4RW7A

Crystal structure of hiv-1 reverse transcriptase (k103n, y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
554
structure length
538
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 138
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw7A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw7A05
5J2PB 3KK1A 4KTWA 3M8SA 1XR7A 4IR1A 4QOZB 4EZ6A 4KI4A 5JUMA 3TABA 2KZZA 2R2UA 4FLWA 4JLHA 1B9FA 3H4DA 4IFVA 3PX4A 4B9UA 1NK4A 5E41A 4CERA 3JYTB 4IRCA 4N56A 2W9CA 4TSXA 3ALYA 3KK3A 4J2BA 1HMVB 4CHPA 4I7FB 1WSEA 3T5KA 1LWCB 3HPHA 2YHAA 5I42B 5J2NB 1IH7A 2HVIA 1RT5B 2HB5A 5EDWA 3PVXA 3I0SA 3FFIA 3S3NA 4RUCA 2ETJA 4BE2A 3O4QA 3OYEA 1WN7A 2F8TA 4FJNA 2E6MA 1TKTA 3IRXB 4IG0B 3AVNA 3KMQA 4CJ4A 3DRSB 4ED0A 1ASUA 4FLYA 1VSJA 4WE1B 3ITHA 5KFKA 3AVJA 1RA6A 1S49A 4IOBA 3G6YA 1JLBB 3QEIA 4KREA 4KB0A 4FZZA 3U3GA 3KTQA 4E0DA 4K4UA 3NGYA 1DTTB 4CGJA 4TLRA 3OHAA 3KLHB 1CLQA 3T3FA 1IKVA 4N5SA 4PWDB 3O3FA 4JS5A 2FVCA 1GX5A 2IC3B 3VQ8A 4E7IA 4KV8A 4DTOA 4CECA 1U4BA 1O1WA 2XRIA 3MECB 3OYAA 1HRHA 1T05B 4QWBA 1HNIA 3QEVA 4QWDA 2YNHB 3V4IB 1XR6A 4ED3A 4GC7A 3LP2B 4O5BA 5HROB 1VK0A 2FVPA 4M3RA 2I5JB 3HL8A 2E9RX 3H5YA 2XY8A 4I2QA 4ELVA 3F9KA 2ZKUA 2IDOA 3NAHA 3PW2A 3KOAA 2D5RA 1L5UA 4ED6A 3CVKA 3HP6A 2OH2A 4IRDA 3T5JA 1S97A 4LH5A 5DG8A 1G15A 1IKYB 4DTJA 5KRSA 2XY5A 3OS0A 1KCFA 2BQRA 1JX4A 1TV6A 4F2SA 1JLEA 1S1UA 5C24A 2ITGA 4DQQA 4HYKA 4XPCA 4FLZA 3TR8A 5FROA 1TL3B 4ID5B 1VSHA 3PUFA 5EWFA 1LAWA 3WNFA 3C94A 2ATLA 4OPKA 1LAVA 3K58A 3UQSA 1B92A 1I6JA 2R2RA 4CGDA 3EY1A 3BGRB 3NF7A 4C8KA 4N41A 3NAIA 1KVAA 4NYFA 3IGVA 3KJVA 1RT4B 4IH6A 2A1RA 1TKTB 4CIFA 3QEPA 4DTUA 4QWAA 3HK2A 1HQEB 2IJNA 1JLGB 4HKQA 5KFIA 3ITHB 4EYIB 4WFZA 4YNQA 3BJYA 3TARA 3HVRA 3RB6A 2OPQA 3WNHA 3CFRA 5KFTA 2VG5B 1DLOB 1I39A 1S9EA 2RPIA 5CY4A 4CF9A 1NK0A 1RT3A 3KK2A 3MEGB 4OJRA 4K4ZA 2Z1GA 2O4IA 4ZHRA 4FLVA 2YNFA 1C1BB 1BI4B 3H08A 4Q44A 4KV8B 2RF2A 5CZ1A 4J2DA 4RG8A 3VA3A 4O3PA 1S1WA 4FJGA 3M9MB 3M9NB 2Y1IA 1ASWA 3NF9A 3DLHA 3IAYA 4FCYA 4FJ8A 3KNAA 2XI3A 4J9SA 3CJ3A 4MH8A 2E4LA 4KO0A 4CEEA 1T94A 2O4GA 1RT7A 2ZE2A 2HNDB 4Q0BB 4ED2A 4CJUA 2HHUA 3HVTB 4OLAA 5KFHA 5KFOA 1X9WA 3BSCA 3LP0A 5FDLA 5KT2A 3RTVA 3TAEA 1Q9XA 1S1TA 3RWUA 5FRMA 2RDIA 1EETA 1Q8IA 1T7PA 1S1UB 5C24B 3T5LA 3QIOA 4CEBA 4CFCA 1K1SA 1JLCB 3SQ0A 2BE2A 4YQWA 4WYWA 4DSEA 3KMSA 3TVKA 5DQGA 1VSLA 3JSMA 4CK2A 3LAMA 4IBNA 3L2QA 2AJQA 3VQDA 4FLTA 3E01A 1HNVA 1LW2A 2NUBA 3H59A 5I3UB 2XWYA 2V4RA 1QHTA 4DTNA 2DFFA 2WONA 3DLKB 1EKEA 3HHKA 3PW5A 4B8CA 4LSNA 1T03A 4Y1DA 4F4YA 4ICLA 4RW6A 3IG1B 3HO1A 3I5AA 4EZ9A 1NK6A 1HARA 5DMRA 4ZTFA 3TI0A 4DU4A 4U6PA 4J2EA 1RT1B 5KG7A 1UOCA 3H5SA 1S6PB 1NJWA 1S10A 1RAJA 2W8LA 3TQ1A 4ZVHA 2RN2A 4CK3A 2YNFB 3I5CA 2O5DA 2AGQA 3BREA 2HWHA 5J2MA 1KVCA 3C6UA 1J5OB 2AGPA 5F8LA 3UPFA 2J6TA 4QAGA 1YT3A 4B9MA 1QQCA 1NJYA 3P5JA 2CKWA 3SUNA 4ZP9A 3T5HA 4MFBA 3QGIA 2DY4A 4B9TA 2OPSA 4NYZA 1N48A 2XO7A 3U3YA 1C0MA 4O4GB 1ZBLA 4ED7A 4CJRA 3MR5A 3DMJB 4TYAA 2G8VA 4UQGA 4LSLB 2ZE2B 2XC9A 4WZMA 4O3QA 2IS3A 3DRRA 1T3NA 4KHQA 3DYAB 4EP5A 3RMAA 3HP9A 3GIMA 4O0JA 3H40A 4G3IA 2KW4A 4TYBA 5KFMA 1BHLA 2R8KA 2BANA 2EHGA 1YTUA 4I2PB 4LY7A 3CIZA 5KFVA 1XI1A 4K50A 1JLAA 1ITGA 2BE2B 1S1XB 1YTAA 4KSEB 5K14A 1K6YA 5C42A 4RNFA 5KG2A 5J2PA 4H54A 4EO8A 2VG6B 3OLBA 2VWJA 1HPZB 2W7OA 1VRTB 4MK8A 2DTUA 3G6XA 1I3AA 1S1VA 2UUTA 3KLEB 3OYDA 4EBEA 1JIHA 2AU0A 5EU7A 4OLBA 1WLJA 1TP7A 1C2PA 2R2SA 3PV8A 3JYTA 5HP1B 4O3RA 2IMWP 4CHZA 2R8JA 2QXFA 4J9KA 4ECRA 1S9FA 4OGCA 4CJTA 1KHWA 2JEIA 4FJKA 3MR6A 5KFZA 4I7FA 1LWCA 3L2RA 4FYDA 1WSFA 3ASMA 3NAEA 4KHSA 3K59A 2CJQA 4X2BA 5I42A 5J2NA 1RT5A 3SI6A 3V9UA 4M3UA 2GV9A 1NK8A 4NLGA 4MKAA 4ZP6A 4IG0A 4FXDA 2HAIA 3EZ5A 3DRSA 5DK5A 1WAJA 2OPPB 3KHHA 4EBCA 4WE1A 1B9DA 1W9HA 1ZTWA 3K5LA 1VSKA 3LPTA 4JRQA 3QIDA 3ZCMA 4E7KA 1JLBA 4W5OA 3NHGA 1JXEA 1DTTA 3QERA 3KLHA 1LWEA 3EZUA 4PWDA 4H8KA 2WTFA 4Q8FA 1RNHA 2IC3A 2UUWA 4CJKA 1K1QA 4JV1A 1TKXB 4FVMA 1CZ9A 2HW3A 2G8WA 3MECA 2DPJA 3SPYA 1T05A 4JUZA 4CHYA 2P5OA 2YNHA 2AQ4A 4XO0A 3N6LA 5CYQA 3OL6A 2XCPA 4LQ3A 2LSNA 3LP2A 5HROA 4RUAA 3OLAA 3ZSZA 2QE5A 3QZ7A 5HRSA 3CFPA 2I5JA 2WOMB 1RBSA 5F8HA 3CQ8A 3UIQA 1KTQA 4Z4CA 3ZSOA 5F8MA 3V6HA 4FJ7A 1S48A 3ZSQA 1S1VB 4E7HA 1LV5A 1QSYA 3HPGA 3P83D 4NZ0A 5C25B 1IO2A 3QO9B 2V4QA 3RRHA 4JRPA 1ZBHA 4CJLA 1RTIB 1IKYA 4F3OA 5J1EB 4FW2A 1KVBA 3MEDB 2I1RA 1S5JA 2X78A 2Q3SA 4EO6A 1SH2A 4QPXA 4F50A 5KFUA 1S6QB 2YHBA 1W0HA 3QNNA 5KT7A 1JLFB 3AVGA 1TL3A 2FVQA 1WSIA 4DFMA 4URSA 4ID5A 4DL3A 2D41A 5KT5A 4G1QB 4E1NA 3FRZA 3TAMA 1VSFA 4CE9A 5KT6A 3AA4A 3BGRA 2P1JA 4DL4A 3EYZA 4OKEA 4WFYA 4NLTA 1RT4A 5F9NA 5SWMA 4BDYA 4IKAA 5KGXA 4BDZA 3CO9A 1TVRB 1HQEA 1JLGA 3GV5B 3KLIB 1WSGA 4GMJB 3P1GA 2ILYA 4J9RA 2Z1JA 2X6NA 3KHRA 2UVVA 4HTUA 4GC6A 3OHBA 1CZBA 1U47A 2VG5A 1DLOA 5KFEA 3OJUA 3HYFA 1RDBA 3MEGA 4K4VA 5KFWA 2QKKA 3OL9A 1LWEB 3UDLA 1NHVA 4Q43A 1C1BA 1BI4A 4M3YA 4C8MA 2HHTA 1QTMA 1KLMB 4DSKA 1IM4A 4O3OA 1VSEA 4Z0UA 4ZVFA 4DQIA 3ISND 3L8BA 3DRPB 5L9XA 3NGIA 3HPOA 3OVNA 5CYQB 3K5NA 3BDPA 3GIJA 3OY9A 4KHRA 