3KLIA

Crystal structure of unliganded azt-resistant hiv-1 reverse transcriptase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
551
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 131
structure length 551
sequence length 551
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kliA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kliA05
2JEGA 1HJRA 3KHLA 1WAJA 3KKRA 3B6PA 3RMDA 1REVB 3S9HA 4KO0B 2D41A 3O3GA 4FW1A 1DTTB 4W5QA 2FBTA 1S10A 3K5LA 3OYNA 4H4MA 3QYYA 5I42A 4WFZA 3KLFB 1IKVA 2QV6A 2RF2A 3LZIA 2OYQA 1JKHB 3MTKA 3OVNA 5EUHA 3K58A 2BR0A 3CJ0A 4DG1B 5KGWA 3SNNA 3AVJA 3QEWA 1Q8IA 3V9SA 3C6TB 4EO6A 1LWEB 4BWMA 4F4WA 4CJSA 4W5RA 3N6LA 3KLGA 2XCAA 4FJ8A 1S1VB 3P1GA 2W9BA 2HHVA 1BI4B 3TR8A 1UA0A 5C24A 2VG5B 3PZPA 1RTJB 4LD0A 4TYAA 4CJTA 3SFUA 1TVRB 4BDPA 3PHEA 4F4ZA 1VSFA 4KREA 1S49A 4M41A 1MU2B 4NYZA 5HP1A 2E6MA 3LDSA 3SZ2A 1RDDA 1HMVB 3CDUA 4TN2A 2R8KA 3OYHA 3FFIB 1U45A 4DSLA 2JLEA 3SUNA 4EEYA 3DMJB 4OKEA 3H40A 1IKWB 1RCHA 3V4IA 2ILZA 3P5JA 3M8PA 3AVKA 3AV9A 2O5DA 3UQSA 5HRRA 3TI0A 4R5PA 1FK9B 1I39A 3RMAA 5FRNA 1FXXA 3H98A 3LP2A 5J2NB 1ZYQA 1R0AB 4O4GB 3VQAA 1LWFA 3QETA 4ECVA 4NLXA 1T05B 3PUFA 3KJVB 3K5MA 4TYBA 2VG7A 1BQMB 3MR2A 1RDRA 3MR5A 1KFSA 4IR9A 1WSFA 4QAGA 4CEBA 2G8VA 1C6VA 3VQSA 3BSCA 3I8DA 3G10A 1ZBUA 1X9WA 4GMJB 5F8MA 3QLHA 3OYEA 4F8RA 2P1JA 4FLZA 3AA2A 3KLHA 1RBVA 1JLBB 3AO1A 3O3FA 3MEEA 4OPKA 2R8IA 4FJ9A 1NK4A 4DTPA 4KI4A 1HNVA 1S1WA 3OL8A 2X6NA 3DI6B 3E01B 1CSJA 2WOMA 4RNOA 4DLGA 4DL4A 3PX6A 4FW2A 4ZTJA 1VRTA 5CYMB 4WZQA 3TAEA 3DOLB 4XIUA 2FBYA 2YNHA 5DG7A 2DPIA 3HVAA 1QS4A 2VG6A 2RN2A 4CCHA 1X9MA 1LWCB 5KRTA 1JL2A 2OPRA 4ELUA 3CYMA 4ED2A 4OVLA 4J9SA 3TWHA 2AJQA 3NF7A 1VRUA 3H4DA 2Z1HA 1OS5A 1C0UA 4WE1B 4KV8B 2BE2B 1VSJA 2YKMB 4H4OA 4Y2CA 4FBTA 4CGJA 2QKBA 4N56A 2BDPA 3IAYA 3V6KA 4IH6A 4CHPA 2ATQA 4DF4A 4YMEA 3V6HA 3ITHB 1KSPA 2D0BA 4FLXA 2FVQA 2W9CB 3QGHA 4YFUA 4CJ3A 4Y2AA 3DLKB 4ED8A 3O4NA 3WNEA 4QCLA 1DTQA 2ASDA 3Q8PB 3DRSA 3AVAA 2IGIA 4H8KA 4EYIB 4CFDA 2AU0A 3CDEA 3QIPB 4EP4A 1YVFA 1U47A 4PUOB 2R8GA 4O55A 1REVA 4O0JA 4DFPA 4KO0A 4FK4A 4N5SA 3EY1A 1DTTA 1RT5A 3FSIA 3BJYA 1SKRA 1YTAA 2DPJA 1NK9A 3GV5B 3K5NA 1GX5A 3MFIA 1NK7A 3QEIA 3KLFA 3NBPB 3NCIA 3OSNA 1JKHA 3KLEB 2HVIA 1S9FA 1HYSB 5KG0A 3V9WA 4RU9A 4FJIA 4DG1A 2W42A 1CZ9A 2CJQA 3LZJA 2R7YA 3ZSOA 1J9AA 1LWEA 4AH9A 3EPGA 4HKQA 3SV4A 4I7FB 4CIFA 5J2MB 3K2PA 5KFDA 3RWUA 3GV7B 2HVHA 1BI4A 4XPCA 3BSNA 4U7CA 4Y3CA 2VG5A 2XHBA 4CGFA 1RTJA 5CYQB 1WSHA 1NKEA 4BE2A 1TVRA 4J2BA 1TV6B 3OYMA 4E7KA 2BQUA 3DLBA 1JLCB 1MU2A 4Z4CA 1SL0A 1HMVA 2UUWA 4DFKA 3FFIA 3UDLA 3OL9A 2JEFA 4WXWA 5KFQA 1JLAB 1NNDA 4LH5A 4DTNA 3OYBA 3RAXA 3F73A 4CEDA 4TXSA 1IKWA 1JLGB 2JGUA 1KLNA 3SQ2A 3QESA 4CJLA 4IH5A 1JL1A 4C8LA 2HMIB 2FJXA 1FK9A 4IRCA 2YHBA 3VQQA 2G8WA 3MF5A 5T14A 5J2NA 1R0AA 4CJEA 3DOKA 4O4GA 4DMNA 2X78A 1VSMA 2DFEA 4WYWA 1T05A 1U49A 2HHSA 3KJVA 4NLGA 1BQMA 1RTHB 1MMLA 2OA8A 3S3NA 4QWBA 4C8NA 4Y1DA 3LAMA 1KHWA 5DQHA 2ATLA 1CXUA 3O4QA 1NK5A 1LAVA 4Q5VA 1JLFB 2HAIA 2XY5A 1WN7A 1RT2B 2W8LA 3NL0A 1LAWA 4K8XA 5HBMB 3H5XA 4DLEA 3GQCA 4M45A 1JLBA 4EBDA 1RDAA 4LQ3A 3LP0B 4O0IA 4WFYA 1NOYA 4IKFA 5K14B 2HNDB 4M3YA 2YNIB 3PY8A 3ZT4A 1UWBB 2GIQA 3LPTA 3SYZA 1S1XB 4NLTA 3DI6A 3E01A 4CGHA 4ECTA 2ZD1B 2RKIB 2PYLA 3HKWA 4IG0B 4DTRA 2FBVA 2O4GA 5CYMA 3DOLA 1QE1B 3LPUA 4F2RA 4FK2A 4J9QA 1RBUA 5FRMA 1TK0A 4DSIA 4KBIA 4KHYA 1LWCA 3OJUA 2DFHA 3DRRB 4FJJA 3CWJA 5KFKA 4YR2A 3DLHA 3MXIA 2I5JA 4KI6A 4FZXC 2XI2A 4OKKA 1UAXA 1C0TB 2FJWA 3MEGB 4KV8A 2D3UA 2YKMA 1QAIA 4QPXA 4U6PA 2E4LA 1C1BB 3ZSVA 4ED1A 4ZHRA 5F9NA 1I3AA 3ITHA 2W9CA 2IMWP 1N5YB 1N4LA 1CXQA 3M8SA 5E41A 4NCAA 3LWMA 4OGEA 4OL8A 2XY8A 2ITGA 3DLKA 3HPGA 3RMBA 4Z4IA 3MECB 4ELTA 3QIPA 4Z4EA 4IRDA 4PUOA 3QIDA 1NK6A 3SQ1A 1TKDA 1BHLA 3ZCMA 1S48A 1BCMA 3QGIA 5HRNA 5KFXA 2ETJA 5DK5A 3KHGA 4OPJA 4DU3A 4BDZA 3HJFA 3NBPA 1JXEA 3KLEA 3V1QA 2AX1A 1HYSA 4KHSA 1GOCA 3ISND 4ECSA 4Q44A 1NHVA 4DTOA 3LANA 1SUQB 5KT7A 3V6DB 4B8AB 2OH2A 4OLBA 5DG8A 4IRKA 4J2AA 4CEFA 4I7FA 2G8UA 5J2MA 4MIBA 3KHRA 1W25A 1RDBA 4K4YA 5HRSA 1LW0B 3DLEB 2X6SA 4E7IA 5CYQA 2W7OA 2Z1GA 1VSKA 1TV6A 1T94A 3TQ1A 2R8HA 4B08A 5F8HA 1JLCA 3RB6A 3Q8QB 2CKWA 5F8NA 2R2RA 4CF2A 1KVAA 3TAPA 1JLAA 4FJHA 1QTMA 4DL5A 2G8KA 4DU4A 1KFDA 1TK8A 1U4BA 4I2QB 1JLGA 2ZE2B 2UVRA 3BSAA 3L2WA 1GX6A 1KVBA 2HMIA 4NCBA 4KB7A 3EZ5A 1SKWA 3CFOA 4KSEB 5EWEA 3AA3A 4J2DA 5KG4A 4CEQA 4QOZB 3H5YA 1ZETA 1S1UB 3KLVA 3QERA 4OKJA 1RTHA 1ASWA 3AA4A 2IM2A 4HCBA 4HUFA 3KOAA 4B9NA 3HO1A 3AVGA 1XC9A 4JS4A 1TP7A 3CQ8A 2Z1JA 4ECRA 4O5BA 4IFYB 1QSSA 1RT2A 5KFIA 4KB1A 3HHKA 3LP1B 2BGGA 1KVCA 4N47A 4I9QA 5HBMA 4JS5A 4FXDA 5KFCA 3QZ8A 5KFNA 1B9DA 3CJ2A 3ZT1A 4C8KA 2FC0A 1F21A 3LP0A 1ZTTA 5K14A 2A1SA 2HNDA 2YNIA 3THVA 2Y1JA 4FLVA 1UWBA 1S1XA 4ZVGA 3NH2A 3AO2A 4RW8B 2ZD1A 2RKIA 4E0DA 3QO9B 1U04A 2QK9A 4CGGA 4WZMA 3G0ZA 3GIKA 4FZYA 4CERA 3CJ5A 3NDKA 1HYVA 3SPZA 3EZUA 4RNMA 4EZ6A 3DRRA 3IG1B 4AHUA 1HNIB 4GW6A 1J53A 2KW4A 4O3SA 4PY5A 2GIRA 1JIHA 4O3OA 4ECYA 4AILC 3MEGA 3AVLA 4FYDA 5KT4A 1N48A 