3DLGA

Crystal structure of hiv-1 reverse transcriptase in complex with gw564511.
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
539
structure length
531
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 150
structure length 531
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dlgA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dlgA05
3MTKA 3SV4A 1G15A 4CF2A 3CFRA 1WSFA 2X74A 3ZT0A 3M8PB 4EYIB 4K8XA 3OHBA 4LH4A 1KVCA 4FLUA 2FBTA 3ZT3A 4AHRA 1W25A 3BGRB 4CFAA 3CWJA 3CJ0A 1HMVA 2CKWA 4CJKA 3IRXA 1U09A 5KT7A 1HQEB 1S6PA 3VQ6A 2D0CA 3KLIB 3SJJA 3U3GA 1ZTTA 4CJTA 1VSHA 2IM0A 3M8RA 2P1JA 1KVAA 4K4ZA 4DU1A 4KTQA 4ZVEA 4XIUA 4DG1B 2R7YA 3Q8RB 3V81B 3H98A 2WB4A 3DOLA 1T03B 3H4DA 5C42B 3OS0A 4IBNA 2KZZA 4F4WA 5KFAA 4B8AB 5KG6A 1RT3B 3H5SA 4TQSA 2EHGA 1WSIA 3T1AA 4WZMA 1VSJA 2G8VA 3JYTB 3TAFA 5DLFA 3QIOA 3ZT4A 2IM1A 4W5OA 2B6AA 4Y2AA 3CJ5A 3MECA 1ITGA 4CHZA 3PW0A 4DF4A 1VRUA 1HQUA 4CF9A 1Q9YA 4KSEB 1JLQB 4DQPA 2OPQB 1HRHA 2BE2A 2VA3A 3KLVA 5CYMB 5HROA 3V6KA 3MXJA 4GC6A 2QKKA 4NLQA 4KB7A 3G0ZA 1TKTA 1SV5A 3HKWA 4H4OA 3UDLA 4FW2A 4FLWA 3KHGA 4W5NA 4FM0A 3RMBA 1RT1B 1DTQA 1FK9B 1RT7A 3V6JA 1VSDA 3ISNC 3BREA 4O4RA 1D9FA 5J1EA 4CHQA 2BANA 1WLJA 2R2SA 4H8KA 4EBCA 1ZYQA 2J6TA 4NCGA 5I3UA 4FJ7A 1J53A 1JL2A 1RT5B 1FKOB 1RILA 3NGYA 2KQ2A 2PZSA 4KI6A 4ID5B 4K4WA 2WONB 2W9AA 2R2UA 2RDJA 1HYZA 4N47A 4ELVA 1N6QB 4CJWA 4IFYA 2C22A 3GV8B 3G86A 3NGIA 4CJ3A 2AX0A 1L3SA 4F4KA 4PUOB 1RNHA 3PW4A 4MK7A 4RNFA 4C8NA 3KD5E 3GIKA 1C1BA 4F2RA 3JSMA 2XY8A 4NLGA 1ZBUA 1JLEA 4O3RA 1WN7A 1S1VA 2B4JA 4J2EA 1RT6B 2HNYA 4RW8A 4DL6A 3PW7A 3MEEA 4CJQA 3AA3A 3AVJA 3THVA 1VSFA 3K5NA 3EYZA 4I2PA 3QIPA 1RTHA 2ETJA 2R2TA 4N56A 1X9WA 4ZVFA 3D28A 3DLEB 4K50A 3ZSYA 3RMCA 4O3PA 3K58A 1TL1A 4NYFA 3BQ0A 3KNAA 4ECTA 1EX4A 4DTOA 3V4IB 2V4QA 4CGJA 1VSLA 2ZD1A 4G3IA 3IRXB 3CYMA 5KT5A 4RNOA 3HSTB 3DI6A 3BSOA 3P83D 3WNEA 5KFXA 4IFVA 4FJ9A 4LD0A 1IKWA 5F8MA 5CZ2A 5KFSA 3QERA 5KFKA 4HYKA 4ECQA 1C1AA 5HLFA 2HWIA 4CJVA 4TY8A 2HWHA 1S49A 2Q3SA 3NBPA 2XCPA 3ITHA 3QLHB 4B08A 4E7JA 2WK4A 4ZPCA 1DLOA 3MR6A 4C8OA 4QAGA 2B6AB 2GIQA 3DLGA 3ZSOA 3OSNA 3OYNA 5JUMA 4FJMA 4AHCA 5KFRA 2PY5A 4M41A 4GC7A 1QE1B 1B9FA 3MXMA 1VRUB 3VQSA 3AVHA 3HVTA 4FLXA 4H4MA 5J2MA 5DK5A 5SWMA 1J54A 5SZTA 3AVNA 1NJWA 2W7PA 3T5LA 4ZTJA 2AJQA 1JXLA 4BACA 5HROB 5F9NA 1NK5A 1TKTB 2IM2A 2FLNA 2F8SA 3OS2A 3ULDA 2HVHA 1DTQB 4B3OA 2AU0A 3VQPA 4Z4GA 3TI0A 3RR8A 4KB1A 2PYLA 4DL2A 4YNQA 4LQ9A 2OZSA 3FFIB 3CO9A 5I42A 4TN2A 1VK0A 2HMIB 4NCAA 4O4GA 4CJ5A 1X9MA 4C8LA 3V1QA 1QS4A 4J9OA 4IFYB 1TP7A 5J2NA 5KFGA 3DRSB 3T3FA 2YNHA 4O3SA 4WFZA 1S1UB 3IGNA 3HPOA 4OPJA 3CM5A 1ZBFA 1LAWA 3CJ2A 4QWCA 4EO8A 4ZPAA 4JS4A 2HHQA 3GV7B 1ZETA 4FK0A 1JLEB 1S1VB 1C1CB 3LP0A 1Z26A 5KFMA 4CK3A 3OYEA 4RW8B 3VQBA 3SYZA 1KRPA 1TL3B 1HNIB 3LP1A 2FBYA 3HP6A 3CQ8A 1RTHB 4CECA 2DY4A 4Q5VA 4U7CA 2JC1A 4HUFA 2PYJA 2BRKA 3CDEA 2XI3A 1NKBA 2CJQA 4O55A 4ECWA 4M3UA 4TYAA 1X1PA 2ZD1B 3MF5A 4R8UB 4NLTA 1KLMB 2WRMA 4EZ9A 4EEYA 4PQUA 4UQGA 3TR8A 3H2LA 3RR7A 3NAHA 5DG8A 2R8HA 4IFVB 1CZ9A 4WFYA 4E19A 4OJRA 4Z4CA 3I0SA 4URSA 5F8HA 3EPGA 2OPPB 3NL0A 4DQQA 5DGAA 4KTZA 4ECYA 3V6DB 1RT4A 2ZQBA 2I5JB 3DLKA 1S9EA 4TY8B 4CJRA 1U45A 4XPEA 1W9HA 4RW9A 4CJLA 3C6TA 3OYIA 3QZ7A 4Y34A 3AVFA 1K1QA 4NRUA 3KLFA 4DTNA 1HARA 3BR9A 1RA6A 3AO2A 3SUOA 4DMNA 1NOYA 3MR2A 4CIEA 1CSJA 1BQMA 1RTJB 4KV8A 5KFBA 3I5CA 3V9UA 4DEZA 5D3GA 4BE0A 2HNZB 2KW4A 2R8IA 3PW5A 2UVVA 4NLUA 3SV3A 4I2QA 5KG0A 3HVTB 4OVLA 3IS9B 4H4MB 1ASWA 3NKYA 4EZ6A 3DM2A 2UVRA 3WNFA 2W9BA 4WE1B 1JIHA 2E6LA 1RAJA 4QOZB 1Q8IA 2W8LA 1YTUA 3LWLA 4O3OA 3QGIA 3QGGA 5FDLA 4ZP6A 1IKVA 1RCHA 1B92A 3BQ1A 2JLEA 3EZUA 5T14A 2YNIB 2RN2A 1GX5A 3HK2A 4J9LA 1WNSA 3QEIA 4CJPA 4RG8A 2G8UA 1WSGA 2YKNB 2FVSA 4W5RA 3OJSA 4YMEA 4RUCA 3V6HA 4CJEA 4XO0A 4ED6A 1TKZB 2F96A 4FW1A 4CFCA 3KLHA 4AHVA 1S6QB 4NLSA 3G6XA 2WOMB 3P1GA 5J2NB 2FVCA 2YNHB 3VQ9A 3TAPA 1J9AA 3TVKA 4EBEA 3FSIA 4JV0A 3PX0A 2IAJB 5L1LA 3BSAA 1LWCA 1EETA 4BWMA 1S1XA 3ZSRA 3GYNA 2B43A 3KHRA 3QINA 3PHEA 3NCIA 3UQSA 3LP0B 4CFBA 1BIZA 1RBVA 4PWDB 3KK1B 3CFPA 4LSNB 5KT6A 3KLGA 3V9WA 2WCXA 4N41A 1C0UB 4TY9A 5KFOA 1JXBA 3AVGA 3O3HA 3KTQA 4IQXA 3DOKA 1C2PA 2XCAA 2VG6A 1JLAA 3OLBA 1J5OB 1MMLA 4TLRA 4WZQA 3PZPA 1TK5A 2FC0A 2WHOA 3UIQA 4FJHA 3SQ2A 2X78A 2DPJA 4Q0BB 5JS1A 4FVMA 2OPRB 3KMQA 1UOCA 2JEFA 5KFPA 5HBMA 1VRTB 4J2DA 4DWIA 1S9GA 3CG7A 1GOAA 1RT4B 4G1QB 4JRQA 4F8RA 3DLKB 3AV9A 1RTIA 2VWKA 1S9EB 3KKRA 3VQAA 3NF7A 4FJGA 3L2VA 1JXEA 1LWFA 3RB0A 1NHUA 2Z1HA 4WXOA 1WNEA 4LH5A 1SL1A 2YKMB 4QW9A 3BSNA 4DTMA 3KLFB 1WAFA 4AH9A 4O0JA 4E7KA 1ZBHA 3CDUA 2B5JB 4J9MA 3OLAA 3O4NA 4QPXA 4CHPA 3H5YA 4KV8B 1XC9A 2UVWA 3AVCA 3HYFA 4NLDA 1I6JA 3RRHA 3VQQA 3MEGA 1ZBIA 4CJUA 3TARA 4YQWA 4ZP8A 4KI4A 3VQ7A 1RDDA 4QWEA 1U47A 4CF1A 2DFEA 1NKEA 1C0TA 1JLGB 4ZHRB 3CJ3A 3NF6A 3ZSQA 3QEVA 1IO2A 1HNVA 4ICLA 3SQ4A 5FDLB 4NYNA 5C25B 2RF2A 3HPHA 3N6MA 4I7FA 4ELTA 3LWMA 2R2RA 4KHSA 1HYSB 1QSYA 3V1RA 2HHVA 1WSEA 3NAEA 5KFDA 1JX4A 1RTDA 3ZCMA 5HRSA 1KSPA 1MU2A 1KHVA 1DTTA 4MKBA 2HHTA 