4RW7A

Crystal structure of hiv-1 reverse transcriptase (k103n, y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
554
structure length
538
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 138
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw7A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw7A05
3NHGA 3RTVA 4MFBB 4FVMA 3OL9A 4CGJA 1U09A 4N47A 3OYIA 4ED0A 3NDKA 4NCGB 1WN7A 5T7BA 3WNEA 5KFBA 1MU2A 3QO9A 4CEQA 2IM1A 3V6KA 3LP3A 5DGBA 1S0NA 1VSEA 4NLSA 3NBPB 1VSLA 1QE1A 3HYFA 5C25B 3DOKB 4J2EA 1C0TA 3MAQA 3G6XA 1UOCA 5KFYA 2DTUA 4CJKA 2HVHA 4ID1A 3QGHA 4KTWA 2KTQA 4AHUA 4YP3A 1ZBFA 2Y1JA 2GBZA 1FXXA 3RAQA 2AX0A 4ZPBA 3MR2A 4OPKA 5KFDA 5KT4A 3PZPA 1IKVA 3MF5A 3OLBA 3M9OB 2VA3A 4RW7B 1SH0A 4BWJA 1FK9A 3H59A 3CG7A 3K59A 3DRSB 5KGXA 3PUFA 1J54A 4FLYA 5F8IA 3QEIA 1NK0A 1SL1A 1IKWA 1KFSA 1KVCA 3MXIA 3G6VA 3AO1A 3PO5A 1GX5A 4OKJA 1J9AA 2AWZA 1DTQB 3C6TA 3TAFA 4RW6B 1RT1A 4QWDA 4O4GB 4Y34A 2ZKUA 4K4TA 4ECTA 3DOLA 4Z4EA 4Y2AA 4CHZA 4XPEA 2F96A 3G10A 1B9FA 1IO2A 1UAXA 2X74A 3I5AA 3D0PA 1RTJA 4KTZA 4E89A 4CEBA 4CCHA 4GC7A 2W7PA 2HB5A 3SUPA 4IG3A 2ZQBA 4CGFA 3C6UA 3IG1A 1HARA 2AQ4A 2QE5A 3Q8RB 4EZ6A 1LWCB 4ID5A 3HVTB 5J2QA 3RB4A 3VQ4A 1EP4A 3PX4A 3NH1A 1JLFB 3ITHB 1RT3B 2WRMA 3FSIA 3S3OA 2FBYA 4HUGA 3HVAA 3DM2B 3M8RA 3CJ0A 5KFZA 2BANB 4B8CA 3JYTA 4WXOA 1QHTA 4PWDA 1ZBLA 4FLWA 4RG8A 4LD0A 4CGGA 4ZVEA 4ZVHA 5EWFA 4ECQA 3KD5E 3L2QA 2XI2A 1S1XB 2W9BB 2E9RX 5KT6A 3SCXA 3TAMA 1TL1A 4FLZA 4DSKA 4FJJA 3NKYA 4FBUA 1TP7A 1ASUA 5DQHA 4F4ZA 3GQCA 4IFYB 1XR6A 4ICLA 1RT6B 2G8VA 3H40A 4KRFA 2FJWA 1WSJA 4CK1A 2A1SA 2AX1A 4BWMA 4N76A 2HHXA 1EETA 1NKBA 2KW4A 4DTSA 2HNDB 1KHWA 2CKWA 3OYNA 4GVMA 3ULDA 3MEEB 4K4YA 5J2PA 4E7HA 3DLRA 3OYBA 2F8EX 4K8ZA 3MR5A 4CFBA 3HK2A 3FFIB 3QNNA 2IS3A 2P5GA 1S1VA 1TV6B 4QWBA 4R8UB 4AHSA 1VRUB 4O3OA 3OYJA 3UPFA 2YNFA 5KG7A 4BE2A 4FJ9A 2ILZA 4AHRA 2XO7A 4IDKA 2FLLA 4QW8A 4JRQA 4TQRA 1C1BA 5F9LA 2D5RA 1LWFA 3RBEA 3AO3A 3H4BA 2OPPB 3EZ5A 1SH2A 4LSNA 3KD1E 5K14A 1DLOB 1WLJA 4DFPA 4FJHA 4JLHA 4LH5A 2WHOA 1RT5B 1RT4A 3LP1A 2B5JB 4CIFA 1KLMB 4KREA 1IKXB 2IM0A 2YNIA 3BR9A 1IM4A 5I42B 4DQIA 3ZT1A 3E01A 4CF0A 1NJWA 5HROB 1S1UA 3SQ4A 2VWJA 1QUVA 3PVXA 3OYDA 1TKTB 3OYMA 1X9SA 2BRKA 4JV2A 3VQ7A 3OYEA 4JUZA 3TQ1A 1T03B 4ECZA 4TY8A 2Z1GA 1LW2B 1X1PA 3VA0A 5CYMA 1T94A 1SUQA 1HNVA 3ZCMA 4B3OB 4BDPA 1RYRA 4PUOB 1QS4A 4DFKA 4HCCA 2B6AA 2D3ZA 2A1RA 3Q8PB 5CYQB 4KV8B 3CFPA 3V6DB 3ALYA 3WNHA 3H5XA 2P51A 4Q45A 1JLGB 5KT3A 3FDSA 1S6PB 5HP1B 4ZPCA 5KFPA 3SNNA 3DLGA 4CHOA 5J2NA 5KTQA 3SFUA 4IG0A 3I0SA 2ZD1A 2HHWA 4QW9A 1LW0B 1UWBA 1HMVA 3ICLA 4CHPA 4B9VA 3DLBA 2W8LA 2YHBA 4ECSA 3RWUA 1S0MA 4KHWA 4L8RB 3KLHA 3KKSA 2G8WA 1L3UA 3O4NA 5FROA 2XGPA 3V1QA 3QGGA 5FRNA 4KE5A 4PY5A 4ED6A 2VG5A 4NYZA 4HYKA 3GV5B 3O3GA 4M3XA 3I0RA 2FVPA 4KPYA 2PYLA 3IAYA 1UA0A 4WFZA 4O0JA 4NZ0A 1QAIA 1TAQA 5KFOA 3QERA 1XHXA 4FM0A 4CEDA 2ASJA 1S9GB 2IC3A 4FJIA 1FK9B 1NK6A 2KZZA 4RW8A 3L2VA 4UQGA 3KLEB 3Q8QB 4WE1A 3OJUA 2HHQA 1S1WA 2WONB 4DL7A 3AO2A 3AVJA 3GIMA 5KT5A 1N6QB 5L1JA 3K5NA 3CIZA 3IN5A 4ECWA 4B08A 4IRKA 4IOBA 2KZMA 2WOMA 1HJRA 1J53A 4QWCA 2AGQA 4ECRA 2O4IA 4KB0A 4EO8A 2D0CA 1NKCA 4OVLA 3TAPA 4Z4CA 2W42A 3OJSA 1C0UA 4FZYA 1RT2B 3DRRB 2VG7B 3M9NB 5JXSA 1L3VA 3NF8A 4CHNA 4DS5A 3PV8A 3A2FA 2C2EA 2ETJA 5J2QB 4CECA 3IGNA 3HP6A 3S9HA 4IFVB 2IM3A 3S3NA 4B9MA 2XWYA 3G86A 5T14A 4AILC 2HNYB 1JLEB 3T1AA 1DTTA 3AVIA 4E7LA 1QQCA 4PWDB 1Y97A 3V81B 3K5MA 3CJ3A 2E4LA 5KFHA 1BCMA 4ZTJA 3RB0A 3UQSA 4CESA 1UA1A 4JS5A 4TSXA 4DMNA 3U3YA 2YNHA 4J9LA 2QXFA 4CF2A 1TL1B 5F8JA 3AVMA 3QINA 3EYZA 4URSA 1ZBIA 4E1NA 2RDJA 1HNIB 3OL7A 3RBDA 5CZ1A 3TARA 2EX3A 4EEYA 4URGA 3D45A 4CK2A 3AVBA 3ZT3A 2J6TA 4FJGA 3BSNA 4CJLA 1VSMA 3AVCA 1NOYA 2GIRA 2G8HA 1HQUB 4TN2A 4KHNA 4IBNA 2LSNA 5I3UA 4O0IA 1Q9XA 1JLAB 2HNZA 5DQIA 4CJRA 3BGRB 2V4QA 5J2PB 4M3YA 2JEIA 5EWGA 1QTMA 4JV1A 3OYGA 3HJFA 3C94A 2ZE2A 2KFZA 3M8PA 4CJVA 2IMWP 2EC0A 5KFEA 3PR4A 3IRXB 3K5LA 3KTQA 5HRRA 2V9WA 1CLQA 4KO0B 5J2MB 2KQ2A 3NF6A 3TAEA 1RTHB 2YNFB 4FLTA 3HVWA 4M45A 4J9MA 1RDBA 4DSEA 4DL3A 2AGPA 3IS9A 1LV5A 4YR0A 4IDKB 1KRPA 2I5JB 2FBXA 4JS4A 1X9WA 4MK8A 4ZP6A 4DSFA 3THVA 3LAMA 3ISNC 1K1SA 4WFXA 5K14B 3V9ZA 5C24B 3MEDB 2FJVA 2OYQA 1EKEA 1GOBA 1N5YA 2J6UA 3L2WA 4W5TA 2BE2A 4AHCA 1Z25A 1S9EA 3H5UA 1A5WA 2FC0A 4IRCA 1RDCA 4E7KA 4DFJA 4BE1A 4OL8A 1EXQA 3JSMA 4ZTFA 4QOZB 4M94A 3CVKA 3QEWA 3KK1B 1K1QA 2JLEA 4K8XA 4MK7A 2G8UA 3E51A 1RT7A 4ELVA 4NLQA 1YVFA 1CZBA 4HUEA 1VK0A 1QSYA 3NF9A 3QLHA 4RZRA 3ZSZA 4RU9A 4YQWA 4KB1A 2Z1HA 4ECUA 3H2LA 4WXWA 3WNGA 5CZ2A 3PW5A 4U6PA 3KK2A 3ZT4A 1RTIA 4MIBA 1BQMB 3RB6A 5SZTA 1KTQA 4J9NA 1B9DA 1C6VA 4EP4A 3MECA 1TKXA 3DYAB 5FDLA 4XPCA 2C28A 4K4UA 1D9DA 3K57A 4Q44A 4ZP7A 2GC8A 3DLGB 1JKHB 4LSLA 3SUOA 4IG0B 3PW0A 5KG2A 3MFIA 4MKAA 2VWKA 1NK9A 3RRHA 4FS2A 1UWBB 1L3TA 1RDAA 3B6PA 5KT2A 2IM2A 5KFIA 4ECYA 1HRHA 4E7IA 1FKOB 4MH8A 3K2PA 2WCXA 3CQ8A 4X2BA 4HHTA 2GIQA 4DU3A 3BDPA 3U6FA 2GUIA 5KFGA 2VG5B 3ZSXA 4C8NA 4J2BA 3BREA 3NGDA 4FM1A 4MIAA 2W8KA 3KKRA 3I0RB 3OYCA 3M8SA 