4KFBA

Hiv-1 reverse transcriptase with bound fragment at nnrti adjacent site
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H, EXORIBONUCLEA P66 RT
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-Ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 165
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kfbA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kfbA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kfbA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kfbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kfbA05
4Q44A 4WE1B 2Y1IA 4FXDA 3LPTA 4CJVA 3AV9A 3AVMA 4W5OA 5HBMA 3KMQA 3I0RA 1GOAA 4M42A 4B08A 1Q8IA 4O3PA 1O1WA 3G86A 3RMDA 5C24A 4CHNA 3EY1A 1IKYB 4PA1A 4JS4A 4KHUA 3PO4A 4DFJA 1S9FA 3L2QA 1JLBA 4UQGA 4ZPBA 2Q3SA 3VA0A 4B9VA 2XY5A 2W8LA 1TKDA 3M9MB 4Z0UA 3C6UB 1RT4A 4G1QB 5CYQB 1RTDB 4N5SA 2YKNB 3BQ1A 4TSXA 1D8YA 4CJSA 3T3FA 4KV8B 2FBTA 4RNFA 1U04A 3MF5A 4CE9A 1QSYA 3E01B 3FFIA 1S0OA 5HRSA 3TI0A 3G10A 3GIKA 4Q8FA 2OPPA 4ZTJA 1C0UB 3WNFA 5DK5A 3ISND 4G3IA 3NF7A 4F8RA 4FJGA 1S1TB 2RDJA 2F8EX 3H5YA 5FRNA 4ELTA 1Q9YA 2EC0A 4E7JA 2VA3A 2Z1IA 4WYLA 2X74A 3KTQA 4ECQA 4Z4HA 2BE2B 3JYTB 3LZIA 2J6TA 2VG6B 3QZ8A 3NH0A 3D0PA 2B43A 4NLQA 4PWDB 4J9RA 4DL2A 2HHVA 3HP6A 4IFVB 3AVLA 2AWZA 5J2MA 3RBDA 3AVIA 5DQGA 4NLGA 3EYZA 3SUOA 4F4XA 4QWDA 4EBEA 2AX0A 1LWFB 1VRTB 2W9AA 4O44A 1RILA 2KQ2A 2HVHA 1UOCA 1K1QA 3SFGA 4GC7A 2FLNA 4BE1A 5KFDA 3NF6A 1JKHB 1B9DA 3MEEA 1RCHA 1NNDA 3HM9A 2AGOA 1RT1A 4O3OA 4DL4A 2HNYB 4B3OB 1XHXA 2WTFA 1C0TA 2C28A 3PX4A 2C22A 4YFUA 3HT3A 3L2RA 3PW2A 4PUOB 1TKTA 1NHUA 1VSLA 1REVB 2VWJA 4QWAA 3OL6A 1S9EB 3T5KA 2KTQA 4FJHA 1RTJB 4Y2AA 1I3AA 1LWEA 1TKZB 4RW8B 4KI6A 2FBVA 4CK2A 3OYLA 4I7FA 4DTPA 3DLGA 2KFNA 4IFYA 3O4NA 3U6FA 4I2PA 4JLHA 5I42A 3BGRB 4J2AA 5KRSA 4CEAA 1N4LA 2W9CB 3QEIA 2JC0A 2R2RA 1LW2A 4ID1A 1JLEA 3DLKA 4ZHRB 4IG0B 2C2RA 4CJQA 3UPFA 1BGXT 1J54A 1KVAA 1LW0A 3VQAA 4OKKA 2ZD1A 4CF1A 3OYDA 3RB3A 1IKXB 2VG5B 4LQ9A 4LSLB 2RKIB 4YMEA 5KTQA 4K4VA 1WN7A 3HHKA 4O3RA 4WZQA 2VWKA 4J2DA 3U3YA 2GBZA 3PW7A 3OLAA 3QINA 4QCLA 3HVAA 4KPYA 1RBTA 1SL0A 1EETB 3KKRA 3HPHA 3RWUA 4F4YA 4E3SA 3GILA 5L1IA 3RRGA 2D0BA 2OPQB 4CJKA 3SNNA 3GIMA 4M95A 3N6LA 3ZT2A 3QIPA 4E7KA 3M8QB 3OL7A 4DSKA 1TV6B 4IDKB 4DU1A 2EHGA 4DU4A 5CZ2A 2HHTA 1KLNA 4ECXA 3CQ8A 1BQMB 3K5OA 1T03B 4TQRA 3OJSA 3VQ4A 3M9OB 4WE1A 1EXQA 3G6VA 3TWHA 5J1EB 1J9AA 3BSCA 4QW8A 3BSNA 3NF9A 3MEGB 1SKRA 4RW6B 5KFQA 2JEFA 2VG7B 1TVRB 5KRTA 4DFKA 1U47A 3MFIA 3T19A 4R5PB 3VQ9A 4DU3A 1CZ9A 4ID5A 4TXSA 3CIZA 1SL1A 4I2QA 1IKYA 3LP0B 3OYFA 4FVMA 3RB4A 3MR6A 1ASUA 1CXQA 1Z26A 4RNOA 4DTXA 1SV5B 3KLFB 3LZJA 4B9SA 2CKWA 3ZT4A 4Y1CA 4RW9B 1NOYA 3LPUA 1C2PA 3C6UA 1S4FA 4CEEA 4CK1A 1S1WB 4G1QA 1RTDA 2YHBA 3RRHA 3IAYA 3KHRA 1YVUA 2YKNA 3KK2B 2I1RA 3M8PB 3ITHB 4DG1A 3QGHA 2HMIB 1XR5A 3SFUA 2UUTA 5KFAA 4HUGA 3QLHB 1RYRA 1TAQA 5JS1A 4PY5A 1QTMA 2HW3A 1KLMB 1XC9A 4QWEA 3NGYA 1BIUA 1HNVA 1JLCB 4KAZA 2FLPA 1XHZA 3DMJB 4GW6A 2IM2A 4KTWA 1X9WA 4HUEA 5KFLA 3TQ1A 5T7BA 4TY8B 2IJNA 4FZYA 4CJFA 4FZZA 2BE2A 1KFDA 3JYTA 3HVTA 4HVJA 5KGWA 1KSPA 2VG6A 3RAQA 3C94A 4K4ZA 3OJUA 4CGHA 3PVXA 4NLPA 2Z1HA 3S3NA 4FK0A 4HHTA 1HYSB 1RT5B 3PW0A 1HQUB 3MXJA 1LWFA 2PY5A 1NK7A 1TGOA 3OHAA 4Z4CA 1S1VB 2ILZA 4Q43A 2G8HA 4BWMA 4U7CA 4QWBA 4KSEB 4CEOA 4KFBB 3CFRA 5KT6A 1EP4B 1F21A 3KD5E 5L1KA 2AQ4A 4KTQA 1J53A 3KJVB 1NJZA 4C8NA 3SUPA 4OGCA 1OS5A 4W5QA 1RT3B 2HNYA 4B3OA 3CJ2A 1NK6A 3EZ5A 3BQ0A 1XR7A 4PUOA 1REVA 1S9EA 4ED3A 5HLFB 2KW4A 5EUHA 3A2FA 2Y1JA 5FDLB 2ETJA 4M45A 2BANB 3NE6A 1HRHA 3ZSXA 3K5MA 1TKZA 4HUFA 3C95A 5KFIA 3SUNA 4QAGA 3BGRA 3BJYA 1JLGB 3E51A 3O3FA 3LWLA 1KRPA 2WHOA 2W9CA 1S1XB 1TKXB 2LSNA 4CGDA 1NKCA 4ZHRA 4IG0A 4FJ8A 4WYWA 4EP4A 1BI4B 4BDYA 5KG7A 2E9TA 1U48A 1TK5A 4RW7B 3ZSYA 1Y97A 2BRLA 2ZQBA 3ZCMA 3HPGA 1WNEA 5HROB 3DI6A 4DEZA 1HQEA 3VQDA 4F3OA 1IKXA 3GV8B 1ZETA 2B6AB 2VG5A 1U49A 4DLEA 2RKIA 3PX6A 3HP9A 4J2BA 3KLHA 3IGNA 4K4XA 5KG0A 4YR2A 3T5LA 2AU0A 3MEDB 1RT7B 4FW2A 1NKBA 5JXSA 3KLEB 3AO4A 2ASLA 4KB7A 4CHYA 4DTOA 2CJQA 1FXXA 4DL6A 5I3UB 4DSEA 2XRIA 4ZVFA 2YV0X 3DLHA 3I5BA 3PW5A 2WONB 3ZSRA 1NHVA 3ZT0A 1S6PB 3M8QA 4K4TA 2D3ZA 1TV6A 1JXBA 5KG6A 2YNIB 2BQUA 4MIAA 1BQMA 3DYAB 4ECZA 1N5YB 4IKAA 2OZMA 2JEGA 3I0SA 3AO3A 5J1EA 2E6MA 2KZMA 3V9WA 3ZSOA 3V9UA 3MEGA 4RW6A 4Z4FA 3ZSVA 3K58A 4EEYA 5HRPA 3NGDA 3ISNC 2JGUA 4CFCA 3GQCA 1SKWA 1JLFB 4R5PA 4AHSA 1Z4UA 4W5RA 1NK0A 1GX5A 1D5AA 3KLIA 2YHAA 3MR2A 2YNHB 2BRKA 4LH4A 4KHMA 3TAFA 3KOAA 2GIQA 1RDBA 5J2QB 4KREA 4LSNB 4O3SA 1SV5A 3KLFA 4ECUA 5DGBA 2FJXA 4RW9A 2JC1A 1RA7A 1ZBIA 1JLQB 1RDCA 4DLGA 4EZ9A 3QYYA 3AVCA 1S1WA 4L8RB 1NK9A 5C42B 3KK2A 2V4QA 4NLWA 1L3TA 3M8PA 4FCYA 2ZE2B 2HWHA 4K4SA 4EBDA 1D1UA 5F8HA 2UVVA 4EZ6A 1KLMA 3QNNA 1IKWB 2HHQA 2HHWA 3O3HA 3RMCA 3LP3A 4K8XA 4O0JA 1IKVB 4FLXA 1JLCA 4TLRA 4FW1A 3TABA 3DRRB 4DS5A 4WFXA 4CEDA 4TY8A 2ZKUA 3DOKB 4LD0A 3ICLA 2R2TA 3UQSA 2P51A 3OYGA 4CJ5A 4R8UB 3RAXA 3SV4A 4CFAA 4AHUA 4NZ0A 3D28A 3Q8PB 5F9LA 4IH7A 4NLDA 4KB1A 3LP1A 3CDEA 4NLRA 4ECTA 3NH2A 1RT2B 4E7HA 1SUQB 4NCAA 