1RTHA

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
543
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 144
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rthA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rthA05
2YNGA 4ID1A 3AO1A 1ASWA 4NLQA 2D3UA 3VQSA 2IS3A 5JXSA 1LW0B 1N6QA 1NK7A 4DTSA 5L1KA 3CDWA 5FDLB 4NLDA 4BACA 3QIOA 3QESA 1C1BA 4ID5B 1IO2A 3LP0A 1OS5A 3DRSB 1JLBB 3RB3A 4R0EA 1BI4A 2W9AA 3GILA 4M45A 1GOAA 3G6XA 3NH0A 4HCBA 4FJ5A 3OYEA 4ICLB 3QGIA 3PR5B 3PR4A 4ECUA 1JLCB 4KTWA 3QERA 1S6PB 2ASJA 2YKNB 1Q9YA 3CM6A 4B3OB 3V1RA 3SNNA 2HHVA 3E01B 3QEIA 4O3RA 3CFRA 3SQ0A 4H4MA 3JSMA 4J9MA 1ZBUA 4G1QB 4QWEA 4LQ9A 2AJQA 4FJ7A 4Q0BB 3OYGA 1NOYA 3O4QA 3V6KA 1J54A 5HRPA 4F3TA 4RUAA 1BIUA 1EKEA 4KREA 1XR6A 3I5AA 5DQIA 5DMRA 1C1BB 1JX4A 4DTUA 3KHGA 2XY6A 2G8IA 4CJPA 2DPJA 1JLAA 4KTZA 4QW8A 4IH6A 4ECTA 2I1RA 3MXJA 4EO6A 3QEVA 3M8QB 1C0UB 3PUFA 5EU7A 3SUPA 2FLPA 3Q8PB 2YV0X 1RT4B 4NLTA 3UDLA 3MXIA 4IG3B 2FBXA 1S10A 1DLOB 3BJYA 1BL3A 3OYDA 4H4MB 1RYRA 4LSNA 3IG1B 4R8UA 1KSPA 3PW2A 1RT7A 1ITGA 3ZSQA 2VA2A 1RTJA 2CJQA 4YNQA 3FFIA 4NCGA 3L3VA 4ED0A 5E41A 1IH7A 3SQ4A 2Z1GA 3V9UA 1JLAB 5KFDA 3RRGA 3L3UA 3AA2A 2VWKA 2ALZA 5KFNA 4ZTFA 3CM5A 1KCFA 2ZKUA 4IDKA 4WE1A 4KSEB 4DFJA 3ZSWA 4TXSA 4CEOA 4ZP9A 3SFGA 4K8ZA 1NOZA 4ZVEA 4F3OA 4LSNB 4NLXA 2BQRA 2Z1IA 4E89A 3OLAA 3TWHA 4M3TA 5KFBA 4EYIB 3OVNA 5KG1A 3OYIA 5J2PA 4LSLA 1RT7B 3OYJA 3CFPA 1RTJB 4MK9A 3HJFA 3FFIB 4YFUA 2D3ZA 5DG8A 2G8HA 3S3MA 3KK2B 4IH5A 5KFKA 1XHZA 1EXQA 4PUOB 4EBCA 4DG1A 4ZPAA 3MECA 3I5BA 3OJSA 5FRNA 5EUHA 3HYFA 3NF7A 3SPYA 2RPIA 1RA7A 1IG9A 4IDKB 3PZPA 4CJLA 3OYAA 1T3NA 2IDOA 2PYJA 2XCAA 3KLFA 3DRPB 3HM9A 4L8RB 3DLKB 4QWAA 5J2PB 3M9NB 4LSLB 1XWLA 1EETA 4BE1A 4TY8B 3NAIA 4DL3A 5KFVA 1L3UA 4ZP8A 1D5AA 1S1WA 2IOCA 3QZ7A 3G0ZA 3C95A 2HNDB 4EO8A 4CFBA 4FJ8A 5KI6A 5EWGA 1LWCA 4Y3CA 1S97A 4RW4A 1R0AB 4CHZA 3TARA 3NF9A 3KIOA 3VQPA 3H4BA 2O4GA 5KRTA 1RBUA 1LAVA 5KGWA 4MQ3A 2ATLA 4DF8A 4RUCA 3CYMA 3NH1A 4E7IA 3Q8SB 4I2PA 1N5YA 4CF9A 5DLFA 5HP1B 3CFOA 3KLGA 3NF6A 5KFUA 3VQAA 2YNHA 3AVFA 5F8MA 4NZ0A 3RTVA 3U3YA 4KPYA 1S5JA 1ASVA 4B08A 2HWIA 4MIBA 3H59A 4M3UA 2IAJB 5KFHA 2IM0A 1RTDA 1SH3A 2B43A 3NFAA 4XO0A 2C2DA 3AVKA 2HW3A 4ZHRA 1LWCB 3NBPA 3KNAA 3N6MA 3SQ1A 1TV6A 2GIQA 4O0IA 4FM0A 1LWEA 1QE1A 1XI1A 2DY4A 5KFYA 4CGJA 4ZVFA 1WAJA 4CK2A 4KHMA 2P5GA 3SV3A 4I2PB 1SL0A 3K5LA 3OYBA 2D0AA 1WSHA 3AA5X 5EDWA 3KK1A 3CJ5A 4J2BA 1FXXA 1Z25A 1WLJA 4DSLA 1C1AA 3ZT2A 1HNVB 4CGIA 3CJ0A 4J9OA 4XPCA 2WTFA 4DSEA 3BR9A 3NF8A 1UA1A 3I0RB 4M3YA 2R2TA 3BGRA 4K4UA 1RTDB 1RDDA 4OKEA 4K4YA 1RT2B 1SV5A 3DRRB 4ECXA 3NBPB 1SH2A 1Q9XA 4FW2A 3SQ2A 3MEGA 3DOLA 3G10A 1RDRA 4KTQA 4GC6A 2IM1A 1LWEB 3ZCMA 2OZMA 1BCMA 1N48A 4RW6B 4J2AA 4KV8A 1EX4A 5J1EB 3KK1B 4O4GB 1TK0A 5EWEA 2KTQA 3OY9A 2XY7A 4M3XA 3QIPA 4I7FA 4ECRA 3KLEA 1QSSA 3AVNA 3MXMA 5KFPA 3GIMA 1T8EA 2WOMA 4CF1A 3LZIA 5KT7A 5HBMA 4Z4CA 1U04A 3TAQA 3BGRB 3OL8A 5K14A 1SV5B 5KG3A 4MFBA 3A2FA 3BDPA 1VRTA 3S9HA 1KHWA 4CJFA 2ZQBA 3V81A 3MEGB 4RW8A 3OYMA 1VSHA 3UPFA 4J9LA 1KVAA 4FZXC 4WYLA 5KT4A 3NMAA 3VQ4A 2HNZB 1RBVA 3DDKA 1BQMB 1QTMA 2BANB 3AO3A 1KVCA 3HVTA 4O44B 5J2MB 4JV1A 4KV8B 3LWLA 3V9ZA 3OLBA 4GW6A 4B9UA 1TGOA 1HMVA 3KLVA 1K1SA 3QIPB 3QO9A 4I7FB 3KTQA 3KLEB 4H4OA 3AVIA 3SI8A 4C8OA 2VG5B 2WOMB 1RA6A 2YNIA 3L2VA 2XCPA 3PHEA 4WZQA 1JXBA 3C6TA 2D0CA 4E0DA 4X2BA 3V9WA 4FBTA 5CZ2A 4DL7A 3ZSZA 1LAWA 3PW4A 1VRTB 3SUQA 2B5JA 3DI6A 3QZ8A 1QQCA 2YHBA 3DOKB 3V81B 1ZBIA 1TL3A 1TKZA 4YR0A 3DLEA 1NK8A 1B92A 4Z4EA 4CEBA 3NH2A 4ZVHA 1KLMA 4CHYA 3VQEA 4IKFA 4CJWA 4EYHB 2QKKA 4MK8A 4Y34A 4ECQA 1HMVB 4AHCA 1NK4A 4H4OB 3OHBA 2XHBA 3L2UA 4IG0B 2YNIB 4IKAA 2F8SA 4KHNA 1VSJA 1RT3B 4IRDA 1T03B 3RR7A 2HVIA 4W5QA 4DWIA 4ZMMA 2ILZA 4KRFA 4E1NA 1U09A 1S1XA 3ITHB 3I8DA 4ECZA 4Y1DA 2ZD1A 4RNMA 3KD1E 3AVJA 2A1SA 1BQNB 1RT6B 1KLMB 1UWBA 1LW2B 3V4IB 1IKVA 1IKXB 2WK4A 1L3SA 4RNNA 3SUOA 1HYVA 3TI0A 4FLXA 2KZZA 1NNDA 3QGHA 4W5RA 4ED8A 3SV4A 3M8RA 4FYDA 1N56A 4FJ9A 2IBKA 2IJFA 2IC3B 4Y2AA 2OPSB 1HYSB 4CFCA 2W7OA 1REVA 3I0SA 3CQ8A 3F73A 4AILC 2XGPA 3U3GA 4DEZA 2O5DA 2EHGA 3E51A 3H5YA 4Y1CA 4RW7A 5C5JA 4OGCA 3LPUA 5KGXA 3ZSOA 4BWMA 4CEQA 4FK4A 4M41A 1HNIA 4GVMA 3HPOA 5SWMA 4CGGA 4HTUA 4FCYA 3OYNA 1TAUA 1D9FA 2QXFA 2IGIA 3BQ1A 1JLQB 4Y2CA 1X9MA 2HB5A 1GX6A 5L1LA 1BGXT 4ZP6A 4Q8EA 2Z1HA 5T7BA 4BE0A 1B9DA 5KFGA 4KHRA 3I0SB 3AVLA 2IMWP 2JEJA 3DMJA 4CGDA 3AO5A 4PWDB 2DFFA 4F4ZA 2CKWA 4BWJA 2W9CA 4O55A 4TQRA 2E9RX 2XRIA 4CHQA 1ZTTA 1X9WA 2DTUA 2XWYA 1RNHA 2RKIA 4O3SA 4YP3A 5L1JA 4CJSA 1T05B 4CK1A 3ALYA 4JS5A 2HHTA 2OYQA 3LWMA 2FVQA 2YNGB 4CJEA 5HLFA 4CFDA 2QK9A 3DLHA 1ASUA 1N6QB 3KHHA 4DQSA 3LP1A 4WYWA 1RCHA 4CEZA 3RB0A 4E19A 4ELTA 4CERA 2ZE2A 2AGOA 3NAHA 3NE6A 5KG4A 3O4NA 3C94A 1DTTA 4E7HA 1JLEA 4R5PA 2G8VA 3LP0B 4W5TA 5JUMA 1NJWA 4DTNA 5C25A 3RAQA 1C6VA 3K2PA 1BI4B 3WNFA 4ECWA 3EZ5A 4F4WA 1WSFA 2AX1A 5F9NA 3HP6A 1UOCA 3KLIA 3BSOA 3IGVA 2D7SA 4DQRA 4FM2A 4NLWA 1XR5A 1I3AA 1HQUA 3EZUA 2HHQA 3N6NA 3JSMB 4NLOA 5F9LA 5KTQA 3S3OA 2X78A 