3VQ5A

Hiv-1 in core domain in complex with n-methyl-1-(4-methyl-2-phenyl-1,3-thiazol-5-yl)methanamine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
151
structure length
133
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 48
structure length 133
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vq5A00
3SYZA 1JXEA 3DRRA 1S1TA 4FVMA 1BIZA 4LH4A 2RF2A 2YKNA 3LP0A 5KI6A 1LV5A 4DQIA 2QK9A 2VWKA 1NKBA 1TKDA 2HHUA 3HPHA 3SJJA 1WNSA 3ASMA 2PY5A 2HW3A 1U04A 4PA1A 1YVUA 4QOZB 3SPZA 1S9EA 4DSFA 4N47A 2HVIA 3KD1E 4CJWA 3K58A 2ATQA 3ITHA 4IBNA 4DS5A 3VN5A 4Z4FA 3TANA 2PYLA 4FCYA 3VQ9A 1HNVA 1UOCA 4M3WA 4DLEA 3KKSA 4OPKA 4B9VA 1J9AA 4LD0A 1WSIA 3CYMA 4DWIA 4CJLA 1KRPA 1QQCA 1UAXA 3TWHA 3SUNA 2Z1JA 3TARA 2HHWA 3JYTA 3LPUA 3F73A 3SUOA 3PO4A 4E3SA 1NJWA 4DTSA 1ZBIA 2F8SA 2BDPA 2XY5A 3P1GA 4KHUA 3CM5A 4KPYA 3VQPA 4IG3A 4ELUA 3HT3A 4AHVA 3AVHA 3S3NA 1Z25A 4CEZA 4YNQA 5I42A 1S5JA 3NDKA 3OJUA 2RPIA 1CXUA 5FROA 3K59A 3D0PA 5FRMA 4F4KA 2GUIA 3HSTB 4JRPA 2Z1HA 1IKYA 4BACA 3MXMA 1T05A 1KVCA 3M8SA 3IAYA 1VSEA 3G10A 5KGXA 3HYFA 4AHRA 4MQ3A 4CIFA 4HVJA 4FLXA 1CZ9A 1NJXA 4CK1A 1XWLA 2YNGA 2E6LA 3O3FA 1JL2A 1VSFA 1Z26A 2BANA 1ASVA 3QEPA 1JL1A 4Z4IA 1C1AA 3NBPA 2G8VA 3NGYA 4KTZA 4Z4HA 3DLRA 5JS1A 2R7YA 1TL3A 4I9QA 4FM2A 1VSKA 1IG9A 4LSLA 4HCCA 2DFEA 2E6MA 2RKIA 4OGCA 3NCIA 4BE0A 1U49A 4B9LA 4AH9A 4F2RA 1NK0A 3ZCMA 4CEOA 5DK5A 3OS2A 1RT1A 3I0RA 4ID5A 3KLGA 1FK9A 1JLBA 1RTHA 4NCGA 4M45A 4AILC 1RTDA 1G15A 3QLHA 2HHXA 4B9TA 1IH7A 1VSLA 2Z1GA 3VQEA 4CEBA 3LZJA 1NK9A 2HVHA 3OYIA 2O4IA 1QHTA 4Q5VA 3AA5X 4CCHA 2HHQA 2KTQA 3CFPA 4CJUA 1WAFA 3ALYA 2OA8A 3NH0A 4ELTA 4GVMA 1B92A 4I2QA 3IS9A 3SQ4A 3AVCA 4O5BA 4CHZA 5C42A 4B9MA 1NOZA 3HO1A 2D0AA 3PX4A 4KHWA 1RT2A 2EX3A 3OS0A 3T3FA 3QERA 3K57A 1D5AA 2G8UA 3VQ6A 4DSJA 3NH1A 4J2AA 4M42A 4OKKA 3TAMA 3AO3A 2D0CA 3ZSOA 3OYCA 4M3RA 4FLUA 4CF2A 2AJQA 4KRFA 4M3UA 4CJ5A 2OZMA 1NK4A 2OPSA 3MEEA 3ZT3A 3KLFA 1VRUA 3AVMA 3L2RA 3V4IA 1U4BA 2RN2A 1CXQA 3RTVA 5FDLA 3LP2A 1RBVA 1D9FA 2PYJA 2YHAA 3AA3A 1SKWA 3SZ2A 4G1QA 4DS4A 4LY7A 4OLAA 1Q9XA 1IKXA 4KB0A 4J2BA 3U6FA 4FJMA 4C8MA 4Z4EA 3OYLA 1IKWA 3L3VA 4B08A 3RMAA 3RR7A 4FK2A 3NH2A 3L2QA 1BHLA 1HYSA 1YT3A 3QIOA 2Q3SA 3ULDA 3VQ7A 3THVA 2OZSA 4KAZA 2JGUA 1HPZA 2XHBA 4CJSA 4FJGA 1C6VA 1FKOA 1MU2A 1W0HA 1SV5A 2WONA 2ZD1A 3ZT1A 2FBVA 3OYMA 4H4OA 1C0UA 3PY8A 5HRNA 5T7BA 2YKMA 4KTWA 4CF8A 4E7IA 4N41A 3VQCA 1BQNA 2ZQBA 3KLHA 3RR8A 4DFPA 4FLVA 5HROA 1HJRA 4IFVA 3AVLA 1EKEA 4CF0A 1JLAA 1EP4A 2VG7A 1S1XA 5C24A 4CIGA 3PUFA 4M3XA 1HYVA 1BCOA 3ZSVA 1ASUA 5KRTA 3AO5A 4CJKA 4L8RB 1IO2A 1BQMA 3AA2A 3WNEA 3ZSZA 3HK2A 4C8OA 4DTRA 2G8FA 1UWBA 3F9KA 4OGEA 4CEAA 3PX0A 1TL1A 4B8AB 3OYFA 5JS2A 4I9LA 4DU3A 3PX6A 4FK0A 1RT3A 3QINA 1BL3A 1WN7A 4CGFA 1WAJA 4CJFA 2XY6A 4Q0BA 4UQGA 4LSNA 1NJZA 1X9SA 3QETA 3BGRA 4CFCA 4W5OA 3SNNA 4O0JA 5CYQA 2FC0A 1U48A 1T8EA 1L3UA 3KK2A 3RRHA 3S9HA 1YTUA 1FXXA 3QNNA 3T1AA 2GBZA 1KVBA 2X6NA 1EX4A 4E89A 3I8DA 1S1VA 3ZSXA 1QSYA 2PZSA 4KFBA 4KHSA 3VA3A 3KK3A 3JSMA 3V1OA 4HCBA 3SUPA 5HRSA 2QKBA 4RW4A 4QAGA 2IS3A 1RNHA 1RDDA 1Y97A 2B4JA 1VSJA 3AVBA 5HRPA 2HHVA 1X9MA 4FJKA 4AHTA 3HVRA 5KRSA 4R5PA 2W42A 5SWMA 4DLGA 4FJ8A 4O4GA 4K8ZA 3E01A 3WNGA 4CHNA 1SUQA 4Z0UA 3OYNA 1HQEA 4O55A 3V9SA 1SL2A 3AVJA 3IRXA 4ICLA 1KSPA 3K5NA 3TAPA 3HXMA 1K6YA 4W5QA 1RTJA 3K2PA 2YNHA 4W5TA 1A5XA 3VQ5A 1NK6A 3DRSA 3HVTA 4N5SA 4DU4A 4DQSA 1VSDA 3NF8A 1XC9A 3QIPA 4BE2A 3L3UA 4KI4A 4CHQA 2KZZA 3AO4A 2VWJA 2B5JA 2YNFA 3HP9A 1J53A 1RBTA 1J54A 1KFDA 4IG0A 5HBMA 1JLGA 3RMBA 2P5OA 1RDCA 2IGIA 1TK5A 3A2FA 2XO7A 3LAMA 1WLJA 3TAEA 4E7JA 2OPQA 3DOLA 3OYKA 3DLKA 4CK2A 3CFOA 1NKCA 4FW1A 1ZBHA 4CF1A 1RBRA 4HHTA 3V1RA 3SCXA 3WNFA 3SPYA 1NK7A 4FZYA 4FJ7A 4CFBA 4FJ9A 4EZ6A 2X74A 4FLTA 4CFAA 1ZYQA 1EXQA 4N76A 3QEXA 2D5RA 4K8XA 4TSXA 4FLWA 2X78A 3NAEA 4NCBA 1KFSA 3C6TA 1LW2A 4W5NA 5J1EA 4KTQA 4O44A 3KLIA 4DSIA 3KIOA 3P5JA 2HB5A 2JLEA 4CGGA 3VQQA 4DTNA 1ZBLA 4C8KA 4FZXC 1JKHA 2LSNA 1RT6A 3MEGA 4CEEA 4FJHA 3QEIA 2KZMA 5EU7A 3NGZA 4FM0A 2OPPA 4EZ9A 3SQ0A 2F96A 1HRHA 2ETJA 4FYDA 5J2QA 3LP1A 4CJPA 3LPTA 1RT5A 3NGIA 3BDPA 4CEDA 4JRQA 3CQ8A 3DMJA 3MECA 4FJIA 3UIQA 2X6SA 3AVKA 3CG7A 4FJJA 3RRGA 4CGIA 2KW4A 2G8HA 1QTMA 4I7FA 4Z4CA 5SZTA 4YFUA 3VA0A 3AO1A 3TR8A 1C0TA 2P51A 4CECA 1JLEA 4CJRA 4E7HA 3LALA 3ZSQA 4ID1A 4CJEA 4DTUA 4DMNA 4B9UA 4FLYA 3KLEA 4FK4A 3ZT4A 3G0ZA 3IG1A 3KTQA 1DLOA 1VK0A 3H08A 4RW9A 4AHUA 5CYMA 3SQ2A 2EHGA 4PY5A 1NOYA 1QE1A 1HMVA 4BE1A 2ITGA 2G8KA 4J2DA 1I39A 1L3VA 2P5GA 1HQUA 3OJSA 4DSEA 3LDSA 1BIUA 4CEFA 1LWFA 1TKZA 4BWJA 3OY9A 3SQ1A 1C1CA 1RILA 1ZBUA 2P1JA 3ZT2A 4IKFA 4KHNA 2KFNA 4M3TA 4OVLA 4M3ZA 4DQPA 2HNDA 1LWEA 2QKKA 4BDYA 1GOCA 4B9NA 4FJ5A 1KTQA 3QEVA 4IFYA 4KI6A 3VQAA 1TGOA 4HUEA 1QSLA 3O4QA 1CZBA 3M8RA 3EYZA 3TI0A 2WOMA 1TAUA 2IOCA 4CJ3A 1JLCA 3C95A 2FBXA 1ITGA 2XY8A 1N6QA 4W5RA 3HP6A 1RDAA 1S6QA 4E7KA 1SL1A 3SUQA 3VQ4A 4RW7A 3AVAA 1I3AA 3C6UA 3AVFA 4EP4A 4DTPA 4FJXA 3D45A 3FFIA 1B9DA 3HL8A 1IKVA 3OVNA 1NK8A 4CHOA 3DLHA 4E1MA 4JS5A 1SKRA 4QCLA 5CY4A 4Y1CA 1J5OA 1TK8A 1SKSA 4KHYA 2OYQA 5I3UA 3EY1A 3PO5A 4B3OA 2B6AA 1NKEA 3TABA 3T19A 1XHZA 1L3TA 1XI1A 3VQDA 4PWDA 1ZBFA 4XIUA 2YNIA 3AA4A 1JXBA 3O3GA 3U3YA 3V81A 1U45A 1D8YA 3KK1A 3NF7A 1TKXA 1HYZA 2FBTA 4OKEA 4CFDA 2Y1JA 2HMIA 3EZ5A 1UA0A 4I2PA 3NF9A 4OPJA 4DG1A 3DLEA 3WNHA 1RTIA 3OYDA 3QNOA 1REVA 3DLBA 2I5JA 3I0SA 4JLHA 3DLGA 5C25A 4CJ4A 1A5WA 3HPOA 3AVGA 4NCAA 3NHGA 4CESA 4ZHRA 4BDPA 1LWCA 3ZSWA 5DMRA 1FKPA 1ASWA 2HNZA 4BDZA 1N5YA 4J2EA 1A5VA 2VG6A 4CK3A 5KTQA 4HUGA 4DFMA 4KREA 4RW6A 4E0DA 1CLQA 2BE2A 3CFRA 4CE9A 2NUBA 1TAQA 4M41A 3LWLA 3SI6A 4PQUA 1VSHA 4NYFA 5CZ1A 4DQQA 4ZTJA 2QXFA 3KD5E 4JS4A 1WSJA 3AVIA 1QSSA 4DF4A 4DU1A 1LAWA 1S1WA 1BISA 3OYHA 3B6PA 4FM1A 3DI6A 3RMCA 2G8IA 1D9DA 2HHTA 4CJQA 1TVRA 3ZSYA 3P83D 4DTXA 3MAQA 1WSFA 1RCHA 1HNIA 1WSGA 3L2UA 2HHSA 3AVNA 4CERA 4CEQA 4DTOA 1KLNA 3QO9A 3V9ZA 1JLQA 3S3MA 2XRIA 2Z1IA 2DTUA 2YHBA 1L3SA 2IDOA 3LP3A 4RW8A 3NE6A 1VRTA 4MFBA 5CZ2A 3SV3A 2KQ2A 2OPRA 5J2PA 1KLMA 3LWMA 3CM6A 3V6DA 1TK0A 2FBYA 4FLZA 3QEWA 1Q8IA 1W9HA 3OS1A 3OYGA 4DQRA 4O0IA 4CHPA 1KCFA 3S3OA 3MXJA 4CGDA 4RG8A 3K5OA 3OYAA 3RMDA 3L2VA 3TAFA 4HTUA 3OYEA 2A1SA 2O4GA 4C8NA 5HLFA 3AO2A 1B9FA 3ISNC 1QS4A 4C8LA 4CF9A 1EETA 1T7PA 4CJVA 3HPGA 4LH5A 2Y1IA 1RBSA 3LANA 1S1UA 2DFHA 2G8WA 3L8BA 1WSEA 3O3HA 2BGGA 4ZTFA 4B8CA 3AV9A 1LW0A 1BGXT 1JLFA 3V1QA 4F3OA 3M8QA 4OLBA 5J2MA 1NK5A 4H4MA 4CIEA 1UA1A 4DFKA 2VG5A 3DRPA 3DYAA 3MEDA 4IDKA 4OKJA 1RDBA 2KFZA 3TAGA 4FJNA 5HP1A 1Q9YA 4OJRA 4GMJB 5J2NA 2E4LA 1LAVA 1BI4B 2DFFA 1TKTA 3M8PA 4GW6A 5HRRA 4CGJA 4DTMA 4WE1A 2DY4A 3QESA 3V9WA 3SV4A 4E7LA 4DFJA 3KJVA 3LZIA 1DTTA 4DSLA 4AHCA 4KV8A 1C1BA 2ZE2A 3U3GA 4Z4GA 1F21A 1KVAA 1C0MA 1RT4A 1X9WA 3ZSRA 3B6OA 1VSIA 2IC3A 4KO0A 4F2SA 2IAJA 3OYBA 1T03A 3V9UA 1L5UA 1GOBA 1XHXA 1O1WA 4EP5A 5K14A 4KKOA 3KKRA 4E1NA 3VQBA 1WSHA 2GV9A 5E41A 3K5LA 3TAQA 3MXIA 4F8RA 2YV0X 2F8TA 1RT7A 4AHSA 3K5MA 1X1PA 3NF6A 3PV8A 4DSKA 3NFAA 4ELVA 1S9GA 1TV6A 5D3GA 5KGWA 3HJFA 4Y1DA 4DTJA 4NYNA 1VSMA 1DTQA 1SL0A 3VQ8A 4M3YA 4E19A 3OYJA 3DOKA 3ZT0A 4DF8A 1YTAA 3O4NA 4FZZA 3LAKA 4BWMA 1BCMA 2HNYA 3C94A 4KHQA 4HUFA 5FRNA 4FW2A 1BI4A 4H8KA 2XY7A 1U47A 3DM2A 4CJTA 4B9SA 4FJLA 4CHYA 4FXDA 3L2WA 2D0BA 1NJYA 1R0AA 3V9XA 3RWUA 4N56A 4F3TA 2A1RA 4PUOA 1S6PA 4KB1A 1RBUA 1GOAA 4CGHA 3HM9A
chains in the Genus database with same CATH superfamily
3SYZA 1JXEA 3DRRA 4FVMA 4LH4A 1LV5A 4CZIA 2HHUA 4C1NI 2PY5A 3R8EA 3O9UA 1U04A 2WC9A 4N47A 3UKRA 4EIAA 2ATQA 4DR1K 4DS5A 4NLBA 2P9LA 4BC5A 4JKDA 3ZETA 1U6ZA 1OH8A 3VQ9A 3OBWA 3ULEA 4PKIA 4OPKA 1VQ5N 4DUYK 4LD0A 4FOIA 4FWNA 4WYBA 4DWIA 3TWHA 5GAHP 3J81O 4XEIA 4DTSA 1ZBIA 2BDPA 5F1XA 2NNWA 5FPDA 4B1UB 4KPYA 3VQPA 4PL7A 4ELUA 1QQOA 2E20A 4J8FA 3SAFA 1K8KB 1S5JA 2E1YA 2NRVA 4IO8A 1EWQA 1EQYA 2A6AA 5AQIA 4U7BA 1MWKA 4KH6A 3ZX3A 1T05A 3AGRA 2P9UB 2O8EB 4AHRA 4MQ3A 3WQTA 3QICA 1U49A 1VSFA 1ASVA 2D1KA 1C1AA 5BRFA 4Z4HA 3DLRA 5JS1A 5BR8K 4I9QA 4FM2A 3EN9A 4HCCA 4YOTA 4OGCA 2IVPA 5M1PA 2VGNA 5E84A 4X64K 2F9WA 3PLAA 3OS2A 1RT1A 4NCGA 1RTDA 1G15A 3LM2A 4YDUA 4DCHA 1NK9A 4CCHA 4YOWA 4KBOA 2YHYA 5LY3A 2OA8A 3ID8A 3SQ4A 3AVCA 5C42A 3U9DA 1NOZA 5AQOA 2D0AA 3PX4A 4KHWA 1RT2A 4J2AA 3F2KA 3FZLA 1RFQA 3RVCA 3AO3A 3KHYA 3ZSOA 1Z6RA 3O1BA 3D6RA 3IUCA 4M3UA 4BQZA 4FOEA 1NK4A 3KLFA 3ZT3A 3HSCA 1U4BA 1CXQA 3RTVA 1JCFA 4G1QA 4LY7A 3VGMA 4M63C 3L3VA 3RMAA 1BHLA 2AP1A 3ULDA 3VQ7A 2J4RA 2VGMA 4IZ9A 1HPZA 2F8SA 2QWPA 2O8BB 4DB3A 5T7BA 3VQCA 4FPAA 3CMAN 3EKSA 4DFPA 5HROA 4JI3K 4M3XA 4YOXA 1ASUA 3BEXA 4ILJA 4CJKA 1IBMK 2G8FA 1UWBA 3F9KA 4CEAA 4B8AB 3OYFA 4DU3A 1RT3A 3QINA 1QQNA 1WN7A 4Q0BA 1NJZA 4LSNA 3PIOL 3HM8A 3LL3A 1VQ6N 1U48A 4BRCA 3PSFA 3T1AA 4KHSA 3KK3A 3JSMA 3MK6A 3SUPA 3K0SA 5HRSA 1Y97A 5GAGP 2KKZA 5JLHA 1X9MA 4FJ8A 4BRNA 3THWB 5KRSA 1P8ZA 1R59O 4O55A 1KSPA 3VEOA 3TAPA 4BRGA 3HXMA 4H0TB 2Q0RA 