2OPSA

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
542
structure length
535
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 134
structure length 535
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2opsA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2opsA05
4DG1B 2B5JA 3PJWA 5KG5A 3MECB 4ECYA 4RW4B 2PZSA 3KLHA 3DM2B 1S48A 4FK4A 3HVTB 3RB0A 2GC8A 3M8QB 2JEGA 2OYQA 4NLGA 3O3FA 3OYJA 4CJSA 3VQ6A 3DRSA 3KLIA 2AGQA 3DRRB 1O1WA 3BR9A 3VQSA 4CJWA 1DLOB 3V81A 2YNFB 4IG3A 4RNFA 3SV4A 4AHUA 3PJXA 3H40A 2FBVA 4FYDA 2KW4A 3OYAA 2P5OA 1HYZA 4J2BA 3VQ8A 2YHAA 1N5YB 3SFGA 2DTUA 2YKNA 3LDSA 3NGZA 5KT3A 5JUMA 4DL5A 3M8SA 3AVKA 1BGXT 3KIOA 3P1GA 2Z1JA 2I1RA 5F9NA 1S1XA 4QOZB 3NH0A 1YTUA 3N6NA 4ECQA 4J9LA 3QLHB 3SQ2A 4ED3A 3SPYA 3OS1A 1K6YA 1TGOA 4AH9A 2B6AB 4CJEA 1CZ9A 1KTQA 3OYCA 3LP1B 1W25A 4RNHA 2FBYA 2BE2B 1NHVA 3OYNA 4J9MA 4WXOA 3BGRA 4G1QA 2HWHA 1LAVA 3BSAA 1VRTB 4CEZA 4B9TA 5J2NB 4Z4GA 2B43A 3KHHA 1FKOB 4LSLA 3RMCA 2KZMA 5JS2A 3RMAA 4F2SA 4FW1A 2FVQA 4O0IA 2JEIA 5KTQA 4FZYA 3AVBA 2ASDA 1VSMA 3LALA 2HWIA 1RDBA 4Y3CA 2E9RX 3H59A 4RW8B 1JLEA 3JYTA 5J2PA 4J2AA 4FJIA 4KO0B 3EY1A 1UWBA 3OVNA 4ZP8A 4KV8A 2FLPA 1S0MA 3H98A 5KFNA 1J9AA 3PY8A 3NF7A 5HRRA 3FFIA 4KHQA 4Z0UA 3K5MA 1UA0A 3CQ8A 4IFVB 1WNSA 1UA1A 5KFJA 4FLXA 1Q9YA 2UUWA 2ASJA 5FDLB 2VG6B 4O3OA 5T14A 2CJQA 1BISA 2ETJA 2D0CA 4O4GB 2NUBA 1N6QB 1LWFA 3O3HA 4IDKB 4B9LA 4H8KA 5J1EB 4WYLA 1FKPB 4IH6A 1DLOA 3V81B 3GIMA 3RMDA 3ZT4A 4FXDA 5KFQA 2FVCA 1GOCA 2HHQA 3MEGB 4DSKA 2BANB 4F50A 3GV8B 4JV0A 3NGDA 4I9QA 3ALYA 1ZBUA 4Y1DA 3V9UA 2C2EA 2P51A 1TKXA 4QWCA 1JLGB 5KG7A 3SFUA 3PR4A 1CLQA 1SUQA 4RW9A 3K5LA 2E6LA 3G86A 4FLVA 3LPTA 1VRUB 3BSCA 3NDKA 1ITGA 1T3NA 1EETB 1RCHA 1U04A 1U45A 5EWGA 2R8HA 5F8JA 1RTJB 5JXSA 4IR9A 2ZKUA 1TP7A 2O4IA 1NK0A 4TYBA 1HNIA 3MEEB 5KFLA 5KG3A 3BQ2A 4BDPA 4B3OB 3EYZA 3LP2A 3IN5A 1S1UA 4EO8A 2IJFA 4LQ3A 3HHKA 2E4LA 4Z4EA 1JKHA 3HK2A 1TAQA 3SV3A 1HQUA 4RW4A 5C25B 4CJUA 1T94A 3EPIA 4I2PB 3TAFA 3HJFA 4ECWA 4ZTJA 5J2PB 4W5OA 1LW0A 1RT2A 4K8XA 4URQU 4YR3A 1QSSA 3L2VA 1REVB 4MIBA 4DFJA 4CGGA 3GIIA 2HNZB 2RKIB 1TKTA 1JLBB 3RBEA 3SUPA 2RDJA 3DYAA 3T5LA 3KHRA 3C6TA 5D3GA 3G0ZA 3HSTB 2FJWA 1L3TA 2OPSA 4ZPCA 4F2RA 3ZSYA 1TV6A 1S10A 1SV5A 3SUNA 4K4VA 3C95A 4O0JA 3V4IB 3AO4A 4DTSA 3CG7A 3GYNA 4CF1A 2Z1GA 5CYQA 2AX1A 2V0NA 1JXEA 3AA2A 1TAUA 1IKVA 5CYMA 4K4WA 3JYTB 5HLFB 4MK9A 5HROB 4KTQA 1RYRA 4BWJA 2VG7B 1KSPA 1N56A 2OH2A 3VQBA 3PW7A 4WFZA 3AO2A 1K1QA 4I2QB 4URGA 3OYDA 4FLTA 1KVCA 3IG1B 1S6QA 4JS5A 1YVUA 4OKKA 1L5UA 4CE9A 2UUTA 4CEAA 3AVLA 3T5HA 1VSHA 5C42B 4HHTA 2ZD1A 4ECZA 2DFEA 2EX3A 3KK1A 2AQ4A 3LP1A 4DMNA 2X6NA 4TY8A 4ECRA 3AA3A 4PWDA 4KREA 5DLFA 3RB4A 4JRPA 3KLIB 4E7JA 1KHWA 1SL2A 2OA8A 1T03A 2HVHA 1L3UA 4PWDB 2WOMA 2UVRA 4FM1A 3NL0A 1WNEA 5CYMB 1IKVB 3GV7B 1C1AA 3MECA 3V1RA 2GV9A 4W5RA 5KFOA 4ELTA 4QPXA 4WFXA 1RA7A 3CDEA 1ZYQA 4DL7A 1BL3A 4DTUA 2HHUA 2YNFA 3C6TB 3RAQA 2IGIA 2W8LA 5HRNA 4YMEA 3MFIA 4WXWA 1S9GB 3V6DB 2IOCA 4I2QA 5F8LA 1BI4A 5L1KA 1ZTTA 4KHNA 3PVXA 4KFBA 3QYYA 2G8FA 3QGGA 4KI6A 3TAMA 1DTTB 3KK3B 1BQNB 3K58A 1D1UA 3VA3A 2W9BA 1BQMB 4Q0BA 2OPQA 4I2PA 1W9HA 4J9KA 4QW9A 3LP0B 1BQNA 4AHRA 3V9WA 3C94A 4AHTA 4CJFA 1NJZA 2F8EX 4N56A 4FJ5A 2G8HA 2W9AA 3SQ1A 4ZVGA 2HVIA 1HARA 1Y97A 4Q5VA 2ATLA 3PW5A 1KFSA 5KGXA 3TAPA 2Z1HA 4E1MA 4YR2A 3AO1A 4FJHA 1IM4A 4M3YA 4IG0B 4QW8A 2IC3A 1KFDA 1NK8A 4CGDA 2R8GA 4J9NA 2HMIB 1QS4A 5KT5A 4CFDA 4CIEA 3KLEB 4E7LA 1NK6A 4ICLA 4ED8A 2R2UA 3MXMA 2XWYA 4FW2A 3CFRA 4ED7A 3ASMA 3ZT3A 1C0UB 1I6JA 5KG6A 5KFYA 3BREA 2IA6A 3I0SA 4F8RA 3U3GA 4IH7A 3QEWA 3PW2A 2X74A 3VQ9A 1D9FA 1S0NA 3M8RA 3PX6A 3QEXA 1N4LA 1SKRA 5KT6A 3LWLA 1RT6B 2HNYB 3CVKA 1IH7A 2ZD1B 2BRKA 2D0BA 5KFGA 4RUAA 1VSDA 3SUOA 5KFFA 1IKYB 5KT7A 3U3YA 1NJYA 4DQIA 4LH4A 1S6PA 4ZP7A 1ZBHA 1T05A 3M8PA 4CHOA 1JLCA 1LAWA 4NLRA 4DL4A 3NHGA 3AA5X 1U47A 3V6KA 3DOKB 5I3UA 3DLBA 2P5GA 3E51A 1ASUA 3HP6A 3KLVA 5KRTA 4KHUA 2QV6A 3KLGB 3KLFB 5E41A 4C8MA 4PQUB 4RW8A 1C1BA 3UDLA 2KQ2A 5KFIA 4FLUA 4EP4A 1SV5B 4DF4A 1UAXA 3Q8SB 4FZZA 5KFMA 1X9SA 4QCLA 1S1VB 1R0AB 3DLEB 4M94A 4IFVA 4NLDA 1XR5A 3ZT0A 3NBPB 4G1QB 3HKWA 3ZSWA 4YFUA 4MH8A 4CECA 4CESA 2C2DA 2HNDA 1ZBFA 3LWMA 2JLEA 2B6AA 3KLGA 3MXJA 4O4RA 5CYQB 3OYBA 4ED0A 2HNDB 3H2LA 1QTMA 1SH0A 5SZTA 2YNIA 4B9SA 2YV0X 4KHYA 1HQUB 2FVPA 3QIOA 3M8PB 1HNVA 4F3TA 2B4JA 5D3GB 3OSPA 1HMVB 1JX4A 3F73A 4CF0A 3RR7A 3DYAB 2BGGA 1FKOA 4GMJB 4FLYA 2F8TA 1IKYA 3H08A 2FBXA 4NCAA 4RW6B 3KKSA 4TLRA 3AVHA 1LW0B 4O3QA 3VQEA 4M95A 4KRFA 1I3AA 3DMJA 3OYFA 4R8UB 2IDOA 4CJKA 1WSGA 4NZ0A 1QSYA 2KFZA 1C0TB 2XGPA 4Z4CA 4GVMA 1RBUA 3T5KA 4EZ9A 3MR6A 4RW9B 4ECSA 3OYKA 4ZPAA 4ECVA 1RDAA 2R2RA 4CJ5A 4DL6A 2O4GA 1TK8A 1L3VA 1NK9A 1HJRA 4IRDA 3CJ3A 2YKNB 3WNHA 4H4MB 3MEGA 4N5SA 4CJLA 4EO6A 4BACA 4CGFA 4RNOA 4OJRA 3RMBA 1RILA 2E6MA 1RTJA 3I5BA 4OLAA 4NLSA 1XHZA 3BJYA 4EYIB 2WONB 4CF9A 4FJ8A 3LAMA 4O44B 3F9KA 1N6QA 4OKEA 3VQAA 4JS4A 3V6HA 4RW7A 2GBZA 4O3RA 1S9FA 5L1LA 1VSKA 4GC7A 3M8QA 1RTHA 4NLWA 3TAGA 4W5QA 4OPJA 3NFAA 4QWEA 