1RTHA

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
543
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 144
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rthA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rthA05
3OLAA 4WFXA 1QE1B 5FRMA 5CYQA 4KHNA 4DEZA 4IG3A 5I3UB 5EDWA 2IGIA 4E7JA 4CCHA 3H2LA 2ITGA 1C1AA 1S1WA 1TL3A 4CFCA 4NCBA 4J9LA 2FVCA 1SV5B 1KLNA 2WK4A 3U3GA 4OPJA 3KLEA 3OYGA 4M42A 5L1JA 5JXSA 1BHLA 4H4MB 3QETA 4DQRA 5F8MA 4TQRA 4E7KA 3HVTA 3UPFA 4YR3A 4JRPA 3TAFA 4NLOA 1RDAA 3SQ1A 3KD5E 3K2PA 4Q45A 1C0TB 4M3ZA 1FKPB 1CLQA 4J9RA 2VG5A 3NAHA 4MIAA 3M9OB 4DQPA 4ECTA 4B3OA 5SWMA 3LALA 4M95A 5J2QB 4PUOB 1IKXB 3AVIA 4R5PB 1JLAB 3C94A 3SJJA 2B5JA 4KTWA 4IFYB 3TARA 5J2NA 3DRSB 2R8JA 5DG7A 2IM1A 3PW5A 4Q8EA 3THVA 3AO5A 3BJYA 2OPRB 1HNIA 3AA5X 4ID5B 2XY8A 3KLHB 3M8PB 1RT5A 3KOAA 1S6QA 3CFPA 4CF1A 1SL0A 1RTHB 4CIGA 1X9SA 2VA2A 3L8BA 3SV3A 3G6XA 4B08A 4EEYA 3KIOA 3PO4A 3OHAA 5CZ2A 3OHBA 5KFJA 2G8HA 1EP4B 4AHVA 1VRUA 4ED8A 1RAJA 3WNGA 4CJRA 1T3NA 4FS1A 4O3OA 4FBUA 2IAJB 4GC6A 3TAPA 4FJKA 4UQGA 5HP1A 4Q43A 4KB0A 3AVNA 5T7BA 3K5OA 4O44B 2UVRA 3VQ4A 3UQSA 1TV6A 3GYNA 3SQ0A 4DU3A 4DLGA 1TK5A 5KFDA 2JC1A 2PY5A 3BREA 4EZ6A 4HUEA 1TKZB 4IOBA 4KTQA 1R0AB 3H59A 2I5JA 2RF2A 3VQ6A 2B43A 2VG6A 3V6JA 2A1RA 3TANA 4FJ8A 4CEFA 5D3GA 3SV4A 4RNOA 3PJWA 1A5VA 1S4FA 4ICLA 3MR5A 5KFZA 4AH9A 4CK2A 4QWEA 1HPZB 3V9WA 4DQQA 3IS9A 3MEGA 4BACA 3JSMB 1RILA 5KFTA 4CF8A 2RDJA 5JS1A 1S48A 4WFZA 4NLDA 3QYYA 3UR0A 3OY9A 2HNZA 1NJXA 1FKOB 3K57A 2G8FA 5EU7A 4F8RA 3C6UA 3PW2A 4K4ZA 1T94A 1JXLA 1HYSA 2FBTA 3KJVA 3I8DA 4I9QA 4IRDA 3OL7A 4OJRA 1F21A 4LH4A 3OLBA 4J9OA 1KVBA 3CDWA 1LV5A 2Z1JA 2IMWP 1QQCA 2P5GA 4TQSA 3UDLA 1RDCA 4KHYA 2IC3A 4PWDB 4OGCA 1TKXA 2WOMA 4JS4A 1Q9YA 5KFMA 5I42B 5DQHA 4OL8A 3BDPA 3T5KA 5FRNA 3CO9A 1XI1A 3I0SB 4CJQA 2E6MA 4FLXA 3IGVA 1SH3A 2OPQB 1ZETA 4CK3A 1Q9XA 2HNDB 4GVMA 2UVVA 2YNHA 4CIFA 1IKVB 4JV1A 2FC0A 1BI4B 1TAQA 2AQ4A 1ZTTA 4ECXA 3VQ8A 4BE0A 4CF9A 3VQ9A 1EETB 1EXQA 5F8HA 1KLMB 4MK8A 5FROA 4J2EA 3TAMB 1JLGA 3VQQA 3ZT4A 2EX3A 4KHWA 1UA1A 1SUQB 3SQ2A 1BGXT 3VA0A 2P1JA 2AU0A 3OYHA 2JEFA 5HROA 4EYHB 1S1VA 3G6VA 3OSNA 3OYJA 3HYFA 4DLEA 2E9ZA 1X1PA 2AGPA 3BGRB 4FM1A 5L1IA 1YVUA 2GUIA 2FVPA 1BIUA 4M45A 1WSJA 2KFZA 2D0CA 3MXIA 1RA6A 4DL5A 5C42A 1NJZA 1RTJA 4CJVA 1TVRA 4K4UA 3H4DA 4R8UA 4Q0BB 2EHGA 3QNNA 5HRPA 3FFIB 1ZBIA 3KLIA 1WSHA 1ASVA 2G8WA 4F3TA 3CJ5A 2AJQA 3QO9A 4TXSA 4FM0A 4I2PA 4YP3A 3MEDA 3HP9A 3AVCA 3LZJA 3KKSA 4ECRA 5KG3A 3V6KA 4CJPA 4OPKA 3FRZA 2ETJA 3KLGB 4MFBB 3HK2A 5HBMA 4BE1A 3DRRB 1WLJA 3L2VA 4M3RA 5KGXA 2FJVA 2ILYA 4EBDA 3T5LA 4FJLA 3RR7A 3M9NB 4BDPA 2ASLA 4B9TA 3ITHB 4FK2A 1BQNB 5KFQA 4E7LA 4OVLA 1TAUA 2YNIB 5HRSA 3H08A 3QGGA 1RDBA 2GBZA 3G86A 4J2DA 3QEPA 4DFJA 5CYQB 3IG1A 3MFIA 2DY4A 3EPIA 4KPYA 1MU2A 4IG3B 1RDDA 3FQKA 4HCCA 4Z4HA 4IDKA 3AVJA 1SH0A 3SPYA 4C8NA 3KK1A 1S1WB 3LP2A 5J2MA 1TL3B 1L3TA 4F50A 2YKNA 4WYLA 2AWZA 3KLEB 3ZT1A 1VSDA 4PA1A 4O0IA 4R0EA 2WCXA 1BISA 1BQMB 3HVTB 4ZP9A 3RWUA 3I0RA 1ZBLA 1NHVA 4LD0A 2BANA 4QAGA 3VQ7A 4DFKA 3CDEA 1S6PA 3G0ZA 3M8SA 4TY8A 1WSGA 5C5JA 5F9NA 1D9DA 2VG5B 2V4RA 1N5YA 5I42A 3QZ8A 1VK0A 4B3OB 3PW4A 3QIPA 3O4NA 1RT6A 1RT7A 5JS2A 2B5JB 4FCYA 1RT1A 5J2NB 4W5QA 3SFGA 3PO5A 4ELTA 4ECQA 1VRTA 4IR9A 3KHGA 3DLBA 1HRHA 4Z4GA 2X6NA 2R2TA 4CK1A 4DSKA 2O4GA 1LAWA 1TK8A 1HNIB 4CHYA 1K1QA 3V6DA 1W25A 2HAIA 4BE2A 4NLXA 3H4BA 1RT5B 4J9MA 1S6QB 3A2FA 3BSAA 4U6PA 4CF2A 2BQ3A 4DU1A 1RYSA 1S1UB 4AHUA 3ALYA 4IH6A 1KFDA 4QW8A 4ZHRA 3FSIA 4DTJA 5C24A 1GOCA 5KFUA 3OSPA 1VRUB 2YNFA 1ASUA 2XY5A 1TQLA 3GILA 4QOZB 3MR6A 5KT3A 1B9FA 3PUFA 4IFVA 2UUWA 4E0DA 3GQCA 1DLOA 3MXJA 3ZT2A 3V81A 3AA4A 4FJXA 1XC9A 1Z4UA 5HP1B 1HNVA 2YKMA 2D3UA 5KTQA 3ZSXA 3NDKA 3DOLA 2R8IA 5KG2A 4Q0BA 4IH5A 2B4JA 1ZBHA 1C2PA 4FK4A 1TV6B 4DTRA 2HMIA 3VQAA 4BWMA 1TP7A 4ZTFA 3AVHA 5DQGA 4W5TA 3CYMA 3NGZA 2E6LA 2X6SA 2I5JB 4JRQA 3SPZA 2RF2B 2G8UA 3DI6A 2VG6B 4RUAA 3L2WA 2C2EA 5D3GB 1RA7A 2ATQA 1NK4A 2HVIA 2ATLA 1W9HA 3NGIA 2OH2A 3K59A 4DS4A 4ICLB 2IM3A 3DRPA 4MIBA 3JYTA 2XY6A 1WAJA 2ASJA 3IS9B 3PW0A 1RT2A 3MEGB 1WN7A 2Y1JA 4CFBA 1XR5A 2HHQA 3T3FA 2FVRA 4ZVGA 5F8NA 2R2RA 2HNZB 1N4LA 3AVGA 5K14A 3M8QA 4C8MA 3BSOA 3DYAA 2HHSA 5KFPA 3C6UB 3DM2A 3CVKA 5DGAA 1IKYA 1HYSB 2YNGA 3V9XA 3KJVB 4NLUA 2ASDA 3B6PA 2QKBA 4FYDA 1GX5A 4FLVA 3DLEA 4NZ0A 3PR5B 2B6AA 2W42A 4KHMA 3PX6A 2E9RX 2EC0A 4AHTA 2VWKA 5KFIA 4CHNA 4J9NA 4RW4A 4NLPA 4ECZA 2IC3B 2HHWA 2VG7A 1UWBA 1IM4A 4CHQA 1WNEA 1TKDA 4CJ3A 4AHSA 1TKXB 2WOMB 3RMBA 3CWJA 3E01A 5KFNA 3ZT3A 3DLGA 1BQMA 5KFEA 3D5MA 3V9SA 1LWCA 1NOYA 4DU4A 4ZPDA 2IA6A 4M94A 4CGJA 3QIOA 2BGGA 4CEDA 4DSEA 1S1XA 3BQ2A 2YNHB 1HYVA 3KHRA 3MR2A 4RW7A 3TVKA 1K6YA 3LANA 3O3GA 5C25A 4URSA 3L3UA 1RYRA 3WNHA 4PQUA 4F3OA 3QINA 3NHGA 3O4QA 5DMRA 1JLGB 4O55A 2HWHA 1QAJA 1QHTA 3UIQA 1C6VA 3IGNA 3LP0A 2HNYA 5HROB 4TYBA 1S1VB 2P5OA 4CFDA 2HHXA 1RCHA 5F8JA 3QEXA 3FDSA 4OGEA 4F4XA 1S1UA 1HQUA 2W9CA 4F4ZA 1ITGA 5C42B 3T5HA 1RTJB 1TVRB 3QGIA 4ZPAA 4R8UB 4DF8A 4NLVA 3ZSYA 4FJ7A 