1WSIA 4CFBA 5KT6A 1QHTA 3ULDA 4FK0A 4I9LA 1EETB 1GOBA 1C1BA 3V6JA 5L9XA 3K5OA 2RPIA 2BQ3A 4BDYA 4CF0A 1N5YA 4KHWA 1SV5A 2J6TA 4DTMA 2IA6A 1TKTA 4JV2A 3C95A 3GIMA 4ZP8A 4B9UA 3WNGA 4CHOA 3S3MA 1KRPA 1IH7A 3ZSXA 3TVKA 1QSLA 4ZP7A 1XR5A 2F8EX 4I2PB 3TAMA 4QWDA 1L3SA 3DLGB 1BIZA 4NLRA 3GYNA 3UR0A 3ZSZA 3OYAA 4MK7A 4ZPDA 5KT3A 2UVVA 4KE5A 3PO5A 1S9GB 1RA7A 2BQRA 1SUQA 4CHQA 1L3TA 1JX4A 4NRUA 3V6DA 5KFWA 4B9LA 1D9FA 5CZ2A 2AGQA 3H5UA 3RB4A 4K4VA 3NGDA 2BRKA 3NF9A 4RUAA 4IFVB 4RW9B 2P5OA 1LW0A 3DLEA 1RTIB 3T5JA 3H2LA 2XY6A 1EKEA 5L1IA 1RNHA 4FJXA 3HVWA 3OLBA 5JUMA 4FM0A 2VWKA 1NJWA 2HNZB 1NK0A 3K57A 4RNHA 3MEDA 3KTQA 3OSPA 1ZBHA 3MR3A 4K50A 5DLGA 4R0EA 4CIGA 5SWMA 2C22A 3DM2B 2W7PA 3PR4A 4ECZA 4RG8A 2D5RA 1ZTWA 4CEZA 1IM4A 2W8KA 3BR9A 4I2QA 3IN5A 2G8FA 2ZE2A 3HVTB 4AHRA 5KG7A 1A5WA 1A5XA 3AA5X 3NHGA 3ZSYA 3T5HA 3H5SA 3OYDA 4F4KA 4ZVEA 3RRHA 3QEXA 2IM3A 4AHCA 2DFFA 3DLRA 1S97A 1RT6B 4FLWA 2Y1IA 2PYJA 4O3QA 3HYFA 1S1UA 3M9OB 4J9PA 4MKAA 4B9SA 3HL8A 1EX4A 1C1AA 3RMCA 4W5OA 4ZPCA 3VQ7A 1D1UA 4OGCA 4MIAA 5KFOA 4FLTA 2C28A 5DLFA 1ZBFA 4Q0BB 1S6QB 4QWEA 3VQ4A 4IFYA 1UOCA 1RBSA 2VA2A 3LP1A 1A5VA 4QW8A 3L2RA 4DEZA 4CHZA 2XCPA 4JRPA 2WB4A 4XPEA 4E7HA 2HNYB 2XO7A 1C1CB 5HLFB 2P5GA 4EP5A 3TARA 2OPSB 1YVUA 3QEPA 2QE5A 3ZT2A 3PX0A 3TABA 2KFNA 5KRSA 3V81B 4RW8A 3C6TA 1RT3B 4CGIA 3HM9A 4K4WA 1RT7B 1HYZA 4DWIA 1X1PA 5J2PB 3QO9A 1S1VA 3PW0A 2D0CA 3FQLA 3KMSA 1D8YA 1TL1B 3T1AA 2HW3A 3TAFA 3S3OA 1JLEB 2IC3B 4O44B 2PZSA 4DSEA 4G1QB 4MK8A 5F8GA 3IG1A 4CE9A 1ZBLA 3HP9A 4F4YA 2GBZA 1TKZB 4K4UA 2O4IA 3KMQA 3OYCA 1RT1B 2KZMA 3M8RA 3VQ5A 3OHAA 1EETA 4MH8A 1HPZB 3DMJA 4NCGB 1BIUA 5EWFA 3H08A 4CF8A 3KD1E 1NHUA 2WRMA 3ALYA 3VA0A 5KFPA 4CJWA 5KT2A 4HUGA 2AX0A 3I0RB 2FVCA 5DQIA 4J9MA 1QSYA 1RT4B 1ZBIA 1WSGA 1C0MA 3UIQA 4CGDA 1S6PB 3BQ0A 1DLOB 4IDKB 5D3GB 1TGOA 3FDSA 5KTQA 1WSEA 2LSNA 2IAJB 3AVBA 1IKYB 4HTUA 4TSXA 5JS1A 3JYTB 3VQPA 4I2PA 1I6JA 2R2UA 1KCFA 3JSMB 3DLGA 4URQU 2BANB 3RRGA 2WTFA 1D0EA 3HSTB 1ITGA 3AVMA 1S9GA 1L3VA 1J54A 4FS2A 4FM2A 3PO4A 4NLSA 3PV8A 1TL3B 4WXOA 4FJNA 3KLIB 3FQKA 1Q9YA 5DMRA 4J9RA 3NAHA 4QWCA 1U09A 4DL3A 1VSEA 2FVRA 1XHXA 4CK1A 2ILYA 4IFVA 4KFBB 4M42A 4RW6B 4FJLA 4RW9A 2R2SA 3ZSWA 2JEIA 3CFRA 1RTIA 3NF8A 3LP3A 4KKOB 2HWIA 4CEAA 1T03B 3V1OA 3BDPA 1NK8A 2HHQA 3OHBA 1KLMB 4K8ZA 4J9NA 5HROB 3Q8SB 3VQ6A 3KIOA 3SQ0A 4TY9A 4M3RA 4BE0A 3DM2A 3QEVA 1CZBA 3AO4A 2YKNB 3KLGB 2YNGB 3HVTA 2W9BB 4CECA 2XRIA 3I0SB 3PW7A 3A2FA 4Y34A 4HYKA 4DTUA 3QNOA 3Q8RB 1RYSA 4ZP9A 4WE1A 1NJZA 2BE2A 2VWJA 3SPYA 3OJSA 3PR5B 4KHUA 1S1TB 3I5AA 2D7SA 2HHTA 4DSKA 3KHHA 4H54A 3SI6A 4C8OA 3ZSQA 4RW4B 2FVPA 2R8JA 3VN5A 1TK5A 2FLLA 4NLDA 5FDLB 4Z4GA 4Q0BA 1FKOB 1S6QA 3RR8A 1HQUB 3KK3B 2RDJA 2E6LA 3N6MA 2BRLA 1W0HA 4QW9A 4WYLA 3LALA 2GC8A 2AGOA 3NH1A 3HPOA 4PQUB 5KFAA 2KQ2A 3L3VA 3NGYA 4MK9A 2HNYA 3G6YA 1HRHA 1C1CA 1NJYA 5HLFA 4NLYA 1LWFB 2IM1A 2DY4A 2Z1IA 3AVFA 3G86A 2B43A 3GIJA 3G6XA 2OPSA 1FKPB 4FCYA 2VG7B 2R2TA 5KFBA 4GC6A 3BGRB 3V81A 1XR7A 5J2QB 3VQEA 1RT7A 5KFFA 3PW5A 4RZRA 5J2PA 2DTUA 4TQSA 3H59A 4Q43A 5EWGA 3T5KA 4IBNA 3PJWA 2E9RX 4JRQA 3T19A 1N6QB 1HQEB 4J9KA 3DRPB 1JLEA 2IC3A 2W9AA 5C5JA 2KTQA 3CFPA 3AO3A 3T3FA 3VQDA 4MFBB 5KFZA 4KB0A 3ASMA 2FBXA 1Z4UA 4NRTA 5L1KA 1RT1A 4IH7A 5CY4A 5C25B 4JV0A 2P51A 1HPZA 4K4ZA 2YV0X 4NCGA 3NAEA 4E1MA 5HRPA 2X74A 5I3UB 3I0RA 4DSJA 5KG3A 2OPRB 4XO0A 3V9UA 1RT4A 3M9MB 3OS2A 4CJ4A 2AQ4A 3OS0A 4DL7A 2IBKA 3RBDA 4MQ3A 1S6PA 3KK2B 2OPPB 4CFCA 1VRUB 1SL1A 4ED6A 1DLOA 4IDKA 5T7BA 5D3GA 1WSJA 2YNFB 3OYIA 4E7LA 2IAJA 3RAQA 5KFVA 3SCXA 1IKYA 4KTWA 3WNHA 3AVCA 3JYTA 4CHYA 1BGXT 4O3PA 3JSMA 4MKBA 2OZSA 1L5UA 2BANA 2EX3A 1JLFA 2QXFA 2IDOA 2V4QA 1JLQB 4KTQA 3BQ2A 1TL3A 3QNNA 3KLIA 1D9DA 2F96A 3CG7A 1RDCA 3NE6A 1SL2A 3L3UA 4B9TA 1NKBA 4KAZA 4ECUA 4UQGA 4LSNB 4NLUA 1RBTA 4KFBA 4HUEA 4DS4A 4RW6A 2JC1A 1RT5B 4JUZA 3HPHA 5CZ1A 3OS1A 1CLQA 2B6AB 4IG0A 4KKOA 4DTXA 4CJQA 1Q9XA 4WFXA 4PA1A 1T7PA 1QE1A 4ED3A 4FJ7A 2G8HA 1T03A 3VQCA 3D45A 3BSOA 4ZTFA 3I5BA 1KLMA 5HROA 1VSHA 4DU1A 3NAIA 4E1NA 3M8QB 3L8BA 2D0AA 3HT3A 2WCXA 4ELVA 2YKNA 4JLHA 5C42B 1JXLA 2YNGA 2IJNA 1QQCA 3I0SA 2WHOA 1C0TA 4F2SA 4CESA 5KGXA 4CJ5A 4ZP6A 2WONB 1XHZA 3DYAB 5SZTA 5EU7A 4BE1A 4EYHB 2XC9A 5KFLA 1S1TA 2IOCA 1L3UA 5DGAA 1BISA 3MR6A 3VQBA 3O3HA 3BREA 3NKYA 1SKSA 3OL6A 2F8SA 4RW4A 1IKXB 2GUIA 2PY5A 2B5JB 2Q3SA 3IS9B 1HARA 2XI3A 2J6UA 3QIOA 1U48A 1K6YA 4FJ5A 3MECA 5FDLA 4O3NA 1FKOA 4Q8FA 4FJKA 2AGPA 1TAUA 3GIIA 2G8IA 1HQUA 1NJXA 4DTJA 3KK3A 3MFHA 3KK1B 4URSA 4K4XA 2HB5A 3SUPA 3HVRA 3H4BA 5KFSA 1WAFA 4PQUA 4RNNA 3SUQA 3DOKB 4NLOA 4LSLB 3RB3A 2F8TA 3PW2A 4ZPBA 1FKPA 2EC0A 3CJ3A 1IO2A 1TQLA 3BGRA 5J2QA 4DL2A 4ID1A 3VA3A 5KFGA 4R8UB 3NH0A 4YNQA 4BWJA 3ZT0A 4Z4HA 3NGZA 1N6QA 1HQEA 1S0OA 5KG5A 4FM1A 3DRPA 4IKAA 3NF6A 4EBCA 1S9EB 3TANA 3OYFA 3NFAA 3I5CA 4OJRA 4YQWA 4AHVA 3D28A 4MFBA 2NUBA 4FJMA 4E7JA 2WK4A 4KPYA 4L8RB 2OPQB 4B9VA 4GC7A 4LH4A 1J5OB 4J2EA 4PWDB 4TQRA 5C25A 2YHAA 4ZVFA 3D0PA 3VQ8A 1S0MA 2HHXA 1S5JA 2V4RA 3V1RA 5I3UA 5KG2A 1Y97A 1BL3A 4CFAA 4DL6A 5J1EB 