2OPSA

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
542
structure length
535
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 134
structure length 535
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2opsA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2opsA05
3EY1A 1C2PA 2WHOA 3RBDA 3OSPA 1B92A 4K4VA 4GC7A 2X6SA 1ZBFA 2BE2A 1RT6A 4ECZA 4E0DA 1DTQB 4KRFA 3DRPA 2J6SA 4FM1A 1S1VB 3CJ3A 3QZ8A 1N5YB 4MK8A 3BJYA 4JS5A 3DM2A 2HNDA 3G0ZA 1CLQA 3V6HA 4DL7A 4JRQA 3D5MA 1LWCB 2W7PA 3PW5A 3LPTA 5KI6A 4CEAA 3M9NB 4CJ3A 1C6VA 4FLXA 2C2DA 4ID1A 2B43A 4ZPDA 3ALYA 4QWBA 1TVRB 5KT7A 1IKXB 3ZT4A 1RNHA 2R2TA 3ZSYA 1HNVA 3AVCA 2G8KA 4LSLA 4E19A 4NCGA 4FLYA 4DU4A 3KK2B 3QERA 2XCPA 2R7YA 3H4DA 2PY5A 1VRUB 1WAFA 4DTOA 3AVFA 1LW0B 4Y2AA 4K4TA 3DRSB 1JLFB 4FJGA 3BSAA 1VRTB 2B6AA 4OJRA 5DG7A 3GIJA 1S1WA 3EPIA 1S9EA 1RT2B 1VK0A 1S6QA 4JS4A 3LDSA 2IM3A 3RMDA 4DTJA 3UDLA 2WB4A 5C5JA 2RPIA 1SKRA 1HQUA 4M3XA 3V81B 2HNZA 2W9CA 4Q44A 1C0UB 4IH6A 1A5WA 4FJNA 5DK5A 3PO5A 2HWHA 2R8JA 4FVMA 4N56A 2FJVA 4WE1A 4IRDA 3IS9B 1BIZA 3TAEA 5DG8A 1FKOA 3PX6A 4TYBA 3V9WA 5KG5A 5EDWA 4NLRA 4YR3A 4FW2A 1HJRA 3AVGA 5KT4A 5KFQA 4C8KA 4MFBB 3LP2B 3N6MA 4ED1A 4QWDA 3DM2B 3PW4A 1ZBHA 1ZTWA 4NCGB 5CY4A 1QAJA 2R2SA 3M9MB 2LSNA 2DTUA 3LZIA 1MMLA 4ZTJA 1BI4A 1QTMA 2XY5A 4E7JA 4DSLA 4J9OA 3QYYA 3DRSA 4N41A 4W5OA 4YNQA 2O4IA 1HYSB 2VA3A 4ECVA 1TAQA 5KFWA 4ZHRB 3BQ2A 1QSYA 3OLAA 3CDEA 5F8MA 1WN7A 4MQ3A 4IQXA 4ZVHA 1O1WA 4M3RA 2FC0A 4HUEA 4CEEA 1UA0A 1DLOB 3ZT1A 1WSFA 3LAKA 3E51A 4DQPA 4Z4HA 1RBSA 2D41A 1NKCA 3ZSVA 4R5PB 4FJ7A 4H54A 2XCAA 3NAIA 3U3YA 2P5GA 1UWBB 2BANA 4OGCA 2GV9A 5EUHA 1BHLA 4I2QB 4RW9A 4MKBA 5J2MB 2IM0A 4KB7A 4CGIA 3KJVB 4Q5VA 3CJ0A 5CYQB 4Z4IA 4C8OA 5C24A 3BDPA 2HW3A 3L2WA 4CHPA 4X2BA 5EU7A 2AQ4A 5KFTA 4FJKA 4URSA 1JXBA 3FQLA 1VSFA 2ILYA 1QSLA 2UVUA 2J6UA 3KHGA 4ED0A 2G8WA 3OYAA 3QEPA 2WOMA 3KTQA 5K14A 1LV5A 1YTUA 3EZUA 5KFFA 5HLFB 4B9UA 3ULDA 3MR2A 3B6PA 4F4WA 4CF1A 3LP1A 1C1BA 4GW6A 4DFJA 1KHVA 4E7HA 4IKFA 1R0AB 4LSNA 1RT3A 4HTUA 4ECRA 2R2UA 4FYDA 1NHVA 3LAMA 1Z26A 3OYHA 5JXSA 4PQUB 4AILC 1A5VA 4NYZA 3O4QA 4Q0BB 3VA3A 1JLBB 4ED7A 2AGOA 3DOKA 1TGOA 1W9HA 4CEQA 4U6PA 1T03B 3P1GA 3CYMA 2IM2A 5HP1A 3KD1E 4I7FA 2IOCA 3T5JA 3TR8A 1LWCA 3KLHB 3DLKA 2YKNB 3SI8A 2I5JA 4DEZA 4RW7B 1IKVB 1J5OB 4FZYA 4GC6A 5L9XA 2F8TA 3DMJB 2RKIA 5KFMA 3QNOA 4DLEA 1RT7A 2V0NA 4KAIA 5KFVA 4CECA 3OL6A 3KNAA 5DQGA 4KBIA 5HROB 1IKXA 3RAQA 2JLEA 1T05B 4PUOA 1IKWA 5F8HA 1FK9A 4TY8A 3D28A 3PJWA 3KJVA 1VRUA 3H5XA 4ED2A 1QE1A 3M8PB 4DFMA 2DFHA 1S1WB 5KFEA 2YNGB 3KLIA 4ID5A 2XY6A 4CK1A 1D9DA 4J9LA 1JKHB 2GBZA 4DQIA 4NZ0A 3BSOA 2OH2A 1REVB 3GIKA 2PZSA 4KI4A 3T1AA 1NJZA 1S4FA 3PX4A 5EWEA 3SJJA 1S6QB 2OPPB 3HJFA 1RTDB 4IH7A 2ASJA 3KK2A 2HNYA 1YVUA 4KPYA 5HRSA 1S9GB 3K5NA 3OYJA 3HPHA 3QGHA 2ASLA 1LWFA 2VA2A 3ZSXA 4KV8A 1I3AA 1NK7A 3TWHA 3TQ1A 4QWCA 5KFCA 4RG8A 4NLOA 2AU0A 3DLGA 2Z1GA 1TL3A 3OLBA 4Y3CA 4Z4GA 2VWKA 3V81A 3MXIA 4EZ6A 4QWAA 3HP9A 5SZTA 4RW6B 1S97A 1IKWB 3T19A 2P5OA 4G1QB 4DU3A 4R8UB 2FBTA 1RTHA 3DLRA 2GC8A 4BE1A 2YNIA 1RT4A 1TQLA 1I39A 4KHWA 3IS9A 4RNNA 4ZTFA 1LAWA 4LQ3A 3V1RA 3DMJA 3PZPA 3NGZA 4CFBA 3MEDA 1BQNB 5KFYA 2F8SA 2O5DA 1RT5A 4H4MB 4CIEA 1VSKA 3RMBA 3E01B 2J6TA 2V4QA 1JLEA 2E6LA 4FK0A 3KOAA 4PY5A 4ED6A 1BIUA 5DG9A 1BQMB 4M3UA 3AVHA 3ASMA 3CJ4A 2YHAA 1CZBA 4YQWA 3S9HA 4ECQA 3O3FA 3QNNA 3SCXA 4FK2A 1UWBA 3ZSQA 3K5LA 3KLVA 3V9SA 4YR0A 3WNGA 4DWIA 4RUAA 2D0CA 1JXLA 1N5YA 4I9QA 4KO0A 2C2RA 4DSFA 3K59A 1W25A 1ASVA 1VSLA 2VG5A 2XO7A 3M8SA 5L1JA 1D5AA 1RA7A 1B9DA 4ED3A 3TAFA 5C24B 4DQRA 3VQSA 1LWEB 5KFAA 5F8GA 2V9WA 3CQ8A 2B5JB 5JS2A 3DYAB 1K1QA 4J9NA 5KFNA 4KB1A 4RNOA 3OL8A 4LY7A 4GMJB 4C8NA 2RF2B 1BGXT 1QAIA 4CEDA 5K14B 5KFOA 3TVKA 3HHKA 3G6YA 2HHQA 2EC0A 2VG7B 4ZP8A 4Q0BA 4CGHA 4CFDA 1NJYA 1YVFA 3DRRB 3DRPB 3C6UA 2BR0A 3FRZA 2W9AA 4RNHA 4CGJA 5I42B 3KHLA 1KRPA 3HKWA 1N6QB 4ZP6A 2C2EA 3BREA 4RNFA 5KGXA 4FJJA 4JLHA 3H98A 4U7CA 4CHYA 3DOKB 4OVLA 5FRMA 4RW9B 3SUNA 3T5HA 4ELTA 4EEYA 4NLDA 2X6NA 2E6MA 1QHTA 3NMAA 1RBVA 3EYZA 4ZVFA 1NKBA 2DY4A 3HVTA 3CJ2A 4F8RA 4PUOB 1NK8A 2X74A 3PX0A 1NK9A 4DF4A 4TSXA 4CK3A 3H59A 1S1UB 3U3GA 5KG4A 3H4BA 3BSCA 4FM0A 4B9LA 2AGPA 4KHUA 1W0HA 3RWUA 4IRKA 5KFPA 1TV6B 2IM1A 2RKIB 3CFOA 2DPJA 4O3PA 3DLKB 1NOZA 4EYHB 1GOBA 5C25A 5DQIA 3NF8A 1IO2A 2IBKA 3KK1B 3SUPA 1QS4A 3PR5B 3V4IA 4KHSA 3QO9B 5D3GA 3SQ4A 3LPUA 1JLAB 1KHWA 1RT7B 3IGVA 2HNYB 3I0SA 3RB6A 2OPRB 1RBRA 4W5NA 1S9GA 4EO8A 3ISNC 5F8IA 1C1CA 2FBXA 4OGEA 3KHHA 3DDKA 1JKHA 3HYFA 3NBPB 2G8FA 1TKZA 3C94A 3T5KA 3OHBA 4Q8EA 1WAJA 3AVNA 4BACA 5EWGA 4ZP7A 1L3TA 2Y1IA 4RW7A 3AO2A 2D3UA 2KZMA 4BE0A 1DLOA 4TN2A 2FVSA 5JUMA 3L8BA 3NFAA 3WNHA 3OYFA 3VA0A 1X9SA 4AHTA 1N56A 5KG3A 3CO9A 2YV0X 4M3TA 4R5PA 1ASWA 4FBUA 4CF2A 3HK2A 3JYTB 1FK9B 2A1RA 4K4YA 4IFVB 4ECXA 4CJLA 3V6JA 4DTSA 5J2PB 3ZCMA 1CZ9A 4CEOA 2C28A 5CYQA 3H08A 4DLGA 3DI6A 3KLIB 3C95A 4N5SA 3RBEA 5F9LA 1C1BB 2IJNA 5KG2A 4WXOA 3VQBA 4F2RA 4O0IA 3GQCA 1YT3A 4O44B 1RAJA 2XWYA 4DG1B 3RTVA 4R8UA 1FKPA 3E01A 