3DLGA

Crystal structure of hiv-1 reverse transcriptase in complex with gw564511.
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
539
structure length
531
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 150
structure length 531
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dlgA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dlgA05
2FC0A 1MMLA 4MK8A 3LPTA 1SL1A 2PZSA 1RCHA 3PW2A 1RDDA 3H5UA 5C25B 4M41A 3HK2A 4PUOB 2OZMA 2HHUA 2WONB 2WB4A 5HROA 5L9XA 3AVNA 1WSEA 1FKPA 3CDEA 3RMDA 2YNIA 3BSCA 1RTJB 3NGZA 1F21A 2YNHA 3AVAA 5KFYA 3TI0A 1JLEB 4WFXA 4CJTA 2YHBA 1NKCA 1S0OA 2DTUA 4YR2A 1RT2A 2ETJA 3MF5A 3E51A 2O4IA 2R7YA 4B3OB 4LSLA 5I3UB 2NUBA 3CJ4A 3RB6A 2G8FA 2F96A 2R8KA 4HYKA 3LP0A 1K1QA 3AA5X 3THVA 3JSMB 1CLQA 4DSEA 4NYZA 3QGGA 3V6HA 3LPUA 4K4VA 4TQRA 1BHLA 2FBYA 3PV8A 4KHNA 4ZTFA 1S9FA 4OPKA 3CM5A 2ZKUA 4DFKA 1BQMA 1C1CA 1JLAA 3KLHA 4ELUA 3H5XA 5KFQA 2AX1A 4IR9A 3I0SA 3IG1A 4KTZA 4Y2CA 3LP1A 1HQEB 2G8KA 4B9TA 4FJNA 3KK3A 1UAXA 1C0TB 2BANA 1JXEA 4ZP6A 1WSGA 1GX6A 4NLXA 2QXFA 1S1TB 2FVRA 4CF0A 1ITGA 3OYMA 3SI8A 4R5PA 3KK2A 4TYBA 1UWBB 1RT5B 1JX4A 4Y3CA 4CF1A 5F8GA 2RKIB 3ZSYA 2XWYA 1HNIB 4CJRA 4MIBA 5DG9A 1Y97A 1UWBA 3KLIB 1BI4A 4CJ4A 1TAQA 5KT7A 4ED8A 3GV7B 2HVHA 2PY5A 1QAIA 5JXSA 4K8ZA 4M45A 1TVRB 1U47A 2BE2A 4B8CA 4CGDA 4W5RA 3RMCA 1TKTB 1L5UA 2XY7A 3KNAA 4AHCA 1J9AA 1CXUA 2HNDB 4EBEA 3EYZA 2FVCA 4TYAA 3VQCA 3ZSWA 2Z1HA 3MEDA 3DMJB 3WNGA 3TAMB 1NJZA 5J2MB 3NAHA 4TQSA 1RDCA 3HVTB 1LWCB 4KE5A 1NOYA 2AWZA 4MFBB 4DTMA 5KTQA 4DSFA 3PW7A 5FDLB 4EP5A 4Z4FA 4FJ8A 1WAJA 4KFBB 4AILC 2WCXA 4J2DA 3CFPA 1S5JA 2VG5A 1BQMB 4Q0BB 4KTQA 4DTSA 5KFZA 3PR4A 1IO2A 3K5NA 3G6XA 4ECQA 1RDAA 1YTAA 2HWHA 3SQ1A 3GV5B 2IDOA 5L1LA 2EHGA 4DU4A 4OLBA 1QAJA 3P1GA 3TAMA 4KAZA 1KLNA 2B6AA 4CE9A 3VQDA 3NBPB 3HPOA 3MFIA 3BGRB 3I0SB 2Q3SA 1CXQA 2HHSA 2RPIA 3OYKA 4RW4A 1S1WB 1S9EB 1S1VB 3F9KA 2D5RA 2WHOA 2C22A 4CJVA 1IH7A 4O5BA 4E7HA 4KHSA 1SUQA 2B43A 1IKYA 3Q8QB 3O4NA 4GVMA 4FLUA 1DTTB 1T8EA 2HHWA 1L3VA 1FKOB 4CGGA 3SV4A 1X9WA 4KREA 1DTQB 1JKHA 1S6PA 4E7JA 1BCOA 3Q8SB 4DFPA 4ECXA 4CK2A 2KQ2A 4MH8A 2WK4A 5DQHA 3OHAA 3GV8B 4DQPA 4RUAA 2ASJA 4IDKA 3QZ7A 3QINA 3RMAA 1IM4A 1JXLA 3IG1B 5J1EA 3LZIA 4KO0B 4O3OA 3QEXA 1HNVB 4E1NA 1BISA 3KK2B 2W7OA 4CESA 3VQBA 3PO4A 3VA3A 4UQGA 1W25A 5KG6A 2J6SA 1QSLA 1NK8A 1TKZB 4FVMA 4PWDA 4DTOA 1QQCA 5C5JA 4F4XA 3GIKA 1A5WA 4E7LA 4NCBA 4LQ9A 4H4MA 2V0NA 1QHTA 4IH6A 3P83D 1DTTA 4K4TA 1VRTB 5T7BA 5FROA 4DLEA 2KZZA 2HB5A 3DYAA 4EZ9A 4CJUA 2UVRA 4FYDA 3PX4A 1TP7A 3F73A 4J9NA 1VSIA 2ZQBA 4LSNB 4LD0A 4BE0A 2O5DA 1C0UA 4WZMA 5KFSA 3K5MA 4CJ3A 3QESA 3DLEA 2JC0A 5C24A 5KFCA 3OJSA 1J5OA 3NKYA 1HJRA 3SFUA 5KFKA 1S1UB 3LP2B 1RBSA 3DRPA 1EP4A 2XGPA 3L2RA 4Q43A 1JL2A 1S1UA 4ED0A 4F3OA 5HRRA 3L2UA 4N56A 3K2PA 1RTIB 4HUGA 3KLFA 3OYGA 1S6QA 1S6PB 1SKRA 1C1BA 1LAWA 3CO9A 2RDIA 3H5SA 1FXXA 2HNYB 5KFPA 1S1XB 4TLRA 1BL3A 1VSKA 3QEPA 2XCAA 2VA2A 3IAYA 4Z0UA 4BE1A 1ZBIA 4CEBA 4RW8B 1KVAA 4KFBA 2GBZA 4R8UA 1S1VA 4ZPDA 4J9PA 4NLDA 3RBEA 3ISNC 4E7KA 2GV9A 3SUQA 1REVA 1DLOB 4ZHRA 3V81A 2OPSB 5KT4A 3D0PA 1N5YA 3AO1A 2OYQA 4CEFA 1WSJA 4DSIA 4CJSA 3ZSVA 4DU3A 3QZ8A 3IRXA 4ID5A 5F8NA 3ZT3A 1RTDB 3IN5A 2V4RA 4FLZA 3M8RA 1SH0A 4F2RA 4K8XA 1RT1A 2HNDA 1ZBHA 3OL7A 2X6SA 4KTWA 1EXQA 4Z4GA 4Q8EA 1TK8A 4EYHB 2V9WA 3CWJA 2BDPA 1LW0B 2VG6B 3DLGB 5KFDA 1ZBLA 4ZVHA 5J2MA 4DQSA 4YP3A 4FJHA 3KIOA 1JLCB 5HLFA 4WFZA 3H98A 2W9AA 2HNYA 3O3FA 4NLGA 2C2RA 4MKBA 3NF9A 3VQSA 1GOBA 4NCAA 3QGIA 1XR6A 3H4DA 3ZSZA 4FW2A 1N5YB 4N47A 4CHYA 3KK1A 3DLEB 3L2QA 3KOAA 2HHQA 3GIJA 5KFNA 4QOZB 2FVSA 1ZBFA 1HPZB 1FKPB 4CF9A 1VRUB 4ID1A 4WXOA 3TVKA 4O4RA 4IR1A 2PYJA 5KT2A 3V6DA 3KLHB 4J9QA 5KI6A 1NK6A 1NJXA 4RNHA 4ELTA 2VG6A 2D3ZA 1T3NA 4DTJA 4FBTA 1JLAB 1C1CB 2G8WA 5DLGA 4ZPCA 2RN2A 2X78A 3OYBA 4FJ9A 4IRDA 1VSFA 2E6MA 4RZRA 2X6NA 3KHRA 3UPFA 3FRZA 4TY8A 2KW4A 4LY7A 2WOMB 4KKOB 5HRNA 4Z4HA 3RMBA 2KFNA 5I3UA 3CDUA 2R8GA 2DPJA 5KFHA 1WSFA 4YR3A 4R5PB 1I39A 3BQ1A 3I5CA 3U3GA 1J5OB 2IC3B 1U48A 1FKOA 4OVLA 4O44A 1C6VA 3SZ2A 3T5KA 2EX3A 2W8KA 4NZ0A 3TAQA 3HJFA 4CFBA 5KRSA 4AHTA 3MAQA 1Q8IA 3RWUA 4CF8A 1RTJA 3HHKA 1I6JA 4U6PA 2W42A 4JUZA 3UQSA 4DFMA 4CIEA 3M9MB 4F4KA 4AHUA 4KAIA 1S1TA 1RTHB 4FZXC 3RAQA 1BGXT 1HNVA 1FK9A 4YNQA 3ITHA 3V9WA 2O4GA 1N56A 3NH1A 3JYTB 4DWIA 4FS1A 2ILYA 4WE1A 4NLUA 3VQ4A 1J53A 3RR8A 4FZYA 2IS3A 3G10A 4FW1A 3DRRA 4OKEA 4B9VA 5F8IA 1RT7B 3T5HA 2Z1JA 3NCIA 2HW3A 5HRPA 2XY5A 3K5OA 3V6JA 1QS4A 4RUCA 3BSAA 1RT4B 2OPPB 2PYLA 3KD1E 1RDRA 4DL7A 4H8KA 3PJXA 3AVIA 3QGHA 4R8UB 4DQRA 4CEQA 3CDWA 3FDSA 5D3GA 4B08A 4FJLA 3VQQA 3QNOA 5L1KA 5SWMA 4RNOA 1S1XA 1RT6B 1B92A 2ZE2A 3LP3A 3QO9B 1RDBA 3BQ0A 4RNFA 3RRGA 1CZBA 4YR0A 1Q9YA 3QIOA 5KFXA 3QLHA 4JRQA 3ZCMA 4Y2AA 3IGNA 5DQGA 3M9OB 2IM1A 1RYSA 3G86A 1X9SA 3SJJA 5KFLA 2LSNA 4KB0A 5KFEA 3I0RB 5EWGA 3S9HA 2IAJB 3TQ1A 1TL3A 4URQU 2XGQA 2W8LA 4FJJA 4IOBA 2YV0X 4IKFA 4F50A 3LAMA 3KLEA 3TANA 3K5LA 4DTNA 4KB1A 3LWMA 4NLRA 1TL1B 1ZETA 3HT3A 1S10A 4CJPA 1JLQB 3AO5A 4W5OA 1XWLA 3SQ0A 4O0JA 3ZT0A 1RT7A 