2V0NA 5KFNA 1T3NA 1QHTA 2OH2A 4CHOA 1HYSA 2A1RA 4CHZA 1ZBUA 1BQNA 4DSLA 2OYQA 1HQUA 3AO1A 3L8BA 5D3GB 4FYDA 3OYHA 2FBXA 3TR8A 1MU2B 4O3NA 1S1VA 3RB0A 4CCHA 3V9SA 4FJ7A 3IS9B 2IAJB 4MK8A 3UR0A 1A5WA 4F2SA 4QOZB 4NLOA 1BISA 3MR3A 2XY8A 4F50A 4Q45A 3KJVA 5DLFA 4M3TA 3Q8QB 4NLYA 5J2NA 4FS1A 2FVQA 3HVRA 1Q9XA 1RT3A 4NRUA 5JS2A 4YR3A 2QXFA 2YKMB 4CJWA 4DQRA 4N41A 3B6PA 2IM1A 3CJ5A 2DPJA 2IDOA 4H8KA 1BHLA 3ZSQA 3QESA 3KK3B 2OPRA 3H98A 4NLSA 2G8WA 3WNHA 2ALZA 2BANA 4IG3B 3NH1A 5KFUA 1WSJA 2I5JB 5KGXA 2W9BA 4E89A 3BSOA 4CGFA 4Y34A 1JLGA 2VA2A 4K50A 4C8KA 3ASMA 2B4JA 4RU9A 1KCFA 1X1PA 4FBUA 1A5VA 3V4IB 1TKXA 3QEWA 4CIFA 4HCCA 3CJ0A 4Z4GA 4CF0A 1BI4A 4KO0B 1T05B 3V6KA 1GOBA 3D5MA 4FLVA 2WOMB 5HROA 4Q0BB 3EZUA 1NJXA 1YTUA 1DTQB 3F9KA 4B9MA 4LQ3A 1HYZA 1RDDA 1JL2A 4IH6A 2E6LA 4FJLA 3LAKA 1TL1B 4FJ9A 4KKOB 1HMVA 2G8IA 1ZTTA 3MEDA 5KFMA 3KLEA 1ASVA 4NCGA 2DFFA 4DFMA 2EX3A 3SQ1A 1ZBFA 5I3UA 4YNQA 5KFZA 1KFSA 1K6YA 1U4BA 1S5JA 3SV3A 3PJWA 1RBSA 3CDUA 2WONA 3VQ8A 3OYCA 3CFPA 4I9QA 2HNDB 1DLOB 3SI6A 4CGGA 2IC3A 3OYAA 4TYAA 1WNSA 3TAGA 3TAPA 3K59A 3AVFA 1R0AB 3DRPB 3M8RA 1QAIA 1CSJA 2PYLA 3DYAA 3NHGA 1SH2A 5KFCA 1N5YA 4DSJA 1FKOB 3OL8A 2C2EA 4H4MB 1LWCB 2B5JB 3V6HA 3TAMB 5KFGA 4M3UA 1JLAB 4MKAA 3LAMA 4ZVHA 3NAHA 1KHWA 5KT7A 2RDIA 1RTHB 5KFVA 2G8FA 3NGZA 3DM2B 3H59A 1JLFA 4QPXA 3PW4A 1C6VA 2DFEA 1EX4A 3DLRA 2XHBA 4IOBA 2RF2B 5KFJA 2QKBA 1S9GB 2YNHA 4CFBA 1J5OB 3MXIA 4CF2A 3B6OA 5J2QA 4DTRA 4LSNA 4KHYA 3CYMA 4DSFA 3L2WA 3ULDA 3K5NA 1JLQA 4MKBA 4IQXA 4WFZA 1QE1B 5C42A 3H5XA 3UIQA 2E9ZA 4BWJA 5HBMB 4CK3A 1SKSA 5CYQA 2FJWA 3C6TB 3S9HA 4Q8EA 4KV8A 1IKWA 3H08A 5EWEA 2WK4A 1IKVA 1UWBB 3E01A 3EPIA 4C8LA 3QGIA 4YR0A 2QE5A 1CZBA 3AA3A 5KFSA 4J9LA 3WNGA 3DOKA 3LP2B 1C0UA 3VN5A 3FQKA 4R8UA 1S1TA 3NKYA 2D5RA 4RUAA 4AHRA 3AVKA 3QERA 4K4UA 3VA3A 1W9HA 4DQQA 5FRMA 2XI3A 4ZPAA 1RT2A 1SUQA 3SQ4A 4ZPDA 2F96A 3GV7B 4ED6A 4ELVA 4J9PA 4JRQA 4J9SA 4PWDA 2IM3A 3LDSA 3L3UA 4CJTA 2WCXA 3G0ZA 5J2PB 4E19A 4IFVA 4MFBB 1HJRA 3CWJA 4F3TA 5D3GA 4NLUA 3MXMA 4FJIA 3LWMA 3O3GA 3FRZA 3IG1B 3L2UA 3K5LA 4MQ3A 2IJFA 4RUCA 2WRMA 3RBEA 4WXWA 5KFXA 3PUFA 3LALA 2GC8A 1VRTA 3CG7A 2RPIA 3QZ7A 3OHBA 4B9UA 4JV2A 1L3UA 2GV9A 4IR9A 4FBTA 3I8DA 2XGQA 5DG7A 4CGJA 5HRRA 1YVFA 5F8GA 2ASJA 4FK2A 4KHSA 1JKHA 3LANA 4R0EA 5KT2A 2IGIA 3PZPA 1RBVA 3SYZA 5J2MB 1VK0A 3M8SA 3MFHA 3OLBA 1W0HA 3KK3A 4CESA 4FM1A 4CJPA 3RB6A 3L2VA 4O55A 3IRXB 3L3VA 5KFBA 3O4QA 4CJ4A 2BDPA 2I5JA 1I6JA 1S49A 5KG3A 1S0NA 3NCIA 1RTJA 1YTAA 3Q8SB 4OPJA 2W7OA 3QGGA 3HKWA 4BDPA 4RW8A 4GVMA 4B8AB 3V4IA 1FKPB 4KAIA 4CEFA 3QNOA 2QV6A 3CDWA 4FLTA 4BACA 3MR5A 4KO0A 4AH9A 2YNGB 1T05A 3MECB 4CJRA 5SWMA 3OYJA 2RN2A 1N48A 4U6PA 1DTQA 1NK5A 2R8KA 3HXMA 4DTUA 4J9OA 3VQSA 4FM2A 4XIUA 2FVPA 4M3RA 4C8OA 3RMAA 4KKOA 4QWCA 3VQEA 3VQ7A 2D0CA 4J2EA 2HHXA 1RT6B 3T1AA 4LSLA 3NFAA 1LWEB 4FJJA 3DLGB 4IFYB 1QS4A 1TK0A 4I2PB 2Z1JA 4ZP7A 3AVJA 3KK1B 1WSGA 4FLYA 2G8UA 5DGAA 3QIDA 3HK2A 1WAFA 1DTTB 4OGEA 3NGIA 4DSIA 3CVKA 2FVCA 4EYHB 1C1BB 3V6DB 4ZTFA 4E7LA 1EETA 2HNDA 1DLOA 2E9RX 1S48A 4ED0A 4OLBA 4KHRA 2OPQA 1LW0B 5E41A 1L5UA 2ZD1B 4KB0A 3F73A 1RDRA 1WSIA 3OYIA 2W7PA 4HYKA 4ZPCA 4IDKA 4IH5A 4H4MA 3U3GA 4GMJB 2KFZA 1LWCA 2B5JA 5HRNA 5KG5A 4DTNA 1XWLA 4RW4B 1BIZA 3K2PA 3H5UA 4ED7A 3P1GA 1T03A 4Q5VA 4OKEA 2HB5A 4CHPA 5DG8A 3SPYA 2AGPA 3CM5A 2WB4A 3DM2A 4OL8A 2C2DA 1ITGA 3KLGB 4DS4A 4NLVA 4ICLB 4O4RA 4CEBA 3SCXA 5C25B 1VSDA 3P5JA 4AHCA 2VG7A 2RF2A 1TVRA 3QIPB 3VQPA 3IGVA 4DF4A 1A5XA 4NYNA 1J5OA 1RAJA 3GV5B 2UVWA 4B8CA 1D9DA 4CIGA 3H4DA 1L3VA 1GX6A 2V4RA 2P5OA 2XCPA 4Y1DA 3LP0A 2JEJA 1ZTWA 1IM4A 5DLGA 3BQ2A 1QE1A 3H40A 1ZBHA 3IN5A 4JV1A 4URQU 4LH5A 2GIRA 4ECRA 1S6QB 1RBUA 1VSJA 4FM0A 3PO5A 3RTVA 3C6TA 5KT5A 4O5BA 1T7PA 4M3WA 2BR0A 3QEXA 3ITHA 4FJMA 4ID5B 2HMIA 3NAEA 3MAQA 4Y3CA 4N56A 4Z4EA 1UWBA 4CHQA 4I2QB 3S3OA 2IA6A 3QLHA 3N6MA 4IRCA 3I5CA 3LP2A 1VSFA 2HHSA 5T14A 2HVIA 4JRPA 2D7SA 4DTSA 3DMJA 5KFPA 1HARA 3AO2A 2IM0A 3KKSA 3HYFA 4PQUB 4GC6A 2ATLA 2XGPA 2BGGA 1TQLA 4DG1B 2D0AA 1TL3B 3AVNA 1S1UB 1NOZA 4MIBA 3OYNA 5J2PA 4OLAA 3CJ4A 5C5JA 1WSHA 1CLQA 4MFBA 3ZSWA 2XO7A 4O3QA 4ED8A 2R8GA 2P1JA 4ZP9A 1RT5A 1HNVB 1LAVA 3IG1A 3EPGA 3VQBA 3GIJA 1JIHA 4OVLA 4CECA 3PJXA 4W5NA 4RG8A 1KVBA 3TAEA 5KFTA 3UDLA 4FLZA 4J9NA 3HVTB 3ZT3A 1TP7A 2FC0A 1ZYQA 4DQIA 3OSNA 5KI6A 2IOCA 1S0MA 4KFBA 4BDZA 3NBPB 4CJUA 1EP4A 3QETA 3RR7A 1XR6A 3V1QA 2XY6A 4FS2A 2D3UA 4M3XA 4Y2CA 2R8JA 4CGIA 4NRTA 2E4LA 3SQ0A 1YT3A 2NUBA 3OYKA 5F8LA 1U45A 3FDSA 4J9MA 2PZSA 4OPKA 3KNAA 3DOLB 2PYJA 4DL3A 3OYEA 3ZT1A 3IRXA 5KFHA 5K14B 2HWIA 2FLLA 3AVHA 5HLFA 2XI2A 3G6YA 1HNIB 3TARA 3DLEB 2FJVA 1WSFA 5F8JA 5FDLA 2YNFB 1FK9B 4DTJA 3SZ2A 3PV8A 4IBNA 1TK8A 1HPZB 1RTIB 2OPSB 4ED2A 1S97A 1FKPA 3Q8RB 4IRDA 2X78A 4JS5A 1IG9A 5HP1B 3PR5B 3HPOA 4DL5A 2YNGA 1QSSA 3MECA 1S1XA 3NDKA 1NKEA 1NJWA 1VSKA 4URSA 2JLEA 2ASDA 4KI4A 2XY7A 4RNHA 3KLVA 4Z4IA 4RW7A 3DDKA 4IKFA 1W25A 1VSMA 3OS1A 3V81B 1EKEA 3G6XA 1C0MA 5DMRA 2B6AA 3V9ZA 4EBCA 1RT6A 4ZP8A 2AX1A 4H54A 3VQCA 2F8TA 4H4OB 1WLJA 3NL0A 3KK1A 2HNZB 1RT7A 3QO9B 5KG4A 4E7IA 