1RTHA

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
543
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 144
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rthA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rthA05
3OYKA 1SL1A 5HROB 5KRSA 2WK4A 3SV3A 2D5RA 3WNFA 4ED1A 4DSLA 4DTPA 4I9LA 3H59A 1QHTA 2IJFA 1B9FA 1Q9YA 4FJJA 5HLFA 2G8KA 4DG1A 4YQWA 4KHUA 3O3HA 4H54A 1BGXT 4J9SA 1SH3A 4NLUA 3V9UA 4K8XA 3KK3B 3NL0A 5KFVA 3DM2B 1ZBLA 2AGPA 1YT3A 2UVUA 2IM2A 1K1SA 1UOCA 1RDRA 1JLBA 3LP3A 3V9ZA 4NLVA 5J2MA 4FLYA 5F8HA 3DMJA 5KFKA 4O44B 2J6UA 1KLMB 4ED7A 5DQGA 1Q8IA 4ZP6A 5JUMA 3OYDA 4CJ3A 2ASJA 4ECYA 3NAHA 4OJRA 4PQUB 2R7YA 4XO0A 3LPUA 3DRRB 4I2QB 5KFYA 4ED2A 1HMVA 5J2QA 4DF8A 4M3ZA 4DQRA 4KREA 1QE1B 4K4YA 3PW0A 3LP2B 1RT3A 3HXMA 4O44A 4AHRA 1L3UA 1S1TA 3ZSQA 4OKJA 4NLWA 4B9VA 2ILYA 5EU7A 4CIGA 5HLFB 5KFDA 4YFUA 2VA3A 3ZSVA 3K59A 2HHVA 1ASUA 2X74A 4ECVA 1I3AA 1NK4A 4K4TA 1LV5A 3LWMA 3M8QB 4WE1B 1TK8A 1WSGA 4BE2A 4DQQA 3HYFA 4KB0A 5KFWA 1TV6B 3ZT3A 4DTNA 2VG6A 4KHSA 4ID5B 3OVNA 1SL2A 3KJVB 4CK2A 4KHRA 3HM9A 4M45A 4M41A 1U04A 3KTQA 4CERA 2ALZA 4EBCA 1HRHA 5KT7A 4IRKA 4FK2A 4LY7A 2E4LA 5EWEA 3M9MB 3AA5X 1VSMA 3PW7A 1SUQA 3AO4A 3OYFA 2KW4A 4RW7A 1ZBUA 1NJWA 2JEIA 1HYSA 2FBTA 4WXOA 1IKWB 4DQSA 3QO9A 4Z4CA 4KAZA 3OYLA 2V0NA 1JLFB 3ISND 4WYWA 4NCGB 3PX4A 2G8FA 4CFAA 4FK4A 2AWZA 5HP1B 3P83D 2Z1IA 4U7CA 1D5AA 4IR1A 3FRZA 2AX0A 4QWCA 1C0TA 2GC8A 2HNDA 2YNFB 4CF1A 1QAIA 2RDIA 3V81B 3JSMA 2RKIB 3ITHB 1RDAA 3RMDA 3KK1B 4NLTA 3PZPA 1RBSA 3PW4A 4XIUA 5JS2A 1TKZA 3MEDA 4BACA 4RNOA 2GV9A 3QGGA 3BJYA 2X6NA 3OL9A 1LAVA 1N4LA 4F8RA 4DLGA 1D8YA 4ED3A 3V81A 4JV2A 2O4GA 3QEWA 2A1RA 2R8KA 3GQCA 1RBVA 1S9EA 1RDCA 1REVA 3DOKB 3CDEA 3NAEA 2HWIA 3M9NB 4DSFA 4EYHB 3LP1B 3TAPA 2IMWP 2FBXA 1SV5B 1U48A 3E51A 4ZPBA 3EPGA 3NF7A 2IDOA 1S6QB 2YKMA 4KV8A 4ECUA 1T8EA 5K14A 1J9AA 3BSOA 4ZP9A 4IBNA 4IKAA 3P5JA 1LW0A 3NH2A 3CO9A 1FK9B 3GIIA 2P1JA 4KBIA 2Z1HA 1JXBA 1N48A 4EO8A 4HYKA 1S1XB 1BQMB 2BQUA 4BE1A 2B6AA 2JGUA 5HBMB 5KFSA 1RT2A 4DFJA 3N6NA 2WCXA 5HRNA 1LWFA 4XPEA 3OYNA 1L5UA 2XHBA 2I5JB 1RT3B 3OLAA 1ASWA 1KVBA 1EETB 4B8CA 1NK8A 2QE5A 1U49A 4ECWA 4CJRA 4RG8A 3KLHB 1B92A 3AVKA 2WB4A 4FW1A 3HPHA 3SUNA 1IKVA 4ZMMA 5KFLA 3PW5A 2YNHA 2I5JA 3ZSXA 2OPQA 2E9RX 1KTQA 3VQCA 1ZTWA 2KFZA 1WLJA 4EZ6A 3OYIA 2WOMA 4O4GA 4F4YA 1RAJA 2YHAA 4F4XA 1VSLA 3V1OA 5KT6A 3KLIA 3HSTB 1HQEB 3SQ1A 4ECXA 3AO3A 4M42A 1VSJA 2HW3A 4CEAA 2VG7A 1X9MA 1WNEA 3TAGA 2O4IA 4BDYA 3NMAA 3ICLA 4RNMA 4EEYA 4FVMA 4ZP8A 4NCBA 1ZBHA 5C42B 1SUQB 4JLHA 2DFEA 2D0AA 1QAJA 4F4KA 4RNHA 1WAJA 3HJFA 4H4MB 4M3XA 1TKXB 2GIRA 3MF5A 5L1JA 4J9MA 1QUVA 3OYGA 3KK1A 2HHWA 4KHMA 4AHVA 3N6LA 5L1LA 3G86A 2F8EX 3UDLA 5HRPA 2AU0A 4DEZA 1S5JA 4CFBA 3V9WA 2PYJA 3FQLA 3QEVA 5KFMA 1NJXA 1S0MA 5KG4A 3SI8A 3DMJB 4IOBA 1L3SA 5KT4A 2HVIA 4IH5A 4CK1A 4ZTFA 1RTHA 1RT2B 3UPFA 2O5DA 3RB4A 5DQIA 4XPCA 1KVCA 4O0JA 1T03B 4DQPA 3DLKA 4FS2A 1DLOA 1HNVB 1RT4B 3VQPA 3DRPB 2OH2A 4B08A 2C2DA 3VQ5A 1UA0A 3QIPA 3AV9A 3DOKA 5DG9A 2IS3A 4ZVEA 1HQUA 5KFEA 4B8AB 2HHQA 3HP6A 1RTDB 5DK5A 2FVSA 3BSNA 3LZJA 3V9XA 3KHHA 4F50A 3V4IA 2E6MA 5KG2A 4HUEA 4GVMA 3L3UA 4B9SA 2OPSA 4Q0BA 4CJWA 2ETJA 2XCAA 4DU4A 3RTVA 4KB7A 4B3OB 2IBKA 2QKBA 2FJVA 3BSAA 1JLBB 1HNVA 4IG3A 3AO1A 3FSIA 4NLDA 2OPPA 3OHAA 4IRDA 3ZSYA 3QLHA 3BREA 4M3UA 1TGOA 5I3UA 3KOAA 1GX6A 1LW0B 3NF6A 1IKYB 4C8LA 2XC9A 2KTQA 1LWCB 4B9MA 3WNEA 1RT7B 3OSPA 1S6QA 3VQ6A 5HP1A 3HT3A 3K5MA 2XY5A 2E9ZA 5KRTA 3FQKA 4Y2CA 3KD5E 4FJIA 2B4JA 1Z4UA 1NKCA 1MU2B 4URQU 3D28A 4NCAA 4RW8B 4LSLA 5KFZA 2ZE2B 4M3RA 3V9SA 4G1QB 1LWCA 3K5NA 2G8VA 2KZMA 2J6SA 4K4WA 3T5KA 4DSEA 2C2RA 5I3UB 2YNHB 4Q0BB 2X78A 3V1QA 1U45A 3UQSA 4UQGA 4CIFA 4E1NA 5J2QB 2XY6A 4FJKA 2IAJA 1I39A 4AILC 4ID5A 4LQ3A 1C1CA 3VA3A 4LSLB 3OS1A 1NHVA 2IC3A 3C6TA 4CJVA 3T5JA 3L2QA 3SQ0A 1U47A 4JRQA 5FDLA 3NHGA 4R8UA 3DI6A 4FK0A 1XC9A 2YKNB 4WFZA 3I5BA 4KAIA 1L3VA 3T19A 4RW6B 3ZCMA 2IM3A 1C0TB 4MKAA 4DTXA 5KG1A 4Z4IA 2BRLA 1FKOB 1J54A 4J9NA 1D0EA 4FJ9A 4DL7A 3OYCA 4N56A 3OJSA 1UAXA 2D7SA 4R8UB 1IKXA 3I5AA 3DRRA 4I2QA 4W5TA 4E3SA 1C1CB 3QNOA 4DL3A 3I0SA 3AVCA 1TKTA 4LSNB 3T5LA 4ELVA 2BGGA 4ECRA 1C0UA 3QIPB 3ZSRA 4EP4A 4Y34A 4AHCA 1G15A 5C5JA 4EBDA 4PQUA 3MECA 4CJ5A 3KK2B 1T05A 1ZETA 1QTMA 3U3GA 1S1XA 2D0CA 4KV8B 3IAYA 3LAMA 3OHBA 3D45A 5EWGA 2HMIA 3D0PA 1VRUB 1YTAA 3ISNC 1S4FA 3GV7B 4FLXA 3HVRA 2KQ2A 1BHLA 1RT6B 4G1QA 5F8LA 1X1PA 1F21A 3K58A 2F8SA 4NLSA 2FLPA 1S9GB 5T7BA 1VSFA 3L2VA 3VQ9A 2YV0X 3G6VA 3MEEB 3TAMA 2VWKA 4RW9B 3QYYA 4OGEA 1S6PA 3UIQA 1XHZA 5K14B 4DU3A 1TQLA 4CGDA 2RDJA 3SYZA 3MR6A 2BQ3A 3AVAA 2W9BA 4DSJA 1TL1B 4J9RA 2AJQA 5J2PB 4DSKA 5FRNA 3HVTB 3G0ZA 2RKIA 5JS1A 3T5HA 3V4IB 5KGWA 4C8NA 3IS9B 1JLQB 3NF9A 3KIOA 3MEDB 1S97A 1ZYQA 4MK8A 1HYZA 5CY4A 3KMSA 5T14A 1RT1B 3SZ2A 1RCHA 3QERA 3L3VA 3V6JA 2IOCA 2RPIA 3BDPA 2PYLA 1XR6A 4CHZA 1TL1A 4F3TA 2FVCA 4DTSA 3RAXA 3E01A 4PUOA 3WNHA 4ZTJA 1VSKA 1X9WA 3ZT0A 2BE2B 1IO2A 3DLEB 4ICLA 1GOAA 1RT4A 2OZSA 2F96A 5CZ1A 1RNHA 1BQNA 3DLHA 1T7PA 2P5GA 