2OPSA

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
542
structure length
535
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 134
structure length 535
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2opsA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2opsA05
4DQRA 1RBVA 2WTFA 4J2DA 4WFXA 3JYTA 3AO2A 4CHNA 3MECA 1U48A 4CGHA 4NLYA 3QZ7A 2IC3A 5KFZA 4ICLA 4J9RA 1J5OB 3SFGA 3MR5A 3P83D 1L3SA 3H98A 1ZETA 3UDLA 4IRCA 4NLPA 3VQ6A 4JRQA 2A1SA 3VQ9A 3MTKA 3PR4A 3DLHA 3P1GA 3DRPB 1XHXA 4J2EA 4DTNA 1L3VA 2YNFB 4DSFA 2YNGA 2BR0A 3DLBA 3EY1A 2F8EX 2GBZA 3LZJA 4K4WA 4FJ8A 5J2MA 3V9WA 4HTUA 2HMIB 4I9QA 4J2AA 4CFCA 4DTJA 2PY5A 4NLRA 4TLRA 3DRSA 4MK7A 2X6NA 1X9MA 3QGIA 1XR6A 4CHOA 2R2TA 5F8GA 1KLMB 3FQLA 3ZSZA 4Y34A 1NK6A 3SQ0A 1N56A 4C8MA 4M95A 3DOLA 1KLMA 5KFKA 5L1IA 2DFFA 4CGDA 3GIIA 4CHYA 3OYHA 1IG9A 4KTQA 4M45A 4F4ZA 4IKFA 1RA6A 4R8UB 1C1BB 3L2RA 3DLGB 3LZIA 2IS3A 1JXLA 2E9ZA 3KLGA 3NAHA 4LSLB 1DLOA 4NLSA 3VQCA 4CGIA 4M3UA 4Q8EA 2AX0A 3HVAA 4HKQA 2FLLA 4MIBA 4GVMA 5F8LA 2RDJA 2G8HA 3HM9A 4FZZA 3MEDB 4O3RA 3ZSXA 2Z1JA 1XC9A 5K14B 3C6UA 3CM5A 4O5BA 1HRHA 4IDKB 5KG7A 3F73A 3M8PA 1IKVA 3WNGA 5FRNA 3LAKA 3SQ2A 1VSIA 1MMLA 2A1RA 4FJ9A 1IKWB 3S3MA 3SZ2A 4RW8B 2EC0A 1UOCA 3KD5E 4M94A 3KK2A 1EETA 4NCGB 4IG0A 1RTDB 5L1LA 1JLCA 3M9MB 3DOKB 2WRMA 3Q8SB 3DMJB 4G3IA 4H8KA 3MEDA 3G6YA 4HHTA 3RMDA 2C2RA 4CJPA 4B3OB 1IO2A 3VQQA 3BJYA 1RTJA 2BANA 1SKRA 4EBDA 2P5GA 2WB4A 5KT4A 4W5OA 4Q43A 1RTJB 1UA0A 4QWBA 2GUIA 3OYEA 3ZSRA 4FJHA 1OS5A 4QCLA 4KHUA 4NLUA 1TKTA 1RBUA 4J9QA 3ICLA 3AVMA 3PY8A 3GQCA 1NKBA 3IG1B 3G0ZA 4FLUA 2AX1A 2FVPA 1QUVA 1RTIA 4WE1A 1WSJA 2YKMA 2FVCA 3T5HA 4IR9A 3DRSB 4XPEA 3TAMA 2C22A 2VG5B 4E89A 3PX0A 4CJ3A 1WLJA 4FS2A 4O3NA 3M8PB 3RRGA 5CZ2A 4RG8A 1D1UA 5JS2A 5HRPA 4FLZA 2R8HA 4DU3A 5JS1A 1GOCA 3PR5B 1D8YA 1LWCB 3CVKA 1S1XB 4DTMA 3D28A 3QEIA 1TL3A 1JKHA 1QE1A 2WHOA 4DL3A 2HNDB 3KKSA 1UWBB 1SV5A 5KGWA 1WSGA 4DSKA 1IKWA 5KFQA 4ID5B 4BE2A 5EU7A 1S6PB 1LW0B 1TKZB 2JEIA 4RW9A 1K1SA 4ECSA 3QGHA 4EP4A 1ITGA 4ID1A 3IS9A 4DQPA 4FM2A 3BQ1A 5HRNA 3HKWA 2HHSA 1RAJA 3HO1A 4FK0A 2D0AA 1LWCA 3MXMA 5KFPA 1LWEA 2XCPA 1NK7A 3RRHA 4CEFA 2XI2A 2E9TA 4NLTA 4ZP9A 2VG6A 4U6PA 4RNHA 3NH0A 3NDKA 4QPXA 2HHXA 5KFTA 1RA7A 3AVIA 4BWJA 3KLVA 5KTQA 3QEPA 4ECXA 1S9GA 4ELTA 4ELVA 2RF2A 4CERA 4ZVHA 1RDDA 1JLAA 3UIQA 2QK9A 4O55A 1TK0A 2YHBA 2HHUA 5KFRA 4WE1B 1S1WB 1RDAA 2G8KA 3EPIA 3MFIA 4FJGA 4OGCA 3MF5A 4DG1B 3RR7A 3OY9A 1D9FA 3H4BA 1U47A 4KHWA 5DQHA 2PYJA 1JLQB 5KG4A 4IR1A 2D0BA 3HYFA 2YKNA 1TL1B 1W9HA 2G8WA 2OPRB 5KI6A 4Z4EA 3AVGA 4TSXA 1SH2A 2HAIA 4CFBA 3KJVB 1TAUA 1ZBHA 4URGA 1VRUA 4DQSA 1CZ9A 4WXOA 2HWIA 4CF0A 2QXFA 1LW2B 3NCIA 3PX4A 3KOAA 4QW9A 3IS9B 4H54A 3NF9A 3KLIA 4NRUA 3CYMA 1RT5A 4O0IA 3OL8A 3DLRA 4DL2A 3LWLA 1BI4B 2ALZA 3QIPA 3KHLA 3OYLA 3LWMA 2HNZB 3CIZA 4M3TA 4PY5A 3NAIA 4ZPCA 2FBXA 1N4LA 4DTUA 4DQQA 4ED8A 1C0MA 2R2RA 3HVWA 4AHRA 1RYSA 5DG9A 1N5YA 3RB6A 3L2QA 4O4RA 2DPJA 2BQRA 3PO4A 1JLBA 4J9PA 1TV6A 3AA4A 1T05A 3AO5A 2G8VA 3HP6A 4F4XA 3L3VA 2R2UA 1NNDA 1TKXB 3WNHA 1FK9B 2BANB 4FXDA 1WSHA 3H08A 3QERA 3E01B 2R8IA 4M3YA 2P5OA 2KTQA 3FFIA 1RT4B 2XWYA 4JUZA 1S9GB 4O4GA 2WCXA 3HVTB 4YR0A 4M3WA 4WZQA 3RTVA 4EBEA 3TVKA 3IGVA 4KFBB 2ASLA 4XO0A 3IG1A 4ED1A 4KB7A 4OVLA 4MK9A 2F8TA 3DI6A 1WNEA 5F8NA 1J53A 4WYLA 5D3GA 1NJYA 1S48A 3CJ3A 1HQUB 4G1QB 1W25A 4QWCA 4MIAA 3L2UA 4PQUA 4IRDA 3E51A 3K5LA 4QW8A 3CDUA 2XI3A 2KQ2A 4LQ3A 4K4VA 1TAQA 4FK4A 2VG7A 3V4IA 3MR6A 4JV1A 3ZSOA 4FJMA 1GOBA 4KTZA 2HNYB 1RTIB 4U7CA 3H5SA 2OPPA 2XCAA 4AHSA 3HP9A 3K2PA 4F50A 3B6PA 4K4YA 4H4MB 1WSEA 4ECVA 4DSIA 4DFKA 2HW3A 3T5LA 3V9UA 3PW0A 2B6AA 1C1BA 4ICLB 2KZZA 2AGPA 4K4UA 1VSKA 4E7JA 4NLXA 4JV0A 3BQ2A 3CFOA 1VSMA 2YNHA 4QAGA 2ATLA 5C25A 2D7SA 3SI6A 1ASVA 4UQGA 4XIUA 3KK1A 1TV6B 1WN7A 1VSHA 2XRIA 3ZT1A 3EZ5A 1RTHA 4H4OA 2OZMA 3TQ1A 4HYKA 2QKBA 3NE6A 3NF6A 5J2NA 2HMIA 1Y97A 1SKSA 3AVBA 4LD0A 4NLGA 2XY6A 1CZBA 5HBMA 2XHBA 1S1TB 3AO3A 3QIOA 5KFHA 2BRKA 3VN5A 3KD1E 3E01A 3Q8PB 3QIPB 5F8HA 1S9FA 5KFAA 4TY8A 3LPUA 3M8RA 3MEEB 5L9XA 4PUOB 4NYFA 1T03A 2W8KA 1TKXA 1NKCA 2CJQA 4HCBA 4B3OA 2X74A 5KFNA 4DTOA 4Y2AA 3V1QA 3FSIA 1RT3A 1DTQA 1N6QA 1N5YB 2FBVA 3U3YA 3C6TA 1S49A 5I42A 3ZT4A 4RUCA 4HCCA 4W5RA 3HPGA 4F4YA 1BCMA 4JLHA 2B6AB 3AVLA 3H59A 1NHVA 3NKYA 3I0RA 4B8CA 3KLIB 3BSOA 1X1PA 2E6LA 1QSYA 5FRMA 3A2FA 4IG3A 4YR2A 3HSTB 4DTPA 4DLEA 4ED3A 1X9WA 1EX4A 4CJRA 4DSEA 2W9CB 4LH4A 4ZP7A 2I5JB 4KRFA 1FKOB 3NBPB 1BI4A 2IM3A 4CJFA 1K6YA 2P1JA 4FJKA 1I3AA 3NBPA 5CZ1A 1HYZA 4IOBA 4CK2A 2HHVA 2VG5A 5KG2A 2BE2B 4B9LA 1QAIA 1KCFA 4CJUA 3PO5A 3RAQA 1Z25A 4LH5A 5C42A 3C95A 5EDWA 2GIQA 4ZPBA 4NLQA 4MFBB 1X9SA 4MKBA 5KFWA 2OPSB 3M8SA 3CWJA 2YV0X 2HHWA 2XY8A 1JIHA 4K4SA 3G86A 3IGNA 4FJNA 3CQ8A 4GW6A 1CLQA 4CIEA 1KVBA 3Q8RB 1REVB 4H4MA 4GC6A 3NGZA 3PW4A 3NAEA 2WONB 1B9FA 1I39A 3NF7A 3NHGA 4FK2A 1GX6A 5DK5A 3KK3B 2FJWA 2IMWP 2FVQA 3LP0A 3ZT0A 1QSLA 5F9NA 4CESA 3SJJA 4KV8A 1VSJA 5JUMA 3KK3A 3VQDA 3KHRA 5J2QB 1RT6B 3LP0B 1SL1A 1RT2A 1VSLA 4Q44A 3KLEB 1IKYA 