1DTTA 4CIEA 3N6NA 4FLUA 2ITGA 1C1BA 3V6DA 5L1LA 4ECYA 4LY7A 2R7YA 1N6QB 4ZMMA 3ALYA 4DQSA 1JXEA 3SJJA 3DI6B 4CF9A 3HL8A 1HQEB 3AA4A 4YQWA 4ZP6A 1D9FA 4EYIB 3H5SA 1S6PA 3KIOA 1BCMA 1C1CB 4FLWA 3V6JA 3TVKA 3KLHB 3SPZA 5DG9A 1KVCA 1TAUA 1BCOA 2YNIA 2OZSA 2AJQA 4DWIA 3DRSB 4RW4A 1C1AA 3CM6A 2G8KA 4N47A 4DMNA 4CFDA 4MK9A 4ZVGA 3QEVA 3DLBA 3AA5X 5JUMA 3FQLA 4HCBA 1WAJA 3KLGA 4O4GB 1LAWA 5CYMB 3OS0A 4CEQA 4ICLA 1JL1A 5C25A 1SL2A 4X2BA 1VRUB 3GYNA 3JSMB 4QW9A 4ECVA 1GOCA 4FJNA 1X9MA 1SH0A 5KG2A 2J6UA 4BE2A 4DFPA 2O4GA 2R2UA 3T5HA 3I0SB 3PY8A 4NYFA 3T5JA 2QK9A 4OJRA 4B9NA 1S6QA 2GUIA 3NMAA 4N76A 1MMLA 4IRKA 4J9QA 1RDAA 5F8NA 5F8MA 2UVRA 3HO1A 3THVA 3OVNA 2ZE2A 1RYSA 4DQPA 3HJFA 1K1SA 3RMBA 5FROA 2XWYA 3I0RB 3KLIB 5KG1A 4HKQA 5CY4A 5F9NA 3TANA 2G8VA 1ZBLA 2BQRA 5KFYA 5C24B 3P83D 3DRRA 3MTKA 1IH7A 4E1NA 3CJ3A 5KFOA 4PQUA 3GIIA 1JLBB 2X6NA 3KMSA 4DF8A 1NK4A 3AVBA 2W42A 1UA1A 3OSPA 1TL3A 1S1UA 4JUZA 1RT4B 4AHVA 1WSEA 4DL7A 4NLXA 4M94A 2HAIA 4CF8A 1CXUA 3HVWA 4M3YA 4F4KA 3FFIB 3M9NB 3KD1E 2OPPB 1X9SA 4CEZA 4MH8A 5F8IA 1MU2A 2ATQA 4F4ZA 4FJ5A 1I39A 1QUVA 2ILYA 1Z25A 4XO0A 4K4YA 1RA6A 3IS9A 5L1JA 1RNHA 2IAJA 2F8SA 2BQ3A 3LP1B 4NYZA 1KTQA 1B92A 2KZZA 1UAXA 3NBPA 5KFRA 3WNEA 4RNMA 3VQQA 4KHWA 3OS2A 4ECSA 4ED1A 2IMWP 3K57A 1KHVA 3SQ2A 4TQSA 2FVSA 5EU7A 3V1OA 3PR4A 1BQNB 3BSAA 2J6SA 4NLTA 5CZ1A 4J9KA 1N56A 3DOLA 2YKMA 2R8HA 2JEIA 3FSIA 5EDWA 5K14A 4MK7A 4RZRA 4CJEA 3OL9A 1HNIA 2D41A 3DLEA 2YNFA 1FK9A 4O44B 2DY4A 3BR9A 4IG3A 4TYBA 4EP5A 1HPZA 1RTIA 2OPSA 3BDPA 3KHHA 3AO5A 1S10A 4OKJA 2XCAA 5KFEA 4EO6A 1T94A 5L9XA 3HSTB 4E1MA 4FZXC 1U09A 1HYVA 5J2NB 2X6SA 1NJYA 1XI1A 1ASWA 4M41A 5HP1A 4M3ZA 2V9WA 2UVUA 1VSIA 4HTUA 5KFFA 4I9LA 3RR8A 2R8IA 3MEEB 4XPEA 4CJLA 4O0IA 1VSHA 2DPIA 4FK4A 1LV5A 1RT1B 4JV0A 1C0TB 4E0DA 2OPRB 3V81A 4B9LA 2DTUA 4EO8A 5DQHA 4F2RA 4K4WA 2WOMA 4Q0BA 3OYBA 3AA2A 2Z1GA 1T8EA 1QQCA 4C8MA 1TKTB 5EWFA 2FBYA 2XC9A 3QIOA 1TL1A 3VQ5A 2W9BB 4H4OA 2AGQA 4WFYA 5KFWA 4XPCA 2OA8A 2HNZA 3QO9A 3V9XA 5KT4A 4URGA 5DQIA 1SH3A 3SI8A 4I7FB 3TAQA 1UA0A 5I42B 3OY9A 3ZSZA 1N6QA 4CJ3A 4WZMA 4KTZA 4TN2A 1JX4A 4AILC 1LW2B 3KHLA 1JLEB 3BREA 3DLKB 4IR1A 4AHTA 4ECWA 1C1CA 4KHNA 3H2LA 4DTMA 1QSLA 2UUWA 1HMVB 1R0AA 1QAJA 3DRPA 4F4WA 3DRSA 3VQ6A 4ZVEA 2A1SA 2IBKA 4TY9A 4FJXA 4NCGB 1VSEA 4KRFA 1B9FA 1FKOA 4WXOA 3CFOA 1JXLA 4KHQA 3SUQA 2QKKA 2IS3A 3TAMA 3H4BA 1JLAA 1RBRA 4B9TA 2HHUA 4ELUA 2W8KA 4O4GA 1IO2A 5CYMA 3CO9A 3AVGA 1D0EA 2O4IA 2FVRA 5SZTA 2P5GA 3I5AA 1VRUA 3JSMA 1RTHA 4FJKA 2IC3B 4CERA 4YP3A 2O5DA 1BL3A 5KFKA 4BE0A 3PX0A 3S3MA 3NAIA 2R2SA 3KHGA 3PHEA 5EWGA 4NCBA 1S9GA 3QEPA 2DFHA 1G15A 4KBIA 3V1RA 3AVAA 5KT3A 1L3SA 1NK8A 3D45A 4RNNA 4K8ZA 4W5TA 4KE5A 3OYMA 3NF8A
chains in the Genus database with same CATH superfamily
4Q44A 2ZF5O 5LMNK 3W1YC 2WTUA 4C98A 1U6ZA 3KMQA 3SCIE 1GOAA 2FGCA 4B08A 3VEWA 2L41A 4YDUC 4B1ZA 1KD1T 3TWZA 3G86A 3B8AX 3POTA 2EFQA 1DZ5A 1VQMN 1M5KC 2EG1A 1WTFA 3PO4A 1GH8A 1MG7A 1H73A 2EBGA 3L2QA 4UQGA 3UO0A 2A5XA 4GKJK 4JI6F 1YRXA 1RT4A 4DR3K 1D8YA 3J81j 4F04B 2V2KA 1OVQA 2FBTA 3BF1A 3RJMB 4CE9A 1QSYA 4GVBB 3GIKA 3D2EB 1R59O 4Q8FA 2HVEA 4ZTJA 2ZITA 4DR1K 3ISND 3SSRA 1YHQN 4CLWA 1WC3A 4F8RA 2NRTA 3H90A 3F0NA 2RDJA 2MTLA 2F8EX 3H5YA 5FRNA 4ELTA 4DV5F 2KRBA 2EC0A 3M5RA 4WFAQ 2BACA 4WYLA 2X74A 3KTQA 2DRAA 4Z4HA 2XS5A 3JYTB 4EAHD 1UFKA 3HSZA 3NH0A 1F5BA 3VGLA 3AXKA 2J7KA 5AXKA 4J9RA 1E6YA 1FNOA 2HHVA 3HP6A 4IFVB 3KG0A 3HFKA 4OX8A 2DNYA 2IVFB 1U0HB 3EYZA 4NMLA 4CZKA 4ZVRB 2B9YA 3I56S 4V1Ak 1EX8A 1CLFA 3T6JA 1LWXA 2HVHA 1AW0A 1Q81O 1K1QA 5AQXA 4GC7A 4BE1A 3KXDA 3NF6A 4O23A 3HHNB 1GMWA 3EMTA 1NO8A 3MEEA 3O2IA 5JVGL 4B3OB 3DAWA 3B82A 2BVZA 4A61A 3PX4A 2C22A 1Z6RA 3L2RA 1VSLA 2VWJA 1REVB 1X7VA 1EJ7L 5EVZA 4JI6J 1MN9A 2B7CB 1U1NA 2VQFK 1N0VC 2XSFA 5DZ7A 1BA0A 2Q6BA 4OLPA 4DUYK 1N33F 1U1RA 1LWEA 4LRFA 3R8YA 4IDHA 3OYLA 2OELA 2ASOA 1NU0A 1NZAA 1Q86O 5I42A 3OUYA 1TTHB 3IRWP 4JAXA 4MO5A 3MCPA 1LW2A 4ID1A 4ZHRB 4JV5F 1GLEG 1NB7A 2XMKA 4DR5K 4NWBA 4DV5J 3UPFA 1BUXA 2BJ7A 3MR7A 1J54A 4CF1A 3RB3A 5AXMA 2VG5B 4H0OA 2KYXA 3NNHA 3KWMA 4LQ9A 4LSLB 1Q16B 4O0NA 2UUAK 2HBLA 4YMEA 4K43A 1WN7A 1BU6O 3HHKA 3N4PA 4OHYA 1ZC6A 5AFUH 1HBUB 1V4SA 3OLAA 3D2FA 4QCLA 3IMXA 4E3SA 3GILA 4X84A 1Q79A 3CC2S 3WX8A 1YJNN 3SNNA 1A0OB 1NPRA 4C2MA 4M95A 5L46A 3N6LA 3ZT2A 1LCUA 4X4OA 4DSKA 3W66A 1TV6B 4DU1A 3JTPA 3W62A 3M6WA 1SCJB 3QATA 3R5BA 3VQ4A 4PL8A 1GNKA 3M9OB 5IOLA 4QIFA 3G6VA 3BBBA 2BUPA 2BKNA 3S41A 1N8RT 1SKRA 4RW6B 5KFQA 2JEFA 3O6WA 3T19A 3VQ9A 4ID8A 1U8SA 4AFFA 1N33J 3CE8A 3CIZA 4I2QA 4NXNK 4JD2B 2KJWA 1YVNA 4YDXA 1UVKA 4FVMA 1N0UA 5HN0A 1CXQA 1WDTA 3ZT4A 2CADA 2E7VA 4JV5J 3PYGA 2E1ZA 4CEEA 4G1QA 1RTDA 3M30B 3KHRA 2YKNA 2NSBA 3M8PB 1PJ5A 4P72A 1Y4ZB 3ITHB 2O1PA 1T0TV 3SBTA 2UUTA 2HS4A 1Y64A 3HHLC 2FXUA 2ZKTA 4DR2F 1QTMA 1W97L 1WOOA 2NUUG 1M1GA 2O8DB 3C65A 4QWEA 4H03B 3TSQA 1BIUA 5AQOA 1E4GT 4CBXA 1XHZA 3LM9A 3DMJB 4QR0A 3HI0A 4LVOP 3TQ1A 4BS2A 2F7TA 4TY8B 4OYOA 5D0GA 3VAMA 4FZYA 1BWVA 2BE2A 3DXKA 3HVTA 4HDHA 1KSPA 2ZZMA 3RAQA 4C1NK 3DKDA 3GJRB 2LLZA 2GHPA 2J7WA 