4ZPAA 4N76A 4CHNA 2I5JB 4RUCA 3KK2A 2OPPA 4IQXA 4QWAA 4F3OA 3E51A 2YNFA 2UUTA 4F3TA 4NYFA 4EBEA 4CJVA 1BQNB 1B9FA 4ID5B 1QAJA 1GOAA 1KTQA 1XI1A 3OYGA 1LW2B 2UVUA 4AHSA 4NLQA 1RTDB 3B6OA 3EPIA 4ZHRB 1TKXB 2FVSA 5DQGA 3FRZA 4M3XA 1JLQA 3P83D 3RR7A 5KFTA 4DQQA 4X2BA 4JV1A 1VSLA 1XR6A 3LAKA 4B3OB 4URGA 2XWYA 3ISNC 3PX4A 3OY9A 4LSNA 4ECQA 1EXQA 3TAQA 4O4RA 2JEJA 4CJUA 3U6FA 3CM5A 3AVHA 1RYRA 4FJGA 3OYJA 3C94A 2B6AA 3ZSRA 4HVJA 1WNEA 4TY8B 5JS2A 1N56A 4M94A 4BACA 1RA6A 4CK3A 5F8IA 4CJPA 2FJVA 2E9ZA 4E19A 3M8QA 4ECWA 3V9ZA 5KG1A 4NZ0A 3PW4A 3L2UA 1HNIA 4FS1A 1RBRA 5C42A 3QGGA 4FVMA 2KFZA 4Q8EA 3K59A 1ASVA 4KAIA 3MXMA 3N6NA 3GILA 4M3WA 2WONA 3DYAA 3IRXB 3DDKA 3CJ4A 4KHRA 3U3YA 2J6SA 4DFJA 5DGBA 4FBUA 4DS5A 2D3ZA 2ZKUA 2FLPA 4RW7B 5KFRA 1IKXA 1ASUA 1S0NA 2B5JA 4F4XA 4ICLB 4KHNA 2HWHA 3IS9A 1EP4B 1K1QA 3V9XA 4YR3A 4C8MA 2A1RA 4W5NA 3QINA 3C6UB 1Z25A 4HHTA 4CJKA 5JXSA 5KFYA 3GV8B 2IM0A 3KK1A 4G3IA 1SH3A 4LY7A 4IG3B 3MAQA 4DQIA 4O3RA 1NOZA 4LSLA 1S4FA 2OZMA 3M9NB 4EO8A 1XWLA 5KFEA 1B92A 2C2EA 4FLYA 4HCCA 4R8UA 1WNSA 1D5AA 4TLRA 3AO5A 3SI8A 1BCOA 4YR0A 4F50A 2UVWA 4K4SA 3SQ4A 3PVXA 1T8EA 4NLWA 1S9EA 4H4MB 2JC0A 1G15A 4KHMA 3CM6A 5I42B 4B8CA 5F8LA 1IKVB 2RF2B 4EZ9A 3T5LA 2HNZA 4IOBA 3HK2A 1T3NA 4M3UA 4DQSA 1WLJA 4ZMMA 2OPQA 4Y1CA 1J5OA 2AWZA 4PWDA 3KD5E 4K4TA 4DQRA 1QUVA 1TAQA 1Z26A 4CEOA 4W5TA 4CF9A 5C24B 5KI6A 4NYNA 4J9OA 2HHWA 3ICLA 5J1EA 2FLNA 3SJJA 1NKCA 1YT3A 3CIZA 4LQ9A 1YTUA 5HP1B 1RILA 3AVNA 3SUOA 1IG9A 1RT6A 3RTVA 4KHQA 1BQNA 4ID5A 2RDIA 3SV3A 3UPFA 2C2DA 2I1RA 2B4JA 5KFJA 1LW2A 2C2RA 3EYZA 2KZZA 4M95A 3V4IB 4FLUA 1RTDA 3RB0A 3D5MA 2IJFA 4OLAA 5L1LA 3M8PB 1TKXA 5KFMA 1SV5B 4R5PB 1SH2A 1O1WA 4DFMA 5KG6A 4DTSA 1TKTB 5L1JA 3MXJA 3LP2B 4Z4FA 4B3OA 3OYLA 3CO9A 1VSIA 4RNFA 3BQ1A 3OYKA 4CIEA 3IGVA 3ZT3A 5FROA 2XY7A 5F9LA 4E3SA 4DQPA 4B9MA 1X9SA 1RT3A 2ASJA 4IR1A 3TAMB 3U3GA 4CJRA 4CEEA 4J9LA 1UA1A 4TY8A 3AVIA 1K1SA 1TL1A 1W9HA 1JXBA 2ZQBA 1KHVA 3QLHB 3LWLA 4O44A 4G1QA 3CDWA 4NLPA 3OLAA 4CK2A 2E9TA 3KLHB 4Z0UA 4GVMA 3MEEB 1C2PA 4FZZA 1TKZA 4CF1A 4KRFA 1RAJA 1HNVB 3HXMA 3L2QA 1S1WB 3IRXA 3KKSA 4E89A 2WOMB 5DG9A 4ED7A 2XGQA 5EDWA 3IGNA 1VRTB 2ASLA 2YNHB 2VG6B 4M3ZA 4RW7A 2V0NA 3MEDB 3TAGA 3PJXA 5KFHA 4ZVHA 2QKKA 3NGIA 4Q45A 4ICLA 4N41A 1EP4A 3SFGA 5KT5A 4CJFA 2IS3A 5KFUA 3KNAA 2EHGA 3C6UA 3L2VA 2XGPA 1VK0A 2VA3A 1C0UB 2ALZA 3WNFA 2HHUA 4H4OB 5F8JA 1LV5A 3CVKA 3QZ7A 4IG3A 2GV9A 4NLVA 3NMAA 4ED0A 4DF8A 4YP3A 1VSDA 4DSFA 4ECXA 3G6VA 3RBEA 1SH0A 4M3TA 4AHTA 4KTZA 3VQ9A 2V9WA 3F9KA 3OL7A 1DTQB 3HP6A 3DRSB
chains in the Genus database with same CATH superfamily
3PIPQ 1VQ6N 4KH0B 1REVB 4AXJA 2D41A 2F4VF 3CNQP 2RHSB 1ZH5A 5E3PA 3OYNA 4H4MA 1X5SA 1OO0B 2E7VA 5I42A 1SC6A 3ENHA 3KLFB 3VVTA 4OX9F 4J9UE 2ZF5O 1JKHB 2DIUA 3G8SA 3OVNA 5HL7Q 1QQOA 2Y1RI 2DHXA 5KQ8A 2BR0A 1HL6A 5A2QU 3SNNA 3KFWX 3AVJA 4MDBA 2Z2ZA 1JWWA 2LEAA 2X1BA 1XC3A 3TZWA 4TVAB 3J7Z5 1NH8A 1LWEB 4CJSA 4G6VB 2XCAA 4FJ8A 1BI4B 3OT9A 5HK4A 5C24A 2VG5B 1NGBA 4JP8A 3BBBA 1H7WA 3PNIA 1TVRB 3GG0A 3O1WA 4MLHA 2HWTA 2I7NA 4F4ZA 2CFXA 2E6MA 4QR1A 1ZAXA 5HVFA 3C7NB 1HI1A 3AA9A 4TN2A 2Y9HA 3SUNA 4UY8T 2R7QA 3DMJB 3FCWA 4LF8J 4OKEA 1IKWB 1RCHA 3PIOQ 2RMLA 3D2EB 2D3OR 3SDEA 5EX5A 3CCTA 1VQ8N 1YBTA 2O5DA 1FK9B 1YJ7A 3A3PB 3H98A 3OR1A 2RE2A 3AJ1A 3EWGA 4WCEL 1R0AB 1VQOS 2RIJA 2HKEA 3VQAA 3THWA 3CCJN 3TA2A 1N88A 1UKUA 2NRRA 1T05B 5BR8F 3MN6A 1BQMB 1VIXA 4BC3A 5FPDA 1IWGA 2G8VA 4C8ZA 4ES3A 2Z0GA 4I68A 2ZHAA 4U8VA 1X9WA 4JI6K 4D3GA 4P6QA 3W1YC 2PFDA 4H5NA 3WIVA 4FVUA 1RFQA 1RBVA 1WEZA 1PBAA 5AXMA 3CQXA 3UDCA 2CIMA 2UXBJ 4KI4A 3A5MC 5C10A 3DI6B 5K8OA 1AFIA 2GGPA 2WOMA 1N33K 4ZTJA 2DBBA 1VRTA 1BD6A 2P9KA 1UTAA 4AL5A 3HVAA 3LGHA 2VG6A 1CPZA 1X9MA 4G9ZA 3G25A 1LWCB 1HX1A 4ED2A 1RTZA 2B56A 2VDHA 5IWAK 1VRUA 2FGOA 4ZVPB 3NLCA 2Z1HA 5M1QA 1GLBG 4WE1B 1JNRB 4Y2CA 3IAYA 1ZOTA 2BDPA 3V6KA 4EU0A 5AQQA 4GKKF 2ATQA 4DF4A 1ZXOA 3V6HA 1NMDA 2D0BA 2FVQA 1JJCB 4G1PA 4OV6A 2O8CA 1WELA 1NSPA 4H0VB 3WNEA 1NDLA 1NG9A 4H8KA 4EYIB 3CDEA 4BVPA 2NRHA 3MM5B 2R8GA 3D2FA 4KH6A 4DDFA 1DTTA 1NPPA 3FSIA 1SKRA 4X64J 1HD0A 2DPJA 3HSDA 4UT4A 2FSNA 4CLYA 4C7QA 3EKSA 5AQOA 3QEIA 3PKMA 3AB2B 3IR7B 1HYSB 2MQMA 1URNA 4DG1A 2W42A 2CWKA 4NASA 2EBEA 4Z94A 3LZJA 3EX7B 3MN7A 1Q16B 5AQYA 3WXMB 4FYVB 2YWWA 4LF6J 2DY1A 4XPCA 3BSNA 2ZH1A 4QS9A 3QRQA 1K8KA 2YPZA 1NXIA 1ZM3A 3DLBA 1HNZK 3MEKA 1SL0A 1R43A 2CGLA 3MMCB 1NNDA 3M2UA 4OYPA 2XULA 3SCJE 3J81U 1FFWB 4IO1A 4TXSA 2CPHA 2HHHK 2V2QA 4AE5A 3FZ2A 3BPDA 3K0JA 4CJLA 4J7CA 2KRBA 2HQIA 4C8LA 2HMIB 4OMFG 5AE1A 1RXOB 1RZMA 2B0GA 2XSJA 5T14A 4L6V3 4CLFA 2K3KA 2L48A 2Q2RA 5K8PA 2ZJPQ 2DGSA 5J2NA 3J7YI 4X62F 4DJBA 2H5IB 1YRTA 2DFEA 1RWOB 2NR0A 2HOEA 5F41A 4FSVA 4NLGA 2GWJA 1RTHB 1SBRA 1PKUA 5G0RB 3JAMY 1VQLS 2QO3A 3DXBA 2GFFA 3CJRA 4JK7A 4Y1DA 3GJRB 1FX2A 1UZDA 1NK5A 1CXUA 3O4QA 4Q5VA 1EJ7L 3BF1A 4RL1A 2HBYB 3NCPA 2CADA 1YUWA 1KR4A 5AQTA 4NI2A 4A57A 3VF6A 4K8XA 2LXFA 4P72A 1FDBA 1H74A 3CQYA 2KXFA 2QA1A 2XMVA 4ILLA 4P2XA 4WFYA 1NBEB 3O6WA 4M3YA 2XO6A 1UWBB 3F0NA 4QJVA 