4KFBA

Hiv-1 reverse transcriptase with bound fragment at nnrti adjacent site
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-Ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H, EXORIBONUCLEA P66 RT
total genus 165
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kfbA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kfbA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kfbA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kfbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kfbA05
1BHLA 5I42B 4LSLB 3NH1A 1O1WA 3VA3A 2QE5A 1GOAA 3VQCA 1N4LA 3L2UA 4KBIA 1JLFA 3JSMB 4EP5A 4KO0B 3SFGA 3FRZA 1TP7A 4BE1A 1HNVB 3EPGA 4IG0A 4Q43A 4F2RA 2KW4A 4DTJA 2HHWA 3DM2A 3TAGA 3OLBA 3RRGA 3TWHA 4ID1A 3KLFA 1ASVA 2BE2A 2FJVA 1VSIA 3V1RA 3PR4A 4CHNA 3BQ1A 2HNZB 4CEAA 1D9DA 1S1TB 4FJ9A 2BQUA 1Z25A 3L2RA 3DOKA 3DRSA 5EUHA 3OYHA 5HROA 1WLJA 4R5PA 3QLHB 3SJJA 2F8TA 3KKRA 4C8MA 3ULDA 3HVTB 5K14A 4CE9A 2IJFA 5KFWA 1MMLA 1SKRA 3H5XA 3MF5A 2G8KA 3H5SA 2X74A 4CEZA 4FJGA 4E89A 3UDLA 4TY9A 4FZXC 1TL1B 4R0EA 1KVBA 2OPPA 4O0JA 1L5UA 2FVRA 4I2PB 4RNNA 3O3HA 4KHYA 1HYZA 5F8IA 3IRXA 2CJQA 2AX0A 3GIMA 1YTUA 4J9NA 1CZBA 1W9HA 5KFCA 1ASWA 3K59A 4FS1A 4CHQA 1VSDA 3H4DA 4DTMA 1UOCA 5I3UB 2FC0A 3EYZA 4XIUA 4IRCA 3ZSWA 3OSPA 1IKVB 1X9SA 4RW7A 4PY5A 3M8SA 5DG7A 2AGPA 4AHUA 1LWFA 3BR9A 3FSIA 2E9ZA 1ZBHA 4NRTA 3C95A 5EWEA 1UA1A 3RB3A 2IBKA 4N41A 4ID5B 4NZ0A 4WYLA 4DL2A 1WSFA 4CJFA 1SUQA 4CEFA 4ELUA 2E9RX 4FJ8A 1JLEB 2OPRB 3ZSRA 4DSIA 3LP0B 1K1SA 1C1CB 3BDPA 2I5JA 1XR5A 5J2PA 3DRRA 3I0RA 1KCFA 3LPUA 3TAMA 5EDWA 2D3ZA 4DTPA 5KG0A 1RYSA 2EHGA 2YNGA 2F8SA 3AVJA 5KFRA 1UWBA 1WSGA 4MKAA 1NK8A 1CLQA 1FXXA 4BACA 2HB5A 3T5JA 4CF1A 3FFIB 4GVMA 3SPYA 4EYIB 1S48A 3GV5B 4O44B 2BQRA 5HRPA 5CZ2A 1WSIA 3PY8A 1RT7B 2HHSA 3CFOA 4ED3A 4DTUA 3THVA 4NCAA 2RF2B 3Q8PB 2R8KA 4ED2A 4B9MA 4OGCA 1L3TA 4KE5A 2KZMA 5L9XA 4CESA 3OY9A 5FRMA 2KZZA 4O4GB 1S9GA 5DLFA 3HSTB 3M8PA 1RDAA 3T5HA 4CF8A 4KHMA 3ZSVA 1ZBFA 1RAJA 3MXMA 3FQKA 1QAJA 4DTSA 4IDKB 1TK0A 2HWHA 5FRNA 4KKOB 1TKZB 3KK3A 1A5WA 4FW2A 3QNNA 1T94A 3DLGA 4IG3B 3OYBA 1S9FA 3ASMA 2YHAA 1TAUA 3KLIB 2IOCA 5F9LA 4BE0A 1HQUB 4DSKA 4FK4A 1VSMA 3KD5E 5KG7A 3NBPA 4WE1A 3PW4A 2RPIA 4FZZA 4DFKA 3AA4A 1HRHA 3LP1A 2FJXA 2F8EX 2O5DA 5KFOA 3S3MA 3KJVA 5KFTA 2HMIB 3VN5A 4W5RA 4CJSA 3O4NA 4K8XA 4AHVA 3MECB 3CFRA 4J9MA 4CHZA 4C8LA 4FJ5A 5KFDA 5F8JA 1S5JA 4JUZA 4URSA 4HUEA 4J9KA 4J9PA 3QNOA 4FJIA 3IN5A 3NBPB 4WE1B 3NF6A 1S9GB 2KFZA 4IG0B 4DSLA 2BANB 2B6AB 1TK5A 3ZSYA 4Q44A 4F4YA 2W9CA 1IKYB 4K4TA 3PHEA 5DQHA 1RDCA 3MR6A 3QYYA 3DLBA 2G8UA 5KFGA 3PZPA 4CJQA 2YKNB 2UVRA 2FVCA 3T5LA 3K5MA 2KTQA 5KFAA 1BL3A 2YKMB 4O44A 1GOCA 1RBTA 4O3PA 5HROB 5L1IA 1I6JA 3Q8SB 2OA8A 5T14A 1FKOA 3DI6A 3RR8A 1DTQB 5KFFA 3OL9A 2IJNA 1TVRB 3KK1B 4ECYA 4AH9A 3NKYA 3BSAA 3T5KA 1QUVA 4KV8B 1T3NA 2AGOA 3SV3A 4ZHRA 4RU9A 5JS2A 4MIBA 4YR3A 2ATLA 2BRLA 1C1CA 4W5QA 4OPKA 5KFYA 3QZ8A 3CFPA 3SI8A 1JXBA 2JEFA 3ZCMA 1ZETA 3TI0A 3QO9B 4CFBA 3TAQA 1JL2A 1KFDA 3IGVA 4CJTA 3NAEA 1IM4A 4ED6A 4I9LA 1RT4A 2D0BA 1NNDA 4O55A 3HPHA 2VG6B 2XC9A 2V4QA 4CHPA 1RTJA 3BJYA 4ZMMA 1IKVA 4NLOA 3LDSA 3OJUA 3P5JA 1LWEA 3VQQA 3O3FA 2HHUA 2AGQA 1JLQB 4J9RA 3KHRA 1Z26A 3TAEA 5KFHA 1N5YB 3OYKA 3V6DA 3LP2B 4XO0A 4R8UA 1RBSA 3ZT4A 4NLPA 4I2QA 4ECZA 3G10A 1X9WA 4Y2AA 4FJJA 4DS4A 4E1NA 3OYNA 3HVAA 3MECA 4M95A 2JLEA 3QIPA 3RAXA 4H8KA 5KRTA 3OS1A 4FLYA 4AILC 4ZP7A 4PWDB 2KQ2A 3KLEB 1IKXB 2OPSB 4FVMA 3BQ2A 4IH7A 4TSXA 2IGIA 2B4JA 2JEIA 4ECTA 4YFUA 4F4KA 4OVLA 3LWMA 4YMEA 3VQSA 4M3TA 4NYFA 2BE2B 4LQ9A 2XI2A 4RW9A 3LZJA 2BGGA 4CJRA 4CJUA 1N6QA 4N47A 3VQPA 3AVGA 3CVKA 4WFZA 3SUNA 1SUQB 3HVWA 3LP1B 4FK0A 2PZSA 2WOMA 4Z4CA 2P5GA 3KLHB 4YQWA 3G0ZA 4E1MA 3V9XA 2O4IA 1RCHA 3IG1B 2VG6A 1R0AA 4TYAA 5HRSA 1S6QA 4IFVA 3LALA 4M3WA 5KG3A 4LSNB 2X6NA 5T7BA 2R7YA 3DRPA 4W5TA 4U6PA 5KFIA 3PJWA 1Q9XA 4E7KA 1WSEA 5I3UA 2HNYB 3V4IB 3GILA 4U7CA 3HT3A 4CGIA 3DM2B 4DFPA 4EBEA 1JLAB 1DTTA 4K4ZA 4XPCA 4ZPCA 3MEDA 3OYAA 3DLRA 4YR0A 4PA1A 4ECWA 2HNYA 3V4IA 4J9SA 3F9KA 1VRTB 1BGXT 3KTQA 3CDEA 4F3OA 3T19A 4Z4EA 3SUOA 4YR2A 3QGHA 3L2QA 3HXMA 3NGYA 3QINA 1RT5A 5KG4A 2JC0A 2ZKUA 3I5BA 4Z0UA 3KHGA 4DU1A 1S1XA 3N6MA 3OL7A 4RNHA 1BISA 4IOBA 4KHRA 3VQ7A 4IH6A 2DPIA 5CYMA 3ITHA 3CWJA 2E6MA 4CFDA 5J1EA 4TN2A 1S0MA 5DGAA 3OYEA 4J2AA 5HBMB 3K2PA 2WB4A 2IM0A 4K4YA 4ZHRB 1LAWA 1RNHA 5KRSA 3KLHA 3AO2A 4M3YA 3NH2A 3SYZA 4BDYA 3DLEA 3KLFB 3OYLA 2X78A 4Z4GA 2OZSA 2AWZA 3VQEA 3ISNC 1LWEB 3SI6A 5DQIA 2W9BA 4CJPA 4E19A 4CK2A 1JLFB 3JSMA 3BGRB 2JEGA 4DL3A 2C2DA 3KNAA 2UVUA 1HARA 3MFHA 3RB6A 2QKKA 3U6FA 4FJ7A 5DQGA 4NLRA 4JV2A 2B5JB 1I3AA 2YHBA 3NE6A 2FLLA 1U09A 1LW2A 4F8RA 1KHVA 4DQSA 4GC7A 3F73A 3H40A 1HYSB 2R2SA 5KFXA 5F8MA 2RKIB 1SL2A 3V6HA 2DFHA 3V6JA 1ZTWA 4KRFA 3G6YA 3MEEB 3PX6A 1HYSA 2E9TA 5DK5A 3LANA 5JXSA 4KTWA 3D5MA 4PWDA 4NLTA 2VG5A 1SKWA 1KHWA 4KHNA 3SV4A 5KT4A 3B6OA 4O3SA 3QGGA 4CFCA 4LQ3A 3LP3A 4O3QA 1RTHB 3WNHA 5HRRA 1RTJB 2JEJA 1RT1A 1C2PA 5DLGA 2WONB 4FYDA 5C24B 2V9WA 4DMNA 4RW4A 2RDJA 3M9MB 4MFBA 3OHAA 2PYJA 3RAQA 4QWAA 