4F4ZA 1XR5A 4BE0A 2GIQA 5HRSA 1DTQA 4I9QA 2HB5A 5KG0A 3NGDA 1RILA 1FXXA 1N56A 2ZQBA 2UVRA 4J2EA 3RAQA 4CJTA 4W5RA 2KFNA 3NGZA 1TKXA 1EX4A 4KTWA 5DG8A 4W5NA 4ECSA 1TAQA 4CJ4A 1C1BB 1SKWA 1S1UB 4NYFA 2DY4A 3ASMA 4MQ3A 4IDKB 1VSEA 3LDSA 4PWDA 1EETA 2OPRB 4N47A 4B9LA 1C0MA 3AA4A 3HP9A 3SV4A 2V9WA 3KLIB 4B9TA 4PA1A 4Z4EA 1KSPA 2HNDB 2AX1A 1NKBA 5FRMA 3E01B 1GX5A 2DPJA 2WOMB 4O4GB 1CSJA 2V4QA 3GIJA 2R8IA 1QSLA 1CZBA 1UWBB 3TI0A 3DLEA 1IH7A 2B5JB 4CECA 2IM0A 2OA8A 2R8HA 4EZ9A 3AVJA 4LH4A 3TQ1A 5KG7A 1D1UA 3RMCA 5C24B 2G8HA 3V6DB 5F8IA 3LP0A 1S1TB 5KFTA 1J53A 1HQEA 1RT5A 4FM1A 1JLCA 5J1EA 1BI4A 1JIHA 4KHYA 3Q8PB 3CQ8A 3AVLA 4FJ5A 1RTDA 1NOZA 3GIMA 2P51A 4CFCA 3TVKA 4AHUA 4E7LA 2GBZA 3SPYA 4DFMA 4MKBA 3G6YA 4CJQA 5F9NA 4QWEA 4R0EA 2XI3A 3UR0A 1C0UB 4Q5VA 5E41A 1DTQB 2XY7A 1N6QA 1JLAA 3QGIA 3NBPB 3HVAA 4QWBA 4Q44A 1EP4A 1YVUA 2GUIA 4I2PB 4URSA 4ZPDA 3F73A 1JLEB 3CJ3A 4TN2A 2G8WA 5EWFA 5KT3A 4KSEB 4ED0A 4KI6A 3MEGB 3M8SA 4O3RA 3H4BA 3WNGA 2I1RA 5HBMA 1L3TA 3NGIA 4Z4HA 4O3SA 4O4RA 4BDPA 1FK9A 4NLXA 4AHTA 4J9LA 2AGOA 5D3GA 3KKSA 4MH8A 3LP1A 3H5SA 3OYHA 5KFAA 2D0BA 2W7OA 3V6KA 4E7HA 1X9SA 4B3OA 1BIZA 3K57A 4KTQA 3ZSZA 4FLUA 3CFOA 1WNSA 3QEXA 4TY8A 3CJ0A 3MXJA 4DF4A 3MR5A 4O55A 2HWHA 3M8PA 3ALYA 4CIEA 3BGRB 3KLGB 4OLBA 4WZQA 1S10A 2AQ4A 1XR7A 4IFYB 2C28A 5KG5A 1NJYA 4O0IA 2QKKA 4E7KA 1KLMA 1TVRA 5KFFA 1NK7A 4FCYA 3IRXA 4O3PA 1S9FA 5F8NA 4CEOA 3IGNA 4QOZB 5KFHA 2XCPA 4JRPA 4OPKA 3VQEA 3OYMA 2E9TA 3H4DA 3FFIB 1WSEA 3O4NA 4DL2A 3OY9A 4E7IA 5KFPA 5KFRA 3QIOA 3AA2A 4LH5A 1VRTA 4DS5A 2WONA 4PY5A 3MECB 1JL2A 3KD1E 3LPTA 3CJ5A 4MK7A 3HK2A 4QWAA 3S3MA 3GV8B 3K5LA 5L9XA 1S1VB 5L1IA 4F3OA 2W7PA 4J2DA 4LSNA 1NNDA 2XGPA 3BQ0A 4ED8A 4ZHRA 4B9NA 3VQ4A 3EPIA 2EC0A 5J1EB 1S1WB 3VQQA 1LW2B 3KJVA 3KLFA 4QWDA 2JC0A 4DTRA 1N5YB 3DI6B 3ZT1A 5C25A 3PHEA 4NLYA 4RUCA 3LP0B 4Z4GA 3AO2A 4K4VA 1BCOA 1TKDA 1HNIB 3NGYA 4CEFA 3H08A 2FC0A 3PO5A 1C6VA 3ZT2A 4J2BA 1VSIA 5DG7A 4FLWA 2D3UA 2QXFA 1JXLA 3ZT4A 1S1WA 4WFYA 3C94A 1S49A 2D41A 3AVMA 5C25B 2G8IA 1RTHB 4RU9A 3QEIA 2JEJA 4O3NA 3KLFB 1Q9XA 2HVHA 3LP2A 3AVNA 5EUHA 5KFCA 2R2RA 4TY9A 1W9HA 2W9CB 4CGGA 1RTIB 4FLVA 1NK0A 5SZTA 3OYBA 4CEQA 5KFUA 4CF8A 2XGQA 3NAIA 2G8UA 2FLLA 1LWFB 1WSIA 1IG9A 4IR9A 4CJKA 3S3NA 3QNNA 3RR7A 2W42A 1RT7A 2IA6A 4DSIA 1KFDA 3NCIA 1KVAA 1A5XA 4OKEA 4CHQA 3IG1B 4URGA 4W5QA 4IFVA 3FFIA 3F9KA 3PO4A 3SNNA 4FJHA 4E19A 4MFBB 3PJXA 4DG1B 2X6SA 4KB1A 4IFYA 3QO9B 4PUOB 3CDWA 5KGXA 3KK2A 1T05B 1HYVA 5HRRA 4DU1A 1IKYA 4DL6A 3DM2A 1N5YA 3H2LA 3RBEA 4ZVFA 4Y2AA 1D9DA 2JLEA 3CJ4A 3TWHA 4FZYA 1DTTA 4IFVB 1NKEA 1RTJB 2OPPB 5J2PA 1NK9A 4NZ0A 3CFPA 4K4SA 5F8MA 1IKWA 3AVHA 3M8PB 3Q8QB 3IS9A 2FJXA 3C6TB 4DQIA 5KFQA 1FKPB 1RT1A 5KG6A 3SJJA 4KKOB 3BR9A 1TKTB 1ITGA 4OPJA 4R5PA 2VA2A 1WSFA 5DMRA 1S1VA 1WN7A 4M94A 4U6PA 3ITHA 4NLOA 3V6HA 3B6PA 4DL4A 4I7FA 4E1MA 2BDPA 1UWBA 4F2RA 3OS2A 3QZ8A 4H4OB 2YNGA 5CYQB 3TR8A 4CEZA 4RNNA 2XO7A 3RMBA 3KNAA 4KO0A 4FW2A 2DFHA 3MTKA 1B9DA 3PX0A 4FJMA 4IH7A 1U4BA 2BE2A 2W9AA 4FBUA 3AVGA 4TYAA 4CGHA 1OS5A 1XWLA 3QEPA 4NLPA 3MXMA 3OLBA 1JLAB 3CJ2A 4JUZA 2BR0A 4NLRA 4X2BA 3DLBA 4IG0B 4GC7A 1IKXB 3RBDA 4RW4B 2R2SA 1Y97A 5C42A 2ILZA 5L1KA 2HHUA 1LWEB 3HL8A 4MK9A 3VN5A 2HHXA 3LANA 4K8ZA 4CHYA 4YNQA 3TANA 1RA6A 4FM2A 3MFIA 1RT5B 4DLEA 3SI6A 3HO1A 2F8TA 2HNYA 3QINA 1J5OA 3NFAA 2FVQA 3B6OA 1WSJA 3H5YA 4NYNA 1SKRA 2DTUA 4OL8A 3RR8A 4DFPA 4O3OA 3KKRA 1SH0A 1D9FA 4CJUA 3KHRA 4HCCA 3HPOA 1DTTB 4Y1DA 4DS4A 4RW9A 1RBTA 4WE1A 2IGIA 4CGIA 2ITGA 1QS4A 2OPRA 2YKNA 3MFHA 3QLHB 2FVRA 2VG5A 4FLTA 5C24A 4JS5A 4QPXA 2FBVA 3NBPA 1S9EB 4DTJA 4CESA 4RW7B 2W8KA 1RT6A 4FXDA 4N76A 1HPZB 4ECZA 4J2AA 1IKVB 2UVVA 3CM5A 3A2FA 4CGFA 4CJSA 1ASVA 1LWEA 3CDUA 2UVWA 4FJLA 3CIZA 4QCLA 3SFGA 4KHNA 3ZSWA 2ZKUA 1NK5A 2NUBA 5SWMA 1NHUA 1BIUA 1RTJA 4QAGA 3QETA 3H5UA 5KTQA 3MR2A 5KFGA 4G3IA 4DFKA 3KLHA 1LAWA 1BQMA 1HQUB 1RYRA 4NLQA 2Y1IA 4O3QA 4M3TA 3Q8RB 4ICLB 4J9QA 1ZBFA 3L8BA 3KMQA 4CJLA 4L8RB 2XY8A 4J9KA 3O4QA 3IG1A 4EYIB 3CG7A 4CJPA 3DYAA 4GMJB 3D5MA 2YNFA 4ZPAA 2ZE2A 1T94A 4N5SA 4NLGA 3THVA 3KHLA 2BANA 2B43A 2JEFA 5I42B 3HHKA 5FROA 2IC3B 2XRIA 1SH2A 3MEGA 1BISA 3ULDA 1SV5A 5KG3A 4F4WA 1RYSA 5CYQA 3IRXB 2QK9A 3HKWA 3K2PA 4KFBB 4TSXA 4Q45A 2FVPA 3SUPA 4ECTA 1S0OA 1JLCB 4JV1A 3OJUA 4N41A 2PZSA 3JYTA 4KHWA 2ZD1B 3ZSOA 4KHQA 3C6UA 1HPZA 3BGRA 3KLGA 3PR4A 5EDWA 1JLQA 3M9OB 4CCHA 4KKOA 1RBUA 4MIAA 1TK5A 4Y3CA 3KLEB 3LALA 4KPYA 3DRPA 2HMIB 2V4RA 3T1AA 1S0NA 2LSNA 1JLGB 3SFUA 4FYDA 4I2PA 4CEDA 1ZTTA 4RW8A 3U6FA 1TV6A 5KT2A 2ASLA 4FJXA 4YP3A 1SL0A 3KK3A 4RZRA 4KO0B 3SUOA 4ECQA 2EHGA 2R2TA 3AA3A 4BWJA 1Z25A 1U09A 4YR2A 3I0SB 4FJ8A 3PJWA 2IJNA 1RTIA 4CHOA 4ED6A 4DL5A 2YHBA 2RF2B 4KI4A 4KE5A 1JX4A 3G10A 4O5BA 3TARA 1JXEA 2HNZB 3NKYA 4YR3A 1YTUA 3OYAA 4FJGA 4IQXA 2ATLA 2YNIA 2WONB 5DLGA 1FKOA 1GOBA 1YVFA 1S6PB 4NRUA 3IN5A 4W5OA 2JC1A 5CYMB 4YR0A 2OPSB 3TAMB 4CGJA 5KFXA 3C95A 5DLFA 3QZ7A 5KFOA 3VQ7A 3OL6A 2W9BB 3OS0A 3SCXA 1ZBIA 4TQRA 4J9PA 2UUTA 3DRSA 2VG6B 5DQHA 4KTZA 4OVLA 2R8GA 4CFDA 3VQAA 