1RTHA

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
543
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 144
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rthA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rthA05
1RT2B 3QEVA 4O55A 3AVMA 2VG5A 3LANA 1FKOB 1N6QB 5F8JA 1T3NA 5F9NA 1W9HA 4RW4A 4KHQA 3IS9A 5C24A 3H2LA 3LP1A 3LZIA 4IG0A 3TAMB 4CEOA 2DPIA 3AO4A 4O3OA 4I7FB 3M8RA 3OYMA 2R8GA 3TAQA 1HJRA 2JC0A 4FVMA 4DL6A 3DM2A 4NLSA 2G8FA 4C8LA 1IKVB 1YVUA 3KLIB 3FRZA 3PR5B 1S6QB 3MECA 4QPXA 3OS2A 3QZ8A 3L2RA 3VQSA 4IDKA 3MEDB 3PVXA 2C2RA 4X2BA 5CZ1A 3SQ4A 1A5XA 1ZBLA 4CJTA 4ELTA 5KFHA 3ZT2A 4I2PB 1ASWA 4NLPA 5CYMA 5KGXA 3KOAA 3LALA 2YNFA 3KLGA 3OLAA 4FZXC 4CHNA 3DM2B 4ECTA 1RT6B 2HNZA 3FQLA 5CZ2A 2D0CA 2DFEA 2OPSB 3MECB 5KFXA 4J9MA 1HQEA 2W9CB 1D9DA 3H98A 5FRMA 2VG7B 2AU0A 4FLWA 4ZVHA 4NLOA 1VSKA 4ED8A 4DU1A 3PW7A 4AHRA 5KFKA 3BQ1A 4BE1A 4WXWA 1Y97A 2YKNA 3OLBA 3V9SA 2YNFB 3QEPA 4ED7A 3SPYA 3KLGB 4NLYA 4E0DA 2XI3A 4KB7A 1TKXB 4IFVB 4DMNA 3AVFA 4LD0A 2UUTA 3VQPA 2HHVA 2XI2A 1HMVA 3MR6A 1T7PA 2RF2A 5CY4A 1ZBIA 5KFQA 2QE5A 3AVAA 5L1JA 4AHVA 2ALZA 1HQEB 3T5JA 2I1RA 2YNIA 1SKRA 5KFZA 2YKNB 2C2EA 4RNMA 4G3IA 3FDSA 1KCFA 1VSDA 4CGDA 1RT7A 2XGPA 3AA3A 3ZSOA 4FS1A 1S6PA 3UDLA 4FZYA 3FSIA 1ASUA 4Z4HA 1LWEB 2RF2B 3QIOA 5KFGA 4E7LA 2BQRA 1TL1A 3V6DA 2J6TA 1U45A 3OYBA 1Z4UA 1BHLA 3PX6A 3GYNA 1HPZA 2YNIB 3ULDA 3KLVA 5EUHA 2HNYB 1Z26A 4E1MA 4CFBA 2XY6A 4E7HA 3ZSVA 1RBSA 4CGJA 4EP4A 3SPZA 1RT7B 4EP5A 2JEFA 2BQ3A 2OH2A 4EBCA 4ECVA 3L2WA 2X74A 3ISND 4B9UA 4OKJA 2ZE2A 4W5OA 4RU9A 3ZSYA 4OKKA 3V81A 4KPYA 5F8NA 4LSLA 1IKYA 3RB0A 4EZ6A 2W42A 3QNNA 3DRPB 2I5JB 1S1UB 5HP1B 1DLOB 4DFJA 1JL2A 4DL5A 4W5TA 1BISA 4CHPA 3T5KA 4C8KA 2XWYA 2UUWA 3ASMA 3A2FA 4MFBB 4M3ZA 2OZMA 4JRQA 4E89A 2ZE2B 3KK2A 3VQCA 4OL8A 4Z4FA 1W25A 4K4TA 3PO4A 2FVPA 1IKYB 4CF8A 4WFXA 1D1UA 4EYIB 5KFCA 3GIKA 4RNHA 3OY9A 3D45A 4O4RA 5KFUA 1L3SA 4O5BA 3SV3A 3CM5A 3BGRA 1N4LA 2X78A 3GILA 5KG6A 2R2RA 3HXMA 3PZPA 4F4XA 4J9PA 1S9GB 3KK2B 4ECZA 4LSNA 4ZVEA 1QHTA 1BCMA 3G86A 4AHTA 1T05B 4WZMA 3V6KA 1RT1B 2Z1IA 4B8CA 4BWMA 3KMSA 1NJWA 2XCAA 3VQ8A 1BQMB 1K6YA 1RDDA 3CJ2A 3BGRB 1RTDB 1RDBA 4OPKA 1FKPA 3SFUA 5J2NB 3L2UA 1A5WA 2Q3SA 3KKRA 4HUFA 4DG1A 4DTPA 1QSYA 4H4OB 1RT4A 4LSNB 4NLTA 2WCXA 1BQNA 1HYSA 3OYEA 3DRSB 3M9OB 4M42A 2B4JA 1TAUA 4C8MA 2HB5A 2E4LA 3M8QB 4LQ3A 4XPEA 2D0AA 1SUQA 3IRXB 2BGGA 3RB3A 4O3RA 1S1VA 2CJQA 3KLEA 3KK1A 3OYDA 3TAGA 5KI6A 4CERA 1SH0A 2FC0A 5C42B 3SYZA 2FVQA 2IC3A 2DTUA 1FKPB 4IG3A 2R8HA 3RMCA 4WYLA 3P5JA 4QWBA 4DG1B 4IR9A 2AWZA 4ID5A 4JV2A 4NYNA 1X9SA 1RT4B 4RNFA 4IBNA 3QNOA 5HRPA 5HBMB 1TK0A 4NLVA 1IG9A 3BJYA 4ECWA 4MK9A 3OHBA 1C1BA 3JSMA 1S1VB 4ECUA 3VQ5A 4NLGA 3KLEB 3KK1B 4PUOA 4M3XA 4O0JA 3OL8A 3U3GA 3DLKA 4FK2A 1JLQB 3DLHA 4IG3B 1OS5A 4FCYA 3BQ0A 4ID5B 3T5HA 5CYQA 1WSIA 1U49A 1JLCB 4OGEA 2IM2A 3OS1A 3E01A 3ZT4A 3DOLB 1RT3A 2R8JA 4N5SA 3KLHA 5DGBA 1KTQA 3U6FA 4PWDA 4W5RA 4CEAA 3BQ2A 1KHVA 3PJXA 1ZYQA 4ECSA 5I42A 5D3GA 3KLFB 3CVKA 4F4ZA 2NUBA 3LPUA 4GMJB 4QAGA 2IGIA 3OSNA 4B9LA 2OPRB 3C6TB 3I8DA 4HYKA 4FK4A 3VQQA 4FYDA 2FVSA 1TQLA 1RT3B 5KT2A 2GUIA 3OS0A 3ZSZA 3SQ0A 5KT6A 3ZCMA 2B6AA 3CDEA 4E19A 4DSLA 2V4QA 1G15A 1WSEA 1S49A 3OL6A 2IM0A 4OJRA 5D3GB 4KBIA 3HVTA 1T94A 1KVBA 4IRCA 4F4WA 1HRHA 3OJSA 1HNIA 3OYJA 3EY1A 4KB1A 2B43A 3DLEB 3HPHA 2BRLA 1IKWA 4ED2A 1HYZA 2UVVA 3DMJA 5C25B 1C1AA 1YVFA 3NGYA 4E3SA 5HROB 3I5AA 5KFYA 1LWFB 4URSA 2Z1HA 1KVAA 5FDLA 3NCIA 4K4ZA 4CHZA 1T8EA 4DU3A 2BRKA 4WZQA 4KI6A 2C2DA 3K2PA 3C95A 1TKTA 3HVTB 3K5NA 4AILC 1VSLA 4IKFA 3QYYA 3KKSA 2XY5A 1IKWB 1L3TA 4JV1A 4O3SA 1TV6B 3SZ2A 3DMJB 4AHUA 4M3WA 4KAIA 3PY8A 1KLMA 2IMWP 1NKBA 2ZQBA 3T1AA 4CF0A 4O44B 2KQ2A 1BIUA 3MR3A 4K8ZA 2ETJA 2XCPA 3HHKA 1J53A 2YKMB 1TKTB 4DTRA 3H59A 3HKWA 3C94A 4CIEA 3MFIA 5KFVA 2QK9A 1SL2A 4CJ4A 5KFNA 2HNDA 2FVCA 4ECYA 1NJYA 1KVCA 3NMAA 4IQXA 3O3FA 3OL7A 4W5QA 2YNHA 4RW9A 4CJFA 4CIGA 4IR1A 3SI6A 3V6HA 1QSSA 4FLTA 3HP6A 2BDPA 2PZSA 5KFEA 1DTTB 3SI8A 1BI4A 3K5OA 4FJLA 1NOZA 3MAQA 5J2PB 4RUCA 4KHMA 3HO1A 2RKIA 1S0NA 2GC8A 1JLFB 2YNGA 4RW7B 3OYGA 5KFBA 5C5JA 3QIDA 2R8IA 3LP0A 3DDKA 2YNHB 3RBEA 4RW9B 4CF9A 4DQPA 4HUGA 5KG3A 4RNNA 2VA2A 4TQRA 3TI0A 3HYFA 3OJUA 3SUOA 3CJ0A 3VQDA 3QO9B 2AGPA 1NJZA 3OVNA 1O1WA 3M8PA 1WNSA 4M94A 4JV0A 4Z4CA 4M45A 1JLAA 4ICLA 2AX0A 1QE1A 3KHRA 1RBTA 4KHUA 4YR0A 3Q8QB 4CE9A 3TWHA 4W5NA 2FBYA 3GQCA 3SV4A 2QXFA 1QAJA 3AVIA 4FJKA 5FRNA 4C8OA 2BQUA 4F50A 3WNGA 3QLHA 3H4DA 3TABA 1C0UB 1LWCB 2FJWA 3FFIA 4H54A 1NJXA 5HLFA 3M8PB 1TKZB 4YR2A 1ZBFA 4J9SA 1HNVA 4DTXA 1S1TA 1QE1B 2D41A 2VG5B 2FLNA 1ZTTA 3M8SA 2FBVA 1JIHA 3PW4A 5F9LA 3NE6A 4KHNA 4M3UA 4RW4B 3OYCA 3IS9B 1LW0A 5C24B 3D5MA 3H40A 3LP1B 4IG0B 2ZD1A 2BE2A 2E9TA 2X6SA 3ZT0A 3AVCA 2OA8A 5KFMA 4B9TA 1TKDA 4ZPCA 4DQQA 4ZHRA 3HPGA 1JXEA 2JEJA 4FW1A 1HNVB 4RZRA 1K1QA 4IDKB 1KSPA 3KHGA 3N6LA 2DY4A 2HHTA 5KFPA 1L3VA 5KG7A 3GIIA 3CJ5A 1VSJA 4KHSA 3PV8A 1LW0B 5CYMB 3HVAA 2BE2B 1Q9YA 4ELUA 1XC9A 1D5AA 5KFIA 4DL4A 3QERA 5L1KA 4ED0A 3KNAA 4WE1A 