4U67L

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4u67L01
1VQON 1VQNN 3CC7N 3CCJN 1K8AO 1NJIO 2ZJPL 5JVGL 5DM7L 3CPWM 1M90O 1VQPN 5MLCQ 4UY8O 1Q81O 1KQSM 3CCQN 3I56N 1KC8O 3CCLN 1Q86O 3CXCM 1YJ9N 5GAGP 3G71N 3PIPL 3G6EN 3CMAN 4WFNL 3G4SN 1YJNN 1ILYA 1W2BM 5HL7L 4IOCL 1YITN 1QVFM 2QA4N 3PIOL 3CC4N 1VQLN 1Q82O 5GAEP 4U67L 3CCMN 2OTJN 3CCUN 4IOAL 5GAHP 3CD6N 3OW2M 1VQMN 1VQ4N 3CF5L 1VQKN 3CCRN 1K73O 1YHQN 1VQ6N 4WF9L 4IO9L 1VQ7N 1JJ2M 1M1KO 2QEXN 3CC2N 4WCEL 1S72N 1VQ9N 3J7ZO 3CCEN 1OVYA 3DLLL 4WFBL 5JVHL 5H1SQ 3CCSN 2ZJRL 1VQ5N 2OTLN 5DM6L 2ZJQL 3CCVN 1KD1O 1YJWN 1YI2N 1Q7YO 4WFAL 1QVGM 5GADP 3I55N 1YIJN 3CMEN 1K9MO 1VQ8N 1N8RO
chains in the Genus database with same CATH superfamily
3NH2A 3HRGA 4DSIA 1BOTO 2GX9A 3IMXA 3K9KA 4MFBA 4Y1CA 1NM1A 4RW8A 5JVGL 3M6GA 2X74A 1IG8A 3G0ZA 2V52B 3TSUA 3L2WA 2P9KB 1KSPA 3S41A 5FLXO 4W5QA 4CJWA 2E20A 2HBMA 4UY8O 3SK3A 4CF2A 3AARA 3CXCM 4ZHRA 1RBVA 3D0PA 1VSLA 2QTDA 1CXUA 4AQYK 2VG7A 4ISGA 4ICLA 3SPZA 4OKJA 3O6WA 2GELA 4Z4IA 3AGRA 3DLBA 4NXNK 1L3TA 1U2VB 3H1QA 4N56A 1NK7A 4FL9A 2HBLA 4KPYA 4KHPK 1NGEA 4A61A 4FXDA 5F0XA 3CCMN 2YHBA 3AA5X 5AQIA 1ASVA 4BRGA 2E2NA 3QBXA 3SMPA 3VF6A 3ZX0A 4M3WA 4KH4A 4LH4A 3I8BA 4E7JA 2QWQA 1KVBA 4ISEA 3SQ1A 1VQ6N 3O4NA 2P9LA 4AHTA 3DXMB 3ZSXA 1F21A 4F3TA 2CGLA 2RN2A 5AQNA 4KAZA 4CBUA 4Z4EA 2VWKA 3HZ6A 4JN4A 2P9KA 3UIQA 4A2AA 3DLLL 4BREA 1KRPA 4PUOA 3O9TA 1SL1A 3LDOA 2O8FB 3EKUA 3QLHA 4ELUA 4BY9C 1B9DA 2Y1IA 5HP1A 5AQMA 4M42A 3TANA 4IG0A 2JGUA 4MLHA 4DQPA 4JKCA 4PQUA 4DTRA 4CBWA 2PYJA 2RKIA 4LF7K 4A62A 3OYLA 3QEXA 3VQ4A 4BR2A 1X1PA 1K9MO 3VENA 3RSEB 4BC2A 4HVJA 3P5JA 2YHAA 2ITGA 4B1WB 1VQNN 5IT9O 2VQFK 2KZMA 1ZBHA 1KLNA 5BRHA 3HK2A 5FPNA 2B6AA 4LF8K 3SZ2A 4IWVA 2UUBK 1LOTB 4ISFA 3S3OA 2NRWA 4DFKA 1IBMK 4BVPA 3ZSQA 3EO3A 3N4QA 1C0TA 1C6VA 4CEBA 3LDSA 1KQSM 2OZMA 3QERA 2ASOA 4YOYA 1RDWX 4YORA 4GV3A 4LF5K 1BHLA 1OKJA 2XY8A 4CJVA 3G6EN 1D9FA 3AO3A 3DOLA 4FLUA 3CJAA 4YOTA 3QDKA 2HB5A 1SKWA 1QSSA 4OO1J 4CEZA 2HOEA 4GVMA 2O8FA 1NU0A 3LM2A 5ADXH 4DFJA 3NGYA 2ZWHA 3HT3A 3E9OA 1BCOA 1RT6A 2HBJA 3VTIA 5IWAK 2YJFA 1FXXA 3QB0A 3K0SA 2E5LK 1C1BA 5HRSA 4RWTA 1VSIA 3ID8A 3RSEA 4FLWA 3MWTA 4DQ8A 4IO9L 2KQ2A 4A59A 4KH6A 2G8KA 3UB5A 3HOTA 3TAFA 4FJJA 3KK2A 3CC2N 3HJFA 2UYTA 1HX1A 3H46O 3O1WA 3OYGA 3L8BA 4FJ5A 3FFKB 1CZAN 5AZJA 4CF9A 1RT4A 2FSNA 5AQRA 2HNYA 3NF8A 1BA1A 3E9PA 2HHQA 1FK9A 4AM7A 4NCBA 4E3SA 3U9ZA 4CGIA 1NMNA 4J2EA 4CERA 1DEJA 1YI2N 1XC9A 4CGDA 4QS7A 4C8NA 4PL7A 3VETA 3EL2A 4BE0A 5HRPA 1GOBA 3ZSRA 3HOSA 3CMEN 3ZCMA 3HPGA 4HCCA 3N4PA 3I0RA 1VQON 1K8KA 4X64K 5HRRA 5HOOA 4DU1A 4FWQA 4FW1A 1Z6RA 1N33K 1M90O 1C0UA 3W3DA 1BL3A 3IKMA 4X65K 4ZTFA 4CHZA 1HQEA 1RDCA 4RTFD 3PLAA 3SV4A 1TK8A 1S1XA 1GLLO 2IC3A 5AQOA 1D5AA 1A5XA 3K5LA 3KTQA 3PIPL 4NYFA 3T69A 3NFAA 1OH8A 4JI2K 3OYBA 3J80O 3T3FA 4KREA 1ATSA 1NLVA 4IOCL 1VSMA 1RDUA 3DI6A 3FGUA 5EX5A 4BR4A 4AILC 1YF5L 2R7YA 4MDAA 1E4GT 4KFBA 4CJTA 4RW9A 3WQUA 4M3RA 1NKEA 3TU5A 1YAGA 2OPQA 3K59A 3CF5L 1U45A 2O8DB 3BGRA 3FZMA 3FZLA 4IZ9A 1K73O 2H3GX 1ATRA 4ELVA 1S1VA 3P38A 1NJWA 3FZHA 4FJXA 4GMJB 1NGIA 1GLJO 3AA2A 1JJ2M 5TKWA 4BG9A 3F73A 1RBUA 4RW6A 4CW7B 5HBMA 3OYIA 3OJUA 5AQJA 4W5TA 4JV5K 4BG8A 3WNGA 3KWGA 4MQ3A 2FF6A 4GKJK 2VWJA 3FLCO 4H0YB 4KO0A 5AQKA 1ATNA 2X6NA 5AQFA 4H5TA 3J7YP 3KJVA 1GLAG 2P9NB 3NAEA 4BWJA 2HMPA 3A5NC 5K14A 5AQQA 1REVA 4K42A 4H5RA 3H08A 3LP3A 5LY3A 4QAGA 3L2RA 1NWKA 1EETA 4KHSA 4A2BA 4N5SA 1GOCA 3VQ9A 2QKKA 4Z4HA 1SZ2A 2D4WA 4B9TA 4ID5A 4AF1A 2Z1IA 1HKBA 3L0QA 4H5NA 3OBYA 2YCHA 3ZSYA 2OANA 1Y97A 2ZGZA 1EO1A 2O8DA 5MLCQ 3KWIA 2ZQBA 2KHOA 1TYQB 1N5YA 3OYFA 1Q81O 3T1HK 1N36K 1WBBA 3VEWA 4B9UA 1JLQA 3ULEB 4I9QA 5T7BA 4IDKA 3THWB 5DK5A 2HNZA 1QQMA 3DRSA 4JRQA 1JKHA 4DCHA 4MDBA 2NRHA 1J53A 4NYNA 4IFVA 1SKRA 3CIPA 3AA3A 3RRGA 1X3MA 1VQLN 1N34K 4U67L 2DTUA 2P9NA 4YOUA 4CBXA 1CXQA 1VRUA 3RMCA 3LDQA 4BRAA 4G1QA 4UQGA 3OTOK 4DR6K 4PKHA 3HYFA 3VQ7A 4OKKA 2FC0A 3JSMA 1UOCA 4K8ZA 4JEPA 5KI6A 1ZYQA 1KVCA 3GBTA 4C8OA 3K9JA 4JYAK 1HMVA 1TKDA 2QEXN 4WQ5C 1Q9YA 3IRXA 2XHBA 1LV5A 4PA1A 1SV5A 4HCBA 3O5BA 5M1OA 4BRPA 4TSXA 2F8TA 3M8PA 3TSQA 4B3SK 2IS3A 2RE2A 3PUFA 5C2FA 2DFEA 2FBTA 5BPLA 1IKVA 2WBNA 2Z1JA 3ATVA 1JLGA 3OYEA 1YXQA 3KK3A 4DV0K 1IO2A 1T44A 1QTMA 4DTXA 3GE1A 4IG3A 3ULEA 2NRXA 3LZJA 4NB4A 2YKMA 3QESA 4DF8A 3O4QA 3WQTA 4FM0A 1NKBA 1QVGM 3RRHA 5E84A 1LWCA 2D0OA 1J5EK 5KQ8A 4B1VA 1CZ9A 2WUSA 4FLVA 1R59O 3LANA 3SQ0A 3F9MA 3H1VX 1XHXA 3NE6A 4M63C 3L3UA 2WONA 4FVMA 3VQ6A 2ZM6K 3PX0A 2O4IA 5J2PA 1RILA 3OYHA 1JCEA 3NF9A 4F3OA 1NMDA 3NH1A 2OYQA 2VYPA 3QICA 2E88A 4DR5K 1T03A 4KB1A 5CYMA 2YHWA 4FYDA 3QMLA 3AO1A 1IKWA 3CYMA 3KD5E 3EY1A 5CYQA 4DSFA 2Z1HA 3CERA 3ZT1A 1S9GA 5D3GA 4OVLA 3TTFA 4M3ZA 2Z1GA 2XY5A 4CHYA 5LL6Z 5FRNA 4DQIA 4BRDA 3ZX3A 1HPZA 1SUQA 3RVCA 2V7YA 4LF6K 3NHGA 3P4IA 3HBTA 4A5BA 1HLUA 3C6AA 4BVOA 1NGFA 4DUYK 3M8RA 4KTWA 5M1FA 3ZX2A 4V19S 1W97L 2YHXA 4FWLA 4CFDA 2Q0UA 3QEPA 5BPNA 3IG1A 2V7ZA 2XY6A 1TK5A 1Z25A 4CGJA 1IH7A 4KI6A 4DV2K 3VQEA 4CJ3A 3EEQA 1SL2A 3I33A 1A5VA 1WUAA 1ZBUA 1UAXA 3QEVA 3VESA 3IS9A 3MDQA 3I55N 4FM2A 4FJ7A 1KAXA 4O8KA 5HRNA 3HTVA 2GUIA 2ZE2A 1K6YA 4M3TA 3R8EA 3C7NB 3VQQA 4FJGA 2RF2A 5FRMA 3GL1A 4JLHA 1RDAA 1QQCA 4FWRA 1W9HA 1T05A 4HTLA 2A41A 1BUPA 1FJGK 4Q5VA 3R9PA 1NK9A 4Q0BA 2OPRA 3I0SA 5BR8K 2QW9A 1KC8O 4CFCA 4GV9A 4DB3A 3G71N 2P9LB 4BRFA 4KTQA 1KFDA 2G8VA 1HRHA 1HNIA 3KKRA 4JI5K 1WAFA 1WBDA 3ZETB 5FDLA 1L5UA 1QVFM 2A1RA 3C94A 1WOQA 5J2QA 1NOYA 3VF4A 3CHWA 4ID1A 2D1KA 3CFRA 1OH6A 4LFBK 2G8HA 4IOAL 5JS2A 3W0LA 4HTUA 1KTQA 2QWNA 1S1UA 5AR0A 2P1JA 3K2PA 2D0CA 4FM1A 3PX6A 3IUCA 4FWKA 1GLDG 5FROA 4FJMA 4L8RB 3CI5A 3HO1A 3C7NA 3M8SA 3SNNA 2I7PA 3O08A 3AY9A 4OPAA 1RT7A 3PO4A 5C24A 2QI2A 1C1AA 3A5MC 4CZGA 4KB0A 4JK9A 3V1OA 3U6FA 1RT1A 3SUPA 5SZTA 2PYLA 1WAJA 1EKEA 3F5TA 3NBPA 1HPMA 1TGOA 3L2VA 4O8UA 4CJ4A 3OY9A 5GADP 3OS1A 3H3OB 3O3HA 3ZETA 4CJ5A 1LCUA 4JKGB 4Z4CA 4FOEA 4B9NA 4KHQA 3BUZB 4XEIA 4BE2A 3NGZA 4R5PA 4Z94A 2UUCK 1MWMA 3M1FA 2JLEA 4M45A 3TTCA 5JLFA 1J6ZA 1BQMA 2P9PB 1VQPN 2HVHA 2ETJA 2O8CB 2O8EB 1HNVA 3NH0A 1XMOK 5FPDA 2F7TA 2JWKA 2E2PA 4B9MA 1QQOA 1X9JA 3ALYA 4H4OA 2QWRA 5AQVA 3V81A 3QIPA 1YJNN 2IDOA 1WSGA 3OYJA 1RBSA 3L3VA 3CM6A 5AZJB 5AQZA 3ZLJA 3I8DA 1QSLA 3ASMA 1KCFA 4DTOA 1S6QA 2D0AA 4W5NA 3TAMA 3C95A 4KHWA 1HYVA 5GAHP 4BE1A 1QHTA 3MN5A 4FWMA 1YHQN 2KFNA 4JKGA 5FPMA 2A5XA 2NLXA 3SLCA 1I39A 3DLEA 4I2QA 3V4IA 4CD1A 4B3RK 4AHVA 4IJNA 3DMJA 4LH5A 4CJFA 3DRRA 4OGCA 3DAWA 4M3YA 3L4QA 1S72N 3ZT3A 3VQPA 4CEEA 4E1JA 2P9PA 4CHOA 1K8KB 4CJLA 2O8CA 2O8EA 1DGKN 3CCSN 