4RW7A

Crystal structure of hiv-1 reverse transcriptase (k103n, y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
554
structure length
538
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
total genus 138
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw7A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw7A05
2E9TA 2JC1A 4J9MA 1LWEB 4DTSA 3NMAA 5KFSA 4I2QB 2IM0A 1BQNA 3K59A 2OPSB 1ZYQA 2IM3A 2FJVA 3KK3A 4ED3A 1A5XA 3E51A 2XGQA 5JUMA 1NOYA 3DOLB 5KFWA 3OVNA 4TN2A 3QETA 1VSEA 1FKPA 1RTJB 2IAJB 1TKZA 4IR1A 3NH1A 4KB7A 1ZBFA 4HHTA 4CIEA 5I42A 2D3ZA 1JL2A 2G8KA 2FLNA 3IG1A 3H5SA 2OZSA 2W8LA 3RBDA 5KFGA 3MECB 2AGQA 3SQ0A 3DRSB 3TI0A 2JC0A 2VG6B 1QUVA 1XWLA 4DU4A 4LQ9A 4NRUA 2R2RA 4DTMA 2KFNA 3V6JA 1HNVA 5EWFA 3AA3A 3D28A 3T3FA 3IS9B 4KREA 3HPOA 4ZMMA 2XY5A 2PYJA 3UR0A 4NLRA 4CIGA 3MEGB 4J9LA 2CJQA 1C6VA 2RF2B 1JLEB 4M45A 1I3AA 3PV8A 4DSJA 3I0SA 3LZJA 2W9CA 3AVMA 4DFMA 4CHYA 2B4JA 3V1OA 3HVTA 2C2DA 3UPFA 5SWMA 1N56A 2HHQA 1IKYB 4RUAA 3T5LA 4OGEA 4CF8A 1WSGA 3KLGA 4QWDA 3VQ7A 4O3PA 3V6DA 3Q8RB 1D5AA 4KHYA 4I2QA 1DTTA 3NFAA 3WNFA 5CYQB 1RT6B 2W7OA 1KLMA 3T1AA 4TYBA 3OHBA 3SYZA 1RT3A 2E9ZA 3OYKA 4QAGA 1JXEA 5EU7A 2D0AA 4J2EA 3DRSA 4PQUB 5HP1B 4KHNA 1S1VA 4J9KA 3K5LA 4ZTFA 3RRHA 2HB5A 2ATLA 3HPGA 3H5YA 3KKRA 3OJUA 4PUOA 4KB1A 1FK9A 3KLIA 2FBTA 1EETA 1RTIB 1JLQB 2VA2A 4RW4B 2FLPA 3HHKA 2YNIA 3AO1A 3KNAA 2DPIA 4DL3A 3VQSA 1WSJA 1HQUB 5DQGA 3DOKA 3PUFA 3QINA 5HRPA 3Q8QB 2I1RA 2IS3A 3OLBA 3VQ4A 1A5WA 1SH0A 3NKYA 4IRCA 4WFXA 4TY8A 3OL9A 3ZT4A 3M8QA 3KK2A 1EETB 3NGYA 1HNIB 3E01A 4DLGA 3BSCA 3CM5A 4NLTA 4ZPCA 3TAPA 1HYSB 1IG9A 4LSLA 2KFZA 1RT2A 4LSNA 4KTWA 1UA1A 2OZMA 3OYLA 3MAQA 3EPIA 1TVRA 4K4WA 1TL1A 1L3SA 4FJGA 1RT3B 1JLCA 3IN5A 2X78A 4URGA 5JS1A 2OPQA 3H08A 4XIUA 5C25A 1RDDA 2XY6A 4J9OA 5E41A 1RDAA 3QIPB 2B43A 5KFIA 4F4YA 3CM6A 3TAMA 3KLGB 2DFEA 3LZIA 2ZD1A 4FS2A 4ZVFA 2BQRA 3HT3A 2BDPA 5HROB 3RTVA 4ECSA 2X6NA 4JS5A 4KSEB 1WAFA 3RMCA 1WSIA 3VA0A 1K1SA 2D5RA 3V1QA 2WOMB 1RA6A 3V4IB 2VA3A 4QW9A 4E19A 2OPPB 3SUOA 4M3RA 4K4YA 2Z1JA 3KLVA 3HSTB 3Q8PB 5HRSA 4K4SA 4ED6A 1HNVB 1S10A 3CQ8A 2A1RA 4ELTA 4JUZA 4E1MA 3EZUA 4B9VA 1KFDA 4KBIA 1S1XA 3S3MA 4FJ9A 2BE2B 1CSJA 4CCHA 3WNGA 4FK4A 2C28A 3CDWA 1Q8IA 3M8SA 1RT5A 2ZE2B 5CZ2A 1T03B 4E7KA 1ZTWA 4WYLA 2OPSA 3DYAA 2B5JB 4WXWA 1WNSA 3C6TB 3AVGA 1BL3A 4NCGA 1LWCA 3NHGA 1S4FA 3BGRB 2HW3A 1FKOB 4ZPAA 4DTUA 3SJJA 3VQAA 3RWUA 5HRNA 4Y2AA 4B8AB 4FM0A 3KJVA 4QWEA 1RTDB 4FW1A 3V9XA 5KG1A 4CJVA 4MIAA 1BI4B 3RMAA 4RW6A 1B9DA 3GIIA 4OL8A 3H5UA 1QAIA 4EBDA 5I42B 4N76A 3AVJA 3KMQA 5KT6A 2YNGB 2X74A 2ASLA 3IRXB 3C95A 2FJWA 4NLVA 4EBEA 2G8HA 4CGIA 2FJXA 1DTQB 4R5PB 4CIFA 1RYSA 2HWHA 3SI8A 4EP5A 3LWMA 3HJFA 1JL1A 4KAZA 1NOZA 2QKKA 3AVKA 3KK3B 3PY8A 3MR3A 2W9AA 1WSEA 4CHQA 4YR3A 3LALA 3ZSYA 4F3OA 4EZ6A 1U49A 1Q9XA 4IQXA 4HTUA 1C0TA 3ZSXA 4FXDA 2I5JA 3OSNA 1BISA 4WFZA 4ID1A 4ID5A 4JS4A 3UQSA 3DM2B 2NUBA 2YNGA 2P5GA 3NAIA 4RW8A 5KFHA 3H4DA 5KG7A 3VQCA 3KHHA 4L8RB 1RTHA 4H4MA 3O3GA 1SKWA 1UWBA 4ECWA 5DQIA 5KFVA 3LP0A 1JLQA 4EYIB 3TAQA 2GC8A 1A5VA 2C2RA 3BGRA 1S0NA 3NAEA 3VQ8A 4CF1A 2IJFA 2YNFB 4B9TA 5KT2A 2Z1IA 1N5YA 3OYJA 3N6LA 1RT6A 2R2TA 4I9LA 3G6XA 2XCPA 4FLTA 4B9SA 3ULDA 1RCHA 3HXMA 3VQ9A 3QEIA 3CFPA 2OH2A 1Z26A 2VG7B 2OYQA 3V4IA 3PW7A 1GOAA 2HNDB 3LP2B 4Y34A 3TVKA 4CFBA 3U3GA 1IKVB 4AH9A 5C24B 1TL3B 1VSIA 4CJSA 3FFIA 3MTKA 5HP1A 4KKOA 3OYFA 1S1XB 4CJQA 2XC9A 1T05A 4IH7A 1TGOA 1KLMB 3SPYA 3G6VA 1SL0A 1UA0A 3IS9A 1NHVA 1JLBA 5DLGA 4YMEA 1JXLA 4AHSA 4ECZA 2D0CA 4CEZA 1WSHA 1VRTB 1LAWA 1UOCA 3L2QA 4HUFA 4KKOB 4RU9A 4C8MA 1VSJA 3MECA 1TV6B 4DSKA 1NJZA 3CG7A 3NBPA 5FRNA 4B9MA 3KHGA 2E4LA 3NE6A 4N5SA 4CGGA 4DLEA 4QW8A 4E0DA 3GYNA 3TANA 4N56A 4EYHB 4NYFA 3M8QB 2ALZA 4JRPA 3GIMA 1S9FA 4CJ5A 1D9DA 5DGBA 4DL6A 1VSLA 1NK9A 5L9XA 4G1QB 5CY4A 4TLRA 2OA8A 4EO6A 3PHEA 3MR5A 3PX4A 3TAFA 4CJLA 3B6PA 2XRIA 4KTQA 1TKXA 1SL1A 1RAJA 2RN2A 5DG8A 1X9SA 5KFNA 3EPGA 5EDWA 2FBXA 1HYSA 2G8FA 3QGGA 3KHRA 4X2BA 4ECXA 4MFBB 5DGAA 2JLEA 4CFAA 1FKPB 5KG2A 2AGPA 1IKXB 1WSFA 4DG1B 4CJPA 2IGIA 4ECVA 4PUOB 3CJ5A 4B9LA 3OHAA 3PW2A 2J6TA 3FQLA 4F2RA 2RKIA 4MQ3A 1S6QA 4CJ4A 1CXQA 2JEIA 2IA6A 3F73A 3SFUA 3TAEA 1ZBHA 5KFPA 4RW9A 4FYDA 4ZHRA 4Q0BB 4DTXA 5KFOA 4OKJA 2FVSA 3V6DB 3QEPA 1N4LA 2XHBA 3RRGA 4EEYA 3AVIA 1LAVA 5KT3A 4DEZA 4RNHA 2AGOA 4NLPA 4KHUA 4DFKA 1KLNA 1VRUB 3CDUA 1S48A 4WYWA 4FJNA 3MEDA 3ISND 1N48A 3I0RB 3L2UA 2DTUA 1VSHA 3I0RA 3TQ1A 4QPXA 2YNHB 5HBMA 3MXIA 1QSSA 1KVBA 4EP4A 2PZSA 2BE2A 4W5NA 3DLBA 2P1JA 1X1PA 4M41A 4PA1A 4DF8A 2UVVA 4ZTJA 4KE5A 3DYAB 2IM2A 3OYNA 2V0NA 2G8IA 2KZZA 3VQDA 3LDSA 3SV4A 4FM2A 4M3UA 4CHNA 3DI6B 4FZXC 1JKHB 1S1TA 2W9BB 3ZSWA 3M8PA 1DLOB 5KG6A 4F3TA 1JLAB 1QSLA 3ZSQA 4NCAA 3NAHA 2JEFA 1S0MA 5KG4A 3P1GA 3LWLA 3P5JA 1JIHA 3LP0B 4DS4A 3QYYA 1WNEA 4DG1A 5F8GA 2XY7A 3V6KA 5J1EA 2YV0X 4OLAA 2J6UA 1YT3A 5J2PA 4FJMA 1LW0B 2ZD1B 3LAMA 4U7CA 5L1KA 4O0IA 1MMLA 4NZ0A 4K4VA 3PJWA 4DTJA 5FRMA 1KTQA 3PR5B 1RT2B 4LSNB 4KB0A 3L2VA 1C1BA 1NNDA 4IKFA 3ZT3A 1VK0A 4AHUA 1KSPA 4NCBA 