4RW7A

Crystal structure of hiv-1 reverse transcriptase (k103n, y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
554
structure length
538
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 138
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw7A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw7A05
4LSLA 3E01B 4NLOA 4BWMA 4CJSA 3MR5A 3V1RA 2VG6B 3IG1B 1TVRA 4QAGA 3NGIA 4CE9A 4NYFA 3U3GA 4ECYA 1KFSA 3V81B 4E3SA 3OLBA 4F4ZA 2HHQA 1SKWA 1NJYA 3QEWA 3LP0A 4TXSA 3EY1A 4CJUA 3SV3A 3SUPA 3GV7B 4FCYA 4G1QB 1Q9YA 4IKFA 3WNFA 3SI8A 1J54A 1EKEA 4FK2A 4WYWA 3PZPA 1RTHB 2FVPA 4IFVB 5KG0A 2B4JA 5KFQA 5I42B 4KHYA 5KFEA 3BQ1A 1J9AA 3O3GA 3AA2A 3DDKA 1ASVA 4RW7A 5SWMA 3LDSA 1S5JA 4IFYA 5EDWA 3T5KA 3RB6A 3AO4A 1R0AB 3FDSA 4DSLA 2BRLA 5J1EA 4ZPDA 2ILZA 2XY5A 3CJ5A 4DFMA 4NLYA 4DTRA 3DRRB 4F3TA 2OPRA 2E4LA 2AQ4A 1SL0A 3QYYA 4CJRA 2WONB 4QWBA 1TV6B 4HYKA 4WXWA 4W5NA 2AGOA 3AVNA 4O0IA 1HRHA 2ASLA 3SCXA 4CEBA 3JSMB 5F8NA 3TAQA 3OHAA 4NLWA 3KD5E 5KFKA 4CJWA 3K5LA 4B9UA 2WOMA 5KFJA 2DPJA 1S10A 1RT2A 4RW6A 4QCLA 3TAFA 3CWJA 2DFEA 3VQPA 5CYQA 3CDWA 1BL3A 1S6QB 3PR4A 4FM2A 3CJ3A 4ECSA 3I8DA 2XCAA 4FS1A 5D3GB 1BIUA 4DSEA 4E19A 1JLEA 4Q0BB 4FJMA 5KI6A 1S1UA 3RAQA 3OYAA 4WYLA 4KB1A 3AVFA 3NFAA 3NAIA 1CXQA 3RB3A 4Y1CA 1S9EA 3G10A 5FRNA 1U09A 4Z4HA 3SUOA 4G3IA 2OPSB 1KLMB 1TKZA 5KT7A 3BGRB 4KBIA 1L3UA 3V4IA 1TKTB 3CFPA 5J2PA 4KKOB 3C6UA 3CJ4A 3RMDA 1RT6A 2D5RA 4Z4CA 3TWHA 2RF2A 4C8NA 3ZSQA 1X9WA 3PO5A 1CLQA 1VSHA 3VQ4A 2FBVA 4H4MA 1WAFA 3KNAA 4XPEA 3E01A 4OGCA 3FQLA 3O3FA 3IRXB 4CESA 4C8KA 2VG6A 3IG1A 2D0BA 3F73A 2HHWA 3LAKA 5EWEA 2HNDB 1TQLA 4TY9A 3V6JA 2D7SA 3THVA 4FZXC 4NCAA 5KFTA 3BR9A 2G8VA 3HVWA 3V81A 3HK2A 4RNMA 4FLVA 3P83D 4WZQA 4FBUA 5L1KA 5KFHA 4E1MA 1TL1B 3PJWA 4G1QA 2FLLA 1HPZB 4HUFA 2BQUA 4YFUA 4CFCA 3FRZA 1UAXA 3QIPB 1RTHA 4IFVA 4KHUA 4E7IA 3D28A 5K14B 5I42A 1SV5B 5KFZA 2HVIA 3SZ2A 5E41A 2KTQA 1RDBA 1REVB 5HP1B 3G6YA 1W0HA 1R0AA 2AWZA 4MFBB 2BRKA 4IR1A 4FM1A 5C42B 2R2TA 5KFYA 4CGGA 4HCCA 3HP9A 5KT4A 3BSAA 3CDUA 2X6SA 5F8GA 5DG8A 3N6LA 4MKBA 4QOZB 1X1PA 1BQNB 3DRRA 4FVMA 2OZSA 4RZRA 4FLYA 1X9SA 1D5AA 1VRTB 3G86A 3OYEA 2WONA 4ZPCA 5C25B 2BR0A 1TV6A 4J9OA 4OLBA 3DMJB 3BQ2A 2HAIA 3ULDA 1IKYB 5KFFA 4MH8A 4DL2A 5KGXA 3JSMA 2EX3A 2G8KA 3ZT1A 1EX4A 3V9WA 4DL6A 2Z1IA 2HHSA 1CXUA 5CYMB 4CGDA 1S6QA 3DLEB 3AO3A 4RW8B 1NK9A 1L5UA 2YNIB 4O3OA 4Y2CA 1BISA 5FRMA 4CEDA 3M8QB 5D3GA 3L3VA 4CJ4A 4Z0UA 1C0MA 3SFUA 4URGA 4OKEA 4Q0BA 2AU0A 3HVRA 4HUEA 4K50A 1JLQB 3SNNA 3T3FA 3QZ7A 5FROA 4O3SA 1C1CB 4RNHA 1RTIB 4R8UB 2FVSA 2ZE2B 4NCBA 4KI4A 3SV4A 2FBXA 2OPSA 3H59A 2W9AA 1KLMA 4IR9A 4HTUA 3MEDB 4LSNB 2VWJA 3BGRA 4FK0A 4Q44A 5L1LA 1U4BA 1TKTA 4KKOA 3G6VA 5F8IA 4FJGA 4W5QA 4MQ3A 1YVFA 3KLHB 2GC8A 1QHTA 3NH1A 1NK0A 3OS0A 3ISND 4ZP7A 3LAMA 4HVJA 3PX4A 3IRXA 1BQMB 4EYIB 1SKRA 3ZSYA 5DK5A 2BDPA 5DLGA 2HNDA 4ED2A 2NUBA 2KZMA 3ITHB 2RPIA 5C5JA 3KKRA 4JRQA 2O4IA 3HVTB 2E9TA 2QV6A 1WSFA 1Y97A 4N56A 3BSOA 3NBPA 5KFWA 5DMRA 3Q8PB 2XY8A 4ELVA 1VSIA 2UUTA 4Q8EA 2DFFA 3HPGA 3OYBA 5F8LA 3SPYA 4DTXA 2UVUA 4Y3CA 4O3PA 1QSSA 1TL1A 2E9ZA 3H5SA 3OL6A 3AVCA 1HPZA 3EPGA 2BE2B 4KHQA 3ZT0A 3QINA 2ATQA 3QIPA 1GOCA 4WE1B 3KHGA 3S3NA 1NKBA 5K14A 5KG4A 4CHYA 3I0RB 3QESA 2ITGA 2BGGA 4Z4EA 2R2RA 1REVA 3IS9B 5HP1A 4M45A 4AHTA 4CEOA 3HSTB 3HJFA 1VSJA 4CJ5A 3AA5X 1HNVB 5F8MA 4MFBA 1L3SA 2R7YA 4CK2A 4AHRA 3CG7A 5C42A 1IKXB 1D1UA 3OYIA 3K5NA 3B6OA 4PY5A 2VA3A 1BQNA 4OLAA 3ZSXA 1VRTA 1KLNA 3DMJA 1IKYA 4DTPA 3L2VA 4ZHRA 1ASWA 4TSXA 1U04A 3H5XA 3N6MA 2FLPA 1ZBLA 3Q8SB 2HNZB 1DLOB 4E0DA 3M9MB 3KLIB 4TY8B 3TAMB 1IM4A 1NOYA 4KHWA 4JUZA 3CJ0A 5CYMA 5KG6A 5KFSA 3DLEA 4RW8A 1EETA 1JLBB 2YNIA 1BGXT 1D9FA 3HPOA 4LQ3A 3OYDA 1B9FA 4M3TA 1LW0B 2HNYA 4O3NA 1JLQA 4BE0A 3QIOA 2BQ3A 4Q8FA 4NLSA 4EBCA 3PW5A 3H98A 2JC0A 1T05B 1C1CA 1RTIA 4OJRA 2JGUA 4I2QB 5KFXA 4NLRA 4EEYA 4R8UA 5DLFA 1WN7A 3L3UA 4YNQA 1JXLA 2O4GA 5KRTA 1CZBA 4FJIA 4W5RA 2EHGA 3MEDA 4LSNA 4BE2A 1LW2B 4IDKB 4O44B 1XI1A 1S9GB 4DTJA 3OS1A 3KLHA 4RW4B 2RN2A 4DTUA 3HVAA 4K4VA 4YR3A 2KZZA 3HHKA 4TQRA 1BQMA 3OYNA 4MKAA 4K4WA 3KMQA 3VQEA 1QS4A 4KAIA 2R2UA 4NLXA 2IS3A 3ITHA 4ECXA 2KQ2A 4FZZA 3OHBA 2IA6A 3NKYA 1I39A 3HVTA 5F9LA 3MR3A 1FK9B 3AVLA 2DPIA 4PA1A 2B6AB 4CF9A 3OSPA 5HRPA 1UWBB 3OYLA 1A5WA 3QEXA 2J6SA 3PJXA 5DQGA 4K4ZA 2W9BB 3HPHA 1RYRA 1EXQA 1HYVA 2UUWA 3OYMA 3CQ8A 4B9LA 3NF8A 2DTUA 3NMAA 2IM0A 2BE2A 4NLTA 3MR2A 2FJXA 4FLZA 3AA3A 3NAEA 1RBTA 3PY8A 4WE1A 4J9QA 4IOBA 5CZ2A 4YR2A 4J9NA 3RTVA 2WK4A 3ZSWA 2GUIA 3I0RA 1S4FA 4J9MA 4DSJA 3AO5A 4URSA 2C2EA 1LWCB 5HRNA 3IS9A 4NLPA 2E6MA 3NGZA 3TAPA 1HNVA 2R2SA 4ZTJA 2F96A 3ZT4A 3AO1A 1ZTTA 4HHTA 3OYFA 3T5HA 3WNHA 4OGEA 4URQU 1IKXA 1S1XB 4KHMA 1IH7A 5KFGA 1NK7A 4DWIA 1HNIB 1A5VA 2QK9A 1W25A 4CJVA 3VQAA 4O4RA 1RBRA 4B8AB 5T14A 1ASUA 3ZT2A 3KMSA 2HNZA 1DLOA 1Z26A 4UQGA 3RMCA 1RTDB 3KLIA 4TY8A 3KHRA 1Z25A 4EZ6A 4WXOA 4IQXA 3T1AA 5FDLB 3ZCMA 4AILC 2FBYA 4FJ5A 3GIJA 4F4YA 1NHUA 4AHUA 3QGHA 1JLBA 4DLEA 4F2SA 1S1VB 4YR0A 1KTQA 4IRDA 3KLFB 1T03B 4I2PB 2IJFA 1HJRA 3D5MA 