3KLIA

Crystal structure of unliganded azt-resistant hiv-1 reverse transcriptase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
551
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 131
structure length 551
sequence length 551
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kliA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kliA05
2R2TA 1SL1A 5I3UB 1IKYB 1LWEB 1C0UB 3PUFA 2WONB 4CJ3A 5DK5A 3AVIA 4DSEA 1JLCA 1RT6B 2HNYA 4PWDB 3V6DB 2XC9A 4OKJA 1A5VA 2W9CA 4LSLB 4CGJA 4TQRA 1TGOA 1U48A 4EBDA 2Z1GA 1LW2A 2GIRA 4IRCA 3SUPA 5DLGA 5DG8A 4MFBB 1B9FA 3MXMA 2IBKA 2GC8A 4DL2A 2VG7B 4W5OA 3HKWA 3H2LA 1XHZA 1BQNA 3M9MB 4ECYA 4LD0A 1NJXA 1EETA 4B9VA 1S1TB 3T5KA 4I7FA 3LP2A 3KHGA 1KHWA 2FJWA 4X2BA 1JLAA 3CDUA 1HNIB 2UVRA 1DLOB 1TKDA 3AVNA 3G86A 1HQEA 3VQEA 5KRSA 2FVSA 2IM1A 4OPJA 2CKWA 4ECUA 1JL1A 3BSNA 1S9EB 1I39A 5KG6A 4TXSA 3BGRB 3OL9A 4FS2A 3O3HA 4ZPDA 4I2QA 3LALA 4NLYA 3AO2A 3DOKA 3KLGB 3V6KA 5J2PA 3QLHA 3QERA 1S1VB 3QEVA 1GX5A 2YNGB 3S3NA 1VRUA 5KG5A 3C6TB 1REVA 4DS4A 3IN5A 2JC1A 2FBVA 2PYLA 5FDLB 3BR9A 4TQSA 3ZSOA 1SL0A 2VA2A 4FLUA 3KKSA 3G6XA 3KLEB 4KKOB 4EO8A 4HUGA 5KFFA 1JLGA 4RW8B 2WB4A 3P1GA 3NHGA 3QEPA 2HHTA 4ZHRB 3ZT1A 4GVMA 4CGHA 3RB4A 4M3XA 1L3SA 1IO2A 4N56A 3S3OA 4DS5A 2XCAA 3VQ9A 1HQUA 3PY8A 2QK9A 1JIHA 3D0PA 4CEBA 2BANA 2OH2A 3QEIA 2W8LA 1J9AA 2WHOA 1HRHA 1UA1A 2R2SA 4CE9A 3DLEB 1FKOB 4DTNA 2XHBA 4ID1A 4Z4GA 3KK3A 3GIKA 1N6QA 1QTMA 2Y1IA 1FKPA 2IS3A 3H5SA 1IH7A 4N47A 2HNYB 1CXQA 3OYLA 2VG6B 4B8CA 1HNIA 3EPIA 1WN7A 2RF2A 5FRNA 2XGQA 3MFHA 3DLBA 1VRTB 4ED0A 2V9WA 1RDCA 3CFRA 3K5LA 4FLTA 4PWDA 1L3TA 4DQPA 1RT2A 4B9SA 2BRLA 4ZTJA 1SL2A 3A2FA 1FXXA 4DF8A 4IG3B 4DTRA 1LAWA 1QS4A 4FJHA 2A1SA 4M3YA 4MFBA 4CF9A 1KVAA 1C6VA 3V1RA 2XGPA 3DDKA 4DFJA 2YNGA 3VQDA 1Q9YA 3QETA 5KG3A 1IKXA 1WLJA 1DTTA 1W9HA 5C25B 3G0ZA 2YNHA 5D3GA 3IGNA 1HYZA 4KFBB 1KLMB 4CFDA 4FS1A 3KKRA 1ZTTA 1UA0A 4K4SA 4HUEA 2F8TA 4O4GA 4EP5A 4FJIA 3FQKA 3AO5A 1JLGB 4RW8A 1XR5A 4O3SA 4URGA 4WFXA 1CXUA 3ZSYA 2ILZA 4ECQA 3ULDA 4FJXA 3DOLB 2G8IA 1ASWA 3O3FA 4CEDA 5SWMA 2ZE2A 4NCAA 3IGVA 4HCCA 1D0EA 4CK3A 4N76A 3HL8A 1WNEA 2W9BB 1EKEA 4ICLA 4WFYA 4KTZA 3E51A 3KLGA 4BDYA 3PX4A 3NGZA 3QLHB 3L2VA 3KHLA 3TARA 3NMAA 2YNIA 1QSSA 4QPXA 4TY9A 3NAHA 4Z4HA 4M42A 4Q8EA 5KG0A 1KFSA 3TAGA 2PYJA 3ZCMA 4CEEA 1J53A 1ZBHA 4DSKA 5KT3A 2IM2A 1NK4A 5EWGA 3OHBA 4AHVA 4FXDA 3OL8A 1S49A 4ZTFA 1HARA 3HP6A 1C0TB 1L3VA 2FBYA 5KFNA 3SZ2A 1Q9XA 2BQ3A 3WNEA 2OPQA 2UUWA 3QGHA 4UQGA 1EETB 3BQ0A 4EYHB 1Q8IA 3KHRA 4CHQA 4W5TA 2PY5A 4FJ5A 2IMWP 4NCGA 4CF8A 3PW5A 1T8EA 3PJXA 3AVAA 4ECXA 4O44A 1WSGA 3OYAA 3OYIA 2B4JA 1NK0A 1HPZB 4H4OA 4CJLA 3RB3A 3RWUA 3O3GA 3Q8RB 4NLOA 3BJYA 4CJEA 3O4NA 3KNAA 2KFZA 4IDKA 1JLFB 2FVQA 5J2MA 2VG5A 4ECRA 3FFIA 5KFOA 4QAGA 4F3TA 4ECVA 1EP4A 1DTTB 1U09A 2V0NA 4ED1A 3I0RA 3G6VA 4M95A 4KE5A 3PO4A 4B9UA 5KT7A 4IG0B 3CM5A 1LWCB 1RT4B 4TSXA 1T03B 2B5JB 3V9XA 3I0SA 5DQGA 5KG2A 1JLAB 3UIQA 1WNSA 3KHHA 2EC0A 4KB0A 4ZHRA 4Z0UA 2OPRA 4PQUA 4J9RA 2HHQA 2W9AA 1ZETA 5KFBA 3C6TA 4FCYA 3LZIA 3AVKA 3SPYA 2WRMA 4H4MB 5HP1B 3HJFA 4FJKA 2W42A 3NGIA 1RT3A 3I5CA 1IM4A 3CWJA 4JLHA 3VQBA 4DL7A 3EZUA 3HM9A 4EEYA 1BIZA 4QOZB 3AVGA 2OPPB 1S1XA 4NLWA 1WAFA 4KI4A 5KFJA 3T5LA 5DMRA 4K8XA 4F4XA 3M8PB 3SFGA 3L2RA 4DLEA 1XWLA 2HVIA 5FDLA 4K4WA 3CVKA 2FJVA 1KRPA 2BR0A 4IFYB 3DLEA 3N6MA 3DYAB 4BWJA 1VSEA 1TKZA 4R5PB 1YVUA 3HYFA 4RZRA 1RBSA 3LP0A 4FJ9A 1RBTA 3C94A 2BRKA 4QWCA 3T3FA 2IA6A 4IG3A 3U3GA 3SUQA 3L2QA 1UAXA 4CHPA 2YNHB 4YFUA 5KFVA 3GV8B 3TAQA 2XY8A 3QEWA 2E9ZA 1S0NA 3ICLA 5KFLA 4MK7A 1UOCA 4R8UA 2HMIB 1S0MA 1RA7A 5KFKA 1RA6A 4CJTA 2D3ZA 4J9NA 1ASUA 3ZT2A 3RMBA 4IH5A 4JS5A 3SUOA 4FLVA 4M3TA 5D3GB 4CFBA 4H4OB 4Q43A 2RDJA 3OYEA 4N5SA 4QWDA 4KV8A 4DSFA 1JX4A 2JEGA 3QO9B 4ZPCA 3MEDB 3HO1A 3IAYA 4FK2A 2EX3A 2W9BA 3LAKA 4E3SA 3TWHA 3ZSZA 3JSMB 4LQ3A 4N41A 4WZMA 4GW6A 4M45A 4CGGA 1TAUA 5KG1A 4Q45A 3KLFA 3LZJA 3NBPB 2IAJB 3EZ5A 3OYKA 4IKFA 1SV5A 4CHYA 4CEZA 4CIGA 3AO3A 2IC3A 3CJ5A 3MR6A 3AVFA 1SH2A 4RW9B 5E41A 3TABA 2G8KA 3CG7A 4CECA 3AVLA 3QEXA 1LW0B 2DPIA 4Y1DA 4KHQA 1RT1A 4KHYA 4IFYA 5F8MA 2RKIA 3SQ0A 4DQRA 4EBEA 3N6NA 4CHZA 1BIUA 3KTQA 2HNZB 3PW4A 3BQ1A 3CQ8A 1S1UA 3T5JA 4Q5VA 4CF1A 3K5NA 4IFVA 1LW2B 4URSA 4NCGB 3H4DA 5L1LA 4CCHA 1JXBA 3C95A 3GYNA 3ZT3A 3PW2A 1NHUA 1R0AB 3VQ8A 4DTUA 4ECSA 1GOCA 3E01A 1S5JA 4E89A 1TP7A 4ED8A 4AHSA 1JLFA 4IDKB 3I5AA 3OLBA 1W0HA 2Z1IA 3H59A 2JEIA 2OPSB 5HRNA 3P5JA 2O4IA 5C5JA 1GOAA 4DL4A 3AVJA 4ZMMA 3OYHA 2BQUA 1X1PA 1CZ9A 5J2QA 2GUIA 1LWFA 2UVVA 1F21A 3CO9A 4FZYA 4J9OA 3IG1B 1N5YB 4FJ7A 1JKHA 2VG5B 2Z1HA 2XO7A 3QNNA 5SZTA 4J9QA 1NJYA 5F9LA 4LSNA 3AVCA 4NYFA 2OPPA 4W5NA 1RBVA 3DLGA 5EDWA 2D0CA 3OS2A 1CSJA 4JV2A 1S9GA 4KB1A 4TYAA 1LV5A 2HNDB 2AX1A 4TYBA 2R2RA 4E7JA 4HKQA 1ZBLA 1NOYA 4RNMA 3SJJA 1VSKA 1YTUA 1FK9A 5J1EB 4DTJA 3WNGA 4CIEA 4MK8A 4ZP8A 2BE2B 3B6PA 3DLRA 4XPEA 4NRUA 1RDAA 1EX4A 3B6OA 5EWFA 3M8PA 2WCXA 3CDWA 5F8HA 3PHEA 1QHTA 1HQUB 1XHXA 2X78A 4AILC 4IQXA 1C0MA 3PX0A 3CM6A 3FSIA 3KK1A 3OS1A 4OGEA 1HNVA 1TVRB 