2OPSA

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
542
structure length
535
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 134
structure length 535
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2opsA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2opsA05
4OKKA 5KG4A 1RTHB 1YT3A 4NZ0A 3KOAA 4ECXA 4KKOB 4ZVGA 4O4RA 1IKVB 4IRDA 4ZP8A 3MFIA 4J9SA 3A2FA 1GX6A 4JRPA 3GILA 1IKXA 1QE1A 3GV5B 5JS2A 4NYNA 4AHRA 4ZPBA 1EKEA 3V6DB 4KHUA 4H8KA 4HCBA 1EETA 2ZD1A 4I2PB 1HPZB 4Q43A 3MEGB 1JKHB 5C24A 4FJNA 3P5JA 3BGRA 4DSJA 4KO0A 4CF2A 3KMSA 2XHBA 4NLVA 1S1VB 2FVCA 3SQ1A 3MXJA 4O3QA 5KFHA 3KK2A 4EZ6A 4CJLA 2BRLA 4CJUA 1RDAA 4ID1A 2W7OA 4H4MB 1RTDB 3V1OA 4K4YA 3T3FA 1U45A 5I3UB 4JS4A 2OA8A 3QERA 2IC3A 3NGYA 1C0TB 4LH5A 4DSKA 1IKYA 4FLUA 3GQCA 4J2AA 2GBZA 5HROA 4RG8A 2PYJA 2UUTA 2IM3A 1SL0A 3KK1B 5KT2A 5FDLA 3SUNA 1TL3B 4NLRA 2AWZA 5KT3A 4OVLA 4FJ8A 1C0MA 4F50A 4PA1A 2FJXA 4CJEA 4FJXA 1RA6A 4R5PB 3T5JA 2Q3SA 2WONB 4CHNA 2HHVA 1DLOA 3KLEB 1REVB 4DU4A 1S1TA 4I7FA 2O5DA 1GOAA 1VSKA 2J6TA 3O3HA 1WSGA 1EP4A 4YNQA 3OJSA 4PUOB 3KLVA 4IH7A 3DRSB 5C42B 4RW8B 1A5XA 5KI6A 4HKQA 4E89A 2V9WA 3ALYA 1BQMA 3KLIB 4N5SA 2G8FA 4FZZA 1JLCA 4CEOA 4K4XA 4OPKA 3QEVA 4KB1A 2FVSA 5KFWA 1NK9A 3QIOA 1D8YA 3NKYA 4GC6A 1RBUA 1D0EA 4IKAA 5KT5A 5J2NA 3VQBA 3SFGA 3M9NB 3E01A 4YR3A 4Z4HA 2D3ZA 4WYLA 4W5TA 5KFEA 4NLSA 3OS1A 3OYAA 3N6LA 4YQWA 4J9MA 3NGZA 5FROA 5DGAA 4DEZA 4BWMA 4CJQA 4KHRA 4E1MA 4DFJA 1D5AA 2XY5A 2IOCA 4M42A 2Z1HA 1K1SA 3SJJA 1BQNA 4KB7A 3EPGA 2Z1GA 5KFMA 1R0AA 4AHCA 1S1XB 1QUVA 1NKEA 4PY5A 3H5XA 3BSAA 1CXQA 5DG9A 3OL8A 3AVKA 4OL8A 1RDBA 3CYMA 1VRUB 4Z4EA 1RT5B 3ZT1A 2AQ4A 1QS4A 4RUCA 2RF2A 3QO9A 3PW7A 3QNNA 2A1SA 1FKOB 1SV5B 5KRTA 4G1QA 4NRUA 2XRIA 3AO1A 3HP9A 3NF9A 3NMAA 1Z4UA 2YNHB 1X9MA 2FVRA 4EO8A 1ASVA 4IH6A 2W9CB 4R8UB 4FXDA 4WFZA 3MEGA 3HYFA 2VWKA 5FRNA 1HARA 3RB4A 3MR6A 1ZTWA 2FJVA 2FBTA 2C2RA 3HO1A 1S6PB 3MF5A 4CJRA 3KHHA 1KHWA 4ICLA 4DFKA 1S9GA 1XHXA 3IAYA 4FW1A 3PR4A 1KVCA 2KW4A 3AVLA 4CIGA 1L3VA 1YVFA 4ID5B 1LW2B 2VA2A 1U47A 4C8OA 4CEBA 3M8PB 2ATLA 4IRCA 1RBTA 3VQ5A 1JLAA 1NJWA 4N47A 3BR9A 4TYBA 2HHXA 1WLJA 1RT7A 3EYZA 4AILC 1NK4A 3FFIA 2ASJA 3M8RA 3BSCA 4MFBA 3HHKA 1C1CA 2BRKA 2B6AA 1RYRA 4YFUA 3DDKA 4ECQA 1CZ9A 3HP6A 3GIMA 4RW7A 4KAZA 3KLEA 2HNYA 1WAFA 3VQSA 3LANA 5KG7A 2OPPA 3SI8A 3LP0B 1ZTTA 2F8SA 4LQ3A 1CLQA 3H5YA 3DM2A 4IG3B 3V1QA 4PUOA 3AV9A 3EZ5A 1J53A 3V6HA 2XY7A 3PO4A 4C8LA 4WZMA 4QAGA 4LH4A 3C6UB 4ED8A 2IS3A 4FJIA 5T7BA 2D0AA 3O4NA 1TV6A 1TQLA 3V9XA 4Z4IA 1VSHA 3V6JA 4J9NA 4B9NA 4NRTA 4CESA 3V81A 2YNFB 2JEIA 4TY8A 1TL1B 1W0HA 4FK4A 1LWEB 2FC0A 4KTZA 2ATQA 1HYZA 3DLBA 5F8LA 1HQUA 3SQ0A 4LQ9A 2FLNA 1EXQA 3T5HA 2XC9A 3I0RB 1HNVA 2PYLA 4B9VA 1ZBUA 1TGOA 4NLWA 2BQ3A 4UQGA 2OPSB 1U49A 1NK6A 2XCAA 2WOMA 3F9KA 4Y3CA 5J2MA 1RT6A 1S49A 3LP2B 5DG8A 4ZVEA 1Q8IA 4AHTA 4DTNA 4NLGA 4LY7A 1LV5A 2HHWA 2YKMB 4ELVA 5SWMA 3HT3A 4CK3A 1TAQA 2E6LA 2FLPA 1XR6A 4RUAA 4BE0A 3K57A 1SV5A 1T05A 2YNGB 1SH3A 2G8KA 3TAQA 3HVTA 3DLEA 3U6FA 3H59A 4O4GB 4B9MA 1HRHA 4OGEA 1RT2A 4YP3A 4QOZB 4EZ9A 4Y2CA 3NHGA 4KSEB 3LP1A 4R8UA 4B9SA 4J2EA 1TAUA 3TAMB 2D0BA 2UVUA 3TR8A 3G86A 2AX1A 3QIPA 4CHOA 4DTRA 1IKWA 2IBKA 1JXEA 3KK3A 4KV8B 2HNZB 3AVJA 2JC1A 3IS9B 1S1UA 1S1WB 2HWHA 1C2PA 4MK8A 1QSSA 1WN7A 2X74A 1NNDA 5KFOA 2VWJA 5D3GA 5KFVA 3NF7A 4ID5A 5KFQA 4WE1A 5J2QA 4O3NA 3VA3A 3AO4A 3SI6A 4KHYA 5CZ2A 3KLHB 3TAFA 4XPEA 3OYCA 4DL3A 2V4QA 1MU2B 1W9HA 3M8QB 1KLMB 3LWLA 2KZMA 1SH2A 2HHSA 3PZPA 4J9QA 4FLXA 3BSOA 4DQQA 3AVIA 2XCPA 3KIOA 3DLKA 4ZHRB 1U4BA 5KFDA 1MMLA 4I2QA 1CSJA 4DTPA 2J6SA 3I0SB 4DS5A 4FJ7A 4M41A 4FYDA 2ASLA 2Y1JA 5KFXA 4DL5A 5JXSA 4KFBA 4LSLA 3BQ1A 1FK9B 5FRMA 3DLGA 1RTJA 4F2SA 1HYSB 4MIAA 2QKBA 3QZ8A 4URGA 3NBPB 3E51A 4FJJA 1S6QB 2AGQA 3U3GA 1UA0A 3L3VA 4Q0BA 2GC8A 3ITHB 1TKXB 3UR0A 1U09A 2BE2B 3G6YA 3WNFA 5C25A 3VQ6A 2IA6A 3IRXB 4PQUB 4CGDA 4J2BA 3TWHA 1JLGA 4I9LA 1QAIA 2D0CA 5KFUA 4ECTA 3NH2A 5KFSA 1QTMA 1RTIB 4JV1A 3Q8RB 3DOLA 4KHMA 4IR1A 1NJXA 4ECVA 3F73A 3DI6A 2HNDB 5KFFA 1RT1B 5EDWA 1HMVB 4RW9A 5KFRA 3LPTA 1BHLA 4IDKB 2VG6A 2HMIA 1JLFB 1JXLA 5KFJA 2X6SA 2UUWA 5CYQA 1NHUA 4MK7A 2KTQA 2OPQB 3KTQA 1C0UA 2YKMA 2W42A 3MR2A 5KFZA 1GX5A 4E7JA 3K59A 3S9HA 3EZUA 4DFMA 1DTTA 1SKRA 3HL8A 5F8MA 4ZTJA 1RT4A 3V4IA 4FM0A 3QEIA 4FBTA 4KBIA 3K58A 4RNOA 2JEFA 5J1EB 2ZKUA 4IH5A 4TLRA 3CVKA 4M3WA 3I5AA 1XI1A 5DQIA 3QLHA 2XGPA 2XWYA 3M9OB 3RMAA 4B3OA 4EP5A 2OZSA 4RW6B 4G3IA 1WSFA 1VRTB 3HSTB 3I8DA 2IAJB 4CEEA 3ZSQA 3PVXA 2JC0A 3CIZA 4IOBA 3IS9A 1L5UA 4J9LA 2DPJA 3DOKB 3S3OA 5KGXA 3C94A 1SUQB 5KFKA 3MECB 4CEZA 2G8VA 5K14A 1J9AA 4M3XA 4Q8EA 5KG6A 1LW0A 1CZBA 4ZPCA 3AO3A 3QETA 1DTQA 2Z1IA 5F8JA 4YMEA 2I5JB 4F3OA 4O44A 3TVKA 5T14A 3HXMA 3PY8A 1RT3A 1NJZA 3OHBA 1LWCB 4QWCA 4FZYA 4IFVB 5L9XA 3MTKA 4HCCA 4CJKA 5I42B 4HUFA 4DG1A 3NGIA 1LAVA 1S48A 4O3SA 1VSDA 5DK5A 3KHRA 2BDPA 3PUFA 4CF8A 2VG7B 1S9FA 1TVRB 3VA0A 4ZPDA 1GOBA 5EU7A 2R2TA 5DMRA 2V0NA 2ILZA 3CDEA 3KLFA 2WHOA 3LAMA 4CF1A 4KE5A 1B92A 4QWBA 2D41A 3D5MA 4DSIA 3OL9A 