4KFBA

Hiv-1 reverse transcriptase with bound fragment at nnrti adjacent site
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H, EXORIBONUCLEA P66 RT
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-Ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 165
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kfbA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kfbA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kfbA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kfbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kfbA05
4KB7A 2AWZA 5L1KA 4O44B 4DTUA 3DOLB 5KG6A 4NLXA 1S1WA 1T03B 4DSLA 3HL8A 1T05B 2ZKUA 1JLGA 1FXXA 3VQ7A 3V9ZA 3M9NB 4F4WA 2FJWA 4FZXC 4HKQA 1I3AA 4YR0A 4CIEA 3AVFA 2ZD1A 4KTZA 3ZSYA 4W5NA 1U04A 2C2DA 2J6TA 3KMQA 4BACA 3DI6B 5EDWA 3KD5E 4KI4A 3AVLA 3FSIA 4LSNA 2XY8A 1S9GB 2F96A 4CF9A 1WSJA 3UIQA 1S1UA 5DLFA 1S9FA 1NK6A 1KFDA 2X78A 3AVMA 4DLEA 4ED8A 1FK9A 3IN5A 5KFEA 4F2SA 1TQLA 5KFMA 1RTHB 4YP3A 3I0RB 5FDLA 4FLYA 2GV9A 4TY8B 4M3YA 3LAMA 4I7FA 3HPOA 3DLGB 5KG5A 2IM1A 4RZRA 1J9AA 2VA2A 3DOKB 1RBUA 3PVXA 3H08A 4HCBA 4J9OA 2W9CB 3MXMA 4Y1CA 3VQSA 3OSNA 4E0DA 4EO8A 3ITHA 1RTIB 2WK4A 3OS0A 4OPKA 4WZQA 2VG5B 4H4MB 3AO2A 3LP1B 4MIAA 4I2QA 4N47A 2HHSA 3V1OA 3SUQA 4W5QA 2ILYA 3TAGA 3T1AA 3M8QA 4CFBA 3SFUA 3JYTB 1U09A 3RR8A 4URQU 4W5TA 1JLBB 2KFZA 3ISND 4CJPA 5KT4A 1VK0A 4Q5VA 1LW2B 2YKNA 5JS2A 2C2RA 1KLMA 3PHEA 1JLEA 3P83D 4MKBA 2R2SA 3TQ1A 3LAKA 2W42A 5C42B 1KVAA 4ZP9A 4GC7A 3PW4A 1SUQB 3TAPA 3EY1A 3IAYA 3UPFA 3C6UA 2ETJA 2RF2B 3V9UA 4O55A 1D9DA 3Q8SB 2AX1A 1NK4A 4JV1A 3P1GA 1TV6A 4ED2A 4CHQA 1D8YA 3SQ0A 5KRTA 4IG0A 2XGQA 3DLKB 4OL8A 3PUFA 4JLHA 4IG3B 3V81A 3RR7A 3LP0B 4RNMA 3KLEB 2OH2A 5CYMA 4ECZA 4F2RA 4O4GB 4DLGA 3U6FA 5KT2A 4B9UA 1RILA 1TKXA 3MECB 1TVRB 5KG3A 2B4JA 2YNGB 4QWEA 3A2FA 4FZZA 3K57A 4R5PA 2EC0A 5HP1B 2VG7A 4IQXA 4O3SA 1VRTA 4ZPBA 3AVIA 1FKOA 4ED3A 4E7JA 2A1RA 1SL0A 3HVAA 3VN5A 3CIZA 4ECSA 4CEOA 4RW9B 4KPYA 1NKEA 2QK9A 3I8DA 2FC0A 2HNZB 5T7BA 3RRHA 5KFOA 4PUOB 1XC9A 4ELUA 2O5DA 2C28A 4AH9A 1C0UA 5HRSA 1S1XB 2AQ4A 3C95A 2Z1JA 1TAUA 1EP4B 3HO1A 4M3WA 3WNEA 4KKOA 4RUCA 4FM1A 3PX4A 5FRMA 4RNHA 1N6QA 1B92A 3IRXA 3Q8RB 4NYFA 2R8HA 4B9LA 4IH7A 2G8UA 4RW4B 2HHTA 3RWUA 1HQEB 1A5WA 4BE2A 1UOCA 1CLQA 4FJXA 1IKYA 5D3GB 4ECQA 3EYZA 4QAGA 4PY5A 1IKXA 3OYNA 2WTFA 1REVA 4ZHRA 2RPIA 3MFHA 4DU1A 2JEGA 3M8PA 3VA0A 2E9TA 3MEEB 5J2QA 2FJXA 1I39A 3TAFA 4QWDA 1VRUA 3IG1A 3VQ5A 3SQ2A 3CFRA 5F8GA 3BSCA 3CVKA 1LWCA 4RW7B 5KFBA 3M8RA 3T5JA 1NK5A 1HYZA 2Y1JA 1WSEA 4AHCA 2D7SA 4TXSA 3AVKA 4NCGA 2HAIA 4LQ9A 2OPRB 3PW0A 1NOYA 3TVKA 1S10A 1S1WB 2RDIA 1NNDA 4CHZA 5KFAA 5KFTA 2IS3A 1RTJA 3AVCA 3CQ8A 3PW5A 3K58A 3LWMA 4JS4A 1RCHA 1O1WA 5HROB 5KFNA 3ZSVA 3MEDA 1Z26A 4KHRA 1JLCA 4F4ZA 1MU2A 3AV9A 2YKMB 3LP3A 2KZZA 3SJJA 4DFMA 1S1TB 4LSNB 2OPQA 1L3VA 3MR6A 3QERA 1CXQA 3AVBA 2IAJA 1RDDA 2FBYA 1S1UB 4TYAA 5C24A 4HVJA 3SI6A 3NL0A 2ZE2A 5KFJA 4XPCA 2J6UA 1ASWA 2AX0A 4IR9A 1RNHA 4KB1A 3UDLA 4KHSA 1Y97A 4RW6B 3KJVB 4B3OA 1KVBA 5DG9A 4IFVB 1MMLA 4KHNA 1RBVA 1NHVA 5DG8A 1SL1A 2AGQA 3ZSQA 4QWBA 4G1QA 4PQUA 2BQRA 4IRDA 3AA5X 4FJHA 5I3UB 4CEZA 1UA0A 2Z1GA 3CWJA 2IJFA 3HSTB 4JUZA 4KV8B 3KK3A 4DG1A 4I2QB 4H54A 2ALZA 1OS5A 4FXDA 4CJFA 2CJQA 1X9MA 3OYBA 3HYFA 3UQSA 3V6DA 4DQPA 1WN7A 1R0AA 3QO9B 4CIGA 1XI1A 3I5AA 3SV3A 4DS5A 3SUPA 2RDJA 4TY9A 4J9LA 2Z1HA 1RT7A 2UVUA 2B6AA 1EETB 3L2UA 4JV2A 2I1RA 1S49A 1S6PA 1JLFA 4LY7A 4Q45A 5KFXA 1BGXT 2QE5A 3OHBA 3AVAA 1DTQA 2GC8A 5DQHA 3OL6A 1CSJA 2XWYA 1C1BA 4FJLA 4WFZA 3NH1A 3E51A 5C25A 4NLWA 3QGGA 3OYIA 3NAEA 2HNDA 4IG0B 1JXLA 1SKSA 1RYRA 5J2NB 4Q0BB 3V81B 1N5YA 1S5JA 2HW3A 1NK8A 4DFKA 4IFYA 3NGIA 4Y34A 3AO1A 4H4OA 3K5MA 4CEEA 1D1UA 3OYLA 2BRKA 4ELVA 3NKYA 2BQUA 4CJVA 3B6OA 4KREA 3DM2B 4CJSA 4DTOA 5KFPA 5I42A 1SV5A 4WXOA 3ZT2A 1S1VA 2OPSB 5F9NA 5KFUA 4HCCA 1FKOB 1HPZB 3VQ8A 4CF0A 4DTXA 3N6LA 4IBNA 1NJXA 3WNHA 1S6QA 3F73A 5F8LA 3QIOA 2E9RX 1QSYA 1QHTA 1TP7A 4C8OA 2D41A 4DQQA 3QIPA 4FYDA 1JLAB 1JXBA 4E7LA 2YNFB 3OSPA 1NOZA 4K4TA 4ECTA 4M42A 3SI8A 2X6NA 3DRPA 2IA6A 1JIHA 4ZVFA 1T7PA 3OY9A 1QE1A 2UVVA 4GC6A 3FQLA 1ZYQA 4EP4A 4FLUA 3CO9A 4K4UA 1VSIA 2ZQBA 2E6MA 3GIKA 4M3UA 5DQIA 5C5JA 3H4DA 3NHGA 5KGXA 4ECWA 2FBTA 3FQKA 3L2QA 4EZ6A 1IKXB 1FKPA 3OYMA 2BANA 4KO0B 2YHAA 3M8PB 3ASMA 2ASDA 3KOAA 4FZYA 1XWLA 4W5OA 1N4LA 5DK5A 1X1PA 5J2QB 4CHPA 2XY5A 2XI3A 5JS1A 4ZTFA 2ASJA 1C1CB 3IG1B 4NLDA 3NFAA 1TKZA 2HMIB 4KBIA 3EZ5A 4BWJA 3KHHA 3T19A 1GX6A 3I0SA 3TI0A 3QNNA 3ZSZA 1J5OA 4NCGB 3IS9A 5F8JA 1WAFA 4E7KA 2QKBA 1TKTA 4LSLA 4ED1A 3KLHA 4CJUA 4ZVGA 1WLJA 5KFGA 3MEDB 5KT5A 1D0EA 2ITGA 4ED0A 3ZT3A 4WZMA 4NCAA 3PJXA 4OPJA 3NH2A 3RMDA 4DU3A 4DTSA 1Q8IA 3THVA 1RA7A 1BCMA 3LWLA 2E6LA 4DSKA 5KFDA 4W5RA 5JXSA 1X9WA 1SH3A 2HHWA 2IAJB 4GMJB 3TWHA 3QETA 4JRQA 1HYSB 2YNIA 3HPGA 2E4LA 3V6JA 3BQ0A 2IMWP 3OYDA 1RT4B 4YR3A 4MK7A 1XR5A 3MR5A 4AHUA 3PJWA 4N56A 1UA1A 4Z4GA 2G8IA 3NBPB 1XHXA 1BQNA 4ZP7A 3DLHA 4M41A 4Z4CA 1N56A 1KSPA 1SKWA 4DL6A 4RG8A 2HB5A 1LW0B 1QUVA 2W7OA 2PYJA 4MQ3A 1SL2A 3D45A 4BDYA 4TSXA 3BJYA 