2OPSA

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
542
structure length
535
Chain Sequence
b'ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 134
structure length 535
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2opsA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2opsA05
3OYJA 2FBXA 2D7SA 4DQIA 3TAMB 2BANA 3BSAA 4FJHA 4FBUA 3NHGA 1B92A 3NDKA 1RBSA 2YNGB 4DL5A 2QK9A 4W5TA 4DL4A 2YHAA 2IA6A 4CJLA 3H59A 1UAXA 4IFVA 1D9DA 4NLWA 1KFSA 3DDKA 3PW0A 1S0OA 5HBMB 4IFYB 5KFXA 2J6UA 4CEAA 4OPKA 1L3UA 3AO3A 3E01B 5KRSA 2XY7A 2IJFA 1QUVA 2FLLA 4B9UA 4G1QA 1JLFA 4WZMA 1TL1B 1RDCA 5L1IA 4PUOA 1S1UB 3VQQA 1GX5A 1REVB 1Z26A 4DL3A 1RYRA 4E7HA 4E7IA 4ED0A 5DK5A 3V9WA 2WRMA 4KHWA 2RDJA 1K1SA 4OLBA 3OS2A 1TQLA 4OGEA 4KFBA 2ZKUA 4OKEA 2RF2A 3KLIB 1JLCA 4B3OA 4I2QA 1T03A 2V0NA 4ID5A 4F8RA 4LH4A 1S1WA 4NRTA 1NOZA 1RT2B 3JSMA 3QERA 3V6DA 5KG3A 1S9GA 1LWCB 1FXXA 3PO4A 4RNOA 4FCYA 3KD1E 3CVKA 3ZT0A 2EHGA 1N6QA 4IG3A 4WE1B 5J2QA 3EZ5A 3ZT2A 4JS5A 2G8IA 4NLVA 5CYQA 3DYAB 1KVBA 4MIBA 1RBUA 3QZ7A 3HXMA 1C2PA 4ECXA 1ASVA 3CDUA 5JS2A 1JLQB 3OYKA 4DQRA 3WNHA 2O4IA 3TR8A 1X9MA 4NLYA 2F8TA 4ZVFA 1HNVB 2XO7A 5KFYA 4CF2A 1K1QA 3PHEA 4DLGA 4EBCA 3CDEA 1WSHA 4DTSA 4J2BA 4QPXA 5HP1A 2YNFA 5KI6A 4IR9A 3TARA 4Q43A 3G10A 2ASLA 2BANB 3EZUA 4ZPBA 3O3FA 4Q8FA 1I6JA 4LD0A 1JIHA 5FDLA 1EXQA 3KHRA 2DPJA 3KNAA 2DFFA 3OYEA 2E6LA 1T7PA 4OKJA 1D5AA 2RN2A 4EZ6A 3QZ8A 5KFNA 4DFJA 4CFCA 4NYZA 5KG7A 4C8NA 4DSLA 5EWEA 4CHOA 1J5OA 4DFMA 3RAQA 4FLYA 1GOBA 3RWUA 1S10A 4FM1A 4G1QB 4O3OA 1JLFB 1RT7A 4EBEA 3CFRA 3IN5A 4CJWA 5KT6A 1C0TA 2FVCA 2Z1GA 4DF4A 1QTMA 4FXDA 3MR3A 4ECVA 2PZSA 4PUOB 1TK0A 4MK9A 3ZT3A 5EWGA 4O4RA 4DQPA 3IGVA 4KB1A 4KHUA 1BCOA 2Q3SA 1CLQA 4CF9A 4MK8A 1QSLA 4RNNA 2IAJA 4JS4A 3AO2A 1RDAA 1N5YA 4H4OA 3AVAA 4KFBB 4YR3A 2OPPA 3SQ1A 3OYDA 1JLCB 1VSIA 3K57A 2VG7A 4I2QB 3T1AA 4Y2CA 1T03B 1HQEB 4ID5B 3TI0A 4DQQA 1S1WB 4AHTA 4E19A 3N6LA 3JSMB 2WCXA 4KI6A 3O4NA 4O44A 3HP6A 3CJ4A 4J9KA 4MH8A 2I5JB 1S9FA 4NLPA 3RB4A 3VQSA 3GIKA 3G6YA 1N6QB 5JUMA 1ZBLA 4ZVEA 3DLEA 4IG3B 4IOBA 5DQIA 1IKVB 2WK4A 2O4GA 5F8IA 4JV0A 4YR2A 3RR8A 2UVUA 5CYQB 4FJXA 1T3NA 3AVGA 4QWAA 3AVKA 4EO6A 1KLMA 3KK3A 3SPZA 2QV6A 1KFDA 1SKRA 4RNMA 5J2NA 2CKWA 1S97A 4QCLA 3CWJA 4ELTA 3O3GA 2BR0A 4IBNA 4DMNA 5HP1B 2YNFB 4U6PA 1QSYA 4NCGA 1HMVB 1NKEA 3SFGA 3DLRA 3DOKA 4J2EA 1NK8A 1KCFA 4B9TA 5FDLB 2D41A 2WOMA 4KO0A 4DTXA 2J6TA 2BRKA 1RT4A 4OKKA 3QGGA 3QEWA 2ITGA 3RB0A 5L1LA 4O3RA 1VSDA 1UA0A 4CF8A 4LH5A 1SV5A 4DFPA 2BDPA 4IH5A 5JXSA 5C24B 1WLJA 1J5OB 4R8UB 4Z4CA 3Q8QB 5K14A 3T5KA 2C2DA 2B5JB 4JUZA 3AO4A 1BQMB 3QINA 2KW4A 4KAZA 3SYZA 1Q9XA 2IJNA 1C0TB 1VSHA 3MEGA 1L3VA 5DGBA 4OGCA 4E7KA 4FZZA 3G6XA 4J9MA 2WONB 2IBKA 3L2UA 4EP5A 4DEZA 2XGQA 2IGIA 2RKIA 2FBVA 2Y1JA 3TWHA 2IAJB 2AGQA 3GIMA 1NHVA 4I7FA 3QNOA 3HVRA 1DTQA 3UPFA 4M41A 1LAVA 3LDSA 1N5YB 2HNDA 5HLFA 2GIQA 1K6YA 1U47A 2OPPB 1LW0A 3CQ8A 5I42B 2D0CA 2FBYA 2UUWA 3ZSXA 3ISND 4FZYA 1LWEB 2IM0A 4O44B 2D3UA 1WAFA 4HYKA 3NF6A 5T7BA 3VQCA 4H8KA 4CGDA 5KT4A 2B6AA 5KG1A 3WNGA 5C25A 3DLKA 4MIAA 3CJ5A 1W25A 3HJFA 4FZXC 4CJ4A 5F8JA 5CYMA 4DWIA 1IG9A 3HPOA 3KMQA 1KLMB 3KK3B 4IQXA 1RBTA 3C94A 4K4WA 4ICLA 5J2NB 5JS1A 5HRPA 4ZP6A 3VA3A 1NK9A 1MU2A 3PX0A 5DLGA 4E3SA 3P5JA 4XIUA 4RW4A 2R2UA 3CG7A 4ZTJA 2O5DA 3VQ6A 1XWLA 4CERA 4BDZA 4E89A 1CZ9A 1BI4A 4NCGB 1ZYQA 4YNQA 4M95A 2YHBA 2G8UA 3S3OA 3LPTA 3DOKB 3TVKA 2WOMB 3OYMA 3OYNA 4G3IA 1WNSA 2BGGA 2IMWP 3OYCA 3NAEA 4KO0B 3LP1A 4CJRA 1RT4B 1LAWA 2BQUA 1SH0A 4TY9A 2W8KA 4IRDA 5KT2A 3P83D 5KFKA 4DU3A 4F2SA 2XCAA 1T05A 2HHWA 1SV5B 4FJJA 2OZSA 1TVRB 3PX4A 3KKRA 4F4XA 1C0UA 4CK1A 4BE2A 3PX6A 2HNYB 1NK7A 3DMJA 3NH2A 1BL3A 2E9ZA 3V4IB 2IM1A 5KTQA 2AGPA 3H4DA 1N56A 3S9HA 3KLHA 5DQHA 2RKIB 2FVQA 4DF8A 2HW3A 5KG4A 4I7FB 4ECRA 4B8AB 1HYSA 3SCXA 1RAJA 3TAPA 2R8GA 4CHYA 2HNDB 5HLFB 3H5SA 3OVNA 1QAJA 1LW0B 3AO5A 4CIGA 4KHNA 4DSIA 2HVHA 5KT7A 2AGOA 4M94A 5F8MA 4RW9B 3KKSA 3BJYA 5CZ1A 3GV7B 4Q8EA 1TP7A 3ZT1A 1XC9A 4XPCA 4O0JA 4CGHA 1L3SA 4DQSA 3OYFA 2KFNA 5L1KA 3MEEA 3SQ0A 4RU9A 2B6AB 3DLGA 5C25B 5HROA 3WNEA 3AVJA 4CECA 4B9SA 3HVTA 5CYMB 4JV1A 1VK0A 2EX3A 3V1QA 3ULDA 4FJ7A 1BHLA 1LW2A 3KLGB 4NLRA 1KVCA 4ICLB 3QYYA 4U7CA 3QO9A 4RW8A 3DRPA 1MU2B 4WFZA 4ID1A 2X78A 4HUGA 3DLHA 3BR9A 4RW4B 4DG1A 1IO2A 3KLFB 3PZPA 3KTQA 1OS5A 3DOLA 1BI4B 4AHSA 1HPZA 2BQRA 2E6MA 4KTQA 3MXJA 4E1NA 4DSFA 3IAYA 1XR6A 4AILC 4ELUA 4KKOA 2AX1A 3OLBA 4KAIA 1KHVA 5KFMA 3H5YA 2ZQBA 4OJRA 4OVLA 4BWJA 3OYGA 3K59A 5F8NA 4O3NA 3HPGA 3H5UA 3ZSRA 1T05B 3BDPA 1QE1A 3EY1A 3CFOA 1FKPA 4FJ9A 5T14A 3AVCA 1C0UB 4Y34A 1JLEA 4CEBA 2VWJA 2AU0A 1CXQA 1S9EA 2VWKA 4CF0A 1HJRA 5KFPA 4QAGA 1Q8IA 4ED8A 3LZIA 4IKAA 2XC9A 3LAMA 3N6NA 3BSCA 3HO1A 4W5RA 1W0HA 2E4LA 4RNHA 4Q44A 1R0AA 2QKBA 5F8HA 2FJXA 5J1EA 5KRTA 2WB4A 1TKXA 3D5MA 3OYAA 3SI8A 5F9LA 2HNZA 1SL2A 5C42A 1ASUA 4W5QA 4W5NA 3H40A 3IG1A 3GILA 5EUHA 4DSJA 3Q8SB 3V1OA 3ZCMA 5D3GA 2C28A 3FQLA 2IOCA 2ETJA 4FLXA 3SV4A 1VRUA 2HHSA 4MKBA 1Y97A 1X9WA 3V6JA 4BDYA 1SUQA 1S6QA 3I0RB 3ASMA 4F3OA 