3KMQA 4Y1DA 3KLIB 1JLCA 4YFUA 3Q8QB 1NK7A 3QZ7A 3QO9B 2IJFA 1GX6A 3OS0A 4I2PB 3QERA 1J5OA 4ECSA 2DFFA 3MEDB 4CGDA 1VSEA 3FQLA 1S9EA 1QSLA 5J2PA 3EZ5A 3AV9A 3HO1A 4PY5A 4DQSA 5KFWA 3LWMA 3LP1A 3C95A 2R7YA 5HBMB 3DLRA 4LY7A 1N56A 3PV8A 2OYQA 4ED1A 4NLGA 4C8OA 2C2DA 4LSNA 4MKBA 2VWJA 3AVBA 3SYZA 4ZTJA 4ECVA 2RN2A 3VQEA 3HT3A 2FLPA 4CJUA 4JV0A 4Z4FA 4QW9A 5HRNA 4DFPA 3RAXA 4AHRA 4RW9A 2XC9A 4TY9A 3IG1B 4WXWA 1MU2B 2W8KA 1TKTA 2Z1HA 3QLHA 1FK9A 5KT6A 1T05B 4G1QA 4IDKB 2E4LA 5KFBA 4TYAA 3RMCA 1LW2A 2C22A 4I9LA 2IBKA 2DTUA 3KK1B 1BCOA 3SFUA 2OPSA 4K4VA 4EO8A 3LP2B 3L2RA 1LWFA 5J2MB 4E3SA 2YKNB 2JEGA 4N56A 1JLBA 4Y2CA 4QWBA 3NCIA 1NKBA 3PJXA 1YTUA 1G15A 4J9KA 3KHLA 3NAIA 4RNMA 3ULDA 2OA8A 4IKAA 1C0UA 3I0RB 4KSEB 4CJ5A 4ED6A 2XGQA 2V0NA 3QIDA 2BANB 1RBVA 3OYEA 1NK0A 4FJ9A 2FJXA 1S6PB 4CECA 5HRRA 4TY8B 4IR1A 1RTIA 2KZMA 1N5YB 4DL6A 3NFAA 3QIPB 4WZQA 4BDYA 5KG1A 1RT6B 1RT7B 1RT1B 5KFSA 2FVQA 4HHTA 4O3SA 3ZSQA 2PZSA 1KSPA 4NYNA 3TWHA 5L1LA 2KQ2A 3SI6A 1X9WA 1VRTB 2FLLA 4FZYA 4B9SA 1SL1A 3MECA 3OVNA 4ED7A 3V6DB 1J54A 1C1BA 1LAVA 4J2AA 2Z1GA 3I5AA 1JLFA 4M3XA 1BCMA 3AO1A 4RNFA 4CJ4A 3ISND 2F8TA 2D5RA 1T8EA 3HXMA 3BQ1A 4ZHRB 4NLWA 3NGDA 5C24B 3ZT0A 2UVWA 1C0MA 3SUNA 2YNFB 4CFAA 2X74A 1RT3A 1O1WA 3RTVA 2JEJA 2W9BA 3RAQA 3SZ2A 4IFVB 4ZP6A 5KRTA 1KFSA 2WHOA 1DLOB 3V81B 3OYNA 2IM0A 1HNVB 2YKMB 3QNOA 5FDLA 3N6LA 4K8XA 1JKHB 4YR2A 3CDUA 5F8IA 3HP6A 4CJLA 3DOLB 2JEIA 1J53A 3P1GA 3V1OA 1ZBUA 4FJIA 4FJNA 2HMIB 3ZCMA 4NCGA 4YQWA 1KRPA 4FK0A 4ID1A 3OYAA 3DI6B 1S10A 2QKKA 1L3VA 4NLSA 1S0MA 1S9FA 1TK0A 2ZD1A 1KCFA 2W7OA 3DRPB 1T03A 3NBPA 4NYFA 1Z25A 4ED3A 3CJ3A 1S9GA 4RW6A 3JYTB 4MK9A 2FLNA 3AVKA 3QEWA 3G10A 1RT2B 3V9UA 3PW7A 3CG7A 3EYZA 2OZSA 3OYKA 4EBEA 4TLRA 4K4XA 5K14B 1S1TA 3M8QB 2WB4A 4DTXA 3AA3A 4Y1CA 3F9KA 1TL1A 5KFHA 4CJSA 3DYAB 1KVCA 3DM2B 3DOKA 1GOBA 4M3TA 1IKYB 1NNDA 1Z26A 1RBUA 2YNGB 4H4OA 1IG9A 4ZPBA 4KHQA 3DLEB 4CEZA 2B6AB 1T05A 3GIJA 3K5LA 4DG1A 4HCBA 3PX0A 4O4GA 3OS2A 4ZVEA 2D3ZA 4RW4B 2G8KA 2GC8A 4W5RA 4DMNA 2DPJA 4E7HA 2VG7B 1UWBB 3OYIA 3CJ4A 5KI6A 1QS4A 1YT3A 3T19A 4JUZA 3E01B 3I5BA 1WSIA 1JLEA 1RBRA 3NH0A 3DLGB 2LSNA 4NLTA 3PY8A 5F8LA 3K58A 3DLKA 1LWCB 4QCLA 3S9HA 3C6TB 4F2SA 3NKYA 2ZQBA 3U3YA 4KAIA 1UAXA 4EP5A 3RMAA 4CEAA 4X2BA 1XHXA 2JLEA 4O3RA 1IKWA 5CYMA 4ED0A 1QAIA 1S1XB 4Z4CA 5KGWA 4NRUA 4RW7B 4KTZA 3ZSOA 3DMJA 1L3SA 2Z1IA 3OYFA 3TABA 5C25B 3NGYA 2HVHA 3D28A 3V4IA 3MTKA 3V1QA 4PQUB 4DS5A 2DFEA 3TAQA 3IAYA 1SKRA 1NOZA 4BDZA 2BE2A 4U7CA 4IG0A 1CZ9A 1VSJA 3O3FA 3SQ4A 5E41A 4FLYA 1VSFA 1NKCA 3LP0B 4CGGA 2JC0A 2HNYB 1ZTWA 4KO0A 3PR4A 2XHBA 4QWAA 1HQEA 1U09A 5KG5A 4N47A 1WNSA 4FJMA 2R2SA 4HTUA 4J9SA 4G3IA 3CM6A 4KB7A 4E89A 1EKEA 1HQUB 3KK3A 4CJKA 1U47A 1JL2A 3NH1A 4LSLA 2W9CB 2ZKUA 2R8HA 4I2QA 4MH8A 1MMLA 1QSSA 4WE1A 1NJYA 4RUCA 4DQIA 4EBCA 1JLCB 1WSFA 2HHUA 4Q8FA 1SL2A 4OLAA 3MXMA 2IJNA 5KG6A 4CF0A 3KD1E 2ZE2A 1J5OB 1UA0A 1NK9A 3SUQA 2F96A 4XPEA 1S9EB 1JKHA 5J2PB 4AILC 4LH5A 2AGQA 1DTTA 4E1MA 5KT7A 2PYJA 3H5SA 3LP1B 3AO3A 5KG0A 2XWYA 2OZMA 1L3UA 4WZMA 1JLQA 1HARA 3NMAA 2BRKA 3RMDA 2FBVA 2C2RA 3WNFA 2P51A 4LSNB 4FW1A 4KI4A 3HPGA 4B9NA 1VSIA 2F8EX 1S49A 1B9DA 5L9XA 3U6FA 5DGBA 2AX1A 3MF5A 4YR0A 3HPHA 4EO6A 3B6OA 1CZBA 3MEEA 4H8KA 1C1CA 1I3AA 4RW9B 3KLFA 1BL3A 1D9FA 4M3UA 2RKIA 1TKTB 3QLHB 4FJ5A 1FK9B 4MK7A 4G1QB 3H5YA 1LW2B 4K8ZA 5EWEA 3HL8A 2OPSB 4FZZA 1LWFB 3H98A 4O3NA 3PZPA 1JLBB 3MAQA 4F4KA 2CJQA 1VSKA 5KFGA 4DSLA 3N6NA 1C0UB 4DTOA 4XIUA 3CJ2A 4URQU 2W9AA 4CHZA 4QWDA 3F73A 1EX4A 3V1RA 3HPOA 2D0AA 4KHUA 1RTIB 4FZXC 3OYMA 4L8RB 2WRMA 4KKOA 1N6QA 3MR3A 5JUMA 4KE5A 4K4SA 4DSFA 2DFHA 3C6TA 1W0HA 3OL8A 4EYIB 4I7FA 1HYZA 2RPIA 4O5BA 4ZVFA 3SI8A 2R8KA 3IRXA 1YVFA 3MECB 1Q8IA 1REVA 4DFMA 1C1BB 4ZP8A 5HLFA 4CERA 4FS2A 1JLFB 2BQRA 2J6TA 3OJUA 4MKAA 1WSEA 4JV2A 4EZ9A 5CZ1A 3CM5A 5EWGA 3RB4A 2UVUA 3BR9A 3L3VA 1XR7A 4GC7A 3AVFA 3VQBA 4RNNA 4HUGA 4KV8A 3LPTA 3HVAA 4J9PA 4FLUA 3HSTB 1NHUA 4J9QA 1RT3B 3E51A 4B9VA 2W9BB 1IH7A 3NAEA 4KAZA 3Q8SB 3GV5B 2AGOA 1D8YA 1UOCA 3G6YA 3DLHA 5FDLB 1LWEB 3K5NA 4Z0UA 1U48A 4CEOA 3LP3A 3V9ZA 2D7SA 1LW0A 3RB6A 1CXQA 1ZYQA 4NLYA 4CHPA 4NCGB 5KG7A 5KFKA 3GV7B 2BR0A 4DL4A 1VSMA 3AO4A 4B9MA 3OYBA 2R8GA 3CFOA 2BDPA 4YNQA 3ASMA 1RT4A 2UUTA 5KFLA 3TAEA 2WONA 1NK8A 2GV9A 2ZD1B 1KTQA 1T03B 3NBPB 3RR8A 3D0PA 1JXEA 1S9GB 4RW6B 4KFBA 1N48A 3AO2A 2XGPA 3OL9A 1NKEA 3BSNA 4Z4EA 3GIIA 4C8LA 3CJ0A 5KT5A 4FBTA 2IS3A 2KTQA 3VQ5A 3BSCA 5L1KA 1RBTA 4NYZA 4ZVHA 4ED2A 4RW8A 2J6SA 4FJGA 4FVMA 1S1TB 2GIQA 1U4BA 4XO0A 5J1EB 1TL1B 4TN2A 4DWIA 3OYLA 4KB1A 3DOKB 4F4YA 4URGA 4OKJA 4H4OB 3KK2A 4CJEA 4FW2A 3PVXA 2BRLA 3V6HA 3SNNA 3LZIA 4CJTA 2W7PA 3AVLA 4DG1B 4O4GB 1XR6A 1RBSA 3RB3A 1HMVA 3SUPA 4FM2A 1L5UA 2CKWA 4WYWA 1RTDB 5DG9A 2OPPA 3L2QA 1JLEB 3GIKA 4OKKA 3ZSRA 3NF8A 3D45A 3DLKB 1DTQA 2F8SA 4ZPCA 4MQ3A 4IQXA 1IKWB 5CYMB 3H40A 3P83D 3N6MA 1QE1A 4C8KA 4KBIA 3DMJB 3LAMA 4ELVA 2Y1IA 4RZRA 2V9WA 2KZZA 5KRSA 2AX0A 5I3UA 3V4IB 4CJFA 2D41A 3Q8RB 3OJSA 4LQ3A 2BE2B 4IG0B 1U04A 4GW6A 4CIEA 3OS1A 1S0NA 