3H5YA 3O3GA 4NLYA 4F3OA 3OY9A 2BDPA 1C1CB 1S1XA 4K8XA 1IKYB 4CHQA 1RDDA 1HNIA 4RW8B 4F50A 1LW2B 3D45A 3B6OA 1S48A 2YHBA 4CERA 3LP1B 3OS1A 3GIIA 3GIMA 3FFIB 3UQSA 4ECYA 3GV7B 4HKQA 4RZRA 3GV8B 3CVKA 4PWDB 3BSNA 4KHYA 3OS0A 3L2UA 5J1EB 1U48A 1KLMA 3CWJA 3VQ7A 3SNNA 4FJIA 4KSEB 4WFYA 3H40A 3TABA 4DQQA 4ZPAA 4EYIB 4DSJA 2C22A 4FJLA 3MF5A 4EBCA 4UQGA 3G6XA 1VRTA 4ZPBA 2BQUA 1ZBLA 1EP4B 1U4BA 3QLHA 4AHUA 3OYCA 2HVHA 3OYGA 2HHSA 3OYLA 2IAJB 2OPSB 4F4KA 4O3OA 1Q8IA 3DRRA 4OL8A 4HYKA 3RB3A 4C8MA 1QQCA 1U45A 3MAQA 2OZMA 4PQUA 4RW4B 3C6UB 2YNGA 3HXMA 1Q9XA 1JX4A 3H2LA 2AGQA 4RU9A 3S3NA 2VG6A 3OYIA 3AA4A 1Y97A 3ZSRA 2QK9A 2YKMB 4J9MA 4O3RA 4BDYA 3SV4A 1XHZA 2FVQA 1G15A 2YKNA 2GUIA 3MEEB 5KFKA 4O4GA 5HRRA 3VQDA 2R8KA 4N76A 4W5RA 1IKYA 2IC3A 1T7PA 4ED8A 3WNEA 1S1UA 4CHOA 2A1SA 4HUFA 1RILA 3NGYA 2HB5A 3HPOA 2ZE2A 5KG0A 4FJ5A 4KB0A 4EBEA 1TK8A 1RTJB 4H4OB 3OJSA 5CYMA 2IS3A 2WTFA 4WFZA 3DLGB 3SYZA 3BGRB 1N4LA 1HYZA 4URQU 5KT3A 1GOAA 3CIZA 3HP6A 3CFPA 3VN5A 3TAMA 3SZ2A 1S0OA 3ZSZA 4FJMA 4JRPA 3OJUA 2OPPA 1TL1A 3LALA 1NK5A 1D8YA 3LP0B 4QOZB 3GV5B 1JLGB 1S9FA 3RMAA 3VQ9A 3OYNA 4B8CA 4L8RB 3HPGA 3V4IB 1HPZA 4O3QA 2IAJA 2OPSA 2XRIA 4AH9A 5C25B 1NK6A 4M42A 1RT5B 3NE6A 2P51A 1QSSA 1JXEA 1IH7A 5C42A 5HBMB 3K58A 3PO4A 4DF8A 1LAVA 3QIPB 3V6DB 3ZT0A 3MEGA 3JSMA 4FLUA 3BR9A 1BQMA 2NUBA 3SPYA 4QW8A 1K6YA 3I0SB 4O55A 4QAGA 1RT1A 2XI3A 4RW4A 5KG1A 4KKOB 4CGFA 1Z4UA 2YNFA 4E7IA 3CJ5A 3NHGA 3AA3A 1DTTB 4MH8A 2FJWA 1SL1A 3QGIA 4B3OB 1TKZB 4FS1A 4FBTA 1WSEA 3HSTB 3OS2A 5EWFA 2OZSA 4EZ9A 4OPJA 1VSJA 2VWJA 3S3OA 4YP3A 4FLZA 1HRHA 2XY7A 4CJRA 4FS2A 4TQSA 1BISA 1TK0A 2P1JA 1GX6A 4B8AB 3UPFA 4MIAA 4ECUA 3VQCA 5CZ2A 1TP7A 2D0AA 4E1MA 3M8QB 1KTQA 4MFBA 5FROA 2HHWA 2FLNA 4BDZA 3I0RA 1ASUA 4XO0A 3EZ5A 4PWDA 4IG0A 4DL5A 2YNHA 4CHNA 1FKPB 2JEIA 1RT6B 3K2PA 4NYNA 1XR6A 3KKRA 5CZ1A 3FFIA 4NCAA 3QIPA 5KTQA 2KQ2A 2F8EX 2E9ZA 1TL1B 4TXSA 4RW8A 3SQ2A 4NLUA 3AVBA 5I42A 1JLGA 4FJHA 3KD5E 3TAGA 4KHQA 3CM5A 4CJ4A 1RBUA 2EX3A 4CIFA 4C8LA 3G6VA 4ECWA 3VQ6A 1VSMA 1HNIB 1F21A 5KRTA 4O0JA 4NLGA 4DS5A 4CJVA 2FBVA 5HBMA 2BRKA 3Q8QB 4B9VA 2AX0A 1WSGA 1KVCA 2B5JA 4DSIA 1ZETA 4JV2A 2E9RX 1OS5A 3NDKA 1HNVB 4KI6A 4K4ZA 3PW7A 2IMWP 5J2NA 4I2QA 3THVA 5L1LA 5JS1A 4ZP9A 1MU2A 1S5JA 3DLEA 3QEIA 4CJSA 4BDPA 1J54A 5KFLA 4DL6A 5HRNA 4O3NA 1QE1B 1S0MA 1RBTA 3MXMA 4Z4CA 3RRGA 3RR7A 2ATLA 4OLBA 4G3IA 4MK7A 4WXWA 4KFBB 4K4WA 4AHRA 4J2EA 4NLWA 1RTHB 3VQ5A 3C6TB 3ITHA 1C0UA 1XI1A 5KT5A 2GIQA 3M8QA 1D0EA 5KFDA 3VQEA 3NH1A 3RAXA 4I2PB 1BQNA 3AO1A 2I5JB 5J2MA 4DL4A 4RNMA 3MR6A 4AHCA 4ZVGA 4H4MA 3MEEA 3AO4A 2W7OA 2G8VA 4EBDA 3DI6B 1R0AA 4NLXA 2Z1HA 2YKMA 4QCLA 3ZT2A 3SPZA 3F73A 4N47A 3ZSWA 2OA8A 4NYFA 3KLGA 2G8UA 3AVIA 4IG3A 2HAIA 4LH5A 4IR1A 3SQ0A 1KVAA 4E1NA 4QPXA 4NLSA 2FLPA 3U6FA 4CCHA 3MECA 1KSPA 3OYKA 3QZ7A 2OPRA 1TK5A 3NH2A 2OPQB 3CG7A 2XHBA 4NLQA 1RT2A 1J5OA 2ILZA 4OPKA 1U47A 2B6AB 1RTIA 5F8JA 1TVRA 3PV8A 1B9FA 1S0NA 4FZZA 4FXDA 2QKBA 5J2NB 3SI6A 1A5XA 4K4SA 4JV1A 4J2DA 3QESA 2FVRA 3M8RA 4FZXC 4IDKB 4I9LA 1T03A 3LANA 2E9TA 3DOLB 4OKEA 2QXFA 4ID5B 2Z1IA 4CF8A 1S9EB 3LP2A 4DMNA 1N48A 1REVA 2HHVA 4HHTA 4CEZA 3L3VA 4Q8FA 2W9BA 4KFBA 4J2AA 4ZPCA 4XIUA 1CSJA 4FW1A 1D1UA 3KLFA 4F4YA 2Q3SA 3V6DA 3L2RA 1Q9YA 3SFUA 4DTNA 5HROA 3IRXB 4AHSA 2ZD1A 4ELVA 1SH3A 4E7LA 4CF9A 1X9WA 1SV5A 4F4XA 4DFPA 3HVRA 4CJUA 2JEJA 1NKEA 5DMRA 5KT2A 2BGGA 4W5TA 1DTTA 4WYWA 3NH0A 1S49A 4KV8B 4K50A 1VSIA 4B9NA 3A2FA 1HYSA 4H8KA 3HVAA 3NAHA 5L1KA 4Y1DA 3M8PA 1WSJA 5I3UB 5C42B 1X9MA 2JEGA 2G8IA 5KG7A 4M3ZA 3KKSA 3IG1B 3MR3A 2W8LA 3SFGA 4BWJA 1VSHA 3V1QA 4F4ZA 5KG6A 3V9ZA 4IR9A 4KKOA 2YNFB 3L3UA 4KTZA 2I1RA 3MR5A 4CK2A 3IAYA 4LQ9A 4M95A 3KLHA 4KHMA 4ZMMA 4LSNB 5D3GB 4NRUA 2BQRA 4IG0B 4KAZA 1HMVB 2W9BB 1RDCA 3BGRA 2KFZA 4O4GB 3V6KA 3SUOA 5J2QB 3QINA 3NF9A 2VG5B 4LSLB 2D3ZA 4DL2A 4DL3A 1NK0A 3V9UA 3PHEA 1FXXA 3TAQA 5FDLA 4KE5A 3KK3B 5E41A 1X1PA 1HYVA 2YNIB 4CJFA 1IKVA 2WRMA 4KTWA 1RT3B 3FQKA 4NLVA 4BE2A 3PJXA 3CFRA 3QEVA 2YNHB 2VG7A 3UIQA 3NL0A 4FLVA 5DLFA 3IRXA 3AO5A 1SL0A 3HT3A 4G1QA 1EXQA 4M94A 4TY8B 4DTPA 4WFXA 1QUVA 4DU1A 1XHXA 5KFJA 4Y1CA 3MFIA 3OSNA 1EX4A 1JL1A 5HP1B 1LWEA 2FVCA 1ITGA 5FRNA 3RRHA 1XC9A 5KFZA 1YTAA 3BQ0A 1HQEB 1LWFB 3OHAA 4DQSA 4O44A 2PYLA 3WNFA 3RB4A 1SUQB 1T94A 3DLHA 1S6PB 3N6NA 3KLGB 2HHUA 4CFCA 3S3MA 4XPEA 4J9SA 3D0PA 1VSEA 3P83D 3AVMA 2HHXA 4KHRA 2IA6A 3O4NA 4NCBA 1SKSA 4E3SA 3Q8PB 3PY8A 3NGIA 2CJQA 4R0EA 2RDJA 3KK3A 2ZQBA 1T05A 2PYJA 4I2PA 2ZKUA 2O4GA 3OYDA 4CJTA 1T8EA 5KFHA 1C0TB 3KLEA 1IM4A 1I6JA 4CJKA 1TL3B 4K8ZA 4M41A 5KFSA 3Q8SB 1TKXA 3LZJA 1WNEA 5KFRA 1JLQB 3ISND 3V1OA 1C0MA 2HMIB 4Z0UA 4CJWA 4CGGA 4ECTA 2UUTA 1WSIA 5F8NA 2EHGA 4EP5A 4DS4A 4DTMA 3QIDA 3VQ8A 3AA5X 1VSDA 1RTDA 5F8LA 3MECB 2CKWA 1SL2A 4KREA 3K5OA 3AV9A 1RT1B 4Y2CA 1UOCA 3NAEA 2ASDA 3M9OB 2IDOA 1JLCB 1TKDA 4HCBA 4IKAA 4Q43A 5KFUA 1KFSA 3QGGA 5F9NA 1ZTTA 3MFHA 4KO0B 1IG9A 4AHVA 4IG3B 1L3VA 4DTXA 1NOYA 2JC0A 3TANA 2B4JA 4Z4FA 2DFEA 1SV5B 4RW6A 1GX5A 4J9RA 1MU2B 1XR7A 3HL8A 4IRCA 4EO6A 1L3UA 2KFNA 1BCMA 