4M41A 1RDBA 1C1CB 2YNIB 3DM2B 3TAMB 3SUQA 4NLVA 1TL1A 4L8RB 4DTXA 3PW7A 1REVA 1Q9XA 4J9NA 4B9VA 3QGGA 1JLFB 1S1WA 3CFRA 4KFBA 1MU2A 5KFUA 1R0AA 4KAZA 4Q0BA 3OS0A 4KHSA 2VA2A 3OYJA 3SPYA 2R8KA 1HYSA 5DQGA 4K8ZA 4Y1DA 4ZMMA 1RYRA 3LDSA 4AILC 4ED2A 4QWDA 4MQ3A 4PQUB 5DMRA 5J1EA 5KT3A 4TQSA 1JLGA 1TKTB 3FDSA 4URQU 1RCHA 4TN2A 4EZ9A 3KKRA 3ZT3A 3LP1B 5KFJA 1A5VA 3KHGA 4RW4B 5HP1B 3V6JA 4BDPA 4F4KA 4R5PA 2DTUA 4TYAA 4IH6A 4E7LA 1RILA 3OYCA 3BQ0A 2OA8A 4MKAA 2ATQA 2HNYA 2HHTA 2IDOA 4RW7B 4URSA 3QIDA 1B9DA 5C25B 3CG7A 1W0HA 3TABA 3OHAA 3BGRA 4ID5A 5KT7A 2O4IA 4EO6A 1ZBFA 3AA5X 3ZSVA 5HBMB 1T7PA 3I5CA 5KFBA 2DPIA 3TAGA 2FJVA 1D0EA 1KFDA 4ZP6A 3G10A 1J9AA 3QLHB 3VQ7A 3SQ1A 1WNSA 4C8OA 3MXIA 3BR9A 3UPFA 3PV8A 1RDCA 3O3FA 1U04A 2V0NA 4CE9A 3DMJA 4KHNA 4TYBA 4ZHRA 3MEEA 5JXSA 4LSNA 5CYMA 4J9KA 4BDYA 2BRLA 4NCBA 3HVRA 4LSNB 1TVRB 3VQ5A 2D5RA 5KFFA 2ASDA 4K50A 3AO1A 4B08A 5KFVA 5KFGA 4WYWA 3TWHA 4Z4FA 3FQKA 4GMJB 5KG3A 1S5JA 4B8AB 2O4GA 1TL3B 3NL0A 1ZYQA 1Q9YA 5KFXA 4ZTJA 4EEYA 1S0OA 1C1AA 5KG0A 2ZD1B 2IM0A 4CEOA 4RNMA 2UVVA 2ZD1A 1JLGB 4CF8A 4EZ6A 1IM4A 3AVJA 4YQWA 1RT1A 4PA1A 3VA0A 1XR7A 3OHBA 3RBDA 3UR0A 1EP4B 3QEWA 4ECRA 5HROB 4I2PB 1C0UA 4FZYA 5HRSA 1ZTWA 2W8LA 2DFHA 4FLTA 4DWIA 3JSMA 4RUAA 3NH2A 4NCGA 4RNOA 3SUPA 4DS4A 3TAQA 5KFMA 4FM1A 1TKZA 1D5AA 3CJ5A 2J6TA 4KB1A 3DLEB 1UA1A 4ZHRB 1WAJA 4E1NA 3C6TB 3DYAA 4OPKA 1EKEA 3BSAA 1RDRA 4DTSA 3C6UB 1IKXB 3SNNA 4FBTA 2OZSA 2AJQA 3PZPA 3DRPA 4HUEA 2IM1A 1GOAA 4CJVA 1S97A 1HQEA 2HHQA 1JLCB 3AVFA 5KT5A 4IQXA 1S10A 4CJ5A 1TP7A 2ILYA 2UVWA 4F3TA 3SCXA 4FJIA 2F96A 1EETB 2YKNB 3C94A 4YNQA 3GIKA 3JYTB 1S1VA 5KG1A 4DG1A 2YKMB 3VQ4A 4NLDA 2UUTA 2FVRA 1HMVA 3SYZA 3S3NA 1VRTB 2WOMA 1N6QB 4O44B 1HJRA 3GYNA 4RW6B 4BDZA 3CJ0A 4RZRA 4CFAA 5J2PB 5KFCA 4KV8B 4DFMA 1FXXA 3RB0A 2ITGA 4BE0A 3KMSA 1VSDA 2ASJA 3EYZA 3EZUA 3L3UA 5CYQA 1SH0A 5KFLA 3HPOA 4CGFA 4N41A 3DRRA 1VSEA 3G6XA 1NOYA 3V1RA 3HJFA 2KW4A 3NFAA 1RT3B 4FS1A 3ZSWA 4Z4GA 3DLGA 3OLBA 1NJZA 4ED6A 4KO0B 4MH8A 5L1JA 3T5JA 4IFYA 2UVUA 3L2VA 2IGIA 1S6QA 2R8GA 1CXUA 4FM0A 3JSMB 1O1WA 4Q0BB 3IN5A 2WONA 3OS2A 1J5OA 2V4QA 1S1XA 1NKEA 4JV2A 2O5DA 4CJEA 4FVMA 2KFNA 1RT7B 1BCOA 3OYFA 4R5PB 3PW2A 2VA3A 2W42A 4YFUA 1L5UA 2I1RA 4O3PA 1RT2B 3T1AA 4N56A 3LP1A 3VQPA 3ASMA 2FVSA 4CHPA 2IAJB 2I5JA 4OKKA 3RMCA 2XC9A 2CKWA 2E6MA 3GILA 4OKEA 4FCYA 3H5UA 1TQLA 3OSNA 4NYZA 3ZSYA 2Z1HA 1U45A 5HROA 4K4TA 4JRPA 1S1VB 1TVRA 3V1OA 1VRUB 2RF2B 2AWZA 3BSCA 3U3GA 1WSIA 3H5XA 4CJTA 2OPSA 1QHTA 4E7HA 3QNNA 5CYQB 2AU0A 1NK5A 1BQMB 3DRRB 4CJQA 1EXQA 4DEZA 4AHCA 3D0PA 3PHEA 2FLNA 4CK1A 3HT3A 3N6LA 3KNAA 3DYAB 1IKXA 1C0TA 1ASUA 5KFIA 3MR2A 1JX4A 4KHRA 4DF8A 4W5TA 3K59A 1JLFA 1FKPB 5F9LA 3N6NA 1S1UA 1DLOB 5DGAA 3I5AA 2PZSA 4RW9B 4ECYA 4CCHA 4WZMA 2D3UA 1KFSA 1RT7A 5T14A 3GIMA 5KFOA 3DOLB 4J9SA 4X2BA 4MFBA 3AVNA 3LAMA 4CIGA 2PYLA 4CHZA 4R0EA 4HUGA 4NYNA 2RDIA 2HVHA 4YR3A 3OYNA 5C42B 1LW2A 4OLBA 1RT1B 1RT4A 4RW4A 5HP1A 3I8DA 4WFZA 4J9OA 4CEEA 2UUWA 3QNOA 3TR8A 4PWDB 4DS5A 1NHUA 4DL7A 3I0SB 1JXEA 3H40A 4KHQA 3AVAA 2HNZA 2LSNA 4JS5A 1LW0A 2B5JA 1SUQA 4KKOA 4QWAA 5DLGA 5FROA 3BGRB 3OL6A 1JXBA 3QESA 1ZTTA 4OJRA 3QZ8A 2JGUA 4BWMA 3RR8A 3O4NA 1KSPA 4CF2A 2ZE2B 2IJNA 4K4ZA 4FLYA 3ITHA 2C2DA 3RMAA 1TKDA 1NK8A 2J6SA 4KTWA 1HNIA 4M3XA 1JLAB 3LPTA 1KLNA 1KVCA 1C1CA 2YNIA 1WAFA 3GV8B 4DL5A 1QQCA 3CDWA 5KFDA 4I9LA 1IKVB 4ZVGA 1RBRA 1DTQB 5EUHA 2GC8A 2G8FA 2YNFA 3DLKB 4E1MA 1WSFA 5C5JA 2BQUA 3SI8A 1VK0A 4AH9A 4EYIB 2Y1IA 4PUOA 3QLHA 5FDLB 4IG0B 4EO8A 2W9BB 5KGXA 3QEXA 1NK9A 3DOKA 1T3NA 3T5KA 4E0DA 2VWKA 1FKOA 5F8MA 4FJJA 2E4LA 4EP5A 4QOZB 4DTRA 1XI1A 4J9MA 3MXJA 1QS4A 2QV6A 4NZ0A 4Y3CA 5I42B 3LP3A 1XR5A 5F8JA 3OVNA 1R0AB 3U6FA 4RNFA 2AGOA 3CO9A 3L2WA 4IDKA 4HVJA 1JLBB 1S9EB 1JL1A 4B9MA 2DFEA 4F3OA 1JLEA 3DDKA 4J9LA 2HB5A 2JLEA 5KT6A 4Z0UA 4CECA 1HARA 4CJLA 3K57A 3PJWA 1FK9A 1QTMA 2YNHB 3GV7B 3KTQA 3ZSQA 4KPYA 3AVHA 4KI6A 2XY7A 1SKWA 2OPRA 4PWDA 4Q45A 2W9CA 2HWHA 2YNGB 1S6PA 3RAXA 4O0JA 4M3ZA 4YMEA 4OKJA 1N48A 4CJKA 1HYSB 3NMAA 4OL8A 4ZPDA 1LWEB 1LAWA 4CFDA 3TI0A 3KLFB 2ZE2A 1CXQA 5CY4A 4ZVFA 3VQSA 1Q8IA 5SWMA 4LQ9A 4FW1A 5DG7A 5F8IA 3KLFA 4QWEA 1LWFB 4DF4A 4H4OB 1C0UB 4K8XA 4O3SA 3V6HA 4CGJA 4MK8A 2VWJA 4FBUA 1IH7A 4CK3A 4J2BA 2Z1GA 4DL4A 2FJXA 5KFEA 1TGOA 4DQIA 4N5SA 5EWFA 3KLEA 4F2RA 5L1KA 3K58A 1KRPA 3AV9A 2QE5A 2VG6B 3L8BA 3SV4A 2W9AA 4ZVEA 3DI6B 3OYAA 3KJVA 5J2PA 2GIRA 4LSLA 4CEAA 4DMNA 4IKAA 3GIJA 3I0RB 4BACA 1HPZA 4I7FA 3HXMA 1I6JA 3OLAA 3QO9A 2RKIB 3TAPA 1S1UB 5KG6A 3TAEA 2W7PA 3TARA 4DL6A 4CGGA 3BREA 3I5BA 1HNVB 3NGYA 1BGXT 1GX5A 4I2PA 1NJXA 1A5XA 4M3RA 1NK4A 1LAVA 4N47A 5E41A 3M8QB 1A5WA 1F21A 4Z4IA 1BL3A 1SH3A 4O44A 3PJXA 3IRXA 3MEGB 2J6UA 4C8NA 2YHAA 1ZBIA 2P51A 3O3HA 1YTUA 3CM6A 3SPZA 4C8KA 1QAJA 3RMBA 1HQUA 2XGPA 3VQ8A 4DU1A 3KLGB 3T3FA 4ZP8A 1G15A 4CF9A 1BIUA 5KT2A 1QSSA 1BQNB 3MECB 3O4QA 5HRRA 4KSEB 3QETA 1ASWA 4R8UA 2B4JA 3VQEA 1J54A 1S0NA 3VQBA 2W7OA 4KAIA 2OH2A 4N76A 5EWGA 2E9RX 1HQEB 2XY5A 3HVTA 4RW8A 3NF8A 1S1TA 2FLPA 4KKOB 1RNHA 3QINA 2BE2A 