2HNZB 2WHOA 4EBEA 4ZHRB 2ATQA 4CFAA 2QKKA 4MH8A 1Z25A 2XY8A 3BSNA 4TY8A 4WXOA 4KO0A 3GV7B 3EZ5A 2B5JA 1RILA 4J2AA 3NF6A 4QOZB 5KFOA 3GV5B 3DI6A 4CF2A 1TAQA 1JL1A 3PO5A 1U09A 3IG1A 3TAEA 3NF8A 4URGA 4NLWA 4ECRA 2R2SA 1UWBA 4WE1B 1LAWA 3PW2A 3IGVA 1FXXA 1XHZA 1HMVB 3QINA 4NLXA 4IRKA 2E9ZA 5K14A 2OPPA 3RBDA 1YTUA 1JKHA 5T7BA 3KK3A 4CEZA 2JEGA 4E7IA 4FJ7A 4K8XA 3TANA 3EPIA 2B5JB 3HT3A 4DSKA 5KFLA 4FLZA 5KGWA 1HYVA 5EWEA 1N5YA 2A1SA 4FJXA 5KG0A 5HRSA 1S6PB 1NK7A 3L2VA 4O3PA 3IGNA 3CJ3A 2FLLA 3LP2A 5K14B 1TL1B 3V6DB 4BDYA 4KTZA 4K4WA 1JKHB 4MQ3A 1HPZB 4B9MA 1NK0A 4TN2A 4Z4IA 5KTQA 1KHWA 5KT5A 3ALYA 1LW2A 4J9QA 1FK9A 2P5OA 2G8HA 2XGQA 4FM1A 4MKAA 3Q8RB 4CJKA 4OGCA 1N5YB 2E6MA 4CEFA 1YT3A 2IJFA 1ITGA 4DWIA 2WOMA 4TYAA 3AV9A 1CXQA 3M9NB 5F8HA 1WAFA 4KHYA 4R0EA 2DPJA 3SUPA 4O4GA 3V81B 1C1CA 3AVNA 1EX4A 1N56A 5J2QA 4NCBA 4LSLB 1D0EA 1LW2B 3OYKA 4EZ9A 1RDCA 3OL9A 4NRTA 2AJQA 4IFYA 2G8IA 4ELVA 3SQ1A 4CEBA 3TARA 4K4SA 4KB0A 2IBKA 4TYBA 2GV9A 3VQ7A 3K5LA 4QW8A 4CK2A 2FVRA 1YTAA 4KFBA 5EWFA 4DFMA 1C1CB 4IH7A 1GOCA 4BDPA 4Z4GA 3PUFA 4PQUA 4IKAA 5KFRA 4DTUA 4Q8FA 2HHUA 4CFCA 2W7PA 3MEGA 3CFOA 5KFFA 4ECQA 4K4YA 3NHGA 4NCGA 1QAIA 4IFYB 4CJUA 4YR3A 1B92A 4Q0BA 1MU2A 4DF8A 1VSMA 3G6XA 2ZKUA 3PJWA 2D7SA 2VA3A 2VG6A 1HARA 3QIPA 1T03A 1VSHA 2JEIA 3NAEA 4NLDA 3MF5A 1EXQA 2J6SA 3L3VA 3HJFA 3L2QA 4KFBB 3IAYA 2W8KA 1W0HA 3O4NA 1NK5A 4Q43A 2JGUA 4FXDA 3MTKA 3S3OA 4Y1CA 4GVMA 4AH9A 3CJ4A 4ZVFA 3HM9A 1CSJA 5J2MA 3G10A 3MEGB 2G8KA 2V4RA 4J9RA 4DS4A 3H5XA 1NHVA 4NCGB 4CJWA 1XI1A 1RT5A 4GC7A 1IO2A 4K50A 2WONA 2R2TA 4CEEA 1C0TA 1MU2B 5KT3A 1RDRA 4DLGA 3H5SA 1QQCA 2J6UA 4DS5A 2VG6B 1IM4A 3PX4A 4E1NA 4AHCA 4TLRA 1L5UA 1EP4A 3KJVA 4XPCA 1GOBA 3E51A 2VWJA 3ICLA 1XR6A 4ZTJA 1NK4A 1BQNB 1HYSB 4K4VA 3DRRA 3VQEA 4ZP8A 4FS2A 4WFYA 3HVWA 1B9FA 5F8MA 3NFAA 3ZT1A 4F2RA 3KHLA 1SUQB 4RW8A 5KRTA 4F3OA 1NKCA 4HHTA 5DQHA 4CJLA 1UA0A 3CO9A 4E7JA 4HUEA 3QETA 2IC3B 2EC0A 3NH1A 2HHQA 4DEZA 3SQ2A 4LY7A 3P83D 5I3UA 1EP4B 2G8WA 1WN7A 5E41A 1HQUA 3SCXA 2ILZA 1ZBUA 4KV8A 3UPFA 4YP3A 3O3HA 2F8SA 4HTUA 4CJ3A 1RTHA 1R0AA 2BANA 4DTMA 4MK7A 2EHGA 1C1BB 3JSMB 1WSGA 2ASJA 4PUOB 4JUZA 4CIFA 1X9WA 1TK5A 1RDAA 2Y1IA 3DLKB 4B3OA 2D3ZA 1RBUA 3N6NA 4ZVGA 1XWLA 1HQUB 4FK0A 5CYQB 4KV8B 5J1EA 3CWJA 3RTVA 1JLBA 3EZUA 3E01B 3DLBA 4XO0A 3KLHB 3I0RA 2IAJA 4CF1A 3P1GA 1RTHB 4PWDB 2O5DA 4MIBA 5SWMA 5L9XA 4DFPA 3RMDA 2R2UA 3I0SA 4CECA 3NDKA 5I42B 4BE2A 1KFDA 3NBPA 3F9KA 3AO2A 3QGHA 4M95A 4TSXA 4BWJA 4B9NA 3BR9A 3MEEA 4N41A 1NHUA 1S10A 4AHSA 3KTQA 5J1EB 4TY9A 1XR5A 1JLBB 3T5LA 4J9LA 1TVRA 3I0RB 2IAJB 4K4XA 3OYNA 4ZPDA 2QKBA 2B6AB 1U48A 4ZP9A 4R8UA 5DG7A 4FJ9A 3S3MA 3PW0A 5DLFA 1WNEA 4CJ5A 3I0SB 2ATLA 4J2EA 1TP7A 4EBDA 1S1XA 4K4UA 3SFGA 3RMBA 4FJJA 1JXLA 3NBPB 4FJ5A 1HNIB 3BREA 3AVKA 1SKSA 2IM1A 1GX6A 3O3GA 4CFDA 2IS3A 4DQRA 4KKOA 3V9WA 5KT4A 4KTWA 1TVRB 2F8EX 3MR5A 5KG2A 2HWIA 2UVRA 4M3TA 1S4FA 5FDLB 2OYQA 2ASDA 1NK8A 2V0NA 2DFFA 3F73A 2P1JA 5F8IA 3MR2A 4Y34A 3NKYA 5DLGA 1RYSA 3NGZA 4TQSA 4O3NA 3G6YA 3NGIA 4EEYA 2RDIA 3RB4A 3DOKA 1KLMB 2RPIA 4KHWA 4DTJA 4KAZA 1EETA 4NYFA 2GBZA 1CZ9A 4BE0A 4DU4A 1RCHA 3VQ4A 4H4MA 4FJIA 4DSIA 4CJQA 5SZTA 1K1SA 4Q8EA 1VRUA 2BR0A 2KZMA 3RRHA 1X1PA 3PHEA 3MXJA 4KREA 4ED1A 2F8TA 3JYTA 3SUNA 3T3FA 4GW6A 1L3UA 2PYLA 1BL3A 4YMEA 2HNDB 1UAXA 4CK3A 3NAIA 1QUVA 1SV5A 2ILYA 4C8NA 2P51A 4DL3A 3DYAA 3H5YA 3RB6A 5KFDA 4H4MB 3AVGA 1BI4B 1VRUB 1RBVA 2FJXA 5DQGA 1N6QA 3QEIA 4J9KA 3JYTB 2QV6A 1JLEA 4NLUA 2YV0X 3WNHA 2IDOA 2RKIB 1DTQA 4B08A 3SJJA 2FJVA 2YNGB 1SV5B 4Q44A 1WLJA 5KG5A 3LP0B 2R8KA 3GIJA 1MMLA 3LWLA 3KLIA 2UVWA 1S6QA 1IKXA 1JX4A 3MEDA 5JS1A 3VQ9A 4JS5A 3HP9A 3T19A 3OHAA 2ITGA 1JLGA 4I2PA 4CCHA 2OPQA 1JLAB 1JLEB 4ICLB 4FBUA 2FBXA 3AA2A 3PX0A 1DTQB 3N6MA 5KFJA 1NNDA 4KI4A 5HRNA 1RT6A 3DLRA 4DTSA 4F4YA 2OPSA 3QLHB 1IKXB 1GOAA 2W9CA 1J9AA 2VG7A 3FFIB 3NF7A 2AX1A 2AGOA 3LWMA 5HLFB 3L3UA 4CGHA 4FLVA 3HSTB 4DQIA 1JLGB 4FLYA 1I39A 2OPQB 4L8RB 4NLQA 2KZZA 4TXSA 1S1TB 2HWHA 3O4QA 3VQAA 4FW2A 3L8BA 3AA5X 4I9QA 1TKXA 4IFVA 2VWKA 4Y3CA 1CXUA 3CQ8A 5JUMA 4IRDA 2ZD1B 1ASVA 3S3NA 3VQBA 3BSAA 1N48A 4F8RA 4WFZA 5JS2A 4IH5A 5DG8A 2X6NA 1RAJA 3QESA 2HMIA 3OSPA 3QGGA 1QS4A 2RDJA 4N47A 3LPTA 4F3TA 4HCBA 1I3AA 1KRPA 1A5VA 1LWEA 3H5UA 3LAKA 3CG7A 4CJRA 3RMAA 3U3YA 3RWUA 1SL1A 5DQIA 1X9MA 2XO7A 2HNYA 3WNEA 2IA6A 2XRIA 3UR0A 2HHWA 3K58A 4TY8B 4CGGA 5KFAA 1BIZA 4CEQA 4KO0B 1U04A 2HMIB 4QCLA 1KFSA 3QGIA 5L1IA 3V9UA 4DLEA 4RG8A 4HVJA 4QWDA 3SUQA 3H08A 4I9LA 4XIUA 3K5MA 1J54A 3G6VA 2RN2A 1WSHA 4HCCA 4YQWA 1TGOA 3DI6B 1RA7A 3QZ7A 3HVRA 3PW5A 4ZPAA 3IG1B 1RA6A 4QWEA 2AQ4A 1D8YA 1UWBB 4JRPA 1SKWA 3DRPA 1XR7A 2I5JA 3IN5A 1S1UA 4B9SA 4U6PA 5HP1A 1DLOA 3UIQA 4ZMMA 4KHRA 2OPPB 3AVLA 5KG4A 3RAQA 5T14A 4I2QA 3KK3B 3V4IA 3AO1A 3OYFA 1WSFA 3UQSA 4MFBA 4O0IA 3S9HA 1S0OA 4FJGA 2XY7A 2WB4A 3KD5E 3V1OA 4H8KA 3ZSWA 1KLNA 4F4KA 2JC1A 3K59A 3THVA 4CHYA 3HK2A 1CLQA 4FBTA 2G8UA 2HHSA 4F2SA 3ZSRA 1C0MA 4FJHA 2C28A 5F8LA 2WTFA 3LAMA 3LP2B 1C6VA 1UA1A 4I2QB 4FM2A 3V4IB 4RUAA 4LH5A 5KRSA 