1HARA 3WNGA 1BI4A 4I2PA 5F8HA 1IKVB 4O3OA 4QWAA 3PO5A 2DTUA 5HRRA 4FW2A 5KG7A 3DLEB 2FVPA 1RTDA 4DTPA 1S4FA 4TN2A 3EZUA 3KK3B 5KRSA 2UVWA 4MK8A 5J2MB 4J9KA 5KFYA 4MK9A 3SV4A 3V4IA 3QEIA 4CJLA 3QEXA 3PO4A 4E7IA 3V1RA 5L9XA 3CG7A 4CHOA 1XR6A 1GOCA 2QKKA 3S3OA 1BQMB 4AHTA 3HJFA 1YTAA 2FBVA 5EWFA 4TQSA 1JLQB 2C2EA 3PV8A 3MF5A 3AO4A 1D5AA 1RT7B 1ZBIA 2B6AB 3SQ4A 3KK2B 4O3PA 4WE1B 4KHUA 2C22A 5HBMA 4J2BA 1RDCA 2XHBA 4LH5A 2P1JA 1VSJA 4CJ3A 5F8IA 4DF8A 2AGPA 3T5LA 4OKJA 2JGUA 5KI6A 1Z4UA 3ZSRA 3QINA 3NF6A 3I5BA 1HNVB 4H4OB 3VQ4A 5E41A 3C6TA 3AA4A 2RKIB 3AVGA 4PWDB 1TK0A 1WSGA 3SUNA 4DWIA 2VA3A 4QW9A 4PA1A 2GBZA 4CEBA 3DRRB 4OKKA 5J1EB 3TAMB 1RT3A 3BREA 1TL1A 5I42B 1SV5B 1Q9YA 3CJ3A 2WHOA 3I5CA 2FLNA 3RAQA 1LAWA 3MTKA 4ELTA 3B6PA 3MEGB 1EKEA 1KHWA 4ZPCA 2YNHA 3GV5B 3H59A 4NLUA 4ICLB 1WNEA 3DRSA 4KRFA 3HP9A 4CIFA 4CGDA 3DRPB 3GIIA 3TAEA 2P51A 3EPGA 4B08A 1IG9A 2XY7A 4FJ8A 4BDPA 4Z4FA 2AJQA 2HHVA 5KG4A 1DLOA 4YNQA 4DSJA 2FVCA 4CJ5A 4MFBA 3O4QA 4IDKB 4FJMA 3H5YA 2G8HA 2J6SA 2BANB 5J2PB 3BSOA 2GIRA 1B9DA 1T94A 1ZBLA 2R8JA 1LV5A 1C1AA 4RNOA 3ZSOA 4AILC 5KTQA 1VSMA 1RT6A 5KFVA 2OZMA 4KTWA 1JKHA 3I0SB 2WONB 2V4QA 5SZTA 3UR0A 1J5OB 3CDUA 3KIOA 4IRCA 4FJ7A 4ZTJA 2W9BB 2G8KA 1TKTB 3H5UA 1QSSA 4IH6A 1TK5A 1S9EB 4RW8A 2B5JA 3NCIA 5KT3A 3KLIA 1TK8A 3L2WA 4JV0A 2D5RA 4Y3CA 4IRKA 3E01A 2VG6A 1C0TA 2R2RA 5HLFA 4KTQA 4B9SA 4CECA 4YMEA 3NGYA 4ED6A 1RT5A 4B9VA 3L3UA 4OLBA 4RUAA 1JLGB 3HVTA 2AU0A 1Q9XA 4CFDA 1SH2A 3OLBA 3QEWA 2G8WA 3SNNA 1IH7A 3OL9A 2ATLA 1RT1A 2ZD1B 2FVQA 4DL3A 4NRTA 1TL3A 4NLOA 1WSHA 4ECYA 4WFXA 3S3NA 1W0HA 2ATQA 4FLTA 2BE2A 5KFHA 4DL5A 3V1QA 4FW1A 3KHGA 1HMVA 4N41A 1S0NA 3D0PA 1ZETA 4RNNA 3ZSXA 3NDKA 4O44A 3DOLA 2NUBA 2P5OA 3H4BA 1FK9B 2BQ3A 5KFFA 3T3FA 1T05A 3QYYA 4EBCA 4I2PB 3ZCMA 5KGWA 5FDLB 3HT3A 4LD0A 4B8AB 3LDSA 1RTDB 4I7FB 3H5XA 3TABA 2XCPA 4QW8A 2IGIA 4KI6A 4CK3A 4NYNA 4DSIA 3TARA 3F9KA 2IDOA 1LWFA 2BDPA 1G15A 1BCOA 3AA3A 2HVHA 4ECUA 1HRHA 1S9GA 3VA3A 1L3UA 4DTMA 3MR2A 3ITHB 3AVJA 4CEQA 3DMJA 1YTUA 3LP2A 1WSFA 3TAQA 3G6YA 1IKWA 5KT6A 3OLAA 1LAVA 4E7HA 4E19A 1RBRA 3M8QB 4FM2A 4HYKA 2D0AA 3OYGA 4URGA 1RTHA 3I0RA 3S3MA 4ECVA 4L8RB 2FBXA 2X74A 4Z4IA 4BWMA 3VQBA 3DOKA 1HQUA 2YKNB 2W9CA 1KLMB 4KE5A 3RB4A 1JLEB 5KFQA 3P5JA 5KFKA 3KD1E 4F4KA 4NRUA 1QQCA 1U49A 4R8UA 4Y1DA 4H4MA 4ID1A 3U3YA 3G6XA 3AO3A 3LP1A 2HVIA 1IM4A 3SFGA 2WOMA 3NE6A 3C6UB 2W8LA 4C8MA 2O4GA 3HM9A 3JYTA 4Q44A 1TV6B 1VSDA 3RMAA 4FLVA 2EX3A 1QSLA 3HPHA 2LSNA 1T3NA 3GV8B 3RMCA 3K59A 4CF2A 1TL1B 4CGHA 3CDEA 1JL1A 5CYMB 1L3SA 4FLXA 3VQDA 1TKXB 1NK7A 3DLBA 5CYQA 4CF1A 5C42A 4FK2A 3G0ZA 4R5PB 2YNHB 3K2PA 4FJIA 2XGPA 2VG7B 2AGOA 4NZ0A 3DRSB 1RDBA 4DL4A 1VRTB 3SPYA 2IBKA 4CFCA 3C94A 3CFPA 3OYKA 3WNFA 1B9FA 4Y2CA 4YQWA 4CJKA 1KCFA 1GOAA 4F4XA 4GVMA 5HRNA 1C0UB 1TGOA 4FJNA 5KFWA 2YHBA 1EXQA 1DLOB 3KLEA 5KFIA 2HNYA 4EYIB 2IJNA 4MFBB 3T5HA 4KKOB 3NGZA 3KLFA 2XI2A 3O4NA 4ZMMA 3MECA 1TVRA 3SZ2A 3GILA 1WSIA 3NH0A 1N6QB 4K4XA 4NLGA 2YNGA 3D28A 3IRXB 3DLRA 5HP1A 4E89A 2A1SA 3HK2A 2ILZA 2IC3A 4DTJA 1JL2A 3N6MA 1L5UA 1IKYB 4RW9A 2KTQA 4DFJA 3OL8A 4FS2A 2HNZA 1REVB 4PUOA 1RT6B 5KFCA 4ZHRB 3V6HA 3M8SA 3Q8QB 3ZT0A 3Q8PB 3H5SA 4OGCA 4NLVA 4IKAA 1S1XA 2XY6A 4M95A 4O0IA 4U7CA 4Z4HA 1EP4A 3SQ1A 2R7YA 5KFLA 4RNFA 4KB0A 1VRUB 3PW7A 5F8NA 2WRMA 2R8GA 3HHKA 3CJ2A 4ECXA 2JEJA 2YV0X 1LWCB 3H40A 2B5JB 1A5VA 3VQAA 3ZT4A 4RW4A 1UWBA 3BSNA 4FK0A 1HQEA 4CF8A 2GIQA 5HLFB 4CK1A 2R8KA 3TANA 1RTJB 4DL7A 1KFSA 1RT5B 3VQEA 3HVTB 2D3UA 3IGVA 5K14A 3OVNA 3MEEA 3OYHA 3HXMA 1JLCB 3RTVA 1RT1B 1MU2B 3IGNA 4KHYA 2DPIA 1TL3B 2XO7A 4C8KA 1J54A 4NLSA 4J9MA 4CERA 1ASUA 4FLWA 2WCXA 4Y2AA 1NKCA 2OPQB 3BGRA 4RW7A 4IH5A 4J9NA 4ZPAA 5KFRA 1EX4A 1RDRA 4H8KA 1HMVB 4ID5A 1RBTA 1S97A 4J2EA 5C24B 4K8ZA 4EYHB 4HHTA 2OPRA 2FLLA 1JX4A 4NLPA 2ZE2B 1N48A 4TLRA 2IOCA 3O3GA 4CCHA 3KHRA 3OHAA 4B3OB 4JS5A 5HROA 3G86A 4BE0A 4K4SA 2YKMA 4CJEA 3OYJA 3OYFA 2Y1IA 1LWFB 2XCAA 4G1QB 1S1TA 4EO6A 4PQUB 1C0MA 4K4VA 1KVCA 3DMJB 4J9QA 3LP2B 1W25A 5JUMA 3MFIA 4AHVA 4DG1B 1IKWB 3OS2A 3AVNA 3QESA 1F21A 1VSHA 2OPPA 2IM3A 4NLQA 5KG1A 4TQRA 3PW2A 4RW6A 3KJVA 4K50A 3QLHA 4IKFA 4CK2A 4IFVA 3V6DB 1R0AB 2VWKA 4O3QA 1HQUB 4QOZB 4DQIA 4DSFA 2X6SA 5L1LA 4M3ZA 5I3UA 3FDSA 4FM0A 3AVHA 3PX0A 4CJRA 4O3RA 1S48A 3CYMA 4M94A 4R8UB 3LPTA 4KHWA 1S6PB 1IO2A 4KV8A 2QV6A 1YT3A 1JLFB 4N76A 2JLEA 3CM6A 3OYAA 4HTUA 3MXJA 3NF8A 2WOMB 1X9SA 4NLRA 4KSEB 3BDPA 4QPXA 3KMSA 1DTQB 1BIZA 1CXUA 3LPUA 1C1BB 5C25B 3V9XA 2HNDB 4J2DA 4CEFA 2RN2A 1CZ9A 2DFHA 4AHRA 4FJJA 2P5GA 4OJRA 1N5YB 4NLTA 1XR7A 3QO9A 4UQGA 1YVFA 3N6NA 4IFYB 3MXIA 4E1MA 2KW4A 5CZ2A 3HKWA 4OVLA 4CHYA 3JSMA 4KHQA 2XRIA 1ZBUA 1EETA 4DTRA 3LANA 4K4ZA 4JRPA 5CYQB 1XHZA 2G8VA 2CKWA 1RT2A 2HHUA 5KG0A 4OGEA 4B9TA 1S1VB 3PR5B 1ZTWA 4F3TA 2D3ZA 4TYBA 2HWIA 5KFZA 2Z1IA 3TR8A 1DTTA 4F50A 1S6QB 3GQCA 5J2NA 4DU4A 3KTQA 3QIPB 3OYCA 2BR0A 4Q0BA 2HNYB 1NK9A 1BIUA 3L3VA 3KLFB 1C6VA 1K6YA 1UAXA 3G6VA 5CZ1A 4K8XA 3ICLA 1RAJA 3DM2A 1QE1B 2JEFA 4O5BA 4IR1A 4FS1A 1LWEA 5DLGA 4Q8EA 1T8EA 4WYLA 2IC3B 1C2PA 4ZPDA 2OPSA 4AHSA 1VSKA 4F8RA 