1RBRA 1BISA 3ZT3A 2DPIA 2ZE2B 2GBZA 4IRCA 3TAFA 4I2QA 4J9KA 5CZ1A 2HWHA 4M3WA 2NUBA 4YR2A 3T19A 4IFYA 4CGFA 3HHKA 2UVWA 2RF2A 3RAXA 4CHPA 2YNFA 3TABA 4O3NA 1TK5A 4TQSA 3BQ0A 2BQ3A 2C22A 1MMLA 5F8LA 3SUNA 1NKBA 5HROA 1SUQA 2D5RA 4B9NA 4WXOA 3VQQA 2FBVA 3HVWA 4R8UB 4E1MA 2AGPA 4HUFA 4JRQA 4DU3A 2IM2A 1XHXA 1NJYA 2E4LA 1S9GA 1C2PA 4K4ZA 4FLYA 4NCGB 2E6LA 1W9HA 3KJVA 3AA3A 4EP4A 1Y97A 3TAMA 5KG7A 1O1WA 1NK9A 1RILA 2UUTA 4DFKA 4C8NA 3LANA 3T1AA 3M8PA 3H5SA 2RF2B 4FJHA 4WE1B 5HRRA 5DG9A 2QE5A 2JC0A 3ULDA 2YKMA 4B9SA 4FJJA 3MAQA 4JLHA 4DS5A 2BRLA 3V6DA 4PQUA 1SUQB 3AVBA 2A1RA 1TP7A 3G86A 1GX5A 4Q43A 3NKYA 2R2SA 1F21A 4OL8A 4DFMA 4M42A 4RU9A 1CXUA 1Q8IA 4J9NA 1KRPA 4PA1A 3RB6A 4M3RA 3AO4A 1VSLA 4DG1B 3MECB 4O3QA 3V9SA 3QGGA 4K4TA 3H5XA 3K57A 1RYSA 2FLLA 4FJMA 3OSNA 3HXMA 1KFDA 3LZJA 2XY8A 5KFMA 4CGHA 2P1JA 2BRKA 3PJXA 2YKMB 3V1QA 2W9BA 2F8EX 5KG6A 3KLFB 3CJ2A 2IA6A 5FROA 2F96A 4OLBA 1J9AA 2AWZA 4B9LA 1D0EA 3Q8QB 5JS1A 1EETB 4J9QA 2XC9A 2VG7A 3IGNA 3RMDA 4FJGA 1SKSA 1S1WB 4K8XA 1Z26A 3RMAA 3BSAA 3KK3A 3Q8RB 2V4QA 5DK5A 2PZSA 4M94A 1BCOA 4DTOA 1WN7A 4FLZA 4J9RA 4RW4B 2PYLA 3HVRA 4NLGA 3IAYA 3RB4A 4U6PA 4DQQA 3M9MB 3IRXA 3GYNA 4ELUA 3RBEA 1X1PA 4G3IA 1N5YB 4QWCA 3OJUA 2JGUA 3KLGB 2YNHB 3T5LA 4CHNA 3KMQA 2G8WA 5KFFA 1TK8A 5F8JA 4DL5A 1TL1A 4M3ZA 2ASDA 4K4VA 2VG7B 3NHGA 1HQEA 3K59A 4F4KA 3LP2A 1S0MA 3RR8A 3CWJA 3F9KA 3AVGA 4Q8FA 3TAPA 4TLRA 3B6PA 4FLTA 4FJNA 3NDKA 4K4SA 4ZHRB 2OPQA 1S1VA 4QOZB 2RN2A 4CJRA 1TV6B 2V4RA 4MKAA 1K1QA 4O0JA 2DFHA 4DQIA 4KO0A 3HVAA 1IKYA 4YQWA 5JS2A 1QE1B 3K5OA 2FC0A 2OA8A 2QV6A 3C6UA 2E9TA 4CK3A 4CEEA 4K50A 3RBDA 2IJNA 1S6QA 4AHSA 3SYZA 2JEIA 1JLGA 4N76A 4CESA 1GOBA 2GUIA 3VN5A 2OPRA 3DM2A 3AVAA 5J2NA 3OL9A 2O4IA 1S1UA 2P51A 5KFTA 3BSNA 3PX0A 4FJXA 5HRSA 2FVCA 3DLGA 5DQHA 3LP2B 3HL8A 2XY5A 1ZETA 1NHVA 3OYHA 2J6UA 3L2QA 4YR3A 4CIEA 4FJIA 3HPHA 2OPQB 4TY9A 3DOLB 3KKSA 1TKDA 2VG6A 4KO0B 5KT3A 4B8AB 2V0NA 4JV0A 4FK2A 1CLQA 3T3FA 1VSMA 5KG2A 4KKOA 1JLGB 3ZSVA 1JLFA 4IBNA 4FLVA 3FQLA 5J2NB 1ZYQA 1S1UB 3PW5A 3QIDA 3DYAA 1XR7A 1WAFA 4CEFA 1S0OA 5HBMB 2JC1A 2WONA 5KT2A 4Q45A 1VSFA 2GC8A 5K14B 4MFBB 4H8KA 4E7KA 1VSEA 3VQ6A 4DTRA 3CO9A 1U4BA 3NAEA 3PY8A 2FJWA 4QAGA 2XI2A 2AU0A 4RW8B 3AA4A 2VG6B 3T5HA 5KRSA 4NRUA 2G8KA 4EEYA 3KD5E 3GV7B 4KB1A 3PV8A 2OPPA 4Z4FA 3ZT0A 4DU4A 3HVTB 4ELVA 3QEPA 5J2QA 4FK0A 4OVLA 4CIGA 4AHUA 4FXDA 2KFNA 4KKOB 1MU2A 1YVFA 3NGDA 3QO9B 1UA0A 3NGIA 2E9ZA 5C42A 3DYAB 4KHYA 3KKRA 3ISND 2J6SA 1A5WA 1YVUA 3C6TB 3T5JA 2WONB 4XPEA 2JEFA 4CJKA 3SFUA 1DTQA 2AX0A 1S9FA 3KHRA 1SH0A 1RAJA 4QW9A 3MF5A 1HARA 4CF0A 2ILYA 4UQGA 2B5JB 3DI6B 3TANA 3TAGA 3PVXA 5KFXA 2X6NA 1TL3B 1TKZB 4B8CA 3AV9A 1B9FA 3DLEB 1SKWA 2EX3A 4CJQA 3DLRA 2OPPB 3QLHA 4ED3A 4JUZA 2E6MA 3IS9A 3FQKA 3BREA 1WSIA 4RNFA 4JS4A 5KFZA 3D28A 4F4YA 4FS2A 1S48A 3H2LA 3GQCA 2C2RA 1QAJA 3ZSYA 3OS1A 4KFBA 2G8UA 1JL1A 3SZ2A 1JXEA 4J9SA 1FK9A 2HVHA 5T14A 4TYBA 1TVRA 3ISNC 3WNHA 3RRHA 3CG7A 1S1XB 3LPTA 5FDLA 4FLUA 2ZD1B 3ZSRA 1ZBLA 2B6AA 1L5UA 3QLHB 4DL6A 1UWBB 3P1GA 3P83D 1IKVB 2R7YA 4ED2A 2GV9A 3IS9B 4URSA 3OHAA 3GV8B 4KHQA 3PO5A 2J6TA 3NGZA 4B9VA 1C1CA 4TYAA 3MFIA 1YTUA 3AO2A 1HYZA 4NCAA 3V6JA 4BDZA 3QETA 4N41A 1S6PA 2YKNA 4B3OA 1KVBA 3E01A 1REVB 4F4XA 4NCBA 3PX6A 1TKXA 1FK9B 4MK7A 4KAIA 3BQ2A 4E7JA 4G1QA 1TVRB 3HKWA 4ED1A 4EZ9A 3GV5B 4RW7B 3FRZA 4Q0BA 3VQ8A 5CYQA 1QS4A 1T94A 3H4DA 1HNIB 2B6AB 1WNEA 3K58A 4URGA 1VK0A 4FJLA 2FJVA 3CVKA 2FLNA 4NRTA 3OS2A 3SJJA 2RDJA 1KLNA 3LP3A 1TQLA 2QKBA 4XIUA 1C1CB 4KB7A 2B4JA 3M8QA 1C0UA 3AVHA 4AHTA 2G8FA 1KFSA 3HSTB 4LQ3A 4OPJA 4DLGA 1RT4A 4Z4HA 1WSJA 4IG3A 4BDYA 2UVRA 2XI3A 3HT3A 1DLOA 1TKXB 3QEWA 4DSJA 4KAZA 3HK2A 3DMJB 4E3SA 3IG1A 4URQU 2W9CB 2FBYA 5I42A 3H5UA 2FBTA 3VQDA 3SCXA 5CYQB 2RKIB 4WFYA 3L8BA 1W25A 1QSLA 4FW1A 4E7LA 4Q5VA 2X6SA 5KFWA 3QYYA 3V6HA 5EWFA 5HLFB 1CSJA 2R8GA 4TN2A 5DGAA 3EY1A 1RTIA 4F50A 3LP1B 2EC0A 4KBIA 4DQPA 4AH9A 4ZVGA 4IQXA 4C8KA 3ZSXA 4NLUA 5KT6A 4WZMA 1DTTB 1JLEB 4R5PB 3TR8A 4RG8A 2R8KA 1VSKA 2WCXA 5I3UA 5C25B 4IOBA 4ED7A 5KG5A 4F8RA 4BE2A 4DMNA 4CHOA 2W42A 5I42B 2GIRA 1L3VA 5F8IA 4NYFA 1NKCA 4I9LA 3FDSA 3KLIB 2DFEA 4NYNA 2BE2A 1RDBA 2FJXA 4N56A 3QINA 1RDAA 4CEAA 3KK2A 2R8HA 1HQUB 4PUOA 1NHUA 5F8GA 3NL0A 3PX4A 4IR1A 3ASMA 1RTIB 1RTHA 3VQ5A 1C0MA 1JXLA 2ETJA 4DL2A 4LH4A 3UIQA 2HAIA 1YT3A 4LY7A 5F8NA 3UQSA 4N5SA 1FKOA 1U45A 4I2QB 4NLVA 2AQ4A 3DRPA 3QNNA 3OYFA 5I3UB 3VQCA 4CE9A 3MR5A 4ZP7A 3M9OB 3PJWA 5F8HA 3DLKA 4ECYA 4DSIA 2FVSA 4DFPA 1HJRA 4IFYB 4J2EA 1XC9A 3MTKA 3KLHA 4TY8A 4AHVA 4NLSA 2YNFB 3NGYA 4ZTJA 1NK6A 2BE2B 2HHSA 3QEXA 1QHTA 3N6LA 1ZBFA 3VA3A 2F8TA 1RT5A 2HNDA 3CDEA 1N4LA 5HROB 3G6VA 3MR3A 3GIKA 1R0AA 2R2UA 4JRPA 1RTHB 1WSEA 4M95A 4DSFA 3D45A 4KB0A 4OJRA 1UAXA 3P5JA 1S9GB 1FKOB 3S3NA 3HPGA 3MR6A 1SKRA 5HP1A 1RT1A 3KJVB 2R2RA 2C2EA 3H08A 3TAMB 1SL1A 1IKWA 4OGEA 3M8PB 1TKTA 5KFRA 3KLHB 4CECA 5SZTA 3SI6A 4QCLA 2IAJA 4CJ4A 4W5NA 1CZBA 3GIJA 1RT5B 2RDIA 4B9MA 5KG0A 3V6DB 4PQUB 4O5BA 3CDUA 1C0TA 1QAIA 1EP4A 4ZPBA 2ASLA 4Z4GA 2XO7A 1VSDA 