3V81B 2XRIA 2D0AA 1TK5A 4CEQA 3BSOA 1JXEA 4KO0B 1G15A 3AVMA 3RBEA 4DFKA 3LPUA 4IKAA 1DTQA 3NDKA 2E4LA 3VQ5A 2B43A 2HHWA 1HJRA 3MTKA 5KFWA 3UDLA 4CEFA 4IBNA 2UUTA 2XI3A 4KTWA 1T7PA 1W25A 3SV3A 1BQNB 4ZVEA 3SFUA 5KFMA 5DG7A 4F2SA 3RRHA 4DQIA 3ZSXA 4YNQA 4NLTA 1TKZB 4R5PA 4LQ9A 4IFVB 5J2NA 3RR7A 1J5OB 3TVKA 4CEOA 5DGBA 4HCBA 3FRZA 4F50A 2QKKA 3QYYA 1KCFA 5JS1A 1QE1B 4L8RB 3SQ2A 4LSLA 3DLKA 1RTDB 3FQLA 1K1SA 3AO1A 1S6QA 4CJUA 5CY4A 2XY7A 5CYMB 5I3UA 3OL6A 2YKMA 4K50A 4ECZA 2WONA 4KHNA 1OS5A 1VRUB 1U49A 1VK0A 1S6PB 2BDPA 4KV8B 2HVHA 3HVWA 3KLIB 5JUMA 3GILA 3LWLA 4QCLA 4E1MA 3AA5X 3T19A 3JSMA 4O3NA 2JC0A 2BE2A 2KQ2A 2B5JA 5L1JA 3WNHA 1RNHA 2DFFA 3V9SA 1S9FA 4AHRA 4OKEA 4CJPA 2AQ4A 4JRPA 4KSEB 4BWMA 1TK0A 3KMQA 1XR7A 3SQ4A 4F3OA 3BSCA 4YR0A 4DU1A 1WSHA 3KLHB 3SQ1A 4NLDA 3KOAA 4QW9A 1RT5A 4DF4A 4LSNB 3HXMA 5KI6A 1RYSA 4O5BA 4CJQA 1B9DA 2HHSA 4YR3A 5I42B 2QKBA 2IAJA 1IG9A 3V9UA 1RTIA 1C1AA 4CJWA 3GIMA 4BE0A 4O3QA 2KFNA 4FLXA 3LWMA 5L1KA 1LAVA 4DU3A 1CLQA 1U47A 3NE6A 3TAMA 4J9MA 1TVRA 1BQMB 4PA1A 1FKPB 3M9NB 1IKYA 2OPQB 5KT6A 4CESA 4RW7A 5KT5A 5KTQA 4DSIA 1TL1A 1A5XA 4GC6A 3CFOA 3V1QA 4ZPAA 4NYNA 1ITGA 5DLFA 3HPOA 3K59A 2RF2B 1C0TA 4EZ9A 4C8KA 4RNFA 3KLEA 4NYZA 2B6AA 1UWBB 1R0AA 3V81A 3VQ7A 4ID5B 4XO0A 3K57A 4KHMA 4FW2A 5F8JA 4KFBA 5J2QB 3MFIA 4TLRA 5KFSA 3ZSQA 4BACA 3AA2A 1BCOA 4BDPA 1RCHA 3DLKB 1RDRA 3NGYA 1BI4B 2F96A 4O3PA 1EP4B 1TKXA 2VA3A 1MU2A 1VSHA 1K1QA 2KTQA 1T05A 1KLMA 4IG0A 3RAQA 1MU2B 3ALYA 4CHNA 4W5RA 4FZXC 4KHWA 4DL5A 3N6LA 4M3WA 3K5MA 4CJ4A 2ZKUA 3VQCA 1YTAA 4CEAA 4I2QB 3PR5B 4BE2A 3HSTB 2XI2A 3ITHB 3VA0A 2W8KA 4FJMA 3M8QB 4RU9A 5K14B 3ZSWA 3HVTB 1D9DA 2ILYA 3DMJB 4DU4A 3KMSA 3IRXA 1Z26A 4TY8B 3CDEA 3DYAA 3MR2A 4HHTA 3KLHA 5JS2A 2Y1JA 2J6TA 5KFXA 5KFHA 3OYJA 1XI1A 1RBUA 4J9SA 4J9PA 3TAEA 4B8AB 3D5MA 3T5HA 4DL3A 1S0OA 2F8SA 4CGFA 1L5UA 5HLFA 4RW6B 3DLHA 2QXFA 3KD1E 4XPCA 1ZBFA 3NF8A 3QGIA 4DMNA 3ISND 2CJQA 3LPTA 4CJ5A 1BL3A 2W7OA 4F4WA 1GX6A 3G10A 1N6QB 2E9RX 2ZQBA 3HP9A 3CJ3A 1VSDA 1TKXB 4WFZA 1B92A 3QZ7A 3H4BA 3V4IB 3OYDA 4CGIA 1JLCB 2YKMB 3QO9A 4BDZA 3RMCA 3MXIA 4NLXA 1RT2B 5HRRA 4YMEA 5HROB 4FW1A 4YP3A 3DRPB 2ASLA 2FLLA 3I0RB 1YVFA 3EYZA 3KLFB 3SPZA 4NLVA 4KRFA 4F2RA 2HAIA 4OKKA 4NLSA 3M9OB 3S9HA 1TV6B 4FLWA 2AGOA 2HW3A 4O4RA 4WXOA 4ZVGA 5C42A 4J9LA 4J2DA 4B9LA 1NNDA 1S4FA 5C42B 2FVCA 2W7PA 4O55A 1NOZA 2IOCA 4ED6A 1JLEA 3KLVA 3NH1A 2XY6A 3HVTA 4DSLA 3VQSA 3MEDA 1SV5B 2ATQA 4LH5A 4GMJB 1QAJA 2P5OA 4IR9A 2RN2A 4I9LA 3V9WA 4DFMA 4C8MA 4I9QA 1HMVB 4CGDA 2VWJA 4FJNA 3PJWA 4GC7A 1D1UA 4Q0BA 1RYRA 2G8HA 1BQMA 4RUAA 1RT6A 5HRPA 1SKSA 2Q3SA 2UVUA 4BE1A 1S10A 1RTIB 1TQLA 3SCXA 3OJUA 4KAZA 1NHVA 1A5WA 4HYKA 3U6FA 5KGWA 1X9WA 2P51A 4WE1A 3OYNA 3OJSA 2D3UA 2FJXA 2C2DA 4AHUA 3RRGA 1JLBB 3H5YA 5KFPA 1TL1B 1I3AA 3RB6A 5DGAA 3KK2B 4I7FB 3BSAA 3MECB 1MMLA 4R8UB 4KHUA 5F8LA 4ZVFA 2FBTA 4DSJA 5HBMB 1DLOA 2B6AB 1VSIA 5KFRA 1BI4A 3I5BA 4CF0A 3ZT0A 4JRQA 2YNFA 1TV6A 3MEGA 5KG7A 4AHTA 2ZD1A 1S9EA 1IKWA 3NF7A 2VG6A 2FVPA 5HRSA 3RR8A 2C28A 3ZSVA 1NK6A 2FLPA 3KD5E 3DM2A 2KZZA 1SKRA 3D45A 2Z1JA 3DRPA 4MK9A 1VRTA 1QE1A 4OVLA 2G8WA 1T3NA 4RW4B 3RBDA 3L2UA 4H54A 3HVAA 1SH0A 4QWEA 4Q44A 3HHKA 2E9TA 3L2WA 4ZPBA 4DWIA 3CJ0A 1S1TA 3H40A 4HVJA 1N5YA 3THVA 3VQ4A 3QIDA 3H98A 5J1EA 4WYWA 5DG9A 4E1NA 2DFEA 1YT3A 5EWEA 5F8IA 3MR3A 4KTQA 4KHSA 2WTFA 1TK8A 4ED7A 1LW0A 3MR5A 1NKCA 2R8KA 3NL0A 5KFGA 5L9XA 1N4LA 2HMIA 5KT2A 3OYCA 4H4MA 5HP1A 4C8OA 4FJJA 4DLGA 4RW6A 4U6PA 4ELVA 1RTHB 2C2EA 4ZP9A 4K4TA 1RAJA 1FKOA 2OZSA 3I8DA 3PW7A 3LP3A 5KRTA 1KHVA 2PZSA 2R7YA 3RB0A 4FK0A 2GBZA 1SKWA 1S1XB 4OLAA 4JV1A 1VSLA 4MQ3A 1Y97A 5KFQA 4CJVA 2O5DA 4DTMA 4Q8FA 2X74A 3QZ8A 1FK9B 3KK1B 4K4YA 3SYZA 3UR0A 1T94A 5J2PB 4KKOA 1RILA 2OZMA 1WSJA 4ZP6A 3OYGA 1VSJA 1N48A 1J5OA 1RT7B 1REVB 4Y2CA 3LAMA 3MECA 2FBXA 1RT7A 2IGIA 2R8IA 5DQHA 2J6SA 4CIFA 2HB5A 3DRSB 3TQ1A 3V4IA 4E7HA 1IKXB 2D41A 1NJZA 4CFAA 3H5XA 3LDSA 2RDIA 4C8NA 5F8NA 4B3OB 2FVRA 3QNOA 3KK2A 2E6MA 5KFEA 2R2UA 1U45A 1JKHB 3KJVB 2OPSA 3V1OA 3NF6A 5EU7A 3VQPA 1KVCA 1KVBA 2GIQA 1NK9A 4PUOB 4F8RA 1K6YA 4RUCA 3DOLA 4CK2A 2AU0A 4TN2A 3CIZA 3DRRB 3FDSA 3MF5A 3RMAA 3AV9A 4O4GB 2AWZA 4ED2A 3DM2B 4ICLB 1RTHA 2DPJA 4FM1A 1NK8A 1QSLA 4K4XA 3V9ZA 4OGCA 3CFPA 4K8ZA 2AGQA 2UVWA 3NFAA 4RW4A 1S1WB 5KFUA 3AA4A 4J2BA 3CJ4A 1HQEB 5I42A 5KFIA 3LP1B 4IRDA 2YV0X 2RPIA 3SI6A 3D28A 1S1WA 4WXWA 3TANA 4E7KA 3BGRA 3RAXA 1TKTA 4DQQA 4MH8A 2FC0A 3F9KA 2R8HA 3UQSA 1TKTB 2YNIB 1CZBA 4TY8A 3OSPA 5C25A 3CYMA 1S1VA 4CJKA 4WE1B 3V6HA 4YR2A 1N56A 4Y34A 4RNOA 3NH0A 1KLNA 1GOBA 3VQQA 4NRTA 1WSIA 3BQ2A 2C22A 3SUNA 5FRMA 2V4RA 4Y1CA 1TAQA 5KFDA 4EYIB 5F9NA 4NCBA 4NLUA 4FBUA 3NGDA 1L3UA 1KSPA 3KIOA 2E6LA 2D5RA 4CJRA 4NLQA 2ATLA 4E7IA 1TL3A 4H8KA 3OY9A 1XR6A 4K4VA 3L3UA 3MXJA 3QIOA 2G8FA 4LY7A 3L3VA 2NUBA 4M41A 1QSYA 3RMDA 1RTDA 3HPHA 2C2RA 3C6UA 3V6JA 4URQU 2KZMA 3SV4A 3C6UB 4Z4EA 3HPGA 2X6NA 1D5AA 1QAIA 2QV6A 1ZBUA 3H5UA 3O4QA 3FFIB 5JXSA 3I0SB 3PZPA 1NKBA 5CZ1A 4RNNA 2WOMB 4QWBA 3SNNA 4K4ZA 4DTSA 4B3OA 3WNFA 1I6JA 4O3RA 5KG4A 3Q8QB 