4B9LA 4EP4A 3AVBA 3RB3A 4EP5A 4F2SA 2FJXA 4DQIA 1QSSA 1HJRA 1VSMA 2DTUA 4ED0A 3O3GA 4CCHA 3KLHB 3NH0A 2D0BA 3SUQA 3L3UA 4M42A 2ASLA 3LAKA 4EO6A 3HT3A 3I8DA 1NK4A 1XR7A 5KFEA 5KI6A 2R8JA 1S9FA 5J2QA 3OL9A 3QEXA 1UWBB 1W0HA 1R0AA 1LWEA 2GC8A 4TXSA 4C8MA 3I5BA 2V0NA 4J9KA 4ID1A 4U6PA 3O4QA 5KFCA 5KFTA 5DGBA 5L1JA 2W42A 4DU4A 4F4XA 4OLBA 3H4BA 1UA0A 2RDIA 1EP4A 3PX4A 4R5PB 5KG4A 4DSLA 4Y1CA 4FBUA 1NHVA 4J2BA 4E1MA 4ED1A 4RW6A 3AO5A 4N76A 3QNOA 4KBIA 4KHYA 1BL3A 3DOKB 4CHYA 4DFJA 2V4RA 2GBZA 3RMAA 4LY7A 3OS1A 4K4TA 4M3XA 5FRMA 3PY8A 1A5VA 2IC3A 3SQ0A 1HPZA 4IG0A 4HUGA 3NGDA 4Y3CA 4DQRA 4RNMA 1S97A 1YT3A 1JL1A 1IKXA 3L3VA 3IGVA 2GIRA 4RW4A 1IM4A 3DRRA 2J6UA 3KK2A 5DQIA 2IMWP 1SUQA 3QYYA 1HMVB 2IJNA 1TVRA 3TAMA 1QQCA 1RYRA 5FROA 4ZTFA 3L2WA 5DLGA 1S0MA 3MFHA 1K6YA 1S6PB 2UVUA 4ED3A 3OYFA 3OHAA 3B6PA 3EZ5A 2JEIA 4CE9A 4CEAA 4WFXA 3C94A 4FYDA 2FVQA 2FBVA 4FZXC 1FXXA 1BQNA 4PA1A 2LSNA 3DOLB 3K2PA 5C5JA 3KK3A 4OKKA 4CIGA 4CJ4A 3KKSA 3G6VA 3AO1A 3SPZA 2ILYA 3TAEA 2VWJA 1RT2A 5F8IA 3ZSXA 1HNVB 4ICLB 4J9QA 4HUEA 2OH2A 4DLEA 5EU7A 5F8GA 1GOBA 4I7FB 4CF8A 3PO4A 1TKDA 2C2DA 3MECB 2JEGA 4FJLA 3FDSA 5J2PA 1RTDB 3D45A 1HQUB 3ZSZA 3H08A 1LW0A 4MQ3A 3DMJA 2BE2B 2XY5A 1TGOA 4NLVA 3OYJA 2XY7A 3HL8A 5L9XA 2YNFA 1XI1A 4DSKA 2QXFA 1JLFA 1TAQA 1SV5B 2E4LA 4E3SA 1BISA 4H4OB 5HRRA 2KZMA 3C6UA 3DDKA 1RT7B 3H40A 3OL8A 2UUTA 5J1EB 5J2QB 3P5JA 2BANB 1JKHA 3GV5B 4ZP9A 1LWEB 4NCGB 5I3UB 4J9PA 2D0AA 1LW2A 4FBTA 2ITGA 4JV1A 1TK0A 3DYAA 3HJFA 4MFBA 3VN5A 4URQU 1N48A 4Y1DA 3D5MA 3FQKA 1S0OA 1BCOA 4CERA 4IH6A 4I9QA 5KFFA 3O3FA 2FLPA 4KHWA 4O0IA 3NGZA 2C28A 2UUWA 5EDWA 3AA2A 4ZMMA 5DG9A 4CHOA 4Q45A 5KFQA 2OYQA 2BQ3A 3TAGA 4CEZA 3M9MB 1C1BB 3JSMB 3E51A 5KFIA 3BSCA 2FVRA 1WSHA 1VSEA 2HNYB 3CM6A 4RU9A 1EXQA 3MEEB 3NH1A 2BGGA 4MK9A 3AA5X 4FLZA 4I2PB 3LALA 3QIPB 4IRDA 3TWHA 4HCBA 3MAQA 5HP1A 4CF0A 3NF8A 3RAXA 4BE1A 3QZ8A 2ASJA 1QAJA 4FJKA 4ECVA 1TL1B 1N56A 2IA6A 2R8GA 1UA1A 3LP2A 1TV6A 4IRKA 3I5AA 4IKAA 4IRCA 3TAMB 5CYQA 5CZ1A 2DFFA 1QHTA 4RW7A 4ECXA 5JXSA 4DL3A 1T7PA 3DI6B 1T05A 2IDOA 3WNGA 1NKCA 3RRGA 1CZBA 4J2AA 3KHHA 4Z4IA 2IBKA 1IKWB 5KT4A 4CEDA 1RDAA 3FRZA 2XI2A 4KHNA 3AA4A 3HP9A 3ZT2A 4R0EA 3GIMA 5HLFB 2EC0A 1KVBA 4GW6A 4FZZA 2HHWA 4K8ZA 3NBPB 2OPSA 3ITHB 4FK2A 4QW8A 1F21A 1RT2B 5E41A 3AO4A 1DLOB 2XGPA 1NNDA 2A1SA 3DLGB 2XWYA 1RBUA 3M8PA 5KG2A 3TABA 3U3YA 4IKFA 2YHAA 4OL8A 1UAXA 3A2FA 3BGRA 3RB6A 1Z25A 4BWJA 2G8WA 2HVIA 5J2MB 5DQHA 4OGCA 1HQEA 2VG7A 4M94A 3KLIA 3T19A 4ECSA 3K57A 3V9XA 4FJNA 2OZMA 3QO9A 3RBEA 4IH5A 4LSLA 1A5XA 4FJ8A 3QGHA 5KFJA 3V81A 3LDSA 3ICLA 4F3TA 4AHSA 2D3ZA 4B3OB 1T03A 4IH7A 4O3QA 3S3OA 5C42A 4MIAA 2ZKUA 5KFUA 4O3NA 1JKHB 3ZT1A 4DSJA 1RT3A 3M8QA 5KFWA 1YTAA 3LPUA 3ASMA 5I42B 3T5JA 1BIUA 1SKRA 1FKPA 4O4GB 4W5TA 3KLEA 1KCFA 3SFUA 2HW3A 1Y97A 1O1WA 3PV8A 1KFSA 1JLQA 5EWGA 1KFDA 2OPQA 3SI8A 4OGEA 1BHLA 5CYMA 3Q8SB 3N6NA 1LAVA 2D3UA 2P5OA 1TKXA 3VQ4A 3OYHA 3K5MA 2XRIA 3PR4A 1RT1A 5K14A 4OPKA 2ATLA 3TAQA 1YVFA 3GIJA 4CEFA 4FXDA 4DL5A 3S9HA 3BQ2A 3LP1B 3OYDA 1RBSA 2G8HA 4M45A 4Z4FA 4QWDA 3S3MA 1I39A 4BE2A 4CEQA 1RT5A 4F4YA 4ID5A 5HRPA 2QV6A 3LPTA 1T94A 2WONA 5DG7A 4URGA 3LANA 4ECUA 3AVAA 4K4VA 2W9CA 3LP2B 1TV6B 4KPYA 2ALZA 4CESA 5CYQB 2ASDA 2XC9A 1XWLA 3LZIA 4PQUB 4RW7B 3V9ZA 4M3ZA 2HB5A 1TK8A 3KD1E 4MK8A 4N5SA 1KTQA 2IS3A 2QK9A 5CY4A 4DU3A 3I0SB 3SZ2A 4L8RB 4FJXA 3F9KA 4B9NA 1SH0A 3CVKA 2E6MA 3KHLA 4J9NA 3OYAA 4NYZA 1RT6A 4ZPDA 4CEEA 3T5KA 4RW9B 1U48A 4ED8A 4ED2A 4M3TA 3C6TB 4I9LA 1L5UA 3HXMA 5KG7A 3KIOA 4J9SA 1REVA 2G8IA 4E7HA 2YNGA 3QETA 3EPIA 1BQMB 3DLEA 3DLHA 4NLWA 2IJFA 5KT2A 1BI4A 3SQ1A 5D3GB 1SH2A 1T3NA 4YR0A 3H59A 1IG9A 1SKSA 3V4IA 4I2QB 1GOCA 1U04A 2HHSA 4KAIA 3DM2B 2O4GA 1KLNA 4CEOA 2VG7B 3MR3A 1TQLA 4OKEA 1U49A 2W9BB 4JLHA 4YR3A 3QO9B 4DFMA 4H54A 3RBDA 4LSLB 2G8KA 2P51A 1QUVA 1S48A 3OL7A 1IKVB 3PJWA 4M3RA 4FLTA 4QWAA 4IDKA 2BRLA 1S5JA 4FM2A 2D41A 4HHTA 3QLHA 3IAYA 2Z1GA 3M8QB 2YHBA 2BR0A 4KHUA 4OLAA 4IR1A 4OKJA 2BDPA 1FKPB 3AVIA 4FJIA 4QCLA 4B8CA 3KLEB 5EWFA 2I1RA 4DSEA 2XGQA 3AVMA 4M3WA 3QESA 1QE1A 1D0EA 2EX3A 3MR5A 2C2EA 3OVNA 4CJSA 3UPFA 4CGHA 5KFYA 3OYGA 3HO1A 3MEDA 4DLGA 3NFAA 3OYLA 1LWCB 1EETB 1S1XB 5KG1A 4B9SA 3G10A 4RNNA 3CJ4A 3Q8PB 1TKXB 4KAZA 5K14B 2ATQA 2P5GA 3AVLA 4Q43A 1D8YA 2D5RA 5T7BA 3KLGB 5F8NA 4Y2CA 4ECRA 1I3AA 3FFIA 1S1WA 3ZSWA 2HMIA 2VG6B 1JLAB 3M8SA 2IM3A 4Z0UA 2W9CB 1RDCA 2ILZA 3NMAA 3SUPA 5DMRA 4ZVGA 5F8JA 3DRSA 4CK1A 3EY1A 1S1UA 5JS2A 4WYLA 3LP3A 3NH2A 5HBMB 3E01A 1XR5A 1S9GB 2G8FA 4KHRA 2F8TA 5DQGA 1RTIB 3RTVA 2Z1JA 5EWEA 2V9WA 2FLLA 1C1CA 4DTJA 1BGXT 3SNNA 1TL3A 1LWFB 1HNIA 2FVPA 4FZYA 4CGDA 3OYCA 1GX6A 3CIZA 4AILC 1REVB 4KB0A 4QWBA 1C6VA 3BDPA 4FCYA 1Z4UA 4NZ0A 2YNGB 2AGQA 4NLOA 3WNHA 3Q8QB 3FQLA 3N6LA 5KTQA 4DFKA 1BI4B 1RBRA 1N4LA 4LQ3A 5KFHA 3L2RA 5HRNA 3SFGA 4BDYA 4CJFA 4R8UA 3MEGB 3KJVA 2E9ZA 1KLMA 3D0PA 1RDBA 2Z1IA 1CXQA 3RWUA 1S4FA 3B6OA 4FS2A 3HVAA 1X9SA 3OSPA 1C0TB 2OPPA 1JLBA 3V6DA 1XHZA 2RKIA 3BJYA 1IKYA 2RF2B 2I5JA 1NK9A 4HKQA 3KOAA 4IDKB 1SL2A 2JC0A 4Q8EA 1SH3A 