3D28A 3ICLA 4BACA 4J9NA 4R0EA 1IKWB 5HBMA 2QV6A 3IGNA 1LW0B 4F4ZA 4URGA 1TK5A 3HXMA 4WFXA 1YVFA 4KRFA 2HHSA 5HRNA 4DLGA 2HNDA 1TAUA 4Q45A 4Q0BA 4HUGA 1U49A 4DTMA 2E9ZA 3HVTA 1BQNB 3NMAA 4LD0A 4NLQA 4DU1A 3IS9B 1FK9B 5KTQA 4CHOA 4CGGA 2B5JB 4QWCA 4MK9A 3RB4A 1Z25A 1A5VA 3D45A 4NLRA 2W42A 2R2TA 3HKWA 3M8RA 1Y97A 1S0NA 4ZP7A 5FRNA 4CJ3A 3AVHA 3C6TB 1JLCA 4O55A 5HLFB 3CJ0A 3PJXA 4KAZA 1C1AA 4FK0A 4TXSA 4AHUA 4CFAA 5J2QB 3Q8QB 4QW8A 3TAMB 4ECUA 3AO1A 3SZ2A 3DI6B 1RCHA 3PY8A 1R0AB 4NLYA 4KAIA 4I9LA 1RT2B 5I3UA 3GV8B 1UAXA 2PYLA 2RDJA 4KHUA 1U48A 4M94A 1QAJA 5CZ2A 3DLKA 4IH7A 2C2RA 1ZBIA 4IH5A 3VQPA 3L3VA 4RW8B 3VQEA 4CEFA 4EP4A 1RBRA 4M42A 1REVB 3IG1A 4TY9A 3LAKA 4YR0A 1C0TB 2IAJB 1NK7A 2PZSA 4R5PA 3FSIA 3KD5E 1RT1A 2WCXA 2ALZA 1QE1B 4FM0A 1S6PA 4U7CA 4ECXA 4PUOB 5KFBA 2D3UA 2EX3A 4OKJA 3DLEB 3L2WA 1TL1A 4C8OA 4DF8A 2WK4A 1W25A 2JC1A 1LWFB 1J5OA 3D0PA 2XHBA 3SPZA 1D9FA 2D3ZA 3RMBA 3NBPA 3CDUA 1KHVA 3SI8A 1BGXT 3DOKB 4IFYB 1RDCA 3QLHB 3KLFB 3BSNA 4NLWA 3MAQA 1ZTTA 2GC8A 4DL7A 2G8HA 5HBMB 3I0RB 4OPJA 3V81A 4O4GA 1JKHB 1JXLA 3FQLA 4O0IA 3OYGA 4B08A 3MXMA 3DMJA 1XR5A 3V6DB 4LSLA 5KG0A 3ZT0A 1JL1A 4TN2A 3TAQA 3DYAA 1TGOA 4FJIA 1JLQA 1RTJB 3AO3A 4MQ3A 1Q9YA 3KKSA 4JV2A 1RT6B 4IKFA 3E51A 3LZIA 2ASDA 1SUQB 4I2PA 4FJHA 1NOYA 4NLPA 1S1XA 3AVAA 2G8IA 2JC0A 1U04A 4DMNA 4R8UB 1EX4A 5EWEA 4YR3A 1VRUA 2VA2A 4NLOA 2VG6A 2BRKA 1WAFA 1HPZA 1VRTA 3ULDA 1KLNA 3VQ7A 3KLEA 3PR5B 3QGGA 4DF4A 3V1OA 3CDWA 3ZSVA 3OSPA 4NLVA 4YP3A 4I9QA 4CJFA 2IOCA 1FXXA 1RTHB 4NRTA 4RU9A 4N76A 5HP1A 1RTDB 2G8FA 5KFCA 1NKBA 1SH3A 4FZYA 1YVUA 1UA1A 2FLNA 1IG9A 3RRGA 2OPRB 4ZPDA 1FKOA 4XPEA 4E3SA 4B9SA 2YKMB 4R5PB 2GBZA 3T1AA 2B43A 5KFGA 3GYNA 3SFUA 1JXBA 2VG7B 4F2RA 3KLGB 3M8QB 3DLRA 4ECZA 4FK4A 3AVFA 2YV0X 1TL1B 3QEXA 1MMLA 3LWMA 2C22A 4NLSA 1DTQA 2OPPA 2D0AA 4K8XA 1TKDA 3NKYA 3NBPB 1RA7A 4NCAA 3V6KA 4RW7A 3MFIA 3UR0A 4K8ZA 4Z4FA 2YKNB 3SQ1A 2YNGA 3HM9A 3SV3A 3RMCA 1C0UB 4KE5A 3OYKA 3EPIA 3V81B 2ZD1B 2A1SA 4DFKA 4KTZA 3SUPA 1KRPA 2E6LA 4RW4B 1VSMA 4N47A 2VA3A 3VQSA 5T7BA 2G8KA 3K2PA 4Z4HA 1TKZB 3RB3A 3PZPA 1IKXB 3VQCA 4AHCA 4IG3B 1TKXA 4ZMMA 4J9QA 5KFYA 1JLQB 1SL0A 3QZ8A 5D3GA 3VQ5A 3AV9A 4J9PA 1HQUA 2PYJA 2Y1JA 4IDKB 4DU3A 3PJWA 2AX0A 1X9MA 3NCIA 4DTXA 2WOMA 1NKCA 4IR9A 4E7JA 4CEQA 4B9VA 1VRUB 4FJLA 4CEDA 1XHXA 2P5GA 4CHNA 4URQU 2IGIA 3DLGB 1L3SA 1RBTA 2DFEA 4NCGB 2UVUA 5C25A 3QGHA 4AHTA 2F8SA 3QO9A 4H4MB 3C95A 2HNZB 3ZT2A 1RTIA 3BQ0A 5F8NA 5J1EA 2KFZA 3MEDA 5KT4A 1L3TA 4Y1CA 2FJWA 2IJFA 2UVWA 4CGIA 5KFPA 2JEGA 3CM5A 4HHTA 4ZTJA 4CIGA 1S6QA 4FJ9A 2AGOA 3M9OB 1FKOB 4NLXA 4CF0A 4FK2A 1JLFA 4RNNA 3TAPA 2WHOA 2P51A 4RZRA 5F8JA 4Z4IA 4G1QA 3RBEA 3H5XA 4DQPA 4W5QA 3OL7A 4XIUA 3LP3A 1HYSB 4ECQA 1J54A 4DQRA 1TAQA 2F8EX 1NK5A 2XCAA 4RW9B 4B3OB 1VSDA 4OKKA 3DM2B 4K4SA 3HJFA 1TVRA 3SUOA 4BDPA 1NKEA 1DTQB 3RAQA 4KI6A 4E7LA 3KLIA 3OYHA 4DQSA 2EC0A 5L1LA 3HT3A 4RW7B 3AVIA 3QIPB 3VA0A 4DSIA 3AO4A 2Z1HA 3PX0A 4M45A 4FJJA 2GUIA 2YNGB 4EBDA 4CHQA 5KFNA 3HVAA 3OYMA 1HYZA 2FBVA 2RKIB 2JLEA 2B6AB 2W9BB 1TQLA 1KLMA 3AO2A 4HUFA 4FM2A 3TAGA 2BGGA 3VQQA 4PQUB 4M3ZA 5D3GB 2YNIB 3MF5A 4KBIA 4Q8EA 3NF6A 2FBTA 4ECSA 4CEOA 3DRPA 4DSLA 5KFFA 1SV5B 4MIBA 3S3OA 1HQUB 3BQ1A 4FS2A 2C2DA 4M3TA 1UA0A 4FM1A 1IKWA 1LW0A 3CJ4A 4M3XA 5L1IA 1L3VA 3V6JA 4ECTA 4KHNA 3HSTB 1MU2A 2IM3A 4FLXA 3SFGA 2HHWA 4W5RA 4J9OA 5KFLA 5DG7A 1ZBFA 1ZBUA 4ELTA 3ZSRA 4DTSA 4M3WA 1BQNA 3IS9A 1FK9A 3VQBA 4KKOB 4ZP8A 3LP1B 1EXQA 2B5JA 3VQ4A 1EP4B 5KFDA 1N6QB 1SL2A 4L8RB 4KFBB 5F8GA 4Y2AA 3OYLA 3MR2A 3GV7B 3QESA 3CYMA 3HVWA 3C6TA 4CFDA 5DGBA 1VSIA 5HLFA 4CCHA 1U45A 5DLFA 4Q5VA 4ZVEA 5L1JA 3M8PB 1QUVA 3THVA 5J2QA 4RNMA 4Z4EA 2BQUA 3GQCA 4CK1A 3DI6A 2Z1IA 2JEJA 1R0AA 1N5YB 2ASLA 1NK9A 1RT2A 4CJWA 3L2VA 4FJ5A 4LH4A 2B4JA 1FKPB 4FLUA 3ZSWA 4O44B 2ASJA 3VQ6A 1BCOA 2FBYA 4TY8B 4RW8A 1RILA 1REVA 2AWZA 2WRMA 4O3NA 1SKWA 4KB1A 1C0TA 2IAJA 4DEZA 3OJSA 3MEEB 3U6FA 1D5AA 2F96A 3OSNA 4CF1A 4NCBA 2OZMA 5F8IA 1SL1A 2HMIA 1QE1A 4CGHA 2IBKA 2FJXA 3F73A 2J6SA 3DOLB 4Y34A 4PUOA 5KFQA 4C8NA 4CF8A 3DLEA 4ZPAA 1RYRA 4E19A 5KG6A 2FLPA 1LWFA 1D1UA 4Y3CA 3SV4A 1BL3A 4ID1A 2JEFA 1QSLA 1SKSA 5DLGA 3DOKA 4IFYA 2ATQA 5EWGA 2IM2A 1GOBA 3FDSA 3V9XA 1JL2A 2KZMA 3QLHA 3KLFA 3DDKA 3PO4A 3PW4A 3I0RA 4FW1A 2FJVA 3SUQA 1JKHA 4EYHB 3MR3A 5KT3A 1S0MA 3I5BA 3AVMA 1MU2B 4F4KA 3V6DA 4OL8A 4FJMA 4DG1B 4MIAA 4PY5A 1TK0A 5KGWA 3K5MA 1U09A 1F21A 2HNYA 1TK8A 1RTJA 3G6VA 3H5UA 5CYMB 1RT6A 1SUQA 5KFRA 1C1CB 3EPGA 4FZXC 4WXWA 1N56A 1BIZA 3KK1B 1S9GA 2R7YA 4F4WA 4HCCA 2IA6A 2FVRA 4H4OA 5DQHA 1WNEA 3L2UA 3T19A 4R8UA 4IFVB 5C5JA 4O4RA 2OYQA 4GW6A 1A5WA 3PHEA 2HWIA 1SKRA 2W9CB 3PW0A 1NJXA 1RYSA 3KK3B 3FQKA 1RDDA 3ZSXA 5KFXA 4CJSA 1NJZA 4E1MA 3TWHA 2C2EA 2XGQA 1S0OA 1RTHA 2DFHA 1RTDA 3AA2A 1L3UA 1CXUA 2OPRA 3OL8A 2VWKA 3RAXA 3I0SB 3FFIB 2YKMA 1RBUA 3G0ZA 3NF8A 4O3SA 3OYJA 4HUEA 2HMIB 3CWJA 3QYYA 3AVCA 3KHGA 2VG7A 1HJRA 2KFNA 5KG5A 4YFUA 3KLGA 3M8QA 3Q8SB 2R8HA 4IRKA 1Z26A 2ZQBA 2IM1A 3RR8A 4FJXA 4B8AB 1A5XA 1GOAA 3WNGA 4K4YA 1RBVA 4ZPCA 4DL5A 1N4LA 