3LZJA 2WRMA 2G8VA 1FK9B 1RBRA 4Y2AA 2E9RX 4ED3A 4DL7A 1NK6A 2IOCA 3H4BA 2AGQA 4IH6A 4Y1DA 2HHXA 5DG9A 2HAIA 1S9GA 4CESA 3NGDA 4LH4A 4QW9A 3RR8A 4DTOA 1T05A 2WOMB 3DLGA 1U4BA 1VSFA 1RT1A 1NKEA 1ZTWA 1REVA 2WK4A 4OVLA 2W7OA 4O4GB 2GIQA 3V9ZA 1BQMA 5J2QB 4ECXA 1D9FA 1RTDA 4ZP6A 2O4GA 4CJPA 5J2NA 2E6LA 1WSJA 3M9MB 1NOYA 1VSIA 4H4OA 1U47A 2Z1JA 2PY5A 3NH2A 3LP3A 4CHQA 4EO8A 1GX5A 2GIRA 2Z1GA 3DLGB 3DRSA 5JXSA 1B9DA 4NRUA 4LQ9A 3BSCA 3TR8A 2CKWA 3VN5A 3OYLA 1QTMA 1REVB 4URQU 4J2DA 3M8QA 3IRXA 2IM3A 2W9BA 4M3RA 4BACA 4G1QA 3VQ6A 3BDPA 3KIOA 5F8GA 2ASLA 5C42A 3OYHA 3EPGA 4PQUB 4DSJA 1IH7A 4KE5A 4FZZA 4PY5A 2KFZA 4EYHB 2P5GA 4PA1A 4NLRA 2D5RA 4Q5VA 4CJEA 1I6JA 5EWGA 4Q0BB 4QWAA 1Q8IA 1SH2A 4R5PA 4KTQA 5DK5A 3B6PA 5HBMA 3QIPB 1T03B 1JXBA 3OYAA 1Q9XA 1S97A 4B9VA 2A1RA 3HPOA 2W9BB 4G1QB 2Y1JA 4OLBA 3CDWA 4M3YA 3MFHA 3KHHA 1JLQA 5J2MB 2W8LA 3VA3A 1LV5A 1RT5B 4Z4EA 2R7YA 2WONB 1C0TB 1JLCA 4R5PB 3AVBA 3BSOA 1UOCA 3NF9A 3RR7A 3DOLA 3MXMA 3V9XA 4FLUA 4HKQA 3KJVB 3NH0A 1VK0A 3ZSQA 4Z0UA 4DFKA 2YHBA 1XHXA 3DRRB 4MIAA 1RTJA 3KLFA 3V1RA 4RW8B 4ZP7A 2OPRA 4CJSA 1NK9A 4FJNA 3C6TA 1BCOA 4CHOA 4NCAA 3TAFA 1RNHA 1C2PA 4OPJA 3V6JA 3Q8SB 2D3UA 4DSEA 4ZTFA 5KT7A 5I3UB 3CYMA 1RTIA 2C22A 2O4IA 2JLEA 4YFUA 2XHBA 1ZBHA 3ITHA 3FQKA 3CM6A 3Q8PB 4DF4A 4CEDA 3NAHA 1RTJB 4KRFA 1R0AB 2BANB 1S1WA 4KSEB 1WAJA 3DLEA 4NYZA 4O3QA 5L1LA 3OYIA 3KMQA 5C25A 1SH3A 4B3OB 5HROA 1LWFA 1VSEA 3AVHA 5KFTA 1RTIB 4DSFA 3CFRA 4U7CA 2IJNA 1ZETA 3D0PA 3ITHB 2HVHA 4Q45A 4CGIA 3G0ZA 1S1WB 3CDUA 2FLPA 4DTNA 1S9EA 1TV6A 4WYWA 4Y2CA 1TL3A 3GIMA 1F21A 3AO5A 4OKEA 3TQ1A 4QWCA 2KFNA 3MEEB 3C6UA 4O44A 2XC9A 5DGAA 2DFHA 4J9OA 2W9AA 1S48A 4RNOA 3D28A 5KG1A 3EYZA 4J9NA 4N56A 2YKMA 2D0BA 1CZBA 4R8UB 4FM0A 2F96A 4B8AB 3ZT3A 1S9EB 4ED6A 1S1XB 3CIZA 4M41A 4FLXA 3I5CA 1TL3B 1TK8A 2YHAA 4RW6A 5FROA 3C6UB 3WNFA 4KKOB 3KD1E 1DTTA 3V1QA 4E7KA 4DL2A 3RAXA 2UVUA 4YNQA 2PYJA 4FJ8A 4NZ0A 4MK8A 2HVIA 5J2PA 1BGXT 3VA0A 3HL8A 4MKBA 4FJMA 1JLFA 5DMRA 4EO6A 4CGFA 2OZSA 4DQSA 4RW7A 3K57A 1VRTA 3AA4A 4RW6B 4CK1A 3SNNA 3AO3A 3GV8B 3I5BA 4IOBA 1SL0A 4GC6A 1RYRA 3DOKB 3NL0A 2LSNA 1J5OA 3ZSXA 3TVKA 2EX3A 3QO9A 1EETB 4J2BA 3QEXA 1QSLA 3PR4A 3AVJA 2V9WA 5HRRA 1RT2A 5KFSA 4ZPBA 2KW4A 1FKOA 4N76A 5KFWA 4OLAA 4ID1A 1VRTB 1S0MA 2KTQA 4CJVA 1S5JA 3CFPA 3TAMA 3QEWA 1EKEA 1S9FA 4I7FA 3B6OA 3TAPA 1C0UA 2FBTA 5EU7A 1LWCA 3LDSA 1J5OB 4JLHA 1LAVA 4JS4A 3DYAB 3RRGA 1IKVA 4BDZA 3ISNC 4UQGA 2HW3A 1TKZA 5EDWA 3MXIA
chains in the Genus database with same CATH superfamily
3AVMA 2IJRA 4JI8F 4ZVTB 2CZ9A 2Q31A 3SBMA 3MUMP 3I32A 2ROEA 4X62J 1T3NA 1RLDA 4BR0A 3J7ZT 4DBQA 3GDQA 3LZIA 3A8EA 3UN2A 4CEOA 3CJKB 1WHVA 4JI4J 3AO4A 2R8GA 4FVMA 3CNQP 2G8FA 3ZTSA 2W4CA 4N8NA 3MECA 1URRA 3QT7A 5BPNA 1RAFB 5E84A 3PVXA 1VFJA 5CZ1A 3CF5L 4PXCA 4I2PB 4A48A 4FF3A 1KVKA 4NLPA 4BS2A 1RCOB 2F8MA 3LALA 2YNFA 5BR8K 2N7CA 4I69A 5K8PA 2D0CA 3MECB 4J9MA 1NJIO 5FRMA 2HRUA 4OV6A 1BWVA 3MR7A 1RFQA 3PW7A 2KL8A 4NA3A 4ZVSB 3BQ1A 4JAXA 1BXNA 4B3SK 5AQNA 2YNFB 3QEPA 3CMEN 1RU2A 2OI2A 2DCLA 1TUVA 4IFVB 5HN0A 3VQPA 4P52A 1HMVA 4A8OA 4ZDNA 2QE5A 3T5JA 3NGKA 2I1RA 4GNIA 1SKRA 2KT2A 1VQKS 1VQPS 2DR8A 2QN6B 5IC6B 4RNMA 4CGDA 3AA3A 3OQ2A 1T3OA 1WC0A 4HT5A 3OXFA 2AJ0A 1ASUA 1LWEB 4E7LA 1TL1A 3V6DA 1TL7B 3K89A 1HPZA 4U8YA 5AZJB 3KLVA 2NXCA 4OX6A 2YHYA 5M1KA 1Z26A 4E1MA 2R42A 8AT1B 3ZZTA 1UVIA 2XY6A 3P3DA 2CJBA 2BUNA 2FUG9 2P9PB 5IS2A 2OMLA 2JEFA 2BMBA 4ZPWR 4EBCA 5GAEU 3L2WA 2X74A 3UDEA 3OR1A 3IBWA 1UPMB 4OKJA 3VEWA 1SKUB 3U7JA 4W5OA 4TU9A 1RAOA 4KPYA 5F8NA 4CLUA 4S0MA 4OYXA 2B4OA 2XHWA 3MK6A 4DFJA 1DLOB 1OWXA 1JL2A 3TZZA 3CD5A 4DL5A 4W5TA 2CNOB 3ETMA 4LBIA 4RJVA 3VF6A 2XLIA 3FZMA 5IV4A 1YHQS 4MFBB 2OZMA 1KONA 4PKGA 3OR1B 4BVPA 1U1OA 2BW2A 1R3NA 4JI0J 4OL8A 1GTEA 2JX2A 3FBFA 3R7BB 3MPUB 2ZM6F 1FJCA 5KFCA 3GIKA 3OY9A 3D45A 3TX8A 3FE1A 1PO6A 1WORA 4K5RA 3VGMA 2XMJA 2BM1A 4CO3A 1RBLA 1N4LA 3FBEA 2KYXA 2GTDA 2R2RA 3HXMA 3U9ZA 1S9GB 4ZVEA 3G86A 1UVNA 4WKYA 2L48A 2Z1IA 4NLBA 1I1GA 3CO0P 4C0OC 4B8CA 2BW7A 3KMSA 1NJWA 1BQMB 1RDDA 2DVIA 1S57A 3CJ2A 2CNKB 4RWWA 1G1XA 3CCLN 4X4PA 5J2NB 2CVEA 3L2UA 2UV8A 5ETOA 1SVDA 2Q3SA 2GNKA 4DG1A 1Q18A 2DHAA 1RT4A 4P73A 2WCXA 4DR1F 1HYSA 4C48A 2CPZA 2E4LA 2AP6A 4PPDA 3PNIA 1NGDA 2BGGA 3IRXB 3RB3A 4H03B 2CJQA 3KK1A 4DUYK 4CERA 3Q2SC 2HEKA 2UXCK 3RMCA 1OY9A 4ZN3A 4DG1B 2AWZA 4P2MA 1X9SA 1RT4B 3BH6B 5GADI 5IT0A 3DC2A 2WSFC 5ETNA 2H54B 4LC9B 1IG9A 4C8ZA 2YKPA 2AEJA 4ECWA 3FEYB 3J7AP 3BZCA 2LP4A 3D54A 3KK1B 4DR4F 2Q36A 4JI6F 3OL8A 4DV2K 1JLQB 3DGVA 3QBWA 1KQGB 3AOAA 5AJ3K 2XS5A 2W7AA 1NPPA 3E01A 3DOLB 3A1YG 3KLHA 2A6OA 3WC2A 1CS4B 1EQ0A 5DGBA 1I3OB 5IQ6A 4W5RA 4DV3J 2XMMA 4DV7K 2IVMA 1HLWA 3ZO7A 1X4DA 4ECSA 3CVKA 3KLFB 4F4ZA 4F3QA 2NR0A 2Z2LA 3RBXA 4QAGA 2IGIA 1HD1A 2WUSA 2LXUA 4HYKA 1SC4B 1FNMA 3VQQA 4FYDA 1DFDA 2CQ1A 2GUIA 3OS0A 4LF8K 1E4GT 5KT6A 3RVCA 3ZCMA 3CDEA 1N32F 3ID8A 4MJKA 1S49A 3OL6A 3L4IA 1H6KX 2LQJA 2DGOA 1NDLA 1UP1A 4NXNF 3HVTA 3IFEA 2RIJA 4WTOB 1HRHA 3EY1A 2B43A 2HS3A 2BRLA 2P9GA 3WBZA 3MM8A 