1NK7A 3ZT2A 2RKIA 4KHQA 1REVA 3CM5A 3LDSA 3OY9A 4OGCA 2O4GA 3OSPA 5DMRA 2FLPA 3BJYA 4F4XA 3DLKA 3NMAA 4M3ZA 4NLYA 3OYAA 4CJQA 4C8LA 1I6JA 5KRTA 2JC0A 1IKYA 1S49A 1KVAA 2DPJA 2RF2B 3KHLA 4CJFA 4I2PB 1HYVA 2YKMA 3BQ1A 4W5QA 4CFDA 4DG1B 4H4OA 2FVSA 4ZVFA 2X78A 1VRTB 3V9XA 4NLOA 2YV0X 4PQUA 2W9AA 3HHKA 2W9CA 2HMIB 1F21A 4DL5A 2YNGA 5KFAA 3L3VA 3M8QB 3V9WA 4H8KA 3NE6A 1U45A 4XO0A 3D28A 5HRSA 3N6LA 1HYZA 1WNEA 3UDLA 1YTAA 4YR2A 4EYIB 4CFAA 1QSLA 4RW9B 1FKPB 4WZQA 4H4MB 4K4WA 3NF7A 1BIZA 1SL0A 2C2DA 1QSSA 3SFGA 2IDOA 3L2RA 5EWEA 1JLBB 1RA6A 4ECVA 2ITGA 2PY5A 2IAJA 2OPQA 2OPSA 3MEGA 3VQEA 3WNFA 1QAJA 3RB3A 4O5BA 4M3WA 4ED7A 4Q8EA 2F8TA 2J6SA 5J1EA 1BCOA 3VQCA 2DPIA 2HW3A 1HQEA 4FLUA 4Z0UA 4DWIA 4J2DA 1XR5A 3QZ8A 1KHVA 4KI4A 3EPIA 4URQU 4Q43A 3KHHA 3EZUA 3P83D 1I3AA 3CFOA 4ZP9A 4DTXA 2HAIA 3I8DA 2WB4A 3KMSA 4K50A 1LWEA 5L1LA 3LZIA 4NLXA 3TWHA 2F8SA 2D3UA 2IBKA 1BI4A 3SPYA 4EBEA 2HVIA 3KJVA 5HLFA 3SI8A 4HTUA 1TVRA 3M9MB 5D3GA 5KFLA 2Z1JA 1D9FA 5KG0A 5KFMA 4ZHRB 3FQLA 4QWAA 4R0EA 4QPXA 4DTUA 4FJNA 4J9KA 5KRSA 3V4IA 4R5PA 3H4DA 3KLIA 1C1CA 3HKWA 1KSPA 3KLFB 1X9MA 5C5JA 5I3UB 4CJ4A 4Q0BB 2QKKA 3S3MA 3AVFA 4HUFA 4OGEA 4B8AB 3AA2A 1JLCA 3KLGA 3M8PB 2ATQA 2B43A 5F8GA 2DFFA 3RAXA 4KHMA 3LP0A 4TQSA 4FZXC 1S9FA 3LPUA 1S1TA 1ZETA 1S6QA 1JXLA 2UVRA 4CF9A 3IS9B 3HL8A 2OPRB 1TKZB 4DF4A 2X6NA 4DQPA 2C22A 3QIPA 4O44A 5C42B 4TYAA 1BQNA 3SV3A 4FS1A 3LZJA 2CJQA 3PW7A 3BQ0A 1R0AB 1NJZA 3LWLA 4CJ5A 1T05A 4CE9A 2BE2B 5DQGA 1S9EB 2YKNA 4FBTA 4M41A 1IG9A 3GIIA 3OYHA 4ELUA 2XY8A 1Q8IA 2XCAA 4NCBA 3RMAA 4I9LA 3CFRA 1J5OB 4TY9A 2GV9A 4MFBA 5KFSA 3OS0A 5KG4A 3NGIA 1CXQA 4FJ8A 2BDPA 4E7JA 4NCGA 4EYHB 4J2AA 3QLHB 2IGIA 4OKEA 5KFQA 1WSFA 5KG6A 1D0EA 2YHAA 3EY1A 3NBPA 3SJJA 1MU2B 3QO9B 3KK2B 5C25A 4W5NA 4DS4A 1RTIB 2OA8A 1KCFA 3LP2A 3TAGA 1N56A 1QE1B 3TVKA 3T5LA 4KHYA 2HHSA 1C0TB 4U7CA 1TKXB 4LH4A 2BRLA 4MKBA 4OLAA 4RUCA 4O55A 2DFHA 1NHUA 1I39A 1XI1A 1MMLA 5KG5A 2RDIA 2OH2A 4FLVA 4F50A 1W25A 1VSJA 1IKVB 4AHVA 1HPZA 3DRSA 1TL3A 2AGOA 4M95A 2V4RA 2P1JA 4ELTA 4IH7A 1B92A 3ASMA 3K58A 4EBCA 1D8YA 3C95A 3VQ6A 3VQQA 1RBSA 2KFNA 1SH3A 1DTQA 1IKWB 3PR5B 1VSFA 2HHTA 3QETA 2E9ZA 3NAIA 1CZ9A 1SV5A 3C6TB 1S5JA 1ZBHA 1RT1B 4I2QA 2JEGA 1WNSA 1SKWA 2FBVA 5DLGA 2G8IA 1TQLA 3DOLB 3GILA 4DTJA 5L1KA 4BACA 1RTJB 4MK9A 3PO4A 3DMJA 1LWCA 3HVTA 1A5VA 5FRMA 4I7FA 1JLFA 3HP9A 5L9XA 3NH0A 4IG3B 4H4OB 3C6UB 3IG1B 3O4QA 4CEAA 4TXSA 4KAZA 4ID5B 4OJRA 3HXMA 2BANA 1EP4B 4O3NA 2W9CB 4RUAA 4B9TA 4F3OA 4HCBA 3V1OA 2R8GA 4CIGA 3NH2A 1BL3A 3JYTB 2PYJA 3KIOA 5KG3A 3PJWA 2IOCA 4DFMA 2OZSA 3NAHA 1RTDA 4DL6A 1S1XA 4JV0A 1S97A 4N56A 5DLFA 3OYLA 1D5AA 4E19A 4NYNA 3HPGA 5SWMA 2IAJB 4I9QA 3EPGA 2OPSB 3CDWA 3TAMB 2HHVA 3KHRA 1BGXT 4IFYA 4E1MA 4DSJA 2O5DA 1RT6A 4GC6A 4FCYA 1RBUA 3L2UA 4KHUA 4NLWA 3AA5X 5KI6A 2V0NA 1W9HA 3AVKA 2RN2A 1D1UA 4ICLB 2R7YA 1WSEA 2I1RA 4LY7A 3QYYA 3QGIA 4Z4GA 1NJYA 3SUQA 4CEOA 5CY4A 2XRIA 3G6YA 3DLHA 4J9QA 1EETB 3OS2A 3QZ7A 4B9SA 2NUBA 4WYLA 1JXEA 3ZSOA 3FFIA 3GV8B 1BI4B 4CERA 3BQ2A 3O3FA 3KJVB 3IGVA 5KFCA 4FZZA 1TV6A 4R8UA 3VQAA 5KFJA 1U04A 1T7PA 3RMCA 4O3QA 4CJUA 3QEVA 1SKRA 1S1VB 3HSTB 5KFKA 4FW1A 3OL8A 3Q8SB 4EP5A 2OPPA 2FVCA 4QWEA 1C1BB 1DLOA 1LWFB 3VN5A 4RNNA 3T5KA 4NLUA 4EO6A 4FJMA 1S0OA 4CJEA 4LSNB 1RT5A 3KMQA 2B5JA 4M3UA 4QAGA 3TAQA 4HVJA 3OVNA 4CF8A 1RT4B 4IKAA 3LP1B 3RR7A 1ZYQA 4CFCA 4CK3A 2YNIB 1VSIA 2VG6A 3TABA 3E01B 2ILYA 1S1UB 4CEFA 3PW2A 4KFBA 4FJLA 4Z4HA 1L3SA 4O44B 3CJ5A 3HT3A 1BQNB 5JUMA 4ED1A 2Q3SA 1KLNA 4F8RA 3SQ1A 4AHTA 3AVNA 4B3OA 1LAWA 4TY8B 3CJ4A 4DTNA 4B9LA 4NRUA 2YKNB 5CYMB 3OL6A 1SUQB 1HNVB 4F4YA 3VA3A 3P1GA 4KV8A 2R8HA 2R2TA 3V6DA 4JRPA 5DK5A 2B6AB 3AVLA 3VQDA 1JLGA 4BDYA 4B9UA 1HYSA 1S6PA 5HP1A 3TI0A 3VQ5A 1ITGA 3PX6A 1KVBA 3P5JA 3FQKA 3DLEA 2XC9A 1LW0A 4KB7A 5HBMA 2BQUA 2RPIA 3QNOA 4H54A 4KKOA 5J2NB 5EUHA 4OLBA 5DG7A 2E6MA 3I0SB 2ZD1B 4J9RA 4ZPAA 4DTMA 3SI6A 1CXUA 3AO5A 4DSIA 2WK4A 2EHGA 1RCHA 1HMVB 3LP2B 2VA2A 1JLQA 3K5OA 2JEJA 1RBRA 2WTFA 1G15A 4DLEA 3KLHB 3F9KA 4WZMA 2UVVA 4DU1A 1XHZA 1YTUA 3NCIA 2QKBA 2JEFA 4G1QA 2PZSA 3OS1A 1WSGA 1S9GA 1T8EA 4C8OA 5KG1A 5E41A 4K4VA 3UR0A 3SQ0A 3HPHA 3U3GA 1RA7A 2UVUA 1HPZB 3QIDA 1T3NA 1TL3B 3KLEA 2FJXA 2IC3B 1ZTTA 2WONA 4RW8B 3H5SA 4E3SA 1N6QA 2HHUA 4WE1B 4WYWA 1S1WB 4ED8A 4PA1A 4RNHA 1TAUA 3AA3A 4DTRA 4ZVGA 2JC1A 1SV5B 3PJXA 4YFUA 4ZMMA 2WOMB 3KK3A 4I2QB 3ZSWA 5KFXA 5HRNA 1RT2A 1C2PA 4LQ9A 3DRRA 2VG7A 1NHVA 4MQ3A 4K4SA 4CGIA 3PY8A 4Y2CA 4FJ5A 1C0UB 3DMJB 5DG9A 4BE0A 1JL2A 4I7FB 4IFVA 3VQ9A 2IJNA 2R2RA 2W7OA 3T3FA 2BR0A 4FK4A 2HNYA 1JLEA 3B6OA 4F4KA 1O1WA 3FRZA 4W5RA 3NAEA 2G8FA 3V81A 2ASDA 4NLVA 1NNDA 1K6YA 1DTTB 1YVUA 4IH6A 3UIQA 3F73A 3RRGA 2JGUA 1NK4A 3L3UA 5JS2A 4WFYA 4CHQA 4O3PA 4F4WA 3DI6A 1WAFA 1RTDB 1YT3A 2UVWA 3AV9A 2AJQA 2E6LA 2R2UA 4CGHA 3V9SA 1TK0A 2BQ3A 1BISA 4Z4IA 2YNHB 1IH7A 1HNIA 2D0AA 4B9NA 3CJ2A 1JL1A 4M3TA 4KI6A 1ASVA 1HQUA 3O3HA 3NGZA 1JLAA 2HWIA 5KFUA 1U4BA 2FVQA 3BGRA 4NCAA 4FW2A 3AVAA 1XR7A 2R8JA 2P5OA 3HPOA 2UUWA 2HNZB 5KT7A 4ZP8A 1TK8A 4M3RA 4N5SA 