4GC6A 3QEIA 3KJVB 2A1RA 5KFDA 1T05A 2EC0A 1WSJA 2V9WA 2G8FA 1NJXA 2HHXA 4I2QA 3VQDA 4J2EA 2V4QA 1WNEA 3CFOA 4DG1B 1K1SA 4EP5A 3LZJA 4K8ZA 2G8IA 4LH5A 1LW2A 4IDKA 2XGPA 1JLFB 3UPFA 1BIZA 3F9KA 4O44A 3ZT3A 4NLUA 4U7CA 1S9GA 4CEEA 4CHZA 3PV8A 1U49A 1SL1A 4RW4A 1NKEA 4ZVFA 4OVLA 3T5JA 4IH5A 4U6PA 4FLWA 3UIQA 4RNOA 4K4UA 2OA8A 4ELTA 1C0UA 4OKJA 4ZVGA 1SKSA 5KRSA 1RYSA 4XO0A 5J2MB 1QSLA 4MK7A 3Q8QB 4FW2A 3OYGA 4I9QA 1FK9A 3SI6A 1QUVA 3EZUA 4DS5A 4HCBA 4ZP8A 3GILA 1GOAA 4QW8A 3PW4A 3L8BA 1UWBA 3KLEB 4O5BA 4TLRA 3NH2A 2KFZA 2W9BA 1YVUA 1C2PA 1QE1B 3KK3B 5KFRA 1S0NA 4LH4A 1S1TB 5JXSA 3OVNA 2Z1JA 2I5JB 3V6DB 4EO6A 2XY7A 1RT1B 4M41A 2YNFB 3P5JA 1T7PA 1LV5A 1RT4B 1VSKA 1L3VA 2FBTA 4DQIA 1LWCA 2FLNA 4EP4A 4Z4GA 3MEGB 4DF4A 2PYLA 4KTZA 1KSPA 4IKAA 2HHTA 4YMEA 1U47A 2RKIB 2R8JA 4NZ0A 4EZ9A 1S1XA 3NGDA 1WSIA 1RT7B 4DSKA 3I0SB 1JIHA 3PR5B 3DLHA 3H4BA 2X78A 3AVGA 5KFCA 5HLFB 3MF5A 3H4DA 3QNOA 2IM1A 1SUQB 1HNIA 4EBEA 3K57A 4N5SA 3G0ZA 4CGHA 4YQWA 2ZKUA 4CJKA 3MFIA 5EU7A 2D3UA 3RB4A 4LQ9A 1JL1A 5EWFA 2B5JB 3NCIA 1RTDA 1HYZA 1BHLA 3C95A 5FDLA 4AH9A 3TI0A 4DQPA 2OZMA 2ETJA 2IGIA 1S1VA 1O1WA 3NGYA 3KLFA 1T03A 4HKQA 3NL0A 4F4WA 4ID5B 5L1IA 4BDZA 3KJVA 3RBEA 1LAWA 2YHAA 4ED1A 4F2RA 2W8LA 4CHOA 2AGQA 1VSMA 4FXDA 4KRFA 3PW7A 1JLCB 2FJVA 4I7FB 4DEZA 4DU1A 4FJ7A 4M3ZA 4J9RA 4KB7A 3AVJA 4CHQA 2D0CA 4RW9B 3KK1B 1WNSA 2WHOA 4CK3A 1JXEA 4CF8A 4DG1A 3KLVA 1HARA 3TR8A 1EP4B 3K2PA 3ICLA 1ITGA 4DL3A 4ED0A 1JLFA 2ATLA 4CIFA 3O3HA 3DOKB 4M3XA 3QEPA 4FM0A 1NK6A 3DRSB 5T7BA 4TQSA 4WZMA 3SQ1A 3TAGA 2AGPA 2XHBA 4W5TA 3RAXA 1KVCA 4F4XA 5KT2A 4NRUA 4M95A 4MK8A 4Y2AA 5J2MA 4QWEA 3NE6A 4ZTFA 1I3AA 3C6TB 3T19A 2XWYA 1D0EA 4IRCA 2FC0A 1WLJA 1SL2A 3L2RA 4PQUB 1S0MA 1LAVA 3KLEA 5HRRA 3MFHA 3AVIA 3DOLB 4FJ8A 4KSEB 3CFRA 5KFAA 1NNDA 2X74A 3VA0A 2WCXA 1QE1A 3KK3A 4E7JA 4LD0A 1S1TA 4CJLA 2I5JA 3V6DA 1Q9XA 4N47A 4M42A 2OPPB 2Y1IA 1RT1A 2GIRA 4QPXA 2YNFA 1B9DA 4AHSA 1NJWA 1DTQB 1UA1A 1WSHA 5KFBA 4FS2A 1X9MA 4ECQA 2X6NA 3E51A 1RT4A 4WFYA 3VQ6A 3L2QA 3AVHA 3QERA 2D3ZA 3MEGA 3OY9A 4E7LA 5KG3A 3RWUA 3KHLA 2B43A 3I5BA 4B3OB 4W5OA 2RKIA 2IJNA 1KCFA 2HB5A 3AO2A 1S0OA 1JLGB 2HWIA 1D8YA 1RT7A 5HBMB 1ZBFA 3I0SA 2PY5A 4DQQA 2P5OA 1RT3B 5HLFA 2QE5A 3ZSOA 4XIUA 4FLTA 1N6QB 4DTMA 1HQUB 1SUQA 4CJTA 5DQHA 4H8KA 2XI3A 3D45A 2XI2A 2YV0X 3V1QA 1SV5A 1VSDA 1RA7A 2GV9A 5JS1A 2W7OA 4CEFA 4HUGA 1DTTB 2B5JA 1I6JA 3OYJA 2QKKA 4FJXA 4KV8B 1C6VA 1KHVA 3HP6A 2KFNA 4CEQA 4FJLA 2UVRA 1OS5A 1C0TB 5DQIA 2VG7B 4KTWA 4Q43A 4F50A 4IG0B 4DSIA 3B6PA 3RMAA 4ID5A 5C25A 3VQ7A 4ECWA 5CY4A 1LWFB 3IN5A 3IGVA 1JLCA 2Z1GA 4I7FA 4DF8A 1FKPB 2JLEA 3AVKA 3LANA 4ED7A 4RW9A 3KK1A 3GV5B 4NCGB 4DU4A 1SH3A 4M3RA 2G8UA 3LZIA 3BJYA 1J53A 1S9FA 2LSNA 3NF7A 4L8RB 1IO2A 1EP4A 4ECUA 2FVCA 4NYNA 3M8QA 2G8HA 1WSEA 4IH6A 5KTQA 4DQRA 3ASMA 3DOKA 1YT3A 4TYBA 3VQ8A 5DGBA 3RRGA 3DRSA 5KT5A 3U6FA 1KRPA 4Q45A 4DSFA 2BANB 1FKOB 4YP3A 4KPYA 1RTJB 1TK5A 1Z4UA 2I1RA 5KFNA 3OYHA 3HYFA 2ZE2A 1ZYQA 3QLHB 1VSLA 4B8CA 4M3UA 5JUMA 4XPCA 2OPQB 1XR6A 2J6UA 3C6TA 2WB4A 3EZ5A 3TABA 3ZSZA 3AVMA 4PQUA 3MXMA 3KK2B 3QEVA 3AA4A 4CERA 1IG9A 3DOLA 2HMIB 4IRKA 3P1GA 5F9NA 1NJZA 5CYQB 3SQ4A 1S6PB 3TQ1A 2HVHA 2IOCA 2OPPA 4FZYA 3DM2B 4O3RA 2CKWA 1S1UB 5KG5A 4KREA 1DTQA 3DRPB 1VSEA 3NDKA 1J5OB 4NRTA 1TKXB 4BDYA 5C24B 4FJ9A 3GV8B 1YTUA 1TP7A 4CGJA 3M8RA 2YNHB 3WNEA 4DTNA 1T3NA 3MECB 5EUHA 1VRUB 2VG5B 4EBDA 5I3UB 5KFPA 3BREA 1JLGA 1D9DA 3KIOA 4DL5A 5HBMA 3C6UB 1TK8A 1JLAB 1YTAA 3DYAB 1GX6A 4R5PB 4J9LA 3S9HA 3MEEB 2XGQA 1N6QA 1HQUA 4TN2A 1KVAA 3O4NA 4DTOA 4F3OA 1NK4A 3QETA 3KTQA 2C2DA 1DTTA 5KG7A 1RBVA 2QXFA 2IMWP 2IAJB 4ICLB 3VN5A 2PZSA 4B9MA 4KV8A 1WAJA 4ECZA 3KHHA 3SYZA 4PUOB 4FW1A 1U48A 2DY4A 2XCPA 3RR7A 4BACA 1C0TA 2YKMB 1RDDA 1UA0A 2UVWA 2VG7A 5KT3A 4IG3B 4WFZA 5KFOA 4IG0A 3GIKA 3FFIB 4CF0A 5L1JA 4DFJA 4KHSA 3DLBA 2Z1HA 3PHEA 1LWFA 3U3YA 1W9HA 3BSNA 2XY6A 1RDAA 2R8IA 2E6LA 2KW4A 3CO9A 1SH2A 1FKPA 4J9SA 1RNHA 4KTQA 4M94A 1S48A 4ZP6A 1N5YB 1T8EA 3TAMA 4NCGA 4GVMA 4B9VA 4F8RA 2HHUA 4B9NA 2WRMA 1T94A 4E1NA 2D41A 1TAQA 4M3WA 2YKNB 4O4GB 4NLQA 4K4YA 5F8HA 2R8GA 4DFKA 4RNFA 1IKVB 3UR0A 2FVRA 5KG2A 4NLVA 1LW0A 2XC9A 3K5MA 4ZVEA 5KG1A 4KHRA 2BANA 4RG8A 1FKOA 2P5GA 1RTJA 3MR6A 4J2DA 4X2BA 5J2QB 1HYSB 1N4LA 1QSYA 3QLHA 2RDIA 3H08A 2OPQA 3L2UA 3LALA 4FK4A 1KHWA 5JS2A 2OH2A 4KAZA 3K59A 3VQ9A 3JYTB 5DG9A 4JV0A 4ECTA 3KK2A 1K6YA 4Z4FA 2HW3A 4CJ3A 3LP1B 1HMVB 3CDEA 3LPTA 2OYQA 4KO0B 4IH7A 1RDCA 2HMIA 2DFHA 1XHXA 3VA3A 1XC9A 4RNNA 3M9OB 3LP2B 1S6PA 3VQSA 4KI6A 3G6XA 2ALZA 4NLDA 3LWMA 3T5LA 3DM2A 1N48A 4DU3A 3SQ0A 3FQKA 3RBDA 3HT3A 4GC7A 4E7KA 3DRPA 4DLGA 1QAIA 1J5OA 3GYNA 1TKXA 3H40A 3ZSRA 5C24A 2B6AA 1ZTWA 1Q8IA 4I9LA 3I5CA 2V4RA 4CK1A 1RILA 1C1BB 2YNHA 3H2LA 1GOBA 3MECA 1VRUA 2VG5A 3RMBA 1NKCA 2ZD1B 3DI6B 5I3UA 4GW6A 4CFDA 1HQEB 1JLAA 3DYAA 4JV2A 4R5PA 3MEEA 4CEAA 1RAJA 5KFLA 3OS2A 3WNGA 1UOCA 1VSFA 2PYJA 3LP3A 1JXBA 3SQ2A 5L9XA 1GX5A 4ED3A 3TANA 3VQCA 3C94A 2IBKA 2IAJA 4ICLA 4EYHB 3PO4A 4MK9A 3RB0A 2ILYA 4PUOA 2C28A 2J6TA 3DLRA 1JX4A 4MIBA 