3LPTA 3SYZA 1N34K 3KG1A 5ETRA 2PYLA 3HKWA 4DTRA 2O4GA 3DOLA 2XYGB 1QE1B 4F2RA 4AFFA 1RBUA 3MM9B 5K9FA 3FLCO 2AV5A 3KUGA 2P9LB 1SPBP 4CO4A 3BKTA 2NSBA 2VGMA 2I5JA 2XMKA 3O08A 4OKKA 1UAXA 4MYTA 3W5ZA 4HI1A 2D3UA 2NYHA 2YKMA 1K8AT 1J6ZA 2H51B 3ENWA 1QAIA 4BR2A 4U6PA 2G2YA 1DY3A 2KVIA 1C1BB 3X1LB 4ZDNA 4HI2A 1SQFA 4ITSA 3ITHA 2J0WA 3R1XA 3D6FB 2IMWP 4LRAA 1N4LA 1CXQA 5M1KA 3L7OA 3LWMA 2ITGA 3DLKA 3FC9A 1HW9A 2XHCA 3RMBA 4Z4IA 3O9RA 3MECB 4ELTA 5ETTA 3QIDA 3L4IA 2MQQA 1TKDA 3ZCMA 4EHUA 3QAUA 5CD4A 3KHGA 2HRTA 5AQXA 3JTPA 3HJFA 4WK3A 5E33A 3OTOJ 3V1QA 4KHSA 4ECSA 1IJFB 1NHVA 2CVEA 2W2PP 4ED4A 4BHQA 1N8RT 2VPZB 3LANA 3NGTA 2ZITA 3V6DB 5A6PA 4B8AB 4OLBA 3LF0A 1YSJA 4JI6F 4CEFA 1RABB 4I7FA 1R8BA 3DLEB 2X6SA 3EEQA 1RLCL 5GADU 1P90A 3KKFA 1P9YA 2FHJA 2Z1GA 4GY2B 2P2CB 3TQ1A 2PBDA 2R2RA 3MWTA 4LF4J 4CF2A 3RBZA 1N33F 3FZLA 3CC4N 3UDEA 2G8KA 4BR7A 4H0OA 1IG8A 5HMWA 3H2VE 2ZE2B 3L2WA 1GX6A 1KVBA 2CUYA 2KYZA 5IWAF 4QU7A 4FDFA 3C2PA 2JZ5A 2X7IA 2XHWA 4QOZB 4C23A 3E1YA 2Q36A 1OH7A 1S1UB 2EC2A 3KLVA 2CJAA 2W4CA 2FSJA 2BMBA 3AA4A 2IM2A 4HUFA 3HO1A 3KOAA 2PA8D 1YJUA 2AMCB 1S4EA 3GSDA 3AODA 3THTA 3HHKA 3L0QA 4LR7A 4M5KA 2PI5A 5KFNA 1VJQA 2LECA 3ZT1A 3HTVA 1F21A 2QLFB 5K14A 2HNDA 4RLEA 3VAFA 5F2RA 4GVBA 2FF6A 9RUBA 1S1XA 2IVFB 3NH2A 4RW8B 2KVQE 1DJ0A 4DUYJ 1LK7A 3J81j 2QK9A 4CGGA 3GIKA 4A61A 4CERA 2OSQA 3FE1A 3CCUS 2GHPA 4DV3K 1ILYA 4EZ6A 3DRRA 3E9PA 2HLUA 2VL1A 2JSXA 3VAHA 3FGUA 4ES1A 1X5PA 4O3SA 2E5HA 2GIRA 2H54B 2W41A 4BROA 1TL7B 5KT4A 1RKJA 3R5JB 1V4TA 3ULDA 1HD1A 1HNZF 3GCXP 3C8YA 2UUBJ 5L9XA 1NLVA 3NWRA 3E66A 4BDYA 4CZJA 1N5YA 3GR0A 2PEBA 1EKRA 1EKSA 2JWKA 2HHHF 4WP9A 2Y0BB 5LJVA 5AE3A 5TKYA 3NOCA 5LJWA 1VQ5N 1OQ6A 3S3MA 4DPOA 2W1BA 1IH7A 4Q2LA 2XMMA 4I2PB 3O4WA 3UVJA 1SJ3P 4L75A 2N7YA 3UR0A 4FWLA 1OSCA 4QZVB 4ZPDA 5KT3A 3M2VB 5E2QA 2QWRA 1YJNN 2BQRA 2IRXA 1L3TA 4CHQA 2Q3PA 4JOUA 3BO3A 3O9SA 3RB4A 4K4VA 4LIWA 3JB9k 3I56S 4RW9B 2P5OA 1LW0A 4DV1J 3NGUA 4JKGA 3U8XA 1HBMA 3JQKA 5HAOA 3H2LA 2YQ3A 3T5JA 3CD6N 1N54B 3D6RA 2N3OA 3LDLA 2Q43A 2BM0A 1N34F 2GJFA 1HWJA 2R7XA 5AQHA 1VQSA 2NZCA 3OSPA 4K50A 1I1GA 1QVFR 3PR4A 4DR3K 2D5RA 1ZTWA 3U1NA 3BR9A 4I2QA 1CS4A 1FDDA 3AA5X 3H5SA 4ZVEA 3RRHA 3ENVA 4AHCA 3QEXA 2OHDA 2HF3A 3ISZA 4OJ3A 3DU6A 1N32J 2RJZA 1RT6B 4FLWA 1X0FA 4OIXA 2W25A 1RBOB 4B9SA 3HL8A 1EX4A 2F9DA 2OMOA 1VQ4S 1SJFA 4OYWA 2CVIA 4OYIA 4QWEA 3VQ4A 1PYTA 4U7UK 3OVBA 2WFBA 2BX6A 1Q81T 3LP1A 1WOSA 1YTYA 1A5VA 4L3KA 3L2RA 3OBIA 4DEZA 5HLFB 4ZLJA 3GFHA 3QEPA 4LFAK 2QE5A 4L76A 3PX0A 4BS2A 3V81B 1S1VA 1AFJA 2D0CA 4U8YA 3CJQA 5KAKA 2AP1A 1JLEB 4O44B 3TU5A 2PZSA 4ZS6A 2JFDA 5D77A 4JAXA 4JK9A 3IG1A 1UCNA 4HT5A 4F4YA 5E3AA 2YKOA 2RE1A 4P7TA 5I3QA 2V9KA 4Y2IA 2IIHA 4PXDA 4ZVQB 3OHAA 3KJNB 2AF6A 4NCGB 1QJHA 2CZVC 3ILOA 3AOBA 3VA0A 2G4BA 5KFPA 5H9EJ 2GQCA 2AX0A 2OUGA 2YH1A 1Q5YA 1QSYA 1RT4B 1ZBIA 2Q6BA 2ERRA 4X65J 1T44A 1IBMJ 2KL8A 4HTUA 2HFNA 2M2BA 3VF2A 3LDQA 3WHIA 2YWHA 1YBUA 3JSMB 1UETA 3VCDA 1V3RA 3IBWA 1CULB 1U8WA 2BANB 2DT9A 1RHMB 2HS4A 2X1FA 1ITGA 3AVMA 1S9GA 5E84A 4H0YB 4FM2A 4FS2A 3BO2A 3PO4A 1TL3B 4FJNA 3KLIB 3FQKA 4QWCA 4A8OA 1U09A 1HI8A 4A8SA 4DL3A 1VSEA 2EEYA 5EXWA 1XHXA 3ZNJ1 1AZSA 1S7IA 4FJLA 1UVKA 4UW2A 3IA0A 4BC9A 3D3BJ 2HWIA 1OWXA 3TUIC 2L41A 1T03B 2RSQA 2HHQA 3OHBA 1GXTA 4DR7J 3SQ0A 4TY9A 2J0SD 5IQ6A 4DUZK 1XERA 3AO4A 4CH7A 1FKAF 1HIYA 1VC0A 3KLGB 1M5PC 1NO8A 2CJBA 3HVTA 2W9BB 3PW7A 1RQ0A 4Y34A 5E0OA 2OGUA 1RYSA 4DV3F 1RWUA 4IOCL 2RHKA 1FTRA 3SPYA 2HG4A 1S1TB 4X4QA 1GLLO 1OJ4A 3SI6A 4A2BA 4RW4B 3U27A 2R8JA 2P9NA 5M1PA 3NXZA 2ZJQQ 3EGNA 1VC6A 3M6GA 2XQCA 5FDLB 1OY6A 4Q0BA 2P9SB 3M32B 4AD6A 5A0YB 2R7RA 3TR5A 1FHTA 3KK3B 1NAQA 5A2QY 1GMVA 2WW4A 4YS2A 3MMBB 3LALA 2GC8A 2OD6A 2XNRA 5KFAA 1OH8A 3P8BB 4ZVUB 4NLYA 4WP3A 2B8QA 2DY4A 2Z1IA 3JXOA 2R2TA 4GC6A 3BGRB 3C15A 5AQKA 3PW5A 1R59O 4RZRA 4TQSA 3T5KA 2XMWA 1F3VA 3IP0A 3CB4A 1N6QB 2RRNA 5CZXA 3MWBA 2IC3A 2GX9A 4IWVA 2LXUA 2AJ0A 5B7WA 3CFPA 3AO3A 3T1HK 4EI2A 3VQDA 2FJDB 1BOTO 4NRTA 5L1KA 3MOJB 3GPAA 1KAZA 2P51A 1UEVA 1HPZA 1T9TA 1U6FA 3NAEA 1NZAA 4E1MA 4P7VA 1JMTA 3O2IA 2AYGA 3EE8A 1OQ3A 2VOOA 4DR3F 5AZIB 2GW8A 2YXLA 2W2QP 3JSRA 3OS0A 2DHSA 2CPJA 2DRAA 4BG9A 1NGEA 3TA0A 3S6EA 4IDKA 5D3GA 1WSJA 4CO2A 4E7LA 4Q7AA 2PMWA 2D1KA 3L95X 3SCXA 1IKYA 1TL5A 3WNHA 3ELHA 1CJVA 5SUHA 3QMLA 3AH6A 4CHYA 1BGXT 2KG0A 4MKBA 3ZZUA 2KRRA 3RW7A 3OUYA 2V4QA 1JLQB 5BN9A 3BQ2A 1D9DA 3CG7A 1T02A 4WF9Q 3OR2B 3NE6A 1EO1A 1RAIB 2UP1A 2XLKA 4UQGA 5JLFA 3LM9A 2HS0A 4HUEA 4JUZA 1RT5B 4U95A 3CJKA 3ZX3A 4DXLA 4AT1B 4IG0A 1Q9XA 2V2KA 3TOQA 4LFAF 3PSIA 2CQCA 2QA4S 4DU1A 3NAIA 3QT5A 2NLWA 5D4OA 2G1DA 3GFZA 4HVZA 1QQCA 3R8EA 1FESA 1R31A 3PACA 4N8NA 3I0SA 2WHOA 2C2OB 4YB1P 3DYAB 3R6MA 3M6VA 4BE1A 1ZM4A 1K9MO 2P9PB 5DGAA 2BZ2A 1BISA 2NNWA 3VQBA 2DHAA 3BGUA 1E4FT 3TSPA 3NKYA 2EKYA 1PAUB 2RD5C 3CCZA 2J6UA 3QIOA 1U48A 4FJ5A 2ZWPA 2YKQA 4NWBA 2OD4A 4JI1J 4O3NA 2AD9A 1FKOA 3HI9A 4JYAK 2VQFF 2Y8WA 1TAUA 2VFSA 1OPIA 2G8IA 1HQUA 1ZBSA 4URSA 4K4XA 3A8EA 2KKZA 5KFSA 1HBNB 1RAEB 3DOKB 2RB7A 1W2BR 3H1VX 2F8TA 4WYBA 