4TQRA 3MEEB 1GOCA 1QSSA 3KLVA 4NLDA 4CESA 3DRRA 3DLGB 5HROB 3DRSB 3LZJA 4KHQA 4AHUA 1D1UA 3SJJA 3QIPB 1QQCA 3K5OA 4KPYA 3HVTB 4FS2A 3CFPA 1LW2B 3BQ0A 2V9WA 3QO9B 4RNFA 5KGXA 1J54A 4NYFA 4YQWA 3LP0A 4LSNA 4DG1B 5KFAA 4EYIB 4TN2A 3DOLB 3T5LA 4J2DA 4WXOA 2GV9A 1U09A 3SUNA 1HPZB 4F4YA 3SFUA 2AWZA 1JL1A 3BGRA 3BSOA 3M8SA 2V4RA 2DFEA 5KFUA 2HWHA 2UVVA 1S49A 3L2WA 3N6MA 3VQBA 2I1RA 4O55A 3AA2A 4CJQA 4Q5VA 2AX0A 4K50A 1QE1B 3OS0A 1KTQA 3O4QA 4MQ3A 4AHCA 1RTHA 3MEDA 4LQ9A 2X6NA 1JLEB 2D0AA 1S9EB 3M8PA 3I0SA 3GYNA 1NK5A 4N47A 2PYJA 4IFVB 4EZ9A 3OHAA 2ASDA 2WTFA 4K4YA 2ZE2A 2R8HA 1XR5A 1HQUA 4IDKA 4FJ5A 4FJKA 4CE9A 4DFKA 4MFBA 3UDLA 1R0AB 2Z1HA 1HNIA 5J1EB 5F8LA 3K5LA 3I5CA 4ECTA 2W9BA 1TKXB 3V81A 3G0ZA 4E7JA 3SNNA 2X6SA 5CY4A 4CCHA 3RB6A 2HNZB 1YT3A 3ZSVA 2G8WA 4FJIA 5C42B 1G15A 3HHKA 2GUIA 1SL0A 2ATLA 3TQ1A 4B08A 1KHWA 3V6KA 4EBDA 3U6FA 1CSJA 1BIUA 4BACA 5D3GB 4NRUA 4CJSA 2RDIA 3BQ2A 3ZSWA 5KFQA 1XI1A 1VRUB 1B9DA 4ZVHA 1S1VA 2AJQA 4ECZA 1SUQB 1S6QB 3PUFA 3PY8A 4OLAA 4KHRA 3K58A 3AVHA 2RF2B 4B3OB 3DRRB 4PA1A 5KFLA 4ZP7A 3M9MB 4HUFA 3RRGA 1RT1A 4O4GA 3V6DB 3AA4A 1S9GB 4Y1DA 3RB3A 1JLAA 3AVNA 1JLGA 3AVIA 3NAHA 4ZHRA 3OL8A 3VQ7A 5FRMA 1UWBA 4F2RA 5J2QB 4CJPA 1EP4A 2RPIA 4M3RA 3LP0B 3QETA 4BE0A 3MAQA 4LSNB 4EYHB 1ZBIA 3KHGA 2DY4A 2X74A 4M3YA 4IKFA 4IRCA 5FROA 4ECYA 4PWDA 3MR6A 3EPGA 2UVWA 2B4JA 1ZTTA 3KLEA 3THVA 3ZSYA 4EEYA 4Q0BA 4RUAA 5KFTA 5KFJA 2D5RA 4FW1A 4FJLA 3LAKA 4CJKA 4DU4A 3IGNA 1JXBA 1RCHA 2OPRA 4J9RA 4FLTA 3I5AA 4O0IA 1ZTWA 4WZQA 1RTHB 1U45A 3MEDB 2FVSA 2KTQA 4CGIA 3M8PB 3I0SB 1ZBUA 2DFHA 1YTUA 3GIIA 2ZE2B 1ZETA 2C2RA 3SV3A 1HQUB 4IDKB 4YFUA 1U48A 1HYZA 4QOZB 4F50A 4QWDA 1HNIB 3D0PA 1KRPA 1XHXA 2W9BB 2OPQA 2KZZA 3V81B 4TY8A 3K5MA 4CIEA 1RT7B 1DTTA 1SKWA 3MXIA 2YNHA 1IM4A 3V9UA 4DTRA 4O3PA 3V9ZA 5SWMA 3T19A 2W42A 4DS5A 4GMJB 4N5SA 1DLOA 4CJ5A 3VQDA 3LANA 4FK0A 3S3NA 3C6TA 5KG0A 4KTWA 1S1VB 4NLSA 4E7LA 2R8JA 1RT3A 3U3GA 4H4OB 3NH0A 4M3ZA 2HHXA 3GV8B 4CEEA 2VG7B 4LQ3A 3VQ9A 3VQAA 4TLRA 1VSLA 4DL6A 3PW2A 1RT1B 4K8ZA 4O4GB 4FK4A 1IKWA 3D45A 1JLAB 1U4BA 3QEXA 1JLGB 2W9CA 2DTUA 3CJ3A 1TK5A 3OYHA 4URGA 3V9XA 3DLEB 3TABA 3M9NB 4KI4A 4R5PA 1S48A 1UWBB 1A5XA 1EP4B 1FK9A 3OYLA 2PY5A 3CO9A 4ECUA 4NLGA 1WSFA 3LALA 3MTKA 4KB0A 4NLUA 4CEQA 2JEGA 3OSPA 4PWDB 1WSGA 5L1JA 3E51A 3FRZA 2ALZA 3HK2A 5KFEA 4WYWA 2HVIA 3VQ5A 3RMAA 3KLEB 1TKZA 1CZBA 5HRRA 3KK1A 4KSEB 4J9SA 4Q0BB 2VA3A 4CEOA 4M3WA 4I9LA 3AVBA 1WSEA 2HHTA 3MFIA 5KT5A 3LPUA 3TAGA 2HHUA 2OPSA 2OPRB 5HRNA 5SZTA 1Z25A 1TKTA 4TQSA 4AH9A 2F8EX 3ISNC 3FSIA 1UOCA 1JXEA 4ED6A 2YKMA 1EETA 3RTVA 2KFZA 4ED1A 4J2AA 2DPIA 1XHZA 1BQNA 3RMDA 2JLEA 3CJ0A 1S0MA 1I39A 2HMIA 3QLHA 3TAQA 4FYDA 3MR2A 3OJSA 1RDRA 5DG7A 5K14B 2EC0A 3L2RA 2R8IA 3F9KA 2OPQB 3VQ8A 5KFRA 4H4MA 3H5XA 2YNHB 2BRLA 1WN7A 3RMCA 2B43A 3MEGB 2FVRA 3DI6A 5DMRA 2R2TA 1O1WA 4GC7A 3NGDA 2J6SA 4Z4GA 3HKWA 2FVPA 3KHLA 1RNHA 4CEFA 2F8SA 3C6TB 3T5HA 3ZSQA 4JRPA 4HVJA 1DTQB 3OS1A 3PV8A 1U49A 2P51A 4Z4FA 4JLHA 2HAIA 1RT3B 3K5NA 3AV9A 2FJVA 4Y3CA 4O3QA 3E01A 3VA0A 3SZ2A 4DTNA 1VSEA 2JEIA 3EPIA 2GIRA 1RYSA 3M9OB 5DGAA 3B6OA 3FQKA 1IKWB 2LSNA 4ZTFA 3OJUA 2W9CB 4LY7A 4KREA 1SH2A 4R5PB 1RA7A 1ZBFA 1FK9B 4JV2A 4YMEA 2ZD1A 3DLKB 3C6UA 2C22A 4IR1A 3SUOA 4H54A 3WNFA 2Z1IA 3G86A 3AVFA 2D3ZA 3LWMA 1NJWA 4ZPDA 4X2BA 5F9NA 3PJWA 4Q45A 4NLTA 1TKZB 3KK1B 2YKNA 4W5OA 3S3MA 4K4VA 3LP2A 3H2LA 2XGPA 2F96A 4K4ZA 1RDBA 1MMLA 1TGOA 2OA8A 2OPSB 4TYBA 3PR4A 3PR5B 2JGUA 4DL2A 4K4XA 1SKSA 3CM6A 3RRHA 4KV8A 1UA1A 1RBVA 4URSA 3LP1B 4XO0A 3QNNA 2YNIA 3MFHA 3AVLA 1EETB 3V1RA 5EU7A 3RMBA 3NFAA 3A2FA 3SI6A 1BQNB 2P5OA 3CJ2A 5KFVA 4DTOA 3OYBA 2HMIB 4DTJA 1F21A 1D0EA 3QGIA 4N56A 2IC3A 3PO5A 2IM3A 2XY5A 3BQ1A 2XY6A 4Z4HA 4H4MB 2QXFA 1WSJA 2XHBA 4CF1A 1T8EA 2OZMA 3F73A 4N41A 1NK4A 3DMJB 5KGWA 1S4FA 4FJMA 5F8GA 2XI2A 1X1PA 3LWLA 3DI6B 5KFBA 4XPEA 2IS3A 4M3TA 4B8CA 3KLHB 4DSEA 3L3VA 5KFDA 5HRSA 4C8LA 3HYFA 1WNEA 3IRXA 1JX4A 3UIQA 3HSTB 3VN5A 1SL1A 1TK8A 4NZ0A 1HYSB 3KK2A 4IG0A 4B9NA 4DTPA 4F3TA 4CHPA 4J9PA 1C0MA 1JXLA 5KFGA 2QE5A 4HCCA 3SUQA 2OYQA 3D28A 1SH3A 4ECSA 3UR0A 5DLFA 2R7YA 2NUBA 4ELVA 1RTDA 4PQUA 4K4UA 2FLPA 2XI3A 2AQ4A 4TSXA 4FM2A 2ZD1B 1TKDA 4HKQA 1RDDA 3CDWA 4I2PA 3C6UB 2W7PA 1C1BA 4WXWA 4RW6A 4ZMMA 4CEDA 4IH6A 4PY5A 4K4TA 1RTJA 4RW8B 4QWBA 3DRPB 2YKNB 2CJQA 3OL9A 1EX4A 1HQEA 4ZP9A 4FVMA 3LP2B 5KFZA 1BISA 3DLBA 4QWEA 3GV5B 1KLNA 4NLXA 3H98A 2G8VA 3KD5E 1NOYA 3BSNA 2I5JA 4I9QA 1L3TA 3V6HA 2A1RA 3NBPA 1IKVA 4KV8B 4KKOB 4MKAA 4WFXA 4KHSA 4M3XA 1S6PA 4KHYA 4RUCA 3ZSOA 2YNIB 2KQ2A 3T3FA 3L8BA 2VG5A 5CZ2A 2R2SA 3QESA 4CFAA 4DTMA 1J53A 3PW4A 4OPJA 4CHQA 3QEVA 1FKPB 4WYLA 2IC3B 3NMAA 1TAQA 3HVWA 3KIOA 4E0DA 4FM0A 3MXMA 1QAIA 1TAUA 2G8HA 1NJYA 3OY9A 1X9SA 3G6VA 1D9FA 4FJGA 1HMVA 3GQCA 1C1AA 4TXSA 1JLBA 3MF5A 1ZBHA 2XWYA 3ITHA 3TAFA 2HB5A 1VSMA 1BGXT 4ZPAA 4DU1A 3IRXB 1TL3A 4CIFA 2UVRA 3ALYA 3KK2B 2BQ3A 4IG0B 2ILYA 3PVXA 3BREA 4GVMA 1ITGA 4K8XA 5KFFA 4J9OA 5C24A 3HPHA 4Z0UA 4FLVA 1Q9YA 4NCBA 4R8UA 3IG1B 5L9XA 1TV6A 2B5JA 3QEIA 2Y1IA 5J2PA 