2FBXA 4CK2A 3NAIA 4MIBA 1MU2B 2IGIA 4FLYA 4DL4A 4WYWA 1DTTB 4KO0A 4AHUA 3L2QA 4DTSA 1RTJA 4DFPA 2E9TA 4TQRA 2YV0X 3LAMA 2HNZA 5KGXA 3K5LA 1RBTA 5KRSA 3K5OA 3IS9A 2XO7A 4CGFA 1B9DA 3RAQA 1D1UA 2VG5A 3MXIA 2E9RX 1HYVA 3MEDB 4W5QA 5F9LA 1R0AB 4WE1A 4DTXA 3RB4A 2A1RA 2D7SA 2X6NA 4E7LA 3GIIA 2J6SA 4Z4EA 4ZP7A 3ISND 5L1IA 3CFOA 3DLBA 2GUIA 2HHXA 2O5DA 3KMSA 1EP4B 3OYBA 4Z4HA 4DS4A 1S1TA 4KHMA 2YNIA 4BDZA 3L8BA 3QEPA 3G6YA 3HM9A 3TQ1A 4CGGA 4RW6B 3OL6A 4AHTA 4MKAA 2YKNA 1S1WB 1KHWA 4KRFA 3NDKA 4F50A 3VA0A 4IG3A 1L3UA 1NK0A 1TKZA 3V9SA 4DTUA 1N5YA 3NHGA 4O44A 3QNNA 3F73A 1S6QA 1JLCA 3T5HA 3AO3A 3MFIA 5KT3A 4KFBA 3AVKA 2WOMA 2W7OA 1EKEA 1S10A 2QE5A 5EUHA 3QEWA 2IC3B 4ZPBA 3VQCA 4KKOA 4K4XA 1HPZB 4IG0B 1BCMA 4DQSA 4B9UA 2AWZA 4Q44A 1NK8A 2IAJA 2W8KA 3E01B 1ASUA 3I0RA 2HHUA 2AGPA 3UR0A 4KREA 1ASVA 4GMJB 1IKXB 3OY9A 1WAJA 4CGIA 4B9VA 1SKWA 4J9RA 4RW4B 2KFZA 2DFHA 3DRRB 4B9TA 3L2UA 2KFNA 4PWDA 3PW2A 3KK1A 4DS5A 4LSNA 4YFUA 3KK2B 3QIDA 2KTQA 5FRNA 3K59A 1SUQB 4DSFA 2FJWA 4FS1A 3HPGA 1TVRB 1IH7A 2Y1JA 1NK7A 1C0UA 3SUNA 2HAIA 3DRPA 3HVRA 3PO5A 3M9NB 2X6SA 2XHBA 4F4ZA 1J5OA 3H5UA 3S3NA 1WSJA 2ZE2A 4WXWA 4ZVHA 4PY5A 1L3TA 4KTWA 1L3VA 1BQNB 5C24A 2VA2A 3PJXA 3PVXA 1ZTWA 3KJVB 3PUFA 4Q0BA 2HNDA 4DL7A 3KK3B 2OPRA 1NJXA 3IG1A 3V1OA 1VRTA 4KE5A 4CIFA 3OJUA 2DPIA 1JLBB 3OYKA 3LZJA 4C8KA 2RPIA 2RKIB 1IKYB 4G1QA 2BQUA 4K4YA 1CXUA 4DSIA 4E7IA 2FJVA 1D5AA 3HHKA 5J2PB 3VQEA 3U6FA 2YKMA 4FM1A 3TANA 4B9MA 1LW0B 3DMJB 4KO0B 2B5JA 3GILA 1QTMA 4JS5A 1YVUA 2JGUA 4YR2A 2F8EX 2YNFB 3DLRA 3HVWA 3SPYA 4IR9A 4KHQA 4X2BA 1JLFB 2AX1A 3PR5B 3IN5A 1SL0A 4DG1A 4NLPA 3H5XA 1T8EA 3C6UB 5KGWA 1OS5A 5KRTA 2VG5B 2O4IA 1D9DA 4JUZA 3ZSVA 1C0MA 4DF8A 1LW2B 1JLGA 1RA7A 4ZHRA 4O5BA 2QKBA 4CHNA 3JYTA 3DYAB 5KG3A 3VQDA 4MFBB 5C25A 2R8KA 4M95A 4FLVA 2JEJA 4FJ5A 1NK6A 1S1TB 1HYSA 4XPCA 4RZRA 2GV9A 3ALYA 4JRPA 3M9OB 4NLRA 3VQ8A 2AGOA 4HVJA 4NLXA 5KFLA 3CDWA 4IG3B 2WTFA 4K4UA 4MH8A 5F8LA 1N5YB 4O44B 2OA8A 1JLCB 4ECZA 3SI6A 4FJJA 4KFBB 1S0NA 4BDPA 4TYBA 2AQ4A 4TSXA 4KKOB 4IOBA 1FK9A 1QAIA 1QSLA 1K1SA 5KFNA 4HTUA 1NOZA 1UWBA 1VSIA 4HCCA 3I0RB 4E1NA 1FKOA 2Y1IA 5HP1B 4M3YA 3OYMA 4JV2A 1ZBLA 4ED7A 4RNHA 4GVMA 3NE6A 4ELUA 3VA3A 4R5PA 4EYHB 1N6QA 4FK4A 1LV5A 4NRTA 3C95A 2XY6A 2IOCA 4E0DA 5KG5A 3SCXA 1U4BA 5KFZA 4NLYA 3NF9A 1Q9XA 1T05B 1XHXA 4PUOA 3DRPB 4E89A 1NJYA 5KFVA 3PX6A 2ZE2B 1XR6A 1NJZA 1A5WA 5C24B 2C2RA 4K4SA 2HNDB 3GQCA 4CFDA 4EBDA 1VSKA 4RUAA 2NUBA 2OPSB 3VQ5A 3IG1B 4Q8FA 4DTRA 4F3OA 5L1KA 1CLQA 4YP3A 1RDRA 4CEBA 3RMDA 1RYSA 1TAUA 2BQRA 4DTPA 4NCBA
chains in the Genus database with same CATH superfamily
1Z2ZA 1NCLA 3DXKB 3CFRA 1WSFA 3H0PA 4C0BA 1T11A 3OHBA 1KVCA 5JVHL 2FBTA 1W25A 3CWJA 1FFSB 5KT7A 1O51A 1YWXA 3VQ6A 2FHJD 2XS2A 3NXZA 1HX1A 3U3GA 1ZTTA 2IM0A 4ZN1A 3Q7CA 1HBMB 4K4ZA 5CQGA 3CO0P 4ZVEA 4UUWA 4DG1B 2R7YA 4OV6A 4TNOA 4WFAL 4NX9A 1VLOA 3I33A 9ATCB 5KFAA 1K8KA 3SMZA 3U9DA 1PGZA 4TQSA 2YWGA 2M0GB 5BPLA 1XBWA 4WZMA 1VSJA 1LOUA 3HLUA 1F9FA 2IM1A 3CC4N 1ITGA 3Q8UA 4CHZA 1CZAN 1HNZK 2ZBQA 3ZZZA 4KSEB 1JLQB 2YWEA 2DNZA 2HFOA 5GMEA 3OV7A 2VA3A 4PABA 1GLLO 1FD8A 3NMUA 3ID6A 3KLVA 3MXJA 4A2AA 2MQPA 2QKKA 1TKTA 3H20A 1RI7A 1SV5A 1AXQA 4Z2XA 3HKWA 4LRFA 3UDLA 3EDQB 3BF3A 1RT1B 4OZJA 3ATUA 4IOCL 4F3MA 1RT7A 1VSDA 3ISNC 3BREA 3OBWA 1D9FA 1M5PC 1MDUB 1HPMA 1WLJA 6AT1B 4YOUA 4NCGA 5I3UA 2P9CA 1YK9A 1N0VC 2IYIA 4C2MA 1RT5B 1RILA 2DNYA 5A6PA 4DV5K 2YHXA 4ID5B 4K4WA 1NU0A 3R2DJ 1MN9A 1FNMA 2WONB 4B3MF 2RDJA 1U2FA 4N47A 1HFEL 4ELVA 4ZLJA 1FRXA 4IFYA 4K59A 4OIXA 1BG3A 3J7ZO 4LF7F 2AX0A 2MQNA 1HNZJ 2A6OA 4PUOB 1VQSA 1FNOA 4O5FA 3H3OB 3J8AA 1NZ8A 3CNQP 2K7KA 3GIKA 3CCLS 4HWIA 5HN0A 4CW7B 1ZBUA 1JLEA 1S1VA 4W4MA 4J2EA 1RT6B 2HNYA 5CE3A 2FYXA 2GA7A 2ZFHA 4K42A 1NDCA 1U1RA 4WFAQ 4N56A 1X9WA 4ZVFA 2EWSA 1XNQF 4DV5J 1HKBA 5B0AA 3PDNA 2CWKA 2XYHB 4K50A 4ZVUB 3K58A 1TL1A 2DNRA 2PD1A 4IWVA 3M3ZA 4EHUA 5GAEI 3MM5B 1W2IA 4CGJA 2ZD1A 4OYOA 4A8MP 2KG0A 3O80A 4F0MA 3BSOA 3P83D 4JV5F 2P9NA 2G9OA 1FEEA 3AB4B 2P6TA 1Z2LA 3QERA 3I56N 3MD1A 4P9SA 1C4CA 4ECQA 1GNKA 2F40A 3PYDA 1N36F 1S49A 2Q3SA 1SJRA 4YB6A 3CJKB 4DR5F 4N7TA 3ITHA 3QLHB 5D6GA 3UVJA 2ZHAA 4OHZA 2F7VA 1T3OA 4A8FA 1HHQA 4IOCQ 2V8GA 1EQ0A 4ILHA 1N5VA 1OVYA 4C8OA 4QAGA 1XMOF 2B6AB 3DLGA 2Q0UA 2IHR1 1ZM9A 4AHCA 3TZWA 1VC6A 4M41A 1QE1B 2P9KA 3MXMA 4GKJF 3HVTA 4Y6IA 5DK5A 1J54A 4LFAK 2W7PA 3T5LA 3M7VA 1T9WA 4JI4J 4WYBA 2AJQA 1Y11A 5HROB 3U1LA 2CPIA 3MM6B 1WG1A 4GV9A 2AEMA 3OS2A 1CEZA 4J9VA 3BEGB 3D2FB 1KONA 2MZJA 3J7Z5 1DTQB 2KT3A 1QVGM 2OTJN 4LMZA 4KB1A 5J1PA 3J7ZT 4A5AA 3D2WA 3KUHA 2ZM6F 5IZHA 4DL2A 3MCAB 2V7ZA 2KI2A 2XMAA 2HHHK 2H3GX 1VK0A 3IC1A 4NCAA 2YJEA 2CQ0A 2E5LF 3BZQA 3K8WA 2DITA 3WC2A 3M6WA 3T3FA 2YNHA 4O3SA 2M88A 4M5NA 2ASPA 2KM8C 3CGIA 3OFFA 4LFAJ 2QXLA 1LAWA 3CJ2A 4QWCA 1H38A 2DRBA 4I6AA 2I9SA 1YI2N 1FA0A 4FK0A 2MJUA 2QT7A 4NA1A 3K5PA 1Z26A 3OYEA 3TWZA 1GXUA 3WC0A 3SYZA 3I6PA 3EVOA 3O2IA 4C7QA 3WX8A 3G2XA 1PYOB 3Q86A 4IZ9A 4WCEL 3CQ8A 4CECA 3ADAC 2AD9A 1S6OA 4Q5VA 3UD4P 4C3KA 5AQIA 1GLAG 3BM7A 1YX2A 3DGPA 