4W5TA 1NK6A 3SMSA 4FWPA 1ATNA 5GIPA 1KAYA 1VSDA 4BE2A 1E4GT 2VWJA 2B5JA 3KZBA 1J53A 2E8AA 1NGJA 5AZJB 1KFDA 5HBMA 3RMBA 2P5OA 3T1HK 1SZ2A 3A2FA 3LAMA 1GLBG 1KC8O 3OYKA 4A5BA 4CF1A 1RBRA 1OH5A 1NK7A 4FJ7A 1K8KA 4FJ9A 4N76A 1EXQA 2D5RA 2OCEA 4NLCA 4DQ8A 1OKJA 1HLUA 5J1EA 3H1QA 2P9UA 2O8EA 4O44A 3KLIA 4DSIA 5EY4A 2HB5A 4FZXC 2W40A 3O9QA 3VQQA 3WUHA 1QVFM 4FJHA 3VTIA 3MWTA 2OPPA 3SQ0A 2F96A 4B3TK 1HRHA 5AQVA 3G6EN 4B3RK 2P9NB 4CJPA 4A59A 4JRQA 3CQ8A 4DV7K 3MECA 5M1NA 5BRDA 4CGIA 3VEYA 4Z4CA 5SZTA 1EWRA 4YFUA 2BH1A 3KWIA 1C0TA 4E7HA 4DTUA 4FLYA 3KLEA 3IG1A 3KTQA 3CCLN 1Z05A 1HMVA 3O4WA 5ADXA 5AQGA 3NMUA 4DHYA 1BIUA 1LWFA 4BWJA 1ZBUA 4IKFA 1HUXA 4M3ZA 1TYQB 2HNDA 1LWEA 2O8FB 1GOCA 1TGOA 1E4FT 1YIJN 4FO0A 5AFUH 1WB9A 4CJ3A 1ITGA 2XY8A 4W5RA 3CJ1A 4E7KA 4BR9A 3SUQA 3VQ4A 3HL8A 1YJWN 1SKRA 3WQUA 1NJIO 3QB0A 5JICA 4Y1CA 2QWRA 3TABA 1OVYA 2O8BA 2Q36A 4CZGA 1L3TA 3QFPA 1U45A 3KK1A 3QFUA 1TKXA 4H5TA 2HMIA 4I2PA 5E26A 3NF9A 4DG1A 3W3DA 5AQNA 3OA9A 3BZCA 1HPMA 1REVA 5C25A 3GBTA 1FKPA 2UUBK 3SBTA 2VG6A 2VQFK 4KREA 1FJGK 2NUBA 3LWLA 4FWLA 5CZ1A 4ZTJA 4B1VA 5I9EB 4FM1A 3RMCA 3B6PA 4CJQA 1BUPA 5LMNK 4BGAA 4DTXA 3CCSN 4DV4K 4ISFA 5AQJA 2VYPA 4I6MB 2YCHA 5AQXA 4JI4K 4RW8A 4MLHA 4X66K 1YJ9N 3THWA 5CZ2A 3SV3A 3Q7BA 2KQ2A 5HL7L 5J2PA 1Q8IA 3CF5L 4DQRA 5M1OA 3CQXA 3MXJA 3L2VA 3AAPA 4FWMA 3TAFA 4JKHA 4C8NA 1M90O 5HLFA 5ELZA 1EETA 2ZGZA 5KQDA 4YOVA 3HPGA 3NVMA 5AZJA 3L8BA 1WSEA 3O3HA 4ZTFA 3SLCA 2OTJN 1BGXT 1NGHA 1YF5L 2WTUA 4CIEA 4FL9A 4FVUA 3DRPA 3MEDA 1RDBA 3ENBA 2KFZA 4A62A 4OJRA 4WQ5C 1BI4B 1TKTA 4E7LA 3KJVA 1DTTA 4DSLA 4EAHD 4KV8A 4DV5K 1F21A 1KVAA 2KLAA 3QBXA 1X9WA 2BUPA 1VQLN 3ZSRA 3B6OA 2IC3A 2NRHA 3OYBA 4R79A 4KKOA 3TAQA 3O5BA 2PFUA 3GDQA 3VOVA 4AHSA 3NF6A 2P9NA 2P9LB 3JAMO 3ULEB 1VSMA 4CZKA 1DTQA 1SL0A 4M3YA 1KXPA 1YAGA 3I55N 4CD1A 3RSEB 2XY7A 4K42A 4GY2B 2I7PA 4CJTA 4FJLA 1T44A 2D0BA 1NMDA 2ZF5O 3P38A 4KB1A 2P9SB 4CGHA 3SMPA 4AF1A 1S1TA 2RF2A 3LP0A 4BR7A 1WBDA 3ASMA 4DR4K 1KAXA 4QOZB 1YVUA 3CETA 3LDOA 1C0FA 1S9EA 4GVEA 2HVIA 1TYQA 4CJWA 3K58A 2O8FA 3VN5A 4Z4FA 2HBMA 2PYLA 2NRXA 1C0GA 3O9TA 4JD2A 1N8RO 3CYMA 1HKGA 2A41A 4WQ4C 4CJLA 4JKEA 1KRPA 1UAXA 2YHXA 3BZKA 3JYTA 3F73A 3SUOA 2CH6A 1HNWK 3DXKB 1IBLK 2W41A 4AHVA 3S3NA 5I42A 3NDKA 4M7XA 4JRPA 2Z1HA 3TTCA 5BR9A 3M8SA 3G10A 5KGXA 3T69A 4FLXA 1S3XA 1CZ9A 3C7NA 1XWLA 2E6LA 2HBKA 1JL2A 2BANA 1ILYA 5C15A 3P4IA 4KTZA 2IVNA 4EHTA 2DFEA 2E6MA 2RKIA 1NNEA 4CEOA 2AA4A 4GKJK 3U4LA 1RTHA 4M45A 4B9TA 1VSLA 2Z1GA 3VQEA 4ILHA 2O4IA 4Q5VA 2V7YA 4BVOA 5IWAK 4CJUA 3C65A 3CFPA 1WAFA 5LMUK 4GVMA 4BR0A 4CZLA 3MMVA 4K0KK 4DKWA 4CHZA 4B9MA 3HO1A 4I6MA 2EX3A 1WBBA 4DSJA 4M42A 4OKKA 5AQYA 4G9ZA 4O8UA 3VEZA 4FLUA 3CI5A 3CC7N 2OPSA 3AVMA 3V4IA 4L3QA 3LP2A 2PYJA 3H3NO 1SKWA 1VQPN 4OLAA 3U6FA 4JKBA 4C8MA 1TUYA 5H1SQ 3CQYA 3NH2A 1YT3A 3THVA 3MX5A 5JLFA 2JGUA 4BRQA 1W0HA 3A5NC 2FBVA 4H4OA 4A57A 3PY8A 5HRNA 3SJHA 2CGJA 1BQNA 4FLVA 1HJRA 2UU9K 1HNZK 2QXLA 1S1XA 5C24A 1OH6A 3FZHA 3PUFA 1HX1A 1IO2A 5C2DA 4DTRA 1DEJA 1XQSC 3M3ZA 3VGLA 4FK0A 1TL1A 3E66A 1WAJA 2XY6A 1X9SA 2GWJA 1KD1O 4WFBL 1XMQK 2NRRA 2HOEA 2FC0A 1T8EA 1L3UA 3S9HA 1FXXA 2GBZA 4BRDA 1EX4A 4E89A 3RSEA 1DT9A 2CGLA 5AQTA 3AAQA 3SBGA 2QKBA 4RW4A 3QMLA 2IS3A 3CMEN 1JCEA 1RNHA 2P9SA 1VSJA 2HHVA 4FJKA 3HVRA 4DLGA 4R5PA 4O4GA 3MN9A 4CHNA 2VQEK 5AQUA 1I94K 3AVJA 3IRXA 4ICLA 1QVGM 1Q7YO 1RTJA 3K2PA 4MLEA 3OHRA 3J7AP 5HOOA 2ZGYA 4PHTX 4DQSA 3ENHA 2KZZA 3AY9A 4JV5K 1XUPO 4BRFA 1RBTA 1J54A 4UY8O 2IGIA 3VERA 1TK5A 2XO7A 4PKGA 2JWLA 1BA1A 4IWVA 3A8YA 3DLKA 5EOYA 3CFOA 4CK2A 4FW1A 3DXKA 3OTOK 3NVKA 3V1RA 3SPYA 3CXCM 2ITMA 1NGBA 4K8XA 1XC3A 3NAEA 4XH4A 4NCBA 1KFSA 3I56N 1LW2A 3FZMA 4CJ7A 4BRPA 1ZXOA 3KIOA 2JLEA 1ZBLA 4DTNA 1VQ7N 4H0YB 2LSNA 1BU6O 2ZWHA 1NGEA 3CJCA 5CHIA 5AQPA 1X9JA 3DWLA 5J2QA 3LPTA 1N36K 4QS7A 1TUUA 3UIQA 2X6SA 3AVKA 3CG7A 3RRGA 2KW4A 3VA0A 3J8AA 3TR8A 4CECA 4CJRA 1NKEA 2QW9A 4DMNA 5M1FA 3LM9A 1DLOA 5CYMA 4BRMA 5ADXH 2EHGA 1NOYA 3N4QA 1QHAA 4J2DA 1QZ6A 1HQUA 3OJSA 3LDSA 3KWGA 4CEFA 2PAVA 5F0XA 3WT0A 4KHNA 5KPRA 4EFHA 4M3TA 3CCJN 2QKKA 4BR5A 4B9NA 2WOMA 2D0PA 1N32K 3THYB 3C95A 2FBXA 2QWQA 3CCEN 3H45C 4RW7A 1I3AA 3C6UA 4FJXA 4LFAK 4CHOA 4QCLA 4BR2A 1NGIA 4CBXA 1J5OA 3B8AX 3SK3A 1Q81O 2OYQA 5I3UA 3PO5A 4CZMA 2B6AA 5FPNA 4FWQA 1QQMA 3BY5A 4BREA 1XI1A 5JVHL 1ZBFA 4JI6K 3AA4A 1JXBA 4V19S 3V81A 1D8YA 3H3OB 3SAHA 3NF7A 4IO9L 1HYZA 2FBTA 1VQMN 3EZ5A 1UA0A 1T3VA 4BRAA 4OPJA 1VQON 2CGKA 4AQYK 1J5EK 3DLEA 4JNEA 3EE9A 2NLXA 3QNOA 3MN6A 2YJEA 3DLBA 4JLHA 3I0SA 4CJ4A 4NCAA 3IKMA 4ZHRA 4BDPA 5JVGL 3ZYYX 3F5TA 3CHWA 2HBJA 5KTQA 4WQ5A 4CK3A 4OO1J 3H46O 1CLQA 3UB5A 3J7ZO 4YHHK 4PQUA 3VGKA 4NYFA 4DQQA 1KAZA 1QSSA 4LF4K 4DU1A 1LAWA 1S1WA 1BISA 2G8IA 4CZJA 4GV9A 1TVRA 1G99A 4YOYA 1KLNA 1NBWA 2KHOA 3S3MA 2NRWA 3CCQN 2YHBA 2DTUA 2IDOA 3NE6A 3O6WA 2GELA 4BRKA 3HOSA 3CM6A 3LWMA 3OS1A 3S3OA 2OTLN 2YX6A 2YHWA 4CGDA 3K5OA 3RMDA 5BRHA 4HTUA 1NGCA 2O4GA 1QS4A 4C8LA 4DV2K 1T7PA 5AR0A 5A2QO 1RBSA 3L0QA 2BGGA 3V1QA 1JLFA 4F3OA 4H4MA 3VESA 3M6GA 5HP1A 1E3MA 1Q9YA 4GMJB 4FWOA 4GKKK 3WXLA 4DTMA 4WE1A 5CE3A 5LJVA 4B1YB 3V9WA 4DFJA 3LZIA 4AHCA 3CCMN 4PKHA 4Z4GA 1RT4A 3HTVA 1VSIA 4KO0A 3KVGA 1EO1A 3BP8A 3TSPA 4IJNA 3V9UA 4JK9A 1O1WA 2YI1A 4E1NA 3KKRA 4DV1K 4F8RA 1WSHA 5AZIB 1RT7A 4CBUA 4DSKA 3NFAA 2ASPA 1HNXK 4DTJA 4ILGB 3VQ8A 4JD2B 4E19A 1OH7A 3ZT0A 4FZZA 3LAKA 2HNYA 5FRNA 1U47A 3DM2A 4B9SA 5AQWA 3L2WA 1R0AA 3V9XA 4N56A 4F3TA 2A1RA 1IKVA 1S6PA 5AQSA 1GOAA 4W5QA 3HM9A 3WXIA 1BIZA 4DQIA 2VWKA 4JKFA 5LL6Z 1NKBA 3HPHA 3SJJA 1WNSA 3R1XA 5AJ3K 3I8BA 4MO4A 3TTFA 3E9LA 3ITHA 4IBNA 1ESVA 4RWTA 3TANA 3C7NB 4HTLA 4FCYA 1HNVA 1UOCA 4BRLA 3FE1A 4DLEA 3THYA 1J9AA 4LF6K 1WSIA 4H0XB 1V4TA 1YITN 3TARA 3LPUA 3PO4A 1KQSM 1LOTB 2XY5A 3WXJA 4FWSA 1V4SA 4IG3A 3HT3A 3AVHA 5GINA 1Z25A 4CEZA 4LFCK 5FROA 3K59A 3R3LA 2GUIA 1JJ2M 3HSTB 1FW6A 4BACA 3MXMA 3K9KA 5BPLA 3O80A 2FSNA 1IJJA 1DKGD 3HYFA 3W0LA 4HVJA 1NJXA 3O3FA 1Z26A 5BN9A 4Z4IA 3NGYA 2R7YA 1TL3A 1IG9A 1VSKA 4LF5K 3TU5A 4BE0A 3F9MA 5AQQA 4AH9A 4F2RA 1NK0A 3C0BA 2ZJQL 3I0RA 4ID5A 3KLGA 1K73O 1JLBA 1GLAG 3QLHA 2HHXA 4IEEA 4B3SK 3OYIA 2I7NA 5KQ8A 2HHQA 5AQLA 3ALYA 2A40A 1B92A 1NU0A 1GLEG 3GOIA 4O5BA 3G25A 3OS0A 3QERA 3VQ6A 3NH1A 5FLXO 4DV3K 2D0CA 1N33K 4GNIA 4H5VA 4CF2A 4KRFA 2OZMA 3DXMA 2RN2A 2FSJA 5FDLA 4DR6K 1RBVA 2YHAA 3AA3A 4DS4A 3CD6N 1Q9XA 1IKXA 4KB0A 2GEMA 5IT9O 4Z4EA 3TTDA 3I33A 3A5MC 4B08A 3RR7A 4FK2A 4BC3A 1HYSA 3QIOA 2OZSA 4KAZA 4YORA 4BC4A 4FJGA 1C6VA 1FKOA 3ZT1A 2WONA 4PL8A 3UKUB 4FWKA 4IFEA 4JEPA 1NMNA 4E7IA 4N41A 2QM1A 4K43A 3RR8A 1Y64A 2QWLA 3AVLA 1EKEA 1JLAA 1EP4A 2VG7A 4CIGA 1HYVA 4U67L 1BCOA 4A5AA 3CJBA 4QS8A 3AO5A 3THXA 4L8RB 3HK2A 1BQMA 5GADP 4C8OA 4OGEA 1IG8A 3PX0A 3PX6A 5AZIA 4CD3A 1BL3A 4CGFA 4CJFA 1IV0A 3BGRA 4CFCA 3MN7A 3SNNA 2E2PA 3KK2A 3RRHA 4Y0WA 3MN5A 2IVOA 1QSYA 2X6NA 1S1VA 3ZSXA 2PZSA 4B9QA 4B1WB 4HCBA 4QAGA 2V51B 4JKAA 1RDDA 1T6DA 3AVBA 2ZJPL 4FSVA 5HRPA 1NGFA 2W42A 1NGGA 3D7EO 4K8ZA 3E01A 4RTFD 1SUQA 4Z0UA 2E2QA 5AQMA 3HI0A 1SL2A 1HKBA 5KPTA 4H0VB 3DRSA 3HVTA 4N5SA 2HF3A 3QIPA 4CHQA 4O8KA 1JCGA 3AO4A 3EZWA 2YNFA 2H3GX 3HP9A 4KH4A 3VETA 3O8MA 1SAZA 1RDCA 1YJNN 3VEWA 1WLJA 4B1XB 3P39A 2NRTA 3IDHA 5AQFA 3DOLA 3VPZA 1NKCA 4JI7K 5C0YA 1ZBHA 2HF4A 4JI8K 3BF3A 4HHTA 5M1KA 1N34K 4FZYA 4CFBA 4EZ6A 2X74A 4FLTA 1ZYQA 3QEXA 5TKWA 3ZLJA 4TSXA 1NG9A 4A61A 3C6TA 4KTQA 2P9PB 4KH5A 4HWIA 4DV6K 3P5JA 4CGGA 4JYAK 4C8KA 1GLDG 4CEEA 1VQ9N 3QEIA 2KZMA 5EU7A 3NGZA 3G4SN 4EZ9A 3R6MA 2ETJA 4FYDA 1J6ZA 3NGIA 2D0OA 4JI1K 4O5FA 3BDPA 3J7YP 2FF3B 3DMJA 4FJIA 3E1YA 4FJJA 2G8HA 1QTMA 4EHUA 3AO1A 1JLEA 4MDBA 3LALA 4FK4A 3ZT4A 4RW9A 3H08A 4AHUA 3SQ2A 1O13A 1QE1A 2ITGA 4CW7B 2HHHK 3DJCA 4H5WA 2WFBA 5M1QA 3CCUN 1VQNN 3OY9A 1C1CA 2KFNA 2UUCK 5BPNA 4JI2K 3CCVN 4OVLA 3UE5A 4DQPA 1W7AA 4BDYA 3QEVA 3VQAA 3O4QA 1CZBA 3VF2A 3M8RA 3EYZA 1TAUA 2IOCA 2Q2RA 1K9MO 1JLCA 1RGIA 3GE1A 2E2NA 1N6QA 4LF8K 3HP6A 1S6QA 5C10A 1SL1A 3PIPL 2UXCK 4EP4A 3AVFA 3CJ9A 3G71N 3D45A 2NRZA 1B9DA 3FFIA 1OVQA 5B8HA 4JS5A 5CY4A 1LCUA 3VENA 1TK8A 4CZHA 3D2FB 3EY1A 1SS6A 3WEEB 5GIOA 3UKUA 2O8CB 3Q7CA 2F7TA 1XHZA 1WUAA 2ASMA 4PWDA 4IEIA 2YNIA 3O1WA 4H03B 4CFDA 3AARA 2WBNA 2A42A 4CZFA 1RTIA 4BVPA 2Q31A 1HJOA 2I5JA 3DLGA 4A2AA 3AVGA 3NHGA 4QS9A 4CESA 1U2VB 2WUSA 3ZSWA 3H1VX 5DMRA 4CZEA 4BDZA 1N5YA 2YJFA 3VEXA 4J2EA 3VF6A 4HUGA 4DFMA 2OANA 1TAQA 4M41A 3L4IA 3OW2M 3SI6A 1VSHA 4JS4A 4B3MK 3AVIA 2UUAK 1CZAN 4CVNE 3OYHA 3A0IX 3MAQA 2D4WA 1WSGA 3L2UA 4CERA 4OPHA 4CEQA 4DTOA 3QO9A 2QWMA 1BOTO 2Z1IA 3LP3A 1VRTA 1KLMA 5CR4A 3PSIA 1S72N 4FLZA 3OYGA 4MDAA 4BC2A 5EX5A 4CHPA 1KCFA 5AQKA 4JI5K 4A2BA 3TSUA 2A1SA 4JHDB 2ZJRL 4BY9C 3AO2A 1DGKN 1BWFO 4AM6A 4LH5A 4F9OA 1GLLO 3DLLL 2Y1IA 3A5LC 2G8WA 3AV9A 2O8DB 4OLBA 1UA1A 3FGUA 1X3NA 3DYAA 4IDKA 4BGBA 4K25A 4OKJA 4FJNA 4JK8A 2QTDA 1T6CA 3M8PA 1YXQA 2DY4A 4GW6A 3QESA 3SV4A 3MCAB 3HZ6A 