2AX0A 2IM3A 3NBPB 4ID1A 2YKMA 2WTFA 1JKHB 4CHNA 4DTSA 4IG3A 4CIGA 3V9ZA 1F21A 3FFIA 4DFPA 4N41A 3KOAA 4CJFA 2UVVA 4QWDA 1NK5A 4CCHA 4JV1A 2ASJA 4OPKA 3TVKA 3BSCA 1N5YA 3QZ8A 2Q3SA 2IM2A 4H54A 4GMJB 3HL8A 2W42A 1C1AA 2VA2A 5HROB 3D0PA 2CJQA 2YKNA 1NK8A 4O4GA 2YNGB 4O55A 1ZBHA 1TKDA 4KB0A 1IKVA 4I2PA 5EWGA 4JLHA 4RU9A 4NYZA 4FJNA 1KFDA 4Q5VA 4J9KA 4J2BA 3H5YA 2GBZA 5J2QA 1HYSA 2JEGA 1WSGA 1QTMA 4BE1A 5J2NB 4FJKA 4DMNA 2W9CB 3QO9B 4B08A 2C22A 2F8SA 4QW9A 3JYTA 3ISNC 4ZHRB 3AVBA 1S1WB 2W7PA 3OYKA 2AX1A 3LP1A 5KT6A 5SZTA 1HMVA 4KO0A 4E7HA 2G8WA 1ZBIA 1G15A 3CIZA 3LWLA 2A1SA 3DLGB 3LP2A 1RBSA 1EETB 4CIEA 3S3MA 1RBUA 1MU2B 4PWDB 3LPUA 3PX6A 5KFVA 2JC1A 4QWCA 4FBTA 4M3YA 2IC3B 2HNYB 4KFBB 1CSJA 1RCHA 4BDPA 3H5UA 1RDRA 2V0NA 4F4KA 3PW0A 3O4QA 3QGIA 4ED8A 1C1BA 1IKWB 3OSNA 4JRPA 1K1QA 3VQBA 3I5AA 2HHVA 1RA6A 3DLKB 4ZPAA 4ECVA 4ZP9A 4DL4A 2ZD1A 3DI6A 4CGFA 3SPZA 1BI4B 1HQEA 1TGOA 3SJJA 3MXIA 1SH0A 2XO7A 4CJQA 5HRSA 2D0AA 1FXXA 1BCOA 4MIAA 4LY7A 2O5DA 1VK0A 4NLGA 2W8KA 4ECRA 3PUFA 1TL3B 4O3QA 1XHZA 3CVKA 4FJJA 2Y1JA 3QNNA 3HXMA 1RT5B 4ZMMA 3VQQA 5KGWA 3CJ2A 2C2RA 4CF2A 5F8JA 4IBNA 4AHVA 3IGNA 4Y1DA 4C8LA 3V1OA 1JKHA 3RRHA 1QQCA 3KD1E 1MMLA 2AJQA 1LWEB 2JEJA 2YHBA 4J2AA 4JS5A 3EYZA 1U45A 2F8TA 4KHNA 4OL8A 3M8PB 4H4OB 3A2FA 4CJEA 3KLGB 4LSLB 4WFXA 3BQ0A 4CFAA 1NHVA 3CM5A 3GIMA 2E9RX 3OL7A 3AVAA 4DQSA 3TARA 4E89A 1TVRB 4K4SA 2BQRA 3OL8A 3VQ5A 5HROA 3HKWA 5DG7A 3SFGA 4BWJA 2ZQBA 2JEIA 2YNGA 4R0EA 1JL2A 4CHPA 4K8XA 3V9SA 3ZSVA 3LP0B 3CM6A 4ED6A 3N6NA 4CF1A 4EO8A 2GIQA 4FYDA 3BDPA 4K4TA 3MXJA 4RUCA 5J2NA 2VWKA 2ASDA 3UQSA 3EPIA 3GIIA 2W9CA 3SUNA 3QO9A 4TYAA 1XR7A 3M9NB 4FLUA 4Y34A 3HO1A 2HWHA 3Q8RB 1S1WA 4N76A 1XR5A 4DL7A 4RW7B 3PVXA 4IFYB 3NF9A 1TK0A 1BCMA 4FJHA 1B92A 3SUQA 1S97A 5J1EB 3NH0A 3DLGA 3FSIA 1CZ9A 1QAJA 2R8HA 1MU2A 4PWDA 3AV9A 5CZ1A 1A5XA 4CFBA 3QIDA 4RUAA 3UDLA 1TAUA 2OPRB 2IC3A 4ZPBA 3ALYA 4KFBA 3TAEA 4B9SA 3K58A 4JS4A 4C8OA 4OKKA 4OPJA 2FVQA 3M8SA 2WOMB 4QWAA 1ZBUA 1IKWA 3V6KA 2JEFA 1KVBA 1RT2B 4RW6B 3CYMA 2RDJA 3PX0A 3DLKA 3IAYA 3K5OA 4K4XA 4AHCA 3L2WA 1BI4A 4J9PA 3OJUA 3V9UA 4ELUA 1JLEB 5KFMA 5KFUA 1ZETA 4B9TA 4CJPA 1XWLA 3OL9A 4KE5A 1TL3A 1N56A 3V6HA 1C0UB 1S9EB 3NF6A 2R8KA 4CECA 1RT5A 2XRIA 3OJSA 1L3TA 2QKBA 4DS4A 4B3OA 3KKSA 3S3OA 3NHGA 1S49A 2P51A 4FLXA 1TKZB 3HM9A 5DGAA 3V4IB 5KFIA 4Z4IA 2F8EX 5J2PB 2P1JA 4ZVHA 1RT6B 3OLAA 3MTKA 2RF2B 3NAHA 1LWEA 4CEZA 3RR8A 1RT3A 3OYCA 4C8MA 3MAQA 3V9XA 4H4MB 3M8PA 4CGIA 1NOZA 2FJWA 3GQCA 4H4OA 3QGGA 3PW2A 4O0JA 2IDOA 3KLGA
chains in the Genus database with same CATH superfamily
4LSLA 3E01B 1FRJA 5D0EA 5G0RA 1LKZA 2YTCA 3J80Y 2P9UA 4QZVB 4LFBF 4K2XA 1O6XA 1TVRA 4CM2A 2HHPA 2G0IA 1M1KO 1HL6A 2DNLA 2I6WA 4ECYA 4B1XB 2BW2A 4E3SA 4F4ZA 3B54A 3Q23A 3UKRA 1MMDA 2AP1A 2Z8QA 1SC3B 4QYRA 3SV3A 2NXEA 4DV2J 1IV0A 3L95X 4YB5A 4AM6A 2Q79A 4D3GA 1JK9B 4EK2A 1RTHB 2FVPA 3T1YK 2DHXA 1EO1A 2EFPA 3C16A 3TNVA 5AJ3F 3M6UA 5I42B 5LSOA 1W7AA 4KHYA 4S0MA 1VC0A 2NRVA 2PEBA 3MAAA 4RW7A 1OWXA 3J7ZO 1S5JA 4IFYA 4USKA 1VHXA 4DSLA 3J81U 2ILZA 4FPAA 4A48A 1UVNA 3N5BA 3QFWA 2IPOB 3DRRB 2OPRA 2CJAA 2AQ4A 3FZMA 1H38A 2WONB 2AGOA 1D4XA 1HRHA 2EFVA 3QRRA 4CJWA 2HEKA 1S10A 3TAFA 4IOXA 4GVBB 3I8DA 3C2PA 4JKGA 2LKZA 1BE4A 5J1NA 1BIUA 4E19A 5IM0B 3RAQA 4U9RA 3EVWA 2CWKA 4P71A 5AJ3J 3AVFA 2B51A 4UY8O 4NPOA 2A42A 2M9KA 4F02A 3HSDA 1CXQA 4FF2A 1CJUB 4ES1A 3BPSP 3CJ1A 2WBNA 3TTDA 3P6YC 3HSJA 4G3IA 3IFEA 2UU9F 1KLMB 2RHQB 3QATA 1Q4RA 5FPDA 3DGPB 1L3UA 1TKTB 2HQGA 4DR7K 3CJ4A 4DN9A 3TWHA 2D5RA 2C2ZB 3PO5A 3ZSQA 4DHVA 3E1YA 1TFWA 4H4MA 4CZLA 1JMTA 1RAEB 3KNAA 5E84A 3NCRA 2B0GA 3E01A 4OGCA 3OBYA 2HHWA 2NRZA 3LAKA 3BH6B 5EWEA 3P4IA 4AXIA 3QSIA 3JQKA 4MDBA 2D7SA 1XNRJ 3THVA 1VLYA 3UFCX 2FJBB 5KFTA 4GVEA 4Z7YA 1SZ2A 2G8VA 3PSIA 3CJCA 5E33A 5U47A 4WZQA 3MD1A 4PQAA 5LJ3Y 1TL1B 1H7XA 4DUYK 3BPDA 4Z94A 4QPTA 5A76A 1VQ4N 2NSCA 3RBXA 5AXKA 3FRZA 4PWWA 2VDHA 1RTHA 5E3PA 2NREA 4KHUA 3D28A 1KNZA 2NXNA 2KKZA 5I42A 2E5IA 2GS8A 5KFZA 2C2NA 5GIOA 2KTQA 4CZCA 1VQKS 3WXKA 3LPEA 4NXNJ 1REVB 4PPZA 1W0HA 1KD1T 2XSJB 4MFBB 2DNMA 2JWNA 5BPLA 4R25A 5C42B 2R2TA 1WI8A 1V3RA 1ZBSA 1IWGA 1KDNA 4CGGA 4HCCA 2QL9B 2VF3A 1X3MA 2PEHA 5KT4A 3BSAA 4LF6F 1T11A 4JB8B 2HHHK 1BQNB 2N3OA 3DRRA 2OZSA 4RZRA 1X9SA 1D5AA 3FCWA 4X66J 2WONA 5C25B 4WJBA 3VQTA 1IKYB 4HH1A 1JJCB 1NHKL 1PC4A 5KGXA 1EX4A 1XQSC 4B3TF 3LQVA 4DL6A 2Z1IA 1XNQJ 1D8ZA 1M5HA 1KAYA 3W3DA 2ZGYA 4CGDA 2QWOA 4GVBA 5M1FA 4Y2CA 3M8QB 4Z0UA 4C0OC 1JJ2R 4X4SA 2BX6A 3JSRA 5IM0A 2AU0A 2LMIA 3QZ7A 4B1UB 2VFRA 5FROA 2DHSA 4USHA 4OYAA 2W7AA 3EUNA 1DJ0A 1KC8T 4PKHA 1CJUA 4KI4A 1KR4A 2CG8A 3QAEA 2W9AA 2KO1A 1KLMA 2VWJA 3CCMS 4LF6J 4FK0A 4Q44A 3DGPA 1FDAA 1U4BA 1RKJA 2GHPA 1TKTA 3G6VA 5F8IA 4MDAA 4X4TA 1XERA 3I6PA 2GFFA 4ID8A 1YVFA 5BYSA 1CULB 1RGIA 3HFZB 5IOLA 1X3NA 3W7BA 2GC8A 5FIIA 1MWKA 1QHTA 3OW2M 3G71N 2HLTA 1HR0F 3KXDA 1Q0NA 2OTLS 2IRUA 4H4KC 5DDPC 3EDQB 1SKRA 3VR1A 3EE9A 2NUBA 3SBGA 4L3NA 4NMXA 4JRQA 5B0DA 4NX9A 1WSFA 4JKCA 1Q78A 3UO0A 2F7VA 3BSOA 4GO7X 3NBPA 2DEJA 3BUZB 2XY8A 