3ZT2A 1BQNA 1S49A 4HKQA 2HNDB 3FDSA 4O3NA 2WTFA 1BQMA 3LP2A 3CJ2A 4R8UB 4FCYA 4CJVA 2ITGA 4CEDA 5KFPA 5C24A 5F8LA 1XWLA 3OYIA 4RNOA 2FBYA 4IFYA 5FDLB 1K1QA 4DLEA 3QIOA 4ZVEA 3I5AA 4AHSA 3VQ9A 4OKJA 2HMIA 3QGIA 3RBEA 1EP4B 3ZSQA 1TL1A 1S0OA 3EY1A 4CECA 1JX4A 2XWYA 5EU7A 3H5UA 1RT4B 1QAIA 1C1BA 1S10A 4IRDA 3QEXA 1ZTTA 1XR7A 1XC9A 2C22A 4CGGA 3H5YA 3DMJA 4EO8A 4LD0A 1XHZA 3MEGA 3AA5X 2IC3B 3AV9A 3HJFA 5HLFB 3OJSA 4RW9B 3AVKA 3AVNA 1EXQA 2J6TA 1J53A 2GUIA 1S1UA 2YNIB 3D45A 1NKCA 2G8VA 4WYWA 4DTXA 1HNIA 2Z1IA 1LW2B 4RW8A 3GQCA 2C28A 4IDKA 1SH3A 5L1LA 2EC0A 4EBCA 4ED7A 4CGHA 2ATQA 3RBDA 2J6UA 4KREA 1IO2A 3C6UA 4ZTJA 4QCLA 3MTKA 3GIKA 3OYJA 1RT1B 3I5CA 1RTIB 2XY5A 1U4BA 5KFUA 3PV8A 2G8IA 4DSJA 5KT7A 1TKZA 3PW7A 2HHTA 4KAZA 3PW5A 3V9SA 3HL8A 1MU2A 4HTUA 4B9UA 4HYKA 4MH8A 3U3GA 1JIHA 2B43A 3KIOA 4B08A 2HW3A 2ALZA 2WONA 2D41A 4JV1A 3ZSXA 1FKPB 3PUFA 1X1PA 1WN7A 5HBMA 5K14B 4DLGA 2D7SA 3OYCA 4B9SA 2HHQA 5KG2A 4H54A 1T03B 3CJ5A 4BE2A 1RDRA 1D8YA 5JS1A 4KB1A 1SH2A 4OKKA 4JV0A 4KO0A 2RDIA 2QV6A 3LWLA 1A5XA 4KFBA 1QHTA 1RT3A 2DFEA 4ZVFA 4HVJA 4N5SA 1QE1A 4Z4IA 3UQSA 3MR2A 3NF9A 4ECUA 4IFYB 5FDLA 1EX4A 4EP4A 1NKEA 4TQSA 5KGXA 3IRXB 3TARA 2IS3A 4H4MA 1N6QB 1G15A 1S1VA 1OS5A 4NYNA 2PYLA 3DOLB 3TAMB 1NJXA 4FK2A 2D0CA 4JRQA 1RT3B 2YNHA 4O0IA 1WSHA 4Q8EA 4JRPA 3PW2A 1RA6A 3IG1A 1KRPA 5F8GA 1REVA 4PUOA 3QLHA 3O3GA 3WNFA 2DTUA 2IAJA 1NK9A 3DLEB 3SZ2A 4HCBA 3V81B 1TK8A 3UIQA 5KGWA 1S4FA 1JKHB 1BCMA 4DFMA 3DLGB 3ICLA 3QEVA 3RRHA 4DL6A 1EP4A 3TVKA 4Z4FA 1S1TA 4KSEB 3V9ZA 2I5JB 2BRKA 2R2RA 1NK6A 2QKBA 4M3UA 3VQ6A 4ZP6A 3ALYA 3I8DA 2FVPA 1ZBLA 3NF8A 1MU2B 3KD1E 3PX4A 3HK2A 4ZPDA 3K5NA 5CYQB 2VWJA 1F21A 3NFAA 1L3UA 1Z4UA 1S97A 3OHBA 3DOKB 3DRSB 4LSNA 4NLXA 5EWFA 3HYFA 3ZSZA 2RF2A 3G86A 5D3GB 4DF4A 4CGJA 1LWFB 3RMDA 3E51A 3GV8B 4ICLA 2FBXA 4QAGA 4DU4A 1VSHA 1YT3A 3KHLA 4M41A 3OYDA 4CK1A 1QSSA 3IS9A 2D0AA 2UUWA 3CG7A 1S1XB 2HAIA 1VRUA 3PX0A 3N6LA 1UWBB 4K4XA 2R8GA 1TKDA 3AA2A 4AHTA 1JLGA 2HNZA 1KVCA 4FLVA 1L3VA 2HVIA 1RTDA 2W8LA 1S0NA 5KFJA 1U49A 2UVWA 2NUBA 3DRRB 4W5NA 1HPZB 4DU3A 4F4XA 3OL6A 3LAMA 1C0TA 2GC8A 3NMAA 1TAQA 3BSOA 4ZPAA 4Q5VA 1D1UA 4KI4A 4DFJA 4HUFA 1NJZA 5CYMB 4ED1A 2GIQA 3KMSA 4MQ3A 2XHBA 4NCGA 1T03A 4EO6A 4E7HA 2BDPA 2YNHB 4IKAA 1RILA 3SFUA 4FS2A 1JLGB 4DL7A 4CHOA 2UUTA 1FKPA 3I0RB 2RN2A 2XI3A 4G3IA 3RB0A 3AO3A 3V6KA 4DEZA 4ZVGA 2W8KA 4AHCA 3RMBA 4HCCA 2W9BB 2XY8A 5J2NA 4KB7A 3HP6A 2A1RA 4F4WA 1KLMA 1JLCB 4EYHB 1J5OA 4B3OA 5DG9A 2BR0A 2ZE2B 3CJ0A 4K50A 4TY8B 3RB4A 1VSFA 4EZ6A 1A5VA 4FLZA 5D3GA 5KFNA 3N6NA 2Z1HA 4KTZA 4WXOA 5KFKA 3UR0A 1U04A 1GX5A 1D9FA 3KOAA 4TXSA 4CJLA 2AJQA 3G6VA 4ZP9A 5F9NA 1N5YA 4FBUA 3E01A 1C0TB 1TV6B 2OZMA 3LPTA 3ZT1A 5F8HA 3Q8QB 2Z1JA 2AQ4A 4NLVA 3P83D 4FLTA 4CEQA 5DGBA 1ZYQA 5C25A 5SWMA 2G8HA 3HVRA 5J2PB 2GV9A 3HPOA 4QWBA 4B8AB 4C8NA 1LWCB 3MAQA 1JLEA 3TQ1A 4CF9A 5KFEA 3CM6A 4NLSA 5HP1A 4PQUA 2P1JA 3HM9A 3MEGB 5J2MA 2XRIA 1KSPA 1HQEA 3HVTA 4C8OA 3VQ4A 2OPSA 1HMVA 3FQLA 4ED0A 3MXJA 1QS4A 4DWIA 2IMWP 2V4RA 3NAIA 4UQGA 5I42A 4Y34A 3CM5A 4IR9A 4ECXA 4IR1A 4FJLA 3BGRA 1BQMB 1QSLA 2VA2A 4GMJB 1C0MA 2G8FA 4DS5A 2AX1A 1J54A 4BWJA 2HWIA 1YVFA 1S9EA 2WHOA 3SQ1A 3CO9A 1T7PA 4Q45A 2QXFA 3QESA 2W7PA 2DFFA 4LY7A 2W9AA 4C8KA 4Y3CA 3L2VA 4NRUA 5CZ1A 2R8HA 5KFSA 4CEOA 1JLBA 3K5OA 4RG8A 3KLGB 3KLEA 2R2TA 1EETA 4PQUB 2JGUA 4K4WA 2ASDA 2CKWA 3M9OB 4BWMA 1BI4A 4KV8A 3AVFA 1IKWA 4B9VA 1KVAA 3LAKA 4NLYA 3H98A 3NGZA 3VQAA 4CIFA 4TYBA 2OPQB 4CJKA 3OS0A 4ZPBA 4WFYA 1D5AA 5KG5A 2YKNA 4NLDA 1CSJA 1C0UB 1IG9A 1QE1B 2PY5A 4MFBB 1RTIA 3RMCA 4EZ9A 4EEYA 4BDZA 3KLIA 4DSEA 3VQBA 3T1AA 4QW9A 4Y1DA 2ZE2A 4E7IA 2ILYA 4RW7B 1XHXA 1IKYA 3ZT0A 4URGA 4NCBA 3BREA 2OPQA 2Q3SA 4B9TA 1VSKA 4CIEA 4KAIA 1U47A 2XO7A 3UPFA 3PW0A 4E0DA 4DTRA 1NHVA 4WZQA 4Q0BA 4FJMA 1TKTB 2GIRA 1KTQA 4FM0A 4ECSA 1RBRA 3ITHB 1T05B 3V9UA 2FJWA 1DTQA 1TQLA 4CGDA 3VQ8A 4KTQA 3PVXA 2IM2A 2D5RA 1BQNB 3KLGA 3E01B 3BSCA 4M3ZA 4FLXA 3NAHA 3ZSOA 4ICLB 4KPYA 1REVB 2WK4A 4F3TA 3QIDA 3PO5A 4TQRA 1RA7A 3QIPB 3NL0A 4J9LA 3S3NA 3EPIA 4NLGA 3NHGA 1FK9B 4GC6A 4WZMA 4B3OB 2YV0X 3H08A 4FJKA 1NOZA 3V9WA 1RT7A 3BQ0A 4TY8A 1SKSA 4QPXA 3C6UB 3CJ3A 2OH2A 2XY7A 4I2QB 2HHXA 1L3SA 5J2NB 3JYTA 1W25A 2FBTA 1S1VB 4DTNA 1UAXA 5KT2A 1LWCA 3AVCA 3NGIA 1XR6A 3PJXA 4CJ5A 3SQ0A 2GBZA 4WFXA 5HLFA 4LH5A 4FM1A 4NCGB 3AVMA 1B92A 2W42A 1HJRA 2QK9A 3OL8A 1S1WB 2YNFA 4K4VA 1ZBUA 5C42B 2FVSA 2JC1A 4MKBA 5J2QB 1NKBA 1TL3A 3WNEA 4NLQA 5J2MB 1JXLA 4QOZB 4W5OA 1K6YA 4DTOA 4KHUA 3QZ7A 4Y1CA 4NLUA 1VSEA 2O4GA 3P1GA 1VSLA 1NK0A 4WXWA 3TAFA 4KKOA 3KK3B 4ECQA 4FM2A 3RWUA 4J9QA 5KT3A 4DQQA 3MEDB 3AVIA 2ASJA 4L8RB 4ID5A 4G1QA 1TV6A 2LSNA 4IBNA 2YNFB 1DLOB 5KFQA 1RT2A 5FROA 5J2QA 3TANA 4CERA 1RDBA 4I2PA 3IS9B 3HP9A 2R8JA 3HKWA 5KFZA 1GOBA 4ZVHA 5L1JA 4K4UA 3OYMA 1R0AB 2AU0A 4IFVB 3AO4A 5SZTA 3AA3A 2WOMB 1VRTA 3M9NB 4RUCA 1ITGA 3DDKA 3QEIA 1HMVB 3SPZA 1TGOA 3V6DB 4KB0A 3T3FA 1JLAA 3CYMA 1RT2B 3IAYA 5KFVA 2HNDA 5CY4A 4M45A 5HP1B 4TLRA 1RBVA 1WAJA 3S9HA 1SL1A 4OL8A 2RKIA 4KFBB 5DMRA 4DQIA 4RNMA 1LW0B 3AVLA 3SQ4A 3K57A 4JS5A 