2OPSA

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
542
structure length
535
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 134
structure length 535
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2opsA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2opsA05
5FDLB 2QXFA 3VN5A 1HJRA 4NCGB 1NHUA 1SUQB 3PZPA 1W25A 1BCMA 5DQIA 5F8MA 2P5GA 3OJSA 1TV6A 4W5TA 5D3GB 1VRUA 3KOAA 2Q3SA 3OVNA 2Y1JA 5KT5A 4RW9A 4XPEA 5SZTA 1C1BA 4R8UB 1G15A 2IDOA 4B9MA 3CO9A 3E51A 2DFHA 1WSEA 3RMBA 2V9WA 3L2RA 3MFIA 3I8DA 4CERA 3DRPA 1LW2B 2W7PA 4ZPBA 3QYYA 1C2PA 4F4XA 3G86A 5J2MA 1EETB 1IH7A 4MKBA 5KFHA 5E41A 3EPIA 2C2EA 4KKOB 1SV5B 4NRTA 1VSLA 2OPSB 2IAJB 4WYWA 4FJIA 4KFBA 3KK2B 1QQCA 4CHZA 3QEPA 2I5JA 4DG1B 4FM1A 2WONA 3H59A 1KSPA 4Q8FA 5L9XA 3LALA 3C6TB 3KLGB 1RTJA 2B6AB 3PR5B 3GV8B 1U45A 4C8MA 3PW5A 1WSGA 4RW6B 1ITGA 3OS1A 3H5YA 4M3ZA 3Q8RB 3H08A 2JEJA 5KT6A 4ID5A 4DU1A 3RB3A 4CE9A 4RNMA 1ZBFA 4YFUA 4CFCA 2HHWA 1TK8A 3PO4A 4Q0BB 1RCHA 3FFIB 1S0OA 3NF7A 2B5JA 5C42A 4FJ9A 5J2PB 3KMSA 2VA2A 1FXXA 4OPKA 3VA3A 4K4TA 3T5JA 3KHLA 4IR9A 2A1RA 1S6PA 4EBCA 1S1VB 3DLGB 1FKPB 5J2NA 1C6VA 2A1SA 3P5JA 3OHAA 3ITHA 4IRCA 4Y2AA 3Q8QB 2WK4A 4BE0A 3ISND 4ECRA 4O5BA 1IKYB 2W9BB 3RMAA 3OYKA 4PWDB 1RTDA 1RILA 5HRNA 5L1KA 4RW4A 4HCBA 4OKJA 1YTAA 4HUGA 1JKHA 4KPYA 1XR6A 4GVMA 3PJWA 3DM2B 3NAIA 2W7OA 2VG5B 3ZSRA 3V9ZA 2OPRA 4M95A 4K4SA 3HL8A 1TKXA 3C94A 3QGGA 3G0ZA 4FJ7A 5FRMA 5C5JA 1T8EA 3ZSXA 1FK9A 3V1RA 1QAJA 1LW0A 1HARA 4DLEA 4ED7A 3HPGA 4DU4A 1YTUA 1GOBA 2WHOA 4B8CA 4DL4A 1T03B 3TI0A 1T3NA 3M8PB 1LWCB 1HQEB 2JLEA 1SL2A 3LAKA 2BANA 1GX5A 2HNZB 4FLWA 5J1EB 2YNIB 3GIKA 2RF2A 5T7BA 2XY7A 4YMEA 3LP0B 3SFUA 2ASJA 1N5YA 3OYHA 4FK0A 3LWLA 3DLEA 1N6QB 4Y2CA 4E3SA 3IGVA 4HVJA 1RT5A 4DFPA 1T05A 4DSLA 2RDIA 2F8TA 2X6SA 2IJNA 2AWZA 1J53A 5DLFA 3HVTA 5C24A 4CHQA 4R5PB 1S10A 2F8SA 3NGYA 4WE1B 1S9EA 1XWLA 5HP1B 4KHSA 4MK7A 4DTNA 1FKOA 2EC0A 5FRNA 1S9GA 3V6JA 3Q8PB 4H4OB 5KFOA 2F8EX 5KG2A 3KTQA 2WRMA 4FBUA 2AX1A 2FBVA 5KFXA 3T5LA 5KFNA 2ZQBA 4IQXA 5DLGA 1B9DA 3O4QA 4M3RA 2X78A 4FS1A 4TY9A 4RU9A 1JL1A 4K8ZA 5EUHA 4WYLA 3T19A 1JLCA 1VK0A 3AVCA 4EEYA 1BHLA 3CDWA 2HNDA 1VSMA 5FROA 4CFDA 3SV4A 1TKZA 3MECA 3VQAA 1RT2B 5KRTA 2HHQA 5JS2A 1C0TB 4JUZA 4ED6A 4L8RB 5KT2A 4CJPA 3ICLA 2KTQA 3MEGA 4FM2A 2D0AA 2ZKUA 2O4GA 3ZT0A 3ZT1A 4F8RA 5DMRA 3NF8A 3BREA 1KLMB 4GW6A 4O44A 4E7HA 4BDYA 1HNVA 1K6YA 5CYMA 3BSNA 1QTMA 4CESA 3RB4A 3VQ7A 2UVRA 2ZE2B 4CF0A 1CLQA 4DSEA 3BQ0A 3PW7A 1MU2A 2OPQB 2R7YA 3HYFA 4PA1A 4YR2A 4ECZA 3DLRA 1D0EA 3PW4A 4KHMA 4KI4A 4F3TA 3NGDA 4ELVA 3NF6A 4O3PA 3NE6A 4DSIA 4PY5A 4U6PA 2DFEA 3V81A 4AHCA 2FBTA 1Q8IA 4KHUA 2GIQA 3E01A 5KG0A 1LV5A 2VG6B 1WSJA 3QEWA 4CJFA 2X74A 4ECSA 3VQ5A 4H4MA 4QAGA 3RB6A 1UA1A 2WOMB 4KAIA 2WTFA 4DTOA 3SPZA 3VQ8A 1CZBA 1S9FA 1RBSA 4K4XA 3RRHA 3VA0A 3SQ4A 4TYBA 5DG9A 3DRRB 3NAEA 1IO2A 1DTQA 1JLEA 4CEZA 1Z4UA 4CEFA 4F50A 3OYJA 3D5MA 2YNHB 2FLPA 4I2PA 4KV8B 1JLFB 4Z4CA 2FVCA 2VWJA 3OL9A 3KKRA 2XHBA 2W42A 1WSHA 3IAYA 3IG1A 2GBZA 3KHRA 4IG3A 2E6LA 3SJJA 3LAMA 3NBPA 1NK9A 4J2AA 5K14B 1S1XB 3DMJA 2V4QA 2E9TA 3MFHA 4FJKA 1WSFA 4H54A 1QS4A 2E9ZA 1KVBA 4ED1A 3OHBA 3V6HA 1DTTB 4CHOA 3AO4A 2ZD1A 4DQSA 1IKWA 4QWCA 1ZBUA 3DOKB 2HNYB 4XPCA 3KLIB 3SUNA 3RAXA 5KG7A 1RTHB 5EDWA 3MR2A 1S1WA 2FLNA 3PW2A 5KFLA 1HQUA 3KK1B 3KK3B 5L1JA 4O3QA 3K59A 2HMIA 2UUWA 3H5SA 1HPZB 1BI4B 2YNGA 1ASVA 1HNIA 3PUFA 3EZUA 2QKBA 2YNFA 1KFSA 1GX6A 4CEQA 1XHZA 3AVGA 1TVRB 4DL2A 1Z26A 1QAIA 4K4UA 1J5OA 3GILA 4I2QB 4CJ4A 1NJWA 2HHUA 3V6DB 4CJ5A 1HYSB 2UVVA 3LZJA 1XC9A 4N56A 1RT7B 4CJLA 3RRGA 4IFVB 3OYEA 3OYGA 4MIBA 4E7JA 3HM9A 1HMVA 3C6UA 1RBVA 4N5SA 4WFXA 2JEGA 1S1TB 3LP2B 1Z25A 1SKRA 3NMAA 3I0RA 2J6SA 3BQ1A 1RT6B 2C2DA 3AA2A 4FW2A 3PW0A 2Z1JA 2KZZA 1QE1A 1RT4A 3ZSWA 4TY8B 3JSMB 3ZSYA 1D5AA 3NDKA 1RT3A 5KFSA 2IM0A 3G6XA 4AHRA 3C95A 1SL1A 1NOZA 4CEBA 1RBTA 2HVHA 4OVLA 2IMWP 4C8NA 2R8GA 3QLHA 3AO2A 2G8KA 4J9SA 1N48A 1ZYQA 4NRUA 4FZYA 4J9NA 1C0UA 2GV9A 1D9FA 4NLDA 3H5UA 3OY9A 3V9SA 3MR6A 4PUOB 4W5RA 2O5DA 2JGUA 4CJQA 3NCIA 4DL6A 3V4IA 3CJ5A 3T1AA 1TV6B 1WLJA 1L3SA 1KTQA 4OGCA 3DI6B 1KVCA 1VRUB 3TABA 4O3NA 3OYIA 1B92A 4ZTJA 2BQ3A 1GOCA 2D3ZA 1JLGA 2P51A 4ECVA 4B9SA 1BCOA 3KIOA 1C1BB 4FLXA 4G1QA 4URSA 2VWKA 2C22A 2ALZA 1TL1A 4W5OA 3DRPB 3CM5A 3OYFA 4NYNA 1NJYA 4F2RA 5I3UB 4KB7A 2VA3A 4EZ9A 4CHYA 3QGHA 5J2QA 4M41A 5CZ2A 1NK7A 1ZTWA 4CFAA 1C0MA 4FW1A 1NJZA 1NKBA 4ZVEA 2R8JA 4KFBB 4CECA 3SQ1A 4Y1DA 2FBYA 3ZT2A 3OYMA 2WONB 4FLZA 4QPXA 4RZRA 3H4DA 1RTJB 4FLVA 4F4YA 4J9LA 3FQKA 3RAQA 4J9RA 3QZ8A 2RKIA 4YP3A 4DQIA 2BGGA 1TL3A 2XI2A 1NKCA 4RW8A 5KG5A 3TAEA 3KJVA 4MFBB 5JS1A 4ID5B 3VQQA 3M8QB 3RBEA 1KLNA 3VQDA 3AVLA 3KLHA 3HJFA 4ZPDA 3IRXA 5C42B 4DMNA 2ASDA 4IOBA 2FVPA 4OLAA 2FLLA 1S6PB 4CEOA 2R8IA 3BR9A 5J2NB 4FVMA 2AGQA 3IN5A 2IC3A 3ITHB 2OZMA 3FSIA 2DTUA 3GIMA 4Z4GA 1LWFA 3KLEA 3CYMA 1QSLA 3FRZA 2B4JA 3EZ5A 2KFNA 1RTDB 1IKVA 4BWJA 4RW4B 5KFYA 3AO5A 4CK1A 2ETJA 1S1UB 5D3GA 2B43A 1S6QB 1YVFA 4K4VA 4W5NA 3BSAA 3OL8A 3CDUA 3F9KA 3QO9B 2LSNA 4E1NA 