3DLGA

Crystal structure of hiv-1 reverse transcriptase in complex with gw564511.
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
539
structure length
531
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 150
structure length 531
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dlgA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dlgA05
3OS2A 3DM2A 1D1UA 1JLFB 1TKTA 5L1JA 3LAKA 5HP1B 4DSJA 3GV8B 5F8NA 3G6VA 4Z4FA 4RW4A 2G8UA 2XY8A 4O4RA 1NK9A 1MMLA 3T19A 2FVSA 3G86A 5C5JA 2RPIA 4O55A 4DLEA 4DSKA 1T8EA 2DY4A 4NLGA 4KHSA 1BGXT 1NKBA 4DSIA 1HNVB 3DRRB 4URQU 5KG2A 1LWCB 2OPQA 3HPGA 1LV5A 1N6QA 4DFPA 1WLJA 4QOZB 3VQAA 2PYLA 1HYZA 2BDPA 5HLFA 3EZ5A 1WAJA 4HTUA 4CGFA 4YR3A 1SKWA 4AHSA 1LAVA 1N5YB 4WZQA 4F4YA 5JXSA 4LD0A 3HK2A 4RW6A 4DQQA 1K1QA 1U09A 4G1QB 2UVWA 3OJSA 3KK2B 5F8HA 3NF7A 1TKDA 2W9BB 4KTWA 4W5OA 3OL8A 3ICLA 3T1AA 1G15A 1NHUA 4Y2AA 3RRHA 1L3SA 4Q45A 4IFYB 5D3GA 3MEDA 2BQRA 2XHBA 1IH7A 4CF8A 4OPJA 1QE1A 5J2PB 4B3OA 3QZ8A 1GX6A 4N47A 4CF1A 3V9SA 4B9TA 4QWBA 4PWDA 1XHXA 1NJWA 4Q8FA 3FQLA 1SUQA 3HHKA 2DFHA 3OYMA 4IH5A 4CJVA 4E1MA 4CFDA 4I2PB 4DTPA 1C0UA 5KFYA 4CJ5A 4OL8A 4TSXA 3PW0A 2ATLA 3N6MA 4F4KA 4RW4B 4Y34A 1Z26A 2IGIA 2G8HA 4I9LA 1ZTTA 4ELVA 2XCAA 2WK4A 4MKAA 3SNNA 5DLGA 3KLHA 1Z4UA 3AO1A 4CJ4A 1S1TA 2OPQB 1QAJA 3VA0A 1N6QB 1RDRA 3WNFA 4CEFA 5KG7A 2C2EA 5KFPA 1MU2A 3T3FA 1A5XA 3KKSA 1RT5A 4ZTFA 2JC0A 2XI3A 1NOZA 3AO4A 2R7YA 3D0PA 1KFDA 2IJFA 1JL2A 4DWIA 3EPIA 3NF9A 4HVJA 4RW6B 3TAFA 2VA2A 1IG9A 5KFLA 4IG3A 4M3TA 3H40A 4W5NA 4FLTA 1KSPA 5HRRA 4YFUA 4DQRA 2D3UA 5EWGA 4EYIB 4DL6A 3TI0A 1JKHB 3SQ0A 4KHNA 4MIBA 1RT2B 1S0MA 2Y1JA 3EPGA 2R8GA 5D3GB 4KAIA 3MEDB 1NJZA 2R2SA 1C0TB 1SV5A 4ICLB 3LP2A 3FRZA 4EP4A 1DTTA 4B3OB 2UUTA 2RN2A 4LSLB 4PWDB 1SUQB 4NCGA 3KD1E 4O4GB 4RU9A 4K4XA 4IFVB 4M42A 3PHEA 3PX4A 2IC3B 1NOYA 5L1IA 3SI8A 4CJWA 3JSMB 1C0UB 3MF5A 4HUEA 4DL3A 1FK9B 1RTDA 4DG1A 3T5KA 4FJKA 5EUHA 5KT6A 5F8IA 2VA3A 4J9OA 3UR0A 5KFIA 1RA6A 2P51A 3V1QA 4WYWA 5KFCA 4FJ5A 4TY9A 1ZYQA 3KLHB 1NK8A 3OYHA 3V9WA 1A5WA 4ED8A 3OYLA 3CJ0A 1HNIB 3LANA 3DLEA 4B9SA 3IS9A 3OYDA 4ED3A 1N48A 3QNNA 4TN2A 1MU2B 1LW2A 1T7PA 2YKMA 3U6FA 5SWMA 4MK8A 2KW4A 4AHCA 3NBPA 3OVNA 5I3UA 3KK3A 3OYAA 2EHGA 3OL9A 2QKBA 4MK7A 4FCYA 1T94A 4Z4EA 3ZT0A 2W9CA 3TAQA 2KTQA 1ZBUA 4ECVA 2DTUA 3MEGA 3CJ3A 5DG7A 1Q9XA 3WNHA 1B9DA 4K4ZA 3L3VA 3S3OA 2ASJA 5KGWA 1RTIA 4IOBA 1I6JA 1RT3A 4IR1A 3AVLA 1HPZA 4CEOA 5KFSA 1YT3A 4DFKA 3NFAA 3CO9A 4M41A 4C8KA 2RKIA 1TGOA 4TYAA 4FLZA 4CF2A 4CJFA 3PY8A 3M8PA 2O4IA 2JEJA 4YR0A 4DL5A 3HVTA 1REVA 2JC1A 4ZPCA 2IM2A 1FKOA 4ZP9A 3OYBA 1J5OB 4KHYA 4DG1B 2Z1HA 1BISA 3LPTA 3OY9A 4PA1A 3VQCA 5C24A 4OKEA 2ILZA 1DTQA 1BI4A 4QCLA 4KBIA 4RUAA 1XC9A 2QK9A 4QPXA 4CFAA 3C6TB 3OYEA 1VRUA 4ZPDA 3ZSVA 5F9LA 3BSOA 2JEGA 3KKRA 3PZPA 3SPYA 1D8YA 5CYQA 4YP3A 1LW2B 2I5JA 4DQPA 1WSHA 3S9HA 4NYFA 1TQLA 3TAPA 2X6NA 1S6PB 4FW1A 1QQCA 2O5DA 3IRXA 2W8LA 1Q8IA 3DRPA 1ZBLA 3KK3B 1S1VA 5KFNA 3ZT3A 3C6UA 1RYRA 1ZTWA 1B9FA 1N4LA 3CVKA 2W9CB 3IGVA 4TY8B 4KFBA 2Z1GA 1KCFA 5KFTA 3KIOA 1W9HA 4PY5A 4RNNA 4E19A 5KFHA 3ISND 1RTHB 4NLPA 1RTIB 4YQWA 4KI6A 1RT3B 2WCXA 3AVBA 1VSLA 3SYZA 5KTQA 5DMRA 3ZT1A 1IKXA 4ZVFA 2RKIB 5KFDA 3GV5B 3RBEA 4GC6A 3M8PB 3DLHA 3C94A 4EZ6A 3HKWA 3L2QA 3QLHA 4DTRA 3RMDA 5DK5A 4ZP6A 1REVB 1U45A 3GILA 1T05A 4O3NA 3LAMA 3T5LA 4JRPA 1VSJA 4K8XA 3QNOA 4IR9A 2G8IA 3ZSOA 2FJWA 3AVJA 4IBNA 4URGA 3OYFA 3QIOA 3MEEA 3BQ1A 2WONB 3DLRA 4DS5A 1XR7A 2W7OA 1SH3A 1FXXA 1XR6A 4OPKA 3JYTA 5K14A 4K4VA 1RT4A 2OPRA 3K59A 3KHGA 4NLRA 4FYDA 2ATQA 4OLAA 1ITGA 5CYQB 3V81A 4CEEA 3BQ0A 2I5JB 1SH0A 4LH5A 2O4GA 4ZP7A 3LP0B 4GMJB 2D0CA 3DLBA 2P5GA 2F8EX 1J54A 4DFMA 3DYAA 2V9WA 3IRXB 1S5JA 3H2LA 3QERA 2HMIA 4Y2CA 5JS2A 2UVRA 1RNHA 2KFZA 4F50A 4KFBB 1ASWA 3BREA 4QW8A 3MXIA 1SH2A 3H5XA 3RB4A 4CGGA 1TK0A 2FVRA 3P5JA 2EC0A 1D9FA 3I8DA 3HP9A 3QYYA 4FLYA 4GC7A 5KFVA 2B6AB 2XGQA 1IKXB 4K4WA 4CERA 3TAEA 4E7JA 4J9MA 3AVAA 2D0AA 3HP6A 4ECYA 1BCMA 1S48A 2HNYB 4J9PA 1WSJA 4J2AA 3M9OB 2B5JA 5J2NA 4KTZA 1VRTA 4EBEA 1X9WA 3K57A 1T05B 3I5CA 1X9MA 4NLDA 3M8QB 3NMAA 3OS0A 4CIEA 4L8RB 4KHQA 1S10A 1BCOA 2X74A 3VQ8A 4GW6A 1YTAA 4BWJA 3KMSA 3K5MA 1SKRA 3CIZA 4IKFA 3O3FA 4IRCA 4CK2A 1RT4B 2OPRB 3M9MB 3H5SA 3M8RA 1WSFA 3CDEA 3V81B 4DTJA 4F2SA 2V4RA 2OYQA 2VG5B 4QW9A 3VQSA 4KSEB 2KQ2A 1J53A 1QS4A 5FRMA 1KVAA 1C6VA 5CY4A 3OHBA 2AQ4A 2W42A 2IJNA 4CECA 1CZ9A 4PQUA 1I3AA 2HMIB 4H4MA 3N6LA 4KHUA 4CHNA 1DLOA 5DLFA 2PZSA 3CDWA 4Z4GA 1EP4A 1O1WA 3KD5E 4KHRA 3BQ2A 3PO5A 4CESA 3V1RA 4I7FA 2FLLA 2Q3SA 3G10A 2KZMA 4O0JA 3C95A 3MR2A 3H4BA 4QWCA 4C8LA 2JGUA 4M3UA 3AVMA 4YNQA 3CG7A 2J6SA 3WNEA 1RDCA 4O3QA 1JLEA 3NF8A 4DTUA 4W5RA 4DQIA 4C8MA 3G6XA 4AHRA 2R8JA 5DG8A 2ZD1B 3NH2A 5J2NB 5J1EA 1VRTB 4AHUA 4IDKB 2CJQA 3OL7A 1TV6A 4KAZA 3TQ1A 4FBTA 1JLAA 3MR5A 3V6DA 3MECA 4FW2A 3S3NA 3AVFA 3Q8SB 3I5AA 4G3IA 3OLBA 3CFRA 2BQ3A 4O3OA 3ULDA 4DQSA 1U48A 4ED7A 3PR5B 3LWLA 4FS1A 2KZZA 1S6QA 1LW0A 3LALA 4DS4A 1BQMA 2YKNA 4WE1B 3MFHA 1IKYB 5KFAA 1EETA 5KT5A 3KLIB 3RB0A 4JUZA 4KB0A 3DM2B 