1FKOB 5J1EB 3AVAA 4O3OA 1RBUA 3RMAA 2IC3A 3C94A 3V81A 3L3VA 1IKXA 4J2DA 5CYQA 2ASLA 1NK7A 3OYGA 3MR5A 1BIUA 1TL3B 4ED8A 1T05A 1QSYA 1QQCA 4QWEA 4CIGA 3M8QB 1RT5B 4Y2CA 4OLAA 2WCXA 4AHRA 2VG7B 2XGQA 3GIJA 4F2SA 4Q0BB 2B5JA 2VA3A 3A2FA 1S6QB 3NF7A 3OSNA 4O5BA 2IM1A 1RTDB 4CK3A 4CJ4A 1LV5A 3ZT3A 3C6TB 5C5JA 2FVQA 3DOLA 1DLOA 1CXQA 1KLMB 1S6PB 3SUQA 4CFAA 4IRKA 4CHYA 3C6TA 2Z1GA 1JXEA 3RTVA 4J2BA 5HRNA 3DRPB 4MK7A 1Q9YA 3AO1A 1EETB 2DY4A 3NGDA 4FLWA 4CGFA 3V1OA 2ZD1A 4E7JA 4M42A 2XGPA 1RTHA 4LSLA 4MK8A 4IQXA 3KK2B 2OYQA 4I9QA 4H4OB 2ZQBA 3HPGA 2BQ3A 1S6PA 4HUGA 1EKEA 4B9NA 1HPZA 1Y97A 2R8IA 3IGNA 1XI1A 4CCHA 2X6SA 4M3XA 1CZ9A 1HNIB 4IH5A 2P5OA 1I39A 1JL1A 3WNGA 2XCPA 3LP0A 2E6LA 4RW6B 3GV7B 4RUAA 5KFMA 2YKMA 5C42A 4CJWA 1RT6B 3DLKB 3KKSA 5KFBA 4M3RA 3CIZA 2IM3A 4BDPA 4RW4B 3H4BA 3BSNA 1NHUA 3RR7A 4Q8FA 3VQDA 1S1WA 3QEPA 1U48A 1WSJA 3MR3A 4CF0A 4DSFA 4CJEA 4OGEA 3TAPA 2FLNA 3OS2A 2BANA 4N76A 2W9CB 3V1QA 3H2LA 3PR5B 1JLCA 4E7LA 4N56A 1U45A 1C0UA 4RW8B 1B9FA 1WNEA 4B8CA 2C2EA 3S3OA 3EZUA 2A1SA 3O4QA 5DG8A 2EX3A 3G6XA 1T8EA 4ELVA 4OLBA 1SL0A 3CQ8A 1S1UB 2YNIA 4NYZA 3QERA 2HHVA 4RNFA 1TKXA 4FJHA 2OPRA 4KI6A 1KFSA 4IKFA 3DI6B 1LAVA 3M8QA 2VG7A 2HVHA 4F4ZA 1JLBB 4DQRA 4ZP8A 2VG5B 5F8NA 5KTQA 3ISND 3Q8RB 2ILZA 3D0PA 5L1KA 1RYRA 4K8ZA 4EBDA 2YNGB 1SH0A 4DG1A 1W0HA 4PUOB 4G1QB 1NJYA 3PO4A 2J6SA 3DYAB 3SUPA 1SV5B 3I0SB 5KG1A 1B9DA 2DPJA 5KFLA 3NH0A 1TKXB 2R2UA 2WRMA 2FLPA 1VSJA 4GW6A 1N48A 4KHQA 3DYAA 3K58A 2Y1IA 3MFIA 4YNQA 1HYVA 4OPJA 4X2BA 2UVVA 4O4GA 5E41A 4H4MB 4JS4A 4DL4A 4XPEA 3AVBA 3QETA 1JLQA 2OPPB 1IH7A 3SQ2A 2G8WA 1NOYA 3KMQA 4ECVA 4MK9A 4I7FA 1YVUA 4OJRA 5KT6A 4FXDA 1SV5A 3I0SA 3OLAA 4ECRA 3NCIA 2V0NA 1NK4A 3U3YA 4JLHA 5JUMA 1X9MA 3OVNA 3QO9A 2XCAA 2XY6A 4YP3A 4O4RA 2B6AA 1C1AA 1D0EA 4URQU 1HQEB 3TABA 3GYNA 1ASUA 4RW6A 3HO1A 3JYTB 4FZYA 3KLVA 3AO5A 3CDUA 4CF2A 1BI4B 1Q8IA 1TKTA 4KHWA 1IKWB 3L2WA 3MEEA 1J9AA 1TVRA 3KK1A 5KI6A 3KJVB 2FBVA 4DQPA 3M8RA 3MXIA 4B9LA 4O3RA 1BIZA 4H4OA 3B6PA 5KT5A 4MIAA 3VA0A 3L3UA 2VWKA 3QEWA 2ZD1B 5KG6A 1C1BB 1LW0A 3OYFA 2W7OA 4Z4HA 3D28A 1WNSA 1YTAA 2Y1JA 3AVHA 1RDDA 4E3SA 4IG3A 2C2RA 4FBTA 3CJ4A 4I7FB 3EZ5A 4FJNA 2KFNA 3K5LA 2F96A 1HNVA 3DLKA 1GX6A 4RZRA 3M8PB 4FW1A 2ETJA 3H59A 4FLUA 3KK2A 1BCOA 4QW8A 3VQ5A 4F50A 4LH4A 1NJWA 1QTMA 4FJXA 2I1RA 4CEEA 1UA0A 4ZTFA 1FK9A 2IAJB 4DG1B 1N56A 3L8BA 1C6VA 3CDWA 4QWDA 4NLWA 4R5PB 3DMJB 4M94A 3KHHA 3HHKA 2E4LA 4HHTA 4KHSA 3FFIA 1WAFA 1KLNA 1RT6A 3DLHA 2P51A 2D3UA 2IDOA 3SNNA 1CXUA 3NDKA 4J2EA 1JKHA 1HQUA 1NK5A 4DL5A 5EWGA 4CJ3A 4ELTA 5C25B 1J5OB 4K4SA 4QWCA 1ZBIA 4DF8A 4CEBA 4J9OA 1DTTB 1VRUB 2IA6A 1S9EB 3LZIA 3TR8A 1VK0A 3GIIA 4OKEA 3SCXA
chains in the Genus database with same CATH superfamily
1BHLA 4JI8K 5LJ3Y 1NU4A 4P9SA 5IWAF 3NH1A 3CC7S 3DLLL 2VUGA 1O1WA 1F2HA 2UXCF 2P9LB 3VQCA 1NBWA 2DCLA 3L2UA 1AUDA 4KBIA 5BREA 5I9EB 1NJIT 1IWAA 3W62A 1R27B 1NGIA 2KW4A 4H5RA 1RP5A 5THWA 1UVLA 3FSYA 3DM2A 3RRGA 4U96A 2J4RA 1REGX 3ETOA 4TU9A 4LF9K 3CCEN 4ISFA 4H5NA 4BC3A 2FB0A 1PC4A 2V2VA 3SBGA 2HRYA 1D9DA 3VF4A 1J27A 2AJFE 4FJ9A 2QC3A 2BQUA 1EO1A 1Z25A 4ES2A 3C7NB 2DR7A 3CPWR 1DKGD 4JD2A 3WZ0A 2F8TA 3B4MA 3KKRA 3ZNJ1 3ULDA 1MMLA 1SKRA 3MF5A 2JH3A 2MZSA 2X74A 4CEZA 4C3LA 2PN6A 4FZXC 2KHCA 2CJ9A 1GNKA 4XH4A 3JAMO 2QSWA 4UOHA 2F9JA 4LFAK 4OHXA 4RNNA 3O3HA 1YJNN 2L9WA 3OTCA 5F8IA 2CJQA 1TFYA 2E1RA 1VQKN 2AX0A 1YTUA 1SJ4P 5BRHA 1ASWA 4DR5F 2H3GX 4FS1A 3BBBA 4CHQA 1X4DA 3H4DA 5FD1A 5I3UB 2P9SA 2A6OA 3CCQS 3OSPA 1XQSC 3MX5A 4AM6A 2E9ZA 3TO8A 4BVOA 3LOUA 4NRTA 3NY0A 1NHKL 1SPBP 3RJMB 4ID5B 1VQMN 3R5DA 4ID8A 2E9RX 4O23A 4FL9A 2OPRB 4YDUA 3A13A 1NGAA 1KOOA 3DRRA 2BJ1A 3ADAC 3TAMA 1C0GA 2HIQA 5EDWA 3SQOP 7FD1A 5IFMA 3A5MC 4DTPA 1RYSA 2F8SA 4A8WA 4MKAA 1NK8A 3D1OA 1FXXA 4YB5A 2HB5A 5CE3A 2AF6A 3GV5B 4O44B 2BQRA 5CZ2A 4USWA 3G71N 1RT7B 3W8GA 4DTUA 3THVA 3KUGA 1FF2A 2RIJA 4NB4A 4I6WA 4PQAA 5FPEA 4ZCMA 3UKRA 3QFPA 4FVUA 2H5IB 3L09A 2ZDOA 3SMSA 1RDAA 2ZZTA 3ZSVA 2DNQA 1FHTA 4IDKB 5FRNA 1TKZB 2CUYA 1RI7A 4F67A 3AB2B 4KIAA 4A62A 1IG8A 1WG4A 3OYBA 1S9FA 2IOCA 2NRTA 3DWLA 3QT7A 1H2UX 2HYIB 3NS6A 3KD5E 3M2RA 4OX9J 1OO0B 4WE1A 3PW4A 2RPIA 1HRHA 4G1IA 3LP1A 1U1QA 3NWRA 2X1GA 2RRNA 2FHKA 2HMIB 2HKEA 4LF5K 4CJSA 2V94A 1EIYB 3I8BA 3O4NA 2BX6A 1WBBA 4LF5F 4FZVA 4OQJA 3MECB 2PA8D 4JHDA 1J5EK 3VF0B 2XMWA 4J9KA 5DDQC 2UUBK 4ETZA 2HK3A 1X4CA 1S9GB 3SJHA 4IG0B 3T41A 3ZSYA 5M1NA 4YOTA 1IKYB 1RAFB 3CPEA 4OMFG 1GXLA 4K4TA 2UXCK 4DUTA 3MCOA 3DLBA 3MDQA 4JI5J 2G8UA 5KFGA 5B0AA 3QFUA 4I67A 1FX2A 4DV1F 4WF9L 1WF2A 4I6MA 3K5MA 2F63A 2CQ4A 2YKMB 3FCHA 1GOCA 1RBTA 5L1IA 2M7SA 1NDLA 3DI6A 3OL9A 3TSPA 2IJNA 3KK1B 1F5CA 3NKYA 4AH9A 3BSAA 2BH1A 2VJUA 4K41A 1T3NA 3C2PA 4ANCA 3ZO7A 4RU9A 3O3LA 4H0TB 4OPKA 5KFYA 2EFGA 2WB1D 2E1MC 3D7SB 1IBLF 4CLPA 4CFBA 2H1YA 2IMOA 2OSQA 1PSDA 1QVFR 4LFCK 5CYJA 2VQFJ 1RAIB 2O8EB 3QJLA 4ED6A 4F36A 1GLCG 4OJHA 2V50A 2XC9A 3BJYA 1IKVA 4NLOA 3VEVA 1T11A 1G2EA 1W7WA 3BY5A 1Z26A 4K2XA 3GU0A 2YWHA 2ZWOA 1RBSA 4R0JA 4DR4F 3G10A 1N5SA 5A8RB 2AJ1A 4BLGA 4DR4K 3BO2A 5FPDA 4AL5A 4M95A 