2GS8A 4W90B 1LEOA 1V5IB 4PG8A 1TQLA 3A13A 3CJAA 2VQEK 2DGWA 5AFUA 3B78A 5EHHA 4DL2A 4ID1A 2ZDPA 2KXNB 1ITPA 4BWJA 2KLAA 1HQEA 2CRLA 4M63A 3DRPA 4CWBA 2DCUB 3O8WA 4ES2A 2MB0B 1R27B 1VQ6S 2M4MA 3J81Y 2Q1LA 2MQLA 2CZ4A 4MYUA 4CW7B 4MFBA 1NZ8A 3LQVA 2OEJA 4E7JA 4YY3J 3C65A 4C1NI 4FWNA 4TQRA 2ZH3A 3ZZOA 2E1AA 4FKYA 1S5JA 1VIOA 1JJ2M 4DUZF 2Z2MA 5I3UA 1BL3A 1VC5A 2G2ZA 4QIFA 2AHOB 4IQXA 4DV5K 2J9DE 2HZAA 4LR8A 3F9MA 3WIUA 1B9FA 4M1KA 1UFLA 2EVZA 2ZBRA 4AHSA 5IT9O 2YH0A 2P9IA 1GLJO 1UEKA 3EPIA 3A1YG 3T7ZA 5DQGA 4DMZA 1Y9OA 5FLXO 3P83D 3RR7A 1LKZA 3MM7B 4DQQA 4JV1A 1D4XA 5B0BA 2GHWA 3ZZZA 3GJSB 1DZ5A 1M5KC 3GE1A 1NH7A 1VQ8S 4PG6A 2B4PA 1F9EB 2OTLN 3U9DA 4BR9A 3R9LA 2JEJA 2CH5A 1UVNA 2RRAA 3OYJA 4KH5A 1ZM9A 3NG8A 3CCLS 4JYAJ 4DHVA 1WNEA 3MTJA 2GAHC 5BRDA 4BACA 3MCPA 4CJPA 4DV7F 2VCPA 2M8DB 3N4WA 4CT9A 3VESA 2FJVA 2F40A 4BRAA 4E19A 3M8QA 3TSUA 5KG1A 1FD2A 1RBRA 3M5RA 3QGGA 1KQFB 2V8VA 4RWXA 3M1VA 2MSSA 1Q7LB 1ASVA 1BLUA 2ZNYA 3N6NA 1KAXA 3EZOA 1P6TA 3T1HF 5DGBA 1S77D 4CQ1A 4X4SA 1CC8A 4RW7B 1ASUA 3G96A 3CEDA 1WC6A 2EFGA 1QQNA 4ICLB 1HKGA 3GBTA 3M2RB 2A1RA 1WDDA 3BN4A 3BZKA 1VISA 5JXSA 3KG0A 2IM0A 4DHYA 4LY7A 1QQMA 4A46A 2UUAJ 4DQIA 1YVNA 2J76E 3AXKA 3W66A 1BWVA 3POTA 3CPWM 4N7TA 4BVOA 5KFEA 2I38A 2WBRA 1NGCA 1Y11A 1LQ9A 2E8AA 4P75A 4U67Q 2DYAA 4R8UA 2HYIB 3B6BA 3AO5A 3SI8A 4KR0B 3PVXA 1WWHA 4A8XA 3IMQJ 3P6YC 4H4MB 5ETLA 3CM6A 3FZKA 3AQOA 5I42B 2BJEA 1G3OA 2CNNB 1S3XA 3JS9A 2Z2YB 5JVGQ 4H5VA 2VC0A 2PIIA 3SQGA 3HK2A 1XMOF 1T3NA 2CQ1A 4DQSA 2FZGB 5AQRA 4ZMMA 1DRZA 3KUHA 4CZIA 1WKLA 1RHQB 3HZ6A 2JWLA 3W65A 4DQRA 2LQ9A 1TAQA 2IPOB 4DR2K 2EWHA 5C24B 2HLTA 3DWLA 4NYNA 4J9OA 1GMWD 4M5HA 2ZVIA 5J1EA 2FLNA 4O8KA 4H5TA 1YT3A 3AVNA 3AT1B 2N7CA 5F1XA 3SUOA 1S57A 2VASA 4JI8K 1R8AA 3ID6A 3BY5A 5U47A 5KFJA 2X3GA 1XTZA 3EYZA 2C2RA 1NJIO 4M95A 2IHR1 4FLUA 1TR0A 3D5MA 3SDEB 3E3XA 1SV5B 1SH2A 4ZVOB 1ZZNA 5DM7Q 1I5OB 1E6VB 4Z4FA 3OR1B 3CO9A 3THWB 2Z30B 5B0AA 2M52A 4QBUA 4LSZB 2XY7A 5F9LA 2QZ8A 4IR1A 3M3ZA 4J9LA 1B3TA 4KGZB 1DT9A 1J5EK 2NPFA 3AVIA 3QT6A 4JI7K 2ZQBA 4OX6A 2VQEF 2G1HA 2D0OA 4G1QA 3OLAA 1RU1A 2DR5A 3CHWA 3FBEA 2E9TA 3PFOA 1Z2LA 5A8RA 3O6QA 1C2PA 4FZZA 1TKZA 3WEEB 3HXMA 1NPKA 2UXDK 3IRXA 2GGPB 4E89A 4NXNJ 2WOMB 4ED7A 4HHHA 1VRTB 2IJRA 3V4MA 2P9KB 1WSRA 2VG6B 4M3ZA 3CCEN 2BOAA 3OTCA 2ATCB 1I51B 3NGIA 4LF7K 3A5LC 5EX3A 4N41A 1EP4A 1QDUB 2H9ZA 2FUG9 2IS3A 1D09B 5KFUA 2RS2A 3LO3A 3D1OA 3L2VA 3QFHA 2BJ1A 1VQON 2VA3A 2LCWA 2ALZA 2HVEA 1ICEB 3FVYA 1VK3A 3CVKA 4DV5F 1F9HA 3NMAA 1AB8A 3M30A 1N0VC 4DR1K 2RQCA 3G6VA 1LFPA 1WTBA 1F2GA 3N4PA 4M3TA 1GAOA 5BREA 3T9ZA 2O8CB 1KVKA 2O8FA 2QSWA 2E5IA 5LMUK 4LFCK 2V9WA 2APOA 3K2YA 1TZ0A 3EKUA 3EM1A 2JEGA 3KKRA 3B6PA 4A8MP 3RMDA 2FDNA 3D2FB 3VGUA 2QI2A 1XNQK 1DHMA 4OZJA 1DTTB 3CXCM 1S10A 2G13A 3K5LA 1HR0K 4NL5A 3QYYA 1GLEG 4WFZA 4L74A 4ZN1A 1IKVA 1F3FA 3MTKA 3W60A 2NSCA 3NS7B 4DG1B 2HQFA 5KGWA 3Q7BA 2CG4A 1HLUA 3WX4A 5LSOA 1Q8IA 3V9SA 3ADAC 5HMZA 3EO3A 2FHMA 2HGMA 1CEZA 4Y6IA 3P1GA 2E2NA 2CPDA 3DXSX 3MM6A 5IQQA 3OVSA 4DQ8A 1T9XA 3UN2A 1MWZA 3SFUA 2VFUA 4BDPA 3MPYA 3PHEA 4JI7J 1HI0P 2DNNA 1S49A 4M41A 4NYZA 3LDSA 2P6TA 2YJFA 3CDUA 2M88A 1QAXA 2I9SA 2NPIA 1U45A 1UPMB 1SXLA 3M2UB 2QN6B 4V19S 5LL6Z 2JLEA 1KN6A 4P9SA 2KHOA 3V4IA 5HN0A 2V52B 2VBXA 1WG4A 3AV9A 1ZA2B 1OH5A 3TI0A 5HRRA 4BGAA 3CC4S 1NLKL 1IBKJ 4HACA 2XSJB 5J2NB 2HHPA 3PG9A 1LWFA 2V51B 3H3OB 3K5MA 1WC5A 2VG7A 4ANDA 1TUWA 1HNXK 1RUSA 2FPHX 4QAGA 1EWQA 1IVZA 2OKQA 3VQSA 3BSCA 5D0HA 2E7WA 2NZTA 1ZBUA 3M05A 4GNIA 5F8MA 4AXIA 4DV4K 4FO0A 3QLHA 3OYEA 4NI2B 4FLZA 1X5TA 2UU9K 3RU0A 1X31C 4BC2A 1M1HA 3DOMA 2MJUA 3NS6A 2BUNA 3MEEA 3N28A 4OPKA 4I64A 2CQBA 3VEOA 6FDRA 3CC2N 2B4VA 4DV2J 3I6PA 3OHRA 4DLGA 3HSCA 1DURA 1X3NA 1LNQA 3TAEA 3DOLB 1SC3B 2YNHA 4HEA9 2IIRA 1QS4A 4CCHA 2ZNZA 3TX0A 2H4YB 3CYMA 2ROGA 4DR2F 3J7YU 1FJGK 2AJ4A 2RU9A 3NF7A 1WG5A 2KO1A 4WCEQ 3H4DA 1C0UA 1SJ4P 2BE2B 2YI1A 3EVMA 2YKMB 4H4OA 3K5PA 3HSZA 3RYLA 4FBTA 4K25A 3WUHA 2C2MB 4N56A 5D4LA 5EGYA 4MDAA 3MGJA 3MDQA 1G99A 1IQTA 1FXRA 4YMEA 4HHJA 2PD1A 1N5SA 3ITHB 2P9EA 3IWXA 1KOOA 4JI8F 4YFUA 2VJVA 3SAGA 1V6HA 5L46A 5H9FK 3D7EO 3DLKB 3MUMP 3N79A 4JI3K 1DTQA 2ASDA 3Q8PB 1GLAG 4CFDA 4X66J 4DFPA 4KO0A 4B3RJ 3BJYA 1X3MA 2AJFE 5LXYA 1NK9A 3GV5B 5EX0A 2N4DA 1NK7A 1FD8A 3DC2A 4X4PA 5GIPA 5HATA 4OZNA 2HVIA 5KG0A 4RU9A 2DGTA 3J80Y 1CZ9A 1W2IA 1NGHA 2VZ9A 2JL9A 3ZSOA 3A3OB 4CBUA 4JKDA 2NUUG 1J5EF 2HAFA 3EPGA 3KDNA 4I7FB 1VLYA 4CIFA 3K2PA 3RWUA 3GV7B 1YJNS 3R3LA 1JK9B 1SVDA 4U7CA 4Y3CA 1FF2A 2LQBA 3LUYA 1RTJA 1WSHA 1NKEA 4BE2A 2WUSA 2A3ZA 1FWPA 1VBKA 4DV4J 3QQCD 1MU2A 3VQTA 2LU1A 1HMVA 2UXDF 4DFKA 3B4DA 3FFIA 3AHPA 3PEHA 3TVYA 3Q7CA 2V69A 2GMHA 3IBFB 2F9JA 1FO1A 3ZETA 4OI3A 3OBYA 1BMQB 4IH5A 1IXKA 4LF7F 1JL1A 4N77A 1SZ2A 1M1GA 4IRCA 3VQQA 2YHBA 4IYQA 3MF5A 2DHHA 2CPXA 2R7WA 1WORA 2RT3A 1WTFA 3EDRB 2A42A 1BWFO 2ZZTA 4TNOA 1KONA 1VSMA 4GRSA 2WVEA 1SIWB 1U49A 3ZZYA 3CULA 1XJWB 2OA8A 4QWBA 4DR1F 1KHWA 5DQHA 2AEFA 2BJ9A 2ATLA 4WWSA 2DEJA 2HAIA 2BJ8A 3FEZA 2OELA 1WN7A 5LMUF 4LFCF 2MPUA 