3VQ5A

Hiv-1 in core domain in complex with n-methyl-1-(4-methyl-2-phenyl-1,3-thiazol-5-yl)methanamine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
151
structure length
133
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 48
structure length 133
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vq5A00
2ETJA 4B8CA 1S5JA 3NF7A 4ID1A 2Y1IA 1JLFA 4FJIA 1IKVA 3IRXA 3QO9A 1QHTA 4O4GA 3M8RA 3VQPA 1KVBA 1BIZA 2O4IA 4DSEA 3TI0A 3TR8A 3DM2A 4KRFA 2GUIA 3NE6A 4LY7A 1LAWA 4CERA 3TWHA 3NFAA 1A5XA 3KK1A 4CJTA 3PUFA 4F3TA 2D0AA 4Z4IA 2RPIA 5CYQA 3KJVA 2P1JA 4E7IA 4FZXC 3AVAA 3AVIA 4ID5A 1L3SA 5HBMA 2OZMA 3AVGA 3HM9A 3K59A 1NJXA 1RDCA 4CJKA 3OYHA 1SUQA 4CEBA 1VSEA 3NF9A 4DQIA 4HCBA 2Z1JA 4RG8A 2YKNA 1D5AA 4CJFA 4CJSA 3ZSOA 3NGZA 1C0UA 3V6DA 1BCOA 1TKDA 3LP2A 1UOCA 3VQ6A 1QSSA 4Q0BA 2OZSA 3SQ2A 4Z4HA 2QK9A 3D45A 4O0JA 4CEOA 1X1PA 4KB0A 3CFPA 4Z4EA 3OS2A 3V1OA 3QNOA 4DU1A 1JLCA 4C8OA 4CFDA 2BDPA 1HJRA 3VQ5A 5SZTA 3V4IA 4FK0A 1D9DA 1UA1A 1IKWA 2IDOA 3OS1A 3SZ2A 5CY4A 1TK5A 2A1RA 1J9AA 4Z4GA 4CJRA 3AO3A 3NF6A 1XI1A 3KLEA 1ZBIA 1JL1A 3ZCMA 2BGGA 2EHGA 4CEFA 4CE9A 5C25A 3VQEA 1KTQA 3OVNA 4CFBA 3OYDA 3U3YA 4OLBA 2HHWA 3T1AA 4FJJA 3DI6A 2JLEA 4QAGA 4CHOA 3AO4A 1RBRA 2LSNA 3K5OA 4IBNA 2AJQA 4BWJA 3SYZA 4CJVA 4IDKA 1S1UA 1VSHA 1QTMA 2GV9A 3OYFA 3OY9A 3NHGA 4B3OA 4GMJB 2YNGA 3K5NA 2KTQA 2IS3A 1TAQA 1ZYQA 1FK9A 1RT4A 4PY5A 3K5LA 4BDYA 1RTDA 1SL0A 3PO4A 3KLHA 4LH5A 3LPUA 3QLHA 4PWDA 3CM6A 4GVMA 1REVA 5T7BA 4E0DA 4M3ZA 4FJLA 5J2QA 3QIPA 3OYLA 4CJUA 2KQ2A 1JL2A 3ISNC 4CF9A 3RR8A 1XWLA 3AO2A 3AO1A 1SKSA 4CFAA 4N47A 4FYDA 1WNSA 4I2PA 2IC3A 4CJPA 4MQ3A 4FK4A 4HTUA 3KTQA 5DK5A 5DMRA 1TK0A 2I5JA 4KV8A 1DLOA 4BACA 3SJJA 4HUGA 5HRRA 1KFSA 4FLXA 1C0TA 3QERA 4NCAA 4KI6A 4BDPA 3HVRA 2F96A 3DMJA 1B9DA 3LZJA 3ZSRA 4HCCA 3P83D 3RRHA 3WNGA 3THVA 4CK1A 1RILA 1XC9A 2G8WA 3L2WA 1IH7A 3O3FA 1L3TA 3G10A 3TAFA 3WNHA 4CHNA 2ITGA 1XHXA 1S6PA 3ZT2A 4CJ3A 4DTPA 4AHVA 3TANA 2XY8A 3QIOA 4I9LA 4FJMA 3K5MA 1NOZA 4YFUA 1TKTA 1I3AA 4CJEA 1ASVA 3ASMA 4CF2A 3TARA 1NK4A 4RW9A 3RMAA 3QEVA 3MEDA 4O0IA 2XO7A 1X9MA 1HYZA 2XRIA 2X74A 4CF0A 4DFKA 1TAUA 4KB1A 1HYVA 1F21A 1C1CA 3I8DA 1ZBUA 3B6OA 3KK2A 2HHQA 3CG7A 4CEAA 3KIOA 4N56A 3HT3A 4EZ9A 4B9SA 1T05A 3IS9A 1QE1A 4OPJA 4LSLA 2FC0A 1RTHA 4DSFA 1W0HA 4DTJA 1C1BA 1NOYA 4B9TA 3OS0A 2VG7A 1Q9YA 3VQ4A 4CJLA 1N6QA 3VQ9A 4FZZA 3OYCA 4I2QA 4KTZA 1BQNA 3TAPA 4KKOA 4DFJA 4DSKA 4DTXA 4HUFA 5HROA 1A5WA 3TAQA 1SKRA 1IG9A 1QS4A 1YTAA 4AHTA 1KVCA 4FXDA 5I3UA 4F4KA 4AHRA 1G15A 2X6SA 4CHYA 3L2UA 2HNDA 3BGRA 1CXQA 4Z4CA 3ZT3A 5KRTA 1ZBFA 2FBYA 3OYNA 1QQCA 2XY7A 4FJNA 3ZSQA 1TVRA 2JGUA 3LWLA 3SUPA 3V9XA 3ZSZA 4ZTJA 2KW4A 2VG6A 5HRNA 3QEXA 3S9HA 1VSJA 1HQUA 2HB5A 4H4OA 4B9NA 3DLKA 4RW8A 1K6YA 3O3HA 3V9ZA 5J2MA 1D8YA 4J2BA 2RKIA 1NKCA 4DSJA 4QCLA 1RT7A 3L2QA 3D0PA 4CF8A 2Z1HA 3RTVA 3HK2A 3BDPA 5KI6A 4C8MA 3I0SA 2HNZA 4J2AA 2RF2A 1NK0A 3I0RA 4FJ8A 2B5JA 3LP3A 3S3OA 3MEEA 1RDAA 4CGDA 5FDLA 1S1WA 3G0ZA 4AHCA 4OVLA 3LWMA 3TAEA 1TL1A 4KFBA 3SPYA 3MXJA 2FBXA 1TKZA 3JYTA 3AVNA 2P5OA 4BWMA 2G8FA 3DOKA 4FJGA 3IAYA 3SQ1A 4I9QA 5FRNA 1EKEA 4EP5A 1S1VA 4DLGA 4MFBA 3NAEA 4M3TA 4EP4A 1SL1A 2OPPA 1UA0A 2DFEA 4KTQA 3K58A 1VSFA 1U04A 3LAKA 4CJQA 3M8PA 1QSYA 4JS4A 1U4BA 4BDZA 5E41A 1GOCA 5KGXA 3C94A 3SUNA 3HP9A 4JRQA 2HHXA 4H4MA 1HPZA 1BCMA 1B92A 4PA1A 1JKHA 3PX0A 1UWBA 4CJ5A 4CCHA 1A5VA 3SPZA 1RT2A 1JLEA 1JXEA 3VN5A 4QOZB 2YHBA 2E6MA 4M41A 4DTRA 4FLZA 4DMNA 3KKRA 3AVCA 3NH0A 3RWUA 4O44A 4CEQA 1FXXA 2ATQA 1ITGA 1WSHA 1EP4A 3RMBA 3AVJA 2VWJA 4L8RB 3KLGA 1ASUA 3KLIA 1SL2A 2NUBA 1KLMA 3V9UA 5HRPA 1CZ9A 4CF1A 3LAMA 3OYEA 3U3GA 4JLHA 3L8BA 2DY4A 4KREA 3S3MA 4Q5VA 4FLTA 4CK2A 1YT3A 1S9GA 2G8VA 1Z26A 1C0MA 2IOCA 2O4GA 3T19A 4DQQA 3QEWA 4E3SA 1EXQA 1HYSA 1J54A 3ALYA 3S3NA 2G8IA 1C1AA 4IFYA 3VQ7A 4CEZA 4M3XA 4E89A 3HYFA 2KZMA 3EZ5A 5HLFA 1XHZA 4CHPA 1WN7A 3CFOA 3M8SA 2W42A 2HW3A 4HUEA 4DQSA 1VSLA 2X78A 5KGWA 2Y1JA 1KLNA 4EZ6A 4NCBA 1KVAA 1WAFA 1JXBA 3V81A 1Q9XA 1RBSA 1QSLA 3QINA 2OPSA 3ZSYA 4CGFA 1NJYA 2YHAA 4K8XA 3DRSA 4KHNA 4I7FA 3OYMA 4DU3A 3C6UA 1L3VA 4FM0A 1Z25A 3QNNA 4FJKA 2FBVA 4CGJA 4UQGA 3TABA 4OKEA 5C24A 4OGEA 1LWEA 4FM1A 1IO2A 4DFPA 4J2EA 2DFFA 2GBZA 3VQQA 4CGGA 4KI4A 1LV5A 4E19A 1MU2A 2IGIA 1WLJA 2YKMA 4FJ7A 4GW6A 3AVLA 4CHZA 4JRPA 2XY6A 1JLQA 4E1MA 5I42A 1BL3A 3OYGA 4AHSA 3ZT1A 3L2RA 2KZZA 1W9HA 3ITHA 3V1QA 4W5QA 2PYJA 2G8UA 4DQPA 4NYNA 3VQAA 1RT5A 4NYFA 1L3UA 3HJFA 2DTUA 4W5OA 4LH4A 1FKOA 1O1WA 1RDBA 3L3VA 4IG0A 1T8EA 3AVBA 3V9WA 1J5OA 2FBTA 3KD5E 4DSIA 4M3UA 1NK5A 3SNNA 2X6NA 3VA3A 4PUOA 1RBVA 3NDKA 4IKFA 2D0BA 1D9FA 3UIQA 1S1TA 3NBPA 3MECA 1BIUA 3HPOA 4KHUA 1JLBA 2ZD1A 3LANA 1YTUA 2XY5A 3DRRA 4CJWA 3HL8A 3PX4A 2HMIA 3PV8A 3F73A 2XHBA 1ASWA 2D0CA 3CM5A 3DLRA 1CLQA 4R5PA 5SWMA 3HP6A 4FW2A 3NF8A 3VQ8A 1L5UA 4N41A 3HPHA 3ULDA 4KPYA 4M3RA 4DTNA 5JS1A 1X9WA 3F9KA 3TAMA 1IKYA 2WOMA 1Y97A 4HVJA 3VQDA 3HXMA 1SKWA 4M3YA 1NK9A 1BQMA 1LW0A 2OA8A 2PZSA 3WNFA 1RTJA 4CK3A 4RW6A 1KCFA 3DYAA 3T3FA 1VSDA 4FLUA 2P51A 4IG3A 3OJUA 2Z1IA 2F8TA 2HHVA 3OYAA 2QKKA 4ELTA 4JS5A 2PYLA 4B9VA 4ELVA 4XIUA 1CXUA 4N5SA 4Y1CA 1NJWA 4KTWA 3LALA 4Y1DA 3A2FA 3L3UA 1KSPA 4FK2A 4F2SA 5FROA 1BGXT 3CFRA 3TAGA 1N5YA 3RRGA 2P5GA 1TK8A 3O3GA 4B9LA 5JS2A 4OKJA 3ZSWA 2HVIA 1DTTA 4BE2A 1NK8A 3RR7A 4DWIA 3KKSA 4OLAA 2QKBA 3DOLA 4ZHRA 1ZBHA 3U6FA 4YNQA 4KHYA 3RMDA 2YNIA 1LWFA 3NGYA 3LDSA 1EX4A 2WONA 2ZE2A 3KLFA 2G8HA 3HO1A 3AA2A 3AVHA 3P5JA 2F8SA 5K14A 4DU4A 4ELUA 4B9MA 4TSXA 1BISA 1WSIA 4DQRA 4DTMA 3AVMA 3KD1E 1TGOA 4E7LA 1U45A 1WSEA 1YVUA 4LSNA 3OYIA 2BE2A 3K57A 1T7PA 4CIFA 2OYQA 3SV3A 1VRTA 4DTOA 4ZTFA 3HVTA 4IFVA 2Z1GA 4ICLA 1WAJA 4FW1A 2BANA 1X9SA 3SI6A 1VSKA 3MEGA 3KK3A 4E7HA 3C6TA 4AILC 4FJXA 2DFHA 2A1SA 3ZSVA 4BE1A 1TL3A 3LZIA 3OJSA 1U47A 3QEIA 4DS4A 1LAVA 4CGHA 4W5TA 4CIGA 3JSMA 4DSLA 1JLGA 4CEDA 2Q3SA 2HHSA 1S9EA 3FFIA 2IAJA 5J2PA 5FRMA 1RTIA 4FLYA 4CECA 4CGIA 3ZT4A 1NKEA 2B6AA 5C42A 3RMCA 1HQEA 3OYKA 1T03A 4OKKA 1R0AA 3PX6A 4Z4FA 1HMVA 1NK6A 1RCHA 4E7JA 4DLEA 4FM2A 3EYZA 2QXFA 1DTQA 3OYJA 3NCIA 3O4QA 5CZ1A 3ZT0A 5J1EA 4O5BA 4B9UA 4KHSA 1EETA 3DLBA 4OGCA 4E7KA 2HHUA 4NCGA 1S6QA 3V9SA 4CEEA 1TV6A 4G1QA 3PO5A 3DRPA 3LPTA 3WNEA 3SCXA 4DTSA 3AA4A 1JLAA 3AVKA 3ZSXA 4AHUA 5HP1A 2YNHA 3SQ4A 3C95A 3E01A 1HNVA 4DS5A 3SUQA 3H08A 4C8KA 3CYMA 3SV4A 3K2PA 4F8RA 2D5RA 4WE1A 1S1XA 3QESA 4O55A 4FZYA 4J2DA 4OJRA 4Z0UA 4N76A 1B9FA 2B4JA 4E1NA 5KTQA 1RNHA 4PQUA 4H8KA 1WSJA 1WSGA 3QEPA 4F2RA 1ZBLA 1RDDA 1HNIA 5CZ2A 4RW7A 1U48A 4M42A 4KHQA 4FLVA 1IKXA 4DF8A 3CQ8A 3M8QA 4HHTA 2EX3A 2KFNA 1KFDA 4W5RA 3MAQA 4AH9A 4FCYA 2VG5A 4DF4A 1RT3A 3SUOA 1TKXA 4DTUA 3NH1A 2G8KA 4B8AB 4BE0A 4DFMA 4CFCA 2ZQBA 4CIEA 3SQ0A 4RW4A 1BI4A 1LW2A 4CESA 1VK0A 2RN2A 3MXMA 1VSIA 2VWKA 4C8NA 1VRUA 3DLEA 4LD0A 2E6LA 3OYBA 4B08A 1NK7A 5D3GA 1WSFA 4KO0A 2KFZA 5KRSA 3LP1A 1VSMA 2YV0X 2HHTA 1RBUA 2E4LA 1J53A 1LWCA 1SV5A 3AO5A 1I39A 3AA5X 4KHWA 1HRHA 3O4NA 4FJ5A 1CZBA 3P1GA 3QETA 1NJZA 5J2NA 5EU7A 3DLGA 3NGIA 1U49A 2OPRA 4FLWA 1RT6A 4K8ZA 3DLHA 4M3WA 4C8LA 3AV9A 1KRPA 4DG1A 1GOBA 1C6VA 3EY1A 4M45A 4FJHA 4FVMA 3IG1A 3AVFA 2R7YA 1RBTA 2HNYA 3PY8A 1GOAA 1BHLA 2HVHA 3V1RA 4KAZA 3B6PA 5CYMA 5HRSA 4FJ9A 1RT1A 3HPGA 3VQCA 4OPKA 4CHQA 1UAXA 3VA0A 1FKPA 4CJ4A 2YNFA 3MXIA 3HSTB 3VQBA 3LP0A 3L2VA 2PY5A 4F3OA 4W5NA 3AA3A 1NKBA 2OPQA 3NH2A 1Q8IA 1BI4B
chains in the Genus database with same CATH superfamily
2Y1IA 3EZWA 1IKVA 3QO9A 2RE2A 2I7NA 1QHTA 3IKMA 4O4GA 4RCHA 4KRFA 3TR8A 2YJEA 1LAWA 3WXIA 3NFAA 3H3OB 4Z4IA 3LDPA 5CYQA 3KJVA 4FZXC 3AVIA 3O1BA 4CEBA 4DCHA 3NF9A 4DQIA 3ZSOA 1C0UA 4F9OA 3H46O 3N4PA 1EO1A 1QSSA 2OZSA 4Z4HA 5JVGL 3D45A 4O0JA 1IBKK 3CFPA 1VQLN 1JLCA 4CFDA 1HJRA 1DKGD 3V4IA 1D9DA 1UA1A 1IKWA 3SMPA 1QQNA 3WXKA 4X65K 3SZ2A 4LFBK 3FGUA 1TK5A 2A1RA 4CJRA 5AZJA 3NF6A 3CCSN 1XI1A 1ZBIA 3ZCMA 4M7YA 4CBWA 1KTQA 3OVNA 4CFBA 3U3YA 3T1AA 4GKJK 3AO4A 4JKDA 1YITN 1VSHA 3OYFA 3NHGA 2YNGA 1YUWA 3P38A 3MN6A 3O9RA 4PY5A 4BDYA 3MN9A 3M5RA 3LPUA 5T7BA 4M3ZA 2ASMA 3ISNC 5AQPA 3RR8A 1XWLA 3AO1A 5E26A 1SKSA 1GLLO 4CFAA 1WNSA 4FWOA 2P9LA 2IC3A 2GUPA 4CJPA 5JLFA 2P9UA 4FK4A 3KTQA 1TK0A 3CCRN 4BACA 3SJJA 2VWBA 1C0TA 3AY9A 1O13A 2CGLA 3HVRA 3DMJA 4KHPK 4CD1A 3BZCA 5LMNK 4CJ3A 1QVFM 4DTPA 3TANA 2XY8A 4GVEA 4K43A 2IIRA 1TKTA 1I3AA 1NK4A 4BRLA 1QZ5A 3TPQA 1NGJA 1HYZA 2XRIA 4DV0K 4CF0A 4DFKA 3I8DA 3CJCA 3B6OA 3ZETB 4JAXA 3CG7A 4CEAA 4N56A 3QICA 4EZ9A 4QS8A 2JWLA 3IS9A 1T05A 4B9QA 4LSLA 3VGMA 1KAXA 5HL7L 1IBMK 2VG7A 1Q9YA 3VQ4A 1N6QA 3MMVA 1BQNA 3O5BA 4DTXA 5HROA 4YOWA 4UY8O 3OBWA 4FXDA 4MO5A 4AHRA 3L2UA 4JKEA 3SLCA 3OYNA 5GAHP 3HM8A 3ZSQA 5M1FA 4IO9L 2IVPA 3O8MA 4NLBA 1Q82O 4ZTJA 2VG6A 1Q81O 1KAZA 3DLKA 4RW8A 1K6YA 1D8YA 2RKIA 3MX2A 2Z1HA 4IEEA 4C8MA 1NK0A 3I0RA 2B5JA 3LP3A 3MEEA 5FDLA 3LWMA 4OVLA 3MXJA 1HJOA 4LF9K 1TUYA 2P9PB 5E84A 2P5OA 3J7AP 3O9UA 4KH5A 3DJCA 4I9QA 5FRNA 5JICA 4DLGA 