1L3VA 2OPRB 2G8WA 1NK6A 3OYLA 3O3FA 4R8UA 1IG9A 1JIHA 4M3TA 2FVRA 4DTJA 5F8GA 4F4ZA 5HROB 3OYBA 3PX4A 3WNEA 5EWGA 2JC1A 2HAIA 3DRSA 5KFCA 4O3RA 4ED3A 2IGIA 3NL0A 1REVA 1FK9B 4U7CA 4JV1A 1LW0B 3SQ2A 4ZVGA 4IDKA 4CEAA 4TYAA 1SL0A 3ZSVA 4ZPCA 4JS4A 3U6FA 2D0CA 4CGIA 2XY6A 3CQ8A 2BANB 3H5XA 3FQLA 3WNGA 4ZP6A 2R8HA 4FJMA 2AJQA 2RF2B 4O4GB 4ED8A 2XRIA 4TLRA 3I5BA 3VQCA 4KO0A 3CJ2A 4ZP8A 3AO3A 1N5YB 4E0DA 3VQ4A 3DLEB 3C6TA 3KLGA 3EYZA 4DSFA 4NYZA 3WNHA 4RW6A 1T05B 4LH5A 4CJ3A 3GIIA 4H8KA 2YV0X 3HVTB 5EWFA 2DPJA 1VSJA 3L8BA 1S9EB 3HXMA 4AH9A 1FKOB 4Q0BA 4Q8EA 5KFPA 4E19A 3OYNA 1S9GB 5KFIA 3P83D 1JXEA 2OA8A 1CXQA 3AA4A 1JLBA 2WB4A 4FJJA 4PQUA 4ZHRA 2FJXA 4QOZB 3BJYA 1N56A 3UQSA 4ECUA 1Y97A 4JLHA 3QIPA 4HUFA 4KTWA 4FJHA 1ZTTA 3L2UA 4KRFA 2YKNA 5DGAA 4NLQA 2XGQA 2FC0A 1JLCB 3NFAA 2OPPA 2GUIA 4NCAA 2W8LA 2BQRA 4DSKA 4OLBA 2HNDB 4LQ3A 4FJGA 3D28A 1WN7A 2QV6A 3MEDA 4IH5A 4DS4A 1TKZB 3MECB 2BRKA 4IH7A 4ZVHA 1RDRA 3QEXA 3S3OA 4YQWA 4BE1A 1RDCA 4QWAA 1NK8A 1BL3A 3DM2A 2YKMB 3MEGB 4KREA 2ILZA 3TR8A 3TANA 4C8OA 4CK3A 4RW7A 3M9OB 4MQ3A 1C1CA 4O44B 3OYCA 4YR3A 2IS3A 3NH0A 1NK4A 5HRRA 3GV5B 4KI6A 4BWMA 4NCBA 1UWBA 1EXQA 4MKAA 3RWUA 3AVFA 4ECYA 4LY7A 2W9AA 2UVUA 3K5OA 5DG7A 3LP1B 1KVAA 3M8PA 1LWCA 3T5HA 5JUMA 2RPIA 4UQGA 3QEIA 4RUCA 4F4KA 5C25B 3QESA 2IJFA 3V81B 2JC0A 3E01B 5HBMA 5J1EA 4NLVA 2XC9A 5F8LA 4NLGA 4H4MB 2IM3A 3G10A 1N6QA 1BIZA 1RBUA 5F9LA 1BQNB 4EO8A 4J2EA 4R0EA 1T94A 4K4WA 4DQPA 4IG0A 1W9HA 4NLSA 3H40A 2BE2A 3BSCA 1JLEB 4FZXC 3H2LA 4R5PA 2J6TA 3OJUA 4KHYA 4ZTFA 4HHTA 4FK4A 5HP1A 4LSNB 3SUPA 4F4WA 3QERA 4B9NA 4I2PB 4K4YA 1VSIA 3QETA 5KG4A 2D41A 1X9MA 4JRPA 4FXDA 2HWHA 1WSIA 2HW3A 5F8JA 2W9CB 1DLOA 3IG1B 4G3IA 3AVKA 3NGIA 1D8YA 4C8KA 2F96A 3PX6A 3NBPB 1TQLA 3SI6A 3UPFA 2HWIA 2XI3A 2D7SA 1CZ9A 4FS2A 2BRLA 1RYSA 4KHRA 1TGOA 2ZD1B 2PY5A 1IKWB 1RT2A 4J2DA 3LP3A 3JYTB 1HYVA 3QGIA 3GYNA 2DFFA 4AHUA 1N4LA 3IGNA 3LANA 5KFGA 1S1WB 3HVRA 2P1JA 4J9PA 1UAXA 4E7LA 1HRHA 2ILYA 2YNGB 2YHAA 1HNIB 1JXLA 3N6LA 4OPJA 4XIUA 4M94A 3QZ7A 4J9MA 2JEFA 2ZE2A 1XI1A 4LSLA 2PYJA 2O4IA 1YVUA 3VQEA 2OPQA 3QEVA 2PYLA 4OKEA 1TAQA 3ULDA 2OZSA 3M9NB 2HVIA 3T3FA 2PZSA 3V1QA 4FLUA 2XGPA 4BDZA 3C6UB 1RNHA 4ZP7A 3HK2A 2WOMA 3KLFB 4CJWA 4NLTA 4WFYA 3VQ6A 1U04A 1I3AA 2CJQA 1QE1B 4OJRA 4B9VA 1BQMA 4M3WA 3KHHA 2YHBA 3MTKA 3KKSA 4ED0A 4BDPA 1RTIB 2D3UA 2YNHA 1WAFA 1BGXT 4GMJB 2RDJA 1JLFA 3D0PA 1OS5A 4DFJA 2VG7B 1U48A 3L3VA 4XO0A 2Z1HA 4CCHA 3QLHB 4Q43A 4KB0A 4CGHA 3DLBA 5I42A 4LQ9A 1ASWA 4B3OB 4MK8A 1C0UB 3PY8A 3BGRA 4IRKA 4RNHA 3HSTB 2Y1IA 2CKWA 3TAPA 1RBRA 2AGPA 3I0SB 4KE5A 5KFFA 2D0BA 1RT1A 4KB1A 4B9TA 3SNNA 2C2RA 4DTUA 3DOLB 2Z1GA 3HT3A 5KG6A 4FK2A 4NLXA 4RUAA 1CXUA 1TAUA 2OH2A 3KMQA 4ICLB 4ECQA 1LWEA 1Q9XA 4G1QB 1TKTA 3TAGA 1TL1B 3B6OA 3KLIA 4CF1A 4CGJA 5CY4A 4NLOA 1TP7A 1NK5A 4EBDA 5HLFA 1SKWA 1XR7A 4O4RA 5KFAA 3I5AA 3H98A 3K57A 3KK1A 1JX4A 2C28A 3CJ3A 5KFMA 2BQUA 4IRDA 3HVWA 1BI4A 3MF5A 3MEEA 1L3TA 4YNQA 5DG8A 3F73A 3NGZA 2QK9A 2P5OA 4ZP9A 3RB0A 3S3NA 3PO5A 2JEIA 1JLAA 2KZMA 1W0HA 4M3UA 4NLUA 4O3OA 1VSHA 1RT7A 5CZ1A 1RAJA 4RW9B 1EP4A 3NF9A 4NLRA 3CIZA 1X9SA 4RW8B 1O1WA 4CF9A 4OL8A 4IBNA 3KJVB 4IR1A 1XHXA 3DYAA 3G6YA 4GC6A 5KFKA 3S9HA 1X9WA 4CIEA 1ZBIA 1SH2A 4IKFA 3SUQA 5J2MB 3KLHB 1LAVA 3SI8A 3AA3A 3IRXB 4TY8A 2V4RA 1T7PA 4DS5A 5SWMA 2RN2A 1A5XA 3OYDA 4Z4IA 1XR5A 3MR5A 1JLQA 4Y34A 3G6VA 1R0AA 5KG1A 5KT7A 3TWHA 4E7KA 4FJXA 2HB5A 2BDPA 2IC3B 4QW8A 2I5JB 4ZPAA 1ZBLA 3CWJA 3Q8SB 1LWFB 3B6PA 5DQGA 4AHSA 5CYQA 3KLEB 2D5RA 4PUOA 1IKVB 1QHTA 3TVKA 1CSJA 3M9MB 5KFTA 4CHPA 3DI6A 3OLAA 4FJ8A 1A5VA 1ZETA 4DTPA 2XCAA 1NNDA 4DTMA 1VRTA 4ECWA 4HTUA 3KD1E 2B5JB 1F21A 1IKXA 4IFYA 3PVXA 4NZ0A 3DLKA 3AO1A 4QWBA 3O3HA 3BDPA 2IM1A 1D1UA 3EY1A 3DRSB 5I3UA 4I7FA 3IS9A 1REVB 3QIDA 4CF2A 3TAMA 3ZSZA 3PHEA 4DQRA 5FDLA 4DL3A 4IDKB 5EWEA 4KTZA 2XO7A 3K58A 1X1PA 4K4ZA 4NCGA 1SUQA 2R8KA 3SPYA 4URQU 4FJ5A 5KFQA 3AVJA 5KFDA 1B9FA 3P1GA 4NLYA 5KT4A 1S5JA 2R2RA 2BR0A 1JKHB 3CVKA 3V6KA 3DDKA 3BQ2A 4KO0B 3NH1A 4KSEB 4MH8A 2KFZA 3OLBA 4CGDA 1GOAA 3OSPA 1TKXB 3QNNA 4FJNA 1VSKA 1RA6A 2XWYA 3SUOA 4AHTA 4TSXA 3HP6A 4MFBA 5JXSA 2WCXA 4C8LA 1LW2A 3M8QA 3AV9A 4KHWA 4MK9A 2GIRA 4CJUA 1U09A 2FVQA 2EHGA 3KHGA 3ASMA 1EETA 2ASLA 3M8RA 3ALYA 1I6JA 3N6MA 2FVSA 3QINA 1JLBB 1S0NA 4PQUB 4ZHRB 4ID1A 4KKOA 1SV5A 1UOCA 3U3YA 2OPSA 1RDBA 2IAJA 2DY4A 4JV2A 4B08A 3KK2A 3QIPB 4QWEA 3TAQA 2YKNB 4DG1A 4EBEA 3LPTA 4QW9A 3M8SA 2OPPB 2Z1IA 4EO6A 2UVWA 2B6AA 4FZZA 1EKEA 3AVAA 1RT5B 5DGBA 3PJXA 3GIJA 5KFEA 3S3MA 4DL5A 3MEDB 2HHXA 1S1UA 3SZ2A 1C1AA 1S6QA 3T5KA 5C24B 3WNFA 1KHWA 2DPIA 3ZT4A 1NHVA 3HO1A 3QO9A 5EU7A 5DK5A 3L2QA 1MMLA 3TARA 3K2PA 3FFIA 4NLWA 3QNOA 4ED2A 3RTVA 3L3UA 5J2PA 2NUBA 2R2TA 5KFBA 4RW7B 5HROA 3AVMA 1C1CB 3QIOA 4DWIA 3AVIA 1S1VA 3DLGA 2ITGA 1FKPA 1ASUA 3HPHA 3LWMA 2HHVA 3I5CA 5KG3A 2V0NA 2AU0A 1UWBB 3RMDA 1NKEA 1KFDA 3ZCMA 5KRSA 1KCFA 4TXSA 4M42A 1IKYA 2W9BA 1S49A 1WNSA 4PWDA 5T14A 4LD0A 4OGEA 4E1MA 2J6UA 2G8HA 5HBMB 3RMCA 4O4GA 3OL6A 2FJWA 4EP4A 1TK5A 3RR8A 4J9QA 4ZVFA 1VSFA 