4JAXA 1C1BA 2ZE2A 3HOTA 4MO5A 4BQLA 1C0MA 2P9PA 4BG9A 1RDUA 2IAJA 3L4QA 4JK7A 1T03A 1L5UA 1XHXA 4EP5A 1NGDA 2GV9A 5E41A 3K5LA 2QA4N 4LF7K 5DM6L 1QZ5A 2F8TA 1MWMA 3VMFB 1YUWA 4ELVA 1S9GA 1YVNA 4Y1DA 2V7ZA 3GG4A 3DOKA 4DF8A 2GUPA 3KK7A 3O4NA 2GWKA 5TKYA 4BWMA 3CJAA 4FW2A 3VEVA 1NLVA 4XH1A 5F2RA 3U9ZA 1RBUA 3ZSQA 2Y1JA 3HJFA 1P90A 4DR2K 3WXKA 3LDNA 5KI6A 2YKNA 4KHPK 2QK9A 3IFRA 4DR5K 1TKDA 3M1FA 2HW3A 4PA1A 1X3MA 4XH5A 2P9KB 3SPZA 4DSFA 3KD1E 2HSTA 1VAZA 4WF9L 4M3WA 3KKSA 1VHXA 4B9VA 4CBWA 1QQCA 5C2FA 3SUNA 2Z1JA 2E88A 2HHWA 4Z94A 4DV0K 2QI2A 4E3SA 1NJWA 4IDHA 1Q82O 3DAWA 3P1GA 4KHUA 3CM5A 3D2FA 3N4PA 3WEEA 4YNQA 4GV3A 5EVZA 3LDPA 3OJUA 2RPIA 1CXUA 2O8CA 3D0PA 5FRMA 4F4KA 3O9SA 2PBDA 5FPEA 1IKYA 1KVCA 3OBYA 3IAYA 1VSEA 4CIFA 4CK1A 2YNGA 3EEQA 3QEPA 1JL1A 3MDQA 3NBPA 3VF4A 2ZM6K 2G8VA 1U2VA 4LSLA 4B9LA 3NCIA 3DXMB 3ZCMA 5DK5A 4X65K 1FK9A 3ENOA 4AILC 1IH7A 3LZJA 4CEBA 2HVHA 2UYTA 1QHTA 3AA5X 2IIRA 2KTQA 4ELTA 3NH0A 4I2QA 1NWKA 3IS9A 3T3FA 2E1ZA 2G8UA 3K57A 1D5AA 4IOCL 3TAMA 1MDUB 3OYCA 4M3RA 4IJAA 2AJQA 4CJ5A 3MX2A 3MEEA 3L2RA 1VRUA 4WQ4A 4H0OA 4JHDA 3THXB 4BROA 2P9IB 3SZ2A 1BDGA 4J2BA 1WOQA 3FFKB 4FJMA 4JKGB 3TSQA 3OYLA 1IKWA 2O8DA 3L2QA 2Q3SA 1K8AO 2XHBA 4CJSA 1MU2A 3OYMA 1SV5A 2ZD1A 2UXBK 1C0UA 2Q97A 2YKMA 4KTWA 4CF8A 2HMPA 3MWPA 3E9OA 2V52B 2ZQBA 2HBLA 2F4VK 3KLHA 1YHQN 2FXUA 4YDUC 4IFVA 3ATUA 4CF0A 5DM7L 3U8XA 1XNQK 4NXMK 3S41A 3ZSVA 5KRTA 3HRGA 2EWSA 4OPAA 3AA2A 1GLJO 3WNEA 3ZSZA 2CH5A 5JS2A 4I9LA 1BO5O 4IOAL 3CJ7A 4UQGA 3ATVA 4H5NA 4ISEA 3QETA 4W5OA 3ZEUB 4O0JA 5CYQA 1VQKN 4BRIA 1YTUA 4NXNK 3J80O 3MCPA 3QNNA 2UXDK 1KVBA 3HBTA 3R9PA 3I8DA 1IBKK 3L6QA 3D2EB 4NO7A 4KFBA 3VA3A 3V1OA 4DR3K 1VQ4N 2B4JA 2RE2A 3CPEA 4H5RA 5MLCQ 1NM1A 4AHTA 4NB4A 3CIPA 5SWMA 5BN8A 2FF6A 3WNGA 3OYNA 1HQEA 4JKCA 1ZC6A 2NZTA 3V9SA 4CI6A 2P9KA 2E5LK 2JWKA 2ASOA 3K5NA 1K6YA 5AQHA 3BF1A 2YNHA 1A5XA 3VQ5A 4DU4A 3EL2A 3NF8A 3JXUA 1XC9A 4KI4A 3L3UA 3O9RA 3CERA 1BA0A 1XNRK 4IG0A 1JLGA 1GLFO 2DPNA 5GAEP 3CPWM 3TAEA 4E7JA 2OPQA 4B1ZA 3FZFA 2BTFA 1XMOK 2Q0UA 3SCXA 3WNFA 4CFAA 4FLWA 2X78A 5FPMA 1M1KO 1HR0K 4M7YA 4W5NA 3SAGA 3WXMB 4BG8A 1JKHA 3MEGA 1RT6A 2RHKA 1Q18A 4FM0A 4IOXA 3LP1A 1RT5A 1H1VA 4CEDA 4FWRA 3ID6A 3TPQA 4I7FA 4DR7K 1D9FA 2P51A 4CJEA 4ID1A 4B9UA 5EXWA 3G0ZA 2GX9A 1D4XA 1VK0A 4PY5A 1HKCA 2VCPA 4BE1A 2G8KA 4JN4A 4ISGA 1I39A 3LDLA 1L3VA 2P5GA 4DSEA 3T1YK 2FLOA 3P31A 1TKZA 2W6KA 3SQ1A 1RILA 2P1JA 3ZT2A 3A5OC 3UKRB 4FJ5A 1RDWX 1KTQA 1W2BM 1S22A 4IFYA 4DUZK 4KI6A 4HUEA 1QSLA 3ZETB 3TI0A 5LJWA 3QDKA 2QWNA 1Q86O 3M5RA 2P9IA 5AFUA 1RDAA 2F9TA 3E9PA 3AVAA 4DTPA 4BRHA 3OVNA 4E1JA 1NK8A 4JKGA 3ZX2A 3JS6A 3DLHA 4E1MA 4GV6A 1SKSA 4KHYA 4B3OA 1YI2N 3T19A 3O08A 3CCRN 3VQDA 3C6AA 4XIUA 3O3GA 3U3YA 4OKEA 3CC4N 3WNHA 5C12A 4K41A 5JMVA 3OYDA 3GL1A 1A5WA 3HPOA 4AM7A 1W97L 1LWCA 1ASWA 2HNZA 4WFAL 2E2OA 1A5VA 4RW6A 4E0DA 2BE2A 3CFRA 4CE9A 3ZEUA 4C1NK 3KD5E 2QXFA 4H0PA 1WSJA 2A3ZA 2W6LA 4DF4A 3DI6A 2HHTA 2VWBA 1D9DA 3ZSYA 3D2EA 3P83D 1GLCG 1WSFA 1RCHA 1HNIA 4BR4A 2HHSA 3AVNA 3V9ZA 1JLQA 2QWOA 2XRIA 4WCEL 1L3SA 4MFBA 2OPRA 4YY3K 3V6DA 1TK0A 2FBYA 3QEWA 1W9HA 4O0IA 1BG3A 4RG8A 3OYAA 3OYEA 1B9FA 3ISNC 4CF9A 3AGKA 4CJVA 5KPZA 4LF9K 3LANA 1S1UA 2DFHA 3EE8A 1ATSA 4B8CA 1ZBSA 1LW0A 1SQKA 3M8QA 1VQ8N 3VTHA 5J2MA 2QEXN 1ATRA 1NK5A 2A5XA 4FPBA 4RCHA 4DFKA 2VG5A 4C23A 3TAGA 4JI0K 5J2NA 2E4LA 4IXCA 3C6HA 3EO3A 1LAVA 5HRRA 2DFFA 4CGJA 5AQRA 4X62K 3FR0A 5AQZA 3U3GA 4F2SA 2Q1NA 5BREA 4LFBK 1GOBA 5K14A 3MXIA 3H6EA 3VQBA 5BPMA 1MA9B 2YV0X 3EKUA 3FZKA 1NGAA 3PV8A 3K5MA 1X1PA 3IMXA 5D3GA 1TV6A 5KGWA 3LDQA 4NYNA 3QBWA 3OYJA 3T7ZA 1YTAA 4WFNL 4YOUA 2FSKA 1BCMA 2GTDA 3C94A 3FLCO 4LC9B 4HUFA 4KHQA 1BI4A 4H8KA 3ZX0A 4CHYA 4FXDA 4OX9K 1NJYA 3K9JA 3RWUA 4PUOA 3CC2N 3BUZB
chains in the Genus database with same CATH topology
3SYZA 1JXEA 3DRRA 1S1TA 4FVMA 1BIZA 4LH4A 2RF2A 2YKNA 3LP0A 5KI6A 1LV5A 4DQIA 2QK9A 2VWKA 1NKBA 1TKDA 2HHUA 3HPHA 3SJJA 1WNSA 3ASMA 2PY5A 2HW3A 1U04A 4PA1A 1YVUA 4QOZB 3SPZA 1S9EA 4DSFA 4N47A 2HVIA 3KD1E 4CJWA 3K58A 2ATQA 3ITHA 4IBNA 4DS5A 3VN5A 4Z4FA 3TANA 2PYLA 4FCYA 3VQ9A 1HNVA 1UOCA 4M3WA 4DLEA 3KKSA 4OPKA 4B9VA 1J9AA 4LD0A 1WSIA 3CYMA 4DWIA 4CJLA 1KRPA 1QQCA 1UAXA 3TWHA 3SUNA 2Z1JA 3TARA 2HHWA 3JYTA 3LPUA 3F73A 3SUOA 3PO4A 4E3SA 1NJWA 4DTSA 1ZBIA 2F8SA 2BDPA 2XY5A 3P1GA 4KHUA 3CM5A 4KPYA 3VQPA 4IG3A 4ELUA 3HT3A 4AHVA 3AVHA 3S3NA 1Z25A 4CEZA 4YNQA 5I42A 1S5JA 3NDKA 3OJUA 2RPIA 1CXUA 5FROA 3K59A 3D0PA 5FRMA 4F4KA 2GUIA 3HSTB 4JRPA 2Z1HA 1IKYA 4BACA 3MXMA 1T05A 1KVCA 3M8SA 3IAYA 1VSEA 3G10A 5KGXA 3HYFA 4AHRA 4MQ3A 4CIFA 4HVJA 4FLXA 1CZ9A 1NJXA 4CK1A 1XWLA 2YNGA 2E6LA 3O3FA 1JL2A 1VSFA 1Z26A 2BANA 1ASVA 3QEPA 1JL1A 4Z4IA 1C1AA 3NBPA 2G8VA 3NGYA 4KTZA 4Z4HA 3DLRA 5JS1A 2R7YA 1TL3A 4I9QA 4FM2A 1VSKA 1IG9A 4LSLA 4HCCA 2DFEA 2E6MA 2RKIA 4OGCA 3NCIA 4BE0A 1U49A 4B9LA 4AH9A 4F2RA 1NK0A 3ZCMA 4CEOA 5DK5A 3OS2A 1RT1A 3I0RA 4ID5A 3KLGA 1FK9A 1JLBA 1RTHA 4NCGA 4M45A 4AILC 1RTDA 1G15A 3QLHA 2HHXA 4B9TA 1IH7A 1VSLA 2Z1GA 3VQEA 4CEBA 3LZJA 1NK9A 2HVHA 3OYIA 2O4IA 1QHTA 4Q5VA 3AA5X 4CCHA 2HHQA 2KTQA 3CFPA 4CJUA 1WAFA 3ALYA 2OA8A 3NH0A 4ELTA 4GVMA 1B92A 4I2QA 3IS9A 3SQ4A 3AVCA 4O5BA 4CHZA 5C42A 4B9MA 1NOZA 3HO1A 2D0AA 3PX4A 4KHWA 1RT2A 2EX3A 3OS0A 3T3FA 3QERA 3K57A 1D5AA 2G8UA 3VQ6A 4DSJA 3NH1A 4J2AA 4M42A 4OKKA 3TAMA 3AO3A 2D0CA 3ZSOA 3OYCA 4M3RA 4FLUA 4CF2A 2AJQA 4KRFA 4M3UA 4CJ5A 2OZMA 1NK4A 2OPSA 3MEEA 3ZT3A 3KLFA 1VRUA 3AVMA 3L2RA 3V4IA 1U4BA 2RN2A 1CXQA 3RTVA 5FDLA 3LP2A 1RBVA 1D9FA 2PYJA 2YHAA 3AA3A 1SKWA 3SZ2A 4G1QA 4DS4A 4LY7A 4OLAA 1Q9XA 1IKXA 4KB0A 4J2BA 3U6FA 4FJMA 4C8MA 4Z4EA 3OYLA 1IKWA 3L3VA 4B08A 3RMAA 3RR7A 4FK2A 3NH2A 3L2QA 1BHLA 1HYSA 1YT3A 3QIOA 2Q3SA 3ULDA 3VQ7A 3THVA 2OZSA 4KAZA 2JGUA 1HPZA 2XHBA 4CJSA 4FJGA 1C6VA 1FKOA 1MU2A 1W0HA 1SV5A 2WONA 2ZD1A 3ZT1A 2FBVA 3OYMA 4H4OA 1C0UA 3PY8A 5HRNA 5T7BA 2YKMA 4KTWA 4CF8A 4E7IA 4N41A 3VQCA 1BQNA 2ZQBA 3KLHA 3RR8A 4DFPA 4FLVA 5HROA 1HJRA 4IFVA 3AVLA 1EKEA 4CF0A 1JLAA 1EP4A 2VG7A 1S1XA 5C24A 4CIGA 3PUFA 4M3XA 1HYVA 1BCOA 3ZSVA 1ASUA 5KRTA 3AO5A 4CJKA 4L8RB 1IO2A 1BQMA 3AA2A 3WNEA 3ZSZA 3HK2A 4C8OA 4DTRA 2G8FA 1UWBA 3F9KA 4OGEA 4CEAA 3PX0A 1TL1A 4B8AB 3OYFA 5JS2A 4I9LA 4DU3A 3PX6A 4FK0A 1RT3A 3QINA 1BL3A 1WN7A 4CGFA 1WAJA 4CJFA 2XY6A 4Q0BA 4UQGA 4LSNA 1NJZA 1X9SA 3QETA 3BGRA 4CFCA 4W5OA 3SNNA 4O0JA 5CYQA 2FC0A 1U48A 1T8EA 1L3UA 3KK2A 3RRHA 3S9HA 1YTUA 1FXXA 3QNNA 3T1AA 2GBZA 1KVBA 2X6NA 1EX4A 4E89A 3I8DA 1S1VA 3ZSXA 1QSYA 2PZSA 4KFBA 4KHSA 3VA3A 3KK3A 3JSMA 3V1OA 4HCBA 3SUPA 5HRSA 2QKBA 4RW4A 4QAGA 2IS3A 1RNHA 1RDDA 1Y97A 2B4JA 1VSJA 3AVBA 5HRPA 2HHVA 1X9MA 4FJKA 4AHTA 3HVRA 5KRSA 4R5PA 2W42A 5SWMA 4DLGA 4FJ8A 4O4GA 4K8ZA 3E01A 3WNGA 4CHNA 1SUQA 4Z0UA 3OYNA 1HQEA 4O55A 3V9SA 1SL2A 3AVJA 3IRXA 4ICLA 1KSPA 3K5NA 3TAPA 3HXMA 1K6YA 4W5QA 1RTJA 3K2PA 2YNHA 4W5TA 1A5XA 3VQ5A 1NK6A 3DRSA 3HVTA 4N5SA 4DU4A 4DQSA 1VSDA 3NF8A 1XC9A 3QIPA 4BE2A 3L3UA 4KI4A 4CHQA 2KZZA 3AO4A 2VWJA 2B5JA 2YNFA 3HP9A 1J53A 1RBTA 1J54A 1KFDA 4IG0A 5HBMA 1JLGA 3RMBA 2P5OA 1RDCA 2IGIA 1TK5A 3A2FA 2XO7A 3LAMA 1WLJA 3TAEA 4E7JA 2OPQA 3DOLA 3OYKA 3DLKA 4CK2A 3CFOA 1NKCA 4FW1A 1ZBHA 4CF1A 1RBRA 4HHTA 3V1RA 3SCXA 3WNFA 3SPYA 1NK7A 4FZYA 4FJ7A 4CFBA 4FJ9A 4EZ6A 2X74A 4FLTA 4CFAA 1ZYQA 1EXQA 4N76A 3QEXA 2D5RA 4K8XA 4TSXA 4FLWA 2X78A 3NAEA 4NCBA 1KFSA 3C6TA 1LW2A 4W5NA 5J1EA 4KTQA 4O44A 3KLIA 4DSIA 3KIOA 3P5JA 2HB5A 2JLEA 4CGGA 3VQQA 4DTNA 1ZBLA 4C8KA 4FZXC 1JKHA 2LSNA 1RT6A 3MEGA 4CEEA 4FJHA 3QEIA 2KZMA 5EU7A 3NGZA 4FM0A 2OPPA 4EZ9A 3SQ0A 2F96A 1HRHA 2ETJA 4FYDA 5J2QA 3LP1A 4CJPA 3LPTA 1RT5A 3NGIA 3BDPA 4CEDA 4JRQA 3CQ8A 3DMJA 3MECA 4FJIA 3UIQA 2X6SA 3AVKA 3CG7A 4FJJA 3RRGA 4CGIA 2KW4A 2G8HA 1QTMA 4I7FA 4Z4CA 5SZTA 4YFUA 3VA0A 3AO1A 3TR8A 1C0TA 2P51A 4CECA 1JLEA 4CJRA 4E7HA 3LALA 3ZSQA 4ID1A 4CJEA 4DTUA 4DMNA 4B9UA 4FLYA 3KLEA 4FK4A 3ZT4A 3G0ZA 3IG1A 3KTQA 1DLOA 1VK0A 3H08A 4RW9A 4AHUA 5CYMA 3SQ2A 2EHGA 4PY5A 1NOYA 1QE1A 1HMVA 4BE1A 2ITGA 2G8KA 4J2DA 1I39A 1L3VA 2P5GA 1HQUA 3OJSA 4DSEA 3LDSA 1BIUA 4CEFA 1LWFA 1TKZA 4BWJA 3OY9A 3SQ1A 1C1CA 1RILA 1ZBUA 2P1JA 3ZT2A 4IKFA 4KHNA 2KFNA 4M3TA 4OVLA 4M3ZA 4DQPA 2HNDA 1LWEA 2QKKA 4BDYA 1GOCA 4B9NA 4FJ5A 1KTQA 3QEVA 4IFYA 4KI6A 3VQAA 1TGOA 4HUEA 1QSLA 3O4QA 1CZBA 3M8RA 3EYZA 3TI0A 2WOMA 1TAUA 2IOCA 4CJ3A 1JLCA 3C95A 2FBXA 1ITGA 2XY8A 1N6QA 4W5RA 3HP6A 1RDAA 1S6QA 4E7KA 1SL1A 3SUQA 3VQ4A 4RW7A 3AVAA 1I3AA 3C6UA 3AVFA 4EP4A 4DTPA 4FJXA 3D45A 3FFIA 1B9DA 3HL8A 1IKVA 3OVNA 1NK8A 4CHOA 3DLHA 4E1MA 4JS5A 1SKRA 4QCLA 5CY4A 4Y1CA 1J5OA 1TK8A 1SKSA 4KHYA 2OYQA 5I3UA 3EY1A 3PO5A 4B3OA 2B6AA 1NKEA 3TABA 3T19A 1XHZA 1L3TA 1XI1A 3VQDA 4PWDA 1ZBFA 4XIUA 2YNIA 3AA4A 1JXBA 3O3GA 3U3YA 3V81A 1U45A 1D8YA 3KK1A 3NF7A 1TKXA 1HYZA 2FBTA 4OKEA 4CFDA 2Y1JA 2HMIA 3EZ5A 1UA0A 4I2PA 3NF9A 4OPJA 4DG1A 3DLEA 3WNHA 1RTIA 3OYDA 3QNOA 1REVA 3DLBA 2I5JA 3I0SA 4JLHA 