2OPSA

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
542
structure length
535
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 134
structure length 535
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2opsA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2opsA05
2YNHA 1DLOA 4CGHA 4URSA 4NLSA 3AVJA 4IQXA 3PHEA 1S4FA 4NLYA 3V81B 3RAQA 2KTQA 3H98A 4IRDA 4XPCA 4FJGA 4ZPAA 1SKRA 5KFFA 3UQSA 3NBPA 4RUCA 1NK8A 1KLMB 2FVSA 3RB4A 2GUIA 1B9DA 4J9KA 3V1RA 4KPYA 1NKCA 4AH9A 4CJKA 3QEIA 2G8KA 2LSNA 4FJMA 2X78A 2RKIA 3HHKA 1RBVA 5KFLA 4DSKA 5C25B 1KCFA 4WYWA 4WZMA 4F50A 3KLGB 4CEDA 3L2QA 3U3YA 3AVMA 1U04A 3SI6A 3WNGA 4EZ6A 4NRUA 5I3UB 5EUHA 3AVIA 2FBTA 3LPUA 4CJEA 4ED0A 2UUWA 5I42B 2XI3A 3DLKB 4KBIA 4ZP8A 2Z1HA 1NJWA 3L2VA 1XHXA 4PUOB 5JS2A 3NGDA 2E9TA 2HB5A 4Y1DA 4ZMMA 3M9OB 3SFGA 3V6HA 1ASWA 4E7IA 3H4DA 1S1TA 2R2SA 2JEFA 1CXUA 1S1UA 3OYLA 3PJXA 4NLOA 4RG8A 5J2QA 5KFUA 3RR7A 2VG5B 4Y3CA 1B9FA 5KFVA 3OLAA 1FK9A 3ISND 1S0NA 4HYKA 1RT5A 4CHYA 4XO0A 4OKEA 4CHZA 2QKKA 2KFNA 4HCBA 3L2UA 1TKTB 5KFQA 3KMQA 1BISA 1X1PA 2FVQA 4BE2A 4NRTA 3P1GA 1MU2B 5F8MA 3KHLA 1CZ9A 5EWGA 2C2EA 1BQMA 1SV5A 4M3ZA 4N76A 1ITGA 1RTIB 3OYDA 2Z1IA 2WOMB 3V9XA 2PYLA 3O3GA 1X9SA 3AA2A 4DFKA 4KI6A 4O3NA 2BDPA 3PR5B 1VSKA 4DTSA 2UVUA 2D41A 5L1KA 1RDCA 1QHTA 4CERA 1R0AA 4M95A 1QSLA 5J1EB 1S1WB 4URGA 3KNAA 1U09A 3ZSYA 3M8QA 3N6MA 3D0PA 2JGUA 2F8TA 3SUNA 1SH0A 4KHNA 4QAGA 4KV8A 3LP2A 4NCAA 4DTPA 5KFGA 1RDDA 4E7JA 4Q0BB 4B8CA 3DLRA 4KHQA 4I2PA 3S9HA 2DFFA 3O3HA 2G8FA 2EX3A 4M3TA 1LW0B 1U48A 3LP1A 4Q0BA 1I39A 2XO7A 5KFRA 1UWBA 3KHRA 4N5SA 5F8IA 1BGXT 4QW9A 1WSGA 4O55A 4M42A 3VQSA 3MEGB 3AO1A 5KFBA 2KZZA 1A5WA 3THVA 4F4XA 4TQRA 3GIIA 3BGRA 4L8RB 5HP1B 4PWDA 2DPIA 2E9ZA 1N5YA 2IC3A 4CGGA 3SFUA 3CJ2A 2Q3SA 4CEBA 4RW9A 5C5JA 3OYFA 2VG6B 1GOCA 4KHWA 3TAPA 4IG0A 2YKMB 1DTTB 4ELUA 4ED8A 1ZBIA 4FJ5A 3QO9B 5CZ2A 2OPSA 2YV0X 4MK9A 1RT3A 1S1XA 3LZIA 2YNIB 1FKOB 5L9XA 2O5DA 3DM2A 1LWCA 1RTIA 1TVRB 1RYSA 5HRRA 4HTUA 4FVMA 2W9BA 1RTHB 2R8HA 1HMVB 4C8OA 2ZQBA 4J2DA 3JSMB 3I0SB 4DG1B 2R2UA 2GV9A 2G8UA 5D3GB 1QE1B 1NJXA 4NYZA 3IS9B 1IKXA 4EO6A 1TQLA 4RNMA 4DSIA 3SPYA 1RDRA 4M94A 4FK0A 3NCIA 2W8LA 2E4LA 3CIZA 4M3YA 5K14B 3DYAA 3BSNA 1JLGA 1QAIA 4WXWA 2R8IA 3HVTA 3ITHA 3CM6A 3HXMA 2AWZA 4QWDA 4MFBA 5DGBA 2C28A 4ED6A 3KOAA 4CK2A 4ZP6A 3V1QA 1U49A 4YP3A 4QWAA 4OKKA 2C22A 3DDKA 4HHTA 2PZSA 3KLVA 4DU4A 2ZD1A 3SQ4A 4PQUA 4N56A 4LD0A 3H08A 3C95A 3GV8B 1HNVB 2BE2A 4FK4A 3LP0B 1Z25A 4PA1A 4KE5A 4ZTFA 4EP4A 1IM4A 1ZETA 4CEAA 4Z4IA 1DLOB 5I3UA 4RW6A 4WYLA 4ECSA 2AGQA 3DOKA 4KO0A 3OLBA 2W9CB 1GX5A 3TVKA 2F96A 1DTQA 3MEEA 1VRTB 4TY9A 3K5OA 1BL3A 1CSJA 4MKAA 4CEZA 4EEYA 4K8ZA 3LDSA 3CYMA 4E7LA 4F4KA 4I2QB 2HNYA 4CGJA 1S6QA 1J5OA 4FBTA 3L3VA 1W0HA 1N56A 1DTQB 3MEEB 4XIUA 4F8RA 1XR5A 4Y2CA 3KK1A 3BDPA 4KRFA 4DWIA 2YHBA 2FLPA 1BQNA 3L3UA 2V9WA 5KFEA 1G15A 4IFYA 4QWCA 1S6QB 1RTDB 3LP0A 2ZD1B 4I2QA 3H5UA 4NLPA 2HAIA 4E1MA 3OJSA 4Q5VA 4B3OB 2ITGA 4AHVA 4JV1A 1S10A 3QEPA 4ECXA 5KFAA 2VG5A 5KFDA 1L3UA 4DFJA 3OYBA 3CFRA 3ZT2A 3ALYA 2HHTA 4FS1A 3TANA 3V9WA 5KT6A 3T5HA 4W5QA 4IRKA 3RBDA 1S49A 3TR8A 4O5BA 1XHZA 2IA6A 4DQSA 4K4TA 3AVAA 1TL1B 4B9TA 4CGIA 3SCXA 3M9MB 3U6FA 1IKVA 4BDPA 4DSLA 3VQ7A 3I0RA 4OVLA 3PR4A 2ATLA 4B9LA 3NGYA 2F8SA 4CFCA 4E7KA 3DLBA 4C8NA 1C6VA 3OSNA 4FK2A 2ALZA 2G8WA 3HPHA 4F2RA 3GIJA 1T7PA 4DEZA 2KFZA 5KFJA 1VSHA 4H4MA 1S48A 1NK5A 3NAEA 3RMBA 2VG6A 5HROA 2BR0A 3LPTA 3LZJA 5F8HA 5KT5A 1RA6A 4KB0A 4HUGA 4FJKA 3IG1B 3HVRA 3CJ4A 5FDLB 5KFSA 1T03B 1YVFA 3FQKA 1Y97A 3DRSB 4YR0A 4CFAA 1QSSA 1I3AA 1IKWB 1RT6B 1LWFA 5J2PB 5KT2A 1J9AA 2GIRA 4RW7B 1VSEA 4B8AB 4J9RA 5HRPA 4KFBB 3RMDA 1KSPA 4BACA 1D9FA 3MEGA 4E19A 1HYZA 3AV9A 3EZUA 3SQ2A 1SL1A 3HVTB 3ITHB 4J9NA 4ZP9A 3TAEA 3QIPA 5DLGA 2P5GA 1VRUA 5C24A 1RT3B 1S6PA 4K4UA 1IO2A 3RTVA 4DS4A 3K2PA 1YTUA 4O3PA 3TAMA 4WE1B 4LH5A 2W9BB 4ECYA 3MR6A 4KI4A 3TAMB 1JLCA 1LAWA 3VQBA 2NUBA 4O4GA 1LWFB 4G1QA 5C24B 1YTAA 3M8QB 1S1XB 2GC8A 3O4NA 1FK9B 1NK7A 4ZVEA 1JLBA 1JXEA 1WAJA 2GBZA 4CECA 3NL0A 5KG1A 4FM2A 1TKZA 3V6KA 4CEQA 2EC0A 2XY6A 3QIOA 1ZBLA 4WXOA 4B9MA 4TSXA 4WFYA 2IC3B 1KTQA 4DL3A 3NGZA 4CJVA 3V9SA 3MAQA 3SUOA 2ETJA 3GIKA 1WLJA 1U4BA 3BR9A 5KFNA 1L3VA 2UVVA 2WOMA 3QESA 4ED3A 1BI4B 4QOZB 3V4IB 4DQQA 1WSEA 4CIGA 3DLGB 2ASDA 2ZE2A 4DU3A 1SH3A 3SNNA 4PY5A 2FLNA 3Q8QB 4KREA 3FRZA 2I5JA 1LWCB 2G8IA 2XCPA 1VSIA 4I2PB 4OLAA 2P51A 1FXXA 3VQ6A 5J2QB 4DL4A 4O0JA 4CCHA 4KB7A 1S1UB 1U47A 4CHNA 1WSJA 3QO9A 2R8KA 3H59A 2VA3A 3QIDA 4DFPA 5KG3A 3HPOA 2ILZA 4ECVA 1S9GA 3K5LA 5L1JA 1RBRA 3SV3A 3KLFA 4PUOA 1BCMA 3ISNC 1X9WA 1VSFA 1NJZA 1IKVB 3VQ8A 4IRCA 1ASUA 4MIAA 1TK0A 1NKEA 4ZTJA 3S3MA 2QK9A 3RBEA 4LQ9A 4DS5A 2JLEA 2X6NA 3QIPB 3OYCA 1VRTA 5F8GA 3QEXA 5KFPA 2B6AA 3I5CA 4O0IA 3G6VA 4NLWA 3QYYA 4URQU 5F9LA 4ID1A 4R0EA 2IM2A 1LW2B 4E1NA 4TLRA 3VN5A 1TL3B 4RW7A 3ZT0A 2BE2B 1W25A 4FW2A 4FM1A 4IDKB 4QWBA 1RAJA 1TKDA 1RT5B 2BQRA 4NYNA 1JLQA 5T14A 3Q8RB 5FDLA 2XI2A 4W5OA 1CXQA 5KTQA 1C0UA 2YNHB 2AJQA 3IRXA 1WNEA 3AVKA 1GOAA 3KK1B 