4OGCA 3L2WA 4Q43A 2WRMA 3CFRA 2IM1A 2DFFA 3DLRA 1S1UA 3BQ2A 1BL3A 1K6YA 1HNIA 1UA1A 4IG3B 2YKMB 4K4ZA 3DRSB 3QIDA 3QGHA 4DMNA 3PW2A 1QSYA 1VRUA 1QE1A 5DGAA 3NDKA 2D3ZA 1CXQA 3EYZA 4H8KA 4ZHRB 4TLRA 1VK0A 5J2MB 1A5WA 4E7JA 4NYZA 2B6AB 1RA7A 2JEGA 3MXIA 4M3WA 4CF0A 3OYJA 4K50A 5CZ2A 3SQ2A 3EZ5A 2XI2A 3CVKA 4BDZA 4FLZA 3M8RA 3SUQA 4CEBA 1EKEA 4CF2A 2BANB 4ID1A 1TL3B 3I8DA 2R8JA 1CXUA 3DYAB 4B9UA 4RW6A 4Z4FA 3I0RA 2VG7B 4IH6A 3AVFA 4CEEA 3OL8A 3PX6A 3JSMB 4OLAA 4NCGA 3MEEA 4ZVHA 5F8GA 4K4XA 3IGVA 3GYNA 4Q8FA 4LQ9A 1TK0A 3RB0A 4HUGA 3P1GA 4CJEA 1DLOB 2UUWA 4M3YA 1SKSA 5FDLB 3LZIA 3L2UA 1NJZA 4C8OA 3RMAA 3G6XA 1GOCA 3M8QA 1C1AA 3OL7A 4BWMA 4OKKA 2HHTA 2ZD1A 3DOLA 3MR3A 3V1RA 1EXQA 4HTUA 4ELUA 4FM0A 2AGQA 4IKFA 1JL1A 3O3FA 3SPZA 3TAFA 1REVB 4DWIA 1K1QA 3C6UB 4CHPA 2Z1GA 5F8JA 2FJWA 4HVJA 1TAUA 3GILA 4E89A 3RB3A 3H5XA 4DTMA 3RRHA 4IDKA 4EO6A 4FJNA 3TAEA 4J9OA 1KHWA 4CK3A 4JS4A 5KFIA 3PUFA 4QW8A 1RDBA 2WTFA 3VQBA 2ATQA 1KHVA 3DDKA 3SQ4A 2WHOA 1BI4B 4WZMA 1HJRA 2R2UA 2BQRA 3S9HA 4CJFA 1S48A 1NK6A 3LAKA 4C8KA 2B5JA 1I6JA 2W8LA 4HKQA 1KCFA 4RNFA 4K4UA 4FZXC 4H4OA 1T03A 3L2RA 1RDDA 3HVWA 5DGBA 3VQDA 4ELTA 3DOLB 4MFBA 2RN2A 1J5OB 1VSDA 4GW6A 1IM4A 1JLEA 1NOYA 3I0RB 2QV6A 3FDSA 2OYQA 3Q8SB 3NH1A 4FBTA 1QQCA 1KRPA 2C22A 2P5OA 1W25A 2CJQA 3RRGA 2XWYA 4C8MA 2RF2A 1O1WA 1HARA 4IRCA 4F2SA 1VSHA 4TYBA 3VQ8A 2ASDA 4DTUA 1KLNA 4EBEA 4H4MA 4TQSA 1MU2A 3NE6A 4HCBA 4FJ7A 3AVBA 4IG0A 2KZZA 4AH9A 4HUFA 3CWJA 2E6LA 1XI1A 4MIBA 4ZP7A 1W0HA 3AVIA 5J2NA 5KT5A 3MAQA 1TP7A 3KHGA 3QESA 5F9LA 2VG5B 2PY5A 3T3FA 4ZPCA 2OPQB 4WXWA 3K5OA 3CYMA 2Q3SA 1CZ9A 1XHXA 3LWLA 2FLNA 4WYLA 5KI6A 2OZMA 3I5CA 4Y1CA 1JKHA 5KFNA 5J2NB 3AO5A 3DLGA 1A5VA 3BQ1A 2HHSA 3TABA 4RW4A 4PWDB 1FKPA 1TVRB 2VWJA 4RUAA 3PVXA 2C2EA 4GC6A 4TY8B 4ZVGA 1TL3A 4Q8EA 4R5PB 4KFBA 1N6QB 1R0AB 4LD0A 5KFJA 1WSHA 4YMEA 3GV5B 1KFSA 3RWUA 2HNZA 5JXSA 3N6MA 2DPIA 3OSNA 3JYTB 5KFBA 2HAIA 4E0DA 3VA0A 3HPGA 4Z0UA 3KLVA 2CKWA 3H98A 1JKHB 1BQNB 1QSSA 4FZZA 4CHNA 3GIKA 1JLGA 4QW9A 1C2PA 3BSCA 4I7FB 3O3GA 1MMLA 3EY1A 2A1SA 4AHSA 5I42A 1CLQA 3OYEA 3PY8A 4NRTA 1S9GA 3RB6A 1EP4B 2YNGB 3NH0A 4CF9A 3EZUA 3S3OA 1HYSB 4KRFA 1BCMA 4CE9A 3PR5B 3KLEA 4DTOA 1LW2A 5HROA 4TXSA 1RBRA 5CYMA 1JLFA 3VQSA 1HMVB 4FS1A 2Y1JA 3U3YA 1R0AA 2EX3A 2FBYA 3TAQA 2W9CA 3H40A 2BRKA 1Z26A 2Z1JA 4WFXA 3HVTA 2HNYB 1T3NA 4EP5A 4JV0A 5D3GB 3CM6A 4HHTA 1WAFA 1C1BA 3DLGB 2YNIB 2J6TA 1VRTB 3V6DA 3DLKB 3PV8A 2IAJB 1TKZB 3NF8A 4M95A
chains in the Genus database with same CATH superfamily
3R2DJ 3N0VA 3WNFA 3H59A 2R42A 1OY6A 4OZ1A 2IJFA 2PFFB 1RBAA 2G8KA 4H54A 4X84A 5AQZA 4B3SK 2AW0A 2OD4A 5KFVA 2P9NA 2AYGA 3VF6A 2IRXA 5AQXA 3EVWA 2ACMA 3WHIA 2QWPA 1RWOB 4GVBB 2MHEA 1RDRA 1X4CA 4KGXB 2GHWA 4NLVA 2V50A 5AQVA 4ER8A 2DYAA 1KAZA 1VOMA 4CRJA 4JI2J 4PPDA 2G2ZA 2D1CA 3OUYB 3FZHA 4RWXA 4I2QB 2Q6BA 2W6LA 4UQTA 2HVZA 4M3ZA 4JKHA 4DN9A 1K8AO 4DQRA 4M5IA 1S1TA 4IQMA 1A9NB 3AJ2A 5L8RC 1Q5YA 4DPUA 4CIGA 2QYGA 4JI7K 1QY7A 3ZSVA 4DCJB 3THWA 2HHVA 3R5DA 5DDPC 4K4TA 2QYCA 2MTLA 4WE1B 4DQQA 2A5XA 3FRYA 1FEHA 4KB0A 4HT5A 5F0UA 2DNOA 3OFGA 3IM9A 7AT1B 4KHSA 1V5IB 1ZAVA 3JAMU 1NMNA 5LMUK 1PSDA 2M52A 4I6MA 2CQPA 1WG5A 3OV7A 2UUAK 4JI0J 3W9IA 3WT0A 2IVPA 4CK2A 4KHRA 3HM9A 1J6ZA 1U04A 2FGOA 4XTTA 2ALZA 2EFNA 4EBCA 2DH8A 4FK2A 1PIEA 1VCTA 1UVJA 4LY7A 4LFAF 2ZBRA 5EWEA 2VODA 3P8BB 3SSRA 4ID8A 1ZAXA 3POTA 1PGZA 3F41A 1YK9A 1X4DA 2A3ZA 3TA2A 2N4CA 3IFEA 3QO9A 2YVSA 3TVYA 3MM5A 3ISND 2RH3A 3PX4A 2YQ3A 3PG9A 3LL3A 2FIUA 2AWZA 2I9SA 1YJ7A 3E8OA 3FRZA 2AX0A 2H48B 2YNFB 2YWKA 2VJVA 4LF5J 2FZCB 3V81B 1XNRJ 4LF5K 2RKIB 3VQTA 3V4MA 3RMDA 4WU2A 3PZPA 1RBSA 1VQ7S 4Y6IA 1O8BA 4EUVA 2B4OA 4DV1F 3FBEA 1DGKN 3I56N 2P9SA 3HHDA 1LOTB 3QGGA 1F2HA 5IOLA 1HNXJ 1LFWA 2EVZA 1NGJA 2ASPA 3HTVA 5IT0A 1H2VZ 4DV6K 3FSYA 4DLGA 2J0QD 2KT2A 3V81A 2HVDA 3QEWA 3CC7N 5GAHI 2E29A 2OGUA 3SQGA 4IO9L 1IG8A 5K5MA 5D4OA 3GLJA 3UKUB 5TKWA 1SV5B 2LFVA 4K2JA 2GAHC 4V19S 2OUGA 1L3KA 4LRDA 2HVEA 3BSOA 4B1ZA 3L95X 1C4CA 2CG4A 3P5JA 3FZLA 1IQZA 4KBIA 4F0MA 3QSYB 4JI2F 3F0NA 4CZMA 1JJCB 1WHVA 4BC4A 1S1XB 4BE1A 3GBTA 4WTOB 1RT2A 2COLA 5HRNA 2WCXA 4JI5K 1KVBA 1NK8A 2KHOA 3PYEA 1GEHA 1K73O 3BF3A 1HR0F 2LA6A 3AVKA 1WI8A 4N77A 3WQUA 3O9UA 1J27A 4GVEA 3SUNA 1IKVA 4A57A 3FGUA 2XMWA 4FWOA 1UFKA 2V8PA 3TVZA 4F4YA 1RAJA 2YHAA 2LXFA 2IVFB 2VBYA 1VSLA 1IR1A 5KT6A 4B3RJ 3HSTB 1HQEB 1HIYA 3UE2A 4CEAA 4YOUA 1X9MA 3UKUA 2O4IA 4BDYA 4KPCA 4EEYA 4FVMA 4OYPA 4XDCA 3D54A 3ID6A 4NXNK 2D0AA 3MMBA 2B9XA 3W64A 1WAJA 3FMBA 2V5HG 1TKXB 2CZVC 2M5YA 1HBMB 2GIRA 2FJEB 4CZGA 5L1JA 3KNGA 3B78A 2HHWA 4KHMA 2E2OA 2DEJA 4OI6A 4AHVA 3EKSA 3OTOK 1N88A 3FZBA 2JWKA 4HDGA 2LXIA 2F8EX 4WFNQ 4BRNA 1UTAA 3DOMA 2PYJA 1VI7A 1KVIA 1FX2A 2RDDA 2DNMA 1S0MA 3GE1A 1RJJA 1Q53A 4IH5A 1RWXB 2HLTA 4M1KA 3ZTPA 4ZTFA 3ZXWA 4JKGA 2UV8A 3A8KA 1T03B 3VAKA 3RZAA 5LM7E 5KOWA 4FS2A 3O80A 1DLOA 1NGCA 3GZ7A 2OH2A 4B08A 3TTDA 2JVRA 1VQ4N 3OBIA 1Y7PA 3MOJB 5LMNK 1TELA 1DQAA 2DITA 3DOKA 2DNZA 5KFEA 1FT8A 5AZIA 3HP6A 5DK5A 3HKZD 2FVSA 3KWGA 