4U67L

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4u67L01
3PIOL 5GAHP 4WCEL 1K9MO 3G4SN 1W2BM 1YJNN 1QVGM 1K8AO 1M90O 5GAGP 1NJIO 5JVHL 3CCLN 1Q81O 3I55N 2QA4N 1JJ2M 3G6EN 5GADP 2ZJPL 1VQ8N 1VQ5N 4UY8O 2ZJQL 2OTLN 1YITN 4IOCL 3CCJN 1OVYA 3CCRN 1VQON 1M1KO 4WFAL 1QVFM 1YHQN 1YI2N 4WFBL 3CF5L 1Q82O 1Q86O 3CC7N 4IOAL 2QEXN 1VQLN 3CC2N 3G71N 1VQ6N 2OTJN 1VQ4N 1VQ7N 5H1SQ 5HL7L 1YIJN 4WFNL 4WF9L 3J7ZO 1N8RO 3CCSN 3CPWM 3CCVN 3CCMN 1KQSM 1S72N 3CC4N 1YJ9N 3CXCM 1YJWN 3CMEN 1VQ9N 1VQMN 3CCEN 3CCQN 3PIPL 4IO9L 3CD6N 5MLCQ 1VQPN 1VQKN 1VQNN 1KC8O 3CCUN 5DM6L 4U67L 1K73O 3OW2M 3DLLL 3CMAN 3I56N 2ZJRL 1KD1O 5DM7L 5GAEP 5JVGL 1ILYA 1Q7YO
chains in the Genus database with same CATH superfamily
4Z4CA 1CLQA 4XEIA 3AY9A 4FJJA 1FW6A 4OKKA 1ZXOA 3O08A 3D2EA 1XHXA 3MX5A 1LAWA 3MN7A 3G6EN 4BRDA 3S41A 1C1CA 4M3WA 3CI5A 2XHBA 5HOOA 1VRUA 2ZGZA 2UXCK 1U2VB 1S1VA 1CXUA 3KK7A 4DTRA 3OYNA 3CHWA 1N5YA 2WC9A 4ZHRA 3M8QA 3A2FA 1TKTA 1LCUA 5ADXA 3ZSZA 3O3GA 4IJNA 3AAPA 4C8KA 3QFPA 3OJSA 4F2RA 3WNGA 4CJ7A 2GUPA 2XRIA 1KVCA 5BRFA 2LSNA 4DV6K 4EAHD 3DXKB 1L3TA 1R59O 4ELTA 5BRHA 4MO4A 3ENOA 1HNIA 3MCAB 3ZSYA 4RW8A 4OPHA 4EP5A 1TV6A 2EX3A 1QQMA 1YVUA 1IKWA 4AHCA 1B9DA 3WXIA 4CJSA 3FR0A 3LDOA 4BRIA 3QEVA 4CHYA 4BRKA 4FJXA 3VQ7A 4FJLA 1NK7A 3QIPA 3OYHA 4FCYA 3QBWA 4ID5A 3UKUB 3I8DA 1I94K 3A5NC 3VPZA 4CJUA 1N6QA 4DTUA 2QK9A 2VG7A 2VWKA 5LL6Z 1QZ6A 1U47A 2HOEA 3H45C 3NGIA 1SQKA 2AA4A 3CM5A 3A5OC 5FPDA 1N36K 2OPRA 4CIGA 5KQDA 1IG9A 3FZLA 1C0TA 1V4TA 3OYMA 2P1JA 2BH1A 4IJAA 5TKYA 4CBWA 5AQRA 1TVRA 4DV1K 1NNEA 4DCHA 1SAZA 1SV5A 3ZYYX 4DQIA 2AP1A 4E1MA 4H0VB 1VAZA 2YHXA 3N4PA 3CQ8A 4CJQA 4DUZK 3P4IA 1FXXA 3TSPA 4DQ8A 3ZETB 2XY7A 3S3NA 1U48A 4BG9A 3GBTA 4RCHA 3DI6A 4CJ3A 1QSSA 3DLKA 1BG3A 4H0PA 3VF2A 4YNQA 1IG8A 4FWMA 1RT4A 2W6LA 2P9UB 3U9DA 3KK1A 4C8LA 2NZTA 5AQYA 3VQBA 2FLOA 2IVPA 1QZ5A 4JKBA 2CH5A 5AQMA 2G8KA 3ZEUA 4BWJA 4Y1CA 2YHWA 5IWAK 2W42A 3HZ6A 1WLJA 4Z0UA 3VGMA 3E01A 4FLTA 1BDGA 2BE2A 3H46O 1HYSA 4JV5K 4PKHA 4DQQA 1VQ4N 2FBVA 3SLCA 5M1OA 4CFDA 4M45A 3CCSN 4JAXA 3V1OA 5AQFA 3AVMA 4E0DA 5F2RA 2ZQBA 4ILJA 3P38A 3MEGA 2HHTA 4E1JA 5J2PA 4ID1A 1GLFO 3OS2A 1YJWN 2NRXA 1MDUB 1KLMA 4KI6A 5F0XA 3AVBA 1S1XA 4BRFA 3CD6N 3E9OA 3CETA 4BRHA 1HMVA 2P9SB 4B1WB 3WNHA 2HB5A 3HM8A 3EN9A 4MDAA 3HM9A 3VESA 3ATUA 2NRHA 3I56N 4PA1A 5HP1A 2J4RA 2P9PB 3SNNA 3KWGA 2UUAK 4BACA 3OY9A 4OO1J 4O5BA 4KPYA 3DLHA 4GV3A 3LZJA 5JICA 4FJNA 3AO5A 4RTFD 4BC3A 3VQ9A 1TK0A 3G10A 2HSTA 3WEEA 1EETA 3RMAA 1L3UA 3PUFA 1ZBUA 1U4BA 4FO0A 3ENBA 3FZFA 2NRZA 2YKMA 3EYZA 3OA9A 1WNSA 3RMBA 1T7PA 4KHYA 3DXMB 4WQ4C 4BRQA 4IG3A 3SBGA 1EO1A 3SUNA 4JHDA 2ASOA 3EE8A 2HHQA 4IFYA 3AVCA 3THWB 1TUUA 3MMVA 3HSCA 1YITN 2D0CA 2HHHK 2WUSA 4FLVA 4PUOA 1JLEA 3BY5A 3UKRB 2Q1NA 1XMQK 1KFSA 3I33A 1QVFM 3IAYA 3ZLJA 2FXUA 1T8EA 2E20A 1Q9XA 4I9LA 3AVIA 1NK9A 2OZSA 4J2BA 4NXNK 4NCAA 3AV9A 2IVNA 3LDSA 3ID6A 2D4WA 3KTQA 5B8HA 1U2VA 4JI6K 3LPUA 4JI2K 5H1SQ 4F3TA 3NF7A 3SJHA 2HNDA 1BQMA 2BTFA 2ETJA 4H5TA 5HLFA 3CPWM 4NXMK 1WBBA 3OJUA 1P8ZA 4BC4A 4B08A 3SV3A 1BHLA 3AA3A 4YY3K 1LV5A 2GBZA 2YI1A 4IZ9A 3PSFA 4M3ZA 3CXCM 1KSPA 4DFMA 4CHNA 3DXKA 4RW9A 3LM9A 5BPLA 2O8EB 4BE0A 1T3VA 3QEWA 4IO9L 4DV0K 4FWSA 3KLFA 3LP3A 4M3YA 2DY4A 4FJIA 3NF9A 3VQQA 1K73O 1NGFA 3K9KA 4DTXA 4FYDA 2KQ2A 4DF8A 3HK2A 4LFAK 4JRQA 1HPMA 1RT2A 4TSXA 5JS1A 2YHAA 4FWOA 1CXQA 2HHWA 3O8MA 3VEOA 4Z94A 3ULDA 3QBXA 4JI8K 4B1XB 4CW7B 3KD1E 4IKFA 2A40A 5GIOA 3G4SN 4B1UB 1EQYA 4B9UA 1P90A 3UKUA 1M90O 1RBVA 3DAWA 2XY8A 2YKNA 1TKZA 3CJBA 3QINA 4PQUA 4OKEA 3PLAA 1GOAA 3KLHA 3VA3A 1RTIA 4NB4A 3R1XA 4CE9A 1X3MA 3R3LA 5AFUH 3BEXA 4KB0A 1G99A 4IOCL 4CJTA 1VQON 4B3MK 4E7HA 5CYMA 2FF6A 2A1RA 1F21A 3ZETA 1ZBFA 4FW2A 3KWIA 2ZF5O 1B92A 5M1KA 4RWTA 3EL2A 2F9TA 2RPIA 4I2QA 2OPQA 1I39A 4JKCA 1BU6O 4NYFA 4CGDA 2FC0A 1NMNA 1U04A 3D6RA 2P9UA 3AVHA 2E1YA 2UUBK 1X9JA 4CGFA 4CJLA 1YJ9N 4OX9K 3ZSWA 3OBYA 5GIPA 2NRRA 4DU4A 4LF7K 4HUEA 4N5SA 5FPEA 4FM2A 3B8AX 4LH4A 2IOCA 4Z4HA 3LM2A 3AO2A 4NLBA 4OPAA 3CJCA 3CCUN 3K5OA 5DM6L 1S1TA 2X6SA 2JLEA 1C0FA 1KRPA 1ATRA 3CMAN 4CHZA 1EP4A 4DSLA 3T69A 1YAGA 2W6KA 5C42A 2NRTA 3HO1A 3K2PA 3FFKB 4H8KA 3P39A 1T6CA 3MEDA 3V9ZA 1GLJO 4OGEA 3VENA 5FLXO 1WSFA 3U9ZA 1OKJA 3HYFA 4CIFA 3H1QA 3VN5A 3VGLA 2G8IA 1SZ2A 3DRSA 5GAHP 1BO5O 3MX2A 1RT7A 1GLEG 4B9LA 4DR4K 3MDQA 2P9SA 4FLYA 2F4VK 4KTZA 2ZJPL 1J5OA 3DOLA 1NWKA 1BI4B 2P9PA 3DLRA 4IO8A 3WNEA 4CJEA 2ZGYA 3LL3A 3PX0A 1WSIA 4W5OA 3J7YP 1HKGA 4DTPA 4LSLA 4NCBA 4DTSA 3KK2A 1RTJA 1EWRA 1KTQA 5LY3A 4LFBK 2A5XA 4CEAA 1L3SA 3CCRN 2PZSA 4Z4GA 3AVLA 5CR4A 3SMSA 3K5LA 3CF5L 3SQ0A 4CF2A 4DUYK 4JKAA 4AHUA 1BOTO 3HXMA 3R6MA 4FSVA 3SMPA 3NF6A 5SZTA 4KTQA 3CJAA 3S9HA 4C8OA 4QCLA 4B1VA 3OYDA 3DXMA 4YOVA 3C7NB 2HW3A 1VSHA 4BVOA 1YIJN 2V52B 4HTUA 2KLAA 5AQXA 3SBTA 3THWA 2W41A 3CCVN 3OYIA 3DLBA 3IG1A 3NE6A 3UKRA 1RDCA 2Y1JA 1BWFO 5FPMA 3M8RA 3ZT3A 1C0MA 3E9LA 4A57A 3GL1A 3OHRA 1E4FT 4CZGA 4JD2B 1TGOA 4IOXA 3O3FA 1KC8O 1EXQA 2CH6A 2G8HA 3OW2M 3ULEB 4PWDA 1JLGA 3BUZB 5C2DA 3NDKA 5E84A 4BQLA 2HMPA 2WFBA 4IXCA 3NGZA 4Q5VA 5AZJB 1ZBIA 1NJZA 3OYCA 4DTJA 2O8EA 3QNOA 3UE5A 2D0OA 2Q2RA 4CEBA 4CK2A 2NRVA 2FSJA 4DV5K 3MN9A 4K43A 4WCEL 4R5PA 4FOIA 4FWRA 4CFCA 4QOZB 2ZD1A 5JVHL 3SQ1A 5LMNK 3HSTB 3I55N 2D0PA 1OVQA 1RFQA 3KZBA 1L3VA 2UXBK 1WN7A 1KAYA 3LDNA 3G0ZA 4FZZA 3VOVA 1JCFA 3MECA 1OH8A 2HNYA 4FW1A 1NGCA 3FZHA 1U6ZA 4OLAA 2F7TA 4DHYA 4CGJA 4DV3K 4DSEA 3AO3A 1S9EA 4DSKA 4BR2A 1NK0A 5CYQA 5E41A 4DTMA 4H0YB 3AVJA 3M3ZA 4B3TK 2YV0X 2V51B 4KBOA 2UU9K 3KJVA 3RR8A 4A5BA 4LSNA 4KB1A 1HX1A 1YTUA 3SZ2A 4IOAL 2F8SA 1QHTA 3C95A 2ZM6K 5M1NA 1YT3A 4HVJA 3IFRA 4FLXA 1EX4A 3QEPA 4JS4A 1WSJA 3A5LC 2HHVA 3DYAA 1D9FA 1LWEA 2E2OA 4CZHA 1VSEA 4E19A 3SAGA 1UA0A 4JI3K 4H0TB 4AHSA 4DR1K 4F2SA 1HUXA 2PFUA 4DMNA 4AILC 2E88A 4LH5A 3H6EA 3HOTA 4N76A 3D45A 1Z26A 2KFNA 4HUFA 3P31A 1VSIA 4CZFA 4OGCA 5I42A 1S22A 3M5RA 4CHQA 5IT9O 4IWVA 3TAEA 4NO7A 4KAZA 3VQCA 5CHIA 1NJWA 5T7BA 3LDPA 1BGXT 3SQ2A 1JXBA 3LDQA 5DM7L 3LP2A 4FWPA 4O8KA 2BUPA 4LF5K 4BE1A 3BZKA 1VSFA 1X9WA 4YFUA 1XWLA 1J54A 1VK0A 3OYEA 2BGGA 5CY4A 5GAGP 2DFFA 4AHRA 4CJWA 2QA4N 4E7JA 5HRRA 3AO4A 2B4JA 4H5VA 2RN2A 4E89A 3HT3A 3VQAA 3LWMA 2GTDA 4WYBA 3ZX3A 1T44A 1WSGA 1WB9A 2QM1A 5EU7A 5JMVA 3D0PA 4J2EA 1TKXA 3O6WA 4FJ8A 4M3UA 5LJVA 3SYZA 1HQEA 1HPZA 3QO9A 3EE9A 4E7KA 4H0XB 5J2NA 4KH6A 1OH5A 4WFAL 4BRGA 3BF1A 4CEZA 3CFPA 2GWKA 2O8FA 1LWFA 4FVUA 1BI4A 3IKMA 1T03A 3NHGA 4M42A 4DG1A 4CESA 4YDUC 2QKKA 2FSNA 1C1BA 4B8AB 4E1NA 2VWJA 1XI1A 4DV4K 3J7ZO 3MCPA 2QWMA 3K9JA 2O8CB 3ZX0A 1WAJA 3DM2A 3LPTA 