3DLGA

Crystal structure of hiv-1 reverse transcriptase in complex with gw564511.
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
539
structure length
531
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 150
structure length 531
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dlgA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dlgA05
1HMVB 1JKHB 4EO6A 4CHNA 1WN7A 5KFGA 4Q44A 5KT5A 3E01A 4CFCA 4I2PA 3O3GA 3DRRA 4CHOA 3VA3A 4ECWA 4J9QA 1FKPA 5HLFA 3QEPA 3HVWA 1VSDA 5KFCA 5F8NA 3S3NA 3MR2A 2OPPA 2Z1JA 4QWCA 4C8NA 1RT5B 3OYFA 2RF2A 1IKWA 3WNHA 1RT5A 4KB1A 4WFZA 2F8EX 3Q8QB 4O4GB 4ZTFA 1D9FA 2V4RA 2YV0X 2C22A 5KG7A 2XI2A 2OPQA 4E3SA 4FJIA 4PQUB 2FLPA 1D5AA 4GMJB 3ALYA 4CIEA 4IKAA 5KFFA 2D0BA 5KFIA 3TARA 3CVKA 1KVAA 4NLTA 4K8ZA 1TKDA 4KV8A 2IJFA 3AVBA 3KIOA 5HRRA 3MR6A 4TLRA 1WLJA 4AHSA 4FJKA 1S9EA 4H4OB 1NOZA 1S1WA 2B5JA 4CIGA 1RILA 1KRPA 4QWEA 1Z4UA 4O3PA 4G3IA 3ITHB 1S1VB 4URQU 5F9LA 4J2AA 2J6UA 3PHEA 2R2UA 2B4JA 4ZPCA 2BRLA 2BR0A 1XC9A 1RTDA 4KTQA 5KFDA 4CEFA 2W9CB 3HKWA 1DTQB 4Q0BB 4ZVEA 3ZT0A 3K2PA 4M3YA 2VG7A 2E6LA 5L1KA 1KCFA 3A2FA 4DEZA 4F4KA 1JLBB 3KLIA 4NCGA 3IS9A 3BSOA 3T1AA 3D0PA 4FLTA 3H40A 2IMWP 4C8MA 3IRXA 1QQCA 5KFYA 4DSLA 5K14B 1A5VA 1W0HA 1JXLA 1VSLA 4ZVFA 5HRPA 1KVCA 4IRCA 4O0IA 4O3SA 3HSTB 5F8GA 4H4MA 4ID5A 3JSMA 2ZKUA 1UWBA 4EO8A 1GOCA 3DLBA 4O0JA 2E9TA 1DLOA 4J9SA 3OSPA 3AV9A 1IKYB 3V81A 3OYAA 1IKVB 1RT1A 1ZTWA 3V6KA 3SI6A 5C25A 1RT6A 4ECQA 4TY8A 3FRZA 4DQIA 4CJWA 2O5DA 1HRHA 1U49A 1FKOB 3HPGA 1XWLA 1LV5A 3MFHA 4K4YA 2HHWA 5KFPA 4BWJA 4QAGA 5F8MA 3V6DA 1WSIA 4NLOA 2W9BA 1X9WA 3KLGB 3OHBA 2HHVA 2PYLA 4CJQA 1WSJA 4MIAA 1HQUB 4FJ9A 2YKNB 3MEDB 2WONB 3DI6B 4FXDA 4N47A 4C8KA 3OYIA 5L1IA 4FBTA 4FLZA 2YHAA 3MECB 3MR5A 4G1QB 4F8RA 1J9AA 3TANA 2AU0A 3TAFA 1NHVA 4KI4A 1QSLA 1J5OA 3OSNA 4ICLA 1NKCA 2G8WA 2YNHA 1QTMA 3AVHA 4F4ZA 1U04A 4CEDA 1Q9YA 4KHNA 4I7FB 1EKEA 4YMEA 3B6PA 2GIRA 1WNSA 4DMNA 3OYNA 1NJWA 4NYZA 1XI1A 1CLQA 4DTPA 5EWFA 2RDIA 1TGOA 2R8IA 4CGJA 4WFYA 3RAQA 3ZSRA 4JV1A 3AVNA 2FBXA 3NAIA 3KLGA 2YKNA 3DI6A 3QGIA 3ZSVA 5K14A 4DFPA 1YT3A 5KGXA 1YTAA 4EEYA 3L8BA 3MECA 4NYNA 4WFXA 2HHSA 3E01B 2W7PA 4NLSA 3OS0A 4OL8A 4CF2A 1OS5A 1IKYA 3V81B 5DGAA 3OS2A 5KFXA 2IS3A 4B9LA 2JC1A 1JX4A 1HYSB 3HVAA 4TYAA 3OYEA 3CQ8A 1KFSA 2X6SA 2HNDB 1JLFA 2QKKA 4CEOA 4MH8A 2HNYA 2IC3B 3SI8A 2JEJA 3HO1A 4C8OA 3RWUA 3MF5A 2EHGA 4Z0UA 1Q9XA 2KFNA 3DLGB 3VA0A 4KBIA 2D3ZA 3PVXA 3AVJA 4Z4EA 3ZT1A 2HNDA 2KZMA 3KLEB 1T03A 2P5GA 3QO9A 5L1JA 1N6QA 3HJFA 1SL0A 3SZ2A 1SH0A 4K4WA 3KK3A 1S1VA 2IDOA 3HK2A 1JLGB 1S48A 4DS5A 4CHYA 3QINA 3G6YA 4MKAA 5FROA 3KMQA 3SFGA 3OS1A 3K5NA 3HVRA 1JLFB 4XO0A 3PJWA 1TL3A 1ASWA 4RW6B 4YR2A 3C6UA 2IA6A 3MEEB 4RNHA 4KTWA 4ZPAA 1T05A 3EYZA 2E4LA 4IRDA 2HMIB 1RT3A 3DLEB 3C95A 4FJ5A 2GC8A 2CKWA 3GV8B 3SQ4A 4URSA 4URGA 3KKSA 4JRQA 3KLFA 3LALA 3D5MA 5FDLA 3JYTB 3SQ1A 5KRSA 1VSJA 5I3UB 3EY1A 3OVNA 3UQSA 3V9XA 4KHWA 2HMIA 2WOMA 4N5SA 5KG5A 1RT2B 5DGBA 3BQ1A 1TAQA 2HNZB 3HPHA 2RPIA 2HHXA 4U7CA 4KHUA 4MK7A 3OL9A 3AVAA 5KT2A 3K5OA 5J1EA 4DLEA 1LWEA 3M8RA 4DG1A 1JXEA 2J6SA 3AVMA 4O4GA 4ECSA 4AHRA 3RB4A 5J2PA 2DFEA 1FK9B 1RT3B 4E7KA 3BQ2A 4MK8A 2IGIA 3DYAA 4MK9A 5J2PB 2WTFA 1TV6A 1IKXA 3FFIB 1RA6A 1LWCB 3VQEA 2PYJA 2OPPB 2A1RA 4CJUA 3BSAA 3NH0A 2FC0A 4YNQA 3L2VA 3HP6A 1BI4B 3V9ZA 4LQ3A 4IFYA 1SKRA 2W8KA 4ED1A 2VG5A 5HP1B 2GIQA 2YKMA 4M45A 5FDLB 3JYTA 1J5OB 1NOYA 1QSYA 1ASVA 1S6QA 3M8QA 3QGHA 1L3UA 1BISA 1YVFA 3MR3A 2OZSA 1K6YA 3SQ2A 4KO0B 3OYBA 1DTQA 2ZE2A 4BE0A 1JL2A 1IO2A 2EC0A 4ECVA 1VSFA 1SV5A 3PJXA 4DSEA 3DLKA 2BANB 4E1NA 1X9MA 1T7PA 3E51A 3CJ3A 2W8LA 1TL1B 3LAKA 1HQEB 3DRSB 4CGGA 4FVMA 3VQSA 2DPJA 1VK0A 2IC3A 1WSEA 5DMRA 3CJ0A 4ZHRB 3BQ0A 2D0AA 4OVLA 3NKYA 1TAUA 1YTUA 1FXXA 3UDLA 2G8UA 4QWAA 3AVGA 1MU2A 4Y2AA 5DG9A 3EZUA 3CFOA 4RNFA 1DLOB 1YVUA 1J53A 2KFZA 4O3RA 3DRPB 4LSNB 4Y3CA 4CGIA 1UAXA 1C1CA 1S1TB 4CJVA 3VQBA 4OPKA 2OPQB 1S9EB 4H4OA 3RMDA 4C8LA 5HROA 3DOKB 5CYMB 5KFNA 1I6JA 2XO7A 2PY5A 4QW9A 1KVBA 1UOCA 4B8AB 3CFRA 4O5BA 4PUOA 1SV5B 4ED7A 2AQ4A 1C1BB 1TKXB 2OA8A 3MEGB 3CFPA 3AO2A 2R8KA 3HVTA 3RR7A 5C42B 2FLLA 1HQUA 2GV9A 4DL7A 4DL4A 4O44B 1BQMB 4EZ9A 3T5LA 1ZTTA 4M94A 2YNGA 4ID1A 4DU1A 3PW7A 4W5RA 4JS4A 4CIFA 4I7FA 2ALZA 3VN5A 4ELTA 1T94A 1BQMA 3TVKA 3I0RA 2ASJA 1JLEB 5KFLA 4CF1A 3NL0A 3ASMA 4NYFA 4FS2A 1JLEA 1TKTA 1BCOA 3AO5A 1NK7A 1TP7A 4N56A 3ISND 4PUOB 5HLFB 1JLQA 5D3GA 2HAIA 2JEFA 3MEDA 3DLRA 3HM9A 4ELUA 4IFVB 3FQLA 3CDEA 3PO4A 2KW4A 4OKEA 2ITGA 3RTVA 3BGRB 3KJVA 3MXIA 5C42A 3NAHA 5KTQA 2HWHA 2IM3A 1JLQB 5D3GB 3DRPA 1C0TB 3OLBA 4R5PA 1JKHA 3N6NA 2JLEA 3RBDA 1CSJA 3LPUA 4FS1A 4FJNA 1U48A 2WCXA 1RTIA 3ZSOA 3SV4A 4RNMA 4DL3A 2V0NA 3TQ1A 4JS5A 4LD0A 2XHBA 4DTMA 1QAIA 4Y1DA 4EBEA 3UR0A 4I2PB 1TL3B 5DQIA 3DDKA 2Z1IA 3GIKA 3ZT4A 1CZ9A 3V4IB 4ECZA 3IG1B 3M9MB 4NLWA 3ZSZA 4ECUA 4FJXA 3RB6A 2XI3A 4K4XA 4ECRA 4QW8A 1HNIA 3T19A 4IG0B 3BJYA 4FLYA 4OKJA 1LWFA 2O4IA 1N6QB 5EWEA 2WB4A 4KI6A 2E6MA 4J2BA 3PX6A 3KLEA 2D41A 4CF0A 4K4ZA 2R2RA 1I3AA 1NHUA 4OLAA 2G8HA 1RDBA 3KJVB 