4X2BA 3MAQA 2VG5A 4FYDA 4M45A 4E89A 1NOYA 2GC8A 4IG0B 3N6NA 3AVNA 2BE2B 1S4FA 2KQ2A 2ATQA 3CFOA 4J2BA 1HNVB 1U49A 5CYMB 1TK0A 4Z4EA 3L2VA 4FLTA 1Q9YA 3RBDA 1MU2B 5KGXA 4FCYA 3D45A 3LDSA 3VQPA 3ZSOA 4KTQA 3MR3A 1T03A 1HQEA 1DLOB 5KFWA 3NHGA 3KNAA 2G8VA 3UR0A 3FDSA 3CFRA 2HNZA 1K1SA 2YNIA 3V9UA 1A5WA 1QSYA 3OL7A 4DFMA 4IKAA 1HYZA 4TQSA 4F3OA 3LP0A 4FM0A 4DTXA 4O55A 4CIFA 4N41A 2IM2A 2FBXA 4WXWA 4QWDA 4FLYA 3KD5E 2EX3A 1L3UA 1EX4A 4RG8A 1D9DA 1DTQB 1YT3A 4WE1A 1SH3A 2G8IA 1RA7A 3AVBA 2YKMA 3ZSQA 2G8FA 4Y3CA 2IBKA 4Z0UA 4Q45A 4H4OA 1RYRA 4Z4HA 5F8IA 3PV8A 4URGA 4DL7A 2XY5A 4WXOA 4KAZA 4OKKA 4AILC 4TQRA 4DSJA 4WZMA 2ATLA 3O4NA 3HKWA 4CGGA 4CFBA 4WZQA 4ECXA 4WFZA 4LSLB 4IG3B 1BIUA 1SKSA 2E6MA 5F8NA 3DMJB 5KFUA 1VSEA 4CEDA 4DTSA 3LP1A 4FJLA 3VQ9A 3SYZA 3TQ1A 5C25A 3LZIA 3CFPA 4HYKA 4HCCA 1VSDA 3OS0A 2IOCA 2R2SA 1C0TA 5KGWA 3PR4A 2UUTA 4ELUA 4O0JA 4N76A 2KW4A 4MIAA 3UDLA 4QCLA 4CIGA 3BSOA 4B9UA 1KHVA 5L1IA 4NYFA 1BQNA 3K5NA 3CG7A 4DF8A 1HQUB 1BQMB 5KI6A 1U47A 2HMIB 1ZBHA 1KLMA 3NAHA 5KTQA 3RR7A 3VQSA 4ELTA 5L1LA 2YNFB 4LSNA 3L2WA 3HPOA 3ZT3A 3OS2A 1J5OB 4IH6A 3MXMA 2OYQA 4CJTA 3PX0A 5I42B 4CJEA 1LAWA 3NKYA 3CM6A 4CJKA 5KFVA 4DLGA 4KHQA 2HHTA 3MXIA 4Y1CA 2W9CA 3KLVA 3BGRB 1J9AA 3ISNC 5KT3A 4K8XA 3V1OA 4K50A 4BE2A 2VG6A 1HMVB 2AX0A 1BISA 1RT1B 5HRSA 4TN2A 3OSNA 3V9XA 3I0RB 1UA0A 1TKDA 4DU3A 3GQCA 4EYHB 4JRQA 1RT4B 3DRRA 3HHKA 5DQHA 4JS5A 1QUVA 1LWEB 1RT3B 4EYIB 4FBTA 3JYTA 1TKTB 2QE5A 2E9RX 4CK2A 2R2UA 3LPUA 3VQBA 2W8KA 3EPGA 3K5MA 3SCXA 2AGOA 4KV8A 5HLFB 4KHNA 2X6NA 2FJVA 2IA6A 3CJ4A 4DTRA 1WAJA 3U3GA 3MEEB 1JXBA 4RNFA 3V4IB 1IM4A 3HP9A 5K14A 1S1XA 3CDEA 1JLAB 4KBIA 1J54A 4GC7A 3MXJA 2QKKA 1DTTA 3THVA 1JLGB 1SH0A 1EP4B 1JL2A 4J9OA 2G8UA 1S0MA 3DOKA 2HNYA 3A2FA 3KLFA 4EP5A 4DQQA 4I9QA 1RTHA 3DYAB 4F2SA 4M3XA 2XY8A 2XCPA 5J2QB 3KK3A 4Q44A 4CGFA 1HPZA 4AHVA 2E4LA 5HRPA 1RTIA 1TVRA 4ZMMA 3UIQA 1JLQB 2I1RA 4E7IA 1R0AB 4I9LA 4CEEA 4DEZA 4M3YA 4I2QA 2HHSA 2VG7A 4NLPA 5F8HA 3K5LA 5KFRA 3SFGA 3V6DA 4B8AB 1HYSA 4CHNA 4B3OA 3SQ0A 3CJ0A 3GV7B 1S97A 4B9LA 1NJXA 1RDAA 4LH4A 3OYAA 1RDDA 5CYQB 4IFVA 4O0IA 1U4BA 4CJSA 2RKIB 3I0SA 1NK0A 3HVAA 1TL3B 3SV3A 3H4BA 4J9KA 4O3SA 1I39A 3AA5X 4CJVA 1S1TA 4CJRA 3LP2A 3DOLA 5F9NA 3TAFA 1RT6A 1VRTB 4RNNA 1K1QA 3NH2A 3V9WA 4ECTA 4N47A 5KFZA 4W5QA 4DF4A 4ICLA 4HKQA 3JSMA 1IKXB 4JV0A 4IFYB 4CF8A 1S48A 4Q5VA 3DLKB 1L5UA 4YR0A 3O3GA 4HUEA 4DFKA 1WNEA 4I7FB 4EZ6A 3IS9B 4RNOA 4BACA 1QSSA 1KRPA 3AVHA 3TAMB 2AQ4A 4Z4FA 3DLHA 5KFJA
chains in the Genus database with same CATH superfamily
5FDLB 3VN5A 4U7UD 3SAFA 1TYQB 1HJRA 2XMAA 4BS2A 3FE1A 4NCGB 1UETA 2GNKA 1W25A 2E2NA 1S6OA 2RSQA 1ICEB 4W5TA 2UXDJ 3FCVA 2Y1JA 5AQNA 5IZHA 2MQQA 2AP6A 4R8UB 2HMPA 5GAHI 1WOSA 3CO9A 3RMBA 1T3OA 1RHQB 3L2RA 3I8DA 2PI4A 3C16B 3D2EB 2ITMA 2P9IA 4KGXB 2BVZA 4RBUA 3JAMY 4I64A 2HBLA 2DEJA 1OO0B 3I9ZA 5J2MA 1IH7A 1VQPN 4WKRA 1X4BA 1FDAA 1DZ5A 1R59O 5AQFA 1U1OA 2KJWA 1BE4A 3SBTA 1HD0A 3BGFA 3A8JA 4LRAA 3IFEA 2ZH3A 2ZNZA 3POTA 3QEPA 2I5JA 3H7HB 5L9XA 2A2CA 3LALA 3IM8A 3LO3A 2J4RA 3B82A 2B6AB 1K8AO 1EIYB 1WSGA 4BGAA 3PXGa 1ITGA 3QDKA 4IXCA 3QFHA 4ID5A 3QBCA 3BDEA 4CBUA 1NG9A 1FDNA 4YFUA 2HHWA 1HNWJ 5AQZA 2CH5A 3VGMA 3FC9A 1S0OA 4B3RK 3O9TA 3KMSA 3DDIA 3PSIA 1I94F 4K4TA 3GPAA 3BN4A 1TL7B 4IR9A 3ENQA 1S1VB 3ZC4A 5LL6d 5LJWA 2A1SA 3TSPA 3ITHA 3VVUA 2AZ3A 1HR0F 4Y2AA 1NJIT 3SMZA 1E4FT 4BC9A 3MD1A 4OV1A 3RMAA 1WC1A 2HFSA 2UXBK 5AJ3J 5IT9Y 3UD4P 4USTA 4RW4A 2CQ0A 2CNOB 3RSEA 3PJWA 1NH7A 3SBGA 3A8KA 2E2OA 2D3OR 3V9ZA 2AYMA 1CJUB 1Q7YO 3TA2A 3Q24A 4FP9A 2V69A 4NEYA 3A5LC 3UCUP 1S4EA 1H6KX 4KC5A 2GS8A 3OD2A 3J8AA 3M4XA 5C5JA 2DIUA 2E5JA 2M0GB 3ZSXA 4X4RA 1QAJA 1LW0A 2LA6A 4DLEA 3SQOP 5LSRA 2O66A 5DM6L 4DU4A 4X64F 1YTUA 3K89A 2ZH7A 1GOBA 1T03B 3TI0A 1BO5O 2F7VA 4JK8A 4Q2LA 4RBVA 1GX5A 2DIVA 4FLWA 2XY7A 2ZGZA 4FK0A 3DLEA 4Y2CA 3HRGA 4E3SA 3R1HA 1ITPA 2EFPA 4LF7J 1EHWA 1RT5A 1WC3A 2IHR1 1T05A 2RDIA 3MM6A 5DLFA 3TZZA 5C24A 4R5PB 3KUEA 4WE1B 4EHUA 2HFZA 1XWLA 3HZ6A 4MK7A 1AUDA 5T41A 1N5SA 2EC0A 4G1PA 4B9QA 1R8PA 1S9GA 3Q8PB 2LVWA 5KFOA 4NYOA 5KPRA 5B08A 3KTQA 2AX1A 4TKTA 5KFNA 4IQXA 5DLGA 4FWMA 4KH6A 4FS1A 2X78A 3GONA 4I56A 4CLSA 1JCGA 2Q2RA 4TY9A 4RU9A 4K8ZA 1JLCA 1VK0A 8RUCA 4EEYA 1RLCL 3A1YG 3WXMB 1VSMA 5ITHA 4CFDA 4JKBA 3ET6A 1I94K 3MECA 2R7UA 1WHVA 3BKFA 4XTTA 3CCES 2A10A 1MMNA 2WC9A 2QGFB 1HBUA 1GLLO 3N5FA 3VWSA 1NB2A 4WU2A 2KHOA 2O8CA 1FKAF 3BREA 1XK8A 4E7HA 3TOQA 2CJXB 2K2PA 2DVIA 4M5JA 1QTMA 3VQ7A 2OHDA 3BQ0A 3A4TA 5GAEU 4MDAA 2WVBA 2OPQB 3MM5A 2N7CA 4YR2A 4ECZA 1NRKA 1D0EA 1GNKA 1Y10A 3PW4A 4WKYA 5ETPA 3NGDA 2ZKTA 2XMUA 5KAKA 4CZFA 4U6PA 4JB8B 1WDTA 2DFEA 4YB1P 2FBTA 2NRRA 3QT8A 4KHUA 2V51B 2J0WA 3FZLA 3L4BC 5GAGP 4CJFA 2X74A 3EM1A 2K8GA 4MAKA 5AQUA 3P4IA 4X64K 1RBSA 2VC1A 4ZVPB 1RAFB 4TYBA 3DRRB 2DXFA 2NSCA 4PRFA 3D68A 2WBRA 2HVZA 6FD1A 3U9DA 2FLPA 4KV8B 3ZNJ1 1YRXA 4YB5A 4DV2K 2ZC3A 2M88A 2KT3A 3SIPB 4WWSA 1FRLA 3CD6N 1FJGJ 1H72C 2DNQA 3KHRA 2F9JA 4DV0K 1ZAXA 2UV8A 4IG3A 3H20A 1F3FA 2XG8A 1S1XB 2V4QA 2EKNA 