2DFEA 1U04A 1QSYA 4JI1K 4JS4A 3C94A 3HP9A 4JRQA 4PA1A 4CJ5A 4CCHA 3SPZA 1RT2A 1JLEA 1JXEA 4M41A 4DMNA 3KKRA 3AVCA 3NH0A 1FXXA 1EP4A 2VWJA 1VAZA 3CI5A 1CZ9A 3VESA 4KREA 1BDGA 2G8VA 1C0MA 2IOCA 2O4GA 4JHDB 2G8IA 2BH1A 3CC2N 5AR0A 2FXUA 3HYFA 5CHIA 3EZ5A 2YCHA 1XHZA 2HW3A 2V52B 3HOTA 2X78A 3SAFA 4EZ6A 4XH5A 1JXBA 2YX6A 3RVCA 5BR9A 1QSLA 2WC9A 3QINA 3ZSYA 4YOVA 3GBTA 3GE1A 4I7FA 3OYMA 1Z25A 5BRFA 4DFPA 2DFFA 2GBZA 3E9LA 1LV5A 4E19A 1MU2A 1NGFA 4GW6A 4JRPA 2XY6A 1NGAA 4BC4A 4E1MA 3DAWA 3F5TA 5AQKA 3L6QA 4AHSA 3OYGA 4DR5K 4W5QA 2PYJA 1L3UA 3G25A 3LDQA 2DTUA 4FVUA 4LH4A 3R8EA 1T8EA 4IG0A 3IMXA 4BR9A 1VQ7N 3SNNA 3MX5A 3NBPA 1YTUA 3DRRA 4CJWA 5IT9O 4BGAA 2HMIA 3F73A 4NO7A 1XUPO 2E2NA 4H0PA 4AF1A 1L5UA 1EWRA 4KPYA 4M3RA 1HUXA 4HVJA 3F9MA 3MK6A 3ULEA 3HXMA 1SKWA 4M3YA 1N33K 2O8FB 1ESVA 3WNFA 3BEXA 4RW6A 1KCFA 1OKJA 3T3FA 4FLUA 4IG3A 3TU5A 4ELVA 1T44A 3O9SA 2I7PA 3UKUB 4Y1DA 1NBWA 3J7ZO 4F2SA 5FROA 1BGXT 1N5YA 3TAGA 3RRGA 4B9LA 3J80O 5M1QA 2HVIA 1DTTA 4BVPA 4B1VA 1NK8A 3RSEB 2QKBA 3DOLA 4V19S 4A5BA 3U6FA 2OTLN 2UXDK 3RMDA 2PBDA 3AGKA 4A59A 3D2EA 4LFAK 3AVHA 1BISA 4JD2A 1BA1A 1TGOA 4I6MA 4E7LA 2BE2A 2OYQA 1VRTA 4ZTFA 4NXMK 1WAJA 3VEXA 4LF7K 1X9SA 4ILGB 3SI6A 1Q18A 4OPHA 3VTHA 4GV3A 1ATRA 4FWMA 4BRFA 3LZIA 3GOIA 4CGHA 4W5TA 2HHSA 1C0FA 3PIOL 2IAJA 4XEIA 1BWFO 1X3NA 4CECA 2D4WA 5C42A 4KH4A 4KBOA 3RMCA 3THXB 1T03A 4OKKA 1RCHA 3EYZA 4MDBA 2ZGYA 3MN5A 1DTQA 3OYJA 3NCIA 3O4QA 4BROA 4O5BA 1VQ5N 3IFRA 2HHUA 4NCGA 4CEEA 4BRCA 5AQMA 4BRDA 4CI6A 4B1YB 3AA4A 4AHUA 2Q31A 2QWOA 2GWJA 1HNVA 4C8KA 1KD1O 4F8RA 3QESA 2HOEA 5AQHA 4O55A 4J2DA 3HRGA 4Z0UA 1JCFA 3I55N 2A6AA 4H8KA 2OCEA 1WSGA 1ZBLA 1KAYA 4DR7K 1Z05A 1WBBA 4H0TB 4B8AB 3T7ZA 4CFCA 4RW4A 2E2PA 1VK0A 3MXMA 1VSIA 1VRUA 1K8AO 3DLEA 3OYBA 4RTFD 1J6ZA 3R9PA 5KRSA 2QWMA 2YV0X 4FO0A 5FPNA 2HHTA 1LWCA 1NJZA 5J2NA 5AQQA 1TYQA 1YI2N 2D0PA 3AV9A 3ZEUA 1C6VA 4EFHA 5M1NA 4IO8A 3QBWA 3IG1A 3KVGA 5GIOA 5AJ3K 1XMQK 3PY8A 2KKZA 2HVHA 1RT1A 2YJFA 3PIPL 3VA0A 3HSTB 3L2VA 2ASPA 4H5TA 3OBYA 2P9PA 2OPQA 1ZC6A 2ETJA 1ILYA 1IV0A 3VQPA 4JI7K 1SAZA 4IEIA 4DSEA 3TWHA 1NNEA 1A5XA 4F3TA 3ZX0A 1VQ8N 4E7IA 1L3SA 4IXCA 2OZMA 3AVGA 5DM7L 3K59A 1NJXA 3OYHA 1ATSA 5KPZA 1VSEA 2GWKA 4YOXA 2Z1JA 4RG8A 4CJFA 1R59O 3NGZA 4CJSA 4JNEA 1DEJA 2FSKA 4Q0BA 5AQIA 4JKFA 4AQYK 2QK9A 3BZKA 4CEOA 4JI4K 4FWNA 2HSTA 5JLHA 3OS2A 3V1OA 3K0SA 3QNOA 1T6DA 3VQ5A 1RFQA 1LCUA 5SZTA 3CCJN 3WEEA 1J9AA 4Z4GA 3CMEN 1RDUA 3H6EA 1JL1A 2BGGA 4BRHA 4CEFA 4WYBA 1VQMN 5C25A 3VQEA 4JI3K 2HHWA 4DV7K 1YIJN 4CHOA 4BREA 1NM1A 3H45C 3VGKA 4IBNA 2F7TA 5AFUA 3CCMN 2GV9A 4MLHA 4GMJB 4BRIA 1HKCA 2KTQA 1TAQA 1RT4A 4LH5A 2BTFA 1WUAA 4BVOA 3OYLA 1N32K 1JL2A 4H5WA 5GIPA 4LF4K 4BRGA 3CXCM 4X62K 4H0VB 4MQ3A 2A42A 1RDWX 5DMRA 2HF3A 4KV8A 3U9ZA 4HUGA 1KFSA 5KQ8A 5AQSA 4GNIA 4PHTX 1B9DA 4XH1A 3ZSRA 4BR0A 3WNGA 4CK1A 1XC9A 3QFUA 4JV5K 3TAFA 4G9ZA 2ITGA 5MLCQ 1XHXA 3ZT2A 4AHVA 2ZWHA 3LDNA 3QIOA 4I9LA 4B1UB 2FF3B 4JK7A 3K5MA 1ASVA 3ASMA 4RW9A 3RMAA 4DR6K 3K9KA 1NGDA 4KB1A 1C1CA 4DV3K 1ZXOA 1ATNA 3KIOA 4BGBA 3CPEA 1SS6A 1NOYA 3FZHA 3OS0A 4FZZA 3TSPA 4JI8K 4I2QA 2V51B 1IG8A 1A5WA 2W6KA 3G6EN 1QS4A 1YTAA 4AHTA 4FOIA 2X6SA 4BG9A 2HNDA 5F1XA 3BGRA 1YAGA 2H3GX 3D2FB 2E8AA 1TVRA 2JGUA 3LWLA 3VEVA 2KW4A 5HRNA 3R6MA 5J2MA 4J2BA 3O4WA 2NRWA 1KC8O 4BQZA 3D0PA 1K8KB 5KI6A 3I0SA 5A2QO 3WXMB 3S3OA 4CGDA 4AHCA 4FWPA 3SPYA 3CIPA 1OH8A 4ISFA 1TKZA 3CPWM 3C6AA 1HKGA 4JK8A 1VQON 1SL1A 3C7NA 4KTQA 3K58A 5BRHA 4BRKA 1VSFA 3LAKA 1U4BA 3DXKB 4B3TK 5IWAK 4IOXA 1N36K 4K42A 3PX0A 1UWBA 4QOZB 4DTRA 5GADP 4BR5A 3M6GA 4YY3K 3RMBA 4L8RB 4ISEA 1SL2A 2NUBA 4HWIA 3V9UA 2WUSA 4JLHA 3S3MA 4CK2A 1VQ4N 3UKRA 4E3SA 1EXQA 2QWPA 4DUYK 4IFYA 3UB5A 4CEZA 4E89A 2D0OA 1WN7A 1E4FT 2W42A 4HUEA 4NCBA 1MDUB 4B3MK 2O8EB 1Y64A 1Q9XA 4JKGA 1XMOK 4DU3A 4FM0A 5AQOA 2F9TA 4CZKA 4OKEA 1LWEA 4J2EA 2NRTA 4CHZA 5I42A 1HNZK 2D1KA 3ZT1A 4YOTA 3L2RA 3FE1A 3ITHA 3V1QA 2ZJPL 3ID8A 4NYFA 4W5OA 1O1WA 4EAHD 4DSIA 3AVBA 3V9WA 1RGIA 2FBTA 4A62A 3NDKA 3UIQA 1S1TA 1GLFO 2F4VK 1BIUA 1JLBA 3DWLA 4BRQA 4X64K 2D0CA 2NRZA 3DLRA 4DV1K 3NF8A 5KQDA 3HPHA 1X9WA 5AZIA 1IKYA 2WOMA 2O8CA 1BOTO 4FOEA 1NK9A 1WB9A 5BPNA 2PZSA 3DYAA 2E5LK 2P51A 4IFEA 2PAVA 2QKKA 2OTJN 3J8AA 4XIUA 1OVQA 4AM7A 1NGCA 4FK2A 3L3UA 4CW7B 4O5FA 2VQEK 1TK8A 5JS2A 4OKJA 1I94K 4BY9C 3ZSWA 4RWTA 1QQOA 5AQFA 5I9EB 5TKYA 4FWLA 4JKBA 3LDSA 1EX4A 2WONA 2ZE2A 3KLFA 4DUZK 2F8SA 5K14A 4B9MA 1WSIA 3KD1E 3VEWA 3K57A 2Z1GA 4ICLA 3EE9A 3A5NC 1VQKN 3THYB 3C6TA 1MWMA 3M1FA 1TL3A 1N8RO 3QEIA 3BY5A 4CIGA 3EKUA 4EHUA 3D6RA 1EQYA 2Q3SA 4CEDA 1S9EA 4CGIA 3ENOA 3ZT4A 4ILJA 1MA9B 2B6AA 3OYKA 3G4SN 3I33A 1HMVA 4WCEL 1XQSC 2KHOA 5J1EA 5CZ1A 3ZT0A 5CR4A 4B9UA 3LDOA 1WBDA 3PO5A 5EX5A 5GINA 4CZGA 3WNEA 3THWA 2F9WA 4CZHA 1TUUA 2YNHA 3C95A 3SUQA 4H0XB 4DQ8A 2NNWA 3AARA 4N76A 4A61A 5AQWA 4K0KK 2P9IB 5KTQA 5M1PA 3NVMA 1RDDA 1HNIA 3ID6A 4RW7A 5CZ2A 4M42A 4C23A 1IKXA 4DF8A 1E3MA 3M8QA 4HHTA 2BUPA 3PLAA 4FCYA 2VG5A 4DF4A 2G8KA 3SUOA 3NH1A 4IOCL 5AQRA 1BI4A 1LW2A 2ZGZA 3J7YP 2VWKA 3KWIA 3OTOK 3R1XA 5ELZA 1VSMA 2E4LA 3J81O 1SV5A 1HR0K 4FJ5A 3P1GA 3AAQA 3QDKA 2W41A 3A5OC 3DLGA 1N34K 2W40A 4FWQA 5TKWA 3DLHA 4C8LA 1KRPA 3U9DA 1VQ9N 2E20A 3AVFA 4BRAA 3LDLA 1GOAA 1BHLA 4LFCK 3GG4A 3B6PA 3L4IA 5CYMA 4FJ9A 4OPKA 4CZMA 1UAXA 5M1KA 4CJ4A 4BC3A 3MXIA 1NGIA 1J5EK 2PY5A 3U8XA 1K73O 3AA3A 5CE3A 1Q8IA 4GKKK 2O8DB 4B8CA 1S5JA 3NF7A 4ID1A 1JLFA 3IRXA 5BR8K 3M8RA 4DR3K 3TI0A 3NE6A 4LY7A 4CERA 3BUZB 4BRPA 2E1ZA 3CQYA 3KK1A 2D0AA 1V4TA 2RPIA 3HI0A 3UE5A 2P1JA 3AVAA 5HBMA 1YXQA 2P9SB 3AGRA 5C2DA 1CZAN 4HCBA 2YKNA 3V6DA 2ITMA 1TKDA 1UOCA 2CH5A 4EIAA 2Q1NA 1X1PA 1S22A 3A5LC 4YHHK 4LF6K 1XNRK 2BDPA 3O08A 4IJNA 2OANA 4FK0A 2IDOA 2NRXA 3OS1A 5CY4A 4JI6K 4CVNE 3KLEA 2EHGA 4CE9A 2Q2RA 4FJJA 2JLEA 3SJHA 3NMUA 1RBRA 4BR4A 2AJQA 3SYZA 4CJVA 3TSUA 3VMFB 4B3OA 4H0OA 5EOYA 3K5NA 1ZYQA 4PL8A 3K5LA 1RTDA 1SL0A 1Z6RA 4B1XB 3L0QA 3DXMB 4GVMA 3SMSA 4E0DA 4FJLA 2E88A 4PKHA 3QIPA 1NMDA 5AZJB 4N47A 4FYDA 3HBTA 3ZETA 2J4RA 2WBNA 1VQ6N 4DV5K 2I5JA 1DLOA 5HRRA 4FLXA 3QERA 1M90O 4NCAA 4KI6A 4BDPA 4HCCA 3RRHA 3L2WA 1IH7A 3CC4N 1L3TA 4EHTA 2UYTA 3EKSA 4KH6A 1NU0A 2RHKA 3CERA 2UUBK 2IVOA 5LY3A 4YFUA 4LF5K 4CJEA 4CF2A 3CJ9A 3MEDA 3QEVA 4FPBA 2X74A 3CQXA 3CETA 4A2AA 2O8BB 2P9LB 1EWQA 3AAPA 2GTDA 3KK2A 1X9JA 2P9UB 3HT3A 1S3XA 1QE1A 4IWVA 1NGGA 2YHWA 1RTHA 3LL3A 1W0HA 3HZ6A 3SBTA 2HHHK 1QZ6A 3VPZA 4DR1K 3OYCA 4KKOA 4DSKA 4HUFA 3CCLN 3TAQA 1IG9A 3CJ7A 4B1WB 3KHYA 4F4KA 3P31A 3ZT3A 5KRTA 2XY7A 2QM1A 1DT9A 4CZIA 3I56N 5DM6L 3EL2A 3VERA 3QEXA 3TTFA 3EEQA 1HQUA 2HB5A 4H4OA 4IJAA 4QCLA 4FPAA 2QWLA 1RT7A 3L2QA 3RTVA 4CF8A 3BDPA 3E9OA 4J2AA 4YDUA 4B3SK 4FJ8A 1S1WA 2Q0UA 3THYA 3TAEA 4KFBA 2CGKA 3JYTA 3PSIA 4BWMA 4GV9A 2G8FA 3DOKA 3SQ1A 1GLEG 4JHDA 4C1NK 1S1VA 5HOOA 3NAEA 4M3TA 3GDQA 2OPPA 4DR2K 4NLCA 5BN8A 1KXPA 3M8PA 4ILHA 1GOCA 5KGXA 4CZLA 2HHXA 4H4MA 1HPZA 3HSCA 1BCMA 1B92A 1JKHA 2QWRA 2E6MA 4FLZA 5BREA 2ATQA 3AVJA 1ASUA 2A41A 4CF1A 3L8BA 3OYEA 3U3GA 3H1VX 4R79A 4Q5VA 1OVYA 5AQVA 1Z26A 3E66A 3QEWA 3ATUA 3T19A 4DQQA 1HYSA 1J54A 3ALYA 3S3NA 5FLXO 5EVZA 3VQ7A 2P9IA 2KZMA 3CFOA 5LL6Z 2YHYA 1VSLA 4JYAK 5KGWA 4FL9A 3CCQN 1KVAA 1U2VB 1NLVA 1WAFA 2OPSA 3VTIA 4CGFA 1NJYA 2YHAA 4K8XA 3DRSA 3KWGA 4IOAL 4CZEA 3C6UA 4WQ5A 3VEYA 1L3VA 4FJKA 2FBVA 4CBUA 4CGJA 4WF9L 4UQGA 4FM1A 4H03B 4DHYA 5C2FA 4CGGA 4JKCA 2IGIA 1WLJA 4FJ7A 1LOTB 3AVLA 3IDHA 3TSQA 1JLQA 1U6ZA 1WOQA 3MWTA 1BU6O 2QWNA 3HTVA 1IBLK 3DLLL 4WFBL 2KZZA 2O8FA 4DQPA 4NYNA 3HJFA 1RT5A 5C10A 1FKOA 4LC9B 3HK2A 4M3UA 1OH7A 3S41A 2X6NA 3VA3A 4PUOA 1RBVA 2D0BA 3UKUA 1D9FA 3MECA 3SBGA 3HPOA 4KHUA 2ZD1A 2XY5A 3W0LA 3CJ1A 3PX4A 3PV8A 2XHBA 5GAEP 4CZFA 3T1YK 3CM5A 3LM2A 4FW2A 1HX1A 3VQ8A 4N41A 3ULDA 2V7YA 4DTNA 1SZ2A 3RSEA 5KPRA 5JS1A 3MN7A 5LJWA 4K41A 1LW0A 2OA8A 1RTJA 1W7AA 5BPLA 1VSDA 3QBXA 3Q7CA 2Z1IA 2F8TA 4M63C 4L3QA 2HHVA 3OYAA 1YF5L 4JS5A 4BR2A 2PYLA 4B9VA 1SQKA 3A5MC 1BUPA 4N5SA 4Y1CA 4KTWA 1KSPA 3A2FA 2ZF5O 4M7XA 3CFRA 2P5GA 4H0YB 3TTDA 2IVNA 1ZBSA 3EN9A 2DPNA 4ZHRA 3ULEB 2P9KB 2YNIA 1NMNA 3THXA 2G8HA 3HO1A 3AA2A 5FPDA 3WXLA 4DU4A 4ELUA 4TSXA 4DTMA 3AVMA 3R3LA 1Q86O 1WSEA 3G71N 4LSNA 1T7PA 3SAHA 3HVTA 2FSNA 3KK7A 3A0IX 3A8YA 2BANA 3O9QA 4FW1A 4DV6K 4E7HA 3KK3A 1FJGK 3DXMA 4FJXA 2A1SA 1U47A 3C6HA 4DSLA 3JSMA 5BN9A 1JLGA 3SAGA 1YVNA 4E1JA 5FRMA 2WFBA 1NKEA 4YDUC 3D2EB 2UU9K 5EY4A 3P39A 4MDAA 4Z4FA 1G99A 1NK6A 3IUCA 4DLEA 4FM2A 4JD2B 4I6MB 4K25A 1GLBG 5BRDA 1EETA 3DLBA 4OGCA 4E7KA 5C0YA 2YHXA 3DRPA 1KQSM 2A40A 1JLAA 3AVKA 3ZSXA 3SQ4A 3TTCA 3E01A 3VGLA 4DS5A 3H08A 3SV4A 3C0BA 3K2PA 1S72N 2D5RA 5BPMA 1S1XA 3O6WA 4FZYA 3Q7BA 4O8UA 3O1WA 1B9FA 2O8BA 4CJ7A 4E1NA 4BRMA 1WSJA 3QEPA 3ENBA 4BRNA 3JS6A 4JEPA 1W97L 4KHQA 4FLVA 3CQ8A 4GY2B 2EX3A 2KFNA 3MAQA 4AH9A 1TKXA 4BE0A 4JN4A 3MCPA 4DFMA 3SQ0A 3MWPA 4X66K 4CESA 3BP8A 2RN2A 2HBLA 5AFUH 1NK7A 4LD0A 2E6LA 4B08A 