1BQMA 4DLEA 4FLZA 2G8KA 4CGJA 4N76A 5KFOA 4QWCA 4WFYA 1D8YA 1RTDB 4PQUB 1RT6A 5KT3A 5KFSA 2VG6A 2G8FA 3I8DA 3Q8PB 3ZSZA 3M8QA 2WONA 3ICLA 4I2PB 1C1BB 3EYZA 3M8RA 4RW6B 3B6PA 4J9NA 4ED3A 1HRHA 2GBZA 1NK6A 1RILA 1RTJB 5KFWA 4CJEA 2HWIA 2KZMA 5I42A 2FLNA 1S1XA 1HYVA 4MK7A 4CK2A 3OSNA 1N48A 1LWEA 1VRTA 4ECWA 4CGFA 2E9TA 3RBEA 3RBDA 3OL7A 4BDPA 3C95A 2D0BA 3BGRB 3NBPB 4RG8A 3IS9A 2P5GA 5KG6A 2GC8A 5KG2A 3L2QA 3NCIA 1NJZA 1S6PB 1LV5A 3NKYA 1EKEA 1S0NA 2VG5B 3L3UA 2UUTA 3CIZA 3SQ4A 4KTZA 4YR0A 3HP9A 2P1JA 4KB7A 4NLOA 4HHTA 4J9LA 4ZVGA 3U3YA 4EO8A 3HL8A 4RW7A 1GX6A 4KBIA 4CFBA 3HM9A 3L2VA 3MECA 2QKKA 4M45A 4GC6A 3OLAA 3NGYA 1YVUA 1JLBB 4FW2A 5FRNA 4ED2A 1ASWA 4MFBB 3ITHB 4DTUA 3MR5A 3VQPA 5J2MA 1RTIA 3OHBA 1I3AA 1TL3B 3PJXA 3DM2A 4Y1CA 5DG8A 1VSKA 3QIOA 4UQGA 4NCAA 2W9AA 4NYNA 1NKCA 1TVRA 1S5JA 2IDOA 1BCMA 3H08A 1TV6B 1N4LA 1Z4UA 2Z1JA 4FK2A 5J2PB 1FKOA 4M42A 2HNYA 2ASJA 4ZP8A 2R2RA 2C2EA 3TAEA 4J9QA 3NF8A 3V4IA 1RT6B 1HARA 1U04A 2VG6B 1IKYA 4M3UA 3M8QB 4FBTA 2HHQA 2E9RX 3P1GA 1C1CA 4KHMA 4ED7A 3NH1A 4DSKA 1KVAA 4HTUA 1QHTA 1WAJA 1L5UA 4F4ZA 4ZHRB 4B9MA 1JKHA 2A1SA 4CJUA 1RT5A 3VQEA 4AHRA 3NGIA 3SUPA 1S1XB 3QEPA 1KSPA 1RA6A 4RW9A 3KJVA 1IKXA 4KRFA 1VRTB 4CJTA 4RZRA 4IH7A 4C8KA 1NK0A 3AA3A 3SQ2A 2XCPA 4FJNA 2VA2A 4CHNA 3NE6A 4K4SA 1NNDA 3KMSA 3IS9B 3Q8RB 3RR7A 1S1TA 4HUEA 4AHVA 5I3UA 3KLGA 3NGZA 1IH7A 3JYTA 4LSLA 4JRQA 1VSFA 3H4BA 3AA5X 1A5VA 4RW7B 4EP4A 5C5JA 3CYMA 4B9LA 1C6VA 3FFIA 3RAXA 4FLWA 3MECB 4F4WA 3KLFA 4URQU 4O3SA 2PYLA 3NAIA 3T5JA 4CGGA 4CK3A 5EDWA 3GIJA 5KG5A 2BE2A 3QGHA 3K2PA 1JL2A 1LWFA 4HCBA 1B9FA 5J2MB 4GW6A 5DQGA 2R8KA 1RTIB 4TY8B 3CM5A 3KHHA 2FBTA 1A5WA 3PW7A 1DTTB 3DM2B 2YV0X 4FLUA 4O5BA 3TAMA 3AVMA 2FJWA 4ZPCA 4E1MA 4CJVA 1NKBA 2YNGA 4DL7A 4B9VA 1DLOB 4FJ8A 3VQ4A 1FKOB 3KOAA 3UQSA 1W9HA 3O3HA 2W7OA 2FC0A 3NF9A 5E41A 4Z4IA 3HVAA 1NHUA 5KFIA 5HBMA 4IFYA 1T94A 1XR7A 1IKYB 3OL6A 1C1CB 4CHZA 4L8RB 1WSIA 1TL1A 3TANA 4C8OA 3PW5A 4Y2AA 1QS4A 1JKHB 4R0EA 1RT5B 1S1UA 1YVFA 1RBRA 1REVA 5KFHA 3I5BA 2ATQA 3KJVB 4FS1A 3QIDA 1CXUA 1IKXB 2OH2A 2ILZA 2IM2A 4TYAA 3I0RA 1BIZA 2WHOA 4C8MA 3NL0A 4ECQA 4BWMA 2XRIA 3KLIA 2XY8A 3DRSA 3ZT4A 3AO1A 2HHVA 3QIPA 4KE5A 4Z4EA 3OYIA 1S1TB 3SPYA 1RT2A 4DS4A 4IRKA 1LWCA 5I3UB 2JC1A 4CJ3A 3JYTB 4LSLB 1NJXA 4CJFA 3FDSA 4QW9A 1TKTB 5EWFA 4WE1A 4NLQA 4CFDA 3NF7A 2W8LA 3FFIB 2JEFA 2JC0A 2JEJA 2YKMB 1GOAA 4YP3A 3HT3A 3DYAA 4BE1A 3LP3A 5KFCA 4CEZA 3V9SA 1J9AA 1JLQA 3QLHB 2BE2B 1VSJA 4F4KA 1LWFB 2V4QA 1HNVA 4OL8A 5DG9A 1YTAA 4QW8A
chains in the Genus database with same CATH superfamily
4DV3F 3QJLA 2FBXA 4DQIA 3UCGA 4JKCA 2YWEA 2Y1LB 1SQGA 3C3LA 1Q7LB 4FJHA 4FBUA 3P39A 3WXJA 4DL5A 1OQ3A 1XMBA 4C11A 4CJLA 3H59A 3UCUP 2MJUA 2HFVA 2LQ5A 1WEXA 3EVOA 4NLWA 1KFSA 3L7PA 2Q3PA 2EXUA 2PGCA 2B9YA 2PFUA 4CEAA 3MOJB 1OQ6A 4MO5A 3NCRA 5KRSA 1KDNA 1RDUA 3ZFVA 1QUVA 2EFNA 2PE8A 3HTVA 4G1QA 1CC8A 4H4KC 4WZMA 5JVHQ 1VYAA 5JLHA 3WIVA 5L1IA 2UUCJ 1EAYC 3IR5B 1ZBSA 5F1XA 1GX5A 2E5JA 4W4MA 3FSYA 1RYRA 4E7IA 2MKYA 3M1VB 2V4JA 4DV6K 1N5VA 3A13A 2B51A 4UOCA 3Q7BA 1FWKA 3P96A 1GMVA 1GLDG 2Q1NA 3PJ9A 2RF2A 2J8SA 2QTWA 4LH4A 4DU7A 1S1WA 3JSMA 2F7TA 5KG3A 4ED4A 2VIHA 4RNOA 3KD1E 4J37A 1N6QA 4EFAC 2AP6A 3S41A 1PJ5A 2P9KA 3ZT2A 4JS5A 2H65B 3MAAA 1GQEA 1DBDA 2DEJA 3A0IX 1B64A 5HATA 3HXMA 1C2PA 4HHJA 4DPYA 1JLQB 2V94A 4DQRA 3R5JB 4CH1A 1X9MA 1UEUA 1HNWF 2FGOA 4ZVFA 1KAXA 1BG3A 3OBWA 4CF2A 3HFZB 4DTSA 4NPOA 4K59A 3TARA 2Z2YB 4Q43A 2F7VA 4NA1A 4ZPBA 2GVZA 4X62J 4PZVA 2A42A 5AZIA 2DPJA 4C11B 3KNAA 2DRAA 2YWFA 3QZ8A 5KFNA 8RUCA 2X1BA 4Y2IA 3CETA 1WF2A 4NYZA 4BC2A 4DSLA 5EWEA 4DFMA 4USKA 3IKMA 4CYUB 2ROEA 1XQIA 1EQ0A 4G1QB 2G1HA 4O3OA 3JAMY 3VAHA 1C0TA 1RAEB 2KKZA 2Z1GA 1QTMA 3BO4A 1M5PC 2DHXA 3VQTA 2I2YA 3VF0B 1IBMF 4KHUA 2ZH4A 3MURP 1CLQA 4CF9A 2LP4A 4RNNA 2CG4A 3VEZA 1YVNA 3R7NB 3GPAA 3Q8YA 3AVAA 4PG6A 4YR3A 1VSIA 4JI5K 2VG7A 5D0GA 4OI4A 3TI0A 4WF9Q 4DQQA 1S1WB 2GWJA 3AOBA 5RUBA 3JTPA 3JSMB 2ZZMA 3L7UA 4O44A 4MH8A 2DNOA 2I5JB 3ZO7A 4NASA 1SCJB 3K2YA 1N6QB 5JUMA 4LFCK 4BVOA 2WK4A 5MAOA 5F8IA 2P9KB 4XDCA 4YR2A 3MAAB 4TLQA 1PSDA 2HLTA 2CVIA 4HL9A 4QWAA 3KK3A 2F1FA 2QV6A 2XMJA 2NUHA 4M5LA 2Q79A 3UN5A 3TX0A 1QAXA 4CLLA 2CQBA 1HKBA 4CZCA 2EG1A 4DMNA 1Y00A 1U6BA 1N34K 3CD6N 4YDUA 2GVZB 5AZIB 2ZWOA 2XS5A 2J6TA 1RT4A 1JJCB 2LLZA 3CCWA 3IM9A 3IUCA 3JSYA 4A5BA 2ITGA 3EZWA 2P2CB 3AXMA 2FHKA 2P5VA 3RB0A 5L1LA 1UA0A 2HIYA 4KGXB 4KHPF 4IEEA 4DFPA 2M52A 1PC4A 4IWVA 4Z4CA 2KO1A 9RUBA 4BRGA 3AO4A 4WQ5A 2VQEF 3L6QA 3QBWA 4WJBA 3RJMB 4DPXA 3QSYB 4FYVB 1C0TB 3CCLS 1S7HA 2PA8D 1L3VA 3I82A 3MMCA 4J9MA 2WONB 2W2NP 4C97A 2IBKA 4KIAA 4DEZA 2XGQA 3FK4A 1VQ4N 4V19X 4WKYA 1S3XA 4HDHA 3QNOA 4GVBB 1VC0A 2WW8A 2FIUA 2Y0SD 2KG0A 1K6YA 3VV2B 4FN5A 4BC9A 3ISND 4FZYA 3EE3A 2ATCB 3CERA 4WFAL 4O44B 4YOYA 1WAFA 4HYKA 4AF1A 3SCJE 4CT8A 2M88A 1MDUB 2ADBA 5C2CA 1W25A 1MSWD 2WSFC 4RKUC 4DR6F 2CNNB 1IG9A 3KMQA 3KK3B 4IQXA 1RBTA 2DNGA 3M8YA 4K4WA 4ICLA 1JJ2R 2HFNA 1EKSA 1FWLA 5AQSA 3VA3A 2A1BA 2QWMA 4GVLA 2AYMA 3PX0A 5DLGA 1WOQA 1BA0A 5LOQA 