1IJJA 5AQWA 2EWSA 3QMLA 1C0UA 4FZXC 2HVIA 2QXFA 4CECA 4EZ9A 2V7ZA 4AM7A 3JSMA 2OA8A 5AZIB 3AO1A 3CIPA 1VQMN 1GLLO 1XC9A 4B9TA 3C65A 3QESA 3C7NA 1K6YA 3RSEB 3ENHA 4A5AA 4KFBA 5AQSA 2DPNA 2CGJA 5EY4A 4U67L 4FL9A 3MN5A 1KAXA 3B6OA 5JS2A 2IVOA 4NLCA 3ZSVA 3VQ8A 2G8UA 3W0LA 1LOTB 3JYTA 1XHZA 3NVKA 2HBJA 3TU5A 3BP8A 3O9UA 5D3GA 4KHPK 1X3NA 2E8AA 4JD2A 3T19A 4OPJA 4FOEA 2P9KB 3TAFA 1NK5A 4LF8K 4X62K 1RT6A 3ULEA 3Q7CA 3NFAA 2ITMA 4N56A 4CK1A 4ZTFA 4ELUA 3QDKA 5EOYA 2ASPA 2QXLA 2QW9A 4ICLA 3EZWA 1HKBA 2Q97A 3L4QA 5BR9A 4KKOA 3SUOA 5AZJA 4J2DA 1O13A 1DTTA 1NKEA 4EFHA 3C6HA 3VEZA 1EWQA 1XC3A 4K42A 5FPNA 4OLBA 3J8AA 3L6QA 1M1KO 4L8RB 1Q82O 1KLNA 3MWPA 4CCHA 1Q9YA 2KFZA 4ZTJA 2W40A 3QEXA 1TAUA 4GKJK 4CBUA 1VQ6N 4H5RA 2OTJN 4FPBA 1CZ9A 3W3DA 1J53A 4JN4A 1RILA 3WT0A 1D4XA 2IS3A 2WONA 1S6PA 2ATQA 5FROA 3Q7BA 1HYVA 5EVZA 4DLEA 1VSKA 2YCHA 4CJPA 1E3MA 1ATSA 2F9WA 4YOUA 5DK5A 4GNIA 2D5RA 4K8XA 1W7AA 1UOCA 5E26A 2YNIA 3BDPA 4B1YB 5BR8K 3LP0A 2BDPA 4DSIA 4KRFA 2RKIA 2VYPA 4PKIA 4BC5A 3KVGA 3FLCO 2Q36A 4ILHA 2X6NA 2A41A 1QHAA 1VRTA 4FK4A 1SUQA 3FGUA 1CZBA 1LWCA 5AQIA 4YOWA 4JI4K 3QETA 3QNNA 3O4QA 3ZT1A 3TABA 4WQ5A 3OBWA 1HRHA 4BRMA 1NK8A 4PY5A 2VG6A 1RDWX 1NJIO 3CCLN 1Q81O 3AVFA 4JK9A 3MXJA 2A3ZA 4DFJA 4DV2K 3HL8A 4CJFA 3SQ4A 3BGRA 5KTQA 2OANA 3GDQA 3CJ1A 2OTLN 1TL3A 4B8CA 1JLCA 1NGJA 4Y0WA 1QQNA 1RTDA 3EY1A 4KHWA 1J9AA 3O3HA 4JKFA 1YI2N 4I7FA 1KXPA 3ASMA 3MXMA 1Q86O 3L2UA 1BA1A 4PHTX 3UIQA 3EEQA 4FWKA 1JL2A 1VSJA 3C6UA 1SKSA 3NH0A 1BCOA 1HR0K 1T05A 1LAVA 2GWJA 5C2FA 2O8BB 1VQ7N 1S9GA 1NU0A 2Q0UA 3SJJA 2VQEK 5AQVA 2QWOA 3OYGA 3OYAA 1N8RO 1RBTA 3D2FB 3R8EA 3HPHA 2ZE2A 2QI2A 1IKXA 4A59A 1ZBHA 3EZ5A 4KHQA 3N4QA 3CQYA 4CZMA 3SI6A 4F3OA 5K14A 4EHTA 4AH9A 1VQ9N 3LALA 1KVBA 2KZMA 5BRDA 3V9WA 3T3FA 3OTOK 4BR9A 4CF0A 1K8KB 5TKWA 3ZSOA 4BC2A 4CGHA 4FZYA 3BZCA 1JLAA 1ESVA 2HNZA 4FK0A 3L2RA 2O8CA 3OVNA 3WXJA 1JLQA 2IAJA 5GAEP 4JYAK 1DT9A 1RBSA 3CERA 3NH1A 3THXB 1NGDA 5ADXH 2I7PA 5AZIA 2E5LK 3PIOL 4I9QA 4W5QA 3OYFA 3VEYA 1HJOA 1NLVA 4HUGA 1W2BM 4KH5A 4JEPA 4CI6A 3RSEA 2QWQA 3NVMA 3SV4A 5HROA 2DFEA 4BGAA 4PL8A 3T7ZA 3VEXA 4O8UA 5GADP 3JXUA 4FWQA 5FRNA 3QERA 4G1QA 4BDYA 1NK6A 4BDPA 3VQ4A 3RMCA 3KD5E 1JL1A 4CEDA 3EKSA 4CJ5A 4EHUA 5BN9A 4B9NA 3T1YK 4KHNA 2A1SA 2ZJQL 4DR5K 3T1HK 3LAKA 4XH1A 1ZBSA 1VSLA 5CE3A 2CGLA 2HHSA 5KPTA 2P9KA 4CGIA 2IIRA 2E2PA 3ALYA 2PBDA 4DSFA 1YHQN 4WFBL 5LJWA 3O1WA 2QEXN 3AGRA 1FK9A 1SL2A 3CC2N 1RT1A 1RBRA 3THYB 4FWNA 2YHYA 2VG5A 4BDZA 4QS8A 2HVHA 3CJ9A 1NGEA 4BRLA 4FVMA 3KKSA 1S72N 2VCPA 1UA1A 3UB5A 3GOIA 3RWUA 3HTVA 3J81O 4CJRA 4O0IA 3C6AA 3H3NO 2HBLA 3A8YA 1S1UA 4AHTA 3ZSRA 3HRGA 5HBMA 4C23A 4CVNE 3D7EO 3VTHA 2X78A 2P9LB 3EKUA 3GG4A 2WTUA 3HJFA 3DLLL 4I6MB 3V9XA 2QKBA 3SUQA 2Z1JA 3U3YA 2Z1IA 2ZJRL 1NBWA 3V81A 1LW2A 1RTHA 3PV8A 4DTOA 4YHHK 2NRWA 1YXQA 5AQHA 2V7YA 4H5WA 1XNRK 1N32K 3B6PA 4KHUA 1C1AA 4RW6A 4JI7K 4M7XA 5CZ1A 1MWMA 5KPZA 5C12A 1BQNA 4OKJA 3S3OA 3FFIA 3VEVA 4DR7K 4MFBA 4CF9A 3ATVA 2P5OA 3EO3A 1W97L 1BCMA 4CFBA 1NKCA 3LP1A 5FRMA 3WNFA 1BA0A 3ZCMA 3K0SA 4HHTA 4M3XA 2RE2A 3T1AA 1UAXA 3AVKA 5EX5A 2PAVA 1HKCA 1WOQA 2IDOA 1VQ8N 5BREA 4CEFA 3CPEA 5KI6A 4F8RA 2KTQA 4H4MA 3KHYA 4EZ6A 3SPZA 2OPSA 3O9SA 5BPNA 3K5NA 1TL1A 5HRPA 3TAGA 3NMUA 4B9SA 3CQXA 1J6ZA 4ISEA 3MEEA 2D0BA 3A0IX 5J2QA 4FJ9A 5JLHA 2E4LA 1MWKA 2E2QA 5AQLA 4OJRA 3HVRA 3RTVA 2OZMA 3O9TA 2D0AA 3WQTA 3M1FA 4RW7A 2ITGA 3H3OB 1NOZA 1D8YA 3ZSXA 4CEEA 3MXIA 4LF6K 4IFVA 4GKKK 4C1NK 3KK3A 3O4NA 3OYJA 4GV6A 3PY8A 1HNVA 2R7YA 2WOMA 1JCGA 4L3QA 4A61A 5KPRA 2IC3A 4W5NA 1FKPA 4CJKA 4FXDA 3PIPL 5AQUA 3NBPA 4WE1A 1VQPN 1XNQK 1NG9A 2FF3B 3CG7A 3FE1A 2O8BA 3VQEA 4IFEA 4DLGA 3WXLA 2E6MA 2OYQA 3O9QA 1KFDA 5JLFA 1WSHA 2G8FA 4B3RK 5AQPA 3D2FA 1RGIA 1KD1O 1O1WA 2YNGA 4FJ5A 4KI4A 1I3AA 2X74A 3VQPA 4NCGA 1HNZK 2PYJA 3ZT0A 4DFKA 3RRHA 2DTUA 1DTQA 2JWKA 3VA0A 3THVA 1K9MO 3QEIA 4BE2A 3A5MC 3L3VA 4KHSA 1K8KA 4C1NI 4JI5K 3U4LA 3VMFB 1BISA 3ISNC 3TSUA 1CZAN 4WQ4A 1IBMK 1E4GT 1Q8IA 3QFUA 1ITGA 2GEMA 4YOXA 3F9KA 5M1FA 4IBNA 4AHVA 3THXA 2GUIA 1RDUA 3DRPA 3CM6A 3VERA 3CFRA 4F4KA 2O4GA 5F1XA 1X9SA 2XO7A 2B5JA 3VQ6A 1QTMA 4QS7A 1KAZA 2B6AA 1VHXA 3TAQA 4BR5A 3HPGA 4IG0A 1NJXA 3J7AP 3HVTA 4H03B 4BRPA 3VETA 1IKVA 3IRXA 3PO4A 2QWPA 1DKGD 3V1QA 3TWHA 3C0BA 1RCHA 5HL7L 2Y1IA 4QAGA 5AQJA 5FDLA 4CF1A 1KCFA 3IDHA 4N47A 1S3XA 4ISFA 2NLXA 4OPKA 3ITHA 3ID8A 1TK8A 2KKZA 1HQUA 4O0JA 3NCIA 3DLEA 1ASVA 2UYTA 4JKEA 2CGKA 3L4IA 3L2VA 1SKRA 2FBXA 4YOTA 4M7YA 3CMEN 3QIOA 3V1RA 1N33K 3VGKA 2PY5A 4H0OA 3G25A 4CZIA 3IMXA 3TTDA 4FLWA 3THYA 3VQDA 1NGHA 3SUPA 3BF3A 1HNWK 5KRTA 1YTAA 2D1KA 4Y1DA 4DR3K 1QSLA 4BVPA 4BR7A 4QS9A 3HP6A 2YJEA 1B9FA 3HP9A 1D9DA 2DFHA 4BRCA 2FBTA 3MAQA 2P9IB 4HTLA 3F73A 4B1ZA 3TARA 2P9LA 3PSIA 2P9NB 1GLCG 1YJNN 1V4SA 1GLBG 3AA5X 4Z4EA 4ILGB 3WUHA 1NGIA 4RG8A 4MDBA 4I6MA 3HOSA 3CYMA 2OCEA 4FM1A 4K0KK 2HBKA 5J2MA 3ZSQA 3TAMA 1YUWA 2O4IA 4JS5A 5AR0A 4LF4K 4PL7A 3OYLA 4JKGB 4XIUA 1VQ5N 3SAHA 5HRSA 3L2QA 1ASUA 3VF6A 1NJYA 3ZT2A 4G9ZA 3OYBA 1Z6RA 1TAQA 3WXKA 2KZZA 4DTNA 3LZIA 2QWNA 4M3RA 4BY9C 3AARA 1IKYA 4CHPA 4FJHA 4J2AA 1TK5A 4FM0A 4DSJA 2P51A 4DR6K 2G8WA 3WQUA 3TTCA 3G71N 1IBKK 4AF1A 5AQQA 4B3OA 1IV0A 2E1ZA 3MN6A 4IEEA 4WF9L 2YX6A 4HWIA 1RT3A 3U3GA 1S5JA 3I0RA 4IDHA 4EP4A 3L3UA 1JCEA 3LDLA 3QB0A 1NKBA 4NYNA 1A5VA 1G15A 3OS0A 4FJ7A 1VQNN 4FJGA 4JLHA 1RDAA 4PKGA 3NF8A 5KGWA 1Y64A 1BIZA 4C8NA 1WSEA 3M8PA 4O55A 1IH7A 4CIEA 4MLEA 3RMDA 3E1YA 4KREA 1SS6A 2XY6A 1X9MA 3L0QA 1MA9B 4Z4IA 5AQOA 5AQZA 4A2AA 4E7LA 4LY7A 4DWIA 1ZC6A 2F8TA 3M8SA 5GINA 1K8AO 1SL0A 1BL3A 1WBDA 1JJ2M 2O8DB 4ISGA 3K57A 3TTFA 1S1WA 3DJCA 4KTWA 4CJ4A 3P1GA 2AJQA 2YNFA 4BROA 3C6TA 2UUCK 1TYQB 2Q3SA 1U45A 4N41A 3F9MA 4Q0BA 4R79A 1QS4A 1REVA 1Y97A 1QE1A 1Z25A 3DMJA 3CCJN 3PX4A 1NK4A 1OVYA 3FZKA 1J5EK 1GOCA 1S6QA 4U7BA 3KKRA 1A5XA 3OS1A 3MK6A 2NUBA 1VSMA 3JAMO 3CC7N 3S3MA 4A62A 2P5GA 3HPOA 3AVGA 2WBNA 3IS9A 4DR2K 4F9OA 4CGGA 4IDKA 1TKDA 2HMIA 3V9SA 3AA4A 1L5UA 2Z1GA 4K41A 2RHKA 3TPQA 4X64K 2RF2A 4EIAA 2VGMA 1KQSM 1RBUA 4JKHA 1T6DA 1JLFA 1SL1A 5AQTA 3I0SA 4K25A 4DS4A 3QLHA 1GOBA 4CZEA 3NAEA 3TI0A 2FSKA 4B9QA 2YHBA 4M63C 3L8BA 4DKWA 3KLEA 5MLCQ 1FKOA 3P83D 4KV8A 2UXDK 1JKHA 2I5JA 1ATNA 1IO2A 4CZLA 4DU3A 4BWMA 3D2EB 4O44A 3R9PA 5SWMA 4KO0A 5AQKA 2PYLA 3DWLA 3K59A 5C24A 5A2QO 4LD0A 1C0GA 4IEIA 3TR8A 5KQ8A 1Q18A 4CZJA 5JVGL 1QQOA 2IGIA 4BQZA 4JRPA 1NOYA 3VQ5A 1Q7YO 2JGUA 3RVCA 4JNEA 5BN8A 2HBMA 4CD1A 1JXEA 3V4IA 4DF4A 2HF3A 3E66A 3VEWA 3DRRA 4FLUA 1QVGM 1BUPA 4FJMA 3WXMB 5C0YA 2NNWA 2E6LA 4GVMA 4AM6A 1ZBLA 3L2WA 1OH6A 2KW4A 