3QFPA 3WXJA 2F9WA 4PL8A 4CJUA 1KVAA 3VTHA 1BG3A 1BO5O 1VSDA 1SKSA 3BDPA 3AO2A 1KLMA 2YHYA 3D2FB 3E9LA 1LAWA 3LP0A 4BDZA 4H0VB 4K25A 1EQYA 1N6QA 3V9SA 2GBZA 3LP1A 2XRIA 3OYCA 4FJ9A 2HHHK 5AFUA 5C10A 3O3GA 4H8KA 4W5OA 1E3MA 4BRLA 1N8RO 1X9MA 3LZIA 3NF6A 1IJJA 1NGDA 3QETA 1BIUA 5DMRA 3MEEA 3EZWA 5ELZA 4LSLA 1EWRA 4WQ5A 4CJEA 4C8LA 4IJAA 2DFHA 3CJ7A 5AJ3K 2LSNA 3TWHA 1MU2A 5AQWA 4BRIA 3U9DA 1A5WA 4FWSA 4CJ7A 2KW4A 4C8KA 3OS0A 3LPUA 4FO0A 4BC4A 3VPZA 4H0XB 2PBDA 2YNHA 1TAQA 3E1YA 3C6TA 1C1CA 4QS9A 1RTIA 1WSHA 1DTQA 1UWBA 4PY5A 5F2RA 4CHNA 3D2EB 4JI4K 3HXMA 3D2FA 1RT5A 2CGKA 3TAQA 3SMSA 3AVGA 1EX4A 5M1KA 3VOVA 2VQEK 2NNWA 1J54A 2GTDA 4W5RA 3MXMA 4HUFA 3KLIA 2IVOA 3MN7A 1ZBSA 1JCFA 3O9QA 2FF3B 1S22A 4BQLA 4WF9L 5AQUA 1HNXK 5EVZA 1O13A 5AQYA 4F9OA 5J2NA 2QWMA 2J4RA 1BA0A 1TAUA 4CZIA 1VSHA 3TSPA 5LMUK 1OH7A 5BREA 3L2UA 4DUZK 3F9KA 5I42A 1L3SA 4BQZA 4JAXA 4O0IA 5GIOA 2G8IA 4C23A 3ZSOA 1BI4B 1Y64A 3CJ1A 1SS6A 4JKEA 4DU4A 2Q0RA 2EWSA 4CJSA 3B6OA 3U3GA 2I5JA 1Q7YO 3NCIA 3J7AP 3HSTB 3MX5A 4IDHA 2QK9A 5C15A 5C25A 4H5WA 3D2EA 1TL1A 1D8YA 4LFAK 1RT2A 4B08A 4LF4K 3VQ5A 3CC7N 4GW6A 2A3ZA 3JS6A 3BP8A 1XC3A 4KV8A 1TKXA 3S9HA 4ILGB 4E7IA 1NGJA 3D7EO 3CPEA 4EHUA 1DT9A 2E6LA 5KQDA 3AVJA 3QEWA 5CHIA 1QHAA 1NK5A 4Z4GA 1XUPO 3CCQN 1Z26A 1XMQK 2O8BB 5CZ1A 4DR4K 3R1XA 4YFUA 4WFNL 3OYMA 3KHYA 2NRVA 2QXFA 2E1YA 3VMFB 4HHTA 3HPOA 3IDHA 1BI4A 4O0JA 1S9EA 4F2SA 4WQ4A 3AGKA 3SUQA 2KTQA 2EHGA 4E0DA 3SBGA 1XHZA 4E7HA 4CGFA 3L6QA 2PY5A 3VA0A 4KH5A 2YX6A 2Y1JA 2BH1A 4F8RA 4KHYA 2HVIA 3ZSWA 2VG5A 1VQMN 4CIFA 4CZEA 1VQKN 3OYKA 3KLGA 3HPHA 3WEEA 2OPPA 1ASWA 4DLGA 3DYAA 3HSCA 5CR4A 3BZKA 2O4GA 3DLKA 4CZHA 4E7LA 4K43A 1ESVA 1B92A 1M1KO 1GLEG 4FZZA 4CF0A 1BWFO 4CEAA 3CCEN 3WT0A 4C1NK 4DSEA 3M5RA 1S1WA 5BPMA 1DKGD 1HKGA 3MX2A 2O8BA 3CFPA 4H0PA 3JYTA 2E1ZA 4M3XA 1O1WA 1NJYA 5KRSA 3VEZA 1G15A 1QE1A 1ZBIA 3D45A 1NGGA 4H03B 5CZ2A 4LY7A 3O8MA 1VK0A 4YDUC 5J1EA 3RMBA 3EKSA 4BRNA 5AQTA 2HBKA 3ISNC 5BN8A 4Z4FA 3AVBA 3LPTA 1IKXA 3CJ9A 3TPQA 3TAPA 3CCJN 3B8AX 1U4BA 3VN5A 5AZIB 2YNFA 3SAFA 2ZJPL 4CJQA 4JI8K 4FW2A 3FE1A 4IFEA 2PAVA 3KVGA 4JI0K 3CJCA 4BRCA 3MCAB 2A42A 4XH1A 4NXMK 4CF1A 1NKCA 4CJRA 4J2DA 3LDLA 1TUYA 4CZKA 1Q86O 1QZ5A 1YVNA 3P83D 4M41A 3VQBA 1NK8A 5AQGA 5AQHA 3HP9A 2HHUA 3CMAN 4GNIA 4WE1A 4DLEA 3GG4A 3AVHA 3P31A 1JLAA 2QA4N 3V9WA 1FKPA 3E01A 1D4XA 1NGHA 3HI0A 2AA4A 5E41A 3L4IA 3AVFA 2HW3A 3KK1A 3KZBA 3ITHA 3CD6N 3C65A 2E4LA 1BGXT 4FJHA 3K5OA 4O5FA 1WSFA 3O4WA 4AHUA 4EZ6A 3SPYA 4OPJA 2GWJA 2P51A 5AFUH 2Q97A 5KPTA 3JAMO 4FJKA 5AZIA 1S5JA 3EN9A 3CETA 4B1ZA 3U4LA 4I2PA 5BN9A 3DWLA 1P8ZA 1NGBA 4FSVA 4E89A 2ZJRL 2VGMA 4E1NA 1E4FT 2QWLA 1CLQA 4J2BA 1SQKA 1V4SA 3KD1E 4CI6A 1VSFA 3WNFA 4O44A 4CJKA 1RTJA 4DR3K 3U8XA 1EXQA 3PX4A 2A6AA 4EAHD 4R79A 1I94K 4MO4A 4ILHA 2F9TA 1QZ6A 2W6LA 2A40A 5B8HA 1YT3A 4CEOA 1HNWK 1VAZA 4H5VA 3AV9A 4JK7A 2BTFA 3ZEUB 5M1NA 3VQ8A 3VEVA 4YOWA 3OYDA 3SYZA 1ZBLA 4GVEA 5KGWA 3RMDA 1NJIO 4DTMA 3K5NA 4CF8A 2D0PA 4DFMA 4EFHA 3SAHA 3AVMA 3PO5A 5I3UA 1NK4A 2WFBA 3T19A 1Q9XA 4L3QA 3THXB 4WQ4C 4DSLA 2IOCA 3AAQA 1MA9B 1V4TA 5KPZA 3SQ4A 3LAMA 2P9SB 5JLHA 1KXPA 1ITGA 1TKTA 4B8AB 1TL3A 2ASPA 3OA9A 2DY4A 4G9ZA 2W6KA 2WC9A 2G8WA 1JLCA 4N47A 3A0IX 2G8FA 2ZGYA 3KLHA 2W40A 4B3TK 1ZBFA 3PV8A 1G99A 1MWKA 3NDKA 3ENBA 2OA8A 4B3MK 3ZEUA 4DSKA 4C8MA 3ENHA 5KTQA 2OZSA 3OYAA 4FWOA 3RMAA 4KBOA 4DFPA 4DR7K 4GKKK 1VQ9N 4DTSA 3SCXA 1RNHA 1OVYA 1H1VA 3E66A 4FLZA 3AVCA 5JVHL 4PWDA 1WSJA 1OH5A 4JRPA 5AQLA 4DV5K 2NZTA 3MCPA 1TKZA 3THXA 4CCHA 5F1XA 2QXLA 2RPIA 4B8CA 4IKFA 1NBWA 3FZKA 3BF3A 4F4KA 5J2MA 5C2DA 2KFZA 3KKSA 1XQSC 3F2KA 4DS4A 2P9SA 5LMNK 2A1SA 4XIUA 4AH9A 4GY2B 4EP4A 5M1PA 3RR7A 2HHVA 3THVA 2FBYA 4OJRA 3LWMA 1S3XA 4DV3K 3ZSVA 4M7YA 2IIRA 1HNZK 1RDDA 4DV4K 1RBRA 5KRTA 1U48A 1S1TA 2WOMA 3PSIA 3H45C 3DXKB 3VQDA 3QNNA 3CPWM 3GOIA 4BRMA 1SL0A 4IFYA 2E2OA 1N32K 2QM1A 3S3NA 2W42A 4I9LA 2E8AA 3TAGA 2B4JA 3OHRA 3J81O 1YTUA 4BR0A 4JHDB 4HUEA 3CG7A 4CZLA 3TARA 2QWOA 4DWIA 3AVIA 4OPHA 2E6MA 1TK0A 1LWFA 3O9RA 4JD2B 5HL7L 3HVTA 3KLEA 4NLBA 3EYZA 3QO9A 1B9FA 2YI1A 2QWPA 1YUWA 4RW7A 1J9AA 2JWLA 4OGEA 3CM5A 1JCGA 3CQ8A 4DQSA 4JI3K 4JNEA 3SUNA 3OW2M 3EE9A 4K8XA 3LWLA 3NVKA 4JI7K 2P9UB 4YHHK 5BRFA 3MEDA 1W0HA 3A2FA 4N41A 2Q1NA 4J8FA 3SV3A 1NG9A 3BF1A 5EXWA 3V1QA 2NRZA 3U3YA 3QIOA 2NRTA 3DXKA 1U2VA 3KIOA 2NRRA 1JLBA 3CFOA 4FLYA 5C12A 1YTAA 2GEMA 2OTLN 5DM6L 4YOVA 2ZJQL 1KAYA 4FWNA 3MN6A 4FJLA 4JHDA 4O5BA 1EWQA 1T6CA 4OPKA 4LD0A 4LF9K 3FR0A 4KTZA 4CIEA 4JD2A 3DXMA 1U49A 2FSJA 3LL3A 4XH5A 3C6HA 4QS8A 4IEIA 1BCMA 1BU6O 3WNEA 4CHQA 4FCYA 3G10A 4EIAA 3AA4A 3V1RA 5HLFA 3HVRA 1CZBA 3PSFA 1IG9A 4H0OA 4YOXA 1GOAA 1X9SA 1LWEA 5DM7L 3A5LC 3ZYYX 4BC5A 2P9UA 3ZT2A 3DLRA 5E26A 3AO5A 1T6DA 4M7XA 4K41A 4DSJA 4YY3K 1I3AA 4NCGA 4E1MA 4B9SA 3CCLN 4NO7A 3ZSZA 4CFBA 4PHTX 2HF4A 3ZT4A 5GAGP 1VSJA 2Q31A 3C0BA 1HUXA 1C0GA 3J8AA 3G4SN 1NGCA 1HR0K 4FK4A 4YDUA 4I6MB 1RTDA 3KK7A 4FZYA 4IXCA 2FLOA 1BQNA 3SBTA 4DF4A 3WNHA 4DR1K 2D5RA 1NJZA 2VGNA 4NLCA 1RCHA 1DLOA 2BUPA 4BACA 4FJNA 1S6PA 1LAVA 5CY4A 5AQPA 4A5AA 1LW2A 3ENOA 5EOYA 4KRFA 3LDNA 4DV6K 3UKUB 1ASUA 3OBWA 2E2QA 4BR5A 4FLTA 3O1BA 4HWIA 3M3ZA 5LJVA 4EZ9A 2YKNA 3VEXA 4B3OA 1TVRA 4CESA 4WFBL 4JKHA 4N76A 4CGGA 4DS5A 4JS4A 4BGBA 2Q3SA 4B1XB 4B9VA 1NK6A 1QSYA 1KD1O 4OKEA 4DQRA 4AM6A 4CZFA 3V9UA 3M8QA 3AVKA 4CEQA 3DM2A 4KHUA 3WXMB 4I6MA 4BDYA 4DG1A 2YNIA 4OX9K 4KHNA 2VWBA 3SJJA 3TI0A 2HF3A 3AO4A 3NMUA 3SQ2A 2WTUA 5EY4A 4FK0A 4FVUA 3QEIA 2BGGA 4DV7K 1FKOA 2YV0X 3C6UA 3R6MA 4CK3A 3VF2A 4OLBA 2ASMA 4JKFA 1GLFO 1RGIA 4JS5A 1OVQA 3TAEA 1VHXA 4HUGA 4RCHA 4BROA 1L3VA 4H0TB 3LAKA 4DQQA 4B1UB 4NCAA 3SJHA 5C42A 3Q7BA 2FXUA 3VEYA 2P9IB 3UKUA 5I9EB 2HHTA 4Y1DA 5BRDA 1NOZA 3VGKA 3DLHA 1UA1A 1QS4A 3UKRB 3QNOA 3NGIA 3AVAA 3OYNA 3OVNA 3WEEB 1U04A 1JL1A 2CH5A 3GDQA 1HQUA 2BE2A 3MK6A 3K58A 3ULDA 2GV9A 4CK1A 4ZTJA 5AQSA 2KKZA 3SAGA 1ZC6A 3LM9A 4IEEA 5GAEP 4C1NI 3DRPA 4AHRA 1WN7A 1IV0A 1RDBA 4U7BA 4ELTA 3H6EA 1IBKK 1Z05A 2VG6A 4KKOA 3ID6A 5BR9A 2UXDK 2I7NA 2VCPA 3VQAA 2XY7A 1P90A 4B9LA 4RG8A 2UXBK 4DR2K 1WSIA 4KI4A 3RR8A 3BEXA 5FPEA 4JI6K 3BZCA 4JI1K 3CQXA 4DTUA 1BISA 2DPNA 3J7ZO 3P1GA 2IVPA 4CGHA 3MEGA 3A5OC 4JK8A 5H1SQ 2P9IA 3D6RA 1VSEA 3RTVA 1R0AA 4FWPA 2FSKA 1QQNA 4AHCA 4OLAA 3UKRA 4H4MA 4CJPA 2ITMA 5GINA 3WUHA 2V51B 1EP4A 1J5OA 3T7ZA 3T1AA 4BR7A 3A8YA 4DU3A 1JLEA 3AVNA 1LW0A 2GWKA 4GV6A 3O9UA 3PIOL 4CVNE 5C0YA 4ILJA 4JKBA 3BY5A 3UE5A 3QBWA 4XH4A 4DTNA 1NNEA 4RW4A 2UU9K 3HL8A 3G25A 5A2QO 4QCLA 2EX3A 4Z0UA 2G8UA 1XWLA 3MXJA 1XNRK 1HYSA 2YNGA 4MO5A 2UXCK 3L2QA 