1NK6A 1X1PA 2OZMA 4O3OA 3LWLA 5I42A 2FVCA 3LP1B 3QZ8A 4GW6A 3VQ6A 1C1CB 1S1TA 2XRIA 3KD1E 4DTJA 4JV2A 3NHGA 3PO5A 4ZVGA 3V1RA 3D45A 1S9GA 3PY8A 3GILA 3G10A 4GVMA 5J2NA 3KK2B 5JS1A 3RBEA 5KFZA 4ZP9A 1LWFB 2IAJB 1SH2A 4IH5A 1MU2B 4RG8A 1HNIB 3SFUA 4KE5A 1U47A 4FYDA 1RYRA 2QK9A 2OPSA 3NGIA 2ETJA 3WNGA 3PX0A 4Q43A 3QESA 4DWIA 3M9OB 5KI6A 1RBRA 5HP1A 4MFBA 1TL1A 3CDWA 3N6MA 3O4NA 5F8HA 4J9NA 3C94A 3DOLA 4QOZB 1BI4A 1N56A 1I39A 4F3TA 1RTDB 3BREA 2R8HA 4XPEA 1ZYQA 3H5SA 3V6HA 2XGQA 2YNIB 4CHPA 3ZSWA 3FFIA 4GC7A 2XY6A 5FRMA 4KHQA 3DLEA 5C5JA 4DF4A 1VSHA 4RW7A 1S1WB 2B5JB 4QPXA 2BRKA 4Q45A 1C1AA 4M3RA 3V9UA 2BQRA 2GUIA 3VQ9A 1BQNB 3OL8A 4M95A 4NLVA 3HPOA 2G8VA 1XHXA 3THVA 3L2RA 5KG0A 4RNOA 2GBZA 4HUEA 2AJQA 3RMCA 4KAZA 2YNFB 2FJXA 2HNZA 5KG2A 4CEAA 1LW0A 4LH5A 4NLRA 2O4GA 4CJ3A 1JIHA 5J2QA 4QWBA 4WXWA 4NLGA 4H4MB 4TY8B 4DTOA 5DK5A 4FLUA 4FCYA 3L2UA 3IN5A 3HVTB 3CDUA 2WK4A 2P5OA 5JXSA 1LW2B 3N6LA 1K1QA 4YQWA 4FLXA 1F21A 3OYMA 1FKOA 3M9NB 3DOKA 5CYMA 1EP4A 1JLBA 4NCGB 5EWGA 3Q8RB 2YHBA 4IR1A 4I9LA 3JSMB 2AWZA 4FM1A 5CYQB 2IM1A 4FJ8A 5SWMA 3NGDA 4AHCA 3QLHA 3QEWA 4KO0A 3KLIB 5J2MA 3KK1A 4IG0A 4ED8A 4YFUA 5DLFA 4E7HA 4PWDB 3PV8A 5EDWA 1L3TA 4HVJA 1W25A 2V4QA 4FLWA 1A5XA 3H59A 4MQ3A 1D0EA 4KTZA 3GIJA 1RTJB 3CJ5A 5KFQA 4RW9A 3LP0A 4J9PA 2JEGA 4ZHRA 3VQ5A 4FK0A 4W5NA 4M3UA 4E0DA 5CYQA 3DM2A 1C0TA 2J6TA 4AHTA 4DTSA 5KT6A 4IDKB 2QV6A 4CK1A 3MFIA 3ULDA 4AHVA 3KLVA 3MAQA 3QEVA 4IFVA 4CEQA 4BDPA 1R0AB 5KG4A 3VQ7A 3KD5E 1S6QB 3M8QB 2VWJA 2E9ZA 3PW5A 2E9RX 3TABA 4U6PA 1QSSA 3M8PB 4FZYA 1TVRA 4IG3B 3RB0A 4Y1CA 4IFYB 4KRFA 2OPSB 4K8XA 4G1QA 4JV0A 3SCXA 2B43A 4QCLA 2XWYA 2W7OA 2ZQBA 3QEXA 1GOBA 4DL2A 1RDAA 1DTTA 4DTUA 2XY7A 4DTNA 3AA5X 3AO4A 5KGWA 3GYNA 3TAQA 2KTQA 4HTUA 1A5WA 2JC0A 5F8JA 4J9KA 4NRUA 3PW0A 2D3UA 2QE5A 5KG3A 4DQSA 3QYYA 4DSKA 3NDKA 3SUNA 1S0MA 3BSNA 2VG6B 1CXQA 4B08A 2BE2B 4RUAA 4CE9A 3IGVA 2OPRB 1RBUA 5E41A 3OYDA 1RT6B 3U6FA 1JL1A 4IBNA 5DQHA 2UUTA 2I5JA 3NF6A 1RDDA 1UWBB 4LSNA 1X9SA 5KFOA 1KTQA 1XR7A 1BHLA 3KHGA 4CCHA 4FM2A 1VSMA 3AA4A 4K50A 4B9NA 2NUBA 3M8PA 3CO9A 4IG3A 2FJWA 4I2QA 4F2SA 4HCBA 3ZT2A 1RNHA 4CGDA 3MEEA 2AGPA 4TYBA 2YNHB 4BDZA 1NJXA 1GX6A 3BDPA 3G6XA 3I0SA 5C24A 1JLCB 2JEIA 4DU4A 3I5AA 4I9QA 1NK4A 3NE6A 3LZJA 4Q8EA 3C6TB 3KNAA 3ZSQA 1UA0A 4O55A 1SKSA 4FK4A 5KFRA 3OJSA 4Q8FA 1TKTB 1S9GB 3V1QA 3P83D 3I5CA 1KSPA 1N5YB 3KK2A 3OHAA 1T03B 4Z4HA 1NNDA 3BR9A 3NF8A 2Y1IA 3DLHA 4K4SA 5I42B 4RW8A 5KT4A 4CHZA 3O4QA 4M41A 4FLVA 1Z25A 4BWMA 1S0OA 4FW1A 4ZP8A 4J9OA 4J9MA 4DFMA 2UUWA 2BANA 4TXSA 4KKOB 1TV6B 4RW4A 2QKBA 3QNOA 3MEGA 3NF9A 4LQ9A 1KHVA 4KKOA 1KHWA 4CJRA 4DU3A 3QIPA 4X2BA 3D28A 2XC9A 3H2LA 2UVRA 2AX0A 1U4BA 3PW2A 3H5XA 1REVB 1KLMA 1RT7A 2ATQA 1D9DA 4E1MA 3NBPB 1B9DA 4EYIB 5JS2A 2R2SA 4TN2A 3T5HA 1RDRA 4F4WA 1IKWB 4BDYA 4WZQA 4OJRA 4TSXA 4KAIA 1HJRA 4W5OA 3OYCA 3PX4A 1W9HA 4Z4GA 4EZ6A 3K57A 4ED6A 1RAJA 3L2WA 2YNIA 5KFTA 1RYSA 1HPZA 5J1EB 1LW0B 3QIOA 1EETA 3ITHA 2W9BB 4NLUA 1NKEA 1C0UA 2FVRA 1T05B 3TAEA 4N41A 3PR5B 5KRTA 3DMJA 1HNVA 2HWIA 1C0UB 2F8TA 3Q8PB 2D7SA 5F9NA 1S1XA 4WE1A 4B9SA 2Z1GA 4IQXA 3LANA 4DTXA 3EPGA 3OYGA 3AA3A 1TK8A 2ASDA 5KFKA 1RT2A 3I5BA 4ZTJA 3OL7A 2UVWA 1KLNA 5KFVA 2VA3A 5I3UA 1S1XB 4WE1B 4FW2A 4Z4CA 4CERA 1D1UA 1HYZA 4AH9A 1Q8IA 3HL8A 3H4BA 5KFEA 1TKZB 3L3UA 3C6UB 3I0RB 2P1JA 5HRSA 4CFBA 3EPIA 4CJSA 5DLGA 4IOBA 4XIUA 3KLHB 2DFFA 5CZ2A 4ZP6A 4CJFA 3OJUA 4HUFA 3EZ5A 1RTHB 3RMBA 1RA7A 4CJTA 3KMSA 3TWHA 3VQPA 4J9LA 2C28A 4OGCA 2VG7B 4WXOA 4WYLA 4M3XA 2UVVA 2ILZA 4BE1A 4EBCA 3QETA 2XY5A 3QLHB 3QIDA 1BGXT 3SQ0A 4QWDA 1NJZA 4FJHA 3RMAA 3AO1A 4O4RA 1S6PB 4Z4IA 4J2EA 3DM2B 5DQGA 2I1RA 4ID5B 3ZSXA 3QO9B 4FJJA 4BE2A 4KHMA 3MTKA 2YNGB 5HBMB 1RT1B 3LP2A 4TQSA 2PZSA 1R0AA 3LP1A 4TQRA 4ED3A 3LP0B 4FZXC 3SJJA 1G15A 5T7BA 4FJMA 3OYKA 2RKIB 3IS9B 1U09A 3K5LA 5J2QB 4H54A 1NK0A 2DFHA 4CF8A 1VRTB 4JLHA 3ICLA 4Y2CA 3ZSYA 4CJEA 3IG1A 2HHQA 1RTHA 3AVFA 4W5QA 3K59A 1VRUB 3NGYA 2R2TA 4FBUA 4ZPDA 1WAFA 2Q3SA 3OYJA 3L3VA 4LSLB 3AVKA 4KB7A 1RTJA 3MXMA 1SUQA 1NJYA 1L3SA 4FM0A 3LP2B 1WAJA 2X78A 3H08A 1N4LA 4ECTA 1S10A 3KHHA 4KFBA 3OLAA 3NH1A 3DLKB 5T14A 1GX5A 4KHYA 3O3HA 3FQKA 4CJ4A 4HKQA 2XCPA 2I5JB 4IRKA 3CM6A 4IR9A 1VSIA 3VQCA 4Z4FA 4E7JA 3H4DA 1C6VA 1VSKA 4CHQA 2ZD1B 3QEIA 3BGRA 3I0SB 5C24B 3KHLA 4CK3A 3OYLA 3GV5B 4CGHA 2BE2A 3G0ZA 4ZVHA 1EX4A 2HB5A 1KLMB 1RT7B 4B9MA 3U3YA 2UVUA 4OKKA 1VRUA 3S3OA 4NCAA 4FZZA 1B92A 1TK0A 4JUZA 5L9XA 2LSNA 4YR0A 4HHTA 4M3WA 5F8IA 3F73A 1IG9A 4KPYA 2YKMB 4DQRA 4R5PB 4B9TA 3VQAA 4DTRA 4KHRA 4PY5A 1C1BA 1EETB 1TKXA 3FSIA 2FJVA 3KKRA 2Y1JA 3HXMA 4RUCA 1J54A 4F2RA 4CJPA 2XCAA 3V9SA 4J2DA 1SKWA 2V9WA 4ECYA 2ZD1A 1S5JA 2W42A 1IM4A 4RW6A 3V6DB 3SUPA 2HVHA 4DFKA 3NFAA 3G86A 2F96A 4FJ7A 2IJNA 3GIMA 3TI0A 4ZPBA 3OYHA 4F3OA 3SPYA 3ZCMA 4CECA 1GOAA 4ELVA 3DRRB 5KFHA 4FJLA 3T5JA 2VWKA 2IM2A 2FVPA 1ASUA 3H5YA 1WSFA 3IAYA 1JLCA 3O3FA 4YP3A 3GV7B 4RW9B 1BCMA 2FVSA 3P1GA 3T3FA 1UA1A 3TAMB 4K4TA 1HQEA 3DRSA 3SYZA 1RTIB 1RCHA 5L1LA 3AO3A 1HMVA 4IH7A 2JGUA 3RAXA 4LH4A 4RNNA 4E7IA 