4RW7A

Crystal structure of hiv-1 reverse transcriptase (k103n, y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
554
structure length
538
Chain Sequence
b'MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 138
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw7A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw7A05
5DQIA 4LQ9A 1RT5B 1RILA 3OYBA 4W5NA 2X6SA 3U3YA 2J6UA 3OYNA 1RT6B 4BDYA 2Y1JA 4KSEB 4CF8A 4DFKA 3QGGA 3QGIA 2W9AA 1A5XA 2R2TA 4O44A 3PR4A 1KVCA 1WSJA 2WONA 3OHAA 4EP4A 3HVTB 4YFUA 3GV7B 1EP4B 5KFKA 4XPEA 1TP7A 4NZ0A 2JC1A 2ZD1A 4IBNA 1VSFA 3RB4A 4AHUA 3GV5B 1RT1A 4F4KA 4F4YA 4CEEA 3FQKA 3QEVA 3I5AA 4FJJA 1YTAA 4QAGA 1NK6A 1VRTB 2JEGA 2HB5A 4KFBB 4IDKB 3CDEA 2AWZA 4R8UA 1HNVB 5KFPA 2VG6A 3PZPA 4YNQA 4NLWA 3DRSA 4J9NA 1NK5A 2IMWP 4FM0A 2D0AA 1OS5A 3VQSA 1C1CB 4KPYA 4PUOA 2D41A 3PJWA 1S0OA 3PO5A 4GVMA 3TAEA 1I3AA 1UWBA 3GIMA 3KLEA 2ETJA 4Z4GA 3MR2A 3BSOA 3LPTA 4IQXA 4RUAA 3QNNA 5KFAA 1KLNA 4K4VA 2FJWA 3D45A 1RDDA 4CFDA 3L3VA 4ZVEA 1S49A 2VA3A 1J54A 5KFXA 4JRQA 1Q8IA 4KB7A 4HCBA 4CEQA 2D7SA 4GC7A 3FRZA 4CERA 2BANA 1DLOA 3V81A 3V6JA 3I0RA 4FLTA 2YNIB 3BSAA 2WTFA 4DS5A 1SL1A 3HJFA 3HM9A 4DTNA 3NH2A 1TAQA 3AVMA 3D5MA 1KFSA 4CCHA 4H4MB 1C0TA 3AA4A 2IS3A 1HNIB 3DLRA 2W9CA 5KFMA 3FSIA 3MF5A 4FLUA 1XWLA 4MK7A 5DG7A 3SQ0A 3V6KA 4OLBA 3LZJA 3T1AA 1HARA 3SI8A 3OYGA 4DSKA 4ECTA 3JSMA 4CEZA 4H54A 5SWMA 3AVCA 2E9RX 4URQU 1RCHA 1TL3B 1LWCB 1HQUB 4FLZA 3BSNA 3RAQA 2R2UA 4EP5A 1MU2A 3JYTB 1RTHA 2X78A 1RT4B 5HRPA 4CESA 3ZT2A 3T5KA 3DLHA 1S1WA 3OL6A 3F9KA 4TY8A 1KVBA 2D3ZA 3HXMA 3T5HA 2UVRA 4LD0A 3AO3A 3C94A 4Z4HA 1KLMA 1NJWA 3VQ7A 3CFOA 2X6NA 4ECVA 4W5QA 2DTUA 4NCGA 4ZTJA 2O4GA 1JKHB 1S9FA 3S3NA 3BDPA 3VQEA 1WSHA 3MEDB 2X74A 4FZYA 1HQEA 1JIHA 3TQ1A 5KT6A 4DQRA 4AHRA 3LP0A 1QTMA 4MIBA 3WNFA 1QUVA 1U47A 4CHPA 4F3TA 4DL5A 2B5JA 3G6YA 3OYDA 3Q8RB 4YP3A 1HYSA 4K4WA 1WSFA 3OL9A 1S97A 2I1RA 2VG7A 4CE9A 4Z4CA 4NCBA 4DTMA 2HMIA 3HVWA 1ZTWA 5KT5A 1KSPA 3UR0A 4C8MA 5K14B 4MIAA 2HAIA 5HROA 3H4BA 3GV8B 3Q8SB 4TSXA 1TAUA 4CGHA 4ICLB 2RDIA 3OLAA 4ZHRA 2W9BA 4DWIA 4CJ3A 2JEJA 1RA7A 4FCYA 1IKXA 4J2EA 5J1EA 3HP6A 1IKVA 2F8EX 3AO4A 3N6MA 4I2QA 2E9ZA 5KG3A 3NGYA 5DK5A 3V9UA 3ZT0A 4CEOA 4CJTA 4QOZB 2IGIA 3N6LA 5FDLA 2G8IA 4IG0B 3RRGA 2HVIA 1ZBIA 5C25B 3DI6B 1R0AB 4FJGA 1RNHA 1EETB 2G8WA 4FK2A 3M8PB 3CO9A 4RW4A 2DFEA 4CHQA 4DTPA 3L2WA 2CJQA 2BE2B 4PA1A 4TLRA 5KFJA 5C42A 1NKCA 4F2RA 3KK1B 4B9UA 2R7YA 4QPXA 1RYRA 3PW2A 1GOCA 3NF9A 3NF6A 4R0EA 5L1IA 4CJPA 3DRRA 3I5BA 4RW8A 2R8HA 5KFVA 3K5LA 3VN5A 2OZMA 4TXSA 2ILYA 5C24A 4G1QA 4M45A 4UQGA 3HPHA 4B8AB 4M3UA 4HUGA 1IKWA 1RAJA 3KHRA 2BRLA 3MXIA 3ITHB 3PO4A 2QXFA 4Y34A 4HHTA 1TL1A 1ZTTA 2BDPA 3M9NB 4JV1A 1SUQA 1JLGA 3O4NA 1BL3A 3KLIA 3KK3A 4Z0UA 2VA2A 4FW1A 3AVJA 4NYFA 3CVKA 4RNHA 3PW4A 4W5TA 1S1UA 3A2FA 1SV5A 5FROA 3E01B 2HHWA 3MEEB 1RBVA 2RF2B 4URGA 1U09A 1RTIB 4O4RA 1KHVA 2FC0A 1RBUA 1RTDB 4N47A 4BWMA 1QSSA 3VQ6A 4ECYA 4F4WA 3RMAA 3CJ5A 2GUIA 4CJEA 4E7IA 2XI2A 4OGEA 3QETA 4FJ5A 4WFYA 2F8TA 1VSLA 2ILZA 4Q0BB 1NK9A 4FJNA 5J2NA 4QWDA 5KT3A 4TN2A 3AA5X 3VQAA 3CYMA 4K4UA 3M9MB 2G8UA 2RPIA 4CECA 4FLXA 3GYNA 3CJ3A 1J9AA 4Z4FA 5KFHA 1UA1A 4Q5VA 4EZ6A 5I3UA 3LP2B 4DTRA 3CJ0A 4DFJA 3V4IB 3CWJA 3MECB 3NE6A 3TAMA 2R2RA 4TY9A 4BWJA 4MFBB 1D9FA 4J9KA 3V1OA 2AU0A 1LW2A 3G6VA 4E7KA 4YQWA 5CYMA 4OGCA 1RA6A 2Z1HA 1J5OB 3ISNC 1RT7A 3TAPA 4ZMMA 1QS4A 4OKJA 4W5RA 2AQ4A 3B6OA 1JXBA 4E89A 4AHTA 1HMVA 1U49A 2JEFA 2IM3A 2C2DA 3L2QA 4KO0A 4DSIA 4CFAA 4JUZA 3DLKB 2YNHB 5DLGA 1KHWA 4RNOA 5J2MA 1HYZA 2DY4A 1SKSA 4FK4A 4EO8A 4IKFA 3AVGA 4J9RA 1ASWA 4CJLA 3SNNA 1WLJA 4CJ5A 1RBSA 3IAYA 1EKEA 2YNGB 2A1RA 1IKYA 3SCXA 3BGRB 4DS4A 3HPGA 1RT3A 3IG1B 2HWIA 3AA3A 1BQMB 3KJVB 1S6QB 4O4GA 4KB1A 2XGPA 3KLGB 4LSLA 2HNZB 2B43A 3KK2B 2RDJA 4J9OA 1BI4A 4DMNA 1T7PA 1IO2A 1A5WA 2ZKUA 5KG5A 4ED6A 4ZPAA 2WRMA 3NBPA 3LP1B 3EZUA 1S48A 1S9EB 4ED0A 2GIRA 1VSHA 2AGOA 1TKTB 4IFYA 5J2QB 4I9QA 2E4LA 3KMQA 5CYQB 2Z1IA 4CHNA 4ZP7A 1QHTA 5J2PA 5KT4A 3QERA 5HBMA 2XY7A 3I0SB 3AVAA 3CG7A 2OPRB 3G86A 2FBXA 3DRPA 4KTZA 4J9SA 5HRRA 3SYZA 4O55A 3NGIA 2G8HA 4L8RB 2C22A 1N6QA 4FS1A 2Z1GA 3DOLA 4HVJA 1LW0A 4X2BA 1Z25A 3SV3A 1NK7A 1CSJA 2HHQA 1N5YA 4KV8B 5F9NA 2AGPA 4FLWA 5JUMA 2BRKA 4I7FA 4DG1A 4WZQA 3NF8A 4DSFA 3PJXA 4DL4A 3SQ1A 4K8ZA 3LAKA 4LSNA 5F8HA 4I2PB 3QO9B 3VQ5A 1REVA 1JL1A 1LAWA 4CJRA 4WE1A 4DTUA 1G15A 1RTJB 5KFSA 5HLFB 4JS5A 2OPQB 3ZSVA 3RWUA 1FKOA 5F8NA 4DTJA 1VSJA 3K5OA 4RNMA 2CKWA 3NGDA 3AA2A 3LPUA 3S9HA 1BIZA 2OPPB 1D9DA 4K4TA 1NKEA 1YVFA 2P1JA 1LV5A 5L1JA 1GX5A 2IBKA 1S4FA 4IG3A 3CM5A 3HKWA 2FVCA 4DTXA 2R8IA 1TQLA 3OYFA 4QW8A 3TABA 4ECSA 1EP4A 3AVLA 3TAGA 5F9LA 4F4ZA 1B92A 4RZRA 3UPFA 4ED3A 1JLBA 4G3IA 2QKKA 3QEXA 4KFBA 5E41A 4TQSA 3LALA 3MEGA 4CEBA 1N4LA 3ZSZA 3OLBA 3DOKA 1T03A 5F8IA 3S3MA 3M9OB 4KHYA 2GC8A 1RDAA 3QLHA 5L1KA 3KHHA 2KFNA 1S1TB 4KKOB 1RT1B 5KFZA 4ZVFA 3ZSQA 5KFGA 1S0MA 4DQQA 1JLAA 3HK2A 1UOCA 3QIPB 3IS9A 3OSNA 4DFMA 2O4IA 5KG2A 4AHVA 4CEAA 4RW7A 3V1QA 2VG6B 3DRSB 4OLAA 3K5MA 5HP1B 1LWEA 4MK8A 