4RW7A

Crystal structure of hiv-1 reverse transcriptase (k103n, y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
554
structure length
538
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
total genus 138
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw7A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw7A05
3CDWA 4ECXA 3O3FA 3V6DB 2BDPA 4EO8A 3N6MA 2OPPA 4DG1A 1B9DA 1JLAB 4MKBA 3SNNA 3TAMB 1HYSB 1NK9A 1S5JA 1BI4B 4CJWA 4G1QB 2UUTA 3NGIA 1SH2A 4CF8A 2HVIA 4ZVHA 4KTQA 4O44A 4MKAA 1FKOB 2IC3B 3ZT1A 3HP6A 1XWLA 1HYVA 4Z4FA 3V6DA 3MR5A 1WAJA 2QKBA 4ECWA 1Y97A 4U7CA 5KFLA 1VSEA 2R8HA 2I1RA 3ITHA 5J2QB 5KFTA 2FVRA 4B9VA 4CHPA 4CHNA 4NLOA 5F8HA 1UOCA 2HHVA 3JYTB 3H5XA 3OYLA 2RN2A 1QE1A 2O5DA 3AVIA 4RW4B 3MR6A 4CHQA 1SKRA 2IJNA 4NLQA 2DFEA 1RBVA 4FJKA 4KTZA 1B92A 4NCGA 3T1AA 3SYZA 4B9SA 3H5UA 2E4LA 1RTDA 3K5LA 4ED2A 3DMJA 3CJ3A 4F3TA 3CG7A 1WN7A 4RNFA 2J6TA 1CXQA 5HP1A 3BSOA 1QAJA 3LZJA 4B9MA 2GUIA 3G10A 1ZTTA 3UDLA 3DLEA 4FLVA 1S1XA 2G8HA 1TKTB 4IG3A 4N47A 1UAXA 3PX4A 4MFBB 1NK6A 4LY7A 3DOKB 3BSAA 4KSEB 2R8JA 1VRUA 3HKWA 4GC7A 4I2PA 2YV0X 3CFOA 3QESA 1C1CA 4ECRA 1R0AB 4FK2A 2V4RA 3NH0A 1WNSA 4PA1A 4IDKA 4IG0B 3KK3A 3ZT3A 3O3GA 4M3UA 3TANA 4NLGA 2IM2A 4F4XA 2HNYB 2XI2A 1LW0B 4CGGA 1IKVB 4J9SA 4O3PA 4I2PB 4LSNB 3CQ8A 4F4ZA 4ECVA 4IH6A 3RBDA 3ZCMA 4URGA 1SL0A 5HRPA 1SKSA 4M45A 2C2DA 1J9AA 1SKWA 4DEZA 4AH9A 4Q0BB 4FYDA 3KLEA 4H4OA 4TQRA 1BISA 2UVVA 3PO5A 4L8RB 2JGUA 3L2VA 1J5OA 4TYBA 3ZSRA 3GIJA 4MK7A 1HYSA 3L2QA 2FBVA 3PW5A 1JLCA 3KHRA 3BGRA 5KG1A 1Q9YA 3V1QA 1S4FA 4IBNA 3ZT4A 2E6MA 1S9GB 5I3UB 5DG7A 3NAEA 4DQRA 4KTWA 4EP4A 1JLGA 1IKXB 4FJXA 5L1JA 4ID5B 4FJIA 4QW8A 4Z0UA 3AVLA 5EWGA 3ULDA 3PW2A 1TKZB 1UA0A 1S9GA 3OYCA 4M3TA 4N41A 3G6YA 2D0BA 4B9LA 3V9XA 3HVTB 4IDKB 3LWMA 4DTJA 3DLBA 4WFXA 3NHGA 3HPHA 1HPZA 2R2UA 3C6UB 3KHLA 3T3FA 1EKEA 4CHZA 4MH8A 4Y2CA 2I5JB 1J53A 4O4RA 4DSEA 1ASWA 3K5OA 3KK2B 5DMRA 1LAVA 1U48A 1CZBA 4FM1A 3OS0A 3S3NA 2BE2B 3CVKA 5KFVA 3DYAB 3RMDA 3NAIA 3L2UA 4FJ8A 4WE1A 2PYLA 5HLFA 1K1SA 1RTJA 1TL1B 3HPOA 3SI8A 2IM3A 1NJXA 1L3TA 4FJJA 3K57A 4DL3A 2IS3A 1HNVB 4E7IA 4IG0A 3KK3B 2HWIA 3H5SA 2QK9A 5KG7A 3MXMA 1NNDA 1QSLA 3K2PA 3DM2B 1ZBFA 4JV0A 1T03A 4M3YA 1LW0A 1RDBA 3CJ2A 2G8UA 2XGQA 1NKEA 1RNHA 3H4BA 4KHWA 3MXIA 4W5QA 4O0IA 1C1BB 4B8CA 1Z4UA 1JX4A 4B8AB 2P5GA 2W9CB 3RR7A 5C42B 4CJ4A 3FFIA 4NRTA 3AO5A 4E1NA 1LWFA 4FJHA 4DQIA 5HRSA 1MMLA 2AX1A 3GIIA 4PQUA 4KRFA 1NK8A 4R0EA 1F21A 4YP3A 1JLQB 2D7SA 3LP1B 2IOCA 3DRSA 1MU2B 4ZPBA 1RDDA 4W5RA 4WFYA 4HVJA 1X1PA 3BR9A 2VA2A 4YFUA 4CJ5A 3TAMA 2OPPB 4LH5A 4Y2AA 2YNGA 1I6JA 5CYMB 4O4GA 1K6YA 3C94A 1REVA 3NE6A 1QQCA 4ZP6A 1C1AA 4FM2A 1XR5A 3LZIA 2OPRA 4N5SA 3VQDA 4CGHA 1L3SA 4KFBA 2HHXA 3AVJA 3H5YA 1S1UA 3AO4A 5I42A 3DOKA 1QSSA 3DLKB 1IM4A 4DQPA 3LP2B 3VN5A 1VSFA 2BQ3A 1NOZA 3O3HA 4WYWA 1KTQA 4MQ3A 1Z26A 3MEEA 4CEOA 4CEEA 4QWAA 4K4XA 4BACA 3V6HA 3AA2A 3SCXA 1UWBB 4DTOA 2VWKA 2HB5A 4F2RA 4BDZA 3DI6A 4CFCA 3HVRA 2UVWA 4OPJA 5C42A 4HKQA 3RB6A 1C0MA 4BE0A 1FXXA 5KGXA 2XY8A 4OJRA 5DGBA 4ED7A 4CGIA 1ZETA 3LP0B 3KLFA 3WNHA 1RYRA 2D41A 3SZ2A 3N6LA 5KFDA 3ITHB 5J2QA 5EDWA 4TN2A 5KFXA 4DTNA 3F9KA 1REVB 3OLBA 5KFRA 5F8MA 4OPKA 3NF6A 2QE5A 2OA8A 4WFZA 1BQNA 3OL9A 4RW7A 4FJ5A 4J2AA 2EHGA 3CJ0A 5EWFA 3GQCA 4KO0A 2IA6A 3HT3A 3ASMA 3MAQA 3VQ6A 1S48A 5F9NA 1C0UB 2GBZA 1HYZA 3OS2A 1JLFB 1BIZA 1I39A 3LDSA 4B9TA 3I0SB 3VA0A 3M8QA 1JLAA 4JUZA 4O3OA 2FLPA 4K8XA 3MR2A 3LAKA 3DMJB 4YQWA 3VQAA 4AHCA 4CEQA 1BQMA 1LW2B 4CEZA 4RNOA 4AHTA 4KPYA 3K5NA 4IFYA 3HVTA 2OPQB 1RBSA 3MXJA 4J9MA 3P83D 3NH1A 4NCAA 4O4GB 3GILA 1RTHB 4I9LA 5KFSA 3Q8SB 1JLCB 3AO1A 3EZUA 1N5YA 1ZBUA 2OPSB 3V9WA 2F8EX 3QNNA 4GC6A 4FK4A 1TL3B 4EO6A 3C6TA 1VK0A 3H40A 1RT5B 4ID1A 3OYEA 2HAIA 4W5OA 2AWZA 1S0OA 3V4IA 3D5MA 3IS9B 4K4WA 1EP4B 3MEDB 3V9SA 4WXWA 4BDYA 4IFVA 3VQCA 3MFHA 1UWBA 3I0SA 4EYIB 2E6LA 1JL2A 1KVCA 4DU1A 4FJGA 1RA7A 4CFAA 3ZSQA 1HPZB 3BDPA 2ILZA 4DF4A 3AO3A 5KRSA 1HNIB 3SFUA 1RYSA 3P1GA 1EX4A 4RUAA 4MIAA 1QE1B 5KT6A 2ZQBA 3P5JA 3OYFA 1TK8A 3I5BA 1VSLA 3KLFB 5DK5A 3KJVB 3G86A 3WNGA 4MK9A 1QTMA 2O4IA 1ASVA 2IGIA 5KTQA 3DLHA 3NBPA 1N6QA 2YNFB 3QLHB 5F8LA 3IGNA 3L3VA 1SV5B 3NMAA 4O44B 2ALZA 1N48A 5J2PB 4FLTA 2HHUA 1CLQA 1N4LA 4BWJA 3V6KA 4XO0A 2FLLA 5KFKA 2W7PA 1TKTA 4PWDB 1JKHB 4IKFA 2KFZA 2D3UA 1GX6A 2IMWP 3OS1A 4PUOB 1NK5A 1D0EA 3AO2A 5KFEA 4K4TA 3KNAA 4G3IA 1XHXA 2HNZA 3AVNA 3S3OA 3C6UA 2HNDA 1W9HA 2W9CA 3OHAA 4FS1A 5FDLB 4RNHA 4ECTA 3I0RA 4QCLA 5F8GA 4QWDA 4TLRA 3ALYA 1WNEA 3RRHA 5C24B 4F4KA 5L9XA 5JUMA 4QOZB 4DSLA 1KLNA 4IH5A 1NKBA 4ZP8A 2OPQA 4RNMA 3NF8A 4FZZA 2BE2A 5KFCA 4CIFA 3N6NA 3PY8A 3GV8B 2PY5A 4ED8A 2HHQA 4AHUA 4YR0A 2KZMA 3NAHA 3RWUA 3IG1B 2ILYA 2VG7B 1WSJA 5J1EA 1L3VA 1VRTA 4CJLA 4I2QB 4TSXA 2W8LA 2GC8A 1N56A 3DLGA 3L8BA 3QEIA 3OYJA 4CJQA 2AU0A 2ZKUA 4DWIA 3QIDA 4E3SA 3QEVA 1NOYA 4HYKA 1XR7A 2XY6A 2YKNA 1T05B 2IJFA 4RU9A 3TAEA 4KREA 3EZ5A 2RKIA 3KMSA 4EEYA 1L5UA 4CJUA 4UQGA 3M8SA 3EPGA 3A2FA 4CHYA 1S1TA 3LP2A 1KFSA 4LSNA 3VQ5A 3GV7B 4H8KA 3HO1A 5CYMA 1RT7A 