3Q8PB 1SV5A 3RBEA 2Q3SA 3ZSVA 2QV6A 3NH2A 1X9MA 4FJHA 3NL0A 4DL7A 4W5OA 4H4MA 4KO0B 1HJRA 1HQEB 2IDOA 4HKQA 1K1SA 5F8GA 3OYDA 4Y2AA 2PYLA 2KFNA 4Z4IA 4FLTA 3CQ8A 3KK3B 3ZSWA 2QK9A 1C0TA 1FKPA 5CY4A 1NK5A 4LSLB 4I2QB 4WE1B 5DLGA 4PUOA 5J2QA 4CJWA 1IKXA 4R5PA 4M3YA 1JLAA 4N5SA 4E19A 4W5NA 2QXFA 4IFYA 2ILZA 4IBNA 3DRSA 2D0BA 4CEBA 4KHRA 4DTMA 4M41A 1JXBA 3AA2A 2ZE2B 4OLBA 2JGUA 3ISNC 1LWEA 5KT2A 4Q44A 4Y34A 3EY1A 2O4IA 2OPRA 3CIZA 3HHKA 1RNHA 3MFHA 3O3HA 3NF6A 4ID5A 3KLHA 3QEVA 3M8PA 3TAGA 1DTTB 5KFYA 5KFVA 3BQ0A 1RTHA 3QGHA 1KVAA 3NE6A 1JLQB 4KRFA 3GIMA 2I1RA 1QTMA 1S97A 5KFCA 3NF9A 1XHZA 1EP4A 4DL2A 4NRTA 1I6JA 3VN5A 5KFAA 2HW3A 2FJWA 1D1UA 1YTAA 3EPGA 4RG8A 4HVJA 2IAJA 3TR8A 3MEEB 3K5MA 1C1CB 4WXOA 2FVSA 1GOAA 4K4TA 2NUBA 3GV8B 3M8RA 3KLFB 4B8CA 4JLHA 2RKIB 3VQCA 4O44A 4FLZA 2DPIA 4DTUA 5T14A 3T1AA 3RRHA 3KTQA 4NCAA 3OYCA 4ECWA 4LQ9A 5J1EA 5KFOA 1J9AA 4B9UA 3HVWA 4CGFA 4IRCA 1D5AA 1TKZA 1R0AA 2HB5A 3SUOA 4FLWA 4ZP7A 3CFRA 3ICLA 2ALZA 2VA3A 4KHSA 3RRGA 2RDIA 4O3QA 5F9LA 4ELUA 2V4QA 3WNEA 3H5UA 4ECYA 4XPCA 3RBDA 2WTFA 3VQSA 2XY7A 1RTDA 1HPZA 4E7IA 1SKSA 2FBYA 1QSYA 3QEIA 4O3PA 3PHEA 3JSMA 4YMEA 3KNAA 4KKOB 1N6QB 4ZMMA 4CHOA 4QPXA 1U49A 2YV0X 1TGOA 1KHWA 1BIZA 1T7PA 4RNHA 1FKOA 4I7FB 4TSXA 2YHBA 3TQ1A 2G8VA 3OL6A 3IRXB 3IN5A 1FXXA 4Q5VA 1REVB 1S5JA 4KREA 4CEEA 5HLFB 2GIRA 3LPUA 3NF7A 5DQIA 4AHCA 4IRKA 2C28A 4CEQA 1ASWA 1CXUA 4DSJA 2XRIA 3LWLA 1A5XA 4KV8B 3LAKA 2FBXA 1S0OA 3T5JA 4PWDA 3TI0A 2HHVA 3M9MB 3QESA 3KLVA 1U45A 2HHTA 4IKFA 1CSJA 4DTSA 3H5XA 4H54A 3AVMA 4NLRA 1JX4A 3P5JA 1I39A 1D0EA 3I0SA 2IOCA 3PX4A 5KT4A 2A1SA 4FJJA 4ECUA 2OPQA 4HUFA 4B9LA 1A5WA 2HNDA 3S3MA 1JIHA 4K50A 2O5DA 1IKVA 3LDSA 1KHVA 1BI4A 1LW0B 1OS5A 1XWLA 5DLFA 1EETA 5KG4A 3KKRA 5DG8A 5KFXA 4QWCA 3HKWA 4K4YA 1KLMA 4DTPA 2E9TA 3TAMA 5DK5A 1VSHA 3HM9A 4DTNA 3VA3A 1SUQA 2IM2A 2QE5A 5KFRA 4FXDA 4F2RA 4WFYA 2YHAA 1RT4B 5EWFA 2G8IA 1VSLA 2XO7A 3HJFA 4CGIA 2WONB 4B8AB 3BGRA 2KW4A 3S3OA 1B92A 4KFBB 4EP4A 3I5CA 4J2BA 4NLQA 4IH7A 3S3NA 3HVRA 4OKEA 1RDRA 4K4WA 4CESA 1QUVA 3FFIA 4RW8B 2XCPA 4JS5A 1IO2A 3ZSZA 4O4RA 5KFFA 4Y3CA 4DSIA 1NJWA 4BWJA 2X78A 5EUHA 3VQPA 4DL3A 4M3WA 3SCXA 2R2UA 4DF4A 1NK6A 4HYKA 2HWIA 3KK2B 4N76A 3VQDA 4CE9A 3RB0A 3KMSA 3KLGA 4MFBA 1SH2A 2W8LA 1HMVB 3KHHA 2XI3A 4E1NA 2XCAA 1Y97A 4RU9A 2J6UA 3DRRA 2BQUA 4F4WA 2OPPB 4CGHA 3EZUA 1ZBFA 3AVAA 2XI2A 5SZTA 1SKWA 1DTQB 3DDKA 1JL1A 4GMJB 4O0JA 3ITHA 1WAFA 4KI6A 4N41A 1BQNA 3L2UA 2YNIA
chains in the Genus database with same CATH superfamily
1MWZA 4WFXA 2W41A 2ZUGA 5FRMA 4LF8F 4DEZA 2BJEA 2B0GA 5I3UB 4NXMJ 3S6EA 5H9EJ 3FC9A 2P9KB 3M1VB 2DRBA 2HBJA 4WIQA 3L4BC 4J9LA 3U3GA 1Y7PA 2G2YA 1NGAA 2XZDB 4HWIA 5MLCQ 5D78A 5JXSA 1BHLA 2KJVA 4ILRA 3WHIA 5BR8F 3VGKA 1OPZA 2E5JA 1U0HB 4JRPA 4GVBB 2V8GA 3CCRN 2WSEC 3KD5E 3K2PA 4OV1A 4A47A 1UFLA 5LMUF 1C0TB 1FKPB 4DV6J 1CLQA 2XLJA 3DOMB 5IV3A 4N8NA 1HBMB 3M9OB 4ECTA 4I6MA 2MY7A 4X4VA 2VQEK 3SJJA 2R8JA 5BR9A 5BYSA 4C0HA 1VQSA 3HSDA 1HLUA 1TTHB 1S59A 1EARA 3TJ8A 1P27B 5ETLA 4CF1A 1ATRA 1RTHB 1X9SA 1H2UX 5L9NA 3OHBA 1HWJA 5KFJA 3D2EA 2P9NA 3VGMA 4C97A 1CJKB 3I56N 3VHQA 2AEMA 1NDLA 4X66J 3WNGA 4YY3F 4L74A 4O3OA 1HWKA 3CPEA 2IAJB 1Q18A 5A8RA 1OVYA 2DR6A 1V4SA 3OR1B 4UQGA 5AJ3F 1VLYA 2JWNA 3W5YA 5ELZA 1R89A 2UUCF 2R42A 3M2UA 3W9JA 2N7CA 3UDCA 1T95A 3A8JA 5A8KA 3MI7X 4PL8A 3VQ4A 3MMAA 1BC6A 3GYNA 3KHYA 3T1HJ 2QA2A 2A6OA 4ES3A 1UW9A 3BREA 3SXLA 1H38A 4ILLA 5M1QA 2DPNA 4KTQA 1BA0A 3H59A 1KVJA 2RF2A 3FCWA 1KVIA 4OHVA 2A1RA 4JK7A 2BE7D 4RNOA 1VQNN 2V8PA 1YBTA 3TUZC 2G13A 2KI2A 5HL7Q 3IS9A 3MEGA 2QA4S 3G82A 3ZLJA 2RRBA 3EE8A 5JS1A 3QYYA 3ZZPA 4LREA 3P96A 1M1KO 3K57A 3HHLB 1AZSA 2G8FA 2KHCA 2DXEA 1KOHA 3PW2A 4PKDB 1KVKA 4K4ZA 3CJAA 4CBXA 1OH5A 2K7JA 2DNOA 3I8DA 4IRDA 4ZOSA 4B3TK 2V34A 4OJRA 5ADXA 1I51B 3OLBA 4J9OA 4LR9A 4P9SA 2Z1JA 5B0GA 2WBMA 3LDPA 4TQSA 3UDLA 1A6LA 5EN1A 3POTB 1Q9YA 4JS4A 5D0GA 5KFMA 5I42B 2DB1A 3MM6B 1U2CA 5FLXU 4CRJA 1ROFA 4DR6J 2ZWPA 4H5WA 3T5KA 3TA1A 3E1YA 4Y65A 2QN6B 2HBYB 3I0SB 4D3GA 2VQFF 2E6MA 4ALZA 1IG8A 3K9JA 1IBMF 1LFWA 3IGVA 2I9SA 2K1RB 2OPQB 1Q7YO 1Q5VA 4M5HA 2DXDA 4JV1A 1TAQA 2AQ4A 4ECXA 1NGIA 1K8KB 3UKUA 4BE0A 4CF9A 2YX1A 1EXQA 5F8HA 2E1PA 3MWBA 1U6FA 3AOCA 3I87A 1UA1A 3AXKA 1SUQB 4AD6A 2UXBJ 2HBRB 4UF4A 3VA0A 3NXZA 2AU0A 3Q8VA 2HMPA 3US5A 1R31A 2DR7A 4JYAJ 4EYHB 1IBKK 4EWTA 1S4EA 3G6VA 3OYJA 2E9ZA 4CLSA 1OYEA 2Q1LA 2AGPA 4FM1A 4YS2A 2YHXA 2DNRA 4Y0WA 1WSJA 1Q8BA 2Y0BB 4GNIA 2GJFA 1N32F 4DL5A 2EWSA 3HF5A 1RTJA 1S7HA 3OBIA 1VQ5S 1G7CB 3SAFA 4QZVB 4D3HA 2XBPA 3FFIB 1WSHA 4YB1P 5K8MA 2G8WA 4F3TA 3CJ5A 1X4CA 4FM0A 4NXNK 4NA1A 3W61A 1VIOA 3GZ7A 2BW7A 4NMLA 2C1EB 4CJPA 2ETJA 1XMOJ 2DNHA 3HK2A 1XQSC 4PEOA 5D0EA 4WQ4C 2ILYA 4NPOA 2ZZNA 3QQCD 4FJLA 2J76E 1FWLA 3M9NB 2P6SA 3D6HB 2L08A 2MKYA 1P9QC 3ITHB 3TQEA 4OO1J 1SCJB 1RHUB 1SC6A 2H3GX 2GBZA 4DUZF 3P45B 3G86A 2HF3A 3EVWA 5IWAK 2DY4A 2EFNA 3M2RB 2YH1A 4HCCA 1SC1B 2FF6A 4LF4F 1AUDA 5GIPA 3MOJB 1RKIA 2BJ1A 4CO1A 1TL3B 4MO4A 2PBDA 4ZIVA 2XNRA 3S8SA 1TFYA 3KLEB 