2NPFA 1HNZF 5BYSA 2ITMA 4ANDA 3IR6B 1ZPWX 1HQUB 3MXJA 1U2VA 1OH7A 4OHWA 2BM1A 2VPXB 3OHAA 1PC5A 3WT0A 4Q43A 2G8HA 3OPKA 4BWMA 5LSLA 2NNWA 4WTOB 4KSEB 1F21A 2P9SA 1ZH5A 1RFQA 5L1KA 2UXDK 1J53A 3KJVB 1CZAN 1DFDA 2QMUB 2ZM6K 2HNYA 2ZH1A 1FJGF 3CJ2A 3P96A 5A76A 4ITSA 4CZFA 2RMLA 3BQ0A 4ZCLA 3HZEA 5FLXY 2ZZNA 1S9EA 4YHHK 1L3KA 1NDPA 4TLQA 4D3HA 2Y1JA 1U2FA 4B1XB 2ETJA 3NE6A 2CQ2A 2JOQA 3ZSXA 1TKZA 3OTDA 1ZA2B 2BE9B 3ENBA 3SUNA 4DR2J 3BJYA 3E51A 3LWLA 3O3FA 3LA0A 2CDRB 2FHKA 1S1XB 2BV3A 5JMNA 1ZBSA 4IG0A 2VL1A 4EP4A 1HWUA 4K8RA 2HYIB 2BRLA 1N34K 4AE5A 2EKYA 4DEZA 1RHUB 1HQEA 5LXRA 2C1EB 2H54B 3KLHA 3DXBA 3D54A 3T5LA 2G1DA 1HNZJ 1RT7B 4FW2A 4DV2K 1JJ2M 1BDGA 2D3O1 1WKLA 4KB7A 4DL6A 3K9JA 1ZM4A 2MQPA 3VTIA 3PW5A 3P3DA 2WONB 2E1AA 4UUWA 3ZT0A 4HHHA 3M8QA 2D3ZA 4WK1A 2UP1A 3G96A 1OPZA 5KG6A 3NNCA 2BQUA 2NXJA 4MIAA 1S77D 4PABA 2M9KA 3GFHA 2K3KA 1WF0A 2OZMA 3I0SA 1M1KT 1FJGJ 1Y3JA 5CXTA 2CVIA 2E6MA 2BJ3A 1FJCA 3LO3A 3IDHA 3K89A 3Q8VA 2L9WA 3ZSVA 3TZZA 1HI1A 4A4JA 3ISNC 2JGUA 4CFCA 2KRRA 1JLFB 1P8GA 1HHSA 4AHSA 5DM6Q 2ZBPA 2JWNA 3OVSA 2JSXA 3MHYA 4IXCA 2HGMA 1QVGR 2F3JA 3QQCD 1D5AA 4PG8A 5CE3A 4LH4A 1VK3A 2GIQA 4KREA 3WC0A 5AQFA 2QTWA 3LGHA 3A1YG 1SV5A 4ECUA 1PJ6A 4BRFA 3A12A 4KGXB 1RA7A 1JLQB 3CUNA 4DLGA 2KXHA 1S1WA 2P6TA 4O5FA 5C42B 2V4QA 1L3TA 2YWFA 4FCYA 3H1VX 3ENAA 3PKYA 2HWHA 2B51A 2A40A 4ZVOB 4EBDA 3VEYA 4DX7A 5F8HA 1SJ4P 1JNRB 3ILOA 3HFVA 5L9NA 2HHWA 3VETA 3RMCA 3LP3A 2V2ZA 1JLCA 5HL7Q 4USMA 2RHKA 2KKHA 4CYUB 1JCEA 2BJ9A 2M4MA 2ZKUA 3ICLA 3UQSA 4USKA 3OYGA 2LXFA 1MA9B 1NMEB 4CFAA 3C14B 4NZ0A 3D28A 3Q8PB 3QT5A 4NLDA 3OVBA 3A5OC 2WVCA 4TKTA 3RVCA 2ZGZA 1UZHA 1T3NA 4JKBA 4X4QA 2ZOMA 3O1LA 3TEHB 2GCFA 2ZBRA 3CHWA 1CBKA 3P4UB 3Q2TC 1TZ0A 2HSEB 3L8BA 4FDFA 2R4FA 5D3GB 2JVOA 1HWLA 4PYDA 4O3NA 1S1VA 3V9SA 4RUHA 4H5RA 3AGKA 2CJYB 3R7SB 2VOPA 3CMES 4QOZB 1BISA 3MXHP 4Q45A 2OTJS 1SKUB 1B0TA 1OMSA 2F40A 3P6YC 1NM1A 2OEMA 2LXIA 1MSWD 1RT3A 3L0QA 3VVTA 3E3XA 4JI4K 2HHHF 2HZVA 2YKMB 2HURA 5K8OA 2DPJA 2IDOA 4H8KA 3ZTRA 4LIRA 2C3UA 3ZEUA 3KK3B 1VBKA 2MSSA 3FCVA 3H98A 4NLSA 1TFWA 5THWA 5LL6Z 4FWRA 4NZ7A 2Z2ZA 4LFBK 3J8AA 1WSJA 5KGXA 4USUA 1OQ3A 3JTOA 4DN0A 5C7PA 5ETRA 3PYEA 3O08A 3MCMA 1AUSL 2X1BA 1E4FT 2B4JA 3ASMA 1X1PA 4A47A 3G2XA 1DBDA 1TKXA 3I96A 4QIWD 3ZNUA 4CF0A 2QG9B 3MOJB 3THXA 2XSJA 2WOMB 4Q0BB 3OR2A 2CQ0A 2RNEA 1H74A 2IMOA 4BR4A 1Y5LB 1TL1B 4KKOB 2K06A 1HMVA 2G8IA 1ZTTA 1SJQA 2JDJA 1CPZA 4GV3A 1IBLK 2B4VA 4OI3A 4DV4F 1KBRA 1NHKL 2O3DA 4NCGA 4KH4A 4XH4A 1ZBFA 5I3UA 1AA1B 2WBRA 2E8AA 1K6YA 3PJWA 5IV3A 1TUVA 2Z56B 3HTVA 1H7XA 4HT7A 2HNDB 2CWXA 3ELHA 3TAPA 3R7NB 3AVFA 5I9EB 2L48A 1U1MA 5BRFA 1R0AB 3M8RA 3DLLL 5CHIA 2PYLA 2PFFB 2MHNA 2R7OA 1FKOB 4BC5A 3VZHA 2B5JB 3QB0A 5LT5A 4NA1A 1RCXB 2HHHJ 2GELA 4ZVHA 1VQ8S 1G99A 3NAHA 1KHWA 5KT7A 2DCUB 1NCLA 4DR4K 4GMKA 2G8FA 5HMWA 4ZOSA 4CZHA 1KDNA 4RJVA 2O8CB 3ZZPA 5IT9O 2AHOB 2RF2B 1S9GB 3CCMN 4NZ6A 4LF8K 2ALYB 3MXIA 4CF2A 3IP0A 2DO4A 5J2QA 5D78A 3CJKB 2W25A 2A10A 3L2WA 2OCEA 4YORA 3DDIA 4JI3K 3L7PA 3HM8A 4WFZA 2Y3YA 3EXCX 3ZZZA 4XH5A 5EN1A 3J7AN 3H5XA 1T9TA 2QLXA 2E9ZA 1ZOTA 2HBRB 1R0BG 3PCOB 4DZ6A 2FJWA 1Q18A 4CJ7A 5EY4A 3UE2A 2NUHA 1LXJA 2XNQA 3MMVA 4DV4J 5EWEA 1IKVA 3KYLA 3E01A 1H38A 2QL7B 2QE5A 1T02A 1X4CA 3CB4A 2H5JB 2ZUAA 4J9LA 4Q2LA 5HMZA 4R8UA 3VVUA 1AXQA 1O0PA 3GFZA 1S1TA 2BUNA 2D5RA 4H5VA 4RUAA 1NGDA 4MYTA 2XI3A 1RT2A 4I6MB 1SUQA 2AYEA 4FWQA 3E9LA 2F96A 1XBWA 5GAHP 1RGIA 3KHYA 5D4PA 1NH8A 4JRQA 4PWDA 3ILIA 2P9UB 2KU7A 2WCXA 5J2PB 2Y1RI 1EWRA 2ZVSA 4L76A 3J7YP 1Q1KA 4CWBA 2DNZA 1FFSB 4PPDA 2ADCA 3UI3A 2NCKL 1B99A 2VBYA 3MUVP 1YJRA 1DRZA 2XTJP 4B9UA 2F63A 5K8NA 4OYXA 3MCOA 3N79A 4JV2A 1V5IB 1L3UA 2JVRA 2HEKA 3TJ8A 2F9WA 4IR9A 3C15B 2XGQA 1YVFA 4JI1K 1Q5VA 4CO4A 1JKHA 5B0GA 1P1LA 4A8WA 5KT2A 1RBVA 1FJEB 1W0HA 1FX4A 1G4CA 3MCNA 3CCWA 4FNIA 4KIAA 4WK3A 2RIJA 3CC7S 1RU1A 3L95X 2NRWA 3L2VA 2DIVA 2A2CA 2GO9A 3FMWA 2Q36A 3MURP 1I6JA 1VR6A 4OI4A 1EQMA 2P9CA 3UVJA 1S0NA 3NCIA 3AY0A 4X62F 2ZH7A 4M5IA 3Q8SB 4OPJA 1X31C 4QU6A 5T41A 4RW8A 4GVMA 3T69A 1FKPB 3VPZA 4KAIA 1WC5A 2OEKA 4CEFA 2QV6A 3CDWA 4FLTA 4BACA 3MR5A 2WSEC 1VJQA 4AH9A 2YNGB 1T05A 1XERA 4BBYA 1WTBA 5SWMA 1TYQA 2MZTA 4U6PA 2R8KA 1M5SA 2MDAA 4CI6A 3O44A 4JYAF 3CD5A 1H7WA 3VQSA 4A8MP 1Q8BA 4M3RA 4LF2A 4C8OA 4PPZA 2GX9A 3ZTQA 4LF4F 3U1LA 3HF5A 4P71A 4YEAA 4DL0C 1UP1A 1NDCA 2HHXA 3CC4N 3NFAA 1OPIA 5B0BA 3CCES 3MMBB 1T9UA 2P9IA 3BPSP 1WSGA 3DC2A 1WAFA 3D6TB 1SJRA 2FVCA 2I6WA 3OXLA 3TZYA 4UF4A 4Y0WA 4ZTFA 4ED0A 4CP5A 1LW0B 2ZH6A 1L5UA 3H8YA 2A3ZA 3I87A 1RDRA 4PL7A 1WSIA 4K0KK 4WP8A 4JB8B 3OYIA 3OXFA 4KH1B 1IBMF 1D9AA 1RSCA 4IDKA 1VLOA 2FUG9 4M5MA 3HDSA 2I7PA 4IH5A 3U3GA 4GMJB 1QVFM 3C2PA 4RW4B 1I94F 2KYZA 3CMQA 1A7GE 2H65B 2QLJB 5G0RB 4CHPA 2CGLA 2AGPA 3KDNA 1JQGA 3VR1A 4D3GA 3HCXA 1U24A 1FT8A 2CPZA 4ICLB 4PHTX 2OHDA 1VSDA 1TVRA 3QIPB 3IGVA 1YBAA 2UVWA 4B8CA 2M5YA 2C2NA 4X62J 1JB0C 4X66F 4B3RK 2HZAA 3GU0A 2V4RA 2NZCA 2XS2A 3G6ES 2H3EB 3LP0A 3B54A 1IM4A 3FZFA 5DLGA 2LU1A 5IWAK 1RWMB 5F1XA 4JV1A 4URQU 4ECRA 2GJIA 1WORA 3TA0A 1Z1ZA 4JYAJ 2GHWA 