3LANA 1NHUA 1IKVB 1SH0A 2OZSA 3KLVA 3KKRA 1GOCA 3QNOA 3AA5X 3OYFA 2YKNA 3O3HA 1OS5A 4J2AA 4E89A 1X1PA 3PX6A 1XC9A 5F9LA 1C0UA 3CM6A 2ZD1A 3V1RA 4RW4A 3N6MA 2DPIA 1HNIB 1TKZA 3ZT4A 3NH2A 1IKXA 1S4FA 3OS1A 1WSJA 2X6SA 4IG3A 3WNEA 4DTRA 5JS2A 2HNYB 1RDRA 1J53A 3SQ2A 1BQMA 2HVHA 2GIRA 2E9TA 4B9NA 5KG4A 2FBXA 3NFAA 1D8YA 4I2QB 1T8EA 4OVLA 1S9GB 2PY5A 4C8LA 3MXJA 4IDKA 5JS1A 3LWLA 3SNNA 4H4OB 4EEYA 3S3MA 5T14A 3H2LA 3K57A 2IM0A 4ECWA 4DSFA 3SQ4A 2GIQA 3DLGA 4NYNA 3LPUA 4NCGA 4GVMA 1TV6B 3RR7A 4HVJA 1JLEB 3LALA 4DSJA 4H4MA 3V9WA 2KQ2A 4RNHA 4KB7A 2HNZA 3SCXA 2WB4A 1XWLA 4NLUA 5DGAA 3PO5A 4AH9A 1QSSA 3V1QA 4WXOA 4CGFA 3KJVB 1J9AA 4AHSA 2HHXA 3KIOA 3K5OA 1HYSA 4CJQA 4BWJA 4CJ5A 4FBUA 4CF2A 2JGUA 3L3UA 3OYCA 3QEWA 2R8IA 4RW9A 4B3OA 4WYLA 3DM2A 3H98A 3IN5A 3G10A 3GIKA 4CJPA 2OPQB 4KHYA 4QCLA 4JS4A 4FBTA 1S9EB 4ELUA 4Z4GA 3Q8PB 1RT3B 3KK2B 4DLEA 3OYNA 3G86A 4TQSA 4ZHRB 2X74A 3QIPA 1KFSA 4F8RA 2QKBA 2XY6A 2D7SA 4JV0A 4ZVGA 2AX1A 3KHLA 2RF2B 3V9ZA 3H4BA 2OA8A 1S1WB 3CDEA 5KFAA 4BE0A 1XHZA 4DWIA 3KD1E 3PW7A 4KHWA 2RKIA 3O3GA 3ZSYA 2B6AA 2W9BA 2BR0A 4ED1A 4NRUA 3B6PA 3OYIA 4HCBA 4WZQA 1X9SA 3GILA 3RB0A 3NL0A 4DS5A 1BQMB 4PQUA 2YNIA 1GX6A 3LDSA 4IQXA 4K4WA 1CXQA 2R8GA 4CEAA 4KO0B 1SV5A 1RT7B 3ZT1A 3O4NA 1ZYQA 2HHVA 4MK7A 4F3TA 4MKBA 5KFSA 4YR2A 2KTQA 4CESA 4B9LA 3SJJA 3MTKA 4M95A 3VQAA 3LP0B 4ECYA 1UWBA 3AVBA 5FDLB 1S1TB 3N6NA 3BR9A 3RBDA 4K4TA 4KPYA 1D9DA 1EETB 1HYVA 3NE6A 5L1KA 4CJVA 4KKOA 2XI2A 5KG1A 1ZETA 5HRRA 1QS4A 3LP1A 5JXSA 1EP4A 1RDAA 3VQ9A 1N6QA 4KFBA 2HHQA 3S9HA 3NGZA 3JSMB 4YMEA 3LZJA 4BWMA 5EUHA 3E01B 1HNVB 1LW2B 4CIEA 2FLLA 3OYBA 2W7PA 3M8PA 2BQ3A 2G8UA 2WONB 1KFDA 4DL2A 4AILC 3QETA 4LSNB 2D0CA 4AHVA 1N5YA 1T03B 3QINA 3MXIA 1HMVA 4ICLB 2V9WA 3MFHA 4RW6B 4K4XA 1NOZA 4KTQA 1FKPA 1WNSA 4O44A 3I8DA 4F4XA 5KFJA 4QWEA 3GIIA 3PR4A 4TY8A 3BQ2A 3NGDA 1Z4UA 3Q8RB 2W9AA 4TQRA 3TAFA 1NNDA 2FC0A 5DG9A 1BCMA 3MEEA 1BISA 4DTPA 3OS2A 4W5TA 2W8KA 4KHMA 3B6OA 3IRXA 3DLBA 2UVRA 2D0BA 5J2MB 3CJ2A 3NH0A 3NDKA 3V9SA 3C6UB 5KG3A 3DOLA 1D0EA 4NLDA 3AA3A 3AVKA 2QK9A 3BSOA 4QW9A 4M41A 4MFBB 2V0NA 2OPSB 3VN5A 4W5NA 4DFJA 4LQ9A 4PA1A 5KI6A 3AO5A 1C6VA 4DL6A 3ZT3A 4ZPBA 4ECVA 2BDPA 4Y2CA 1ASVA 3D5MA 3CFOA 5DQIA 2XGPA 3ISNC 4J9MA 3DRRB 3TANA 4DS4A 3A2FA 4FS1A 4DFPA 1CSJA 4RNOA 3NH1A 5SZTA 4ED8A 5KRTA 3CG7A 4CFBA 1UWBB 4DG1A 4CEZA 3RMDA 2BANB 4J9LA 3V4IA 5HRPA 3AVLA 2BRLA 4CJEA 2J6UA 3CJ5A 4BE1A 1KSPA 1JLAB 4OGEA 2C28A 3BSAA 2XY7A 1WSHA 2ILZA 5CYMA 1BIUA 5K14B 4AHRA 5C42B 3SYZA 2FVSA 1C1CA 1QAIA
chains in the Genus database with same CATH superfamily
5J2PB 3KK1A 5LMNJ 1TR0A 3LDPA 4M7XA 1YITS 2R2UA 2BACA 2B51A 4FLWA 3RJMB 1B0TA 2ROEA 3OPKA 4NZ7A 3H4DA 4IFVA 2UUCJ 1NO8A 1H0HB 5L8RC 1VI7A 3TW0A 4TSXA 4QR0A 4CHPA 4C3LA 1WF1A 1EX8A 3MN5A 2HG4A 4I7FB 1WSEA 3T5KA 3J7A1 2QJ3A 1NU4A 4BVOA 3HBTA 2Q79A 2IVYA 4HH0A 3KZBA 4BR4A 1IH7A 2HVIA 2J76E 5EDWA 5MLCQ 3S3NA 4X4NA 5BR9A 2ETJA 4DOZA 3G96A 4BE2A 3O4QA 1M1HA 4FJNA 2K06A 1TKTA 1RKJA 3HHEA 4OYBA 4PCQA 3KMQA 4CJ4A 3DRSB 4ED0A 1SPBP 4ZITA 3CHWA 4WE1B 3ITHA 2YX7A 3AVJA 2NZCA 3QBCA 3CPWR 2XYHB 1RA6A 5A76A 2BTFA 4KB0A 2Y0BB 1TUVA 5FJ4A 3U3GA 2OUGA 4DR3J 3BF4A 3OHAA 1HI0P 2LYVA 4N5SA 2E29A 3TX8A 3AA9A 2VFVA 4M8LA 4M7YA 2FVCA 2IC3B 3VQ8A 4KV8A 1HR0K 4LF7F 3GE1A 4BC4A 2BBEA 4QWBA 1NGJA 3J81j 2ZH5A 4OJ3A 5J1NA 2I5JB 4ANEA 1V5IB 3DJCA 2YH0A 1MN7A 5IWAF 2IDOA 2DHXA 2DNLA 4FWMA 1CJKB 3NCQA 1PBUA 4LF8J 2RE1A 1RE1B 1NH7A 1S97A 4J37A 4UT4A 2JWLA 4CM2A 3SSRA 1G15A 3NY0A 1P6TA 1WF2A 4R79A 2V52B 3LW5C 3AFGA 5C24A 4BG8A 4DQQA 3CMES 4ID5B 3PUFA 5EWFA 1FWKA 5M1OA 3C94A 1XNRF 2ATLA 4G65A 3UQSA 2E5HA 3GR0A 3N0VA 3EY1A 3NF7A 1Q8KA 1VHIA 4C8KA 4NA2A 3GOIA 4IH6A 4ZLJA 2V4JA 2B8QA 3S41A 4DTUA 3MDFA 3KKFA 5KFIA 4EYIB 2DR6A 4X64F 3D2EB 1JQGA 4AUKA 1A9NB 2M0GB 4UUWA 2UU9J 3QATA 3UDEA 3WNHA 5KFTA 4CF9A 3FZFA 1U0HA 1H1VA 2F8HA 3BPDA 3D6RA 2XLJA 4FLVA 2YNFA 1C1BB 2VQEK 3O2IA 4JI1F 2QXLA 1D4XA 2KT3A 4B3RK 4PXEA 4RKUC 1NB7A 1NLKL 4O3PA 5GINA 3M9MB 3M9NB 4WYBA 2Y1IA 4U7UD 1HBNA 3B8AX 4UQTA 1OKJA 1VBKA 4ISGA 1N5QA 1VQ8S 4DR1J 4JKFA 2DH8A 2DXFA 3BO2A 4OZ5A 4KO0A 4CEEA 1EHWA 1VRQC 1RT7A 3ZTQA 3AA8A 4HI1A 2P9LB 4OYMA 2NLXA 2V7ZA 3UNYA 2CZ4A 2L48A 4ED2A 2HHUA 2XULA 2NYHA 3VWSA 3BSCA 3HF5A 5A6PA 5FDLA 2VPXB 2H48B 3FJ2A 4KGXB 5FRMA 2RDIA 2A2DA 1T7PA 3QIOA 2CAJA 2HGMA 4U67L 3SQ0A 2BE2A 1UFWA 1BQXA 3EVOA 3T41A 3R2CJ 4WYWA 4YHHK 1WD6A 2DKOB 3TTCA 1GLLO 3HLUA 3UKUA 5DQGA 1VSLA 4JK9A 3DGPA 3LAMA 2AJQA 4IBNA 3L2QA 3PEHA 4BRCA 2WTUA 2KXHA 1RK8A 3E01A 2M3DA 1UP1A 1G99A 3C65A 5I3UB 1X5SA 2XMMA 4EU0A 2KXFA 1VS3A 3PW5A 1XNQF 4NMLA 3G8QA 2OD6A 2MMYA 3W9JA 4PPZA 3IG1B 8AT1B 5DMRA 4ZTFA 2V51B 2JDJA 2GTDA 4U6PA 1RT1B 2BMBA 1S10A 1AFIA 4H5WA 1NDCA 2W8LA 4ZVHA 2CQDA 4KH0B 3HHLD 2QWQA 1Q86O 2HWHA 1KVCA 3UPFA 2O01C 3M6VA 1V5VA 1QQCA 3EX7B 2AYBA 4DDFA 2OKQA 4HHJA 2EVZA 4ZP9A 3QGIA 4RUBA 4NYZA 2VV5A 4ZCKA 2XO7A 2DHSA 1ULRA 4ED7A 2KYZA 1TYQB 3DMJB 4AM6A 3HD2A 4FKXA 5F41A 4WZMA 4O3QA 4LFAF 5RUBA 2VQFF 3X1LB 4B1ZA 3FKBA 3DYAB 3AD7C 4XDCA 2KW4A 1KXPA 