5I3PA 5AQVA 4ZTJA 1XWLA 5L39A 2VH7A 4NEYA 1CZ9A 4DHYA 1ZYQA 4M95A 2BE9B 3FFKB 4NZ6A 3S3OA 1SZ2A 4X4TA 5IQQA 3TVKA 1ZPWX 2DR9A 5A8WA 4CTAA 5ETKA 3NAEA 3LP1A 4CJRA 1RT4B 4KR0B 1SH0A 4DV1J 1GH8A 2KH9A 2VB6A 4FJJA 2OZSA 3PX4A 4U8VA 3KKRA 1XTZA 1C0UA 4BE2A 5BYRA 3E9OA 1QVFM 4Z7YA 1RWOB 3FCVA 3N0VA 2A6OA 1BL3A 3V4IB 2IM1A 3FZMA 3MMCB 1N56A 2RAQA 4CD3A 2B7BB 3NCQA 1NM1A 1VQPN 1TZ0A 2HK3A 1GEHA 1N32F 1NBEB 2IHR1 4DR1J 1K9MO 2HW3A 5KG4A 4ECRA 1HYSA 2ZH8A 3CCRS 4WYBA 5DDPC 3G8SA 2R8GA 4CHYA 3H5SA 2SXLA 2JZ5A 4OX6A 3BJYA 2KXFA 3TP2A 3GV7B 2DO4A 1XC9A 1F2GA 4XPCA 2UYTA 5DM6Q 2OHDA 3OYFA 3VENA 5L1KA 4LFAF 3KJQB 5CXTA 3MEEA 3SQ0A 1CZAN 1FJGF 5HROA 3PSIA 2RE1A 4M1KA 5KPRA 3AVJA 4CECA 2B8PA 3FEZA 2MKKA 2EX3A 3V1QA 3ULDA 3TUZC 2ERRA 1OVQA 4ICLB 2V34A 3S7RA 5LSLA 3C66A 3QO9A 3DRPA 2DH8A 3I31A 1P8ZA 1FW6A 1CULA 4HUGA 3O4WA 5ETSA 3DOLA 3R1HA 1HD1A 1HPZA 4YB6A 2BQRA 1R8CA 1VQ5N 2FZGB 1XR6A 4CTAB 4KKOA 3MCSA 3AGKA 3T1YF 3H5YA 4OJRA 2HAFA 3K59A 5EXWA 2CQDA 2X1AA 3BDPA 4WIQA 3EY1A 4ZK7M 2AW0A 3MN9A 1C0UB 5AXMA 2VWJA 4CEBA 4AXIA 1CXQA 3SQGA 4QAGA 2P9NA 3LZIA 4A2AA 4IKAA 1M5KC 5CABA 3BSCA 5F3TA 1TUUA 1W0HA 2AF6A 4U7BA 1MWQA 3GG4A 3KZBA 3IXQA 2FJXA 1Y5LB 5KRTA 1YI2N 1ESVA 1TKXA 1Y64A 2GHVC 1J5EK 4NWBA 5F9LA 2HNZA 3MGJA 2GJIA 3WC0A 1SL2A 2DGOA 2F3JA 2YKQA 3CCJS 2O8CA 4W5NA 5E3RA 1R8AA 3H40A 1VAZA 3DAWA 4DV5F 5EUHA 2JDJA 1TFYA 2K1RA 3V1OA 3ZCMA 1W2IA 5D3GA 2C28A 4NA2A 4DUTA 1WHYA 2ETJA 2HEKA 1VRUA 1SUQA 2AZ3A 2ZH6A 2RU3A 4TQRA 2CNOB 3MEEB 1FXDA 1GOCA 4CESA 5HROB 3DRSB 4KHQA 4AHUA 3SJJA 1N0VC 3EX7B 1RBOB 3EN9A 2YWKA 1X5OA 1RHUB 2OSQA 2QWLA 4JYAF 2HHHJ 4WWSA 3QO9B 4RNFA 2YH1A 1IWGA 1CULB 4U9RA 2K3KA 4DV3K 2VU5A 1R0CB 2R7VA 3AT1B 3KWGA 4MDBA 3OBYA 1NUEA 3DOLB 4CLFA 3T5LA 3IA0A 1HPZB 4F4YA 2E66A 1SPBP 2AWZA 3BGRA 1V5VA 2VFVA 1FFWB 2OAUA 2DFEA 4QR2A 1S77D 1OPIA 3PXGa 1S49A 4DX7A 2I1RA 4O55A 3AA2A 3D6TB 5SUHA 1BUPA 2LU1A 4EIAA 1NXIA 1RTHA 3K17A 1TL5A 2X6NA 2RILA 2D0AA 3EUNA 2BKOA 3VTIA 3I0SA 1NK5A 4CO4A 2DGTA 2KM8B 2P9NB 4AM6A 3GJRB 4EZ9A 5ETOA 2WTFA 1OY6A 2HBMA 1XR5A 1UETA 1VQMN 4FJKA 1ZA1B 2CPDA 3I5CA 4ECTA 1RAHB 1TKXB 4E7JA 2O3DA 3TZXA 1NMNA 4PR6A 2HNZB 3HMJG 2VPXB 2O8CB 2D9OA 1G15A 1RBAA 2IPOB 4NO7A 2XB2D 1SL0A 1NPRA 3FBFA 4BRFA 1GT8A 1KHWA 5CCLA 4DV7J 4EBDA 2K1RB 5D3GB 2W2OP 1FNMA 3X3UA 1VRUB 1B9DA 2AJQA 1SUQB 4FPRA 2VBWA 2P9IA 4JI3J 3KNGA 3AVHA 2PMHA 3H6EA 4DN9A 1XMOF 1RQ0A 3J7AN 1RT1A 4YUDA 4F9OA 3AA4A 3J7YP 3ULEB 3NAHA 3BY5A 2DH9A 5LT5A 4UOHA 5EX0A 3E9LA 2QXLA 5ETMA 5FRMA 1UWBA 1HNWK 3UB5A 1EP4A 2RPIA 1RSCA 2CWXA 1ZBIA 2X74A 4R0JA 4M3YA 4IKFA 3TJ9A 4IRCA 4ECYA 2GA7A 2PDAA 1GMUA 2W4PA 3EPGA 3RBZA 3J7A1 2B4JA 1CPZA 1ZTTA 4GRSA 4RUAA 2CJ9A 3TEHB 5KFJA 5AJ3J 3LAKA 4CJKA 4WU3A 2YWHA 3D7EO 2WC9A 2L9DA 2OPRA 1NJIT 2HVDA 2YPZA 1X31C 3QDKA 1W2BM 1ZTWA 4U8YA 1RTHB 1U45A 3GJTB 4OMFG 1FTCA 4LF4J 3I0SB 3W5YA 2HFZA 2IY5B 3J7Z5 3GIIA 1BWEA 4NXMF 2NYHA 2L9WA 4OHZA 4PG7A 1OMSA 1HHTP 4ZVUB 4K2XA 4QWDA 2DNHA 3D0PA 1A7GE 2KZZA 1BA1A 4TY8A 3MXIA 2BABA 3MUVP 4PL7A 4O3PA 4ERDA 3SCLE 2W42A 1WHXA 4BBYA 3IWNC 1W97L 3W64A 4ILHA 1S22A 1DQ8A 3LANA 1G6BA 4OYXA 4FK0A 2P9GA 1VJQA 2QWPA 4CO2A 2BACA 3THWA 1VRQC 3UDVA 4OZ0A 2P9IB 3U3GA 3M2VA 3Q0AA 3GV8B 3UNGC 1IBKJ 2ZZNA 3JTOA 3G82A 3VQ9A 5GAHU 4CZGA 1PAEX 4DL6A 1RT1B 1RKJA 2PFDA 1I94J 4ETZA 4ES2A 3T41A 3AARA 3GWCA 1ZXOA 1TK5A 3OYHA 1VQLS 3TABA 3DLEB 3VR1A 3M9NB 3ZX3A 1UVMA 5K5MA 1UWBB 3E3XA 1EP4B 2J0WA 4ECUA 1WSFA 3MTKA 4JI8F 1DEJA 4QYRA 4CEQA 3ENWA 1KQKA 3GLJA 5L1JA 3GR0A 2E7WA 2ALZA 4WYWA 2RDDA 3RMAA 2CIMA 5IFMA 1TKZA 2DY1A 4BS2A 3KK1A 2DRDA 2ZJQL 3I56N 2QA4G 5JICA 2XLIA 3LPUA 3LM2A 2J76E 3UKUA 4KHPK 1YJWN 2HHUA 1JK9B 1Q4RA 2OPRB 2B4VA 3A12A 2QC3A 4NZ7A 4EAHD 1IG8A 2H4YB 5L9NA 1Z25A 1TKTA 1X9JA 2MZ1A 2UZAA 1FCAA 3THTA 3NXZA 3QWUA 1YKWA 3ISNC 2VQEK 4NL5A 2E5GA 2YKMA 2FC9A 2M7SA 2R4FA 4JKAA 4ED1A 5EN1A 3W3DA 4OHVA 3QLHA 3TAQA 2WSCC 1Z05A 1W7AA 2NR0A 2ZGYA 4FNIA 4ZN3A 2HBRB 3F9KA 3VQ8A 1NRKA 3U9ZA 5KFRA 4H5TA 4H4MA 1R43A 4DV0F 3IR7B 2MY7A 3RMCA 4NE9C 1P6TA 7AT1B 4W98A 4JK8A 5H1SV 4Z4GA 3HKWA 4CZLA 2FVPA 2FJDB 4CEFA 2F8SA 1VQOS 3DXSX 1M0SA 1X4BA 4JLHA 3THWB 1OY8A 3K5NA 4WQ4C 3M2VB 2NCKL 3E01A 3G82B 3SZ2A 3MUMP 1SJFA 4DR6K 2RU9A 1RYSA 3M9OB 3MR7A 2HS3A 2E5HA 5GVQA 3HKZD 4BR0A 4DPUA 4KREA 4ZVPB 4DXLA 3HI9A 1UWAA 1RA7A 4UUWA 1Q8KA 2JFDA 5D78A 4ZJQA 2ZD1A 3DLKB 2UUCF 3HZGA 3VAGA 1QQOA 3AVFA 4FZVA 1QM9A 2D3ZA 3LWMA 1HWKA 1U1QA 4DI6A 3PJWA 2MHNA 1TKZB 3KK1B 1YJTA 1WUUA 4USJC 3PSFA 3LP2A 1PIEA 2XGPA 1EKRA 3ELHA 3OTOF 1TGOA 3UKUB 3J80Y 1RAIB 2JGUA 2DD8S 4DL2A 3BZCA 1XMQJ 1SKSA 3T69A 4KV8A 4L3NA 4M5DA 4MYTA 2OTLS 5F2RA 4URSA 1PC5A 4JAXA 3NRBA 1HBNB 1MWYA 4LVOP 1CC7A 3ZX2A 1WWHA 3NFAA 2ZUGA 4ZIVA 3ZETA 4ANDA 5KFVA 3OYBA 3MAHA 1S57A 5B8HA 1F21A 1D0EA 3QGIA 3PO5A 2IM3A 2XY5A 3C8YA 1N32K 2PEHA 4MKYA 4H4MB 1WSJA 2XHBA 2HF4A 1T8EA 2DH7A 2MKHA 4N41A 1NK4A 5F8GA 3FR0A 2XI2A 3VVTA 3LWLA 5KFBA 3HLUA 4MLEA 2EG2A 3IDHA 1N8RO 3DHXA 2CVEA 2UV8G 3IRXA 1VOMA 1KAYA 1JX4A 1OYEA 3HSTB 4X62F 4QS8A 3BGOP 4CNZA 4CIOA 1D4XA 3W2WA 