4IRKA 5KFQA 3P83D 3F73A 4PQUB 2G8FA 4H4MB 4JS5A 3KLFA 2GIQA 2ILYA 1TKTB 1DLOB 3KHLA 1ASUA 5KI6A 3KLVA 5HBMA 4J9SA 1EP4B 3VQBA 2IAJA 2ASLA 4Y3CA 3PVXA 1U47A 3RWUA 3FQKA 1S97A 4XO0A 3FDSA 1TAQA 3KLGA 4I7FB 4FJGA 1K6YA 3SZ2A 2R8KA 4CHZA 3QIPA 3U3GA 4M95A 3QEPA 4ZHRA 4K4YA 1KRPA 2Y1IA 3L2WA 3L2UA 3SV4A 4WXOA 4M3ZA 5HLFB 3ALYA 2VWKA 1JLEB 4ELTA 2HWHA 2YHAA 3GV7B 5JS1A 5KT3A 5KG5A 4B9MA 3DLGA 2XY6A 3SFUA 4RNFA 4KKOA 3RTVA 5DQGA 4B9NA 3IAYA 4X2BA 3EZUA 4O44A 3HPOA 1HQEA 1JLAB 3AVNA 4FJLA 5L1LA 2ETJA 4K4TA 3A2FA 2GC8A 4CGIA 4Y1CA 1TK5A 4M45A 4B9VA 4F3TA 5J2QA 4I9QA 3CWJA 3RB6A 1U4BA 1S6QB 1JL1A 4NYNA 3QGIA 3VQ7A 2FVCA 1QE1B 2ALZA 2D7SA 1CZBA 3RB3A 2LSNA 2I1RA 1BQMB 2C2DA 4ID5A 5CZ1A 1RBSA 1EETB 3KLEA 1L5UA 2F8SA 2R2RA 2YNIA 4EO8A 3V9ZA 3IN5A 5CZ2A 3KLFB 4H4OA 2GIRA 2VG6A 2XO7A 3PX0A 1L3VA 2IAJB 3K5LA 5F8MA 1QSLA 3ZSYA 5FDLA 4H54A 4BACA 3QEVA 1JXBA 3VQQA 2IBKA 3L2RA 3KLGB 3F9KA 4OJRA 4KV8A 3V1OA 4M94A 4ECUA 2W8KA 4ZTJA 3BJYA 3D5MA 1S1TB 2AX1A 2E9ZA 3QO9A 2IM0A 5F9NA 4B9LA 4K50A 4ZHRB 3HYFA 4OKJA 2OZSA 4TQRA 1TKZA 3H59A 1IKVA 1RA7A 1NK0A 1RT5B 4O3PA 1T3NA 2DFEA 1HARA 1QHTA 4KB7A 3EYZA 4RNHA 3QINA 1VSFA 4KKOB 3KTQA 4IG3B 4O44B 5KFEA 1VSHA 3UDLA 1RT1A 1TAUA 1ZBHA 4HKQA 2B43A 4O3RA 3P1GA 3RMAA 3NGZA 1BIUA 1C2PA 1SV5B 3LP2B 3MAQA 2FBVA 1DTTB 1GOCA 3K5OA 4ID5B 4DU1A 3KLEB 3AA4A 2AGOA 4NCGB 3SQ1A 1U49A 2F96A 1N56A 5J2MA 4DL2A 2YNIB 3QZ7A 1VSDA 3TAGA 3VQPA 1JLCA 4CIFA 1KLNA 1RBVA 1RTDB 4EP5A 4I2QA 1KTQA 1C1CA 5FDLB 1YVFA 3V6KA 3G6YA 3V9UA 1NK5A 5KG6A 3NF6A 1BQNA 5EWFA 4ZMMA 3RR8A 1KLMA 4KV8B 1GOBA 4LQ9A 2FJVA 4CHPA 4XPEA 1W25A 4CFBA 1F21A 1FKPA 3QO9B 4BE1A 2UUWA 3DLEB 3IS9B 1HYSA 4C8NA 2WHOA 2YNHA 2YNGA 1SKSA 2J6UA 4ED2A 5DGAA 2BE2A 3TVKA 2YKMB 3NAIA 3QIDA 5SZTA 4J2BA 2AU0A 4CJQA 3NBPB 2FLPA 2OZMA 2ITGA 1RDDA 2HWIA 3V4IA 5T14A 3LPUA 3ITHA 5I3UB 1QUVA 3I0SA 3NGYA 5KFJA 1UWBA 2F8TA 3RAQA 3LDSA 3M9NB 2DFFA 4HUGA 3TANA 4QWDA 4NRTA 5HROA 3MEGB 1RT1B 4ZPAA 2BRKA 4KO0A 2RDIA 3KHRA 3H08A 1CLQA 3CDUA 4HCBA 3AA3A 4ZVGA 1NK7A 1NKCA 4CJEA 4TYBA 3BSAA 4NRUA 4ZVHA 3RR7A 4ECRA 4FJ7A 1TVRA 4DFJA 1HPZB 3PX6A 1IO2A 3BDPA 5JUMA 3DOLA 3VQ5A 3PJXA 4B08A 3MXMA 4Q0BA 2IM1A 3VA3A 5KG4A 5J2MB 2ZQBA 3ZSZA 3ZT2A 3HVTB 2GBZA 4ID1A 4CJUA 3OYCA 2E6MA 2OPPA 3RMBA 1JLCB 3FFIA 4XIUA 1FKOB 1S1WA 4I2QB 4FLVA 4EBDA 5C24B 2VG7A 1DTQB 4E7KA 1BI4B 3MTKA 4ZPBA 1SL0A 1BQNB 4ECXA 1Z25A 3CM6A 1LWEA 2YNFA 3AVCA 1KLMB 2E9RX 3HVWA 4DL7A 5HRPA 3DMJA 1NK6A 1RILA 4FVMA 3D28A 2XY7A 1FKPB 4J2EA 4CK3A 4JS4A 5I42A 5KG3A 3TAMA 1VRUB 1LAWA 2HHTA 1RTJA 4FZZA 2YNHB 3OHAA 4OGEA 1NJXA 5KFKA 3L8BA 3GYNA 1S9GA 1X9SA 3LP1A 3ISNC 2HNDA 4CEBA 1YVUA 5KRTA 3N6NA 4Q43A 3V4IB 3HT3A 4C8OA 3DRPB 3ITHB 4Z4HA 3AVGA 2GV9A 1S1VB 3I0SB 2JEFA 3C6UB 1CXUA 3K5NA 3HXMA 1UWBB 4FK0A 1EX4A 3QEIA 5HROB 3DLKA 4PUOA 4KO0B 2PYJA 3GQCA 3HVRA 2YHBA 5KT2A 3SQ4A 3UIQA 2P5OA 1CSJA 2AGQA 2WRMA 1ZBFA 1TVRB 5FRNA 1YTUA 4CHQA 3PV8A 3NCIA 3CFPA 3DOLB 4Q0BB 4RW8A 2W7PA 2XCPA 3SI6A 4NLTA 3QLHB 2C2RA 4OLBA 4YMEA 4CHOA 4FJIA 4KHMA 2OPPB 2AJQA 1WN7A 3LWMA 3O4QA 3OSNA 4DLGA 1UAXA 5KG0A 4FS2A 3NHGA 4XPCA 3CQ8A 1SL1A 1S0OA 2R8HA 1WNEA 3MEEB 3HL8A 4F4WA 4CGHA 4HUFA 2ZE2A 4J9RA 2WB4A 3JYTB 5K14B 2XY5A 4EZ9A 4DTOA 5I42B 1VSEA 2FVPA 3KK2A 2NUBA 4DTMA 4CE9A 1RTJB 3CYMA 2HHWA 1WSEA 4J9LA 2XGPA 1S9GB 2HNDB 4M3XA 4IFYA 3OYGA 3DYAB 1JXEA 4HHTA 1XWLA 5HRSA 4B8CA 3OYNA 5J2PA 3T5HA 3H98A 3E01A 1U04A 3DI6A 4CEDA 4E3SA 4NLQA 3NGDA 5KFWA 1S9EA 3O4NA 4Y1DA 3DLKB 4NLUA 2AWZA 5L1KA 3BSNA 1RBRA 3SV3A 4FLWA 1BL3A 1KFSA 1B92A 4I2PA 1NNDA 1TKXA 4AHVA 4MFBA 2QE5A 1WAFA 4EBCA 3EY1A 1GOAA 4J2DA 4FJNA 1C1BA 4CJPA 3HSTB 4CJSA 4RW8B 1NKEA 4FJJA 3AO2A 1NHVA 1ZETA 4ELUA 3H5UA 1UA1A 5DQIA 2B5JB 5KFMA 1BIZA 4E7LA 3PW7A 1K1SA 1W0HA 4E89A 3UQSA 4BDYA 4NLWA 4FJXA 3OJUA 1S9FA 2HHXA 4DSFA 1GX5A 3KJVA 1JX4A 1ZBIA 2V0NA 2E6LA 1VK0A 5FROA 3KK1A 1RCHA 4IKAA 4B9UA 2ZE2B 3CJ5A 3PO4A 5F8GA 4E7IA 2RF2A 5F8JA 4Z4IA 2KFNA 4CF9A 2R2UA 2R2TA 3BGRA 4U7CA 3PW5A 1S4FA 1S49A 2D0BA 5F8LA 1NJYA 4W5QA 4AHTA 4FLXA 3SFGA 2HVIA 1JKHA 3H4DA 3NKYA 2Z1JA 1RT2A 3TARA 2FJXA 1EKEA 1ASVA 2X6SA 2HHUA 4ED0A 3OYIA 1C0TA 4ICLA 2UVVA 3E01B 3VN5A 4CGDA 3DI6B 4LSLA 1S9EB 4WXWA 2J6TA 3U3YA 3LZIA 4O4GA 4NYZA 3HPHA 4IFVA 5EDWA 1RBUA 4O0IA 1TKXB 2IC3A 2IMWP 4KTQA 3JSMA 4CEQA 4MFBB 3HVAA 4TXSA 1FK9A 5KFZA 2HB5A 4CIGA 3GIIA 4DSEA 4BE2A 1C1BB 4QWEA 4FM2A 4LSNA 4CJRA 1JIHA 4FZXC 3VQDA 3QESA 2RDJA 5KG1A 4NLXA 5C42A 3SCXA 4M3RA 1CXQA 4FJMA 5J1EB 4F2RA 4F8RA 1HNIA 3ZT4A 1TV6B 4FK2A 4NCAA 2OH2A 3TABA 3QETA 3V6DB 4ECWA 5KFRA 3MECB 4JRQA 1C0MA 3UPFA 1XR5A 3KJVB 4RZRA 2B4JA 2FC0A 3VQEA 3NH1A 1QSSA 1Y97A 4DEZA 3SUNA 4M3YA 2QXFA 3KK1B 2E9TA 3QEXA 4URSA 2HHQA 4DMNA 4F3OA 2RF2B 4CJTA 1UA0A 4CF0A 4CJLA 1LW0B 3BGRB 2D41A 4RW7A 2X78A 5KFOA 1KVBA 1VSKA 2YKNB 3DOKA 1JLGA 2BGGA 3BSCA 5CYMA 2FBYA 1KHVA 5KRSA 4FJ8A 1XI1A 1TL1A 4LY7A 3ZCMA 3IGNA 4EO6A 1TL3A 3ZSRA 4KPYA 3QEWA 5HBMB 4NLOA 1T03A 2VWJA 3SJJA 4MH8A 4OVLA 3GIMA 3OYJA 2HVHA 4U6PA 2HW3A 2HHVA 3E51A 3OLAA 3AA5X 4MKBA 3SPZA 2AX0A 3GIJA 2JLEA 4KE5A 