3T5LA 5F8GA 2YHBA 1L3SA 4YR0A 4PUOB 2E6LA 2HW3A 4B3OA 3MR3A 4WYLA 3M8SA 3OL7A 2W42A 3KNAA 2Q3SA 3P5JA 4CJ4A 4NLYA 2O5DA 4ZVHA 1TVRA 5HRNA 3CJ4A 3T19A 5DQGA 3DMJA 4DL3A 3CJ2A 1WSIA 1HNIA 2WOMA 3LDSA 2YV0X 4E0DA 3AVNA 3GIIA 3QEWA 5D3GB 1DLOB 3V81B 4KHNA 4EYIB 1VK0A 3BQ1A 5DQHA 2LSNA 2JEIA 1JLEA 4W5OA 4Q43A 1JLCB 4KAIA 1C0TB 1RDRA 3JYTA 4BDPA 2YKNB 5F8MA 1T94A 2W9CB 3P83D 2KW4A 4DQIA 2IOCA 5KRTA 4XIUA 2VWKA 1WAFA 3HSTB 3JSMB 4RG8A 2R8JA 4O3OA 1GOBA 1HPZA 4O3NA 5DG8A 1SL2A 3VA0A 1RYSA 2G8FA 3O3FA 4N76A 4J2BA 1TGOA 4J9PA 1TV6A 2DPIA 4K50A 3M8QA 1JKHA 4CFBA 4DLGA 4KHMA 1ZBHA 3RTVA 4ECZA 2A1SA 3ZSYA 1KLMB 3U6FA 4ID1A 3MXMA 4FBUA 2F8SA 4U6PA 5KFRA 4NCGB 4EYHB 3V6HA 1Z26A 2G8KA 3NL0A 4M3RA 3H59A 2YNFA 5KG6A 1C0UB 5KFCA 3VQCA 2BQ3A 4FZZA 3IN5A 3HPOA 3V9XA 1NOYA 3ICLA 4LH5A 3OS0A 1S1XA 3G10A 5K14A 2UUTA 2P51A 4PQUA 3KLFA 3QIOA 4ICLA 1S1VA 1L3VA 4ELTA 3CIZA 1SKRA 2B5JB 2FVSA 1BGXT 1JXLA 3ZT1A 1HYSB 5T14A 4R5PB 2KZMA 2RKIB 1LWFB 4NLXA 3SUQA 3RBEA 4KHSA 4CGFA 3RR7A 2HMIB 1KVAA 4LY7A 4B9TA 1C1BB 2FVQA 1T3NA 3FFIA 5HROB 4PWDA 2FLLA 3SQ4A 3OL8A 4ZHRB 1X1PA 3I5CA 4RU9A 2R2SA 4MKAA 3N6NA 3MXJA 1R0AA 4KE5A 4HUEA 1S9GB 3K2PA 1IKXB 4CIFA 4ZP6A 1IKVB 2W7PA 1IM4A 4RW6A 4ED2A 3QEIA 3M8PA 2QV6A 4I2QB 4TQRA 3U3GA 1SKWA 4H4OA 4CF0A 2BE2A 2XY6A 4M95A 4E7LA 2YKMB 4Y1DA 5F8LA 2E9TA 1S5JA 1ZYQA 4KRFA 4OPKA 1NK4A 4CK2A 3D28A 3GQCA 3T5JA 1QSYA 3GILA 3PW0A 3OYCA 3T3FA 1NK8A 4QWCA 1HYVA 4ECQA 5KFQA 3MFHA 4BDZA 3IGVA 2WHOA 4RW4B 1CZBA 3ISND 4RW9A 2WB4A 1NJZA 2FBTA 4FYDA 2EC0A 4KTWA 4CF2A 3AVIA 3AVHA 5C42B 4J2DA 4M94A 1N56A 4NYZA 2KZZA 2FLNA 1FK9A 2R8KA 5KFTA 3M8RA 1NHUA 1TK0A 2OPSB 5KFIA 4K4SA 2QE5A 4FM1A 3LWLA 3BQ0A 4IR1A 2VWJA 4IKAA 2AX0A 1B9FA 4G1QB 3V9SA 4M3WA 5KT7A 4DLEA 4B9VA 4Q8EA 2ZE2B 1ZETA 3E01A 3MEEA 1NNDA 4KI4A 2RF2A 5KFFA 2BGGA 4FLYA 1RTIA 1JLQB 5DLFA 1DTTA 4DEZA 1JLGB 1RTDA 4E3SA 4C8KA 3HVAA 4DL2A 2VG5A 4FLVA 2XCPA 3KLIB 3KK3B 3QESA 4N41A 3PR5B 4CGIA 2XY5A 3G0ZA 1SV5B 4FJLA 3DM2B 3TAQA 4DF4A 1VSDA 5C5JA 4B9MA 3LP2A 4DTOA 1NHVA 3I8DA 3CQ8A 4C8LA 3L8BA 3CFPA 4IRCA 3HL8A 3UDLA 1BQNA 1ZBLA 1K1SA 4EBEA 2JGUA 2HNDB 4HYKA 3KTQA 3PUFA 5CY4A 4DF8A 2EX3A 3DLGA 4NLVA 3OJSA 4IFVB 3TAMB 4WXWA 5KFUA 4F4XA 3RRHA 5EWEA 3RMDA 1VRUB 3OYIA 1LW2B 5KFOA 4CF1A 4ZVGA 1NJXA 3PW7A 4JS4A 3QYYA 3V9WA 1NOZA 4DU3A 3DLKA 2YNHA 1TKZA 1RT7B 3QGHA 2I5JA 2IAJA 3VQQA 3DYAA 2D3UA 3O4QA 3AVBA 4XPCA 4FJ7A 1YTUA 4ID5B 3DLEB 3ZSRA 2IC3B 3BGRA 4LH4A 1HMVB 3IG1A 4NLPA 2XY8A 2P5GA 5SZTA 1CXUA 4ELVA 3K57A 3IGNA 3VQ9A 4EO6A 1S6QA 3NCIA 1FKPB 3KLGA 4EBDA 2JC0A 4N56A 4NLUA 3HO1A 3LP3A 1T05B 3NAIA 4J2AA 2B6AA 3SUNA 1Q9YA 4DFPA 3RMCA 4DSJA 3H40A 4WFZA 1IKYB 4FW2A 5KFBA 3OYAA 3UQSA 4CIGA 1TKTA 4KHQA 2HHTA 1S6PB 2WCXA 2HNYB 1QE1B 5CYQA 2V9WA 1X9WA 2J6TA 5JS1A 1CXQA 3I0SA 3SFUA 3QINA 3RR8A 1ZBFA 2RN2A 3NBPB 2UVWA 2WK4A 4BACA 1RT2B 4E1MA 3BQ2A 3L3UA 1ASUA 3LWMA 1VSMA 4F2SA 3V6DA 4IFYB 4IH5A 3SQ2A 4F50A 4OL8A 4BE0A 4KHWA 5I42A 1XR5A 4Y2AA 4Q44A 5J2PB 2F96A 3C6TA 5HBMB 4ECXA 3MR6A 1HRHA 3AVFA 3OYKA 2FBYA 2ASDA 1UA0A 1EXQA 2XI3A 4GW6A 1DTQA 1GOAA 4FJIA 3VA3A 3DRPB 4F8RA 2BR0A 1LAVA 3C6UA 1TKXB 1N6QB 1LW0B 3KLHB 3TWHA 5HLFA 1RT5A 2OPQA 3NDKA 1N5YB 4E1NA 1Y97A 1RT6A 1RDCA 4E7JA 5FRMA 4I7FB 2R8GA 4LQ3A 3TI0A 4XO0A 3IRXB 5EWGA 4NLRA 3MTKA 4YR3A 2C28A 3KOAA 4IOBA 4AILC 5EU7A 1REVB 1JLFB 1W0HA 2FBVA 4ED1A 1RBRA 4WE1B 4CK3A 3CFRA 4RUCA 3HVTA 4M3ZA 1XR6A 1FKOB 3V1RA 1NJYA 3PHEA 5KFNA 4JLHA 3OYEA 3F73A 4Z4EA 4DQPA 2XRIA 3AO2A 1VRTA 5DGBA 3KIOA 1U4BA 4IDKA 3RB0A 2XO7A 4B9NA 4IG3B 4O44B 1NKBA 1HNVA 3DLBA 1CLQA 2WONB 5T7BA 4WZMA 4IH6A 4CFCA 4CK1A 3O3GA 3SFGA 2ZD1B 3VQ4A 1WSGA 4I9LA 2PZSA 4OJRA 1JLBB 3BR9A 1S1TA 4KKOA 1C1CA 2ITGA 5KG1A 1CZ9A 4DSEA 2DFHA 3NGZA 2FLPA 3RMBA 3QNOA 4KBIA 1J53A 3QIPA 3RB3A 4E19A 3NFAA 2YHAA 3MEGB 3VQ8A 5KGXA 4R8UB 3DOKB 1T03B 2C2EA 4B9SA 1BISA 3OYJA 5HP1A 3L2UA 3QEPA 3QLHB 3PVXA 3LZIA 3KLVA 4DU1A 4FK0A 2KFZA 2W8LA 3H08A 4Y3CA 4E7HA 1XC9A 1WN7A 3VQDA 4DSLA 4O3QA 1UWBB 2G8VA 1SH2A 3KLEB 1JLAB 3V9ZA 1Q9XA 4O3RA 4Q45A 3IS9B 4IR9A 2OH2A 3TVKA 3ZSOA 2YNIA 4K4ZA 4RW7B 2BQRA 4NYNA 2XHBA 4FJMA 4H4MA 4H8KA 1LWEB 4HKQA 3H4DA 4CJWA 3L2RA 4M3XA 2C2RA 1RDBA 5CZ1A 3UIQA 4WXOA 1VSKA 1VSIA 4KAZA 2E6MA 1F21A 1VSEA 5D3GA 4B3OB 4B08A 2GIQA 2BANB 5JXSA 4NLDA 3I0RB 3CDUA 1TVRB 4FZXC 1D8YA 1TL3A 1LWCA 1JLCA 1HQUA 4ZP8A 3DMJB 4JV2A 4FS2A 1QSLA 2PYJA 3EPIA 2YKNA 4QWEA 2P5OA 4J9MA 2WOMB 1RBTA 2FVRA 2HVHA 4ZPDA 3FQLA 1XI1A 3AVKA 3EY1A 1RT4A 3QZ7A 4CJQA 1C0MA 5DMRA 4OVLA 3G6XA 5HRSA 4JRPA 3KMSA 2ZQBA 1JLEB 2JLEA 5KRSA 1T8EA 4QW9A 3ULDA 4EEYA 5KG0A 1MU2B 2HHUA 1RTHB 4CIEA 3WNHA 2Z1JA 3AO1A 2AJQA 3H5XA 3GIKA 1IH7A 1KRPA 3MEDA 1S1WB 2IM0A 4TY8B 5L9XA 3FDSA 2XCAA 4O5BA 5KG7A 1HPZB 4GMJB 1TK5A 3OHBA 2FJXA 2HWHA 1TV6B 3S3OA 3M8QB 3THVA 1KCFA 3ZSXA 3NAHA 5KFYA 4DQSA 2V4RA 1C0UA 1ZBUA 3WNGA 1K1QA 3KKSA 1W9HA 5KTQA 1NK0A 3PX4A 2DPJA 1U48A 5KT2A 3PW5A 4K4YA 4OKEA 4DL7A 2IM2A 1HQEB 3HHKA 2XWYA 2PY5A 3LP0B 4Y1CA 2QKBA 1D0EA 4DU4A 5KFEA 1JL2A 4EBCA 3KHLA 2IJNA 3RB6A 4R5PA 4URSA 2RKIA 2FJVA 