2XO7A 3V81A 3DLEA 5DLFA 3I0SA 2UVRA 1JL2A 1RT6A 5DGBA 4W5QA 4B9SA 5J2MB 3OYIA 1NOZA 3V81B 4K4XA 4CEBA 5C24A 1YTAA 3ULDA 2ZKUA 3V9XA 2JEGA 4Z4CA 2IJFA 5J1EB 3D5MA 4FJ7A 4KREA 4FJ5A 4TY8B 1BISA 3TANA 2FBYA 4IG3B 5I3UA 4YP3A 4FJXA 3UQSA 4AHVA 1DTTB 1NK0A 3QO9B 3OYBA 4ECTA 4ED7A 4IH7A 4NLWA 1BHLA 1T94A 3THVA 1YVUA 2BGGA 4IFYB 3F9KA 3OS1A 5HLFB 1UWBA 4ECQA 1HPZB 2C28A 3SQ4A 1LWFA 3OSPA 4ED0A 3CJ2A 2F8SA 4E3SA 3G6VA 4DLGA 4LY7A 2W9BA 3MAQA 3V6DB 4CJ4A 5J2QA 3OYDA 1VSFA 5KRSA 3AVKA 2BQ3A 2V4RA 1Z4UA 1SUQB 5SZTA 2FBTA 4DSJA 3VA3A 4HUFA 3IAYA 3PX6A 1KVAA 5KFYA 1U09A 1BIZA 2G8IA 4ECUA 3TAFA 4KHYA 3AO4A 4OGEA 3RBEA 3HL8A 2Q3SA 3KIOA 5HLFA 2D3ZA 2X6SA 3K5NA 1ZBLA 4ELUA 4KI4A 5EWEA 1ZBUA 4O3OA 3PW5A 3CFPA 2Z1IA 5DG8A 3H5YA 2X78A 4NCAA 4KB0A 1C2PA 4RW7A 4RNNA 2IA6A 2JC0A 3QEVA 2RN2A 4DFPA 2IC3B 3KMQA 2FC0A 4CIFA 3MFHA 3V9SA 3M9NB 2B5JB 3N6MA 2ILZA 1LV5A 4AHTA 1BQMA 1HYVA 4F2SA 1KHVA 4IRKA 4Q5VA 4ZPAA 1JLQA 4FJLA 3LANA 4O3QA 3ZT2A 3WNFA 3MR3A 3ITHB 3M9OB 4XPCA 3DLKA 3FRZA 4FZXC 1T03B 3T19A 4CF1A 3OYMA 2IOCA 4Y1CA 3H2LA 3OJSA 2G8UA 5KG5A 4IFVB 3ISNC 1UAXA 4DSLA 5KRTA 2KZMA 5DQIA 3RB4A 1FKPA 4CHQA 4TY9A 3DM2A 4FYDA 5I3UB 1QE1B 2EHGA 4ZTFA 3NH1A 2OPQA 5D3GB 3OL9A 1YT3A 4DU4A 1Z26A 3V6KA 3AA3A 3LP2B 1TK5A 1C6VA 3K5MA 4CJSA 2AGQA 2WOMB 4JS4A 1S9EA 1MU2B 2RPIA 4RU9A 2C2EA 2IBKA 4RW6A 3Q8QB 3KHHA 4WXWA 1XHZA 4ECZA 1XWLA 2ZQBA 1S4FA 2JEFA 2DY4A 2XGQA 2RKIA 1L3TA 2D41A 1DTTA 4I2QA 4FLXA 2OPPB 3BSNA 2HNDA 1KHWA 4EYHB 4CEQA 2JEJA 1RT5B 4F4WA 1SL2A 2VG7B 3V4IB 4B9TA 4C8LA 5J2NB 3CDEA 2ETJA 3SV3A 1JKHB 3AVCA 4KHMA 2R2SA 1JLEB 3VQAA 1RTHB 1BQNA 2IAJA 3PUFA 1RBTA 4TXSA 3V9ZA 4KE5A 4OLAA 3H4DA 1VRTA 2R7YA 4FLWA 3PVXA 1U49A 1HNIB 3AA2A 2OYQA 4NRTA 4IFVA 4I7FB 4B9NA 3S9HA 4W5NA 1U4BA 4M42A 3EPGA 2D0CA 4FW2A 2NUBA 3WNEA 2IM2A 2B43A 1HMVB 3O3GA 3FFIB 3K5OA 3NGDA 4Z4HA 1S0MA 4CEZA 4F8RA 2AQ4A 4O4GB 1L3UA 3HPHA 5C24B 3RB3A 4KO0A 4E7IA 4Q8FA 5CYMB 2GV9A 5KFSA 4WFYA 1T8EA 4KBIA 4DFJA 2V9WA 1IKYB 2WK4A 5T7BA 3IRXB 3MEGA 4Y2CA 2QKKA 4G1QA 3LALA 1K1QA 4CEDA 3ALYA 1C0TB 3LP2A 4OPJA 3SFUA 3V6DA 2OPQB 3OYKA 3S3OA 3HK2A 3NGIA 4B9UA 4EBCA 1TK8A 1S6QB 3ZCMA 1D9DA 3KK2B 4TQRA 3KLHA 4BE1A 4E7KA 4IBNA 3B6OA 2KFZA 4I2QB 1KTQA 3CJ4A 4FLVA 2JC1A 3P5JA 3GV5B 3QYYA 3D45A 3KLHB 2EX3A 3SUOA 3SUNA 1SV5B 4IH5A 2BDPA 1T05B 3OL7A 4GC7A 4E19A 5FDLA 3OJUA 3M8QA 5K14A 2R8JA 3BDPA 3KK1B 4NLOA 1EP4A 1YVFA 4ECWA 1CSJA 2Y1JA 3OYGA 4AHUA 1SL0A 1NJWA 1HNVA 3ISND 4CJWA 3RWUA 1B92A 1RTDA 1RBSA 3HHKA 2HVIA
chains in the Genus database with same CATH superfamily
3F5TA 2AJ4A 4J2DA 3I55N 3CT9A 3ISZA 4YY3F 2FYXA 2FSJA 1IN0A 3QZ7A 2I38A 4J9RA 4OX8A 3MR5A 1L3SA 1ZETA 1S0VA 4LR7A 3MD3A 3VQ6A 2H54B 3VQ9A 5GMKa 1M5PC 2QXLA 5CXTA 3MTKA 2YKOA 3I82A 1X4AA 1KXPA 4RWXA 4PPDA 5HSPA 4U95A 4M5JA 3WXIA 2QWOA 1RWMB 2KHDA 1WG5A 2BR0A 5D77A 3HSJA 2F8EX 2H9ZA 4K4WA 5BXIA 5J2MA 5C2CA 4I9QA 2M0GB 3CPWM 2DK2A 3OV7A 2QA4G 3PRVA 2CQCA 2QG9B 2X6NA 1F0XA 1TL4A 4DR4J 2KG1A 4AQYJ 5F8GA 2DHHA 3FQLA 3MMAA 4FO0A 3AOAA 3CQYA 2KHCA 3D2FA 3VEOA 4C8MA 2DNMA 3R7BB 2VB6A 2HGNA 2DFFA 4WP8A 3IMXA 3D0HE 2VD3A 3A8IA 3WHIA 4M45A 3C7NB 2IA0A 1Q86T 1K9MO 2IIHA 4WYBA 1T9XA 2H5JB 1TUYA 2LXUA 4MIBA 3OW2M 1RBAA 5LOQA 5E84A 3L3CA 1GTHA 4L3NA 4N77A 3M2VA 2E5LF 2HQDA 1IKVA 3W0LA 3LAKA 2HHHF 1KD1O 3TA2A 4DPWA 1VQKS 1DBDA 1WC0A 3SQGA 2IIRA 5DO2A 1IKWB 4JEPA 3E1YA 2W4PA 1UOCA 3K0JA 5HL7L 3OUYA 3KK2A 2IYIA 4NCGB 1N8RO 4IG0A 1NDPA 3GFHA 1RTDB 2QZ8A 1ZM4A 3R3TA 3DOKB 3ENWA 3Q8SB 1NSAA 2BABA 3I4PA 3DMJB 3UNGC 4H8KA 3S8SA 3GJTB 3D6MB 3VVUA 3BO2A 3NCQA 1H2TZ 2MQOA 4EBDA 5ETOA 2P5GA 1CC8A 2DHGA 2PEHA 5KT4A 2C2KB 2B7BB 1UA0A 1VGYA 3R5DA 4Z7YA 3RSEB 4QCLA 4NLUA 3LM9A 3PY8A 1T6CA 4GY2B 3GQCA 5EX0A 4I56A 2C3PA 3PACA 4JI4J 1FRIA 4L75A 3CC7N 3A4TA 1RTIA 4WE1A 5A0YA 3KDOA 2RRNA 3CJQA 2YKMA 3T5HA 1HQ2A 2CQ1A 2XEXA 2VUGA 2NYIA 1B70B 3QATA 1TTHB 1Z2LA 4YEAA 2AD9A 4KHPK 5HMYA 1UW9A 1T9UA 4DCOB 3P5BP 4FS2A 2MGZA 4RLEA 1ZZFA 4O3NA 3G96A 2V68A 3NEKA 3M8PB 5F0WA 4RG8A 5JS2A 2XS7A 5HRPA 4FLZA 3BYPA 4K2XA 2RQCA 1GOCA 2OMLA 3CVKA 4RU2A 4IOAL 1S1XB 1RAHB 3DCAA 5AQRA 1TL3A 1ACMB 3EGZA 1UFKA 3MM8A 1GLCG 2WHOA 2FHJD 4DUTA 2HNDB 3KKSA 4LF7F 4BHQA 3WT0A 5KGWA 1Z05A 3H90A 1IKWA 5KFQA 4BE2A 2DEJA 1TKZB 4UTGA 3HI9A 1K1SA 2MHEA 1JCEA 4DQPA 4FM2A 3H2UB 3BQ1A 5HRNA 4IJAA 1FE0A 1P6TA 4CJ7A 4DV5K 1UFLA 1WB9A 2D0AA 3EEQA 4OX9J 4JN4A 1DQ8A 3MPYA 3FZLA 1FTCA 1UJ4A 3I32A 4DZDA 4FYVB 5ELZA 4LREA 5KFTA 3AVIA 4BWJA 3J7YI 2GHVC 4EI2A 4DV0J 3AA8A 4M7XA 4ECXA 2P9KA 2PI4A 2BKNA 3U4LA 5IZHA 2HQCA 1RWUA 3ZZTA 2ZGZA 4O55A 3ZX0A 2FY1A 2YHBA 3C65A 4TU8A 1S1WB 2G8KA 4WKRA 2BACA 2CVIA 1Q82T 3M2RA 4A5BA 2HRUA 2V94A 3O9TA 2CPHA 4N8NA 5DQHA 2PYJA 4IR1A 4RL1A 4WFNL 5KI6A 4Z4EA 1VHXA 1RWPB 4QYZK 2HAIA 2BKOA 2CJ9A 2QLXA 1ZBHA 5E26A 1LXJA 4URGA 1VRUA 1U7LA 2GNKA 5H9FJ 3PX4A 3HZGA 4ZIVA 4QW9A 3M2RB 3W65A 5AQWA 5DDQC 4X4UA 4O0IA 4LF8F 2QW9A 3QFPA 3UDEA 3LWLA 4DL2A 2XWXA 4LF9J 1BI4B 2QWLA 2F9WA 4Z7CA 2VL1A 3T6BA 3P45B 3LWMA 2HNZB 4H03B 1N4LA 2FBXA 1YJ9S 1W26A 3D6RA 4OJGA 