1RDAA 1T3NA 1XR5A 3T3FA 2F96A 2HWIA 4CE9A 3KLEB 5SWMA 3HVTB 3QIOA 3I5BA 1GOCA 4K4UA 3HVWA 2HNDB 3PW0A 3EPGA 3KLFB 3KMSA 1EETB 4CIGA 2WK4A 4B9SA 2WONB 4K4XA 4ZVEA 2XGQA 2R8GA 4CGDA 4M3YA 4EP4A 3O3HA 1JLBA 4ELUA 4HUGA 4MKAA 2W42A 1C0TA 1J53A 1RT4B 3NBPA 2XI2A 3NF6A 5DGBA 2BQ3A 5KFIA 3GYNA 4NLTA 2QKKA 4QW9A 3NF7A 1ZBUA 2QV6A 1SH0A 4B9MA 3NGDA 3AA2A 5J2QA 2R8IA 3OL9A 1U09A 4FLTA 3IGNA 3AVKA 3MTKA 3SV3A 4FJ8A 1LW2A 1LW0A 4WYLA 1L5UA 3IG1A 3F9KA 1BL3A 3OL7A 1JLFA 1J9AA 1EP4A 2UVVA 2IGIA 2BE2B 1HMVA 4KTQA 3DLEB 1SH2A 4CJEA 2JGUA 4FLWA 4Y34A 3K5MA 1S1VA 2W8KA 2HNZB 2W9CB 3AVLA 1D9FA 3MXJA 3DYAA 1HARA 2QE5A 5DLGA 4MK9A 5I3UA 4YMEA 4YR2A 5FDLB 2GIRA 4ICLB 3LWMA 3LWLA 4DFKA 3N6LA 2FBYA 4Z4EA 4CJQA 3ZSOA 1UA1A 4RUCA 4IBNA 2R8HA 3TI0A 3I8DA 1S10A 2Z1JA 3CM6A 1HQEA 2KW4A 4FJ9A 1N6QA 2WOMB 4BWMA 5KFXA 2JEFA 4IFYA 1JLAA 4JUZA 2R2RA 4IH5A 4TQRA 1SUQA 3G86A 3HO1A 2D0BA 2ITGA 3ICLA 3KHRA 2OYQA 3JYTA 5HRPA 4LH4A 3DOLA 4FK4A 5L1IA 4OKKA 4TY9A 4HVJA 1WNSA 2E4LA 3CDWA 3K57A 4TYAA 1NNDA 3PUFA 2ALZA 3MEDB 1RA6A 4NRTA 1RYSA 3LP3A 3SQ1A 3SUQA 3KK1A 1RTIB 4J9PA 5KFGA 3P5JA 4LD0A 4E7KA 2HMIA 1S1TA 2WCXA 3FSIA 2FVPA 4IFVA 4DSEA 3BQ1A 4CHZA 2D7SA 3QLHB 1NHUA 3PR4A 3PW2A 4FCYA 3G10A 4M45A 3OYBA 1Z25A 1TKXB 4E89A 3VQQA 1WLJA 1U04A 3AVJA 4FM2A 1RCHA 2AX1A 4QWEA 1TKTA 3IN5A 5J1EA 4J2BA 4FJXA 1JL2A 3PVXA 1JIHA 4XPCA 3GILA 2DFFA 1RDBA 3I5CA 4WZQA 1KLNA 2FLLA 4WE1B 3VQPA 3UR0A 4URGA 3V9XA 1FKOB 4J9KA 4W5QA 4B3OA 5KFBA 2FJXA 4CJ5A 4O4RA 4PA1A 4CEBA 3QEWA 1ZYQA 4IFYB 4TLRA 3OYMA 1HPZB 4O5BA 2ATQA 3CDUA 3QEXA 5J2PA 2JC1A 3T5LA 4IOBA 2AWZA 4DG1A 1HQUB 3MEGB 2RF2A 3JSMB 2ETJA 1JLQA 1NK4A 2IC3B 2Y1JA 1RYRA 5DQHA 2XC9A 1UAXA 4HCCA 1S1TB 2IJFA 4I7FB 1EETA 2ZE2B 1BI4B 4NLPA 2AJQA 1KFDA 1WSHA 4DSKA 1NJXA 5CYMB 2RDIA 1BCOA 1CXUA 3KIOA 3AO3A 2DPIA 1JLCA 4YFUA 4B08A 1RDRA 1SKWA 1DTQA 3RB0A 3L2QA 3L2VA 2WONA 1S6PA 1K1SA 3VQ4A 5HLFA 5T7BA 5DGAA 3I0RB 3TARA 2UVRA 2BANB 3ZT3A 1NJWA 2OPQA 4M3WA 1S1XB 3VQAA 2G8HA 3FDSA 5T14A 2RN2A 2UUWA 1XWLA 1JLEB 3HM9A 1TV6A 1TAUA 3OVNA 4H4OA 4CFAA 4ZHRA 5KGWA 4B9TA 2D5RA 1TKTB 4WZMA 1ZBIA 2V4RA 3AVAA 3OYEA 3KMQA 3QETA 1KLMB 3I5AA 3QO9A 4F3TA 3TAMB 3H5UA 3NKYA 4IDKA 2HHTA 5KRSA 4OKJA 3NCIA 4KHNA 1KCFA 4CEFA 3LP0A 1L3SA 4CJPA 1RTJA 4CF0A 1EKEA 4DTRA 5KT6A 2VG6B 4OLAA 4Q45A 4JV0A 4CESA 2UVWA 4GVMA 2KTQA 2X78A 3TAPA 2KZZA 3RR8A 4ICLA 1KVBA 4J9QA 4O3SA 4F2SA 2ZD1B 3C6TA 3ITHB 2BRLA 3H5SA 4MIBA 2XGPA 3DLBA 3RMCA 1CXQA 4DTUA 2HVIA 1U49A 3Q8RB 4ECSA 1C1AA 2XY8A
chains in the Genus database with same CATH superfamily
3EY1A 1HPMA 1OWXA 4IO1A 4OX6A 2R7RA 1ZBFA 4ECZA 4KRFA 3QDKA 3VTHA 1S1VB 3BZQA 2FF3B 4BC7A 2CQCA 1N5YB 2XHWA 2VV5A 3DM2A 5DRKA 3AOCA 2HPUA 3TUZC 2KL8A 3G0ZA 2DR8A 4JRQA 4RBTA 2VC1A 4O8UA 2QEXS 1KVJA 4HEA9 1FRXA 4CBWA 4FNIA 4FLXA 2C2DA 1YJRA 4ZPWR 4IJNA 2B43A 4JV5J 1T02A 4QWBA 3AGRA 3F9MA 3HHLA 1NGEA 2RJZA 1B7YB 5AQYA 1F6TA 4E19A 4NCGA 5DETA 1TMMA 5BPLA 5A8RB 4ZPTR 1LW0B 2CZ4A 5ETMA 2Q31A 3H8YA 4BG8A 1YTYA 2H65B 2ZH9A 4OV6A 1M90O 2WBMA 1VK0A 4DTJA 3UDLA 5C5JA 1WG5A 1FNXH 2VPZB 1XNQK 1HQUA 2D4WA 3ZZYA 1EO1A 2W9CA 4AT1B 1EB0A 3W60A 4M63C 3CF5L 4MKVA 3A8IA 1V6HA 2Q1NA 5E3CA 1F2GA 3KHYA 3LDOA 3IS9B 3PX6A 3V9WA 2GEMA 5EDWA 4NLRA 4YR3A 1HJRA 3AVGA 2NXNA 3T1HJ 4CT8A 4HHJA 3DXSX 3RG6A 3EZWA 4QWDA 2QXLA 1ZBHA 1WHYA 3O8WA 1PGZA 9RUBA 2R2SA 3M9MB 4C6AA 3AODA 5D78A 1MMLA 3LZIA 1WTFA 4E7JA 2IRYA 3VMFB 5JJBA 4NXMK 2FGOA 3DRSA 3CIPA 1NBWA 4JKCA 2VA3A 4ECVA 4OZLA 1TAQA 3HD1A 4BR9A 1QSYA 3AXMA 1CJVA 4GRSA 5HN0A 4P52A 5JLHA 1O1WA 4DV1K 4M3RA 4CLFA 4HUEA 1DLOB 3ZT1A 4DQPA 3E51A 2OFHX 4KH6A 1LFPA 2MZQA 1G3OA 1NKCA 3U02A 3LDQA 3FSYA 2UU9J 4JI8K 3EGNA 1VQOS 3THWB 4FJ7A 4H54A 3M8YA 2QO3A 3U3YA 1JXVA 2W2PP 4C11B 1UWBB 4YDDB 1X4GA 4JYAF 1BHLA 4RW9A 2PFDA 3NWRA 4KB7A 3FFKB 4LR9A 2NRVA 3BDPA 2HK3A 1R8PA 1JXBA 2IIHA 3Q0AA 4ILJA 1VQLN 4ED0A 4AFFA 3LDPA 4IJAA 1U1OA 2WOMA 1Y5NB 1S6OA 2EFPA 3KTQA 5K14A 3ZO7A 1YTUA 4J8FA 2EBEA 1ACMB 3MR2A 1R43A 3MD1A 5LJ3Y 4CF1A 3LP1A 2ZJQQ 3MPDA 1KHVA 1R0AB 1RAIB 3TSQA 4JB8B 1AFIA 3UKUA 2MSSA 4A8WA 4ECRA 2XMTA 2R2UA 4FYDA 4CYUB 3OYHA 4UF4A 2ZITA 2NYHA 2EFGA 4Q0BB 1NDLA 3OPKA 1VFJA 3ZZOA 1UCNA 3AOAA 4ED7A 1W9HA 2Q6CA 2MKIA 1BE4A 3CYMA 1V9OA 3D1QA 2N4CA 2Z30B 3KD1E 4U96A 1H7WA 2ZJPL 2HHPA 2YKNB 3MM8A 2I5JA 1IKVB 1J5OB 2RKIA 1NG9A 3QNOA 2DK2A 3NOGA 3KNAA 1RXOB 4KBIA 4BQLA 3ZC4A 5F8HA 1HWJA 3MUVP 4ZKAA 3J81O 3N5BA 2DFHA 5KFEA 2YNGB 4ZPVR 4C0OC 3EM1A 3FBEA 2B4UA 2KYXA 3MD3A 1RZMA 1Y0HA 4CLZA 3JTOA 4E8UA 3AA8A 2E1YA 4KI4A 3PX4A 1NSKL 3J7Z5 2ASJA 3KK2A 2RRBA 2HNYA 1Y5IB 4LRCA 5B7WA 1EARA 4C23A 5HRSA 4JI1J 3OYJA 1RBOB 3QGHA 1EWQA 1I3AA 1FRKA 4QWCA 2NRZA 1JWWA 4LF5J 4UOFA 3CJ9A 2Z1GA 5CCMA 4NASA 4EZ6A 4QWAA 1ZA2B 3BGOP 4G1QB 2HRTA 3O6QA 3CC7S 4DU3A 1YJWN 2I7NA 2GC8A 3FVYA 3MM8B 1RT4A 3AHPA 1LAWA 4LQ3A 1IBKJ 2CH6A 2FJAB 2V5HG 5KFYA 1ZC6A 4K2JA 4Y2KA 1RT5A 4MYTA 3CPEA 2CJYB 4JI4J 4UTGA 3WXKA 2GHVC 3MCSA 2V4QA 3A5NC 4FK0A 2RHQB 4YS2A 4ED6A 1LKZA 1Q78A 3QT7A 1TR0A 3KG4A 4P2SA 3S41A 3CJ4A 1IQZA 2C2NA 2ZZMA 