3KLEA 2YNHA 5HRPA 3AVAA 4Q45A 3NMAA 3JSMB 2Y1IA 4KV8B 4DG1A 3QETA 1NJXA 4KBIA 3G6YA 3G6VA 4OGEA 4O3PA 4F4WA 4XIUA 4E7KA 2R8KA 5HP1A 4H54A 4RZRA 4CK3A 2IS3A 5C24A 4LY7A 1BI4B 4O4GA 4N47A 4DQSA 1SL1A 4BDYA 2G8UA 4RG8A 1KLMB 4BE2A 4E19A 1HNVB 4XO0A 3FFIB 4AHCA 5J2NA 3KJVB 2J6TA 3OYHA 2WCXA 4WYWA 3MR3A 1XC9A 2BE2A 3AVGA 3KMQA 4MFBA 2ZE2A 3RWUA 1C1BB 3KK2B 4FK2A 1OS5A 2EC0A 2FLLA 3BSOA 4QAGA 2HHTA 3KNAA 4NLQA 3NAEA 4KFBB 2PYLA 3WNEA 1U4BA 4WE1A 2XO7A 4HUFA 3RB6A 4FJ7A 3M9NB 3IRXA 1I39A 3AVNA 2RPIA 4F3OA 1J5OA 4EBEA 3ZT1A 1S6PB 4B9UA 4LSLB 4I9LA 3H4DA 4O3NA 4BE0A 3AO5A 4C8OA 4KB1A 5KT2A 3OYIA 1FK9B 3FRZA 3Q8RB 3TABA 3AVCA 2BQ3A 5KFCA 3D0PA 4K4UA 3DLRA 5FRMA 4IH5A 1IKXB 3NAIA 3MTKA 3PW0A 4HTUA 5HBMA 3AO3A 2WOMB 5J2MB 3HM9A 2HHSA 3CDUA 1G15A 4E89A 2BR0A 1XWLA 1JLCB 4LQ9A 4TQSA 3MF5A 1C0UA 1SKSA 3KTQA 3CJ2A 4KAZA 2HAIA 3B6PA 1RTDA 2UVUA 1HYSA 1S9EB 2HMIA 5I42A 3UR0A 3GIKA 1JLQB 4OPKA 3O4NA 2C28A 4NYZA 5KG2A 3KJVA 3LP3A 2VG5B 4IFYA 1WSIA 3PZPA 4AHSA 5DG8A 5C5JA 5KFAA 2PY5A 3T1AA 4PY5A 5K14A 4FJGA 2RKIA 4F4XA 4PUOB 3RR8A 2W7OA 2HHWA 4M3ZA 2OPRA 3ZCMA 4OLBA 3CM6A 5JS1A 4HCBA 2BQUA 2P1JA 4M3UA 1CXUA 1QE1A 4B9NA 3RAXA 3KKRA 4FM2A 4H4OB 3DLGA 5F8IA 5C25A 1ZETA 1QE1B 4Q8EA 4DU1A 3L2UA 1JKHB 1DTTA 2IC3B 3KK3A 2RDIA 3T3FA 3RB3A 4NLYA 5DK5A 3OYLA 3EZ5A 4ZHRA 2A1SA 3A2FA 3D5MA 1RBVA 4PUOA 1HPZA 5KFPA 1BIZA 1VSLA 5DG7A 3CYMA 1XI1A 3VQCA 1LWEA 1JLFA 3RRHA 2R7YA 4LH5A 1SH3A 1RT7B 3DOLB 3NAHA 2W9BB 4NLTA 3K5OA 3CO9A 1LW2B 4IRCA 5J2QA 4DTNA 4CFCA 4R5PA 4ED6A 4O5BA 4LD0A 5KFKA 3MEDB 5DG9A 1NKBA 4NLVA 2WTFA 3I8DA 3QGIA 4CK1A 1QUVA 3NH1A 1RBRA 3RRGA 2UVWA 4KHMA 4DTMA 1S9GA 3V6DA 4CJPA 4ID5B 4TSXA 1EX4A 4O44A 3MAQA 3RTVA 3HT3A 2WK4A 4Q8FA 4JLHA 3IS9B 4ZMMA 2VG5A 2V9WA 4C8NA 3OLAA 3CFPA 4TXSA 4JUZA 1VSFA 5EDWA 2QK9A 1D0EA 3I5CA 1FK9A 2XCAA 2DPJA 3D45A 4CJQA 1MU2B 1VRUA 1S9EA 1NHUA 4J9PA 2AGOA 4CEFA 3E01A 2XY5A 2HB5A 3OYMA 4DWIA 4M45A 3OL6A 4K50A 3EPGA 1ZBIA 4K4TA 3K5NA 3CJ5A 2JGUA 3QERA 1C0TA 1TL3A 1UWBB 5HROA 2E9TA 5KGWA 2XGQA 4DFMA 4KE5A 4RNNA 3ULDA 5L1IA 4Z4HA 2XI3A 3HVAA 4NLOA 3VQQA 1TV6B 3QGHA 2OPSB 4TY9A 1TQLA 3C6UB 4E1NA 2VWJA 1XR6A 1EKEA 1VSEA 2HNZA 2IM0A 2PYJA 4DEZA 3SI8A 3TAEA 4KTZA 2DFHA 1QQCA 3OYGA 3B6OA 1RT4B 1YVFA 2AU0A 4KO0A 3KK2A 1RT4A 4CIGA 5L1JA 4OGCA 3PX0A 5KFXA 3HXMA 3QLHA 2WHOA 3NBPA 2W9CB 1T8EA 3HVWA 4AILC 2FBTA 4FZXC 1JIHA 3NF6A 1WSHA 3CIZA 3NF8A 3QEVA 2G8KA 4TN2A 2IM3A 4FLZA 3D28A 3BGRB 4QWDA 1MU2A 5DQGA 4CEDA 3O3GA 2BRLA 2YNGA 3DLKB 2AWZA 1U49A 1RT2B 1N48A 1QHTA 1CXQA 1RT3B 4J9OA 3OY9A 4DL3A 3ITHB 3MR5A 4M3TA 4N41A 2AJQA 3JSMA 4CHNA 3K2PA 3OS0A 1U48A 1S49A 2W42A 4B8AB 2D41A 3TQ1A 2IMWP 4J2DA 4DTPA 1S1XB 2ZQBA 1YTAA 3SNNA 2OZSA 5F8GA 4B3OA 5KFSA 3E01B 3WNGA 3N6LA 5EUHA 4FJKA 3AVFA 1RT3A 4CEEA 3OSNA 4BWMA 2YKMB 5KG1A 3VQ7A 1IKWA 4FVMA 3HO1A 4NCBA 3BQ0A 4RW6A 3TARA 4H4MA 4ID5A 2XHBA 3M9OB 1BIUA 5KFEA 1LV5A 1SUQB 4RUCA 3UQSA 1WSJA 3QESA 5KFUA 2D0AA 3VQDA 4ELUA 4O3SA 1HMVA 3IAYA 3KLHB 5KG4A 3VA0A 2W9CA 4M3XA 2ILYA 1TKZA 4E3SA 4KI4A 1LWCA 4FBTA 3NGIA 1EP4B 3TAMB 3DLHA 4K4YA 1QSLA 5F9LA 3AVJA 3AVMA 2HHXA 5L9XA 2AX0A 2OPRB 4KHWA 1JL2A 4B8CA 2G8IA 5K14B 3TAQA 4FJLA 4MKBA 1JLAA 4KAIA 1WAJA 4K4SA 4R0EA 1BCMA 1QAJA 3LZJA 4M3RA 4TQRA 2R2TA 1JLQA 3THVA 4KPYA 2KTQA 2OPPA 1HYSB 2ITGA 1RTDB 3T5JA 1UOCA 1RBSA 4DTRA 4WZMA 3SUQA 3NCIA 2XC9A 1T7PA 2ASLA 1TKDA 3H5XA 1NK5A 2FVRA 3QNOA 1F21A 1R0AA 4BE1A 3QO9A 3BDPA 4CJRA 1L3SA 1N5YA 1NJWA 1S97A 3V6JA 5FRNA 3H5SA 4K8ZA 3CJ0A 1TL1B 3OHAA 3O4QA 3UIQA 2F8SA 1TL3B 4DLGA 5CZ1A 3DRRA 4ZPBA 3IG1A 1KVAA 3SZ2A 1RTIA 4J9QA 1JL1A 1YT3A 4CERA 1RA6A 1KLNA 1S5JA 1RTIB 3V1QA 3ZSRA 2VWKA 2VG7A 3OS2A 1IKXA 4WFYA 5HLFA 5J2QB 3LAKA 3NGYA 4ED2A 4KHRA 2RF2A 4K4XA 1LW2A 4DTOA 3OL8A 3KK1B 1CZBA 4BDZA 4MFBB 4KB7A 2QXFA 4U7CA 4YR0A 2IM1A 2XY7A 3H4BA 2FLNA 2VA3A 2QE5A 3KD5E 3I0RA 2ATQA 5KFVA 3KOAA 2G8WA 4ELVA 1RT5B 4XPCA 1JLBA 2JEJA 1J5OB 3DRPB 5EU7A 3NE6A 1TK5A 1HPZB 2VA2A 1X1PA 2FVSA 4ZHRB 4C8LA 3ZT2A 4F4YA 5KFWA 3MEDA 4ZVEA 1BCOA 5KG0A 4KTWA 5HP1B 4R5PB 2HW3A 1RDRA 3NF9A 1B92A 2OPPB 2V4RA 1NK4A 3L8BA 1LWCB 4ZP6A 3K59A 3VQ5A 2QKKA 2O5DA 3SPZA 5DQIA 4IG0A 1C0MA 3IGVA 4Q43A 3LPUA 5DQHA 3VQ4A 1GOBA 3FSIA 3KMSA 4NYNA 3CDWA 2RN2A 2WB4A 3DI6B 4FJJA 4LSNA 3LP0A 4CHQA 1S0OA 5F8HA 3S3NA 3N6MA 3QINA 3LANA 4CFAA 2FJVA 1RT1A 4Q44A 2CKWA 3HYFA 2YHBA 3CJ4A 4DSJA 2IJNA 4IOBA 1TK0A 3BSNA 4GC6A 2EHGA 3QIPB 1S1UB 3H5YA 4Y2CA 3LP2B 1J54A 1CSJA 1XR7A 4ECUA 3L2WA 3S3MA 4FM0A 4DSEA 1SKWA 1VSIA 2BANA 2XY8A 1DTQA 1WAFA 1ASWA 4CHZA 4ZVHA 4EP5A 3PO5A 5HBMB 3ISNC 4TY8B 4CFBA 1WSFA 3P83D 3I0RB 4R8UA 3OYEA 3HPHA 4CIFA 5SWMA 3TWHA 3U6FA 4ECXA 1LWFB 3FQLA 3HPOA 3OL7A 5C42A 4OVLA 3KHLA 3ZSQA 5T7BA 3IGNA 1X9WA 5DGBA 4FLWA 2F96A 4W5NA 4DFPA 3CFOA 1HQEA 1TVRB 2I5JB 3IRXB 4HUGA 4KKOA 4FJXA 2YNIB 5F8NA 1VK0A 2GUIA 3OJUA 3LZIA 1RAJA 3ITHA 1FKPA 3SQ4A 3ZSVA 4EBDA 2BQRA 3DMJB 3AA4A 3ICLA 1RDDA 2YNGB 3DLKA 4YQWA 4O55A 4I7FA 4F4KA 3OHBA 4DU4A 1SL0A 3I5AA 4X2BA 4NCGA 1B9DA 3DLEA 2JC0A 2J6SA 3S9HA 3SJJA 1JXBA 2XRIA 1FXXA 1VRTA 