1UA0A 2ZF5O 3RWUA 1HKCA 2X78A 3CQYA 4DMNA 3MECA 4CK2A 2IVNA 3DJCA 3LP2A 4BR9A 3P39A 4BDPA 1YJ9N 3HP6A 4O4GA 1WLJA 5TKYA 3FZFA 4LFCK 2PFUA 3VGLA 5SWMA 1ILYA 1W2BM 4CZMA 2ATQA 4K0KK 3VQCA 2CH6A 4JKDA 4CEDA 1ZXOA 2FBVA 2IGIA 3T1YK 3CC4N 1HJRA 3ZT0A 5GIPA 3MN9A 2PZSA 5KGXA 1TYQA 3WXIA 2OPSA 2Q2RA 1JXBA 1FW6A 2KZZA 2X6SA 1RFQA 3VGMA 2B5JA 3OS2A 3ATUA 1IBLK 3QFUA 1YVUA 3TABA 4QOZB 4PKGA 1NJXA 5JICA 1VQ7N 3THWA 4FPBA 1X9WA 2W41A 3VERA 3LALA 3MXIA 1T8EA 4LC9B 5KPRA 3WXKA 4I7FA 5ADXA 5CE3A 1W7AA 3MWPA 5LJWA 1WSEA 4FK2A 3R3LA 4MLEA 3LDPA 3WXLA 3AAPA 3DLGA 4DV1K 3HM8A 3NVMA 1VQ5N 3IFRA 3TR8A 1TV6A 2CGJA 4BRQA 3CCVN 4AHSA 1X3NA 1BDGA 3V6DA 1YJWN 3VA3A 3PY8A 4DKWA 1DTTA 4M3UA 1KFSA 3TTDA 3EE8A 1IKYA 3MAQA 2AJQA 1Q8IA 2DFFA 4YNQA 4CE9A 2AP1A 4E7KA 1YIJN 4IO8A 4CD3A 4CZJA 3H3NO 1JL2A 5HROA 3IAYA 2QKBA 1WB9A 2ZD1A 3FFIA 1RTHA 3V9XA 2GUPA 4JKAA 1VRTA 3THYB 2HSTA 3Q7CA 4FOIA 1U6ZA 1K8AO 1GLCG 2BDPA 2NUBA 2P5OA 2OCEA 3HM9A 2XO7A 4FPAA 2UUAK 1JXEA 2HHXA 2F8SA 3DOKA 2F4VK 3AVLA 4WYBA 1XI1A 4F2RA 4BRHA 3I56N 4DTJA 4LSNA 1U47A 5AQXA 3SUOA 3MMVA 4A57A 2KLAA 1KAZA 3EZ5A 2HHSA 3CJBA 2HHWA 1BIZA 1RBTA 1XNQK 1TUUA 3NF7A 4B9QA 4BRKA 1HJOA 2Q36A 2HNDA 4CEFA 1YITN 4X62K 4PKIA 2IAJA 3VEOA 2F96A 4DHYA 4BWMA 3K57A 1Q82O 2OTJN 3QINA 4FJ8A 5M1QA 3CCUN 4B1YB 4Y0WA 3O9SA 1HYZA 4CECA 1L3UA 1VQ4N 1T7PA 3CCRN 4X66K 1JLFA 3THYA 1NK0A 4J2AA 4O55A 1Q18A 2YJEA 4FJIA 5JS1A 3O80A 1GLBG 4IBNA 3S3MA 1C0MA 3KLFA 2RHKA 1NGAA 5EU7A 4BGAA 4WCEL 3B6PA 3V9ZA 1VSKA 5JMVA 2BANA 3O3FA 3K5MA 4CHPA 4CIGA 4FLXA 2HMIA 1RT3A 4IOXA 3SI6A 4EP5A 4FZXC 4EHTA 1D9DA 3JXUA 4WFAL 4BC3A 4E19A 1SAZA 3OJSA 1WNSA 2FBXA 4DTPA 4CFAA 1MDUB 1C0FA 1T3VA 2P5GA 2D0BA 1VQ8N
chains in the Genus database with same CATH topology
3HRGA 4H5WA 3D2EA 5KQ8A 4IEIA 4B1VA 1BU6O 2WUSA 1BOTO 1R59O 3F9MA 3CC7N 4EIAA 3H1VX 2GX9A 3IMXA 2A3ZA 3K9KA 3JS6A 4H0OA 1NM1A 4YOXA 4M63C 5JVGL 3M6GA 5DM7L 3A5LC 3ZYYX 4BC5A 3BP8A 1XC3A 1IG8A 4ILGB 2V52B 2P9UA 3TSUA 1JCEA 1NGJA 2P9KB 3D7EO 5E26A 1NMDA 3S41A 3CPEA 4EHUA 1T6DA 4M7XA 1DT9A 5KQDA 4K41A 2E20A 2HBMA 2VYPA 4UY8O 3QICA 3SK3A 1QHAA 2E88A 5CHIA 1XUPO 3CCQN 3AARA 2YHWA 3CCLN 3QMLA 4NO7A 4PHTX 3CXCM 2QTDA 2HF4A 5GAGP 4ISGA 2Q31A 3C0BA 3R1XA 1HUXA 1C0GA 3J8AA 4QS8A 3O6WA 4WFNL 3KHYA 3G4SN 2NRVA 1NGCA 2E1YA 2GELA 3CERA 3VMFB 3AGRA 4YDUA 3IDHA 4I6MB 3TTFA 1U2VB 3H1QA 4WQ4A 3KK7A 3AGKA 4IXCA 4FL9A 2HBLA 2FLOA 3SBTA 1NGEA 4A61A 3SBGA 4BRDA 2VGNA 4NLCA 5F0XA 3CCMN 3ZX3A 3L6QA 5AQIA 4BRGA 2BUPA 2E2NA 3QBXA 3SMPA 4KH5A 3VF6A 3ZX0A 2YX6A 3RVCA 2BH1A 2V7YA 4KH4A 1VQMN 5AQPA 4A5AA 3I8BA 4CZEA 1VQKN 2QWQA 4ISEA 3P4IA 1VQ6N 3ENOA 5EOYA 3HBTA 4A5BA 3WEEA 2P9LA 3LDNA 1HLUA 3C6AA 3HSCA 4BVOA 5CR4A 3DXMB 3UKUB 1NGFA 3OBWA 4CZHA 2E2QA 4K43A 4BR5A 1ESVA 5M1FA 1M1KO 3ZX2A 1W97L 1GLEG 2CGLA 2YHXA 3O1BA 3M3ZA 4FWLA 4HWIA 5AQNA 2Q0UA 5LJVA 5BPNA 4CBUA 1BWFO 3VEXA 2V7ZA 3CCEN 3WT0A 3HZ6A 4C1NK 4JN4A 2P9KA 3M5RA 4A2AA 3DLLL 4WFBL 4JKHA 4BREA 5BPMA 1DKGD 1HKGA 3O9TA 3MX2A 4BGBA 3I33A 4H0PA 3LDOA 4B1XB 2E1ZA 3EKUA 1KD1O 4BY9C 3VEZA 4AM6A 1WUAA 4CZFA 5AQMA 1NGGA 4H03B 3VESA 4MLHA 4JKCA 3WXMB 4CBWA 3O8MA 4I6MA 4A62A 3MDQA 3I55N 4YDUC 4BR2A 2VWBA 3EKSA 4BRNA 2HF3A 3VENA 1K9MO 3NMUA 1KAXA 5AQTA 2HBKA 4O8KA 3HTVA 5EY4A 3RSEB 4FVUA 4BC2A 5BN8A 3R6MA 3VF2A 4B1WB 1VQNN 2ASMA 3CJ9A 4JKFA 3TPQA 5BRHA 5FPNA 1GLFO 1RGIA 3CCJN 3B8AX 3R8EA 5AZIB 3C7NB 3SAFA 2ZJPL 4RCHA 3GL1A 3FE1A 4IWVA 4IFEA 1LOTB 4BROA 4ISFA 4FWRA 2NRWA 4H0TB 2PAVA 3KVGA 4HTLA 2A41A 1BUPA 4BVPA 3EO3A 4B1UB 3N4QA 3CJCA 4BRCA 3MCAB 2A42A 4XH1A 3SJHA 3Q7BA 2FXUA 3R9PA 3VEYA 2P9IB 3UKUA 3LDLA 5I9EB 1KQSM 1TUYA 2ASOA 2QW9A 4CZKA 4YOYA 1RDWX 1KC8O 5BRDA 1Q86O 4YORA 1QZ5A 3VGKA 1YVNA 4GV3A 3UKRB 1OKJA 4GV9A 5AQGA 4DB3A 3G71N 5AQHA 3WEEB 3G6EN 2P9LB 4BRFA 2CH5A 3CMAN 4GNIA 3CJAA 3GDQA 4YOTA 3QDKA 3MK6A 3GG4A 3P31A 4OO1J 3ZETB 2HOEA 3LM2A 5AQSA 5ADXH 2QA4N 1QVFM 2KKZA 1D4XA 1WOQA 3SAGA 1ZC6A 2ZWHA 1NGHA 3LM9A 3HI0A 4IEEA 2AA4A 5GAEP 4C1NI 3E9OA 3VF4A 3VTIA 3L4IA 2HBJA 3CHWA 2D1KA 4U7BA 2YJFA 3H6EA 3KZBA 3QB0A 4IOAL 1Z05A 3C65A 3CD6N 3W0LA 5BR9A 3ID6A 2I7NA 2QWNA 2VCPA 5AR0A 4RWTA 3ID8A 4O5FA 3RSEA 3O4WA 3MWTA 1P90A 4DQ8A 3IUCA 4FWKA 4IO9L 1GLDG 2GWJA 3BEXA 5AFUH 5FPEA 2Q97A 3CI5A 4A59A 5KPTA 4KH6A 5AZIA 3C7NA 3UB5A 3EN9A 3HOTA 3CQXA 2I7PA 3O08A 3AY9A 4OPAA 3CC2N 2UYTA 3CETA 2DPNA 1HX1A 3H46O 3O1WA 4B1ZA 3J7ZO 2IVPA 3FFKB 2QI2A 1CZAN 5BN9A 3A5MC 3U4LA 3DWLA 4CZGA 5AZJA 2FSNA 3A5OC 1P8ZA 4JK8A 5H1SQ 4JK9A 1NGBA 4FSVA 2ZJRL 2P9IA 2VGMA 3D6RA 5AQRA 4FWPA 1E4FT 2QWLA 2FSKA 1BA1A 1QQNA 3E9PA 4AM7A 1SQKA 1V4SA 3UKRA 3U9ZA 4CI6A 3F5TA 1DEJA 2ITMA 5GINA 1YI2N 3WUHA 2V51B 1HPMA 4O8UA 4QS7A 4PL7A 3T7ZA 4BR7A 3U8XA 3VETA 2A6AA 3A8YA 3EL2A 4EAHD 5GADP 4R79A 3H3OB 2GWKA 4MO4A 4GV6A 3ZETA 4ILHA 3O9UA 3HOSA 3CMEN 2F9TA 1QZ6A 2A40A 5B8HA 3PIOL 1LCUA 4JKGB 3N4PA 4FOEA 1VAZA 3BUZB 4H5VA 4ILJA 4XEIA 5C0YA 1VQON 4JKBA 2BTFA 4JK7A 3ZEUB 3UE5A 4Z94A 3VEVA 1K8KA 3QBWA 4XH4A 5M1NA 4YOWA 1MWMA 3M1FA 4GVEA 3G25A 1NJIO 5HOOA 3TTCA 5JLFA 1J6ZA 2D0PA 4FWQA 1Z6RA 4EFHA 2P9PB 1VQPN 1M90O 3W3DA 3SAHA 3IKMA 4MO5A 2ZF5O 2WFBA 1HKCA 4RTFD 3CQYA 3PLAA 5FPDA 4L3QA 1GLLO 2F7TA 2JWKA 2IVNA 3DJCA 5AQOA 4BR9A 2E2PA 4WQ4C 3P39A 1QQOA 1X9JA 1YJ9N 3AAQA 1MA9B 5TKYA 3PIPL 3FZFA 3T69A 2PFUA 2QWRA 1V4TA 5AQVA 3VGLA 5KPZA 1ATSA 1YJNN 1ILYA 1W2BM 2P9SB 4CZMA 1NLVA 2CH6A 4IOCL 4JKDA 5JLHA 1KXPA 1RDUA 2ASPA 3FGUA 3OA9A 1ZXOA 5EX5A 4BR4A 4G9ZA 2WC9A 1YF5L 5AZJB 5AQZA 3CC4N 5GIPA 3MN9A 4MDAA 1E4GT 3A0IX 2ZGYA 1TYQA 3WXIA 2Q2RA 3WQUA 2W40A 5GAHP 1RFQA 3TU5A 3VGMA 1YAGA 3CF5L 3FZMA 3MN5A 1G99A 3FZLA 4FWMA 4IZ9A 3ATUA 1YHQN 1K73O 1MWKA 4JKGA 5FPMA 3QFUA 2H3GX 2A5XA 2NLXA 3SLCA 1ATRA 3ENBA 4PKGA 3P38A 3ZEUA 3FZHA 5JICA 1VQ7N 4CD1A 1NGIA 1GLJO 4FPBA 4IJNA 1JJ2M 5TKWA 2W41A 3VERA 3ENHA 4BG9A 4FWOA 3DAWA 4KBOA 4LC9B 3L4QA 5KPRA 1S72N 3WXKA 1VQ9N 4E1JA 5ADXA 2P9PA 1OVYA 5AQJA 1H1VA 3E66A 1K8KB 5CE3A 3MWPA 5LJWA 5JVHL 1DGKN 3CCSN 3QFPA 3R3LA 4MLEA 3LDPA 4BG8A 3WXJA 3WXLA 3AAPA 3HM8A 3KWGA 3NVMA 2F9WA 4PL8A 5AQLA 3IFRA 1VQ5N 2FF6A 3VTHA 2NZTA 1BG3A 1BO5O 3FLCO 2CGJA 3MCPA 4H0YB 4BRQA 5F1XA 3CCVN 2QXLA 5AQKA 1X3NA 1ATNA 5AQFA 1BDGA 1NBWA 2YHYA 3D2FB 3E9LA 4H5TA 3FZKA 1YJWN 4H0VB 4K25A 1EQYA 1GLAG 3BF3A 4DKWA 5C2DA 2P9NB 3TTDA 3EE8A 1XQSC 3F2KA 2HMPA 2P9SA 5AFUA 5C10A 2AP1A 3A5NC 1YIJN 4IO8A 5AQQA 4CD3A 4K42A 4CZJA 3H3NO 4H5RA 4GY2B 5M1PA 4BRLA 5LY3A 1N8RO 1NWKA 4A2BA 1IJJA 1S3XA 2GUPA 4JKAA 2HSTA 4M7YA 1NGDA 2IIRA 1SZ2A 2D4WA 3Q7CA 4FOIA 1U6ZA 4AF1A 1K8AO 1GLCG 3EZWA 5ELZA 1HKBA 3L0QA 4H5NA 