3TAGA 3GIKA 4DFJA 2V4RA 4WZQA 4HUEA 3JSMB 4CEOA 1T7PA 3T5HA 4ZHRB 4RW7A 4Q0BA 3DLRA 1HQUA 4FLWA 2OPQB 1HNIA 3E01B 4DSLA 5CYMA 5J2PB 3QIDA 2PY5A 2Z1GA 1U47A 1BIUA 2ASJA 4FCYA 5F8JA 2IMWP 2ASDA 2B5JA 3V9WA 3EZ5A 2ILZA 2GBZA 2HNYB 4YQWA 1T3NA 4NLDA 5KT5A 2AQ4A 4G1QA 4CJ3A 3L3UA 4Y3CA 1NK6A 1KRPA 3GILA 3TARA 1RT1A 2UVUA 4OVLA 1RNHA 4KAIA 3PO5A 3QLHB 2P5OA 4OPJA 5F8HA 2R8JA 1S1UA 4MH8A 4LH5A 1S1WB 3PR4A 4FVMA 4KHSA 2AWZA 3NF6A 5KFCA 4MIBA 3CYMA 1REVB 1JLGB 4QWCA 3HP9A 1VSFA 4CJWA 1YVFA 3WNEA 2CKWA 1NJYA 2IC3B 3MEEA 1HQEB 3LP2A 3PX0A 3M9MB 1U4BA 1ITGA 5K14B 4E89A 4O44B 4ICLB 3SUPA 1HMVB 1DLOA 3KHLA 5FDLA 2QE5A 3RB3A 1W25A 1JLBB 3SV3A 5I3UB 2HHXA 4TXSA 5JS2A 2D7SA 1IH7A 5C5JA 3DRRA 1J9AA 2B6AA 4QOZB 5KI6A 2KZMA 3AV9A 2V4QA 4AHCA 1TK0A 4N41A 1S9GB 2YNFA 3A2FA 3VA3A 3AVHA 3SQ2A 4G3IA 4M42A 4CESA 4NRTA 5HROA 4JV1A 4Z4FA 4ZP6A 3ALYA 3DLEA 2RPIA 3SI6A 3K58A 5J2MA 3QO9B 4GC7A 1S0OA 2HHUA 2RDJA 3T5KA 2F8SA 1IKWB 3N6NA 4OGCA 2D0BA 2G8UA 4KHQA 3OSPA 4IG3A 2IM1A 4CF9A 1WN7A 3ZSVA 2Y1JA 3C94A 3DOKB 3QZ8A 1JX4A 2E9RX 4BWJA 3BREA 4IKAA 2WCXA 3BJYA 4IRKA 3HK2A 1SKSA 4B3OA 1C0TB 1BCMA 4MFBA 4YP3A 4LQ3A 3QNOA 3OYEA 4XPEA 1GOCA 1ZBLA 3K5MA 4FLYA 2VG5A 3LP1A 3KIOA 3G86A 4C8NA 4FZYA 3OL8A 1L3VA 3KLEA 4CGFA 4J9SA 1ZBIA 4JRQA 4LD0A 2EC0A 4HCCA 2I5JB 5FROA 3GV5B 3AA5X 4CE9A 1LW2A 2W42A 4F4KA 2EHGA 3OS1A 4H4OB 5DLFA 4LSLB 2R8IA 4CK1A 1TV6A 3QZ7A 1EP4A 1D8YA 1VRTA 3DDKA 4CHPA 4HCBA 3C6TA 3ZCMA 5KFDA 3RR8A 4C8KA 5KFFA 3L3VA 1NJXA 4ZP9A 3HVWA 2BQUA 3N6MA 5D3GB 4M3ZA 2FVCA 2HHVA 3ITHB 3SNNA 1T05B 1IKXA 2AJQA 1U04A 3NF8A 4Q45A 3DLEB 1D0EA 4K8ZA 4FZZA 2IDOA 4WXOA 4W5OA 3G10A 3BSNA 5DMRA 4IR9A 3U6FA 3TR8A 3VQ5A 3OYCA 2OPPA 2FVRA 4KHRA 4CF2A 1NK7A 1TKTA 4QWAA 3FDSA 1RDCA 3KLHA 3ZSZA 2HHWA 4DTPA 5EUHA 3U3YA 4PWDA 1TQLA 3HO1A 1C2PA 4MKAA 4Y1CA 4ECQA 1C0UB 3MF5A 2IC3A 2E6MA 3UIQA 5CZ1A 2YKMA 1RT5B 2ZE2A 4IDKA 3QIPA 3IGNA 2HNZB 3BQ2A 4ZVGA 1L5UA 1LWFA 4Y2CA 1FXXA 4GW6A 2PYLA 1J53A 1JLCB 4IFVB 2VG7A 4Q5VA 3OS0A 1XHZA 1S97A 3LPUA 1OS5A 1TAUA 4KHMA 4Z4IA 1R0AB 1S1UB 3KLEB 2D41A 2DY4A 3KLHB 4FJXA 3M9NB 4DFPA 3ZSOA 1O1WA 2Y1IA 1YTAA 3QESA 3DLGB 4DMNA 3CJ3A 3PZPA 3AO3A 4WFYA 4HVJA 3AVNA 4ELVA 2WONB 5SZTA 3SZ2A 2G8VA 1S49A 5L1IA 2RKIB 3NGIA 1XC9A 4YR2A 4H4OA 4KI6A 1GOBA 2Z1HA 3OYIA 1RT1B 3CFOA 3KTQA 1BQMB 1RILA 4O3RA 4RW4A 4BDYA 1K6YA 4CJEA 5KG5A 1HPZA 3CDEA 4Q8FA 4I2PA 2FBYA 5C25B 2BQ3A 3S3NA 1NK8A 4EZ9A 5J2NB 4FK2A 1D1UA 3L2RA 4O4GA 4I7FA 3NGDA 2R2UA 3HKWA 4FJ7A 2UVWA 1IM4A 4FJ5A 5F9LA 2YHAA 2UUWA 1RT7B 1RBTA 1HPZB 2OPRA 3VN5A 4OPKA 4ED0A 2BGGA 2ZKUA 1LWCB 4CHZA 5J2QA 4RUCA 5DG9A 5DK5A 4QCLA 1SV5A 2HMIA 5KFEA 4I2PB 2G8WA 1MU2B 4FBTA 2P51A 4Q8EA 4CECA 1R0AA 5FDLB 2DFFA 5KG3A 1C0UA 3O4QA 4FW2A 4IOBA 4TYAA 4ZP7A 1BI4A 3G0ZA 2HHTA 1BGXT 4M3TA 4Q44A 3KJVB 4CF0A 3AVFA 2ILYA 2YKMB 4O3OA 4J2DA 4HKQA 1RA7A 4CFCA 1RYRA 4J9NA 4M3WA 1JLGA 4NLOA 4R5PA 1TK5A 2XI3A 4KI4A 4IH6A 3CJ4A 3IRXA 3ZT0A 3C6UB 3MR2A 2UVRA 1CZBA 4Z4EA 2YKNA 3L2WA 3ASMA 3KLFA 3DMJA 1IO2A 2UUTA 2QXFA 1VSDA 4K8XA 1HMVA 1RBRA 3O3HA 5KFAA 1XR7A 1IKWA 4DSEA 1JLEA 5KFKA 2XCAA 1ZETA 1RTDA 2V9WA 4XPCA 2AX0A 3DI6A 5J2MB 1RDRA 5KFXA 4ED2A 4WE1B 4YFUA 1CXUA 4F50A 2HNYA 3SQ1A 5F8LA 1CLQA 4E1NA 4J9RA 3KKSA 4OKEA 1TL1B 1KFSA 3NL0A 4CEQA 3D5MA 3IG1B 3AO2A 4DL5A 4U6PA 4RW7B 5HRRA 2YNHA 4AHRA 3SUQA 4WE1A 3M8RA 4DQRA 3NDKA 1LW2B 5HLFB 5KT7A 3F9KA 1SKRA 3DLHA 3PW5A 2O4IA 4GMJB 4FJIA 2ITGA 4K4ZA 4F2SA 4CFDA 2BRKA 2C2EA 3NH2A 2FVPA 5KT4A 4DU3A 1DTQA 4H4MB 1RTIA 1BIZA 1EP4B 1NHUA 3ITHA 5KFBA 2O4GA 3QIOA 2BANA 3I8DA 3QLHA 2WONA 2EX3A 3D0PA 2XWYA 1S6QB 4HYKA 4DQQA 4AILC 4NLSA 1EX4A 4DWIA 5CYQA 2E6LA 4FLUA 3H5XA 4KV8A 3NGZA 1Y97A 2J6SA 1B9FA 3OYAA 1C1CB 3K2PA 4DL7A 3H4BA 1IKYA 3BQ0A 3G6YA 1B92A 4JV2A 4IFVA 4K4UA 4URSA 3KOAA 3QGHA 5F9NA 2IBKA 4ZP8A 5KGXA 1TKDA 3HYFA 1BQMA 3QEWA 1WLJA 1QE1B 4NLUA 4FLXA 1QHTA 1T8EA 3IAYA 3RR7A 3PVXA 4CGJA 4O4RA 3RMBA 2QKBA 4FLZA 4PQUA 1QQCA 1S9GA 1HRHA 2KW4A 3MEGA 2JEJA 4W5RA 3QO9A 1KCFA 3T19A 5C42A 1C1BB 1T03A 1SL2A 1ASWA 3S3OA 3VQQA 1NJWA 3OY9A 3K57A 1SUQA 4IG3B 1TKTB 4ZVEA 3V9UA 3CWJA 5JXSA 1Q9YA 2YNIB 4AHTA 5F8MA 3H98A 4F4ZA 4F4WA 3MR6A 1ZBUA 3GIJA 2XO7A 3DRRB 4DTOA 3OYMA 1RT4B 2WB4A 4BDZA 2WTFA 2YKNB 4MK8A 4E7LA 2XY8A 4F4XA 2IAJA 3ZT1A 4OJRA 3V6HA 1NKEA 4TQRA 1HYVA 3OYHA 2XGPA 4DQPA 3D45A 1REVA 2HHSA 4N47A 2WHOA 2D3UA 3CIZA 4MKBA 3VQBA 4BE1A 1L3UA 4NYZA 4BE0A 4ECYA 2R8KA 3AA2A 4ZVHA 4JLHA 4O0JA 3LANA 1U48A 1UAXA 4RNOA 3OS2A 1NK0A 2OPRB 1CZ9A 1S1WA 5KFTA 2BR0A 4C8LA 4LH4A 2HMIB 3WNHA 3LP3A 2QV6A 2X6SA 3SUNA 4K50A 1JLFB 1XI1A 4F8RA 2C22A 3AO5A 3K5NA 2RF2A 4TY8B 3OYDA 4ELUA 4O55A 1QS4A 3QNNA 1RDBA 1Z4UA 2FLLA 5KRSA 4O3NA 3GV7B 5L1LA 1VRUA 4KO0A 5J2QB 3CJ2A 3OLAA 3VQPA 4B9UA 1X9MA 4K4XA 1T94A 3CO9A 1RBVA 1RTHB 4OLBA 3V81B 5EWEA 3AVAA 1YTUA 4O3QA 4H54A 5KFMA 1I6JA 3QERA 3ZSRA 3OJSA 1RBUA 4C8OA 3KK1B 4E7HA 4W5TA 3EY1A 4CEFA 4O4GB 4ID5B 5KFQA 2QK9A 1TKZB 4DQIA 3KK2B 3LPTA 4XO0A 3V1RA 3KMSA 3I5BA 1XHXA 1VSMA 4DL2A 1W9HA 2GIQA 2ETJA 2VWKA 1SH2A 4CEAA 1NKCA 4H8KA 4E7JA 1LV5A 