4IR1A 4DTJA 4K8XA 4O4GB 4CF8A 2XHBA 4R5PB 4RU9A 3VQPA 1JXLA 3IRXB 3MXJA 2HNYB 2WRMA 2GIQA 4FM0A 3NF9A 2OPPB 4KKOA 5DMRA 1KLNA 3QLHB 1HYSB 4ZHRA 2HNZB 4ICLA 1TV6A 1VRUB 3KJVB 4K4SA 2D0AA 1T94A 1RBSA 2YNGB 4UQGA 2HWIA 4KHSA 1BQNB 2JC1A 4Z0UA 5HRSA 4FZXC 1SL2A 5EDWA 3TAFA 3FDSA 3PY8A 3WNEA 1BIZA 3P83D 2W7PA 3KLGA 1S97A 4DSFA 4EO8A 4ID5A 3KJVA 1J54A 3NH0A 4IH7A 1QE1A 2FC0A 5DG8A 4CESA 3V9ZA 4FJNA 3CWJA 3ZSVA 1T03A 4DQIA 4ELVA 2X6SA 3QZ8A 2AX1A 4JV0A 4EZ9A 4IH6A 4JLHA 4H54A 5KFIA 5JXSA 3EYZA 5C42A 4R8UB 3BQ0A 5F9NA 3KTQA 5K14A 3G10A 3NKYA 4N41A 4G3IA 3KLIA 1XR6A 4ZVHA 4BE0A 1XR7A 4Z4HA 2FJXA 3BQ2A 4DG1A 3OL6A 4O44B 3ZSZA 5KG5A 1BHLA 2BANB 1EP4B 4J9OA 3HPGA 3JYTA 4CK3A 4IH5A 4OGEA 4NLUA 4QPXA 2B6AB 2HVHA 4QCLA 3DYAB 2HNZA 4W5TA 1Z26A 3K59A 1RTJA 3RMAA 3HK2A 4E89A 1LAVA 3L2RA 3QGGA 2HHQA 4OL8A 1JLAA 3CDUA 2DFEA 4MH8A 3PZPA 3NFAA 4E0DA 3RR8A 4CFBA 4DTMA 3OSPA 3VQ9A 3MR5A 1YVUA 2V4QA 1C1AA 2HWHA 3ZCMA 2J6SA 1EXQA 1FKOA 5KI6A 1K6YA 5J2NB 1O1WA 4NLRA 1KVBA 2F8EX 1TL3A 4RNOA 2AGOA 4YFUA 3OYGA 2PY5A 1HRHA 4ECWA 5C42B 4R8UA 3OYEA 2RN2A 1JLFB 1KVCA 5KFYA 4KHYA 3OY9A 1HQEA 1D8YA 3O4QA 1JLBB 4FBUA 5CZ1A 4ECTA 1L5UA 4C8MA 4ED2A 3MECA 1EKEA 3HO1A 3LAKA 2I5JB 1HYSA 4CF9A 3K5MA 3FQLA 1T8EA 3DLEB 5DG9A 4DMNA 4BDYA 3UPFA 4KHRA 1TKXB 3V4IA 1Q9YA 1C1CA 5CYMA 5KRTA 3PV8A 2IJFA 4JS4A 3ICLA 2D0BA 4NCGA 2HMIA 3P5JA 4IG3A 1NK9A 4KV8B 2HHSA 2W42A 3RWUA 3LANA 1RT4A 4DQPA 4J2BA 4NCGB 3KK2B 1REVA 3EY1A 3SZ2A 2HNDA 1C0TA 4TY8A 1HNIA 3MEDA 3MXIA 2HVIA 1MU2A 1XWLA 5D3GA 3D45A 1HPZB 5T7BA 3UDLA 1NJYA 3RRGA 4H4MB 1HQUA 2KZMA 2VG7B 4YMEA 1LV5A 3SI8A 5SWMA 4CJTA 5F8JA 5J2MB 1NHVA 2QXFA 3OYHA 3I0RB 4DTNA 4FLZA 1S0OA 4CEFA 2YHAA 2HHVA 2OZSA 3HT3A 2RPIA 1C0TB 3GQCA 1Q8IA 1RT6A 3LWMA 4EBEA 1N5YB 3VQAA 2HNDB 2QKBA 2R2RA 2VWKA 4PWDB 1NOYA 2YNFA 3IG1A 1JKHB 1LWEA 3KLEA 4HUFA 1D5AA 4JUZA 3AVGA 5KGXA 1UOCA 4W5RA 1NK4A 3K5NA 1HJRA 4O3SA 1EX4A 3ZSRA 4RNHA 4HCCA 4J9MA 4J9QA 5CYMB 1KLMA 4FJIA 3K57A 3CVKA 3TARA 3C6UA 3BSAA 1N6QB 3ULDA 3DOLA 3VQ5A 3PW5A 5JS1A 3V81A 3V9UA 3SQ0A 4NYFA 3ZSQA 3DRSA 3H5YA 1QAJA 1ZBUA 3E01B 2FBXA 1HARA 4CIEA 1HQEB 3VQ4A 3MR3A 2BANA 4KSEB 3GV5B 3N6NA 1QQCA 3TABA 1L3TA 2D7SA 1SL0A 4PQUB 3I5AA 3AA3A 1RYRA 1I6JA 4Z4EA 4WFXA 4IBNA 3SUQA 3HL8A 3BSOA 2J6TA 4FXDA 4U7CA 3ZSXA 4EYIB 1OS5A 4DF4A 4NCBA 3FFIB 5L1LA 4FLYA 3CJ3A 4KTWA 4FJ8A 2IDOA 4M41A 1QUVA 4DLEA 3UIQA 4BWMA 4B9UA 1TV6B 3DI6B 1S1VA 4I7FB 4ZHRB 1FKPA 3JSMA 3QZ7A 3QETA 1SKWA 4NLTA 4E7HA 4DL5A 2IGIA 1GX6A 4FJ9A 2YNFB 4J9PA 4JV2A 2IJNA 1T05B 3DMJA 1X9MA 3AVFA 5HROB 5KGWA 1S9FA 1UAXA 4N47A 1HNVA 1XI1A 4FS2A 3SYZA 4H4OA 2OPSB 3GILA 1VSLA 4I9QA 4RUAA 1D0EA 1SUQB 2XRIA 2FVPA 4ECQA 4C8LA 4DU1A 1F21A 1T05A 2DTUA 2OPRA 2KW4A 4GC7A 3AO3A 3EZ5A 3NGIA 1JLEB 5DQGA 1IKYA 2IS3A 4IFVB 1L3SA 1RTJB 3DI6A 3LP3A 5KFZA 4YR2A 3VA3A 3T19A 5L1IA 4J9SA 2OPPA 5KT3A 4ED7A 3GYNA 1LW2A 5DQIA 2IAJA 4NZ0A 2G8HA 4FJLA 1JX4A 3FFIA 1JL1A 4ZPCA 1EP4A 2OPQA 3CO9A 2W9AA 2Z1JA 3KK3B 2FVCA 1REVB 3BREA 3CDEA 4J9LA 3IGNA 3ZT1A 2B43A 2WONA 1N48A 4FLTA 3QNOA 3CFPA 4FZYA 4KKOB 3GV7B 2CJQA 2AU0A 2CKWA 5FRMA 2W9CA 4TYBA 1RNHA 1WSIA 4NLDA 3CFOA 3DRPA 2OZMA 1C0UB 3MFHA 1B92A 2QE5A 2D5RA 3VQCA 2HHWA 5F8NA 1C1BA 3RB3A 3MF5A 4YQWA 4OPKA 1VSJA 3IGVA 4O3QA 3B6PA 4F3OA 3PW2A 3MTKA 2OPQB 3OYMA 3DOKB 4OPJA 4HUEA 3RMCA 2Z1GA 1TVRA 5DLFA 4QWEA 1BI4A 4CJ5A 2E6LA 3MECB 4ED1A 3HP6A 5CYQB 3KLHA 1LW0A 4K4ZA 2P5OA 4ICLB 4GC6A 5KFKA 3K58A 4M3WA 1UA1A 2VG7A 3IS9A 4HKQA 5HBMA 2UVWA 2OYQA 1WSHA 4R5PA 1RBTA 3AA5X 4F4ZA 3AVHA 4TQSA 1JLGB 5E41A 3MXMA 3EPGA 4EBDA 3Q8PB 5J1EA 2FBYA 4ZPDA 3H4BA 1T3NA 1CLQA 4K4XA 2WCXA 2IM1A 4JRPA 3RB6A 5HLFA 4GMJB 2ZE2B 3NH2A 2X74A 2YKMA 4IG0B 2V4RA 2B5JB 3HJFA 3C6UB 4RW9B 2W7OA 2FJVA 4TYAA 1KHVA 4Z4FA 2DY4A 3VQQA 4AHRA 3C94A 4Q44A 2RF2A 3OL9A 4RW4A 1RT1A 3HM9A 3DRRB 2C2RA 4ECRA 1RT7A 3PW7A 4FYDA 2WK4A 4F4WA 4YR3A 4OKJA 3PX6A 2DFHA 1C0MA 5HRNA 2IBKA 4RW4B 1IKWA 2IOCA 4FLXA 4ZVGA 2R8GA 3KLFB 3Q8SB 3L8BA 4FZZA 4DSJA 4ZPBA 4TXSA 2BGGA 2IM0A 2RDIA 4Y1CA 1JLFA 3QGHA 2R8JA 4FCYA 2XCAA 2VA2A 2E9RX 4Q43A 1NK6A 5KFCA 3OYNA 3PVXA 4B3OA 3OS1A 1SKSA 5SZTA 3T5LA 5J2NA 1U45A 4IKAA 4M3XA 1TK8A 3OS0A 3B6OA 4KAIA 4M45A 4J2AA 1TKXA 4MKBA 4ZP7A 3KMSA 2B5JA 4LH4A 4FLWA 1RT2B 4B9NA 1JLAB 4FLUA 5HLFB 1HPZA 3TAGA 4OLBA 3QLHA 2WTFA 2W8KA 1S6PB 4KTQA 3KHGA 4CGFA 3M8RA 1TGOA 2IMWP 4Q45A 3OYAA 3KD5E 4HVJA 1TAUA 4CHQA 4CJPA 3DRPB 4KFBA 3AA4A 2C2DA 4B08A 3AO5A 5HBMB 1SH2A 1WN7A 4M3UA 1LWEB 1SUQA 3KLEB 4O44A 1UA0A 1RDBA 1JLQB 3NF8A 1VSMA 1C1BB 5KFTA 4K4WA 3CQ8A 4IDKA 4EYHB 4MIBA 2AQ4A 4MK8A 4O4RA 1C2PA 3PX0A 1SV5B 3PW0A 4WFZA 4K4VA 4RW8B 2FJWA 2D0CA 3OJUA 3U3GA 5KG7A 1ZTWA 4CF1A 4FJ7A 3NMAA 2XGQA 1KVAA 4CFDA 5KT7A 3KLHB 2HHUA 5KRSA 1JLEA 3I5BA 3S3NA 1S9EA 4RW8A 3NHGA 3T5JA 3N6LA 4CF0A 1NOZA 3SV4A 3IAYA 4NLGA 4FJXA 2YNGA 1J5OB 2YKNA 2G8VA 1D1UA 1N4LA 1RBUA 3AO2A 4CK1A 4I9LA 2Y1IA 4DLGA 3NF7A 3DLKA 3EPIA 4CHOA 3O3FA 2XY7A 4MQ3A 4DL2A 2IM3A 3UR0A 4AILC 3MR2A 4IR9A 3V6JA 3ZT3A 1NNDA 3LALA 1KRPA 1ZTTA 3CJ5A 3ZT4A 5DGAA 3RB0A 4CF2A 