4QWBA 5CY4A 4DU3A 5C24B 4ID1A 4WE1B 1NKEA 2A1RA 4DSLA 2Y1JA 2G8VA 4CJVA 1EP4A 4CCHA 1SH2A 1JLEB 2XI2A 5EWFA 2ZE2B 2WRMA 3KD1E 3PHEA 1KCFA 2GIQA 4RU9A 1Z4UA 3DDKA 1HQEB 1TVRA 1K1SA 1U09A 5KFZA 1RTHB 1C2PA 5DGAA 4IRKA 4NCGB 2IAJA 1IO2A 5KFTA 4FBUA 1EXQA 1REVA 4CEBA 2IM2A 3QEPA 1C1CB 1HNIB 3MEEA 1WN7A 2D3ZA 1RNHA 4CGJA 2WONA 1RT6A 2YKMA 1NNDA 3Q8QB 3KLFA 4ECTA 1IG9A 1EETA 1Z26A 2DPIA 1HYVA 1TKZB 3MFHA 4NRUA 4KKOB 3I0SB 3G10A 2C2RA 3BQ1A 2YNHB 1D9DA 4K4ZA 3G6XA 2R2SA 4CHPA 1S1TB 1A5XA 3L3VA 3V1OA 5KFBA 3PR5B 2QKBA 4WZQA 4DSIA 4HCCA 4MIAA 3QNNA 4CF2A 1NK7A 1NKCA 4MK7A 4ZTFA 1RT1B 3L2QA 4EEYA 4KSEB 4DQPA 5KRSA 5J1EA 4N76A 1JLFB 1LWEB 3K57A 3IS9A 3VN5A 4DSFA 1B9FA 4CEOA 4CF8A 4NLUA 3T19A 2FJXA 4ED1A 2ALZA 3DRSB 4PA1A 3OJSA 3PW4A 4DS5A 4F4ZA 5DMRA 2IAJB 3VQPA 1JLGA 2JC1A 3M9MB 5FDLA 1VSJA 1TKXB 4AHVA 4CJTA 1JXLA 3TR8A 2DY4A 1QAIA 4CHYA 3UPFA 1S1TA 1NOZA 3DM2A 3ISND 3SQ0A 2W8KA 1D5AA 4IKFA 1GX6A 4HYKA 4FS1A 3DOLA 3NKYA 1KRPA 2OPQB 2R8IA 3S3OA 4MQ3A 3GV5B 4XPEA 3WNFA 3H5UA 5KI6A 4NLPA 4IDKA 4IR1A 4ZP9A 3ZSOA 4CEQA 2XY6A 4IKAA 4E7HA 3QIDA 1C1CA 4EZ6A 4Y1CA 3QZ8A 2VG6A 4CGHA 3MR2A 2JEFA 1ZTWA 3HPGA 4JRQA 3C6UA 4J9SA 4HUEA 4E0DA 2DFFA 3ZSZA 2FC0A 2J6UA 4I7FB 4ZVFA 4H4OA 4EBCA 5KFHA 1A5WA 4PQUA 4IQXA 3SI6A 3RBDA 3CWJA 2W7PA 3QZ7A 1J53A 4Y2AA 5F8MA 3PUFA 1WLJA 1RYSA 2X6SA 4NLXA 2KZZA 2UVVA 4NRTA 4QWAA 4EYHB 3L3UA 3V9XA 4CJ3A 1T03B 4FCYA 2ILZA 3P5JA 4YNQA 5FROA 1ZBLA 3TANA 3DRPA 4NYFA 1T05B 2BDPA 1KHVA 3AVIA 4Z4IA 4DFKA 1S1VA 3EZUA 2R8JA 1RT5A 4IFYB 4JV2A 3HP9A 2LSNA 3SYZA 4B08A 4CGIA 3HL8A 5KT4A 4MK8A 4DS4A 1X9MA 5I42B 3V9ZA 4DLEA 1Q9XA 4FJNA 2X78A 2RF2B 3QEIA 2OZMA 3QO9B 3NH2A 4FJMA 4L8RB 4MKAA 3PV8A 3DOKA 5I3UB 4CK2A 1DTQB 3HVRA 4W5TA 1KVBA 4DQRA 2I5JA 1Q8IA 5J2MA 1RBTA 5HRSA 1A5VA 1BHLA 3HVTA 2IBKA 4FK0A 1C6VA 4GW6A 3TVKA 4M3WA 4HVJA 1TL1A 2D7SA 1S4FA 1GOAA 1MMLA 4JV1A 2B5JB 3CM5A 4KB0A 4J2EA 4C8KA 2HNYA 3KHGA 1S1WB 3V9SA 4LSNB 3DI6A 4IG3B 4E7IA 3AV9A 4M41A 5EWEA 3PO4A 4RNMA 1S6QB 5KFRA 4ZPDA 4DTXA 3ZSXA 4TYAA 1ASVA 3FQKA 4FJ9A 4CJ4A 3GIJA 4FS2A 3QIPA 3L2RA 1RDCA 4ICLB 5CZ2A 2D3UA 4OKJA 2C22A 4Y34A 3GQCA 5KFDA 2D5RA 1RT7A 4HKQA 2Q3SA 4YP3A 4Q0BB 1BQMA 4DL2A 3V4IA 1HRHA 4DTJA 4B9VA 1GX5A 1WSEA 2Z1IA 2HHVA 1XHXA 1JLAB 4U6PA 3FDSA 2E9ZA 1KLMA 5DLGA 4DQQA 4B9MA 4DF8A 3OLBA 1TKTB 3OL9A 4J9RA 2AGPA 4RW7B 4URSA 3Q8PB 3SCXA 2GIRA 4G3IA 3PX4A 1IKWB 1NOYA 4KHSA 2V4QA 1W0HA 1Z25A 3MXIA 2XCPA 1S1WA 2KFNA 3TI0A 4Z4FA 3GILA 4UQGA 4M42A 4IBNA 4OL8A 1D8YA 3DLGB
chains in the Genus database with same CATH superfamily
1UZDA 2WBMA 4BGAA 2ZJRQ 4AQYF 2PZSA 2IYIA 5FJ4A 3M7VA 4WIIA 4B1XB 3J7AP 1S48A 2GC8A 3VVTA 3M8QB 2KT3A 3P38A 2OYQA 4NLGA 3O3FA 3OYJA 3QAEA 4CJSA 2ZITA 2AYGA 3KLIA 3HD1A 2PFUA 3DRRB 5HMYA 2DNGA 3VQSA 1DLOB 1GXUA 2YNFB 4CLYA 3ZX0A 4LSZB 3SV4A 3PJXA 1DKGD 1B4SA 2KW4A 3WXLA 4UOHA 4ZLJA 2UXCK 2YHAA 2YKNA 3TO8A 3PSIA 2OP5A 5KT3A 1FCAA 2F65A 4A2BA 3AVKA 3FCHA 1BGXT 1MA9B 2DD8S 1RU2A 2Q79A 2CPIA 4IZ9A 3A5OC 1Y5IB 4ECQA 4J9LA 3QLHB 4PWWA 4ED3A 2BZ2A 2IRXA 1VQ9S 1CZAN 4CJEA 1IBLK 2E2NA 1KTQA 4A8QA 2HQFA 1OIAA 2IVMA 2DEIA 3KWMA 3EVMA 3DXMA 1HBUB 1VRTB 5J2NB 2APOA 2B43A 1FKOB 1FFWB 4WP3A 1WUAA 5JS2A 3RMAA 1N5VA 3R2DJ 5E33A 1SQGA 4CLZA 2VC1A 1FT8A 3M2RA 5G4DA 4A61A 2Q31A 4J2AA 1SJFA 1WWHA 2VBXA 2Q97A 2ZWHA 5HMWA 4N8OA 2FLPA 4ED4A 2CPEA 1S0MA 4C3MA 3ZTSA 3QRPA 4DV1J 3NF7A 4Z0UA 3K5MA 4F3MA 3PYEA 5LY3A 2UUWA 3P4UB 3NMUA 1BISA 2CJQA 1FDDA 5M1QA 4TNOA 4ILLA 2P9KA 2BVZA 4JI0K 3PHTA 5H9EK 4C3LA 3OXFA 3O3HA 4IDKB 3ETMA 2NUHA 3ENBA 5K8PA 4H8KA 1DLOA 4P75A 3RMDA 1GOCA 3MEGB 4ZVRB 1W2BM 3TJ9A 1HA1A 4F50A 3GV8B 3ALYA 2I0XA 2Y0BB 3V9UA 2C2EA 3POTA 3MN6A 5M2PA 1K8AT 4K2XA 4QWCA 3PR4A 3K5LA 2E6LA 1WKKA 4FLVA 3BDEA 1EETB 4GMKA 2H5JB 1RCHA 1U04A 1VQ5N 4U8YA 3R1LA 2NXEA 1RTJB 3I55S 5JXSA 1N54B 3ZZ0A 1HNIA 2X1FA 3K89A 4K5SA 4F9OA 1NGCA 5KG3A 3BQ2A 4LIWA 2KU7A 1AW0A 2ATCB 3EYZA 4CLTA 5GADP 3K0SA 1GLEG 4EO8A 4A8MP 4HHJA 4K0KK 2C3OA 3HHKA 1N33F 4OZ2A 5JVHQ 1T94A 3B4MA 1EX8A 2E7WA 5JLHA 4OZ1A 4FXWA 4OYPA 2BX6A 4MJKA 3TVYA 2E5JA 4URQU 1QSSA 3ZZOA 1REVB 3GIIA 2RKIB 3IR5B 2R7SA 1TKTA 1KQSR 2RILA 5BN9A 3RBEA 4C8YA 3LQVA 2RDJA 3DYAA 3B8HA 3O3LA 3G0ZA 4MLEA 1L3TA 4G1PA 4F2RA 2OPSA 3ZSYA 3IDHA 4G1IA 4PQAA 2E66A 4FPRA 4CF1A 2KL8A 2Z1GA 4YY3F 5CYQA 3W2WB 5FIIA 3TEGA 2CDRB 2DGOA 2EG1A 2ZFHA 4K4WA 8RUCA 3JYTB 5HROB 4KTQA 1RYRA 4HR2A 4BWJA 1VQ4N 1H2VZ 2OH2A 2BKOA 3VQBA 3VGKA 2O8CA 2QEXN 1B70B 5DM7L 3TUZC 4CE9A 2UUTA 5AZIA 2YBVA 3AVLA 2GVZA 3U1LA 1VSHA 5C42B 2D3O1 2ZD1A 3J81O 2I2YA 3UE5A 3CSKA 4DMNA 3SDEB 2G1DA 2AYBA 2DTJA 2Z2ZA 3KLIB 4CTAA 5BPMA 2JLFA 5J1PA 2IVYA 1M5VC 1SL2A 4LF4K 1T03A 4PWDB 2LQ8A 4J8FA 3VEOA 3A8KA 4L3NA 5L9NA 5ETVA 1IKVB 3MECA 1BA1A 4QPXA 2QMUB 3H2VE 5C2DA 4ID8A 3NCRA 1BL3A 1FX2A 4M5GA 2W8LA 5HRNA 4YMEA 3T6BA 4HDGA 4WXWA 4BREA 5B0FA 1SJ3P 2UUBF 5HATA 5FD1A 3HMJG 5AJ3F 5D8HB 2A3ZA 1IBLJ 1DTTB 4JKFA 2RNEA 4WKRA 1W9HA 3QJJA 4QW9A 2VPYB 3GB0A 3V9WA 2A5XA 4YN3B 2XLIA 3UD3P 5A2QY 1OH5A 3HSGA 1KFSA 4M5DB 3CD0A 4GVLA 4OX9K 4OX9F 