3BSCA 1LV5A 3PW7A 3RMBA 1RT1B 2WB4A 1VRUA 4BDPA 4DS4A 2VA3A 2X74A 3VQ9A 1HNVA 1D8YA 1IKWB 3LAMA 4F2SA 2FVPA 2KZMA 1TKTB 3OYCA 4RW9A 5D3GA 1A5VA 4LH5A 5KFSA 4MKBA 3ZT4A 4B9TA 1A5XA 1X9SA 3I0RA 3MEEA 2Z1JA 4HUEA 3OSPA 2W9BB 1KTQA 1RT2A 1D1UA 3TQ1A 4IFVA 3RWUA 1LWFA 3DRRA 1C0TB 1CZ9A 4CJ5A 1EP4B 1Z4UA 4CJTA 4WXWA 2VWJA 2BQUA 1S0NA 3UR0A 1S49A 3KOAA 5KT5A 1S4FA 1ZTWA 3DLBA 4U7CA 3OL6A 4CCHA 4RW6A 1VRUB 5J1EA 3KK3B 1QSYA 4O4GA 3HP9A 3MEDA 1RDCA 1S9EA 2UVVA 1J53A 4CJVA 1JL2A 3V9XA 4F2RA 4GC7A 4DF4A 1JIHA 4QWDA 3EPGA 2V9WA 4RW9B 5D3GB 2LSNA 3L2WA 5DLGA 4KHWA 4KI6A 3IRXB 3MEEB 4W5OA 2W8LA 3T5KA 4FBUA 1U47A 2KW4A 1T7PA 4NYZA 4YMEA 1I6JA 5KFJA 3K5MA 4IFVB 1LWFB 3U6FA 4O4RA 2HMIA 1NKEA 5L1IA 1S1TA 1TAQA 2Y1JA 3FSIA 2YHAA 1TL1B 3K5NA 4H54A 5DG7A 1W0HA 4MH8A 2OH2A 3VQBA 4DTPA 2HNZA 1RBSA 4KI4A 1BQMA 3G6YA 1HQEB 2BANA 3QNOA 4O44A 5J2MA 2P5OA 4TSXA 3OYKA 2I5JA 1JKHA 1G15A 3MEDB 3D0PA 1S9EB 1HPZA 4FS1A 5KFLA 1S1VB 4ED6A 4LD0A 4HUGA 4DLEA 2VG5A 3KHLA 4EZ6A 3H98A 2Y1IA 4EBDA 1IKYB 1WSGA 3C6UB 4DTJA 3TVKA 1K6YA 4NLRA 3PO4A 2Q3SA 3OYLA 3OS0A 3JYTA 1S6QB 4NLPA 4FVMA 2OZSA 3WNGA 3DOKA 4OKJA 2HMIB 2HNYA 4C8LA 1S1TB 5DQGA 2OPRB 3DM2B 2JLEA 1NJXA 4RZRA 4RNOA 4HKQA 4DL4A 1NK0A 3DLGB 3MR2A 3IN5A 5CYMA 1WNSA 2IM3A 4AHRA 2I5JB 4J9PA 1JKHB 4CJUA 3LDSA 4FM1A 1HPZB 4IRKA 4NLYA 2W7PA 1CXQA 4K4WA 3ICLA 4IG0A 5L9XA 3L2RA 3CIZA 2BGGA 1RT3A 4QPXA 1U48A 4FZZA 1T03A 4CF2A 2C28A 4O3PA 4CEDA 3JYTB 1GOCA 5FRMA 4I9QA 1L3TA 4OPKA 2HNYB 1JLFB 4Q44A 4IR9A 3ITHA 4KHSA 4RNHA 3AVCA 4JV2A 4HYKA 1BQNA 1RT6A 3B6OA 2JEGA 4EBEA 2UUWA 2BR0A 5CYMB 4OKKA 3TAEA 4CF8A 1NK5A 1NJZA 1LW2A 3V4IA 3PW0A 3LALA 3O3HA 1IKXA 3SPZA 3O3FA 3RMCA 4ZPCA 1KHVA 3GIIA 5HRNA 4IH7A 3M8SA 1HRHA 4Z4IA 4ECSA 2R8IA 4KHUA 2IC3A 2OPSA 1HYSA 4HHTA 3LAKA 3KMSA 4HVJA 1J5OA 1FKPA 1YTAA 1D9DA 5J2QB 5KFQA 3VQ7A 5CY4A 4GMJB 3HO1A 1MU2B 3CJ4A 4K4XA 4Z0UA 2AGQA 2D0BA 4FJKA 3WNEA 4EP5A 5C24A 4ECVA 3OL7A 4CFAA 4N47A 5C42B 2D41A 4FLWA 3D5MA 3AVMA 2HHUA 3NCIA 1RBTA 4KE5A 3ZT1A 3I5CA 5KFCA 2ATQA 3CJ3A 1DTQB 1JLQA 2HHXA 2KFZA 2R8JA 2FVRA 4DSKA 4J2DA 1LW0A 4C8MA 2UVUA 1SL2A 2ITGA 4CIFA 2WHOA 4DTMA 1VSIA 3VA0A 4CJ3A 5KFOA 4WFXA 2XGQA 3MFHA 2WRMA 3THVA 1J5OB 1QUVA 1I39A 1FKPB 2KQ2A 2HHWA 4ID5A 3V1OA 4O3OA 3DRSA 1JLBA 1ZBHA 4PWDA 4ZPDA 4DTXA 2PY5A 1BHLA 4OLAA 5C24B 1U49A 4ICLA 1IM4A 4WFZA 5KFIA 4PY5A 3O3GA 3EPIA 1JLCA 1BIZA 4DU1A 1T05A 2BDPA 4FZYA 3H40A 5DGBA 2W8KA 4QWBA 3EYZA 4KFBB 5KFAA 4MIAA 5KFEA 4HCCA
chains in the Genus database with same CATH superfamily
4C6AA 5AE1A 1U1RA 1ASWA 2BJEA 3OXGA 4YN3B 1I1GA 3VQSA 2J7KA 3DRXA 4DTSA 3VCDA 1YSJA 4JKEA 3CDWA 2GIFA 4ILJA 4CYUA 1PC5A 1WHWA 5IOLA 3QIOA 3QESA 2QM1A 2RD5C 4L72B 3LP0A 1OS5A 1VJQA 1JLBB 3RB3A 2AP1A 3CCWA 3NH0A 3OYEA 3NS6A 3QGIA 2FY1A 3G8QA 1VK3A 3QERA 2XB2D 2LMIA 1Q9YA 4B3OB 5HVGA 4OZ2A 3TJ9A 1WKLA 4O3RA 3KJFB 2FC9A 3GJSB 2NLXA 2DNPA 4ZITA 3MXHP 3VVUA 4LQ9A 2AJQA 3IWLA 3J80Y 5EHHA 1ATNA 3O4QA 4CYUB 2D0OA 1GT8A 1T02A 4F67A 2CH6A 3WIUA 3HHDA 3M8WA 3VTHA 1WI6A 5DQIA 5DMRA 2Y0SD 1HW8A 1B70B 4HI1A 5GADU 2XY6A 1U1QA 2DPJA 4YY3J 5B7WA 4ECTA 2MPUA 2UV8G 1DKGD 3QEVA 3PUFA 3BF1A 3MMBA 4JB8B 2YV0X 3EICA 3MM5B 4AL5A 4IG3B 2DRBA 3MGJA 1DLOB 2V7ZA 1R89A 4IOXA 2VH7A 4U67Q 2IVFB 5GMEA 3OYDA 3BS9A 4ZJLA 4CIOA 5BRFA 3IG1B 4DUZK 3TJAA 3H2UB 4ISEA 1FE4A 2MLYA 2W2QP 1RT7A 4TU8A 3M1VA 1HNWK 4LMZA 2C2KB 2DHAA 4YNQA 2GUPA 4OPHA 1YI2S 4NCGA 3A8JA 1JB0C 3W62A 3SQ4A 3V9UA 3RRGA 3HSZA 1N33J 2JFKA 3CD6S 4YB6A 3AA2A 5KFNA 4ZTFA 3HTVA 3MMBB 2QW9A 4WE1A 1DZ5A 3CPEA 1XK8A 2QSFA 1X4CA 1RBAA 4ZP9A 2R4FA 2NZTA 3W64A 3C16B 1NSAA 4N7TA 1ZOTA 3C0BA 4PWWA 4OYZA 4DR5J 1MDUB 5KFBA 4CH1A 3A12A 1RT7B 3OYJA 3CFPA 3EGVA 4OYOA 4DV5J 4YFUA 2D3ZA 2G8HA 4P2MA 3KK2B 4IH5A 2XMKA 3KDNA 2DITA 2RUSA 1EXQA 5IT9O 4DG1A 2X3GA 4ZPAA 5EUHA 3GU0A 2E2OA 3NF7A 5LMNK 4DR4J 3MUMP 3LDLA 2VU5A 2DO4A 5LXRA 3OYAA 2XTJP 3AOCA 2WB1D 1SJ4P 3HX9A 3KKFA 1RCOB 1WF2A 2PYJA 4CNYA 2P9EA 4CLKA 3HM9A 4CTAA 3QB0A 3DLKB 1UZDA 2UUCJ 3M9NB 1XNQF 5HJXA 1RHUB 1K8AT 1L3UA 4JI2K 3RW6A 2HFSA 1N32F 3JB9k 3CCMS 4DX6A 3C95A 1S3XA 3NWRA 5CCLA 2DBBA 4FJ8A 4CHZA 3MD3A 1R0AB 2CQIA 3NF9A 3NCRA 1HA1A 1BD6A 3CCTA 2CQPA 3A5NC 1R3NA 1BOTO 2ZH4A 1RBUA 5KGWA 3MM6A 2ZNZA 4G1IA 2UXCF 1ACMB 1M0SA 4USJC 4E7IA 3CUNA 4DV4K 5HP1B 3KLGA 3NF6A 4RWWA 5HVHA 4IO9L 4I69A 1RQ0A 3MMJA 4CTAB 2W2NP 1UEVA 2O8DA 4ZLPA 1G6BA 3OQ2A 4O5FA 4NZ0A 1PKUA 4NLCA 2XMJA 1VJWA 3P39A 4MAKA 3I6PA 3EDQB 2IVMA 2AP6A 1ASVA 4XDCA 4B08A 2HWIA 2B4UA 2UXBK 4MIBA 4Q2LA 1Q0NA 5KFHA 5AXMA 2FHOB 2EG2A 1RTDA 4WTYA 1VQKS 3JQMA 3NFAA 2E7WA 3KNAA 3O3LA 2P9NB 2CNNB 1XJWB 5HL7L 1WTBA 1G3OA 3SLCA 2PEHA 1QE1A 2D4WA 3DOMA 1XI1A 3R5CA 1W97L 5KFYA 4X64J 2DKOB 2P5GA 1GLCG 3GR0A 1RAHB 3R9LA 4BQZA 5H1SQ 2MKKA 2O8DB 3SCIE 4F3MA 2KJVA 4XPCA 2ZBIA 4DSEA 3BR9A 1SQEA 4F25A 1T3OA 2YPZA 4ANCA 1UA1A 1R8PA 3G96A 3IBFB 2MKCA 1RTDB 3S1TA 1RDDA 1SV5A 3L95X 3LDNA 2Q1LA 3WQUA 2PDAA 1Q9XA 4FW2A 4FXWA 2DNYA 3ID6A 3CNQP 4KTQA 4GC6A 4M7YA 1E6VA 3DOMB 3ZCMA 1KD1O 1KWMA 2OZMA 4BR4A 1Q8LA 2DGOA 