3DLGA

Crystal structure of hiv-1 reverse transcriptase in complex with gw564511.
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
539
structure length
531
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 150
structure length 531
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dlgA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dlgA05
3KHGA 4RW9A 1BQNA 4U6PA 4GC7A 4DL4A 4ZHRA 2EC0A 3VQ4A 4O4GB 2R8IA 4ECVA 4JRQA 1RTJB 1SUQA 2WHOA 3OHAA 1RBVA 4DL6A 2XY5A 4ED0A 4K4UA 4PY5A 1NK8A 1JL1A 5HROB 1RTIA 3NGDA 1RBTA 2C2RA 2JC1A 3AVKA 3T5JA 2D0AA 2VWJA 3L8BA 5J2PA 2OA8A 4B08A 3NBPA 1GOCA 4ELTA 3MECB 4AHSA 4AH9A 1TK5A 3OYMA 4DQPA 1RT3B 5KFKA 1C1CB 1CZBA 2F8EX 3PHEA 4ED8A 4ECRA 1JLBA 4Z4HA 2FLLA 3PX0A 4G1QB 3LDSA 1WSIA 4R5PB 4BE2A 4IDKA 1TK0A 4HVJA 3AVBA 3D45A 4XO0A 3BDPA 3V9WA 2HMIA 1KRPA 1HPZB 2VA2A 4RW4A 1T94A 1TKZA 3CJ3A 3OLBA 3OL9A 3NMAA 4I9QA 2HW3A 2YKNB 1S4FA 1S49A 1XWLA 3LWMA 4URGA 3KJVB 4O3RA 4L8RB 3DOLB 2BQ3A 5HRRA 2HNYA 4O3QA 4NLDA 4MFBB 1S6PB 5EDWA 2OPRB 1ZTWA 3LPUA 3VQ9A 3DLKA 4WZQA 4IFVB 1TKTB 2IMWP 3V1OA 3WNGA 3KLHA 5SWMA 3SUQA 1SH0A 3RB3A 4CJ5A 3PJWA 3P5JA 4RNFA 4IBNA 5J2NB 1X1PA 4CEZA 1IKXB 1LWFB 2R2RA 4NLXA 2YNHB 3KTQA 3IGNA 4Y2AA 4Z4EA 1EKEA 2DFHA 5KRSA 1HNIA 4M3RA 2QV6A 2R8HA 1RTHA 2D41A 3HXMA 5JXSA 3GYNA 2Z1HA 3KLFB 4Y1CA 4EO6A 3SI8A 2WONA 4OVLA 2ASDA 2JEFA 4EP5A 1REVA 4MK7A 4J9NA 3VA0A 4F2RA 3M8PB 4TY9A 2HHUA 4ID1A 3G6YA 3CQ8A 2XGPA 2IAJA 2XGQA 5L9XA 3I5CA 2O4GA 4ZP9A 1WAJA 4ECZA 1ZTTA 2W42A 4FJ9A 4R5PA 3QERA 4U7CA 4EP4A 4WFXA 3PW5A 4CIFA 1S1VB 4IG0A 1SH2A 3WNEA 2HNZB 2XWYA 3MFIA 3H4DA 4I7FB 4WZMA 2JEJA 2KW4A 4Q5VA 4B3OB 1XHZA 5SZTA 2UUTA 1ZBLA 3OJUA 3TAFA 4CF9A 3PVXA 4KTQA 3BSNA 4CFAA 4FLXA 3VQDA 3DYAB 4ZMMA 1RDRA 3I0SB 3S3OA 3GV8B 2DFFA 2F96A 3RRHA 1C1BB 3G10A 3GV7B 1JLAB 3IRXB 1B9DA 2DPJA 4W5TA 3PY8A 5KFYA 2R8KA 2DY4A 4ECWA 3AVGA 3DLHA 1Z26A 5KG5A 3H4BA 4EBCA 1TP7A 5L1JA 3H5XA 1IKVA 2IC3B 2IJFA 3PUFA 4FK0A 3LALA 1ASUA 5EU7A 3C6TB 3DRSA 1C6VA 1WN7A 3GV5B 3OVNA 3T1AA 3OYAA 3V6DB 3TQ1A 3TAQA 3B6OA 1HNVA 5KFFA 3FDSA 2OPRA 4M94A 4F50A 1S48A 4CJVA 1HMVB 1IKYB 3OHBA 4NYZA 2ASJA 1JLGA 4CF1A 1N5YB 1JKHB 3C6UB 4N47A 4NCGA 3DOKB 1DTQB 3ZCMA 4W5QA 2HMIB 4IR1A 3BR9A 3Q8SB 4GVMA 4CF0A 4DF4A 4AHVA 2XI2A 3TANA 2IJNA 5JS2A 2BANA 2B43A 1IKWA 3M8RA 3VQSA 4DF8A 2WCXA 5I3UA 1Z4UA 2D3UA 2YNGB 3D0PA 4JS4A 3CO9A 3C6TA 3DRSB 3ISNC 2RKIB 4FS1A 4WXWA 1IKVB 1HYVA 4FJ5A 1S1UA 1ZBUA 1QSSA 2YHBA 3LP2A 4CJSA 1ZBHA 4J9MA 4KHWA 1RCHA 4TYAA 4ECTA 5KT6A 2X6NA 4TY8B 4E7JA 3IGVA 1RTIB 5L1LA 1TVRA 1UAXA 3ALYA 5J2QB 4OJRA 3SQ2A 1R0AB 2E4LA 2VG6A 4TSXA 1SKSA 2V9WA 4DG1A 4O3NA 5KFRA 1HQUA 2OPSB 4CHOA 4E1NA 2IGIA 1SV5B 3I0SA 1N4LA 1C0MA 5KG0A 1TV6A 1XI1A 4I9LA 1EXQA 2J6UA 3F73A 4LSNA 4DL3A 3KD1E 4M3YA 4J9QA 3OYBA 4DG1B 3HK2A 1K1QA 3QGGA 2F8SA 3QLHB 3VQPA 1HQEB 1HYSB 2O4IA 1NJWA 3SFGA 4CE9A 5KG7A 2RPIA 3KHRA 4B3OA 3V81A 1U09A 4R8UB 2ALZA 3LP2B 2HNZA 2XC9A 4RW7A 4CJFA 4ECUA 3OYJA 4IQXA 3MXJA 3DLEA 4KV8A 3FQKA 3VQCA 4JV1A 4ID5A 4EYHB 4CGGA 1HRHA 4DLEA 3V6HA 3AVLA 4DSEA 4FLZA 3S9HA 1IKWB 4LSNB 3GIIA 4DS5A 4Y34A 4RNHA 3TARA 2RF2A 3DRRB 1BCOA 1DTTB 1A5VA 4URQU 2GIQA 1TKXA 4MKAA 2ILZA 4NCGB 1RTHB 1VK0A 1HQUB 2V4QA 1RT7A 3V9ZA 1TQLA 3K2PA 2HHTA 5DQHA 5C25B 1VSEA 3OJSA 4FJJA 3MR6A 2KQ2A 5KT2A 1J5OA 1VSIA 1T8EA 5J2QA 4URSA 3O3FA 4QPXA 1OS5A 1TL1B 4KHRA 1L3SA 3MEDA 3LP1A 4KFBA 4CFCA 4DSIA 2D3ZA 1S1UB 2YNIA 4IR9A 2IBKA 2C2DA 3P1GA 4F3TA 1JX4A 3VQBA 3PO4A 4O5BA 1Y97A 3RMAA 4HHTA 2EHGA 2P5OA 2PYLA 4DQQA 5DLGA 2HHQA 3GILA 4PWDB 3TAPA 4IG3A 3IG1B 4LY7A 2X6SA 4DTPA 4ZVGA 4K8XA 4RU9A 5D3GA 4NLUA 2E6LA 2YKMB 4F3OA 4K4TA 3DOKA 4RNOA 3AA5X 2HB5A 4FJLA 5EWFA 2FVSA 4H4MB 2GV9A 3TABA 4IH7A 4Z4GA 3T5LA 3KK3B 3OLAA 2PZSA 3ZT2A 3DI6B 4RW7B 1BISA 1JLCA 3HYFA 2FBXA 3HHKA 2OPPA 4FK4A 3V81B 4FS2A 1EP4B 5KGXA 4KB7A 2IM1A 3NGIA 3EZ5A 3NFAA 3QEVA 1HYSA 4K50A 3I5AA 3CIZA 1XR5A 4ZTJA 3KK2B 3KK1A 4EZ6A 5DMRA 1N56A 3DLRA 4DMNA 1KFSA 4H4OA 4J2EA 3PW4A 1KLMB 1ZBFA 5DQGA 3GIKA 4K4SA 4DLGA 4DFJA 4Q0BB 5KFOA 1KTQA 4YQWA 1D1UA 3QNOA 4TQRA 4RZRA 5KG4A 3MXIA 4CIGA 4CEAA 1FK9A 2OPSA 2FVRA 4ZPAA 1U49A 3T3FA 1ASWA 3K5NA 3H5SA 2ASLA 5KFSA 1TAQA 1G15A 5EUHA 2WONB 3Q8QB 1JXBA 4IG3B 1A5XA 4IRCA 4I2PA 1RTDA 3L2QA 2ZQBA 3CFOA 3HVAA 4KHMA 3O4QA 2OYQA 4BE1A 4E7LA 4CJUA 3EPIA 2FJVA 3V4IB 3CYMA 1IM4A 3SV4A 4J9LA 4ED1A 4KHUA 3SCXA 1BI4A 2VG5B 3PR4A 1RILA 4MH8A 4TYBA 4IH5A 4RNMA 5F8GA 3QEPA 3KLEB 3LWLA 1L3UA 4B9MA 3DDKA 3I0RA 5C24A 4CGDA 1S1XA 2UVWA 3CG7A 3BREA 1EX4A 1LAVA 4FK2A 3NAIA 1N5YA 3V6KA 2WOMB 3N6NA 4CESA 3PX6A 2RF2B 3TAGA 4CEEA 1QTMA 2XCAA 1W25A 3AVFA 1U04A 3NF7A 2JLEA 3T5HA 3BQ1A 3VN5A 4E89A 1IG9A 4WYLA 4CEOA 1TKDA 4WYWA 3NL0A 3TWHA 3NCIA 2R2TA 4QWDA 4RNNA 4KHNA 2A1RA 3MFHA 4PQUB 3E51A 3H98A 3AVMA 3FRZA 2YNHA 1L3TA 1CXUA 4IFYA 5CYMA 1NNDA 4M3XA 5J2NA 5I42A 1LW2B 5KFAA 1HQEA 2E9ZA 2ZD1A 2I5JB 4BDPA 4FXDA 4FM0A 4RW6A 1QAJA 1IH7A 3FFIA 3SPZA 2BE2A 2WK4A 1CXQA 2IDOA 1YTAA 3OL8A 2UUWA 4O4RA 1KVCA 1N48A 3UR0A 3HP9A 1DTTA 4I2PB 4CGIA 1TV6B 1S97A 4WFZA 4KE5A 