4TYBA 3A8KA 2R8KA 1NJIO 3OR2A 4DR5J 2DGOA 4ZLPA 5ADXA 1ZPWX 4LFBK 1OSDA 1XI1A 3FFKB 5EOYA 1ITGA 1WG4A 4DU8A 4FZVA 1YTAA 4KSEB 5K14A 1K6YA 3O9RA 4LJMA 3CCQN 3J8AA 4EO8A 1I3AA 1OH5A 4BREA 3KLEB 2WSEC 1JIHA 2MQ8A 4OLBA 5AQYA 1XNRJ 3T1YF 3IUCA 2OSRA 2R2SA 1E4GT 3JYTA 4LF6K 3G8TA 3CJAA 4ECRA 3D9BA 1S9FA 4OGCA 4QZVB 4QYRA 3SAFA 1KHWA 3P96A 3MR6A 3BH6B 3WHIA 1LWCA 3L2RA 1A6LA 2CJQA 4X2BA 1JWWA 2OCEA 5J2NA 1CJUA 1RT5A 1Q4RA 4M3UA 3Q22A 2GV9A 3LUYA 1R0CB 2DGWA 4M63C 4ZP6A 1WELA 1UPPA 4FXDA 1RWKB 3T6JA 1WAJA 3FBCA 1B9DA 3CD5A 4JI1J 2CWKA 1E6VA 2NRVA 1VSKA 3DXKA 1Y64A 2XBPA 2UUBF 4E7KA 5DZ6A 3CCRN 1ZM9A 1JXEA 4BR5A 3VALA 2XLIA 3DLLQ 1WHXA 2MTLA 1QZ6A 4CWBA 4ZVOB 4H8KA 3W64A 2WVBA 3U27A 1RNHA 4CTAA 4CJKA 2NXUA 1VQYA 1FNMA 4JI6K 1N32K 4OFZA 1K44A 1T05A 3B4DA 2ASOA 2AQ4A 1B99A 3DOMA 5CYQA 1CULB 1RP5A 2VASA 3LP2A 5HROA 1FF2A 5JJBA 3ZSZA 3QAEA 1HNWF 4D3GA 3MUTP 4RBTA 1WOSA 5F8MA 3LPEA 4FJ7A 1S48A 4B3SF 4NB4A 3CCZA 3ZSQA 3TQEA 3P83D 1YX2A 5IM0B 4PG8A 4A8WA 4CLYA 2YQ0A 1ZBHA 1VQNN 1XQIA 3VGLA 3CETA 1IKYA 4F3OA 3LM2A 2I1RA 1HHQA 4A62A 4QPXA 1K73O 2RVJA 3D6MB 2MKYA 2ZWOA 3Q8YA 3AVGA 4BS2A 2KDOA 4URSA 1T9VA 2DGVA 2DRDA 1HNXF 4EFAC 3KUGA 4G1QB 4AQYJ 3TAMA 4ILJA 4PL7A 1CC8A 1X4DA 4OYPA 1P8ZA 3WXLA 1RT4A 4BDYA 2VOOA 1G1XA 1FWLA 3J7AP 2IVPA 1FE4A 4FDFA 1Y7PA 3VOVA 2Y9HA 1S99A 2CGLA 4JI3F 3G2XA 2GA7A 3TVYA 3I56N 3L4BC 4X4PA 5ETQA 4WQ5C 2VG5A 1FJEB 5KFEA 3HYFA 1FJGJ 2M52A 5HAOA 3BH7B 3MGJA 4K4VA 1XTZA 5JLHA 1VQKS 3UDLA 1DQAA 2I8EA 1FXRA 1X4BA 1I94F 1LKZA 1KLMB 2NPIA 1IM4A 3OBWA 1LQ9A 4OV1A 4LFAJ 3VGUA 3UR3C 3OVNA 5DM6L 3A4TA 3D28A 2HHHF 5DDQC 3G4SN 2R9LA 3C7NA 3FZMA 4URGA 2QYGA 3GZ7A 1YVFA 3ZNJ1 4JI8F 4C11B 5HRNA 1DBDA 3CERA 4DLGA 2HNDA 1RBOB 4Q0BA 3MAAB 3R9LA 1BXNA 4WIQA 3WIUA 5ADXH 1R89A 3NMAA 2D74B 4NLQA 3M6WA 5H9EK 1Q81T 3OXFA 1YG0A 4WU2A 3CC2N 4ZCLA 3A5MC 4QWCA 1G6BA 4MK9A 3IWLA 2PFFB 2VGMA 3D45A 4MYTA 3VEXA 3T1HF 3NGTA 4WP8A 5T41A 3F9MA 5FRNA 3C6TB 3Q86A 1S76D 4CI0B 4B3TK 1WB9A 3VHQA 1RU2A 1C1AA 5E3AA 2KH9A 4BG9A 4TXSA 1NGEA 1P9YA 1WHWA 4M5HA 4DUYK 4X66F 3UNGC 3NRBA 2MLXA 4ECUA 2O8FB 4I9LA 1RT2B 3ZZUA 5G4DA 4UY85 2PYLA 2RDJA 5GADP 4M94A 1WHYA 2DNNA 5CZ2A 1NSKL 3NMRA 4IH7A 3PFOA 3M2RA 4EK2A 5GADI 3VQEA 4CEFA 3Q8UA 2E1YA 3NEKA 1REVB 4AD6A 4TY9A 3LAKA 5LSRA 1HBUB 3HI9A 4KIAA 1R8PA 3QFUA 1RAIB 4R5PA 1UW4A 2K3KA 3F41A 1YSJA 2RJZA 4FPRA 4RBVA 4DKWA 4FM0A 4U7CA 2GAGC 3L9ZA 3W9IA 2UUBJ 2EWHA 4PUOB 5KFBA 3H6EA 4C8OA 3PRVA 3CJ1A 2LQ8A 1W25A 1J5OA 2CQGA 2ZH7A 2XHBA 1VQ9N 3SPZA 4CD3A 1YAGA 3NBPA 3DOKB 1IBKF 2R7VA 4G1IA 1UFLA 3LH2S 4MTPA 4NLWA 3MAQA 3L7OA 2ROPA 2GC8A 2L41A 3GG1A 4PWUA 2K7JA 4KGKA 5D4NA 5ETMA 5HOOA 1JXLA 4QYZK 3BGOP 3C8YA 4N77A 3R2DJ 4WFNL 4CH1A 2Z8QA 4ITSA 4FJIA 5FLXU 3JAMU 1OPZA 3WIVA 4B3SJ 2VB6A 2JOQA 3FBBA 2F40A 2GNKA 3E51A 1SUQB 1RISA 3HI0A 5DDRC 2H54B 4CO3A 4IOCL 3D6FB 4FJHA 1NOYA 4NLPA 1S1XA 2JC0A 4DMNA 4DPUA 5EWEA 1GMWA 1VRUA 4HR2A 4NLOA 3NNHA 1VRTA 2GHPA 4PRFA 3QGGA 1VBXA 2HLTA 3S7RA 2RU3A 3HDSA 2N4CA 4F7VA 2JJ4D 2W2PP 4NLVA 1FD8A 3UE5A 1YF5L 2DB1A 4YP3A 5F3ZA 4K42A 4CJFA 2DEJA 1FXXA 2MLZA 1YIJS 2G8FA 5KFCA 1SH3A 1UJ5A 3OFGA 3THYA 1UA1A 3OTCA 2ALYB 1I1GA 3WQTA 5DDPC 2I9SA 4FP9A 4B9SA 2YKMB 1SXLA 2GBZA 4P7VA 5KFGA 4JB8B 3FC9A 2VG7B 4GY2B 3KLGB 4JI3J 3M8QB 4ES2A 1T3OA 3QEXA 2UUAF 3WQPA 4NLSA 2HLUA 1VLYA 2FSJA 1GLBG 4U67Q 2V2KA 5CCMA 3VGMA 4YOWA 3NKYA 1RA7A 1I94J 3I33A 4B3MK 4LBHA 4NCAA 4EUVA 1KAXA 2O3DA 2CGKA 1U1OA 2B4UA 3VEZA 3UR0A 4K8ZA 1EWRA 3GE9A 5KAKA 2HQGA 2YNGA 3SV3A 3RMCA 1Y5NB 2HEKA 4LFCF 3V81B 3BPSP 2VFTA 1FWPA 2E6LA 4F25A 3I96A 3VQSA 2BABA 1UMJA 2HHHJ 2LECA 3RB3A 1IKXB 4YY3K 5KFYA 4DV2K 4JI8J 2VF3A 2VBWA 2UP1A 3BV8A 4IDKB 2C3OA 4DU3A 3PJWA 3R5AA 3ZX0A 2AX0A 1YTYA 3X3UA 1ELOA 4OYAA 2UXBJ 2WVCA 3NCIA 1EZZB 2QWOA 4DTXA 1NKCA 2RRAA 3G82A 4CEDA 2H1YA 1OQ3A 1HJOA 2B56A 2IGIA 3DLGB 2XZDB 2DFEA 4NCGB 2G0CA 4Y2MA 3A3PB 2UVUA 3FZBA 5C25A 3IFEA 3GWCA 1G4CA 3TRGA 1BHNA 5K8MA 2HNZB 3G71S 3I31A 2G9OA 1IBMF 1L3TA 4Y1CA 1DRZA 2YX4A 2YWHA 4IO1A 2JEGA 2B3TB 3CM5A 4HHTA 5LXRA 4CIGA 1FXLA 1S6QA 4FJ9A 3K5PA 1MDUB 4YB6A 2AEFA 3M9OB 2J7WA 1VQOS 2E1AA 3EDQB 2C2KB 2WHOA 2P51A 4P75A 5F8JA 3AH6A 1TFYA 2Y8WA 4NLCA 1HLUA 3H7HB 1SZ2A 1H6KX 2HPUA 1X4EA 1GMUA 1HYSB 3OHRA 1MLAA 4YB7A 2F8EX 3RYLA 2XCAA 2PI5A 4HDGA 4X65F 4K4SA 1XEZA 2P9IB 4XEIA 3SUOA 4TLQA 4ZOSA 1BA0A 2RE2A 2XZWA 4FWOA 3KLIA 3OYHA 2YCHA 5LM7E 3OVSA 1PGZA 1NPRA 1CVJA 3QIPB 4X84A 3NS6A 4ZPVR 4LR9A 4FJJA 3LTOA 2XTJP 6AT1B 2GUIA 4CHQA 1VQNS 4O8KA 2JLGA 3MN6A 3OYMA 3IA0A 1JNZB 1IBKJ 1HYZA 1X9JA 2F7TA 2CXEA 3FBEA 2OEKA 2YKAA 2LQ5A 2ZVSA 4F4AA 2W9BB 5E5NA 4HUFA 4JNEA 3NOGA 2CZVC 3KFWX 4FS2A 1HKBA 1SC4B 4M3TA 3BF3A 2F9DA 3V6JA 4UOFA 1HBOB 4KHPK 2HHWA 2AV5A 1WEZA 3KWGA 1NM1A 2IPOB 3ZSRA 4JI7F 1NMEB 3GCXP 4WQ4C 1J5EJ 3VQBA 4KKOB 1VFJA 3CW2C 2B5JA 5D0GA 3CJKA 1EP4B 4L8RB 5F8GA 4Y2AA 2PFDA 3OVBA 4L3QA 3MR2A 3GV7B 5DGBA 3ADAC 1U45A 2X3GA 4CP5A 3M8PB 1QUVA 4DI6A 1MROB 1SAZA 5LMUK 3ZTOA 2ADBA 1RU1A 1R0AA 3BR8A 2CPZA 3V2UC 4LF9K 5A0YB 2H5JB 3BGFA 1N36F 1N8RO 2G2ZA 