2I1RA 1GOBA 1RCHA 3TAQA 2FVRA 4H8KA 3PX4A 2O4IA 5KG6A 4ID5B 4IFYB 3PO4A 3DOLB 4FW1A 1RILA 4DTRA 2QV6A 2VWJA 1TL1A 4DSEA 3RRHA 4CJSA 4W5NA 4RNFA 4Z4CA 1ZBHA 2B4JA 1S0MA 4CE9A 5KG2A 5C25A 3C6TB 4H4OB 3NAHA 4NLVA 3QERA 4DTXA 3SPZA 1CZBA 4B9SA 4AHSA 3IN5A 3QINA 3OHAA 4GVMA 1KHWA 1TP7A 3OYKA 3M8PA 3PUFA 3D28A 5F8LA 3AVNA 3VQEA 3H2LA 3DM2B 3KKSA 3OVNA 4AHUA 3G0ZA 2D3UA 4O3RA 2WONB 3OL7A 3F9KA 3A2FA 3V1OA 2ASJA 1R0AB 1K1QA 3ZSOA 4QW8A 4TN2A 5KFMA 3ASMA 3I0SA 3ZSWA 1RA7A 4EP5A 1RT7B 2JEGA 3DRRA 4WE1A 1S9EB 1N6QA 3CG7A 3WNHA 1RT1B 3NH1A 3AVBA 1KFDA 3PJWA 3E01A 4J2EA 3HKWA 3CDWA 2BQ3A 3BQ1A 3HSTB 4IFVA 3RAXA 1RT2A 3SJJA 2BRKA 1RTHA 1UWBB 5J2PA 5KG4A 4ECZA 3SQ1A 3LAMA 4K4YA 3OYIA 4IKFA 3GIMA 5DQHA 4RNNA 2YNIA 2ILYA 3SUPA 1JXBA 2RDJA 5DK5A 2WHOA 2YKNB 3LP2B 4MFBB 1A5XA 2AGPA 3AO4A 1TAQA 1FKPB 5J2MA 3S3OA 4CJLA 4I7FA 1S1VB 1IG9A 4GW6A 4Q8FA 5KFWA 4DTOA 3BGRB 3HYFA 4LSLB 3G86A 5CY4A 3OL8A 2Y1JA 2JEJA 2JEIA 4Z4GA 4O3OA 3DLGA 4XPEA 3M9NB 2ATQA 3VA0A 2AX0A 4KTZA 1ZBFA 3QEWA 3LP1B 2DPJA 1YT3A 3KKRA 2RF2B 1S1WA 4Y34A 3AVCA 2A1SA 1QS4A 1BQMB 4JS5A 1S9GB 3V6DA 1RT4B 3KD1E 1DTTA 4DTUA 5FRNA 5EWFA 3L2WA 1ASVA 3LWLA 4F2SA 4KAZA 3T3FA 2O4GA 2HMIB 4MK7A 4NLQA 2R7YA 3BJYA 1Q9XA 4TY8B 1RTDA 1EETB 3OS2A 3KIOA 4F4YA 2D3ZA 4YNQA 3DLEA 1Z4UA 2P1JA 1HQUB 4DQRA 3NAIA 1MMLA 1S1TB 1KFSA 5EWEA 2IAJB 4LY7A 3KHHA 5JUMA 1XC9A 2ASLA 2J6UA 3C6TA 5KFHA 1HNIB 3MEDB 3V6DB 2E6MA 5KFOA 1S5JA 3OHBA 4Y2AA 4F3TA 4BE1A 1IKYB 4E3SA 2XY5A 4KHUA 5KT4A 3JYTB 3H5XA 4FJHA 1TK5A 3G6XA 4ECUA 3VQDA 3F73A 4IG3B 1IH7A 5FROA 1TKZB 4LQ3A 1NHUA 2PYJA 5DG7A 3M8SA 2WB4A 4X2BA 1EETA 4K50A 3NDKA 4BWJA 3QEVA 1NKBA 3BSCA 3HVWA 1WNSA 5I42A 3KK3A 3H40A 3H5SA 2JC0A 4CJ3A 3DMJB 4G1QB 1RDAA 4CJQA 4CHPA 3TI0A 1JLCB 3MFIA 1WAFA 4FLVA 4CJUA 2ZKUA 3M8PB 3PW4A 4CJRA 1QTMA 3CJ0A 4DL7A 3T5KA 2BRLA 4LSLA 3NE6A 1ZYQA 3PO5A 2FBVA 3T1AA 4OGCA 4CEEA 1IKXB 1VK0A 1C1CB 1A5VA 2UUTA 4ZVFA 2UVRA 1VSDA 4KHMA 4CEOA 2XY8A 4DF8A 2XWYA 3OYJA 1TKTA 1WSFA 1JIHA 3AVLA 4EBCA 2EHGA 3I8DA 2HW3A 4B9VA 3KK2A 2FLLA 2XGPA 1W9HA 1J53A 3WNFA 4Q8EA 3NBPB 4KO0B 4AHCA 3NF6A 2OA8A 4RW6B 1QSYA 2XC9A 4CJFA 2OPRB 5KG0A 4FJJA 5EU7A 1BCOA 1BIUA 4KB1A 5KFXA 4AHTA 2OH2A 4U6PA 5HP1A 1JL2A 2A1RA 4M3RA 3DLHA 3TQ1A 4IOBA 3KLIB 3CM5A 5CYQA 4JRQA 3QNNA 4OJRA 3QGIA 4CJWA 4C8KA 4CIFA 4WZQA 2V0NA 2KQ2A 2HHXA 2BQUA 4BDZA 1D9DA 2R2TA 4DFMA 3HVAA 4LSNB 4RZRA 4NLXA 4ELTA 1K1SA 1HYVA 4DL6A 3D5MA 4CJ4A 2RKIB 3E51A 3HP9A 4LSNA 3G6YA 4CGDA 3TWHA 1HMVA 1NK0A 3FSIA 1JKHA
chains in the Genus database with same CATH superfamily
2YNHA 4CGHA 3LDPA 4DN9A 4NLSA 4CM0A 3N5FA 4F9OA 4OYPA 1UVIA 4NLYA 3RAQA 3QWUA 3H98A 4A2BA 4FJGA 5ETRA 4BC7A 2QLBB 2MB0B 4AQYF 4R79A 1X0PA 3NBPA 1NK8A 2E1CA 5F3TA 3RB4A 4J9KA 3V1RA 4JK7A 2LSNA 1WBBA 2X78A 1RBVA 1BA1A 4CH7A 2ASOA 3QMQA 2V52B 5C25B 2XMMA 2AP1A 2NSCA 2QLXA 1LK7A 4CEDA 4GO7X 3ZTRA 2HGNA 2QX0A 1KNZA 2R9LA 3L4IA 4DV3J 2BYCA 3FSXA 5I3UB 3T1HK 1K9MT 3AVIA 3SBGA 3CSKA 3OPKA 4TU8A 4GVEA 2UUWA 2H5EA 2HFVA 1XHXA 4YB1P 1QQOA 2P6SA 3CIMA 1ASWA 2KL8A 1FD2A 2R2SA 3NCPA 3OYLA 4GVBA 2ZZMA 3PJXA 4NLOA 2DH9A 1CJVA 5J2QA 4FKYA 1WF2A 1N32J 1VQ9S 5G0RB 3M7VA 5KFVA 1FK9A 2FPHX 4XO0A 4FZVA 1T3VA 1HA1A 2XNRA 3G9CA 3EUNA 4ZCLA 4OPHA 1A6LA 3PEJA 3SXLA 3G96A 5GADP 3L2UA 2R4FA 1TKTB 1BISA 4WQ5C 4BE2A 4HHJA 2VH7A 2OCEA 4NRTA 2DIUA 4TKTA 1CZ9A 3QGPA 2IY5B 2LMIA 2VPYB 3TNVA 1BQMA 2H3GX 4M3ZA 4DXLA 2WOMB 1XIQA 3THYB 2F3JA 2QA4N 3HSDA 2B8PA 3AA2A 4DFKA 1CQNA 1WG5A 2BDPA 2UVUA 4DV5K 1J5EJ 3QJJA 2V7ZA 1NRKA 2JLGA 4LF8K 1RDCA 1YUWA 5K8PA 2CJBA 2WTUA 3MXHP 4FXVA 5F0XA 3JSBA 1V3ZA 1HBMB 4LBIA 1U09A 3BO4A 4UTGA 2WVDA 1PKUA 4FWPA 4DHYA 4KHNA 4QAGA 5E0OA 4JI4F 3DHXA 4HHUA 3A13A 1FESA 5HQLA 4I2PA 3S9HA 2DFFA 3HLUA 1MMDA 4I4BA 4CLUA 2YJEA 4KHPF 1LW0B 1H38A 1Q81O 2HIYA 4Q0BA 1I39A 3MM7A 1OIAA 2YX6A 1BGXT 4UT4A 3IR7B 3VQSA 3MEGB 2F8MA 4IWVA 1A5WA 3QFHA 3THVA 4F4XA 3VAJA 5HP1B 5CCLA 3M4XA 2DPIA 4EIAA 2O67A 1DHMA 4CGGA 4FVCA 5G0RA 2ZH6A 1DRZA 5IOLA 5JVGL 2Q3SA 4CEBA 4QYRA 1E6VB 2FHOB 1Q1KA 1IBCB 5E3CA 2Y0BB 4L3KA 3J7YU 3J7AP 4PKDB 3VMFB 4BCAA 2DNNA 1S1XA 2YNIB 1SBRA 2PSZA 1CQMA 5L9XA 3KHYA 1B7FA 4FVMA 2MLXA 1RTHB 2QTWA 2R8HA 1HMVB 3ZX2A 4V1Ak 3THPA 1OY8A 1NJXA 1TQLA 4RNMA 3M6WA 1LOUA 4FK0A 5GIPA 2RHSB 2OEJA 4M3YA 2PFFB 3DYAA 1DQAA 1QAIA 3CJBA 2R8IA 4IFEA 2P9UA 4CD3A 1AFJA 1R0CB 2YWGA 2C28A 3KOAA 5M2RA 1HX1A 2QGFB 5BPLA 2GTDA 3I55S 4S0MA 2PZSA 4HHTA 3IMXA 3SQ4A 2RQCA 1OSCA 2EWSA 4IOCL 4LD0A 3CJRA 3GV8B 4JOUA 4NXMF 3LP0B 3MOZA 4IOCQ 4ZTFA 3PACA 5B09A 4Z4IA 1T9YA 1DLOB 1HNWJ 2Y8YA 4KO0A 4LF4J 4DV6J 3TVKA 4DV7K 4AM7A 5LXRA 3UB5A 5EGYA 4XK8C 2KVIA 4CEZA 2AF6A 4E7LA 4I2QB 2HNYA 1S6QA 2YXLA 1VGYA 3N79A 1V9OA 1N56A 4YOXA 4YORA 3S41A 4OI0A 3AJDA 4Y2CA 4NMLA 1ZM3A 3KK1A 1HLWA 1BQNA 2RU9A 3G4SS 1G15A 3T1HJ 3E66A 1KVKA 4NLPA 4E1MA 4B3TJ 1WI6A 1SIWB 4J9VA 1HUXA 2OLWA 4JV1A 2CH6A 4B9QA 4ECXA 5KFDA 4DFJA 3OYBA 2E5LF 2VYPA 2K1RA 3TANA 3P4UB 5KT6A 2E7XA 4IRKA 4NL5A 1T11A 4B3RJ 3PSIA 3AAQA 2ADBA 2AP6A 2IA6A 3WXJA 4DR6K 4OMFG 3FEXB 4CGIA 1H0HB 