4LSLB 3UPFA 2HNYB 3SQ1A 5J1EA 3SUOA 1IO2A 4ECYA 4NLPA 4FJIA 3BSCA 3QGIA 1RT4B 3AO2A 2FLPA 4WE1A 2QKKA 3CWJA 3AO4A 3IS9B 2C2EA 3I0RB 4C8NA 3LZIA 1R0AA 5KFWA 4ZP7A 1BQMA 3K5MA 2E9TA 4FJGA 4G1QA 3Q8PB 1YVUA 4Y1DA 5KRTA 4ZVFA 1KVAA 2RKIA 4CJKA 3O3GA 4FM2A 1T05B 4B9TA 3G6XA 3CDUA 2YV0X 2Z1JA 3G86A 1HARA 1QS4A 3ZT4A 4OLBA 3SV3A 5L1KA 4K4YA 2Z1GA 5HROA 1JIHA 3LZJA 3HVRA 4F4KA 4J2AA 1RT1A 2NUBA 3H2LA 1WSGA 3OSPA 3K5OA 5KFVA 2R8GA 2BQUA 4OKJA 1S1TB 1C0TA 4ZHRB 3OSNA 1NK6A 3NAHA 4K8ZA 1IKYA 4TXSA 3L3UA 1T7PA 1J54A 4KTZA 1YTUA 3QEIA 1RT5A 1N6QB 2UVRA 2P1JA 1TVRB 1RT6A 1TL3A 4F8RA 4FCYA 1QE1B 1WSFA 4RUAA 1TAUA 2B6AB 3NGYA 4HCBA 3HP6A 4F4ZA 3NHGA 1Q9YA 3LPTA 4CJPA 3KHLA 3DLGB 4QWBA 3V9UA 4E7IA 1JXEA 3L2RA 3RRGA 5I42B 1BIZA 5JUMA 3H5YA 2RDJA 3LP1B 4KFBB 4DSFA 4LH5A 5KG3A 2HWIA 4DQRA 4EBEA 3EYZA 1BHLA 1RDBA 1MU2A 2FBYA 4J9OA 3V9XA 1SL2A 4O44B 1C0UB 2D0BA 1FKOA 5HBMB 4OGEA 1NJYA 5C25A 1U48A 3HVWA 3DRPB 1RT7B 3KLVA 5KFGA 5K14A 5DQIA 4OLAA 2KFNA 5HP1B 3KOAA 1CLQA 3HPGA 2UVVA 4DU1A 1RDAA 4NZ0A 4CEBA 3DYAA 2QK9A 2P5GA 4QAGA 4PWDA 4K4VA 4AHCA 1VSHA 4CHZA 3IN5A 5KFCA 3ZSZA 5HLFB 4N5SA 3OYKA 2GBZA 3T19A 4KV8B 4FLUA 3V1RA 5KT4A 4GW6A 4I7FA 3CM5A 4E0DA 2HHWA 3AA4A 5F8IA 1NKCA 3PO5A 3FSIA 3WNHA 3QNNA 2B4JA 2G8VA 5T14A 4W5OA 1N6QA 4CJ3A 3RMCA 3RAQA 4CHPA 4DU3A 1U47A 1RTJA 1SUQB 3MR2A 4LD0A 3IRXA 1X9WA 1REVB 3HSTB 4QWAA 1WLJA 2BGGA 4FJMA 2AU0A 4ZP6A 1LWCB 4JLHA 4DWIA 4AHUA 4KB1A 1LWCA 3M8QB 3KHHA 3AO1A 1RA6A 2KZZA 2HHXA 4ECSA 1S0OA 1SV5A 1T03A 1XR6A 4ZP8A 4O3SA 4MQ3A 3ZSXA 1FK9B 2EX3A 2XI3A 3KLGB 2OPQA 4AILC 3KIOA 3CJ5A 1T05A 4HKQA 1VSMA 1IKXA 1LWFA 2FC0A 1KLMA 3ZSQA 4AHRA 4CHQA 4Z4FA 2HAIA 5CYMB 3OL7A 4OKKA 1B92A 3I5BA 3HPHA 3PX4A 4EO8A 4NLQA 4O0IA 3QETA 4JRPA 1ITGA 4O3PA 4XPEA 3PZPA 4NLVA 4QOZB 1ZETA 4M3UA 4Q8EA 3BGRB 4B9SA 3M8PA 3GQCA 4CECA 3QINA 1RT4A 1S6QB 2ETJA 2W9BB 3VQ6A 3HT3A 2AX1A 4FLTA 3QESA 3OYIA 1RBUA 5KT3A 3RBDA 4JUZA 3JSMB 3HO1A 3BSAA 3ZT1A 4HTUA 2IM2A 1RYRA 3H59A 1NOZA 2UVUA 1ZBIA 4O55A 4Q44A 1DLOA 2BE2B 3RAXA 4QWEA 3C6UA 1UWBB 4M3WA 1WNEA 4FBUA 3VQAA 4EZ9A 2ZE2A 5HBMA 4RW6B 3UQSA 3RB4A 2E6MA 1L5UA 5KG6A 4O44A 3IG1A 1RDCA 4FJXA 1FKOB 3QGHA 3MEGA 1SKRA 3AO3A 4CEFA 1BCMA 2Y1JA 5KFEA 3TI0A 5CYQB 1TGOA 2E9RX 4ED3A 1QHTA 2GUIA 2YHAA 4CHYA 3L2WA 5KFJA 3NBPB 2RDIA 2W8LA 3L2VA 3NAEA 3ZT3A 2B6AA 4KI4A 5CYQA 3H5UA 2OH2A 3DLKB 1U4BA 3HL8A 1TL1A 2FBTA 4FJHA 3NGZA 1RT6B 3MEEA 4BWMA 1QE1A 3TVKA 5CZ1A 4OKEA 4CFBA 5HRNA 3DOLA 2WB4A 3AV9A 2P51A 1LAWA 4JV0A 3AA3A 1D5AA 1JLAA 2ATLA 3KD5E 4FM1A 1HPZA 3VQ8A 3S3MA 5C24B 3CVKA 1YT3A 1BQNB 1JLGB 3ZSYA 3ZSRA 3DRRA 5DGBA 4FJ8A 3RTVA 4DTNA 3KLEA 4B8CA 2FVPA 3AVAA 4YR2A 3F9KA 3QZ7A 1VRTA 3CFPA 4CJWA 1S6QA 1JLBB 2XO7A 5KFHA 2X78A 5CZ2A 3KK2A 3QIPB 3AO5A 4F2SA 4YFUA 5KFZA 2XY6A 4QWCA 2XCPA 5T7BA 1D9DA 1CZ9A 3RR8A 3BSOA 1K6YA 3QIPA 4F4WA 3V6JA 4DL7A 5HRPA 3HPOA 3ITHA 1VRTB 3TAMB 4KHQA 1EETA 4CK2A 4G3IA 2B5JB 4KPYA 4WE1B 4H4MA 4DTMA 3IS9A 3PW0A 2IAJB 2J6TA 4UQGA 4CGHA 4HUEA 3CM6A 2AJQA 3EPGA 2C28A 1W9HA 4NCBA 4R0EA 4LSLA 2ATQA 2V0NA 2V4RA 2ITGA 4BACA 1QQCA 4MIAA 5KFUA 1I3AA 2FVQA 1NK5A 2AX0A 3RMDA 4KI6A 2G8IA 1UOCA 2JGUA 4HYKA 2Y1IA 2A1SA 4E19A 1GX5A 3OS2A 3KKSA 1NKBA 1S9GB 1JLQB 3QIOA 1T3NA 2OZMA 5KFMA 3EY1A 4N41A 1NK4A 2HHVA 2ZD1B 2WTFA 3LP3A 4HUGA 4ECXA 3AA2A 2IM3A 4CF8A 3FQLA 4DQIA 1JLCB 5FDLA 2QE5A 3KMSA 2BQRA 4M41A 4NLYA 4PQUA 4KSEB 3RWUA 4DTUA 2HVHA 4M3TA 3KK3A 4FJKA 2QKBA 3M9MB 1TKTA 4HUFA 4OPJA 3HVTA 4CFDA 4YP3A 3Q8RB 2G8KA 1TKXB 3M9NB 3GIMA 1KLNA 2HHSA 1GOAA 4Q43A 2VA3A 3SUPA 3AVIA 1Q9XA 2W9CB 1HYZA 2HWHA 4DTJA 4CJEA 2D5RA 4PUOA 4IKAA 1ZYQA 4CF2A 3KLIB 4NLWA 3OYFA 3NDKA 4CERA 5K14B 1VSJA 4C8LA 2D7SA 4ED6A 3BJYA 1C1AA 2FLNA 4CJ4A 3LANA 5KG2A 4FBTA 2PYJA 4ECQA 4B9NA 2KTQA 3DM2B 4NLTA 1MU2B 4RG8A 1S1WA 1UA1A 3PR5B 4O3OA 2AGOA 1WSJA 2AGPA 3V6DA 2VWKA 3THVA 1O1WA 3AVJA 1HJRA 3NE6A 3H08A 4MK8A 4NYFA 4XIUA 2XY7A 3QLHA 3V4IA 5KG1A 4RW8B 3KLGA 4IFVA 4FZZA 1S9GA 5F9NA 2VG7A 3ULDA 4CK3A 4HCCA 5DLFA 4B8AB 2D0CA 4BWJA 2CJQA 1S1TA 4JV2A 3DMJB 4CCHA 1VSKA 3E01A 3KKRA 4Q0BA 3N6MA 1I39A 2B5JA 3PW2A 4FLWA 2R8JA 2IS3A 1KCFA 4M42A 2OZSA 4IDKB 1LW0B 2W7OA 3B6PA 5F8LA 1EETB 5DK5A 4W5NA 4AHTA 3L3VA 3OYGA 1D8YA 3RB0A 1BGXT 4YMEA 3MXMA 1JL2A 4NRTA 3OYEA 2YNFA 4J9KA 1RT3A 5HLFA 4MIBA 5I3UB 4IRKA 4FJ7A 4CHNA 3DI6A 1QUVA 2BANB 4TQSA 3GIJA 3WNFA 4OL8A 3D5MA 4KHSA 1JXLA 4B9VA 1S9EA 3NH1A 3QO9B 1YVFA 3V9SA 2WRMA 2ILYA 3L2UA 4B9UA 1VRUB 4M45A 4O4GA 5HP1A 1WSHA 5D3GB 4ED7A 2YKMA 2R2SA 3LP0A 3MEEB 4TN2A 5KFQA 2W7PA 4GMJB 4IRDA 3K58A 4XPCA 3CDWA 3I8DA 2HNDB 4BDYA 1Q8IA 2QXFA 4OGCA 2IC3A 5KFIA 3P83D 4W5RA 3SPYA 2ZKUA 1JLFB 4I2QB 4GC6A 3OY9A 3MEDB 2R2UA 5FDLB 2DPIA 4CEQA 4Y3CA 3A2FA 1FKPA 3PV8A 1WSEA 1S1WB 4ZPDA 4NLSA 2XHBA 3NH2A 5KFTA 1J53A 5KT5A 3AVNA 1RBSA 4DEZA 3KLHB 3VQ7A 3ZSWA 3H40A 3NF9A 1A5WA 1DTQA 4DFKA 4F4XA 3HJFA 1SKWA 1DLOB 5KT7A 1VRUA 1S6PA 4EYIB 4DSJA 5KFXA 4J9PA 2R7YA 1SL1A 4C8MA 3QO9A 5J2MB 3BQ2A 1BIUA 4FZXC 2W9BA 4LQ9A 1HNVB 1S1XB 3HVTB 4C8KA 4FLVA 3KMQA 4Q8FA 2IA6A 4FLYA 4ID5B 4ELUA 2YNFB 