1NGDA 2P5VA 1GQEA 1LAWA 4LT6A 5JJBA 3VVUA 2LQ5A 2DXEA 2YQ1A 4DR5K 5HQLA 3CE8A 4M45A 2W4PA 4EBDA 1XNQF 1RDAA 3I32A 4LQ3A 5K14B 4YHHK 4K5RA 2HNDB 1HR0F 4GKJJ 1VAZA 2ZKTA 4M8LA 1Z6RA 4GVBB 1S1XB 2X1GA 4NLTA 4X4OA 3E01A 4ECTA 2AJ1A 2OO4A 2KH9A 1CG2A 1UVJA 4MKVA 4J9QA 3J80O 2OTJS 1TK0A 3CCVN 2QWLA 4KBIA 1BWEA 3OJUA 2QLBB 3DRRB 4FJJA 3CWJA 3MM8A 4LR9A 2W4DA 5LMNJ 3DLHA 2KJVA 1FNMA 4FZXC 3JSBA 1EQMA 3G2XA 3F41A 2HRUA 3BUZB 1P27B 3A8IA 1PGZA 1PJ7A 3ZSVA 4ZHRA 1I3AA 2W9CA 1N5YB 2O3DA 3R97A 4ZJOA 4OL8A 2QMWA 2IYGA 3O5TB 4IOAQ 2AYMA 3QIPA 4IRDA 2YX4A 4PUOA 4NEYA 2RQMA 1LFWA 4DR4J 5GINA 1BCMA 5HRNA 1R0BG 2ETJA 5DK5A 1SB6A 3UVJB 2K2PA 3KLEA 1VYAA 3NP5A 3ISND 4WIIA 4KYZA 1WHWA 4DTOA 1HNXF 1DQAA 4F67A 5DG8A 2H1YA 4J2AA 2F5GA 3EDQB 2E2OA 3HHDA 4MIBA 4ZPTR 2J5AA 1W25A 1HBUA 2UU9F 2DO0A 1LW0B 4J37A 3F2KA 4E7IA 4KBOA 4JKGB 1HBMB 2IVYA 1TV6A 4IEEA 1T94A 5CAAA 3ENAA 2ZBCA 2R8HA 2ZM6K 5F8HA 1YQHA 5F8NA 2PI4A 3OXFA 1WBDA 2EI5A 1KVAA 1U1QA 1JLAA 2GZOA 2M70A 2XLJA 1F2HA 4DU4A 3HRGA 2ADBA 3Q22A 1U4BA 4I2QB 1JLGA 2UVRA 3BSAA 2EXUA 1CS4B 1DAXA 2XEXA 2DTJA 4WQ5C 5CQGA 3SJHA 4NCBA 4DBQA 4ERDA 1FJGF 1SKWA 4C0BA 3CFOA 5EWEA 3OW2R 3AA3A 3A3NB 4J2DA 4A4JA 5KG4A 4CEQA 1ZETA 4OKJA 2YWFA 1ASWA 2CGJA 2ZGYA 5F0WA 4JK8A 4B9NA 4UY85 3AVGA 1XC9A 4JS4A 2UZAA 1BO5O 4FPRA 2Z1JA 4O5BA 4F26A 3MX5A 4DN0A 3CERA 3LP1B 4JI3F 1SIZA 2KU7A 3I56N 3DGVA 2X3DA 1O0PA 4I9QA 3R27A 5HBMA 4LF5J 3HHNB 4BBYA 4FXDA 5KFCA 2B9WA 2CQHA 3TW0A 4C8KA 3WXJA 5C0YA 2EG1A 1ZTTA 1U8SA 2YNIA 3MPDA 3THVA 2JFKA 4ZVGA 3AO2A 1U0SA 2W40A 2D3O1 1YJTA 3VERA 4PG4A 1U04A 4WZMA 3TEGA 2J4RA 3SCKE 1XNRJ 2C3MA 1HWIA 3DAWA 3EZUA 2B7CB 3IG1B 1NMNA 2CYYA 1HNIB 2IDLA 1O5JA 4PY5A 4C48A 1WSVA 3K17A 2OI2A 1LOUA 4AILC 4FYDA 1VDHA 1WSIA 1QHTA 4FK0A 3EJMA 4EMDA 2F9TA 3LW5C 4KHPK 2ZH2A 2DH7A 1VQ4N 4OYOA 1JXVA 5JMVA 4LRBA 1TKTA 1DKGD 5T41A 3UW1A 3GIMA 2XZTB 4B9UA 1H2TZ 5HMXA 4AM6A 3P5BP 3Q2SC 4BR0A 1NHKL 1YKWA 4JI5K 1VS3A 2C2ZB 1FI4A 5DJBA 1QSLA 2YQ0A 3VEVA 2J7UA 2F8EX 2PFUA 4QR2A 4RCHA 1GTHA 3TZYA 1BIZA 3ZSZA 1SAZA 1FXDA 2GVZA 1Q53A 3PO5A 1S9GB 2F3JA 5ETNA 3AD8C 2F7VA 1JX4A 3HHLD 5AXLA 3AARA 5CZ2A 4BRKA 1I94K 5B09A 3CJSA 4PKGA 3NF9A 1AZSB 4RUAA 4OJGA 1NSKL 3Q0AA 3W9HA 4DR5F 3FCHA 4A5BA 4FWPA 3FSXA 1X7VA 4YHHF 3BP8A 4F3MA 1A9NB 2HNZB 3H1QA 3K57A 4ZVRB 3CC7S 4RNHA 4HHUA 1IUJA 3KTQA 3WZ0A 4CIGA 1RB0A 2GVDA 2XS5A 4OHVA 1R8PA 4M5DA 2W8KA 3L6QA 3IN5A 3HVTB 3H8YA 4AHRA 3I9V9 1A5XA 4UOHA 1R7IA 2FB0A 4RR5A 2J9EA 1LXNA 2WVBA 4JN4A 1X4BA 2X1AA 3PRDA 2A40A 1D3WA 4BRNA 2DFFA 3DLRA 3SIPB 4AQYJ 2Y1IA 5BYSA 4O3QA 1YGYA 3L9ZA 2P9NB 4J9PA 4PG5A 1A7GE 5BYQA 2ZFHA 4LC9B 3RMCA 4ZPCA 4OGCA 2E20A 4MIAA 2YHWA 4F7VA 2C28A 1X4CA 4Q0BB 1YJVA 4HTIA 1NU4A 2VA2A 4MO5A 4QW8A 4XPEA 4E7HA 4DR6J 2XO7A 1Y64A 3HZEA 2P5GA 3RSEA 3CJ7A 2KFNA 1PC4A 3C15B 3HM9A 4DWIA 2HMPA 1WKJA 3I31A 3FQLA 3QICA 1TL1B 3QSYB 3R2DJ 2YBVA 1NGJA 2HW3A 1H2VZ 2IC3B 4B1UB 3TQEA 4DSEA 4MK8A 1TMMA 2B9XA 4U67L 4NXMK 2A2CA 1I3OB 1WF0A 3HP9A 1VQYA 2AP6A 3HCXA 1X60A 3I4PA 5F0UA 3OFHA 2EFPA 2V4JA 2FSKA 4KGXB 1YF5L 2LDYA 1S72N 1TELA 1EETA 2ZM6F 4PPDA 4MH8A 1HPZB 3DMJA 1K9MT 4QYZK 5EWFA 5JVGL 1KDNA 3KD1E 2F1FA 1N36J 4CJWA 2QRRA 1KAYA 2FVCA 3BGFA 5L39A 4BLGA 2WSFC 3H6EA 1WSGA 3DXMA 4WU2A 4HT7A 4FF3A 4IDKB 3C6HA 5D3GB 1TGOA 5ETSA 2LSNA 3AVBA 1IKYB 4K5SA 1CJVB 2OAUA 5JS1A 1C4CA 3VQPA 3D6MB 1KCFA 4URQU 2VDIA 1VGYA 1VQKN 4Y65A 2QWMA 1D0EA 3OUYB 1YIJS 4NLSA 4OI0A 5DMRA 4UUXA 3NAHA 4J9RA 2CPEA 2PA3A 2WAQD 1IBLJ 4Y00A 2DNZA 3EGVA 4LF9J 1KQGB 4CK1A 4BGBA 2ILYA 4HR2A 4M42A 5DM7L 3CJKB 2R2SA 3CFRA 4DV6J 1RTIA 2H65B 4B1WB 2LVWA 2A5XA 1PYSB 2P9GA 3V1OA 2F4VJ 2VOPA 3NWGA 4J9NA 1KQSR 1Y00A 2GELA 1U2FA 2PO4A 1SS6A 4OX9J 2MLYA 3VENA 3LA0A 1MROB 3IWLA 3I0SB 3PRVA 3A2FA 4HYKA 4M5LA 4ZP9A 4WE1A 5BPNA 3PR5B 1VHXA 2G9OA 1FWKA 1TUVA 1P8GA 2HHTA 2OCEA 3KHHA 4C8OA 2KI2A 3ZSQA 4GV3A 2FYXA 2RILA 3VN5A 4CJ7A 2CJKA 4KHPF 1TK5A 2MKHA 5DZ6A 1Y5IB 4ZJQA 2UYTA 4NLDA 4BC5A 4C6AA 4H03B 3MM5A 1FKOB 1S6QA 5CH7B 3GZ7A 2ROEA 2RQKA 3W2WA 1KC8O 1FERA 1HQUB 3AJ2A 1EWRA 2RDJA 4QYZJ 2BRLA 2LU2A 2GHVC 3CJCA 2CQ4A 3OFEA 1PCAA 3R6GB 3ZTSA 2E88A 1RWVB 3G6YA 1HRHA 1NJYA 4NX9A 4JI5F 3FZMA 4OYBA 3AVFA 3G86A 2B43A 3GIJA 3G6XA 2OPSA 4FCYA 4ZCLA 4RKUC 2QA4N 1NM2A 1RT7A 5D0GA 5J2PA 4Q43A 2R7OA 1XQSC 4IBNA 3PJWA 1X5OA 2LYVA 4JRQA 1HQEB 4M63C 2V5HG 2DHGA 3DRPB 4I0WA 2BUPA 2W9AA 1I94F 3MMVA 4IOCQ 1CLFA 3Q8UA 3QFWA 2NXNA 4OYMA 4QPTA 3VAJA 4MFBB 4PR6A 3NVMA 2FBXA 2WBNA 1NSQA 3P45B 3I33A 1RHJB 1K73O 3SAHA 5HRPA 2X74A 5I3UB 3I0RA 2HSEB 4JI0K 2OPRB 4XO0A 2BEFA 3V9UA 2OLWA 2KN4A 4USUA 2HSTA 1O8BA 2XYHB 1NMEB 3DNCA 1U1RA 2V8GA 2V50A 2N4CA 3OYIA 4NO7A 1QHAA 5KFVA 5DRKA 4KTWA 3A0IX 3W3SA 1RWXB 1APSA 4O3PA 2VC1A 2E1YA 3ULEA 2P9IB 3IAM9 3ZO7A 4LFBK 4OX7A 2MJNA 2QXFA 2IA0A 2HK3A 3KUEA 5ETKA 1KTVA 4CM2A 2P9CA 1AW0A 3CDBA 2Q6CA 2FC8A 4GKKJ 2PSZA 1OY8A 4X4VA 4NLCA 4NLUA 3NCQA 2BOPA 3DGPA 4KFBA 3BF4A 1VQ9S 5CZ1A 4TU8A 3OS1A 4R79A 4WU3A 4JV5K 1F5AA 2QTDA 4PA1A 2HFUA 3MN5A 1T7PA 2MKSA 1QE1A 4PKIA 4BRPA 3D45A 2RDDA 4MIWA 3FMBA 5HROA 