1WC3A 3J80O 4KV8A 4MMOA 4O4GB 3OY9A 3QIPA 2RILA 3A8EA 1QSSA 4KQZA 3AVNA 3R7SB 5KFPA 2ZH2A 1DRZA 3L4BC 3QAEA 3LZIA 5KT7A 3LPEA 4XTTA 3OL8A 3CHWA 2UU9K 1SV5B 2WSEC 5GMKa 3A2FA 1Y4ZB 3D2WA 4ZPTR 2ZQBA 1WOPA 4RW8A 4ZVOB 2V5HG 1VSHA 4CLFA 2QL5B 4WYLA 5KT4A 4JI4F 2HNZB 3DDKA 1ZAVA 3AO3A 4DHYA 5J2MB 4KV8B 4QS7A 4JI6F 2KRRA 2FC8A 1Z2LA 2PI4A 3KLVA 3QWPA 3FKBA 1K1SA 1T9UA 3FVYA 3QIPB 1B3TA 6FDRA 3AVIA 3BBCA 4OPAA 1VC5A 3GL1A 2VG5B 4K0KF 1S57A 4A57A 3TZYA 3NNAA 1HR0F 5L39A 3ETMA 3RJMB 1T11A 5CAAA 2QN6B 5AQZA 3DI6A 3QZ8A 3NOCA 1TU0B 2VB6A 1RWNB 1RSCA 3ZTSA 4PXDA 2GVDA 1NK8A 2R7SA 4DPYA 4CEBA 3NH2A 2MKIA 1F2HA 2E88A 2EK1A 2QKKA 4CZJA 5ETTA 2P9PB 3K0SA 2B4OA 3TU5A 1NK4A 4U7BA 3OTBA 4IG0B 5AQWA 2F8SA 4X4QA 5BREA 1RT3B 3D0IE 4DR2J 4LRBA 4DR6K 2FYXA 1T03B 3RR7A 2M0GB 3GFZA 3A13A 2ILZA 4DR3K 4M5DA 3TZXA 3VAJA 4LREA 4Y1DA 5IT4A 2ZD1A 1YHQS 4RNMA 1YJNN 3KD1E 2MHNA 1GMVA 3CIMA 2GVDB 4M5GA 3AFGA 3J7YI 3DWLA 3CQYA 1LW2B 3U1NA 2MZ1A 2YXLA 1L3SA 4RNNA 3SUOA 1HYVA 3CJ8A 5GVQA 1WELA 3QGHA 4DQ8A 2P9UA 1V3ZA 3SV4A 2HZAA 1PBUA 4YDUC 2IJFA 3M2VA 2IC3B 1YITN 1HYSB 1KN6A 3G8SA 1REVA 3F73A 3OUYB 4AILC 3P5TL 2EHGA 2O5DA 3E51A 4FKXA 3C7NB 5BR9A 4L74A 4FK4A 3O8WA 3VGSA 4FCYA 1TAUA 2IGIA 4DV3K 4Y2CA 1O0PA 1Q78A 1GX6A 3C8YA 4Q8EA 2EC2A 2Z1HA 3QSIA 4KHRA 3AVLA 3U02A 2F1FA 2V6AA 5M2UA 4ILHA 3IC1A 4OZ5A 3DMJA 2VIHA 5EGYA 4A8QA 2XRIA 1ZTTA 2DRAA 2DTUA 1RNHA 1X4HA 1GXTA 4O3SA 3VGVA 2PI5A 4YP3A 3O9QA 4A5BA 1J27A 2A6OA 2C3PA 2VF3A 2XMMA 4P52A 3EMTA 2HQ3A 1RCHA 3WIVA 2LEAA 4CM2A 2ZE2A 2P9IB 4ILLA 1IBLF 1UMJA 5JUMA 4DTNA 1KEKA 3BBFA 3CMAS 4AQYF 2OSQA 1XN9A 2ADCA 4CM0A 1BXNA 1BG3A 4F4WA 2CPXA 2AX1A 4P73A 3BSOA 4H5VA 4U8YA 5D4LA 2OTJN 3WEEB 2FLOA 2E1AA 4DQRA 4FM2A 1XR5A 3I31A 4C23A 5AJ3J 1VRQC 5AQHA 2MHEA 4CI0B 1XNRK 3N6NA 3CEDA 1KQGB 4IDHA 3C3LA 1BISA 2ZE2B 1YBAA 1X7VA 2XLIA 4ER8A 3VEVA 4M3WA 4JYAK 1HQ2A 1HKCA 3I4HX 2IHR1 2CQ4A 3GDQA 3WDOA 3HHKA 2UVWA 2HFNA 3RAXA 4LFAJ 3CCES 3TABA 1TK5A 4QBUA 5LL6d 2MJUA 2HSTA 1NGGA 5D4PA 2J9DE 3CPWR 1SUQA 4A62A 3D1OA 4B9NA 4LF7J 3HVWA 4KHPJ 2Y1RI 4JRQA 2IFXA 1HKBA 3M6XA 4WWSA 2ASOA 1U1MA 5A2QU 2P8IA 3AA3A 4EP4A 5KG7A 5K8PA 4DFKA 2ZM6K 3B8HA 3T1AA 5LMUJ 4EGLA 4LF9K 2OCEA 3L4QA 2QWQA 3D6FB 3DDIA 5DG9A 2ZZMA 3VPZA 2QE5A 3ULDA 1EAYC 2YKMA 3JAMO 3MAQA 3O8MA 1R8CA 3A8YA 3OTOJ 1WG5A 4PQUA 1SUQB 4FPBA 3AVBA 1GX5A 2R2SA 4M42A 2AA4A 1WHVA 1ZS6A 4J9NA 4M1KA 1J5EJ 1OWXA 5E3AA 4JI3J 1KRPA 2G2YA 4PA1A 3TNVA 1R59O 4M3RA 4NXNF 3PG9A 2VPWB 2NSCA 4CDIA 2FLLA 3FZHA 3MM9B 4YB1P 3SMSA 3LZJA 4DN0A 5KFMA 2GS8A 3FZ2A 4O23A 2V68A 2RRNA 2YKMB 3V1QA 2F8EX 4JNEA 2VASA 2XZWA 4NXMF 2F96A 3M30A 5B0DA 3ILJA 4OLBA 5ETQA 2LQJA 2H3GX 3IO1A 2XC9A 1KOHA 2DR5A 5AQXA 1KXPA 4DV6K 4X62K 3QNWB 4U7UD 3Q8RB 1KAXA 2VBWA 2X1GA 2AYBA 3DAWA 1BDGA 5KAKA 3NOGA 3IAYA 4ZPVR 3M9MB 3T7ZA 3CCRN 4R79A 3IRXA 3GYGA 5ADXA 2F4VJ 1UEUA 4G3IA 4DV2J 1Z6RA 3T6BA 4QWCA 2X3DA 2YNHB 2DNMA 4OHZA 2HBRB 3EVWA 4RWXA 4CBXA 4M3ZA 2HAFA 4F9OA 4B3RJ 3WXKA 1HQEA 4DR7K 2HQGA 4HACB 2DY1A 1REGX 4X4SA 2M3DA 3CERA 3MAAA 3B6PA 3MN7A 2DHSA 4FLTA 3NDKA 3H1QA 5JLFA 4C11B 3WT0A 4QOZB 4DUYJ 3M2UA 4YS2A 5C7PA 1LOUA 1K1QA 3O1LA 2DFHA 4LRFA 4KO0A 1F6TA 5DM7L 1EARA 1AUSL 3QJPA 2CVEA 3GP9A 3QAUA 4WKRA 4F4AA 4NEYA 5IFMA 1S6QA 1UVLA 1Q1KA 2HQDA 2YX7A 4UQTA 2O4IA 4DXLA 3R97A 3TTDA 4ENOA 3PX0A 2K3IA 4DUZF 2JNJA 4UTGA 3HL8A 3Q2SC 1HNWF 2XULA 2OTLN 2W01A 2VBXA 2J6UA 5GINA 4YR3A 4FJIA 1FE0A 1FXRA 3H1VX 4AUKA 3VR1A 3M2UB 1VDHA 4KO0B 1SKUB 2VBYA 2CPDA 5IS2A 2HS3A 1CLQA 3M32A 1WSVA 5GAGP 1SXLA 4YHHK 1VSMA 1M1GA 2Z2YB 3WQTA 3ZSVA 3OFFA 2J7UA 2MQQA 1V6HA 4FLVA 3LUYA 3UN2A 1XR7A 3FC9A 4JKAA 2MQNA 2XYHB 2JC1A 2VDIA 3SAGA 4LF5K 5JVHL 1E4GT 3T1HK 2BJ1A 2XI2A 3TEHB 3FUYA 4NRUA 2JX2A 1FNMA 3NGRA 4IO1A 5GMDA 2G8KA 3SBGA 3G6ES 3PV8A 1VOMA 5LMNF 2AZ1A 3R5DA 4ELVA 1UFKA 5J2QA 4FK0A 4OVLA 1MA9B 4CIGA 4BR7A 2MSTA 2E8AA 1IV0A 5C10A 1UA0A 3D2FB 4PG4A 1OVQA 1FDBA 4KHYA 3KKRA 2GHPA 4KT0C 2J6SA 2JL9A 2K7JA 4OI6A 3C6TB 4H03B 4XPEA 2C42A 3OFHA 2V2VA 1DTQA 2ZH7A 3X1LB 4JI2F 2ILYA 1YG0A 2B5JB 1FXDA 3TX8A 3PVXA 1NG9A 1TKZB 2HHHF 5DZ6A 1B9FA 3DLEB 4EHUA 1SKWA 5GADP 2RE2A 1IJFB 3DLRA 4ED3A 5IZHA 4MJKA 4JUZA 1NBWA 3L09A 1QVGM 2GHWA 3FQKA 3O6WA 1SQKA 4X4UA 1EKRA 2CADA 2IDLA 4F4YA 1UPPA 3N0VA 4H0OA 3I33A 4DV4F 2C2RA 4KH5A 5HVFA 1QAJA 1FESA 3FZKA 4F0HA 3ZZUA 5D15A 4KFBA 1GMWA 5BPNA 4C8YA 3JTOA 3FEYB 2HVHA 2ZZTA 5T14A 2FSJA 4W92B 2FSNA 5CD4H 3ISNC 3WNHA 3KG1A 3FE1A 4UT4A 4LR8A 1UWBB 4OV1A 2Z56B 1JK9B 2OMOA 1IBMF 2R7YA 3T69A 4KHQA 3NGZA 4B9VA 1C1CA 3DN9A 1UP1A 1CVJA 3V6JA 3D7SB 2R7UA 3QETA 1S76D 2HIQA 1TUGB 1VMBA 2DR7A 4CO4A 4MK7A 1FRLA 3ZTPA 4UUWA 2APOA 2V9KA 4DV7F 1YAGA 4A8FA 4USMA 2QL9B 4LFCJ 3TPQA 4GRSA 4C3MA 1UETA 1CQNA 4I64A 3SJJA 2KJWA 2NUUG 2QLBB 4LF8J 2FHMA 3VF6A 4I0WA 4BGAA 4XIUA 1C1CB 4KB7A 5BPMA 3VF2A 3AVHA 1C0UA 4AHTA 4TVAB 2ZWOA 4DLGA 1WSJA 3PIOL 4BDYA 4A8MP 3HT3A 3O4WA 4DSJA 3EE8A 4USIA 4GKKK 3PKYA 1H38A 1DFDA 3QFWA 3UNYA 3SCXA 2J0SD 2RKIB 2JLFA 1W25A 1VQMN 4M8LA 1Q53A 4P74A 3W5ZA 5EWFA 5HLFB 1MW7A 1CSJA 