3AVCA 2FBVA 3O4NA 5C42A 4JS5A 3NF8A 4KHYA 4R8UA 1NK9A 4LQ3A 1BI4B 4FVMA 4KO0B 5F8MA 1BQMB 3V1QA 4NRUA 1C1CA 4IH6A 2DFEA 3KNAA 5F8NA 4RUCA 4J2BA 3MECA 4ICLA 4H8KA 2OPQB 1NJZA 5F8HA 4EEYA 1J9AA 4ZVEA 5HRSA 2FJXA 4FW2A 5KFLA 2AGQA 1T03B 4WXOA 3RR7A 1MMLA 3OYHA 5J2MA 5KFNA 1U45A 1RT2B 4NLGA 1RTDB 2AQ4A 2BRKA 4ELVA 1RAJA 2GC8A 3M8QA 5KFPA 4N56A 2J6SA 4LH4A 3HKWA 4CIEA 3OYCA 4E7KA 4CK1A 3FFIB 1HNIB 1W0HA 1NK7A 3QZ8A 4WFYA 3SYZA 3VQEA 3S3NA 3AVHA 2LSNA 4DFMA 4NCAA 2I5JA 2BR0A 3MF5A 4Y2CA 3U3YA 5DG7A 2IOCA 1LWEB 4FYDA 4TY8A 3TAMA 4KREA 4DQSA 4H54A 4MK9A 1QSLA 3RBEA 3KK1B 1JLFA 4I2QA 1SH3A 5KGWA 4DTSA 4J2DA 4DL2A 4TLRA 3SNNA 4E7HA 4CJLA 1FXXA 4ZTFA 2X74A 4DS4A 1KSPA 1KHVA 4ZVHA 3MR5A 1EP4A 3U3GA 2YNGA 2OPPB 5EWGA 3CDEA 2PY5A 4KAIA 4J9RA 3TR8A 3TAEA 3LP0B 1Z25A 1WAFA 3OS0A 3ICLA 2GIRA 5DG9A 2WOMA 4M95A 1JLEA 4ZPBA 4Z4CA 5C5JA 3MR3A 3JYTB 1JKHA 2BRLA 4ED2A 3DRPA 1QAIA 3VQQA 3QEXA 2Q3SA 1JLEB 3OYDA 4QW8A 3IAYA 1C0UA 2F8TA 5JS1A 3CJ0A 3N6LA 1RDDA 2G8FA 1NK0A 5DG8A 3CFRA 3BQ0A 4N76A 5FRMA 3BGRA 2RN2A 4BE0A 4CEDA 4DU4A 3DLGA 4YR0A 3MTKA 4K4XA 4CJTA 3VA3A 4KBIA 1ASVA 2KZMA 5E41A 1NHUA 4KB0A 5EWEA 3C95A 1NKEA 1RT5B 1J5OB 5KI6A 4M3ZA 3MEGB 3OS1A 1TL3B 3ASMA 1BL3A 2HVIA 1X9SA 3CJ2A 3E01B 5DGAA 4CJQA 3MAQA 3SJJA 1QSYA 2KFZA 1UWBA 1NHVA 1C0TB 3SQ0A 4DSKA 4BDZA 3NH0A 4K4WA 4E3SA 1RNHA 4RW4B 3O3HA 3JYTA 4KTWA 1C1BA 1XC9A 2BDPA 2Z1IA 1X9MA 1XHXA 1S9EB 4DSLA 3UIQA 3SZ2A 3ZT0A 1RT2A 3LAMA 2VG7B 3ITHB 4KKOA 3QYYA 3G6VA 4FJNA 4H4OB 3QEWA 5FRNA 1KFDA 1GOBA 2G8HA 2JEIA 4Z0UA 1S5JA 4K4ZA 4CGFA 3SI6A 2G8WA 2W8KA 3SUNA 1NJXA 4IOBA 4C8OA 4CGJA 2G8UA 1S1VA 4IG0B 4E1MA 4Q45A 1B9FA 2DTUA 4OPKA 2JEGA 1I6JA 1LWEA 4NLRA 3ZSOA 3LAKA 1SL0A 4YNQA 4KKOB 3DMJA 3PJXA 3RMBA 1VSDA 3ISND 3D28A 1D9FA 4DL5A 2JC0A 4Z4IA 4J9SA 1VSLA 3UDLA 1VSFA 5J1EB 1S0NA 4DTOA 4RW9B 3K5LA 1NOYA 3ZSVA 1S0MA 1D0EA 3KLFA 3VQ5A 3EZUA 2I1RA 1S10A 4NYNA 4RW8A 4PA1A 1XR7A 4ICLB 2VG6B 5KFDA 4IKFA 2YNIB 2AWZA 1LW2A 4KO0A 3PW7A 1FKPB 4MKBA 3M8SA 3DLBA 4IFYB 2C22A 3DM2A 5C42B 3K59A 3NKYA 1GX6A 1F21A 3SQ4A 5KFBA 2IM0A 2HNDA 2ZE2B 5L1IA 2XRIA 4FW1A 1RBRA 3KLIA 4F4YA 4PUOB 1KHWA 3CJ4A 4KRFA 3C94A 2W9CA 4DTRA 4MFBA 2CKWA 5F9LA 2FJWA 3M9OB 3SFUA 5FROA 5KTQA 3JSMA 3KJVA 1CSJA 3T5KA 2YKNA 1LV5A 4ZPCA 1TKZB 4NLOA 1S9FA 3DLEB 1RT1B 4QCLA 4CJRA 3U6FA 1HMVA 3G0ZA 3QIDA 1KVBA 4DFPA 4KAZA 4O0JA 2FVCA 3OYNA 1WNSA 1L3VA 2O5DA 2VG5A 4B9LA 1UA0A 4X2BA 3OYLA 1RA7A 4YR3A 3NF6A 3RB6A 1RYSA 3OL6A 1JLQA 1TK8A 5J2PB 2W9AA 3HM9A 1C2PA 4FZYA 4EBDA 4DTXA 1K1SA 5F8JA 3K57A 4QW9A 5CY4A 2XY8A 1LW0A
chains in the Genus database with same CATH superfamily
2RNEA 3KHGA 1HFEL 2C1EB 3HCXA 5ETQA 1U7LA 5B0FA 5LSOA 4U6PA 3VOVA 2HFZA 4DL4A 5E3CA 3DKDA 3JTOA 2BJ1A 2EC0A 3PYFA 3ULHA 5M1OA 1UFKA 5ETNA 4JRQA 3QFUA 2OEKA 4IEEA 2MHEA 1NK8A 1JL1A 2AIRB 1RTIA 2E5JA 2C2RA 3AVKA 2D0AA 3R1LA 2V4JB 3BGLA 1WC3A 2C3OA 2DBBA 3G8QA 3NBPA 3N79A 6FD1A 4B3MF 1GOCA 5JLHA 2V8DA 1TK5A 2N3OA 3WXMB 4A8FA 2F8EX 3SMPA 4JYAJ 4CH7A 5JLFA 1QLNA 5AE2A 2EEYA 1LK5A 4Z4HA 1S72N 4KYZA 3EWGA 4B3RF 4HTLA 3VAJA 2GVZB 5B0BA 5AJ3F 4AL7A 3D45A 3V9WA 5IXUA 1KRPA 2BACA 2LXFA 3VESA 1T94A 4UTGA 3OL9A 4DI6A 5AT1B 1J5EJ 1VQMS 3B6BA 3W5ZA 4L8RB 4BR4A 5HRRA 1QTNB 3R2CJ 4CBUA 4NLDA 4ID8A 1VMBA 2HRUA 2OPRB 1RHQB 3B8AX 3BKTA 2DNPA 1QZ5A 3X1LB 1FA0A 2IDLA 1H6KX 4FKXA 4LIRA 4IFVB 4DR7F 5SWMA 1SH0A 2EK6A 4JI1J 1H74A 3PJWA 1FD8A 3P5JA 5H1SV 4RNFA 4IBNA 3PFOA 5J2NB 2GJIA 1LWFB 2FXUA 3CI5A 3NMRA 1NHKL 2HK2A 3L7OA 3A8EA 4B1VA 3KTQA 3HHNB 3IGNA 2ZUGA 3WQPA 3D1OA 2BM0A 2HS0A 2VPZB 2E5LF 2FY8A 5HL7L 5GAEI 1HNIA 2R8HA 2MQQA 4JI5K 3MPYA 2P9KA 2Z1HA 3WEEB 4K0KJ 4CT8A 2OTJN 4EO6A 1IBKK 3SI8A 2LCWA 2XS5A 3EZWA 1REVA 1YHQS 2IYGA 2PA8D 2SXLA 4F2RA 3VA0A 2DNLA 3A3OB 1EQ0A 4L75A 5TKWA 3GE1A 2QG9B 2YTCA 1DKGD 4BLGA 3UFCX 4ZP9A 2QTWA 1K8KA 1ZTTA 3P8BB 4X62J 4FJ9A 3QERA 4U7CA 2XZTB 3OR2A 3VVTA 3QQCD 4CIFA 1FRJA 1SH2A 1Z2ZA 2XO6A 4DR5F 1SQKA 3D6TB 2QFIA 1U1PA 1FKAF 4I7FB 2K3KA 2YQ1A 1NJIT 3EVMA 2EFNA 3MMCA 1KS2A 4P75A 4PXDA 3PLAA 4PG5A 4GY2B 2F4VF 1ZBLA 4A8WA 5FPEA 5IQQA 2JFKA 1XIQA 2V51B 3BN4A 3H8YA 2C2ZB 1QUPA 4KTQA 3BSNA 4EGLA 3PIPL 3VQDA 4ZMMA 1G3OA 2V2KA 5LJ5Y 3S3OA 2F96A 1AUDA 2AKWB 4H0OA 3V5RA 1GLDG 3C7NB 1WC4A 3CMAN 5KFYA 2R8KA 2DY4A 2KKHA 1NMNA 2BH1A 3UVJA 3H4BA 3CJ8A 3S41A 3MAAA 1TP7A 2H4WB 3CPWM 4YOTA 4EHUA 1CJTA 2BKNA 3H1VX 3PUFA 3LALA 1ASUA 4JKFA 5AQGA 3T1AA 2DIUA 1IBMJ 3QBWA 1HNZJ 7AT1B 4JD2B 1HNVA 5E84A 1D8ZA 1H2TZ 3JB9k 4M94A 1U8SA 4HT7A 3IKMA 1MDUB 3AAQA 4NYZA 4WCEQ 1JKHB 1MLAA 4JV5J 3IBFB 4U67L 2E1RA 4N47A 1RAGB 4NCGA 2X1FA 3NG8A 3BR9A 1K9MT 3ZEUB 4AHVA 3HF5A 2MZRA 4JD2A 2EBEA 4I4BA 3P5TL 3VQSA 2D3UA 2RE2A 2YNGB 2X7IA 4JS4A 1GAOA 3ZYYX 3QRPA 4HACA 4FS1A 2J9DA 4F04B 2M3DA 1HYVA 2DCUB 2M0GB 1S1UA 3ZZOA 2YHYA 3LP2A 1U0HB 2E7XA 3AGRA 5KT6A 3K89A 3IGVA 1KD1T 2XMUA 3ENHA 1I1GA 5AQOA 1ZAWA 2XS2A 2VG6A 1TUGB 1NB7A 4TSXA 4IUFA 2V9WA 3OPKA 1UFLA 5TKYA 5KFRA 1UJ6A 1VR6A 3ZXWA 4DN0A 2APOA 3DDIA 3TA2A 5AQRA 1N4LA 1SI9A 1C0MA 3TSPA 3R5DA 3T9NA 1TUVA 1X4DA 1SC6A 2J6UA 3DRXA 