2RDJA 4EP5A 3C6TA 4ECXA 4CEEA 1TQLA 3AVLA 3V4IA 1L3VA 3VQ4A 3WNFA 4ED2A 4CGFA 2HNYB 3HHKA 4DL5A 1S4FA 5J2MB 2Z1HA 4YR3A 2DY4A 3NCIA 2B6AB 2R8JA 3KLHA 2C2RA 2DPIA 1RBSA 2G8FA 4DFJA 4EYHB 1HYSA 4DS4A 3RRGA 4R8UB 2P51A 2FLNA 3CG7A 2IM0A 3SUQA 2VG5B 1S49A 4NLXA 4FK2A 1QE1A 3NH2A 3TAMA 4PA1A 2RN2A 4MFBB 5KFUA 3F9KA 4DQPA 3DMJB 2ILYA 1S0NA 4NCBA 1CZBA 3KOAA 3TR8A 3QERA 2HVIA 4OGEA 3V9WA 2YNFA 1LWCA 1FKPB 3ZT3A 4F4XA 4KREA 5CY4A 2IBKA 3OY9A 3AVIA 1BQNA 1HNVB 1QS4A 2W9AA 5FRNA 4AHUA 2CJQA 1LWEB 4KV8B 3LP3A 2XY8A 1D8YA 2B6AA 4WZMA 4IH6A 4DG1B 4DSJA 3HYFA 3RRHA 4PQUA 1HARA 3K58A 2AX1A 5EU7A 2WOMB 4R0EA 2BDPA 2ATLA 2ASLA 4RW7B 4O3QA 3T5KA 4CEZA 4E7LA 4CEBA 1L5UA 2C2EA 5CZ1A 1RBVA 4Y34A 3S9HA 5JUMA 5EUHA 2WONA 3FDSA 1T8EA 4KSEB 1VSEA 4K4UA 3QIPB 1IKVA 1NKBA 4DSIA 3V6JA 3TAGA 4E89A 2G8KA 1ZBUA 4LSLA 4EP4A 1RT4B 1REVA 2BQUA 1JLAA 2HW3A 4RW8B 1K1SA 4NLDA 4K4VA 3CM5A 5HBMA 5F8LA 1RT4A 1ZBIA 3S3MA 1WNEA 4W5TA 4CFDA 4NLPA 2W9CA 1IH7A 5HROB 4HYKA 2RF2B 2FBVA 1BL3A 4L8RB 5C25B 1ZBLA 4B9VA 2OH2A 4FJGA 4RU9A 1B9FA 3LAMA 2OYQA 3AVCA 1VRTA 1DTTB 3P5JA 3IGNA 3PR4A 1XHZA 1LAVA 1EP4B 4NLQA 5DG8A 1U45A 3OL6A 4CESA 3SV3A 2A1SA 4Q0BA 3GQCA 1XR5A 3CJ2A 1QHTA 1TVRB 4NRTA 3LDSA 1Z26A 4B9UA 1SUQB 3IRXB 1WSHA 4IKFA 2VG6A 4H8KA 1HYVA 1XR6A 4CF9A 3QGGA 4EBDA 5KG6A 5SZTA 3G6VA 3PUFA 1C0MA 2X6NA 1LW2A 1QUVA 4ZMMA 3UPFA 3CJ4A 3KK3B 3LPTA 4GC6A 1TKZA 4CJKA 1O1WA 1N48A 4RZRA 2RKIA 1SL2A 2XGPA 1EXQA 3K5MA 3L2QA 1RDCA 4B3OB 3WNEA 5KFSA 4M3ZA 3LWMA 4B8CA 3U3GA 4ED0A 2HHTA 1IKXB 3RB3A 1S1UA 4HUGA 4UQGA 1Y97A 3VQQA 2HHUA 2QXFA 5KG1A 1C2PA 5KT3A 2VA2A 1BIUA 3M8SA 1SL1A 3SUOA 2FVQA 1S6PA 1SH3A 3KK1B 4HCCA 2FBTA 3KLFB 2BGGA 1RBTA 4CK2A 3TAPA 3BSCA 3NF7A 4MKBA 4KFBB 2R7YA 3H5UA 3QZ7A 4Q5VA 3DOLB 1QAJA 5KFAA 2G8IA 2BQ3A 4OLBA 1WSGA 3PZPA 2D0CA 2X74A 4WYWA 4B3OA 1NK9A 5KT7A 5KFWA 2WRMA 3MXJA 2WHOA 1MMLA 3NAEA 4IDKA 4BACA 4NZ0A 3HP9A 3B6OA 3AA2A 1BIZA 4J9RA 3SNNA 3ISNC 4TY9A 1NK8A 3UIQA 3DYAB 3CIZA 3QNNA 2D5RA 1S1UB 2AGOA 4RW4B 2FBYA 4DQQA 1CXUA 3HT3A 3H98A 2OPRA 4N76A 4XPCA 1ZETA 3NBPA 3VQDA 1TK5A 2AGQA 4O44A 1QE1B 3DLGA 1KFDA 1S97A 2IAJA 2C2DA 1T3NA 4ICLB 2DTUA 4M3TA 4PWDA 2KZZA 1JLAB 2KQ2A 5HRNA 3PW4A 4OPJA 4DLGA 1LAWA 3CWJA 1ZBFA 4CFAA 2ZE2B 1HPZB 2EX3A 4NLYA 2F8SA 3VQ8A 2R8GA 4CJ5A 3SPZA 4R8UA 4DF8A 1JLGA 4ZP7A 4DL6A 5J2NB 4AILC 3RR8A 3KHRA 3I8DA 4E19A 1S9FA 3NGZA 5KFBA 4MIBA 4CJLA 1NK5A 1ITGA 4F50A 1JXBA 5KFMA 4JRPA 3GIIA 4KHSA 2IOCA 3NMAA 4LY7A 4DSFA 3V1OA 4M42A 4F4YA 3Q8SB 4KB0A 4I2QB 5KFJA 1ZBHA 4O3NA 3LZIA 3CYMA 3KTQA 5DG7A 1N5YA 1FK9A
chains in the Genus database with same CATH superfamily
3NP5A 1JKHB 3BKTA 4WU2A 2V2QA 4EO6A 4CHNA 3BV8A 2ZM6K 3RGIA 4Q44A 1HKAA 1S59A 4LF7F 1NGCA 4DR2J 3O3GA 2RHSB 1MMDA 2BKOA 4CHOA 4X4TA 2VDHA 1R7IA 1M5KC 4OHXA 1GQEA 1FKPA 1NDLA 4CM0A 4ZIWA 4IZ9A 3HVWA 4CZIA 2CQ3A 3MEKA 3U7JA 3MAHA 3R6GB 3TPQA 2W01A 2GA7A 2CNOB 2OPPA 1VQYA 2Z1JA 4C8NA 3F9MA 5H9FJ 1IKWA 3QRPA 2BUNA 2J9CA 3IXQA 3Q8QB 2DH7A 5GADI 3FZFA 1D9FA 4X4NA 2V4RA 3N4QA 2HZAA 3L7OA 5E3RA 1Z05A 4WFAQ 3JB9k 2CPDA 2JFDA 2OPQA 1TUGB 2VASA 4F67A 4PQUB 2FLPA 1IBCB 1RADB 5KFFA 1FCAA 2D0BA 4PL7A 3WZ0A 5LMUF 2P9LB 2VBWA 1KVAA 4NLTA 4UZBA 4IWVA 4JN4A 4KV8A 2Z30B 3L9ZA 4BRKA 2QN6B 2WAQD 2C42A 1FWPA 3CJ9A 2ZF5O 2D9PA 4TLRA 3M2RA 3QMLA 3SAHA 2B9WA 5E2QA 1S9EA 4H4OB 4C98A 1K9MO 4HH1A 4DV4F 5GAHU 3NXZA 5C2GA 4O3PA 3AJDA 5CAAA 2RHKA 4URQU 1P8ZA 5LSLA 3DWLA 4J2AA 2J6UA 3DC2A 2B9XA 3ZO7A 2B4JA 3OTBA 1AW0A 2ZVIA 3MMCB 2VG7A 3GLJA 2VQEK 3A2FA 2HOEA 4F4KA 1JLBB 2K3IA 3MN6A 1SJ1A 3BSOA 2GVDB 3RU0A 1RB0A 2J8AA 1HNZJ 2YKAA 2PDAA 4DSLA 4OX8A 5F2RA 1W0HA 2WSEC 3CMAS 2FSKA 4W90B 1VSLA 4ZVFA 5HRPA 2X3DA 4O0IA 4O3SA 3S01A 1FE0A 3HSTB 4UT4A 3AA8A 3VTIA 4BC9A 2ZHAA 3W5ZA 3AT1B 4IOAQ 1RT1A 4ECQA 3A8EA 4YOWA 3FRZA 1HBMA 1HRHA 1U49A 1EQ0A 3HPGA 2MKSA 3FSYA 3MFHA 2GQCA 1H98A 1NMEB 5KFPA 5KQDA 5B7WA 2ZJQQ 3OTOF 3TP2A 5F8MA 3UI3A 3JAMU 2RT3A 3THYB 3OA9A 3TTFA 3BO2A 4CJQA 3CT9A 1WSJA 3DI6B 3OW2R 3IO1A 5LY3A 3OYIA 1W97L 2A6AA 4FLZA 1DKGD 1HWIA 3MR5A 1UMJA 5LJ5Y 3TANA 2AU0A 3BO4A 1WACA 2QO3A 3P96A 3A0IX 3R5BA 3BKFA 2YNHA 3IC1A 1FRIA 1XNQJ 4A8YA 3GFZA 2A6MA 4A48A 2GIRA 4NX9A 1WNSA 3A13A 5IWAJ 2NRWA 1XI1A 1CLQA 4DR4K 4CO2A 2RDIA 1TGOA 4TKTA 1OY9A 5F0WA 3TX0A 6FD1A 3RAQA 1DRZA 1GK8A 3ZTSA 3M6GA 4OO1J 5HQLA 1P27B 1YT3A 5KGXA 3HSJA 2CQ0A 4NYNA 4DR3K 3E01B 2W7PA 2R7VA 2P9GA 4QYZJ 1L3KA 3UVJB 3OS0A 3J7AN 4W98A 2HFUA 3V81B 5DGAA 1TUUA 3MM5A 1XC3A 4CH7A 1V5IB 1Y3KA 2UUAK 5KFXA 2IVFB 4GKKF 1AZSB 2BKPA 3KUHA 2KL8A 1FRKA 3HVAA 2N3LA 3OYEA 2V50A 5AR0A 2X6SA 2QKKA 1XNRK 4CEOA 1N32K 4MH8A 2CPJA 2HNYA 4J8FA 1FJCA 2B7CB 4C8OA 2XM3A 5J1PA 3PHTA 5D0RA 4QIFA 2KFNA 1Q9XA 4B9QA 3VA0A 4KBIA 3GFHA 2D3ZA 3M2RB 5E3PA 3PVXA 5DS7A 2HNDA 4JKHA 1SCJB 3ZZ0A 2XB2D 2KZMA 1T03A 5B0GA 2KDOA 5HMZA 2OMOA 5M1QA 1SL0A 2QMXA 4A47A 4USTA 2VODA 4NXMF 2P9SA 1KC8O 1RI7A 2IDOA 4FKXA 4JI0F 3S41A 1ELOA 1S48A 2CUYA 3G6YA 5LJVA 2FPHX 5GAEI 3HFKA 2V8VA 2DITA 2QC3A 1WG5A 5GAGI 1JLFB 4XO0A 2VL1A 1VBZA 1ASWA 2HBLA 2AA4A 3C6UA 3F0NA 2UXBJ 