2B4JA 2QMWA 3ZXWA 3PRBA 1RWUA 4L75A 4O44B 4CLZA 3W61A 3M6GA 5E84A 2HURA 4HEA9 4CO2A 3ILOA 1RILA 3PTWA 2AWZA 2WRMA 1HNZF 3CC7N 4B1VA 2R7QA 1NWKA 2F96A 1S7IA 1IVZA 5AJ3F 1UKUA 2CNNB 4CGHA 2FJXA 2MQLA 2FF3B 3V4MA 5EHHA 3BKTA 3DLEA 1S72N 2LXFA 4E19A 5KG6A 2OLWA 4KGVB 1LWFA 4JD2B 2AIRB 2MEWA 3SV4A 2R7TA 2JEFA 1JNRB 1SKSA 3T9NA 4LRDA 1GOBA 1HL6A 1JL2A 4DQ8A 3I6PA 2O1PA 1ZOTA 2JH3A 5BRDA 2UXDK 5JLFA 4DPTA 1T11A 4JN4A 5KT3A 3I5BA 5CD4A 3PCOB 2W7AA 4DG1B 1S12A 1TK0A 4P72A 1IBCB 2NPFA 4NXMF 4XDDA 1F21A 3P39A 1RTJA 4GKJF 2FJEB 4M5LA 3UDCA 3WDOA 4JHDA 4M5MA 4QIWD 4CDIA 1N56A 2R7YA 3GP9A 4HWIA 3CQXA 2IA6A 2F4VF 2QLXA 4H4OA 5DQHA 1YLXA 3OXLA 1M5PC 4KBOA 3CJQA 4RBUA 2P9EA 1Q86T 4H0OA 4JI5K 3PHEA 2DY1A 4OHWA 2HWIA 2A3ZA 4GO5X 1NJXA 1RYSA 3KK3B 3ZSXA 1SBRA 4E1MA 1G7CB 5LOQA 4CBUA 5DM6Q 1RTHA 3CO0P 3MM7A 3B82A 1RTDA 2EEYA 3AA2A 5EX5A 1GMWD 3BM7A 4DR4K 3PDNA 3I0SB 4OX8A 4Y00A 3EL2A 2FHJA 3OYJA 3I55N 2HMIB 4KPCA 1WI8A 3KHGA 3EVWA 1HJRA 3QQCD 3MMCA 3FNNA 3Q8SB 3HSZA 2R8HA 4IRKA 1IJJA 2V9KA 1UVJA 4FJXA 1N54B 3MM9A 5FLXY 1LXNA 1RBVA 1JJ2M 2DGTA 4CT9A 4DCJB 5GMKa 1NGAA 4CO5A 1SIWB 4XTTA 1SH0A 3W63A 1JJCB 4H4KA 2W2QP 3AA5X 4QBUA 4CLFA 3OYFA 3J7ZO 4E89A 3PX6A 3TSPA 1C0UA 4RL1A 2VPYB 1IBLJ 4DR6F 2D1CA 4BC9A 3KHYA 4PG7A 3ZT4A 1KC8O 3O6WA 3KJQB 1KVJA 3OS1A 1WSJA 2J0XA 2XLKA 4NXNJ 2E7VA 4IG3A 4DR7J 3QWUA 2HNYB 1RDRA 2J8AA 2IMOA 2ZM6J 1BQMA 3H45C 4NLBA 1X4GA 2GIRA 2E9TA 4B9NA 1D8YA 1S9GB 1CJVA 5U47A 3ENAA 5JS1A 3O1LA 5D4LA 4CJ7A 3LWLA 2GQCA 5T14A 3DC2A 3GG4A 2VHGA 3H2LA 3K57A 1X4AA 4A48A 4ANCA 4DSFA 3OW2M 4ZVQB 4FO0A 2CQ4A 4NYNA 2AKWB 1UFKA 3CULA 3TP2A 3WEEB 1HKAA 2ZVIA 2UUCK 4H4MA 3V9WA 1HLWA 4PKIA 4RNHA 1YUWA 1YJVA 2IHR1 3W8GA 1R59O 4NLUA 5HQ8A 1N36J 1IR1A 4KGMA 1QSSA 4X62F 4WXOA 4WFNQ 3SQOP 4TKTA 1YJ9S 3O9TA 4D3HA 3KIOA 4P52A 1YRXA 4CJQA 1Q5YA 4CJ5A 4FBUA 2VC0A 3QEWA 4Y2KA 2J0SD 4RW9A 2GQ2A 3N79A 3G10A 4IOCQ 5EX3A 1AROP 4PKHA 1YHQN 2EPIA 2J8SA 2OPQB 2C2OB 4JS4A 4FBTA 5JVGL 1NBEB 3UWTA 4UUXA 2EFNA 2W4PA 1FT8A 4DLEA 4HT5A 4EHUA 1ATSA 2FHKA 2EKYA 2E1ZA 3QRQA 4EAHD 4ZVGA 4DR3K 2IRUA 4J7CA 1QTNB 3V9ZA 2FC9A 1QHAA 2QA4N 3H4BA 1S1WB 3CDEA 4KY3A 5KFAA 1MWKA 5I3PA 5AE1A 2BR0A 1I3OB 3B6PA 1AZSB 3N9UC 1X9SA 1RTZA 3GILA 1K73T 4PQUA 3LDSA 1EWQA 2BE9B 2R8GA 4CEAA 3DFEA 4ILMA 1R27B 5CD4H 1ZYQA 4GKJJ 2AF6A 2VKZG 3L4IA 4NZ6A 2KTQA 3O8MA 4OV6A 3VAHA 3SJJA 3OBYA 2NLWA 4M95A 1RJJA 3LDQA 4Z7YA 3ILJA 3PJ9A 3KYLA 3M1VB 4BRHA 3AVBA 2Q6BA 3P4UB 2HBKA 4K4TA 2V8PA 3ZZ0A 1HYVA 3VGVA 3NE6A 4M5NA 5AQJA 2P9KA 5BYSA 5HRRA 3LP1A 3CQYA 1RGVA 5GMEA 4KFBA 3JSMB 3LZJA 1RWNB 4I6WA 2OD4A 3POTA 1LW2B 2RQ4A 1HKCA 4WCEL 3EE3A 4NL5A 4BRQA 4AILC 4DL2A 1RWVB 2G1HA 2J4RA 4F02A 2N7YA 5HJXA 3UD5A 2F4FA 2EBGA 1BDGA 3GIIA 3CCTA 2NQPA 3PR4A 3TTDA 2PSZA 1SI9A 1Z4UA 3BP8A 2W9AA 3OFFA 1FVQA 1K8KA 3T6BA 4DTPA 3NNAA 1F0XA 2OMOA 1KOOA 4KHMA 3B6OA 5ADZA 5J2MB 2VYPA 3CJ2A 1K8AT 5BR8F 4GV9A 3VF0B 3GONA 4DUTA 4A47A 1DQ9A 2J5AA 2QFJA 5IOLA 1X5PA 3AVKA 3SDEA 2MSTA 4QW9A 5K8OA 3MMAB 3FE1A 1LOUA 1VQ4N 4RCHA 5IS2A 1T6DA 2BDPA 2U1AA 1OH8A 1IN0A 3EZOA 2HK2A 3ISNC 4J9MA 3DRRB 4RX6A 3QRPA 1Y00A 4FS1A 4M5DA 4OZ2A 4J9VA 5CH7B 1UWBB 3THWB 2AEJA 2IFXA 2MKJA 1HWKA 2F9WA 4CJEA 2Q97A 2UZAA 3MUVP 4NYPA 2G2YA 1WSHA 2ILZA 2MQMA 4AHRA 3G9CA 5T7LB 5C2DA 4KTWA 2V2VA 5JUMA 5A8KA 4BRMA 3TABA 4MIWA 4JLHA 1S72S 1YJWS 2O8CA 4B9UA 1Y3JA 4B9QA 2FLOA 4DV1K 3D1OA 5E41A 2JFKA 4QIGA 3I9V9 2BJ1A 1U24A 4X62J 3D6HB 4IRCA 4N56A 4C0HA 4IZ9A 7FD1A 2ZZMA 2LA6A 4I67A 4O23A 2WC9A 3IMXA 1U8SA 4AT1B 1ACMB 4CZIA 3EKSA 3CJSA 2E2PA 1S59A 2HB5A 4TU9A 2FIUA 3FFIA 2E6MA 5F0WA 3AVNA 2MSSA 3BGLA 4FLYA 2E2OA 3AOAA 3CEDA 2HFSA 4IOBA 3G6YA 1PILA 3CI5A 4I56A 1B64A 1JLBB 5L39A 1IUJA 4ILGB 1WKLA 4E0DA 3KTQA 4ZJLA 1WF0A 3NLCA 2FHJD 2RS2A 1DTTB 2BKNA 3KLHB 3R5GA 3O9QA 1CLQA 4NMXA 1TFWA 1PAEX 4E7IA 2CFXA 4CECA 4DV3F 2CQ3A 4HACB 2X1BA 1O1WA 3CCMN 3AD9C 2V8DA 1BD6A 1IWGA 4DV4J 2DIVA 3C46A 1QVGR 1NHKL 1PAUB 1H72C 1HNIA 2GVDB 4PR6A 2VC1A 4OQJA 4O5BA 2MZJA 4M3RA 4A2AA 4DR5K 3KJFB 4XH4A 4I2QA 4JI4K 3F9KA 4V1Ak 1EQ0A 3RSEB 3UFCX 3PW2A 2DXDA 3D0IE 2P9PA 4IRDA 3G25A 3T5JA 5DG8A 2SXLA 1SQEA 3OS0A 5HVHA 4F2SA 4JKHA 2PT0A 4HYKA 4FLZA 3TR8A 1TL3B 3FZLA 5FPMA 1VSHA 3OUYB 5FD1A 1T9XA 1P1LA 4OPKA 2RMLA 1P90A 4F0HA 3BGRB 2KFYA 5AQMA 2HZAA 1U7LA 1NG9A 2DITA 2HS4A 5C15A 1TKTB 4CIFA 4C97A 5CQGA 3FGUA 3SMPA 1BU6O 4ZVTB 1VQ6S 3ITHB 2HBMA 3E2EA 3BJYA 3E9PA 3ZZZA 2JNJA 5EX0A 3SMZA 5CY4A 1S9EA 2MQPA 3H2UB 2Q36A 1ZPVA 3KK2A 1FA0A 3MEGB 4FF1A 3MEKA 3NWGA 4ZHRA 4ANDA 2WSCC 2ZH1A 3H08A 4Q44A 2ZBQA 4KV8B 4Y2IA 3TZWA 3M7VA 1F5AA 2L9WA 4J2DA 2CH5A 3VA3A 4FJGA 3MN7A 2P9UB 1ASWA 2BZ2A 2K8GA 4L72B 3NF9A 4NO7A 2QX0A 3FRYA 3NNCA 1BWFO 2QGFB 4BR7A 3A1YG 1Y5LB 4F9OA 1X5OA 4LF5F 4FJ8A 1CPZA 1RBLA 5LSOA 1MWZA 4J9SA 3DRXA 5JICA 3CJ3A 4HT7A 3HSJA 3R1XA 3TU5A 2E4LA 4C0BA 3W2WA 4DXLA 1MA9B 3R5JB 2PI4A 4CJUA 3HVTB 3IWNC 1HI8A 4MAKA 4OLAA 5KFOA 1EIYB 3D1QA 4BRNA 1YHQS 5KT2A 2YX6A 1GTHA 1EETA 4WBFA 1Q8IA 2IBOA 5C24B 3T5LA 4CEBA 4CFCA 1K1SA 1JLCB 4GO7X 3TVKA 1F2GA 1U1PA 2V68A 5B08A 