4IH7A 2ASJA 1LWFA 3BREA 4GC6A 2YNFB 2VG7B 2IJFA 4FXDA 4CGDA 2ATLA 1C1BA 3OSPA 1S1XB 1WAJA 3SPZA 3KD1E 4PQUB 3KLFB 1S1VB 3NH0A 3VQPA 1XHXA 3D0PA 4KREA 3HT3A 5DG9A 2W9BB 4M41A 1BIUA 4IG0A 1S9GA 3C95A 2OZSA 5C25A 3DI6A 2KTQA 1L5UA 5J1EB 1EETA 2V4QA 3LANA 4BE1A 3SUPA 1ITGA 3OVNA 3FFIB 2J6SA 4PWDB 4CGJA 3OYLA 3SI6A 4OKKA 4HUFA 2YKMA 4DL6A 3H5SA 5FDLB 3KK1A 1U04A 2KQ2A 4CJKA 4WYWA 1HJRA 4MQ3A 4FVMA 3E51A 2OYQA 4RW6B 3K59A 4M3TA 4H4OB 4CJFA 1QQCA 3BJYA 5DGAA 2HHXA 4ZPCA 3SZ2A 4ECWA 2IDOA 4U7CA 4N5SA 4IRDA 3HVRA 4TYBA 3ITHA 1FXXA 4O0JA 4YR2A 1X9MA 1I39A 2OPSA 4CF9A 4FJ9A 2W7OA 5F8JA 3DRRB 3Q8QB 2IM1A 4CJVA 1QAIA 4RW8B 4ZTFA 4RW9B 4O3SA 4CGGA 3ZT3A 4KHUA 3MR5A 1O1WA 3RBDA 3TANA 1WSEA 4AHCA 2XC9A 1MMLA 5C24B 3VQBA 1IKWB 2ZE2A 3PX6A 3P1GA 3SPYA 3CDWA 1FK9B 4IRKA 1YT3A 1JLQA 4ED8A 4FM2A 1TL1B 4HTUA 4NRUA 2UVVA 4DTSA 4NLGA 4AHSA 4CJUA 1ASVA 4CJSA 2HHSA 1SUQB 4CHZA 4J9LA 4FJXA 3EYZA 5L1LA 3O3HA 3GIJA 4NLSA 3LAMA 5KFLA 1JXEA 4Y2CA 1GX6A 4Q0BA 1S1UB 1TK8A 3DM2A 1Z4UA 3ALYA 4WFXA 4HCCA 3H5UA 1DTTB 5KGWA 3CM6A 3PV8A 2VG5B 3V4IA 1S0NA 3MECA 4MFBA 4O3PA 3SUOA 3MFIA 4C8OA 4B9LA 1D5AA 3AV9A 4F3OA 2UUWA 5FRNA 5J2NB 3PX0A 4ED7A 5EDWA 2HNDA 1BHLA 1J5OA 1SH3A 2AGQA 1SH0A 4C8NA 3SJJA 2BQUA 5I3UB 4IFVA 4JV0A 4ZP9A 4YMEA 4CEFA 3RAXA 3B6PA 2W8KA 1VRUA 4MK9A 4AH9A 3SV4A 1BQNB 5CYMB 1A5VA 2XGQA 1D1UA 5KI6A 4K4XA 4QWAA 3OS1A 1JX4A 4CEDA 3EPGA 1WNSA 3DLGB 4ID5A 3DLEA 3OY9A 2IC3A 2DFFA 5KG4A 4MKBA 1BCOA 2YNGA 1WNEA 1KTQA 3KHGA 3ZSWA 2UVUA 3NKYA 3HP9A 1B9DA 4KO0B 1BQMA 1W25A 1FKPA 3KJVA 1C1AA 4B8CA 4ECUA 4O0IA 1S10A 3TARA 4KI6A 1TKZB 2HNZA 1T05A 4QCLA 5J2MB 3KK2A 3K5NA 1C6VA 4CHYA 4TYAA 1L3UA 2I5JB 2IAJB 2ALZA 3K58A 3DYAB 4NRTA 4FJHA 1YVUA 2ASLA 3LP1A 4PY5A 4M3YA 4Z4IA 3H5YA 2Y1IA 3MAQA 1U45A 2D0BA 1TKDA 1RT3B 1S9EA 4M42A 1S6PA 5EWFA 3WNEA 2HNYA 2B4JA 5J2QA 1QE1A 4NLTA 4MH8A 4O4GB 3NHGA 3DDKA 3L2VA 4NLQA 1I6JA 2NUBA 4LSLB 4RNNA 2B6AB 2IA6A 1BI4B 4ELUA 2D5RA 3KD5E 3Q8PB 4ECRA 5CZ2A 3OJUA 2OPRA 4FBTA 5KFDA 1QAJA 1EX4A 1SL0A 1RT2A 2D0CA 4J9QA 2GV9A 2V0NA 4OPJA 3QIDA 4CHOA 2FVPA 4KHRA 4NCAA 3QZ8A 1K6YA 2ATQA 1KFDA 3NMAA 1X9SA 3TAFA 4BE2A 4QWBA 4K8XA 4KTQA 3NF7A 4Q8FA 3AO5A 4KV8A 4FJ8A 3NAEA 4RNFA 1N48A 5EUHA 4EZ9A 3ZCMA 3ZT4A 5KFWA 3V6DB 3OYMA 1L3TA 1C2PA 1TKXA 5I42B 4I2PA 3QO9A 3OS2A 3KKRA 3NH1A 3H98A 5JS2A 1BCMA 3KLHA 3C6TB 3DOLB 1RTJA 3BSCA 3PY8A 3HYFA 3H2LA 2HHVA 3ASMA 2OA8A 3OYHA 2AX1A 3EZ5A 1DTQB 4ZPBA 4FJKA 3IRXA 1UAXA 1IG9A 2QK9A 4DG1B 4NLOA 2EHGA 2GBZA 2PYLA 2OPPA 1XHZA 4KB0A 3C6UB 4LSNB 3TR8A 1JLFA 1XR7A
chains in the Genus database with same CATH superfamily
2P6TA 2O8DA 1NB7A 4LQ9A 3SCJE 2BJ8A 3V2UC 3OYBA 4W5NA 2ZJRL 5M1OA 4H5NA 2V68A 2Y1JA 5K8MA 1SS6A 4MYUA 5HAOA 3H1VX 4CF8A 1Q82T 3MM8A 2JNJA 2QFJA 4JI3J 3GWCA 2OEKA 3G25A 1J2VA 3R5AA 2CZ9A 2W9AA 2R2TA 4O44A 1WSJA 3OHAA 3EE3A 1N32F 1KVKA 2JC1A 3UE2A 2ZD1A 5F0XA 1VSFA 3M6WA 5CZVA 4F4KA 3PKMA 3SSQA 4FJJA 1XN9A 3RBXA 3P31A 4OI3A 1TFYA 2BE9B 2WBNA 2HS0A 4YORA 2FJEB 1QQOA 5KFPA 1CJKA 1D9AA 4BVOA 2F7VA 1NK5A 2AJ1A 3C3LA 3UKRA 2RE2A 3CJAA 5L9NA 1C1CB 1S0OA 1KKHA 3H45C 3GIMA 4JI0F 3KLEA 5AR0A 5A76A 4Z4GA 2C3OA 2DR5A 2N3LA 2ASMA 3OFGA 3BSOA 3M2VA 3ZZUA 3PG9A 4IQXA 2ZBIA 4RUAA 1CLFA 3QNNA 4Y2IA 3UD3P 1BUPA 3L0QA 3K7RA 1T9YA 1GK8A 1RDDA 4Y2MA 3PIOQ 3L09A 3L3VA 1J54A 3DDIA 4JRQA 2CG8A 2LDYA 1FTRA 3GG4A 3CMEN 1XEZA 1OVYA 2HFUA 4CERA 3LDPA 1MNEA 3FZFA 2WTFA 4DS5A 5KOWA 2BVZA 2MZ1A 1SL1A 3HHLA 2E1CA 2M8HA 2MYFA 1TAQA 4H4MB 5C15A 2UXCJ 3TTDA 2A10A 2HLUA 1F9EB 3NGSA 3DLRA 3OR1B 4A2BA 4MK7A 3SQ0A 2WAQD 1JJHA 4DSKA 1VK3A 4ECTA 4RBUA 4L3NA 5SWMA 3AVCA 1TL3B 9ATCB 1HQUB 4FLZA 1F5CA 2R2UA 4UUWA 4BRQA 1QDUB 1MU2A 3FBCA 1EQYA 1X4DA 3P3DA 3MN9A 4CESA 1S1WA 3F9KA 1VMBA 1Q1KA 2D3ZA 1ESVA 3AO3A 4ENOA 4LIRA 3RGIA 5DM7Q 2RE1A 3H25A 4ECVA 4B3SK 2J4RA 5AJ3F 2CQDA 4KGMA 4TKTA 5CYJA 3VF2A 3BDPA 2NXUA 1RAAB 1H7XA 3T41A 4BY9C 2JHEA 1T11A 1JIHA 1C4CA 1SC3B 2A3ZA 4FPRA 2UV8A 2V50A 1HNZJ 3HDSA 2DGOA 4DL5A 1HYSA 4K4WA 2F9TA 4FKYA 4RX6A 2I1RA 4NCBA 2VIHA 4Y65A 1KSPA 1ZXOA 2HHHF 4CZJA 2GJ2A 2MTLA 1W97L 1XC3A 4TSXA 2GS8A 4PG8A 2RDIA 1Q95G 3P4UB 2WZ1A 4DWIA 5JJBA 4J8FA 2RHSB 1BWFO 2HMPA 1NPRA 1GTHA 2KKZA 3CXCR 2ZZNA 5BRHA 3BBBA 5ADXA 2HBJA 3NVMA 3NGYA 5DK5A 4CEOA 4JI2F 3OTEA 4QOZB 4N7TA 4HHUA 4MLHA 5FDLA 2JWNA 3A5LC 3RYLA 1ZBIA 4FPAA 2FYXA 3EVWA 2VFSA 1XTZA 4GVEA 3OTOJ 3M8PB 2XNQA 2DFEA 2QLBB 3L2WA 2CJQA 4ITSA 2HBLA 2D3OR 4TLRA 2H51B 1R8BA 1VR6A 2ZWOA 2DGSA 2F4VF 5KFJA 2KT3A 1UVMA 4QPXA 2LA4A 1TYQA 3WHIA 3NF6A 4R0EA 3HD1A 3KUHA 3K5LA 5ADZA 2DEIA 4BBYA 1RBOB 4DR6K 3ZETB 2MKSA 1IKWA 4LFBK 2D1KA 3HF5A 1RDUA 1S79A 4HHTA 1ZM4A 3M6VA 3THWA 4JI8K 1TL1A 4B1YB 1ZTTA 2RU3A 1U26A 3M9NB 2Y8YA 2J7KA 3O4NA 3GJSB 1YJ9N 1LXNA 4H4KC 3KLIA 3CDAA 3UKUB 1MMDA 5GAHI 5B0DA 4FW1A 2WSCC 3WEEB 4KRWA 4HH0A 3CD6N 4W90B 2QMUB 4QZVB 1RBVA 2RF2B 3GDQA 1U09A 3PSIA 2WSEC 1KHVA 3QBXA 2DY1A 1DZ5A 1RFQA 2JH3A 3VQ6A 2ALYB 2M70A 5IC6B 4F4WA 1M90O 1U6BA 4E7IA 4OGEA 1UFWA 4PCQA 2W2PP 2F8TA 1VSLA 2IVPA 4Q0BB 1NK9A 5J2NA 3OXLA 1OYEA 4I69A 4QWDA 3TR5A 