3QIPB 3L2VA 1J5OA 3MXJA 2OA8A 3M8SA 1TP7A 1LWFA 3RAXA 1WSIA 4NZ0A 4LSNB 2IS3A 4RNOA 3SUPA 3O3GA 4CEAA 5C42B 3C6TA 3GIKA 3DLGB 2IM3A 4OGCA 4N76A 3ZSWA 4NLSA 2DPIA 4JV0A 1HQEB 4DU4A 1RAJA 4ZVEA 4F4ZA 3AO5A 2UVUA 1D0EA 3MFIA 4R5PA 2HNZA 4E1NA 1S6PA 4R8UA 5J2QB 5E41A 2GUIA 3PW2A 2V4QA 3RRGA 4JLHA 1HQUA 3K2PA 3OYKA 3NAEA 4RW7B 4Q44A 3PUFA 4TY8A 4ECTA 3CM5A 1TK8A 2OPSA 4RUCA 3PR4A 3DOKB 1JLGB 1R0AA 4FZYA 4FLUA 4TLRA 4N41A 4FK4A 2IDOA 3CFOA 5CYMB 1L3UA 1BHLA 1RTHA 4WFZA 3KMQA 2XI2A 4E0DA 5KT7A 2FVQA 1TL1B 3LZJA 1C1AA 4WZMA 1D9DA 4N56A 3KHHA 1L3TA 3VQ4A 1J9AA 5EU7A 1TL3B 4H4OB 3NE6A 1S1XA 4E7HA 3WNGA 1HJRA 1JLBA 2VG6B 2JEIA 3I0RA 1T03B 2BANA 3PJWA 3KOAA 5HRNA 3B6OA 3RBDA 2FLNA 2DPJA 3G0ZA 4KB1A 2XWYA 4J9NA 3V6JA 3V9XA 4Z4CA 4NCBA 1JLQA 4Z0UA 1LWFB 4CEZA 4DU3A 1TKZB 4FJHA 1IKWA 2IA6A 3B6PA 1IKVB 3HM9A 4R0EA 4IQXA 4W5TA 3CJ2A 3OSPA 4O3SA 4LQ3A 2WONA 4CJ3A 4MK9A 1RT6A 1S0NA 3QGGA 2PY5A 4MQ3A 1QTMA 3L3UA 3K58A 1WNSA 1XHZA 2HHSA 2R8IA 2D5RA 1WSGA 3NGIA 3Q8PB 4FBUA 3LP0A 4R5PB 4TQSA 2HNZB 5KT4A 3SQ2A 4IRDA 4R8UB 1A5VA 3HO1A 4O5BA 3ZSXA 1RDBA 4RG8A 1VSMA 1SL2A 1HQUB 4HYKA 5KFXA 1EXQA 1JXLA 4IH6A 1D5AA 3MR3A 1I39A 2G8KA 4J9QA 5KFFA 1OS5A 3VQ6A 3ZSQA 4BDZA 2OPSB 2ZKUA 1R0AB 4J9KA 3MR6A 3I5BA 3OL6A 1QSYA 3AV9A 4BWMA 3AA2A 4CGJA 4RW9A 3THVA 2YV0X 4CK1A 4UQGA 3TWHA 4OKKA 4CHYA 3SUQA 1HMVA 4YR2A 2B6AA 3NAHA 3AVKA 1S1XB 1JLBB 1IM4A 3NH0A 2XC9A 4DTSA 3I0RB 3KNAA 2BANB 4QAGA 4WYLA 4H8KA 4LH4A 1C1CB 3DDKA 2HNYA 2HAIA 4ECSA 3AVIA 4ED6A 4KRFA 4DL4A 5C25A 1VSIA 3QGHA 2G8VA 2AGPA 5DQHA 3M8QA 1JLQB 1RYSA 2QV6A 1HYSB 4ED1A 3AO3A 1IKWB 2YNGB 4BDPA 2BRLA 2BE2B 4IG0A 4WFYA 3DRSA 3PW4A 1RT7A 1RT6B 1S1UA 2WTFA 4KREA 3O3HA 4Q5VA 3IG1A 3VQ9A 4JV2A 2WOMA 3ASMA 2VG5A 5DGBA 2G8WA 2A1SA 2W9AA 4NLVA 4M3WA 4QWAA 2A1RA 3CJ4A 2FBTA 3D45A 4CFCA 4EYHB 3FSIA 2E4LA 4N5SA 2BR0A 1JLFA 5HP1A 3BR9A 2C28A 2QKKA 4IH7A 3V6HA 5KFGA 4CCHA 4HCCA 2FBXA 3RMCA 4DSLA 4DTXA 3NL0A 4RW9B 1RBTA 4B8AB 1HNVA 3DRRA 4EEYA 1LWCA 3LP3A 1HMVB 4AH9A 2EX3A 3FFIB 1KHWA 3H5YA 3OS1A 2Z1IA 1S1WB 3Q8RB 1HRHA 2D3ZA 4NLYA 4AILC 4JV1A 2VG7B 4K4UA 3SUOA 5T7BA 1QAIA 4DF8A 3HJFA 4K8ZA 1LWEB 2YNFB 3T5JA 2C22A 1N5YA 2BQUA 2ZD1A 4WFXA 5L9XA 3DMJB 5C25B 4IDKA 1NK4A 1Q9YA 4G1QA 3TAMB 1RDAA 4BE0A 4GVMA 1UOCA 2W9BA 5KFUA 4RNMA 4Q8EA 2IOCA 4FM0A 4IG0B 4KHWA 1HYVA 3DRSB 5EWEA 1RT7B 3LP1B 4ECQA 5KGXA 1KVCA 3AVHA 1S1UB 3NDKA 1X1PA 4KI4A 4CJKA 4F4XA 4K4SA 3S3MA 2P1JA 2XRIA 3Q8QB 3IG1B 4FXDA 5KFBA 4FM1A 2WOMB 4MIAA 2CKWA 4WE1A 1IKYA 5DG9A 4DTNA 4ZP8A 4PUOB 3KLIA 4ECZA 4DF4A 4FJ9A 3TR8A 2ASDA
chains in the Genus database with same CATH superfamily
1Y0HA 1S12A 3OBIA 4PG5A 2LEAA 1TKTA 3EGZA 3LAKA 4DSJA 1FVQA 3G6VA 3QT8A 1X4AA 1E4GT 4BC7A 3ET6B 2K8GA 1NK9A 3BPSP 1M1KO 3T19A 3J81O 4O55A 4NLGA 4CYUA 1BGXT 5BYRA 1NKBA 3EL2A 4LF8K 3DRRB 1RLDA 1WEYA 4JI5J 3HBTA 4QOZB 3VQAA 1HYZA 3ZTRA 4DV7J 1X0PA 1S6OA 5KAKA 5HLFA 2HBZB 2QO3A 5IFMA 5F3TA 7FD1A 4AHSA 3ZZRA 3J81j 4CH0S 2CQ0A 1N36J 2OGUA 1XK8A 3OJSA 3NF7A 2X1FA 1TKDA 2UP1A 1H38A 3P96A 2UXDJ 4OYBA 2CIMA 2MZRA 4CLYA 4KTWA 3B6BA 1G15A 2J0WA 4LF1A 1NHUA 3RRHA 2L08A 2HS0A 3CT9A 3FR0A 3EE3A 3PFEA 3MEDA 2BQRA 2QM1A 3EGVA 4OPJA 5J2PB 3BBBA 3A5LC 2P9SA 4KC5A 4B3OA 3SDEA 3KVGA 2KO1A 3H42A 5BJRA 4LF8F 3HHLD 3N4QA 3C0BA 3KG4A 2DRBA 1X4CA 2GMHA 4TSXA 5AQMA 2LXUA 1U0SA 4CBXA 4F4KA 1HX1A 4L73A 1N5SA 3W61A 2V51B 3A3NB 4FVCA 4JD2A 4I9LA 1ZTTA 5AQPA 2WK4A 4FWRA 3SNNA 5B0GA 3ZX0A 1V5VA 2FSNA 4CJ4A 1N6QB 2F40A 2DRAA 1F5BA 5KG7A 2C2EA 1H0HB 3KKSA 2GCFA 1SIZA 2XI3A 1NOZA 1FXRA 2W2OP 3TVZA 3NWRA 2V8HA 3C15B 1R6YA 2F9JA 4FXWA 4DWIA 1JL2A 4K7QA 1N54B 4P2XA 5GAGU 4HVJA 3TAFA 2VA2A 4IG3A 3H40A 3TQEA 5EY4A 2D3UA 5EWGA 3LQVA 4DL6A 1ZM3A 3TI0A 4ATNA 1GMWA 2E2NA 1AUDA 2NSCA 2Y1JA 4A59A 3EPGA 5CAAA 3LGNA 1YDLA 3OBYA 3DAWA 2R2SA 2KLAA 2XBPA 3MDFA 1V3ZA 2CQPA 2LQ9A 2X7IA 2HQGA 1SUQB 3W5XA 1HI1A 4NCGA 2EFPA 4RU9A 4K4XA 5M1OA 4IFVB 2CPEA 3SI8A 4DCHA 3SCJE 2PC6A 3JSMB 1C0UB 3D67A 2OHDA 2RIJA 3NVMA 1FJCA 3ID6A 1FK9B 1U6FA 3EVWA 1DJ0A 1H73A 3JQJA 3F2KA 5EUHA 2KHOA 2DGVA 3DRYA 1E4FT 3BH6B 3VZIA 5KFIA 2BJ9A 1RA6A 4WYWA 4FJ5A 5IZHA 1WTFA 4OLOA 4WPAA 2RQCA 1U2VB 4DV1K 4G1PA 2HHHJ 3OYDA 4ED3A 2V7ZA 2VQFK 2DIVA 4NE9C 1U1KA 2C2MB 5SWMA 2Z2YB 4RBTA 1HKBA 2J0QD 4NX9A 1NGCA 4F9OA 3OYAA 3MN6A 2QKBA 4MK7A 2WVDA 4A46A 2GJ2A 3MEGA 3L7PA 5A2QY 3WNHA 1B9DA 2V69A 5KGWA 4C8ZA 2ZWOA 4IWVA 2HPUA 1RTIA 3AVLA 4CEOA 2DGXA 3GIRA 4KGKA 2RKIA 1TGOA 1HI8A 2BACA 5IC6B 3M8PA 2GX8A 5I3QA 1OVYA 2M70A 4XH4A 2JEJA 4OMFG 2HQIA 1JJ2M 3R6GB 4A8KA 1YQHA 3PRDA 4DV1F 3PYEA 3HM8A 2JC1A 5KOWA 1WOSA 2IM2A 4ITSA 4ZP9A 1U0HB 4LF7F 4GVBA 2VQFF 2CAJA 2K1RB 3VEWA 2GVDB 3OY9A 1IM6A 4PA1A 3VQCA 5CHIA 3OFHA 2F7TA 2ILZA 1NGJA 1J6ZA 1BI4A 1K8AO 2ZBCA 4RWXA 2CUYA 1U1QA 1XC9A 2KVIA 5JVGQ 2ZH1A 4DV4K 5IS2A 2DHSA 2O8BB 3A3PB 5IC4B 4P73A 3OV7A 2W25A 4BRHA 1IVZA 2C3UA 4YP3A 2DXDA 4A5BA 1LW2B 2I5JA 2V4JB 5DZ6A 3CUNA 2CQ3A 2O5DA 3HSJA 5B8HA 3DGPB 2W8LA 2XZWA 1ZBLA 1S1VA 2PT0A 3ZT3A 1XMOK 5CCLA 2MKYA 4BR5A 1B9FA 1N4LA 3D9BA 2B9EA 1CS4A 5KFTA 3AOAA 