4OZ0A 2R8GA 3KWIA 2MGZA 4G6VB 3SMZA 2QSWA 1H73A 3PXGa 3H20A 2MY8A 3ATUA 5KT6A 1DTTB 4R5PB 1MN9A 3BKUA 3QQCD 2I0XA 2WCXA 5C25B 5KG5A 2NREA 3PTWA 4CHOA 4NASA 1F0XA 4H0TB 1NKCA 2RUGA 4I9LA 1WHYA 2ZJQQ 3NGKA 1NM1A 5EX3A 4N56A 4JKCA 3BF3A 1NB2A 2POKA 3L6QA 5JJBA 2NSBA 2R8HA 5AQJA 5A8RA 4RBVA 5F8GA 1RTHA 3VQ5A 5F8NA 2EFQA 1Y7PA 4I2QB 4L75A 3MUTP 3CC7S 3DRPA 1LK5A 3VWSA 3QNNA 3M9OB 3FK4A 4DSIA 3M4XA 4DFPA 2MB0B 4DR6F 3IAS9 2AYMA 4F3QA 3NNHA 3KLHA 2W4CA 4AHVA 2HBMA 2UXBJ 4DR3F 3O1WA 1QHTA 1ZBFA 5CH7B 2OEJA 4H0XB 2B0GA 1K8AO 2F8TA 5A8RB 2PC6A 1N4LA 3J7ZT 5HROB 3G6VA 2YWEA 3N28A 3MR3A 1P9QC 4JKBA 2F3JA 4JRPA 1RTHB 2G4BA 2OAUA 4DSFA 4M5JA 2WSCC 1UAXA 4OJHA 1IR2A 3HPGA 2Z2MA 3MR6A 1SKRA 5CHCB 1RT1A 2R2RA 1Y5NB 2C2EA 1X31C 5LJWA 2DNNA 3M8PB 1TKTA 3KLHB 3MPVA 5SZTA 3SI6A 3BPSP 3PFOA 1HNZK 3JXOA 3GIJA 4XH1A 4X66F 1RI7A 2LU2A 4KPCA 4O5BA 3CDUA 1QAIA 4GO7X 4ZPBA 3DXSX 1CC8A 4Z4GA 2V69A 4LFBF 3CDBA 2OLWA 3BSCA 1AFJA 2E20A 3RMBA 4KH1B 1DQ8A 1RT1B 3H8YA 2DEJA 2CYYA 4DS4A 4L3KA 2WVEA 4A8KA 3VGMA 4O8KA 3E3XA 1FFGB 2MQPA 3C2PA 1D8YA 3TVZA 3CD5A 2KH9A 3BO2A 1H3DA 1TKTB 2KZMA 2HF3A 3FCWA 4RW9A 4J7CA 3I0RA 2RJZA 2AIRB 4AM7A 3VETA 4HUEA 3TA0A 2UU9J 4CLTA 1RT2A 1D1UA 5AZJB 1X4BA 1LWFA 3DRRA 3OFEA 1CZ9A 3KJQB 1Z4UA 2W6LA 4WXWA 5AE3A 1W7WA 4M63A 4V19S 4LSZB 1ZTWA 2A3ZA 4NL5A 3DLBA 4U7CA 3A5OC 4CCHA 3DU6A 5H9EJ 1S72S 3HP9A 4BC2A 1UVKA 1RDCA 1J53A 3BZCA 2AV5A 2JDJA 3V9XA 1RAEB 3D3BJ 4F2RA 1UTAA 4DF4A 1JIHA 4QWDA 1CULA 3FJ2A 1FVSA 2ZC3A 4RW9B 2LSNA 4KHWA 2W4PA 4JI1K 3FBBA 2C2MB 1HWUA 4MTPA 3L3CA 4YMEA 4PXBA 4B3SK 1MG7A 4GV9A 4I6WA 3CC2N 1LWFB 3QBWA 1VQ4S 2YX4A 5L1IA 4PHTX 3KUEA 1AYEA 1TL1B 2EKNA 3R27A 1FRKA 3G6YA 1UVMA 3M6VA 3I96A 4O44A 4N8NA 1JCEA 4TSXA 1OQ6A 3S8SA 4FS1A 4TLQA 3HHLA 2J9EA 4BCAA 5KFLA 1S1VB 2K8GA 4ZKAA 2XWXA 1CULB 4DLEA 1M5PC 3KHLA 1VQPN 3LF0A 2Y1IA 2OJ3A 3UCZP 5CXTA 2Q3SA 2K1RB 1FFSB 1QUPA 2B4PA 3N5BA 4NLPA 4OKJA 3J81U 1NM2A 3E66A 3DM2B 1RP5A 2JLEA 3UD4P 3TUZC 2RHSB 1NK0A 4EFHA 4JKHA 4C97A 2DT9A 2L3MA 4BVOA 3IN5A 1WNSA 1P90A 1WC1A 4NLYA 3CW2C 3ICLA 1U0HA 1OY6A 3W9IA 5L9XA 4A8XA 2BE9B 1Q7LB 4I6YA 1RWUA 1RGVA 2ZM6F 4IEEA 4WF9Q 2WC9A 4LF9F 4BRNA 5FRMA 4OPKA 1VQON 4HT5A 1WKJA 1MN7A 3ITHA 4KHSA 2MQOA 2KB2A 4RNHA 3U1LA 2R7QA 1RT6A 2IYIA 4P2XA 4EBEA 2HLTA 4TNOA 1NJZA 1NCLA 4DV3J 3AY9A 3O3HA 1IKXA 2KKZA 3UKUA 1IBKK 3GIIA 4JV5J 1EB0A 1BU6O 2QA2A 4ECSA 5LSRA 1U0HB 2COLA 4UY85 4ZVUB 4E98A 3J7Z5 1H74A 2YTCA 1YTAA 3VQ7A 5CY4A 3U7JA 1MU2B 4Z0UA 2AGQA 3MOZA 1B0TA 5C24A 1NDLA 4CFAA 2WVDA 4N47A 4FLWA 2ASPA 2HHUA 2NUHA 2GQ2A 1N34K 3WHIA 3W1YC 2ATQA 5LOQA 4P6QA 3ILLA 2N4DA 4DX5A 3KHYA 2E44A 4DV6F 4X62F 4DSKA 2XHCA 4J2DA 3AA9A 3LL3A 1SL2A 3VAGA 4CIFA 4DTMA 2M52A 2QGFB 1RAOA 4IOAQ 2WFBA 2C3UA 5KFOA 4CJ3A 3T1YK 2H5EA 3PM9A 5AR0A 4G1PA 2WVFA 3THVA 1I39A 3DRSA 4WP8A 2A0FB 3MAHA 5AQKA 3DGPB 2GX8A 5C24B 1VQYA 5HQMA 1DHMA 5LSLA 3IDHA 3FBFA 4PY5A 3O3GA 1I51B 2RS8A 2BDPA 5DGBA 2W8KA 3IWNC 1Q4RA 1XNRJ 2YNGA 1K8KA 4ID1A 4WU2A 4NLQA 2DGQA 2ZF5O 5JXSA 3OPKA 1RZMA 2ZBCA 3RAMA 3IXQA 3AOBA 3V2UC 1C1BA 4JYAJ 5LSOA 1XQSC 3DRSB 1BI4A 3G6XA 5AT1B 2PO4A 4HI2A 4HCBA 4KGKA 3PR5B 3WBZA 4K2XA 4ECUA 4KTWA 2ASJA 3V1RA 3SNNA 2HHVA 3E01B 3M05A 4NZ7A 1K8KB 2BXJA 3OR2A 2QXLA 4H4MA 5M1NA 3SIPB 1ZBUA 4G1QB 1UFLA 4CO0A 1YGYA 8AT1B 4FJ7A 5E2QA 3OYGA 1NOYA 3EKSA 4WFNL 1J54A 4F3TA 2B8PA 4RUAA 3I5AA 1C1BB 1JX4A 1RAIB 4OHYA 1P1LA 2IVNA 3AJDA 1TFWA 4CJPA 2V2ZA 1JLAA 2H4WB 2I1RA 4EO6A 1SC4B 1WD6A 3HSDA 3O9TA 5EU7A 2Q79A 2RS2A 2FLPA 4AYBD 3ADAC 1GLDG 3UDLA 2MQMA 1SVDA 2CJYB 3LTOA 3BJYA 3OR2B 4H4MB 2R42A 3PIPL 4OYBA 2GAHC 4R8UA 2ZUGA 3UVJA 3PW2A 1YJ9S 4ZCKA 1ITGA 3ZSQA 1RTJA 2P6TA 2NRTA 3FFIA 4RPFA 1RKIA 4ED0A 5E41A 1IH7A 1JLAB 3RG6A 3TP2A 4DZDA 4ERDA 1GLLO 3C15B 3L3UA 2VWKA 2XG8A 2ALZA 2CQ3A 1KCFA 3Q89A 2HF4A 2DHXA 4KSEB 1SCJB 5AZIA 3GSIA 4TXSA 3SFGA 4K8ZA 4ZVEA 4F3OA 2HMPA 4NLXA 3OW2M 5JICA 4M3TA 3ZEUA 5KG1A 5J2PA 2QWOA 4X4NA 2OANA 1RTJB 1T9WA 1CJUB 3FFIB 3THTA 3HCXA 5B0FA 3FCVA 2HVDA 3S3MA 5KFKA 3UN5A 2HVEA 1RWPB 4PUOB 3MECA 4K41A 3D4JA 1F5AA 2YKAA 4NPOA 1WUAA 4F26A 1R31A 2QZ8A 3PYGA 3PZPA 4CJLA 5GIOA 2FF3B 4LF1A 5AZIB 4MKYA 3AARA 3KLFA 1U6ZA 4KY3A 1KQSM 1WUUA 3PDNA 1E6YA 2D3OR 3VZHA 5J2PB 2MSSA 5IWAK 1EETA 4BE1A 5HMWA 4DR7J 3NGUA 3I4PA 1D5AA 1NSKL 2IOCA 4JI5K 5H9FJ 1IN0A 4JAXA 2HNDB 5T41A 4CFBA 1NU4A 3W65A 1LWCA 2NRZA 5HMZA 5AFUA 1N33K 3H4BA 4FWMA 5KRTA 1LAVA 2KXHA 3QWUA 2PE8A 4DF8A 4KJIA 3CYMA 1W26A 3ET6A 3LDQA 1N5YA 5AQNA 3VQAA 1KAYA 1E6YB 1HKAA 1RWKB 3B4DA 3BGOP 3UD5A 1NGBA 4DR5K 4A5AA 5F1XA 3CIPA 4KPYA 3L4IA 3B4MA 1S5JA 3VEZA 2BV3A 3H59A 4M3UA 2IAJB 3ZNJ1 5ETOA 2W24A 2MZTA 1AW0A 1SH3A 3D2EB 3AVKA 4ZHRA 1QZ5A 1LWCB 3NBPA 1BMQB 4X84A 5E26A 1OH8A 1TV6A 2FGOA 1NWKA 2K7KA 3NY0A 4FM0A 1LWEA 4ZLJA 2QMWA 3ZTQA 1WAJA 4CGJA 4CK2A 4YHHJ 4KHMA 3SV3A 3K5LA 3OYBA 4CP5A 2RRAA 3AJ2A 3CJ5A 4J2BA 6AT1B 1SC1B 4DSLA 3QBXA 1HNVB 2CQGA 1FO1A 3CJ0A 3ZTRA 4M63C 1HIYA 4J9OA 5EY4A 4R0JA 4GKKF 4WFBQ 3NF8A 4LF5J 2AT1B 3P5BP 2R2TA 1F60B 5IM0B 4OJ3A 4K4UA 4YEAA 4K4YA 1JJ2M 