3O9RA 1TUYA 4HCCA 3RRGA 5M1QA 1GLDG 3AA2A 3M6GA 1H1VA 4O4GA 1UWBA 1SKWA 1XQSC 4BRAA 2I7NA 3VF4A 4DB3A 2GV9A 1OH7A 4CERA 5C25A 1HYZA 4M41A 2Q31A 2G8VA 3PO5A 3K58A 2P9IA 3DLGA 1NGGA 1GLAG 4K8ZA 3KIOA 2P9NA 1NGBA 1N34K 3MWTA 4ELVA 1WAFA 3SAFA 4DQPA 2HHUA 3O4WA 4MLHA 5HRNA 4B9MA 1DLOA 3IUCA 5M1PA 3PX6A 3O1BA 1RDDA 3H1VX 5LMUK 4FJKA 1VQLN 4GY2B 1LW0A 5C15A 2VWBA 1MU2A 4FPAA 4CHOA 4J8FA 2VGNA 3AVAA 2QWRA 4JKGA 4AQYK 1IBLK 1VSDA 4CEOA 4WFNL 1BIUA 1D5AA 1KVAA 3V6DA 2HF4A 3V9UA 4DQRA 4DU1A 4X65K 4Z4FA 4I2PA 4UQGA 4CBXA 3HI0A 4XH4A 3QICA 1HJRA 1XUPO 1WUAA 3FZMA 1U49A 3CCEN 2OPPA 2A6AA 1ZYQA 3CCQN 2XY5A 3TSQA 4JK8A 3O80A 3TAPA 3AAQA 4DV7K 5EXWA 2A42A 4GV9A 1RNHA 4JK7A 4YOYA 3H08A 4DQSA 1NM1A 5DMRA 4V19S 4LF9K 3KLGA 4BGBA 2O8FB 3ZX2A 3LWLA 2EHGA 3U8XA 1YVNA 4H4OA 4BRNA 1DGKN 3F2KA 5AJ3K 5ELZA 2QTDA 2H3GX 1W0HA 4MO5A 1R0AA 2BANA 1QQCA 2YNHA 5C10A 1A5WA 4DFPA 2F96A 5I9EB 2KHOA 5KRSA 4MQ3A 4WQ5C 4JI1K 1YF5L 3ZEUB 3DOKA 1RDBA 4LFCK 4JI0K 4GW6A 2GX9A 5CZ2A 3K5MA 3AVNA 3U6FA 4BG8A 4O5FA 4YORA 1XMOK 4C8MA 4FWLA 1HLUA 3CFOA 4A2BA 4B3SK 4GMJB 1W9HA 1X1PA 4UY8O 4GVEA 3OYKA 3LANA 4FLZA 2HHXA 4E7IA 4CF8A 2Z1HA 2ASMA 5I3UA 2Q0RA 3KLIA 2GELA 1NGAA 3I8BA 3ZT4A 4E3SA 2O8DA 3NGYA 4M3TA 4YDUA 4HCBA 4B9VA 4W5TA 1DEJA 3SPYA 5KGXA 1TYQA 3AGKA 4LC9B 4DS5A 4H5NA 2QWLA 3LAMA 1EKEA 3E9PA 1HNXK 2YJFA 3VTIA 3CCMN 3GE1A 1Z05A 3HBTA 3CC4N 5BPMA 4KH4A 3C94A 4CZKA 2JWLA 3SK3A 3O5BA 1ASWA 4CEQA 5AQNA 3J80O 4BR0A 1JLBA 1FJGK 1RT5A 2ZWHA 1NMDA 3JS6A 4XH5A 4JKDA 3F5TA 5AQGA 2FBYA 3P5JA 3WEEB 4BREA 4CJVA 4CFAA 1VQKN 4FK2A 5J1EA 3CJ7A 4CK3A 4BR4A 4X66K 2E2NA 5AFUA 4CD3A 3NH2A 4RW4A 3SCXA 3TANA 3RR7A 4W5RA 1C6VA 1ILYA 4JHDB 2VQFK 1QSYA 4OVLA
chains in the Genus database with same CATH topology
3H1QA 4BRCA 3VGLA 4XEIA 2P9IB 4HTLA 1SZ2A 4WQ5A 4B1ZA 3OBWA 3AY9A 5GAHP 4BRMA 1BO5O 2P9LA 3MX2A 2P9NB 1GLEG 1GLCG 1RDWX 1V4SA 1GLBG 1ZXOA 1YJNN 4ILGB 3WUHA 3O08A 3D2EA 2P9SA 3MDQA 3MX5A 1Q81O 1NGIA 1NJIO 3CCLN 3MN7A 4I6MA 4JK9A 4MDBA 3HOSA 3G6EN 4BRDA 3S41A 2ZJPL 1NWKA 2P9PA 3CI5A 2HBKA 2A3ZA 4IO8A 5HOOA 1YUWA 2ZGZA 2ZGYA 1U2VB 3LL3A 5AR0A 3KK7A 4PL7A 3CHWA 1HKGA 2WC9A 4JKGB 1VQ5N 3SAHA 5ADXA 3VF6A 1LCUA 4G9ZA 2OANA 3GDQA 1Z6RA 3CJ1A 4IJNA 3WXKA 2OTLN 3AAPA 3QFPA 1NGJA 5LY3A 2QWNA 4Y0WA 4BY9C 4CJ7A 2A5XA 1QQNA 2GUPA 3CCRN 3AARA 5BRFA 4JKFA 4EAHD 1YI2N 3DXKB 5CR4A 3SMSA 3CF5L 1R59O 1Q86O 1KXPA 5BRHA 4JKAA 4MO4A 1BOTO 3R6MA 1BA1A 3ENOA 4FSVA 3SMPA 4PHTX 3CJAA 3WQUA 4FWKA 3TTCA 3G71N 4B1VA 3MCAB 4AF1A 3DXMA 4YOVA 5AQQA 3C7NB 2GWJA 5C2FA 4BVOA 1VQ7N 2E1ZA 4OPHA 1YIJN 2V52B 3MN6A 2Q0UA 2KLAA 4IEEA 5AQVA 2QWOA 5AQXA 3SBTA 2YX6A 4WF9L 2W41A 1QQMA 1N8RO 3CCVN 4HWIA 3D2FB 3R8EA 3WXIA 2QI2A 4A59A 3FR0A 3UKRA 1BWFO 3LDOA 3N4QA 5BR9A 4IDHA 3CQYA 5FPMA 4BRIA 4CZMA 4BRKA 4EHTA 1JCEA 3LDLA 3QB0A 1VQ9N 3E9LA 4A57A 3GL1A 3OHRA 1E4FT 4CZGA 5BRDA 4JD2B 1VQNN 3QBWA 4IOXA 1KC8O 3UKUB 4BR9A 1K8KB 2CH6A 3A5NC 4PKGA 5TKWA 3VPZA 4BC2A 3OW2M 3ULEB 1Y64A 3BUZB 1ESVA 5C2DA 1QZ6A 2HOEA 3H45C 3WXJA 5E84A 4BQLA 1SQKA 2AA4A 2HMPA 2WFBA 3A5OC 4IXCA 5GAEP 5FPDA 1DT9A 3CERA 5AZJB 4MLEA 5KQDA 3E1YA 3FZLA 1SS6A 1NGDA 3L0QA 5ADXH 1V4TA 1MA9B 2I7PA 5AZIA 2BH1A 4IJAA 5TKYA 4CBWA 5AQRA 3UE5A 2D0OA 2Q2RA 3PIOL 5AQOA 2NRVA 2FSJA 5AQZA 1HJOA 1NLVA 3VEYA 3MN9A 4A2AA 4K43A 4DCHA 1SAZA 4WCEL 1W2BM 3ZYYX 1ZC6A 4FOIA 4JEPA 4KH5A 4FWRA 4CI6A 2AP1A 5GINA 3RSEA 4H0VB 1K8AO 1VAZA 2QWQA 2YHXA 3NVMA 5JVHL 3N4PA 3I55N 2D0PA 1JJ2M 3P4IA 1RFQA 3KZBA 3TSPA 4DQ8A 4BGAA 4ISGA 4PL8A 3T7ZA 3VEXA 3ZETB 4O8UA 5GADP 3JXUA 1KAYA 3LDNA 4FWQA 3TTFA 3DJCA 4BG9A 3VOVA 3GBTA 1JCFA 4RCHA 1NGCA 3FZHA 4BROA 1U6ZA 2F7TA 3EKSA 1BG3A 1TYQB 4H0PA 3VF2A 4DHYA 5BN9A 4EHUA 1IG8A 4FWMA 3F9MA 4BR2A 2ZJQL 2P9UB 3U9DA 4R79A 4H0YB 1ZBSA 2NZTA 3M3ZA 4XH1A 2V51B 5CE3A 5AQYA 2CGLA 2FLOA 1QZ5A 2IVPA 4JKBA 4KBOA 3CCJN 5KPTA 2P9KA 1OVYA 3FZKA 2CH5A 2IIRA 5AQMA 2E2PA 4A5BA 4U7BA 2PBDA 3ZEUA 3MK6A 1YHQN 4WFBL 1HX1A 2YHWA 5LJWA 3CC7N 4IOAL 3O1WA 3HZ6A 4A62A 2QEXN 3AGRA 3VGMA 3CC2N 1BDGA 5M1NA 2WBNA 3H46O 3IFRA 4F9OA 4FWNA 4PKHA 1VQ4N 4K41A 3SLCA 2YHYA 4QS8A 5M1OA 3CJ9A 3A5LC 2RHKA 1NGEA 4BRLA 3TPQA 2E2OA 4CZHA 3CCSN 4JAXA 4EIAA 2VGMA 1KQSM 1S72N 2VCPA 5AQFA 4JKHA 3SAGA 4H0TB 5F2RA 3UB5A 1T6DA 3GOIA 4ILJA 3HTVA 3P38A 4E1JA 1HUXA 2PFUA 5AQTA 3C6AA 3H3NO 4K25A 1GLFO 1YJWN 2HBLA 2NRXA 1MDUB 2E88A 3A8YA 5F0XA 3H6EA 3HOTA 4CZEA 3HRGA 4BRFA 2FSKA 4B9QA 4C23A 3D7EO 4M63C 3VTHA 3E9OA 3CETA 4DKWA 5MLCQ 3CD6N 3P31A 2P9LB 3EKUA 4CZFA 4BRHA 3GG4A 1ATNA 1S22A 4CZLA 3D2EB 2P9SB 3M5RA 3R9PA 4IWVA 4B1WB 3DLLL 4NO7A 4I6MB 3HM8A 3EN9A 5AQKA 4MDAA 3VESA 3ATUA 5CHIA 3DWLA 2NRHA 3I56N 3LDPA 2J4RA 2P9PB 1NBWA 1C0GA 3KWGA 2ZJRL 4IEIA 3LDQA 5DM7L 4OO1J 2NRWA 4FWPA 1Q18A 1YXQA 4CZJA 5KQ8A 5JVGL 1QQOA 2V7YA 4H5WA 5AQHA 4BQZA 4O8KA 4GV3A 2BUPA 1Q7YO 5JICA 3RVCA 4M7XA 4JNEA 5BN8A 1MWMA 2HBMA 4RTFD 4BC3A 4CD1A 2HF3A 3E66A 5KPZA 5C12A 3VEWA 2HSTA 3WEEA 3VEVA 1QVGM 1BUPA 5GAGP 3ATVA 4FO0A 3EO3A 1W97L 3WXMB 2QA4N 5C0YA 2NNWA 3ENBA 4AM6A 3FZFA 2NRZA 3O9RA 4H5VA 1TUYA 5M1QA 1BA0A 2GTDA 1GLDG 4WYBA 3OA9A 3ZX3A 3M6GA 2RE2A 1H1VA 1T44A 2QM1A 3DXMB 5EX5A 1XQSC 4BRAA 4WQ4C 5JMVA 2I7NA 3O6WA 2PAVA 3VF4A 1HKCA 3SBGA 4BRQA 4DB3A 1WOQA 1EO1A 4JHDA 1VQ8N 2ASOA 3EE8A 5BREA 3CPEA 5LJVA 2Q31A 3KHYA 2P9IA 5BPNA 3O9SA 1TUUA 3MMVA 3HSCA 1YITN 1NGGA 1GLAG 3EE9A 2P9NA 2WUSA 1NGBA 3MWTA 3NMUA 4H0XB 3SAFA 3UKRB 2Q1NA 3O4WA 4MLHA 4KH6A 3CQXA 1J6ZA 3IUCA 3I33A 4ISEA 5M1PA 4WFAL 4BRGA 1QVFM 3BF1A 2FXUA 2GWKA 2E20A 3O1BA 3A0IX 4FVUA 5JLHA 3H1VX 1VQLN 1MWKA 2E2QA 3IKMA 5AQLA 4GY2B 5C15A 2IVNA 3ID6A 2D4WA 2VWBA 3O9TA 5B8HA 4FPAA 1U2VA 4YDUC 3WQTA 4J8FA 2FSNA 2VGNA 3M1FA 3H3OB 5H1SQ 2QWRA 4JKGA 3SJHA 4WFNL 2BTFA 4H5TA 3J7ZO 3MCPA 2HF4A 2QWMA 3CPWM 3K9JA 3ZX0A 1IJJA 1P8ZA 4BC4A 4CBXA 4C1NK 3HI0A 4XH4A 2YI1A 2EWSA 3QICA 4IZ9A 5AQWA 3QMLA 3CXCM 4GV6A 3DXKA 3LM9A 1XUPO 1JCGA 2V7ZA 4AM7A 4L3QA 5BPLA 1WUAA 3CIPA 3FZMA 5AZIB 1T3VA 4A61A 5KPRA 1GLLO 2A6AA 1VQMN 3CCEN 3CCQN 3PIPL 5AQUA 4IO9L 3TSQA 4JK8A 3O80A 4FWSA 3C65A 3AAQA 1VQPN 3C7NA 5EXWA 2FF3B 3FE1A 2A42A 3ENHA 3RSEB 4GV9A 4A5AA 4JK7A 2DPNA 2CGJA 4IFEA 5AQSA 5EY4A 4U67L 4YOYA 4FL9A 3MN5A 1NM1A 3WXLA 1K73O 1NGFA 3K9KA 4BGBA 1KAXA 3O9QA 3ZX2A 5JLFA 5AQPA 3D2FA 1RGIA 2IVOA 3U8XA 1KD1O 4NLCA 1YVNA 1HPMA 4BRNA 1DGKN 3F2KA 4FWOA 3W0LA 1LOTB 2QTDA 5ELZA 3O8MA 2H3GX 3VEOA 3NVKA 2HBJA 4MO5A 3QBXA 3BP8A 3O9UA 3TU5A 4B1XB 4Z94A 1X3NA 2A40A 2E8AA 5GIOA 4JD2A 2JWKA 5C10A 1K9MO 3G4SN 4B1UB 1EQYA 5I9EB 3A5MC 4FOEA 1P90A 2P9KB 3UKUA 2KHOA 1M90O 1K8KA 4C1NI 3DAWA 4WQ5C 1YF5L 