3V9XA 3KHHA 2E6MA 3BKUA 4HUEA 2ZDOA 3L3UA 2HQIA 1C0GA 2OPSA 4CJWA 3RTVA 2DHXA 1RDUA 2RE1A 3GSDA 2XM3A 2VQEJ 4B3OB 2FSNA 2FJVA 1JLBB 2PT0A 2J5AA 3OHAA 1DEJA 3QLHA 2EW9A 3I9ZA 4M3UA 1MWZA 3D6TB 3L4IA 2N3OA 1OSDA 1I5OB 3AOAA 3NXZA 1LWCB 2E5GA 2R7UA 2CQ4A 2J76E 3VQ6A 5HP1A 3HT3A 3K0SA 2E9ZA 2CQBA 4OYXA 4OZNA 4GVLA 3HSZA 3D2EA 1URNA 1NKCA 1WSRA 4URQU 4NCAA 2ZE2B 3ENBA 4AUKA 1DHMA 2JJ4D 5HI7A 1LWCA 2KZMA 2HHHF 3DC2A 2Z2LA 4NEYA 3T5KA 5GVQA 5I3UB 2YNHB 4B3TK 4Q0BB 2X78A 1U45A 3V1QA 1QVGR 4I6WA 3BGUA 2XY6A 4FJKA 4AILC 4ID5A 2IBOA 3R5JB 4LQ3A 2RAQA 2DGXA 4LSLB 1HKCA 4CD1A 1CQNA 2UXBJ 3ZETB 3A8IA 2IC3A 1KBRA 4CJVA 3DWLA 4WFAL 4IJAA 2PFDA 3T5JA 3L2QA 4H5WA 1VIXA 3TUPA 4ZIVA 4OYAA 1UVNA 2M9KA 3H45C 2MQOA 8RUCA 2ZM6J 3TA1A 3NHGA 1CZAN 1KOOA 4WK1A 3DI6A 3BR8A 3I5BA 4LVNP 3C14B 3OXFA 3T19A 1HKBA 2CRLA 4LRBA 3W3SA 2BRLA 4J9NA 4FJ9A 2HBRB 3GG1A 3WXIA 3HSDA 2HKEA 2QSFA 4ZCKA 3GJRB 2ALYB 2P6TA 2QZ8A 4N56A 3OJSA 5GADP 4BHQA 2G9OA 5K8MA 3MX5A 3DRRA 1YZ7A 2DHSA 3TRGA 1MSWD 1BA1A 4Y2KA 1C0UA 1UZDA 1NAQA 1N34F 2RU9A 2N7YA 2QL9B 3DGPB 4X4UA 4Y34A 3MPVA 3DJCA 2ZWPA 3TSPA 3G4SN 1WI6A 4PQUA 2V6AA 4CJ5A 3KK2B 1ZETA 1QTMA 4KV8B 2VPWB 1VQMN 4CM2A 5EWGA 1QDUB 1VRUB 1VQ6S 1YTAA 5ITHA 3GV7B 4FLXA 4X65K 5MAOA 5F8LA 1X1PA 4KH6A 3J7YU 4DV4F 5AQUA 3ZNUA 1F21A 4PXBA 3BBBA 2P2CB 1VSFA 4Y28C 4ZCLA 2LECA 4PG6A 3E1YA 1XHZA 2RDJA 4QYZJ 2NXNA 3C16A 4R25A 2J0SD 1TUWA 1K73T 4OPAA 3HVTB 3G0ZA 3T5HA 2I7NA 3IMXA 3IS9B 4YHHF 3KIOA 3OUYA 3CCRS 1NEEA 1U6BA 2B0GA 4MK8A 1HYZA 3DAWA 1RT1B 4DV4K 2DXEA 5D0EA 3DLLQ 3F44A 4CHZA 2NCKL 1IJFB 3GJTB 3AQOA 1X4HA 3RAXA 1TU0B 2J7WA 1Y64A 2MSSA 5CD4A 3P5TL 2GEMA 3RRKA 4ICLA 4J8FA 2F96A 5BRHA 1RNHA 1Q8BA 1IBLF 2GIQA 4DV1K 4H5TA 2HB5A 4JI3F 3O9TA 3Q8YA 1M1KO 2GQCA 4W5RA 3NGZA 3P96A 1WWHA 3QFHA 4W5NA 1Q7YO 1C1BB 1KNZA 1S1UB 4NYFA 1IBMK 2G2YA 2MGZA 2W4DA 2VC1A 3KLIB 3D0HE 1KSPA 4YOVA 4MYUA 1UFWA 4RWWA 1KAXA 5FRMA 4IOAL 1GX5A 1N33F 1T9TA 1CSJA 2XBPA 3UB5A 2F8HA 2R8IA 5LSLA 1QSLA 2UUCK 3UNYA 4CLLA 2IA0A 4DMZA 3DLEA 1IH7A 2CNKB 1JNZB 2B5JB 2VD3A 3KJNB 2OA8A 2R8HA 4DDFA 3BBFA 3GIRA 3WX4A 2ZC4A 3AVJA 5KG7A 2G8HA 1MN9A 1XEZA 2W2PP 4DCPB 4RJVA 4GV6A 3L09A 3BB5A 2BW7A 5KFTA 1J53A 3RJMB 1HQEA 3BV8A 1RT5A 2ZFHA 4YOTA 2CDRB 5J1EA 2XULA 3MCMA 3MM6B 1RTDA 2KO1A 1KTVA 2P51A 3TVKA 1K0TA 4AHUA 2AMCB 1RAAB 4JKFA 3G6YA 4CJQA 3OT9A 2IYGA 2XI3A 2KVQE 2UYTA 1QQMA 1C0UB 4IEEA 5J1NA 5LMNJ 4JAXA 1LFPA 5BR9A 3NBPB 3HVAA 3LM2A 1O13A 1YVUA 4I2PB 5IQQA 4URSA 2C2ZB 4ED0A 3MEGB 4O3RA 2MMYA 4JI5F 3L0QA 4C0HA 4TKTA 4GRSA 1MMDA 4Z4HA 3R6LB 3CD7A 4CLPA 3CPWM 1X60A 2G0JA 4ZVTB 2GNKA 1R7IA 3JQJA 3MCOA 1X9SA 4H4KA 2P5VA 1XMQJ 3W9HA 1RSCA 4I1TA 4OFZA 1A6LA 4A59A 4OLBA 4U8VA 1RK8A 5KPTA 3CQYA 2AQ4A 5FPDA 4DV5K 5KG5A 1SS6A 4WIQA 3CE8A 4O0IA 2P9LB 2JFKA 4JI3K 4B1YB 3MI7X 2B9YA 2BM0A 4K0KJ 4CEOA 2AYMA 2XCPA 2K06A 2E5LK 3VQEA 2OMOA 3CCLN 2E9TA 5I9EB 3H4DA 2CQGA 1WSEA 3FFKB 4LFBF 3D4JA 1VRTA 2WONA 5ETQA 4KGKA 1X4GA 5DZ7A 1XQIA 3UKRB 4P72A 2W7PA 1F9FA 4J7CA 3CJ7A 4LSNA 3BQ0A 4ED8A 3CCVS 1CJTA 4GKJF 4B9NA 3EPIA 1Q95G 3UWTA 1RGIA 4CO1A 3UVJA 3KWMA 2ZM6F 3QT7A 3ZT1A 4I68A 1YJWS 1ATSA 2MB0B 1TKDA 3NGYA 1S59A 4DV1J 4LF7J 3QT5A 3PO5A 1C6VA 1VSIA 5ETVA 1S7HA 3EDQB 2RVJA 3CCJN 5DM7L 2QXFA 3OD2A 1VAZA 2AF6A 2HFSA 3MN5A 4JI8K 2D41A 3I33A 2ZHBA 1BXNA 2JEJA 3J80U 2CNLB 3EE3A 2E2NA 2HVHA 3LP2A 1OH6A 1D9AA 1WHYA 2PA8D 3E3XA 1BDGA 3P3DA 4WWSA 2OMLA 4CGGA 3VZHA 4A5AA 4ILHA 3OTBA 3GWCA 2ZM6K 1KOHA 3FVYA 1ULRA 4A4JA 3CCMS 2J8AA 5GAGI 4M7XA 4DXLA 2G8UA 1LWFB 1SC6A 3IMQJ 1FERA 2NRRA 1N5SA 3CTRA 2IA6A 4K41A 5CZVA 4HTLA 4DCOB 4M5JA 3I96A 5ETLA 4FJHA 2AZ3A 3R27A 3PJXA 4OX8A 2X6SA 4RKUC 1X4BA 3QO9B 4E2FB 1WACA 1T05B 2O67A 1HYVA 2X7IA 4A47A 2FHKA 3MR7A 2DO4A 5EVZA 2CDQA 4EHTA 2DY9A 4ZVFA 1D9DA 1B0VA 4CLSA 5J2PA 3HOTA 2BOAA 4LFAJ 4K4SA 1TTHB 5F8MA 3G82A 5H1SQ 5GAEU 5M2UA 4BLGA 3Q8QB 2FJXA 2XMTA 3QJPA 5DO2A 1FVSA 3BR9A 1TKTB 2CAJA 3K2YA 4M94A 4A5BA 2H3EB 1QZ6A 1J5EJ 1X5OA 4WCEQ 2BDPA 3GDQA 2RNEA 4WF9Q 2E20A 3MZIA 2M3DA 4CO3A 4K43A 2CQ2A 3W5XA 2CJKA 1MW7A 3QZ8A 2YJFA 3OR2A 5CYQB 4CEZA 3B8HA 1CEZA 3KNAA 2BE2A 4CGHA 1OS5A 1XWLA 2G13A 3QEPA 3MXMA 2BM1A 2XS5A 3CJ2A 3JXUA 4JUZA 4KH0B 4NLRA 4X2BA 3T1YF 1X5TA 5KQ8A 3T1YK 2XYHB 4PKDB 3VHQA 2BV3A 3RUBL 2D74B 3HL8A 3MN9A 3LANA 5C7PA 1T6CA 4YNQA 1RA6A 3UN2A 3MFIA 4YDDB 4DLEA 5CA5A 3SI6A 3HO1A 3BP8A 1WSJA 3MHYA 2DTUA 2B4VA 3PEHA 3CJKA 4OL8A 4DFPA 1CJVB 2GW8A 3WQPA 1FFSB 4YDUA 4BBYA 2CG8A 4CJUA 4HDHA 4CGIA 2VG5A 1IUJA 1YJRA 3H20A 2CQCA 4ZLJA 2KHDA 4CESA 4ZDNA 4RW7B 2UXBF 4N76A 5D4LA 4J2AA 2DRDA 3VEYA 1IKVB 1NU4A 1UEKA 2JNJA 1MA9B 4CGFA 4BR9A 3PIOL 4ES1A 4OI4A 4X66F 1S3XA 3PKYA 1LWEA 2CIMA 3CIZA 4QCLA 4KHNA 3ZSWA 1VS3A 2DY1A 2XLIA 5B0AA 4FSVA 3H5UA 2Q43A 3OW2R 1HNXF 3EZWA 5KTQA 3MCNA 1FNOA 4G3IA 4DFKA 3PNIA 3Q0AA 5BN9A 2P6SA 4PWUA 1YTYA 2VDHA 2OIHA 4ICLB 5JLFA 1CJUB 3O4QA 4CJPA 3DYAA 4GMJB 3RBZA 2BEFA 2ZE2A 4NXNJ 3H2VE 2B56A 4QYRA 2F4VK 5HL7Q 5IFMA 2F65A 2IC3B 2XRIA 3MEGA 1BISA 3MN6A 1AYEA 5C2GA 1RYSA 2XB2D 2HGLA 3IRXB 4JI3J 4YN3B 