1CZBA 3S9HA 3BKUA 3VALA 1BQXA 1XMOF 1RGVA 2B51A 2FZGB 2HOEA 3TO8A 3WQTA 4ZVRB 3T1YF 2Q97A 3V9SA 4FWKA 5AQWA 4DWIA 1NXIA 1JXLA 1QVGR 3MWTA 1WBDA 1VQKN 2JRSA 2XLKA 2QLJB 3DHXA 2NSBA 5HVFA 1CJTB 3K59A 4XDDA 1W25A 1MWYA 4FZVA 1ASVA 2XO7A 1D5AA 1RA7A 5EX3A 3TAFA 4FWLA 4HVZA 2R7QA 1VK8A 3LPEA 3CQXA 3ZZ0A 3PSIA 3K9KA 1Q0NA 1Z1ZA 3CQ8A 2B5JB 3DYAB 1YI2N 2QWRA 4J9VA 5EN1A 4C8NA 4CEDA 1F0XA 2P8IA 4DR4K 5C2CA 2VG7B 4ZP8A 4DU7A 1MDUB 4CGHA 5GADP 2IPOB 1NJYA 3DRRB 1E3MA 3C6UA 2BR0A 1CS4B 2W9AA 2J9DE 5IM0B 1I94J 2MGZA 4M5NA 2JFKA 4ZJLA 3KDOA 4FJJA 4DN0A 4DR1F 3H98A 4NWBA 4OVLA 3SUNA 3T5HA 2VPYB 3VGMA 4EEYA 4DV4K 2O8EA 1QHTA 4CT9A 3EVOA 4OPAA 3HVTA 4FN5A 4PUOB 3EVWA 2QLXA 2OJ3A 3CULA 2X74A 5FLXY 2VU5A 2NZCA 4DF4A 1MWQA 4K7QA 2Y8WA 3QMLA 4CK3A 3H59A 5F0XA 4FM0A 2ZH8A 2AGPA 4PG7A 1JJ4A 1TV6B 2XSJA 3VGUA 3CFOA 2RKIB 1NU4A 2DPJA 2F40A 4O3PA 1TL7A 2BKPA 1GOBA 5C25A 1BU6O 4KH1B 4A2BA 1IO2A 2RS8A 2IBKA 4KGZB 1HBUA 1FI4A 2JVOA 3VTIA 1VJWA 1QQMA 2EBGA 4ILLA 4JN4A 1RT7B 2WSCC 4NA2A 3HHDA 5IS2A 4LIWA 5F8IA 1RSCA 1T9VA 1DQ9A 2WBNA 3R1XA 2G8FA 3C94A 3UB5A 4Q8EA 3I6PA 3SXLA 4BACA 5U47A 5EWGA 1FWPA 4ZP7A 4K42A 5K8MA 3AO2A 3PEHA 1N5QA 2EG2A 1S0VA 3ULEB 3DGPA 4FL9A 3H3NO 3PRDA 3L8BA 3VA0A 1X9SA 4AHTA 3CO9A 4AQYK 4K0KK 4P7TA 3C0BA 3US5A 1DARA 3HTVA 2A1RA 2CQHA 3V6JA 1KOOA 4DR7F 4DTSA 1CZ9A 4A8OA 3MN6A 3OBIA 4A8MP 2KRRA 4LJMA 5DDQC 4DLGA 2DISA 4GVBB 3KLIB 4N5SA 3MMAA 2GVDA 3AA9A 3OR1A 4U67Q 3TSPA 1AZSB 3FBCA 3VQBA 4F2RA 4ITSA 4O44B 2G0CA 4DG1B 1NB7A 1FKPA 1WG1A 1RKIA 2DGQA 1SIZA 3SCJE 1APSA 2L48A 1XMOK 4YHHK 4O5FA 1S1XA 4CHQA 1P90A 2VBWA 1GMWA 1O0PA 4LF8J 3GIMA 1TUUA 5BXIA 4RZRA 1JK9B 1KN6A 1RHKB 3CVKA 3Q24A 1GH8A 1KLMA 3CWJA 2OSQA 3SNNA 5JVHL 3NMRA 3PDNA 3TABA 1CULA 3WXJA 3I4PA 3CDBA 3R6GB 5HVGA 3OFEA 3G6XA 3TZXA 2ZUGA 5HMYA 4WFNL 2XULA 4H0XB 3EE9A 3EZOA 4OI2A 3QLHA 3OYCA 5K8NA 2ZJPQ 2I0XA 2F4VJ 1U2FA 3FEXB 4O3OA 3PIOL 4KQZA 3MCMA 2HQIA 4HL9A 3RB3A 3I87A 4C8MA 4U8VA 2MZTA 2HYIB 4RW4B 1XN9A 1VQLS 1R8HA 2YKQA 4QZVB 1QY7A 3H2LA 3NWGA 1FESA 2VG6A 3OYIA 1Y97A 3TU5A 3ZSRA 4O3RA 1XHZA 4ZLLA 3TX0A 2GUIA 3FBBA 2FIUA 4O4GA 4HWIA 4N76A 1T7PA 1IKYA 1S1UA 5AXNA 2A1SA 1RILA 2HB5A 3RYLA 3UCGA 4KB0A 4EBEA 1R8AA 3P49B 2QRRA 4WFZA 3DXBA 3TTFA 3LUYA 4URQU 5KT3A 1T3VA 2A3JA 1QQOA 2CDQA 1S0OA 3RGIA 2BE7D 1VHIA 3SIPB 2PMZD 4OX7A 3ILLA 3H25A 4X62J 2YH0A 1NK5A 2R7SA 3GV5B 4QOZB 1S9FA 3VQ9A 3OYNA 2HLTA 4O3QA 2PBDA 4AH9A 1JXEA 2YPYA 4DF8A 3ZETB 3V6DB 3JSMA 3LW5C 3BR9A 2NUBA 1RDWX 1NSQA 4X62K 4FWNA 3PG9A 6FDRA 4RW4A 5HMWA 1K73O 3Q7CA 2QSWA 4KKOB 3NLCA 1Z4UA 4E7IA 3CJ5A 2ADCA 3R6LB 1T9WA 2FJWA 1WORA 3QGIA 3FGUA 5BN8A 4A57A 2ZH7A 2V9KA 3RUBL 2R7XA 3HSTB 3OS2A 2OZSA 3C7NB 4YOEA 1WUAA 2CGJA 2XM3A 1UAWA 4BRPA 1BISA 3R7NB 5BR8J 1NMDA 2JLFA 2P1JA 4B8AB 4DV7F 2MXYA 3UPFA 1VQNN 1GMWD 5D0EA 1OQ6A 4WFBL 3W5YA 3AFGA 3G71S 3SQGA 1KTQA 2K7KA 1WKKA 5KOWA 3I0RA 1SVDA 3PTWA 1OO0B 4DV5J 3CCTA 3QIPA 5KTQA 2WTUA 2JJ4D 2UV8A 4M7XA 2E9ZA 5A8KA 4KH0B 4IYQA 2M5YA 2Z56B 2V8DA 3R5BA 1G99A 1NCLA 3AVBA 1RBUA 3VQ6A 1VSMA 3P4IA 2C3UA 4O0JA 4CJVA 1UWAA 2B9XA 5HBMA 2OD6A 2BRKA 2VD3A 5HANA 1KVCA 4FOIA 3T9ZA 3W2WA 2J7UA 5HVHA 2FHOB 2F9JA 1HNVB 4YB1P 2K06A 1FFSB 2DT9A 4WIIA 1P9QC 1MU2A 4L73A 1DBDA 4CJSA 5KFLA 4JD2B 4DL6A 3ZZTA 4OV1A 4O3NA 3VGTA 4X84A 1BWFO 2HFSA 3D9BA 1RBTA 4A5BA 2VFTA 2W4DA 2UV8G 4DKWA 3SEOA 2QA2A 1T9XA 2PO4A 4DV0F 4TNOA 1UETA 4K4WA 3R1HA 4DN9A 1YRUA 2F63A 3ITHA 1XNRJ 2MZ1A 2DO4A 3LDNA 4IEEA 2WB1D 3CO0P 2QTDA 2GIQA 1N33J 3DWLA 5DM6L 3WX8A 4I2PB 3M2VB 4DV2F 5E3PA 1J2VA 1NMEB 4AHCA 4ZVGA 4H4MA 3MEEA 4JI1F 3DI6B 2ROPA 4LF9J 1PSDA 1R59O 4ZDNA 4QCLA 4GMKA 3DLLQ 3ZT2A 3BBFA 2V2KA 3Q22A 4IG3A 5GINA 1X5SA 2HAIA 2WBRA 3GMGA 3H3OB 4IR1A 4LF5F 4AQYJ 4E1NA 1E6VB 4LF7K 4DR2J 4HH1A 4OPHA 1U1KA 3RSEB 5AJ3K 1F5BA 3NH2A 2C1EB 4YDUC 2OPQB 2JX2A 5AE2A 4NLQA 1GLJO 1CBKA 4KY3A 5ADXA 2YBVA 5LMNF 1U47A 2WC9A 4A8YA 1B9FA 1S0NA 2QKBA 3AD9C 1KD1T 2BZ2A 3G6ES 1IBKF 3SI6A 2RQ4A 3EO3A 1T3OA 3QESA 3A0IX 5K9FA 2UXDF 2B56A 4IDKB 2J7WA 4AM7A 3CCMN 5EX0A 2D3OR 4XTTA 2QJ3A 3LP2A 4DMNA 2HHVA 4CEZA 4PKHA 2GJ2A 2LA4A 2XS7A 4ED4A 1SPBP 4DTNA 4IOAL 1OH7A 1TL5A 1BWEA 3N4WA 1YF5L 1XMQJ 4CF9A 3M2VA 2PFFB 3DHWC 3HVRA 3WQPA 3V2UC 2F9WA 3KYLA 4B9NA 2CYYA 3IP0A 2BJEA 2H9ZA 2W8LA 3Q8UA 2QYCA 4FPIA 2BUNA 4KTZA 1YJ7A 3IAYA 4PAAA 4DV0K 2RE2A 1HBUB 5D8HB 4ZVOB 4M95A 4ZMMA 1K8AO 1UVMA 2FDNA 4BVPA 4KAZA 2IMOA 3A3OB 5FPNA 3EGZA 1M1KT 3VEYA 3QATA 3QINA 2HWTA 2NQPA 4DCJB 2DRAA 2KYZA 4OYBA 4NB4A 3CJRA 1SJQA 2HZCA 3JQJA 3R5CA 5E41A 1ZM4A 1HW9A 1TELA 1RADB 2AJ2A 1R8BA 2W2OP 3HHLC 4NLVA 4ALZA 5DO2A 2YNHB 3NL0A 3AO5A 1SL0A 5D15A 3D6RA 1SJ3P 4TY8B 1QUVA 2ALYB 1F9FA 4Y1CA 3ETMA 1EX4A 4ZJOA 2YKOA 1Q86T 2BM0A 1FX2A 5FLXU 4FWPA 1LWEA 3GFZA 1YHQS 3MMBB 5FRNA 3WDOA 2W2QP 3OBWA 4OI0A 2KT2A 1LWFB 2C3YA 4O44A 2PYLA 1MG7A 3WNFA 1XNQF 3RB4A 1SUQB 3CCSN 3KLGB 4RUHA 3DLLL 3WEEB 4L76A 3GBTA 4QPTA 4KHRA 2E2QA 4NCBA 4NO7A 1WACA 4E3SA 2YTCA 1SJFA 3MTJA 3O2IA 1UVIA 4BRNA 3D2EB 3MAHA 4A2AA 5ITHA 1UTAA 3GPAA 5KFHA 1C0TB 2HZVA 3ZEUB 1ILYA 