2RKIA 1Y97A 4F8RA 5CYMA 4CF0A 2EX3A 4FJLA 3MEEB 1KLNA 5KFCA 4M3TA 1JLQA 5F8GA 2DFEA 2YKNB 1KVBA 5SZTA 2OPRB 3TAEA 1D9DA 1X9SA 1TKXA 1TKZA 1JLBA 3ZSWA 4RNFA 2E6MA 3QGHA 4M95A 3UIQA 1A5WA 3V9UA 5KTQA 3VQPA 3OYFA 2KFNA 1T03A 5KG2A 2J6UA 4J2DA 1B9FA 3LZJA 1NK8A 2CKWA 1RTIA 2ALZA 3G6XA 4Y2AA 4IG0A 3FRZA 1TK8A 3NF8A 3DRRA 3OYMA 3HJFA 1VSLA 3ULDA 2ZE2B 5HLFB 2VG5A 3DYAB 3MEDB 3S3NA 1NJYA 1NOYA 5HBMB 3OL6A 1HMVA 3RB3A 3KLGB 4FLVA 1N5YA 3ZT4A 4ZPAA 3N6MA 4DF8A 1N56A 3SUQA 3OLAA 4F4YA 4EBDA 1J5OA 4DF4A 1F21A 3L2QA 4WYWA 4DSLA 1RTHA 2HHTA 4KKOA 2UVRA 3GYNA 4FJ5A 1IKVA 4O5BA 3C6TB 4NLYA 3L3UA 5KGWA 4QWAA 3SPYA 4YR2A 4W5NA 5DLFA 1VSIA 1WNEA 3V6DA 1S10A 2RN2A 4FLTA 5JS1A 1C6VA 4DQRA 4I2PA 4DTJA 1HPZA 4I9QA 4YR0A 3L8BA 1JKHA 4DS4A 3DMJB 2QK9A 1EX4A 4CEAA 4CHYA 3GV8B 1WSJA 2G8HA 4CCHA 1S1VA 4M3ZA 3PW4A 1JX4A 5HRSA 4ZP9A 3RB6A 4O3PA 3FDSA 3SNNA 4CECA 2ILYA 4K50A 3NL0A 4DL4A 4CHQA 1C1BB 4FJGA 4KAIA 4H4MA 4ED2A 1RTDA 1SUQA 4Z4CA 5KRSA 5F8HA 1N6QB 1L3SA 5I3UA 4RNMA 2GUIA 2R2RA 1C0TA 4GW6A 3IGVA 1RYSA 4H4OB 4NYZA 3SQ4A 3KK1A 2BANB 4CF9A 4N56A 4GC7A 1HQEB 4NYFA 1TL3A 3IGNA 3KJVB 3CJ2A 4Q8FA 4CJPA 3CFOA 3HVRA 4M3RA 4X2BA 1FKPB 1K1QA 5KG0A 4ECZA 4DTUA 1IO2A 4R5PA 1WNSA 1XR7A 4ECWA 1D1UA 2WONA 3TQ1A 4RZRA 1CXUA 1REVA 4DTOA 3PJXA 4MKBA 4Y34A 3QEXA 1HNIB 4AH9A 2AU0A 3TI0A 2HAIA 3TAGA 5KG1A 3OS0A 3QGGA 5L1JA 4CIFA 3DRSA 5C42A 2YNIB 4RW8A 2F8EX 3TARA 1TKDA 4NLPA 2R2UA 5HP1B 2C28A 3B6PA 4DL6A 2W9BB 3MEEA 1QSYA 3PX0A 3KLIA 1ZYQA 4M3YA 3Q8SB 2DPIA 3V9ZA 3ZT2A 4URSA 3O4QA 4LSNB 1JLEB 2DTUA 1WAJA 3JSMB 3H08A 3GIKA 4WXOA 1IH7A 3PX6A 3KHLA 3K5LA 1WSEA 4TYAA 1ITGA 1UWBB 2GIRA 2CJQA 4KI4A 1T7PA 2XO7A 1XR5A 3EPIA 3LZIA 3PX4A 1ZBIA 2W8KA 2IM0A 3RWUA 1SL1A 5CZ1A 5J2PB 2HHQA 2JEJA 2G8WA 4NCGB 3VQ9A 3RAXA 3T19A 3NDKA 1S1XA 2IDOA 3FSIA 1T3NA 2P5GA 2D7SA 3QEWA 2GIQA 2IGIA 4L8RB 4CGJA 4XIUA 4CGHA 1KFDA 2F96A 5EWEA 1VRUA 1RT5A 4NLOA 5DGBA 4JRQA 2FVQA 3IG1B 4EO6A 3CFPA 3UQSA 1FKOA 2D3UA 4CFCA 4FCYA 4K4WA 2UVWA 4ED3A 3MXMA 2P1JA 1NK7A 4NCBA 1BGXT 3AO2A 3H98A 2YNHA 4Z4FA 4DMNA 5HRPA 3HKWA 3PW2A 3RR7A 2AGOA 3L2WA 4HUEA 2W9CA 4E0DA 2JEGA 3H5SA 4CJSA 4KHSA 4O3OA 4DTSA 3ZT3A 3L2RA 3DMJA 4ZP7A 3ZSYA 3QZ7A 1IKXB 1QE1B 3THVA 3ASMA 3PJWA 1RILA 2KZZA 1S6PA 4NCAA 4DQIA 3MAQA 4CFDA 1EETB 2ZD1B 4DSFA 3RMBA 3AA3A 5C24B 3DRPB 3MR3A 3BGRB 3VQAA 1RDRA 3ISNC 4KO0B 1RA7A 1LW2A 4F2RA 4CJWA 3M8PA 2FBXA 5F9LA 4H4OA 5KFLA 5DQHA 4ED1A 4E3SA 5KFGA 1NK0A 2AJQA 3GIIA 4M3UA 1RBVA 2BQRA 4TSXA 5E41A 1OS5A 1TKTB 4ECUA 2IC3B 3S3MA 4U6PA 4O0IA 3O3GA 2W7PA 1VSFA 2PY5A 3N6NA 4BE2A 1U04A 5HROB 3QNOA 2BGGA 3KNAA 3ZT0A 5FDLB 2B5JB 3CDUA 2B4JA 5DG7A 4ZP6A 3SPZA 1BIZA 4N41A 4OPJA 5F9NA 4CE9A 3LP0A 1WSIA 1T94A 4IG3A 4AHVA 4LD0A 2QKKA 3PW0A 2GV9A 1DLOB 3C6UA 1S1TB 4I7FB 1LWFB 3OYNA 3D0PA 2C2DA 1EP4B 2YNFA 1Z25A 1TL1A 4ZVFA 2EHGA 4W5QA 1LWEA 4NLQA 3CM5A 4ED6A 1TK5A 3UDLA 4O3RA 3NH1A 3AA5X 4CFAA 4MH8A 3JSMA 3AVGA 4KHQA 4BWJA 2HW3A 3ZSOA 1N4LA 1BQMB 3ZSRA 4NLDA 3K5MA 4O55A 4Q44A 1JLCB 2R2SA 3I0RA 4KI6A 2DY4A 4F4XA 4M94A 2R7YA 1KTQA 5J2NB 2OH2A 2LSNA 2ZQBA 2OPSA 3SV4A 3CJ0A 3ZSVA 1BIUA 3NH0A 2XI2A 1RBSA 3LP2A 1UA1A 3NF6A 5EWGA 4EYIB 3OYJA 4EEYA 1FXXA 4ZMMA 3PW5A 3V1RA 4DL7A 5EWFA 3MFHA 5KFAA 2OYQA 3KKSA 3TANA 2C22A 1BQNB 3VQ8A 3LDSA 4DTXA 4E7IA 1R0AB 3ZSXA 5CY4A 4JV0A 2YNGA 4NLTA 4EYHB 3NFAA 5L1IA 1D9FA 1XC9A 4O4GA 3H5UA 2RDJA 4ED0A 5JUMA 5KG3A 3C95A 2P51A 2RF2B 3QO9B 4EBCA 1VSJA 4OJRA 2X6NA 3TAMA 4C8KA 1S4FA 4G1QB 4CHPA 3QINA 3Q8QB 4CJ5A 3RR8A 3SUPA 4KV8A 2HNZA 4CJTA 3MXIA 1JL1A 1NKCA 3H40A 3V9SA 3AVCA 1S1WA 4TY9A 2ITGA 3OYGA 4GVMA 5L1LA 4Q5VA 4QWDA 3CM6A 4DU3A 2XGQA 3DRPA 5KFTA 2AGPA 3CJ4A 2E9TA 2BQUA 2E9ZA 3KLHA 1BCMA 4CFBA 3QGIA 4ICLB 3NAIA 1S9GB 2DFFA 3AVMA 4XPCA 4JV2A 1G15A 1RBRA 4IQXA 1MU2A 1S0OA 3M8QA 1KLMA 2YV0X 1TKTA 2PZSA 3ISND 4B9LA 3M8SA 1VSEA 1JLAB 1I3AA 3HPHA 3OYIA 2HB5A 4QWEA 3H2LA 1BISA 2B5JA 4ECYA 1RT7B 1S97A 3FFIB 4RNHA 4FK2A 4ZHRA 3DLRA 4WFYA 1T8EA 3JYTB 4MFBB 4RNNA 4EBEA 3I0SA 1C1CB 2W8LA 2B6AB 1RAJA 5KT7A 1KVAA 4B9TA 4DLEA 2W9AA 3D45A 2BR0A 4OKEA 5EUHA 2QXFA 4RW7B 2HNYB 3AVBA 1FK9A 1YTAA 1JL2A 2R8IA 1LWFA 1HYSA 4QW9A 1RDDA 3AVHA 2OPPB 3SFUA 2Z1JA 3NBPA 4FLZA 3CDWA 3DM2B 4Y1CA 1S6QA 3ITHA 1S0NA 1UOCA 3QEPA 3WNEA 2BE2A 1TV6B 3RBEA 4BACA 2WRMA 3DLHA 3P83D 3IRXA 4PQUA 3V81B 4K4SA 3RRGA 4TY8B 4TXSA 3OSPA 4ELTA 2E9RX 3OYHA 4FJKA 3P1GA 3GIJA 4C8NA 4CEFA 3HPOA 3AO5A 2YHBA 4KTWA 3PV8A 2WCXA 2HNDA 1HQUB 1L3TA 1RT1A 4CJVA 4HHTA 1ASUA 1LAWA 4IDKA 1O1WA 1HNVB 4KREA 1JLFA 3GV7B 4Z4GA 4AHSA 4N76A 2G8IA 2OPQA 3VQDA 4MIBA 4WFXA 3VQQA 4E7KA 2WOMB 2NUBA 4ECRA 5J2MB 1RT6B 3KKRA 5DQGA 4FJ9A 4JUZA 3OYLA 2JGUA 4F4WA 1J54A 3VQCA 3KD1E 1BI4B 2FJWA 4JLHA 1SKWA 5KT4A 5KFIA 2B43A 2DFHA 5DLGA 1VK0A 5J1EA 4ZVHA 4FZXC 3QESA 3UPFA 2ETJA 1IG9A 1T05B 4RW4B 3LWMA 4K4UA 3HVTB 4RW6A 3DLEB 2ASDA 1VSMA 1VRTA 4FLYA 2IAJA 4KB0A 3NAEA 1RT2B 4CHZA 1KFSA 3CJ5A 3DOKA 3LP1B 3H4BA 3AA4A 3MECA 1Z26A 1HJRA 2R8KA 4FJHA 4KHNA 3QIPB 4QW8A 1IKWB 4OGCA 3L2VA 4IKFA 2I5JA 3KK3B 4CJ4A 1GOCA 1S1UB 4TQRA 4DFPA 