1S6QB 5DLFA 2JEFA 2ETJA 3I0RB 3TAPA 3LAMA 4Y1DA 3TAGA 3DRPB 2YKMB 3NDKA 4CJKA 1U49A 2IAJB 1XI1A 4O3NA 3QEXA 2W9AA 1XC9A 4C8LA 3SUNA 3QEWA 4PY5A 2F8TA 2AGOA 2UVUA 4O0JA 3EPIA 2Y1JA 1NK0A 4DL5A 2IDOA 2B5JB 4DSFA 4CF2A 4Q8EA 4NLUA 4KKOB 4GVMA 4ZP9A 3TQ1A 3BSNA 2J6SA 1RDCA 2ITGA 4HCBA 3OL8A 3VQ4A 3B6PA 3CO9A 3RRGA 1TL3A 3V1RA 3EY1A 4KHNA 4Z4GA 3QIPB 4KI6A 3SUQA 1RT1A 1S1WA 3RB4A 2CKWA 3QO9B 3UPFA 3KOAA 4E19A 4QAGA 5KT3A 2ZE2B 3LP0A 2RKIB 1U47A 1X9WA 2R2RA 4K4VA 2JC0A 3SFGA 5F8JA 1LW2A 3T5KA 1QUVA 1WSGA 4LH4A 1IKXA 3K5MA 4FS2A 4M94A 1U45A 3VQ9A 3OYBA 4Y1CA 2XO7A 4TY9A 2ZD1B 1LAWA 2WHOA 3DRRA 2EX3A 2VG7A 2OZSA 1YVUA 3RMAA 2ASLA 4C8OA 1TKXB 4AHRA 4DS5A 3B6OA 1RT3B 4CGJA 1RT6B 3KIOA 4W5TA 1TQLA 3LALA 4CK3A 4QWEA 1IO2A 4E7HA 2JLEA 4IRCA 1D5AA 4CEBA 3V4IB 3AVAA 4O3SA 3AVGA 2HHTA 1GOCA 3OJUA 1RT2B 3NBPB 1N6QB 2XY7A 1JXLA 1NKCA 1BHLA 1JLBB 1SUQA 2FVSA 2VG6A 4GW6A 5D3GB 4JV2A 1YT3A 4NLTA 1W25A 3PX6A 4AHVA 4DQSA 4OKKA 4RW9B 5FROA 4YR3A 5KFWA 1WAFA 3AA4A 3ZSWA 4WE1B 2ZE2A 4FLWA 5CYQB 1VSDA 2XCPA 3FSIA 4OKEA 3OYKA 3VQ8A 1RT1B 2LSNA 5DQHA 5HLFB 1EETA 2GIQA 4OVLA 1S6PA 2WOMB 1KRPA 3GV5B 2G8IA 4EBDA 4J2EA 2OZMA 4CJ3A 3NL0A 1RT6A 3KLGB 4TY8A 4URSA 4KHUA 2VG5A 3KLHB 5E41A 5DQGA 4M3XA 2Z1GA 1WLJA 4OL8A 4JRPA 3KKRA 3PV8A 2W9BB 1S49A 3PZPA 3ICLA 3QZ7A 2XHBA 4IFYB 2XC9A 4ZTJA 3KD5E 5KG4A 1IKYA 3PW0A 3CJ5A 4CJPA 4NCBA 2W8KA 1KCFA 2WRMA 3TAFA 1MU2A 2FLNA 4MFBA 2HWHA 2KTQA 4CEAA 3LP1A 2QV6A 1HQEB 3TR8A 3DLEB 2HNDB 2B43A 3FQKA 4K4YA 4DSKA 3AVBA 3DI6B 2WCXA 4Q0BA 3ZT2A 3ISNC 4IRDA 2D5RA 4DTSA 4FJ7A 2AX0A 5C25A 2YNFA 3Q8RB 4CEFA 1HQEA 4JV1A 4TXSA 2Q3SA 5EU7A 3CWJA 2F8SA 3OYGA 3BQ1A 5JS1A 1TK0A 1S1UB 3VQBA 5KFUA 4DLGA 4KI4A 4DF8A 4R8UB 2HNYA 1FKPA 1HRHA 4NLWA 3EYZA 3V81A 2ATQA 4Y34A 3CFPA 4AILC 1A5WA 1T8EA 5KFFA 4HUEA 1HNVA 3KTQA 3LANA 5HBMB 3VQSA 1KSPA 4H54A 4NYFA 4CF0A 3L3UA 3DOLA 2YNIA 4NZ0A 1BL3A 4DU3A 1S9EA 4RW8A 4Z4CA 3TI0A 4OGCA 5HRRA 4Z4EA 1WSHA 2QXFA 1KLMA 3CFRA 2KFNA 3ZSVA 4DG1B 1HQUA 2WONB 1RAJA 3VA3A 4M42A 2RDIA 4RNNA 4ZHRB 3MECA 1RBTA 2WB4A 1TV6A 4DTPA 4F8RA 1DTQB 3PJXA 4IR1A 4I7FB 3RR8A 4LSLB 3IGVA 1OS5A 4J9PA 4IQXA 2B4JA 1YVFA 4KO0B 2Z1HA 4K8ZA 4R5PA 5C5JA 3DM2A 3OSPA 4ZP7A 4TQSA 1TKZA 3OY9A 1N5YB 4K4UA 3KHGA 4RG8A 1QS4A 1RDAA 1ZTWA 4CESA 3U3YA 4EBCA 1NHUA 5K14A 3SQ2A 3OL7A 2FJVA 3Q8PB 3V81B 4DTUA 3DDKA 3MTKA 4Q45A 1RA6A 1ZYQA 4YNQA 3T19A 3BSCA 3NFAA 2BANB 3RMBA 4JLHA 1I3AA 2FVQA 3IAYA 1LWCB 2E9RX 5KGWA 5T14A 1VSIA 5KFIA 1TP7A 1BI4A 1QSYA 4CHOA 3MR3A 3O4QA 3QGHA 4FZYA 3FDSA 3V9ZA 3TABA 1EXQA 3PO4A 1HQUB 2YNIB 3CIZA 4DL6A 5CZ1A 5F8NA 3E01A 3ZSXA 2ATLA 3D28A 5EUHA 4RUCA 3FRZA 4ED0A 2OPSA 4C8MA 1SL2A 3PR5B 3F73A 4DLEA 1CSJA 1SV5A 3OYNA 2AGQA 1TVRA 3L2WA 4IKAA 5KT2A 3AA3A 3QNOA 4OKJA 5KI6A 1T7PA 4ZPDA 1X9SA 1CZ9A 4WXOA 1J54A 4RW6A 1S1WB 4I7FA 1FKPB 2YHAA 4F50A 1BCMA 5K14B 2E9ZA 3SUPA 2HHWA 2Z1IA 4GMJB 4Q5VA 5J2NB 3QZ8A 1JLGB 3KK2A 4ED3A 3G6VA 4O3RA 4WZQA 3AVCA 4KB7A 5F9LA 4DMNA 4N76A 2X78A 3OVNA 3KLHA 3SV4A 1RTIB 4DFMA 4PUOA 4KBIA 1JLQA 2X6NA 3SQ0A 4W5NA 4IRKA 3NKYA 4DL7A 4BWMA 2GIRA 5DGAA 1ZBIA 3PHEA 3DRRB 1J5OB 3KK1A 4NYZA 3HL8A 3AVHA 4CIEA 3O4NA 1DLOA 4NLPA 4FJMA 3QIOA 4ZMMA 4IR9A 5KFNA 3HYFA 2DPJA 3SI6A 1IG9A 4KFBB 4ECUA 1KHVA 4O3QA 1L3UA 5CYQA 5KFJA 3OYIA 3CYMA 1S0NA 3HP9A 4ICLB 3JYTA 2FBTA 2R7YA 1IKWA 3BQ2A 1GOBA 1QHTA 1TVRB 4RW7B 5KG0A 2FC0A 1TAUA 2VG6B 4LQ3A 2DFHA 1U04A 4C8KA 4E0DA 5D3GA 3M9NB 4ID5A 4CERA 4HTUA 1D1UA 1G15A 4F2SA 2NUBA 4J9RA 3OSNA 1JLBA 1SUQB 3SJJA 3JSMB 2HMIA 2EC0A 1S0MA 4CJSA 5KFGA 2DTUA 2YNHB 5FRNA 4FZXC 3HK2A 4KHSA 1HARA 3OYAA 4IH7A 1UA1A 3NGDA 2DY4A 1RILA 1C0UA 4E7JA 4EYHB 3KKSA 3RB3A 3M8PA 4I2QA 3FFIB 2AGPA 4FLYA 3OHBA 2YKMA 3RMCA 1HMVB 4OLAA 4E7LA 4KHQA 2IAJA 4FVMA 5KFHA 3UQSA 1TL1A 1IKWB 2VG5B 2W42A 3CJ4A 3HHKA 3ZSZA 1RCHA 4HCCA 2G8WA 4FJ9A 4ECYA 3SQ1A 4ED6A 3VQEA 3VQ7A 3PUFA 2BQUA 4KHMA 2W9BA 4H4OB 5DQIA 1RT4A 4CFBA 3M8QB 4JS5A 5CZ2A 4ECSA 4ZPCA 1U09A 5HROB 1SH0A 3JSMA 2HMIB 3CDUA 4J9NA 2KQ2A 3OLAA 2C28A 2F96A 4X2BA 3RAXA 1S10A 4DFPA 1EP4A 3MEDA 1RBUA 4XIUA 1NHVA 4LQ9A 4RW8B 4BDPA 1CXUA 4FM0A 4ELVA 1VRTB 4I9QA 4YMEA 3H98A 3VQPA 3SPZA 4QPXA 3HXMA 3MF5A 4IOBA 4AHSA 4FXDA 3DRPA 4KAIA 5DLGA 2X74A 3ZT0A 3KJVA 1RBRA 2A1RA 1RT5A 4FW1A 4FJLA 5EWEA 4FJNA 3NF9A 4B08A 4ICLA 4Q43A 3D0PA 2XWYA 1D8YA 1T94A 4DS4A 1TV6B 1Q9XA 4KKOA 5KFZA 2J6UA 5L1LA 3GIKA 1DTQA 4M3WA 2FVCA 1JKHA 1TKXA 2I5JA 1R0AA 5KG3A 5KT4A 2XGPA 4DU4A 5KFBA 4BE1A 1WSIA 2FBYA 3IRXB 3RBEA 3KK1B 3NGYA 2V9WA 2R2TA 2WTFA 3MEEB 5KFYA 3ZSYA 1S9EB 3UIQA 5F8IA 3DLKA 2XI3A 1DTTA 3PJWA 4PQUB 2HVHA 1LWCA 3HVAA 4DTMA 3K58A 2X6SA 2P51A 3ZSOA 2FJWA 2IM1A 2ZD1A 5J2NA 1KLMB 2KW4A 4DFKA 3SPYA 3IN5A 4F4YA 1LWEA 1JL1A 1X9MA 3V9UA 4DSJA 4DQQA 4B9UA 1GOAA 3PVXA 4HUFA 2E9TA 4R5PB 4WYLA 4CJRA 4N56A 4MIBA 2B6AB 5FRMA 4FCYA 2FBXA 3PW4A 4NRUA 4FBUA 1VRUB 3OL6A 4LSLA 3LPTA 4H4MB 4M41A 1NK7A 2RF2A 2JEJA 2QKKA 3KLGA 3PR4A 1JLEA 5KG2A 3QIPA 2Z1JA 5HROA 3V6JA 1RT2A 3S3MA 5KT5A 4F4WA 3RB0A 1VSKA 3KLIB 1WSFA 5I3UA 1RT4B 2R8IA 2YKNB 5KG6A 1ZBHA 1FKOA 2IC3A 