3DLGA 5C25A 4CJ4A 1A5WA 3HPOA 3AVGA 4NCAA 3NHGA 4CESA 4ZHRA 4BDPA 1LWCA 3ZSWA 5DMRA 1FKPA 1ASWA 2HNZA 4BDZA 1N5YA 4J2EA 1A5VA 2VG6A 4CK3A 5KTQA 4HUGA 4DFMA 4KREA 4RW6A 4E0DA 1CLQA 2BE2A 3CFRA 4CE9A 2NUBA 1TAQA 4M41A 3LWLA 3SI6A 4PQUA 1VSHA 4NYFA 5CZ1A 4DQQA 4ZTJA 2QXFA 3KD5E 4JS4A 1WSJA 3AVIA 1QSSA 4DF4A 4DU1A 1LAWA 1S1WA 1BISA 3OYHA 3B6PA 4FM1A 3DI6A 3RMCA 2G8IA 1D9DA 2HHTA 4CJQA 1TVRA 3ZSYA 3P83D 4DTXA 3MAQA 1WSFA 1RCHA 1HNIA 1WSGA 3L2UA 2HHSA 3AVNA 4CERA 4CEQA 4DTOA 1KLNA 3QO9A 3V9ZA 1JLQA 3S3MA 2XRIA 2Z1IA 2DTUA 2YHBA 1L3SA 2IDOA 3LP3A 4RW8A 3NE6A 1VRTA 4MFBA 5CZ2A 3SV3A 2KQ2A 2OPRA 5J2PA 1KLMA 3LWMA 3CM6A 3V6DA 1TK0A 2FBYA 4FLZA 3QEWA 1Q8IA 1W9HA 3OS1A 3OYGA 4DQRA 4O0IA 4CHPA 1KCFA 3S3OA 3MXJA 4CGDA 4RG8A 3K5OA 3OYAA 3RMDA 3L2VA 3TAFA 4HTUA 3OYEA 2A1SA 2O4GA 4C8NA 5HLFA 3AO2A 1B9FA 3ISNC 1QS4A 4C8LA 4CF9A 1EETA 1T7PA 4CJVA 3HPGA 4LH5A 2Y1IA 1RBSA 3LANA 1S1UA 2DFHA 2G8WA 3L8BA 1WSEA 3O3HA 2BGGA 4ZTFA 4B8CA 3AV9A 1LW0A 1BGXT 1JLFA 3V1QA 4F3OA 3M8QA 4OLBA 5J2MA 1NK5A 4H4MA 4CIEA 1UA1A 4DFKA 2VG5A 3DRPA 3DYAA 3MEDA 4IDKA 4OKJA 1RDBA 2KFZA 3TAGA 4FJNA 5HP1A 1Q9YA 4OJRA 4GMJB 5J2NA 2E4LA 1LAVA 1BI4B 2DFFA 1TKTA 3M8PA 4GW6A 5HRRA 4CGJA 4DTMA 4WE1A 2DY4A 3QESA 3V9WA 3SV4A 4E7LA 4DFJA 3KJVA 3LZIA 1DTTA 4DSLA 4AHCA 4KV8A 1C1BA 2ZE2A 3U3GA 4Z4GA 1F21A 1KVAA 1C0MA 1RT4A 1X9WA 3ZSRA 3B6OA 1VSIA 2IC3A 4KO0A 4F2SA 2IAJA 3OYBA 1T03A 3V9UA 1L5UA 1GOBA 1XHXA 1O1WA 4EP5A 5K14A 4KKOA 3KKRA 4E1NA 3VQBA 1WSHA 2GV9A 5E41A 3K5LA 3TAQA 3MXIA 4F8RA 2YV0X 2F8TA 1RT7A 4AHSA 3K5MA 1X1PA 3NF6A 3PV8A 4DSKA 3NFAA 4ELVA 1S9GA 1TV6A 5D3GA 5KGWA 3HJFA 4Y1DA 4DTJA 4NYNA 1VSMA 1DTQA 1SL0A 3VQ8A 4M3YA 4E19A 3OYJA 3DOKA 3ZT0A 4DF8A 1YTAA 3O4NA 4FZZA 3LAKA 4BWMA 1BCMA 2HNYA 3C94A 4KHQA 4HUFA 5FRNA 4FW2A 1BI4A 4H8KA 2XY7A 1U47A 3DM2A 4CJTA 4B9SA 4FJLA 4CHYA 4FXDA 3L2WA 2D0BA 1NJYA 1R0AA 3V9XA 3RWUA 4N56A 4F3TA 2A1RA 4PUOA 1S6PA 4KB1A 1RBUA 1GOAA 4CGHA 3HM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYZ A;  1JXE A;  3DRR A;  1S1T A;  4FVM A;  1BIZ A;  4LH4 A;  2RF2 A;  2YKN A;  3LP0 A;  5KI6 A;  1LV5 A;  4DQI A;  2QK9 A;  2VWK A;  1NKB A;  1TKD A;  2HHU A;  3HPH A;  3SJJ A;  1WNS A;  3ASM A;  2PY5 A;  2HW3 A;  1U04 A;  4PA1 A;  1YVU A;  4QOZ B;  3SPZ A;  1S9E A;  4DSF A;  4N47 A;  2HVI A;  3KD1 E;  4CJW A;  3K58 A;  2ATQ A;  3ITH A;  4IBN A;  4DS5 A;  3VN5 A;  4Z4F A;  3TAN A;  2PYL A;  4FCY A;  3VQ9 A;  1HNV A;  1UOC A;  4M3W A;  4DLE A;  3KKS A;  4OPK A;  4B9V A;  1J9A A;  4LD0 A;  1WSI A;  3CYM A;  4DWI A;  4CJL A;  1KRP A;  1QQC A;  1UAX A;  3TWH A;  3SUN A;  2Z1J A;  3TAR A;  2HHW A;  3JYT A;  3LPU A;  3F73 A;  3SUO A;  3PO4 A;  4E3S A;  1NJW A;  4DTS A;  1ZBI A;  2F8S A;  2BDP A;  2XY5 A;  3P1G A;  4KHU A;  3CM5 A;  4KPY A;  3VQP A;  4IG3 A;  4ELU A;  3HT3 A;  4AHV A;  3AVH A;  3S3N A;  1Z25 A;  4CEZ A;  4YNQ A;  5I42 A;  1S5J A;  3NDK A;  3OJU A;  2RPI A;  1CXU A;  5FRO A;  3K59 A;  3D0P A;  5FRM A;  4F4K A;  2GUI A;  3HST B;  4JRP A;  2Z1H A;  1IKY A;  4BAC A;  3MXM A;  1T05 A;  1KVC A;  3M8S A;  3IAY A;  1VSE A;  3G10 A;  5KGX A;  3HYF A;  4AHR A;  4MQ3 A;  4CIF A;  4HVJ A;  4FLX A;  1CZ9 A;  1NJX A;  4CK1 A;  1XWL A;  2YNG A;  2E6L A;  3O3F A;  1JL2 A;  1VSF A;  1Z26 A;  2BAN A;  1ASV A;  3QEP A;  1JL1 A;  4Z4I A;  1C1A A;  3NBP A;  2G8V A;  3NGY A;  4KTZ A;  4Z4H A;  3DLR A;  5JS1 A;  2R7Y A;  1TL3 A;  4I9Q A;  4FM2 A;  1VSK A;  1IG9 A;  4LSL A;  4HCC A;  2DFE A;  2E6M A;  2RKI A;  4OGC A;  3NCI A;  4BE0 A;  1U49 A;  4B9L A;  4AH9 A;  4F2R A;  1NK0 A;  3ZCM A;  4CEO A;  5DK5 A;  3OS2 A;  1RT1 A;  3I0R A;  4ID5 A;  3KLG A;  1FK9 A;  1JLB A;  1RTH A;  4NCG A;  4M45 A;  4AIL C;  1RTD A;  1G15 A;  3QLH A;  2HHX A;  4B9T A;  1IH7 A;  1VSL A;  2Z1G A;  3VQE A;  4CEB A;  3LZJ A;  1NK9 A;  2HVH A;  3OYI A;  2O4I A;  1QHT A;  4Q5V A;  3AA5 X;  4CCH A;  2HHQ A;  2KTQ A;  3CFP A;  4CJU A;  1WAF A;  3ALY A;  2OA8 A;  3NH0 A;  4ELT A;  4GVM A;  1B92 A;  4I2Q A;  3IS9 A;  3SQ4 A;  3AVC A;  4O5B A;  4CHZ A;  5C42 A;  4B9M A;  1NOZ A;  3HO1 A;  2D0A A;  3PX4 A;  4KHW A;  1RT2 A;  2EX3 A;  3OS0 A;  3T3F A;  3QER A;  3K57 A;  1D5A A;  2G8U A;  3VQ6 A;  4DSJ A;  3NH1 A;  4J2A A;  4M42 A;  4OKK A;  3TAM A;  3AO3 A;  2D0C A;  3ZSO A;  3OYC A;  4M3R A;  4FLU A;  4CF2 A;  2AJQ A;  4KRF A;  4M3U A;  4CJ5 A;  2OZM A;  1NK4 A;  2OPS A;  3MEE A;  3ZT3 A;  3KLF A;  1VRU A;  3AVM A;  3L2R A;  3V4I A;  1U4B A;  2RN2 A;  1CXQ A;  3RTV A;  5FDL A;  3LP2 A;  1RBV A;  1D9F A;  2PYJ A;  2YHA A;  3AA3 A;  1SKW A;  3SZ2 A;  4G1Q A;  4DS4 A;  4LY7 A;  4OLA A;  1Q9X A;  1IKX A;  4KB0 A;  4J2B A;  3U6F A;  4FJM A;  4C8M A;  4Z4E A;  3OYL A;  1IKW A;  3L3V A;  4B08 A;  3RMA A;  3RR7 A;  4FK2 A;  3NH2 A;  3L2Q A;  1BHL A;  1HYS A;  1YT3 A;  3QIO A;  2Q3S A;  3ULD A;  3VQ7 A;  3THV A;  2OZS A;  4KAZ A;  2JGU A;  1HPZ A;  2XHB A;  4CJS A;  4FJG A;  1C6V A;  1FKO A;  1MU2 A;  1W0H A;  1SV5 A;  2WON A;  2ZD1 A;  3ZT1 A;  2FBV A;  3OYM A;  4H4O A;  1C0U A;  3PY8 A;  5HRN A;  5T7B A;  2YKM A;  4KTW A;  4CF8 A;  4E7I A;  4N41 A;  3VQC A;  1BQN A;  2ZQB A;  3KLH A;  3RR8 A;  4DFP A;  4FLV A;  5HRO A;  1HJR A;  4IFV A;  3AVL A;  1EKE A;  4CF0 A;  1JLA A;  1EP4 A;  2VG7 A;  1S1X A;  5C24 A;  4CIG A;  3PUF A;  4M3X A;  1HYV A;  1BCO A;  3ZSV A;  1ASU A;  5KRT A;  3AO5 A;  4CJK A;  4L8R B;  1IO2 A;  1BQM A;  3AA2 A;  3WNE A;  3ZSZ A;  3HK2 A;  4C8O A;  4DTR A;  2G8F A;  1UWB A;  3F9K A;  4OGE A;  4CEA A;  3PX0 A;  1TL1 A;  4B8A B;  3OYF A;  5JS2 A;  4I9L A;  4DU3 A;  3PX6 A;  4FK0 A;  1RT3 A;  3QIN A;  1BL3 A;  1WN7 A;  4CGF A;  1WAJ A;  4CJF A;  2XY6 A;  4Q0B A;  4UQG A;  4LSN A;  1NJZ A;  1X9S A;  3QET A;  3BGR A;  4CFC A;  4W5O A;  3SNN A;  4O0J A;  5CYQ A;  2FC0 A;  1U48 A;  1T8E A;  1L3U A;  3KK2 A;  3RRH A;  3S9H A;  1YTU A;  1FXX A;  3QNN A;  3T1A A;  2GBZ A;  1KVB A;  2X6N A;  1EX4 A;  4E89 A;  3I8D A;  1S1V A;  3ZSX A;  1QSY A;  2PZS A;  4KFB A;  4KHS A;  3VA3 A;  3KK3 A;  3JSM A;  3V1O A;  4HCB A;  3SUP A;  5HRS A;  2QKB A;  4RW4 A;  4QAG A;  2IS3 A;  1RNH A;  1RDD A;  1Y97 A;  2B4J A;  1VSJ A;  3AVB A;  5HRP A;  2HHV A;  1X9M A;  4FJK A;  4AHT A;  3HVR A;  5KRS A;  4R5P A;  2W42 A;  5SWM A;  4DLG A;  4FJ8 A;  4O4G A;  4K8Z A;  3E01 A;  3WNG A;  4CHN A;  1SUQ A;  4Z0U A;  3OYN A;  1HQE A;  4O55 A;  3V9S A;  1SL2 A;  3AVJ A;  3IRX A;  4ICL A;  1KSP A;  3K5N A;  3TAP A;  3HXM A;  1K6Y A;  4W5Q A;  1RTJ A;  3K2P A;  2YNH A;  4W5T A;  1A5X A;  3VQ5 A;  1NK6 A;  3DRS A;  3HVT A;  4N5S A;  4DU4 A;  4DQS A;  1VSD A;  3NF8 A;  1XC9 A;  3QIP A;  4BE2 A;  3L3U A;  4KI4 A;  4CHQ A;  2KZZ A;  3AO4 A;  2VWJ A;  2B5J A;  2YNF A;  3HP9 A;  1J53 A;  1RBT A;  1J54 A;  1KFD A;  4IG0 A;  5HBM A;  1JLG A;  3RMB A;  2P5O A;  1RDC A;  2IGI A;  1TK5 A;  3A2F A;  2XO7 A;  3LAM A;  1WLJ A;  3TAE A;  4E7J A;  2OPQ A;  3DOL A;  3OYK A;  3DLK A;  4CK2 A;  3CFO A;  1NKC A;  4FW1 A;  1ZBH A;  4CF1 A;  1RBR A;  4HHT A;  3V1R A;  3SCX A;  3WNF A;  3SPY A;  1NK7 A;  4FZY A;  4FJ7 A;  4CFB A;  4FJ9 A;  4EZ6 A;  2X74 A;  4FLT A;  4CFA A;  1ZYQ A;  1EXQ A;  4N76 A;  3QEX A;  2D5R A;  4K8X A;  4TSX A;  4FLW A;  2X78 A;  3NAE A;  4NCB A;  1KFS A;  3C6T A;  1LW2 A;  4W5N A;  5J1E A;  4KTQ A;  4O44 A;  3KLI A;  4DSI A;  3KIO A;  3P5J A;  2HB5 A;  2JLE A;  4CGG A;  3VQQ A;  4DTN A;  1ZBL A;  4C8K A;  4FZX C;  1JKH A;  2LSN A;  1RT6 A;  3MEG A;  4CEE A;  4FJH A;  3QEI A;  2KZM A;  5EU7 A;  3NGZ A;  4FM0 A;  2OPP A;  4EZ9 A;  3SQ0 A;  2F96 A;  1HRH A;  2ETJ A;  4FYD A;  5J2Q A;  3LP1 A;  4CJP A;  3LPT A;  1RT5 A;  3NGI A;  3BDP A;  4CED A;  4JRQ A;  3CQ8 A;  3DMJ A;  3MEC A;  4FJI A;  3UIQ A;  2X6S A;  3AVK A;  3CG7 A;  4FJJ A;  3RRG A;  4CGI A;  2KW4 A;  2G8H A;  1QTM A;  4I7F A;  4Z4C A;  5SZT A;  4YFU A;  3VA0 A;  3AO1 A;  3TR8 A;  1C0T A;  2P51 A;  4CEC A;  1JLE A;  4CJR A;  4E7H A;  3LAL A;  3ZSQ A;  4ID1 A;  4CJE A;  4DTU A;  4DMN A;  4B9U A;  4FLY A;  3KLE A;  4FK4 A;  3ZT4 A;  3G0Z A;  3IG1 A;  3KTQ A;  1DLO A;  1VK0 A;  3H08 A;  4RW9 A;  4AHU A;  5CYM A;  3SQ2 A;  2EHG A;  4PY5 A;  1NOY A;  1QE1 A;  1HMV A;  4BE1 A;  2ITG A;  2G8K A;  4J2D A;  1I39 A;  1L3V A;  2P5G A;  1HQU A;  3OJS A;  4DSE A;  3LDS A;  1BIU A;  4CEF A;  1LWF A;  1TKZ A;  4BWJ A;  3OY9 A;  3SQ1 A;  1C1C A;  1RIL A;  1ZBU A;  2P1J A;  3ZT2 A;  4IKF A;  4KHN A;  2KFN A;  4M3T A;  4OVL A;  4M3Z A;  4DQP A;  2HND A;  1LWE A;  2QKK A;  4BDY A;  1GOC A;  4B9N A;  4FJ5 A;  1KTQ A;  3QEV A;  4IFY A;  4KI6 A;  3VQA A;  1TGO A;  4HUE A;  1QSL A;  3O4Q A;  1CZB A;  3M8R A;  3EYZ A;  3TI0 A;  2WOM A;  1TAU A;  2IOC A;  4CJ3 A;  1JLC A;  3C95 A;  2FBX A;  1ITG A;  2XY8 A;  1N6Q A;  4W5R A;  3HP6 A;  1RDA A;  1S6Q A;  4E7K A;  1SL1 A;  3SUQ A;  3VQ4 A;  4RW7 A;  3AVA A;  