3ZT1A 3UVJB 2CPIA 1VQ8S 3QFUA 1FWKA 4R0EA 4BQLA 1SI9A 3HZ6A 1BISA 1J6ZA 1A9NB 3HVTB 4ZP9A 4U67L 2C2MB 3DLLL 3I0RA 2EK1A 2AKWB 1X4FA 1D8ZA 3ZFVA 3QMLA 3CDEA 1WSGA 2RJZA 4LF9J 2FF3B 1PJ6A 3AQOA 1IQZA 2V4RA 5J1PA 4M63A 2XTJP 3QZ8A 1VK0A 3CCSS 4B3OB 2E1ZA 1S6OA 3VR1A 4ED5A 3T9NA 4ZK7M 1R7IA 4ELTA 3FZKA 5JVGL 2MGZB 4IR9A 3DLBA 2R2TA 3RGIA 2LCWA 2O4GA 1LAWA 4C11B 4KGVB 3V6DA 1W25A 2HAIA 4BE2A 2BZ2A 2DR8A 2MEWA 1YRXA 1TFWA 1O13A 2V7YA 2WW4A 4QW8A 4ZHRA 1CC7A 4M7YA 1GLCG 3OSPA 1VRUB 2LVWA 2J9DA 4M5DB 4X65F 2YQ0A 3GILA 5KT3A 3FMWA 2CNNB 3OTEA 3AA4A 4WQ5A 2QM1A 1HNVA 2NNWA 5KTQA 4ES2A 2VD3A 1EZZB 3ZSXA 1HD0A 1YZ7A 3ZZYA 3DN9A 2NRTA 5KG2A 4Q0BA 1TV6B 4LIRA 4ZTFA 2LQ5A 5DQGA 2AP6A 3NGZA 1LFPA 3C7NB 2G8UA 3D6TB 3DI6A 2XSJA 5C2CA 4RUAA 3D0IE 1NG9A 3L2WA 3I33A 2C2EA 5D3GB 1MA9B 2W1BA 3NGTA 2HVIA 4JK8A 3QT7A 1KAYA 3NGIA 3MHYA 2MJNA 3R8EA 2H48B 1B99A 2H4WB 5DDQC 2FHMA 5B8HA 4CFBA 3UDEA 1MLAA 3WQPA 5C7PA 2FVRA 4CJ7A 2DITA 2CPFA 4Q2LA 8ATCB 2DNQA 2HHSA 2B9YA 3CVKA 1WELA 3ZTOA 5DGAA 1IKYA 3QJPA 3G6EN 4NZ0A 2W42A 1PGZA 2DK2A 4KHMA 1K73T 2EC0A 4AHTA 2VWKA 5KFIA 1DEJA 1O0PA 2X1GA 1KOOA 3JAMU 3M8ZA 3THPA 2HHWA 2IC3B 2VG7A 1TKDA 4BR0A 2IRXA 1TKXB 3RMBA 4BLGA 3E01A 2D69A 4K7QA 4R25A 3O08A 2QTWA 3ZT3A 2XULA 4FDFA 2HVDA 4M5MA 1LWCA 1NOYA 3M7VA 4M94A 3SQGA 4CGJA 1DARA 4YOEA 4MO5A 4PPZA 4CEDA 1S1XA 2KXHA 3LGMA 1H74A 3BQ2A 3TVKA 4JI1J 4ZVQB 1RXOB 2RS8A 4HTLA 2B4UA 1UTAA 4URSA 3WNHA 4PQUA 3O4QA 3IKMA 3GCXP 1JLGB 1EAYC 5DO2A 3IRWP 1C6VA 4DV1K 4DJBA 1QVFM 1OQ3A 4DCHA 5IQQA 2I38A 5HROB 1WSVA 1S1VB 1YTYA 2AJFE 2HHXA 2XEXA 5F8JA 3QNWB 4YB7A 4IYQA 4RWWA 3ET6A 1S1UA 4DV4J 2J8SA 1Y5NB 5LMNK 3SCLE 4LF2A 3VVTA 3LGNA 3R1LA 3W9HA 4OX6A 3R5AA 1NMEB 1RP5A 3QATA 4R8UB 4XEIA 5E0OA 3AY9A 4NLVA 3KLIB 1H7XA 4TU8A 3J8AA 3W0LA 3QZ7A 3QO9B 2IJFA 1OVQA 1GX6A 1Y00A 2DFFA 1RBLA 4QS7A 3H1VX 2HHHK 1S9EA 4QPTA 1QSLA 5J2PA 3AV9A 3CCWA 4DQSA 5KFWA 3LWMA 2AYGA 4LVOP 5AQHA 3UKRB 1CULA 2MHEA 3LP1A 3C15A 2R7YA 4QYZJ 2GZOA 2OTLN 4RUHA 4ZJLA 4F7VA 5IQ6A 4DV3F 1T9XA 3UN5A 2C2DA 4V19X 4JHDB 4X62F 4MKBA 3ZX2A 2VWJA 5LT5A 1WDTA 4ZTJA 5KPTA 4ECVA 2RN2A 2AYMA 3LTOA 3VQEA 1V5IB 4N7TA 4DV5J 2GFFA 3MM9A 4FNIA 4JV0A 3QRQA 4X4NA 4Z4FA 4QW9A 5HRNA 4DFPA 3TSPA 4CZMA 3PIPQ 2GTDA 1RACB 1TUYA 2ROGA 3BGOP 2Z1HA 4W90B 4A8SA 1RJJA 3RMCA 1BXNA 2X51A 4I9LA 2IBKA 4EO8A 1LWFA 5J2MB 2NXUA 1UJ4A 1R8CA 3NCIA 3HSGA 3PJXA 3ULEA 4RNMA 2MPUA 3ULDA 2OA8A 4OMFG 2RVJA 1C0UA 5LSRA 4KSEB 2FZCB 4ED6A 3O5TB 2BANB 1N33F 1NDPA 3OYEA 1OY6A 2C3MA 2DD8S 2FJXA 1S6PB 4P2FA 3ULHA 1ZXOA 5AQPA 1RTIA 2KZMA 1N5YB 1JCEA 2ZBRA 5JMVA 2NSBA 3CCEN 1NU4A 4WZQA 1YIJS 1R8HA 5KG1A 3MAAB 1RT7B 2FJBB 1G2EA 4OX9F 1RDWX 1X9WA 1VRTB 2FLLA 2E5LJ 4FZYA 3JS9A 3OR2B 4B9SA 3M2VA 3IWXA 4IO9Q 3C6AA 2XNQA 1OYDA 3FFKB 2QTDA 1AW0A 3I5AA 1VYAA 1BCMA 4RNFA 4IEEA 2PAVA 4NLWA 3J7AP 5C24B 3D54A 3ZTSA 4AE5A 2RNEA 4G6VB 4GKKF 3SUNA 3PFEA 1H73A 1CS4B 1QAXA 4X4SA 1X5TA 2N3OA 4DR4K 4X64F 1ZM2A 4IFVB 5KRTA 1DLOB 3V81B 2RDDA 1RQ0A 1VIXA 3A3NB 3LDOA 4GKJK 4NL5A 3DHXA 5HATA 4GY2B 3T1YK 4DHVA 3DHWC 2JEIA 1J53A 3WXKA 3P1GA 4E98A 2W25A 1EKSA 3E3XA 4NCGA 3X3UA 3BYPA 3OYAA 5M2RA 4KHPK 3VALA 2B9WA 2H5EA 1L3VA 3CC4S 4P10A 3H3NO 2UU9J 4DUYK 2ZD1A 4ILGB 4JKAA 1T03A 1WC4A 4NYFA 1PG5B 1RE1B 1X4EA 4MK9A 2FLNA 3AVKA 3NP5A 3G10A 3QEWA 1S12A 2A40A 3EUNA 2QX0A 2CNOB 2ZJRL 2O67A 4JI3F 3OYKA 3E66A 3O9RA 3FJ2A 3R5CA 4EBEA 4TLRA 1PBAA 1WUAA 4YDUA 5K14B 1N8RT 3M8QB 3OFHA 4Y1CA 2GGPB 5AQTA 4AXIA 5KFHA 4X4OA 2VQEF 1FI4A 5A2QO 3DM2B 4RX6A 3GMGA 3HFVA 1OKJA 1Z26A 4IJNA 1IG9A 4ZPBA 4KHQA 4ZVPB 1YHQS 2F9DA 1KQSM 1FTRA 4FVCA 4ZVEA 3CMES 3N28A 3I55N 2AP1A 2D3ZA 2A2DA 2GC8A 4W5RA 4DMNA 1UWBB 2CQIA 4JUZA 3MGJA 1JLEA 2DTJA 2FUG9 4G65A 3BEXA 3KNGA 1U2VA 3NH0A 4ERDA 4A8MP 1AYEA 4OYZA 4F2SA 4CNYA 4KAIA 4EP5A 3QRRA 3RMAA 2CDQA 2E44A 4LFAK 1XHXA 3QFPA 2ACMA 1JCFA 4DR2K 4O3RA 3H90A 1QAIA 1B7FA 2XMVA 1U25A 4RW7B 1YRTA 3WX8A 1L3SA 5EHHA 3UE5A 4WTOB 2HVHA 4GVEA 5B0EA 3MTKA 2HOEA 3J7ZT 2DH8A 3C46A 5DM6Q 4IG0A 1QVFR 2VGMA 1IR0A 3O3FA 3SQ4A 2LQBA 3ZTPA 2N7YA 1FKAF 1SC3B 4F9OA 2OMLA 4AL7A 2HNYB 3QBXA 3KFWX 3IR6B 3PR4A 2XHBA 4DU8A 1HQEA 1U2FA 4YEAA 2R2SA 2MQOA 2V9KA 4J9SA 3CM6A 2BJDA 1MWYA 1HQUB 1U47A 3NH1A 1PC4A 2W9CB 4J8FA 3HT0A 3UWTA 1YBUA 3HJVA 1SZ2A 1QZ5A 3MM5A 1EQMA 2OTJS 4L3KA 1NNEA 1JLCB 2J0XA 2HHUA 1SL2A 4AFFA 3JXUA 5CXTA 5JJBA 1J5OB 1UA0A 3SUQA 4YY3J 3QJLA 2NRRA 4NXMK 3TTCA 2NREA 5H9EK 5M1PA 2W40A 3CJ1A 1KC8T 5AJ3J 5GAEU 4B3TF 3TYTA 3U1NA 5M1OA 3NMAA 2RQMA 3C14B 3WQUA 3ADAC 3OD2A 3WNFA 2P51A 3HM8A 2LDIA 2F8EX 3R2DJ 2MZQA 5DGBA 3R2CJ 4DV6K 4ZCMA 3MEEA 2C3YA 3TUIC 4KH5A 1C1CA 2W2QP 1VLOA 3OTOJ 3C65A 2GO8A 1BL3A 1XC3A 2MQMA 1TKTB 2F40A 3QLHB 3GPAA 1NSAA 5IV4A 1VBXA 5EWEA 4DR1J 2OPSB 2V51B 3CCLN 1VQYA 5A8WB 2Q97A 1WHWA 4P75A 5KFGA 4DSLA 4ATNA 1ZAXA 4AUKA 3TJ9A 5F0WA 4L76A 1BWFO 2B8QA 4XIUA 4IOAQ 4BCAA 4CHZA 3GIRA 4JI4F 4Z94A 3H2VE 3V1RA 1N34J 5L8RC 3AJ2A 1NSPA 5EOYA 4QIEA 4X66K 2FHKA 3J80U 1EQ0A 3HSZA 4K43A 1EKRA 2DNMA 2PEHA 5KPRA 1GMVA 3OL8A 4PKGA 4KBOA 2HS0A 4Z2XA 