1FK9A 2AJQA 2BANA 4URQU 4FK0A 4DTRA 3T5JA 1JLFA 3I5AA 1YTUA 4KV8B 5CY4A 4U6PA 2ASDA 2UUWA 4QWCA 1LV5A 1T3NA 3OYMA 2BQRA 1GX5A 1RTIA 3M9OB 3K59A 2Y1IA 4RW9A 1NK4A 3E51A 4ECQA 2PZSA 4CEDA 4CJTA 4WZMA 1QAIA 1ASUA 1IKYB 4Z4HA 1S9FA 3AV9A 3BQ0A 3THVA 4HHTA 5T7BA 3I5CA 4CK1A 4Q8FA 2XCAA 1ITGA 1IH7A 3I8DA 1O1WA 3DYAA 5HRNA 2B6AA 1IKVA 5L1IA 4J9KA 4CF9A 3GIMA 3DRSB 4CGFA 4KAZA 3RAQA 4J2BA 2YHBA 3IRXA 2BRLA 4J2DA 4J9LA 1XHZA 1W0HA 3PW7A 2DPIA 4Z4IA 1T05A 1SL1A 1VSHA 2PYJA 3SUOA 2OYQA 3KLEB 2GV9A 4NLYA 4E89A 1JLEB 4IFVB 4TYAA 4CJVA 2D0CA 3AVMA 3SQ4A 2RPIA 4FLZA 3L2RA 3QERA 4CGDA 4RW4A 2IBKA 3VQQA 4R8UA 4NLRA 4QWBA 1S97A 1EETB 3ISND 4ZPAA 1C0TA 3T5LA 2JC1A 5DG8A 4CECA 4HUGA 3H2LA 4Q44A 4M95A 3HSTB 1LWEB 4CJFA 4XPCA 4DL2A 3AA5X 2BRKA 1YTAA 3H4DA 3AVFA 2G8VA 1JIHA 2IM0A 3FQLA 5KFPA 2YNGB 1Q8IA 1RTJB 2A1SA 4K4SA 1K1QA 1RT3A 3LPUA 5JXSA 1FK9B 1S1VB 1XR6A 1C1CB 4ZHRA 3G0ZA 2V0NA 3IS9A 3NH2A 2FVPA 5KFMA 4E7KA 1S6PB 4J9OA 2BGGA 4EZ9A 4NLDA 2OPRB 4NYNA 3DLRA 4NCGB 4FW2A 5HP1B 4CCHA 1BGXT 5I42B 3MFIA 1RTHA 1TGOA 1Z25A 4ELUA 4ZTFA 1U4BA 2HW3A 1RDRA 3KMQA 5J2MB 1SH3A 4KHRA 1VSJA 1HNIA 3NF7A 3HJFA 5KFAA 3D45A 2OH2A 4M3ZA 1BIUA 4ZVGA 1TK5A 3TARA 3GYNA 4C8NA 3QGGA 2P5OA 5C24A 1DTTB 1BQMB 3QETA 3TVKA 3NCIA 4F3OA 4KHYA 1D9FA 4B3OA 4KV8A 3E01B 1DLOB 2HHSA 4PWDA 2YNHA 2JEIA 5JS2A 4J9QA 1LWFB 2C2RA 2WOMA 3IG1A 1A5XA 5J1EB 1RTDB 4EBEA 4ECZA 4FBTA 2ASJA 1BCOA 3OJSA 5KFQA 1KHWA 2WK4A 4EZ6A 2KZZA 2BR0A 4FLXA 5SWMA 2AQ4A 4YR2A 4MK8A 4NLXA 3RTVA 3HVWA 2XRIA 3HM9A 3M9MB 4Y3CA 2VWJA 3G6XA 1C6VA 3MEGB 1JXBA 2W7OA 4OGEA 1NJWA 4DFJA 3C95A 5J2MA 2DFFA 1ZBLA 4CK2A 4M3RA 4RZRA 2P1JA 4BE2A 5KRTA 4ED1A 3LWLA 4DL4A 1S1VA 1WSEA 4JRQA 4TY8B 3BGRB 2D0AA 1VSMA 3CM5A 4ZVEA 1C2PA 3HPGA 3QINA 3T5HA 4KE5A 3CM6A 5KT7A 1TAQA 4KB1A 2R2SA 2RDJA 3M8RA 2XY5A 3DLGB 1BQNB 2WONA 3CDEA 4CJEA 3LP3A 2G8KA 4RW6B 2V4QA 3OYHA 3BREA 2RF2B 1A5VA 4K50A 3TAQA 1NJZA 2JEGA 1C1BA 3WNEA 4CF1A 2CJQA 4KB0A 2G8FA 4B9NA 2VA3A 1KVBA 3U3GA 1RT7B 4CIGA 2R8KA 4DSIA 1T03B 1S6QA 4DTXA 3QEPA 4E1MA 5DG9A 4OLBA 3H59A 3H08A 2D3ZA 1TKDA 4JS4A 3NGZA 5KFOA 4CFDA 4ZVFA 1KVAA 4B3OB 3KHHA 4NLSA 4QW9A 5L1KA 4G1QA 1S1XB 2C22A 3WNFA 4IG3B 1B9FA 3AVKA 5C25B 3V1OA 3QYYA 3Q8QB 1KFDA 4H4MA 2B5JA 4LD0A 3C6TB 3QLHA 2C2EA 5SZTA 4K4ZA 3BJYA 3KLIA 3QGIA 4FLUA 5HBMA 3S9HA 1S1TB 4ELTA 1NJYA 3DOLB 3KD1E 2FJXA 5J2PA 3MEGA 3KLVA 3TWHA 2UVRA 4CE9A 1HJRA 4NLVA 3PX0A 4EP5A 3U6FA 3SV3A 3QO9A 5KG5A 2O4GA 3UR0A 1JXEA 5FDLA 4O55A 1D9DA 1HMVA 2R8GA 4O5BA 3MECB 1C0TB 3M8PB 4XPEA 3OYDA 2HNZB
chains in the Genus database with same CATH superfamily
4ECXA 2BDPA 3JAMO 1R89A 2V94A 3R2CJ 3O8MA 2KB2A 5D0HA 4R25A 1NK9A 2FHOB 1S5JA 2Z4PA 1BI4B 1SJFA 1PAEX 2W40A 1S99A 1XNRK 1YQHA 4O44A 2D3OR 1E6YA 1M5PC 1JMTA 1HYVA 4JKGB 2RDDA 1WAJA 1Q5VA 3A8IA 1V9OA 2QKBA 4ECWA 2ACYA 3IR5B 2B51A 1NGFA 5KFTA 1Y4ZB 4N77A 2VU5A 5K5MA 2RB7A 3NLCA 2ZH4A 2I2YA 4BY9C 2HHVA 1K0VA 3JYTB 3H5XA 3ILLA 3QATA 5FPMA 1KQKA 3ETMA 2OJ3A 2IJNA 4YOTA 2FHJA 4KTZA 3RJMB 3T1AA 3MHYA 3G4SN 3EKUA 3JTOA 2E4LA 3DMJA 1NHKL 3R7BB 3CJ3A 3F2KA 3THXA 1HNXJ 1BMQB 4WCEL 3BSOA 4V1Ak 3AOCA 3LZJA 4B9MA 2GUIA 3G10A 2DGQA 3MWTA 1ZTTA 2J5AA 3VEVA 2HBMA 1RHKB 3B78A 3R7SB 4OO1J 4ZN1A 5GADP 1H7WA 2HLTA 4GC7A 3HKWA 3CFOA 2DO0A 1C1CA 4ECRA 2MQNA 3WX8A 2V4RA 3NH0A 4FXVA 3NP5A 4C7QA 1VQ5S 2ERRA 2KKHA 3KK3A 3ZT3A 3LQVA 3HDSA 3TWZA 4CGGA 1UPMB 1LW0B 2QA2A 1XMOF 3H3NO 4O3PA 3CQ8A 4UW2A 4A2AA 1VK3A 2I6WA 4OYAA 1WEYA 2F63A 2VFTA 1UVKA 4WFAQ 4URGA 3F5TA 1VOMA 3R1XA 3OPKA 4L74A 4M5HA 1SKSA 1OYDA 4FF2A 4HHJA 4FYDA 4DR7K 4YY3K 2MKIA 2UVVA 3L2VA 5AQLA 4CNZA 2HZAA 3BB5A 1JQGA 3L2QA 4IO9Q 5TKWA 5KG1A 3CJ7A 4IBNA 1OY8A 2MKKA 3ZT4A 1S79A 2R7WA 1HR0J 2RE1A 2D69A 1Q1KA 4ID5B 4FOEA 4Z0UA 1B7FA 3UE2A 1HWIA 1RAAB 2VQFJ 1UA0A 2ZH3A 1GLAG 5EHHA 2D0BA 1UVMA 4DTJA 5U47A 4WFXA 3HPHA 4O8UA 1HPZA 3C6UB 1GTHA 2CDRB 1K8AO 3KHLA 3TZXA 1FJGF 2I5JB 4BRKA 3W1YC 3ZEUA 4QQBA 4DSEA 3M1VA 2DNZA 2H51B 2YX4A 2IFXA 2EK6A 3TYTA 1CJTA 2M8DB 5GADU 5BR8J 1CZBA 4FM1A 4JI4J 3OS0A 2JVOA 3SEOA 3S3NA 5KFVA 3DYAB 2J0WA 4HTIA 2O3DA 1SS6A 2F9JA 1Q8BA 2RQ4A 5SUHA 4WE1A 2LDIA 2ZJRL 1VQ4N 1WHYA 4GVLA 1NU0A 5HLFA 4LFAJ 3MCPA 1RTJA 3HPOA 1NJXA 4FJJA 3TU5A 3OR2B 1NEEA 4DL3A 4E7IA 3KK3B 2GTDA 4BLGA 2QK9A 3SCIE 3K2PA 1ZBFA 2RQMA 1IWAA 1LW0A 3CJ2A 4YOVA 2NXUA 3UN5A 3H4BA 1RNHA 4KHWA 5M2UA 4MYUA 2O8FA 4Y00A 1Q81O 1C1BB 2LMIA 3SMSA 2P5GA 4DV7J 3DJCA 4NRTA 2HVZA 1PKUA 3AO5A 4E1NA 1LWFA 1T3OA 3M6XA 3PDNA 1U24A 2W24A 1MMLA 2AX1A 4YHHK 1MWYA 4P2SA 1Y5NB 4FKXA 2P9KB 2IDLA 2UXCF 4C0HA 1HX1A 1SC4B 4EFHA 1IQZA 1RDDA 4WFYA 3DU5A 4CJ5A 4TKTA 4Y2AA 1I6JA 3UCUP 1X4CA 4O4GA 5ETTA 1K6YA 1RBLA 2VFSA 4EGLA 3C94A 3NE6A 1F5BA 1ZBTA 2PI5A 4FM2A 4X4NA 4U7UK 2ZBCA 3UDEA 3W8PA 4HH1A 5AQGA 1CC8A 4KFBA 3AVJA 3H5YA 5M1QA 5I42A 3DOKA 3UR3C 3W60A 3CCQS 1IM4A 2FC8A 2DGVA 3LP2B 1UL3A 2MQLA 1OJ4A 1NOZA 3O3HA 4WYWA 1KTQA 1Z26A 3OW2R 4CEOA 1YUWA 4QWAA 4BACA 3V6HA 5AFUH 5HK4A 2Z2MA 3SCXA 4ZVRB 2VWKA 2HB5A 2MKYA 3TVYA 1S57A 3DI6A 5A6PA 2Y1LB 3VAMA 3HVRA 3L0QA 4JI7K 4RWXA 