1I3A A;  3C6U A;  3AVF A;  4EP4 A;  4DTP A;  4FJX A;  3D45 A;  3FFI A;  1B9D A;  3HL8 A;  1IKV A;  3OVN A;  1NK8 A;  4CHO A;  3DLH A;  4E1M A;  4JS5 A;  1SKR A;  4QCL A;  5CY4 A;  4Y1C A;  1J5O A;  1TK8 A;  1SKS A;  4KHY A;  2OYQ A;  5I3U A;  3EY1 A;  3PO5 A;  4B3O A;  2B6A A;  1NKE A;  3TAB A;  3T19 A;  1XHZ A;  1L3T A;  1XI1 A;  3VQD A;  4PWD A;  1ZBF A;  4XIU A;  2YNI A;  3AA4 A;  1JXB A;  3O3G A;  3U3Y A;  3V81 A;  1U45 A;  1D8Y A;  3KK1 A;  3NF7 A;  1TKX A;  1HYZ A;  2FBT A;  4OKE A;  4CFD A;  2Y1J A;  2HMI A;  3EZ5 A;  1UA0 A;  4I2P A;  3NF9 A;  4OPJ A;  4DG1 A;  3DLE A;  3WNH A;  1RTI A;  3OYD A;  3QNO A;  1REV A;  3DLB A;  2I5J A;  3I0S A;  4JLH A;  3DLG A;  5C25 A;  4CJ4 A;  1A5W A;  3HPO A;  3AVG A;  4NCA A;  3NHG A;  4CES A;  4ZHR A;  4BDP A;  1LWC A;  3ZSW A;  5DMR A;  1FKP A;  1ASW A;  2HNZ A;  4BDZ A;  1N5Y A;  4J2E A;  1A5V A;  2VG6 A;  4CK3 A;  5KTQ A;  4HUG A;  4DFM A;  4KRE A;  4RW6 A;  4E0D A;  1CLQ A;  2BE2 A;  3CFR A;  4CE9 A;  2NUB A;  1TAQ A;  4M41 A;  3LWL A;  3SI6 A;  4PQU A;  1VSH A;  4NYF A;  5CZ1 A;  4DQQ A;  4ZTJ A;  2QXF A;  3KD5 E;  4JS4 A;  1WSJ A;  3AVI A;  1QSS A;  4DF4 A;  4DU1 A;  1LAW A;  1S1W A;  1BIS A;  3OYH A;  3B6P A;  4FM1 A;  3DI6 A;  3RMC A;  2G8I A;  1D9D A;  2HHT A;  4CJQ A;  1TVR A;  3ZSY A;  3P83 D;  4DTX A;  3MAQ A;  1WSF A;  1RCH A;  1HNI A;  1WSG A;  3L2U A;  2HHS A;  3AVN A;  4CER A;  4CEQ A;  4DTO A;  1KLN A;  3QO9 A;  3V9Z A;  1JLQ A;  3S3M A;  2XRI A;  2Z1I A;  2DTU A;  2YHB A;  1L3S A;  2IDO A;  3LP3 A;  4RW8 A;  3NE6 A;  1VRT A;  4MFB A;  5CZ2 A;  3SV3 A;  2KQ2 A;  2OPR A;  5J2P A;  1KLM A;  3LWM A;  3CM6 A;  3V6D A;  1TK0 A;  2FBY A;  4FLZ A;  3QEW A;  1Q8I A;  1W9H A;  3OS1 A;  3OYG A;  4DQR A;  4O0I A;  4CHP A;  1KCF A;  3S3O A;  3MXJ A;  4CGD A;  4RG8 A;  3K5O A;  3OYA A;  3RMD A;  3L2V A;  3TAF A;  4HTU A;  3OYE A;  2A1S A;  2O4G A;  4C8N A;  5HLF A;  3AO2 A;  1B9F A;  3ISN C;  1QS4 A;  4C8L A;  4CF9 A;  1EET A;  1T7P A;  4CJV A;  3HPG A;  4LH5 A;  2Y1I A;  1RBS A;  3LAN A;  1S1U A;  2DFH A;  2G8W A;  3L8B A;  1WSE A;  3O3H A;  2BGG A;  4ZTF A;  4B8C A;  3AV9 A;  1LW0 A;  1BGX T;  1JLF A;  3V1Q A;  4F3O A;  3M8Q A;  4OLB A;  5J2M A;  1NK5 A;  4H4M A;  4CIE A;  1UA1 A;  4DFK A;  2VG5 A;  3DRP A;  3DYA A;  3MED A;  4IDK A;  4OKJ A;  1RDB A;  2KFZ A;  3TAG A;  4FJN A;  5HP1 A;  1Q9Y A;  4OJR A;  4GMJ B;  5J2N A;  2E4L A;  1LAV A;  1BI4 B;  2DFF A;  1TKT A;  3M8P A;  4GW6 A;  5HRR A;  4CGJ A;  4DTM A;  4WE1 A;  2DY4 A;  3QES A;  3V9W A;  3SV4 A;  4E7L A;  4DFJ A;  3KJV A;  3LZI A;  1DTT A;  4DSL A;  4AHC A;  4KV8 A;  1C1B A;  2ZE2 A;  3U3G A;  4Z4G A;  1F21 A;  1KVA A;  1C0M A;  1RT4 A;  1X9W A;  3ZSR A;  3B6O A;  1VSI A;  2IC3 A;  4KO0 A;  4F2S A;  2IAJ A;  3OYB A;  1T03 A;  3V9U A;  1L5U A;  1GOB A;  1XHX A;  1O1W A;  4EP5 A;  5K14 A;  4KKO A;  3KKR A;  4E1N A;  3VQB A;  1WSH A;  2GV9 A;  5E41 A;  3K5L A;  3TAQ A;  3MXI A;  4F8R A;  2YV0 X;  2F8T A;  1RT7 A;  4AHS A;  3K5M A;  1X1P A;  3NF6 A;  3PV8 A;  4DSK A;  3NFA A;  4ELV A;  1S9G A;  1TV6 A;  5D3G A;  5KGW A;  3HJF A;  4Y1D A;  4DTJ A;  4NYN A;  1VSM A;  1DTQ A;  1SL0 A;  3VQ8 A;  4M3Y A;  4E19 A;  3OYJ A;  3DOK A;  3ZT0 A;  4DF8 A;  1YTA A;  3O4N A;  4FZZ A;  3LAK A;  4BWM A;  1BCM A;  2HNY A;  3C94 A;  4KHQ A;  4HUF A;  5FRN A;  4FW2 A;  1BI4 A;  4H8K A;  2XY7 A;  1U47 A;  3DM2 A;  4CJT A;  4B9S A;  4FJL A;  4CHY A;  4FXD A;  3L2W A;  2D0B A;  1NJY A;  1R0A A;  3V9X A;  3RWU A;  4N56 A;  4F3T A;  2A1R A;  4PUO A;  1S6P A;  4KB1 A;  1RBU A;  1GOA A;  4CGH A;  3HM9 A; 
#chains in the Genus database with same CATH topology
 3SYZ A;  1JXE A;  3DRR A;  4FVM A;  4LH4 A;  1LV5 A;  4CZI A;  2HHU A;  4C1N I;  2PY5 A;  3R8E A;  3O9U A;  1U04 A;  2WC9 A;  4N47 A;  3UKR A;  4EIA A;  2ATQ A;  4DR1 K;  4DS5 A;  4NLB A;  2P9L A;  4BC5 A;  4JKD A;  3ZET A;  1U6Z A;  1OH8 A;  3VQ9 A;  3OBW A;  3ULE A;  4PKI A;  4OPK A;  1VQ5 N;  4DUY K;  4LD0 A;  4FOI A;  4FWN A;  4WYB A;  4DWI A;  3TWH A;  5GAH P;  3J81 O;  4XEI A;  4DTS A;  1ZBI A;  2BDP A;  5F1X A;  2NNW A;  5FPD A;  4B1U B;  4KPY A;  3VQP A;  4PL7 A;  4ELU A;  1QQO A;  2E20 A;  4J8F A;  3SAF A;  1K8K B;  1S5J A;  2E1Y A;  2NRV A;  4IO8 A;  1EWQ A;  1EQY A;  2A6A A;  5AQI A;  4U7B A;  1MWK A;  4KH6 A;  3ZX3 A;  1T05 A;  3AGR A;  2P9U B;  2O8E B;  4AHR A;  4MQ3 A;  3WQT A;  3QIC A;  1U49 A;  1VSF A;  1ASV A;  2D1K A;  1C1A A;  5BRF A;  4Z4H A;  3DLR A;  5JS1 A;  5BR8 K;  4I9Q A;  4FM2 A;  3EN9 A;  4HCC A;  4YOT A;  4OGC A;  2IVP A;  5M1P A;  2VGN A;  5E84 A;  4X64 K;  2F9W A;  3PLA A;  3OS2 A;  1RT1 A;  4NCG A;  1RTD A;  1G15 A;  3LM2 A;  4YDU A;  4DCH A;  1NK9 A;  4CCH A;  4YOW A;  4KBO A;  2YHY A;  5LY3 A;  2OA8 A;  3ID8 A;  3SQ4 A;  3AVC A;  5C42 A;  3U9D A;  1NOZ A;  5AQO A;  2D0A A;  3PX4 A;  4KHW A;  1RT2 A;  4J2A A;  3F2K A;  3FZL A;  1RFQ A;  3RVC A;  3AO3 A;  3KHY A;  3ZSO A;  1Z6R A;  3O1B A;  3D6R A;  3IUC A;  4M3U A;  4BQZ A;  4FOE A;  1NK4 A;  3KLF A;  3ZT3 A;  3HSC A;  1U4B A;  1CXQ A;  3RTV A;  1JCF A;  4G1Q A;  4LY7 A;  3VGM A;  4M63 C;  3L3V A;  3RMA A;  1BHL A;  2AP1 A;  3ULD A;  3VQ7 A;  2J4R A;  2VGM A;  4IZ9 A;  1HPZ A;  2F8S A;  2QWP A;  2O8B B;  4DB3 A;  5T7B A;  3VQC A;  4FPA A;  3CMA N;  3EKS A;  4DFP A;  5HRO A;  4JI3 K;  4M3X A;  4YOX A;  1ASU A;  3BEX A;  4ILJ A;  4CJK A;  1IBM K;  2G8F A;  1UWB A;  3F9K A;  4CEA A;  4B8A B;  3OYF A;  4DU3 A;  1RT3 A;  3QIN A;  1QQN A;  1WN7 A;  4Q0B A;  1NJZ A;  4LSN A;  3PIO L;  3HM8 A;  3LL3 A;  1VQ6 N;  1U48 A;  4BRC A;  3PSF A;  3T1A A;  4KHS A;  3KK3 A;  3JSM A;  3MK6 A;  3SUP A;  3K0S A;  5HRS A;  1Y97 A;  5GAG P;  2KKZ A;  5JLH A;  1X9M A;  4FJ8 A;  4BRN A;  3THW B;  5KRS A;  1P8Z A;  1R59 O;  4O55 A;  1KSP A;  3VEO A;  3TAP A;  4BRG A;  3HXM A;  4H0T B;  2Q0R A;  4W5T A;  1NK6 A;  3SMS A;  4FWP A;  1ATN A;  5GIP A;  1KAY A;  1VSD A;  4BE2 A;  1E4G T;  2VWJ A;  2B5J A;  3KZB A;  1J53 A;  2E8A A;  1NGJ A;  5AZJ B;  1KFD A;  5HBM A;  3RMB A;  2P5O A;  3T1H K;  1SZ2 A;  3A2F A;  3LAM A;  1GLB G;  1KC8 O;  3OYK A;  4A5B A;  4CF1 A;  1RBR A;  1OH5 A;  1NK7 A;  4FJ7 A;  1K8K A;  4FJ9 A;  4N76 A;  1EXQ A;  2D5R A;  2OCE A;  4NLC A;  4DQ8 A;  1OKJ A;  1HLU A;  5J1E A;  3H1Q A;  2P9U A;  2O8E A;  4O44 A;  3KLI A;  4DSI A;  5EY4 A;  2HB5 A;  4FZX C;  2W40 A;  3O9Q A;  3VQQ A;  3WUH A;  1QVF M;  4FJH A;  3VTI A;  3MWT A;  2OPP A;  3SQ0 A;  2F96 A;  4B3T K;  1HRH A;  5AQV A;  3G6E N;  4B3R K;  2P9N B;  4CJP A;  4A59 A;  4JRQ A;  3CQ8 A;  4DV7 K;  3MEC A;  5M1N A;  5BRD A;  4CGI A;  3VEY A;  4Z4C A;  5SZT A;  1EWR A;  4YFU A;  2BH1 A;  3KWI A;  1C0T A;  4E7H A;  4DTU A;  4FLY A;  3KLE A;  3IG1 A;  3KTQ A;  3CCL N;  1Z05 A;  1HMV A;  3O4W A;  5ADX A;  5AQG A;  3NMU A;  4DHY A;  1BIU A;  1LWF A;  4BWJ A;  1ZBU A;  4IKF A;  1HUX A;  4M3Z A;  1TYQ B;  2HND A;  1LWE A;  2O8F B;  1GOC A;  1TGO A;  1E4F T;  1YIJ N;  4FO0 A;  5AFU H;  1WB9 A;  4CJ3 A;  1ITG A;  2XY8 A;  4W5R A;  3CJ1 A;  4E7K A;  4BR9 A;  3SUQ A;  3VQ4 A;  3HL8 A;  1YJW N;  1SKR A;  3WQU A;  1NJI O;  3QB0 A;  5JIC A;  4Y1C A;  2QWR A;  3TAB A;  1OVY A;  2O8B A;  2Q36 A;  4CZG A;  1L3T A;  3QFP A;  1U45 A;  3KK1 A;  3QFU A;  1TKX A;  4H5T A;  2HMI A;  4I2P A;  5E26 A;  3NF9 A;  4DG1 A;  3W3D A;  5AQN A;  3OA9 A;  3BZC A;  1HPM A;  1REV A;  5C25 A;  3GBT A;  1FKP A;  2UUB K;  3SBT A;  2VG6 A;  2VQF K;  4KRE A;  1FJG K;  2NUB A;  3LWL A;  4FWL A;  5CZ1 A;  4ZTJ A;  4B1V A;  5I9E B;  4FM1 A;  3RMC A;  3B6P A;  4CJQ A;  1BUP A;  5LMN K;  4BGA A;  4DTX A;  3CCS N;  4DV4 K;  4ISF A;  5AQJ A;  2VYP A;  4I6M B;  2YCH A;  5AQX A;  4JI4 K;  4RW8 A;  4MLH A;  4X66 K;  1YJ9 N;  3THW A;  5CZ2 A;  3SV3 A;  3Q7B A;  2KQ2 A;  5HL7 L;  5J2P A;  1Q8I A;  3CF5 L;  4DQR A;  5M1O A;  3CQX A;  3MXJ A;  3L2V A;  3AAP A;  4FWM A;  3TAF A;  4JKH A;  4C8N A;  1M90 O;  5HLF A;  5ELZ A;  1EET A;  2ZGZ A;  5KQD A;  4YOV A;  3HPG A;  3NVM A;  5AZJ A;  3L8B A;  1WSE A;  3O3H A;  4ZTF A;  3SLC A;  2OTJ N;  1BGX T;  1NGH A;  1YF5 L;  2WTU A;  4CIE A;  4FL9 A;  4FVU A;  3DRP A;  3MED A;  1RDB A;  3ENB A;  2KFZ A;  4A62 A;  4OJR A;  4WQ5 C;  1BI4 B;  1TKT A;  4E7L A;  3KJV A;  1DTT A;  4DSL A;  4EAH D;  4KV8 A;  4DV5 K;  1F21 A;  1KVA A;  2KLA A;  3QBX A;  1X9W A;  2BUP A;  1VQL N;  3ZSR A;  3B6O A;  2IC3 A;  2NRH A;  3OYB A;  4R79 A;  4KKO A;  3TAQ A;  3O5B A;  2PFU A;  3GDQ A;  3VOV A;  4AHS A;  3NF6 A;  2P9N A;  2P9L B;  3JAM O;  3ULE B;  1VSM A;  4CZK A;  1DTQ A;  1SL0 A;  4M3Y A;  1KXP A;  1YAG A;  3I55 N;  4CD1 A;  3RSE B;  2XY7 A;  4K42 A;  4GY2 B;  2I7P A;  4CJT A;  4FJL A;  1T44 A;  2D0B A;  1NMD A;  2ZF5 O;  3P38 A;  4KB1 A;  2P9S B;  4CGH A;  3SMP A;  4AF1 A;  1S1T A;  2RF2 A;  3LP0 A;  