3IRXA 2MLXA 1YVFA 2NZTA 2LXUA 5D4LA 4DR7J 2YJEA 1C1BB 1D9AA 2VQFJ 2ZWOA 3T1HK 2FDNA 5EWGA 4OHWA 4H5VA 2NXEA 3L3VA 1XR7A 4GC7A 3AVFA 3VQBA 4RNNA 4HUGA 4OYAA 4GMKA 3MOZA 1MMNA 3HVAA 3LO3A 2V2VA 4DX8H 3MUVP 4FLUA 1CG2A 5C15A 2EVZA 3EDRB 3TSQA 1RAOA 4KAZA 2F9JA 1P90A 3GV5B 1QZ6A 4CLPA 4USWA 1Q7LB 3DLHA 2CQ0A 5GADU 1LWEB 4FYXB 3K5NA 4KRWA 4X4RA 5ETMA 4CEOA 2DNKA 1NRKA 1LW0A 3RB6A 4JBCA 1O51A 3FGVA 5IWAF 4AYBD 3GV7B 4DL4A 3DFEA 4UW2A 2ZH3A 2OKQA 2I7NA 2F7TA 1WEZA 3TR5A 2MJUA 5AXLA 2MKHA 2BDPA 1S57A 1BUPA 1RT4A 5EXWA 3QJJA 1KTQA 2DGTA 2VBZA 4M5JA 5M1FA 4HTJA 1JXEA 3D0PA 4CT8A 1N48A 4I1TA 2NXNA 1VBZA 1NKEA 1FDBA 2KH9A 4IQMA 4DR6K 5HQMA 3Q8YA 5KT5A 2KTQA 5L1KA 4FYWB 4NYZA 2ZVIA 1Q81T 4ED2A 4RW8A 2J6SA 2R7UA 3UE2A 4YOVA 3G8SA 1TL1B 1YLXA 1W97L 2XMWA 2MMYA 4FWQA 5EVZA 4LF1A 3R5GA 1M5HA 2JWKA 3QT5A 4EHUA 3WBZA 3ZZRA 4URGA 4OKJA 1KQSR 2D1CA 4PXDA 1N5QA 3JQKA 2O8BA 3HOSA 3OTCA 4HI2A 5GMKa 4KH4A 3D2FA 2W7PA 3B8AX 4Y2MA 4C7QA 1ATNA 3B6BA 1RBSA 4A5BA 2H5IB 1HX1A 3DLJA 1L5UA 2QSFA 1RTDB 2UXBK 4CLWA 2QI2A 4OYWA 3L2QA 4JYAK 3GIKA 1JWWA 4FOIA 4CLLA 3VAMA 1ELOA 3D45A 5EX0A 2IVFB 4WFNQ 4OYOA 2IBOA 4EIAA 2L3MA 3CCJN 2HQFA 1X4DA 2HZCA 1UJ6A 2DISA 3TX0A 2A41A 4MQ3A 4FF4A 1RHQB 5CYMB 3H40A 3RSEA 4MLEA 3MDQA 2YVSA 4BBYA 2QC3A 2AYBA 3IDHA 4ZPWR 1NWKA 3D1HA 4RZRA 3V4IB 2HFUA 3Q8RB 2E29A 4LQ3A 2QRRA 3FZMA 1NSQA 2BE2B 1U04A 3L6QA 5E3AA 3ZSVA 2FIUA 3KG0A 2HBMA 3NH2A 5A2QU 1QD1A 4CO3A 1HJRA 1XMOK 4BQZA 2KFNA 4FLTA 3CQ8A 3KK3B 2QK9A 2CWKA 1GK8A 2CQBA 1FXLA 1NK5A 4LRDA 5IZHA 3O4WA 4OZ5A 5HMXA 4OX8A 3ATVA 3BM7A 2ERRA 2HRTA 5J2QA 1IKXA 2IVOA 4IFYA 1XMQF 4HVZA 3HBTA 4CEBA 1U02A 1G3OA 1EO1A 4FWPA 1F5AA 1JXBA 2ZE2B 3OVBA 3HRGA 4X65J 3NOGA 1NUEA 4RPFA 3UR3C 3IXQA 4C3MA 3O3HA 3NF6A 4ID5A 4EHTA 2KT3A 3CT9A 5AQOA 1RTZA 3OUYA 1WUUA 1VBYA 4K41A 4DV0J 1KVAA 1JLQB 3IM9A 3CQYA 1GNKA 5FJ4A 3TUJC 3NF9A 1XHZA 1EP4A 4NRTA 5HO4A 5KFAA 1VHIA 1TUWA 1QHAA 1HBOB 4B17A 4LF9K 3DU6A 5LXRA 4K4TA 3U27A 3LUYA 3KLFB 4JEPA 3J81Y 2VOOA 4P74A 1HR0J 2DPIA 4DTUA 4OJHA 1V4TA 5T14A 4PZVA 3KTQA 4NCAA 3K9KA 3OYCA 2CGKA 4JKHA 3HVWA 4IRCA 2CH6A 1R0AA 1BA1A 2WVEA 5F2RA 4DV1F 1UKUA 2ROEA 3WNEA 4XPCA 3OPKA 1U6BA 2YWGA 4ZIWA 1SKSA 2FBYA 2H65B 4WJBA 3KUGA 2Z2MA 5LMNF 4QPXA 4LF7K 1U49A 5KPZA 4I7FB 3T41A 5BPLA 3TQ1A 4FYVB 3K7RA 3OL6A 5DJBA 3NVKA 5HLFB 3GDQA 4AHCA 4LMZA 3P39A 1CQMA 1CJVB 3U4LA 5LM7E 2HHHF 2XRIA 2B9XA 4B3RF 2LMIA 2YWEA 2EBEA 2FBXA 1A7GE 1FCAA 5C12A 3TI0A 2E8AA 1JJ4A 3GFYA 1CSJA 4DTSA 4OZ3A 4UZCA 2BKOA 3A5OC 3W3DA 3M30B 3AA9A 3P5JA 1D0EA 3Q89A 3AODA 2ABYA 3MM7B 4FJJA 2H51B 5LJVA 3F2KA 4HUFA 2HLUA 2HNDA 2BJ7A 3S3MA 1OWXA 3SBMA 2CQDA 1M90T 1JIHA 4K50A 2O5DA 1Q82T 4C9DA 2GMHA 1GTEA 4RU2A 1M5OC 3GJTB 3EKSA 2QFJA 1MMDA 2CFXA 1EETA 5KG4A 3KKRA 5DG8A 4QWCA 1KN6A 1NU0A 4BC5A 2FTRA 1ULRA 3TAMA 4TU7A 5DK5A 1H0HB 4DTNA 2ASYA 3J7AN 1YITN 3THXB 3CXCM 2E1YA 1VI7A 2CPEA 1ICEB 2YHAA 3LDQA 5AZIB 4XK8C 3IAS9 2XO7A 3HJFA 4HACA 3U7JA 3UDVA 1DRZA 4DX7A 2LFVA 5IM0B 1XK8A 2Y3YA 4DB3A 4ISFA 5KAKA 3OT9A 1RWXB 4BC3A 1FJ7A 2XLIA 4JS5A 3AHPA 3ZSZA 3NGKA 1GFWB 2V63A 2IFXA 2QYCA 1GLAG 4O4RA 4DV2F 2YQ3A 4UY8T 4DV3J 2X78A 3VQPA 4RBUA 4DL3A 5GAGP 4M3WA 2ZGYA 1JJCB 4X62J 1ZA1B 3SCXA 2BYCA 3M32A 2R2UA 4JI1K 3KK2B 3TU5A 3AFGA 4U96A 3ETMA 1UPMB 3R8YA 1IQTA 2VBXA 3KMSA 2DRDA 4MFBA 2JVOA 3QBCA 1HMVB 3JQMA 4AT1B 3KHHA 5AZJB 4CZIA 1Y97A 2RRNA 2BQUA 1K9MT 4WCEQ 4B1VA 3K8WA 3O80A 3PYFA 1NH8A 5AT1B 5SZTA 1CEZA 4GMJB 4DV4K 1FE4A 3PCOB 2CJYB 4N41A 1GQEA 1HIYA 5G0RB 4DR4F 3CGIA 2YNIA 1HUXA 3OLAA 2CQGA 1U1NA 4L6V3 4C0OC 4KHNA 1RSCA 4WF9Q 2D1KA 4E2FB 2KLAA 4M7XA 4B1ZA 4WFAL 4IOCQ 4QIWD 2IGIA 4TVAB 4CW7B 2ITGA 3T1YF 1S1WA 2E2QA 1SV5B 2U1AA 5CYJA 2XWXA 2WK4A 4OPJA 1OSCA 4M42A 2ZBCA 3TOQA 5L1JA 3CJ8A 5FPNA 1RWPB 2ZHOA 3PACA 4KHPF 3QBWA 4DOZA 4QYZK 1WKLA 5DDPC 3FBCA 1YXQA 4A59A 3CCMN 1K44A 3IBWA 2UUAK 3MN6A 1NMDA 4Q45A 3PIPL 5T7LA 5CH7B 4J9RA 3GE1A 1URNA 2H3EB 4FF3A 3LGHA 2E7VA 4WYBA 2OD6A 3MXHP 2PSZA 3LALA 5LJWA 4DV5K 2EBGA 2Z30B 3TARA 5J2NA 1HI0P 3DRSB 5IT4A 3A5NC 1HPMA 4NYOA 3B54A 3FSXA 1CZAN 3PW5A 2YPYA 3VF4A 4Q8EA 2JJ4D 3L3CA 3BJYA 5IT9U 2OPRB 1HNIA 3AA5X 2DXFA 3M8PB 2HIYA 3KOAA 2MYFA 3CFPA 3EXCX 1KD1T 4PG8A 3VWSA 5CHIA 3L8BA 1F2HA 2DIUA 4ED8A 3NCQA 1RAJA 3QFHA 3O9SA 3CTRA 4FS1A 4FBUA 4HH0A 8RUCA 1HWLA 4GC6A 3TA2A 2HIQA 5HP1A 4Q43A 2V50A 4CLKA 4QS9A 1FFSB 4DR2F 3DXKB 3AJDA 1IJFB 5HVHA 2E5LK 4P72A 3A12A 2QLXA 1TR0A 1TKZB 3WX4A 2E1AA 2ZH4A 4JI3J 4PRFA 4WWSA 3NNAA 2B43A 2VG6A 3CD7A 3BV8A 3V6JA 3THWB 1WJ9A 2GELA 1BY9A 3EICA 1LK5A 3PJWA 2VONA 1S4FA 1X0PA 4NZ6A 4ICLA 3MR5A 5KFZA 1VQ7S 5E26A 4CK2A 2C2ZB 2KYZA 3TZXA 4BACA 1SQEA 2CZVC 2ZEJA 3JSMB 4FVUA 3HTVA 4C8YA 3C16A 2BKNA 2QWRA 2HNZA 4OYXA 1NJXA 3AD7C 1FKOB 2FY8A 3PSIA 3R1XA 2QJ3A 5EU7A 2WVCA 3C6UA 2NYIA 3FVYA 4CO4A 1CVJA 1T94A 1HYSA 3KJVA 1WD6A 3IM8A 1YQHA 3KWMA 1NLVA 3OL7A 1RHJB 3BZQA 2XS5A 2J4RA 1FXRA 1QQCA 2NS1B 2P5GA 4NXMF 2F8MA 3UNGC 5GAGI 2AA4A 1UVJA 4JNEA 4PWDB 3R6GB 3D6MB 2DHXA 5CZXA 5DQHA 2EW9A 4JI7F 2LP4A 2CJAA 4BG9A 4RJVA 2UU9K 1ZC6A 