2ASPA 3ETMA 1NSAA 1RHMB 3WXKA 1UETA 3AY0A 3QICA 2GAGC 1RT3B 2WCXA 3AVBA 1VSLA 2XSJA 3MUVP 2D74B 4DUYK 2C3OA 5DMRA 3ZT1A 4LRBA 3ISZA 3T1YJ 3AOBA 2YH1A 1IKXA 4CBUA 1FJEB 3GV5B 4ZN1A 3GCWP 4DV4F 2VASA 4UOGA 1UVKA 4FPIA 4PXDA 1S99A 3L2QA 3JSYA 2NXUA 3RMDA 3M2UA 4ZP6A 2GA7A 4K8XA 3QNOA 3W9IA 3ZSOA 4IBNA 4HI1A 1RAAB 3MEEA 5T7LA 2Z2MA 2WONB 4DS5A 2RJZA 2W7OA 1SH3A 1EAYC 4WIQA 5DM6L 1QQOA 2E7XA 5K14A 2GMJA 3BN7A 1PGZA 4H5TA 1RU1A 1RKJA 2HF3A 3MTJA 1HNWF 5CYQB 2FZGB 2E8AA 1ZPWX 4Y28C 3W7BA 1SH0A 2O4GA 4JI6J 1WHVA 3V5RA 4ILLA 2KL8A 2F8EX 1J54A 3W8PA 1NCLA 3PDNA 3DYAA 5HVHA 3IRXB 1CJUB 4Z7YA 4K43A 3QFUA 4NXMJ 4A2AA 2YKOA 5G0RB 4KYZA 4M5NA 4EHUA 4Q2MA 4FWMA 3CJKB 5GAGI 1ROFA 3NWGA 2QN6B 2FVRA 2E88A 3BKUA 4OHYA 4WQ4A 2CQCA 1JCEA 3H2VE 1D9FA 3I8DA 3GBTA 3SCKE 2IRUA 5KFVA 5ADZA 3BO4A 4C6AA 4K4WA 1SQFA 3TAEA 3GONA 3DXKA 4BR0A 4NMXA 2SXLA 3AVAA 3HP6A 2D0AA 1RWXB 2XMTA 1VBKA 1S48A 2BKNA 1F6TA 5J2NA 4UF4A 3I5CA 3WIUA 1YRTA 3CMES 3CIMA 2X74A 4WQ4C 3O9QA 1B7FA 4BWJA 5M2PA 1OO0B 4M7XA 4M8LA 4IKFA 3LDNA 1YZ7A 2XHWA 1Q8LA 1I94K 3M9MB 4KH6A 3H5SA 1CJVB 3CDEA 4TKTA 4F2SA 3TR5A 3ONQA 1TFWA 1G4CA 4KSEB 4DV7K 1VHXA 2GO8A 5BRDA 2POKA 1C6VA 1U02A 2AQ4A 2W42A 2IJNA 2DGQA 1VQKN 1NEEA 4X4RA 4H4MA 1HUXA 2YWGA 4CHNA 1N36K 1JJCB 1O1WA 4LIRA 3BQ2A 1DZ5A 3PO5A 1REGX 3M6UA 2BJ1A 2KZMA 3M2VB 2P9PA 3G82A 3QPIA 3UDEA 3MR2A 4ZDNA 3QT5A 3NGKA 1U1MA 1ELOA 3NCQA 3AVMA 4YNQA 3CG7A 1FEHA 4YORA 1F1BB 3O2IA 4MLHA 4O3QA 4RKUC 3RU0A 1CQMA 5E3PA 2DITA 4DQIA 3PHTA 4C8MA 5IM0A 3HD1A 1W26A 4K8RA 3CXCM 5FLXY 4DV7F 2KDOA 3I82A 4H03B 2QJ3A 3QAEA 4FKXA 2P9UA 5CA5A 3Q8SB 3OLBA 2BVZA 4DQSA 3TX0A 4QPTA 2QYCA 1FRMA 5EGYA 1N36F 4FS1A 3VENA 4CQ1A 1P1LA 4ZLJA 5LMNK 1ZAWA 1LW0A 3LALA 2FC8A 1NSQA 2YKNA 3PTWA 1H2TZ 4ZLLA 5KFAA 3TNVA 3VZHA 2E2OA 3KLIB 4JUZA 3VAKA 2LU1A 4LF9J 4IRKA 2GHVC 1T0TV 4PQUB 4YOWA 2GIQA 3L4BC 2ILYA 4PYAA 3KHLA 3W2VB 4C3KA 5KI6A 3KLVA 2HVEA 1S0VA 1ILYA 3VV2B 4NPOA 4Y3CA 5DDPC 2N7CA 4I7FB 4FJGA 2FSKA 1K6YA 2WB1D 4CLTA 3HHLA 5F0UA 1YI2S 2R7UA 4BRAA 4MDBA 4DQ8A 1J5EJ 1ZBSA 2VOPA 1R3NA 4WXOA 4M3ZA 3ALYA 3TEGA 4ELTA 2XNRA 2L3MA 3UE2A 1CC8A 3SFUA 2ASMA 3MM5A 4RNFA 3NXZA 5DQGA 3J7Z5 3EZUA 4FJLA 5L1LA 3A2FA 2GC8A 3AD9C 4CGIA 2A5XA 3DOMA 4MYTA 3HHLC 2CH6A 2OLWA 4B9VA 4L76A 3FZFA 5J2QA 1F3FA 5AQHA 1IQZA 2KYXA 3D1HA 4FDFA 2FVCA 3FKBA 2QA4N 1QE1B 1FTRA 2ALZA 2I1RA 5HMXA 5DRKA 3A5MC 1QAYA 1A9NB 3UE5A 2BA9A 2Q2RA 4WFBL 4ANDA 1VIXA 2YNIA 2ROGA 3V9ZA 3LPEA 3F56A 2HBLA 1WEZA 3CXCR 3NG8A 3JXUA 1P9QC 3PFOA 1Q8BA 4FSVA 1OH5A 1VYAA 3K5LA 3UKRB 4GV3A 5FDLA 4BACA 1GT8A 1YBAA 5LL6Z 4B3TJ 3V1OA 3GU0A 4ECUA 4ZTJA 3BJYA 5D8HB 4WFAL 3D5MA 1MW7A 5H9EK 2O66A 4AQYK 2HFUA 3BZKA 4K50A 3Q0AA 2OZSA 3L4QA 3FFKB 1YJNS 2PBDA 2WVCA 1HARA 2XYGB 1OH8A 4KB7A 3M3ZA 3EYZA 4ANEA 4FWNA 2CPJA 2HHHF 3PSIA 3VEXA 2X3DA 5K8PA 1XUPO 1VQ7N 3Q24A 3AARA 1ZBHA 2EKYA 4OZJA 1ZC6A 4QU7A 1NNEA 3J7AN 5B09A 4MYUA 1FXDA 1WDTA 3A3OB 4ZLNA 3KWGA 2YJEA 1C2PA 2OO4A 2IIRA 1SV5B 3MAQA 4K2XA 2CPFA 1YXQA 1SI9A 4RBUA 2XMUA 4CZLA 2HHPA 3J7YU 2HZVA 3KLEB 3GMGA 3SQ1A 1HWKA 2F96A 3OR2A 4AQYF 3VGLA 4FO0A 2GUPA 2KKHA 3LOUA 1JLCA 4CBWA 2RE1A 2BH1A 4KQZA 4B1UB 1SJQA 3TA2A 1C1CA 3FZKA 2E5LK 3V6KA 2HLUA 5H1SQ 3V9UA 5LM7E 2EXUA 3RR8A 4KV8B 2FJVA 1CC7A 4CFBA 1MROB 2B7CB 5AE2A 1VQ4N 3IS9B 1HYSA 3B4DA 1ZH5A 3CD6N 3V2UC 2YNHA 1LXJA 1Y5NB 2JHEA 2BE2A 4JHDA 3NAIA 1UEUA 3QIDA 4J2BA 2W24A 2AU0A 4CJQA 2FLPA 2OZMA 2HWIA 5L8RC 1U25A 5DM6Q 3D6FB 1EO1A 3TTCA 2BJ3A 2ZHAA 2R7OA 1UWBA 2HIQA 2Q66A 3LDSA 4NRTA 2R9LA 3EE9A 2A6OA 5GMEA 3AA3A 3LA0A 4CJEA 2KT2A 4NRUA 2DJWA 1A0OB 3O1BA 3MCAB 1TVRA 3G25A 1HPZB 1AROP 3ZEUB 4ZS6A 4B08A 1K0TA 1IXKA 2FQQB 3A1YG 5EN1A 3MCNA 5KG4A 2G2ZA 2QLWA 2GBZA 2AA4A 4JI6K 2W4CA 4CJUA 3QRQA 1TL4A 3QDKA 1WF1A 5A76A 4NXMK 4WJBA 4I2QB 3IBCB 1HD1A 1HNZJ 4UOCA 2CVIA 3BR8A 3DLLQ 3T1HJ 1LOUA 1CULA 1BQNB 3KXDA 1Z25A 2DPNA 1LWEA 2YNFA 5F0WA 3BBCA 2E9RX 2F9TA 1NHKL 1FKPB 4CK3A 2J8AA 5I42A 3PYFA 4DPWA 3CCLS 3HOSA 1VRUB 1IBKK 1RACB 2R7RA 4FZZA 1FT8A 1FFGB 4X4SA 1PYSB 4W98A 2AYMA 3GYNA 5M1NA 3RG6A 1FFSB 4EGLA 3FZMA 4CI0B 3CE8A 2WW8A 3N6NA 3V4IB 4C8OA 2GVZB 1SBRA 2YKQA 3AODA 2QSFA 5L38A 2BKOA 2DXFA 1RFQA 5HROB 3SCLE 2RVJA 3I4HX 4IEIA 4JI6F 3DWLA 2YHBA 4NXMF 3UIQA 2BYCA 2AGQA 2WRMA 4CIOA 1YTUA 2HS3A 2HG4A 4QYZJ 3EKSA 3DOLB 4LFCK 4Q0BB 3JXOA 2AJ1A 5JLHA 3D0GE 1IJEB 3SI6A 4NLTA 4OLBA 4FYWB 1VQLN 1N8RT 2AHOB 2NRXA 2W4DA 3WBZA 2HWTA 4DB3A 4CZJA 1KR4A 5BPNA 1QDUB 2Y9HA 1WB9A 5KG0A 2QLJB 4NL5A 4XPCA 3CQ8A 2R8HA 4OZNA 4CLFA 5BR8K 2HRTA 1Q86O 2V2VA 4F4WA 1K73O 5M1KA 1AB8A 2DXEA 4J9RA 3JYTB 4DTOA 5EXWA 1VSEA 3KK2A 2P9KB 4LJMA 4UY8T 4UY85 2HHWA 3RSEA 1GLFO 2L48A 3GJTB 2GHPA 1O0PA 3OYGA 1OWXA 3DXMB 3OD2A 3OYNA 5E3QA 4Y0WA 3EE8A 3DI6A 2QLFB 3ZYYX 3M30A 4Y1DA 3DLKB 2QTDA 1YAGA 1APSA 1BL3A 1KFSA 2MKSA 3Q7BA 4JV5K 1PAUB 4M63A 4AHVA 4BR4A 1IQTA 4MFBA 3JS6A 3E1YA 3M6WA 4J2DA 1C1BA 4CJPA 5GIPA 1TL7A 1WOOA 3M6GA 2C2NA 2DNPA 5ETVA 3THTA 1NKEA 5ETRA 1FXLA 1Q95G 3H5UA 5AQFA 2E29A 2ZWPA 3AQPA 3J7YI 5KFMA 3O5BA 3VF0B 2PGCA 3C19A 2KG1A 2XLKA 4E89A 