1FJGK 2XZTB 4E8UA 1X5SA 1N36F 4KBOA 3G96A 3IO1A 1T3OA 5KFGA 2DIVA 4PG4A 3TTDA 2OYQA 3QPIA 2B7CB 1SH3A 4ELVA 2CQ0A 2CQPA 3BKFA 2MGZB 1H98A 4GKKJ 4LF1A 2QLXA 4DCPB 1TKDA 2ZD1B 1WOPA 4HKQA 4FM2A 2XMWA 2W7PA 5LJ5Y 3UD3P 2BVZA 2BBEA 2CWKA 4PY5A 4LF7J 5BRFA 1IV0A 4RW8B 2X3GA 4FPBA 3EGWB 3W0LA 4FVMA 3LP2B 3HX9A 1BISA 2ASMA 3T1YK 4OPAA 3GV5B 1KLNA 4OI3A 3R6MA 3T6JA 5KPZA 2DBBA 5CD4A 1G3OA 2VDHA 2VBXA 2A1RA 3MM9A 2ZH5A 4KV8B 1IKVA 4M5DB 1IJEB 2DHSA 3FBBA 4WFXA 4M3XA 1S6PA 4KHYA 3RZAA 4OYOA 3ZSOA 2B3TB 1QQMA 2R2SA 2C3OA 3QESA 4R79A 1DZ5A 2YPYA 3ZETB 4BRLA 4CHQA 1FKPB 2F40A 4RLEA 3NMAA 3K9JA 4IFEA 4FM0A 1V3SA 2M5YA 2VONA 1TAUA 2M3DA 3WQUA 3W2VB 2RHSB 2KVIA 2GS8A 4FJGA 2MLXA 1T3VA 1ZBHA 1Y4ZB 4DV5K 3ITHA 3RAMA 5JLFA 4OYMA 4DU1A 3OTEA 3IRXB 3CMES 4K7QA 3BDEA 1BLUA 1FF2A 2E2OA 2HOEA 2JVRA 4OZ2A 1F0XA 1S5ZA 3HSJA 1ITGA 2OTJS 1IR1A 4JKHA 3W2WB 4OPHA 4NCBA 2EKNA 3EZOA 3MN5A 2ZBPA 1TR0A 3QEIA 1MMNA 1BQMA 4DKWA 2QMUB 4C4WA 3CC4N 2QFIA 2G0JA 2RQCA 3LDNA 2OD4A 1D8YA 4BR2A 3EVWA 4CT9A 2G8FA 3ZSZA 2FJAB 2KVQE 1O8BA 2CADA 3CE8A 2CZ4A 3EYZA 2QJ3A 1FE4A 2GFFA 4ZVOB 3CF5L 1HRHA 2AJ2A 2I8EA 2P9UA 1T9YA 3MX2A 4USIA 3CJKB 1HBMB 1ZZNA 2FLNA 3NWRA 1JQGA 3T9ZA 3Q86A 3OSNA 5ETRA 1U24A 5E0OA 4ILMA 4GVEA 3CIMA 2KU7A 3C19A 2CXEA 3RBDA 4F25A 1FVSA 2D0BA 2ZOFA 3I33A 3MM9B 3M6UA 1VC5A 4LF9K 3NCIA 1S6PB 5LL6Z 1EKEA 2WTUA 4FF3A 2ZJPL 3TVYA 3NNAA 2DGWA 1FD8A 1WC1A 3ZTSA 3HP9A 4KB7A 2P1JA 1HWUA 3BO2A 4HHTA 5H9EJ 2N7CA 4X4UA 4EO8A 2YVSA 1FRHA 2IYIA 2QKKA 3VAIA 3HT0A 3UO0A 1EQYA 2LA6A 2VICA 4FW2A 4MFBB 3ITHB 2B4PA 3M2UA 2RSQA 5J2MA 1V3ZA 3OT9A 1RTIA 4FWQA 5GAEP 4DCOB 4Y1CA 2BJ7A 4ISFA 2R7WA 2W9AA 4HTLA 3Q8UA 4I6AA 1E4FT 4DV1F 3FRYA 1J2VA 4UOGA 4BRPA 2OEKA 4M42A 2GW8A 3TAEA 3MK6A 4XH5A 3IBCB 1FFGB 2YWGA 1NSKL 4M3UA 1IKYA 2VZ9A 2O8EB 2ZFHA 1RADB 4FBTA 3ZLJA 2X1FA 2LMIA 4UUXA 4DSKA 3TZYA 4HTUA 3C15B 3ZZTA 2FHMA 4B3SJ 5D4OA 1L5UA 2HK2A 2NXNA 3QAEA 3I4HX 2V2VA 4ZHRB 2F5GA 2P9UB 4CJUA 1U1RA 4DR1F 5AQKA 3NGIA 3AJ2A 4RW9A 2E1MC 1FO1A 3CJ1A 4P7VA 2JSXA 1T0TV 3GOIA 4LIRA 1RZMA 3SJHA 3SQ2A 4K2JA 4OHXA 1WB9A 2VA2A 1R3NA 2GMJA 1DKGD 1XK8A 3KMSA 1KC8O 4MLHA 5BRHA 4HUEA 4NXMK 1RHKB 5I3UA 1Q18A 4JRQA 1K8KB 3H4BA 1A5VA 4MO4A 2GV1A 4TNOA 3CCLN 3GYGA 1HWIA 3EWGA 4FLWA 1OH5A 4OYZA 4B1XB 3LPEA 1VQ7N 3I55S 2W40A 3W8PA 5AT1B 3T5JA 3CC2S 4X64J 3ZTRA 2IVYA 1T02A 5K8PA 3M2UB 1LWFA 5J2MB 1RTIB 3CM5A 4DX8H 2ZITA 1LNQA 5BR8J 3PW7A 2E2QA 1DTTB 4O5BA 5EX3A 4ZPCA 2G0CA 4JK7A 3M4XA 4FJ8A 2H5EA 3UQSA 3O3HA 1YJ7A 2W7OA 5E41A 5EGYA 1VISA 4Z4IA 2CQHA 1D09B 1NHUA 1WORA 4BRQA 3PTWA 5HBMA 3CO0P 3O9QA 5AXLA 1IKYB 2DGQA 4OZ5A 3JQMA 2V7YA 3POTB 5LMUK 3W9IA 4KY3A 2N82B 1RAOA 3VWSA 2E1PA 1TL1A 2GNKA 4IO9Q 4C8OA 2QTDA 3PW5A 5L38A 5FLXY 4R0EA 2IIHA 5DM7Q 2IRXA 2XNQA 3PYGA 3JS6A 1WKKA 2HGNA 3QIDA 1NH8A 4E1JA 2RT3A 1IUJA 2IM2A 2BW7A 2QLFB 2NYIA 2WHOA 3GYXB 5M2UA 2KFYA 4C8MA 3RU0A 2Q1LA 1Q81O 1LOTB 2RUSA 2IBOA 3SPYA 3MEKA 5E26A 4ANCA 2AJ0A 5I3UB 4F26A 1OH8A 1H72C 1OSCA 4CJ3A 2M4MA 5HQ8A 4K5SA 3ZZUA 2XMVA 2DGXA 4UZCA 4NLQA 4CFDA 5AQLA 3R8EA 3CCVN 1GOAA 2OCEA 4DV0K 3HT3A 3V9SA 1UEKA 3OPKA 5CQGA 2QT7A 4JI0F 1V9OA 1VSJA 1LWFB 3CCRN 1HNVA 2V6AA 2NLXA 4QW8A 5JVHL 1RWWB 3U4LA 3S8SA 4AYBD 2BANA 2F65A 3NHGA 2VBYA 3EE9A 3NDKA 2BKPA 2QK9A 2QX0A 4DL4A 2YHAA 2EWSA 1VQ8S 4PG8A 2XHWA 3PW0A 2WVFA 4PG5A 2LFVA 3ENHA 5HBMB 2V68A 6FD1A 2JX2A 2J9EA 3VF6A 2UUCK 3A5LC 2XZWA 1OIAA 1JLFA 1TL1B 1UFLA 1RDCA 1QVGR 2Z2MA 3RBXA 1UTAA 2J0QD 1IJJA 3RUBL 4DL3A 4E7HA 2AYBA 4ED0A 1T6DA 4KHWA 4DB3A 1K1SA 2HF3A 4OLBA 3OS2A 1U6ZA 1TQLA 1CEZA 3NVMA 4DV7F 5GAGP 4P7TA 1F1BB 4OKEA 4L6V3 4OZLA 4I2QA 4F8RA 3OW2M 4RCHA 4JI3F 3B78A 5AQRA 3V6DA 1ELOA 3OUYA 4OZNA 3GB0A 1J6ZA 3R5DA 1S0VA 4JI7F 1YJRA 3BN7A 5J2QA 4X66J 1VBZA 1WDTA 2CGLA 1ZM2A 4PABA 3PKMA 4USTA 2X1GA 3R1LA 2CG8A 3KG0A 2XG8A 4CP5A 4MIBA 3D9BA 3QZ7A 3Q2SC 2WBNA 2NSBA 1ASVA 1FNOA 2BTFA 4M63C 3VEXA 2F4VJ 5GIOA 3GTYX 3WNHA 2JLGA 3BB5A 5HOOA 4NLYA 3ISZA 2F8TA 1HNVB 5KFYA 4X62K 3PHEA 2R42A 4QPXA 5HP1A 2YNFA 5CE3A 2H51B 2BANB 5GADI 4A8FA 5ADZA 5H1SQ 1I6JA 5FDLA 1U8SA 2ZJRQ 2F63A 2DFFA 1F5AA 2E6LA 1IN0A 2RN2A 5T7LA 4IXCA 2ZH9A 4DFJA 4C8NA 1PYTA 4LF4F 4OX9F 4WF9L 1GOBA 2QA2A 3RWUA 4K25A 3CPWM 4FM1A 3CFRA 1JLFB 4EBEA 5AZJA 3IN5A 3H2UB 5KT6A 3GCXP 3C46A 1X4FA 3MR3A 2PZSA 1TK0A 3IR6B 3ZT3A 2HLUA 2C3PA 4CBWA 3IBFB 2YJFA 4A57A 4MK8A 3MMJA 2ZH7A 2IAJA 1KP6A 4JS4A 2CRLA 3M7VA 4FVCA 4K41A 3M32A 2Y9HA 4WPAA 1D3WA 2V67A 4TKTA 4I2QB 3T1AA 1HQEB 4F7VA 3R97A 3M6VA 3OUYB 4M5IA 1IBKF 4KI6A 4Y0FA 3O4NA 5IV3A 4J9KA 4Z94A 3RB4A 3G6YA 4WQ4A 1I94F 2EWHA 1HLWA 5DQIA 3PFOA 3OFFA 4B9QA 1CG2A 2G2OA 3RR8A 5FPEA 3AVGA 4BRMA 3AVKA 4EO6A 2DXDA 2WAQD 1SKRA 2L08A 4RNMA 2MSSA 1B70B 2ZWHA 3NGTA 4QCLA 3CWJA 4GO7X 2VJVA 2NLWA 5AQGA 5HANA 1UMJA 2BR0A 3Q89A 2NRZA 4YEAA 4BRIA 5HP1B 2YNFB 4ZCMA 1KQFB 2E7XA 1QSYA 1FWPA 5KOWA 1NKEA 3DOKA 4P74A 1KCFA 5FDLB 2D41A 3MM8A 2D0PA 1LEOA 1YJUA 2PMZD 2P8IA 4DTXA 2BRKA 5IC6B 3AGRA 4OKKA 3QGGA 3CI5A 5C15A 3PM9A 3QEWA 3ILIA 5T7LB 5BYSA 4O3RA 1VSDA 1DQ9A 2M2BA 3PRVA 4LH5A 