4BR7 A;  1WBD A;  3ASM A;  4DR4 K;  1KAX A;  4QOZ B;  1YVU A;  3CET A;  3LDO A;  1C0F A;  1S9E A;  4GVE A;  2HVI A;  1TYQ A;  4CJW A;  3K58 A;  2O8F A;  3VN5 A;  4Z4F A;  2HBM A;  2PYL A;  2NRX A;  1C0G A;  3O9T A;  4JD2 A;  1N8R O;  3CYM A;  1HKG A;  2A41 A;  4WQ4 C;  4CJL A;  4JKE A;  1KRP A;  1UAX A;  2YHX A;  3BZK A;  3JYT A;  3F73 A;  3SUO A;  2CH6 A;  1HNW K;  3DXK B;  1IBL K;  2W41 A;  4AHV A;  3S3N A;  5I42 A;  3NDK A;  4M7X A;  4JRP A;  2Z1H A;  3TTC A;  5BR9 A;  3M8S A;  3G10 A;  5KGX A;  3T69 A;  4FLX A;  1S3X A;  1CZ9 A;  3C7N A;  1XWL A;  2E6L A;  2HBK A;  1JL2 A;  2BAN A;  1ILY A;  5C15 A;  3P4I A;  4KTZ A;  2IVN A;  4EHT A;  2DFE A;  2E6M A;  2RKI A;  1NNE A;  4CEO A;  2AA4 A;  4GKJ K;  3U4L A;  1RTH A;  4M45 A;  4B9T A;  1VSL A;  2Z1G A;  3VQE A;  4ILH A;  2O4I A;  4Q5V A;  2V7Y A;  4BVO A;  5IWA K;  4CJU A;  3C65 A;  3CFP A;  1WAF A;  5LMU K;  4GVM A;  4BR0 A;  4CZL A;  3MMV A;  4K0K K;  4DKW A;  4CHZ A;  4B9M A;  3HO1 A;  4I6M A;  2EX3 A;  1WBB A;  4DSJ A;  4M42 A;  4OKK A;  5AQY A;  4G9Z A;  4O8U A;  3VEZ A;  4FLU A;  3CI5 A;  3CC7 N;  2OPS A;  3AVM A;  3V4I A;  4L3Q A;  3LP2 A;  2PYJ A;  3H3N O;  1SKW A;  1VQP N;  4OLA A;  3U6F A;  4JKB A;  4C8M A;  1TUY A;  5H1S Q;  3CQY A;  3NH2 A;  1YT3 A;  3THV A;  3MX5 A;  5JLF A;  2JGU A;  4BRQ A;  1W0H A;  3A5N C;  2FBV A;  4H4O A;  4A57 A;  3PY8 A;  5HRN A;  3SJH A;  2CGJ A;  1BQN A;  4FLV A;  1HJR A;  2UU9 K;  1HNZ K;  2QXL A;  1S1X A;  5C24 A;  1OH6 A;  3FZH A;  3PUF A;  1HX1 A;  1IO2 A;  5C2D A;  4DTR A;  1DEJ A;  1XQS C;  3M3Z A;  3VGL A;  4FK0 A;  1TL1 A;  3E66 A;  1WAJ A;  2XY6 A;  1X9S A;  2GWJ A;  1KD1 O;  4WFB L;  1XMQ K;  2NRR A;  2HOE A;  2FC0 A;  1T8E A;  1L3U A;  3S9H A;  1FXX A;  2GBZ A;  4BRD A;  1EX4 A;  4E89 A;  3RSE A;  1DT9 A;  2CGL A;  5AQT A;  3AAQ A;  3SBG A;  2QKB A;  4RW4 A;  3QML A;  2IS3 A;  3CME N;  1JCE A;  1RNH A;  2P9S A;  1VSJ A;  2HHV A;  4FJK A;  3HVR A;  4DLG A;  4R5P A;  4O4G A;  3MN9 A;  4CHN A;  2VQE K;  5AQU A;  1I94 K;  3AVJ A;  3IRX A;  4ICL A;  1QVG M;  1Q7Y O;  1RTJ A;  3K2P A;  4MLE A;  3OHR A;  3J7A P;  5HOO A;  2ZGY A;  4PHT X;  4DQS A;  3ENH A;  2KZZ A;  3AY9 A;  4JV5 K;  1XUP O;  4BRF A;  1RBT A;  1J54 A;  4UY8 O;  2IGI A;  3VER A;  1TK5 A;  2XO7 A;  4PKG A;  2JWL A;  1BA1 A;  4IWV A;  3A8Y A;  3DLK A;  5EOY A;  3CFO A;  4CK2 A;  4FW1 A;  3DXK A;  3OTO K;  3NVK A;  3V1R A;  3SPY A;  3CXC M;  2ITM A;  1NGB A;  4K8X A;  1XC3 A;  3NAE A;  4XH4 A;  4NCB A;  1KFS A;  3I56 N;  1LW2 A;  3FZM A;  4CJ7 A;  4BRP A;  1ZXO A;  3KIO A;  2JLE A;  1ZBL A;  4DTN A;  1VQ7 N;  4H0Y B;  2LSN A;  1BU6 O;  2ZWH A;  1NGE A;  3CJC A;  5CHI A;  5AQP A;  1X9J A;  3DWL A;  5J2Q A;  3LPT A;  1N36 K;  4QS7 A;  1TUU A;  3UIQ A;  2X6S A;  3AVK A;  3CG7 A;  3RRG A;  2KW4 A;  3VA0 A;  3J8A A;  3TR8 A;  4CEC A;  4CJR A;  1NKE A;  2QW9 A;  4DMN A;  5M1F A;  3LM9 A;  1DLO A;  5CYM A;  4BRM A;  5ADX H;  2EHG A;  1NOY A;  3N4Q A;  1QHA A;  4J2D A;  1QZ6 A;  1HQU A;  3OJS A;  3LDS A;  3KWG A;  4CEF A;  2PAV A;  5F0X A;  3WT0 A;  4KHN A;  5KPR A;  4EFH A;  4M3T A;  3CCJ N;  2QKK A;  4BR5 A;  4B9N A;  2WOM A;  2D0P A;  1N32 K;  3THY B;  3C95 A;  2FBX A;  2QWQ A;  3CCE N;  3H45 C;  4RW7 A;  1I3A A;  3C6U A;  4FJX A;  4LFA K;  4CHO A;  4QCL A;  4BR2 A;  1NGI A;  4CBX A;  1J5O A;  3B8A X;  3SK3 A;  1Q81 O;  2OYQ A;  5I3U A;  3PO5 A;  4CZM A;  2B6A A;  5FPN A;  4FWQ A;  1QQM A;  3BY5 A;  4BRE A;  1XI1 A;  5JVH L;  1ZBF A;  4JI6 K;  3AA4 A;  1JXB A;  4V19 S;  3V81 A;  1D8Y A;  3H3O B;  3SAH A;  3NF7 A;  4IO9 L;  1HYZ A;  2FBT A;  1VQM N;  3EZ5 A;  1UA0 A;  1T3V A;  4BRA A;  4OPJ A;  1VQO N;  2CGK A;  4AQY K;  1J5E K;  3DLE A;  4JNE A;  3EE9 A;  2NLX A;  3QNO A;  3MN6 A;  2YJE A;  3DLB A;  4JLH A;  3I0S A;  4CJ4 A;  4NCA A;  3IKM A;  4ZHR A;  4BDP A;  5JVG L;  3ZYY X;  3F5T A;  3CHW A;  2HBJ A;  5KTQ A;  4WQ5 A;  4CK3 A;  4OO1 J;  3H46 O;  1CLQ A;  3UB5 A;  3J7Z O;  4YHH K;  4PQU A;  3VGK A;  4NYF A;  4DQQ A;  1KAZ A;  1QSS A;  4LF4 K;  4DU1 A;  1LAW A;  1S1W A;  1BIS A;  2G8I A;  4CZJ A;  4GV9 A;  1TVR A;  1G99 A;  4YOY A;  1KLN A;  1NBW A;  2KHO A;  3S3M A;  2NRW A;  3CCQ N;  2YHB A;  2DTU A;  2IDO A;  3NE6 A;  3O6W A;  2GEL A;  4BRK A;  3HOS A;  3CM6 A;  3LWM A;  3OS1 A;  3S3O A;  2OTL N;  2YX6 A;  2YHW A;  4CGD A;  3K5O A;  3RMD A;  5BRH A;  4HTU A;  1NGC A;  2O4G A;  1QS4 A;  4C8L A;  4DV2 K;  1T7P A;  5AR0 A;  5A2Q O;  1RBS A;  3L0Q A;  2BGG A;  3V1Q A;  1JLF A;  4F3O A;  4H4M A;  3VES A;  3M6G A;  5HP1 A;  1E3M A;  1Q9Y A;  4GMJ B;  4FWO A;  4GKK K;  3WXL A;  4DTM A;  4WE1 A;  5CE3 A;  5LJV A;  4B1Y B;  3V9W A;  4DFJ A;  3LZI A;  4AHC A;  3CCM N;  4PKH A;  4Z4G A;  1RT4 A;  3HTV A;  1VSI A;  4KO0 A;  3KVG A;  1EO1 A;  3BP8 A;  3TSP A;  4IJN A;  3V9U A;  4JK9 A;  1O1W A;  2YI1 A;  4E1N A;  3KKR A;  4DV1 K;  4F8R A;  1WSH A;  5AZI B;  1RT7 A;  4CBU A;  4DSK A;  3NFA A;  2ASP A;  1HNX K;  4DTJ A;  4ILG B;  3VQ8 A;  4JD2 B;  4E19 A;  1OH7 A;  3ZT0 A;  4FZZ A;  3LAK A;  2HNY A;  5FRN A;  1U47 A;  3DM2 A;  4B9S A;  5AQW A;  3L2W A;  1R0A A;  3V9X A;  4N56 A;  4F3T A;  2A1R A;  1IKV A;  1S6P A;  5AQS A;  1GOA A;  4W5Q A;  3HM9 A;  3WXI A;  1BIZ A;  4DQI A;  2VWK A;  4JKF A;  5LL6 Z;  1NKB A;  3HPH A;  3SJJ A;  1WNS A;  3R1X A;  5AJ3 K;  3I8B A;  4MO4 A;  3TTF A;  3E9L A;  3ITH A;  4IBN A;  1ESV A;  4RWT A;  3TAN A;  3C7N B;  4HTL A;  4FCY A;  1HNV A;  1UOC A;  4BRL A;  3FE1 A;  4DLE A;  3THY A;  1J9A A;  4LF6 K;  1WSI A;  4H0X B;  1V4T A;  1YIT N;  3TAR A;  3LPU A;  3PO4 A;  1KQS M;  1LOT B;  2XY5 A;  3WXJ A;  4FWS A;  1V4S A;  4IG3 A;  3HT3 A;  3AVH A;  5GIN A;  1Z25 A;  4CEZ A;  4LFC K;  5FRO A;  3K59 A;  3R3L A;  2GUI A;  1JJ2 M;  3HST B;  1FW6 A;  4BAC A;  3MXM A;  3K9K A;  5BPL A;  3O80 A;  2FSN A;  1IJJ A;  1DKG D;  3HYF A;  3W0L A;  4HVJ A;  1NJX A;  3O3F A;  1Z26 A;  5BN9 A;  4Z4I A;  3NGY A;  2R7Y A;  1TL3 A;  1IG9 A;  1VSK A;  4LF5 K;  3TU5 A;  4BE0 A;  3F9M A;  5AQQ A;  4AH9 A;  4F2R A;  1NK0 A;  3C0B A;  2ZJQ L;  3I0R A;  4ID5 A;  3KLG A;  1K73 O;  1JLB A;  1GLA G;  3QLH A;  2HHX A;  4IEE A;  4B3S K;  3OYI A;  2I7N A;  5KQ8 A;  2HHQ A;  5AQL A;  3ALY A;  2A40 A;  1B92 A;  1NU0 A;  1GLE G;  3GOI A;  4O5B A;  3G25 A;  3OS0 A;  3QER A;  3VQ6 A;  3NH1 A;  5FLX O;  4DV3 K;  2D0C A;  1N33 K;  4GNI A;  4H5V A;  4CF2 A;  4KRF A;  2OZM A;  3DXM A;  2RN2 A;  2FSJ A;  5FDL A;  4DR6 K;  1RBV A;  2YHA A;  3AA3 A;  4DS4 A;  3CD6 N;  1Q9X A;  1IKX A;  4KB0 A;  2GEM A;  5IT9 O;  4Z4E A;  3TTD A;  3I33 A;  3A5M C;  4B08 A;  3RR7 A;  4FK2 A;  4BC3 A;  1HYS A;  3QIO A;  2OZS A;  4KAZ A;  4YOR A;  4BC4 A;  4FJG A;  1C6V A;  1FKO A;  3ZT1 A;  2WON A;  4PL8 A;  3UKU B;  4FWK A;  4IFE A;  4JEP A;  1NMN A;  4E7I A;  4N41 A;  2QM1 A;  4K43 A;  3RR8 A;  1Y64 A;  2QWL A;  3AVL A;  1EKE A;  1JLA A;  1EP4 A;  2VG7 A;  4CIG A;  1HYV A;  4U67 L;  1BCO A;  4A5A A;  3CJB A;  4QS8 A;  3AO5 A;  3THX A;  4L8R B;  3HK2 A;  1BQM A;  5GAD P;  4C8O A;  4OGE A;  1IG8 A;  3PX0 A;  3PX6 A;  5AZI A;  4CD3 A;  1BL3 A;  4CGF A;  4CJF A;  1IV0 A;  3BGR A;  4CFC A;  3MN7 A;  3SNN A;  2E2P A;  3KK2 A;  3RRH A;  4Y0W A;  3MN5 A;  2IVO A;  1QSY A;  2X6N A;  1S1V A;  3ZSX A;  2PZS A;  4B9Q A;  4B1W B;  4HCB A;  4QAG A;  2V51 B;  4JKA A;  1RDD A;  1T6D A;  3AVB A;  2ZJP L;  4FSV A;  5HRP A;  1NGF A;  2W42 A;  1NGG A;  3D7E O;  4K8Z A;  3E01 A;  4RTF D;  1SUQ A;  4Z0U A;  2E2Q A;  5AQM A;  3HI0 A;  1SL2 A;  1HKB A;  5KPT A;  4H0V B;  3DRS A;  3HVT A;  4N5S A;  2HF3 A;  3QIP A;  4CHQ A;  4O8K A;  1JCG A;  3AO4 A;  3EZW A;  2YNF A;  2H3G X;  3HP9 A;  4KH4 A;  3VET A;  3O8M A;  1SAZ A;  1RDC A;  1YJN N;  3VEW A;  1WLJ A;  4B1X B;  3P39 A;  2NRT A;  3IDH A;  5AQF A;  3DOL A;  3VPZ A;  1NKC A;  4JI7 K;  5C0Y A;  1ZBH A;  2HF4 A;  4JI8 K;  3BF3 A;  4HHT A;  5M1K A;  1N34 K;  4FZY A;  4CFB A;  4EZ6 A;  2X74 A;  4FLT A;  1ZYQ A;  3QEX A;  5TKW A;  3ZLJ A;  4TSX A;  1NG9 A;  4A61 A;  3C6T A;  4KTQ A;  2P9P B;  4KH5 A;  4HWI A;  4DV6 K;  3P5J A;  4CGG A;  4JYA K;  4C8K A;  1GLD G;  4CEE A;  1VQ9 N;  3QEI A;  2KZM A;  5EU7 A;  3NGZ A;  3G4S N;  4EZ9 A;  3R6M A;  2ETJ A;  4FYD A;  1J6Z A;  3NGI A;  2D0O A;  4JI1 K;  4O5F A;  3BDP A;  3J7Y P;  2FF3 B;  3DMJ A;  4FJI A;  3E1Y A;  4FJJ A;  2G8H A;  1QTM A;  4EHU A;  3AO1 A;  1JLE A;  4MDB A;  3LAL A;  4FK4 A;  3ZT4 A;  4RW9 A;  3H08 A;  4AHU A;  3SQ2 A;  1O13 A;  1QE1 A;  2ITG A;  4CW7 B;  2HHH K;  3DJC A;  4H5W A;  2WFB A;  5M1Q A;  3CCU N;  1VQN N;  3OY9 A;  1C1C A;  2KFN A;  2UUC K;  5BPN A;  4JI2 K;  3CCV N;  4OVL A;  3UE5 A;  4DQP A;  1W7A A;  4BDY A;  3QEV A;  3VQA A;  3O4Q A;  1CZB A;  3VF2 A;  3M8R A;  3EYZ A;  1TAU A;  2IOC A;  2Q2R A;  1K9M O;  1JLC A;  1RGI A;  3GE1 