3AO1A 4IG0B 3P96A 1B3TA 4A8FA 1NK8A 1E4FT 4NXNJ 3MMCB 4J9NA 5KT5A 3VENA 3KLEB 1RLDA 3HDSA 3TVZA 2O3DA 3RAMA 4X66F 5HL7L 4OJGA 5KG6A 2CJAA 1T11A 2Y8WA 5LT5A 3CCEN 3U3GA 3QEWA 3W62A 3GFZA 4RL1A 2FSJA 5CAAA 2D1CA 2H9ZA 3M8RA 3QEXA 1SKRA 1ZH5A 5KT6A 2DHSA 2EFVA 4DV0F 2ZD1B 3BO3A 1JJCB 5KFGA 1VSDA 3P5TL 4ILRA 4OJHA 4PRFA 3ZZRA 4DR6F 1NJYA 1ZBHA 4IFEA 1IWGA 2MKCA 3R7BB 3FZLA 3NHGA 4IOCQ 3AA5X 3C15B 1U47A 4X65K 3MTJA 4PXEA 3V6KA 1R31A 3MM5B 3DOKB 3HHLB 1ASUA 4AL7A 3HP6A 3KLVA 4KHUA 2QV6A 5FPNA 3KLFB 1YBAA 3PXGa 5E41A 3OR1A 4JN4A 1HUXA 1OH6A 2MJNA 5AE2A 4RW8A 3VEVA 3CMAN 1HX1A 3RBZA 4A8KA 5KFIA 1XNRK 1Y5LB 3M30B 2VDIA 4YY3J 3AQPA 2VFUA 2W01A 5F0UA 4EMDA 2JFDA 2G4BA 4QU7A 4QCLA 1S1VB 3DLEB 3TU5A 1XMBA 4NLDA 3FBEA 1N5SA 4GKJJ 2GHVC 3ZT0A 3NBPB 2BABA 1T9VA 4A47A 1YJUA 3IR7B 2RQKA 4CECA 2K06A 1SB6A 1VK3A 2F9JA 5AE3A 2ZM6F 3BPDA 4WPAA 5MLCV 3LWMA 2JLEA 3G8QA 3OYBA 3IP0A 3LA0A 1SH0A 2YHWA 1TL7A 4LIRA 3OVAA 4KHYA 1N36J 2Z4PA 3RBXA 3QIOA 4ZLLA 1WC6A 4DCJB 1HMVB 4PPDA 3F73A 2EXUA 3DYAB 4LF8K 2W7AA 5A6PA 1FKOA 3N0VA 3D6RA 1RHUB 2F8TA 2IFXA 2VYPA 4DR3K 1N88A 3H08A 4OX6A 3W61A 2YQ3A 2E5LK 4TLRA 1EQYA 3TUPA 1WHXA 4M95A 4KRFA 1X5TA 2F63A 2ZUGA 1I3AA 5T41A 4FWOA 9RUBA 4CJKA 5IT9O 4DBQA 2GHWA 8AT1B 1QSYA 1C0TB 4UUXA 4GVMA 3O9RA 1RBUA 4OIXA 5DZ7A 4BY9C 1HLUA 4CH0S 4EZ9A 4ECSA 4C9DA 4RWXA 5KPZA 3WUHA 1Q8BA 4U7UD 4CJ5A 2O4GA 2BKPA 1NDKA 1HJRA 2F5GA 3CJ3A 1XUPO 3WBZA 3MEGA 1O51A 2C42A 1NAQA 4EO6A 3RMBA 1HWKA 2CPYA 1X5SA 1RILA 2QX0A 4OLAA 1HIYA 2GAGC 2AKWB 3OBWA 1UFKA 4NLSA 2LXIA 2K7KA 4D3HA 4X4VA 4L3QA 1N6QA 1NSQA 4OKEA 3U4LA 3VQAA 2E1PA 4JS4A 3V6HA 2GUPA 2PEHA 2RU3A 3SSQA 4P72A 5AQSA 5A8KA 2EKNA 4EAHD 5HRPA 2MQMA 3MAAB 2DGVA 3AY0A 2WVFA 4MDAA 4X62K 2VODA 4ZVQB 1FW6A 1GFWB 5CZVA 5HP1A 4H54A 1BUPA 4FO0A 3L4BC 4KGMA 1FRHA 4OV1A 4LY7A 4M7YA 1HNXK 3NGUA 4KHPJ 5HSPA 2BH1A 3NNHA 4DQSA 1SL1A 4RG8A 1V5IB 1MWYA 1V5VA 3QBWA 1R6YA 3KVGA 1KONA 2J6TA 1TFWA 4BROA 2CPFA 3MR3A 3D0HE 2ZE2A 4DV2K 1K9MO 1T3OA 3QMQA 3CCMS 2V63A 2HHTA 2R7TA 2IIRA 3P8BB 1VLOA 4NLQA 2PYLA 2KN4A 2F4FA 3WNEA 3CQYA 4WE1A 4HUFA 3RB6A 3IRXA 1E4GT 4F3OA 4USIA 3D9BA 3H2UB 4JOUA 2HGLA 4B17A 5LM7E 4WQ5A 1S6PB 3CCVN 3NRBA 4I1TA 3H4DA 3SDEA 2DNNA 4IO9L 3ILLA 2VFTA 5F2RA 4KB1A 1XMOJ 3A5MC 3OYIA 2NRRA 3LH2S 2HFVA 1YG0A 2BQ3A 4HTUA 4LF4J 3B82A 3AO3A 4P7VA 1F5CA 5I3QA 2POKA 2XM3A 4JI6J 4NYOA 4RWTA 2VQEK 4Z7CA 1RJJA 2HAIA 3B6PA 4KGVB 1RTDA 1HYSA 1FA0A 1WORA 3TSUA 2A10A 5I42A 1JLQB 4NYZA 2JVOA 3EVOA 3KJVA 3LP3A 2VG5B 3OTEA 4LRFA 5JVGL 3PZPA 4O8KA 5DG8A 4I0WA 5AQVA 4LT6A 4FJGA 2PN6A 2NS1B 2MQLA 3UVJA 3ZCMA 1S0VA 3HOSA 4JI7K 1NGEA 1P9QC 1NGJA 4OLBA 5A76A 4Y2IA 2P1JA 2NPFA 3GPAA 3CJ8A 2KXNB 1CXUA 4FSVA 2HRUA 4B9NA 3D2FB 3C8YA 1LEOA 1CJUA 1N36K 3GZ7A 1NU0A 3MN7A 5GMKa 3L2UA 4FZVA 4OYBA 4Z37A 1SKUB 5M1KA 2K8GA 2CGLA 4A5BA 2RB7A 4JI8F 3D5MA 4GO5X 5KFPA 1BIZA 2Z8QA 2J0XA 1NGFA 1YJ9N 1LWEA 4QS9A 2PAVA 3FZFA 1NZ8A 1JLFA 2NPIA 1VQLN 2YWHA 2COLA 1SH3A 1RT7B 3J8AA 5HJYA 1YQHA 4WF9Q 1LW2B 4IRCA 4LD0A 5KFKA 3MEDB 4E1JA 4XH5A 3BYRA 2NCKL 1GK8A 2XS5A 2NRZA 2PI4A 1EX4A 3MAQA 4BR5A 3M2UB 2ZH8A 4Q8FA 4ZMMA 3HHLD 2GWKA 4OHVA 2B8QA 1WJ9A 3OLAA 2I6WA 5M2UA 1UEUA 2MZRA 5EDWA 2XCAA 1HQ2A 4CJQA 4ZVTB 3MURP 4Y0WA 4J9PA 1CPZA 3A8YA 1XERA 2B7BB 4DJBA 2J8SA 4DWIA 2BTFA 2CQHA 4FWPA 2IMOA 2DNKA 1FESA 4UF4A 1ZBIA 4DMZA 3HHNB 2JGUA 1C0TA 3DU6A 2XMTA 2QM1A 3OTOF 5AFUH 4OHZA 3HVAA 4PCQA 1UFLA 3Q0AA 3VQQA 2YCHA 2KG1A 5D77A 2ZWOA 1Q4RA 1VSEA 3GFHA 2ZNZA 1HW9A 3NVKA 3R7SB 3ZZUA 4CO2A 3SI8A 2JFKA 2UUAJ 2IVPA 4NPOA 4KTZA 3TAEA 1IBMJ 1WOPA 1WHVA 3FEYB 2V8VA 5ITHA 1RT4B 1Q7YO 4NWBA 4OI1A 3CJSA 3HXMA 1NWKA 2NNWA 3NBPA 2FBTA 3CO0P 1WSHA 3L9ZA 3A5NC 2FJDB 1LNQA 2UV8A 4FLZA 2IVOA 3D28A 1MU2A 3J80U 4ES1A 3DLKB 4ISEA 1UW9A 4FWQA 1RT2B 1XQIA 3M05A 1T44A 1N48A 2WAQD 3HFZB 4M5IA 4MT1A 3OY9A 2QA2A 4DR7J 4AT1B 1EIYB 3UD4P 3K2PA 3TQEA 1DGKN 3BN7A 1HNZF 1U48A 1VQLS 2D41A 4QR1A 4DTPA 2ZQBA 1HLWA 2ZH6A 1YTAA 3SNNA 1TL5A 4OHXA 5AQHA 2QWPA 3AD9C 1TUYA 2UXCJ 4JI5F 3WNGA 2YH0A 3N6LA 2D3OR 1G6BA 4LVNP 4DX6A 1FI4A 3CCVS 5EXWA 2HEKA 5ETNA 3HO1A 4LF8F 2VICA 3D1QA 1MWKA 3F44A 4M5DA 5KFEA 4CD1A 1CJKB 2QYGA 3Q23A 1HMVA 3IAYA 1VQ5S 5KG4A 4P52A 3VA0A 2W9CA 4E3SA 1LWCA 3OVBA 2D74B 3NGIA 3GTYX 2LEBA 2NZ4A 5AXLA 4JI5J 3MX2A 3DLHA 3KJNB 2BW2A 2HHXA 4WJBA 2JH3A 3GONA 1REGX 5C2GA 2OPRB 4KHWA 2DEJA 2W4DA 2MSSA 4CIOA 3D68A 2UUCF 4CD3A 2G8IA 5GAEU 1U24A 4RO0A 4EWTA 3LGNA 4MKBA 4USWA 1NMNA 3G96A 3ZEUB 3ZX2A 3WZ0A 1F3FA 1S99A 1N34K 4TQRA 3SCJE 2FIUA 4DU8A 2W2MP 4Y28C 2RH3A 3PRBA 3T5JA 1S79A 3GCXP 4BQLA 1XC3A 3SUQA 3O9TA 2CG8A 3I4HX 1T9WA 1VR6A 4B3SF 2OANA 1VAZA 2E8AA 5DDQC 3GL1A 1F21A 2ACYA 3ZTQA 4B1YB 5AQFA 4BE1A 2E20A 3QO9A 1FDAA 1ZPVA 2C3PA 1RKJA 1RABB 2UUCJ 2CH6A 3V2UC 3V6JA 5FRNA 3QJPA 3W2VA 3EZWA 2FHJA 3HCXA 4K8ZA 2Z2MA 2UP1A 2E5IA 2DNRA 3CJ0A 3UIQA 2IRYA 4CRJA 1PAUB 4AD6A 1RZMA 3IG1A 3P6YC 3UKUB 2IPOB 3BKUA 3O80A 2KO1A 4CYUB 4DR2F 2P9UA 1S5JA 2VG7A 1NDPA 3OS2A 2M0GB 1IJEB 4WFYA 1IKXA 3PRDA 4X4QA 3OL8A 1SJ4P 2EFPA 1T9TA 4YUDA 2CQBA 2QE5A 