4WFBQ 2JWLA 1IM4A 1E4GT 4DR7J 4M41A 3W63A 2W4PA 1N34K 2WVBA 3NS5A 5KFRA 4HR2A 2UU9K 4K0KF 4DUTA 4GO7X 4CGGA 4GKJF 3QSYB 4EP5A 4DTMA 1YIJN 2H5IB 2FSNA 2C3OA 1Q8BA 4ZIVA 1VSDA 3HFZB 4DL0C 3E2EA 3KVGA 3WQUA 3UCZP 1W2IA 2HQFA 5ADXH 3WXMB 1OJ4A 1Y11A 3NAEA 3M9OB 3VOVA 1N36J 2YX1A 4MDBA 1H38A 4Q43A 1HHSA 4FYVB 5KFUA 3FCVA 2F7TA 3MFHA 1HNZJ 1ZH5A 3DLJA 2FC9A 1L3VA 5HI7A 4B3MK 1NOYA 3JAMO 2JC0A 4PXBA 4JI7F 4EIAA 5DZ7A 5B0EA 1SV5B 3H46O 4ZJQA 1MU2B 3O1WA 3HL8A 1Y5LB 4EO6A 1L3UA 3FUYA 4EI2A 3B8AX 1Q5VA 3MCPA 1LWXA 1XR5A 3T3FA 3FZBA 4QS9A 3T6JA 4C48A 2ZF5O 4YDUA 1Y9OA 3IA0A 1SC1B 2GHPA 3EJMA 4JI3J 2MPUA 3BF1A 1FWLA 2Z0GA 1H2UX 1WSVA 3KZBA 4E2FB 1WOSA 2DXEA 3CCSS 2WONB 2AEJA 4ZVEA 2BBEA 4M3YA 4LIRA 3WC2A 1U1RA 2DNNA 1MSWD 2XI2A 4NOHA 3THXA 4NLTA 5C10A 2CNOB 4M5IA 5CXTA 1SH0A 1VQNS 4B9MA 3G25A 3OL9A 2IYIA 1AW0A 5THWA 3S01A 3W3DA 3DJCA 3IG1A 2BKNA 3F9KA 1VS3A 3OUYA 4TKTA 3OL7A 1JLFA 2E5LJ 5EGYA 4MO5A 5A6PA 2UVVA 3TQEA 4CJ7A 2KXHA 3WIUA 2DHSA 2XMVA 8RUCA 4M5LA 1LK5A 2IVYA 3TUPA 3TA0A 4Y34A 3K5MA 1X4FA 2HNZB 2DCUB 1D9FA 4LT6A 2EEYA 5IV4A 2O8FB 4OLOA 1OSCA 4N77A 5ETLA 3P5TL 3H45C 2GIRA 3PIPQ 2VGMA 5AR0A 2JWNA 2FBYA 4AYBD 4CJQA 3R3TA 2ZH3A 1O6XA 1RBLA 1S10A 3NVKA 2JVRA 4PHTX 3V5RA 3I55S 1HQEA 1NGDA 2KW4A 3AOBA 4X62F 2FLOA 5HAOA 5KFXA 4CZLA 1OVQA 3HDSA 2P9LA 2HF4A 1JLAA 2AEFA 4BROA 1B99A 1YX2A 3HI0A 2R2RA 3BGFA 4LFCK 2ZJRQ 1SUQA 4WK1A 1CULB 4EU0A 3A5LC 2D0BA 2ITGA 3THWA 2ATCB 5AQOA 1FFWB 3DDNA 1M5HA 5M1PA 3AAWB 1E6VA 1U02A 5BRDA 5A0YB 4XEIA 3M1VB 5A8KB 2CJ9A 3CCRS 4M1KA 1NDCA 3SUQA 1FFGB 4J9PA 2HBKA 5AQGA 4C8ZA 4C3MA 4E7KA 2HBQB 1CPZA 4DSEA 3BQ1A 2D7SA 2E5JA 4FCYA 3MMBA 4CLWA 3OYBA 1RCOB 3CI5A 1TKXB 5L8RC 3E1YA 1Q7YT 3VQQA 1ATSA 1HNXF 4DUZF 2I38A 2DNZA 3QT6A 4CM2A 1TKTA 4GV6A 5J1EA 3TP2A 3MWPA 4FJXA 1JL2A 2YI1A 1U8WA 4X64K 1UZHA 2RE1A 3QQCD 2XQCA 1KLNA 3OTOJ 1P27B 2WSEC 2M3DA 4B3OA 2MQLA 3SSSA 2Y0SD 2PA3A 5K20B 3VAMA 3OYMA 4ZK7M 3VF2A 2A2DA 1Q7YO 4IDHA 2MDAA 2P9UB 2AWZA 5A2QY 1NK4A 2IC3B 4B1WB 3ETOA 1RYRA 2HBJA 5KQ8A 4USIA 4KC5A 1S1TB 5GAHP 4I7FB 1WBBA 1SJ4P 2Y8YA 2AJQA 2NLXA 1RLDA 2CQ3A 1J6ZA 3HFKA 2HRYA 1Q7LB 4ER8A 4B08A 3VR1A 1RDRA 1SKWA 4DX6A 2V2ZA 3L9ZA 1UMJA 2ASPA 3CC4N 4WQ5A 3Q89A 3L2VA 2BV3A 1LXJA 3JTPA 1Z2ZA 1B3TA 4UOGA 3I0RB 3TARA 1NJWA 3FZLA 1NGHA 3VQAA 3M6XA 2BXJA 4LF7F 1HI8A 3ZZZA 5AZJB 2CPHA 1TV6A 2XSJB 1TAUA 2NUUG 3OVNA 4BHQA 2ZH1A 2M88A 4CFAA 2D5RA 5GIOA 1TKTB 2DR7A 2XS2A 1Q79A 1YITN 2ZVIA 1ZBIA 2QZ8A 3QETA 1RTZA 2Q43A 2V67A 4QYRA 5LSRA 5ETTA 3CMAN 4IDKA 4P2MA 1ZM9A 1M5PC 3NCIA 1RWXB 2DRDA 4MDAA 4CEFA 1CJKB 4A4JA 4X4SA 3W5XA 2VG6B 5AFUH 3CETA 4HI1A 4Q45A 1URRA 3BBBA 1J27A 4NLBA 4HHUA 5A8WA 3BUZB 2HEKA 4QIEA 1KVBA 1W2BR 3JAMU 1S6UA 4MIBA 3DLBA 4J90A 2MYFA 2YVSA 1CXQA 2KVQE 5T7LB 1PC5A 2VJVA 2E7WA 4WQ5C 4X66F 2HVIA 2HHQA 4HACA 2XY8A 3M8PA 1C2PA 3AARA 1R7IA 3M4XA 1GXTA 4GC7A 2PMHA 1RT6A 1V5IB 1M5SA 3AB4B 2IVPA 3M2RA 3QZ8A 4OYAA 2DBBA 3ZEUA 3BJYA 5A0YA 4JS5A 4X4NA 4YHHJ 1WC5A 2ZWHA 2HNDA 3V6HA 3CF5Q 3U8XA 4PG5A 3M5RA 3D5MA 3CC4S 3PW5A 4CEAA 2V52B 1DT9A 2RHSB 3M9NB 4PKIA 3BY5A 2HS0A 2GO8A 2CJXB 1HHQA 2P9NB 3QJPA 4M5GA 2E1PA 4ID1A 1RQ0A 4ZPDA 3UWTA 1XMQF 5LSOA 2Z8QA 1IKXB 3TTCA 3ZT4A 5IFMA 3ZSYA 1RHQB 4LSLA 1JJ2M 3KK2B 1Q95G 2Q3PA 1S59A 2UUCJ 2XNRA 3H4DA 1VQPN 3R2DJ 3B82A 4NA3A 2MKHA 4Y2AA 2LYVA 1NGIA 3EE8A 2MGZB 1KBRA 5BPMA 4ZIWA 1JLFB 4OJRA 5DG7A 4CIOA 1X4AA 3GIJA 1VBXA 4F4AA 1S9EA 3GTYX 3H7HB 3MHYA 4CLTA 4FNHA 2IM3A 1YIJS 3GFHA 2WB4A 2RPIA 4KJIA 2D1KA 3NGUA 3V81B 4LF6F 2HNZA 5ETNA 2AD9A 2MHNA 1A5WA 2VICA 4FJNA 4WFAQ 4X4UA 3PO5A 2HWHA 1FX4A 4DDFA 4B1UB 4PYDA 5E3RA 1YBAA 1H6KX 4FVMA 4N56A 1YGYA 4WE1A 4OZJA 2MLXA 4IZ9A 4DV6F 3NP5A 4G9ZA 2IHR1 4JI4F 3OTCA 4C8KA 4GKKF 5A2QO 4ZN1A 3N6MA 2ZC4A 1GMVA 4DUYJ 2XYHB 5EOYA 5G4DA 1BUPA 4NCGB 2AKWB 5CY4A 3NEKA 1ZPWX 2LSNA 1W26A 2DTUA 3AH6A 3AD8C 2XY5A 4DSLA 2QWNA 1IJFB 1DQAA 1J5EJ 4N41A 3D3BJ 4X4QA 3OFGA 2D0PA 3ZLJA 4YNQA 3IRWP 3P38A 2EK6A 1HYSB 6AT1B 4K8RA 4WJBA 3MDFA 3PIOQ 2NPIA 3BQ2A 1NPPA 3MUTP 3BF3A 1WN7A 4JI0K 4MQ3A 4CEEA 1WSFA 2UUCK 3HLUA 1VC0A 1BDGA 2D41A 2HHHF 4GNIA 4JI6J 2KFYA 2LDYA 4R5PB 4ES3A 4X65F 2XCAA 3NAIA 3IR5B 2GJFA 4G65A 1HWIA 1S12A 2OSRA 4HH0A 3BGLA 4YORA 2DY9A 2OO4A 2GV9A 1XQIA 4UOCA 3EXYA 2CH5A 4MKBA 3O5TB 3UO0A 4R0JA 3CJ0A 4Z4IA 2V4JB 1KAZA 3RVCA 2HW3A 2OD4A 2DNHA 4CHPA 5KFTA 4FJKA 2DGSA 4CD1A 3PEJA 1QSLA 3E8OA 2CZVC 2J6UA 2UVUA 4CZJA 4KGMA 3UKRA 1F9HA 2ZBIA 2J5AA 2ZOGA 4YY3K 2SXLA 4B9UA 3ULDA 5BYSA 4DX8H 3JS9A 1M0SA 1X5PA 3CCLN 4DFJA 2EK1A 4E7HA 4NA1A 4M5JA 1RT3A 1X31C 2UUAJ 2E2PA 3PIPL 1J5EK 1Z26A 1H2TZ 5JXSA 2VQFK 4AILC 1MLAA 1U26A 2X1AA 1B0PA 2MKKA 3M1VA 2HFVA 4P73A 3GYXB 2DB1A 4V19S 2DR6A 5IWAJ 1DGKN 4C2MA 2IM2A 1V3SA 1SKUB 3AAPA 2GTDA 4WP8A 3ATUA 3JSYA 3T5JA 4K41A 3TR8A 3KLHB 4QBUA 2Q36A 3SI8A 1TU0B 4RW7B 3CNQP 4GC6A 1FDAA 4I64A 4DLEA 2PAVA 5BN9A 1RT7A 2V0NA 3PYEA 5DQGA 1AB8A 4DR6K 1T05B 3CQYA 1IKWA 1FK9A 2G9OA 2EW9A 2V69A 2ZJQL 1IBCB 1OPZA 4LSZB 4ED2A 2P2CB 3PLAA 4CK1A 2UUBJ 1D9DA 2KU7A 4NZ0A 1S7HA 2J0QD 3J80Y 3NCRA 1NJZA 