4TLRA 3LANA 3IRXA 1S10A 2ZE2B 2D41A 3RMDA 4IR1A 2D0BA 1W0HA 4FM2A 1BHLA 3SPZA 3SV4A 4F2SA 5KFFA 3N6MA 4KO0A 5J2MA 3TR8A 1RTHA 4IH5A 5KGWA 4NLRA 4FXDA 4TYBA 3HO1A 1NK5A 2I5JA 1GOAA 1XWLA 4ED2A 1JX4A 5HRPA 4KTQA 3D5MA 3ISND 3I5CA 4Q5VA 3DRPA 4Q8FA 4J9SA 3PW4A 2AU0A 4QCLA 5C24A 4HKQA 2R8IA 4O3RA 1C0MA 3MEDA 4DLGA 4RW4A 2FBTA 1NJXA 1RNHA 5L1IA 1JIHA 4LQ3A 3PHEA 4DQQA 4Y1CA 1N5YB 1RBTA 1ASWA 3PX0A 1S4FA 3KK1A 3CWJA 2VG6B 3RMBA 3JSMB 5DGAA 1L5UA 1N4LA 4CEEA 4N41A 3BSOA 4KFBB 4K4ZA 5EDWA 3LPTA 5KFVA 3SZ2A 1S48A 1RT7B 1JXBA 2FLNA 3CYMA 4M42A 4ECXA 4K4XA 4CJWA 1Z26A 4RNOA 3VQPA 2XCPA 1BQMA 3KOAA 4CGDA 4FK2A 3DOKA 4DF8A 2XY7A 3DYAA 5KFTA 3MXMA 4IRDA 4NLGA 2XI3A 3G0ZA 3AVHA 1HYSB 4CIEA 3MECB 1SL2A 5FDLB 5F8HA 1JKHA 4O3SA 3DLEB 2UUTA 3AVGA 3NGYA 2XY6A 1U48A 3VQ8A 5HBMB 3MTKA 3H5YA 1TKDA 4KKOB 4KAIA 4CF1A 2G8KA 4LSLB 3MXJA 2BGGA 4RW7A 2R2SA 1FKOA 4GMJB 1JLQB 2IA6A 1NOZA 3BSAA 5KFWA 3N6NA 4DEZA 2R8KA 3BSCA 3OHAA 4G1QB 1OS5A 2E9TA 1BIUA 4IKFA 1RDDA 4Z4FA 3HVRA 4RW6A 4DU4A 4O4GA 3OYKA 2RKIB 1REVB 2QK9A 5JS1A 4GW6A 3MR3A 2DY4A 3DLKB 4CJ3A 2RF2A 2XHBA 3SUNA 3V6HA 4I2PA 4AH9A 1LAVA 1IKYB 4EBDA 4DG1A 1GX6A 3NL0A 3DDKA 5DG8A 4DL4A 1VRTA 3ZSYA 3H08A 2YKMB 3ITHA 1RT3A 5F8NA 2HMIA 4KBIA 2ASLA 2OZMA 3DM2A 2XY5A 4OPJA 3AO4A 2Y1IA 3M8QA 4PQUB 4Y3CA 3T5HA 1WSHA 3KK3B 3ZSRA 3V1RA 2YNGB 4DQSA 4RW9A 2B4JA 2X6SA 1ZTWA 4BDZA 1FKPA 4H4MA 1SKSA 3H98A 4ED3A 3ZT0A 3CM6A 1JLBA 2IJFA 5F8LA 1XC9A 5EU7A 1RYSA 3MR6A 4XIUA 2W9BA 2C2RA 1EX4A 3QEXA 2ALZA 3OLAA 1VSHA 4DSLA 1Z4UA 2OPQB 4E0DA 3MEGB 4KSEB 1A5XA 4CJTA 1CSJA 4J9OA 4CJSA 4F3TA 4FJXA 5J1EB 4G3IA 3AA4A 4NYFA 1HQEB 4FLXA 2FVRA 3HM9A 2HNDA 2BQRA 2XGQA 4FK0A 3DI6B 1NKEA 4NRTA 3ZSVA 3MEEA 4IQXA 3ZSQA 2HWHA 4YR3A 1LWEB 3LALA 5KFRA 1KFDA 2D7SA 4ZHRA 1U49A 1VSKA 3GYNA 5HLFB 1TVRB 5D3GB 3CDUA 1VSDA 1VRUA 4FJKA 4DTPA 3KLFA 4Y1DA 4DTOA 4NLTA 3SYZA 4Q0BA 1RDRA 1RBVA 3V4IB 4R5PB 3NFAA 3KLIB 1C1CB 3GIKA 4OKKA 1RAJA 3KHGA 1ZBUA 2Z1IA 4CEZA 2DFEA 5F8MA 3QESA 1JLCB 3KLGB 4CHYA 4CJPA 1U47A 3L8BA 4C8MA 4EZ9A 3I5BA 4YNQA 4DL2A 3LP0B 4C8KA 3OYFA 1KLMA 3CO9A 4KHRA 3SQ2A 5KFNA 1IKXA 4KHSA 4DQRA 3GV7B 2OPRA 3QIOA 5I42A 3LWMA 1TKZA 3V9UA 1S1TB 1GOCA 4NLDA 1S6QB 5HROA 1TGOA 1RILA 3DRPB 4ZPDA 1TK5A 3T5JA 5C42A 1TKTA 4FJ7A 4RNMA 3LAKA 4RW4B 1N48A 4RNFA 4F2RA 5F9NA 3QIPB 1R0AA 1T03A 4FYDA 3OSNA 1NK8A 3RR8A 3GIJA 1WAJA 4NLPA 1WSIA 1LW2A 3V6JA 3CDEA 3QEPA 3TANA 4IR9A 1T05B 4YMEA 3VQSA 1C1AA 3KLVA 4J9PA 1J5OA 3VQBA 4PUOA 3KNAA 4O4RA 2ATLA 1Q9YA 3MFHA 2QV6A 4W5OA 5CYQA 3OHBA 3T19A
chains in the Genus database with same CATH superfamily
3RTVA 2GJFA 3ENWA 4FWNA 2HLUA 2FGOA 2VQFF 2QFIA 3OL9A 4CGJA 2QA4N 1VJWA 3H7HB 4DKWA 4NCGB 4C1NI 2DNKA 3LDNA 3WNEA 3ADAC 3MI7X 5AFUA 4ZJOA 3QO9A 3L4IA 4CZHA 3EL2A 3D1OA 3T9ZA 4NLSA 2YX7A 3HYFA 5C25B 3W2WA 2HBMA 3G6XA 1UOCA 2RU9A 2CIMA 3Q22A 3JAMU 3CULA 2YXLA 2EVZA 3VEXA 5LSRA 2Y1JA 1CJVB 3SMSA 4OPKA 3OVSA 1IKVA 3MF5A 3OLBA 4BROA 2VA3A 2C2ZB 1FK9A 2Y9HA 4HACB 3K59A 1V6HA 5KGXA 3PUFA 4FLYA 5AQMA 3NCPA 1EAYC 4GO7X 3VR1A 1KVCA 1Q18A 2PFUA 3WXMB 5A0YA 3P3DA 1RAGB 1GLDG 4OKJA 4BC4A 2AWZA 2RE2A 3UE5A 3O9QA 4LREA 5ITHA 4YS2A 5AQGA 4RW6B 4QWDA 2CG4A 2KVQE 4QJVA 1KXPA 4ECTA 3OBWA 3T6BA 2DPNA 1IBLF 2A5XA 4AQYJ 4RKUC 2F96A 1B9FA 1UAXA 3LGMA 4KTZA 2RS8A 5JVGL 2KVIA 4E89A 4CCHA 1VS3A 2CGLA 5LMNK 1WTBA 2W7PA 4ZPVR 3W61A 5KQDA 4IG3A 2A40A 2RRNA 8RUCA 2HGMA 3IG1A 2LQBA 2QE5A 2HBLA 1LWCB 2GUPA 3VQ4A 1ZM9A 3H42A 5LSLA 3C19A 3IWNC 3S3OA 3Q7BA 3UN3A 1BQXA 1YZ6A 5M2RA 2DH8A 3QT5A 5KFZA 2XM3A 2BANB 2OJ3A 4WXOA 4BC3A 3H8YA 4FLWA 4RG8A 4GV6A 4MMOA 2PMZD 4ZVEA 1YTYA 3KD5E 3QFHA 3C14B 1S1XB 3NRBA 2W9BB 2XZWA 4DCJB 1TL1A 4FLZA 4DSKA 1ZM2A 2ZOFA 2UXDK 4DV3J 4WFNL 2WVFA 3NKYA 4LFBJ 5L46A 4FBUA 5A2QO 1VOMA 2PDAA 3GQCA 4ZJQA 5BJRA 2LEBA 2MQMA 2FJWA 4ES1A 4CK1A 3GB0A 4BWMA 1N5TA 1EETA 1NKBA 5E0OA 2ROPA 5AQRA 1EKRA 4DTSA 3GYXB 2QI2A 2DH9A 4Q2MA 2DGOA 4LUBA 2KLAA 2YWEA 2VKZG 2CKWA 4PXCA 1VQLS 4K4YA 1EQYA 4E7HA 1CBKA 2GHVC 4K8ZA 3JSRA 3FFIB 1VI7A 5J1NA 1FEHA 3BR8A 3QB0A 5KG7A 2P9NB 2RJZA 1ZM4A 3HZ6A 3RBEA 3I6PA 3O9TA 5IT9Y 3MPDA 3L9ZA 4N8OA 2SXLA 2DTJA 2XMTA 4JI6K 3D7SB 2HLTA 4FJHA 4DR4F 1N32K 2N82B 3QT7A 3DXSX 3GP9A 3B78A 4L76A 1N0UA 2CGJA 2WTUA 1KAXA 3LP1A 2Z2LA 2VBZA 4QYZK 1FWLA 3R5JB 4X62K 4F0MA 3E01A 5HROB 2Y0BB 5GMKa 5CQGA 4GKKJ 3PVXA 3OYDA 1UETA 3BYPA 3C8YA 3RUBL 1TKTB 2Z0GA 4JV2A 3VQ7A 3OYEA 2FJEB 4UOGA 1T03B 3KKFA 5EVZA 2Z1GA 2V50A 4V19X 5CYMA 2IDEA 2PAVA 2K7JA 1SUQA 1HNVA 2XSJB 1KC8O 3P38A 4BDPA 2QGFB 4PUOB 2LXFA 1QS4A 2NYHA 4DX6A 1PSDA 1PJ7A 2B6AA 1IR0A 2DGSA 3H6EA 5CYQB 4KV8B 1V3RA 2PEHA 5IWAJ 2GMLA 1IJFB 1HQ2A 5KFPA 5J2NA 5KTQA 3SFUA 4IG0A 4C3LA 3U7JA 3I0SA 4DUYJ 2YJFA 1Y0HA 1HMVA 4DV1J 1N33F 3DLBA 1TUWA 2JLFA 1S0MA 2G8WA 1L3UA 4AQYF 3KZBA 2F8HA 3NGTA 4CTAA 3Q8VA 3QQCD 3QGGA 1U0SA 4KE5A 2VG5A 1SJ4P 3CCMN 3O3GA 2W40A 2BJEA 4KPYA 1KQGB 3BKFA 5C15A 1CJUB 5E3PA 3R8YA 1XHXA 6AT1B 1S9GB 3H90A 1KVIA 3F5TA 2YKOA 3PACA 4UQGA 2E88A 3KLEB 2POKA 3U1NA 3Q8QB 3OJUA 2M8HA 1SBRA 1S1WA 2ZH1A 2VQEK 5M1NA 3D68A 