4DR7K 3MM5B 1RCXB 3RAXA 5KRTA 2VC0A 1HWIA 1RTZA 3UI3A 5F2RA 3EKUA 5AQZA 3BZKA 4TSXA 4EIAA 4MKVA 2ZH8A 3MCSA 1AZSA 4K0KJ 3VGUA 2NLWA 2YX4A 1U25A 2GHWA 4LT6A 4GNIA 8RUCA 2LYVA 3D3BJ 2QL5B 4RR5A 4DPTA 4CJUA 1FWPA 4N47A 2K3KA 3R1HA 2DO4A 3HZGA 2QMUB 3OVSA 5E0OA 1WD6A 3CJ7A 3HVWA 3UVJB 3OR2B 4ETXA 3LP1B 1GXUA 1KN6A 1U6FA 3BF4A 3ID6A 2WOMA 2P5GA 3A8IA 1JJ2M 4DX8H 3IG1B 1R0AA 3R5AA 3BEXA 5HRSA 3J7ZT 5KG3A 4LSNB 4M63C 3DRPA 1SQGA 1VQLS 1DBDA 2KO1A 5I3UA 2XS7A 1XERA 2P9SB 4CGIA 3BGUA 4DFPA 4FPBA 1UVKA 1DTTA 1RHJB 4XPCA 1HIYA 1O5JA 4WF9Q 1G3OA 3CD0A 1S79A 4PA1A 3CJAA 2HNYA 1EWQA 3F9KA 3KTQA 3NGYA 3I5BA 3KHGA 3QT8A 4DU1A 2MY7A 3OL7A 3M8YA 5M1OA 1BISA 4IOBA 1ZA1B 2DPIA 3CWJA 3DLJA 2P9GA 4X4UA 1VAZA 1RWWB 2V8PA 4CDIA 2E5LF 5AQUA 2WB4A 2CG8A 4BQLA 1LAWA 5E5NA 1H73A 3KLHA 2DNPA 3NH2A 3JSYA 1NNEA 1WHVA 2NXEA 3WIUA 1UEUA 3OYLA 4Z4GA 1RGVA 3O6QA 3CC7N 3DU6A 4U8VA 3SI6A 2W9BA 2LQBA 4CJPA 2O8CB 3I56N 3HHEA 2CJXB 3BGRB 2AJ0A 1FFGB 1XMBA 5BR9A 3S6EA 1ATNA 4CNZA 3K7RA 2CPHA 5AQLA 2B5JB 3B8AX 2OHDA 1U09A 3OV7A 4BRKA 1NMNA 5CQGA 2FHOB 4CTAA 4Q2LA 4CI6A 4DV2K 2LQJA 5CCLA 3DJCA 5IT9Y 2VQEF 3OXFA 2NQPA 4NO7A 3IWLA 2DFHA 2CJBA 1R8AA 4M5JA 4X64F 4LR9A 4KRFA 2B7CB 4X66J 2QT7A 4FSVA 2E9TA 3IWNC 2ZH4A 3E3XA 5JXSA 1Y11A 2XYHB 3D5MA 5GADP 1SKWA 2XSJA 3SV4A 1TU0B 3DGPB 2CH6A 1FDDA 1Y00A 5B0EA 4H03B 2AP6A 4CYUA 3WNHA 1UPPA 1UW4A 3BKTA 4FYVB 5DLGA 1VQ6S 1KR4A 3KWMA 3CCRS 4YUDA 5JMNA 3BN7A 4QWAA 3ZT2A 1S49A 4HKQA 1B3TA 2WTFA 3FDSA 1BQMA 1VBXA 3HF5A 2P9NA 1CC7A 1IJJA 4KGMA 2D3OR 4FCYA 5C24A 2ZH2A 5F8LA 2C3YA 1H0HB 1KS2A 4U67L 2L41A 4I64A 1X4AA 3NMRA 4X62K 2K1RA 1A7GE 4CECA 1NLKL 1RT4B 2CQBA 1QAIA 3HTVA 1O6XA 4CZGA 3QEXA 1G1XA 3I6PA 2MQPA 1NGGA 4CGGA 3IM8A 1RHKB 3O1LA 3DMJA 4LD0A 3TR5A 1M0SA 3AV9A 3Q7BA 4EUVA 1KAXA 4BGBA 5HLFB 3R8YA 1GFWB 4G65A 3AVKA 4OI6A 2B9EA 2VOOA 5GAHU 4OX6A 4I1TA 2YNIB 2Z30B 2HF4A 2P2CB 1UFWA 1HNIA 2D0PA 2Z1IA 3HM8A 4RW8A 3M2UB 2C28A 5LL6d 2EC0A 5CH7B 3VAGA 2EI5A 2J6UA 1IO2A 2W01A 1U7LA 3MPYA 3GPAA 3GIKA 1RT1B 1GLJO 4JI6F 5AQRA 1VISA 4H0YB 1FCAA 3O1BA 2M88A 4F4AA 1P8ZA 4JI7J 4DSJA 2QEXS 1K8AT 1I5OB 3C15A 5C0YA 3IR5B 4KGVB 4DJBA 3N79A 4B9UA 1FDNA 5E3QA 2J8AA 2N3LA 5LT5A 3KIOA 2HW3A 4K0KK 3TUZC 3IM9A 3CC2S 1HHTP 2WONA 2D41A 4X62F 2RQCA 5D77A 3LDOA 3LL3A 4AUKA 5K14B 2UV8G 1QY7A 2HSTA 5KG2A 4A48A 3ZZPA 1T03B 3BPSP 1VQ4N 1D8YA 5JS1A 1MG7A 5AQWA 1SC3B 1FJCA 1YJUA 2XHWA 4OKKA 4KO0A 2QV6A 2YXLA 3LWLA 4JAXA 3OFEA 2FPHX 1N0VC 4XK8C 1RT3A 4HVJA 2YQ0A 1ZA2B 3UWTA 1QE1A 2EWSA 4Z4IA 1TL7A 3ELHA 3OUYB 1CS4B 1RQ0A 1EX4A 1DEJA 4JV5K 5JVGL 4TQSA 2PO4A 3I56S 4KH6A 2GHPA 1N6QB 2C3PA 1CPZA 1KWMA 2K2PA 3OPKA 3DC2A 1HPMA 4JRQA 1OH7A 4BRIA 3T1YK 2QTDA 2O67A 1BMQB 2HBRB 3PW2A 2QWQA 2DY9A 2FC9A 3M05A 1UETA 2AEJA 5I4MA 1ATSA 3ENAA 4A8MP 4C0OC 3FZKA 3W65A 1IBLJ 2OEJA 4CBUA 1W2BM 1QVGR 2DTUA 3DLEB 3QT6A 5AQFA 4B1YB 3UIQA 1BCMA 1Q16B 2QZ8A 3IAM9 3ICLA 3O9SA 3O8MA 3E9OA 5AE2A 1YHQN 2EW9A 3TVKA 2UXBJ 3V9ZA 4BREA 2BRKA 2F9DA 3ALYA 5GADI 1K47A 4B1XB 1ZBLA 5AJ3K 3N4QA 1C4CA 1EZZB 2Z2MA 3CIPA 3F41A 3FBFA 3NFAA 5HVGA 3OHBA 3DRSB 4IWVA 3SBMA 4ALZA 3HYFA 4QIFA 3G86A 5D3GB 3RMDA 3GV8B 2YWEA 4ICLA 1VBKA 3VTIA 4JI7K 1YX2A 1MWKA 1VSHA 3OYDA 5J1PA 2EFVA 3ONQA 1QSSA 2A1BA 2RRBA 2UUAF 3J80U 2E2NA 4Y2MA 3ENVA 4NXMK 4OJ3A 2R8GA 1TKDA 2A41A 2HVIA 1N33K 1RTDA 1U49A 2NUBA 3DRRB 4DR2F 1UEKA 1TUUA 1C0TA 1TAQA 1D1UA 1UFLA 1IBMK 1NJIO 1FO1A 3CTRA 4ED1A 3KMSA 1S5ZA 4MQ3A 3THYA 4BC9A 3HOTA 3THXA 4NCGA 3C6HA 2GHVC 4EO6A 3CCLN 1Y5NB 2YNHB 3R27A 5F0XA 1JLGB 1N5TA 5LMUF 3G82B 2FY1A 4DR6J 2HQIA 3RB0A 4V19S 3AO3A 2RILA 5AZIA 4ZVGA 2G1DA 2XY8A 3HP6A 1WHXA 4A8KA 2DGOA 1JLCB 4A57A 3W2WB 1HLWA 2I38A 2F4FA 3UDEA 2BR0A 4K50A 3RB4A 4NPOA 1VHFA 4DR3F 3FZHA 4C23A 4HT5A 1ITPA 3GCWP 3D67A 1OKJA 3N6NA 2Z1HA 1RLDA 4KTZA 3VOVA 5KFKA 4J7CA 5EGYA 2O1PA 4RWTA 2DNKA 4TXSA 2KH9A 2NSCA 4CH7A 1F9HA 4ZP9A 2MZJA 1UKUA 2E7XA 4FBUA 4W90B 1P9YA 1TV6B 1YJWN 3RUBL 1E6YB 3VR1A 5L8RC 3Q8QB 2AD9A 3F56A 3BM7A 1UTAA 4NLVA 1ZYQA 5C25A 1J6ZA 2G8HA 1SJQA 3P5TL 5J2PB 3HPOA 4QWBA 2QM1A 1QAYA 4C8NA 2X51A 1JLEA 3TQ1A 3CM6A 4PEOA 5J2MA 1VJQA 1G99A 3KWGA 4FO0A 3FQLA 4ED0A 4JB8B 3MXJA 4CO4A 1M5OC 3D0HE 1S22A 2GVZA 2IMWP 3NAIA 5I42A 5HL7Q 2CADA 3CM5A 2Z2LA 2KJWA 2VICA 4ECXA 3MMJA 1B0VA 1QZ5A 1C0MA 1RBAA 3THPA 4DS5A 2WC9A 9ATCB 2V63A 2Y9HA 3VGTA 4QR0A 2DY1A 2WHOA 5LSRA 4M5DA 3SQ1A 1H98A 2FZCB 5T7LA 4MAKA 1HR0F 2DFFA 2ZITA 3OUYA 4LY7A 1U8SA 4CO3A 2W9AA 2J9DE 4X66K 1OH5A 3W0LA 2LLZA 2LA4A 5EOYA 2R8HA 2VFRA 3OTOK 3K5OA 3KLGB 1TR0A 2L9DA 1WC1A 4PQUB 1FW6A 1F3VA 2CKWA 2CNLB 2V5HG 4JI4J 4FYWB 3EM1A 1CQMA 4CJ7A 2BJ7A 2P9CA 4AXIA 3DDNA 3VQAA 1CJKA 5AQJA 4CIFA 5KQ8A 3OS0A 4ZPBA 3MUTP 1D5AA 3LM9A 1CSJA 1IG9A 2VQEK 1QE1B 4MFBB 3IKMA 3RMCA 1MN7A 1CS4A 3KLIA 3EGVA 2A42A 3TJ8A 4AM7A 2WTUA 4QW9A 2ZE2A 2ILYA 5E3CA 4URGA 5B09A 3BREA 4B9TA 1VSKA 3VAKA 3AXMA 1XC3A 2XO7A 2B8QA 2R7OA 3FSXA 3UPFA 4LC9B 5D0HA 5AQPA 4E0DA 3AXKA 1KAZA 2NCKL 4BR7A 4WZQA 3D1HA 4JNEA 2M70A 4FJMA 2P9UB 1HFEL 2MSSA 3FZFA 4ECSA 1RBRA 2QG9B 4B3RK 3BDEA 3EVWA 5ETNA 2IM2A 3THYB 2YHWA 