3MFHA 4V19X 4FJKA 3M6XA 4GVEA 4OLOA 2UUCJ 2R7SA 2CGJA 4AL7A 4CHOA 4YY3J 4BR4A 2BXJA 4DQSA 2VBXA 4X4UA 1TL4A 3BO3A 3R27A 1M0SA 3KUGA 4IWVA 1ZBUA 3TUJC 3N4QA 4HI1A 1X3MA 5HQLA 3ZETB 3KLIB 3SUNA 1ZPVA 3RAXA 4YORA 2DR9A 3N4WA 1S72S 5AQWA 2QWQA 3G9CA 3ADAC 3GB0A 3KWGA 1UZHA 4QIFA 1TUWA 4DV7J 1HNIA 2OGUA 1EKRA 3PUFA 2CNKB 2YNFA 2W4DA 1GX6A 1XBWA 3O5TB 5DDQC 1QAIA 1R0BG 4K4UA 2VCPA 2KHCA 2HHUA 2FHMA 3CULA 1HYSB 2UVVA 2X1AA 3I32A 3T7ZA 1RT7B 3QT6A 4CI0B 4JKGA 4MIBA 3BS9A 3K7RA 4HT7A 2X3GA 1GMWA 4WFXA 4A8XA 2RS8A 1SKRA 3BV8A 3EVMA 2J6SA 2ZJPQ 3PW0A 4WP8A 2P5VA 3CIPA 2ASYA 1QE1A 2HF4A 3I4PA 3M6VA 3F0NA 3VOVA 4TY8B 2YQ0A 2IVPA 4BBYA 4JI5J 4GVLA 3G6XA 4EAHD 3C95A 1CEZA 1RBTA 1EQMA 5AQIA 2ASPA 4C8NA 3VQTA 3AO2A 4J9SA 1URNA 2IY5B 1N48A 5GAHU 3MMBA 4NRUA 2N4DA 4P75A 4HLBA 1ELOA 1D9FA 4OYOA 4NO7A 3OY9A 2BABA 3NCIA 3CJ5A 5ADZA 2GZOA 4M7YA 3DI6B 4B3RJ 4ZVUB 1KVCA 1U2VB 4X62F 3D6RA 1KAZA 4KIAA 1JLGA 4U9RA 5IT4A 4ECVA 3H3NO 5GIPA 3HJVA 3WX8A 1HWJA 2DH8A 1TL1A 3IXQA 3CM5A 2P9IB 4F2RA 1NJYA 4NYNA 3TJ8A 3OYFA 2BBEA 3F44A 4RO0A 1GAOA 1NSPA 4KB7A 1MG7A 4EZ9A 3OW2M 2UXBJ 5G4DA 4DPTA 2DK2A 1CG2A 3CJSA 4KH5A 1NK7A 4ISEA 4CFAA 2EEYA 1G3OA 3GE9A 1V3RA 1H7XA 1YWXA 3TWZA 2EFNA 4CECA 4Y1DA 3POTB 3BGOP 2NQPA 3QBXA 3CF5Q 2LA4A 2D0PA 5HL7L 1E6YA 5E3RA 4J9RA 3QZ8A 2RKIA 4TVAB 4LF4K 2XI2A 4UY85 4C8ZA 1V6HA 5A6PA 4ID5B 3UN2A 1KLNA 5AE3A 3CCSS 2G2OA 3OW2R 1UFKA 3FCHA 2X1GA 4QS9A 3AVLA 2NRHA 3FEYB 4BQLA 4CZLA 1VI7A 4ZPDA 3HJFA 1U7LA 3FZHA 4IOBA 1VC5A 4BC3A 2QL9B 4CEOA 2GWJA 3M6UA 4FVMA 1TUUA 4CLUA 5AFUA 2IC3A 3ITHB 2WVEA 5DZ7A 1HBMB 4UQTA 3CPWR 2ZC4A 1IKVA 4BWJA 1J6ZA 4RW4B 3AO5A 3NMUA 5D3GA 2FPHX 2KYZA 3RSEB 5D78A 1HL6A 3D6HB 1G4CA 4DU7A 3THWA 2G8WA 1WBBA 3OYLA 1IG9A 3NWRA 3VCDA 3OYBA 2RRBA 3WNEA 2RHKA 2HAIA 3W66A 1X7VA 5KFCA 4L3QA 2MSSA 1NDCA 1LW0B 3M32A 1YK9A 4X62K 2E5GA 3OVSA 2GJIA 2Q31A 4OYIA 1VQ7N 2OIHA 1SL0A 1X5PA 2M2BA 4ZPCA 4BR9A 4OQJA 1PYOB 4H5NA 2W2QP 4YOWA 3CQ8A 3H5XA 5L46A 2QFJA 1N8RO 2WSCC 4FJMA 1E4GT 3CJCA 1K0TA 3D0IE 3VQ4A 1FNMA 3DLEB 4CLPA 3C6TA 3KLGA 2EC2A 2HRTA 2VFTA 3PCOB 3FVYA 1BQXA 4B3TJ 1T05B 1OY8A 3MM6B 4A8SA 4H8KA 1M5HA 2KG0A 4FKYA 4Q0BA 5KFPA 4F36A 4MLEA 1S9GB 2J9CA 4USUA 5KFIA 3WIVA 3R5CA 3DJCA 5H1SV 3BJYA 3ZZ0A 1X4DA 1N56A 4A5AA 4JLHA 2X7IA 2EXUA 4FJHA 2CQDA 2HQFA 3CUNA 2YKNA 2XGQA 1JLCB 1HWUA 2W8LA 4DSKA 2BM1A 2DH9A 1PIEA 4FJGA 4FF2A 3ZTSA 1FERA 2IVYA 3R1XA 3ET6B 3MECB 5KOXA 4IH7A 4ZVHA 1RDRA 3FZ2A 4BE1A 4DV2J 3RRKA 1F5CA 4K8RA 3EDRB 3DM2A 2DNMA 4JHDB 2YKMB 4C0HA 1O51A 2ILZA 3TR8A 1HBUB 1VHFA 2AIRB 5E3AA 4DV0J 3K8WA 3TANA 4C8OA 4CK3A 2HK2A 2OP5A 1FX4A 5B0AA 1NSKL 4YR3A 2Z2LA 3GV5B 3FEXB 5CD4H 4NCBA 3BBFA 4JI7F 3IO1A 5ELZA 2XZWA 3PYFA 3LP1B 3SSRA 3HF5A 4UQGA 2RPIA 1LFPA 3QT5A 4RUCA 1VK8A 3QESA 4LF6F 2IJFA 2H4YB 2CPJA 2ZDOA 2JC0A 3VAFA 4PR6A 5J1EA 1YZ6A 5AZJB 5F8LA 4H0TB 4BC4A 3HHLA 3SDEA 1ESVA 1QUPA 1BQNB 5IXUA 4J2EA 1T94A 1TFYA 3A5OC 3H2LA 1VJQA 2XMTA 1CULA 4NEZA 2UZAA 4U96A 4UT4A 4LSNB 3SUPA 4DR4J 4B9NA 1VSIA 1XQIA 2YWGA 3QETA 5FJ4A 5KG4A 4FXDA 4JRPA 3AOAA 1WSIA 3BGUA 1TMJA 4KT0C 4G3IA 5ADXA 3ZEUA 1WF0A 4GRSA 2Q0UA 2R7RA 2OANA 3SSQA 2FHKA 2JWKA 2HWIA 2D7SA 1VQ9S 3SMPA 2JLGA 3PKMA 3OFHA 3FSXA 3MCSA 4KHRA 3GFZA 1RT2A 1XNQF 3LP3A 3R8EA 5RUBA 4BC7A 3JYTB 4DB3A 2W4CA 1ATRA 3HD2A 4J91A 3HCXA 2FSJA 5T7LA 1VQ5N 2MB0B 5KFGA 3QGPA 1ZAWA 1NBEB 3HVRA 3D4JA 1CJTA 5ETVA 4E7LA 2MZJA 1HRHA 2VASA 2YHAA 1VQSA 4DV5F 1HNIB 2R42A 4EWTA 4XIUA 4M94A 3QZ7A 3UCZP 4ALZA 1YVUA 3VQEA 3EL2A 4LSZB 3T3FA 4RWWA 1OH8A 3V1QA 4DCPB 2IYGA 3ZX0A 3BEGB 4X65F 2QWLA 5KPZA 4WIIA 3HK2A 2ZWPA 2H51B 3M2UA 4JI4F 2DGWA 4WFYA 3OTBA 4JI7K 5LJ5Y 3VQ6A 5D4LA 1AZSA 1I3AA 1WF1A 3HHLD 5G0RA 1QE1B 1VQPS 4NI2A 3W8PA 5FLXY 1FRJA 2LXUA 4BRLA 2YHBA 1BY9A 3VHQA 4LF6K 5BRHA 1RWKB 3J81j 9ATCB 2YNHA 4ZITA 4M1KA 3P38A 4DPYA 2RDJA 4XH4A 1OS5A 1U48A 1EWRA 5A2QY 3H1QA 4Q43A 4KB0A 4CGHA 4LF4J 3ZZYA 1RHMB 1FCAA 1F3VA 4EMDA 3FUYA 4KB1A 5DZ6A 3CC7S 7FD1A 1MN7A 2A5XA 3HT3A 1BC6A 1NMEB 2JDJA 2VH7A 1TAUA 2QWNA 4ICLB 3C0BA 3MDFA 1PO6A 1P8GA 2PGCA 3I31A 1TL1B 4CF1A 3MAHA 2MKYA 5CY4A 1RWWB 3VVTA 3S7RA 1NK5A 2W24A 4O4RA 1YXQA 5KFAA 2I2YA 2YJFA 3K57A 1JX4A 3CJ3A 1U1MA 2ZJQQ 2DHAA 5DS7A 2BQUA 3HVWA 1BI4A 3R6LB 3MF5A 1QVFM 4AF1A 4YNQA 1XNQK 2BACA 2QK9A 2P5OA 3FSYA 4Y28C 3RB0A 4QS7A 1JLAA 4QPTA 2CDQA 1KVJA 1W0HA 1NJIO 4M3UA 2LU2A 3H2VE 1T6DA 4BR0A 1RAJA 3CPEA 1T9XA 1YBUA 1OJ4A 4OHYA 2QI2A 1V3ZA 1EP4A 1E6YB 2H3GX 3PNIA 4W92B 4FPBA 3CIZA 1ZPWX 3G71S 2UXCF 2WAQD 4X62J 3VGTA 1Q53A 3F2KA 2VKZG 4GC6A 2ERRA 4CIEA 3OVAA 2L41A 3GSDA 3ZX3A 1WTFA 5JMVA 1LAVA 3SI8A 3WZ0A 3VALA 2V2VA 5SWMA 2UV8G 3OYDA 4Z4IA 2FYXA 1XR5A 3O44A 3BPDA 3GFXA 1JLQA 3H90A 2XM3A 3HZEA 3C7NB 4JI4K 4ZLLA 2IC3B 3PM9A 5BPLA 2PFDA 3CWJA 3B6PA 1X0PA 3Q2TC 4PUOA 1IKVB 3LDPA 5AQYA 5C15A 4JI8K 3T1YF 5KFTA 4CHPA 4FJ8A 1ZETA 2ZJPL 2XCAA 5J1PA 1PGZA 1C0GA 1WKJA 4DTMA 2DR5A 3FGUA 4HTUA 4OZ0A 1IKXA 3D1HA 3L3CA 2B56A 2IDLA 2R4FA 5HOOA 3B4MA 3BDPA 4TLQA 4IOXA 1D1UA 2YPZA 3SXLA 3PJ9A 3QIDA 1N32F 1RADB 3NNCA 2OI2A 3VEXA 1KVKA 