2YNFB 3DMJA 4NLRA 4CFCA 1HYSA 3IRXB 3IS9A 4KO0A 4G3IA 3H08A 5C24B 2ALZA 3G6YA 1RT3B 4U7CA 4M94A 4FJ8A 4PUOA 4G1QB 3JYTA 2D0BA 1T05B 3ITHA 4JV0A 1S6QB 2IM3A 5CYMA 3GV7B 3M8RA 4K4UA 3F73A 3HK2A 3NKYA 3GIJA 3PX6A 3ISNC 3DLGB 5CYQA 1S6PA 3GQCA 4J2AA 2F8EX 3KLIA 1VSFA 1RT5B 3OYMA 1S48A 1RTJB 1U04A 1RTJA 4JUZA 4FJGA 3NBPA 4KBIA 1HMVA 4B9NA 2OPRB 4PQUB 2HWIA 4AHCA 2XWYA 4ELTA 1KTQA 3QIPB 5HLFB 1IKVA 3TAFA 2LSNA 3CJ2A 5KGXA 5KT4A 5T7BA 4FM0A 1Z25A 1BCMA 4IR1A 4LH4A 4EZ6A 2I5JA 2IJFA 4O0IA 4ECTA 3U3YA 4NLPA 5CZ2A 4EP4A 2JEFA 4MIBA 3QINA 4QWAA 4DG1B 1BGXT 2A1RA 2BANB 1QUVA 3PO5A 1X9SA 4C8LA 2R8JA 1KFDA 1UWBA 3EPGA 2G8UA 3TR8A 1NKEA 3PV8A 3TAMB 1NK7A 1LWEA 3QGGA 2IDOA 3K2PA 3PR4A 2VWKA 2D7SA 5C24A 1HPZA 4FYDA 3LP0B 4KPYA 1RBRA 2V4QA 4I2PA 3DI6A 4ECWA 2XCPA 1NK5A 5HROA 4KB7A 3L8BA 3PVXA 3ZT4A 5J2NB 4M3ZA 4ZVHA 5J2MB 4Z4CA 2WOMA 1U4BA 2P1JA 4CJFA 1JL2A 2VG7A 4FVMA 4XIUA 3DRRA 3PW0A 3LP1A 3NAIA 5KFYA 3GIIA 4RG8A 4Z4FA 1T03A 2J6UA 3TAPA 3AVBA 4Y3CA 5KFCA 3MAQA 3Q8SB 4J9KA 3VN5A 5L1IA 4FZZA 4R0EA 1JLQB 4NLGA 3OS0A 4ID5A 2OYQA 5K14A 3UPFA 5EUHA 4B9MA 2R8GA 3OHAA 4CJSA 4E7LA 4NZ0A 3HT3A 2JEJA 1XC9A 4G1QA 3VA3A 1RDDA 4CK1A 4FJLA 1O1WA 4YQWA 4Y2AA 4EO6A 3VQ6A 4DTPA 1HYVA 4WYLA 3Q8PB 1J54A 1S1UB 1TL3B 1RT1B 3AVHA 2IM0A 1C1CA 4F4ZA 2RKIB 4ZP7A 1C2PA 2DTUA 2I5JB 4Z4IA 3KK3B 1C1CB 4F4KA 4DEZA 1IKWB 2HHUA 3M8QA 3MEEA 2GV9A 4O3OA 3QIPA 4DG1A 2YKNB 3E01B 2ASJA 2P5GA 2IJNA 5KFTA 2O4GA 2AGPA 3OVNA 3TI0A 4RW7B 4CHOA 3V6DA 3K58A 4FLZA 3VQAA 2YHAA 1JXLA 2W9CB 4OLBA 2KW4A 4CF2A 4MKBA 3OYFA 4DFPA 1C1BA 2DFHA 1S97A 4M3UA 4EBCA 4RW9A 4IRKA 1X9MA 4WZQA 2ASDA 3EY1A 1JLBA 1C0UA 1C1BB 1ZTWA 1VSMA 1WSFA 1ASVA 4E0DA 1QQCA 2EHGA 4FM2A 1HYSB 1BHLA 2JGUA 4FK4A 2HNZA 3IG1A 4W5QA 5HBMA 3LP2B 3P83D 3QESA 4ED3A 4M3RA 5DQIA 2AX0A 4ELUA 4KREA 4DQSA 3BREA 3JYTB 3KJVA 4MKAA 4AH9A 1EXQA 1ZBIA 3OL7A 3GV5B 1JLEB 3IS9B 4I2PB 4F4YA 1SUQB 4OL8A 2HNDA 4QW8A 3ZSRA 1WAJA 5T14A 1SUQA 4HUFA 4E19A 3RTVA 2QE5A 3OYBA 3OLAA 2HHVA 4HTUA 3ASMA 1BISA 1Z4UA 1LWCA 1RT4A 4Q0BB 2DY4A 2BQRA 1S9GB 3S3MA 1D9FA 4J2EA 3NF9A 2WK4A 4KAIA 3K5OA 1IKVB 1RDBA 2XY5A 2BGGA 1ZYQA 4CERA 2ITGA 3NH2A 4KI6A 3DOKB 2I1RA 2OA8A 2IC3B 3NAEA 1JLQA 2AJQA 3NCIA 4JS4A 4B9TA 2YKNA 3T1AA 4RNHA 2ZE2B 1WSEA 1LWFB 3BDPA 3AO4A 2HWHA 4FBTA 5F8GA 5CYQB 2ETJA 2G8VA 4IOBA 4DL6A 4B08A 4IH6A 4MIAA 1HNVB 4OPKA 3HVRA 5KFAA 5FROA 3M8SA 4KHRA 1D8YA 3MEEB 3AA3A 4IH7A 1NJWA 4PY5A 3MEGB 4FLYA 2FLNA 2ZD1B 4OJRA 2HHXA 4O0JA 1DTQB 3SI8A 2JLEA 3DI6B 3LANA 2YHBA 2X6SA 4DTXA 3OSNA 1SH3A 3DRSA 5KFZA 4O44B 4DTOA
chains in the Genus database with same CATH superfamily
3BPSP 2LP4A 1IKYB 5F3ZA 4H0PA 3AVIA 4OX9K 2V5HG 3D0GE 2F9DA 2Q6CA 2ZHOA 4DCPB 4EU0A 4CGJA 4TQRA 2Z1GA 1LW2A 2VQFK 3SUPA 5DG8A 1HWJA 1B9FA 2QN6B 2YKPA 5HQLA 2A42A 2GC8A 2K7KA 3CXCM 3H2LA 4JI2K 3M9MB 3FZMA 4ECYA 2DNZA 4CW7B 2AJ4A 1S1TB 2YX6A 5F1XA 4LFCF 4XH5A 1KHWA 2A18A 2E66A 2EFQA 1TKDA 4RKUC 1SS6A 3DHXA 1U6FA 1HL6A 2IM1A 4OPJA 3CCVS 2HS0A 4Q2MA 1O8BA 3MCOA 2KXFA 3BGRB 3OL9A 4FS2A 4JI1F 2RQ4A 3O3HA 3D66A 2WW4A 4NLYA 1AFIA 3D1QA 3DOKA 1UEVA 1MN7A 5J2PA 3QLHA 2HVEA 2C3UA 2YNGB 2DNLA 3HZGA 2YWWA 2XS2A 3NLCA 4U95A 4DX7A 4LUBA 3EJMA 3N79A 1F2HA 3C6TB 3CCES 1REVA 2FBVA 5FDLB 2YWEA 1ZM9A 2DCLA 3KJFB 2J4RA 4FLUA 2VDIA 4EO8A 4HUGA 2BW2A 3S7RA 4GKKF 3P1GA 4ZHRB 1BG3A 3W66A 4F25A 4B1XB 4M3XA 3EE3A 2XNQA 3CCUS 3S3OA 2NPIA 2QK9A 3D0PA 4DV0J 3ULHA 5IT0A 3KFWX 4CE9A 4YN3B 5D0RA 4ID1A 1R7IA 1RABB 3KK3A 3BO3A 3P38A 2DGUA 2DNNA 4B1VA 4JK7A 1Y9OA 1IH7A 4I6MB 3QB0A 2WB1D 1CXQA 5JLHA 4O0NA 2V6AA 2RUSA 2ZUAA 3QBWA 3DLLL 1URRA 1EARA 4IO9L 3THWA 2CPEA 2JFDA 2QIFA 2VPXB 4M5KA 1RT2A 2BRLA 4BGBA 1PGZA 5GADU 2R7SA 1A9NB 5HMZA 4DV7F 3PEHA 4M3YA 3UVJB 4MFBA 1WEYA 3HHLA 1KVAA 4DFJA 2C3PA 3VQDA 5E5NA 2CPYA 3QETA 3BYRA 2LQ5A 1NB7A 3G0ZA 3IGNA 3CMQA 1SJFA 1T3OA 4OZJA 3QFPA 3THYB 2O01C 1WOQA 3O3LA 3ATVA 4YY3F 4O4GA 4EP5A 4NXMJ 4BG9A 2F63A 3G6EN 1NM1A 4FJXA 2N82B 3O3FA 2QSFA 2HPUA 1XK8A 2EI5A 2YQ0A 5B0GA 3TJ8A 1U0HB 4V19J 3L0QA 1WNEA 1UVIA 1QAXA 1YJ7A 3HDSA 5A76A 2E29A 4KR0B 3D0IE 1Q7YT 2ZBCA 2ERRA 2KLAA 3THXB 1LFWA 1KFSA 3GSDA 5KG0A 1TFYA 2BUNA 4CEEA 2PYJA 4DHVA 4DSKA 3Q8UA 5EWGA 1H72C 1RI7A 3CCJN 4ZTFA 3HP6A 5E7OB 5ETSA 2MZQA 5C7PA 3SZ2A 1Q9XA 3I31A 3O44A 2OPQA 2X1GA 1QZ6A 1Q8IA 3KHRA 1RISA 3PYGA 4NXNF 3CDBA 1QVGM 1VQLN 1KN6A 4U7UK 1YRXA 4B3RF 3ILOA 3WDOA 5A8RA 3U4LA 3OYIA 3B78A 1S12A 1E6VB 3DU6A 3RB3A 3UO0A 1UJ6A 4CQ1A 3DXKB 2ZOMA 1OYDA 5KPZA 2XZWA 3Q8RB 1N0UA 2XLJA 3KNAA 1E4FT 2FVQA 1LNQA 2DNGA 3MN7A 3GTYX 4LF5K 2BTFA 4X4PA 4F3TA 2F8MA 2KRBA 1I3OB 3G6VA 5JICA 4M95A 4WCEL 3K89A 4KE5A 3VERA 4KIAA 4OYXA 2B56A 2I8EA 3C16B 1HLUA 2UYTA 4RO0A 2HWTA 1T03B 3GWCA 3CCUN 2B5JB 4YOTA 3BZKA 2UUAJ 4UT4A 4FVUA 4KT0C 4HH0A 4CP5A 1ZAWA 1JLAB 2UXBK 2W2MP 4CBUA 2LQ8A 2ZH3A 3JQJA 4PQUA 1ZETA 3GZ7A 4X4TA 2WRMA 2HBLA 5HP1B 2B4OA 5C2FA 4EHUA 1RT3A 2ZOFA 2ZGYA 2PA3A 3UN3A 3EZUA 3M2RB 1BIZA 2XZTB 1EQMA 4ILLA 2LCWA 3CJSA 4NLWA 5KFJA 2AYEA 4BR0A 4K8XA 3CPWR 4A8OA 3SFGA 2M52A 5BN9A 4LBHA 2HVIA 3G71S 4OQJA 1RDWX 