3T1HJ 4B1ZA 3NBPB 2ZHBA 3MEGA 4RU2A 2QLJB 2IM1A 3ENAA 1ZZNA 1LWEB 2C3OA 2P5VA 1VLYA 3ZETA 2NZ4A 1N48A 4J2AA 1EX4A 4A8WA 4FKYA 2DNKA 4OX8A 4PABA 5EWEA 2J0XA 3LOUA 4ECRA 2M9KA 2E2QA 3MXMA 3OVSA 5ETSA 3GIMA 4GVBB 2WOMA 2QMUB 4M7XA 2W7AA 3MPYA 4CF1A 5HBMA 4Z4CA 1U04A 5K14A 1ZAXA 3BDPA 3HHLC 5KG3A 1YJNS 1CJKA 2E2PA 4RUHA 1ULRA 3MEGB 1I94F 1KD1T 1FD2A 1IBCB 2PFUA 1N52B 4NYPA 1F9HA 3NMAA 2GHVC 3ZETB 3MCOA 1QTMA 2BANB 4X64K 2VHGA 1WOOA 3V9ZA 4GW6A 1HMVA 2V8PA 2ROGA 2KFYA 1YITS 1RABB 4Y65A 3KTQA 4OHVA 3TOQA 3GZ7A 1UW9A 2M2BA 4BLGA 4C8OA 1EO1A 2WOMB 2XHWA 2YNIA 3L2VA 3MM7A 4WZQA 4PKDB 3MWBA 3E2EA 3BBBA 2HFVA 4DL7A 3QMLA 3ZSZA 1LAWA 4EUVA 1LOTB 4I68A 1OO0B 1QQCA 4PCQA 3DOKB 4QIVA 3WZ0A 2DR8A 1NSQA 1VQ9N 1WG4A 3R6GB 4YR0A 2O66A 1HNXK 5HATA 1HWIA 3J7AP 1KLMA 3B6BA 1N5SA 1TL7A 2GWJA 2HS0A 4EYHB 2F9DA 4MYUA 4ECQA 1HMVB 2HPUA 4H5NA 2XHBA 3O5TB 4YOWA 3CJSA 2YNIB 4KHNA 3MM7B 3ZZOA 4IRDA 3SQGA 5IC4B 4FF3A 1M1HA 2HLUA 1KTVA 4DOZA 2KL8A 4RTFD 2CNLB 2DGSA 4KRFA 1S1XA 3I8DA 4IZ9A 3EJMA 4V19J 3AVJA 3GCWP 1SJFA 2A1SA 2ALYB 4XK8C 1KLMB 3OFGA 3V4IB 2KO1A 1OIAA 3ULEA 3TI0A 5I3QA 2KZZA 1T6DA 3ENWA 4ED8A 3M8RA 3P38A 2MXYA 4Y2AA 2CDRB 4CFCA 3W0LA 3I0SA 4DEZA 2QEXN 4QIFA 1N8RO 3R3LA 3H5YA 1QLNA 2RB7A 3EWGA 4B1XB 5C5JA 4AD6A 2OTJS 3CQXA 1HBNB 2CA9A 5IT9U 2DGTA 4DV0K 1HNIA 2FXUA 3HPOA 5SWMA 3L7UA 1K9MT 1D9FA 2QXFA 1XUPO 3KWGA 2GQCA 1BGXT 1YRUA 1X3NA 1WTFA 4JN4A 3FGUA 4BE0A 1B9DA 5KFGA 2L9NA 4QOTA 3O44A 3S7RA 3I0SB 4DR2K 1OPIA 3O9RA 3SDEA 4CGDA 2QT7A 2NXNA 4O55A 4TQRA 4CHQA 5ITHA 2PAVA 1X9WA 2XWYA 2VC0A 4K59A 2ZJRQ 3GG4A 5FJ4A 5L1JA 4AL7A 1T05B 1B0PA 2LFVA 2HRTA 2OYQA 1NXIA 2HYIB 4J37A 2AHOB 4UZCA 4EU0A 2Y1LB 4DV1K 4K42A 2M4MA 4FXVA 4OI3A 1N6QB 3KHHA 1FD8A 1OY9A 4E19A 4CEZA 4FL9A 1EZZB 2WW4A 4WYBA 3QRQA 4ZLLA 3G71N 4KRWA 3C94A 2G8VA 3D6HB 3CJBA 4W5TA 4FF4A 3H2VE 2KHDA 4C0OC 3GJQB 2XM3A 2E5LJ 1VCTA 5F9NA 2QO3A 5HANA 4FF1A 3IGVA 2X1FA 3KG4A 2BW7A 4NMLA 4FYWB 1HQUA 2P6SA 2CQHA 3JSMB 1VQ6N 1B4SA 4Z7YA 5KTQA 3S3OA 3LPYA 5CZXA 2VV5A 1YJUA 3ZT3A 2DPIA 3F9MA 1XERA 1PG5B 5A76A 3HM8A 1QY7A 4WCEL 2GNKA 3EGNA 4J9KA 5CZ1A 2HWHA 2NUBA 2OO4A 1YIJN 4EWTA 3PEHA 3SMPA 4CGFA 3NS7B 5LY3A 3N4PA 4CHPA 1RB0A 2YNFA 2AEJA 1G99A 4O3NA 4YDXA 1HNZJ 1RWOB 2D69A 1OJ4A 1YJRA 3DNCA 2E1RA 2C22A 2J7WA 3SUNA 2DGUA 2LXFA 3JTPA 1RU2A 4QU7A 3VQQA 2FBVA 3J80U 4JD2B 4A2AA 3J7ZO 2HBLA 2UV8A 2H4YB 1H2TZ 4DU3A 5AQRA 2ZVSA 1PO6A 4CD3A 4Q7AA 3C6AA 1XHXA 3HHNB 2E4LA 4FLYA 3AA8A 1W9HA 3KJVA 2GJIA 2FF6A 1Y97A 4OMFG 1TUYA 1B0VA 3CCRS 1RILA 4FVUA 1F5CA 2CAJA 3LANA 4GVEA 5FLXY 1YJ7A 5HRRA 2FPHX 3HFVA 2D1CA 2EFVA 5BYRA 3D6RA 1H72C 4DS5A 2IRYA 1SQFA 2MQLA 1NGFA 1FDDA 4Q43A 1F21A 3GB0A 5BR8K 4RU9A 3R5GA 2E7VA 5BYSA 4OLOA 1ZBTA 3RB6A 3T1YF 1RLDA 5A8WA 1VSLA 1QQOA 3QGGA 3K57A 4K4TA 2CGLA 2V52B 3CJQA 3HXMA 4JI1J 3SXLA 2Y0BB 4DCJB 4B3SJ 4OYAA 2W9BA 2IYGA 1MNEA 3Q83A 5FROA 2WZ1A 2KM8B 3HSJA 2AWZA 3IR5B 1U2VA 2OTLS 2K06A 4ZCMA 5D8HB 1OSDA 2N3OA 1I3OB 2E1CA 1SKSA 4P9SA 1S1WB 5AXKA 1IUJA 1Z26A 4DU8A 1N5QA 3RMAA 3SCLE 3KK3A 3D68A 4M94A 3NEKA 1RCXB 1BCOA 1U02A 4DKWA 1WN7A 2ZBRA 4RW4B 4OHWA 4NLGA 1XC3A 3VAMA 4DQQA 5LMUK 3JXUA 1QD1A 1SS6A 4XH5A 1PSDA 4ELUA 3RBEA 4NE9C 1RUSA 1URNA 2K2PA 5AQSA 2O8EB 4HTLA 1PAEX 3T5LA 4P75A 4CHNA 3OTOK 3OTCA 1WBDA 1VBXA 3IFRA 1XMQF 1NDKA 5JMVA 3W5YA 5E33A 2Q0UA 3ISZA 1U2VB 2ASDA 4K4VA 4A8OA 3X3UA 2Q2RA 1KKHA 3K59A 4F4KA 3E9PA 2F8MA 3F9KA 2IA0A 1X4FA 1Y9OA 4JI3K 4TLRA 2N7CA 2JJ4D 3O9UA 1LQ9A 1FX2A 2OPQA 4B3TF 4LF6F 3L9ZA 1AUDA 3HVAA 4LF4K 2A2DA 1IKYA 2BABA 4YQWA 5JS2A 3HMJG 3C6UA 4C0BA 3HI0A 2A3JA 3RBDA 3RUBL 4ZN1A 4AHSA 2JEIA 2KHOA 1JLGA 2GZOA 1XMOF 1GOBA 4NA2A 3VN5A 5C2DA 3SQOP 4JHDA 5IQQA 3OL9A 1TYQA 1NRKA 5AQYA 5HRSA 2J5AA 2FVCA 3IFEA 3UW1A 2R7XA 3RZAA 2XY5A 2XMVA 4J90A 1IBKJ 1NHVA 1W7AA 3C14A 4NZ6A 3MX5A 2OPQB 4ZA1A 3DOLB 1S7IA 2AJ1A 1TKDA 2VG6A 2HGMA 1HI0P 5KT3A 1U25A 2BJ7A 2F4VK 4WFBL 4BS2A 4CRJA 4RR5A 3M1FA 3D1QA 3T3FA 4KKOA 1JLGB 2VCPA 4IBNA 2Q3PA 3PW5A 3DYAA 4CO3A 3QSYB 4CEFA 2C3MA 3DJCA 1N34J 5EX0A 1RAAB 4B3RK 2WONA 1YRXA 5CD4A 5T7LB 4BROA 4MFBB 4E7KA 3VQ6A 4HTJA 1U4BA 4UW2A 1H1VA 3HD1A 3A1YG 1C0FA 2AU0A 1NU0A 4FYXB 3T5HA 2VG6B 5KRSA 1K44A 3CJKA 2A18A 3KD5E 2CJBA 3LA0A 4YY3F 2AJ2A 5C2CA 4OZLA 3ZT0A 3Q7BA 3HVTB 4DU4A 2DCLA 1NGAA 2PIIA 2F9TA 4AHUA 4KKOB 4RL1A 1DEJA 2XZTB 3D6MB 2VODA 3QO9B 4KIAA 4P10A 2HOEA 2VYPA 4JBCA 5C42A 3DYAB 4C3LA 1JWWA 3ISND 2KT5A 1QAYA 1A5WA 2EVZA 3T5JA 2WONB 5GAEI 2JEFA 2QG9B 2HRYA 4NMXA 1S9FA 1SH0A 3Q22A 5FLXO 2EI5A 3BM7A 3TAGA 2X6NA 1TL3B 5D6GA 1CC7A 1HL6A 3AV9A 2E1YA 4EI2A 2QYCA 1DY3A 1ZA1B 5DRKA 3MK6A 3A8IA 3PFEA 1N33F 2IVPA 1H2UX 2BUNA 3BREA 4JS4A 4RNFA 2L9DA 5KFZA 3D28A 2BA9A 1KC8O 3J7A1 4FVCA 7FDRA 3HSGA 4DR5F 3OS1A 4BR2A 1JL1A 3ZO7A 3W2WA 3H6EA 4C98A 2HG4A 2GW8A 2XMAA 2AJFE 1YJVA 2VBZA 4DV5F 4JI0J 1VQMS 3RRHA 3CG7A 4CO2A 2HFZA 3GFYA 2B6AA 4JKFA 1NGHA 1IKVB 2GV9A 2VZ9A 4DR4F 3OHAA 4URSA 2B9YA 2J6TA 3EZWA 4J91A 3PCOB 2IDEA 2Z57B 1O13A 3AO2A 5AQTA 1HYZA 4N41A 4B3OA 4WK3A 4FDFA 1RTZA 3SAHA 2ABYA 3AT1B 5AQOA 