4JV5F 1H0HB 1S4FA 2RDDA 2X51A 1FTCA 4A8FA 1RHMB 4WCEL 2BJ9A 2YHWA 1RACB 2Z58B 2C2ZB 1YVUA 1YK9A 3EDRB 4KPYA 1S9GB 3SDEB 1HBOA 2O1PA 1M5KC 1VK3A 4DJBA 2P9SB 2HIYA 1QQNA 1NK7A 3TWHA 1MA9B 2AU0A 4FF2A 1TL3A 4Y3CA 1OVYA 2OEJA 2W1BA 2YWKA 3MXIA 3HP9A 1NSAA 1PYOB 1AZSA 3ATVA 4OIXA 2L3MA 4PCQA 2P5OA 4DR6J 2ZOMA 2E2NA 4F25A 5B08A 5IT0A 1OSDA 2DH9A 2W2MP 4BE1A 4UUWA 3PRVA 4RNNA 3LGNA 2H51B 3PZPA 3NGZA 3QGPA 4CFBA 4PL7A 3CUNA 4LR8A 2O5DA 4DV1F 4H4MB 1VSKA 5CE3A 3E01B 4WYBA 3MX5A 3QBWA 4DR1K 3KOAA 5DG9A 3FNNA 2FSJA 1SI9A 2YJFA 1KAYA 2M0GB 3ASMA 4YQWA 3K2YA 3FRYA 3BB5A 3C65A 2ZOFA 1UWBA 3ZSQA 2VASA 4H5WA 5AT1B 2XYPB 3VF6A 4B1YB 5IOLA 3NS6A 2FTRA 4KO0A 3IBFB 4ZCLA 4B3MF 3H90A 1KDNA 2VG5A 3M8SA 1Q82O 4BY9C 3RAMA 3J7A1 4ED3A 1EAYC 1YITS 1YRXA 2V4JA 2HBYB 4OHWA 3VQSA 4DQRA 1DZ5A 4CM0A 5M1NA 3E66A 5KFAA 1B4SA 5F8GA 2V9WA 3W2WB 5JS2A 4JYAJ 5BRHA 2FJEB 2H48B 2M7SA 4Y0WA 3LL3A 4JK9A 4GMJB 2QA1A 2YQ0A 4CFDA 4IO8A 2VBZA 1YVFA 1HNXJ 4BRLA 4DUZJ 1X3NA 2ZGYA 3D1OA 2LMIA 4LFBK 1EX8A 1KRPA 5IZHA 2RS2A 8ATCB 4HTIA 1N6QB 4ZP6A 5IT9O 5KGXA 2V8PA 2HIQA 2KG0A 2CPYA 4QU6A 5FRMA 4RW9B 5AQRA 2CPEA 4NLDA 1IBMK 1PKUA 3NMAA 2KM8C 2MKSA 1XMBA 4ZCMA 2LXUA 1WC4A 2K7JA 3CJ2A 4F8RA 1NK8A 3UKRB 3MMCB 4LFAF 2IJRA 3C19A 3MI7X 1NK9A 2MJNA 2DGUA 5LOQA 2DYAA 3IAS9 1U2RA 4OYZA 3MM9B 3HHNB 4PABA 4IRKA 2IM1A 3GSIA 3A1YG 3LPYA 3DLKB 1VBKA 5BREA 5LT5A 3NGKA 3H20A 3SUPA 1CEZA 1GNKA 3E3XA 5D3GA 3SQ4A 4RBVA 3LPUA 2HNYB 3RB6A 4FDFA 1C1CA 3TR5A 1IBLF 2FBXA 2MKCA 2KDOA 1PAEX 4LVNP 1HIYA 3NBPB 1TKZA 1HKBA 2CQ2A 4PXEA 3AVNA 1ZBSA 2DNGA 4PPZA 2Y1IA 4RW7A 4FO0A 4U9RA 4BE0A 2CQ1A 4KHPJ 4H0PA 1QVGM 5JUMA 1FJ7A 2RNEA 5E2QA 2XG8A 5KG3A 2V7ZA 4CF2A 3JYTB 1FK9B 4PYAA 5J2PB 3ZCMA 2V8VA 4Q2LA 2C28A 5CYQA 2WVEA 3TX8A 4ZS6A 2IJNA 5KG2A 3HBTA 4O0IA 3J80U 4OZNA 1CC8A 2G4BA 2VWBA 3RTVA 3AQOA 4B3TF 2WAQD 3H5YA 3O3GA 3D4JA 3OY9A 4P7VA 2Q0RA 1IKYB 3NNHA 4RW8B 4F50A 1FVQA 4MTPA 4K59A 2YHBA 2V34A 2AV5A 3BPSP 3FFIB 3UQSA 1U6BA 4X66J 3KDNA 4PWDB 1Q8KA 2KKHA 3L2UA 2JSXA 4KSEB 4WFYA 2E88A 4FYWB 5LMNK 1YWXA 1VLYA 2QFJA 3CPWM 4WK3A 3OW2R 2QGFB 3MF5A 1VRTA 2N82B 4ZPBA 4YHHF 4DHYA 1U4BA 2MB0B 3AT1B 1KVIA 2VQEF 2HHSA 3OYLA 3W7BA 2R7UA 2HQCA 4RX6A 1Q8IA 1GTHA 3SJHA 2HRUA 3J8AA 4DR3J 1N33F 3MPVA 3TUIC 4CTAB 2V2VA 4CWBA 4DV2J 3Q2SC 3NS7B 3C6UB 2A40A 3HXMA 2LDIA 1Q1KA 2DO0A 2D0OA 2X7IA 3AA4A 3IMXA 3L09A 2QK9A 2YKMB 1NU0A 4BDYA 1G15A 3MCOA 5HMZA 5D0GA 2FXUA 3MEEB 3IFEA 2DGTA 5KFKA 1GXUA 3R9LA 2R8KA 5GAEU 5DDPC 4W5RA 2IC3A 1FD8A 3VWSA 4ED8A 3HULA 4CHOA 1WELA 2F1FA 1U7LA 3IM9A 3HPOA 1TK8A 5DS7A 2Y9HA 4H4OB 3MPUB 2IS3A 3VGSA 2WTFA 3FZFA 5MLCQ 3DLGB 2VL1A 3BGRB 1E4FT 2HK2A 2HFZA 4AE5A 4ZVQB 3I32A 1HI0P 3HP6A 2HMPA 2DR5A 3CFPA 4DV6J 3TAMA 2HVEA 4BS2A 5KPTA 4FJMA 3W3SA 5C0YA 4JRPA 2HQGA 3I33A 3G2XA 4OFZA 1EKRA 4P9SA 2OPPA 1TL1A 5AQUA 3T1YK 7FDRA 3M7VA 1P8GA 1JLGB 3RMAA 2Z2MA 2GZOA 2RU9A 5F41A 5LMUF 4LBHA 4B8CA 3Q8YA 3TW0A 3V4IB 1HPZA 4WTYA 3NE6A 2P51A 3FMBA 1VHXA 5HBMB 3CTRA 5GMDA 3K58A 3PO4A 1LAVA 4A61A 3R3LA 2BOAA 3MEGA 1BQMA 2W6KA 1K6YA 3I0SB 4QAGA 2BW2A 2XI3A 1VGYA 5KG1A 2VGNA 1IV0A 2V63A 2HHHJ 1T9TA 3NHGA 1DTTB 2ZC3A 2MQNA 4MH8A 3ENAA 1SL1A 2E8AA 4L3KA 2DIVA 4FS1A 3QAEA 4O0NA 1WSEA 2DD8S 3MZIA 1BO5O 3JAMY 2XB2D 2W01A 1U8SA 3D6HB 4IXCA 2QMUB 2B8PA 2XY7A 4FS2A 3A3NB 3C2PA 4A48A 2W25A 4MIAA 3A13A 4USVA 4ECUA 3VQCA 3BZCA 3SAGA 4BRQA 2D0AA 1BOTO 4F3QA 4DPWA 3CC7N 1U1MA 2NXJA 1RT6B 2CG4A 3P31A 4OX9J 3QICA 3FFIA 1BUXA 5I3PA 3ZETA 5KQDA 5AQKA 2W40A 1TL1B 4RW8A 4NLUA 1JLGA 4KHQA 3CM5A 3CPWR 3THXB 2EX3A 3G6VA 1ATNA 1RWKB 1HNIB 3K8WA 1ZA1B 5KRTA 3SQOP 3CSKA 3G6EN 2FBVA 1N32K 5IWAF 4E98A 4K2XA 4LF8F 4FF1A 3ZX2A 2AX0A 3R9PA 1RAHB 2EKNA 1UPPA 2YX7A 4JV2A 3O9TA 2NXCA 1OS5A 2FYXA 3JQMA 4H03B 4K4ZA 3PW7A 3CCMS 4C7QA 5IC4B 1Y4ZB 1NJIT 4PKGA 2CNLB 2HFOA 2BJDA 3CC2S 3O1LA 3FR0A 1RAAB 1S79A 2K2PA 3MUMP 1S0MA 3UKUB 3NNAA 1JJ2R 4OZ0A 1P9YA 5E3QA 2A6AA 4WXWA 2CPJA 4AHRA 4CO4A 1LFWA 2LECA 3AJ1A 1EQMA 3I56N 5KT5A 1EQYA 2DGXA 3NH1A 3RAXA 2P9KB 2I5JB 1KC8O 4J5OA 4RNMA 4NX9A 3ENBA 2VPXB 4EBDA 2CUYA 2Z1HA 1MWMA 2G2ZA 1RP5A 2O8FA 2G8UA 3NG8A 2F9TA 5M2PA 1ZAVA 3JQKA 1SQGA 3VEOA 1KVAA 4CCHA 3U6FA 2VDIA 4AD6A 4WIQA 4KHPK 2OPRA 2AZ1A 4FYXB 4RWWA 2D1CA 2ZZNA 4DU8A 4OPKA 1RTIA 4B3SK 1TVRA 3W9IA 1HJOA 2QWLA 2Z2YB 2Z2LA 5J2NB 4Y2MA 1A5XA 3IDHA 2PI5A 4J2DA 1TZ0A 2CJBA 1R31A 3M8RA 4U8YA 2CPDA 5HK4A 4FZXC 4ISEA 3LOUA 4ES2A 4A8QA 4B3RK 1PAUB 1NPKA 4ZA1A 1VQ7S 1Y10A 1WHWA 3O3LA 4K5SA 5EVZA 1IBKK 4ID5B 4OI6A 3CC2N 1RAGB 4JI3F 3QFWA 4YUDA 3L3VA 5KOXA 3NXZA 4XIUA 4DR2K 1LEOA 3D7EO 4KPCA 4F4YA 2Q3SA 4CI0B 5LSLA 3W66A 5D6GA 4AUKA 3OT9A 2ZD1A 4ELVA 4E7LA 3G82A 4CJUA 2JEJA 1NKEA 4W5TA 4LF9K 4WYWA 2JWKA 4DV4J 4KV8B 4U7BA 3TJ9A 2DNPA 4JOUA 1HYSA 1FRLA 4H8KA 5L1KA 2Q79A 1WSJA 4V19J 2LLZA 5KG7A 3OV7A 3ELHA 3BO4A 1NGAA 2YXLA 3IG1B 4NMLA 3MR3A 1H73A 4B3TK 1UFWA 3V1QA 4F4ZA 3M2UB 2HVZA 4HTLA 3V9ZA 3BS9A 4KKOA 3CD0A 2UUBK 4PWWA 3MR5A 3A4TA 1NNEA 5IT9Y 2FSKA 2G2YA 3THYB 3DGVA 3KLHA 1F5CA 4LSNB 5D3GB 3BO3A 3UNGC 4IG0B 1TL4A 1RDCA 2W9BB 