2D1CA 2F4VF 2LFVA 3BS9A 1YJVA 1T7PA 3QEXA 4FJMA 4LF4J 2Q97A 1WG4A 3JS6A 3TUIC 3UDVA 2IA6A 3QLHA 1MWQA 3N6MA 1VSFA 2HHSA 5T14A 1ZXOA 4JRPA 4JI0F 2IM0A 3HYFA 4PQUB 5IM0B 3EDRB 4ZVPB 1BUPA 3CJCA 1FDBA 3DHWC 3CI5A 3P5TL 3GLJA 2V8PA 4AD6A 1S1UB 1IBMJ 5L8RC 4ED4A 3TTCA 2EBEA 1UVMA 3CJ4A 2VQEF 1I94J 2MKYA 4O3QA 2R8GA 2P1JA 2VCPA 4OZNA 4K41A 4I6WA 4OYAA 3EPGA 1YJ9N 1WHXA 1JIHA 3SCJE 4CECA 1MW7A 3PJXA 5SUHA 1NGHA 5AE1A 2M52A 5EHHA 3UDLA 4DPOA 3AOAA 4C8ZA 3W3SA 1TP7A 4LF9K 3TOQA 4DQIA 5LMUK 3CDBA 1FI4A 2AEMA 3BB5A 1X0PA 3PXGa 2FD2A 2HLTA 4IYQA 4CT9A 3NBPB 2OSQA 4CJUA 4X66J 1EP4A 1IV0A 3N01A 2ROPA 2XHCA 1JNZB 4EU0A 4M3XA 2R8JA 4NRTA 2E2OA 1OYEA 1YT3A 3G4SS 3FDSA 4J9MA 4OPKA 1V4TA 2ROGA 3LTOA 3IRXA 1BLUA 5KFHA 5K14B 4C8YA 3D1HA 1I5OB 5BPLA 2GAHC 3WXKA 3VAFA 5HLFA 1YHQS 2F4VJ 2MZQA 3DLEB 4NLBA 1WSFA 5F8JA 5FDLA 2YNFB 3ZETB 2MQNA 4KGKA 4HLBA 2B8QA 1KEKA 3DU5A 1E6VA 4FYXB 2X78A 3PR5B 2DBBA 3HPOA 1QSSA 3MWTA 1MMNA 2MQMA 1UWAA 4JI0J 3PFOA 1VQ7N 3GG1A 4RW7A 1K8KB 5F0XA 1WEXA 3LDOA 1X4FA 1W25A 3OS1A 1EKEA 3EX7B 3RBZA 3W61A 1SC3B 4EBCA 4GKKF 2HVZA 3VQCA 3BM7A 2M7SA 1FDDA 4DCPB 1ZAXA 2HNZB 2CNKB 2VQEJ 3BR8A 4ZLPA 2L3MA 3KWIA 1VQ5N 1HKCA 2QTDA 2CRLA 2OSRA 3NCQA 4FLUA 1RHRB 2PGCA 2RQMA 3SIPB 1YJTA 2YX6A 3ALYA 1HUXA 4F67A 1U1LA 4YOWA 5JLFA 2VBXA 4FLWA 3M2RB 1M0SA 4BR0A 2DHAA 2KL8A 5DG9A 3WEEA 1BCOA 2YNIA 5IFMA 2GTDA 3I32A 1NB2A 3PSFA 4BRAA 2K8GA 4MK9A 4QIEA 5LJVA 3DLBA 3QEVA 5JUMA 4U8YA 1WSVA 3TTFA 3EDQB 3FQLA 3QNWB 4USVA 1U02A 4I67A 4Y2MA 3KLGA 5CYMB 3OS0A 4CEQA 3CMAN 1JL1A 2XMVA 1CJUB 2OFHX 3HBTA 1A9NB 2OO4A 3JSMB 1R31A 4FSVA 1WBDA 3NS6A 3ENQA 5K5MA 1K9MT 3W2VA 2N3LA 4AL7A 4B3MF 3CCQN 5K8PA 1W7AA 4ZJLA 2WZ1A 4CT8A 4C9DA 2F9TA 2ZWOA 3T5HA 4ILLA 4JI6K 4BGAA 1X5SA 3CIMA 4L74A 3BZQA 2I2YA 2GUIA 1MMLA 4OYWA 4YDDB 5F8MA 4LSZB 3R2DJ 2ZE2A 1RYSA 3BP8A 1JXVA 5GAHI 2D3OR 2M8DB 2ZJPQ 4GKKJ 5KG1A 2A1BA 1Q82T 2V34A 2FGOA 5G4DA 3J7YI 4DV5K 1UVNA 4PKIA 5KFYA 2J76E 1SJ1A 5AE2A 1WHVA 2DGOA 3DRRA 4ES3A 3C7NA 5A8WA 1NK4A 3KMSA 2HBZB 4P2SA 4QR2A 2WSCC 1KVKA 4UTGA 1RT4B 3S7RA 2OIHA 1UEUA 2BTFA 2A18A 2OAUA 3M6UA 4X4SA 4F4KA 3X3UA 2ZH5A 3TUJC 3M9NB 4XH1A 3ZTSA 4CEZA 2IYGA 1UJ5A 1IR2A 1QUVA 4XO0A 3RG6A 1ATRA 3IS9A 2COLA 2IAJA 1B92A 3PJ9A 2V4JB 4ECSA 3SQOP 3CJ8A 1F5AA 4B3MJ 3SQ2A 2FVSA 3MX2A 5EU7A 1UAWA 3DXSX 2QL9B 3PR4A 3VF4A 1VMBA 3J7AP 1E6YB 4FWKA 3UW1A 2O8FA 5IZHA 5F0WA 1XMQF 3J81O 5EDWA 3BH6B 1N33K 1P27B 1QJHA 3OL9A 3AY9A 1F9HA 2DY4A 1T9XA 1Q95G 4TYBA 4EP5A 3QT7A 5AE3A 2OPSA 1TUWA 4F3QA 3AO5A 1S10A 2XCAA 5KFEA 4E1MA 1XI1A 4M41A 2ZZTA 4JV5K 1F3VA 4R25A 1WKKA 1CJVA 1OY6A 4ED5A 5KFFA 4HTUA 4WFNL 3MEEB 2V9KA 4CJLA 5FJ4A 5ETQA 4O0IA 1VSHA 2DEIA 3SQGA 1EKSA 2DPIA 4FK4A 1MWKA 2MJUA 4OI6A 5DQHA 4H0YB 2F7VA 4K4WA 2GWKA 2Z1GA 1Q0NA 4C8MA 2PSZA 2XC9A 4FF4A 3QIOA 4M8LA 3VQ5A 1YK9A 2G9OA 4WFYA 1MROB 2R3VA 2R7XA 4DV1F 5KT4A 1WC6A 4CBUA 4XDCA 1ZPVA 5I42B 3OUYB 1EQYA 4CJ3A 1GFWB 4WZMA 1WHWA 3W65A 1REGX 1LW2B 3R5CA 3J7Z5 4IR1A 4QS8A 2VUGA 3CCSN 1M1KO 1C1CA 3BYPA 2V68A 1QSLA 3UCZP 1Q7YO 4FYWB 3SAGA 1KOOA 1FNMA 3VQ6A 2IA0A 3U1MA 4A8OA 1Y11A 1JXLA 3PIOL 2QKKA 1J6ZA 2R42A 3CPWR 4B9TA 1OIAA 2B56A 5AQPA 3VALA 5A2QO 3N5BA 4UQTA 1XMQJ 2XLJA 3D2FB 3M8YA 1Q8LA 3LF0A 4Y00A 5KFKA 3PX0A 5KQDA 5KPZA 3CJ1A 2DGUA 1HL6A 4I1TA 5D4LA 2GHVC 3V1RA 2E1RA 2EG2A 1E3MA 3ZO7A 4WCEQ 2C2ZB 6FDRA 3D45A 4K8ZA 4KE5A 3NF8A 2FF3B 4A8KA 2HBJA 3DXMA 3IBWA 3MX5A 4ISFA 1KQSR 4W5OA 2WW8A 4DR2K 5HBMA 4BREA 4BY9C 4OJGA 1Z2ZA 4E8UA 3F41A 4M5DA 1RZMA 4RWXA 4O3PA 2EK1A 2ZBIA 3MM8A 2QM1A 4DV1J 2DHHA 2DHXA 5C24A 4CHNA 2Z4PA 3BBFA 4JS4A 1IVZA 4DPUA 2JWKA 4DFJA 3LOUA 3MPDA 1SS6A 3VA0A 1TKDA 2DNMA 3ZYYX 1HNZK 4RWWA 3Q83A 4G1QB 3MN6A 1RTDB 4N5SA 2YKNB 1F9EB 1HNXF 3J7ZO 4TSXA 3B6BA 3NG8A 4BC2A 3AT1B 3L7UA 4EWTA 4KV8B 1SC1B 4RNFA 1U04A 4A8FA 3MF5A 3I56N 4P73A 1S0OA 5HRSA 3G10A 4UOFA 2V2VA 4JP8A 4P74A 4CW7B 2H51B 4G3IA 3NF7A 4FJGA 1QVFR 2AYBA 2MZJA 2CQGA 2HRYA 1YF5L 2VA3A 4LF5K 4ECQA 4GNIA 3NXZA 2BE2B 2ABYA 2J6TA 1FJGK 5AXNA 4GRSA 1BWFO 1LFWA 4NYOA 2IVMA 3GE9A 1XNRF 4DL2A 2VGNA 2E2PA 1J5EJ 3F5TA 3DLJA 3AVLA 1M5HA 2AWZA 3RBDA 4RLEA 1NGFA 4F4XA 4QWDA 3E9PA 1ZS6A 4MT1A 2AX0A 4G6VB 1U2VB 4U8VA 2OEJA 1YBUA 4PG7A 1ZA1B 2HBKA 1UOCA 2FLNA 5CHCB 1RHJB 2LQBA 2P9SB 3ZZOA 3SSSA 1RCHA 1EKRA 4ZPVR 1RT1A 4O3OA 2B3TB 2HNYB 5KPTA 1C0TA 5AQYA 4K5SA 4IO9L 4BRLA 2VD3A 2RRNA 3PW2A 2YHXA 4B9QA 2V7ZA 4QWAA 3OL6A 1S9EB 5B0FA 1C0FA 4HTJA 1NBEB 3H2UB 4FJHA 1HNXJ 1RTJB 2KO1A 3ZZYA 2HPUA 3TRGA 4TU8A 1TKZB 2FBVA 2N7CA 1YTYA 3DLGA 4H5WA 3CC2N 1Q81T 3ZZUA 4OQJA 3H3OB 1FE0A 5KRSA 4DPXA 4CEAA 2JC0A 1F2GA 3IM9A 4IG0B 4CJQA 1BGXT 1XUPO 2V52B 1KVAA 4OKKA 2ZD1A 3H7HB 4MJKA 3TPQA 4QYZJ 2VIHA 2CQBA 2P9NA 5KTQA 2VU5A 4ZS6A 3W64A 1XNRJ 4K4VA 1WOQA 4YB6A 5AQWA 4O3RA 2QWOA 4H0PA 3U3YA 4J2DA 2YY3A 3WC2A 1UVJA 3QINA 3HVAA 4LVNP 4F3MA 3NEKA 1EETB 2ZH4A 4X4UA 5DM7Q 1SL0A 3HPHA 2OPQB 4PRFA 4YY3J 3GIMA 2W2MP 1JJ4A 1HA1A 3KZBA 4E7KA 3M8QB 4FL9A 4H4KA 3UFCX 2EHGA 3SLCA 3GG0A 5CZ2A 4ECXA 2PC6A 5IXUA 1FTRA 2HQ3A 1T03B 3BN4A 2H48B 3OJSA 4JKHA 1TMJA 3W9IA 4WE1A 2QWMA 1U1PA 2LQ5A 