4WQ5A 3OBYA 2YCHA 3H45C 3DXKB 2OANA 2ZGZA 4IJAA 3CPWM 3GOIA 1EO1A 4BRMA 3CJ7A 4FPAA 5MLCQ 3KWIA 2KHOA 5AQWA 1TYQB 4WYBA 2E2OA 1Q81O 4BRIA 3U9DA 2QM1A 2E8AA 4BRHA 3I56N 3OHRA 4FWSA 5AQXA 4CJ7A 3MMVA 4A57A 2KLAA 1KAZA 4JHDB 3VEWA 4BR0A 4FO0A 3CJBA 4CZLA 4BC4A 3ULEB 2QWOA 4H0XB 3VPZA 2PBDA 4OPHA 3E1YA 1TUUA 4B9QA 3O9RA 4JD2B 1HJOA 1QQMA 2Q36A 4QS9A 4BRKA 4DCHA 4MDBA 5HL7L 2NRHA 4NLBA 1YITN 5F2RA 4PKIA 2YI1A 3CIPA 3D2EB 3VEOA 4DHYA 1X3MA 3D2FA 2QWPA 1YUWA 1VQLN 2JWLA 2CGKA 3SMSA 1Q82O 2OTJN 4U67L 2P9NA 4YOUA 5M1KA 5M1QA 4CBXA 3VOVA 1JCGA 3LDQA 3CCUN 4BRAA 4B1YB 4JNEA 2NNWA 2GTDA 3OW2M 4Y0WA 2IVOA 3O9SA 3EE9A 1ZBSA 3MN7A 1VQ4N 4PKHA 3NVKA 1JCFA 3CCRN 3O9QA 2FF3B 2P9UB 1S22A 4BQLA 4WF9L 5AQUA 5BRFA 4JEPA 5EVZA 1O13A 5AQYA 4F9OA 2QWMA 3GBTA 2J4RA 1Q18A 2Q1NA 1BA0A 2YJEA 3K9JA 3O80A 4J8FA 1GLBG 4CZIA 3BF1A 5EXWA 2NRZA 2RHKA 2NRTA 3DXKA 1NGAA 3TSPA 1U2VA 4BGAA 2QEXN 4WQ5C 4WCEL 5BREA 2NRRA 5JMVA 4BQZA 5C12A 3O5BA 4JAXA 5M1OA 4BRPA 3TSQA 2GEMA 5GIOA 2RE2A 4C23A 5C2FA 2OTLN 5BPLA 1Y64A 3CJ1A 4IOXA 2WBNA 5DM6L 3ATVA 4YOVA 2ZJQL 1SS6A 4JKEA 2Q0RA 2EWSA 1YXQA 1KAYA 4FWNA 3MN6A 1T44A 4JHDA 3GE1A 1T6CA 3ULEA 1Q7YO 4EHTA 2NRXA 4NB4A 3MX5A 3FR0A 3JXUA 4WFAL 4IDHA 4BC3A 1SAZA 4JD2A 3DXMA 3WQTA 1QVGM 2FSJA 1MDUB 3LL3A 1C0FA 5C15A 1T3VA 4XH5A 5E84A 3C6HA 2D0OA 1VQ8N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO N;  1VQN N;  3CC7 N;  3CCJ N;  1K8A O;  1NJI O;  2ZJP L;  5JVG L;  5DM7 L;  3CPW M;  1M90 O;  1VQP N;  5MLC Q;  4UY8 O;  1Q81 O;  1KQS M;  3CCQ N;  3I56 N;  1KC8 O;  3CCL N;  1Q86 O;  3CXC M;  1YJ9 N;  5GAG P;  3G71 N;  3PIP L;  3G6E N;  3CMA N;  4WFN L;  3G4S N;  1YJN N;  1ILY A;  1W2B M;  5HL7 L;  4IOC L;  1YIT N;  1QVF M;  2QA4 N;  3PIO L;  3CC4 N;  1VQL N;  1Q82 O;  5GAE P;  4U67 L;  3CCM N;  2OTJ N;  3CCU N;  4IOA L;  5GAH P;  3CD6 N;  3OW2 M;  1VQM N;  1VQ4 N;  3CF5 L;  1VQK N;  3CCR N;  1K73 O;  1YHQ N;  1VQ6 N;  4WF9 L;  4IO9 L;  1VQ7 N;  1JJ2 M;  1M1K O;  2QEX N;  3CC2 N;  4WCE L;  1S72 N;  1VQ9 N;  3J7Z O;  3CCE N;  1OVY A;  3DLL L;  4WFB L;  5JVH L;  5H1S Q;  3CCS N;  2ZJR L;  1VQ5 N;  2OTL N;  5DM6 L;  2ZJQ L;  3CCV N;  1KD1 O;  1YJW N;  1YI2 N;  1Q7Y O;  4WFA L;  1QVG M;  5GAD P;  3I55 N;  1YIJ N;  3CME N;  1K9M O;  1VQ8 N;  1N8R O; 
#chains in the Genus database with same CATH topology
 3NH2 A;  3HRG A;  4DSI A;  1BOT O;  2GX9 A;  3IMX A;  3K9K A;  4MFB A;  4Y1C A;  1NM1 A;  4RW8 A;  5JVG L;  3M6G A;  2X74 A;  1IG8 A;  3G0Z A;  2V52 B;  3TSU A;  3L2W A;  2P9K B;  1KSP A;  3S41 A;  5FLX O;  4W5Q A;  4CJW A;  2E20 A;  2HBM A;  4UY8 O;  3SK3 A;  4CF2 A;  3AAR A;  3CXC M;  4ZHR A;  1RBV A;  3D0P A;  1VSL A;  2QTD A;  1CXU A;  4AQY K;  2VG7 A;  4ISG A;  4ICL A;  3SPZ A;  4OKJ A;  3O6W A;  2GEL A;  4Z4I A;  3AGR A;  3DLB A;  4NXN K;  1L3T A;  1U2V B;  3H1Q A;  4N56 A;  1NK7 A;  4FL9 A;  2HBL A;  4KPY A;  4KHP K;  1NGE A;  4A61 A;  4FXD A;  5F0X A;  3CCM N;  2YHB A;  3AA5 X;  5AQI A;  1ASV A;  4BRG A;  2E2N A;  3QBX A;  3SMP A;  3VF6 A;  3ZX0 A;  4M3W A;  4KH4 A;  4LH4 A;  3I8B A;  4E7J A;  2QWQ A;  1KVB A;  4ISE A;  3SQ1 A;  1VQ6 N;  3O4N A;  2P9L A;  4AHT A;  3DXM B;  3ZSX A;  1F21 A;  4F3T A;  2CGL A;  2RN2 A;  5AQN A;  4KAZ A;  4CBU A;  4Z4E A;  2VWK A;  3HZ6 A;  4JN4 A;  2P9K A;  3UIQ A;  4A2A A;  3DLL L;  4BRE A;  1KRP A;  4PUO A;  3O9T A;  1SL1 A;  3LDO A;  2O8F B;  3EKU A;  3QLH A;  4ELU A;  4BY9 C;  1B9D A;  2Y1I A;  5HP1 A;  5AQM A;  4M42 A;  3TAN A;  4IG0 A;  2JGU A;  4MLH A;  4DQP A;  4JKC A;  4PQU A;  4DTR A;  4CBW A;  2PYJ A;  2RKI A;  4LF7 K;  4A62 A;  3OYL A;  3QEX A;  3VQ4 A;  4BR2 A;  1X1P A;  1K9M O;  3VEN A;  3RSE B;  4BC2 A;  4HVJ A;  3P5J A;  2YHA A;  2ITG A;  4B1W B;  1VQN N;  5IT9 O;  2VQF K;  2KZM A;  1ZBH A;  1KLN A;  5BRH A;  3HK2 A;  5FPN A;  2B6A A;  4LF8 K;  3SZ2 A;  4IWV A;  2UUB K;  1LOT B;  4ISF A;  3S3O A;  2NRW A;  4DFK A;  1IBM K;  4BVP A;  3ZSQ A;  3EO3 A;  3N4Q A;  1C0T A;  1C6V A;  4CEB A;  3LDS A;  1KQS M;  2OZM A;  3QER A;  2ASO A;  4YOY A;  1RDW X;  4YOR A;  4GV3 A;  4LF5 K;  1BHL A;  1OKJ A;  2XY8 A;  4CJV A;  3G6E N;  1D9F A;  3AO3 A;  3DOL A;  4FLU A;  3CJA A;  4YOT A;  3QDK A;  2HB5 A;  1SKW A;  1QSS A;  4OO1 J;  4CEZ A;  2HOE A;  4GVM A;  2O8F A;  1NU0 A;  3LM2 A;  5ADX H;  4DFJ A;  3NGY A;  2ZWH A;  3HT3 A;  3E9O A;  1BCO A;  1RT6 A;  2HBJ A;  3VTI A;  5IWA K;  2YJF A;  1FXX A;  3QB0 A;  3K0S A;  2E5L K;  1C1B A;  5HRS A;  4RWT A;  1VSI A;  3ID8 A;  3RSE A;  4FLW A;  3MWT A;  4DQ8 A;  4IO9 L;  2KQ2 A;  4A59 A;  4KH6 A;  2G8K A;  3UB5 A;  3HOT A;  3TAF A;  4FJJ A;  3KK2 A;  3CC2 N;  3HJF A;  2UYT A;  1HX1 A;  3H46 O;  3O1W A;  3OYG A;  3L8B A;  4FJ5 A;  3FFK B;  1CZA N;  5AZJ A;  4CF9 A;  1RT4 A;  2FSN A;  5AQR A;  2HNY A;  3NF8 A;  1BA1 A;  3E9P A;  2HHQ A;  1FK9 A;  4AM7 A;  4NCB A;  4E3S A;  3U9Z A;  4CGI A;  1NMN A;  4J2E A;  4CER A;  1DEJ A;  1YI2 N;  1XC9 A;  4CGD A;  4QS7 A;  4C8N A;  4PL7 A;  3VET A;  3EL2 A;  4BE0 A;  5HRP A;  1GOB A;  3ZSR A;  3HOS A;  3CME N;  3ZCM A;  3HPG A;  4HCC A;  3N4P A;  3I0R A;  1VQO N;  1K8K A;  4X64 K;  5HRR A;  5HOO A;  4DU1 A;  4FWQ A;  4FW1 A;  1Z6R A;  1N33 K;  1M90 O;  1C0U A;  3W3D A;  1BL3 A;  3IKM A;  4X65 K;  4ZTF A;  4CHZ A;  1HQE A;  1RDC A;  4RTF D;  3PLA A;  3SV4 A;  1TK8 A;  1S1X A;  1GLL O;  2IC3 A;  5AQO A;  1D5A A;  1A5X A;  3K5L A;  3KTQ A;  3PIP L;  4NYF A;  3T69 A;  3NFA A;  1OH8 A;  4JI2 K;  3OYB A;  3J80 O;  3T3F A;  4KRE A;  1ATS A;  1NLV A;  4IOC L;  1VSM A;  1RDU A;  3DI6 A;  3FGU A;  5EX5 A;  4BR4 A;  4AIL C;  1YF5 L;  2R7Y A;  4MDA A;  1E4G T;  4KFB A;  4CJT A;  4RW9 A;  3WQU A;  4M3R A;  1NKE A;  3TU5 A;  1YAG A;  2OPQ A;  3K59 A;  3CF5 L;  1U45 A;  2O8D B;  3BGR A;  3FZM A;  3FZL A;  4IZ9 A;  1K73 O;  2H3G X;  1ATR A;  4ELV A;  1S1V A;  3P38 A;  1NJW A;  3FZH A;  4FJX A;  4GMJ B;  1NGI A;  1GLJ O;  3AA2 A;  1JJ2 M;  5TKW A;  4BG9 A;  3F73 A;  1RBU A;  4RW6 A;  4CW7 B;  5HBM A;  3OYI A;  3OJU A;  5AQJ A;  4W5T A;  4JV5 K;  4BG8 A;  3WNG A;  3KWG A;  4MQ3 A;  2FF6 A;  4GKJ K;  2VWJ A;  3FLC O;  4H0Y B;  4KO0 A;  5AQK A;  1ATN A;  2X6N A;  5AQF A;  4H5T A;  3J7Y P;  3KJV A;  1GLA G;  2P9N B;  3NAE A;  4BWJ A;  2HMP A;  3A5N C;  5K14 A;  5AQQ A;  1REV A;  4K42 A;  4H5R A;  3H08 A;  3LP3 A;  5LY3 A;  4QAG A;  3L2R A;  1NWK A;  1EET A;  4KHS A;  4A2B A;  4N5S A;  1GOC A;  3VQ9 A;  2QKK A;  4Z4H A;  1SZ2 A;  2D4W A;  4B9T A;  4ID5 A;  4AF1 A;  2Z1I A;  1HKB A;  3L0Q A;  4H5N A;  3OBY A;  