4TN2A 3JTOA 4U8YA 3M9MB 3EGVA 3VGLA 3RW6A 3L6QA 3CJ3A 3CW2C 4OJHA 2VQEJ 3VOVA 1UA1A 2JFKA 2GEMA 2AJ2A 2FB0A 1S7HA 3MECB 1SJ4P 4TY9A 1CG2A 2DR9A 3O9QA 4J9KA 4FF2A 4UZBA 2F40A 1R8CA 3G6VA 4F26A 1N33F 5AQMA 2GFFA 4DOZA 4C0BA 1FERA 2ZC3A 3TZXA 2Q6BA 1QS4A 1B99A 3FBEA 4KH4A 3QAUA 2DXFA 4AHTA 3L2QA 2BYCA 2UU9J 4JUZA 2XMAA 2YBVA 1X4GA 4AL7A 2DY4A 2VZ9A 2VJUA 1NLVA 2YXLA 4FK4A 1TFWA 3AVGA 2Z0GA 4C6AA 1WLJA 2BV3A 3IAYA 3SBGA 4FF1A 5LMUF 3HLUA 1IKYA 2QSWA 2MGZB 2EFOA 1RT3A 3D68A 2XS5A 2HWIA 2XULA 3AA3A 1BQMB 4DV1K 2HBMA 2HNZB 4QIEA 1SI9A 2B43A 2RDJA 1J6ZA 3MZIA 5I3PA 1FJGF 4ZPAA 7FD1A 3EZUA 4HL9A 3T1HF 1TKTB 4I9QA 3CCMN 1S5ZA 4GKJJ 4DV4J 5CYQB 3DXKB 4XK8C 5HBMA 3LPEA 3SLCA 1WUAA 4M5LA 4B3RF 2FBXA 4DJBA 4KTZA 3J81O 4J9SA 1UCNA 2FHKA 5AQFA 2GVDA 3SYZA 4DR2J 1X4FA 3CMES 2G8HA 4L8RB 1N6QA 5D77A 4LSZB 1HBUB 2Z1GA 3HZGA 4HVJA 4LRDA 4CQ1A 1Z25A 2IVYA 2RAQA 1Z6RA 3E8OA 1RAGB 3A8JA 4IJNA 2WVBA 4FWQA 4DG1A 1S22A 4PKGA 3PJXA 4K8ZA 3BY5A 3J7ZO 3IDHA 4LSNA 5F8HA 3QO9B 4PG6A 2RQCA 3VQ5A 3QT5A 3TVYA 2E5GA 3MCMA 3POTB 3R8EA 4DTUA 3VTIA 4H0XB 3ZSVA 3RWUA 4R79A 4OI0A 3LPUA 3S9HA 5AQVA 1BIZA 2OPPB 4JV5J 5LMNK 1GX5A 2E7WA 4ILHA 4J5OA 3CM5A 3HKWA 2FVCA 4DR1F 4DTXA 4ECSA 1W7WA 2HFZA 2DYAA 3UPFA 4ED3A 1VLOA 2CJKA 1DQ8A 2LXUA 5B8HA 4X62K 3KK7A 1M90T 2DEJA 2ERRA 4CEBA 1SJ3P 5FPMA 3ZSZA 3OLBA 4MDAA 1T03A 3QATA 2RNEA 2GC8A 2BW2A 3IAM9 3KHHA 1S1TB 4KKOB 1IQZA 2E5LJ 2HFVA 1ZOTA 4P2FA 4P2XA 1V3ZA 3LL3A 2GV1A 4OHVA 5KFGA 3AGKA 3HK2A 3L7OA 3IS9A 1K44A 3C66A 4AHVA 1ZC6A 3V1QA 3KUGA 4JAXA 5HP1B 4MK8A 1HBNB 5F8GA 2YHBA 2NRXA 4YR0A 3CJ1A 2XLJA 4NA2A 4PUOB 1WSRA 4BQLA 3CIPA 4B3OA 3KNAA 2Q3SA 3TA0A 4CJ4A 3S6EA 2Q0RA 1OKJA 2O5DA 4ZVHA 3VAFA 3MMCB 2G2ZA 2UXDF 1XUPO 1P1TA 2KM8C 2C3YA 1PBUA 2W24A 5HRNA 3T19A 4OIXA 3UN5A 3VGUA 2Q97A 2ASOA 3G6EN 2ZBRA 3OFFA 1XJWB 3FE1A 1QQNA 4E0DA 3GIIA 2QXLA 3R2DJ 1DLOB 3V81B 2R7VA 5ETNA 3VV2B 4LF9F 1VK0A 3BQ1A 2VB6A 2FJDB 3MOZA 4Q2LA 4BG8A 4Q43A 3CCWA 1A0OB 3CJKB 5F8MA 1BOTO 2W9CB 4UF4A 4DQIA 4BG9A 3U9ZA 3JTNA 1HBOB 2X7IA 2LEPA 4C8ZA 3W65A 4O3OA 1GOBA 2BABA 2RJZA 4TVAB 1FX2A 2WBRA 4J9PA 4K50A 1HWJA 1RWUA 4DLGA 5DZ7A 3KWMA 5AQNA 3RTVA 2B9WA 3AOAA 1WHXA 3QT8A 4LF5J 1KLMB 3U6FA 2F8SA 1FWKA 4U6PA 4PWUA 2P8IA 4NCGB 4FWKA 3QICA 2CPHA 2ZVSA 1YJWN 1FO1A 2NXJA 2P5VA 4A8SA 2G8KA 1XBWA 1N32K 4GKKF 2CQGA 2YNFA 2MHEA 4DDFA 4FZZA 4OV1A 3J7ZT 1KNZA 3ICLA 3BEGB 4LH5A 4FYYB 2UUTA 2EXUA 3J81j 3AT1B 1GMWA 1L3VA 4YEAA 2ZH9A 3ZT1A 1AFIA 1BWVA 4R5PB 2KZMA 2VFRA 1M5VC 1LWFB 4J90A 3BGOP 1Y4ZB 4CGFA 5AQSA 3MMAB 1KVAA 1FXDA 4IYQA 1C1BB 2P9NA 3MAHA 3GE9A 5HROB 2QA4N 2FLLA 1NSQA 4TLQA 3KKFA 1P9YA 4ZHRB 3PRBA 2J0QD 3AAPA 1X1PA 2OUGA 4MKAA 4LF6F 2FSJA 3UDVA 3MXJA 2XQCA 3EL2A 1IM4A 4LBHA 4RW6A 3M8PA 2MDAA 4JN4A 1SKWA 4QR1A 3WUHA 4OHXA 2GNKA 5HJYA 5HQ8A 3GIRA 1NGBA 1KAXA 4NA3A 3RBZA 3VEXA 4OZ2A 4CK2A 5AQTA 3SBTA 2B9EA 3RZAA 3Q24A 3OTBA 2CRLA 1YX2A 1R3NA 3PW0A 5A8KB 4QWCA 1NK8A 4M5NA 1Q7YT 4BDZA 5A8WA 3IGVA 2WHOA 4NOHA 1HQ2A 4RW9A 3BKFA 2BUPA 1SIWB 1ZM9A 5C42B 3G8QA 4J2DA 3Q7CA 1FF2A 4NYZA 1RU1A 1E4FT 4LUBA 2OPSB 1TK0A 4DR7F 5G0RB 5D4LA 5EHHA 5MLCV 2FHOB 4CYUA 1WDDA 1QVGM 4LREA 3OTOF 3WEEA 4BS2A 4M3WA 3CD7A 1HR0F 4D3HA 2VD3A 1ZAWA 4ISGA 3ELHA 1WKJA 4KI4A 2RF2A 5KFFA 5AJ3K 3VVUA 3MM6B 3CCMS 4IOXA 4BQZA 2N82B 3FMBA 4MAKA 4DEZA 1VC6A 2PDAA 4C8KA 4G1IA 3UB5A 1YKWA 3KK3B 4CBXA 3QESA 3PR5B 5FD1A 3J7YP 2QLWA 2BOAA 1VLYA 4JI5J 4ZVRB 1OSDA 4FJLA 3DM2B 3TAQA 1S6OA 2Y1RI 4KY3A 4DTOA 2X51A 1NHVA 1NGJA 2ACYA 3CQ8A 1KN6A 1PKUA 2ZWHA 1WHYA 2HHHK 3NP5A 5GIPA 1WOQA 1M5KC 1Z1ZA 3WX8A 5HMYA 1YHQN 3B54A 3U1LA 2C2KB 4EBEA 2HNDB 2W4CA 5CY4A 2C2MB 4H5TA 4OX9J 2EX3A 1UETA 1MDUB 3DLGA 4NLVA 5K8OA 4IFVB 4OZNA 4F4XA 1IBLJ 1NOZA 2QN6B 3MPUB 8AT1B 1TKZA 3I55N 3HT0A 2YHXA 3QGHA 1YF5L 5C2FA 2D3UA 4ID5B 5DJBA 4JKHA 2CDQA 3WXIA 5SZTA 4ELVA 3FEYB 3BZQA 2DNPA 2JC0A 2UZAA 3PJ9A 3LP3A 5AXMA 4K2JA 3VAKA 1Q9YA 1FT8A 3ILIA 2M52A 4MTPA 4USVA 3RMCA 2O3DA 3KHYA 3H40A 4L74A 4FW2A 1SCJB 3OYAA 1K8AO 4MT1A 4CIGA 1TKTA 3O8WA 3NNHA 3M2UB 5CYQA 2CQ4A 1DY3A 3MD3A 4M5GA 2OO4A 1VHXA 3B6BA 3P45B 3RR8A 3MM5B 4BACA 4KIAA 1B3TA 3J7AN 3ZTRA 4F2SA 4DB3A 3V6DA 4BE0A 2PN6A 1XR5A 4Y2AA 1V5VA 3L9ZA 3F9MA 3FZKA 1HBUA 1RKJA 5J2PB 3W8GA 1VHFA 3CO0P 3MPYA 1IR2A 1UA0A 4DCOB 3U02A 4GW6A 5HMWA 1ZZFA 1XERA 2YPYA 3VA3A 1F6TA 1WELA 5THWA 4BR0A 4F8RA 2PFFB 4M5IA 4CZIA 4EUVA 1FKAF 3KG0A 1LFWA 3IC1A 1T0TV 4ZJLA 1R43A 5AZIB 4YY3J 1IUJA 1RP5A 2P9CA 2FSNA 4WYBA 4GKJF 3VF4A 1RDCA 1NJIO 1WDTA 3UVJA 3TI0A 2BZ2A 2YI1A 3ULHA 4IEIA 3AY0A 2V69A 2NUHA 4GVBA 4YR3A 3HFVA 3C6HA 2FBVA 2C2NA 3BUZB 4WE1B 3S8SA 4CK3A 5CCMA 1FD2A 5AE2A 4RUCA 3HVTA 2Q36A 3TA1A 2H65B 1N33K 1XR6A 2NRZA 2CQCA 3V1RA 3J8AA 4PKDB 3OYEA 3GE1A 1LNQA 3M8YA 1KP6A 2BEFA 3J80Y 2XO7A 1YJTA 2C42A 4OJ3A 3NCPA 4LIWA 3BN7A 1EKRA 3M32B 1TL4A 3SFGA 3VQ4A 3EUNA 4I9LA 1PAEX 1Z2ZA 1JLBB 1S1TA 4KKOA 2Q1LA 2VDIA 1FEEA 3JTPA 5KG1A 1SJQA 4U7UD 2HYIB 1YJWS 1T6DA 5LMUK 1HLWA 3QNOA 1J53A 2BKNA 4HI1A 2YHAA 2MKJA 3DXMB 1S72N 1ATRA 1B0PA 3TUZC 4B9SA 3LM9A 3OYJA 4FP9A 5HP1A 1HBNA 