2Q0UA 1YBTA 3EVWA 2FJVA 2BR0A 3DXBA 4K0KF 3N6MA 1KTVA 4R5PB 1YVUA 4NI2B 3LP0A 4A59A 2DGVA 3C94A 4QWCA 2MQMA 1IBKJ 4EI2A 2I38A 2C2ZB 3U3GA 3L2QA 3AODA 3RJMB 2M3DA 3BGFA 2NRZA 1WBDA 3I82A 4QR0A 4YFUA 4XK8C 4FYWB 3UKRA 1S0NA 5KFLA 1XNRK 2CQ2A 3NCPA 2UV8G 2W2NP 4DZ6A 5KFKA 2R7XA 1NGBA 4LRFA 2V4JA 5LMUF 3RMBA 2IFXA 5IQ6A 2NSBA 4WQ4C 1MW7A 1FTRA 4Q43A 2HFNA 4GV9A 5LSRA 4QWDA 3LDQA 1SC1B 3QATA 4IO1A 4KV8A 2KJVA 4DSFA 1SBRA 5AQUA 3AT1B 3DRYA 3VTIA 3QO9B 2JEGA 2G4BA 5D4PA 5H9FJ 3J81Y 2W9BA 4E3SA 2KG0A 4W98A 5BRFA 3ZSZA 2CH6A 2GEMA 4LQ3A 5HVGA 4U9RA 3EEQA 2G2YA 2DR6A 4M45A 1PBAA 1UWAA 1IBLJ 5E0OA 4Q45A 4DCOB 4NXNJ 3ID8A 5K8PA 4FPIA 3EZ5A 3CIMA 5AQXA 1SV5A 1VC6A 4QYRA 3DDNA 1RAHB 2E5LJ 4C0BA 4PABA 3MR6A 2KYXA 1N36F 4RWXA 2GO8A 2HS4A 5AZIB 4QR1A 4WQ5C 3WHIA 4CECA 4ZVSB 3QEXA 5A8WA 2DPIA 3O8MA 3D4JA 1LFPA 1VQ7S 1YJWN 3O1WA 3PRDA 3LO3A 1WD6A 3HT0A 2EFPA 4I67A 2RKIA 1DHMA 4DQRA 4EBEA 4U67L 2LKZA 3N6NA 3E9LA 2E5JA 4DR4K 3C7NA 4UOGA 1N5QA 3L4QA 3C15A 3BQ1A 3CQ8A 4CF1A 3OV7A 1RTZA 4CCHA 3GYNA 1LCUA 1R0AB 5LJWA 4LBIA 3EMTA 4DV6F 3CD6S 3W5XA 1S5JA 1Z2LA 1X4DA 1TP7A 3W5YA 4IDKB 2HLUA 1W0HA 1AA1B 4C1NI 3BBBA 2JEIA 2GAGC 2YBVA 2GQCA 3WZ0A 2F7VA 2O4IA 3AVJA 5EOYA 3QBCA 3MM6B 3VZIA 1T6DA 3OD2A 1LWFA 2QL7B 3A5MC 1CULB 1ZM4A 4FJ7A 1MA9B 3US5A 3VF2A 2OMLA 1VQKN 4OLOA 1F1BB 4LSNA 3AVCA 4NYFA 2D0CA 4WQ4A 1KR4A 1H6KX 3EWGA 4KB1A 1LV5A 2AX1A 1NSPA 2P9KA 4TYBA 4BS2A 2R2RA 2H48B 4HT5A 2VFRA 4HKQA 3VETA 3DXMB 1S59A 4LF4K 1YTUA 1P1LA 3ZEUA 3BH6B 1RDUA 2CPDA 1VIXA 5D78A 3EKSA 2ZOGA 3B6PA 2NXEA 4DKWA 5EWFA 3M8PA 3CDWA 4LF7J 3PHEA 2GQ2A 2X78A 1XHXA 5DZ6A 5CD4A 3VWSA 3NNAA 2HLTA 2DNKA 5AFUH 2HQGA 3FMBA 2C2NA 2MZRA 3O9TA 3EGVA 3H6EA 3AVMA 3RBEA 4K59A 4IKAA 3T1YJ 2YHWA 3NDKA 1N36J 2E4LA 3VQ5A 3UDLA 1N33K 3WBZA 2ZDOA 1W25A 4ZVEA 4F2SA 2F3JA 3QWPA 1REGX 2O8BA 2NRWA 4B17A 4IFVB 4YOVA 1J5OB 3AAPA 3TVKA 2QKKA 5JS1A 3MCPA 3DLKA 1RTDB 4DV4J 4USUA 1WDDA 1S6QA 5AE1A 2XO6A 4JI8K 2QLJB 4FOIA 3AFGA 1JJ2R 3OL6A 4ALZA 1VLOA 2WONA 1VK0A 2PMHA 2BDPA 2ZZMA 1EZZB 2K3IA 2DITA 2B4VA 3KKFA 3T19A 4PWUA 1M90T 2BE2A 3UKUA 1H38A 1JCFA 2DFFA 3MMAA 4DR5K 3V9SA 3BEGB 4XH1A 3CW2C 4CJPA 3A8IA 3G6ES 2FC9A 1PYTA 4DJBA 1I51B 5EX5A 2DB1A 2CQ0A 2L9WA 4BRMA 3TUZC 2QRRA 3ZNJ1 1RFQA 1R8BA 3A0IX 4O5BA 1B9DA 4IJNA 2HHSA 1KOOA 2G0IA 2D4WA 2A6MA 1V4SA 2V8GA 2P9EA 5ETTA 4JI8F 1RTIA 1C1AA 4CJWA 3VALA 4NA1A 4M5DA 4FLXA 3AAWB 3W7BA 3S8SA 4JD2A 1NBEB 4ATNA 2BZ2A 3NE6A 1UFWA 1OSDA 2P9NA 2X3GA 5LJ3Y 2VGNA 1MLAA 1FESA 2JH3A 5L38A 3PTWA 5KTQA 1C0GA 4YOWA 3CFOA 3ZTPA 5DLFA 2MGZB 1T3VA 4IOXA 3K59A 2ZH5A 2R4FA 3KLEA 4I1TA 3G96A 1FVSA 4CLTA 2PI5A 2HBKA 2R9LA 3KDNA 4MO5A 2FHJA 3H90A 5G0RA 4DUYF 4BDPA 3DLKB 2VOPA 1BI4B 3A3NB 2F96A 4O3PA 4LF9K 1EP4B 4X65F 3CF5L 5LMUK 4P2SA 3GJSB 4NPOA 3IFEA 4BG8A 1KLMA 2IVYA 1CS4B 4CHNA 2R7WA 2MKSA 4NZ7A 5BN8A 1CQMA 3N6LA 1NDKA 4CJ4A 5AJ3J 1YTAA 4CEAA 3GR0A 2N3OA 4BE2A 2OD6A 2L41A 2XI2A 2W8KA 4RL1A 3ILJA 3ZSWA 4JKAA 3HVTB 3OFHA 3FR0A 2PGCA 3DMJB 4DU4A 3KMSA 4C8YA 1GXTA 1MDUB 3MD3A 2Y1JA 5KFXA 1XI1A 4WFNL 1RBUA 3N28A 2CZ4A 2E5HA 4PXDA 4DL3A 1U0HA 1NGCA 1ATSA 3W9IA 2C3MA 3DXSX 2FGOA 1VQON 1R0BG 2DNRA 4RW6B 2QXFA 1J27A 2BKNA 2Z2YB 1VDHA 2H4YB 1WEZA 3QGIA 3J80O 2CJQA 3LPTA 4CJ5A 4MKYA 2HAFA 1BL3A 2W7OA 5BRDA 1YJ9S 2ZQBA 4ZVRB 2LECA 1U1QA 2MKYA 3OHRA 4WFZA 3KNGA 3VGTA 2OUGA 1BMQB 3OYDA 4QJVA 2YKMB 1U8WA 3DN9A 2KDOA 4UOFA 3M8ZA 4K5SA 5AQSA 4EMDA 3FEXB 3MXIA 1YJNN 2D1CA 3UD4P 2J9EA 2PBDA 4YMEA 4KGXB 3JTOA 4IDHA 4CZFA 2YY3A 1PSDA 3H46O 3EYZA 3ENAA 4LF6F 1LOUA 4KRFA 2QT7A 4NLSA 3M9OB 4DR2J 2DCUB 4DR6J 3R3LA 4ZCLA 1TV6B 1ZZFA 2QWRA 2QEXN 3J7YP 4BC2A 5C42A 3ZTSA 3PACA 3HX9A 1YX2A 5JVGL 4G9ZA 4A4JA 1P27B 2B7BB 4L74A 2NRHA 3EM1A 1NOZA 3L3CA 4DCHA 3HVTA 3R27A 2HBYB 3VQSA 2CPHA 3TNVA 1XNQK 4GMJB 1N32J 4UY8T 4KHPJ 2ZGZA 3V9WA 1SJRA 4CGDA 1V4TA 3IMXA 4RUAA 4DUYJ 5E3RA 3JB9k 3W8GA 1UVNA 6FD1A 1S10A 3RBXA 3OJUA 4UOCA 4IO8A 3QRRA 1NGHA 3GYXB 4YDXA 2ASPA 3RAMA 2LXUA 1YJRA 3FLCO 5CE3A 3RRGA 1JLBB 4B3TF 5KFPA 1YLXA 2A2CA 1TL1B 2PMZD 1I3AA 3KK2B 4I7FB 2L3MA 3BSAA 9ATCB 4NXMK 4OZ3A 4PL7A 4KHUA 2P9UA 2G1DA 5LOQA 3VGVA 1KAYA 2L08A 4X4NA 1DLOA 3C14A 4JRQA 2YNFA 3LL3A 5TKWA 2ZD1A 1IKWA 3BR8A 3RR8A 2C28A 4FF2A 3I6PA 4YHHF 4JI5F 2DO4A 4YDUC 1SKRA 3D45A 2Z1JA 1U2VB 1M5HA 4MK9A 1OMSA 4DXLA 2G8WA 5A6PA 4GNIA 4QIFA 4Q44A 1SKUB 5A2QO 4PWWA 4FF4A 3WXMB 4GO5X 3EGWB 4USMA 3THVA 5HVHA 2DFEA 4ZN3A 2JDJA 2POKA 3L95X 5MLCV 1Q0NA 1J6ZA 2WTFA 2W24A 3TSPA 2AZ1A 1N4LA 3KUEA 1Q78A 4P10A 3M1VA 4U6PA 1RTHB 4ZP9A 2EC2A 1RAJA 3MPYA 5CZXA 4DV6K 2Q79A 3PW7A 3BPDA 3LP3A 2YKAA 1VQPN 2OGUA 1XIQA 1WBBA 1YBAA 4MQ3A 1Y97A 2O5DA 3J81j 1Q5VA 2BXJA 4DTMA 4Q8FA 2X74A 3S1TA 2KKHA 3BGLA 1RILA 1WSJA 1EX8A 4HI2A 3OYGA 2VV5A 4KJIA 1TFWA 1MWMA 3AGKA 3W5ZA 4XTTA 2ZVSA 4IJAA 4IEEA 2IGIA 3MUMP 3DRSB 4L75A 2WBRA 3BGOP 1NJZA 1TELA 2LA4A 4WYBA 4B3OB 2FVRA 1WC6A 3OTOJ 2P6TA 3QNOA 4C0HA 1DY3A 5AQHA 4BVPA 2XB2D 5ADXA 1VHIA 3OR1A 4NA2A 1WTBA 1ICEB 5A6WA 4Z7CA 3VQPA 1KVCA 1WC1A 1V3RA 3K17A 3CJKB 1CC8A 4CK2A 4DV3K 4ISGA 3MOZA 1EHWA 