3ZSZA 4C8YA 1X1PA 1SUQA 1ZM4A 2YWWA 4NASA 4PG8A 3P1GA 4NLYA 1S5JA 2JHEA 1JKHB 2Q6CA 5BPNA 2HS0A 4N7TA 2CGKA 4C0OC 2KFZA 3H2UB 2OUGA 3O9SA 3J7AP 2F1FA 3RG6A 3CJKA 4CTAB 4OFZA 3QNNA 2HGMA 1VSKA 4FJNA 4TSXA 4DCOB 4CQ1A 4MFBA 5JXSA 1HHQA 3KG1A 3F9MA 2FD2A 2HVDA 4NZ6A 2XNQA 3F56A 2FVSA 3RU0A 2FY1A 3SCJE 3BY5A 4ID1A 1OQ3A 4LRBA 4HVZA 2UXCK 3THYA 1UOCA 2OPSA 2HQGA 2IAJA 2DY4A 2FB0A 4JV2A 2J76E 4DI6A 3CF5L 2YKNB 3C66A 4IOCQ 1DQ8A 3TVZA 1KR4A 4F67A 3M8SA 1HKBA 4EO6A 3RW7A 4FZZA 3D2FA 1RAOA 5DGBA 1XIQA 4YHHF 3G4SN 4DL5A 2WZ1A 5GAGI 3SZ2A 3M8YA 3VGLA 3FBFA 4RU2A 1NLKL 2PO4A 3MI7X 3P31A 1VGYA 4QU6A 4ED2A 5EHHA 3L3UA 2CG4A 4XDCA 3OV7A 3I6PA 2J5AA 2LEPA 1XMOF 4X4VA 2A6MA 2BJDA 4DPXA 1SVDA 3BPSP 4L73A 4MLHA 4ZVQB 5HMXA 1S99A 3RMDA 2DD8S 2V50A 5KRSA 3ZCMA 1S49A 4LD0A 3MHYA 3BP8A 2J6UA 4D3HA 5IWAF 4F3QA 4EP4A 1TK5A 5GADP 2C3OA 4G9ZA 1N32K 5AXKA 4J9QA 3SDEB 1MW7A 2VG5A 4PG4A 1YJNN 1PAUB 4ANEA 3NS7B 1EO1A 4J2BA 1U49A 1TK0A 3FCWA 4BR5A 4HR2A 5MLCV 5AE1A 3MR3A 3UVJB 3QICA 2H3EB 1RWUA 4DZ6A 5KFWA 3NHGA 2G8VA 3FDSA 2WUSA 3ZEUB 2YNIA 1A5WA 4GKKF 1T3VA 4H0XB 1AUSL 5LY3A 4FM0A 4DTXA 5A0YA 4CIFA 1KQGB 1FA0A 2FF3B 2BEFA 1DEJA 4W90B 4FLYA 3GJSB 3TUPA 4ZVSB 4ZOSA 1H2VZ 1R8CA 9RUBA 1MWQA 1S22A 1WOOA 3ZSQA 2G8FA 2IBKA 4Z0UA 4H4OA 4U67Q 1CJTB 2QZ8A 5F8IA 4WK3A 4OKKA 4C11B 4TU8A 4TQRA 2ATLA 4CGGA 4XK8C 4WF9L 1O6XA 2Q3PA 4WFZA 1PJ6A 2E6MA 5K8MA 3LF0A 1R8AA 2QEXS 3BKTA 4CEDA 5GMKa 3DOMB 1AYEA 4ZIWA 2CA9A 3VQ9A 4CZEA 3WEEA 5C25A 3CFPA 3TZWA 2HYIB 2IOCA 3LGMA 3Q22A 1XMOK 1X3NA 1XMQJ 2E5LF 3M2UB 2KW4A 4I67A 4CIGA 4FOIA 4NYFA 5L1IA 3CG7A 4ISGA 4Y65A 2E1AA 2XSJA 4NI2B 1U47A 1KLMA 2BJ1A 1F9FA 3QMLA 1UEVA 5E3PA 1V5IB 3NS5A 1RCOB 2MJUA 3MGJA 5BXIA 5IWAK 3OS2A 2CJBA 2OYQA 2QM1A 3NWGA 2PN6A 4WU3A 4OI2A 3GMGA 1YJVA 5KFVA 3QJPA 3KJFB 3QAUA 2DGQA 5E3QA 3ISNC 2DNRA 2MLZA 4OZJA 1VQ6S 1NGAA 3VEVA 2GMLA 2AX0A 3OSNA 1OPZA 5LMUF 1FWLA 2O3DA 4PAAA 3CETA 1UA0A 1TKDA 2QA4S 1RT4B 4HH1A 1RT3B 4RTFD 4FBTA 4JI4J 1EKSA 3FR0A 2W8KA 4GKKK 3Q89A 2AGOA 3CCJS 2W6KA 4FWOA 3DRXA 4KY3A 2X6NA 1VQYA 4P74A 4JI8J 1Q78A 2FJVA 2IA6A 5B09A 1SC3B 1WAJA 2YWFA 2ZUGA 1DKGD 1JJ4A 1JXBA 2GVZA 3HP9A 4EK2A 2CPHA 1JLAB 1J54A 3CMAS 1DJ0A 1SCJB 2RILA 3THVA 2H5JB 1BOTO 2RU9A 1IJFB 1SH0A 1EP4B 2U2FA 1NLVA 1NGBA 1S77D 4BC2A 3KLFA 4DQQA 1SQFA 2XULA 1RTHA 1RGIA 4I0WA 4M3XA 1BDGA 2MPUA 1KQFB 3KG0A 3EUNA 1VQ7S 2QLFB 1PYTA 2BA9A 3ENWA 4PCQA 1GH8A 5AQXA 3GCWP 2BJ3A 4CLWA 3U27A 4DV6J 3J7YI 1JLQB 4I9LA 4CEEA 3T6BA 4DEZA 3VGUA 2E5LK 5F8HA 3MPYA 3SFGA 5KFRA 3OTDA 1VQON 1FXRA 1WDDA 2OJ3A 2MQMA 4B9LA 1RDAA 3OYAA 2NXUA 1U4BA 1NK0A 2H65B 3HVAA 1TL3B 3SV3A 4J9KA 4CJRA 2UU9J 2P2CB 4CM0A 1RT6A 2G2ZA 1K73T 3D2WA 1JCFA 3V9WA 4N47A 4PQAA 2Y9HA 4W5QA 4OX9F 1IKXB 4JV0A 4AQYJ 4CW7B 4Q5VA 3P8BB 3VGKA 2F9DA 3LGHA 2I38A 2RE1A 1VQ4S 4OX8A 4DV3F 5LMUK 1QSSA 5AQHA 4Z4FA 5KFJA 1SPBP 4WYBA 4OHVA 4ILLA 3MWBA 5D4OA 3FBCA 4HH0A 1NHUA 1SUQB 1BCMA 5DQIA 3DHWC 3K0JA 4DR2F 1F5AA 5LMNJ 1WEYA 3R3LA 4RW9A 5GAEP 1I1GA 4XPEA 1C1BA 3FBEA 2DFHA 1WSEA 5HN0A 3MFIA 2C3MA 2V7ZA 3DRPA 1IBKJ 4DUZJ 4ZPBA 1C2PA 3M6WA 4NX9A 1FF2A 5BR8F 3G86A 1QQNA 4YOEA 2YBVA 3AB2B 5GAGU 5KFHA 2VODA 5E41A 3EPIA 3JXUA 2ZH8A 3DLLQ 4CLYA 1N32J 4B17A 3PFOA 1VSLA 3THYB 2OPSB 2IAJB 4WYWA 4FJIA 1OH6A 1A7GE 3ZFVA 3CGIA 2KO1A 4FM1A 4UZBA 1KSPA 5K5MA 2K06A 2Z0GA 2E2PA 2ZFHA 3N28A 3SSSA 3D2FB 1EARA 4C8MA 2E2QA 3Q23A 1RABB 3H5YA 4M3ZA 2E7XA 3P5TL 4XDDA 2M3DA 4DU1A 1EB0A 4RNMA 1BHNA 1ZBFA 1VOMA 4CFCA 3Q86A 2E1MC 2LEBA 1KXPA 4I4BA 1VBYA 3CHWA 5DDPC 2FUG9 2VA2A 3KHLA 2V63A 5EX0A 1S6PA 4WQ5C 4OYWA 1C6VA 4CD3A 1Q82T 4A48A 3VEZA 2HBQB 2DNHA 1ULRA 4BE0A 4O5BA 3LPEA 1RKJA 4NA3A 5HRNA 3PRVA 4OKJA 1Q1KA 3LW5C 3IWLA 1NEEA 1YTAA 4HUGA 1XR6A 1UPPA 4A8MP 4GVMA 4DR3F 4AD6A 2Q79A 8ATCB 4DV3K 2W7OA 1VQ5S 5IQ6A 2VG5B 3ZSRA 2ZOMA 1TKXA 2KXHA 4FJ7A 3CC2N 4FWSA 2DHGA 2FJBB 4DR2K 2AF6A 1YGYA 4LR8A 3FJ2A 2H9ZA 1HARA 5HSPA 1BA0A 2Z2YB 4BVPA 3GYXB 3MPDA 1FNXH 2GVDA 3M8PB 1VBXA 1VQLN 4M8LA 2CPIA 3LAKA 2BANA 3CCMS 3M3ZA 3VAJA 2Q1LA 2YNIB 2RF2A 1PYSB 3L95X 4OI4A 2PE8A 2Z57B 2P9CA 5A0YB 1N6QB 3A8IA 2XQCA 4QQBA 5BR8K 4PL7A 5GAHP 1NMDA 2F8SA 2EW9A 3NGYA 1JNZB 4HTIA 2BZ2A 3UNGC 4DMZA 3WIUA 4JNEA 5HP1B 4KHSA 5SUHA 5FRNA 4EHTA 2XMJA 4CM2A 2GMJA 4H4OB 2L3MA 4B1ZA 5KG2A 3MMVA 4CLLA 2WRMA 3IFRA 2A3ZA 5KFXA 5K8PA 3VERA 1OH5A 2W01A 2J8AA 3KVGA 3O4QA 4WBFA 4IOCL 5M2RA 4BR7A 1CJVA 1X31C 1JL1A 1DY3A 3AVCA 2ADCA 4ENOA 1IJJA 3D3CJ 4B3SF 2P9KA 3CDWA 3WEEB 1FVSA 4A8FA 4OHXA 2HBRB 4B02A 3SV4A 3T41A 1TKZA 3VQAA 2DGXA 2CNLB 3C14B 2HHQA 3FKBA 4ED6A 3CJ9A 4CJPA 3MEGA 1HHTP 5K8NA 5CXTA 3ZT1A 4BRHA 5DMRA 3FNNA 2XSJB 1RBLA 1S79A 3ATVA 1KLMB 4M5HA 4O44A 2BJ8A 5AQVA 3I8BA 4CESA 3K5PA 3RB4A 4CF0A 1CLQA 4DSEA 4ED5A 3X3UA 1NHKL 4DR3K 2VIHA 2BOPA 2RUGA 4KI4A 3NF6A 5I3QA 1R27B 2VJVA 4PY5A 3V81A 4AHCA 4DPUA 2A3JA 2ZH6A 3QSYB 5KG0A 3NY0A 5JLFA 3QEWA 4WFNQ 1H74A 4LRFA 2XMVA 3VQ5A 4H4MA 4QAGA 4NZ7A 3RB6A 1UA1A 2WOMB 4KAIA 4YDUA 3R3TA 1B0VA 1S9FA 2M9KA 3RRHA 3VA0A 5DG9A 3NAEA 4NA1A 2YX6A 1X4HA 4O23A 1DTQA 5H1SQ 3ID6A 