3U4LA 3ZEUB 3VMFB 3ULEA 3CJBA 3Q7CA 3TSUA 1CZAN 2ITMA 4WQ4A 2GX9A 3QDKA 3PLAA 1E4GT 2QXLA 2ASPA 3QFUA 2QW9A 2GEMA 3EZWA 1HKBA 2Q97A 3L4QA 5EOYA 4BG8A 4O5FA 4YOXA 5M1FA 4YORA 5AZJA 1O13A 4FWLA 1HLUA 4NB4A 4A2BA 1RDUA 4EFHA 3R1XA 3VERA 4UY8O 3C6HA 1X3MA 3R3LA 4GVEA 5AFUH 3VEZA 5F1XA 3BEXA 1XC3A 4K42A 1G99A 5FPNA 4IOCL 3J8AA 4QS7A 1KAZA 2ASMA 3L6QA 1VQON 1M1KO 2Q0RA 2FF6A 2GELA 1NGAA 3I8BA 3ZETA 1Q82O 3KWIA 2ZF5O 3MWPA 4BR5A 4YDUA 5M1KA 2W40A 4RWTA 3EL2A 2F9TA 4H03B 4BRPA 3VETA 4CBUA 1VQ6N 4H5RA 2OTJN 1DEJA 2QWPA 1DKGD 4JKCA 1BU6O 4FPBA 1TYQA 3AGKA 3C0BA 4LC9B 3W3DA 5HL7L 4H5NA 2QWLA 5AQJA 3E9PA 4JN4A 2YJFA 3D6RA 3IDHA 2P9UA 3VTIA 3WT0A 1S3XA 1D4XA 3CCMN 2E1YA 4ISFA 2NLXA 3GE1A 1Z05A 3ID8A 2KKZA 3Q7BA 3HBTA 1X9JA 3CC4N 5BPMA 4KH4A 5EVZA 1YJ9N 2UYTA 4CZKA 2JWLA 3SK3A 3O5BA 3OBYA 2YCHA 4JKEA 5GIPA 2CGKA 2NRRA 1ATSA 2F9WA 3L4IA 5AQNA 4YOUA 4YOTA 5FPEA 4BR0A 4GNIA 4M7YA 3CMEN 2ZWHA 1NMDA 3JS6A 5E26A 4XH5A 3B8AX 4JKDA 3F5TA 4B1YB 5AQGA 3VGKA 4H0OA 3G25A 4CZIA 3IMXA 3TTDA 3WEEB 4BREA 3LM2A 1VQKN 2VYPA 3CJ7A 4PKIA 4BC5A 4NLBA 4OPAA 3CJCA 3CCUN 1NGHA 3KVGA 3FLCO 5DM6L 4BR4A 3BF3A 2Q36A 4ILHA 1C0FA 1ATRA 3CMAN 2E2NA 2A41A 5AFUA 1QHAA 3T69A 1YAGA 4CD3A 2NRTA 2D1KA 3FFKB 3P39A 3FGUA 1T6CA 1GLJO 3VENA 5AQIA 4BVPA 4YOWA 4BR7A 3U9ZA 1OKJA 1ILYA 4JHDB 4QS9A 2YJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIO L;  5GAH P;  4WCE L;  1K9M O;  3G4S N;  1W2B M;  1YJN N;  1QVG M;  1K8A O;  1M90 O;  5GAG P;  1NJI O;  5JVH L;  3CCL N;  1Q81 O;  3I55 N;  2QA4 N;  1JJ2 M;  3G6E N;  5GAD P;  2ZJP L;  1VQ8 N;  1VQ5 N;  4UY8 O;  2ZJQ L;  2OTL N;  1YIT N;  4IOC L;  3CCJ N;  1OVY A;  3CCR N;  1VQO N;  1M1K O;  4WFA L;  1QVF M;  1YHQ N;  1YI2 N;  4WFB L;  3CF5 L;  1Q82 O;  1Q86 O;  3CC7 N;  4IOA L;  2QEX N;  1VQL N;  3CC2 N;  3G71 N;  1VQ6 N;  2OTJ N;  1VQ4 N;  1VQ7 N;  5H1S Q;  5HL7 L;  1YIJ N;  4WFN L;  4WF9 L;  3J7Z O;  1N8R O;  3CCS N;  3CPW M;  3CCV N;  3CCM N;  1KQS M;  1S72 N;  3CC4 N;  1YJ9 N;  3CXC M;  1YJW N;  3CME N;  1VQ9 N;  1VQM N;  3CCE N;  3CCQ N;  3PIP L;  4IO9 L;  3CD6 N;  5MLC Q;  1VQP N;  1VQK N;  1VQN N;  1KC8 O;  3CCU N;  5DM6 L;  4U67 L;  1K73 O;  3OW2 M;  3DLL L;  3CMA N;  3I56 N;  2ZJR L;  1KD1 O;  5DM7 L;  5GAE P;  5JVG L;  1ILY A;  1Q7Y O; 
#chains in the Genus database with same CATH topology
 4Z4C A;  1CLQ A;  4XEI A;  3AY9 A;  4FJJ A;  1FW6 A;  4OKK A;  1ZXO A;  3O08 A;  3D2E A;  1XHX A;  3MX5 A;  1LAW A;  3MN7 A;  3G6E N;  4BRD A;  3S41 A;  1C1C A;  4M3W A;  3CI5 A;  2XHB A;  5HOO A;  1VRU A;  2ZGZ A;  2UXC K;  1U2V B;  1S1V A;  1CXU A;  3KK7 A;  4DTR A;  3OYN A;  3CHW A;  1N5Y A;  2WC9 A;  4ZHR A;  3M8Q A;  3A2F A;  1TKT A;  1LCU A;  5ADX A;  3ZSZ A;  3O3G A;  4IJN A;  3AAP A;  4C8K A;  3QFP A;  3OJS A;  4F2R A;  3WNG A;  4CJ7 A;  2GUP A;  2XRI A;  1KVC A;  5BRF A;  2LSN A;  4DV6 K;  4EAH D;  3DXK B;  1L3T A;  1R59 O;  4ELT A;  5BRH A;  4MO4 A;  3ENO A;  1HNI A;  3MCA B;  3ZSY A;  4RW8 A;  4OPH A;  4EP5 A;  1TV6 A;  2EX3 A;  1QQM A;  1YVU A;  1IKW A;  4AHC A;  1B9D A;  3WXI A;  4CJS A;  3FR0 A;  3LDO A;  4BRI A;  3QEV A;  4CHY A;  4BRK A;  4FJX A;  3VQ7 A;  4FJL A;  1NK7 A;  3QIP A;  3OYH A;  4FCY A;  3QBW A;  4ID5 A;  3UKU B;  3I8D A;  1I94 K;  3A5N C;  3VPZ A;  4CJU A;  1N6Q A;  4DTU A;  2QK9 A;  2VG7 A;  2VWK A;  5LL6 Z;  1QZ6 A;  1U47 A;  2HOE A;  3H45 C;  3NGI A;  1SQK A;  2AA4 A;  3CM5 A;  3A5O C;  5FPD A;  1N36 K;  2OPR A;  4CIG A;  5KQD A;  1IG9 A;  3FZL A;  1C0T A;  1V4T A;  3OYM A;  2P1J A;  2BH1 A;  4IJA A;  5TKY A;  4CBW A;  5AQR A;  1TVR A;  4DV1 K;  1NNE A;  4DCH A;  1SAZ A;  1SV5 A;  3ZYY X;  4DQI A;  2AP1 A;  4E1M A;  4H0V B;  1VAZ A;  2YHX A;  3N4P A;  3CQ8 A;  4CJQ A;  4DUZ K;  3P4I A;  1FXX A;  3TSP A;  4DQ8 A;  3ZET B;  2XY7 A;  3S3N A;  1U48 A;  4BG9 A;  3GBT A;  4RCH A;  3DI6 A;  4CJ3 A;  1QSS A;  3DLK A;  1BG3 A;  4H0P A;  3VF2 A;  4YNQ A;  1IG8 A;  4FWM A;  1RT4 A;  2W6L A;  2P9U B;  3U9D A;  3KK1 A;  4C8L A;  2NZT A;  5AQY A;  3VQB A;  2FLO A;  2IVP A;  1QZ5 A;  4JKB A;  2CH5 A;  5AQM A;  2G8K A;  3ZEU A;  4BWJ A;  4Y1C A;  2YHW A;  5IWA K;  2W42 A;  3HZ6 A;  1WLJ A;  4Z0U A;  3VGM A;  3E01 A;  4FLT A;  1BDG A;  2BE2 A;  3H46 O;  1HYS A;  4JV5 K;  4PKH A;  4DQQ A;  1VQ4 N;  2FBV A;  3SLC A;  5M1O A;  4CFD A;  4M45 A;  3CCS N;  4JAX A;  3V1O A;  5AQF A;  3AVM A;  4E0D A;  5F2R A;  2ZQB A;  4ILJ A;  3P38 A;  3MEG A;  2HHT A;  4E1J A;  5J2P A;  4ID1 A;  1GLF O;  3OS2 A;  1YJW N;  2NRX A;  1MDU B;  1KLM A;  4KI6 A;  5F0X A;  3AVB A;  1S1X A;  4BRF A;  3CD6 N;  3E9O A;  3CET A;  4BRH A;  1HMV A;  2P9S B;  4B1W B;  3WNH A;  2HB5 A;  3HM8 A;  3EN9 A;  4MDA A;  3HM9 A;  3VES A;  3ATU A;  2NRH A;  3I56 N;  4PA1 A;  5HP1 A;  2J4R A;  2P9P B;  3SNN A;  3KWG A;  2UUA K;  4BAC A;  3OY9 A;  4OO1 J;  4O5B A;  4KPY A;  3DLH A;  4GV3 A;  3LZJ A;  5JIC A;  4FJN A;  3AO5 A;  4RTF D;  4BC3 A;  3VQ9 A;  1TK0 A;  3G10 A;  2HST A;  3WEE A;  1EET A;  3RMA A;  1L3U A;  3PUF A;  1ZBU A;  1U4B A;  4FO0 A;  3ENB A;  3FZF A;  2NRZ A;  2YKM A;  3EYZ A;  3OA9 A;  1WNS A;  3RMB A;  1T7P A;  4KHY A;  3DXM B;  4WQ4 C;  4BRQ A;  4IG3 A;  3SBG A;  1EO1 A;  3SUN A;  4JHD A;  2ASO A;  3EE8 A;  2HHQ A;  4IFY A;  3AVC A;  3THW B;  1TUU A;  3MMV A;  3HSC A;  1YIT N;  2D0C A;  2HHH K;  2WUS A;  4FLV A;  4PUO A;  1JLE A;  3BY5 A;  3UKR B;  2Q1N A;  1XMQ K;  1KFS A;  3I33 A;  1QVF M;  3IAY A;  3ZLJ A;  2FXU A;  1T8E A;  2E20 A;  1Q9X A;  4I9L A;  3AVI A;  1NK9 A;  2OZS A;  4J2B A;  4NXN K;  4NCA A;  3AV9 A;  2IVN A;  3LDS A;  3ID6 A;  2D4W A;  3KTQ A;  5B8H A;  1U2V A;  4JI6 K;  3LPU A;  4JI2 K;  5H1S Q;  4F3T A;  3NF7 A;  3SJH A;  2HND A;  1BQM A;  2BTF A;  2ETJ A;  4H5T A;  5HLF A;  3CPW M;  4NXM K;  1WBB A;  3OJU A;  1P8Z A;  4BC4 A;  4B08 A;  3SV3 A;  1BHL A;  3AA3 A;  4YY3 K;  1LV5 A;  2GBZ A;  2YI1 A;  4IZ9 A;  3PSF A;  4M3Z A;  3CXC M;  1KSP A;  4DFM A;  4CHN A;  3DXK A;  4RW9 A;  3LM9 A;  5BPL A;  2O8E B;  4BE0 A;  1T3V A;  3QEW A;  4IO9 L;  4DV0 K;  4FWS A;  3KLF A;  3LP3 A;  4M3Y A;  2DY4 A;  4FJI A;  3NF9 A;  3VQQ A;  1K73 O;  1NGF A;  3K9K A;  4DTX A;  4FYD A;  2KQ2 A;  4DF8 A;  3HK2 A;  4LFA K;  4JRQ A;  1HPM A;  1RT2 A;  4TSX A;  5JS1 A;  2YHA A;  4FWO A;  1CXQ A;  2HHW A;  3O8M A;  3VEO A;  4Z94 A;  3ULD A;  3QBX A;  4JI8 K;  4B1X B;  4CW7 B;  3KD1 E;  4IKF A;  2A40 A;  5GIO A;  3G4S N;  4B1U B;  1EQY A;  4B9U A;  1P90 A;  3UKU A;  1M90 O;  1RBV A;  3DAW A;  2XY8 A;  2YKN A;  1TKZ A;  3CJB A;  