2W9BA 3H4BA 3TAGA 2OPSA 2JC1A 3CIZA 1G15A 1TVRA 4Z4EA 2YHAA 3NGYA 1QTMA 3OS1A 3VQEA 4DTXA 4OKKA 3MXIA 1BI4B 3ZSRA 4DG1B 3V9UA 1LWEB 2GC8A 2R8JA 4BDYA 2D0BA 4K4XA 3VQPA 4M95A 3KJVA 4Z4IA 1KFDA 2YKMB 4MK9A 3KLFB 2VWKA 3VQ5A 1TKDA 5J2PB 1SV5B 5F8JA 4CK1A 2P51A 1LW2B 2OPQB 3MEGB 3KLEB 1IG9A 4O4GA 3DLKA 4J9SA 2BQ3A 4RW6B 3IS9A 3AVMA 2D0AA 2E9RX 1UA1A 4TXSA 3FQKA 5J2NA 4FBUA 4M3TA 4FK4A 1BIZA 3V6KA 1CZ9A 3V9SA 3OYFA 2G8HA 3T5LA 2BGGA 3V1OA 4G3IA 5KG1A 1VRUA 4ICLA 3OLAA 5K14A 3DOLB 2XC9A 1HQUB 2OA8A 2R2SA 4AHVA 2UUTA 3SUNA 3MEEA 3PHEA 2AQ4A 3QEIA 4CERA 4DL2A 2AGPA 2BQUA 3NGDA 1TL3B 4ELVA 3LDSA 4W5NA 1JLEA 2W7PA 3V4IA 3QYYA 4Y34A 2ASDA 3MR6A 2G8UA 3DRPB 3V4IB 1D1UA 2P5OA 2IC3A 1N48A 1X9MA 4CK3A 3TWHA 4IKAA 2QKBA 1D9FA 4J9MA 4ID5B 1KLMB 4ED1A 2EC0A 4F3TA 4FS2A 1N6QB 4Y1CA 1KLMA 3HVWA 3NMAA 3NGIA 5KFFA 4CECA 4JV1A 1W0HA 2YNHB 2R2RA 5F9LA 2RF2B 1K6YA 4DG1A 4LSNA 1NK4A 3CQ8A 4FCYA 4I7FB 4IFVB 3K57A 4F2SA 1HMVB 5SZTA 3OS0A 3DLHA 3BGRA 3DM2B 2KZMA 5CYMA 5J2PA 4KHUA 3T5JA 1HYZA 4M3RA 1S48A 5EU7A 3S3NA 3NFAA 3PX6A 4RW9A 5DG8A 1KTQA 3IRXB 4L8RB 3KHHA 1XR7A 4RNMA 1BIUA 4F4ZA 2XI2A 3LP2A 2HMIA 2BRKA 4YMEA 4K4WA 1S97A 1WNSA 4WYLA 2BE2B 4I9QA 4CEEA 4CF2A 4TY9A 2KFZA 4C8NA 2AJQA 4O3PA 3V1RA 4E89A 1JLGB 2B6AB 5KFGA 4DL5A 1RYRA 2YNIB 4IFYB 3SI6A 3PR5B 1HYSA 2D41A 5FRMA 3PVXA 4K4UA 4CIGA 3ISND 4E0DA 3QIDA 2RDJA 4FM2A 3HVTA 3HKWA 1VK0A 3QNNA 3H40A 4QPXA 3DRSA 4KHYA 1MU2A 1EX4A 5J2NB 1WN7A 1L3UA 1RAJA 1JLBB 4I2PA 4O0IA 5DGAA 4KRFA 2JEJA 4ZP9A 4ZVEA 5HP1B 1NHVA 3M8QA 2V4QA 1B9FA 3SPYA 3OYLA 1Q9XA 1NK5A 3SQ2A 3M9NB 1XC9A 4FZZA 5CZ2A 3KLIA 4J9KA 1YTUA 3MR5A 3V9XA 3EZ5A 2FLPA 3M8PA 1JKHB 1NJYA 4Z4CA 1RBTA 1S0MA 4RG8A 1C1BB 3O4QA 4CGJA 1T03B 2IM0A 4CHZA 1ZTTA 1NK0A 1D8YA 4NLYA 2Z1IA 3S3OA 5DLFA 4M3UA 4J9RA 4IFVA 3H08A 3KHGA 1TK0A 4EZ6A 4HCCA 4XO0A 3DOKB 4KO0A 1XHZA 1XHXA 1KHVA 2FJWA 5L1IA 1J54A 5F8MA 3I5AA 1KRPA 1VSJA 5FRNA 3RRHA 4CIFA 3AVCA 5K14B 3L8BA 5KFVA 4PY5A 4WZQA 4DFJA 3KMQA 4C8MA 4I2QA 4AHSA 1L3SA 4J9LA 4Q0BA 1RBUA 1RILA 3MFHA 4I7FA 5KFBA 3C94A 4J9OA 1NNDA 1T03A 2ATQA 4Y1DA 3WNEA 3B6PA 4Q8FA 3GIMA 1LAVA 4DL4A 3CVKA 4ECTA 1BQNB 1A5XA 1LW2A 2QV6A 4M3ZA 4RW6A 4Q5VA 4LSLB 3JYTA 4CJKA 3BQ2A 5KFRA 4IG3B 1TKZA 4B3OA 3I8DA 2GUIA 5DG7A 4B9MA 3LWLA 4O44B 2QK9A 4PQUB 3SPZA 3DRRB 4M42A 2HMIB 5JUMA 4FXDA 3RB0A 2ZD1A 3NF7A 3SQ4A 2XY8A 4RW7B 3KLGB 2JEFA 3AVLA 5F9NA 4Q45A 4DMNA 1LV5A 1C2PA 4EBCA 4DTUA 4KHWA 1TV6B 4O4GB 4OLAA 4KKOA 4BWMA 4OGCA 4IFYA 1TL1A 4QAGA 3DMJA 1RTHA 1WNEA 3WNHA 4BE2A 4C8LA 3HP6A 4FJXA 1JLFA 5KFJA 4K4YA 4IG0A 5CY4A 3NE6A 4ZPBA 4NRTA 5EWEA 1X1PA 3AVHA 3CM6A 5KFWA 3PW4A 4GMJB 2QE5A 3G6VA 1D9DA 1QSYA 4X2BA 2XRIA 2R2TA 3DOLA 3IGVA 4O3SA 5F8LA 4FM1A 2FLNA 2DY4A 2Y1JA 3NDKA 5HROB 3AA3A 4E7IA 2XY6A 2HHVA 2DPIA 1HYSB 1ASWA 1IKXB 1RT1B 1Z4UA 3G0ZA 4CHQA 1HQUA 5F8HA 4DQQA 2YKMA 2IOCA 4G1QB 3KKSA 5KT6A 5J2QB 4DL6A 3OYEA 2G8IA 2HHTA 2CKWA 5KFOA 4CHPA 4MKAA 3NAIA 4ECZA 4ED3A 3N6MA 3DOKA 1YVFA 1B9DA 4FLTA 2C2DA 2YNGB 2ZE2B 4W5QA 1WSIA 4WXWA 4CFAA 1SL2A 5KT3A 2I5JB 1KVCA 4CHOA 3ZT1A 1T05B 2CJQA 3MTKA 3UDLA 2IA6A 1RT5A 3CJ3A 4DSKA 2X74A 3AVGA 5KFAA 5T14A 4DLGA 3HXMA 5HBMA 5KG5A 3FFIB 5EDWA 3TARA 4DSLA 3OYDA 3NH0A 1YVUA 4O3RA 1S4FA 3D5MA 1HMVA 1YT3A 1Z25A 3OL9A 4OPJA 4W5TA 3SYZA 5KG3A 1RBVA 4CJEA 1LWFA 4JLHA 2R2UA 3C6TB 2IM2A 2IM3A 3PZPA 1MU2B 2JEGA 1BCMA 3HL8A 4ZTJA 4I9LA 4ZP8A 4RNNA 1RA6A 2F8EX 2OPQA 3MEGA 3HPGA 4EO8A 4CEDA 3QEWA 3PJWA 1HNIA 2ITGA 3DDKA 4FLVA 4B9LA 4DS4A 4EYIB 1RT3A 1JLBA 4I2PB 3HVAA 2Z1GA 4C8OA 3VQ7A 4ZHRB 3V81B 1O1WA 1ASUA 1JLGA 2WONA 1TKXB 4QWDA 1KFSA 4URSA 4OGEA 3HVRA 1HARA 2D0CA 4EO6A 4MK7A 5KG4A 4I2QB 4FLWA 4FLYA 4BACA 4JS4A 4K50A 3GYNA 1OS5A 3GQCA 1S9GA 3H59A 1LWCA 3AA2A 3PY8A 3OYNA 2WOMA 4O55A 4IRKA 3SUPA 3LAKA 4ZP7A 1HRHA 1DLOA 1REVB 4CJLA 3TAPA 3WNFA 2XCPA 3CJ0A 3I5BA 4ED7A 2FBTA 2C28A 4XPEA 3V6DB 2YNFA 4CFCA 3HO1A 5DK5A 5C42A 3M8SA 4ZVGA 1RBRA 3B6OA 1TK5A 1RTDA 2XI3A 4ZPAA 3ZSOA 1TAUA 4JRPA 2ALZA 3Q8RB 5KG0A 4QWBA 4HUFA 1VSLA 3OYAA 4GC7A 1RTIA 1VSDA 3U6FA 5KFTA 4NLWA 3MXMA 2KTQA 1HQEA 3DLRA 3EZUA 3ICLA 1S9GB 4K4SA 4DL3A 3ULDA 3VQ9A 2D7SA 3QERA 4CJ5A 1IKWB 4KHMA 2JEIA 2DFFA 3RB4A 4C8KA 3DRSB 4AHRA 3OL6A 4JV2A 4CGHA 2W9BB 4NYFA 1ZBUA 4IG0B 3KD5E 4H54A 3OLBA 3EY1A 2IMWP 1DTQA 4MIAA 1WSHA 3MR3A 3PUFA 3T19A 1KCFA 1D0EA 1GOAA 2UVVA 3JSMA 2FLLA 4DQIA 4YQWA 4CJQA 1ZTWA 1GX5A 4RW7A 3HPHA 3K58A 4LH4A 3KJVB 4XIUA 3CFRA 3ZT4A 3A2FA 4CJWA 4FK0A 2FVQA 3QIPA 1JL1A 5CZ1A 4TSXA 3NHGA 2ILZA 2VG7A 4ECVA 4B9SA 3IS9B 4HHTA 3NBPA 4J2BA 4XPCA 1IKYB 4TY8B 1S49A 1VSEA 2AU0A 1U04A 1EKEA 1HYVA 3D28A 5FDLA 1S1WA 1S9EA 1I3AA 3RAXA 1EETA 4DU1A 5HRSA 2E6LA 2E9ZA 3NL0A 2WRMA 3VN5A 3AA4A 4KB7A 1RT3B 1U4BA 3DYAB 1LWEA 5E41A 4CGFA 5EUHA 2F8SA 2IBKA 2OPRA 1U45A 1EP4B 3O3GA 1QE1A 4KI4A 1NK7A 5C42B 3PW5A 3D45A 1IKVB 4NLPA 5CYQA 3SUOA 1NJWA 1ZYQA 5KG2A 2UVWA 3CJ5A 4GW6A 3OJUA 1LW0A 4MFBA 3TR8A 3BSOA 3L3UA 4N41A 3VQ6A 5J2QA 3OHBA 4M3XA 1XR5A 3GIIA 3AVKA 1T94A 1JLCA 4NCGA 5J1EB 2VA3A 4PWDB 1SKSA 3NH2A 2ATLA 2G8VA 2B5JB 4KI6A 5CYMB 