4KHWA 3OHAA 1LWCA 2HVHA 4IFVA 1SL2A 1KRPA 2IJNA 5I42A 3OL7A 5D3GB 4IBNA 4FVMA 1NHVA 3VQEA 5KT6A 4GMJB 4WE1B 5J2QB 3LAKA 2JLEA 3SCXA 4OKJA 1Q9YA 1KSPA 2VG7A 1RDCA 3T5KA 1TVRA 5KG5A 3OYBA 1N48A 1S9EB 4J9KA 2IM1A 4B9UA 3HM9A 3ZSZA 3QIDA 3CFRA 3JYTA 4U7CA 5HRRA 4XO0A 3RRHA 3BQ0A 2V4RA 3OLBA 1KHVA 4TQSA 2A1RA 2FBVA 4BDYA 4BDPA 3U3YA 3CJ3A 4O0JA 1WSHA 3M9MB 3DLKB 3L2UA 4NLXA 3MR5A 3NCIA 2G8UA 1KCFA 4I2QB 3AVAA 4CGFA 5KFYA 4CGGA 1S0MA 4HUGA 3NGDA 4FS2A 2C2EA 4E1NA 3WNHA 1B9DA 2YKNA 3VN5A 4H54A 2OPRA 3SYZA 4FLWA 4KFBB 4LSLB 1NK5A 4FM2A 3DLGB 1RTJB 4KPYA 2KQ2A 4PWDB 4M45A 3HK2A 3G0ZA 1ZBFA 4CK1A 4MKAA 4Q0BB 2XY6A 4FM1A 1RCHA 1K6YA 3FQKA 2FVPA 3OVNA 2FBYA 3BJYA 5C25B 4KTQA 3NE6A 2ZE2A 5HLFA 3DYAA 1W25A 4K8ZA 3MEDA 2O4IA 5HBMA 1JLGB 3RTVA 3KLGA 1XWLA 3K2PA 1BCOA 1TP7A 3FQLA 2KFZA 4R0EA 2D5RA 3DOLB 3OY9A 4DSEA 1QAJA 1ZBLA 3DI6B 3BREA 1U48A 3KMQA 5L1KA 4DWIA 1IM4A 4B8AB 2HVIA 3BQ2A 4FJMA 4DQSA 1UAXA 4IFYB 4RW9B 5KFBA 3OYEA 3OS2A 3LALA 3VQ4A 2VG6B 2HMIB 4F4KA 4C8MA 5CYQB 3SQ2A 3C6TA 1BI4A 4K8XA 1QQCA 4CEQA 1S5JA 4DTMA 1C0UB 2F8TA 2XI3A 4F4ZA 4HTUA 2WK4A 2RDIA 4ED7A 3QYYA 2XY8A 1DTTB 4MQ3A 1X1PA 4W5OA 4RW4A 4ECSA 1HYVA 1RT4B 3V4IB 2YHAA 3OJUA 4J9PA 1ZETA 3RBDA 2P5OA 4E7LA 4E7HA 1JIHA 1C1BA 4K4ZA 1BL3A 3NAHA 3QLHB 1N6QA 4WXWA 4B3OB 3EY1A 2QE5A 3PO5A 3OYKA 3AVNA 2X78A 4FK0A 3KK2B 3G6VA 4CK2A 4Z0UA 3HVAA 3SUOA 2RPIA 2E4LA 2BANA 4RU9A 2I1RA 5F8IA 1I6JA 1XHZA 3ZCMA 5K14B 2O4GA 1HQEA 2VA3A 3KJVA 1LW0B 3SV3A 4CEDA 4DU1A 1L3UA 4EP4A 1I39A 5HRNA 3OSNA 1DTQB 1IKYB 3I5CA 4FW2A 1FKPA 1YVUA 4NLUA 3TABA 4O44B 1QHTA 4CIEA 3WNGA 1RT3B 4IR9A 1S9EA 2HHUA 4Y1DA 3T1AA 3RMDA 1RNHA 4J9RA 3H4DA 4DG1B 3RMCA 4HVJA 1HNIA 4CGIA 2HWIA 3K5NA 4DL2A 1X9WA 4CJFA 1NOZA 4JS5A 5C5JA 2IMWP 4IRKA 4ELUA 4TN2A 1JXBA 2EC0A 3SZ2A 3ICLA 3KD5E 4B8CA 2YNIA 4F3TA 3RAQA 4CERA 2R8HA 3KLFB 5HP1A 3HVWA 4FS1A 2W9BA 1ASWA 3BDPA 1QSLA 3OYDA 1SH0A 4Q45A 3D28A 1C1AA 3PR5B 2RKIB 2QV6A 1A5VA 5CYMB 2FLLA 4LSNA 2OZMA 1JLEA 2AX0A 2WB4A 4K4VA 3V9WA 1YTUA 3O3FA 4E19A 3PHEA 4PWDA 1JLQB 4KRFA 4CJ3A 3V6KA 3AA2A 4OLBA 2UVVA 2IJFA 1UWBA 3I5BA 4QCLA 5KFPA 3TAPA 3RB0A 2R8GA 1TKZB 1JLBB 3LP3A 3CO9A 4URQU 4K4TA 5J2PA 2WTFA 3VQ7A 3E01B 1T03B 4B08A 4NCGA 3G10A 4OLAA 4QPXA 3CWJA 4J9OA 3Q8PB 3CQ8A 4MK9A 5F8NA 4IG0B 3CG7A 4DLGA 1Q9XA 4BDZA 3K5OA 3DRRB 2VG5B 5KFNA 1ZBHA 3LPUA 4WZQA 4IFYA 1N5YB 3IG1A 3AVFA 4ZTFA 3BSNA 4W5RA 2R8JA 1NKBA 4DQPA 2IM2A 4BE1A 3KHGA 4FBUA 4AHUA 3T5LA 1SKSA 3B6OA 3HPGA 3IN5A 1J5OB 1TK0A 2Y1IA 4HYKA
chains in the Genus database with same CATH superfamily
5KG4A 3W2VA 3H1VX 2EC2A 1WC6A 2QA4G 4V19J 4AD6A 1Q5VA 4ZP8A 3MFIA 3THXB 1KD1T 4DX7A 3GILA 1QE1A 5K20B 3GV5B 5JS2A 2JLFA 2PD1A 2V94A 4KHUA 4YOUA 3LH2S 4HCBA 1EETA 2ZD1A 4I2PB 1JKHB 5C24A 4OZNA 3BGRA 1PYTA 1NGDA 1EWRA 1S1VB 3MXJA 4O3QA 3KK2A 3R7BB 3BGLA 5DS7A 4A62A 1S76D 1RDAA 1Q1KA 4ID1A 2GO9A 1JWWA 1M1KT 2HFVA 3ZZYA 5AQZA 3T3FA 1U45A 4D3GA 2RJZA 2OA8A 4YB5A 2IC3A 3TW0A 4V19S 3SCJE 5BN9A 2EFVA 2FY8A 3G8SA 1HNXJ 4DSKA 2KYZA 2J9CA 4F26A 3CMAS 2IM3A 3KK1B 5FDLA 3A12A 1RCXB 1NMEB 3SUNA 4DR1K 5HSPA 4NLRA 5KT3A 3NP5A 4OVLA 2GVZB 3HZGA 4PA1A 4JEPA 2NRTA 4GKJK 5LT5A 1UFWA 1YAGA 4R79A 1M1GA 1RA6A 3T5JA 1NGBA 3NGUA 3DCAA 4HR2A 1MSWD 1GLJO 5LOQA 5AQWA 5KOXA 4ER8A 4JK7A 2DNOA 2HBLA 1T02A 3KLVA 3IAS9 4DV4F 4IH7A 2Q3PA 5KI6A 3T1YF 3BO2A 4E89A 3WUHA 4WPAA 2VYPA 3RSEA 3I55N 1NGAA 2A3ZA 4BQZA 2EG2A 3A5MC 5KFWA 3QIOA 3WXIA 1FRIA 5KT5A 3A0IX 3FCHA 3SFGA 5THWA 1AT1B 3E01A 4GKJJ 2E88A 4YR3A 4USVA 4Z4HA 2HFUA 4WYLA 3MUTP 2UXDF 3OYAA 1UW9A 4OJGA 4K2XA 4OHWA 4DEZA 2NZ4A 1NGGA 4CJQA 2UV8A 2XY5A 4QU6A 2CPFA 5KFMA 2VFTA 1QUVA 4ZCMA 3H5XA 1OIAA 1TUYA 3TVZA 4C98A 4OL8A 4J91A 4NXNF 2QTWA 2IIRA 2AQ4A 3IKMA 4UF4A 4LSZB 2NUUG 3EXCX 1XEZA 3JTNA 1FKOB 1BUPA 4PG7A 4NI2A 4NRUA 3NF9A 2QSWA 1Z4UA 2GNKA 2YNHB 2ITMA 2NXUA 1OPIA 1VQNN 4OPHA 1HW8A 2X1GA 4BR5A 5CABA 5HQLA 3MR6A 1ZTWA 2RUSA 1SQGA 3TQEA 1YI2S 4CJRA 2RHKA 2HAFA 3GONA 1XHXA 2DKOB 4C4WA 2E1PA 4HACB 3HSGA 5TKWA 1L3VA 2HF3A 2VA2A 2DRAA 4NYOA 1EZZB 4LR9A 4IRCA 1RBTA 1WG5A 1NJWA 3IR7B 4TYBA 2HHXA 2CRLA 4AILC 1REGX 3MMBA 3OTOK 2KHCA 1EAYC 4MFBA 2HS0A 1M5OC 2WBMA 1U0HB 2J0XA 3DDKA 1U6FA 3OXLA 4FYYB 3HP6A 4USMA 1CZ9A 1VQKS 1V4TA 1WAFA 3VQSA 3QBWA 2DBBA 3SI8A 5BRDA 1ZTTA 2F8SA 1WI8A 3M30B 1CLQA 1VHIA 2VJVA 4C8LA 3PO4A 3P38A 4LH4A 5T7BA 3O4NA 3MDFA 1TQLA 3V9XA 4Z4IA 1VSHA 2LQ8A 4J9NA 1LFWA 2BE7D 4NRTA 2H4YB 2V2KA 3LGNA 4FK4A 1LWEB 2FC0A 4M5DB 2F8MA 2CJKA 2OAUA 3OTOJ 4U67L 5F8LA 2IFXA 2R7SA 2A1BA 5C2CA 3CUNA 3MN7A 1V3RA 3SQ0A 4LQ9A 1RSCA 1EXQA 3QAEA 1NH8A 1HNVA 2AYMA 1TGOA 1D4XA 1IR0A 4O5FA 2ZHAA 1U49A 3V2UC 3A4TA 4BHQA 3MM8A 1RT6A 1TL7B 1E6VB 2BX6A 3MK6A 4FWMA 3OXGA 2KJVA 1EO1A 2X3GA 2GVDB 4LY7A 3ZTSA 2MMYA 1LV5A 3I4HX 4AXJA 1QAXA 1TAQA 1R8HA 5LMNK 3QBCA 4CLWA 4FOEA 1XR6A 1XNRF 1X4DA 1SV5A 5DZ6A 1PAUB 3TAQA 1FVQA 2QYGA 3AHPA 1JK9B 4O4GB 3R5AA 1U1OA 4YP3A 4K42A 5T41A 4JAXA 4EZ9A 4DBQA 3WXKA 3P4UB 2AP1A 1TAUA 2BM1A 3OW2M 2D0BA 3IO1A 2VQEF 4I6AA 4CZJA 4LFAK 2IBKA 3IUCA 4C7QA 1YDLA 4KV8B 