4BR7A 3GL1A 4KO0A 2KFZA 3LP1A 1J53A 4FWKA 3AO5A 1I39A 3AA5X 4BG8A 4KHWA 1HRHA 1JJ2M 1CZBA 3QETA 1U49A 2OPRA 4FLWA 1RT6A 4K8ZA 4M3WA 1VHXA 3EY1A 4WQ5C 4M45A 4FJHA 3WUHA 5AQTA 1T6CA 1V4SA 3MDQA 2HNYA 4J8FA 2ASOA 3ATVA 4KAZA 2GX9A 3HPGA 3VQCA 4CHQA 1FKPA 2QTDA 5AQGA 4W5NA 5AQLA 1Q7YO 1OH6A 2AA4A 4OX9K 4JI2K 5ADXH 4FJIA 1NWKA 5B8HA 1KVBA 4JKAA 1BIZA 2O4IA 2HMPA 3DM2A 2GUIA 3WXJA 3M3ZA 4CJTA 3PUFA 2ZJQL 5AQUA 2NRHA 4U67L 1TYQB 5FPMA 4ID5A 3I8BA 3ZEUB 3HM9A 3O9TA 1RDCA 4CJKA 1SUQA 1MWKA 2CGJA 1D5AA 1BCOA 2UXBK 3LP2A 3VQ6A 3OW2M 3EO3A 3SQ2A 5LJVA 4KB0A 4Z4EA 3N4QA 4DU1A 4C8OA 4WQ4A 2HBJA 5JMVA 5GAGP 3AO3A 1U2VA 4H5RA 3CCUN 4OLBA 3OYDA 4FWRA 1VQPN 3DI6A 4QAGA 3VF2A 1C0GA 3K5OA 2LSNA 5AQNA 4BWJA 4IDKA 1S1UA 2AP1A 1QTMA 4NB4A 3OY9A 1NJIO 4A5AA 2EWSA 1VQNN 2IS3A 3T69A 1FK9A 3PO4A 3KLHA 4BQLA 4PWDA 3QLHA 3WQTA 3CM6A 3KZBA 1REVA 5J2QA 4CJUA 2KQ2A 1HPMA 3WEEB 4CF9A 2QI2A 3AO2A 4AM6A 4I2PA 4DB3A 1NG9A 4HTUA 5DK5A 5JVHL 2VGMA 3ENHA 1QVGM 3BF3A 2F96A 3LZJA 3P83D 4PKGA 2G8WA 3THVA 1RILA 3O3FA 3G10A 4MO4A 1NGEA 4NXNK 2FF6A 4CHNA 1S6PA 3H3NO 1IJJA 3C65A 4FJMA 1NOZA 1GLAG 2P9NB 3TARA 1BA0A 4O0IA 2XO7A 3NVKA 3F2KA 3D2FA 1X9MA 1HYVA 1F21A 1ZBUA 2HHQA 2NRVA 4B9SA 3L4QA 1K8KA 4OPJA 4DSFA 4DTJA 3SK3A 2FC0A 4YORA 1C1BA 2VQFK 4B9TA 4CJLA 3VQ9A 3MCAB 3VF4A 4KTZA 3TAPA 2A3ZA 4DFJA 1X3MA 1YJWN 5AQJA 4A2BA 1SKRA 1KVCA 3EE8A 3FFKB 5I3UA 1G15A 4CHYA 2P9KA 3VF6A 4Z4CA 1CXQA 1ZBFA 2FBYA 2HBMA 1QQCA 4FJNA 2NZTA 3DXKA 3SUPA 3BF1A 4U7BA 3U4LA 3ZSZA 3V9XA 3S9HA 4C1NI 1VSJA 4B9NA 3O3HA 3V9ZA 2E2OA 5H1SQ 1NKCA 4DSJA 1XNQK 2UUCK 2HNZA 1BG3A 2RF2A 2E2QA 3HOSA 1RDAA 3G0ZA 4QS9A 1TL1A 2FBXA 4H5VA 3AVNA 4FJGA 3IAYA 1FW6A 4JI0K 1EKEA 4EP5A 2VGNA 4MFBA 3T1HK 4EP4A 1UA0A 4FSVA 3OA9A 4CJQA 3FZFA 4BDZA 5E41A 2ZM6K 3SUNA 1T3VA 2O8EA 1GLJO 1A5VA 3VN5A 2YHBA 3VEOA 3RWUA 4O44A 4CEQA 4JI5K 1ITGA 1WSHA 3KLGA 2ZJRL 3CF5L 3KLIA 1KLMA 3K9JA 5HRPA 5C15A 3LAMA 2DY4A 4FLTA 1YT3A 1S9GA 2Q0RA 4XH4A 1C1AA 3C7NB 4M3XA 2Q36A 5HLFA 1JCGA 3ZX3A 4CHPA 3M8SA 4DQSA 2Y1JA 1KLNA 3CJBA 5EXWA 3V81A 1JCEA 1NGHA 1RBSA 5F0XA 2HF4A 5LMUK 4KHNA 4WQ4C 4WFNL 3QNNA 2E1YA 3TABA 2PFUA 5C24A 4OGEA 1IO2A 3VQQA 4A57A 4KI4A 1D4XA 2YKMA 4IDHA 3UKRB 5AQYA 4O8KA 3FZMA 1BL3A 2HBKA 2GEMA 4LF8K 1W9HA 4Y0WA 2G8UA 2UXCK 3VQAA 3H1QA 1RDBA 3L3VA 1J5OA 1HNWK 1TAUA 3KD5E 1NK5A 4ISGA 4IKFA 4CBXA 4DKWA 2QEXN 4IZ9A 4JKGB 3LANA 1YJ9N 1QQMA 3HL8A 1HKBA 4OPAA 2QXLA 2FLOA 1ASWA 1CLQA 3ZX2A 3FLCO 4R5PA 5SWMA 4HTLA 3HP6A 3LM9A 1P90A 1P8ZA 3F9KA 3TAMA 3VOVA 3JAMO 1Y97A 3VEZA 3VQDA 1BQMA 2YI1A 2UUAK 3D7EO 4CK3A 3OJUA 4YOYA 3VENA 3QFPA 2QWQA 4ELTA 4CZJA 4Z94A 1CXUA 1NJWA 3LALA 3CD6N 4H5NA 3VETA 4B1ZA 3O3GA 3B8AX 1QHAA 4DR4K 4BC5A 5AQZA 4BE2A 1HNXK 3CC7N 3QB0A 4QS7A 3KKSA 3RR7A 4DWIA 4OLAA 5AZIB 3E1YA 5AQXA 1ZBHA 1H1VA 2O8CB 4YNQA 4KHYA 1HLUA 1LWFA 3NGYA 3O80A 4OO1J 1W2BM 3P5JA 3WQUA 3JXUA 1OH5A 5F2RA 1GLCG 4DQRA 1YHQN 4BC2A 1U45A 3FZLA 3CHWA 1YVUA 3OYIA 4CIFA 3SV3A 2NRRA 4DTOA 4PKIA 4IFVA 2CH6A 4FWSA 3CCEN 1VSKA 3CJAA 3MEGA 4JK9A 4AILC 2DFHA 3ZSVA 4CD3A 4BE1A 3OJSA 1GLDG 4DS4A 1LAVA 2QW9A 1E4GT 1M1KO 3FFIA 2QA4N 5J2PA 1RTIA 4FLYA 2A5XA 1HQEA 3P4IA 1R0AA 3PX6A 4WFAL 4MLEA 1YJNN 4E7JA 2QXFA 4B3RK 4YOUA 4KHSA 3ZLJA 1S6QA 3V9SA 1TV6A 4G1QA 1NGBA 3LPTA 3SCXA 4DTSA 2KLAA 2Q97A 5HP1A 2P9NA 1BO5O 3CYMA 3CMAN 4WE1A 4GV6A 4OJRA 3PSFA 2B4JA 5FPEA 1RNHA 4PQUA 4JKHA 4F2RA 1U48A 2FSJA 2VYPA 1KFDA 4W5RA 3W3DA 5M1OA 1RT3A 4DTUA 5ADXA 3E9PA 5C12A 3CCVN 2ZQBA 4CIEA 2O8DA 2JWKA 3THWB 3WT0A 2GELA 4C8NA 5D3GA 1WSFA 1XC3A 1DGKN 2WTUA 1RBUA 3QMLA 4DV2K 3ZYYX 3O4NA 3FZKA 5EU7A 3NGIA 4DV4K 2P9SA 2W6LA 4DG1A 1GOBA 1K9MO 2NLXA 4FVMA 3FR0A 2R7YA 1RBTA 3V1RA 5HRSA 2V7ZA 2VCPA 2YNFA 3OHRA 3VQBA 3LP0A 4F3OA 5KPTA 1NKBA 3WNHA 4PL7A 3NH2A 1BI4B
chains in the Genus database with same CATH topology
2ETJA 4B8CA 1S5JA 3NF7A 4ID1A 2Y1IA 1JLFA 4FJIA 1IKVA 3IRXA 3QO9A 1QHTA 4O4GA 3M8RA 3VQPA 1KVBA 1BIZA 2O4IA 4DSEA 3TI0A 3TR8A 3DM2A 4KRFA 2GUIA 3NE6A 4LY7A 1LAWA 4CERA 3TWHA 3NFAA 1A5XA 3KK1A 4CJTA 3PUFA 4F3TA 2D0AA 4Z4IA 2RPIA 5CYQA 3KJVA 2P1JA 4E7IA 4FZXC 3AVAA 3AVIA 4ID5A 1L3SA 5HBMA 2OZMA 3AVGA 3HM9A 3K59A 1NJXA 1RDCA 4CJKA 3OYHA 1SUQA 4CEBA 1VSEA 3NF9A 4DQIA 4HCBA 2Z1JA 4RG8A 2YKNA 1D5AA 4CJFA 4CJSA 3ZSOA 3NGZA 1C0UA 3V6DA 1BCOA 1TKDA 3LP2A 1UOCA 3VQ6A 1QSSA 4Q0BA 2OZSA 3SQ2A 4Z4HA 2QK9A 3D45A 4O0JA 4CEOA 1X1PA 4KB0A 3CFPA 4Z4EA 3OS2A 3V1OA 3QNOA 4DU1A 1JLCA 4C8OA 4CFDA 2BDPA 1HJRA 3VQ5A 5SZTA 3V4IA 4FK0A 1D9DA 1UA1A 1IKWA 2IDOA 3OS1A 3SZ2A 5CY4A 1TK5A 2A1RA 1J9AA 4Z4GA 4CJRA 3AO3A 3NF6A 1XI1A 3KLEA 1ZBIA 1JL1A 3ZCMA 2BGGA 2EHGA 4CEFA 4CE9A 5C25A 3VQEA 1KTQA 3OVNA 4CFBA 3OYDA 3U3YA 4OLBA 2HHWA 3T1AA 4FJJA 3DI6A 2JLEA 4QAGA 4CHOA 3AO4A 1RBRA 2LSNA 3K5OA 4IBNA 2AJQA 4BWJA 3SYZA 4CJVA 4IDKA 1S1UA 1VSHA 1QTMA 2GV9A 3OYFA 3OY9A 3NHGA 4B3OA 4GMJB 2YNGA 3K5NA 2KTQA 2IS3A 1TAQA 1ZYQA 1FK9A 1RT4A 4PY5A 3K5LA 4BDYA 1RTDA 1SL0A 3PO4A 3KLHA 4LH5A 3LPUA 3QLHA 4PWDA 3CM6A 4GVMA 1REVA 5T7BA 4E0DA 4M3ZA 4FJLA 5J2QA 3QIPA 3OYLA 4CJUA 2KQ2A 1JL2A 3ISNC 4CF9A 3RR8A 1XWLA 3AO2A 3AO1A 1SKSA 4CFAA 4N47A 4FYDA 1WNSA 4I2PA 2IC3A 4CJPA 4MQ3A 4FK4A 4HTUA 3KTQA 5DK5A 5DMRA 1TK0A 2I5JA 4KV8A 1DLOA 4BACA 3SJJA 4HUGA 5HRRA 1KFSA 4FLXA 1C0TA 3QERA 4NCAA 4KI6A 4BDPA 3HVRA 2F96A 3DMJA 1B9DA 3LZJA 3ZSRA 4HCCA 3P83D 3RRHA 3WNGA 3THVA 4CK1A 1RILA 1XC9A 2G8WA 3L2WA 1IH7A 3O3FA 1L3TA 3G10A 3TAFA 3WNHA 4CHNA 2ITGA 1XHXA 1S6PA 3ZT2A 4CJ3A 4DTPA 4AHVA 3TANA 2XY8A 3QIOA 4I9LA 4FJMA 3K5MA 1NOZA 4YFUA 1TKTA 1I3AA 4CJEA 1ASVA 3ASMA 4CF2A 3TARA 1NK4A 4RW9A 3RMAA 3QEVA 3MEDA 4O0IA 2XO7A 1X9MA 1HYZA 2XRIA 2X74A 4CF0A 4DFKA 1TAUA 4KB1A 1HYVA 1F21A 1C1CA 3I8DA 1ZBUA 3B6OA 3KK2A 2HHQA 3CG7A 4CEAA 3KIOA 4N56A 3HT3A 4EZ9A 4B9SA 1T05A 3IS9A 1QE1A 4OPJA 4LSLA 2FC0A 1RTHA 4DSFA 1W0HA 4DTJA 1C1BA 1NOYA 4B9TA 3OS0A 2VG7A 1Q9YA 3VQ4A 4CJLA 1N6QA 3VQ9A 4FZZA 3OYCA 4I2QA 4KTZA 1BQNA 3TAPA 4KKOA 4DFJA 4DSKA 4DTXA 4HUFA 5HROA 1A5WA 3TAQA 1SKRA 1IG9A 1QS4A 1YTAA 4AHTA 1KVCA 4FXDA 5I3UA 4F4KA 4AHRA 1G15A 2X6SA 4CHYA 3L2UA 2HNDA 3BGRA 1CXQA 4Z4CA 3ZT3A 5KRTA 1ZBFA 2FBYA 3OYNA 1QQCA 2XY7A 4FJNA 3ZSQA 1TVRA 2JGUA 3LWLA 3SUPA 3V9XA 3ZSZA 4ZTJA 2KW4A 2VG6A 5HRNA 3QEXA 3S9HA 1VSJA 1HQUA 2HB5A 4H4OA 4B9NA 3DLKA 4RW8A 1K6YA 3O3HA 3V9ZA 5J2MA 1D8YA 4J2BA 2RKIA 1NKCA 4DSJA 4QCLA 1RT7A 3L2QA 3D0PA 4CF8A 2Z1HA 3RTVA 3HK2A 3BDPA 5KI6A 4C8MA 3I0SA 2HNZA 4J2AA 2RF2A 1NK0A 3I0RA 4FJ8A 2B5JA 3LP3A 3S3OA 3MEEA 1RDAA 4CGDA 5FDLA 1S1WA 3G0ZA 4AHCA 4OVLA 3LWMA 3TAEA 1TL1A 4KFBA 3SPYA 3MXJA 2FBXA 1TKZA 3JYTA 3AVNA 2P5OA 4BWMA 2G8FA 3DOKA 4FJGA 3IAYA 3SQ1A 4I9QA 5FRNA 1EKEA 4EP5A 1S1VA 4DLGA 4MFBA 3NAEA 4M3TA 4EP4A 1SL1A 2OPPA 1UA0A 2DFEA 4KTQA 3K58A 1VSFA 1U04A 3LAKA 4CJQA 3M8PA 1QSYA 4JS4A 1U4BA 4BDZA 5E41A 1GOCA 5KGXA 3C94A 3SUNA 3HP9A 4JRQA 2HHXA 4H4MA 1HPZA 1BCMA 1B92A 4PA1A 1JKHA 3PX0A 1UWBA 4CJ5A 4CCHA 1A5VA 3SPZA 1RT2A 1JLEA 1JXEA 3VN5A 4QOZB 2YHBA 2E6MA 4M41A 4DTRA 4FLZA 4DMNA 3KKRA 3AVCA 3NH0A 3RWUA 4O44A 4CEQA 1FXXA 2ATQA 1ITGA 1WSHA 1EP4A 3RMBA 3AVJA 2VWJA 4L8RB 3KLGA 1ASUA 3KLIA 1SL2A 2NUBA 1KLMA 3V9UA 5HRPA 1CZ9A 4CF1A 3LAMA 3OYEA 3U3GA 4JLHA 3L8BA 2DY4A 4KREA 3S3MA 4Q5VA 4FLTA 4CK2A 1YT3A 1S9GA 2G8VA 1Z26A 1C0MA 2IOCA 2O4GA 3T19A 4DQQA 3QEWA 4E3SA 1EXQA 1HYSA 1J54A 3ALYA 3S3NA 2G8IA 1C1AA 4IFYA 3VQ7A 4CEZA 4M3XA 4E89A 3HYFA 2KZMA 3EZ5A 5HLFA 1XHZA 4CHPA 1WN7A 3CFOA 3M8SA 2W42A 2HW3A 4HUEA 4DQSA 1VSLA 2X78A 5KGWA 2Y1JA 1KLNA 4EZ6A 4NCBA 1KVAA 1WAFA 1JXBA 3V81A 1Q9XA 1RBSA 1QSLA 3QINA 2OPSA 3ZSYA 4CGFA 1NJYA 2YHAA 4K8XA 3DRSA 4KHNA 4I7FA 3OYMA 4DU3A 3C6UA 1L3VA 4FM0A 1Z25A 3QNNA 4FJKA 2FBVA 4CGJA 4UQGA 3TABA 4OKEA 5C24A 4OGEA 1LWEA 4FM1A 1IO2A 4DFPA 4J2EA 2DFFA 2GBZA 3VQQA 4CGGA 4KI4A 1LV5A 4E19A 1MU2A 2IGIA 1WLJA 2YKMA 4FJ7A 4GW6A 3AVLA 4CHZA 4JRPA 2XY6A 1JLQA 4E1MA 5I42A 1BL3A 3OYGA 4AHSA 3ZT1A 3L2RA 2KZZA 1W9HA 3ITHA 3V1QA 4W5QA 2PYJA 2G8UA 4DQPA 4NYNA 3VQAA 1RT5A 4NYFA 1L3UA 3HJFA 2DTUA 4W5OA 4LH4A 1FKOA 1O1WA 1RDBA 3L3VA 4IG0A 1T8EA 3AVBA 3V9WA 1J5OA 2FBTA 3KD5E 4DSIA 4M3UA 1NK5A 3SNNA 2X6NA 3VA3A 4PUOA 1RBVA 3NDKA 4IKFA 2D0BA 1D9FA 3UIQA 1S1TA 3NBPA 3MECA 1BIUA 3HPOA 4KHUA 1JLBA 2ZD1A 3LANA 1YTUA 2XY5A 3DRRA 4CJWA 3HL8A 3PX4A 2HMIA 3PV8A 3F73A 2XHBA 1ASWA 2D0CA 3CM5A 3DLRA 1CLQA 4R5PA 5SWMA 3HP6A 4FW2A 3NF8A 3VQ8A 1L5UA 4N41A 3HPHA 3ULDA 4KPYA 4M3RA 4DTNA 5JS1A 1X9WA 3F9KA 3TAMA 1IKYA 2WOMA 1Y97A 4HVJA 3VQDA 3HXMA 1SKWA 4M3YA 1NK9A 1BQMA 1LW0A 2OA8A 2PZSA 3WNFA 1RTJA 4CK3A 4RW6A 1KCFA 3DYAA 3T3FA 1VSDA 4FLUA 2P51A 4IG3A 3OJUA 2Z1IA 2F8TA 2HHVA 3OYAA 2QKKA 4ELTA 4JS5A 2PYLA 4B9VA 4ELVA 4XIUA 1CXUA 4N5SA 4Y1CA 1NJWA 4KTWA 3LALA 4Y1DA 3A2FA 3L3UA 1KSPA 4FK2A 4F2SA 5FROA 1BGXT 3CFRA 3TAGA 1N5YA 3RRGA 2P5GA 1TK8A 3O3GA 4B9LA 5JS2A 4OKJA 3ZSWA 2HVIA 1DTTA 4BE2A 1NK8A 3RR7A 4DWIA 3KKSA 4OLAA 2QKBA 3DOLA 4ZHRA 1ZBHA 3U6FA 4YNQA 4KHYA 3RMDA 2YNIA 1LWFA 3NGYA 