2DGTA 1T6DA 2ZNZA 3C19A 5B0CA 3NF9A 2VG7B 4LF7K 2FY1A 4DFKA 5LJWA 4ZJQA 4BG9A 4F26A 2XYGB 3DLLQ 4AL5A 4ID5A 1GMVA 4PYAA 1SL1A 1IKYA 1BG3A 3RB4A 5FPNA 3EUNA 1Q8KA 4RNOA 1SV5B 2K2PA 2IY5B 2VFSA 2E5LF 3C6UA 1QZ6A 1S4FA 4CK1A 1S1WB 3RRHA 2WAQD 3OR1A 2I1RA 3MOZA 3EGZA 1VQLS 4DG1A 3QGHA 2HMIB 1VYAA 1XR5A 1URNA 1YUWA 2H9ZA 3PACA 4OYBA 3D0GE 4LR8A 1N36F 4PY5A 1XC9A 3NGYA 1HNVA 1JLCB 2M88A 2FLPA 3VEOA 4KTWA 1AROP 4HUEA 1WACA 3FGVA 4L6V3 2IJNA 3VF2A 4CJFA 2VWBA 3ZX2A 1NJIO 2VG6A 3ETOA 2HHHK 3V4MA 4GVLA 3PVXA 4NLPA 3S3NA 1NSKL 2XEXA 1HD1A 4LR9A 3FCWA 4HHTA 2D1KA 1RT5B 3PW0A 2AJ4A 5RUBA 1XNQF 4L3NA 1PILA 1OSDA 3ID6A 5LOQA 1PAUB 3A5LC 3H42A 1CQMA 4HEA9 4I68A 2RILA 1S1VB 4QIVA 3GG4A 2G0IA 4QWBA 1VQOS 5CCLA 1KOHA 4JKGA 4KFBB 5KT6A 1EARA 3VQTA 3KD5E 4KTQA 1NJZA 3CF5Q 3SUPA 2GA7A 2EEYA 1TUUA 3QMLA 1RT3B 2DGWA 1FWKA 1NK6A 1HBOA 5B8HA 4UT4A 4PUOA 2E5LJ 1T6CA 4ANCA 3Q2SC 4ED3A 2A42A 3UCGA 4X4RA 4DV4K 2KW4A 5EUHA 3A2FA 3ENOA 3CJTA 3THYA 2Q66A 4ILMA 2KT5A 1QD1A 5MLCQ 3K5MA 4V19J 4HUFA 1FTCA 2DXFA 3C95A 4OI0A 2LDIA 1N36J 2HGLA 3BGRA 3BPDA 2WVBA 1TKXB 2LSNA 4CGDA 5GAGP 3A0IX 5B0EA 5KG7A 2E9TA 1TK5A 3ZSYA 2GO8A 5M2UA 1Y97A 3MUTP 3THXB 2XSJB 3CSKA 3ZCMA 5AQLA 3HPGA 1WNEA 4GO7X 3DI6A 2FLOA 3W0LA 1IKXA 4IEEA 2VONA 2B6AB 2XQCA 1U49A 3G8QA 4YS2A 4DLEA 3AAWB 2RKIA 5IQQA 2HFNA 3MN9A 4K4XA 3UKUA 3NWGA 5KG0A 2HKEA 4EFAC 2AU0A 1VHFA 3MAHA 1SXLA 3T1YF 2ASLA 1XNQJ 5I3UB 4NXMF 4ZVFA 3SBMA 1VC0A 4DV6F 4FF2A 4A8SA 1H6KX 2Z2MA 3KJQB 3MN5A 4WP9A 3ZSRA 3M7VA 4P7TA 4HL9A 1DT9A 3H2VE 5GMKa 2OANA 3BY5A 4JN4A 1BC6A 1BQMA 4KGMA 4GV9A 4WQ5A 2I7NA 2NRRA 3R5JB 4BRPA 4B3TF 3A3NB 3ATVA 1OVYA 4I69A 3V9WA 4DU8A 3K58A 3CJQA 4OZ5A 1OSCA 1KAZA 2WSFC 3GQCA 3I55S 1LOUA 3ULHA 3GZ7A 4W5RA 1CJTB 2POKA 1OJ4A 2VZ9A 1NK0A 2YCHA 1GX5A 4UW2A 4PXCA 2PI5A 1FHTA 2YHAA 4OZLA 3MR2A 4NLCA 2MGZB 3O5BA 1V3RA 3KOAA 5J2QB 4FWLA 3KLFA 2CQ1A 5BR8F 4HHUA 3GP9A 1RBOB 3QWPA 1IQTA 4LRCA 3QYYA 3AVCA 1HBMB 1UTAA 2J9EA 1CS4A 4QBUA 2NRVA 4M1KA 4CDIA 3BZKA 1D1UA 2FJEB 4EZ6A 2GEMA 1MDUB 3CD7A 1KLMA 3T1YJ 1IQZA 2HHQA 2Y8WA 2QA4G 4K8XA 1IKVB 4FW1A 3CMEN 2GIFA 3KG4A 4NXMJ 4CEDA 2ZOFA 4PR6A 4DV6J 1FW6A 4C3MA 2OTJN 4R8UB 3SV4A 3RAXA 2YHWA 3CERA 4OJHA 3LP1A 4H4KC 4NLRA 1RT2B 4E7HA 1SUQB 2FSNA 2V0NA 2GVDA 4ZLNA 3A8KA 2CJBA 2J0WA 1QHTA 2W2QP 2OH2A 1HYSA 1OO0B 3CCLS 3MM6B 4CHZA 4HDGA 4L75A 4M5NA 1ZBUA 1BQNA 4Z37A 4B3TJ 1PIEA 1Q5YA 4P6QA 3HOTA 4FYDA 2FBXA 4JKDA 4F0KA 4X62K 4CCHA 4BRIA 3D66A 5FPDA 3UR0A 2V5HG 4LREA 3GDQA 4NLOA 4C3LA 4DZDA 5A0YA 4BRDA 1HX1A 2D4WA 3HVRA 4BG8A 2WVEA 3TVZA 3SJHA 4JYAK 5B7WA 5JS2A 3H0PA 5JJBA 4YR3A 5BR8J 4DQRA 4N41A 3CJ5A 3LPYA 4LF4K 5AQRA 1Y5NB 1BHLA 3OHRA 2OPRA 5ETNA 3P31A 2G8WA 3NWRA 1S4EA 4TNOA 5KFUA 4QZVB 2LQ8A 3BGLA 2ZUGA 3Q8UA 3UR3C 3GMGA 2QN6B 3WX4A 3BSOA 3UVJB 4Y34A 3WXLA 3J7A1 1Y3KA 2J7UA 3F9MA 2LP4A 2NXEA 2V67A 2GUPA 1KCFA 4FBUA 1R8CA 3FCHA 3UDCA 3QEWA 4CIFA 4HCCA 3ET6B 3CJ0A 4CI0B 1GXUA 3B8HA 1N5QA 4HI1A 1BI4A 1T05B 2IDLA 1IBMK 2OLWA 4EI2A 2ZJRL 2VC1A 3O9UA 4FLVA 5HROA 3HULA 1TYQB 1CQNA 1FRIA 1YTUA 3IAM9 4Y2IA 4HACA 4B9MA 4LQ3A 1HYZA 1RDDA 2W7AA 1I94K 2DY1A 3ZZ0A 5HJYA 2IRYA 3UNGC 2A2DA 4UUXA 3OVAA 3FZHA 2BJEA 2HAFA 4FWOA 5AQSA 3SMSA 5H9EK 2DFFA 1NPPA 2IVNA 4DV0F 5E3QA 2DITA 3D67A 2EX3A 3I4PA 1KFSA 2DCLA 5KFZA 2P9IB 2JH3A 1AFJA 1K9MO 5IC6B 1U4BA 1S5JA 1PC4A 3SV3A 2XMMA 1HNWJ 4X66K 3VQ8A 3OYCA 4IOCL 3S6EA 5HMXA 5HAOA 4CGGA 2IC3A 2Z58B 4KY3A 4TYAA 3TAGA 3K59A 1V3ZA 1W2BM 3LDLA 4JEPA 3EL2A 3NHGA 2ZEJA 2E44A 5KFCA 2GJFA 4JK9A 2QMWA 4JKEA 3TAMB 3WQPA 2E66A 2F4VK 3QBCA 2PBDA 3LAMA 1QQNA 2VC0A 2KG0A 1Q82O 1NAQA 2CPYA 5AQQA 2U1AA 4CTAA 3W5ZA 5M2PA 3H59A 4FPAA 3VOVA 5D0EA 2C2OB 2DFEA 1EX4A 4XK8C 4IOBA 3TSPA 2QKBA 4FO0A 2YNHA 4CFBA 4JI0K 1X3MA 1SPBP 3B6OA 4LSNA 2BKPA 4KHYA 2K7KA 3CYMA 4DSFA 4BRKA 2LA4A 1S79A 2X1GA 2M8HA 4IQXA 2CIMA 4OMFG 2VF3A 1Z05A 2EW9A 3UIQA 1Q4RA 4DPYA 2HFSA 2VQEK 2XLIA 3O9QA 4WF9Q 1B4SA 2CG8A 2DNPA 4FPIA 4IQMA 3FSYA 1IKWA 3P8BB 1G2EA 4DCOB 4NYPA 2XS7A 1BQXA 3E1YA 2AJFE 4DV0J 2HF4A 1CZBA 3AA3A 4C48A 3WNGA 3FQKA 4LBPA 3GR0A 3C16B 1ULRA 2QO3A 2CUYA 5HVGA 3Q8YA 3MMCA 4RBTA 1R8PA 4P75A 3SCKE 4K4UA 3VA3A 5CD4A 4ZPAA 3CO0P 3GB0A 3SQ4A 2DIUA 2HFUA 1BD6A 4BVOA 1RBAA 1TUGB 2Z57B 1T44A 3CC7N 1XQIA 1GLAG 4WQ5C 3KUHA 4J9PA 4J9SA 3L3UA 1HWIA 4CJTA 4IFVA 4ZVUB 3HKZD 1YI2S 4F3TA 4NLUA 2IIHA 3LWMA 3O3GA 1NWKA 3FRZA 3L2UA 3Q22A 1IJJA 5KFXA 4P2MA 2RPIA 3QZ7A 3OHBA 4FVUA 2V6AA 4WWSA 4ZITA 3SXLA 3K2YA 3I8DA 5HRRA 3FBBA 2ASJA 2E5IA 5HQMA 4FK2A 4IOAL 1JCFA 3LANA 4R0EA 2CQHA 1TUYA 5J2MB 3MFHA 3OLBA 3FGUA 4GKKK 2YPZA 4I64A 4M5HA 3HHLD 3NY0A 4A2AA 4DX8H 3P38A 3CCEN 3IRXB 3EKSA 2V69A 2FZGB 2I5JA 2DXDA 3FC9A 5KG3A 2W40A 3RAMA 1YTAA 1YDLA 2XZWA 5LL6d 3QGGA 5F41A 2GMLA 1LQ9A 1E6VB 3QNOA 1HWKA 3O8WA 1VQPS 5ETLA 3IWNC 4KO0A 1SIWB 4CJRA 4U67L 3OYJA 1QVGM 2NSCA 2BMBA 4DTUA 4J9OA 4FM2A 5M1KA 3RMAA 5C2DA 2O01C 4X64F 4GY2B 3VQ7A 4M7YA 5GAGU 1RAAB 2CYYA 2D0CA 3T1AA 4LSLA 2MQLA 3T9ZA 3VF0B 2BH1A 4XEIA 4IFYB 4I2PB 2Z1JA 3AVJA 3I8BA 4FLYA 2XNRA 1HBUA 3JQMA 4DU7A 1RLCL 4EYHB 1TU0B 1DLOA 2E9RX 4B3MK 