1BQNB 3BSCA 1VRQC 3NAHA 4KPYA 3PO5A 3ZTOA 4TQRA 1RA7A 3EPIA 3NHGA 2WSCC 4ZDNA 1LWXA 3QAUA 1M5PC 4YY3J 4NA3A 3X1LB 1NOZA 5L46A 3BQ0A 3V9WA 4WK1A 1OVQA 3GR1A 3AQOA 2OH2A 1RWKB 3SCKE 3MN7A 1RBOB 1W25A 3MMCA 4X4SA 2FGCA 1UAXA 3PM9A 4X4NA 1U1RA 2JL9A 4J8FA 3P39A 3SQ0A 4X4TA 4GVLA 3EVOA 4CWBA 1HD1A 3ZZUA 3AVMA 4B3SJ 3G4SN 2W42A 1X9JA 1C0FA 1YLXA 4K4VA 2YNFA 3SK3A 3W64A 1YJWS 2YVSA 2JC1A 2LQ9A 2CZ9A 1NKBA 2KJVA 3G8SA 2EBGA 1YITS 3ZEUA 2MYFA 1P6TA 5A6WA 4LVNP 1HBNB 2WBMA 3QZ7A 1VSEA 4Y1CA 4JI5K 1NGHA 4DV7K 2CQCA 3TAFA 4KKOA 4JI5F 4J9QA 3QMLA 3RU0A 4ENOA 3MEDB 2KHDA 3AVIA 4L8RB 2ROGA 2Y3YA 1TV6A 1DLOB 5KFQA 3OTBA 5J2QA 2FF6A 1RDBA 1R31A 1OY8A 1IXKA 2E29A 3HKWA 5L1JA 4OYIA 1R0AB 2EFNA 2NREA 3GFZA 3M7VA 3PRVA 2X3DA 3AA3A 1H38A 2NZ4A 3OHRA 1M1GA 3B6BA 2BKNA 3GZ7A 2VD3A 1IBLK 3IAYA 4FPAA 1FVSA 4S0MA 2ASPA 2HOEA 5HP1B 3MCMA 1WAJA 3TNVA 3ZC4A 4OL8A 1ZAWA 5DMRA 3N4PA 3UR3C 2YHYA 1V3SA 5EVZA 1FKOB 2D4WA 1FT8A 2V4JA 4M5NA 3C94A 2W4CA 2CWKA 1B7YB 5BR8F 1IKXA 1V9OA 1QSYA 1QQCA 4L3KA 5E7OB 1R89A 4Y2CA 4CRJA 3HSDA 3ISZA 2CQ1A 4I68A 4F2SA 2A3ZA 4WYBA 2ZH7A 3T1YJ 1GH8A 1N33J 4HHHA 2POKA 3V4MA 4CZFA 2GO9A 3C6TB 1GK8A 2E7WA 5AJ3J 1FDAA 2ZJRL 3U8XA 1JCFA 4IRKA 3I87A 4CHYA 1SZ2A 4JI0K 3T6BA 2KXFA 1Q5VA 4LJMA 2Q36A 1KVKA 5HRNA 4MK7A 2B51A 1KQFB 1Q9YA 2YBVA 1J2VA 2UUCJ 2I7NA 2YKOA 3AO1A 4DV6F 4X4OA 3NGDA 2ZD1A 4E7JA 1W7AA 1P1LA 1U1OA 2XGPA 4MK8A 2CQDA 4P2FA 4IQXA 3HPGA 3QWUA 4LR7A 1S6PA 4HUGA 2BJEA 3UD4P 3IGNA 4J37A 4CCHA 2QWMA 2B7BB 4Y65A 4IH5A 4P73A 3WNGA 3AD7C 2NZTA 1RAEB 4BC2A 1JQGA 3LP0A 2FQQB 1NGBA 2E6LA 3O5BA 5DM7Q 4CO5A 1M5HA 4FWMA 3VERA 4CJWA 2IVPA 1VFJA 3NNCA 3GFHA 4Q8FA 4ZVOB 2EXUA 3QEPA 1WSJA 3UNYA 3TUPA 1FX4A 4GKJF 2VPYB 4C0HA 4DQ8A 2IVYA 3L6QA 2FLNA 3OS2A 3G6EN 5BPNA 4ILMA 3CCUS 4RW8B 3FC9A 3M2UA 2Q66A 4V1Ak 4B8CA 3S3OA 1U2CA 3CJRA 2AA4A 4IJAA 2DGTA 2E66A 1T8EA 1NGEA 1LK5A 1NPKA 1S1UB 2YX1A 4LR8A 4RNFA 1TKXA 5E84A 4KI6A 2UXDK 2D1KA 4F3QA 3DI6B 2CQ3A 3CETA 3AB4B 3O44A 3EJMA 3I33A 2E7VA 2A10A 4F4ZA 3EEQA 1JLBB 3ZETA 4HHJA 4G6VB 2VG5B 5F8NA 3MMAA 3Q8RB 3Q2SC 2NYHA 4BRLA 2C3OA 2ZZMA 2V6AA 1T9UA 4G1QB 3PO4A 4PWUA 4DR3K 4JI8J 4B1VA 2MEWA 1NU0A 1F5AA 2Z57B 4DV3F 5AQYA 1Q5YA 4TVAB 3VENA 1DAXA 2VCPA 2DR6A 1XN9A 3K58A 2Y1IA 4B3SF 2FUG9 1HYVA 4OPJA 2B4UA 4X2BA 4O4GA 3EDRB 2ZNZA 5L39A 3QETA 2GVDA 1VK3A 1IQTA 2OPPB 3D6TB 1IH7A 4MDAA 1NOYA 4X64K 4MK9A 2HGMA 2DXEA 4OJRA 4WIIA 1SV5A 3TA1A 2E5GA 3NCIA 3RVCA 1YWXA 3MGJA 4QU7A 1M5KC 3POTA 4CO1A 1YRUA 1WEYA 4YP3A 1S12A 3NXZA 4AF1A 4DR1J 3MUVP 4USTA 1ASUA 3NVKA 3JYTB 3AO5A 2KHOA 4CF2A 3QGPA 1BI4B 3S41A 4WTYA 4YOEA 1YBAA 1IKWB 3GG1A 2RS2A 3IC1A 2E5JA 3KJVB 3LQVA 4DX7A 2J0WA 2FBVA 2XSFA 3GCXP 3ZZYA 1N32F 3B6PA 2FJBB 1R7IA 3D4JA 3L3UA 3VHQA 2VWKA 3AARA 2ZD1B 3QEWA 4LBHA 1X5PA 3GE1A 2FXUA 1S7IA 2C42A 3OYFA 2BABA 3OW2R 1WBDA 4M5IA 3ENWA 1YTAA 4LF9F 1KBRA 3WIVA 3AVHA 4IG3A 2C2RA 1JMTA 3JTPA 4I69A 3VTHA 2MB0B 1GX6A 1Z2ZA 5DETA 2ZH3A 5AZIB 4JI3K 3FEZA 4FLUA 3JAMY 3KK2A 2HRTA 3J7AN 3L9ZA 3GYXB 2PMWA 4CLWA 4DHYA 2DGSA 1D3WA 5IXUA 2I1RA 4CEEA 1FK9A 4DI6A 1EX8A 7FDRA 3TZZA 3CDWA 1YG0A 2H48B 2IRUA 4R5PB 1LCUA 3PNIA 1WUUA 3KHHA 3HHKA 4KHSA 1SC4B 3FFIA 3AD8C 1WAFA 1KLNA 1V5VA 2ITMA 2P51A 1U6BA 3KFWX 5E2QA 2IDOA 2OEKA 1JKHA 4JI0F 1NK5A 4ZJLA 4LRDA 2JDJA 4IOAL 4ELTA 5C25B 2QA2A 2VFUA 1J5OB 4QWCA 2UUCF 4DBQA 1D8ZA 5BYQA 1DTTB 1VRUB 4CLUA 4PG6A 1VK0A 3FZLA 5HQMA 5G0RB 2MHNA 2Y8YA 3O2IA 2ZJPL 3ZETB 4LSLB 2BUPA 1URNA 2G13A 3VA3A 1RFQA 1WC5A 4FF1A 4LF4J 1S57A 4YY3K 1HNZF 2B4PA 3FRZA 1TP7A 4FF3A 2MSTA 3EPGA 2OCEA 5A6PA 1FE0A 4NXMF 2I6WA 3TAGA 3PIOL 3ENOA 3J7YP 1AFJA 4NE9C 2CDQA 3G4SS 4NZ6A 4WK3A 1B0TA 4CEAA 2BE9B 1S1TB 3GSIA 3S01A 3JSRA 2P9PA 2QMXA 3L2RA 3DRSA 1QD1A 3OYHA 2E44A 1WLJA 3VZIA 3SJJA 3W3SA 3DXMB 2IJFA 5K8MA 3H5XA 2MZ1A 5BRFA 1Y64A 4K2JA 1S6OA 2QIFA 2VONA 3RBXA 3IBFB 3H90A 3CJSA 2VYPA 1DRZA 1KVBA 2EFPA 4O0JA 3ILLA 2FVRA 3M4XA 4I2PB 4KHYA 2WVFA 1HYZA 3IRXA 4NXNK 3DGVA 3RSEB 3K59A 1EQ0A 1WSRA 4AL7A 2GGPA 2FC0A 1T9TA 2LA6A 4XIUA 5IM0B 3J7AP 5FLXO 3GJSB 3CMAS 1X9SA 2P9LA 1Q86T 2VZ9A 2J7UA 5GIOA 5DG7A 2ACYA 3C95A 1YZ7A 1HBUA 4LF6F 5FPMA 3ZZTA 1J5EJ 2O8CA 2C2NA 2GS8A 1IUJA 2ZDPA 1XUPO 2MQNA 4CEFA 4A8XA 5AQGA 1JLEB 2BKOA 3D0IE 1VHIA 3CD6N 5B0FA 1K1SA 1C1CB 4LFBK 5M2UA 3EICA 1PYSB 5J2PA 2P8IA 3I0RA 3WXIA 2Z56B 2XHCA 2EHGA 2HBKA 5KFRA 1UWBA 1F6TA 1WSGA 1NCLA 3T5JA 1QZ6A 4CF1A 3FFIB 1MWYA 3NP5A 4YN3B 3SPYA 4HH0A 1WSIA 4LIRA 5AQNA 4M5MA 3CFOA 4ED3A 5D78A 4NCAA 2RF2B 1WWHA 5D0EA 3Q8PB 1UPMB 2Q1NA 1AB8A 5D4NA 5IWAK 2NXNA 4ED2A 4B9MA 3A3PB 2K1RB 4OZ2A 2LQ5A 4QS9A 2GQQA 5L9XA 4O4GB 2V69A 5HVHA 4FKYA 4CF8A 2FLOA 3MXMA 5JVHQ 1W97L 3FQKA 4H0XB 1QAJA 2HWHA 4BG8A 2NRVA 4ILGB 3M1VB 4IG3B 1TAUA 3KLIB 2QL9B 4HDGA 1WJ9A 2D3O1 1RZMA 4FK4A 2NLXA 3BEGB 5LXYA 4M63A 1JCEA 5AQKA 3TZYA 2RS8A 3T7ZA 2BJ8A 3K9JA 3HFVA 1WC4A 1RAOA 2CVIA 4GKKF 3S3MA 2N3OA 1YIJS 3KJVA 5KFTA 4W5RA 4LUBA 3TU5A 4ER8A 4K8XA 3EO3A 2XYPB 1Y3JA 3CFRA 3W5ZA 4J9MA 1JJ4A 4CHZA 4DCHA 4GRSA 4FJ5A 4NA2A 2CZVC 3MM6B 4FJIA 3EMTA 3DFEA 3IN5A 4WE1B 3GFYA 2XS5A 3NF6A 4P7VA 