3LDSA 1EX4A 2WONA 2ZE2A 3KLFA 2G8HA 3HO1A 3AA2A 3AVHA 3P5JA 2F8SA 5K14A 4DU4A 4ELUA 4B9MA 4TSXA 1BISA 1WSIA 4DQRA 4DTMA 3AVMA 3KD1E 1TGOA 4E7LA 1U45A 1WSEA 1YVUA 4LSNA 3OYIA 2BE2A 3K57A 1T7PA 4CIFA 2OYQA 3SV3A 1VRTA 4DTOA 4ZTFA 3HVTA 4IFVA 2Z1GA 4ICLA 1WAJA 4FW1A 2BANA 1X9SA 3SI6A 1VSKA 3MEGA 3KK3A 4E7HA 3C6TA 4AILC 4FJXA 2DFHA 2A1SA 3ZSVA 4BE1A 1TL3A 3LZIA 3OJSA 1U47A 3QEIA 4DS4A 1LAVA 4CGHA 4W5TA 4CIGA 3JSMA 4DSLA 1JLGA 4CEDA 2Q3SA 2HHSA 1S9EA 3FFIA 2IAJA 5J2PA 5FRMA 1RTIA 4FLYA 4CECA 4CGIA 3ZT4A 1NKEA 2B6AA 5C42A 3RMCA 1HQEA 3OYKA 1T03A 4OKKA 1R0AA 3PX6A 4Z4FA 1HMVA 1NK6A 1RCHA 4E7JA 4DLEA 4FM2A 3EYZA 2QXFA 1DTQA 3OYJA 3NCIA 3O4QA 5CZ1A 3ZT0A 5J1EA 4O5BA 4B9UA 4KHSA 1EETA 3DLBA 4OGCA 4E7KA 2HHUA 4NCGA 1S6QA 3V9SA 4CEEA 1TV6A 4G1QA 3PO5A 3DRPA 3LPTA 3WNEA 3SCXA 4DTSA 3AA4A 1JLAA 3AVKA 3ZSXA 4AHUA 5HP1A 2YNHA 3SQ4A 3C95A 3E01A 1HNVA 4DS5A 3SUQA 3H08A 4C8KA 3CYMA 3SV4A 3K2PA 4F8RA 2D5RA 4WE1A 1S1XA 3QESA 4O55A 4FZYA 4J2DA 4OJRA 4Z0UA 4N76A 1B9FA 2B4JA 4E1NA 5KTQA 1RNHA 4PQUA 4H8KA 1WSJA 1WSGA 3QEPA 4F2RA 1ZBLA 1RDDA 1HNIA 5CZ2A 4RW7A 1U48A 4M42A 4KHQA 4FLVA 1IKXA 4DF8A 3CQ8A 3M8QA 4HHTA 2EX3A 2KFNA 1KFDA 4W5RA 3MAQA 4AH9A 4FCYA 2VG5A 4DF4A 1RT3A 3SUOA 1TKXA 4DTUA 3NH1A 2G8KA 4B8AB 4BE0A 4DFMA 4CFCA 2ZQBA 4CIEA 3SQ0A 4RW4A 1BI4A 1LW2A 4CESA 1VK0A 2RN2A 3MXMA 1VSIA 2VWKA 4C8NA 1VRUA 3DLEA 4LD0A 2E6LA 3OYBA 4B08A 1NK7A 5D3GA 1WSFA 4KO0A 2KFZA 5KRSA 3LP1A 1VSMA 2YV0X 2HHTA 1RBUA 2E4LA 1J53A 1LWCA 1SV5A 3AO5A 1I39A 3AA5X 4KHWA 1HRHA 3O4NA 4FJ5A 1CZBA 3P1GA 3QETA 1NJZA 5J2NA 5EU7A 3DLGA 3NGIA 1U49A 2OPRA 4FLWA 1RT6A 4K8ZA 3DLHA 4M3WA 4C8LA 3AV9A 1KRPA 4DG1A 1GOBA 1C6VA 3EY1A 4M45A 4FJHA 4FVMA 3IG1A 3AVFA 2R7YA 1RBTA 2HNYA 3PY8A 1GOAA 1BHLA 2HVHA 3V1RA 4KAZA 3B6PA 5CYMA 5HRSA 4FJ9A 1RT1A 3HPGA 3VQCA 4OPKA 4CHQA 1UAXA 3VA0A 1FKPA 4CJ4A 2YNFA 3MXIA 3HSTB 3VQBA 3LP0A 3L2VA 2PY5A 4F3OA 4W5NA 3AA3A 1NKBA 2OPQA 3NH2A 1Q8IA 1BI4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ETJ A;  4B8C A;  1S5J A;  3NF7 A;  4ID1 A;  2Y1I A;  1JLF A;  4FJI A;  1IKV A;  3IRX A;  3QO9 A;  1QHT A;  4O4G A;  3M8R A;  3VQP A;  1KVB A;  1BIZ A;  2O4I A;  4DSE A;  3TI0 A;  3TR8 A;  3DM2 A;  4KRF A;  2GUI A;  3NE6 A;  4LY7 A;  1LAW A;  4CER A;  3TWH A;  3NFA A;  1A5X A;  3KK1 A;  4CJT A;  3PUF A;  4F3T A;  2D0A A;  4Z4I A;  2RPI A;  5CYQ A;  3KJV A;  2P1J A;  4E7I A;  4FZX C;  3AVA A;  3AVI A;  4ID5 A;  1L3S A;  5HBM A;  2OZM A;  3AVG A;  3HM9 A;  3K59 A;  1NJX A;  1RDC A;  4CJK A;  3OYH A;  1SUQ A;  4CEB A;  1VSE A;  3NF9 A;  4DQI A;  4HCB A;  2Z1J A;  4RG8 A;  2YKN A;  1D5A A;  4CJF A;  4CJS A;  3ZSO A;  3NGZ A;  1C0U A;  3V6D A;  1BCO A;  1TKD A;  3LP2 A;  1UOC A;  3VQ6 A;  1QSS A;  4Q0B A;  2OZS A;  3SQ2 A;  4Z4H A;  2QK9 A;  3D45 A;  4O0J A;  4CEO A;  1X1P A;  4KB0 A;  3CFP A;  4Z4E A;  3OS2 A;  3V1O A;  3QNO A;  4DU1 A;  1JLC A;  4C8O A;  4CFD A;  2BDP A;  1HJR A;  3VQ5 A;  5SZT A;  3V4I A;  4FK0 A;  1D9D A;  1UA1 A;  1IKW A;  2IDO A;  3OS1 A;  3SZ2 A;  5CY4 A;  1TK5 A;  2A1R A;  1J9A A;  4Z4G A;  4CJR A;  3AO3 A;  3NF6 A;  1XI1 A;  3KLE A;  1ZBI A;  1JL1 A;  3ZCM A;  2BGG A;  2EHG A;  4CEF A;  4CE9 A;  5C25 A;  3VQE A;  1KTQ A;  3OVN A;  4CFB A;  3OYD A;  3U3Y A;  4OLB A;  2HHW A;  3T1A A;  4FJJ A;  3DI6 A;  2JLE A;  4QAG A;  4CHO A;  3AO4 A;  1RBR A;  2LSN A;  3K5O A;  4IBN A;  2AJQ A;  4BWJ A;  3SYZ A;  4CJV A;  4IDK A;  1S1U A;  1VSH A;  1QTM A;  2GV9 A;  3OYF A;  3OY9 A;  3NHG A;  4B3O A;  4GMJ B;  2YNG A;  3K5N A;  2KTQ A;  2IS3 A;  1TAQ A;  1ZYQ A;  1FK9 A;  1RT4 A;  4PY5 A;  3K5L A;  4BDY A;  1RTD A;  1SL0 A;  3PO4 A;  3KLH A;  4LH5 A;  3LPU A;  3QLH A;  4PWD A;  3CM6 A;  4GVM A;  1REV A;  5T7B A;  4E0D A;  4M3Z A;  4FJL A;  5J2Q A;  3QIP A;  3OYL A;  4CJU A;  2KQ2 A;  1JL2 A;  3ISN C;  4CF9 A;  3RR8 A;  1XWL A;  3AO2 A;  3AO1 A;  1SKS A;  4CFA A;  4N47 A;  4FYD A;  1WNS A;  4I2P A;  2IC3 A;  4CJP A;  4MQ3 A;  4FK4 A;  4HTU A;  3KTQ A;  5DK5 A;  5DMR A;  1TK0 A;  2I5J A;  4KV8 A;  1DLO A;  4BAC A;  3SJJ A;  4HUG A;  5HRR A;  1KFS A;  4FLX A;  1C0T A;  3QER A;  4NCA A;  4KI6 A;  4BDP A;  3HVR A;  2F96 A;  3DMJ A;  1B9D A;  3LZJ A;  3ZSR A;  4HCC A;  3P83 D;  3RRH A;  3WNG A;  3THV A;  4CK1 A;  1RIL A;  1XC9 A;  2G8W A;  3L2W A;  1IH7 A;  3O3F A;  1L3T A;  3G10 A;  3TAF A;  3WNH A;  4CHN A;  2ITG A;  1XHX A;  1S6P A;  3ZT2 A;  4CJ3 A;  4DTP A;  4AHV A;  3TAN A;  2XY8 A;  3QIO A;  4I9L A;  4FJM A;  3K5M A;  1NOZ A;  4YFU A;  1TKT A;  1I3A A;  4CJE A;  1ASV A;  3ASM A;  4CF2 A;  3TAR A;  1NK4 A;  4RW9 A;  3RMA A;  3QEV A;  3MED A;  4O0I A;  2XO7 A;  1X9M A;  1HYZ A;  2XRI A;  2X74 A;  4CF0 A;  4DFK A;  1TAU A;  4KB1 A;  1HYV A;  1F21 A;  1C1C A;  3I8D A;  1ZBU A;  3B6O A;  3KK2 A;  2HHQ A;  3CG7 A;  4CEA A;  3KIO A;  4N56 A;  3HT3 A;  4EZ9 A;  4B9S A;  1T05 A;  3IS9 A;  1QE1 A;  4OPJ A;  4LSL A;  2FC0 A;  1RTH A;  4DSF A;  1W0H A;  4DTJ A;  1C1B A;  1NOY A;  4B9T A;  3OS0 A;  2VG7 A;  1Q9Y A;  3VQ4 A;  4CJL A;  1N6Q A;  3VQ9 A;  4FZZ A;  3OYC A;  4I2Q A;  4KTZ A;  1BQN A;  3TAP A;  4KKO A;  4DFJ A;  4DSK A;  4DTX A;  4HUF A;  5HRO A;  1A5W A;  3TAQ A;  1SKR A;  1IG9 A;  1QS4 A;  1YTA A;  4AHT A;  1KVC A;  4FXD A;  5I3U A;  4F4K A;  4AHR A;  1G15 A;  2X6S A;  4CHY A;  3L2U A;  2HND A;  3BGR A;  1CXQ A;  4Z4C A;  3ZT3 A;  5KRT A;  1ZBF A;  2FBY A;  3OYN A;  1QQC A;  2XY7 A;  4FJN A;  3ZSQ A;  1TVR A;  2JGU A;  3LWL A;  3SUP A;  3V9X A;  3ZSZ A;  4ZTJ A;  2KW4 A;  2VG6 A;  5HRN A;  3QEX A;  3S9H A;  1VSJ A;  1HQU A;  2HB5 A;  4H4O A;  4B9N A;  3DLK A;  4RW8 A;  1K6Y A;  3O3H A;  3V9Z A;  5J2M A;  1D8Y A;  4J2B A;  2RKI A;  1NKC A;  4DSJ A;  4QCL A;  1RT7 A;  3L2Q A;  3D0P A;  4CF8 A;  2Z1H A;  3RTV A;  3HK2 A;  3BDP A;  5KI6 A;  4C8M A;  3I0S A;  2HNZ A;  4J2A A;  2RF2 A;  1NK0 A;  3I0R A;  4FJ8 A;  2B5J A;  3LP3 A;  3S3O A;  3MEE A;  1RDA A;  4CGD A;  5FDL A;  1S1W A;  3G0Z A;  4AHC A;  4OVL A;  3LWM A;  3TAE A;  1TL1 A;  4KFB A;  3SPY A;  3MXJ A;  2FBX A;  1TKZ A;  3JYT A;  3AVN A;  2P5O A;  4BWM A;  2G8F A;  3DOK A;  4FJG A;  3IAY A;  3SQ1 A;  4I9Q A;  5FRN A;  1EKE A;  4EP5 A;  1S1V A;  4DLG A;  4MFB A;  3NAE A;  4M3T A;  4EP4 A;  1SL1 A;  2OPP A;  1UA0 A;  2DFE A;  4KTQ A;  3K58 A;  1VSF A;  1U04 A;  3LAK A;  4CJQ A;  3M8P A;  1QSY A;  4JS4 A;  1U4B A;  4BDZ A;  5E41 A;  1GOC A;  5KGX A;  3C94 A;  3SUN A;  3HP9 A;  4JRQ A;  2HHX A;  4H4M A;  1HPZ A;  1BCM A;  1B92 A;  4PA1 A;  1JKH A;  3PX0 A;  1UWB A;  4CJ5 A;  4CCH A;  1A5V A;  3SPZ A;  1RT2 A;  1JLE A;  1JXE A;  3VN5 A;  4QOZ B;  2YHB A;  2E6M A;  4M41 A;  4DTR A;  4FLZ A;  4DMN A;  3KKR A;  3AVC A;  3NH0 A;  3RWU A;  4O44 A;  4CEQ A;  1FXX A;  2ATQ A;  1ITG A;  1WSH A;  1EP4 A;  3RMB A;  3AVJ A;  2VWJ A;  4L8R B;  3KLG A;  1ASU A;  3KLI A;  1SL2 A;  2NUB A;  1KLM A;  3V9U A;  5HRP A;  1CZ9 A;  4CF1 A;  3LAM A;  3OYE A;  3U3G A;  4JLH A;  3L8B A;  2DY4 A;  4KRE A;  3S3M A;  4Q5V A;  4FLT A;  4CK2 A;  1YT3 A;  1S9G A;  2G8V A;  1Z26 A;  1C0M A;  2IOC A;  2O4G A;  3T19 A;  4DQQ A;  3QEW A;  4E3S A;  1EXQ A;  1HYS A;  1J54 A;  3ALY A;  3S3N A;  2G8I A;  1C1A A;  4IFY A;  3VQ7 A;  4CEZ A;  4M3X A;  4E89 A;  3HYF A;  2KZM A;  3EZ5 A;  5HLF A;  1XHZ A;  4CHP A;  1WN7 A;  3CFO A;  3M8S A;  2W42 A;  2HW3 A;  4HUE A;  4DQS A;  1VSL A;  2X78 A;  5KGW A;  2Y1J A;  1KLN A;  4EZ6 A;  4NCB A;  1KVA A;  1WAF A;  1JXB A;  3V81 A;  1Q9X A;  1RBS A;  1QSL A;  3QIN A;  2OPS A;  3ZSY A;  4CGF A;  1NJY A;  2YHA A;  4K8X A;  3DRS A;  4KHN A;  4I7F A;  3OYM A;  4DU3 A;  3C6U A;  1L3V A;  4FM0 A;  1Z25 A;  3QNN A;  4FJK A;  2FBV A;  4CGJ A;  4UQG A;  3TAB A;  4OKE A;  5C24 A;  4OGE A;  1LWE A;  4FM1 A;  1IO2 A;  4DFP A;  4J2E A;  2DFF A;  2GBZ A;  3VQQ A;  4CGG A;  4KI4 A;  1LV5 A;  4E19 A;  1MU2 A;  2IGI A;  1WLJ A;  2YKM A;  4FJ7 A;  4GW6 A;  3AVL A;  4CHZ A;  4JRP A;  2XY6 A;  1JLQ A;  4E1M A;  5I42 A;  1BL3 A;  3OYG A;  4AHS A;  3ZT1 A;  3L2R A;  2KZZ A;  1W9H A;  3ITH A;  3V1Q A;  4W5Q A;  2PYJ A;  2G8U A;  4DQP A;  4NYN A;  3VQA A;  1RT5 A;  4NYF A;  1L3U A;  3HJF A;  2DTU A;  4W5O A;  4LH4 A;  1FKO A;  1O1W A;  1RDB A;  3L3V A;  4IG0 A;  1T8E A;  3AVB A;  3V9W A;  1J5O A;  2FBT A;  3KD5 E;  4DSI A;  4M3U A;  1NK5 A;  3SNN A;  2X6N A;  3VA3 A;  4PUO A;  1RBV A;  3NDK A;  4IKF A;  2D0B A;  1D9F A;  3UIQ A;  1S1T A;  3NBP A;  3MEC A;  1BIU A;  3HPO A;  4KHU A;  1JLB A;  2ZD1 A;  3LAN A;  1YTU A;  2XY5 A;  3DRR A;  4CJW A;  3HL8 A;  3PX4 A;  2HMI A;  3PV8 A;  3F73 A;  2XHB A;  1ASW A;  2D0C A;  3CM5 A;  3DLR A;  1CLQ A;  4R5P A;  5SWM A;  3HP6 A;  4FW2 A;  3NF8 A;  3VQ8 A;  1L5U A;  4N41 A;  3HPH A;  3ULD A;  4KPY A;  4M3R A;  4DTN A;  5JS1 A;  1X9W A;  3F9K A;  3TAM A;  1IKY A;  2WOM A;  1Y97 A;  4HVJ A;  3VQD A;  