5CD4H 4WCEQ 3SUOA 5D77A 4CBUA 4LSLB 4RWXA 1NK0A 3MAAA 1KKHA 1K0VA 3T1HF 3ONQA 1VQMS 5GIPA 1HYVA 4KTWA 1DRZA 2QI2A 1YJNS 2CGKA 1NWKA 3QEVA 4PKDB 2PSZA 1IBLK 3W9JA 4DTPA 4WFXA 4DU1A 3LGHA 1XHXA 3MFIA 3IC1A 4WP9A 1YBTA 1HNZK 2FVCA 2HSEB 5KFZA 1YTAA 3BKTA 4X66K 3VCDA 5HL7Q 3H0PA 2UU9F 3FBFA 2Q1LA 2WFBA 3AY9A 5T7LA 2W2NP 3N6NA 2HHUA 1EJ7L 2CVIA 1VSEA 2IA6A 3SAFA 3O4NA 1GMUA 3ID6A 3S6EA 1GEHA 2DCLA 3Q8PB 3PY8A 3LM9A 1QVFR 2RDJA 3KK3A 1F3FA 2ZQBA 1T05A 3W1YC 3M32B 4QIWD 4DXLA 4O8KA 1B7FA 2O4GA 2XLJA 3J7AP 3KLEA 1SJ1A 1VJQA 2Y1LB 3T7ZA 4M5DB 2AEMA 4E1JA 1TKXA 3PSFA 5I3QA 4LF9F 1JLQB 2HMIB 4DPTA 3OTOF 1V4TA 2EHGA 4DS4A 3QIDA 1RTDA 1GXLA 4ZCKA 2KO1A 3MECB 2CKWA 2E2OA 3AV9A 1RT1B 4DR2F 1NDKA 4CBXA 1VQMN 1FNMA 3DGPB 1KFSA 1MMDA 4PR6A 2MY7A 4ZN3A 5F9NA 3CCUN 1ZTTA 2ACYA 3MDQA 4QOTA 1N5SA 1UVJA 1GLDG 4IG3B 4DTXA 2F4FA 4H5NA 1CG2A 3JSBA 2B4JA 4Z4FA 3BP8A 1WOOA 3T1HK 3C3LA 2UXDJ 4J9RA 4I4BA 1XR7A 4IRCA 2MHEA 3MM9A 3R8EA 3B6BA 1WF2A 3RSEA 2ZH4A 2ZBCA 3O08A 2AP1A 2P9NA 5L9NA 2KFNA 1BCMA 4GVEA 2PA8D 4Q7AA 2J9EA 2MLYA 1A9NB 5SWMA 3GIRA 2DNOA 3I5BA 4BGBA 2CNNB 2FB0A 4EFAC 4H5VA 1Y00A 7FD1A 1NGBA 3TOQA 1EETB 1Z6RA 4I0WA 3DXKB 2DKOB 1K8KB 4CIGA 4EWTA 4K4XA 2XGQA 4A8KA 1FKAF 4L6V3 2VBXA 1ZZFA 2ZM6K 1RT4B 3NBPA 4WU3A 1TUVA 3GYNA 3VHQA 4QW9A 2QYGA 2FGCA 2O8EB 1FEEA 5FJ4A 5J2QA 2PE8A 3AVKA 1ZZNA 3MTKA 1DY3A 1LW2A 2L9WA 1K47A 4DR3K 2KN4A 1BG3A 1BL3A 1J9AA 1EP4A 2P9GA 5D4LA 2JNJA 1IG8A 1SXLA 2IGIA 3OFHA 2BE2B 1HMVA 1YSJA 2AJ1A 3DLEB 2O67A 5E5NA 2L08A 2XBPA 4CVNE 1TYQA 2BVZA 1HARA 5GMKa 5FDLB 2HF3A 3FEYB 2P6SA 3LWMA 1WEXA 4DFKA 2HZAA 2LXFA 5AQVA 3CT9A 4U7UK 3IWXA 1X5TA 1RUSA 3C16A 3TI0A 3I8DA 2YKAA 2Z1JA 4H5TA 4QS7A 1N6QA 3OR2A 3Q23A 2G0IA 4P75A 1VRQC 1R6VA 4UY8T 1D9AA 2CNKB 4JK7A 1OYDA 4CQ1A 3ICLA 3KJFB 4I6YA 4ZVPB 2E66A 3DOMB 2OYQA 3POTB 2VIHA 2ASYA 4LH4A 3DOLA 4X4OA 5L1IA 1VMBA 4TY9A 3VV2B 2XZWA 1WNSA 3CDWA 3K57A 1XUPO 1NNDA 2K3KA 3H2VE 1FRMA 2ALZA 3MEDB 1C4AA 2J0SD 3KG1A 3DN9A 3F5TA 3BM7A 4NRTA 4H4KA 1RYSA 1M5VC 3SQ1A 1P1LA 2HURA 1RTIB 4QJVA 2EFNA 3P5JA 3WC0A 2HMIA 1NEEA 2WCXA 2P9IB 3N4PA 3FSIA 4DV3F 1FE0A 2LQ9A 4WU2A 2B3TB 4CHZA 1NHUA 2R7WA 5GADU 4H5RA 4LF6J 4FM2A 1RCHA 4PRFA 2AX1A 3R5GA 1HQ2A 4QWEA 3IN5A 3QNWB 2HLUA 1SQKA 4JKAA 4J2BA 2HGMA 4DR1J 3H1QA 3PVXA 2OELA 3GILA 2HVDA 1RDBA 1S76D 3I5CA 3C16B 4OX9F 2FLLA 3VQPA 3RW6A 2ZDPA 3MN7A 1KTVA 4DPOA 5EXWA 4WWSA 2OMOA 4O4RA 4GKKJ 4PA1A 1XJWB 4DUYF 5C2DA 4Y65A 3CDUA 3QEXA 4DPYA 4A59A 5J2PA 2E7VA 2HQDA 2JC1A 5F1XA 1N36F 2RUSA 3KWGA 4IOBA 4DG1A 4EFHA 1EIYB 2ETJA 4YN3B 4FVCA 2P9PB 2DNMA 3L7UA 1IXKA 3F44A 1EETA 2LVWA 2Y1RI 4F26A 1WSHA 4EHTA 3CHWA 1NJXA 1HR0F 5CYMB 4BLGA 3M2UA 3KIOA 5HO4A 3AO3A 3AJDA 4YFUA 3HZEA 4MLHA 4BQZA 2E7XA 2QWPA 1X4EA 3ZX3A 2CQDA 3E9PA 1NHKL 3M8WA 4W92B 1BXNA 5HLFA 3CIMA 3CJAA 1OPIA 4M3WA 1OIAA 3W2VB 2RN2A 5JICA 1XWLA 1JLEB 5G0RA 5AE3A 4H4OA 3GE9A 3OVSA 1CQNA 1VQPS 4LMZA 1H2VZ 1FNOA 4AL5A 2XNQA 2DNRA 3QO9A 3NKYA 3H2UB 3EKUA 5AQIA 5DZ6A 1KCFA 3SCIE 2DJWA 3B4DA 1RTJA 3I82A 4CF0A 4Z7CA 4DTRA 5AFUA 2UXBK 2F9DA 3M30A 4OLAA 1IUJA 1FJGF 3LA0A 2KZZA 4O3SA 4F2SA 1TFWA 5D4OA 2ZD1B 4EAHD 3C6TA 2KVIA 3H5SA 5F0UA 2OTJS 1M1GA 3BF4A 5I9EB 1RB0A 3QRQA 3DXMB 2ZH5A 1IVZA 1YJNN 1OY6A 1QE1B 3VAJA 3W61A 1QZ5A 3RBDA 3OSPA 2AMCB 1WI8A 5J1PA 4IWVA 1B92A 4A47A 2QWMA 2ITMA 3W62A 4JI0F 4E0DA 2ZHOA 1RAOA 4ES1A 3DRPA 4FM1A 3TJAA 2C3MA 4MK8A 1WC6A 1D8ZA 2JZ5A 1HWKA 4OX8A 3W65A 1N0UA 4KGKA 4DL7A 2A2CA 4JI5F 2DNQA 1TMJA 4WQ4C 3DXKA 1LWCB 3LPTA 1K8KA 2VFVA 4AL7A 4QR2A 3CMQA 1VQ4N 2F5GA 3CJCA 4CJ3A 3F41A 1S57A 1PG5B 2O8BA 3HM8A 1ZAXA 3ALYA 2XYGB 5KT7A 4UY8O 3KUGA 2E1MC 2VFSA 2R2TA 3MPYA 3F2KA 3AVCA 3OTOK 1N0VC 2P9IA 4DU4A 4PWUA 2XCPA 2R7YA 2PY5A 4U67L 1I1GA 3J7AN 1OQ3A 3AVFA 1FE4A 3WIVA 4EMDA 3DRSB 1BA0A 3GCWP 1VRTB 3OXGA 1B0TA 1SC3B 1S1WA 1PYTA 1RT2B 2VC0A 4JS4A 3RMDA 3MEKA 4L75A 3B4MA 1XEZA 5JVGL 2E1RA 2I8EA 2R4FA 3IWLA 3FKBA 3QT8A 4Q44A 4CLSA 4BRHA 1C0UB 2EG1A 4L3QA 1GTEA 2AJ4A 2KT3A 4DV2K 3CCLS 7AT1B 2R8JA 2FJVA 3EN9A 1BIZA 5DG8A 1FKOA 3AGKA 5KG5A 4CI6A 1BLUA 1IN0A 4USWA 4ZVTB 4LRDA 2I9SA 4DR4F 5GVQA 3PW4A 3HKZD 3R6MA 4OYXA 2FC8A 3ZTPA 1W97L 1QAJA 1VIOA 2VQFF 4R79A 5GAHU 3THPA 4DR5J 3TSUA 4ZTJA 1QTMA 4LBPA 1HBNA 2QA4S 2UXBF 4JAXA 4W5OA 2AJFE 1UEUA 2LEAA 2O4IA 3N01A 1SZ2A 1RU2A 2CXEA 3C8YA 1VBZA 3R97A 5KFWA 4ZHRB 2HBZB 1OMSA 3JSRA 2EFQA 3CDEA 5F8MA 3T9NA 3VETA 2RRNA 4IQXA 1FF2A 3D6MB 1UA0A 3LAKA 1YBUA 2O66A 2I6WA 1REGX 3ZSVA 3H1VX 1PILA 4CZIA 1FTRA 2CJAA 2EKYA 4BC5A 1MROB 2P5GA 2BANA 3D0HE 3D1HA 3EE3A 5J2MB 2IM0A 4CGIA 2YWEA 3KJVB 5B0DA 4Q5VA 4C8OA 5C24A 1N8RO 1D4XA 3MMAB 4X2BA 3N0VA 5EU7A 2P9EA 1W7AA 2R42A 3FQLA 2ILYA 1HWUA 4OMFG 3KHGA 3OYAA 3QEPA 3FGVA 2QMXA 3NRBA 1LV5A 4JI8J 2ZGZA 4C3LA 5CABA 5KFFA 3L95X 4GY2B 5HLFB 3UDEA 2ABYA 3MM7A 3B6PA 4F4WA 2V50A 4JD2A 2H5EA 3M05A 2FZKB 4IKFA 1KQFB 4UT4A 4LSNA 2Q2RA 4HTUA 2DHXA 1NHVA 5IV3A 4LFAJ 1U1LA 4PQUB 2OIHA 3VAGA 3FCHA 4NYZA 1A5VA 2RU3A 1AUDA 3VA3A 2VOPA 2AGOA 3DOKA 1TGOA 4CEQA 3P1GA 2CQPA 5HP1A 1DHMA 1VHFA 4I7FA 1C0FA 1CJKA 