1UL3A 5KT5A 3NG8A 3K5NA 3FC9A 2HIQA 4A5BA 4ECWA 4B08A 2D1CA 4IOBA 1VHXA 2VJUA 5EXWA 3GJRB 1J53A 1GLEG 3UDVA 3BBBA 5FIIA 5CABA 2D0CA 1KONA 2QL9B 2CQDA 4FZYA 1NGFA 1ATRA 1RT2B 3M30A 1FNXH 3MM5B 4P73A 4E1JA 5I3PA 4EK2A 3A2FA 5J2QB 2RILA 3B4DA 4CECA 4IFVB 3S3NA 4B9MA 3VETA 1HKBA 1QTNB 4PZVA 3P45B 4LF9K 4E7LA 3GU0A 3MCNA 2EFGA 3K5MA 3CCRN 3J7YP 3FKBA 3THPA 1NPPA 3A8EA 3E9OA 4PXEA 1FESA 4MIWA 4G9ZA 2C3PA 2X7IA 5C2GA 3CCLS 1WF0A 4TSXA 4I6YA 4DMNA 4J9LA 2RHKA 5L9NA 1WSVA 3HZEA 1W2BR 1F3FA 2OTJN 4E1NA 2RQKA 3TUJC 1WOOA 2F7VA 3O9UA 3G9CA 5IXUA 3ZT3A 3BSNA 1VSMA 2QEXN 2G8HA 2B7BB 5AQZA 2J5AA 4KHNA 2LSNA 4B3RJ 5I3UA 4DR6K 1JLAB 1OPZA 1YHQN 4QIWD 2B9XA 4JV1A 1GMVA 3TUPA 4P10A 3FMWA 3M8PA 4U95A 4GKKF 2VODA 3DFEA 1ZAXA 1E6VA 3IRXB 3IR5B 2M4MA 1T11A 4FKYA 1CLQA 4ILMA 4KO0B 5J2MB 1FVQA 4LF4K 1IJJA 1CPZA 4JS4A 4F36A 4L72B 4KPCA 2FJVA 5D4NA 2BX6A 5B09A 1GOBA 2J6UA 4QS7A 3L2WA 3CD7A 2BUNA 2XEXA 3U27A 5IWAF 1EX8A 3CT9A 1AA1B 4JP8A 4JI0K 4IRCA 1RDCA 4K7QA 3UNGC 2KU7A 4DFJA 3H1QA 3BYRA 1TTHB 3LM9A 4M94A 3QEWA 3KK1B 5AT1B 3E51A 1RT7A 4ELVA 1YVFA 1MWKA 4HUEA 1QSYA 4RZRA 2HFZA 4YQWA 4P7VA 3ZC4A 2GA7A 3FBCA 1SCJB 1ZBSA 4YOYA 5DS7A 4AL5A 3VALA 1VC0A 2W2PP 3CF5L 4YHHJ 5A2QY 1W2BM 1C0FA 1RTIA 2D74B 1BQMB 3OFGA 1UVIA 1QVFR 4PL7A 2WVBA 1TL5A 2AJ1A 1ZZFA 1B9DA 4EP4A 5ETSA 5FDLA 4XPCA 4J7CA 2W1BA 3D2EA 1NGIA 3DLGB 4LSLA 4BR7A 3TA0A 4K5RA 3D7EO 5KG2A 2W2NP 2H65B 1FJ7A 4MKAA 3Q0AA 3ILIA 1L3TA 2XHCA 2FSNA 1ZBTA 2ZF5O 2ADBA 3K2PA 5A8KA 3CQ8A 1LEOA 4X2BA 4HHTA 2GIQA 3EJMA 1YKWA 1KOHA 3BDPA 3WXJA 2G13A 1HR0F 2KXHA 3HBTA 4FM1A 1NK7A 4DPWA 4BRGA 4OGCA 2MZJA 4A4JA 4ER8A 2RUGA 3SBGA 5C7PA 2QLJB 3OYAA 2ACMA 4CJQA 6FD1A 3GSIA 1U2VA 4C8LA 2RQ4A 3L7UA 4ETZA 3C7NA 4GO5X 2DB1A 3QGPA 2WVEA 3BQ1A 3Q83A 4USTA 4DDFA 3K0JA 2HEKA 4ZVFA 2GELA 4HR2A 3V9XA 1GNKA 2PFFB 2FJBB 3IM9A 6FDRA 3HHKA 2HMIB 5U47A 2J0WA 4R0JA 2YNGA 1I1GA 3M8QB 3V9WA 4H8KA 4IOXA 2UXBF 3U1LA 3D28A 4OV6A 4YR2A 4A8SA 1SC3B 1FKPB 4OJHA 1BO5O 3NF7A 2C2DA 3L2RA 1O0PA 3ID6A 2D9OA 2ITGA 4B3RF 1Q5YA 2OPSA 3HRGA 1N88A 2QIFA 2IJRA 4O5BA 4M3WA 2J6SA 4J8FA 5J1EA 3VQCA 3OW2M 5EY4A 3BZCA 3QZ8A 1HBNA 3EPIA 4Q43A 3KHHA 2YJEA 5K8OA 1XIQA 3D1HA 3O1BA 3KMSA 2LQJA 4K50A 4A61A 2LLZA 2F8SA 4X64J 4EBEA 2GJIA 3VTIA 2HVIA 2Z56B 2UUBK 3WZ0A 1TVRA 1F9HA 4LF1A 3HOTA 2GNKA 5KG0A 4DV7J 4ZHRB 3FQLA 1K73T 4U67Q 4QWAA 4X4SA 3AGRA 4OZNA 4PXBA 4ZDNA 5KRSA 3V4IA 4X4RA 1C1CA 2H4YB 1VQSA 2ZJRL 3KLFB 1X9MA 4IOCQ 4OZ0A 3WQPA 4F04B 1CZAN 4HUFA 4OGEA 1BD6A 4QIVA 2KH9A 3AA2A 3KLGA 1HWIA 2G9OA 4I6WA 3QBCA 3VPZA 3J7AN 2HRUA 1NO8A 3RAXA 5ETKA 3H2VE 2J8AA 4WU2A 4KH5A 2YPYA 3CCUS 2DXFA 2UV8A 3AOCA 2AJ4A 2VF3A 4YHHF 3C15B 4AE5A 2X6NA 2ZWPA 3WDOA 2F63A 2DEIA 3SV3A 3EDQB 2AF6A 3BQ0A 4QR2A 1NJZA 5EGYA 2NXJA 1F2GA 4HHJA 4MT1A 5IC6B 4C0HA 1S9EB 3GZ7A 4RL1A 4B1WB 4JI3J 1IG9A 2FGCA 3OVBA 4TY9A 2GV9A 4MFBA 4RBVA 5ETVA 3CJKA 2YHXA 5AJ3J 2BDPA 4E7JA 4CLSA 2MSSA 4I64A 3CIPA 3VGUA 4OKEA 3AXMA 5KFQA 2A6OA 4BC7A 1K44A 2P9SB 1K0VA 2QC3A 5A8WB 3D6FB 3QRRA 4IO9L 3TVKA 2KM8C 2E1AA 1C0TB 3JXOA 2CZVC 3FCHA 4L3NA 4FP9A 1NWKA 1QUPA 4Y65A 1LK5A 4CM0A 1MMLA 2X1BA 2Q1NA 1O51A 1IWGA 4FLVA 3LOUA 1W25A 4FPRA 4AHVA 1OPIA 4AM6A 3M6WA 4BS2A 4M95A 1HKGA 2VICA 4OYPA 3DU5A 1GXUA 2E1ZA 3K58A 4EBCA 1D8YA 3FBBA 4BR5A 3RW6A 1WEZA 1BLUA 1YBUA 3CJAA 1HBOA 3NAIA 4LR7A 1CZ9A 1S5JA 3LH2S 3CIMA 1WNSA 5DLGA 1XMOK 1TQLA 3DOLB 5L1KA 2KXFA 1XQIA 2MZQA 4ZVTB 2P9PB 3G4SS 5L9XA 2PI4A 2LU2A 3HDSA 4LF5J 4KAZA 4OJRA 1G4CA 3RW7A 2OEJA 4O3NA 4QU6A 5JVHQ 1X9JA 4B02A 4X64F 4FPIA 2PYJA 3KIOA 5KG3A 5B0AA 3EGNA 4X84A 3NAHA 5HSPA 1RTDA 5GMDA 4JV0A 3OYLA 1D5AA 5AXKA 2XZTB 2GX8A 2NXEA 2D3OR 3CDWA 3TAMB 1B0VA 3AQPA 2O5DA 1RT6A 2OMOA 4LF2A 3FEYB 2V2KA 3L2UA 2V0NA 3M6GA 1B0TA 1D1UA 3THYB 4ICLB 2XMKA 1RAAB 3Q8UA 3PNIA 2YCHA 4Z4GA 2H5JB 5CY4A 1DHMA 1LK7A 3NGRA 3UVJA 4USUA 3AAWB 1JXEA 3ZSOA 1S3XA 1C4AA 1SJ3P 3O3FA 3KJVB 2VZ9A 4TKTA 4FZZA 1ZZNA 1S0VA 4EIAA 3GONA 1F3VA 3VQAA 4CLKA 2BKNA 3G82A 4RPFA 5KFJA 1Y64A 4CJUA 5KFKA 1Q8BA 1S6OA 2GMJA 2OPPA 3N5BA 2QL5B 4P2XA 1LWFB 3OQ2A 3ILLA 4PR6A 3UW1A 1RHKB 3T5KA 1VQLN 4FJMA 1S0OA 4CJEA 4LSNB 4AL7A 4FWLA 5AJ3F 4M3UA 2P9IB 3TAQA 4F0HA 4HVJA 4Y6IA 1AFJA 1T9TA 1YLXA 4CK3A 4PL8A 4L75A 1VSIA 3M8ZA 1LCUA 1VJQA 5F0WA 2MGZA 4OZ5A 4YOTA 3B54A 4OZLA 4P2SA 4FJLA 4Z4HA 2CQ2A 5JUMA 2BKOA 2Q3SA 4HHUA 3MN9A 5HQLA 4MTPA 2KG0A 3SQ1A 4AHTA 5GAHU 4B3OA 1FX2A 1LAWA 4EFHA 2ZNZA 3CJ4A 4B9LA 2NR0A 4NRUA 4CH7A 2YKQA 1XMQK 1RSCA 2JDJA 2R2TA 2PEBA 4O23A 5DK5A 5GINA 3BV8A 3VQDA 1HYSA 1S6PA 5HP1A 2XMAA 3M6UA 3TI0A 1KVBA 3P5JA 1B64A 4NPOA 3LDPA 3LQVA 2YX1A 4KB7A 2OSQA 3ZTOA 3ZTSA 4BGAA 3TJ8A 3J80U 1K8AO 2E6MA 5AQVA 5F0UA 1SB6A 1BA1A 1XNQJ 2WTFA 4DLEA 3L95X 1REGX 3MEKA 3CMAS 1YTUA 3ZZZA 3ZO7A 3VGKA 4KGXB 3GLJA 1GMUA 3PTWA 4C8OA 1LXNA 3B6BA 5KG1A 5E41A 4O5FA 5LL6Z 2GHPA 1NUEA 4LF5F 3AOBA 3SSRA 3W65A 1RA7A 2UVUA 1HPZB 3QIDA 2FJXA 1IV0A 2F4VF 1WD6A 3VEWA 2PE8A 4E3SA 2O8CA 4C0OC 3H45C 2ZM6K 1A7GE 1WC4A 2U1AA 2KT2A 2BUPA 3QT6A 2GWJA 1N0VC 1RWXB 2O01C 1SV5B 3KK3A 2C2MB 2ZDPA 1WC0A 2ASMA 