1MDUB 2EK1A 2BANB 1FD8A 1TK5A 4DPWA 3SAGA 4XEIA 2ZGYA 1ZPWX 3P96A 5DQHA 2W6LA 3QYYA 1WOOA 4I6YA 5ETVA 4OI4A 2PMHA 1BA1A 4F25A 4FYYB 4CJQA 2YKNB 4JI1K 3EL2A 3MWBA 3T5LA 4ZS6A 5KFAA 3H25A 2MQMA 1CEZA 1BL3A 1CJVA 3OBWA 4ZLPA 2OKQA 3D2EB 3Q86A 4FVCA 4O44A 4O3PA 2P9KA 1T02A 1CJKB 1X0FA 1RLCL 5KFFA 1B4SA 1VQYA 4FF4A 3MN6A 4Y2KA 2DGWA 3T5KA 2AW0A 1QUVA 2D9PA 3EDQB 4D3HA 4IQMA 3SIPB 4YR3A 3IRWP 1X4HA 2BRLA 2QLFB 1HNWK 4W5QA 1FFWB 3QZ8A 1RGIA 5BYSA 4IXCA 3SI8A 1JXBA 2V2ZA 2XZDB 3TI0A 3QO9B 1JL2A 4DV4F 3IGVA 1IM4A 2DGVA 4I9LA 1K44A 1RT4A 1NNDA 2G0CA 4O55A 4WFAL 2VG6B 4RL1A 4CHPA 4GO5X 4ZMMA 4GVBA 3HT0A 4LF8K 2PE8A 3HOSA 3LDSA 2XYGB 1HNXJ 4JI7F 2HHUA 2AGQA 3KVGA 4J9RA 5KOXA 3KHRA 3TAEA 1BUXA 5KFHA 3P6YC 4PG8A 2E5HA 4A4JA 2Q43A 2YWKA 3LP2B 2ZH6A 3HD2A 5EX0A 2HBZB 1HA1A 4UOCA 3M32A 1OQ6A 4YEAA 1I3OB 3ZT4A 4I2QA 1R8PA 4Y2AA 4DS4A 5D0RA 2E1CA 3HVAA 3MECA 2HQDA 2JLEA 4FWKA 3OS1A 2QTWA 1WHYA 4FNIA 2KB2A 5AE3A 4ZP7A 3KLEB 1IKXB 4XAKA 4L76A 2CJKA 4HVZA 4BRAA 2VH7A 3BQ2A 5HO4A 3M1FA 4LRAA 2IGIA 1PKUA 3M2RB 4CM2A 4JKHA 2AYGA 4ECTA 4YFUA 4F4KA 3QICA 2HK2A 3LWMA 4YMEA 3VQSA 4LQ9A 1X7VA 4RW9A 2ZHBA 3LZJA 2BGGA 1N6QA 3EE3A 5DRKA 3AVGA 4JI1F 2AV5A 2BBEA 2DRDA 4MDBA 3G0ZA 2MXYA 1IBKK 1RHQB 1FDBA 1IBKJ 1RCHA 3H6EA 3GG4A 2NUUG 5AQVA 4U6PA 1ACMB 1T44A 2EG2A 5KFIA 4AYBD 3FR0A 1Q9XA 1WSEA 3LM2A 3V4IB 1YGYA 1NZAA 4U7CA 4IEEA 3HT3A 3MM6A 4EBEA 2DNYA 4IDHA 3K8WA 4ZPCA 3MEDA 4YR0A 5A2QU 4DX5A 4CT8A 1R8BA 1H74A 3CDEA 4F3OA 3ILOA 2LXFA 1VQPN 3L2QA 4DUZK 2MQOA 1E6YA 3QINA 4MIWA 3UD3P 2ZKUA 2GELA 4NEZA 1FRMA 3BR8A 1CJVB 4RNHA 2MMYA 1YIJN 4USHA 4IH6A 5CYMA 3BN4A 4BRPA 2E6MA 1WHWA 5DZ6A 5DGAA 4JI2F 4LFCJ 4R79A 3OYEA 4U7UK 5HL7L 5J1NA 2IM0A 4K4YA 3VAJA 5A2QO 5KRSA 2IVFB 5AFUA 1BQXA 1WOQA 3SYZA 4BC4A 2C2KB 2ASOA 3DLEA 2I0XA 4P2SA 3WDOA 4USKA 3KLFB 4WP8A 4A8YA 3A8JA 3ISNC 3J7YU 1JLFB 3JSMA 4QS8A 2RE2A 2UVUA 2E5IA 1NPRA 3H45C 4A8QA 4QU6A 4DV7J 3QATA 2U2FA 4W4MA 2QKKA 2FGOA 2UP1A 4FJ7A 3R1LA 4CZHA 4JV2A 2A40A 5GMKa 2KU7A 3NE6A 4LF2A 3W5YA 2RRAA 3NNAA 3PDNA 4GC7A 3M8ZA 4OFZA 4C3MA 3A4TA 2R2SA 1HKGA 1IJEB 3W7BA 1ZH5A 2QW9A 4RUBA 3SAFA 4C98A 4M1KA 1HYSA 1X5TA 1CULA 2KT3A 3LANA 2QMWA 3TTDA 2VG5A 3KG4A 2DEJA 4KHNA 2G0IA 4WIQA 2ZWHA 3OFGA 4O3QA 4AD6A 4W92B 3P3DA 1KQSM 1IV0A 3EVMA 3ILJA 4QZVB 5AQQA 1YJNS 2XTJP 3M30B 1Z2LA 4EGLA 2VODA 4DMNA 3VAFA 4MFBA 3OHAA 3RAQA 3BP8A 3CCQN 3LP2A 3CJ2A 4CJVA 2ITGA 2YHXA 2EK6A 2RQ4A 4IOXA 4ZVEA 2OFGX 1S77D 5KPTA 3MN5A 3VQ9A 1PAUB 1TL1A 1S0OA 1IJFB 3H5UA 2YCHA 1C1BA 2P9KB 1ZTTA 4Y28C 3MMAB 1XR7A 4IUFA 1U0HA 2C22A 4JK7A 5ELZA 3LGNA 4YS2A 3U1LA 4H0PA 1U26A 4RW9B 4F26A 2MKYA 1BO5O 4PG7A 1EXQA 2CWXA 2L48A 5IOLA 2GUIA 1S1UA 3D45A 1SKUB 4OX9F 5MLCV 4DTXA 2KYXA 3AT1B 1I94F 3GQCA 2VPWB 3G71S 4EBCA 4CGHA 4JYAK 3RBDA 3HHLB 4KREA 2WSFC 4ZTJA 3I31A 3IP0A 2Z8QA 4DR4J 5BPLA 2XY5A 4GVEA 4DV0J 5KFUA 1HWUA 4WKRA 1Z05A 3J81O 1NM1A 3NCPA 5KT7A 2HHTA 3D54A 4KAZA 5F0WA 1BUPA 3K17A 3MAHA 4Z2XA 4E98A 4MH8A 5HK4A 3U3GA 4OI3A 1TL5A 2BJ3A 2BA9A 3HLUA 2DGQA 3UN3A 1ZAVA 4OO1J 4JV1A 3RRKA 3BYRA 3ULEB 1FKPB 1X1PA 1WN7A 3OA9A 3R6LB 3AY0A 3P4UB 3OYCA 2AHOB 5B08A 2YPYA 4DB3A 5K8PA 4B3RF 1IBMF 3CJ5A 1RDRA 4KB1A 4PL8A 3TVZA 2H54B 4JV0A 3JXOA 3ZX0A 1A5XA 1O8BA 4XH5A 4KFBA 3WQTA 5C7PA 1QHTA 5D4PA 3W9IA 2DFEA 3DCAA 4K42A 1CC8A 4N5SA 5I3QA 1U2VA 1HR0J 2AJ2A 2CYYA 3MR2A 3OTOJ 4ECUA 4HR2A 1NKEA 1N34K 3IRXB 2IS3A 2GW8A 1OYDA 4H0OA 1T9WA 2FJAB 2HGNA 1CULB 3DOLB 2ZH9A 3TAMB 1F9FA 5BXIA 4JK8A 3VGKA 5HQ8A 2BZ2A 4DPXA 4FK2A 1RT3B 4FN5A 2GAGC 1RSCA 4WQ5A 1HR0K 1RA6A 3BZQA 4HDHA 5F8GA 3VVTA 2OIHA 3AH6A 4DV2F 1EAYC 3VGVA 2ZHAA 4HCBA 3M2VA 5KGWA 2DHAA 1S4FA 1JKHB 2M0GB 3QBCA 3DLGB 3CJ9A 5CA5A 3RBZA 3QEVA 1S1TA 3TJAA 2R2RA 2QKBA 3KJQB 5LMNF 3PIOQ 3LO3A 3AGRA 5GAEP 2V67A 3LDLA 5HMWA 5CYQB 1PCAA 4GKKJ 3GP9A 2X7IA 1T6DA 1KQSR 4LF7F 5EWFA 2LFVA 2RF2A 2GQ2A 2MGZA 1HNZK 3J81j 2P9IB 4L74A 2AZ1A 3E51A 3D68A 3EE9A 1N32J 1Y9OA 4CK1A 1XQIA 3GR0A 1HD0A 3KXDA 4TNOA 3HHLA 1R8HA 5LJ5Y 1LQ9A 2GGPB 2YQ3A 1LNQA 2HAIA 3UDCA 1RABB 1XNQF 1VRUA 3N6LA 4CH0S 4B1ZA 3TQEA 4K4XA 2A0FB 3AA2A 3R3TA 3UB5A 2KL8A 4FNHA 4CZKA 3FVYA 2W8LA 5KFJA 2CPJA 2KVQE 4DU3A 2JZ5A 1SIZA 3LAMA 1VQOS 2GC8A 3NMAA 2IRXA 3H7HB 3NMUA 4ZPAA 2XNRA 4KI4A 1UL3A 2W2QP 3NG8A 4DFJA 1PBAA 3MMBB 3M6GA 3UDVA 5M1FA 2Z58B 1T03A 3MHYA 3LA0A 3T1HF 4N8OA 2MLXA 5G4DA 2R7SA 4E7HA 3UO0A 4IKAA 1RILA 3SFUA 2ZM6J 3W60A 1FKPA 3I0RB 2RN2A 4RLEA 2ZNYA 4X62J 3FBCA 1WOPA 1ROFA 5IS2A 3RSEA 4KB7A 3ZXWA 4FOIA 1C4AA 6FD1A 4F4WA 2CPEA 1KLMA 2M5YA 2H4WB 5LXRA 4RJVA 4B3OA 3M30A 4DMZA 3J81Y 1VQLN 5AXKA 2VBZA 5D3GA 2NRWA 2LEAA 3C0BA 1QHAA 1U04A 1GX5A 1D9FA 4P6QA 1TMJA 3KOAA 2BJDA 3T69A 5ADXA 1FJ7A 2O8EA 2PMZD 5F9NA 3HI9A 2E8AA 4JV5J 1N5YA 2EC2A 1N8RT 3ZT1A 2AIRB 4QYZK 2AQ4A 2HPUA 4CEQA 2ATCB 3PIPQ 1D9AA 3NGSA 4CD3A 3IDHA 2NS1B 4DUZJ 5LMUJ 2DNOA 2G9OA 3PEJA 3KYLA 5KFEA 5HP1A 3NGUA 1AROP 3C6AA 4C8OA 1HQEA 2VB6A 4HWIA 2OPSA 2XM3A 2ZOMA 3KHYA 5CAAA 4H0VB 4KGKA 2R7TA 1WSVA 3CSKA 1XNQK 5GADU 1B64A 2MKIA 3SDEA 1YSJA 2GMHA 2OI2A 4FJLA 2LU2A 3MAAB 1QSLA 1TUYA 4GMJB 4RO0A 5T41A 