3KOAA 2G8WA 2R7RA 1ZC6A 2HSEB 1U8WA 2JEJA 1J5OB 4Y0FA 4L6V3 1TK5A 1HPZB 2VA2A 1VJQA 1VBZA 4P73A 1OSCA 5BR8K 4F4YA 1WEZA 4LF1A 1AT1B 4KTWA 4R5PB 4WF9L 2HW3A 1RDRA 1GAOA 2OPPB 1NK4A 2P9GA 5IT9Y 2YX1A 2CJYB 3EJMA 1LWCB 1FD2A 3ILJA 1YBTA 4DPYA 3K59A 5H9FK 4NXMK 3VQ5A 1F5BA 4ZOSA 5DQIA 2NR0A 3UDEA 4CH7A 1X60A 4LF2A 4JKEA 1ESVA 2E2PA 2CNLB 1J6ZA 1GLDG 1KAYA 3M3ZA 4DR1K 5DQHA 4F04B 2F8HA 2P2CB 4ZS6A 2RN2A 1F6TA 3AGKA 4FJJA 4LSNA 3EE3A 4IXCA 3HTVA 3MMBB 1Q16B 2ZZTA 5F8HA 3S3NA 3LANA 1H38A 5F0XA 3BZKA 3VAHA 3D2FA 2PGCA 1R27B 3JXUA 2NLXA 1WEXA 2AHOB 4WP8A 2P9PB 4IOBA 4FWKA 1ITPA 3NVMA 4DR5J 2BM0A 3GIRA 4WP9A 3FBCA 2RQMA 3NXZA 5M1NA 3LP2B 4FVCA 1CSJA 5ETSA 1SKWA 3RU0A 1YBUA 4A8OA 4C98A 2XY8A 3MK6A 1DTQA 4CHZA 1UAWA 4ZVHA 4F0MA 3WXIA 4RX6A 4X4SA 1CQNA 5AQZA 4R8UA 3M8WA 2PE8A 2AZ1A 1B64A 1HI0P 3OYEA 4CIFA 2W6LA 3NGTA 2M2BA 2X1AA 4JP8A 2F4VF 4P7TA 3VAFA 2DHHA 4BS2A 1WG5A 1IWAA 2KRBA 3BGLA 4FYXB 3GWCA 4W5NA 3IFEA 3CFOA 1HQEA 4DV6J 5DO2A 4BC9A 5F8NA 1XBWA 4M8LA 3Q7CA 4JHDB 3SK3A 2LU1A 1FKPA 1U1KA 4K25A 3IM9A 3DMJB 3CJCA 1WC4A 4HI2A 3N5BA 3AH6A 2YNGB 1Q18A 1Z05A 2VQFJ 4C4WA 2C2MB 1BWVA 3I5AA 3CNQP 4X2BA 3ADAC 2J6SA 4CZEA 3SJJA 3CCSN 1JXBA 5H9FJ 2Q1LA 3DXSX 4ID1A 4WE1B 1S77D 2JJ4D 1P90A 2CWKA 4DSLA 1T3VA 2Y1JA 4NO7A 3THXB 1YAGA 4CCHA 2EKYA 1SH2A 3ZTPA 3HSZA 5E3AA 3NY0A 3KD1E 2DNLA 1OH7A 4CO4A 3GSIA 1H74A 2LDYA 2KXFA 1K1SA 2PC6A 1XMQK 1RTHB 1WKLA 5LXRA 2QIFA 3SBMA 5DGAA 4NCGB 1IO2A 4PXBA 4JI8J 4USHA 3RW7A 1T9YA 3SBTA 2WONA 2YTCA 3CJKA 4E8UA 5D15A 1NNDA 2YWGA 4OI4A 4NYPA 1L3KA 1EETA 1Z26A 1W26A 1XMQJ 3C7NA 4NRUA 4KKOB 3I0SB 1D9DA 4K4ZA 2JWKA 4USTA 2QFJA 1KS2A 5KFBA 4DSIA 3TPQA 1IN0A 4MK7A 3C7NB 1A0OB 1AZSA 4FPBA 4FF2A 3L2QA 2XS2A 3AOCA 5KRSA 4KHPK 4DSFA 1U2RA 2NRVA 4CF8A 2RUSA 4NLUA 3FZHA 2ALZA 4OJ1A 2M4MA 2GQQA 3OJSA 3PW4A 1O0PA 1SVDA 2IAJB 2YWWA 1JLGA 4G9ZA 3POTB 4LR7A 1Y10A 3TR8A 3FSYA 2DY4A 1QAIA 2LECA 2B4OA 2B4UA 1N33K 2YWKA 3JQMA 3D6TB 1GX6A 1WF0A 4FS1A 3NS7B 3IWLA 3FJ2A 3CJTA 4NE9C 4LFBK 2YXLA 5FPDA 3GV5B 3NMRA 4LF5J 3H5UA 4J9VA 4ZP9A 5DRKA 4CEQA 4ZPTR 2PFFB 3EN9A 4J7CA 1VMBA 2FHKA 4JRQA 3C6UA 1OVYA 2Z2LA 2IYGA 3O44A 3MDQA 3ZSZA 3AD8C 3DGPB 2B4PA 5GINA 2RU9A 3FCWA 1X7VA 4DV4F 4DV4K 5KFHA 4WYBA 3SI6A 2FY1A 4NASA 3RBDA 3CWJA 3QZ7A 2X6SA 4QWAA 4EYHB 4W92B 2E1RA 3M2RB 4KH6A 3GJQB 2QLFB 4IWVA 2P9SA 3W9IA 2ILZA 3KUEA 4OZ5A 2W4PA 3P5JA 4YNQA 5FROA 2BA9A 2KT2A 1Y9OA 3DRPA 3AXMA 4KC5A 1AFIA 4JYAF 4DFKA 1DBDA 2CQDA 1OJ4A 1WDDA 4QIVA 1WBBA 1I51B 2QLBB 2EFOA 2O8EB 4CGIA 1U6ZA 1CQMA 1UP1A 4DS4A 3I82A 4FYYB 2G0CA 2X78A 1UVKA 1S72S 3QEIA 3ZX3A 3QO9B 4FJMA 3NOCA 3DOKA 3HVRA 4CK2A 4IOAL 1KVBA 3S1TA 1FE0A 3WXMB 1Q8IA 4CTAB 3HX9A 1SC4B 1BHNA 1H7WA 5HRSA 1BHLA 2RRNA 2IBKA 4A8YA 4M3WA 4HVJA 2D7SA 3CTRA 3CJ1A 1IG8A 1U1OA 2W2PP 4DR5K 2B5JB 3CM5A 2ZC3A 2XNQA 2HNYA 1NRKA 5E0OA 3V9SA 4E7IA 3AV9A 5EWEA 4GNIA 3KK7A 3D3BJ 4GV9A 2XG8A 4DTXA 3ZSXA 4TYAA 2V4JB 4FJ9A 3UDVA 3BZCA 3BKFA 1AROP 1HW8A 2H3EB 3RSEB 5I3PA 3J7YU 1RDCA 4X4PA 3AA8A 5CZ2A 1U1PA 3VETA 2C22A 1HL6A 4Y34A 2F7VA 1MLAA 5KFDA 3A5LC 2Q3SA 4YP3A 1HRHA 1FTRA 1DQ8A 1GX5A 2CQ4A 2Z1IA 1SJ1A 1XHXA 2B3TB 2J8AA 5K9FA 1MROA 4DQQA 4B9MA 3EMTA 1TKTB 1KVIA 3CETA 3FZMA 4J9RA 1X0FA 4RW7B 4URSA 3M6VA 3CIPA 1FRJA 3JTPA 2K2PA 4G3IA 3PX4A 4UQTA 5KQ8A 2G2ZA 2KFNA 3GG1A 3TI0A 1CC8A 2XZDB 1YHQN 1D8YA 3DLGB 2B5JA 1RQ0A 4NLBA 3HOTA 4ECYA 3CD5A 1R7IA 5K8NA 4LF9F 3KDOA 4H0OA 3KLHA 3DM2B 2QA4N 2JNJA 2V8PA 2E7VA 4HWIA 5HQ8A 2AP1A 2MKSA 5AE1A 1NNEA 3DRSA 4C1NI 2V68A 1K73O 1XMQF 4CJWA 1ELOA 2XMMA 3E66A 4UY85 3BPSP 3L09A 4CI6A 3HZ6A 2WW8A 4FYDA 3LDOA 3FZKA 4RBVA 3VQ8A 3QT8A 4LF5F 5JUMA 3P1GA 2Z1JA 3MAHA 5GAGI 2MGZB 1S1XA 1X4GA 1YTUA 2CZ4A 2E5GA 1VQYA 3SPYA 2CJBA 1TGOA 1NM2A 1R8HA 4AH9A 2B6AB 4BGBA 4AQYK 4X66J 3J81j 3LP1B 1HWIA 5B7WA 4DR6J 4LBHA 1YRXA 2FBYA 3D6FB 3LDPA 3MM6B 2BE2B 4YB5A 4J9MA 1LAVA 2HWHA 4B9TA 2UXDJ 5AZJB 2MB0B 2OIHA 1MN9A 4PKDB 4LSLA 3OBYA 3RMCA 1ULRA 2P9IA 4BRLA 1IR1A 2P9LB 4U8VA 4FW1A 1Q53A 4O0IA 5K8OA 4DR4F 2HWIA 3HRGA 1HWLA 1R8CA 4K0KF 1YKWA 1NEEA 3JYTA 1VJWA 2VFSA 3I4PA 2F4VK 3VQTA 4KO0B 5AQRA 1P27B 4OMFG 4KV8A 5KFNA 3HSDA 1HBOB 2GV1A 5HRRA 1X4CA 3B8AX 3FFIA 5HJXA 2MZ1A 2ZJPL 1UA0A 3O5TB 4IFVB 1UA1A 1RE1B 5KFJA 3JS9A 2KG0A 2I7PA 2VG6B 2ETJA 2MKJA 4O4GB 2H4YB 3MR7A 1LWFA 4KBOA 4DKWA 3PACA 4K7QA 1DY3A 5JJBA 5J1EB 1FKPB 4IH6A 2QSWA 2MQQA 4I69A 2GA7A 3ZT4A 1EKSA 5KFQA 1PBUA 2QWOA 1FRIA 2HQCA 4B3MJ 3MMVA 4DSKA 1FD8A 4JV0A 3NGDA 3OHRA 5M1OA 5M1PA 1ILYA 3CMAS 4ZIVA 5GIPA 4L75A 3UO0A 4DHYA 4QIGA 5AQNA 1CLQA 3SFUA 3G4SS 4DR3F 3LPTA 3BSCA 3W3DA 4OHWA 4QYZK 3W9JA 1NMDA 4IJNA 1FRMA 1FJ7A 1RBOB 5HVHA 2GELA 4IO9Q 4ENOA 2ZKUA 4JK9A 1NK0A 3MEEB 3VF0B 2J0WA 1SJRA 3NP5A 4YY3K 5GAHP 4H5RA 1DARA 1APSA 3EM1A 2JHEA 3BH6B 3IN5A 4HH0A 4FP9A 2E4LA 1B0VA 2ZGYA 3VWSA 2GMHA 5HK4A 4I2PB 1RDUA 3TTFA 4MKVA 3US5A 4ECWA 2FC8A 4WK3A 3CXCM 3CW2C 3CJKB 1RT2A 2JL9A 3FGVA 1QTNB 5B08A 1VQOS 3SUPA 2VPXB 4D3GA 4DX7A 4RU2A 2XB2D 2LQBA 3C6TA 3HJVA 2D9OA 3HSTB 2FJWA 3TA0A 5LL6Z 4ZPCA 2R7XA 7FD1A 4K4VA 3V4IB 3N01A 