2WB1D 2DFFA 4DV3K 1NSQA 1GLLO 4UF4A 1TL1A 4AQYJ 1H2VZ 1D09B 3AVCA 4PXCA 3P31A 3QINA 4Z37A 4BRAA 1IBKF 2ATQA 4JI6K 1ZZNA 1QJHA 4NYPA 3BP8A 3KHGA 1U1NA 2GV1A 3I0RB 1SKUB 1UEVA 2ITGA 4Z4EA 5LMUJ 1HNXJ 5CXTA 1REVA 3IS9B 4OI3A 3HJFA 4TU7A 4XDCA 2XSJA 4MFBA 1HR0J 1H7WA 2PC6A 4OJHA 4CK2A 4EUVA 5C42A 4OQJA 3C65A 2WTUA 1RABB 1D1UA 4OYXA 3ENVA 1BQNA 4KT0C 3M8ZA 1KLNA 1MG7A 4EFAC 4CLUA 5CH7B 1UVMA 1IKYA 3CCEN 1C4CA 3L2VA 3GMGA 3Q7CA 3D7SB 4KH6A 3M9MB 2OANA 3VTIA 4M7XA 1E6VB 5TKWA 3GYGA 4CBXA 3OHRA 4HVZA 1F5AA 1EETA 4BR5A 3E9LA 3GYXB 1FXRA 3VVUA 3PIPL 2CQ2A 2O8FB 2BQ3A 1WSVA 3PW5A 1PCAA 2MKIA 3H98A 1X4FA 1R0BG 2DNQA 4CD3A 5HVGA 3J7Z5 1HW8A 5DLFA 4F26A 3RW7A 3L3UA 2V7YA 2D0OA 1OO0B 1NGBA 2PFFB 3CJAA 3IR6B 4LF7K 4BRGA 2RD5C 5HVHA 2W4DA 3K8WA 3THTA 2PIIA 1CULA 2EPIA 3NLCA 4K4VA 3S41A 4YR3A 3HHKA 3MN9A 4USIA 2QA4S 2DR9A 1MWQA 2ZNYA 3IR7B 3E3XA 3ENAA 4C3MA 5JVHQ 4BBYA 2EW9A 1QS4A 4N77A 2NPIA 2KHDA 4NLXA 2KQ2A 4FZZA 2QWQA 2DR7A 5H9EJ 3US5A 2IA6A 1I39A 3CGIA 4ZS6A 4DU8A 1FK9B 2DPIA 4CF9A 3OSPA 4ILMA 4WQ5A 4NEZA 1PO6A 3VEVA 2J6SA 2ZH2A 2WVDA 4ZJQA 3WT0A 3PJXA 5DQGA 2K7KA 2HRYA 1EXQA 1HYVA 1S5ZA 2E1PA 2A6OA 3NMAA 4F3MA 5LL6d 1X8DA 3AA3A 3RBZA 2JHEA 2IIRA 4FXWA 4YR2A 1CBKA 2FPHX 3I0RA 2ZM6F 1GLCG 2CPJA 2GCFA 3AO5A 2OIHA 1S72S 4JKAA 5A6PA 2DR8A 5HRNA 3IS9A 3IP0A 3W8GA 2KT3A 1M5OC 1ZTTA 4HHTA 1VQ5N 2VQEF 1S1XB 4KHMA 3FEXB 3NRBA 3TZYA 5IQ6A 5C10A 1NK7A 3T1HF 2NUHA 2F8MA 2HFOA 2QK9A 1W25A 1Q5YA 1R8PA 4JI4F 3VQAA 1ASUA 4JP8A 4OO1J 2FJAB 3KHRA 3SMZA 1Z25A 1E6VA 1ZA2B 4GV3A 3GIJA 4F4YA 4Q7AA 1WF2A 1X7VA 4F04B 1VQOS 4YR0A 2O8DB 3KLFB 1OIAA 2VQFJ 1U6BA 4I2PB 3D5MA 4IO8A 2O8FA 1S59A 2A3JA 3TSUA 4PPDA 1N0UA 5F0UA 1JXVA 1NJXA 2HHXA 2W1BA 1LEOA 4RUBA 1YRTA 4UW2A 4J2EA 5EGYA 1FRIA 8RUCA 2HQ3A 1ZZFA 4J91A 4LH5A 4GO5X 1P8GA 1O51A 3F9KA 1JLFB 3H25A 3OTEA 4AF1A 5GAHP 2ITMA 1GTHA 4NXMF 1G1XA 1J5EF 4OVLA 1RI7A 1X4CA 2XMJA 2BM1A 1RYSA 2ADCA 4XO0A 2E1AA 1QSLA 1YXQA 3Q8QB 1BD6A 2ZUGA 3VETA 1FK9A 3SI6A 1T9UA 2GHVC 4QW8A 4X65F 2E20A 4TLRA 3NH2A 3WIVA 3LDNA 1OVQA 1WOPA 2XZDB 4YEAA 2XYHB 2R7QA 1VQ9S 1QE1B 5JXSA 3OVNA 1T3OA 1N36J 5BR9A 2I5JB 3HZEA 1F60B 4EO6A 4CZHA 1SQGA 4F36A 4PKDB 5BREA 2OEKA 9ATCB 4U67L 3CQXA 5E7OB 3BM7A 2V34A 3ULEA 1RT4B 1L3VA 2FBTA 4HL9A 2G9OA 2FLNA 4EP4A 3MEGB 4DF4A 2PYLA 4KTZA 2DR5A 2F5GA 4F67A 2HHTA 1U47A 4LIRA 2HFZA 1KS2A 1S1XA 3NGDA 1PYSB 3HD2A 3GLJA 3DLHA 4FPIA 2VOPA 1N52B 2X78A 3AVGA 1WELA 1KVJA 3ISZA 3BO2A 2IM1A 3K57A 3AAQA 3W5YA 2ZKUA 1DBDA 4CZKA 3VF0B 2D3UA 3RB4A 1KWMA 4FXVA 2MQQA 2NPFA 2X51A 4HH0A 2VZ9A 1VIOA 3BEGB 3RGIA 3AARA 4USUA 2YHXA 3WZ0A 4JKFA 2RRAA 2O8DA 5CHCB 2F1FA 3NGYA 3KLFA 4KH0B 3QJJA 4M5DB 3BEXA 4BDZA 2OFGX 4F2RA 2W8LA 2RHSB 4WU2A 1F1BB 1VSMA 1GMVA 2UYTA 3VALA 1JLCB 2FJVA 4DEZA 4F7VA 1SS6A 1XK8A 3R9LA 4KB7A 2QX0A 2G2OA 1HBUB 4DCPB 3ZX3A 3KK1B 1WNSA 2UXDF 5AQMA 1ATNA 1X5TA 1HNWK 2Q66A 3CCUN 1U1PA 3EVMA 4DL3A 1JLFA 2CNKB 4CIFA 3ILLA 4A8OA 1QVFR 3NMRA 2PN6A 5DZ6A 3J80U 1N88A 1X5SA 4M3XA 4OJGA 2H5EA 3QEPA 2ZBIA 3DRSB 1NK6A 4JI2J 1UPPA 1U7LA 2P6TA 5AE1A 3RW6A 3FZHA 3SQ1A 1UEKA 1U1OA 1Q7YO 1KVCA 2E1MC 4I1TA 5HVFA 4MK8A 4Y2AA 2E88A 2XMAA 1EWQA 3AQPA 1I3AA 5IWAK 1X0FA 3ADAC 4LF9J 2CJBA 4XH5A 1SL2A 5A6WA 1OVYA 1AROP 1ZAXA 3CFRA 2WCXA 1NRKA 2GQCA 1QE1A 4CJLA 2BTFA 2I5JA 2H54B 3D9BA 4ZJOA 2HBQB 1RWMB 1YX2A 2P8IA 2GIRA 2RQ4A 3FGVA 3HHLD 1NJWA 3PRVA 3G6EN 1MMNA 5B08A 1N8RO 2PI4A 3NS6A 3JSBA 2X6NA 2OSRA 1RT4A 3WXIA 3C6AA 4BVOA 3MEGA 1YJVA 4ZVUB 5ETOA 4LREA 3PEHA 2I7NA 2OD6A 3OBWA 1FJCA 2HB5A 3AO2A 1JLGB 2HWIA 1HJOA 3LF0A 4B3RF 1WOOA 2QE5A 3ZSOA 4C2MA 3N79A 1HQUB 4CJTA 4H8KA 2XI3A 2V6AA 2ZDOA 2YV0X 4ZK7M 1V5VA 2GV9A 4FF1A 5AQXA 1U2RA 5HOOA 2CJXB 2ZBRA 4I67A 1O8BA 2OD4A 2VH7A 2KFNA 4FYYB 3ZC4A 1ELOA 5DQIA 1FEHA 2C2MB 4M5DA 2RRNA 4DSIA 3B6PA 3TJAA 5CY4A 4JI3F 4JI5K 3L7UA 1JLCA 1FKPB 2FSKA 3AVKA 4FVUA 1HBUA 3KK1A 3OPKA 4DU4A 4GKKK 3LZIA 1J53A 3GSIA 3KJFB 3ILIA 3MX5A 2PMZD 2I0XA 2YXLA 2FVCA 4CLKA 5KTQA 2KG0A 4MO4A 1NGEA 1YT3A 4TYBA 2QIFA 3OFFA 3D54A 3DRSA 4WPAA 1UCNA 3QWPA 5D0RA 2BANB 1FKOB 4KPYA 3M32B 1EJ7L 1YLXA 3P39A 3ETOA 2UP1A 4B8CA 2ZH4A 4M3UA 1RU2A 2K2PA 4XPCA 4RR5A 2VCPA 3UNYA 2J6UA 1S6UA 2B56A 4ZVRB 3R6MA 3BF4A 4JV5J 2FB0A 1R8HA 3VVTA 4DR2J 4OYOA 3AA4A 4HTJA 4EIAA 3MCAB 3GU0A 2MQLA 3KG0A 4C3KA 4P73A 3PXGa 3FK4A 3SQ4A 1W2BR 1NB7A 1P8ZA 1JNRB 4DV6J 5FPMA 3PDNA 3BZKA 1S1UB 1N33K 2XMTA 1JCEA 3P96A 3WC2A 1TYQB 1ZAVA 4IUFA 3NDKA 3O5TB 5BR8K 4EGLA 4I0WA 1TP7A 2YNHB 3RJMB 3TZWA 3OVAA 4K0KJ 4A57A 3MECB 4XH1A 3WUHA 1JLGA 4L72B 3KIOA 4DL5A 3C6UB 1JLAB 1P1TA 3MEEB 2AJFE 2WSFC 1HQUA 3PRDA 3PLAA 4ILHA 2Q31A 3I56S 2ZKTA 1NK4A 5EX5A 3QETA 1OH6A 1K8AO 3RSEB 2QXFA 4B9MA 1VCTA 2IFXA 4ECZA 4DV7K 4LIWA 2JX2A 2DY4A 1W2IA 1SXLA 3GIKA 3E8OA 1PYOB 3H2VE 5D15A 5DJBA 3DLBA 4KHSA 1JWWA 3F44A 3CJSA 1W9HA 2XY6A 3HF5A 3BGOP 1SH2A 3BBCA 1FKPA 2RRBA 3CCLN 1S48A 3FBEA 3TAMA 1YQHA 2SXLA 4F8RA 3HFKA 1RQ0A 1FCAA 4M5NA 4E1NA 2AZ1A 2DNHA 3GWCA 1NXIA 5F8HA 4ZDNA 3BS9A 4WKRA 1IKVB 5KG2A 3QJLA 2XM3A 2Z2ZA 4PL7A 3ZYYX 3K5MA 1UZDA 2EWHA 