1FDAA 2DR8A 3D1QA 5M1FA 3BO2A 3OJUA 3C16B 1WG5A 2DHGA 3IXQA 4M63C 5FROA 1VK0A 4PKIA 2H51B 4DHVA 3CPWR 3CJ5A 4E7IA 1ZAXA 2LFVA 4I6WA 4LF6K 3SXLA 2R2TA 3PW5A 3IFRA 3VGSA 3GG0A 1J5EK 1S49A 2D0BA 2FZKB 1LFPA 4USHA 4W5QA 4AHTA 1SXLA 4JKGB 4JEPA 2QEXN 1JKHA 3MHYA 1RSCA 1RT2A 2M9KA 3TARA 1MN7A 1EKEA 2X6SA 2FTRA 1M1KT 4ED0A 1C0TA 5IT9O 3E01B 3VN5A 3A4TA 3TX8A 2FIUA 1Q4RA 2ZVIA 2DHAA 4WXWA 2HGLA 3CSKA 3LZIA 4O4GA 3FBBA 1RAHB 3HPHA 5L9NA 3WXMB 2EEYA 4LF9F 3H46O 4O0IA 1RBUA 1TKXB 1S76D 1HA1A 2E20A 4CEQA 2MLYA 3SBMA 4TXSA 2HB5A 2CQBA 4CIGA 1RCOB 1X60A 1QQMA 4BE2A 4QWEA 1GLJO 1AW0A 3TTDA 2F5GA 3QJJA 2OUGA 2RDJA 1FWLA 4LF6F 4NLXA 5C42A 4ILRA 2MGZB 2A0FB 4PG6A 1J5EF 1FRJA 1FRKA 2E1RA 4BRKA 1X5OA 4OZ2A 1TV6B 2ZEJA 3EDRB 2EFVA 3V6DB 3ZETA 2CNLB 3MECB 4ES2A 3UPFA 1XR5A 5JJBA 1FNOA 3VQEA 3CJQA 3SUNA 4M3YA 3KK1B 2E9TA 2B9WA 3QEXA 4OO1J 1W2BM 4URSA 1FDBA 4DMNA 4F3OA 3HSGA 1UA0A 1SS6A 3VESA 2NR0A 2RDDA 3T9ZA 4RW7A 2FXUA 3ZZ0A 1EZZB 5RUBA 4ZVPB 1BQXA 2LYVA 2R42A 2MY7A 5AXMA 3OT9A 5T41A 5KRSA 4LY7A 1TL3A 4DR1K 5HBMB 4NLOA 5E0OA 1RWUA 1HBMA 3TU5A 2JSXA 3OLAA 1VQ6S 3NNHA 3K5PA 3BF4A 5ETOA 3BGUA 3QIPB 4LC9B 5DO2A 1VISA 3E3XA 1NZAA 3RAXA 4CO2A 4DV0J 3WQTA 2QFJA 2VPYB 4RNOA 2PEBA 3CCJS 2Q6CA 3LPYA 1KVIA 2CNKB 4Q7AA 3DN9A 3ZSWA 4NLSA 4QR0A 1BWVA 2HFZA 4DU4A 4F4ZA 3B78A 1NU4A 4DZDA 2UVUA 1D0EA 2BOPA 4R5PA 2IA0A 1SQEA 1KAYA 3S01A 1NG9A 4YY3K 4DPUA 3CF5Q 3KWIA 2OEMA 2AJ2A 2AEMA 2FHJD 2VWBA 1AT1B 3HULA 3NAEA 5L39A 2G0JA 4F04B 2B8PA 4TY8A 3DC2A 3DOKB 1JLGB 1R0AA 3E9LA 2IFXA 1X5SA 5HMWA 1EQMA 5KT7A 2DGOA 3G6ES 2FVQA 2QX0A 3KHHA 2DNNA 1J9AA 4H4OB 4AD6A 1DRZA 3NE6A 1S1XA 5HL7Q 1SC4B 3W66A 2E5JA 4YN3B 2OFHX 2A1BA 3O08A 4ZVOB 2FLNA 3WHIA 2DPJA 2Q43A 4USTA 4FWLA 1OSCA 4IYQA 3QT7A 1ATSA 4Z4CA 3KG0A 1NWKA 3W8GA 1LWFB 4Z0UA 1TKZB 3HM9A 1MWQA 1Y5LB 3OSPA 4O3SA 2JOQA 4MK9A 2HF4A 4FYYB 4DR7J 3DHWC 1P27B 3PIOQ 3G71S 4QIFA 1HBUA 1MMNA 3B54A 2WBRA 3ELHA 1WNSA 2GMLA 2R8IA 4BQZA 1JQGA 3G8QA 4NEYA 3NGIA 4N8NA 2Q0UA 2DBBA 4FBUA 4U96A 3TOQA 4TQSA 5KT4A 1PAEX 3DU6A 3IR5B 1VCTA 1UFKA 4O5BA 3W5YA 1VSMA 1SL2A 1NGDA 2NREA 1EXQA 4LREA 1JXLA 5AQOA 5KFFA 1OS5A 5HQMA 5A6WA 4UW2A 2OPSB 1HWUA 3I5BA 3OTCA 3AV9A 2WFBA 3AA2A 2UUBK 4CGJA 4W90B 3LDQA 3THVA 3GSDA 1K8AT 1HMVA 4YR2A 5AZIA 3NAHA 4P7VA 1IM4A 3BGFA 4QAGA 2BANB 3FZ2A 2YH0A 5IT9U 5A0YA 4V19S 4OLPA 5AQWA 3PYDA 3DDKA 2DEIA 1VQKS 4ECSA 3AVIA 3J7AP 3A8KA 4XAKA 2AGPA 3PKYA 2BW7A 3Q83A 4J7CA 2FF6A 1JLQB 1RYSA 2DNYA 4ED1A 1ZA1B 3T1HF 3GPAA 4BDPA 4QYZK 1K9MO 5DM7L 2M3DA 2BM1A 4UQTA 1RT6B 4OYIA 3O3HA 1KD1O 4KRWA 2MJNA 3Q2SC 4Q5VA 1ZXOA 1Q0NA 2I0XA 3IDHA 4IO9L 2WOMA 3W0LA 2BXJA 4EU0A 2UUBF 5AE3A 3BV8A 4DV5J 5CE3A 4QWAA 2A1RA 2FBTA 3DXBA 1HW9A 1JCFA 3UD5A 2EBEA 1URRA 4AE5A 2HK3A 4WP9A 3C46A 3TYTA 2UU9J 3ET6A 3V6HA 2GX9A 5IV3A 4CCHA 4HCCA 4L75A 4RW9B 1MMDA 1RAOA 4B8AB 2RE2A 3DRRA 3LP3A 4AH9A 2WBMA 1KHWA 4H5NA 5F2RA 1S1WB 2EFGA 2ZH9A 1VQ5N 1HRHA 3IA0A 3MK6A 2ZDOA 1PBAA 2HGNA 3IR7B 1WC6A 4JV1A 2YPYA 4DBQA 4LSZB 2MYFA 4CT8A 1GLEG 2E44A 2MB0B 2ZD1A 4Q2LA 5L9XA 3DMJB 2XG8A 1JJHA 2LECA 4IDKA 5TKWA 1NK4A 1Q9YA 1RDAA 2G0IA 4ES3A 1N34K 2MZTA 2JNJA 2IVNA 1Y10A 2W2PP 3MM9B 2IOCA 4KHWA 4JYAJ 1X3MA 3HSZA 3R1XA 1HYVA 3DRSB 5EWEA 5BN9A 2XYPB 3LP1B 1VR6A 1KVCA 2DB1A 1S1UB 4DUTA 2DH8A 3NDKA 2OSQA 4CJKA 4GV6A 3S3MA 1PJ5A 2P6TA 4MIAA 1ATNA 4UZBA 2W41A 2ZM6K 3G4SS 1IKYA 4BG8A 1CJTA 3O6WA 4ECZA 4WCEQ 1ULRA 2LU2A 4FJ9A 1SJ1A 4XH5A 3P45B 4LRCA 4FF3A 1D1UA 5I4MA 1JLFB 1ZPVA 4PKDB 2MY8A 3GYXB 3GV8B 4OX6A 4Z4FA 2MQQA 2ADCA 2G8UA 2A18A 4O4RA 2CZ4A 4NLBA 1MMLA 4I64A 5C5JA 4ZPVR 3G86A 4DSKA 2RPIA 1T8EA 4DSIA 1FKAF 2VKRA 2BZ2A 1LV5A 2YX7A 3HPGA 1N6QA 2HFOA 4OPAA 1ZBTA 1WLJA 4FOEA 2PYLA 2VIHA 3OTDA 2BDPA 3QJPA 1V9OA 5EX3A 1N5VA 4BRDA 2CJBA 1YG0A 3N4WA 3C15A 4WZQA 2J8SA 4LD0A 3ATVA 4I6AA 4DQQA 4G1QB 2R7SA 3US5A 1R8BA 5F8HA 2O8CB 5D4NA 5EHHA 2JFDA 2JFKA 2X51A 3THYB 4W5OA 3OL8A 1TZ0A 3T1AA 3VF2A 1VC5A 3KJFB 1NPPA 1L3SA 1XQSC 1X4HA 2ZBRA 2XHBA 4CF8A 2DH7A 3QZ8A 4N47A 3VAHA 1XHXA 3ENBA 1SUQA 3HHKA 3OYMA 3IAS9 3NMRA 1NGBA 5BPMA 4FVUA 4EFHA 3UB5A 3I55S 3OW2R 4R0JA 2QL9B 2DNQA 4DTPA 1C0UA 2RHSB 2W4PA 2PMZD 5KFYA 4OL8A 4GKKJ 3B82A 3CMAS 2ATLA 3CCQN 3MCSA 4RW4B 2Z0GA 3THWB 3AXKA 4ELVA 3AO1A 1S1TA 1QAJA 1RDRA 3KFWX 3WNFA 4H5WA 3RVCA 3R7SB 4JK8A 2Y0SD 4I4BA 3HF5A 1XNRJ 5FD1A 1A5XA 2JC0A 4AYBD 4UT4A 2ZH3A 3F41A 1YLXA 4FN5A 2R7YA 3D0PA 2Q1LA 2RSQA 3BM7A 4IOCL 1VQ8S 3EPIA 3NF9A 2YHYA 4RW6B 1IG9A 4AT1B 3WT0A 2AKWB 2YQ0A 3EXCX 1VOMA 1MWMA 3IO1A 3SQ0A 1S72N 1S0MA 4CZIA 2R4FA 9ATCB 2E1CA 1VQ4S 1JJ4A 2HVDA 4M5KA 1NJZA 2RUSA 2VQEK 4ICLB 5CXTA 4EP4A 3IM8A 4PWDB 3QFPA 4BY9C 3O8WA 4QU6A 4M42A 3PX4A 2IC3B 5AXKA 5L1IA 1EB0A 3MF5A 2B8QA 1U0HA 1RTDA 2HURA 5JMNA 3FJ2A 3I87A 5J1NA 5F8IA 2VA3A 3LTOA 4J9OA 3VEZA 3AHPA 3IFEA 3MMAA 3D54A 1ZYQA 4ED8A 1P8ZA 1HNIB 2ITMA 2LEBA 3DLEA 4B9SA 1FJGJ 2ZJPQ 5F41A 4DV0F 4BG9A 5ETNA 2JRSA 5HQ8A 4TN2A 1WBDA 1LW2A 2V4JA 4K0KK 2YKMA 3U6FA 1JCGA 3SSQA 3AD8C 2VQEF 5CHCB 4AL5A 3DGPA 3OVNA 5I3UA 2DGTA 4Z4EA 2KTQA 3LUYA 4PPZA 3CJ3A 5DG7A 4C3LA 4CWBA 