1HPZA 3DYAA 2KZMA 4BDZA 5EU7A 3KLGA 5F9LA 4DF4A 2DPJA 1FKPB 5EWGA 3MAQA 2VWJA 4E1NA 5T14A 1U45A 1JLAA 3D5MA 2YNFA 4BE1A 2I5JA 4I9QA 2R8IA 3NMAA 5L1JA 4K4WA 4CHNA 3HP6A 4FLZA 1VSFA 3CJ0A 2ASLA 4CGIA 1TKZB 4EBDA 4B9NA 4C8NA 3KHLA 3PY8A 3QZ7A 2R2UA 1UWBB 1RYSA 3IS9B 2W8KA 3CDWA 4HUFA 1WNSA 3KK1A 1NHUA 4YR2A 3NF9A 1RDAA 4LSLB 4KFBA 3KLHB 2BRLA 1ASVA 4NLYA 2HHXA 4KO0A 2BGGA 2F8EX 5DGBA 3L2VA 1HNIA 5K14B 4FJ5A 3NF7A 1S0OA 3V9WA 1C1CA 3CM5A 2KFNA 3KKSA 4XO0A 5KFSA 3RAXA 5SWMA 2HMIA 2IM0A 3O3HA 3QIDA 3BGRB 4HUEA 3FFIA 2D0CA 3OJUA 2JC1A 4ID5B 4ZP8A 2YNIB 4MH8A 4GW6A 4RU9A 1NJZA 5FROA 4M3XA 4F4YA 4FBUA 1HYVA 1KLNA 1KTQA 5EUHA 3MR3A 1W9HA 4K4YA 4EZ9A 4DL2A 4QWCA 2W7PA 5HRPA 1RA6A 3NGDA 4E3SA 1BQNB 1VSEA 3G10A 2KQ2A 1S0MA 3OJSA 1SKRA 1KRPA 2OA8A 1QS4A 4FJKA 3RMBA 3AA2A 1NKBA 3SPZA 1T03A 1TAQA 1K1SA 1BI4B 4Q8FA 3OYEA 4CGFA 4DMNA 3ISNC 3T5KA 2FJVA 1NJYA 1HYSA 3RB0A 4ZVHA 3ZSWA 4M3TA 4ECRA 1K1QA 1RT4A 2UUWA 3DI6A 3BQ2A 1WAJA 2OPPB 3V4IB 4FBTA 4XIUA 1QAJA 1GOBA 4CFAA 3NBPA 4O0JA 3QLHB 4B8CA 3AO5A 5F8MA 4R0EA 4ZP6A 4MKAA 4CESA 3U3GA 4O3NA 4M3RA 4F3OA 1LW0A 4WFYA 3PZPA 3M9MB 1CZBA 3EPIA 4CJWA 5EWEA 2V9WA 1U48A 2OZSA 1IKVA 4DQRA 3ZT1A 4XPEA 3VQPA 4TY8A 1TKDA 3DLEA 2V4RA 2O4IA 3HVWA 3H2LA 2R2TA 3LZIA 4J9RA 4O4RA 3DLGA 4FJ9A 3S9HA 2WB4A 3K5OA 4CEAA 2B43A 3QNOA 1D9FA 5J2MA 3RRGA 5CY4A 4DTNA 4FK4A 5HBMB 2UVRA 2Q3SA 2GUIA 4DSEA 3QZ8A 5DMRA 2D0BA 5L1IA 3K5NA 3RB3A 3ALYA 1RTIA 1Z25A 3L8BA 1U4BA 3VQQA 2JC0A 2VG5A 1BQMA 4CJ4A 3LZJA 3SCXA 2F8TA 1JLQA 3C6TB 1KHVA 1NK0A 4QCLA 4FCYA 3SUOA 3L2RA 3JSMB 1JLBA 2IM2A 3KNAA 3KK2A 1JXEA 1BL3A 4LH4A 3GV7B 4Z0UA 2PYLA 1LW2A 4WE1A 1RBSA 1RT2B 1RT3B 2DFFA 1QAIA 4DS4A 3BQ1A 1I6JA 3NAIA 2EHGA 1GX5A 2V0NA 1U47A 2OYQA 4FJGA 1ZTTA 3OS1A 3RB6A 4J2AA 1DTTB 1YVUA 2HWHA 3RBEA 3CJ5A 4CEDA 4J9SA 1SUQA 4KAIA 4CGGA 4M45A 3PR4A 1HNVA 4X2BA 2RF2A 3PX6A 2RKIA 4PWDA 3H98A 5FRNA 3V6KA 3QEVA 1BISA 3SYZA 4J9PA 3CJ4A 2PY5A 3RBDA 4NYZA 3DLKA 3DRRA 3VQ6A 4IG3A 5J1EA 3TAMA 3LP0A 2E9ZA 1LWEB 4LQ3A 1SH0A 4CE9A 1L3TA 4OKEA 4O4GA 3DYAB 3KLGB 1ZBHA 3ULDA 2FVRA 3VQCA 3LALA 1HJRA 3MEGA 4OLAA 4N5SA 1ITGA 4DFPA 4EP5A 5DGAA 4ICLA 3O3FA 5DG7A 2I5JB 4CGJA 1ZBFA 4DQSA 3QGIA 3KKRA 4ED7A 4ZVEA 3FRZA 3GYNA 4B9MA 4EBEA 5KG2A 2DFEA 2XC9A 2FLPA 3BSAA 1A5XA 2G8FA 1JKHB 3NAHA 4IOBA 1NJWA 4MIBA 3GIJA 1QTMA 3CFOA 3DDKA 3M9OB 1BHLA 4IDKA 2JEIA 1J53A 3KK1B 4NCBA 4KFBB 3GIMA 5KT7A 4DEZA 3HVRA 3VQ9A 5J2PA 4RW8B 4EEYA 2PZSA 1HNIB 3BR9A 4CJTA 3KLIB 3QGHA 4URSA 4C8LA 3E01B 4WXWA 2VG6B 2UUTA 4CJQA 1C0TB 5D3GA 2HHQA 3V9SA 4YFUA 4WYWA 5DQGA 4KAZA 4FVMA 1VSLA 4I9LA 3FFIB 2W9AA 4Z4EA 3QEPA 2WONA 3KLVA 4G3IA 3OL7A 2F8SA 4HUGA 2W9BA 2FVSA 4U6PA 2QXFA 2BE2B 4Q43A 1S9EA 3K5LA 4KHMA 2DY4A
chains in the Genus database with same CATH superfamily
1LK5A 4KB7A 4I6MB 1J5EJ 4O44B 1U25A 1VS3A 3MN7A 5KG6A 5E26A 4NLXA 4ID8A 4DSLA 4KR0B 3QDKA 2ZKUA 3W60A 1FXXA 1NH7A 3MMVA 3TEGA 4FZXC 4HKQA 4YR0A 1Q5VA 4AQYJ 3ZSYA 1U04A 4DCPB 2EFNA 5EDWA 3FSIA 4LSNA 4OFZA 3C65A 4PYAA 4E98A 2DGVA 2GFFA 1NMEB 1S9FA 1X0FA 2FC9A 3QT5A 3J80U 4BG9A 4CH0S 1QAXA 3AVMA 4ED8A 3O1WA 1VQKN 1YKWA 2L9DA 2XZTB 3I0RB 1N88A 1MW7A 1A7GE 2DT9A 7FD1A 1IBLJ 4TY8B 2GV9A 4FLYA 1VISA 3LAMA 2JWNA 3T6JA 2EKYA 2LDIA 1CJVA 2IM1A 1J9AA 4LBPA 5HL7Q 2JWKA 2GZOA 1F6TA 4A8MP 3VQSA 2DEJA 1T9VA 4OV1A 5L9NA 1M1KO 5B8HA 4EO8A 4DUZK 1RTIB 3S8SA 2QWQA 4WZQA 4H4MB 3AO2A 1M5OC 3LGMA 5A0YB 2Q1LA 3LH2S 1T9WA 2EK1A 4W5QA 2PIIA 1C0FA 3JYTB 4A2AA 5IWAK 2DNHA 2OEJA 3A5NC 3CPWR 1VK0A 4MAKA 2EXUA 6FDRA 5JS2A 1TL7A 2UXDJ 3EXYA 4YHHJ 2ZFHA 5IQ6A 2X3GA 5ETRA 1JLEA 5CHCB 3P83D 2DH8A 3P3DA 1FDAA 3JSYA 4PXCA 3LAKA 5BXIA 1YRTA 5C42B 3B78A 4GC7A 3NCRA 3PW4A 2DGXA 5ITHA 3V9UA 4JYAJ 3FKBA 4O55A 1D9DA 1QQMA 5F0UA 3P1GA 3HMJG 1D8YA 2BYCA 2WB1D 5KRTA 4C9DA 3CIMA 5D4LA 2VFVA 3PUFA 4OYXA 4IG3B 1F3VA 1WI8A 3VHQA 2Z56B 4RNMA 5CYMA 3AT1B 3UE5A 1V3ZA 2PMHA 4ECZA 4O4GB 3U6FA 3FEYB 1MROA 1WC1A 1MMDA 3PXGa 3PLAA 2V67A 5EGYA 2DNQA 2YNGB 2AJ1A 3MUMP 3RZAA 4CO1A 4IQXA 2BH1A 2PD1A 4PZVA 4O3SA 2P9PB 1XERA 2DK2A 4DL0C 2A1RA 3HVAA 3CIZA 1NKEA 4OHYA 4LF7F 2QK9A 1MA9B 3CD6S 5T7BA 5KFOA 1XJWB 1WOSA 1HHTP 1B0TA 5LJ5Y 1R31A 3O5TB 5A2QY 3C95A 3SQGB 1EP4B 3HO1A 4NLBA 4M3WA 3WNEA 4KKOA 4RUCA 3PACA 2W4CA 3C7NA 4RNHA 5T41A 2A5XA 1B92A 3G4SN 1ILYA 3IRXA 2AF6A 2QA2A 2QSFA 3W2WA 2KVIA 2CDRB 4IH7A 2HEKA 3H8YA 3RWUA 2W41A 1A5WA 3CJCA 4KPCA 2JHEA 3TSUA 1D4XA 1WACA 4QAGA 1TUVA 3C2PA 1IKXA 2M8DB 1REVA 4ZHRA 2RPIA 4DU1A 3M8PA 3M6XA 4DUYF 4BVPA 3OBYA 2AEMA 2FJXA 1NDPA 4HH0A 3CCES 4YY3F 6AT1B 3IG1A 3WXIA 4LREA 3CFRA 5F8GA 3BSCA 5CZVA 5K8OA 3R1XA 4LFBJ 3OTDA 1HYZA 4ZDNA 2COLA 3AVKA 3THWB 4NCGA 2HAIA 2OPRB 4U8YA 4WTOB 1IQZA 4Z7CA 1NNDA 3R8EA 2IS3A 1XNRF 3LF0A 3PW5A 3J8AA 1RCHA 1O1WA 4WU3A 5KFNA 1VQLN 2MY7A 2YKMB 3QSYB 2ZVSA 2XS5A 4P74A 1HBNB 3QATA 3R7NB 2KZZA 4LSNB 2OPQA 1CXQA 1DQ9A 4RUHA 4JKAA 1F5AA 5BR8J 2QFIA 3LDPA 4HVJA 4X65K 3K5PA 3PYEA 2FY1A 4NA3A 3NL0A 2ZE2A 4XPCA 2J6UA 1X5OA 1RNHA 3UDLA 2CH6A 4KHSA 2NXUA 4IO8A 5DG9A 1CJVB 4ZJQA 4DB3A 5DG8A 2AGQA 3ZSQA 4G1QA 3W62A 2O01C 3DHWC 2V8PA 3ZTSA 