3D2EA 3CJTA 3K2YA 1YVFA 2RUGA 1S9EA 3KK7A 2KM8C 3CO9A 4JI4F 2QXFA 4FOEA 3QESA 4X4RA 2HSEB 2ABYA 4C8KA 3D9BA 4Y3CA 4DUZF 4FDFA 3L2VA 4NRUA 5CZ1A 3DXBA 1YUWA 4RG8A 1Q8LA 2GJFA 4FPIA 1CBKA 4H5WA 3KLEA 2UUAJ 4LSZB 2R2TA 3CJQA 2WW4A 3WXKA 3QT5A 1PAEX 2JGUA 2A6MA 1KVIA 5A8WA 3AY9A 3M9OB 4OYAA 2X1FA 3BYPA 5T7LB 1F2GA 2QL7B 3R5JB 4UOGA 4JOUA 4BY9C 3GDQA 1ZS6A 4IEIA 1KVAA 3LAKA 5A8RA 4NXNJ 3HCXA 2OPQB 4CJKA 4A8SA 4WFYA 1EQYA 3A3OB 5KG5A 2YKNA 5ADXH 1ULRA 2PY5A 2QWLA 1RTIA 3CCMS 3BZCA 2GVZB 3NWGA 3ZZ0A 4DSEA 3T1AA 2DH9A 1HNWJ 3I96A 4E7IA 4RW7B 4NWBA 3R6MA 3ZT0A 3CD5A 3QRPA 2Q3SA 2H4YB 2O8BB 4CIEA 3J7Z5 2KM8B 4KAIA 5EN1A 1M5VC 2EEYA 3GLJA 3K9KA 2AYEA 4YOXA 4DTRA 2GIFA 2PAVA 3CC4N 1JB0C 4GKJK 1H7XA 3N28A 3TEHB 4AQYK 1KTQA 4FM0A 4DV3J 1XJWB 2BM1A 2RVJA 1K8KB 1NMEB 3RAMA 4JV5F 3TPQA 4CGDA 3VQ8A 4KTQA 2D5RA 3KLGA 3TUIC 4FLXA 2A18A 1REVB 4F3TA 4USMA 2VQFK 2IJRA 3S3NA 2YJEA 2QYCA 1FK9B 1GTEA 1HHSA 2NYIA 3QRQA 4GC6A 1SC6A 1QVFM 2P9UA 4FJKA 5H1SV 1SKSA 1YF5L 4QPXA 2XY7A 4I2QB 2EKNA 2HHXA 2NZCA 3JYTA 2FBTA 3GWCA 1S1VB 1G4CA 4NLBA 4HEA9 3P49B 4DTNA 5E33A 1P27B 1WI8A 2CPZA 2E2OA 2NPFA 5HVFA 2MKJA 1JK9B 3HULA 3DXKA 3OW2M 4DN0A 3HI0A 3CCES 4EAHD 1QAXA 1BLUA 5KQDA 2QLXA 1QQOA 4LMZA 4A5BA 1V6HA 1S1WB 4ZLJA 2DHXA 5C42B 5KAKA 2DNZA 1U1KA 1IBMJ 1TL3A 1OH8A 4NLQA 5J2MB 2V8HA 3WT0A 1RAGB 4OI0A 4DTOA 5GAEU 4NLUA 1WG5A 4F7VA 1S99A 3KK3B 3RWUA 3M32B 4UY85 2F65A 5KT3A 1LXNA 4ID5A 3VGSA 1Y10A 2YNFB 2BOAA 1PC5A 1KTVA 4I2PA 1KC8T 4YOVA 3WC0A 1GOBA 4K4UA 5DO2A 2P9PB 4EFHA 2QFJA 2RU9A 4Q2MA 1BY9A 2OD6A 2ZZNA 1T6CA 3NRBA 4C2MA 3GBTA 3DDKA 4HH1A 4QBUA 1FRHA 2QI2A 3SPZA 3NS7B 2CVEA 4WFBQ 1RBVA 1FA0A 4RNMA 2A2DA 3SQ4A 2VKZG 4JS5A 2XMKA 3C16A 1RBUA 1RHRB 1N34J 2LMIA 1OY6A 2F9TA 2L08A 1ZM2A 1NK7A 1BIUA 4BR9A 4DV5F 4ERDA 2MHEA 3MXHP 5IT9O 5CHCB 1FJGJ 1YHQS 2EWHA 1IR0A 2WW8A 3HFZB 4UUXA 1S6QB 1NDPA 1F3FA 3AA9A 2CPXA 1M5SA 4CLLA 1WKKA 3NF7A 3TTCA 3OSNA 1HBOA 2IM1A 5EX3A 4CK3A 3CCJN 2FVQA 1FRXA 1DLOA 1CXQA 2HMPA 3HX9A 3SUQA 3IFRA 2XB2D 3EWGA 3MD1A 3UE2A 1FJGK 4BRCA 4YB6A 3D66A 1JXEA 1XK8A 3RTVA 3UCUP 4J2BA 3U9ZA 1GXTA 1WEXA 2VDIA 3AOCA 1EETB 2DY4A 4FLWA 4CGFA 4IYQA 4M42A 2ZVSA 4H5TA 3MI7X 4LSLA 1N36K 1GLFO 1BHNA 3VPZA 2ZQBA 4GMKA 2W2MP 1EKEA 5CZXA 4FXWA 3CC4S 1Y97A 2R8IA 3G8QA 4M3XA 2X6SA 1PJ5A 1HNIB 1I39A 4B3MJ 2QLJB 4JKGB 5AQIA 4EHTA 3R2DJ 2HVZA 3CQYA 5B0CA 3CB4A 3J7A1 1MWZA 2YKMA 5C42A 3Q8VA 1OY9A 1RT6B 1S72N 5DS7A 3KKSA 3CIZA 2IM3A 2ACMA 3KKFA 3NGKA 3H4BA 3BSNA 3E66A 2GNKA 3L3CA 1S1WA 3MR3A 4CJEA 5HMYA 4OGEA 2HURA 4CZMA 1VLOA 2OELA 4LF8F 2BANA 5AT1B 5H9EJ 3M6UA 4CLFA 2GCFA 1SQKA 3QBXA 1U45A 1YJRA 2GX8A 3NVMA 1VGYA 3QSIA 3UN5A 3JAMU 2C2EA 2UUBJ 4DPOA 2KXHA 1HWJA 3JTNA 3QFHA 2BV3A 3C8YA 5DG8A 1SJRA 3G6XA 4ELVA 2MLYA 1SL0A 3PKYA 2HHVA 1FEHA 3C14B 2R42A 4EI2A 1IWGA 4FJHA 4ZKAA 4A5AA 2AP1A 1KFSA 3VGMA 2SXLA 3O9TA 4CIOA 4ZP8A 1U0HB 4OPHA 3D0PA 1YITN 1RYRA 3V5RA 4K8ZA 5H9FK 2LEPA 5KOWA 1W0HA 1NJYA 3PFOA 2LXUA 2J6SA 3DYAB 4X84A 1VOMA 2DBBA 2XZWA 3I0SB 1BC6A 1B9DA 5KG1A 4XTTA 2DPJA 1JWWA 3GJTB 4RBUA 2IVMA 1TKXB 4KPCA 3BKUA 4LRFA 4GW6A 1VSJA 1Q8BA 3FK4A 1OWXA 3OR1A 3CERA 3Q2TC 3H3NO 3RW6A 2QJ3A 1VQKS 1UJ6A 4JS4A 1URRA 4DL4A 1S76D 4IJNA 3O80A 1KEKA 5MAOA 3SQ2A 2G8WA 4I7FA 3HMJG 4FXDA 2ZBRA 3BKFA 5GVQA 5K20B 4KC5A 1T9XA 3U3YA 1EB0A 5JUMA 3QO9A 1RWOB 3OR2A 1MLAA 1VR6A 3C46A 3BB5A 3A8EA 3GYNA 1CG2A 2ZF5O 3HO1A 1UW9A 3KLVA 3CDUA 1UVNA 3CJ1A 1TKTA 4KHWA 5IT0A 1NB7A 2CNOB 1LK7A 3L2WA 3MEEA 3KK1A 3R3LA 4P74A 3CD6S 4F0HA 3N5FA 1QDUB 4NI2A 2OTLS 4UY8T 3E9LA 4O3RA 2E1AA 4B3TF 3F9MA 2DPNA 1VS3A 3HFKA 2G4BA 1SB6A 4CLSA 2XLJA 1BA0A 2W7OA 4Z4HA 1WEZA 1XNRJ 2M8DB 3PLAA 5BR8K 3HZEA 4NYPA 2EFOA 2W2NP 1HNVA 2FSKA 4C7QA 4FW1A 2ETJA 4EK2A 4UF4A 3FNNA 1PJ6A 2CXEA 2QLWA 2G0JA 4GVBB 4PYAA 4F50A 1OQ3A 1NJWA 3W9HA 1HW8A 1UA0A 3D0GE 5AQTA 2GMLA 4MLHA 3W9JA 5HATA 3ENBA 3HSZA 2E4LA 4HHTA 3M8WA 4KBOA 3BO4A 1O51A 1GMUA 1E6VB 3PEHA 3WQPA 1K0TA 3OBYA 2D3UA 3SNNA 2KDOA 1CXUA 3C14A 1KNZA 5DM7L 1HQUA 1WELA 4DL5A 3QB0A 3A5LC 1W2BR 3IWXA 2PI5A 4NOHA 1RWUA 3LUYA 1S72S 1PILA 4DUYK 4J9OA 3LZIA 4I0WA 1MW7A 2A2CA 1Q8KA 2XZTB 3MOZA 5I42B 5BYRA 4CNYA 2HRUA 5I3PA 3NGRA 1UZHA 2FIUA 1GOAA 4HTJA 4HL9A 4CZLA 1N4LA 3CCUN 1JLFA 3JSMB 4EP5A 3DDIA 2MKSA 2QA4S 2BTFA 2D1CA 1FRJA 4Q43A 2CNNB 5GMDA 2HHWA 3OLBA 3TWHA 1ASVA 3QAEA 2FJVA 1ZAXA 4DOZA 4ISGA 4NLCA 3BGFA 2WSEC 1XMOK 2ZJQQ 4P7TA 2FSNA 1HQ2A 3VESA 5EUHA 5HROA 1R6YA 1VDHA 4R5PA 3QLHB 1KONA 4RWXA 5EX5A 5H1SQ 1V4TA 5AXMA 3NCQA 4M5LA 4E89A 4DR7F 4TY9A 2B4VA 4DCJB 3R7NB 3UCGA 2OPPA 1Q81T 1WDTA 4LF6J 1MWQA 2HFOA 2Z4PA 3GIMA 5DM6L 1WACA 4J9NA 1CZBA 3C19A 2N7YA 3MPWA 3C65A 1WB9A 2G1HA 1VSDA 1UOCA 2VQEJ 5L9NA 3EYZA 1NGCA 2NRHA 4ZPTR 3IMQJ 4EFAC 4AHUA 3D3CJ 3BR9A 1NRKA 3FSIA 4LFAJ 4U67Q 3MM9A 3EXCX 1UCNA 2FHJA 4IOAQ 5EWEA 3RB3A 2IBKA 3AODA 5IZHA 4N41A 3CUNA 4FWPA 4NZ0A 1KQGB 4ELUA 3H42A 1M90T 3MD3A 3ZSRA 4DSIA 3MDFA 3BDPA 1B99A 4JKBA 2I5JA 1NZ8A 1XR5A 3P4IA 3G25A 3LPUA 1T95A 1N32K 1U1PA 3AVJA 4B3RJ 1CLQA 2LCWA 4BACA 2BMBA 4GVMA 4BRQA 4OYOA 3SDEB 4ILHA 4A61A 1GAOA 3QSYB 4FPRA 