5IT9O 5I9EB 2FF6A 3HVWA 4LFCF 4ERDA 3TSPA 5DG9A 1VMBA 2RHSB 3L2QA 1WI8A 4DDFA 3G6ES 5E3CA 2HKEA 2GWJA 4PEOA 3CB4A 1T05A 4TNOA 2G8VA 3HP6A 5K20B 4F4XA 5LJ5Y 3WNHA 1AUDA 3DOMA 3BP8A 3CEDA 4FXDA 1WSHA 4S0MA 4P2MA 1FD8A 4L73A 2FTRA 1RT4B 4RX6A 4JUZA 2WCXA 3TA1A 3PHTA 4KJIA 3RTVA 4WZQA 3VGSA 3H8YA 4EBEA 5ETLA 4JYAJ 3BPDA 3MPWA 5DDOC 3HRGA 4KB7A 1WOPA 2XMJA 3KDNA 1I1GA 3DI6A 3LPYA 1X5OA 5F8NA 2H1YA 4WU3A 4CI6A 3ZZYA 4G1QB 1BWFO 4YOEA 5AE2A 4PQUA 2G9OA 3E51A 1PJ6A 1CPZA 2A1BA 4J90A 4DR5J 4LQ3A 3MUTP 4B3TJ 2ABYA 4FK4A 1FRMA 2VG7A 2HZCA 4CZEA 1RAIB 4CZCA 2DNKA 4JV1A 2XSJB 4ZN1A 1RTIB 3WC2A 2QMUB 3ILLA 4NA1A 4AHSA 2GWKA 3W5YA 4DSIA 2HW3A 3T5LA 4BRLA 1T3VA 4PXDA 2KZZA 4K4UA 4JV0A 3CFOA 4CD1A 2NCKL 4NXNF 2YNHA 3TJ8A 2D7SA 3I31A 3L6QA 3C16A 4CH7A 1Y0HA 1WN7A 1QAXA 2C2ZB 1ICEB 2CG8A 5C2GA 2HOEA 3SCJE 3NE6A 3EVMA 1Y97A 3TTFA 4CW7B 3N9UC 1XUPO 4FWQA 3PJ9A 3AVBA 1VC5A 4NLGA 4LUBA 2XG8A 3A5NC 3MCSA 4BVPA 1JNZB 3GCWP 2BRKA 3VN5A 3CCLN 2XYGB 3KD1E 3E01A 3QIPB 3QMQA 1DFDA 2O8EB 4IOXA 1S76D 5L9XA 4R79A 1GLAG 1T03A 2W8KA 1TKXA 5KQDA 3M1FA 4HCBA 4B3OA 5FLXO 1UFWA 5AJ3F 2X74A 4FKYA 2OTJS 2M70A 4Y2AA 3CCJN 4AT1B 4MT1A 2ZH5A 3T1HJ 1U0SA 2QWRA 4JBCA 3IWLA 3QWUA 4P6QA 5I42A 3TQEA 4HACB 2RAQA 4F4YA 1Y3KA 2ZZMA 5LSOA 4CLZA 2UZAA 5GAHI 4KH1B 2DR5A 2GQCA 1F3FA 4B8CA 2UV8G 1NHKL 3LL3A 3BSOA 4OZ3A 5A2QO 4IOCQ 1CJVB 1QSYA 5FRMA 1X4DA 3A2FA 2L48A 3H1QA 2IVNA 1A7GE 4YN3B 4ED3A 1RGIA 4DSEA 4ZP7A 4O0NA 4KRFA 1CS4A 4HH0A 1JB0C 1LOUA 2IM3A 2RIJA 2FHMA 1YITS 2V7YA 4I6YA 1K73O 1I3AA 2MLYA 5CZ1A 4IOBA 4CK2A 1GTEA 2VG5A 3TTCA 3LTOA 1N32K 5AQUA 2R7UA 4OFZA 5CZXA 4A8MP 4CJUA 3LDLA 2YWKA 1RHMB 5IV4A 1Z25A 4X66F 1PGZA 3EXYA 3CIPA 4OX6A 3M8SA 3CWJA 1VBKA 2E20A 1KQKA 2HHWA 1JIHA 1YWXA 2QIFA 3ZTOA 1QVGR 2NRVA 3CQ8A 1CLQA 3V5RA 3SDEA 2HBZB 1Q18A 3T9NA 5AFUH 3NAEA 2WONB 3WXLA 2AV5A 1PAEX 1GK8A 3G82B 4H0VB 3CCMS 1GX6A 2FJWA 4HTIA 2FVQA 3P38A 4CESA 4X64K 4KV8A 1T9WA 4KGKA 5LMNK 1YX2A 2KYXA 3LP0B 2V69A 2UUBF 3KLEB 5IWAF 2LXIA 1BXNA 3D67A 3OR2B 1GLLO 1OYDA 2W2QP 4K59A 3MGJA 4BC7A 3RJMB 2YNIB 4UOFA 3DM2B 3ZO7A 4K0KF 5BYQA 1TL1A 2MXYA 3R8YA 4L8RB 3H7HB 1REVA 2H5EA 2GJ2A 1Q9XA 4J9NA 2DNNA 4B9VA 1U26A 2N3OA 1DARA 1N8RT 2EFVA 1YBTA 4USTA 2R8KA 1HYSA 5DQGA 5AXNA 4K8ZA 4WIIA 3OR1B 3IWXA 3R7SB 4F0HA 3DAWA 5J1EA 2PFFB 3HHDA 3GG4A 4PKGA 2M5YA 4LBHA 4WF9L 4GRSA 2YX7A 5LL6Z 3KKRA 1NH7A 5KFJA 2YH0A 2OTJN 4RW4B 5HP1B 3V6JA 1IBMF 4BDPA 5ETKA 2F8MA 5G0RB 3M32B 4R5PA 1RXOB 4IH6A 4FPBA 3GCXP 2ZH8A 1UEVA 5C15A 1Q5VA 2IDOA 2HK2A 3QIDA 3CCMN 4RBUA 3GJQB 3BGRA 4ID5A 5BR8F 2O4IA 1M5VC 2FXUA 1FI4A 3ZSVA 2H3EB 3I5CA 9RUBA 4RPFA 3JXOA 2FJVA 3TO8A 3OHRA 3OVSA 1D0EA 4J8FA 3G10A 3ETOA 5B0AA 3A1YG 1WNSA 1IJFB 1XQIA 3K9JA 5E3PA 4KGVB 2DRDA 1NGGA 1OPIA 2YKAA 2UU9K 9ATCB 2P9PB 4KHNA 1UL3A 1FFWB 1NCLA 2NUUG 2H5IB 3D1OA 3D0IE 2AJ0A 4BDYA 2Y8YA 3ULEA 1TMJA 3IA0A 1CJVA 2IFXA 2D5RA 1T3OA 2ASDA 3AO1A 3PYFA 3EWGA 1RAFB 1G1XA 5KFVA 5KFGA 4WYWA 1K44A 1Q79A 3UN3A 1C0GA 5KG3A 1S5JA 4P71A 4B8AB 5B8HA 3DGVA 2VU5A 2UXDJ 4ZTJA 3EKUA 2Z4PA 5KG0A 1LEOA 3GL1A 4CEOA 1EAYC 5AQZA 4GKKK 3ZZOA 1DAXA 2UVVA 3EO3A 1JLGB 4CF8A 5GADI 2E8AA 4WQ4A 2A10A 4CLKA 1JXVA 2Y0SD 4ECRA 3CJKB 1P1LA 3H6EA 4FZYA 5HRSA 3NH2A 2VIHA 2IDLA 2P9SB 1HBMB 2K3KA 1TKZA 2YWGA 5D6GA 3CJ5A 2ERRA 2KXNB 4KH6A 3D2EA 4ZVUB 2KFYA 3J7ZT 3Q23A 4NXMK 2YQ3A 4KB1A 6FD1A 4M5KA 1WAJA 4BRGA 3X1LB 1EKEA 2K3IA 3C6UB 4JI8J 3SNNA 2NXCA 4KT0C 1GOAA 2RT3A 5I3QA 1S97A 3AXMA 2R42A 1JLCB 2RUGA 2YPZA 3UW1A 3W3SA 1LCUA 3DJCA 4CJ5A 2UVWA 4GV3A 4TLQA 1NJIT 2I7NA 1EETB 1OVQA 1RHRB 1ZA1B 2ZGYA 4BR4A 1U0HB 2F7VA 2YKMB 2FVRA 1HMVA 1P8ZA 1VRTB 4DR2K 5BYRA 3GIRA 2WOMA 4O44B 1HJRA 4M5IA 4RW6B 3LQVA 5ETMA 1KS2A 2NXEA 2R7QA 4HEA9 2NR0A 3RB0A 3D3BJ 4BRAA 1QZ5A 3SCKE 1VSDA 1SH0A 5KFLA 2NZTA 3SK3A 3DRRA 3G6XA 4NWBA 1N32J 2KW4A 2X1BA 1FRXA 3M2UB 4C3KA 3WXJA 2WC9A 4Z4GA 1SIZA 5L1JA 3IBCB 3T5JA 4IFYA 3HSGA 2NRXA 5BPLA 1V9OA 2R8GA 2C2NA 3IN5A 2CQHA 2WONA 4DV4J 3OS2A 1J5OA 3U1NA 2BJ8A 3Q2TC 4H0PA 3I56S 4JKAA 4JV2A 4JI7K 2J76E 2U1AA 1UVLA 4R5PB 1RWKB 2FF3B 4BC9A 1GMWD 3BEGB 1FEHA 5DZ6A 3KG4A 2GIFA 3ASMA 3FE1A 4QS7A 2GEMA 2O01C 4WU2A 2CQIA 2CKWA 4B02A 2BM0A 1X4HA 2Y1RI 2QLFB 3BKUA 4CM0A 3KG0A 4DR4K 3VTIA 1FE4A 3ZSYA 3ATUA 2ZDPA 3KHYA 3PSIA 3HHLD 1F5AA 1WEZA 3IR6B 4JRPA 3CMES 2RF2B 4FPIA 3BSCA 4DPXA 1HBOA 1AA1B 3H5XA 2OPSA 3O08A 2DHSA 1KAYA 4E7HA 3QNNA 1PYOB 2AU0A 1BQMB 1HNWJ 5CHIA 2DKOB 1H6KX 3R27A 1EXQA 4G1IA 3MCMA 3I55S 3PHEA 2E7XA 1XEZA 3CDAA 1ITPA 3UVJB 1HNWF 5KFIA 1JX4A 2BJ9A 4W5TA 3K59A 1V6HA 3ATVA 3L9ZA 4NPOA 3VEZA 5IT4A 4RW9B 3FEXB 1FVQA 3RUBL 4ECYA 5GVQA 5G4DA 1RT7A 1SJFA 1VCTA 2CIMA 4MFBA 3PG9A 3FZ2A 4R0EA 3MWTA 3OYNA 5E3AA 1R8AA 2R7OA 3WX4A 4WFZA 3L7PA 4H5WA 4BRDA 1M1KO 4J9OA 1XMQF 3M05A 4CEEA 3QNOA 3TR8A 4PWDB 4M5LA 3THXA 4XH4A 4UZCA 3D1HA 4YB6A 1G4CA 2HNZA 3EMTA 4JS5A 4P7TA 4GNIA 4KKOA 5T7LB 5FROA 3UI3A 1KQGB 4USIA 1QAYA 1GLBG 2KXHA 2COLA 2Q2RA 3EZWA 3LDOA 3Q8UA 1DQAA 2HHPA 3P6YC 1AYEA 4QZVB 4K4ZA 3ITHA 4WTYA 3RMAA 4DR5F 4DR4F 1FDBA 2ZH2A 5JICA 4M3XA 1RSCA 