3FBFA 3VEVA 1VJQA 2HSEB 2VBXA 4BRQA 4WQ4C 3C6HA 1QVFR 2NUUG 1JLCB 4N41A 2PZSA 2K3IA 2ZD1B 4NXMJ 1ZM2A 2MZ1A 4AF1A 1KDNA 2HQGA 4MIAA 3TJAA 1TK5A 1DBDA 2HHHK 3LALA 3CMES 2V4RA 3RW6A 3R3LA 1S0NA 3HHLD 2W24A 5AQIA 4RW8A 1Y5IB 5KT2A 1Y9OA 4QIEA 4CVNE 2R4FA 5CQGA 3Q22A 4RZRA 4KO0B 3NOGA 4F3MA 3SUOA 1JK9B 2OELA 3AA3A 1GLCG 4ED6A 2YHBA 2DH7A 3WC2A 5HK4A 3M1VA 1BLUA 1JXEA 3NKYA 3AA8A 3OR1B 4QYZK 1VQ5S 1VBYA 3LDPA 3LDQA 5K8PA 4IQXA 2WONB 1AA1B 1FKOA 5AQPA 4NRUA 5IV3A 4NXMK 2JC1A 3S1TA 1QQNA 1WC1A 2UXDF 1QHAA 5KFOA 3VQ7A 2W9BB 2KKZA 3IBFB 3SCXA 1ZBIA 3D2WA 2VG6B 3B4DA 2O8BB 4KTZA 4CFDA 3SMSA 3VQAA 2J9CA 2KJWA 4OHXA 4LT6A 4MDBA 3T1YJ 4O8KA 2HK3A 3THWB 3CFRA 2DFFA 1K6YA 1HNIA 3HJVA 4IG3B 4P2SA 1UWAA 1UPMB 3QIDA 1K9MO 3C66A 4DMNA 1WORA 2GMLA 4CZLA 5BREA 1UAWA 1QSYA 1QE1A 3G8QA 2ZHOA 4AT1B 4IOCQ 7FD1A 1VLOA 4ZHRB 3LDLA 1QAYA 5J2MB 3Q83A 5HJYA 3NGUA 1M5SA 1A5WA 1HWLA 1APSA 2DT9A 3D7EO 5D15A 4B3RF 2A41A 5CZ2A 3SQ2A 3CNQP 3CVKA 4FLZA 3M8RA 3ETOA 3T9NA 2GIFA 4CEBA 2BANB 1PBAA 4MLEA 1CXUA 4Z4FA 4IH6A 1T9XA 3AVFA 4CEEA 3OL8A 1NH7A 3JSMB 3KJQB 4NCGA 3MEEA 5F8GA 3S8SA 3IAM9 2HBQB 5B7WA 5FDLB 3LZIA 2QTWA 1LXNA 1NJZA 4MDAA 3ZTSA 1EQ0A 3BBCA 5BYSA 2OEJA 4B3TJ 4HTUA 4C97A 2O8EB 1X3NA 3SPZA 4CZIA 1REVB 5E33A 2V8GA 2OEKA 2L9WA 2B51A 2BE7D 3GILA 4C98A 3RRHA 3H5XA 2QA1A 4L74A 5HOOA 1M1HA 5HL7L 2ATQA 1S76D 4IWVA 1U2FA 3DDKA 1SQEA 4DKWA 2GQ2A 2WHOA 3NS5A 3CCUN 1HJRA 1UEUA 3Q23A 1K47A 3AGRA 3LAKA 4C8KA 2B5JA 5SUHA 5FPNA 2PO4A 3JSYA 2W8LA 4HKQA 1YZ6A 1U24A 4RNFA 1RDDA 3OPKA 2OP5A 4EK2A 4ELTA 4Y2MA 4USWA 4F7VA 1FA0A 4MFBA 1JLEA 3VEXA 5C2FA 3LUYA 4JYAJ 2CUYA 3Q8SB 5LXYA 2LDYA 3SQGB 1QQCA 2WUSA 1Q86O 2AJ2A 3M4XA 5HJXA 2PI4A 1J2VA 1VC6A 2IIHA 3RRGA 3FMWA 5AQRA 4DHYA 4QZVB 5BRFA 3M30A 2XSFA 3NCPA 4IRCA 4LFBJ 4LF6J 2QM1A 4OI3A 3KZBA 1TUUA 4LFBK 3KYLA 4EBEA 3GJSB 1NSPA 2J7KA 1MU2A 4JBCA 2CQIA 2VV5A 1HI0P 1VBXA 3VR1A 3O6QA 4HUFA 3NNAA 2E6LA 3W2WA 2VQFK 4RLEA 4LF4F 3BPSP 3MAQA 1VRQC 3QESA 5F9LA 1NGBA 4EAHD 2EK1A 2D69A 4ZPCA 3GYGA 2DGQA 4ZPTR 4WXWA 3K89A 4KGZB 1XHXA 3CC2S 1LWXA 1FESA 1F60B 3BF1A 2C3MA 1CJVA 4Y1CA 3EZOA 3BKFA 5KFNA 2XNQA 1YITN 2RT3A 2HHSA 4PG7A 2VQEK 4PWDB 1FKPA 1GTEA 2C2EA 4GC6A 1FJEB 4JHDB 2E5JA 3R9LA 4ZVRB 4ZVGA 2O1PA 2MHNA 2OSQA 4ITSA 4WU3A 1SQKA 4IOXA 3QICA 4JI8F 2YKAA 5FPMA 2DPIA 5GINA 4NA3A 3H98A 1JNRB 2ZH1A 2WVDA 3NG8A 1JKHB 1J5EF 1YF5L 2P9EA 3GIKA 1HBNA 3HI9A 4RPFA 1C2PA 4FYVB 3TYTA 4NZ6A 3CI5A 4CLTA 2C1EB 5ADZA 2A1SA 5B0DA 4H0YB 3PY8A 1S9GA 3NH0A 4CF9A 2XQCA 4P75A 2ZOGA 4DPWA 3BGLA 4A46A 2NXUA 4BGBA 1SKUB 4AYBD 1GAOA 1R8HA 1N5QA 3CCEN 2QI2A 4FS1A 2VFRA 3W5YA 2MLZA 2E2QA 1R0AA 2EX3A 4QU6A 1BY9A 3G82B 3CF5L 2BRKA 1VGYA 4DPOA 4WFXA 2LEAA 4HH1A 3HSJA 4CO4A 1VC0A 5D3GB 5E0OA 1R89A 1HL6A 4NWBA 4FWPA 4RCHA 3DLGB 2YNIB 4OJ1A 4HTIA 2QO3A 2HBJA 3V6DA 3PV8A 1IM6A 2XEXA 3NF8A 3J7Z5 1LOUA 3P31A 2GVDA 1SL1A 5KRSA 4UOFA 3TJ8A 1YHQN 4DSLA 1YRUA 5B0EA 2PEHA 3MOZA 3WXJA 3NWGA 4AL6A 4DG1A 4AM6A 3O3HA 1BGXT 2FPHX 4J9SA 3MWPA 1SIZA 3KK3B 2VFUA 3NL0A 3SCJE 3DM2B 1Q7YT 1HI1A 2AGPA 5A2QU 2UVUA 1K1SA 2LXUA 3DXSX 4FLYA 2CJBA 4IDHA 4BC2A 3M8ZA 1YKWA 4NXNF 2J6UA 5HO4A 4JI4F 1VIOA 3DGPA 4ZN3A 1PJ7A 2U2FA 2R9LA 3CERA 8AT1B 2DXFA 4ECYA 5GAGP 5L38A 1F6TA 4PQUB 4X4QA 3I56S 1OH5A 4XO0A 3DRRB 1HMVA 5IXUA 3QGPA 4KH1B 1FFWB 3NGRA 3W5ZA 1YI2S 3HXMA 4O44A 2Y8YA 5DM7Q 3A13A 4ERDA 1FFGB 5CXTA 4NLWA 3HFZB 3WX8A 2ILYA 4LF9F 5EU7A 5KFDA 4EGLA 5IV4A 3KG1A 4IEIA 3RYLA 4DBQA 1S0VA 4ECVA 4LR7A 1S4EA 1NK4A 2NLXA 4DPYA 3D6FB 1TK8A 3LDNA 4BE2A 4GKKF 2VKZG 3VALA 3ZT3A 2L3MA 4HR2A 4BGAA 4X62F 2VG6A 2NNWA 2O8BA 2WSCC 4ID5B 5H1SV 3MUMP 1YVNA 1KKHA 2KKHA 4CZCA 3I6PA 3CD6S 2CWXA 2A2CA 3KJVB 3R1XA 4M45A 4CZKA 2VQFJ 1HRHA 5KT7A 4IRKA 3MN7A 2V4JB 3I4HX 2FZGB 1VSMA 3PRDA 3PW7A 4X4TA 1KXPA 1SUQA 3BGFA 2KW4A 4V1Ak 3FEZA 3SIPB 4RW7A 3DLLL 1HYSA 4OX7A 4WXOA 1Q78A 1ZM4A 4F4AA 4DQSA 3PKMA 2ASMA 3EVMA 3OYLA 2Z56B 4PRFA 4USIA 5F3TA 4CFAA 4FK4A 5GAGU 3R2CJ 4LBHA 4U7CA 1D5AA 4WFBL 1FDAA 4BR2A 1C0TA 2GC8A 1AZSA 2V63A 4A8MP 4FF2A 1M5PC 3S6EA 3JSMA 3NNHA 3ITHB 2O3DA 2ZOFA 5JS2A 3TWZA 2R7WA 1TKZA 4DUYJ 2A6OA 3B4MA 3IBCB 1IBMJ 1GMWD 5HMWA 4PEOA 3BJYA 3UVJB 4O23A 4C11A 4WFBQ 3GFZA 3ZYYX 2KT5A 2HFUA 1D8YA 4ED3A 1LEOA 4JV2A 3C16B 1VBZA 1CJTB 2GWKA 5F0WA 2J9EA 1KQSM 3PRBA 2YWWA 1RBVA 1RDCA 3HI0A 5AZJA 2BBEA 3CDEA 3M9NB 4DSFA 4IO8A 2CPHA 3O3LA 1U48A 2IY5B 3L7UA 1V3RA 2C2NA 3E51A 1ZM9A 4ZPBA 2L41A 1AB8A 2RHSB 2HLUA 1FRJA 1VHIA 4ECUA 4ISFA 5IWAJ 2V9KA 3TZWA 4YHHK 1LW0A 2A6MA 3CO9A 1FK9B 2P1JA 3NS7B 5HMZA 4DV7K 4EO8A 3A3NB 4HYKA 4ATNA 1IBLK 1SAZA 4GMKA 5HBMB 1BHNA 4ZVQB 2V8DA 3N6NA 1L5UA 2RIJA 1EETB 1TL7A 4C0BA 4X4RA 3CCMN 3R1LA 2QE5A 4UOCA 4FWNA 3JSRA 1XMOJ 4ECWA 2NYIA 4RG8A 3KLHB 2XMMA 4OZLA 1YJNS 2WB4A 3QT6A 4FW1A 1B7FA 3HPHA 2EK6A 5KFLA 3PW5A 2YNHA 4DR1J 3D9BA 2MZTA 3OFFA 4DUTA 1ZTWA 2KFZA 1NG9A 4EZ6A 4N8OA 3KLIA 3BGOP 1VDHA 1WC5A 4M42A 2UU9K 3FE1A 1TR0A 2VICA 1WC6A 3NMAA 3ICLA 2ATCB 1WUAA 3J7YP 2MQLA 1PAUB 2YHWA 5C42B 3K17A 1BU6O 4UOHA 1R3NA 1IBLJ 2VWBA 2XMAA 1QAJA 4F4KA 