5HRNA 2J7WA 4A8QA 4LF6F 4LQ9A 1NHVA 2VG7A 1QAYA 4Y2CA 4HT7A 4X66K 4ZVOB 4FJ5A 3ELHA 2VWBA 5DG9A 4BE0A 2BE7D 3IRWP 4I7FB 3VQ9A 2R2RA 2W7OA 3BF3A 5HANA 2DO4A 2BR0A 1HKCA 2HNYA 1JLEA 3B6OA 4F4KA 3GFYA 4RX6A 2G8FA 3V81A 2QL7B 5AQNA 2ASDA 1Y5IB 1NNDA 1SC6A 1K6YA 4D3GA 1YVUA 4IH6A 1I94J 2P8IA 2B4PA 1EO1A 3AAQA 3X1LB 1WAFA 4QIFA 3AD7C 2E5GA 3AV9A 2AJQA 4CBXA 4N8NA 2R2UA 4CGHA 8ATCB 3KFWX 2BQ3A 3BO2A 1TZ0A 5GAHI 2YNHB 2GVDB 4OLPA 2D0AA 5F0XA 3P96A 3DHXA 4ZKAA 4M3TA 3CXCR 2CJXB 3BKTA 2U2FA 3MM8A 1Q5VA 3NGZA 3VQTA 1U4BA 3LDOA 1SQKA 2KM8B 1X4BA 3MMJA 5JICA 2V8GA 3CCLN 4GRSA 4TLRA 3LANA 2D0BA 2DNLA 4I4BA 3R5GA 4F2SA 1ELOA 5JJBA 4CLTA 3TR8A 5KGWA 5K5MA 4B1YB 4NLRA 4LF7F 3HO1A 1NK5A 2I5JA 3J81j 2J76E 1P1LA 1DEJA 5HRPA 2BBEA 3ISND 4IUFA 4LVNP 8AT1B 2XO6A 1A0OB 5FPNA 3MEDA 4RW4A 4JYAJ 3PYDA 2XLKA 4TU8A 5GIOA 4DQQA 4NOHA 5H9FJ 3GFHA 1RWUA 1U1MA 2UXCK 1ASWA 1X60A 1XNRK 3DLLL 3PX0A 2HAFA 5FPDA 1CS4B 2QTDA 3RMBA 3JSMB 5DGAA 3W8PA 3K5PA 2MKIA 5B0CA 4N41A 1BU6O 4KFBB 4KR0B 4H0VB 1U1KA 4OMFG 4CD1A 2KJWA 4K25A 4ECXA 1YJ9S 1NU4A 3VCDA 1YDLA 4RNOA 3QJLA 3EGWB 3GYGA 1UCNA 1K8KB 3M05A 3OR1B 2AZ1A 1LQ9A 3CW2C 2XY7A 3MXMA 2QYGA 4X65J 3CXCM 1NAQA 2XI3A 3G0ZA 3D1QA 4A2AA 3ILOA 2LA4A 3AVHA 1HNXJ 1SL2A 5D0GA 1JKHA 3T1YK 2KHDA 2P6TA 2UUTA 4FWQA 3NGYA 1NGJA 5AQPA 4QR0A 2VHGA 4CT9A 4CF1A 2BTFA 4F26A 5IV4A 5D4PA 2R2SA 3M32B 4C0BA 5BYSA 1FKOA 4CO4A 2P5VA 2IA6A 3CPWR 3FR0A 3VF2A 2WSFC 3N6NA 2ZZTA 2C1EB 2CPDA 4DEZA 3E9PA 4G1QB 2E9TA 5H1SQ 1BIUA 4IKFA 4CRJA 3LO3A 4R25A 2YH1A 1RDDA 2ITMA 1IM6A 2ZFHA 4Z4FA 2BYCA 3HVRA 4RW6A 2RKIB 5DZ7A 1REVB 5M1OA 4DB3A 4FF1A 1CC7A 4ANCA 3R1XA 1TL7A 2RF2A 1SJFA 2XHBA 3SUNA 2MHEA 3MM6B 3V6HA 2E2PA 5AFUH 1I94F 4DG1A 5DG8A 2G0CA 1N8RT 3ZSYA 1W7WA 3WEEA 4CD3A 5I4MA 4UT4A 1YRXA 4JI1K 2Y1IA 4PQUB 3A13A 3T5HA 3ZSRA 3CJTA 3R27A 3Q2TC 3DGVA 4RW9A 2B4JA 1ZTWA 2X6SA 5FPEA 2VPYB 1SKSA 4CLYA 3CUNA 2FD2A 4W90B 3CM6A 3CC2S 1RYSA 4QBUA 1T6DA 5LT5A 2QA2A 3L3CA 1QY7A 4DU7A 2W9BA 2GIFA 1Z1ZA 1DARA 1EX4A 4H0PA 4O8KA 1RP5A 4DSLA 1O8BA 4E0DA 3KDNA 4LFCJ 1CSJA 4J9OA 2DNOA 4F3TA 3A5LC 2KT5A 3VZIA 3D66A 9ATCB 4NYFA 2QO3A 4G6VB 2VPXB 3HM9A 1M90O 4FK0A 3H1VX 1R31A 2BJ9A 2E5HA 2RDDA 3HFZB 4JI4J 3BF1A 1R7IA 4LBIA 1X31C 3PYGA 4WP8A 1U6ZA 3ZETB 5HLFB 5LM7E 3CDUA 4FJKA 1F60B 2EBEA 1WG5A 2VKRA 4NXMF 3IP0A 4USJC 1RAJA 4WKYA 4OKKA 3B8AX 2ROEA 1K9MO 4CEZA 3MMCB 4DCPB 2DFEA 1P8ZA 2GCFA 5F3TA 5ETNA 3W60A 1JLCB 5DDRC 1U47A 4B3TF 5T41A 2LYVA 3I5BA 4ZS6A 2LMIA 3LP0B 4C8KA 4JN4A 4AM7A 5KFNA 1OQ6A 4H0OA 2EKYA 4FVUA 3R9PA 1S6QB 5HROA 3TJAA 2G0IA 1TGOA 1VBXA 1RAFB 4HEA9 3DRPB 1HNWK 1TKTA 2NUUG 1U8SA 4PKHA 3SLCA 3LAKA 4H5RA 3VWSA 4ZITA 2DH7A 3MUVP 3NVKA 1T03A 1HNXF 3HFVA 2MKKA 3V6JA 1TU0B 1NGGA 2FPHX 3QFUA 2Q36A 4P75A 3AB2B 1F5AA 4OX7A 4U8YA 3DU6A 1T05B 5LL6d 3KLVA 3PSIA 4MAKA 1WBDA 2DIVA 4J9PA 2OSRA 3VQBA 4PUOA 4UZCA 4H5VA 3BF4A 1VLYA 2KYZA 4KH1B 4CZLA 5CYQA 3OHBA 2UUAF 1NJIT 4AF1A 2Q1LA 2V6AA 3CCUN 1U09A 3OYIA 2DGQA 4L3KA 3N4PA 2ZBPA 2XYHB 2IM1A 1PG5B 2FHJD 5DGBA 1BG3A 3NBPB 1QE1A 1M1KT 3DOKB 5KFYA 4CJKA 2HVHA 4JI5K 1RCOB 3I9ZA 1FTCA 1S7HA 4GMKA 4ZLJA 2O3DA 4YP3A 3VESA 1ZBFA 4JI6J 2Z30B 1CJUA 1FXXA 1N32J 5KFDA 4ITSA 2QRRA 3M9OB 3MMBA 3K89A 5HVFA 2OGUA 4BWJA 3K9JA 3Q7CA 3CG7A 2QSWA 2L41A 5IM0A 4X62J 4LR9A 2DEJA 4RWTA 2MJNA 4KGMA 4QU7A 4J37A 3QEIA 4RTFD 2AHOB 1IKWA 1SL1A 1KFSA 2JSXA 3K8VA 3G6VA 3PO5A 2AJ0A 1S6UA 3ZX2A 1U0HB 3TAFA 4JHDB 4O4GB 1QZ5A 2DITA 4Z4EA 5DJBA 4CHZA 4XPEA 1RTJA 1WKKA 2V8HA 3ID8A 2QFJA 4CEBA 4N77A 4GC7A 3ZZPA 2HB5A 1JNRB 3SUPA 4CGFA 3C6UA 1HARA 4KGKA 2I6WA 3Q8RB 4EZ6A 4ID5A 5J2QA 1EP4A 1JLFB 3KG4A 3FSIA 4PABA 3KG1A 2O67A 3MN7A 3GDQA 3CSKA 1B0PA 2HFVA 4U7UK 4JI4F 5MAOA 4B8CA 3JYTA 2ZH6A 1ZBLA 1V9OA 1XJWB 4YDUC 2XBPA 2ZJPQ 4U7UD 4HL9A 4ZVHA 5EWFA 3R6MA 1LOUA 4Y28C 3L2QA 4ILRA 1EZZB 2M3DA 2XI2A 3EKSA 3PKMA 4LF8K 4X4NA 5LMNF 3G4SN 1WHYA 4WK1A 2OANA 3JAMO 4JOUA 3JSYA 5DQHA 4F4ZA 4IFYB 2E5LK 1YRTA 4GKJK 2R7SA 4CI0B 1WSJA 2HVEA 4FVCA 2B56A 4RJVA 2WZ1A 4GVMA 3O6WA 4DV2J 3DLRA 3OYBA 4CFBA 3HK2A 1WHWA 5KOWA 2W01A 4ANEA 4IEEA 1S1VA 2UXDF 5M1FA 4YOWA 3OYJA 3CB4A 3UPFA 4NO7A 4MLEA 1F5CA 4BE2A 3WUHA 4FJ9A 3KNGA 1NMDA 2FLLA 5F9LA 5D77A 2IFXA 2PBDA 3SXLA 1SH2A 4JB8B 1DLOB 1DBDA 1WLJA 4DFPA 1VQNS 2KYXA 4KGZB 4LH5A 5LY3A 4LF9J 2WHOA 1RT5B 4BRDA 1RT4A 3OTEA 4CIFA 1KLMB 2IM0A 2YNIA 5HVGA 1IM4A 2AD9A 4JV5J 2QA4S 3TSPA 3S6EA 1S1UA 1NDKA 4M5GA 5LJWA 3SQ4A 1QUVA 2ZH8A 5B0EA 2R7VA 1X9SA 3BO3A 3SSQA 2O8BB 3ENAA 1R0CB 2UUCK 2HRYA 2R9LA 5HJXA 1YJNS 3UCGA 2FHOB 4DHVA 3BBCA 3MD1A 4JI6F 1N32F 3FZLA 2GO8A 2X1GA 1RYRA 3AT1B 3ENVA 2PSZA 1R3NA 1CQMA 1RAEB 2DNQA 2D3ZA 2A1RA 3Q8PB 2B0GA 2Y1LB 1RWKB 4A46A 4X62F 3O1WA 3ALYA 2HKEA 1WI6A 1UJ5A 3HCXA 1FXLA 1JLGB 3FDSA 4ZPCA 3DLGA 4CHOA 3KWGA 2I9SA 4ZK7M 1FW6A 3G71S 4YOXA 2XHWA 1VQPS 1HBMA 4NI2B 4CHPA 4B9VA 2W8LA 2YHBA 5D0HA 3MN6A 3KLHA 4CZMA 4M5JA 1N5SA 2B8QA 3VERA 5FROA 4LIWA 1M5HA 3H2UB 1ULRA 2MMYA 5MLCV 5FRNA 1RK8A 1FJCA 4HYKA 1YVNA 1VQ4S 2QWPA 1YG0A 3SCJE 1UA0A 3VGVA 1T44A 4NZ0A 2P9CA 5AZIB 1QAIA 4A59A 