3GJSB 2AX1A 3WQUA 1N8RT 1IKVA 1Q0NA 2J9DA 5A8WA 4O23A 1R8PA 3RSEA 2VG7B 1U1NA 1KSPA 1N56A 3PSFA 2R7VA 1HFEL 4PG5A 3AO2A 2ZOFA 3IAS9 1HR0J 1ATNA 4FLTA 1KVCA 3IG1B 4OI6A 3PJ9A 1YVUA 4OKKA 4WU3A 2ASPA 5THWA 2VJVA 1VQMN 3T5HA 3CIMA 2DXDA 3DXMB 3BV8A 2ZVSA 1FJCA 1RAFB 3FLCO 1RDWX 1WOQA 3HF5A 2CADA 5DDPC 4ECZA 3V5RA 4QIFA 2EX3A 1WUUA 1NPRA 2J0SD 3U02A 4ECRA 5DLFA 1YHQS 1IV0A 2OA8A 1URNA 1L3UA 1PSDA 1VC6A 1WDTA 2B9XA 3KUHA 3KG0A 4MIWA 5CHCB 3V1RA 2GV9A 5KFOA 4ELTA 2X1BA 2GX8A 3MM9B 4WFXA 2RRBA 4FDFA 3NS6A 2CJXB 3P45B 1RA7A 3D4JA 2HHUA 4DTUA 3DLLL 2YNFA 5CABA 3V6DB 4KR0B 2GGPA 4KHNA 4KFBA 3QYYA 1LXJA 2G8FA 2NQPA 4KI6A 3TAMA 1Q8LA 3K58A 3VA3A 3I96A 1FFSB 2ZEJA 2OPQA 1IVZA 1VIOA 4NEYA 1BQNA 2HS3A 2H1YA 3C94A 3P4IA 1NJZA 5B0EA 1BY9A 3O6QA 1KEKA 2XO6A 3BZQA 4ZVGA 2HVIA 1QQOA 1B7YB 5RUBA 5FLXY 2QTWA 3DGVA 4JI1F 1BU6O 5KGXA 1NBEB 1VQSA 2Z1HA 4E1MA 4FJHA 4J91A 3M6WA 1RHQB 2IC3A 4PWUA 2KYZA 2MEWA 3CF5Q 4PXDA 4DV5J 1X9JA 3BUZB 2HS0A 2W41A 4CZIA 2HMIB 2ZHAA 4CIEA 4LFAF 4E7LA 4ICLA 3A1YG 2R2UA 2XWYA 1Q81T 4N77A 5DDRC 3TJ8A 4ED7A 4NEZA 2IA6A 5AJ3J 2XSFA 3PW2A 2XEXA 2HZAA 1RCXB 1S0NA 1N4LA 3M32A 4NX9A 1HI1A 1JCEA 3WXJA 2BRKA 1S6OA 5KFFA 4C11B 2B4VA 2DO4A 1H2UX 2HKEA 4CLFA 4DQIA 2QL7B 1Q5VA 4ZP7A 2UV8G 5JMNA 3FK4A 3VEZA 5I3UA 2CNNB 2E5LJ 2HFUA 5LJVA 4B3RK 2HF3A 3K8WA 1B7FA 1E6YA 1SV5B 5BN8A 3Q8SB 4FZZA 1X9SA 2BOPA 4DV7F 1R0AB 4PKIA 4CLWA 3QSYB 3HKWA 1NUEA 2A1BA 3ZSWA 4DV0K 1RP5A 4CESA 1BOTO 4BR7A 1LKZA 1ZPWX 4PYAA 5D78A 7FDRA 4UW2A 2RUGA 1SIWB 2B6AA 3KLGA 3THWB 2HNDB 1QTMA 4DDFA 2YNIA 4B9SA 3GSDA 2YV0X 5IV4A 3CJ7A 3G82B 5I4MA 2FVPA 4KY3A 4F3TA 2B4JA 5D3GB 1MMNA 2KXHA 3RR7A 2YJFA 1YI2N 2AD9A 2MZJA 5IWAF 3H42A 5IWAK 4GMJB 4A8WA 1IKYA 1WHWA 2Y1LB 5D4NA 4RWWA 4NCAA 4RW6B 4M5JA 1LW0B 1X5PA 2MDAA 5IC6B 3OYFA 4M5KA 2IDOA 3ZTRA 3BF3A 3OR2A 3CDBA 2KFZA 4Z4CA 4CI0B 1HNZK 4RW9B 1ZAWA 3BKTA 2YHXA 4ZPAA 2ZOGA 1RAAB 4WK1A 1RDAA 1T6CA 4DL6A 3OUYB 1L3VA 3DNCA 1RU1A 1NK9A 3O8MA 4BRDA 2YKNB 3B4DA 2VGNA 3VF2A 4N5SA 2A41A 5IWAJ 3GOIA 4CGFA 2NREA 3I5BA 3M32B 1XHZA 3BJYA 4EYIB 2WONB 3MI7X 2CPJA 1M1KO 4OI2A 3S41A 2HVDA 5BRHA 1Z1ZA 3QPIA 1S9FA 5L1LA 1U1MA 1VQ7S 3FBBA 4GC7A 3M8QA 1UPPA 4W5QA 3NFAA 4QWEA 5T7LA 2DNOA 5FLXU 2VQEF 2Q0RA 4C48A 4DG1A 5E3QA 4MMOA 2DITA 3G6VA 4OGEA 2BJ9A 4XIUA 3LPYA 5E3RA 2DGSA 4RZRA 1VQPN 2EVZA 5C24A 2M70A 1BI4B 2OUGA 4N47A 4C0BA 5DM6Q 4ED5A 1ZAXA 4ZVUB 2EPIA 1VC0A 2VC0A 3UW1A 1W2BR 4USMA 4DCOB 2MQ8A 3FFIB 3GG4A 3F41A 2QFIA 2WCXA 4WYWA 4KQZA 1RTZA 2GAHC 4PG6A 3CCUS 3T7ZA 3W7BA 1F60B 2BE2A 3GU0A 5F3ZA 1VHXA 1C1BB 1KDNA 4FK2A 1OS5A 2EC0A 3MPWA 1H7XA 2KRRA 4M5NA 2VGMA 2MPUA 3NAEA 3UNYA 3MUMP 4FYWB 3SLCA 2V2QA 1HBNA 3AVNA 1J5OA 4MTPA 2HOEA 4HTIA 2EI5A 3I55N 4I9LA 1XNQF 4O3NA 2WSFC 4DUTA 1NH7A 3AO5A 2NXUA 1ATSA 3N28A 5KT2A 3Q8RB 1E6VA 1R8AA 2ZBCA 5KFCA 2XBPA 4K4UA 4IH5A 5H1SQ 5HBMA 3ZYYX 2WOMB 4WQ4C 5J2MB 2BR0A 5JVHL 2FJBB 4LQ9A 3GJTB 5AJ3K 2M3DA 3CCQN 5TKWA 3K9KA 3KTQA 2FD2A 4YS2A 2BEFA 2OSRA 1WI8A 3JAMY 2UVUA 4HLBA 2GIFA 1S9EB 1VIXA 1WHYA 3SEOA 2JDJA 5KOWA 3UR0A 5JICA 1LCUA 5GAGP 1AYEA 3AB2B 5LMNK 2O8EA 1XNQJ 2MQPA 2J4RA 4CZFA 3SAGA 4DV5K 2OSQA 4CZLA 2PY5A 3TRGA 3R5GA 4JI3J 2CQ3A 3RR8A 2LA4A 2UUBK 2MZQA 2BW7A 2IBOA 2VPWB 1RCOB 4HTJA 4HVZA 1RAEB 1KQGB 1OPIA 3A13A 2F8MA 2KB2A 5HOOA 1QE1A 4CBXA 3RAXA 4GKJK 3RUBL 4IO1A 2QEXS 1RWNB 4FPAA 3CCES 2VFVA 4LVOP 2B51A 4DU1A 1JKHB 3KK3A 3O9QA 2RDIA 4B3RF 3RB3A 5G0RA 2AJFE 5DK5A 3R1HA 2LQ5A 5C12A 3CI5A 3EGVA 3LM2A 4DR1F 3A2FA 1LK7A 1V3SA 1RBVA 2QW9A 4DPTA 1SJQA 3Q2TC 4BRIA 3G4SN 2MJUA 3VQCA 1WG1A 1FXRA 1KOHA 3C19A 3DCAA 4X65J 1U6BA 3J81U 4EFHA 4QS8A 1KQSM 3NAHA 3K5OA 1X4DA 3DRXA 4WFBQ 1ZA1B 3EVWA 5DJBA 3QJLA 3AAPA 2BJ1A 2MKIA 2GVDA 4CK1A 3MD1A 1RBRA 1EWRA 4KHMA 2DK2A 3V6DA 4ID5B 2Q3PA 3T1HF 4O44A 2UUAK 3RTVA 3HT3A 2MHEA 1U0SA 2NSCA 1R8BA 2UZAA 4OPHA 3VAKA 1UVIA 2QK9A 3EXYA 2DPJA 1FK9A 1XNRF 3KDNA 2YQ0A 2B7CB 1S9EA 4DR6K 2M7SA 3Q8UA 3W8GA 2C3YA 1T95A 1GLAG 2ZBIA 5GAGU 4K4TA 1HR0K 3CJAA 3CJ5A 1TYQB 1UWBB 2A2DA 1NHKL 1MNEA 4M63C 2XGQA 4NA2A 4DFMA 4A57A 3ULDA 3AJ2A 2GQCA 3EDRB 3DJCA 5DS7A 1HKGA 3FZBA 4I4BA 1CULB 4ZCLA 4TY9A 4I67A 2VASA 2QXLA 1WD6A 4OI0A 2DGWA 2HNZA 4X64K 4PG7A 2PYJA 1FDBA 3FNNA 1CLFA 1BWEA 2O8CB 2FJEB 5AQOA 3CPWR 4ILMA 4ZN3A 1YVFA 2ZM6K 1GQEA 1RACB 3KK2A 2KI2A 5AQQA 5HN0A 3QLHA 2WHOA 4O8UA 3HVWA 1X4BA 2HHHK 1X4FA 2OJ3A 3NF6A 4CWBA 4O5FA 3NF8A 2JSXA 2QZ8A 4JKHA 5L8RC 4ZN1A 4Q7AA 4CNYA 3TP2A 2V8DA 2BRLA 2YNGA 5E84A 3SQGB 4F36A 3CJRA 3A0IX 1U49A 4YORA 1TL4A 1WF1A 3CGIA 1RT3B 4DL3A 3E8OA 1FXLA 3ITHB 3BYPA 2QL5B 3M2UA 2ROPA 4GVBB 3JSMA 4CHNA 3R3TA 5MAOA 5LSOA 2AJ4A 4IOCL 1S1XB 3IFRA 2DH9A 1VCTA 5IT0A 5F8GA 4USVA 1VQ8N 3EE8A 2HK2A 4B02A 3QMLA 3D1OA 2ERRA 3O4WA 4NXNF 4H0VB 3HT0A 2A3JA 2R42A 4A48A 4X62F 1CC7A 2HYIB 4BWMA 5KG1A 1C4CA 2Q6BA 2NXJA 3M9OB 3ZETA 1SUQB 1FWLA 3UQSA 3H6EA 5AQMA 2D0AA 2M8HA 2Z2YB 1GMUA 2A0FB 3BP8A 1SAZA 2DGXA 4ETZA 1DRZA 2ILYA 2Y1RI 3THWA 3V4MA 2XNRA 1YIJS 2BUPA 2HLTA 1EP4B 4UTGA 1PJ7A 1QSLA 5F9LA 3CXCR 1JL2A 1YLXA 1MWMA 4B8CA 5K14B 4DU7A 