2OPSA

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
542
structure length
535
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 134
structure length 535
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2opsA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2opsA05
4CJKA 4I2QA 2ETJA 4E7HA 2DTUA 1UA1A 4OVLA 4B9NA 1TL3A 4CGJA 4FJIA 3RTVA 4WXOA 1RBSA 2FVSA 3IRXA 4ED0A 4MK9A 5J2MB 4ELTA 4M42A 3QZ8A 3VN5A 4K50A 3OYMA 2X78A 3L2UA 3S3OA 1HNIB 2G8UA 3HK2A 3BR9A 1HJRA 3V6DB 2B5JB 1N5YA 1S9EA 3DOLB 4K4YA 3LP3A 4BDYA 1JLEA 1FXXA 4NLPA 4JRPA 5J1EB 4JLHA 3QEWA 3KK3B 2RDIA 4YFUA 3SUNA 4RW9A 2HHTA 5K14B 3KNAA 3UR0A 4J9QA 1FKPB 4NLDA 1IH7A 1S4FA 1X9SA 4OLAA 4FLVA 4KV8A 1N5YB 4WFXA 4CIGA 1T7PA 3DLGA 3DRRA 1NKCA 2R8GA 3M8PB 5HBMA 2J6SA 4FJHA 3DMJA 4KHYA 4ZPBA 3OS0A 3MECB 3DRPA 3OYKA 1UA0A 4O44A 3LP0A 5HRNA 4FLXA 1QAIA 3ULDA 1LW2B 2ZD1A 2A1SA 4KV8B 1JIHA 5DQIA 4N41A 1ZBUA 3FQKA 3CFOA 2VG7A 1OS5A 4KTWA 4DL5A 4DFPA 4CESA 3TARA 1REVA 1JXLA 4BACA 3ZSZA 2R2SA 3KLGA 4DMNA 2IM0A 2WCXA 3IGVA 4LH4A 4DSFA 2WOMB 4E7KA 4QWEA 2XY8A 4OL8A 1FK9B 3PW0A 4E1NA 3HVTA 2PYLA 2ATQA 4FJGA 1REVB 1HNVA 4M41A 4DFJA 3AVGA 2EX3A 3B6PA 4KHSA 5I3UB 3UIQA 4K4WA 4JV2A 1XWLA 3SUQA 4EP4A 3CM6A 3HVAA 4HCCA 4ED3A 4URGA 3K2PA 3HVTB 4DSJA 4AHTA 4FS2A 2LSNA 3LZJA 3VQAA 1CZBA 5DGAA 2D3ZA 1GX6A 1SUQB 3SCXA 3AVHA 4Q44A 4ZVGA 4MFBB 4CHQA 3TWHA 2V9WA 2HHXA 4B9VA 4J9LA 1RDRA 4IQXA 2V0NA 4ECUA 4W5QA 1YVFA 3JSMA 1JXEA 4FBTA 5F8JA 1WNSA 4MIBA 3KLFB 1QAJA 4CEBA 3O3HA 4ECTA 3V9UA 3PX0A 4FJ7A 3V1OA 2BANA 2ASDA 3KOAA 4CJWA 4R5PA 3QLHA 2ASLA 4FJ8A 2ASJA 5CYQB 2P5OA 3UPFA 2DFEA 4H4MB 1LWEB 3RAQA 1TK8A 2QK9A 2BE2B 1S9GA 4PA1A 4BDPA 5KFTA 3KKSA 3SJJA 4DF4A 3KJVB 3KLEA 4ZP7A 3PHEA 3P1GA 2BRKA 3OL8A 4B3OA 3BQ1A 4ZPDA 4W5OA 3ISNC 5KFWA 1WAJA 4R5PB 3QLHB 1S0OA 1HYSA 3M9OB 2Q3SA 2JEGA 3HVWA 1JLBB 3KMSA 1RT2A 4CJTA 5JXSA 1W25A 4G1QB 3MFHA 4URSA 4TXSA 3RR7A 4HYKA 4B3OB 3THVA 2RF2A 3FQLA 3PW5A 4YNQA 3EPGA 2V4RA 3L2QA 3I0RB 4GVMA 2KQ2A 1B9DA 3KK2B 3SFUA 4Z4FA 1D8YA 2YKNA 2G8KA 3AA2A 1YVUA 2FBYA 4K4UA 4DSKA 1RT2B 1T3NA 4QWAA 1R0AA 4MQ3A 4CIEA 5L1IA 1BCOA 4BDZA 3BGRA 4IOBA 3V9WA 2X6SA 4NLSA 4CEFA 2HMIA 2JLEA 3OYEA 4NLVA 1VRTB 3C6TB 5KTQA 2OH2A 2B6AA 1KFDA 2IC3B 4CJUA 4WZQA 3SPZA 2YKNB 2GC8A 4EZ6A 1RTDA 4ED1A 3AO4A 5JS2A 5CY4A 5KI6A 4WXWA 2VG5A 4J9PA 3MXMA 1BCMA 4IFVB 1UWBB 4Y2CA 3ZSRA 3KHRA 3CWJA 5KG1A 5CYMB 3AVAA 3BQ0A 4IG3A 4CEZA 3DLHA 3QIOA 4PWDA 3RMCA 1SKRA 1C0UA 3PR5B 4TLRA 2VG5B 3I0SB 4IR1A 4DTPA 5F8HA 4KKOB 1TAQA 1S48A 1N6QB 2W9CB 3NH1A 1SL2A 4CECA 3MXJA 4ECWA 4E1MA 5KFXA 1IKYA 3Q8QB 2F8EX 1KTQA 2P1JA 1XHXA 3E01B 3QINA 4QOZB 2R2TA 2OYQA 5C5JA 3E51A 1TL1B 1U4BA 3KK1A 3QGIA 4DSLA 4KI4A 1WNEA 5KT3A 2Z1GA 4HHTA 3QEXA 3GIIA 1FKOA 2YNHA 2HHSA 1IKYB 2BRLA 3Q8PB 2HB5A 1SV5A 5HRPA 1RNHA 3H59A 1KVAA 3T5JA 3H2LA 4RG8A 4FJXA 2YNIA 5DLFA 5EDWA 3NF8A 5CZ1A 3GQCA 4Z4HA 3LAKA 4F3OA 4F3TA 3HPHA 2GV9A 4LSNA 3I5BA 4ECSA 5HP1A 5KT4A 4F8RA 5FDLA 4ED2A 1KVCA 4DQPA 2B43A 1HMVB 4ECQA 4JS5A 4DFMA 5DGBA 2QE5A 1IKXB 3QIPA 4CF8A 4DL6A 4TYAA 1BIZA 4R8UB 5L9XA 2HVIA 4I2PB 4DTMA 1LWFA 1S1TA 4ZVHA 4ID5A 5HP1B 1A5VA 2JEFA 3ASMA 4Q0BB 4C8NA 3LWLA 4KHRA 4ZTFA 3GYNA 2X6NA 2F8TA 2F8SA 3U6FA 5KT7A 2E6MA 2HNZB 1X9MA 2EHGA 3KLIB 3LP2A 4NLTA 4CHPA 4HTUA 3QESA 4DL4A 2ALZA 3GIKA 4CHOA 3GV8B 3CJ4A 3K57A 3G6VA 2KTQA 4E19A 5KFPA 4B8CA 4RNMA 1J54A 4C8KA 2VWKA 3QIDA 1S1WB 2W9BA 3CG7A 1D0EA 1RT1A 2OPQB 1SKSA 4FJLA 1C1BA 3OL9A 1NOYA 3SI8A 1KHVA 4CFCA 3PJWA 4AHSA 5KG0A 1BI4B 3SQ2A 1NK8A 3F73A 4MK7A 4OJRA 4TSXA 4M3XA 2FLPA 4LSLB 5KG3A 1JLAA 4ICLB 2Z1JA 2CKWA 4MKBA 1TGOA 5E41A 3DLBA 1RT1B 3V9SA 2QKBA 3IS9B 4DF8A 4FBUA 1S6QB 4B9TA 1HYZA 1NJYA 4KAZA 4OGEA 4F50A 1MMLA 1B92A 4IBNA 1TKDA 1S6PB 1C0MA 4M3UA 1RT6B 4IDKB 3U3YA 4KPYA 1I39A 3AVNA 3ISND 2OPSA 3DRSB 1I3AA 3AVMA 3M8RA 4RUAA 4FW2A 1RYRA 3RB4A 3KMQA 3ZSYA 3VQ8A 4FLYA 2RDJA 4CEEA 4RW6B 2PZSA 1XR6A 3T5KA 1JLQA 2IJFA 4DTOA 5DMRA 5KFEA 5KFBA 4RW8A 4KB7A 2D5RA 4CF2A 2GBZA 1JLFA 3CDEA 3OYFA 2OPSB 4CJPA 2IM2A 2ATLA 1RBRA 3L2WA 4RW4A 1RDBA 4ID1A 5C25A 1JLQB 5KFZA 4FLZA 1LAWA 3G6YA 1ITGA 3C95A 3VQ7A 4H8KA 3Q8RB 2A1RA 4B9SA 4QWBA 2W42A 3ITHA 1K6YA 2XO7A 3VQPA 4FLUA 4MIAA 3RMAA 2KW4A 1EETB 4RW4B 3DOKA 1C0TB 3H98A 3S9HA 4IKFA 1K1SA 3SI6A 2W9AA 4AHCA 5C25B 3V4IA 1D1UA 4K4VA 1RT4B 2OZSA 2VG6A 3TQ1A 3RMDA 3PO4A 4NYFA 4FM2A 1JLCB 3NGIA 3VQSA 1NNDA 4HCBA 4IR9A 3IAYA 3GV5B 3OYBA 2RKIA 1KFSA 4KRFA 4CGHA 3LP1A 3AA5X 3EPIA 4KB0A 3LANA 4WYWA 1JL1A 1MU2A 4YQWA 4J2AA 1S49A 4F2RA 2ITGA 1VSHA 2YNFB 2IS3A 4DTUA 4O3NA 3PZPA 1RTHA 2WONB 5HLFB 2UUWA 2QKKA 4JRQA 4IRDA 2RKIB 2VA3A 4E7JA 2XC9A 3MR3A 3O3GA 1NJWA 4Y3CA 2C2RA 3C94A 3LALA 2OPRA 3PW2A 5JUMA 4I2QB 4H4OA 3D5MA 3V1QA 4DU1A 4K8XA 4EP5A 2DFHA 1TL3B 3IRXB 1N48A 1VK0A 4WYLA 3DLEA 4ZTJA 3NH0A 2HNYA 4MKAA 2ZQBA 5FRMA 1TKTA 1SH3A 4M95A 2R8JA 3MR5A 1C1CA 3AO2A 3WNEA 4N56A 3TVKA 1WSGA 1S9EB 2QV6A 3CYMA 4TN2A 2FVRA 3DLRA 1CXUA 2G8VA 1JLEB 1RCHA 4ZVFA 4E7LA 4EYIB 2HNYB 1GX5A 1VSJA 3CQ8A 1TKTB 1S5JA 3SYZA 4RW9B 1C1CB 4O4GA 4DTRA 