2YCH A;  3ZSY A;  2OAN A;  1Y97 A;  2ZGZ A;  1EO1 A;  2O8D A;  5MLC Q;  3KWI A;  2ZQB A;  2KHO A;  1TYQ B;  1N5Y A;  3OYF A;  1Q81 O;  3T1H K;  1N36 K;  1WBB A;  3VEW A;  4B9U A;  1JLQ A;  3ULE B;  4I9Q A;  5T7B A;  4IDK A;  3THW B;  5DK5 A;  2HNZ A;  1QQM A;  3DRS A;  4JRQ A;  1JKH A;  4DCH A;  4MDB A;  2NRH A;  1J53 A;  4NYN A;  4IFV A;  1SKR A;  3CIP A;  3AA3 A;  3RRG A;  1X3M A;  1VQL N;  1N34 K;  4U67 L;  2DTU A;  2P9N A;  4YOU A;  4CBX A;  1CXQ A;  1VRU A;  3RMC A;  3LDQ A;  4BRA A;  4G1Q A;  4UQG A;  3OTO K;  4DR6 K;  4PKH A;  3HYF A;  3VQ7 A;  4OKK A;  2FC0 A;  3JSM A;  1UOC A;  4K8Z A;  4JEP A;  5KI6 A;  1ZYQ A;  1KVC A;  3GBT A;  4C8O A;  3K9J A;  4JYA K;  1HMV A;  1TKD A;  2QEX N;  4WQ5 C;  1Q9Y A;  3IRX A;  2XHB A;  1LV5 A;  4PA1 A;  1SV5 A;  4HCB A;  3O5B A;  5M1O A;  4BRP A;  4TSX A;  2F8T A;  3M8P A;  3TSQ A;  4B3S K;  2IS3 A;  2RE2 A;  3PUF A;  5C2F A;  2DFE A;  2FBT A;  5BPL A;  1IKV A;  2WBN A;  2Z1J A;  3ATV A;  1JLG A;  3OYE A;  1YXQ A;  3KK3 A;  4DV0 K;  1IO2 A;  1T44 A;  1QTM A;  4DTX A;  3GE1 A;  4IG3 A;  3ULE A;  2NRX A;  3LZJ A;  4NB4 A;  2YKM A;  3QES A;  4DF8 A;  3O4Q A;  3WQT A;  4FM0 A;  1NKB A;  1QVG M;  3RRH A;  5E84 A;  1LWC A;  2D0O A;  1J5E K;  5KQ8 A;  4B1V A;  1CZ9 A;  2WUS A;  4FLV A;  1R59 O;  3LAN A;  3SQ0 A;  3F9M A;  3H1V X;  1XHX A;  3NE6 A;  4M63 C;  3L3U A;  2WON A;  4FVM A;  3VQ6 A;  2ZM6 K;  3PX0 A;  2O4I A;  5J2P A;  1RIL A;  3OYH A;  1JCE A;  3NF9 A;  4F3O A;  1NMD A;  3NH1 A;  2OYQ A;  2VYP A;  3QIC A;  2E88 A;  4DR5 K;  1T03 A;  4KB1 A;  5CYM A;  2YHW A;  4FYD A;  3QML A;  3AO1 A;  1IKW A;  3CYM A;  3KD5 E;  3EY1 A;  5CYQ A;  4DSF A;  2Z1H A;  3CER A;  3ZT1 A;  1S9G A;  5D3G A;  4OVL A;  3TTF A;  4M3Z A;  2Z1G A;  2XY5 A;  4CHY A;  5LL6 Z;  5FRN A;  4DQI A;  4BRD A;  3ZX3 A;  1HPZ A;  1SUQ A;  3RVC A;  2V7Y A;  4LF6 K;  3NHG A;  3P4I A;  3HBT A;  4A5B A;  1HLU A;  3C6A A;  4BVO A;  1NGF A;  4DUY K;  3M8R A;  4KTW A;  5M1F A;  3ZX2 A;  4V19 S;  1W97 L;  2YHX A;  4FWL A;  4CFD A;  2Q0U A;  3QEP A;  5BPN A;  3IG1 A;  2V7Z A;  2XY6 A;  1TK5 A;  1Z25 A;  4CGJ A;  1IH7 A;  4KI6 A;  4DV2 K;  3VQE A;  4CJ3 A;  3EEQ A;  1SL2 A;  3I33 A;  1A5V A;  1WUA A;  1ZBU A;  1UAX A;  3QEV A;  3VES A;  3IS9 A;  3MDQ A;  3I55 N;  4FM2 A;  4FJ7 A;  1KAX A;  4O8K A;  5HRN A;  3HTV A;  2GUI A;  2ZE2 A;  1K6Y A;  4M3T A;  3R8E A;  3C7N B;  3VQQ A;  4FJG A;  2RF2 A;  5FRM A;  3GL1 A;  4JLH A;  1RDA A;  1QQC A;  4FWR A;  1W9H A;  1T05 A;  4HTL A;  2A41 A;  1BUP A;  1FJG K;  4Q5V A;  3R9P A;  1NK9 A;  4Q0B A;  2OPR A;  3I0S A;  5BR8 K;  2QW9 A;  1KC8 O;  4CFC A;  4GV9 A;  4DB3 A;  3G71 N;  2P9L B;  4BRF A;  4KTQ A;  1KFD A;  2G8V A;  1HRH A;  1HNI A;  3KKR A;  4JI5 K;  1WAF A;  1WBD A;  3ZET B;  5FDL A;  1L5U A;  1QVF M;  2A1R A;  3C94 A;  1WOQ A;  5J2Q A;  1NOY A;  3VF4 A;  3CHW A;  4ID1 A;  2D1K A;  3CFR A;  1OH6 A;  4LFB K;  2G8H A;  4IOA L;  5JS2 A;  3W0L A;  4HTU A;  1KTQ A;  2QWN A;  1S1U A;  5AR0 A;  2P1J A;  3K2P A;  2D0C A;  4FM1 A;  3PX6 A;  3IUC A;  4FWK A;  1GLD G;  5FRO A;  4FJM A;  4L8R B;  3CI5 A;  3HO1 A;  3C7N A;  3M8S A;  3SNN A;  2I7P A;  3O08 A;  3AY9 A;  4OPA A;  1RT7 A;  3PO4 A;  5C24 A;  2QI2 A;  1C1A A;  3A5M C;  4CZG A;  4KB0 A;  4JK9 A;  3V1O A;  3U6F A;  1RT1 A;  3SUP A;  5SZT A;  2PYL A;  1WAJ A;  1EKE A;  3F5T A;  3NBP A;  1HPM A;  1TGO A;  3L2V A;  4O8U A;  4CJ4 A;  3OY9 A;  5GAD P;  3OS1 A;  3H3O B;  3O3H A;  3ZET A;  4CJ5 A;  1LCU A;  4JKG B;  4Z4C A;  4FOE A;  4B9N A;  4KHQ A;  3BUZ B;  4XEI A;  4BE2 A;  3NGZ A;  4R5P A;  4Z94 A;  2UUC K;  1MWM A;  3M1F A;  2JLE A;  4M45 A;  3TTC A;  5JLF A;  1J6Z A;  1BQM A;  2P9P B;  1VQP N;  2HVH A;  2ETJ A;  2O8C B;  2O8E B;  1HNV A;  3NH0 A;  1XMO K;  5FPD A;  2F7T A;  2JWK A;  2E2P A;  4B9M A;  1QQO A;  1X9J A;  3ALY A;  4H4O A;  2QWR A;  5AQV A;  3V81 A;  3QIP A;  1YJN N;  2IDO A;  1WSG A;  3OYJ A;  1RBS A;  3L3V A;  3CM6 A;  5AZJ B;  5AQZ A;  3ZLJ A;  3I8D A;  1QSL A;  3ASM A;  1KCF A;  4DTO A;  1S6Q A;  2D0A A;  4W5N A;  3TAM A;  3C95 A;  4KHW A;  1HYV A;  5GAH P;  4BE1 A;  1QHT A;  3MN5 A;  4FWM A;  1YHQ N;  2KFN A;  4JKG A;  5FPM A;  2A5X A;  2NLX A;  3SLC A;  1I39 A;  3DLE A;  4I2Q A;  3V4I A;  4CD1 A;  4B3R K;  4AHV A;  4IJN A;  3DMJ A;  4LH5 A;  4CJF A;  3DRR A;  4OGC A;  3DAW A;  4M3Y A;  3L4Q A;  1S72 N;  3ZT3 A;  3VQP A;  4CEE A;  4E1J A;  2P9P A;  4CHO A;  1K8K B;  4CJL A;  2O8C A;  2O8E A;  1DGK N;  3CCS N;  3QFP A;  3WXJ A;  2F9W A;  4PL8 A;  4CJU A;  1KVA A;  3VTH A;  1BG3 A;  1BO5 O;  1VSD A;  1SKS A;  3BDP A;  3AO2 A;  1KLM A;  2YHY A;  3D2F B;  3E9L A;  1LAW A;  3LP0 A;  4BDZ A;  4H0V B;  4K25 A;  1EQY A;  1N6Q A;  3V9S A;  2GBZ A;  3LP1 A;  2XRI A;  3OYC A;  4FJ9 A;  2HHH K;  5AFU A;  5C10 A;  3O3G A;  4H8K A;  4W5O A;  1E3M A;  4BRL A;  1N8R O;  1X9M A;  3LZI A;  3NF6 A;  1IJJ A;  1NGD A;  3QET A;  1BIU A;  5DMR A;  3MEE A;  3EZW A;  5ELZ A;  4LSL A;  1EWR A;  4WQ5 A;  4CJE A;  4C8L A;  4IJA A;  2DFH A;  3CJ7 A;  5AJ3 K;  2LSN A;  3TWH A;  1MU2 A;  5AQW A;  4BRI A;  3U9D A;  1A5W A;  4FWS A;  4CJ7 A;  2KW4 A;  4C8K A;  3OS0 A;  3LPU A;  4FO0 A;  4BC4 A;  3VPZ A;  4H0X B;  2PBD A;  2YNH A;  1TAQ A;  3E1Y A;  3C6T A;  1C1C A;  4QS9 A;  1RTI A;  1WSH A;  1DTQ A;  1UWB A;  4PY5 A;  5F2R A;  4CHN A;  3D2E B;  4JI4 K;  3HXM A;  3D2F A;  1RT5 A;  2CGK A;  3TAQ A;  3SMS A;  3AVG A;  1EX4 A;  5M1K A;  3VOV A;  2VQE K;  2NNW A;  1J54 A;  2GTD A;  4W5R A;  3MXM A;  4HUF A;  3KLI A;  2IVO A;  3MN7 A;  1ZBS A;  1JCF A;  3O9Q A;  2FF3 B;  1S22 A;  4BQL A;  4WF9 L;  5AQU A;  1HNX K;  5EVZ A;  1O13 A;  5AQY A;  4F9O A;  5J2N A;  2QWM A;  2J4R A;  1BA0 A;  1TAU A;  4CZI A;  1VSH A;  3TSP A;  5LMU K;  1OH7 A;  5BRE A;  3L2U A;  4DUZ K;  3F9K A;  5I42 A;  1L3S A;  4BQZ A;  4JAX A;  4O0I A;  5GIO A;  2G8I A;  4C23 A;  3ZSO A;  1BI4 B;  1Y64 A;  3CJ1 A;  1SS6 A;  4JKE A;  4DU4 A;  2Q0R A;  2EWS A;  4CJS A;  3B6O A;  3U3G A;  2I5J A;  1Q7Y O;  3NCI A;  3J7A P;  3HST B;  3MX5 A;  4IDH A;  2QK9 A;  5C15 A;  5C25 A;  4H5W A;  3D2E A;  1TL1 A;  1D8Y A;  4LFA K;  1RT2 A;  4B08 A;  4LF4 K;  3VQ5 A;  3CC7 N;  4GW6 A;  2A3Z A;  3JS6 A;  3BP8 A;  1XC3 A;  4KV8 A;  1TKX A;  3S9H A;  4ILG B;  4E7I A;  1NGJ A;  3D7E O;  3CPE A;  4EHU A;  1DT9 A;  2E6L A;  5KQD A;  3AVJ A;  3QEW A;  5CHI A;  1QHA A;  1NK5 A;  4Z4G A;  1XUP O;  3CCQ N;  1Z26 A;  1XMQ K;  2O8B B;  5CZ1 A;  4DR4 K;  3R1X A;  4YFU A;  4WFN L;  3OYM A;  3KHY