2VCPA 2UXCJ 1FRHA 3CIPA 2GVZB 4ICLB 4UOHA 2DPJA 3CC7S 1HNZK 4FM1A 4K4XA 2AJ2A 4BRIA 4K8ZA 2AGQA 4F0MA 5LMUJ 4EFAC 4ILJA 4J2BA 2PD1A 1R89A 5DO2A 3LP1B 3QJJA 2YV0X 1ZAVA 1S1WA 3TANA 3SIPB 2KJWA 4F4AA 3OVSA 1VR6A 1RAEB 3ZETA 5THWA 2GWKA 1U1OA 1CZBA 3LA0A 2MZJA 4PPDA 4CJKA 1S1VA 4WE1B 1JJ2M 3Q8YA 1RKIA 4RNOA 4IOAQ 1EQ0A 1TMMA 3M2UA 1Q4RA 1QY7A 4DR4J 4YS2A 1U24A 2V4RA 4P2MA 3DXMA 1BU6O 1TAQA 1N52B 5KFDA 1C4CA 2DRAA 4NCBA 1H2UX 4CYUB 2E6LA 4NLQA 1XR6A 3FMWA 2G8FA 3VHQA 2RE1A 1FNMA 4M41A 1RBOB 1RTDA 1BDGA 1N32F 2MDAA 4LFAF 1HA1A 1IJEB 2VPZB 2GELA 1N34J 1KS2A 3A8EA 3F9MA 2M0GB 1QVGR 2O8CB 5HATA 3TUPA 3CCLS 1QAIA 2QV6A 3CPEA 3H5UA 5JXSA 3PZPA 1YUWA 3UVJA 3MM7A 1WB9A 2V34A 1NCLA 1I6JA 5IT9O 3Q8QB 2DRDA 2FZGB 4RR5A 5C24B 2ALZA 4U7CA 4FJ8A 3ENBA 4PUOA 3JYTA 3GPAA 1YI2N 1T05B 3ITHA 4JV0A 1S6QB 3ZFVA 1YJNS 3GV7B 4K4UA 3F73A 3ISNC 3KG1A 2F8EX 4OV1A 4KH5A 1RT5B 1S48A 1RTJB 4DV0F 3O9SA 5CQGA 3CNQP 1U04A 4QYZJ 1KOHA 3WQPA 4ES3A 3J7AP 2ZVIA 4AHCA 3ZXWA 1VK3A 1CJTB 1RB0A 3HSDA 4Y6IA 3UFCX 4PXBA 2Q31A 2NRXA 3TAFA 2LSNA 4O8KA 2HK2A 3CJCA 3THYA 2EG2A 2XM3A 4B3MJ 3ZZUA 1VQOS 5EX3A 2IJFA 4ZJOA 3UDCA 4X4SA 2EW9A 5KPRA 4ECTA 3U3YA 5CZ2A 4EP4A 5M2RA 2JEFA 2I6WA 3RG6A 2JVOA 5AZJB 3P49B 2A1RA 2BANB 2FHJD 1M1KT 2R8JA 1OVQA 2AJFE 4B02A 3MMCB 4ILMA 4KHPK 4FNHA 3TR8A 3PV8A 1NSQA 4BCAA 1UVKA 2D7SA 3ET6A 3H1QA 2E7XA 4KPYA 4ZLJA 2XMAA 2XCPA 3C65A 3PVXA 1IJFB 5J2NB 1NWKA 2OP5A 1FTCA 4A8FA 2E1YA 1RWNB 4JK9A 4XIUA 2J0QD 2L9NA 2P2CB 4NZ6A 1BQXA 2IDEA 3EDQB 3JSRA 1RHQB 2J7UA 4PG5A 3HSCA 4KRWA 2E1ZA 4FWRA 5DS7A 1FJGJ 2Q66A 3E2EA 4Z4FA 1T03A 2J6UA 2XNRA 3AVBA 4Y3CA 2FJAB 3MAQA 3VN5A 4ID5A 1JCGA 3EGNA 1K8AO 1P90A 1IUJA 1F9HA 1VBKA 4DX6A 4CJSA 3GL1A 1HX1A 3ZX2A 1UZDA 1XC9A 4X62K 1S99A 4IQMA 4YB6A 1T9TA 1RDDA 4C11B 3O4WA 4DR1F 4FJLA 2VBXA 4JI0K 4J91A 2VODA 2LYVA 4WYLA 3IWNC 2DHGA 4L6V3 1YVNA 2GJIA 2CQGA 4LF5F 2AP6A 3CCTA 4CO4A 1C1CA 3WXLA 2I7PA 5ETOA 2VFSA 3KK3B 2BKOA 2JWLA 2Y8YA 2YTCA 4O3OA 3VAJA 4JV5K 2ASJA 4CZIA 4DBQA 2O4GA 2ZF5O 3OVAA 3DGPB 4RW7B 3K58A 2MQQA 4OLBA 2KW4A 1BA1A 4S0MA 1VQNS 4F7VA 4W92B 4P7TA 4DFPA 2A41A 1S97A 4DR4F 4RW9A 3P5TL 3EY1A 4HI1A 5D0HA 5FD1A 3I8BA 3DLJA 1VSMA 1WSFA 1ASVA 3D54A 1ZM2A 3LTOA 1HYSB 4FM2A 2JGUA 1RWPB 3IG1A 5ITHA 4OYBA 5HBMA 4CIOA 3LP2B 1URNA 1X4EA 4YY3J 3QESA 3I56S 4ED3A 3MMJA 1SIZA 1TZ0A 4KREA 3IWLA 2ZJPL 3KJVA 4MKAA 4AH9A 2HQ3A 1EXQA 1YIJN 3GV5B 4WQ5A 1NNEA 1SUQB 4OL8A 4NI2A 3OUYB 3THTA 3UNGC 4MTPA 4DUTA 4E19A 4ZLNA 4JKDA 2W4CA 3OLAA 4HDHA 1VQ8N 2HHVA 5AJ3F 1R3NA 4E8UA 2ACYA 1Z4UA 2M4MA 4IFEA 4I64A 2DY4A 2BQRA 2VU5A 1S9GB 1MROA 2WK4A 3Q89A 4KAIA 1IKVB 1UKUA 2GMHA 1CJUB 2QA4N 1GFWB 4CERA 5B8HA 2PFDA 3NH2A 2I1RA 2OA8A 2AJQA 5C15A 2OELA 1NJIO 3KZBA 1HWLA 3T1AA 1M1GA 1TL7A 3BDPA 4NMLA 3UD5A 3AO4A 4KC5A 1ZZNA 5CYQB 1VQ4S 3ILIA 4IH6A 2I0XA 2XG8A 3L4BC 3FZFA 3NNHA 3KG4A 4MIAA 4OPKA 5AQJA 4IH7A 1NJWA 4JYAJ 1RAFB 2ZD1B 2HHXA 1OQ6A 5HMWA 4O0JA 1DTQB 3SI8A 2R7VA 3UDEA 2JLEA 4LF8F 2LEPA 2YHBA 2X6SA 1DKGD 5LMNF 1SH3A 2V2KA 1FX4A 4C6AA 1BD6A 4DTOA 3AOCA 2FD2A 4V19S 1SL1A 3NY0A 5I3UB 1FNXH 1LWEB 3K0SA 4CJ3A 3CO0P 1QAYA 3DXKA 3GE9A 1DGKN 3T9ZA 3K0JA 3UCGA 1RT6B 2HNYA 4PAAA 3ID6A 4WP9A 3V6DB 3SBMA 3F0NA 4LSLB 1TGOA 1U48A 4EBDA 3QT5A 1SZ2A 4JI2F 3MXMA 3VGMA 5GAGP 3SCJE 5KAKA 3U02A 2VG7B 4DPTA 4DR7F 2IIHA 4W5OA 1FJ7A 2Z2MA 3W9HA 2NRTA 1QM9A 3I32A 3ETOA 2VASA 1NJXA 1YDLA 4F0HA 3T5KA 2A5XA 1ACMB 4AL7A 2LEAA 3WEEA 2DIVA 4Y2KA 1E6YB 2AD9A 1XMQJ 4X2BA 1JLAA 1HNIB 2UVRA 2F4VF 3QMQA 5A2QU 1Q81O 2V63A 1UJ4A 5KRSA 2CKWA 1P9YA 1N8RT 1I39A 2FSJA 4PKDB 4TXSA 1LXNA 4DR5F 3P31A 3LALA 2KU7A 3AO2A 2DR5A 4HDGA 3W3DA 2PIIA 3QERA 3QEVA 3CC4N 2U2FA 5BR9A 1VRUA 5KG5A 2HHHJ 4DS4A 1VLYA 2PYLA 2ZFHA 3RW7A 3ZSOA 5M1PA 1RE1B 3AAQA 3ULEB 1SL0A 2VA2A 3EDRB 3CCSS 3MI7X 2PT0A 2Q3PA 4TLQA 1K47A 2Q1NA 1JLGA 2WB4A 4PG6A 3RB4A 1HI0P 1KD1T 1IO2A 1NLVA 3AQPA 2BJDA 5A0YA 3MGJA 2QFJA 2XULA 1JB0C 2W8LA 3BO2A 3RGIA 4H5WA 2RHKA 1NM2A 1ZBSA 4DTNA 4CM2A 2AIRB 1QTMA 2MKCA 5LJVA 3H5SA 4N47A 2HNYB 3J7Z5 1OYEA 4B8CA 2FIUA 4YB1P 2C2KB 4B3RK 5ADXH 2O8EA 5FRNA 3CHWA 3MUVP 2NNWA 1ELOA 2XGQA 4N8OA 5AQIA 1VRTB 1RDCA 3CFRA 3K5LA 4WJBA 4PWDA 5L39A 3RBZA 1QZ5A 3VF0B 1SL2A 3T69A 3A2FA 2DEIA 1Q8KA 4DTRA 2MZTA 2P9PA 2A1SA 3ZETB 4FJHA 4CF9A 4WFAQ 1VQPS 1M5OC 1UP1A 3DDKA 1IXKA 3ENVA 2V2ZA 1PO6A 2WSCC 1OKJA 1DTTA 3JQMA 1FRLA 3D1HA 3T41A 2K3KA 1TMJA 2XSJA 4CFDA 1F9FA 3TTCA 2DXFA 4K4SA 4HUEA 2GVZA 3FQKA 3AO5A 2EFGA 4RW8A 4CNYA 5A8KA 1UAWA 2DNQA 5E3AA 4J9VA 4URGA 4WFXA 4K43A 4ECQA 1VIOA 3ULDA 1EO1A 1U1NA 3FCVA 2G8IA 1ASWA 3HJVA 5SWMA 2YJFA 1HR0J 4OPAA 1Q82T 4HCCA 1N0VC 3HL8A 2W9BB 1EKEA 4V1Ak 4WFYA 2AF6A 1YG0A 3WUHA 4EIAA 3KLGA 3GU0A 3PX4A 4DHYA 2Y9HA 3L2VA 4M5DB 4DR3F 1HBNA 4G6VB 2AKWB 3NMAA 4QPXA 1Z1ZA 3TZWA 2KVQE 4TY9A 3MMVA 4Z4HA 4M42A 2GJFA 3TAGA 3ZCMA 1UMJA 2P9NB 1KEKA 4CO3A 1IR0A 5KT3A 4MT1A 3SAFA 4CLSA 1NK4A 4MAKA 4JI4F 3OHBA 4HTLA 2A2DA 2JSXA 1HARA 5BR8J 5FPMA 3VENA 4WCEQ 1HNZF 5AQNA 2FBYA 1HWUA 1X4BA 3WNEA 4UQGA 4BRQA 2VPYB 2E1AA 4EYHB 4A8YA 4W5TA 1JQGA 4FJ5A 5E3CA 