2HNZB 2AEFA 3AVJA 3VETA 4NZ7A 1S1UA 1C2PA 1QSSA 2X74A 1VQ6S 3A13A 1HR0K 3IFRA 2ZH2A 3EGWB 5D3GA 3ILLA 2LQ9A 5KFVA 1ESVA 4ID5A 5KFQA 5J2QA 3GYGA 5HVHA 4KHYA 3KLHB 3R8EA 4XPEA 1DQAA 3OYCA 2M8HA 2V4QA 1YSJA 3WHIA 1OWXA 1Q8BA 4Y28C 5BJRA 2EPIA 1ZM9A 1KLMB 3LWLA 4Z37A 2KZMA 4AM7A 1O6XA 4B3SK 4R0JA 1B64A 3DLKA 1N32K 3WQTA 2CQPA 4EGLA 1G4CA 3I6PA 1ZA2B 4I2QA 1CSJA 3P3DA 3CE8A 2NUHA 4LFAJ 4DS5A 4DR6F 2F4VK 5HI7A 1HBOA 3CSKA 4DOZA 1AXQA 2CH5A 1R27B 3QSIA 4DL5A 2XHWA 5JXSA 4BR7A 3WX4A 4DV5K 1HR0J 4BREA 1HKBA 1FK9B 3C0BA 3ZXWA 1ACMB 2RE1A 1Y9OA 2RNEA 1FTRA 3GDQA 2AGQA 2PIIA 5H9EK 3L3VA 3Q7CA 2GC8A 3H8YA 4GMKA 4OV6A 3ITHB 3UR0A 4EFHA 3CCES 3G6YA 1WBDA 3WNFA 5C25A 4QU7A 2DH8A 4RX6A 1JLGA 4B3SJ 3C16B 3PIOL 4QR2A 2KFYA 3THWA 3R1HA 5KFUA 5KFSA 1RTIB 1ZM2A 2R7WA 1YKWA 3GYXB 3NMUA 4JV1A 2QZ8A 4CLPA 2F4VJ 3BH7B 4KH4A 1RT1B 3HOTA 3CC2S 1VBZA 2IY5B 2F40A 3R3LA 3U4LA 4LF8F 3TTFA 2VG6A 4YB6A 3AAWB 5CYQA 1NHUA 3H1QA 2KTQA 4LIWA 2CA9A 5AQFA 2OPQB 1NB2A 2YKMA 5KFZA 3BB5A 3ZX0A 3I87A 3K59A 3MDQA 3H3NO 3S9HA 3L4QA 3O3LA 3NWRA 3HL8A 5F8MA 1HQ2A 3V4IA 4BRLA 4ZJOA 4FBTA 1MWKA 2JEFA 4JI3K 1RHQB 2OTJS 3QLHA 2XZTB 1NU4A 2XWYA 3LQVA 1WKKA 3M2RB 2YWEA 2IAJB 2DNPA 2IRYA 3IS9A 2Z57B 3S3OA 2JZ5A 5KFKA 3MECB 2KDOA 4DV6F 1LW0A 1CZBA 3A8EA 3DN9A 2G0IA 3QETA 1K73O 3A8JA 2Z1IA 5F8JA 3FBEA 4YMEA 5ETPA 5T14A 1R8PA 5D0RA 5L9XA 1ZBSA 4IOCQ 3J8AA 3CJ8A 2PSZA 4H5VA 2CFXA 3NGIA 5E84A 3D54A 1VSDA 1WEXA 4X62F 1TFYA 2YY3A 1BD6A 2OO4A 1S9FA 4K2JA 1YJNS 4H5TA 4YHHK 4JI3J 2V0NA 4BVOA 3CDEA 3LAMA 4YDDB 2MKSA 1B92A 2D41A 3D0HE 4LVOP 3ZZPA 4OJ1A 2QGFB 5LSRA 4DV7F 3ZETA 1LNQA 4WTYA 4OV1A 2MQMA 2BJ8A 1LXJA 5F8GA 4BVPA 1WELA 5ADZA 1O5JA 1HD0A 3WDOA 1TKZA 2E6MA 1LQ9A 1UEKA 3UDVA 4M95A 4OO1J 3V9UA 2JNJA 3GJTB 3EGZA 5BPMA 4OYMA 3IM9A 5JVHQ 2MZJA 4J9UE 1NK8A 1YUWA 1VJQA 2ZOGA 2CKWA 2ZH6A 1XMQF 3G6XA 4IG0A 4GV3A 3G9CA 3DRRA 3RYLA 2DXEA 1VSLA 3ULDA 1FA0A 1NJYA 2WVBA 3SSRA 1HMVA 1HWLA 3KLGB 4FLVA 1QHAA 3ZT4A 1ZA1B 2B3TB 3M2UA 4YDUA 3N6MA 4DJBA 3M8ZA 2ZGYA 3NG8A 1N56A 3IP0A 1RAEB 3SUQA 3LPEA 3AOBA 1J5OA 5I4MA 4DF4A 4CZGA 4F3MA 1F21A 3NLCA 5CYJA 2GWJA 1J6ZA 3ET6B 3C6TB 1ZBTA 3POTB 2XNQA 5KGWA 5AQLA 1RHUB 3SPYA 2AHOB 3VGUA 5AE2A 5DLFA 3NVKA 1Q18A 1S10A 3CT9A 2RN2A 4FLTA 2YJFA 1N8RT 3ZC4A 1C6VA 4I9QA 2DD8S 1S99A 1OMSA 4DS4A 4ZVTB 1EX4A 3Q8UA 2YKOA 4X65K 3SAGA 4A57A 2LMIA 3J7YU 4CM0A 3FDSA 4CECA 3NL0A 1C1BB 2P2CB 4KAIA 1R3NA 3S1TA 3WQPA 4A2AA 6AT1B 5I3UA 4YY3F 1QLNA 3MM7B 3D0GE 3GL1A 4GW6A 1SJQA 1RYSA 3Q8YA 2P9NB 3N28A 4H4OB 2QXLA 3RUBL 3SQ4A 1TYQB 3UE5A 3CCJS 5A8WB 4CF9A 2MB0B 4GC7A 5IC6B 2AIRB 3VEZA 2JFKA 1TL3A 2XSFA 3KJVB 4OI3A 4Q8FA 4GKKF 4EUVA 4I69A 3G87A 2UXBK 3HVRA 5KG0A 2W2OP 4L6V3 1IO2A 4F7VA 2WONA 3TQ1A 5L46A 3F56A 3FR0A 3CJ1A 1IBMJ 4WJBA 2AU0A 2DR6A 1H2UX 3TI0A 4X65J 5KG1A 1PO6A 3ULEA 3IC1A 1P9YA 3OS0A 3QGGA 2ZH5A 4CIFA 2OD6A 5GAGI 1X4GA 2F8EX 2RQCA 1TKDA 2CWXA 4QIEA 2QL5B 3O9QA 8RUCA 2X51A 1OPZA 3RBZA 1QSYA 3PX0A 3NMRA 2V63A 4LFCK 1Y7PA 2YBVA 4ZIVA 2DPIA 5AQKA 4LR7A 3KG1A 4URSA 2P6TA 2IVNA 2DTUA 1WAJA 1CQMA 3VOVA 1T44A 3K0SA 2JH3A 3JSMB 4B3MK 4WXOA 2X7IA 4CH0S 2IVMA 1WSEA 3IBFB 1MA9B 1VQPN 2GIRA 2CJQA 1RAHB 2E7XA 3PRBA 2LXFA 3EPIA 5CA5A 1ZBIA 2W8KA 3EL2A 2IM0A 1U26A 2VFUA 2CGKA 4X4NA 5CZ1A 4K41A 4C3LA 3I33A 2BUNA 1S1XA 3S6EA 3FSIA 1BDGA 2ZOFA 2CJXB 2GIQA 4L8RB 4XIUA 4ZK7M 2XMVA 2F96A 2K2PA 3O4WA 3FCWA 4Z94A 4OX8A 5DGBA 4LFCJ 4JRQA 2L9WA 2FVQA 4CO3A 3CFPA 3UQSA 2QL9B 2D3UA 1J27A 3Q83A 2PFUA 3VR1A 1VAZA 1FFWB 3MMCA 5LJ3Y 2KT3A 4ED3A 3MXMA 2P1JA 5DDPC 4NCBA 2Y3YA 3AO2A 3H98A 2CQIA 2XS7A 4ZIWA 4WFBQ 2AGOA 3FLCO 3GB0A 4HUEA 3TVYA 2CQBA 1N34F 1X4FA 3MWTA 2DYAA 1PJ7A 4NB4A 5AQNA 3ZT3A 3L9ZA 3QT7A 1CJKA 3QZ7A 3PEJA 1AA1B 2L3MA 3L4IA 1S7IA 1S6PA 2E29A 4NCAA 3QFWA 4ZJQA 5AZJA 2DO4A 2MSTA 3AA3A 3VQAA 3HULA 1RA7A 3D0IE 5C15A 1LW2A 1UZHA 4F2RA 1NMDA 1A6LA 3MOJB 5F9LA 3L95X 5KFLA 5D77A 2GMJA 4E3SA 1NK0A 2UXDK 1RBVA 3GWCA 5K8OA 4BROA 1TKTB 4ECUA 5AT1B 4NX9A 2W7PA 4WP9A 1BY9A 4BE2A 5HROB 3LA0A 2BGGA 4BRCA 3KNAA 2Q97A 1FX2A 3CDUA 2VKZG 3H42A 2GA7A 3UVJB 4DV4J 3AD9C 1T3OA 4U9RA 4N41A 4QYZK 2WB1D 3QT6A 4H0YB 2ZJRL 4IG3A 4AHVA 4AL5A 2IDEA 4CNZA 4DKWA 4JI0F 2N3OA 4I7FB 2VGMA 4WTOB 1P90A 3IBWA 3OYNA 3HDSA 3LGMA 5AZIB 1EP4B 3CM5A 4ED6A 2L48A 3G82B 1U1LA 2UXDJ 3WXMB 2A40A 4I67A 4FOIA 1F0XA 4G1IA 2Z2YB 3SQGB 3QDKA 3ZSRA 4NLDA 4O55A 1NSQA 1JLCB 2CPEA 4ZVOB 4ZN3A 2PMHA 1XMOF 2DGSA 4KGKA 4LF5K 3N5FA 4F4XA 2E66A 2DHSA 2M5YA 1GFWB 5H9FJ 3CC4S 3SV4A 4QYZJ 2DGOA 5EXWA 1B7YB 1B0PA 3OT9A 2XI2A 4JD2B 3DDNA 3I82A 3NF6A 5EWGA 1FEHA 4EEYA 1AZSA 2PMZD 1RDUA 1WTBA 4DL7A 2CQ4A 4MKVA 5L8RC 4DCPB 1VIXA 2BW7A 3KFWX 4DTXA 1VCTA 4JV5K 3ZSXA 7FD1A 4JV0A 2YNGA 2HYIB 4YOYA 5ELZA 3P96A 2ZBRA 4TVAB 2NYHA 3CD7A 3OHRA 4CI6A 3TO8A 2QJ3A 5AQIA 4UUWA 2J9DE 4OX6A 1F3FA 2EWSA 3C95A 4C3KA 3C66A 3M1VB 1QY7A 3IMXA 1NDLA 4M63A 4EBCA 4OJRA 1K8AO 3M1FA 4C8KA 2BTFA 4JB8B 1TUGB 2HK2A 4DR5K 3RR8A 1VQ9N 1FFSB 2V34A 3SUPA 5E5NA 1NKCA 4P2SA 3FEZA 1FW6A 3L6QA 4JKEA 5BR8K 4Y00A 4GVMA 2O8CB 4Q5VA 2WVDA 3CM6A 1NAQA 