A;  2NRV A;  2QXF A;  2E1Y A;  3VMF B;  4HHT A;  3HPO A;  3IDH A;  1BI4 A;  4O0J A;  1S9E A;  4F2S A;  4WQ4 A;  3AGK A;  3SUQ A;  2KTQ A;  2EHG A;  4E0D A;  3SBG A;  1XHZ A;  4E7H A;  4CGF A;  3L6Q A;  2PY5 A;  3VA0 A;  4KH5 A;  2YX6 A;  2Y1J A;  2BH1 A;  4F8R A;  4KHY A;  2HVI A;  3ZSW A;  2VG5 A;  1VQM N;  4CIF A;  4CZE A;  1VQK N;  3OYK A;  3KLG A;  3HPH A;  3WEE A;  2OPP A;  1ASW A;  4DLG A;  3DYA A;  3HSC A;  5CR4 A;  3BZK A;  2O4G A;  3DLK A;  4CZH A;  4E7L A;  4K43 A;  1ESV A;  1B92 A;  1M1K O;  1GLE G;  4FZZ A;  4CF0 A;  1BWF O;  4CEA A;  3CCE N;  3WT0 A;  4C1N K;  4DSE A;  3M5R A;  1S1W A;  5BPM A;  1DKG D;  1HKG A;  3MX2 A;  2O8B A;  3CFP A;  4H0P A;  3JYT A;  2E1Z A;  4M3X A;  1O1W A;  1NJY A;  5KRS A;  3VEZ A;  1G15 A;  1QE1 A;  1ZBI A;  3D45 A;  1NGG A;  4H03 B;  5CZ2 A;  4LY7 A;  3O8M A;  1VK0 A;  4YDU C;  5J1E A;  3RMB A;  3EKS A;  4BRN A;  5AQT A;  2HBK A;  3ISN C;  5BN8 A;  4Z4F A;  3AVB A;  3LPT A;  1IKX A;  3CJ9 A;  3TPQ A;  3TAP A;  3CCJ N;  3B8A X;  1U4B A;  3VN5 A;  5AZI B;  2YNF A;  3SAF A;  2ZJP L;  4CJQ A;  4JI8 K;  4FW2 A;  3FE1 A;  4IFE A;  2PAV A;  3KVG A;  4JI0 K;  3CJC A;  4BRC A;  3MCA B;  2A42 A;  4XH1 A;  4NXM K;  4CF1 A;  1NKC A;  4CJR A;  4J2D A;  3LDL A;  1TUY A;  4CZK A;  1Q86 O;  1QZ5 A;  1YVN A;  3P83 D;  4M41 A;  3VQB A;  1NK8 A;  5AQG A;  5AQH A;  3HP9 A;  2HHU A;  3CMA N;  4GNI A;  4WE1 A;  4DLE A;  3GG4 A;  3AVH A;  3P31 A;  1JLA A;  2QA4 N;  3V9W A;  1FKP A;  3E01 A;  1D4X A;  1NGH A;  3HI0 A;  2AA4 A;  5E41 A;  3L4I A;  3AVF A;  2HW3 A;  3KK1 A;  3KZB A;  3ITH A;  3CD6 N;  3C65 A;  2E4L A;  1BGX T;  4FJH A;  3K5O A;  4O5F A;  1WSF A;  3O4W A;  4AHU A;  4EZ6 A;  3SPY A;  4OPJ A;  2GWJ A;  2P51 A;  5AFU H;  2Q97 A;  5KPT A;  3JAM O;  4FJK A;  5AZI A;  1S5J A;  3EN9 A;  3CET A;  4B1Z A;  3U4L A;  4I2P A;  5BN9 A;  3DWL A;  1P8Z A;  1NGB A;  4FSV A;  4E89 A;  2ZJR L;  2VGM A;  4E1N A;  1E4F T;  2QWL A;  1CLQ A;  4J2B A;  1SQK A;  1V4S A;  3KD1 E;  4CI6 A;  1VSF A;  3WNF A;  4O44 A;  4CJK A;  1RTJ A;  4DR3 K;  3U8X A;  1EXQ A;  3PX4 A;  2A6A A;  4EAH D;  4R79 A;  1I94 K;  4MO4 A;  4ILH A;  2F9T A;  1QZ6 A;  2W6L A;  2A40 A;  5B8H A;  1YT3 A;  4CEO A;  1HNW K;  1VAZ A;  4H5V A;  3AV9 A;  4JK7 A;  2BTF A;  3ZEU B;  5M1N A;  3VQ8 A;  3VEV A;  4YOW A;  3OYD A;  3SYZ A;  1ZBL A;  4GVE A;  5KGW A;  3RMD A;  1NJI O;  4DTM A;  3K5N A;  4CF8 A;  2D0P A;  4DFM A;  4EFH A;  3SAH A;  3AVM A;  3PO5 A;  5I3U A;  1NK4 A;  2WFB A;  3T19 A;  1Q9X A;  4L3Q A;  3THX B;  4WQ4 C;  4DSL A;  2IOC A;  3AAQ A;  1MA9 B;  1V4T A;  5KPZ A;  3SQ4 A;  3LAM A;  2P9S B;  5JLH A;  1KXP A;  1ITG A;  1TKT A;  4B8A B;  1TL3 A;  2ASP A;  3OA9 A;  2DY4 A;  4G9Z A;  2W6K A;  2WC9 A;  2G8W A;  1JLC A;  4N47 A;  3A0I X;  2G8F A;  2ZGY A;  3KLH A;  2W40 A;  4B3T K;  1ZBF A;  3PV8 A;  1G99 A;  1MWK A;  3NDK A;  3ENB A;  2OA8 A;  4B3M K;  3ZEU A;  4DSK A;  4C8M A;  3ENH A;  5KTQ A;  2OZS A;  3OYA A;  4FWO A;  3RMA A;  4KBO A;  4DFP A;  4DR7 K;  4GKK K;  1VQ9 N;  4DTS A;  3SCX A;  1RNH A;  1OVY A;  1H1V A;  3E66 A;  4FLZ A;  3AVC A;  5JVH L;  4PWD A;  1WSJ A;  1OH5 A;  4JRP A;  5AQL A;  4DV5 K;  2NZT A;  3MCP A;  1TKZ A;  3THX A;  4CCH A;  5F1X A;  2QXL A;  2RPI A;  4B8C A;  4IKF A;  1NBW A;  3FZK A;  3BF3 A;  4F4K A;  5J2M A;  5C2D A;  2KFZ A;  3KKS A;  1XQS C;  3F2K A;  4DS4 A;  2P9S A;  5LMN K;  2A1S A;  4XIU A;  4AH9 A;  4GY2 B;  4EP4 A;  5M1P A;  3RR7 A;  2HHV A;  3THV A;  2FBY A;  4OJR A;  3LWM A;  1S3X A;  4DV3 K;  3ZSV A;  4M7Y A;  2IIR A;  1HNZ K;  1RDD A;  4DV4 K;  1RBR A;  5KRT A;  1U48 A;  1S1T A;  2WOM A;  3PSI A;  3H45 C;  3DXK B;  3VQD A;  3QNN A;  3CPW M;  3GOI A;  4BRM A;  1SL0 A;  4IFY A;  2E2O A;  1N32 K;  2QM1 A;  3S3N A;  2W42 A;  4I9L A;  2E8A A;  3TAG A;  2B4J A;  3OHR A;  3J81 O;  1YTU A;  4BR0 A;  4JHD B;  4HUE A;  3CG7 A;  4CZL A;  3TAR A;  2QWO A;  4DWI A;  3AVI A;  4OPH A;  2E6M A;  1TK0 A;  1LWF A;  3O9R A;  4JD2 B;  5HL7 L;  3HVT A;  3KLE A;  4NLB A;  3EYZ A;  3QO9 A;  1B9F A;  2YI1 A;  2QWP A;  1YUW A;  4RW7 A;  1J9A A;  2JWL A;  4OGE A;  3CM5 A;  1JCG A;  3CQ8 A;  4DQS A;  4JI3 K;  4JNE A;  3SUN A;  3OW2 M;  3EE9 A;  4K8X A;  3LWL A;  3NVK A;  4JI7 K;  2P9U B;  4YHH K;  5BRF A;  3MED A;  1W0H A;  3A2F A;  4N41 A;  2Q1N A;  4J8F A;  3SV3 A;  1NG9 A;  3BF1 A;  5EXW A;  3V1Q A;  2NRZ A;  3U3Y A;  3QIO A;  2NRT A;  3DXK A;  1U2V A;  3KIO A;  2NRR A;  1JLB A;  3CFO A;  4FLY A;  5C12 A;  1YTA A;  2GEM A;  2OTL N;  5DM6 L;  4YOV A;  2ZJQ L;  1KAY A;  4FWN A;  3MN6 A;  4FJL A;  4JHD A;  4O5B A;  1EWQ A;  1T6C A;  4OPK A;  4LD0 A;  4LF9 K;  3FR0 A;  4KTZ A;  4CIE A;  4JD2 A;  3DXM A;  1U49 A;  2FSJ A;  3LL3 A;  4XH5 A;  3C6H A;  4QS8 A;  4IEI A;  1BCM A;  1BU6 O;  3WNE A;  4CHQ A;  4FCY A;  3G10 A;  4EIA A;  3AA4 A;  3V1R A;  5HLF A;  3HVR A;  1CZB A;  3PSF A;  1IG9 A;  4H0O A;  4YOX A;  1GOA A;  1X9S A;  1LWE A;  5DM7 L;  3A5L C;  3ZYY X;  4BC5 A;  2P9U A;  3ZT2 A;  3DLR A;  5E26 A;  3AO5 A;  1T6D A;  4M7X A;  4K41 A;  4DSJ A;  4YY3 K;  1I3A A;  4NCG A;  4E1M A;  4B9S A;  3CCL N;  4NO7 A;  3ZSZ A;  4CFB A;  4PHT X;  2HF4 A;  3ZT4 A;  5GAG P;  1VSJ A;  2Q31 A;  3C0B A;  1HUX A;  1C0G A;  3J8A A;  3G4S N;  1NGC A;  1HR0 K;  4FK4 A;  4YDU A;  4I6M B;  1RTD A;  3KK7 A;  4FZY A;  4IXC A;  2FLO A;  1BQN A;  3SBT A;  4DF4 A;  3WNH A;  4DR1 K;  2D5R A;  1NJZ A;  2VGN A;  4NLC A;  1RCH A;  1DLO A;  2BUP A;  4BAC A;  4FJN A;  1S6P A;  1LAV A;  5CY4 A;  5AQP A;  4A5A A;  1LW2 A;  3ENO A;  5EOY A;  4KRF A;  3LDN A;  4DV6 K;  3UKU B;  1ASU A;  3OBW A;  2E2Q A;  4BR5 A;  4FLT A;  3O1B A;  4HWI A;  3M3Z A;  5LJV A;  4EZ9 A;  2YKN A;  3VEX A;  4B3O A;  1TVR A;  4CES A;  4WFB L;  4JKH A;  4N76 A;  4CGG A;  4DS5 A;  4JS4 A;  4BGB A;  2Q3S A;  4B1X B;  4B9V A;  1NK6 A;  1QSY A;  1KD1 O;  4OKE A;  4DQR A;  4AM6 A;  4CZF A;  3V9U A;  3M8Q A;  3AVK A;  4CEQ A;  3DM2 A;  4KHU A;  3WXM B;  4I6M A;  4BDY A;  4DG1 A;  2YNI A;  4OX9 K;  4KHN A;  2VWB A;  3SJJ A;  3TI0 A;  2HF3 A;  3AO4 A;  3NMU A;  3SQ2 A;  2WTU A;  5EY4 A;  4FK0 A;  4FVU A;  3QEI A;  2BGG A;  4DV7 K;  1FKO A;  2YV0 X;  3C6U A;  3R6M A;  4CK3 A;  3VF2 A;  4OLB A;  2ASM A;  4JKF A;  1GLF O;  1RGI A;  4JS5 A;  1OVQ A;  3TAE A;  1VHX A;  4HUG A;  4RCH A;  4BRO A;  1L3V A;  4H0T B;  3LAK A;  4DQQ A;  4B1U B;  4NCA A;  3SJH A;  5C42 A;  3Q7B A;  2FXU A;  3VEY A;  2P9I B;  3UKU A;  5I9E B;  2HHT A;  4Y1D A;  5BRD A;  1NOZ A;  3VGK A;  3DLH