1FXLA 4NCGA 1YWXA 3LDOA 1T8EA 4FWPA 3AVAA 1BUPA 3MM6A 3SQGA 3OYAA 2B4JA 2RVJA 1B70B 2UUBJ 1HPZB 4OYWA 2AEFA 1IVZA 4NLOA 4NASA 1JLFB 2UUAF 1FXRA 1R6YA 5IT9U 2QWOA 4DV7K 3O5BA 1GLEG 1Q1KA 3MWTA 2HZVA 1DTTB 4ED1A 3I0RA 3PM9A 1YSJA 1DURA 4DR1J 3PO4A 1ZBTA 4NX9A 4IG0B 2B4PA 1CJTA 2GIFA 1IR1A 1LWCB 4JI3K 4RPFA 3C16A 3I0SA 2U1AA 2OPRA 1WOPA 2W9AA 3G82B 4PG7A 5KFBA 3C6TA 4FCYA 1O51A 1LKZA 3NGIA 3I5CA 1IM4A 5E26A 2N3LA 4DL7A 2D69A 1VBYA 1JJCB 3M8WA 1U25A 1KQFB 1WAFA 1SXLA 4CI0B 4KI4A 2OANA 4F4XA 3BDEA 5RUBA 1NMNA 1WORA 2UXDJ 3CVKA 4R0JA 9RUBA 2D3OR 4IFYB 4KPCA 1S72S 4B3TK 4ZIVA 3DLLQ 3CEDA 3GR1A 4BWJA 3N9UC 4OI3A 2YKOA 1DFDA 3PLAA 1UVMA 3CCMS 1AW0A 2BM0A 2NRVA 1JJHA 2W6KA 2BRKA 2COLA 3FCHA 1HFEL 5AZJA 4YOYA 3D6HB 4IG3A 3K8WA 4XDCA 2IRYA 2YNHB 1NPRA 4WIIA 1F60B 2DJWA 1FJEB 3QEWA 2FQQB 4A8QA 1I94F 3ICLA 4MK7A 3PFEA 1NMEB 2HMIB 2KT2A 4CJTA 4J9NA 4CZGA 4IH5A 4OX6A 4BREA 4FLVA 3FBEA 3BY5A 2YXLA 2QMUB 4H4OB 4I6AA 2MB0B 3OYEA 2QL5B 1H3DA 4N5SA 3M5RA 3QRQA 1SJQA 1BWFO 4FYYB 1JX4A 4ZPCA 2Q0RA 4DPOA 2V94A 5ETLA 3JSMB 4N41A 4AQYF 4WZMA 4WPAA 4GW6A 2O67A 2EWSA 1TAUA 2KM8C 3NBPB 3EN9A 5GADP 5CCMA 2OEKA 4CEZA 1HHTP 3CULA 2IC3A 5F3TA 3K9KA 1FRMA 1SH2A 4RW9B 5E41A 3BEXA 3TABA 1UJ5A 3OW2R 4JNEA 2MLYA 3BBFA 3Q24A 2K06A 1M1KO 1S5ZA 3OFFA 4KHYA 1MWQA 4IFYA 1RHUB 5F8MA 2Q97A 4LFAJ 4OMFG 5I3PA 3D2WA 4NEYA 1FT8A 1CJVB 2HNZB 2O8DB 4CLFA 3MN9A 3K5NA 1LW2B 4URSA 2UUCJ 1IBLK 3ATUA 3H4DA 3E9PA 1B0VA 4JI4J 1XMQF 1NHUA 2RU3A 3IFRA 5C10A 4JKBA 2GX9A 1GOCA 4X4VA 3E01A 4CO5A 4E89A 1P6TA 5LL6Z 4LFBK 3H59A 4DV5J 3V4MA 5FLXU 2OSRA 2BQUA 4E1JA 4M5GA 1CZ9A 1RLDA 1TL7B 1NGEA 3F41A 4K2XA 3C66A 3LW5C 3AA9A 4AT1B 1T9YA 1ZC6A 3P5BP 1JKHA 2VG5B 2QSWA 4ZKAA 4BC7A 4HTIA 5SZTA 2ZUGA 1NJYA 1TUUA 3NG8A 1VQSA 2OPPA 4W5NA 3ZTQA 1AUDA 3B8HA 3OS2A 2FTRA 3KJQB 1F9EB 4JV2A 4B1ZA 1S9GA 3AA8A 4TYAA 2HNDB 1UW9A 1BA0A 4ETZA 2F9TA 1ZBLA 4OJ3A 3SJJA 2RQKA 1NG9A 3IRWP 1HNWF 4K7QA 4CNZA 3FEZA 4CIEA 2E5GA 4ZP8A 3W2VA 2AHOB 3ZEUB 4XPEA 3AB4B 3A8JA 2RHQB 3BF4A 2CGKA 3UWTA 1DJ0A 2EVZA 4M5NA 4KH1B 3FSYA 4AILC 3PX0A 1C0MA 2DGWA 3KK1A 2LFVA 3OS1A 1ATRA 3CC2S 1R8PA 2B0GA 2GMLA 1XNQJ 4KQZA 4JYAF 4X66K 3B6BA 1TVRB 1BWVA 1HWKA 2NLWA 2VFTA 2D0AA 2HBQB 3BSOA 1G15A 4DFKA 1DTQA 5EXWA 1IBMK 3AD9C 2HF3A 1E6YA 3HD1A 1HHSA 5FLXY 4KTWA 3TU5A 1YTYA 1T7PA 4DR1K 4NYOA 3RZAA 4RUBA 1BQNB 3B4MA 5KFMA 5DG7A 1NSAA 1F2GA 3RRHA 3ZSXA 4YNQA 4NLTA 5HVFA 3D2FB 3UKRB 4LQ9A 2BUPA 5J2NA 5AQLA 4HCBA 2VH7A 2ROEA 1KCFA 3PHTA 1QE1B 4LSLA 2RHSB 4WFBQ 5CY4A 5CYMB 2QTWA 3JSBA 3R2DJ 3P4UB 2YKMA 4KHNA 2UUBF 1VRUB 1FKAF 4F02A 4KV8B 4EGLA 3HVWA 3X1LB 4PCQA 3R5JB 5IWAJ 3LWLA 3R1HA 1HNXJ 4I4BA 2WVFA 4WFBL 3AA5X 1HNXF 2V2VA 4DDFA 4O3NA 3HHEA 2K2PA 3T9NA 1CBKA 2GVDB 1RNHA 3U1MA 4JI1K 4AHRA 4BWMA 5E3PA 2J0XA 2UV8A 1TK0A 4JN4A 3KMQA 1FF2A 4EFHA 3BSCA 2W7AA 3MN6A 4USKA 5IQQA 2F4VJ 2KH9A 1WSHA 4DN0A 4YHHK 4U96A 3LM9A 2E2OA 3HXMA 1RYSA 3I87A 3RSEB 3AXMA 4CJQA 4FZVA 3IR5B 2NXNA 2QKBA 3E8OA 5C2CA 3V9UA 3UDVA 2VHGA 2KFNA 3B4DA 3GIMA 4C2MA 1LAVA 4DU3A 1CLQA 3DJCA 5DM6L 3MAAB 3OXGA 1TVRA 3D6TB 4PA1A 1FKPB 2OPQB 4ID8A 4RW7A 1NUEA 1A5XA 4GC6A 1AB8A 2IBOA 2WVCA 3V1QA 2WBMA 2QJ3A 4LMZA 2VJUA 3ZZYA 1F6TA 2RF2B 1C0TA 4EZ9A 1QQMA 4LF5J 4ZVOB 4NYZA 2B6AA 3KVGA 1UWBB 3ZZPA 4GV6A 1R0AA 3V81A 2V52B 4JKHA 2ZNZA 4DR7J 4FW2A 2PO4A 2P9LA 4CO1A 5F8JA 2ZH8A 1AXQA 5J2QB 3OPKA 1VI7A 2AZ3A 1HBMB 1N34K 4LF9J 3I56N 3NGYA 3I55S 3VAGA 1TKXA 4RTFD 3CQYA 1RWWB 1K1QA 1UEUA 4EHTA 2KTQA 1T05A 4EK2A 2ZKTA 3RAQA 3MPWA 4CH7A 3ALYA 4KH4A 1IM6A 4WFAL 2UXBJ 2KFYA 4DL5A 2D9PA 3CCEN 4MYTA 4ZITA 4JI7K 1CULA 3K5MA 3DDIA 5LMNK 3F5TA 1U1PA 3VQCA 2HG4A 4I2QB 2NZ4A 3TUIC 3TRGA 1QDUB 3TEHB 3M8QB 4RU9A 5K14B 3BZCA 4LRAA 2RB7A 4MDAA 3HHNB 2XSJB 5F0XA 3CJ8A 5L8RC 2P6SA 2MPUA 3EO3A 3DYAA 4DV2F 3M2RA 2J6TA 3OYJA 4J9SA 1GK8A 2XHWA 5J1NA 3TAEA 3GE1A 2NUUG 3T5HA 2W2QP 2F8SA 4CGFA 1PYSB 1N5VA 5ETVA 2CJAA 4LFCK 5HOOA 2MLZA 2XMMA 3DLHA 3D68A 3KD1E 3A8YA 2ZBQA 4A2BA 2QLWA 1K0VA 3NF8A 5IM0B 1VQ9N 2VOOA 2VYPA 1WHYA 3DRXA 4F4WA 4O8UA 4OI1A 3S01A 3G10A 1N6QB 1WEXA 2E9RX 4OYAA 1G3OA 3CJ3A 3VAIA 2PFFB 4DR3J 3O2IA 1LWXA 1SJ4P 1B92A 3V4IB 3ZX0A 1VQ7N 3LF0A 3NGUA 4CGIA 4K5RA 3CCMN 1D8ZA 3AB2B 2WBNA 4TU9A 4GVEA 2A3JA 4GVLA 4FWLA 5ELZA 2P9CA 1OY9A 3MCSA 4OX8A 2BJEA 3POTA 4FW1A 2Y0BB 2H65B 5IV3A 3DRPB 2ASLA 2FLLA 1T44A 2RQCA 4IYQA 2N7YA 1UEKA 3IXQA 3WQTA 3KLFB 1S7HA 3PSFA 4F2RA 2HAIA 4Z94A 2EPIA 4O5FA 5BPLA 5LSLA 5AQZA 4BRFA 3N4WA 4J2DA 3CETA 2YX1A 1NNDA 4FF1A 3NMRA 1S4FA 4JI4K 2R7OA 4H03B 4HACB 3C46A 5C42B 2I2YA 3HKZD 4H5NA 2K7JA 4ED6A 1JLEA 3NH1A 1QLNA 3OTBA 4DSLA 1SV5B 3NNCA 4WP3A 2P5OA 3MN5A 3AJ1A 3NRBA 2R3VA 3Q7CA 2DGQA 2IVOA 2RN2A 4I9LA 3VGKA 4C8MA 1RBLA 2VWJA 2ZDPA 3PJWA 4LVNP 4CO2A 1BQMA 4LRBA 1R59O 3D6FB 3BV8A 2Q3SA 1S4EA 2UVUA 1TL4A 3CMES 4KGZB 2CG8A 1RTIB 2MXYA 2LDIA 1NHVA 3ZTOA 4JI8J 1A5WA 4HYKA 4NLCA 2QA4G 3PFOA 4WE1A 3OJSA 4PKHA 2C2DA 4AHUA 3HHLD 3CMAS 2CQ3A 1MMLA 4OZ2A 5GAEI 1AUSL 1C4AA 5HBMB 1UFKA 4L3NA 5KFRA 3I5BA 4CF0A 1VAZA 3ZT0A 4C3MA 5MAOA 3OT9A 3PYEA 4P74A 3MEGA 1VQYA 