A;  2E2N A;  1N6Q A;  4LF8 K;  3HP6 A;  1S6Q A;  5C10 A;  1SL1 A;  3PIP L;  2UXC K;  4EP4 A;  3AVF A;  3CJ9 A;  3G71 N;  3D45 A;  2NRZ A;  1B9D A;  3FFI A;  1OVQ A;  5B8H A;  4JS5 A;  5CY4 A;  1LCU A;  3VEN A;  1TK8 A;  4CZH A;  3D2F B;  3EY1 A;  1SS6 A;  3WEE B;  5GIO A;  3UKU A;  2O8C B;  3Q7C A;  2F7T A;  1XHZ A;  1WUA A;  2ASM A;  4PWD A;  4IEI A;  2YNI A;  3O1W A;  4H03 B;  4CFD A;  3AAR A;  2WBN A;  2A42 A;  4CZF A;  1RTI A;  4BVP A;  2Q31 A;  1HJO A;  2I5J A;  3DLG A;  4A2A A;  3AVG A;  3NHG A;  4QS9 A;  4CES A;  1U2V B;  2WUS A;  3ZSW A;  3H1V X;  5DMR A;  4CZE A;  4BDZ A;  1N5Y A;  2YJF A;  3VEX A;  4J2E A;  3VF6 A;  4HUG A;  4DFM A;  2OAN A;  1TAQ A;  4M41 A;  3L4I A;  3OW2 M;  3SI6 A;  1VSH A;  4JS4 A;  4B3M K;  3AVI A;  2UUA K;  1CZA N;  4CVN E;  3OYH A;  3A0I X;  3MAQ A;  2D4W A;  1WSG A;  3L2U A;  4CER A;  4OPH A;  4CEQ A;  4DTO A;  3QO9 A;  2QWM A;  1BOT O;  2Z1I A;  3LP3 A;  1VRT A;  1KLM A;  5CR4 A;  3PSI A;  1S72 N;  4FLZ A;  3OYG A;  4MDA A;  4BC2 A;  5EX5 A;  4CHP A;  1KCF A;  5AQK A;  4JI5 K;  4A2B A;  3TSU A;  2A1S A;  4JHD B;  2ZJR L;  4BY9 C;  3AO2 A;  1DGK N;  1BWF O;  4AM6 A;  4LH5 A;  4F9O A;  1GLL O;  3DLL L;  2Y1I A;  3A5L C;  2G8W A;  3AV9 A;  2O8D B;  4OLB A;  1UA1 A;  3FGU A;  1X3N A;  3DYA A;  4IDK A;  4BGB A;  4K25 A;  4OKJ A;  4FJN A;  4JK8 A;  2QTD A;  1T6C A;  3M8P A;  1YXQ A;  2DY4 A;  4GW6 A;  3QES A;  3SV4 A;  3MCA B;  3HZ6 A;  4JAX A;  1C1B A;  2ZE2 A;  3HOT A;  4MO5 A;  4BQL A;  1C0M A;  2P9P A;  4BG9 A;  1RDU A;  2IAJ A;  3L4Q A;  4JK7 A;  1T03 A;  1L5U A;  1XHX A;  4EP5 A;  1NGD A;  2GV9 A;  5E41 A;  3K5L A;  2QA4 N;  4LF7 K;  5DM6 L;  1QZ5 A;  2F8T A;  1MWM A;  3VMF B;  1YUW A;  4ELV A;  1S9G A;  1YVN A;  4Y1D A;  2V7Z A;  3GG4 A;  3DOK A;  4DF8 A;  2GUP A;  3KK7 A;  3O4N A;  2GWK A;  5TKY A;  4BWM A;  3CJA A;  4FW2 A;  3VEV A;  1NLV A;  4XH1 A;  5F2R A;  3U9Z A;  1RBU A;  3ZSQ A;  2Y1J A;  3HJF A;  1P90 A;  4DR2 K;  3WXK A;  3LDN A;  5KI6 A;  2YKN A;  4KHP K;  2QK9 A;  3IFR A;  4DR5 K;  1TKD A;  3M1F A;  2HW3 A;  4PA1 A;  1X3M A;  4XH5 A;  2P9K B;  3SPZ A;  4DSF A;  3KD1 E;  2HST A;  1VAZ A;  4WF9 L;  4M3W A;  3KKS A;  1VHX A;  4B9V A;  4CBW A;  1QQC A;  5C2F A;  3SUN A;  2Z1J A;  2E88 A;  2HHW A;  4Z94 A;  4DV0 K;  2QI2 A;  4E3S A;  1NJW A;  4IDH A;  1Q82 O;  3DAW A;  3P1G A;  4KHU A;  3CM5 A;  3D2F A;  3N4P A;  3WEE A;  4YNQ A;  4GV3 A;  5EVZ A;  3LDP A;  3OJU A;  2RPI A;  1CXU A;  2O8C A;  3D0P A;  5FRM A;  4F4K A;  3O9S A;  2PBD A;  5FPE A;  1IKY A;  1KVC A;  3OBY A;  3IAY A;  1VSE A;  4CIF A;  4CK1 A;  2YNG A;  3EEQ A;  3QEP A;  1JL1 A;  3MDQ A;  3NBP A;  3VF4 A;  2ZM6 K;  2G8V A;  1U2V A;  4LSL A;  4B9L A;  3NCI A;  3DXM B;  3ZCM A;  5DK5 A;  4X65 K;  1FK9 A;  3ENO A;  4AIL C;  1IH7 A;  3LZJ A;  4CEB A;  2HVH A;  2UYT A;  1QHT A;  3AA5 X;  2IIR A;  2KTQ A;  4ELT A;  3NH0 A;  4I2Q A;  1NWK A;  3IS9 A;  3T3F A;  2E1Z A;  2G8U A;  3K57 A;  1D5A A;  4IOC L;  3TAM A;  1MDU B;  3OYC A;  4M3R A;  4IJA A;  2AJQ A;  4CJ5 A;  3MX2 A;  3MEE A;  3L2R A;  1VRU A;  4WQ4 A;  4H0O A;  4JHD A;  3THX B;  4BRO A;  2P9I B;  3SZ2 A;  1BDG A;  4J2B A;  1WOQ A;  3FFK B;  4FJM A;  4JKG B;  3TSQ A;  3OYL A;  1IKW A;  2O8D A;  3L2Q A;  2Q3S A;  1K8A O;  2XHB A;  4CJS A;  1MU2 A;  3OYM A;  1SV5 A;  2ZD1 A;  2UXB K;  1C0U A;  2Q97 A;  2YKM A;  4KTW A;  4CF8 A;  2HMP A;  3MWP A;  3E9O A;  2V52 B;  2ZQB A;  2HBL A;  2F4V K;  3KLH A;  1YHQ N;  2FXU A;  4YDU C;  4IFV A;  3ATU A;  4CF0 A;  5DM7 L;  3U8X A;  1XNQ K;  4NXM K;  3S41 A;  3ZSV A;  5KRT A;  3HRG A;  2EWS A;  4OPA A;  3AA2 A;  1GLJ O;  3WNE A;  3ZSZ A;  2CH5 A;  5JS2 A;  4I9L A;  1BO5 O;  4IOA L;  3CJ7 A;  4UQG A;  3ATV A;  4H5N A;  4ISE A;  3QET A;  4W5O A;  3ZEU B;  4O0J A;  5CYQ A;  1VQK N;  4BRI A;  1YTU A;  4NXN K;  3J80 O;  3MCP A;  3QNN A;  2UXD K;  1KVB A;  3HBT A;  3R9P A;  3I8D A;  1IBK K;  3L6Q A;  3D2E B;  4NO7 A;  4KFB A;  3VA3 A;  3V1O A;  4DR3 K;  1VQ4 N;  2B4J A;  2RE2 A;  3CPE A;  4H5R A;  5MLC Q;  1NM1 A;  4AHT A;  4NB4 A;  3CIP A;  5SWM A;  5BN8 A;  2FF6 A;  3WNG A;  3OYN A;  1HQE A;  4JKC A;  1ZC6 A;  2NZT A;  3V9S A;  4CI6 A;  2P9K A;  2E5L K;  2JWK A;  2ASO A;  3K5N A;  1K6Y A;  5AQH A;  3BF1 A;  2YNH A;  1A5X A;  3VQ5 A;  4DU4 A;  3EL2 A;  3NF8 A;  3JXU A;  1XC9 A;  4KI4 A;  3L3U A;  3O9R A;  3CER A;  1BA0 A;  1XNR K;  4IG0 A;  1JLG A;  1GLF O;  2DPN A;  5GAE P;  3CPW M;  3TAE A;  4E7J A;  2OPQ A;  4B1Z A;  3FZF A;  2BTF A;  1XMO K;  2Q0U A;  3SCX A;  3WNF A;  4CFA A;  4FLW A;  2X78 A;  5FPM A;  1M1K O;  1HR0 K;  4M7Y A;  4W5N A;  3SAG A;  3WXM B;  4BG8 A;  1JKH A;  3MEG A;  1RT6 A;  2RHK A;  1Q18 A;  4FM0 A;  4IOX A;  3LP1 A;  1RT5 A;  1H1V A;  4CED A;  4FWR A;  3ID6 A;  3TPQ A;  4I7F A;  4DR7 K;  1D9F A;  2P51 A;  4CJE A;  4ID1 A;  4B9U A;  5EXW A;  3G0Z A;  2GX9 A;  1D4X A;  1VK0 A;  4PY5 A;  1HKC A;  2VCP A;  4BE1 A;  2G8K A;  4JN4 A;  4ISG A;  1I39 A;  3LDL A;  1L3V A;  2P5G A;  4DSE A;  3T1Y K;  2FLO A;  3P31 A;  1TKZ A;  2W6K A;  3SQ1 A;  1RIL A;  2P1J A;  3ZT2 A;  3A5O C;  3UKR B;  4FJ5 A;  1RDW X;  1KTQ A;  1W2B M;  1S22 A;  4IFY A;  4DUZ K;  4KI6 A;  4HUE A;  1QSL A;  3ZET B;  3TI0 A;  5LJW A;  3QDK A;  2QWN A;  1Q86 O;  3M5R A;  2P9I A;  5AFU A;  1RDA A;  2F9T A;  3E9P A;  3AVA A;  4DTP A;  4BRH A;  3OVN A;  4E1J A;  1NK8 A;  4JKG A;  3ZX2 A;  3JS6 A;  3DLH A;  4E1M A;  4GV6 A;  1SKS A;  4KHY A;  4B3O A;  1YI2 N;  3T19 A;  3O08 A;  3CCR N;  3VQD A;  3C6A A;  4XIU A;  3O3G A;  3U3Y A;  4OKE A;  3CC4 N;  3WNH A;  5C12 A;  4K41 A;  5JMV A;  3OYD A;  3GL1 A;  1A5W A;  3HPO A;  4AM7 A;  1W97 L;  1LWC A;  1ASW A;  2HNZ A;  4WFA L;  2E2O A;  1A5V A;  4RW6 A;  4E0D A;  2BE2 A;  3CFR A;  4CE9 A;  3ZEU A;  4C1N K;  3KD5 E;  2QXF A;  4H0P A;  1WSJ A;  2A3Z A;  2W6L A;  4DF4 A;  3DI6 A;  2HHT A;  2VWB A;  1D9D A;  3ZSY A;  3D2E A;  3P83 D;  1GLC G;  1WSF A;  1RCH A;  1HNI A;  4BR4 A;  2HHS A;  3AVN A;  3V9Z A;  1JLQ A;  2QWO A;  2XRI A;  4WCE L;  1L3S A;  4MFB A;  2OPR A;  4YY3 K;  3V6D A;  1TK0 A;  2FBY A;  3QEW A;  1W9H A;  4O0I A;  1BG3 A;  4RG8 A;  3OYA A;  3OYE A;  1B9F A;  3ISN C;  4CF9 A;  3AGK A;  4CJV A;  5KPZ A;  4LF9 K;  3LAN A;  1S1U A;  2DFH A;  3EE8 A;  1ATS A;  4B8C A;  1ZBS A;  1LW0 A;  1SQK A;  3M8Q A;  1VQ8 N;  3VTH A;  5J2M A;  2QEX N;  1ATR A;  1NK5 A;  2A5X A;  4FPB A;  4RCH A;  4DFK A;  2VG5 A;  4C23 A;  3TAG A;  4JI0 K;  5J2N A;  2E4L A;  4IXC A;  3C6H A;  3EO3 A;  1LAV A;  5HRR A;  2DFF A;  4CGJ A;  5AQR A;  4X62 K;  3FR0 A;  5AQZ A;  3U3G A;  4F2S A;  2Q1N A;  5BRE A;  4LFB K;  1GOB A;  5K14 A;  3MXI A;  3H6E A;  3VQB A;  5BPM A;  1MA9 B;  2YV0 X;  3EKU A;  3FZK A;  1NGA A;  3PV8 A;  3K5M A;  1X1P A;  3IMX A;  5D3G A;  1TV6 A;  5KGW A;  3LDQ A;  4NYN A;  3QBW A;  3OYJ A;  3T7Z A;  1YTA A;  4WFN L;  4YOU A;  2FSK A;  1BCM A;  2GTD A;  3C94 A;  3FLC O;  4LC9 B;  4HUF A;  4KHQ A;  1BI4 A;  4H8K A;  3ZX0 A;  4CHY A;  4FXD A;  4OX9 K;  1NJY A;  3K9J A;  3RWU A;  4PUO A;  3CC2 N;  3BUZ B; 
#chains in the Genus database with same CATH homology
 3SYZ A;  1JXE A;  3DRR A;  1S1T A;  4FVM A;  1BIZ A;  4LH4 A;  2RF2 A;  2YKN A;  3LP0 A;  5KI6 A;  1LV5 A;  4DQI A;  2QK9 A;  2VWK A;  1NKB A;  1TKD A;  2HHU A;  3HPH A;  3SJJ A;  1WNS A;  3ASM A;  2PY5 A;  2HW3 A;  1U04 A;  4PA1 A;  1YVU A;  4QOZ B;  3SPZ A;  1S9E A;  4DSF A;  4N47 A;  2HVI A;  3KD1 E;  4CJW A;  3K58 A;  2ATQ A;  3ITH A;  4IBN A;  4DS5 A;  3VN5 A;  4Z4F A;  3TAN A;  2PYL A;  4FCY A;  3VQ9 A;  1HNV A;  1UOC A;  4M3W A;  4DLE A;  3KKS A;  4OPK A;  4B9V A;  1J9A A;  4LD0 A;  1WSI A;  3CYM A;  4DWI A;  4CJL A;  1KRP A;  1QQC A;  1UAX A;  3TWH A;  3SUN A;  2Z1J A;  3TAR A;  2HHW A;  3JYT A;  3LPU A;  3F73 A;  3SUO A;  3PO4 A;  4E3S A;  1NJW A;  4DTS A;  1ZBI A;  2F8S A;  2BDP A;  2XY5 A;  3P1G A;  4KHU A;  3CM5 A;  4KPY A;  3VQP A;  4IG3 A;  4ELU A;  3HT3 A;  4AHV A;  3AVH A;  3S3N A;  1Z25 A;  4CEZ A;  4YNQ A;  5I42 A;  1S5J A;  3NDK A;  3OJU A;  2RPI A;  1CXU A;  5FRO A;  3K59 A;  3D0P A;  5FRM A;  4F4K A;  2GUI A;  3HST B;  4JRP A;  2Z1H A;  1IKY A;  4BAC A;  3MXM A;  1T05 A;  1KVC A;  3M8S A;  3IAY A;  1VSE A;  3G10 A;  5KGX A;  3HYF A;  4AHR A;  4MQ3 A;  4CIF A;  4HVJ A;  4FLX A;  1CZ9 A;  1NJX A;  4CK1 A;  1XWL A;  2YNG A;  2E6L A;  3O3F A;  1JL2 A;  1VSF A;  1Z26 A;  2BAN A;  1ASV A;  3QEP A;  1JL1 A;  4Z4I A;  1C1A A;  3NBP A;  2G8V A;  3NGY A;  4KTZ A;  4Z4H A;  3DLR A;  5JS1 A;  2R7Y A;  1TL3 A;  4I9Q A;  4FM2 A;  1VSK A;  1IG9 A;  4LSL A;  4HCC A;  2DFE A;  2E6M A;  2RKI A;  4OGC A;  3NCI A;  4BE0 A;  1U49 A;  4B9L A;  4AH9 A;  4F2R A;  1NK0 A;  3ZCM A;  4CEO A;  5DK5 A;  3OS2 A;  1RT1 A;  3I0R A;  4ID5 A;  3KLG A;  1FK9 A;  1JLB A;  1RTH A;  4NCG