3MM6A 3BP8A 4P9SA 4D3GA 4M63C 4PWUA 1N33F 2OD6A 1K1QA 6AT1B 5AQLA 3P31A 1GMUA 3MM9A 5AQSA 2ALZA 2VU5A 4ZLNA 3SBMA 2B8PA 2QT7A 5HMZA 3DLEA 4KV8A 3V6HA 2RSQA 1PYTA 5LSRA 3R97A 3SQGA 2R7TA 3TJ9A 4DS5A 3LDQA 1H73A 3G82B 3R6MA 2YX6A 4DPXA 3MI7X 3NS5A 4URQU 1URRA 2VFRA 1RLDA 1FX2A 2ILZA 4NCGB 5D77A 2NPFA 1TQLA 2VBXA 2CGLA 4NB4A 3OJSA 1QQNA 2KT5A 4QS8A 1VSIA 4URSA 4QPXA 3GYXB 4KHRA 4BRNA 4CFCA 2OKQA 2YNIA 4BVOA 1NM1A 3CCMS 1A7GE 4X4SA 4DCJB 3CXCR 1VQ9S 2IBKA 4DPTA 3CCEN 1Y97A 1A9NB 4HHTA 2P5OA 4DQQA 1EX8A 5DLGA 2FTRA 5K8OA 3TAPA 2DH9A 1Q81O 3IG1B 4K8XA 5D3GA 1IUJA 3KYLA 2LEPA 3ENQA 1PKUA 3QT6A 3DXSX 2GV9A 3TABA 1MMDA 1WHWA 1TU0B 3T5LA 4H0XB 4M7YA 1E6YB 3GJRB 1WF1A 1FDNA 2WBNA 3DI6B 2KG1A 4CO4A 4RW7B 1BISA 3HHKA 2OPPA 4FS2A 1UVMA 1NU4A 3CC7N 2E2NA 4V1Ak 3NFAA 1FDAA 2O66A 3KK1A 2P9CA 1N56A 2Q0RA 4J2EA 3TUPA 3BUZB 3PW4A 4K4SA 2VQEK 2E1ZA 5LT5A 4W98A 2CWXA 4WPAA 1JQGA 5KOWA 1JNRB 5FPDA 5GAHP 1FK9A 3FSYA 2OPSA 4JI3K 4KGKA 1ASWA 3K5NA 3H5SA 4CLLA 5KFSA 1G15A 1KVKA 4J8FA 2WONB 4IO1A 1V6HA 1MROA 3WQTA 4I2PA 3FCVA 1RTDA 2BJDA 3BYRA 1FRXA 1SCJB 1IV0A 3W9IA 3V4IB 3MR7A 1VFJA 3UD3P 2ZWOA 4B1ZA 1IM4A 3T1YK 3TUZC 3ZNUA 4PAAA 5E2QA 3SCXA 1YIJN 1UWAA 3OVAA 1AUSL 3TYTA 1T6DA 3ZZPA 2WSFC 3OR2B 3ZZ0A 3K5PA 4NE9C 5HL7Q 2Z2ZA 4RNMA 5F8GA 3QEPA 1YJWN 3LWLA 1L3UA 4BRIA 1NGEA 3DDKA 1H3DA 4CGDA 2W6LA 1S1XA 2I7NA 1FRKA 3FCWA 4RLEA 1OH8A 3NAIA 1O13A 1W7AA 4YOEA 2ACYA 4ZA1A 3TAGA 4LF8F 4FXVA 4OX8A 1QTMA 2XCAA 1W25A 3T5HA 2CQ0A 4C7QA 3VN5A 4IFEA 5LMUF 1TKDA 2P5VA 4WYWA 3Q8UA 1UJ5A 3MN7A 4ZVUB 2A1RA 2O8FA 2ZUAA 3FRZA 3I31A 4IFYA 5DM6L 3MUVP 4LFAJ 2Z8QA 2AEJA 4P6QA 5I42A 2H4YB 1D4XA 1NGGA 2FZCB 1SQGA 2G0IA 1ZOTA 2CNNB 4FM0A 4RW6A 4LF6J 3Q24A 1IH7A 5BRDA 5GIOA 3SPZA 2WK4A 4OX9K 1IG8A 1I94K 4A5BA 2DR5A 4I2PB 1TV6B 2NYHA 3UPFA 5DRKA 2JDJA 2V7ZA 3OR1B 3SUOA 1GLEG 1RT4B 2UU9F 4DV6F 4L3NA 2QKKA 5M1KA 1K9MO 1J27A 1RU1A 3WT0A 3P4IA 3K5MA 4RBTA 1M90O 1EB0A 1YJVA 3WBZA 2DRAA 1YVUA 1YHQN 3DOMB 5ETKA 4Y1DA 5KRTA 4ZVFA 5C7PA 1DZ5A 3HZ6A 3O3GA 2RS2A 1YKWA 3Q7BA 3G6XA 2VJUA 3CDUA 3OBYA 4OZ5A 3CC2S 1VK8A 3ZT4A 3M6VA 4CO1A 4DUTA 2ZEJA 4ZVSB 4K4YA 1JIHA 3HVRA 1RT1A 3CW2C 3H2LA 4FPBA 1SAZA 2ZJQL 3K5OA 2QA1A 2BQUA 1S1TB 1HPMA 4NXNF 2R42A 3OSNA 2PBDA 3MMBA 3L3UA 1IBMK 1EHWA 4KTZA 4UOCA 5D0EA 2ASPA 1YTUA 4CZCA 3EL2A 2BM1A 5K8PA 3HFVA 3CQYA 4FL9A 3FEXB 5CZXA 2MQNA 3NY0A 1KQSR 3CJQA 3NHGA 1RAIB 2FHJA 3CMAS 5DM7Q 1NH8A 3V9UA 2A18A 3BEXA 3CJCA 5MAOA 2H48B 4YOVA 3CJKB 4LH5A 5AQHA 1WTFA 5KG3A 1T3OA 1HNXF 1U1KA 5K20B 1BUPA 4MKYA 2FBYA 2NUHA 5B0AA 2UXBK 4JI7J 4OYXA 1U26A 3G25A 4MLEA 2AA4A 1FKOA 1PC4A 5HBMB 4OGEA 2ZNYA 5C25A 4GRSA 4OZ0A 4XDDA 5HP1B 3KOAA 3ZX0A 5C0YA 2GQCA 5GAGU 4CEBA 2DHHA 3G82A 5BPLA 4PWDA 5C2GA 3D0GE 4IZ9A 1B64A 3TZZA 2K7KA 4KH0B 5DJBA 5KFCA 3ZSZA 2QMWA 4QYRA 4X84A 2MLXA 3IMQJ 3MCSA 4GW6A 4I7FA 3VALA 4CLKA 2VUGA 2HHWA 5F8IA 5AQNA 4OX7A 4X62K 2GGPA 4MAKA 3G71S 2ABYA 3A5MC 2IPOB 2VKRA 3QNNA 3NEKA 2G2ZA 2QWRA 4W5OA 1VQON 3RMCA 3VEZA 3T1HF 3IR6B 1I51B 2G1DA 2V8VA 1KQKA 2XLIA 5AQUA 3MR2A 3HD1A 5T7LB 1REVB 2VOOA 3GFYA 4A2AA 3MM6B 4TVAB 4QWAA 2BGGA 3SMZA 2ZNZA 4JLHA 2P9LA 2M52A 3W8GA 3GFHA 4DHYA 1RA6A 2KZZA 3WEEA 1XMBA 3GL1A 1S0OA 1SV5A 1XR6A 2HFVA 2P9IA 4O3SA 3AA8A 3VPZA 4JI4J 4AILC 2YVSA 1M5KC 4DUYF 1GXTA 1VSMA 4UW2A 1LWFA 1LOTB 1PYOB 3OL7A 4M7XA 4OKKA 1LXJA 2CQIA 4NLQA 4WFAQ 4C48A 1MSWD 4EFHA 2VDIA 2XZWA 3THTA 4QOZB 4X4RA 5MLCV 4M3UA 2PSZA 3M32A 3BGRB 4B9SA 2NXUA 1RT4A 3QESA 4KH1B 2KL8A 5KT3A 3JSMB 1WG5A 2HG4A 1R0BG 3HO1A 4KR0B 3BSAA 2AYBA 2A6OA 2IM2A 1GTHA 2OLWA 1ZBIA 4N77A 4O55A 1Q8BA 4GNIA 3J81j 3C6UA 3VQAA 2ZE2A 3UQSA 4YUDA 1RDCA 3QRRA 5E33A 1FKOB 4NYOA 2IIHA 3QGHA 3MEGA 5AZJA 4RUBA 4H5RA 4L72B 3AO3A 3TZYA 1BCMA 4CEFA 4IO9L 5D4OA 3BGOP 5IM0B 1NDCA 3L6QA 4DV5F 1TGOA 1KR4A 4CO2A 4EMDA 1FXDA 3GONA 3ATVA 5GMDA 5AE1A 2RDIA 1BHNA 5LXYA 2QWLA 2B6AA 5CYQA 2CA9A 2OH2A 3SIPB 2GELA 2PN6A 3GCXP 3ET6A 4FJHA 3VETA 4JKHA 2BW2A 3TVKA 2ROGA 4OKEA 4FDFA 2B7BB 3UKUB 1YUWA 4ETXA 1T02A 2WB4A 3AV9A 2DYAA 1B0TA 2AV5A 1D5AA 3R1XA 3H90A 4ZIWA 2DHGA 3KD5E 3ZTOA 4ZJOA 3VQ8A 3S3MA 1KTVA 3ZSYA 1JLGB 3DRRA 5AQFA 3RTVA 2X3DA 4DTNA 1YWXA 2FVPA 3F9KA 1VRTA 4KHPF 3H2VE 3JAMY 1HLUA 4FWPA 4NZ6A 4K25A 4GVLA 5KFZA 1KQSM 3LDOA 1XERA 4GMKA 4K2XA 1RAOA 1SIWB 3A1YG 1REGX 1C4CA 3B4MA 1EETA 3NS7B 2G9OA 4QS7A 2F40A 2A3ZA 4DTMA 2IAJB 3D2EB 5EOYA 2P9NB 3QBCA 3CM6A 4JKGA 3G6EN 2C28A 4J9UE 4NCBA 4OO1J 4LSLA 5AJ3K 1OSCA 3VZHA 3HI0A 2R7RA 4OJ3A 2FVQA 3RMDA 2YPYA 4DV7J 3T1HJ 3QMQA 3QAUA 1HBUB 2A1SA 3THWB 4LF5F 3CD6S 4OPAA 4QIGA 2EXUA 1SZ2A 3EY1A 4NEYA 1X4CA 1NK4A 2ZD1B 2HFSA 5L9NA 4ATNA 4HUGA 2BVZA 4B3MJ 2E5IA 1ZS6A 3BZCA 4CLFA 1LK7A 1KWMA 2GJ2A 3FJ2A 2LMIA 2QE5A 1WHVA 2BQRA 4KSEB 2BKOA 4YOXA 1NPKA 3C14B 3KK3A 4FJKA 2QKBA 3U4LA 2YHWA 4HUFA 2PGCA 4OPJA 2O67A 3QMLA 4UOGA 3KWMA 4IWVA 2EG1A 1Y10A 1TYQB 1Q9XA 2DNQA 3CE8A 1Q86O 1HYZA 4PUOA 2K1RB 4IKAA 1F2GA 3PEHA 4CF2A 2DY9A 2PFFB 3OYFA 3NDKA 1VSJA 1FJ7A 4ED6A 3BJYA 2L9NA 3O1BA 2E2OA 2B4VA 5KG2A 5K8NA 2PDAA 4OX9J 4B9NA 3OBIA 5JMNA 3M1FA 3PACA 