5FPEA 1RACB 5D4OA 5HRSA 4WK3A 3DM2A 4JKCA 3DRPA 1VRTA 2V8VA 3NCQA 4OVLA 3L9ZA 3MWPA 4ILRA 3IM9A 4RW4B 3HVAA 2UU9K 2EBEA 1GQEA 1U7LA 2A6OA 3CJ0A 1S1TA 2XEXA 2CPJA 2M5YA 4AL5A 4HVJA 3VQ4A 3H98A 5J1EA 4WYWA 4E1NA 3L6QA 3KHYA 1YT3A 5CCLA 3AY0A 4D3HA 4HL9A 2WAQD 3IBWA 4BVOA 1RWKB 4KHSA 2ZWOA 1N33F 3EKUA 3MR5A 1NKCA 3A1YG 2N7CA 3NL0A 3MCMA 4FJJA 4DLGA 4ELVA 4A8KA 2C2EA 4K4TA 3W9JA 1NJIT 1I94K 1RHMB 4NA3A 3C3LA 3MOJB 2R7YA 3AXKA 5AQTA 3W60A 1S1XB 1N54B 1DZ5A 2DYAA 4JV1A 2CQPA 4J7CA 2ZJPQ 1U26A 2AYMA 3WIUA 2ZH2A 3GJRB 2OHDA 1FERA 3QZ8A 1FK9B 4K4YA 2A1BA 2FB0A 5BJRA 3GJQB 2BACA 1RT7B 1YRUA 3IAS9 4RBTA 5CR4A 2FBXA 4ETXA 4C97A 1X9JA 4N8NA 2KL8A 2QGFB 4JB8B 3PIOQ 4HEA9 4X62F 1BWEA 1FD2A 2RDIA 4OZLA 5D4NA 1GNKA 5KFEA 2R2UA 1FEHA 2ZZTA 3R5GA 4DZDA 4ERDA 1U1KA 1U45A 3MMCA 1JKHB 2OPSA 4RX6A 5M2PA 5EU7A 3PIOL 2FYXA 2GIQA 4A8WA 1H98A 2XMUA 4L3KA 2ZM6J 3SXLA 1N34F 4AM6A 2CJXB 5CXTA 1K6YA 1G4CA 4IOCL 1GMWA 3CIZA 3NS5A 3TQEA 1P9QC 3RMAA 1R27B 2AWZA 5FLXO 5LXRA 1QSLA 4PR6A 2R7RA 5GMEA 3NFAA 3OFGA 5KFUA 3AA4A 2ZH1A 1HQEB 1HIYA 5KFIA 4OZ0A 3SI6A 2L9DA 3RAXA 1TKTA 4DQQA 1YJVA 2R8HA 2KXNB 1T95A 3UQSA 3FBBA 4TY8A 4BC3A 3OSPA 5C25A 1KXPA 1KONA 4A8XA 3V6HA 4FN5A 5AQGA 1Q82O 3ZZZA 4Y34A 4CRJA 2AW0A 4BRCA 2KVIA 1X31C 1GOBA 4DV4F 5DDOC 3BYPA 3J7YU 5T41A 2ZWPA 4USWA 1EIYB 3LQVA 3UCUP 3MEKA 1Q8LA 4H0YB 3J7YI 2G2ZA 1DQ9A 5F9NA 2NR0A 1KKHA 4NLUA 2CNNB 2ALYB 3NGDA 4CJRA 4ZLPA 3L3UA 3MXJA 3QIOA 2E1MC 3EGZA 2X51A 3L3VA 3ZZTA 2VGMA 4A5BA 3RMDA 2AA4A 3TA2A 3HPHA 1J2VA 5FPNA 3C6UA 3V6JA 3HSGA 5DM7L 3SV4A 2H3EB 2XLKA 4RU2A 1FWLA 1H1VA 3ENHA 2RS8A 1YZ6A 2GHWA 3FFIB 5DDRC 4CI6A 2PC6A 4JHDB 2OD4A 4RNNA 2DR8A 3SNNA 3NOCA 2NCKL 5FIIA 2OFGX 4JI6K 3K5PA 3H2VE 1HYSA 2HIYA 1RBAA 4WU2A 4KO0A 4B1UB 2VDHA 1RT3B 2DNYA 2ROPA 1B7YB 4NL5A 3O6WA 2VD3A 2IM3A 1U8SA 5CYMA 1XN9A 2HGMA 5D0GA 4B1WB 3HK2A 1O6XA 1HLWA 1QTNB 1X60A 4CLWA 3PX6A 4PZVA 3HLUA 3M32A 5CYQA 3GQCA 1RKJA 2V8HA 5ETPA 2Y3YA 3VMFB 4LF7F 5AQQA 4CZKA 4CLUA 3OYMA 2JL9A 3I4HX 1BLUA 5HI7A 2KHOA 1P8ZA 1RTJA 2FHKA 3NBPA 2QL9B 4KBIA 1HMVA 4PQUB 4C0OC 4ILHA 4ELTA 1KTQA 3QIPB 1IV0A 2DD8S 1IKVA 3D9BA 2JOQA 5T7BA 1FE0A 4IR1A 3IBCB 4EZ6A 3RYLA 3HHLC 4MIBA 3W8PA 5H9EJ 2CZVC 4DG1B 2ZHAA 3GFHA 2W40A 2QC3A 2V8PA 5BXIA 3T6BA 1HBMA 4DPUA 5HL7L 3Q83A 2HYIB 1NKEA 1KDNA 4A57A 2F9JA 1NK7A 4LFAK 4ZCIA 3QGGA 2UXBF 2IDOA 3K2PA 4LF7K 3PR4A 3T1HK 1HPZA 4CLLA 4FYDA 3LP0B 2QMWA 4I2PA 4ECWA 2W01A 1NK5A 3L8BA 3SLCA 1KD1O 3IC1A 1WWHA 3VZHA 1TUYA 2H9ZA 2HHHK 4CT9A 2B9EA 2G0JA 5SUHA 2NYIA 3AOBA 5EHHA 3PW0A 3GG4A 5KFYA 1U2FA 1Q16B 2YI1A 4IXCA 2WSEC 3GIIA 4RG8A 1N33J 3TAPA 2BVZA 2IVMA 5KFCA 3Q8SB 1B64A 1CJKA 1IBCB 2LQJA 4R0EA 4NLGA 3V2UC 5GAGI 5EUHA 4B9MA 1BOTO 2ABYA 1VJWA 4JKEA 4E7LA 4WIQA 2ZWHA 4G1QA 3HSJA 4AD6A 2V9KA 1VQ5N 3EE9A 5H9EK 1D09B 1O1WA 4YQWA 3BF1A 1RZMA 4BRHA 2IYGA 1Q81T 3TZXA 3Q8PB 2XBPA 5FPDA 3FBCA 1TL3B 4JI5J 3AVHA 4F3MA 4ZVUB 3U8XA 2WSFC 2WVDA 4ANCA 2YH0A 4M8LA 7FDRA 2GFFA 3AH6A 1YITS 2ZHBA 3O9RA 1C1CB 1DAXA 3MEEA 2CYYA 1HBUB 2CNOB 4LVOP 5GIOA 4DG1A 3ZZOA 3MCNA 2AGPA 1X5OA 3OVNA 2NRRA 2YHAA 2E1RA 2EG1A 3CC4S 2OKQA 4F26A 2CWKA 2MJUA 4M3UA 4EBCA 3NXZA 1F3FA 4WZQA 2ASDA 2WC9A 3O1BA 1C0UA 3JQKA 3E1YA 1SI9A 3H0PA 4E0DA 1BHLA 1BXNA 3IUCA 4FK4A 1F3VA 4I0WA 1MMDA 2QYGA 1ESVA 3U9ZA 4W5QA 3VGUA 1WF1A 4X4UA 2JJ4D 5DQIA 2AX0A 5GAEP 4DQSA 2CQIA 2D74B 3K8VA 1M1HA 1JLEB 4G65A 3J7A1 4ZLLA 3WIVA 3HZEA 3TR5A 3M6GA 1WC4A 4D3GA 5T14A 1SUQA 4OV6A 3VPZA 4CH0S 4CZMA 3TA1A 4QS9A 1KQKA 5IWAK 5T7LA 1WF0A 4PG8A 2QO3A 3S3MA 2DT9A 4FWSA 2BGGA 5M1OA 1HBNB 2ITGA 5GIPA 4KI6A 1JMTA 5IV4A 2IC3B 1R43A 2RSQA 1JLQA 2YPYA 4HT7A 4ENOA 4QIGA 2YKNA 4B9TA 2YWGA 2MLXA 1GLLO 2ZBPA 2ZE2B 5BPMA 3PSIA 1IBKK 4FBTA 2ETJA 2HZAA 2NXJA 2X3DA 4EUVA 3GIRA 1HNVB 1EKRA 3HVRA 4JAXA 5KOWA 1D8YA 3BO4A 4Z37A 4FVCA 1VQNN 3MEEB 5GMKa 2O8BB 3MEGB 4JOUA 4FLYA 2E20A 1FDDA 2GMJA 2DR9A 4ZDNA 2WUSA 4Z2XA 3LANA 3R5CA 3OXLA 3OSNA 1KVIA 4X66F 3DRSA 2LXIA 3SQGB 3LDLA 2R2TA 3VV2B 2CDRB 1C0UB 3PUFA 2WONB 3B8AX 5DK5A 4N7TA 2FZCB 4OJHA 1JLCA 1NGGA 1SQFA 2FZKB 4LT6A 3JXOA 2W9CA 1APSA 4Y0WA 3VVUA 1ZM3A 2RQMA 2QA4S 3C6AA 4MFBB 2IBKA 3TOQA 2V7ZA 4DL2A 1N88A 4QIEA 4NO7A 4QIVA 4G1PA 1XNRJ 1DRZA 4F0KA 2YWHA 4B9VA 1V5IB 1VQ8S 4F9OA 4ZN1A 4H0OA 3QGPA 4DPXA 2Z2ZA 3CDUA 3NMUA 4Q2LA 2VB6A 2E8AA 3G86A 1FRIA 2FVSA 3C0BA 2K8GA 4ECUA 2YJEA 3CT9A 1S9EB 2C3YA 3CCQS 3N5BA 3WX8A 4I2QA 4B3TJ 1FRKA 1NGDA 1OH8A 3V6KA 3OTOF 1S1VB 1SB6A 2FSNA 1N32K 2EKYA 2V67A 5B09A 3S3NA 2AV5A 5IXUA 3IN5A 2JC1A 1RHRB 4C4WA 1A6LA 2B9XA 4DMZA 4TQSA 4OYMA 4RJVA 5KPTA 1RCOB 3KKSA 3KLEB 4KKOB 5AQFA 1LEOA 1FCAA 3QEPA 4HVZA 2BABA 4CYUA 4GVMA 4CGHA 4OPHA 4DI6A 2EFVA 5LM7E 2CWXA 4X66J 4DR6K 4OYZA 4N56A 4DS5A 3GBTA 2XCAA 1FDBA 3VQ9A 1HQUA 1YRTA 3ZZRA 5AQYA 1JIHA 2OH2A 1BUXA 3QEIA 1J9AA 2WHOA 1HRHA 1UA1A 3TO8A 2R2SA 1FDNA 3DLEB 1FKOB 2YHXA 1GTHA 3P3DA 2XHBA 4Z4GA 1N6QA 4FWOA 4PXCA 3CB4A 2IS3A 2D3O1 2CVEA 3OYLA 4B3RJ 2EFNA 2PN6A 2MGZA 1WN7A 1GXLA 3KG0A 1K8KB 1WJ9A 4ED0A 2V9WA 2CAJA 3CCQN 3BP8A 4FLTA 3LPYA 2V2QA 4ZTJA 3UB5A 1FXXA 