3QIN A;  4PQU A;  4OKE A;  3PLA A;  1GOA A;  3KLH A;  3VA3 A;  1RTI A;  4NB4 A;  3R1X A;  4CE9 A;  1X3M A;  3R3L A;  5AFU H;  3BEX A;  4KB0 A;  1G99 A;  4IOC L;  4CJT A;  1VQO N;  4B3M K;  4E7H A;  5CYM A;  2FF6 A;  2A1R A;  1F21 A;  3ZET A;  1ZBF A;  4FW2 A;  3KWI A;  2ZF5 O;  1B92 A;  5M1K A;  4RWT A;  3EL2 A;  2F9T A;  2RPI A;  4I2Q A;  2OPQ A;  1I39 A;  4JKC A;  1BU6 O;  4NYF A;  4CGD A;  2FC0 A;  1NMN A;  1U04 A;  3D6R A;  2P9U A;  3AVH A;  2E1Y A;  2UUB K;  1X9J A;  4CGF A;  4CJL A;  1YJ9 N;  4OX9 K;  3ZSW A;  3OBY A;  5GIP A;  2NRR A;  4DU4 A;  4LF7 K;  4HUE A;  4N5S A;  5FPE A;  4FM2 A;  3B8A X;  4LH4 A;  2IOC A;  4Z4H A;  3LM2 A;  3AO2 A;  4NLB A;  4OPA A;  3CJC A;  3CCU N;  3K5O A;  5DM6 L;  1S1T A;  2X6S A;  2JLE A;  1C0F A;  1KRP A;  1ATR A;  3CMA N;  4CHZ A;  1EP4 A;  4DSL A;  3T69 A;  1YAG A;  2W6K A;  5C42 A;  2NRT A;  3HO1 A;  3K2P A;  3FFK B;  4H8K A;  3P39 A;  1T6C A;  3MED A;  3V9Z A;  1GLJ O;  4OGE A;  3VEN A;  5FLX O;  1WSF A;  3U9Z A;  1OKJ A;  3HYF A;  4CIF A;  3H1Q A;  3VN5 A;  3VGL A;  2G8I A;  1SZ2 A;  3DRS A;  5GAH P;  1BO5 O;  3MX2 A;  1RT7 A;  1GLE G;  4B9L A;  4DR4 K;  3MDQ A;  2P9S A;  4FLY A;  2F4V K;  4KTZ A;  2ZJP L;  1J5O A;  3DOL A;  1NWK A;  1BI4 B;  2P9P A;  3DLR A;  4IO8 A;  3WNE A;  4CJE A;  2ZGY A;  3LL3 A;  3PX0 A;  1WSI A;  4W5O A;  3J7Y P;  1HKG A;  4DTP A;  4LSL A;  4NCB A;  4DTS A;  3KK2 A;  1RTJ A;  1EWR A;  1KTQ A;  5LY3 A;  4LFB K;  2A5X A;  4CEA A;  1L3S A;  3CCR N;  2PZS A;  4Z4G A;  3AVL A;  5CR4 A;  3SMS A;  3K5L A;  3CF5 L;  3SQ0 A;  4CF2 A;  4DUY K;  4JKA A;  4AHU A;  1BOT O;  3HXM A;  3R6M A;  4FSV A;  3SMP A;  3NF6 A;  5SZT A;  4KTQ A;  3CJA A;  3S9H A;  4C8O A;  4QCL A;  4B1V A;  3OYD A;  3DXM A;  4YOV A;  3C7N B;  2HW3 A;  1VSH A;  4BVO A;  1YIJ N;  2V52 B;  4HTU A;  2KLA A;  5AQX A;  3SBT A;  3THW A;  2W41 A;  3CCV N;  3OYI A;  3DLB A;  3IG1 A;  3NE6 A;  3UKR A;  1RDC A;  2Y1J A;  1BWF O;  5FPM A;  3M8R A;  3ZT3 A;  1C0M A;  3E9L A;  4A57 A;  3GL1 A;  3OHR A;  1E4F T;  4CZG A;  4JD2 B;  1TGO A;  4IOX A;  3O3F A;  1KC8 O;  1EXQ A;  2CH6 A;  2G8H A;  3OW2 M;  3ULE B;  4PWD A;  1JLG A;  3BUZ B;  5C2D A;  3NDK A;  5E84 A;  4BQL A;  2HMP A;  2WFB A;  4IXC A;  3NGZ A;  4Q5V A;  5AZJ B;  1ZBI A;  1NJZ A;  3OYC A;  4DTJ A;  2O8E A;  3QNO A;  3UE5 A;  2D0O A;  2Q2R A;  4CEB A;  4CK2 A;  2NRV A;  2FSJ A;  4DV5 K;  3MN9 A;  4K43 A;  4WCE L;  4R5P A;  4FOI A;  4FWR A;  4CFC A;  4QOZ B;  2ZD1 A;  5JVH L;  3SQ1 A;  5LMN K;  3HST B;  3I55 N;  2D0P A;  1OVQ A;  1RFQ A;  3KZB A;  1L3V A;  2UXB K;  1WN7 A;  1KAY A;  3LDN A;  3G0Z A;  4FZZ A;  3VOV A;  1JCF A;  3MEC A;  1OH8 A;  2HNY A;  4FW1 A;  1NGC A;  3FZH A;  1U6Z A;  4OLA A;  2F7T A;  4DHY A;  4CGJ A;  4DV3 K;  4DSE A;  3AO3 A;  1S9E A;  4DSK A;  4BR2 A;  1NK0 A;  5CYQ A;  5E41 A;  4DTM A;  4H0Y B;  3AVJ A;  3M3Z A;  4B3T K;  2YV0 X;  2V51 B;  4KBO A;  2UU9 K;  3KJV A;  3RR8 A;  4A5B A;  4LSN A;  4KB1 A;  1HX1 A;  1YTU A;  3SZ2 A;  4IOA L;  2F8S A;  1QHT A;  3C95 A;  2ZM6 K;  5M1N A;  1YT3 A;  4HVJ A;  3IFR A;  4FLX A;  1EX4 A;  3QEP A;  4JS4 A;  1WSJ A;  3A5L C;  2HHV A;  3DYA A;  1D9F A;  1LWE A;  2E2O A;  4CZH A;  1VSE A;  4E19 A;  3SAG A;  1UA0 A;  4JI3 K;  4H0T B;  4AHS A;  4DR1 K;  4F2S A;  1HUX A;  2PFU A;  4DMN A;  4AIL C;  2E88 A;  4LH5 A;  3H6E A;  3HOT A;  4N76 A;  3D45 A;  1Z26 A;  2KFN A;  4HUF A;  3P31 A;  1VSI A;  4CZF A;  4OGC A;  5I42 A;  1S22 A;  3M5R A;  4CHQ A;  5IT9 O;  4IWV A;  3TAE A;  4NO7 A;  4KAZ A;  3VQC A;  5CHI A;  1NJW A;  5T7B A;  3LDP A;  1BGX T;  3SQ2 A;  1JXB A;  3LDQ A;  5DM7 L;  3LP2 A;  4FWP A;  4O8K A;  2BUP A;  4LF5 K;  4BE1 A;  3BZK A;  1VSF A;  1X9W A;  4YFU A;  1XWL A;  1J54 A;  1VK0 A;  3OYE A;  2BGG A;  5CY4 A;  5GAG P;  2DFF A;  4AHR A;  4CJW A;  2QA4 N;  4E7J A;  5HRR A;  3AO4 A;  2B4J A;  4H5V A;  2RN2 A;  4E89 A;  3HT3 A;  3VQA A;  3LWM A;  2GTD A;  4WYB A;  3ZX3 A;  1T44 A;  1WSG A;  1WB9 A;  2QM1 A;  5EU7 A;  5JMV A;  3D0P A;  4J2E A;  1TKX A;  3O6W A;  4FJ8 A;  4M3U A;  5LJV A;  3SYZ A;  1HQE A;  1HPZ A;  3QO9 A;  3EE9 A;  4E7K A;  4H0X B;  5J2N A;  4KH6 A;  1OH5 A;  4WFA L;  4BRG A;  3BF1 A;  4CEZ A;  3CFP A;  2GWK A;  2O8F A;  1LWF A;  4FVU A;  1BI4 A;  3IKM A;  1T03 A;  3NHG A;  4M42 A;  4DG1 A;  4CES A;  4YDU C;  2QKK A;  2FSN A;  1C1B A;  4B8A B;  4E1N A;  2VWJ A;  1XI1 A;  4DV4 K;  3J7Z O;  3MCP A;  2QWM A;  3K9J A;  2O8C B;  3ZX0 A;  1WAJ A;  3DM2 A;  3LPT A;  1IJJ A;  5AQW A;  2EWS A;  3QML A;  1C0U A;  4FZX C;  2HVI A;  2QXF A;  4CEC A;  4EZ9 A;  2V7Z A;  4AM7 A;  3JSM A;  2OA8 A;  5AZI B;  3AO1 A;  3CIP A;  1VQM N;  1GLL O;  1XC9 A;  4B9T A;  3C65 A;  3QES A;  3C7N A;  1K6Y A;  3RSE B;  3ENH A;  4A5A A;  4KFB A;  5AQS A;  2DPN A;  2CGJ A;  5EY4 A;  4U67 L;  4FL9 A;  3MN5 A;  1KAX A;  3B6O A;  5JS2 A;  2IVO A;  4NLC A;  3ZSV A;  3VQ8 A;  2G8U A;  3W0L A;  1LOT B;  3JYT A;  1XHZ A;  3NVK A;  2HBJ A;  3TU5 A;  3BP8 A;  3O9U A;  5D3G A;  4KHP K;  1X3N A;  2E8A A;  4JD2 A;  3T19 A;  4OPJ A;  4FOE A;  2P9K B;  3TAF A;  1NK5 A;  4LF8 K;  4X62 K;  1RT6 A;  3ULE A;  3Q7C A;  3NFA A;  2ITM A;  4N56 A;  4CK1 A;  4ZTF A;  4ELU A;  3QDK A;  5EOY A;  2ASP A;  2QXL A;  2QW9 A;  4ICL A;  3EZW A;  1HKB A;  2Q97 A;  3L4Q A;  5BR9 A;  4KKO A;  3SUO A;  5AZJ A;  4J2D A;  1O13 A;  1DTT A;  1NKE A;  4EFH A;  3C6H A;  3VEZ A;  1EWQ A;  1XC3 A;  4K42 A;  5FPN A;  4OLB A;  3J8A A;  3L6Q A;  1M1K O;  4L8R B;  1Q82 O;  1KLN A;  3MWP A;  4CCH A;  1Q9Y A;  2KFZ A;  4ZTJ A;  2W40 A;  3QEX A;  1TAU A;  4GKJ K;  4CBU A;  1VQ6 N;  4H5R A;  2OTJ N;  4FPB A;  1CZ9 A;  3W3D A;  1J53 A;  4JN4 A;  1RIL A;  3WT0 A;  1D4X A;  2IS3 A;  2WON A;  1S6P A;  2ATQ A;  5FRO A;  3Q7B A;  1HYV A;  5EVZ A;  4DLE A;  1VSK A;  2YCH A;  4CJP A;  1E3M A;  1ATS A;  2F9W A;  4YOU A;  5DK5 A;  4GNI A;  2D5R A;  4K8X A;  1W7A A;  1UOC A;  5E26 A;  2YNI A;  3BDP A;  4B1Y B;  5BR8 K;  3LP0 A;  2BDP A;  4DSI A;  4KRF A;  2RKI A;  2VYP A;  4PKI A;  4BC5 A;  3KVG A;  3FLC O;  2Q36 A;  4ILH A;  2X6N A;  2A41 A;  1QHA A;  1VRT A;  4FK4 A;  1SUQ A;  3FGU A;  1CZB A;  1LWC A;  5AQI A;  4YOW A;  4JI4 K;  3QET A;  3QNN A;  3O4Q A;  3ZT1 A;  3TAB A;  4WQ5 A;  3OBW A;  1HRH A;  4BRM A;  1NK8 A;  4PY5 A;  2VG6 A;  1RDW X;  1NJI O;  3CCL N;  1Q81 O;  3AVF A;  4JK9 A;  3MXJ A;  2A3Z A;  4DFJ A;  4DV2 K;  3HL8 A;  4CJF A;  3SQ4 A;  3BGR A;  5KTQ A;  2OAN A;  3GDQ A;  3CJ1 A;  2OTL N;  1TL3 A;  4B8C A;  1JLC A;  