1LWXA 1UKUA 4DUYF 1WJ9A 3C66A 2DIVA 1SKUB 2Q1LA 3KUGA 4A8MP 5KGXA 1B0VA 1WACA 4ED7A 3CDAA 4CGIA 2XNRA 3VVTA 4JKDA 1GXUA 2AA4A 2D41A 3D7SB 1MLAA 3ENQA 3OR2A 5GAEI 4TN2A 4WYBA 4HLBA 1FWLA 3SQGB 1KTVA 1ZZFA 3N79A 5CAAA 5KFRA 4LF7J 6FDRA 2QE5A 5LJWA 1MNEA 2OA8A 3OL9A 4I68A 1PGZA 4ZVSB 1NDLA 4FJ5A 5E3RA 3CJ0A 1S76D 5M1NA 3KWGA 1LK7A 2AJ1A 3R6GB 3J7ZT 3MAQA 3ASMA 1FKAF 1YHQS 2E2PA 2FHKA 2G1HA 4JI8K 1ZM9A 3L09A 2GBZA 2AKWB 3AJDA 1YF5L 1BIZA 4OYMA 1N36F 3VA0A 4GKKJ 3M8QA 3VWSA 1JLAA 4O3OA 3Q24A 1N52B 3BF1A 2BKNA 4AHCA 9ATCB 5HOOA 4CEQA 1NAQA 1BQMA 2J9DA 1LW2B 3QBWA 3UN3A 4IFYA 2OPQB 3NGRA 3W9HA 4J9MA 3CJQA 2KYXA 3O9UA 5IC6B 4NO7A 3GB0A 4XEIA 1N5YA 1ZBUA 2OPSB 3V9WA 2GJFA 4CI6A 4K2XA 4GC6A 4CDIA 4BC3A 1RHJB 2FQQB 4IEIA 3C6TA 1P9YA 1VK0A 4EIAA 2VBZA 2P9GA 4W5OA 4YDDB 1S0OA 3D5MA 4LF5J 3MPWA 1EIYB 4BDYA 4IFVA 3VQCA 5LT5A 3MR7A 3I0SA 4FJGA 1SPBP 1NO8A 3AD9C 3IKMA 1H2VZ 2V52B 2P9IB 4PG4A 4FN5A 1IBMJ 4OI2A 2CYYA 3RSEA 3AO3A 1URRA 1QE1B 2ZQBA 1I3OB 4ZCIA 1TK8A 5BJRA 2VICA 4QU6A 2YKQA 1UVJA 2W7AA 4I6MB 2CNOB 1YG0A 3CD7A 4LMZA 3WNGA 1QTMA 2O4IA 1IM6A 3G82B 1NPKA 1X4EA 1NH8A 2IGIA 5KTQA 1RE1B 2YNFB 2QI2A 1I5OB 1JNZB 1GNKA 1SV5B 3TA0A 3OT9A 5DDRC 5J2PB 3MUVP 2FLLA 1BUXA 2W7PA 2KFZA 2IMWP 3OS1A 3PSIA 4B1VA 4PUOB 2B4UA 1AB8A 1RTZA 1NK5A 5KFEA 3BGUA 4CQ1A 3CJTA 4G3IA 1VJQA 1XHXA 1VQMS 3S3OA 2HKEA 2HNDA 4KQZA 1M90O 4RNHA 4QCLA 5F8GA 4QWDA 3FJ2A 3ALYA 3HD2A 3M2RA 4F4KA 3BY5A 5JUMA 4QOZB 4BRGA 2YPZA 1KLNA 4IH5A 4H5RA 2DBBA 2BE2A 4FF3A 3N6NA 2DB1A 2F4VF 1WF2A 9RUBA 5KPRA 3O6QA 4AHUA 3ID6A 2O8BA 3GDQA 3NAHA 4X64F 2GQQA 1VRTA 1E6YB 4AXIA 5B0EA 3S1TA 4GY2B 2YJEA 1PAUB 2OTJS 3DLGA 1MG7A 4DWIA 3QIDA 2V50A 2UUCK 4X4OA 4ZPVR 3QEVA 1NOYA 1LFPA 2OEMA 1Q7YO 1T05B 3TAEA 4KREA 2YWHA 4NOHA 4TU9A 2CG8A 3SMPA 1UZHA 2DNPA 3ZZTA 1L5UA 4B1XB 2DY9A 5GINA 2HGLA 5A0YB 3HSZA 2V2QA 1KFSA 4EHTA 4JKAA 3GV7B 3HO1A 4H8KA 5AQWA 2YBVA 5DLFA 2QSFA 2VQEJ 3EGZA 2VIHA 4Y1DA 2YKMB 4CJKA 3Q8UA 1XI1A 2XYGB 2W9AA 4B3RJ 2DGUA 1DGKN 2AGOA 2UVUA 4M1KA 2Y1JA 1BDGA 2IHR1 2G2YA 5KQ8A 4ZCMA 4Q8EA 4DUYJ 4KKOB 2ZC3A 4B3SK 3E9LA 3BSNA 1I51B 4U67L 2CQGA 3P5TL 3GFHA 3CO9A 3C65A 1HHSA 3R8EA 4WFBL 3RRGA 1U0SA 4LF9F 3WEEB 1DQAA 4IOAL 3SUQA 3SDEA 3NOGA 4CO2A 4ZJOA 2MKCA 3QO9B 2ZE2B 4H0YB 2BKOA 3P49B 3KVGA 2W2MP 5F8JA 1QUVA 1WSGA 3AD8C 4OYOA 4LH4A 1IKXA 3K5MA 4M94A 3VEWA 3RVCA 3OYBA 4PKDB 4HI1A 3UNYA 1K8KA 1IBKK 4LF8F 1SJQA 5D4OA 2AYGA 3DRRA 2L48A 4WFBQ 2QL7B 2EX3A 2ASLA 4C8OA 4PG7A 4CGJA 1F5AA 1HBOB 2ROEA 1IO2A 3IXQA 5A2QU 1D5AA 3QJPA 4ED5A 2PO4A 4YY3F 1WEXA 2L9WA 3OJUA 4CJ7A 1CJUA 3IAM9 3QPIA 1RLDA 1JXLA 5CR4A 2ZBRA 4XH5A 4OYPA 4G6VB 1WSRA 3HI9A 3WX4A 1HHTP 4DR4F 1RHMB 3C14A 2QWMA 3U8XA 3N9UC 2I8EA 5HVFA 2E5GA 3Q0AA 5FROA 2VF3A 2JWNA 2GIFA 1WAFA 3ZSWA 4FLWA 2R7VA 4A57A 2PEBA 1VSDA 3TSPA 4OKEA 3ENHA 4USHA 1RABB 3VZHA 4OHWA 5DQHA 1K47A 4M8LA 2FGCA 3P31A 3NNAA 5AQYA 2L41A 1CQNA 2CIMA 4IXCA 4EBDA 2HPUA 4DR6J 2OZMA 4Q2MA 1RT6A 2H3EB 3U4LA 1LNQA 3KLHB 4BG9A 4LFBF 3A8YA 3EZOA 3F56A 3CPWR 5E41A 4MTPA 2LEBA 4OL8A 1U1LA 3KKRA 3CCJN 2VOOA 1U1NA 4CH1A 3SQGA 3ICLA 3RG6A 3DLLQ 1UAWA 2XHBA 3T69A 4LFCK 5HL7Q 2JRSA 3CCRS 3D2EA 2MYFA 4NA1A 5AQTA 5KG4A 1IKYA 4DV2K 3MN6A 5K9FA 1CJUB 1SZ2A 2W8KA 3QFUA 1J2VA 2FHJD 3M2RB 5IT4A 1ILYA 2XM3A 1MU2A 4MFBA 2KTQA 4CEAA 1T6CA 2HQ3A 2QV6A 1OVYA 3W2VA 3TR8A 1EHWA 2LXIA 2HNDB 1Q7YT 4DV3J 3CJ8A 2WVCA 2CPFA 3CD6S 3IC1A 5B0FA 4Q0BA 2MZSA 4ZOSA 3ISNC 4P73A 3R5GA 4FJ7A 4TVAB 2NPIA 2YNFA 2HSTA 2HOEA 2Q3SA 3CWJA 3NVMA 2F8SA 4IOXA 3BQ1A 3DXBA 2A41A 2OTJN 1TK0A 2Y8YA 3VALA 3BS9A 4CNYA 1HNZJ 4LF6F 5B09A 2PFDA 2HNYA 4PAAA 5I9EB 3J81O 1QVFM 1DAXA 4NLWA 4UT4A 4C1NI 3PHTA 1T8EA 1TUGB 1YLXA 2E1MC 5HBMB 3VQSA 4JV5K 4A47A 1G99A 4H54A 4M5DA 4C8ZA 2MZJA 3BGOP 2YNIA 4DU3A 1S9EA 2HBJA 3SAFA 1XQIA 1Y00A 2KLAA 4Z4EA 1SJRA 4I56A 1KLMA 4C3MA 2KFNA 3J7A1 5C2CA 3VERA 3ZSVA 1N34K 1IWGA 4DG1B 4LBHA 3QT5A 2YJFA 3OTOK 2GX8A 1RAJA 2CQDA 4X64J 1R6YA 4JV5J 1DHMA 1PCAA 1VQYA 3ZEUB 2RDIA 1RBTA 1VQ8N 1TL4A 4DTPA 5HATA 1IV0A 5FPDA 3PJXA 1YJ7A 2DR8A 4BR9A 4USUA 2VHGA 1C4CA 3OVAA 2VQFF 3IGVA 2B4JA 3U7JA 4K8ZA 2P9UA 1OO0B 1N5YB 4U96A 4F3MA 4RG8A 3J7YU 1NGAA 1RDAA 3OBYA 3U3YA 4EBCA 2C42A 3Q8PB 4DTUA 2CJKA 4Q45A 4USWA 5A0YA 3M5RA 3MN9A 3BSCA 5AXKA 3RMBA 4D3HA 5GMKa 2DK2A 1LWCB 2Q2RA 4DV3K 1VSIA 3VGKA 1YJUA 3VPZA 4BRNA 4X62F 4FZYA 3TJ8A 2MZQA 3QFPA 1PILA 2GV1A 5GIPA 4HTJA 3H0PA 2ATLA 5B0GA 5TKYA 3FRZA 1Y3JA 3LW5C 3TUPA 4C8MA 1SL2A 4DV1K 5CYJA 2VQEF 2EKNA 3KWIA 3L2WA 2CQCA 3AA3A 1T7PA 1N54B 1Q53A 4NMLA 4RW6A 4I7FA 2APOA 5FIIA 2YHAA 1N5VA 4F50A 2ZZTA 2HHWA 2H4WB 3EO3A 3MM6B 3KK2A 3G6VA 4WZQA 1WUUA 3ET6A 2P9UB 5F9LA 4BRAA 4N76A 2G0JA 4NA2A 3O9TA 1VQON 1RTIB 2Z0GA 3TSQA 1YJ9N 2HZVA 4A8OA 1JLQA 2IMOA 1N8RO 4IRKA 2ZZNA 4BWMA 2GIRA 4FVUA 3P4IA 5DGAA 3CC4S 3TO8A 1ZBIA 3PHEA 3HRGA 4GVBB 3PTWA 1T9TA 4WK3A 2DIUA 3QIOA 4CZMA 5ETSA 4IR9A 1Y0HA 3HYFA 2DPJA 5ELZA 4KFBB 3HFZB 1X4HA 1J5EK 2XEXA 5KFJA 2HLUA 3OYIA 4ZIVA 1IBLF 2BV3A 4C97A 1RADB 1VHFA 4ICLB 3LUYA 4PQAA 3HI0A 2R7YA 2DCUB 2GO8A 3M1FA 3BKTA 4AQYJ 