1R8BA 4Y0FA 2DRBA 3I5AA 5KFYA 5JVGQ 3CIMA 3BY5A 3CCRN 2Z1HA 2CADA 5FDLA 1FRLA 2QI2A 2FHJA 2HZAA 3HOSA 4WZQA 4ZK7M 3C95A 2DD8S 4PL7A 3HVTB 2DEJA 4IKFA 2XY5A 1AB8A 2ZH5A 2M3DA 4FKXA 3MM8B 4M3WA 4AHUA 4ES1A 1KLMA 4L3QA 2IMWP 3T1AA 4YHHK 4H4KC 4O44B 1NM2A 2RRAA 4E98A 3ZZRA 1BIUA 3MR3A 3G8SA 6AT1B 3UE5A 1DURA 3O1LA 4C98A 1OPIA 1J2VA 2Q3PA 5GADP 5FPEA 1J53A 4DTRA 2HQ3A 2Y0SD 2ZH2A 1QQOA 4CIEA 4AL7A 2VCPA 3BPDA 4CJ4A 5KFNA 2MZ1A 2VQEJ 2UU9F 4J9UE 3J80O 4ECYA 3NMAA 3O3FA 4TU7A 1NM1A 1MDUB 1PAUB 2QWQA 1GXUA 1X7VA 2HFNA 4CJFA 3SI6A 3V6HA 4FLTA 2WZ1A 2BDPA 4JI7F 3MMCA 4PAAA 1FJGK 2CPFA 3R97A 2Q66A 1MMDA 4DOZA 1VIOA 2VFSA 1IBLK 1NSQA 1BC6A 1NU0A 5J2PB 4RUCA 3Q22A 4KHMA 1Y10A 2RKIA 3A8IA 3D2FB 3AY9A 2LQ9A 1YJRA 5GMDA 2E5HA 1WJ9A 1VQOS 3H8YA 4CF9A 2MLYA 1V9OA 4BY9C 2VA2A 2ZVSA 3VALA 3CJ0A 5CAAA 3MMCB 4B3MF 2IFXA 4M94A 1WNSA 4BR2A 4Z4CA 3GONA 3QRPA 3I33A 2N3OA 2XHCA 2AX0A 1QE1A 1Z2ZA 2OTLS 4PKDB 4KHUA 4YR0A 3MZIA 1FWPA 2K2PA 4DR6K 5DM7L 3AFGA 2VFVA 3GQCA 5AQFA 3PG9A 3TSUA 3AVIA 5DO2A 1YG0A 4FJKA 2BQUA 3BV8A 5HAOA 3R7NB 2CJYB 1Y64A 3OTCA 1PYTA 2RT3A 3WXJA 5D4PA 4OJGA 2K7KA 2CZVC 2W24A 3DLLL 2X1BA 4JI5K 2UUBF 3JAMY 4J9SA 4CLTA 1T9VA 2BJ8A 3OXGA 1QE1B 2D41A 2VG5B 4OZLA 2CXEA 3BBFA 1JIHA 2UUAF 2E88A 1WF1A 2MMYA 4CRJA 3TZXA 3OYCA 3IS9B 3D5MA 3M5RA 4IG0B 2E5LK 2XO6A 2ZD1A 2E9TA 1WOQA 4K0KJ 3CJQA 1ZAVA 2FF3B 3V4MA 3SSSA 2I0XA 5AXKA 2JSXA 4ILGB 1XMOK 3Q8UA 4FW1A 4RZRA 4IDKB 1QTNB 4BQLA 4B9QA 2HHTA 3T69A 1YIJN 5KFPA 1J6ZA 3VR1A 5KG7A 4ANDA 3PV8A 3NP5A 2OTJN 1RU1A 2COLA 1Q9YA 4DL4A 1NGHA 4DR7F 3AT1B 1YRTA 2QL7B 4WE1A 4LF5K 3HT0A 4J91A 2KRRA 4H5NA 2CGLA 4MH8A 2VASA 5BYQA 1K73T 2XY8A 4CZEA 2BEFA 3NGUA 3GV7B 3EZ5A 1RILA 3NF6A 2M0GB 1XEZA 1X4EA 2VONA 1VLYA 2HS4A 3DI6A 2RB7A 4IO8A 2G2ZA 4CF2A 1U09A 4OYWA 3IG1A 3NF8A 4URGA 1MW7A 2GEMA 3CJBA 2R2SA 4WE1B 4QR0A 3QINA 4CI6A 3ISZA 2B8PA 2VHGA 5K14A 3VAIA 2MKJA 1S6UA 3JSBA 4UOHA 3RW6A 2A18A 3HT3A 1R7IA 4FLZA 2ZEJA 5KGWA 5LJWA 1ESVA 4P72A 5EWEA 2VODA 2A1SA 3L2VA 2Q6CA 2RUGA 1BE4A 5K14B 3R5BA 2V8PA 4K4WA 4MQ3A 2J5AA 4X4SA 2J9DA 1NK0A 3VAKA 1KHWA 5MLCQ 2UZAA 1LW2A 1TZ0A 1UFLA 3CB4A 1FK9A 2KH9A 4CO2A 2XGQA 4MKAA 3D9BA 4CP5A 4P75A 2AD9A 1YVNA 4OGCA 4CJKA 4M5NA 2E6MA 4CEFA 2DR7A 2IJFA 4DWIA 5KPRA 1QM9A 4IO9Q 3AD8C 1OPZA 4JI8K 1Y3KA 1WAFA 3DXBA 4R0EA 3PXGa 3W1YC 4O4GA 2JFDA 1C1CA 3E3XA 3AVNA 4YY3J 1LW2B 1RDCA 1RACB 3OL9A 4I6YA 3LM2A 4U67L 2EFGA 4ZLJA 3IUCA 2KM8C 4FXWA 2G8IA 3VAHA 1IR1A 5M1QA 4M5DA 3TZYA 1RHMB 3PYEA 4TYBA 2GV9A 1O51A 3K5LA 2FZCB 4WFBQ 3GCWP 1P6TA 2LDIA 2OEKA 4DFMA 1C1CB 4KPCA 1GOCA 2A1BA 4BDPA 1E6VB 2GW8A 3PUFA 2FXUA 2N7YA 4PKHA 2WSEC 5KFRA 4DTUA 5B0AA 2HHUA 5LSLA 1PBAA 2W7PA 3MEGA 4GO5X 4OHWA 5KFFA 3K7RA 4YR3A 1B92A 4M5DB 3PJWA 2D7SA 4PYDA 1JJHA 1QHAA 1HARA 3NAEA 2JEIA 4NLDA 1X31C 1UEVA 1RWVB 1FW6A 5LSOA 2MPUA 4JKHA 3US5A 1WG5A 3L2QA 2LFVA 3MCPA 1F60B 1FERA 2W8KA 3O4NA 3IAYA 4CLLA 2PT0A 3BO2A 1ZC6A 4Q43A 3W63A 2WVBA 1GLAG 1Q95G 4FXDA 2F4VJ 2Z56B 2ZH1A 5ETSA 3CETA 3MEGB 2UXBF 1FF2A 1VGYA 2V4RA 4J9RA 2HSTA 4CJWA 1XI1A 2HSEB 1RT5A 3P5BP 2ZJRL 4GC7A 3CCJS 4PWWA 4B3RF 1RDRA 2BTFA 4DLGA 3H5SA 1QQCA 4NEYA 4USWA 2YCHA 4X64F 3QT5A 1NRKA 2HQGA 2V69A 3TW0A 1L5UA 1R0BG 3P49B 1Q16B 1GOBA 3H1VX 1XR6A 2N3LA 4HWIA 3DRRA 3P4IA 2NRWA 1B9FA 5E3QA 4LRFA 5F8MA 3MMVA 4F2RA 3JAMO 1FDNA 1SUQB 4RW8A 5GAHP 1R8PA 4IEEA 1B70B 3WXLA 4HHTA 4CM0A 4LSZB 3KG0A 3ZNUA 1FFGB 4DUZF 4HHHA 1DQAA 4E7JA 2CG4A 3NH1A 4DEZA 4JI1F 4P9SA 4A8XA 1JCEA 3QAUA 2LEBA 3UPFA 4YP3A 3O3HA 3SK3A 2ATCB 1AXQA 4DV0F 5AQHA 1QZ6A 3W9IA 1RTHA 2BANA 1EB0A 5ETMA 4MK7A 2EHGA 1C1BB 3JSMB 2ASJA 3CPWM 3RZAA 1HBMB 3I55S 4BGBA 1JMTA 2AKWB 4ISGA 2VPZB 1WF2A 3D4JA 1BLUA 3GJQB 4N77A 2D1CA 5A2QO 4ZVGA 2VYPA 4V19J 1NNEA 1EKRA 5J1EA 3JXOA 4DV4F 3DLBA 4P10A 4XO0A 2GUPA 5AT1B 2IAJA 4CF1A 2KB2A 3DGPB 1RTHB 4PWDB 2O5DA 3IR6B 2EFQA 3H2UB 4WFNQ 1OQ3A 1KFDA 1QVFM 4DHVA 3CD0A 4M95A 2WVCA 2GIFA 5CQGA 2ZM6K 2J7KA 4FPBA 4JD2B 4IZ9A 5J1EB 2V2ZA 4TY9A 1M5KC 1SS6A 4LMZA 2QFJA 2IAJB 1ZAWA 2B6AB 4L73A 1U48A 4OYAA 5DG7A 4FJ9A 4KJIA 4W98A 1M5OC 1U24A 3DDIA 2F9TA 3ZYYX 1TP7A 2HGMA 1R6VA 1TFWA 4CZFA 5C7PA 4FJJA 1OH6A 1VAZA 4W4MA 1HNIB 1XBWA 4CFDA 2IS3A 2W6LA 3J7Z5 2GCFA 1KAYA 1VQSA 5CZXA 1Q81O 2DIUA 2NSCA 4EMDA 3K0SA 2C3YA 3Q8YA 3O9QA 4BRDA 3SQOP 3ZTQA 4CLKA 4DR1K 4CZLA 1BY9A 5DLGA 4PG4A 1V5VA 4HTLA 1YF5L 3CJ9A 4IEIA 4BQZA 2RDIA 3ENAA 5D4LA 4KT0C 3I56S 1EETA 2AJ4A 2YWEA 1YBAA 4A62A 1RCHA 4FJIA 4CJQA 4CD3A 2BR0A 2KZMA 1X1PA 3MXJA 3T3FA 1L3UA 3R9LA 2PYLA 2FLOA 1UAXA 1QUVA 3GE1A 4DR4K 3CTRA 4JI6K 3DYAA 1U1QA 3RB6A 3HF5A 1CBKA 3THXB 3BZKA 2QC3A 3MD1A 1BO5O 1BI4B 4NE9C 5B0GA 3NGRA 4OI3A 3QJJA 4FOEA 2IDOA 2DTJA 2C2ZB 2YNGB 1KR4A 2FDNA 3PSIA 1LWXA 3GIJA 2XWXA 5BN8A 1RHJB 4AQYJ 1S6QA 1FFSB 1IKXA 4G1PA 1U0HA 3M6GA 1B7FA 3VQ9A 4JS5A 2YJFA 3T19A 1RJJA 1TUGB 1HKGA 4ICLB 4A8SA 4X66J 1N32K 4EK2A 3DU5A 3N6MA 2RQMA 3NWGA 1D3WA 2YH1A 1WC3A 1FE0A 2E1AA 3BN4A 4NXNK 3O9SA 4DTSA 4F4YA 2OPSA 1RKIA 1IKXB 3MMAA 4F3MA 1U0HB 1RBAA 1HR0J 2CJ9A 3T41A 2AGOA 1M1GA 5HLFB 3L3UA 