2EXUA 4DU3A 2R42A 4CJ7A 1OH8A 3Q8VA 1CJTB 4DX5A 4ERDA 4ICLB 3NAIA 3HLUA 4ZVUB 4IQXA 4X4TA 1MU2A 3M8QA 2ACMA 1VC5A 2HGNA 3WIVA 3V5RA 2PZSA 3K8VA 2HS4A 3CCMS 2CZ9A 1SQEA 5JICA 4DUYK 1BISA 2B5JA 5BXIA 4ECYA 3OVBA 3LL3A 1Q16B 4WFYA 2RU9A 5G4DA 4RNNA 2E1RA 2RS8A 2W8LA 1WD6A 4F9OA 2XG8A 4WU2A 2W9AA 5BR8J 2BYCA 2V68A 3N4QA 1YQHA 2HNYB 1NDKA 3CJ9A 4MMOA 1HYSA 3AVHA 3AOCA 3NBPA 4FLZA 2QM1A 3DM2B 1JJHA 2CJAA 5TKYA 3QFPA 4CT9A 4WFAQ 2BE2A 3SEOA 1TV6B 3RBEA 4LRDA 2Q31A 2WRMA 2HS3A 4ZA1A 1YXQA 3IRXA 2V50A 5AXKA 4TY8B 4ELTA 3W8PA 1CS4B 3D2WA 1TTHB 4FJKA 3I4PA 3VZIA 3GIJA 4AL6A 4PHTX 2HVDA 1VQMS 3AO5A 4WQ4A 1Q5YA 2WCXA 3M6WA 2W4DA 3CDBA 1UPMB 3BPDA 2QSFA 3SLCA 4LBIA 2CUYA 4HHTA 4KREA 4AYBD 1XNRJ 2F9TA 2ROPA 4F0HA 2BEFA 3GE9A 4XDDA 1VK3A 4RWWA 5J2MB 3KKRA 1JJCB 2NLWA 2JGUA 2Z2MA 2QA1A 1JNRB 3V4MA 4JLHA 4OYZA 3WC0A 4KH1B 2B43A 2XM3A 3K5PA 3W65A 1VQ7N 2VQEJ 3N01A 3J7Z5 3C19A 1DKGD 2AJFE 2HQFA 2BUPA 3MMAA 2ETJA 4DN0A 1S57A 1KWMA 2FXUA 2LECA 2ASDA 1HNWK 1WC4A 4RBTA 2O8EB 3KJNB 3ZZTA 2OSQA 4CHZA 2VFRA 2NZTA 1VLYA 1NWKA 3CJ5A 3BF1A 1W2IA 3FGUA 3Q89A 4Q2MA 2QEXN 4DV0F 2R8KA 2ZH8A 2DISA 4KHNA 2YKPA 3L2VA 2LCWA 3AOAA 2I5JA 4CJ4A 2V69A 2MGZB 2VFVA 1NB7A 4DFPA 1VC0A 2O8DA 4U7UK 5I42A 2ZH9A 1GLCG 3R7SB 2YWKA 1NHVA 1GLLO 4AT1B 4DR3K 2JLEA 3SCXA 1RDCA 1TVRA 4ETXA 4DR6J 3OYBA 2HSTA 2DGWA 3BGOP 2E5LF 3KWMA 4B9UA 3ZSZA 3CFRA 4IJAA 1HNWJ 2GTDA 4XO0A 1CJVB 3QRRA 3AQPA 3RRHA 1TUVA 3R7NB 2PI4A 3U3YA 4L74A 3OPKA 3MR5A 2G8UA 2X1AA 3M8WA 4CGFA 5HATA 1T95A 3H45C 3QT5A 3WNHA 1B9DA 3CCQN 4BR0A 4FLWA 4JI8K 1RWUA 1NK5A 1FTCA 4MO5A 2QC3A 1RTJB 2EBEA 4KPYA 4DR3J 2IVPA 1ZBFA 2RQ4A 1K0TA 4YOVA 2FVPA 2D9PA 4LF8J 4R25A 4DV6K 4KTQA 2IYGA 3NE6A 1LWXA 2ZE2A 3BUZB 1NPRA 4K8ZA 3MEDA 1EQMA 1T6CA 5HBMA 4PPZA 3RTVA 1X4AA 4M5LA 2HHPA 3OQ2A 5DDRC 1H73A 2IYIA 3OY9A 1Y10A 5M1PA 4K59A 1QAJA 3PSFA 3DI6B 3KMQA 1IM4A 1NLVA 4B8AB 3LW5C 4O0NA 3BQ2A 4FJMA 4RW9B 4B02A 3SQ2A 3KDNA 5F41A 3UKUA 3A3OB 4IZ9A 3A3PB 4HTUA 3TJ9A 3QMLA 1SJ1A 2Z0GA 2WK4A 2RDIA 3QYYA 4Z2XA 2XY8A 4W98A 2XBPA 4RW4A 4DR7F 2O1PA 1SIWB 4FWLA 1WF1A 3OJUA 4DV6J 1ZETA 5CHCB 2P5OA 1RZMA 2A6MA 1DJ0A 5E3AA 4E7HA 2UUCF 3D6HB 4OPAA 1N6QA 2VDIA 2HBKA 1HWUA 3C7NB 3AVNA 2K1RA 3KK2B 4JI6F 5E2QA 4Z0UA 4X62J 4C11B 4TKTA 3D2EB 2BANA 2I1RA 2KRRA 4X4OA 1XNQF 1HQEA 3UO0A 1UCNA 2C3OA 1ZAXA 3HHDA 4CEDA 3LDLA 4EP4A 5HRNA 1DTQB 1H7WA 5FJ4A 1YVUA 4DPYA 4ANDA 3IFEA 2CQDA 4CIEA 5F3TA 1NGEA 4Y2MA 1S9EA 4BRAA 1P6TA 4DG1B 3GFHA 4HVJA 4CGIA 2HWIA 4DV7J 2P9SA 4X66K 4DL2A 4C6AA 1O13A 2JDJA 1IWGA 1MN7A 2DH7A 4P7TA 2CZVC 1FKAF 4B8CA 2YNIA 2KVQE 3ZZOA 1F5BA 3FBFA 1SXLA 4PKHA 3I55S 3KLFB 5HP1A 1S22A 2ROEA 3Q22A 5IM0A 3ONQA 3PKYA 1M5PC 1U1MA 3OYDA 3D28A 2AYEA 2LXUA 1C1AA 2RKIB 2PAVA 3SMSA 2POKA 4PXEA 2Z56B 2J7UA 4U7BA 2MKCA 4CBUA 3SMZA 3O3FA 4E19A 1N36K 1HBNA 4CYUA 1JLQB 4A47A 4CJ3A 3OR2B 3TRGA 1OH7A 3I5BA 5KFPA 4JKCA 1JLBB 3M5RA 3TUZC 1JNZB 2GQCA 4URQU 2KKZA 1WOPA 4DU8A 4X66J 1W2BM 3E01B 3IXQA 3DHWC 3G10A 4OLAA 2F1FA 1FNOA 4B3RF 4BRQA 4LVNP 3Q8PB 1N5VA 5F8NA 4TU9A 3D68A 4DLGA 3D3CJ 2EEYA 3PJ9A 2VOOA 5AQHA 1CJUA 4RKUC 1VJWA 3IG1A 2ZBCA 5AQJA 4ZTFA 4K0KF 3VAMA 3HHLC 3R2DJ 4DQPA 2IM2A 1X4BA 1UKUA 3H20A 2Y1IA 1VQNS 3KG0A 3HSZA 4FPBA 5D15A 2BH1A 4WFNQ 1YT3A 2FF3B 4ECXA 4KKOB 1W2BR 1IKVB 3MR7A 1VC6A 3A2FA 3OVAA 1M0SA 4AHRA 1EKEA 5A8RA 3V6DB 3O8MA 1IQTA 4PG6A 1ATSA 1Y64A 2W4CA 1HPZB 1HWKA 1X4EA 2JHEA 4FJNA 4KO0A 1GMWD 2BM0A 3NS7B 5DRKA 3VF0B 4GKKJ 2XO6A 1NGJA 4CJUA 2ERRA 3W64A 4H4MB 3EE3A 1RTDB 3EZOA 5A0YA 3V1OA 1YK9A 1B70B 5C12A 1VQON 3NGYA 3EVWA 2CQ2A 1AUSL 4BRMA 1LOUA 2V8GA 4IOCL 1IKYA 1G6BA 2GBZA 2V2QA 2UUTA 5KT2A 4LF4F 5M1OA 4G1PA 3SBGA 3MMBB 3VERA 3H2VE 2HQ3A 4F50A 4FF2A 2FJXA 4KGVB 3VPZA 4FJXA 5FLXO 4UT4A 4DV2K 2DNGA 2VONA 4CHNA 1TMMA 4JI4F 2Z4PA 1REVB 2W1BA 1T9VA 2LQBA 5BREA 3VVTA 4YDXA 2H5EA 1UVLA 3O3HA 1M5VC 1WSGA 2MHNA 3OJSA 4YNQA 1TL4A 3HI0A 3B54A 3MM5A 2HQDA 2BKNA 5C42B 2QFJA 1UVIA 3M8YA 4BS2A 5BRHA 2VDHA 4ZVPB 4CBXA 1FJGK 2V9WA 5GAEU 3KLIB 4N5SA 4GVBA 2XMJA 2F3JA 1Z6RA 1VBYA 1EQYA 1X7VA 2RD5C 4L3NA 4U95A 1QDUB 2VODA 1YLXA 1CLFA 3NKYA 4GC6A 5JLHA 2QRRA 2Q0UA 2V9KA 4IKAA 5JVHL 5J2NA 3VQBA 1YWXA 1TMJA 2AKWB 1YRUA 2DR9A 4ZS6A 3I31A 4K5RA 4LRBA 5CXTA 4W5TA 4NLSA 3OS1A 3C15A 3EICA 1CG2A 4YQWA 4OZ2A 5FROA 5DGAA 4ZCKA 4MLEA 1DAXA 4BWMA 4LRFA 4DFJA 2DVIA 2IOCA 2GJ2A 4M42A 1K1SA 2B9EA 4CDIA 1XBWA 3EPGA 2Z1GA 4AHCA 1NDCA 2MQQA 3LOUA 2SXLA 5E3CA 1FWPA 1CXQA 3LDOA 1AFIA 1YRTA 2GUPA 4JK9A 2R4FA 5DG9A 3OL8A 1FJGJ 3AVKA 1S3XA 3MM6A 1RDBA 3CYMA 3O08A 1RT5B 3ZT1A 2XHCA 1BWFO 3QO9A 3QNNA 2A1SA 1SV5B 3CTRA 4AF1A 4BC7A 4ZCIA 2XRIA 3HP9A 1HUXA 3NMAA 1P9QC 3PSIA 2W2QP 3MCMA 2UU9F 1W7WA 3VTIA 3MEGA 3MN9A 3HYFA 5IXUA 3BKUA 1DURA 2RRNA 3RB4A 2N4DA 4KHPF 4BR2A 4GV9A 3HO1A 1NM1A 3MF5A 4DR2K 3SXLA 2V4JA 3TNVA 3U9DA 3IAYA 4FW1A 3PR4A 4PRFA 3O9TA 4ILLA 1U1PA 3QICA 4ID5B 3HI9A 1U47A 2CGJA 3THYA 3GZ7A 2ATLA 1E6YA 4H0OA 2OANA 1JLAA 2R7XA 3RZAA 2HFZA 4N47A 4C23A 1RXOB 2M9KA 2QWLA 2JWNA 3BR9A 2F63A 1RT7A 3EYZA 3FFIA 3M8RA 2ZNZA 4M5KA 1KAXA 3CCRN 