3HP9A 4QW8A 3OS1A 2FVCA 3OLBA 2GUIA 2HHWA 3DLGB 4EO6A 5KFVA 3DRRB 4J9RA 3NGZA 4MK8A 3ICLA 4DSEA 2WK4A 2EC0A 5HBMB 5DG9A 1K1QA 4J2DA 3DMJB 4GMJB 3V9ZA 4FVMA 3SFGA 3WNFA 3DRPB 3AO1A 4O44B 2HVHA 3NGYA 3LP0B 3TAMA 5KFKA 2RN2A 4UQGA 3AVCA 4F4XA 3ZT2A 2ZD1B 1BL3A 3H5XA 4RNHA 4TY8A 3GV7B 1WSJA 3H08A 5DQHA 4O3PA 2VG7B 1U48A 4F4KA 4K4TA 2Z1HA 3PUFA 3BJYA 4DL7A 4CEOA 1X1PA 3KLHA 5F8MA 4PUOA 5L1KA 3NHGA 3KLGB 4W5NA 3OYCA 4IH7A 3HXMA 1YT3A 1VSKA 4QWCA 4ED6A 1RT5A 5C42A 5EWEA 2ILZA 2W8KA 2Z1IA 4URQU 3QEPA 2W7OA 4DLGA 1HNVB 5KFHA 4J2EA 2FJVA 4AH9A 4YR2A 4NLGA 1JKHA 5KFJA 1QHTA 3FSIA 3CDUA 1TP7A 5FRNA 3IG1A 3C6UA 2JC1A 4IRKA 1WLJA 1RT5B 4E89A 3VQ4A 4L8RB 3SQ4A 5C42B 3BSOA 2R7YA 2VA2A 2CJQA 3AVIA 4K4ZA 3GIJA 4EYHB 4Y2AA 1HYVA 3QNOA 3NFAA 3C6UB 3SUOA 2GIQA 3OYIA 3G86A 3OL7A 4QWDA 5FROA 4Z4IA 3CJ3A 3LDSA 4FK0A 3PJXA 3JSMB 5KGXA 2O4GA 2BANB 3HKWA 2RPIA 5JS1A 4QPXA 4CJ3A 3OYHA 3T3FA 2DFFA 2YNGA 2XGPA 1EP4A 4KSEB 5KFMA 3ZSXA 5KFGA 3SQ0A 1S9GB 2IAJA 1S10A 3TI0A 2YKMA 3KLEB 1N4LA 3DLKA 4OKJA 5EUHA 1Q9XA 1RILA 4O55A 3QERA 4WFZA 2YHAA 1HYSB 3MEDA 1NJXA 3OHBA 5J2QA 2C2EA 4CGIA 3G0ZA 1NK4A 3MEEA 4O3OA 3HPGA 3RBEA 4PY5A 1ZBFA 3Q8SB 3AVLA 2RF2B 4CIFA 4RNNA 2R2RA 4CHZA 3MEEB 3AVJA 4OGCA 1R0AB 1IKWA 5J2NA 3BGRB 2IMWP 4RW7A 2HMIB 1RBUA 3RB6A 2AGQA 1GOAA 2KZMA 2B6AB 5DLGA 1TQLA 1SL1A 5J2PA 3TAQA 1VSFA 1XR7A 1RTDB 1DTQA 4ED7A 1IKWB 2JC0A 3U3GA 4K8ZA 4DQSA 4DTSA 1RT3A 4ZP8A 4ED8A 1LAVA 3TAPA 4J9OA 4DG1A 3ZT4A 4DQQA 1XR5A 4FZXC 2IDOA 5DQGA 4WZMA 1QUVA 3O3FA 3OYAA 1G15A 2AGOA 3H5UA 4M3TA 5DK5A 4IG3B 4PWDB 1Z26A 1ZBIA 5KG6A 4I9QA 1C0UB 4YR3A 4DFKA 3CDWA 1TVRA 1IM4A 2BQRA 4FJKA 5KFNA 2XWYA 4JV0A 4I7FA 4C8MA 4F4WA 1CSJA 1HPZA 3NBPA 3T5HA 3CJ5A 4WE1A 3HSTB 3KIOA 2XY7A 2FBTA 1TVRB 2FVQA 3KK1B 1U09A 5KFFA 2NUBA 3AV9A 5KG2A 1JLGA 1T03A 3EY1A 1BISA 1FKOB 2R8KA 2WHOA 2YNHB 1F21A 3M8QA 2HWHA 3L3VA 1A5WA 1SV5B 4X2BA 3JYTA 4OKKA 4ZPCA 3FDSA 2WTFA 4Z4EA 4Y34A 4R0EA 4NLUA 1RDDA 4CK1A 2YNIB 1NK7A 3NAEA 4RU9A 2O4IA 4ZP9A 3V1RA 5KFDA 4ECYA 2UVRA 3DM2A 3NGDA 1IKVA 4Q8FA 2I1RA 1DLOA 4LSNB 3L8BA 5FDLB 4NCGA 1RA7A 4ZMMA 3CM5A 3OJSA 1D9FA 4FJJA 3QIPB 4DS5A 3QEVA 3B6OA 1KSPA 3D28A 4NLYA 3V6KA 1NOZA 4CGFA 5F8LA 4DL3A 4YP3A 1WAFA 1RAJA 4NLXA 4KHUA 1J5OA 1LWFB 2AU0A 1S1TB 2R8HA 3T19A 1L5UA 2V4QA 3CJ2A 3BQ2A 4ID5B 4DS4A 3PW4A 4NCGB 3G10A 4WFYA 2FVPA 4HUFA 3KKRA 1LWCA 2C2DA 4ELVA 3GILA 4NRTA 1NJZA 2FC0A 5KFCA 3DI6A 3HT3A 5EWFA 3MTKA 4TYBA 3LP2B 5KFIA 4GW6A 3MR6A 4AILC 1YTUA 1C6VA 4HVJA 2JEIA 1W9HA 5KRTA 1LWCB 1BGXT 2DPIA 1U04A 3QO9A 3OSPA 4LQ3A 2W9BB 3DI6B 4NYZA 1O1WA 4IFYA 3H4DA 3TANA 1C1BB 2FLNA 3LWMA 3PX4A 1TKZA 1BHLA 3H5SA 1TKXA 4AHUA 1NK9A 4DTJA 2ZKUA 2ZE2A 4ZHRA 4Q43A 4LH5A 3OJUA 4DQIA 4NYNA 2XHBA 3QO9B 1KLNA 4RUCA 1JLAB 3MF5A 1S9FA 1U45A 4PQUA 1VRUA 4IFYB 4OPKA 4DL2A 1S1VA 2R2UA 1TKZB 4B9LA 1WSFA 3MEGA 2IBKA 3L3UA 3VQEA 3IGNA 4FS1A 4K4SA 3M8SA 4DSIA 2WRMA 2G8WA 2UVVA 4IRCA 4QCLA 1RTJA 3ZCMA 3V9XA 4GC7A 4RZRA 4O3SA 3NL0A 1QE1A 3ZSQA 1HQUA 1NK5A 1BQMA 3MEGB 4FM0A 1NHUA 3HM9A 2HAIA 1ZBHA 4ZVEA 5KGWA 3A2FA 3OVNA 1VSMA 2I5JA 3H40A 4CCHA 4RW8B 2XCAA 3NF7A 1JLFB 3RR8A 4QAGA 4FCYA 3QGHA 2B4JA 1S0NA 5C24A 3QNNA 2OZMA 4CJ5A 4ECXA 3ZSVA 1TK0A 5I42A 4IG0A 1T05A 4Y1CA 3V6JA 1ZTTA 4F4YA 4AHRA 1HRHA 2XY5A 3EZ5A 1XHZA 5L1LA 3V81A 4J9MA 3SUPA 3ITHB 4DU3A 3DYAA 5HROA 4CF1A 3SV4A 4FK2A 1U47A 1RT7A 2HWIA 2JGUA 3OLAA 3VQBA 1C2PA 3DOKB 1RA6A 3OYJA 3LAMA 3FFIA 3OHAA 4O3RA 5I42B 2J6UA 3V4IB 4IH5A 3RAXA 1ZBLA 3P83D 4J9NA 4CJLA 1W0HA 3IN5A 4JV1A 1LW0A 2VG6B 3BSCA 1NKEA 1NKBA 1L3SA 2FBVA 2UVWA 1QSLA 3CVKA 3TABA 3LP1B 4CK2A 4XO0A 1HNIA 3NH2A 4N76A 3I5CA 1MU2B 3SPYA 4FLTA 3V6DA 4CEDA 2B5JA 4CJRA 3DOLA 1LW0B 4ELUA 4N5SA 1RTHB 3TAEA 5DG7A 4EZ9A 5J1EA 4IKAA 3KK3A 1S97A 3UQSA 1RYSA 3OY9A 1B9FA 5K14A 4JS4A 2OPRB 2J6TA 3FRZA 1FKPA 4CFAA 4H4OB 4ECRA 4CFDA 4OKEA 5KG5A 1Z25A 3BSNA 5D3GA 1WSIA 3M8PA 4M3ZA 4DU4A 3DLEB 4CJFA 5HRRA 2IM1A 3VA0A 2AJQA 3O4NA 3MECA 4EO8A 4BWJA 2HNDA 2R8IA 2IA6A 4CF9A 4J2BA 1LW2A 2AWZA 3OL6A 1HARA 3PW7A 5DG8A 5T7BA 4FYDA 4OPJA 5D3GB 3PO5A 3VQQA 4YMEA 1EKEA 3PX6A 3S3MA 2E9TA 3CIZA 2FBXA 2E4LA 2HNDB 2XGQA 4F4ZA 4Q5VA 4TQSA 3KHHA 5F9LA 2QXFA 4O4GB 2KFNA 4KE5A 4M3WA 2WOMA 4KREA 1N56A 2W7PA 2F96A 3WNHA 1FK9A 2D0AA 4EBEA 2FLLA 2IGIA 3ZT0A 4K4XA 3NF6A 1DTTA 2HHVA 5I3UA 2YHBA 3TAMB 4CFBA 1EXQA 4U6PA 3OYNA 4FM1A 4ECVA 4TY8B 4FW1A 1TV6A 3I5AA 2DY4A 1L3UA 3HHKA 4Z4GA 2C22A 3KLHB 1SUQA 5KFUA 3CO9A 4PUOB 1CZ9A 1DTTB 1JXBA 4MFBA 3SQ1A 2Y1JA 4XIUA 4NLOA 1J53A 1RDAA 4CJ4A 4DTXA 1TV6B 3KLFA 3HJFA 5EWGA 3N6LA 3ZSWA 1GOBA 2UUTA 3RMBA 5CYQA 4NRUA 4BE2A 1T8EA 1JKHB 2D41A 1KCFA 3I8DA 1LWEA 4H4MA 3KTQA 3IG1B 5KFLA 2BE2A 4CERA 1KRPA 3KJVA 5KG4A 4B8AB 3RRGA 3EZUA 4B9UA 3MXIA 1XC9A 1SKWA 1GOCA 2Y1IA 4LY7A 1JLBA 1RDCA 3S3NA 1T94A 2WB4A 3NKYA 4G1QA 4J9SA 4CHYA 3ZT3A 4KB1A 2JEJA 1YTAA 4CJQA 2P5GA 3NE6A 4FZZA 1EX4A 2G8HA 3PVXA 4KHQA 4NZ0A 2AQ4A 3I0RA 3KK2A 1WSEA 3VQ5A 1QTMA 3L2RA 3RB0A 3KD1E 2YNGB 1XI1A 2UVUA 1EP4B 5KT5A 2IAJB 1QSYA 1NK6A 2YKMB 3N6MA 4RNFA 4ECZA 4J9KA 3AO3A 3DLKB 