1NHUA 4K4ZA 4J2AA 2YKNA 2A1SA 1SUQB 2QKKA 5HP1A 1NKBA 4EP4A 1NKEA 3C6UB 3L2WA 4ED2A 4NLTA 3BJYA 2YNFB 1HPZA 3E01A 3M8PB 2HNZA 2P1JA 4QW8A 4KV8A 1VSHA 1CSJA 3KTQA 3KHLA 2FJXA 4H4OA 4F4WA 4N5SA 3RTVA 4EEYA 3OYHA 3C6TA 2W9CA 4DTRA 4NCGB 3HSTB 3SCXA 5HLFB 3RB3A 2AGOA 3ZSQA 2HWIA 4LH5A 4FJMA 2YNGA 3RR7A 4KHRA 5EWFA 1QE1B 2RKIA 4FJ5A 2OPPA 4KBIA 3G6YA 3PX0A 3TABA 3ZT2A 4NLOA 4FLXA 3NF6A 3CJ2A 3P5JA 3OL8A 3KKRA 3TAEA 4ICLB 4HCBA 4WYWA 4F4YA 4Q44A 3EPGA 4OJRA 4RU9A 2FBVA 4FJKA 1QUVA 2ZD1B 3DM2A 3N6NA 2E9TA 1WLJA 2IJNA 1S6QB 3UIQA 2VG7B 3AO2A 4EBDA 2R8IA 4QWEA 1TV6A 3QIPB 2UVUA 4IH7A 4CFDA 3OY9A 1JLQA 4KHQA 4QWAA 2IGIA 3PO5A 2J6TA 3VQAA 4DSJA 4FJGA 4H4MB 5C24B 1JXBA 3U3YA 1JLFB 4CCHA 5KG7A 3KK1B 2FBXA 1EETB 3KMSA 3RBDA 4FJ7A 4CGIA 5C25A 1U09A 4ECWA 2GIRA 4ED6A 4BDPA 4BDZA 2VWJA 2IJFA 2E4LA 3M8QB 3LP0B 3SFGA 2AGQA 4HVJA 1KVBA 2Y1IA 3MECB 1W9HA 3T3FA 3AVBA 4G1QA 4IQXA 3KLVA 3NAEA 4ZMMA 1FK9B 2JGUA 1Z26A 4RW4B 2OH2A 3MEEB 1NOZA 3AV9A 1GOCA 1R0AB 1C0UB 1JIHA 1RT6A 2J6UA 2W9CB 1RA7A 1T05A 3N6LA 4JS5A 3MXJA 3HP9A 1SKWA 4O3QA 1A5VA 2HAIA 4DS5A 1N6QA 3CG7A 2I1RA 3AO4A 4JV0A 2D3UA 2F8TA 3VQ8A 2ASLA 1IKVA 3FSIA 3BREA 3CFOA 4CJFA 3C95A 3AO3A 1QSSA 1TQLA 4URGA 4QCLA 3MECA 3OS2A 4ECYA 2GIQA 3KLGA 4AH9A 1UOCA 3S3MA 1RT2B 5KFMA 3Q8PB 4M3YA 2XHBA 1BQNA 3LALA 3OVNA 1LWFB 3OSPA 4PA1A 3CYMA 4E19A 4QWCA 3HM9A 5I42A 4CHNA 4RW9B 4ECSA 4U7CA 3FFIA 1XI1A 3EPIA 1RT4A 5DMRA 4HUEA 1L3TA 2UUWA 1N4LA 4WFYA 3HYFA 4BWJA 5JS1A 2B4JA 4GC6A 2JLEA 4B9UA 4FJIA 4KPYA 5KFUA 2RF2A 4FM0A 4NRUA 3MEDB 4J2EA 2BQRA 3DI6B 1ASVA 5KT5A 4FK2A 2DFEA 1S0NA 2IAJA 2DFHA 4ZVFA 4DF4A 3L3VA 4CEAA 2HVIA 4HKQA 3VA0A 3OYJA 3DI6A 1IKWA 4M3WA 3QEVA 4ECUA 5D3GB 4MQ3A 1UA0A 3DLKB 4IG3A 3H5YA 2BRLA 4KSEB 4LQ3A 3FQLA 3PW0A 1T7PA 2YKNB 3QLHB 4NYNA 5DGBA 4OKJA 1SH3A 2FJVA 3LANA 2VG5B 5KRTA 1WAFA 3I0RA 3T1AA 1C1AA 4KV8B 3ZSXA 3SV3A 2OZSA 4F8RA 2XO7A 2HNZB 4NLSA 4PUOA 3LP1B 4NLQA 1D5AA 1C0MA 3AVFA 5JS2A 3DLGA 5CYQB 4H4OB 4DEZA 2B5JA 3QETA 3V9ZA 3QO9A 5KGXA 1C0TA 1SV5A 2BANB 4M94A 4YFUA 3ITHB 3OYCA 2HHXA 3V1QA 2P5GA 4B8AB 4HTUA 2I5JA 1SL0A 1NK9A 4DTPA 4IBNA 3E01B 3BSNA 1VSMA 3OYIA 2AX0A 3MR2A 4E3SA 1KSPA 1TKTA 3C6UA 3O3HA 4PQUA 3OSNA 1SH2A 4IRCA 4E1MA 2OPRB 3GILA 5L1JA 5HBMB 1VRTA 3UR0A 4O3NA 3DLBA 1TKXA 2BR0A 4IH5A 4OL8A 4N76A 3SNNA 1TGOA 5KFIA 4IDKB 3NF8A 2WTFA 3TAFA 1R0AA 4CEZA 1IKXA 2R8HA 4QW9A 3AVJA 2FVPA 4R0EA 1U49A 3ALYA 4WE1B 3K59A 4DF8A 1RNHA 3BDPA 3KK3B 4CEOA 4B9NA 3BR9A 5DQIA 4RW8A 1KHWA 2C2EA 5I42B 4ECRA 3LZJA 4TN2A 2A1RA 1K1SA 5KGWA 3L2VA 3ASMA 3H2LA 4NLVA
chains in the Genus database with same CATH superfamily
2FC0A 4K5RA 3LPTA 4OYPA 2CAJA 2PZSA 5EN1A 4GO7X 3ET6A 1RCHA 2WZ1A 1U1OA 4P2MA 1KR4A 3H5UA 5ETOA 1WC0A 3HK2A 2YHXA 2HHUA 2WONB 5HROA 4KQZA 4OYWA 3HZEA 1WSEA 2CQ2A 3CDEA 3RMDA 2YNIA 3CCRS 3R6LB 1XJWB 3C8YA 3ZEUB 1YJ7A 4DQ8A 2GAHC 4JV5J 3C14B 1NKCA 2DO0A 4U9RA 3MF5A 4UQTA 1WG4A 1J6ZA 4AM7A 3HOSA 4B3OB 4CZJA 4NB4A 2R8KA 4EFHA 3CDBA 4ES3A 3JQMA 1FJEB 1QZ6A 1HI8A 4K4VA 3PV8A 4NLBA 5A76A 3G82A 1TL7A 1RAIB 1B64A 2ZH1A 4OPKA 1XMOJ 4F25A 2L9DA 1C1CA 1RBOB 2LCWA 3PSIA 1T3VA 2G1DA 3I0SA 3M8YA 2G8KA 2Q43A 3ZTPA 2NRWA 4QS9A 2UZAA 1UAXA 5IOLA 4YY3F 4IFEA 5M1QA 4ZP6A 1WSGA 4MDBA 1GX6A 4NLXA 2XZWA 3J7YI 4CF0A 2XMMA 2QEXN 3O9RA 3PLAA 3KK2A 4TYBA 1IM6A 2I8EA 4Y3CA 3GFZA 4CF1A 5F8GA 2HK2A 2RKIB 1FE0A 1HNIB 4CJRA 3N28A 5DG9A 1Y97A 1UWBA 4UOHA 2VGMA 4CJ4A 1TAQA 5KT7A 4ED8A 3CC4S 2HAFA 2JWLA 1QAIA 1XIQA 5DS7A 4K8ZA 3VAMA 2LEAA 4JI1F 4QYRA 1MA9B 3RMCA 1TKTB 3J7AN 3KNAA 4LF4K 1YXQA 3BGFA 2O8CA 2Y0BB 3EYZA 4JI8J 3WHIA 4WQ4A 1UTAA 1B0PA 2BW7A 4DN0A 1NJZA 1GMWD 2CDRB 4BRKA 5J2MB 3NAHA 4DZDA 4KE5A 1NOYA 4KH5A 3SDEA 3AOBA 3JTOA 2GNKA 5FDLB 3RU0A 4QR2A 4QU7A 4EP5A 2ZNZA 4D3GA 1NGBA 2DHXA 2Z30B 2CFXA 2EFOA 3QWPA 2WCXA 2F9TA 1UPPA 3DDIA 3R9LA 1S5JA 3DDNA 4LF2A 2M3DA 2HQCA 3S01A 2IVYA 4CZCA 4Q0BB 2CVEA 2DB1A 4DTSA 5FD1A 1RLCL 3PR4A 4C4WA 3PYEA 3SQ1A 2MY8A 1DY3A 2E5HA 1IV0A 3P1GA 3EEQA 3VQDA 3FE1A 3HPOA 3T1YJ 2HHSA 4C11B 3LDPA 3OYKA 4RW4A 2DR8A 1S1WB 2F9JA 1UWAA 1IXKA 2C22A 4E7HA 3G71S 1WORA 3RBZA 4BR4A 2CZVC 3MMBA 2EG1A 3M05A 2ZM6F 5GADP 2RS2A 2APOA 1VAZA 4FLUA 4JYAK 1SVDA 2CQBA 1L3VA 1FNOA 1NDCA 4LF5K 5K8MA 2E29A 3WBZA 4E7JA 4XK8C 1U24A 2WK4A 5DQHA 3OHAA 3GV8B 2J7UA 3E8OA 2ASJA 4DQPA 2Y8WA 2XLIA 4G1IA 1YRXA 3QINA 1JXLA 2GAGC 5CZVA 5J1EA 4LFBF 4HH1A 1HNVB 2RHQB 3TUJC 4FWQA 3SMSA 3KK2B 3Q7BA 4YDDB 4EAHD 1B3TA 2OJ3A 1UMJA 3N4WA 1BWVA 3THTA 3GDQA 1MN9A 4DTOA 1LK7A 5C5JA 1FXLA 4X4PA 3PRBA 3OBYA 2H54B 2RRBA 4RL1A 4DLEA 3FZFA 3DYAA 3QAEA 4CJUA 5HANA 3PX4A 5BXIA 3JAMO 3VAIA 1NLKL 1UJ4A 3D4JA 4LSNB 4LD0A 2NYHA 1QVFR 4BRAA 2O5DA 1C0UA 2CQDA 1QVGM 1WSVA 4RWTA 1OYDA 3RAMA 1TR0A 2PT0A 3HFVA 4JD2A 4X65F 2OTLN 2Z4PA 2K7JA 3LP2B 1GLJO 2EFNA 1RBSA 2PN6A 5ADZA 5HVHA 2N7CA 1QD1A 2DNHA 4Q43A 4CLZA 2KRRA 3G6EN 4QS8A 3L2UA 2JNJA 2DK2A 1RTIB 4ZS6A 1XTZA 1S6PB 3HZ6A 4USUA 4LR8A 4B02A 2RDIA 3H5SA 3W9IA 2RD5C 1DKGD 2OCEA 3W2WA 1C4AA 2HS4A 2UUAJ 1Q7YO 4TLRA 3TUZC 1A0OB 1VSKA 3D6TB 2XCAA 4Z0UA 4BE1A 1PJ7A 