2N4DA 3HFZB 3LM2A 2MZRA 1GXLA 3EKUA 2KHOA 3G6EN 2DEJA 2P9PA 1DURA 3HHLA 3WEEB 1IG8A 4U7UK 1NM2A 4H4MA 3G8SA 2KFZA 1LWCA 4OZ2A 4DTNA 4CD1A 1S76D 2VFTA 1BIZA 2Z30B 5JVHQ 4OKEA 5DG8A 1A6LA 3CM5A 3R1HA 3DM2A 2W41A 3KLGB 4NLVA 3M6VA 4F36A 4AHCA 3QJJA 4DF4A 4U7BA 1HBNB 3NP5A 4U96A 4ZCKA 3FMBA 1CJKB 3CCSS 1X8DA 1FWPA 1GX6A 2R7RA 2NRXA 4JD2A 3PIOQ 4MLHA 2JEJA 2YVSA 1ZBHA 2P8IA 4E98A 2DYAA 3CCRS 1RBUA 1VSJA 3CJ9A 4KGVB 4FM0A 1V6HA 5H1SQ 3C6TA 1UETA 5KT5A 2KM8C 1WF2A 2BR0A 4ISEA 1KQFB 4X64J 3ITHA 5DO2A 2NRZA 4RUBA 5IT9U 4CHQA 3A8IA 2UXBF 4KJIA 3BZCA 1ZM3A 3LP2A 5E3PA 4DPTA 2KKZA 4F0MA 3D6RA 2LA6A 3OA9A 5M2RA 3DMJA 4ZLJA 1GMWD 5BN9A 3KKSA 1OH8A 3AA9A 3K5PA 2ATLA 2HLUA 1X4GA 2XGPA 5A8WB 2BGGA 1TQLA 2LXUA 3HJVA 2D0AA 1S99A 3KVGA 3G4SN 1CVJA 1XMQK 2CH5A 3GPAA 4MFBA 4N8OA 3TVYA 3W63A 3UD4P 2QA2A 2Q2RA 3VQBA 5E84A 2YH1A 5AZJA 5CZXA 4RG8A 1KVBA 3TAEA 5KFTA 3MPYA 4A57A 4J9NA 3ZT3A 5JMVA 9ATCB 2CQCA 4PXBA 2QZ8A 3IWLA 5ETOA 4CZCA 3OSNA 5KI6A 2HOEA 2IOCA 5AQKA 1U7LA 3JSYA 2AZ1A 5BJRA 3QETA 3CJ7A 1XR6A 3I82A 2XY6A 2OD4A 2J0XA 4LT6A 4FS2A 4Y2CA 4CGIA 4A5AA 2ZH3A 3KWGA 5EX0A 2B8PA 2E4LA 4XDDA 1YX2A 3OYKA 2PZSA 3GFYA 4DR6F 2GVZA 2DNOA 3KNAA 4DL3A 3H45C 2VJVA 3GYXB 2FLLA 1H3DA 2FPHX 3FBCA 4DV1K 3G6YA 2FJVA 4DTJA 3PV8A 2ASPA 1MMDA 1TK8A 4ED2A 2OPSB 4J91A 1S97A 3EWGA 3VGTA 2JX2A 3O9TA 4BCAA 2UXBJ 2E2QA 2P9LA 4JS5A 1IG9A 4K25A 3MECA 1CJVB 2O8BA 1H2UX 3CD6S 1S1XA 2FDNA 1VSKA 2P2CB 2ATCB 1XEZA 2JLEA 2ASDA 4KI4A 4Z4IA 3DDKA 4IKFA 5DETA 4NXNJ 4A2BA 3G6XA 3BEGB 1C0MA 5DMRA 2EFVA 3V9ZA 2PEBA 4YUDA 3G9CA 3EN9A 4K5RA 2F8TA 2VH7A 3LL3A 1WLJA 3KK1A 1RT7A 1DTTA 3FE1A 4CIEA 4DCJB 1F0XA 3W60A 2ITGA 5GMDA 1C1BA 3IO1A 3TA1A 3HSGA 2RU9A 1JXEA 4ATNA 3HL8A 3AA4A 1X4BA 1D9FA 1CULB 1VK8A 1GAOA 3H5SA 4DX6A 1C1CB 1M1HA 3TVKA 3SPZA 2BZ2A 4DR7F 2J5AA 1C1AA 2L9DA 3W9HA 2NPIA 3FUYA 2ADBA 4ZVGA 2QGFB 2W01A 1M90O 3W8GA 2AT1B 4Q7AA 4JI2F 5AJ3F 4DR6J 2GMHA 3MCAB 1YSJA 1SL2A 4QW9A 3EICA 4ECVA 1RHMB 4DV2F 3HHDA 3CIPA 1GOCA 1DQAA 2BW2A 4FJNA 3OW2R 3HT0A 4ZIWA 1SH0A 1I3OB 5KG2A 1R6YA 4NI2B 2J6UA 2AEFA 2RHQB 2RS2A 3KG1A 2R2UA 4ETZA 3PY8A 2VODA 4NYFA 5J1NA 5F3ZA 3T5JA 2HBMA 2QK9A 1YZ7A 1YQHA 1QQMA 3UWTA 4X4TA 3H46O 1HNXK 2DNGA 4N76A 4Q2MA 2CG4A 4IRKA 1PGZA 1RDAA 1H2VZ 2UVRA 3DXMB 2W6LA 3HO1A 3MPVA 3THVA 2JHEA 1S0VA 4DQPA 3ENWA 3HJFA 3FBEA 3OBWA 3KLIB 4HKQA 2CJXB 4M5DB 4YHHJ 1ZBLA 2VBWA 5M1FA 3MM8B 2RU3A 4W98A 4OYMA 5C24B 3GR1A 2UV8A 3MTKA 4KPCA 2YKQA 1V9OA 4QYZK 3R1XA 4E1NA 1RWNB 4CYUA 1N5SA 5FLXU 3BGOP 4DF8A 1D4XA 3AVBA 2W42A 1UA1A 1XNRK 3C14A 5DDPC 2RB7A 4G65A 4JUZA 1WSEA 1NLKL 3W5XA 1FF2A 4DR7J 1U2CA 4NLXA 2YJEA 2HAIA 2N4CA 1W2BR 3VEXA 4M3YA 1U8WA 1HIYA 5TKYA 4JI2J 3M2VA 1VQ9S 5AJ3J 3KD1E 1TL7B 4MH8A 1ZZNA 2JL9A 4MYUA 2ATQA 4F4ZA 4JNEA 4FJ5A 1I39A 4HHJA 2ILYA 4CO2A 1RA6A 5L1JA 1RNHA 5GAEP 1FKAF 2DR6A 5BYRA 4DV2J 3OTCA 1MWMA 5EX3A 4UY85 3PRDA 4RNMA 3VQQA 1RADB 1RI7A 3OD2A 2QEXS 1KHVA 3A13A 4NA2A 2V8DA 2V8GA 1VIOA 3M2UA 3ZTPA 2J6SA 1YITS 2YHYA 5AQHA 3NCPA 1NRKA 3DOLA 2YKMA 1KQGB 2R8HA 3M3ZA 3EGVA 3EVMA 4RZRA 2OTLS 1HNIA 3A3OB 3H25A 3HZGA 4CRJA 4QQBA 1FK9A 3MMAA 5IC4B 1RTIA 3R9LA 2DISA 4EO6A 1T94A 5L9XA 4WQ4A 4FZXC 4NO7A 1HYVA 5J2NB 2X6SA 1NJYA 1ASWA 4KH0B 5E3CA 2MB0B 2G2OA 2D9PA 4M5LA 2UVUA 2YTCA 1H2TZ 4A46A 2XYHB 1YZ6A 2B9XA 1RT1B 2AJ0A 4IJNA 1C0TB 2PFUA 3V81A 2DTUA 4C97A 2WOMA 4Q0BA 4WU2A 1T8EA 1QQCA 1JMTA 2HIQA 3BO3A 5GIOA 4B02A 1VBXA 1TL1A 1LEOA 2W9BB 3I33A 4H4OA 5B09A 2HRUA 3JSBA 4H0TB 4MKYA 3GCWP 4XPCA 4G1IA 2OA8A 4ANEA 1WC1A 3QO9A 1PBUA 3WZ0A 5CAAA 5HANA 1SH3A 5AZIA 3TAQA 1UA0A 4AF1A 3ATUA 1JK9B 3EXYA 1HD0A 3C0BA 3MAAB 4TN2A 3O80A 4AILC 1Z2LA 4RL1A 4KHNA 3DOMA 3R5GA 3Q89A 1R0AA 2MKJA 1RB0A 5DM6L 4O8KA 3DRSA 4LMZA 4FJXA 3VESA 2AIRB 4KRFA 1B9FA 1FKOA 4M5GA 3VMFB 4Z7YA 4DI6A 3SUQA 4DV3F 2HHUA 4R0JA 4O4GA 1IO2A 4H5NA 3CO9A 4H5TA 2FVRA 5SZTA 3QRRA 3I5AA 4GV6A 1FA0A 4YP3A 1O13A 1D09B 1BL3A 3S3MA 4ILHA 3BKTA 3NAIA 2HWTA 3PHEA 1S9GA 2APOA 2DFHA 2RE2A 2UUBF 2E5LK 3CJKA 3KKFA 1NK8A 3HHEA 1Q7YT 3IBCB 1K47A 3KJNB 2YX7A 2MQQA 3OYMA 1NDLA 2C3PA 4Z94A 4WE1B 2Y1IA 2BJ1A 2E29A 3P5BP 3AVMA 1N36K 4OJ3A 4QR1A 5I3PA 2HQFA 5KAKA 5HVHA 2E1PA 4M5JA 3JS9A 5E7OB 2IVYA 4NE9C 4ER8A 5AQZA 2KHCA 2QX0A 1O1WA 2AZ3A 1NDKA 3EY1A 1IKYB 1RHKB 4PA1A 1Y9OA 5GMEA 2HQDA 3R1LA 4I6YA 4OX9F 1SC4B 1S9FA 3O5TB 1FRLA 2Q3SA 4AM7A 2XY5A 4Z0UA 3CD0A 3C6UB 2WB1D 1R0CB 5CYQB 1HHQA 3OR1B 4I6MA 1RCOB 1IM6A 2YWEA 3GIRA 4WKYA 3BQ1A 1XNQK 4MIWA 2BX6A 2Q1NA 3FKBA 1FCAA 3OXGA 4KH5A 1PBAA 3TI0A 2UXCF 2P9UA 5CQGA 1VQKS 2XHWA 1C0UB 4DV3J 1J27A 5DK5A 3DGPA 5JICA 3EGWB 3OV7A 5DRKA 4CZLA 1UL3A 4ZKAA 3QMQA 2VG6B 3QZ8A 3VAHA 1VCTA 3C15A 3D0PA 4FZVA 4KHPF 2B43A 3D0IE 2UUBJ 4LFCF 3MM5B 2H4YB 5ETMA 2RH3A 3J7ZT 2KJVA 4DV7F 5DQGA 3SAHA 2QLBB 1N54B 1X9JA 3SUOA 4EBEA 3PNIA 2DRDA 2ZHBA 1PG5B 1VRTB 3MD1A 3SEOA 2W9AA 4O44A 1RILA 2KQ2A 3QSYB 2J9DA 1UKUA 2ZH9A 3VAJA 5KFDA 2PMHA 1B7YB 1B9DA 1FRMA 4KYZA 4DL4A 2WVDA 1XHXA 4OX9J 5LJ5Y 3IA0A 4YFUA 1NPKA 2Z2LA 4PUOB 1NHUA 5L38A 3BGFA 3T1YK 4PEOA 3J81U 2KTQA 3OFFA 5M1OA 3THYB 4JI3J 2FF6A 4NXMK 5GADP 2CZVC 