4K4ZA 1NZ8A 3L3VA 2ASJA 3GL1A 3EXYA 4IOBA 1I6JA 1RT3A 4WU2A 4IR1A 4DR7K 3N79A 4J90A 4CLZA 2FHJA 3CO9A 4M41A 2AJ0A 2W40A 4CF2A 2YPZA 4CM0A 1UVMA 4M5GA 1O51A 2GJFA 4CT9A 5L46A 2VOOA 2FLOA 2X1BA 3TUZC 2M8HA 5HN0A 4NXNJ 4NA2A 2Y0BB 4ZPCA 5HANA 2WSCC 3OYBA 1J5OB 2RHKA 3I56N 4K0KF 4DG1B 3LW5C 2Z1HA 1BISA 3LPTA 1P1TA 4F3MA 5C24A 1DTQA 1F2HA 4C11B 4L72B 4KBIA 4USKA 4PAAA 1X4EA 5AT1B 4RTFD 3C6TB 3EMTA 1G99A 3KNGA 1X4GA 2P9LB 1FEEA 3ZSVA 4MKVA 4Y0FA 3UD4P 1KNZA 2JEGA 3QMLA 4PKHA 3SPYA 1Q81O 4JOUA 1D8YA 4B3SK 5CYQA 4OZ3A 2B9XA 4DQPA 1YJTA 2H1YA 3MR7A 5DM7Q 4JI8J 4DR7F 1VQLS 1RB0A 1N5TA 2X6NA 3IRXA 1CJUA 4BC5A 1CG2A 3C6UA 5AFUH 3MEKA 4AM6A 4G6VB 3CVKA 2CYYA 3IGVA 3GE1A 4CLLA 3CJKA 3KIOA 1W9HA 2EBGA 4F02A 4NLPA 4F25A 1QTNB 4YQWA 4KI6A 2COLA 2GGPA 3UCGA 4WFNQ 1SC1B 5KTQA 4DR6K 1RTZA 5C15A 3OVAA 3KUEA 3RBEA 2LXFA 4CLWA 2OP5A 3JS9A 3TPQA 3WX8A 2OTLS 3W3DA 3OTOK 3I9V9 3GDQA 1X9JA 4DR3J 5IT4A 3AGRA 2YKAA 5DK5A 1REVB 1HR0J 2C1EB 3LAMA 2VPZB 3T5LA 2ACYA 3MUTP 3CW2C 4IR9A 1FDDA 2FJWA 3AVJA 3B8HA 4URGA 3OYFA 2IDEA 3BQ1A 2IDLA 3R5GA 1YJRA 1XR7A 4OHZA 2J4RA 3IR6B 4YOVA 4OPKA 4CLSA 3ZNUA 3IC1A 3R8YA 1VBXA 3SSSA 1CJVA 3X3UA 4WF9Q 4FYDA 5ETTA 2ATQA 1ITGA 1HLUA 2YWFA 4CEEA 4GMJB 3DLBA 3JAMU 2P5GA 1NMDA 3CCRS 4HHJA 2V9WA 4DR6F 2D1CA 5A2QU 2RU9A 2FPHX 1AUSL 1AA1B 3P4UB 2RD5C 1DAXA 4OX8A 4F50A 3BREA 1XMQJ 2MHEA 3RB4A 1NGGA 4CGGA 2VF3A 3R5BA 3SMSA 2MSTA 4V19J 5C7PA 1NSKL 4OYMA 2DR9A 2OTJS 3HP9A 3O5TB 1F9EB 1RCXB 2B6AB 5FLXO 3EVOA 4Z2XA 2UU9F 3HHDA 5DJBA 1VQON 3AJ2A 1N5QA 2HNYB 2DNHA 5CZVA 2ZJRL 3MAAB 3M9OB 4J2AA 1OH6A 3K57A 1T05B 4JI2K 4K25A 1X9MA 2H9ZA 3M8QB 2EI5A 4HWIA 3OS0A 1BG3A 4L8RB 5AJ3J 1F5AA 1BCOA 3S8SA 1WI8A 1RWKB 3VQ8A 3HKZD 2UUAJ 2VONA 1NM1A 4ENOA 1A7GE 1YTAA 3KMSA 1SKRA 5FJ4A 3I31A 2OMLA 4OQJA 2UZAA 1S22A 4IRCA 5D0EA 2KFYA 4LFAJ 3TUPA 5GAHP 3SIPB 3JTPA 3CO0P 2V4RA 2VG5B 4JYAF 4QW9A 3BGOP 1PCAA 1WC0A 2O8EB 1J53A 1QS4A 2KJVA 1WC3A 1NO8A 2UXBK 3PM9A 5AQKA 1H7WA 1KDNA 4PQUA 4ZCMA 2HMIB 3C6AA 1O13A 3QB0A 1X8DA 2PZSA 3CDWA 4TU7A 4Z4GA 2KRRA 2DO0A 4RUBA 4KHRA 2HBQB 5GMKa 4CESA 4JI2F 4I7FA 2FLLA 2HQCA 2Q3SA 3L09A 4O0JA 1RQ0A 2J9CA 3C95A 3H4BA 1HKCA 1Q86T 4QWCA 2CVEA 4F26A 2JGUA 3QFWA 4M3UA 2F8HA 2UXCK 2DH9A 1RDCA 3M05A 4ANCA 3NF8A 4L3NA 2WSFC 3G6XA 2HFSA 1X4DA 2XO6A 1IBMJ 3P49B 5DG8A 3NH2A 3SQGB 5JLFA 5J1EA 1TUWA 3OL7A 1U1PA 1AFIA 1KVKA 2UXBF 4FW2A 3S3NA 3AVFA 2DY1A 3I5AA 1U1LA 2YTCA 4BRLA 4CJ7A 3LWLA 1NMNA 1U26A 2AP1A 4LF5K 2MJUA 1T9UA 5MLCV 2WSEC 2D3OR 1Z05A 3I9ZA 5LJWA 3QMQA 2ACMA 2KN4A 3AXMA 2WBNA 1RWVB 2GIFA 1RWMB 1M90O 3R7NB 2CDQA 4CRJA 1RBLA 2XLIA 2YQ3A 2W7AA 2A6MA 1TKTB 1ASUA 5JMVA 3VQBA 2ASLA 3UKRA 4HHUA 1U47A 3RWUA 1NAQA 3FQKA 3ZC4A 4JKEA 2CQGA 3MD1A 2R8KA 1H98A 1VQPS 1HIYA 2AP6A 3GJSB 5F1XA 4GKKF 4B3RK 4ZA1A 3BP8A 4K4YA 1KRPA 3SEOA 3UR3C 2Y1IA 3L2WA 3L2UA 1KOOA 5HLFB 2VWKA 1PSDA 1RDUA 4QOTA 1WC4A 1VBYA 5KT3A 3DLGA 1WD6A 4EK2A 1WELA 2K3KA 3IAYA 2YX6A 3AVNA 1F3VA 1XNRF 2ETJA 2YXLA 1RAIB 4C9DA 1VQSA 5LOQA 1VI7A 1JL1A 1YTYA 4ILJA 1QVFM 3VQ7A 2YCHA 4E98A 1CZBA 3RB3A 2LSNA 2P9SB 3O1WA 3SDEB 4LUBA 4J9UE 1BD6A 2PN6A 4OHXA 4P75A 2ZVSA 1EETB 3R2CJ 3KLEA 2H5IB 3R6LB 1L5UA 3Q22A 1VK3A 5AQTA 3CERA 2HRYA 3BZQA 4EO8A 3NGUA 4USVA 1BA1A 4DUZJ 2LQ5A 4GRSA 2XO7A 5AQLA 5K8MA 5F8MA 3EGWB 3ZXWA 1YHQN 3VQQA 2IBKA 3ZTQA 4OJRA 2H3GX 3ENAA 1QLNA 3HD2A 4KV8A 4RLEA 4KH5A 1UPMB 2E9ZA 2KXFA 5F9NA 3M2RB 4B9LA 3D4JA 3QBCA 1IG8A 2QWNA 4JKFA 3H59A 1NK0A 1UEKA 3D6RA 3MM8B 2DYAA 3Q2TC 2ZOFA 1FFWB 4BCAA 1VSFA 4KKOB 1GFWB 4WTOB 4IG3B 3J80U 1U2FA 2HMPA 1RHUB 3UDLA 2HS4A 1FA0A 3JSRA 2OEJA 4HKQA 1RHJB 2Z4PA 1GTHA 2MPUA 4A8MP 1F5CA 5HOOA 3P1GA 5LL6d 1DBDA 4WP8A 2QWOA 3NGZA 3P39A 4RWWA 2QWQA 5IV4A 1QHAA 1JNRB 3ZEUA 4ID5B 4DU1A 3TJ8A 2G9OA 4CP5A 2AGOA 4NCGB 2ZH8A 1RGIA 3KK7A 4IOAL 3SCIE 2VBYA 1N56A 4JI3K 2MTLA 4DL2A 4BROA 2XMVA 3TAGA 2V63A 1EQ0A 3N9UC 4CIFA 1KLNA 4EP5A 4I2QA 4YEAA 3EGNA 1NK5A 2NLWA 4S0MA 1BQNA 5LT5A 4ZMMA 1WUAA 1GOBA 4LQ9A 3Q23A 1FW6A 1W25A 2JLFA 3GSIA 1F21A 1FKPA 3C14B 3GFXA 3N0VA 2G1HA 3ULEA 4DPOA 5CCMA 2BJ7A 4CZGA 5AQYA 2N3OA 3AAWB 1M5SA 2J6UA 3NGTA 3R9PA 2XS7A 2PE8A 1GTEA 3TVKA 4YOTA 2GQQA 2E1MC 5SZTA 4QJVA 2IRYA 1IBLJ 2ITGA 3V4IA 2AYEA 2ALYB 1IJJA 3LPUA 4QR1A 3IKMA 4KIAA 5JVHL 2ZC4A 4PQAA 2F8TA 3G8SA 4WKYA 2DFFA 4HUGA 4PXBA 4RUHA 2G13A 2XSFA 5HROA 2E1YA 4HDHA 3MEGB 4ZPAA 3VGUA 1N33J 3MPWA 4CO4A 1I1GA 2RDIA 3UWTA 3KHRA 1TFYA 4RR5A 4R79A 4BC4A 4HHHA 5J1PA 3RR7A 2NLXA 3GFYA 2YX1A 3ZZPA 2L9DA 4ZJLA 3PX6A 3S7RA 2VKZG 3W1YC 1KWMA 3DOLA 3MXMA 4Q0BA 2ZDPA 3W9JA 3H6EA 1QQNA 5J2MB 2ZQBA 1H74A 4CO5A 1W7AA 4JI4J 4V19X 2F7VA 3OYCA 3FFIA 4XIUA 2QIFA 3BS9A 3UFCX 1G1XA 3U27A 4FLVA 4EBDA 2Q0RA 3ID8A 1VQNN 2VG7A 1BI4B 4DR3F 3VAJA 4BRNA 3L0QA 1F2GA 1HR0F 4DL7A 2P9GA 5HRPA 3D28A 2XY7A 5KG3A 1LAWA 1PILA 2XZTB 2HQDA 5AE1A 4NZ7A 4JI7K 2LCWA 2P9KA 5KFKA 2CWKA 1VQMN 4CEBA 4DDFA 2AV5A 3U7JA 5KRTA 4YB7A 4UOFA 3ITHB 3AVGA 1S1VB 2JEFA 1TTHB 3K5NA 1BU6O 3HXMA 4XDCA 2LEPA 4FK0A 3CJRA 2FF3B 3PRBA 3DLKA 4I6MB 3HVRA 4A8SA 3LGHA 2R7WA 2P5OA 3VCDA 2A42A 1CSJA 