1NMDA 1U1QA 3GV8B 2VC1A 3IWNC 4DL5A 3WQUA 3I56N 2E2PA 1ATSA 1RBRA 1DTQB 3GYXB 2GC8A 3DLKB 1RAOA 2MQLA 5D4OA 2BQUA 4RWWA 4AH9A 4EYIB 2Y1IA 4PUOA 1ZS6A 5SUHA 2VWBA 1NXIA 3P96A 4LRFA 3QEXA 3U7JA 3ILOA 1IM6A 2VWKA 2GQ2A 2MDAA 1FKOA 4NXNK 2RQMA 4FJJA 2OUGA 2LYVA 3N4WA 4J9MA 2QV6A 3NS5A 4UUWA 1XR5A 5F8JA 3CD0A 2CQ3A 1R0AB 4ZITA 5D4LA 4IDKA 3PEJA 1JL1A 2LFVA 3DDKA 1VK3A 4OX9K 2FIUA 3WEEB 4DV2K 2L9DA 4CLSA 3K57A 1FHTA 2D69A 4DV0K 1U1PA 3KTQA 5H9FK 2AYMA 2VBXA 3CIMA 4PABA 5AJ3J 1EQYA 4DPYA 4M3ZA 1HYSB 1LWEB 3D4JA 4DV5J 1Q7YO 4GVLA 2ZE2A 5CY4A 4ZVFA 4YS2A 3HMJG 2OELA 4FW1A 3KLFA 1LWFB 2KRBA 4CYUB 4OI1A 1FJCA 1IUJA 3NP5A 4RWTA 2BUNA 2PD1A 1NLVA 4CGJA 3GONA 2K1RA 4QIGA 1HI1A 4CK3A 4J2BA 4FPRA 4N5SA 3HDSA 5GAHP 4I6MB 2ZUGA 4DV3J 2QM1A 3R5JB 4F2RA 1RWWB 3WX8A 1K47A 2MJUA 3L8BA 3SV4A 5AQHA 3BF4A 2F4FA 3DI6B 2RE1A 3HSDA 4I6AA 1VBXA 4MKYA 2HK3A 3THPA 3HXMA 3M30A 5HAOA 2XZDB 1Q1KA 4FF3A 3MUVP 1RE1B 5I3PA 3DLLL 3UB5A 2YCHA 1UPMB 1AW0A 4MKVA 3MURP 1OYEA 4OHXA 3CJKA 1NJXA 1NK4A 5E41A 1F21A 1X4FA 4JKEA 1YJ7A 3G8SA 2CPXA 1VQOS 3N4QA 3PJXA 2CVEA 4IQMA 2YHAA 3MMCA 4AXIA 5JLFA 3I33A 1YTUA 3CM6A 1Y9OA 3KLGB 1G15A 2UU9F 1X31C 1OQ3A 1B4SA 4KSEB 2B4JA 1BWVA 3NMRA 2K8GA 3VQEA 2EW9A 1X60A 4GV9A 1WD6A 4DQ8A 3CF5Q 4KAIA 4N76A 2H51B 5AQPA 1HQEB 3HVTA 1NSKL 1F5BA 1X5TA 4U8VA 4RW8A 4BRCA 1S1TA 2FLPA 4B3TK 4DR5K 3QINA 4PKDB 3ILJA 1YGYA 5M1OA 5DLFA 4W5QA 4B9SA 2BM1A 1NOZA 4U7UK 4DUZF 5C24A 2UXBF 3V9XA 2M8DB 3RZAA 2IVYA 3ADAC 3D5MA 3TPQA 1YLXA 1N0VC 1QZ6A 2FBYA 4IG3B 5I3UA 4YP3A 3BM7A 4CDIA 4AHVA 1N54B 3QO9B 3OYBA 4ECTA 4IH7A 4NLWA 1Q0NA 4PPZA 4OO1J 2ZOFA 2PGCA 3OS1A 5HLFB 1CBKA 2MYFA 4ECQA 2O8BB 3SQ4A 1LWFA 3K2YA 1TL7B 3CJ2A 3VGVA 4ISGA 3SBMA 4OYPA 3MAQA 2W9BA 3OYDA 4IOCL 5KRSA 1Y10A 3AVKA 1UVJA 2NRWA 1HLWA 2JHEA 2FBTA 2G2OA 4LMZA 5ETPA 5AQYA 3IAYA 3DC2A 3PX6A 1KVAA 4KYZA 4ATNA 2R7SA 2G8IA 4H5TA 4OGEA 3TEHB 3RBEA 2CZVC 1SZ2A 2Q3SA 1KKHA 3KIOA 3KXDA 1F3VA 3MZIA 4ELUA 1UKUA 4PXEA 4JYAF 4RR5A 4O3OA 3CFPA 2Z1IA 1F5CA 2DR6A 1SJQA 2J4RA 5AQNA 3FZBA 2F9JA 4TKTA 4YOTA 2FZKB 2JLFA 2JC0A 1FT8A 3JS9A 3QEVA 3KMQA 4CIFA 3MFHA 1Z2ZA 3DXKA 2V5HG 3M9NB 3BGOP 3J7Z5 2ILZA 4LF1A 1BQMA 1HYVA 4F2SA 3AB4B 1CZAN 3MM6B 1KHVA 2CQPA 1R3NA 1X4GA 4BR2A 3DLKA 4FZXC 3DDIA 3D3CJ 4CF1A 3CCEN 3NRBA 5B0FA 3HOTA 4FXWA 4ZPWR 3O4WA 5J1PA 4LRDA 1KC8T 3BZKA 3VWSA 5DQIA 1TR0A 1YK9A 3DM2A 2OEMA 4C11B 2W24A 2KKHA 2DHAA 4OI4A 2D0PA 1EO1A 2DNQA 3IM8A 3CCVN 1PG5B 2WOMB 4B3SK 1MU2B 2XLKA 2C2EA 3Q8QB 1KOOA 1K8KB 2QL7B 4ECZA 2DTJA 1HWUA 4CZMA 2APOA 2WFBA 2B0GA 3IBFB 3OFHA 1QVGM 2PI5A 2HFVA 1NSQA 1RKIA 1OVYA 2RKIA 1B0VA 3IR5B 1P1TA 1L3TA 4I2QA 5AQFA 3DOMB 2HFNA 2UUAK 1KHWA 4CEQA 1IBLJ 3HM8A 1X5PA 1FX4A 3MK6A 5J2NB 3CDEA 4USMA 2Q1NA 1JKHB 2UXCK 3HCXA 1RTHB 4DU7A 4UZBA 1RBTA 4B1UB 3ZZPA 3VR1A 4TXSA 1VRTA 2R7YA 4H4KA 1QVFM 3A8YA 3X3UA 2UUBJ 3PVXA 1HNIB 3R3LA 4NRTA 2VBZA 4LF6K 5BJRA 2LMIA 4FNIA 2DB1A 5A8KB 3S9HA 1O0PA 5EXWA 4M42A 1YG0A 1ELOA 2O66A 1OH7A 3M6XA 4ED4A 3WIVA 2F40A 3O3GA 2B4UA 3FFIB 4Z4HA 1XNRJ 2NNWA 2AQ4A 2VFRA 2FJAB 4JI1F 5C24B 3J81j 3CJ7A 4YY3J 2OEJA 5IT9U 3CULA 2V9WA 2WK4A 2DITA 2HHHJ 3GMGA 1UZDA 4ZIWA 2HRTA 4MLHA 3VALA 2CNKB 3ALYA 1OQ6A 2E88A 4X66J 3FZKA 2GQQA 4OPJA 2BYCA 3SFUA 3V6DA 4BRQA 4BR9A 1CVJA 2L41A 4DR2F 4JI2J 3JSRA 3C14B 3T69A 3WBZA 1S6QB 1OY9A 1HNZK 3CMAN 4TQRA 2ZM6J 4I2QB 3GTYX 4FLVA 3P5JA 3D45A 1RWNB 3VERA 4FOEA 2BMBA 1SV5B 2BDPA 2XMMA 1K8KA 1B0PA 5U47A 3GDQA 5FDLA 4GKJF 3OJUA 2BBEA 3BDPA 2O8CA 5LXRA 5ETVA 4HTLA 1M0SA 4L72B 2Y1JA 3PTWA 4DV7K 2O1PA 4C11A 5IT0A 2WBRA 2J8SA 1KNZA 2ZH3A 2E7WA 1KWMA 4WFXA 1IR2A 3PKMA 1Q4RA 4JI3F 3CCVS 3JYTA 1IBKK 1U48A 4WQ5C 2NLXA 5L8RC 5A8WA 3LF0A 3PIOL 2ZNYA 2D3O1 1G6BA 3H98A 3FFKB 4DCHA 2Q1LA 3C8YA 4JRQA 2PA3A 1BUXA 3DLHA 1XHXA 5FPDA 1PO6A 4J2EA 4DTNA 1U1LA 1MN9A 1WDTA 2YNGA 3DLBA 2ZDOA 1H2VZ 3LZJA 4OYAA 3SSQA 4OIXA 2PFDA 2HMIB 4J2AA 4BY9C 4GVBA 2L08A 1G3OA 1S72N 2CPYA 2HBKA 3Q89A 4AD6A 1XR6A 2DNPA 2NSCA 4NXMF 2EWSA 1KLMB 4CZGA 4Y34A 1NK6A 3GYGA 3DRYA 2OSRA 2VZ9A 2UXDK 1KLMA 2NZ4A 3UWTA 5DM6L 2YX1A 1U8SA 3FC9A 3ET6B 5EOYA 4IKFA 4R8UB 4FWKA 2FPHX 5GAHU 1EX8A 2XZTB 1DLOA 3W7BA 5BPNA 2AX0A 3HVAA 1QQOA 2AYBA 2FLLA 5F8LA 2RDJA 2G8HA 4FZZA 2HPUA 3LGMA 4O3RA 2Z1JA 2KT3A 3QAUA 5K14B 3VETA 3C6UA 2HSTA 5JVHQ 4J91A 3BR8A 4WCEQ 5KG7A 3F73A 4BROA 1SQEA 3MTJA 2D1CA 1VSIA 1MMLA 1Y5IB 1R6VA 3M8WA 4RCHA 3S3MA 2X3DA 4RW8B 2YXLA 2RMLA 1EETA 2EK6A 2BV3A 3FZFA 2WRMA 4BR5A 5T7LA 3VEWA 3G6YA 2C2RA 1YIJS 1S72S 3LM2A 3SAGA 3CCRS 4BC5A 2E2NA 2BANA 3KWMA 4CP5A 2WB4A 4F3QA 4W5OA 2P9PA 2BTFA 5AT1B 4PRFA 4IZ9A 3N5FA 3OYEA 1TKTA 2B56A 3L4BC 3FR0A 4PL8A 1WKLA 3IG1B 2RJZA 3O44A 1HBNB 2AX1A 3IFRA 1SJ3P 4IR9A 1KN6A 4UT4A 4ZK7M 4XPEA 2VG5B 3HX9A 1WLJA 3H3NO 4XTTA 3ILIA 3RRGA 1WG4A 2V9KA 5TKWA 4F02A 3PR5B 1LWCB 4AUKA 3D28A 4M7YA 4OI0A 2OIHA 2F4VJ 2ZBCA 3LGHA 5CA5A 3FBCA 1WSGA 4YY3K 4P2XA 3FMWA 4NA3A 2W4CA 4JOUA 2HBYB 1SQKA 2JEIA 4RW9A 1IBMJ 3MM5A 1UVKA 4OI6A 1YJTA 3IS9A 3O1LA 3TVYA 1J27A 3HKWA 4M5DA 2A6AA 6FDRA 3HO1A 2CJXB 1VLYA 4P75A 5KFPA 1LWEA 