4CYUA 5FPNA 5KG0A 2FC0A 2YX7A 1TAUA 2QZ8A 4QIFA 4ATNA 2VG6B 4NI2A 4E0DA 5D3GA 4HTUA 1UFLA 2OI2A 4F2SA 1FO1A 3SJJA 1XMOK 1SCJB 4MT1A 4CJSA 5DM7Q 2HG4A 2R7QA 5E2QA 3R7NB 4JHDB 1ATRA 4KHPF 2HURA 2BJ3A 3NGDA 1KOOA 5EX5A 3DOMA 3WHIA 3EM1A 4DV5J 1JJ2M 3WUHA 5A8KA 2QIFA 1X31C 3R5AA 5C7PA 3GU0A 4FYYB 2PSZA 5F2RA 2WUSA 2AGPA 2X1AA 3O08A 2O1PA 4C4WA 2IAJA 2J7KA 5KFHA 2NPFA 3F44A 3IM8A 3NMRA 2Z8QA 1IKWB 2VG5B 2W42A 3J80Y 2WSEC 1KWMA 4Q7AA 1ZS6A 4HCCA 5ETNA 4DUYK 4PXEA 3LPYA 3SQ1A 4OZJA 3PUFA 1GMUA 1KVKA 4JKGA 2W9BA 4IO9L 3BBBA 4DI6A 4ZPCA 4F4AA 2BJ8A 5HROB 2HMIB 3CDUA 2D4WA 4J9NA 3JS6A 3WZ0A 5B08A 5BN8A 1WC4A 2SXLA 1DY3A 4CBUA 1EP4A 3MEDA 1RBUA 1NHVA 1YITS 1YI2S 1JB0C 4RW8B 4BDPA 1CXUA 4QR1A 2B3TB 5BXIA 3CTRA 2DHXA 3VQPA 2ZWPA 3HXMA 4IOBA 4JI3K 2QTDA 3NVKA 1XN9A 2QWOA 4CLPA 3C7NB 2X74A 3VCDA 3ZT0A 3KJVA 3IO1A 3R5JB 5EWEA 4FJNA 2FHMA 2BUNA 1NPPA 4B08A 2P9NB 4BR5A 2DNYA 2ZKTA 3B8HA 1D8YA 2UUCJ 4QYZK 5AT1B 1JCFA 2ASOA 3HOSA 1TV6B 2Q6CA 1YJNS 4MMOA 4UOHA 2D9PA 5KFZA 4OHYA 3C16B 4WQ5A 4M3WA 1VISA 1JKHA 3IAS9 2I5JA 2LFVA 3N4QA 4BE1A 3T1YJ 2OMLA 1RAOA 4CP5A 1WSIA 1VQPN 2R2TA 3CHWA 5ETRA 4FSVA 4FDFA 3ZSYA 1RFQA 2C3MA 2XI3A 3J7AP 3MXHP 3PJWA 3QJLA 2HVHA 2MLYA 3KJNB 4DHYA 3A3NB 3GJTB 3AB2B 3M8ZA 5M1OA 1KLMB 2A3ZA 1NGBA 5GMEA 4F04B 3SPYA 1MW7A 4F4YA 1LWEA 1JL1A 4DSJA 4B9UA 3M2UA 1GOAA 3PVXA 4HUFA 4PPDA 4N56A 4MIBA 2B6AB 4FCYA 3PW4A 2DO4A 3OL6A 3LPTA 4M41A 1NK7A 1GLJO 2RF2A 3R5CA 1RZMA 2QWNA 2LA4A 5AJ3F 1VC0A 5KG2A 5HROA 4FF4A 2BE7D 5KT5A 3RB0A 1W2IA 1WSFA 3KLIB 3LA0A 2EW9A 1GK8A 1D9AA 3BN4A 3GR0A 2VC0A 1ZBHA 1F6TA 3SSQA 5F0UA 3VMFB 4URQU 4RTFD 4YN3B 1HKGA 2KYZA 2NNWA 4U6PA 2UUWA 1LV5A 1T3NA 1RTIA 3K59A 2FTRA 1WI8A 3A0IX 3UD5A 4RW9A 2L9DA 4ECQA 4CEDA 4G9ZA 2BOPA 2HWTA 4DR2K 1IKYB 1WTBA 3JB9k 4CM2A 1WHXA 4Q8FA 1S0VA 1ITGA 1NJIO 3PRVA 4OX6A 5IZHA 3VGVA 5HRNA 3P6YC 3E66A 4J9KA 4CF9A 5CE3A 1C4AA 3H2UB 2PD1A 5LJVA 3I56N 2ZFHA 2Q43A 3IRXA 3A12A 1VHIA 4J9LA 1W0HA 2WBNA 2UUAK 4Z4IA 1T05A 3M32A 1SL1A 3HKZD 3CNQP 3QGPA 4P9SA 3ET6B 2OAUA 4NLYA 3VGMA 3DGPA 2VGMA 3POTA 4GRSA 4F9OA 3L2RA 1MA9B 2IBKA 5KQDA 2E1CA 3LF0A 3V5RA 3T41A 5HVGA 3M8YA 3ZZPA 1S97A 5AQOA 3ISND 4AXJA 4UOGA 3MI7X 1Y9OA 4OZ5A 3FR0A 2B8QA 2HFOA 2A6OA 4KGZB 4Q44A 4M95A 3D0IE 4TNOA 4CJFA 3CJBA 1H74A 3DNCA 4DL2A 1WHWA 1CLFA 2BRKA 3H4DA 1JIHA 3FQLA 4F0HA 3CMAS 2HK2A 1Q8IA 1YDLA 5D78A 1IBKJ 3LOUA 2WZ1A 1RWKB 3MCOA 1KQSM 3MM7B 2RE2A 4CBXA 1U2FA 4ZHRA 3G0ZA 3FKBA 1FE4A 3Q89A 1D8ZA 5KFMA 3LO3A 4MKVA 4LF7K 1HL6A 1KC8O 5J1NA 1FD2A 2OPRB 4V19S 2V8HA 4CZLA 4DPYA 4CH7A 4NCGB 4UY85 2OD4A 4CCHA 4FW2A 3MFIA 1RTHA 1Z25A 3BYPA 3VETA 4BRHA 5C0YA 2PT0A 4RCHA 2LEPA 2K7KA 5J2MB 3HJFA 1FX4A 1DURA 2PIIA 2CGLA 3EL2A 1BIUA 4ZVGA 1KDNA 3TARA 2ZH9A 2ZUAA 4C8NA 4KT0C 5AQQA 3QGGA 2P5OA 1U26A 1DTTB 4W98A 2C2OB 2GWJA 5A8RA 3CD0A 4B1YB 4F3OA 1NGHA 4KHYA 3FGUA 4LBIA 4B3OA 1OY6A 4LRBA 4PWDA 2YX1A 3C8YA 3JAMY 1HNZF 1NGDA 3CCUS 4J9QA 2WOMA 5J1EB 2WAQD 4EBEA 2KI2A 3TQEA 1WB9A 3BO3A 5KFQA 1KHWA 2KZZA 2BUPA 5SWMA 2AQ4A 1LFWA 1ZPWX 3HM9A 3EDRB 3M9MB 4OI1A 3TOQA 2VWJA 1FVQA 3U1LA 5E3CA 3IFRA 1JXBA 3LPEA 1R31A 3J80O 2W41A 4QYZJ 3IR6B 2WSCC 2P1JA 3MMBA 5KRTA 4ED1A 2YKOA 4DL4A 2G9OA 3BGRB 2LP4A 2Z2YB 2O8EA 3WQPA 1VIOA 2XSFA 1KKHA 5CCLA 4DN9A 5KT7A 3VV2B 2R2SA 3ILIA 3M8RA 4W4MA 3DLGB 1BQNB 1R27B 1NM1A 2XLJA 2ZM6J 3JTNA 3LP3A 3AJ1A 1N5QA 2XZWA 4NXMF 2BM1A 2V4QA 1GLBG 2C2ZB 4ILMA 1X4BA 1MWQA 2JEGA 3WNEA 2G8FA 4OLPA 3U3GA 3PIPQ 1CZAN 3QEPA 4CIOA 1YJ9S 3HSDA 2MMYA 5DG9A 4OZLA 4OLBA 1T6DA 4CD1A 1S6UA 5BR9A 1U6FA 2D3ZA 2VPXB 1IG8A 4FWKA 4QPTA 2AP1A 4WF9Q 2Z58B 3FBBA 4WFAL 2WSFC 1Q8KA 2CH5A 3EE8A 1HJOA 2M7SA 2QLFB 4NLSA 2ITMA 1QAXA 3ZC4A 3B4DA 2KT2A 1S1XB 3KJQB 3AQOA 2C22A 1E6VA 1B9FA 3AVKA 3Q8QB 5A6WA 2CPEA 3U02A 3BJYA 5DDPC 3KLIA 2LYVA 1VQLN 2DCLA 1R43A 1S1TB 4HDHA 3CCQN 2GHWA 3DOLB 1PJ5A 5J2PA 2QEXN 3M2VB 2CWKA 2UXDK 1B64A 3LM2A 3VAGA 4A8KA 4CZGA 4EP5A 3U6FA 3QO9A 3D1OA 3RSEB 1RBAA 3T6JA 5FDLA 4PCQA 2CNLB 2X3GA 4OI3A 1YXQA 3I32A 4ZK7M 4J8FA 2NS1B 3DLLL 4MIWA 1B9DA 5HL7L 1VYAA 1EKSA 4P52A 3AXMA 4LFCF 2FD2A 3SNNA 1WBDA 1K8KB 1HYSB 1Q16B 2UUTA 5E33A 3NGIA 4CF8A 1SJ3P 1FKOB 2L9NA 3HP6A 3ZT1A 1XMBA 2BMBA 1F9EB 4Z4FA 4ALZA 4FF1A 3CCMS 2F1FA 4NX9A 4C11A 2R8HA 1VLOA 2VASA 5JJBA 2FVRA 4WF9L 4CHNA 5K8PA 1FEEA 3OXLA 4DR5K 3CMEN 4TU8A 3BGFA 4ZLPA 2POKA 3OYLA 1QE1A 5A2QO 1CEZA 3AVIA 4YOWA 1B99A 4NLQA 3AH6A 1RBVA 1PYTA 2DFEA 4NCGA 4JI8J 1Y5IB 5H1SV 4B9SA 1SXLA 3K5LA 4ED2A 2P6TA 2W2OP 1SQEA 4USIA 2JVRA 3CG7A 3FEXB 2G1DA 4NYPA 1V4TA 1QAJA 3HSJA 1IJEB 3ZETB 4F26A 1RI7A 1FRKA 3IBWA 2G8HA 1UAXA 3M1VB 4MFBB 1NK6A 2WVBA 3MM7A 3BSAA 4KSEB 3OXFA 6FD1A 3GLJA 4BC7A 2YV0X 3QESA 1N5TA 4ILHA 2DRAA 1MROA 2FZGB 3TX0A 5E0OA 1YRUA 4ZVUB 2N3OA 3O3GA 4M3UA 3FCHA 3MMAA 4X4RA 4F4XA 4DR1F 2DTJA 5IT9Y 2YX6A 3VR1A 1BD6A 4ZLNA 2D9OA 3CCVS 3M2VA 3MWBA 4I2PB 4ECVA 3ZCMA 4WP3A 1FWPA 5HJYA 3W5YA 3D54A 4U95A 2C2DA 1J9AA 3C15A 2NRRA 4AH9A 3CCRN 4Q0BB 1ICEB 3IRWP 2DNRA 4TQRA 4LF4J 1BISA 3PO5A 2BJ1A 4L8RB 1J5OA 1PIEA 4ER8A 2A2DA 1DEJA 2FBVA 2QEXS 4LBPA 