4CEBA 1KVAA 4KFBA 2GBZA 4NLDA 1APSA 1IBKJ 3ISNC 4B3MJ 1REVA 1BOTO 4ZHRA 5KT4A 2OPSB 2BOPA 4FYXB 3IRXA 4ID5A 4OZ1A 5A0YB 1RTDB 2V4RA 4YOWA 4NMXA 1SH0A 3D54A 4DR3J 3OL7A 2QT7A 4F36A 4V19S 1VFJA 3FK4A 2GV1A 2V9WA 5HOOA 4ENOA 4DR2K 3DLGB 2FY1A 5J2MA 5AQHA 4DQSA 2EG2A 2DT9A 3CCSS 3KIOA 5HLFA 1UEVA 2HNYA 4C3LA 4NLGA 2C2RA 2LEBA 3VQSA 3H2UB 3PYDA 3ZSZA 3BN4A 5CQGA 4PG8A 3L2QA 3KOAA 2HHQA 4X84A 5CZXA 2DEIA 4Y00A 1HPZB 2YVSA 4O4RA 1FRXA 2E5LK 2QZ8A 1MWYA 2HMPA 4UTGA 1WOOA 1NK6A 1IWAA 4HVZA 1VQSA 1YG0A 2D3ZA 3CMEN 1NEEA 1JLAB 2LKZA 3RZAA 4FBTA 3O80A 3CMAN 2G8WA 4FJ9A 1G6BA 3FZKA 2MQNA 2X6NA 2QA1A 1WI6A 3KHRA 3TQEA 3FRZA 4TY8A 3JAMY 1B0VA 2YWHA 4OJGA 4DR5J 2WOMB 3G87A 1G3OA 5I3UA 4WU2A 2DPJA 4NPOA 2WW4A 3D2WA 3GYXB 2YWFA 2DNYA 4IQMA 5J1NA 3I5CA 2WBNA 2IC3B 2HK3A 1PO6A 2BXJA 5DM7L 1YI2N 3T5KA 3TAQA 3HJFA 3HD1A 1FDDA 4CFBA 2MZQA 4DUYK 2OMOA 1R6YA 4CF8A 1Q81T 3K0SA 1RTJA 1F5AA 2W42A 3A8EA 3QJLA 2HBLA 1NZ8A 1YJ9N 4F4KA 5AQVA 2W1BA 3EUNA 5B08A 1FK9A 4YNQA 1X8DA 2O4GA 3JYTB 3OBIA 4QBUA 4X62J 3M30B 2MLXA 4DV5F 3D1QA 3TSQA 1K9MO 4OKEA 1Y5NB 3N79A 1F3VA 4AM6A 3PEJA 1KAZA 1TL7B 4GKJK 4W4MA 2XY5A 3K5OA 2IYGA 1S22A 3V6JA 5ITHA 1RT4B 2HHHK 4WP8A 4B3SK 3M1VA 4X4TA 1WSRA 2HHHF 2NLXA 1JWWA 2DNPA 2ADCA 3J81j 3JS9A 4KGKA 4DQRA 3CDWA 5CH7B 3GE1A 3VQQA 5A2QU 2NZTA 5CYJA 1S1XA 2ZH5A 2V50A 2ZOFA 4AL6A 5E3RA 2FYXA 3RRGA 3GPAA 4K2JA 1RHUB 5KFXA 1GH8A 1Q1KA 4DX5A 4Y2AA 4DR6F 4CBWA 2VQEJ 1X9SA 2A40A 1N34J 3I0RB 1UVKA 2DNKA 5EWGA 2XWXA 4H5NA 2IAJB 1TL3A 2N82B 5IWAF 2DXDA 1KP6A 4HT7A 4X4VA 2ZGZA 4JI3J 2UXBF 3ZC4A 5M1KA 5G0RA 1SS6A 3LWMA 2CGKA 3SQOP 1S10A 3D9BA 4CJPA 5E33A 4L72B 3CPWR 2HGMA 3AO5A 1XWLA 4P7TA 3MCMA 4O0JA 4LF5J 4DMZA 2AZ1A 4AFFA 3H4BA 3TAGA 2JC1A 3CIZA 1G15A 1VISA 2HFNA 4DTXA 5H9EK 4OKKA 1UETA 4DB3A 4LF1A 3V9UA 5GAHI 2HBKA 1FTRA 3KJVA 2AYMA 1KFDA 2CJAA 2NSCA 5ELZA 3KLFB 5J2PB 2MDAA 1SV5B 5F8JA 5JMVA 1TFWA 2P51A 3KLEB 5AE1A 3ZTOA 1GLEG 3E3XA 5A8KA 2MQQA 2OELA 4P10A 4ZN3A 3IS9A 2O66A 3NS7B 1UA1A 4E8UA 2AP1A 1PIEA 5J2NA 4FBUA 2DNQA 1CZ9A 2IVPA 1WOPA 3L3CA 2VDHA 4G3IA 1GLAG 1IQZA 1KDNA 1KVJA 3DOLB 2XC9A 6FDRA 4C97A 4YB5A 2DGVA 3DRXA 4CLKA 3MEEA 2HFVA 5F0XA 3P8BB 4ZLNA 3QEIA 2W6KA 2UU9F 1PC4A 3HZGA 1RLDA 1AT1B 2AGPA 1TL3B 1QUPA 4ELVA 3MCNA 4A2AA 2A42A 3V4IA 3H46O 5K8OA 4X66J 4IYQA 3THWB 1N48A 2QFJA 3TWHA 2QKBA 3L7PA 2DHGA 1DQ9A 3BGLA 5DDQC 3MD3A 1AXQA 1N6QB 3FCWA 3QMQA 2HRTA 1KLMA 2CYYA 4JV1A 2YNHB 3WEEB 5F9LA 2VF3A 1K6YA 1UEUA 2H48B 1IBMF 4FCYA 4IFVB 4X64F 3DLHA 3BGRA 3ADAC 4B3MK 4FL9A 2PEHA 5J2PA 4KHUA 4JD2B 3I4PA 2IMOA 2MQOA 1S48A 3NFAA 3CJQA 2Q36A 1Q0NA 4H0XB 1KTQA 2Z8QA 4DV0J 1I94F 4BHQA 4MYUA 3BBFA 3CO0P 1KD1T 1HJOA 3KNGA 3VGTA 2XI2A 2KRBA 2NPFA 1QZ5A 5LMUK 2AJ0A 3K0JA 2W4PA 4CF2A 2B6AB 2G0JA 2QWOA 1Y64A 1RYRA 1YF5L 4DV2J 3C66A 3R3LA 2YNIB 3SI6A 2PA8D 4UF4A 3UNGC 2UYTA 3X1LB 4KGZB 3H40A 4QPXA 4ID8A 3DRSA 4KHYA 3T41A 2VONA 2EC2A 3TEGA 3MCOA 1WN7A 1RBLA 3OUYB 3WXKA 1KKHA 2CJYB 2AV5A 2RT3A 2QA4G 1JLBB 4O0IA 2RVJA 2EK6A 2HIYA 1F9FA 1B9FA 1DQ8A 3T6JA 5AQIA 3OYLA 1KAYA 3MR5A 4BRFA 3EZ5A 3M8PA 1NDKA 3AA9A 1LK5A 1F60B 2G13A 1JJ2M 2MGZA 4PWUA 3Q2TC 3TO8A 1C1BB 4JK8A 4CGJA 4IJAA 4CHZA 1NK0A 4NLYA 3H08A 4HCCA 2ZZTA 1Q8KA 3TJAA 4CLTA 1XHZA 1VQMS 5E26A 5LY3A 5F8MA 2E8AA 2OLWA 5BREA 5FRNA 3RG6A 2KHDA 1K8KB 5BRFA 2ITMA 1T9VA 3L8BA 4R0JA 4DFJA 3KMQA 3P31A 1KQSM 4L3KA 3DU6A 3U1NA 2H65B 2CH6A 4I2QA 4AHSA 2MKCA 1U2FA 1U6ZA 3D6RA 4Q0BA 1YQHA 3ILOA 4HR2A 1YBUA 5KFBA 1T03A 2Q31A 5LJ5Y 5I9EB 2P8IA 3OFHA 3H2VE 1T6CA 3I31A 4HEA9 2I0XA 3W63A 4FYVB 3IBCB 2GUIA 1YITN 2QK9A 4NXMJ 4LBIA 5JUMA 5AQZA 4IOXA 2ZD1A 1AUDA 3KLGB 4DV4F 2FB0A 3QGPA 4EBCA 3VEOA 1TV6B 2VPXB 1VQ5S 4JI7K 2IDEA 3JTNA 2FHMA 4QIWD 1WNEA 2GX8A 1FWPA 3PHTA 5KFJA 2POKA 2C2KB 3K17A 3GG0A 1S6UA 1JQGA 3CM6A 5KFWA 5AFUA 1PAEX 3PW4A 1NPKA 2M5YA 1D9DA 2N3LA 2R2TA 2Z57B 4JAXA 1T9XA 1VQPS 4O3SA 3O5TB 2WUSA 3M8ZA 4FM1A 2FLNA 3BPSP 3QT5A 4IZ9A 2DY4A 3NDKA 3RJMB 4FPAA 3BR8A 4E7IA 1FA0A 2HHVA 3HHLA 1IKXB 3VF4A 2W25A 4YOYA 3G0ZA 4DQQA 1X4FA 1ZA1B 1IBLJ 3B4MA 3FZMA 2NXNA 1CJUA 2CKWA 5KFOA 2YPZA 4NYPA 1UJ5A 4B3RK 3CPEA 3RBXA 4WXWA 3SDEB 1VLYA 2BTFA 3GONA 1S59A 5KT3A 4CHOA 2E7WA 3ZT1A 4S0MA 2FF3B 2V8VA 3DLLL 2IA6A 4NXNJ 2ZH9A 2JLGA 3ENOA 2X74A 3AVGA 5KFAA 3HHDA 4V1Ak 2BM1A 4E2FB 1AFJA 3TARA 4E1JA 1YVUA 2I6WA 1HMVA 2E5LJ 5LMNJ 1WC5A 2PI4A 4I6MB 4DR5F 3PYFA 3AT1B 4CJEA 2R2UA 3L7OA 3DFEA 2IM2A 4P2FA 2ZJQQ 1WI8A 4ZTJA 4K43A 5B0DA 5IWAK 3MEGA 3HPGA 2O01C 2IVFB 3CMQA 1WHYA 1EQYA 3VMFB 4C8OA 3VQ7A 4PL8A 5LJWA 2CG8A 2WONA 1TUWA 1TKXB 4DV2F 1VJWA 3QNWB 4C8ZA 4DV7F 4URSA 1R31A 2YKOA 5KG4A 3M6GA 3MK6A 2YX1A 1RDUA 4FLWA 3J81U 3EXYA 1CJUB 2WVBA 5BYSA 4BACA 1T95A 4LF6K 4CZFA 1S9GA 4O55A 4G65A 1X5TA 1IUJA 2YX7A 4OYOA 4FN5A 4W90B 2DCUB 4LRDA 2XCPA 2WVCA 3FEXB 1VK8A 2Q1NA 3FMWA 2C28A 3BF1A 3VGKA 4IO1A 3HO1A 3M8SA 4ZVGA 4OZ0A 2PDAA 1TK5A 4ZPVR 4CZKA 4QWBA 2DPNA 3AFGA 3BO2A 1VSLA 3BDEA 3OYAA 5AQJA 1NB2A 5KFTA 4NLWA 4MKYA 2E1CA 2KTQA 4DR3F 2UXDK 2MZ1A 1DT9A 3CE8A 4U7UD 4FWPA 4DV1J 3VQ9A 3WX8A 4Z7YA 2CADA 1G1XA 