3FEZA 2R9LA 4B3SF 1FJGF 2YKAA 4ITSA 3WZ0A 4CD3A 1WF0A 2V8DA 4FLXA 2X1FA 1AXQA 3ZX0A 4C3LA 1MWKA 1X4HA 2UVVA 2YNHA 3N4WA 3I4PA 3DNCA 1BI4B 3F44A 3E9PA 3DRYA 1N54B 1YK9A 2P8IA 2C3UA 4BVPA 1ZAVA 1WC5A 2BUNA 1PYTA 3RBXA 1HI1A 1F9EB 3VQQA 3ZT4A 4F4AA 3JQJA 3SIPB 3CXCR 3SQ2A 1BGXT 3G9CA 4QR0A 1XNRJ 4I6WA 3OYHA 2JEFA 3RVCA 2RAQA 4H5TA 3MZIA 3BGRB 3MCNA 2FVPA 3IP0A 5DDOC 1BIUA 1H2TZ 4M45A 4X4QA 2KFZA 2D0CA 3MXIA 3OXGA 3CHWA 5C42A 5E3PA 3ZTQA 4CJVA 3W62A 3H4DA 3QNNA 3VCDA 1OY8A 4NEYA 5AQMA 3AJ1A 2I8EA 1X4AA 1S5ZA 2AJQA 2RE1A 2ZFHA 2J7WA 3MEDA 1R3NA 1EX8A 1X5PA 2O8EA 3IBFB 1FESA 4WU3A 3KLGB 1F9FA 4RKUC 3G8TA 5C10A 4RBVA 3SMZA 2XYHB 3DRRB 1D4XA 1WLJA 4XH1A 3L2VA 2W01A 2WSFC 2FJVA 2YWFA 3T5LA 3CC2N 3RR7A 3EGZA 2ZNZA 2DGWA 2ASLA 3I9V9 4UTGA 4LRBA 1BQNB 5U47A 2MHNA 1TAUA 1Y3KA 5HRSA 2DCUB 4J2DA 1Z05A 2AW0A 1I94J 3I8BA 1MU2A 1TYQA 2GJIA 4JI4J 4Z4HA 4IDKA 2V6AA 3W60A 2EWHA 3PRDA 4WFBQ 1TUGB 2W2MP 3LP2A 2ZJPQ 1L3TA 2GAGC 4F50A 4YY3K 3I6PA 1VSDA 2V94A 1BQMB 5AJ3K 4BG8A 1KWMA 1ZPVA 4LD0A 3VQ7A 1WEYA 3LL3A 3M8SA 4TY8A 3FZLA 5F9NA 2BX6A 1QVGM 1O8BA 3HI9A 5I42A 4I6MB 2Z2ZA 1YX2A 3O4NA 1RT6A 4ETZA 1RT1A 4DR6F 3CC7S 3SFGA 4MYUA 3KHGA 3AOBA 3OTOK 4Z4GA 3FZFA 2X6NA 2AEFA 3N5FA 4CK1A 3QAEA 1P9YA 1K1QA 4NLXA 4J9MA 3BEGB 4DR1K 3WC2A 4IOAL 4U6PA 4CF2A 3M6GA 1FRIA 2L9NA 3HULA 3O9UA 4AHUA 4DTJA 2VWBA 3BO4A 1GOCA 2P9NB 3CI5A 2BA9A 2KT2A 4DZDA 1R0CB 2YX6A 3MR6A 4QQBA 2DGQA 4BR4A 4JYAF 3MAHA 3MXJA 1XC9A 2C3PA 5A8RB 2RQCA 1N34K 2Y8YA 1MWMA 2CQ3A 3IA0A 1F2GA 2AD9A 3TUPA 4F25A 4EMDA 3M2UB 1WTFA 5A8KB 3M8YA 1WC3A 3DOLA 3MMAB 2B4JA 3DAWA 4FK4A 1HBNA 4BWMA 2QA4N 2IVNA 4P2MA 1URRA 4HTIA 4DPWA 2BTFA 2X6SA 2ZH9A 4DR7K 2MTLA 2RF2B 4IEIA 2VQFK 2W4PA 4WU2A 3GU0A 3BH7B 2PI5A 3EMTA 1RA7A 5GADI 3D3BJ 2OH2A 4DS4A 3DRPA 3GR0A 4MIBA 3KUEA 4RLEA 2JFDA 4ZVOB 2QWNA 1WAJA 4I4BA 3IS9B 3PW0A 3MEGB 1WN7A 3G82B 2VFUA 1XR5A 2HHQA 3T3FA 2R2RA 5F8NA 2R7VA 4C8MA 5IFMA 1AZSB 3BSOA 3LPEA 3DYAA 1SS6A 3AGRA 4JI6J 1WG1A 3WXJA 1BO5O 2YNGA 2ASDA 2QKBA 2G0CA 4BRAA 2YX4A 3R3TA 1SQFA 2B6AA 4QU6A 3PX6A 2QMXA 1VK3A 4A8YA 3MN5A 4RW4A 1Y4ZB 5AQYA 1IM4A 1WNEA 4AHSA 3NMRA 2CPJA 2ZM6J 4OZ1A 3X1LB 1UP1A 1R27B 2HAFA 2R3VA 4Y6IA 1H6KX 4PL7A 1YF5L 5KFEA 2J7KA 4DU4A 4OJGA 4DX6A 1Z2ZA 1X3NA 4DSEA 4BVOA 4CWBA 2ZOGA 3VGLA 3C8YA 4ZLJA 3KHRA 4O23A 4LF9F 4AXJA 3UKUB 5C25A 4AL5A 1Y0HA 3L3UA 2M3DA 1HA1A 4F3OA 3QINA 4M5NA 4MJKA 1VQ5N 3ENBA 3MR7A 4O55A 3QB0A 3MPVA 2VF3A 1QHTA 3UIQA 1FRLA 5BYQA 3GG1A 3J7ZO 2M5YA 2P5OA 4WFNL 1XMQJ 4CFDA 3D7EO 4PHTX 1RCHA 1VQ6N 1P8ZA 3QEXA 3FDSA 4OGEA 4LF6K 2YKQA 4ZJQA 2P9SA 2ZJQL 5HI7A 4KC5A 4OYBA 3SQOP 3T5HA 1RTJB 3Q0AA 1QJHA 4ZPAA 2AT1B 2M88A 1K8AO 4X4PA 1W7WA 4YFUA 1TL5A 1XN9A 1NK7A 4LF7F 4Z7YA 4OI6A 3OS0A 4CZCA 3NNCA 2HFZA 9RUBA 1NZ8A 2L9WA 3EZ5A 1OY9A 4OYPA 4ZPVR 3HO1A 4DZ6A 1K0TA 3CCVS 1RUSA 2YH0A 1KC8O 5E2QA 2MLYA 3N4QA 3Q2TC 4EUVA 3IFEA 5TKWA 3L9ZA 3AVBA 3A1YG 5CABA 2DVIA 1VQ8N 2R7OA 4AF1A 2VODA 4ZVTB 3CUNA 4NZ7A 4BRLA 4CJUA 1NGGA 4OHXA 3RAXA 2CAJA 4OIXA 4RW9A 4WXWA 2W8KA 2PFUA 5KT6A 4JI8J 1KDNA 4G1QA 3IR5B 2WVDA 1LW2A 2C22A 2QWPA 5I3QA 1YG0A 5AQWA 2DTUA 1BCOA 3FBFA 2GQ2A 4X65K 3CCSN 3GCWP 3T69A 2JEGA 1NM1A 1ZAWA 2YWWA 1E6VA 1LCUA 1YTUA 1G15A 3MCOA 3NAIA 1M0SA 3I0RB 2M70A 4DV0K 1LK7A 3QIDA 1RBVA 3NRBA 2E1RA 1NK0A 4FJ9A 2I0XA 1QVGR 4WP3A 3B4DA 3VVUA 4DL6A 3VMFB 3EX7B 4B3RJ 3ZEUA 4HHTA 2Z0GA 5D77A 7FD1A 4O3SA 2GX8A 2PZSA 1KSPA 2KQ2A 1Y10A 5ETNA 4WPAA 3C19A 3D0GE 4HEA9 1SL1A 1J5EJ 3CDAA 2F5GA 3MECA 1OSDA 1S99A 4ED7A 1HR0K 3V6DB 4O0NA 1LAVA 4J2AA 3TVZA 2Z1GA 2XMKA 5FLXY 4M3XA 4JI1F 3A3PB 3AO1A 4CJ4A 1Q5YA 2F8TA 2OSQA 2MQQA 2D5RA 4IFEA 2CXEA 3HXMA 4ZHRB 1LXNA 4HLBA 3ZT0A 2UVWA 1KQKA 4CFAA 2HQIA 1RT3A 1ATSA 2YX7A 5JMNA 1O1WA 2W9BA 4M8LA 3SZ2A 4ZP6A 1D3WA 2IM0A 1HNVB 2DNGA 3CULA 1NDCA 5GMEA 1EIYB 1YBAA 4JAXA 3CCTA 1VQPN 4FP9A 2H4YB 3V1OA 3GG4A 1B0PA 2VASA 3Q2SC 1SVDA 3DI6B 2XSJB 2PN6A 2CQ2A 3MUTP 4DV2J 4NLSA 2BXJA 1TK0A 4MDAA 1M5KC 3NBPA 4UOCA 1OH8A 4ED3A 3I4HX 3CJ3A 2GCFA 2V52B 4GV3A 5D4OA 1FVQA 1Q16B 3ETOA 4JK9A 1Q4RA 1RWNB 2UUAF 3EYZA 2BMBA 2OZSA 1YJRA 4K4XA 3J7YI 1FX4A 2KDOA 5F0XA 3AA3A 3G87A 5HSPA 4ED4A 3B4MA 1N36K 3LF0A 1KVCA 4FWLA 1XMBA 3DOKA 1Q81O 4M3TA 1IKYB 1YJTA 5AQVA 1RBUA 4H4OA 5CE3A 2CPDA 2ASMA 2BBEA 2M7SA 4DG1A 3OS2A 2IJRA 3GJSB 2LDYA 2DPJA 4E7HA 2VG7B 2OP5A 4WKRA 5KI6A 1JK9B 1NGEA 1HWUA 1QS4A 3T19A 3E01B 1YWXA 1IWGA 1Q95G 3EXYA 1IUJA 2MZJA 1GXUA 4YDXA 3T1YJ 3PY8A 3K58A 3DLKA 1LWCB 3CIMA 2ZQBA 1ZPWX 3SQGB 1UAXA 4PXBA 2WTUA 2MB0B 2HS4A 1S1XB 3W2WB 4NRUA 1GLFO 4FWSA 4KTZA 2MKSA 2HKEA 2Z1IA 3THYB 1HNWJ 4GRSA 3NGYA 3V1QA 4PQUB 3J81O 1SKRA 1H1VA 1CZ9A 2E5LF 4CGGA 4CZHA 4HDGA 1ZTWA 1UVLA 4BREA 1T3VA 3W2VA 5A0YA 2D0OA 2I6WA 1B7YB 5FPDA 5F3ZA 4HTUA 3ET6B 4KB7A 1EKEA 1NAQA 4LSLA 4P2XA 4H0YB 1U6ZA 4OI2A 3FBBA 2WSCC 4EBCA 2VOPA 2E7XA 5JVHQ 4Q8FA 2A3ZA 3CERA 3MM8A 4OLAA 2GMLA 1PJ5A 2D0PA 2IJNA 3MXMA 3VETA 2DGUA 4CF0A 2DBBA 1DT9A 2G2ZA 4AM7A 4PXCA 1FW6A 3TNVA 1WG4A 1AFJA 3CPWM 2GIFA 4XPEA 3ZZUA 1S9EB 2QXLA 5J2PB 2OAUA 3ID6A 4OZJA 1DTTA 