1F5BA 4RNHA 1KQKA 4LF8J 1WKJA 1AFIA 1NUEA 2GZOA 1VBKA 4NE9C 4DR7J 3GFYA 1RDWX 1Q8LA 4DN0A 3PHTA 2NXJA 3I55N 5AQFA 5L1LA 5AQSA 2CPFA 3UDLA 2AU0A 4HWIA 1C0FA 3V9WA 3D3BJ 3U1LA 2CADA 2JRSA 5GAHP 4DR1K 5KG4A 3FR0A 3TX8A 5HMYA 4IUFA 4DZDA 3DMJB 1LQ9A 5KT4A 2FSKA 4QS8A 3H25A 1Q16B 2O5DA 2PE8A 3SMZA 4JKAA 1WG4A 2HSTA 1YJ9N 4OZJA 5AJ3F 2DO0A 3VQPA 4MKYA 2ASYA 1F9HA 1WELA 3FEXB 1ZPWX 4ILMA 1M5OC 3VQ5A 1UA0A 3QIPA 2QMXA 2BYCA 4HLBA 2Q1LA 4ZVEA 1O5JA 1JMTA 1RTDB 3LZJA 3H8YA 4F50A 5KG2A 1GNKA 3IBWA 4B9SA 2DNNA 4Q0BA 4LF8K 2FHMA 3ZZ0A 4KB7A 3P39A 3CJSA 3CJRA 2LEBA 1OY8A 1HNVA 4IG3A 2FJAB 1PYTA 2IVOA 3FSIA 3QWUA 5AE2A 3ZSYA 3BREA 1NWKA 1MWYA 4JI8J 2VOOA 1I51B 5I3UA 5EHHA 2LQBA 2KYXA 3NF6A 2NZ4A 4IO9Q 4C8LA 3QNWB 4ZA1A 1VLYA 3VERA 2X1BA 2W4CA 2EBGA 3OSPA 3THPA 1S6QA 1TFYA 3FNNA 2W4PA 2HZVA 2IDLA 3ZC4A 5KRTA 1XMBA 1S7IA 1NGFA 4Y2CA 3KD5E 4FOEA 3M7VA 2BJ8A 1Z4UA 2GO8A 3BUZB 1NHKL 4RW8B 2XS2A 4LBPA 2IPOB 2V2ZA 3X3UA 4G1QB 3ZTRA 2J6SA 2R7QA 4DSEA 4ZVUB 3TR5A 4UQGA 4CIFA 3KDOA 4E1NA 5J2QB 3CMEN 4NO7A 3H1VX 1I39A 1N36J 3IDHA 4B3SJ 1C1CA 4DR4F 3VA3A 2CJXB 1X4FA 3UKRA 1VYAA 4KYZA 4OHWA 4EFHA 3OS1A 2CPIA 2FZKB 3NCRA 1VISA 3IFRA 2VQFF 2QSWA 1U47A 5AXMA 1X9JA 5FDLA 4FPRA 3VPZA 4FK0A 1XC9A 2KM8C 2YPYA 1Y5NB 1FKOB 4UZBA 2NXEA 4DL7A 5JJBA 3OBYA 2YH1A 3D0IE 4U7UD 2E1AA 4I2QA 4W5TA 2GFFA 4WPAA 1TKTA 4LSNB 3T5LA 4ELVA 2BGGA 1N5TA 5BR8J 2GO9A 2UXCK 3ZSRA 3F2KA 4AHCA 4LF2A 3H2UB 3MK6A 2NPFA 3MECA 1GLEG 2RHKA 1H1VA 2H1YA 2PGCA 2CGJA 3OBWA 3LAMA 4CLZA 3OHBA 1BHLA 1OYEA 2YQ1A 3K58A 2FLPA 5D0RA 1S9GB 1RABB 3ILLA 3OQ2A 5T7BA 3G6VA 3MEEB 4PG8A 4FP9A 4NI2A 5L39A 3Q8UA 5CABA 1H6KX 3VGLA 3UIQA 1W26A 3J7AP 5K14B 4DU3A 1TQLA 3IWXA 2HHPA 2V2KA 2QGFB 3SYZA 2BQ3A 1EKRA 3JQKA 1RAIB 2XMJA 4DSJA 1TL1B 4J9RA 4YORA 3M1VB 2AJQA 5J2PB 2QWLA 1LK5A 1SXLA 3BY5A 2OO4A 5JS1A 4B3MF 4DZ6A 2GWJA 3J7ZT 1JLQB 3NF9A 3MEDB 3NMUA 1QLNA 1WHWA 2E44A 4TU7A 4RBTA 3LGNA 1RHRB 2RJZA 2RPIA 3V6JA 3ZZRA 1H2UX 2GHVC 1TL1A 2QLFB 4DTSA 3ENVA 2B7BB 3R5CA 3EGZA 2MKIA 2E1CA 1U02A 1WF2A 1R43A 2VFTA 3WNHA 4ZTJA 1Q81O 1VQSA 2VFSA 1IXKA 1X9WA 1AUDA 1IO2A 4BVOA 3DLEB 2BH1A 1XUPO 2JDJA 1M1GA 4H0TB 5CZ1A 1T7PA 5JVGQ 4EU0A 1DTQA 4LJMA 3IUCA 1FX4A 2FDNA 5KG0A 2POKA 3EVOA 3DHXA 1N56A 3AY0A 3KKFA 4W92B 4CJTA 4JEPA 3W60A 1NGGA 1TKXA 5DG8A 1IVZA 4ECSA 4F3QA 4PL7A 4PKHA 1U1QA 4K2XA 1WEYA 1EETA 2OPRB 3AA4A 2F4VF 2EKYA 3SV4A 1KC8T 4PA1A 1RCXB 2KL8A 1YX2A 3BN7A 2EFVA 3UCZP 3TI0A 3G6ES 4RTFD 4CECA 1Q81T 2IM0A 3SXLA 1MLAA 3H7HB 5BN8A 3TQ1A 2WBRA 3J81U 3RMCA 3V6DB 3OXGA 5F8IA 1Z1ZA 4Z2XA 4DPXA 2JFDA 1RU1A 1AXQA 3NWRA 3DHWC 2RD5C 3VGSA 2O8DB 3QFUA 1JLCA 3MMVA 4I67A 1JIHA 3L4QA 4KHYA 3CQ8A 1NCLA 3J7ZO 2F9TA 2E7VA 3LPYA 1ZA1B 3R6GB 1NM1A 2LKZA 2GBZA 1UCNA 4DFMA 5H9FK 1KQSR 5CHCB 3M6WA 3UR0A 1OH8A 4MT1A 1DTQB 2BKNA 3WXLA 4M5DA 1IWAA 4Q44A 2ZJPQ 1RFQA 1EP4A 3WIUA 1JLEB 2BXJA 4TN2A 2G8WA 1VK3A 1E3MA 4KI6A 3M8SA 1X5SA 1RLCL 3NP5A 3DNCA 2VUGA 2MQNA 1EARA 1VJWA 4BDPA 2E5IA 4OZ2A 4XH4A 2AGOA 3NGTA 3W9JA 3FZFA 4MH8A 1N34K 3LP1A 4KRWA 3AT1B 5HN0A 2DGTA 2XS7A 4A2BA 3BS9A 2MQ8A 2Y0BB 2W7OA 3V6KA 4B3OA 1U7LA 2PA3A 1BIZA 4ILJA 3K57A 1I94F 3HHLA 1WNSA 1ZC6A 3QEXA 1HW8A 1N33K 5BPNA 4C11B 1F5AA 1O51A 2DD8S 3MAAA 1FO1A 4MAKA 5E2QA 3M8PA 5AR0A 4ETXA 3KLGB 3G71N 4WZQA 3G8TA 4DV5J 2GUPA 5IM0A 1NJYA 2DNQA 4E7KA 1PC4A 5KFFA 2QMWA 2QWQA 1M1KT 3JXOA 1OPZA 2WB1D 3CC4S 4KHPK 3D6MB 1DAXA 4O3PA 4PHTX 3IKMA 3GCXP 3T1HF 4ETZA 2D9PA 1GK8A 1BE4A 3OVAA 4C1NI 3O4NA 2CPXA 2VDIA 5AXLA 2ZH8A 2R7XA 4LH5A 4O0NA 3AGKA 2VJUA 1QZ5A 3KD1E 3LPTA 3CJ5A 3HK2A 3S3MA 3GV8B 2XHWA 1Q82O 3K5LA 5L9XA 1S1VB 4B3SF 4L6V3 4F3OA 2RUGA 2ZNYA 4J2DA 4B3TF 5LXRA 5FIIA 1PJ5A 4WP9A 4ZHRA 2PSZA 1NSKL 3RBXA 3TUIC 4NA1A 2NRHA 3VQ4A 3PCOB 2UXDK 5GMDA 3M2UB 4OZ5A 1CPZA 3VQQA 1LW2B 4IYQA 4K7QA 4NLYA 3AO2A 1BCOA 3VGTA 4CEFA 4HL9A 3H08A 2FC0A 3W8GA 5AQMA 4X4SA 1M90O 2HAFA 4FLWA 5ETPA 2JLGA 3UW1A 3ZT4A 1W2BR 2Z2ZA 3C94A 1N36F 2QA2A 3GCWP 1N36K 4OYMA 4AL5A 2WTUA 2G8IA 1RTHB 3QEIA 1NO8A 5LSOA 4PL8A 1Q9XA 5MLCQ 3MM5B 3MTJA 3AVNA 3IR5B 3MCAB 2R2RA 5CZXA 1W9HA 3CO0P 2FYXA 1ZA2B 1NK0A 4C1NK 4AE5A 2BA9A 5KFUA 4TU8A 1VQMS 1S22A 5LMUF 1EHWA 3H0PA 2Z30B 1IG9A 1R31A 4WQ4A 1V5VA 3NVMA 2W42A 4UZCA 3S7RA 1NMDA 4OHYA 2ABYA 4OKEA 3IG1B 2AD9A 1ITPA 3F9KA 3GP9A 3SNNA 4MFBB 3Q24A 4DG1B 5A2QO 4KB1A 3ZLJA 4PUOB 4KH5A 5BYRA 5KGXA 3AB4B 5JMVA 4DU1A 1ATRA 2HFVA 1X31C 1N32J 5FLXU 2X3GA 1DTTA 4IFVB 1NKEA 1RTJB 4GKJK 1HBNB 3HHLB 1NK9A 3CFPA 1B99A 2WAQD 3N4WA 2GS8A 2HQCA 4JV5F 2OD6A 3SBMA 3I31A 4DQIA 1AROP 3TZXA 3DDIA 1R6YA 3W62A 5IM0B 1RT1A 4CM0A 3S41A 2FHJD 1H72C 5AJ3J 4UY8O 1LCUA 1U1MA 4ZPVR 2KVIA 2VA2A 2ZNZA 1MNEA 4JI4J 3WEEB 3V6HA 4UT4A 3D1OA 4I7FA 4OPHA 1UWBA 4UUWA 4U9RA 4F2RA 3OS2A 4H4OB 2YNGA 3TR8A 2XO7A 2QXLA 3RMBA 4LRCA 2DFHA 2D0PA 1B9DA 4FBUA 3BO4A 4TYAA 5JMNA 2HK2A 3K0JA 1XNRF 1NJIO 4FWLA 1I94J 2DHHA 1XNRK 4FWRA 2Q6CA 3HF5A 3DLBA 1IKXB 5M1QA 4YDXA 3RBDA 4RW4B 4JV5J 1Y97A 5C42A 4PAAA 4CBUA 2HHUA 1LWEB 1E6YA 3AD7C 2AYEA 4K8ZA 3VCDA 2AHOB 1OY9A 5AT1B 4DUZJ 4JI7F 2HNYA 