4CJ5A 1IKWB 3RB4A 4C8KA 5L39A 3EE3A 2LQBA 4JV2A 1VQON 3E2EA 1DJ0A 1B7FA 5D4LA 1XBWA 2VB6A 5AE3A 4HI2A 3M5RA 3I56S 5AXLA 4MO5A 3MR3A 3PUFA 2O67A 2HKEA 2HBYB 2HF4A 4ERDA 1GFWB 2Z2LA 4KY3A 3CXCR 2W2MP 3CMAS 1FESA 1SJ4P 1Q8BA 4UY8T 2QL9B 3MAAA 3G4SS 1WB9A 5E7OB 4FK0A 1ZM4A 5CZ1A 1QQOA 2O8FB 2ILZA 1WC1A 4ILLA 4B9SA 3IS9B 1WEZA 1XUPO 4XPCA 2NXJA 4UOCA 3BF3A 2OEKA 3M2RB 2Q0RA 3W64A 1HYVA 3EKUA 1OMSA 3A5NC 3RAXA 3EE9A 5D77A 3ETOA 2U1AA 3LTOA 2E6LA 2WRMA 2OAUA 3AA4A 2MLZA 1F3FA 1RT3B 5DZ6A 1PSDA 1UFKA 1U4BA 5E41A 2CQHA 2CNNB 5SUHA 3IM9A 1H1VA 1QE1A 1KQGB 4DOZA 5DETA 2EFVA 2FTRA 1HKBA 1IKVB 2COLA 3SUOA 2VPYB 3GL1A 1ZYQA 3VZHA 4PABA 4BR5A 3CJ5A 3IFEA 2CWKA 3TR8A 3BSOA 1AROP 3K5PA 5J2QA 3CC2N 2WSFC 2KHCA 4ATNA 1NO8A 1XR5A 1T94A 2VA3A 2G8VA 4KI6A 1NHUA 3W62A 1NSKL 3CJ1A 3O3LA 3DOMA 2J9CA 3FCVA 1NKBA 1X3NA 4ED2A 4NLTA 2YNFB 2DGSA 4ISEA 3RUBL 3O1WA 4DDFA 1YBAA 3PM9A 2EPIA 4QW8A 1CSJA 1YTYA 3OFFA 4EEYA 3O9SA 3OHRA 4BGBA 4JN4A 1EAYC 4KH6A 2J9DE 1YBTA 3R7SB 3HSTB 2P9NB 1VQ6S 3SCXA 3RB3A 5DO2A 2E1ZA 4MYTA 4LH5A 3T7ZA 2Y3YA 2XLJA 2R9LA 3TA1A 1YJUA 3UD4P 1QE1B 4LSZB 3SCLE 5EXWA 3G6YA 1UW9A 5IQQA 4FLXA 1SQFA 4DV1F 4HCBA 4F4YA 4OJHA 4JI3F 4N8NA 2IJNA 3NWGA 4OX9F 3VQTA 3AO2A 2W4CA 1H0HB 1VQPN 2BKPA 3NS5A 3D2FA 2KG0A 3ULEA 5D15A 1JLQA 1YLXA 1KWMA 2DXFA 1ZA2B 3F41A 3PO5A 2IGIA 3CPWM 1JXBA 1NBEB 1JMTA 4I6YA 4GNIA 5KG7A 4V19X 3KK1B 1EETB 3KMSA 4O8KA 4IDHA 1AYEA 3P4UB 1KQFB 1U09A 2L48A 2Z2YB 5BN9A 4QZVB 1RI7A 2G1HA 2VWJA 4WU3A 3UO0A 2AGQA 2Y1IA 2GO9A 2LU1A 3AVBA 3VENA 4FPRA 4IQXA 4ZK7M 2JGUA 3M6UA 4KBOA 4DPWA 5F0WA 3MEEB 3H20A 1JIHA 1RT6A 4M63C 2O8BB 1RA7A 5JVHL 2VQFF 1F5CA 5H9EJ 3R7NB 3U1MA 5CCMA 3CG7A 2BW2A 2I1RA 4ZLJA 3MMBB 4DV5J 1H38A 3OTOK 2LP4A 3JQJA 3FSIA 3BREA 5IC4B 3W5XA 3AO3A 1YKWA 1TQLA 2VOOA 1Z2ZA 3K7RA 2HURA 3CCSN 3GYGA 4ZIWA 4JI0K 5JICA 1CJTA 3KLGA 1BHNA 1BC6A 2ZWHA 2O8EB 1GLFO 3F0NA 4HACB 2RRNA 3OR2A 4N8OA 4YN3B 1XQSC 1WBBA 2HFOA 1LWFB 3OSPA 4PA1A 4L74A 3TSPA 1NG9A 2JWKA 1MDUB 4E19A 4NXNF 1K8AO 3GCXP 3W61A 4FVCA 3MM9A 3IBFB 2HLUA 2MSTA 3MD1A 3MMAA 1MWMA 4NA3A 4B9QA 4WIIA 1N4LA 3HYFA 5JS1A 3I87A 1Q79A 4W98A 5KFUA 2RF2A 4NRUA 4J2EA 3UR3C 2DFEA 2IAJA 5C10A 4CEAA 3VA0A 3OYJA 2C1EB 4TNOA 2G2OA 3QEVA 3CCMN 2HQFA 4WFNQ 2K2PA 3I82A 3V2UC 3CERA 2BRLA 2CPYA 3P49B 2YPYA 4LQ3A 4NEZA 3PW0A 1T7PA 3M4XA 5DGBA 3NXZA 2CJ9A 4BRNA 4CW7B 3LANA 2CWXA 1VQNS 3T1AA 2QN6B 1C1AA 3N5BA 4KV8B 4WK3A 3MOJB 1J5EJ 4CTAA 3TTFA 1D5AA 1VQLN 1H2VZ 4DV4K 2MSSA 2V8PA 4OZJA 1T44A 4DV2K 1R0CB 2XM3A 1U2RA 1A9NB 2DH9A 5GVQA 4TU8A 1V4TA 3KYLA 2CPFA 3AQPA 4GV9A 1FXDA 5C15A 2B5JA 2VFUA 3SBMA 3QO9A 5DM6Q 1C0TA 4M94A 3KZBA 4WQ5C 3J80O 1VBXA 1VQYA 3V1QA 4PG6A 2RUGA 4HTUA 2H4WB 5BR9A 1CZAN 1NGFA 1VQ7S 4HDHA 4CD3A 1NSQA 3BSNA 2BKNA 1VSMA 3QT6A 3HSZA 3OYIA 3V4MA 3PJ9A 4B3MF 3LM9A 5AXKA 1YZ7A 4PQUA 1NMEB 1SH2A 4IRCA 5EVZA 3GILA 3DLBA 1GLDG 3IBWA 5T41A 4BVPA 2K1RA 3OFGA 4OL8A 4H0VB 4A4JA 5KFIA 3NF8A 2VASA 2WTFA 2FPHX 3TAFA 4ILHA 3THYA 3A8YA 2DRDA 5TKYA 3CB4A 4DF8A 5K8NA 1KS2A 5DQIA 2PFDA 4BR7A 4RW8A 2ACMA 2KM8C 3CD6N 2Q2RA 1MMLA 4MK8A 3D1OA 1SL1A 2JRSA 3LA0A 4CJ7A 4JHDB 1Y10A 1FRJA 2BJEA 1RDDA 4M41A 1LXJA 3M1FA 3AVNA 1KC8T 1E6VA 1FVSA 1X4HA 2VIHA 2LQ8A 2MKKA 3NGZA 1F21A 4CBXA 2YNHA 3AVAA 3WEEA 4YS2A 3ATVA 4WFXA 5B0AA 1VBZA 3AGKA 4YEAA 1ESVA 3VGLA 2DTUA 1FHTA 2DVIA 1RT2A 2ETJA 1IBCB 1LWXA 2HVDA 2H5EA 5IT9Y 4UW2A 1IR0A 3E51A 2O4IA 1O13A 3M32A 4JV5K 2MPUA 2PE8A 2NUBA 3GCWP 1K1QA 1RQ0A 2P9LA 3QGGA 1HNXK 2GHVC 1U1LA 3LPUA 2YBVA 1X31C 5IT0A 4ZTFA 4CZLA 1NAQA 1FJGK 2UU9K 3UCZP 4B1WB 2ZKUA 1K44A 3KLHA 4ELUA 4DCHA 4A46A 3UB5A 1ICEB 3BBBA 2VPWB 3IG1A 4Y2CA 2XMKA 1IQTA 2JZ5A 3KKFA 3W9HA 5THWA 2BANA 1VRQC 1ITGA 1FRIA 3S1TA 4I68A 4R5PA 2CQIA 1HNZF 3TUPA 2BUNA 2KI2A 2XZTB 1JX4A 3ZSYA 2DR9A 1V3ZA 2X7IA 4F3QA 1ULRA 2PY5A 3VETA 5JXSA 1IBKF 4M45A 3VVTA 4N7TA 3L9ZA 1E4GT 1L5UA 2BE2A 1YK9A 4B8CA 4W5RA 4PPZA 3MEKA 1CXUA 2ZBCA 1CJVB 2Z1HA 3V5RA 1OIAA 3MGJA 4TQSA 4L3NA 1OH6A 4Y0FA 2AWZA 3BZQA 4MFBB 5E5NA 4DTMA 4CO1A 5KTQA 2P9CA 1O51A 3PW7A 4FWLA 4Z4FA 2KU7A 3POTA 3MDQA 4FJ8A 2MZJA 4BGAA 1W7WA 4J2DA 3CFPA 4WK1A 4JK9A 1UVNA 5AZJB 4KTQA 3K5NA 3G6XA 2XMTA 3MM8A 1RDAA 4K25A 3G82B 2VZ9A 3GV5B 2DRBA 4ANDA 1G7CB 1ZBSA 5RUBA 5L1LA 2OUGA 4DU4A 5AQUA 1QAJA 3ZYYX 3OR1A 1KLNA 3X3UA 3EGWB 2B9WA 1KVIA 4H0OA 3BGRB 2RH3A 1CXQA 1SPBP 3Q24A 1S1VB 2QL5B 4FVUA 3F9KA 3J7YU 2ASYA 3U4LA 4CJVA 4M63A 3MPWA 1NZAA 3VGVA 4TLQA 4RJVA 3UFCX 4CGGA 3W8PA 4HI1A 2ZZNA 1OSDA 3GU0A 3OXFA 1Y3JA 1X9WA 4KREA 3NGSA 3A12A 3LF0A 1URRA 4DFPA 3TVYA 2LFVA 2KQ2A 1OH8A 2QM1A 2ZH8A 2M7SA 3RMAA 1IM4A 3IG1B 4M5HA 5LSRA 2P5VA 4M5KA 2R7QA 4KO0B 2J7WA 2I7NA 4NMLA 3BGOP 4ZLPA 3NVKA 4CESA 5LM7E 1YJNS 5IFMA 3VA3A 4UQGA 5KG6A 4M7XA 2J6SA 1QSLA 3HMJG 1NK8A 4CT8A 4FVMA 1BY9A 1R59O 4CZGA 3TP2A 3CF5L 4NCBA 2QG9B 1OSCA 2VH7A 2V0NA 4NX9A 2KJWA 2LLZA 5T7BA 2HB5A 4EZ9A 2Y0SD 2UVRA 1TP7A 2ADBA 4JV5F 3IAS9 3CJKB 4DPTA 2BM0A 2AZ3A 4BE0A 3HFZB 2HSTA 3K5MA 2FZKB 2P9KA 3AARA 1MLAA 4I56A 1WOSA 4BRGA 3M3ZA 1SJ3P 1WEXA 1QLNA 5C24A 1ZS6A 5ETKA 3OJSA 1RKJA 