4CEDA 5KFLA 4DTRA 1JLAA 4RNFA 3ZT2A 5F8NA 1KVCA 4M3XA 3DLGA 4Z4CA 4FJJA 1JKHA 1S1TB 1KHWA 2W9BA 3CVKA 1QSYA 2W7PA 5C24A 2Q3SA 1RT4A 1KVAA 3TABA 2JGUA 4BDPA 2FC0A 4MK9A 3V81A 1LW0A 4Z4GA 1J5OA 3V9SA 5HLFA 1HJRA 1U09A 4FLVA 3MFIA 2R8HA 4TSXA 4BWMA 3V9ZA 2JEGA 4CERA 1C0MA 1NK4A 3S9HA 5KFUA 5KG0A 4CHOA 3OL7A 4LY7A 5T14A 4EO8A 2GIRA 1S6PB 3RB6A 5KTQA 4J2AA 3AA4A 3JYTB 2VG6A 2AX1A 2GV9A 1WAJA 4DU1A 4CGHA 1EXQA 4M95A 4URQU 1JLFA 4J9PA 4IBNA 1IKVA 5HBMB 2LSNA 1X9WA 1ZTTA 2HAIA 3MFHA 2HVHA 3LAKA 3HVAA 4E3SA 1XR5A 3QGIA 1J5OB 4NLYA 3VQ6A 1S6PA 4B9NA 2WOMA 1C1AA 2B6AB 1NK5A 2ZQBA 3DMJB 3MEDB 4KV8B 4NLQA 1K1QA 2R2SA 4J9QA 1LWEA 1I39A 1QAJA 3NF7A 4CEBA 4YNQA 2DPJA 4ECRA 3JYTA 5K14A 4DSIA 4FK0A 2YHBA 3NH0A 3NCIA 3DLKB 2BANB 1QTMA 2W8KA 3SPZA 1W0HA 4FJHA 1QE1A 1J54A 4KPYA 4RZRA 2A1SA 3HPHA 1S5JA 1C1CA 5KFZA 4R0EA 2F8TA 3CJ0A 4RW8B 5I3UA 3H2LA 3FQKA 4CK3A 4FJ8A 3KD5E 3QEVA 2BRLA 4ECUA 1SH3A 2WRMA 4W5QA 4ED1A 3LP1B 2VG5B 3HVRA 1TVRB 3BDPA 4CJKA 1HQEA 5J2NA 2O5DA 1MU2A 3MXJA 2R8GA 2RDIA 3KK1A 1FKOA 1G15A 4RW9B 4PY5A 4I7FB 3T5JA 3DRPA 1N6QB 5KRTA 4B3OB 3I5AA 1ASUA 4QWBA 3DRPB 4KRFA 1BHLA 3FSIA 2KQ2A 2FBVA 4Z4HA 2IOCA 1RT7A 2XI2A 2DFHA 3PJXA 3QEXA 3MXMA 3KD1E 3I5CA 5KGWA 3DM2A 4FS1A 4HUGA 4O3SA 3RB0A 1TKXB 3Q8SB 4CJRA 4ECTA 4CGDA 4KO0B 1GX6A 4CJUA 3IGVA 3M9OB 4RNNA 4DF4A 4GVMA 3BSAA 2R7YA 3H40A 4RG8A 4ZPDA 1S1VB 4E7IA 3SQ4A 3RAQA 3EYZA 4DQSA 3VQEA 4R8UA 1N6QA 5J1EB 1FK9B 3KLIB 4UQGA 1S9EB 1DTTB 4IFYA 2HVIA 4IDKB 4DTNA 4TQSA 3K5OA 4M3YA 5T7BA 3ISNC 3I0SB 3SCXA 4TY9A 5KFJA 4CJFA 3PX6A 4GC6A 4ZPBA 3BR9A 4CEEA 2HNDA 4ICLA 3GV8B 4O44A 3RBEA 4PWDB 4DSFA 3MEEB 4DL4A 4KFBB 3H59A 1EKEA 1TL3A 4KHWA 3RAXA 1SUQB 1XR6A 2IJNA 3CFRA 3NBPB 5KFYA 2AU0A 1SV5B 4B8CA 3C6UA 4KTZA 5DG7A 4O5BA 3BQ1A 4BE2A 4Z0UA 4R8UB 4Q43A 3PO4A 5EWGA 1JXBA 4NLGA 3FFIB 1NKBA 4FJKA 4IFYB 2HWIA 3HM9A 1TAQA 3AVBA 3AO4A 3OL6A 3HL8A 2W9CB 4KFBA 4NLXA 4WZMA 4I9QA 3O4NA 4M94A 3OYGA 1BCOA 4Y1DA 1ASVA 4EBCA 4ED7A 4AHVA 3ICLA 4RNMA 4BACA 3OYBA 3M8PB 2F96A 3NF9A 3L8BA 4FJLA 3TAMB 1KHVA 4DS5A 4ED8A 4OKKA 3HP6A 1HARA 3KLFB 4CJTA 5D3GA 3UDLA 1L3TA 1S9EA 2WK4A 4MK7A 1BQNB 5KFRA 2F8EX 1D9FA 4FM1A 1RTJA 3PW4A 1N5YB 2KTQA 3RMDA 3DOLA 3P83D 3TWHA 4YR0A 1TK8A 3BSOA 1TP7A 5C42B 1U45A 2FVQA 4K4TA 4FBUA 4NYNA 3AVLA 3B6OA 4NLWA 1UWBB 4B08A 1VSKA 1Z25A 5F8IA 1RBSA 4JV0A 4J2BA 3JSMA 3PW0A 3O3FA 5L1JA 3GQCA 1YVUA 4RW6B 3THVA 2GUIA 3FRZA 1HYZA 5CYMB 4CK2A 2VWJA 5DQHA 3HVTB 4IG0A 1LWFB 1GX5A 3RB4A 2HNZA 4IH5A 2ATQA 3DLKA 4IG0B 4IRDA 3SFGA 1F21A 3AVCA 4NCGB
chains in the Genus database with same CATH superfamily
4OFZA 4JI0J 2W41A 2E9TA 1MWZA 2VPYB 2OMLA 2DHHA 3TX8A 3K59A 1FJGF 2IM3A 5L38A 2FJVA 4ED3A 1A5XA 3E51A 4GVBB 3CJKA 1YTYA 5BYSA 1W97L 3O5BA 2FZCB 1NGFA 2MQMA 3CDAA 1IBKJ 4IR1A 4DX8H 2Y8YA 3LDNA 4B1VA 2LDIA 2JJ4D 4PYDA 5ETKA 2OZSA 3RBDA 3TI0A 3M2VB 4CO5A 4JKCA 1IQZA 2R2RA 4NXMF 1K0TA 5M1QA 4DUZF 1T9UA 1MA9B 3PJ9A 5ELZA 4LF1A 7FDRA 1GMWD 3T3FA 2XY5A 1CJTB 4LIWA 3ILLA 3J7AP 4NLRA 3MEGB 1S0VA 1JLEB 4NASA 3VEWA 2OD6A 1I3AA 4DUYJ 1PBAA 3LZJA 3HJVA 2CIMA 3HVTA 3CIPA 2MQNA 1BA0A 2V9KA 3A8YA 1N54B 2HHQA 2JVRA 1V5VA 2FPHX 2E8AA 3VQ7A 4O3PA 4HDGA 1D5AA 4YY3K 4KHYA 4QU7A 3W8GA 2XSJB 4HDHA 3T1AA 3CJ8A 3OHBA 2OTLS 2MQ8A 2X7IA 2VBYA 2D0AA 4OX7A 3VTIA 4B1XB 4L3NA 2V67A 3MPVA 1YVNA 4GVLA 3W66A 4CYUB 4A57A 4WFNL 1RTIB 1CLFA 1WG4A 2KXHA 2FLPA 2HIQA 2YWEA 3MUMP 3DCAA 3BF4A 4RR5A 3DOKA 3I6PA 4IWVA 4XH5A 2V6AA 4FSVA 3TSPA 3OL9A 3CCLS 1CULB 1FD8A 1JB0C 1HNIB 2DNQA 2J9DE 3VQTA 2VYPA 1RAOA 1UVJA 4CYUA 3TAPA 4LSLA 2KFZA 1UA1A 2CQIA 2B56A 3OYLA 4D3HA 3MAQA 2A1BA 3J7YI 2RQCA 4BG8A 3MR7A 3R5CA 3DU6A 5JS1A 3UE2A 4XIUA 2FGOA 2JZ5A 3TAMA 3O80A 1HNWK 1VQLN 1DQ9A 5A8RB 5IWAK 5HMZA 4GKKF 4P10A 1ZH5A 1P8ZA 4ECSA 4JS5A 2B4OA 2FHOB 3AXKA 1WAFA 3VA0A 1K1SA 3V1QA 3HHLC 4J91A 4E19A 3SUOA 4M3RA 3NGUA 2VHGA 4I6WA 3KLVA 4K2JA 2LQ5A 4K4SA 4ED6A 1S10A 2FHKA 3CQ8A 1X9JA 3MM6A 1KFDA 3GG0A 3WX4A 4KBIA 3OXLA 2FY8A 3S3MA 2Q6BA 1XC3A 3CCJN 2BE2B 1I51B 4CCHA 4FK4A 1Q8IA 1U1PA 4CM2A 2RRAA 1T03B 5CZ2A 2OI2A 2OPSA 1JCEA 3BO3A 4FWLA 1RWMB 1WNSA 5AQGA 3RBXA 1PC5A 3UCGA 2V7ZA 3CETA 2HBYB 1FKAF 3HLUA 4CIOA 1R0CB 3SJJA 4LR8A 4IJNA 1H7XA 3R3LA 3KJVA 4FW1A 4FF2A 3LPEA 5KG1A 4FDFA 1XNRJ 3JSBA 1UVKA 3OBIA 1B3TA 3RMAA 1NZAA 4KQZA 3HHNB 5DM7L 4RW6A 3FCWA 4EBDA 5LM7E 3AVJA 5KT6A 3ENOA 4YOTA 3AH6A 2X74A 4WYBA 5K8NA 4CZCA 2KVIA 2G8HA 4NLVA 2FHMA 4CGIA 1KBRA 1HNWJ 4R5PB 3RJMB 1BOTO 4WKRA 1AXQA 2BJDA 2OMOA 3LWMA 1NOZA 2KL8A 5GAHU 3CHWA 1HJOA 2W9AA 1WSEA 4CHQA 3LALA 1D3WA 3MPDA 4LF4J 4F3OA 1U49A 1EQYA 1Q9XA 2VGNA 2CQHA 1C0TA 3O1BA 2MYFA 4JS4A 4Y6IA 2NXEA 2YNGA 2YY3A 2KLAA 1FESA 1FXDA 2BMBA 4F3MA 4I6YA 4H4MA 3O3GA 4Q2LA 1UWBA 1IBKK 2QWOA 1UKUA 1WOPA 2C2MB 3CCVN 3LP0A 3BEXA 5ETVA 4EYIB 3HI0A 2VODA 3MMBA 4LRBA 3R2DJ 1A5VA 2GHVC 9RUBA 3M32B 4M7YA 5AQUA 3NAEA 2IJFA 2YNFB 2PN6A 5C12A 3OYJA 1IBKF 3D7SB 1NM1A 2JDJA 2RS8A 4GKKK 4I9LA 1F5AA 2IRYA 1RCHA 2X1GA 1PC4A 2VFRA 2VQEF 1LQ9A 2OFHX 5DZ6A 4C0OC 2VG7B 3V4IA 2LA6A 2HNDB 2BKOA 5CCMA 4ZKAA 3UKRB 