4CGHA 2L9WA 1PSDA 1R31A 2C2MB 2HWHA 3VEOA 3L8BA 1WHYA 4A61A 3A3PB 3W3SA 3IO1A 5HK4A 1M5PC 3TUPA 5IT9Y 1NGFA 3VAJA 3BO3A 4IRDA 1XNQF 3UD4P 3S3NA 3MMAB 2EFNA 5EY4A 4QIVA 3TYTA 3PSFA 2PMHA 2ZGZA 4LF1A 5DG8A 1N0VC 3QESA 3KUEA 1YBTA 3IAS9 3SCIE 4X65J 3VZIA 3LPTA 4HCBA 1I3AA 3VQTA 1A5VA 3MN9A 3CC4S 3LAKA 2E5GA 2HHHF 1E6YA 5E7OB 4QU7A 1SL1A 1I94F 3HHLA 1RISA 1X9MA 3AODA 2HNYA 2UU9K 4GKJJ 4TY8B 4ED5A 4KIAA 4OQJA 1LOTB 3L3CA 3W5YA 4J9VA 3SUQA 3VENA 4I9LA 1J54A 2RN2A 4JI7K 2F40A 1KQKA 2M8HA 1E6YB 5M1FA 1AA1B 3HHLB 3DRPA 2B4VA 2I5JA 3G71N 3AVLA 1VJWA 2CQPA 3OYFA 3FC9A 4DX5A 1ZPWX 3O3LA 1WSFA 3OTOJ 4IJNA 3UQSA 5A8WA 1GFWB 5L38A 1TUYA 4FJGA 4EHUA 3VV2B 3SLCA 4B3MK 1VBZA 4F4KA 4H8KA 2FYXA 1SJ1A 1RAGB 4BRHA 3GJTB 2B9WA 1O8BA 4FBTA 3D1OA 2HHSA 2GX9A 2NREA 3P4UB 5EVZA 3G25A 5U47A 2VF3A 3LAMA 3LP2B 2B4UA 2VKRA 1F5BA 3I82A 3WXIA 2WRMA 3CD6S 2HLUA 2A3JA 4Y2AA 1JCFA 2GELA 3TTCA 3EVOA 4FNIA 3D6RA 3IC1A 5CZVA 4X62F 4Y1DA 5DG9A 3OV7A 4WP8A 2PGCA 4CESA 2DNKA 3WHIA 4QW9A 1VQ5S 2UUBK 1T05A 3DLGA 4JI4F 1VSFA 3JB9k 1RT1A 2UUAK 1ZTWA 1REVA 4R25A 3WX8A 2GMJA 2ZBCA 3V9ZA 2YH0A 2Z57B 4ECXA 2F9DA 3MCAB 3CI5A 4C0BA 4DMZA 4HEA9 2E6LA 3SQGB 1VSIA 2Z1JA 5E3AA 5CE3A 3LP3A 2DH9A 4EO8A 1GX5A 2Z1GA 3DLGB 3DRSA 2RUSA 4NRUA 3ATUA 3B4MA 1S7HA 2K3KA 3OYLA 1REVB 3M8QA 2W9BA 1P90A 3BDPA 4G1QA 4M5GA 3VQ6A 3QBCA 1F2GA 3SDEA 5C42A 4PQUB 1U2VA 4FZZA 5AQLA 4DR7K 3W8PA 3ZX3A 4Q5VA 2BZ2A 1I6JA 4Q0BB 1Q8IA 5DK5A 2BKOA 4P2XA 1YHQN 5GVQA 5HBMA 3QIPB 1WC5A 1JXBA 4B9VA 2Y1LB 2W9BB 3Q23A 4G1QB 3AH6A 3NXZA 3DN9A 2O8FA 5D15A 1YLXA 1KAZA 5HQMA 3MFHA 1DAXA 3M2VA 3OT9A 1K8KB 1NJIT 1LV5A 2PDAA 1JLCA 3C14A 4C7QA 5H9FK 1NGCA 3NF9A 1JK9B 1MG7A 1BDGA 1ZZNA 4I6MB 4DQ8A 1VK0A 3ZSQA 2FF6A 3POTA 2YHBA 2G13A 3BGOP 3MAAB 2WB1D 2FZKB 3V1RA 2D3OR 3C65A 2J8AA 4KH6A 3IRWP 4OPJA 5AQJA 3C14B 1T9TA 4UOGA 3GBTA 4DSEA 4ZTFA 5KT7A 1RTIA 2O4IA 1NH8A 4USHA 5I9EB 5EXWA 1Q1KA 4Y00A 1OMSA 3MAHA 1HKAA 3POTB 4I64A 4CEDA 4KRFA 1HI8A 3D0HE 1V3RA 3MPVA 4H0TB 4AYBD 3KMQA 4B3OB 5HROA 3NWRA 3AVHA 1R59O 1QY7A 1RTIB 5HATA 2EK6A 1AFIA 4DSFA 2F5GA 3MOJB 2FJEB 4WFAQ 2G1HA 4YDDB 4U7CA 4FNHA 2AJFE 4NOHA 1SZ2A 1ZBTA 2O8DB 3TZWA 1TL3A 1F21A 3TQ1A 1FFWB 1HHQA 3HLUA 4P2FA 3H25A 2XC9A 5DGAA 2DFHA 3W64A 5AZIA 2ASOA 3M6XA 2E1CA 3ET6A 4DR3J 2YKMA 2IYIA 1U1NA 2ZITA 2F8HA 4B8AB 3ZT3A 4Y2MA 3TA2A 3OBYA 3CIZA 2O8EB 1TL3B 1WB9A 3AY0A 3TNVA 5B08A 3GR1A 2CAJA 1T0TV 1NXIA 3KZBA 5C0YA 4CNYA 4V19X 4LF9J 2UXBK 3SIPB 2L41A 2ZH3A 3ET6B 3RAXA 2PYJA 4B3RK 2E2NA 4IO9L 4FJ8A 4NZ0A 4MK8A 2VQFJ 4X64K 3CCVN 3HL8A 2B9XA 3N4WA 4FJMA 4CGFA 1MWKA 1VRTA 1UVJA 1XERA 3AA4A 2EXUA 2JDJA 4CK1A 3SNNA 3QT6A 4CNZA 1Y5IB 3E9LA 3DOKB 3NL0A 1J5OA 3ZSXA 2V34A 4DUZK 2HGLA 2XB2D 4GVEA 4WFBL 4JI1K 1RAEB 3FNNA 1NBEB 3GP9A 5A0YB 2X3DA 5KFWA 4N76A 1KNZA 4LF6J 3VEXA 1VRTB 3UI3A 3AGRA 4DV0K 3CULA 4I6AA 2B56A 2PSZA 1J5OB 3MWTA 3BKUA 4JLHA 4BREA 3QWPA 4BDZA 2V50A 4FWQA 2HW3A 2NCKL 1FX4A 4DV3F 1O5JA 3KUHA 3LANA 3GSDA 4MLHA 5F8JA 3CCUS 4DV4K 5C24A 3H2LA 1VQYA 3M32A 2DPIA 4WCEQ 3M8RA 5D78A 3CCES 4OJ1A 5KPTA 1YI2S 1RWOB 1YQHA 3N01A 3KLIB 5EX3A 4HTJA 1Q8LA 2Z2MA 3QZ8A 3L2RA 2E7XA 1RHUB 4X2BA 2A10A 3UNGC 5KFHA 1U2CA 3M32B 5JLFA 4CHNA 3A5MC 3D7SB 3Q0AA 2GZOA 1RT6B 3UCGA 2DFEA 5KFXA 1BWEA 2W9CB 1D9DA 2VG7B 2AU0A 3EKUA 4ZVHA 5B0CA 2RHSB 1VSKA 1SQKA 4GV3A 2NXEA 2DKOB 4WXWA 1Y97A 3GLJA 2YKNA 5AQUA 3GPAA 3C66A 2BOAA 2FC8A 2MZJA 1AYEA 4RKUC 4ED7A 1W2BR 3SPYA 1H2TZ 4BR4A 2GMLA 5D6GA 3AVFA 4LD0A 2UUTA 2HMPA 4B3TF 2QSFA 2XI2A 2GGPA 1T7PA 2RF2A 1U7LA 5KFQA 4C3LA 2E1YA 2CPXA 2ALZA 2BYCA 4PRFA 3A3OB 3AD9C 4XH5A 2EFOA 2DGUA 1EKSA 2YKNB 3IDHA 2C2EA 2WC9A 3G8TA 1X5TA 4WQ4A 4G65A 4OFZA 1KCFA 2V8VA 2BJ9A 4K8RA 1RT7A 4CIOA 2ZOGA 3CC7N 2VQEF 3P45B 3UDLA 4WFNL 3R6LB 2OP5A 2J9CA 2RF2B 4TU8A 2NLWA 1Z05A 3DFEA 4KH0B 1MWYA 4CZGA 2IRYA 1Z4UA 1TUUA 1BHLA 3EX7B 1S22A 2EBEA 1B3TA 1RTZA 3ULDA 5EUHA 4C0HA 1ZM3A 4CFBA 3BGFA 4M5KA 3R3TA 3ZSVA 3SPZA 1RT7B 4EP5A 3M1VB 1BQXA 4ECVA 1D09B 1SXLA 4D3HA 1QD1A 4ZJOA 2KO1A 3ILJA 1IJJA 1VCTA 2RE1A 1NSPA 2G9OA 1R0CB 4OKKA 1IM6A 4LSLA 4NYOA 5FLXO 1UETA 4OYIA 2W42A 1U8WA 1S1UB 5HP1B 1V4TA 4YB6A 3TTDA 4CHPA 5AQVA 2XWYA 3ASMA 5ETKA 3KNGA 5BR9A 4E89A 2HBYB 3KK2A 4J90A 1W25A 4KGZB 1KOHA 1N5QA 3AXMA 4EYIB 3OXLA 2DXDA 2RQKA 5KFUA 4FWPA 1L3SA 3ZLJA 1P9YA 3SV3A 2H48B 3BGRA 2WBNA 1W2IA 1LOUA 3GILA 2EC2A 3VGKA 2Y8WA 3BZQA 1FRXA 1Y4ZB 3KK2B 1T6DA 4YB5A 1F9HA 2OKQA 4NYPA 4ANEA 5D0GA 2M70A 2FHJD 3W5XA 1LKZA 1HW8A 3DDNA 3VQ8A 4ZVQB 2A6MA 1K6YA 3BGRB 4A47A 2I2YA 1XNQK 4QIWD 2DIVA 4PYAA 3LQVA 4FKYA 4WQ5C 2NZTA 4H4OB 1ICEB 3DOMA 4NLTA 1BQNA 4DV6J 3FZFA 3M9OB 2P9SA 4M42A 1TAUA 1TR0A 4DN9A 3R2CJ 2A41A 4LQ3A 2D0AA 2EWSA 2JVOA 4O3RA 1S1VA 4L75A 3B82A 3BUZB 4LFAK 3SYZA 2E2OA 2HHHK 4F25A 4XDCA 2FVQA 2NPFA 2IC3A 1I94K 3P5JA 1DT9A 4ID5A 1RWUA 5GMKa 3B8HA 4NYNA 3B8AX 2CQHA 3DOMB 4BBYA 2HBLA 1C4CA 3OBIA 3J81Y 2A40A 4DV1J 4K7QA 4Y2IA 1NGEA 4MK9A 1P8ZA 2MZQA 2R4FA 3AA8A 2W1BA 1S1VB 4ECUA 4PUOA 2YJEA 4F0HA 2AEFA 3PIPQ 4M3XA 3D7EO 2KT5A 5AXLA 3ZZ0A 2WW8A 2R7OA 2MKKA 