1TAQA 5KFOA 2QSFA 3R5AA 5IQQA 4FM0A 5CCLA 2ASJA 2WUSA 2CJKA 4AL6A 5ELZA 1NK6A 2KZZA 4WYBA 2C3UA 3ZLJA 1RLDA 5C12A 1HW8A 2BH1A 2MYFA 4WE1A 4IO8A 2WB1D 1AZSA 1G1XA 2WONB 4DL7A 3AVJA 3GIMA 1N6QB 1QVGR 3VGTA 3VTHA 3DDNA 3CD5A 3IN5A 5AQLA 3CMAN 5BPMA 2XMJA 3A3OB 2CRLA 3AAPA 1HJRA 2AZ3A 5AXMA 4ECRA 4WCEQ 3MTJA 1BWVA 4EO8A 1RTZA 2W42A 3OJSA 2HBJA 2OUGA 4IWVA 4DCOB 3DRRB 2LCWA 5DM7Q 2A0FB 4CHNA 5LXRA 1UPPA 2O8DB 3S9HA 2XWYA 1FRKA 3KUEA 5T14A 3W3SA 1N34K 3T1AA 2MQNA 2QMXA 1DTTA 4S0MA 3O2IA 1QQCA 4PWDB 1ZA1B 1VIXA 1F9EB 1Q16B 2W41A 1UVJA 1BCMA 5BR9A 4M5LA 1DJ0A 3A5NC 1HBUA 2L48A 2V69A 1RCXB 4CH1A 1UA1A 3UB5A 1R8PA 3BBFA 1CG2A 2V2ZA 1ZOTA 2QXFA 3UD4P 3R6GB 2HK2A 4C8YA 1UKUA 1JCFA 3DXKA 3J81U 4M5NA 3AVMA 3QINA 4Z7CA 4URSA 1VDHA 1WDTA 3TARA 4EHUA 4EEYA 3LGHA 2WSCC 3AVBA 1OY6A 4FJGA 4LF9F 2GIRA 1H74A 5A8RB 4IBNA 3DC2A 3ULHA 2HNZA 4M5DA 4JV5F 4M3YA 1UFKA 2XB2D 2BVZA 4NL5A 3OYGA 3C94A 2ZE2A 3FK4A 4JI8K 4BREA 4LFAK 5C2CA 2KFZA 4DV0K 7AT1B 3TSQA 2EC0A 5M1KA 1G3OA 4TNOA 2X3DA 1H3DA 2CNNB 5HRRA 2V9WA 3ZZTA 4HI1A 3NF6A 2KQ2A 3TAEA 3DGPB 3S01A 4FLTA 4J9MA 5CXTA 1KDNA 2N3LA 4DL3A 2HFNA 3SDEB 3R5BA 3DDIA 3C15A 3C3LA 2KG1A 3CETA 3O5TB 3LAMA 3FZKA 3HTVA 3OXGA 4DR6F 4IEIA 2OYQA 1EKEA 1N5YA 2WW8A 2OELA 4W5TA 2V4JB 3B4MA 2UV8G 5LJVA 1LNQA 4AHCA 1S9EA 2QA4G 3H5UA 3C2PA 2Z2ZA 4E7KA 4DR3K 3MOJB 1EXQA 3I32A 4EHTA 3TRGA 3CVKA 3SAHA 2JLEA 2ZBIA 4LF4F 4MK7A 4BRMA 3HD2A 1OIAA 2HIYA 4EWTA 4ZLNA 2RSQA 3NF9A 2UUBJ 4RU9A 2Z1HA 4ECUA 2G2YA 1YI2S 4OX9J 4CLPA 2LQ9A 5E3RA 5G0RA 3PW5A 2UU9K 3SCIE 1S12A 1M1HA 3JAMY 1IBKK 3LUYA 5A8WA 4LRCA 5SZTA 1KTQA 4FPBA 2K1RA 4HHHA 3VEZA 4JI0F 2HBRB 2RE1A 4JKCA 4K4UA 2DNYA 3O3LA 4BC2A 3K57A 2ASYA 3PJ9A 4NA3A 5AQUA 1ICEB 1PIEA 2HBQB 4BG9A 3ENBA 2JZ5A 5JVGQ 2XYPB 2FDNA 2HHHK 4FS2A 1YJ9N 1RDAA 4O8UA 1MWQA 3B6PA 4QS8A 1MROB 1MMNA 1HRHA 5ETRA 1YX2A 2VFUA 3C16B 4CNYA 2IHR1 2GVZB 3ZXWA 4E7IA 4MH8A 4GV9A 2IA0A 5D78A 1DURA 2GUIA 3RSEB 3VAKA 4LR8A 3P4UB 3KKRA 1GTEA 2HK3A 3CM5A 3LDSA 1HWJA 2O4GA 3OSPA 4YORA 3MAAA 2K06A 1RBAA 4F4XA 2V5HG 3T6JA 3UNYA 1ROFA 4NLYA 5HL7Q 2GHWA 2JC0A 1IKYA 1KVAA 1UAWA 2M52A 2DPJA 2Q6CA 2RUSA 3TQEA 1WC1A 3EEQA 1KTVA 3D6RA 4I2PB 3CJ7A 4W5QA 2DR8A 4CFDA 2P9KB 1DGKN 2FVSA 2X78A 2JFKA 4DV6K 4NA1A 4NLOA 2KL8A 4CLZA 1BWEA 1OVQA 3H25A 2YV0X 1NZ8A 2FSKA 1SIWB 3CD6S 1WOQA 4DL5A 3MD3A 4CI6A 3I82A 3ZEUA 5CYJA 4XO0A 1NH7A 2C42A 1YTAA 3LPYA 4EYIB 4CFAA 4K4WA 1SL0A 3EVOA 1AFIA 1BIZA 2O8FB 1EB0A 5EWEA 1H1VA 1RA6A 1NXIA 3VAFA 3AGKA 4FWKA 2LXIA 1HD1A 2OPQA 3MEGA 2CNOB 3RU0A 1QLNA 4JKGA 3WNFA 2HBKA 3C46A 1QAJA 3TEGA 3RB3A 4ED7A 3RGIA 1TUYA 2LEAA 2NRHA 1GT8A 2DPIA 3THYA 4FLUA 3KUHA 4Z0UA 4DWIA 1IVZA 1R8HA 3FFKB 4URQU 4JK8A 1I3AA 3CFOA 2DISA 2QX0A 4MO4A 3NNHA 4NWBA 4WFAQ 2WB4A 5L1LA 2CPHA 4UQTA 5JMVA 4FWMA 3CC2N 3OA9A 3KJVA 4BHQA 2VBWA 5D3GA 5KFLA 5BR8J 2Z1JA 4R0EA 4DTUA 1KWMA 3GFXA 1VFJA 2JJ4D 4R5PA 3H4DA 4K0KJ 2ASPA 4HVZA 4Q0BB 2JWKA 2QKKA 3ET6B 1UFWA 1U7LA 4B8AB 4ZIWA 4QPTA 4N7TA 2YPZA 5F8GA 3M6VA 2K3IA 1RHJB 4KHMA 3IFEA 3THXB 2V7ZA 2QWOA 3HHLD 2UUBF 3U02A 1S1TA 3RJMB 2UVRA 3CJCA 2YX6A 3IS9B 3QWPA 4OX9F 3V2UC 4BRAA 1TKZB 2AYEA 2RMLA 4U67L 1YUWA 1B99A 4DQPA 2C22A 3RAMA 4F25A 2I7PA 2HS0A 4IOCL 1YBTA 2E1MC 5DDQC 4FWOA 1FJGK 4KJIA 3CI5A 1RWNB 1Y5NB 5DQGA 2XNQA 3D2WA 3SAFA 1P9YA 1RQ0A 2HFOA 4M41A 2Z8QA 3OYHA 2XCAA 2P6SA 4I9LA 3CFRA 1J5OB 2CNKB 4W98A 1JJHA 1TUGB 5KFSA 3OS0A 5D8HB 4OX8A 4WTYA 4E2FB 5KG4A 1VMBA 3NGIA 1CXQA 3FNNA 3I87A 4DN9A 4JBCA 5B7WA 3MCPA 3QLHB 1T95A 1WSFA 5ADXA 3KDOA 5KG6A 1D0EA 3QWUA 2KRRA 3QO9B 3CGIA 3UCUP 3KK2B 1Y4ZB 1KCFA 3ZNJ1 4C7QA 4CZJA 3T5LA 4KHYA 2Q66A 1WOPA 2P9UA 1TKXB 5ETQA 1M5KC 2MZRA 2VBYA 1D09B 4O55A 4OI2A 1WG1A 4P71A 4E98A 1I39A 3A1YG 4FF3A 4DV3K 2OH2A 4BRFA 1U2FA 4LFBK 3EGVA 3CCSS 4F50A 4H03B 2KHCA 5D6GA 2EFNA 1IKVB 2VQFJ 2PA8D 1HPZA 3DRSA 4CZIA 4DPUA 2AGOA 1YSJA 2V4RA 1W97L 2HGLA 3IFRA 4ELTA 1MW7A 1H6KX 1VQ7S 1QZ6A 4CIOA 3VQ6A 1Q82T 1RBSA 1SH3A 1DTQA 1NDLA 4RUHA 1VSFA 5A0YB 4BGBA 4IJNA 2JFDA 3SCLE 1SV5A 4OYMA 2V7YA 3OT9A 4NXNJ 2QWQA 2AA4A 1ZBHA 3ZX0A 2G8IA 1NU0A 4DTJA 3AD8C 2AP1A 2Q79A 4BACA 2HF4A 5M2PA 4P2MA 3HVTA 3MMVA 5GAGP 5FRMA 4I7FA 3OBYA 3HP9A 4IG3B 3ENHA 3IG1B 3R1HA 3KVGA 5SUHA 3W5YA 3R5DA 4ZVQB 3ZYYX 1SQGA 2ZHOA 2J0SD 2I38A 3NH2A 1Y5LB 1YJUA 3J7ZT 3PJWA 1LWXA 2CQ4A 4I68A 2IOCA 4DFMA 2OZSA 1YJVA 1XMOF 2CPZA 3QFPA 1S97A 4N56A 2VOOA 2Y0SD 4KC5A 4GKKK 1IBLJ 1U1NA 4NYNA 4FN5A 2APOA 3HPGA 2BABA 2IAJB 1JB0C 4CJ7A 3KHRA 4GC6A 2Q6BA 4FCYA 1RBUA 3OVAA 1Q7YT 1ZC6A 2NPIA 4PQAA 1MLAA 3MPVA 1W9HA 2RN2A 2CXEA 4NZ7A 3UKRA 2BZ2A 1WSEA 5B0FA 1VK3A 5JVHL 4CEOA 2DIUA 2XRIA 2YI1A 1EETB 3OS2A 2YTCA 3QZ7A 2EBGA 3TZZA 1UEUA 2ZUAA 2ZM6J 3CDAA 4WYLA 1SC4B 4IFEA 1HHSA 1FDNA 3HSZA 4CM2A 1K73O 4H4KA 3I4PA 3IGVA 2V63A 1TV6A 1J27A 4R8UA 4DQ8A 1JQGA 1U04A 1T7PA 3RMCA 5C10A 5CR4A 1ZAVA 4DUYK 3TWZA 3HSTB 4OJ1A 4DV1K 1OSCA 4X66J 3FZHA 1EQ0A 3L4QA 1YK9A 1DKGD 2L3MA 3K7RA 3TTFA 4EO6A 3FRYA 3W5XA 2BJ3A 4WP3A 2B5JA 2MLXA 4ZVSB 1WC5A 3C66A 1VQ5S 4F9OA 2LEPA 3LP1B 1ZYQA 2A41A 1CS4A 3E01B 2ILYA 3UR3C 