4CEZA 3LM9A 2Z1GA 3LDNA 1WD6A 3O9UA 4FWRA 2ALZA 2RHQB 4MLHA 5BJRA 4JI5K 1R7IA 2UUBF 1ZM2A 1AFJA 2DNZA 1VJWA 4YB6A 4RX6A 4F25A 2ZOMA 2HYIB 4HTLA 3JSRA 1XI1A 3R9LA 1X60A 2DNNA 3CCVS 3M1FA 4IDHA 1HWIA 5BPLA 1WF2A 4TY9A 2Z1HA 3RSEB 2PA8D 2NPIA 3Q8VA 5JVGL 2J7UA 1RT7A 2O8CA 1RWKB 4DBQA 3HF5A 3OR2B 1IJEB 1RWOB 1JLFA 4Q45A 2CXEA 1WEZA 2QE5A 3OHBA 4DV3F 1DTQA 5DQHA 3OL6A 1C1BA 4NYOA 1VQ8N 3UWTA 1CJUA 1QM9A 4Q0BB 3AJ1A 1G7CB 1NK8A 4DFKA 3VOVA 2E5IA 4M5DB 2WTUA 2QLBB 2FF3B 2BRKA 5B0EA 1MROB 4DV2F 4DCHA 2BQUA 4C23A 2Q43A 4P2XA 4DTOA 3DKDA 2V51B 2LDYA 5B09A 4WXOA 3ZT2A 3GJTB 2EI5A 3ZX2A 3ETMA 4IBNA 1Q1KA 3FLCO 1QSYA 4ETXA 1QHTA 4DQQA 1N52B 3TVZA 1RE1B 2W6KA 4FYDA 4JI3J 4E7LA 4UZCA 2YNFB 1ROFA 4M42A 4ENOA 2I7NA 4EGLA 3TA0A 3C7NB 4JI1J 3TZYA 3FZKA 3G6EN 3OW2R 3THYA 5ETOA 4GC6A 3FQLA 3CO9A 4XH1A 2ZHBA 3U4LA 4WFBL 2W4PA 3VERA 1RDWX 1EHWA 1SAZA 5C5JA 2VOPA 3H4DA 5AQIA 5LL6d 5KGXA 3IWXA 2LXUA 3EE9A 3WXMB 4CD3A 2FBTA 3FQKA 3CCJN 1KQGB 1IKXB 2P6TA 5EVZA 3OYMA 2ZM6J 5C2DA 3M8PB 1UJ4A 4X4NA 4FZYA 1N4LA 1X1PA 1J27A 3KG0A 8ATCB 5JS1A 1VC5A 2GW8A 3IG1B 4NLDA 2B4UA 2EBEA 1NSQA 4A2BA 3MCOA 3T19A 1GX6A 2D9OA 3I0SA 3BS9A 3BR8A 3BGUA 4BRQA 4L75A 4NCGB 5F8JA 3IP0A 1HHQA 3N0VA 4LSLA 4QZVB 1BA1A 2LKZA 2EG2A 1SI9A 5KFGA 3FJ2A 1Q81T 4MO4A 3D6HB 2QWOA 2ITGA 4ED0A 1VQMN 1P9QC 2OKQA 2QA1A 2FD2A 3W0LA 4Y28C 1G1XA 3PJXA 1GLFO 1I5OB 3PYFA 3RU0A 2JFDA 2YWGA 3CETA 2GUPA 1SH3A 3L7UA 1NAQA 4JRQA 3NWGA 3HCXA 3BQ0A 2FJBB 2GMJA 2ZBPA 3OYDA 1ZAWA 4DV0F 4AHUA 2XMKA 2HQGA 3S7RA 2CZ9A 3R6MA 1PILA 3VZIA 1BQNA 1UKUA 3VGUA 1YGYA 2VPYB 5HQ8A 4IOAQ 2MPUA 3AXKA 3BN7A 4NA1A 1DQ8A 4RG8A 1QUVA 1SL2A 4TSXA 2RQ4A 3WNGA 1HARA 4CZJA 2UV8G 1H2UX 3PO5A 5HRRA 4FW2A 1EJ7L 1RTDA 5A8WA 4DTPA 3MAHA 5ETQA 4Y2MA 4TN2A 3JS6A 5FPEA 2UVWA 5KRSA 1OQ6A 3IR5B 5KFYA 2N7YA 2R42A 1RCOB 3V4IA 2HHHJ 4NZ6A 1TYQA 4FPRA 3NWRA 1R8BA 1WC0A 4QBUA 5BN9A 4E7IA 2NLXA 2DY1A 1HNXK 1XMOF 3V1RA 4F04B 5L9XA 1XR6A 3TUIC 2QKKA 1TUGB 3HJFA 2V4JA 1AT1B 2RHKA 4YB7A 3PV8A 3MF5A 3AO4A 2NRTA 1S7HA 1RT7B 1WUUA 3A8KA 4N77A 1XMQJ 1NZ8A 4KHUA 5LMUK 4ZLNA 4DR4K 4J2BA 1RDCA 1GMVA 2R7VA 3EKUA 5CHIA 2P1JA 2HRYA 4CJ3A 1IJJA 1BC6A 2EPIA 2JGUA 5KI6A 4LJMA 2U1AA 3QINA 3DHXA 3VQ4A 3IA0A 1RAEB 3AA4A 2RKIB 3CD0A 4DR7J 4FF4A 4Z2XA 3M3ZA 4ILLA 4DWIA 2VA3A 2E8AA 3TP2A 2YTCA 4UOGA 5I3PA 1Q79A 1VQ9S 4K0KF 1RT3A 4BRHA 1TL1A 4HACA 3CJ3A 2WHOA 2FB0A 1WG5A 3NS5A 1LAWA 3C8YA 1ZAVA 3MEGB 2YNHA 5D0GA 4NLUA 1FWLA 2ZH1A 4WTYA 2Y9HA 2CVEA 2F4VJ 4CIFA 5THWA 1VDHA 3GIIA 3QJJA 2BV3A 2R3VA 3CJKA 4F26A 3EPGA 2F5GA 3GR1A 1NUEA 1R27B 4BDPA 1ZA1B 2XNRA 1Y9OA 3N4QA 4MFBA 1TUUA 3TO8A 3C16A 1QVFM 2FHOB 1HD1A 3H5YA 3D3BJ 4OYPA 3W3DA 2FZKB 2AKWB 1B0VA 2GELA 3BKFA 3D0HE 4GKKF 1SJQA 5D0RA 4ALZA 1C1AA 4RNOA 3ZSOA 1KQKA 2BM0A 3SMSA 3NGRA 4NPOA 1K47A 5BRFA 3M32B 4DOZA 2E7WA 2DNOA 3I0SB 2M4MA 2WONB 2RT3A 5SZTA 2MKCA 3UR0A 3LPEA 2DNGA 3O9RA 2DR6A 4FJ7A 3CMES 2G8KA 3EDRB 1F1BB 4IH6A 4I6YA 3KLIA 5HQMA 1TK8A 1U26A 2D5RA 3PYDA 4P75A 2VG6A 5HMYA 3JAMO 3U1LA 3V5RA 4B9SA 4YMEA 2IVOA 3G82A 2B0GA 1NJIT 3CCSS 3I82A 3QEWA 5D0HA 2E5LK 3AQOA 3EXCX 1TMJA 2ZD1B 3ZXWA 3X1LB 4ECYA 3BGOP 4WFXA 1W0HA 2FJEB 2ACMA 5KFHA 3V1QA 1GLEG 1S0NA 1X4FA 5K8PA 3G96A 4OPAA 5EX5A 2DHAA 3U02A 4BROA 2UZAA 1T05A 5AFUA 3I4HX 1VLYA 2BA9A 4C8YA 5FDLB 5H9EJ 1RTDB 2W1BA 2PAVA 3H5XA 2IGIA 1EO1A 2VH7A 1B3TA 5AQGA 1BCOA 5CA5A 1TYQB 5B0CA 4ECUA 1HRHA 3CJSA 3MR2A 4FWOA 3AVJA 3DMJA 1K0VA 3GDQA 3LP2A 2VQEK 3TAQA 3G6YA 3OLAA 4E7HA 3FGVA 3VAIA 1PGZA 2MDAA 3M8QB 2N3OA 4G9ZA 4H5RA 3MMJA 1NXIA 4P7TA 4B3RF 2FBXA 5HJYA 1OKJA 4Z4IA 3IBFB 1YHQN 2KO1A 3GZ7A 2ASYA 3VQBA 4JI7F 3DOKA 2YKNB 1RAAB 2CZ4A 1KLMB 2YHWA 4DV1J 3OTOK 2RRBA 1R8CA 1M1KT 4LF5F 3V2UC 3KD1E 1QQCA 1YI2N 2RRNA 2BKPA 1VQKS 4ID1A 2V8GA 4UTGA 2B7CB 4CLLA 3M4XA 2ZUAA 1WOPA 4BQLA 4DR2K 4ILMA 1SQKA 3D54A 3OT9A 1HNZJ 3HPHA 2LSNA 3HM8A 4BR0A 2V8DA 5M1KA 4IJNA 3IAM9 1TL1B 4J9UE 4IWVA 4CGHA 1JL1A 4DV5F 3JAMU 4WP3A 1L3SA 1PO6A 3VQDA 1R59O 2E2PA 3O8WA 2C2OB 4FF3A 4CF1A 3G87A 4FK2A 2XS2A 2YNHB 3EUNA 5CZXA 2XGPA 4FWQA 3MMBB 1RDBA 3SPYA 2A10A 3GSIA 3WNFA 3RBXA 4ILRA 1S3XA 2CQGA 4FYXB 1KQFB 5AQNA 4YQWA 2GEMA 2MJNA 1BY9A 2OTLS 2I2YA 4Q2LA 1N33J 4MFBB 3AA8A 1IR2A 3O4NA 5D6GA 1U24A 5AJ3K 4JD2B 1TVRA 3GILA 3NH0A 4K4XA 3D28A 4NWBA 4CRJA 1TELA 1GAOA 2CYYA 1FRLA 2YWHA 2OFGX 4DTJA 1JL2A 3N6MA 4MIWA 4RW9A 4CZEA 4DFJA 5LL6Z 1JWWA 2VONA 2RD5C 1XNQJ 4FS2A 3ZT0A 3Q8PB 1Y3JA 4NLVA 4IKAA 3B4DA 1S1XA 2RQMA 3TTDA 1QZ6A 1S59A 4U7CA 1HJOA 2J7KA 3QRRA 3EEQA 2HBQB 3M05A 2E5HA 5AE2A 2RE1A 1LWCB 3CCUN 4J37A 3H40A 1XK8A 4EFAC 3MN6A 2OO4A 1U7LA 1UWBA 3ILOA 3BSNA 1PBAA 4LFAJ 4A5BA 1NHKL 1XBWA 3TANA 2CPFA 3TOQA 1RTJB 4JI6J 4M5KA 3IGVA 2J8AA 4OHWA 1NNEA 3HXMA 3RTVA 4DR6J 1VHXA 3RYLA 5IOLA 1D8ZA 1VHIA 3TRGA 1ASUA 4FLWA 3VVTA 2WCXA 2NXEA 1NKCA 1X4DA 3BGRA 2O3DA 3K8WA 4IH5A 4EWTA 1V3RA 4LFCJ 2B4OA 4IUFA 4L76A 4EYHB 4HHTA 3ENHA 1JX4A 4NLPA 1UJ5A 5IFMA 2NUUG 4UZBA 1NM2A 5MLCQ 3VGLA 2GVDB 3G71N 5HROA 2HBRB 2HGMA 3HTVA 2KM8C 4JB8B 3CMAN 4LF6K 4PWWA 4DMZA 5EOYA 2Y1IA 3ZEUB 4TU8A 2VDIA 3KG1A 4C97A 1NWKA 3DMJB 4J9QA 