2HHHJ 2BRKA 2XI3A 4JYAF 3BYPA 3HZGA 3L9ZA 1K73T 4TYAA 3EICA 1KLMB 1WEYA 4JNEA 2PMWA 5DG8A 2KHCA 4IFVB 1BWVA 2KU7A 4Z4CA 1SJFA 2VQEK 2HFNA 2W01A 4P73A 2QRRA 4B3SF 3UKUB 1YJ7A 2I5JB 2WSEC 1S9EA 4ETXA 1U45A 4CI6A 1IBCB 5AJ3F 3LTOA 1PAEX 5FPMA 3QJJA 3C6TA 2B4PA 2YWWA 2CQ2A 2ZNYA 3M1VA 1H3DA 4NRUA 4CDIA 3M5RA 3KLFA 4ZVPB 4BRMA 3BR9A 2EW9A 2MGZA 1OJ4A 1NOYA 2JWNA 1CSJA 1ROFA 3Q2TC 3I5CA 3CIMA 4R0JA 2HQCA 2DNKA 2KW4A 5CH7B 2R8IA 4NWBA 2ZH7A 5KG0A 5AQFA 1WD6A 4H4MB 1IJEB 2GS8A 3NKYA 1VBXA 4DZ6A 3BEXA 2UVRA 3VTIA 2W9BA 4WE1B 1JIHA 2VD3A 1Q8IA 2Z56B 3MN5A 5BR8K 1RHMB 3LWLA 1YJUA 4ZCLA 2HS0A 1QTNB 2ROEA 4ZLNA 3ZX3A 3QGGA 5LT5A 5FDLA 4ZP6A 4XH1A 2RUGA 2UXBJ 5T14A 2KVIA 1ZPVA 3P45B 1PIEA 8RUCA 2XWXA 2G8UA 2GVZA 3VV2B 4XO0A 5D0EA 2F96A 4CO1A 3DOMB 2IRYA 2VFSA 4NLSA 3P1GA 3ZTSA 4L74A 2FVCA 2MZTA 1J9AA 3M32B 1FF2A 1GTEA 4EBEA 1DT9A 4JV0A 3PX0A 2EKNA 1RUSA 3WQPA 2IAJB 3HI9A 5L1LA 2ZH5A 3ZSRA 5BR8J 4O8KA 3AOAA 3NCIA 3V5RA 3M6VA 4CLPA 3LH2S 1BIZA 3D3CJ 4PWDB 3KK1B 3D1OA 2ZGYA 4LRAA 1T6CA 2BJ9A 3JSRA 4GRSA 4JK9A 2BACA 5I9EB 4N41A 1C0UB 4MKYA 3O3HA 4CO3A 1IM6A 3UO0A 2D9PA 2DISA 5GADI 2VG6A 3L4QA 1HLWA 1RB0A 3WZ0A 4TLRA 4I6MA 2I38A 1XNRK 2YWHA 4JHDA 3M6XA 4WZQA 4I4BA 2IA0A 4WQ4C 4M63C 4YB1P 2JZ5A 3SQ2A 4PKHA 3NCQA 1A0OB 3POTA 1UW9A 3QSIA 2OPRB 4NYPA 1WI8A 4JI7K 5KFPA 5HBMA 1S9GA 3I31A 1GOAA 3F5TA 1AZSB 1X9JA 3DLKB 1EIYB 3F41A 5C0YA 1WG5A 2CADA 3KDOA 4M5DB 2RU3A 4JK7A 1WNEA 2O8EB 1IUJA 4QW9A 3U1NA 3VWSA 1WAFA 4AH9A 3M05A 1FFWB 2O01C 4J9MA 4QPXA 4KV8B 3EE3A 3GU0A 1VQ5S 4CZKA 1XNRJ 2NRHA 3IM8A 5BYSA 4ZP8A 1U25A 2C2MB 3NF6A 5C2CA 4ICLA 4PXBA 4X4QA 5C25B 2RF2A 3HPHA 3N6MA 2CVEA 1AROP 4KHSA 2F4FA 1X4GA 2CJKA 5KFDA 1RHQB 1OH8A 1JX4A 2A41A 1KSPA 1HNZF 3MOZA 2RSQA 2AYEA 4FPBA 2HHTA 4B9LA 3AVBA 2LQ9A 1VJQA 2QSFA 1HJRA 1VSMA 3KLHB 3HULA 1KQSR 2GUPA 4YDUA 3NH0A 3EX7B 4B9QA 3AY0A 4M42A 1VQMS 3HT3A 2QJ3A 3D0IE 1XR7A 4NMLA 3NOCA 2RAQA 4M5KA 3C16A 3OL9A 1R0AA 1BE4A 2C3OA 1F6TA 4RBTA 2BVZA 2GC8A 2ZBRA 3CJ8A 4U6PA 4DV5F 2UZAA 5DZ7A 2GAGC 1UA0A 5EGYA 1UWAA 5GAGP 3H2VE 4RPFA 4R5PB 1ZOTA 1UVKA 1QQOA 4E1MA 4RW6A 2QA4N 2IYGA 3RMAA 4LY7A 4M3XA 5FRMA 3PY8A 3SBGA 3OVBA 1HPZA 2DGWA 4MDAA 4ANCA 2RE2A 4F0KA 5KAKA 2I6WA 2A40A 1JL1A 1UJ4A 2V8DA 2GIRA 4E8UA 1SB6A 2DH7A 2M2BA 2CDQA 1IM4A 3P4UB 3NG8A 5DQIA 2E29A 1SUQA 3PRDA 1RYRA 4ZTFA 3L2WA 1S0MA 3J7YI 3MFHA 3OVAA 1S59A 1D9AA 3PFOA 4OHWA 2HZVA 2P9GA 3I4PA 3B6PA 3QAUA 3O1BA 1UW4A 2JEIA 4ZJOA 3L0QA 4KH4A 3Q8YA 2FVQA 4GMKA 2FBVA 2BX6A 1FXXA 2LSNA 2FHJA 3HHLD 3K2PA 1T9VA 1CG2A 3KK3A 2OJ3A 2VFUA 1I3OB 3D9BA 3ZZTA 4RWWA 4CIGA 5DDPC 2Y0BB 4CJ4A 1SQFA 2ILYA 5AZIA 4BC5A 3DGVA 1RT2A 4C11A 1HNVB 1TL7A 1AYEA 1RAAB 5M1QA 3TTFA 3VENA 1JK9B 4I7FB 1Q86O 3PO4A 4CLYA 3DFEA 1TKDA 3FDSA 1NDLA 3CCWA 3U27A 4D3HA 5ETOA 1LW0A 2BE9B 4LFAF 3K9KA 2P9EA 4NLVA 2OIHA 3OYJA 5D0GA 4B1WB 1XI1A 1JLFA 1UVLA 1SV5B 1RGIA 3G8TA 1GH8A 1RAIB 1IR2A 5HRRA 2KZMA 1S0VA 4CH7A 1RT7B 3H40A 1HBOA 3BS9A 4ES2A 3P5JA 2M3DA 4JI0J 5FIIA 1Z05A 4NCGB 5I3UB 2NXEA 4NXMK 5B0EA 3W2VB 1XMBA 1NH7A 4JV1A 2UUCJ 2HHHF 2YCHA 4PR6A 4Z37A 1S0OA 1H1VA 3KVGA 4ZS6A 4CERA 1TZ0A 4Q7AA 4ZIVA 3R5DA 4I9QA 3SIPB 2FLPA 1HJOA 4KHWA 3SSSA 2W25A 2UUWA 5EDWA 4UQTA 2W2PP 2QM1A 4CHOA 4Q45A 4F7VA 5ETVA 3EXCX 1VQNS 4CEZA 1OYDA 3E51A 5AQVA 3GDQA 1TTHB 5KFIA 3FEYB 4OLPA 2BJ7A 1YDLA 1VSEA 3TA2A 2D74B 2HNYB 4YOWA 3NH1A 2BGGA 1JWWA 2MY8A 3MAQA 4G1PA 1U6ZA 3WBZA 2KXHA 1OWXA 1VQ6S 2ASJA 2ZHBA 3IM9A 1TL1B 4CM0A 2XM3A 2Y1LB 1TV6A 3F0NA 4OI1A 3WIUA 3HSDA 5IT4A 5E26A 2ZVIA 3TAMB 1YLXA 4NASA 4BRKA 2H3EB 2IDOA 3RRGA 4J2AA 2AEJA 2P9NB 3LQVA 4CLFA 3KHHA 2VOOA 1FXRA 1OH6A 4P75A 2NS1B 4C48A 1RDAA 2Y1RI 1R8BA 3HP9A 2FIUA 2HWTA 4DI6A 1ESVA 3BY5A 1WF2A 3SQOP 2EC0A 1KVBA 2DVIA 3SCJE 4FZZA 1UCNA 3DXMB 1LOTB 3R3TA 4B1UB 3ITHB 3A8YA 3UVJB 5FLXO 1NO8A 1F21A 5AFUA 4IXCA 5E41A 2MQOA 2XMKA 1NNDA 2A1SA 1VGYA 4AXJA 3DLGB 1IJJA 4RCHA 5KG2A 3TABA 1P8GA 5CYJA 3A2FA 4DPXA 2G8WA 3NNHA 2CIMA 5DQHA 4OGCA 3V2UC 1HQEA 2QA4G 1ATNA 2VG7A 4X84A 3AH6A 1LKZA 3T19A 3K57A 4FJNA 4FXVA 1CQMA 4NI2A 3U7JA 4NA2A 3RBEA 4WBFA 5BR8F 4IH5A 3GONA 3CW2C 3VZHA 2J0SD 2YX7A 4LR7A 1A5XA 2XYGB 3TZYA 2HHPA 3LDSA 1RTZA 1LXNA 2D3ZA 1TUUA 3U1MA 4ETZA 5HOOA 2X3GA 7FDRA 5KFUA 4O3NA 2O67A 1RT3A 2I7PA 1YTAA 1U2VB 3LPUA 1RGVA 2GWKA 3RVCA 1FFGB 2W2MP 4JBCA 2HBRB 2CNLB 3OXLA 2POKA 2QSWA 5F1XA 1WSVA 3KLEA 5L46A 1HBUA 3SFUA 2HW3A 1Y97A 1KQSM 3TSQA 4QIWD 4FF2A 2PAVA 4ITSA 1F5AA 1OPZA 1NSKL 4UZCA 2VQFJ 3M6UA 2H5EA 1ZBTA 1Q1KA 4GVLA 2BBEA 3RG6A 3VQ4A 1RADB 3NOGA 5K14A 2O8CB 3RU0A 3CCRS 4F04B 4CEFA 3VEZA 4QZVB 4DBQA 4NXNK 3PLAA 1UVMA 2OLWA 5B0BA 5MAOA 3BQ2A 4USUA 2PDAA 1RBSA 3LM9A 2BM0A 4QWDA 2FGOA 5DM6Q 2EFOA 1KQGB 4U9RA 3FVYA 3U4LA 2G1DA 1T94A 2OKQA 3DGPB 4FWKA 3LANA 1NDKA 4K41A 4ECUA 4UT4A 3HZ6A 1XNRF 3LP2B 3CCMN 3THYA 2CQPA 1U0HA 2J8AA 4R79A 4F9OA 2XC9A 4RW7B 2DH9A 3V9ZA 4M3ZA 2NXUA 4LT6A 4JI7F 2PFFB 1BOTO 2M9KA 2XZTB 3SZ2A 3ZTPA 1NGBA 3B8HA 3IMQJ 4MLEA 4NYZA 3GPAA 3AGKA 1YJTA 2MZRA 3OFEA 4ZPDA 3T5KA 4NE9C 4M3TA 3C6TB 4NXNJ 5AXNA 4AXIA 1NSPA 5KG7A 