3PW2A 3E8OA 2XTJP 1NGEA 2MKHA 2FJAB 4KFBA 3CJ5A 1NB2A 1BQNB 3J7Z5 4ED1A 1PCAA 4I56A 4C3KA 5AQQA 4LIRA 1VQNN 2GS8A 2QLWA 1APSA 2YKNB 4USVA 5CYMB 3OL6A 2E1YA 3TTDA 1SUQB 2ZBCA 1HNVB 4F4YA 4ALZA 2RNEA 1FRXA 4YDXA 4DR4J 2R8HA 3V6DA 3BPSP 2ZEJA 1WWHA 1S59A 1U8WA 4YEAA 2B6AB 3W9HA 3FGVA 1PILA 3MDQA 4ES3A 5E3AA 5IV3A 3VQ5A 1ITGA 2D4WA 3PX6A 4OHVA 3IBCB 4NYOA 3CCQS 3CC7S 1LW0A 5DRKA 3QNOA 2IYGA 4H54A 3VVUA 5J2NB 3I0SB 3M32A 4J9RA 5DETA 4ZPAA 4LRAA 1U1OA 4YB7A 3HX9A 3SI6A 1YJNN 2EHGA 1RCHA 1HMVB 3K5OA 1MA9B 4NXNF 2V67A 2XMMA 2UVVA 1OVYA 5A6PA 1XHZA 1YZ7A 4CTAB 1Q8LA 2QKBA 1XMQF 1DFDA 4G1QA 4PEOA 5LMUJ 4XDDA 1RWMB 5IFMA 4H5WA 9RUBA 3PIPQ 4CO5A 3UR0A 3E66A 2EFVA 4TU7A 1T3NA 1TL3B 4CLFA 4FXWA 1FFSB 2GAGC 3G71N 1XNRJ 3ENQA 2P2CB 1FO1A 2YWKA 3MM6A 3AY0A 5GAEP 1VQPN 3O1LA 1T9VA 3BZKA 3M2RB 2HHUA 3BH7B 4B3RK 1S1WB 3BDEA 1S22A 3J7AP 4OYOA 3VOVA 1N33J 2FZCB 5ETTA 2YKPA 3BGUA 1RACB 1VQ4N 4ZVGA 2G2ZA 3EO3A 2P9LA 2XZDB 4ZMMA 2CYYA 4I2QB 2J9DE 5KFXA 2DXDA 1SS6A 2IPOB 3HHLA 3PY8A 4K4SA 3A3NB 1BUXA 4C48A 2W6KA 3DMJB 4AXIA 3T3FA 5AR0A 2HHPA 4X4OA 1O1WA 2ZM6F 4IDHA 1X4HA 3FRZA 2E20A 4NLVA 1J2VA 2CAJA 1NK4A 2ZNYA 2F9TA 5HAOA 4NASA 3J80O 2WBNA 4EAHD 1OMSA 3L4BC 3NGKA 1RBLA 2ZKTA 1JWWA 2Y8WA 2FY8A 4X66F 4ES2A 1QQOA 1BISA 1GEHA 2YQ3A 3EGZA 1HNIA 4B9NA 3CJ2A 4M1KA 3FJ2A 3WXLA 3FLCO 4KI6A 2G4BA 3HHDA 1HQUA 3NWGA 2DBBA 3UE2A 3Q8YA 4YHHK 1LOTB 1Q81T 3BGRA 4J9VA 4FW2A 4X4QA 1ZPWX 2VL1A 2R8JA 1FVSA 4ZP8A 1TK8A 4DV4J 1FXRA 4BRLA 3RMDA 1S10A 3FBFA 5AQKA 2IVNA 1W0HA 4FM2A 4ID8A 4OYZA 1HA1A 3N6MA 1RTHA 4WF9Q 1E6VB 1T9UA 2WVCA 4FWPA 5F41A 4TYBA 1GOAA 3JSBA 4ED2A 2XULA 3W3DA 2C2NA 2CFXA 1X0PA 4BRCA 3D5MA 4H0XB 4L73A 4LRBA 3AOAA 5BRDA 2NRRA 3DRPA 4Q8FA 1B3TA 3PW4A 3WXKA 2AU0A 5CHCB 4QCLA 5C24A 4HKQA 4EFAC 3HD1A 3ONQA 1DAXA 2FBTA 2YX4A 1NJXA 1RNHA 2XWXA 4CO0A 3U9DA 5L1IA 3GG1A 4LQ3A 3PHEA 3A8IA 1DY3A 1RBTA 4MDAA 2OAUA 3OR2A 3AODA 2Q43A 3D2FB 1VLOA 2B9EA 4FYXB 1CULB 2F8MA 2R7XA 1SQEA 4JKDA 1L5UA 1N4LA 2XS2A 4K59A 2CZ9A 5KFVA 2IY5B 1AROP 1RT7B 1JXBA 3JTOA 4U8VA 2GX9A 3CYMA 4M42A 4K4XA 1Z26A 1HD0A 2W2QP 3SQGA 1WACA 3TNVA 3M8WA 3KOAA 5LMUF 2F9JA 2YKAA 3SIPB 2RS2A 4FXVA 3DOKA 1FX4A 2RVJA 2BEFA 4GVBA 3DYAA 5KFTA 2BE9B 3TJ9A 2UXCF 1C0GA 2YQ0A 1XNRF 2VC1A 2VFRA 5FDLB 3MWBA 5F8HA 3RBZA 2CQ0A 1M5SA 4O3SA 1D3WA 2XY6A 4QOTA 1GMWD 3VQ8A 2GWKA 4UTGA 2EK6A 3D2EB 4KKOB 4LSLB 1HWKA 1M5PC 1HW9A 4ILHA 4HLBA 4X4UA 2AJ2A 1YI2N 3NNAA 3R7SB 1JLQB 3C65A 3PSFA 3BSAA 2HZVA 5A8KB 4MLHA 3BSCA 4ZPTR 3Q89A 2GEMA 1OS5A 1U0HA 1DT9A 5AE1A 4DU4A 4O4GA 5BRFA 3QJPA 3TTCA 2QK9A 1H2TZ 3T1YF 4DV7K 1RU1A 2DY4A 3CCZA 3VGLA 1U2VB 5AE2A 1RDWX 1NSQA 4AH9A 1LAVA 3M6XA 4EBDA 1Z05A 2K3KA 3NL0A 4DL4A 4ILGB 1VRTA 3C7NB 2ZC4A 1AUDA 2A6AA 5EX3A 4ZLLA 3MMAA 3D0IE 2IIRA 3AH6A 4KBIA 3AXKA 2ASLA 2XY5A 5B0DA 3AO4A 3DKDA 2A3JA 2MZSA 3D4JA 1HR0J 2YNGB 4WPAA 4OPHA 2ZOMA 2HZCA 2VV5A 4H4MA 1MWMA 5B8HA 4F4AA 1KKHA 1JLBA 3NS5A 5F8LA 5EU7A 3M2VA 1Q1KA 3MR6A 1BDGA 2IRXA 2C2RA 2KKHA 1S7IA 3PIOQ 3OLAA 2H48B 3GG4A 1Z4UA 1GXLA 1V4TA 4KSEB 2NS1B 4CJTA 4B3SK 4DV4F 4NMXA 4GVEA 4JAXA 3O6QA 2DNMA 2EG2A 1IWAA 4FJXA 5J1EB 4G3IA 3CD6N 4JI1F 2FVRA 3J8AA 4JI3K 1HBNB 2HVZA 4OIXA 3GG0A 4NZ6A 4AFFA 4IQXA 3Q23A 3ZSQA 3VV2B 2HWHA 3A0IX 2UXBJ 3W64A 4PCQA 1OH6A 1YXQA 3LALA 1KFDA 3MDFA 2D7SA 1QQMA 1VSKA 3MM9A 2VGMA 1TVRB 3EE8A 3J7YU 3MURP 4Y1DA 1V3ZA 4NLTA 5GADP 1RDRA 5CZVA 5KQ8A 3V4IB 4OI3A 1C4CA 1C1CB 4KYZA 4I67A 2HPUA 3R6LB 3CCTA 2C2KB 4PG7A 2E66A 1RI7A 2PA3A 2Z1IA 1FFWB 4DL0C 2OI2A 3VF0B 3QESA 1IN0A 2GQCA 4LBHA 4P6QA 2UP1A 3KLGB 2E1PA 4CJPA 4C8MA 4WFBQ 1QM9A 2OTLS 4EZ9A 2DNHA 2BKPA 4YNQA 1KLMA 3EN9A 4NB4A 3AA8A 4F67A 2NCKL 3IWLA 5HJYA 2OPRA 3LWMA 2ZZMA 1SI9A 4NLDA 3J7A1 4J5OA 3DRXA 1V5IB 3N01A 1IJEB 4ZPDA 3T5JA 4LF8J 1GLBG 5C42A 4FJ7A 4RNMA 2O8BA 1N48A 4K2XA 3WQTA 4F2RA 1R0AA 1UZDA 3AHPA 1E6YA 3GIJA 1WAJA 1D9AA 2PGCA 4JKHA 4IR9A 4GKJJ 2R7OA 1X8DA 4YMEA 1FE4A 3VQSA 5F2RA 1CJTA 4EU0A 4O4RA 4OX6A 2QV6A 3LW5C 3T19A 3SMPA 3NHGA 4MFBB 3CD0A 1VQ9S 3J80Y 2IRUA 3QNWB 3KHYA 3NDKA 2RIJA 3CJKB 3JQMA 4LF5K 1HNWF 3G87A 4BRKA 1MU2A 5C2FA 3LP3A 1GLLO 1RKIA 1FXDA 4NI2A 2IMOA 1UFLA 4J2EA 2MZTA 4ID1A 3QGHA 4KTWA 4F0KA 2KTQA 4OLOA 3OW2R 4JEPA 4V19J 5EN1A 3CO0P 3RAQA 2AX0A 4ZPBA 4EGLA 2FLOA 5KT4A 2VCPA 3EXCX 4BRHA 3D3BJ 1SH0A 2J8SA 4DR2K 1SC1B 3MZIA 2AYBA 5EX0A 3VGMA 5F8IA 3CCVS 2VFVA 1NK0A 2HGNA 4GY2B 1FNOA 3MXIA 3PYEA 1GX5A 3UKUA 2VBXA 2YH0A 1J9AA 3C6TA 3J7YI 2VIHA 1RT1A 4B1XB 4K4TA 4I6MA 3PM9A 1HBOB 4Y2AA 1FI4A 1IO2A 3BZQA 3D0PA 2CQ3A 5K8NA 5BXIA 3CCSN 1N8RO 2AEJA 2H3EB 3GSDA 4OHYA 2W4CA 3BGFA 3G8QA 2ZQBA 2AQ4A 1VQ7N 2KB2A 2O8DA 3PX4A 3NH1A 2WRMA 4LRDA 4KT0C 5E7OB 2FBYA 3HVAA 3SMZA 3W2VB 2COLA 1VHIA 3SJHA 3MWPA 4ETXA 4PWDA 2W7AA 3TA1A 4WKRA 4PG5A 1XBWA 4HH1A 4OYIA 4DPOA 3KK7A 4JK9A 1D8ZA 3G2XA 4ECQA 1H72C 3FSYA 3IAS9 2O8EB 2K8GA 1URRA 2MB0B 4JKEA 5KT6A 3SCXA 1Q79A 4ANDA 2DCUB 5CE3A 1KOOA 3MM7A 1TP7A 2MKCA 1ASUA 4DPTA 1RT6B 3H40A 2E2OA 4KRFA 4Y2MA 2A1SA 3OUYB 2AX1A 3T1HK 2HHXA 4C3MA 2KW4A 5A8RA 1PC5A 1KHWA 1S72S 3OYNA 1PBAA 