2IY5B 1CEZA 3PVXA 3LZIA 4DU1A 2W8LA 4BROA 3UW1A 1FJGK 2HBYB 3GJQB 2H5IB 5IOLA 2CPXA 4CO3A 3HSDA 5EOYA 1JLAB 2DNNA 1KC8O 4RJVA 4O3RA 2IBOA 2OH2A 3W2WB 3TVKA 3T1HK 3MMCA 2YNIA 4K4ZA 3GTYX 1NEEA 3DLLL 4NYNA 5FJ4A 3MX2A 3UDCA 1LWEB 1PIEA 3G96A 1UEVA 4B3RK 1VSIA 2W25A 4ZCIA 4U95A 4QOTA 2E6MA 4WQ5C 1VSEA 4OI4A 4B08A 6FDRA 2VPZB 2GIQA 3HKZD 1D8YA 2JWLA 3FUYA 4WTYA 4ZP8A 4P2MA 1YZ6A 3CJKA 2WOMB 4PPZA 2XMUA 4TU7A 1XI1A 1C0MA 3S01A 1HBOA 4NWBA 4XH5A 4OYMA 2RQKA 5IQ6A 3PYFA 3FZHA 1TUGB 3Q8VA 4DPYA 3TA2A 4Z37A 4FWNA 1T8EA 2N4CA 3DGVA 4NE9C 5E7OB 3ULDA 1NGFA 4WQ4C 2HHUA 3VEYA 1RTHB 4CIEA 2Z1JA 3AO1A 2AJQA 3C7NB 2W01A 3MEDA 3JAMY 1KD1O 4TY8B 1U6ZA 3CJBA 3WQUA 1HPZB 1H74A 3AOBA 2H5EA 2NZCA 2VHGA 1TK5A 2PT0A 2O8FB 1YXQA 4DR1K 1YJVA 2K7JA 3CT9A 3A3PB 3GL1A 2FIUA 5F2RA 2V4RA 2FY1A 1X5SA 5KTQA 3VCDA 3PW5A 1EKSA 3R2CJ 4OKEA 3W0LA 3CF5L 3HHKA 2AYMA 2PY5A 2ZH4A 2QKBA 4DU4A 3OBIA 1REGX 3KHLA 3RB6A 4R5PA 3UCGA 1LWFA 2OLWA 2FF3B 3MMAA 1HKAA 1K9MT 1C1BA 3I4PA 2XSJB 3TWZA 1DGKN 2H48B 4PQUB 5C2CA 3KLFB 1S1VB 3NH0A 1Q8BA 1TUYA 2CNNB 1U2FA 5EVZA 4JI3K 2MQMA 1ZZNA 1WWHA 5KOXA 3CCUS 4F7VA 1L5UA 4RWXA 3A8IA 4BE1A 1YHQS 3ZZZA 2JLFA 3FFIB 4AYBD 5BR8F 1VQON 2DGVA 1T44A 4JKAA 1OPIA 4F9OA 3GR1A 2UXDK 4CJKA 3SDEB 3SK3A 1DQAA 2NUUG 5A8KA 3HZ6A 2GAGC 4OPAA 4B02A 2JSXA 2M8DB 1T02A 1IG8A 1UFKA 1NAQA 2DCUB 4M3TA 4H4OB 2PMWA 2HHXA 2BMBA 4ZPCA 4P10A 4DBQA 4LF9K 2MEWA 9RUBA 4ZKAA 1Q78A 1MN7A 4C23A 4WU3A 2LLZA 1FXXA 5CE3A 1X9MA 2OPSA 2F63A 2NZ4A 3DRRB 3U1MA 4U96A 4CJVA 2PAVA 2IPOB 3A8KA 3O2IA 4RWWA 4O3SA 4CGGA 3CJRA 3HHLC 2QWRA 2M2BA 4CLZA 3VQBA 1H6KX 3P1GA 5AQPA 1FDDA 2E66A 3MM6A 3QFUA 5DZ6A 4NRUA 4HTUA 4DTSA 1WF2A 4DHVA 1NMDA 4AL5A 4J9LA 4X64F 3ZEUB 1R8AA 3EYZA 4C0OC 1UKUA 4Y2CA 4JI6J 4IO9L 1S1UB 1TK8A 5K5MA 3DM2A 3ALYA 4OPHA 4WFXA 4HCCA 3H5UA 1DTTB 1G4CA 5KGWA 4GKKK 4GVLA 2VG5B 4DR3F 4MFBA 2WSFC 4DPTA 4DUZF 3MFIA 4C8OA 2GJFA 3AV9A 2K3IA 4ANDA 5FRNA 2HNDA 4PKIA 1X5PA 2AGQA 2V67A 1KD1T 2BQUA 2HFOA 1DRZA 4IFVA 2D1CA 2GAHC 3B6PA 2W8KA 1FI4A 2VODA 3NNCA 2EVZA 3SV4A 4WP3A 4E8UA 1BQNB 3B4MA 2K3KA 3ISZA 4LF6K 1WC1A 2GCFA 3MD1A 3EPGA 1WNSA 4ID5A 1GLFO 2DFFA 3PLAA 1WNEA 5IZHA 4CZLA 2DTJA 1B9DA 1W25A 2OELA 4DV7J 4O0IA 3DHWC 2LA6A 4QCLA 1OQ6A 1Q53A 2RT3A 4BCAA 4CHYA 2ALZA 3MX5A 3DYAB 4HHJA 1SKUB 3BEXA 2ASLA 4PY5A 5IT4A 4M3YA 4Z4IA 3MAQA 1R31A 1WOOA 4M42A 1KBRA 3TP2A 3WNEA 3BYRA 3M2UA 2B4JA 5J2QA 4NLTA 4QS8A 1L3KA 3DU5A 1I6JA 3K8WA 1OQ3A 4H0VB 2PEHA 4ELUA 4FNHA 1OJ4A 1RAIB 2KM8B 3MM5A 3C65A 3CCJS 1HKBA 2OPRA 4FBTA 3EGZA 1S72S 3VENA 3G4SN 4J9QA 2GV9A 2YWGA 4DR7K 2HOEA 2EFNA 4CHOA 5LJWA 1R6VA 1URRA 3RW7A 3F56A 3UFCX 5HMZA 5DRKA 3OTOK 4BE2A 4K59A 1HR0K 3OR2B 4IUFA 2NR0A 5M2PA 3DFEA 4YS2A 4FJ8A 4B3SJ 1D09B 3GCWP 2CPDA 2YCHA 2Z2MA 1L3TA 2KVQE 2N7CA 3KKRA 1QAXA 3W5ZA 3MCNA 2DR8A 5AZIA 2LEAA 3NGRA 3DOMB 1OWXA 1WG4A 3PY8A 2HHVA 3ASMA 2MY8A 2OA8A 2V9KA 4DPUA 3OYHA 2B4OA 2ROEA 2UXBF 1DTQB 1RISA 2CNKB 5LL6Z 4JEPA 4LF4F 2AV5A 1KDNA 4NLOA 2JDJA 4YOXA 2MB0B 4X65F 4BRCA 5DQIA 4LMZA 1O13A 1NDLA 1S0VA 1RT5B 2QT7A 3NXZA 1TTHB 2R7QA 1C0GA 1RT6B 1KWMA 4BDYA 1LFPA 1VQ5N 4DN9A 2FHJD 1WBDA 1PJ6A 4A4JA 1PC4A 3QGGA 1A5XA 1KVCA 1NGDA 4EP4A 5E3CA 1BUXA 1U1QA 4BC4A 4C3MA 3NWRA 3FCWA 2F4FA 5E2QA 4F4AA 2H3GX 3ENBA 4AHUA 2JX2A 3GV5B 4HHHA 4CEEA 3T1YF 1NK6A 2CGKA 4OZ5A 2JEGA 4KFBB 2F1FA 2YH1A 2WC9A 2V63A 2P9UB 3E1YA 2AWZA 3DXMA 1LKZA 2ZVIA 5HVGA 3L3CA 4NLWA 1Y3JA 4J9NA 2IMWP 4FM0A 2W2NP 2D0AA 1FXLA 2YPZA 1OS5A 2GVZB 3PJWA 3O08A 3C8YA 4GVMA 3TAEA 1I3AA 3O3LA 3PYGA 2ETJA 5DDPC 3VESA 2CZ4A 3LPTA 3W2WA 2JWKA 2GA7A 3CPEA 2MQLA 1GFWB 2EG2A 4CFDA 1TUVA 3AA8A 4ZVEA 4ANEA 1S49A 3MR7A 5D4OA 2VA3A 2CPEA 5L46A 4HCBA 1RWVB 4CEQA 3FRZA 4B3TJ 1V3RA 2VPYB 4JI8J 3M1VB 3JXUA 2A42A 1IJFB 3CC4S 3R5CA 3D5MA 2KDOA 3MWPA 4ZK7M 2F65A 3AA4A 1VQOS 3AFGA 4OMFG 3CB4A 5AQRA 1HNIB 1GLLO 2RHQB 3FSIA 3BZKA 1EZZB 3MAAB 4OYZA 2B8PA 4I4BA 2HS3A 3MN7A 3T1AA 3GR0A 3ZTPA 1F5BA 1PYSB 5CD4H 2HIQA 4H4KA 3EKUA 1LWCB 1IWAA 4DX5A 1NZAA 1UZHA 5E26A 1RTHA 3BH7B 4GKJK 1U8WA 4Y2KA 4DV4K 1RT4B 5HRPA 5B7WA 4USHA 3L4BC 4TY8A 2UVRA 1NJWA 3C94A 1TELA 2Y3YA 2QTWA 4DUTA 1WC6A 2RVJA 2O8FA 2DTUA 3RJMB 2O4GA 3MWBA 1YBAA 3S3NA 3VTHA 1HL6A 1V4TA 2E20A 4DQRA 4AHRA 1PJ7A 2DGTA 1QTMA 1ZS6A 2QM1A 4CHPA 2PBDA 1U8SA 4F3TA 2EBGA 2B5JA 3NOCA 2L9DA 3OYDA 3Q8RB 3TTFA 1WSFA 4FWLA 3OL9A 3HHLD 4L75A 4NI2A 2M9KA 1EHWA 4Z4CA 2HMIA 3HVWA 4WFAQ 1YJUA 2XSJA 3D6TB 5KT5A 3D66A 4C11B 2FQQB 3ONQA 4WFBQ 4BC7A 5K14B 4H0YB 3D0HE 2PA8D 4CBUA 3GV8B 2AEMA 1TAUA 2ASPA 4CGHA 1S59A 1KXPA 3ULEB 1NM1A 1RHQB 5HK4A 2FGCA 5IS2A 1IKXA 4J2EA 2WB1D 1IKVA 1KQKA 3AO4A 5TKYA 2RQMA 4JK9A 3QRRA 4X4UA 2ZOGA 3BN4A 2AEJA 4LR9A 3ZT0A 4CJTA 1BXNA 1RAOA 1KS2A 4DPOA 3SDEA 4DU7A 1H0HB 4QS9A 2HVIA 5C25B 1P8ZA 3N5BA 3KNGA 1EIYB 1RNHA 2ZGZA 2XTJP 4M63C 2GX8A 1FDAA 1R8PA 2HZCA 4Y6IA 3MMVA 2BE2B 3CCZA 2E5LK 1AROP 4UW2A 5B0EA 2M7SA 3LOUA 1N5TA 1NKCA 3KK1B 4B9UA 4WK1A 4L73A 3B82A 2XB2D 1RYRA 3PW2A 4CJPA 3DRRA 1RKIA 4RUHA 2YJFA 1QD1A 2B56A 2R8HA 2H4WB 3DRYA 3VN5A 2OZMA 3WZ0A 4TXSA 4JKGB 3QFHA 