3TAQA 2H5IB 4GY2B 1AB8A 1JLAA 2AA4A 4KAIA 1WAJA 3LGHA 3QWUA 2M52A 4K41A 4R0EA 5CD4H 3X3UA 1ZZNA 2MZTA 3T1HJ 2ADCA 3LZJA 5AQTA 2YJEA 2XWXA 2R2TA 4C97A 2Q6CA 3THVA 2E1AA 4KPYA 3TNVA 2OPPA 2DR7A 1TUGB 3AA9A 1LFPA 1NDLA 1NU4A 2KJWA 4N8NA 1F0XA 4USJC 3ENWA 1JK9B 3F0NA 3W0LA 3G87A 1NK5A 3JAMU 1UVJA 2FVRA 1FXDA 3R9PA 2K3KA 1GLJO 2VIHA 4CJRA 3U7JA 3HSJA 3H1QA 3DDIA 1NJWA 1S97A 3H5SA 3MPUB 1QQNA 4CZKA 3UI3A 2N7CA 4ATNA 2ADBA 5BYSA 3VGTA 3OHAA 3O4QA 2EFQA 4DLGA 4BC7A 3W5YA 3SZ2A 4ZPBA 4CT8A 4JD2B 4OYMA 4J9QA 4X62J 2J9CA 1JL1A 4CERA 3WC0A 1RA6A 4LF6F 5LXYA 1HBNB 3ZSRA 2VWKA 3FEZA 3CCSS 3EDQB 2FY8A 3H0PA 2L9NA 4ED2A 3MWBA 2P6TA 1V3ZA 4DTOA 5LSRA 4G6VB 3T1HK 4MFBB 3I6PA 4U7BA 3W2VB 4LR9A 2QXFA 4U7CA 3G71N 3MPVA 4IO8A 1I94J 1HD0A 3H4BA 2XY7A 3T9ZA 2KKHA 5B0GA 5KFVA 3SBGA 3EWGA 4X4NA 2Q66A 3DRPB 1NGBA 3ENOA 1WC3A 4MO5A 2G2OA 4C8LA 4ANDA 1TUUA 2NSBA 3C46A 1UTAA 3MEDA 1MROB 1NDCA 5KG0A 4U95A 5HP1B 2RVJA 3J81Y 2PMHA 3QFHA 1ZAVA 3OD2A 1SZ2A 1QZ6A 4KH4A 2HPUA 4ZP6A 2CDQA 3ZEUA 1RUSA 2EK1A 4ZKAA 1C0MA 1OY6A 3QSIA 3IGVA 4RJVA 1U26A 1RLCL 4Q43A 3CC4N 1G1XA 2D1KA 1YJNS 3FSIA 3KMSA 3QGPA 2XZTB 3DI6B 3KZBA 3JS6A 1DJ0A 3LP0A 1S0OA 4KYZA 4CLUA 3QINA 2RIJA 3CC4S 1RT1A 2VZ9A 2UU9F 1TTHB 3EZOA 5SUHA 2GO9A 3KWGA 3BSNA 2PFDA 2XMJA 1S1UB 4ECUA 3S3MA 4FM0A 2WBRA 2PMZD 2BANA 4A8SA 2FHMA 2H4WB 1WAFA 3PO5A 4EP5A 2XLJA 3ISNC 3QQCD 4TY8B 2L48A 4ZVPB 3LW5C 2PIIA 4K5RA 1VYAA 4KH0B 5SWMA 2JRSA 3ZXWA 5LL6d 1RWOB 4ECXA 1LWFB 3FQLA 2HGMA 2NRTA 1BA0A 5CHIA 4H0TB 4I56A 4JI2F 3IGNA 3DOMB 3IBWA 3Q8YA 4FLWA 2UU9J 3H90A 4X66K 1TVRB 2QTDA 4AQYJ 3IRXB 1FVQA 4CLPA 2ZC4A 1Z2ZA 5IM0A 4NI2B 3OJUA 5GAEP 4NXMF 1RAOA 2C3UA 4OZ0A 3K7RA 1Z6RA 1K47A 3THXA 3AA4A 3C3LA 3ICLA 1X3NA 3AXKA 1RDDA 3A8JA 1UJ5A 1RISA 5KPTA 3ZZTA 4DU4A 3VZHA 1VS3A 8ATCB 4NCGA 4DCHA 1B9DA 3DLEA 2JC0A 2CWXA 1XEZA 4H5TA 5AZJA 4DU3A 4L3KA 1RGVA 5C24B 1SPBP 3VEWA 3VGSA 4BHQA 4CBWA 1EP4A 2GWJA 3TSQA 3W2WA 1NGDA 2FZGB 2QLXA 1M90T 1U25A 2R4FA 2DVIA 2WRMA 3PHEA 3MM5A 3I9ZA 4OLPA 2ZGZA 1Z4UA 1HQEB 1HR0F 2MGZA 3CCMN 1U09A 2DIUA 1H3DA 3HSCA 1MN7A 2R7WA 5AXKA 2IAJA 1NO8A 2CVIA 4CEBA 3K5PA 1HNIB 1WN7A 2D3ZA 2HS4A 5AQUA 4CQ1A 4NA1A 2ASMA 4NA3A 3KLFA 2J9EA 2GX9A 2BV3A 2HZVA 4CW7B 2FSKA 3BH7B 1HYVA 3IMQJ 3TR5A 3BEXA 2DNQA 3G10A 2DCLA 2O8BA 4CHPA 2HRYA 3DOMA 3V1OA 4IEEA 1BMQB 4RUBA 3E9PA 4MIAA 4PABA 4A8XA 4CF2A 4U7UK 3CCWA 4WCEQ 2ZH1A 5C0YA 1RT1B 5BREA 5J1EA 1JLFB 1LWEB 3VN5A 4AYBD 5BPLA 3T1YF 1VISA 4H0XB 4PA1A 2IA0A 3VQPA 1TKXB 4AHVA 4IOAQ 4DV2J 1TMMA 1NOZA 3SQ0A 2CH5A 4YOYA 3NKYA 1KRPA 4MQ3A 3WNFA 5KI6A 4NLPA 4IDKA 3OT9A 3ZSOA 2QWNA 1EWQA 2VQFF 2VQFK 4E7HA 4H5WA 4I64A 5IT9U 1KVKA 1R0BG 3IWXA 3QZ8A 2VG6A 2YKQA 3MR2A 3VGVA 2JEFA 3W3SA 3CC7S 2XYGB 1K9MT 2FPHX 4J9SA 4E0DA 3MCOA 4C8ZA 3MGJA 2OGUA 4LF4F 1S6UA 2J6UA 4ZVFA 3R2CJ 2H65B 3EGWB 1WACA 1A5WA 4FWMA 3THYB 4TLQA 2OFGX 1NZAA 1VQKN 5HVFA 2CPZA 1WLJA 3EX7B 1N34J 3AJ1A 2UVVA 4NRTA 3L3UA 2DH8A 1RGIA 3ENQA 4NOHA 4CJ3A 4FCYA 4Y00A 4B3SK 2HRTA 4M5HA 1ZBLA 3H25A 3TANA 4DV6K 1FEEA 1H6KX 4EFAC 4DV3F 1KHVA 3AVIA 2RHKA 2ZVIA 3EZUA 1FDNA 5DZ6A 1RT5A 4XH4A 3SYZA 4KHPF 3HL8A 1WG4A 2E2QA 4YEAA 2FF3B 2F9TA 5AXNA 1X9MA 4PYDA 3CCRS 5I42B 4I6AA 2QL9B 1EO1A 2RF2B 1RWWB 2XS7A 2OZMA 1X3MA 2V2KA 3NH2A 4L8RB 4JNEA 5L39A 3O2IA 4MKAA 5I3UB 2YPZA 4ILGB 4DQRA 1ZBSA 2ZF5O 4RBTA 5J2MA 4LFCK 2N82B 3G8TA 2LQ9A 4UZBA 4LF7F 1NCLA 4H0PA 2O01C 1S4FA 1CJTB 1GOAA 1MMLA 3OXGA 3R8EA 2CIMA 4LUBA 3ZLJA 4C8KA 4KRWA 2HFSA 4BBYA 1S1WB 2CGKA 4LSNB 2OEMA 4IG3B 2V6AA 1Q78A 2HLUA 4ZPDA 1YK9A 1ASVA 1OSDA 3GIJA 4FS2A 1S3XA 3L2RA 2ALYB 1O8BA 2D3UA 4JKDA 4JI6K 4JI6F 4LFAJ 5D4PA 2OD4A 4CM0A 1RT7A 4HKQA 4B3MK 4Q0BB 4DTJA 4B9VA 2LVWA 1WSEA 1B0PA 1MWZA 3MPYA 5J1NA 2O8DA 2J5AA 2HBRB 1PYTA 3HD2A 3OLBA 3OL9A 1CJKA 3TJAA 2FYXA 1IBKK 4HT5A 4MDBA 3Q8PB 4HI1A 1MW7A 2GIRA 1ZM9A 1IKWB 1Q82T 4F0KA 2V4QA 2XCPA 2DNYA 1YJWS 4IBNA 4OL8A 3PJWA 4QYZJ 3HI0A 3MECB 4RW4B 2VB6A 3MAAA 5F0WA 1FRLA 2MTLA 4QJVA 5CXTA 3HVTB 5E2QA 3FMWA 2EFNA 1M5KC 1FTCA 1AA1B 1SXLA 2AGQA 1O1WA 2R3VA 1RB0A 3W65A 2FDNA 4PR6A 2LA6A 4RNFA 3JSYA 3H40A 1UFWA 3IO1A 2P5OA 3WEEA 4EK2A 3LO3A 1HYZA 3EL2A 3O1LA 1PGZA 4J2BA 2FSNA 2UXCF 1N5YB 2DTUA 1X4AA 3NGZA 5HMZA 3PFEA 3KIOA 1DHMA 4B3TK 2DXFA 5F9NA 2MKHA 3N6NA 1X8DA 3R6GB 1F2HA 2ZZMA 4OLOA 1RWPB 3SQ2A 1K6YA 4FPIA 4ANCA 1UVNA 2X7IA 4ZK7M 3OFFA 4ALZA 1U1QA 3R97A 1K44A 1CZ9A 3OYCA 2O8FB 5HL7Q 1W25A 2OTJS 4YOXA 3B54A 4FWNA 1E6VB 1OPZA 2VONA 2EK6A 3KNGA 1NHVA 2W25A 3OYNA 4WXOA 3BGRA 3VMFB 4G1QA 3MXHP 2VD3A 1DURA 4ZA1A 1IQTA 4Z4GA 2GEMA 3KHHA 2KZMA 4DV0J 4LMZA 2OTJN 4F2SA 2IDEA 2FVQA 2C2NA 3AVBA 2P9NB 1VSMA 3LALA 2A18A 1RDBA 4Y3CA 2E9RX 3H59A 4RW8B 3H46O 1KD1O 3DXBA 1QZ5A 4CT9A 1G99A 1TFYA 5J2PA 2FF6A 4FJIA 1AUSL 1UWBA 2AF6A 3OVNA 4ZP8A 1EHWA 2VHGA 3I31A 1IBCB 4FKXA 4BR4A 3H98A 3GLJA 2L9DA 4CVNE 3C15A 3J80O 4ZVSB 3U1MA 3CQ8A 3DC2A 5JMVA 1WNSA 4BRCA 3GG0A 5HVGA 2ASJA 3I87A 2QN6B 4O3OA 4MYUA 2N4CA 2LEAA 3A3NB 3EICA 2NRXA 1WC5A 1WTBA 4LF8J 1Y00A 4EU0A 4PKHA 3S6EA 3WIVA 4B9LA 4B1WB 2VH7A 5CD4A 1CEZA 2YX7A 