2ZHBA 3U3GA 1AZSB 5C24B 5D4OA 3BS9A 4OX8A 1VSIA 2E5JA 2QEXS 3OYFA 2OFGX 1JQGA 1WG1A 3RG6A 5T41A 5DO2A 4NEZA 1KOHA 2DJWA 3PEJA 2QSWA 5DLGA 1JXLA 2GVZA 4AHSA 4ECZA 3FJ2A 1NSQA 5BPNA 1PYTA 2SXLA 4RU9A 4HWIA 3MECA 1NJZA 3AHPA 3HULA 1LXJA 5HMWA 4B9MA 2HVZA 3QRRA 2XMWA 4DLEA 4QW8A 2UUBJ 4C3LA 3IWNC 4EYHB 3NRBA 4UZCA 3NGTA 2KDOA 5HVGA 2XS2A 4CJ5A 3EE8A 5DGBA 4DL6A 4G1QB 1Q18A 4EO6A 2BE9B 1FFWB 3VENA 4BRMA 3L7OA 4DV4F 4ID8A 3TAFA 3KG4A 5AQPA 1YQHA 1YJVA 3EX7B 3B6PA 2XRIA 1K8KA 1TKXA 2AJ0A 1RAJA 2VKZG 2RN2A 3KHRA 4ECXA 2I38A 2P9NB 3AY0A 5K8OA 1KKHA 2KT3A 1WSFA 4ALZA 4KC5A 1V6HA 2Q36A 3CJKB 3JQJA 2IGIA 1FWPA 2U2FA 1MNEA 3CJ5A 2J6TA 2RKIA 4U8YA 2GX8A 2DEJA 1NGAA 4FPRA 5BRHA 5IQ6A 1S6QA 3B8AX 1M1KO 4U7UD 2P6SA 2GX9A 3NMUA 2D0PA 5KFOA 4OZJA 1AZSA 2NPIA 3P39A 4EEYA 3AVIA 2DTJA 2QLXA 1G7CB 1OVYA 4NLPA 4DFKA 4CO1A 3CDUA 2B4UA 4ISFA 3TJAA 2KXNB 5D78A 1QVFM 5AXLA 5LT5A 3GFXA 3T1HF 2NXUA 3BKTA 2QC3A 4X4OA 3L2UA 3UCZP 3IM8A 1FRIA 1WHXA 2J0SD 3TQ1A 2HBLA 2ACYA 1HHTP 2YNHB 5HBMA 1QSSA 1KVBA 1HWJA 2V8HA 1RFQA 4OYPA 3J7ZO 2P9UB 2MKJA 1SJ1A 1FJGJ 3L0QA 3TVYA 4KE5A 1U26A 2V0NA 2KZZA 2WVEA 1G4CA 3J7A1 3LDSA 1VQMS 1RUSA 4DR7J 4FZXC 3ZEUB 2W9BB 4J8FA 4K25A 4F3TA 1JLAB 4AE5A 2VFUA 3ZSQA 4NCAA 1PYSB 3E3XA 1OH8A 1Y11A 3ULEB 5A6PA 2E5IA 2VASA 3OUYA 1JIHA 3AB2B 4ZVQB 5F8GA 4LREA 4FJMA 4U7CA 1HI1A 1MMLA 3ZNJ1 3DWLA 1Q4RA 1KTQA 5E0OA 4LSNB 3L2VA 1C1BA 4UF4A 1NNDA 4IKFA 2YWKA 3S7RA 1VK0A 4DR2J 4WZQA 1T7PA 3QT7A 1DFDA 3S41A 3T5HA 3MM5B 3DLRA 1HQUA 4IO9Q 4FLWA 4LRAA 4DSLA 1FE0A 5CYMA 5ETRA 3ZZZA 3OD2A 3IC1A 2X1BA 2Z1GA 4CLLA 1FDAA 3WBZA 1U47A 3F0NA 1YJRA 4FWOA 5IC4B 3MAAA 3MX2A 5B0BA 2DGOA 3D4JA 1UCNA 3SEOA 1O5JA 5JVGL 2H48B 1ZBTA 3A5LC 1CS4A 3TYTA 3GILA 3TARA 2FIUA 3BM7A 4OVLA 2MZRA 4DV4J 4KAIA 3PO5A 3QLHB 1NMDA 2P5OA 1VQ8S 4MH8A 5GAHI 1HBUB 1SVDA 4IDHA 4KHSA 2M52A 4LRDA 5MLCV 1H1VA 5LXRA 3CYMA 1QZ6A 2HSEB 1E6YB 1MWYA 4OLPA 4CJWA 1YVFA 1UPMB 2V8VA 6FDRA 2CKWA 1NJYA 1HQEB 1NSAA 3LP2A 3M9MB 4I6MB 3E66A 4E89A 3BBCA 5B0FA 2QE5A 1ROFA 1W25A 2VCPA 2QWNA 3GLJA 2JSXA 5G0RA 4LF5J 5B0DA 3SSQA 4TXSA 3D6HB 2CQBA 5JS2A 1IH7A 3Q24A 2CGKA 4N41A 3V2UC 3WQPA 1CJTA 2ZHOA 3VEVA 1N36J 4JV1A 4IFEA 2KN4A 4KH6A 1F2HA 3SI6A 5J2MA 3CCWA 3CC4N 1SXLA 1IKWB 2QXLA 2D0BA 2G8UA 1A6LA 1YJ9S 3C15B 1VYAA 4IG3A 2P9KB 4U96A 4UOGA 1K73T 1ZM9A 4DPTA 1SKSA 3M2VA 1CJVB 4JI2K 5FJ4A 3KZBA 4B3MJ 3KNGA 4BCAA 4YP3A 3CD0A 1CC7A 4LQ3A 3R7BB 2ALYB 3K5MA 2VG5A 1DGKN 3DLLL 4RBUA 5CD4A 1R31A 3F56A 3L95X 3OL8A 2NREA 1L3VA 1S12A 2XHCA 3JTPA 1KVIA 4DR3F 1FFGB 3FZBA 1NO8A 1DEJA 3SBGA 4CM0A 2MQLA 1SB6A 2F8MA 3GV5B 2A6MA 2W42A 4F4KA 2EHGA 2VUGA 2EFPA 4IOAL 4LSLB 3KG0A 3L3CA 1MROB 4CK1A 3LDOA 2H4WB 3QZ7A 4JEPA 4C9DA 1D8YA 2Y1LB 3QBWA 3DDKA 2KM8B 1ZPWX 1VQKS 1VQ7S 3ZCMA 2BM1A 3L3VA 2D9OA 4X62J 3HVWA 3ULEA 5D3GB 4M3ZA 4YHHK 5LXYA 5ADZA 1T05B 2AJQA 2CA9A 3T6BA 3UDVA 1V4TA 1U04A 2A40A 4JK8A 4C98A 3MUTP 2VFTA 4DQ8A 3E9LA 4CLZA 5ADXH 2I2YA 1LOUA 3G10A 3U6FA 1AYEA 5AQWA 1NK7A 3TP2A 3ZTOA 3A3OB 3KLHA 4J5OA 2GELA 3ATUA 2QFJA 3U3YA 4DV3F 2YJFA 2W4PA 1BHNA 5AJ3F 3HO1A 3K0JA 4ECQA 1C0UB 4GO7X 2CJBA 3UIQA 5CZ1A 2YKMA 3QSIA 4MLEA 2HNZB 2DIVA 1L5UA 3HSCA 4GW6A 1Q81O 2PYLA 3A13A 1Y3JA 2NPFA 1JLCB 3FMBA 5IS2A 4JD2A 2NRHA 2ZJQQ 3L7PA 1W7AA 2VG7A 4Q5VA 3OS0A 1R0AB 3FCHA 2B9YA 1MMDA 3KHYA 3M9NB 1M5VC 1IQTA 2AP1A 3BR8A 2C42A 3A8JA 4CW7B 3MM8A 4MJKA 2VQEK 4LF5F 3D2EA 2GVDA 4N8NA 2RE2A 4CZMA 3Q7BA 2V69A 5IQQA 2GCFA 5L1IA 2XNRA 3JTNA 3NGIA 2ZH9A 1GOBA 3FSYA 4BC2A 1RT1B 3KTQA 3CFOA 4USWA 2NZTA 1RSCA 4RW4A 3Q2TC 1QY7A 5M1NA 5A0YB 3JXUA 1Y3KA 3HOTA 4L3KA 4CD1A 4UY8O 3CDEA 4PXCA 4I2PA 2VL1A 5C25B 3FFKB 1VLOA 1NK8A 3T6JA 5DM6Q 1OY9A 4FK2A 2MLXA 2DH7A 2BW7A 4BR5A 1KDNA 5H1SQ 3WXLA 4C4WA 2ZGYA 3TOQA 2PFUA 1UJ6A 4O4GA 2EKNA 2A3ZA 4OX9F 3G71S 4Z94A 2VDHA 1GEHA 4BRCA 4DCOB 1BWVA 2ZNZA 1T9TA 1RT7B 1RBTA 1HPZB 5A8KB 2E7WA 2BEFA 1W26A 5J2QA 4NLCA 4DUTA 4RUCA 2F7VA 3UVJA 3MM5A 4Q8EA 4CECA 3ZTQA 4DUZJ 1C0UA 1D4XA 5JLHA 2G0IA 2RAQA 4TYAA 1BI4A 2W2MP 2HK2A 1BGXT 4NLBA 4M3TA 4DZDA 2ILYA 4KGVB 5U47A 1EIYB 4HKQA 1RA7A 4CFCA 1RYRA 4J9NA 4MYUA 4I6AA 4M3WA 1JLGA 3LQVA 2ZH2A 4LRFA 2O3DA 2N82B 4JN4A 4IH6A 3CDBA 2Q79A 2MDAA 4C0BA 3IRXA 1EHWA 4DV2F 2DRDA 1NJIO 2FJAB 3ASMA 2ZJPQ 2XLIA 2W6KA 2QXFA 3B4MA 4K8XA 2RUSA 2ZVIA 1XR7A 1IKWA 1JLEA 3CMAN 4JI7J 4TVAB 2QLBB 2HS0A 3DI6A 4CZFA 5KFXA 3HHLA 2E2OA 1FCAA 1EKRA 3CJRA 3T1HJ 3MM7B 1WI6A 1YAGA 2VFVA 5AQYA 3HBTA 2OD4A 4CEQA 1UTAA 2YNHA 3U1MA 2JLFA 1VC6A 4HACA 4B3SF 1LW2B 4C0HA 1B70B 1HKCA 2ZC4A 3VAFA 3PW5A 2ABYA 4GMJB 4WFNQ 1IWAA 3G8QA 3NNCA 4J7CA 5BN8A 1TUYA 4C3MA 3Q2SC 2MHNA 2FVPA 2C3OA 1TUUA 5M2PA 2PMZD 4LFCF 2RQMA 4JI1F 3LDPA 1BIZA 4B9QA 2ZWHA 2DNKA 2PDAA 2P9NA 2BE7D 4FPAA 3QB0A 3IR7B 2WAQD 3QLHA 2WONA 3W1YC 1S99A 2KHOA 5AQZA 1CULA 1WOSA 1S6QB 2O1PA 3GFZA 4MDAA 2UUBK 4NLSA 4DWIA 2E6LA 4LT6A 2G9OA 2GJ2A 3AOCA 4RO0A 3H5XA 3NGZA 1B9FA 2HQDA 5CD4H 3C15A 3H4BA 5DZ7A 3BQ0A 5I4MA 2MJNA 1VHXA 3N4WA 2M70A 4FLXA 1T8EA 4O4RA 2HBMA 3TUZC 2HBQB 2A18A 3D2EB 1EAYC 3DGVA 4ZA1A 3CC7S 4L6V3 1F1BB 1T03A 