3OYJA 3D5MA 4DR7F 3O6WA 1UW9A 4DR1F 4Z4CA 2VOPA 2FVCA 2Z58B 2I7PA 2VWJA 2XHBA 2W42A 3GR1A 4JK7A 1SXLA 3H0PA 2X1BA 1RWMB 2B9YA 4L76A 1TELA 2HBYB 3PEHA 4JI2F 2GJFA 1XJWB 1NK9A 3NBPA 3SJJA 5I4MA 4J2AA 4KBOA 1S12A 3DMJA 2E9TA 2IVNA 2J9DA 1KVBA 3V6HA 4LR7A 2QA4G 2CQ4A 3CJ7A 2ZOGA 3LTOA 4HT5A 3J7YU 1UFWA 1N5QA 1TU0B 3ONQA 4BRAA 3TTCA 1H3DA 4DCHA 4ZLNA 4LFCF 4RBTA 3BH7B 2C2KB 2KB2A 1DQ9A 2L48A 4OLPA 4A8OA 1RTHB 4H5VA 3M1VA 1UMJA 1S1WA 2FLNA 4NB4A 3A3NB 5LXRA 1HQUA 1Z2ZA 2GQQA 4B3SK 4ILRA 2UUWA 2E1PA 4A62A 4DKWA 1ASVA 1SJ1A 3ZZPA 4CEQA 4KGMA 3ZZRA 1XHZA 1JMTA 1M5SA 4DL2A 2BE9B 3R9PA 1J5OA 2D9OA 3GILA 4NXMJ 4OX7A 3LQVA 3UI3A 1XC9A 2MZTA 4CJLA 3MR7A 3NCPA 3OYEA 4E7JA 2L9NA 1F0XA 4ZDNA 5BR9A 1WWHA 3L7UA 1R8HA 1Z25A 2QTDA 3I0RA 3VGSA 1R31A 1RT6B 3HX9A 1HI8A 2Z1JA 4OZNA 3NDKA 3S6EA 5KFSA 5DRKA 4HHUA 2MXYA 3IDHA 3BEXA 3CCEN 4OYMA 1SBRA 1SL1A 2HVHA 4OVLA 2R8GA 3QLHA 3I56S 3MK6A 2DNPA 2ZBPA 2D4WA 2EFGA 1MROA 4CZJA 3AY0A 4FZYA 3V9SA 3G4SS 3WQUA 3G6ES 4W5RA 3EJMA 1UTAA 1WLJA 3M30A 3TABA 4DR7K 4O3NA 4OMFG 2H1YA 1B92A 2BQ3A 3CE8A 1NNEA 4DR1K 4FYXB 2P51A 4HTJA 2XEXA 1K8KA 4Z2XA 2IIHA 2XZTB 5GINA 1BCOA 1C1BB 4CNZA 4BLGA 2V7YA 2VWKA 4ZK7M 2C22A 2ALZA 2KYXA 3DRPB 2B0GA 4JI2K 3DXMA 2VA3A 3RGIA 5CZ2A 1CPZA 4R0JA 2Q97A 4FW1A 4NA2A 2FQQB 4LFCK 4ZVEA 2R8JA 3SQ1A 2LFVA 1HWLA 2GHWA 3IBFB 2FBYA 4V19S 3TA0A 2A6AA 5EOYA 3D6FB 1UVMA 2ATCB 4RZRA 5F3ZA 3PSFA 2IIRA 4DR2J 2PEBA 4LR9A 3FQKA 4J9LA 3RAQA 1FESA 4RW8A 3TAEA 1Q16B 4F3MA 3MUMP 3VQQA 3UE2A 3RBEA 2XMMA 2O8EA 3NVMA 2NYIA 1CC8A 5A8KB 2XB2D 2FTRA 2AJFE 2YKPA 3R6MA 2HIYA 4AUKA 1S6PB 4C1NI 5BR8J 2AJ0A 2AGQA 3GE1A 1S72N 1CJKA 3W5YA 4ILMA 4K42A 2OZMA 2DTUA 3GIMA 1YITS 2VBWA 2CQIA 2B4JA 3EZ5A 3CD5A 4FXWA 2UP1A 3E3XA 4W98A 1S1UB 3RJMB 3E9PA 1SI9A 2W4PA 3F9KA 3QO9B 3JSRA 1TTHB 4R8UA 2Q36A 1M5KC 2QLBB 5HROB 1WC4A 1WHYA 3PX4A 3CCVN 3C16A 3D2EA 5EX5A 3GLJA 2EG1A 4ED3A 2IGIA 4O8UA 1NZAA 4PKIA 4K5RA 3O9QA 3HKZD 3I4HX 1J5EK 4ZVGA 1H2UX 2GVDB 3DHXA 3ZSVA 4JS4A 2ZF5O 2D0CA 2XY6A 4CGIA 2HLTA 1FJ7A 2BANB 3AD7C 4ZP6A 4HACA 4PG5A 2R8HA 1AA1B 2YHWA 5AJ3F 2RF2B 1AFIA 1GQEA 1Q5YA 1R43A 3ILOA 3CJ2A 4ZP8A 4QR1A 5CR4A 4E0DA 1D3WA 3EYZA 3SMSA 2LCWA 4DSFA 2QFIA 2QWRA 2KKHA 3HZGA 2LU1A 3CTRA 4OYZA 4LH5A 3GIIA 3QNWB 5LOQA 3L8BA 2G0IA 5LSLA 2VPZB 1YLXA 1BLUA 2CWXA 5ETNA 3P83D 1E6VB 2OA8A 2V34A 1JLBA 4FJJA 1YBAA 4JN4A 3DLLL 3CCUS 2VYPA 2MKHA 3A0IX 1R89A 5AE2A 2YJEA 2HRUA 4HUFA 3L2UA 1CJVB 4ITSA 4P2MA 2OMLA 5DGAA 2Q43A 1VC0A 3NFAA 4NCAA 2GUIA 4AL6A 1Y0HA 3F5TA 3JQJA 1WN7A 3LM9A 4KQZA 4HWIA 4IH5A 4FO0A 2FF6A 1TKZB 2W41A 2BRKA 2RT3A 3R5AA 2G4BA 3QEXA 3H8YA 2E5IA 1FTRA 1RDCA 2ACYA 3MEGB 2HAFA 4YUDA 2RQCA 3EGZA 2QMUB 5M1KA 1NSQA 1HHSA 4RW7A 1Q7LB 4BR2A 1C1CA 4O44B 2GJ2A 1R6YA 4TNOA 3PRBA 1B7YB 1G6BA 4MKAA 3RWUA 4LY7A 2W9AA 2UVUA 3K5OA 2O8FB 3U7JA 3G8TA 4C6AA 3T5HA 1RAEB 3V4MA 3QEIA 4CO1A 1RAIB 2AJ2A 3V81B 4KGVB 3MM9A 4H4MB 2IM3A 1IWGA 3NOCA 1GLDG 1R7IA 2C2OB 5F9LA 1XTZA 1YRTA 3C2PA 4R0EA 4BRIA 4IG0A 1W9HA 4ZVRB 4R5PA 1RBOB 2D1CA 3OJUA 1KKHA 4KHYA 2HOEA 5AJ3K 4F4WA 3QERA 5D77A 4K4YA 1OPIA 1S59A 1Y5NB 1X9MA 2HW3A 1C4CA 2W9CB 2PMZD 1D8YA 2E20A 3PLAA 1EZZB 2JWLA 4DR5J 1FNOA 2GMHA 3OXGA 3NBPB 3PX6A 2EVZA 3UPFA 1NO8A 1UVLA 2KL8A 1QM9A 3UN5A 3A5MC 4M5NA 2R7QA 5TKYA 2DNZA 4FS2A 2CJ9A 2DRDA 3WQTA 4JV5K 3JTOA 3B4DA 5L38A 2IBOA 4C9DA 1WOPA 1RWPB 2DFFA 4AHUA 1N4LA 2DYAA 1K73O 3M1VB 1S1WB 1N54B 4LMZA 1ZA1B 4RL1A 3JTPA 3Q7CA 2A2DA 1ZH5A 2D9PA 4DR7J 1F6TA 1JXLA 1XC3A 2WBMA 2BE7D 4J9MA 1XI1A 4DUYJ 4DR1J 2CVEA 5E3CA 2OPQA 2JSXA 2G2YA 4AM6A 3QEVA 2H5IB 4P71A 3ULDA 2OZSA 3M9NB 2W6LA 2HVIA 5C0YA 1YJ9N 3GCXP 2EFOA 2UUCF 2KJVA 3IWXA 4YY3F 1YHQN 3ENAA 4QJVA 4ZP7A 4JI1K 5AFUH 2LQBA 1DARA 3S01A 4CJWA 2BW2A 1FHTA 5MLCQ 5ETTA 2V6AA 1U04A 4X4QA 1YIJS 1PC4A 2YCHA 3NGUA 2C2NA 3NGSA 2W7AA 3FBBA 1WAFA 4DV7F 1BGXT 1J27A 3A13A 5JJBA 3D0PA 2VG7B 2QA1A 3U1NA 4JD2A 3QLHB 3DLBA 3TRGA 4LQ9A 1ASWA 1MROB 4FSVA 2Y1RI 5CZXA 4BRNA 3C65A 3BGRA 1L3KA 4RNHA 3MM8B 3G96A 4DN9A 4WFNL 2FZKB 3I0SB 1T95A 1OSCA 1QVGM 3K8VA 2F9WA 1QD1A 2XLKA 3DOLB 2Z4PA 1HNZJ 3VESA 4FK2A 4NLXA 4DDFA 1HUXA 1K8KB 2HGNA 1FO1A 1SQEA 4ECQA 3M8ZA 1SJ3P 1SIWB 1RP5A 2V2KA 4M5KA 3ZETA 3KLIA 4CGJA 4NLOA 1Y7PA 4JI5F 3MWPA 1HFEL 4EBDA 4WFBL 1SKWA 1XR7A 3J81U 3H98A 4QOTA 1SIZA 3I55S 1BMQB 4PYAA 5KFMA 5B0EA 5AR0A 3QFPA 3AA9A 1L3TA 5DG8A 2NNWA 3F73A 1ZA2B 1NAQA 1KTVA 1Q82O 2CFXA 1NPPA 3EVOA 4ZCKA 4USHA 1V5VA 1VLOA 4IDHA 1VSHA 1RT7A 4DPWA 1O0PA 2HBMA 1J5EJ 4RW8B 1O1WA 4IBNA 2L08A 2B4PA 1XHXA 2LMIA 3G6YA 1VQ9N 3BO4A 2O8EB 5KFKA 3S9HA 1RHUB 3JAMU 2DRBA 1SH2A 5ETRA 4TY8A 3W60A 2UXBF 1T7PA 4XEIA 3NGRA 2YQ3A 2HHHF 4JI3F 1QDUB 3NLCA 1K9MT 4YY3K 4P73A 3E66A 1Q4RA 3G6VA 1R0AA 1BG3A 2W2MP 4NE9C 3HSDA 4QW8A 4ZPAA 4H0PA 1FXLA 3SEOA 4O0NA 2P9UA 4K2XA 3GSIA 4AHSA 3BB5A 3LDOA 2QC3A 2YKQA 1CSJA 5GMDA 1NBWA 3DI6A 3EE8A 4HDGA 1U2VA 4DV7K 1Q95G 3MN7A 4DTPA 4WCEL 2ZDPA 2NZCA 4OZ3A 1UKUA 3BKUA 4RWXA 3HHNB 2B5JB 2MYFA 1T44A 3IAM9 1F21A 1WC0A 4IFYA 5C10A 3DLKA 2DGUA 1ILYA 5LM7E 4I7FA 4PG7A 2QSWA 4QR0A 1BA1A 