4ID8A 1IKVA 3VQ7A 2VBYA 4DV1F 4B9LA 4ENOA 4K0KJ 1C6VA 3HPHA 4JI3K 4QIEA 3QPIA 2KFZA 5KFJA 3CGIA 1TMJA 4FOIA 2FJBB 1UFKA 1X31C 5GADI 3AGRA 4UOCA 2XG8A 5KT5A 1OQ3A 2GCFA 2M52A 5JVHQ 1LWXA 1AA1B 1WWHA 3A4TA 3CJ4A 4USKA 1T03B 1YVFA 3FQKA 3TA1A 3BGLA 5JLHA 3JS6A 5J2PB 5KT2A 2LCWA 2GIRA 2KVQE 2L3MA 1VSEA 5HRPA 5AQJA 2P9PB 1T9TA 3RMDA 4ER8A 2KM8C 4E19A 5CR4A 5E5NA 4J9NA 4ZP9A 3TAEA 1VQPS 3F5TA 5EVZA 4K4UA 3S6EA 1YTUA 4WQ5A 4WE1B 2IVMA 3KKFA 3WC0A 2N4CA 4P52A 4DUYK 2DNKA 1JLCA 2QN6B 1EQYA 4QIVA 5EX3A 3M8QB 3O4NA 1SQKA 1I94K 3HD2A 1JLBA 4J8FA 2BMBA 1WAJA 3W0LA 3UE5A 4ZVUB 3OW2M 4FM2A 4CEQA 3CI5A 4DR5F 1JCFA 3J7YP 3QIOA 1ZBLA 4B9MA 1VQ9N 1CS4B 3IM9A 4CJVA 4U67Q 2CPFA 2HIQA 2EKNA 2BEFA 4A8YA 5JLFA 4LF5F 3BR9A 5KFNA 4BC9A 3IAM9 3BS9A 4ED3A 4QOZB 4DQQA 4JP8A 4PQAA 1PAEX 3QT5A 4DU3A 1SH3A 5BN9A 3VENA 2O8CA 1K9MO 3G8SA 2FLNA 3FRZA 3SSRA 4USIA 1LWCB 1LFWA 3CDAA 5J2QB 1FCAA 3VQ6A 1NZAA 4O0JA 4CHNA 2R8KA 1X4EA 2VA3A 2ZGZA 1UVNA 1VC5A 3O5BA 2RRAA 5HJXA 1KC8O 4DR7K 3LOUA 1RBRA 4PUOA 2P6TA 2JVRA 2IDLA 3IUCA 1VIOA 2P5VA 3TJ8A 3VQ8A 1AYEA 4ILGB 2HS3A 2Z8QA 4JBCA 4DV3F 3NGSA 2MKJA 3RBEA 4PKIA 4CT9A 3W3SA 3E9LA 2YX7A 3NLCA 3DXMA 2X6NA 2VDIA 3R3TA 5F8GA 2LA6A 3QEXA 2X1AA 5LMNF 2A6OA 4NLWA 1EZZB 4R0EA 4DR4F 3M5RA 5L46A 1ZM9A 4RW7A 2DO4A 1BUPA 2B9WA 3A5OC 1OYEA 1R89A 1RT5B 4B1UB 5ELZA 3Q8RB 2CJ9A 5KTQA 4DPYA 1SQGA 3O2IA 1GOAA 4IDHA 2XHBA 4R5PB 3K8VA 3GG1A 1S7HA 4RU9A 5CZVA 4RO0A 1T44A 4LMZA 4JYAF 2WRMA 2B7CB 2GIQA 4NXNK 3J80O 2PFUA 5DMRA 1HYSB 4ZHRA 2J7UA 1IUJA 1TV6A 3KJVB 4K4SA 1T94A 1RBSA 2A6MA 4U95A 2HWIA 4DZ6A 5HO4A 1YJTA 1EQ0A 4LF9K 2XMJA 2JC1A 2H65B 4Z0UA 3PY8A 3P83D 2QW9A 1NBWA 1NUEA 3BN4A 1FDNA 2JWNA 3NS5A 3NH0A 4CLSA 1BWFO 4CESA 4FJNA 3ZSVA 1E6YA 2AX1A 4X62F 1HIYA 4G65A 4DR3J 4JLHA 5L38A 3CCSS 1URRA 2YH1A 2KRRA 5A6WA 2IPOB 5AQKA 3SCLE 5F9NA 3KTQA 2HVEA 4KH0B 3FGVA 2XS7A 4I1TA 4Y65A 5LMUJ 3D2EB 1X60A 3ZZTA 4RBTA 1NGDA 3TTCA 3BQ2A 4C9DA 1S59A 5KG5A 3J81Y 2JH3A 4Y2MA 4KHPJ 1FJ7A 4GRSA 4KYZA 1HW9A 3TPQA 4G1PA 1Y9OA 2HLUA 3C16B 3MPYA 2WUSA 1UZHA 1Z1ZA 4Z2XA 2UUCJ 1U1NA 4OL8A 1RAOA 3K89A 4KGZB 3CDUA 2DFEA 1WSVA 3PZPA 3NFAA 4DPXA 1Q95G 2CQDA 1DBDA 4DU8A 3OSPA 1Y4ZB 1YVUA 1YDLA 2BKNA 1BY9A 2HF3A 2J6SA 3AY0A 1FKOA 5KI6A 3A3PB 4JI0K 1KVBA 3OTOK 3TTDA 5HAOA 1VAZA 2AGOA 4YFUA 4JI1F 3OYGA 4Q2MA 3NGKA 3OYEA 2RN2A 1JLFB 1KVCA 1Y3JA 4C4WA 4DV2F 1R8CA 4FBUA 4DKWA 5JMVA 3CXCR 1U6FA 4C8MA 4LRAA 3THYA 1EKEA 3HO1A 1YQHA 1WUUA 1FXRA 1EWQA 2H5JB 1HYSA 3K5MA 1T8EA 3WDOA 3CCLS 2LFVA 5DG9A 4KIAA 4BDYA 2CVIA 1Q9YA 2EG2A 1KAXA 2KLAA 3EN9A 5E84A 2D0BA 1WUAA 3P5JA 2UZAA 2CYYA 2IRXA 2QL7B 2CDRB 4DR1F 2DT9A 3RWUA 4BRHA 1UAWA 4F26A 1RT4A 4DQPA 3ID8A 4NCGB 1REVA 5AQYA 3EY1A 2PC6A 2KT5A 4U7UD 2MSSA 2NZ4A 3ZEUB 1ZC6A 2O8CB 1XWLA 4MTPA 1VC6A 2ZH8A 3W8PA 4BRCA 3D3CJ 3RRGA 4YMEA 1DURA 2XSJB 3AD8C 3VF6A 4FF4A 2YI1A 5J2MB 1TFYA 4IQMA 2NYHA 4ZKAA 4ZPVR 4DTNA 2GZOA 1AUSL 4RPFA 1VQKN 2YHAA 1N88A 1X4CA 1DFDA 1K0VA 3D54A 1U1MA 2RPIA 1C0TB 3GQCA 2AKWB 4F0MA 1FFGB 1Q8IA 1IQTA 1DKGD 1RT6A 3TUPA 2QXLA 3VQAA 1U26A 2R2RA 3Q22A 1SKUB 4E1JA 3VAHA 1LWEA 2UUBK 2MXYA 2IVOA 4GV6A 1RWOB 1KQSM 2F65A 1A0OB 3K5NA 2VU5A 5E7OB 3FBCA 2V69A 3FBFA 3BZCA 1X8DA 4K0KF 3N4QA 2U1AA 4J9QA 3W2VB 1Q53A 5CYMB 1KLMA 3K57A 3CVKA 3EM1A 1N6QB 1M0SA 4OYXA 4UOHA 1LEOA 3CCES 3UCZP 2OKQA 5FPDA 4AF1A 4OZLA 2DR8A 4ZN3A 1N32F 1EKRA 4WFAQ 1QQCA 2JZ5A 1SL0A 3EVMA 2ACMA 3I5AA 2AJFE 2BJ8A 4WFXA 4GKKK 4XAKA 4IEEA 1TYQA 2J6TA 4WTOB 4U7CA 4KQZA 3WXKA 1OS5A 2CPIA 1WC6A 1F2GA 4NCBA 2MPUA 2K06A 2RNEA 1GTHA 2J9CA 3DOMB 3CJ3A 2AD9A 4FJ8A 1U0SA 4DLEA 4B9UA 1S1VA 2MZRA 3GCWP 3OTBA 1MDUB 5GAHU 1HWKA 4GV3A 1U1RA 3MM8A 4NLTA 4FWRA 1LKZA 2RH3A 4FJ9A 3JTOA 4J9PA 4C11A 2VPWB 4JV2A 2IJNA 3WHIA 4HI2A 1X9MA 5E3RA 5KGWA 4N47A 5DM7L 2QJ3A 3EXYA 1XI1A 4H4OA 3GILA 2HOEA 3OHRA 3NVKA 4I9QA 1D0EA 2DHSA 4L72B 3A8YA 2ZJRL 2DTUA 3R5GA 3EZ5A 4YOVA 2AJ0A 1WEYA 4QIWD 4IFVB 2EW9A 1L3SA 4JKEA 4QS8A 4BQZA 3KYLA 3PYGA 4YR2A 1TR0A 2HVZA 5KT3A 4DCPB 5DQIA 2IAJA 4NZ0A 3UO0A 1MW7A 1JL1A 4ZPCA 1EP4A 5GVQA 3MMAB 3FBBA 1VQ5N 4NXMJ 2J5AA 3TUZC 1ZPVA 2VFTA 4KHPK 2GV1A 5I3QA 4NPOA 5HMYA 4FF2A 4KKOB 3HHNB 3F44A 2AU0A 2CKWA 2W9CA 4JI4K 1RNHA 4YB5A 1W2IA 3IWNC 1PAUB 1X4AA 2E66A 3ENAA 4UZCA 2YKPA 1BO5O 2XMUA 2XNQA 2DGTA 4YB7A 4BVOA 5AZJA 4YQWA 4OPKA 4O3QA 2CQ0A 1NDPA 4CQ1A 3PW2A 2COLA 4JK8A 4Y0FA 3DOKB 4OPJA 2Z1GA 1VHFA 1KXPA 1BI4A 2VICA 3HP6A 2UXCJ 1LW0A 2XYHB 4K4ZA 4ICLB 3ZO7A 5EX5A 5KFKA 4OX8A 3MR7A 4BHQA 2AYBA 2BJ3A 2DY9A 2W24A 4P2SA 4HKQA 2GVZA 2O01C 5HBMA 3GJSB 5C10A 2OYQA 3UN5A 4X65F 1WSHA 3CCQS 4F4ZA 3D6RA 1CJTB 1JLGB 4PXCA 4DUZF 3QT8A 2V8VA 1WEXA 1VR6A 2QFIA 5CXTA 2VCPA 1HPMA 1P1TA 1X4GA 1HNWF 4A8XA 1T3NA 2P9GA 2ZM6K 2DJWA 4BC5A 4GMJB 2ZE2B 3UDEA 2ZJQL 2X74A 4D3HA 2W7OA 2YHYA 4WIQA 5AQUA 2CIMA 3VQQA 1YHQN 3CMAN 1MWMA 4Q44A 3FCVA 3OL9A 1K8AO 4PEOA 2FTRA 1Y0HA 2E8AA 2K7KA 4ECRA 1JNRB 3CO0P 3T1HF 4FYDA 2GHVC 1RAHB 4QR1A 4DR3F 3LPEA 3LM2A 3PX6A 2DFHA 4CI0B 2E29A 2CPYA 4GY2B 2EC2A 2V94A 1HW8A 2HZAA 2WFBA 2VFSA 3GSIA 5KFCA 3EKSA 4B3OA 