3BGRA 2OD6A 3V1QA 1S4FA 3QFWA 3S8SA 1S9GB 3CXCR 1M0SA 1RGVA 1U6BA 3OTOJ 4KYZA 4J9VA 4LR8A 3UO0A 3TP2A 2E7XA 2GELA 4DPWA 4IO8A 4A46A 3K0SA 1FJEB 3F41A 3SBGA 3UN2A 3HVTB 3OFHA 3DLBA 2MQ8A 2P9IA 3DRXA 2XS7A 3T3FA 4CHZA 3THTA 5F1XA 1CJVB 5H9FJ 5ETMA 3M7VA 4ZVTB 1LAVA 2ZJQL 2FF3B 2P6SA 1U48A 4NXMK 2V68A 2XS2A 3KK7A 1KVIA 2BE2B 3EE3A 2YQ3A 4E2FB 3L2UA 1ZA2B 3WIVA 1ULRA 1K1SA 2E88A 3KKFA 2QFJA 1BA0A 3G4SS 3MM5A 2WVFA 5ADXH 3ZNUA 1VQ9N 3FMWA 5E26A 1NNDA 3BO4A 5CZVA 4K0KK 4JV0A 1T03A 5EGYA 4X64K 1FJGJ 2XGQA 2DD8S 1V4SA 4HH0A 4FPIA 2YWEA 4B8CA 3MMCB 4J90A 3THPA 2FJAB 2N82B 1N88A 3RR7A 5C42B 3FFIA 3TUZC 3TA1A 3TZWA 4FJHA 5HRSA 3CEDA 2M2BA 4KRFA 2HQCA 4RBTA 1EB0A 3FMBA 4BBYA 1VBXA 1JLQB 3LP1B 2IOCA 1N32K 2HGNA 4W5RA 4JOUA 2BJEA 3JSYA 3BR9A 1ROFA 2JLFA 2EBEA 2H5EA 3OD2A 3TAMA 2EC2A 4CO0A 4LH5A 2YNGA 4LF4K 3HULA 3F9MA 4P72A 1REVA 1CC7A 1RWNB 3UVJA 3O8WA 1QQCA 1QTNB 1Q18A 2OPRA 3R9LA 1OH6A 5GAEP 3FCVA 3AO4A 5THWA 2F40A 3DLKB 4OFZA 3W64A 1RBOB 2BQ3A 2VPYB 4MQ3A 4D3GA 3MEEA 3AA2A 1UWBB 4F2RA 4TU7A 3MAHA 2HVEA 4OPJA 5IFMA 4LFCJ 5C42A 2ZOGA 3Q83A 3CGIA 1FXXA 1Z2ZA 1N0UA 2XY8A 4OJRA 4NYOA 1FDBA 3WNHA 3O44A 1YIJS 3N6LA 3ITHB 3Q8YA 5EDWA 3X3UA 5KFXA 1YRTA 1YJTA 1REVB 5F8MA 3OBIA 4MLHA 4ILRA 1LQ9A 2VBXA 2K8GA 2W2PP 4LRCA 4J2AA 2CNNB 2EHGA 3HT3A 4KO0A 3D0HE 4K7QA 5F9NA 4DR3K 1TUVA 4LIRA 2C2MB 4QYRA 4DCOB 1UWAA 1X4FA 1PO6A 4YQWA 4GMKA 5HN0A 5AQVA 1RJJA 2HS4A 2QLBB 2NSBA 2RU3A 3THYB 4RNOA 4JKFA 2DGTA 3K5NA 2XMMA 3HVTA 4JI1F 1X4GA 3TEGA 3FBCA 4BRLA 2LA6A 4NCAA 1Z2LA 4O4GB 1XNRJ 2I7PA 3MTJA 4I9LA 3VAKA 3Q8SB 4Z37A 3AO1A 1RWWB 1OKJA 2YWFA 3QBCA 1A9NB 4JI5J 1NGIA 3CERA 5BPMA 2CQIA 2VQEK 1NSAA 2ZITA 1FRJA 4LF4F 4PXCA 3H40A 1Q4RA 4FYVB 4ID1A 2HAIA 3A8EA 1NGEA 4CLZA 4BCAA 3V4IA 3IS9B 1S6OA 2HFSA 3DXSX 1U25A 4LVOP 1FRXA 4NXNJ 2P9KA 3GONA 4WXWA 4X4VA 1VMBA 3P4UB 4H5VA 4F0MA 3NCPA 3MFHA 2E6LA 2KG1A 4DU1A 3CO0P 4CFAA 2UZAA 2MSTA 3BDPA 4BQZA 4QS7A 1Q5YA 3SCJE 2O8FB 3SFUA 1RYSA 1AFIA 2FIUA 1EX4A 3P1GA 2IDEA 1VBKA 5T7LA 2QMWA 2LU1A 5KT6A 3OYFA 5B8HA 3W62A 4GV9A 1QY7A 4C1NK 3GWCA 4PWUA 4CO5A 3Q86A 2HHHJ 2NRVA 2DNMA 3QLHB 5F8LA 2LEAA 4O44B 2ALZA 2HHUA 1CLQA 1N4LA 4B3RK 5IQ6A 1RKIA 3V6KA 4YHHF 3KDNA 4NA3A 1WG1A 3PFEA 3HHEA 1JKHB 2VKRA 4IKFA 2D3UA 3FZBA 4X66F 5IS2A 2VZ9A 5CCMA 4K4TA 3R6MA 4IOCL 3PIOL 2LKZA 3AVNA 3CPEA 3C6UA 2W9CA 4C3LA 3H7HB 4JI4K 2EG2A 3I0RA 1WNEA 5C24B 1VBZA 2XMTA 3NWRA 2QXLA 4RJVA 4DSLA 1NKBA 2OPQA 2XO6A 5KFCA 4CIFA 3GV8B 4ZCLA 2PY5A 2HHQA 2VPZB 1H98A 4YR0A 2KZMA 1FERA 3IG1B 3GE9A 1S72N 5B0BA 4HT5A 2P5VA 3TNVA 3PIOQ 4CJLA 3EXYA 2OEJA 4BR4A 2DISA 4L3KA 3AY0A 4HDGA 1RWVB 3CJSA 1WOPA 2Q0UA 3L8BA 3QEIA 3SBMA 2ZKUA 3RW6A 1HBOA 2QWQA 5IXUA 3GSDA 1IBMK 1NM2A 4HYKA 2XY6A 2YKNA 5CQGA 4AL5A 3KMSA 3SJHA 4EEYA 2VDHA 4PG6A 2W2NP 4PPZA 1Q7LB 1P1TA 3A2FA 5CD4A 3GSIA 2RUSA 1Y5LB 2V34A 3ZXWA 2QYCA 4DXLA 5KOXA 2JEFA 2M0GB 3TR5A 4NPOA 3AB4B 2DNQA 3TAPA 3RAMA 3DRPB 1U49A 3A5MC 2IRUA 3QSIA 3H3OB 4C8LA 1NSPA 4PY5A 4WP9A 1F0XA 1RHRB 5KPZA 4O0JA 2OFGX 2XQCA 3EPIA 4H0PA 1YRXA 1ATSA 2IDOA 4DSFA 2VBYA 4B1ZA 3DXKA 3HLUA 4NLUA 1E6VB 3ELHA 4ZP9A 1GLFO 2BACA 1NNEA 2ITGA 1AXQA 1H2UX 8RUCA 4M63A 3NOCA 2J8SA 1SIZA 2G4BA 3I31A 3EY1A 4Z4GA 1WC5A 4WTYA 2HRUA 2MLXA 5JVGQ 4DR7F 4E19A 4BVOA 5KT3A 3LP0A 2RKIB 1U47A 2R2RA 4K42A 4E98A 4P7TA 3PXGa 2L08A 2VKZG 2E5LF 4ZN3A 2E7VA 4RR5A 2ZM6F 2E1PA 2XO7A 3OBWA 2V2ZA 1IUJA 2QWRA 2WHOA 2J4RA 3UB5A 3THXB 2VG7A 2ZJPQ 1YVUA 4ZLJA 1NJIT 3B6OA 1RT6B 1F2HA 4UOCA 5IWAF 3VAJA 3D1QA 3KFWX 1TQLA 4E7HA 3K0JA 4FWLA 2JLEA 4GV3A 1RAHB 2IRYA 1V5VA 3AVGA 5IM0A 3D3BJ 4BVPA 1GOCA 4LF8K 4OZNA 3NBPB 1N6QB 1QD1A 1S4EA 1NKCA 4L3NA 4LREA 1JCGA 1SUQA 2DNGA 2FVSA 1I94J 4B9QA 5E3AA 3KJFB 4NLTA 1W25A 3PX6A 4WU3A 1CS4A 4DQSA 4AHVA 1VDHA 5GAGU 1MWZA 3AA4A 3CQXA 2ZE2A 3VQ8A 2GA7A 4LF9K 2BE9B 1FE0A 2OTLN 2NZTA 3AAWB 4AFFA 1EETA 2GIQA 1KC8T 1Z05A 4FWMA 2WOMB 1O6XA 2M8HA 4G1IA 3R5BA 3JQJA 4Y28C 5L38A 4OIXA 3D67A 4M5IA 4DV1J 4LSZB 3RU0A 2KXNB 2NZ4A 3FGVA 4B02A 2A42A 3NGTA 3MX5A 4BROA 5EX0A 5M1FA 2Z1GA 1S3XA 3UW1A 1S49A 3PZPA 2UXBK 5B7WA 3QZ7A 1MMDA 2XC9A 4BRCA 3ZZ0A 3KD5E 4FPAA 4EAHD 2B9XA 2DRBA 3TAFA 2FLNA 5CABA 2HIYA 2LQBA 2JFDA 3LP1A 1HQEB 3K9KA 1AW0A 4OMFG 1M1HA 3FQKA 2RJZA 1RCOB 3R2DJ 4DPOA 3SAGA 3CCSS 1NLKL 2WCXA 3CC7S 3ZT2A 4V19X 5BN9A 4DTSA 4FVCA 3AGKA 3DLJA 1Q8LA 5JMNA 3Q8RB 1HQEA 4JV1A 4JI1J 3NMUA 3ULHA 4C98A 2DYAA 1P6TA 3UKUA 4OJGA 1YK9A 1NDPA 3U9ZA 4X84A 1FDAA 1KD1O 1EQ0A 1L3KA 4KI4A 4ZJLA 4FYXB 1HRHA 4CZIA 4X65K 4ITSA 3V81A 2ATQA 3CFPA 4JI3F 1SQFA 3U1MA 3KTQA 2V8GA 1KXPA 2D0PA 4WIIA 4CF0A 3DOLA 3R3TA 2YWWA 2V2VA 1KBRA 4NXNF 2LQ9A 1FTCA 5HRRA 3A8JA 3O5BA 5B0CA 4ISFA 2BJ7A 1JXVA 4H4KC 1BWEA 4ZJQA 1HNZK 4ZHRB 1WKJA 3W2VB 1DTQB 4I7FB 4J9PA 5IWAJ 4QIGA 1YVFA 4R5PA 2AEJA 3HHNB 2JWKA 3OSPA 1TKZA 3AA8A 4MKYA 2XULA 3KHGA 3W9IA 4CESA 1ZTWA 5FJ4A 5K14A 3V81B 3EZWA 3MURP 1GLCG 3NFAA 1XIQA 2AHOB 3ONQA 3L9ZA 2GVDA 2GNKA 1CJKB 1TP7A 1BI4A 1R8HA 2H1YA 4WBFA 2QGFB 3QGHA 4DR3F 3VTHA 2WVDA 1Q78A 4AM7A 2G13A 3ZZUA 3TABA 3OUYA 3CIZA 1APSA 4DL6A 1BO5O 