2MJNA 2H5EA 4ZPAA 2VBXA 3FRYA 1GTEA 3IBFB 4IRDA 3K8VA 5LMNK 4ILRA 3VR1A 5GAHP 1B3TA 3FBEA 3J7Z5 3KKSA 4JRQA 1NSPA 3KLFA 5FDLA 5BPMA 5I3UB 1KQSR 1H1VA 1F2GA 4DX7A 4XH1A 2M5YA 4PABA 2IRXA 2V52B 3CC7S 3L95X 1RT2B 5DGBA 1TAQA 3H6EA 2LMIA 2QLBB 2BOPA 1BE4A 4PR6A 2Q0UA 2VOOA 1NMNA 3CCVS 1OMSA 3UNYA 4DLEA 5AQNA 4DG1A 3C3LA 2J6SA 4DV3J 1OPZA 5KQ8A 2DHGA 1RHRB 2DFEA 4X65J 2NXNA 4Y2IA 1RT3B 4E7KA 4MK8A 3DYAA 4WF9Q 2WTFA 5E33A 3FFIB 5EVZA 4WK1A 4H03B 3GB0A 4AD6A 2DH9A 2UV8G 4CJUA 1VMBA 2V8GA 4HHHA 1RBLA 2MKYA 3WQTA 1NMDA 2BE9B 1XERA 2LDYA 3AOBA 1SKRA 1RDUA 3FBCA 2GIQA 5FDLB 4QU7A 1S6QA 2OZSA 3A4TA 4IOCL 2JDJA 1NNEA 3OYBA 1JJHA 3MM7A 4BE0A 2NZTA 2ZITA 3CJRA 2EC0A 4U7UK 4CZHA 2EG2A 3UFCX 1B0VA 2BANB 2V51B 1X9MA 2M8DB 2LECA 3CJ3A 2A41A 1WG4A 2KN4A 4CGGA 4FVMA 5E84A 2ZH4A 5DMRA 2CPZA 1IXKA 2XS5A 2KT3A 4OPAA 4X66F 1JCEA 5CCLA 2LQBA 4QOTA 1YTUA 2G8UA 2VZ9A 4A46A 3EZUA 4F3QA 2QGFB 1YVUA 2KXNB 1N52B 1QAXA 2UYTA 4NMXA 3TWZA 3FCHA 2BX6A 1HW8A 2DNMA 4CJVA 4OPKA 2OPQB 2FHKA 3RMDA 5HROA 2B9YA 1HNWJ 3MN7A 2W41A 2BJ9A 5MLCQ 4X4QA 3CIMA 3R7BB 4X66K 1UOCA 2ZUGA 1MLAA 3G71N 3HD1A 1QJHA 1RACB 3HVTA 1UW9A 5C42B 2FLLA 4ZVSB 1UJ5A 2AT1B 1KQGB 4O44B 1M1KT 2CNNB 2YWGA 3G6EN 4M94A 4NEZA 2DYAA 3TO8A 3NEKA 2ZM6J 2QL9B 4I7FA 4FN5A 1KC8T 2HQDA 4ELTA 5BN9A 4U95A 3TVKA 1Q7YO 3I0RA 2ASJA 4AT1B 2I0XA 4N8OA 3E3XA 1Q1KA 1CJVB 1NJIO 2AZ1A 3AO5A 1CS4B 4E8UA 4NA3A 3OVBA 4FL9A 4PUOB 4LF9K 2GO8A 4X64J 1DAXA 2P9CA 4QJVA 3MEDA 4BLGA 3R8YA 3VWSA 1NZAA 2LQ8A 4ELUA 2DISA 3OBYA 2CDQA 3FQLA 3CDEA 2KW4A 3RTVA 3BGRB 5E3CA 5AXNA 2IM3A 1JLQB 3CC7N 1TMJA 1U1OA 5IM0B 2C3UA 2XS2A 1KS2A 1WBDA 3HHLB 3PLAA 4RNMA 5C2DA 4LD0A 1S22A 2XHBA 1H74A 2U2FA 4ANCA 1NAQA 5MLCV 4PXDA 4EBEA 3OVSA 2BOAA 5FLXY 2GIFA 5LMNF 1MSWD 2LXFA 1RKIA 2UUBF 3ZSZA 4NLWA 2UUCK 4FJXA 1DQ8A 2OO4A 4K4XA 1PJ6A 2EPIA 4QW8A 3T19A 3KUEA 4PKHA 4CZGA 2ADBA 3LDNA 3QJPA 2O4IA 2Z2MA 5K8OA 2JWNA 1HKCA 4JKGB 2D41A 1NHUA 2PAVA 2XLIA 1JK9B 1E4GT 1TFYA 3LWLA 2FVCA 3UWTA 2HFVA 3LP1B 3M32B 3O44A 5B08A 1UPPA 3QZ8A 2VFVA 3Q86A 3KD1E 2CQ4A 1PAUB 2LKZA 1NGEA 3P49B 4ZVGA 3V1RA 3D45A 1S9GA 4F26A 3R27A 3WUHA 3GILA 3T9NA 1EB0A 4GVMA 3ET6A 4C8YA 2D3OR 2CVEA 1NBWA 3C19A 3PRDA 3W2VA 2OPSA 3NGIA 1IBLF 4GKJF 2ETJA 1Y3JA 2DB1A 5KI6A 2HBKA 3RW7A 4MFBA 3CDWA 1U02A 4J9NA 3PEJA 3C94A 2IVMA 3HHDA 1QQOA 1N56A 3GFYA 1RTDB 2RRBA 1ZC6A 4DR5J 1ZYQA 2X51A 3MI7X 3V6HA 2UU9K 2HK2A 2D1KA 1EZZB 5IT9U 1N5TA 3IWLA 3ZTPA 1NU0A 1HQ2A 2VGNA 4DF4A 2KRBA 1S1WB 4NE9C 1C1AA 4M3RA 3BDEA 2BQRA 4GNIA 1VQKN 4M95A 3THVA 3CCSS 1FXRA 1GXTA 1J5EF 2GBZA 4HUEA 4LR9A 4JNEA 1O51A 2GWKA 2OEKA 3DXMA 4LF8K 1LW0A 1KWMA 4NLRA 2J4RA 2ZDPA 3UDVA 4IO1A 5DDOC 4TY8B 1M1HA 5SUHA 4WTYA 1ZBTA 2OEJA 3ZLJA 3CCJN 3TOQA 3IN5A 1VIOA 4ER8A 1X4CA 1LW2B 5DETA 4FVUA 4FLXA 1SBRA 3M30B 1EP4A 3US5A 2AWZA 1NGHA 2KVIA 2FF6A 3NGDA 2DNGA 1U2VB 5CR4A 3W9IA 3HCXA 1GT8A 3IR5B 4X65K 1X5PA 4ZLJA 1W25A 1ZAWA 2HBYB 4OZLA 2V4QA 4FLWA 2EEYA 2N4CA 4IJAA 3CJ5A 4L74A 5BYQA 2CJBA 2MY8A 5LL6d 2V4JB 2RUGA 4W5NA 2UUBK 3BP8A 3MMAB 4BC2A 1C0TA 2V7ZA 4AHTA 4IDKB 1RHUB 4J5OA 2QV6A 4CK1A 3MFIA 2VB6A 2HHHF 4AHVA 1G99A 3W9HA 3RZAA 3KLVA 4IFVA 4BDPA 1R0AB 1JCGA 3VQ7A 4HTJA 2KLAA 2VWJA 4LFCK 3JS9A 2RJZA 3BF1A 4U6PA 4MKVA 3M8PB 4IFYB 2WBNA 4KRFA 2FD2A 4JV0A 3SCXA 4QCLA 3CJBA 2QW9A 4CD3A 4MT1A 2DNHA 2G0JA 4DTNA 4RUBA 4CLWA 3GYNA 1UFKA 3SAFA 2VUGA 2X1BA 2OELA 4HTUA 5F8JA 5HVHA 4WIQA 4J9KA 4NRUA 3PW0A 2D3UA 2QE5A 2CJYB 3SUNA 1LNQA 3AGRA 2NZCA 3DLLQ 5HOOA 1WHYA 4B08A 2HVZA 2HIYA 2OPRB 3MURP 1JL1A 1RK8A 5DQHA 2UUTA 1IBLJ 1RDDA 3OUYB 2IVOA 2W2PP 8RUCA 1XR7A 3MM8B 5AJ3K 3M8PA 1P9YA 3CO9A 2FJWA 4I2QA 4F2SA 3N4WA 3WBZA 2FZCB 3MEEA 4LF7J 2DVIA 3V4MA 4DV1K 3HBTA 1YRXA 3G6XA 2I7PA 3M2VB 3HZ6A 4I9QA 5D78A 1R3NA 2B0GA 4AFFA 3C6TB 3KNAA 2AEFA 2XHCA 5BN8A 4O55A 4DV2F 4FK4A 5KFRA 1S9GB 2WB1D 5B0DA 1KSPA 3QJLA 4BR0A 1T03B 4K7QA 4Z4HA 1R89A 4JKGA 4JI4K 5D4LA 3O4QA 3GYGA 2NCKL 2H3GX 4FLVA 1X4DA 1T3OA 3EZWA 1Z25A 2ALYB 4P75A 4WU3A 3PG9A 2W2QP 4J9MA 2KYZA 4AQYF 3E8OA 4AE5A 2K06A 1TV6B 4USMA 3MEGA 1V4SA 3NF9A 2DK2A 1KHWA 3A3PB 4DU3A 3A12A 3P5TL 1CULA 2IY5B 4X2BA 4A8MP 3LGHA 3RSEB 2FHJD 3AAQA 2AX0A 3H5XA 4OYPA 1KLMA 1RT7A 2QIFA 1VQ7N 4NWBA 2RS8A 5FPNA 1B9DA 2XZDB 5JS2A 2H3EB 1Q8KA 1KAYA 3T5HA 3AQOA 4F4WA 4OJRA 3OYCA 1Q7LB 1W9HA 3K57A 4E2FB 1RAJA 1UJ6A 2HVDA 5EXWA 4YHHK 4ZCLA 1HPZA 1LW0B 2ZWPA 4H5VA 2W9BB 2E7WA 2H4WB 4WTOB 5JMVA 1NKEA 1VCTA 1YF5L 1T05B 5AQJA 3MGJA 1C0UB 1WOQA 2F8TA 2Z2ZA 5E7OB 2Z1GA 2JL9A 4P9SA 2HVEA 4CLTA 4ZOSA 5IXUA 1B64A 2VYPA 4W4MA 3O9QA 3FEYB 4KH5A 1X7VA 5CH7B 1KVKA 3PACA 4NEYA 1CPZA 2FGOA 2Q31A 1MWQA 4PKIA 5HI7A 3NY0A 3ULHA 4CERA 4G6VB 3FFKB 5BREA 3BZKA 1I5OB 4CZLA 3VEOA 1M5OC 5BR9A 4BRCA 3L3UA 4LSZB 4JD2B 5HRSA 1FWKA 4CJSA 4FWSA 5CZ2A 1CJTA 3OJUA 4CJFA 4HUFA 2Q2RA 3M6UA 5GMDA 2C28A 4WXOA 3CC4N 4M3XA 5A8RA 4FWLA 3QETA 3UCZP 4BBYA 3W61A 4QWDA 4FJHA 3B54A 2NYHA 2D0PA 1S6PB 3N4PA 4BRPA 4K5SA 3CCES 4JI1K 4JI4F 3QPIA 3QO9B 4FJJA 3THWA 4ZCKA 3DAWA 5HBMB 3LP2A 4DOZA 4TQSA 3L4BC 4DR6K 1SAZA 1GLBG 1UWAA 3LP0B 4CH0S 