5J2NA 3VETA 1TK8A 1EIYB 3OS0A 3B6OA 4M45A 4AD6A 3CJ7A 4ZP7A 4CH0S 5LJ3Y 1GMVA 2B5JA 2D9OA 4LH4A 4FLWA 1RT2B 1JLAB 2UUCF 3Q8VA 4FLUA 4HHHA 3TAGA 1AUDA 1VOMA 3POTA 4OYMA 5KOXA 3FZFA 2WTFA 5AE2A 4FO0A 3H45C 2MKSA 5MLCQ 1EB0A 5CD4H 1NH7A 2RHQB 3SIPB 2IMWP 4OQJA 5AQPA 4QOTA 3OYAA 3KD5E 2J9DA 3VAFA 5A2QY 2C2DA 1WKLA 5HBMB 1SH2A 4OV1A 1WN7A 1SUQA 3BH7B 3UD5A 1UA0A 4DPUA 1TELA 1RDBA 1VLYA 5KFTA 1H72C 3NCQA 4MIBA 3MCMA 4FXWA 2DIVA 2G0JA 2DGWA 4LF6F 4J5OA 3ET6A 4B3SK 2DYAA 1MMNA 3VR1A 3NNAA 2KYZA 3R1LA 3HDSA 4RW8B 1D3WA 1WC3A 3OJUA 4PABA 3Q2TC 3LW5C 3U3GA 5KG7A 2XGQA 1KVAA 4CFDA 3DGPB 1FJGF 1FRMA 4ZVPB 4PRFA 2W2PP 1NHKL 2XS5A 2P9LA 1FKAF 1S9EA 4NI2A 1FRHA 3TTFA 2M8DB 1R8AA 2QMXA 3BP8A 3SV4A 4FJXA 3DDNA 5T7LA 2YNGA 3W60A 2NS1B 2FSKA 1VC0A 4WU2A 3NF7A 2MQPA 1S5ZA 4B02A 2OIHA 2A2CA 1S6UA 1Q4RA 3C2PA 1G1XA 2PN6A 3A5NC 1HJOA 3C19A 2ZWPA 3LALA 4OYIA 3K7RA 5DGAA 3Q24A 2PT0A 3S1TA 3VAMA 3TAQA 3R5CA 1XMBA 5HN0A 4IFYB 2UV8A 2QSFA 1HKBA 2Y8WA 2IRUA 2VWJA 1TL1A 2AEMA 2ZH5A 2NRVA 4CJSA 2DRBA 2HQGA 1VQSA 5CQGA 3R9LA 3C6TB 4H4OB 4NLVA 4LSZB 2C2MB 4AT1B 3IN5A 4P71A 4QBUA 3OHAA 1PYSB 1KHWA 2BW2A 1TP7A 4M5KA 3FNNA 3M8PA 3PUFA 4JKHA 2VGNA 1YI2S 4OHYA 3DRXA 4JKGA 2NXUA 4IO9L 3N01A 1WHXA 4ILRA 1YTYA 3OL7A 1NGJA 1CC7A 1R0AB 3JXOA 2V8PA 3ZSOA 3O6WA 4QW8A 5KFMA 3ASMA 1IM6A 3M2UB 2R7RA 3I0SA 1ZH5A 1SZ2A 3W7BA 3AD7C 4EP5A 1RT7B 2VZ9A 2BOPA 4WE1A 3EICA 3PYFA 1S9EB 3CG7A 4PYDA 2GELA 5IT9O 1RT1B 4I69A 7FD1A 3AVBA 3AQOA 3P31A 2ATCB 3PJWA 2CVEA 3MN5A 5LMNJ 1RWUA 1LK5A 3CDWA 2P9KA 3BQ1A 3HSTB 4ISEA 4IFVA 4ATNA 3O3LA 3RAXA 2H4YB 4L73A 2BRKA 3EZWA 1YAGA 4ECZA 3CCQN 2HAFA 3DJCA 3LAMA 4DBQA 2R7TA 2ILYA 2QFJA 3LGMA 2PMHA 5A8KA 1KS2A 2Z2LA 1NPKA 2QWLA 3CQYA 1YITN 3GMGA 3RJMB 2FHJA 4QS9A 1RWPB 4BROA 3SCJE 2DNLA 1FKPB 3S3OA 4A8WA 4CJLA 3BEXA 3D2FB 4Q8FA 4DTOA 3WX8A 2ABYA 2H3EB 2HBJA 2E1YA 4DR4K 2RT3A 2JEIA 4JI7J 3N4WA 2AX0A 2IVFB 2QA4S 3QEWA 3C3LA 2Y3YA 3KKRA 2D0OA 1S1WA 3AVCA 3OTOF 4JI1J 5F0WA 4OI6A 3Q89A 1BQMB 4JS5A 1S9GB 3V6DA 3FVYA 1S6OA 2DHHA 1M5OC 4H5TA 2DRDA 3LDLA 3T3FA 2O4GA 3PKMA 3C15B 1MA9B 2R7YA 1RU1A 4JI3F 4H4KC 4BR0A 4MIWA 1R6YA 1G2EA 4LR7A 4MLEA 1O8BA 2E5IA 4FPAA 2MZ1A 1H3DA 4YNQA 3DLEA 2W25A 3A3OB 4DQRA 1MMLA 4CLZA 2NUUG 2F9TA 2LKZA 3KHHA 1K8KB 5JUMA 1OJ4A 1HNIB 1OO0B 5KFOA 3OHBA 4ZIVA 4DV4J 4Y2AA 3MAAB 5AQIA 4E3SA 3R27A 3H5XA 3G6XA 3VQDA 1P27B 3F73A 3CQXA 1ILYA 4LQ3A 2PYJA 5DG7A 3ZC4A 3M8SA 4C2MA 4WK1A 4BRAA 4K50A 3NDKA 1NKBA 3LDQA 3HHLA 3NVMA 2DK2A 5LXYA 4HT7A 3H40A 3DMJB 1R0BG 4CHPA 1S7IA 1HBOB 1WD6A 2W1BA 2NPFA 3CJ0A 4DL7A 3T5KA 1GLBG 3ILLA 4U8VA 3T1AA 1U6ZA 1IBMF 5C2CA 1IKXB 4X4VA 4RWTA 3E3XA 3P3DA 2UUTA 3IMQJ 4KHMA 1RDWX 2XY8A 4JN4A 3OYJA 1SCJB 1OKJA 1VQNN 4LFBK 3MMBB 5A8WB 1WSFA 4J91A 2DGQA 1PYOB 2EHGA 3I8DA 3WT0A 2Y0SD 1BA0A 3KK2A 2ZWHA 5FLXY 1S76D 3F0NA 4Q8EA 2DO0A 3TYTA 4IEIA 1EAYC 5ETVA 4W4MA 2OPRB 3AFGA 1R8HA 4KB1A 4GNIA 4M5NA 3G6EN 3LUYA 3M8WA 5CH7B 4AYBD 5HP1A 3ENOA 3THXB 3DLHA 3TQ1A 4DX6A 4ILLA 5CYQA 2FJDB 2V8DA 1NU4A 3NWGA 4CJWA 4CZMA 2V0NA 3TZXA 4BQLA 3G71S 4ZOSA 2R2TA 4ANCA 1D9DA 2IVPA 4J7CA 4NLXA 1YJWS 2LDYA 4DL6A 3R5BA 3HOTA 2VFRA 4CJ4A 2N3OA 3BPDA 1NGCA 3E51A 2ZKTA 4LSNA 3G6YA 3TWHA 3M6XA 5D4LA 3WXMB 2MQOA 5M1PA 2VODA 4WYBA 3JSYA 4MMOA 5ITHA 2BM1A 1DLOA 2UXDJ 3AVJA 1RWVB 1H74A 3OXGA 3MM6B 4DJBA 2KTQA 1TZ0A 4IRDA 1S22A 4XPCA 2ZGYA 5GAHI 1HNXK 1HNZK 9RUBA 2E5HA 2MEWA 2FVSA 1HNXF 2MMYA 3GP9A 2LDIA 4CJKA 2LXFA 1M1GA 2RKIA 4BC4A 5KFLA 4YN3B 2R42A 1FW6A 5EUHA 3JAMY 2FBTA 1F3FA 2PE8A 2OO4A 2XI3A 4ZP8A 2D3OR 1OMSA 1P8GA 2W40A 3L2VA 4IO9Q 5HVFA 4YS2A 4Y1DA 3M9OB 3SFGA 2LXUA 4E7IA 3H4DA 2QA1A 1CXUA 3R9PA 1RCXB 2UU9F 2B56A 4LF6J 1EO1A 4TU7A 1XUPO 2VG5B 2AYEA 1VQLN 4Y3CA 3ISND 4CHYA 3DXMB 4OX9J 5IT0A 3K9JA 4HCBA 4MKYA 2XQCA 1GEHA 3VCDA 3I8BA 1PBUA 5KFQA 2BKOA 2FVQA 3CC2N 3NOCA 5FLXO 1MU2B 3UW1A 3AGKA 3C6AA 3W8GA 3D0GE 4N76A 1RTIB 1RHKB 1ITGA 3OYDA 1FDAA 4CLTA 1Q18A 2I8EA 4I6MA 4CDIA 3O3GA 2WSCC 1DY3A 2VBZA 4R25A 4LFBF 4O3NA 3PR5B 4XEIA 5MLCV 3DLLL 4DTSA 3G87A 1UFLA 2D41A 3RAMA 4X66K 1SVDA 2F40A 4LBHA 3QJLA 2RU3A 1R0AA 1QSLA 1S1WB 1Y7PA 1N34F 1PIEA 2BJ7A 3IBWA 3BKTA 2V6AA 5B0AA 2P9CA 1F3VA 4Q2LA 3N6MA 3D0PA 1WOSA 3AOAA 2JGUA 2CQ4A 2VFVA 4CO2A 2F8TA 1O0PA 3NNHA 2H4WB 5KFGA 3VERA 1RDDA 2CQCA 2EX3A 3T69A 2Z2YB 2UUAF 3DU5A 3GFYA 1HR0J 3MK6A 1RHJB 1RTZA 5THWA 4N5SA 3U1MA 4AL5A 3GPAA 5F8IA 5DO2A 2H9ZA 4M42A 2V2KA 3AO1A 2F1FA 5KFBA 1WKKA 4TQRA 3GIIA 4L8RB 1FA0A 3TSUA 3TVYA 4PWDA 3TSQA 1N5YA 3CERA 3MI7X 1GAOA 1JB0C 3NRBA 1NCLA 3CJ2A 3VTHA 5GMEA 2EFVA 4RW9A 2VG6B 4ZPWR 1QZ5A 3AQPA 4ED8A 1ZBIA 4FJ5A 5D0RA 2OPSA 4RJVA 3IM8A 2FLOA 2ZWOA 1FWPA 4FWMA 2VD3A 3LZIA 4A61A 4ZVSB 1LWCA 4LFCK 3MM5A 1RYSA 1NAQA 1WDDA 3D6HB 2UXCF 4PKHA 4J2DA 3JSMB 2GV9A 3I31A 3PNIA 3R5DA 2VOPA 1QE1B 5DDOC 1V4TA 2DGOA 3SPYA 1WSRA 3NCIA 4HTJA 4YDXA 1NZ8A 5K14B 1JLGA 3HVTA 2AWZA 4MFBA 1OSDA 3LL3A 4ZP6A 4L6V3 4ZLLA 1U49A 4YP3A 4GVLA 3N5BA 4WKRA 3C95A 2BE2A 4KE5A 1JCEA 4CEAA 1FEHA 3H25A 3DOKA 3PG9A 3U8XA 1WG4A 2R7WA 3OLBA 2H48B 2BE9B 3MEEA 4JV5J 2BXJA 