3EZOA 3Q0AA 2BANA 1FKOA 2DITA 2UXBF 3GPAA 3M32A 1I94F 4B9QA 1RKIA 2C1EB 5J2QB 2OGUA 5E3CA 2P9NA 1N4LA 3IBWA 1FJ7A 4JNEA 2ZZNA 2YVSA 4KAZA 2N7YA 2MJNA 3VQ9A 3M8WA 2HW3A 4FNHA 4OIXA 4BCAA 3CDEA 4W90B 4KO0B 3W3SA 5D0HA 4DCHA 2OTJN 4KH1B 2GAHC 2KM8C 2BACA 3LWMA 3W61A 2X1AA 3FQKA 4EAHD 3HT3A 2OLWA 2ZJQL 2AJ0A 1TYQA 3GYNA 3H40A 1K0VA 4ZOSA 3O8WA 3I5CA 3SAGA 5F3ZA 2YNHA 3FMWA 2NS1B 3MECA 2CPFA 2I38A 4CFDA 1JLAA 3MEKA 1YBTA 3MEEA 1RAJA 4HDGA 2VHGA 1ATSA 5KFLA 2E8AA 1LNQA 3O80A 3WNGA 2KRBA 1UMJA 1UOCA 3LP3A 3MWTA 1JXBA 1FJGK 1SQKA 1MDUB 3TANA 3VQCA 3C94A 4GY2B 3RSEA 3IDHA 1F2HA 1DKGD 4EYHB 3PO4A 2WSEC 5CZVA 4HTIA 3W9HA 1JX4A 4MIBA 1WC1A 2GO8A 2YBVA 2ZZMA 4CHNA 3RUBL 3V9ZA 1JJ4A 4DFPA 3T1YJ 2QRRA 1XMQF 2RMLA 5DETA 2UVVA 4LFCK 2KJVA 1WKLA 1FFWB 4JV1A 1BDGA 3TVZA 2DO4A 3IMQJ 3VGKA 5HROB 3G25A 3M05A 1RWOB 4O55A 4WF9Q 1WB9A 3W64A 1IKVA 3FGUA 5EWGA 3H3OB 3QMQA 3UD4P 4JYAF 2R42A 3FEYB 4Q5VA 4NLCA 4J2BA 1RACB 1VC6A 1HKBA 4DPUA 2GBZA 5J2QA 2X3DA 2K3IA 2YJFA 4BE1A 4FJKA 1SIZA 2QW9A 2ZC3A 4B08A 3KK7A 1RGVA 4DR3K 1WF0A 2W4CA 2V2VA 4LF4K 4UUWA 3ISNC 4ZHRB 1WG4A 2ZHBA 5AQVA 1E3MA 3C15B 3W66A 5SZTA 4DDFA 2DR6A 4KO0A 4BGBA 1FFSB 4E7HA 2CPZA 2DEIA 1KVIA 2G8WA 4ZLPA 4GVLA 3Q2TC 3AQOA 5F2RA 3F2KA 1MU2B 2AT1B 2JC1A 4M3YA 1OH5A 2IYGA 3R1HA 1RWWB 2IC3B 1RAHB 2HNYB 1FDBA 3I32A 4E8UA 4KFBB 4C98A 3EZWA 3CXCR 4ZPWR 4OI0A 1VC5A 3HI9A 4DR7J 2BH1A 4CLTA 1KD1O 5EN1A 4JYAJ 4BRIA 2RVJA 5K8OA 2D1CA 1K1QA 3G2XA 1RA6A 3DLKB 4ZPAA 1OQ6A 4RL1A 1VQ4S 3SPZA 3UDCA 2MZTA 3SJJA 2OMOA 3UNGC 1Q5VA 3QWUA 2JOQA 3HHLB 8AT1B 2D0AA 3A8YA 1BA1A 5FPNA 1K8KB 2H3GX 3QMLA 3TRGA 1BXNA 2C3PA 3BR8A 2NR0A 2Y1JA 4U95A 3CDBA 3CJ2A 4CF2A 4C8LA 1SC6A 3B4MA 2N3LA 2L08A 4NZ6A 3NWRA 1CEZA 2RU3A 1U45A 2UUAK 2F8TA 3M8PB 1DEJA 4H4OB 3CQYA 3N5FA 2G1HA 3BQ0A 4I56A 1UTAA 1NHVA 3CM5A 4DL0C 4DQSA 2LECA 4K4SA 2HMPA 3OL8A 4DR5K 5HROA 4KH5A 5F1XA 4WP8A 1JL2A 4BC7A 3VOVA 3K9KA 3V9SA 2RS8A 3LP0B 2ZH5A 2IY5B 3ZSVA 4KC5A 4K41A 3N6NA 4X4QA 4EO8A 2HG4A 4F0HA 4FYDA 4LF8F 3BDPA 1EHWA 2H3EB 6AT1B 4MAKA 2FIUA 3UQSA 3W2WB 4TYAA 1XR7A 1TZ0A 3M9NB 3P5BP 1VJWA 1BC6A 4OZ2A 4ZVQB 2XHCA 3MPUB 2E5HA 4HEA9 1XR5A 3LGNA 4DL7A 3C15A 4PL8A 2VODA 4OJ1A 4P74A 4YY3K 5J1EB 3A0IX 2HAFA 2V2QA 2R8HA 1MU2A 3AV9A 1F9FA 1A5XA 4CFBA 2IC3A 5A2QO 2HIYA 4IZ9A 1CJTB 2LQ9A 4KFBA 4RU2A 4JS4A 4OPJA 1ICEB 3D1HA 4QWAA 4IFEA 1KVBA 5ETNA 3A8EA 3PX0A 3L0QA 3DLKA 3MDFA 3AJDA 3O44A 1RHRB 5ITHA 3L2WA 1DURA 3VAIA 1M1KT 4GV6A 3IO1A 3HHLA 1ZETA 2AMCB 4B9TA 5HMXA 2W4PA 2DGVA 4CJPA 1K8KA 5LL6Z 1NDKA 2J9DA 3V6HA 1C0UB 2PMHA 3AH6A 4CLLA 1S9EB 4Z2XA 5AXMA 2R8KA 1NGAA 2QKBA 1HHTP 3H42A 3R7NB 5AJ3K 4FLXA 3HM9A 3I9V9 4IQMA 5T7LB 5HL7Q 3OLAA 3MTKA 1RT3A 4YB1P 4C23A 3CMQA 2W2OP 4C8MA 4JI6J 3ZX0A 3M8PA 3J7ZT 1F5CA 4H4OA 4FF3A 2U1AA 1BUXA 3OYEA 4BWMA 1V5IB 2GWJA 4KQZA 3T6JA 3EXCX 4CJSA 3S8SA 3MR5A 3V1RA 3NCQA 1BO5O 1NSPA 4QS8A 4TNOA 3CI5A 2KVIA 1ACMB 3CF5Q 2DRDA 3V81B 4ES2A 2LU2A 3OLBA 4FNIA 4KIAA 1UETA 2VFSA 3TZZA 1H98A 3I33A 4ES3A 1NJYA 3LP0A 1XNRK 1O0PA 2Y8WA 4W98A 2K1RB 4IKFA 5BN8A 3CMEN 1B0PA 3IR5B 1J54A 1EKEA 5T41A 4WYWA 1UEUA 3X1LB 3W2WA 2FDNA 5MLCQ 5KFQA 3JQMA 4IYQA 3BQ1A 1LK5A 1DQAA 1Y4ZB 1HX1A 3MUTP 1N5SA 3DDKA 4CZEA 1OMSA 4O8KA 1TUUA 3AO4A 3FDSA 2QLBB 4JK9A 1YITN 5J1EA 4ZPDA 2UXCF 4U7UD 4C7QA 4NLYA 4DTRA 3R3LA 2B4OA 1IQTA 1R89A 1CJTA 3ENHA 3QYYA 4NA2A 5HO4A 4O0IA 3TUJC 4IOCL 5GAEU 2A1BA 2NZCA 2HQIA 2FGOA 3OHAA 4LR8A 2V51B 5D0GA 1MNEA 5KFKA 4LC9B 4ZPVR 3K5LA 4ETXA 2DPJA 1U6FA 3PYGA 4QCLA 4X66K 3NWGA 3CWJA 1HUXA 4FWOA 3CDWA 5HQMA 1S6QB 3PR4A 4BRNA 4ZKAA 4FM2A 2GUPA 4FS1A 5D3GB 2HVZA 1OSCA 2B4VA 3KJNB 4LJMA 3GE1A 4ZPTR 3SAFA 3RAMA 4DSEA 1N34J 1G99A 2HBMA 3H20A 4OI1A 3DRYA 4L3KA 3NFAA 1SVDA 3RB3A 3MPWA 2VOOA 1S9EA 4H5WA 3D4JA 2ZITA 3J7YU 4UTGA 4L73A 2ZJRQ 3SUOA 1FA0A 4CO4A 2ADBA 2UXCJ 1MSWD 2AIRB 3WX4A 1HKCA 4DV5J 4KKOB 5IC6B 3RMDA 5T7LA 1PYTA 4U7UK 1CLQA 2KU7A 2EFOA 1VSHA 3VQ4A 1OQ3A 3LDLA 2Z0GA 4XPEA 3MUMP 4LF6K 5BXIA 1YBUA 2E5LJ 4QS7A 2D0BA 2MHEA 2ZH3A 2B9WA 2WFBA 1TQLA 5LJ5Y 3HHEA 3SQOP 4P52A 4NCAA 2BKNA 3BR9A 2FYXA 3R9PA 3HVWA 3V81A 1LK7A 3R6GB 4B3TK 1U8SA 3G82B 4FLVA 3OQ2A 3P83D 3EE3A 3V5RA 3TA2A 5A2QY 5KFHA 3CC7N 3D0GE 2FLLA 4HUFA 2K1RA 4BRLA 3W9JA 1G2EA 2BKPA 2QG9B 3PFOA 4E7IA 4DQ8A 2IVFB 2HQDA 4U7BA 3HHNB 2AYEA 3GOIA 5E41A 1X4AA 1RDBA 2D9PA 1S6OA 5HP1B 1V3SA 4DV4F 2AWZA 4L6V3 4QIEA 2BRKA 1NPRA 2Y8YA 3L7PA 1ZM3A 5KFYA 5RUBA 4OV1A 2X6SA 5F8GA 3N6LA 1KQSM 5B0BA 2J9DE 4USJC 3GJRB 5GAEI 1VRTB 2LFVA 2J7WA 2CADA 1HR0K 2ASPA 1FI4A 3UE2A 5KFFA 4X64F 3CDAA 4PWUA 1V4TA 2FY8A 2FF3B 3ZT1A 1Q8LA 4KHPF 3CC4S 2ZUAA 2HHSA 4NWBA 4M5GA 1CVJA 2IDEA 2W41A 4FDFA 1S6QA 3DLEB 5AQLA 2CZVC 4CJ4A 5D3GA 5ADXA 3R5BA 4URGA 4CM0A 1VBZA 1WKKA 3HVRA 1JLQB 2PSZA 5AQNA 3T3FA 2AW0A 3ZZOA 2G0CA 2MKSA 3J7YI 1DAXA 3DXBA 1IBKK 1ZS6A 3GFYA 4P2SA 1NJIO 3GIRA 4DV4J 5EY4A 1QAXA 2FBXA 2MEWA 3H59A 5AQHA 2N82B 2ZDPA 3MEDB 2QL5B 2VKRA 1WKJA 2MKJA 4KKOA 1FEEA 1X31C 1AT1B 2KXHA 1VQSA 2EEYA 4MQ3A 4FF4A 3EDRB 4BLGA 3QQCD 4MTPA 1ZM2A 3U9ZA 4EYIB 2H4WB 2RSQA 1YIJN 2H65B 