2BDPA 3EGNA 2IVOA 1YHQS 3BF4A 3A8YA 1B7FA 3TZZA 2CYYA 2DNNA 1RFQA 1Q82O 2KW4A 4KAZA 3BF3A 3SYZA 2UP1A 3ATVA 2VKRA 4EMDA 1IBMJ 2UV8A 2CQ4A 3R3LA 3G9CA 3OVBA 3MEGA 1FRMA 2IRUA 2FD2A 2RRAA 3W9JA 2DHGA 5LM7E 2PFFB 2E44A 4QYZJ 3W65A 2Y8YA 1AYEA 1H73A 1NZAA 3CMQA 2IGIA 2OI2A 2RKIA 2FBVA 4I4BA 1FDAA 4IJNA 4A62A 2IAJB 1HI8A 2C2OB 4JK9A 2BOPA 4M5HA 1HW9A 1DTQA 4NB4A 5HMYA 3THXB 2HNDA 5HLFA 2GIQA 5IC4B 2CDQA 5CR4A 2P9SA 1LW0A 1RWUA 2KHDA 3M32B 1U1KA 3W9HA 2A3ZA 1KS2A 2ZH2A 5M1OA 2FBYA 4ZA1A 4F67A 2DIUA 2J9DE 2IM0A 3NF6A 1PILA 5AXNA 1NM2A 2OFGX 4LR7A 3O9SA 4FZXC 4CJ4A 2L48A 1VHXA 5GAHP 2CPXA 3HPOA 2DHHA 2G0IA 1ZS6A 3NCPA 5C2GA 1HUXA 3DLJA 3BN4A 4CLPA 1K73O 4L72B 1C0GA 4ZP6A 1QLNA 1OPZA 2AEJA 2B0GA 4E3SA 3A8KA 3P5JA 4J7CA 2R2UA 2DXFA 1Q53A 2J9CA 2BJEA 3QGPA 2R7SA 3QT8A 4E89A 1KOOA 1BI4A 2ACMA 4YNQA 2Y3YA 3DOKB 2MZTA 1YIJS 4DV1K 3OYNA 3MM8B 1WNSA 3AAQA 2C1EB 2MEWA 2PBDA 3EGVA 1XMQF 2W8KA 5KFKA 3R6LB 2RB7A 1M5VC 2XCAA 3FNNA 2V50A 1T05A 1TVRB 4KC5A 3C14A 3K7RA 4PHTX 1EARA 2RRNA 3N01A 1VQLN 3DMJA 3NH2A 4AL6A 3SEOA 1TYQA 4DR1K 5I4MA 5KTQA 5DDOC 3CCSS 3H4DA 2AGPA 3KLHA 1ROFA 2V7ZA 1PBUA 2AV5A 4RWTA 2RKIB 4EU0A 4CO3A 3PLAA 1VHFA 1QQNA 1RAJA 1NMDA 5A2QO 3K0SA 2HNDB 5HLFB 2P9SB 1LW0B 4DSIA 2AGOA 4AQYJ 3UN3A 2P6SA 5F8MA 3O6WA 2BZ2A 1AT1B 1KR4A 4PKDB 5HQMA 5B7WA 4O0JA 4CGHA 1L3SA 4DQSA 2KFNA 1CS4A 3IFEA 4BQLA 4PAAA 3WNEA 1F6TA 1DGKN 4ANEA 2N7YA 1H38A 3MM5B 4CZIA 4BG9A 3HVTA 3IWLA 1WF1A 4GKKF 1BHLA 4YOWA 3QT5A 4NLRA 4YDUC 3QYYA 3F9MA 2POKA 1Q8BA 1SVDA 4LF7F 1IO2A 4I0WA 4WBFA 3PZPA 2GWKA 1BI4B 1C4CA 4IO8A 1SQKA 2OEJA 2MZQA 2MQLA 5D4NA 4AHSA 3MD3A 5CYJA 2CPEA 3MXJA 1VQON 3R7SB 3KJFB 4DSFA 3DXKA 1AUSL 1RU2A 4AILC 2MXYA 2AX1A 3V4MA 3OLBA 1C0FA 4OX8A 2ZQBA 4OVLA 4BWJA 4O8UA 1WI8A 3H5UA 1T05B 1X4GA 1VS3A 3CFOA 3CC7S 4CLUA 4FJ9A 4WP8A 3A8JA 3TW0A 4Y34A 1Y5NB 3K89A 1S9EA 2UU9J 5HI7A 2EK6A 5KFPA 3O08A 5ETNA 2D3O1 1VQNS 3DRYA 1TYQB 1IQZA 1UZHA 1R8HA 2A41A 2D4WA 5F8HA 5J1EA 4A8XA 2V2QA 3OHRA 3D5MA 1T9TA 1KVKA 3G87A 2C2MB 5C42A 4K43A 3VMFB 3ZEUA 2A0FB 3ENOA 1SB6A 1F9EB 1GLAG 5BYQA 4Q2LA 4Z7CA 1ZAVA 1HI0P 4DSJA 3Q8SB 4LFAJ 4PWUA 4FWSA 2IOCA 2VL1A 2OTLN 2HHSA 4MKBA 1Y97A 1X9WA 3V6JA 4BCAA 1S6QA 1CS4B 3ASMA 3T9NA 4F3OA 2LCWA 3S01A 5IM0A 3QIPB 3ILJA 3IWXA 3GSIA 1VBXA 3K5OA 3HVTB 3A4TA 1QVFR 4K5RA 4YY3F 1V3RA 4FS2A 2BM1A 2QSFA 4CZFA 3BQ0A 1HNZJ 2J4RA 5LJWA 2OIHA 3R1XA 1J54A 4YQWA 4JKDA 2FC8A 5ETVA 3NS5A 4W92B 1S59A 4RBUA 5KFAA 4EYIB 3GBTA 4BRNA 4TN2A 1U09A 4FWPA 2KN4A 3SFUA 3FCWA 4OI1A 3DXKB 5KFUA 5K8NA 4ILJA 4O5FA 1NH7A 1X4EA 4UY8O 1RACB 3MX5A 4CJQA 2AX0A 2NRTA 3O4QA 1DURA 4AHCA 2PT0A 3TZWA 1FVQA 5E3PA 1CJTA 3D6FB 4RUBA 1S9EB 2ZH1A 2QMWA 2PYJA 1NHKL 4IFVB 3TQEA 2O1PA 4K4YA 4F0MA 1HQUA 4FJ5A 4QIEA 1JCEA 1UVKA 4ES1A 5J1EB 2CJKA 1Y11A 2IIRA 3G0ZA 1E4GT 4A8OA 3O1LA 5CY4A 4CCHA 3P8BB 1YT3A 4LF2A 4FJIA 4DV7K 5C42B 2KXHA 1VK8A 3ZEUB 1ZA2B 2OMLA 3TJAA 3HHKA 2ATLA 1T11A 2QI2A 2M8DB 4FVUA 3J7YU 4JI3K 1CSJA 1M1GA 4NRUA 2IA0A 4K0KJ 4CI6A 2OMOA 1XI1A 3D0HE 4ZVHA 3WQPA 1S1VA 1S6QB 1YJVA 4OLAA 4KHRA 1UEVA 5IT9O 2GCFA 1FE0A 4B3OB 4C7QA 3MM6A 5JVGQ 4JYAJ 5IM0B 1OVYA 1X4CA 2BJ9A 4L76A 5CHCB 1VQ9S 3RSEB 2HBKA 1EJ7L 1S9GB 4Y1DA 3RB3A 3AVNA 3AVIA 3D6MB 2KJVA 3OL8A 2LEBA 2HPUA 4B3SF 3JS9A 3OFGA 4F2RA 4WTOB 1UAWA 4BE0A 2ZZTA 4DU8A 4EYHB 3VOVA 3KHGA 2BJDA 2ROPA 5AJ3K 1BD6A 3R9LA 3MR6A 2UVWA 4EEYA 3N28A 4P9SA 5KFTA 1UFKA 2KM8C 3HM8A 1YJNS 4DU4A 2OTJN 5M1NA 2I7PA 4YDXA 4K8RA 1JCGA 4FPAA 3J81Y 1RCHA 4LF4K 3P6YC 2VPYB 4FLTA 3R2CJ 1K0TA 5LXRA 1S6OA 4FF4A 1CJTB 4CNYA 1ZBUA 1M90T 2DFHA 1BU6O 2M70A 2XHCA 3O9UA 2JH3A 4FPIA 1FRIA 2C2RA 1HQUB 4TU9A 2R7UA 1YZ7A 4F50A 3NG8A 3G25A 4P52A 5A0YA 4X64F 3K5MA 1NDLA 2LXIA 1RT7B 1SKWA 1YGYA 2OLWA 4RPFA 4LF5J 3BPSP 1JNRB 4C48A 1RWVB 5FPNA 1SJRA 5BR8F 5GMEA 2HFSA 1DLOA 4P71A 1IBKK 3C6TA 1XMOJ 4IOAQ 1WBDA 4KTWA 1S1VB 2V2ZA 4NLSA 1P90A 2R8JA 4LRAA 1I94K 3U1MA 4H4OB 3NH0A 2GVDA 3GCWP 4CEEA 4LQ3A 1VSLA 5AQJA 1WOSA 5HJYA 2BW2A 4FK4A 2KRBA 2LA4A 4A47A 1U4BA 1FJ7A 5B08A 1S48A 2AEFA 1A5XA 2PY5A 3CO9A 4QIWD 3PIPQ 1TUYA 3DGVA 4GKJJ 2YCHA 3OSPA 1SJ3P 1V4SA 3FRZA 2KI2A 5KFEA 1MWKA 1CZBA 5U47A 1YQHA 1Z6RA 4J9SA 5D4PA 4I9LA 2H5JB 4F02A 5KT5A 1NU4A 1SJ1A 4ZLLA 4NYPA 5HRNA 2CGJA 2AHOB 1JMTA 3GJSB 2F8EX 4DJBA 2HFOA 2EEYA 1UOCA 1JXEA 1GNKA 4U7UK 1SJQA 2HBQB 1EETA 1BE4A 1AXQA 1R6VA 2Y1RI 4J2AA 1XHZA 3RMDA 4NI2A 2HMIA 5THWA 5A76A 1EQMA 2Z4PA 3SMSA 3OJSA 1HKAA 1RDRA 5K14B 5DG7A 5A0YB 5BJRA 4OYIA 1DT9A 4CLYA 3EVMA 3KG1A 1WN7A 2B43A 2W6KA 3DI6A 1CJKA 2ZEJA 3L09A 2YQ1A 1Q16B 4GC7A 3O2IA 2J6SA 1HFEL 4LMZA 1G99A 3BBFA 3RVCA 3M8ZA 3C6TB 3T5HA 2N4CA 2H54B 4HVJA 1U49A 4P2MA 1HNXF 2MDAA 4Z4FA 2HAIA 1Z2LA 1N52B 2QEXN 2GVDB 4A4JA 5LSRA 2E2NA 1WKJA 4BRDA 3VA0A 1W2BR 2M8HA 3JSRA 1AA1B 2VJUA 2ASPA 5LSOA 4JHDA 4GMKA 3GL1A 3OJUA 4DR4F 4LY7A 1FX2A 1VLYA 4JI8J 3CMAS 2RVJA 1SH2A 4GO5X 5M1FA 3E1YA 4KQZA 4BRHA 5A8RB 5HVHA 4EUVA 4WCEQ 2O8FA 2R7TA 4IR1A 3CC2N 3F41A 3SUOA 3FZ2A 2Z1IA 2GHPA 3M1VA 2MLZA 4M8LA 2Z0GA 1NPPA 4NLTA 5IOLA 3S3MA 2IRYA 4DR2J 3MZIA 1XMQK 