3EKSA 2WW8A 1SL2A 1ASWA 1NJWA 4H4KA 4B17A 2ZH7A 3CCES 1UPPA 3ULHA 1Q9YA 4NL5A 2BOPA 1RAAB 4F4ZA 3MR6A 3MK6A 2BBEA 3D1OA 2WTFA 3EVMA 5J1PA 4MK8A 1NPPA 4F4XA 1QVGM 5GAEI 1GK8A 1NKEA 2DNZA 1WF1A 4DQPA 3D45A 2QN6B 2DNMA 1QDUB 3CIZA 3VQBA 4CLUA 3AJDA 2JH3A 3BF3A 2P9SA 2WB1D 2N3OA 4X62F 4O0JA 3LANA 2MKIA 3QWPA 1UAXA 2OPRB 5AE1A 1ATSA 5KFTA 2EG2A 2BR0A 3LP3A 2M8DB 2K1RA 2X6SA 4K50A 4DR1J 3D54A 3KWMA 4B3SK 1FRKA 2FLOA 4O55A 5LMUK 5AT1B 3HOSA 1IG8A 4F67A 2J0XA 2AYBA 1C0FA 3IM9A 4KO0A 4B9UA 3CO9A 4A8QA 1RBVA 6AT1B 1DRZA 3V81B 5KFMA 2I8EA 3QERA 1RBUA 3KK1B 5HMXA 1VK3A 4W5TA 2F9DA 4JKGA 2MHEA 4CEFA 3KJQB 1RK8A 2FD2A 4XO0A 4CZJA 3O2IA 1XHXA 1VSMA 3UNYA 4DL2A 2IHR1 2Z4PA 1OQ3A 1W9HA 3CCZA 1M5OC 1T0TV 1SH2A 4H8KA 4TU9A 2CPDA 1FD2A 5KFLA 4CEDA 4DTRA 4U67Q 1GFWB 3VAMA 1S1TB 1KHWA 1GMWA 4YDUC 1YJTA 5C24A 4QIGA 5KQDA 2Q3SA 3DOMA 2FZKB 1QQNA 2JGUA 2XM3A 4YHHF 2QA4S 5AJ3K 3EICA 2OTJN 3VGSA 1HJRA 4FLVA 1F2GA 1B0PA 3EVOA 3LW5C 2JEGA 3I82A 2GUPA 3GIRA 1DKGD 3P49B 2O8DA 4M5MA 4JI7K 1VOMA 1X4BA 5AXKA 2Y9HA 1XQIA 2E1MC 4EO8A 4MYTA 2Q0UA 1WAJA 3KDNA 4CGHA 4CLFA 2J4RA 4J9PA 1RWUA 4BC7A 2E2PA 1IKVA 2LU1A 1ZTTA 2HVHA 3AGRA 3LAKA 3HVAA 5C2CA 4MT1A 4UOFA 2B9WA 3VQ6A 4HI1A 3BYRA 4B9NA 4DV3K 1C1AA 4I4BA 1NK5A 3GWCA 3DMJB 4YDDB 1I94F 2HHHJ 4ZPVR 2R2SA 5HL7L 5CXTA 3IXQA 2RT3A 1OYEA 1E4FT 4CEBA 2DPJA 1DT9A 3IMQJ 4DSIA 2YHBA 2PAVA 1GXUA 4USHA 4LFAK 2CQ3A 1GLEG 3P8BB 3VEZA 4OHZA 3I56S 4KPYA 4PRFA 3M2UA 2NRXA 1C1CA 4P72A 1VQMN 3FQKA 1YZ6A 4BLGA 3ZTRA 1RU1A 2OSQA 1Q86T 3QEVA 4W5QA 2R3VA 3HVRA 5AQJA 5GAEP 1S6OA 4DU7A 2VJVA 3BDPA 2YWGA 4LF9F 5J2NA 2AW0A 1MMNA 2CWKA 2CZVC 2R8GA 2RDIA 3O9SA 1RAIB 4P9SA 4RW9B 1YGYA 4I7FB 3OTEA 2RRBA 3O08A 2CAJA 3DRPA 1N6QB 3GJRB 1RHRB 3I55S 2XI2A 1IM6A 3PJXA 3QEXA 1VQPN 4RCHA 2W2QP 2OANA 1Q0NA 3DM2A 4HI2A 4O3SA 3PFOA 3ZETA 3HHEA 4F3QA 3ID6A 3P31A 1DZ5A 1BXNA 3N01A 4NEYA 1GX6A 2Q2RA 2E7VA 4AL5A 3H6EA 1NB2A 1A9NB 3MD3A 3EXCX 4RG8A 2HHHK 4O23A 3SQ4A 5C0YA 2IMOA 3VQEA 3DLLQ 4R8UA 1FWKA 3OFEA 1SJFA 1FK9B 3SIPB 4NMLA 3QJLA 3TU5A 3OXGA 4CZKA 4TQSA 3A5NC 3ISNC 3HMJG 3I0SB 3VF4A 5KFJA 4CJFA 1AFIA 4CEEA 4ICLA 3RBEA 3VVTA 4NX9A 4DSFA 4Y0FA 1NU4A 2PI4A 2RHQB 3RAXA 1RQ0A 2ZBRA 2IJNA 3D6MB 3FEXB 2AU0A 1LEOA 3O9QA 1OVQA 1W2BR 4Q43A 3VOVA 1YX2A 3UD3P 2X1FA 1BWFO 4JI2J 3FFIB 2W24A 2DK2A 5IC6B 3OV7A 4KH4A 2BJEA 1TAQA 4WZMA 4B3SJ 3UKRA 1M5HA 1JXVA 4JV5J 3FNNA 4ED7A 3OPKA 3O6WA 3L8BA 2F1FA 2VC1A 1SI9A 1HARA 4ZVSB 1FJ7A 2QWQA 2YJEA 3KLFB 5HANA 2B4VA 3UDLA 3K89A 1BQNB 2F8EX 4HHJA 1RTJA 1Y9OA 2E5GA 1U6BA 4OX6A 2CYYA 3RMDA 3TWHA 1AUSL 2V2VA 4IO9L 4LF7K 3MCNA 1RE1B 4FBUA 5DETA 3TA1A 2QA2A 2EK6A 1VSKA 1RBSA 4H5NA 3ENBA 3D66A 4NXNF 3JSMA 3I8BA 1QHAA 1MWQA 1YVUA 4RW6B 2GUIA 2FJBB 4DV0K 1HYZA 4CK2A 1NGEA 5DQHA 3HVTB 4IG0A 4J9VA 2DCUB 3KDOA 4IH5A 5LL6d 3U7JA 2F9TA 1R0BG 4WCEL 3UD4P 4PZVA 2DNLA 2HBRB 4NCGB 1ZM2A 4DR5J 1XMOK 2XBPA 2JC1A 1LWEB 4DTSA 3NMAA 3A1YG 4I2QB 2IM0A 3U27A 1T02A 3KK3A 4CTAB 3VAHA 3AA9A 4M7XA 1CEZA 3QPIA 1VSEA 2IAJB 4KB7A 1ZBFA 2ZOMA 2YCHA 4CIEA 1C4CA 1ZS6A 2D3ZA 2UUAJ 1JL2A 3H5SA 4CQ1A 2LEPA 3MMAB 5KFGA 2WVDA 4DV3J 4YY3F 3SQ0A 2OKQA 2JC0A 4CT9A 1XWLA 4LQ9A 2BJ3A 4FKXA 4YY3J 3O5TB 4M5HA 3V6JA 2DVIA 4DV6K 1CC8A 2ZBIA 3H20A 4J9LA 1C6VA 3PIOL 5HJXA 3W65A 5LMUF 1FVQA 1WUAA 5JJBA 3C6HA 3O8MA 3VAKA 1HBOB 2ACMA 3G4SS 3AVMA 2B4JA 3V1OA 3D1HA 4X84A 4ETXA 4HTJA 2AEJA 1YIJN 5SWMA 3W5ZA 5A2QO 3UKUB 2Z57B 4DV0J 4RUAA 4DR2K 2DCLA 1VIOA 2Y8WA 3KLGA 3T1YF 4FWQA 4PL7A 1G6BA 3WNFA 1EKSA 5CYQB 1HA1A 2ZHAA 1RT6B 3SYZA 1JXEA 5CYJA 1F9HA 2OP5A 4PQUB 4NYPA 3K5LA 2CQDA 3CJSA 2HB5A 2FJDB 2ATLA 4YOVA 3KLIA 1EETA 1JLQB 2AA4A 2MLZA 4RW4B 2AT1B 1G99A 2RIJA 4DUYF 3AO1A 1NGGA 1V5IB 4WFBQ 3VAIA 2UZAA 3PUFA 3JSYA 3ZZ0A 2UXBF 2I1RA 1SH0A 4OYWA 3NKYA 4BR7A 1SPBP 4IRCA 3ZT4A 4L74A 3M8QA 3KK2A 4RBTA 3J8AA 1X0FA 1B99A 2C1EB 2H5IB 1UFLA 2VOOA 4NLTA 4BRIA 4LSNA 2OZMA 4KTWA 3GCWP 3C14A 4FJGA 1AFJA 1FI4A 1JLCA 2COLA 3TA0A 1Y5IB 2MQOA 2UXDJ 3NLCA 3D6TB 4DV5K 1RDDA 3NGRA 3CM6A 2DFEA 2N4CA 3LZIA 2BOAA 4U67L 4ZVFA 2L41A 1X4EA 3TEHB 3RTVA 4DR4J 5BPLA 2KXFA 4H5TA 3EVWA 2UYTA 2ROGA 5GADI 2DISA 2VA3A 1MW7A 4QW9A 1HNWF 1LOTB 1SJQA 3GFYA 4B3MF 2QX0A 4FXWA 5JLFA 2HGMA 1HNVB 2A1RA 4YOUA 3K2YA 5H1SV 4UW2A 4NXMJ 3MN9A 4AYBD 5B7WA 4WU2A 4DV7J 3OR1A 1FJEB 4CD3A 3NOGA 1RAEB 4CZHA 3R9PA 2XMJA 1VQ9S 3CJQA 2OO4A 2LVWA 4WYLA 2ZEJA 3DYAA 1OQ6A 4OZNA 3AVGA 1VCTA 1BL3A 2YHXA 1LWCA 4X4UA 2PMHA 1QTNB 5KPTA 5D0RA 3M32A 4PQAA 1FKOB 3VQAA 1XJWB 3SJHA 3RWUA 3AARA 1CBKA 4GO5X 1Q82T 2CPIA 4W4MA 4JHDB 1VJWA 1QAIA 2MGZB 4U7BA 2D4WA 2YNGB 1ACMB 3RGIA 2AEFA 2CGLA 3KUHA 2GMLA 1URRA 2WVBA 4EBEA 2FJXA 3BGOP 2NRTA 1NLKL 3U1LA 2RE1A 1NGJA 2KFYA 3J80Y 1JK9B 1CJKB 3SI8A 3HJFA 5E7OB 2QKKA 3AVKA 4ES2A 2YWHA 3MR3A 2GTDA 3J7AN 1OO0B 3K7RA 4YR3A 3D0IE 1N5QA 1PGZA 3VALA 3PACA 4HTUA 3PIPL 4FXDA 1S7IA 2GA7A 2ZITA 4WFZA 2KKZA 2P9IB 3UQSA 1N33J 4ATNA 5CHCB 2HBKA 3ILJA 2P5GA 2MMYA 5KFHA 1NM2A 3UFCX 2APOA 1RTHA 3MHYA 5ETMA 3UKUA 4ECWA 5KFVA 1YG0A 1UVMA 3TAQA 1WC0A 1SZ2A 1G1XA 2C2RA 4NI2A 3BGRA 1S0NA 1XMQJ 