4DEZA 1VRTA 2GIRA 3C6TA 3HVRA 3K58A 1QSSA 4FXDA 3PY8A 2IC3A 1RBTA 3OYGA 3RBDA 1ZETA 1S1XA 4XPCA 3MEDB 5J2QB 4HKQA 3VQDA 4M94A 1CLQA 1RTIA 4E7IA 3AVFA 2D0CA 3MFIA 2AX1A 1UAXA 3ZT1A 4EEYA 3K59A 3TAGA 3VQ6A 4IFVA 3MAQA 3V6HA 1S1XB 1UWBA 1Q9YA 2KZZA 4KI6A 1D5AA 5HRSA 5CYMA 5KFAA 1RTIB 2C28A 1SL0A 4FJNA 2PY5A 5KFOA 1TAUA 3VA3A 5J2NB 3VQCA 1VSLA 2YV0X 2XRIA 5KT6A 3HL8A 3I0SA 4NCBA 4RW7B 3DDKA 1KVBA 1QS4A 3L2VA 4KKOA 1N6QA 2W9CA 4M45A 3K5OA 4CJVA 4DWIA 4C8LA 2HHUA 5J2PB 3TAFA 3KHLA 1BIUA 2KFZA 3E01A 2G8FA 4O0IA 4NLRA 3NDKA 3NMAA 1DTQB 3BSAA 4QW9A 3CFRA 1ZTWA 1RT3B 1TL1A 3AA4A 1QQCA 2XY6A 4DG1B 1VSEA 1SH2A 4W5TA 4NLQA 4FJ9A 4E0DA 5KRSA 4B08A 4LD0A 2BDPA 5F8GA 3K5MA 2E9ZA 5KFYA 3M9NB 1JX4A 1IO2A 4CHNA 1IG9A 4O4RA 3HP6A 1ZYQA 2W8LA 1U49A 3LZIA 2G8IA 1HMVA 4I7FB 1IKXA 4TY9A 4IH6A 4FJMA 1HPZB 3NBPB 3VQ9A 4KO0A 4WE1B 2IM3A 1WN7A 1L3TA 5T14A 2OA8A 4R8UA 2XI2A 3GIMA 4I2PA 4E3SA 1ASUA 4MH8A 4DTNA 1JLGB 1T03B 4DQRA 3K5LA 4JUZA 2PYJA 3M8QB 4Q0BA 5F9NA 1Q8IA 5EU7A 2DPJA 3NAHA 3OYLA 3JYTB 3AO5A 4AHVA 5KFQA 4KTZA 2D3UA 4FZYA 4EBCA 4KO0B 4BE0A 4KBIA 3ALYA 2HNZA 4Q8EA 1LV5A 2FJXA 2IOCA 4XPEA 3AVBA 3KLIA 2D0BA 3HYFA 3RRHA 2BGGA 2E6LA 1S1UA 4CJEA 5L1JA 3DM2B 1L3VA 3KHGA 3MR2A 1IKVB 4U7CA 4N47A 3QYYA 4Z4CA 4GC6A 3QZ7A 3NF9A 1DLOB 3P5JA 5CZ2A 4YR0A 3RB3A 2BQ3A 4HUGA 1RBVA 1S1WA 4Z0UA 4LQ9A 4O3QA 1Z4UA 4TQRA 2OPQA 3G6XA 1NHVA 3OYDA 4CGGA 4NCAA 4ZPAA 1ASWA 2XCPA 1D9DA 1S1UB 1J5OB 5F8NA 1BI4A 3QGGA 3UDLA 1ASVA 3NCIA 4KHMA 4H54A 4M3RA 1WSHA 3NAIA 4LSLA 4ICLA 1KHWA 3BREA 1C1AA 3BDPA 2AGPA 4M3YA 3ZSOA 3IS9A 1A5XA 3K5NA 4F2SA 1S6QA 3D45A 3T1AA 1VSIA 1X9WA 3RWUA 4CGDA 1NK0A 2HW3A 3QETA 4EBDA 3OSNA 3LPTA 3SZ2A 1S6PA 4CEQA 1RT6A 4IDKA 4O5BA 4O0JA 4CK3A 3CFPA 3DRSA 1TKXB 3TR8A 5KG7A 4B9MA 2ZE2B 4ZHRB 4CF0A 1KLMA 3AA3A 3SNNA 4RW6A 4CJSA 3CJ0A 3PV8A 4KFBA 4PQUB 2OPPA 1VRUB 4W5RA 2XI3A 5F8IA 1JL2A 1VSDA 1S1VB 4KTQA 4KHNA 4FLWA 1BQNA 2BQUA 1KLMB 4BE1A 4NLWA 4I9LA 3N6NA 3WNGA 3O4QA 4FJ5A 3T5LA 4KFBB 5KT2A 2P51A 2AX0A 4FK4A 1Y97A 4RNOA 2OPPB 1I6JA 2VWJA 3SV3A 1EETA 1RTJB 2BR0A 1SH0A 1C0TA 4DLEA 1BQNB 3EYZA 4OLBA 4BWMA 1HQEA 1QE1B 3HPOA 1HQUB 1BQMB 2E9RX 3F9KA 4HUEA 4ZP6A 3AVKA 1RT4A 2X74A 3KLVA 3QEIA 1S0MA 4G3IA 2I5JB 1J9AA 3H4BA 4Y1DA 2HHQA 2O5DA 1JLCA 2IJNA 4CE9A 3KD5E 4KHWA 3D0PA 3LPUA 5C24B 5KFRA 1TK5A 1HQEB 4C8OA 4KAIA 2ILYA 4IG0B 2FJWA 1T05B 3HO1A 3M9MB 1UOCA 5KFSA 4Q45A 3H5YA 2YNFA 3V81B 5SZTA 3DYAB 2WONA 5HROB 5HLFA 2D7SA 5J2MA 1RT7B 3OS2A 3PR4A 1CXQA 4CEAA 5SWMA 3FFIB
chains in the Genus database with same CATH superfamily
3WQTA 4C8YA 2RMLA 4B3MJ 2FQQB 3VTHA 3K5PA 4A8WA 2G2YA 2PEHA 2KH9A 2D0OA 4B9NA 4K25A 1Z1ZA 1BWEA 4FJIA 1RBSA 2FVSA 3IRXA 4ED0A 4ELTA 4OYAA 5D0RA 2EFVA 4M42A 1KTVA 2RDDA 3L2UA 4U95A 2FY1A 5A8RB 3H1QA 5ETPA 4PKGA 4D3GA 3HK2A 3BR9A 2E5IA 5BPNA 2VC0A 3LP3A 1CJKA 3J80Y 1GMUA 2CWKA 1JLEA 3IKMA 5F2RA 3QEWA 2H48B 2RUSA 3KK3B 4B3MK 2RDIA 4LRFA 2DNKA 4YFUA 4UW2A 2CNOB 3SUNA 3POTA 3LGMA 3WXLA 1X9SA 4CO4A 4FLVA 3LOUA 2YTCA 5BYSA 4B02A 3CF5L 1RWPB 2J6SA 4KHYA 4XAKA 2NLWA 1WOPA 2R9LA 3OYKA 1WWHA 4QIEA 3K17A 4Z7CA 5HJYA 2K7JA 2C2MB 1FRIA 3G8SA 1R0BG 2AP6A 5EGYA 1ZBUA 3A5MC 5LY3A 5H9EK 2QWRA 3BUZB 4KTWA 4YDUC 5GMDA 3TARA 2HWTA 3A12A 3O8MA 4KBOA 2R2SA 3M2RA 4K5SA 1Q16B 3MMBB 1QAYA 4OJ1A 2XY8A 1FK9B 4LFCF 3PW0A 4NB4A 1EWRA 2VV5A 1HNVA 3DLJA 3A8IA 3AVGA 1HD0A 2KL8A 2Z57B 2LQ5A 4MYTA 2W4DA 2BVZA 1X4EA 2MKKA 4ED3A 3HVTB 2FZKB 3LZJA 3VQAA 2HQ3A 3OBYA 4MFBB 4CHQA 1TFWA 2KM8B 4FBTA 1RKJA 1E4FT 1SPBP 4CEBA 4ECTA 1UEUA 5ETMA 3ZNUA 2BANA 1RAAB 3HF5A 2ASJA 1DKGD 4F02A 2UXBF 2RVJA 3DRYA 1MMDA 2CNLB 2IRYA 1SBRA 4BDPA 5KFTA 3KKSA 3SJJA 3KJVB 2J5AA 4A8XA 4FYYB 1O51A 2FIUA 3OL8A 5A8KA 1QVGM 3EGZA 1RHMB 1TR0A 3QLHB 3CCSN 3C65A 2BYCA 4ANEA 5HL7Q 1B0VA 4CJTA 5JXSA 3MFHA 2VUGA 1PC5A 4B3OB 3THVA 2RILA 3EPGA 3KK2B 5GADU 4N8NA 1D8YA 3AA2A 1KS2A 3W0LA 3BGLA 4IFEA 2RS2A 1PYOB 4OYWA 5L1IA 1BCOA 3P4UB 4DQ8A 4NLSA 1NU0A 2HMIA 2F40A 4M5LA 1VRTB 5KTQA 2OH2A 3VGVA 1HKAA 2IC3B 4CJUA 2N3OA 4FVUA 2YKNB 1E6YB 2GC8A 3O1BA 1RTDA 2O8CB 4ANCA 3OVBA 4DL0C 5JS2A 3UKRA 3BF1A 5CY4A 4HACA 4AE5A 5KI6A 4WXWA 2NRVA 3U27A 1OYEA 4WIIA 1URNA 3VAIA 4Y2CA 4CLYA 3HHLC 3AVAA 2IFXA 3M1VA 3DLHA 3IBCB 4X64F 1R31A 1Q8BA 3I0SB 2UZAA 5F8HA 1TAQA 7AT1B 2WAQD 3FCHA 5DETA 4RKUC 1N6QB 3Q86A 4C3LA 4GVBA 4X62J 1B70B 4QOZB 4DZDA 4R0JA 2OYQA 1TL1B 1U4BA 3QGIA 4B1VA 3WX4A 3CCSS 1WNEA 4KY3A 2C3UA 1FKOA 4DI6A 2OKQA 3O9UA 2H4WB 4RWTA 4ENOA 2V2KA 1N5TA 4QR2A 5HVHA 3W63A 1RTZA 1NGDA 3GQCA 4Y0WA 3D6TB 4H5WA 2MHEA 4F3TA 4X62K 3I5BA 5FDLA 2MJUA 1WHWA 2B43A 1HMVB 4ECQA 4PXDA 1VI7A 3CJ8A 1X5TA 3BPDA 2WZ1A 1RWKB 2HVIA 5L9XA 3D6HB 3C66A 4DTMA 4NXNJ 2QL5B 4DV2F 4GKJF 2JEFA 1NBWA 4Q0BB 5F3TA 1JMTA 2F8TA 1BMQB 2AYEA 3DAWA 4DUYF 1NGGA 4WPAA 2EHGA 3KLIB 3ZETB 5CH7B 1TL7A 4ISFA 2YKQA 4DL4A 3GV8B 5F0UA 4KR0B 2QX0A 3G6VA 2KTQA 4E19A 1YDLA 2AV5A 5GAGP 5AT1B 1S1WB 5AQNA 1CC8A 2FHJD 3LDLA 4FJLA 1UETA 5AE3A 1UVNA 2E8AA 1KHVA 4CFCA 2WW4A 5KG0A 1BI4B 4F4AA 4OI0A 1WC6A 1G7CB 2FLPA 3H3OB 4LBHA 4WU3A 5KG3A 