A;  4M45 A;  4AIL C;  1RTD A;  1G15 A;  3QLH A;  2HHX A;  4B9T A;  1IH7 A;  1VSL A;  2Z1G A;  3VQE A;  4CEB A;  3LZJ A;  1NK9 A;  2HVH A;  3OYI A;  2O4I A;  1QHT A;  4Q5V A;  3AA5 X;  4CCH A;  2HHQ A;  2KTQ A;  3CFP A;  4CJU A;  1WAF A;  3ALY A;  2OA8 A;  3NH0 A;  4ELT A;  4GVM A;  1B92 A;  4I2Q A;  3IS9 A;  3SQ4 A;  3AVC A;  4O5B A;  4CHZ A;  5C42 A;  4B9M A;  1NOZ A;  3HO1 A;  2D0A A;  3PX4 A;  4KHW A;  1RT2 A;  2EX3 A;  3OS0 A;  3T3F A;  3QER A;  3K57 A;  1D5A A;  2G8U A;  3VQ6 A;  4DSJ A;  3NH1 A;  4J2A A;  4M42 A;  4OKK A;  3TAM A;  3AO3 A;  2D0C A;  3ZSO A;  3OYC A;  4M3R A;  4FLU A;  4CF2 A;  2AJQ A;  4KRF A;  4M3U A;  4CJ5 A;  2OZM A;  1NK4 A;  2OPS A;  3MEE A;  3ZT3 A;  3KLF A;  1VRU A;  3AVM A;  3L2R A;  3V4I A;  1U4B A;  2RN2 A;  1CXQ A;  3RTV A;  5FDL A;  3LP2 A;  1RBV A;  1D9F A;  2PYJ A;  2YHA A;  3AA3 A;  1SKW A;  3SZ2 A;  4G1Q A;  4DS4 A;  4LY7 A;  4OLA A;  1Q9X A;  1IKX A;  4KB0 A;  4J2B A;  3U6F A;  4FJM A;  4C8M A;  4Z4E A;  3OYL A;  1IKW A;  3L3V A;  4B08 A;  3RMA A;  3RR7 A;  4FK2 A;  3NH2 A;  3L2Q A;  1BHL A;  1HYS A;  1YT3 A;  3QIO A;  2Q3S A;  3ULD A;  3VQ7 A;  3THV A;  2OZS A;  4KAZ A;  2JGU A;  1HPZ A;  2XHB A;  4CJS A;  4FJG A;  1C6V A;  1FKO A;  1MU2 A;  1W0H A;  1SV5 A;  2WON A;  2ZD1 A;  3ZT1 A;  2FBV A;  3OYM A;  4H4O A;  1C0U A;  3PY8 A;  5HRN A;  5T7B A;  2YKM A;  4KTW A;  4CF8 A;  4E7I A;  4N41 A;  3VQC A;  1BQN A;  2ZQB A;  3KLH A;  3RR8 A;  4DFP A;  4FLV A;  5HRO A;  1HJR A;  4IFV A;  3AVL A;  1EKE A;  4CF0 A;  1JLA A;  1EP4 A;  2VG7 A;  1S1X A;  5C24 A;  4CIG A;  3PUF A;  4M3X A;  1HYV A;  1BCO A;  3ZSV A;  1ASU A;  5KRT A;  3AO5 A;  4CJK A;  4L8R B;  1IO2 A;  1BQM A;  3AA2 A;  3WNE A;  3ZSZ A;  3HK2 A;  4C8O A;  4DTR A;  2G8F A;  1UWB A;  3F9K A;  4OGE A;  4CEA A;  3PX0 A;  1TL1 A;  4B8A B;  3OYF A;  5JS2 A;  4I9L A;  4DU3 A;  3PX6 A;  4FK0 A;  1RT3 A;  3QIN A;  1BL3 A;  1WN7 A;  4CGF A;  1WAJ A;  4CJF A;  2XY6 A;  4Q0B A;  4UQG A;  4LSN A;  1NJZ A;  1X9S A;  3QET A;  3BGR A;  4CFC A;  4W5O A;  3SNN A;  4O0J A;  5CYQ A;  2FC0 A;  1U48 A;  1T8E A;  1L3U A;  3KK2 A;  3RRH A;  3S9H A;  1YTU A;  1FXX A;  3QNN A;  3T1A A;  2GBZ A;  1KVB A;  2X6N A;  1EX4 A;  4E89 A;  3I8D A;  1S1V A;  3ZSX A;  1QSY A;  2PZS A;  4KFB A;  4KHS A;  3VA3 A;  3KK3 A;  3JSM A;  3V1O A;  4HCB A;  3SUP A;  5HRS A;  2QKB A;  4RW4 A;  4QAG A;  2IS3 A;  1RNH A;  1RDD A;  1Y97 A;  2B4J A;  1VSJ A;  3AVB A;  5HRP A;  2HHV A;  1X9M A;  4FJK A;  4AHT A;  3HVR A;  5KRS A;  4R5P A;  2W42 A;  5SWM A;  4DLG A;  4FJ8 A;  4O4G A;  4K8Z A;  3E01 A;  3WNG A;  4CHN A;  1SUQ A;  4Z0U A;  3OYN A;  1HQE A;  4O55 A;  3V9S A;  1SL2 A;  3AVJ A;  3IRX A;  4ICL A;  1KSP A;  3K5N A;  3TAP A;  3HXM A;  1K6Y A;  4W5Q A;  1RTJ A;  3K2P A;  2YNH A;  4W5T A;  1A5X A;  3VQ5 A;  1NK6 A;  3DRS A;  3HVT A;  4N5S A;  4DU4 A;  4DQS A;  1VSD A;  3NF8 A;  1XC9 A;  3QIP A;  4BE2 A;  3L3U A;  4KI4 A;  4CHQ A;  2KZZ A;  3AO4 A;  2VWJ A;  2B5J A;  2YNF A;  3HP9 A;  1J53 A;  1RBT A;  1J54 A;  1KFD A;  4IG0 A;  5HBM A;  1JLG A;  3RMB A;  2P5O A;  1RDC A;  2IGI A;  1TK5 A;  3A2F A;  2XO7 A;  3LAM A;  1WLJ A;  3TAE A;  4E7J A;  2OPQ A;  3DOL A;  3OYK A;  3DLK A;  4CK2 A;  3CFO A;  1NKC A;  4FW1 A;  1ZBH A;  4CF1 A;  1RBR A;  4HHT A;  3V1R A;  3SCX A;  3WNF A;  3SPY A;  1NK7 A;  4FZY A;  4FJ7 A;  4CFB A;  4FJ9 A;  4EZ6 A;  2X74 A;  4FLT A;  4CFA A;  1ZYQ A;  1EXQ A;  4N76 A;  3QEX A;  2D5R A;  4K8X A;  4TSX A;  4FLW A;  2X78 A;  3NAE A;  4NCB A;  1KFS A;  3C6T A;  1LW2 A;  4W5N A;  5J1E A;  4KTQ A;  4O44 A;  3KLI A;  4DSI A;  3KIO A;  3P5J A;  2HB5 A;  2JLE A;  4CGG A;  3VQQ A;  4DTN A;  1ZBL A;  4C8K A;  4FZX C;  1JKH A;  2LSN A;  1RT6 A;  3MEG A;  4CEE A;  4FJH A;  3QEI A;  2KZM A;  5EU7 A;  3NGZ A;  4FM0 A;  2OPP A;  4EZ9 A;  3SQ0 A;  2F96 A;  1HRH A;  2ETJ A;  4FYD A;  5J2Q A;  3LP1 A;  4CJP A;  3LPT A;  1RT5 A;  3NGI A;  3BDP A;  4CED A;  4JRQ A;  3CQ8 A;  3DMJ A;  3MEC A;  4FJI A;  3UIQ A;  2X6S A;  3AVK A;  3CG7 A;  4FJJ A;  3RRG A;  4CGI A;  2KW4 A;  2G8H A;  1QTM A;  4I7F A;  4Z4C A;  5SZT A;  4YFU A;  3VA0 A;  3AO1 A;  3TR8 A;  1C0T A;  2P51 A;  4CEC A;  1JLE A;  4CJR A;  4E7H A;  3LAL A;  3ZSQ A;  4ID1 A;  4CJE A;  4DTU A;  4DMN A;  4B9U A;  4FLY A;  3KLE A;  4FK4 A;  3ZT4 A;  3G0Z A;  3IG1 A;  3KTQ A;  1DLO A;  1VK0 A;  3H08 A;  4RW9 A;  4AHU A;  5CYM A;  3SQ2 A;  2EHG A;  4PY5 A;  1NOY A;  1QE1 A;  1HMV A;  4BE1 A;  2ITG A;  2G8K A;  4J2D A;  1I39 A;  1L3V A;  2P5G A;  1HQU A;  3OJS A;  4DSE A;  3LDS A;  1BIU A;  4CEF A;  1LWF A;  1TKZ A;  4BWJ A;  3OY9 A;  3SQ1 A;  1C1C A;  1RIL A;  1ZBU A;  2P1J A;  3ZT2 A;  4IKF A;  4KHN A;  2KFN A;  4M3T A;  4OVL A;  4M3Z A;  4DQP A;  2HND A;  1LWE A;  2QKK A;  4BDY A;  1GOC A;  4B9N A;  4FJ5 A;  1KTQ A;  3QEV A;  4IFY A;  4KI6 A;  3VQA A;  1TGO A;  4HUE A;  1QSL A;  3O4Q A;  1CZB A;  3M8R A;  3EYZ A;  3TI0 A;  2WOM A;  1TAU A;  2IOC A;  4CJ3 A;  1JLC A;  3C95 A;  2FBX A;  1ITG A;  2XY8 A;  1N6Q A;  4W5R A;  3HP6 A;  1RDA A;  1S6Q A;  4E7K A;  1SL1 A;  3SUQ A;  3VQ4 A;  4RW7 A;  3AVA A;  1I3A A;  3C6U A;  3AVF A;  4EP4 A;  4DTP A;  4FJX A;  3D45 A;  3FFI A;  1B9D A;  3HL8 A;  1IKV A;  3OVN A;  1NK8 A;  4CHO A;  3DLH A;  4E1M A;  4JS5 A;  1SKR A;  4QCL A;  5CY4 A;  4Y1C A;  1J5O A;  1TK8 A;  1SKS A;  4KHY A;  2OYQ A;  5I3U A;  3EY1 A;  3PO5 A;  4B3O A;  2B6A A;  1NKE A;  3TAB A;  3T19 A;  1XHZ A;  1L3T A;  1XI1 A;  3VQD A;  4PWD A;  1ZBF A;  4XIU A;  2YNI A;  3AA4 A;  1JXB A;  3O3G A;  3U3Y A;  3V81 A;  1U45 A;  1D8Y A;  3KK1 A;  3NF7 A;  1TKX A;  1HYZ A;  2FBT A;  4OKE A;  4CFD A;  2Y1J A;  2HMI A;  3EZ5 A;  1UA0 A;  4I2P A;  3NF9 A;  4OPJ A;  4DG1 A;  3DLE A;  3WNH A;  1RTI A;  3OYD A;  3QNO A;  1REV A;  3DLB A;  2I5J A;  3I0S A;  4JLH A;  3DLG A;  5C25 A;  4CJ4 A;  1A5W A;  3HPO A;  3AVG A;  4NCA A;  3NHG A;  4CES A;  4ZHR A;  4BDP A;  1LWC A;  3ZSW A;  5DMR A;  1FKP A;  1ASW A;  2HNZ A;  4BDZ A;  1N5Y A;  4J2E A;  1A5V A;  2VG6 A;  4CK3 A;  5KTQ A;  4HUG A;  4DFM A;  4KRE A;  4RW6 A;  4E0D A;  1CLQ A;  2BE2 A;  3CFR A;  4CE9 A;  2NUB A;  1TAQ A;  4M41 A;  3LWL A;  3SI6 A;  4PQU A;  1VSH A;  4NYF A;  5CZ1 A;  4DQQ A;  4ZTJ A;  2QXF A;  3KD5 E;  4JS4 A;  1WSJ A;  3AVI A;  1QSS A;  4DF4 A;  4DU1 A;  1LAW A;  1S1W A;  1BIS A;  3OYH A;  3B6P A;  4FM1 A;  3DI6 A;  3RMC A;  2G8I A;  1D9D A;  2HHT A;  4CJQ A;  1TVR A;  3ZSY A;  3P83 D;  4DTX A;  3MAQ A;  1WSF A;  1RCH A;  1HNI A;  1WSG A;  3L2U A;  2HHS A;  3AVN A;  4CER A;  4CEQ A;  4DTO A;  1KLN A;  3QO9 A;  3V9Z A;  1JLQ A;  3S3M A;  2XRI A;  2Z1I A;  2DTU A;  2YHB A;  1L3S A;  2IDO A;  3LP3 A;  4RW8 A;  3NE6 A;  1VRT A;  4MFB A;  5CZ2 A;  3SV3 A;  2KQ2 A;  2OPR A;  5J2P A;  1KLM A;  3LWM A;  3CM6 A;  3V6D A;  1TK0 A;  2FBY A;  4FLZ A;  3QEW A;  1Q8I A;  1W9H A;  3OS1 A;  3OYG A;  4DQR A;  4O0I A;  4CHP A;  1KCF A;  3S3O A;  3MXJ A;  4CGD A;  4RG8 A;  3K5O A;  3OYA A;  3RMD A;  3L2V A;  3TAF A;  4HTU A;  3OYE A;  2A1S A;  2O4G A;  4C8N A;  5HLF A;  3AO2 A;  1B9F A;  3ISN C;  1QS4 A;  4C8L A;  4CF9 A;  1EET A;  1T7P A;  4CJV A;  3HPG A;  4LH5 A;  2Y1I A;  1RBS A;  3LAN A;  1S1U A;  2DFH A;  2G8W A;  3L8B A;  1WSE A;  3O3H A;  2BGG A;  4ZTF A;  4B8C A;  3AV9 A;  1LW0 A;  1BGX T;  1JLF A;  3V1Q A;  4F3O A;  3M8Q A;  4OLB A;  5J2M A;  1NK5 A;  4H4M A;  4CIE A;  1UA1 A;  4DFK A;  2VG5 A;  3DRP A;  3DYA A;  3MED A;  4IDK A;  4OKJ A;  1RDB A;  2KFZ A;  3TAG A;  4FJN A;  5HP1 A;  1Q9Y A;  4OJR A;  4GMJ B;  5J2N A;  2E4L A;  1LAV A;  1BI4 B;  2DFF A;  1TKT A;  3M8P A;  4GW6 A;  5HRR A;  4CGJ A;  4DTM A;  4WE1 A;  2DY4 A;  3QES A;  3V9W A;  3SV4 A;  4E7L A;  4DFJ A;  3KJV A;  3LZI A;  1DTT A;  4DSL A;  4AHC A;  4KV8 A;  1C1B A;  2ZE2 A;  3U3G A;  4Z4G A;  1F21 A;  1KVA A;  1C0M A;  1RT4 A;  1X9W A;  3ZSR A;  3B6O A;  1VSI A;  2IC3 A;  4KO0 A;  4F2S A;  2IAJ A;  3OYB A;  1T03 A;  3V9U A;  1L5U A;  1GOB A;  1XHX A;  1O1W A;  4EP5 A;  5K14 A;  4KKO A;  3KKR A;  4E1N A;  3VQB A;  1WSH A;  2GV9 A;  5E41 A;  3K5L A;  3TAQ A;  3MXI A;  4F8R A;  2YV0 X;  2F8T A;  1RT7 A;  4AHS A;  3K5M A;  1X1P A;  3NF6 A;  3PV8 A;  4DSK A;  3NFA A;  4ELV A;  1S9G A;  1TV6 A;  5D3G A;  5KGW A;  3HJF A;  4Y1D A;  4DTJ A;  4NYN A;  1VSM A;  1DTQ A;  1SL0 A;  3VQ8 A;  4M3Y A;  4E19 A;  3OYJ A;  3DOK A;  3ZT0 A;  4DF8 A;  1YTA A;  3O4N A;  4FZZ A;  3LAK A;  4BWM A;  1BCM A;  2HNY A;  3C94 A;  4KHQ A;  4HUF A;  5FRN A;  4FW2 A;  1BI4 A;  4H8K A;  2XY7 A;  1U47 A;  3DM2 A;  4CJT A;  4B9S A;  4FJL A;  4CHY A;  4FXD A;  3L2W A;  2D0B A;  1NJY A;  1R0A A;  3V9X A;  3RWU A;  4N56 A;  4F3T A;  2A1R A;  4PUO A;  1S6P A;  4KB1 A;  1RBU A;  1GOA A;  4CGH A;  3HM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...