1PJ6A 5EX5A 2XS7A 4ID5B 1U49A 2CA9A 2DNOA 3ZT4A 1KTQA 3FVYA 3FMBA 4BR7A 3H45C 3U6FA 3H3NO 3IA0A 4N8OA 3BQ2A 2OEMA 4J37A 2GO8A 1NMDA 2V2VA 5D3GA 2ZH9A 2NUBA 2OIHA 3HRGA 2MDAA 2LU1A 5T41A 2OPRB 3FZLA 3I8DA 3HHDA 3JTOA 3BN7A 4FK4A 3N5BA 1Z1ZA 1TQLA 3F0NA 3MN6A 4WIIA 4MIWA 2V8HA 4DSLA 2XYGB 3QQCD 2H1YA 4YB1P 1LFWA 2CGKA 4X62K 2VPWB 5D3GB 1KVBA 1KXPA 4F4WA 4YY3F 1N33J 2R7VA 4KQZA 1SJRA 3U02A 3DLEB 3SSRA 4JI4K 1R8AA 4OYMA 1HYZA 3ZTPA 5C25B 1YVFA 1CG2A 3NGYA 3ZXWA 5GAGP 2J9EA 1WOPA 3UCZP 2OFGX 4QBUA 2OEJA 1ZM9A 1T8EA 2BRKA 4BRNA 3F41A 2C2DA 3K2PA 5KOXA 1VQMN 1NZAA 2CQBA 3C16B 3K5NA 2XMWA 2DR9A 3KKSA 4JV1A 1ZZFA 1N34J 3UFCX 2QWNA 3QT8A 3FGVA 1HWUA 1BUPA 5ETVA 5GADU 1T11A 3EGWB 2KQ2A 1CJKB 2ZBQA 1FXDA 5AQMA 2XNRA 3HKWA 3Q86A 2F4VF 3MFIA 1RBOB 2HNDA 1NJYA 3UNYA 2HQIA 4IQXA 4N7TA 4RW9A 4CIGA 1H1VA 2IPOB 4P71A 2QW9A 1U2FA 2E1MC 1WTFA 3THWA 3HSCA 2QL5B 1V6HA 2IIRA 1HNXJ 1K47A 3LW5C 1WUUA 1LEOA 3L09A 1B0PA 5CABA 2GC8A 2PEHA 4OZ2A 4RW7B 1RWPB 1B99A 4FP9A 5KFBA 2KRBA 5C5JA 3QIDA 3MN7A 1IR2A 1WSVA 2VH7A 5IFMA 3LP0A 2HF3A 3RBEA 4RW9B 4DQPA 3HDSA 3C0BA 4C11A 4LVOP 4TQRA 2L9DA 3HYFA 1FCAA 4Q2LA 3OJUA 3D0GE 4O8UA 3VQDA 2AGPA 1NJZA 2FJAB 1ROFA 2MY8A 1FRHA 4HDGA 4K2XA 4CQ1A 2XM3A 4JYAJ 1TFYA 3GB0A 3PYFA 1KWMA 5M2PA 4C97A 5F3ZA 3AXKA 1VQ8N 3EICA 1QAJA 3GG0A 3IR7B 1X5PA 5LJVA 4UUXA 3H4DA 3TABA 1C0UB 2FJWA 2RU9A 2A0FB 5HVHA 4OHVA 4M5HA 1TKZB 4YR2A 2P9IB 1OH8A 1GLEG 2H5IB 4NZ7A 4CDIA 2FLNA 4X4NA 1FRMA 3M8SA 2MHEA 2FBVA 1M5VC 3KYLA 5F9LA 4JBCA 4KHNA 4RW4B 2QA4G 3H40A 3LP1B 1G7CB 2B7BB 2FZGB 2AZ1A 1RSCA 2ABYA 2X6SA 4QS8A 4H0OA 2R7WA 5KFMA 2M9KA 5FPDA 3LA0A 1TKDA 2DNQA 5IWAJ 4FOIA 4ZHRA 1X5OA 1JXEA 3BB5A 2JL9A 1K1QA 1KSPA 3VGLA 3TUZC 3CJ5A 1VSJA 1ATNA 4AXIA 4DX6A 4CO5A 5CYMB 1FKAF 3UE2A 1PCAA 2VDIA 3MURP 3E9OA 1FTCA 3GOIA 3Q7BA 1XC9A 3PHTA 3LGNA 2FC9A 2LMIA 3KNAA 2HNZB 4BC2A 2QLJB 2LA6A 2RRNA 4EBEA 4A2BA 4ZHRB 4CFAA 2QKKA 1IWAA 4BC9A 4PR6A 1MROA 4KO0A 3IMQJ 2HF4A 2MEWA 2E8AA 4OYPA 4CZCA 4KGKA 1R27B 4NB4A 3MWPA 1KQSR 3N9UC 2ZUGA 4F04B 1UFWA 4K2JA 2QWMA 3ILLA 1UWBA 1LAWA 3PW2A 3IGVA 1XHZA 3ILIA 2QMUB 4ZLNA 2VOPA 4NLXA 2ZOMA 2DY1A 1WI8A 4IRKA 2E9ZA 2H3GX 2IMOA 4A5BA 2OPPA 2H4YB 4LRCA 1MROB 5AFUH 4WFAL 3HI9A 4CEZA 3CCQS 1Q81T 1UZDA 2BV3A 3R5DA 4DSKA 5KFLA 1X4BA 3CXCR 4X4VA 4EHTA 1XMQJ 1APSA 1N54B 3R3LA 2XLKA 4DX7A 1FE4A 4YOWA 4BRMA 3PYDA 5HRSA 1S6PB 3QGPA 4O3PA 3VOVA 3VVTA 3R27A 3CJ3A 2B3TB 2JRSA 1CC7A 3T1YJ 1U0SA 5DJBA 4BDYA 2YPYA 1U6BA 1R89A 4TN2A 4USVA 2RQCA 4DI6A 5K20B 4FM1A 1U1KA 1B7YB 2ZH4A 1HUXA 3NNAA 2QL9B 3EXYA 1RHRB 1KP6A 2V5HG 4DJBA 3CCSN 5LSRA 4DV3K 3VERA 5F8HA 5LJ3Y 3L0QA 5C15A 1KOOA 3CUNA 3V81B 1N56A 3FKBA 3LTOA 4AQYF 3LDQA 4NMXA 3OYKA 1VQNS 2XBPA 1U1PA 3NY0A 2P9UA 5C2GA 2QEXN 4NRTA 3S01A 4JI3J 3SQ1A 1HBNA 4CO1A 4X66F 3VQ7A 2MKHA 2FVRA 1VQ7N 3WUHA 4IH7A 3H46O 2HQCA 3CJSA 2MGZA 4IKAA 3O9TA 4KRWA 4CFCA 1H7WA 3WZ0A 1HR0F 5AQWA 2ACMA 3NHGA 1U25A 4CJUA 2RVJA 1VSMA 2MJUA 4B1VA 2IVYA 4NMLA 1HBNB 3MF5A 1G2EA 2Z0GA 3J8AA 2CPDA 4KGVB 4P7VA 3EZWA 4JKFA 3SJHA 5FPMA 4EI2A 5H1SQ 3VWSA 2JGUA 3MTKA 1U2RA 4UT4A 2ZFHA 4ZVFA 1GTHA 5J2MA 3DXKB 3TQEA 4DS4A 3H5XA 3EMTA 4B3TK 3IP0A 1H2VZ 2WONA 3RUBL 1C0TA 4A5AA 2B8QA 4ES3A 4X65F 1S72N 4TLRA 3UKRA 3I4PA 3JAMU 4XPCA 1YRUA 3ICLA 3QDKA 1B64A 5AE3A 5GAHU 2KLAA 3R1XA 3VQEA 4U9RA 4FS2A 4WCEL 3I96A 3NFAA 1CPZA 3MM5B 4FSVA 1HWKA 2VQEK 3J7ZO 3FUYA 1NKCA 3HHLC 2MQQA 2KKHA 4GKJF 4CJLA 4RU2A 4HUEA 3QETA 2EC0A 3O9UA 3SQ2A 4LY7A 3P83D 3UKRB 3QAEA 3LOUA 5E41A 1HQUA 3CJ7A 3SCXA 4DR5J 2DNLA 3OPKA 4X4QA 1CVJA 1G99A 3D66A 3TTFA 1R0AA 1WSGA 3J7YP 4JUZA 4CIFA 1X9WA 2K06A 2Q1NA 2E44A 3DLKB 3NG8A 4Z7CA 2O67A 2D3ZA 1Q78A 1TU0B 1VI7A 3R1LA 3C6HA 3DU6A 3OTOF 1HQUB 5JLHA 1Q7YO 5CYQB 2X51A 3Q7CA 4FK0A 2L9NA 5M1OA 4A59A 1S3XA 3GFXA 3CE8A 4K25A 3IXQA 4LR7A 5AXNA 2GMHA 3M4XA 5L9XA 1FD8A 2R2UA 3I0SA 3W60A 1F1BB 4EWTA 4CECA 2V94A 5I42B 2I38A 2UP1A 3NBPA 3AO2A 3QGHA 3TVYA 2JNJA 3M6VA 4IQMA 2QLFB 3BR9A 3MEEA 3F2KA 1XIQA 3M2UA 4C23A 2CRLA 4AF1A 3CMAS 4J9LA 1TVRA 5HOOA 3MM7A 2QKBA 1KC8T 3CEDA 2A3ZA 4R8UA 1XQSC 3PW0A 3OUYB 4CJ5A 3I0SB 4J2EA 2V4JA 2YWKA 2VJUA 2ACYA 2MZTA 4YS2A 2DHSA 3RMBA 2PEBA 4AM7A 3NBPB 3BREA 1SKSA 4CYUA 3M2UB 1NG9A 1RWNB 2QXLA 4KKOA 3V9WA 4KTWA 4TNOA 4FF1A 4H5RA 1CC8A 1GAOA 4Y6IA 1TVRB 3VETA 1SQEA 3AOCA 4M3TA 1S4FA 4F4AA 2OYQA 2ASDA 3IBCB 5TKWA 2V0NA 4PL8A 4JK8A 3I9ZA 3QBXA 1F9FA 3N4QA 1PC5A 1K9MO 2IRUA 2IYGA 4Y34A 1RYSA 3HFVA 2RH3A 1NMNA 4DR2J 6FDRA 2XEXA 3PJ9A 4KAZA 2AJ2A 1CZ9A 3QICA 4DU4A 3VQ4A 1R43A 1RDWX 3HHLD 4DSIA 5SZTA 1VHIA 4HH1A 5IM0A 3PHEA 5ADXH 2RS8A 2A5XA 1NPKA 4WU2A 4LF2A 4H0XB 3NAIA 1QVGM 3CSKA 2ILYA 5LXRA 2P51A 2P9CA 4DN0A 2PAVA 1EAYC 4PHTX 1RBVA 2FJXA 5DQGA 4IWVA 2ERRA 2ZUAA 2ZDPA 5KQ8A 1DTQA 3CMES 4B08A 5AFUA 2HIYA 1URNA 1WLJA 2E66A 2DB1A 3LWLA 3CJTA 3VAMA 5AQOA 2CWXA 2POKA 2CIMA 1H98A 4DKWA 4AFFA 4HHJA 4DZDA 2IVPA 3HP9A 4PQAA 2ITGA 4I2PA 2OPQA 4YDXA 1JLAB 3GG1A 2KHOA 2VL1A 3PX0A 4BCAA 1DTQB 3PKMA 4ILJA 4FZVA 2P9EA 4EAHD 5KFJA 4KI4A 5HRNA 5LY3A 4ATNA 3L7UA 3FGUA 4CO0A 