1V3RA 4MKBA 2KKHA 5E41A 3ZLJA 1RT1B 2QKBA 1FNXH 3IS9B 1VQ5N 1VBXA 3C14B 4C11A 4FBUA 1S6QB 3H8YA 3AY0A 1U7LA 3DFEA 3I9V9 1WBBA 1HYZA 4KAZA 1RWMB 4F50A 2NZ4A 2MQ8A 3RW7A 2GGPB 4M3UA 1OKJA 1RT6B 2LQ8A 4IDKB 1M5PC 4B1YB 1I39A 3M2UA 5ETTA 4ES1A 2Q0UA 1RYRA 3S01A 1HJOA 4CEEA 1BA1A 4RW6B 1UVMA 2DKOB 2PZSA 3FBFA 3T5KA 1JLQA 4DTOA 2AJ0A 4G6VB 2QC3A 2D5RA 3A5OC 4CF2A 1OO0B 2IDEA 3CDEA 4CJPA 2N82B 1FX2A 1UFWA 2ATLA 1RBRA 2W2OP 4JKCA 2MQMA 4I6YA 4F7VA 2KXNB 3T1YJ 1HWUA 3VHQA 1FFSB 3G6YA 2U2FA 3VQ7A 4B9SA 3Q0AA 1DBDA 3NGTA 4MIAA 1HR0F 1RKIA 1IBKJ 3PIPL 3PXGa 4IKFA 1K8AO 1K1SA 4AHCA 5C25B 3V4IA 1CLFA 2ZUGA 3IXQA 3TQ1A 3PO4A 4F9OA 3G4SS 4FM2A 3QWPA 4LVOP 4M5JA 4IR9A 3GV5B 2KXHA 3HHLB 2DR8A 3T1YK 4ZLLA 4CGHA 3EPIA 3P3DA 3JSRA 4AXJA 3LANA 1JL1A 4YQWA 4A2BA 1S49A 2E7WA 2YNFB 3LDQA 3QICA 1WKJA 2NXUA 2Z56B 3KFWX 2J9DE 4UOHA 2JSXA 1ZAVA 1IBKK 2QKKA 1QZ5A 1PJ7A 4LF2A 1KOHA 4Y3CA 3C94A 3NVKA 3QT8A 5F0XA 3FGUA 3UWTA 2KHDA 3KG1A 3W60A 3R5BA 3IRXB 3A5LC 4I6WA 4WYLA 3FSYA 3JXOA 4DDFA 4DV1K 3Q8UA 4ID8A 5FRMA 4M95A 3AA8A 4XH4A 4NI2A 4UZCA 1PIEA 3WNEA 4N56A 2W4CA 2O8DA 2D1CA 2QV6A 3L4QA 3PJ9A 1KVIA 2FVRA 1CJKB 2G8VA 4TU9A 1JLEB 1K9MO 2VU5A 1S3XA 1YKWA 1ULRA 1VSJA 1RCOB 3CQ8A 1VQMN 3G82A 1OVQA 5FPEA 4CLSA 2DNMA 4B1ZA 1EARA 3POTB 3CMAN 3H3NO 3CCEN 2VQEJ 5EXWA 2R7TA 3OS1A 1K0TA 4P72A 3OLBA 4EO6A 2ASOA 3NGZA 3ICLA 2JJ4D 5DG9A 4JI6J 1YX2A 1K47A 2CGJA 3AO1A 3K8VA 4EI2A 5KFKA 4A4JA 3NOGA 4OLPA 3JTOA 3O5BA 3I9ZA 1H72C 2OLWA 4RNHA 3N5BA 3GV7B 4JKGA 5BRFA 3H08A 5DQHA 4M7XA 1FD8A 4CNYA 3Q23A 2Z1HA 3PUFA 4LF4F 2V68A 3VAGA 2VQEK 2HFUA 1VS3A 3VF6A 2ZWPA 5LJVA 2BJ8A 3HXMA 1YT3A 1VSKA 4CQ1A 3Q2SC 5C42A 2K2PA 4DR3F 5EWEA 4JI6K 5JJBA 2MQPA 3Q7CA 4W98A 4Y2KA 2MZRA 3QEPA 1G6BA 1HNVB 3EDRB 1LOTB 1YZ7A 2F4VF 2KU7A 1QD1A 4JK7A 4K59A 1WI6A 5FRNA 2JC1A 3KHYA 4IRKA 4ZITA 1RT5B 3HFZB 4MO4A 2IHR1 2YPYA 1N52B 3VQ4A 3OPKA 1BOTO 4ZIVA 2CJQA 3MI7X 3E66A 4K4ZA 3AAPA 2NXJA 4EYHB 3LO3A 2DTJA 2H5EA 1VYAA 3NFAA 4KGZB 1VISA 1HPMA 4YB1P 4J7CA 5M1NA 4QWDA 3O9SA 2QI2A 3PJXA 3OXLA 3D1OA 4KH4A 2Q36A 2BANB 1VQMS 2J0SD 1WF2A 3HKWA 3MUVP 5JS1A 3CCES 4BC3A 2YNGA 2XGPA 3IC1A 3SQ0A 2E1PA 2RNEA 4RPFA 2IAJA 2BW2A 3CJQA 3G8TA 3M30A 1N4LA 2DJWA 5AQYA 4OI6A 2JX2A 1GTHA 3HX9A 1RILA 4O55A 4WFZA 2YHAA 4PQAA 3T7ZA 4F67A 1NK4A 3G0ZA 2MY8A 3MEEA 3CXCR 3HPGA 1SJRA 1NSAA 1TTHB 3BYRA 2XTJP 4Y6IA 4WYBA 3UDEA 2ZKTA 1T6CA 4RNNA 3FE1A 1BD6A 3EZOA 3MWTA 2D9OA 1EIYB 1RDWX 2VFRA 3MAAA 2XYPB 4OGCA 2Y0SD 1N8RO 4ALZA 1FRMA 3ZX3A 2IMWP 4OX9F 5AQKA 1UL3A 2HMIB 1RBUA 3MN9A 3A5NC 2KZMA 1FRXA 3O08A 3A8YA 1HHQA 1YWXA 3TAQA 1P6TA 1RTDB 3D0GE 2H3EB 1FDDA 4ED7A 2JC0A 3QBXA 4K8ZA 4H0YB 3UKRB 4HACB 4DTSA 1RT3A 4J5OA 3T9ZA 4QOTA 4ED8A 4DG1A 3O6WA 5GMKa 4DX7A 3BR8A 2QLFB 1OH6A 3I55S 4IEEA 3O3FA 1ATNA 3OYAA 1MN9A 2ZC4A 3O3LA 3M1VB 1RWXB 1ZBIA 4YR3A 1VJWA 1FWLA 3CDWA 1I1GA 3OW2M 2XHWA 4V1Ak 2XWYA 1Q5VA 1LXNA 4C8MA 4GVBB 4F4WA 3NBPA 3BKUA 5A76A 2QEXS 1Y5IB 1HUXA 1FXRA 3GG0A 2FBTA 3BZCA 5BYQA 5KG2A 1T03A 1FKOB 4ZVPB 1F21A 3O5TB 4O0NA 4X2BA 2YHYA 3R1LA 4OKKA 2M52A 3FDSA 4ZPCA 2WTFA 4R0EA 2BW7A 1R8CA 1MNEA 5KFDA 2FSJA 5IV4A 4IUFA 3KG0A 3DM2A 3L8BA 1XJWB 5FDLB 4NCGA 4ZMMA 1UPPA 3CM5A 3OJSA 3NGKA 1D9FA 4FJJA 4DS5A 3QEVA 2DRDA 4CGFA 5F8LA 2NSBA 4OX6A 4DL3A 4FVCA 2WVFA 4G65A 3AJ2A 4NLXA 4KHUA 1SQFA 2BUPA 2R8HA 3T19A 2V4QA 3QB0A 3MMVA 2DHAA 3AOBA 4JHDA 3SSQA 3OR1A 2HZCA 1NJZA 4IXCA 3FR0A 3DI6A 3G2XA 4IOCQ 1SCJB 1TL7B 4AILC 1YTUA 3P38A 2AYMA 1EZZB 1NU4A 1W9HA 4BRPA 4BROA 1BGXT 1U04A 2JVRA 1YJRA 4NYZA 4OLOA 1O1WA 2O66A 5AQGA 5GINA 3CPWR 3MD3A 2H54B 4PKHA 3DC2A 4BR9A 4AHUA 4DTJA 2ZE2A 4ZHRA 1MA9B 4Q43A 4NA1A 2HF3A 2WVDA 1YRTA 1NGHA 1KLNA 2YKAA 3UN2A 1S9FA 1VRUA 4IFYB 1ZH5A 1TUUA 4JKEA 4DV2J 1S1VA 2R2UA 1TKZB 2DGQA 2FDNA 2F4FA 4ZKAA 4B9LA 3PKMA 1QDUB 2J7UA 2C2NA 1WSFA 5G4DA 4QIVA 2D9PA 3J7AN 5AQWA 3J7ZT 3I4PA 2WRMA 2ZH8A 4DPTA 2VFUA 2UVVA 4IRCA 1YJ9N 1N54B 3M2UB 1KAYA 1D8ZA 5I4MA 3V9XA 4BVOA 1PGZA 2XZWA 3PRBA 4RZRA 4W92B 1HQUA 1NK5A 2DNOA 5KPZA 2HAIA 3BDEA 3ULHA 4CO0A 1ELOA 2DNGA 4A5AA 1VHXA 3AOCA 5BR9A 1U1NA 2ASMA 2YQ3A 1S0NA 4QQBA 3QNNA 3FZBA 4I56A 2BJDA 5ITHA 1IBLJ 3CCQN 3O44A 4DU3A 5HROA 4JI3F 3P6YC 1RT7A 5KAKA 2JGUA 3OLAA 3P96A 3RJMB 2LLZA 2AMCB 5LSOA 1HIYA 3B6BA 4N7TA 2ZJQL 3HHLD 4O3RA 5I42B 3VPZA 4KGXB 3V4IB 3N5FA 3RAXA 2OUGA 5DRKA 3W2VB 3PIOQ 4F36A 5J1NA 2EFGA 4V19S 3IN5A 1LW0A 4UOCA 1NKBA 1L3SA 1OWXA 2E5GA 5GAGU 8RUCA 1SC1B 3FEYB 3UKUA 1QSLA 2PDAA 3CCUS 1GT8A 1IBLK 3AARA 2QT7A 3DOLA 4DV6F 4DX5A 1YRUA 5E3RA 3CE8A 3J80O 1H7WA 2H4YB 4DR6F 1VQYA 4O8UA 2QM1A 4CD1A 1FKPA 4IDHA 4JKHA 4BC7A 5H1SV 1Z25A 3BSNA 4KJIA 4K41A 2RAQA 4M3ZA 4A48A 1XMBA 4BC9A 1KC8T 3QNWB 1FDAA 4C0HA 2VPWB 4JI7F 2QW9A 5HRRA 2AYBA 4CJFA 3W9JA 1F9FA 2HNDA 4CF9A 4B3TF 4CZLA 1LW2A 4NI2B 3QSIA 1HARA 3THXA 2O8DB 1Q86O 3GL1A 1R7IA 2BE7D 2IBOA 2E9TA 2C2KB 4FF2A 2XGQA 2Q97A 5JVHQ 2DB1A 2QXFA 2KFNA 4KIAA 2G1HA 3T69A 5HN0A 2WOMA 3SSRA 3VMFB 3MN7A 3J7ZO 4KREA 3M2VA 3WNHA 2DNHA 5DDRC 2IGIA 2UXCF 3LH2S 2ZFHA 1U26A 5GAGI 5I3UA 4X66F 2P8IA 1W2IA 4WBFA 