1QVGM 2Q6BA 3RBXA 2BRKA 2AYGA 2B6AA 3ILIA 2P9EA 2J76E 4CP5A 2AD9A 2YXLA 1B7FA 2CPHA 4BC2A 4A8FA 1C4CA 2DNHA 2OMOA 4KAZA 3KLEA 3WZ0A 1ZAVA 3ENAA 2VOPA 3LANA 2HQCA 3KK7A 4QR1A 4LQ3A 3JXUA 1HBOB 2PT0A 2ZDPA 3H5YA 1KP6A 4PUOA 2D3OR 3AV9A 2KRBA 4WZMA 4JK8A 4UQTA 5CE3A 4ED8A 3O1WA 2D0AA 1XMOJ 2P9IA 1FHTA 2XSJA 4J7CA 3ZNUA 2NREA 4B9NA 4CESA 3V81A 2YNFB 2PN6A 3Q86A 1W0HA 1QVGR 4L76A 3CC7S 2ATQA 2BJ1A 5ADXH 1M1HA 3TA2A 4ZLJA 1HQUA 4MDAA 4P6QA 2XYHB 3T5HA 2QA4N 3DOMB 1X0FA 2PYLA 4BR9A 1HKGA 5M2PA 5K8NA 4UQGA 3T6BA 2N7YA 1FESA 2NPIA 2WOMA 4WP3A 3F9KA 1S49A 2LU1A 2DHGA 4DR1F 2DGUA 4WK3A 4DTNA 3LM9A 4GKJF 2HHWA 4OMFG 4LF9K 2YKMB 2O8FA 3TEHB 1UVNA 1DQ9A 2L9NA 4RUAA 4E98A 4BE0A 3K57A 3VF6A 1T05A 2G8KA 4OZ5A 3DLEA 3H59A 1GEHA 1UTAA 1RT2A 3VQTA 1PC4A 2FZKB 1VQ4N 5JVGQ 3TAMB 2KU7A 1SJFA 1SJRA 2AX1A 3SQOP 3QSYB 4USTA 1IKWA 1U7LA 2ZOMA 3KK3A 1NO8A 4LT6A 3IS9B 1LOTB 1S1WB 3KWGA 4P10A 1RKIA 3W62A 1S6UA 5KFOA 3NF7A 4W4MA 4WE1A 3SCKE 4LF9J 3SI6A 1CEZA 3NS5A 2A6AA 3O6QA 3E3XA 4P52A 1Q78A 2D74B 4E2FB 4YB1P 2GX9A 2KB2A 1TL5A 2BABA 4WKYA 1SH2A 4RUHA 3CCUN 4U8VA 2FJAB 3N0VA 2MJNA 4OIXA 3KIOA 2MQLA 4IDHA 4ZHRB 2VH7A 1U4BA 3VHQA 1ICEB 1MMLA 1FD2A 2FIUA 1T11A 2GGPB 2J0WA 1WSRA 3I0SB 4FJ7A 3BBCA 2KJWA 2IMOA 1XERA 2ASLA 4WKRA 2Y1JA 3KXDA 3R6GB 5KFXA 9RUBA 3AQOA 1Q82O 4LSLA 1PC5A 2VPXB 4USJC 4PG4A 3DLGA 4F2SA 4C9DA 4B3TK 2QKBA 1FE4A 1D8ZA 4URGA 4JHDA 1F6TA 4B1ZA 1RAOA 2OHDA 4L3QA 1S6QB 4C2MA 3U3GA 1UA0A 4Q0BA 1YJRA 1GXUA 1U09A 3IM8A 4I56A 4IQMA 4OZLA 4DV0K 1S79A 2XQCA 2GW8A 4PQUB 4CGDA 1C0FA 2HPUA 4Y6IA 2Q1NA 4DR4K 1QAIA 2D0CA 2KKHA 3K9KA 4CZCA 2E1ZA 4NLBA 4ED4A 2V7YA 3M4XA 1IJEB 1OQ3A 2QLBB 4KHMA 4IR1A 4FKXA 4ECVA 1NU0A 5HMYA 2HNDB 2CG4A 5KFFA 3ATUA 2WUSA 4I6MB 4G9ZA 1HMVB 2F5GA 3DKDA 4OI4A 3O1LA 1FEEA 2VQFF 2JRSA 4DX6A 3CPWM 1RABB 2DCUB 3O44A 2LYVA 4PKDB 1EKRA 4B3TJ 2YH1A 3EDRB 4E7JA 2JLGA 4BY9C 3O1BA 4ZN1A 2DNZA 2ZKTA 4OHXA 2O66A 4BGAA 4DV0J 3QEIA 2LEAA 2GZOA 3G4SN 3C65A 1RFQA 4USUA 2ZKUA 4IH5A 4TLRA 4DR4J 3CVKA 4M3WA 3CDAA 3CJCA 3I5AA 5DM7L 4JKGB 3UD3P 5ETSA 3RMAA 2VPZB 2I7NA 3PIPQ 3SJHA 4NE9C 1WSFA 5IV4A 1U2VA 1VRTB 3HSTB 1RUSA 3OUYB 2ZBPA 3I8DA 2Y0SD 3W0LA 3CPWR 3CIZA 1J5EK 1UPPA 4M5GA 3DLLL 3DOKB 3DGPA 5KGXA 3MCAB 5EN1A 4M3XA 3HZEA 5K14A 2VC0A 2ZBQA 2FC9A 5KG6A 2QWQA 3JTPA 4ZPCA 2FUG9 3AO3A 2HLUA 1HBUA 4F3OA 3MUVP 3HXMA 2QLFB 1RT3A 3OHBA 4UZCA 2XLIA 1NBEB 3T41A 4K5SA 1S48A 2W4PA 2C2MB 3KHRA 4LF1A 2OD4A 3PUFA 4NEZA 4CF8A 2EVZA 1X31C 4KT0C 1VQ8N 1RACB 4N8NA 4C0OC 1H0HB 3RW7A 5D0HA 1PBAA 3W61A 5KOWA 1T9YA 5LMNF 1XQSC 2MKKA 4P2FA 4AXIA 3OL9A 3ENQA 4F8RA 5CYMA 1ELOA 5FPDA 4H5NA 1Z2ZA 1RU2A 4FJLA 2GHWA 3CJKA 3WC2A 2DEJA 2E2NA 1VQPS 4FYVB 2V2VA 4WFAL 2V8PA 2DFEA 2YKNB 3MUMP 2QYCA 4DCOB 3AFGA 3IBCB 2OPRB 1LFPA 3NNAA 3TAEA 1X9SA 1TKXA 3DWLA 3ZSWA 3LTOA 4RWTA 3UIQA 1A5WA 2P9KB 3OYFA 1T03A 2J6UA 1GQEA 1NPKA 1P1LA 1B3TA 1HR0F 3HHLA 4CM2A 2MZQA 5M1QA 2C3YA 1A0OB 2C3MA 2KT5A 1R59O 3FRZA 3NS6A 4M1KA 2FHMA 5HLFB 3IR5B 4C8ZA 2MLYA 4PXCA 2FSNA 3EX7B 3OL6A 4JN4A 2QWOA 4DF8A 2R7QA 2NRRA 3FEXB 2XMAA 1VQSA 4DCJB 1G3OA 4TU7A 4DR7J 1WF2A 3KUGA 2ROGA 1GTHA 1N32F 1ZC6A 1FXLA 4UZBA 3PFOA 2UUCJ 4UY8O 3THXA 3G96A 3MMCB 2F4VF 1YITN 4NLYA 2ZWPA 4QWAA 1E4FT 4YR2A 4MO4A 2APOA 1F60B 1M90O 1OQ6A 4DV5F 2NR0A 4CZEA 3KYLA 4DQRA 4I2PA 1BUXA 3W66A 2I8EA 3L8BA 1MDUB 1JKHA 2FJDB 1RB0A 2GQQA 3HD1A 4AUKA 1S1VA 5HRSA 2ALYB 4PXBA 2QT7A 3FSXA 3SNNA 2VU5A 2KH9A 4FJGA 4UOHA 5AZJB 4NASA 1SUQA 3CGIA 5KRSA 1L3SA 4IWVA 3WXLA 3R9PA 4RNMA 3O8WA 2GUIA 2R2RA 1SQKA 1K9MT 4PG8A 4NYZA 3KK1A 3CO0P 4N56A 4NYFA 4BRKA 2QX0A 3IGNA 3CJ2A 2GVZA 2PA3A 3KG4A 2YWWA 1QQMA 1GLAG 4CD3A 3W7BA 1RWWB 1CXUA 3JS6A 2LFVA 4DTOA 5GAGP 2M52A 2QIFA 4Y34A 3KWIA 1HNIB 4ZDNA 3UKRA 4AH9A 1H3DA 1ZZNA 5I9EB 3TAGA 2ZH4A 2QWNA 1UVJA 5L1JA 3CCMN 3DAWA 3OA9A 2B7BB 5KAKA 4DL6A 2HQIA 4A4JA 3MEEA 2AF6A 2RRAA 1Y5IB 1ZYQA 1Q95G 4JI3F 3RGIA 2F7TA 3Q8SB 2CQ1A 3ZT2A 4B3RJ 1V5VA 3D66A 3KHLA 3CW2C 3PKMA 1UP1A 5GADP 4TYAA 3M2VB 4CT8A 1UWBB 2DRDA 5FD1A 1V3ZA 1T7PA 1LCUA 4EWTA 1XR5A 1APSA 3AGRA 3PX4A 4K0KJ 2M4MA 4A5AA 1SL1A 2KXNB 5M1FA 2VV5A 2HHQA 5CH7B 4NCGB 4HH1A 3RAXA 2OCEA 2XB2D 3NDKA 2HZVA 1WHYA 4MLHA 1HFEL 2MY7A 1AZSB 3HX9A 4B1UB 2WVEA 4CGJA 1RWPB 4CGHA 1Y4ZB 4YHHF 5BYSA 4BRFA 5LJVA 3MX5A 4F25A 2J7WA 5CD4H 3J81U 1HLWA 1FKOA 4PWUA 4C48A 4CFCA 4FCYA 1VQ9S 3AJ1A 4JI4K 2UVWA 4PWWA 2OMLA 3BEGB 1AFJA 1BGXT 2YNHA 1B99A 5HRPA 4DZ6A 3ZEUB 2VF3A 4FWOA 3A8IA 4FKYA 2G1DA 4E0DA 5EHHA 3QATA 4RPFA 4JBCA 1TFWA 2RU3A 5C2FA 1IKXB 3ASMA 5B0GA 1RILA 1F9HA 2DEIA 5HJXA 4CFDA 3LPYA 1S4EA 4C0BA 3R2CJ 4LF4J 4HACA 4Y2KA 3MR3A 1RDRA 3ISNC 3H7HB 3QMQA 3VEYA 3Q2TC 2FBXA 2X3DA 2DIVA 4OYPA 5EX3A 4QZVB 4PR6A 3C14B 5JLFA 3B78A 4JI4J 5IV3A 1OS5A 5BN8A 1H38A 4U6PA 4O0IA 3O3GA 2PY5A 3N4PA 4ENOA 3N6NA 1U0HA 4Q7AA 3QNOA 2B5JB 2B4JA 2KI2A 3SPZA 4JOUA 1NDPA 3VF2A 4PL8A 3G6EN 5EX0A 2E1YA 4OPJA 4AQYK 2ZVIA 5F9NA 4CE9A 1KXPA 3MTJA 4UY8T 3M30A 3VZHA 4OX7A 5HK4A 4LD0A 2QKKA 4CIOA 1DLOB 1HX1A 3MPVA 5HO4A 4UOFA 1M90T 1S1TB 1QAYA 2VGNA 1CC7A 3D0PA 1YJTA 