4JI7F 1PILA 4X4PA 3W5XA 2HSTA 4M3UA 1VC0A 1VJWA 1R0BG 4YDDB 3ZZRA 2HGMA 4JKEA 2XMMA 1CQMA 1SJ1A 2BDPA 3AQPA 3I31A 4L72B 2OIHA 3SAGA 1GEHA 3SJHA 4DZ6A 1KVIA 4BRIA 2HQFA 4NYFA 3AVJA 3CVKA 4V19X 1S1UA 3CD5A 3E01B 2UP1A 5LMNJ 4HVZA 2H1YA 4O4RA 4LRCA 5JLHA 2FC0A 4LR7A 1HIYA 4BWMA 2CPJA 1QSSA 2CJ9A 2CWXA 3EJMA 4AL6A 1N36F 1A9NB 2LXIA 2OMLA 4DR5J 3H90A 3RMAA 3K2YA 3CJ5A 4CJEA 3OVBA 1U0HA 3Q8YA 3NLCA 4FJ5A 4WFYA 2ILZA 4Q2MA 1T9TA 3SQGB 4X62J 2ZUGA 5BREA 2CG4A 4EU0A 2RPIA 1YWXA 3M2RB 4CECA 1J9AA 1UVLA 4ILRA 4J9VA 2CNLB 3W64A 4DTRA 2DBBA 3A0IX 3IMXA 2M5YA 3ENOA 3NE6A 4BWJA 1D9FA 5AQKA 3GYGA 5GIOA 4YQWA 4OGCA 3EGNA 1WSVA 1NU0A 1RA6A 4CZFA 3C16B 3MOJB 2GGPB 1WC3A 1RT7A 4JI6F 3TAPA 3N4QA 2RS8A 1OY9A 4W5RA 3FZMA 1WI6A 5D0EA 2XYPB 2NRVA 3SCLE 1JXBA 4E89A 2MZSA 5T7LB 1HMVA 2IM3A 5T41A 5BR8K 4A8MP 4CFAA 1XNQJ 1VQ5S 2GX9A 2YNHB 5DLGA 4JNEA 1HYZA 1HWKA 1CJTA 4NYPA 1SKSA 1UZDA 4FWRA 4EO8A 4IKFA 4J9RA 1ASWA 4CJLA 3SNNA 1EKEA 5BN9A 2P9LB 2ZUAA 3BGRB 1QVFM 4AM7A 2O67A 2FPHX 4OLPA 1NSPA 3KJVB 4MKVA 2KHOA 4KB1A 3KK2B 5HVFA 4OZ0A 2AIRB 1A5WA 2ZKUA 2HVDA 3A5NC 2A5XA 2WRMA 1CULB 3NBPA 3LP1B 3D1HA 4QBUA 2KXHA 4C4WA 1G2EA 2GIRA 2I9SA 2H4YB 5E3PA 2AGOA 4IFYA 3VGKA 1Q81O 5F0UA 2W2MP 3M8WA 3KMQA 1QHTA 4CM2A 3OR2A 3QERA 3QNWB 2ZC4A 5AE3A 3I0SB 5CA5A 4DV7F 3CG7A 5BXIA 2DNKA 3DRPA 2X1AA 1RAHB 4GNIA 3CHWA 5HRRA 3I6PA 2R3VA 4X64K 1ZH5A 4XH1A 4A8YA 4CZMA 4CLYA 1U25A 1DBDA 3DOMA 1HKCA 2Q6CA 3GMGA 4X2BA 2HHQA 4KV8B 1N5SA 5F9NA 4OHZA 5JUMA 2FHMA 4OYIA 3NF8A 4DSFA 1TMJA 3GBTA 3SQ1A 4DL4A 1NM2A 2E2NA 1KQFB 1N32J 2FUG9 4DR3K 1REVA 2DO0A 4DUZK 1RHKB 4NA1A 1RTJB 3LDNA 4YOWA 4RU2A 2Q43A 2ROPA 5F8NA 2D0OA 1VSJA 4RNMA 4JKFA 2LECA 1VQ9S 4K4TA 1NKEA 4L3KA 2P1JA 1MWKA 2KJVA 3HHDA 2O8DB 4IG3A 3ILLA 2AYGA 2R8IA 2CQ2A 3OYFA 2ZOMA 3AVLA 1VIOA 1VQMS 4CH1A 4JI0J 5LSOA 3TU5A 4ZCLA 3CULA 4JI5K 3MM8B 1WG1A 2OFGX 2Q31A 4KFBA 5E41A 5E84A 1U1KA 1TL5A 3M6UA 3MEGA 1RQ0A 5ADXH 3DHXA 3QGPA 1NSAA 3S3MA 1E4GT 1PC5A 1RDAA 3QLHA 2GVZA 2G0CA 3SAHA 1X7VA 1QQMA 4I68A 1XMBA 5KFZA 4I1TA 1S0MA 1SPBP 2WBMA 1UOCA 5KPZA 3OSNA 2OFHX 4DFMA 1FESA 2C1EB 2DXDA 4Y0FA 1CJKB 4RW7A 1MSWD 3UKRB 3SIPB 2BW7A 2LU1A 3A5OC 1Q5YA 3FBFA 4FPIA 4DKWA 4A2AA 1CQNA 3OL7A 3CCSN 3PDNA 4NLYA 1TVRA 1D4XA 3KWIA 1RBLA 3QB0A 3TJ8A 3A3NB 1Q4RA 3CJ4A 5DQGA 2GO9A 5MAOA 3DMJA 1ATNA 1HNIA 3NCQA 3LDSA 5D8HB 3AVNA 3S7RA 1CS4A 5LJVA 1H72C 1VCTA 3T6BA 3V5RA 3MDFA 4EYIB 2ZH8A 3AAQA 5DQHA 2G2OA 1JLEA 1G6BA 1RWOB 1H3DA 5BYRA 2R7SA 2JOQA 4BDPA 2IVNA 2PFUA 4LF7F 1T94A 4UQTA 2AP6A 2IOCA 5KRTA 2UXBK 4XIUA 2VWKA 3C2PA 1RHJB 6AT1B 1H73A 4DI6A 3C0BA 5AQUA 4LF4K 4P9SA 2VGNA 2QYGA 5DG8A 4B3TF 4X65K 3O3FA 3VWSA 4N76A 3J80U 2DPIA 4FDFA 1WEXA 3N9UC 2HHHJ 3K9JA 4KHMA 4PXCA 4I6WA 5HMXA 5FPNA 3VZIA 5AXKA 4JI4F 2GMHA 4M5DA 1VHIA 4IQMA 5LJ3Y 4ID1A 2P9SA 2QJ3A 3HCXA 2Z4PA 1X5OA 1M5SA 3W60A 3QRPA 2HZAA 4L3QA 4JOUA 2BQ3A 1RWXB 4JI2J 1NOYA 4YY3K 7AT1B 3OS0A 5KQDA 5K14A 3Q7BA 3T1YK 2GQQA 2DGUA 1YBUA 2FVSA 3M3ZA 1HYSB 4PHTX 3QT6A 4HDGA 1OY6A 3UD4P 3SUQA 3RBEA 4B9TA 2FVQA 1T3NA 2GQ2A 2Z2YB 2F4VJ 3TQEA 4PWDA 5IFMA 2NXCA 3T9ZA 1NMNA 1W2BM 4TU8A 4JB8B 4HI2A 2DIVA 1H2UX 3BO4A 4PL7A 1U2VA 1MLAA 5M1PA 4ZP6A 2PC6A 4ZLNA 2A6OA 2QO3A 3FFKB 4CF0A 2BE2A 2XY6A 4AXJA 4E7LA 1KAYA 1K73O 1WORA 1K0VA 2YKMB 4Y1DA 5F8LA 1ZYQA 1S5JA 5CR4A 3IBCB 5CXTA 2DHXA 3NY0A 4WFBL 3T5JA 3H46O 1QSYA 1X4EA 2PO4A 3MFHA 1LOUA 1CZBA 1BG3A 3UE5A 2YWEA 4HDHA 2WB4A 3TSPA 2NXEA 1NJZA 2I2YA 1ZBSA 2LP4A 1S99A 2DD8S 3W62A 3NMRA 4ZCMA 3AVIA 3PYEA 1GMWD 1N56A 2M3DA 2KZZA 3ZX0A 3W3DA 4K4SA 3VGVA 3I4HX 2IVMA 3TUIC 2CFXA 4KBOA 3LWLA 1IXKA 2QI2A 2QA1A 2O66A 2Q79A 1B9FA 2G13A 3V9SA 5KT7A 2B4PA 4B9VA 4KGZB 2ZE2B 2GHVC 1S77D 5B0CA 1F3VA 3E01A 2WW8A 4C98A 3THWB 5CD4A 2L9NA 5DLFA 2QLFB 4CO0A 4YOUA 4EHUA 3EMTA 3HOTA 2R4FA 2BTFA 4FLVA 2KHCA 3KLIB 3H0PA 4N41A 2VBYA 3CC7N 4IOAQ 2J9DE 2XY5A 3G0ZA 3SQGA 4CNZA 2GWKA 2QGFB 3M2RA 4DF4A 2OANA 3TNVA 3MTJA 1VSDA 3I8DA 1WF0A 3CFPA 1T3OA 3OQ2A 1F9FA 4IRCA 2DNZA 4IWVA 4JKDA 4LJMA 5BYSA 3OA9A 1KOOA 1K1SA 4OYAA 5LMUJ 3C16A 3E9PA 3EZWA 3KTQA 4CNYA 3PUFA 1HFEL 3C15A 5KFUA 1ITPA 1VQLS 5EWEA 3RMDA 2VBXA 1VRUB 3Q2SC 5KFOA 1FJGJ 4ZVGA 2MPUA 4H0TB 3KYLA 4AM6A 3V9WA 3P5TL 2YNHA 2YKAA 3AODA 4DR5F 4P6QA 5AFUA 5M2UA 2I5JA 3T1HJ 3O4QA 3AVBA 2YH0A 2P9LA 1DHMA 1VOMA 3BGRA 5E33A 2B7CB 4HH1A 4DV6F 3N28A 3D7SB 2XY8A 1CXUA 3W2VB 3K57A 1M5HA 2JVRA 2ZM6F 1FKPB 4B3RJ 2CUYA 3R6MA 4KR0B 1T05B 3NAIA 2B6AA 3MM7A 2BM1A 1CULA 3JQKA 3GZ7A 3O1WA 4CLFA 4DSJA 4WFZA 1IKYB 5KFBA 2DKOB 2XEXA 4YOYA 2ZF5O 3HHNB 4JI7K 1QE1B 2ZHOA 1X9WA 2J6TA 4LF1A 5JS1A 4F02A 4FWSA 3I0SA 1LK7A 3BBFA 4F25A 1XNQF 2VUGA 3GOIA 5LSLA 1O8BA 2UVWA 4OX6A 4M5KA 3BQ2A 3E2EA 3FRYA 2HVZA 4P2SA 3CGIA 1K73T 4IH5A 2HBQB 5I42A 3D0IE 3QDKA 3C6TA 5HBMB 4NMLA 2FBYA 2XI3A 1UMJA 2DPNA 2KLAA 4FJIA 1Y00A 4DR1J 2BR0A 1T6CA 3A5MC 4K7QA 4DCJB 1SQFA 3C6UA 1FD8A 2GVDB 1LAVA 1TKXB 3BPSP 5AQYA 2LU2A 1N36K 4C97A 2G4BA 1N6QB 1G1XA 3TWHA 1T9VA 4JK7A 4DX8H 4BRGA 1HWIA 3NDKA 1HNXF 1NPPA 4QQBA 2EFGA 2R8GA 4EK2A 1URNA 1OH6A 3KOAA 1JNRB 2I6WA 