4YHHK 4CZMA 1S7HA 2MLYA 2XMVA 4OPAA 2WSCC 5LOQA 5CZXA 1ZBUA 4Y1DA 5FPEA 1SUQA 4RW9A 2I8EA 3KWIA 3G86A 3P5BP 2DGUA 3NDKA 1LQ9A 4V1Ak 4CZGA 5EX0A 3TZWA 4PG8A 4RLEA 4NLCA 3GYXB 5EWGA 1U45A 3W5XA 5F8JA 2CUYA 4IR9A 2O4IA 1UCNA 4JI0J 3MUTP 5KFLA 4BDPA 3HFKA 2QT7A 4B3OB 2WFBA 3QRQA 1KKHA 3VEXA 1V4SA 5GMEA 4LQ3A 1VDHA 3HK2A 4Z4EA 1JKHA 1TAQA 3SV3A 2F1FA 1HQUA 2E1YA 5C25B 4CJUA 4CM2A 1WELA 3EPIA 5ETKA 3TAFA 1K8KA 2DGTA 4ES2A 2VFRA 5J2PB 4W5OA 4DUYK 2ZJPQ 1W7AA 5M2RA 2AYMA 4K8XA 3MUVP 4YR3A 2LMIA 3KJQB 2ZH3A 4KJIA 4CGGA 2G0IA 3IC1A 2HNZB 1XMOF 1RADB 1JLBB 2D0PA 3T5LA 3OV7A 4DCPB 3WIUA 1CULA 3G8SA 1SV5A 2XTJP 3UE2A 3SUNA 3C95A 4O0JA 3FMBA 2ZM6J 1JXEA 1TAUA 3HFVA 5CYMA 3W63A 1VLYA 5L46A 3I56S 5HLFB 4MK9A 3PEJA 3PYDA 4WFZA 6FD1A 4I2QB 5CCLA 3UKUA 5ETPA 3ULEB 3E3XA 1RAGB 4JD2A 2VBYA 4IJAA 2QWQA 4JS5A 1L5UA 2QSFA 4CEAA 5K5MA 4JI1K 4HHTA 3EKUA 4BC5A 4DR5F 1WBDA 4L76A 4A5AA 3QFWA 2OFHX 2DFEA 3KK1A 3UFCX 3LP1A 3CD6N 2X6NA 5GAHI 1OWXA 2I7NA 3OTCA 4TY8A 4PWDA 4OQJA 4I6MA 3RB4A 4Q2LA 4JRPA 1NB2A 2EWSA 5B8HA 4E7JA 3TZXA 4CYUA 2W1BA 4RR5A 2OD6A 3LL3A 3LDLA 3FRYA 2WOMA 2UVRA 3CD6S 3W60A 4FM1A 2B9WA 1Y7PA 3NL0A 3MWTA 1YJ9S 5CYMB 2AEMA 2ZBPA 1YXQA 3PCOB 3GV7B 4W5RA 5AQXA 1W97L 1CJVA 2Q2RA 2CA9A 3CDEA 1CS4A 5CR4A 3CJQA 3C6TB 3RAQA 4HEA9 2IGIA 3AQOA 1R0CB 2CRLA 2IOCA 5F8LA 2ZNYA 2GVDB 2VV5A 3EXCX 3CQXA 4BC2A 3AJDA 5L1KA 1ZTTA 2RSQA 3U9ZA 1UMJA 5A8WB 3P49B 3J7YI 4M5MA 4AM7A 3QAUA 4ZLNA 2YQ1A 2IY5B 2R7OA 1F9HA 1BWFO 3LP0B 4LF9K 5D0GA 1HBMB 4DV5F 2F8EX 4N56A 3VEYA 4LFCF 4FJ5A 2G8HA 2W9AA 3MPDA 5C10A 3SQ1A 3OPKA 4LC9B 5AQWA 1HNWJ 2EFGA 2H51B 4Q5VA 1X31C 3BF1A 4V19S 3TAPA 5GAEI 1LWXA 3HHLC 3CMQA 1IM4A 4M3YA 3ZFVA 5B09A 4JI3F 1KFDA 3VF4A 4CGDA 1OYDA 2BE9B 5EN1A 4XTTA 1QS4A 3ATUA 1CBKA 4A62A 3G9CA 1NK6A 3MXMA 4FWSA 4FW2A 3PG9A 5KFYA 4PHTX 1V4TA 3I0SA 1U2CA 1QVGM 4I6MB 4GVBA 2X74A 1D9FA 3TEHB 3LWLA 2Y0SD 4DR7K 1RT6B 1BO5O 3DLLQ 3IMXA 1D4XA 4RUAA 5H1SV 4NB4A 1KQFB 3SUOA 2XYHB 5KT7A 1P8GA 5L38A 4CLKA 1JJ4A 4LH4A 3SAHA 1HNWK 3VTHA 1RWXB 3AHPA 3M8PA 4CHOA 1JLCA 3DU5A 4DL4A 4IQMA 3DLBA 2P5GA 4YHHJ 3PYFA 3KLGB 2CG4A 1WOOA 4PQUB 3PIPL 3P31A 1Q7LB 2HQGA 1Y11A 2KQ2A 2MY7A 4ZPVR 4DF4A 4AE5A 3HZGA 5KFMA 3L3CA 2YWFA 4IFVA 2KLAA 2XYPB 4BVOA 1XR5A 2KVIA 4YFUA 3JQKA 3OW2M 3QDKA 4UOCA 3LOUA 2RQCA 2WVBA 2W24A 2BYCA 4O4RA 5CYQB 4ES3A 4ED0A 3H2LA 3FGUA 3BBFA 4XH1A 1HQUB 3JSBA 1HNVA 2KT5A 4UT4A 3OSPA 3D67A 4CF0A 3MN5A 5CA5A 3NWRA 2PT0A 4FLYA 2G0JA 3ELHA 5DM6L 1S59A 4QIWD 5F41A 2BKNA 5CCMA 3VAGA 2M9KA 3AVHA 3VQEA 4H5NA 4R8UB 3RW6A 5F1XA 2O8FA 3MWPA 4NZ0A 1QM9A 3OA9A 3MM8A 3CB4A 3MR6A 4LRDA 3OUYA 1QD1A 4JI7J 1WB9A 1TK8A 3D6MB 4IRDA 3WNHA 1DT9A 4H4MB 4DPUA 3H8YA 4BACA 4RNOA 2QMXA 4QBUA 3PM9A 3PRVA 3M6GA 3ZZYA 4CF9A 2V69A 3R5BA 4O44B 3FR0A 3MCNA 4C23A 2GBZA 4O3RA 1BG3A 1UW4A 2DY1A 3JTOA 2O67A 1KD1T 3TAGA 4OPJA 2PA3A 3OQ2A 3BM7A 4DUYJ 2HBQB 3NMAA 4KV8B 3RYLA 5GMDA 3QETA 2ACMA 1NJXA 2IDLA 4O3PA 4E7KA 4CK3A 1X4HA 2IS3A 4TU9A 4O4GA 3AB4B 1NGIA 2DKOB 4DX5A 1KLMB 1HNVB 3KJVB 1U2FA 3UN5A 1FJGJ 1K0TA 3AVGA 3RWUA 4WQ4A 3KK2B 3WXKA 2VDHA 3BSOA 2FLLA 3F5TA 4QAGA 3KNAA 3L6QA 2HIYA 3BB5A 4JV5K 2XMWA 2XO7A 4A4JA 4OYAA 1NSAA 2E5HA 1KBRA 4FJ7A 1ZM4A 3M9NB 2RPIA 1NJIT 4EBEA 2N3LA 4N7TA 3ZT1A 2HSTA 4LSLB 4Z2XA 4BE0A 4WU2A 2BMBA 2QMWA 4C8OA 3UR3C 3OW2R 2HBKA 3FRZA 3TABA 5AFUA 2UUBJ 3ZZPA 2KHOA 3D0PA 4JI3K 3DLRA 3R5AA 5FRMA 5I9EB 3NAIA 3PW0A 4JI4J 4DUZK 3N4WA 2HFOA 3AOBA 2HHSA 3CDUA 1RAHB 2FGCA 2W6KA 4CH1A 1JLCB 1C0UA 2JLGA 3I8BA 3QFUA 1SKSA 2Y8YA 1V9OA 3CJ2A 4KAZA 5AQIA 4WFAL 4GRSA 2RD5C 5HQLA 1WC0A 1VQON 3PIPQ 2UUAF 1KN6A 3O4NA 2C28A 5KG2A 3P39A 4IYQA 2GVZB 4CO1A 1OO0B 1OKJA 2QWMA 1ATRA 4IFYA 1VFJA 2HGNA 1DEJA 1LXNA 3H3OB 1VBXA 5KFAA 4PZVA 5K14A 2RKIA 4PUOB 2HHWA 3UNGC 3ENHA 2OPRA 3SXLA 2J7KA 4ZCKA 1WEYA 5LSLA 2CJKA 3UD5A 4HCBA 4M3UA 3THYA 2N7YA 3PIOQ 1VQNS 3NGSA 4FM2A 4H4OB 3DLGA 1JXVA 1KP6A 4GKKK 1DTTA 3HKZD 1U7LA 4NLYA 4DUZJ 3JB9k 1HPMA 4ZIWA 3EZ5A 4ZHRA 1N33J 4JI8K 4PUOA 3UCUP 1VSLA 2BOAA 3PNIA 4YOTA 5DG7A 1EZZB 2DH7A 3O1WA 2Q1NA 3A3OB 5DDOC 2HVEA 3D66A 5ETTA 4LH5A 4JYAJ 3C2PA 3DOLB 5HO4A 2NYIA 3DKDA 2J9DE 1CJTA 3CO9A 5IT4A 4HTLA 1UEVA 5J2QA 1YI2S 1SQEA 4R5PA 4ED6A 4BG9A 4DL0C 4NLVA 3I8DA 1G7CB 1M1HA 3RRGA 3NH1A 2ASOA 4CJPA 1BXNA 1GMWD 4LRCA 3ENAA 2DIVA 4CLLA 5C7PA 3MX5A 4JEPA 1FWKA 2WK4A 4JLHA 2HWTA 2DXEA 2V9WA 1K0VA 4C8NA 2Z56B 4JUZA 3MHYA 3SQGA 3TA2A 4CLSA 3NGRA 3M2VB 2AGOA 4ZJOA 4CEFA 3E01A 1RBLA 2XY5A 3OYMA 3L4IA 3NG8A 3AY9A 9ATCB 3OL6A 1HHQA 4K50A 2FXUA 2FHJD 3EPGA 3D7SB 1TL7B 4DR2J 2HHHF 3EEQA 3RVCA 1JCFA 3QERA 2YX6A 5HROA 5LJ5Y 2E9TA 5EOYA 5KGWA 4DV1F 4DV1K 2MHNA 4BC4A 4RNNA 4GVEA 4K59A 2OI2A 2XI3A 2AMCB 3BGOP 1Q82O 3C16A 4NZ7A 5A0YB 1TV6B 3QGHA 2OPSB 4MAKA 4LF5K 2ZWPA 4E1NA 1H2TZ 1QHAA 1BLUA 1JJHA 1XJWB 1EKEA 3WT0A 2IM0A 1NSPA 3QICA 3PDNA 1HNXJ 4DEZA 2VF3A 4JI2J 2DFHA 5LMNJ 3F9MA 1YJVA 4HH1A 1Y5NB 2AU0A 3IWNC 4KO0A 2K3IA 4NXNK 2ZHBA 2FZKB 5L1JA 2B0GA 4F67A 2W9CB 1T8EA 1NLKL 1U0HA 1ZM3A 3M4XA 4FZXC 1HD1A 2ZBQA 4FF3A 1S5ZA 3QFPA 3QEVA 4TN2A 2IM3A