3T41A 1EXQA 4FM1A 1M1GA 1NGCA 4FW1A 1TV6A 1EQYA 1L3UA 3D0HE 3CHWA 5F3ZA 5BR8F 4WTOB 1VHIA 2DH9A 2XMWA 2Y1JA 4QBUA 4M5IA 3ILOA 2ACMA 2X3GA 3CC4S 3THPA 3S8SA 4NLOA 3QATA 1YJ7A 2PMZD 2V9KA 5AQZA 2VL1A 4DTXA 3KLFA 2ZITA 3CO0P 2B3TB 3FZHA 4NRUA 2LKZA 1ZAXA 1T8EA 1T95A 1KCFA 4LF1A 1U6FA 2BE2A 4K2JA 3NGUA 1KRPA 3EZUA 5CXTA 2I7NA 2HPUA 1M1KT 1XC9A 1VIOA 1Y10A 2Y1IA 3UI3A 1JLBA 3KDOA 7FD1A 3WT0A 3OTCA 4CRJA 4LR9A 4CHYA 4JK9A 4BRLA 3BYPA 4CJQA 1HNXJ 4FZZA 5E3AA 3WC2A 3R5DA 1KVKA 3PVXA 2HFVA 3IRWP 5LMUF 2AQ4A 1FRJA 1AFJA 4WJBA 3CMEN 3HZ6A 1DY3A 3VQ5A 3L2RA 5HL7L 1Y3JA 3RB0A 4ED4A 2AEFA 2YNGB 1XI1A 2UVUA 1AUDA 3WQPA 5KT5A 2IAJB 1NK6A 4OI3A 3FRYA 3IM9A 4DR3J 1Q8KA 3M30B 3VAJA 3EVWA 4D3HA 1M90O 1QSSA 1KC8O 3PY8A 2FPHX 2DHXA 1ZETA 4XPCA 1XNRF 2PFFB 4M94A 5LJ5Y 1HNXK 5F0WA 1UAXA 2ZH5A 4DN9A 5K20B 4RBUA 3BH7B 2HRUA 3CB4A 3H42A 2GHVC 4EEYA 1OY9A 3D0IE 3B4DA 3TAGA 2HGLA 3V6HA 1S1XB 4P2FA 1D5AA 2BE9B 1OQ6A 4LF9F 1RTIB 3MAAB 1TAUA 2YV0X 5C7PA 3W62A 1QHAA 2XRIA 1CS4A 3VEWA 2Z2LA 2RQMA 3R7BB 1KVBA 1YJTA 5FLXY 2XMTA 4USKA 2E1AA 4DWIA 4C8LA 3JQKA 2CQCA 1BIUA 4F0HA 4NLRA 5IFMA 1S76D 2LU1A 1RISA 1IWAA 3CFRA 2EFOA 5KPTA 1RT3B 3AA4A 4P75A 4DG1B 2QLJB 3NG8A 1IBMF 3MM8A 1ZM2A 5C2GA 1D09B 3CC7S 4E0DA 4B08A 2BDPA 2BV3A 5F8GA 1U2VA 2CQBA 2XS5A 5HQLA 2E9ZA 2FC9A 5JMNA 1JX4A 3E1YA 1WOQA 2QA4N 1S22A 3CMES 2CZ9A 1G3OA 1J6ZA 2W8LA 3OR2A 5M1OA 4NPOA 2LDYA 1BA0A 3U8XA 2YWWA 4JV5F 3TUJC 3NBPB 5K8NA 2BTFA 3VQ9A 1F9HA 4DBQA 2OA8A 3CC2S 3EGVA 2UUBJ 1JK9B 3GIMA 1T11A 4JB8B 1ASUA 2LXFA 4TU7A 1ZAWA 1T03B 2CPDA 2G2ZA 2HRYA 3RU0A 2PYJA 3H46O 2KT2A 2R7XA 4C7QA 4CD3A 2HZAA 2DISA 2D3UA 1XMOF 3VR1A 2LECA 4KBIA 3ALYA 3O4WA 2PMWA 2HYIB 2IOCA 4XPEA 4DR5J 3HYFA 4H4KA 2XMUA 1S1UA 4CJEA 2JFDA 1L3VA 3DM2B 2CFXA 3KHGA 4EMDA 2DYAA 4GC6A 4FKXA 3NF9A 4USWA 3P5JA 3SDEA 4OPHA 4YR0A 1SKUB 3RB3A 2E29A 2D3OR 3OFEA 3D7SB 3HHNB 2UUBK 1Z4UA 5DS7A 4TQRA 2OPQA 4CGGA 2ZC3A 2DIUA 4DV7J 4ZPAA 2UV8A 1ASWA 1D9DA 1ZXOA 4NO7A 3QGGA 3UDLA 3MMJA 4KHMA 2BJ1A 4MLHA 1N36J 1WSHA 4GV3A 4JHDB 1FJ7A 1Y11A 4ICLA 3OR1B 3BDPA 2AGPA 4DR5K 2ZVIA 1ZZFA 2GA7A 1A5XA 4CO1A 3V5RA 4QS9A 4Y2MA 1VSIA 3RWUA 1NLKL 4CGDA 3THTA 4XEIA 2R42A 3OSNA 4CEQA 1U6ZA 1WG5A 2JH3A 4WFAL 1S4EA 4DV7K 4FWPA 4FF3A 3MR7A 1GLLO 1FWPA 4MYUA 1SJ3P 1N36K 1EX8A 3CUNA 1BUPA 1RWOB 2ZE2B 4ZHRB 2QLXA 2XQCA 4CJSA 2UV8G 5HANA 2VF3A 3D7EO 3W5ZA 3KYLA 2LEAA 4OJ3A 1IQTA 1VRUB 3D3CJ 5F8IA 4DPUA 4HH0A 3MOZA 1S1VB 2HSTA 4KHNA 1X5SA 2D0PA 1KLMB 4I9LA 2AJFE 3T5LA 2XSFA 4YOVA 2E88A 3CGIA 2PE8A 4FK4A 1VC0A 2AIRB 4ES2A 2OPPB 4PL8A 1WOOA 5DM7Q 1WF0A 3SQOP 2BR0A 2RHKA 1SH0A 2WTUA 4DOZA 4DLEA 3HPOA 1HQUB 2ERRA 4HUEA 2CUYA 3KLVA 4G3IA 2OANA 1AW0A 4Y1DA 4YDDB 1B3TA 4CE9A 2VBYA 4E8UA 1HNZF 3VCDA 4ZJQA 3LPUA 2DNRA 5HVFA 5KOXA 1ZBSA 5HOOA 2HLTA 4OYZA 1X31C 2N7CA 4B1XB 2ZGYA 2WONA 5HROB 5HLFA 4ZPWR 5J1PA 4A8QA 2AP1A 5J2MA 1RT7B 4PKDB 4CO2A 3MOJB 2MLYA 4V19X 2D4WA 4CJKA 4I2QA 4FPIA 2NYIA 4WFBL 2DY1A 2VOPA 4O23A 3NWRA 1YTYA 4WXOA 4MK9A 2P9EA 2ZJRQ 2CZ4A 2OMLA 4CT9A 5ADZA 4M5GA 5EVZA 2X51A 3VN5A 4M63C 3UKUB 1B99A 3AA9A 4ZVRB 2G8UA 3D6FB 3HHDA 4LMZA 1S9EA 2G2OA 1M5VC 3DOLB 2W1BA 4K4YA 4EGLA 1X5PA 4NLPA 4JRPA 1URRA 2DIVA 3J8AA 2IMOA 3FSXA 2QWOA 3KNAA 3UR0A 1FKPB 4NLDA 3M5RA 4OLAA 3GDQA 4KV8A 1N5YB 4KHPF 2ZVSA 2QG9B 2YJEA 1T7PA 4JI3J 4MDBA 5HBMA 4CBWA 1HWKA 2CQIA 3AHPA 2XEXA 1UA0A 4O44A 3TJ8A 4JI5F 4FLXA 4GO5X 3ULDA 1JNRB 1LW2B 4U9RA 2E7XA 2A1SA 4JKDA 1JIHA 5DQIA 4N41A 3THXB 2CQDA 1RSCA 3FQKA 1VBZA 2HF4A 4DL5A 3R6LB 4CESA 3DNCA 4BACA 3GYXB 2M2BA 1DQ8A 3KLGA 3M05A 1Q8LA 2NRWA 4JI3K 1K44A 1WC0A 2ZF5O 2ZHOA 4OJHA 2WOMB 4KC5A 2CADA 2PYLA 5C0YA 2B4UA 4H0OA 3JS9A 3WDOA 1RU2A 1REVB 1MWQA 3EVOA 1EKRA 2N4CA 5JVGQ 2EX3A 4KHSA 4H4KC 4CZEA 3DHXA 5I3UB 3ZZRA 3OT9A 3UIQA 4P2SA 4JV2A 1KD1T 3SBTA 4EP4A 3CM6A 2HRTA 3PSIA 1Q79A 1ATRA 2BM0A 3K2PA 5GAHI 5IM0A 4JI7J 4AHTA 4FS2A 1CZBA 2D3ZA 2V5HG 3GWCA 1S72S 2ASYA 6FDRA 3SCXA 3AVHA 2W2NP 5AFUH 1VQPN 1T9YA 4ZVGA 3DN9A 4B17A 2RUGA 3TWHA 4DR4J 4YOTA 3LW5C 4J9LA 1ESVA 1YVFA 4DU8A 1JXEA 4MIBA 3KLFB 4ZVTB 3O3HA 4FJ7A 1NDLA 3V1OA 4N77A 1V5IB 2C1EB 1F5CA 3NRBA 2VGMA 2P5OA 3UPFA 2VDHA 5BN9A 5T41A 2QK9A 2BE2B 1S9GA 2VC1A 3M6WA 4PA1A 3KKFA 3PHEA 3BQ1A 3VWSA 1WI8A 3RBXA 5KFWA 1X9JA 4R5PB 2MB0B 1S0OA 4DR4K 3HVWA 1JLBB 3KMSA 3DGPA 3OTOF 2QA4G 2MKSA 5LJ3Y 3KUHA 1FJCA 4TXSA 2RF2A 2XG8A 3PW5A 2V4RA 4AF1A 1KQGB 4WFNQ 2C3MA 3SFUA 4ZJLA 4ZPVR 2FBYA 1SJ1A 1RT2B 4FZVA 1T3NA 4EU0A 4QWAA 4DR1F 3QT6A 3PSFA 4CIEA 2E5LJ 3V9WA 2X6SA 7FDRA 3DU6A 2V2ZA 1VC6A 2B6AA 1WSRA 4WZQA 4B3SF 3SPZA 3QBCA 5AZJB 2FXUA 4EZ6A 2NLXA 2GVDA 2XS7A 3FMBA 4PXCA 5K8OA 4YHHF 3ILLA 3B8AX 3ZXWA 2F8MA 4BY9C 2CNKB 4J9PA 1PC4A 2C3PA 1BCMA 1OH5A 1JXVA 1H6KX 1HW9A 3KHRA 4LC9B 4MJKA 1NPKA 2E5LK 4LF5F 4CEZA 2XZDB 4ZLNA 1C0UA 3L3CA 2VG5B 3OFFA 3VGLA 1CS4B 3BV8A 3GFHA 4HH1A 4HL9A 2RRBA 3NH1A 2YX1A 3MXJA 4E1MA 5KFXA 1GLBG 2P1JA 2X3DA 1KD1O 4FWQA 1Q7YT 4U8YA 1C0GA 5E84A 2DCUB 1VLYA 5C5JA 3AJDA 3E51A 1VQLN 3A3PB 4DSLA 3EM1A 4HHTA 4LFAF 3MM8B 1YQHA 1IKYB 3Q8PB 1SV5A 5HRPA 1KVAA 