2DR6A 2QN6B 4DQRA 4J37A 1OY6A 2XO7A 3C6HA 2PC6A 2R8KA 2PBDA 4DUTA 2IVOA 5KFQA 5IFMA 5IT9U 2DPNA 5KT4A 1GLJO 4HACB 1P27B 2BR0A 1Q18A 3CVKA 4JI5K 1Z1ZA 3NH1A 4NXNF 4KSEB 5CCMA 1QHAA 3OLBA 1GOAA 5CE3A 3PYEA 2MKJA 5F41A 3TO8A 2GELA 4DN0A 1RA6A 4FOEA 4FPIA 4BROA 5ADXH 1WG1A 3Q83A 1LW2A 3CC7N 4LREA 1JJHA 2R7XA 4ES1A 3AV9A 2GIRA 1FWKA 3CMES 1VQNN 2RS2A 3SAGA 2FVQA 4L6V3 2VL1A 1EETA 2ASLA 3ALYA 1I6JA 3QINA 1JLBB 5C7PA 3LDNA 3DWLA 4KKOA 2O8BA 3FMBA 2XSFA 1FDBA 1SV5A 4PZVA 3U3YA 3T1HF 4UUXA 4PKDB 5D0GA 3KK2A 3O4WA 3ETOA 2F8MA 4EBEA 1SJQA 1ZS6A 5D0RA 1GLCG 2CJAA 3DXSX 2UVWA 4KHPJ 4QYRA 1HBMA 1EKEA 2PT0A 4LVNP 3S3MA 2F4FA 2HHHK 4JI3K 2PMWA 2DT9A 4B3TF 1C1AA 4B1VA 4A2AA 2WB1D 2DPIA 1SB6A 1N36J 4IYQA 4FNHA 1SQGA 5EU7A 2MQLA 3TSQA 3DN9A 2IJRA 3HMJG 3TARA 1DAXA 3RTVA 2HBJA 2BTFA 2JH3A 5J2PA 3S1TA 2WW8A 2NUBA 4DR6J 4RW7B 4FWKA 3G71N 3MD3A 1C1CB 1T9YA 3DLGA 3LWMA 2W2PP 1Y11A 3N9UC 4LC9B 3I5CA 5KG3A 2B4OA 2OSQA 4FYYB 1NKEA 1NGGA 1RDWX 4JV5J 1UWAA 1IKYA 2W9BA 1GLAG 4PWDA 2YQ1A 3P96A 2HLUA 2QWPA 4ZJQA 2MJNA 2Z8QA 2AJ1A 3MM9B 2FJWA 3TZYA 4JYAJ 4DV2F 2Q1NA 4FYDA 2OTLN 2VPXB 2EFQA 4H4KC 4OYPA 1NOYA 4IG0B 1F5BA 3W3DA 2FGOA 3N6NA 2BUPA 4DV0F 5IS2A 2CXEA 3WXJA 3OR2A 1HNVB 5CYMB 4ZN3A 4OYAA 4JK9A 1Q9YA 1MU2B 4CO5A 4PWWA 3GJTB 3HSGA 3AAQA 3D45A 1VK3A 4NXNK 3VQPA 3NS6A 1HIYA 3EEQA 2DISA 4JI1J 2EBEA 3KNAA 3CFRA 3OR1B 4RPFA 1K1SA 2RUSA 3HFVA 3R8YA 1QSYA 4IUFA 3OL7A 1NGJA 4DFMA 3LP0A 2OKQA 2AJ4A 3OBWA 1KBRA 3UD3P 1VR6A 2FBXA 2AKWB 4QWDA 2QMWA 4P10A 2DY9A 1KQSM 4FVCA 3EX7B 5KQ8A 3AGKA 1EX4A 3IKMA 2XLJA 4UF4A 2EKYA 1YT3A 1JCEA 3T1HK 1SH3A 3D0HE 1U25A 1RA7A 1S7HA 2AEFA 3AVBA 4JHDA 5KQDA 2YKMA 2HURA 4BCAA 2KXNB 3WXIA 4DR4F 2WBNA 2DTJA 4URGA 4AILC 5FLXO 1P90A 3PIOL 2CPZA 4ECXA 2JJ4D 4WZQA 1I5OB 2XBPA 4B3TK 3MN6A 3MMJA 3CCRS 3I87A 1VSEA 4GV6A 3IBWA 5FD1A 2ZHOA 4RLEA 3LP1A 5A2QO 4KGKA 1VHIA 2GTDA 3O1BA 3CSKA 4HYKA 1FI4A 1Q7YT 1N88A 1KQSR 3UO0A 3OS0A 2CQ2A 1Q8KA 1FEEA 4NL5A 1C0TA 5AZJA 5KGWA 2UUTA 3M05A 2BM0A 3T9ZA 2K1RA 5AXMA 4QCLA 3PKYA 4KH0B 1BQNA 3K5NA 4KYZA 4DF8A 5HMWA 4ZPVR 5E5NA 1S76D 2HMIB 5F3TA 3RR7A 5AQRA 2CDRB 2F65A 2F3JA 4ELTA 5L1LA 1Y3KA 2DEIA 4LSNA 4WTOB 1ZM2A 4KR0B 3QRQA 2DB1A 4CJTA 4JD2B 3PX0A 2FHOB 2NRXA 4DLGA 1LAWA 4CJKA 5JLHA 2C3YA 4U7UK 2U1AA 2CQ1A 3BGRB 2DGTA 4BREA 1SZ2A 4K8XA 4K50A 4BE2A 2VG6A 1FRMA 4YB7A 1Q79A 1HMVB 1IBLF 2ZH9A 1IBMJ 4PHTX 1SS6A 3LOUA 4PPZA 4TN2A 3B54A 3AARA 1X5OA 3J80O 3KG4A 4EYHB 4WP3A 4ANCA 4CZIA 1N34J 2XTJP 3HHKA 3H45C 1U0SA 1RQ0A 2NZTA 3OQ2A 2B9WA 3JYTA 4CK2A 4C3LA 4K5SA 3K5MA 4WJBA 4OI3A 2DNKA 1LKZA 3ZO7A 4KHNA 4AT1B 3W0LA 3N01A 4U7BA 2LYVA 2CAJA 4CH0S 3GBTA 1GLFO 3I33A 4LF4F 3VAMA 5HMZA 3ZTRA 3V4IB 1IM4A 1GK8A 5K14A 2NYHA 1U1KA 3CDEA 4Q7AA 3GP9A 1DTTA 5CA5A 2V8PA 3MZIA 3THXB 4DR4K 1YRUA 4J9OA 1ZM3A 2AMCB 2CQBA 3FFKB 3CCVS 4GKJJ 2VQEJ 4EP5A 4I9QA 3CCWA 4F2SA 3UDVA 3CJAA 5J2QB 3MM7B 3HSZA 4Q44A 2A40A 2BJ9A 5M1NA 2E4LA 2RAQA 3UIQA 4E7IA 1R0AB 5M1OA 4M3YA 4I2QA 2HHSA 2LECA 3UDCA 1NMNA 4H5RA 3BGLA 2KG1A 3SQ0A 1M5PC 2P9UB 1NJXA 4LH4A 2ZWHA 4DCJB 3ILIA 2DGOA 4LF9J 1YJ7A 4HDHA 1OVYA 2AV5A 1I39A 5GIOA 4N77A 5D6GA 1OH7A 1S1TA 1VQMN 3HD1A 2QEXN 3LP2A 1RHKB 3EGVA 2CWKA 4CWBA 1IN0A 4RNNA 2E5HA 1K1QA 1ZM9A 3CQXA 2NLXA 3IR6B 5KFZA 5CCLA 4DF4A 4ICLA 2HGLA 4WTYA 4HKQA 5GMEA 3JSMA 1BU6O 4IFYB 3DLKB 3K17A 1L5UA 3PYGA 5DDRC 4YR0A 4I7FB 4EZ6A 1IBLK 4RNOA 4BACA 5HJYA 3FGVA 3TNVA 2HHHJ 4JI3J 2QXFA 4R25A 4MDBA 7AT1B 2MZ1A 2F8HA 3HSJA 4MYUA 2ADBA 5ETQA 1TV6A 2B9EA 4QIEA 2R7VA 4FDFA 3MTJA 3M2VA 2CH6A 4JI6J 1DFDA 2GQCA 2V5HG 3UKUA 2IVFB 3E51A 1ZOTA 1VQ6N 2V4JA 5D0EA 4UZCA 2D1KA 2RIJA 1LW2B 2IMOA 2IDEA 4CRJA 4U95A 2HHPA 1GMWD 2KLAA 4RWTA 1PBAA 1U02A 2YX7A 2QA4N 1EETB 3L09A 3G2XA 2FJEB 3BR8A 4MKBA 2V67A 1ZZNA 2VWBA 2IRYA 4LF5J 1DURA 4KKOB 2O8BB 4EGLA 2ZH4A 1SV5B 4NRTA 1RAHB 2BOAA 3KK2B 3C7NA 3CCJN 1QQCA 1HKCA 1EX8A 2WONA 1U8SA 1Z05A 1M5OC 1RWOB 1RTJA 4NLBA 3GV8B 5AQTA 2FC8A 1U45A 3PW5A 5I3PA 3FZMA 4RW6B 1FEHA 5FIIA 2NZ4A 1TUYA 3H08A 4NXNJ 4USJC 3LUYA 5HQMA 5KT6A 2P9LA 2DO4A 1UCNA 2WTUA 3RB3A 4I6AA 2DJWA 3MX2A 1IG8A 3CMAN 2YWHA 2LDYA 4BRPA 3EKSA 2YPYA 3QT7A 3UCGA 4C48A 3KWMA 4FJ9A 5J2PB 5C12A 4IO8A 2CPXA 1FXXA 3CXCM 3T5JA 3CD0A 1V4TA 1R3NA 1WBDA 3QAEA 4EBCA 3DLGB 3M1FA 4FZVA 3MCPA 3P5JA 3J7YP 3OHAA 3RZAA 1KOHA 3OA9A 4LFAJ 2WK4A 1YJWS 2LDIA 3O9RA 1IKYB 3A12A 2W9BB 3VF0B 3T1HJ 1JK9B 3OYKA 4PWDB 1RTDA 2YKAA 5L1KA 4C23A 3IWNC 3HSCA 4HCBA 2XS7A 2BJEA 2RRNA 5D0HA 2KVQE 4XAKA 1U1RA 1JKHA 1Y9OA 3HT0A 2DNLA 4NWBA 3VAIA 2GGPA 4M63C 4ZLPA 5A8RA 2E88A 3L0QA 4M95A 4K4SA 1UJ4A 3PRDA 4CTAA 2G0JA 3L4IA 1WORA 2EK1A 5FRMA 1T8EA 1APSA 3OR2B 2OEKA 4F02A 3V1RA 1Y64A 3AHPA 5EXWA 4ED7A 3HPGA 3D1OA 2WHOA 4DL4A 2WVDA 1YJ9S 1T3NA 1LWCB 2BKOA 5C2DA 2LQ9A 2JLEA 1SL2A 1NM2A 4CT8A 3M5RA 2OFGX 4L3NA 5THWA 1YHQS 1VQ4N 2E1YA 2OSRA 4WF9Q 3MDQA 3GIKA 5T7BA 4C3KA 3EGNA 4F4AA 3LP0B 3SFUA 3OYHA 3LWLA 1T9WA 3IP0A 2KRBA 4IO1A 2PI5A 4USKA 5AQGA 1RHJB 2AHOB 1G99A 2ALYB 2XYHB 4DSLA 2IJNA 1J53A 5H9FK 3HVTA 3AFGA 1NPRA 4HHJA 5F0WA 3H1VX 4H5TA 2P9EA 