3HXM A;  1SKW A;  4M3Y A;  1NK9 A;  1BQM A;  1LW0 A;  2OA8 A;  2PZS A;  3WNF A;  1RTJ A;  4CK3 A;  4RW6 A;  1KCF A;  3DYA A;  3T3F A;  1VSD A;  4FLU A;  2P51 A;  4IG3 A;  3OJU A;  2Z1I A;  2F8T A;  2HHV A;  3OYA A;  2QKK A;  4ELT A;  4JS5 A;  2PYL A;  4B9V A;  4ELV A;  4XIU A;  1CXU A;  4N5S A;  4Y1C A;  1NJW A;  4KTW A;  3LAL A;  4Y1D A;  3A2F A;  3L3U A;  1KSP A;  4FK2 A;  4F2S A;  5FRO A;  1BGX T;  3CFR A;  3TAG A;  1N5Y A;  3RRG A;  2P5G A;  1TK8 A;  3O3G A;  4B9L A;  5JS2 A;  4OKJ A;  3ZSW A;  2HVI A;  1DTT A;  4BE2 A;  1NK8 A;  3RR7 A;  4DWI A;  3KKS A;  4OLA A;  2QKB A;  3DOL A;  4ZHR A;  1ZBH A;  3U6F A;  4YNQ A;  4KHY A;  3RMD A;  2YNI A;  1LWF A;  3NGY A;  3LDS A;  1EX4 A;  2WON A;  2ZE2 A;  3KLF A;  2G8H A;  3HO1 A;  3AA2 A;  3AVH A;  3P5J A;  2F8S A;  5K14 A;  4DU4 A;  4ELU A;  4B9M A;  4TSX A;  1BIS A;  1WSI A;  4DQR A;  4DTM A;  3AVM A;  3KD1 E;  1TGO A;  4E7L A;  1U45 A;  1WSE A;  1YVU A;  4LSN A;  3OYI A;  2BE2 A;  3K57 A;  1T7P A;  4CIF A;  2OYQ A;  3SV3 A;  1VRT A;  4DTO A;  4ZTF A;  3HVT A;  4IFV A;  2Z1G A;  4ICL A;  1WAJ A;  4FW1 A;  2BAN A;  1X9S A;  3SI6 A;  1VSK A;  3MEG A;  3KK3 A;  4E7H A;  3C6T A;  4AIL C;  4FJX A;  2DFH A;  2A1S A;  3ZSV A;  4BE1 A;  1TL3 A;  3LZI A;  3OJS A;  1U47 A;  3QEI A;  4DS4 A;  1LAV A;  4CGH A;  4W5T A;  4CIG A;  3JSM A;  4DSL A;  1JLG A;  4CED A;  2Q3S A;  2HHS A;  1S9E A;  3FFI A;  2IAJ A;  5J2P A;  5FRM A;  1RTI A;  4FLY A;  4CEC A;  4CGI A;  3ZT4 A;  1NKE A;  2B6A A;  5C42 A;  3RMC A;  1HQE A;  3OYK A;  1T03 A;  4OKK A;  1R0A A;  3PX6 A;  4Z4F A;  1HMV A;  1NK6 A;  1RCH A;  4E7J A;  4DLE A;  4FM2 A;  3EYZ A;  2QXF A;  1DTQ A;  3OYJ A;  3NCI A;  3O4Q A;  5CZ1 A;  3ZT0 A;  5J1E A;  4O5B A;  4B9U A;  4KHS A;  1EET A;  3DLB A;  4OGC A;  4E7K A;  2HHU A;  4NCG A;  1S6Q A;  3V9S A;  4CEE A;  1TV6 A;  4G1Q A;  3PO5 A;  3DRP A;  3LPT A;  3WNE A;  3SCX A;  4DTS A;  3AA4 A;  1JLA A;  3AVK A;  3ZSX A;  4AHU A;  5HP1 A;  2YNH A;  3SQ4 A;  3C95 A;  3E01 A;  1HNV A;  4DS5 A;  3SUQ A;  3H08 A;  4C8K A;  3CYM A;  3SV4 A;  3K2P A;  4F8R A;  2D5R A;  4WE1 A;  1S1X A;  3QES A;  4O55 A;  4FZY A;  4J2D A;  4OJR A;  4Z0U A;  4N76 A;  1B9F A;  2B4J A;  4E1N A;  5KTQ A;  1RNH A;  4PQU A;  4H8K A;  1WSJ A;  1WSG A;  3QEP A;  4F2R A;  1ZBL A;  1RDD A;  1HNI A;  5CZ2 A;  4RW7 A;  1U48 A;  4M42 A;  4KHQ A;  4FLV A;  1IKX A;  4DF8 A;  3CQ8 A;  3M8Q A;  4HHT A;  2EX3 A;  2KFN A;  1KFD A;  4W5R A;  3MAQ A;  4AH9 A;  4FCY A;  2VG5 A;  4DF4 A;  1RT3 A;  3SUO A;  1TKX A;  4DTU A;  3NH1 A;  2G8K A;  4B8A B;  4BE0 A;  4DFM A;  4CFC A;  2ZQB A;  4CIE A;  3SQ0 A;  4RW4 A;  1BI4 A;  1LW2 A;  4CES A;  1VK0 A;  2RN2 A;  3MXM A;  1VSI A;  2VWK A;  4C8N A;  1VRU A;  3DLE A;  4LD0 A;  2E6L A;  3OYB A;  4B08 A;  1NK7 A;  5D3G A;  1WSF A;  4KO0 A;  2KFZ A;  5KRS A;  3LP1 A;  1VSM A;  2YV0 X;  2HHT A;  1RBU A;  2E4L A;  1J53 A;  1LWC A;  1SV5 A;  3AO5 A;  1I39 A;  3AA5 X;  4KHW A;  1HRH A;  3O4N A;  4FJ5 A;  1CZB A;  3P1G A;  3QET A;  1NJZ A;  5J2N A;  5EU7 A;  3DLG A;  3NGI A;  1U49 A;  2OPR A;  4FLW A;  1RT6 A;  4K8Z A;  3DLH A;  4M3W A;  4C8L A;  3AV9 A;  1KRP A;  4DG1 A;  1GOB A;  1C6V A;  3EY1 A;  4M45 A;  4FJH A;  4FVM A;  3IG1 A;  3AVF A;  2R7Y A;  1RBT A;  2HNY A;  3PY8 A;  1GOA A;  1BHL A;  2HVH A;  3V1R A;  4KAZ A;  3B6P A;  5CYM A;  5HRS A;  4FJ9 A;  1RT1 A;  3HPG A;  3VQC A;  4OPK A;  4CHQ A;  1UAX A;  3VA0 A;  1FKP A;  4CJ4 A;  2YNF A;  3MXI A;  3HST B;  3VQB A;  3LP0 A;  3L2V A;  2PY5 A;  4F3O A;  4W5N A;  3AA3 A;  1NKB A;  2OPQ A;  3NH2 A;  1Q8I A;  1BI4 B; 
#chains in the Genus database with same CATH topology
 2Y1I A;  3EZW A;  1IKV A;  3QO9 A;  2RE2 A;  2I7N A;  1QHT A;  3IKM A;  4O4G A;  4RCH A;  4KRF A;  3TR8 A;  2YJE A;  1LAW A;  3WXI A;  3NFA A;  3H3O B;  4Z4I A;  3LDP A;  5CYQ A;  3KJV A;  4FZX C;  3AVI A;  3O1B A;  4CEB A;  4DCH A;  3NF9 A;  4DQI A;  3ZSO A;  1C0U A;  4F9O A;  3H46 O;  3N4P A;  1EO1 A;  1QSS A;  2OZS A;  4Z4H A;  5JVG L;  3D45 A;  4O0J A;  1IBK K;  3CFP A;  1VQL N;  1JLC A;  4CFD A;  1HJR A;  1DKG D;  3V4I A;  1D9D A;  1UA1 A;  1IKW A;  3SMP A;  1QQN A;  3WXK A;  4X65 K;  3SZ2 A;  4LFB K;  3FGU A;  1TK5 A;  2A1R A;  4CJR A;  5AZJ A;  3NF6 A;  3CCS N;  1XI1 A;  1ZBI A;  3ZCM A;  4M7Y A;  4CBW A;  1KTQ A;  3OVN A;  4CFB A;  3U3Y A;  3T1A A;  4GKJ K;  3AO4 A;  4JKD A;  1YIT N;  1VSH A;  3OYF A;  3NHG A;  2YNG A;  1YUW A;  3P38 A;  3MN6 A;  3O9R A;  4PY5 A;  4BDY A;  3MN9 A;  3M5R A;  3LPU A;  5T7B A;  4M3Z A;  2ASM A;  3ISN C;  5AQP A;  3RR8 A;  1XWL A;  3AO1 A;  5E26 A;  1SKS A;  1GLL O;  4CFA A;  1WNS A;  4FWO A;  2P9L A;  2IC3 A;  2GUP A;  4CJP A;  5JLF A;  2P9U A;  4FK4 A;  3KTQ A;  1TK0 A;  3CCR N;  4BAC A;  3SJJ A;  2VWB A;  1C0T A;  3AY9 A;  1O13 A;  2CGL A;  3HVR A;  3DMJ A;  4KHP K;  4CD1 A;  3BZC A;  5LMN K;  4CJ3 A;  1QVF M;  4DTP A;  3TAN A;  2XY8 A;  4GVE A;  4K43 A;  2IIR A;  1TKT A;  1I3A A;  1NK4 A;  4BRL A;  1QZ5 A;  3TPQ A;  1NGJ A;  1HYZ A;  2XRI A;  4DV0 K;  4CF0 A;  4DFK A;  3I8D A;  3CJC A;  3B6O A;  3ZET B;  4JAX A;  3CG7 A;  4CEA A;  4N56 A;  3QIC A;  4EZ9 A;  4QS8 A;  2JWL A;  3IS9 A;  1T05 A;  4B9Q A;  4LSL A;  3VGM A;  1KAX A;  5HL7 L;  1IBM K;  2VG7 A;  1Q9Y A;  3VQ4 A;  1N6Q A;  3MMV A;  1BQN A;  3O5B A;  4DTX A;  5HRO A;  4YOW A;  4UY8 O;  3OBW A;  4FXD A;  4MO5 A;  4AHR A;  3L2U A;  4JKE A;  3SLC A;  3OYN A;  5GAH P;  3HM8 A;  3ZSQ A;  5M1F A;  4IO9 L;  2IVP A;  3O8M A;  4NLB A;  1Q82 O;  4ZTJ A;  2VG6 A;  1Q81 O;  1KAZ A;  3DLK A;  4RW8 A;  1K6Y A;  1D8Y A;  2RKI A;  3MX2 A;  2Z1H A;  4IEE A;  4C8M A;  1NK0 A;  3I0R A;  2B5J A;  3LP3 A;  3MEE A;  5FDL A;  3LWM A;  4OVL A;  3MXJ A;  1HJO A;  4LF9 K;  1TUY A;  2P9P B;  5E84 A;  2P5O A;  3J7A P;  3O9U A;  4KH5 A;  3DJC A;  4I9Q A;  5FRN A;  5JIC A;  4DLG A;  2DFE A;  1U04 A;  1QSY A;  4JI1 K;  4JS4 A;  3C94 A;  3HP9 A;  4JRQ A;  4PA1 A;  4CJ5 A;  4CCH A;  3SPZ A;  1RT2 A;  1JLE A;  1JXE A;  4M41 A;  4DMN A;  3KKR A;  3AVC A;  3NH0 A;  1FXX A;  1EP4 A;  2VWJ A;  1VAZ A;  3CI5 A;  1CZ9 A;  3VES A;  4KRE A;  1BDG A;  2G8V A;  1C0M A;  2IOC A;  2O4G A;  4JHD B;  2G8I A;  2BH1 A;  3CC2 N;  5AR0 A;  2FXU A;  3HYF A;  5CHI A;  3EZ5 A;  2YCH A;  1XHZ A;  2HW3 A;  2V52 B;  3HOT A;  2X78 A;  3SAF A;  4EZ6 A;  4XH5 A;  1JXB A;  2YX6 A;  3RVC A;  5BR9 A;  1QSL A;  2WC9 A;  3QIN A;  3ZSY A;  4YOV A;  3GBT A;  3GE1 A;  4I7F A;  3OYM A;  1Z25 A;  5BRF A;  4DFP A;  2DFF A;  2GBZ A;  3E9L A;  1LV5 A;  4E19 A;  1MU2 A;  1NGF A;  4GW6 A;  4JRP A;  2XY6 A;  1NGA A;  4BC4 A;  4E1M A;  3DAW A;  3F5T A;  5AQK A;  3L6Q A;  4AHS A;  3OYG A;  4DR5 K;  4W5Q A;  2PYJ A;  1L3U A;  3G25 A;  3LDQ A;  2DTU A;  4FVU A;  4LH4 A;  3R8E A;  1T8E A;  4IG0 A;  3IMX A;  4BR9 A;  1VQ7 N;  3SNN A;  3MX5 A;  3NBP A;  1YTU A;  3DRR A;  4CJW A;  5IT9 O;  4BGA A;  2HMI A;  3F73 A;  4NO7 A;  1XUP O;  2E2N A;  4H0P A;  4AF1 A;  1L5U A;  1EWR A;  4KPY A;  4M3R A;  1HUX A;  4HVJ A;  3F9M A;  3MK6 A;  3ULE A;  3HXM A;  1SKW A;  4M3Y A;  1N33 K;  2O8F B;  1ESV A;  3WNF A;  3BEX A;  4RW6 A;  1KCF A;  1OKJ A;  3T3F A;  4FLU A;  4IG3 A;  3TU5 A;  4ELV A;  1T44 A;  3O9S A;  2I7P A;  3UKU B;  4Y1D A;  1NBW A;  3J7Z O;  4F2S A;  5FRO A;  1BGX T;  1N5Y A;  3TAG A;  3RRG A;  4B9L A;  3J80 O;  5M1Q A;  2HVI A;  1DTT A;  4BVP A;  4B1V A;  1NK8 A;  3RSE B;  2QKB A;  3DOL A;  4V19 S;  4A5B A;  3U6F A;  2OTL N;  2UXD K;  3RMD A;  2PBD A;  3AGK A;  4A59 A;  3D2E A;  4LFA K;  3AVH A;  1BIS A;  4JD2 A;  1BA1 A;  1TGO A;  4I6M A;  4E7L A;  2BE2 A;  2OYQ A;  1VRT A;  4ZTF A;  4NXM K;  1WAJ A;  3VEX A;  4LF7 K;  1X9S A;  4ILG B;  3SI6 A;  1Q18 A;  4OPH A;  3VTH A;  4GV3 A;  1ATR A;  4FWM A;  4BRF A;  3LZI A;  3GOI A;  4CGH A;  4W5T A;  2HHS A;  1C0F A;  3PIO L;  2IAJ A;  4XEI A;  1BWF O;  1X3N A;  4CEC A;  2D4W A;  5C42 A;  4KH4 A;  4KBO A;  3RMC A;  3THX B;  1T03 A;  4OKK A;  1RCH A;  3EYZ A;  4MDB A;  2ZGY A;  3MN5 A;  1DTQ A;  3OYJ A;  3NCI A;  3O4Q A;  4BRO A;  4O5B A;  1VQ5 N;  3IFR A;  2HHU A;  4NCG A;  4CEE A;  4BRC A;  5AQM A;  4BRD A;  4CI6 A;  4B1Y B;  3AA4 A;  4AHU A;  2Q31 A;  2QWO A;  2GWJ A;  1HNV A;  4C8K A;  1KD1 O;  4F8R A;  3QES A;  2HOE A;  5AQH A;  4O55 A;  4J2D A;  3HRG A;  4Z0U A;  1JCF A;  3I55 N;  2A6A A;  4H8K A;  2OCE A;  1WSG A;  1ZBL A;  1KAY A;  4DR7 K;  1Z05 A;  1WBB A;  4H0T B;  4B8A B;  3T7Z A;  4CFC A;  4RW4 A;  2E2P A;  1VK0 A;  3MXM A;  1VSI A;  1VRU A;  1K8A O;  3DLE A;  3OYB A;  4RTF D;  1J6Z A;  3R9P A;  5KRS A;  2QWM A;  2YV0 X;  4FO0 A;  5FPN A;  2HHT A;  1LWC A;  1NJZ A;  5J2N A;  5AQQ A;  1TYQ A;  1YI2 N;  2D0P A;  3AV9 A;  3ZEU A;  1C6V A;  4EFH A;  5M1N A;  4IO8 A;  3QBW A;  3IG1 A;  3KVG A;  5GIO A;  5AJ3 K;  1XMQ K;  3PY8 A;  