3CMQA 2UUCF 3D6TB 4Z37A 2OEKA 1Y5LB 3M8ZA 3ZZTA 3HKWA 4ED1A 4EZ9A 4RW7B 4BR9A 3FRZA 4TU9A 4YOEA 4BC3A 5BXIA 1KNZA 1T94A 3EM1A 2B6AB 1WNEA 5GADI 3IMXA 4C8ZA 2RDJA 3G8TA 2Q1NA 2E1PA 3EO3A 3POTB 2LQ9A 2B56A 2B4JA 3FMBA 2H65B 1KFSA 4OPJA 2YH0A 3MM5A 1NMEB 3CGIA 1FTRA 4IG3A 4U7UK 2UVRA 4LC9B 5K8OA 1DLOA 1HHQA 4KAZA 3HK2A 4K8RA 3BZKA 3FRYA 4E3SA 3IG1A 2MKYA 4V1Ak 2W9CB 2FBYA 1C4CA 4BRDA 1OYDA 2FBTA 2I7PA 3VQDA 3VZIA 2B9WA 2RH3A 1TUUA 2W25A 3L8BA 4GMKA 3ENVA 4E7LA 2X6SA 3V6HA 2WVBA 1BWEA 3KJNB 1TR0A 3NRBA 4TN2A 2DGXA 1XEZA 3EY1A 4X64F 1Q95G 3LP1B 2EC0A 4KBIA 3PJ9A 3I8BA 4ZVGA 3ZSXA 2ZJRL 1JLEB 3TR8A 3C16A 4Y6IA 2FHJD 3GFHA 4DHVA 4ED7A 2W42A 5IWAJ 1L3VA 4I4BA 4NYFA 1UJ5A 2NS1B 3KLIB 2DFEA 4LFCK 4NYNA 2BE2A 4JI5J 3VENA 2FJXA 1I5OB 4K2JA 3KK2A 3DLLL 2XBPA 5LT5A 2P2CB 1NHUA 4LF8K 2RRBA 3PX4A 1HLWA 3M6UA 2HBQB 3TR5A 1YK9A 1JXLA 1XQIA 4DL2A 4Z7CA 3N4QA 4LH4A 2HAIA 1ILYA 1NPPA 3FEXB 4N5SA 1VGYA 5M1PA 2DEIA 2O8FA 4NLVA 1JJCB 2B3TB 2EPIA 3VQCA 3MR5A 5F8HA 3DLKA 5DDRC 1ZC6A 2Z0GA 1HJRA 5EN1A 4IFYB 5ETMA 3MTKA 3UDVA 1U6FA 4NLSA 1HHTP 3NGYA 1YWXA 2ZC4A 4ZTJA 2BE2B 1AB8A 1M5HA 1VQ8N 5BRHA 1R0CB 1D9AA 1X3MA 2VPYB 1YJWN 3GIKA 2FSKA 1R0AA 3MCNA 3CULA 3VF4A 5CE3A 2DNQA 2JVOA 4USUA 3D45A 3CDAA 3WX8A 4OJRA 4CLZA 1S9GB 4WPAA 2J9DA 2O8FB 1BWFO 2U1AA 5HP1A 2KM8C 2E2NA 3TAMB 1SL1A 5AQIA 2O01C 4OGEA 3EE9A 4RX6A 3CC2S 5IV4A 4W5NA 4IOCQ 4QIWD 3PNIA 3QT8A 3V6DB 2P9NA 4ZVRB 3HFZB 3RU0A 4C4WA 4GKJK 2ZBPA 1FRJA 2HQFA 3JTNA 4KBOA 3QBCA 1LFPA 2WB4A 1T3VA 3LDPA 1VQPS 2ITMA 3TZZA 1OPZA 2X74A 1T9YA 3KVGA 5FPDA 3AAPA 2HZVA 2UP1A 4DR2F 2G0CA 5D3GA 2I8EA 9RUBA 3ZT4A 5E5NA 2ACYA 4B9TA 2Z1JA 3BN4A 2V67A 2DH8A 4LF2A 2DXDA 1KTQA 2E5HA 2BM1A 3TQ1A 2LCWA 5G0RA 3D66A 2LXIA 3BPDA 4CWBA 1WB9A 4CJTA 1LXJA 4PL7A 3DHWC 2ZFHA 2XZDB 2PA8D 2FD2A 1UL3A 3KOAA 5KT5A 1KOOA 4HHUA 2DK2A 1QSYA 4O4GA 3ATVA 2CJAA 4CJVA 2G13A 8RUCA 2P9LA 1KQFB 4GC7A 1Q5VA 3AOAA 3EPGA 1U0SA 3I55N 5D3GB 2XS5A 3L2WA 4KI6A 1VQOS 1GLBG 2QTWA 3SJHA 2CJKA 4AXIA 3T5KA 4FBUA 1T7PA 2KW4A 2FTRA 4NYZA 3PEJA 3QRPA 3M3ZA 1BA0A 3GTYX 4I6AA 5G0RB 3ZZRA 1S1TA 1TAQA 3W60A 2Y1JA 3FSIA 2H54B 1HNXJ 1JCFA 2BH1A 3K5NA 1W0HA 3HOTA 3AAWB 2HNZA 1FXLA 3RW7A 5CQGA 3WXJA 3W9JA 1ZXOA 3QNOA 5J2MA 4BBYA 2NZCA 1NUEA 3OYKA 4Y2MA 1JKHA 1HPZA 3RSEA 2P9LB 3AGRA 4LD0A 2CVIA 2VG5A 1MWYA 3R7NB 4EZ6A 3H98A 2VC1A 1WSGA 5M1KA 1TL4A 3TRGA 4B02A 4NLRA 2BJ9A 3QJLA 3D3CJ 1T0TV 4FVMA 2OZSA 5ADXH 1VHXA 2KKHA 1S1TB 4PPDA 5DQGA 2OPRB 4WP9A 2CFXA 4HKQA 2RU3A 3ZNUA 2AEMA 3DLGB 3C65A 1NGDA 3BO4A 3MR2A 1PBAA 1NB7A 3CCVN 1D4XA 1KP6A 2P9PA 1JKHB 2XNRA 4CJUA 5H9EK 3LDSA 1HPZB 4IRKA 1ROFA 5B09A 3RSEB 2DB1A 3CTRA 1X4AA 3T41A 2C1EB 1S5ZA 1NPKA 4IG0A 1QVGR 2M8DB 1URRA 2F63A 3CIZA 1RT3A 4QPXA 4FZZA 1T03A 1HX1A 4CEDA 1FRXA 3CCQN 3CCUN 1JLFB 4Q44A 2EFNA 4IR9A 5KPRA 4DV0J 2NNWA 5AJ3F 1IXKA 4JI8J 1U1LA 2NRXA 2JEGA 2UUWA 1M90O 2BW2A 1LW2A 3SPZA 3O3FA 3RMCA 1RHJB 2PMZD 1DGKN 1FJGJ 3LGMA 1TZ0A 4ZPCA 3R6MA 4LT6A 4C7QA 1VAZA 1HRHA 2KU7A 4JK7A 2IC3A 2G2ZA 1HYSA 4L73A 3LAKA 4HHTA 2EBGA 4PKHA 1FKPA 3OUYA 1X4EA 1D9DA 5KFQA 2DR9A 4LFAF 3BH6B 3C7NA 1Y00A 4K4XA 4KGZB 3MX2A 1U2FA 4EP5A 4ECVA 3MCAB 5LJ3Y 2D41A 3EKUA 3AVMA 1RBTA 2DR6A 4ED4A 1HBMB 4LF7F 2MZJA 5KFCA 4KHPF 4DV1J 2V2QA 2CZ9A 4OYMA 2V7YA 3B54A 1BWVA 2HHXA 1ZAWA 1XNQK 1K9MO 3GJTB 1LW0A 3B8AX 3MN9A 3R1LA 1N32K 3R5BA 5HJYA 4WFXA 2GJ2A 4WK1A 3MFHA 1XIQA 2WRMA 4OYIA 1QUVA 1FKPB 2KQ2A 3EVOA 4JP8A 3CXCM 3QT5A 2UUAJ 5LMUF 4IEIA 2GO9A 2SXLA 4ZPDA 3BN7A 2V2KA 2UXCK 1IM4A 1OVYA 2AYGA 1BIZA 2R7TA 4DU7A 3OTOF 4FZYA 5KFAA 4P7TA 1XTZA 4HH1A 3AO1A 1NLKL 1MMDA 2R7OA 3S41A 4BRPA 2I2YA 2IS3A 1LW0B 1J5EF 4JV5K 2PBDA 4JI3F 2KRBA 5FDLB 4GVLA 2P9IA 4ZVSB 2HBKA 3VGUA 4LBIA 2M88A 3CCSN 2W9AA 4M45A 2FJBB 1WORA 4FJ5A 1Q81O 4DDFA 1U1OA 3PR4A 2VJUA 4NA1A 1S6PB 2YKNB 3CM6A 3WEEA 3QEIA 2XSJA 1RADB 3CFRA 3SQ0A 1X4DA 2WW8A 4J9MA 5U47A 2MLZA 1HWKA 2YQ1A 4BY9C 3KXDA 4Q0BB 2W2OP 3EDRB 1WSRA 3K9JA 4YOTA 5MLCQ 1O6XA 4H5TA 3FR0A 2N82B 4KREA 2YWKA 1DBDA 2QWNA 1NAQA 2G8IA 1S77D 4K7QA 2VQEJ 4QS9A 5AQGA 4IH6A 2F4VF 2R3VA 3MXJA 1Q16B 3M8QB 4DPWA 2D3O1 1WEYA 4DV2F 2QLXA 3KNGA 3Q8PB 2NRHA 4FOEA 1RT4B 4NLTA 2FBXA 2XSJB 1S10A 2VPXB 2HZCA 1BL3A 4LSNA 4B3RF 3GPAA 3FCHA 1KSPA 1JQGA 1MWZA 5BR8J 5IC6B 5K8NA 5E3RA 4R25A 2VA2A 2CJQA 1YX2A 2B9EA 5M2PA 3TTFA 3G82A 4DUYF 2UYTA 4JI4K 2JWNA 3CM5A 2ZKUA 2YCHA 2W2MP 1UFWA 4DFJA 3BR8A 3ZSWA 4CEOA 3MMVA 4CZKA 1YTYA 4C1NI 4K0KK 4LSNB 2BQRA 3D7EO 3VAKA 4E89A 4USKA 3BEGB 4EYIB 2MJNA 5EOYA 4LSLA 2UXDJ 5TKWA 1AA1B 1BUXA 4MK9A 4X65J 3HJFA 4D3GA 3UKRA 3CCZA 3G82B 4IO9Q 2BJ3A 3EGZA 1XHZA 1AZSA 4EBCA 1RU1A 3UI3A 3TO8A 4U67L 5FRNA 3MM9A 5LM7E 3SPYA 2RPIA 2OSRA 3D1HA 4FPAA 1RA7A 4PKIA 4MDAA 3QT6A 2DIUA 4JI7J 1T3NA 1YXQA 2DD8S 2R7RA 1YBUA 2IDOA 1H98A 2XCAA 2F7VA 2V63A 1HLUA 1CJTA 3CCJN 3CJTA 4L8RB 5HL7Q 3AODA 1RLCL 4KYZA 3SCJE 1NGIA 3H45C 1VISA 4QWAA 2VDHA 3U9ZA 2M70A 4LSLB 1XWLA 5KPZA 3GBTA 2QIFA 4TY8B 2A42A 2WBNA 2Z2LA 4DL3A 3NLCA 1FRIA 4OX6A 1KS2A 3A3OB 3QZ7A 4EIAA 3UKRB 3UCUP 3G0ZA 2GTDA 1AZSB 1FWLA 