1Q86O 4CD1A 3TUIC 3W8GA 1M5SA 3AQPA 2JWNA 3OV7A 5M1PA 4K4XA 3RRHA 2VASA 2KT3A 2VGMA 1QD1A 5MLCV 3JXOA 2QYCA 3MFHA 1EETB 5EU7A 3RMBA 1FJEB 1FRLA 3CJ2A 2HMIB 1MNEA 2XWXA 4DTJA 2IC3A 3RRKA 3BQ1A 5J1NA 3AOAA 3KDOA 2F4VF 3DHWC 4CF1A 4PPDA 3DGPA 4Y6IA 3MCOA 2MKIA 3DI6B 1CJKB 4XPEA 2IS3A 4JI1J 2V8VA 3L3VA 5KFDA 5HRSA 3KVGA 3HYFA 4CO5A 3EJMA 1F60B 2BX6A 1SL1A 4LRCA 3VN5A 2E1RA 1TK8A 5AQFA 4DTPA 3EDRB 1TUVA 1M1HA 2RQKA 3SMPA 5LJVA 4CHPA 1QAYA 2QWRA 2O8BA 3PKYA 4J9PA 4CYUA 1C0MA 3CIPA 2DNMA 4LF6J 1MA9B 4B1VA 2QE5A 4DV2J 4JHDB 4GKKK 1U2RA 3SUQA 2HSEB 1NSAA 4B3RJ 4DV4J 4ECSA 1RABB 3UR0A 1CJVA 4K4UA 4PQUA 4DCJB 2XEXA 2FLPA 1JCFA 1NLVA 2XI3A 3AA8A 2AQ4A 2FY1A 1RDDA 3CDWA 4LF7K 4LRDA 2O8FB 4ZVSB 3SCKE 1F9FA 2ZC4A 2ZBIA 1QTNB 4MYUA 4ZMMA 4K4TA 4YOEA 4AL5A 2R3VA 4MJKA 1C4AA 2GAHC 3CJ9A 6AT1B 1RE1B 4ZN1A 3OTOJ 2CJQA 3OL9A 4ZP9A 3DLBA 1XIQA 3NS7B 2MQMA 3ULHA 2N3OA 4DPTA 3MCPA 1UJ6A 2I5JA 1PJ7A 4I9QA 3DNCA 3UDCA 1YUWA 2MQOA 1VQ8N 4WFBL 1CLFA 3V6HA 1NZ8A 2XMMA 4IOXA 2Y0BB 2AJ1A 1QY7A 1OKJA 1B0VA 4DUZJ 2KQ2A 3L8BA 2VG5A 3VGVA 4ZPWR 3MPVA 3LH2S 4DTMA 1J53A 3ZZZA 3MDFA 1SI9A 2IC3B 2DJWA 3HVWA 4E0DA 1QAIA 3PCOB 1RWPB 2DGUA 1NJYA 3DGPB 3H1QA 4Y00A 1S99A 1MWZA 3A3OB 1SQEA 3TAFA 2HB5A 3TR5A 3KK7A 1VSMA 3T6BA 4M7YA 2MZRA 2AZ1A 3MTJA 3ALYA 1N36J 2ILYA 3PVXA 4USUA 1RLCL 5I9EB 1MLAA 3CJCA 4K8XA 5KFFA 3ZC4A 4J9OA 4LFBJ 4Z0UA 1Q9YA 1ZC6A 2O8BB 3IG1B 4LVNP 5L9XA 4ZLPA 1FRKA 2PD1A 2EFPA 4DLEA 3FGUA 2BM0A 3QFPA 3O8WA 4N76A 4CGJA 1CJVB 3K8WA 4P2SA 4YB7A 4PQUB 1B4SA 1KQGB 2AJFE 3FUYA 4XK8C 2VG6A 3Q8PB 3T1HJ 3M8QA 2WONA 3MCNA 3ICLA 5JJBA 4B1YB 1HBOB 3M8RA 3P38A 5AQUA 4ITSA 4GVBA 1NLKL 2GBZA 5LXYA 2ZOMA 5KFWA 4ZCIA 1S1XA 4LT6A 3VGKA 3VGTA 3AJDA 4B17A 4CGFA 2E9TA 3RBEA 1WEZA 1GLBG 1VQ4S 3IFRA 4MAKA 3DU5A 1MROA 3IS9A 2FYXA 5KG6A 2O01C 2A3JA 3R5AA 3L2QA 5H9EK 3UD4P 3NKYA 2VFUA 2OJ3A 2VG5B 1W26A 2UUTA 4JV5J 1IWAA 4CH0S 5IV4A 1KN6A 4KTZA 3CXCM 3DWLA 2LEAA 4ZVGA 2BKNA 2ZNYA 3I87A 5GAEU 4RW7A 3B82A 2MMYA 3HM9A 3P45B 2J5AA 2WVDA 4M45A 2VUGA 4RU2A 3PYEA 3OLAA 2XYGB 2R7QA 3AD8C 4WK1A 3DU6A 3GFHA 4A2BA 4GNIA 4JNEA 4X84A 4DTUA 2NZCA 2GAGC 1IQTA 3SAHA 4PXBA 3FBCA 5B0AA 2WZ1A 1RK8A 1I3AA 4OHWA 1YXQA 4IYQA 4LIWA 3NMRA 3CCQS 3NWGA 3ZTOA 4NCAA 1YJ9S 3H3NO 3I96A 3IAS9 5HN0A 1BCMA 1Z4UA 3WX8A 2Z1JA 4G1PA 2ASJA 2X3DA 3H42A 1DAXA 3MMVA 2R2RA 4EK2A 4J9QA 4F0HA 3V4IA 2RRBA 4OV1A 4ZCKA 4B3SK 2MKJA 2YI1A 2VG6B 2ZWPA 2F9DA 3M8QB 3OQ2A 3GDQA 2QYGA 2HHQA 1C1CA 2RJZA 4ED7A 5C7PA 2AKWB 4ZCLA 1IBLJ 1QHTA 1WAJA 4JKEA 2D0OA 4B9MA 5BN8A 2A1SA 3AB4B 2GELA 3R7BB 2C2ZB 3SUPA 1KSPA 4I69A 1S1XB 1RA6A 3KJVA 4JI6J 1IKXA 1F3FA 2VYPA 4OI0A 3B8AX 2Q36A 4AQYF 4RZRA 3CJBA 1QJHA 2DYAA 2D69A 1M1KO 3R3TA 4HHUA 1NNDA 1MROB 2HHPA 3J8AA 3IS9B 3IM8A 4OV6A 2PN6A 2GQQA 1S1TA 1YHQN 4U67L 3H25A 3G71S 1VSFA 1Q95G 2GUPA 3AJ1A 4X64K 4RW7B 4EP4A 3SXLA 4KJIA 3FFIA 1YRXA 3RAXA 1K9MT 2MSTA 3LM9A 1HQ2A 2E88A 3UFCX 2H48B 3FJ2A 4O3SA 2PYLA 3UKRA 2VHGA 1HKGA 5BR8K 2X51A 3L4QA 3GG1A 3GIJA 2BE2A 4ZS6A 2RMLA 3D2WA 1JL2A 4GW6A 4LC9B 2ZJQQ 4IO9L 5E3AA 1A5WA 3FZHA 4FLUA 2JVOA 5K20B 2WVBA 3AVMA 3WZ0A 1NGIA 5DM7L 4MMOA 3LF0A 3LQVA 1GFWB 5KPTA 4LUBA 3GFXA 2YNGA 3MCAB 3KUGA 4DL7A 3QSIA 3HHLB 4FWLA 2UU9F 4IFYA 1XR7A 4L74A 3ILOA 3ENQA 3OL6A 1C1CB 5DDQC 2K8GA 4C8YA 2DR6A 5IWAJ 3CULA 1WSIA 4RX6A 4Y2AA 1QS4A 3LDQA 2QLJB 1BWFO 4YOXA 1DY3A 1REVA 3I5BA 3KJVB 2VPZB 1IKXB 4IOCQ 2OH2A 2ILZA 1YIJN 2JWLA 3GFYA 4CO0A 1ZBTA 4ECQA 5AQOA 4BWMA 2VFRA 1T9UA 3DRSA 3G2XA 1UZDA 2AJ4A 4KE5A 3OYIA 1S1TB 1JJ4A 1RT2A 3C6HA 1LWCA 1DRZA 3VGSA 2DHAA 2YQ3A 5E7OB 4KH5A 1FXRA 1TFWA 3N4QA 2W01A 1HNZF 4OX7A 3FFIB 2CQIA 3CCSN 4ER8A 2JEJA 2XMTA 1Z2ZA 2EK1A 4H0PA 3UKRB 4H0XB 4HT5A 4WKRA 2A2DA 1J9AA 5HMXA 3WXLA 2BE2B 4KH4A 3NEKA 4C0BA 4F4KA 1Y5IB 2HURA 1YTAA 4F3QA 3CPEA 2IVPA 4USHA 2VV5A 4PKGA 2D7SA 4BROA 1IBCB 1X0PA 1B92A 3DCAA 3A3NB 4C23A 2YNGB 1FDNA 2IA6A 3GE1A 3NP5A 3LTOA 2QWNA 3DDKA 2DXEA 2EFVA 1PG5B 4FF2A 2IVMA 4IFYB 2J6UA 4OPKA 1L3UA 3AO3A 2CFXA 5E84A 3PRBA 2XY7A 2BJ3A 2PI5A 1XEZA 3QICA 3WT0A 4B9UA 5GAGU 3QB0A 2YKAA 4UOFA 4BQZA 4QIVA 3FEXB 3BP8A 4PUOA 1K47A 3WIUA 1REVB 1Z26A 3AHPA 3AY9A 2DISA 1RP5A 3V9WA 2WRMA 3EICA 2RDJA 1QZ6A 3OR1A 4WU2A 3TTFA 4OGEA 5IXUA 4KFBA 1N5SA 3FEYB 4K0KF 3M2RA 3LO3A 3TRGA 1YZ6A 1ZM4A 1E6YB 2GJFA 2EFQA 1NOZA 1RT2B 4X66K 3CC7N 3VCDA 3EDQB 3J7ZO 2AEMA 4X65F 3F5TA 3ULEA 1LWCB 3PO4A 1FXXA 4LJMA 3ZT0A 2Z8QA 1B0TA 5HO4A 4IG3A 2YX4A 3WQTA 1I1GA 1SIZA 3EZ5A 2XMKA 2F4VK 1VQNN 4J90A 1SAZA 4JI0J 3NNCA 1RBUA 1U2CA 4ECXA 3WEEB 2CPZA 2Y8WA 2HBZB 3CDUA 4AXJA 4F04B 1VCTA 4ISGA 3KKFA 2O4IA 1R0BG 4DBQA 2GQCA 2XO7A 3MXHP 2UXDJ 4OHYA 1WSHA 4J2BA 2MTLA 1WACA 4ES3A 5HQLA 1EB0A 3G10A 3CB4A 2ASLA 2NZTA 3EZUA 3SAFA 2QW9A 3O3FA 4TVAB 4LD0A 4ZIWA 2G2ZA 1EXQA 1LFPA 2DITA 1GLJO 3KHRA 4V19J 2GQ2A 3OYEA 1T7PA 4EZ6A 2V8GA 3ZZ0A 4CFCA 1Y3JA 5KG7A 2CJAA 1X4AA 3JTNA 3VALA 5DS7A 1J5OA 4C2MA 1PAUB 2QL5B 1WUAA 2QN6B 2FVCA 2O8DA 4FXDA 4PUOB 2LKZA 1X60A 5EWGA 4LF5F 3IGVA 4KB1A 2Q3SA 3ATUA 1QSLA 5ETPA 3OR1B 1SQFA 1VHIA 2MQPA 4CBXA 2KLAA 1NGGA 4KFBB 