5BRDA 5ADXH 3CJ7A 1GNKA 4JD2A 4WYBA 1EQMA 3IS9B 1U09A 2JLFA 4H5TA 3WDOA 4H54A 3I8BA 2DFHA 1WUAA 2MQLA 4GY2B 5L38A 1VISA 3BF4A 3ZSYA 3IG1A 2HHQA 4B3TJ 1CJTB 2DY1A 4OYIA 3NGYA 1TL5A 1WAFA 4ZPDA 4JI7J 2ZGZA 3J7YP 4GKKK 4S0MA 1PO6A 1UEUA 3ENBA 2X78A 3MX2A 2DHSA 9RUBA 4KFBA 3OLAA 3LO3A 4BR5A 4LFAF 1FJGJ 1NGJA 2VBZA 1UVIA 5M1FA 2A0FB 4IRKA 5DJBA 3CM6A 1PJ7A 4NASA 2OUGA 4AUKA 5JJBA 3WXKA 1YJVA 2ZD1B 3OYLA 3GV5B 3MDFA 1NGIA 4ZVHA 4OYOA 1KLMB 1RT7B 2E5JA 3AA9A 1YI2S 4UW2A 3CJKB 1YSJA 4JUZA 1FX2A 2LSNA 4U8YA 4K25A 2O8CB 4KGKA 1GLJO 2CNKB 4KPYA 1IG9A 5CHCB 4USHA 4OI3A 2E7XA 4DKWA 1VK8A 3MCOA 1C1BA 3FSIA 1WD6A 3HI9A 3HXMA 2KM8C 3IM9A 2MQ8A 2OIHA 2MY7A 4FWQA 2F7VA 3SIPB 1S5JA 2W42A 2E1ZA 4RW6A 4DFKA 4M8LA 2F96A 4FJ7A 2ASPA 1BY9A 3TI0A 1FJGK 1RWXB 4F3OA 4C3LA 1HBOB 1Y4ZB 3ZCMA 1GLDG 1GOAA 3DRRB 2MYFA 3T5JA 1WF0A 2FVPA 2M52A 3H5YA 1KBRA 2GAHC 3IAYA 4A61A 1DBDA 1JLCA 4Z37A 1EJ7L 1UA1A 3VAJA 1QUPA 4P73A 4OQJA 2G2ZA 3AO3A 3KK7A 2JGUA 1K8KB 4E7IA 4EP5A 3C6TA 2R7OA 2FJAB 5A8KA 3J81j 3AVLA 4ANDA 4CO0A 5ETSA 2ROGA 3AOCA 2NUUG 2M9KA 2DNPA 2HNYB 3HHKA 2Z0GA 3PIOL 4DL5A 3AODA 3RSEA 2DPNA 4YR3A 1HKGA 2DY4A 3FZKA 2GX8A 3HHEA 3CCEN 2DPIA 2A18A 1HYSA 4DR5K 2DNZA 3GYXB 4UY85 2FLNA 3MM5B 1J5EK 3M8WA 3LM2A 4K59A 4DUYJ 5EY4A 4P2FA 4PA1A 4NCBA 4LREA 4UQTA 4LR8A 2HVIA 2YNFA 1VBKA 3LM9A 5AZIA 2HBZB 4KREA 2XLKA 3AVIA 1X31C 3R3TA 4JYAJ 5JLHA 2W9AA 3WXMB 4KV8B 2JNJA 5CCMA 1T3VA 1PYTA 3W8PA 2XY8A 2VH7A 2B6AA 4GKJK 3NGSA 1FRJA 3AOAA 4WIIA 4DSJA 1HARA 1V9OA 5EU7A 4OHZA 2VICA 3MX5A 1B70B 4R0EA 3DDIA 4PWUA 2ASLA 1HNWF 2Q97A 1BA1A 4CO3A 3C2PA 1HD0A 5IT9Y 5AT1B 1L5UA 1UKUA 3OTOK 2WVCA 4Y34A 1SQFA 5JUMA 1NM2A 2EXUA 1I51B 1TUYA 1T8EA 4DHVA 1WI8A 2MZSA 1PG5B 4YUDA 3X3UA 3EICA 2I2YA 4WFAL 1ZBUA 4DV6F 4EP4A 1IBMJ 1REVA 1V3ZA 2NQPA 3NOGA 2MQMA 4DB3A 4K4VA 2J5AA 1ZAXA 1NZ8A 5ETVA 3C8YA 1N5YA 4NLPA 1KEKA 3MPUB 3WEEA 5HROB 3GJTB 4YY3K 3UD4P 2FBVA 5C25B 1RGIA 2OH2A 2YBVA 3K8WA 3P5JA 3J7ZT 3PR4A 1EP4B 1LAVA 1QVFR 1GLEG 3OL6A 2AYGA 3H25A 3HFVA 3NGUA 3CJ2A 5LMUJ 5AFUA 2GVDA 1IJEB 2DEJA 4NYPA 3LDSA 1Z26A 1SUQB 3CJ1A 2VG6A 5BR8J 3UKUA 4MTPA 2HQFA 1RAFB 2X6NA 1LW2A 1LK7A 4FF3A 1M0SA 3OUYA 3KK3B 4CJKA 1VFJA 4RZRA 4DV1F 3THPA 4IO9Q 2F4VF 1GMUA 1EXQA 3CCQN 3K5MA 5AE3A 1RDCA 4B3OB 4B8CA 4ED0A 1E6VA 2AEJA 1XQIA 1X60A 3MD3A 4GRSA 3VQQA 2K7KA 5CA5A 2HHUA 5KT3A 2G2YA 3CCRS 2V34A 2MSSA 1S6PA 1NSKL 3KK1B 2FBTA 4DQ8A 3KLFB 2QFJA 2DY9A 3TAPA 4O23A 4MKBA 4KFBB 3QZ7A 3DOLB 1MROA 1QAJA 1Q16B 3ZNUA 1FVQA 3D3CJ 3FBBA 3KHYA 5RUBA 2D0CA 1UJ4A 3K0JA 2N4DA 1FRMA 1PC4A 3NAEA 2Q1NA 4IDKA 1YZ6A 1VAZA 4HR2A 1ZS6A 4J9RA 3G9CA 3R97A 5DO2A 1IWGA 2YH1A 2FBYA 1T9TA 2OPRA 1DHMA 3M7VA 1ZETA 2ZJPQ 1YVNA 2ZBPA 3MCAB 2N7CA 1KFDA 2QLFB 2C2DA 1T3NA 3CXCM 4M3TA 1VC5A 2Q6CA 1BXNA 1T9YA 3A8JA 2WC9A 5HRNA 4A8WA 3O1BA 4OX9F 2W2OP 4WFBQ 2RU3A 1LAWA 4I64A 1X0PA 4F9OA 2ZE2B 2Z57B 4LFAJ 2F8SA 1BLUA 5B0AA 4CJ5A 2HGLA 3H46O 4DF8A 3THXA 5J2NB 3KHRA 1S9FA 3NGZA 2HGMA 1BWFO 4X62K 5K8PA 2GGPA 1ITGA 3I55N 2AZ3A 2CQBA 4I6AA 4JV5K 4JRPA 3M05A 2NRXA 3GIIA 4KHSA 4LY7A 4KB0A 4I2QB 3EXCX 1ZBHA 1GLLO 2F65A 2XYGB 3RUBL 5JMNA 1FK9A 1UVNA 1HMVB 2H51B 4TU9A 3O9UA 3W66A 1DEJA 1UVMA 3VGTA 3AY9A 5A2QO 3TU5A 2DNLA 1FTRA 5AQZA 3SAGA 3PXGa 4DV2K 4ECWA 1U7LA 3P4UB 3QEPA 3NLCA 3EM1A 2VQFF 2NRRA 1GXLA 4X4UA 5I3PA 2RD5C 5KFCA 4I6WA 2MZJA 4WJBA 3CD7A 3MR2A 4UUWA 2P9PB 1RT5B 3D54A 1VBYA 3BZCA 2DBBA 2K8GA 2OHDA 4KB1A 4WFZA 2E7VA 3FKBA 4V19X 4Y6IA 2ZH6A 2G0IA 4ZTFA 3FZBA 3C65A 1QZ5A 2Y9HA 3W63A 5A0YB 1B7YB 3PCOB 2XI2A 2D4WA 4E3SA 1URRA 1D5AA 3ALYA 4QS9A 1FDDA 1BO5O 4JV5J 3QRRA 1N54B 1UL3A 4RWWA 3OTDA 4CO1A 4K8ZA 3MMAA 2F9WA 4USUA 1BHNA 1XBWA 1NDKA 3VQTA 1D09B 1XMOK 1LXNA 2X1GA 3MMVA 4FJKA 4FWRA 3OXLA 4B1VA 1WTFA 3D9BA 1YITS 2YJEA 2CGJA 1S1WA 5EX5A 2D0OA 2MKKA 3VEYA 4JI0K 3CB4A 1RILA 4M5DA 2VQFK 4BGBA 4QWEA 4ERDA 4G3IA 2K2PA 1RXOB 4NLBA 2FUG9 2R2UA 3PFOA 2YPYA 3F5TA 4MJKA 3KWMA 2BRLA 2BR0A 1RTDA 4KTQA 4ZVQB 4CEFA 4NXNK 2FZGB 3WC0A 4Q0BB 3BPSP 3K2PA 4M3YA 1P6TA 1Z2ZA 4NCGA 2HK3A 1IR2A 5I4MA 3EGWB 2ZNYA 4FLTA 4OI0A 2E5LF 2DRDA 1WOSA 1FVSA 3IRXA 1A9NB 1QQCA 3GSDA 4CZJA 4X4OA 1A5VA 4KHPJ 1BUXA 3K0SA 4JKDA 3VF4A 3K2YA 4OX7A 5ETNA 1OH5A 4IRCA 2OEMA 4H4MA 4ID5A 2HS3A 2ZKUA 1GOCA 4O0JA 2E9TA 4BRIA 1IKYB 3OYAA 4PL8A 3MPWA 3SI6A 4NB4A 5DM6Q 4JI5J 4TY8A 1F3VA 1ICEB 5BR8F 2O5DA 2ZZNA 1BDGA 3GBTA 4JHDA 3CW2C 2BJ7A 1WF1A 3D6HB 4FPIA 1FKOB 3TUPA 1OY6A 3T6JA 1VQSA 2HHWA 5D0GA 3V6DA 4NLOA 2W9BA 3CCVN 3DN9A 2HHVA 5DDRC 4OYAA 2C1EB 3VV2B 1JJ4A 2WONB 4FXDA 3Q7CA 2MZTA 4FBTA 1Z6RA 2YHAA 3MECB 1NHVA 4OLPA 4RTFD 4QR0A 2RAQA 1WUUA 2LU2A 1ZPWX 3HF5A 3CNQP 2G8WA 1MROB 8AT1B 1NG9A 4F4ZA 1Y5NB 1Y11A 4CEDA 2YJFA 4I7FB 4LRFA 3B6PA 1C4CA 1ZM2A 4DMNA 1NJWA 3OYNA 5EWFA 2R8IA 4AF1A 2VFSA 4JV1A 4OI4A 1YBUA 1MN7A 3QGIA 1XMOJ 5K14A 4DFPA 1UEVA 5JICA 3FR0A 5D0EA 1GXUA 4HT7A 3M5RA 4EEYA 4M7YA 1B0PA 3L8BA 4CI6A 3MMBB 2X3GA 4WFXA 5AQVA 1AB8A 3M32A 3DXKA 4NLSA 3R2CJ 4PXCA 4OIXA 4D3GA 3Q22A 2CQDA 1N0UA 4X66J 4L73A 1Y7PA 1IKYA 4FYWB 4CNZA 2F8MA 1IBLK 3I33A 2M8HA 4B9LA 3CO0P 