1FFGB 3VEYA 2NRZA 5EUHA 4RUCA 3DXKB 1OVQA 4ED0A 2G0CA 1NRKA 4CTAA 4FWRA 3T7ZA 5D4NA 4DLEA 4DV4F 1HR0K 2BEFA 2MY8A 1SV5A 1TVRA 2A2CA 3L7OA 5KT2A 3ISZA 3QNOA 5KI6A 1CZ9A 3DHXA 1J54A 2J7UA 1U6ZA 3T1HJ 2AD9A 1BCMA 1VC6A 5HQMA 5J2NB 3HJVA 1XC3A 1JLGB 4I0WA 4KIAA 3HMJG 4QIVA 1AZSB 2FXUA 2VCPA 5LM7E 4PUOA 1GEHA 2HYIB 2L3MA 5AXLA 2X6NA 3SQ0A 1Z6RA 3IWXA 4DL7A 1SC6A 3D6RA 3DRRB 3HL8A 3GG4A 4Y2IA 4FJMA 4ZMMA 1H38A 4UTGA 2WTUA 4H0VB 4CW7B 4GV6A 4ECUA 1L3UA 5CYQA 3HHLD 2F4VJ 3AOBA 1S0NA 2RUGA 4CLTA 3BQ2A 2KJWA 4C8YA 1GOBA 1NMDA 1TVRB 1CQMA 5CH7B 2R7XA 2MQOA 2RH3A 3DHWC 4Y0WA 1GMWA 4FO0A 4ID5A 2UU9K 2PMHA 2KXHA 4ED4A 4FWPA 1SUQB 1WC1A 1NGGA 3JSMB 1S0MA 1M5OC 2CRLA 4AQYF 2NRXA 1HI1A 2YH0A 5KFGA 4BR0A 5D4LA 1MWKA 3OHRA 2YNHB 4LC9B 2XG8A 3PEJA 2V7YA 5FRNA 3HK2A 4KHSA 1WTFA 2Q97A 1UA1A 4USJC 2DY4A 3TZZA 3EN9A 3IA0A 4E7JA 3MUTP 2CZ4A 4EYHB 1TYQA 3RB3A 1OSDA 1OYEA 3RUBL 2O01C 3QJJA 2QA4S 3SQOP 2YKMA 3OHBA 3RMCA 1FF2A 4FVMA 3RGIA 4NL5A 4BC5A 2G2ZA 2XTJP 3HHKA 2EWHA 3LGMA 1YJNN 4ECYA 2ATCB 4HR2A 3HZGA 3VQEA 2F9DA 1F1BB 4KHMA 1KOHA 4H4OB 1RT4A 2CQPA 3VAHA 3M8QB 4S0MA 4JS5A 2FJEB 1U09A 1RP5A 3OLAA 2C28A 2F96A 4NWBA 4XIUA 3N5FA 5E84A 1Z1ZA 2DPNA 2OEKA 1T9UA 5HMWA 1M5SA 4FM0A 3TJAA 4ELVA 1VRTB 2KDOA 4I9QA 2DGWA 3H98A 1NB7A 1QQMA 3HCXA 2EVZA 2YKAA 3AAQA 4KH6A 1N34J 1UJ4A 5GVQA 4FXDA 2UUCF 4JI5F 1A7GE 3W9JA 3FLCO 4KAIA 3I33A 4JI0F 4L75A 4QJVA 4YB7A 3NF9A 3CCLN 2GO9A 2KN4A 3HHLC 1XNQJ 1T94A 3D6TB 1HNXF 1HNWJ 4FWQA 4DS4A 4OJHA 5MLCQ 1YBTA 1GLLO 2XGPA 3E1YA 5IT9O 2UXBF 1CULB 3IRXB 3RBEA 2WTFA 3FUYA 4I6YA 4CO3A 1T95A 1YJVA 1FTRA 2GMJA 4OI4A 3UIQA 4KH4A 3MMBB 5CD4H 3HVAA 5E5NA 4DTMA 5AQFA 3SCKE 5D4PA 2FJWA 2IM1A 2ZD1A 3CUNA 3QQCD 4UUWA 1P27B 5AQNA 1LXNA 2FF6A 4DQQA 3PRDA 5LMUF 4WYLA 3JSBA 3UDVA 5JVGL 1NDCA 2E1RA 3J8AA 4R0JA 4LSLA 1HBNA 2VBWA 4BG8A 4H4MB 1ZBSA 2JEJA 3KLGA 4ILLA 1UVNA 3C7NA 2FYXA 3QIPA 2MKHA 2QM1A 3V6JA 3H20A 1RT2A 3NY0A 4E8UA 4Z2XA 1VSKA 2E66A 3R97A 2YKNB 2CA9A 1FK9A 2AJQA 2BANA 2CJ9A 3VEZA 5CY4A 2ASDA 5ITHA 2UUBJ 4FWSA 2YHWA 3OFFA 3M9OB 1PSDA 2Y1IA 3E51A 2PZSA 1DRZA 3UDCA 3G71N 1ASUA 3BM7A 2DGOA 2F8MA 1BHNA 1S9FA 4NASA 1VQKN 3BQ0A 3THVA 1HR0F 5T7BA 4CK1A 2XCAA 1IH7A 4BR2A 2XMWA 3DYAA 5L39A 5JLFA 2EFQA 4I6WA 5T7LB 1UFWA 3GIMA 5LMNK 3RAQA 2YHBA 3BR8A 2W01A 3A13A 3E3XA 1XHZA 4AD6A 4M5GA 1RAFB 2DPIA 1RQ0A 4C23A 1VSHA 2PYJA 2RRBA 3JTPA 3SUOA 1JNRB 2AW0A 4E89A 1JLEB 2D0CA 3SQ4A 2MTLA 2RPIA 4FLZA 3VESA 4CGDA 2YKPA 3L3CA 2VJVA 4JHDA 2QA4G 4R8UA 4QWBA 3QDKA 2RU9A 4ZPAA 1C0TA 3GYGA 4GKKK 2ZH8A 1QZ6A 3H8YA 5DG8A 4CLSA 3H2LA 2NCKL 1U8WA 2WVEA 4WU2A 1NSKL 2CQ1A 2O8DA 4DBQA 2JX2A 1IBMF 1YTAA 3CW2C 1OQ6A 2CDQA 3D2WA 2CGJA 2YNGB 3HTVA 2OCEA 4NB4A 3M3ZA 2B7BB 4USKA 2DT9A 4C9DA 3LPUA 4MJKA 1CG2A 1K9MT 1FK9B 1XR6A 2J8AA 1C1CB 4FNHA 2V0NA 3BH6B 4BRDA 3IS9A 2FVPA 4E7KA 1S6PB 4QS9A 3IR7B 1F60B 2BGGA 4NLDA 4NYNA 3MMCA 1ZZNA 2XYHB 3NGKA 1FEHA 4JI7F 3MPYA 1TTHB 2ROPA 2Q0RA 3KWMA 2E29A 1TGOA 4ELUA 1NUEA 3I55S 4CZHA 4C0BA 5K8OA 4BRQA 1RDRA 2BXJA 3GJSB 1SH3A 4KHRA 4U8YA 1WWHA 4OHXA 3NF7A 4YS2A 5KFAA 3K5PA 1RISA 4KH5A 3GYNA 5EOYA 3R8YA 3HFKA 5M1KA 3GCWP 5AE1A 2NQPA 4B3TJ 3MWPA 5LMNJ 1VS3A 1K73T 3UD3P 3TTFA 3TVKA 1VQLS 3NCIA 1D9FA 4KV8A 3CJ1A 2AT1B 4PABA 1LWFB 4RWTA 2RHQB 4NZ6A 5T41A 1VFJA 3IBFB 1P90A 3W5ZA 2XMVA 4FBTA 2ASJA 3C16A 1WOQA 4EZ6A 1N5SA 3VF2A 3BDEA 4MK8A 2GHPA 2XRIA 3OVSA 4M7XA 4Y3CA 2IJRA 3G6XA 4OYIA 2V4JB 4B3RF 3G6ES 2W7OA 3K8VA 5KOWA 1NJWA 3ULEA 4DFJA 2QG9B 2P9SA 1HNWK 4M3RA 1FDNA 1VI7A 2WW4A 1HPMA 3MM8A 1WSEA 3HT0A 3K89A 3CM5A 3TZYA 4RO0A 2PN6A 4RLEA 3CM6A 6AT1B 2GGPA 4X4UA 2WB1D 3CDEA 3QAUA 4CT9A 5AZIB 1DKGD 2X1GA 4K5RA 3ZZZA 4RW6B 4JI1K 5ETOA 3CC2S 3BREA 4K50A 1ATNA 1NJZA 2VA3A 1KVBA 3O6WA 1MN7A 4CIGA 4DTXA 1S6QA 3L95X 5D6GA 1AFJA 2G2OA 7FD1A 1RWOB 2EFOA 2AEMA 3W2WB 4A8XA 4DR1K 4WPAA 1TKDA 4DCPB 3KUEA 2WBMA 3NGZA 5KFOA 4CLFA 2HRYA 4AYBD 3AT1B 4RWWA 3NNCA 3D7EO 1PJ7A 1KVAA 4DR4J 3A3OB 5L1KA 4G1QA 3AGRA 3H25A 1RCXB 1S22A 4FPBA 3V1OA 4JI2K 1OPZA 1PC4A 4H4MA 2GX9A 4YB1P 4IFEA 3QLHA 2C2EA 5E3PA 2WFBA 2E5LK 5HAOA 4J7CA 3S01A 3VGSA 3QGIA 2JLGA 5HBMA 3J81j 4A59A 3UVJB 4ELTA 3FEYB 5CHIA 1NJYA 5GAHP 3KD1E 2FJXA 2Z57B 3C3LA 2UVRA 2KU7A 3TW0A 3JXUA 4DU7A 3PX0A 1W2BR 1S72S 2YWKA 2HQGA 1N8RT 3PG9A 1O13A 1Q82O 2CJBA 2OELA 4CH0S 2RMLA 4DR5F 2UU9J 1HMVA 4B3TK 4XPEA 3CJCA 3J7ZO 3OYDA 3PEHA 3N4PA 2HNZB 5C10A 3CDWA 2LQJA 2OPPA 4DG1A 2C2NA 1NGJA 3H1VX 2BTFA 1U7LA 2HSEB 4CJWA 4XK8C 3FSXA 4N8NA 2JZ5A 3MCNA 5FD1A 2KT3A 1SH2A 1J5EF 4DQ8A 2HVIA 4ZVHA 4KTQA 2IC3B 1XWLA 5AZJA 3CIMA 1Y97A 4U7BA 5KFLA 3TVZA 1R6VA 1M5VC 4DV1F 3N28A 5J2QB 3DCAA 4JI0K 3CJKA 5H9EK 4B9VA 3T9NA 2QMUB 4V19J 5F8HA 1HNWF 3HHDA 1FXLA 2RN2A 2KO1A 3HOTA 1K73O 2UXDF 4RW4B 2BABA 3D2EB 1SKRA 3NNHA 1NXIA 4FJKA 1T44A 1B92A 3BV8A 4DR3J 2HIQA 1RLCL 4PYAA 1JJ4A 3SYZA 3H5UA 1EQMA 3KUHA 2LCWA 4F3TA 3UCGA 5JMVA 1WN7A 2E2NA 2GFFA 4RNFA 3D6MB 1CXQA 2MDAA 5C15A 5HP1A 1OH5A 2GQCA 4AL7A 3UDLA 4FLVA 1S1XA 1TKTB 4IG3A 1NMNA 4CZFA 4F36A 3PX4A 3D66A 4BC9A 2HF3A 2R8JA 2AIRB 1VRUA 2ZH7A 4I2PA 