3K5OA 1CSJA 2IIHA 2G13A 1J27A 4EEYA 4K8ZA 3LDSA 2VJVA 1FT8A 3L3VA 3O08A 1DTQB 3HI9A 4KRFA 2P9LB 2V9WA 4IFYA 3QFUA 1S6QB 1RTDB 3E8OA 4I2QA 3UNGC 3P45B 2HAIA 5ETNA 2HHPA 4B3OB 1H1VA 4OI3A 2ITGA 2XYGB 4U7UK 3QEPA 4AL7A 2QWPA 1YWXA 3EO3A 1L3UA 5HJYA 3SJHA 3CFRA 5GMKa 4X4SA 5G4DA 2HHTA 4NXNJ 5FJ4A 3V9WA 1QD1A 3MWBA 1U6BA 1ATRA 3RBDA 4ZN1A 1WACA 3R5JB 1KQFB 1REGX 4DQSA 3CMES 1U2RA 3UVJB 3R6MA 4KPCA 3OVSA 5AXKA 4FWLA 1TL1B 3SAFA 3SCXA 1X5TA 3M9MB 2WBMA 4HLBA 4BDPA 2XLKA 3I0RA 4DL0C 4DPWA 4CFCA 3DLBA 4C8NA 4FK2A 4I56A 1ZBSA 4YUDA 2GX8A 1S48A 5A2QU 2K2PA 3NAEA 3LZJA 1CJUB 4OI1A 3MN6A 3AOCA 1Q0NA 5FDLB 4TVAB 1Y97A 3DRSB 4YR0A 1QSSA 2B7BB 4PHTX 2W4DA 1IKWB 1RT6B 5B7WA 3MM6A 4QPTA 3BGOP 1J9AA 3A1YG 4B3TF 4KFBB 1G4CA 3CCLN 4LBPA 1KSPA 1Q86T 3THWA 4BACA 2RS2A 3AV9A 3ITHB 2Q79A 3PHTA 3VF0B 1VMBA 1MROA 4H0TB 3QIPA 3NG8A 3T1YJ 2MQNA 3S7RA 2HBMA 1IO2A 2X51A 2MDAA 3RTVA 4LR8A 3K2PA 2Z58B 4O3PA 4ES2A 3CCVN 5IC4B 2NPIA 4QZVB 2W9BB 3QFPA 2FHMA 4RWWA 4CLPA 3VQBA 2NUBA 3D68A 1LWFB 4G1QA 4L74A 5E33A 2E5JA 5KPTA 4A59A 1NK7A 2A0FB 3AAPA 5AQNA 3RBXA 2L9WA 1B99A 2GBZA 1EWRA 4GKJJ 5KG1A 1PJ5A 3AB4B 2EC0A 4YB6A 4ZVOB 2KG1A 2J9DE 2IC3B 4FPIA 1SJ3P 4DL3A 3V9SA 3MAQA 4UW2A 3SUOA 2ETJA 1Y11A 1FE4A 3M1VA 4K5SA 1Q79A 5A6PA 2GX9A 3G8QA 1IWAA 4RU2A 3THWB 3EE3A 3DLGB 1N52B 3SNNA 3RSEB 3CCEN 4JI6J 1U0HA 5IV3A 4KREA 4BS2A 5M1KA 1N0VC 2XCPA 4B1YB 4OLAA 2UXDF 4KGVB 4DL4A 3TA2A 2D74B 2V51B 1LNQA 3BM7A 1FTRA 3CCSN 3HPOA 2NRXA 1Z6RA 4WF9L 4PG7A 2HFNA 4KT0C 1JJ2R 4WCEL 5GAGP 1YLXA 3ILJA 2QL9B 1BCMA 3MCPA 5I3PA 4OLPA 3FEYB 3VGKA 1HHQA 3ID6A 1NJZA 1VSFA 3FK4A 3OTDA 1CJVB 1ASUA 2Q0UA 2HRTA 4MIAA 2MGZA 1TK0A 3ZZUA 3KG0A 1NKEA 1UVJA 3S3MA 2R7XA 2QK9A 1B0VA 1ZOTA 4DS5A 3SBTA 2MSTA 5GINA 1VQ7N 3HJVA 3NMUA 1QVGM 1J2VA 1RSCA 3QIPB 3MWPA 1VRTA 3OYCA 3CC7S 3I5CA 4O0IA 4JB8B 1RBOB 3G6VA 4URQU 2NREA 2D4WA 4E1NA 1M5VC 4K2XA 1TL3B 1WC4A 4P2FA 4FP9A 2DNHA 3PIOQ 2UU9J 1N5TA 2BQRA 3VVTA 5FDLA 4W5OA 1R59O 1C0UA 4WIIA 2YNHB 1WNEA 4M63A 4IR1A 4DTJA 3MD3A 4CF8A 4OX9F 1MN9A 2Z2ZA 2ZM6F 2CQPA 3Q7CA 4DMZA 2C3YA 1JXLA 3IRXB 4NO7A 1PC5A 1F2HA 4WU3A 4ICLA 3HFVA 2FYXA 2D0AA 3I56S 1SL2A 3TAFA 2ZC4A 3Q7BA 3D4JA 3KLGA 4ES1A 5RUBA 3OA9A 3KJVA 1QE1A 5DG8A 4RLEA 1VHXA 4DQIA 4ELVA 2X6SA 2K1RB 4JV0A 4EZ9A 1WF1A 2R7SA 4X64F 5JXSA 3EYZA 5C42A 4R8UB 5K14A 4OZJA 4CTAA 4ZVHA 2CGKA 4BE0A 2CJKA 3U27A 4Z4HA 3TWZA 3OL6A 1QVFR 5F41A 4ZDNA 2C2OB 2G2OA 1X4BA 3C16A 1RHRB 1WHYA 2H51B 1EP4B 3HPGA 3ONQA 1NSQA 4CK3A 4IH5A 2VPXB 2B6AB 4QCLA 1FVSA 2QMUB 4QYZK 2HNZA 2Q66A 4W5TA 1NDKA 1WTFA 2N4DA 4DN0A 3HK2A 1LAVA 3G6ES 4DV6F 2HHQA 4OHZA 2GHPA 1U1KA 2BJ9A 1M5HA 3NEKA 3RR8A 2O8FB 3EDRB 4DZDA 1HBOA 5M1FA 2V4QA 1C1AA 1EXQA 2HHHK 2QO3A 2AZ3A 1SJQA 2F8EX 2RSQA 2NLXA 4N8OA 5C42B 4R8UA 3MM9A 3MWTA 3AA8A 1D8YA 2VKRA 4EK2A 3O4QA 4ECTA 4ED2A 1NNEA 3QQCD 5HQMA 4YOWA 3POTB 2E5LJ 4CF9A 3NGTA 2EFPA 4BRFA 1YJNN 5E2QA 4P2MA 2DY1A 4DMNA 1SC1B 4KHRA 5SUHA 4X4NA 3OTCA 3BEGB 4DUZK 1RLDA 5KRTA 1HKGA 4JS4A 1F9FA 2LQ9A 3ZTSA 2V7YA 2HG4A 2AJ1A 2W7AA 3ZNUA 2OMOA 5L39A 4HI1A 1A7GE 4J90A 3ENVA 3C8YA 3LANA 4CO4A 4J2BA 5ETPA 1GTEA 3VZHA 1HNIA 2D1CA 2R7QA 2B4UA 3C14B 1MU2A 1K8AT 1RP5A 4EFAC 5D3GA 3D45A 4ITSA 4CVNE 2QSWA 2WSEC 1VQON 4NZ6A 2VG7B 2V68A 5SWMA 3HRGA 1TUVA 1NGHA 1NHVA 2OMLA 3GONA 2QXFA 4BR5A 4FYXB 5AZIB 4FLZA 1O51A 2B4VA 1I94J 1PYTA 2WZ1A 4YY3K 3KUEA 3HZ6A 1RHQB 3FC9A 4F7VA 3P96A 4NWBA 1Y5IB 4JD2A 4DUTA 3CJCA 4UY85 3R7SB 4KJIA 3HHDA 2KB2A 4BRNA 3LWMA 1M1KT 2G1DA 4EBEA 3CT9A 1N5YB 1XNRF 2V9KA 2VWKA 2DNQA 4PWDB 2OFHX 1NOYA 2YNFA 4NYPA 2QWMA 4DU7A 3KLEA 3WUHA 4NASA 4HUFA 1T02A 2IMOA 3GFZA 5KGXA 1P8ZA 1RFQA 1C0FA 2H54B 4LFBJ 2PEBA 1HJRA 2XYPB 4DR1J 3EWGA 4HCCA 5TKWA 1DQ9A 3TARA 3C6UA 3J81O 3BSAA 5C2FA 5KQ8A 5ADXA 3MMJA 3CJTA 5A8KB 3CE8A 3V9UA 5HANA 3D1QA 4NEZA 3I55N 2B9XA 4IJNA 3M30A 3L3CA 2W41A 4MDAA 1NU0A 4B17A 4CIEA 2YH0A 1LXJA 1HI8A 3WQPA 4KSEB 3GV5B 3W9HA 1TL5A 2UXBK 3GCXP 3TABA 1L3TA 1MNEA 4PQUB 3AA3A 4Z4EA 4IBNA 3SUQA 2ZF5O 3D0HE 1U1LA 4DF4A 5IFMA 2AT1B 2QA2A 4X65K 1B7YB 5L1LA 3WX4A 4DOZA 1SI9A 1BOTO 4HDGA 4GKKF 1QUVA 2UXBJ 2QI2A 4BWMA 4USVA 4OZ1A 3K9KA 2P9EA 5HVHA 3I4HX 4WWSA 3QETA 3KWGA 1QVFM 4HTIA 1XK8A 4DL5A 2WBRA 1YI2N 3PIOL 1T05B 5DDPC 3QDKA 2ACYA 2J7WA 1SJFA 2XWXA 1KVIA 2CFXA 1ZS6A 3H90A 1SUQB 4JI5K 2XRIA 1ZPWX 1F21A 3IO1A 1YJWN 4OJHA 1M90O 3O8WA 3NGIA 1JLEB 3QRRA 1IKYA 5AJ3K 4DV7J 1HD0A 1OVYA 2FZGB 4FF1A 4DR4J 3LP3A 5KFZA 4Y2IA 2V8HA 5L1IA 3VTIA 1JJCB 6FD1A 5A2QO 3IR6B 2LEAA 4OV6A 4U96A 3MCOA 4FJLA 3TEHB 3FFIA 5LSOA 3UKRA 2W9AA 2Z1JA 2KJWA 2M0GB 3EE9A 4J9LA 3IGNA 3ENHA 4FNIA 2M70A 1B64A 2QEXN 1CPZA 3CW2C 4FLTA 3QNOA 3D1HA 3HFZB 4JI2K 2LP4A 4TYBA 1RXOB 4NLDA 1TUGB 3CFOA 3DRPA 1B92A 3I9ZA 5ETMA 1XMOJ 3HZGA 1CZAN 2D5RA 1IG8A 2DR7A 2DGVA 4JI8F 5A8RB 3MF5A 3MURP 1VSJA 3IGVA 3I87A 5IWAK 4F3OA 5D77A 1GLDG 4HUEA 4F02A 1HWJA 5DLFA 2E1RA 4ZJLA 4QWEA 1R8PA 4JKCA 3MECB 4ED1A 1IR0A 5CYQB 3K58A 1YITS 3D6TB 5AQZA 3K8WA 2OEMA 3H3NO 4LF9F 2MQMA 2UVWA 4PL7A 4R5PA 1GLJO 2EI5A 3AA5X 4N77A 2DR6A 1OPIA 4EBDA 3Q8PB 