2KKZ A;  2HVH A;  1RT1 A;  2YJF A;  3PIP L;  3VA0 A;  3HST B;  3L2V A;  2ASP A;  4H5T A;  3OBY A;  2P9P A;  2OPQ A;  1ZC6 A;  2ETJ A;  1ILY A;  1IV0 A;  3VQP A;  4JI7 K;  1SAZ A;  4IEI A;  4DSE A;  3TWH A;  1NNE A;  1A5X A;  4F3T A;  3ZX0 A;  1VQ8 N;  4E7I A;  1L3S A;  4IXC A;  2OZM A;  3AVG A;  5DM7 L;  3K59 A;  1NJX A;  3OYH A;  1ATS A;  5KPZ A;  1VSE A;  2GWK A;  4YOX A;  2Z1J A;  4RG8 A;  4CJF A;  1R59 O;  3NGZ A;  4CJS A;  4JNE A;  1DEJ A;  2FSK A;  4Q0B A;  5AQI A;  4JKF A;  4AQY K;  2QK9 A;  3BZK A;  4CEO A;  4JI4 K;  4FWN A;  2HST A;  5JLH A;  3OS2 A;  3V1O A;  3K0S A;  3QNO A;  1T6D A;  3VQ5 A;  1RFQ A;  1LCU A;  5SZT A;  3CCJ N;  3WEE A;  1J9A A;  4Z4G A;  3CME N;  1RDU A;  3H6E A;  1JL1 A;  2BGG A;  4BRH A;  4CEF A;  4WYB A;  1VQM N;  5C25 A;  3VQE A;  4JI3 K;  2HHW A;  4DV7 K;  1YIJ N;  4CHO A;  4BRE A;  1NM1 A;  3H45 C;  3VGK A;  4IBN A;  2F7T A;  5AFU A;  3CCM N;  2GV9 A;  4MLH A;  4GMJ B;  4BRI A;  1HKC A;  2KTQ A;  1TAQ A;  1RT4 A;  4LH5 A;  2BTF A;  1WUA A;  4BVO A;  3OYL A;  1N32 K;  1JL2 A;  4H5W A;  5GIP A;  4LF4 K;  4BRG A;  3CXC M;  4X62 K;  4H0V B;  4MQ3 A;  2A42 A;  1RDW X;  5DMR A;  2HF3 A;  4KV8 A;  3U9Z A;  4HUG A;  1KFS A;  5KQ8 A;  5AQS A;  4GNI A;  4PHT X;  1B9D A;  4XH1 A;  3ZSR A;  4BR0 A;  3WNG A;  4CK1 A;  1XC9 A;  3QFU A;  4JV5 K;  3TAF A;  4G9Z A;  2ITG A;  5MLC Q;  1XHX A;  3ZT2 A;  4AHV A;  2ZWH A;  3LDN A;  3QIO A;  4I9L A;  4B1U B;  2FF3 B;  4JK7 A;  3K5M A;  1ASV A;  3ASM A;  4RW9 A;  3RMA A;  4DR6 K;  3K9K A;  1NGD A;  4KB1 A;  1C1C A;  4DV3 K;  1ZXO A;  1ATN A;  3KIO A;  4BGB A;  3CPE A;  1SS6 A;  1NOY A;  3FZH A;  3OS0 A;  4FZZ A;  3TSP A;  4JI8 K;  4I2Q A;  2V51 B;  1IG8 A;  1A5W A;  2W6K A;  3G6E N;  1QS4 A;  1YTA A;  4AHT A;  4FOI A;  2X6S A;  4BG9 A;  2HND A;  5F1X A;  3BGR A;  1YAG A;  2H3G X;  3D2F B;  2E8A A;  1TVR A;  2JGU A;  3LWL A;  3VEV A;  2KW4 A;  5HRN A;  3R6M A;  5J2M A;  4J2B A;  3O4W A;  2NRW A;  1KC8 O;  4BQZ A;  3D0P A;  1K8K B;  5KI6 A;  3I0S A;  5A2Q O;  3WXM B;  3S3O A;  4CGD A;  4AHC A;  4FWP A;  3SPY A;  3CIP A;  1OH8 A;  4ISF A;  1TKZ A;  3CPW M;  3C6A A;  1HKG A;  4JK8 A;  1VQO N;  1SL1 A;  3C7N A;  4KTQ A;  3K58 A;  5BRH A;  4BRK A;  1VSF A;  3LAK A;  1U4B A;  3DXK B;  4B3T K;  5IWA K;  4IOX A;  1N36 K;  4K42 A;  3PX0 A;  1UWB A;  4QOZ B;  4DTR A;  5GAD P;  4BR5 A;  3M6G A;  4YY3 K;  3RMB A;  4L8R B;  4ISE A;  1SL2 A;  2NUB A;  4HWI A;  3V9U A;  2WUS A;  4JLH A;  3S3M A;  4CK2 A;  1VQ4 N;  3UKR A;  4E3S A;  1EXQ A;  2QWP A;  4DUY K;  4IFY A;  3UB5 A;  4CEZ A;  4E89 A;  2D0O A;  1WN7 A;  1E4F T;  2W42 A;  4HUE A;  4NCB A;  1MDU B;  4B3M K;  2O8E B;  1Y64 A;  1Q9X A;  4JKG A;  1XMO K;  4DU3 A;  4FM0 A;  5AQO A;  2F9T A;  4CZK A;  4OKE A;  1LWE A;  4J2E A;  2NRT A;  4CHZ A;  5I42 A;  1HNZ K;  2D1K A;  3ZT1 A;  4YOT A;  3L2R A;  3FE1 A;  3ITH A;  3V1Q A;  2ZJP L;  3ID8 A;  4NYF A;  4W5O A;  1O1W A;  4EAH D;  4DSI A;  3AVB A;  3V9W A;  1RGI A;  2FBT A;  4A62 A;  3NDK A;  3UIQ A;  1S1T A;  1GLF O;  2F4V K;  1BIU A;  1JLB A;  3DWL A;  4BRQ A;  4X64 K;  2D0C A;  2NRZ A;  3DLR A;  4DV1 K;  3NF8 A;  5KQD A;  3HPH A;  1X9W A;  5AZI A;  1IKY A;  2WOM A;  2O8C A;  1BOT O;  4FOE A;  1NK9 A;  1WB9 A;  5BPN A;  2PZS A;  3DYA A;  2E5L K;  2P51 A;  4IFE A;  2PAV A;  2QKK A;  2OTJ N;  3J8A A;  4XIU A;  1OVQ A;  4AM7 A;  1NGC A;  4FK2 A;  3L3U A;  4CW7 B;  4O5F A;  2VQE K;  1TK8 A;  5JS2 A;  4OKJ A;  1I94 K;  4BY9 C;  3ZSW A;  4RWT A;  1QQO A;  5AQF A;  5I9E B;  5TKY A;  4FWL A;  4JKB A;  3LDS A;  1EX4 A;  2WON A;  2ZE2 A;  3KLF A;  4DUZ K;  2F8S A;  5K14 A;  4B9M A;  1WSI A;  3KD1 E;  3VEW A;  3K57 A;  2Z1G A;  4ICL A;  3EE9 A;  3A5N C;  1VQK N;  3THY B;  3C6T A;  1MWM A;  3M1F A;  1TL3 A;  1N8R O;  3QEI A;  3BY5 A;  4CIG A;  3EKU A;  4EHU A;  3D6R A;  1EQY A;  2Q3S A;  4CED A;  1S9E A;  4CGI A;  3ENO A;  3ZT4 A;  4ILJ A;  1MA9 B;  2B6A A;  3OYK A;  3G4S N;  3I33 A;  1HMV A;  4WCE L;  1XQS C;  2KHO A;  5J1E A;  5CZ1 A;  3ZT0 A;  5CR4 A;  4B9U A;  3LDO A;  1WBD A;  3PO5 A;  5EX5 A;  5GIN A;  4CZG A;  3WNE A;  3THW A;  2F9W A;  4CZH A;  1TUU A;  2YNH A;  3C95 A;  3SUQ A;  4H0X B;  4DQ8 A;  2NNW A;  3AAR A;  4N76 A;  4A61 A;  5AQW A;  4K0K K;  2P9I B;  5KTQ A;  5M1P A;  3NVM A;  1RDD A;  1HNI A;  3ID6 A;  4RW7 A;  5CZ2 A;  4M42 A;  4C23 A;  1IKX A;  4DF8 A;  1E3M A;  3M8Q A;  4HHT A;  2BUP A;  3PLA A;  4FCY A;  2VG5 A;  4DF4 A;  2G8K A;  3SUO A;  3NH1 A;  4IOC L;  5AQR A;  1BI4 A;  1LW2 A;  2ZGZ A;  3J7Y P;  2VWK A;  3KWI A;  3OTO K;  3R1X A;  5ELZ A;  1VSM A;  2E4L A;  3J81 O;  1SV5 A;  1HR0 K;  4FJ5 A;  3P1G A;  3AAQ A;  3QDK A;  2W41 A;  3A5O C;  3DLG A;  1N34 K;  2W40 A;  4FWQ A;  5TKW A;  3DLH A;  4C8L A;  1KRP A;  3U9D A;  1VQ9 N;  2E20 A;  3AVF A;  4BRA A;  3LDL A;  1GOA A;  1BHL A;  4LFC K;  3GG4 A;  3B6P A;  3L4I A;  5CYM A;  4FJ9 A;  4OPK A;  4CZM A;  1UAX A;  5M1K A;  4CJ4 A;  4BC3 A;  3MXI A;  1NGI A;  1J5E K;  2PY5 A;  3U8X A;  1K73 O;  3AA3 A;  5CE3 A;  1Q8I A;  4GKK K;  2O8D B;  4B8C A;  1S5J A;  3NF7 A;  4ID1 A;  1JLF A;  3IRX A;  5BR8 K;  3M8R A;  4DR3 K;  3TI0 A;  3NE6 A;  4LY7 A;  4CER A;  3BUZ B;  4BRP A;  2E1Z A;  3CQY A;  3KK1 A;  2D0A A;  1V4T A;  2RPI A;  3HI0 A;  3UE5 A;  2P1J A;  3AVA A;  5HBM A;  1YXQ A;  2P9S B;  3AGR A;  5C2D A;  1CZA N;  4HCB A;  2YKN A;  3V6D A;  2ITM A;  1TKD A;  1UOC A;  2CH5 A;  4EIA A;  2Q1N A;  1X1P A;  1S22 A;  3A5L C;  4YHH K;  4LF6 K;  1XNR K;  2BDP A;  3O08 A;  4IJN A;  2OAN A;  4FK0 A;  2IDO A;  2NRX A;  3OS1 A;  5CY4 A;  4JI6 K;  4CVN E;  3KLE A;  2EHG A;  4CE9 A;  2Q2R A;  4FJJ A;  2JLE A;  3SJH A;  3NMU A;  1RBR A;  4BR4 A;  2AJQ A;  3SYZ A;  4CJV A;  3TSU A;  3VMF B;  4B3O A;  4H0O A;  5EOY A;  3K5N A;  1ZYQ A;  4PL8 A;  3K5L A;  1RTD A;  1SL0 A;  1Z6R A;  4B1X B;  3L0Q A;  3DXM B;  4GVM A;  3SMS A;  4E0D A;  4FJL A;  2E88 A;  4PKH A;  3QIP A;  1NMD A;  5AZJ B;  4N47 A;  4FYD A;  3HBT A;  3ZET A;  2J4R A;  2WBN A;  1VQ6 N;  4DV5 K;  2I5J A;  1DLO A;  5HRR A;  4FLX A;  3QER A;  1M90 O;  4NCA A;  4KI6 A;  4BDP A;  4HCC A;  3RRH A;  3L2W A;  1IH7 A;  3CC4 N;  1L3T A;  4EHT A;  2UYT A;  3EKS A;  4KH6 A;  1NU0 A;  2RHK A;  3CER A;  2UUB K;  2IVO A;  5LY3 A;  4YFU A;  4LF5 K;  4CJE A;  4CF2 A;  3CJ9 A;  3MED A;  3QEV A;  4FPB A;  2X74 A;  3CQX A;  3CET A;  4A2A A;  2O8B B;  2P9L B;  1EWQ A;  3AAP A;  2GTD A;  3KK2 A;  1X9J A;  2P9U B;  3HT3 A;  1S3X A;  1QE1 A;  4IWV A;  1NGG A;  2YHW A;  1RTH A;  3LL3 A;  1W0H A;  3HZ6 A;  3SBT A;  2HHH K;  1QZ6 A;  3VPZ A;  4DR1 K;  3OYC A;  4KKO A;  4DSK A;  4HUF A;  3CCL N;  3TAQ A;  1IG9 A;  3CJ7 A;  4B1W B;  3KHY A;  4F4K A;  3P31 A;  3ZT3 A;  5KRT A;  2XY7 A;  2QM1 A;  1DT9 A;  4CZI A;  3I56 N;  5DM6 L;  3EL2 A;  3VER A;  3QEX A;  3TTF A;  3EEQ A;  1HQU A;  2HB5 A;  4H4O A;  4IJA A;  4QCL A;  4FPA A;  2QWL A;  1RT7 A;  3L2Q A;  3RTV A;  4CF8 A;  3BDP A;  3E9O A;  4J2A A;  4YDU A;  4B3S K;  4FJ8 A;  1S1W A;  2Q0U A;  3THY A;  3TAE A;  4KFB A;  2CGK A;  3JYT A;  3PSI A;  4BWM A;  4GV9 A;  2G8F A;  3DOK A;  3SQ1 A;  1GLE G;  4JHD A;  4C1N K;  1S1V A;  5HOO A;  3NAE A;  4M3T A;  3GDQ A;  2OPP A;  4DR2 K;  4NLC A;  5BN8 A;  1KXP A;  3M8P A;  4ILH A;  1GOC A;  5KGX A;  4CZL A;  2HHX A;  4H4M A;  1HPZ A;  3HSC A;  1BCM A;  1B92 A;  1JKH A;  2QWR A;  2E6M A;  4FLZ A;  5BRE A;  2ATQ A;  3AVJ A;  1ASU A;  2A41 A;  4CF1 A;  3L8B A;  3OYE A;  3U3G A;  3H1V X;  4R79 A;  4Q5V A;  1OVY A;  5AQV A;  1Z26 A;  3E66 A;  3QEW A;  3ATU A;  3T19 A;  4DQQ A;  1HYS A;  1J54 A;  3ALY A;  3S3N A;  5FLX O;  5EVZ A;  3VQ7 A;  2P9I A;  2KZM A;  3CFO A;  5LL6 Z;  2YHY A;  1VSL A;  4JYA K;  5KGW A;  4FL9 A;  3CCQ N;  1KVA A;  1U2V B;  1NLV A;  1WAF A;  2OPS A;  3VTI A;  4CGF A;  1NJY A;  2YHA A;  4K8X A;  3DRS A;  3KWG A;  4IOA L;  4CZE A;  3C6U A;  4WQ5 A;  3VEY A;  1L3V A;  4FJK A;  2FBV A;  4CBU A;  4CGJ A;  4WF9 L;  4UQG A;  4FM1 A;  4H03 B;  4DHY A;  5C2F A;  4CGG A;  4JKC A;  2IGI A;  1WLJ A;  4FJ7 A;  1LOT B;  3AVL A;  3IDH A;  3TSQ A;  1JLQ A;  1U6Z A;  1WOQ A;  3MWT A;  1BU6 O;  2QWN A;  3HTV A;  1IBL K;  3DLL L;  4WFB L;  2KZZ A;  2O8F A;  4DQP A;  4NYN A;  3HJF A;  1RT5 A;  5C10 A;  1FKO A;  4LC9 B;  3HK2 A;  4M3U A;  1OH7 A;  3S41 A;  2X6N A;  3VA3 A;  4PUO A;  1RBV A;  2D0B A;  3UKU A;  1D9F A;  3MEC A;  3SBG A;  3HPO A;  4KHU A;  2ZD1 A;  2XY5 A;  3W0L A;  3CJ1 A;  3PX4 A;  3PV8 A;  2XHB A;  5GAE P;  4CZF A;  3T1Y K;  3CM5 A;  3LM2 A;  4FW2 A;  1HX1 A;  3VQ8 A;  4N41 A;  3ULD A;  2V7Y A;  4DTN A;  1SZ2 A;  3RSE A;  5KPR A;  5JS1 A;  3MN7 A;  5LJW A;  4K41 A;  1LW0 A;  2OA8 A;  1RTJ A;  1W7A A;  5BPL A;  1VSD A;  3QBX A;  3Q7C A;  2Z1I A;  2F8T A;  4M63 C;  4L3Q A;  2HHV A;  3OYA A;  1YF5 L;  4JS5 A;  4BR2 