3BPDA 4L75A 3QINA 1W97L 2FVQA 3GB0A 3B6OA 4PXCA 3T69A 3H5YA 1SKRA 4NYNA 2M88A 5IT9Y 1TL4A 4HVZA 3A8EA 4DR1F 1D9FA 3ISZA 1RBTA 4WE1A 3QDKA 4E8UA 2P8IA 3HZ6A 2OPRA 4LMZA 2ITMA 1T9UA 1T9VA 4CLWA 3WXMB 4ZKAA 2FBVA 3NBPA 2GX8A 5B0GA 4DQ8A 4OZ3A 4FXDA 2LMIA 4ECZA 1V4TA 2PEBA 4F0KA 1R6VA 2EEYA 3Q2TC 4FOIA 4Y2IA 4QIVA 1P1LA 3EUNA 4CJSA 4B1UB 3KJFB 1CVJA 4O5FA 3UDCA 1NK5A 3VEOA 5AE1A 2YHXA 1NHUA 4ZCIA 4BC7A 3QETA 4IO1A 3MR2A 1YBUA 4P74A 3TUZC 5K8OA 1FI4A 1K9MT 4DUZK 6FD1A 4FF1A 3IR6B 3TO8A 4M3TA 1YUWA 5LOQA 4CJLA 4L8RB 5IC6B 3CG7A 2YNFA 4ZPAA 3R97A 2APOA 3KHLA 2BANA 3K5PA 5JLHA 3CXCM 4M5MA 2RS2A 3CIPA 5KAKA 3VEZA 2RILA 4ZN1A 3ULDA 3AAPA 2ZJPL 1SV5A 3O9RA 5CYQA 3ONQA 1FJGF 3HKWA 5CH7B 4Q45A 2FVPA 2G4BA 3SUPA 4ECTA 3UD5A 4BRGA 4JV1A 1ROFA 2HIQA 4NASA 3ZSOA 3C6UA 1YLXA 3BH7B 1Q0NA 5EDWA 1JLQA 1HW9A 2DNGA 2QLBB 1Q1KA 3IWLA 2C3UA 1HWJA 2GJ2A 3ULEA 4X62K 4Y3CA 1CJUA 2V94A 4KPYA 2EFGA 3FCWA 5CCMA 3O5TB 3T1AA 4CEDA 4YB1P 3U6FA 1U0HA 1ILYA 4ZLNA 1R8AA 1V9OA 1Z2ZA 4FJXA 2CVIA 1B70B 4LR9A 4RO0A 2KT3A 1U1NA 1P8GA 4BWJA 3DOMB 2CPJA 2V8HA 4FJ8A 3PJWA 1RTIA 2RF2B 5AQYA 4CTAB 3G10A 4HT7A 3CETA 1HKAA 3W61A 4O5BA 4M5GA 4CT9A 3E9OA 2HNZB 4YR3A 3HDSA 1N5VA 4KHPJ 4K25A 2ATLA 4G1PA 1T6DA 1GOBA 1YVFA 4IZ9A 2EFQA 4W5OA 1M5HA 5E84A 5CYMB 2OPSB 3T7ZA 4CGJA 3WIVA 2EFPA 4J9PA 3DRSA 2F9JA 4OVLA 2CJAA 2WVCA 1YAGA 3EEQA 2QLXA 4PG5A 3UE5A 2DISA 1T02A 2K8GA 5L46A 2B3TB 3DLRA 1BL3A 2D1KA 1RP5A 3DRSB 1C4AA 1U26A 2CYYA 2C2MB 1VR6A 4OIXA 1UKUA 2XHCA 3AFGA 1CXQA 4H8KA 3D2FB 5DDRC 1VK0A 4B1XB 4Q2MA 4NYZA 1EX8A 1WF1A 4DJBA 4U7UK 2DBBA 2C3OA 3AY9A 3CJ9A 1N32F 4M3WA 1FJ7A 3OYJA 2XI2A 2RMLA 4NEZA 4DV4J 3SUQA 2B9EA 2Y9HA 3B8AX 4ID1A 5B0CA 1TL3B 3PJ9A 2D4WA 2DNPA 1CLFA 3I0RA 2VG7B 1VHXA 3PX6A 4FZVA 4K4XA 3IGVA 4Q8FA 4Z7YA 2GGPA 4DV6J 4M3YA 1NSAA 2QA4G 1GLBG 3LGMA 3GE9A 5EX3A 1C1AA 2ZBQA 4M63A 3OL7A 2YHYA 4BWMA 2HHTA 3MR3A 2HGMA 1WF0A 2BX6A 5E7OB 2FY1A 3Q8VA 1GXTA 3FJ2A 1BC6A 3O3FA 3TAFA 3N28A 4BRPA 3ZFVA 2Z1GA 2DGSA 2FJWA 4HVJA 2RRBA 4X4VA 4E89A 2KFYA 4B1VA 2JX2A 1KHWA 4CK3A 1G7CB 4JS4A 1GTHA 4B9QA 4QW8A 3PYDA 2GMJA 2WTFA 3SSSA 3FZKA 1GQEA 2GJIA 2MQMA 3TQEA 4CJFA 1S48A 2A18A 5D4NA 1Q4RA 2PFUA 1I6JA 2GA7A 1KCFA 4C4WA 4K4UA 1MROB 4NX9A 1UPPA 1SBRA 3PYFA 1T03A 3CEDA 3L2RA 3MUVP 4X65F 4YB7A 1SVDA 2XO6A 1PILA 1VSDA 1FJCA 2ZH4A 1W2IA 1NOYA 5CAAA 2QV6A 2R7RA 2ZEJA 4C6AA 4FBTA 1BUPA 1HX1A 4BR7A 3A8JA 1TZ0A 2CJQA 1KQGB 2OSRA 3AJ1A 4U95A 2XWYA 2XSJB 2ZOMA 4OV6A 2JH3A 1HARA 1O1WA 4GNIA 4H0PA 3VQ8A 2ASDA 1I3OB 4DTUA 2DEIA 5ETOA 1DFDA 4TQSA 4NXMF 2NPIA 2IVYA 3PIPL 3AVBA 1GMVA 2KZZA 1Q86T 5BYQA 4MIBA 4ZP7A 1FDBA 1VQ9N 2XTJP 2QC3A 5H9FJ 1W0HA 3SJHA 4ZIWA 2W1BA 1VQON 4X66K 1TP7A 2VG5B 3PSIA 2DNHA 1RXOB 3T3FA 3C14A 3K5OA 2IHR1 3CYMA 4BR5A 4OHZA 1RADB 4JV5K 2CQDA 1CZ9A 2KU7A 1DURA 4WYLA 1IJEB 3SEOA 3QJJA 4DR7F 1JKHA 1HNZF 5J2NB 1FWKA 1A5VA 2HRUA 3TABA 1EZZB 1TVRB 2W2MP 3M30B 2EWSA 1VQOS 2MZQA 3K7RA 2PMWA 3DXBA 1S5ZA 1WBDA 1VQ7N 3ENWA 3MDFA 4KFBA 4BRMA 1N6QB 1R0AB 1Y3KA 4JI1J 3RWUA 3QMQA 3N6MA 3JYTB 5KFBA 2HAIA 1OQ3A 3KLVA 3DN9A 2ZUGA 4CDIA 5K9FA 5LT5A 2UU9F 2L9NA 1QSSA 5FPEA 3SAHA 3JB9k 3HHNB 1JLGA 2XSJA 3R5BA 1QAXA 5D77A 2LQ8A 3BSCA 5MLCV 2E1PA 3O3GA 5I42A 1FNMA 2CFXA 4YUDA 4NRTA 4LFCJ 2YNGB 3E9PA 5BR8K 2VPYB 4DR6F 5KQDA 4LF7F 2NREA 3AOBA 3KLEA 4DTOA 4DR2J 4TXSA 1RBRA 1JLFA 3EN9A 2ZH2A 4JI6K 1SIWB 3CCTA 4JI6J 3U3YA 4WIIA 2FBYA 4PR6A 3CCRN 5KPRA 1Q79A 1Z26A 2Z1JA 2Z8QA 3HVTA 2F1FA 2QA4S 1B7YB 3HFVA 4LF4K 4J91A 4MKVA 1WAFA 1HBMA 1H74A 1EQMA 1ZXOA 1TYQA 1VRTB 2IAJB 3UDVA 3OYKA 3HZGA 4LIRA 4PQAA 1FDDA 3SV3A 4FYYB 4MMOA 1QHTA 4AQYJ 3EXYA 2GX9A 1FRHA 1Q9YA 4FJJA 4PPZA 4YQWA 5DJBA 4KHUA 1RACB 5AQGA 4V19X 4K0KF 4NLUA 3V9UA 2CGKA 9ATCB 1ZZFA 4IFEA 1MG7A 1YT3A 1BO5O 1UOCA 3THXB 2VCPA 3LP3A 2VKRA 2I7PA 1AW0A 1KLMB 5DQGA 3LOUA 3AB2B 1Q8IA 4BS2A 2AYBA 1FKAF 4ZP6A 1MDUB 5JUMA 3FK4A 3Q2SC 3VAJA 3OYDA 4USMA 2QL5B 1RWVB 4CJ3A 1HNXK 3NAHA 1Y3JA 4OJRA 2R7YA 4GVBA 4C8ZA 4ED2A 5KFYA 5J2QA 2BJEA 1RWPB 1BMQB 2L08A 4FYWB 1QE1B 3PW0A 4CO0A 3LP2B 1RT3A 2NSBA 1L3UA 3CT9A 4OKJA 2KH9A 4B9VA 2R7TA 5HLFB 2VA3A 1F3FA 4DL0C 1XTZA 2UUBK 1HHSA 1RKIA 2J7UA 1ASUA 3PSFA 2M8DB 1ZM3A 2VF3A 1LV5A 2KN4A 3LWMA 3M8QB 1WSGA 1HNWJ 2PAVA 3HYFA 2IDEA 5A6WA 5KFWA 1UVKA 1TV6B 2J0WA 3ILJA 4CP5A 4Q7AA 1SJQA 3ULHA 3OVNA 4CBXA 3CCWA 1SL2A 1JCEA 4A8YA 3EX7B 4M41A 4CERA 2KRBA 3FKBA 5BJRA 5CE3A 3CMAN 3ZZPA 5A0YB 5GAEP 1VQPS 2GTDA 1JCGA 2E4LA 2Y3YA 1T3OA 3M9MB 3PACA 3AA5X 4U96A 4I6MB 2VL1A 1H7WA 3OYFA 1NDKA 3MURP 2GVZA 1ZBUA 3O5BA 2JEIA 3HHLC 4DUZF 1J5EK 3D1HA 3VAHA 2HF3A 1IKWB 3HHEA 2IRYA 4F26A 3DU5A 4JK9A 2V0NA 5M1NA 2G8FA 2L48A 4CLFA 2BJ3A 4JI4K 5E5NA 2CQHA 1FWPA 4QWCA 1QAIA 1P9QC 2K3KA 2OFGX 1CQMA 2QL7B 1GLJO 2RDIA 3J81j 2Q97A 4M5LA 1RDAA 4DR5J 4NLTA 2NQPA 4XIUA 3SCKE 3DXKB 5AE3A 2DNKA 5A2QY 4BACA 4RNOA 2YX4A 2GV9A 4QBUA 1WC4A 5AQTA 2X6NA 3US5A 3OL9A 2R7SA 1FXRA 4DV5F 2O4GA 2PBDA 4RBUA 2MLXA 2R8KA 3M1FA 3GQCA 4H4KC 1S9EA 2VB6A 2VHGA 3TSUA 2IFXA 3LP1B 2DIVA 1P8ZA 3TAPA 2Q2RA 4BRKA 2IMWP 2FBXA 2ZF5O 