2XCPA 3AQOA 4DV3K 2R7RA 2E9TA 3NNAA 4NLTA 5G0RA 4ZP9A 4U6PA 2ZBPA 3F2KA 1WHWA 4K7QA 5FPMA 4KHPJ 3VV2B 3OR2A 1EJ7L 5HL7Q 2W6KA 1N5SA 2RVJA 1TUUA 2GA7A 4LF6F 2RF2A 4CZHA 4CERA 1RDDA 3I6PA 1TK0A 4Z94A 2HHUA 4OYWA 3OTOF 4WE1B 2BE7D 3QT5A 1RDAA 3EPIA 3O2IA 4FJGA 1U2VA 4OGCA 4GVEA 3G8TA 5JLHA 3WC0A 4DG1B 4I0WA 3OY9A 1FJGK 1U47A 1NDLA 4KHWA 3PFOA 3RAMA 4ZA1A 5AQVA 1TL1B 1W9HA 2G8WA 4X4TA 3LA0A 3MI7X 1MG7A 1XMQJ 4LBPA 3KJVB 2J9DE 5BN8A 1N88A 1VQ9N 4AL7A 4IWVA 3NCIA 3MDFA 3KOAA 4NOHA 3IS9B 2J7UA 3J7ZO 2YWWA 3KLIA 1NBWA 1RT5A 1Q8KA 2H48B 1MMNA 2CWKA 3KHLA 3AXKA 2CNOB 2EBEA 1FXLA 4PYAA 4C0HA 3CD6N 4A8FA 4DR7K 2EFQA 1C0MA 5AQJA 2ZVSA 3HOSA 2B7CB 2V50A 1T6DA 4PZVA 2BQRA 3POTA 5LY3A 1JLBA 4J9PA 1O8BA 3SMZA 4ZLPA 1WF0A 4DUYF 3AO5A 3EE8A 4EUVA 2P9LA 5FIIA 1VQSA 4OHVA 2P9SA 4X4RA 2XWYA 1CULB 1DHMA 3GG1A 1JCFA 4DV6K 2KH9A 4M3WA 4JYAK 3T1YF 5F2RA 3IGVA 4KFBB 4V19X 2QMXA 4XO0A 2DR7A 1RISA 2F8TA 3QT7A 1EWRA 3ZLJA 1X3MA 2RSQA 4WYLA 1VYAA 1S48A 5AFUA 2P9LB 1HQUB 2OANA 3TNVA 3C2PA 1D09B 1T9TA 4MIAA 2MKIA 4AQYF 3K5LA 4IRDA 1FWPA 2Q97A 2ZUAA 4K4VA 3V4IA 5F0UA 1U6FA 2Q6CA 4A8SA 1GOBA 2HNYB 2VPZB 2DGSA 1H98A 4CVNE 3H5SA 4F50A 3KZBA 3B6PA 3R9PA 1F9FA 3R5CA 4DFKA 2AKWB 4YUDA 3PW0A 2B6AA 2Q3PA 3ENOA 2O3DA 2QRRA 1Q5YA 4P74A 5C25A 4HDGA 3K89A 3TP2A 2KVIA 1ASVA 2HLTA 4UQGA 3FVYA 1DQ9A 3BN7A 1RTHA 2OZMA 3TQ1A 3NGKA 2YI1A 5BYSA 3NGUA 5AQKA 2IVOA 4OZ1A 5J2NA 2F7TA 4OJHA 1M5HA 1C4CA 1AUSL 4LD0A 2XY6A 2XHBA 3CQXA 3BYRA 4DR1J 3AO3A 4CZIA 2KHOA 4RUBA 2OO4A 1WJ9A 1R31A 2G0CA 5DZ7A 1U2VB 3MMBA 5KFAA 3B78A 2IDEA 3M8RA 1U6BA 2DGUA 2NRRA 2I0XA 2XHCA 3FSXA 1NKCA 5HI7A 2CJQA 4B1WB 1J2VA 1IWGA 2QGFB 2D9OA 4NXMJ 3AOCA 2YBVA 1HR0K 2ASYA 4MJKA 4QIFA 3G4SN 2FBVA 4CO5A 3U3YA 3L09A 1S49A 1HKAA 4RUCA 4HCCA 3HPGA 3ULEB 3R7NB 4A2BA 4UY8O 1SB6A 3MX2A 2GVZA 3H20A 3AVLA 3A8KA 3TX0A 1BWEA 2HGLA 1NHVA 3N4PA 3P4IA 4A57A 1MWYA 2F4VK 1NDCA 3MMJA 2ZNZA 1QY7A 4MTPA 2GJIA 3DXBA 4DTPA 5H9EJ 3M32A 1G99A 1X9WA 1EX4A 4CJRA 1RDWX 4LH4A 1WKKA 2DY1A 4NZ7A 1BI4A 4JI8K 3P8BB 4CWBA 4JD2B 1V5VA 2P1JA 4FJKA 2HHVA 5KG2A 5D4PA 2BE2B 4B9LA 1VQ7N 1TUGB 5E3QA 2DGTA 3VAFA 1KCFA 3K8WA 3PO5A 3D7SB 2AZ3A 4ZVOB 4LH5A 2GGPA 5C42A 3AY0A 3C95A 1SQGA 2BJEA 3MMBB 4BREA 4OV6A 1YQHA 1KDNA 2YV0X 2XY8A 4K4SA 2Z2LA 3G86A 4FJNA 4BR7A 2GMJA 2AZ1A 1OKJA 2CQDA 4CD3A 4FOIA 3ONQA 4GC6A 5ETTA 3PW4A 3NF7A 4FK2A 1HIYA 2ZJQL 2J9EA 2NZCA 1MLAA 3SCIE 4GKJK 1QSLA 2IVPA 5F9NA 2D1KA 1VSJA 3AH6A 1IQZA 2KDOA 3VQDA 2BJDA 5J2QB 3U9ZA 1RT6B 2YPYA 4DV7F 4DV0F 1RT2A 1YHQN 4JI5F 3VENA 4OLOA 3NGRA 5K5MA 4KGZB 3VF2A 4NLVA 3CJTA 3OBWA 4DTXA 1JJ4A 2I7PA 2GHPA 4DPUA 1D4XA 3CFRA 3A13A 5L9NA 5KFUA 5D0RA 4QIVA 1HJOA 3AT1B 1RYRA 3LDSA 4ED2A 2QT7A 3KUGA 2VKZG 5FJ4A 3T6JA 5F3ZA 4FVUA 4JI8F 5AQQA 4TQSA 1TKTB 1RCHA 4TN2A 4EZ9A 1GMWA 3LP1B 3ENVA 5M2UA 2AJFE 3KHGA 1KR4A 1LWXA 2MMYA 4DR7J 1JJ2M 3MAAB 4I1TA 2KVQE 2KM8C 3J7AP 2DTUA 3A8EA 1S59A 3CI5A 1RILA 3OYCA 2VFVA 2OA8A 2ZH9A 2HS0A 2I9SA 3FNNA 4MKAA 2ATQA 2HNYA 2HHTA 2CNNB 3G8QA 1U8WA 3GJSB 2VOPA 3CG7A 5M1NA 3OHAA 5CCLA 5KT7A 3J7YP 2VDIA 2ROEA 3ZNUA 4K25A 5E3RA 4F04B 1ZBFA 4BLGA 4DV4F 5HBMB 2O8FA 2CGLA 3TAGA 4O8UA 1AT1B 4ZP6A 3MAHA 3UKUB 3M5RA 3VCDA 2G2YA 3UFCX 2DH7A 3UPFA 3BR9A 3THTA 1ZM9A 4I6WA 4B1ZA 2M7SA 2X3GA 3RRKA 3OA9A 3O3FA 2DISA 2V0NA 4CE9A 1NBEB 1HUXA 1RABB 1R43A 3M8YA 3PNIA 4TYBA 3MEEA 1NPPA 1MW7A 4LSNA 4DX5A 3H2VE 4DUYK 2HRYA 1HKCA 2KLAA 2OP5A 4KH5A 5CYMA 4J9KA 4NCBA 2H4WB 2P5VA 2XMUA 3CERA 3AJDA 5KFFA 2JLGA 2XS5A 3QFHA 4B08A 1QD1A 5F3TA 1OY8A 4Z4FA 1H72C 2C3YA 4E98A 3CHWA 3HHNB 2O4GA 1TL3B 1Q81T 2QWMA 1Q9YA 4EEYA 1S0OA 1FRKA 1C1AA 1NGIA 2ZD1B 4CZKA 2PE8A 4RNMA 2N3LA 2ZD1A 3AVJA 2B51A 1IV0A 4WFBQ 3HULA 1HL6A 2CA9A 5A2QU 2H3GX 4YQWA 3ID8A 3UR0A 1QLNA 5ETQA 2R7TA 4LVNP 1ZTWA 2W8LA 2DFHA 3QQCD 1S6OA 4CZLA 4NCGA 4BGAA 3VEXA 3W5XA 3CJRA 3GWCA 1WDDA 3RBXA 1U2RA 2Z56B 4ETZA 1D5AA 5IC4B 1HNZJ 3J7YU 2J6TA 2FGCA 5EGYA 5E0OA 3UCUP 4ZHRB 4E1NA 4NX9A 1IBKJ 4A61A 2M2BA 4V1Ak 3DXSX 4DTSA 2CH6A 4FBTA 1OPZA 4HUEA 3WDOA 3BS9A 5LMUK 3G2XA 4CBXA 4X4SA 2C1EB 3PRBA 4OJ1A 3GE9A 2P9IB 1TP7A 4DR2J 4OYBA 4QU7A 2YKNB 4A8WA 1B7FA 1F2HA 3C94A 1GQEA 4H0XB 1Q82O 4PWUA 1S1VA 5JVHL 2UUTA 4JV5K 1HNXJ 4OHYA 8ATCB 1N6QB 4IYQA 3D2FB 1HWIA 3CJ0A 4CFAA 5J2PB 2UXCF 3LO3A 3SBGA 4A2AA 2NPIA 2QN6B 4BE0A 3BH6B 2ASJA 4H0OA 3L3UA 5CYQA 2VF3A 4CGFA 1WI6A 5HQMA 5IWAJ 3JB9k 4QYRA 3ZSWA 3R9LA 3OLBA 2ZHOA 4M8LA 2UP1A 4YHHJ 2R4FA 3JSMB 1Y7PA 2V4QA 1KQSM 1RADB 3NWGA 1VS3A 2ZHAA 2G1HA 4CJEA 2KFNA 1RT7B 1BCOA 3OYFA 4WTOB 2FZGB 2VA3A 2F9TA 2LLZA 3R1LA 2YVSA 1L5UA 2I1RA 2E5HA 4O3PA 1RT2B 1ATRA 2LQ8A 4WP9A 4BRKA 2I5JA 4OKKA 4M5MA 4CLYA 3IMQJ 3RMCA 3DN9A 3POTB 3S7RA 4OKEA 3PCOB 2CPEA 3ELHA 4ED5A 4FCYA 3N28A 1NU0A 4ZLLA 5GINA 2J5AA 1TQLA 2VCPA 2Z1HA 2VFUA 4K4TA 2RUSA 4FZVA 1S1VB 1TVRA 2GELA 1VRUB 3V1OA 5C2FA 4B9QA 1SQFA 2AWZA 3U3GA 1BU6O 4CJTA 4OJ3A 4L76A 3I9ZA 3BBCA 4UW2A 4LF4K 1NK5A 4BRFA 2XNRA 4CJQA 3D0PA 4UY8T 4C3LA 2IHR1 3L4IA 3HT3A 2B9YA 2OI2A 4YB7A 2FJEB 3O9QA 2ZH4A 1C0TA 1ASUA 3MR2A 2GS8A 2P9GA 1FKPB 5F9LA 