3M6VA 2XSJB 3AOCA 4OZLA 5FRNA 1VIOA 4A8XA 3M32A 4CHQA 3PV8A 1M5KC 3U9DA 2LKZA 4B1XB 3BEXA 2QMUB 3AB2B 1WG4A 2G2OA 3VR1A 4YMEA 4JI7F 1K9MT 3M2UB 3A8EA 1WN7A 2HQ3A 3DDIA 3FGVA 1U1NA 3ZX2A 2IYIA 1IWGA 3CJTA 1KD1T 1Y00A 3O4QA 3G96A 3OSNA 2IVFB 4O8UA 1UAXA 4FS2A 3NHGA 3C16A 2NPIA 1SL1A 1WNEA 4B3MK 3MEEB 5GADP 1TUUA 1BDGA 3BN4A 1WOQA 2WB4A 5K14B 2FVPA 5AJ3F 1RTJB 5LXYA 4MMOA 4BS2A 2MKHA 2H3EB 2UUAF 3MZIA 2Y8WA 3BKTA 3FCWA 4IFYA 3DYAB 4PG8A 3P8BB 3ENWA 2V50A 2GWKA 4JKHA 5C10A 3H98A 3E01A 4PWWA 5ADXH 2C2KB 1U04A 4CEDA 3NGDA 4WKRA 2V7YA 1RBRA 4CZMA 1B99A 3AGKA 4JK9A 1B92A 4I2PA 1TKXA 2KXHA 2IVMA 2FYXA 4B3MF 5HVFA 2QE5A 4ER8A 1WAFA 4LBIA 3L95X 3O8MA 3F9MA 3DXKB 5DS7A 5IWAJ 3MCOA 4CJSA 3VEVA 4FJJA 1NHVA 1ZETA 2ZGZA 3CCMN 3FRYA 2ZZTA 1WHWA 3CC7S 1BIZA 1N32J 3KJQB 4OZ1A 1K1SA 1RWNB 3FBCA 1M5PC 2Y1LB 4NLWA 1FHTA 4CTAA 2ZH5A 2HHXA 3MPVA 2XHCA 1ZBIA 2Q36A 1UKUA 2E6LA 1B0VA 3J8AA 3JQMA 3THPA 1RWWB 3KK1A 1RCHA 3ZLJA 2ZE2B 1KQKA 3R27A 3PO4A 4Z4IA 2C2OB 2BEFA 1LK7A 4GKJJ 3C6HA 3CJ1A 2DRDA 1C0FA 5BR9A 5F8LA 1FI4A 1NJYA 2X3GA 1UZDA 2K3IA 1IR1A 3NKYA 2F65A 2HHUA 2IVOA 4LSLA 5ETPA 3GFZA 3VAMA 3ENOA 4LVNP 1WC5A 5FPEA 4NYZA 1YK9A 4BBYA 4ZVSB 5HJYA 4DV2J 3FEYB 2IMWP 4KTQA 4CNYA 1RDWX 5B7WA 3TWZA 2J9DA 1K0VA 4Y2KA 1BWEA 5KFZA 4ZVQB 1FNMA 3GIIA 5HATA 4UUWA 4DSEA 2NQPA 4OYOA 4BRCA 2AW0A 1JIHA 2E1ZA 3VQDA 3QESA 2BE9B 5E84A 3DRXA 2QZ8A 4M3RA 1AZSB 1CXQA 4PL7A 4FF4A 1P90A 3W3SA 1RABB 4NCAA 1R59O 4KH4A 3LDPA 3TABA 1B7YB 2VGMA 1ZS6A 4K2JA 1WBBA 3L4IA 3CC2S 1CVJA 3SK3A 2B4JA 2FC0A 1QSSA 5EOYA 4M7YA 1RJJA 2CJKA 3CCSS 3HHEA 3CQYA 4B1VA 3JTNA 2D3O1 2RF2B 3I56S 1HWJA 1LW0B 3CCES 2RT3A 1Q18A 1KVBA 2YKNB 3DGVA 2ROPA 3DOKA 1JLGA 2V8VA 3KZBA 4X4NA 2N3LA 2KU7A 1XI1A 4DHYA 1H72C 1BUPA 3IGNA 1V4SA 3DFEA 1KBRA 2EK6A 1VQ9N 4QIEA 3N5FA 2VWJA 1XTZA 4P52A 4OVLA 8ATCB 3OYJA 4DR5J 2P8IA 4U6PA 1K8KB 3CTRA 2VUGA 2HHVA 3P3DA 3AA5X 4CZCA 1BXNA 3HHLB 1UW4A 2B4VA 2JLEA 4KE5A 4O0NA 1KXPA 3MXJA 3M8SA 4NASA 1TP7A 4EFAC 1LWFA 3O6QA 1WSIA 1BHNA 2NXJA 1NM2A 3KDNA 1NLKL 3GG1A 5IXUA 4U7UD 3GIKA 2P5VA 4LRAA 2DPIA 5B0FA 2LVWA 1GXUA 4LF7K 4QR2A 4HEA9 3DOMB 4HH1A 1NBEB 3EKUA 3NRBA 4E1NA 2JH3A 1S6PA 5J2QB 4ZIWA 4IJAA 4JLHA 4KPCA 3K2PA 4ISGA 1RBOB 1E6VB 3P5BP 3PUFA 3CM5A 2VC1A 3UVJB 2OPSA 4N41A 4FLUA 3LF0A 2GNKA 4DX5A 1NGHA 4FK4A 3CFOA 1BHLA 1RTHA 4YS2A 4X4OA 1TL1B 1D9DA 3LZJA 2W2MP 4M5HA 4WZMA 4N56A 1L3TA 3VQ4A 4ETXA 4J91A 2QWMA 2BANA 3QRPA 2A2DA 5CD4H 3KOAA 2ZUAA 4N7TA 5HRNA 2QMWA 3B6OA 5AXLA 4GV9A 2GV1A 2VU5A 4AUKA 5LMUJ 3OHRA 1H2UX 3V9XA 2EKNA 1VLYA 4EHTA 1JLQA 2XMAA 2QTWA 4JI0J 4LQ3A 2MZJA 4A61A 1RT6A 5BXIA 2CQ1A 3OXLA 2PY5A 5AFUA 4LFBJ 3J81U 5B08A 4JI4K 1XHZA 2HHSA 2F4FA 3UKUB 4ED5A 5G4DA 2P6SA 2PSZA 1NGAA 1WSGA 3LP0A 1UEVA 1YIJS 2DHXA 4PYDA 5IQ6A 4R8UB 4LMZA 1RDBA 4RG8A 5GINA 1HL6A 4HYKA 5KFXA 3MOJB 1WI6A 3P38A 4IZ9A 1I39A 3QJLA 4J9QA 5K20B 3C66A 2RUGA 1RKIA 3VQ6A 4Z94A 3KUHA 2ZKUA 1WKJA 4J9KA 2F63A 3OL6A 3GP9A 1KQGB 1HNWK 4OX7A 3PJ9A 3BF1A 3M8ZA 4TVAB 4RW9A 1SJRA 4BHQA 2Z2LA 4UQGA 3TWHA 4CHYA 3SUQA 2GHWA 2F4VK 5D0GA 2O1PA 1JLBB 2XC9A 2GTDA 3I0RB 1DFDA 1C1CB 2OAUA 4KHPJ 3ZTPA 4M5IA 3HSDA 1Q81T 3R6MA 3CJ8A 4ID8A 4JI4F 1RE1B 4KRFA 3FMWA 4ZOSA 2I38A 2G8VA 2J7UA 3QSIA 5DQHA 5BPLA 2QSWA 1HYSB 3AO3A 4MDAA 3CCVS 2O8DA 4PWUA 2BE2B 2EWHA 4WFYA 3DRSA 1XNQJ 2HIYA 1S1UA 4KREA 4DV6K 4DX7A 4ZJQA 2KM8B 4OYPA 2FSJA 3ASMA 4QIGA 1FRLA 3K7RA 3VGKA 1RWOB 1FRXA 2XMJA 3SQOP 2R7VA 4M3WA 4DCPB 3FZHA 4LF2A 2F4VF 2B56A 1VAZA 1ZM4A 4X65J 2I9SA 4EYHB 4DR2J 1U8WA 2E4LA 3MDQA 4UTGA 2UYTA 4N5SA 1JLFA 5H9FJ 2IYGA 2C28A 2QKKA 3ADAC 3MGJA 4F0MA 7AT1B 3RMCA 4DSLA 4DTXA 2HEKA 3E8OA 3OS1A 3AB4B 5E3AA 1T02A 1R89A 4P2SA 4DV6F 4YHHJ 4NLYA 1CULB 4AILC 1NRKA 2JWLA 4K4UA 3SUOA 5T7BA 1QAIA 4DF8A 1YJUA 1UWAA 3AA9A 1LWEB 2YNFB 3T5JA 2YHWA 1FVSA 5M1PA 3MURP 3UN5A 4G1QA 2O8CA 2VFUA 3MWTA 2AYBA 4NA3A 4GVMA 4I67A 4RNMA 1Q7LB 2FHOB 3K89A 4C1NK 1WHXA 1SZ2A 4FM0A 3G8TA 1RT7B 1PG5B 1Q82T 2HFNA 3AVHA 1X1PA 3D6HB 2A10A 2P1JA 5GAEP 3Q8QB 3IG1B 1SJ4P 2PDAA 1KQSR 1YGYA 3FNNA 2R3VA 2VJVA 4FM1A 1ZM9A 1QM9A 4Y00A 4MKYA 2CKWA 4WE1A 4JI5K 4ZP8A 4IO8A 2GQ2A 1U2CA 3CC4S 3TR8A 5AQGA 3OS2A 3DM2A 1DURA 1SVDA 1EKSA 1YJ9S 3IAM9 4OJ1A 5L1JA 3VERA 1ESVA 4GKJK 3GB0A 4DI6A 2UXDK 4RW4A 2XY8A 3OVBA 1H3DA 1XBWA 2MXYA 2ZH6A 4HI2A 2MQOA 5KG2A 1LWCB 4DR4J 4BLGA 4YB1P 1JXVA 3TVYA 3A8JA 2DCUB 4HTUA 4C97A 1GNKA 1RUSA 2P9EA 4YR3A 1SKWA 1S57A 1LAVA 1N5YB 4L6V3 1LCUA 4C8YA 4F4YA 4JI5F 1N32F 7FDRA 4RW6A 2UVWA 3KK2B 4RCHA 4A47A 2NRTA 2ZFHA 2KKZA 2XLJA 1IBCB 5F0XA 4USMA 2AF6A 3DXSX 1SAZA 1HFEL 2B3TB 2ASOA 3VALA 4LF8J 4AL6A 3J7ZO 3IWXA 4E2FB 4GKJF 2UXDF 2OSRA 2Q3PA 5LSOA 4B9TA 3V9SA 1GEHA 4PWDA 3K2YA 1KQFB 1NJWA 4B1WB 3M30B 1U7LA 3M7VA 3MN9A 4CLUA 1VC0A 1Z2ZA 2YI1A 4U9RA 1DGKN 4E1MA 2IIHA 4CFDA 4YUDA 2Z58B 3H8YA 3VGMA 4CJ5A 4A8QA 2DK2A 3PW0A 4B1ZA 2VBXA 1RHRB 3MPYA 1TL7B 5KPTA 2HZAA 4E8UA 2G8HA 1LEOA 2XCAA 4CLKA 2JWKA 3PKMA 4MKAA 5DLGA 1Z4UA 3BO3A 4QS7A 2RAQA 2OPQB 1I51B 3K8VA 2VCPA 3VA0A 4JKCA 3QAUA 4CEFA 4FNHA 3T3FA 1GMWD 1RT5A 3E66A 1X5TA 