3E66A 1X5SA 1UA1A 3PR5B 5ETLA 3MPUB 2AGOA 1YJNS 4CT9A 2W24A 2VWKA 1RU2A 2J0SD 3AVJA 4WQ4C 1MWKA 3NE6A 4XIUA 4PCQA 2XY7A 3QLHA 2CVEA 3DAWA 2GWKA 2QFJA 3KLGA 1WG4A 1R59O 2NZ4A 3RRKA 2FHJD 2FJEB 2NRTA 4U7UD 3THWA 2CWKA 5LJVA 3ULDA 3HZGA 5DLFA 2QMXA 1SJRA 4B8AB 3ILIA 3I96A 3MM5A 4BWJA 2OI2A 4MJKA 4KH4A 3VF6A 4USMA 4NXNK 4OJHA 2LQ8A 3CNQP 4OYBA 4CLYA 4JV2A 4CCHA 1BE4A 3ZO7A 4JI2K 3E01A 3HRGA 2F3JA 3Q22A 1I39A 2UUBJ 2B5JA 2HYIB 1ZBTA 4FLWA 1YJ9N 4I6AA 1KCFA 2OZSA 2W7OA 2D0PA 2KXFA 4AHTA 4EUVA 1JL2A 1EJ7L 4NRTA 3QB0A 1YF5L 1XN9A 3F56A 4BRAA 3QFPA 4TQSA 3WNFA 4PQAA 4OHXA 1IR1A 1JXLA 1XTZA 4PG7A 4DV3J 3KJFB 4BR2A 4J37A 4WFBQ 5DETA 2GO8A 1YJ7A 3J7YI 1YJ9S 3WHIA 2E1YA 3KWIA 3FKBA 1HI8A 3RW6A 2R2SA 1YAGA 1M0SA 2OJ3A 1Y5IB 4BRCA 4TN2A 3TTCA 2W7PA 4IRDA 2MY7A 2ZC4A 3K58A 1FF2A 3THYB 5CH7B 4CDIA 1Q8IA 3CCRS 8AT1B 4OGCA 2Q79A 2ZBCA 2R2UA 2DEIA 5B08A 3CQXA 2DNZA 3AHPA 3O80A 3IXQA 5D4NA 4N7TA 1S1WB 2XHBA 3C3LA 3NH2A 2MZ1A 4I67A 5KFTA 5KT5A 3AVNA 5FIIA 1PAEX 4DEZA 3VQ7A 5BJRA 2CQBA 3LGNA 4DFKA 3T6JA 4DR4K 1VRUA 1S6PA 2RQCA 2XYHB 6FDRA 4BR5A 4QQBA 1E3MA 2ZH6A 2G0CA 5J2MB 1BIUA 3M5RA 4FZXC 4LQ9A 3G9CA 1JCEA 1HR0K 4FLVA 1Y3JA 4X65J 4PHTX 1T9YA 3FE1A 4AQYF 2IA6A 4ID5B 3CJAA 1YI2S 2OSQA 4ELUA 2FBVA 3PIOL 3O4NA 1JWWA 4RR5A 3JTPA 4CWBA 4DR2J 2XYPB 3NF8A 2K7JA 4R8UA 3CCSN 3NNCA 3CJ9A 4NRUA 4IH6A 4JI0J 3CCVS 3FVYA 3WXKA 3LPYA 4ICLA 3ZTQA 3V2UC 4FW2A 5KFLA 2AGQA 1I94J 2KI2A 4ZJLA 3MTJA 1JJCB 2FGOA 3JS9A 2CGKA 2AQ4A 2BRKA 3CCUS 2WTUA 3W62A 3MPVA 4DOZA 1RAJA 2AJ0A 3CMES 3M8QA 5KFPA 2ZH9A 5E5NA 1HKBA 4NA1A 2VC0A 4CO0A 1YLXA 2L41A 3A13A 2J6SA 1Q5YA 4CIEA 1HHQA 1HNIB 4ZLLA 1MG7A 1XBWA 3S3NA 3AVHA 1FXRA 2ZGZA 2MKJA 2J9DE 5KPTA 4FYDA 1RACB 1FFGB 2HBRB 5ADXH 1FVQA 3C6AA 4F02A 4KREA 4DQSA 5GVQA 5IQ6A 4JI0K 3LDNA 2LDYA 1SH3A 5KGWA 4X65K 4J2DA 2R4FA 4DL2A 1S5ZA 1GT8A 2EBGA 4DS4A 2X74A 1KHVA 5E3RA 1K8KB 4O8UA 2Y0SD 3OFFA 3CDEA 2PY5A 3JQKA 4KAIA 3ZZTA 4J9RA 3O5TB 3LP0B 2E5LJ 1WAFA 3ICLA 4C0OC 2GIRA 5DG9A 2HAFA 2J7KA 5C5JA 1TL7B 3JYTB 1BWEA 1PIEA 1QAIA 4B3TK 2RHSB 3EEQA 3VQQA 1JLEB 4WU3A 3VAGA 2LEAA 2QLXA 2FZGB 3WC2A 4CTAB 3CJ1A 2CZ9A 1RDDA 3DXKA 3TEGA 1JB0C 4LC9B 1ZC6A 3WDOA 4Q7AA 3ILJA 4KGZB 2RN2A 4BE0A 2QL5B 2QRRA 2F5GA 3TTDA 4ZKAA 3VEYA 1UVNA 1JCFA 3ISZA 2F7VA 2RMLA 3K0SA 4C8YA 3PDNA 1VJQA 4FYYB 1ASVA 2KZMA 1NHUA 2P9PB 2MZSA 3KDOA 3MAAB 5EWEA 4QYZK 2YQ0A 1CJVB 1J5OB 3JXUA 3K2YA 2IIRA 3CJ2A 5DGAA 2W2MP 5L46A 2Y8WA 3OW2M 1UMJA 2ACMA 3NH0A 2CDRB 5GAHU 2JNJA 3O3HA 2OCEA 1UETA 4QU6A 2XQCA 2BDPA 2Z1IA 4DSLA 3ZT0A 1RT2A 3LAMA 2MB0B 2VG7B 3G6VA 4DR6F 5HQMA 1KFDA 2G8HA 2A41A 3U9DA 5CR4A 1XEZA 3LO3A 1YGYA 4CZEA 2O8CB 1Z05A 1S77D 3SUNA 3BZQA 4C8OA 4V19S 3DXBA 4IG0B 2CPJA 4E1MA 1B9FA 4JHDA 5JMVA 2DTUA 3FRYA 1TR0A 1LWEA 4LRCA 1RDUA 4UF4A 1LQ9A 2KLAA 1W26A 4BR7A 1WORA 4KT0C 1Z1ZA 2MGZA 1VSLA 4BQZA 1S0NA 3C65A 4EWTA 5D6GA 3EXYA 4NLBA 3NS6A 1S10A 2Y8YA 1WBBA 2FPHX 2N82B 2J9EA 4RW8A 5CD4H 1O6XA 3MMJA 1P90A 5KFDA 5CABA 3ZLJA 2YNIB 2AWZA 1NGIA 3AQOA 2UU9K 3ENBA 1U8WA 1FKPB 4CIOA 2R7WA 5K9FA 2ZH8A 3DM2A 5GAGP 1AZSA 1RBLA 1H1VA 2YHXA 5AZJB 2JLGA 2C3UA 1HWIA 2XWXA 4USUA 4WQ4A 5EHHA 3E9PA 2IM0A 4A48A 1RBRA 2D4WA 1F5AA 2DHAA 4CD3A 3W5YA 3CJ4A 1XNRJ 5K8MA 2W2PP 4KRFA 4LJMA 1K73T 4DTRA 2CKWA 4JI8K 5F9LA 2FJWA 2QTDA 3SFUA 5FROA 2JH3A 3JSMA 3PCOB 3K8WA 2RQMA 3PNIA 1NMEB 3D0IE 2HSEB 2GHVC 1QAYA 3O1LA 4CJRA 4CI0B 2IDEA 3G0ZA 3QIDA 3GZ7A 1L3VA 3G2XA 3FZFA 3DXMA 2HBJA 3GB0A 1W2IA 2AJ2A 2WBRA 1CS4A 4LFAF 2HPUA 3PYEA 3RB6A 1WOPA 2NSBA 3HM9A 1C2PA 4FZYA 3KG0A 3W61A 3VHQA 2LU1A 5D0GA 1GLJO 4DSJA 4RW9A 3HULA 1BY9A 3B54A 3RU0A 1MNEA 1AA1B 4PKHA 1QVGR 1UVIA 1KQFB 3UN3A 3Q0AA 4ILRA 2Z56B 1NO8A 3VQ4A 2ZHBA 3EGNA 3NRBA 2WHOA 1VJWA 3LGHA 1QZ6A 2DR6A 3PEJA 3CJRA 4L74A 1RBVA 2QWNA 1DHMA 1Q82T 4LRFA 3UE5A 4JI1K 1RBTA 5DDOC 2E20A 4KC5A 2F1FA 4B08A 1XC3A 4F25A 2BMBA 2F4VJ 3D1HA 4DR3J 2RD5C 2ZHOA 1QQMA 4OHYA 5KFKA 5LSLA 1C1CB 1VQ4S 1FTRA 1FJGJ 4JP8A 1CZBA 1HA1A 2GW8A 1JLBA 2FLLA 5THWA 4G1QB 5KPZA 1WTBA 1WWHA 4BE2A 3ZETA 1V5IB 4HHUA 5CZVA 1TK0A 1UPMB 4M5DB 4RW4A 4LF7F 3NMAA 4WJBA 5J1PA 3DC2A 2UUBK 3SJHA 4IOCL 1XWLA 2Q66A 3LWMA 4X4QA 2F63A 2BQ3A 2HNYA 3TJAA 9ATCB 3BO4A 4DUZF 4DV0K 3E1YA 1O8BA 3DLKA 4Y0WA 3V1OA 3WNGA 2IY5B 1VGYA 2Q3PA 2HFNA 4DR6J 4X4PA 4FWNA 4B3SF 5L39A 5F0XA 4XH5A 3GSDA 1IKXB 2R2RA 1X9JA 5FPMA 4F26A 2ZH7A 3SCIE 2ZBPA 2J8SA 2DFHA 2DNRA 2H9ZA 5KRSA 2B9YA 1RKJA 2Z57B 1T9TA 4LFBJ 2D41A 3TTFA 1X4HA 3UD4P 3HXMA 2I38A 5JXSA 1YJUA 4ZN3A 3KLFB 2UUAJ 1VQOS 3A8YA 4JAXA 2VQFK 2OEMA 2JEFA 4EP5A 5K5MA 1NSQA 4GV9A 3MWTA 3G6YA 4YORA 1U2FA 2XGQA 4BROA 2O4GA 2AJFE 1N0UA 3UCUP 4MMOA 3O9QA 4WBFA 4WFXA 2M8DB 3WNEA 1XMOK 2XMVA 1G6BA 3H4DA 3D2FA 2JEJA 2KW4A 4Q5VA 1XHZA 5SZTA 2UUTA 2KVIA 2Z0GA 3QT8A 3OJUA 3U1NA 4CF9A 1RCOB 1WI8A 3KG4A 1ZZNA 5B09A 3PVXA 4YB6A 5CXTA 3HSCA 5HQLA 3UW1A 3RRHA 3GV7B 5HOOA 2NRWA 1JLAB 2W01A 2N7CA 5EY4A 3GG4A 4DV0F 1FO1A 3PY8A 4LF8J 4ZVPB 1IR2A 4HTJA 2PC6A 3W3SA 1BDGA 5IS2A 4QJVA 2ZOGA 5KG5A 4EBCA 5KOXA 3RW7A 2P8IA 2IJFA 3ELHA 5DDPC 3C6TB 1RWOB 1WN7A 3GV5B 3OVNA 