1HYSB 1I94K 2NPFA 2F4VK 4K0KF 1VLYA 1VQ4S 4JI3J 2GAGC 3HO1A 4U67L 4RL1A 2EHGA 3MCNA 3DLGB 3J7YU 2FZKB 3AVJA 4Z4EA 4MLHA 3KLEB 3MAAB 4HACB 3KUGA 4X64K 3CJCA 4KGMA 1N6QA 4NI2A 2OFGX 3G71S 4EK2A 2LVWA 4M5KA 1JLGB 4DS5A 3SFGA 2JX2A 3T6BA 4F4AA 2EVZA 2QZ8A 4HH0A 1TL3A 1V6HA 2O8BA 4WFNL 1RSCA 3SQOP 2UUCF 1T05A 2PFDA 3C14A 2E1CA 4V19J 5AQTA 1RT3A 3DLEB 4YB1P 3C16A 4FJ5A 2P9LA 2GC8A 4PYDA 2CKWA 3GV8B 1GLCG 2PC6A 3MMJA 4BC5A 3SQ1A 1VSJA 5CZXA 3EY1A 5B0BA 2RRAA 3BEGB 3V9XA 3UDCA 2WOMA 1M5PC 4JB8B 2HNZB 2RPIA 1VQPN 4QU6A 4MK7A 4ZKAA 1DARA 5KT2A 1JXEA 3ENQA 2CGLA 4AHRA 4EAHD 3H7HB 2HHPA 4I69A 3B82A 4JKAA 4MDAA 3KWGA 3BQ2A 2FQQB 4FWNA 2EG1A 2IYGA 5J2PB 3TRGA 1TV6A 4U96A 3J7ZO 3S1TA 2O01C 3VQEA 4LF6J 2PYJA 5GVQA 4YHHF 3GE1A 4CI0B 2FC0A 4ZITA 3B6BA 4OJGA 1BI4B 1FNXH 3V5RA 2B3TB 3JYTA 1J5OB 2QLWA 3CCLN 1L3UA 1ASVA 3QGHA 3NOCA 3AB2B 1YVFA 3MR3A 1K6YA 3O1WA 1Q86T 1H2UX 2SXLA 1T44A 3DFEA 3RJMB 2COLA 3ENAA 4NA1A 1NWKA 1IO2A 3ISZA 4AM6A 3VENA 3PJXA 5GAGP 4DSEA 4E1NA 3E51A 3C14B 3LAKA 3JQMA 2IDLA 3DRSB 2PA8D 5I3QA 1DFDA 3AD8C 3VQSA 3CHWA 2LYVA 2D0AA 2YHXA 2C3MA 1QY7A 5A8KB 4JI6K 2XMTA 4KH0B 5D6GA 2RMLA 2O8EA 2BJ8A 4USJC 1MU2A 3JSBA 4Y2AA 5CD4A 3CFOA 5HANA 1DLOB 1J53A 1CJUB 5HL7Q 3LGMA 4PG5A 3TA0A 3DRPB 3DDNA 4LSNB 1NDCA 2OCEA 3QMQA 4IUFA 5F3ZA 1S1TB 4A4JA 1NLKL 4X4RA 4C8LA 3K5PA 1R8HA 5KFNA 1SC6A 2BJ1A 3WXIA 2B4UA 4O5BA 1RQ0A 1YGYA 1Q8BA 4OYZA 1VQ4N 4OHWA 2AQ4A 1TKXB 2GJ2A 3ULEB 4PRFA 3RR7A 1HQUA 1N36F 2GV9A 4CM2A 4DL7A 1VJQA 1ZTTA 2ZDOA 5AQXA 5AJ3F 5AQWA 2IFXA 3LDPA 1RDWX 3H1QA 1IBMF 4ISGA 4FPRA 2ZJRL 1K47A 2MQOA 4W5RA 4JS4A 2ALZA 1U24A 2AJ0A 1RWUA 3AQPA 2ASMA 1BQMA 3ZX2A 4BRQA 1XNQK 1JLEB 1C4AA 2MHNA 1T9VA 1YK9A 2WZ1A 4CF1A 3ASMA 3DRXA 4NYFA 4FS2A 3AD9C 1S5ZA 1VHFA 1TP7A 3KG1A 5HLFB 1NM1A 5D3GA 1J2VA 3I4PA 4HI1A 5KPRA 2JOQA 4F25A 1ACMB 1VR6A 2PI5A 3CSKA 3NWGA 2GMLA 5D8HB 2MHEA 3ONQA 4DUZJ 4LRBA 5KTQA 1JMTA 2HWHA 1M90T 5D3GB 3D6MB 4R5PA 1JKHA 4FZVA 4JYAF 1BUPA 3VGKA 4O0NA 4FJNA 3M2UB 2I8EA 3ZNJ1 3DNCA 5LL6Z 2EWSA 2IRYA 2YQ0A 3I82A 2V0NA 3TQ1A 4RJVA 1X4GA 2QYGA 4Y1DA 4JBCA 2V8PA 1VRQC 2AW0A 3EE9A 5BPNA 4FP9A 3W8GA 1SJRA 2QL5B 2QWRA 3M2VA 4Q2LA 1OWXA 2Q66A 3FC9A 2PIIA 2B4PA 3RB6A 4ECRA 1WSRA 4YOEA 4IG0B 1D4XA 4FLYA 4ANEA 3L0QA 1O6XA 3H2UB 4OKJA 4OZ0A 3VERA 2WB4A 3CPWM 3PX6A 2ZWHA 3MM8A 3F56A 5HVFA 4K4ZA 4OLOA 1WOOA 5F41A 1RDBA 1E6YA 2C3PA 3IFRA 1GMWA 3OFGA 3VGLA 1C1CB 2XRIA 4YS2A 3EKUA 3NHGA 3DHXA 1RLCL 4DV5F 2BZ2A 2QL7B 1X3MA 5JS1A 4ZIVA 2J76E 5MAOA 1IM6A 4B1XB 1MU2B 3DGPB 4IQMA 1HNIB 4KE5A 2MGZB 2LA4A 1XMOF 3C15B 4TU8A 1RYRA 1IV0A 2QK9A 4H4KA 3WNGA 3M9OB 5H1SV 1RBRA 5HP1A 4I6YA 5DM7Q 1TL1A 3DOLA 4DX6A 2HGNA 2PGCA 2ZH8A 1QLNA 4F3TA 2HF3A 2R8HA 2KJVA 4LF4J 3VMFB 3LUYA 4HLBA 4CHPA 3ZSWA 4LT6A 5M1OA 5JVGQ 3DLEA 1UZDA 4Y00A 4C97A 3R3LA 4Q45A 3V9UA 3TVYA 2I7NA 1BQNB 3OL8A 3TQEA 3AH6A 5KG0A 4RNOA 2APOA 1UFWA 3ENWA 2AJQA 3FZLA 4KAZA 2YNFB 1X9JA 2XHWA 4CEAA 1N8RT 1VQ9N 4CJ3A 2P9SB 1UTAA 1JIHA 4C48A 2M4MA 1FDBA 3OBWA 4DTOA 4H4MB 3IFEA 5DK5A 4FLUA 4FCYA 2QA1A 3P8BB 4U7BA 3FGVA 4ZN3A 2AEMA 4YQWA 4NL5A 2F4VJ 3BGFA 2ZBIA 1FKOA 2AKWB 2GCFA 3M9NB 2ZH2A 2DIUA 3NS7B 4NCGB 3LPEA 3JSMB 1WF2A 3N5FA 3HSCA 1N5SA 4BRMA 5EX3A 3ZEUB 1DQ9A 3KK1A 4ED8A 1U1RA 3PV8A 3IP0A 4P74A 2E8AA 3G82B 3SSSA 5FPDA 1A5XA 3CEDA 1OSCA 4MQ3A 3HULA 4KTZA 1LQ9A 1VQ7S 1ULRA 3PRVA 2ZH9A 2JVRA 1SKUB 3QGPA 3LP0A 4JOUA 4ZHRA 4HHJA 2IMOA 3D0IE 2X1AA 4Q2MA 4OX9K 2A10A 4PQAA 1KN6A 2ZWOA 3POTA 4AL6A 1V4TA 2NSCA 1YHQN 3TW0A 3VEXA 4DTSA 2O1PA 4NXNJ 2CJXB 2E5IA 3CJTA 5A2QY 4LF5K 2E2QA 3UD5A 2KH9A 3NNCA 3MAQA 4DJBA 4RBVA 4JI2K 3MPVA 2JVOA 3KD5E 1ZM3A 3SLCA 3TABA 1QSSA 1QQMA 4FZYA 4IG3B 5FD1A 4Y1CA 5IFMA 2NLXA 2HFNA 2OPSB 1K0TA 4K8XA 4G1QA 2B43A 8ATCB 1NGGA 2W7OA 2ZQBA 3N0VA 3QEXA 3J7YI 1GOBA 3CMQA 2RQKA 1DTTA 2FJDB 2XY7A 1S12A 4CT9A 1VK3A 3W1YC 4YOTA 3HHLC 4ZDNA 1U6ZA 1YKWA 1CZAN 1Y9OA 5GAHI 5KG3A 3QYYA 4DI6A 3NDKA 5JVHL 3O9SA 3BH6B 4FWMA 1S0MA 2V5HG 3MWPA 2CZ4A 2F9JA 1CXQA 1VI7A 4XDCA 2CQ1A 1EKRA 3PTWA 1OO0B 4IBNA 3NF6A 4LSNA 2D1CA 3ENOA 1FXDA 1SS6A 1KTQA 1BHLA 3WIUA 4DX5A 3VGVA 2DNYA 3CD6N 1AROP 4FM2A 2VJUA 4B9NA 4K50A 4IG3A 2YI1A 1XMQF 4HCBA 4CGDA 3FGUA 4TYBA 4B1WB 3FEXB 4BDZA 1NJXA 4DU4A 1TZ0A 2H4YB 3KDOA 3I5AA 1NK4A 1QAYA 1SJ4P 3NE6A 3LZJA 3O6WA 2LQ9A 4DR7F 1YITN 3ET6B 2EW9A 3ZETB 4Q8FA 1VQMN 1TKTB 1HX1A 1U0HB 1CULB 5D0HA 5M2UA 2RVJA 3NF8A 3ID6A 3FVYA 4PG4A 3M1VB 4NI2B 1F60B 3DLHA 1SIZA 4CHZA 2QEXN 4KR0B 4M41A 3T69A 2OI2A 4KBOA 4DCHA 4BWMA 1S0OA 4FW1A 1VQLN 3I56N 5LSOA 2VPYB 1I94F 4J9OA 3MN9A 3KFWX 3O6QA 4DFMA 4DZ6A 3U1LA 1NO8A 3JAMO 3QFUA 4LQ9A 1KHVA 3AAWB 4KKOA 4CJRA 2OGUA 3BUZB 3RAMA 4HDHA 2XC9A 1ATNA 5BXIA 2UVRA 3CERA 2DR5A 5HAOA 3PW2A 4HTLA 3PJ9A 2ATQA 5ADZA 2HSEB 2DGQA 4EYIB 4QS8A 2CVIA 2GELA 1FO1A 3H1VX 1IKWB 1ATSA 4WZQA 4BDYA 4W5OA 2GQ2A 4IOXA 1WEZA 3MD1A 3J8AA 1AT1B 2MEWA 2KT2A 3M3ZA 1WJ9A 4KGZB 4AYBD 4ED6A 3MUTP 2YNIA 3HHLA 4PXBA 2VC0A 1RYSA 4JAXA 3QIOA 2M7SA 2QWMA 2AYMA 1EETA 3B4DA 3ITHA 4CLSA 2W4DA 4NLUA 4YHHJ 2R7SA 1C0UA 2ACYA 1H3DA 2UXBF 1DJ0A 3Q8PB 