3QAUA 2CPZA 2WVCA 5L9XA 2F8TA 2N7CA 2I7PA 2FHMA 3R5DA 4CECA 5KFVA 4J37A 1IKXA 4ANEA 4JKDA 2J0XA 3RAQA 3QB0A 3GJQB 2JLEA 4PUOA 3TNVA 4TY8A 3CJ1A 4CTAA 3ZX0A 3CD6N 1MWKA 3PJWA 1ELOA 3KJVA 3H5XA 1QE1A 3M8PB 4HACB 3SBMA 4DFMA 4DV0J 3K17A 4TVAB 5GAEI 2A6OA 1SQEA 2ZJRL 4DQIA 3BSOA 3BEXA 4BGAA 1XNRF 2EVZA 2OI2A 2G13A 3T1AA 3IM8A 3SJJA 2P5VA 2OPPB 3M2RB 3HJFA 1RTDB 3TA1A 4P6QA 1FD2A 5B0GA 2MZRA 1O51A 1UZDA 3E9LA 3GFYA 5E7OB 1FHTA 2PD1A 2YJEA 1FDBA 3HPHA 4QR1A 5D4NA 2GVDB 2VA2A 3P45B 3TQ1A 2B9WA 5HL7L 4OYMA 4FOEA 3CJKB 4AQYF 4C3KA 3M30B 3OLBA 1MW7A 4NXNJ 1N32F 5SZTA 2GV1A 5C2FA 1IKWB 3T19A 5L46A 4P2XA 4KH5A 3EL2A 2V8HA 2FBTA 3DLRA 2YNIA 1TQLA 1I39A 2RHKA 3IS9A 2IIRA 3JXUA 3DMJA 3L4IA 3SLCA 4CLPA 4B3RJ 4UOHA 3MEDA 4TU8A 1F2HA 3TZWA 2H54B 2G0JA 1Q86O 4HDGA 3RMBA 2ZDOA 1JLEA 3FEZA 1BY9A 3MX2A 4PY5A 5SUHA 2UXCK 3UR3C 4M3UA 3CE8A 4F7VA 3CCES 2IVFB 1SJRA 1HKCA 2YHAA 4F04B 4ECQA 2LFVA 3OVAA 3LH2S 2R7VA 4K5RA 4ZCIA 4UQTA 2I2YA 4YR0A 2UXCF 3WNGA 1KR4A 4RUAA 3QBXA 2D0CA 3PCOB 2O8CA 1N5YA 4I9QA 4JI2J 1YZ6A 2C2RA 1BD6A 5ETQA 4DSFA 1HWLA 3K9JA 5L1JA 3VGLA 4BRCA 5C24B 4X65J 1AXQA 1LWEB 1P8ZA 4NXMF 1WUUA 4FKXA 2LU2A 5E84A 3WUHA 2R7TA 2AIRB 2M4MA 4RNOA 2P9LB 3VAKA 2HSTA 4LY7A 3K0SA 2ZZTA 4UZCA 4PG8A 1QAIA 2DHAA 5AQXA 3TVKA 3U4LA 3HHKA 3G6YA 3SMZA 4Q0BA 1WG4A 3FLCO 5T41A 1K0TA 3O9SA 3DRPB 1FVSA 3L4QA 4JI6K 1PBUA 1RWVB 4IEIA 3BKFA 5AQTA 3HKWA 3G8SA 1ZAWA 5B0AA 2U1AA 3IO1A 4FWOA 4JLHA 4CHYA 5AE1A 2X6NA 3EYZA 4ZVFA 1NJIO 3MMVA 2E5GA 2CA9A 5JVGQ 3CERA 1IR1A 1UW9A 3R7SB 4JP8A 2CQ0A 2OHDA 3HSDA 2XWXA 1Y64A 5LMUJ 2VFUA 3CJSA 2U2FA 4OI3A 2GMHA 4JI3K 3BH6B 3H4BA 3BSCA 4RJVA 4KHUA 1W0HA 4DUYK 3GP9A 1SCJB 1JQGA 3RWUA 2RB7A 3C14A 2ZVSA 3SCKE 1NOZA 3VF0B 4DB3A 4EYHB 5DDOC 2DITA 2XMMA 3NF8A 1U24A 2NZ4A 2A6MA 3KK1B 1QS4A 3PR5B 3QJLA 3V4IA 4KHSA 2KKZA 3QO9B 5BYRA 1HLUA 1JLAB 3M3ZA 3IGVA 1BA1A 2OAUA 1VQ9S 2B8QA 4EHUA 5AXLA 3N79A 2OPRB 2GA7A 4EO8A 4DZDA 5IM0A 4Q2MA 1VQSA 1KD1O 2VONA 1M90T 4OGEA 3UI3A 3KHHA 1JKHA 2QFIA 1SQFA 1XNQJ 3HYFA 4YY3F 4LF6K 1T9UA 2GGPA 3T5KA 3OHBA 1WAJA 5IC6B 1L3TA 2UUAK 2R9LA 2ERRA 2KZMA 4TN2A 1X4DA 3HHEA 2FVSA 1WF0A 3VPZA 3NFAA 3WNHA 1N56A 5GMEA 2YV0X 4M3TA 1V3RA 4FBUA 1FJEB 9ATCB 3P3DA 2IVMA 2LU1A 4ILGB 4CJLA 2IA0A 1WC0A 4CEOA 2DIUA 1KVKA 3H08A 3FZMA 4YDXA 2HHHK 3C95A 1NLVA 2RSQA 3RBEA 4WQ4A 2P9PA 1NUEA 4WXOA 2CGLA 3WX4A 3GQCA 3VZIA 1RAJA 3MURP 2X3DA 3E01A 2A1BA 3AY0A 4NLYA 4F3OA 2MLZA 2BDPA 1C1CB 4CO5A 2J4RA 4K8XA 4ANDA 2DH8A 1HNIA 4DR6F 1LW2B 2GHWA 2IRUA 3FCWA 4JKBA 3D45A 3G87A 4CERA 1O13A 5ETKA 2QWQA 3O9UA 3ZNUA 3GV7B 4HKQA 3ZZPA 3GV8B 4KHYA 1DAXA 4ID8A 3PYFA 2QA4N 1U48A 3RZAA 1GAOA 4FJIA 4M5DA 2XZTB 3H40A 3O9RA 5AQMA 2W6LA 4DSJA 4FF4A 4EBCA 4UQGA 3C15B 2MMYA 3ILIA 1VQ9N 1VCTA 2B7BB 3N9UC 4P10A 3PKYA 2BQUA 2GW8A 4OI1A 1CZAN 3OYGA 1FXLA 4F4KA 4F0HA 4FKYA 3DRRA 4BC9A 3SAHA 3PKMA 3OR2B 4OL8A 4HYKA 3HMJG 1HKGA 1QQCA 1U45A 3MAQA 2VDHA 3FJ2A 4PQUA 1NO8A 3CJTA 2QLWA 4H4KC 4B3MJ 1GFWB 2P9KA 1X3MA 1Q9XA 1V4SA 3DOMA 2PN6A 3HSJA 1Q4RA 4B02A 2AGQA 1VR6A 4RU9A 2HS4A 3UN5A 3KFWX 4J9MA 2FVQA 3DXMA 4BR5A 3M8ZA 3HT0A 4C98A 1JCEA 2LEBA 1MNEA 2VBYA 4J9UE 3DCAA 4HUFA 3NGYA 4DX7A 1X8DA 2HFUA 3O4WA 1RTJB 2BE9B 4IOCL 2XMKA 4QQBA 3OJSA 5RUBA 1N4LA 1I3OB 3R2CJ 2OTLN 1WWHA 2B4PA 1GOAA 3F56A 3CIZA 1UJ6A 1PIEA 3VN5A 2XMUA 2HBMA 3SZ2A 3ZSZA 4G1IA 2BKOA 3C15A 5AZIB 2VQEK 2F8HA 3OJUA 4LFCF 3LALA 2V6AA 1D8YA 4X4RA 1ATRA 3DRXA 3SQGB 4DR5F 4L8RB 3W2VA 5ETPA 2ROEA 2YH1A 2XRIA 1AT1B 5C25B 1QSSA 1IH7A 1P1TA 4FSVA 5C42A 3ZT0A 4GVLA 1HBMB 1TYQB 4QW8A 2VHGA 3GDQA 1RWWB 1RT1A 3Q7BA 1M1HA 2QSFA 1U1QA 2LKZA 2YNFA 1NGFA 1IBLJ 1SBRA 1UVLA 5A6WA 4UY85 4LR7A 4LF4F 4FBTA 2W24A 3VVUA 1OH6A 5EWFA 3A5MC 3S3OA 4YP3A 4FWSA 2LXIA 1XTZA 1FJGK 4CJRA 3MMJA 3GJSB 4TQSA 2XMWA 2FQQB 4KHPF 4CZHA 5ELZA 2CDRB 1TK0A 4M8LA 3O1BA 2GUPA 2WW4A 4BR4A 4E1MA 1EWRA 4LRAA 2FLNA 4Y28C 1ASUA 4XO0A 1DJ0A 2WZ1A 2HAFA 3EZ5A 2P9CA 4IG0A 4DL5A 1ZM2A 3K2PA 4NYNA 2RQKA 3BZKA 3DFEA 5CZ1A 1UP1A 1FJCA 4X4PA 1PCAA 1VI7A 1PO6A 3GG4A 2DR9A 2E29A 5I42A 3DC2A 4C11A 3TAGA 2CWKA 4ZOSA 4B3TJ 5LJWA 2FPHX 1RHJB 4ECWA 2KH9A 3CJBA 2QT7A 3UCUP 4NLGA 2GX8A 4I6MA 1EZZB 1O5JA 1N5VA 2VKZG 2ROGA 1WSGA 3JTNA 5H9EJ 1YRTA 2YCHA 4D3GA 1KOHA 1ZETA 2E9RX 4V19X 2VH7A 2X1BA 4KI6A 3G4SS 2VB6A 5J2NA 3THVA 2PEBA 5H1SV 4ETXA 1KEKA 5JS1A 1S5JA 3EVMA 3DLEA 1SC4B 3CGIA 1R89A 1J54A 4O23A 3RRGA 3KK7A 4OQJA 3V4MA 3RR7A 3ENQA 3SSQA 2ATLA 1UL3A 4C0HA 4YB6A 4G3IA 4DUZK 2GWJA 2H4WB 5M1QA 4KFBB 2ZFHA 3O5BA 1MN7A 1T6CA 4J2EA 4NLWA 4PG4A 1RTHB 3GG0A 4OZ3A 2UP1A 4CD3A 4DR3F 1D0EA 2E1CA 4FPRA 1A6LA 1HX1A 2BJ8A 3VQEA 4CZKA 3AO1A 4TU7A 4ANCA 5J2MA 3CCVS 3AO4A 1C4CA 2C2MB 2MQOA 3OXFA 1KONA 4NLXA 4QYZJ 3SPZA 1IWGA 3F73A 4MT1A 1WHXA 3ZSWA 3AB2B 3KLGA 2GQQA 2IFXA 2RT3A 2XO6A 3SQ0A 2NREA 5JMVA 1CQMA 1GLCG 1Q8LA 2BOPA 3GCXP 2FLPA 5E0OA 3MECA 2EI5A 1KSPA 3OYKA 1N32J 4BCAA 4I6MB 1AFJA 2CVEA 4R25A 3MOJB 1GQEA 4ILRA 2AT1B 5BRFA 2F8MA 4ZITA 2BA9A 3J81j 5LL6d 4QYZK 2LQ5A 2B6AB 1N88A 1D09B 3PV8A 4FZZA 4FXDA 2XTJP 1B64A 4JV1A 3PFEA 2ASOA