1PJ7A 1P9QC 2V2QA 3QFUA 2RNEA 2D3UA 4C7QA 4DR3F 5KFOA 3KG1A 3O6QA 2C2OB 3ZZUA 4X2BA 3R1XA 4CIGA 2QTDA 2YX4A 4X65J 1ZA2B 2HVZA 1WUUA 4OYMA 1FO1A 3E3XA 1IBCB 5AQSA 3GR0A 4OLBA 3VEYA 1RT4A 4RW4A 5HP1A 3I8DA 3BO3A 3FRYA 3UKRA 5THWA 1LK5A 2UUWA 1FRHA 2YJEA 4QR2A 4C6AA 1GAOA 4QPTA 4DL7A 4JK8A 2PSZA 1PBUA 4JKGA 3QRRA 1N33J 1W7AA 3KVGA 1I94F 4OZ5A 3BGRB 3OL6A 2KO1A 1IJJA 4YOWA 3QZ8A 4BWMA 2JGUA 1YZ7A 4BRPA 5ADXA 1RUSA 3H42A 3VTHA 4CF2A 1R8HA 5BR8K 1NK8A 4B1XB 2J6SA 1NZ8A 1Q16B 2VHGA 1KLNA 2XMVA 5B0DA 4DV1J 2YNIA 2HGMA 4I6MA 3PXGa 1QQCA 5KFDA 4I9LA 1GEHA 1IR1A 3M6VA 5EUHA 4DKWA 1NZAA 4QJVA 3LDQA 3R5GA 2ZITA 2UXBK 3SI8A 1YXQA 2B8PA 3AAPA 4USJC 4PYDA 4IG0B 2W9BB 5KGXA 4ZJQA 1T3NA 2W25A 1DRZA 3DXMB 4NYOA 3CCES 4X4VA 4BG8A 3W8PA 2FSKA 1U0HA 4KPCA 1ZH5A 4EP5A 3MXJA 4NZ0A 3VGTA 4Y3CA 3O80A 1V3SA 3BV8A 2VV5A 3OVNA 3HLUA 3U6FA 3BO4A 1YJNN 1FD2A 3PIPL 5D0HA 2BKPA 1XIQA 2DFEA 4F3OA 1JLEA 1UEUA 4F9OA 1UEKA 3O5TB 1IXKA 2HF3A 4CECA 1PJ5A 2E1MC 3THXB 4CJLA 2IRUA 2JX2A 1QTMA 2HBMA 4NL5A 2GW8A 4Q45A 1S6PA 4DHVA 4EWTA 1N48A 4OKJA 2DD8S 3NMAA 1LAWA 3D7EO 3A3PB 4DV7J 1CXQA 3C19A 3JQKA 2R7XA 2EPIA 3E9OA 1Q8IA 2UYTA 5DG7A 4QWEA 4ZVTB 1F2GA 4MK8A 4JI1K 4DV2J 4FBUA 1MSWD 1AB8A 1CJTA 4DL4A 2A6OA 4QR0A 2R7VA 5EWFA 2YH1A 1FKAF 4F26A 1QQMA 2QE5A 1F6TA 3J81O 1U2CA 2W9AA 5TKYA 3EGVA 3M4XA 2MJNA 2YQ1A 1J5EF 4EHUA 4PG4A 4FWRA 5CAAA 2GIRA 4IKAA 3GIJA 4JI4K 2MGZB 1AROP 1TZ0A 4E8UA 2NRTA 4BACA 1XNQF 1HPZA 3L7UA 2K1RB 3T7ZA 3P31A 3KJFB 2EFOA 3OLAA 4JK9A 4BRMA 2JZ5A 5KG6A 1Y00A 2RHQB 4DL6A 2CWXA 4CGGA 1UVNA 1YJWN 3I5BA 5GADU 3MM8B 1OJ4A 3I4HX 4I2PA 3ZX3A 3M8QB 2N4CA 4ZOSA 1IBKF 4FL9A 3IRXA 3MD1A 3DU6A 1ZBIA 3O3HA 3SPZA 1R27B 4AE5A 2XM3A 1VDHA 3JAMY 3VQ8A 4JI0J 4OX9F 5IM0B 1Q81O 3H45C 5HRRA 3A12A 1ASWA 3QETA 4R8UA 4AQYK 3OTOK 2Q36A 4JI5J 3FLCO 3I9V9 2ZJQQ 5C0YA 4PHTX 4WP3A 2W7OA 1OY6A 2Z0GA 4GO7X 3CE8A 2XY5A 2HIYA 2ZZTA 4RKUC 2E29A 2MKHA 3VZIA 2ZJPQ 2LA4A 2FY8A 4XK8C 3P5TL 2Z2ZA 2BE2A 2XO7A 1YRXA 3R2CJ 3V81A 1WC6A 5HANA 5LMUF 1K0VA 2UVRA 4JI7F 1VISA 3OYIA 1VJQA 1U1OA 4K4XA 4CEBA 1R8CA 4Z4CA 4ILGB 5J1EB 1CG2A 4A59A 3GP9A 4KREA 2KI2A 3Q86A 4TY8B 2D4WA 4FJXA 2KKZA 1N52B 3UN5A 1NK0A 3MXHP 3JSYA 1VHFA 1T94A 2BGGA 1H74A 3CETA 3FBEA 1WC4A 2WVFA 3C7NA 2DNLA 4K42A 5AQGA 3CCUN 1PYTA 2KU7A 2KXFA 1ZAVA 3VQTA 4DLGA 4PG7A 4JNEA 3MM9B 5AQXA 5I4MA 1VSFA 5H1SQ 3WEEA 5SZTA 2UUAF 3VA3A 4HUFA 1SJ4P 1BIZA 4ECUA 4FDFA 3TAFA 4KHYA 2MSSA 4A8YA 3HL8A 4M1KA 2LU1A 1ZM2A 2MKKA 4KI4A 1BDGA 4G65A 3W66A 2I6WA 2HFOA 5DG8A 3H5YA 1NU4A 1KONA 4KB0A 4DXLA 4RNNA 4J7CA 4Y0WA 3F44A 3QT8A 4ER8A 4C1NK 3BH7B 5KOWA 1SPBP 4JI2F 4WFAQ 2GX8A 4A8QA 1TMMA 1EZZB 1VR6A 3C15A 3EE3A 4B3TF 3LANA 1JQGA 3ZT2A 2ZBRA 2ZBQA 4OI2A 1P27B 3M9OB 1NGBA 2XBPA 5GMDA 3OBYA 4XPCA 2OAUA 1T03B 3OYMA 2WW8A 3KNGA 2G0JA 3A5OC 3H2LA 2G8UA 5GAGP 4IFVB 1UAXA 1X7VA 2F9DA 4QS8A 1VOMA 3S01A 2AA4A 3OTBA 1KVIA 4CHQA 1QVFR 2BJ3A 4CLWA 3AJ1A 4NA2A 2CGKA 4X62F 1QE1B 2EHGA 2NRHA 4ZTFA 3JAMO 4WK3A 1ZZNA 1PC4A 2LECA 4ZPVR 3AA3A 2EFNA 4JKCA 3LP2B 1TK5A 1C6VA 2OJ3A 4JS4A 1S9EA 4QQBA 1L3KA 1FDNA 4RU9A 2IBKA 5GIOA 3ZNJ1 1I94J 3F41A 4NB4A 2DJWA 4GO5X 4KIAA 2ZQBA 2XS2A 2MY7A 4LF5F 1DTTA 4FLXA 2OPPB 4GMKA 2HNDA 1RT5B 2BX6A 4F4WA 2BA9A 1H7WA 4U7UD 4OX7A 3AVCA 3QJJA 2R2SA 2VOOA 1JLEB 3R1HA 2Y9HA 2IAJA 1HPMA 2OSQA 2DO0A 2V7ZA 2JSXA 4WKYA 2QJ3A 3RVCA 2E1PA 3TZYA 1GLEG 2CDQA 2OYQA 3IM9A 4CYUA 3UCZP 1S3XA 3LW5C 2DNHA 3M6WA 1NGJA 5BRDA 3EPGA 1JNRB 4FW2A 2R3VA 1LFWA 3WNEA 1E6VA 2IM2A 4M63C 4OHWA 3HF5A 5FPEA 4OZ2A 1GLJO 2W4DA 2GAHC 1HMVB 3FZMA 1IBMK 3K5OA 3MM5B 1L3UA 3O3LA 4Q8FA 5CYMB 2MKCA 4KBIA 4DFJA 1I94K 1WELA 5T7BA 3MEGA 2OTLS 1NGFA 1VQKN 4NLCA 1VQ5N 2QKKA 3OVBA 4G1QA 3LALA 4J9VA 2E1CA 1NGDA 3FK4A 3AODA 1WSRA 2OPQB 3H0PA 2GUPA 3OYKA 3BN4A 4DPTA 1WC5A 3NGIA 4B9UA 3PIPQ 4EBCA 4I69A 1HR0J 3ZCMA 1D9DA 3VEVA 2CPIA 5HATA 4BE1A 3KLHA 2P9NB 4IBNA 4USKA 4K0KK 4JI4F 3B6BA 2PEBA 3RW7A 3GV5B 3QYYA 1WTBA 4CO1A 4OMFG 1NGCA 1T02A 4IH5A 3UDVA 4HVZA 4W98A 4E19A 5LT5A 1FFGB 5BPMA 3OYGA 4FWMA 4HHUA 3CC7S 3ZTSA 4J5OA 1HNVA 3OW2R 1NJWA 3RWUA 3BB5A 1RTDA 3HHKA 3AOBA 4M5DB 1RBVA 2WTFA 2PA8D 2O8FB 3OT9A 1S22A 4CHNA 1NLKL 4ICLA 3SFGA 1D3WA 1LK7A 4N7TA 4IRCA 5IQ6A 3MN5A 2A1SA 3MMAB 1VAZA 5HVHA 3CJ8A 3P1GA 3OXLA 1S6UA 3DRPB 3DGPB 1XTZA 2XQCA 3GB0A 3L7OA 1L3VA 1SC4B 1M5OC 3EY1A 2GBZA 4C48A 4P9SA 4PR6A 5AZIB 4JKHA 3V9WA 4HTUA 3N79A 3H1VX 4CFCA 2F63A 4DTJA 2PY5A 4OPHA 1X9MA 2MZSA 2WW4A 2N82B 4CHOA 1I5OB 2R2TA 2X1GA 3EJMA 2FQQB 2XSFA 1FCAA 3FZHA 1N56A 4EGLA 1KVJA 3IC1A 1YHQS 5L1IA 5AQIA 4CGDA 1KAZA 4CHYA 1IG9A 5A8RA 4F4ZA 1RA6A 3HHLC 1C1BB 3L2RA 3DLGB 1S5ZA 3LZIA 2IS3A 3GJRB 3ID6A 4KHPF 3EICA 2E9ZA 3KLGA 3NAHA 4LSLB 3CNQP 4CLUA 4NLSA 1AXQA 2UUCF 3L95X 4X84A 3N01A 3E9PA 4Q8EA 3DDNA 2QA4S 2FHOB 1AFJA 3CPEA 4MYUA 3HM9A 3MEDB 4O8KA 3F0NA 1XC9A 3MM9A 3CM5A 4IXCA 4JI7J 4O5BA 3QAEA 5BRFA 4LFBJ 3M8PA 3WNGA 2Z30B 3SQ2A 5IWAK 2YHYA 1SC1B 2KL8A 4YOVA 2MKYA 4FJ9A 3HTVA 3KD5E 1WF2A 1CQMA 5L1LA 4HH1A 2DYAA 1SJRA 4CJPA 2QMWA 1HHQA 3WXKA 2OFGX 4B3OB 2Q79A 1NMNA 1RTJA 