5EU7A 3TEGA 1RBRA 3L4IA 5A0YB 3CFRA 2HF3A 1A7GE 4M3ZA 4A47A 3R5JB 4USJC 5GAHU 4JLHA 4ZPWR 4JI6K 4DQPA 3AO2A 1VRTA 5DGBA 3EDRB 4IDKA 2ZITA 4MMOA 4YHHF 1FWPA 1HNVA 2R42A 1MWZA 3CE8A 1CLQA 1PJ5A 3EKSA 4WZMA 2XLKA 4IH6A 3TOQA 1VQ6N 4BLGA 4I0WA 2ITGA 4DSEA 4BRNA 2QWQA 4LT6A 5C0YA 2UXDJ 2A41A 4UOCA 2KT5A 3IUCA 1VQ7S 3R27A 2YWWA 3DGPB 4R8UB 2MLYA 4CD1A 1T03B 1F9HA 1HD0A 1BISA 2XZTB 3L2UA 4FK0A 3PEJA 3DC2A 4LF9J 5M1KA 2F5GA 4DSLA 1UWBB 1I3OB 2G8VA 2F8HA 2XBPA 5C7PA 4IR9A 3IS9B 1UWAA 3UN2A 4FPBA 2OEJA 2F8MA 4H8KA 4M3XA 3H4DA 3L2RA 4OHWA 1PG5B 3R9LA 1RDBA 2BJ7A 4ZVOB 3UIQA 4DV7K 4QIGA 3R3TA 1F21A 3HI0A 4B3OB 2BANB 5JXSA 3BZCA 4FWMA 4LBIA 4FZXC 2W6KA 2OJ3A 2EWSA 1OIAA 1B7YB 4MO4A 4FS2A 3H2UB 3EPIA 4J9MA 2FVRA 2MZQA 3TSUA 4ZPDA 4JK8A 3AVKA 4ZJQA 1Q0NA 3O9RA 5GINA 3H1QA 1F0XA 3G6XA 1ZA1B 1HUXA 4JRPA 4RBTA 2ZQBA 4J7CA 4GKKJ 4XEIA 5MLCQ 4JI1F 4NZ6A 2LKZA 4QW9A 1DQ9A 4EEYA 3WNHA 4PWWA 4NASA 1SC6A 2IM0A 4WK3A 3FDSA 2XCAA 4AE5A 4O5BA 5KAKA 1UPMB 2C2OB 3Q22A 2CVIA 5A6WA 2HWHA 4PABA 5K9FA 4RTFD 3S3OA 5H9FK 1KCFA 3ZSXA 3NAHA 4K8RA 2WVEA 3CEDA 4DQSA 2W2OP 3ZXWA 3JQMA 2VQFF 1ZBUA 3WNGA 1IR0A 3BP8A 1HHTP 1K1QA 3PX4A 5KT2A 3ZZOA 1B0TA 2EG1A 1HQEB 3QMQA 4ETXA 2NLWA 2XWYA 4LF6J 2MQQA 3LP0B 1N5VA 1K47A 4Y1CA 1BQXA 3BR8A 5L38A 2PMHA 5KFEA 2LDIA 4J37A 1HD1A 1R59O 1IQTA 1HI1A 2DB1A 4URSA 4IH7A 1QZ6A 2YNFB 4ES2A 3CC7S 4FN5A 1WKKA 2G9OA 1WTFA 3J7AP 3EE9A 1NCLA 3K9KA 2Z58B 1WAJA 3SPZA 4WIIA 4AQYJ 2FZCB 2E1PA 3VQPA 4LVNP 4KREA 4JKCA 3K0JA 3HT3A 2W9BB 1XNRF 4IG0A 1M1HA 1N54B 1B7FA 3DI6A 3TZZA 2R7WA 1X0FA 1EETA 1R7IA 2V4QA 4HR2A 3LANA 2QG9B 3D54A 2P9NB 1AUSL 3SI6A 4CO5A 2YKMA 3EN9A 5HQMA 2H54B 3NCRA 4DR7J 4CZHA 2KQ2A 1U04A 1CJVB 2P9IB 3DCAA 2ZBCA 3ZNUA 1RXOB 1NZ8A 2FZGB 4Z94A 3T7ZA 3E51A 4A8KA 2UV8G 4ZCKA 4X4RA 4RW6B 1HR0J 2DHSA 2QZ8A 2ZH1A 2ZH6A 1QQCA 1X8DA 2BJEA 1NG9A 2J9DA 1N34J 2L41A 3VEVA 3ITHA 3LGNA 4O0JA 4MJKA 4KHPF 3WC0A 4CW7B 4CF9A 3UR3C 2AJ0A 2W7OA 1KQSM 2X1GA 2RD5C 2IM1A 5A8WB 4FVCA 5D6GA 3BM7A 1T9WA 4RW9B 2JFDA 1YTYA 1OMSA 3IBFB 1XQIA 3ZT3A 4KHUA 3MPDA 1FXRA 4AHCA 1MMLA 5I3QA 1NGIA 2ZE2A 3J80O 3SPYA 3E66A 4B3TK 3CDWA 2UVVA 4CJUA 4CYUB 1ASVA 2HHSA 1SUQB 2EK1A 4D3GA 4JI4K 3AB4B 5L1LA 3O3HA 1OH5A 1NLKL 1IVZA 1GX6A 3C14B 3I9ZA 2RMLA 4PAAA 3AOCA 4BREA 3GSIA 3U1NA 2AP1A 3RRKA 4CLLA 3V4IA 1AT1B 2EBEA 3SUOA 4F3OA 1VFJA 1BA0A 5KPRA 5LXRA 1NPKA 3PX0A 3MPWA 2QWPA 4NB4A 1J5OA 3D3BJ 2QA2A 1LOTB 1SH3A 4C8NA 2EC2A 5CZXA 4JV0A 1JNZB 1Y5LB 4YMEA 4CEFA 3RAXA 1Z2LA 1GQEA 3EVOA 3UWTA 1VRUA 3WXMB 4LRFA 4AH9A 1FWLA 5A6PA 3I96A 1WF1A 5CYMB 4DR4J 2Y0SD 1JX4A 5CHCB 4K5RA 3DLGB 3PKYA 4IOAL 4DV5J 2H9ZA 4MKBA 2YNGA 3SAFA 4C2MA 4EGLA 3HOSA 3GLJA 3RVCA 3W2VA 3CIMA 2GUPA 2UVUA 4KO0B 2CXEA 1FKPA 1SJFA 5I4MA 3AGRA 1VYAA 4KI6A 1TKZB 2I38A 1T05A 2NPFA 2FC8A 5J2MB 3ZYYX 3K5NA 1QUPA 4TYAA 2ADBA 1UTAA 1A6LA 4JYAJ 3N4PA 2ZKTA 4H5RA 3D0GE 2LFVA 2D0BA 1LEOA 3IFEA 2J8SA 1U1OA 1S9EA 2C2ZB 4B17A 5EWFA 1VQ6S 1QE1A 4I6AA 4MH8A 3JAMO 3PEHA 4ZVQB 2NUBA 2P2CB 5IV3A 3DNCA 4ECRA 5KFDA 1EX4A 1S3XA 4OPJA 2FVPA 1CPZA 2VC0A 2ZHAA 4C1NK 3QZ8A 3NMAA 3QJLA 3TAFA 3CD0A 1O51A 3ZLJA 4QWBA 4K8XA 5EXWA 4KTQA 2EWHA 5CABA 3BYPA 2CYYA 2XYGB 1V6HA 3JQJA 4K0KJ 1N48A 2Q0UA 2J8AA 5EUHA 4CH7A 3LW5C 1SZ2A 3V6DB 3J7YI 3OYMA 3P5BP 2A3JA 1C2PA 1TKXA 1JJCB 3IR6B 4I2PA 4N8NA 1SC4B 2MXYA 3H98A 5JS2A 2IVFB 2GQCA 5DO2A 2CPZA 3BSCA 1NHKL 4ED4A 5CHIA 2DGWA 1E6VA 3M6GA 4CI6A 3MHYA 4FJKA 4HWIA 2CA9A 3OVSA 3FZBA 1XHZA 2UUAF 3TR8A 1FRKA 1RADB 1ZM2A 1EB0A 5AQOA 3TO8A 1FRLA 2HRTA 5A0YA 2CGJA 1XMOJ 3AARA 2X6SA 1RACB 3RUBL 5BJRA 4KSEB 3UVJB 4BR4A 2OMOA 4GVBB 2CPFA 2D69A 1MMNA 3QGIA 3KG1A 1YLXA 1RSCA 2Q1NA 2VU5A 3HVTB 2VC1A 2E29A 4NZ0A 2DH7A 4A8XA 4RLEA 4DR5K 3DLLQ 2DHHA 3RB4A 3HRGA 2L9WA 3GG1A 1GMUA 1UAWA 2IHR1 1RT1A 5HO4A 1FTCA 3FQKA 1YZ7A 2HB5A 3DGPA 4DV6K 4ETZA 4PL8A 1HPMA 2V51B 4OX7A 3V4MA 4R8UA 3AJ1A 4WBFA 2ZM6K 2XS7A 2VG6A 3PZPA 4X66J 3DRSA 1QVGR 3ATVA 2RSQA 4KPYA 2D41A 3PO5A 4CWBA 2DNGA 1UWBA 4A62A 2R7TA 3D2FA 3E9LA 3QJJA 1VS3A 4E2FB 3MR2A 4MKYA 4GV3A 4M63A 3BKUA 1KLNA 3FMWA 5DM6L 2Z30B 3UI3A 1FRJA 1NU4A 3QJPA 1XNQK 2EW9A 1Q8IA 4KB7A 2V8PA 4FOEA 2MZRA 1S7IA 2IA0A 2DRAA 4GC7A 1FJCA 2BANA 1FRHA 2D3O1 3V6JA 2F9DA 1HBMB 2ZH7A 1PYOB 4FLTA 3FKBA 2YNIB 3BSAA 4FOIA 2DISA 3HJFA 4CZGA 3NH2A 3AVMA 4OYOA 1KFSA 4CCHA 1C0TA 3CTRA 4U7UK 2IS3A 3TPQA 2OGUA 2GIFA 3MF5A 4FLUA 2AEFA 3C6AA 1GLDG 5DG7A 2H3EB 4OLBA 2ZWPA 4DR6F 1HARA 1PBAA 3SI8A 3JSMA 4CEZA 4H54A 4CLPA 2GZOA 1P27B 2E9RX 4URQU 5K20B 3CF5Q 2HF4A 2DCLA 3BSNA 1WJ9A 2LQ9A 2DHAA 3ET6B 2XMKA 3NRBA 2X78A 4PRFA 3CJCA 3T5KA 5E3AA 3DLHA 4R25A 1KVBA 4PKHA 4B1VA 4Z4HA 2PSZA 4C3KA 1FVQA 3VQ7A 3CFOA 5JICA 2CJXB 4M5HA 2E2OA 1WUUA 4W5QA 2ZJPQ 3CCVN 1TR0A 4ZTJA 3FSYA 1JKHB 2A40A 1NGAA 1S9FA 4UY85 2V7YA 2ZEJA 1UVJA 1AYEA 3VQEA 1WSHA 2DNQA 4ZVTB 3MEDB 2X74A 5M1FA 1X0PA 3AQOA 1YIJN 1HQEA 3TQ1A 5KT6A 1ZBTA 3LP0A 3I82A 1QUVA 3LH2S 4YHHK 2VCPA 3EX7B 1IBCB 2DO4A 4PEOA 3G6YA 4X4VA 2O01C 5BR8J 3MXHP 4CE9A 3BGLA 4TNOA 2J0WA 4DTMA 1UEKA 3A8EA 1ZTWA 2DGXA 3UR0A 4C8MA 3QRQA 4F0HA 