1HW8A 3TQ1A 3TAQA 3DXMB 2NRHA 3EGZA 1WSVA 2PO4A 3FCHA 1HBMA 2OPRA 3UE2A 4CJVA 4E8UA 1BWFO 2F9TA 5BN9A 5AQWA 1M1GA 2ASJA 1N5YB 5IWAK 2JOQA 4G6VB 1QVGM 2UZAA 4L76A 3DOKB 2HRYA 3ZCMA 2HMIB 4IR1A 2V8GA 3Q8SB 2FY1A 2MPUA 4CF0A 3TANA 5EXWA 2IJNA 2WVDA 4BHQA 1WG1A 2BANA 3M8RA 4DDFA 5H1SQ 4DF8A 1RGVA 3FBFA 5I3UA 2F8HA 2C2NA 4JYAF 2K8GA 3QSYB 3C19A 4JI8F 3NGUA 1LNQA 1MWYA 1T11A 2GWJA 2YHBA 4JI0F 1ZBHA 4KHWA 2DH8A 2X6NA 1QM9A 5J2QB 2DT9A 2XS7A 4OJRA 1U1MA 3VAFA 2A6AA 1FFWB 3GJTB 4TU9A 1VC6A 5AQKA 1HQUA 2OPSB 4CHOA 2IGIA 5T41A 5KG0A 1BQXA 1XI1A 2RIJA 2PEBA 4C3MA 1IXKA 3NLCA 3KD1E 3OYBA 4DG1B 1WUUA 1HIYA 3QGGA 3A3PB 1HQEB 1HYSB 1NJWA 3SFGA 1PJ6A 1KOOA 1LFWA 5KG7A 4OI0A 4B3OA 3V81A 2VBYA 2YY3A 1U09A 3J7AP 4R8UB 3J7Z5 1X4EA 1U2VB 4TLQA 1R8AA 4RW7A 4IQXA 2XNRA 1HUXA 1VHIA 5F3ZA 4EYHB 4JV1A 1APSA 1RAAB 4DLEA 5BR8K 4DSEA 3S9HA 1CQMA 1Y9OA 5IWAF 1IWAA 2RF2A 2BJ3A 1BCOA 3A3NB 2GIQA 2ZJPL 3FMBA 1J2VA 2D9PA 2XG8A 3S6EA 3VGTA 1FFSB 4JI5F 2K3IA 2R7SA 2Q1NA 2HHTA 3K2PA 3GJSB 2RRBA 2DXDA 3RGIA 1D3WA 1VQSA 4OFZA 4USKA 4MKVA 1J5OA 4ED4A 3AAPA 1K0TA 3PFEA 1RFQA 4ALZA 2MKIA 4FF4A 1Y4ZB 4CBWA 2HS4A 4QYZJ 3UB5A 1IQZA 1MMNA 2C3MA 4DV7K 4DV2J 1JX4A 4KRWA 4O5BA 3RMAA 2I7PA 2ZC3A 4NI2A 4KHPK 1SKUB 2YXLA 4UUWA 3ID8A 2KVQE 1GNKA 2V7YA 2Q2RA 4LY7A 4DTPA 4JOUA 2E6LA 2M70A 4LBHA 1DFDA 2LYVA 4K4TA 1NZAA 4X4OA 3AA5X 2J4RA 4FJLA 2ZVIA 4H4MB 3RZAA 4JK8A 2O8EB 4Z4GA 3ZETB 2PZSA 2GVZA 3HYFA 2DRDA 4DR3K 4KB7A 4ES3A 4YB7A 3EZ5A 4E1JA 1L3KA 4ZTJA 4G1PA 2V68A 3R5AA 4H4OA 2B9WA 4ANEA 3M05A 4DKWA 3Q83A 1R6VA 1KLMB 1ZBFA 3GIKA 2E8AA 5M2UA 5EX3A 1V3ZA 4Q0BB 2NREA 1OQ6A 2CXEA 4DV6J 4RKUC 4RZRA 4A61A 2QEXN 2DCLA 5C2DA 1EWQA 4JI8J 5IT0A 1RP5A 3CD6N 4ZPAA 3LA0A 1U49A 3T3FA 3GMGA 2ADCA 2ASLA 5LL6d 2P9LB 1JXBA 2GV1A 4IG3B 4RPFA 2CYYA 2K06A 5AQJA 2ZQBA 3HVAA 4O5FA 4E7LA 2XULA 4CJUA 3EPIA 1R31A 2ASOA 3SV4A 4J9LA 3J7ZO 4KHUA 1YZ6A 1DY3A 2OFGX 1OH6A 4FYVB 4JKEA 3I82A 1RILA 1X5OA 1WC6A 1PYSB 4TYBA 3OUYB 2H5JB 5M2PA 4B9MA 5ITHA 1VQ4N 2QC3A 1RWXB 5G0RB 2UVWA 1F5CA 4FK2A 5HVFA 5B0DA 3V6KA 2WOMB 3TSUA 3N6NA 4PXCA 3PX6A 4CESA 1OKJA 3C66A 4P7TA 5HJXA 1G4CA 3EXCX 3AVFA 1U04A 4H03B 4CVNE 1SJFA 2H1YA 3SXLA 2WVBA 2IVPA 3CETA 3DLLQ 4QWDA 4KHNA 3MFHA 4DCHA 4WK1A 2ZZNA 2YNHA 1L3TA 1CXUA 3VGUA 5CYMA 4IOCQ 2V50A 4M5IA 2UXCF 1B7FA 1F2HA 4BRMA 1VYAA 1PSDA 1KVIA 4ZN1A 1LW2B 4LF5J 1HQEA 3C15A 2I5JB 2ZOFA 4FXDA 3HHLC 1QAJA 1MA9B 1EQMA 2BE2A 1OQ3A 1Q7YT 5G4DA 4C9DA 5HJYA 2RHKA 3M2UB 2GHPA 3UR0A 4DR5J 3HP9A 1DTTA 1JK9B 2MXYA 4CGIA 3ILOA 3EDQB 2HNYB 1V5VA 1IO2A 4IOAL 5M1PA 3BSCA 3QGIA 1KP6A 3R3TA 3MD1A 3UO0A 3AO2A 4DCOB 2UUCJ 1YJNN 3LZIA 3O3LA 3BY5A 4FJGA 1FJGF 4AT1B 2CJYB 2KN4A 3MN6A 2Y1RI 2RKIA 5M1FA 1YITN 4B9TA 2FJDB 2YV0X 2P9SB 2Z1JA 1QS4A 4ETZA 3LW5C 5E3AA 1NJIO 1VQMN 5BXIA 2GMJA 1PBUA 3UCZP 5BPMA 2Z1GA 4F4KA 2ZM6K 2MQPA 3SSRA 2FLOA 3U02A 2QX0A 1QY7A 2CG4A 1FJCA 1UEKA 2DO0A 4OJGA 4OKJA 4F9OA 2HQCA 3N5BA 3UKUA 3M6UA 1T7PA 3O9RA 1CJVA 2GZOA 2A0FB 1RT6A 1TL3A 4ZDNA 1QE1B 3G8TA 3TRGA 4RUAA 3QRQA 1TAUA 1UVKA 2IVFB 5BR8F 2B6AB 2HVDA 3NGYA 3SAFA 2F4VK 4HCBA 5HMYA 3OV7A 4KIAA 2VIHA 1N36K 2X51A 1D09B 1BIZA 5JUMA 1XMOF 3H5YA 2RDJA 3DLJA 4FYXB 2QL7B 2HWIA 4DQRA 4RL1A 3PXGa 3EYZA 2HGMA 4EBEA 4P7VA 4J9OA 2OTJS 2DR7A 2J7WA 3BM7A 3BB5A 5ADXA 1C0UB 1NJYA 3HVWA 2Q97A 1UKUA 2UVVA 4CZJA 4DU1A 2X1BA 4BC2A 3EVWA 2QK9A 2PI4A 4LSZB 4QAGA 2HQ3A 4CH0S 5IWAJ 2VQFJ 1RBAA 4PXBA 2DGSA 1DAXA 2ITMA 3OYKA 2Q43A 5HVHA 4DR4J 4XH1A 5A0YA 5ADZA 3V1RA 3VCDA 2BOPA 4LF9K 1X4AA 5M1QA 5CCMA 4ISEA 1KKHA 1N6QA 2BUNA 5B0CA 3W8PA 3VEOA 3M2RA 1YRUA 4GO7X 1RTJA 1SUQB 3W9JA 4YHHJ 3IRXA 3IDHA 1WLJA 5AQIA 1NSAA 2DGUA 4ZP6A 3GCWP 4LF8K 4DWIA 2CJBA 3KHHA 1N52B 3AO1A 3KK7A 5I9EB 2RQ4A 4ECSA 2DJWA 3O8WA 3CB4A 3ZSXA 1Q95G 2XI3A 4IEIA 2CQ2A 2V8HA 2R7QA 2OGUA 4DU8A 1SJ3P 2M5YA 1IKXA 4AF1A 3CCTA 4Z4FA 4DV5K 1ZPVA 3BPSP 5CYMB 1NH7A 1T9XA 3I5BA 3PX4A 2AMCB 4PKDB 3QETA 4L3KA 1XMQK 4O3PA 4NLVA 1ZETA 2H5EA 1DJ0A 1X3MA 1E4FT 3M8PA 4CW7B 1GEHA 4FLTA 3OYIA 2CQPA 4FPIA 2JFDA 3JQMA 1IJFB 1NOZA 2DRBA 1B3TA 2V69A 4ILGB 2IFXA 2BE2B 4M5DA 4QWEA 4M3WA 4DZ6A 4FBUA 4EZ9A 4AUKA 4A8SA 5HBMA 3ATUA 1L5UA 4DV5J 4P2SA 4DR3F 4YEAA 5AXKA 2QLBB 1IM6A 1BUXA 3SCKE 2Y1JA 4LMZA 3T1YJ 4QIWD 5CYQB 3CIPA 3BF1A 3HOTA 2QA2A 2GUIA 2YHAA 5U47A 4K42A 5KFJA 3NAEA 3ZT3A 4DJBA 1NCLA 3DLKB 1U4BA 3R8EA 3FGUA 3JAMU 3HJVA 1QE1A 5CZ1A 1RISA 5HRNA 2Y1LB 4JV0A 3AA3A 1HJOA 2ZKTA 2NLXA 1UW4A 1I94F 1J6ZA 4NOHA 4USIA 1HI0P 2V94A 2VJVA 1HPZA 4KH5A 3CVKA 5J1NA 3ZSRA 3D6MB 5IOLA 4YR2A 3I55S 3QZ7A 3CFPA 3VV2B 1S6QA 2D0OA 5KFHA 2X78A 3KK2A 3GYGA 3AO5A 3IAS9 2VZ9A 4F2SA 2XY6A 3PRBA 3FR0A 4CLZA 4OLOA 4X4VA 5T7BA 1NPRA 1DQ8A 2EKNA 2WVEA 1XMQJ 5AFUH 3OTBA 4F4WA 3CXCM 3V6JA 1WUAA 4Y2MA 2DR8A 5AXLA 3U8XA 3A5NC 3HD2A 4KHQA 3L7PA 2R7XA 4G3IA 2B5JB 2C2MB 1R6YA 3N9UC 3KVGA 2MKHA 4WE1B 2C3YA 3CO0P 4H4MA 5BYSA 5D4PA 3IS9A 1B4SA 3PW0A 3GSIA 2J6TA 4UQGA 4CGHA 3NGKA 1W97L 3NWRA 4JI5J 4R0EA 5HANA 2V0NA 3MGJA 2V4RA 4OPHA 3PIOQ 4JI2J 3I56N 3HHDA 2CJAA 3J7AN 2W41A 1EQYA 4Z7CA 2VFSA 4KI6A 2JGUA 4Y6IA 