1T02A 1DQ8A 3M1VB 2G8IA 1T3VA 3JAMU 2MGZB 2YNGA 1WOSA 2Q31A 3DLEA 2IJFA 3SQ1A 1SH2A 4YR0A 2ZZTA 1LQ9A 3EM1A 1M90O 2HHSA 4KAIA 1KLNA 2PEHA 4CEOA 3ENBA 4ILRA 3ULEA 4CJ7A 1U49A 1WDDA 2W9BB 1GT8A 2B4UA 5D78A 3VEXA 2D1CA 3NGRA 4CP5A 5LJWA 1OH5A 4IDHA 3SJHA 1YRXA 4QWAA 4IDKA 2BRLA 4DJBA 4HHTA 3EO3A 3IAYA 1R8CA 2V4JB 2GVZB 2XHCA 4NYOA 4CD1A 2RRBA 4A47A 4OKJA 2BDPA 4PEOA 2XGQA 3G82B 3AVMA 4M3WA 1QQMA 3MR5A 2X51A 3CQYA 4F4AA 3OYGA 3EJMA 4IJNA 3HO1A 3MEDA 2CAJA 3W0LA 4A8XA 4OZ3A 4UOCA 2Q2RA 4NOHA 2P5GA 3SCKE 1E6VB 3AVLA 4Q43A 1D8YA 2BKPA 4WWSA 5AQZA 3UDVA 2O8FB 4XDDA 3CPWR 2NR0A 1J6ZA 5F8NA 2KXFA 4P2FA 2BKOA 4WU3A 1DJ0A 3R5CA 3ZSWA 3FCVA 2DXDA 2HMIA 2VG6B 2FY8A 4Y0FA 3T9ZA 1S72N 4Z0UA 2W9CB 3W8GA 4CLUA 1H74A 5DMRA 1MWZA 5A0YA 3A5LC 1S1UA 2J9DA 2LFVA 3POTB 1XIQA 4WYLA 3BUZB 4FWNA 4USKA 4KIAA 3LP3A 3VGKA 1G4CA 5HBMB 2N4CA 3VAIA 1XR5A 1S9GB 2ASMA 1X8DA 3RTVA 2Z1JA 4DTJA 1PAUB 3ENOA 3SNNA 1TL3A 2VB6A 4OYWA 2EFVA 3OYCA 3MR7A 4JKBA 3CIZA 4AILC 1M90T 4M7XA 3VOVA 1Z4UA 2HK2A 3FQLA 1BI4B 2OSQA 4OYMA 4LQ3A 3UE5A 1HKCA 3DCAA 5HRNA 4A8SA 4BDYA 4R8UA 3D0PA 3QMLA 2XNRA 1CJUB 3BGUA 3LGMA 3OR1A 3CC2S 4QOTA 4FS2A 1NGEA 3HVAA 3PIPQ 1ZM2A 2YY3A 1X9SA 4I69A 1XHZA 2RF2B 4K5SA 3CCTA 2V94A 3KOAA 1GQEA 3AAWB 3GR1A 4CK2A 1PSDA 2IGIA 3IBCB 3A3NB 2G2ZA 3G9CA 3L2QA 2ZOGA 1KQKA 4TQRA 2ZBPA 2HQFA 4C9DA 1KDNA 2YV0X 3LAMA 2HNZA 3H1VX 4OYXA 3NCPA 5KGXA 4X64K 1RBTA 5KRSA 4CH0S 3K5OA 3IS9A 3ZZUA 2QEXN 3QFHA 4QYZK 1B9DA 3RAQA 4Y0WA 3MXIA 1B99A 3AFGA 3C16B 2FZKB 3TX0A 1R0AB 1JB0C 4GNIA 2QWQA 1VQ7S 1N8RO 1UVJA 3GIIA 5L1IA 3GFXA 2J4RA 3NGTA 2HHXA 4DS4A 3R1LA 1FW6A 4Z4HA 2V34A 4BDZA 4N8NA 3CC7N 4RW6B 3OL6A 1TYQB 1FJGJ 4MKAA 2YKNA 1KHWA 1PBUA 4MDBA 3NDKA 4IG3A 2LECA 4O44A 3QNNA 3QICA 5AQWA 1SVDA 3D6FB 3AO3A 3WDOA 4F02A 4WPAA 3AVKA 2WOMA 2MYFA 1EKEA 1I1GA 4AM6A 2GVDA 1HPZB 4X64J 2V2QA 5HMXA 1NK8A 4QYZJ 2D0PA 4OJHA 3TEGA 4OI4A 5LM7E 2QA1A 4GMJB 2AJFE 4LF8J 5BYQA 4CGIA 1SKWA 3J7AP 2A6MA 2DFHA 1NGDA 3TTCA 3N9UC 1SUQB 4DDFA 4DSFA 3DNCA 1IH7A 2C1EB 5AQOA 3DRXA 4QIFA 1WHYA 3LGNA 3HVRA 3ILJA 2X6SA 3H5UA 3WEEA 2FDNA 2ZE2A 4PY5A 4H5VA 5AQJA 3FUYA 1ZTWA 4Q0BA 3DJCA 4USVA 3KK3B 1K44A 2CRLA 2GQCA 3V1OA 4IFEA 1BY9A 1VRTA 4M5JA 2F5GA 3OJUA 4XH4A 4C11B 1TL7B 5E5NA 3M6GA 1OY9A 4BRCA 3S01A 4DSIA 1K0TA 1A7GE 2GHVC 3MWTA 4JI2K 3VQEA 1VK3A 3PXGa 3NY0A 3CCVS 1LW0B 2AV5A 2ZWPA 4EU0A 4YR2A 2F8EX 4ATNA 4WP3A 2LXIA 4ZITA 3SPYA 1H0HB 1JLFB 3LM2A 1IWAA 3UD5A 3PR5B 1T8EA 5KGWA 1UJ5A 3CJAA 1OS5A 3UCUP 3BKUA 1D9DA 2NRXA 1TUYA 2G2OA 1JLGA 1RA7A 5CABA 2DGTA 3OHRA 4O5BA 4ANEA 5KG3A 1NGHA 2VPYB 2NPIA 2R8KA 4FLVA 4FJ5A 1HYSA 4XPCA 1B64A 2GV9A 5DS7A 4JKGA 4L73A 1EHWA 2WVEA 3ALYA 5JICA 2C2ZB 4XEIA 1MNEA 3KWGA 4LJMA 2CJBA 2MY7A 5BJRA 3GZ7A 1YBUA 2FSKA 3HT0A 2VHGA 1FRKA 1JLCB 4FWLA 4KFBB 4CTAA 4BDPA 4QIEA 4TYBA 2AQ4A 4CZJA 3D67A 3VR1A 4KKOB 2QMXA 4J37A 4NXNF 5D0RA 3GJRB 4NO7A 2ERRA 4AD6A 3PKYA 4ISFA 3CPWM 5B08A 4HCCA 3C65A 4RNHA 1G2EA 1IJFB 3HCXA 2EG2A 3VA3A 4FXWA 2MHEA 2DNGA 4EYHB 4NRTA 5BPMA 4E0DA 4YS2A 3CD0A 2FJEB 3SDEB 5KG5A 3SCXA 5KFZA 1Q9XA 3NF9A 3P49B 2ZH4A 3K7RA 1ZM3A 3KUGA 1AB8A 5KFVA 5IM0A 1VYAA 1XR6A 5GMKa 3MCMA 3CD6N 3PYGA 3THPA 4CFDA 4EBDA 3VQ5A 3EGVA 4F3OA 2CA9A 4CEBA 2JFKA 1VHFA 4M1KA 1BUPA 4DTPA 4NCBA 1G7CB 3MTKA 1UPMB 1G15A 4TU7A 2OTJS 2X74A 4RX6A 4LH4A 2Y9HA 4OZ1A 1HMVA 4CJKA 2UV8G 2YKPA 2EPIA 1HQEB 1S6PA 4X4OA 3SJJA 2IPOB 3FSXA 3BN7A 3M8RA 4KTQA 1V6HA 3Q8RB 4BRLA 4OX9K 1Q82O 2GAHC 3CJQA 5FPEA 1FWPA 3U02A 4H0PA 2QG9B 4IBNA 2KZZA 2HF4A 1X5PA 1NLKL 2HSEB 1RT3B 2BJEA 4C23A 3T1AA 1NJIO 3TW0A 3JYTB 3QIOA 3ZT4A 3O5BA 3Q22A 1JQGA 4ZPVR 4Y2AA 3CJ5A 2DR6A 2KT5A 3PW0A 3R2CJ 5ETTA 2QA2A 3H3NO 1QJHA 1Q9YA 3MAAA 2MKKA 4WF9L 4M7YA 3A8EA 2CQ4A 3OTDA 3E2EA 2GV1A 2OI2A 1XJWB 3VALA 4NLQA 3W62A 2RJZA 3QSYB 2X1AA 3KHGA 1S79A 2AF6A 4FM0A 3GFZA 4DZDA 4OX9J 3W5YA 3JAMY 3SAFA 4CHQA 3LDNA 1VLYA 2R2SA 4H8KA 1ZYQA 2J6TA 4FJ7A 1J53A 3NGYA 3MUMP 3CCJS 2QN6B 5HVFA 2W9AA 3UNGC 2DRAA 1N6QB 4CJWA 2UV8A 5C10A 1BD6A 1U0HB 5A2QO 1DFDA 4DV2J 5M1PA 2HLUA 4KGZB 2OP5A 3PW4A 4DUYK 1VR6A 4DR4J 1D3WA 1L3KA 2NYIA 4C8NA 2RQ4A 2ZJPL 3BDEA 1N0UA 3JSMA 4J9UE 1YIJS 3W5XA 3PJ9A 3PW7A 3RGIA 1PBAA 1HR0K 3MEEA 3AA3A 1NG9A 1JNRB 3K5NA 3C8YA 4I2PA 2LMIA 1DKGD 4OYZA 3MUTP 4ANDA 3D28A 3DLEB 4WK3A 2YBVA 3RMCA 4O3PA 5HO4A 2R7QA 3K9JA 5IC6B 4NYFA 2UXCK 1ZZFA 1VSLA 1KAYA 2LU1A 2NZCA 3IRXB 3JQJA 1NMEB 2MQMA 1R3NA 3N28A 1Y5LB 3ULEB 2XQCA 3JTNA 5KFXA 4FJ9A 4JB8B 4LD0A 3MPUB 3C14B 3MI7X 1FKAF 3GR0A 4WF9Q 2F8HA 2HWIA 2D0OA 4CO5A 3PYEA 3A5MC 4DR3K 2ZH3A 3Q89A 4LSZB 3I82A 3F9MA 4E7JA 4PL7A 5BRDA 1P27B 3AXKA 4AL6A 3MR6A 2GIQA 2CG4A 3OYNA 1RWXB 2XZWA 2F4VK 3HMJG 3AY9A 1VRUB 4X64F 2O1PA 2UXCJ 2LVWA 2G2YA 1XK8A 1JXLA 4H4KC 4U96A 3PSIA 3FE1A 2VPZB 4LF8F 5I3PA 2IM2A 2ROGA 4RWXA 4JD2A 1PC5A 1Y64A 4Z4GA 1E3MA 4PPDA 2R7UA 2CPDA 1XQIA 2E1CA 4CWBA 2ZJPQ 3N0VA 2OZSA 5I42A 4D3GA 2HMIB 5AQXA 3R5GA 1QS4A 2E1ZA 2VCPA 4USWA 1PG5B 2ZUAA 3DDIA 2GJ2A 4MTPA 1KEKA 3TYTA 5A0YB 3C6AA 2F4VJ 5F0XA 1J5EK 1S1UB 3IGNA 3K0SA 4MJKA 1KNZA 1Q5VA 1RXOB 5DJBA 4RR5A 