1N5SA 3QAUA 1FDDA 3VQ8A 2A3JA 1NDLA 2IDLA 5KT2A 1X4DA 4TNOA 2Z1IA 2B9EA 5HI7A 3IUCA 2R7TA 3CC2N 1WBDA 4RL1A 5B0EA 1KQFB 4FLTA 4F7VA 4QIVA 3HXMA 3CCQS 3DAWA 4GV9A 1KOOA 3N5BA 1N8RO 1NG9A 2EFGA 2OYQA 3PW7A 4EK2A 2DXDA 4CRJA 4CT8A 4CFBA 1IKVB 3PG9A 3QJPA 4DZ6A 4K5RA 2QM1A 1TL3B 1W7WA 5FPMA 4WTYA 2YBVA 4KKOA 3Q7CA 2IJRA 4CJQA 2XC9A 3SQGB 3EEQA 3EJMA 3THYA 2RUGA 3R6LB 2R7SA 3G6VA 4ZVUB 5E33A 5EN1A 3IS9A 3PFEA 1WB9A 2AIRB 5E3AA 2ZZTA 3HZEA 2D0CA 4CEZA 4OYAA 4LFCJ 4A8KA 1LCUA 3AAWB 2GFFA 3C46A 3TPQA 2KB2A 4HUFA 5CAAA 4C8MA 3AGKA 1VSJA 1TV6B 4I69A 3CG7A 2CNKB 1E4GT 5FRNA 2FTRA 2KG0A 1N33K 3KHGA 2E4LA 4O8KA 4CGGA 3Q23A 1R8CA 3QRPA 4E0DA 3GYNA 4N56A 2YQ1A 2ALZA 2ZZMA 1S9FA 3D2FA 2QTWA 4ES3A 5HK4A 5CY4A 4TLRA 2OA8A 2DR8A 1Q82O 1NMEB 1T6CA 2DXFA 3MMCB 4EI2A 4E98A 5ETSA 3MR5A 3EZOA 3K0SA 2XS5A 1NBWA 2RS2A 3HCXA 3DGPA 5DG8A 1X9SA 1HWKA 2FBXA 2G8FA 3A5OC 4JV5F 1HI0P 1F9FA 3D67A 4UZBA 4HHUA 4MFBB 2W4CA 4TLQA 1VQYA 4CFAA 1FKPB 2E1RA 2HFOA 2JWKA 2Q1NA 5JVGQ 2LKZA 2ZBQA 1RB0A 2J0QD 4KIAA 4GKJJ 3MCAB 3PLAA 1M1HA 1T9YA 4ECVA 3PRBA 4A2AA 1HKGA 3DKDA 3MAAB 4IEIA 3P4IA 1U8SA 4DCHA 1Y7PA 2J8SA 5M2RA 1CXQA 1CVJA 2JEIA 1VBZA 3S01A 2KVQE 3TAEA 2ZGZA 5KFPA 4FYDA 4ZHRA 1D9AA 1JCFA 2GQCA 2FVSA 4DV2K 3V6DB 3THWA 4A8MP 2KYZA 2IVNA 3JS9A 5KT3A 2IIHA 4R0JA 2O01C 3EM1A 4HR2A 4P75A 1TL7B 1KLNA 1VRUB 5EHHA 2YX7A 2IY5B 1U1QA 2VPWB 3GU0A 3CMQA 2G1HA 1EARA 1N48A 3MMJA 3I0RB 2C3PA 3TZXA 2DTUA 3LOUA 2XLKA 3T1HK 1P6TA 1RU2A 1OIAA 4MMOA 1V3ZA 5FLXY 1X1PA 2ZDOA 2AP6A 3CJCA 4DU8A 5F3ZA 2UVVA 4ZTJA 2CQGA 3OYNA 2ZH3A 2G8IA 1J6ZA 2IRXA 3EKUA 1YJUA 3VQDA 1TMJA 4FM2A 1RJJA 1JKHB 2RQ4A 1WI8A 5KG6A 4K59A 1QSLA 4FWMA 4KGKA 3ET6B 1S57A 2XEXA 2P9PA 2JEFA 3CJTA 3EMTA 3FZ2A 3P5JA 2GS8A 4DS4A 5JMNA 4NXNJ 3V6KA 4K0KJ 4F4AA 2YV0X 2J6UA 5J2PA 1K44A 1O51A 2B8PA 4O0IA 1LW0B 5L1KA 3LAMA 3R7NB 4LR7A 3ZC4A 4YOWA 3PJWA 4DTJA 2XNQA 1FTRA 1Y00A 3PR5B 1RT2B 3K9KA 3O44A 2ZBPA 2IPOB 5GIPA 3ZT3A 4A8YA 4OI4A 1D8ZA 2O8CB 2NSCA 4DFJA 2V4RA 4OYZA 2G2OA 4HUEA 3TZWA 1V4SA 4CEOA 4ZCKA 2Z2ZA 1WD6A 1YBUA 1RZMA 1GXTA 4RW7A 4FVUA 4JI1J 3E01B 3FZMA 5J2PB 3AQPA 1BIUA 4IZ9A 4CDIA 2ASDA 2DGUA 3RSEA 4W90B 2GBZA 2Q3PA 1Q8BA 4LIRA 1ZM4A 4K43A 2P9PB 3W8PA 1BO5O 2HF4A 5LSOA 1RWVB 3NNHA 3DHXA 1NK6A 1SC4B 1K0VA 4IEEA 5DS7A 1RT1A 2M7SA 4NMXA 4JKFA 1X3MA 2G2ZA 3F9MA 3GYXB 4X66F 3PR4A 4FVMA 4LC9B 2AWZA 2ROPA 3LH2S 3NF6A 4JI7F 2ZH4A 1VSFA 2YVSA 4EUVA 3I31A 3IAS9 3MEEA 3CMAS 1YITS 5AQNA 5FPDA 3ET6A 4ICLB 3SUPA 1VQ9N 2V52B 4KGXB 4JI6K 2U1AA 1P1LA 3TJ8A 3SV3A 4MKYA 2HHXA 4DR3J 3MN5A 4AUKA 1LNQA 3DRRA 3BGUA 4QOZB 5A2QU 3AV9A 2FC8A 5M1FA 1TK0A 1WWHA 1K9MT 4X65J 2YNFA 4CLPA 4H0OA 4G3IA 2BVZA 4M42A 3A8IA 3HHLD 4LF7J 4Z4FA 4ZP6A 3ALYA 4F0MA 4H0VB 3QO9B 2HHUA 1KS2A 2B7CB 3N6NA 4I1TA 5ETNA 3G4SN 2LXIA 1UVLA 3L9ZA 4CF9A 1NUEA 1WN7A 2O8FA 3M3ZA 5D6GA 5KQ8A 2CZ4A 2HFNA 2LDYA 4FYWB 1JX4A 1CJUA 3S1TA 4IKAA 1XNQK 2W2PP 2IDEA 3RBZA 3FE1A 4JKHA 4L75A 4MFBA 3TRGA 2XMUA 3GJTB 4EFAC 4DL0C 2OAUA 2NRVA 4OZ2A 4XPEA 3M4XA 4BQLA 2WFBA 2IA0A 1GOCA 1WOOA 4CO2A 4QR0A 4C8NA 3LM9A 3RRKA 4HH1A 2IVFB 2UXCK 4CGFA 3DFEA 1AROP 3G2XA 4J9SA 1ZBIA 2OEKA 3NEKA 3B6BA 4HCCA 5FROA 1OH7A 1FXRA 3CW2C 2GHWA 5I3PA 3UR3C 1GLDG 3M2RA 3W2WA 4BR0A 4H4OB 5DLFA 2MKYA 4PG8A 4CZIA 2R8IA 3BBBA 1TV6A 2W01A 5EX0A 2DR9A 5RUBA 5GAHP 4HCBA 1EWQA 3RR8A 4C8KA 4ZOSA 5HL7Q 1NJXA 1KVJA 3CJ9A 2BQUA 3N6MA 1FHTA 2FVCA 4WIIA 5MAOA 2LYVA 2ZM6J 2HHVA 1VQ4N 4AQYK 2PEBA 3I4HX 4XTTA 4PCQA 3W9HA 4JI0K 4U8VA 1B7YB 1OH5A 1TUVA 5IT9O 1D0EA 4HHHA 3OFGA 2H65B 5DMRA 3THXA 4ZJLA 4B3RJ 3EGZA 1YIJS 4LUBA 2FVRA 1TKTA 1RDCA 4ISEA 1WORA 2CJ9A 1HQ2A 1KTVA 5IWAF 4DTPA 5EGYA 2D74B 4PWDA 1IR0A 2JWLA 2OTLN 2CRLA 1TQLA 1E6VA 4MKAA 2CPHA 4Y1CA 3QNWB 3JAMO 3HFVA 3J81j 3G8SA 2IC3A 2EW9A 4DV1J 2ZE2A 1YI2N 3ILOA 3QIPA 4DR7F 4CVNE 3HHLB 4Y2CA 4KBOA 4LF6F 1J53A 4C8YA 3OT9A 1RWNB 4IFVB 2BW2A 3NS7B 3LPUA 1TAUA 4KHMA 1ZM3A 2P5VA 3UDCA 1H2VZ 4FJXA 1ZZNA 2Y1IA 2HSTA 3OR2B 3DLGB 2HFVA 4DMNA 3LGMA 3GG4A 3CJ3A 4KYZA 3AO3A 4HVJA 1IBLK 4ELVA 3FZHA 3X1LB 3SZ2A 4ZDNA 1Q53A 3QMQA 3I33A 2LQBA 2FYXA 2Z1HA 1YHQS 1LK7A 1YRXA 4BRKA 1H7WA 1RBAA 1VHIA 2DB1A 4O3RA 3MWBA 4WTOB 2LQJA 4CJEA 1MSWD 3HHDA 4LFAJ 4Q8FA 1JJ2M 2BQ3A 5LJWA 4X4VA 1ULRA 3RU0A 2DHAA 3CEDA 2NLWA 2V5HG 2DGWA 5EOYA 2B7BB 1X4HA 4S0MA 1Q7YT 4FJ5A 5F9LA 3OFHA 4PWUA 3VN5A 3N4PA 2BGGA 2ZKUA 4BC4A 4CHZA 1K8KB 4EFHA 1X7VA 2QLFB 2BABA 4RWWA 3BO4A 2VBXA 3FGUA 4ZPWR 4LSZB 1U1MA 2G8WA 2CPXA 2P51A 2V8DA 2XSFA 1EZZB 1C0GA 4FW2A 4IOBA 4XDDA 4ZP7A 2E5LF 3H46O 2HHTA 4Q44A 2YH1A 2LFVA 4X64F 4WF9L 3HDSA 4JI8K 2YKMB 5AFUH 1BWEA 3TO8A 3GE9A 5LY3A 4NLOA 1YUWA 3NXZA 1EX8A 4ILRA 1PBUA 2RH3A 3FEYB 2C2NA 4WQ5C 1CZBA 3MOJB 1WC4A 3DMJA 1YI2S 4IJAA 4A62A 1HMVA 5KFAA 3OR1B 5KFKA 1S72S 1RHUB 5HJYA 4P2MA 2F63A 2AX0A 3SAGA 4ED2A 4NA1A 1CXUA 4F50A 4ZLNA 5IT0A 1EWRA 2BJ7A 3SQ1A 5F8LA 1CLQA 4E1NA 1TL1B 1VJQA 3CCMS 4Z2XA 4OZLA 2F9JA 4USKA 4LBIA 3IG1B 1P90A 4ZVRB 1QAXA 5AQOA 1GH8A 4DQRA 5D0HA 2DHGA 5HLFB 3F9KA 2O4IA 4FJIA 1RKJA 4ANCA 4F2SA 4K4ZA 2F9WA 2CUYA 1REGX 2P9IA 1XNRK 