2F65A 1WKJA 1K44A 2OSQA 3QLHB 4YY3K 4PG6A 3VF4A 4U95A 3FFIB 3NF7A 1Y3JA 3W9HA 3VEVA 4M8LA 5RUBA 4DQIA 5EN1A 4FLYA 1I39A 2OPQB 4CT9A 2W25A 4L8RB 4NLQA 3AA9A 3AJ1A 1S1TB 3B54A 3U9DA 4LREA 3EJMA 4DU8A 3VQAA 1WKLA 2AT1B 3PIPL 4IFVA 4UW2A 4Y3CA 3LUYA 1XN9A 5I4MA 1U1RA 3LF0A 1DHMA 2XLJA 4HACB 2JWNA 2J0XA 2CPEA 4XTTA 4DR3F 4DCJB 2IBOA 2X6NA 2QA4N 3LGMA 1XNRJ 4J5OA 2MXYA 1KBRA 5JICA 2HMIA 3OSPA 3QGGA 4UY85 3CD7A 2RAQA 2R7SA 4F3TA 2KG1A 5AQGA 1TMJA 2OAUA 3GR0A 1LWEA 3KJNB 1FTRA 3TOQA 3RMAA 1FDBA 2PA8D 3U3YA 1TL7A 3BF4A 2KJWA 3DHXA 2F4VK 5DQIA 5AZJA 4X4UA 1C4AA 4LF9F 3I9V9 1UPPA 2IA6A 3UR0A 4QZVB 2QA1A 2P9PA 4CGGA 4CEQA 2HMIB 1KFSA 4OPAA 2VQFF 3QGIA 3FBBA 2Z2ZA 4TLQA 3H08A 3WIVA 2OJ3A 3G6VA 3CQXA 1WSHA 1TGOA 1RA6A 4QWEA 4DV5J 2VFRA 2AQ4A 2XTJP 2EKNA 1XR7A 1UVLA 3A5NC 4B9SA 3R6GB 4U6PA 1DLOA 1DARA 4ZMMA 1RB0A 4KHRA 2QWOA 3LL3A 2CVIA 3G4SN 4USTA 3B6BA 2HFOA 2ZZTA 3KK3B 2VPXB 1BHNA 3AO1A 4YOVA 3H7HB 3MX5A 4F36A 1Y00A 5AQSA 2PI4A 3CCLS 4MFBA 4O0IA 3S9HA 1S0OA 4LF6F 2WB4A 4IDHA 3TR5A 3KD5E 3V1OA 2JC1A 1PJ5A 3M8WA 3AAPA 3M8YA 3RAMA 1SIZA 2ZDOA 3ZSRA 3W66A 2NLXA 5AQXA 4PG8A 1HNWJ 1C6VA 4OYZA 2YHXA 3KUGA 1N88A 3BF3A 3GG4A 2DXFA 3BEGB 1CJUA 4ZA1A 5KRSA 4WBFA 2HKEA 1RBRA 3J80Y 2WVFA 3M3ZA 2HHXA 2U2FA 1S9GA 1O6XA 3RR8A 1HIYA 4DTOA 2WOMB 2A2CA 5AQZA 3UKUA 3HFKA 1A7GE 2WK4A 2KHCA 3NVMA 4JKAA 1BQMA 5J2QB 3PIOQ 4LRAA 1CJUB 1UMJA 3RBZA 4DCPB 4ZP6A 2O4GA 5J2NA 4KHPJ 1BA0A 2P9KB 2Q1LA 1DKGD 4MT1A 2QZ8A 2NXUA 3ILOA 4C4WA 3C8YA 3G96A 3UKUB 3TR8A 1Z2LA 3W5ZA 4URQU 4J2DA 3IRXA 4M3RA 4BRFA 1YITS 2MQ8A 1WC1A 5F8GA 3CERA 3W61A 4KE5A 3I6PA 2OMOA 2KFZA 2GVDB 4E1JA 1VQLS 3OTEA 1RK8A 5CCMA 5EWGA 2EK1A 4R5PA 1OIAA 4NX9A 4CH7A 1YJTA 1T03B 3OYAA 1JJ2M 1Q9XA 3GJRB 2A1RA 1SJ3P 2Y1JA 1W97L 5B8HA 1S6OA 2HFZA 1X8DA 1JLQA 2RS2A 3UW1A 1FHTA 3LH2S 3VA3A 3MUTP 1GEHA 1YTYA 5MLCV 4R5PB 3AVBA 2IHR1 1GK8A 3RR7A 3O1BA 2HHPA 3DOLA 3V9XA 4ISEA 3SMZA 1CS4A 4FLUA 3CCRS 4WQ4C 3NGSA 4HKQA 2V68A 2W2PP 3KJVB 4Z0UA 1VBXA 3EO3A 1N5VA 1REGX 4ZCKA 3FRYA 5GMEA 3KLFA 3CJCA 3EDQB 1TYQB 5IT9U 5AQKA 4CJSA 5E3CA 4NCAA 1FWKA 1VLOA 1RHKB 2WBRA 4X4RA 3FCHA 4RX6A 1EQMA 3U27A 5I3UB 3EVWA 1WF0A 2JLEA 5ADXA 3MCMA 1F2HA 1XJWB 3NAHA 4FWSA 2RHKA 3DRXA 1VR6A 2QSWA 5F0XA 2DRDA 1RQ0A 1WAJA 8ATCB 4O3QA 4EGLA 1VHFA 2BABA 3AARA 1WACA 1HLUA 2VBXA 5JJBA 2O01C 1RLCL 4AQYK 2O8CB 3D1HA 1X0FA 1UEKA 1NBWA 1F3FA 3HTVA 5C2DA 1X0PA 3MXHP 2VV5A 3OBWA 2HVHA 5GINA 3J81j 5CXTA 5C10A 4CGIA 2KT3A 1Y9OA 3G0ZA 4X66K 1S9EA 4DPXA 1ILYA 1MWZA 3G2XA 3AGKA 4F26A 3BYRA 4Y2CA 4BRGA 3QWUA 4QWCA 4O44A 3WC0A 1Y5LB 3M6WA 1HR0K 4RNOA 3D28A 5KG1A 1IR0A 2D0BA 5ETLA 1CZBA 1S5ZA 3RSEB 3A8KA 2G2YA 3I31A 2F96A 2KXFA 1S9EB 3OW2R 3D2EA 1S1XB 4M41A 1TK8A 3DXMB 2E1RA 4G6VB 2GHPA 2YQ1A 1HJOA 1HW9A 5E26A 1T6CA 3NCRA 2FJDB 2JZ5A 5AE2A 2G1DA 4RUBA 4DL2A 3U4LA 4DV6F 2SXLA 4QIFA 2EG1A 1GLJO 4X65K 4EFAC 2AZ3A 2HVIA 2PC6A 5J2PA 2IA0A 1VC0A 3W7BA 2YX7A 3D2EB 4MKBA 3D2FA 2HBJA 2OZSA 4EO6A 4NO7A 3AAQA 1Q4RA 4RWXA 1LK7A 3AO3A 3G87A 3I5BA 5HJXA 4GC6A 2X7IA 3EVMA 1X4GA 4GKJK 3GYGA 4J2BA 4DV1F 4BR9A 3QEXA 1RT2A 1J5EJ 1UW4A 5KFSA 1NB7A 1FKOA 1J27A 1FA0A 1YIJS 4H0YB 4CBXA 1R6YA 5DDQC 2OTJS 4BC7A 2DEIA 3P6YC 3D3BJ 3C2PA 2YX4A 1S5JA 4ETZA 3QEWA 1D4XA 2PD1A 3B6OA 3J7AN 5EU7A 3D1QA 4LF4J 2RU3A 2E2PA 2MKCA 3RRGA 4JS4A 1IKVA 1WEZA 1FX2A 4GY2B 5C12A 1EQYA 1RT2B 4OV1A 4K42A 4O55A 3QEVA 4H5WA 2VG5A 3OTOK 1FKOB 2W6KA 5AQYA 2IRXA 1N6QB 3NVKA 4FYWB 1W9HA 5F9NA 4ALZA 4AUKA 3IS9A 2XSJB 4OJHA 4BC5A 2MTLA 4IG0A 3HCXA 4F67A 1OSDA 2CZ4A 3OYMA 2E1ZA 1N0UA 1N36J 3TAQA 5BPMA 1HJRA 5J1NA 3DM2A 3FCVA 4NLSA 2JHEA 4KGXB 1IKVB 4ZIWA 4OHYA 1E3MA 1CZAN 3PR5B 2CWKA 4OI1A 3OS2A 1GMVA 3VQSA 4KGMA 4IDKA 3HHEA 3VGVA 3MEDB 1WC6A 1YK9A 2KXHA 2C2RA 4QS7A 4CD1A 3SQ4A 1A5XA 4CJTA 3ZT2A 3TUIC 1ASWA 1QQNA 4WJBA 3KOAA 5HMYA 1N33F 5F0WA 2HQFA 4YOEA 4DUTA 4FZXC 1IUJA 3M8ZA 4QR2A 3DM2B 2RDDA 4ECTA 5CD4A 3FQLA 2XMVA 3EM1A 5CZ2A 4WQ5A 2LKZA 4GV6A 1HQEA 5ETPA 3H98A 4FLWA 2ROPA 4DU1A 3NLCA 4BE1A 3DHWC 3QRQA 1H3DA 5BREA 5A2QY 3OLBA 1WG4A 3V9SA 1GH8A 2DPNA 4NLYA 4E0DA 2XI3A 3GMGA 2ZZMA 4KB7A 1TKXB 1N34F 4DMNA 1S4EA 3PLAA 2OUGA 3UR3C 2B4PA 2HHVA 4DCHA 2ASMA 3MR6A 1PIEA 1Y0HA 3AVAA 3TSPA 4KY3A 4A46A 4AHVA 1HQEB 2F3JA 2YNIA 2ZWPA 2BX6A 4EIAA 3O5BA 5KFZA 4G3IA 3FDSA 1VSDA 3QFWA 2XGPA 3ENVA 3ZSOA 3IFRA 2FHMA 4FS1A 3IWNC 2DISA 1NEEA 3FSIA 3GU0A 3U1LA 2KVIA 2F7TA 4Z4HA 1VOMA 2J6TA 3GTYX 3OYBA 3S7RA 2NRVA 3GYNA 2YNIB 2A6AA 4USJC 1ZOTA 4W92B 3CC2S 4CLWA 3BM7A 1WKKA 2PN6A 1RBSA 1LXNA 3D6FB 1HNXF 5THWA 1K8AT 4CWBA 3PTWA 2BQ3A 2OH2A 4X4TA 2VOOA 2IIHA 2WVEA 3M7VA 2MQMA 2DHGA 5GAHI 2KVQE 4DV4J 3G8QA 4RU9A 3ZSYA 5HMXA 4IOCQ 3CW2C 2ROGA 5DDOC 1IKYA 1NLKL 1HWIA 1YRXA 3O8MA 3JQKA 3BH7B 1OYDA 1YWXA 2ZC3A 3TUJC 5MAOA 3MM9A 5ETRA 5HL7L 4C8KA 3T5KA 1HWLA 3SAGA 4WIQA 3DNCA 2IVFB 2VD3A 4RCHA 4LFBJ 4M3ZA 4JYAF 1RWXB 4ZCIA 3AHPA 3VQCA 4Z4FA 3SBTA 3HBTA 1IKYB 4R79A 3W2VA 1E6VA 1YJUA 1D1UA 3LPYA 4RNHA 2QGFB 1YJ9S 4O4RA 4CZJA 1IBCB 3MM9B 3E2EA 3IM9A 3K0JA 3CM5A 3TEGA 2W2NP 5KG6A 2P5VA 3PZPA 4DX8H 