3DCAA 3H2LA 3GZ7A 1U2VB 4JOUA 5CABA 2PEBA 1RACB 4NWBA 4BQLA 2VIHA 4F3OA 1JCGA 4LSNA 3ZC4A 3OR2B 1VDHA 5KT4A 4ED2A 1QTNB 4LF9J 2YPZA 4JS5A 4YB6A 1OY8A 2ROGA 3RSEA 1BIZA 1VQ6N 3I96A 4XH5A 3VQTA 4FYVB 3KDNA 4P9SA 1SI9A 1BHNA 2EKNA 1PJ6A 4Y0FA 2BJ7A 2L48A 3QDKA 4ZVHA 4ID5A 5HP1B 5AQSA 4CJ7A 3WXIA 4JI8F 4ZTFA 5CD4A 4OYXA 2HG4A 3U6FA 3CCJS 1UMJA 2GJ2A 3LGHA 5ETRA 4NZ6A 4HTUA 4LF9K 2ALZA 4CHOA 3VGTA 3SDEB 4LUBA 4JI0K 3UCUP 2CA9A 4UQTA 4IEIA 2W9BA 2RE1A 1D0EA 2OPQB 2I6WA 4QU7A 1TMJA 4IOCL 3OL9A 1NOYA 4BR0A 3SQ2A 4HHHA 1CJUA 4GRSA 4OJRA 3VF4A 3FCWA 2V7ZA 2DXEA 2HKEA 3EVMA 4ICLB 2Z1JA 2CKWA 5EOYA 4PPZA 4JKBA 1VQLS 3V9SA 3EUNA 1Q82T 1RQ0A 2F65A 4LVNP 2CGKA 3ILJA 3DXKB 4YY3F 3ZFVA 1CJTA 4OGEA 2HVEA 1B92A 2Q0RA 1J27A 1N0UA 1EKSA 4AXIA 1C0MA 5HQMA 1RAFB 3U3YA 5AQHA 1HBOB 4AUKA 3WC0A 3ISND 1QUPA 4KT0C 2A6AA 1GXUA 4JNEA 5M1QA 1T44A 2KKZA 4FLYA 2RDJA 2B4OA 4YUDA 1XR6A 2B0GA 1YHQN 2OI2A 5KFEA 4KB7A 5HJXA 1NEEA 2GBZA 2EC2A 1Q7YO 3KZBA 4LFBF 3OYFA 2OPSB 2EG2A 4NXMF 2P9UA 2I0XA 4YOUA 1NRKA 3GONA 4CBXA 4DR2F 3TZZA 3Q22A 2IVPA 4FLZA 1LAWA 4L75A 4QWBA 2D1KA 2W42A 1GXLA 1K6YA 2YWKA 2HHHK 3W9HA 1VBKA 4RW4B 2OO4A 3A0IX 4FWMA 1EO1A 3SI6A 3X3UA 1CQMA 5CCLA 2PFDA 2ROEA 1D1UA 3E8OA 4K4VA 5KQDA 4YB7A 1GAOA 1ZPWX 2VG6A 3RMDA 4GKKJ 2ZM6F 4NYFA 3NGIA 1NNDA 4HCBA 4OHXA 2K8GA 1KFSA 4KRFA 2XNRA 3AA5X 3VENA 2IVNA 4WYWA 3MDQA 2QSFA 4F2RA 2JOQA 3QT5A 5IT9U 2IS3A 1R0CB 2WONB 5HLFB 4ZDNA 5AQFA 1GEHA 4PR6A 3UR3C 4RWWA 2RKIB 1FESA 1H2TZ 2XC9A 3MR3A 1NJWA 2C2RA 3H45C 4I2QB 1M5SA 1Q5YA 4GKKK 2H5JB 1WB9A 4KGKA 1QAXA 4DU1A 4EP5A 2DFHA 1VK0A 3EE9A 4A62A 3E9LA 1XQIA 2HNYA 1SQEA 1TKTA 5SUHA 2GX9A 1SH3A 4LF6F 2UYTA 4JK8A 1WTFA 1DRZA 3PCOB 2GJFA 5AXMA 2KN4A 4RO0A 3PEHA 3RAMA 1WSGA 1S9EB 1YI2N 2DGWA 2GAGC 1S6OA 2QGFB 4GV9A 1HNZJ 3CXCM 1RCHA 2MHNA 4E7LA 4CVNE 1ZOTA 1FKAF 3SYZA 2IVYA 2A6MA 2MJNA 4MT1A 1T9XA 2DT9A 1C1CB 4O4GA 4MKVA 2FVCA 1CBKA 2VH7A 4CLKA 2Q6BA 2GUIA 4MK8A 4DSEA 3J80U 5HBMB 1Z2ZA 4GMJB 3V9ZA 4JI2J 2NSCA 5JVHL 3UD5A 4O44B 1IWGA 3TAMA 2RN2A 2Z8QA 4F4XA 2JVOA 3H5XA 1WSJA 4O3PA 1U48A 4F4KA 4K4TA 4HLBA 2W6LA 4A59A 5F8MA 3OBWA 1E6VA 5C15A 4BRFA 2A10A 2A0FB 2QJ3A 3NHGA 3KLGB 3CCTA 5ETOA 3OYCA 1TYQA 3I4HX 4QWCA 1HFEL 3MWPA 1TZ0A 3RZAA 2YH0A 5CHIA 2FSKA 3KK7A 3M7VA 2W8KA 1N32J 4ZVSB 5AQIA 2Z1IA 4URQU 2NR0A 4JI2K 2W7OA 4PWWA 4DLGA 1NH7A 4J2EA 2FJVA 4EWTA 2ASPA 2J4RA 1LK5A 4AH9A 5K9FA 5HMZA 2WBMA 1WF1A 1QHTA 3CDUA 3QAUA 1WLJA 2JWLA 3KWGA 3IA0A 4HDGA 1MLAA 3SQ4A 5IM0B 2VA2A 4PG8A 4ANDA 4H0TB 1YJNN 3CEDA 4Y2AA 1NPRA 2ZGZA 2C3OA 4AL5A 3HZGA 2YCHA 3C6UB 4PXEA 3F5TA 3OYIA 5E5NA 3G86A 1EWQA 3HOSA 4Z4IA 3CJ3A 1N32K 2VBZA 2O4GA 3I33A 1P90A 3K2YA 2ZNZA 1N34J 1FWKA 4DV4F 2EFQA 1RGIA 3C0BA 3ZX0A 4F0KA 1K73O 4QPXA 1DURA 5ETKA 4CJ3A 5AJ3J 3CCLS 3HD2A 1EP4A 1X4GA 2EKYA 1S9GB 3JB9k 2V8PA 4FF1A 4OKJA 3VEZA 2ADBA 2G13A 1Q9XA 1NM2A 1HBUA 3AAWB 3TYTA 3QERA 2WUSA 1S7HA 4CDIA 3OHBA 5J2QA 2KO1A 4CWBA 1GLCG 1T3VA 3DGPB 4C48A 4OI2A 1GH8A 2IPOB 4RUBA 2Y1LB 2OFGX 1N34K 3EGNA 1O5JA 1N33F 3BP8A 4YN3B 2RF2B 1FEHA 2CH5A 2GMJA 2AJ4A 5AJ3K 2GZOA 1K0VA 5D4PA 1UVJA 2OTJS 2AZ3A 3W64A 1FTRA 1NGBA 5LMNF 1IKWA 5J2NA 3W65A 3TSPA 3DU5A 4OYMA 1BG3A 1SC6A 5EHHA 1KWMA 4IJNA 4BRMA 2B6AB 4F0MA 3GR1A 4HHUA 2NCKL 1SL1A 5FLXO 1D4XA 3CPWM 2V2QA 4ETXA 3RBZA 2GVDB 4HWIA 4X65F 4H03B 1DTQA 1NDKA 3AH6A 2VBWA 2DH8A 1H73A 1HHSA 1LAVA 1GNKA 3TAPA 2YWFA 1UCNA 1YJNS 3ZT4A 2IYIA 4FZXC 4K0KK 4ILLA 1QUVA 3U9ZA 3V4MA 5GIPA 4OJGA 4P6QA 3H5UA 1OJ4A 3CJTA 4ZCKA 3W2WA 4I9QA 1C0UB 2FJEB 4DV0J 2DH7A 2EFPA 1TVRA 1JB0C 1TUYA 1RBOB 4EHTA 2E2QA 2QZ8A 4HI2A 4AYBD 2VZ9A 3C46A 5DJBA 3T1HF 3GCWP 4FWOA 1HPZA 1HI8A 3HSTB 2PBDA 1U6BA 4B1UB 4O5FA 2CG8A 1U09A 1LFPA 5KFFA 1RE1B 5AZIA 3NCPA 1JLGA 3U02A 2R8KA 1A5WA 1SV5B 1LFWA 3W3SA 4DV0K 4YHHJ 1RDDA 4YDUA 3NAEA 1QVGR 2R7QA 3TUPA 2EK1A 3SMZA 3K7RA 2C42A 4U7BA 4ECYA 2BMBA 4FYXB 3TVYA 4Q8FA 1V3SA 1PO6A 4LSNB 1KOOA 3D54A 3ONQA 3FMWA 3QJLA 1RA7A 4LF5J 5ETNA 2UUAF 5M2PA 2Y8YA 1RB0A 4X4QA 2FC8A 4YOEA 2CWXA 1J5OA 1FJGF 2NPIA 1UFLA 3BQ2A 4ID5B 4DS4A 3PW4A 5CQGA 4HUFA 1LWCA 4QYZJ 4ELVA 2DR6A 4CZJA 3GILA 2FHOB 3JTPA 5EWFA 3MTKA 1T3OA 4GW6A 4P52A 2ZZNA 2CH6A 2LQJA 4LF5K 3OFGA 1NGFA 2JEIA 3VEVA 3FBCA 3ZO7A 3NP5A 2B9YA 1PAEX 1EQMA 2W9BB 3BY5A 2FTRA 3NY0A 4OZ0A 2FLNA 3PX4A 1NK9A 3QGPA 3CSKA 1U24A 3PDNA 4QYZK 4F3MA 2OELA 4DQIA 1CJUB 1FE0A 1Z05A 3QO9B 2ZH6A 3MF5A 8ATCB 1QQMA 4PQUA 3R6GB 5GAEP 2DNLA 4DL2A 2GO8A 1VRQC 3CMQA 1TFYA 1WHYA 1CJTB 1AZSA 3CDAA 1R59O 4ZA1A 2IBKA 3MEGA 3L3UA 3H2UB 3MN5A 1LNQA 2QXLA 4DSIA 3MHYA 2V94A 2E66A 2QFJA 4QCLA 1B7YB 2WFBA 4WF9Q 3BBCA 4AQYJ 4A47A 3C7NA 1FNMA 4BR5A 1QE1A 2J0QD 1BQMA 2QA1A 4FM0A 1S99A 2GMHA 5ETQA 2GNKA 2QMUB 3A2FA 3OVNA 5KGWA 3H40A 2ADCA 2HQDA 5DM7L 2XCAA 4WP8A 2NUUG 3HJVA 4A8KA 2P9UB 2OFHX 5C24A 2OZMA 1SB6A 3HZEA 1ICEB 4ECXA 3WIUA 3ZSVA 1YIJN 3PTWA 3ZZZA 4Y1CA 5IT9Y 3NEKA 2I7PA 1RCXB 4I67A 3LTOA 3SUPA 5THWA 4CP5A 3DGVA 3ZZPA 3ENAA 4AQYK 4LBPA 4FK2A 3VQBA 4UY8O 4YY3J 2QWMA 3FFIA 1UZDA 1XTZA 5AQUA 3LDPA 3W5YA 2J6UA 2DGTA 1YJWN 1KP6A 1WG4A 