3NKYA 5I4MA 2M8DB 5D4NA 4FNHA 4PPDA 1HJRA 3SFUA 3DRPA 1EP4A 1S1UA 1ZM9A 5AQOA 2GJFA 4F3OA 5HRRA 2ZUGA 4HUGA 2KVIA 2MTLA 2CRLA 2PO4A 1U2CA 1C1BA 4CLFA 3OFEA 3QMLA 2RMLA 1WWHA 4X4SA 4FWNA 3RSEB 1FXXA 3P38A 1KVKA 4AQYJ 3CD7A 3D0GE 4P6QA 5LL6Z 3FCHA 2MZTA 1KAXA 3M2UA 5LXRA 2QI2A 2N3OA 4Y28C 1M5HA 1V5VA 4B1UB 1S1VA 4J9PA 1MMNA 2KYXA 3D0PA 2UV8A 1TUYA 4HWIA 3CD0A 3QZ8A 1GMVA 2QWMA 3NGUA 4K59A 1WHVA 3MTJA 4FF1A 5F8NA 3EM1A 2CGLA 4NA2A 3IR7B 4FLZA 2F4VK 1RT1A 2HNDA 1HD0A 1W97L 4KTWA 4Z4GA 5C2FA 1CC7A 2L9WA 2F3JA 4BS2A 2VG6B 4ZVHA 1TU0B 4YP3A 2LDYA 3NGTA 2QLJB 4IOAL 1PYTA 5IT9U 1M0SA 5E3QA 3VTIA 4WFZA 3H98A 2W9AA 4DPYA 1I1GA 3A5LC 4MKBA 4WP9A 4EHUA 4WF9Q 2BKOA 1DBDA 3QGIA 1XR6A 3H4DA 4BRHA 1FD2A 3PIOL 3QB0A 2LA6A 2RU3A 3MCAB 1FXRA 1HBNB 1D09B 2XULA 2O3DA 5F2RA 4CLWA 3OVSA 4QOZB 2FVSA 5FIIA 3I33A 1FKPB 3PACA 3QSIA 4IR1A 2PYJA 4DR5K 4C7QA 5KT2A 2CNKB 3V6DA 2A6MA 3EGVA 4A8SA 1GLCG 1NM1A 1T3NA 2NLWA 4ZPCA 4EGLA 5GADU 3LPYA 1WF1A 4PYDA 3IWLA 5LJVA 5FPNA 2YWGA 3CEDA 4KKOB 4Z4HA 5ETRA 2B56A 1LNQA 5AQFA 5KFHA 1FERA 3VWSA 1YJTA 5FPMA 4R5PB 1HBUB 3VF0B 4C9DA 3BQ1A 3BN7A 1CULA 1U48A 1FKOA 2ALYB 4IOCQ 1M90T 3SZ2A 1C6VA 4NZ0A 2A3ZA 4PG4A 4AHTA 3EX7B 1Q8IA 5D4PA 3TSUA 1I6JA 1HLUA 4HHJA 4CIEA 4RUHA 4YOTA 2A2CA 1S1TA 3RAQA 4EI2A 3ITHA 3V9WA 4M5DA 5GMEA 2KHOA 5L46A 2B3TB 3HTVA 4KH4A 4DI6A 1N5SA 2ILYA 4WE1A 4NLUA 2A10A 1ACMB 3VQ4A 1PAUB 1J53A 1LEOA 1DFDA 2F63A 3G10A 3OVBA 4FW1A 3T1YK 4OQJA 4O0NA 1RT7B 2Z1JA 2C2ZB 2HW3A 2JWNA 3ETMA 2J0XA 2GELA 4RUCA 1FWLA 2OPPB 5CABA 2PYLA 2IYIA 3BS9A 3SMPA 2CXEA 2CQPA 4DR7J 2NCKL 4DL7A 3E9LA 3BY5A 2GVZB 2LXIA 2E1AA 2P2CB 4CEQA 2LDIA 2XQCA 3IWXA 2XYGB 2E1RA 2BMBA 4RNOA 4RNFA 1TL4A 3BM7A 1IWGA 2XHWA 4JI5J 3TPQA 4WJBA 5B0CA 2DR5A 3LQVA 3MM5B 5I3PA 4QU6A 3QIOA 2ZF5O 2IHR1 2ZOGA 1RXOB 5BPNA 3IGNA 1WHXA 1NCLA 4L73A 5DQGA 3M9OB 4PXBA 3SJJA 2NUUG 2P9GA 4WCEL 3LOUA 3FZ2A 3CJ9A 2F7TA 2GQ2A 4YOXA 2XGQA 2W8LA 4FJJA 2RNEA 2HBJA 2YV0X 4IKFA 1TZ0A 4DV3J 3KLEA 2HQ3A 2NRRA 4DTNA 1WBDA 2HIQA 1HR0F 2O8DA 4DR4F 5T7LA 5JLHA 4OJ1A 1JCFA 4W5OA 2HF3A 1RT7A 1RKIA 2W9BA 1TVRA 1QDUB 1CULB 4NASA 3F56A 1QQNA 2P9IA 5HL7Q 4CH0S 3WQUA 2QA2A 1BI4B 4B17A 5BRHA 3MR7A 4BDYA 4Z4IA 2ROGA 2GW8A 3CCTA 1UJ6A 1TKDA 4DPUA 3AB4B 1N36F 1LW2B 5D4OA 4WFNL 2UU9J 3MEGB 1YX2A 2D74B 4O4GA 4USTA 3O9QA 4BC9A 5F0UA 1N5TA 5U47A 2J0QD 5DDOC 2FZGB 4TXSA 3JB9k 2V9KA 4DHYA 1B4SA 1ZM3A 2QWRA 4FK4A 4BRLA 3V9SA 2RHKA 2GUPA 3MM6A 5D0EA 1OWXA 4A8FA 2BGGA 4MLEA 5KG1A 4CT9A 1VRUA 2HBRB 3OLAA 1D4XA 2OA8A 3UN3A 2LEPA 2R2SA 4AHVA 1ZAVA 2AQ4A 3TZZA 2BBEA 4PCQA 1P6TA 2FHOB 4B3RF 4RO0A 2ZJRL 1G4CA 1EIYB 4W5NA 3DN9A 2N7YA 1JLEA 1U0HA 3QYYA 5LMUJ 1M5OC 3H25A 3MR6A 2G8UA 1RWOB 3DRPB 4P2XA 3V4IB 4B1VA 2VFVA 2IC3A 4IKAA 1D9FA 2EC0A 3H1QA 2BZ2A 2LXFA 2QW9A 4FS2A 1VHIA 4WYBA 1WC6A 3T1HJ 1RWNB 1S5ZA 5EX0A 3NGIA 4CECA 1HHSA 1YJ9S 2V52B 3IWNC 1W0HA 2ZM6J 3ZEUA 3MOZA 2RF2B 3AHPA 1RFQA 2DHAA 2RQMA 3CQ8A 1YJRA 1HNZJ 2YQ0A 4MO4A 5EX5A 2D0OA 4USIA 3R5CA 2H3GX 3OS0A 2HZVA 4IXCA 1TELA 2QSWA 2DO4A 4QPTA 1HYZA 5EU7A 3S3NA 4B3TF 3UKRB 3PX6A 3R97A 2QO3A 2UXCK 1GNKA 4L8RB 3KHHA 1XR7A 1YJWS 2DJWA 2J9DA 4CLUA 4F4ZA 3GJQB 4USVA 4WYLA 2BE2B 1FRKA 4BY9C 1RP5A 4TY9A 2AJQA 2ZGYA 3V1RA 7FDRA 3P4IA 2OD6A 1SQKA 5KFGA 4DL5A 4CH7A 2DITA 5AR0A 4OYIA 3DU5A 4AQYF 2NRZA 1OH7A 4IFYB 5AT1B 1XEZA 1HYSA 1SIWB 5FRMA 3PVXA 1T9TA 4CIGA 3TTCA 2NSBA 3HKWA 3QNNA 5GAEI 3HSGA 2HOEA 3E9OA 2IA0A 1M5PC 5J2NB 3ONQA 3TU5A 1SCJB 4A8MP 4HL9A 4FO0A 3D0HE 5DGAA 4J91A 4ZVEA 1SC1B 1NHVA 1QTNB 3M8QA 2GS8A 1OPIA 2DY1A 2MEWA 4PEOA 5CZ2A 4J9KA 1YTUA 1FT8A 2H4YB 3V9XA 2AEFA 1K0TA 3A13A 1HIYA 5F1XA 2XYHB 4HT5A 4RG8A 2V2ZA 4AYBD 3O4QA 2C3UA 3S3OA 5DLFA 4M3UA 1DAXA 3VV2B 2B9EA 3DOKB 1XHXA 2IRXA 1KHVA 1PC5A 2K7KA 3I5AA 1VSJA 3RRHA 4DN9A 2V7ZA 2G4BA 4CIFA 4OYZA 5KFVA 3A3OB 3K8VA 3F2KA 4ETXA 1WTBA 1VMBA 1VC6A 2O8CB 1L3SA 1WF2A 3MPVA 4J9LA 2B9XA 3M2VA 1HW8A 1RBUA 1O8BA 4B3SF 1RILA 3EZOA 2G9OA 3BYPA 5ETSA 3NY0A 2ZKTA 4J9OA 4CWBA 3CT9A 3WNEA 1VHXA 2UXDF 4Q8FA 3GIMA 3W2WB 3CVKA 1BQNB 1A5XA 2MLYA 3G96A 3FKBA 1LW2A 3AOAA 3FBCA 3BUZB 1X0FA 4M3ZA 4R25A 4UZCA 4BRCA 3QT8A 4LSLB 1KONA 3JYTA 4CBUA 3J7Z5 3OA9A 2PBDA 3I8DA 5DG7A 2EBEA 1VQOS 3MMAB 2VUGA 1B0TA 4NEYA 4PQUB 3DRRB 4M42A 1FFSB 2D4WA 1R43A 3QPIA 3O1LA 2CNOB 3AVLA 4CIOA 4DMNA 1LV5A 1C2PA 4XDCA 2NREA 4Z2XA 1H7WA 3CCQS 4C98A 4O4GB 4LF7K 1HKGA 1WTFA 1RTHA 4C8LA 3WNHA 4BE2A 2ZJQL 1RWWB 2YHWA 4C0BA 3W66A 4FJXA 4K4YA 4IG0A 1JJCB 3BZKA 2ASPA 1C0FA 5HMWA 5EWEA 2IRYA 4H0TB 3D2EB 4LRBA 2QE5A 1QSYA 5AQRA 3MMJA 2VBWA 2A41A 4KGVB 2CZ9A 2NRXA 3FBBA 1NM2A 2Y1JA 3KG4A 5HROB 3AA3A 2XY6A 2Z56B 3WDOA 4JKEA 1DZ5A 1ASWA 1RT1B 3C0BA 1Z4UA 1HQUA 2IOCA 3FSYA 2IIHA 5CCLA 3NAIA 4LIRA 1B9DA 2ZE2B 1UVJA 4ZVRB 2BOAA 1XNQJ 4JI4J 5ETQA 3CF5Q 1HNZK 2HRUA 2I5JB 1KVCA 1JB0C 3UDLA 5CE3A 3CJ3A 4BC3A 2MHEA 3LDLA 3QSYB 3VAJA 2GJIA 3HXMA 1U1KA 1FNMA 2QYCA 5EDWA 2CQ3A 4DR2F 1S72N 4USKA 1N5VA 2BACA 1YT3A 3U7JA 4A5BA 3ENBA 4H4KC 3DNCA 3J80Y 2GX9A 3O8MA 4OPJA 4W5TA 3VAGA 1RBVA 1HNXF 1LWFA 2O8DB 1N52B 2X3GA 2IM3A 3PZPA 