1CULB 3LP1B 3C15B 3AO3A 3EO3A 1TU0B 3OA9A 4RO0A 4DPYA 1GH8A 2HS3A 3RMDA 4DR2J 2W4DA 1TL7A 3HPGA 3PIOQ 3U6FA 3EJMA 2O8DA 4XDCA 3MF5A 4YR0A 3U8XA 3MM9B 2BACA 4EO6A 2UU9F 5K8NA 1M1KT 1D9FA 1Q78A 4KPCA 2RKIA 4FJ5A 2O8FA 2YQ1A 1FT8A 2YHYA 1VJQA 4TLQA 5B0FA 1LWFB 1ZS6A 3H98A 4O3NA 3UCZP 3R7SB 1YIJN 3R6MA 3MAQA 2GX9A 2HBZB 2VDIA 3CJ7A 1NSKL 3PYDA 3FMBA 3A8EA 4F4KA 2CJQA 3ULEB 3N6NA 2UUBK 4FXVA 1C0UB 4DTOA 1O6XA 3CJ2A 1E3MA 3ZETA 3NS7B 3F73A 3R1HA 3A4TA 3FZHA 4KHUA 5CD4A 1W7AA 1RTIB 3FBEA 2X1AA 1NCLA 3VGTA 4KKOA 1TUVA 1JXVA 1SIZA 3MR3A 2GHVC 4DSFA 1Q7YT 1W0HA 2DNNA 4P6QA 1AFIA 2VKZG 3A3OB 1HYZA 4ZVFA 4W4MA 3M2VB 4JI7J 1DY3A 2L9DA 3JSYA 3JAMY 1REVA 4DFMA 4ZP8A 4B3SJ 3JTOA 1FJGJ 3QICA 4FS2A 4DPUA 4MKAA 4JV2A 1EJ7L 3CM5A 1UETA 2N4CA 4ZCIA 1WI8A 4JI3K 4KV8A 3FKBA 4J9PA 3HSTB 2G0IA 3E51A 2Z58B 4S0MA 3Q8SB 2UV8A 4RL1A 2AGOA 2FD2A 3UW1A 3CC4N 3G6YA 1YDLA 5KQDA 1OH6A 4CI0B 1WORA 5D8HB 2BJ9A 2PMZD 3BR8A 4OZLA 1RISA 4NLYA 3NOCA 4HH1A 2WVBA 5GAEP 2KU7A 1WOPA 4NCGB 4LC9B 5DETA 1U1RA 1K0VA 2CZ4A 1OO0B 5EY4A 3N0VA 2R8GA 2YWHA 2DH7A 5EGYA 4XH5A 5KFLA 4ANEA 4IUFA 1NK8A 3GP9A 2ZD1B 1T03B 2V68A 3E9LA 4KFBA 3AO2A 3OL9A 3BSNA 2XS7A 3CMEN 2MQLA 3OW2M 3GIIA 1IXKA 4C8LA 4FBTA 2HQGA 3DDNA 3OVAA 5M2UA 1WWHA 4A8OA 4ZVHA 3AB2B 2VPWB 4FPRA 2GIQA 2FZKB 2NPFA 1HBUA 3J7Z5 3Q8UA 4TN2A 1H2VZ 3SAHA 4I6YA 3OYLA 2GHWA 4KB1A 3VEVA 4A4JA 4F4YA 3GBTA 3PVXA 4CZKA 4USTA 3SNNA 2IIRA 4UY8O 3OTOF 4CJTA 4CO2A 3EDQB 4FOEA 1HL6A 1GXLA 1XR6A 3G25A 1XNQK 4F0KA 4DR1F 3BBBA 1XNRK 5DG9A 1MROA 1JJ2M 1OMSA 3K0SA 2GVDA 1JLEB 4PG5A 1WACA 1U2VB 3FUYA 4FPAA 1G6BA 1DTQA 1IBCB 4K42A 2A42A 4A8FA 1RAFB 1PAEX 2O8CA 2VBYA 2EFGA 4IQXA 1IJJA 1VQMS 1QE1A 2FLOA 4Y28C 4KBIA 5HMWA 1ZM3A 5ETKA 1N34F 4H4KC 4ELVA 5HJYA 3ENWA 5KRSA 2V67A 4CJFA 2D41A 3BS9A 1BWVA 2F4FA 1LOUA 4IG0B 1R8BA 2OTJN 1Q8KA 1S0NA 2CVEA 3Q8PB 1JMTA 1NO8A 1X9MA 4FJHA 3VF6A 2VPYB 4DL7A 2WC9A 4W5OA 5ETQA 2E20A 4H4MA 1B0VA 2GMJA 5H9FJ 2MKJA 3G71S 2CA9A 3T9ZA 4J7CA 5HANA 1HQEB 5I3PA 2XLKA 4DR7F 1SJ3P 1K1SA 5F8GA 3OYDA 2UXCK 2D4WA 3ZSWA 4K8RA 4EU0A 3VEWA 3PNIA 2LQ8A 2DO4A 4YORA 3MM5B 4DHYA 1C0FA 4PUOA 4CJWA 4R5PA 1JLAA 1CJUA 1M5VC 2ZJPL 3NEKA 4W5NA 1EWQA 2ILZA 1JNZB 2PC6A 4KHRA 3TEHB 4DTMA 3CPWR 4CBUA 2A2CA 3AA2A 4OLBA 1VGYA 1LWEA 5KT2A 1I94K 3R9LA 3GJQB 4Q44A 3K0JA 3EY1A 3BPSP 2O4IA 4JI4K 2F4VJ 3KLHA 3MCAB 4C2MA 3CF5L 3K5PA 5KFYA 5KFVA 3BQ0A 3QGHA 4A8XA 1MSWD 4MLHA 3MEKA 3J81U 5KFCA 4DL2A 2MKIA 1I6JA 1E4FT 2MQNA 1V3RA 2H9ZA 2FJWA 3AD9C 1D1UA 3N9UC 1TL4A 2GWKA 3A8IA 4RG8A 4HVJA 2ZBPA 5C0YA 3TR8A 1FHTA 3MEEB 3WT0A 1C1CB 4WXOA 3J7A1 2UV8G 3M8RA 3GV8B 4B8CA 4JKFA 2CZ9A 4O44A 4BRCA 2VKRA 3T1AA 4ECWA 4Y2IA 2PA3A 5KFOA 2JSXA 1J9AA 4JD2A 3H3OB 1UJ5A 3NGUA 2HB5A 3SUOA 1IR2A 2G9OA 3W1YC 4E8UA 1S72N 3ICLA 3GB0A 2VA3A 4CZJA 2F63A 2EFQA 2RDIA 4O3QA 4IO8A 5F9LA 1WI6A 2C2NA 1HFEL 3H5UA 2DT9A 1RHKB 3RBDA 1SJ1A 1RTDA 1HPZA 1S3XA 1REGX 4ZLPA 1IV0A 4LF6F 4LBPA 4BR7A 3W7BA 1SJFA 4YB5A 4YMEA 4RUBA 2Q0UA 4CHOA 2CADA 1MG7A 2HURA 2L48A 2QA1A 3RYLA 2U2FA 4RTFD 1BIZA 5AQJA 2YKOA 2OEMA 3IN5A 3IRXB 4LFCJ 4J37A 4Q5VA 3PKMA 5I4MA 2WZ1A 2D9OA 5DQIA 4IRKA 1CXUA 4B02A 2MZRA 3LWLA 1A5XA 2NLXA 3O1LA 3LAKA 3BY5A 1RADB 1S0OA 2OJ3A 2HHVA 5LY3A 3KLVA 3TPQA 4H54A 3AVMA 4NLRA 2CPHA 1I39A 2IOCA 3AY0A 2A1SA 4OJ1A 1FRJA 1RAHB 2ZVSA 4HHHA 1A5WA 5B09A 1IKVA 1KHVA 1LW0B 4ZVSB 4HR2A 5IC4B 4LVNP 3MCSA 3AAPA 1ILYA 1KLMA 4DTPA 2E9TA 4JI6K 3EVMA 2R7QA 3Q22A 2NRVA 3HM9A 1SJRA 4YHHJ 4MT1A 3VA3A 1NGDA 2JOQA 2IM2A 2EPIA 4FXDA 1NHKL 4F2RA 4WFYA 2J0WA 4G1IA 1RT4B 3EGVA 5D4NA 3CD5A 4LF7J 4B8AB 3WEEA 1B92A 5H1SV 3I5CA 1SJ4P 2M0GB 4J2BA 4NLQA 5G4DA 2ZM6K 3OW2R 5BRFA 4CH7A 1UVMA 3N01A 4DV0F 3S3NA 1C4AA 2E2NA 4OKEA 4K4WA 2Q66A 3UN2A 4NOHA 2EFPA 4A2AA 2ZH7A 4RW8B 2IVMA 2H5JB 4U67Q 4Y3CA 4DSIA 1XEZA 3EWGA 1OH7A 2OANA 2HWIA 1BDGA 1UPPA 2CUYA 2QLJB 4UOFA 5LOQA 2O8BB 2FSJA 3D2FB 2HRYA 2N82B 2DGOA 5L38A 1HR0F 3W64A 4B3MK 3BN4A 1JJ2R 1F5BA 3DKDA 4DCJB 3KDOA 5JVGQ 4F4WA 5ETSA 3CQXA 3EZUA 3EVOA 1XMQK 7AT1B 3AVAA 4F3MA 2GO9A 3MCPA 3AXMA 2GA7A 3VF0B 1VQON 3BKTA 1WC0A 3CJRA 1UZHA 1GLDG 3RSEB 2E88A 3Q86A 5CYQA 5GINA 4WIIA 4IG3A 2OUGA 2RSQA 1XUPO 4NE9C 5GIOA 1ZM9A 2C2OB 1VJWA 4CCHA 3IAM9 3H2LA 3CB4A 4CFCA 3VPZA 1VC0A 3KVGA 2OELA 3OYGA 2J0SD 2AJ1A 3QETA 5F8MA 2IYIA 3UPFA 4YR3A 4NI2A 3WXIA 3J80Y 3TAFA 3VAKA 3AAQA 4YOXA 4C48A 2CGJA 2VG5A 4C8ZA 3NAHA 1U8SA 4DQPA 3AD8C 4M95A 5J2QB 1IKXB 5ETPA 2HFSA 2B5JA 1VS3A 3FE1A 4IFYB 4CT9A 5DG7A 2IM1A 4QJVA 3IO1A 3THVA 4WK3A 3AO5A 1HNXJ 4EAHD 4JKGA 4JI8K 1N36F 4ID5B 4ZITA 1RT5A 1S6QA 2GAHC 3OUYB 2VA2A 5CQGA 3G6XA 3KIOA 3PO4A 3ZZ0A 2VBWA 3OHAA 1R59O 5CZ2A 2K2PA 3FCVA 1EP4B 4AHVA 5AQNA 1RKJA 1UFKA 1T3OA 1T9YA 3AB4B 1RGIA 3MCMA 1UMJA 4FJKA 1UEVA 3NGRA 4ZVRB 2KO1A 2V4JA 1PJ7A 2JDJA 1FNXH 4B3RK 2DO0A 1X0FA 1NPRA 4YN3B 3SDEA 1ZBSA 3SQ0A 2LYVA 4DU3A 4DLGA 1TK5A 5KFDA 3P5BP 2PY5A 4OZ2A 1J5EK 4EZ6A 2WFBA 2R4FA 1R0AB 2UUAJ 4DQ8A 2I5JA 3I82A 4CTAA 3VQ6A 1Z6RA 2G1DA 2RUGA 3TANA 3B78A 2CH5A 2LEBA 4CEFA 3SV4A 5M2PA 5HOOA 3DGVA 3PTWA 1OJ4A 2V8VA 