1QDUB 3TA1A 5F9NA 1S1XA 1XN9A 3LANA 4DTXA 3EPGA 4QZVB 1TK8A 1FW6A 2DH8A 3ZZYA 1N88A 5KFKA 3I5BA 1R27B 3CCMS 2CJ9A 4CBXA 4WKRA 4ZTJA 4C23A 4L72B 2W40A 4UOFA 1S1XB 2UUAJ 1G3OA 1D1UA 5HMXA 4PAAA 4M5HA 2O3DA 4QIWD 1RP5A 1TKZB 2P6SA 5F0XA 2GFFA 1QTNB 4PEOA 4WQ5C 3EPIA 5DLGA 4IOBA 5LOQA 1TUWA 1U2CA 4CT8A 2YX7A 2E2OA 4LFAK 3VAKA 3A5OC 4ZP6A 1RTHB 3KMSA 3TWHA 3VQPA 4CO4A 4DR5F 2BW2A 5IQQA 4DPUA 4OGCA 2VG7B 4JI2J 3BYRA 1FE4A 4WQ5A 3QLHB 1BGXT 2R4FA 1NJZA 4GO7X 4TNOA 3IWXA 2MQNA 1A0OB 1EIYB 3AJ2A 5DZ6A 3DM2B 2Z58B 3MWBA 1H73A 3H42A 4RBUA 2JH3A 2Q6BA 4KHMA 2E2NA 3MTKA 3FLCO 2ZH7A 2VQEF 2HFOA 2HS0A 3NCQA 4B3TF 1F2HA 4WCEQ 1WOPA 4EFAC 2D3O1 2PZSA 4OV1A 3IA0A 3LP1A 2HSTA 4TQRA 5LT5A 4FJMA 4BQZA 2WVEA 3CPEA 3CQXA 4DHYA 1FDNA 3TJAA 4B3TK 3K5LA 5J2QB 1ITPA 2JZ5A 4CF8A 2KG1A 1VQ9S 4JLHA 4Y2CA 1N32F 1XNRF 1N5QA 4JI7F 1RTHA 3K59A 1S6UA 1DGKN 4RR5A 3MM9B 2R2TA 6AT1B 2QLJB 4LSLB 4KB7A 1RTJA 1NJYA 3MXMA 4A57A 3H08A 2GEMA 1N4LA 3NH1A 3DLKB 2FB0A 1GX5A 2P9KA 1AFIA 1R43A 4WWSA 3O3HA 4Y28C 3FQKA 3UD3P 1ZXOA 4HKQA 2XCPA 1KTVA 4IR9A 1VSIA 5GADP 4Z4FA 1VLOA 1XQSC 1FA0A 1OYEA 4A5BA 3H4DA 4KH6A 3KXDA 4ES1A 1IVZA 2VHGA 3OTOJ 3OT9A 4PG8A 3BGRA 2ZBCA 3KHLA 5AQQA 4CYUA 3HJVA 4DR4F 4CGHA 1EWQA 1JXVA 4OYXA 4CO5A 1AXQA 2FSJA 2HB5A 4USVA 3UE5A 4OKKA 3NCPA 3OHRA 4FF1A 2DNNA 1B92A 2HLTA 4CNYA 1TK0A 1KAZA 4OYBA 2Z8QA 2Q79A 3OQ2A 2XWXA 4K8RA 3UDEA 1WHXA 4PKDB 4M3WA 2X1FA 3I96A 2CH5A 4FOEA 4R5PB 4B9TA 3VQAA 1K44A 2M70A 2A5XA 2KHCA 4KQZA 1TKXA 1EETB 4NOHA 2FJVA 3TUZC 3KKRA 2IJRA 2EFVA 3KJFB 3JSRA 1UZHA 4CJPA 3V9SA 4J2DA 1YWXA 4GVBA 4ECYA 2YQ1A 3P4IA 1CQNA 3TZYA 1FRXA 3SUPA 2HVHA 1ZM9A 2EFQA 2ZOGA 1Y64A 1RWKB 2F5GA 4K2JA 4CECA 2Y0SD 2VWKA 3L7UA 4BCAA 2XLJA 3N5BA 1Q82O 2O8DA 4YP3A 3GV7B 3KNGA 1Y5IB 2FVSA 3DRYA 3T3FA 1LXJA 2X7IA 1WELA 2L9DA 2KHOA 5H9FK 3CIPA 1HQEA 1RTIB 1RCHA 4LH4A 4RNNA 4P52A 1UVJA 5FLXO 2ADCA 4CZFA 2RDJA 1Q8LA 4CLLA 1OQ6A 2HKEA 3VVTA 5D4PA 2E5LJ 1TYQA 1RHKB 3CCZA 4I56A 3UKUB 3O2IA 1XJWB 4CGFA 1KDNA 4KY3A 2W2NP 2M0GB 5J2MB 5A2QU 5C2CA 4DR7K 2P5VA 3ZTRA 3U1MA 2WVBA 4R8UB 4ZVPB 1ESVA 3VAMA 2P51A 3ATVA 4IFEA 2IM0A 4BR2A 3VF6A 2F1FA 1XMQK 4NLXA 3TAMA 1F6TA 2O8FA 4DQPA 2ILYA 1CZBA 2U1AA 3QERA 3TZXA 3V9WA 1LWCA 2GW8A 3SCLE 4ZJLA 1P8GA 3C6AA 2OKQA 1Y00A 3ZXWA 3E66A 3MDQA 4FPAA 1U1MA 1HNVB 3GJSB 2ASYA 3O5TB 5C10A 5FRNA 2CPEA 1LWEB 3EGNA 4DR1F 3SCIE 5HMYA 2WVFA 1KR4A 4WZMA 3EJMA 3KZBA 4DG1B 3CXCR 4BC3A 4PQUA 1TR0A 3D4JA 2WOMB 2ATLA 4LF5J 2A1BA 1VYAA 5FJ4A 4FKYA 4CEZA 1YDLA 3OPKA 1T02A 2C2EA 1Q95G 2IIHA 1RBVA 4BGAA 5EUHA 2CPXA 2AF6A 3HDSA 1IBKF 4JI2F 2HHHK 2O8EB 4K4UA 4LF5F 2P9KB 1NKBA 2HLUA 2QWPA 5BYRA 4OZ1A 4F04B 3C7NB 1G7CB 3TX8A 5HBMA 3NS6A 2I6WA 1WNEA 2W9CA 2RF2B 4L8RB 1ZBLA 1TTHB 2V2KA 3AVCA 1VHXA 2QWLA 1V3RA 3ULEA 3GMGA 1XHZA 3SV3A 2BXJA 4IJNA 4DV6K 1YJTA 4MAKA 4NRTA 3PEHA 2CH6A 3HI0A 3T1HF 1HYVA 4DR4J 2BW7A 3ZYYX 4CF9A 4DV0J 4IOAL 1BU6O 1NXIA 1CEZA 1C0MA 3PUFA 1QUVA 3MM6B 3WEEB 3CJ4A 1HNWK 5J1NA 3EVMA 3H0PA 4JI5K 4ID8A 2RKIA 2AMCB 3WX8A 1NGFA 2IVNA 5KFSA 1K73O 3OR1A 3A5NC 1IKXB 1Y97A 3LPYA 2PE8A 1VS3A 1C2PA 2VA2A 2ZJQL 1RU2A 1SL1A 2E29A 2FVQA 3A1YG 4HCCA 1IJJA 3CF5L 2QM1A 1N32J 4CK2A 1BMQB 3SMSA 5KFAA 1FTCA 4M63A 2VIHA 3CETA 1MN9A 1DURA 1WSGA 1HL6A 4WK3A 1NK9A 1XTZA 5KT7A 3Q8YA 3MXJA 3U02A 4DPYA 3UNGC 3ISNC 1OJ4A 5EGYA 1YTYA 2GHPA 2AGOA 1P1LA 3TTDA 1HNZK 3IM8A 4DQQA 2ZKTA 1OVYA 3CD0A 2YHYA 4QQBA 3VQDA 5CYJA 3CQYA 2IVYA 1H7WA 4PG7A 3QFPA 2V7YA 4PWDA 2KZZA 2CQGA 2KQ2A 1SC1B 4DLGA 4USKA 2MJUA 3MCSA 2RUSA 4H0YB 2EX3A 3TUIC 2E66A 3VQ8A 4DV3F 1IBKJ 3I6PA 4CLUA 1VQOS 3FZHA 3EDRB 2BBEA 4C0OC 1NGAA 4AILC 3RR8A 3EE8A 4ILLA 1IUJA 3ZX0A 2G13A 4GMKA 5KFBA 4MIBA 4P2SA 5T7LB 3VEZA 2I9SA 2IOCA 2V8HA 4M42A 2KFYA 2F7TA 3LZIA 2BJDA 3TZZA 5AZJB 5K8NA 5C12A 1WN7A 4FF4A 5KFGA 1QVGR 4CZEA 2OTLS 4ZLPA 5KT5A 3E01A 4CFCA 4BRHA 1VOMA 2LFVA 3DRRA 1YHQS 3BN7A 4GVBB 3VA3A 2DIVA 4LMZA 3BH7B 4LF6K 3O9TA 2VU5A 4A8QA 2F8HA 5HLFA 5LJ3Y 2A42A 4ED4A 1VSDA 4LF8F 3CPWR 4DV4J 1HKBA 4WQ4C 4YB5A 3B8AX 3GCXP 4HL9A 2RF2A 4B3MJ 1U1LA 3KG0A 3F44A 1XEZA 2GVZB 3L6QA 1T95A 1RT5A 2KKHA 2KI2A 3DXMB 2KVQE 2F8EX 3PIOQ 5U47A 1NDPA 2UU9F 2YV0X 1MWMA 1X4HA 3BKUA 5KG7A 2LQ5A 4CBUA 2NZ4A 3T1YJ 3DHWC 5HO4A 4IKAA 1CVJA 3D7SB 5KFIA 1RAAB 2ERRA 2HRYA 3NGTA 1WHWA 5M1NA 3GJRB 2KHDA 1U26A 3MR6A 4H5NA 5IS2A 1BG3A 3CD6S 1W2BR 1NOZA 4YN3B 2IBOA 2E1YA 2B5JA 2JWLA 1YX2A 3TR5A 3QAUA 1WKLA 2AV5A 2C2ZB 4DBQA 2F9TA 2BABA 3ITHB 4KRWA 2YWEA 5F9LA 3SBGA 3PHEA 3ZZOA 4ZPCA 1XC9A 1IQTA 4EI2A 4B17A 2W9CB 3HKWA 1DTQB 4LF7K 3PRBA 3ZT0A 2E6LA 3R9LA 4GV3A 2BM1A 2ITMA 4PXEA 4DEZA 3KLIA 4NYOA 3WQPA 3GTYX 4JI1F 3P39A 3D0PA 1FD8A 3ILJA 1U2RA 3H40A 2GJIA 1Q79A 5KFYA 2ACMA 4I67A 1FJEB 4OI1A 4ZCMA 2XG8A 1JXLA 3SDEB 1QQNA 4DPOA 3CCTA 3JSMA 2HG4A 4UOCA 4EO8A 2GJFA 4DR2K 3ZZZA 1S6OA 1DLOA 2ZNZA 3OSPA 4C4WA 3V81A 5AQLA 1IKVB 5IQ6A 1ZTWA 4TVAB 3THWB 3G4SS 4DQIA 4CJWA 1AZSA 2B8PA 2VQFJ 1LV5A 1YJUA 2NSBA 5G0RB 2ZH3A 4WBFA 4BWJA 1WSIA 1X9WA 3J80U 3Q7BA 3OHBA 4JKCA 3WIVA 3SCKE 2CNLB 2RQ4A 3QSIA 3IMXA 1HQUB 2MB0B 4FJ9A 