4FSVA 2K8GA 1KEKA 1N5SA 2FBYA 4ZPDA 2CH5A 2YCHA 1CLQA 4K4XA 5M1QA 3SLCA 2W2QP 2DXEA 1JK9B 3MMCB 3UE2A 3RB6A 5HLFA 2CXEA 3NH2A 1HL6A 4IG0B 2MY7A 3HX9A 2GQCA 2ZZNA 2I7PA 2B5JB 3HJFA 4AUKA 1KHVA 2DY4A 5C0YA 2D0PA 1L3KA 1R43A 3I32A 1DARA 3DRRB 2RS8A 2C2RA 2HF4A 3BR8A 3T41A 4F4WA 2J0QD 4KR0B 3QATA 4PPZA 4OKJA 1BUXA 4JKAA 5HRNA 4RW4B 1NSAA 3KJFB 2IOCA 4ZVGA 1J5EK 3FFKB 3KLFB 2MZJA 3AOBA 4ZPBA 3K0JA 2RDIA 2XS2A 3CUNA 4FCYA 2XCAA 4WFBL 2VA2A 3I9V9 2IVYA 4CZKA 3OYNA 1VQ4N 1SKSA 1U45A 5C12A 1RAIB 5EOYA 2JJ4D 4PAAA 3WQTA 1X3NA 3KMSA 4Z37A 4LF7F 1B70B 2QEXS 4B9NA 2MLZA 3TJAA 3LPYA 2DGXA 2DEJA 4OLBA 4QJVA 3QLHA 1TUYA 4EHUA 2B51A 3A5MC 2W8KA 1HI1A 1N34K 4CGFA 3M8RA 4CJPA 5LM7E 3DRPB 3BBCA 2D9PA 3KLEB 4O44A 3NF8A 1NB2A 1IBLF 2AQ4A 4H5WA 4O4RA 4USTA 3CCMS 1C4CA 2BUPA 2VONA 3E9PA 1RHMB 3A12A 2HWTA 2ASMA 3Q8YA 2D0CA 1K44A 1I51B 2GMJA 4CF1A 3BY5A 2QLJB 1PO6A 3CETA 3IWLA 4DUYF 3T5JA 3N6LA 1GNKA 1NOZA 3BF3A 2UU9K 4NLGA 2RAQA 5E26A 3IA0A 2YKNA 1VQOS 1KVJA 1RBUA 4CZEA 3EPIA 3QT7A 3GSDA 3UR0A 3O9RA 3V6JA 2M5YA 1NNDA 2GFFA 3ZT4A 1AROP 5L8RC 3RB0A 5BPNA 4P72A 4A5AA 1GOBA 1FDDA 3HSJA 2HBLA 4H8KA 4OYWA 4BRGA 1LCUA 4ID5B 4JKFA 5LOQA 1P9QC 1X9JA 3M1FA 4DSEA 2LQBA 1B3TA 1VBYA 4Z4CA 1ZBHA 1S0MA 4F4AA 3H0PA 1N8RO 1M5SA 3QERA 3D6FB 4DTXA 3AH6A 1CZBA 2IYIA 4B9SA 4AHSA 5T41A 1XQIA 4X4PA 1XMQJ 4A8MP 3OYKA 3D28A 3AVNA 4DR2J 3ZETB 4AE5A 1EJ7L 3DM2B 1Y5LB 4L3NA 4AHUA 3BZKA 3G0ZA 4O3RA 2WONB 4B3SJ 3A2FA 2ASJA 1K1QA 4P74A 4ILMA 1QQNA 4TN2A 2GVDB 3ZSWA 3DOMA 2W4PA 2HGLA 3AHPA 2E1ZA 4FOEA 1N6QA 4BREA 4LF5K 5K8OA 3QJPA 4X62K 3E01A 1H73A 3TVZA 4CM2A 4HH1A 2QWOA 5IWAJ 4J2EA 3M8ZA 4RKUC 3R6GB 3CPEA 4USUA 4YHHK 2R7VA 1UVMA 3MM7B 4AL6A 3UI3A 2B4PA 4CYUB 4USWA 1YXQA 3PRDA 3OYIA 4YOEA 4IZ9A 4IKFA 4ZCIA 3GIMA 5DQHA 4RNNA 2NUHA 1ROFA 2YKNB 1FVQA 1AW0A 1KDNA 4JYAK 4NXMK 1FHTA 1A5XA 1O5JA 2AGPA 1CG2A 1HBMA 3AO4A 2GAHC 1TAQA 4LF2A 4H0OA 4I7FA 1RBLA 2RIJA 5IT9U 3G86A 5CY4A 3CPWM 2FC9A 2POKA 2JEJA 4Z4GA 4O3OA 3VA0A 4KH5A 3D1OA 2HQCA 4LC9B 1MSWD 2GNKA 3GR1A 5DDRC 3I56N 1C0GA 4Y34A 2XB2D 1QS4A 2YHWA 3Q0AA 4DTUA 1AZSB 5FRNA 4JI0J 4XH5A 1N36K 1J6ZA 4ANEA 2GVDA 4F2SA 2RRNA 3V4MA 1VQ5S 4ZA1A 1Q9XA 1Z05A 2NLWA 4V19X 3DFEA 5J1NA 3ZETA 2KJVA 4F4YA 2MQLA 1Z4UA 1HQUB 1VBXA 3TSPA 4N7TA 2XHWA 4LY7A 2QTDA 2UYTA 1WHVA 2A6AA 4Q7AA 2Q1LA 4KGMA 5KFHA 3RGIA 1MWQA 2BZ2A 1BU6O 2HBZB 5AQLA 1NXIA 4BRQA 4KHUA 5KT4A 1TK5A 1IJJA 2FQQB 1TKZB 4DDFA 5I9EB 3F41A 4ZCMA 1S72S 1WNSA 2Q2RA 2JC0A 4G1QB 5JMNA 2KU7A 4P7VA 3TEGA 2A3ZA 1WAFA 2PMWA 1AZSA 4CJRA 5CD4A 1ZYQA 3NY0A 2JSXA 3OXLA 4OGCA 3VEZA 3CULA 1PGZA 5A8WA 5HI7A 5EHHA 2E20A 4A8OA 1A5VA 4CLYA 4I6WA 3LDNA 3CD6S 3QB0A 1KQKA 1QLNA 2CQ1A 2UVRA 1VSDA 4CEOA 4LFAK 4RR5A 1TKTA 2DISA 3J7YI 3VALA 2F4VJ 1JJ4A 1GXLA 5FLXU 4ZLPA 2FLLA 2XGPA 1W9HA 3CCWA 1J53A 4K25A 3WNFA 5ADZA 4DV4F 4OHWA 2OA8A 3NF6A 1QSYA 5IZHA 2MTLA 3HKZD 2LU2A 3DLLQ 4FJJA 2E1PA 3M30B 1VQ6S 3VZIA 4YDUC 3C7NA 3HHLB 4AHTA 4XH4A 3MGJA 3LO3A 1JL2A 2A1RA 3KLIB 2DEIA 2CRLA 2FUG9 4JRQA 3QNNA 3QGIA 2OTLS 3UCUP 4C8KA 1VISA 4WQ4A 2YQ1A 2CQHA 4LRCA 4UF4A 2BQUA 2KXHA 3PRVA 2KHDA 4LSNB 4UY8T 5D6GA 2ZOFA 4DCHA 4ELTA 3MCSA 4EMDA 1K1SA 5BRDA 3C66A 3D5MA 1IBMJ 3HP9A 1NK0A 2ZH9A 1NPRA 4PPDA 2N7CA 1JKHA 3W2VA 3GTYX 4BG8A 3GE9A 5FIIA 4USJC 3CJKA 1FNOA 2VHGA 5HL7L 3D66A 3FCWA 3D9BA 4QIGA 3MCNA 2AW0A 1SKRA 1R31A 2GGPB 2HFUA 4I6YA 5KFFA 4RUCA 1KLMB 2IA0A 2PEHA 1KC8T 1B9DA 1NKCA 4AH9A 2PIIA 2HBRB 4AQYJ 2F4FA 3ULEB 1PJ7A 4FJMA 2P9SA 5IQ6A 4DSKA 4NOHA 4X4QA 1KCFA 3BBFA 4WZMA 2K3KA 3VGVA 3KLGB 3L2QA 5LT5A 2ZH7A 1U04A 3UN2A 1K0TA 4OIXA 2K7JA 3WNGA 2PA3A 4O0NA 3EZOA 2CUYA 3TA0A 1F5BA 4JI5F 2BABA 2ZHOA 4YDDB 3GJRB 3EVOA 2GEMA 5I42B 5B0CA 4KBIA 2WW4A 5JS2A 2HB5A 1KD1O 3V6HA 1SAZA 4B1WB 1S1TA 1VJWA 4DV7F 3ZEUA 4NA2A 4NB4A 4HDHA 2J76E 4OJ3A 4FF3A 1WBDA 1B9FA 5EY4A 3OLAA 4HYKA 2AEJA 1EKSA 4X4TA 2KFNA 1K8KA 3VESA 4FVUA 3KMQA 3A8EA 1NPPA 3JTPA 1I5OB 4XH1A 3KUHA 3KHLA 2VOOA 1ZXOA 4A8KA 4QYZJ 5EWGA 1SXLA 1YJ9S 1U24A 3VAKA 5DS7A 3SQOP 2C2EA 1SV5A 1QAYA 3AB2B 3H1QA 1FX4A 1X9SA 3T9NA 2HFOA 3A3NB 1YBAA 2HQ3A 4PG6A 1UETA 3HHEA 5L1KA 2O8DA 4EU0A 3NP5A 1QHTA 1OH7A 4CERA 1TFWA 3VGMA 3O9SA 4URGA 4KY3A 3GFHA 5M1NA 3KNAA 2B9EA 3L9ZA 3E2EA 1BC6A 1W97L 3CHWA 3ZSYA 3M8QA 5DDQC 2O8FA 2FY8A 1WDTA 1SH0A 4OYOA 3MUMP 2NXEA 3OQ2A 3LP2A 4NCAA 4DTPA 5ETSA 4LF7K 4E7JA 1HWLA 2EXUA 4B8CA 1F5AA 4KHQA 4KGXB 2G8FA 2WVBA 2ZUGA 4M1KA 4M3TA 4LF9J 4QS7A 2C2NA 3HOSA 4ZITA 3LP1A 4DR6J 4HACA 2XO7A 2J8AA 1UWBA 3PIPQ 2NXCA 3ATVA 1PG5B 2VWBA 3L7OA 4QW9A 1WSGA 2OSQA 3KZBA 2YWWA 3BGRA 3MHYA 1TTHB 3DWLA 2QLFB 1SC3B 2IC3A 2GIFA 3SFUA 5HSPA 5A76A 3KVGA 4B3MF 2KHCA 5KAKA 4YY3F 3CC4N 2G2YA 2OTJN 2NYIA 1UJ5A 5HK4A 5C5JA 1XMOF 2DBBA 2DD8S 4KHWA 3TAPA 2YKMB 1DTTB 4ELUA 4CP5A 5DETA 5CZ2A 2YV0X 1RUSA 1GXTA 1IBKF 2NXJA 1RT3A 3ZNJ1 4C3MA 1VBKA 1YJ9N 4BGBA 2A10A 3AXMA 1FNMA 1TVRB 5A0YB 1NMNA 3OTOJ 4HTUA 2HRUA 4C8OA 4BG9A 3ETOA 3I0SB 2Q1NA 2G8UA 5D3GB 2A1BA 3IS9B 4DSIA 2J4RA 3R6LB 2LA4A 2W8LA 4C3KA 2KI2A 2YWHA 3CIZA 1HWIA 3BSNA 1TMMA 2EG1A 2UUAJ 5DGBA 