3ULEB 3A3NB 2QL9B 2QA4S 2KL8A 2O8DB 3SCKE 4FLTA 1HNVA 3MM8B 2BEFA 2NUBA 2ZDOA 2XM3A 1KONA 4AQYK 2V4RA 1D9AA 5LY3A 2V4JB 1F9FA 2EK1A 2KT5A 1LNQA 3U1MA 4F4YA 3MM6A 4ICLA 1RLDA 3W3SA 4BCAA 2BJ3A 3HO1A 2ROGA 5HQLA 4OYWA 2W41A 4DU4A 2RH3A 4GRSA 1UOCA 3H5SA 1S6PB 2JZ5A 2OI2A 4FWKA 3M8WA 5C2GA 2YNFB 2O5DA 4NA3A 3BREA 1VAZA 1FJGK 2MHNA 4JI0F 5F8LA 3HRGA 1R0BG 4K0KJ 1PYSB 2KVQE 1JB0C 2CUYA 1U6ZA 2CRLA 2B7CB 4BR0A 2DGQA 2V50A 2CKWA 3SUNA 4MFBA 4DX6A 3MD3A 2D0PA 4QR2A 5HVGA 3P49B 3PXGa 1N48A 2GX8A 2ZJPL 3AOCA 3HT0A 3MR5A 2P2CB 4JK7A 4FKYA 2XC9A 2P9CA 1O51A 4DV5F 4EP5A 3RMAA 2DNQA 2VFRA 5M2RA 3GIMA 2GIFA 4NWBA 3H40A 1EKSA 4G3IA 2BANA 2K1RA 4AE5A 5JVGQ 3CIZA 2BJ7A 5D0RA 4K50A 1JLAA 4IO9L 1Q82O 3W3DA 2BE2B 1VLOA 2L9DA 1FRIA 3BGUA 4ETZA 4RNFA 2AHOB 3FBFA 1XMOF 4WKRA 5J2PA 2E5LK 3F0NA 2OANA 1UEKA 2F65A 5E3RA 3GR1A 2UUTA 3OYDA 2LCWA 5EU7A 6FDRA 3GBTA 2IYGA 2NUHA 1WLJA 4LR7A 3U9ZA 4AM7A 1T02A 4C8YA 5HP1B 2GW8A 4CHZA 1XK8A 1C0FA 4J9KA 1GLFO 4GVEA 2PMWA 2HBZB 3AQOA 5A8WB 4DB3A 4N8OA 1HBMB 3DDIA 2AJ1A 4I7FA 1IWAA 2RQCA 3NAEA 4KHSA 3K59A 2ZGZA 2YWWA 1UL3A 5HI7A 3PFEA 1UETA 1XERA 1Y0HA 2E8AA 1HKGA 4JV5F 1NSPA 1WSVA 3EZ5A 3DRSA 4ZKAA 4WE1A 1PJ6A 3IR6B 1ZTWA 1NAQA 1BWEA 3LPTA 3ZCMA 2J7UA 4W5OA 3NHGA 4MDBA 3AJ2A 2HMPA 4WCEQ 3NVMA 3QERA 3EZUA 1S3XA 2WTFA 4Q8FA 2CJKA 2IC3A 4ZN3A 1B70B 4JV1A 1TKXB 5ETKA 3P5TL 4JYAJ 1SKUB 2BUNA 2DPJA 1NB2A 4USMA 4JUZA 3SBGA 4QOTA 4LRCA 4YEAA 3ATVA 1WG5A 2XCPA 4LQ3A 1IQTA 4PAAA 3OLAA 3CFPA 2I5JA 4YORA 3J80Y 3J7YP 1QY7A 4C2MA 1QSYA 3R6LB 4NZ0A 1CJKA 1IQZA 2DGUA 1N33K 4JRPA 1S5ZA 3J7YI 1U1NA 3ISZA 2RSQA 1M5SA 4JK8A 2CQ2A 4ERDA 3MEDB 1S5JA 2QG9B 2Q3SA 3CC4N 2DRBA 1W0HA 5SUHA 1JLFB 1Q78A 3PYEA 3U1LA 4FOEA 1WSIA 4ID5A 4P2FA 4CE9A 5IT9Y 2IJRA 3EYZA 5GAEU 4OKEA 2DY9A 2Z30B 5SWMA 2CPYA 4BDZA 4H5VA 3TNVA 2A3JA 5IC4B 1FTRA 5BYQA 2O8BB 4FWSA 1M1KT 3TTFA 1E6VB 4GMJB 1CEZA 3D2EA 3IMQJ 2XNRA 1FHTA 2D69A 2Z1JA 4GC6A 1CZBA 1YVNA 1RAGB 5KFWA 2UV8G 2BKPA 2W6LA 3A3OB 1FNXH 2DPNA 4Q43A 1C1BA 4M3YA 2H3GX 3GJSB 1WKJA 1QTMA 2E5JA 3PSFA 1VSEA 2ZJRL 4ZVFA 4OYZA 5HANA 5E33A 2EFGA 4DV5J 5BPNA 4JKGB 3DRPB 1HR0F 3HULA 3HPOA 5CYQB 3K5NA 3BDPA 3GIJA 4BACA 4R0EA 5HBMA 1RHUB 1OVYA 1LW0B 4F4ZA 2BX6A 3PYGA 2P9LA 2MZRA 2UXBK 1H2TZ 2F9JA 4Q45A 1U49A 1DQ8A 2E9ZA 2Q6CA 1XMOJ 4KH4A 5ETOA 3HSGA 1MN9A 3IS9B 3J7Z5 4CHOA 4CLUA 5J1PA 4NLRA 5I3QA 1ZA1B 4QIEA 2YH1A 1Y97A 4I69A 4ZP7A 3AVHA 3K9JA 5K5MA 1RUSA 2B4VA 4QQBA 4KAZA 3S01A 4CZHA 4OX9K 5AQVA 2HVZA 2AYMA 2KM8B 1KQSR 3Q8QB 1NSAA 3TAMB 3LDOA 2NRWA 3AO1A 1VC6A 4KAIA 1JJHA 3OTDA 5I3UA 2OTJN 3IM8A 4KH6A 2NREA 5HK4A 1QAJA 2Y3YA 1ZBIA 1WJ9A 2DO4A 4H0PA 4JI2J 4CLKA 2QW9A 3L3VA 3IG1A 2IAJB 1KWMA 3VTHA 2HGNA 1Z1ZA 4P74A 1TMMA 5F0XA 5IFMA 1RT1A 2ALZA 2ZF5O 5AQSA 3EGWB 1GLDG 2YWEA 2DNRA 2D0OA 2NRXA 2MB0B 3NGKA 1ESVA 5CHIA 4GKKJ 3N01A 5D4OA 2KKHA 2MHEA 3RMBA 2FYXA 3CDUA 2VQEF 1BGXT 2HFNA 3H2VE 1X5TA 4B3RF 2DO0A 3F2KA 3KLFB 4K7QA 1CBKA 4MYUA 1YXQA 4DL7A 2G8HA 3I0RB 4OPJA 3DAWA 1VMBA 1R8AA 4B08A 1TYQA 3DMJA 2XEXA 3V6DB 5KG0A 4O8UA 4TNOA 4CZMA 2JL9A 3HOSA 4TN2A 1WBBA 3DYAA 1TGOA 4P10A 3AO3A 4MQ3A 4BR9A 1Q9YA 3KKSA 5H1SV 4JV2A 4BBYA 2KXNB 1VHFA 2LMIA 1J5EK 3JTOA 2F5GA 4DN9A 2AT1B 3A0IX 2CQBA 2BOAA 5HMWA 2I6WA 3DCAA 2LQJA 3KLEA 4OJ1A 3D3CJ 1FNOA 3V1OA 4YHHF 3ZSVA 1AT1B 4KQZA 3FZHA 1IV0A 2IOCA 2FY8A 4IFEA 4NRTA 5A8RA 4RU9A 4N76A 3M2RB 5KPTA 1FXDA 4AFFA 1I5OB 4WQ5A 1NKBA 1YVUA 3TVZA 2FLNA 3WC0A 3RRGA 2OPRB 4MDAA 1FKOA 4IYQA 1H2VZ 2B8PA 2CNLB 4R5PB 4ALZA 4ZIVA 3ENVA 2HQCA 4ILHA 3GYNA 1JXBA 1ZAXA 4ZLNA 1MSWD 1FTCA 4F2RA 4FK4A 3AVFA 2YY3A 3LWMA 2C22A 2KM8C 2XS5A 3ETOA 1HHTP 1DTQA 2PC6A 1TKDA 3NBPB 1XQSC 3A8EA 4DPWA 4RW7A 4QIFA 1HWIA 4Z4FA 5FPNA 4G6VB 3CCVN 2YKNB 3SQ1A 1K9MO 3HM9A 4HHUA 1YJUA 4DR2J 2A1SA 3SUPA 4M5KA 4RW4B 3MM5A 4N47A 1VSMA 2VA3A 3C15B 5T7BA 4Z4HA 4YOXA 1TKZB 1YI2S 1AB8A 3OTBA 4AHCA 4ZMMA 3ENOA 1E4FT 2V34A 2D3OR 5AR0A 1SL0A 2N4DA 2YHXA 2BJEA 1UAWA 2LDIA 5F2RA 4OX6A 3LPYA 1HQUA 2PYJA 2Y1JA 4V19S 1CULA 3WT0A 3IR7B 3MWTA 1X9MA 3GB0A 1CZAN 2YJEA 2QA4G 4IR9A 1HI1A 4E7JA 2MKKA 1VRUB 4GNIA 2B0GA 1XHXA 3VAJA 2CJXB 2P5GA 4CHNA 4LFBF 2C2MB 2XMTA 3VMFB 1FD2A 2E88A 4A8MP 7FDRA 5IM0A 3QGHA 1KQGB 3VF2A 1VYAA 1K0VA 4E1JA 1FRXA 2CPDA 3D67A 4DV6K 3M6XA 3NGSA 2FJWA 4PXCA 4CGIA 2QEXN 2ZJPQ 3CCES 3CCJN 4CF0A 4FK2A 3TAPA 2AJ2A 3BB5A 3SQGA 4LF6F 3OTOJ 1OH6A 4G1QA 3RBEA 4W5QA 3QWPA 1J2VA 1WKKA 4DCOB 2Q43A 1TAQA 1NM2A 4LBIA 2NRRA 4B3OB 2MQQA 4A8FA 2HFZA 3HSCA 3DM2B 3G87A 3HJFA 4IXCA 1NKEA 4IO9Q 5A2QY 2W2OP 4E7LA 3BYRA 4U95A 1T9TA 2BUPA 2FHOB 1N34J 2DHAA 4DSIA 4OX7A 3PX0A 3AO4A 4M45A 3QJJA 2YNGB 2VQEJ 3R1LA 2BA9A 2R7UA 3HVAA 1Z05A 1NBWA 1WC0A 3ZETB 2GX9A 1VC5A 3CC4S 2YKPA 1H2UX 1KLMA 3AO2A 1IBLK 1GH8A 4XH5A 1TL7B 3TAGA 4M3ZA 2YNIB 4BC5A 3NF6A 3KUHA 2FBTA 4ECSA 4NXNK 4DR7K 3L09A 1SV5B 3BQ1A 4JI6F 2ZM6K 1E6YA 1N32F 5LL6Z 1UA0A 4GV6A 4M5JA 4FM1A 4FF4A 2GFFA 4G9ZA 4P2SA 4H0TB 3D4JA 3HSTB 4BQZA 1MU2A 2H5EA 2IM3A 2A18A 2NXEA 3SFGA 3EVMA 3KG4A 2C3UA 3MAAA 4DTSA 2HWTA 4M3WA 2ZBPA 2XMJA 1HA1A 2OFHX 4H0XB 1EXQA 3CXCM 