4FO0A 4X4UA 1CBKA 2MQOA 3J81O 3LP2B 2CG8A 2YJEA 1FNOA 4DG1B 1HWUA 4WWSA 1JXVA 4CM0A 4PQAA 2RVJA 2OPPA 2EFGA 4TQRA 4OHVA 3KJVA 4IKFA 4CK2A 4IFVA 3V6DB 2ZJRL 1FJEB 2XG8A 3MM7A 3TUPA 2X6SA 4IO1A 2YX7A 1PYSB 4M3ZA 5I3UA 3FDSA 2WVBA 2H5JB 3GIRA 3PX0A 2E1YA 3AVHA 4RTFD 4CJRA 3CYMA 4M94A 4KHWA 2DB1A 5FLXO 5IT0A 3AODA 5CYJA 1CJTA 2Z2YB 2VBZA 3BDPA 3KMSA 1JMTA 3OR1B 1CXUA 1HBOA 2HNDB 4PAAA 1FTRA 5AQKA 4AHRA 1J5EF 1XR7A 4UQGA 1YVFA 2P9NA 3RUBL 2KFYA 3VZHA 1ZM9A 4CHYA 1WTFA 3IMXA 3LTOA 2MKSA 4F9OA 3JSMA 2JFKA 2HBZB 3UE2A 2V2VA 2VF3A 2G8VA 4K2XA 4AQYF 1DQAA 2FPHX 2HHUA 3GJRB 4J91A 2VQFJ 4IZ9A 1CG2A 2EFVA 4CVNE 1ZTWA 4TYBA 3I56N 4RWXA 1H2VZ 3TR8A 4F50A 1RDUA 4JKCA 3MAAB 5J2NA 1BWVA 3QIPB 3OYCA 4MYUA 3MD3A 5AZJA 3NEKA 4X64J 2P9UB 5IM0B 3VESA 2HS4A 1BIUA 1GXTA 1MSWD 3L3VA 1IBLF 2YHYA 4K8XA 2AIRB 1QE1B 4C98A 3BPDA 3DXMA 1VQ8S 4FS1A 5FPDA 3LW5C 3HHDA 3EICA 4F8RA 2VBXA 1N8RT 4WJBA 4ZPTR 2QMUB 3DYAA 1HLWA 5AZIA 1VI7A 5CXTA 2W7AA 5EWGA 3MAQA 4E1NA 4EIAA 5T14A 3FEZA 2I5JA 4KGKA 3MM8B 1UAWA 2HBMA 1RWVB 4KHPJ 5LSLA 4CHNA 4X62J 3DDIA 3AD9C 5C0YA 3IBWA 4F67A 3KHLA 2LEAA 3GR0A 4OYMA 2UXDF 2ZDPA 4YHHF 4AE5A 1UWBB 5D77A 3MX5A 4C0OC 1N54B 1NHUA 3NF9A 1R0CB 2LXFA 1BQXA 2QRRA 3CULA 3NOGA 1N32J 4TVAB 1BMQB 2HHXA 4KO0A 2BGGA 2F8EX 5DGBA 4LF9K 3NF7A 1N36K 4JYAF 1NSKL 3BF3A 3QQCD 3AFGA 1S0OA 3G6ES 3IRWP 3TU5A 1C1CA 3J7ZO 2D74B 4JI0K 3KK7A 3O3HA 2IM0A 1D9AA 1DT9A 3BGRB 3BDEA 4FL9A 1Q95G 3OJUA 4NXMK 1RHUB 4NX9A 1RK8A 3LDLA 5C7PA 3X3UA 1R6YA 5LSRA 2GAHC 3C15A 4GW6A 4DCOB 4F4YA 4QWCA 1H7WA 4ZLJA 1S0MA 2HFNA 2XYPB 4FJKA 1RHMB 4F36A 3QBCA 1TAQA 1O8BA 1NMNA 3ZNJ1 1K1SA 2RS8A 3D4JA 1BI4B 4Q8FA 2G9OA 2B56A 1X4AA 4DMNA 3ZTOA 3EL2A 1NJYA 1HYSA 1KAXA 1PJ6A 4ZVHA 4BGAA 3ZSWA 4M3TA 2BJEA 1RT4A 4MDBA 1WAJA 1K0TA 5GADI 2OPPB 3EZWA 3NLCA 1NB7A 3NBPA 5AT1B 3AO5A 3VEXA 3U3GA 2KLAA 4M3RA 2OSRA 1LW0A 4WFYA 3M9MB 4A8QA 5E0OA 2ROPA 4AL7A 3ZT1A 4UOCA 4DR1J 4NASA 2O4IA 4GO5X 4LF8K 4H0XB 3DLGA 2MSTA 4FJ9A 2P2CB 3CCMN 1QD1A 3EO3A 2UVRA 2YKPA 1NPKA 5DMRA 1H0HB 1X4CA 4LFBF 2Q6CA 2RQCA 3RB3A 1M5PC 2KHDA 3M5RA 3L0QA 1TUWA 3W9HA 1VQNN 2VG5A 4DV7J 3CHWA 4CO2A 3SCXA 4PKGA 2POKA 1EQYA 3UKRB 2F8TA 4EUVA 2P9NB 4DR5K 3CCTA 3C6TB 1EARA 3KZBA 4FCYA 3SUOA 3JSMB 1JLBA 1NPPA 1JXEA 4BQZA 1Y11A 4UT4A 3SK3A 1Y00A 1RBSA 3CT9A 2DFFA 1A0OB 1U8WA 2GV1A 3CPEA 2EHGA 2FTRA 2MQLA 2BJ3A 4A8OA 3RB6A 1BDGA 2PEBA 2E7XA 5BR8F 5TKYA 1BWFO 4GV6A 3UN5A 3PX6A 3H98A 3V6KA 2I7PA 4ZK7M 4WF9Q 2E5GA 2QEXS 1NGCA 3DLKA 2U2FA 3DRRA 4JBCA 1YBUA 1TTHB 3JTOA 2A6AA 4P9SA 1ACMB 1YIJN 3BYRA 3DYAB 1VC0A 3UN3A 5AZIB 5AXNA 4ZJLA 4N5SA 1OWXA 4OMFG 2CFXA 3P96A 1X8DA 5BYRA 4UOFA 1SJFA 2LQ8A 2CQ1A 2I5JB 5DG7A 3O6WA 3EGNA 1ZBFA 3QGIA 4ED7A 2DITA 3FRZA 2A2CA 2XC9A 4KH5A 3AJDA 3BSAA 3IM8A 1JKHB 1NJWA 2DNPA 2V68A 3GIJA 1RWNB 3FC9A 1S22A 2J8SA 4ED4A 4JI2J 3GIMA 4F4AA 4B3MK 2CQBA 5E2QA 5M1FA 4WFAQ 3EGWB 4URSA 4C8LA 3E01B 3U9ZA 4WXWA 3W8PA 2AJ4A 5D3GA 3L4BC 2HHQA 3OXGA 1UTAA 4YFUA 4KAZA 3HKZD 4U8VA 3OUYA 4FVMA 1VSLA 1NGAA 4I9LA 2LA4A 2PE8A 3KLVA 4XAKA 4ZVPB 4D3HA 1QHAA 2EBGA 3C15B 4IO9L 2QXFA 3K5LA 2BACA 1M1HA 4DX7A 2YX1A 2BVZA 3VF6A 2AWZA 2AYBA 4DTUA 2QLXA 1AUDA 3KUHA 3QT8A 2P9GA 2GVZB 1DKGD 3HL8A 2EW9A 4P6QA 4F4WA 4GVLA 4JI3F 2DNLA 3P39A 4ANEA 3AVFA 2RILA 4KTZA 2DIVA 2OEMA 4BACA 1DBDA 4JI1F 1KKHA 1N34K 4KI4A 2XY8A 3D2FB 1UL3A 2NYHA 3GWCA 1BUPA 1HI0P 3UIQA 4CNZA 1RWPB 1WKKA 4CH7A 3CTRA 4O8KA 2N4DA 2CPZA 5M1OA 1RAFB 2X78A 4DLEA 1Z05A 5KFEA 1TQLA 3FBFA 2ZM6F 1AB8A 4YP3A 1K9MO 1ZBSA 3DLGB 5KG5A 2VA2A 5B0DA 3P31A 3PVXA 3H08A 2J9DE 2W9CB 3MXMA 1WC4A 4G6VB 2RUSA 3S41A 3MMCB 2WK4A 3NCQA 4OPKA 4AUKA 1WF0A 2VG5B 3LP1B 5KQ8A 5B7WA 4BR4A 4GV3A 3V1OA 3T1AA 3R5AA 3M6WA 4CFBA 2N7CA 1VQ4N 5GAHI 3W3SA 4H0YB 3SFUA 1U09A 1V3SA 3VGKA 4DUZJ 4URQU 1JLBB 1JCEA 2PFUA 5LSOA 2HVEA 1W2BR 4B3TK 4Q5VA 4KGXB 3HHEA 1IBKK 1FJ7A 1ZOTA 3BPSP 4PRFA 5IWAJ 1HI8A 3TQ1A 2QYCA 2QLFB 2VBWA 2QWNA 4FZVA 5LMNK 3CJQA 2H5EA 1UPPA 3TAPA 3AD8C 3IAYA 3UPFA 3B54A 5B0GA 4P7VA 3Q8SB 2XLJA 1YHQS 1TV6A 4ED2A 2CVIA 3V4MA 3SQ0A 3PKMA 3DLKB 4OL8A 4JLHA 1YG0A 4X4OA 3RR7A 4IXCA 1YI2S 1JJ4A 3ENQA 2ZC4A 3DFEA 4M5IA 2RU3A 3P4IA 3CUNA 1S72N 4MJKA 1T3OA 4F2RA 2F4VK 3A8EA 1RILA 1TKXA 5IZHA 2XLKA 1YITS 2B4JA 1PIEA 3D68A 2V34A 4QWEA 3A2FA 4FZZA 3K57A 3Q22A 5HP1B 3IMQJ 1P8ZA 2HHHF 1FKOA 2XBPA 5GINA 4ED3A 4E7JA 1I51B 2BM1A 3VN5A 4F0HA 2GGPB 3ZETB 3BZQA 4CYUA 2HNZB 2FC0A 3RRHA 1ICEB 1XC9A 5M1QA 2O5DA 3JXUA 4MLEA 1C0UA 4ZVUB 5HRSA 4P73A 1E6VB 2AQ4A 1U1KA 1TAUA 3AXMA 1APSA 4X66K 4OYIA 2HLTA 3PX4A 3D6MB 3MCMA 3KJFB 2X3DA 3GCXP 2JJ4D 4NYFA 3MWTA 2G8UA 4RW4B 2RB7A 2UV8A 2F9TA 2CNNB 4OLPA 1HQEB 2LVWA 1S12A 1IKYA 5D3GB 5MLCV 4ECQA 3Q89A 4USTA 3OUYB 1IBKF 2QMXA 4EHTA 3G9CA 3R27A 2E9TA 3MEEB 3IR6B 1RAIB 1U1PA 2HVZA 2HSEB 4IOXA 4DR7F 1I39A 2FSKA 3QFHA 3TAFA 4PG5A 1VRUA 2E88A 2W40A 1RCXB 5M1PA 5I9EB 2Z4PA 2Y1JA 3EE8A 4AHCA 3SAGA 3PW0A 4L73A 1N0VC 1S10A 4CHZA 3FMWA 1C0GA 3K58A 3LWMA 4JS4A 1B4SA 3GLJA 3ZSVA 3MEDA 1IQTA 2F4VF 1OPIA 4F4ZA 3LP3A 2I38A 3FCWA 3MWBA 3M2VB 3QFUA 1S1TB 5M2RA 5HOOA 2ABYA 4JKGB 4FXWA 3KNGA 