4OI1A 2Y1IA 3ILLA 3IO1A 4E19A 2MZJA 1NKBA 1S9GB 4CYUB 3QIOA 2VONA 2OZMA 4N41A 2HHVA 2D1CA 3LP3A 3LF0A 3IBCB 3BF3A 4ILHA 4IO8A 1RI7A 4K5RA 4WQ5A 2QIFA 1NM2A 2JX2A 3HDSA 4NLYA 3ZZRA 2JVRA 1OY6A 3M7VA 3C46A 1GLBG 4A5AA 3M9MB 4CZGA 1TKTA 2MKSA 1HWJA 5A8WB 1Y5LB 3GIMA 3OW2R 1KLNA 2HHSA 1VOMA 4LF7J 3EMTA 4NZ7A 4A8YA 4CJEA 1X7VA 2D5RA 3IP0A 5AXMA 4BC9A 3KLIB 4OYIA 5K14B 2P6SA 1RZMA 2D7SA 4DUZJ 5AZIB 4CJ4A 3M2VB 2WSEC 2DNYA 2PYJA 2KTQA 2B8QA 3DM2B 4NLTA 2V9KA 2E1PA 1WKLA 2X1AA 4TU8A 1U1QA 3V6DA 4RWTA 4BRQA 1O1WA 1O5JA 4PRFA 1HJRA 2DNGA 4DPUA 4ZCKA 4X64K 2BE9B 1IBKJ 1S4EA 3Q2TC 4FWKA 4MDAA 3CCQS 4FZZA 1TL5A 2VG7A 3NGTA 1VQ9N 2DR9A 4NLCA 3Q2SC 3UVJB 4CK3A 2WUSA 2CPYA 1K47A 4BRGA 2KU7A 2LQ9A 2HZAA 4WFNQ 2CJQA 1S1TA 4DV6K 4OX6A 4R79A 2QLJB 3R7NB 3IWLA 3KKRA 3N6MA 1Q82O 1U1NA 1OWXA 4C4WA 2R8JA 4J9VA 3VTIA 5FLXU 4IDKB 1AW0A 5F8LA 2CNKB 5DK5A 1BA1A 4WF9Q 3L3VA 3ZX2A 2DTJA 1D8YA 3RB0A 3MXMA 4FWOA 2JSXA 4JI6F 3PYGA 4UUXA 4BC7A 3OYEA 2Z2LA 2YNFA 3MPDA 1DEJA 5L38A 4MIBA 3VAMA 3VGSA 5A8KA 2VOPA 1VHXA 3DI6A 2V2ZA 4BY9C 2BANB 4JB8B 3CGIA 4OL8A 3D5MA 4KHSA 1V9OA 4B9VA 1S9EA 3NH1A 3QO9B 1FI4A 2EPIA 2XMJA 4DCPB 3J80O 3W1YC 3L2UA 4YDUA 4M45A 1HKAA 3RSEB 5D3GB 1B7YB 4ED7A 3IAM9 3I6PA 2L9WA 2AF6A 1NXIA 4H0YB 2C2KB 4U8YA 2RILA 2ROEA 2NRZA 3LH2S 1W2BR 1LFPA 2UXCJ 3OTOF 2J0XA 2PMZD 4USTA 2R9LA 3HHLB 3KDNA 4M63A 3O9SA 2OHDA 3SPYA 2ZKUA 2DNNA 3MEDB 3Q23A 3JXOA 4LREA 5FDLB 2ZH4A 1CC7A 1FKPA 2ERRA 4ZPDA 1J53A 2UV8G 4ZJQA 3QFWA 1NLVA 2EK1A 2N3LA 1A5WA 1DTQA 3FZMA 2O8DA 3HJFA 1FTCA 4XTTA 3CCVN 4DR6K 1DLOB 5KT7A 2PEHA 4MTPA 2HVZA 4J9PA 1P9YA 1WACA 4QIFA 3QO9A 4B3TJ 2ZBIA 3DGPA 2W9BA 1ZXOA 5AQTA 3HX9A 1S1XB 1BMQB 4C8KA 3KMQA 3OTEA 4EAHD 2KRBA 3GIRA 1VQLS 3N01A 4CNYA 3D2FB 2OIHA 2HBKA 4GKJK 5C42A 3K7RA 5CCLA 1FHTA 4BRDA 4KHYA 1NK9A 3R9PA 2BJEA 5F8MA 1M5VC 4P74A 3BYPA 2DFEA 5F8NA 4J2BA 1KQGB 3CC4N 2AD9A 2OPQB 3VVUA 3LM9A 1J9AA 4EEYA 4AD6A 4ZVEA 4GVBA 4USJC 1RHJB 3ZZUA 1NGCA 4B3SJ 5J2MA 1RT2B 4NLGA 2YWFA 4ELVA 2FD2A 2RU9A 4H5TA 4N56A 4LH4A 3HKWA 3B4DA 2E66A 3B78A 1NK7A 3QZ8A 4WFYA 3AXKA 3GPAA 3MEKA 3ZTPA 2YWKA 4NCAA 3M2RB 2BR0A 4Y2CA 5GINA 2I9SA 4FZVA 3CUNA 1WBDA 1NAQA 2HIYA 3F9MA 4CJ7A 4JBCA 1QHAA 1S59A 4MK9A 3RBEA 5HI7A 2HBMA 4DTSA 2C42A 3O8MA 3FZ2A 1FESA 4B9QA 3MR5A 2O8CA 4CD1A 1CLFA 3U3GA 3L7UA 5EWGA 4GKJJ 4QR0A 1X31C 1Z25A 3AFGA 3HMJG 1SB6A 2WOMA 2MZTA 3CHWA 4Z4CA 2W25A 1JKHA 3W66A 4QS9A 4C11B 3P6YC 2Q3SA 1Q8LA 1HX1A 3VMFB 2CH6A 1FJEB 3N6LA 2G8FA 4AM7A 1NK0A 5DG8A 3CFRA 2UXDF 3BQ0A 4NXMF 2MQOA 2AT1B 3OA9A 4OI4A 3H3OB 2RB7A 3FK4A 2KJWA 1I5OB 4K4XA 3VA3A 1YDLA 2WAQD 4KGXB 2MY8A 3P96A 4KB0A 4P2MA 2Z2MA 2MLZA 1RT5B 4X66F 1TL3B 4Y65A 1BL3A 3ASMA 3KKFA 1FT8A 3LPEA 5HK4A 4DV3K 1M5HA 4A59A 4BDZA 1N34J 4E3SA 5B7WA 1RNHA 4BC3A 3UDCA 2Z4PA 4WU2A 1H2VZ 1AFIA 4PXEA 2FQQB 1XC9A 2OANA 4ER8A 2GNKA 1HHSA 3SZ2A 3JSRA 4LF6K 1N32K 4DX7A 3ITHB 1QVFM 3QYYA 3O9UA 4FJNA 1E6VB 3QEWA 1BLUA 2QWPA 2JEIA 1S5JA 3NWGA 5ETMA 4CGFA 3HT0A 3MMCB 2G8WA 4ZLPA 4LUBA 4F3QA 2W8KA 1R89A 5E0OA 2PFUA 1GQEA 4IOBA 2I6WA 4B1UB 4CGJA 2G8UA 3LL3A 3R7BB 3AGKA 3AB2B 4WKRA 4OPKA 2JEGA 1F0XA 1FERA 3H0PA 1YXQA 3BO2A 4NLRA 2NPIA 2Q6BA 5RUBA 3RG6A 2UXDK 3RMBA 1P8GA 3J8AA 3ISND 4DL5A 2JC0A 2CRLA 2QZ8A 3UDLA 2LQJA 3MCNA 4DTOA 4RW9B 2EVZA 2DVIA 3OT9A 5HO4A 2CAJA 1TMJA 3GFZA 3F2KA 1GLLO 3CJSA 2VFUA 4MLHA 4OYMA 1IQTA 2YKAA 1KN6A 4NYNA 1XR7A 4ICLB 4NMXA 4I6MA 3MMVA 3N4PA 1P9QC 1ZM4A 1TELA 1LW2A 1WSRA 2W2QP 4C6AA 4MKBA 1F9EB 5GAEP 3DLBA 4IFYB 4U67Q 2C22A 2MTLA 3ADAC 3W2VB 3C0BA 1ZA1B 2HSTA 4ILJA 1F21A 4IJAA 1R8BA 3G6ES 3F0NA 1Q78A 4BGAA 4OX9F 4DB3A 1MWQA 2MQ8A 3C94A 1HQ2A 4MFBA 2M88A 2ZZTA 3KJVA 2WVFA 4ZOSA 2QMUB 2P9NA 2YKNA 1PJ7A 4ZPWR 2NR0A 2HHHF 1UW9A 4HL9A 3JSYA 2FF3B 3FNNA 1RT1B 1HMVA 3FZBA 2NZCA 4DFPA 2FVCA 1YJTA 4AM6A 4DMZA 5AQYA 3QAEA 1Y7PA 4X2BA 5H9FK 3AB4B 4Z2XA 3HKZD 4P10A 3NF6A 1CC8A 1JLQA 1LOUA 1LCUA 3NMUA 5JICA 4EBDA 1NBEB 1VS3A 4QW9A 1LW0A 5F0UA 2W4DA 1BQNA 5BYRA 3MMBB 2W4PA 3SCLE 1BOTO 4JI2F 4FWLA 1UL3A 4ECVA 1X0PA 4UOHA 1RTJB 1SUQA 2XB2D 3R6GB 3OHAA 3SLCA 5AXNA 5ETSA 3NGDA 1OY8A 3T5JA 2VDHA 3MN9A 1F3FA 3L8BA 1SC3B 2OA8A 2CPZA 4L73A 4AXIA 2E2PA 3EE3A 4OMFG 4ELTA 3I55N 3OYMA 1RT3B 2XLJA 3VENA 5C2FA 1HNWK 2RS8A 1AFJA 1VISA 2QEXS 4ED8A 4PG8A 1Y3KA 2IMOA 3C6HA 3S8SA 1QAXA 3VAKA 3PX0A 3LDSA 1YBTA 1WSIA 4R5PB 3KJNB 4HVJA 1AT1B 3AVBA 3UN2A 4XO0A 2HMIA 2VA2A 1TKZA 3CJ3A 4I9QA 3NNHA 3H42A 2HW3A 5D4LA 2P9UA 3GBTA 3I87A 4URGA 3DOLB 5KAKA 1V3RA 4BRFA 5EDWA 1ZTWA 3RAMA 3VQ9A 4F0HA 1YIJS 1HWUA 4WZQA 3KLHA 2WZ1A 3BBFA 3SUQA 4HH0A 4CJ5A 3TVZA 1NGDA 4JI4K 4CEZA 2N4CA 3CD5A 2A6MA 1VAZA 3FEZA 5CD4A 2W4CA 2A5XA 3T1HK 4Z4EA 1NU0A 4BRHA 5ETOA 2V2QA 1S7IA 4M3RA 4MT1A 3NGRA 1RTHA 2YWEA 3CCLN 1FDBA 5GIPA 3GYNA 4Y1CA 2LQBA 1EAYC 4ZCMA 2OSRA 4O0NA 2IVYA 2WONA 2VYPA 2CVIA 1Y11A 2ASDA 3WC0A 3LUYA 3OHRA 2VL1A 4TY9A 5H9FJ 4LBIA 1R0CB 4ID1A 3CQ8A 2IAJA 4WP9A 1T6CA 2VFTA 2BEFA 5FLXY 3I5CA 2QGFB 4B17A 1WAJA 4ECZA 3T1YF 1S12A 4BS2A 4ISFA 4R5PA 2HLTA 4EP4A 2WW8A 2WVCA 4HI2A 1BO5O 1S1VB 2HNZB 2XWYA 4WFNL 