3THYA 5DK5A 3O2IA 5C5JA 3KKRA 3CC2N 2QN6B 2O4IA 3HVTB 5AFUA 4N56A 3J81Y 2Q6BA 3Q8PB 3G82A 1VSIA 1R8AA 1HD0A 2UUTA 4Q8EA 1T02A 4PG7A 3HPGA 1TUYA 4DTXA 4E1JA 2MQOA 4O3PA 1QSSA 2BJ3A 1KEKA 2W24A 1NGCA 5IT9O 3ZT0A 5AZJB 1EKRA 4K25A 5HANA 2OI2A 4WE1B 2ZH7A 2GGPB 3S3NA 3CULA 4CH1A 3M30B 3QESA 2BGGA 3DLJA 1M1HA 2UUCF 4OX9F 2R2RA 5HP1A 3GTYX 4M45A 2CZ9A 3HSTB 1VSJA 4CJ5A 3AA5X 2LEPA 2QA2A 2NZTA 4PY5A 5M1KA 3ZSXA 1PC5A 3FE1A 1VRTA 1L3KA 1HNWJ 5B09A 3F56A 4AL7A 1ZPVA 3G8QA 4DTPA 4JI1F 2COLA 3VV2B 4E0DA 5HQ8A 2G4BA 4NMLA 1ULRA 3H2UB 4KHWA 4JUZA 3L4BC 3DLEA 4BRFA 1BGXT 5JLFA 3EGWB 2MDAA 2XWXA 4YB6A 3G6ES 2FUG9 1JLQA 3DLLQ 3QIOA 4Q8FA 2MZQA 5K8NA 1OJ4A 2F9JA 2HFNA 2BOPA 2JC0A 1T05B 4AD6A 2PI5A 4OJRA 4DUZF 2F3JA 5IWAJ 5BRHA 1HBNB 5KFXA 1KVKA 4FVCA 4YNQA 3U27A 4FJIA 2OKQA 4W5RA 3OVSA 2EHGA 3MEDA 2ZM6K 2BEFA 1T0TV 1LW2B 4FWQA 4O44B 2GNKA 1F5BA 1XI1A 2DYAA 4BR4A 4U8YA 4C0BA 4DTJA 4P9SA 4OHXA 2HWTA 4MLEA 3NNCA 2KZZA 1CQNA 2VQEK 3OYNA 3KMQA 3VQEA 1N5QA 4FYWB 2DGTA 3T1HK 4KAIA 4DZDA 2R2UA 4ZIWA 4RBVA 3R97A 4YOTA 4ZCKA 3HVTA 3K17A 4JI4K 2EK6A 1F9HA 3AVLA 2B6AB 2F9TA 4RUHA 2Y1RI 1Y5IB 3QEXA 2DPNA 2P9KB 3A3PB 2EFQA 3HPHA 3VF6A 3W1YC 3OYMA 3CQ8A 2XB2D 3W8PA 2CXEA 5AZJA 2FJXA 5A8WB 4FLZA 4BR2A 3NAEA 1RBTA 2V8PA 3PY8A 5EXWA 1YJ9N 4WE1A 1FNMA 5CZ2A 2GGPA 1WHVA 1A6LA 5LM7E 1TL7B 3M30A 4DPTA 1S4FA 4J9MA 3AD9C 4ILLA 3TEGA 3MI7X 2ATCB 3C8YA 3J7AN 4USWA 4G1IA 5GMKa 2E6MA 2J76E 4FSVA 2WSCC 1HKAA 1WI6A 1PAUB 4H5NA 1RAIB 3AO1A 4WU3A 3OYFA 4OGEA 3D67A 3EGZA 5GIPA 4CIOA 1IH7A 1JJ2M 3UCUP 1AB8A 1RJJA 5EX0A 3Q24A 4CRJA 4DWIA 3D6MB 3IKMA 4IO1A 3N4WA 2POKA 4NXMK 1J5EK 4LRBA 1AYEA 1URRA 4K5SA 1TMJA 3THXB 3KMSA 1Q82O 4UQGA 1QAYA 5FDLB 4WBFA 1VLOA 1EARA 1RFQA 1NHUA 3QGHA 3SSSA 2RUGA 1PSDA 3LM2A 4F2SA 1S1VB 3BKFA 1CLFA 3NGSA 2MMYA 3OFHA 4K59A 2JLGA 4OZ3A 4HI1A 5KFDA 1T05A 2EC0A 1WSJA 3LPYA 3QICA 2G8FA 4YOXA 1HBNA 2CFXA 5DO2A 3VQDA 1VK8A 4YHHJ 1WNEA 2BW7A 1K1SA 2DGSA 1PILA 5HATA 3JTPA 3FR0A 2PE8A 4Y0WA 1LW2A 2F40A 2XGPA 3BH7B 4O44A 5IT9Y 1CZAN 1EX8A 4U7CA 3VERA 1WDDA 1KONA 5LMNF 3ID8A 5A8RB 3GG0A 3TEHB 4DR6J 1A7GE 5BR8J 3R5GA 2W2NP 4ZVGA 1HNZF 3BYRA 1FNXH 4OPHA 5KRSA 3W60A 1RAGB 2KHCA 1K0TA 4X62F 4J37A 2XLIA 4FW2A 3CB4A 3K7RA 3OYGA 4D3HA 1HW9A 4HWIA 4HCBA 4ZP8A 3PW4A 4F0MA 1GLFO 1HWUA 2DCLA 2P9KA 2KFZA 4MLHA 3SBMA 2YQ0A 1U0HB 3CCLS 5KFRA 4LH4A 3D6RA 1WHXA 1S1TB 5JVGL 3PIOQ 3FZKA 3OR2B 3LTOA 5A8WA 2R7UA 2YNFB 4A8XA 1VFJA 4Y00A 2QEXN 4DV7J 3IXQA 1TL7A 2EKYA 2FZGB 4FOIA 3I55N 3R5JB 2NUUG 1VSKA 4DQIA 2UXDK 3ET6B 1TUVA 4Z4GA 3GG1A 2CIMA 3KVGA 4IKAA 3PG9A 1HPMA 2RKIB 2RILA 3AOCA 3ZTRA 1RT7B 4DSKA 3PR5B 3H4BA 1AZSB 4CNYA 2CPYA 1U8WA 2VC0A 3H4DA 2Y0BB 3QNOA 4I6YA 1SUQB 4EBEA 4N5SA 1UFKA 4YQWA 2L41A 1RBLA 2CQCA 2KVQE 5ETRA 3THXA 1JL1A 2CJYB 3R1LA 4WTOB 2AV5A 3X3UA 1S0VA 5D78A 1VOMA 3UW1A 1Q7YT 2OTJS 1BHLA 5FDLA 1SJRA 2BJ1A 2XNQA 3AA8A 4B3MF 2OZMA 2ETJA 1S1VA 2V94A 5KOWA 4O23A 3NL0A 4F4WA 5JMVA 4BRQA 3CCRS 1BOTO 3RBEA 1LAWA 2AGQA 4FXDA 1QY7A 4I7FB 4DU1A 2V69A 4FJ7A 4WFNL 4M3ZA 4CHQA 2D0CA 1JXEA 4CF8A 1K44A 2OEJA 3R2CJ 2BUNA 4ED0A 2ATLA 1N32F 2NYIA 2QFJA 1OPZA 2HS4A 3MPYA 1N8RT 5EHHA 1GLEG 4PKGA 2AJ2A 3ZTPA 5T7BA 1DGKN 5A8RA 4C48A 1ZOTA 1WWHA 3TAGA 2AGPA 2IVPA 2D1KA 3O1WA 2RJZA 3CCSN 4B3RK 1WG5A 2QMXA 4F4XA 1N5TA 2BJ7A 4JI0F 4H0PA 3HTVA 5AXNA 2KT2A 3NE6A 5BPMA 3QPIA 3A4TA 4B3MJ 3T19A 2FZKB 2MXYA 2FC0A 1WLJA 3P5TL 2CPIA 5HRRA 1SC4B 4CBUA 1M5VC 2X1FA 3DOLB 2BABA 1ZA1B 4WP3A 1OKJA 1U0HA 4KSEB 2ZZTA 1R7IA 3C19A 4UOHA 5KFAA 2X74A 4P6QA 4EI2A 1PBUA 3WQUA 4E7JA 4LD0A 2MQ8A 1S1TA 4M63A 6FDRA 4N47A 4CO0A 3OR2A 2HQCA 2MKYA 4KPCA 4HLBA 1B9DA 2YNFA 2CGJA 4JI3K 2GQ2A 1WSHA 1DFDA 1SJ1A 4K42A 4ECQA 1NGDA 2DT9A 3E51A 4CNZA 4WFAL 4OHZA 3NS7B 1HLUA 1VBKA 3ET6A 3OY9A 1HFEL 3RWUA 2NLXA 2B43A 3I5BA 4B3OB 4LFCJ 2RKIA 4DR1F 3Q8UA 1HHQA 1KCFA 1X4GA 2OO4A 1RT7A 4H0VB 2GVZB 1AZSA 2P5OA 3ENWA 2HZVA 1SUQA 4ZCMA 2M88A 1X4DA 1SV5A 4YOEA 2UUBF 4FJXA 2NXJA 4KV8B 4RX6A 5L8RC 2OCEA 5DM7Q 3HP6A 4FN5A 1PJ5A 4CEQA 1YAGA 4AFFA 4KTWA 5ETMA 1HHSA 2I8EA 1WUAA 3VQ7A 4ECWA 4DHYA 3JAMO 2M3DA 2MQPA 2CNNB 2RAQA 3UR3C 4LF4J 4I7FA 2BUPA 3NEKA 1WTBA 2JLEA 2LQ5A 1SIWB 4NCGB 3R5AA 3BJYA 1UJ6A 1S9FA 3TTFA 4M5JA 1IO2A 1J2VA 5GADI 5D4PA 3Q7BA 4NL5A 1QHAA 2W6KA 3GP9A 2FHOB 2GJIA 5DGBA 3H3NO 3RRGA 1KRPA 3C6HA 4QU7A 4Q45A 1FTCA 2B8PA 4YP3A 1EAYC 1TK5A 2FC9A 4B3SF 3TPQA 7FDRA 5HSPA 4PAAA 2BE9B 5KFNA 2ZE2A 4LSZB 4M5MA 2V63A 5A2QU 2WB4A 2MSSA 1H6KX 3AVMA 1X60A 3NGTA 1GEHA 2UV8A 3ZTOA 4HTLA 2XEXA 2B9YA 6FD1A 1RWKB 2NZ4A 1IG9A 3DOLA 4WCEL 5F9NA 5AQJA 1S6PB 2PFUA 4IDHA 3TQ1A 2GAGC 3CW2C 3FFKB 2BJ8A 3DM2B 4BC2A 5KG5A 4KREA 1YHQN 3OTBA 3DRPB 3VZIA 2V67A 3ZNUA 2APOA 3GV8B 3FEZA 4WQ4C 2ZH9A 1SJQA 2UUAJ 2DRAA 4EBDA 1YJWS 2GQQA 5BRDA 3OFGA 1D9DA 1TK8A 3DYAB 2GVZA 3R27A 3C46A 3THWB 1FRLA 3C3LA 2UXBK 4DR5J 2NSBA 3PYFA 1I94K 4RO0A 3SSRA 1KOOA 4LF7F 1FJEB 3O4NA 4GKJJ 2C2DA 3DOMB 1RBVA 4V19X 4KV8A 1WAJA 2JFKA 3HLUA 3KHHA 1VDHA 4FW1A 3PRBA 1U48A 3RR7A 1AUSL 4CZIA 5HK4A 4BACA 1QVFM 5HN0A 1UA0A 1SAZA 3K9JA 4JAXA 1QTNB 