1HBMA 1HNWK 4DXLA 3W2VB 1KOOA 3F9MA 5KFJA 4IR9A 5F3TA 5I4MA 4CZMA 3ATVA 2ZGZA 4B3OA 5JMVA 1K8KB 4X65J 2ZOGA 3FFKB 1YJ9N 1RBVA 2P5VA 1NHVA 3FZBA 4ZVRB 2LYVA 2E7VA 1SL1A 3MOJB 2CAJA 3Q8UA 4QS9A 2BQRA 2M7SA 3AA5X 5HVGA 2PI4A 3OBWA 4JUZA 2M52A 1U2RA 4KV8B 1HLUA 2Q97A 3MPWA 4A8XA 1OS5A 3G71S 1UVNA 2NZCA 4FNHA 3HYFA 4ZIWA 4DV1K 1T6CA 3SQOP 2RS2A 4C3LA 2CWXA 1WN7A 1R0AA 4BY9C 3HFZB 4CIGA 3I5AA 4DS5A 2B4VA 2RDJA 4JI5J 1JB0C 4J9LA 3MXHP 2FXUA 5D0EA 2C3PA 3CC7S 5AE1A 3L2UA 3HRGA 2I1RA 2BXJA 1S6PA 4ZA1A 2UP1A 4LY7A 5KFXA 2UYTA 2M5YA 4BRDA 3AVAA 3J81Y 4M5NA 4YOXA 2H65B 3P5TL 5F41A 3QFPA 3E51A 3QGGA 3NAEA 1VYAA 1JXLA 1RYRA 4LMZA 2HW3A 1RSCA 2ZWOA 3NGIA 1HL6A 3OVSA 3B4MA 3K5MA 4CEEA 1D1UA 5GAGP 3NKYA 2HOEA 4CJSA 2PC6A 1TMMA 3BGFA 3ZO7A 5FLXY 2J0SD 4UY8O 5F9NA 4HCCA 5BR9A 1FKOB 4JN4A 3N6LA 4X84A 3GE1A 2CQPA 3WNHA 3F73A 5F8LA 2E9RX 4CYUB 5AQWA 2O8DB 4C8OA 2DNRA 3CPWM 1JLAB 4K42A 2FLOA 3OSPA 2AJ0A 3MPVA 4ECTA 3SI8A 8AT1B 1FX4A 3C19A 3OY9A 1KDNA 4S0MA 3I56S 1ZYQA 4FLUA 1VSIA 3QGPA 2NRXA 3T1YK 3K0SA 3GIKA 4M3UA 4DV1F 5DQIA 2MLZA 3NY0A 1GXUA 4NEYA 2VV5A 4EZ6A 3L2QA 3C6AA 2BANA 2E1ZA 2VODA 1VQ5S 3BBCA 2CQCA 3ASMA 2ASDA 1XWLA 5JLFA 4FKYA 2W2QP 4JK8A 1U2FA 1FT8A 2XY5A 3D6RA 4JKHA 4LFAK 3IXQA 1VIXA 4LRAA 1GLJO 3EE3A 4WQ4A 3L95X 2DH7A 1TKZA 2HMIB 3EZ5A 4NZ7A 1U0HB 3KHHA 3NGUA 3SBGA 3ZSZA 1J5OA 4JV5K 3IS9A 2LP4A 5AQYA 4ED1A 3KLHA 2M9KA 5ELZA 1VFJA 4GVBA 4PCQA 3MM9B 3DXSX 5CD4H 3O9TA 3MEDB 2V52B 2XNQA 4OIXA 1D0EA 5D15A 3O4WA 4CLKA 3A1YG 1BOTO 3ZT3A 2EC2A 1WKJA 2OIHA 4BRCA 3J7ZT 4NCAA 1TZ0A 3THVA 1IG8A 4DSKA 2E6LA 4W5RA 5JXSA 2ZH9A 3TWHA 1U1LA 2A0FB 3QETA 4DPUA 1HBMB 1EAYC 3ZC4A 3L3CA 2YNIA 1N33F 3MM6B 4W98A 2WFBA 2IMWP 2Q79A 2N3LA 4MK7A 1ELOA 3MR5A 2QLJB 4N56A 5GIOA 4TNOA 1UA1A 4BC2A 4KGZB 5GMDA 4MKYA 4M5GA 2C2NA 4W90B 2CQ3A 1OYDA 4MQ3A 2XMAA 1XNQF 3BJYA 2IIHA 1IKVB 1XIQA 4QWAA 1QDUB 2GHVC 3T1YF 2HFVA 3UDVA 3EZUA 1XTZA 4HDGA 2DRAA 2BABA 3K9JA 3CF5L 4KH0B 4BR2A 5J2MB 2IVMA 1YXQA 1E4GT 3VAMA 2EEYA 4CLSA 3PO4A 3PEHA 1S6UA 2MSSA 2UUCK 1GOCA 3S3OA 4LFAF 3HSJA 4AHTA 3TZZA 3DRXA 1P1TA 4TQSA 1JLQB 3BV8A 1O13A 2ASMA 2QA4N 4JI6F 2PGCA 4HEA9 1ZBIA 1Q82O 2XEXA 1V4TA 3MUVP 1HNXJ 3KK2B 4ES2A 4O3PA 1LOUA 4FPAA 4OZJA 2VFUA 4DR6F 5CQGA 1YK9A 3FVYA 4JKDA 2JRSA 4F3QA 3S01A 1WC5A 2AZ1A 5HBMA 4I67A 1X9JA 3TZXA 2LLZA 4LH5A 1VSJA 1Y64A 3QAUA 1DARA 4LFCF 4LR9A 2GWKA 2O8FA 2YVSA 5ETSA 3MX2A 4DF8A 3T5LA 4O8UA 5LMUJ 2ASOA 1VRQC 4DR4J 3W9JA 3NF6A 3P4UB 1E6YA 2DHSA 2W2MP 3H2VE 1SQEA 3AVGA 3DNCA 3CCMS 1M5HA 2B51A 3SUNA 5FD1A 3R97A 1OO0B 2GCFA 4XEIA 4OKKA 5J1EB 3MGJA 2YWKA 3TAMB 1VBKA 2YQ1A 1VQNS 2BJDA 2E1AA 2K3IA 2FLNA 3RAQA 1X4HA 3AOCA 3GJSB 1RAGB 3B6PA 4CLPA 2ZGYA 1EKEA 3GV5B 3DLJA 1FVSA 3DRSA 4ZKAA 4KRFA 3HP9A 2R7QA 4FF2A 2DPNA 5JICA 2P51A 1K8AT 1PG5B 1I94K 2UXBK 4B08A 3S1TA 1AZSA 1SJ4P 1O0PA 1OSDA 4CJ5A 4FWPA 2BX6A 5D4OA 4KHPK 2DHHA 4X62K 3VGSA 3CB4A 2BANB 3LO3A 3BSOA 2GIRA 1B9DA 5B0BA 3UCGA 3KDNA 1LV5A 2QM1A 1UEVA 1LNQA 1RT6A 3G8QA 2OZMA 4USUA 3P6YC 3NS7B 1RFQA 1J5OB 4IRCA 2DR5A 4ILHA 4ZTJA 2KB2A 5K9FA 2FZGB 4LRDA 4TU7A 3H5UA 1TK5A 1G2EA 4GVBB 4K2JA 2EWSA 4BRKA 3IR7B 2VQFF 2GHPA 1Z2LA 5KT3A 3L2WA 3H20A 2MGZB 1QUPA 2RJZA 4KTQA 3OPKA 3ZZPA 4BRLA 4OLBA 1JLGB 3HVTA 4ZCIA 2UXCK 2AU0A 1ESVA 4LRCA 4I56A 2O8EB 1IH7A 4X64F 3OL9A 1RBOB 3OW2M 2ATLA 3DLLQ 4DL3A 4CLTA 4NLOA 1XEZA 5EX3A 1WSHA 3MD1A 4BRGA 3S3NA 3P49B 1P6TA 2ATQA 2BE2A 3W5YA 3OTEA 2E5LJ 4FW1A 4OHZA 3TNVA 3KHGA 4N41A 1ZETA 4I6MA 4RNNA 3H46O 3NDKA 4O44A 4WP8A 2A3ZA 4DDFA 2XMWA 3VEVA 2BQ3A 1FK9B 4IQMA 3RVCA 3DU5A 3GFXA 1VQ6N 1MWKA 4EBCA 3LPYA 3VALA 3CDBA 4CI6A 3UFCX 4I7FB 3TABA 4QW8A 4NYNA 1XMBA 4KRWA 4DSIA 4KHPF 2WBNA 2H4WB 1H6KX 3TARA 4IEEA 3F9KA 1SIWB 4X62F 4B1UB 1LWFA 2BDPA 3VGTA 1FEEA 3KYLA 2GMHA 3WIUA 2QTDA 3AA3A 3SCLE 2HZCA 1L3UA 3ITHB 4WF9L 2J0QD 4CEQA 4FYYB 3FRYA 3CIPA 1T44A 3H3OB 1FJGK 4CNYA 4A59A 4R79A 2W2PP 1LK7A 2V8HA 1IKWA 5KT6A 1LAVA 4OZNA 4CTAA 4CBXA 4H5WA 1N32F 3R5CA 3OYGA 2O67A 4URGA 3I0RA 3L4QA 3EM1A 2Q0RA 2VQEJ 1OY6A 2CNLB 4BWMA 2YWWA 1YVNA 1YAGA 3RB4A 2CQ2A 1NGEA 5KFQA 3UKUB 4NRUA 2D3O1 1U49A 2CPJA 4Y1DA 4H4MA 3U3YA 2OP5A 2WBMA 2F9WA 2HVIA 3SFGA 2WOMA 3NE6A 3C6UB 1K73O 3GYXB 3QT6A 1E6YB 3OTOJ 4CT9A 3J7AN 3JYTA 3FUYA 1VSDA 4FLVA 2EX3A 1QSLA 2GO9A 3OFGA 1T3NA 4WKYA 3ZZOA 3JTPA 5T7LA 3K59A 2XM3A 4CF2A 3P5BP 4DR2J 3A8YA 1BO5O 5HO4A 4CZCA 1X31C 4NXNJ 1RLDA 3TSQA 3IM9A 3R5GA 3BF1A 5K20B 1PCAA 5IT9Y 5CYQA 5C42A 4R5PB 4FJIA 2VG7B 2AGOA 4FOIA 3DRSB 2XSJA 1VRTB 1SC6A 3I96A 3T1HK 3R6LB 2ZH5A 2JVRA 4H0VB 4XH5A 3E9LA 4LIWA 2B9WA 1KCFA 1GOAA 2A2DA 1EWRA 5KFWA 2P9LA 3CCLN 1RZMA 2UU9K 3L7OA 2IJNA 3T5HA 3NOCA 1ZPWX 2W4DA 1KD1T 5GMEA 4DR1F 3NGZA 2W25A 2XI2A 1RWXB 4ISEA 2VFSA 1FJGF 3SZ2A 3FBCA 1Y0HA 3AAWB 1N6QB 2YNGA 4NLGA 4X4SA 3TQEA 3NGTA 1WHWA 4L6V3 1NGFA 3FE1A 2WVCA 2ILZA 2P9PA 1SJRA 1S79A 3GL1A 5AJ3J 3R3LA 4CI0B 4ZS6A 3UDEA 3PIPQ 4DV7F 1S72S 1RT6B 5AQPA 4GKJK 5D8HB 3UW1A 2KJWA 1IR0A 3SQGA 1EP4A 2DR9A 3C6HA 2R7YA 4N8NA 4CLZA 3UD4P 3PW7A 4F7VA 4BREA 3CJ2A 1KVJA 2JEJA 2E44A 3B8AX 2CDQA 2VYPA 2OCEA 1YJUA 1WG1A 1A5VA 