4RNNA 3EDRB 3QEWA 3L09A 4EO8A 3CTRA 4LFCJ 3P6YC 1HNIA 3P96A 4XTTA 3VPZA 2FGOA 4FLVA 4EYIB 3CQYA 3AQOA 1RJJA 4DUZF 2Z1GA 3V81B 1ASUA 4QWDA 2GMHA 4K7QA 1KFSA 2IVNA 4U67L 4OGEA 1Q81O 2WVEA 4LJMA 1OQ6A 3DKDA 4EO6A 3N4PA 2MQ8A 3FLCO 1WDDA 3UN5A 4FKYA 4GKKJ 3ISZA 3DJCA 1CJKB 4K50A 3GYNA 3HHLC 3GQCA 2MGZB 3H59A 4DV6F 2ZC3A 2XNQA 4IRKA 4EK2A 4LF7F 1S12A 1RE1B 2C42A 4RBUA 3U1LA 3VEXA 3LAKA 2FHKA 4FDFA 1REVB 3MURP 4M1KA 2E88A 3CJ0A 3T1HK 3I5BA 2ROEA 5AQSA 4F7VA 4IO9L 1SJQA 2ZVIA 3V6DB 2YNFA 1SC6A 1T9YA 5DK5A 4MIWA 1I5OB 5LMUF 1RBRA 3B6OA 4O23A 3CXCM 2HG4A 5KPZA 3Q8RB 4RR5A 3HJVA 3UD5A 2MKYA 3H3OB 1RTIA 1VSDA 3U6FA 1YRTA 3MXMA 3HRGA 3MN7A 3T69A 3DLRA 3O2IA 3EZUA 1J5EF 4DL3A 1BA1A 3ULDA 1GMUA 1L3KA 3ZX0A 1R7IA 5BRDA 1CVJA 4KHMA 4F4AA 4AHRA 3OL6A 1VQMN 4CGHA 3VAKA 4IG0B 1E6YA 3KJFB 2F5GA 3OLBA 3TX8A 4MIAA 4QQBA 1WSHA 1YWXA 1GQEA 3NG8A 1D0EA 2F65A 2UVVA 2FLLA 3VGUA 2IBOA 4Y2MA 1ZTWA 4DV3F 2EBGA 1GX5A 3FZHA 3K58A 4LH4A 1BQXA 3W2VA 2HVZA 3CFRA 1YGYA 4CJWA 2FVQA 3QIPA 3DGVA 1R3NA 3MPYA 1CJKA 1HA1A 4ECVA 4HHTA 1XMQJ 4J2BA 1G99A 1VSEA 2GEMA 2H1YA 1NDPA 3IXQA 1S1WA 2F40A 3VESA 2NXCA 4H0YB 4QIVA 1YRUA 3VN5A 3ZZZA 5BYQA 2IVMA 3ENHA 2Q0UA 3UDEA 1QAYA 2K3KA 4WQ4C 2OHDA 2OPRA 1U45A 1NSPA 3RW6A 1EP4B 3GR1A 2RJZA 4I6MA 4ZVQB 3PW5A 2KG1A 5CYQA 1K9MT 1NJWA 2RQKA 5KG2A 4LF9J 3OD2A 1UEKA 2KYZA 1VOMA 2PFFB 4OJ3A 4YHHJ 1SXLA 3BEXA 2OP5A 1V6HA 3CUNA 4MLHA 3RSEA 1SJRA 5FPEA 1HPMA 3PIPQ 2DHSA 4NCGA 4YOUA 2KH9A 4PWDB 1I51B 2I7PA 1MN7A 4K4ZA 4JKAA 3G71N 2YKNA 1OO0B 2QKKA 5JMNA 2UXBJ 5GAGU 1P8ZA 2BE9B 4GY2B 3AD7C 1FFWB 3OBWA 1NGCA 3L2WA 4AF1A 3BJYA 3CC7N 1HPZA 1TMMA 3E01A 5K20B 3MX5A 3R3TA 4M5JA 2P1JA 5GIOA 3SIPB 4RTFD 3KHLA 4H4OA 4N5SA 4NZ6A 3MN6A 2FF6A 3IR5B 2W9CA 4B1YB 2J5AA 3CJAA 3O6WA 4MJKA 3THXA 2O1PA 3SBTA 5HLFB 2NXEA 4ILGB 3ZSQA 4FJMA 3QFPA 3CCQN 2IY5B 3EJMA 2HRYA 3BO4A 1EB0A 2M52A 4ZLLA 3OVAA 4BREA 2QLXA 1U2VB 1NWKA 4NLOA 3NF6A 3OL8A 3TAEA 4PHTX 3HT0A 3CC7S 1S6OA 4A8YA 1U6FA 3FJ2A 4DX8H 1NHKL 4RU9A 2FBVA 2KXHA 2V2QA 4FJKA 4ZJLA 1QUVA 3J7ZT 2ZD1B 1VQNN 3DM2A 4XH1A 3D7SB 4CM0A 1S6QB 5CA5A 3UIQA 2VG7B 2OSQA 4EBDA 1V4SA 2CPZA 3CCUN 4LF9K 3IRWP 4IH7A 1J27A 2AP6A 2B4VA 7FD1A 3OY9A 2ABYA 2VDIA 4P72A 4KHQA 4H5TA 4QWAA 2J6TA 4DSJA 4H4MB 3C14A 3B54A 5D0RA 1JLFB 4ZCKA 3JSRA 2SXLA 4KHPF 5C25A 4ECWA 3SSRA 4ED6A 3H90A 4ZIVA 2OI2A 3SFGA 3LP0B 4HVJA 1KVBA 1NJIT 4WKRA 3G6ES 3MECB 3MM6B 4JI2K 4I4BA 4G1QA 2IPOB 5AQTA 4ZDNA 3NAEA 1JJ4A 1VI7A 2OH2A 3H45C 1RADB 1GOCA 1C0UB 2J6UA 2P9UA 1XK8A 1T05A 2BVZA 3FBFA 4JS5A 1U0HB 1A5VA 2HAIA 3ID8A 4ISFA 2ZDOA 5M2PA 1GXTA 2D3UA 1N8RO 4KJIA 1Z2LA 2F8TA 2BEFA 4OHZA 3DLLQ 4PKHA 3VQ8A 4MMOA 1GK8A 3HOTA 1U8WA 2QMWA 2MQLA 3C19A 4CTAB 3SSQA 3CFOA 2HGLA 1F2GA 3G4SN 1AFIA 3WXMB 3MECA 3FZLA 4ECYA 4BR2A 1WUUA 1H3DA 3S3MA 3Q8PB 5K5MA 4DUYJ 1EX8A 1M1KT 3O6QA 3UCUP 2GQCA 1BQNA 2QMUB 2V4JA 4FXVA 4K5SA 4PXEA 3CYMA 5M1FA 4O8UA 3HM9A 2P9EA 5I42A 1R6VA 3M6VA 3WIVA 2MQPA 1HBNA 4X4NA 2KL8A 4ECSA 1RHRB 4EMDA 5D0HA 2OKQA 3DAWA 4U7CA 1RDWX 5F3TA 2MYFA 4JI0F 3AB2B 1U2VA 4MDAA 4OV1A 2B4JA 2M70A 4A59A 4B9UA 2B51A 1K73T 2EWHA 5AFUH 4FM0A 3MEDB 3ZX2A 3DI6B 5KT5A 4Z37A 3JAMU 2DFHA 4ZVOB 2VQFJ 3F44A 2MXYA 3L3VA 4WIQA 4M3WA 3JXOA 2XMWA 4OHYA 1KXPA 2AT1B 4IG3A 4M5DB 4WPAA 1T3OA 2DR7A 3GB0A 2FLOA 1N32F 3PKYA 3ZNJ1 4YB1P 3GG4A 4DKWA 1SC3B 3CCZA 4JI7F 4U8YA 2LXUA 4A8XA 4DV5K 1FCAA 3NMUA 8ATCB 2FUG9 4RBVA 3LP1B 1C0MA 1MWKA 5JS2A 3DLGA 4FPIA 3EVWA 5LMNK 5KGXA 2BANB 1MWZA 3ITHB 1YHQN 1HHTP 4B8AB 3THWA 4YHHK 2I5JA 2LQ5A 4EFAC 2AIRB 3KJNB 3DXKA 3S7RA 5B09A 5BPMA 2XZDB 4IBNA 1FF2A 1MROB 4USJC 1TKTA 2KDOA 2GMLA 3OSNA 2RILA 2VJUA 3AA8A 2OPRB 5L1JA 5HBMB 2UXCF 4O3NA 1U26A 3OTBA 3HCXA 2YJFA 1F5BA 1RWPB 5LSOA 2EEYA 1TGOA 2F9WA 1RK8A 1R0AA 4X65J 4QW9A 3AVJA 1SIZA 3LDNA 2FVPA 4R0EA 1U49A 3GJRB 1HD1A 4WE1B 3K59A 3BDPA 4K41A 3BR9A 2CQ4A 2DGWA 1KHWA 3DCAA 3O1BA 4KT0C 2X1GA 5EOYA 3I56N 3U9DA 3H2LA 4OZ2A 3IAM9 3IMXA 4FOEA 1N33K 2P9PB 1Q8LA 1NRKA 3OTOF 4PUOB 2WB4A 4H5WA 5IQ6A 1FKPA 3A4TA 4OI2A 1JLEB 5C12A 4ED5A 3MN5A 2ZWPA 4KGXB 2YHBA 1S0OA 4YR2A 4RX6A 4JKGA 4DUZJ 2E2OA 2R7YA 3J81O 1T6DA 4LSLA 4BC7A 1HQ2A 4IWVA 3CJ4A 4OZLA 2F96A 3THVA 3LP0A 3JSMB 4NYZA 4LFCF 1HHQA 2EW9A 4TQRA 2FBYA 2R7VA 1Y5IB 2JLFA 3HHNB 2FSNA 3CM5A 1HNXJ 4KRWA 2DNMA 2HHPA 5D78A 4P2SA 3VR1A 4H03B 4IR9A 5A8RA 2PMZD 3M2VB 2HYIB 3MHYA 3QICA 3EVOA 4Y2IA 5EX3A 4FJNA 2P9UB 1C0TB 1JXEA 4KYZA 3W65A 4O5FA 4K0KK 4I64A 2QXFA 2NUHA 2FVRA 4QIGA 3M2UB 1Q16B 2YJEA 3SI8A 3TNVA 4JYAJ 2LU2A 4ETZA 5GAGP 5IC6B 2DRAA 3KLIB 2RRAA 1BI4A 3O9TA 3R2DJ 3GV7B 2HVHA 1TVRB 2X1FA 2ZFHA 1U47A 4CGDA 3GSDA 3U9ZA 2XY7A 4AHCA 4JOUA 5AQPA 2HNDB 2R7UA 4TYAA 3VQCA 3WNGA 3AH6A 4YY3K 3PDNA 2HEKA 3HVTB 4WTOB 1LWCB 5T7LB 4CI6A 4JI4F 1RTZA 4DSFA 4JK7A 4NXMF 1WAJA 2W01A 1EQ0A 4J7CA 3UE5A 4OYBA 2VG5A 2KB2A 1OJ4A 4UUXA 1BQMB 1NPRA 2AJ1A 5KFZA 2RIJA 1IO2A 4ECQA 1S4EA 2GCFA 2XNRA 1YTAA 2HWHA 3CHWA 3VTHA 2H3EB 3GZ7A 4EU0A 2W2PP 1BXNA 3W3DA 4KAZA 4BQLA 3J7YP 4CE9A 3IA0A 2VPZB 3NBPB 4X62F 2W2QP 3MFIA 2Q79A 5KAKA 1N5QA 4BC4A 2UUBF 2RPIA 