3B8HA 2VG6B 4L74A 3MDFA 3DXMA 1XBWA 3NS7B 3GJQB 4WU2A 2UVWA 1S5ZA 1HNIA 3NH2A 1Z2LA 3I5CA 2Y9HA 3DLLQ 5E2QA 3SPYA 1XNQF 4FLTA 3MAHA 3V6DA 3SCJE 2B5JA 1YRXA 4JI1J 2F9JA 2VWBA 5FD1A 4CJRA 1NZAA 1ZS6A 4LFBJ 2ZJRL 4N5SA 5DG7A 3JSYA 1RHJB 3UQSA 4X4NA 1RYSA 3OY9A 5LL6Z 1B9FA 5K14A 4JS4A 2J6TA 2RRAA 2BH1A 4LIRA 4CFAA 4ECRA 4CFDA 2UU9J 3GFXA 2F1FA 4B1WB 2HK2A 1NNEA 4USUA 1RAOA 4DU4A 1QZ6A 1U1PA 4QU6A 4BWJA 2BEFA 2R8IA 4JI1K 5B08A 2MGZA 3LGNA 4K43A 1C0FA 3PW7A 5MLCQ 3RVCA 4OPJA 5D3GB 3S3MA 1NG9A 1BY9A 1U1OA 3B54A 3F0NA 2L41A 5AQXA 5E0OA 2UU9K 2V2VA 4BHQA 1NWKA 2MY7A 4TQSA 3KHHA 5F9LA 4O4GB 4KE5A 4NOHA 4USVA 4M3WA 1F60B 2RT3A 4DV3J 3TZXA 2D0AA 4EBEA 1VC5A 5BYRA 4G1IA 3AD9C 3W1YC 1X0PA 5AQPA 4QIWD 2HHVA 4ZPTR 3TTCA 3TAMB 3AXMA 1U1MA 4KGMA 2QFIA 4CFBA 3BGUA 4M5KA 1Y5NB 4RBVA 2HGNA 2DY4A 4DR7J 2E2NA 2YKOA 4YORA 1SUQA 5JVGL 4LF6J 2O8EA 1DTTB 1E6VB 1JXBA 3FJ2A 2OTLN 3TWZA 4BRGA 4DV3K 1TYQB 2M5YA 2O8FB 4CT8A 3DJCA 1RDAA 3K0JA 1MWKA 4CJ4A 5HATA 3HJFA 4BRIA 1FRKA 3OXFA 4GMKA 1PBUA 5AXLA 3KWMA 2XO6A 3ISZA 4LF7F 2CDQA 1NMDA 5IQQA 3KTQA 2UUCF 4ZLPA 2J7WA 2WVCA 4CERA 2PA8D 1X4FA 5KG4A 4B8AB 4DR7K 2J9DA 2WB1D 1Q81O 5IT0A 5F1XA 1JQGA 1VHFA 5E3QA 4C23A 4MTPA 2Z30B 1G1XA 4LY7A 1RDCA 2M4MA 3S3NA 1J2VA 3TUZC 2WB4A 2I9SA 4J9SA 3ZT3A 3TW0A 4KB1A 2M9KA 2P5GA 4DB3A 5CZVA 4NZ0A 4I1TA 2YWHA 1BO5O 3MPVA 4F25A 1WSEA 2E20A 1CULA 2P9CA 4KPCA 3HI0A 3KD1E 3ID6A 5IC6B 1EP4B 1B7FA 2QTWA 2V34A 4J9KA 1BWFO 1QM9A 3AO3A 3N4QA 4YOYA 1J5EF 4FXDA 2GIRA 3C6TA 4F26A 3EN9A 1CVJA 4WFNL 1HBUB 2Q43A 3MURP 2MLXA 3GE9A 3DDIA 5J2QB 2DXFA 4HKQA 1WG1A 1CLQA 3AVFA 1UEKA 3MFIA 4JP8A 3ZT1A 4JN4A 5HMYA 2LQBA 1LWXA 4DUZF 2Z0GA 1EB0A 2DXDA 3D2EA 3VQ6A 4IFVA 4ZCIA 3MD1A 1FHTA 1UWBA 2GJIA 2AJ2A 1Q9YA 2F9TA 3DXBA 1C4AA 4FYWB 3VA3A 5J2NB 3VQCA 3TZYA 1YAGA 3SEOA 5KT6A 3HL8A 1T9UA 3DDKA 1QS4A 4KKOA 4B3RF 1HNWF 4JYAJ 2W9CA 4BR7A 4FDFA 1JJ2R 1UJ4A 3KHLA 4TLQA 2KFZA 3E01A 4P10A 1DTQB 3MMCB 4FWKA 3U1LA 5AQRA 3FBBA 4OZJA 3RRKA 4UOGA 3R7NB 2XY6A 4BGAA 2K3IA 2F3JA 1YG0A 1SH2A 5BPLA 4W5TA 3THWA 4NLQA 2AF6A 1I94F 3Q8YA 5KRSA 1O13A 3M1FA 3K5MA 2Q79A 3JXUA 5KFYA 3W2WB 4OZ5A 4CHNA 1R3NA 1IG9A 4JYAK 4O4RA 3Q24A 2VFTA 3M8WA 2CPHA 4C98A 3AB2B 3SSSA 3M8YA 5LMNJ 1U1KA 1HPZB 4KO0A 1L3TA 3UNGC 2R7OA 4R8UA 5HI7A 1XMQF 1BDGA 4I2PA 3HSZA 3KJNB 1K8AT 3IWLA 1JLGB 4FWLA 1B64A 3SMSA 1DT9A 4U8VA 4WQ4A 5EU7A 3AO5A 4AHVA 5KFQA 3L4IA 4KTZA 5CAAA 1NJIT 3OUYB 4Q8EA 2JWNA 4KYZA 2D0BA 3RRHA 5G0RB 3U9DA 2Q6CA 4U7CA 2VQFJ 3UNYA 4H5RA 2BQ3A 4HUGA 2J8AA 2FHJA 3G6XA 3KUEA 3OYDA 2XCPA 4FWRA 1J5OB 1AROP 2X7IA 2KHCA 4PZVA 2DRAA 4M3RA 3W5XA 3F44A 4ILHA 1RGVA 3NAIA 4LSLA 2QWQA 1KHWA 3BREA 1VQ7N 3ZSOA 4NXNK 2DK2A 3TA0A 2DPNA 2VQFK 4F2SA 3D45A 1X9WA 1NK0A 1WORA 3QETA 4EBDA 3CJ9A 3MM6A 3VOVA 5F41A 5D4OA 6AT1B 3R3TA 4WFAQ 4ZCLA 4O5BA 4DX6A 4CK3A 1K9MT 3D1QA 3ZEUA 2CNNB 3HSGA 1RBAA 3L7PA 3TR8A 4CF0A 1U25A 4I68A 1DARA 2RS8A 3BB5A 2FJDB 1FVSA 4B3MF 4KFBA 1RWUA 4M5DB 2LA4A 5AQLA 4RUHA 4PQUB 1WHXA 3TOQA 3H25A 4FLWA 1BQNA 2X1AA 1ZZNA 2BQUA 1AZSB 2DNPA 2O1PA 2O8BA 4FJ5A 1H2VZ 4QIFA 2PO4A 5KT2A 2PT0A 2MZQA 4RNOA 3WIVA 2UP1A 4DV5J 4W90B 3LA0A 1OH8A 4QS7A 2XYHB 1EETA 1DQAA 1BC6A 1U1LA 1RADB 4CW7B 3C7NB 4UUWA 4BWMA 1QE1B 3G71N 1Q18A 1BQMB 3F9KA 2YX6A 2CPXA 3MN6A 1SZ2A 1S0MA 4CH0S 3H4BA 1JLCA 2IJRA 2IJNA 4ISGA 4KHWA 3D0PA 2NPFA 2F9WA 5C24B 5KFRA 3NNAA 4JI4J 1CZAN 1HQEB 3D67A 2FJWA 2XLJA 4DV5K 4ZS6A 3H5YA 1U8WA 1NJIO 2UXDJ 2D7SA 3DDNA 3R9LA 1HWJA 1CXQA 4CEAA 4Z2XA 4PKIA 3FFIB 1U0SA 2R7WA 3TTDA 4GVEA 4E7HA 1GK8A 4WFBQ 1VIXA 1ZA2B 2G1DA 2DTUA 1UA1A 4DX8H 1VQ5S 4OVLA 1TL3A 4CGJA 4NLCA 4ILMA 3DXMB 1VOMA 4JI4K 1P9YA 4K50A 2XS2A 3OYMA 2X78A 1HNIB 6FD1A 3V6DB 1Y00A 2B5JB 2UXDK 4IO1A 3NCQA 4OYIA 5JLFA 3H0PA 4ZLJA 3NLCA 4LF8J 3H90A 2HVZA 3CJ1A 4JLHA 4YS2A 2HHTA 5K14B 4J9QA 1NMNA 1S4FA 4G1PA 1VQSA 1U0HA 4CIGA 3B4MA 3DLGA 4XDDA 2R8GA 4OHVA 4ETZA 2KB2A 4UOFA 3DMJA 3ENBA 2JL9A 5BXIA 4C6AA 3G71S 3OS0A 5ETLA 2MEWA 2HMPA 1QAIA 2ZBRA 1N8RT 2CPFA 4DPXA 2MYFA 2HFSA 4LF8K 3FEXB 3CFOA 2VG7A 4CZMA 4DFPA 3P31A 2OCEA 2LQ9A 3L9ZA 1Y9OA 2IM0A 3IGVA 2DGXA 4LH4A 2RH3A 4DSFA 2CVIA 4C3KA 2CQGA 4WQ4C 4OL8A 4E1NA 3HVTA 2ATQA 3H6EA 4FJGA 4M41A 5RUBA 4DFJA 1WOSA 3QRRA 3M2RB 3B6PA 2HURA 4K4WA 1XWLA 3SUQA 2DNNA 2KVQE 1RAGB 3HVAA 1XERA 3QFWA 2LSNA 2DGOA 5DGAA 1GX6A 5DO2A 3FCVA 2I2YA 1W97L 1SUQB 5D4NA 2O8EB 3FZ2A 2LFVA 2Z4PA 2YY3A 4RLEA 2V9WA 2HHXA 1RDRA 3RGIA 4IQXA 3O9RA 3TQEA 2AW0A 5GAEI 2VD3A 1H2UX 3JSMA 5FPNA 1VK3A 5F8JA 5T7LA 2PA3A 2NUHA 2ASDA 3QLHA 2ASLA 1MWYA 2MQOA 3J7A1 4NYOA 2LYVA 2H9ZA 4HHJA 4A57A 4H0XB 1UJ6A 3RAQA 1TK8A 2GHPA 3WXKA 2Q1LA 3UVJA 2CQ0A 2B9EA 4ZP7A 2R7VA 4B3OA 1DHMA 2ACYA 3MZIA 1RBLA 3GU0A 3MPYA 1RUSA 2Z2YB 2JWKA 1WBDA 3CMAS 2HFZA 3VGUA 3AXKA 2JEGA 2ZDPA 3VGSA 4WWSA 4OZ3A 1SXLA 4X62F 3C3LA 4WCEL 1TMMA 1EAYC 1PYTA 1SQGA 3I32A 4LFCJ 4URSA 3RR7A 1RHRB 1OPZA 5A8KB 4YNQA 3L2QA 4GVMA 2KQ2A 4ILRA 3W8GA 1FVQA 2YKNA 4DSKA 4WK3A 3IR7B 4ZCMA 4OZLA 2F7TA 1R0AA 3VAFA 4ZJOA 4CEFA 2VJUA 5B0FA 4OX8A 3OYEA 3C6TB 5D78A 5IWAF 1KFDA 3HCXA 4PWUA 