3Q8SB 3TSQA 3OLAA 2W9BA 2DHGA 5IQQA 1NGHA 3ENQA 1FFSB 4CJ3A 2W1BA 4ZIWA 4QR2A 1UFLA 2J9EA 3NS6A 2F8EX 3D4JA 4UOFA 2DJWA 1U2CA 3HZEA 3N6MA 4QU6A 1SJRA 4I2QA 3SBMA 4JI0K 2E9ZA 1NDCA 4QYZK 4IOCL 2Z2LA 1CJVA 2P9IA 1RWNB 4KH5A 1R0AB 4WJBA 2OD6A 5AQLA 3EXCX 1G7CB 2MLXA 4FK2A 2DH9A 3CO9A 4RW4A 2YJEA 4DMZA 2E44A 4DTPA 4ZLPA 3THXB 4ZIVA 5HATA 4U8VA 4AQYF 4F2RA 3R1HA 3G82A 1JCFA 3EWGA 4X64J 4M1KA 4IO9Q 1GOCA 4IFEA 5L1IA 2MLZA 3HFZB 1JK9B 5KFVA 2CPIA 2UUBF 4BRDA 4G1QA 4UQGA 4M45A 4B8AB 1UVIA 3KHRA 3EZOA 1RHUB 4F67A 3QMLA 2QXFA 1HA1A 4WFNQ 4DR3J 1DEJA 2VPWB 3TJAA 4DUZJ 3VALA 1SUQA 1JLGA 2NXNA 4NZ7A 3R97A 2VA2A 5B0BA 2FDNA 4B9QA 3OW2M 4YB1P 1NMEB 2SXLA 4DZDA 3C14A 2CQ1A 3PW4A 3L95X 1AB8A 3CCEN 1SV5A 1QM9A 2G1DA 2HHWA 4JHDB 1N34F 5HI7A 4ISEA 1RTIB 4P74A 2VQFK 4FWPA 4ZDNA 1WC4A 1RUSA 4ZVSB 4ECYA 1EWRA 2GUIA 2XI2A 5DDRC 2FY8A 2J76E 4FJNA 3CYMA 1EAYC 4IXCA 4CP5A 2G8UA 4FLXA 3GYNA 2NRTA 1BY9A 4OFZA 1J5EF 4EZ6A 3LP2B 3CJ0A 2E1RA 5TKWA 3CWJA 5EX5A 3TAMA 2R2RA 4ILJA 4MFBB 4GO5X 3CCUN 5H1SV 2AU0A 1LW2A 2BA9A 1T95A 2I8EA 4E7KA 3BS9A 2HEKA 5M1NA 5CYMA 4C9DA 2XO6A 2Z1HA 4FNIA 3ISNC 1S76D 4ZOSA 1XNRK 4OKJA 2AQ4A 2YX7A 2Q3PA 5HL7Q 1VBZA 1U49A 2C2DA 4KO0A 2KG1A 4DSIA 4R0JA 4JI2K 3GYXB 4ZN3A 3F5TA 1KHWA 5J2MA 4I56A 3UCZP 1FRIA 3ZO7A 5EGYA 3R5DA 5BN8A 2V6AA 4HTJA 4CJ5A 4G65A 1KR4A 2A1RA 3SCXA 3GB0A 2HG4A 3IG1B 1IBKF 2VBWA 1ACMB 4YOVA 4J9OA 4Y28C 2F4VK 4DMNA 3SCIE 1IO2A 5KG5A 8ATCB 3D3CJ 3FGUA 2CJAA 4Z7CA 2Y0BB 4DR4F 4KHPK 3NGKA 1Y7PA 2CH5A 3Q86A 1S48A 3LDQA 3AD7C 3NOGA 2PA3A 4DV5F 5J2QB 4LF8F 2OTLS 3MMJA 2E4LA 3ETOA 2ZH3A 4ZP7A 2UXBJ 5K8NA 5KT4A 3ID8A 2B9XA 4LF4J 4DV3F 3AVAA 2OPRB 4N77A 5JMVA 4X65J 5AZJB 3G2XA 1FX4A 4JYAF 1YAGA 4OYWA 1TZ0A 3BO2A 4O55A 3NGIA 4PZVA 1GLAG 4ILGB 1SQEA 1LW0A 3H42A 3SV3A 1JCEA 1NK7A 4FWOA 1CSJA 1YDLA 1N5YA 1FRMA 5IV4A 2AGPA 1RLDA 2CVEA 2BRKA 4CZCA 4I7FA 2HVEA 3FZ2A 1FNMA 3O5TB 1S6UA 3AHPA 3LAKA 5B09A 3PHTA 4BR9A 1JL1A 2P9EA 1LAWA 2W40A 4CJRA 3MGJA 2I0XA 1G15A 4NLBA 4HT7A 5HLFB 5KFSA 4JS5A 2OPQB 4O0NA 1YVNA 1B4SA 3T1YJ 2DNRA 1FKOA 2OD4A 4B3MJ 2XHWA 4DTJA 1SQGA 3K5OA 2HQ3A 3AA2A 3RAMA 1UPPA 2KXNB 4WWSA 3WX4A 1WHWA 5C12A 4K0KF 5L1JA 4QS7A 2IBKA 2A18A 5ETQA 2PE8A 2WTUA 1TQLA 2HFNA 4QW8A 4JP8A 4CZEA 1B92A 4G3IA 3CCVS 2HS4A 4TQSA 2M88A 4LC9B 3KJNB 2DVIA 3LALA 3O9SA 1N4LA 3DOKA 5IT9Y 1YIJS 1NO8A 2MZTA 2E8AA 4KH0B 5L1KA 3O1LA 1IJEB 2MSSA 1XMOF 3QFWA 4V19S 3ZX3A 5EX0A 3VAGA 4NXNF 5B0AA 3ZSQA 4WIQA 3ENHA 3O6QA 3CCJN 1RABB 2HWTA 1BU6O 2O4IA 5KG2A 4CEAA 4KQZA 1DFDA 4G6VB 5DDQC 5IWAF 3T5LA 1ILYA 3CCQS 1L3SA 2W6LA 4XDDA 3Q23A 2E6LA 1HW9A 2GMJA 5C2GA 2B8QA 3B78A 3CJ7A 1WEYA 3MR3A 4WYLA 2HLTA 2A2DA 1HBMA 3VF6A 2CPYA 2CQ3A 3CJTA 3P5JA 2G0JA 2VWBA 2Q66A 3SCKE 4F3QA 4DL3A 4IDHA 3CJ2A 1UP1A 1WSIA 1G3OA 5ETPA 4X66F 4DN0A 3WT0A 3FK4A 2MJUA 3LUYA 3JSRA 1O0PA 3N79A 4BVPA 5LL6d 3OD2A 1X31C 4FYVB 3IKMA 1RCXB 1K0TA 3IM8A 4W5OA 3ET6A 4PXBA 3SXLA 1VBXA 1RDRA 3PM9A 4NEYA 4CLUA 2YKNB 4RL1A 2FZKB 3PIPL 1K8AT 4QIWD 3GJTB 4L76A 2O8EA 4FYWB 3HSTB 2D74B 1SL2A 2DRBA 2UUAK 2MQOA 1RYSA 3IBWA 2G8FA 4J2BA 5CAAA 1TGOA 1TV6A 3M8QA 1Y0HA 2AYEA 1XMQF 2HIYA 1JKHA 1LQ9A 2IIHA 1DURA 4CFBA 1IBMJ 4F0KA 1CC8A 5GAEU 1X9JA 3X3UA 4ECZA 2E1AA 1N88A 3VHQA 2N3OA 2NNWA 2A1SA 3ZSYA 1KTVA 3GP9A 4FBUA 1GNKA 1VQPN 4GRSA 1HWUA 3ZZYA 3DWLA 3FBBA 4YOTA 2HK2A 3CI5A 2XMVA 1Z26A 1AUDA 2APOA 3H59A 4WU2A 2KO1A 5KFCA 2NLXA 3VQCA 3HPOA 4BRLA 1FDBA 1S1XA 3CCES 4W4MA 2O8CA 4ZLJA 2V2VA 2KRBA 2P51A 1PSDA 4ELTA 3WIUA 3QIOA 4NXMF 3Q0AA 3CIZA 3N0VA 1SKRA 2CH6A 2B5JB 1BGXT 2U1AA 1JXLA 5T14A 1NJIT 4NI2B 4PG5A 4NLXA 4KPCA 4KHSA 3RR7A 2HMIB 3O4WA 2VYPA 1MROB 2AJ4A 3BKTA 2ZJPL 3R7BB 4LVOP 4RWTA 3OL8A 2LCWA 4DV2F 1AW0A 3QFPA 1F3FA 3I5CA 2R2SA 3N6NA 3P38A 1R0AA 3W3SA 1S9GB 2V2ZA 1IKXB 4CIFA 4A8QA 1S12A 1IKVB 2XLIA 4JI7J 4LF2A 4NLCA 4PG4A 3CC4N 3QEIA 1VDHA 4OJGA 4TQRA 2FLOA 3THXA 4YN3B 3HBTA 3M7VA 5F41A 3CERA 3GQCA 1YSJA 4B1UB 3T3FA 3OYCA 1HYVA 1Q5VA 2L3MA 3MMBA 1R6YA 5KFQA 3U4LA 3QSIA 3ISND 4H5WA 3Q2TC 3MCAB 4FYDA 4KTWA 5D15A 3AVHA 2HAFA 4OV6A 3Q8UA 3OXGA 2FLNA 1FK9A 3A8YA 3D1QA 3M8RA 1NHUA 1N36J 5KFIA 3WBZA 5FIIA 2QE5A 4BRMA 1KC8T 4FM1A 3AB2B 3M4XA 2DGQA 2HKEA 4A46A 3BQ0A 2LQJA 4CVNE 5HVHA 5AQWA 1I94F 3CJSA 2QX0A 2QLJB 4MIWA 4OHYA 2R9LA 3TUJC 2A0FB 3NVKA 4Q8EA 1ZETA 2ADCA 1NNDA 1QTNB 4JHDA 1GLEG 5BPMA 1CC7A 2BGGA 1RTIA 2B9YA 2J0SD 2HBKA 4NL5A 3HVAA 4DL2A 1HLUA 2QMWA 4DU8A 2RRBA 4CGIA 4OI2A 2AW0A 2J9CA 1H1VA 3RU0A 3TYTA 2QFIA 2E2QA 1RWPB 3LP2A 4OQJA 4I67A 1WC5A 2BUNA 3HL8A 1U0HB 3UDLA 3QSYB 3A12A 1UEUA 4CLSA 4WFNL 5KQ8A 1ZBLA 5FLXY 4FL9A 4EHTA 3PXGa 2P9KA 1RLCL 4ILMA 1RBAA 3RRHA 3HJVA 3OYIA 1NJXA 1RB0A 3PW7A 2Z56B 4DU3A 1D3WA 2KVIA 1NNEA 1TUUA 4BHQA 2OI2A 2HK3A 4ES1A 1RT7B 3U27A 1W2IA 4H5VA 2IAJA 5BPNA 3VQQA 3GJRB 3LDOA 4XPCA 4FJ7A 5GAGU 1YTUA 3ZSRA 2IC3B 4LH4A 1KQGB 1HMVB 3IG1A 3CQXA 4U67Q 3NCIA 2MHNA 1NDKA 5F1XA 4N56A 4O8UA 3IRWP 4LFAF 3PFEA 1CJTB 3T6JA 1X4BA 2YX4A 3KG4A 1YJ7A 1KEKA 4AQYK 3SUNA 4HT5A 2NRHA 2FXUA 1HNWF 4DFPA 1K8KB 5E5NA 2QC3A 1U2RA 1WKLA 3R9PA 4KHQA 3UDE