3VQ4A 4QS8A 1H73A 4RPFA 3TZZA 2VGNA 3SCLE 1U0SA 3C6TA 5CZVA 5HMZA 1VSIA 1XIQA 4CCHA 2DJWA 2EFVA 2AEMA 2JWKA 1AA1B 4Q5VA 4ZVEA 3R3TA 1N36K 1VBYA 3H8YA 2M8HA 1NGIA 4Z4EA 4F36A 6FD1A 4ZK7M 3QB0A 4CK1A 2JEJA 2ASLA 4AF1A 1NK9A 1RT2A 4LH4A 2JWNA 1AW0A 2YBVA 1FKPB 4FLUA 4CM0A 2ASJA 1TUYA 2ZNYA 2IDLA 5TKYA 4TY8B 4YN3B 2OEMA 4V19J 3EKUA 1REVA 4FPIA 1GLEG 1SKWA 4DEZA 2YTCA 1PYTA 1HBUA 4CIOA 3U6FA 3OSNA 2OZMA 3MXHP 2ITMA 4AYBD 3AY9A 2W2MP 2IBKA 3JXOA 3DOLB 1GFWB 4I64A 4JKCA 4PUOA 5KFQA 3N5FA 4BRLA 3H3NO 3ATUA 5LXYA 1RYRA 1VISA 1RI7A 1T0TV 2FLPA 2UYTA 5GVQA 2CDRB 1D1UA 4LIWA 4Y3CA 2XMAA 3FLCO 1BL3A 2DCUB 3RG6A 1QSLA 2KJVA 1TUWA 1ILYA 1BG3A 3DOKA 3V9XA 3H1QA 1OWXA 1RSCA 2KZMA 1U02A 2KI2A 3R27A 3QNWB 4ZCIA 3PW4A 2YHYA 5JMVA 4FW1A 2FJVA 4EYHB 1Y11A 1S0MA 4OL8A 4PY5A 1ZM2A 3VERA 2DH7A 3K5MA 5KGWA 3KVGA 5AQXA 3MPUB 4LFBJ 3VEWA 1N5VA 4JBCA 3CJKB 1SUQA 5KFRA 2HS0A 4WXWA 1BIZA 2HOEA 1Y3KA 2L08A 3KWIA 2MQNA 5E2QA 3PIPL 5HSPA 2EXUA 1N0UA 3TZXA 3WXMB 1FJ7A 3T19A 4A4JA 4AL6A 1NH8A 3B4MA 2YJFA 4B3TF 2W9CB 2ZJRQ 4UZBA 3TEGA 1RDDA 2LQ9A 4X4TA 1FO1A 1NJZA 3TWHA 2ZZNA 4DUYF 2C2EA 1N0VC 1S0OA 3E9OA 2ADCA 4AL5A 3CMAN 1VQMN 2ZITA 4CD1A 2NZTA 3Q89A 3OL8A 2G2OA 3RAXA 2VICA 4QS7A 2ACMA 3CNQP 2YKMA 4DL0C 1JCEA 1RBUA 1LXJA 1TTHB 1PCAA 3G0ZA 3EDRB 4YUDA 2FDNA 1NGGA 3W8PA 2XYGB 2ZH6A 2ZNZA 3AARA 2VG7A 5KG5A 2ABYA 3KLGA 4CZJA 3M8QA 4E98A 2V5HG 1BWVA 2IM1A 1DT9A 3G6EN 2J7KA 1SVDA 3U8XA 2UXCJ 2GJIA 3UKRB 2RRBA 4DUZJ 3CD6N 1NHUA 1VC0A 4ENOA 4Z7CA 1IKVB 2OZSA 1C4AA 3DNCA 4DJBA 2HIYA 4UF4A 4LRFA 4DV7J 3O3HA 1OS5A 4J2AA 1X1PA 1Z6RA 3AJDA 5F9LA 3CM6A 2E7XA 1XMQK 2E1MC 2EFPA 1RCXB 4K59A 4IWVA 2O67A 1TMJA 1RZMA 1IKXA 4QU7A 2X6SA 3IAM9 1NDKA 1F2HA 5JS2A 5D0EA 2VONA 2B4PA 2XG8A 3SQ2A 4OI1A 3ZZPA 4I4BA 3NFAA 4ZVSB 3I8BA 4OJHA 3HKZD 4IDKA 2VJVA 1VK8A 3AAPA 2ZHAA 4H4OB 4EEYA 4YS2A 3OR1B 2PO4A 3CTRA 3IR5B 5L46A 2Q31A 2BVZA 2FHMA 4K25A 3DLGA 4DX8H 1GLJO 4NCGA 4GVMA 4CZGA 1TV6B 1JLEB 1UVNA 4OPHA 4WFAL 3A8IA 2QWMA 3L95X 1SJ4P 4BY9C 4KB7A 2KG0A 2HNZA 4FYWB 1S0VA 3MM7B 4OLOA 2CIMA 3DU6A 4X4RA 5THWA 3J81Y 2WVEA 5D0HA 2EFQA 3M8YA 1W2BM 2I7PA 3KJVB 1J9AA 4AHSA 2QT7A 3SCIE 3K5OA 1HYSA 5AQOA 2JGUA 4WU3A 4DHVA 4ZCMA 3K17A 2RQKA 4ILRA 2P9IA 2LQBA 4PG5A 4CJPA 1OY9A 4Z4GA 2IDEA 1RT3B 4NASA 4OZNA 2E7WA 4GMKA 1RADB 3G86A 2ZOFA 2X74A 2M4MA 3QIPA 4A8OA 4F8RA 2QKBA 3NOCA 2PIIA 2D7SA 3BEXA 1NGFA 2RF2B 4B3MF 4K41A 2MGZB 1XHZA 5KQDA 3KD1E 4KHWA 2NXJA 1UW9A 4I68A 2WBMA 3H90A 3O3GA 2LXIA 2W40A 2W9BA 2QEXS 4ED1A 4LF7J 3U02A 4DV4K 5AZJB 3ET6B 3RB0A 2JSXA 2HBLA 3JSYA 1BQMB 1QAXA 1FCAA 4YB5A 2WVFA 3JS9A 2GGPB 3ZT1A 3O4NA 4YY3F 2JLFA 4DV2F 4MKBA 4YR2A 4U8YA 2VCPA 2OAUA 3E66A 4CESA 3R7BB 4B9LA 5IWAJ 1HBOA 3LP0B 4ECYA 4WPAA 2H9ZA 1S1TB 3N6NA 4JAXA 3RBDA 5K8NA 3BZQA 2R7OA 2VD3A 1M90O 1N5SA 4PQAA 2B7BB 4KKOA 2XI2A 1QS4A 4RWWA 3MOZA 3M32B 1EP4A 3VQ9A 4H0VB 3JQJA 3NGZA 3S9HA 3PEJA 4DUYJ 1KDNA 2I0XA 2AP6A 1VJQA 2B9EA 2P9SA 3M8PA 2CG4A 4USKA 4I6MB 1MROA 2CQPA 2WONB 5M1NA 3D68A 3MZIA 1RHJB 4LSNB 2D0CA 4AHVA 1T03B 1YRUA 2VDHA 3MXIA 1HMVA 1MMDA 5A0YA 4RW6B 3FEYB 5AQQA 4WK3A 2B9YA 4JEPA 4O44A 2HBYB 3I8DA 4F4XA 2HSTA 5AQWA 4X64J 3OFHA 3O4WA 3M8ZA 4GVBB 2KHCA 3Q8RB 5M2PA 1NNDA 1XUPO 3C0BA 1QDUB 1G3OA 1VQLS 1BISA 4QPTA 4U7BA 3IRXA 2D0BA 3NH0A 3NDKA 3V9SA 1SJ3P 3C6UB 2HQ3A 5KG3A 2FQQB 3THPA 5DJBA 5LJ5Y 3ZEUB 4CLSA 3WXKA 4NLDA 5E0OA 3AA3A 2OEJA 1OVQA 2OFGX 3VEVA 4JD2A 1HX1A 4ZIWA 3IFRA 2OPSB 1CS4A 3IXQA 1Q18A 5KI6A 2PEBA 4DL6A 4ZPBA 3ONQA 4ECVA 2RB7A 1ASVA 3CFOA 3TANA 3A2FA 4DFPA 3OA9A 5SZTA 4ED8A 1REGX 1WDTA 4CFBA 4DPOA 4R25A 4DG1A 2B4OA 2NSBA 4J9LA 3V4IA 2BRLA 2CPJA 4LF1A 4DV0K 4KHPF 4YOYA 3CCLN 5C42B 3J81O 4Q7AA 4K8RA 3M8SA 1XR7A 4QOZB 2GVZB 1YWXA 1D09B 1FRHA 3POTB 4P73A 5HJYA 3AAWB 2X1FA 3E8OA 3IKMA 3PX4A 1NK4A 3IBWA 2AYGA 2GAHC 4UTGA 1DKGD 2QO3A 3MCAB 3BBCA 4ZJQA 4JOUA 3KK3A 3CJ9A 4J2BA 3O6QA 1ZS6A 5LMUF 1XNQJ 1WOOA 2QLJB 1GLAG 3HPHA 2YHAA 1FFWB 5EN1A 2W6KA 1O5JA 4LF9F 5I42B 4WP9A 2VBZA 3PVXA 3I0SA 3CE8A 5CXTA 4L76A 1KAYA 2F8TA 5C0YA 2CPHA 4IG0B 3HZ6A 4Z94A 1ASUA 4B1XB 1VSJA 3ILLA 5KFKA 4UW2A 1CQNA 3FSXA 4FWLA 1S49A 2GMLA 3HM8A 5EXWA 4FSVA 4K0KK 3QEIA 3SDEB 4KREA 3GPAA 4BHQA 1JXVA 1RACB 3I32A 5ETPA 3M2UA 4UY8T 4BRFA 1SS6A 1QVFM 4CGJA 3T3FA 2KHOA 4PWDB 1XJWB 4ATNA 3LGNA 2E2QA 1GX5A 4LF2A 3IDHA 4DTOA 2DEIA 1H7XA 3MECB 3SAHA 3QAUA 3OYAA 4YY3J 1HRHA 4FWRA 1VQMS 2VQFJ 3QEVA 2YNHB 2DIUA 2J9DE 2UXDF 4ED3A 1X4FA 2LDYA 4GC7A 3BUZB 1VK0A 2FVPA 5AQIA 3M1FA 3CDBA 2Z2ZA 1FFSB 1RWPB 3H5YA 3EUNA 1J27A 3NAHA 2FUG9 1KR4A 3KOAA 3LDNA 4ED6A 2X1GA 2R7RA 3CVKA 3HP6A 3DRYA 2O8CB 4A5AA 4NEZA 4DTJA 5KRSA 2FGOA 2BQRA 1JX4A 1EARA 2GO8A 3CD6S 3WEEA 5C2FA 2F7VA 1Q7YT 1S1UA 3T1YJ 3GFYA 4DHYA 3WXIA 3UDVA 4OYXA 3QDKA 4XPCA 1OPIA 4YDUC 4JI5F 5K9FA 1YBUA 3QJLA 1VOMA 1Q7LB 1LAWA 2RNEA 4BC2A 2H4WB 3Q7CA 4PYAA 2ERRA 1I6JA 4N41A 3BKFA 1KVAA 4HH1A 4NYFA 3IGVA 4L74A 1CJTB 3E1YA 3AGRA 3EN9A 2CA9A 4QWAA 4DR4F 3HK2A 1HQEB 1JLGB 4A57A 4LVOP 3W1YC 2CADA 3JQMA 4YNQA 2P9NB 3Q83A 2Y0SD 3TARA 5BPMA 5GIOA 2ASMA 3PIPQ 4CYUB 