A;  1UA1 A;  1QS4 A;  3UKR B;  3QNO A;  3NGI A;  3AVA A;  3OYN A;  3OVN A;  3WEE B;  1U04 A;  1JL1 A;  2CH5 A;  3GDQ A;  1HQU A;  2BE2 A;  3MK6 A;  3K58 A;  3ULD A;  2GV9 A;  4CK1 A;  4ZTJ A;  5AQS A;  2KKZ A;  3SAG A;  1ZC6 A;  3LM9 A;  4IEE A;  5GAE P;  4C1N I;  3DRP A;  4AHR A;  1WN7 A;  1IV0 A;  1RDB A;  4U7B A;  4ELT A;  3H6E A;  1IBK K;  1Z05 A;  2VG6 A;  4KKO A;  3ID6 A;  5BR9 A;  2UXD K;  2I7N A;  2VCP A;  3VQA A;  2XY7 A;  1P90 A;  4B9L A;  4RG8 A;  2UXB K;  4DR2 K;  1WSI A;  4KI4 A;  3RR8 A;  3BEX A;  5FPE A;  4JI6 K;  3BZC A;  4JI1 K;  3CQX A;  4DTU A;  1BIS A;  2DPN A;  3J7Z O;  3P1G A;  2IVP A;  4CGH A;  3MEG A;  3A5O C;  4JK8 A;  5H1S Q;  2P9I A;  3D6R A;  1VSE A;  3RTV A;  1R0A A;  4FWP A;  2FSK A;  1QQN A;  4AHC A;  4OLA A;  3UKR A;  4H4M A;  4CJP A;  2ITM A;  5GIN A;  3WUH A;  2V51 B;  1EP4 A;  1J5O A;  3T7Z A;  3T1A A;  4BR7 A;  3A8Y A;  4DU3 A;  1JLE A;  3AVN A;  1LW0 A;  2GWK A;  4GV6 A;  3O9U A;  3PIO L;  4CVN E;  5C0Y A;  4ILJ A;  4JKB A;  3BY5 A;  3UE5 A;  3QBW A;  4XH4 A;  4DTN A;  1NNE A;  4RW4 A;  2UU9 K;  3HL8 A;  3G25 A;  5A2Q O;  4QCL A;  2EX3 A;  4Z0U A;  2G8U A;  1XWL A;  3MXJ A;  1XNR K;  1HYS A;  2YNG A;  4MO5 A;  2UXC K;  3L2Q A;  1UA0 A;  2ZF5 O;  3RWU A;  1HKC A;  2X78 A;  3CQY A;  4DMN A;  3MEC A;  4CK2 A;  2IVN A;  3DJC A;  3LP2 A;  4BR9 A;  3P39 A;  4BDP A;  1YJ9 N;  3HP6 A;  4O4G A;  1WLJ A;  5TKY A;  3FZF A;  4LFC K;  2PFU A;  3VGL A;  5SWM A;  1ILY A;  1W2B M;  4CZM A;  2ATQ A;  4K0K K;  3VQC A;  2CH6 A;  4JKD A;  4CED A;  1ZXO A;  2FBV A;  2IGI A;  3T1Y K;  3CC4 N;  1HJR A;  3ZT0 A;  5GIP A;  3MN9 A;  2PZS A;  5KGX A;  1TYQ A;  3WXI A;  2OPS A;  2Q2R A;  1JXB A;  1FW6 A;  2KZZ A;  2X6S A;  1RFQ A;  3VGM A;  2B5J A;  3OS2 A;  3ATU A;  1IBL K;  3QFU A;  1YVU A;  3TAB A;  4QOZ B;  4PKG A;  1NJX A;  5JIC A;  1VQ7 N;  3THW A;  4FPB A;  1X9W A;  2W41 A;  3VER A;  3LAL A;  3MXI A;  1T8E A;  4LC9 B;  5KPR A;  3WXK A;  4I7F A;  5ADX A;  5CE3 A;  1W7A A;  3MWP A;  5LJW A;  1WSE A;  4FK2 A;  3R3L A;  4MLE A;  3LDP A;  3WXL A;  3AAP A;  3DLG A;  4DV1 K;  3HM8 A;  3NVM A;  1VQ5 N;  3IFR A;  3TR8 A;  1TV6 A;  2CGJ A;  4BRQ A;  3CCV N;  4AHS A;  1X3N A;  1BDG A;  3V6D A;  1YJW N;  3VA3 A;  3PY8 A;  4DKW A;  1DTT A;  4M3U A;  1KFS A;  3TTD A;  3EE8 A;  1IKY A;  3MAQ A;  2AJQ A;  1Q8I A;  2DFF A;  4YNQ A;  4CE9 A;  2AP1 A;  4E7K A;  1YIJ N;  4IO8 A;  4CD3 A;  4CZJ A;  3H3N O;  1JL2 A;  5HRO A;  3IAY A;  2QKB A;  1WB9 A;  2ZD1 A;  3FFI A;  1RTH A;  3V9X A;  2GUP A;  4JKA A;  1VRT A;  3THY B;  2HST A;  3Q7C A;  4FOI A;  1U6Z A;  1K8A O;  1GLC G;  2BDP A;  2NUB A;  2P5O A;  2OCE A;  3HM9 A;  2XO7 A;  4FPA A;  2UUA K;  1JXE A;  2HHX A;  2F8S A;  3DOK A;  2F4V K;  3AVL A;  4WYB A;  1XI1 A;  4F2R A;  4BRH A;  3I56 N;  4DTJ A;  4LSN A;  1U47 A;  5AQX A;  3SUO A;  3MMV A;  4A57 A;  2KLA A;  1KAZ A;  3EZ5 A;  2HHS A;  3CJB A;  2HHW A;  1BIZ A;  1RBT A;  1XNQ K;  1TUU A;  3NF7 A;  4B9Q A;  4BRK A;  1HJO A;  2Q36 A;  2HND A;  4CEF A;  1YIT N;  4X62 K;  4PKI A;  2IAJ A;  3VEO A;  2F96 A;  4DHY A;  4BWM A;  3K57 A;  1Q82 O;  2OTJ N;  3QIN A;  4FJ8 A;  5M1Q A;  3CCU N;  4B1Y B;  4Y0W A;  3O9S A;  1HYZ A;  4CEC A;  1L3U A;  1VQ4 N;  1T7P A;  3CCR N;  4X66 K;  1JLF A;  3THY A;  1NK0 A;  4J2A A;  4O55 A;  1Q18 A;  2YJE A;  4FJI A;  5JS1 A;  3O80 A;  1GLB G;  4IBN A;  3S3M A;  1C0M A;  3KLF A;  2RHK A;  1NGA A;  5EU7 A;  4BGA A;  4WCE L;  3B6P A;  3V9Z A;  1VSK A;  5JMV A;  2BAN A;  3O3F A;  3K5M A;  4CHP A;  4CIG A;  4FLX A;  2HMI A;  1RT3 A;  4IOX A;  3SI6 A;  4EP5 A;  4FZX C;  4EHT A;  1D9D A;  3JXU A;  4WFA L;  4BC3 A;  4E19 A;  1SAZ A;  3OJS A;  1WNS A;  2FBX A;  4DTP A;  4CFA A;  1MDU B;  1C0F A;  1T3V A;  2P5G A;  2D0B A;  1VQ8 N; 
#chains in the Genus database with same CATH homology
 3HRG A;  4H5W A;  3D2E A;  5KQ8 A;  4IEI A;  4B1V A;  1BU6 O;  2WUS A;  1BOT O;  1R59 O;  3F9M A;  3CC7 N;  4EIA A;  3H1V X;  2GX9 A;  3IMX A;  2A3Z A;  3K9K A;  3JS6 A;  4H0O A;  1NM1 A;  4YOX A;  4M63 C;  5JVG L;  3M6G A;  5DM7 L;  3A5L C;  3ZYY X;  4BC5 A;  3BP8 A;  1XC3 A;  1IG8 A;  4ILG B;  2V52 B;  2P9U A;  3TSU A;  1JCE A;  1NGJ A;  2P9K B;  3D7E O;  5E26 A;  1NMD A;  3S41 A;  3CPE A;  4EHU A;  1T6D A;  4M7X A;  1DT9 A;  5KQD A;  4K41 A;  2E20 A;  2HBM A;  2VYP A;  4UY8 O;  3QIC A;  3SK3 A;  1QHA A;  2E88 A;  5CHI A;  1XUP O;  3CCQ N;  3AAR A;  2YHW A;  3CCL N;  3QML A;  4NO7 A;  4PHT X;  3CXC M;  2QTD A;  2HF4 A;  5GAG P;  4ISG A;  2Q31 A;  3C0B A;  3R1X A;  1HUX A;  1C0G A;  3J8A A;  4QS8 A;  3O6W A;  4WFN L;  3KHY A;  3G4S N;  2NRV A;  1NGC A;  2E1Y A;  2GEL A;  3CER A;  3VMF B;  3AGR A;  4YDU A;  3IDH A;  4I6M B;  3TTF A;  1U2V B;  3H1Q A;  4WQ4 A;  3KK7 A;  3AGK A;  4IXC A;  4FL9 A;  2HBL A;  2FLO A;  3SBT A;  1NGE A;  4A61 A;  3SBG A;  4BRD A;  2VGN A;  4NLC A;  5F0X A;  3CCM N;  3ZX3 A;  3L6Q A;  5AQI A;  4BRG A;  2BUP A;  2E2N A;  3QBX A;  3SMP A;  4KH5 A;  3VF6 A;  3ZX0 A;  2YX6 A;  3RVC A;  2BH1 A;  2V7Y A;  4KH4 A;  1VQM N;  5AQP A;  4A5A A;  3I8B A;  4CZE A;  1VQK N;  2QWQ A;  4ISE A;  3P4I A;  1VQ6 N;  3ENO A;  5EOY A;  3HBT A;  4A5B A;  3WEE A;  2P9L A;  3LDN A;  1HLU A;  3C6A A;  3HSC A;  4BVO A;  5CR4 A;  3DXM B;  3UKU B;  1NGF A;  3OBW A;  4CZH A;  2E2Q A;  4K43 A;  4BR5 A;  1ESV A;  5M1F A;  1M1K O;  3ZX2 A;  1W97 L;  1GLE G;  2CGL A;  2YHX A;  3O1B A;  3M3Z A;  4FWL A;  4HWI A;  5AQN A;  2Q0U A;  5LJV A;  5BPN A;  4CBU A;  1BWF O;  3VEX A;  2V7Z A;  3CCE N;  3WT0 A;  3HZ6 A;  4C1N K;  4JN4 A;  2P9K A;  3M5R A;  4A2A A;  3DLL L;  4WFB L;  4JKH A;  4BRE A;  5BPM A;  1DKG D;  1HKG A;  3O9T A;  3MX2 A;  4BGB A;  3I33 A;  4H0P A;  3LDO A;  4B1X B;  2E1Z A;  3EKU A;  1KD1 O;  4BY9 C;  3VEZ A;  4AM6 A;  1WUA A;  4CZF A;  5AQM A;  1NGG A;  4H03 B;  3VES A;  4MLH A;  4JKC A;  3WXM B;  4CBW A;  3O8M A;  4I6M A;  4A62 A;  3MDQ A;  3I55 N;  4YDU C;  4BR2 A;  2VWB A;  3EKS A;  4BRN A;  2HF3 A;  3VEN A;  1K9M O;  3NMU A;  1KAX A;  5AQT A;  2HBK A;  4O8K A;  3HTV A;  5EY4 A;  3RSE B;  4FVU A;  4BC2 A;  5BN8 A;  3R6M A;  3VF2 A;  4B1W B;  1VQN N;  2ASM A;  3CJ9 A;  4JKF A;  3TPQ A;  5BRH A;  5FPN A;  1GLF O;  1RGI A;  3CCJ N;  3B8A X;  3R8E A;  5AZI B;  3C7N B;  3SAF A;  2ZJP L;  4RCH A;  3GL1 A;  3FE1 A;  4IWV A;  4IFE A;  1LOT B;  4BRO A;  4ISF A;  4FWR A;  2NRW A;  4H0T B;  2PAV A;  3KVG A;  4HTL A;  2A41 A;  1BUP A;  4BVP A;  3EO3 A;  4B1U B;  3N4Q A;  3CJC A;  4BRC A;  3MCA B;  2A42 