1Z25A 4ZVFA 2W6LA 1LWEA 1K8KB 4NLQA 4M5DA 3FBBA 5DDQC 2NRHA 3AA5X 2AJ2A 4X65F 4CFAA 5LSLA 4FWRA 4KHQA 2EI5A 3HF5A 4BWJA 2HW3A 1BQMB 3K5MA 1UJ5A 3MAAB 2Q0RA 2M8DB 1RAAB 2VPWB 4KI6A 2DY4A 1PGZA 1KC8T 4M94A 3GIRA 2R7YA 2BVZA 3QBXA 1MROB 1OVQA 4OZJA 3THTA 2NXJA 1UA1A 4A61A 4NOHA 1E6VA 4EYIB 1VQ7S 3MWBA 4CNYA 5E0OA 2UXBF 5AR0A 3V1RA 2GVDA 2C22A 1BQNB 3LDSA 1I5OB 4BLGA 1R0AB 4QIGA 2CPXA 5CY4A 4CZKA 1WUUA 2UU9J 4EYHB 2E8AA 3QJLA 4J8FA 4O4GA 2RRBA 1NSPA 5HVGA 4KHPJ 3NGSA 2QEXS 5KG3A 4NWBA 3I8BA 3TTDA 1O0PA 2EK6A 3K2YA 2RF2B 3W2WB 4PYAA 5AQVA 3ID8A 1PSDA 1HLUA 1NGFA 4G1QB 2QI2A 3UCUP 3M32B 3EO3A 4I4BA 5GMKa 4CJ5A 3VAKA 3CMEN 4PAAA 4LFCF 3JB9k 3MXIA 4KV8A 2HNZA 4XH4A 2BKPA 1NJIT 3AVCA 1F5AA 4I0WA 2E7VA 4I6WA 4HT5A 4B3MF 2XGQA 3DRPA 1UEVA 4JI2F 2XMKA 5IS2A 3KLHA 3MURP 4CFBA 1XQIA 1S9GB 3AVMA 4XPCA 1RBLA 2BACA 1S0OA 1KLMA 1VYAA 3M8SA 3A5LC 1I3AA 4HDHA 1OJ4A 4FDFA 2KM8B 3H2LA 4MYUA 3MCSA 4RNHA 2C3PA 2V6AA 4ZLNA 2Y8WA 4BRGA 1C1CB 2DNKA 1VISA 3CCQS 2PGCA 3WX8A 4DLEA 3R6LB 4LIRA 4RW7B 5IT9O 1FK9A 1NPPA 3C46A 1YTAA 3G71S 1ZM3A 2P9PB 2U1AA 3TOQA 2OPPB 4NMXA 1R0BG 1OSDA 3D6FB 3ITHA 3G8QA 1S0NA 1RBAA 3S41A 4JI7K 3DXBA 4BACA 3T69A 4H0TB 3JQMA 3PYEA 3RRGA 4KJIA 3CPEA 3L0QA 2C2NA 2CJ9A 4K43A 3OYHA 3P1GA 2Q36A 4DR1J 3HPOA 4BG8A 1H6KX 2YHBA 3HBTA 1L3TA 1RT1A 1IXKA 4CJVA 2IRUA 3AY0A 1LAWA 4CQ1A 5B09A 4Z4GA 2G2OA 3D7SB 3AB4B 3MOZA 4N76A 1MMNA 3TJ8A 2OPQA 2FF6A 3VQDA 1YTYA 3U1MA 3UN5A 2FJEB 1RAFB 4FJ9A 4HTIA 2Z2ZA 2FJWA 2MKYA 3TTCA 4JI7J 1VDHA 3U9ZA 2NSBA 2MQ8A 4RJVA 3UWTA 4PYDA 5IT9Y 3ZZRA 4U96A 4FZXC 1F2GA 1IG9A 2C42A 4RW4B 3LWMA 4K4UA 3M2RA 3HVTB 1IR2A 3KUEA 2IAJA 1HJOA 3C8YA 3LP1B 4IEIA 4DUZK 3AA4A 3MECA 9ATCB 5G0RB 5F0WA 1HJRA 4FJHA 3QIPB 2WSEC 4OGCA 4IKFA 2ZJPQ 3UD5A 1GOCA 4FWPA 4RCHA 4ZVSB 2WTUA 4LF5F 4KHWA 2LA4A 3TA0A 2ASPA 4J90A 1KRPA 1RE1B 2BE9B 4NYPA 5IC4B 5GIPA 2FPHX 5KT6A 1IWAA 1KSPA 1URNA 4X4SA 4YUDA 1YIJN 4NL5A 1S9EB 1BHNA 2VQFK 3JYTA 4U7CA 1S6OA 2RILA 5RUBA 3QFUA 3BQ0A 4CO1A 1N54B 4JV5F 4LF2A 2FBVA 2A1RA 2AZ3A 2HRUA 4O0JA 3L2UA 4DUZJ 1EHWA 1R0CB 3RJMB 4CGGA 1U0SA 4HUGA 3ENBA 3NGDA 3FZFA 3BO4A 4JNEA 4QPTA 2RT3A 4KFBB 3TEGA 2F4FA 2JSXA 4DR5F 1GLEG 2DHHA 2D4WA 4FM2A 2GWKA 2AV5A 3M05A 2H1YA 1AROP 3UCGA 1FXRA 4WBFA 3HK2A 1FDNA 3B4MA 5BR8F 2NLXA 4U67Q 3C6HA 4P2MA 2XY6A 4FF4A 1K6YA 1IQZA 4FXWA 2FBYA 2VQFJ 3OFFA 3BPSP 2ZUGA 1HHTP 1W25A 2O4IA 3GJRB 1FRHA 3KLGA 2NYIA 1XWLA 4UW2A 2XLJA 3EKSA 1WHVA 4GVEA 1TP7A 1S77D 3FQLA 3DOLB 4DSEA 5E26A 4DUYF 1GLBG 4DQSA 3AXKA 3OYEA 3DU6A 3OS2A 3VQ4A 2HMIB 1WHXA 3ET6A 4O23A 4C8MA 3C6TA 2ZJQL 1S5JA 1KAZA 4DTMA 3POTA 5ETLA 3IA0A 1C0UB 1C4AA 1W26A 4FYWB 1IBCB 5L38A 1DTTB 5BR9A 4W5OA 1HYVA 3W9JA 1RT4B 2PI5A 4J9PA 1AW0A 5JVGL 2AZ1A 5A8RB 5HN0A 1C1BA 1VQOS 4K4ZA 1KTVA 5F3ZA 3GLJA 1M5KC 2VBWA 4B3OB 4H5WA 3MM7A 3OYKA 2DHXA 2QTDA 3BN7A 2P9NA 3M6UA 3E1YA 3SUOA 2RPIA 1TYQA 5A8WA 1ROFA 4JKAA 4NZ6A 2DR8A 5AQPA 3BGUA 3KJVA 2P9CA 1KOHA 1YJWN 4DU1A 1L3UA 3HJVA 3FZHA 3DFEA 1IKYB 4FW2A 2CQ0A 1WOOA 4O44B 1T3VA 5LMNJ 3WNGA 2QA2A 3GG1A 2ABYA 4IR9A 2F7VA 2HHUA 5DO2A 4LF6K 3T1AA 4ILMA 5FPEA 3RMCA 1UL3A 4MYTA 3K5NA 1X9WA 3W60A 4LRCA 1RK8A 3OW2R 1NOZA 4JS5A 2ZWHA 3OTDA 3EGVA 2IMWP 4IRKA 4HHHA 1LK5A 1ATRA 1NLKL 4CZLA 3MM9B 2R8HA 4JKFA 1OY9A 4Z7YA 1N88A 5FIIA 2DGVA 5LSOA 2J9EA 4Q45A 3PRVA 4IEEA 3PR5B 3B8HA 2B8QA 1QZ5A 2QV6A 3E9LA 1M5HA 4MJKA 2HZCA 1HNWF 2NNWA 4K4VA 3SSSA 3J7AN 1OO0B 3V9WA 3MN6A 1VFJA 2YKAA 1YZ7A 3GP9A 3D2FB 4PWDA 2HHHK 6FD1A 4KRFA 2YJEA 3V6KA 4IXCA 4DQ8A 4QCLA 3MD1A 3RB0A 4AFFA 2CVIA 3LP3A 3PIOQ 1BG3A 1DBDA 3K9JA 4UTGA 1N32J 4MK9A 1Q0NA 3CG7A 3TZYA 3J80O 3CC7N 4DR3F 1Q9XA 4BDZA 3O80A 2LVWA 2VG5B 4RWXA 2FY1A 1VLOA 2LEBA 4IFYA 4J5OA 1N5YB 3AVFA 2N7CA 3BSNA 4W5RA 2R8JA 4DV5J 1NKBA 5A2QO 3KHGA 4XEIA 4AHUA 3AXMA 3AD7C 3IN5A 1FRKA 2I9SA 1QJHA 1PYSB 1PIEA 4OKKA 1RTHB 3T1HF 3OTBA 4NZ0A 5H9EJ 1X5PA 1Q7YO 4USKA 5B0DA 4IO1A 3ZLJA 4J9SA 4CLTA 4JRPA 3QNWB 4NYNA 3AA9A 3P5BP 4ZPBA 2WVCA 3PIPL 4H8KA 1HBMA 1X5TA 4JI8F 3HZ6A 2MKJA 2FHKA 4CTAB 3MEGB 3P5JA 2YX4A 4DSJA 3CJRA 3KMSA 2A5XA 4NLVA 3MWPA 3OFEA 4EZ6A 2NRZA 2OEJA 2BRLA 5ITHA 2R7OA 4M5HA 3QB0A 4CLSA 3CCRS 3UN2A 1S0VA 1C0TB 4FLUA 3GQCA 1E6YB 4KGZB 1IJFB 2H51B 1RWNB 5HROA 4RG8A 2PYJA 3SAFA 2RAQA 3J80Y 2KXFA 2OELA 4HI1A 3BF3A 3UVJA 1ATNA 2AWZA 2CPJA 1RU1A 2J8SA 2YPZA 2WFBA 1Q81O 4CJEA 3BZCA 4R5PB 4LMZA 3MX2A 1OYEA 5A2QY 1K44A 3VAFA 2HHVA 5M1NA 3KLEB 3P4IA 1P1TA 4I7FA 1NZAA 2GEMA 4F4AA 4MKYA 5M2UA 1GOAA 2VBXA 5AZIA 1EP4A 4PQAA 4PUOB 1KS2A 4BC5A 1T9XA 4EHUA 3G82A 2AJ1A 4YORA 3DRSB 4RW8B 2P9IB 2XSJB 2G0CA 2M0GB 3SQGA 3OR1B 2QA4S 4RTFD 1JLCA 4LF7F 3CD6N 4K4XA 1BE4A 4OPKA 3QEVA 2XS5A 2FHJA 1FO1A 1RKJA 2FVSA 1NK9A 2H48B 1D8YA 2I7PA 1HWJA 5A8KB 1RBUA 1D09B 1D0EA 1U2RA 2XYPB 1VBKA 3KUHA 3M9NB 2CNKB 2AMCB 1SC6A 1SJ4P 2D3ZA 4JD2A 4HTJA 1U1RA 1EARA 3TR5A 4YHHJ 4DV1K 3N6LA 1S7HA 4A8MP 2WVFA 1UWAA 2MY8A 4KHRA 4E1MA 1D5AA 1SPBP 5B0BA 4RU2A 1QQOA 2Z1HA 3GG4A 4GNIA 2Y8YA 3GE1A 3PXGa 1NKEA 3BH6B 5DM6L 4PY5A 5C2DA 3BSAA 4X66F 2FHJD 2O8FB 2Q1LA 1VRUB 1VQ4S 2H65B 