4DU3A 1VQ6N 4H0TB 4DXLA 4H4MB 2MXYA 4DX6A 4LFCK 4A47A 3W60A 3H2UB 2BX6A 3T1YK 4JI5K 4ZVTB 2EX3A 1RXOB 4F36A 2DRAA 2P8IA 2ZM6K 4FLUA 2CNNB 2CH5A 3OTOJ 1FNXH 1C1CB 4P2FA 1GMUA 3G6YA 1H98A 1KC8O 2GO8A 1KEKA 4JD2B 3ID8A 1MLAA 3QGHA 4TU8A 1BQMA 2IIRA 1WLJA 1QE1B 4NLUA 4IO8A 4JKEA 3GTYX 2HOEA 1I94J 4EAHD 5C10A 1QHTA 4DI6A 3IAYA 2HRYA 2QKBA 2QL9B 1A0OB 4PQUA 2QRRA 1HWIA 3H25A 1S9GA 2KW4A 3M1VA 1KD1O 1R59O 4KJIA 5LJVA 1RWKB 3HFZB 2XZDB 1SUQA 3W9JA 3CWJA 3CPWR 3VEXA 4AHTA 5F8MA 4ES1A 5E3QA 2A10A 2OCEA 4DTOA 3U1NA 3E9PA 3OYMA 1X4AA 3W63A 3GMGA 2YKNB 2IAJA 3ZT1A 4OJRA 2DY1A 1HR0K 3FZFA 2XGPA 4NXMK 2HHSA 4N47A 4DR4F 3O9TA 1WJ9A 5AFUA 2GGPA 3VTHA 4WFAQ 1KWMA 3VVUA 2Z58B 2NRZA 1RCXB 4KH0B 4FYXB 1UAWA 3W0LA 1T3OA 3OS2A 4HL9A 1FRHA 1SS6A 2DGSA 1CZ9A 4LH4A 2ROEA 2QV6A 4U95A 1XI1A 3OW2R 3IO1A 2C22A 4ILLA 2VV5A 3K5NA 4TY8B 3OYDA 5GAGI 2ERRA 5HN0A 1FDNA 4UY8T 1BLUA 2A42A 1Z4UA 2FLLA 4LF5K 1UZHA 2IVOA 5L1LA 4O5FA 3HRGA 4C1NI 4BRNA 4K5SA 3VQPA 2LP4A 3OLAA 4B1UB 2ZF5O 1X9MA 4F9OA 4K4XA 4KT0C 1YTUA 1I6JA 1N36K 3PKYA 4AFFA 2QWMA 4O4GB 4ID5B 5KFQA 1TKZB 1U25A 4DQIA 3O1WA 2GVDB 2ADCA 3IWLA 4CH0S 4OYIA 3W2VB 3R6GB 4K0KK 2FF3B 2L3MA 2ZM6F 3CCVS 4CEAA 4WK3A 4E7JA 4ANDA 5B0AA 3R5BA 3JQMA 4P52A 3W7BA 1KVCA 3DLGA 2W7PA 1KONA 1R6YA 2F4FA 1SQGA 1NGCA 2FC0A 3J81O 1U6FA 4DHYA 1ZPVA 4DV7K 4TSXA 2MB0B 3DDNA 3BB5A 3V9ZA 4CERA 3CD6N 2DHSA 4DV5F 5KG0A 3OL7A 5T14A 3FZKA 3RB6A 4J2AA 5KTQA 3GONA 2K7JA 1RWWB 4DU1A 1GTHA 2A2DA 1KQGB 5AZIA 3QSYB 3TVZA 3BZKA 2O8BA 4IBNA 2FF6A 3GDQA 1X9WA 4JKBA 2QA4N 3NS6A 2GZOA 2UU9K 3SBTA 2VQFF 3QGIA 4F0KA 1J5OB 1FERA 3OTCA 1NAQA 4N8OA 4DR4K 3SCLE 3F44A 2GMJA 2WW4A 2WBNA 2PEHA 2MQPA 1K1QA 5ETQA 1QVFR 1QAJA 1I3OB 5GMDA 3NF7A 1SJ3P 2HBZB 5I3QA 5EVZA 3C7NB 4OV6A 2E7XA 4U9RA 2BANB 3MDQA 3GBTA 5CH7B 4UQTA 4BGAA 2E5LJ 1W0HA 4ZS6A 1TL7A 4BR4A 1J54A 2R7XA 5M1OA 2A1SA 3HPHA 2DITA 3AJ2A 3K8VA 4R0EA 5JICA 4CK3A 4FJ8A 2V8PA 3PTWA 3EXYA 3KD5E 4OIXA 3VERA 2A5XA 2XMTA 1QJHA 1XK8A 1SH3A 2WRMA 2K3IA 3PIOQ 4EU0A 2RHSB 1RP5A 4ZJOA 2RSQA 1UETA 2HAFA 1PO6A 1IV0A 4CLKA 4QIWD 1FKOA 1G15A 2QLJB 4PY5A 4UOCA 1T9VA 2UV8G 2AJ4A 2XMVA 1FT8A 2D1KA 5KRTA 4B3OB 3HI9A 1ASUA 4QWBA 4Y00A 3DRPB 4B1YB 1U1NA 2GW8A 4X64K 3FSIA 2KQ2A 2VFSA 1RT7A 2FSNA 2DFHA 2HFSA 5KGWA 2ITMA 1NH8A 2DXEA 6FD1A 2CNOB 4BG9A 3RB0A 5AE3A 1VDHA 4CJRA 5LMNK 4ECTA 5LSLA 4KO0B 1U24A 3GFHA 1QLNA 4ZVPB 2O8EA 3IGVA 4ZN1A 4RNNA 2JHEA 4DF4A 4GVMA 2R7YA 2NLXA 3H40A 3AXMA 1Q8LA 4ZPDA 1PG5B 3A8KA 4E7IA 1VQKN 4OX9J 5AQFA 1CJVA 3THYB 3EYZA 4OJ3A 3LDLA 3QFWA 1B7FA 4UQGA 3ZLJA 1DTTB 1ZBSA 4CNZA 3MAHA 3EZWA 2HVIA 4IDKB 2H54B 1N0UA 1FEHA 3SCXA 4TY9A 3VF6A 3UD5A 4C23A 1PJ7A 4ZPBA 3FBEA 4PWDB 3HKZD 1TZ0A 3OVBA 3WC0A 1WTFA 3H59A 3VZHA 4LFBK 2CJKA 3UN5A 2LQ9A 4WF9Q 2NXCA 3CFRA 3NBPB 4KTZA 4Z0UA 1KQSM 1R7IA 5EWGA 5GVQA 1NDPA 1FF2A 1OH6A 4IFYB 2HWIA 3AVBA 3AO4A 3OL6A 3HL8A 4KFBA 1RWXB 2E20A 3BV8A 3O4NA 3JAMY 1BCOA 2OLWA 3PXGa 1VQON 4H0YB 4AHVA 2LEAA 3NF9A 3TAMB 1KHVA 2G1DA 4DV0F 4OHVA 4ZIWA 2FZGB 3HP6A 1BDGA 3G9CA 1MDUB 3CGIA 5KFRA 4E1JA 5AXMA 4JI3K 3FMWA 1N5YB 2HIYA 5FPEA 5LMNJ 5DM6L 5KOXA 4YR0A 1GT8A 2ZUAA 2BACA 1VHFA 1XMOF 1H6KX 3CC4S 4NYNA 4YORA 2UUAF 4B3TJ 1X8DA 3C16A 1Z25A 2G13A 1H72C 2C2ZB 2C3YA 5F8IA 2FXUA 3NG8A 3S6EA 3U8XA 4NYOA 2F40A 2W7AA 4JV0A 4ZVOB 1IBMK 4KY3A 3NCPA 3PW0A 3CJBA 3VGLA 3O3FA 5A0YA 2QA1A 3M2UB 3DXBA 4DV4K 1RLDA 2JNJA 3FRZA 3CJAA 1H3DA 2E88A 4M5KA 2VWJA 3O9RA 1WEYA 3SCKE 2HNZA 2P6TA 1VK8A 4IG0B 3GZ7A 1HNXF 1HI8A 3FBBA 2MKCA 3HD2A 1F21A 5AZJA 4C1NK 1YJWS 3VAJA 4O8UA 4LF8K 2ZH6A 4J9MA 5KFSA 1TR0A 1BQNA 5HAOA 5BR8J 1K9MO 4FWNA 2FC9A 2QMXA 1HR0F 4Y28C 2V2ZA 3DOLB 5KFWA 3HSDA 4TN2A 2HRTA 5TKYA 2AYEA 2B9XA 4PKHA 3WQUA 3M7VA 5I42A 4QR1A 3HZ6A 4A5BA 1S76D 4X4RA 3CF5Q 2XMAA 2W8LA 2GV1A 2Z8QA 4YS2A 3VGVA 3DRSB 2E1CA 1QUVA 3KUGA 3BN7A 4DU4A 3CXCM 2DEIA 4QPTA 1WBBA 1FXLA 4DTMA 3MM9B 2KFNA 3AA3A 3D28A 3IS9B 3K8WA 3LGNA 2KRBA 2PYJA 1IJFB 3NCQA 2RF2B 5GMEA 3PV8A 4DSJA 4JYAJ 3OVSA 3DN9A 3I0SA 5IV3A 4H03B 1HD1A 3FZLA 1G2EA 3HM8A 1YF5L 2MJUA 3MUVP 3MPUB 3T5LA 4CF8A 1WSGA 1U0SA 1R6VA 3V6DA 3Q8RB 1QAYA 3DOMB 2J8AA 5D0GA 1DTTA 3NFAA 3SMZA 3TSUA 2W7OA 4TYBA 2VU5A 5GMKa 3SQOP 4QAGA 5FLXU 1BD6A 4J2EA 4J9UE 4PWWA 5HP1B 4KHNA 1S1VA 4J9KA 2BUNA 5A8KA 3RRHA 4ZTFA 3DHWC 4CH7A 1CQMA 3UB5A 2MZSA 3KKRA 4PUOA 4KB1A 1FK9A 1Q81T 2FBTA 3BYPA 2VA2A 3LUYA 3OTDA 3HHKA 3D68A 3KNAA 2DPIA 4DL3A 1WSJA 4FOIA 3HD1A 4NWBA 1HFEL 3QINA 5HRPA 4IOAQ 2IS3A 3OLBA 2OSRA 4FYVB 2J7UA 1N5VA 1VBYA 2V50A 3NGYA 1RGVA 2F7TA 1WHYA 4DLGA 3BSCA 2NNWA 3CM5A 5AE2A 1IG9A 1RT2A 3H1QA 4H4KC 2FB0A 2HK3A 1RHMB 2HGLA 4A2BA 1L3SA 3WUHA 2BA9A 3IN5A 2Z2MA 4URGA 2X78A 1RLCL 3H08A 1EO1A 1O6XA 4J9OA 2XY6A 3QIPB 2B43A 2PGCA 2P9KA 4F4YA 1RADB 2ZD1A 4FS2A 1IN0A 4GV6A 2BQRA 3H8YA 3HT3A 2ZWPA 4IYQA 3F2KA 5HROB 2HG4A 2RRNA 4KSEB 2JL9A 3RMCA 1KAYA 3Q8UA 1WSIA 1E6YA 4V1Ak 2D5RA 1RA6A 2X51A 4A61A 4BC3A 1PJ5A 3V4IB 1Q1KA 3QMLA 3Q8PB 5HRSA 3GJSB 4E1MA 4BQZA 5G4DA 3EZUA 4USUA 4B9VA 5IOLA 2ZOGA 1U1LA 3FCVA 1VQ5N 1XNQJ 2YH0A 2ZH1A 2OIHA 4HACB 3WNGA 