2HK2A 3H42A 1X4AA 2HPUA 5ADZA 3M8QB 2QWNA 4QU6A 2ITMA 2W2MP 1WC0A 2YKNA 4JLHA 4JD2A 1JXLA 2MEWA 3M1VB 2N3LA 4M5IA 4CJ5A 4ZP6A 4NXMF 4OZLA 1XHZA 5EU7A 5M1NA 1HHQA 2Z56B 3O3HA 2PY5A 2YPYA 1F5CA 4AL6A 3J8AA 2IVNA 2VYPA 1TL4A 3GWCA 3MECA 4NYPA 3R7NB 1NJIT 3FBFA 4PKDB 3B54A 4U9RA 3CCES 3H20A 1JNZB 2AGPA 3GIIA 3NMRA 2ZBIA 2N82B 3HVRA 3H4BA 1WAFA 2DRBA 4PQUA 4B3MK 1FRJA 3CCLN 3NOGA 2R7TA 3UWTA 1U2VA 3HSJA 3RB3A 3POTB 1EZZB 2HIQA 3D68A 2Z57B 2DISA 4X62J 3N01A 4R8UB 1AA1B 3GG4A 2R42A 4F25A 5M1OA 3NGZA 2MQNA 1S0OA 3UNYA 5KG5A 4FM1A 4IKAA 2NRWA 4EBCA 3TANA 3S41A 2UUCK 3EVWA 1ZPVA 4A8QA 2XYPB 1BDGA 4EAHD 3TUPA 3I5CA 4OJRA 1Y5LB 5CE3A 3D28A 2P9UA 4EGLA 2XNQA 3SQGB 5HMYA 1RKIA 5HO4A 2BJ3A 3TJ8A 4FJMA 3CCWA 3PYDA 2IDEA 4L8RB 1B4SA 3ID8A 4J2EA 3HSGA 5C25A 4ZVFA 3QB0A 2R3VA 3W7BA 3D0PA 3VQ8A 2HHXA 3IBCB 1N5QA 5KG2A 4YUDA 1RE1B 5HQ8A 4C0OC 4FPAA 3D67A 4BR4A 5J1EB 1WHXA 3MN9A 3WQTA 1RWWB 4N76A 4AUKA 4KPCA 4OPAA 3KK2A 1WI6A 4F3OA 3E51A 2UUTA 4EBEA 1T11A 5ADXH 1QAJA 2CJ9A 3OYGA 2UVUA 1DARA 4JI2K 3AAPA 1DEJA 4X2BA 1R0CB 3IFEA 1VSLA 3SMZA 3LAKA 1E3MA 3KDOA 3QPIA 2DD8S 4C4WA 5AQGA 5IT9U 2XWYA 3ISNC 2BBEA 3PX4A 1SC4B 4LSNA 1XMQK 3LH2S 4O4RA 5FLXU 2VF3A 3CM5A 3AVHA 3PFEA 1RAAB 2MLXA 3L09A 2DNRA 3OFGA 2D9PA 5AXNA 2F9WA 4CK3A 4DPYA 1YRUA 2O67A 2AA4A 4FPBA 4ECWA 2HFZA 3PW4A 3L2UA 4BR5A 5A8RB 4CM0A 3K59A 4KAIA 1EX8A 3MXMA 3MR7A 1U25A 4K41A 3IRXB 1K0TA 3DDKA 1U1LA 1SCJB 4KHRA 3U3YA 1UJ6A 1YZ7A 3QT8A 1YRXA 3DJCA 1Y4ZB 4JI6J 2QL5B 1TYQA 4BC7A 5KFRA 3CC2S 1ULRA 1S0NA 4NZ7A 4F4XA 3R6LB 2KG1A 1REGX 2HWHA 1EP4B 4C8MA 2JOQA 4MO4A 3EE3A 4KGKA 3CMQA 3D3CJ 3K8WA 1RCXB 4OO1J 1WOPA 4HHTA 4JI0F 1T9UA 4FNIA 1N33J 3U9ZA 3BPSP 5KFYA 3KK1A 4G3IA 1SH3A 3JSYA 5HQMA 2E1MC 1HJOA 3RVCA 4BRHA 5D6GA 4O3RA 3M30B 3AOAA 1S4FA 1QVGR 4ZVSB 2OZMA 3M9NB 4EO8A 3O9QA 2O8FB 5IWAJ 4LFBF 4CH0S 3LDNA 4LREA 4YN3B 4HCCA 4PL8A 1U2RA 1D5AA 4TLRA 4YR0A 4F50A 2ACMA 4MAKA 4IOAL 3OD2A 2QFJA 4CZGA 4B8CA 2XWXA 1IKVB 4EZ9A 3MMAA 4IOBA 5AQUA 4M3UA 4JV5F 3K9KA 5FPMA 5DO2A 1X4HA 4Y1CA 2AWZA 1U1KA 3SEOA 4PWDA 4K4TA 2JDJA 3UDVA 4DB3A 2FJEB 4K0KK 1Q8LA 3A8JA 4BC4A 4CF9A 3LL3A 3MM6B 1FW6A 2HQGA 1W7WA 5KI6A 3CUNA 3NMUA 2HHWA 4S0MA 2HBQB 3OBWA 3LDPA 3SJJA 3HLUA 1NKCA 4LQ9A 1RP5A 1WB9A 1YTUA 4ZPWR 3RBXA 1IG9A 1RT6A 2M5YA 3RTVA 2BKNA 1HWKA 2A0FB 1IR2A 4ID5A 5KOXA 3SV3A 2JHEA 4CIOA 2C2DA 3B8HA 3N9UC 2B4JA 1LW2A 5EN1A 3V4IB 1RTDA 2R4FA 1OH6A 3RB0A 4OLAA 1E6YB 4DCPB 2EFNA 4HACB 4ZA1A 1HNZJ 1DFDA 5L1JA 2QIFA 4PABA 3BQ1A 2CNLB 3OYKA 5GAGP 3HHLC 3J7ZO 2HHHJ 4B3MF 3TAMB 4CJRA 2MDAA 4CEEA 2GWKA 5KPTA 1UA1A 1KKHA 3UCUP 1HNWK 4BRMA 4L72B 4UOFA 1K1SA 4CZKA 1VR6A 2ZC3A 2V7YA 1W9HA 2MQ8A 1SQKA 3QLHB 5IFMA 4O44A 1VK8A 2IVPA 4NLPA 3EGZA 4CK2A 3DOMB 2RHQB 4NA3A 4Z0UA 3ZX2A 2C3PA 3A12A 4B3SF 2PMHA 1V5VA 3DN9A 5DETA 4BRCA 3MEEB 3PYFA 4CF1A 2UUCF 1ESVA 1RAJA 2KT5A 3TWZA 3L7UA 4USWA 4RPFA 4DV0K 5DG9A 3G4SN 1FVQA 3W61A 2ASLA 2YNHB 3PTWA 3KWMA 4CT8A 4RWWA 2V0NA 3VWSA 1ZPWX 3IO1A 3MEDB 3AJDA 5KPZA 3CD7A 3PJXA 1XN9A 2ZUGA 4OHYA 3SFGA 2RS8A 2EHGA 2PN6A 4OV1A 1N34J 1YAGA 2ZVSA 3QJPA 1G4CA 3CCVS 1N0UA 1VK0A 2IVOA 1C0UB 2GAGC 2F65A 3WNFA 4H4OB 1LV5A 9ATCB 1FCAA 1T95A 4IG3A 4I56A 3D0HE 4NLVA 4ED0A 4DF8A 4YP3A 2H4WB 3HDSA 2CZ9A 3THPA 5HVGA 4LMZA 4CLSA 4AHTA 3VQ9A 2Y8YA 3F9KA 1DTQB 1OIAA 4JHDA 4JI2F 3HP6A 3KHLA 1WAJA 2PT0A 3S9HA 5AQMA 4KO0B 3O3GA 4FW1A 1BXNA 4CLWA 2VH7A 2ADCA 1ZZFA 4E98A 3AY0A 1DQ9A 4F0KA 2VB6A 5L9NA 1XMQF 4A5AA 2OYQA 4USHA 5EUHA 3K58A 1NGIA 3SBTA 5C2GA 4PWWA 3VEXA 2H48B 3QEWA 4H5WA 2OP5A 2RRBA 3C6TB 4EO6A 4BWMA 5AJ3K 1O6XA 3N6LA 3KLGA 4NA2A 5I3PA 2W9BA 3NS5A 2HF4A 1UA0A 3HULA 1JB0C 4BRFA 1RTJB 4LD0A 4TYAA 4CJTA 2FF3B 4ANCA 4ILGB 1XIQA 3I82A 5LJ3Y 2YWKA 4DPXA 1VSFA 4KREA 4BCAA 2H5JB 1MU2B 3SZ2A 5JVHL 3UKRA 1HMVB 3ENBA 1VMBA 4A59A 2R8KA 3FFIB 2POKA 4DSLA 5FPNA 2IBOA 3NVKA 4EEYA 1Y3JA 4BRIA 2K1RB 3ZETB 2YKAA 3P5JA 4RWTA 3M8PA 3AVKA 3SSQA 4BREA 2EPIA 4BY9C 3LTOA 3UQSA 3OVAA 3KNGA 2LFVA 2J7KA 7FDRA 3PHTA 2DGOA 2K3IA 3AXMA 4NOHA 5CD4H 3QETA 4NLXA 1GFWB 3PUFA 3SSSA 4TYBA 3MR2A 1RDRA 4ZK7M 1RK8A 2QSFA 4IR9A 4CEBA 1FJCA 4NZ6A 3I8DA 2MHEA 3DXKA 5IM0A 2EFOA 1DQ8A 3VV2B 4F8RA 1WEXA 3GTYX 2P1JA 2WTUA 2KYXA 3AA2A 5CXTA 3OPKA 1PIEA 2CPYA 4OHZA 3QFPA 3O3FA 1MDUB 2R8IA 5FPEA 1NK4A 3EXCX 4WBFA 1V4SA 1IQZA 3OL8A 2Y3YA 3E01B 1CSJA 1UVMA 4RNOA 3OV7A 1U1MA 3PX6A 1X4EA 4FW2A 2YX6A 4XIUA 2FBYA 5HJYA 1VBXA 2DPIA 3BF3A 3H45C 2L9DA 4KY3A 3FMWA 4YB7A 4EIAA 4PRFA 5AZIA 1HKCA 3MM8B 4K0KF 2NZ4A 3MDFA 1FE0A 3TWHA 2VODA 5D8HB 3PDNA 1PILA 1U1OA 3EUNA 2QXLA 3KWGA 1OS5A 3HD2A 4WQ5A 4CGJA 1IWAA 2QKBA 3RW6A 2JNJA 2MMYA 3M4XA 4CHPA 2FZKB 3ZZRA 1FRLA 1KSPA 4FLXA 4FXWA 2W9CB 3QGHA 2GUPA 4DV3J 1H3DA 4I67A 3NNHA 4ED8A 5GAEP 3CMAN 1UZHA 1YI2N 3O4NA 2QYGA 4QCLA 4CLPA 3DRSA 2IGIA 3T41A 3PSFA 3QIPB 3C14A 1U47A 4PUOB 2A6MA 4O0JA 4B3TK 4FK4A 4N5SA 2XM3A 1MWMA 1RT5A 1NDCA 4KRWA 4KGMA 5BR9A 2VBWA 2ZH5A 4QOTA 3K5NA 3MFIA 3IM9A 3NCIA 3OSNA 3KLEB 1S9FA 1TFWA 4MLEA 4CP5A 2BA9A 2OTJN 2ZOMA 2D1CA 2ZZMA 1W26A 4ILRA 1HNWF 8RUCA 1B7YB 4A8WA 5CCMA 2KT2A 