3SQ1A 3US5A 3M2RB 4Y2CA 3KUEA 1R6YA 2D3OR 4Y65A 4JI7J 2WCXA 1HBUA 3MMBB 3HP6A 3CJ4A 1P9YA 3BS9A 3BKUA 1S9FA 4PPZA 4NLPA 3VQSA 5AQQA 3GIKA 4ZVEA 3DLEA 4IG3B 3L95X 5MLCQ 1YSJA 1WC0A 2O4GA 4BR9A 3CD7A 3OXFA 3SDEA 4ID8A 2UVUA 1RBLA 4FJXA 1H6KX 5L46A 5F3ZA 3SPZA 1KFDA 3UR3C 2UUAJ 1WKLA 5J2NA 2YBVA 2CKWA 1S97A 1VLOA 4GKJF 4M7XA 2GMHA 4WFNQ 4UF4A 4IBNA 2E2PA 4U6PA 3EM1A 2ALYB 4NCGA 1HMVB 3WXKA 1SC6A 4PWWA 3SFGA 3LOUA 3TSUA 4ZKAA 4J2EA 3OBIA 2WOMA 3HZ6A 3DKDA 3WX4A 3OW2R 4A46A 1U7LA 4OX9J 4JKFA 1X5TA 2ZJPQ 5DJBA 3CCTA 5C24B 1VQ9N 1J5OB 1BMQB 1IBMK 4R8UB 1FT8A 3C0BA 2B4OA 2B5JB 3N5FA 5I3QA 4QYZK 1ATSA 1G7CB 3MOZA 2IJNA 3GFZA 4HHHA 2O8DB 1VSHA 2ASOA 5DGBA 4OGCA 2XMUA 2V8HA 2V52B 5C0YA 3BO3A 2RD5C 2Y1JA 3TWHA 2AGQA 3Q8VA 1REGX 3CHWA 1H2TZ 3GIMA 1NHVA 2GMLA 4I7FA 2KYXA 3UPFA 1YJNN 1N33J 3J81j 1U02A 4J8FA 3OVSA 5I42B 2D0CA 1GTEA 2Q6CA 3ZSXA 4XEIA 2MZSA 5GAHI 1GK8A 4X4NA 2LQ9A 1LWEB 5D4LA 1HBUB 2RE2A 3D3CJ 2MPUA 3NGRA 5T7BA 3VQCA 2VC0A 2FHJD 5KT4A 5KG1A 1M5OC 3DLKA 5E3QA 3GZ7A 4FF1A 3CJ5A 3HJFA 3QJPA 2NXJA 2NRXA 5CYMA 4DWIA 3SDEB 3CPWR 3AB2B 2ZBRA 3C94A 5J2NB 3MN6A 3BGUA 5HRPA 1Q7YO 2WVEA 2WUSA 4XIUA 2HQGA 4C3LA 4RW4A 3CCES 4NCGB 2GO9A 5KOXA 3K8VA 2QIFA 4DR2F 2Q0UA 2YHBA 4C0OC 2A6AA 1HLUA 2C2NA 4USMA 1YITS 2QWQA 3C2PA 3THPA 2MKSA 2R9LA 3MWBA 2WOMB 3OYMA 4FWOA 2BGGA 2IMWP 1LAWA 1HBNA 2BQUA 4TY9A 3P31A 5HMZA 4IRDA 4HLBA 5CCMA 4DU3A 1NB7A 4F2SA 2DO0A 2HHWA 2DNZA 2H1YA 1ULRA 3QNWB 2E29A 3A5MC 1P1LA 5G4DA 4I64A 3VAKA 3PX6A 2HNYB 1NK7A 4CLTA 3MPUB 3CJSA 2CNKB 1CBKA 1NBWA 3HD2A 3VEWA 1K8AO 4DDFA 1WI6A 1GLLO 3Q2TC 1H0HB 1F5CA 2EVZA 1RAGB 4AQYK 3VF4A 2VODA 4JI1F 4PXCA 4I7FB 4B8AB 3SCXA 2QZ8A 4JN4A 5A6PA 2E1AA 4CIGA 4DX6A 3M6WA 4M94A 1WEYA 1TMMA 3KKSA 2CDRB 1WG1A 5CZ1A 3MI7X 4JI4F 4RL1A 2ZOGA 2WSEC 4FWRA 1FERA 3VAMA 1WBBA 3O1WA 3ZT1A 5JMVA 4BG8A 4OQJA 4TU7A 4LF6F 4DV2F 1YG0A 5LMNJ 4KPCA 2MGZA 4PRFA 1OY9A 1PYSB 3D66A 4DV4F 4B3RF 3QQCD 3CJ8A 3NNHA 4GV6A 2MYFA 5CYMB 1MW7A 2DRBA 4JV1A 4CLZA 1F5BA 5IT4A 3KLGB 3O6QA 1KVCA 5IZHA 3NMUA 2E1YA 4L75A 1N8RT 2VQFJ 5E33A 4U7CA 3BGFA 4RW8A 2ZDOA 2AYEA 2MQ8A 1VFJA 3TUJC 3BR9A 4RW4B 4DG1A 3KLFB 1OS5A 4DL0C 2NXEA 3AD9C 4E1NA 3IAYA 1S6UA 4HACA 4J91A 4KAIA 3SSSA 3H90A 2DNKA 5F8NA 4O3NA 1HWJA 1U0HB 2UU9K 5J1PA 3AAWB 4DX5A 1QE1A 4DUZF 1FKPA 2G4BA 5T14A 1CJUB 2DPNA 3AVCA 3ID8A 2AU0A 1WHWA 3OR2B 4CF0A 1HJRA 1P1TA 1EWQA 3CMAN 1Q8IA 3W2VA 4YHHJ 2XC9A 4I1TA 3SLCA 5D77A 3FVYA 2VKZG 4PYDA 2E4LA 4Q44A 1YAGA 4FWKA 1Y9OA 2LXFA 2HBYB 3OYAA 1BHNA 4N77A 1L3KA 1OYDA 1ASUA 3WC2A 4W5QA 4LFAK 3S1TA 4CLWA 1KD1O 2HRTA 3GILA 4E98A 4LFBF 4NLBA 3IRWP 4FLXA 4QBUA 2AMCB 4BDYA 3I0RB 2DCLA 2KB2A 3OTDA 1QSSA 4NLDA 2B4UA 3DRRA 1HNZK 3B4MA 4BR7A 1D1UA 2HQ3A 5B0EA 1HKCA 1NDPA 4KPYA 1QQCA 3T1HF 2I6WA 1X7VA 3CC4S 3CJKA 1HBMA 1KONA 1SC1B 3O44A 2B9WA 3R2DJ 1NSQA 3U8XA 3AXKA 4HWIA 3GE9A 1KAZA 4DG1B 1LQ9A 3D0IE 4A8YA 4J2DA 2GV9A 1P9QC 3LGMA 2KYZA 3OVAA 1F3VA 2WBRA 3BSOA 2GJ2A 3M8SA 2V4RA 2XQCA 4HACB 2OKQA 4KH6A 2HWHA 3UN2A 3JAMO 3CGIA 5ELZA 4CO1A 3L2WA 3VQBA 1HA1A 3DLLQ 4Q5VA 4ZVRB 4K50A 1QE1B 1KTQA 2GX8A 4MQ3A 3PYFA 3UWTA 4JV5F 1DJ0A 3EGZA 4GV3A 1FJCA 3M5RA 4P2FA 2W24A 4N47A 3M6GA 2J7UA 3E8OA 3KDNA 2ASDA 3VGUA 2D9PA 3VZIA 4KH0B 2KG1A 2R8HA 1A6LA 2OSRA 4F36A 1T9VA 2KL8A 4UZBA 5JVGL 4DFKA 2D1KA 5GADP 4MFBA 2Z1HA 5GINA 5F8LA 3K5LA 1U1PA 2W9BA 4B3MJ 5H9FJ 3V81A 3SNNA 2OGUA 3RB6A 4M5MA 4KGMA 3ZSVA 2G8WA 5HVGA 1IVZA 1RGVA 1OJ4A 2GUIA 1F9HA 4K0KK 3WDOA 4A59A 3TQ1A 4B08A 4M5JA 3QBXA 1XJWB 2IDEA 4X65K 1UCNA 2V4JB 4JYAK 3I6PA 4HVZA 4ECZA 3PUFA 3O5TB 3K58A 1KOHA 2RF2B 4YY3J 3A8IA 2O8EA 2MB0B 3MWTA 3DRRB 5KFLA 5E5NA 1JJHA 4ZP7A 4YB1P 1XQSC 3RRGA 4O4GA 3C15A 2AD9A 3CUNA 4ZHRA 4CI0B 2HFUA 1VQ6S 1IBLF 3GU0A 4M3RA 3HF5A 5KQ8A 1U2VA 2HRYA 2ZVSA 2DY4A 3GIRA 5FROA 4JI6F 4HI2A 3KHYA 1WTBA 4QU6A 1Z1ZA 1V4TA 1B3TA 3UI3A 1HR0J 3KLEA 3THVA 3PRDA 3C16A 4DZ6A 4QR0A 4Q0BA 4FW1A 5M2RA 2D5RA 5M1KA 4FJLA 2QL9B 2D74B 3O9RA 4CM2A 1K8KA 2HQDA 3I5AA 4O0IA 2C42A 2FVSA 2LQJA 1UKUA 2FZKB 1TUGB 4DR3F 2KTQA 4CGIA 2VFSA 4IOAL 1YTUA 2QO3A 1ZETA 3SV3A 1U48A 1HYZA 4KGKA 1ZAWA 4LF5K 2I7NA 4WP3A 1H2UX 1KRPA 2W9BB 3V81B 4EHUA 5AQWA 4CIEA 1MMDA 2W4DA 1U1NA 5LJ3Y 3P4UB 1DTTA 1IM4A 4X4SA 4LBHA 1RAAB 3V9ZA 2KT5A 3T19A 1WC5A 1XMOK 1Y10A 3FZFA 1KC8T 4O23A 3CQYA 3PIPL 1VQ7S 4C8ZA 4KT0C 3NGKA 4YB5A 3S3NA 3MCMA 3G8QA 2ZNZA 4K42A 4E7LA 4D3HA 5F0XA 5GMKa 1RT3A 1QHAA 2HHXA 2W2MP 2VG7B 3UNYA 1H2VZ 3CJAA 2FY8A 4WP9A 1FHTA 4TLRA 3POTA 3PW2A 4K8ZA 4O4GB 4YOTA 2H9ZA 3D45A 3NGSA 4FDFA 3QMQA 3CJ3A 3SSQA 4GKJK 4QIFA 4URGA 5IWAF 2FDNA 4DQ8A 2RUGA 1FK9A 2PAVA 4LR8A 3OYLA 2QRRA 4NLGA 5CH7B 1U2VB 4KB0A 4NLUA 4BC4A 1Q1KA 1WSGA 3E51A 1BWVA 3HK2A 8ATCB 1KKHA 3ENVA 3MD1A 1U8WA 3KLEB 4EI2A 1FEEA 3C16B 4KSEB 4Q0BB 4NXNJ 3CCQN 1UFWA 4CEOA 5BN9A 2HHTA 3AVBA 4CZEA 1YJ9N 3X1LB 3MFIA 3SQOP 5HAOA 1WOOA 3TAGA 3TVZA 3ENBA 5SZTA 3PIOQ 2RQ4A 4YOVA 2A5XA 4C3MA 3GMGA 2YHYA 1KQSM 2UUBJ 3JAMU 2RIJA 3RTVA 2KFZA 2COLA 1UW9A 2JLEA 3D1OA 1RISA 4FYDA 4AUKA 2PIIA 2FSJA 3L2RA 2EC0A 2QM1A 3TWZA 7FDRA 5FIIA