3Q83A 2N4DA 1XNQJ 2R8KA 4TLQA 4OGCA 2KYZA 4UOFA 4K0KF 4AQYF 4KE5A 3HSJA 3VVUA 2KZMA 4CESA 3OY9A 5FRMA 2KZZA 2BW2A 1S9GA 3HSTB 4DDFA 5ETOA 2IHR1 4KYZA 3ET6A 3T5HA 2MKCA 4KHMA 4ZA1A 2QEXN 1Z6RA 1A6LA 4KKOB 1A5WA 4JI2K 4HLBA 3QNNA 4B02A 1IM6A 2R7QA 2OP5A 2C2MB 2XMJA 1HNZJ 5F9LA 3X3UA 2D9OA 1R59O 1RE1B 4B3SK 1N5VA 1BXNA 5KG7A 3NBPA 3WEEA 4OZNA 2FJXA 1HHQA 2O5DA 5KFOA 1VQ4S 1GMWA 3VN5A 2L9NA 1MWMA 1QM9A 4YDUC 4C8LA 3CGIA 4A2AA 3CI5A 4OI1A 3AQPA 5KFDA 4JUZA 4HUEA 2KN4A 3QNOA 1SI9A 3UKRB 5H9FJ 2Y0BB 4DU8A 4JHDB 4Q44A 1KKHA 4F4YA 4A46A 1Q4RA 2Y1LB 4CO2A 3PHEA 1RDCA 3THTA 5JVHL 2FHMA 2QA4N 3UKUB 4DCOB 4DV3K 2ZOFA 3PZPA 3EGZA 3H3OB 2UVRA 3C3LA 3OD2A 2B0GA 3W63A 3ZTRA 1W26A 3EKSA 4DXLA 1A0OB 2C1EB 2VFTA 3Q8SB 1Y0HA 2ADBA 1E3MA 2OA8A 2JRSA 3TJ9A 5IQQA 1PO6A 1FKOA 3QPIA 3RR8A 4JKEA 1TVRB 4ECYA 2X1BA 2DRBA 5ETPA 4KV8B 1Y7PA 3SV3A 2AGOA 4ZHRA 2IVNA 5JS2A 2ATLA 3NNHA 1C1CA 3CFPA 3R5BA 2JEFA 3M6XA 3MCPA 1ZETA 2GWKA 3TZWA 3TAQA 2BUNA 1UMJA 4CJTA 3MM9B 3NAEA 4QYZJ 1OIAA 1UEVA 2HFZA 2E2QA 4KRWA 5IWAJ 2D0BA 3ILIA 3HPHA 1I1GA 2V4QA 1RTJA 2XLKA 4TKTA 1Y4ZB 4LIWA 4K43A 3CXCM 3LTOA 3P5JA 3B4DA 1LWEA 3VQQA 3O3FA 4M5HA 1JLQB 1M1HA 1FERA 4WQ5C 5BN8A 4YOYA 3CO0P 2OSRA 3HHNB 3OYKA 4XO0A 4Q7AA 4R8UA 4L3NA 2E5LK 4NLPA 4FJJA 2AZ3A 3MUMP 1U0SA 1MROB 1N88A 3OYNA 1KC8O 1YZ6A 1N36F 4RTFD 1AA1B 4H8KA 1P1TA 2ZUGA 1FNOA 1IR2A 2UUBF 3JS9A 3ENQA 2QGFB 3SCJE 1MMDA 3CCVN 4ZITA 2B8PA 4MT1A 5F0UA 2F1FA 5AQOA 2RQKA 1U1LA 1R43A 2BE2B 1X4GA 2XI2A 1JNRB 1R3NA 4CBXA 1EJ7L 4LFAF 4CJRA 3U9DA 1RHUB 1AZSB 3VQPA 2CQIA 1H6KX 1RDWX 4WFZA 3HBTA 3CPWM 2DJWA 2HS0A 2WZ1A 2ZJQL 1QLNA 2PZSA 3W5XA 4Z4CA 3KLHB 4RCHA 3VQTA 4YQWA 3HHLC 1IBCB 3CJCA 3JQJA 2VG6A 4TYAA 1S6QA 2PFUA 3LALA 2X6NA 5T7BA 4PKGA 2R7YA 4J9UE 5M2RA 4W5TA 1NH7A 2F4VK 3J8AA 2ERRA 2I8EA 2CPFA 2OD4A 5B8HA 1AT1B 4BRFA 2V8DA 2HNYB 3HSCA 3R9LA 3DM2B 4A59A 4ECWA 3L4QA 4J9SA 1VRTB 4I4BA 1H2VZ 2J9EA 2J9DA 4Z4EA 3SUOA 3QGHA 4PG5A 4NL5A 4JKGA 3QRRA 5KG4A 4Z0UA 3HHLD 2GJ2A 1F9EB 2CG4A 1YRXA 2MQ8A 4OYZA 2PGCA 2J7WA 4KHRA 3E8OA 4DV5J 4WFBL 3ITHA 1OYEA 4CFDA 5J1EA 1S0MA 1NGDA 2P9IA 5HBMB 2CGLA 3QJPA 1V3RA 4ZHRB 1U24A 3U27A 2DNLA 2RHKA 1I94K 3AO2A 1BD6A 2UUCK 4M3YA 3OVAA 2OMOA 4ANDA 2VOPA 1YRTA 2AWZA 5DQIA 4C6AA 4E19A 3MAAA 2E5LJ 1SS6A 4OZ0A 2Q6BA 3H2UB 4CZCA 1SJFA 2JSXA 3RB6A 2IBOA 3U6FA 1LXJA 2N4CA 2W2PP 4DUYF 4C1NK 1HWLA 1I3AA 2YHBA 2NRRA 1FD2A 2FLLA 2AT1B 2CQPA 3PACA 1LW2A 2AEMA 4QQBA 4F8RA 3F73A 4BS2A 5M2PA 4LFBF 5A76A 1K73T 3U4LA 1ZC6A 5KFXA 3WXMB 2CH5A 1KAYA 3VETA 3UN2A 1ZTWA 2YH0A 1U2FA 3G6YA 1VQ5S 3MEEB 3PX6A 2I7PA 1GLEG 4WFNQ 5DK5A 1XEZA 2UU9F 4KTWA 4LRBA 5HSPA 4NLTA 1TUGB 2UU9K 2Q31A 3B6OA 4O3SA 3FEYB 4OZJA 4Y0FA 1P9QC 3POTB 4FWNA 5HRRA 1RTJB 1PYOB 2UXCJ 1ZBTA 2DGUA 4CLZA 2DHGA 5C24B 4FYDA 1CLFA 4RW4A 4C1NI 2RDJA 2VWBA 1IN0A 2VJVA 4JI1J 6FDRA 1BQNA 3CCTA 2GFFA 5ETQA 2W24A 4FP9A 4O3NA 4R8UB 2V34A 2XQCA 2DH7A 2GTDA 2W41A 1ZPVA 4RNOA 2FBYA 3GJQB 1UVJA 4IFYA 4YHHF 3PTWA 4DLEA 3QIOA 1HBNA 3I5AA 1JJHA 3QGIA 3RBEA 4DR2K 1X4BA 5EU7A 5DDPC 4IRDA 4BRHA 2HAFA 1XC9A 4MYTA 4U7UD 4GKKK 2D74B 2YKPA 3H5YA 3D6HB 4EO8A 2R7VA 4AE5A 1XHZA 1T9YA 4J91A 3AA5X 2IC3B 5B0GA 4P2XA 3VCDA 2VFVA 1H72C 4JKCA 2ZKTA 1Q7YT 1NKCA 4WYWA 2C3MA 1N36J 3D6RA 1Q53A 4DHVA 4IDKA 1SH3A 5L1LA 4ED7A 1FXDA 1ZXOA 5EHHA 4ILRA 4QCLA 3MTKA 3VEOA 4USVA 1Y5LB 4JI2J 4Z7YA 2LDIA 4ZOSA 4PL7A 1HLUA 3CHWA 4ZLLA 2HBJA 1U4BA 4B3MF 1FWKA 4Y2IA 1G6BA 4M8LA 3L95X 2Q3PA 1VJWA 3HL8A 1MU2A 3ZTSA 4O8UA 4HTUA 3OR1B 3CF5Q 2AKWB 4JBCA 2F8MA 1NLVA 3Q8YA 2ALZA 4JKDA 4AT1B 2B9YA 4ZVPB 2WBNA 1TUWA 4LVOP 4AL6A 3HJVA 3BBCA 4ZN1A 2MZQA 2D7SA 2HHQA 2GA7A 2CZ4A 1U02A 4RKUC 4CLYA 5BPMA 5JVGQ 1SH2A 2RDIA 3T1HK 2E1PA 1P90A 3FJ2A 5JICA 4ZVFA 2ZGZA 4OYBA 1N33F 3MMVA 2VPXB 3TTFA 1TZ0A 1HNWF 3R7BB 2QX0A 2PFFB 3NF9A 3CMEN 4OLPA 4IFYB 2DB1A 3O9UA 1VQNN 2RSQA 3SSQA 3TOQA 5KGXA 3TARA 2PIIA 2UUAK 3QQCD 1SXLA 1UVIA 3DU5A 2PD1A 1G15A 4TU8A 1OS5A 3MM7B 1M1KO 3I82A 3CXCR 3R9PA 5ETRA 5HQLA 2D0CA 3TEGA 2ZJRQ 4DPYA 4AQYJ 2MQQA 2HZAA 4O0IA 3AHPA 2B9WA 4Q8EA 4JRPA 4PKIA 1KRPA 2NXJA 3FCVA 1REVA 3LDNA 3NEKA 4PUOA 3QLHA 4RUHA 3WNFA 3BPDA 2MKKA 4MO4A 2IAJA 3QFWA 1NK9A 3MM8B 3TW0A 3SZ2A 2AYMA 2XMUA 5DDOC 4DFMA 3RRHA 3E2EA 4DL6A 4KSEB 2VGNA 3GB0A 1HUXA 2UV8A 2I5JB 1NK6A 4DUYJ 3VQ6A 2BOPA 2FVPA 2VIHA 2XLIA 2BKPA 1RJJA 3KD1E 1O0PA 4ZLNA 1SC1B 4ZPDA 3K5NA 2VWJA 1XBWA 3UW1A 3CMQA 1L3UA 4Y0WA 4PXDA 2WUSA 3L7UA 3DOKB 3EUNA 4LSNA 4NLXA 3FMBA 3ZLJA 4CGJA 5C2FA 2OO4A 2PC6A 2EPIA 1R0CB 4DU4A 1YT3A 3KHLA 2ZJPQ 1ZM4A 2EVZA 2D0AA 4P10A 2ZHOA 5AQHA 3CG7A 1S1XB 1X0PA 4BR0A 2PEBA 1UWBB 2AYBA 3T9NA 3TX0A 1KVCA 4ZVRB 3DNCA 4FLVA 1LOUA 1Q7LB 2XMTA 3EGWB 1T3OA 4F4XA 4BQZA 3MX2A 3EN9A 3MWPA 4Q5VA 2WFBA 5L38A 4HUFA 2GIQA 4JI3F 1S3XA 1WC6A 2XHBA 2DT9A 2HZCA 3US5A 1YJVA 1HBMB 2NRXA 2COLA 4FS2A 1FESA 4CHOA 2UUTA 3WXJA 1FNXH 4PCQA 2XI3A 2G2OA 4G3IA 1BOTO 3V6KA 4DEZA 3R6GB 2W8KA 3G9CA 2QWPA 3O9RA 4HCCA 2W9BB 2A1RA 2HFSA 4DV5K 4KJIA 4EYHB 1WF1A 3O1WA 2Y0SD 4TY8B 4USUA 2IIHA 4FLZA 3MCAB 4IO9Q 3WXLA 1Q79A 3OQ2A 1X4EA 4RBVA 4ZCIA 2AJQA 3G6VA 1NSKL