4ZPAA 2Q66A 1WTFA 1ZETA 3LP0A 4CK3A 4PWUA 1LEOA 4RW8B 1BUXA 1KRPA 1TL3B 2HRTA 4M63A 2W41A 1X3NA 2B3TB 1G1XA 1RTHB 5HK4A 1K8AO 3IXQA 3T9NA 2YTCA 2VFVA 2JC1A 2JX2A 3KKFA 2H65B 5A76A 5CHIA 4PZVA 3MHYA 3CDEA 3Q83A 2DCLA 4M3UA 2P2CB 1T95A 1VQMN 3O9TA 4NLCA 4R8UB 2WRMA 3QT6A 2KB2A 3G87A 2U2FA 4UQGA 3H2LA 3NAHA 3V4MA 1BA1A 4DUTA 4WFYA 4BCAA 3FZLA 2YKAA 5F8HA 2CNNB 3NL0A 3Q0AA 1RT4A 3VGSA 1YGYA 3FKBA 3MMVA 2RQMA 4TY8B 5K5MA 1WTBA 4CJRA 1UAWA 2EFQA 4RW9A 3BBFA 2WVBA 1DQ9A 4JI2F 1SCJB 3MMCA 3M30A 2GELA 1HARA 3AO2A 1X5SA 4OX7A 4R25A 3JS9A 3CI5A 4DEZA 5D3GA 4B3TK 4ILJA 2HNZB 5IWAK 1T9YA 2Y0SD 2DK2A 2NRVA 4OVLA 3IS9B 1SC1B 1ASWA 5MLCQ 4EZ6A 3DM2A 1SBRA 1FJEB 4J90A 1R7IA 3WNFA 5K20B 1MLAA 2RNEA 1YTUA 3R3LA 2JLFA 4MAKA 1VQKN 1IKVA 1VIXA 1B92A 2QL7B 3QDKA 3EZUA 1ZAXA 3T6JA 3W3DA 4XDCA 2RN2A 2B8PA 1PKUA 4J9LA 4LBHA 2CPFA 2RD5C 2ZITA 2V63A 4BRGA 4RG8A 2YKNB 1U8SA 4RUCA 4ED6A 3O5TB 2VUGA 3OXGA 3E9OA 3D2EA 1DRZA 5HJXA 3FR0A 3G6XA 2WOMB 5J2NB 4B3TJ 3T1HK 5F0UA 5IWAJ 3OXFA 4F36A 3TVKA 2GVDB 3HZEA 4EAHD 3TX8A 4ZIWA 1C0FA 3FSIA 4YUDA 4UOFA 3BSAA 2Z2MA 1LWCA 4BWMA 3GYNA 2B43A 3KHRA 1HHTP 5ETMA 4NA3A 5LXRA 5LL6Z 4ZVRB 4LVOP 1S76D 2XS5A 1Q4RA 2E1RA 3IFEA 5IC4B 3CULA 2WTUA 2WCXA 1EQMA 2A5XA 3R1XA 3RW7A 1JLAA 5D77A 4F26A 1WUAA 3OLBA 2BV3A 4FDFA 3VQTA 2J8SA 2ZJQQ 5KPTA 3PZPA 1TK5A 4FJHA 4C1NI 3UIQA 3ZTRA 2HZCA 2Z2ZA 2X78A 4Q0BB 5I4MA 2QLWA 4C3LA 3KMQA 3VGLA 2Q6CA 1F1BB 2HBZB 4J2DA 1VRTB 2KYZA 4CZLA 4DWIA 4A8YA 3CG7A 4ZJLA 4A8OA 2GO9A 4F8RA 4DUZK 5DDQC 3MTJA 3AV9A 3EEQA 2IVOA 2LEPA 2R7TA 3KKRA 1GXTA 4FJGA 3L2VA 3CCZA 1ULRA 2Z1HA 4WXOA 2VFRA 2V9KA 2YI1A 3WXIA 1ZBHA 3O3LA 1KD1O 2BABA 1FDAA 1XC9A 2QLBB 1NB7A 1VQNN 1CC8A 4U7UD 1LFWA 4OZ5A 4OX9F 4L76A 4UF4A 2B9YA 3MEGA 1KVJA 4CJUA 4LR8A 1ZAVA 3TARA 4KI4A 3H6EA 4FZVA 4CF1A 1JLGB 3QEVA 1IO2A 3FK4A 5GADU 2B9WA 2VC1A 2GNKA 3KZBA 4KGMA 4DUZJ 1NU4A 3LWMA 2R2RA 4F3QA 1HYSB 1QSYA 3PRVA 3HOSA 3TJ8A 3S7RA 3ZFVA 5E3CA 2E20A 3ATVA 1DTTA 1IWGA 2DGVA 3IR5B 1W7AA 3B4MA 2C2NA 3CPEA 4F2SA 1RABB 1QSSA 3C0BA 2DTUA 3O3GA 4CCHA 3AOBA 3C46A 3QFPA 4OZLA 2D0BA 3QBCA 3SUQA 3L3UA 3M2RB 3DKDA 2ASLA 3LAKA 4CTAB 3I8DA 1YKWA 1KXPA 3R5AA 2WC9A 1FTRA 1S9FA 1UKUA 5J2QA 3D3BJ 3J80U 2OD6A 3QEXA 1SJ1A 1LWEA 3I87A 4TXSA 3O4QA 3HJVA 2UP1A 2LQ8A 5KFTA 5L1JA 4J8FA 4F4XA 4OLBA 3E9LA 3H4BA 3CJRA 4NEZA 2RDIA 1EP4A 3N4QA 5KG4A 4DSLA 1NHVA 3KJQB 4ED1A 4CO0A 1OSCA 3WUHA 4KBIA 4DUYF 4KHYA 1BL3A 3DOKB 1YJNN 4DFJA 1EKSA 2BJ1A 3MCPA 2Z4PA 3EGWB 2WW8A 1A5VA 2HBKA 3NGKA 3SQ0A 2VPWB 1HR0F 5ADXH 3QBXA 2AIRB 2E5IA 4Y3CA 2DB1A 3T1YK 4OI2A 4CLTA 5ETSA 4RNMA 1S97A 4TKTA 4FF4A 4PPZA 2GW8A 2BJDA 2O8DA 4RW4A 5LOQA 3LDLA 4CRJA 4QYRA 1B7FA 3H2UB 3KK2A 2UXCF 1XTZA 1HMVB 2IJNA 5DLGA 2EG1A 2HMPA 1S6PB 3I8BA 4HT7A 4NZ7A 1QUPA 4ED5A 3AAPA 4CE9A 1LFPA 4CEAA 2HBQB 4FZXC 4Z94A 3SQGB 4LF4K 3P39A 1WKJA 3NS6A 3C15A 2ZZNA 3CCRN 2CUYA 4BQLA 1O8BA 1PILA 3IBFB 2OMLA 2OUGA 1JJ4A 3KKSA 2IMOA 3QBWA 3AO1A 4DR3F 3SPZA 3TAEA 1YXQA 2VWJA 5F8IA 3T1YJ 1M5KC 4HUEA 1ZA2B 3SBTA 2KH9A 5EU7A 5F8GA 4MKVA 2N7CA 1TUWA 4K25A 1DAXA 2IDLA 4LF6K 3A8KA 4ILMA 3R8YA 3AD7C 4GO5X 5J2PA 1RTDB 2F4VF 3D45A 3MPWA 1BWEA 3W9IA 3H08A 3ENWA 4HACA 3DMJA 3NLCA 1WC0A 2XY5A 3MAAB 2QWPA 1FRJA 1X4FA 1HI0P 3SEOA 2DRDA 1BISA 2MHNA 2W4CA 4PQAA 2N82B 3HD2A 1X4AA 4LF4J 3OL8A 2UUTA 1FDDA 1JKHA 2F1FA 3GV5B 4ZP9A 2D0AA 2XTJP 1QLNA 2KM8B 2B9XA 1TK0A 3HJFA 2LQJA 3VN5A 1N48A 1Q95G 2Q1NA 4Y1DA 3D5MA 3QMQA 5HVGA 3O3FA 5C15A 4DPOA 4LF6J 2HQ3A 2JL9A 1WB9A 4O0IA 1J5EF 1JJHA 1OO0B 2JFDA 1QVFR 5DG9A 1NDPA 5KFQA 3R7BB 2W40A 2A42A 1ZC6A 2E2QA 3TUZC 1KQFB 1H6KX 3ILOA 3JSMB 3AHPA 4DCHA 3M4XA 1T6DA 3BSCA 2FVRA 4RU9A 3MEEB 2CJYB 4JEPA 4MK9A 3AA5X 4FLZA 4I2PB 1YSJA 3LALA 2CPJA 1K9MO 4GV6A 1IBMJ 1BXNA 5D0HA 5BRHA 1LK5A 4PG8A 3RAXA 2QW9A 1VIOA 1Q16B 1FJCA 1N56A 2IA6A 2PGCA 4DPTA 2DGOA 3SCIE 3FBCA 5CZ1A 3LPEA 3W5ZA 1RFQA 3WNGA 2D3OR 4LF5K 4Z4IA 1KAZA 2IBKA 3VEVA 3EZOA 3FRZA 3AA4A 1OQ6A 5JVGL 2PE8A 3GIMA 1FE0A 3HOTA 1YRUA 5BN8A 3O9RA 4K8ZA 2WFBA 1HNXK 2Q1LA 3W3SA 4QW8A 3AO4A 5K8NA 4RUBA 4B3SK 1OIAA 2P9IA 2H4WB 1V5IB 3OPKA 4TU8A 3M8PA 2QMUB 2ACMA 2VV5A 4B3TF 5IWAF 1R43A 3BGRA 2HVIA 1U1MA 1BC6A 4L72B 3C2PA 1WDTA 2RIJA 3KLIA 4ECSA 2OZMA 4LF5J 1MROA 4LIRA 2GMLA 1VQ9S 4LSLA 3WXJA 4RLEA 2BEFA 1VQOS 3QGHA 5KFJA 3JXUA 3V81A 4JD2B 3LUYA 4F3TA 3UWTA 4AHSA 1SIZA 1PC4A 1T03A 3IBWA 2HOEA 4O3QA 3DU6A 2ZKUA 3GG1A 1OMSA 1X4CA 2IDEA 3ZT1A 2HBLA 1HNXJ 3PSFA 2G1HA 2GZOA 8AT1B 1Q8BA 5I42B 3ENQA 1BIUA 1UVNA 3E1YA 4DHYA 1SKRA 5AQKA 3D66A 2ZBCA 1QVGR 3GSDA 4W5TA 4JOUA 4Y2MA 1O1WA 2QTDA 3CB4A 1F3VA 3PV8A 3K2YA 4U95A 3D0HE 3T1HF 2HIYA 2QWMA 4YHHK 2K1RA 1KFDA 4OYIA 2J0WA 2D1KA 2F3JA 4ZLLA 3FLCO 1A6LA 3CC2N 5CYMA 3WXLA 1LAVA 2I8EA 3IKMA 4J7CA 5GAGU 2FSNA 3FZFA 1TKXA 2AHOB 2YHWA 3ZX0A 3QT5A 3K5MA 4X66K 3PR4A 1H2UX 3J81O 5EHHA 3CJ1A 3QWPA 4DL5A 1RWMB 5JVGQ 2G8HA 4BRDA 4M45A 2HQGA 3X3UA 3HSGA 4FYXB 4CEQA 1CJKA 4TVAB 1CJVA 3RYLA 5EVZA 4CZEA 5HRPA 3BKFA 2A2DA 2LKZA 2KKZA 3A8JA 2OGUA 1UP1A 3AVAA 1AA1B 1R6YA 2ZWOA 1O6XA 1F60B 5CYQB 1B0VA 2ASDA 1XWLA 