4GMKA 1S9EB 4UOFA 2RE1A 2D5RA 2WHOA 5HVGA 5G4DA 2QTWA 2UXDJ 2HZCA 4KHSA 1SUQA 2F1FA 2WTUA 1IKYA 3AJDA 3Q8QB 3O4NA 2YXLA 4CH1A 3KXDA 1HWLA 5BYRA 1T8EA 2HHWA 4B3SJ 1K8KA 1FKOB 3HLUA 4B3TJ 4HTLA 2CPDA 1DTQB 1JKHA 4J9VA 1S6PA 3I55N 2VKRA 2F8HA 1WKLA 3M6XA 3Q8SB 3P45B 4GKJJ 4ECXA 4CK2A 2ERRA 2ZVSA 1YIJN 4RUAA 1YI2S 1K0VA 3AODA 1ROFA 3K9KA 4I1TA 1REGX 1S72S 2FDNA 1PG5B 1JNZB 2FHJD 1HKAA 1VR6A 3R5DA 2NPIA 4O3OA 3QEXA 3I32A 1TTHB 5M1NA 1W25A 1SQGA 3HI9A 1RAFB 4OLPA 3VERA 4AD6A 6AT1B 1TKZB 3MM7A 1WEYA 2GVDA 4JHDA 3GIKA 1A5WA 3A0IX 2XG8A 4UUWA 2VC0A 2E44A 4IH6A 1DTTA 4FXWA 2B8PA 1ZAXA 1VRTB 5FROA 3D66A 2KZZA 4QYZK 4FYDA 1V3RA 2ACYA 1RWMB 3DGPA 1Q82T 5AJ3K 1U1QA 2HQDA 3MWBA 2L9NA 2EFQA 3O8WA 3WIUA 3NNCA 1VSIA 1NNEA 2ZQBA 5DM7Q 3GR0A 2QXLA 3CCLN 3D6HB 5B0FA 4Y0WA 4LFBK 5CAAA 1JJHA 1J5EK 4IO8A 3IR6B 3QESA 3SBGA 2XLKA 4ZN1A 3DLEA 5H1SQ 1XMOK 3EDQB 3VGMA 2C2NA 4DUTA 1J5OA 3UVJA 4PQAA 1ZPVA 5KFKA 3KWGA 2XSJB 3OUYA 2CJKA 3NWRA 2RDDA 2XGPA 1JL2A 2HFUA 4ED0A 2R7TA 5JVHQ 4BRIA 2W24A 1AB8A 3C3LA 5C2GA 2I9SA 1S6QA 1TYQA 1SKRA 3DWLA 5AQMA 3T1HF 3CO9A 1EKSA 4UOGA 5KFPA 1S1XB 3K8WA 1BL3A 2IRUA 2B0GA 3FGUA 1KC8O 3FUYA 1I94K 4GV6A 3ZETA 3RBEA 4E7KA 2GV9A 1UVMA 3SUQA 1DLOB 1VQ8N 3V81A 2OYQA 4CEFA 4DSIA 3NRBA 4WBFA 3ZSVA 4DU3A 4NE9C 3DC2A 2B7BB 1X60A 3EGNA 2R42A 3IN5A 2JL9A 4DJBA 1ZBHA 1N88A 3C16B 2X6SA 1EXQA 4GV3A 4Q8EA 3LGNA 1P1TA 1Q53A 3CWJA 1LW0B 5KFDA 2P9KB 1ZBLA 4I6AA 2VICA 4FKXA 3GOIA 1VC0A 3W7BA 3D67A 3VZIA 4FJHA 3WQTA 3AOCA 2E5JA 5DDRC 2VBZA 3UI3A 3AXMA 2FSKA 1XERA 3ENVA 3TJ8A 1N5YB 4N47A 4A62A 4CHYA 2GHPA 1NUEA 1RAOA 3GIJA 4DCOB 1VQ8S 2X3DA 5HMXA 3WXLA 4LVOP 3ZZUA 3VF6A 2CPXA 1FFGB 2V94A 4WXOA 3TVKA 4OZ5A 3KLHB 4J9QA 4BQZA 5KI6A 4DXLA 1WDTA 3CCUS 4F0HA 4DTJA 1D3WA 4EHTA 4UZBA 2AYBA 3E9PA 5DLGA 2X78A 4QJVA 4NI2B 4DCPB 1VSFA 2E6MA 4LF8K 4Y6IA 3UPFA 1OVYA 3TJ9A 4LY7A 5HRNA 4X4QA 3RMBA 1RZMA 4DU7A 4NOHA 3OXGA 4PXDA 1VC5A 4YR3A 1I39A 2A6OA 4D3HA 1NGGA 4HH0A 1H2TZ 3CQXA 1FRLA 4O44A 2V69A 1N36K 1NDLA 4DV0F 1CQNA 3LUYA 5MLCV 2WAQD 1NU0A 4LUBA 3SMZA 4YORA 3RWUA 4WCEQ 4U6PA 3G9CA 1DQAA 1IVZA 2GHWA 3UQSA 4DFMA 4AHUA 2E5GA 4KAIA 1RTHB 3LGHA 1BGXT 3G8SA 2Q97A 5BR8F 3T1YF 4FS1A 2HZAA 4GKKF 2WSEC 1X9JA 5A2QY 4GKKK 4OIXA 3RR8A 4CD1A 2GWKA 4HTIA 3DRRA 4ZOSA 5F8IA 1O5JA 4KHPK 3NCIA 3ZTSA 3CCRN 5HRPA 4W92B 4P7VA 2OANA 2CNLB 2JHEA 1QS4A 5MAOA 3MMVA 1F1BB 4R79A 5E2QA 4WKYA 2UUCF 3DGPB 2QWQA 3UDVA 4H8KA 3PJXA 3AVIA 5CD4A 1KD1O 1SZ2A 4C3MA 3FDSA 5AZIA 2DTJA 5C7PA 4LT6A 3CDAA 1WKJA 4U67Q 1B92A 2A3JA 4JI8F 3QO9B 1RDBA 1WF0A 3I8BA 4QS7A 1RGVA 5KOWA 2KT2A 4JI1J 1HI0P 3QLHA 1VQKN 4JRQA 3MPDA 4H4KA 3ZCMA 3K2YA 1RYSA 2IM1A 3G86A 1SBRA 1RCOB 5KFLA 2LSNA 5KFEA 2NR0A 2J76E 2NXUA 4URQU 4IOBA 1VHFA 4DUYF 4IOAQ 3TANA 3K5LA 4IJNA 4LVNP 4NLRA 4OYAA 1D9AA 3HT3A 2RUSA 1KQSR 1YITS 5M2UA 2MB0B 3KG1A 4LBPA 3L95X 2RE2A 4YDUC 4P9SA 4Z4EA 2YHAA 3NGYA 1QTMA 2GMJA 2OTLS 3OS1A 4GVEA 1Q4RA 3AGRA 3MXIA 2Y9HA 1AUSL 3ZSRA 1LWEB 2GC8A 1VGYA 4JI5K 4M95A 2YKMB 4BRPA 1BDGA 3EN9A 4MK9A 1XNQF 2VWKA 3SAFA 2D1KA 2KT5A 3FZBA 2OPQB 5IV4A 1IG9A 3LW5C 2QWPA 4LR9A 2XMAA 4J9SA 4LC9B 4RW6B 3MMCA 2PGCA 2U2FA 2E9RX 1QJHA 3FQKA 4NO7A 4M3TA 4ILJA 3EE8A 2HLTA 1F9EB 1BIZA 3C15A 3OYFA 2G8HA 3MUTP 1EO1A 2GWJA 2P9LB 3THPA 4DPXA 5AQGA 5GINA 5A2QO 1HQUB 2BABA 1PKUA 2CG4A 2UUTA 2L41A 3SUNA 4OPAA 3PHEA 1X0PA 1CBKA 3BH7B 3J7AP 1HBOA 4CERA 4DL2A 3CCWA 3CCJS 2BQUA 3ZZYA 3NGDA 4H0PA 4OX9K 2DCLA 1WJ9A 3LDSA 2W7PA 4Y34A 2ASDA 3R5BA 1KN6A 5GIPA 1M90O 4GRSA 1HFEL 4ZVSB 1FRMA 2P5OA 1P9YA 1X9MA 2O8BA 2JFKA 4ID5B 1RHQB 3HVWA 3NMAA 2FJAB 5HL7L 2QC3A 5KFFA 1FE4A 2VFTA 2BYCA 1KTVA 4USWA 2R2RA 3R1LA 2PAVA 5AE2A 1ZM2A 4M8LA 4LSNA 3D68A 1NK4A 2DBBA 4RCHA 2XB2D 2P6TA 4I7FB 4F2SA 2QGFB 2CQCA 5A6PA 3EO3A 2KZMA 1XMQK 3NGKA 4M3RA 2P6SA 1QY7A 3U8XA 5M1PA 1BUXA 4UT4A 4RW9A 2W40A 3IRXB 3KVGA 1BIUA 2HQIA 2DNGA 3LP2A 3HFKA 2HMIA 1E4FT 1DGKN 2BRKA 1S97A 3G8TA 1WNSA 1GT8A 4CEEA 1UFWA 2KFZA 4ZVPB 4O3PA 1JLGB 3MUMP 2EK1A 1VJQA 3OTDA 1XNRJ 1FDAA 2UUAF 1PYOB 3IO1A 1W2BM 3PR5B 4ZJOA 4DHVA 3ISND 1R27B 2E5IA 1R8BA 5FLXY 4FM2A 1VK0A 3HHLD 2XYPB 1MU2A 3EWGA 4CI0B 2V51B 1RAJA 4DV4J 2RAQA 1RISA 5E3PA 4KRFA 5LSLA 5HP1B 3TA2A 2QLWA 2YKQA 1N32K 3SPYA 3SQ2A 3M9NB 3UW1A 1TYQB 2F4VJ 3MN9A 3SK3A 2ROPA 2IDLA 2FLPA 4FWMA 5AXMA 1JKHB 1NJYA 4Z4CA 1RBTA 4FNIA 1S0MA 3HSDA 4ZCLA 1EKRA 3CI5A 1X4EA 1ILYA 5AZIB 2EFPA 1RAHB 2PEBA 4EUVA 1IBLK 2CQ1A 1D8YA 2Z1IA 2GQQA 4J9RA 2B7CB 4IFVA 4EZ6A 3LDOA 3PYGA 4C1NK 3ELHA 4AQYK 2FJWA 1IBMJ 2HWTA 4NLCA 3M30A 5L1IA 1J54A 2W2OP 1IJFB 2YKPA 3CSKA 3GP9A 1KRPA 1FO1A 1U8SA 4Q2MA 3HSCA 4CVNE 2KKZA 4C8MA 1VQ4S 5AQQA 2X1AA 2HS0A 4P52A 3PIOQ 4I7FA 3VAFA 4B3TK 1NNDA 2GVZA 3GFXA 1FJGF 2ATQA 4Y1DA 1UKUA 1HLWA 3B6PA 3ENAA 1UP1A 1LAVA 1A6LA 3T9ZA 2QV6A 2AKWB 2OEMA 2PI5A 3FFKB 3H6EA 4FWKA 4RW6A 4NXNK 2D3OR 3PKMA 2Z0GA 4NXMK 4WFBL 3P5BP 3BQ2A 5KFRA 2FSJA 4IG3B 4PRFA 4XEIA 2JFDA 4B9MA 1Z6RA 3LWLA 4YB6A 4K0KF 4O44B 1NGDA 3SPZA 2K3IA 3D6MB 3RB0A 4U8VA 2P9SA 3L7UA 4CQ1A 2JEFA 2HS3A 3CJSA 4CLLA 2VKZG 3M7VA 2BUPA 3H7HB 3GBTA 2NNWA