1NGJ A;  4Y0W A;  1QQN A;  1RTD A;  3EY1 A;  4KHW A;  1J9A A;  3O3H A;  4JKF A;  1YI2 N;  4I7F A;  1KXP A;  3ASM A;  3MXM A;  1Q86 O;  3L2U A;  1BA1 A;  4PHT X;  3UIQ A;  3EEQ A;  4FWK A;  1JL2 A;  1VSJ A;  3C6U A;  1SKS A;  3NH0 A;  1BCO A;  1HR0 K;  1T05 A;  1LAV A;  2GWJ A;  5C2F A;  2O8B B;  1VQ7 N;  1S9G A;  1NU0 A;  2Q0U A;  3SJJ A;  2VQE K;  5AQV A;  2QWO A;  3OYG A;  3OYA A;  1N8R O;  1RBT A;  3D2F B;  3R8E A;  3HPH A;  2ZE2 A;  2QI2 A;  1IKX A;  4A59 A;  1ZBH A;  3EZ5 A;  4KHQ A;  3N4Q A;  3CQY A;  4CZM A;  3SI6 A;  4F3O A;  5K14 A;  4EHT A;  4AH9 A;  1VQ9 N;  3LAL A;  1KVB A;  2KZM A;  5BRD A;  3V9W A;  3T3F A;  3OTO K;  4BR9 A;  4CF0 A;  1K8K B;  5TKW A;  3ZSO A;  4BC2 A;  4CGH A;  4FZY A;  3BZC A;  1JLA A;  1ESV A;  2HNZ A;  4FK0 A;  3L2R A;  2O8C A;  3OVN A;  3WXJ A;  1JLQ A;  2IAJ A;  5GAE P;  4JYA K;  1DT9 A;  1RBS A;  3CER A;  3NH1 A;  3THX B;  1NGD A;  5ADX H;  2I7P A;  5AZI A;  2E5L K;  3PIO L;  4I9Q A;  4W5Q A;  3OYF A;  3VEY A;  1HJO A;  1NLV A;  4HUG A;  1W2B M;  4KH5 A;  4JEP A;  4CI6 A;  3RSE A;  2QWQ A;  3NVM A;  3SV4 A;  5HRO A;  2DFE A;  4BGA A;  4PL8 A;  3T7Z A;  3VEX A;  4O8U A;  5GAD P;  3JXU A;  4FWQ A;  5FRN A;  3QER A;  4G1Q A;  4BDY A;  1NK6 A;  4BDP A;  3VQ4 A;  3RMC A;  3KD5 E;  1JL1 A;  4CED A;  3EKS A;  4CJ5 A;  4EHU A;  5BN9 A;  4B9N A;  3T1Y K;  4KHN A;  2A1S A;  2ZJQ L;  4DR5 K;  3T1H K;  3LAK A;  4XH1 A;  1ZBS A;  1VSL A;  5CE3 A;  2CGL A;  2HHS A;  5KPT A;  2P9K A;  4CGI A;  2IIR A;  2E2P A;  3ALY A;  2PBD A;  4DSF A;  1YHQ N;  4WFB L;  5LJW A;  3O1W A;  2QEX N;  3AGR A;  1FK9 A;  1SL2 A;  3CC2 N;  1RT1 A;  1RBR A;  3THY B;  4FWN A;  2YHY A;  2VG5 A;  4BDZ A;  4QS8 A;  2HVH A;  3CJ9 A;  1NGE A;  4BRL A;  4FVM A;  3KKS A;  1S72 N;  2VCP A;  1UA1 A;  3UB5 A;  3GOI A;  3RWU A;  3HTV A;  3J81 O;  4CJR A;  4O0I A;  3C6A A;  3H3N O;  2HBL A;  3A8Y A;  1S1U A;  4AHT A;  3ZSR A;  3HRG A;  5HBM A;  4C23 A;  4CVN E;  3D7E O;  3VTH A;  2X78 A;  2P9L B;  3EKU A;  3GG4 A;  2WTU A;  3HJF A;  3DLL L;  4I6M B;  3V9X A;  2QKB A;  3SUQ A;  2Z1J A;  3U3Y A;  2Z1I A;  2ZJR L;  1NBW A;  3V81 A;  1LW2 A;  1RTH A;  3PV8 A;  4DTO A;  4YHH K;  2NRW A;  1YXQ A;  5AQH A;  2V7Y A;  4H5W A;  1XNR K;  1N32 K;  3B6P A;  4KHU A;  1C1A A;  4RW6 A;  4JI7 K;  4M7X A;  5CZ1 A;  1MWM A;  5KPZ A;  5C12 A;  1BQN A;  4OKJ A;  3S3O A;  3FFI A;  3VEV A;  4DR7 K;  4MFB A;  4CF9 A;  3ATV A;  2P5O A;  3EO3 A;  1W97 L;  1BCM A;  4CFB A;  1NKC A;  3LP1 A;  5FRM A;  3WNF A;  1BA0 A;  3ZCM A;  3K0S A;  4HHT A;  4M3X A;  2RE2 A;  3T1A A;  1UAX A;  3AVK A;  5EX5 A;  2PAV A;  1HKC A;  1WOQ A;  2IDO A;  1VQ8 N;  5BRE A;  4CEF A;  3CPE A;  5KI6 A;  4F8R A;  2KTQ A;  4H4M A;  3KHY A;  4EZ6 A;  3SPZ A;  2OPS A;  3O9S A;  5BPN A;  3K5N A;  1TL1 A;  5HRP A;  3TAG A;  3NMU A;  4B9S A;  3CQX A;  1J6Z A;  4ISE A;  3MEE A;  2D0B A;  3A0I X;  5J2Q A;  4FJ9 A;  5JLH A;  2E4L A;  1MWK A;  2E2Q A;  5AQL A;  4OJR A;  3HVR A;  3RTV A;  2OZM A;  3O9T A;  2D0A A;  3WQT A;  3M1F A;  4RW7 A;  2ITG A;  3H3O B;  1NOZ A;  1D8Y A;  3ZSX A;  4CEE A;  3MXI A;  4LF6 K;  4IFV A;  4GKK K;  4C1N K;  3KK3 A;  3O4N A;  3OYJ A;  4GV6 A;  3PY8 A;  1HNV A;  2R7Y A;  2WOM A;  1JCG A;  4L3Q A;  4A61 A;  5KPR A;  2IC3 A;  4W5N A;  1FKP A;  4CJK A;  4FXD A;  3PIP L;  5AQU A;  3NBP A;  4WE1 A;  1VQP N;  1XNQ K;  1NG9 A;  2FF3 B;  3CG7 A;  3FE1 A;  2O8B A;  3VQE A;  4IFE A;  4DLG A;  3WXL A;  2E6M A;  2OYQ A;  3O9Q A;  1KFD A;  5JLF A;  1WSH A;  2G8F A;  4B3R K;  5AQP A;  3D2F A;  1RGI A;  1KD1 O;  1O1W A;  2YNG A;  4FJ5 A;  4KI4 A;  1I3A A;  2X74 A;  3VQP A;  4NCG A;  1HNZ K;  2PYJ A;  3ZT0 A;  4DFK A;  3RRH A;  2DTU A;  1DTQ A;  2JWK A;  3VA0 A;  3THV A;  1K9M O;  3QEI A;  4BE2 A;  3A5M C;  3L3V A;  4KHS A;  1K8K A;  4C1N I;  4JI5 K;  3U4L A;  3VMF B;  1BIS A;  3ISN C;  3TSU A;  1CZA N;  4WQ4 A;  1IBM K;  1E4G T;  1Q8I A;  3QFU A;  1ITG A;  2GEM A;  4YOX A;  3F9K A;  5M1F A;  4IBN A;  4AHV A;  3THX A;  2GUI A;  1RDU A;  3DRP A;  3CM6 A;  3VER A;  3CFR A;  4F4K A;  2O4G A;  5F1X A;  1X9S A;  2XO7 A;  2B5J A;  3VQ6 A;  1QTM A;  4QS7 A;  1KAZ A;  2B6A A;  1VHX A;  3TAQ A;  4BR5 A;  3HPG A;  4IG0 A;  1NJX A;  3J7A P;  3HVT A;  4H03 B;  4BRP A;  3VET A;  1IKV A;  3IRX A;  3PO4 A;  2QWP A;  1DKG D;  3V1Q A;  3TWH A;  3C0B A;  1RCH A;  5HL7 L;  2Y1I A;  4QAG A;  5AQJ A;  5FDL A;  4CF1 A;  1KCF A;  3IDH A;  4N47 A;  1S3X A;  4ISF A;  2NLX A;  4OPK A;  3ITH A;  3ID8 A;  1TK8 A;  2KKZ A;  1HQU A;  4O0J A;  3NCI A;  3DLE A;  1ASV A;  2UYT A;  4JKE A;  2CGK A;  3L4I A;  3L2V A;  1SKR A;  2FBX A;  4YOT A;  4M7Y A;  3CME N;  3QIO A;  3V1R A;  1N33 K;  3VGK A;  2PY5 A;  4H0O A;  3G25 A;  4CZI A;  3IMX A;  3TTD A;  4FLW A;  3THY A;  3VQD A;  1NGH A;  3SUP A;  3BF3 A;  1HNW K;  5KRT A;  1YTA A;  2D1K A;  4Y1D A;  4DR3 K;  1QSL A;  4BVP A;  4BR7 A;  4QS9 A;  3HP6 A;  2YJE A;  1B9F A;  3HP9 A;  1D9D A;  2DFH A;  4BRC A;  2FBT A;  3MAQ A;  2P9I B;  4HTL A;  3F73 A;  4B1Z A;  3TAR A;  2P9L A;  3PSI A;  2P9N B;  1GLC G;  1YJN N;  1V4S A;  1GLB G;  3AA5 X;  4Z4E A;  4ILG B;  3WUH A;  1NGI A;  4RG8 A;  4MDB A;  4I6M A;  3HOS A;  3CYM A;  2OCE A;  4FM1 A;  4K0K K;  2HBK A;  5J2M A;  3ZSQ A;  3TAM A;  1YUW A;  2O4I A;  4JS5 A;  5AR0 A;  4LF4 K;  4PL7 A;  3OYL A;  4JKG B;  4XIU A;  1VQ5 N;  3SAH A;  5HRS A;  3L2Q A;  1ASU A;  3VF6 A;  1NJY A;  3ZT2 A;  4G9Z A;  3OYB A;  1Z6R A;  1TAQ A;  3WXK A;  2KZZ A;  4DTN A;  3LZI A;  2QWN A;  4M3R A;  4BY9 C;  3AAR A;  1IKY A;  4CHP A;  4FJH A;  4J2A A;  1TK5 A;  4FM0 A;  4DSJ A;  2P51 A;  4DR6 K;  2G8W A;  3WQU A;  3TTC A;  3G71 N;  1IBK K;  4AF1 A;  5AQQ A;  4B3O A;  1IV0 A;  2E1Z A;  3MN6 A;  4IEE A;  4WF9 L;  2YX6 A;  4HWI A;  1RT3 A;  3U3G A;  1S5J A;  3I0R A;  4IDH A;  4EP4 A;  3L3U A;  1JCE A;  3LDL A;  3QB0 A;  1NKB A;  4NYN A;  1A5V A;  1G15 A;  3OS0 A;  4FJ7 A;  1VQN N;  4FJG A;  4JLH A;  1RDA A;  4PKG A;  3NF8 A;  5KGW A;  1Y64 A;  1BIZ A;  4C8N A;  1WSE A;  3M8P A;  4O55 A;  1IH7 A;  4CIE A;  4MLE A;  3RMD A;  3E1Y A;  4KRE A;  1SS6 A;  2XY6 A;  1X9M A;  3L0Q A;  1MA9 B;  4Z4I A;  5AQO A;  5AQZ A;  4A2A A;  4E7L A;  4LY7 A;  4DWI A;  1ZC6 A;  2F8T A;  3M8S A;  5GIN A;  1K8A O;  1SL0 A;  1BL3 A;  1WBD A;  1JJ2 M;  2O8D B;  4ISG A;  3K57 A;  3TTF A;  1S1W A;  3DJC A;  4KTW A;  4CJ4 A;  3P1G A;  2AJQ A;  2YNF A;  4BRO A;  3C6T A;  2UUC K;  1TYQ B;  2Q3S A;  1U45 A;  4N41 A;  3F9M A;  4Q0B A;  4R79 A;  1QS4 A;  1REV A;  1Y97 