2OPQA 3VF6A 1SCJB 5FPEA 1DLOB 1I39A 2RPIA 2D9OA 5CAAA 1NZAA 3JQKA 1RHRB 1FDDA 4OJRA 4K4ZA 1WUUA 2Z1GA 1HD1A 1BI4B 1BUXA 4P6QA 3F44A 4CZCA 5CZ1A 2ZOGA 5JVHL 1S1WA 2RHKA 4ZPWR 1YJRA 1J6ZA 4GV3A 2E1CA 3VETA 4JYAK 2Z2LA 1AZSA 2PDAA 4FCYA 3ZZRA 2XI3A 5B0AA 2ZH2A 4MH8A 4N7TA 1T94A 2O4GA 2ZE2A 1Q79A 2DT9A 5EVZA 1WWHA 1T9YA 2VKRA 2AJ0A 5KFHA 1HNWJ 2VL1A 1UVMA 2J9DA 3M1VA 8RUCA 3MTJA 1WOPA 4H5TA 1Q9XA 2QWNA 4XK8C 2VOPA 4YQWA 2AZ1A 2PEHA 3L7UA 4ID8A 2MZQA 5IT0A 3JSMA 2UUCF 4OPAA 3NS7B 3VQDA 2K7KA 2XZTB 4DBQA 5AQFA 4A8SA 3BDEA 4EI2A 1LW2A 1HNXJ 2XWYA 3WUHA 1VQ8N 1BC6A 1QHTA 2ZC4A 4J9UE 4DTNA 3DLKB 3HHKA 1NDLA 4EMDA 2ZOMA 4Y1DA 2RHQB 3TSUA 1Q81O 2AD9A 4C4WA 5GAHU 1NK6A 3DU5A 3TI0A 3FZKA 5CA5A 8ATCB 4J2EA 2BV3A 3VEYA 1RAJA 2KN4A 4CK3A 3I5CA 1GEHA 1KQKA 5J2MA 5E3CA 4WFAQ 2ASYA 2LU2A 4IJNA 4DN0A 4U8VA 3W5XA 2J6TA 3CCQS 4B9MA 1UPMB 3ZTSA 2HGLA 4DR3F 3T5HA 2DY4A 4B9TA 1SJQA 3MMAA 1KP6A 3U3YA 3MPWA 4O4GB 1ZBLA 4CJRA 4TYAA 2G8VA 4LSLB 1ROFA 1BA1A 3DRRA 2WZ1A 1T3NA 2W24A 3L6QA 1FRKA 4O0JA 2QWPA 3THWA 3JSBA 2BKOA 1KN6A 2PE8A 1BHLA 1ICEB 4NI2B 1T3VA 3I9ZA 4WWSA 4I2PB 1NCLA 2IVOA 3LOUA 5KFVA 1ZM3A 3MPYA 4OLPA 5KG2A 9RUBA 3T1HJ 4LF4K 4CZEA 2VG6B 2VWJA 1HPZB 2W7OA 2DTUA 3M4XA 3G6XA 1S1VA 2FSKA 1Q8BA 4EBEA 2VFSA 4JI5J 2HQDA 2CDQA 4USIA 4FXVA 1OY8A 1BMQB 3GJQB 3BY5A 4X66J 3CCRS 1TP7A 1C2PA 2M2BA 3PV8A 4J8FA 1GQEA 4O3RA 2IMWP 2HVEA 2QXFA 5IQQA 4USJC 1RBAA 4PXBA 4OHVA 1HWUA 4RLEA 2YI1A 5KFZA 1U2FA 2D3O1 2QWRA 5AQKA 4JI2K 5DDOC 4BRKA 1DFDA 4LIRA 2OJ3A 3V9UA 4K2XA 1X4CA 1BY9A 3MCOA 1GXLA 2J0WA 5H1SQ 3C19A 2QL7B 5DK5A 2OPPB 3KHHA 3CCLS 4FL9A 3VEOA 2FZGB 1W9HA 2LFVA 5C10A 3V5RA 4HTLA 4GKKK 2DXEA 1JLBA 2ZH8A 4PKGA 3QGPA 2COLA 3KXDA 3TPQA 3OVAA 3O1BA 1DTTA 3KLHA 1LWEA 4CZFA 3R1HA 5MAOA 3VAKA 4C9DA 3R97A 4F0MA 1X31C 2UUWA 5CHCB 4MO4A 1NGHA 4HACA 1CZ9A 2D4WA 3THXB 3D2WA 2E5IA 3IM9A 2GVDA 4RJVA 2H5IB 3C16A 3N6LA 3CPWM 3TWZA 3OL6A 2LSNA 3QZ7A 5HRSA 4FF3A 2WOMB 5F8HA 1H3DA 1SIZA 1KTQA 3QSYB 3ZSOA 3RSEA 2EG1A 2CG8A 4USUA 2N7CA 2Z2MA 2A40A 3GSDA 1YKWA 5M1PA 3GG0A 3J7AN 3PSIA 3IO1A 4E7HA 3FEXB 3HPGA 1RCOB 3QO9B 4RR5A 3I56S 4DX5A 1NDPA 1RTIB 3WBZA 5J1EB 2X78A 3GL1A 4F50A 5KFUA 1UVKA 4DV1F 3QNNA 5KT7A 4CVNE 5GAHP 1TL3A 2FVQA 4DFMA 2XSJB 4DL3A 5KT5A 1CQMA 3OUYA 4E1NA 4FYYB 1R43A 3WX8A 5GAHI 4X4OA 3AA4A 3BGRA 5DZ7A 4NLTA 4BRPA 5F9NA 4FWQA 5KGXA 3CO9A 1TVRB 2P9GA 4JKAA 4FF2A 3G4SS 2UUAJ 2RUSA 1FDAA 1WSGA 2F8MA 2ILYA 4J9RA 3SIPB 2X6NA 3KHRA 3AY0A 4OZ3A 1U47A 2QMXA 3OJUA 1RDBA 5CYJA 3MEGA 4P71A 3CC2S 3OL9A 5G0RA 1MW7A 3GIRA 3U1NA 1MWMA 4DMZA 2LKZA 4LFCJ 2HIQA 4C8MA 4DR2K 4BQLA 2BM0A 2IRXA 4ISFA 4A8YA 4WIIA 4O3OA 2P9UA 4Z0UA 1O8BA 3ISND 4PABA 2IA0A 3L8BA 3BKUA 3NGIA 3ICLA 3FCWA 4ZN1A 1IKWB 2QV6A 3IGNA 3TR5A 4QU6A 5LT5A 1GMVA 1V3RA 1TK5A 3H46O 4OZ0A 3MMVA 2HHSA 3MWPA 5ETNA 1B3TA 4B1WB 2DNYA 3HVTA 3AJ1A 4DR5F 1BQNB 4LD0A 4BRIA 4DU1A 4JI4F 4FWPA 1FK9B 5KTQA 1VQKN 3MAHA 5AQHA 3RB4A 1A5VA 4WK1A 2Q2RA 4Q2LA 2R2TA 2PD1A 3M8RA 4K5RA 2FD2A 3A8YA 4CJ3A 3FMBA 1JLCA 3EE9A 5HLFB 4ISEA 3CJ0A 1IBMJ 1WORA 1UZDA 4BGAA 2R7WA 3ULEA 3FCVA 4C3KA 5IT4A 4DPYA 1VQ9S 4CFAA 5J2QB 2O8DA 9ATCB 1M1GA 3SZ2A 3Q2SC 3DI6B 1RCHA 1U1RA 3PY8A 4ZVUB 3OTOK 3MM8A 3C6AA 4CLTA 5HVFA 2GMHA 3GV8B 1UAXA 2MZTA 5L9NA 4KHUA 1U48A 2C2RA 4IH5A 1XC3A 4X65J 4RW8B 1Y4ZB 4EP4A 1RBRA 2EK6A 1X0FA 3MX2A 3IWXA 1C0TB 3M3ZA 5AZIB 2PZSA 2R7XA 3EMTA 2P8IA 4CLLA 1QE1B 2CYYA 1S6PA 2XMVA 1N34K 3VZIA 2XB2D 2EX3A 4EIAA 1TL1A 2XQCA 1NJIT 1IXKA 4DF8A 2JC1A 2AZ3A 3JAMY 4L3NA 3ZYYX 3MCSA 2D3ZA 4RWXA 3HD1A 3QFHA 1M90T 1AUDA 3VGSA 1KHVA 4BC3A 3SI8A 2Q1LA 2V8HA 1F9HA 4IFYB 5ELZA 3QLHB 1K47A 3BSNA 4B17A 2HFOA 1ZTTA 2A10A 2CQHA 5HBMB 4ED5A 4LVNP 3VAGA 1JKHB 2YKOA 4O0IA 4U7UK 2OMLA 1T95A 1XR5A 1UJ6A 3ZT0A 2N3LA 3TAQA 3MUMP 2H51B 4H03B 1JLQA 3QBWA 3M2VB 1RT6B 3H1VX 1O6XA 3O9UA 1O13A 2XS7A 3DN9A 2BW7A 4JI7J 2OO4A 4CO4A 3PKMA 2CH6A 4PL8A 2G8IA 3GLJA 4R8UB 1EX4A 2VA2A 2KU7A 5LMNK 2IIHA 1WAFA 3ULDA 4DV1J 4MKYA 3HSDA 2AYEA 5JVHQ 4DF4A 4PKDB 1DEJA 3CDWA 2IYIA 1PYOB 1FRLA 2R42A 1JJ2R 3C14B 3MN9A 2XMWA 1RWXB 3BYPA 4WP3A 2WBNA 1YK9A 5HP1A 2V7YA 4FZYA 2WAQD 5A8WA 1IG9A 4AQYF 3NP5A 4ZPDA 1HBMA 3C2PA 3VAFA 1GT8A 4JKBA 3T1AA 2G0JA 2NZ4A 4C48A 1HNZJ 4HI2A 3DLRA 4ECZA 3MMBB 5AJ3J 3RGIA 3Q7BA 2YV0X 1T6CA 1EQMA 5D78A 1MMLA 3QBXA 1QQMA 4OZ1A 1N5TA 2D0AA 4K8XA 4FWNA 2JHEA 1UEVA 3VPZA 5AXKA 1FJGF 2NYIA 3V6KA 3MFIA 5KOXA 4FVUA 4CBWA 1X0PA 4X4VA 1TUGB 3OW2R 1YIJN 5B0BA 4KE5A 4A46A 3SK3A 2ZD1B 4DFKA 1FDBA 3PLAA 1AFJA 2G8KA 5B0FA 5C7PA 3PZPA 4LSZB 3T7ZA 4OMFG 4MKVA 2BYCA 3RZAA 2ZWHA 3UVJB 3VQCA 1TKXA 2GJ2A 3WC2A 1VR6A 5D3GA 3NGUA 3VQ5A 1ZBSA 2DK2A 3AV9A 4NXMJ 3AQPA 2GO9A 4JI4J 3I4HX 2CNKB 2C42A 2HF4A 2E20A 4LT6A 4CEQA 4B9VA 5C12A 4P2MA 3QFWA 2F4VJ 2HQIA 4LF8K 4MMOA 4F67A 5E3PA 4OI2A 3W7BA 1RAOA 4AHTA 3R8EA 2F8SA 2MLYA 2HRYA 1YJNN 2E5LF 3C95A 3ZZTA 3ZT2A 5A8RB 3UD4P 2KFZA 3MEDA 4ZTJA 3TUIC 2AGOA 1VQSA 3AD8C 1FKOB 1JLFA 1YQHA 2GWJA 2Y1LB 2BJ8A 4Z4IA 2CJAA 4ER8A 1WACA 3H5XA 4DQPA 2MKSA 3OL7A 3LP3A 3R7SB 4ZJOA 1J54A 1F5CA 4DQRA 5FLXO 3JXUA