4Y2AA 2G4BA 1I3AA 5I4MA 1UMJA 4DV6K 1TFYA 4CK2A 4TU7A 4I7FA 2UXCJ 2CQIA 2KFNA 4PXDA 1NZ8A 4C1NI 5HVFA 2L9NA 4H0XB 3BGRB 4J2AA 1N4LA 4OZJA 3GBTA 2P9KA 5AFUA 2R2RA 1JJCB 1VFJA 1JLEA 3DLKA 3AA8A 2C2RA 1HW9A 5T7LA 1S72N 1LW0A 3VWSA 4B3TK 1IKXB 1QLNA 1FE4A 2RKIB 4KHPJ 3PYFA 3QAEA 4K7QA 4WZQA 2VWKA 2XMWA 3IWXA 4LFCJ 1SB6A 1C4CA 4B3SF 4V19X 4DV7J 3W9JA 3PYDA 3VF6A 2OKQA 4KPYA 1RBTA 2CJAA 4PXEA 3EM1A 3KKRA 2ZJRQ 3AAPA 1FFWB 4ZK7M 1NGAA 5L1IA 3RRGA 3SAFA 1T9YA 2J8SA 1N5TA 5BREA 4FKYA 1RACB 1GEHA 3QIPA 2BE7D 2F8MA 2RQKA 4WQ4C 3OL7A 2MXYA 5BR8K 2HG4A 2F5GA 2OUGA 2KLAA 4DU4A 2DK2A 3CQ8A 4NMXA 1BQMB 1TR0A 5A8RB 2XULA 1FFGB 1VQLN 2AV5A 1EXQA 4K0KF 3TWHA 1OH6A 3W5YA 5A2QU 4JI1J 4QW8A 3BSNA 1DKGD 3NGRA 2IRUA 3DRXA 1QDUB 1SQGA 1VQNS 1D3WA 4DU3A 1CZ9A 1XMOF 2Z0GA 1NBWA 8AT1B 1OH5A 1WHYA 5KPRA 3OYFA 3A4TA 2KDOA 3MR6A 1ASUA 2D0OA 2MLYA 1Z26A 3KLFB 1RBLA 4B9SA 2HQIA 3TYTA 4Y1CA 1NOYA 3MGJA 1C2PA 5GAEI 3IAYA 1HW8A 2YHBA 5C12A 1CS4B 4WBFA 1NH7A 5HATA 2R9LA 1Y5IB 5KFAA 3O9RA 1QUPA 2IHR1 1TAQA 1WELA 3CGIA 1W2IA 2QJ3A 1KLMB 2X3DA 1NGCA 4B3SJ 4N8NA 1NGIA 1VQON 4KAZA 2PAVA 1B0PA 2ZWHA 5KFLA 3B4MA 1YBTA 4FZZA 1KFDA 3JQJA 3LGNA 5KGWA 4NX9A 2X3GA 5GIPA 4CZEA 3C94A 1FEEA 3OJUA 4C11A 3O9SA 4LFAF 2J9DE 2V2QA 2BOPA 2Z1HA 4FK0A 3NNAA 2GVDB 4DQ8A 1PYTA 3FEZA 1HYSB 3UD3P 3AQPA 3QICA 4OI1A 2CPXA 1DQ8A 4BRQA 2JFDA 4K0KJ 1LWFA 2YQ1A 4I0WA 2HQGA 2KVQE 3HLUA 3IR7B 1YJ7A 3T1HF 4U7CA 4FP9A 2MQOA 3ZETA 4V19S 4CEOA 3CPWM 3CFRA 5D8HB 1XMOJ 1SIZA 4WJBA 4CM2A 3VGSA 2C2MB 2AQ4A 4WYBA 3KJFB 3VENA 4C0HA 1NJIT 3C6AA 2QFIA 1XR7A 2GJ2A 1WKJA 1K8KA 3W2WB 4DV0K 4ILGB 2OJ3A 3AQOA 4IOAQ 4QOTA 3MEKA 4B1UB 5BN8A 3U1NA 3TR5A 1Y10A 1EQ0A 2K7JA 1KQSM 1KRPA 2W9CA 2R7WA 3WQUA 1WOSA 3HI9A 2XMTA 1NKCA 4FJ8A 1V3SA 1BI4B 4BDYA 2P9GA 3ONQA 1RJJA 4LF6F 4RX6A 5HROB 4K2XA 3I4HX 3VQDA 2GQ2A 3GV8B 3W3DA 2R7SA 2AMCB 3UDEA 2IPOB 1IBCB 2HZCA 1TL4A 5C0YA 3VZIA 4J2BA 4LFAJ 2YBVA 4Y6IA 3I9ZA 3TA2A 4YOUA 3GJTB 1NKBA 1FNXH 3AO4A 3I55N 4DSEA 1WG1A 4U67Q 3TQEA 2YV0X 2YQ0A 4ALZA 2UU9F 5C2CA 3DLHA 2RQ4A 2FJAB 1NHVA 3WXIA 1S6PB 1AUDA 3T1HJ 3N4WA 1JXBA 3NCRA 3PHTA 3MZIA 2HBQB 1XQSC 4IKAA 2JEGA 1UFWA 2PMZD 2ZH2A 4FOIA 5J1EA 2V7YA 1QAYA 1RAHB 5HJXA 3ZSOA 3MEGA 4CTAB 4EEYA 1S22A 5HRPA 1HFEL 2NZTA 4AM6A 1SKWA 2MKIA 3G8TA 4R5PA 3CTRA 2XMAA 2F9JA 4UZBA 2ZDOA 1PKUA 6AT1B 2YNHB 5FLXO 1HHTP 3ZLJA 3M8WA 4DDFA 1RDBA 4DCHA 4LSNB 4O3SA 1KQKA 1LOTB 2FJXA 4RW9A 4A8QA 2JC1A 1ZAWA 4Y2KA 1RWKB 4LUBA 1NK9A 5HMYA 2QXLA 3KK2A 4LF6J 2DNLA 1K8AO 2C2KB 3CCLN 2Y9HA 2I0XA 1FDNA 3G71S 5AQJA 4PG6A 4B1YB 2UVVA 1F2HA 3AD7C 2J0SD 1WI6A 1O5JA 3QNNA 1IKWB 4CNYA 4AXJA 5IS2A 4YOVA 3O3HA 4RCHA 1X5PA 4O0JA 3A8JA 4TLRA 3TABA 4JI8F 4DS5A 2DD8S 3PDNA 4WFXA 4LD0A 3M32B 3KK7A 2R2TA 4WU3A 2P51A 1EIYB 1DGKN 5HI7A 2UU9J 5HK4A 4AHUA 2BKOA 2FSKA 4IOXA 3MMCB 4BRNA 1C4AA 2GGPA 4ECTA 3NH2A 3DN9A 4NCAA 2V4JA 3SDEA 5BR9A 1FJ7A 1GLLO 4CHOA 4FF1A 1BMQB 4FPRA 2XZTB 3OQ2A 4OFZA 3TR8A 3M1VB 1MU2B 3MM9A 2DB1A 4L3KA 3RB0A 3QDKA 2DGSA 4FJ7A 2J0QD 5B08A 1A5WA 1WB9A 5GADI 4F50A 2CNNB 2CZ4A 2DHSA 5DLFA 3Q8QB 4NLYA 3OBYA 2IRXA 4NB4A 1Q9XA 4NRUA 5IT9Y 2DR5A 2QXFA 3U27A 4BC7A 4CJWA 3B6PA 1KONA 4X64K 2J8AA 2HS0A 4EGLA 2DRBA 3ZSQA 3I6PA 2BANA 4IG3B 3NH1A 3G82B 2ACYA 7FD1A 2I5JB 2VPZB 4CZIA 1G3OA 1VQSA 1MROA 3DWLA 4CGFA 1WOPA 1VS3A 1JLGA 5ETKA 4K50A 1A5VA 1RP5A 3R3LA 2KG1A 4JI8J 3PFEA 4PG5A 5A8KA 3GONA 3PEHA 2GZOA 1N32F 5GADU 4KO0B 3V6KA 3D5MA 3BF3A 2FHOB 3EZUA 4OX6A 1VQ6N 1HKGA 1T3OA 1HLUA 2E6LA 4IH6A 4FJLA 3HSCA 4L72B 2AYMA 2A6AA 2BJDA 5LSRA 3ZZRA 3MEDA 1WUUA 5JVGQ 2EXUA 1ZZFA 1PJ7A 3KLEA 1XK8A 4DFMA 5ADXH 1FX2A 2DXEA 3AJDA 2QWLA 1RBSA 2ZHOA 1SJ3P 3M6GA 4CQ1A 2WUSA 2QA4N 1DLOB 3SI6A 3OBIA 8RUCA 3QJLA 4JI5F 3OYAA 1YJWS 1R3NA 2LQ9A 1WNSA 1HLWA 4CO1A 1YAGA 3DRPB 2P9PB 1CSJA 3DYAA 1SH2A 4DSJA 1N5YA 1VHXA 3HHLB 2ZJPL 4OYIA 2C2EA 4H4MB 2XMUA 4RU2A 1LWCB 3R5AA 5C10A 3V6HA 4CBWA 1JLAB 4JHDB 4RKUC 2R7VA 2OMOA 1CG2A 2B9WA 1RTHB 2LVWA 5KFVA 1N88A 3GOIA 3DM2B 1C6VA 3FR0A 3TX0A 2JLGA 2UXBK 2EFGA 1GMUA 3DLRA 1X4DA 4N7TA 5KFJA 2Q1LA 2PDAA 1VQ4S 4NPOA 2DR9A 2O67A 4QPTA 2KI2A 2FIUA 4DTRA 2PD1A 2HFOA 3HZ6A 1RAIB 3ULDA 3U02A 1KC8O 3K5NA 4NL5A 4MKBA 4BHQA 1N32J 2CQ4A 3TJ9A 1F60B 4CD3A 4BWJA 2MLZA 2VJUA 3GYGA 1SKSA 3C6TB 1YI2N 3S9HA 1XTZA 2K3IA 1DHMA 2RT3A 4F7VA 3AH6A 2AKWB 4Q8EA 4KV8A 2WK4A 1VAZA 4C8LA 3POTB 1R27B 2PI4A 4UOHA 4OYPA 2Y8YA 3WIUA 3DOKA 3LP2B 2ZDPA 3R6MA 3E66A 3VN5A 3F2KA 3DCAA 2EFPA 3JB9k 3QERA 1X4EA 3O6QA 1W9HA 4RR5A 5HO4A 4DQQA 1AYEA 4JI5J 3I31A 4RBUA 2FTRA 5IV4A 4DR6K 4ED6A 4ELVA 1HR0F 5CR4A 4EIAA 5E0OA 4E19A 3D1QA 1ATNA 4MFBB 1HJRA 6FD1A 5GAHU 4FJIA 1SI9A 4DUTA 4MQ3A 2IJFA 3EE9A 2ZC4A 5AZJB 4PZVA 3RBEA 4EHTA 3LALA 2GC8A 3J7YU 3CG7A 2M70A 5JLHA 4BGBA 3PLAA 1VQPN 3EJMA 2GV9A 3RGIA 2DTJA 3GJQB 4FBTA 2BM0A 1VOMA 5D4OA 2FZCB 1WC0A 3FZ2A 1IBKF 2RQCA 3PZPA 1R8HA 1RXOB 3SYZA 1VK0A 3M8SA 4LF5F 1FXLA 2XO6A 4FM1A 4F02A 4ZVQB 2GVZB 4FVCA 4DHYA 2VASA 4O55A 2AW0A 2GQQA 1DJ0A 3L3VA 5KFBA 3CCVS 3O4QA 4CJ4A 2JJ4D 2BDPA 2YPYA 1S49A 1TELA 4CH7A 3PSIA 1RTJA 3BBCA 2B0GA 1IR1A 3C3LA 3O4WA 3HKWA