3ZT4A 4J90A 1CPZA 5AQVA 4DX8H 4USWA 2VGMA 1HQ2A 1O5JA 3HVTB 2D3UA 2KYXA 1YQHA 3OYHA 2IFXA 5ETTA 1JLCB 1RTZA 3N9UC 5E5NA 1MU2B 5DDQC 1DAXA 2DPIA 2VC0A 2XQCA 1J54A 4PKHA 4NLSA 4CERA 3TSPA 1U2CA 5AQFA 5RUBA 4Y2AA 5AQQA 1KC8O 3LOUA 1U1NA 1EX4A 4CLWA 2OUGA 1H98A 3DN9A 1V5IB 3BEXA 1AFIA 1S97A 2QL9B 5C24B 3THWA 4UQTA 2OPRA 5ETNA 1N48A 1RU2A 4YB1P 2WUSA 4ZJOA 2AYGA 2IOCA 3UB5A 4CCHA 3HULA 4PWUA 3DDNA 1UVJA 1ZC6A 2ZBQA 4DR3K 1CEZA 2JZ5A 3W61A 3Q24A 2L9NA 3CC2N 2NXNA 1FERA 2HS0A 3G86A 2YKMA 3PYGA 3R7SB 3OYFA 1LWFB 2ZUGA 3L7PA 2XCAA 1HBNA 3GONA 1FEHA 3GCWP 3VEWA 2W2NP 1URNA 4EO6A 4PQUB 1ZS6A 2GJ2A 1F0XA 3QBWA 5C2FA 1PKUA 2KI2A 5JUMA 4LF6J 1TR0A 4JI2F 4A61A 1IKWB 2DCUB 4CTAB 1VSHA 1SC3B 5KG1A 4GKJF 4K50A 3QLHA 1G6BA 4AT1B 3PDNA 2IIRA 5TKWA 2VWKA 3CJRA 1NSPA 4O3QA 2LCWA 3CQYA 2Q0UA 3CD5A 2DJWA 4BGBA 3RBZA 1NGDA 3THTA 3CJAA 2YQ0A 2GX9A 2YWEA 1SZ2A 1JQGA 1OIAA 2RU9A 2CPDA 4K43A 4N76A 1X9SA 3MXJA 2WOMB 4H5TA 3P8BB 5C15A 3FZHA 1NU0A 1YJ9S 2AW0A 3CCWA 4H0TB 5C25B 3TUJC 2ZJPQ 4CEFA 2MQMA 4YEAA 1KAYA 4FJJA 1N5YB 2RMLA 5T7LB 1BXNA 3EKSA 4GV9A 2RHSB 3BO2A 4IFYB 1UJ6A 3RSEA 4OVLA 3O5BA 2ALYB 2M88A 4KHQA 3C66A 3OR2A 3FR0A 4K4ZA 5J1PA 5CYQB 2A6OA 2PMWA 1XHZA 2CKWA 2XLIA 1WELA 1JJCB 5KG0A 2NXJA 4X4VA 2WBRA 1S1VB 2XSJB 2LQ9A 4P71A 4FYVB 2IVFB 1S6QB 2KHOA 3HJVA 4QYZK 1GLBG 4HR2A 2BR0A 1VQOS 4Q0BA 2P9LB 4XTTA 4DKWA 4M5DA 1NK9A 4FPBA 3AARA 4JNEA 2V2KA 5DDOC 1K6YA 1RAJA 2ZJRQ 2V6AA 3GFZA 4LVNP 3GPAA 3ILIA 2F8HA 4QIVA 4OLOA 3ZNUA 1VSKA 4UY8T 1HR0K 4ANDA 2KZMA 5H1SV 5EU7A 3KLGA 3L4IA 2GJFA 1FKPB 2BW2A 3R1HA 1J6ZA 3D5MA 2YNFA 3NMAA 5AXLA 4FWMA 4DUZF 3HP6A 4FLZA 2IPOB 2BOAA 1VCTA 2QWLA 4YUDA 2ASLA 1IUJA 4CGIA 2LEPA 2PFFB 2D1KA 2AMCB 3PY8A 3MEKA 5D4PA 3RAMA 1RYSA 2R7WA 3EVWA 5IWAF 3CXCR 3CDWA 2MZTA 1Q8KA 3MM5B 3DXBA 2VD3A 4NLYA 3NCPA 1WBBA 2F63A 2A1BA 2YH0A 1U1MA 1MN9A 3T6BA 4U7BA 1W7WA 1OH6A 2BEFA 2KFNA 2YY3A 1HWLA 3Q7BA 3QIDA 4LF9J 3R6GB 4RBUA 1N36J 1CC8A 2JC1A 1NBWA 4ZP8A 4K25A 4K59A 2EFOA 2ROEA 4K5SA 4MH8A 1R8HA 4JI0J 1KLNA 4FBUA 1KTQA 4JK7A 1W9HA 4K4YA 4EZ9A 4NXMJ 3KWIA 2W7PA 1RA6A 4Y0FA 4ATNA 2OA8A 2N82B 1QS4A 4CJ7A 2J9DA 1YJWS 3SPZA 3U9DA 1T03A 2ZITA 4FNIA 2F7VA 4PR6A 2LECA 3SAHA 2FJVA 2LMIA 4LT6A 4B9QA 2H5IB 4LF4K 3CW2C 3O1LA 1KOHA 1VMBA 2GHWA 1NDLA 3DI6A 4FBTA 2HIQA 2YCHA 3MR7A 2I6WA 2CJBA 3WEEB 4O0JA 4MDAA 3QLHB 4GO7X 5H9FK 1Y4ZB 5F8MA 4CESA 3D0GE 1RAHB 1P90A 3EPIA 1X4EA 1AA1B 5EY4A 2OZSA 3HD1A 4XPEA 3VQPA 1GLDG 2QXLA 2DH9A 2V4RA 3U1NA 4DN0A 2D0PA 2MQNA 4CEAA 4X4TA 3M30A 3WX4A 1FCAA 3QNOA 3WDOA 4FOEA 3RRGA 5CY4A 2PT0A 2H3EB 4NE9C 4C1NK 4DSEA 3QZ8A 1VK8A 3ALYA 1GQEA 1Z25A 4LF8J 2JC0A 2X1GA 4CJ4A 3LZJA 4P72A 4O0NA 3ENBA 4WU2A 5LY3A 4QCLA 2MQ8A 3KNAA 4LH4A 5A2QO 4C4WA 3GV7B 3CNQP 1RHKB 2OMOA 1LW2A 2YBVA 3ZZ0A 4HT7A 4MMOA 4DR5J 1QAIA 4DS4A 2VFTA 1HW9A 1I6JA 4BCAA 3CD6N 5KPZA 1U47A 2OYQA 2QG9B 1BUXA 4J2AA 3PEJA 2HWHA 3CJ5A 3JQMA 2QA4S 3F44A 4CEDA 1H73A 1UEUA 4KAIA 1UEKA 2ZDOA 1U8SA 5HSPA 2DCLA 2RKIA 4KC5A 2MKYA 2MLXA 1BISA 1TL4A 3SYZA 4J9PA 3CJ4A 1NDKA 4HTJA 2PY5A 2D0OA 4X65F 2XWXA 3VQ6A 2EG1A 1YWXA 3NP5A 1M5KC 3A3OB 4U9RA 5G0RB 1NPRA 4CBUA 1HBUB 4LQ3A 1P8GA 1SH0A 4C6AA 3T41A 3PFEA 1JNRB 3K9KA 3KLGB 1ZBHA 3VQCA 1H74A 5FPNA 2RH3A 5DM6L 2Q6BA 2ZBIA 3LALA 1HJRA 3MEGA 4OLAA 3CCZA 3MTJA 4FYWB 5BREA 2QSWA 3M6UA 3M6VA 5DGAA 4FVUA 1NH8A 3VCDA 2KT5A 4CGJA 3G8SA 3W5ZA 1RUSA 4USJC 1ZA2B 5EXWA 4EBEA 1AROP 5KG2A 2DFEA 4B3SK 2FLPA 1FDNA 4USVA 2E1RA 2K1RB 1A5XA 4V19S 3NAHA 4WCEL 4JI5F 1RHQB 1VQSA 3M9OB 2JEIA 1J53A 4CM2A 5CH7B 4DEZA 3HVRA 3PIOL 4RW8B 3E9OA 2PZSA 4X4QA 2YX4A 3QGHA 4DV6K 4H0PA 2VICA 1VHFA 4CJQA 1C0TB 4R0JA 4OJ1A 4B3MJ 4IOCQ 3BZCA 3M32A 2WVEA 2YKAA 3CD7A 2W9AA 4Z4EA 2WONA 4HUGA 1X5SA 3CC4N 2CJAA 1B7YB 1EKSA 3TEHB 2KRBA 5A2QU 2R4FA 3GJQB 1YBTA 2FDNA 3H1QA 5K5MA 1OH5A 3BM7A 1T9TA 5L1KA 2P8IA 5EHHA 3DOLB 1S1WA 3FSYA 1T03B 3PM9A 5IV3A 4EAHD 1LXNA 3VQ7A 3LUYA 3SDEA 3V9ZA 2NUHA 1I3AA 1Q8LA 2ZD1A 4FXVA 2MMYA 4W5NA 4WIIA 2JX2A 2Z58B 1I1GA 2C2DA 2J6TA 3DI6B 3BKTA 5EX0A 3D3CJ 3J7YU 2HGLA 3AVLA 4OX9K 1S9GB 1FTCA 2F96A 3LGNA 2OLWA 2XMVA 3CCVN 1S1UA 1R8PA 2ZKTA 2K7JA 1NK6A 2J7WA 1N34J 4DPWA 4PG6A 1RTHB 5FDLA 2B3TB 4WP9A 3HPOA 1Y5LB 1U1RA 1AYEA 4DI6A 3HZGA 1RBUA 3M30B 4HCBA 4J9OA 2LQJA 2JH3A 4E0DA 1PC5A 5F1XA 3OBIA 2QIFA 1VQ6S 4NMXA 1V4SA 4I2QA 3SUQA 4IO9Q 3TAGA 3M8QA 2X7IA 1PJ7A 2HURA 5L8RC 3RR8A 4W5TA 1R6VA 1CZAN 2KDOA 3M1VB 5AQOA 2CQ0A 1LW2B 1DGKN 2YKNA 1KLMA 2ZH4A 3PHEA 2Y0BB 4MKBA 5JMNA 2KG1A 1QJHA 3SBTA 3AQPA 4B3TJ 1ZAXA 5E3RA 2W42A 3R7BB 4JEPA 4OZ1A 1KVAA 3GSDA 4ZP9A 1IBKJ 1B7FA 3CSKA 2DGQA 1RADB 3EY1A 2ETJA 4WKRA 2JVOA 1NK4A 1C4AA 3A4TA 4CHQA 1Q16B 3UD3P 1EIYB 4KGMA 5C10A 2XGQA 5LMNJ 4LBHA 4JI8K 4ED5A 4BRMA 4C11B 2HF3A 3KLEB 1SJ1A 2FHMA 1U1QA 2IVYA 4DLGA 5KT2A 3MECB 3RRKA 2KYZA 4OI2A 3T9ZA 1JNZB 1DHMA 2EC0A 1WEXA 2HWTA 3MMBA 5AXKA 3DLLL 4IEIA 4CEOA 1X3NA 3B8HA 3C14B 3I8DA 4PUOB 2BJ7A 5DZ7A 2GNKA 1OVQA 3QSIA 3VQTA 4G1PA 2ADBA 5GMKa 1HNXF 4FM1A 4JKEA 4JD2A 1RI7A 5FRMA 4CZFA 3ZZRA 1WJ9A 2HQFA 3Q8RB 3HHNB 2R8HA 4B9LA 2ZHAA 2HHTA 2F1FA 2G2YA 2QC3A 4QS8A 4X66J 