3FZ2A 2MQNA 1G7CB 4CF0A 3MAHA 5L1JA 3JB9k 2KXNB 4QIVA 1RDAA 2ZJPQ 3BZQA 2R8IA 4YDUC 1RNHA 3TX0A 4NCGA 3G87A 4B9NA 1H0HB 2D41A 4YY3J 4MKVA 4M3WA 2VPZB 4OMFG 2NXUA 1FD8A 2ZGZA 4NLQA 1OY8A 4PR6A 2W6LA 2R8GA 2AEJA 4B1WB 3JXUA 1LW0A 3A5MC 4YOVA 4AL5A 5HAOA 4MT1A 3ZEUB 4K5RA 2KH9A 4X2BA 4ILJA 1HYSB 5AQIA 4LFBJ 2OHDA 1IXKA 4A5BA 1JNZB 3L2UA 3PFEA 3K59A 3D2WA 2G1DA 5DG9A 5JJBA 4DCOB 4CYUB 2XNRA 5KQ8A 1XMBA 3W5ZA 2OYQA 3B6BA 4IH7A 1RDCA 3VA3A 4RNNA 3NG8A 1S6PA 2WC9A 3VQSA 4DI6A 2O3DA 1HWJA 2OFHX 3T5LA 4A46A 2HVDA 3DM2A 1XMQK 3T9ZA 1N48A 4H0YB 3RBDA 4E7KA 4GC7A 3DRPA 2MLYA 3WEEB 1QAIA 2VC1A 1ZTWA 5M1PA 1RP5A 1Q8IA 1VQ8S 4CK1A 1RILA 4CLZA 1C1BB 4KYZA 1IR2A 3MMAB 4DN0A 1T9XA 3JAMY 4FZVA 2L3MA 1NKCA 3RMBA 2O8EB 3CMES 2HFSA 3D1QA 2FZCB 3D0HE 3QT5A 4PZVA 3DYAA 3NGUA 1WBDA 4JYAK 3THWA 1HIYA 2WW8A 2CQDA 3JQJA 5CE3A 4ISGA 1SJ3P 1T44A 3AODA 5IC4B 2H5JB 5E0OA 5L9XA 1GX5A 3MM8B 2Q43A 3VAJA 3DOMA 5B0CA 1TTHB 2IBKA 4MMOA 3OXLA 3RB0A 4BGAA 2C28A 3KUHA 2J6TA 3B8AX 2AX0A 3NBPB 3KFWX 4PG4A 4DX5A 1IBLF 4H5TA 1VHIA 4CIGA 1U1MA 1F21A 2O8BB 1F6TA 3KOAA 3B78A 4CJFA 4P7VA 3HBTA 4ZCIA 1DHMA 3AT1B 2AEFA 2JLFA 3MCMA 1O13A 2VJVA 3BSCA 3SIPB 4C8YA 4QBUA 4JEPA 3HL8A 2UU9J 1RSCA 3QDKA 2W42A 1C1AA 3PM9A 4JHDB 3TYTA 5AQGA 4CI0B 4J9KA 1W2BM 3ZEUA 3GBTA 4IWVA 4YN3B 1HYSA 1WSGA 1QTMA 5J2NB 4QR0A 4CO1A 4FWSA 3JSYA 3AB2B 3M5RA 3J7A1 3LUYA 3WIUA 2M4MA 2KI2A 5M2RA 4BR9A 4NE9C 1IBLJ 1EQ0A 4DR4F 2QTWA 1NMDA 3P38A 4LF2A 2AX1A 4CYUA 1GNKA 5KT6A 4CW7B 3W63A 2RB7A 5DDQC 2HOEA 3UN3A 2F4VF 3W9IA 3MR7A 3ZZYA 3CMAN 2EBGA 3DLGB 1RBSA 1EETB 4XTTA 1YSJA 5KAKA 2QTDA 5ETVA 5HMZA 3T9NA 1RCHA 3A3OB 3WEEA 1WUUA 2V0NA 3PW0A 1S57A 4ED8A 1C1BA 4BR7A 1REGX 3CC7S 1FHTA 1SJ4P 5AE2A 3MMAA 2FHMA 3D0IE 1IWAA 2O8EA 3NGKA 3GJQB 3BKUA 3O9TA 1Q79A 3GFHA 3D6FB 3G4SN 3HJVA 3CERA 1SH0A 3EGNA 4DBQA 4O5FA 4MIAA 3VEYA 3L6QA 1RHUB 4LF8K 1LFPA 4ECRA 5CD4A 4C4WA 4B3TJ 5ADXH 3MM8A 2VPYB 1RDUA 5AQKA 1RT5B 4ZMMA 1NMNA 1NGFA 3W65A 1QLNA 5F8JA 4IBNA 4AHVA 1B70B 3KWMA 3IGNA 4Y1DA 2RDDA 3I31A 2BE7D 3V1OA 3RRHA 3MMBB 5AZIB 1QQCA 1MMLA 2AJQA 3A5LC 1YRUA 2DGWA 2O8BA 4RBUA 1X4HA 3EYZA 3P49B 1VQNN 4OL8A 4UOFA 3KUGA 3BYPA 5IT9U 4CFAA 2E9RX 1FRKA 3DNCA 3NGRA 2KLAA 1NDCA 2QWMA 1XQIA 3HKWA 5DG7A 4CLSA 4JHDA 1IJFB 2ZQBA 2JEIA 3K89A 1KAXA 4CHPA 3MMCB 2NNWA 2RU9A 4K8XA 3VWSA 1U2VB 2NCKL 2FSNA 4P2FA 3LDPA 4HACB 1K9MT 2DNRA 5AFUH 3IUCA 5FJ4A 1S22A 4K4TA 3W0LA 4DPYA 4RUCA 5J2NA 1A0OB 4WK1A 4LRDA 2VWKA 2J9EA 4X4VA 3PYEA 5D77A 2BM0A 2HWHA 3I96A 1NGHA 3U7JA 2QWRA 2L48A 4N76A 1IM6A 2LXUA 3OVBA 2D74B 1WC6A 3NF9A 2VONA 5DM6Q 1S72N 1B92A 4CQ1A 3NH0A 3D6HB 3DLGA 3LA0A 1TL4A 1F2GA 4KGXB 1YK9A 3MGJA 4KGVB 1IBKJ 5CCMA 3UCGA 1TAUA 2ZC4A 1N54B 3TAEA 3GG4A 3ZNJ1 2QZ8A 1FVQA 2YKOA 3VF2A 3D7EO 2FVQA 4LBPA 3M8SA 4C6AA 1NGIA 2WOMB 2DTJA 3V6KA 1Y11A 3CYMA 2RDJA 1YGYA 1UVKA 3EEQA 3IAYA 4AHCA 1J27A 4ZIVA 4JI5F 3WXMB 3MM5B 1SCJB 2DXFA 1SQFA 1JLEB 1VQON 3UDVA 2DIUA 5KFMA 3H1VX 3SBTA 2JVOA 2XMWA 4L74A 1N56A 2CH5A 5L9NA 1X9JA 2VFVA 2P9EA 3LDOA 2K8GA 3NF6A 1N34K 5E3QA 4CTAB 1RT5A 2GW8A 3TX8A 2R3VA 3OJSA 1L3TA 2AJ1A 4WFBQ 1U0SA 2LDYA 2LQBA 2ROGA 3NHGA 5ETPA 2P51A 3IMXA 1XMOF 5DGAA 3V4IB 3CTRA 4Z4IA 5J2PB 3FUYA 2DKOB 1RT6B 3MMBA 5AZIA 4OZNA 3RR8A 3OYCA 3MAQA 3OTOF 4A2BA 2UXCK 1NOZA 4O0JA 5KOXA 2IDOA 4WK3A 4OI2A 4NLOA 4DX7A 3ETMA 4DV5K 3TSQA 2XMVA 2VG6B 3IG1B 3QAUA 3FCHA 3DDIA 5CZXA 2RQKA 3HT0A 1RCOB 2ZHAA 4IO9Q 4NYFA 3U3GA 4H4KA 5HMYA 1B99A 3U02A 3ULEB 2E5LK 3MMCA 3L4QA 3QEWA 2YI1A 1U2VA 4HACA 3SUPA 3GV7B 1VQYA 3ELHA 4FCYA 4G1QB 3O9SA 3DFEA 3WNFA 1VQ9N 3SI8A 4JI7F 3PZPA 3BKTA 4HT7A 3CXCM 4C11B 4IFVB 3ILJA 3G96A 4WIQA 2E29A 2YX6A 5KFEA 1J9AA 3O3GA 3QJPA 5SWMA 3LDSA 4A61A 2X1BA 3J81j 1IBMF 3QBWA 2QGFB 3T5KA 3LDQA 1I5OB 3TQEA 4EMDA 1VQ6S 1EKSA 2NRXA 4IOAQ 2YWWA 4DFMA 4DXLA 3QFPA 3EM1A 2P9CA 3WHIA 4F3TA 2E4LA 1SL0A 4Y28C 4HYKA 4W5NA 2G2YA 2ZM6J 2V8VA 3O9RA 3A8JA 4CEBA 1KKHA 3JSMB 5F8NA 3KD5E 2CQGA 4C8ZA 4F4AA 2WOMA 1Y64A 3KNGA 3VQPA 2DNGA 5CYQA 4DV1F 2VQEJ 2OP5A 2DNNA 4QQBA 5JVHL 3MM5A 1DQ9A 4BREA 2BBEA 1YJ9S 2J8AA 3TO8A 4BHQA 5ETSA 1JLEA 1NU4A 5K8MA 3T1HJ 4Q0BB 5KI6A 2HF4A 2UV8G 4WYLA 1M5KC 4KB1A 2B7CB 4JI4J 2A5XA 2RE2A 2B9EA 2IJRA 3J7YP 3CCVS 2PDAA 3TW0A 2LA6A 5SUHA 3Q22A 4Y1CA 3G10A 3VHQA 1BWFO 4CTAA 4BY9C 4Z4HA 3QFHA 2XBPA 2OPSB 2J4RA 2ZH8A 4KBIA 3V4IA 3V4MA 3CFPA 5J2PA 1LWXA 1RT6A 2WVEA 4DU7A 4C8NA 2YH1A 1X9WA 2PO4A 1BLUA 4LF5F 3HM8A 3C7NB 4DV4K 3GFZA 3CT9A 3PACA 4OZJA 2ZH1A 1FRXA 1R8BA 3O3FA 3IRXB 4CESA 1GH8A 1UPMB 4RCHA 4C8KA 2VG6A 3IG1A 3F73A 2HBYB 3BZCA 1FD2A 2HNDB 2KJWA 4TY9A 3V6JA 4DV1J 4ZLJA 5HQLA 2JSXA 5C2FA 1EWRA 4X64K 4FZXC 1RWPB 3SJHA 2EFGA 4LBHA 3D3CJ 5AQWA 5THWA 4KHPK 5ETKA 3O1LA 4FBUA 4NXMJ 2PFDA 1J5EJ 2L9NA 5CAAA 1R6YA 3PJWA 4G1QA 2M8DB 1HPZB 4DV0F 2AKWB 2VICA 4C1NK 4JD2B 1UAXA 2H48B 3QIPB 4FYXB 2DGXA 2MZRA 4C11A 4IFVA 1KQGB 4KBOA 3CCJN 5M2UA 1M5PC 5K14B 3CSKA 4X65J 1XTZA 3GZ7A 4PEOA 2HVIA 1UFLA 1M0SA 4JKHA 2H9ZA 4CZGA 1NCLA 1E4FT 3G6YA 1QQNA 3NP5A 3KHYA 2D4WA 1NJIT 4IR1A 1TU0B 3CDUA 1FJGF 4MKBA 4QOZB 