2CPFA 2XMMA 4WZMA 1ATSA 4B3OB 3MM7A 4NXMJ 1QD1A 2QLFB 3TAFA 2KT2A 4KHPJ 5GADU 3DDNA 3DYAB 3SDEA 4YHHF 1RDRA 3BH7B 3I0SB 4B3RK 1C1BB 3G10A 1VHFA 1NWKA 1UEVA 2DPJA 4W5TA 2QWOA 3D0HE 4W4MA 2ZVSA 3NXZA 4ECWA 3AJ2A 3DLHA 1Z26A 1Q0NA 4FXWA 3C16A 3W65A 1WDDA 4B3RJ 1U0HA 5HATA 4CLSA 1CJUA 1KD1O 1SIZA 2IC3B 3SMSA 2B4OA 1VQ5N 4F36A 4FK0A 4RO0A 2XMWA 5EU7A 1VQ7S 3DRSA 4L3QA 3F41A 3QFHA 3OYAA 3V6DB 4F4AA 2YX7A 3B6OA 2ALYB 1VK3A 3GR0A 5KFFA 3W2WA 1Q81T 4F50A 1S48A 2CH5A 1EWRA 4XK8C 1HMVB 2YWGA 4P73A 3M6WA 1IKYB 3OHBA 5E3QA 4DX8H 1JLGA 4CF1A 3UI3A 1KVJA 1BWVA 4B3TF 3C6UB 4FN5A 4GV3A 1U6ZA 5LMNF 1YG0A 2C3PA 4W5QA 3H25A 5FPNA 2XSJB 4J90A 1FVSA 4DF4A 2WC9A 4GVMA 2XI2A 4FF2A 3SQGB 3QDKA 2B43A 1IKWA 1Q4RA 2UP1A 3PJ9A 2WCXA 4DV2F 1Z4UA 3D0PA 4EFAC 3D3BJ 4ZVRB 3HM8A 3C6TA 3ISNC 4WXWA 5EX0A 4YDXA 2AEMA 4FJ5A 2NS1B 1JNZB 1QSSA 3MDQA 1OSDA 4DX5A 5E3PA 2CJ9A 3DOMA 1WEZA 2DGVA 3QBXA 4J9MA 4TYAA 4ECTA 4TY8B 2I2YA 4OIXA 1TVRA 1UAXA 3ALYA 3SQ2A 1R0AB 2DB1A 3E8OA 2E4LA 3R2DJ 3MK6A 3D66A 3MX2A 4QOTA 2CZVC 3QGPA 4FO0A 4USVA 2FIUA 4I56A 4OHZA 1C0GA 4HDGA 1U6BA 1SV5B 3DU6A 4ZCLA 3MOJB 3I0SA 1TV6A 2M4MA 4I9LA 4JN4A 1EXQA 3J80U 5EGYA 3F73A 2N4DA 1U1OA 4JNEA 3PKYA 2OAUA 1R27B 3K8VA 4LSNA 3SBTA 4M3YA 4J9QA 3M32B 2DD8S 2F8SA 3QLHB 4ZIVA 3CJ7A 5IC6B 2O4IA 3PHTA 4CE9A 2NXJA 3T69A 4U7UK 3KHRA 2RPIA 4LF4K 2CPEA 1M1KO 3LP2B 2XC9A 3MCPA 1XMQF 1NZ8A 4I6YA 2JL9A 1M5SA 2HQDA 3BF4A 1XMOJ 1VQ8N 3PYDA 3FQKA 3KJQB 3VQCA 4ID5A 2GX8A 2YX1A 3IRWP 1HRHA 1Q8KA 2ZH2A 2UUAF 3AVLA 4MO4A 1IKWB 4LSNB 4Y34A 4RNHA 3L4QA 2CQ3A 3TQEA 3CC4S 3MM5B 1A5VA 3T6BA 1N88A 4BG8A 2VGMA 2LQ5A 4MKAA 1RTHB 4NI2B 2V4QA 2CQCA 1RT7A 2G2OA 5DQHA 4Y2IA 5C25B 4EI2A 3KHYA 1HBNA 4FJJA 3MR6A 5JVGL 5DDQC 5KT2A 1T8EA 2W2NP 2JZ5A 3VF0B 1TL1B 4WIIA 1L3SA 2AYGA 2J7UA 3S7RA 3MEDA 4KGVB 4XAKA 4DSIA 3BH6B 5H9EJ 1S1UB 3U1LA 4CLWA 4S0MA 4IR9A 1N54B 1YJRA 4U9RA 2IRXA 3BDEA 1TTHB 2PYLA 5FLXO 3C16B 3GG0A 4MIWA 4PWDB 2X6SA 4ZVGA 2BE7D 4NLUA 3DGVA 4I69A 4F3OA 4M5GA 4DV0J 3G8SA 4TU7A 2HB5A 2DGOA 3HTVA 5EWFA 2FVSA 3F44A 5JJBA 2RHQB 4IH7A 5HN0A 3KK3B 2LXUA 1NRKA 3UDVA 2AYMA 2RAQA 1JLCA 2FBXA 2V6AA 3SSQA 2D9OA 4FK4A 2CQHA 4LF4F 2ZJPQ 3V81B 3O1WA 5KGXA 1B0PA 2MSSA 5EVZA 3M1VA 1NLKL 3QEVA 1HYSA 4K50A 3I5AA 3CIZA 1XR5A 3AJ1A 4FNIA 4EU0A 4WP8A 2W40A 1WC5A 4ZS6A 2ZWPA 2KB2A 5DQGA 4DLGA 4DFJA 5H9EK 5KFOA 4YQWA 1YBUA 1D1UA 3QNOA 2GIFA 4TQRA 1N5QA 2D3OR 3C7NA 1O51A 4JKGB 2OEJA 2RVJA 2Y3YA 4XEIA 4A47A 1TAQA 2BYCA 3OR1A 1S22A 2LVWA 1A0OB 5AE3A 3M8ZA 3L2QA 2P9KB 3WUHA 3O4QA 4BE1A 1KDNA 3MMAB 5B0GA 3CYMA 1NEEA 2QSFA 4ZVOB 1PCAA 4M5NA 3J7ZT 1RWVB 5JVHL 2NQPA 4MH8A 2YH1A 4H5VA 4CZIA 4Y00A 3DXKB 3M2VA 2YWHA 2Z30B 2L48A 1RLCL 2CPDA 3I0RA 5C24A 4DV1J 1YTYA 1EX4A 1LAVA 4CZMA 4L6V3 1N5YA 1UTAA 5BR8J 4FF3A 2XMAA 2HQFA 1NDPA 2ZF5O 3WZ0A 3NF7A 3AD8C 3BQ1A 2B7CB 2CG8A 3BBCA 1QQOA 1C4AA 5AQXA 3WXLA 4E89A 1IG9A 4BQLA 4F3MA 2DGQA 3H20A 3NL0A 3NCIA 4PQUB 2PD1A 3H98A 3AVMA 3L4IA 2LKZA 3D9BA 2VD3A 4JK9A 2D3O1 2IJRA 4M3XA 2HK3A 5J2NA 3D68A 3EX7B 3IFEA 5KFAA 2E9ZA 3J7A1 2ZD1A 1YITS 2OP5A 1WELA 3A4TA 1XNQJ 3FFIA 1CXQA 1OVYA 5BPNA 3OL8A 2FJAB 1YSJA 5AQVA 3HZEA 1KVCA 1N48A 2VQFF 4FOIA 3SQ1A 4C1NK 5J1EA 4FJIA 1KEKA 1IVZA 4WE1A 3AO4A 2C2EA 3I0RB 1Q5VA 4C8NA 1H38A 4BRPA 1R0AA 2KHOA 1RHRB 1R8HA 1S6OA 3TJ8A 5HQ8A 3KNGA 3TA0A 3HOSA 4C0BA 4DV1K 5E7OB 3CJTA 3NOGA 4HLBA 1GFWB 1ATRA 2Q36A 2KHDA 1Q16B 1ZBSA 4ANCA 1KVAA 4CJKA 2R7VA 4NX9A 2JJ4D 2J0WA 4FM2A 1T05B 1SQEA 1VLYA 2OO4A 1IBCB 3D6FB 3G86A 4A62A 4X4UA 2DGWA 4DUYJ 3WX4A 1E4GT 1XQSC 2VHGA 3CCSS 3E2EA 3ZTSA 2L9DA 4J2AA 4G1IA 4F0KA 3GU0A 3CSKA 3TSQA 2Y0BB 3OFGA 3A5OC 5MLCQ 3OSPA 5T7LA 5KFVA 2R8GA 3R5BA 1CBKA 2KJVA 1C0TA 4OI6A 4K8ZA 1IKYA 1RB0A 1RT5A 2P1JA 1TVRB 3CMEN 4F8RA 4FCYA 4QZVB 3MM8A 1WSFA 4DZDA 1GLAG 3AT1B 4XDCA 1FD2A 3CDAA 2VC1A 3DNCA 2MQMA 4F4ZA 1Q9YA 1TMMA 4CJPA 3KHLA 3DLGB 4QWBA 1JJ2M 1Q79A 2BBEA 3CERA 1BHLA 4ANDA 1MU2A 2CDQA 3V9XA 1UVJA 5DO2A 1IBKF 4JI6J 3KWGA 1RHKB 1U48A 1PILA 3DRPB 1YBAA 1RT7B 3NCQA 4P72A 3KUEA 5KFGA 5K14A 2KFNA 2BJ8A 1DARA 2XM3A 4UQTA 3HPGA 2WB1D 4GVEA 4QU7A 1KAZA 2XNQA 2CJKA 1RDAA 4M5MA 3DYAA 4ISGA 1MN9A 2HGNA 3DLLL 2O3DA 2DIVA 4AHCA 1HKGA 3SCJE 4CHZA 3IN5A 1FRLA 4DV1F 1PG5B 2EFGA 5ELZA 2VPWB 5M1NA 5HLFB 2GBZA 1W2BM 4KV8B 2QO3A 4BREA 2QYCA 5KT4A 4YY3J 3AA4A 3FSIA 2ZJQQ 4FPAA 2QYGA 4CH1A 1KC8T 2G8VA 4CJ3A 3FSXA 2UU9J 4I6WA 2HGLA 3IUCA 4F7VA 2IHR1 3AOBA 3MN5A 4OYOA 4LD0A 1X9WA 3HSTB 5IZHA 2ZWHA 4FJMA 2AU0A 1FRHA 4AHUA 2B9XA 4HH1A 4KB1A 1LWCA 3M8QB 1N34F 3GG1A 1IJEB 2HHXA 1VQLN 3X3UA 3MUMP 4MQ3A 3FZLA 2EX3A 3EICA 3GOIA 5AJ3J 3KLGB 4M5HA 5CAAA 1FE0A 3KIOA 3QT7A 1T05A 4HKQA 1KLMA 1JJ4A 1XUPO 3ZSQA 5KQ8A 2P6TA 3POTB 4CZFA 3AY0A 1B92A 4EO8A 3W3DA 1OO0B 1OJ4A 3K0JA 4O0IA 3CCUN 3D7SB 3W5XA 1ITGA 5LMNJ 3PZPA 4XPEA 2YWWA 1HWLA 4LF4J 2ZJRL 5IFMA 2KG0A 2O8BA 4CECA 3QINA 1S6QB 3DGPB 2W9BB 3UWTA 1KNZA 4Y0FA 1RBUA 3NOCA 3RBDA 4OZLA 3SBGA 3M8WA 4A8XA 3CCES 1TYQA 4EK2A 4K59A 2UVUA 3LOUA 3PRDA 1A6LA 4Q44A 3HI9A 1UWBB 1WNEA 2G4BA 4RW6B 3RB4A 2E6MA 3CCWA 5KG6A 4O44A 1EARA 2P2CB