1R0AB 1HQ2A 4DX7A 2F9TA 2FLOA 1LCUA 1WNSA 2I0XA 3CIPA 4M5MA 2DR5A 4IG0B 3M6WA 4EMDA 3TANA 4NLGA 2IM2A 2BM0A 3L6QA 7AT1B 3WXMB 2XI2A 2DY1A 2MSSA 4LSNB 3RBDA 2NR0A 2W6KA 1Y7PA 5HRPA 3M05A 4IOAQ 1IR0A 1HIYA 2RT3A 1FCAA 4A5AA 2E2QA 2E8AA 3DC2A 5FLXO 4FP9A 1RACB 4P7VA 5GAGI 4H4OA 1TYQB 2AYMA 3J7YI 2DNOA 3B54A 1S77D 3HSGA 4TYBA 3ZSRA 3GIRA 3OR1B 4KR0B 4LF5F 3ZX2A 2OSQA 2GEMA 3W63A 2GJIA 3PW5A 2NXJA 1JLCA 1Q9YA 3E9OA 3D9BA 2E6MA 3CCTA 4X62J 4CD3A 4DQRA 5BPLA 1JLGA 2A10A 1IKXB 5EXWA 1MROB 1HLWA 1H3DA 4FJIA 3MGJA 4MO4A 2R4FA 4QW8A 3AVLA 5EWGA 3ULDA 2V5HG 2NRTA 3FZKA 3OYCA 1TMJA 4M3TA 3G6YA 4IDKB 1KQFB 1FX2A 4X66J 1FT8A 4X65J 1EKEA 4MH8A 1LEOA 3QBXA 3EX7B 3K5OA 1LXJA 1KQGB 4XTTA 3MAAB 4OI0A 4PRFA 4OYZA 2YTCA 1ZXOA 3RMDA 1VRQC 3NAIA 1EAYC 4FJ8A 1ZAWA 1S12A 4KGXB 2PYLA 4LF7F 2GVZA 1TL1B 1YTYA 3SI8A 1BC6A 1NU4A 1U0HB 3AODA 2IS3A 1HNVB 4IG0A 3H5SA 5KG7A 3MXMA 1QSLA 3JSRA 5H9FK 4JK9A 4DV0F 2ZM6K 1VC5A 3DM2B 4L72B 1OH7A 2VB6A 2G8UA 4QR0A 1KS2A 2IVOA 5DDQC 3MXIA 1D3WA 3EUNA 4DV6J 5CHCB 4B8AB 2W9CB 1YGYA 4CJ4A 4DU8A 3A5OC 1XNQK 1XBWA 4KJIA 2GVDB 3GIIA 4DZ6A 1NK8A 5AQUA 4R0EA 1QQNA 2D7SA 3NEKA 2XMKA 3DRSA 5FLXU 1MU2B 4ZPBA 3O4WA 1X1PA 3GOIA 4KHPJ 4OZ0A 3VVUA 2LLZA 1FWKA 1RSCA 2E1ZA 3J81U 4DX8H 4OZ3A 2R7UA 1OH8A 3GCXP 2DRDA 3D1HA 3RW7A 4ZP6A 1C1AA 2MQPA 2ZC4A 4LF9J 2R3VA 4N5SA 2UYTA 3VQDA 4CGHA 1L3SA 4I6MA 2HHXA 2DH8A 1S1UA 1NDKA 4W90B 3QFHA 4DQPA 4L6V3 2PMWA 1VSFA 3CCVN 1F2GA 2AYEA 2QX0A 4CBWA 3F0NA 4DTOA 4LFBJ 2A3JA 4GO7X 4BDZA 2Y0SD 3AOAA 4JP8A 1OY9A 4CFCA 3RB6A 2H65B 4IOCQ 2F65A 1U0HA 1VR6A 4WTOB 3LP0B 1RU1A 3CCZA 2XSJA 3SZ2A 1HNXK 3ZNJ1 5KFDA 5J2QA 3G82A 5B0DA 1KR4A 2ZDOA 4DTNA 1WHVA 3OLBA 4P6QA 5AJ3K 3MEKA 4UUXA 1BQNA 1TUUA 4RW7A 5EWFA 2XLIA 1NZAA 3GQCA 3H1QA 3ZX3A 2P2CB 1WC3A 1S48A 3RZAA 3R1HA 3GYXB 1HYZA 3OS2A 2HBLA 1JLFB 2KG0A 1CJTB 1I39A 3ENBA 3GBTA 4B9TA 3I0SB 2BJ9A 3N0VA 4JD2B 4K8XA 3MR2A 3LAKA 3GFYA 2D1KA 2KJVA 3GJQB 4X65F 3B82A 1J27A 4UZCA 4QIWD 2BX6A 3TTDA 2O67A 2E5IA 3TA2A 4AHTA 4KPYA 5HVHA 2U2FA 1RBSA 3MXJA 2XHWA 5HJXA 3P83D 4KH0B 2DXFA 4O5FA 3GILA 3QWPA 1RTHB 1R8AA 1WDDA 4IYQA 4PL7A 5KFSA 1EZZB 3DN9A 1JLCB 3C19A 2F8EX 2KT5A 3QNNA 1TL3B 3UKRA 3K2YA 3OYEA 1VQ7S 1FVSA 4K4WA 2FGOA 1EP4B 3MEDB 4USVA 1CJKA 3DGPB 3WT0A 1T9WA 1WF0A 3CCUN 1UWBA 4EYIB 1LOTB 1V6HA 4OZ2A 1JL2A 1KVCA 1RA7A 3ZZOA 4JI2J 5DDOC 1HPZB 1Y3KA 4GKKF 2B9YA 4ZCKA 4DF4A 4DR2J 5KRSA 4M63C 1HNIB 2QL5B 4RUAA 1QM9A 4MIAA 4YB6A 3BKUA 2HQIA 3P5JA 3I5BA 1XMQK 2BH1A 1GXTA 3KJVB 4FKYA 4MK9A 2KFYA 2NUHA 4CZJA 4JI6K 3DLHA 3NBPA 1N6QA 4HHUA 4BRPA 3IGNA 5AZJB 4FLTA 4BWJA 2VJUA 2B4PA 4XO0A 4H0TB 5KFKA 1TKTA 1MDUB 3LGHA 2RHKA 4IQMA 2QLWA 2EBGA 3QT7A 1R8PA 5EVZA 3AO2A 1UFKA 2ZH5A 1VQ9S 4JKBA 2PFUA 4CI0B 1WBBA 3GZ7A 4AM6A 2HNZA 3VAFA 2IYGA 1IBLJ 2HMPA 1W9HA 4FS1A 5AR0A 3C6HA 5F41A 4Y2MA 5ETQA 4CLUA 4H0XB 1QHAA 1UPPA 3RRHA 4DOZA 5L9XA 4BRFA 2ZOMA 5C2GA 1X5TA 1OWXA 3KG4A 5FPEA 3PY8A 1HKAA 2PC6A 3Q7BA 4ED8A 3AD7C 4XDCA 3W5XA 2ZGYA 2IVYA 4QOTA 3JQKA 2VG7B 1WSJA 5J1EA 1L3VA 2HBRB 5A8WA 2W8LA 4OHVA 1N56A 3BN7A 1FHTA 4RL1A 3CDBA 5I4MA 5LSLA 3OYJA 4CJQA 2AU0A 2XZTB 1P9QC 1UTAA 4IO1A 4E3SA 4DV6F 3H45C 5IT9U 3MM9B 4GKJJ 1XR7A 2MJUA 5LMUK 1HKBA 4RU9A 1NMEB 2RKIA 2X51A 4CJUA 2YXLA 4PXDA 2E5JA 3I56S 2FSNA 4UQGA 3M8SA 2MXYA 3EPGA 2MZ1A 1WKLA 3D0GE 3VQ5A 5BREA 1W7AA 2OMOA 2NXNA 1RT7A 4JI2F 2NYHA 5M1PA 1RXOB 4DV0K 1S6QB 2LQ8A 2MGZB 2ETJA 5AFUA 4ILGB 2V2KA 1N36J 4XAKA 3TAGA 3NDKA 1NBWA 2B56A 3SUNA 2QLXA 2F8TA 1ZAVA 3ILJA 4YDUA 1H7XA 3D68A 1NK0A 1K44A 3EGWB 4CF2A 2EPIA 3CMQA 1H1VA 4NEYA 4GVMA 2UXBJ 5J1PA 3TQ1A 3NGUA 1RDCA 3OL8A 3DDNA 3VQ4A 2KKZA 1TL3A 3UKRB 2XMUA 3IP0A 3V1RA 4PWWA 3QIPB 2YQ0A 4KI6A 1RT1A 1S1WA 1RDWX 2CKWA 1ITPA 1G3OA 3UPFA 3KOAA 5D0EA 1P8ZA 1X9WA 4K4VA 2JC0A 3SFGA 1QLNA 1JK9B 1LW2A 2Y1RI 3NGSA 3EMTA 1MMNA 4FS2A 4YEAA 1U45A 3S7RA 4A2BA 5DZ6A 4Y1CA 5G0RB 1XEZA 3EGNA 1PBAA 4LRAA 1RUSA 4ID8A 3RMAA 1UVLA 2PDAA 1TKXB 4DS5A 2CH6A 4JI5K 3PKYA 2YHYA 4W5TA 2YCHA 4CO4A 1O5JA 3LALA 4QWEA 3BYRA 4IRCA 4CEBA 3V4IB 3AVAA 1RT2B 2XY7A 2Q6BA 3EVWA 1YZ7A 5IOLA 3JS9A 2FPHX 4GW6A 5D3GB 1BLUA 4JV2A 4M5DB 4RW9B 4A5BA 1Q86T 2P8IA 5LY3A 3JXOA 1IBCB 5CYQB 2XCPA 2RIJA 1UVIA 3OYKA 1FDDA 2N7YA 5JVHL 2ZWHA 1CPZA 2NYIA 4O0NA 4MO5A 3HM8A 3P39A 4BQLA 4QU7A 4OVLA 1S6PA 1X4DA 4K2JA 2YWGA 3BBFA 1KAZA 2ACMA 3L7PA 2XZDB 1AYEA 4G1PA 4CJ3A 3KLGB 1WORA 4GO5X 4HHHA 3WC2A 2VG5A 2VV5A 5DO2A 2A6MA 5DQGA 1K9MO 1HWLA 1WLJA 1NPRA 3K7RA 3PV8A 4LT6A 2CUYA 3W0LA 5BR8F 1DJ0A 2VODA 4ZTJA 1VCTA 2C3UA 2RSQA 1FRMA 3N4WA 1FJGK 3GFXA 2WRMA 5A8KB 5HO4A 2B7CB 4X4SA 4LF6K 1P1LA 1QDUB 2HWHA 2B9WA 2B43A 4K4YA 3AVBA 1X0FA 3OUYB 2W25A 5IWAK 5HSPA 5EX3A 2VFRA 1WG5A 5DETA 5C25A 3AHPA 3NWGA 1KN6A 4ES3A 2B8PA 4TXSA 5EU7A 2EFVA 5BPNA 5KAKA 1Q79A 3D6HB 5JS1A 2H9ZA 1S1UB 4OYBA 5KFUA 2X1FA 3ZTSA 4DLGA 3EGVA 3PSFA 3CD6N 3DRYA 4R8UB 4H5WA 5M2RA 4PL8A 2CVIA 3B4MA 3FE1A 3L4QA 1RWUA 2QN6B 1A5WA 3IMQJ 1HNVA 2IVMA 3PNIA 3LANA 3K17A 4Y65A 3ENOA 4NYFA 3L3UA 3L7UA 4NZ0A 1X8DA 1BL3A 4ES2A 4RW8A 3TI0A 1KD1T 5MAOA 1JJ2R 3BEXA 1WSHA