A;  2PYL A;  4B9V A;  1SQK A;  3A5M C;  1BUP A;  4N5S A;  4Y1C A;  4KTW A;  1KSP A;  3A2F A;  2ZF5 O;  4M7X A;  3CFR A;  2P5G A;  4H0Y B;  3TTD A;  2IVN A;  1ZBS A;  3EN9 A;  2DPN A;  4ZHR A;  3ULE B;  2P9K B;  2YNI A;  1NMN A;  3THX A;  2G8H A;  3HO1 A;  3AA2 A;  5FPD A;  3WXL A;  4DU4 A;  4ELU A;  4TSX A;  4DTM A;  3AVM A;  3R3L A;  1Q86 O;  1WSE A;  3G71 N;  4LSN A;  1T7P A;  3SAH A;  3HVT A;  2FSN A;  3KK7 A;  3A0I X;  3A8Y A;  2BAN A;  3O9Q A;  4FW1 A;  4DV6 K;  4E7H A;  3KK3 A;  1FJG K;  3DXM A;  4FJX A;  2A1S A;  1U47 A;  3C6H A;  4DSL A;  3JSM A;  5BN9 A;  1JLG A;  3SAG A;  1YVN A;  4E1J A;  5FRM A;  2WFB A;  1NKE A;  4YDU C;  3D2E B;  2UU9 K;  5EY4 A;  3P39 A;  4MDA A;  4Z4F A;  1G99 A;  1NK6 A;  3IUC A;  4DLE A;  4FM2 A;  4JD2 B;  4I6M B;  4K25 A;  1GLB G;  5BRD A;  1EET A;  3DLB A;  4OGC A;  4E7K A;  5C0Y A;  2YHX A;  3DRP A;  1KQS M;  2A40 A;  1JLA A;  3AVK A;  3ZSX A;  3SQ4 A;  3TTC A;  3E01 A;  3VGL A;  4DS5 A;  3H08 A;  3SV4 A;  3C0B A;  3K2P A;  1S72 N;  2D5R A;  5BPM A;  1S1X A;  3O6W A;  4FZY A;  3Q7B A;  4O8U A;  3O1W A;  1B9F A;  2O8B A;  4CJ7 A;  4E1N A;  4BRM A;  1WSJ A;  3QEP A;  3ENB A;  4BRN A;  3JS6 A;  4JEP A;  1W97 L;  4KHQ A;  4FLV A;  3CQ8 A;  4GY2 B;  2EX3 A;  2KFN A;  3MAQ A;  4AH9 A;  1TKX A;  4BE0 A;  4JN4 A;  3MCP A;  4DFM A;  3SQ0 A;  3MWP A;  4X66 K;  4CES A;  3BP8 A;  2RN2 A;  2HBL A;  5AFU H;  1NK7 A;  4LD0 A;  2E6L A;  4B08 A;  4BR7 A;  3GL1 A;  4KO0 A;  2KFZ A;  3LP1 A;  1J53 A;  4FWK A;  3AO5 A;  1I39 A;  3AA5 X;  4BG8 A;  4KHW A;  1HRH A;  1JJ2 M;  1CZB A;  3QET A;  1U49 A;  2OPR A;  4FLW A;  1RT6 A;  4K8Z A;  4M3W A;  1VHX A;  3EY1 A;  4WQ5 C;  4M45 A;  4FJH A;  3WUH A;  5AQT A;  1T6C A;  1V4S A;  3MDQ A;  2HNY A;  4J8F A;  2ASO A;  3ATV A;  4KAZ A;  2GX9 A;  3HPG A;  3VQC A;  4CHQ A;  1FKP A;  2QTD A;  5AQG A;  4W5N A;  5AQL A;  1Q7Y O;  1OH6 A;  2AA4 A;  4OX9 K;  4JI2 K;  5ADX H;  4FJI A;  1NWK A;  5B8H A;  1KVB A;  4JKA A;  1BIZ A;  2O4I A;  2HMP A;  3DM2 A;  2GUI A;  3WXJ A;  3M3Z A;  4CJT A;  3PUF A;  2ZJQ L;  5AQU A;  2NRH A;  4U67 L;  1TYQ B;  5FPM A;  4ID5 A;  3I8B A;  3ZEU B;  3HM9 A;  3O9T A;  1RDC A;  4CJK A;  1SUQ A;  1MWK A;  2CGJ A;  1D5A A;  1BCO A;  2UXB K;  3LP2 A;  3VQ6 A;  3OW2 M;  3EO3 A;  3SQ2 A;  5LJV A;  4KB0 A;  4Z4E A;  3N4Q A;  4DU1 A;  4C8O A;  4WQ4 A;  2HBJ A;  5JMV A;  5GAG P;  3AO3 A;  1U2V A;  4H5R A;  3CCU N;  4OLB A;  3OYD A;  4FWR A;  1VQP N;  3DI6 A;  4QAG A;  3VF2 A;  1C0G A;  3K5O A;  2LSN A;  5AQN A;  4BWJ A;  4IDK A;  1S1U A;  2AP1 A;  1QTM A;  4NB4 A;  3OY9 A;  1NJI O;  4A5A A;  2EWS A;  1VQN N;  2IS3 A;  3T69 A;  1FK9 A;  3PO4 A;  3KLH A;  4BQL A;  4PWD A;  3QLH A;  3WQT A;  3CM6 A;  3KZB A;  1REV A;  5J2Q A;  4CJU A;  2KQ2 A;  1HPM A;  3WEE B;  4CF9 A;  2QI2 A;  3AO2 A;  4AM6 A;  4I2P A;  4DB3 A;  1NG9 A;  4HTU A;  5DK5 A;  5JVH L;  2VGM A;  3ENH A;  1QVG M;  3BF3 A;  2F96 A;  3LZJ A;  3P83 D;  4PKG A;  2G8W A;  3THV A;  1RIL A;  3O3F A;  3G10 A;  4MO4 A;  1NGE A;  4NXN K;  2FF6 A;  4CHN A;  1S6P A;  3H3N O;  1IJJ A;  3C65 A;  4FJM A;  1NOZ A;  1GLA G;  2P9N B;  3TAR A;  1BA0 A;  4O0I A;  2XO7 A;  3NVK A;  3F2K A;  3D2F A;  1X9M A;  1HYV A;  1F21 A;  1ZBU A;  2HHQ A;  2NRV A;  4B9S A;  3L4Q A;  1K8K A;  4OPJ A;  4DSF A;  4DTJ A;  3SK3 A;  2FC0 A;  4YOR A;  1C1B A;  2VQF K;  4B9T A;  4CJL A;  3VQ9 A;  3MCA B;  3VF4 A;  4KTZ A;  3TAP A;  2A3Z A;  4DFJ A;  1X3M A;  1YJW N;  5AQJ A;  4A2B A;  1SKR A;  1KVC A;  3EE8 A;  3FFK B;  5I3U A;  1G15 A;  4CHY A;  2P9K A;  3VF6 A;  4Z4C A;  1CXQ A;  1ZBF A;  2FBY A;  2HBM A;  1QQC A;  4FJN A;  2NZT A;  3DXK A;  3SUP A;  3BF1 A;  4U7B A;  3U4L A;  3ZSZ A;  3V9X A;  3S9H A;  4C1N I;  1VSJ A;  4B9N A;  3O3H A;  3V9Z A;  2E2O A;  5H1S Q;  1NKC A;  4DSJ A;  1XNQ K;  2UUC K;  2HNZ A;  1BG3 A;  2RF2 A;  2E2Q A;  3HOS A;  1RDA A;  3G0Z A;  4QS9 A;  1TL1 A;  2FBX A;  4H5V A;  3AVN A;  4FJG A;  3IAY A;  1FW6 A;  4JI0 K;  1EKE A;  4EP5 A;  2VGN A;  4MFB A;  3T1H K;  4EP4 A;  1UA0 A;  4FSV A;  3OA9 A;  4CJQ A;  3FZF A;  4BDZ A;  5E41 A;  2ZM6 K;  3SUN A;  1T3V A;  2O8E A;  1GLJ O;  1A5V A;  3VN5 A;  2YHB A;  3VEO A;  3RWU A;  4O44 A;  4CEQ A;  4JI5 K;  1ITG A;  1WSH A;  3KLG A;  2ZJR L;  3CF5 L;  3KLI A;  1KLM A;  3K9J A;  5HRP A;  5C15 A;  3LAM A;  2DY4 A;  4FLT A;  1YT3 A;  1S9G A;  2Q0R A;  4XH4 A;  1C1A A;  3C7N B;  4M3X A;  2Q36 A;  5HLF A;  1JCG A;  3ZX3 A;  4CHP A;  3M8S A;  4DQS A;  2Y1J A;  1KLN A;  3CJB A;  5EXW A;  3V81 A;  1JCE A;  1NGH A;  1RBS A;  5F0X A;  2HF4 A;  5LMU K;  4KHN A;  4WQ4 C;  4WFN L;  3QNN A;  2E1Y A;  3TAB A;  2PFU A;  5C24 A;  4OGE A;  1IO2 A;  3VQQ A;  4A57 A;  4KI4 A;  1D4X A;  2YKM A;  4IDH A;  3UKR B;  5AQY A;  4O8K A;  3FZM A;  1BL3 A;  2HBK A;  2GEM A;  4LF8 K;  1W9H A;  4Y0W A;  2G8U A;  2UXC K;  3VQA A;  3H1Q A;  1RDB A;  3L3V A;  1J5O A;  1HNW K;  1TAU A;  3KD5 E;  1NK5 A;  4ISG A;  4IKF A;  4CBX A;  4DKW A;  2QEX N;  4IZ9 A;  4JKG B;  3LAN A;  1YJ9 N;  1QQM A;  3HL8 A;  1HKB A;  4OPA A;  2QXL A;  2FLO A;  1ASW A;  1CLQ A;  3ZX2 A;  3FLC O;  4R5P A;  5SWM A;  4HTL A;  3HP6 A;  3LM9 A;  1P90 A;  1P8Z A;  3F9K A;  3TAM A;  3VOV A;  3JAM O;  1Y97 A;  3VEZ A;  3VQD A;  1BQM A;  2YI1 A;  2UUA K;  3D7E O;  4CK3 A;  3OJU A;  4YOY A;  3VEN A;  3QFP A;  2QWQ A;  4ELT A;  4CZJ A;  4Z94 A;  1CXU A;  1NJW A;  3LAL A;  3CD6 N;  4H5N A;  3VET A;  4B1Z A;  3O3G A;  3B8A X;  1QHA A;  4DR4 K;  4BC5 A;  5AQZ A;  4BE2 A;  1HNX K;  3CC7 N;  3QB0 A;  4QS7 A;  3KKS A;  3RR7 A;  4DWI A;  4OLA A;  5AZI B;  3E1Y A;  5AQX A;  1ZBH A;  1H1V A;  2O8C B;  4YNQ A;  4KHY A;  1HLU A;  1LWF A;  3NGY A;  3O80 A;  4OO1 J;  1W2B M;  3P5J A;  3WQU A;  3JXU A;  1OH5 A;  5F2R A;  1GLC G;  4DQR A;  1YHQ N;  4BC2 A;  1U45 A;  3FZL A;  3CHW A;  1YVU A;  3OYI A;  4CIF A;  3SV3 A;  2NRR A;  4DTO A;  4PKI A;  4IFV A;  2CH6 A;  4FWS A;  3CCE N;  1VSK A;  3CJA A;  3MEG A;  4JK9 A;  4AIL C;  2DFH A;  3ZSV A;  4CD3 A;  4BE1 A;  3OJS A;  1GLD G;  4DS4 A;  1LAV A;  2QW9 A;  1E4G T;  1M1K O;  3FFI A;  2QA4 N;  5J2P A;  1RTI A;  4FLY A;  2A5X A;  1HQE A;  3P4I A;  1R0A A;  3PX6 A;  4WFA L;  4MLE A;  1YJN N;  4E7J A;  2QXF A;  4B3R K;  4YOU A;  4KHS A;  3ZLJ A;  1S6Q A;  3V9S A;  1TV6 A;  4G1Q A;  1NGB A;  3LPT A;  3SCX A;  4DTS A;  2KLA A;  2Q97 A;  5HP1 A;  2P9N A;  1BO5 O;  3CYM A;  3CMA N;  4WE1 A;  4GV6 A;  4OJR A;  3PSF A;  2B4J A;  5FPE A;  1RNH A;  4PQU A;  4JKH A;  4F2R A;  1U48 A;  2FSJ A;  2VYP A;  1KFD A;  4W5R A;  3W3D A;  5M1O A;  1RT3 A;  4DTU A;  5ADX A;  3E9P A;  5C12 A;  3CCV N;  2ZQB A;  4CIE A;  2O8D A;  2JWK A;  3THW B;  3WT0 A;  2GEL A;  4C8N A;  5D3G A;  1WSF A;  1XC3 A;  1DGK N;  2WTU A;  1RBU A;  3QML A;  4DV2 K;  3ZYY X;  3O4N A;  3FZK A;  5EU7 A;  3NGI A;  4DV4 K;  2P9S A;  2W6L A;  4DG1 A;  1GOB A;  1K9M O;  2NLX A;  4FVM A;  3FR0 A;  2R7Y A;  1RBT A;  3V1R A;  5HRS A;  2V7Z A;  2VCP A;  2YNF A;  3OHR A;  3VQB A;  3LP0 A;  4F3O A;  5KPT A;  1NKB A;  3WNH A;  4PL7 A;  3NH2 A;  1BI4 B; 
#chains in the Genus database with same CATH homology
 2ETJ A;  4B8C A;  1S5J A;  3NF7 A;  4ID1 A;  2Y1I A;  1JLF A;  4FJI A;  1IKV A;  3IRX A;  3QO9 A;  1QHT A;  4O4G A;  3M8R A;  3VQP A;  1KVB A;  1BIZ A;  2O4I A;  4DSE A;  3TI0 A;  3TR8 A;  3DM2 A;  4KRF A;  2GUI A;  3NE6 A;  4LY7 A;  1LAW A;  4CER A;  3TWH A;  3NFA A;  1A5X A;  3KK1 A;  4CJT A;  3PUF A;  4F3T A;  2D0A A;  4Z4I A;  2RPI A;  5CYQ A;  3KJV A;  2P1J A;  4E7I A;  4FZX C;  3AVA A;  3AVI A;  4ID5 A;  1L3S A;  5HBM A;  2OZM A;  3AVG A;  3HM9 A;  3K59 A;  1NJX A;  1RDC A;  4CJK A;  3OYH A;  1SUQ A;  4CEB A;  1VSE A;  3NF9 A;  4DQI A;  4HCB A;  2Z1J A;  4RG8 A;  2YKN A;  1D5A A;  4CJF A;  4CJS A;  3ZSO A;  3NGZ A;  1C0U A;  3V6D A;  1BCO A;  1TKD A;  3LP2 A;  1UOC A;  3VQ6 A;  1QSS A;  4Q0B A;  2OZS A;  3SQ2 A;  4Z4H A;  2QK9 A;  3D45 A;  4O0J A;  4CEO A;  1X1P A;  4KB0 A;  3CFP A;  4Z4E A;  3OS2 A;  3V1O A;  3QNO A;  4DU1 A;  1JLC A;  4C8O A;  4CFD A;  2BDP A;  1HJR A;  3VQ5 A;  5SZT A;  3V4I A;  4FK0 A;  1D9D A;  1UA1 A;  1IKW A;  2IDO A;  3OS1 A;  3SZ2 A;  5CY4 A;  1TK5 A;  2A1R A;  1J9A A;  4Z4G A;  4CJR A;  3AO3 A;  3NF6 A;  1XI1 A;  3KLE A;  1ZBI A;  1JL1 A;  3ZCM A;  2BGG A;  2EHG A;  4CEF A;  4CE9 A;  5C25 A;  3VQE A;  1KTQ A;  3OVN A;  4CFB A;  3OYD A;  3U3Y A;  4OLB A;  2HHW A;  3T1A A;  4FJJ A;  3DI6 A;  2JLE A;  4QAG A;  4CHO A;  3AO4 A;  1RBR A;  2LSN A;  3K5O A;  4IBN A;  2AJQ A;  4BWJ A;  3SYZ A;  4CJV A;  4IDK A;  1S1U A;  1VSH A;  1QTM A;  2GV9 A;  3OYF A;  3OY9 A;  3NHG A;  4B3O A;  4GMJ B;  2YNG A;  3K5N A;  2KTQ A;  2IS3 A;  1TAQ A;  1ZYQ A;  1FK9 A;  1RT4 A;  4PY5 A;  3K5L A;  4BDY A;  1RTD A;  1SL0 A;  3PO4 A;  3KLH A;  4LH5 A;  3LPU A;  3QLH