2J9EA 1AFJA 1FTCA 3KD1E 3W64A 2PFDA 2AP6A 4YHHJ 4N5SA 4YN3B 1KTQA 2IS3A 2QK9A 3HSZA 4L8RB 3BZKA 1VQLS 2HS4A 6FD1A 4B9NA 4DUZF 1HQ2A 3WHIA 2QEXS 4K0KK 1WBBA 5LMNJ 3TTDA 3KHLA 1T9XA 2GGPA 1YG0A 4X66J 2L48A 4RW9B 2YX4A 3HXMA 1M0SA 3MMCB 1YUWA 2V5HG 3QETA 3DLHA 3VESA 2F9WA 4CZGA 5D3GB 1WWHA 1T3NA 4BC3A 3CC7S 1XN9A 3FBEA 1GOCA 2O3DA 2E66A 3DM2B 3E9PA 3EN9A 3MR3A 1Q5YA 3HHLC 4OKEA 2YHYA 1RWPB 3US5A 3QO9B 2LDYA 3MD3A 4H54A 3RBDA 3TQEA 3UW1A 2XBPA 4WIIA 1IKVB 4FLTA 4K0KJ 1S5JA 3M8QB 5CXTA 2YHBA 2JWKA 4KHUA 2Z58B 3TUIC 2JH3A 1FKPB 3FEXB 3AVIA 2VASA 3D2EB 1U1PA 1X4HA 2DIVA 4RO0A 4DSEA 3N5BA 4FVCA 3VHQA 4L3NA 3HHDA 5M1FA 5A8WA 2EX3A 2C2EA 3UN3A 4CJSA 1Z1ZA 3EUNA 2V7YA 2AW0A 3OYLA 3FZHA 1LWCB 4FP9A 2WBRA 3DN9A 3TEHB 2DR9A 3CJ4A 4BRIA 3Q8PB 5GAHP 4IOAL 4JI1K 3GTYX 1S7HA 4ISGA 4ZCMA 2HF3A 4AUKA 2MKSA 1URNA 3F2KA 3L4IA 5T7BA 1HKGA 3VZIA 4K5RA 3FFIA 1S1WA 1CULB 2R7WA 3KJNB 3CCVN 1QVFM 3CJ9A 5T41A 1RE1B 1JLAB 4M8LA 4CYUB 2IM3A 5HAOA 4JI5J 3N5FA 1RDCA 3NMAA 4ZVGA 3DRSA 4CK1A 4AF1A 1GMWD 5JVHQ 3NH2A 3HKZD 3T1YF 3E01A 1U6BA 3IUCA 4KHRA 1N33J 3BF4A 3FEZA 5DQGA 4QPTA 1U1KA 4OHYA 1CS4A 3IO1A 1TU0B 2FLLA 4JI1J 1KOOA 1BGXT 4FPAA 1RBLA 3MMBA 2FVPA 1NGGA 1F0XA 3AQPA 1GX6A 2UU9K 5BXIA 4IO1A 1REVB 2DEJA 2QYGA 4KB0A 1W2BR 2NZ4A 4BC2A 4FCYA 1N54B 1QDUB 1ZPWX 2DNNA 3PTWA 1RBRA 1N4LA 1G3OA 4DHVA 2W6KA 4LF4F 4OI3A 3SFGA 1SKUB 3MEGB 2E9ZA 4JI4K 2JVOA 4DV6K 2HVEA 3RWUA 3UKRA 3B6OA 4I0WA 1FDNA 1P1TA 1SAZA 1JLBA 2HRUA 2Z2YB 4H5RA 2XNQA 2N3OA 5HQMA 2EK1A 1ZS6A 2RKIA 3ZYYX 3OR2A 3QAEA 3DU5A 2IIRA 1N32K 4HKQA 2NSBA 3GFHA 4BRFA 1SL2A 2JC0A 4LF6F 4IOAQ 2V52B 2C3UA 4MIBA 4ZJQA 3W7BA 3KJFB 1DTTB 5MLCV 3BB5A 1NEEA 2UU9J 4AHUA 2MJNA 4JAXA 4BY9C 3QT7A 5RUBA 2E9TA 4LRCA 1FEHA 3MMJA 3CJBA 3HM8A 2G4BA 1X7VA 3L95X 5AQGA 4JKHA 1K0VA 4DV6J 4DTXA 4BLGA 2D7SA 3ENAA 3CD6S 1X0PA 3BBCA 5IT9Y 2ASOA 3T7ZA 3DLBA 3U8XA 3ISZA 3IRWP 2O5DA 3MMAB 1EP4B 1RISA 2VBWA 1NBWA 1N32J 4KHMA 2IVFB 2W7AA 1P6TA 3HM9A 2HAFA 4KRFA 2ZC3A 4P6QA 2E7XA 1N5YA 3NHGA 2L41A 1S6QA 2VKRA 2W7OA 3TSUA 1S10A 2VFTA 3QEWA 2GWJA 3EGZA 3MX2A 4K4XA 4OI6A 4DQSA 3WXMB 2W8KA 1ASUA 3I0RA 4X62K 1R8AA 3UR0A 1VOMA 1AFIA 1ASVA 4ID8A 2XMTA 2OANA 3CJSA 3G8QA 3OY9A 1WAJA 3VGMA 3KWMA 1SJ3P 4RW4B 3M2UA 1RAOA 4BHQA 4CT9A 4B9TA 3QPIA 1WBDA 2KFNA 3PW2A 4DS5A 1BLUA 4LSNA 4YFUA 3KK2B 3QIDA 4FNHA 5A8KA 2AJ2A 5M1OA 2FJWA 4FS1A 4HT5A 2P9UA 2WB1D 2X7IA 4CI0B 3SCLE 4H5NA 3RAMA 4LF5F 1GLFO 3BP8A 1M5SA 4BR2A 2W2NP 4G65A 4ZVHA 4O8UA 4FL9A 1VCTA 5C24A 3PJXA 1HWJA 4ED4A 3PVXA 2Y8YA 3KJVB 2HNDA 4XTTA 3HDSA 4AL7A 4WKYA 2EEYA 1HNXF 2HURA 1NJXA 3IG1A 3TPQA 3UI3A 4KE5A 4CIFA 2DPIA 3G96A 4X62J 2DIUA 3FFKB 1IKYB 4G1QA 2UXBK 4K4YA 3CCJN 4ZPWR 2MQ8A 3MEKA 1Y10A 2D69A 4E7IA 2FJVA 5AQHA 4HI2A 1V3RA 3KUEA 5EY4A 5J2PB 2H5JB 3U6FA 1B7YB 1KBRA 1X5TA 2VGMA 2CPZA 4HACB 1KTVA 3DMJB 4KO0B 2MSSA 3GILA 1B3TA 1YVUA 2HQDA 3HVWA 4N77A 4IR9A 3W63A 1WOPA 4DG1A 4NLPA 3H5XA 1YIJN 1D09B 5KRTA 2VG5B 4P10A 2O4IA 4JUZA 1C0GA 2QL5B 1B0TA 2MZ1A 2UUAK 1Q7LB 2M70A 1GLEG 4FPRA 4ZHRA 4WQ5C 2RS2A 1NSQA 2QKBA 3VQDA 2Z57B 4L3KA 2HRYA 4ES1A 4DU7A 2JEJA 1S1TB 2CZ4A 4RZRA 1BMQB 4NLRA 4B02A 2PI4A 2BW7A 3VQ8A 4YHHF 1WUUA 2AGOA 2BYCA 4BR9A 2CYYA 3CDWA 4CQ1A 2O8BA 3SXLA 4S0MA 2WTFA 4MH8A 4WCEQ 3CSKA 2OA8A 1D8ZA 1S0NA 2HG4A 1KKHA 4X66F 3X1LB 1QAIA 1QSLA 1R0CB 1P9QC 4RKUC 2XG8A 2GHPA 2I0XA 1UWBA 2XMWA 1GLCG 1QD1A 4WU2A 1SJ4P 2ZHOA 2V2VA 4PXCA 4RUHA 1Q0NA 4JP8A 2UUAJ 2Y1IA 3OYMA 4JV2A 4ED7A 3MDQA 4ELUA 4DCOB 3CCUS 1LV5A 2OEJA 5AQSA 2XY6A 3C95A 4F0HA 1RSCA 3I55S 2HLTA 5KOWA 4NLYA 4PUOA 3DRPB 1NJYA 1IBLK 1FRMA 1YAGA 4DPUA 3MZIA 1XC3A 1NJZA 2JDJA 1CJTA 1E6YA 4K4SA 4K0KF 4CLSA 3BH7B 2H4YB 1PJ7A 4OLOA 1VSKA 2NUBA 4Q8FA 1Y4ZB 4X4NA 3RMDA 2P9LB 1W2BM 4A62A 2P9IB 2Q3PA 3SV4A 2FXUA 4CF2A 4LF1A 1ZAWA 3M8PB 3ZT0A 4EYIB 4K8XA 5DETA 4FLUA 3ZT3A 3BGRB 2DHHA 2RHKA 2CKWA 1SZ2A 3KLIB 2D0CA 5BYRA 4CJTA 5K8MA 4YY3K 1KVAA 3L7UA 3WX4A 2W24A 4KH0B 4OHVA 1IBLJ 4NL5A 1GK8A 3T69A 4UOGA 3V81B 3H98A 2KRBA 2WB4A 1T03B 3H4DA 1DEJA 1FX4A 3ZEUA 4QIVA 1FWKA 2JRSA 4F4WA 5KG6A 2RU9A 3H5SA 3CDBA 2IIHA 4XK8C 1WSIA 1JJ2M 2G8VA 4H4KA 5CA5A 4U8VA 4W5OA 2B6AA 4ZVTB 3AB2B 2XZDB 3E66A 3THWA 5AXKA 1HQUA 4CF9A 2K1RB 1HRHA 4FWMA 3K8VA 1RKIA 4JK8A 2MZSA 2QO3A 5CYMB 5HROA 4GC6A 2XHWA 1N33F 1F5BA 3MM6A 4YY3J 5JLFA 3G0ZA 2DD8S 4FW2A 4JI1F 3QATA 3RMBA 1HI1A 1DTQA 1FK9B 3ZTQA 1F3FA 3V6JA 2G0IA 4O4RA 2BANA 3A5OC 3O9SA 1FXDA 1CJKB 2XMVA 1FKOB 1YJRA 1EB0A 2XSJB 1CJVB 2KQ2A 2PZSA 4KI6A 3FZKA 3NVMA 3A8IA 4C8ZA 1HYZA 3MCNA 4C3MA 2DY1A 3G86A 2OELA 2JSXA 3F56A 3R5JB 2L08A 4OX6A 1RNHA 4MK7A 4K8RA 4RNFA 3KD5E 3VEYA 4F2RA 2XY8A 3THXA 4NLGA 1IBKK 4GV3A 3OTEA 4O3RA 2PSZA 2KXNB 1LK7A 3W2WB 4A8WA 5IQQA 5ADXA 1V4TA 4DL6A 4CJQA 3IR7B 4FKYA 5FLXU 1VSFA 3QIPA 2UU9F 1KN6A 2J76E 2UUBK 1VQKS 4IQMA 4CD3A 3L3CA 1EARA 1KC8O 4ECTA 1EX4A 2V4QA 4G3IA 4H0XB 3HFZB 2P9PA 4JI4F 5KT5A 3HSTB 4DV6F 3KWIA 4OZ0A 5IFMA 4MO5A 4IFVA 1UPPA 3FRYA 4FPIA 1Q79A 3UDCA 5KFSA 2NUUG 3CUNA 1HW8A 4HYKA 1T9UA 2XMMA 2KJVA 1C1AA 5HLFA 1N32F 4JI0K 1IBKJ 2HWHA 5GIPA 