4DTNA 1FKOA 1PG5B 3E2EA 2MZSA 3GDQA 4UW2A 1EAYC 2F8EX 1X60A 1X4EA 2QL5B 1D4XA 4OZ1A 2DNNA 2FBVA 2V8HA 3VAGA 3T5LA 3IBCB 2DXDA 2MEWA 4Y00A 1B9DA 3PDNA 4M3RA 1REGX 2N7YA 5EUHA 4YOVA 4JI0K 3EWGA 2HNDA 2KH9A 4A5BA 4ATNA 3GOIA 4HEA9 5KRTA 2A42A 1C0TB 1FVQA 4JUZA 4DV4F 4L8RB 1F2HA 5LT5A 5KT2A 4O5FA 2K1RB 3ICLA 4H0OA 2ZKUA 2HIQA 1GMVA 2FZCB 3NF8A 2KRRA 3AQOA 4DV1F 1EQYA 2CRLA 1HW8A 4BDYA 1K6YA 3BSNA 4A61A 2JFKA 3OTOF 2ZE2B 4LFBJ 3W1YC 1NUEA 2ZM6J 3MCOA 4PA1A 2R7YA 2XYGB 1E3MA 3DLRA 4CLKA 3UN3A 3UVJA 4KHMA 4PEOA 3VPZA 1YJUA 4F3TA 1PCAA 4O3PA 3NE6A 3BYRA 2IRXA 3E9OA 3OTEA 1Q8IA 4WIQA 3E01A 2AD9A 2VG6B 4BQZA 1N0VC 4P52A 2XWXA 4EI2A 4ECSA 1F60B 2MZQA 1XMQF 1W2IA 4DTOA 1CZBA 2PAVA 3D66A 4K4XA 4LUBA 3SQGB 2QL7B 3NNHA 1I3OB 5E2QA 3AJ2A 2PFFB 1IO2A 5FLXU 2NRVA 5BRFA 4CEZA 4ZPWR 4YOXA 3OT9A 1Z4UA 1HWIA 4I2PA 2GW8A 4CO0A 3AH6A 1JLFB 2GX8A 1HBNA 2VKRA 1WSHA 3EGWB 3O1LA 4C11A 3IAYA 3BZKA 3IG1A 2C2MB 1K9MO 2DHXA 2GBZA 3CCTA 2QA2A 1YTYA 3ZYYX 5K14B 1WSRA 3CCZA 3DOMA 3D1QA 4H54A 1QS4A 4A47A 1WD6A 2E9ZA 3OHBA 1HA1A 1DTTB 1NCLA 3QJLA 3AO4A 1IBLJ 3OUYA 3CCMN 3NEKA 1RHRB 3MOZA 3J7A1 3ENBA 2POKA 2QX0A 3O8MA 1T6CA 4LIRA 5EDWA 3PW2A 2YX4A 3UDEA 2QRRA 2NSBA 1MWKA 3KK1B 3K59A 1KONA 2NXCA 3H5SA 1GTEA 3BYPA 2GHPA 5E84A 4JI8F 3EZUA 1KFSA 4B1YB 2X51A 1WEXA 1W26A 4DV4K 4I2QB 2AYEA 3JSBA 1NJWA 2VPYB 4CJ5A 1RDUA 1FXDA 3LZJA 2CQHA 2NREA 3BF1A 4N56A 2VF3A 2QLWA 3RRGA 4H5WA 1NGDA 3HM9A 4DV1K 4ZKAA 5J1NA 1RBVA 3GL1A 5BYRA 3OTOK 2JEGA 1S1TB 3LP2B 2OMOA 1IM6A 1WACA 2XHWA 5A8WA 4K0KF 3SBMA 1HI0P 2JWNA 1VQNS 4FW2A 2KZZA 1W7AA 1RT4A 3ZSWA 1BWFO 2FIUA 3JSMB 2ROPA 1D5AA 1RT3A 2Z2ZA 1N33F 2IM0A 1NPKA 3P4UB 1RB0A 3AXMA 1GXLA 4AHRA 1NOZA 4KRWA 4CEBA 3N5BA 1KEKA 4JAXA 4DV6F 2G8KA 2C2ZB 2GFFA 3MAAB 1XMQK 1ZYQA 3O3LA 4J9NA 5A6WA 4NLDA 2YHYA 4QZVB 1X4FA 2B4VA 2O5DA 4DL6A 5I9EB 3T1AA 1TV6B 2F9TA 1RWNB 4D3GA 1KTQA 4OGCA 4ZPTR 2GWKA 3PACA 3M2VB 3G25A 1KDNA 4S0MA 4IQMA 3J80Y 4ZTJA 1GOCA 1C0FA 2UU9F 1IXKA 4YOUA 3UKUB 2VJUA 2EBGA 2QYCA 4B9SA 4G1IA 3Q2SC 1RTZA 4UUWA 3KIOA 4FLXA 3B8HA 3WQPA 5EX3A 1X8DA 1J2VA 2V4JB 2ZVIA 4LBHA 5B8HA 4AQYF 5JVHQ 5I3UB 1U26A 3QGHA 3MCNA 2BUNA 3GTYX 1NGCA 5B7WA 1P1TA 3UKRB 1QVFR 1ZTWA 2J9EA 2C3UA 3DFEA 3S8SA 1C0MA 1RWVB 4LT6A 1F2GA 1CBKA 1NKBA 3VAHA 4C7QA 1RAAB 3OYMA 2WONB 1X5TA 4FLZA 5LMNF 3H4DA 2OTLS 1RTJB 4FLVA 1AFJA 1HI1A 4EUVA 5HJXA 4DQIA 1TL3A 2BGGA 3JQKA 4FPRA 3R2DJ 2P9LB 2GHVC 3CJTA 2GAGC 4ZCMA 3M8QB 1RBAA 2XMWA 3KK7A 1IBKF 5H9EJ 4DUZF 3DGVA 4DX5A 4DMNA 1XNRF 1RXOB 2FVPA 4OLAA 1MMDA 2FLLA 3R5BA 2R8IA 3BR9A 2CPFA 4CO3A 2Q66A 3VEOA 1A6LA 3IN5A 2CZ4A 3NCQA 3DDNA 1DT9A 4K0KK 3FSIA 5H9FJ 4WQ4C 2DCUB 2IRUA 4Z4GA 4X4TA 4ETXA 2HK3A 3NOGA 1ZBSA 3OFEA 2KFNA 1RTDB 2OO4A 3MCMA 1N33K 4CZMA 4DJBA 5KFYA 4CK1A 2B43A 1S6QB 1YVFA 4K4VA 4W5NA 4A57A 3CDUA 1QQMA 2GGPB 4E1NA 1L3VA 4DV6K 5A8RB 3KWIA 3K9JA 3CCLN 3IM9A 3MOJB 5DM7Q 1JIHA 4M3TA 2FVRA 3HHLC 3UWTA 5LL6Z 1B64A 3AJDA 4JI0J 3BO2A 3NL0A 3NGTA 4U7CA 4JV1A 3SQ2A 1CLFA 4DPOA 1QAYA 1VBKA 2UU9K 1M1KT 4CEAA 5D15A 3NP5A 3TEHB 3U6FA 1PJ5A 1NWKA 1UJ5A 2G0CA 1T9VA 4ER8A 3FQLA 4AQYK 1RU1A 1CS4B 4O4GB 2Q0RA 2XRIA 3I56N 4TLRA 3VMFB 3VQCA 3AO3A 2VC0A 2BW7A 1Y5LB 3WNHA 3EZOA 3G6EN 4WP9A 4CJ3A 4QIGA 4F25A 2YV0X 3HVTB 5D8HB 1VSJA 4ZJLA 2HWTA 4ILJA 1FFGB 4AH9A 2XNRA 1FKOB 4Q8EA 3G82B 4MO4A 3U1LA 2R7WA 1JXEA 1MWMA 1GXTA 1CXQA 3AA4A 5LMNK 1YBTA 4I6WA 4PQUA 2YX1A 4C0BA 4QOZB 2Y3YA 4BC5A 4Z7CA 3DLJA 1ACMB 3W3SA 1Y97A 3TJ9A 3QIPA 1DQAA 1BXNA 4CD1A 1RE1B 4NLQA 1VRQC 3QQCD 2A6OA 3Q8VA 2OPPA 3CT9A 1IBKK 2P6SA 4OLBA 4DUZK 2HNDB 4M7XA 1I51B 2QV6A 4DS4A 1XNRK 2GV1A 1IUJA 1PJ7A 4YQWA 4QWAA 4IOAL 1NK8A 2BMBA 2NLWA 4KREA 2D74B 2UUAJ 3SCIE 1NH8A 2GIFA 3NGKA 3M9OB 2B8PA 4MQ3A 5BN8A 2NUHA 3VF6A 2QT7A 2LQJA 3OYCA 4CJ7A 1VJWA 3BN7A 2P9SB 1JWWA 1H38A 2ZOFA 4ECYA 3GG0A 3M8PA 2ZH1A 2RMLA 5JUMA 2CZ9A 2FY8A 3TPQA 3E01B 4NLVA 3ZZZA 3E1YA 2WSEC 3G10A 1N6QA 1BIZA 1RBUA 2D0OA 5CAAA 1YITN 1HR0K 4CZCA 4K4WA 2YTCA 4NLSA 4DV4J 2B9XA 3BSCA 5L9NA 3M6GA 1WELA 5LSOA 4HHTA 4FK4A 5HP1A 3LDLA 4I2PB 2YY3A 2WSFC 1HKGA 4PWUA 1HBNB 3O5BA 1OQ6A 3LPYA 2CYYA 4DV1J 2HWHA 2KN4A 3OTOJ 1KP6A 5ETKA 3IG1B 3AVKA 3NGIA 4M63A 1A0OB 2F96A 1WHXA 1TQLA 1VQMS 3SI6A 3W2VB 1CZ9A 3W61A 3FK4A 2N3OA 5IT0A 1RYSA 1Y00A 5ETOA 2PY5A 3C14A 3OUYB 4J2DA 2JOQA 1LXJA 3DU5A 2HBZB 5KPTA 1HYVA 4PXCA 3AODA 4FXVA 3IGNA 3C3LA 2EFVA 3LANA 1HNXJ 1VQKN 4J9PA 4BHQA 1UAXA 2QJ3A 2QTWA 3TX0A 2E29A 3CW2C 3GU0A 1MWYA 4FWLA 3N6LA 5AQLA 4FYWB 2PYJA 2O4IA 1SJFA 2QWMA 1UZDA 3J7ZT 3QATA 2NS1B 2PYLA 4FKXA 3EO3A 1UVNA 2J7WA 4CT9A 2PZSA 4HHHA 2W40A 3CCUN 5B0GA 2HBKA 4X4NA 1JXVA 4W4MA 3QB0A 4F9OA 3QRPA 2LQ5A 3C19A 3NMRA 2WOMA 5A8WB 2XLIA 1KQKA 2CJQA 4JOUA 1BD6A 4TU7A 4OJRA 3TYTA 4B9VA 3TU5A 3MTKA 3AB4B 1RTIB 3X1LB 3OXFA 5B0BA 5A76A 3US5A 4DFJA 1P9QC 3L3VA 4CYUB 4CCHA 2Z1HA 3EXCX 5M1PA 5EY4A 4C4WA 3ELHA 5HVGA 2NRTA 5TKWA 2KXFA 3P39A 1TMMA 4NXMF 4B3OB 1H73A 4MK8A 3PY8A 2R7OA 2V2QA 1UL3A 4IRKA 2M4MA 1WKLA 2Y1IA 2CKWA 3TAPA 1RBRA 3W64A 2AGPA 4BY9C 5ETMA 4KE5A 2D0BA 1RT1A 4B9TA 3THPA 1FWPA