4IG3B 1LAWA 1C6VA 3V1RA 2XGPA 2YNGA 3AJDA 1Q9YA 1IKXA 1WLJA 1W9HA 4DPWA 1U2RA 5C25B 2YNHA 5D3GA 5GINA 3K7RA 4PYAA 3HBTA 3W3SA 2FY8A 4KFBB 5ETQA 1KLMB 4FS1A 2W25A 3MR7A 1ZTTA 1UA0A 2VQEJ 2CQDA 3F44A 3FZLA 1HI8A 2F8TA 4OZ5A 4FJIA 2UP1A 1AROP 1K8AT 2VL1A 4BRPA 4JI1J 3KWMA 1M0SA 1XR5A 4O3SA 3VAFA 1CXUA 4P2XA 2ILZA 3JTPA 1K73T 2G9OA 3H3NO 3DOLB 4NMXA 5HO4A 2FPHX 3D7EO 3SAGA 4DV5K 3VGLA 3IGVA 4J9UE 3Q2SC 1D0EA 4N76A 1HR0K 3O80A 4OHZA 4CDIA 3NGZA 3QLHB 1R8CA 1VBZA 2CPFA 4P9SA 2ZC3A 4JEPA 3NAHA 1VOMA 2B9YA 4Q8EA 2LEBA 1HUXA 1NPPA 2J9DA 4FPRA 3ZC4A 4KGVB 4CVNE 4MO4A 4AHVA 3OL8A 1S6UA 1S49A 3MX5A 1WI8A 5IZHA 1C0TB 3CE8A 1L3VA 3N5FA 1YJ9N 1VCTA 3DOMA 1HI1A 5KFNA 3I33A 1QQNA 1EETB 3HHLB 2PEHA 1P8GA 4CHQA 1B99A 1X3NA 1S79A 3NGSA 1XERA 1X4AA 2J8SA 1O5JA 1UW4A 3IBFB 4O44A 3NP5A 3UR3C 3L7PA 2G2OA 1NK0A 3ENWA 2O1PA 3M6VA 2HBJA 2B8PA 2AP1A 3WEEB 4CJEA 2KFZA 3O4NA 3CJ9A 2VG5A 2C1EB 2E2QA 4ECRA 3FFIA 4QAGA 4NLBA 4WKRA 4JV5F 1B0PA 3THWB 2E2NA 1U09A 4QU7A 4BRNA 3W65A 1GT8A 2FJBB 4FKXA 5KT7A 3PKMA 1RT4B 2P9LB 1TR0A 3V9XA 2MSSA 3IO1A 5DDPC 1IQZA 4BC4A 3D67A 5BRHA 3UIQA 1KAXA 5AXLA 1JNZB 2K1RA 4Z0UA 2JZ5A 2HHQA 2JVRA 3PCOB 4IO9Q 2CG4A 1G2EA 2X1BA 2A3ZA 3MMBB 2F8HA 4FJKA 2W42A 1OH7A 3CWJA 4JLHA 3F2KA 3VQBA 1VC0A 4WWSA 4U8YA 1IN0A 2IVFB 2HF4A 3AVGA 1IJJA 2OPPB 1S1XA 3VESA 2CPXA 4ER8A 2OMOA 3CCZA 4LF6K 3T5LA 5DMRA 4WF9L 3O08A 4W90B 1XWLA 2XMTA 7FD1A 2QXLA 4YORA 3J8AA 4NB4A 1CEZA 3DYAB 3N4QA 1VSEA 4P73A 4RZRA 5BYQA 4FJ9A 5AZIA 1RBTA 4NEZA 1N5SA 3QJPA 4AXIA 5IT9Y 1RCXB 1WACA 1UAXA 3CQXA 2F5GA 5M1QA 2DBBA 3HF5A 5AQOA 4TNOA 3C14B 2Y8WA 1A7GE 4Y00A 5KFVA 4FWQA 4PKGA 4RLEA 1ILYA 2E9ZA 3GDQA 1AYEA 1WSRA 4R8UA 3SBGA 1RA6A 4BR7A 2D3ZA 3ZT2A 4GKJF 1R31A 4CD3A 1S0VA 1G6BA 2CQBA 4HTJA 4QS7A 3D7SB 3HHDA 2GTDA 2IVPA 1E6VA 1NZAA 2RDJA 1DT9A 1I5OB 4LSZB 2B51A 1V3ZA 2MHEA 1UZHA 2RS2A 4K8RA 2EX3A 3LAKA 3TWHA 2XMWA 3JS6A 1RSCA 2CQ4A 4Y2IA 5KG1A 3KLFA 2MQOA 3M30B 3NCRA 2ZITA 2DH9A 4RBUA 4GRSA 4ITSA 3ZNUA 2CJBA 4CIGA 2YWFA 3AVFA 1VHFA 3A5NC 1OH5A 3Q8VA 5GAHP 7AT1B 2I9SA 3CG7A 1UTAA 1VQMS 1LW0B 4Y1DA 2Q36A 4KHQA 3FZHA 4DR6F 2GJ2A 1H2TZ 4PHTX 2ZBIA 3CPWM 1BHNA 4BC5A 4WP8A 3H8YA 4CHZA 2WZ1A 1DEJA 2YVSA 3PW4A 1X4CA 1S1UA 4Q5VA 1R0CB 2BOPA 4Y2MA 2G1HA 4IFVA 2GUPA 4NCGB 4HHUA 4DR2K 5L46A 3ZT3A 3PW2A 3JXUA 1TYQB 3PEJA 3RRKA 4LFCJ 4PG4A 5D8HB 3VQ8A 3GLJA 1RWOB 2V7YA 4DTUA 4ECSA 5CABA 3GG1A 4M1KA 3V5RA 2XMKA 1CZAN 5CA5A 4AHSA 1JLFA 3I5AA 3PRVA 3OLBA 2H5EA 2Z1IA 4BROA 3TVYA 4A8SA 2IPOB 2AEMA 2XS7A 5HRNA 2DEJA 3P5JA 5BR8K 1GOAA 4JK8A 4K2JA 3OYHA 1X1PA 5J2QA 2GUIA 2HMPA 3CDAA 4UY8O 2P9IA 2VFUA 4J9OA 1N5YB 3FSXA 3AJ2A 2UU9J 2XO7A 3QNNA 2E5LK 4J9QA 2JX2A 4ZIWA 4OZ1A 5EX0A 3EZWA 1DARA 4WTYA 4JV5J 2M8HA 1JWWA 1RBVA 3M32B 1CG2A 5EDWA 1YJTA 1CSJA 5F41A 1Q7YO 1RGVA 2G0CA 2OSQA 4E7JA 2DK2A 1RAGB 1NOYA 4RNMA 3TWZA 5HANA 1FK9A 2HFVA 4ISFA 3HM8A 4LC9B 3D2EA 5J1EB 1HQ2A 4DV2J 3WNGA 5IOLA 4ZVQB 2OTLN 4USTA 2BE2B 3UKUB 1WG5A 4NRUA 4YDUA 3C15B 5B08A 1RDAA 3VF6A 3B6OA 2GNKA 4A5AA 2WCXA 5AXMA 5JJBA 1GH8A 1T02A 4YOXA 2ZJQQ 1QHTA 5DZ7A 4IZ9A 4IQXA 3O1LA 3FSIA 4GMKA 1WUUA 3U1LA 5F0UA 3WXIA 3UNYA 1NGAA 3OTDA 5J1PA 1HNVA 2XRIA 3Q2TC 4HHHA 4WU3A 4CEQA 1R8AA 4ZA1A 3EICA 3A3OB 3RW6A 2QWQA 4MLEA 2ATCB 5KFWA 4IBNA 2UUTA 2XI3A 4P6QA 4MJKA 2AT1B 3TTDA 3SV3A 3NGTA 1RWXB 1HKAA 1MWYA 4PKIA 4PXEA 2FLOA 1TKZB 2JWNA 2KT3A 4LF1A 3RR7A 3R6MA 4CEOA 5DGBA 1Y10A 3QYYA 4L8RB 2QA2A 1WG1A 4HR2A 1K1SA 2GX8A 1WC0A 4RUHA 4QOTA 3TTFA 4K50A 2HSTA 1OS5A 1SPBP 2DH8A 4OI2A 1S6PB 3QWUA 3KLIB 2WFBA 5JUMA 3GILA 1QUPA 3POTB 4CWBA 2AJ0A 2A6AA 3JSMA 2FF3B 4YHHJ 4L76A 2KQ2A 2B5JA 2RDDA 3WNHA 2QI2A 2JHEA 1HNXK 5MLCQ 5U47A 4JRPA 4C3LA 4KSEB 1WDTA 5F2RA 3CMEN 3GFZA 4CTAA 1XR7A 1JK9B 3MM8B 2GQQA 4M7XA 2ZJRQ 4YR0A 2FUG9 3KLHB 3SQ1A 4NLDA 3KOAA 4QW9A 4F3QA 1RT5A 3H7HB 4DF4A 4LSNB 2C3OA 2KHCA 5GMDA 3VCDA 4HLBA 1SIWB 4H0VB 1N36K 4YR3A 3HOSA 3D3CJ 5ETNA 4M63C 4RWWA 4UW2A 2IAJA 2KYZA 4QU6A 3TUJC 4QPTA 1RXOB 3H42A 2UUAK 1PIEA 4O3QA 3LWMA 1U47A 3VVTA 3TAMA 2HRYA 3PG9A 4ES2A 1NAQA 5IWAF 1BQMB 5KT6A 3MAAA 4DSIA 3IR6B 4ZPAA 1ITGA 3ZLJA 2E7WA 3HPOA 3OR2B 3H3OB 4CBWA 4C8KA 1F5CA 3GSIA 4JHDA 1Y00A 3DCAA 1XUPO 3VAHA 2MQNA 1XBWA 3AARA 3VQ7A 3I4PA 4ID5B 2RIJA 1FJCA 1Z05A 5K9FA 1S72N 4KFBA 4JI0F 3MFIA 5KFSA 4OHVA 3U1NA 3LM2A 4BACA 3H1VX 4FO0A 3OW2M 2HHHF 5M1NA 2BH1A 3DKDA 4P52A 2IIRA 2HFOA 2VA3A 1MU2A 1CLFA 2ITMA 1VSHA 3R2CJ 4ZPVR 2MSTA 3HZ6A 4IG0A 1SC6A 4FZXC 4KHWA 4JI7J 3HOTA 2BOAA 2BX6A 2EK1A 2MQLA 2XWXA 4I6YA 2FSKA 4PRFA 3VA0A 3BKUA 3BBCA 4FJMA 2ZC4A 1VQ6N 2MMYA 1D9DA 4FOEA 4EAHD 4BR9A 3M3ZA 2ILYA 1PAUB 1Y3JA 1HD1A 1Z26A 3TJAA 1MSWD 3KLHA 1ZPVA 2QLFB 4DR7K 5KFHA 2LVWA 4J9PA 2R7UA 4B8AB 3D5MA 4BC9A 1S0OA 2GO9A 1L5UA 1IQTA 5A8WB 4UUWA 1Y5NB 5HLFA 4X65K 3BN7A 1RUSA 4Y28C 2H5JB 2RRBA 6FDRA 3ISND 5IM0A 1YHQN 4OYIA 2HGNA 2F7TA 1GX6A 2KN4A 1Y64A 2VBYA 2J9DE 1OPIA 1U2CA 4DU8A 4I6WA 2OFHX 4P72A 5LT5A 1JLCB 3MZIA 3NVMA 4BDZA 3MPVA 4Q7AA 3DC2A 4HHJA 4NLXA 1PAEX 5HRRA 2J76E 5HROB 3T1HJ 2M7SA 2XLIA 3JAMU 2MZ1A 1W7WA 1YVFA 2Y0SD 1KWMA <