3MMAB 4JOUA 4EHUA 3UR3C 1V6HA 4CYUA 4QIFA 3EPGA 3PYGA 3MCPA 1Q8KA 4W90B 1UMJA 2YKMA 4KV8A 3CXCR 5K14A 2A42A 4ZP9A 1GH8A 4IBNA 4DR4K 3GIIA 5LMUJ 2Z1HA 2W41A 1N48A 1LXJA 4YY3K 5LL6Z 3HBTA 3QBWA 2E8AA 1SJRA 2BQUA 2B6AA 4D3HA 1YDLA 4ED5A 5KFSA 1OPIA 4XPEA 3MAAB 4OLOA 3OYNA 3GL1A 3M5RA 4NLCA 3OLAA 3TOQA 3P49B 4B8CA 3EMTA 4OJGA 2VZ9A 1U49A 5CD4H 2YY3A 1G2EA 4CJRA 4N7TA 4I6YA 4HI1A 2VGMA 2M4MA 2F7TA 2RQCA 1SJ3P 4ZMMA 1U8SA 5H9EK 4QQBA 3EGVA 3VQCA 3NOCA 1VC5A 1ZBSA 2WOMA 4O4GA 2AT1B 2VPZB 3TZZA 5A6PA 4F4XA 5D8HB 4FN5A 3V1OA 1H73A 4ECXA 1VSJA 2HW3A 3LTOA 1X4AA 3FZ2A 1QQOA 3HCXA 3TEGA 3CC2N 2FSJA 3C6AA 3O8WA 3GSIA 4RNMA 3P38A 4ZP8A 4CBWA 2I0XA 4DI6A 1BOTO 4YY3J 1SUQB 1P90A 1ESVA 4WJBA 3OVBA 2DFEA 3WUHA 1TUVA 3HJFA 2LQJA 4H4MB 4FNIA 4DV6F 1VQ5N 3OR1A 3MF5A 4OI2A 4DR6J 1QUVA 3KK1A 3N6LA 3PIOQ 4A8QA 5HRPA 2J0XA 1FF2A 1S5JA 5KPZA 2Z57B 2RRNA 3G8SA 2E1MC 3K8VA 1E4GT 3ATUA 3VENA 3SI8A 3H3OB 1L3SA 1SI9A 2MQPA 5F3ZA 5I3PA 1RTHA 1RT2B 3UPFA 3AODA 4XPCA 4O0JA 1F2GA 3PRVA 4HACB 1HNVB 1RT4B 3LO3A 4TU9A 2H9ZA 4DR3J 2C2DA 2V8VA 1REGX 1KR4A 2UUCJ 3AV9A 1SJ4P 5DG9A 4B8AB 3VMFB 3CCZA 3PLAA 4FVCA 3F9MA 4ZJQA 2H51B 5HQ8A 2BW2A 2IBKA 1YI2N 3AO1A 5ADXA 5M2PA 4NLDA 2A40A 2OPPA 4IRDA 3QFPA 3BN4A 3LH2S 1WDTA 1TGOA 4NOHA 4JI1F 1T0TV 2PC6A 3G25A 1CJKB 1GX6A 1UJ5A 1T3VA 3A5LC 4OV1A 1IKYB 3HD2A 2KTQA 4K8RA 1FD8A 4IXCA 3WNEA 1WOQA 1TMJA 4MO5A 3P5BP 3W2WB 1RTZA 1U6FA 5BR8F 5AQLA 3K5MA 2XY5A 4CLUA 2QWMA 2B4JA 1MU2B 1FNXH 3D28A 4LSLA 4M3RA 1T9YA 2NR0A 3K5NA 2GV1A 4BRAA 4C8YA 3OW2M 3DFEA 2K7JA 2WW4A 3UO0A 4X4PA 1TUYA 2ZGZA 3QATA 3QSIA 1NZAA 4OI1A 3THXA 5CR4A 4KHPF 1R8PA 2OTJN 4RUHA 1NLVA 3VF0B 3C6TA 4BC9A 1QVGM 3SQ0A 3JAMO 3T41A 2DK2A 5GAHU 3DXKA 4A8SA 3KWIA 4ZVOB 4R8UA 3KG4A 4ZK7M 2YKNB 4DOZA 2AZ1A 2QWRA 4RW6B 1GT8A 2IM3A 3BF4A 1C0TB 4PKIA 4DTXA 5KG1A 3H46O 3QAUA 1J54A 1CG2A 2VYPA 1YJNN 3AD8C 1JB0C 4R8UB 2D7SA 5U47A 1UAXA 3I5AA 2EC2A 2MJNA 2XLKA 4WKYA 5GMEA 2QG9B 1C1CB 5THWA 4DL3A 4ECRA 3H1QA 1SCJB 3QIPB 2VH7A 3FEYB 1G15A 1X8DA 3N4QA 5C5JA 4ES2A 4EBDA 2QMUB 4DX6A 3SMPA 1T05A 1S1XA 2EXUA 3QAEA 2HOEA 3IAYA 1R27B 2E88A 3BDEA 2HURA 2DH9A 3ISNC 2AP6A 2F4FA 2W2OP 1I94K 1S4FA 2VC0A 3M2RB 3HVRA 4P71A 1RT6B 4CJ7A 3DXMA 3VGKA 1VMBA 2F8SA 4NLSA 1P1TA 2ZZMA 2FHJA 1GXLA 4JKCA 2Y8WA 3VQ9A 3FBBA 2YV0X 3N01A 4K42A 3TAMA 2BVZA 3M05A 4C9DA 2VWKA 3QYYA 2A1BA 3A4TA 3NVKA 4OGEA 3UDEA 4QS7A 3VTHA 4CGDA 2IRUA 1SC3B 3D7SB 2P9SB 1DY3A 2WVEA 4E1JA 4LF8F 4H0XB 2DR8A 5FRNA 2RKIA 3KUHA 2D9OA 1TMMA 4L72B 2H4WB 2V51B 1PYSB 2BKOA 4PXDA 3SZ2A 2ZJRL 3M6UA 3L3VA 1IBKF 1CBKA 4LSZB 4QS9A 3E2EA 4OHVA 2XZTB 5G0RA 3E01A 1Y4ZB 4PUOA 4AM7A 2DGVA 2RQKA 1GLDG 2HS3A 3ZT0A 3CCJS 2BE2B 1X3MA 4JD2A 1ZOTA 4LFCK 2AA4A 4P7VA 1BQNA 3CSKA 2VGNA 2P5GA 3C8YA 1WOSA 5D0HA 4I9QA 4UY85 1RILA 4BQZA 7FDRA 2ZQBA 4J2EA 3RAQA 2Q66A 2KFNA 3O1LA 3IO1A 4KTWA 4BY9C 1TAQA 4GY2B 2NXCA 4Y00A 3ASMA 2CNOB 2GQQA 4IDKB 3LDSA 4PWDA 4N47A 4B9LA 4RR5A 1C0MA 4DR5F 4CI0B 4B9TA 3ZX0A 4TLQA 4Z4EA 1NKBA 2WOMB 4O4GB 2V4QA 3GIJA 4P10A 2D3OR 2V2VA 3JTPA 2EI5A 2G0CA 4WP8A 3SQOP 4OYZA 1EO1A 3Q86A 4LH4A 1RAGB 1IBCB 3LP0A 3EXCX 1A0OB 1IQTA 1URRA 2N7CA 1FDNA 4QR0A 1S1TB 3AJDA 4U67L 3CCLS 2LCWA 5H9EJ 1BI4A 4L73A 3Q8PB 3AVLA 5E26A 4CFCA 3GIMA 1HPMA 1NPRA 1V3ZA 3F56A 2PMZD 3SPYA 3C19A 5B09A 3MMCB 4P2FA 1NB7A 2MY8A 1U2RA 4ANEA 4R0EA 4OX9K 2P9GA 3W1YC 4H03B 2CWKA 4Q5VA 2ROPA 5AQJA 5E41A 1N6QA 3IP0A 1JCFA 1JLAA 3ILIA 3QGIA 2QJ3A 2R3VA 1S79A 2GUIA 2O8EA 2QLWA 4ZPDA 3F73A 3CJ3A 2DR6A 5EWFA 1Y11A 4KSEB 4CNZA 1P27B 3H4BA 4JK8A 1RWNB 2CQ3A 1BD6A 3NGIA 2GELA 4DV2J 1OVQA 4H0VB 5ETSA 3VESA 4O4RA 3ILOA 2QEXS 3GU0A 4JKBA 4AHTA 5C2DA 2KJVA 4FXVA 3FSXA 5D3GA 3KKSA 2UXCF 2Y0SD 5L9NA 1K8AT 3CGIA 1RAEB 1P9YA 1XMQF 2BJDA 2LYVA 3KUGA 4KY3A 4FLUA 4TY8A 3CJ0A 4DF4A 3MR5A 4ZITA 5AQHA 4A8XA 3JS9A 4CIEA 3BGRB 3PDNA 1S57A 4WKRA 2C2KB 1XR7A 4IFYB 2C28A 3N79A 4EMDA 1U6ZA 1JJ2R 2DGWA 1KN6A 4ZLPA 3UCUP 2YCHA 3MPUB 2QKKA 1CS4A 1KVKA 3D67A 1ACMB 3Q7BA 4RL1A 1U2VA 3PFOA 1FRIA 4DUYF 1NK7A 1AFJA 4FCYA 3C15A 1S9FA 4QOZB 4WFAQ 2IVMA 2BTFA 1LK7A 5EX5A 2QFJA 2E7XA 4NYOA 4OPKA 3AXMA 1OH7A 1NBEB 4DV0F 3OYMA 3OHRA 2ZBCA 4NYPA 3FFIB 3OY9A 5KFPA 3QIOA 1DJ0A 1RHKB 4DS5A 3CJCA 5C0YA 2YX6A 4DHVA 2ZH6A 3HRGA 1MN7A 5L1IA 4GKKJ 2ADCA 2AJ1A 1VQKS 1NNDA 4NA2A 2W6KA 2P9UA 4NB4A 3NLCA 2EC0A 4CQ1A 2P9NB 3KJVA 4ISEA 2CJ9A 4QWDA 2JC0A 4DTRA 1N5YB 5C25A 4RUCA 4K4VA 4R79A 1HNIB 3CJ8A 3GR0A 1UP1A 3ZT2A 5DG7A 2JWLA 2D3UA 4LF1A 4DPTA 4FVUA 4WFYA 3ATVA 5HATA 3AVMA 2B8QA 1EKSA 1EIYB 5C25B 3CD5A 4RU9A 3LM9A 1M5KC 2OHDA 4O3NA 3KLFB 5M2RA 4P9SA 2LEPA 1UEVA 4ED4A 1TFWA 3GG4A 1EWRA 3O1WA 3J80Y 3OYBA 3M2UA 4WBFA 4ZOSA 2NSCA 4OJHA 1WSIA 2Z2MA 1YQHA 3UFCX 4CJKA 3MM9B 3RR7A 3QNNA 3S3NA 4L3KA 3VTIA 1X0FA 4CZJA 2EKNA 1NGDA 4DSIA 2HBLA 3NCIA 4YEAA 3R6MA 1NSQA 1RAHB 1WC3A 4CHQA 4URGA 4W5QA 1FWLA 3FFIA 3LW5C 2R7VA 1EWQA 3T9ZA 4ZVPB 4E19A 4ZJOA 4JN4A 3J7YI 3N5BA 1S12A 3KK2A 5HRRA 1N5YA 2NS1B 4DV0K 3A12A 3H2LA 3RBEA 4Y2AA 2B4PA 3CJ4A 3TWHA 3ET6A 5AQOA 1S72N 3CUNA 4FKXA 4NZ0A 3B82A 1IKWA