2Z8QA 1FJ7A 3AO4A 1KFDA 1LOTB 3G9CA 4CNZA 1YJWS 1M90T 2NCKL 2I7NA 2RRBA 5KFLA 2WVFA 2VGNA 4FLTA 5HRRA 4ZPTR 4DQRA 2BJEA 4EYIB 3M1FA 1JKHB 2BUNA 1RT2B 2R8GA 5D3GB 4KAIA 3EDQB 3GE9A 3QATA 1C0TB 3LP2A 3FRZA 1DTTA 2UUTA 2RN2A 4PPDA 2HHHK 1B70B 1WSVA 3KD1E 4W4MA 4O4GB 2Q6BA 4X62J 4U8VA 1NOYA 3OR1B 3WC2A 4HUEA 4FF2A 4WYBA 4WQ5A 4F67A 1YSJA 4DG1A 4FJKA 3P31A 2LQJA 1GMVA 5KT6A 4DR5F 1UP1A 4C11A 2FDNA 1QD1A 3V1QA 3M6XA 1Y64A 2J7WA 3KLHB 1NK8A 3OXFA 2P2CB 3OYLA 5I9EB 3CJ0A 3LANA 3MX5A 3OQ2A 3CJCA 1FX4A 2V2KA 3R1HA 1FESA 3QNNA 2J9EA 1MU2B 3ZETB 1T7PA 1KP6A 4AHCA 1XC3A 3DU5A 3NBPA 4WQ5C 5ETSA 3T9NA 2APOA 2EHGA 1Q5YA 3OL9A 1YI2N 1T94A 3ZT0A 5LMUK 4X84A 1ZBUA 4ECVA 1VQNS 3OFFA 2DTUA 1CPZA 3O9SA 1Q9XA 3LDOA 3NP5A 3IMXA 2FJBB 9RUBA 3DDNA 2EFNA 3H3OB 3CCUS 4DV1J 3W63A 3FEXB 4M5JA 4DFKA 2ZHBA 1QZ5A 4C0OC 2VQFJ 4OHWA 2EG2A 2MKCA 4TYAA 4FLZA 3PY8A 1OMSA 1T3VA 3RZAA 1QZ6A 4YR0A 3HVTA 2JWNA 4BRPA 1REVA 2P9CA 2HBRB 3TRGA 1FKOA 3PIPL 3MPUB 5D15A 3CCZA 4QCLA 4PXEA 2YY3A 2QK9A 1DY3A 4CFAA 4LRFA 5LMUF 3OYEA 1WORA 3JTOA 5FIIA 2NXCA 4A8YA 5KPRA 1QUPA 1Y9OA 3VEOA 4L3KA 2RB7A 4GNIA 4FWQA 2DNKA 3T1YK 1WSHA 1ZA2B 4NYFA 3FC9A 1FX2A 1Q7YO 3TJ9A 1GQEA 1YF5L 2HBMA 1QQCA 1Q8IA 3DRPA 2BW2A 4FF1A 3KK3B 4CH7A 2ZC3A 4HDGA 1RYRA 1ZTWA 2CQHA 3BYRA 2W9CB 5AQNA 3TUJC 4TY8B 3D0IE 4E19A 3IBWA 2XM3A 3WX4A 1SCJB 4DV4J 1YJNN 2V67A 3JSBA 3O3LA 1TELA 4IDHA 4FYXB 4A57A 1XNQK 2LMIA 1BLUA 3SYZA 3ZZYA 2J9DE 3NS6A 5KFDA 3QWUA 2GELA 2ZZNA 4GC6A 1KC8O 3FBFA 3U9ZA 3C94A 1LK5A 4P72A 4EZ6A 3HKWA 3QLHA 1XMOJ 2P9IA 4DTRA 4JK7A 5JVGL 1FWPA 3WZ0A 4OZ5A 1U45A 3MAAA 1O8BA 2KG0A 1T05A 4X65K 3T1YF 4JRPA 3CCWA 1VSJA 4HL9A 2OIHA 2G8IA 2BTFA 4HTLA 2LLZA 3T6JA 3R5AA 1OIAA 1LNQA 3LM2A 1WACA 3DLRA 4KT0C 1XR6A 4DUYJ 1HBUB 3SMPA 4K4VA 1PJ7A 3K59A 1VJQA 3KHGA 5FPNA 4OLAA 1RHKB 3BQ0A 1XN9A 4LH5A 1XNQF 4ZP7A 2D0CA 3GG4A 2E5GA 2MEWA 4DFMA 1S5JA 4JP8A 5LXRA 5AZJA 4HVZA 4ZVRB 2AYGA 4D3GA 2HMIA 2JVRA 5JS2A 4HT7A 3PYGA 1RNHA 5AQRA 4KFBB 1ASWA 5KQ8A 4QW8A 3HJVA 1SH2A 3H5XA 1TK0A 4X65F 2O8FB 4DR2F 3CPWM 3P5JA 2EC0A 3TSUA 1NGEA 4FLYA 4GC7A 1MN9A 2PMHA 2LXIA 4NI2A 5A8WA 4ETZA 1OPIA 3QQCD 4AF1A 4E7JA 4J9MA 1WWHA 1U24A 1OY9A 1HWIA 3SQGA 1B0TA 2B5JA 2ZUGA 1A6LA 5ETQA 3F0NA 3KDOA 5AQIA 4NLDA 4DN9A 2O01C 4CIEA 4KHQA 3ZFVA 1S10A 2AMCB 2JJ4D 5LJ3Y 3FCVA 4GW6A 4H0OA 4A8OA 3K5MA 1V3RA 4YDDB 4USWA 3CIZA 4JI1J 2M88A 1R27B 2KJWA 3O3FA 4CK2A 1RT4B 2OPRB 5ADXA 4H0PA 2IBOA 1WSFA 1M1GA 3V81B 3HX9A 2OYQA 2RRAA 2D1KA 3D3BJ 4HLBA 2DVIA 5FRMA 3ILJA 1KVAA 4DCOB 3HLUA 5MLCQ 3OHBA 4CECA 2LA6A 1I3AA 3N6LA 2FGCA 5B0AA 2M5YA 3SSRA 2XB2D 3CCLN 3R2DJ 1JNZB 3FLCO 3BB5A 3VPZA 3IWLA 2GEMA 3G10A 3RBZA 1I94J 4BC9A 3HSCA 4U7BA 3A5OC 4HACA 1QY7A 3WNEA 2E5HA 1WSRA 1S6UA 4DTUA 4MTPA 4W5RA 2H54B 1D8ZA 4AHRA 1SB6A 2R8JA 1NH7A 2ZD1B 4DR4F 2VD3A 2ZGYA 1VRTB 1W7WA 4LF9K 4IDKB 2CJQA 1VQ9S 3BPDA 3NGSA 5AR0A 4QIWD 4ES1A 3M8YA 3CFRA 4O3OA 4UOHA 1W97L 2G4BA 3QNWB 3T69A 1KS2A 2BJ8A 4BR7A 3VMFB 1HBOB 3MFHA 1R8CA 1IKYB 1EETA 3JB9k 1CJTB 1YITN 4WIIA 1FCAA 1BWFO 4KB0A 2GZOA 5KFQA 2G8FA 1HKGA 5GAHU 1DLOB 5E26A 3PLAA 1EP4B 4WFBQ 1VMBA 2OD6A 2EG1A 4XO0A 3FDSA 1TAQA 4IQMA 2V94A 3SZ2A 5LMNJ 4GMKA 4CHZA 3LDLA 2VFVA 5ETMA 3U3GA 5A8RB 3M2RA 5IT0A 3SV4A 2QLBB 3WIVA 1JLEB 1X7VA 3QWPA 2YBVA 2HWHA 3L7OA 4A8WA 5JS1A 3MPDA 4PG4A 2WZ1A 4B9MA 4X62K 5M2RA 3MM8A 4WFAQ 2XY6A 3MMBB 4HR2A 4KKOA 3RTVA 3GWCA 1HQEA 1JLAB 1GK8A 1PC4A 3O9UA 3UN2A 4HTIA 4BGAA 1U1RA 4Y1CA 1TK5A 2PI5A 2MZSA 4M45A 2QMXA 4IUFA 3CWJA 3U1MA 3RB6A 1U4BA 1BC6A 1S6QB 2QYGA 4B3TK 2G1DA 3NGRA 1RAEB 4C0BA 2D7SA 2HYIB 1BQMB 3BEGB 4ID5A 2FJDB 1RBSA 4LVOP 2F8SA 3VEYA 1NSPA 4QS8A 1VQYA 4M5DB 1S4EA 3GYGA 2V6AA 3FSYA 4JAXA 3KLFB 2OKQA 2VFTA 5FPMA 2VG6A 3SAGA 2IAJB 2ADBA 2M7SA 1QSLA 3ZSYA 2PO4A 4H54A 4X62F 2ZHOA 1PJ6A 2FHMA 3L2RA 3KLGB 3EN9A 3F9KA 1K47A 2W8KA 4O5FA 4LIWA 3RBXA 3NMUA 1S1TB 5BRFA 3C14A 4ZHRB 3VAGA 3PIPQ 3TZYA 4TQRA 4KJIA 1Y5IB 1IKVA 2HSEB 4O3PA 1T3NA 3RUBL 4B3TF 3CCTA 1QHTA 2GJIA 1J27A 2RQKA 1TYQA 5K5MA 4B02A 3KTQA 3VTHA 4LR7A 3JAMY 4O44B 3MI7X 3EO3A 3HI0A 1VSHA 5K8NA 1Q5VA 4I1TA 4C48A 2KYZA 3THXB 2NSBA 4Y2IA 1Y7PA 1CLFA 5H9EJ 3RMAA 4AQYJ 3D2EB 2MQMA 2ZBQA 2B7BB 2XULA 4WBFA 3MM6B 4DN0A 2FBVA 1GOCA 2A40A 4K41A 1G6BA 5CD4A 1N0UA 2FGOA 3RRKA 3AA4A 3LL3A 5EX5A 3SBTA 1HPMA 3AT1B 1U49A 5J2MA 1DQ9A 1FO1A 1VSDA 3GOIA 3FUYA 4P2FA 5D77A 1RTDB 3WEEB 2CG8A 3HFKA 1KTQA 1IUJA 5LY3A 3G6YA 5KG6A 3NF6A 3P6YC 1L3KA 5EWFA 4NZ6A 4K59A 3MMAB 4CHPA 4XPEA 3OUYB 2D0PA 3QO9B 3QFHA 4BE1A 2OEKA 1I5OB 3DLEB 2JLGA 4DCJB 4C8NA 1RU2A 2YNGA 2RNEA 1SKSA 4MO5A 5E5NA 1MWKA 4I0WA 2YKMB 2FJEB 1RDDA 3W2WA 2HVZA 3DJCA 3UD3P 3ITHA 5I3UB 1VQ6N 1QVGM 3RAQA 3M9NB 2E5LJ 4P2MA 3TANA 1RT1B 3IRWP 4I6MA 8AT1B 1F0XA 1HNZK 3AAPA 3H08A 1CLQA 3CDUA 3T1HK 1YBTA 5DETA 2I6WA 4ZVGA 3CCJN 1NK7A 3KJNB 4NLCA 4G1IA 4TYBA 3WXLA 4ECRA 2NPFA 4FJ7A 4DFJA 3UNYA 1VHIA 1IJFB 3PJXA 2ZOGA 2ZBIA 4DJBA 3RGIA 3VA3A 5E3RA 1EKRA 4AXIA 1YUWA 1S3XA 3GZ7A 3BY5A 2ZNZA 3ZSZA 3ZT2A 2CQIA 4ID1A 5AQUA 3RMBA 2YWWA 3ETOA 3CI5A 3QBXA 2J5AA 4EIAA 5C24B 3FEZA 4B1YB