4YDDB 2N7YA 5KI6A 3CC4N 1WHXA 5A6PA 2GQQA 1Q82O 2QLWA 4LF4J 3KIOA 3K5PA 1V3RA 3VQPA 4BRFA 4MT1A 4CZHA 5HN0A 3K8WA 4MQ3A 2RT3A 1GFWB 4YUDA 1LK7A 4RUCA 3AD9C 1HBUA 4BRMA 3Q8SB 5D0RA 5DLFA 3MN5A 2YNHA 3AVFA 1CJTB 2BBEA 1V4TA 5F8MA 1Q18A 2FJDB 2C2OB 3OTEA 3U3YA 3VTIA 1Y0HA 3C6HA 4HACA 1X60A 1LXNA 2XQCA 2IM0A 1VQ5N 2X51A 4P72A 2XS7A 2B43A 4C11A 3LM9A 1ZH5A 1W2BM 3SQ1A 2GA7A 2GIQA 3IM8A 4MKVA 1DARA 1NMNA 1D09B 1HBUB 4ZVFA 3QFPA 1FRMA 1N5TA 2D0AA 4TU7A 2UUBJ 2LQ5A 5EDWA 4I67A 1U1NA 3TSPA 4BGBA 4A48A 1Z25A 4CGIA 3HHLD 3W5XA 4NLBA 2ROPA 2WTFA 1AXQA 4BC7A 1LKZA 4M3YA 1M5KC 1VQ9S 3J81j 1KAZA 4HL9A 3BGRA 5H9FK 2XMTA 4OKEA 3G9CA 4A8SA 1RWWB 4ZJQA 3F41A 2ASYA 1SH2A 3SQ2A 3VEYA 2FQQB 1CG2A 3DKDA 1K47A 3BZQA 2LEBA 3CMEN 1FKAF 4B3MJ 4ZIVA 1BCMA 3PACA 4RW6B 5KQDA 5J1EB 2RSQA 1TK0A 2KTQA 4M3XA 1GMUA 4I7FA 4FYVB 3KLEA 3I87A 2EKYA 5HK4A 4B9QA 1SAZA 5AQMA 3O80A 3LDOA 3HKZD 4WIIA 3TX0A 4AQYK 4D3HA 3TAQA 4QYZK 3BGRB 3EX7B 4YB7A 4LFCF 3K9KA 3S6EA 4AXJA 1YKWA 4S0MA 3OYMA 4J9LA 3CT9A 1KVAA 4FWOA 3I56N 2F8HA 4FWSA 4FZXC 3O5BA 4LF8F 3VQ4A 1BQMB 2XSFA 4FWLA 5KOXA 3CJ1A 4OZ1A 3OLBA 4B9UA 1TGOA 4CZIA 1VK8A 4I7FB 3UCGA 1S22A 3KLEB 3D2FA 3SI8A 4ITSA 3GWCA 2QEXS 2FZKB 3T6JA 5BRDA 3C6TA 4E0DA 2D0CA 2V94A 2KG1A 3MMAA 3V9WA 3H0PA 5CZ2A 3M2RB 8ATCB 3PLAA 5CHIA 2LU1A 3SUQA 2B5JA 2F40A 2X1AA 2KT3A 3WUHA 1R8HA 4W90B 1ZBIA 1TKZA 5FPMA 3QT7A 3DLEA 4JK9A 5DDPC 2HHPA 4ZVHA 3P31A 4CHYA 3TSQA 4CJWA 4FP9A 4MK8A 1NHKL 2QA1A 4Y34A 4AHCA 3MM8A 1FEHA 4ES3A 1IG8A 4MO4A 3OHBA 3AAQA 4FN5A 5EX5A 2GFFA 3TJ8A 2ZOGA 3MMAB 4OX9J 4U95A 2HVIA 3M5RA 1HW9A 4FWKA 1PYTA 5F3ZA 4E1NA 1U09A 4LBPA 2JOQA 2LDYA 4ECZA 2E7XA 4HDGA 1BQNB 5CABA 1V5VA 1UWBA 3M6GA 2RMLA 1MROB 1KVKA 2OFHX 5GAEU 2BKNA 3MM8B 1Z1ZA 4WU3A 1GEHA 3G71S 4BREA 2NCKL 4W5RA 1N56A 1Y11A 4QIEA 2MY7A 1SJRA 3G4SN 4FJ9A 3NMUA 1CPZA 2OPSB 4DR1J 2IBOA 1VFJA 3AHPA 3CQ8A 3DLJA 2DYAA 3U3GA 1RACB 2ZDPA 2UXBF 4DCHA 2V8DA 4OGCA 1NZAA 4CEQA 2V8VA 4M41A 4NXMK 1BHNA 3PYDA 1VQ6S 1X9JA 4CGGA 4HTUA 2YVSA 1N36J 5AQLA 1VYAA 3BQ1A 1JLQB 2DJWA 2EK6A 2G1DA 3SEOA 4C9DA 5L1LA 4ZP6A 3EXYA 3ZXWA 5T7BA 2CPFA 4JKGA 3SCKE 2MQ8A 1RHRB 2HEKA 1N8RT 3MPUB 2ASMA 4LRAA 1YIJS 2BTFA 3S01A 3ULHA 2GX9A 1VBZA 3AO5A 4PWDB 2LEPA 4F4ZA 2DFFA 4BWJA 3P3DA 1GQEA 1UKUA 1JXVA 2RKIA 4N77A 2PEBA 2VQFJ 4CK1A 2A6MA 3MCMA 2PFFB 2KN4A 2FVQA 4E8UA 4CJEA 5HLFA 4CFDA 1ZM9A 3DLHA 2CQ2A 2R9LA 3ETOA 4DQSA 4WYWA 1J6ZA 4CERA 4OV6A 2B8QA 2AGOA 4JKGB 1EWRA 3NE6A 1DTTA 4E7HA 4R5PA 3VOVA 3LP0B 1NJWA 5C25A 3RAQA 3K2PA 3WNFA 1SQGA 4ECWA 3FZLA 2KLAA 2UU9F 5AXNA 1UOCA 1ATRA 3ZX2A 3OW2R 1DAXA 3GG0A 3IR6B 4FWQA 2D7SA 2Y9HA 2EW9A 4CVNE 1I3AA 1NGCA 3OA9A 5C2FA 4WFAQ 3SSSA 5F9LA 2QYGA 2ACMA 2Z30B 1RJJA 1RBRA 1WOQA 3JSBA 3UD3P 2GMJA 4F0KA 2GBZA 4QU6A 4IRCA 1T9TA 1P8GA 4WBFA 1GTHA 4RWTA 4I2QA 5K20B 1Q86T 4MIWA 1RDWX 1A6LA 4YR2A 2BOAA 2EBEA 2N4CA 5B8HA 3ZZZA 1KQSR 1VIXA 2ERRA 3BQ0A 5HSPA 2BQ3A 3CCLN 5I9EB 1UPMB 5F8LA 1N0VC 4BC9A 2BACA 2CNOB 1NKBA 5HROA 1BC6A 3CD0A 2D5RA 5CCMA 1E3MA 1UW4A 2OD6A 3R8YA 3V5RA 4GKJJ 3M1VB 2MZRA 2IM2A 1TTHB 4NCGB 2HSEB 2XYGB 1VC0A 4CH7A 5EVZA 4DL0C 1NK9A 4UUXA 3F2KA 2UUTA 4KH0B 2NPFA 1FHTA 3W61A 4WQ4A 4LVNP 3M8PA 2DHHA 1HI8A 4FJHA 2E5LK 1V9OA 4WE1B 2CPZA 4QS8A 1OH5A 1KVJA 4UY8T 1WJ9A 2BRLA 4ZIWA 5LXYA 2A1RA 2VFVA 3G86A 5ETKA 4OL8A 3BGUA 4M5KA 4DFMA 1Q8IA 1CXUA 3HFKA 3DC2A 3BKFA 1UJ6A 2G2OA 1YJ9N 2O8CA 2ZWHA 3AO4A 2HHHK 3CB4A 2GEMA 4DG1B 4JEPA 3H5XA 1RYSA 4FJMA 3E1YA 4MO5A 1VHFA 1KFDA 2XY8A 3FLCO 5C2GA 3QJJA 4BC5A 5G4DA 5J1NA 5F2RA 4CGHA 2P1JA 1Q5YA 4OZNA 1O51A 5HQLA 5FPNA 1JMTA 1R8AA 1SJ3P 3CJ2A 5BJRA 5AZJA 2IA6A 2H51B 3WC2A 4Z2XA 1SC6A 1T9VA 1J9AA 5DM7Q 1GXUA 4B9LA 4DV3F 3Q8QB 2BMBA 2YKPA 4J9QA 4IXCA 2VG7A 3IGNA 3RMDA 1JJ2R 3WXMB 4FJGA 4JV5F 2DO0A 1WC4A 1NEEA 4WIQA 1NDPA 5L8RC 4FPIA 2O8CB 2E66A 2V4QA 2NRRA 4BRQA 4DTOA 1VS3A 2PYLA 4C0HA 3HVRA 2G0IA 2QWLA 1SC3B 2EEYA 3W9HA 4MYTA 1NJIO 1IBMK 4CZFA 3GYNA 3MM6B 3CJCA 3EUNA 1X1PA 1BE4A 2HURA 3KDOA 3IA0A 2R7WA 3OJUA 3MPWA 3KLGB 1EQYA 3IUCA 5BPLA 2KXFA 4CBWA 2BEFA 2HBJA 5F8JA 1TL1A 4RBTA 2VG7B 1HKGA 3ZC4A 2O3DA 1NPRA 5A8KA 3CWJA 4DV7K 3WXLA 5CR4A 2OEMA 3W7BA 5F0XA 1S1VA 4RLEA 2RN2A 3ENHA 4CJRA 1BA1A 2V4RA 1FFWB 5B0CA 3OR1A 1QE1B 3K5OA 2FC0A 1MWKA 4YOVA 2QV6A 5JVHQ 4CK3A 4K50A 5AFUH 2K1RA 2MZSA 2IJNA 2ZBQA 4N76A 4CESA 4XEIA 4M5LA 3KFWX 5DM6Q 3DM2A 4UOCA 3AVAA 2KYXA 1WWHA 3E9OA 1S1UA 4J9UE 2P51A 3UNGC 2OKQA 1XNRF 3BSNA 4FJXA 4PZVA 5DQHA 2JWLA 3SBMA 2HIYA 1RDUA 5A8KB 5HOOA 2OHDA 3BEXA 1ZETA 3OYHA 3R9PA 4CIEA 4TY9A 4JYAF 3KKSA 4CJ7A 2MTLA 4X4PA 2LLZA 3OR1B 1KVIA 1E6VB 3R5JB 4B8AB 2V0NA 2FZCB 4JV0A 4FK2A 4IFEA 1KQKA 3RRKA 5ELZA 2DNZA 5DO2A 3FQLA 1S1UB 3QIDA 1WAFA 3VESA 2QI2A 4GY2B 1S0OA 1XNQJ 2GC8A 3N9UC 3IWXA 1G2EA 1VSEA 3FZBA 3CO9A 1FJEB 3NAEA 3PY8A 2C2ZB 2FJWA 1N32J 4QAGA 2B9XA 4RW8B 3AA4A 3GLJA 1FA0A 4EEYA 4PPZA 1R27B 4O8UA 5CZVA 3GV7B 1HWLA 5GAHI 2OPPA 4Z4FA 5AQUA 3QEPA 2DGVA 2KFNA 3EGWB 1MU2A 3HRGA 2UXCJ 5B0BA 3NGIA 1OYEA 3JAMY 3ENOA 3UDEA 1SZ2A 1YVUA 1RWXB 3EEQA 1ZZFA 4CJKA 3MN6A 1RAJA