A;  1QE1 A;  1Z25 A;  3DMJ A;  3CCJ N;  3PX4 A;  1NK4 A;  1OVY A;  3FZK A;  1J5E K;  1GOC A;  1S6Q A;  4U7B A;  3KKR A;  1A5X A;  3OS1 A;  3MK6 A;  2NUB A;  1VSM A;  3JAM O;  3CC7 N;  3S3M A;  4A62 A;  2P5G A;  3HPO A;  3AVG A;  2WBN A;  3IS9 A;  4DR2 K;  4F9O A;  4CGG A;  4IDK A;  1TKD A;  2HMI A;  3V9S A;  3AA4 A;  1L5U A;  2Z1G A;  4K41 A;  2RHK A;  3TPQ A;  4X64 K;  2RF2 A;  4EIA A;  2VGM A;  1KQS M;  1RBU A;  4JKH A;  1T6D A;  1JLF A;  1SL1 A;  5AQT A;  3I0S A;  4K25 A;  4DS4 A;  3QLH A;  1GOB A;  4CZE A;  3NAE A;  3TI0 A;  2FSK A;  4B9Q A;  2YHB A;  4M63 C;  3L8B A;  4DKW A;  3KLE A;  5MLC Q;  1FKO A;  3P83 D;  4KV8 A;  2UXD K;  1JKH A;  2I5J A;  1ATN A;  1IO2 A;  4CZL A;  4DU3 A;  4BWM A;  3D2E B;  4O44 A;  3R9P A;  5SWM A;  4KO0 A;  5AQK A;  2PYL A;  3DWL A;  3K59 A;  5C24 A;  5A2Q O;  4LD0 A;  1C0G A;  4IEI A;  3TR8 A;  5KQ8 A;  1Q18 A;  4CZJ A;  5JVG L;  1QQO A;  2IGI A;  4BQZ A;  4JRP A;  1NOY A;  3VQ5 A;  1Q7Y O;  2JGU A;  3RVC A;  4JNE A;  5BN8 A;  2HBM A;  4CD1 A;  1JXE A;  3V4I A;  4DF4 A;  2HF3 A;  3E66 A;  3VEW A;  3DRR A;  4FLU A;  1QVG M;  1BUP A;  4FJM A;  3WXM B;  5C0Y A;  2NNW A;  2E6L A;  4GVM A;  4AM6 A;  1ZBL A;  3L2W A;  1OH6 A;  2KW4 A;  3O9R A;  1TUY A;  4HCC A;  3RRG A;  5M1Q A;  1GLD G;  3AA2 A;  3M6G A;  1H1V A;  4O4G A;  1UWB A;  1SKW A;  1XQS C;  4BRA A;  2I7N A;  3VF4 A;  4DB3 A;  2GV9 A;  1OH7 A;  4CER A;  5C25 A;  1HYZ A;  4M41 A;  2Q31 A;  2G8V A;  3PO5 A;  3K58 A;  2P9I A;  3DLG A;  1NGG A;  1GLA G;  4K8Z A;  3KIO A;  2P9N A;  1NGB A;  1N34 K;  3MWT A;  4ELV A;  1WAF A;  3SAF A;  4DQP A;  2HHU A;  3O4W A;  4MLH A;  5HRN A;  4B9M A;  1DLO A;  3IUC A;  5M1P A;  3PX6 A;  3O1B A;  1RDD A;  3H1V X;  5LMU K;  4FJK A;  1VQL N;  4GY2 B;  1LW0 A;  5C15 A;  2VWB A;  1MU2 A;  4FPA A;  4CHO A;  4J8F A;  2VGN A;  3AVA A;  2QWR A;  4JKG A;  4AQY K;  1IBL K;  1VSD A;  4CEO A;  4WFN L;  1BIU A;  1D5A A;  1KVA A;  3V6D A;  2HF4 A;  3V9U A;  4DQR A;  4DU1 A;  4X65 K;  4Z4F A;  4I2P A;  4UQG A;  4CBX A;  3HI0 A;  4XH4 A;  3QIC A;  1HJR A;  1XUP O;  1WUA A;  3FZM A;  1U49 A;  3CCE N;  2OPP A;  2A6A A;  1ZYQ A;  3CCQ N;  2XY5 A;  3TSQ A;  4JK8 A;  3O80 A;  3TAP A;  3AAQ A;  4DV7 K;  5EXW A;  2A42 A;  4GV9 A;  1RNH A;  4JK7 A;  4YOY A;  3H08 A;  4DQS A;  1NM1 A;  5DMR A;  4V19 S;  4LF9 K;  3KLG A;  4BGB A;  2O8F B;  3ZX2 A;  3LWL A;  2EHG A;  3U8X A;  1YVN A;  4H4O A;  4BRN A;  1DGK N;  3F2K A;  5AJ3 K;  5ELZ A;  2QTD A;  2H3G X;  1W0H A;  4MO5 A;  1R0A A;  2BAN A;  1QQC A;  2YNH A;  5C10 A;  1A5W A;  4DFP A;  2F96 A;  5I9E B;  2KHO A;  5KRS A;  4MQ3 A;  4WQ5 C;  4JI1 K;  1YF5 L;  3ZEU B;  3DOK A;  1RDB A;  4LFC K;  4JI0 K;  4GW6 A;  2GX9 A;  5CZ2 A;  3K5M A;  3AVN A;  3U6F A;  4BG8 A;  4O5F A;  4YOR A;  1XMO K;  4C8M A;  4FWL A;  1HLU A;  3CFO A;  4A2B A;  4B3S K;  4GMJ B;  1W9H A;  1X1P A;  4UY8 O;  4GVE A;  3OYK A;  3LAN A;  4FLZ A;  2HHX A;  4E7I A;  4CF8 A;  2Z1H A;  2ASM A;  5I3U A;  2Q0R A;  3KLI A;  2GEL A;  1NGA A;  3I8B A;  3ZT4 A;  4E3S A;  2O8D A;  3NGY A;  4M3T A;  4YDU A;  4HCB A;  4B9V A;  4W5T A;  1DEJ A;  3SPY A;  5KGX A;  1TYQ A;  3AGK A;  4LC9 B;  4DS5 A;  4H5N A;  2QWL A;  3LAM A;  1EKE A;  3E9P A;  1HNX K;  2YJF A;  3VTI A;  3CCM N;  3GE1 A;  1Z05 A;  3HBT A;  3CC4 N;  5BPM A;  4KH4 A;  3C94 A;  4CZK A;  2JWL A;  3SK3 A;  3O5B A;  1ASW A;  4CEQ A;  5AQN A;  3J80 O;  4BR0 A;  1JLB A;  1FJG K;  1RT5 A;  2ZWH A;  1NMD A;  3JS6 A;  4XH5 A;  4JKD A;  3F5T A;  5AQG A;  2FBY A;  3P5J A;  3WEE B;  4BRE A;  4CJV A;  4CFA A;  1VQK N;  4FK2 A;  5J1E A;  3CJ7 A;  4CK3 A;  4BR4 A;  4X66 K;  2E2N A;  5AFU A;  4CD3 A;  3NH2 A;  4RW4 A;  3SCX A;  3TAN A;  3RR7 A;  4W5R A;  1C6V A;  1ILY A;  4JHD B;  2VQF K;  1QSY A;  4OVL A; 
#chains in the Genus database with same CATH homology
 3H1Q A;  4BRC A;  3VGL A;  4XEI A;  2P9I B;  4HTL A;  1SZ2 A;  4WQ5 A;  4B1Z A;  3OBW A;  3AY9 A;  5GAH P;  4BRM A;  1BO5 O;  2P9L A;  3MX2 A;  2P9N B;  1GLE G;  1GLC G;  1RDW X;  1V4S A;  1GLB G;  1ZXO A;  1YJN N;  4ILG B;  3WUH A;  3O08 A;  3D2E A;  2P9S A;  3MDQ A;  3MX5 A;  1Q81 O;  1NGI A;  1NJI O;  3CCL N;  3MN7 A;  4I6M A;  4JK9 A;  4MDB A;  3HOS A;  3G6E N;  4BRD A;  3S41 A;  2ZJP L;  1NWK A;  2P9P A;  3CI5 A;  2HBK A;  2A3Z A;  4IO8 A;  5HOO A;  1YUW A;  2ZGZ A;  2ZGY A;  1U2V B;  3LL3 A;  5AR0 A;  3KK7 A;  4PL7 A;  3CHW A;  1HKG A;  2WC9 A;  4JKG B;  1VQ5 N;  3SAH A;  5ADX A;  3VF6 A;  1LCU A;  4G9Z A;  2OAN A;  3GDQ A;  1Z6R A;  3CJ1 A;  4IJN A;  3WXK A;  2OTL N;  3AAP A;  3QFP A;  1NGJ A;  5LY3 A;  2QWN A;  4Y0W A;  4BY9 C;  4CJ7 A;  2A5X A;  1QQN A;  2GUP A;  3CCR N;  3AAR A;  5BRF A;  4JKF A;  4EAH D;  1YI2 N;  3DXK B;  5CR4 A;  3SMS A;  3CF5 L;  1R59 O;  1Q86 O;  1KXP A;  5BRH A;  4JKA A;  4MO4 A;  1BOT O;  3R6M A;  1BA1 A;  3ENO A;  4FSV A;  3SMP A;  4PHT X;  3CJA A;  3WQU A;  4FWK A;  3TTC A;  3G71 N;  4B1V A;  3MCA B;  4AF1 A;  3DXM A;  4YOV A;  5AQQ A;  3C7N B;  2GWJ A;  5C2F A;  4BVO A;  1VQ7 N;  2E1Z A;  4OPH A;  1YIJ N;  2V52 B;  3MN6 A;  2Q0U A;  2KLA A;  4IEE A;  5AQV A;  2QWO A;  5AQX A;  3SBT A;  2YX6 A;  4WF9 L;  2W41 A;  1QQM A;  1N8R O;  3CCV N;  4HWI A;  3D2F B;  3R8E A;  3WXI A;  2QI2 A;  4A59 A;  3FR0 A;  3UKR A;  1BWF O;  3LDO A;  3N4Q A;  5BR9 A;  4IDH A;  3CQY A;  5FPM A;  4BRI A;  4CZM A;  4BRK A;  4EHT A;  1JCE A;  3LDL A;  3QB0 A;  1VQ9 N;  3E9L A;  4A57 A;  3GL1 A;  3OHR A;  1E4F T;  4CZG A;  5BRD A;  4JD2 B;  1VQN N;  3QBW A;  4IOX A;  1KC8 O;  3UKU B;  4BR9 A;  1K8K B;  2CH6 A;  3A5N C;  4PKG A;  5TKW A;  3VPZ A;  4BC2 A;  3OW2 M;  3ULE B;  1Y64 A;  3BUZ B;  1ESV A;  5C2D A;  1QZ6 A;  2HOE A;  3H45 C;  3WXJ A;  5E84 A;  4BQL A;  1SQK A;  2AA4 A;  2HMP A;  2WFB A;  3A5O C;  4IXC A;  5GAE P;  5FPD A;  1DT9 A;  3CER A;  5AZJ B;  4MLE A;  5KQD A;  3E1Y A;  3FZL A;  1SS6 A;  1NGD A;  3L0Q A;  5ADX H;  1V4T A;  1MA9 B;  2I7P A;  5AZI A;  2BH1 A;  4IJA A;  5TKY A;  4CBW A;  5AQR A;  3UE5 A;  2D0O A;  2Q2R A;  3PIO L;  5AQO A;  2NRV A;  2FSJ A;  5AQZ A;  1HJO A;  1NLV A;  3VEY A;  3MN9 A;  4A2A A;  4K43 A;  4DCH A;  1SAZ A;  4WCE L;  1W2B M;  3ZYY X;  1ZC6 A;  4FOI A;  4JEP A;  4KH5 A;  4FWR A;  4CI6 A;  2AP1 A;  5GIN A;  3RSE A;  4H0V B;  1K8A O;  1VAZ A;  2QWQ A;  2YHX A;  3NVM A;  5JVH L;  3N4P A;  3I55 N;  2D0P A;  1JJ2 M;  3P4I A;  1RFQ A;  3KZB A;  3TSP A;  4DQ8 A;  4BGA A;  4ISG A;  4PL8 A;  3T7Z A;  3VEX A;  3ZET B;  4O8U A;  5GAD P;  3JXU A;  1KAY A;  3LDN