3MEDB 4N47A 2ASOA 5L1IA 3M1FA 1HWJA 5ETOA 3W65A 3UN5A 3LL3A 4F8RA 4DL0C 2ZC3A 3TAFA 4KI4A 2FY1A 1RWVB 1QSLA 3EUNA 3OSNA 4OZ3A 1HI0P 4YY3J 1QTMA 3QT7A 4B3RJ 2AP1A 1U04A 4M63C 3PKMA 1TL7B 1Q9YA 3CCJS 4YMEA 4A59A 4NYZA 5M1PA 4DTPA 2DO4A 4CGJA 4QPTA 5FLXU 4NZ7A 2FBXA 1EKSA 2YKNA 4MMOA 5H9EK 4UY8O 3ZSVA 2QA4G 4ILJA 2B51A 2XSJA 1Q86O 3C15A 3MECA 2L41A 4MKYA 2HHSA 5AXMA 2FJEB 2LDIA 3O9RA 2HYIB 1KVIA 1YIJN 3V2UC 2RQCA 1CBKA 1K8KA 1HD1A 4HT5A 5A8WA 2JC1A 4LFBK 4FVCA 1FEEA 3ADAC 4XK8C 4TYAA 4GKJJ 3CQ8A 1KFSA 1H2VZ 1N8RO 2BMBA 2HNDB 4CW7B 3MF5A 5H1SQ 4J9UE 2J8SA 5BYSA 4V19S 1E6VB 3EX7B 1EAYC 1XMBA 4CLZA 1GLAG 4JI3K 3AXKA 3M1VA 3B78A 3D0GE 1YUWA 3CC2S 1R59O 2RB7A 2IIRA 3QO9A 3HJFA 3SZ2A 4WF9L 1RJJA 4K4WA 3R6MA 3KK3A 2DR9A 2R7XA 4CLYA 2GMJA 2DR7A 2Q36A 4CHYA 1N33K 4MKAA 1PAEX 1U0HA 5FROA 3OS1A 5B8HA 3K5NA 2P9UB 4YOVA 1WB9A 1S72N 4YR2A 2IA6A 4RPFA 5IV4A 4M5GA 4RNHA 5E5NA 2YWWA 2ZVSA 4WFBL 4BRAA 2HMIB 4AL7A 2QLXA 5BRHA 3OD2A 4URSA 3LALA 3D5MA 1Q18A 5AQUA 3HZEA 3OVNA 4KHWA 3TTCA 1APSA 2HMIA 2J7UA 1SQGA 5KG5A 1ZH5A 3RVCA 2F9DA 4ILHA 5C2FA 1FERA 2FGCA 2Z2YB 2O8BB 4FSVA 5A0YA 3CDAA 3M8RA 2DGWA 3O4WA 4ECSA 3MUVP 4ILGB 3G4SN 4U9RA 5J2PA 1FK9B 4LBHA 2IGIA 2MLYA 3JQJA 2V6AA 2OPPB 4YORA 2C3OA 1ROFA 2W1BA 4DV5J 3BSAA 5HQMA 2Q3PA 3MM9A 3L2VA 3HP6A 1PYOB 5HVGA 1K8AT 4LQ3A 4BVOA 3H45C 2W8KA 5HP1B 2WW8A 4M45A 1NOYA 3WHIA 1WC4A 3SQ2A 2DJWA 2F40A 2AJFE 4KO0B 3W0LA 4RWXA 2ZE2A 2J7WA 1ZZNA 4LC9B 4F3MA 2FHMA 1JL2A 2FXUA 4ECVA 2WTUA 4EU0A 1CJKA 1HFEL 1T7PA 3SXLA 5E0OA 2W8LA 3R5CA 1HQEB 3EXYA 2GNKA 4YOXA 2BYCA 2IC3A 1WSEA 3BQ0A 4ZHRB 2HAFA 5HMWA 4OVLA 3NKYA 4LUBA 2CQHA 3J7AP 1FXXA 3P3DA 3UDLA 4UY8T 4QWAA 1Z1ZA 4CRJA 2EBEA 5AQYA 5JLFA 5DG9A 1WC1A 1KKHA 2I38A 4RNFA 2QSWA 2KFZA 3S6EA 3UO0A 1HLUA 4UZCA 4Y3CA 5THWA 4PZVA 1YIJS 2GV1A 3I55S 4CGIA 1UAXA 1C1CA 3VQBA 2GO9A 3W62A 2FJBB 1HBUB 3OFHA 3EMTA 4F36A 3KVGA 2PY5A 4QW9A 1KVBA 4B8AB 3CFRA 4DV4K 4PUOA 1C1BB 3BGOP 3AO2A 2J9DA 3JS6A 4DR3F 3R1XA 1FI4A 4DL4A 4C8ZA 1FF2A 3T5LA 2MXYA 4OX6A 4ID1A 4CDIA 4DU1A 5LMUK 2DGTA 3JXUA 5GAGU 4CZKA 5L8RC 2EFOA 4YDUA 4YOUA 4OJ1A 3J81Y 3MZIA 4CIFA 1ZZFA 2QWOA 4D3HA 5HN0A 4CYUB 3Q0AA 3NL0A 2R7QA 2ROPA 1JLEA 1TKTA 3ETOA 1XUPO 4M5JA 2GHVC 3VVUA 1Q0NA 1F0XA 2QX0A 2WBMA 3HHLD 5LM7E 3HKZD 3ENHA 2HMPA 2RILA 1JLQA 2JEFA 5ADXA 1RCOB 3HM9A 3DLRA 1M5HA 4RU2A 4A8SA 4OKEA 9ATCB 3MXIA 5C42A 1N34K 1C0TB 1EQYA 1YBAA 3HD2A 4LBIA 2DNRA 3Q83A 4MYTA 3HMJG 3T1YF 1RZMA 3RBDA 3JQKA 5G4DA 1CSJA 3K9KA 1LOTB 2WCXA 1RTIA 1NJIT 1OH7A 3SV4A 3ZSOA 5GMEA 4JS5A 4DTMA 3IBWA 4KYZA 3PDNA 1NUEA 3UR0A 1TL3B 3AGKA 3DDKA 5M2RA 3GCWP 4JHDB 3ZT4A 3D2WA 3V4IB 1WHVA 4X62J 4ECZA 2UP1A 2C2OB 4OMFG 7FDRA 2IDEA 2YTCA 1RHQB 4ECUA 2XI3A 2OSRA 4U67Q 2W7AA 2CQ2A 5DM7L 1N6QB 2H5IB 5EWEA 1Y0HA 4X62F 3OR2A 4QIVA 4KI6A 4C11B 4BHQA 2EWHA 2E6MA 4J2BA 1ATRA 3KJQB 1BD6A 1X5OA 3CGIA 2R2RA 1VQKS 1I3AA 2XQCA 5BRFA 2G8HA 1NK6A 2HURA 4DV2J 2BA9A 3OTEA 5I42A 4Q7AA 2H1YA 4GW6A 1YXQA 1B99A 3VQ6A 4QYRA 2DHAA 3GPAA 1S1TA 5ETPA 1IBKK 5CABA 4DTJA 3IR7B 4JV2A 3HSZA 3PO5A 1YJ7A 4USWA 1HHQA 4DR6F 5AQKA 5DZ7A 3DU5A 3PNIA 3N9UC 2BV3A 4P72A 3G10A 5J2NA 2E5HA 2P6TA 3KK2B 5LMNJ 3R5AA 3THXB 5KFZA 1LWFB 3LGNA 2IAJB 4IH5A 2LU1A 4LF4F 3GJQB 4RG8A 4YEAA 3SFUA 2DGUA 1MWKA 4CLPA 2CDRB 1U47A 1YI2N 1WWHA 4FYDA 4ZJOA 3QBXA 1Y10A 4Q43A 4DWIA 1RGVA 5KPTA 2NS1B 1WC6A 4P2MA 5F8HA 2VOPA 1RUSA 1I39A 4OI2A 4XPEA 3X1LB 4B1UB 3QJJA 3L4IA 2RRNA 2PI4A 5D4OA 2XGQA 2YNIB 5AFUH 4DPXA 3EVOA 5C5JA 2ZJPL 1VSHA 3NS5A 2BRKA 1GTHA 2GUIA 1MWZA 3VQ9A 4OYWA 3HPOA 2G8VA 3L2RA 1YRTA 1P90A 5HK4A 5LJWA 2G9OA 4L3NA 2RU9A 3VHQA 4EWTA 2UXDF 5KG2A 3AAPA 5A6WA 3VCDA 2AD9A 4LH5A 5J2QA 4B1ZA 3U1NA 2LQJA 3D2EB 3HVTB 2YHWA 1JNRB 4OHVA 2P5OA 5JXSA 3N6LA 1K1QA 5AQSA 4N7TA 3BS9A 3CF5Q 2QEXS 1YJNS 1GH8A 1K8AO 1OQ3A 1QM9A 1UEKA 3U9DA 5ETRA 4I6MB 1TL4A 3IKMA 4OZ5A 1JLBA 5AQMA 3RYLA 5CYQB 2IM1A 3SCJE 1AUDA 3QLHA 2CADA 5J2MA 2XNQA 4IG0A 4YFUA 2LA6A 3M30A 1CJUA 3W7BA 3OV7A 4R79A 3T41A 3W5YA 5IM0A 1VBXA 1D0EA 3LA0A 3GIJA 4AQYK 1RTJB 3IWNC 1SJFA 5KFQA 5AQOA 2Y1LB 3NG8A 1NCLA 4ISFA 4J9PA 2JEGA 3VQ5A 3WXLA 2N82B 4UUXA 1MMNA 2L08A 4C3MA 1WEXA 4H0XB 3U9ZA 3J81U 3D0HE 5KT6A 1CJVA 3K89A 3BGLA 3ULDA 3KWIA 2EBGA 3U8XA 1VQ6S 2PD1A 4CEQA 4B3SF 2E5GA 2F4FA 1S6QB 2E9ZA 3PW5A 5ETLA 3T1YK 1TVRA 2POKA 4BG8A 4CZCA 2NUHA 2Y0BB 2M3DA 2XWYA 2UXDK 2XMVA 4A2AA 4LIRA 2ZJRQ 4DL2A 4DTUA 3RG6A 3TUJC 5LXRA 3AA5X 3AO4A 5KGWA 3HSDA 3HZGA 2KTQA 3MM6A 3KJNB 4O5FA 2P9NA 1I3OB 2WBRA 5D15A 2EI5A 1KXPA 4IYQA 4DQSA 1RFQA 1JQGA 3BSNA 1PIEA 1H6KX 2VG6B 4CLKA 1OIAA 3H3NO 4WFNQ 2BE2B 1CQMA 4RUAA 4CE9A 3IGVA 5E41A 3OYDA 3SMZA 1WKJA 3SK3A 1LOUA 2I5JA 1N0VC 1UWBB 1X9SA 3M2UA 2YCHA 3KHGA 4CCHA 4KH4A 3AJ1A 1U1KA 3PSFA 4XTTA 1VSMA 3AA4A 5IT4A 4ZVTB 3TYTA 4Y2KA 1HBUA 3GG0A 3ZT2A 4UTGA 2ATCB 1FFGB 2ZBQA 4G1IA 3BDPA 1ILYA 3I0SA 2JEIA 1GMWD 4I68A 4X84A 5KPZA 3L4QA 1F1BB 5T7LA 4Q8EA 3ZSQA 1OSDA 4P71A 4LF6F 1UA0A 2QI2A 1SKSA 1V5VA 5F3TA 3K17A 4E98A 2LEAA 3P83D 3I5CA 3ZETA 1N5YB 4JI4J 3KK2A 3OHAA 1NNDA 3BR9A 1NPRA 2OTJN 1X8DA 2Y1IA 2E1PA