2XZWA 2C28A 4FPBA 3M8SA 2ZE2B 4NO7A 3SK3A 4E7KA 3V4MA 1N34J 1XIQA 5IV4A 4XH1A 4NCGA 3VWSA 3MMAA 2YWWA 4ILGB 3BGRB 3M8ZA 2HW3A 3JQKA 2LQ8A 2HKEA 3B54A 4C48A 1NXIA 4FM0A 4QWEA 1RTDB 3V9XA 1S72N 4CJVA 4MIAA 1B0VA 1BI4B 4AL7A 3CPEA 1VQOS 3GIIA 4OL8A 3H5UA 1M5PC 2CDQA 5I42B 4N76A 4CZEA 4MAKA 4OJHA 3IRXB 3C95A 1FA0A 3BPSP 2G2YA 4CIFA 2HQGA 1RYSA 3LDQA 3CTRA 4EP5A 1VC5A 4KAZA 1F9EB 4RBVA 1TL5A 1NCLA 2UXBK 1B4SA 3ZSYA 4UT4A 4IQXA 1R27B 3BKFA 3ZSXA 2I5JA 3OSNA 2EKYA 1VLYA 4ID1A 4ID5A 4CZGA 5AQIA 3DM2B 2CXEA 2WVCA 1WC1A 3NAIA 3AQOA 5KG7A 3VQCA 2RDDA 3G96A 1N8RT 2M88A 4M5IA 2QSFA 5BRDA 1SKWA 3P38A 5IXUA 3FBCA 4OYBA 1JLQA 1S59A 1HUXA 2AF6A 4Z7YA 3WEEB 3DNCA 4CF1A 4B9TA 2I0XA 3X3UA 2CPZA 3N6LA 1YJWN 1RT6A 2R2TA 2XCPA 4B9SA 2FSKA 1X4GA 5BXIA 1WG5A 3CD6S 1U0HA 5JVHQ 4C2MA 1RWOB 5T7LB 4LF2A 4P7VA 4OI6A 3C2PA 4Y34A 1R8AA 4FYYB 3TVKA 4AH9A 4LMZA 2EWHA 4CJSA 3FFIA 3MTKA 1HBOA 5HP1A 1NSPA 1WHVA 1T05A 1HNZJ 1TGOA 2QI2A 2EEYA 1CQNA 2H4YB 3SPYA 3C19A 1YBTA 1UA0A 5IT9U 1PILA 4FNHA 1P9QC 1JLBA 4P6QA 4U7UK 3LF0A 1U0HB 5AZJB 4DB3A 1LAWA 4DV6J 3L2QA 2EK1A 4DSKA 4W92B 2DGVA 3NBPA 3NGKA 1UW9A 3NE6A 3TUIC 2EPIA 3P5TL 5LOQA 2DR5A 4KH5A 4NYFA 3MOZA 3N0VA 3GIMA 1X5OA 1VQ6S 1D9DA 1VSLA 4A4JA 1SIZA 4B3TF 3VHQA 2YKQA 3J81U 3J7YU 3W2VA 3PX4A 3HFKA 3R7SB 4KTQA 1SL1A 3ZZUA 4JOUA 1XTZA 3ENHA 1Z2ZA 4NZ6A 5CA5A 4X2BA 3J7ZT 4Y2MA 4USTA 3POTA 2AGPA 2Q97A 4OI0A 4XEIA 1T95A 1IBLF 4YDXA 4CJPA 1HBNB 3PYGA 3GOIA 2GVZB 3VPZA 3OHAA 3FQLA 2M0GB 5B0GA 4MQ3A 3LGHA 3PIPQ 3BN4A 3TTDA 1QVGR 2PO4A 2JFDA 4PAAA 1OKJA 3KYLA 2IA6A 3F73A 5GINA 1ZBHA 4EHTA 5A6WA 1O0PA 4Q0BB 2E66A 4DTXA 4JKGB 1PCAA 1N88A 2DT9A 1N4LA 3RRGA 5K8PA 2NZ4A 2F5GA 4DEZA 4RNHA 4YB7A 2M9KA 5BR9A 2IVMA 2E2QA 3VEOA 3E8OA 4KHUA 3TJ9A 1S48A 4WYWA 5DDOC 3MEDA 3TZYA 2QW9A 3D3CJ 3SLCA 2L9DA 2HGNA 2ZOFA 3ZX3A 3I0RA 4UY85 2D9PA 4QPXA 1GQEA 3QFHA 2AD9A 3MXIA 1YITN 3CB4A 2PZSA 2BE2A 2GEMA 3DLBA 7FD1A 2ASPA 4PA1A 1UMJA 3MEKA 1YZ7A 1Q5VA 2UXDF 1N5TA 4OQJA 2XS7A 2FJEB 2GWKA 4DR6J 3DI6B 4CHNA 2V94A 1S1TA 1GLLO 2J76E 2AZ1A 4DR6F 3NAHA 5B0CA 4JI1K 1S0MA 3UN3A 5KG4A 3P1GA 2YX1A 1XBWA 3R1HA 2CJAA 3LP0B 3QYYA 4DG1A 1K8AT 3VGKA 1YT3A 2ZD1B 4QIEA 4NZ0A 4K4VA 2ATCB 1IJEB 4QQBA 2CPFA 2J5AA 1KSPA 1ATRA 3TAGA 5AQLA 2W1BA 4I6MA 3ZETB 2Z0GA 4H5VA 4LJMA 3WEEA 3JSMB 2EVZA 4ZHRB 1YJNN 1PAEX 2FUG9 2Z30B 1HNIA 5FD1A 1BU6O 2WZ1A 1AA1B 3A8EA 2PFFB 2KH9A 2MY8A 5F8JA 4AD6A 3V9WA 3EZ5A 2N3LA 3CPWM 2ILZA 1T3NA 5KT5A 4L3QA 4ZCIA 5IT4A 4G1QA 4CJ3A 2UXCF 4Y3CA 4LF9J 4USVA 2UVUA 2R7UA 2J7WA 4JBCA 4ZJQA 3WT0A 5F8HA 1S1UA 1F0XA 2EBEA 4YOEA 1NLVA 2A2CA 4MIBA 3CJ1A 2F3JA 1YXQA 4R79A 1U2RA 1JLGB 2M2BA 4QWCA 3HP9A 4YEAA 5HQMA 4JKAA 3WNEA 5BREA 5IZHA 2LLZA 1SJ4P 1U4BA 2VPXB 2EC2A 5CZVA 1HMVB 4LVOP 1GAOA 3AAQA 5EX3A 3MM6B 1D09B 3GL1A 1JLBB 3N79A 1QD1A 5C5JA 1J9AA 1IR2A 1UJ4A 3BBFA 2KZMA 2ASYA 4C3KA 4AHCA 2BH1A 5M2UA 3MM7A 3VA3A 5AJ3J 4LVNP 4F02A 5AQKA 5HROA 3G25A 2H3EB 1NRKA 2HRUA 4DKWA 3DLEA 1FJCA 3IDHA 1K73O 3K58A 4LFAF 3MWPA 3T5KA 2F8SA 4KHQA 3H3OB 5GADP 2IM1A 5IM0B 3ZSVA 2Y1JA 5L39A 1OPZA 3C94A 3DOKB 3UI3A 3HTVA 3QZ8A 2NZCA 3TWZA 1RGIA 4BWJA 3BREA 4ETZA 2LECA 2WCXA 3BJYA 3HK2A 4B3OA 2DY9A 3GG1A 1BCMA 3D0GE 1RKIA 4PXBA 4JK7A 1MROA 4V19J 5K20B 2E1ZA 1ZAWA 3L7UA 2AMCB 1Y10A 3VZIA 5CABA 3ISZA 3GPAA 5F0XA 1ZBLA 4FLYA 4BHQA 2XZTB 3L09A 3G86A 2IBOA 2MY7A 4E8UA 3VGUA 2BUPA 4WU3A 3W3SA 3I9ZA 2I5JB 4DN0A 5DDPC 2I7PA 4CE9A 1LW2A 1WACA 2VONA 3OS1A 3EO3A 2EWSA 1Y5LB 2HQCA 1EP4A 2KU7A 5ETTA 4CHPA 1HHQA 1J5EJ 4RUHA 3C6TA 4DMZA 5KPZA 3GCXP 4ZP9A 4OHWA 2PT0A 4G1PA 4R25A 2POKA 5D4PA 2VZ9A 2IVYA 3FEZA 1SC3B 3AY9A 1RHKB 3NF8A 4Q45A 3DLEB 4PEOA 3CF5L 4K8ZA 2XLJA 4OLOA 4GVEA 1H73A 4WXOA 4A59A 1Y0HA 4W5OA 3BSNA 1E6VB 1ZA2B 3OBWA 3TR8A 5HATA 3OYCA 2OPPA 4KHRA 1N34F 5AXNA 1FRMA 3FDSA 4GVBA 3P3DA 3ZSZA 4BGBA 2HHWA 5EUHA 2DO0A 1DQ8A 2Q0RA 4KR0B 3WZ0A 3BY5A 1C2PA 1WELA 2XYGB 2E6MA 3VF0B 1U8WA 3TX0A 1RT5B 3M30A 3RAMA 1GLBG 3G6EN 1YJ9N 2ZKTA 5GADU 1FXXA 3GR1A 2AKWB 5AZIB 4KH1B 3NOCA 3T9NA 1IJJA 1HW9A 4WP8A 1XHZA 4LRCA 2QO3A 1OS5A 4Z4IA 4LF4K 4CZLA 3A4TA 3AOBA 2OEMA 2QWPA 1S1UB 2D41A 5G0RB 3KLHB 2A6OA 4LFBF 3PRDA 5ETOA 1YTAA 3VF2A 1RACB 2UU9F 2ZVSA 2DNRA 5J1NA 4WFYA 4N77A 5SZTA 2G8VA 1S49A 4YB6A 2RKIB 1XC9A 4H4OA 1O8BA 1UJ5A 4OV1A 1HNZF 8ATCB 4AM6A 1IBMF 4FPIA 2NYIA 4KGMA 3OYIA 1PKUA 3Q8VA 1GXLA 1FVSA 2DNGA 2P2CB 1F60B 2V68A 1HPZA 4OYXA 4ZLLA 4QS9A 2FBYA 2OEJA 3J7YP 3S3NA 2CQPA 3JTOA 3RZAA 5J2NB 2ZC3A 1MN9A 4F25A 3MXHP 4IO1A 3L2RA 4RTFD 3NGDA 3RVCA 4C6AA 4FJ7A 2UVWA 1IM4A 4OYMA 2UUWA 5C2DA 5B8HA 4OPKA 3LO3A 4ED0A 1YJNS 3O1LA 1YK9A 2FGCA 5DG9A 1HIYA 1DQAA 2UUAK 2XYHB 3EUNA 5DK5A 2R7QA 4LFBJ 4FBTA 5DJBA 2DFFA 3HSGA 3UCUP 3H90A 3W64A 4OYOA 4K8RA 4Q2MA 3R8YA 5KG3A 4UUXA 1L3KA 3CC2S 5I9EB 4X64J 3NS5A 3D2WA 4CWBA 3MD1A 3KJVB 3TA2A 4CF0A 2B0GA 2OELA 4O3OA 4HH0A 3PHTA 1NNEA 2V4JA 2HS4A 4OMFG 4R5PA 1TK5A 3K5PA 3VGMA 2BYCA 3BF1A 3CJ4A 3ZT0A 4PYAA 3C6UB 3CCEN 2JX2A 4Z4EA 1X60A 4DV1K 4PG7A 4PG4A 1IO2A 2UUTA 1VSDA 4B1WB 1RBRA 3TTCA 4DSEA 2XCAA 4JI3F 2DNYA 1RTDA 2V9WA