3AARA 1A5VA 2YXLA 2JHEA 4H4KA 4AH9A 4A46A 4GVLA 2KJWA 1PIEA 1RILA 4WFZA 3PKYA 1FVSA 1GLLO 4NLDA 3UR0A 1YJ7A 2K7KA 4CO0A 4N8OA 1RCOB 4F8RA 3SSQA 2CGLA 1JXLA 2OEKA 2NZ4A 3MMJA 1KAZA 2FC9A 4I9QA 5GAHP 4BRNA 1KQFB 1I1GA 4Y2KA 4CZFA 1F21A 5KOWA 3CDWA 2HBQB 4BRIA 2QWOA 4OGCA 2OLWA 2WOMA 2QSWA 1VQ9S 1T6CA 3LM9A 2K3IA 4DV2K 4WBFA 3H6EA 2JX2A 3IC1A 4OL8A 3TTFA 4LIWA 3CO9A 3KJQB 2G4BA 4CJQA 2PFFB 2W24A 4ZA1A 2V7ZA 4UY85 4ENOA 3EZWA 3WUHA 1SH3A 2QZ8A 4BRHA 4F02A 1ZETA 2GVZA 4JI5F 2HNDB 2P6TA 4GVMA 2XHWA 3ZX3A 4CIFA 5B0BA 2FC0A 1H3DA 1BE4A 5A2QY 1EETB 3VQ9A 5M1KA 5FROA 3AH6A 1PC5A 4J2EA 3TAMB 4DR3J 6AT1B 2EX3A 4KHWA 3VAIA 3AA8A 2AZ3A 3VZIA 5LXYA 1NJIT 2Q6CA 1CQNA 1R8AA 1QAYA 2VFTA 2WAQD 4BS2A 1FF2A 4ZLNA 4HACB 3HYFA 2PIIA 2JNJA 2B3TB 2QLFB 2UUBF 1YVUA 1BD6A 3R3LA 2V2KA 1U1OA 4F0MA 1Y11A 3MURP 1RA6A 2B56A 3V5RA 1TVRA 5HRPA 1ZBIA 2PI4A 1RWMB 2KXFA 3CMAS 4WQ4A 2DGSA 2NRZA 3CO0P 4TXSA 3W65A 4LFBF 3RUBL 2P9EA 3M32B 1NGCA 4I2PA 3R5JB 2HK2A 3GFZA 4DU7A 1HNWK 4DCPB 3AVCA 3LZJA 3KKSA 5BRHA 4OI4A 2ROPA 5KG3A 3V6KA 3P6YC 1RB0A 4OPKA 1HNZF 4MFBB 2HSEB 5HBMA 5FLXO 3ZZZA 1RHMB 5AE3A 2L41A 4B1XB 2Z56B 2KHDA 1SJQA 5GAGU 3SAGA 3D68A 2RU3A 2AJ4A 1NXIA 1RWOB 3WIUA 4B9TA 4MYTA 2ZHBA 2J9CA 3I96A 3AT1B 1PILA 2HPUA 3PRVA 2YNIB 2AEJA 5B0AA 2A18A 3QGGA 3H08A 3QEPA 4DFJA 1Q86O 3TA0A 3IG1A 3RBZA 3MFIA 1IBLF 3EPIA 4KPYA 1RDDA 3HHEA 3FQKA 2CQ4A 3S1TA 4LSZB 3HD2A 1SH0A 3SPYA 5FPMA 3KK1A 2SXLA 3MPUB 1AUSL 1S1WB 3L95X 1GMWD 4F67A 2YKNA 2QYGA 1Q79A 4WYLA 2AWZA 5AQUA 4BRPA 1OPIA 2VFVA 4O0IA 5JLFA 3PIOL 4P7VA 4CP5A 1BWEA 3O5BA 3WXMB 3MMBA 1WC1A 3RWUA 3AOAA 1T9TA 1ZBLA 2LQJA 4QAGA 3W8GA 2XO6A 3HHLD 3G0ZA 3GE9A 5T7LB 5DZ7A 1WSRA 2GHPA 5C5JA 1PAUB 5DM7L 1NB2A 3QIPA 5JS2A 5AQQA 4FCYA 2DRAA 1CC8A 2QLWA 5J2NB 3BO3A 3PO5A 4ECQA 4LF5J 4K25A 1FA0A 3UN3A 2YI1A 1WBBA 2D3OR 4DSKA 1HNIB 4H0VB 2XZTB 2HK3A 4X4UA 2B4VA 3A2FA 2ZJRQ 1MN9A 3BSAA 2YHWA 2BQ3A 3OQ2A 1RYSA 2LXIA 4M63C 3ALYA 1KFDA 2M52A 2Y1LB 2XMMA 1HKCA 3FSIA 4KT0C 1R6VA 4KR0B 5BREA 5KFUA 2YNFA 1XNQF 5GAHI 1ASUA 2XY5A 3OXFA 1TQLA 4QOZB 1XNRF 2LU2A 1B9FA 3PUFA 2UUWA 4E0DA 2VC1A 3ZT2A 4FJXA 1Z4UA 2EG1A 5HP1B 2YKMA 4QOTA 2WVFA 3MX2A 4I67A 4MIWA 3CSKA 1DJ0A 4USHA 4IH5A 1ZBHA 2WBRA 2HZAA 1VC5A 4DTRA 2HMIA 3VQAA 2ZH1A 3A8YA 1TP7A 4JI7K 3DGPA 4W5TA 4NX9A 4JRQA 1Z2LA 4B3SK 2QEXN 1FJGK 2VH7A 2OI2A 2VG6B 1FO1A 3PYGA 3LW5C 4CZEA 2ALYB 1NK4A 1LXJA 1W9HA 3OBYA 3K59A 2ZHAA 4ICLB 2IM3A 3JYTA 2ASJA 2J0QD 1RT2A 2UXCF 1FJCA 3O1BA 2Q2RA 1NMNA 2W2PP 3C16B 3QWPA 3L0QA 5GVQA 2HNZB 3AVGA 1ZA2B 5EX3A 3GG0A 2B9EA 3ZZTA 5KFPA 3C6UB 3MPDA 1PO6A 3OTDA 2P9PA 1HYSB 4KH0B 4A57A 4A48A 3KJVB 4NLUA 3B6PA 1GX5A 4FLVA 3DLEA 3PR5B 3ONQA 1I94F 5ADZA 2E9RX 4C1NI 1VK8A 3BF4A 1ZM4A 4CO5A 1YJWS 4J9NA 3CJ9A 3B82A 3OFGA 4C4WA 3M1FA 4ISEA 4CHQA 3CC2S 3GWCA 3CWJA 3M6UA 2EFVA 5KFNA 4MTPA 3DLGA 1BQMA 3D5MA 1LKZA 2Y9HA 3QPIA 3SCIE 3P8BB 2OIHA 2RE2A 4C0BA 4FKXA 1K47A 2YNHB 1HYVA 3D9BA 1YRUA 3LANA 3TX8A 1T11A 2KFYA 1VQLS 2GWJA 3FK4A 5HL7L 4MDBA 2A3JA 5DMRA 2HWHA 1C4CA 3UB5A 3L4QA 1X4BA 3IGNA 2CPXA 3BB5A 4OZ0A 3LP0A 5IS2A 3CJBA 2QO3A 2FY1A 1DFDA 3LH2S 2HBKA 2XYPB 1Y5IB 3QFWA 2CNKB 2E2OA 4L3NA 5CCLA 3V2UC 2RQ4A 4F4ZA 2J9DE 3CD0A 4USUA 5C42B 4DF8A 5IT9Y 2BV3A 2GJ2A 4Y1DA 1KS2A 2GV1A 2W7AA 1SB6A 2HWTA 4Z37A 3QERA 4KYZA 3MEDB 4CGDA 1VSEA 4MAKA 1VQKN 3H20A 3VF2A 3CJSA 1VAZA 2O8EB 1CLFA 4V19J 4PY5A 1RHRB 3JAMO 3D66A 1DHMA 1PSDA 4CD1A 5C2DA 1P1LA 2AIRB 3DLRA 1EQYA 3DDIA 3PV8A 1NPKA 2KT5A 4DV7F 3L7UA 2OYQA 4C8OA 5H9FK 3MWTA 2V69A 3KWIA 4CYUA 4LSNA 1TZ0A 4QR1A 3MPYA 3I31A 1WHVA 1X3MA 3OFEA 1U26A 1UL3A 2DGVA 4FN5A 3HT3A 1HLWA 1Y9OA 4FWKA 1DAXA 3FLCO 4HHJA 1FD8A 5HMZA 1E6YA 2XC9A 4TY9A 2MDAA 1VQ4N 1MU2B 2LEPA 1TYQB 1FK9A 4IWVA 1T05B 4OFZA 1Z1ZA 4IDKB 1H7WA 4TYAA 3TSUA 4QYRA 2PGCA 3NNHA 3LP2B 3L2RA 4E3SA 4LF6J 2FSNA 2RH3A 3LM2A 1JLBA 3TW0A 4Y2CA 5AFUA 1NKBA 3CC7N 2F4VK 2P9UA 1FTCA 2ZBQA 4JI6F 4YOYA 3NGSA 3M05A 2JH3A 1R43A 4C6AA 5ETVA 2BEFA 1KR4A 5HRRA 4HT5A 4TY8B 4IR1A 1IM6A 4PXEA 4BRMA 4CLFA 3HHNB 5EX5A 5D6GA 1N5TA 1XTZA 4TKTA 4BDYA 2ZM6F 1RT6B 5E33A 4CNZA 1OIAA 1RT1B 5KFSA 4IXCA 4ZDNA 4NYNA 2VJVA 3TWHA 4QR2A 3FGUA 3DRXA 2GQQA 2YCHA 3OVNA 3M8WA 5HQ8A 1DQ8A 1FRXA 3UCGA 2WB1D 1JLFA 1VCTA 1RBOB 1UZDA 1WKJA 1B70B 3CNQP 1RWKB 3BQ1A 4V1Ak 3ZNJ1 1HJOA 4B3MF 2X74A 1NZAA 2MKCA 2RRAA 1V3ZA 3GLJA 2VIHA 1J27A 2ZDPA 2B4OA 2Y0SD 1KFSA 2WHOA 8AT1B 3W66A 3ZTRA 3QNOA 5FDLA 4K8XA 3BGUA 1NM2A 2ADCA 2NZCA 2QMUB 1JKHB 4YR2A 2RILA 1FFGB 2IVPA 3DOLB 1RLDA 1ZBUA 4FJIA 4FJNA 1QTNB 1HBNB 3CJKA 5BPMA 3ZCMA 2M4MA 3PFOA 2ASPA 4LFCK 1WB9A 4ID1A 1N5VA 2RHQB 1U24A 4KH6A 1VQ6S 5C2GA 3I32A 2PFDA 5J1NA 1PKUA 2VZ9A 2FJEB 3F5TA 3LQVA 2N4DA 1S0MA 2I2YA 1S9FA 1U7LA 2W7OA 3DRPB 1Z25A 1S9GA 4RW6A 4AQYJ 3NWRA 3WQTA 3EL2A 3PW7A 2Q43A 3CG7A 4DPXA 2PA8D 4BROA 3CCUN 1GLJO 1SC4B 1S1TA 2WB4A 4DTXA 3F9KA 3SJHA 4CJSA 3B8HA 3DYAB 4CLUA 1VOMA 4OI3A 3ILIA 1BG3A 1NNDA 4IDHA 2YNGB 1XQIA 4KH1B 4CEZA 3DXMA 2B6AB 4C23A 3NG8A 3HLUA 2HQCA 3ILJA 4O4GA 5DRKA 4JI8F 4KGKA 4YHHK 3WIVA 4RW4B 2G8KA 1FD2A