2VC0A 2XCPA 4FVUA 2AYGA 1R89A 3D4JA 1K8KB 2K3KA 4B08A 2UUCK 2UUBJ 5BRFA 5K8PA 1YHQS 1RDUA 3N79A 2VPXB 2PY5A 4GC7A 1B9FA 3EKSA 2ZDPA 1FESA 1WOOA 3LO3A 4FLXA 4H4MA 3VTHA 5SWMA 2IVYA 5SZTA 2RQKA 1NJWA 2AYBA 1TELA 2DNOA 4BACA 4DX5A 4C98A 2QWLA 5F9NA 2E1MC 1TKTB 2J7KA 2F8SA 2LQBA 2CJAA 2FJAB 4HHJA 4PYDA 4DR7K 1FRHA 2GJIA 5EX5A 1Q53A 3TI0A 1D4XA 4DN0A 3HF5A 2PYLA 3FFIB 2GIFA 1N52B 2KG1A 4KH6A 4H0YB 4O4GA 4CJ5A 5FJ4A 1FNXH 3DOMA 2L9DA 1SQKA 4IFYB 1TP7A 3J7AN 2IFXA 1ZM4A 5KFGA 3DRSB 4OYAA 2PBDA 3F44A 4OV1A 1VQPN 2ADBA 2YWKA 2J9DE 2RE1A 1IVZA 1FRIA 4OPJA 1QY7A 2R3VA 3GB0A 1ZBFA 1UFLA 4KY3A 5A8RA 4X62F 2RHQB 4NPOA 1MA9B 4RWTA 2ZEJA 2HHQA 3A4TA 5HQ8A 2M7SA 1JLEB 1CS4B 3DLJA 3UR3C 1S1VB 4PWWA 2K8GA 1KC8T 3MMBB 1H72C 4DR7J 5HVHA 2YPZA 2FBYA 3HP6A 3CE8A 5IV4A 4U7CA 5JLHA 3IA0A 5KPRA 4QR2A 4J91A 4JKEA 2P8IA 1NKBA 4O55A 4LF2A 2DNLA 4Y2KA 3DXBA 2ZD1B 3MF5A 2E2NA 4PHTX 4EZ9A 3TR8A 3A13A 3H1QA 3MM7A 3W66A 4JI8K 1HNWK 3AOCA 4OJRA 4ZLPA 4URSA 3EPGA 3GLJA 4KBOA 4KTZA 1YITS 1FCAA 4ECYA 4QS7A 1AZSA 2P9SA 2ZQBA 5HQLA 2XMJA 3OR2B 3DLKA 2UXBF 2CH6A 1Q86T 4ZCIA 4BREA 1Q8LA 2E5HA 1W9HA 1S77D 1RBOB 5IT9O 3QZ7A 4E98A 4CVNE 1K1QA 1XMQK 4BRPA 4DTNA 1RA6A 5ETPA 3SUOA 3D7EO 4DMNA 3TZXA 5GAGI 4CIEA 1BQMA 1DARA 4KV8A 3V9UA 4W98A 5B0CA 4BE0A 3CMAS 3GJTB 3VF4A 2P9KB 1NPKA 3KG4A 3HVTB 4OYBA 4DMZA 2VQFK 3MN7A 1YJNS 2KHOA 4ZCKA 4P2MA 2UUAF 1IR1A 1M5VC 2G13A 4ZK7M 4O3OA 3QGIA 4JI8J 1HNWJ 1M1HA 2CQIA 1RCHA 2GCFA 2QI2A 1I5OB 4JKFA 1GX5A 3HK2A 1WNSA 5AJ3J 3QEIA 4CJPA 4IEIA 5GAEP 1WSGA 4LC9B 1JXVA 4W5RA 2HPUA 3OJSA 3E3XA 3V6HA 1XMQJ 2OTLS 4CJEA 2ROPA 2ZH1A 4LVNP 4FW1A 4CFCA 3KLHA 5KOXA 1S6QB 1BHNA 4C0HA 2AZ1A 2ZGZA 1NMDA 2YNHB 1S7IA 3VQ9A 3FCWA 1KWMA 1A9NB 3PNIA 3SSQA 5AQPA 1NPRA 2W4PA 2LDIA 9RUBA 1S1XA 5IS2A 2DR8A 3UFCX 3B78A 3L4BC 4EFHA 4PG6A 2RQCA 3VAJA 3S41A 5TKWA 4CFBA 5DM7L 3L6QA 3M2UB 2Q36A 3FCHA 1RBVA 4ZOSA 3TUPA 4LSNB 1U7LA 3BO4A 1QZ5A 3H45C 5KT6A 5A8KB 5CCLA 3MCOA 3GFYA 3KLGA 2GQQA 2P9UB 1UZHA 3V9WA 2DHAA 2LEBA 3S6EA 4TY9A 2A3ZA 1JXBA 3AVGA 5HSPA 1V3ZA 2Y3YA 1VC5A 1C2PA 3A3OB 3QNWB 1IBLF 4B1XB 3PFEA 5L8RC 2FC0A 2WHOA 3L7PA 2V2ZA 4Q2MA 5HANA 1ITPA 2ALYB 1S22A 2ZOFA 2JEFA 5KPZA 2WVFA 4G1QB 2BZ2A 1Q8KA 1RTIA 1S9EB 4FWPA 3NF7A 5M2UA 4LBPA 2MMYA 4M5LA 3DDNA 3G25A 1JXEA 1LWFA 3RB0A 4B17A 3VF6A 1NHUA 1R8PA 5KQ8A 1X60A 4E1JA 5CZXA 3KLFB 2MDAA 4O0JA 2I2YA 3D6RA 5G4DA 2PN6A 4ZDNA 1DURA 1GMUA 4YY3F 4CHPA 2W2OP 3HYFA 1MWYA 4NLDA 1I6JA 3RRHA 3VQQA 1ZBIA 4KH5A 2HVDA 5THWA 3VQ7A 4ZA1A 1RDDA 4QWEA 5DDRC 1NKEA 2DFEA 3CJ3A 4ZHRB 1HNVA 3SQ4A 1VS3A 3Q23A 2CNOB 5FDLB 4NYNA 4I7FA 2LLZA 4FSVA 1UEVA 1S57A 4UTGA 3M1FA 3V1RA 4KHPK 1X4DA 1WSEA 1CLFA 3NAEA 2WVDA 3ZCMA 1MU2A 4X4VA 1KHVA 4PYAA 5DM7Q 4MKBA 2VU5A 3PHTA 4EP4A 3RB3A 1FI4A 4EP5A 2O8BB 4DQIA 4FF1A 3VCDA 4DV3K 3ZNUA 4RBVA 3WQTA 4A57A 4ZVQB 5AQRA 1KOHA 2MLZA 2ZBIA 4NZ6A 1TR0A 1N88A 4FNIA 1UWBB 1W0HA 2V50A 3LDOA 3I4HX 3W2VA 2CH5A 4OFZA 4J9KA 4ID1A 2R7SA 3BV8A 2H48B 2DNHA 3KYLA 1FE4A 5DGBA 2W42A 1BDGA 4BRQA 2XLKA 3PX4A 2DXEA 3QGPA 4Y1CA 4J2BA 4NB4A 4KHPJ 2FD2A 3AO5A 4QBUA 1RHKB 4N76A 4DV7K 4ENOA 2CZVC 4CZHA 4CHYA 1VJWA 1O5JA 4X4SA 4I6MB 2CFXA 4JHDB 4YOTA 1VQ9N 2B4VA 4DV3J 3OS1A 4K4TA 1CJTB 1E6YB 1VQON 1IBKF 1U8WA 2IY5B 2IC3A 4O0NA 3GSIA 4IG0A 3N4WA 4HUGA 3G8SA 5AQLA 3NGDA 2BOPA 3TOQA 4DQRA 5IT0A 1SC3B 2UUBF 2JOQA 1YT3A 3T41A 2HFZA 3IGVA 3D1QA 3NNAA 3P4IA 2EXUA 4A2BA 2W4DA 1WELA 1RAGB 3BPSP 2DY9A 3QYYA 1TVRA 3TAMA 1TL5A 4GY2B 1K6YA 4A5BA 4ED3A 5U47A 4U67L 4DV7J 4LUBA 4QJVA 1M5OC 2FY1A 4WFXA 3C94A 4FOIA 1K73O 2E88A 1BQNA 2H54B 4BQZA 4LF9K 2GX8A 1MMNA 5AR0A 4JI0F 4M5GA 1U2CA 3ZEUB 2HBMA 3DXMA 1Y3JA 1EWQA 3MCSA 4P7VA 3G6VA 1RK8A 2UUCF 4ICLB 1MMDA 4DLEA 4OPHA 3OVSA 3ET6A 2XLJA 5GADP 2L3MA 2MKYA 1VQ4N 3THWB 4QS9A 1FJGK 1WOQA 1HQUB 2F65A 3ZSZA 3D6MB 2IVPA 3UD3P 1S6UA 2C3YA 3J81j 2XY7A 3HL8A 5T7LA 2YKOA 1RQ0A 4PG4A 4FO0A 2OFHX 4EI2A 1TAQA 1O13A 5FLXY 1VQLN 2CPYA 3DDKA 4DR7F 4LF9J 1KVKA 2BANB 4CBUA 3D6TB 1U2VA 1LW2A 4LF8K 5AQUA 5M1KA 2ITGA 3GBTA 4WTYA 2WVCA 3DYAA 2YWFA 4FYVB 4C97A 3ZC4A 4MFBA 5D4PA 3SK3A 4BRHA 2KVQE 1X4BA 5F2RA 3W9HA 2R42A 3R9PA 1BCOA 4B3RK 1I51B 2FUG9 1WC1A 2LXUA 5KFFA 3B54A 3C66A 1WEXA 3G71S 1GMVA 3NGZA 3AA2A 1JJCB 4Y00A 1NB2A 3GIRA 2VWBA 5AE3A 5C2DA 3M9MB 3IDHA 4U67Q 2NXJA 3THXB 3C19A 4C8YA 1KR4A 2O8CA 3CM6A 1NZAA 3Q2SC 1EXQA 3JS6A 2D9OA 3HBTA 1VRQC 2QWOA 5G0RA 3QIPB 4IRDA 4DPWA 3TWHA 4HCBA 4CZFA 1HLUA 1KAXA 2R7RA 4AQYK 2FJDB 4BE1A 5E3PA 3VAFA 3QZ8A 1SIWB 4FJKA 2Z0GA 3AQOA 1RDWX 3P6YC 1UA1A 3LP2A 3GE9A 5M2RA 4B3RJ 4IKAA 3BYRA 1P8ZA 1K47A 2DFFA 1QHTA 2P9PB 1QZ6A 4RW7A 4ECXA 5JXSA 4DL3A 1T05A 3EXYA 2QLXA 1NKCA 1CZBA 3IFRA 2QZ8A 1CVJA 1WC3A 3NEKA 4JI8F 1HNWF 2RUSA 4PRFA 2XI2A 2PA3A 1XUPO 3R7SB 3ZT2A 1FRLA 5HLFB 4GW6A 1EAYC 2ASYA 2HHWA 1UZDA 1H7XA 1HD0A 2LA4A 5AZIB 1RT2B 2CNKB 1XMQF 3HHLA 1H2TZ 3HD1A 3KXDA 2LCWA 2XGPA 2EKYA 4AQYJ 2XWYA 1RBUA 2A6AA 3U3YA 2EWHA 2M5YA 4OL8A 2YHAA 3R27A 4BWJA 2VQFF 2VICA 1NGCA 3P96A 3V9XA 1UETA 2D4WA 1N8RT 2LQ5A 4DOZA 1B4SA 4FJ8A 2VQEJ 1R8HA 4FWOA 1RLCL 3ICLA 3OA9A