4LFCJ 3RSEA 4NYPA 4RO0A 4K5RA 1RTJB 1Z6RA 2GUIA 1XMOK 1OS5A 4K43A 3AVMA 4Y2IA 3M6UA 3O5BA 2EXUA 3IUCA 4HI2A 5A0YB 3G0ZA 2P9UB 2POKA 1NG9A 1JK9B 4DCJB 5A6PA 1WSJA 5M2RA 2FVCA 2HZVA 4IOAQ 4NI2A 4EK2A 3DRSB 1FEEA 3VAJA 3BUZB 3TAMA 2C22A 4E89A 2F1FA 2KN4A 2R9LA 5H1SV 8AT1B 3VGMA 2DXFA 2KRRA 3U1LA 4X66K 2R8HA 4DU3A 5JS1A 3EZOA 4Y2KA 2E5JA 1D8YA 4DHYA 1SS6A 4A46A 5HQLA 3BGLA 4DTMA 1AZSA 1T0TV 1RCXB 4FP9A 1U24A 1QE1A 1UMJA 3THWA 2O8BA 1SV5A 1BLUA 4B3SF 4LFAF 5ETRA 1Q7YT 4JI6J 2JFKA 3W5ZA 2JL9A 1VC0A 4DR7F 2CQ4A 2Q6BA 4ECSA 1SXLA 3QGHA 4ID1A 1XMOJ 2OEKA 1G7CB 3JAMU 4CBUA 2YWFA 3WIUA 2HHSA 3KWIA 4OLPA 1RAJA 1R7IA 4FK0A 1LWCA 1BMQB 1WEYA 3RRHA 1R8PA 3RYLA 1VQ5S 2VG6A 1VQMS 3CXCM 4RNHA 3NH0A 2FZCB 2HHXA 1CJTB 5KTQA 3KLVA 2GJFA 3QEPA 1YDLA 1VBZA 3R6GB 2J7KA 1FFSB 1KAXA 2QK9A 4ZN3A 2NS1B 4XAKA 4BRNA 1BG3A 2DGXA 5KPZA 5KFRA 2MZJA 2ZWPA 3IP0A 1E4GT 3MFIA 2O8EA 1VQLN 2C3MA 3MF5A 4ANEA 3H4BA 3IAM9 3MN7A 2XB2D 3CCRN 2K2PA 1JLQB 2YKNA 1S57A 2N7CA 2QA2A 4P2FA 2DVIA 2MZTA 4CFBA 4A48A 2LQJA 2E44A 3UVJA 4DQSA 1YZ6A 2HS3A 1CZ9A 2DGQA 1UAWA 4MLEA 3UO0A 2QXFA 5LMUJ 1YAGA 4FWLA 4H54A 5L38A 3NF9A 3BF3A 3DLRA 4Q2LA 1WKJA 4YOYA 3QIPA 3UD5A 2E2QA 1KVKA 2ZJRL 5A8KA 4IUFA 4PY5A 2MKSA 1FXDA 4ZPCA 4L3KA 4DTUA 4DQQA 1SI9A 4ED8A 5K8NA 2B9XA 4F4AA 2R2RA 2VICA 1RYSA 1PSDA 2QWPA 2DPJA 2UV8A 3PO4A 1RTZA 5KQ8A 2CPZA 3AA4A 5AQTA 1D8ZA 2K06A 1JMTA 1XC3A 1NNDA 1TKXB 2VPXB 5D4NA 1MWKA 1OH8A 4DV5F 1FK9B 3SCLE 5AQLA 3QERA 3E01B 2KTQA 1U02A 4O4GA 2B4VA 1GLFO 2LXFA 4XH5A 1O6XA 1RHUB 4CH1A 3AAWB 3EUNA 4ED1A 2GVZB 4MK9A 1RBOB 2HBLA 5HJYA 2J0WA 4LFAJ 4GVBB 1QDUB 4FYWB 5FLXU 2FC8A 1NJYA 1FDDA 2AJ2A 3CJ3A 4V19J 2V34A 1ZBTA 2A0FB 1ESVA 5CABA 2ZH7A 2NXUA 4UUXA 2XI3A 2ZHBA 3DXKB 3D54A 4BCAA 1VQ4N 4C23A 4K0KJ 4FJMA 2PN6A 4KTZA 3PRDA 4LF4J 2QL5B 2OPPA 1HHTP 2ACMA 1BUPA 3K2PA 1H38A 1FX2A 2JOQA 4H4MB 1WSEA 4ECVA 3NLCA 1X0FA 1C1BA 2AGPA 2GFFA 1VSKA 4NLXA 3BQ2A 3VAGA 4J37A 1VSMA 1N0UA 1VQLS 1ZPVA 2ATLA 1TFYA 4OV1A 1N5TA 4XIUA 2PMZD 2CADA 2O8CB 1S4EA 2BZ2A 2WAQD 1URNA 3EZ5A 3ZT1A 3RGIA 4HYKA 3IXQA 3NMUA 5H9EK 3CCSN 5ADXH 5HBMA 2ZJPL 2DCUB 1S1TB 3D6HB 3FEZA 5KFHA 4X64F 4BRIA 3ZFVA 1XNQJ 2QYCA 2ZF5O 3Q8PB 4WFBL 5F8HA 1S9FA 4JI5K 3VGKA 1ZBSA 2BJ1A 1TYQA 3MEEB 1EKRA 4PUOB 1MDUB 2QFIA 1LNQA 1H0HB 5IS2A 4FVCA 1EB0A 2ZM6K 1YBUA 1KQFB 5KFNA 3PKYA 4DTOA 2QSFA 1DTQA 2LQBA 3NVMA 1NM2A 4Y2MA 4C8ZA 3CCZA 2W2PP 5HO4A 4JLHA 4JI3K 2B6AB 4LF8J 3IO1A 5B0BA 3VMFB 3ZYYX 3NKYA 1F60B 1YUWA 3C66A 1X1PA 5LMNJ 1FNXH 3TJ9A 5AXKA 3TUPA 3CMEN 3QPIA 4IG3A 3HSTB 2VPWB 4DLEA 3EGWB 2EG1A 1S79A 5A2QY 1U6ZA 1B99A 3Q24A 5JMNA 3TWZA 5GIPA 2I5JB 3NGTA 5M2PA 4CJFA 4IDHA 3VAHA 3NG8A 2J8AA 2WVCA 4KBOA 2ADBA 3US5A 2DXEA 1QAIA 4D3GA 4KGXB 1R0BG 4PXCA 3M8ZA 1TELA 2GIQA 4U9RA 1B64A 4MFBB 3T9ZA 4E1JA 2OPSB 1NPRA 2R7WA 1CULA 5GADP 1ULRA 2N4DA 3MN6A 3IGNA 1IR0A 1WC3A 4GW6A 1KVBA 4PL7A 2PDAA 4H4MA 4LF7J 1B9FA 1I39A 3NHGA 3CF5L 4B3MK 4DZ6A 1N5VA 2IMWP 4FPAA 1U1MA 3SJJA 4BS2A 3MCOA 4IFEA 4OHZA 3KK3A 3F9MA 3KHRA 3TZZA 1SL1A 1E6YB 4NE9C 2OMOA 3CCSS 4JI0F 3R97A 5AQOA 2YTCA 3A5LC 1RDBA 3HD1A 4X4OA 1ZC6A 3TAMB 3SUQA 3EKSA 2KJVA 3TOQA 4P52A 2HQFA 2QA4N 5HMZA 1MU2A 5MAOA 1R0AA 2BW2A 1W97L 4Q0BA 4ZKAA 4NXNJ 2VA2A 3OYJA 3SPYA 2GO8A 2V51B 3G71S 4R25A 4ZMMA 4Y1DA 4QWDA 1VIXA 4PQUB 3E2EA 5B0CA 1R0CB 2ASOA 5KT3A 3WQPA 1MWQA 3FDSA 3HT0A 5LXYA 1R59O 1QUPA 4G6VB 1BQXA 3ZT3A 4CBWA 2H65B 1A5VA 4TVAB 2CJBA 2BH1A 4F4KA 5DM7Q 3MM7B 4TYAA 4E7LA 3DNCA 3LDPA 4RW7B 5C25B 4DV6J 3TABA 4M63A 1CQNA 4MMOA 1N34K 2C3UA 1DJ0A 3AA5X 3BBFA 2CNLB 2E1YA 1HKGA 1I3OB 1RU2A 4I68A 2QEXN 1E3MA 5IXUA 2DNRA 2E5LJ 1BOTO 2DR8A 4LVOP 4EFHA 3W3DA 1UWAA 4C8OA 2D0OA 4DUYJ 1YIJN 2L9NA 2WVEA 2OFHX 2GX9A 3R8EA 2CQGA 2C2MB 1Q8LA 3W64A 2V4JA 2AHOB 3DMJA 4W92B 1K0TA 2ZJRQ 1NRKA 5B08A 1PCAA 3MPDA 3J80U 3R5BA 4BBYA 3HZEA 1NAQA 3J80Y 1VLOA 4LSNB 4FYXB 1TVRB 3VQ5A 2HYIB 4K50A 2IVMA 3EXCX 2V8DA 2HG4A 4JI0K 3TWHA 3FQKA 3TUIC 3ZTQA 2NXNA 1S77D 1APSA 2HBJA 3Q7BA 1ZYQA 3IFEA 5IOLA 2GCFA 1GXLA 2JJ4D 3Q8VA 2WSCC 2Z57B 1WHVA 2GMLA 1IM4A 1RT1A 3CC2S 4WFNQ 2X51A 4P10A 3VA0A 1XR7A 3H3OB 1HKBA 4QU6A 4ZVRB 1UW4A 5HROB 1NMEB 2VYPA 3U9DA 5LL6d 5L46A 1YITN 3JSMA 2RQKA 3SUPA 4M5NA 4DS4A 3TAQA 1NEEA 4FM1A 3GFXA 1CJUA 3IRWP 1YJWS 2HQGA 2WZ1A 5BN9A 2C42A 1W2IA 1UA1A 1N34F 3OTOJ 3DYAA 3ZZZA 2CJAA 2WB1D 2DCLA 1RQ0A 5EN1A 3PZPA 2EEYA 3DRPA 3DGPA 3UCGA 2IM1A 4CJVA 1HQEA 2BW7A 3Q22A 1XNQK 1QHAA 3AVFA 1X8DA 5KT5A 4IQXA 3W9IA 4F3TA 1OO0B 3SCXA 4FJIA 1NSPA 2F96A 3GIKA 4CO0A 4WPAA 4G9ZA 4DG1A 3VQ4A 5EY4A 2P9UA 3GYNA 3AGRA 4RZRA 2MSTA 3U02A 2RILA 3MN9A 1FXXA 3WUHA 5C12A 1Z1ZA 4JK7A 2ITGA 4FWPA 3KMSA 3EYZA 3NXZA 2ASMA 2F5GA 5KAKA 4N41A 1NOYA 3V1RA 4Z2XA 3HJFA 4C1NI 3NFAA 3W61A 1RT3B 4FS1A 3BPSP 1REGX 7FD1A 4MH8A 2UVUA 3L2VA 4ZVPB 5GAEI 2UU9J 4DR6J 2IGIA 4C0OC 2VQFK 1HNXK 3KJQB 3JSBA 4FM0A 1O1WA 4Q0BB 2LQ5A 2YKPA 2M52A 4CH0S 1M1GA 2DNOA 3MWBA 3TR5A 2JVOA 4IEEA 2DBBA 1S1XA 1NKEA 5E2QA 2O5DA 3FCWA 3MM7A 2Q0RA 1KOHA 2W42A 2ZOGA 1RAEB 4YFUA 3VQPA 4LF8K 4HHJA 3S41A 2HEKA 5GAGU 2IAJB 1RHJB