1YJWN 1QAXA 1W7WA 1N8RT 4FDFA 4ECZA 1U6ZA 3MD3A 1QHTA 2GVZB 2DXEA 4WWSA 1EIYB 3W2VB 3V6KA 2DO0A 2LQ5A 5FIIA 2B7CB 4O8KA 5IWAF 3W62A 1RTDB 1RDBA 4OPKA 1RDUA 3QFPA 1A5WA 3KKRA 1H72C 1WOOA 4HUFA 2JWLA 1QSYA 1GNKA 1IQTA 4DR3K 2C3PA 2B4JA 1BUXA 4ENOA 2O66A 3ZC4A 2HB5A 2QLXA 3KG4A 2X3GA 3EXCX 4UUWA 1H73A 4XPEA 1SUQA 2G0JA 3TAGA 2BBEA 2HRYA 1SH0A 4HR2A 2FC0A 2VBZA 1SJQA 3F56A 2DTUA 4WYLA 1HA1A 2CH6A 3OTDA 2VPYB 4LF9K 4U8VA 4JV2A 4QYZJ 4IUFA 1VQ9N 3FFKB 4IYQA 2UUCJ 1SQFA 1QUPA 4IBNA 3QNOA 5HRPA 3MDFA 1TK0A 4NLVA 2LVWA 3SSQA 4JOUA 4CBUA 2EG2A 4RL1A 2VQFK 3BJYA 2CJXB 3EEQA 3OHBA 3CCWA 3H42A 1C1BA 3JSMA 2XQCA 2EKYA 5IC4B 2OO4A 2ZBRA 3VQ5A 4P7TA 4KH1B 1HBMA 2AYBA 3U3GA 3ZETB 4FK2A 1N5TA 2O3DA 2XNQA 4OX8A 3V2UC 1UVKA 2MKIA 3BQ0A 2E7VA 3T7ZA 3FZHA 4OGEA 1ITPA 4IOAQ 2CPJA 3W3DA 2CJAA 1PYSB 1XMQF 3WEEB 4K59A 3DGPA 1RI7A 4PWDA 1KHVA 2QYCA 3PJXA 3T1YF 3HSDA 1ZYQA 4LF6K 3LPUA 1HNZJ 5JVHQ 3A3NB 1IQZA 1GLBG 4B9LA 3OSNA 3C6TB 2GO9A 4JD2A 2YWFA 1RE1B 2FVSA 4Z7YA 1M1KO 5KT2A 1WEXA 2NRXA 2B6AA 1DZ5A 4E19A 2HBQB 3UB5A 1G15A 3PYGA 2HFSA 1WSEA 2M7SA 2IM0A 3P5TL 1WD6A 3MM6A 4OJRA 1FRKA 4KBIA 1T94A 1VIXA 1NAQA 3A8JA 4IRCA 5GAGU 1HNIA 3OYJA 1Q86T 5HVFA 4KB1A 1SI9A 3HKZD 1IKWA 4OX9J 2JFKA 3AJDA 3DLJA 4MDBA 3DMJA 1C1AA 4JI3F 2CQIA 1FJ7A 1LWFB 1KDNA 4URSA 1KVAA 3NCIA 3NGTA 3G9CA 4CHZA 4DU3A 1XK8A 4KI6A 3MM6B 4JKCA 1TKTA 4OI2A 4CVNE 4AILC 2EPIA 1VSLA 4M5IA 1IKWB 3OHRA 2UXDJ 3TO8A 3FEXB 4O3SA 3FR0A 4M7XA 1TV6B 4USKA 3EE9A 3D6HB 3SZ2A 3DMJB 2C3OA 4LFAJ 3PY8A 4HH0A 4CF0A 4IFEA 4XDDA 4CH1A 3PCOB 4OX7A 2V51B 3KXDA 3GSIA 3CDAA 2H5JB 1TKTB 5H9EJ 3C94A 2HAFA 5KFVA 4JK9A 2QK9A 1SL2A 3M30B 2FVCA 2PA3A 1KVCA 4W5QA 3NNHA 2IDEA 4IR1A 3THXA 3Q83A 5LMNJ 2PZSA 1DTTB 3SI8A 3ULEA 1BI4A 4M5MA 2RQ4A 3FCWA 3U1MA 3K5OA 1NOZA 3QB0A 1VJQA 1JLFB 3ZEUA 2YNGA 3C3LA 3PIOL 5G4DA 3AD7C 2R8IA 4MAKA 5A8RB 3DDKA 3PRVA 3HX9A 4HUGA 1LK5A 4H5TA 5KG3A 4UTGA 4JI2J 3TI0A 1F6TA 2DYAA 3ULEB 3SUOA 4QR1A 4DR5F 3QO9B 2VGMA 2ZHBA 3MPYA 3MHYA 4JV0A 4M45A 4ICLA 1W7AA 1WSRA 2AMCB 3KHRA 4X84A 3ZEUB 2CQ2A 2RMLA 5AQRA 4CE9A 3TWHA 3SCJE 4W5NA 2FBYA 1YZ6A 1ZXOA 2X1AA 3SV4A 3WQUA 1WBDA 5FRNA 3CQYA 2CDQA 2E20A 4O0NA 3WNGA 4ILRA 4P6QA 4LRDA 4DDFA 1LWCB 2P2CB 2NRZA 2NRTA 4H54A 4U7BA 5HLFA 4O5FA 1T44A 1HNVA 3T1HF 1P27B 3J81U 4DTXA 3NS5A 3PW4A 3NE6A 2FPHX 1SCJB 1PKUA 2LCWA 1LW0A 2BE9B 2DH8A 2OLWA 3KDNA 4J8FA 3M1FA 2BE2A 2CQ3A 1UJ6A 3AVCA 4JHDA 1PG5B 3H6EA 5D0HA 3Q8VA 3G71S 1Q7YT 2ALYB 2JEJA 5HQ8A 3UDCA 3GZ7A 1HNVB 3ZZZA 2DY4A 1U26A 1VQ6S 1L3VA 1IWGA 4KHSA 2IDLA 3EDRB 3R5JB 4LF7J 3WQTA 3QMLA 1LW0B 2LEPA 5HI7A 4MKYA 3HVAA 2BE2B 5C2FA 5KFIA 3QERA 2QX0A 3HHNB 4JHDB 5FPNA 5LT5A 1AROP 4YEAA 4ED0A 1S12A 1I5OB 3I4HX 3CDBA 4BRIA 2ATQA 5I3PA 2FY1A 4TY8A 4WXOA 2M88A 2DNGA 2GFFA 3HZGA 5ETTA 1NGBA 2AYMA 4J2AA 4QOZB 2HBKA 4DV6K 3GV5B 1TAQA 3PO5A 1JL1A 4KBOA 3TAEA 2KKZA 5F3TA 1ZA1B 5E2QA 2H4WB 2P9LA 1HMVB 4Z37A 4DR2F 2J76E 3RBDA 2ZGYA 1VISA 2APOA 4A4JA 4K8XA 3TANA 3EPIA 1RWMB 4HI1A 5D8HB 1HYVA 4DV1K 3T6BA 1VBYA 2GQ2A 1N5YA 1K9MT 4RUHA 4FJXA 1NK7A 4FL9A 2FSJA 3IGNA 4TVAB 2P9LB 3RGIA 1SAZA 3LP2A 1TL1B 3V6DB 1HPZB 5D4OA 1NGGA 3MCSA 2XG8A 3G6ES 2P5OA 2HFVA 1RWWB 2NYIA 1RKJA 2C3UA 1HQ2A 4NEZA 2LXFA 1N5YB 4OMFG 1YT3A 1YAGA 3M9NB 3TRGA 4CLZA 3N4PA 3VGUA 2BJ7A 3SUPA 1X4CA 2DNNA 2EFPA 4NCBA 4ILMA 2MJNA 2FSNA 3D6TB 1IBKJ 1OH5A 1VQKN 1D0EA 3KVGA 1VQPN 4C8YA 2RHQB 2AJQA 3C15A 2BJEA 4ZPVR 3SQGA 4IFYA 4OI0A 4ELVA 1HX1A 3TARA 4K4SA 4KB0A 3VVUA 2PMZD 4QW8A 1NGIA 2CNLB 2CPIA 1V3SA 2CQGA 4KFBA 3K17A 5EWFA 2EFVA 2JH3A 2NZCA 4Z4GA 1N33K 4PQUA 3CFOA 4ECQA 3AB4B 4K4YA 3C15B 2VFTA 1QAIA 4IFYB 3EL2A 1VC5A 4Q0BA 4DF8A 2ZKTA 2ZKUA 4MYTA 3N79A 2VG6A 3QIPA 4GVLA 1SQGA 3PRDA 3L3VA 4KFBB 4ES2A 4K5SA 3VEYA 1YKWA 1NK5A 3G82A 4I6WA 3S3OA 1Q7LB 4AH9A 1N34K 1K8KA 2G8KA 1AUDA 1NHVA 5A6WA 1IO2A 4K50A 4CEEA 5KT3A 3WXMB 5HJYA 1XNRF 2OSRA 2VG6B 2QO3A 3PX4A 1FVSA 4AHCA 4NASA 1OO0B 3BDEA 4I6MA 3E51A 2VWJA 2W2MP 4ZTJA 3DKDA 3DRYA 2C1EB 1HYSB 4K4VA 4ZP8A 3G82B 3MAAA 1N5SA 3ZT1A 3KHLA 2W40A 2V52B 3BBBA 5KRTA 3IKMA 1VC6A 5DQHA 3GL1A 3JSYA 3FZBA 4H5VA 4OYOA 2H51B 1AFJA 2G8WA 1WN7A 5L46A 3EGNA 2F8SA 3J7YU 4CJ3A 1HNXK 2CJKA 2VJVA 4DV5F 4DTMA 4TKTA 1YITN 3ONQA 3PM9A 1TK5A 2Y1IA 2MSSA 4B3OA 4LVNP 1RBUA 3N6NA 1VQLN 3DAWA 1XWLA 2DGVA 1EWRA 3RTVA 3E66A 3EZUA 3E01B 4WP9A 3KLHB 1LCUA 3I0RA 4I1TA 1Q8KA 3MMBA 3LDPA 2NQPA 5FD1A 2J0SD 4IXCA 4HVZA 2GS8A 3D67A 4JYAK 3CCVS 2V63A 2D0OA 1HNWF 3NDKA 2FIUA 2O8DA 4MO4A 1X5SA 5AXMA 4TSXA 4BWJA 2PO4A 5M1NA 1NHUA 2J0QD 3AAWB 1S10A 1QJHA 3T9NA 3SCLE 1RCXB 4OZ0A 3T5LA 4JI0F 2VB6A 4USMA 4LR8A 3I0RB 4E8UA 5M2UA 3OYNA 4ZP9A 3MMBB 1PC4A 3S3MA 4ZCLA 5DLFA 1SJ4P 3UO0A 4JKEA 4EBDA 3SFGA 2G0IA 1JXLA 2O8EA 2HVDA 5K5MA 3NS6A 4JV5J 1SB6A 3P39A 3MTJA 1X4AA 3O3GA 4KHPF 4B3TJ 5KT4A 2V8GA 5IWAK 2F8EX 3MR5A 5KG2A 2HWIA 1NH7A 3A12A 5TKYA 3OVBA 5FLXY 1UAWA 3TJ9A 5FDLB 1FDAA 4QIEA 1NK8A 7AT1B 2DO4A 4YORA 1PJ7A 2DFFA 1RGVA 4IOCL 1MMNA 3PACA 3MR2A 1ZM4A 3E1YA 2Y0BB 1D9AA 5L39A 3NKYA 1YJVA 4O3NA 3NGIA 1UCNA 4EEYA 1OVQA 3RB4A