1X1PA 4FVMA 3CO0P 3G86A 4HR2A 2A6MA 1IJEB 1SPBP 2BR0A 4OLBA 3EL2A 3ULDA 4MH8A 4DL2A 3UD3P 1CPZA 3JSMA 2FD2A 2A2DA 2IVYA 2EX3A 2P9SB 2G8KA 1PAEX 4OX7A 5AR0A 3OV7A 2AD9A 2M70A 5GMDA 5FPEA 1OH8A 4K2JA 3V9WA 1CXUA 1DT9A 2Z4PA 4DV0J 3AO3A 4RW8B 2R7XA 1GXUA 2YNIB 4KGMA 1BISA 5FRMA 4CEDA 3L3VA 5HMWA 5C0YA 3SFUA 2QEXS 4OKEA 2RHKA 4Q0BA 2X3GA 4TKTA 4HUEA 4K50A 1Q7LB 4BRCA 3I55S 1C1CB 2D3OR 4R8UB 4TLQA 1UJ5A 2OPSA 1KTVA 4IR9A 1FDDA 3BGUA 2UUCK 4LVOP 4OX9K 3MTJA 3UB5A 3ZZRA 3C7NA 1U24A 3NY0A 3NH1A 1O5JA 3GFXA 3OS0A 3ISND 4ZP7A 2Y3YA 2BJEA 3F0NA 3LAMA 1B0VA 4HVJA 3IRXA 1BQMB 1CJVB 2F7TA 2UXDJ 4DKWA 3ZSYA 2BDPA 2HNDA 4ED2A 4H0XB 2RPIA 5JICA 2GTDA 1D3WA 3ILOA 3SCLE 2E9TA 4GNIA 4CT9A 2QV6A 1Y97A 4FWLA 4JI1K 5KFWA 5DMRA 4ELVA 4CP5A 5F8LA 2AJ4A 4M5HA 4NI2A 2UVUA 4Y3CA 5LXRA 2JVRA 1RE1B 3H5SA 3WC0A 2HKEA 1HPZA 3DU5A 3VAKA 1FWPA 2BE2B 2ZNZA 3R7SB 1TUGB 4JD2A 3QIPA 5J1PA 1GOCA 1QZ6A 1ESVA 3DGVA 3L3CA 1P90A 5K14A 3R7BB 4DUZK 4PABA 4CHYA 2DNPA 4TU8A 4FKYA 4V1Ak 3E66A 2A3ZA 3CJ9A 1TMMA 3GSDA 2CPHA 1NMEB 4A8MP 2NRTA 1V3ZA 2LP4A 1BMQB 4CEOA 5KPZA 5F8MA 3CCSS 2R7YA 1U2FA 4OX6A 2EVZA 4J9UE 3EICA 1IKXB 3OYIA 5MAOA 3K5NA 1RHKB 2VA3A 4ERDA 4G9ZA 4OLAA 3OR1B 1I3OB 4TVAB 1VGYA 3JAMU 3Q86A 1RAAB 2ZFHA 5EOYA 3DXKB 4TSXA 4JI8F 3BGFA 3H5XA 2P9SA 2ZWHA 3N6MA 2ZF5O 2FLPA 3I56N 5E3RA 2EI5A 2VGNA 1ZBLA 2HNZB 1DLOB 3TAMB 1NH7A 3EXYA 2J9CA 4PKIA 3ATVA 4RW8A 3MPVA 1JLBB 2YNIA 3SCJE 3G8TA 3HPOA 4U96A 4B3RJ 1VAZA 3OYDA 1BWEA 2PT0A 1B9FA 1NO8A 4ATNA 4R0JA 4O3NA 4BE0A 4NLSA 4V19S 4Y2MA 1VR6A 2O67A 3TU5A 1C1CA 2JGUA 4I2QB 2E7VA 4EEYA 4R8UA 2C2KB 4B1VA 1WN7A 2P9NB 1U1QA 1S99A 1JXLA 2VPWB 2O4GA 2CQ4A 4YB7A 3CPWR 5LJWA 4BE2A 4OZ5A 4IDKB 5AQYA 4C9DA 3WQTA 2LA4A 3AOBA 3A8KA 1NPKA 4M5LA 4JI3J 2RN2A 4YHHK 4DTUA 3JTNA 2V2KA 2Z58B 2XO6A 1B0TA 4TQRA 2J5AA 1BQMA 1CJVA 2AF6A 4DV2F 1H3DA 4BS2A 2HGNA 5IT4A 4ECXA 5AQFA 3OHBA 3EN9A 5F9LA 1FO1A 3MR3A 4DR6K 5GAGP 4ED4A 1ZM4A 1UWBB 5LSLA 1A5WA 4WIIA 3ENBA 4OX8A 4QIGA 2CUYA 4I69A 1Q82T 4K4ZA 3OA9A 3K2YA 2UUWA 2FSJA 3NF8A 2QMWA 2IM0A 2BE2A 1TR0A 1TL5A 1X4EA 3OT9A 2CJKA 1Q16B 3RTVA 2WK4A 3ZSWA 1M1GA 3MCOA 4NASA 2QWLA 4URSA 1LWCB 1SI9A 2BA9A 3A12A 3QGPA 4NLPA 2DH9A 3T7ZA 3ULHA 2F96A 1P9YA 2XMKA 3WNHA 3BN4A 1IKXA 3VESA 1QVGR 2OUGA 5KFGA 2F65A 3OR1A 3MK6A 5LMNK 3O6WA 4G1PA 3ZZUA 2PMWA 3A1YG 3N01A 3WXJA 1V4SA 4O4RA 1RBRA 4B8AB 5T14A 3DXKA 2XQCA 2QC3A 1FW6A 1HNZK 4OHWA 2HNZA 1DLOA 2VFTA 3RMCA 4X62K 1K73O 3DAWA 3T1AA 5EX3A 3ZCMA 2GX9A 1Q8KA 4DMZA 4DPOA 4AILC 1WG1A 4FJ5A 1JLBA 2ZOFA 2DH8A 1DARA 2AYGA 3AY0A 4YOWA 1KTQA 1U1KA 4IRDA 1T03B 1YHQS 3U4LA 2IJFA 1HJRA 2E2PA 5M1NA 3MD3A 3IM9A 1BG3A 3L9ZA 3QEIA 3KJVB 2HIQA 2A1RA 1ZPWX 3B4DA 1MA9B 5DDOC 1T9VA 3GJSB 4I2QA 3BN7A 2HZCA 4ALZA 2YHWA 4LUBA 2CPDA 2CQ3A 2CG4A 2V4QA 4A47A 3CFOA 2K06A 3F5TA 1XNRF 4IDKA 3Q8VA 3M4XA 2E5GA 3ZT3A 4NLUA 3LOUA 1C4AA 1YJNS 5E5NA 4CHZA 1U49A 1Z6RA 2NRRA 4JKEA 2XYGB 4JK8A 3JXOA 1S4EA 3D68A 4Q2MA 1B7YB 4WKYA 5JMNA 2N4CA 4U6PA 3UIQA 3H0PA 1DRZA 2WZ1A 2C3OA 4RKUC 4C3LA 1SKSA 5DS7A 1WD6A 4OHYA 5J2MB 4Y0FA 4ITSA 2XSFA 4I9QA 3EZUA 3SXLA 4DS5A 3VGUA 3GILA 1GOAA 1NZAA 2IVMA 1UWBA 4O5BA 3CIMA 3ENQA 3PKYA 2HRUA 4NXNF 2VWBA 1Y9OA 1CS4B 2UXBJ 3M2UB 4AXJA 1YVUA 1I94J 4B3MK 4YDXA 3EKUA 1P6TA 2Z1JA 5HJXA 2XY7A 3CEDA 4M41A 4ZLNA 3BDEA 2DISA 4X66F 3P5JA 2KM8B 1HI8A 4OYMA 4L3QA 1T7PA 4IJAA 1LV5A 1PKUA 1LWCA 2HBKA 1LCUA 3K0SA 2DHGA 4M8LA 1KSPA 2KXFA 2CVEA 2Z30B 1XNQF 4YMEA 3ZZZA 1N32K 2R8JA 1QZ5A 4NZ0A 1WSIA 3KDOA 3TOQA 3I0SB 1JIHA 1KQKA 1Y0HA 4I64A 5KFCA 3MF5A 3O08A 3FJ2A 3G0ZA 4CGHA 1H72C 4CJKA 2Q97A 1AUDA 3O9QA 5EU7A 4LQ9A 4PXEA 1QD1A 5EWFA 2B5JB 4JI0K 2XS7A 1NBWA 1HYZA 1RBAA 2YKPA 1EZZB 2RIJA 2Z57B 3OBIA 1AW0A 3KKFA 1NB2A 3TI0A 4DQPA 5I3PA 4BRHA 2IGIA 1O1WA 1GXLA 1T03A 2YPYA 4HKQA 1SQEA 2E7XA 2JJ4D 3KJVA 3IRWP 3BO3A 4A8FA 1FFGB 3RZAA 2ABYA 2QMUB 2CZ4A 2WHOA 3PNIA 1FVSA 2F63A 2XMMA 4C1NI 5GADP 1HARA 2KFYA 2OSQA 1EP4B 2W2QP 2Q0RA 3K2PA 3ICLA 1ITGA 1WBBA 5D8HB 1FWLA 2OEMA 4L75A 4X4RA 1NEEA 1Y3JA 1XMQJ 4ILGB 2WAQD 5AE3A 4TQSA 2EC2A 4DR1K 2DGQA 2XHBA 1R27B 2NQPA 4ISEA 4AQYF 3MM6B 4W5TA 3RAXA 3MURP 3DXMB 1JCFA 3ZX2A 4B1ZA 2ROPA 4WQ5C 2YX1A 5J2MA 4ZTFA 3PIPQ 5DRKA 4RLEA 2XWYA 4IRCA 3OTDA 3MN7A 2XZWA 2XULA 1S0MA 2UUBK 1LAVA 2K7JA 4PCQA 1XIQA 3MFHA 5AQTA 5LMUF 1PG5B 4AL6A 1HNXF 4DPWA 3VEXA 1CS4A 3M2UA 4DUTA 1NNDA 3AAPA 1YJTA 3MM9B 1Q9XA 2Y1IA 3I9ZA 4QPXA 1YRXA 4CZFA 1U02A 2HVEA 1Z1ZA 3KJQB 4FS2A 1S12A 2NLWA 2YWFA 1X9MA 3CJRA 3A8IA 4WFYA 3VQ6A 3AVHA 3QERA 2D3ZA 3J8AA 1TFYA 5KG3A 4E7LA 3KHLA 3AXKA 3IAM9 2W2MP 2IJNA 1JB0C 2XLJA 2Z2MA 3AOAA 2Z2YB 2EBEA 3I0SA 3S01A 1ZBFA 2QI2A 2DGOA 3EGVA 4DQQA 1RT3B 4XIUA 2E66A 2LQ8A 4DTMA 2CPEA 2BVZA 5DQHA 3D45A 4WF9L 4B3SK 3V1QA 3I82A 5D4NA 2XLKA 3M6VA 4LR9A 3A13A 4CEFA 4IEIA 1WC5A 2B5JA 1I6JA 3HD1A 1Z2LA 2VYPA 3OYJA 2QXLA 2QKKA 2VPXB 3CMAS 1U6ZA 3DHWC 3MMVA 3MZIA 2E1RA 5CD4H 1C0TB 3NOGA 4GKJK 1XC3A 2R4FA 4Q43A 1HKGA 1C0FA 3RMAA 3D6TB 5C25A 4JKBA 4BROA 2JDJA 4FKXA 4DF8A 2ZBPA 2MLXA 3LANA 3UWTA 5LJVA 1VHFA 2QT7A 3HRGA 1SH3A 4F9OA 2CQPA