A;  4FWQ A;  3TTF A;  3DJC A;  4BG9 A;  3VOV A;  3GBT A;  1JCF A;  4RCH A;  1NGC A;  3FZH A;  4BRO A;  1U6Z A;  2F7T A;  3EKS A;  1BG3 A;  1TYQ B;  4H0P A;  3VF2 A;  4DHY A;  5BN9 A;  4EHU A;  1IG8 A;  4FWM A;  3F9M A;  4BR2 A;  2ZJQ L;  2P9U B;  3U9D A;  4R79 A;  4H0Y B;  1ZBS A;  2NZT A;  3M3Z A;  4XH1 A;  2V51 B;  5CE3 A;  5AQY A;  2CGL A;  2FLO A;  1QZ5 A;  2IVP A;  4JKB A;  4KBO A;  3CCJ N;  5KPT A;  2P9K A;  1OVY A;  3FZK A;  2CH5 A;  2IIR A;  5AQM A;  2E2P A;  4A5B A;  4U7B A;  2PBD A;  3ZEU A;  3MK6 A;  1YHQ N;  4WFB L;  1HX1 A;  2YHW A;  5LJW A;  3CC7 N;  4IOA L;  3O1W A;  3HZ6 A;  4A62 A;  2QEX N;  3AGR A;  3VGM A;  3CC2 N;  1BDG A;  5M1N A;  2WBN A;  3H46 O;  3IFR A;  4F9O A;  4FWN A;  4PKH A;  1VQ4 N;  4K41 A;  3SLC A;  2YHY A;  4QS8 A;  5M1O A;  3CJ9 A;  3A5L C;  2RHK A;  1NGE A;  4BRL A;  3TPQ A;  2E2O A;  4CZH A;  3CCS N;  4JAX A;  4EIA A;  2VGM A;  1KQS M;  1S72 N;  2VCP A;  5AQF A;  4JKH A;  3SAG A;  4H0T B;  5F2R A;  3UB5 A;  1T6D A;  3GOI A;  4ILJ A;  3HTV A;  3P38 A;  4E1J A;  1HUX A;  2PFU A;  5AQT A;  3C6A A;  3H3N O;  4K25 A;  1GLF O;  1YJW N;  2HBL A;  2NRX A;  1MDU B;  2E88 A;  3A8Y A;  5F0X A;  3H6E A;  3HOT A;  4CZE A;  3HRG A;  4BRF A;  2FSK A;  4B9Q A;  4C23 A;  3D7E O;  4M63 C;  3VTH A;  3E9O A;  3CET A;  4DKW A;  5MLC Q;  3CD6 N;  3P31 A;  2P9L B;  3EKU A;  4CZF A;  4BRH A;  3GG4 A;  1ATN A;  1S22 A;  4CZL A;  3D2E B;  2P9S B;  3M5R A;  3R9P A;  4IWV A;  4B1W B;  3DLL L;  4NO7 A;  4I6M B;  3HM8 A;  3EN9 A;  5AQK A;  4MDA A;  3VES A;  3ATU A;  5CHI A;  3DWL A;  2NRH A;  3I56 N;  3LDP A;  2J4R A;  2P9P B;  1NBW A;  1C0G A;  3KWG A;  2ZJR L;  4IEI A;  3LDQ A;  5DM7 L;  4OO1 J;  2NRW A;  4FWP A;  1Q18 A;  1YXQ A;  4CZJ A;  5KQ8 A;  5JVG L;  1QQO A;  2V7Y A;  4H5W A;  5AQH A;  4BQZ A;  4O8K A;  4GV3 A;  2BUP A;  1Q7Y O;  5JIC A;  3RVC A;  4M7X A;  4JNE A;  5BN8 A;  1MWM A;  2HBM A;  4RTF D;  4BC3 A;  4CD1 A;  2HF3 A;  3E66 A;  5KPZ A;  5C12 A;  3VEW A;  2HST A;  3WEE A;  3VEV A;  1QVG M;  1BUP A;  5GAG P;  3ATV A;  4FO0 A;  3EO3 A;  1W97 L;  3WXM B;  2QA4 N;  5C0Y A;  2NNW A;  3ENB A;  4AM6 A;  3FZF A;  2NRZ A;  3O9R A;  4H5V A;  1TUY A;  5M1Q A;  1BA0 A;  2GTD A;  1GLD G;  4WYB A;  3OA9 A;  3ZX3 A;  3M6G A;  2RE2 A;  1H1V A;  1T44 A;  2QM1 A;  3DXM B;  5EX5 A;  1XQS C;  4BRA A;  4WQ4 C;  5JMV A;  2I7N A;  3O6W A;  2PAV A;  3VF4 A;  1HKC A;  3SBG A;  4BRQ A;  4DB3 A;  1WOQ A;  1EO1 A;  4JHD A;  1VQ8 N;  2ASO A;  3EE8 A;  5BRE A;  3CPE A;  5LJV A;  2Q31 A;  3KHY A;  2P9I A;  5BPN A;  3O9S A;  1TUU A;  3MMV A;  3HSC A;  1YIT N;  1NGG A;  1GLA G;  3EE9 A;  2P9N A;  2WUS A;  1NGB A;  3MWT A;  3NMU A;  4H0X B;  3SAF A;  3UKR B;  2Q1N A;  3O4W A;  4MLH A;  4KH6 A;  3CQX A;  1J6Z A;  3IUC A;  3I33 A;  4ISE A;  5M1P A;  4WFA L;  4BRG A;  1QVF M;  3BF1 A;  2FXU A;  2GWK A;  2E20 A;  3O1B A;  3A0I X;  4FVU A;  5JLH A;  3H1V X;  1VQL N;  1MWK A;  2E2Q A;  3IKM A;  5AQL A;  4GY2 B;  5C15 A;  2IVN A;  3ID6 A;  2D4W A;  2VWB A;  3O9T A;  5B8H A;  4FPA A;  1U2V A;  4YDU C;  3WQT A;  4J8F A;  2FSN A;  2VGN A;  3M1F A;  3H3O B;  5H1S Q;  2QWR A;  4JKG A;  3SJH A;  4WFN L;  2BTF A;  4H5T A;  3J7Z O;  3MCP A;  2HF4 A;  2QWM A;  3CPW M;  3K9J A;  3ZX0 A;  1IJJ A;  1P8Z A;  4BC4 A;  4CBX A;  4C1N K;  3HI0 A;  4XH4 A;  2YI1 A;  2EWS A;  3QIC A;  4IZ9 A;  5AQW A;  3QML A;  3CXC M;  4GV6 A;  3DXK A;  3LM9 A;  1XUP O;  1JCG A;  2V7Z A;  4AM7 A;  4L3Q A;  5BPL A;  1WUA A;  3CIP A;  3FZM A;  5AZI B;  1T3V A;  4A61 A;  5KPR A;  1GLL O;  2A6A A;  1VQM N;  3CCE N;  3CCQ N;  3PIP L;  5AQU A;  4IO9 L;  3TSQ A;  4JK8 A;  3O80 A;  4FWS A;  3C65 A;  3AAQ A;  1VQP N;  3C7N A;  5EXW A;  2FF3 B;  3FE1 A;  2A42 A;  3ENH A;  3RSE B;  4GV9 A;  4A5A A;  4JK7 A;  2DPN A;  2CGJ A;  4IFE A;  5AQS A;  5EY4 A;  4U67 L;  4YOY A;  4FL9 A;  3MN5 A;  1NM1 A;  3WXL A;  1K73 O;  1NGF A;  3K9K A;  4BGB A;  1KAX A;  3O9Q A;  3ZX2 A;  5JLF A;  5AQP A;  3D2F A;  1RGI A;  2IVO A;  3U8X A;  1KD1 O;  4NLC A;  1YVN A;  1HPM A;  4BRN A;  1DGK N;  3F2K A;  4FWO A;  3W0L A;  1LOT B;  2QTD A;  5ELZ A;  3O8M A;  2H3G X;  3VEO A;  3NVK A;  2HBJ A;  4MO5 A;  3QBX A;  3BP8 A;  3O9U A;  3TU5 A;  4B1X B;  4Z94 A;  1X3N A;  2A40 A;  2E8A A;  5GIO A;  4JD2 A;  2JWK A;  5C10 A;  1K9M O;  3G4S N;  4B1U B;  1EQY A;  5I9E B;  3A5M C;  4FOE A;  1P90 A;  2P9K B;  3UKU A;  2KHO A;  1M90 O;  1K8K A;  4C1N I;  3DAW A;  4WQ5 C;  1YF5 L;  3U4L A;  3ZEU B;  3VMF B;  3ULE A;  3CJB A;  3Q7C A;  3TSU A;  1CZA N;  2ITM A;  4WQ4 A;  2GX9 A;  3QDK A;  3PLA A;  1E4G T;  2QXL A;  2ASP A;  3QFU A;  2QW9 A;  2GEM A;  3EZW A;  1HKB A;  2Q97 A;  3L4Q A;  5EOY A;  4BG8 A;  4O5F A;  4YOX A;  5M1F A;  4YOR A;  5AZJ A;  1O13 A;  4FWL A;  1HLU A;  4NB4 A;  4A2B A;  1RDU A;  4EFH A;  3R1X A;  3VER A;  4UY8 O;  3C6H A;  1X3M A;  3R3L A;  4GVE A;  5AFU H;  3VEZ A;  5F1X A;  3BEX A;  1XC3 A;  4K42 A;  1G99 A;  5FPN A;  4IOC L;  3J8A A;  4QS7 A;  1KAZ A;  2ASM A;  3L6Q A;  1VQO N;  1M1K O;  2Q0R A;  2FF6 A;  2GEL A;  1NGA A;  3I8B A;  3ZET A;  1Q82 O;  3KWI A;  2ZF5 O;  3MWP A;  4BR5 A;  4YDU A;  5M1K A;  2W40 A;  4RWT A;  3EL2 A;  2F9T A;  4H03 B;  4BRP A;  3VET A;  4CBU A;  1VQ6 N;  4H5R A;  2OTJ N;  1DEJ A;  2QWP A;  1DKG D;  4JKC A;  1BU6 O;  4FPB A;  1TYQ A;  3AGK A;  3C0B A;  4LC9 B;  3W3D A;  5HL7 L;  4H5N A;  2QWL A;  5AQJ A;  3E9P A;  4JN4 A;  2YJF A;  3D6R A;  3IDH A;  2P9U A;  3VTI A;  3WT0 A;  1S3X A;  1D4X A;  3CCM N;  2E1Y A;  4ISF A;  2NLX A;  3GE1 A;  1Z05 A;  3ID8 A;  2KKZ A;  3Q7B A;  3HBT A;  1X9J A;  3CC4 N;  5BPM A;  4KH4 A;  5EVZ A;  1YJ9 N;  2UYT A;  4CZK A;  2JWL A;  3SK3 A;  3O5B A;  3OBY A;  2YCH A;  4JKE A;  5GIP A;  2CGK A;  2NRR A;  1ATS A;  2F9W A;  3L4I A;  5AQN A;  4YOU A;  4YOT A;  5FPE A;  4BR0 A;  4GNI A;  4M7Y A;  3CME N;  2ZWH A;  1NMD A;  3JS6 A;  5E26 A;  4XH5 A;  3B8A X;  4JKD A;  3F5T A;  4B1Y B;  5AQG A;  3VGK A;  4H0O A;  3G25 A;  4CZI A;  3IMX A;  3TTD A;  3WEE B;  4BRE A;  3LM2 A;  1VQK N;  2VYP A;  3CJ7 A;  4PKI A;  4BC5 A;  4NLB A;  4OPA A;  3CJC A;  3CCU N;  1NGH A;  3KVG A;  3FLC O;  5DM6 L;  4BR4 A;  3BF3 A;  2Q36 A;  4ILH A;  1C0F A;  1ATR A;  3CMA N;  2E2N A;  2A41 A;  5AFU A;  1QHA A;  3T69 A;  1YAG A;  4CD3 A;  2NRT A;  2D1K A;  3FFK B;  3P39 A;  3FGU A;  1T6C A;  1GLJ O;  3VEN A;  5AQI A;  4BVP A;  4YOW A;  4BR7 A;  3U9Z A;  1OKJ A;  1ILY A;  4JHD B;  4QS9 A;  2YJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...