3ULDA 2DGTA 2ZJPL 3Q24A 4TVAB 5KPZA 2LDYA 4L74A 2OCEA 1PYOB 3GOIA 1U2CA 2NYIA 3UVJB 3MR5A 1WC3A 5ADZA 4LF8F 4FDFA 3QNNA 2P5GA 1M5OC 4QWBA 4KGVB 3SBTA 1GMWA 1VRUB 4I0WA 4PG6A 3G82B 3DGPA 4CO2A 1Y3KA 2ILZA 1NPKA 3SDEA 4GKJF 1C1BA 3M1VA 2D5RA 3IAM9 3ZTQA 3AO3A 1MWYA 3F56A 2H3GX 1XNQK 3H4BA 2UZAA 2OPPB 1ACMB 1PC4A 2LXUA 2GO9A 3NVMA 3MCMA 4I6AA 1GH8A 2J7KA 5JLFA 4M5MA 4PWWA 3PYFA 4PPDA 1B4SA 1KBRA 4B1VA 4OI4A 1O6XA 2QMWA 4CO3A 1BWFO 5EX5A 2CPXA 1W2IA 1RGVA 2RHQB 1NJWA 2Q31A 2VWJA 3DXBA 3OYMA 4OI1A 1RDUA 2MGZB 2BRKA 3NMUA 2VFSA 4JUZA 3Q86A 3WX4A 3GWCA 4TY8A 4JK7A 2EFOA 1LW2B 2QYCA 5A6WA 2QM1A 2NZTA 4KH4A 1HNZK 3ZFVA 1FHTA 2X1AA 4B3OB 3LM2A 4CZGA 3AJ2A 3T41A 1NJIO 3VHQA 1VQ5N 1FEEA 2E5IA 4RO0A 3SBMA 4DUZJ 1T9XA 2Y3YA 3WNHA 3BEXA 3HFKA 2P51A 4JI8J 4Q45A 1S6PB 5HP1B 4DV0J 4HWIA 1RAOA 2B4OA 5AQSA 4Z7YA 5KPRA 3X3UA 2ZD1A 1T3OA 4QW9A 1M1KO 3K2YA 2BM1A 2CQ1A 3D67A 1FDDA 4PKGA 4ECSA 3RWUA 1MN7A 3KKSA 3NGUA 1NZAA 1X0FA 2XGPA 3IA0A 2IVYA 1B7YB 3V1QA 2D69A 4PY5A 2CNLB 4ED6A 4NYZA 4DCHA 3RSEA 3GV5B 4M3XA 1RKJA 1ATNA 1TL4A 3L7PA 2PYLA 3IAYA 4WFZA 3JB9k 4O0JA 5E3QA 2NZCA 1WTFA 2VOPA 3U1MA 3AFGA 4CEDA 3PG9A 3CC7N 3CCQN 2AP6A 1TYQB 2IC3A 1YJTA 4FJIA 1RADB 4CW7B 2PT0A 1BOTO 4BVOA 2EEYA 4RW8A 3L2VA 1IBMK 4P7TA 3PRVA 3CJ8A 2HHQA 5HMXA 2O8CB 3AO2A 2P9KA 2AV5A 2E7VA 3DXMB 3R3TA 3POTB 3EWGA 2C3MA 3AJDA 5BYQA 4OYBA 1GLJO 2F9DA 2KZMA 2WOMA 2B7CB 3VF4A 2P9EA 2O4IA 1NKCA 1IBKJ 4FOEA 4OVLA 3TAPA 4Z4CA 1C0UA 4C9DA 4USMA 1SAZA 2VG7B 3M9NB 4M63C 5JXSA 2QZ8A 3NF8A 2O8FA 2C2EA 2ETJA 5JMNA 2GJ2A 5ETLA 1FRJA 3HP6A 2IM3A 5HMYA 4QIEA 2DVIA 2F4VJ 2HNYB 1JLEB 4JYAK 3AVIA 2G1HA 3G96A 4GNIA 1Y97A 4UUXA 3V81B 4RBUA 1A6LA 5H9FK 3CMQA 1TR0A 3SQOP 3RB0A 3UQSA 2FB0A 4DR7J 1H98A 4WCEL 4M5IA 3UCZP 3U3YA 3RG6A 2DR6A 2RAQA 5F8JA 3ZZUA 4LF6J 1IR1A 5DM7L 3OL7A 2EX3A 1R8AA 7FD1A 3D6TB 4CZCA 1RJJA 3D45A 4CK2A 1H7WA 4HI2A 1HHQA 4ZCKA 1N34F 4B3MJ 3N9UC 2VGNA 1NOYA 2EW9A 2BA9A 2JOQA 1FF2A 4O0IA 2ERRA 2IDLA 1Q9XA 5DQIA 5LOQA 4CJRA 4X65K 3ET6A 3SEOA 3FBEA 2V4QA 3PLAA 5J2PB 5EWGA 3THWB 2CJAA 1QTMA 3HJFA 1Y00A 1HNXK 3QAUA 1VQMS 3ZX3A 2YBVA 4FPAA 5KFEA 3PR4A 1LXJA 1ESVA 3KTQA 2W2MP 2YNFB 1Y3JA 3HVWA 4M45A 4DSEA 1RDBA 2AGPA 3IS9A 4YR0A 4IDKB 2I5JB 1WHVA 3BP8A 4MK8A 4DSFA 4FF4A 3QT8A 3ISNC 1K1SA 2R3VA 3F2KA 4GVLA 5K14B 2HQIA 4DUZF 3MEDB 1Y9OA 3CJQA 1EWRA 1WF1A 3W66A 4ZJLA 3GJTB 1JK9B 1WEXA 2ZH9A 4CZKA 3N79A 1S4EA 4LFAF 4JI8F 3TZXA 1Z25A 4DV0F 2FC0A 1FFGB 3LDLA 4BE1A 2DGXA 5LSOA 3ISZA 4ZTFA 4QOZB 1K1QA 2L9NA 3C0BA 2G8UA 3CJBA 1AXQA 4NLQA 2ZOGA 1Q53A 4LF7J 3W9JA 1X4CA 3QLHA 4K5SA 3ZSZA 4H0YB 2HVDA 7FDRA 4PXDA 3H2LA 3HJVA 2L9DA 4U6PA 3KK2A 3J81O 5GIPA 3CPEA 1QQNA 2BJDA 4JD2A 4OHXA 4B17A 2FF3B 2BACA 5ETMA 4CDIA 1C6VA 3MECA 1TKXA 4JI7K 4DR3F 4EI2A 2C28A 1ZA2B 4Q44A 4C4WA 1SQFA 3TO8A 1JKHB 1M5VC 2E29A 3P8BB 3UDCA 1YRUA 3MFIA 2VWKA 2O1PA 3KG0A 2J7UA 2GGPA 3M4XA 1UWBB 2AJFE 2Z58B 5AXLA 5KT2A 4LFCK 5KFIA 4ECYA 2LDIA 1QD1A 3CE8A 3NNCA 1FKOB 2UU9F 2L9WA 1IBKF 4DU3A 3U6FA 4P2FA 3ZSXA 4U9RA 2ROGA 3CEDA 3BREA 3O80A 2W8KA 3I0RB 4WBFA 3M8SA 4JI4K 3ZT2A 3JTNA 4UZBA 1FJGJ 2BJ8A 1GLAG 1L3KA 5DMRA 3DLKA 3I96A 1NGCA 5T7LA 4ATNA 1I6JA 1S49A 3H3OB 2HHHF 1TL7B 5ADXH 2RF2B 5AXNA 3ULEA 3PFOA 4CJFA 1HYVA 2YKMA 4CQ1A 4DG1B 1RWPB 1CVJA 2HZAA 1T02A 4OHWA 1F0XA 2C3YA 4DR7F 3WEEB 3R2DJ 2W9AA 2PC6A 4HTLA 1F21A 3MPUB 1WKLA 4HT5A 3NE6A 4YN3B 4P9SA 3N6LA 4A5AA 1WNEA 3EMTA 3QMLA 4CYUA 4ZCIA 1QSLA 4DR1K 4RW9B 4ENOA 4B3MF 4WZQA 1QSSA 3SFGA 4OYWA 1J5EK 5HL7L 3EDRB 4ECVA 2PY5A 4KHPK 4DR5J 2IAJA 2I2YA 3VQEA 1MNEA 1R6YA 4DV6F 4Q8EA 2F8TA 5I9EB 2HQFA 1HQEA 3P4IA 1KHVA 1Q95G 3P83D 1YF5L 4A8XA 1OYDA 4ZVRB 1SIZA 1S5ZA 4DTXA 1G99A 3CCWA 1LWEA 2KI2A 2PN6A 3TWHA 4IOAQ 2IBKA 2CG8A 2BV3A 1D9FA 4DV5K 4QPXA 4DPXA 3HULA 3MUMP 3EM1A 3A8YA 3KLIA 2GQ2A 3HKWA 1KSPA 1NMNA 4LMZA 4E8UA 3AVFA 1UMJA 2B43A 1KD1T 3LL3A 4ZOSA 5DDPC 1PAEX 1X4GA 5CA5A 4WFAL 2UYTA 2VDHA 3VAIA 1DQAA 3G8SA 1RHMB 1JXLA 2F65A 3RRKA 4XEIA 4B1UB 5EHHA 2F9WA 3R97A 3QIPA 1TFWA 5BREA 1HI8A 4TYAA 1BQNA 3OTCA 3LZJA 3TX8A 5IQ6A 2CJQA 3S8SA 3IM8A 3PW7A 2H9ZA 1R6VA 4CJ5A 2BE2B 4NXMJ 4RWXA 3GR1A 3HF5A 1WUAA 2YKNA 2OTLN 1YIJN 1ZAWA 4FBTA 4BLGA 3GIIA 4ELUA 1Q8IA 1VQOS 3N4QA 2DK2A 2DHSA 1JMTA 3AARA 2MLZA 5HMWA 4B3TJ 1SZ2A 4FJ8A 2RT3A 3WT0A 4NCGA 4J2AA 4FWRA 4OZ3A 1H2VZ 1XQSC 2VDIA 1QAXA 3SJJA 1RLCL 1YAGA 5C25A 1FJGF 1HFEL 4DS4A 1RABB 2DR7A 1N56A 1QE1B 2LA6A 3A4TA 2HHSA 1UVKA 4HDGA 3H3NO 4OJGA 1IQTA 3O9RA 4LH4A 4D3HA 2BRLA 4MKBA 4OLAA 2EI5A 1CJVA 4RUCA 2R42A 1VQ9N 1RZMA 4CVNE 4UY8T 2X3GA 2H5IB 1BMQB 5KG5A 2RDIA 3IMQJ 5H9EK 2MLYA 2H1YA 2P9GA 2YY3A 1UVLA 3JTPA 4DJBA 4YOVA 2AYMA 4HACA 1OQ3A 2UUAJ 3C6AA 1R8CA 3MMBB 1TL3A 3DWLA 4ZPWR 1VR6A 3IR7B 5HOOA 1B92A 5IM0B 4OHZA 1NSKL 3M2RA 3ASMA 3WQUA 2K2PA 3AY9A 3C95A 2NQPA 1BUPA 4M7YA 1IKWB 4DV2K 3F9MA 2FZKB 4WQ5A 2FC8A 3UFCX 4C6AA 5FLXU 4DR5F 3ATVA 2N7YA 4I2QA 2JEGA 2FBVA 1UVNA 3GILA 2W4PA 1TUUA 4DV3F 4LFBF 1HI0P 1RTJB 3F41A 3PO4A 3UD5A 1V3SA 5HN0A 3DMJA 1LWCA 4H4OB 3CCVN 2VJVA 3C6UB 3NS6A 2JLGA 3O4QA 4CEAA 4ID5B 4ZIVA