4BE2A 1UOCA 2NZTA 1CLQA 1SCJB 2JL9A 2HFSA 4CQ1A 3LDOA 3EYZA 3CCLS 2DHXA 1UFLA 2YI1A 5LMUF 3MFHA 2Q1NA 3ENOA 4PG8A 2JEGA 4DR4F 3VA0A 5HMZA 5J2QA 1ZZFA 4QWDA 2P9CA 3J80Y 2FGOA 3D66A 3SQ2A 4HHHA 3HI0A 3CVKA 1LWCA 4RW7B 1NK5A 3TA1A 1WSEA 2D7SA 3GU0A 7AT1B 3H3NO 1NOYA 1NGHA 3TVKA 4QIGA 1S1WB 2RDIA 3BO4A 5KFAA 5KFTA 1RTJA 3G8TA 1D3WA 4C3KA 3GG1A 4JI8F 4PKIA 3BF4A 3ENAA 3DOMB 4I6WA 2HG4A 3SDEB 1PAEX 3U8XA 2LXIA 2RNEA 2ZWPA 3Q2SC 3UDCA 2YKQA 4H4KC 4E2FB 1NGGA 4Y2KA 4FN5A 1L3VA 1YJRA 1FRMA 4ZPWR 1KC8T 1HWKA 2IAJA 1S1UB 1HIYA 4Z37A 4TYAA 1U2VB 2R7OA 4OJGA 3SI6A 5F0XA 3M2UB 2X1AA 3B82A 5B0FA 1BE4A 1KTVA 2Y0SD 2AX0A 4KIAA 1Y97A 4RW6B 1B99A 2GVDA 1KVBA 1Y5IB 1HNWJ 2EFPA 4KHNA 3IUCA 2W2OP 2XHWA 3HX9A 4C1NI 1SQFA 3E8OA 3ZEUA 5IQQA 3SLCA 1H7XA 3M8YA 2F7TA 2E2QA 3IKMA 4IRDA 3DGPB 3O08A 4N7TA 2VHGA 4WK3A 1FFGB 2IJFA 4A8YA 3KK3A 4UOHA 4DG1A 4I2QB 2ZOFA 1FW6A 3RJMB 4CJFA 2CJQA 3BEGB 3OYBA 3CC2S 4DU7A 1VQ9N 3PSIA 4LVOP 2D4WA 3V6DA 4DQPA 2YHXA 1E4FT 5AQTA 3QO9B 1WOOA 3SUPA 1B0PA 3ZZTA 1WKLA 1V9OA 1EETB 2VWBA 3ID8A 3PIPL 4CZKA 3TTFA 2C3OA 2QT7A 1U6FA 3TX0A 3Q86A 2MLYA 3OFFA 5AQMA 4F0KA 1HPMA 3DRYA 4JI4K 4Y65A 1OYEA 4BC9A 3OR1A 3R2DJ 2GC8A 4M5JA 3VWSA 2XWYA 1FA0A 3HFKA 4WFZA 3NH1A 4FJLA 2E5LF 3SAFA 3ULEB 3OYIA 4NXNK 2HNDA 2C3UA 1SKSA 1LEOA 1L3KA 2QWMA 1M90O 3ZTQA 3AO1A 5AR0A 2FIUA 4H4OA 2NREA 1PBUA 5GAEP 3OYLA 4ER8A 5GADP 5GVQA 3JB9k 2ERRA 4CJVA 3J81j 1RACB 3DM2B 1A9NB 2CRLA 5KFPA 1E3MA 1SV5A 4ZIVA 2MY8A 4BR7A 5KAKA 2OPSB 3SSQA 1HPZB 1KVIA 3VQ8A 4CF0A 3WC0A 2DY9A 2BUNA 3VMFB 5DM7L 2J0WA 1R8AA 4RWWA 5E33A 3MAAA 4M5LA 3M8ZA 4ZLPA 3QIPA 1URRA 5A6PA 1W2BM 4PG4A 5ETKA 2ZF5O 1JXBA 3E1YA 5M1NA 5HJXA 1NOZA 2P9UA 5IM0A 4ZVOB 3LA0A 7FDRA 2X6NA 3DRPA 1C4CA 3MCNA 4ZVFA 2VQEF 5I3QA 1HUXA 1QE1A 4B17A 3KJNB 4K4UA 2V8VA 2KT3A 2IA0A 2XTJP 2ZQBA 3SSSA 2E6MA 2W24A 3KUGA 1H2TZ 3KUEA 1YTYA 4GVEA 3QNWB 3W9IA 4FF1A 2ZJQQ 1KN6A 2YHAA 1UW4A 2RIJA 1MNEA 3KOAA 3T1YJ 3N28A 2KKHA 1HI1A 3OTOF 3MM8A 5J2QB 3W8GA 3F41A 2XI3A 2N4CA 2VOOA 3FGUA 2Z2MA 1NJIO 3J7Z5 1ATSA 1W7AA 4HVZA 3TJAA 4BWJA 1CVJA 3CQXA 3MURP 4DR2F 4C7QA 3TI0A 1ZH5A 1WAFA 3CEDA 2QYGA 4NXNF 3TZWA 4FVCA 5CD4A 4ZVGA 1WORA 4JKBA 3MI7X 4CO5A 1WHYA 5KT5A 4JV5J 3W66A 3G4SS 2Q66A 2P9SB 2B4PA 4WZMA 2C2MB 3PG9A 2CJKA 3NH2A 3D67A 4DU3A 4DTSA 1Q8IA 1BCMA 3LWLA 1X9WA 1IWGA 2ZH6A 2IAJB 1T95A 2ZJPL 2ZBCA 2WSFC 3KXDA 3HPGA 2CNOB 2FHJD 4USMA 1FFWB 1CJKB 3E66A 5HAOA 1WI6A 4FWNA 1NU4A 1QTNB 1RGIA 2G8IA 1N56A 1SKWA 4DL6A 4YOTA 2G1HA 4CDIA 5AJ3F 3D45A 4HL9A 4BDYA 5AQJA 2V7ZA 1BI4A 4I2PA 1ATRA 2EKNA 2HQDA 4O3OA 2DTUA 3DLEB 3MOZA 1HFEL 4LF7K 3CCRN 2MZ1A 3KK3B 3D1QA 4MK8A 3H1VX 4J9KA 4MK9A 3QEIA 1VQLS 3AY9A 2ITMA 3CG7A 4CHOA 4BC4A 1BQMB 2FUG9 5EWFA 2P9KA 3GOIA 1KBRA 1RWWB 3NG8A 1D5AA 3DWLA 2UUCJ 4RKUC 5E3QA 5U47A 1FJCA 2BKNA 1JCFA 4WE1B 2L08A 3D2EA 3PRVA 1HX1A 1YZ6A 5AQZA 2C22A 4QR2A 3IDHA 4DUYK 1O6XA 5C2GA 2Y3YA 1S77D 2H48B 1MWYA 2OTLN 2A42A 4YY3K 4OKJA 4RL1A 1WTBA 1LXJA 2DISA 3UKRA 2KXNB 1HNVB 4H4OB 5E41A 3C6TA 3EX7B 4PWDB 1S6OA 2DXFA 1WSGA 2YQ3A 4QW9A 2GBZA 2RDDA 4CEBA 1XNRK 1W2IA 4QPTA 2C2KB 2G0CA 3BREA 3L9ZA 2NRWA 2ZVIA 2C2ZB 1SV5B 4DPTA 4IFEA 4XK8C 1RP5A 3WIVA 1KP6A 3NNCA 3MTKA 4ELTA 1KHWA 3CGIA 4LF6F 3CF5Q 4ICLB 2DTJA 2BMBA 3DRPB 2HVDA 2CJ9A 3JS9A 5A8RB 4RO0A 2C42A 2XY7A 3D9BA 1U02A 1DLOA 4OQJA 4KBOA 2DIUA 5GAHP 3NVKA 2GIFA 1VJQA 4IDKB 1I94J 3KFWX 3IC1A 4FJMA 2UXBJ 3AAPA 5AQUA 3N4WA 2G8HA 1F2HA 5J2PB 2RQKA 3SEOA 5KQDA 4K5RA 1VOMA 2D9PA 3ONQA 3I55N 1GT8A 4AILC 5KTQA 4XH4A 3T69A 4J5OA 2SXLA 3JQKA 3BB5A 2MZSA 3W1YC 1FD8A 1BD6A 2UUBK 3ZLJA 4JOUA 4KTWA 1JKHA 2HZAA 3CDUA 2J4RA 2W9BB 2L3MA 1Q7LB 3GP9A 1GMUA 2GA7A 3R9PA 1S9EB 2G0JA 5HATA 3NCIA 4P10A 3VR1A 3KKFA 1UFKA 3E01A 3RGIA 5HLFA 2HZVA 1FDBA 4OJHA 4CECA 4DPYA 4B9VA 1RT5A 2OTJN 4DV3K 3DGVA 2KN4A 2GMLA 3PRBA 2AP1A 4CFDA 1MN7A 2G8WA 3SNNA 3VF2A 1RT1A 3CCJS 1W26A 1DZ5A 2I0XA 4NRTA 1TL3A 5AQHA 3HOSA 4NB4A 4BRNA 1SS6A 2UXCJ 1IBMK 3US5A 4DL5A 2HRUA 5ETPA 4CZLA 1HMVA 1EQ0A 1DRZA 4DV2K 3ZSXA 4MYTA 3WQPA 2P5OA 2MKHA 2BJ9A 5KFFA 2GVZA 3T3FA 2JLGA 3QYYA 1NCLA 2FQQB 4I2PB 3ZCMA 2B9EA 2CQDA 4DHYA 1F3FA 3CC4S 1G4CA 3WQUA 2XULA 2KJVA 2XCPA 1FX2A 4CK3A 2HQ3A 3H90A 4FDFA 2WVDA 4KQZA 1VK3A 2IDOA 1G15A 2HVHA 3D2FA 3VA3A 1VQMS 4DTMA 4L3NA 5ETVA 3ZTPA 1YTUA 1WSFA 5DZ6A 2BE7D 3FZFA 1WHXA 2CGKA 4E19A 4FM2A 2DHGA 2P9KB 4I0WA 4ISGA 1SBRA 4HYKA 2HQIA 1IR1A 4ECVA 2X74A 1FJGJ 2AP6A 3J7YI 4B02A 5IS2A 3D2EB 1HQUA 1GEHA 1TL7B 4PXEA 2XS7A 4YOUA 3KJQB 2W9CA 2F4FA 1FXRA 1JLEB 3MMCA 2NNWA 4LF9F 5A8KA 1N36F 3P5JA 5KFKA 4OO1J 4F4KA 2V2ZA 5BYSA 3S6EA 3AO3A 5AQXA 3LP1A 1IM4A 4IJAA 2GAGC 4JI0F 4C8MA 4NO7A 2CPXA 2OFHX 1HW8A 2O4GA 2JWLA 4Q44A 2M3DA 5L46A 5F3ZA 4NXMF 2BW7A 2XYGB 3GV8B 1NRKA 4OYWA 8RUCA 5LJ3Y 3RMCA 2B8QA 3CDEA 3O3LA 1B70B 5HVHA 5CYMB 1IBMF 4C8ZA 4HLBA 3MN9A 4IOCL 3A5LC 3DLBA 3RW6A 3G0ZA 3K2PA 1DURA 2FGCA 2NRRA 4TKTA 1N8RO 3HSCA 3OYKA 2OMLA 2ZZTA 2OHDA 2Q31A 1OY9A 2IYIA 4DV0K 3OD2A 4CP5A 4Y2CA 4CJKA 1NLVA 2NRVA 2CGJA 4FJNA 1TGOA 4OI1A 1EXQA 1DLOB 5KFIA 4OYAA 3I9ZA 2HNYA 3HSGA 2DEIA 3T1HJ 1KAZA 1RXOB 4