1R6VA 2GQCA 2E2PA 2FZCB 4ED1A 4CZIA 4LFCK 3TJAA 3R1HA 3AO4A 2MDAA 3EGWB 3I8BA 1AB8A 1WDDA 4JBCA 1VQ9N 2GVZA 3ETOA 5AQJA 1FTCA 3D2EB 4IFVB 2UXBJ 1UWBB 3D66A 2NRXA 3ZSRA 3CWJA 4M5HA 3BQ0A 5HO4A 4IG3A 2M8DB 4PWDA 1SKRA 4BC2A 4NLBA 1RWNB 4TLRA 3MCMA 4DTPA 3J81U 4KKOB 5C2CA 2W9CB 2J9EA 2H51B 1SL2A 4CECA 3PLAA 1I51B 3P4IA 4ECWA 2MMYA 2XMVA 1U1RA 3E01B 1RLDA 2QTDA 5A6PA 2DR5A 5DDPC 3KK1A 4KI4A 2UXBK 2GIFA 1GLAG 2Z1GA 3GIIA 2VFVA 3BH6B 2YNHA 2J9CA 5FLXU 4BS2A 2HB5A 5HK4A 1Q53A 4RBTA 2DHGA 1RNHA 3H59A 4RG8A 4FJXA 2VHGA 2IVMA 3R5CA 1PG5B 1KDNA 1FO1A 3NF8A 3OQ2A 5CZ1A 2ZHBA 2ZH2A 4Z4HA 2RIJA 3G8QA 3EE8A 3LAKA 2ALYB 3C19A 3GP9A 2Q66A 2CQ3A 3DRXA 4ECSA 2PAVA 4CO5A 1KVCA 4RL1A 4DQPA 4DFMA 5DGBA 3R3LA 3QIPA 4DL6A 4G9ZA 4X4RA 4FNIA 1U8SA 3ZZTA 4RTFD 4PG6A 4R8UB 2EK6A 4A8SA 3BBFA 3C16A 3ZETA 4I2PB 1KAZA 3H7HB 3R1XA 5EY4A 2CJAA 3VVTA 1A5VA 1RU1A 3LWLA 1GQEA 4X64J 3UDVA 1HKCA 4X84A 3B82A 1X9MA 1IV0A 2HBZB 3LP2A 3PG9A 2GFFA 3JQMA 4WK1A 5L8RC 4PHTX 2QN6B 3AT1B 3CJ4A 3RW6A 2WSFC 1W2BR 4KH6A 1HA1A 4FWSA 1J54A 4CM0A 4C8KA 3QIDA 2VWKA 4MMOA 1HQ2A 3CG7A 3KNGA 4A8YA 1RT1A 1SKSA 2HFNA 2EWHA 1C1BA 4PL7A 1A9NB 2MZTA 5BRDA 4P2XA 3PJWA 2VGNA 4LBIA 3F73A 1IBKF 4X64K 4M3XA 2PN6A 4LSLB 2BACA 1TGOA 3DLBA 5BPMA 3UCGA 1XMQJ 4M5NA 4CIOA 4DF8A 3AAQA 2KM8C 2HQGA 5GAHP 1JCFA 1FRHA 4Y00A 2YQ1A 2LXUA 1JJ4A 1MMLA 3HTVA 4DV1F 4ER8A 3FZMA 4IBNA 1LEOA 3MM6B 1Q86T 5IOLA 4OQJA 1YSJA 4P74A 2FF6A 2QYCA 1X5OA 4C11B 1I3AA 3ZEUB 3M8RA 2BKNA 4RUAA 3IBWA 1XK8A 3RB4A 3KMQA 4GKJJ 3ZSYA 3CCRN 3ZTPA 2E1ZA 2EBGA 3E2EA 1YJVA 4PG7A 4CI6A 1XMQK 3IAS9 5KFBA 4RW8A 4DUYJ 4WF9L 1JLFA 2QRRA 3RG6A 2IM2A 3VF0B 1VQNN 3MTJA 1RDBA 1P1TA 4H5NA 4TU8A 5CZXA 2O8BB 5C25A 2Z2MA 1S6UA 5B09A 1JLQB 5KFZA 4H8KA 5IT9O 3TU5A 3BM7A 3ITHA 3AJ1A 4CLFA 4DV2K 4AL7A 4FLUA 4GKJK 4IOAQ 2KW4A 3Q83A 1EETB 1VCTA 1XC3A 3D9BA 2HS4A 1AA1B 1Y7PA 3A8EA 3PKYA 5AXNA 4DUYK 1H1VA 5HQ8A 4C1NI 1PCAA 2BUNA 2OZSA 2MPUA 2VQEF 1K8KA 1UW4A 1JLCB 3VQSA 2CVEA 1Q7LB 2XNQA 4JI6F 3EWGA 2DRBA 2L9DA 2NRTA 4RX6A 3JTNA 4O3NA 3F2KA 4DTUA 3O1WA 3PZPA 2O67A 4U7UK 4JRQA 3CIPA 4E7JA 2XBPA 2X1BA 3CQYA 3K9JA 3LALA 2OPRA 3DLLL 5JUMA 1NCLA 2I38A 4HEA9 3D5MA 3HFKA 2XB2D 2ZOMA 2JDJA 1TL3B 2NRHA 2V50A 2POKA 3CCRS 2C2OB 4ZTJA 5H9EJ 4BBYA 2PIIA 2ZQBA 4ZVUB 2QWLA 3ZYYX 1WUUA 2R8JA 1FRLA 3O9QA 1E3MA 3FFKB 1AFIA 3AO2A 2HS3A 1YJ9S 3CJRA 3HMJG 4TN2A 1S77D 5D0HA 4WQ5A 4GY2B 2V67A 1M90T 1CXUA 1VQNS 1BQXA 1HR0J 2MTLA 3BGFA 2KXFA 4ZVFA 4EYIB 2HK3A 1S5JA 4Y65A 4USJC 1YXQA 5A2QU 3R97A 3FVYA 2KYXA 1ZA1B 3HP9A 2F63A 5I3QA 4QW8A 1U0HB 3IUCA 1B0TA 1W7WA 3DLGB 5KFVA 1X4HA 2WK4A 2EC0A 4U67Q 1K1QA 4J2DA 3DMJB 2OD6A 1F1BB 4PEOA 4NA2A 3G82B 3GOIA 3WNFA 3CCQS 5B7WA 2J8SA 5LXRA 4UQGA 1X60A 3AVCA 1BL3A 2VASA 4DMZA 1HR0K 4TY8A 3I87A 2VG7B 3GG4A 1VQ4N 3HT0A 2O01C 3VGMA 4WP3A 4DL7A 1X1PA 3OFHA 2A6OA 4PUOA 2W25A 5LM7E 2PGCA 5L1KA 1ITPA 4W5NA 4IH7A 4MIWA 2DR9A 3I82A 3IFRA 3UE5A 3CCZA 1FEEA 4ATNA 2P5VA 4ED6A 1RT5A 3TX8A 5L9NA 4JKGB 4CBUA 5HSPA 3ATVA 1T9TA 1MN7A 3QFUA 5KFHA 2HHPA 2HS0A 4ZK7M 1KAXA 4YR2A 1YUWA 1FD2A 3OHRA 2WW8A 5ELZA 4C2MA 5C12A 1NGJA 5K8MA 4UY85 3L95X 4L8RB 5C42B 4Q7AA 2ZBQA 3GJTB 3GIJA 3LDOA 3F9MA 5AR0A 1HYVA 3UN5A 3SIPB 4UT4A 3HSCA 1X4AA 3QRPA 1QJHA 3SUOA 2GIQA 1IJEB 3OL7A 5FROA 2G9OA 2Y3YA 3BN7A 2NYHA 3JSMB 5KGXA 5T7LB 1T02A 4L76A 3SBMA 3WBZA 1V3ZA 3SK3A 1SAZA 2RPIA 4BRNA 3T3FA 4YB5A 2DFFA 3ZSXA 5KFGA 3UVJB 1S10A 2YKMA 3BF4A 3DLKA 2QLBB 2Z2ZA 5ETVA 4LF4J 3UN3A 5EUHA 5M1KA 2YBVA 5CHCB 2OHDA 4CH1A 4BC4A 2HQCA 1RLCL 4O3OA 3VAMA 3CNQP 1VQ4S 2V63A 2G0CA 4CLWA 3AVLA 2F4VJ 2IVOA 1HHTP 1HKGA 3LM9A 2R2RA 4USIA 4DKWA 3EXYA 3P8BB 5A6WA 3BPSP 2CGLA 5AE1A 1MW7A 3MEEB 3AVJA 2KFYA 1R0AB 4LJMA 3SQGA 4LF4K 3J81Y 2GS8A 2MKJA 5H1SQ 3RB6A 2AGQA 4WIQA 2X1GA 3IR5B 4MDAA 1TQLA 4O8KA 3FC9A 4UZBA 2CJ9A 4CTAA 5ETSA 3BEGB 4DR3K 4IYQA 2M0GB 3ENHA 3GB0A 2RU3A 4M63A 4DQSA 2F4VK 4R25A 4Z37A 4ZOSA 1VGYA 1RAIB 2ZZMA 1XR5A 2GVZB 2QSWA 4FKYA 4WZMA 1YBAA 2ZJPQ 2HFOA 1G15A 4BGBA 3A1YG 4M3TA 4IG3B 3ENWA 4PWDB 1Z26A 5KG6A 2QWPA 4AT1B 4DPOA 2HBLA 1IM4A 2EFNA 1C4CA 1WJ9A 2BQRA 3P39A 2E1RA 3D68A 2VBXA 4KH1B 4I7FA 3BEXA 1LQ9A 5GADI 2G4BA 1DJ0A 3T5HA 3CJ5A 2ZH1A 4WE1A 2FJBB 2XY7A 5AFUA 5IWAJ 2FVQA 3KK1B 3R5AA 2M88A 3AV9A 1RXOB 3EY1A 2WHOA 2YNHB 4BVPA 2HWHA 1UWAA 2CJYB 2P9IA 4NLUA 4CK1A 4PCQA 4RU9A 4OX9J 3FZLA 3L7UA 4RWXA 1PAUB 4OHZA 3FKBA 1WEYA 2PMHA 4WQ5C 1U2CA 2BX6A 1IKVA 2I1RA 3C6HA 1R8AA 1VMBA 3T6JA 2RQ4A 1TUWA 2K1RA 4IJAA 3QIPB 4DCPB 3B6OA 1KSPA 5IWAK 4NLYA 3V6KA 1NOZA 2QYGA 1NB2A 4YP3A 1WAFA 2V7YA 2Y8WA 3GJSB 3C16B 1KEKA 2R7SA 2G0IA 2LP4A 3LPEA 3CJ2A 1L5UA 2DEJA 3OA9A 4NCGB 3G10A 1QY7A 2P9NA 3TVZA 1H38A 3GMGA 3T9NA 4OX9K 3HKZD 2APOA 2R4FA 2EW9A 5KFCA 2FC0A 2FUG9 2AA4A 2RU9A 4RJVA 3LP2B 5KFIA 3S1TA 3G4SN 5FJ4A 1XIQA 4BCAA 5TKYA 4LR7A 1NGIA 3GBTA 2MQNA 4U7UD 2FYXA 2Q2RA 3SLCA 5KRTA 3QFHA 3AGKA 1IBLF 2DPIA 1TELA 1NPPA 3OSPA 3DI6B 4TKTA 4IFYA 4WP9A 3TANA 4LRAA 1C1BB 1UPMB 1VK8A 1TKZA 3H5SA 4F04B 2ZKUA 4X4TA 2W24A 4P71A 2VCPA 4NYNA 2XHBA 3IR6B 3EKSA 3GFYA 3CCMN 2VB6A