A;  4PWD A;  3CM6 A;  4GVM A;  1REV A;  5T7B A;  4E0D A;  4M3Z A;  4FJL A;  5J2Q A;  3QIP A;  3OYL A;  4CJU A;  2KQ2 A;  1JL2 A;  3ISN C;  4CF9 A;  3RR8 A;  1XWL A;  3AO2 A;  3AO1 A;  1SKS A;  4CFA A;  4N47 A;  4FYD A;  1WNS A;  4I2P A;  2IC3 A;  4CJP A;  4MQ3 A;  4FK4 A;  4HTU A;  3KTQ A;  5DK5 A;  5DMR A;  1TK0 A;  2I5J A;  4KV8 A;  1DLO A;  4BAC A;  3SJJ A;  4HUG A;  5HRR A;  1KFS A;  4FLX A;  1C0T A;  3QER A;  4NCA A;  4KI6 A;  4BDP A;  3HVR A;  2F96 A;  3DMJ A;  1B9D A;  3LZJ A;  3ZSR A;  4HCC A;  3P83 D;  3RRH A;  3WNG A;  3THV A;  4CK1 A;  1RIL A;  1XC9 A;  2G8W A;  3L2W A;  1IH7 A;  3O3F A;  1L3T A;  3G10 A;  3TAF A;  3WNH A;  4CHN A;  2ITG A;  1XHX A;  1S6P A;  3ZT2 A;  4CJ3 A;  4DTP A;  4AHV A;  3TAN A;  2XY8 A;  3QIO A;  4I9L A;  4FJM A;  3K5M A;  1NOZ A;  4YFU A;  1TKT A;  1I3A A;  4CJE A;  1ASV A;  3ASM A;  4CF2 A;  3TAR A;  1NK4 A;  4RW9 A;  3RMA A;  3QEV A;  3MED A;  4O0I A;  2XO7 A;  1X9M A;  1HYZ A;  2XRI A;  2X74 A;  4CF0 A;  4DFK A;  1TAU A;  4KB1 A;  1HYV A;  1F21 A;  1C1C A;  3I8D A;  1ZBU A;  3B6O A;  3KK2 A;  2HHQ A;  3CG7 A;  4CEA A;  3KIO A;  4N56 A;  3HT3 A;  4EZ9 A;  4B9S A;  1T05 A;  3IS9 A;  1QE1 A;  4OPJ A;  4LSL A;  2FC0 A;  1RTH A;  4DSF A;  1W0H A;  4DTJ A;  1C1B A;  1NOY A;  4B9T A;  3OS0 A;  2VG7 A;  1Q9Y A;  3VQ4 A;  4CJL A;  1N6Q A;  3VQ9 A;  4FZZ A;  3OYC A;  4I2Q A;  4KTZ A;  1BQN A;  3TAP A;  4KKO A;  4DFJ A;  4DSK A;  4DTX A;  4HUF A;  5HRO A;  1A5W A;  3TAQ A;  1SKR A;  1IG9 A;  1QS4 A;  1YTA A;  4AHT A;  1KVC A;  4FXD A;  5I3U A;  4F4K A;  4AHR A;  1G15 A;  2X6S A;  4CHY A;  3L2U A;  2HND A;  3BGR A;  1CXQ A;  4Z4C A;  3ZT3 A;  5KRT A;  1ZBF A;  2FBY A;  3OYN A;  1QQC A;  2XY7 A;  4FJN A;  3ZSQ A;  1TVR A;  2JGU A;  3LWL A;  3SUP A;  3V9X A;  3ZSZ A;  4ZTJ A;  2KW4 A;  2VG6 A;  5HRN A;  3QEX A;  3S9H A;  1VSJ A;  1HQU A;  2HB5 A;  4H4O A;  4B9N A;  3DLK A;  4RW8 A;  1K6Y A;  3O3H A;  3V9Z A;  5J2M A;  1D8Y A;  4J2B A;  2RKI A;  1NKC A;  4DSJ A;  4QCL A;  1RT7 A;  3L2Q A;  3D0P A;  4CF8 A;  2Z1H A;  3RTV A;  3HK2 A;  3BDP A;  5KI6 A;  4C8M A;  3I0S A;  2HNZ A;  4J2A A;  2RF2 A;  1NK0 A;  3I0R A;  4FJ8 A;  2B5J A;  3LP3 A;  3S3O A;  3MEE A;  1RDA A;  4CGD A;  5FDL A;  1S1W A;  3G0Z A;  4AHC A;  4OVL A;  3LWM A;  3TAE A;  1TL1 A;  4KFB A;  3SPY A;  3MXJ A;  2FBX A;  1TKZ A;  3JYT A;  3AVN A;  2P5O A;  4BWM A;  2G8F A;  3DOK A;  4FJG A;  3IAY A;  3SQ1 A;  4I9Q A;  5FRN A;  1EKE A;  4EP5 A;  1S1V A;  4DLG A;  4MFB A;  3NAE A;  4M3T A;  4EP4 A;  1SL1 A;  2OPP A;  1UA0 A;  2DFE A;  4KTQ A;  3K58 A;  1VSF A;  1U04 A;  3LAK A;  4CJQ A;  3M8P A;  1QSY A;  4JS4 A;  1U4B A;  4BDZ A;  5E41 A;  1GOC A;  5KGX A;  3C94 A;  3SUN A;  3HP9 A;  4JRQ A;  2HHX A;  4H4M A;  1HPZ A;  1BCM A;  1B92 A;  4PA1 A;  1JKH A;  3PX0 A;  1UWB A;  4CJ5 A;  4CCH A;  1A5V A;  3SPZ A;  1RT2 A;  1JLE A;  1JXE A;  3VN5 A;  4QOZ B;  2YHB A;  2E6M A;  4M41 A;  4DTR A;  4FLZ A;  4DMN A;  3KKR A;  3AVC A;  3NH0 A;  3RWU A;  4O44 A;  4CEQ A;  1FXX A;  2ATQ A;  1ITG A;  1WSH A;  1EP4 A;  3RMB A;  3AVJ A;  2VWJ A;  4L8R B;  3KLG A;  1ASU A;  3KLI A;  1SL2 A;  2NUB A;  1KLM A;  3V9U A;  5HRP A;  1CZ9 A;  4CF1 A;  3LAM A;  3OYE A;  3U3G A;  4JLH A;  3L8B A;  2DY4 A;  4KRE A;  3S3M A;  4Q5V A;  4FLT A;  4CK2 A;  1YT3 A;  1S9G A;  2G8V A;  1Z26 A;  1C0M A;  2IOC A;  2O4G A;  3T19 A;  4DQQ A;  3QEW A;  4E3S A;  1EXQ A;  1HYS A;  1J54 A;  3ALY A;  3S3N A;  2G8I A;  1C1A A;  4IFY A;  3VQ7 A;  4CEZ A;  4M3X A;  4E89 A;  3HYF A;  2KZM A;  3EZ5 A;  5HLF A;  1XHZ A;  4CHP A;  1WN7 A;  3CFO A;  3M8S A;  2W42 A;  2HW3 A;  4HUE A;  4DQS A;  1VSL A;  2X78 A;  5KGW A;  2Y1J A;  1KLN A;  4EZ6 A;  4NCB A;  1KVA A;  1WAF A;  1JXB A;  3V81 A;  1Q9X A;  1RBS A;  1QSL A;  3QIN A;  2OPS A;  3ZSY A;  4CGF A;  1NJY A;  2YHA A;  4K8X A;  3DRS A;  4KHN A;  4I7F A;  3OYM A;  4DU3 A;  3C6U A;  1L3V A;  4FM0 A;  1Z25 A;  3QNN A;  4FJK A;  2FBV A;  4CGJ A;  4UQG A;  3TAB A;  4OKE A;  5C24 A;  4OGE A;  1LWE A;  4FM1 A;  1IO2 A;  4DFP A;  4J2E A;  2DFF A;  2GBZ A;  3VQQ A;  4CGG A;  4KI4 A;  1LV5 A;  4E19 A;  1MU2 A;  2IGI A;  1WLJ A;  2YKM A;  4FJ7 A;  4GW6 A;  3AVL A;  4CHZ A;  4JRP A;  2XY6 A;  1JLQ A;  4E1M A;  5I42 A;  1BL3 A;  3OYG A;  4AHS A;  3ZT1 A;  3L2R A;  2KZZ A;  1W9H A;  3ITH A;  3V1Q A;  4W5Q A;  2PYJ A;  2G8U A;  4DQP A;  4NYN A;  3VQA A;  1RT5 A;  4NYF A;  1L3U A;  3HJF A;  2DTU A;  4W5O A;  4LH4 A;  1FKO A;  1O1W A;  1RDB A;  3L3V A;  4IG0 A;  1T8E A;  3AVB A;  3V9W A;  1J5O A;  2FBT A;  3KD5 E;  4DSI A;  4M3U A;  1NK5 A;  3SNN A;  2X6N A;  3VA3 A;  4PUO A;  1RBV A;  3NDK A;  4IKF A;  2D0B A;  1D9F A;  3UIQ A;  1S1T A;  3NBP A;  3MEC A;  1BIU A;  3HPO A;  4KHU A;  1JLB A;  2ZD1 A;  3LAN A;  1YTU A;  2XY5 A;  3DRR A;  4CJW A;  3HL8 A;  3PX4 A;  2HMI A;  3PV8 A;  3F73 A;  2XHB A;  1ASW A;  2D0C A;  3CM5 A;  3DLR A;  1CLQ A;  4R5P A;  5SWM A;  3HP6 A;  4FW2 A;  3NF8 A;  3VQ8 A;  1L5U A;  4N41 A;  3HPH A;  3ULD A;  4KPY A;  4M3R A;  4DTN A;  5JS1 A;  1X9W A;  3F9K A;  3TAM A;  1IKY A;  2WOM A;  1Y97 A;  4HVJ A;  3VQD A;  3HXM A;  1SKW A;  4M3Y A;  1NK9 A;  1BQM A;  1LW0 A;  2OA8 A;  2PZS A;  3WNF A;  1RTJ A;  4CK3 A;  4RW6 A;  1KCF A;  3DYA A;  3T3F A;  1VSD A;  4FLU A;  2P51 A;  4IG3 A;  3OJU A;  2Z1I A;  2F8T A;  2HHV A;  3OYA A;  2QKK A;  4ELT A;  4JS5 A;  2PYL A;  4B9V A;  4ELV A;  4XIU A;  1CXU A;  4N5S A;  4Y1C A;  1NJW A;  4KTW A;  3LAL A;  4Y1D A;  3A2F A;  3L3U A;  1KSP A;  4FK2 A;  4F2S A;  5FRO A;  1BGX T;  3CFR A;  3TAG A;  1N5Y A;  3RRG A;  2P5G A;  1TK8 A;  3O3G A;  4B9L A;  5JS2 A;  4OKJ A;  3ZSW A;  2HVI A;  1DTT A;  4BE2 A;  1NK8 A;  3RR7 A;  4DWI A;  3KKS A;  4OLA A;  2QKB A;  3DOL A;  4ZHR A;  1ZBH A;  3U6F A;  4YNQ A;  4KHY A;  3RMD A;  2YNI A;  1LWF A;  3NGY A;  3LDS A;  1EX4 A;  2WON A;  2ZE2 A;  3KLF A;  2G8H A;  3HO1 A;  3AA2 A;  3AVH A;  3P5J A;  2F8S A;  5K14 A;  4DU4 A;  4ELU A;  4B9M A;  4TSX A;  1BIS A;  1WSI A;  4DQR A;  4DTM A;  3AVM A;  3KD1 E;  1TGO A;  4E7L A;  1U45 A;  1WSE A;  1YVU A;  4LSN A;  3OYI A;  2BE2 A;  3K57 A;  1T7P A;  4CIF A;  2OYQ A;  3SV3 A;  1VRT A;  4DTO A;  4ZTF A;  3HVT A;  4IFV A;  2Z1G A;  4ICL A;  1WAJ A;  4FW1 A;  2BAN A;  1X9S A;  3SI6 A;  1VSK A;  3MEG A;  3KK3 A;  4E7H A;  3C6T A;  4AIL C;  4FJX A;  2DFH A;  2A1S A;  3ZSV A;  4BE1 A;  1TL3 A;  3LZI A;  3OJS A;  1U47 A;  3QEI A;  4DS4 A;  1LAV A;  4CGH A;  4W5T A;  4CIG A;  3JSM A;  4DSL A;  1JLG A;  4CED A;  2Q3S A;  2HHS A;  1S9E A;  3FFI A;  2IAJ A;  5J2P A;  5FRM A;  1RTI A;  4FLY A;  4CEC A;  4CGI A;  3ZT4 A;  1NKE A;  2B6A A;  5C42 A;  3RMC A;  1HQE A;  3OYK A;  1T03 A;  4OKK A;  1R0A A;  3PX6 A;  4Z4F A;  1HMV A;  1NK6 A;  1RCH A;  4E7J A;  4DLE A;  4FM2 A;  3EYZ A;  2QXF A;  1DTQ A;  3OYJ A;  3NCI A;  3O4Q A;  5CZ1 A;  3ZT0 A;  5J1E A;  4O5B A;  4B9U A;  4KHS A;  1EET A;  3DLB A;  4OGC A;  4E7K A;  2HHU A;  4NCG A;  1S6Q A;  3V9S A;  4CEE A;  1TV6 A;  4G1Q A;  3PO5 A;  3DRP A;  3LPT A;  3WNE A;  3SCX A;  4DTS A;  3AA4 A;  1JLA A;  3AVK A;  3ZSX A;  4AHU A;  5HP1 A;  2YNH A;  3SQ4 A;  3C95 A;  3E01 A;  1HNV A;  4DS5 A;  3SUQ A;  3H08 A;  4C8K A;  3CYM A;  3SV4 A;  3K2P A;  4F8R A;  2D5R A;  4WE1 A;  1S1X A;  3QES A;  4O55 A;  4FZY A;  4J2D A;  4OJR A;  4Z0U A;  4N76 A;  1B9F A;  2B4J A;  4E1N A;  5KTQ A;  1RNH A;  4PQU A;  4H8K A;  1WSJ A;  1WSG A;  3QEP A;  4F2R A;  1ZBL A;  1RDD A;  1HNI A;  5CZ2 A;  4RW7 A;  1U48 A;  4M42 A;  4KHQ A;  4FLV A;  1IKX A;  4DF8 A;  3CQ8 A;  3M8Q A;  4HHT A;  2EX3 A;  2KFN A;  1KFD A;  4W5R A;  3MAQ A;  4AH9 A;  4FCY A;  2VG5 A;  4DF4 A;  1RT3 A;  3SUO A;  1TKX A;  4DTU A;  3NH1 A;  2G8K A;  4B8A B;  4BE0 A;  4DFM A;  4CFC A;  2ZQB A;  4CIE A;  3SQ0 A;  4RW4 A;  1BI4 A;  1LW2 A;  4CES A;  1VK0 A;  2RN2 A;  3MXM A;  1VSI A;  2VWK A;  4C8N A;  1VRU A;  3DLE A;  4LD0 A;  2E6L A;  3OYB A;  4B08 A;  1NK7 A;  5D3G A;  1WSF A;  4KO0 A;  2KFZ A;  5KRS A;  3LP1 A;  1VSM A;  2YV0 X;  2HHT A;  1RBU A;  2E4L A;  1J53 A;  1LWC A;  1SV5 A;  3AO5 A;  1I39 A;  3AA5 X;  4KHW A;  1HRH A;  3O4N A;  4FJ5 A;  1CZB A;  3P1G A;  3QET A;  1NJZ A;  5J2N A;  5EU7 A;  3DLG A;  3NGI A;  1U49 A;  2OPR A;  4FLW A;  1RT6 A;  4K8Z A;  3DLH A;  4M3W A;  4C8L A;  3AV9 A;  1KRP A;  4DG1 A;  1GOB A;  1C6V A;  3EY1 A;  4M45 A;  4FJH A;  4FVM A;  3IG1 A;  3AVF A;  2R7Y A;  1RBT A;  2HNY A;  3PY8 A;  1GOA A;  1BHL A;  2HVH A;  3V1R A;  4KAZ A;  3B6P A;  5CYM A;  5HRS A;  4FJ9 A;  1RT1 A;  3HPG A;  3VQC A;  4OPK A;  4CHQ A;  1UAX A;  3VA0 A;  1FKP A;  4CJ4 A;  2YNF A;  3MXI A;  3HST B;  3VQB A;  3LP0 A;  3L2V A;  2PY5 A;  4F3O A;  4W5N A;  3AA3 A;  1NKB A;  2OPQ A;  3NH2 A;  1Q8I A;  1BI4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...