3SV4A 1U26A 3ATVA 3EE9A 3K8VA 3W5XA 4WFBQ 2YX1A 2HVHA 1NGAA 4BG8A 1HBUB 3O9TA 4U7UD 3KWIA 2XHBA 4CGFA 1PG5B 1H6KX 2MGZA 1U24A 4J2BA 2P9PA 1FT8A 1TV6B 4E7KA 2BQUA 4JI4K 1VLOA 1U0HA 3U4LA 4DV0F 3OL9A 1O51A 4WXWA 2JEFA 3ZX0A 1JLAB 4X4TA 4P52A 4LH5A 1S76D 3OYBA 2NUHA 2D0PA 1MWYA 1JLGB 4DL0C 2JGUA 3B4MA 3QESA 5GAHP 3WDOA 2GQ2A 1DBDA 2OIHA 2CGKA 2MZSA 1C0FA 2VQFK 4UF4A 3I96A 2VFVA 1VJWA 4KT0C 4CBWA 1HBNA 1HA1A 3R5BA 1NGGA 3DOKA 4O4GA 4XEIA 4DX7A 2X78A 2VPYB 1KQKA 5IOLA 4NE9C 2YHXA 1UJ5A 1UEUA 2HHSA 3KJVA 4DR3J 2IY5B 1DGKN 2ZOGA 2E5GA 1MMLA 4W4MA 3S3NA 3V2UC 4C8NA 5E26A 3D66A 1VQ7S 3LAMA 2CDQA 3N0VA 4M7YA 1LAVA 3GL1A 1JLFB 2CDRB 2KHDA 2XY5A 3TSQA 2W8LA 2Q97A 3R1HA 3MUTP 4C1NK 2VJUA 1X4FA 1RAGB 5HBMB 2CH6A 4M5NA 3H5XA 5LT5A 1JLBA 1SJRA 2GJIA 4IKFA 1NOYA 3MD1A 1VBZA 2YNIB 3PY8A 2EKNA 2GIQA 1MMNA 3Q2TC 4CGHA 3C3LA 4RX6A 1RACB 2MHNA 2E5LF 3BGLA 3UO0A 5CYMA 1HHSA 3LPUA 4OPHA 4FK2A 3VAMA 2EFQA 5FRMA 4KHYA 1GMWA 5AJ3F 2D69A 1KEKA 3DRXA 2DFHA 5KFKA 4B9QA 3K0SA 1TFYA 4YR2A 5IT4A 4E8UA 3CMEN 3BDEA 3MOZA 4LFAJ 4DZDA 3J80U 1C0TB 4USVA 2FJWA 4LRDA 2GJ2A 2QLWA 4KV8A 2VKZG 1B0TA 1QZ5A 2DXFA 4QPXA 3PM9A 1S7HA 3QMQA 4ED1A 3WT0A 1SKUB 2P6SA 5H1SQ 4OJHA 3BH6B 2IRUA 4FVCA 4RBUA 4FWKA 2Q0RA 4TU7A 2J9DA 4OGEA 1S72S 2XY8A 3S01A 3ILLA 3W9IA 2VICA 4Z4EA 2HURA 1FRMA 1Q82O 3EL2A 3PYGA 4C3MA 3EGWB 1QAYA 1S48A 3GCWP 3BGOP 5KFXA 4OPJA 5ITHA 2MSTA 4DU3A 1YJ9N 3ZTRA 3NBPA 1JXEA 3T1YF 3TX8A 2LQJA 2GVZB 2AX1A 2VQFJ 2DNOA 4Q44A 2C42A 5KT7A 3KXDA 3MUVP 3G6EN 2U2FA 5GVQA 4K42A 2Q0UA 4U96A 4DV7K 1H7XA 1VQKS 3AGKA 4HTJA 5J2MA 1BA0A 4LF8K 3VAKA 1FDNA 3KHRA 5HRSA 3KG4A 2K06A 1HKBA 5CYQA 4LIRA 1UFKA 4CZEA 1PO6A 4ZLNA 4GO5X 3CJ1A 3Q83A 3FEYB 3RUBL 1QVFM 2BM1A 2HS3A 4B08A 1JLCA 4CLKA 4FWRA 3FZBA 2CKWA 3V5RA 2XZDB 3TYTA 5AZJB 5A8KA 1QTMA 2GVDB 3TP2A 2ZGZA 1KFDA 2WB1D 2C3UA 1TK8A 5C15A 4M5DB 3F5TA 2MZJA 2BH1A 3VEWA 3OTDA 2O8BA 3HFZB 3CF5L 2DB1A 4I6WA 4NLBA 1UW9A 3BS9A 3EZ5A 3CJTA 4V19X 3HZGA 3FR0A 1M5OC 2J9CA 2NS1B 3MPWA 4DUZJ 3JQMA 2BXJA 4PZVA 3QERA 3TTFA 2UXBK 4HCBA 2FY1A 1JCGA 1OYDA 2QWQA 4ECRA 3CSKA 2LLZA 1RT2A 3QNWB 5KFIA 2GX8A 4N47A 1KVCA 1B9DA 4FL9A 3CJ2A 5AQJA 4B3TF 5KQDA 3QBXA 5BYRA 3LP0A 1MWQA 1ROFA 3RSEB 2WBMA 3M6UA 2A1SA 2Y1JA 1CQNA 2NYIA 2EK6A 2O8EA 3CC7N 1XMOK 1HWUA 2ABYA 2ZD1A 2RKIA 3LPEA 1SJ1A 4ZIWA 1KVIA 3CJ5A 4OHXA 3NDKA 1FA0A 3KJQB 4OZ3A 1HYVA 2ZH9A 4WQ4C 3G82A 4QYRA 1AT1B 4RNMA 4AHUA 2H5EA 3ZXWA 2XG8A 5A8WA 2V4JB 4O3OA 3MEGA 4DV7J 3AVLA 2RNEA 4YOYA 1LOTB 3WXIA 3VEZA 4KC5A 1EETB 4JI4F 2RUGA 3TUZC 1GOBA 4X64K 1G7CB 3V6JA 3TPQA 4LF2A 4X4RA 1OVQA 3K5OA 5IT9Y 2RPIA 2BQ3A 4I6AA 3ULHA 3GB0A 1SV5A 2J6TA 4CYUA 4H0TB 2WSEC 1S59A 3T1HJ 5FLXY 2PFFB 4OX8A 4JV2A 4HLBA 1E6VA 3HKZD 2Z2LA 3D9BA 3C6AA 1AUSL 3DXMB 2BABA 3WNGA 3QBCA 5B0CA 1FFGB 1KRPA 1KC8T 3ZSXA 3TVKA 4LF6K 3O8MA 4ZP7A 3QBWA 1XR5A 2A1BA 1VQPS 4NLRA 2G0CA 1YITN 3DLLQ 2UVVA 2ACYA 2CA9A 2AW0A 4KE5A 1XEZA 7AT1B 1KS2A 1SUQA 2FHKA 4NRUA 1UP1A 5KFWA 2I8EA 2V8DA 4G1IA 3H5UA 2JRSA 3NGDA 2BRKA 5D78A 3R9PA 4F9OA 1Q8KA 3WEEA 4WFAQ 3QFUA 2WVCA 1RTIB 4CLZA 4CD3A 1EKEA 5L1IA 2ZZNA 3RAMA 1RNHA 1WEYA 3HVWA 4OHWA 3OLBA 5JUMA 1GT8A 2VWKA 1UW4A 3GFYA 3Q89A 4WJBA 1EHWA 1ZBHA 5DLGA 4R0EA 1WDTA 5MAOA 5THWA 1WF2A 1FEEA 4RG8A 4CEZA 1IM4A 1Y0HA 1YK9A 4X4UA 5KG7A 1K73T 1A5WA 1XMOJ 1Q0NA 4BRQA 1OYEA 3NHGA 4PG7A 3OYDA 5ETOA 2LEPA 3KJFB 1RAHB 2IM3A 1D9AA 3M8ZA 4PXBA 3NY0A 3K89A 2RH3A 4LVNP 1S97A 2B4OA 2VIHA 2I2YA 2MKJA 2PYJA 1FRIA 3HYFA 1NB7A 1YIJN 1CJKA 4W5OA 1EIYB 1D1UA 5KFOA 5DLFA 1ZBFA 1S6QB 3W2WB 4IFYA 2M3DA 2RVJA 1RBSA 4NMLA 4IO8A 3E8OA 4NEZA 3Q8YA 2CQGA 4OYZA 4HTLA 2XCPA 4XTTA 4JRPA 1H1VA 4DU8A 3AY9A 2R7VA 1FNOA 4EP5A 2OPSB 1YVUA 1CQMA 3ZT2A 2DNMA 2RUSA 2MLZA 2GNKA 1RT3B 4CGIA 1RT7B 5J2PB 3QO9A 2CQDA 2J8SA 4P2FA 3KMSA 1D8YA 4OI4A 2AZ3A 4K2XA 3VGTA 3BM7A 5DM6Q 2DK2A 3W3DA 4RJVA 2ZEJA 4WFNL 2XLIA 4CE9A 4LF8F 1R89A 3D6TB 2QA4G 2GBZA 2VQEJ 1FEHA 5L38A 2DGVA 2Q31A 3VQ5A 5K5MA 2WW8A 5CA5A 4RUHA 2O01C 2XMJA 2WRMA 5AQFA 4EHTA 3JQJA 3P4UB 2PMZD 2CPFA 3I0RB 3OTOK 4IO9L 3O80A 3HOSA 4FYXB 2FJAB 3IXQA 4FWQA 4YB6A 3VHQA 3UIQA 4CZHA 3FEXB 3CIPA 5HANA 1G6BA 3AQPA 4AM7A 3K7RA 4RTFD 4ZVTB 1WSEA 3QWUA 1XMBA 4TSXA 4PCQA 2WSCC 1I6JA 2R2UA 3ULEB 5GAGI 1WC4A 3DLGA 1HW8A 3AB4B 1RI7A 2V63A 1UJ4A 2V6AA 5AFUH 1J54A 2KB2A 2UXBF 4YOEA 3OTEA 4YOWA 5HJXA 4LF4K 4DV5J 3MPUB 4I4BA 2FVRA 1CJTA 3FZHA 3G71N 4EWTA 1B0PA 3VZHA 3AD9C 4RUBA 4K8RA 3DGPB 4IFVA 4KFBB 1OVYA 3ZSWA 4YDUC 4YOXA 3NF8A 2DKOB 3DDNA 1WHVA 4FXVA 5IT0A 3BDPA 1NK8A 5HROB 3Q8SB 4DX6A 4PAAA 3ET6A 3KIOA 4M3RA 2E29A 4BE0A 3DM2A 3QEVA 5D4NA 1CZBA 1R8HA 3AGRA 2YKNB 4JD2B 2PEHA 4CECA 4LF1A 4C3KA 3Q8RB 4Y2KA 2BE2A 3OXGA 3JS6A 3OJSA 4F36A 4ISGA 2AT1B 4ETZA 4FWMA 2D74B 4OZ5A 3MURP 5IXUA 4I6YA 5BRHA 2NXEA 4X64F 1NWKA 2A41A 2A2DA 2FLLA 2R9LA 2P8IA 1OPZA 1GNKA 4Z4GA 3RR8A 4DUYK 1W2BM 2DR9A 3AD7C 4PYDA 4F0MA 2NRTA 4H4KC 1W0HA 1VQ9N 4QW9A 3HPOA 4ZLLA 4PQUB 2KQ2A 3FKBA 4MK9A 2HNYA 4PL7A 2CAJA 3M1FA 1C1CA 3G87A 1U2VB 2BVZA 2BJ7A 4LF6F 2IM1A 3FK4A 4DCHA 2MZ1A 2MTLA 3JAMO 5LXRA 1S12A