4W92B 2D69A 3M1VA 3BO3A 5KRTA 1HPMA 5BPLA 1UEUA 3JQKA 2DRBA 2JWKA 2O3DA 2OEKA 3EDQB 4OI1A 1X9MA 4OYWA 4A8WA 2FVRA 1WEYA 4IH6A 2W9CB 3UD4P 5LL6d 2O8CA 5BRFA 5AJ3K 4DV1J 2MZTA 2RSQA 1N36F 2YPYA 2H5JB 3ZO7A 2FJVA 1UJ4A 3FNNA 4ID8A 3FUYA 4B1YB 4WCEL 2C2RA 4DFKA 1CJTA 3C3LA 4ICLA 3DLJA 3FFKB 3OBYA 5CZXA 2GAGC 3OV7A 1SQFA 3WIUA 4E1JA 5AFUH 1CPZA 3AVLA 3CCUS 2CVEA 1WOQA 4C8OA 1F9EB 4CEBA 4ETZA 4MTPA 4XDCA 3M8PB 2QMUB 3VQ5A 2UUBF 4C3MA 2Q43A 1SS6A 1CULB 1NK4A 2FGCA 4USWA 2PEBA 3HTVA 3BSCA 3FSYA 4FNHA 4P72A 4USIA 4ANCA 2PFDA 1RLCL 3E66A 1Z2LA 3W3SA 4DPOA 2MKIA 2HNYA 1YHQN 4F04B 3L7UA 1MLAA 1WWHA 3LP0B 3CB4A 1KAYA 3F5TA 4BQLA 3DM2A 3V1QA 4Z7CA 2BOAA 1J53A 3V6HA 3VAHA 5M2RA 3C6UB 2D0PA 3P5TL 3JSRA 1TV6A 4CH7A 2IHR1 3V6JA 3ENHA 1R8BA 3CF5L 4QS7A 4TY8A 1TL1B 1BLUA 1CS4A 3CCVN 3DLBA 1NGCA 5D4LA 2NPFA 3GR0A 1N0VC 2JOQA 3FZBA 1X8DA 2UXBJ 1WEZA 1VK8A 5DZ7A 4JI2K 3I0RB 5KPRA 1VHXA 3J7YP 1K73T 4B9VA 2BQ3A 5GAHU 2DITA 5GADI 2OPSB 3ZYYX 1U2FA 1JJ2M 1NK6A 2XCAA 2G4BA 1P8GA 3SSQA 3FZMA 2O8BB 4Y3CA 5J2MA 3LP2B 3VVUA 1X5OA 1KOOA 4ZVEA 1Q8IA 4AHTA 1T6DA 4A46A 4NLGA 2B9YA 3CD5A 3G4SS 5FPNA 4CLYA 4PG5A 2BJ7A 5F0XA 1A7GE 2PBDA 3GU0A 5SWMA 4OX9K 3E8OA 4CK3A 1PJ6A 4DV2F 2E6LA 1T9WA 5D4OA 2R7VA 5HOOA 1HNZK 1H2VZ 2ZHOA 3WBZA 4B3MJ 2O8EA 2QFIA 4B9MA 3UN3A 4X4RA 1KNZA 1HRHA 4OGEA 2A6OA 4QOZB 4Y2CA 3NHGA 1V4SA 5LMUF 3D7EO 3M6GA 4JI2J 5T7LA 4R8UA 1GAOA 1JJ2R 3BF4A 4J2EA 4XH1A 3ZZUA 3TYTA 2UVUA 1FJGF 3TR8A 5HAOA 4CHOA 4FWQA 3JXOA 1YJ9N 2MGZA 5CD4A 3ELHA 2HWHA 2Y1RI 1BQXA 1XTZA 3DGPB 4OZ0A 1RWXB 1B4SA 2VWJA 3EM1A 1VQ8S 2XNRA 4F3QA 3AO4A 2G0JA 2CG8A 3TAFA 7FDRA 2MSSA 1YJUA 5CQGA 1NNEA 1W9HA 4HWIA 3NVMA 3OTEA 2DGQA 2HHSA 3PZPA 4J9QA 5LM7E 1HI8A 4X4QA 3BSOA 3VEVA 2I38A 2M2BA 5GAHP 1BMQB 2FJBB 4DQQA 2W01A 3LGHA 1BWVA 5KFDA 3ETMA 2V67A 2GAHC 3A8KA 2Q2RA 4M41A 3ZFVA 3LDPA 1KBRA 2OUGA 3SDEB 1A9NB 3A5OC 2A10A 3BQ1A 1F9FA 1DZ5A 1WOSA 1RTJA 3TX8A 4CZMA 2DGXA 3TUJC 5AXLA 2PEHA 3BKFA 4FJJA 1TKXB 1KVJA 1V3SA 2Z8QA 3IMQJ 1RP5A 4IOAQ 1SC3B 4KBOA 4DR2F 3CERA 3K89A 4LREA 4I9LA 2NXCA 2EFGA 2K7KA 2P9LB 4H03B 2CNNB 1DRZA 3EXYA 3Q8RB 1VMBA 3J81j 5AQUA 2DNQA 3UR3C 3F73A 2MLXA 3DI6A 4FPAA 1FXDA 5IOLA 5EDWA 3HHNB 2HBRB 2UUAK 4RW9A 2LXIA 5KFRA 3LPTA 4IDKB 1YITS 4BC4A 1JLFB 1JXLA 2X6SA 2DK2A 3TSPA 2CIMA 4XTTA 3FVYA 4I1TA 1HNXK 3MPDA 3O6WA 1LK7A 1GX5A 1XC3A 1BU6O 1SKUB 2WAQD 1R43A 3P8BB 1TELA 4DFMA 1IBKF 4M5IA 3MN5A 4YDUC 4WK1A 2OI2A 3CCZA 3B6BA 5J1EB 1RHMB 3A5NC 2GQ2A 4ZPWR 2RQKA 4FL9A 1CQNA 3LF0A 4N7TA 4LF5J 4QS8A 3ADAC 2YWFA 4HHUA 4RW6B 4G3IA 1CC8A 2YQ3A 3C7NA 4ZVRB 2DNMA 3PVXA 2JC0A 3GJSB 4C11A 4J9LA 2DPJA 2UUAJ 3D2EA 2R7UA 3C94A 1SUQB 2HBQB 2G8VA 1J9AA 2UP1A 4ZVQB 1KQGB 3I9ZA 1DTQA 2G2YA 1H1VA 3PY8A 1LWCB 4QWCA 4FZYA 4IFVB 4ZITA 2IRXA 4HCCA 2EKNA 4JV5J 4HUFA 4DG1A 2EKYA 5DK5A 3G25A 3TJAA 1RI7A 2VG7B 4B1WB 3NCRA 4FWKA 4ZPDA 2R2TA 4USHA 5DMRA 2X1BA 4W90B 2ILZA 1H2TZ 2W25A 3KLFA 2WHOA 2CZ4A 2G2ZA 4LF9F 3UKRB 4CF1A 4DR5J 4Y0WA 1XIQA 3T6JA 1FWKA 4DSIA 1FRMA 4UY85 3F9MA 1Y97A 2RKIA 1WTFA 2YHXA 4A8OA 3HRGA 2EX3A 2IJRA 3NCQA 3MEEB 4N77A 1KLNA 1JLQA 4IO9Q 3OR2A 1NHKL 4WQ5C 1H98A 1KVBA 5SZTA 4O8KA 1D9DA 1JLBA 4RNFA 3QGHA 4LC9B 1H7XA 2ZEJA 4YOXA 3AJ2A 1FDBA 1C0GA 4J2DA 3GFXA 3L7PA 3LZJA 1WBBA 1N5SA 4DUYJ 5DETA 3B4DA 3DXMA 2LQJA 3CCTA 3AD8C 2ZDOA 3NF8A 4PKGA 3ZX3A 2KO1A 3HJFA 5GVQA 3DYAB 4FXVA 3S3NA 3D4JA 4YN3B 3WEEB 3J7A1 2GHVC 4OYIA 4IFEA 3OLAA 1VQYA 4NA3A 1DEJA 3MZIA 2FSJA 5AQOA 3L2QA 1Y3JA 1ZM4A 2HHTA 4CO0A 4KKOA 3EWGA 3GYNA 4FJ5A 1I94K 1IKVA 2FB0A 2RUGA 4M8LA 4O5BA 3NWGA 4DPWA 3O5TB 5D0GA 5AQRA 4W5NA 1VSIA 1PILA 3V6DA 1RAIB 1UAWA 1JCGA 3CCSN 4KH6A 1HPZA 3LM2A 3CXCM 2QK9A 4CEAA 3QPIA 4B3TF 2A42A 1WSJA 8AT1B 3KHYA 3EGNA 3RB6A 1AUDA 1RADB 4CHQA 2VL1A 4H4MA 4ED2A 1RTDA 4BGBA 2ZJPL 1O51A 2DR7A 5F8HA 1YBUA 4LFBK 3IWLA 3LO3A 1SB6A 3IGVA 2W2MP 2HLTA 4DR4F 1X3MA 4PABA 4QS9A 3GFZA 2FTRA 3BY5A 2J0SD 4QR0A 3G6ES 3FRYA 2Z30B 1I94J 3CCLN 2HFSA 2ZH3A 3KZBA 1GLFO 4CJPA 4PXDA 2G13A 3OVSA 3CFOA 4M3RA 4X2BA 1FKPB 1K1QA 2J4RA 3CXCR 4ECZA 3DRXA 4P75A 4DTUA 1SBRA 1WNSA 4ECWA 1D1UA 2LDIA 4DN9A 3C2PA 1REVA 2Q6CA 4I64A 4DXLA 4MKBA 3QEXA 4C8YA 2XZWA 4P2XA 3KDOA 3QGPA 1U8SA 4YB7A 2HAIA 1WC3A 3TUIC 3DXKB 2N82B 5C42A 3T1HK 2R2UA 5CHIA 3B6PA 4LFBJ 3LDQA 2W9BB 1BA1A 2BJEA 3KLIA 2I0XA 1K8AT 3D9BA 2W40A 4B1XB 4M3YA 4GRSA 5CZVA 1FNMA 3O4QA 4LSNB 1JLEB 5ETOA 4DU7A 1WJ9A 3PHTA 3NXZA 2QLWA 3GIKA 2LQ5A 4NPOA 1J5EF 2CQHA 2BOPA 3G71N 5HANA 1X9JA 2XO7A 1MWQA 2RB7A 2E2OA 2B56A 3LZIA 2E5JA 2F9JA 4TNOA 1SC1B 2J0QD 3RWUA 3A1YG 5J2PB 1N0UA 3VQ9A 3T19A 4AE5A 4ZLPA 2DT9A 4NA1A 1T3NA 4Y65A 3T1HJ 1FNXH 2D7SA 2E1MC 3QEWA 2IGIA 3E9OA 4CRJA 1KDNA 5EWEA 1NSAA 1RT5A 2V52B 1BWEA 3W5YA 2VPYB 3EKUA 2W41A 3CMES 2YKQA 4LUBA 4JI8J 1R89A 5EOYA 4KIAA 2OP5A 3PEHA 4Z4FA 2RE2A 4DMNA 3PW2A 3L2WA 2B7CB 2D9OA 3PTWA 4PZVA 3W2VB 4I68A 4JI1K 1IVZA 4DTSA 3DMJA 4ZP7A 4X84A 1QM9A 1QE1B 3THVA 2XMMA 3QAUA 5HMZA 2MJUA 3PJWA 2KZZA 2MZ1A 1ZPWX 4DQIA 1VQLN 3MAQA 4J37A 3L4BC 1EETB 2ZD1B 1U1QA 4DSFA 4LF7K 2WC9A 3RMBA 2DCLA 2LLZA