A;  4XH1 A;  3SJH A;  3Q7B A;  2FXU A;  3R9P A;  3VEY A;  2P9I B;  3UKU A;  3LDL A;  5I9E B;  1KQS M;  1TUY A;  2ASO A;  2QW9 A;  4CZK A;  4YOY A;  1RDW X;  1KC8 O;  5BRD A;  1Q86 O;  4YOR A;  1QZ5 A;  3VGK A;  1YVN A;  4GV3 A;  3UKR B;  1OKJ A;  4GV9 A;  5AQG A;  4DB3 A;  3G71 N;  5AQH A;  3WEE B;  3G6E N;  2P9L B;  4BRF A;  2CH5 A;  3CMA N;  4GNI A;  3CJA A;  3GDQ A;  4YOT A;  3QDK A;  3MK6 A;  3GG4 A;  3P31 A;  4OO1 J;  3ZET B;  2HOE A;  3LM2 A;  5AQS A;  5ADX H;  2QA4 N;  1QVF M;  2KKZ A;  1D4X A;  1WOQ A;  3SAG A;  1ZC6 A;  2ZWH A;  1NGH A;  3LM9 A;  3HI0 A;  4IEE A;  2AA4 A;  5GAE P;  4C1N I;  3E9O A;  3VF4 A;  3VTI A;  3L4I A;  2HBJ A;  3CHW A;  2D1K A;  4U7B A;  2YJF A;  3H6E A;  3KZB A;  3QB0 A;  4IOA L;  1Z05 A;  3C65 A;  3CD6 N;  3W0L A;  5BR9 A;  3ID6 A;  2I7N A;  2QWN A;  2VCP A;  5AR0 A;  4RWT A;  3ID8 A;  4O5F A;  3RSE A;  3O4W A;  3MWT A;  1P90 A;  4DQ8 A;  3IUC A;  4FWK A;  4IO9 L;  1GLD G;  2GWJ A;  3BEX A;  5AFU H;  5FPE A;  2Q97 A;  3CI5 A;  4A59 A;  5KPT A;  4KH6 A;  5AZI A;  3C7N A;  3UB5 A;  3EN9 A;  3HOT A;  3CQX A;  2I7P A;  3O08 A;  3AY9 A;  4OPA A;  3CC2 N;  2UYT A;  3CET A;  2DPN A;  1HX1 A;  3H46 O;  3O1W A;  4B1Z A;  3J7Z O;  2IVP A;  3FFK B;  2QI2 A;  1CZA N;  5BN9 A;  3A5M C;  3U4L A;  3DWL A;  4CZG A;  5AZJ A;  2FSN A;  3A5O C;  1P8Z A;  4JK8 A;  5H1S Q;  4JK9 A;  1NGB A;  4FSV A;  2ZJR L;  2P9I A;  2VGM A;  3D6R A;  5AQR A;  4FWP A;  1E4F T;  2QWL A;  2FSK A;  1BA1 A;  1QQN A;  3E9P A;  4AM7 A;  1SQK A;  1V4S A;  3UKR A;  3U9Z A;  4CI6 A;  3F5T A;  1DEJ A;  2ITM A;  5GIN A;  1YI2 N;  3WUH A;  2V51 B;  1HPM A;  4O8U A;  4QS7 A;  4PL7 A;  3T7Z A;  4BR7 A;  3U8X A;  3VET A;  2A6A A;  3A8Y A;  3EL2 A;  4EAH D;  5GAD P;  4R79 A;  3H3O B;  2GWK A;  4MO4 A;  4GV6 A;  3ZET A;  4ILH A;  3O9U A;  3HOS A;  3CME N;  2F9T A;  1QZ6 A;  2A40 A;  5B8H A;  3PIO L;  1LCU A;  4JKG B;  3N4P A;  4FOE A;  1VAZ A;  3BUZ B;  4H5V A;  4ILJ A;  4XEI A;  5C0Y A;  1VQO N;  4JKB A;  2BTF A;  4JK7 A;  3ZEU B;  3UE5 A;  4Z94 A;  3VEV A;  1K8K A;  3QBW A;  4XH4 A;  5M1N A;  4YOW A;  1MWM A;  3M1F A;  4GVE A;  3G25 A;  1NJI O;  5HOO A;  3TTC A;  5JLF A;  1J6Z A;  2D0P A;  4FWQ A;  1Z6R A;  4EFH A;  2P9P B;  1VQP N;  1M90 O;  3W3D A;  3SAH A;  3IKM A;  4MO5 A;  2ZF5 O;  2WFB A;  1HKC A;  4RTF D;  3CQY A;  3PLA A;  5FPD A;  4L3Q A;  1GLL O;  2F7T A;  2JWK A;  2IVN A;  3DJC A;  5AQO A;  4BR9 A;  2E2P A;  4WQ4 C;  3P39 A;  1QQO A;  1X9J A;  1YJ9 N;  3AAQ A;  1MA9 B;  5TKY A;  3PIP L;  3FZF A;  3T69 A;  2PFU A;  2QWR A;  1V4T A;  5AQV A;  3VGL A;  5KPZ A;  1ATS A;  1YJN N;  1ILY A;  1W2B M;  2P9S B;  4CZM A;  1NLV A;  2CH6 A;  4IOC L;  4JKD A;  5JLH A;  1KXP A;  1RDU A;  2ASP A;  3FGU A;  3OA9 A;  1ZXO A;  5EX5 A;  4BR4 A;  4G9Z A;  2WC9 A;  1YF5 L;  5AZJ B;  5AQZ A;  3CC4 N;  5GIP A;  3MN9 A;  4MDA A;  1E4G T;  3A0I X;  2ZGY A;  1TYQ A;  3WXI A;  2Q2R A;  3WQU A;  2W40 A;  5GAH P;  1RFQ A;  3TU5 A;  3VGM A;  1YAG A;  3CF5 L;  3FZM A;  3MN5 A;  1G99 A;  3FZL A;  4FWM A;  4IZ9 A;  3ATU A;  1YHQ N;  1K73 O;  1MWK A;  4JKG A;  5FPM A;  3QFU A;  2H3G X;  2A5X A;  2NLX A;  3SLC A;  1ATR A;  3ENB A;  4PKG A;  3P38 A;  3ZEU A;  3FZH A;  5JIC A;  1VQ7 N;  4CD1 A;  1NGI A;  1GLJ O;  4FPB A;  4IJN A;  1JJ2 M;  5TKW A;  2W41 A;  3VER A;  3ENH A;  4BG9 A;  4FWO A;  3DAW A;  4KBO A;  4LC9 B;  3L4Q A;  5KPR A;  1S72 N;  3WXK A;  1VQ9 N;  4E1J A;  5ADX A;  2P9P A;  1OVY A;  5AQJ A;  1H1V A;  3E66 A;  1K8K B;  5CE3 A;  3MWP A;  5LJW A;  5JVH L;  1DGK N;  3CCS N;  3QFP A;  3R3L A;  4MLE A;  3LDP A;  4BG8 A;  3WXJ A;  3WXL A;  3AAP A;  3HM8 A;  3KWG A;  3NVM A;  2F9W A;  4PL8 A;  5AQL A;  3IFR A;  1VQ5 N;  2FF6 A;  3VTH A;  2NZT A;  1BG3 A;  1BO5 O;  3FLC O;  2CGJ A;  3MCP A;  4H0Y B;  4BRQ A;  5F1X A;  3CCV N;  2QXL A;  5AQK A;  1X3N A;  1ATN A;  5AQF A;  1BDG A;  1NBW A;  2YHY A;  3D2F B;  3E9L A;  4H5T A;  3FZK A;  1YJW N;  4H0V B;  4K25 A;  1EQY A;  1GLA G;  3BF3 A;  4DKW A;  5C2D A;  2P9N B;  3TTD A;  3EE8 A;  1XQS C;  3F2K A;  2HMP A;  2P9S A;  5AFU A;  5C10 A;  2AP1 A;  3A5N C;  1YIJ N;  4IO8 A;  5AQQ A;  4CD3 A;  4K42 A;  4CZJ A;  3H3N O;  4H5R A;  4GY2 B;  5M1P A;  4BRL A;  5LY3 A;  1N8R O;  1NWK A;  4A2B A;  1IJJ A;  1S3X A;  2GUP A;  4JKA A;  2HST A;  4M7Y A;  1NGD A;  2IIR A;  1SZ2 A;  2D4W A;  3Q7C A;  4FOI A;  1U6Z A;  4AF1 A;  1K8A O;  1GLC G;  3EZW A;  5ELZ A;  1HKB A;  3L0Q A;  4H5N A;  4WQ5 A;  3OBY A;  2YCH A;  3H45 C;  3DXK B;  2OAN A;  2ZGZ A;  4IJA A;  3CPW M;  3GOI A;  1EO1 A;  4BRM A;  3CJ7 A;  4FPA A;  5MLC Q;  3KWI A;  2KHO A;  5AQW A;  1TYQ B;  4WYB A;  2E2O A;  1Q81 O;  4BRI A;  3U9D A;  2QM1 A;  2E8A A;  4BRH A;  3I56 N;  3OHR A;  4FWS A;  5AQX A;  4CJ7 A;  3MMV A;  4A57 A;  2KLA A;  1KAZ A;  4JHD B;  3VEW A;  4BR0 A;  4FO0 A;  3CJB A;  4CZL A;  4BC4 A;  3ULE B;  2QWO A;  4H0X B;  3VPZ A;  2PBD A;  4OPH A;  3E1Y A;  1TUU A;  4B9Q A;  3O9R A;  4JD2 B;  1HJO A;  1QQM A;  2Q36 A;  4QS9 A;  4BRK A;  4DCH A;  4MDB A;  5HL7 L;  2NRH A;  4NLB A;  1YIT N;  5F2R A;  4PKI A;  2YI1 A;  3CIP A;  3D2E B;  3VEO A;  4DHY A;  1X3M A;  3D2F A;  2QWP A;  1YUW A;  1VQL N;  2JWL A;  2CGK A;  3SMS A;  1Q82 O;  2OTJ N;  4U67 L;  2P9N A;  4YOU A;  5M1K A;  5M1Q A;  4CBX A;  3VOV A;  1JCG A;  3LDQ A;  3CCU N;  4BRA A;  4B1Y B;  4JNE A;  2NNW A;  2GTD A;  3OW2 M;  4Y0W A;  2IVO A;  3O9S A;  3EE9 A;  1ZBS A;  3MN7 A;  1VQ4 N;  4PKH A;  3NVK A;  1JCF A;  3CCR N;  3O9Q A;  2FF3 B;  2P9U B;  1S22 A;  4BQL A;  4WF9 L;  5AQU A;  5BRF A;  4JEP A;  5EVZ A;  1O13 A;  5AQY A;  4F9O A;  2QWM A;  3GBT A;  2J4R A;  1Q18 A;  2Q1N A;  1BA0 A;  2YJE A;  3K9J A;  3O80 A;  4J8F A;  1GLB G;  4CZI A;  3BF1 A;  5EXW A;  2NRZ A;  2RHK A;  2NRT A;  3DXK A;  1NGA A;  3TSP A;  1U2V A;  4BGA A;  2QEX N;  4WQ5 C;  4WCE L;  5BRE A;  2NRR A;  5JMV A;  4BQZ A;  5C12 A;  3O5B A;  4JAX A;  5M1O A;  4BRP A;  3TSQ A;  2GEM A;  5GIO A;  2RE2 A;  4C23 A;  5C2F A;  2OTL N;  5BPL A;  1Y64 A;  3CJ1 A;  4IOX A;  2WBN A;  5DM6 L;  3ATV A;  4YOV A;  2ZJQ L;  1SS6 A;  4JKE A;  2Q0R A;  2EWS A;  1YXQ A;  1KAY A;  4FWN A;  3MN6 A;  1T44 A;  4JHD A;  3GE1 A;  1T6C A;  3ULE A;  1Q7Y O;  4EHT A;  2NRX A;  4NB4 A;  3MX5 A;  3FR0 A;  3JXU A;  4WFA L;  4IDH A;  4BC3 A;  1SAZ A;  4JD2 A;  3DXM A;  3WQT A;  1QVG M;  2FSJ A;  1MDU B;  3LL3 A;  1C0F A;  5C15 A;  1T3V A;  4XH5 A;  5E84 A;  3C6H A;  2D0O A;  1VQ8 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...