2P9IA 2NRTA 3V1QA 3ENBA 3R7NB 4OKKA 3KLVA 2BACA 4DU4A 2ZD1A 3F9MA 3ULHA 5D4OA 3H08A 1HNVB 4M5IA 1GMUA 4PA1A 1Z25A 3DNCA 4QU7A 1ZETA 2AGQA 4ECSA 2DVIA 2KT3A 1GX5A 2F96A 2APOA 1DTQA 2W2OP 2W01A 1VRTB 4TY9A 2HEKA 3UFCX 1QM9A 1BL3A 4LF4F 2MZQA 4F4KA 3CCZA 4CGJA 1IQZA 1J5OA 3IKMA 4U67L 4WQ4C 4FBTA 1W0HA 3BGUA 4M5JA 3MEEB 1XR5A 3BDPA 4KH6A 3TUIC 2HGMA 2YHBA 2FLPA 3OFGA 4JI2F 3L3UA 1U2FA 5KFEA 1JCGA 2CG8A 3W5ZA 3H5UA 3P5BP 3RU0A 2CZVC 3OJSA 1FERA 4Q5VA 4DV0J 3JTNA 3EE8A 3VGUA 3HFKA 3HD1A 5KFAA 2VG5A 4H0XB 2PAVA 4A57A 3Q2SC 3FZMA 4AQYK 3T5HA 1VI7A 3D67A 3TR8A 1CJKA 4DUYJ 1XNRK 1T0TV 3FCHA 3AVAA 1YKWA 2RRBA 1S79A 4V19S 4DSLA 5A0YA 5GAEI 4Z7YA 3GB0A 3Q23A 3NGYA 2F8SA 4E7KA 4NX9A 2G8WA 2P9NB 3MMVA 1FNXH 4F2RA 3GIJA 4DEZA 5JVGQ 1VSHA 1NO8A 1KN6A 4H4MA 1NK5A 3RMBA 2A3JA 4CTAB 3LPTA 1IXKA 2G1HA 5F8HA 1FJCA 5K8MA 4BBYA 1RA6A 4KB0A 3NCRA 4HUGA 2EFQA 4W90B 3IG1B 3HVRA 1XJWB 2RB7A 2XULA 1SIZA 1KQSR 3CD7A 2E2OA 4CFAA 4MAKA 1I3AA 4L75A 1LWFA 2JFDA 1VQNS 4RW7B 2FGOA 3AD9C 2L41A 1M1KO 1D9FA 1GXUA 1HYZA 1GFWB 3EZUA 3SQ2A 1SL1A 4CIOA 4NMXA 2CQGA 3KJNB 2Q6BA 2Q97A 1ZBTA 5C24A 4NXNF 5FPEA 3U1NA 4DS4A 1TL7B 2F4VF 2Y1RI 3TAMA 1QZ6A 4CZJA 4OX9K 2PMZD 4ECYA 1HLUA 2F4VK 4A47A 4P10A 1YTAA 1F0XA 4KH1B 3NS7B 1GT8A 2GC8A 1FK9B 3O5TB 4JK9A 4OZ0A 4ZVEA 1U8SA 3CC2S 2YBVA 2JDJA 5GMDA 4P7TA 3NL0A 1TKZA 3V6KA 1Q7YO 4IUFA 1RGVA 2BH1A 5LMNK 4B3TK 4PR6A 2XY6A 1DAXA 4WXOA 1HHSA 4WFYA 1KTQA 3NGZA 4OPAA 3O1BA 1BDGA 4DV3K 2V67A 4HTLA 1KD1T 2F9WA 1FD8A 2UVVA 2WOMA 2VC0A 1WSEA 4CIGA 1UWAA 2ZE2A 4HT5A 2C2KB 3S01A 1VS3A 4O8KA 3Q8QB 3WC2A 3TZWA 3W9IA 3MN9A 2LVWA 5A8RA 4DV6K 1YX2A 3MEKA 2P51A 3BPSP 1CJTA 1XMQF 3SK3A 4C0BA 5CHCB 7FDRA 1X4DA 4I68A 4CCHA 1S1UB 1WSJA 3QO9A 4DPOA 1VQ8S 4DFPA 5KG3A 1T9XA 2ILZA 2KM8B 3PLAA 2UXDK 2VBWA 3ZXWA 1S57A 3K5LA 4A8FA 3SV3A 4PXDA 1H2TZ 4E8UA 2HSTA 1X9WA 1IKVB 4IRCA 4BRKA 4QU6A 5DM6Q 3VV2B 3RSEA 2ZZTA 1E4FT 4ZTJA 2JVOA 3FJ2A 3QRPA 2JLEA 1UVKA 1KP6A 4CZHA 1Q82O 2A18A 3MPDA 1URNA 4DR5K 4MKVA 5KFPA 3BBBA 2HURA 4C98A 1N54B 5H1SQ 2FIUA 4F25A 1G6BA 4H5NA 4LVOP 3PFOA 5AXNA 3QYYA 2IM2A 1LW2B 4TLRA 3VN5A 3TUJC 4CO0A 2BE2B 1W25A 4FW2A 4JI7K 2JFKA 4IDKB 4FM1A 3N0VA 3BN7A 1JLQA 5T14A 2XI2A 1CXQA 3N4PA 3IRXA 3MMAA 2HRYA 8AT1B 4K8XA 5IS2A 1MLAA 3QRQA 2KH9A 1Y10A 2HK2A 3MXJA 4FM0A 4BR9A 4KKOA 3UD3P 4JYAJ 3MPUB 5K8NA 4OYBA 2YNGB 3SQGA 4UQGA 2QWQA 5BREA 2ROEA 3G8TA 5HRSA 2EFGA 5EDWA 3FDSA 5F2RA 2W7PA 1Z2LA 2BJEA 4WFBQ 1S97A 2FZCB 3U02A 4EO8A 2NXNA 1VYAA 3ELHA 4F67A 1J54A 2JWKA 4IH7A 4YHHJ 2O66A 4LRDA 3V9ZA 1FEEA 3QZ8A 4IH6A 1VQ8N 3HSCA 4H54A 5KFIA 2P9UB 2CDQA 5LMUF 4X62J 3IBCB 1MWZA 2A42A 3NKYA 4N41A 3KLIA 1JJ2M 2V2QA 2FC8A 3WXIA 3OUYB 3CCMN 1Q7YT 2FJXA 4O44B 3ZSZA 4OZ2A 2BANB 2Q0RA 5HL7Q 4EWTA 1QUPA 4J9OA 4F3MA 4DR6F 3JYTA 4OGEA 4NLUA 2DKOB 3HULA 2ZVSA 2HVHA 3DYAB 4OZNA 3O9UA 3CCUN 3SMSA 1Z26A 1XMQK 3K59A 1MN7A 1RTJA 3RMAA 2E5LK 3QGGA 1G99A 4OX6A 1XQSC 3A8JA 3J7ZT 4MH8A 3K2YA 4B3MJ 3CCUS 4DTMA 3VQ9A 3MR5A 4WFAL 3CIPA 1UW9A 3FZKA 3THXA 3IP0A 1K6YA 5LSLA 2MJUA 1O1WA 4NLRA 3MOJB 1WF0A 3O9QA 1B0TA 2E88A 4RNOA 2OHDA 2PY5A 2HHHJ 1DQ8A 1FRKA 4WCEQ 4KHYA 4X64J 2OUGA 5CZ1A 4GV9A 1QVGR 3LAKA 2I5JB 3D7SB 2AZ1A 3MMBA 1P6TA 5CHIA 2E2PA 2ITMA 2EK1A 2YJFA 2CPJA 2CWKA 2FB0A 2DPNA 3UPFA 1WELA 2LLZA 3V4IA 5AQRA 5CYMA 1LQ9A 3PV8A 2IJFA 3JSRA 2X3DA 3ICLA 4YOTA 1RADB 2HMIA 1HNZJ 3VVUA 3QAEA 2UV8G 2HS4A 3UD4P 2MGZB 4RX6A 2IIRA 2W42A 5BPMA 2ZHBA 5BYRA 1VRQC 4GKJF 3BV8A 2HNDA 1FRIA 4TY8A 4GVBB 2HVIA 3G2XA 1ULRA 3W5YA 2HMPA 5T7BA 2VF3A 3B8HA 3GYXB 3BYPA 4H4MB 2GA7A 1LOTB 2HBQB 3SSQA 4IOAQ 5L9NA 3VAIA 4LF8J 2VFUA 2I0XA 4CJTA 5F8JA 4OJGA 4JI2J 1VQ4S 2FGCA 4X4OA 2WSFC 3OYHA 5K5MA 3I0RB 1S0OA 2HZVA 3VF4A 2YQ3A 3UR3C 3QBXA 5H9EJ 1O6XA 2HHVA 3OBIA 2OZSA 3HT3A 4PKGA 3GG4A 3CDBA 3CD5A 1XTZA 4V19J 2QKBA 1XERA 1RAAB 1FI4A 2DNGA 2ZBQA 2UUBF 3WEEB 2MLYA 3NGUA 1JKHB 1H7WA 1DZ5A 2E2NA 3HMJG 1D5AA 3BUZB 4PWUA 1T9WA 3AVGA 3ADAC 2J0SD 3KJQB 2CPXA 3G82A 3HI0A 5BYSA 1KR4A 2HK3A 3EEQA 3ZZ0A 1RU2A 3NS6A 5ADXH 4JI5J 4CYUA 4FJIA 5IM0B 3DHWC 2XLJA 3BF1A 3VQ5A 3PW5A 1RGIA 2O8EA 5JS1A 3D0IE 2J9EA 3DRSA 1KKHA 3FGUA 2BJDA 1QAJA 3E01B 5GADU 5AQWA 4F0HA 1WOPA 2MY8A 2V5HG 3VQ4A 1RDUA 1GMWD 2J8SA 3Q8UA 2HKEA 1UP1A 3HL8A 3GL1A 3TQEA 2ZM6J 1Q81T 4TLQA 4EYIB 1XNRJ 1TUUA 4DV4K 2JNJA 2FHKA 1Y3KA 2GHWA 4OX7A 2CQIA 4FLYA 1CJUA 2BM0A 4M41A 2FJAB 2YPYA 1TV6B 2KO1A 3J81U 4I7FB 1YK9A 1DGKN 4ZHRB 3AY9A 4DQ8A 2EPIA 1RLCL 3QZ7A 4LFAF 3BYRA 2A40A 4DV0K 8ATCB 4E7HA 1UL3A 3EVWA 2UXCK 2M7SA 3M2UA 5HROB 1S9FA 3KDOA 1HNVA 4CLFA 3SYZA 2OPSB 3CF5L 3D6MB 4I67A 1CJKB 3ZX3A 1VSLA 3DGVA 3X1LB 4X84A 4RUAA 4IXCA 3B4DA 1IBKK 5LL6d 3FR0A 4DU1A 4JI1K 2CZ9A 1T05A 3A5LC 2KXNB 1T3OA 2OPRA 2KW4A 4GC7A 1XMOK 5DQGA 3KK7A 1RTJB 2OANA 3DI6A 3QBCA 3TJ9A 4B3MK 3T19A 2WVEA 4J9SA 3OFHA 4CLWA 3TW0A 1S99A 4OLOA 1LW2A 5H9FK 5AQSA 2G8HA 2EEYA 1JX4A 3RZAA 5HMXA 4PG8A 3D2WA 3VPZA 2CPEA 3CO9A 3KK3B 4UY8O 5AXLA 2FVCA 3BREA 2DHAA 4YY3J 1FXDA 1HHTP 3ZT1A 2UUAK 2B43A 1N48A 2YX1A 1JWWA 3CFPA 4FZYA 3MD1A 3BDEA 5FRMA 4O5FA 1WSIA