3KLIA

Crystal structure of unliganded azt-resistant hiv-1 reverse transcriptase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
551
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 131
structure length 551
sequence length 551
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kliA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kliA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kliA05
1KVBA 2IOCA 3M8RA 5KFYA 1QTMA 3AVJA 5KG5A 4TQSA 5L9XA 4WFYA 3P5JA 5CZ1A 2WONB 4DQSA 3RR7A 1C1CA 4IQXA 4OPJA 2EC0A 5KG2A 2P1JA 3H08A 4GVMA 1LW2B 3CYMA 5HRNA 4DF8A 4DG1A 1UA0A 1HQEA 3KK1A 4Q44A 3KHRA 2O5DA 4RNOA 2WRMA 4N41A 1QE1B 4Q8FA 1SL1A 3S9HA 1XHZA 3PW7A 5KFQA 2D0BA 3KOAA 1J53A 3SQ2A 3VQ9A 1LWEA 3SQ4A 3BQ1A 5KFNA 1RT7B 4B3OA 1WSEA 2HNYA 2RF2B 1NK6A 3DOKA 2X78A 2YKMA 3K58A 3CJ4A 3LDSA 1GOAA 1D8YA 4KO0A 3DLEB 3KJVB 4O0JA 5J2MA 2IBKA 3KKSA 2FVQA 5KRSA 1L5UA 1FKOA 1S6PB 2YNFB 4O4RA 1Q8IA 3AVLA 4HUFA 1RT4A 3ZSVA 1OS5A 1TK5A 1VSDA 2BR0A 4ZVEA 4Q43A 1JLFA 4HHTA 4F2SA 3QEWA 1S9EB 1BQMA 4YNQA 3AVFA 4I9LA 3SUPA 3OHAA 4ZVGA 2ASJA 3QIOA 2A1RA 2X6SA 1S9GA 1FXXA 5KFDA 4KHUA 4CFBA 3PX6A 1NJXA 2IC3B 3RRGA 3K5MA 2XCPA 4ZP6A 3SI8A 2AJQA 4FLUA 1NK9A 4HUGA 1NOYA 2HVHA 3KK2A 4J9SA 5EDWA 4M3ZA 4H54A 3OYBA 3Q8SB 4DU4A 3OLBA 4XPEA 4HKQA 1U49A 3AO5A 4WYLA 4MIBA 4H4OB 4CEZA 2FC0A 3I0SA 1BIUA 3AVAA 5CZ2A 1C1CB 3K2PA 4M3XA 3IRXA 1C0UB 2OH2A 3MEGA 1TL1A 1RILA 4E7KA 4C8MA 1QAJA 4MKBA 1NKCA 1JLEB 1D1UA 1K1SA 2E9TA 4J2BA 2C22A 1XR5A 2QKKA 4QOZB 3C6TB 5HRSA 5EWGA 4ZTFA 1RTJA 1S1UB 4RZRA 2HMIB 4ICLA 3ITHB 1EX4A 5F8HA 5EU7A 3SJJA 3L2QA 2P5GA 1FK9B 1RT3B 3PX4A 5SWMA 3L2VA 3I5AA 2ZD1A 4MKAA 4KRFA 4J2EA 4DQIA 4NLOA 2RKIA 2FJWA 3DLRA 3IS9B 2PYLA 1NK8A 3OYAA 4J9MA 4NLTA 5KGWA 1VSMA 3BJYA 1R0AA 1WSFA 2R8HA 1CXQA 4BE1A 1U47A 1IH7A 5J2PB 4CIFA 4NLXA 5DG9A 4CGFA 1LV5A 3VQDA 3MXIA 3RBEA 1ITGA 3AVHA 1W9HA 1KRPA 4K4VA 3NGZA 5J1EA 3SV3A 3AVCA 5KFZA 4LSLB 3TAQA 4BDPA 1VSHA 4NLWA 3D45A 3E01B 4KFBA 3GQCA 3FFIB 3ZSQA 1NKEA 4DTJA 4RW6A 3QNOA 1JKHA 2OPRB 3HVWA 4ZP9A 1S1TB 1TL3B 3T5LA 4WZMA 3KK3B 5KT6A 3BDPA 4F4XA 3H59A 1KFSA 5KG1A 1LWFA 2FJXA 3TVKA 2X6NA 2VA3A 3NH1A 1G15A 1RDDA 1HPZB 2R2RA 4M45A 5DG7A 5HLFA 4Q5VA 5T7BA 5CYMA 3NGDA 3ICLA 4QWDA 3SQ0A 3KK2B 2R8GA 3I5CA 5F8JA 3KLHB 3RAQA 2IJNA 2I5JA 3U3GA 4Q0BA 1D9DA 2BDPA 1L3SA 1NK4A 3GIMA 2E6LA 4KAZA 4IRCA 1IKYA 3VQ7A 3NF6A 4ELVA 4EBEA 1TL1B 4M3YA 2VA2A 3PJWA 1RT5B 2YV0X 4J2AA 2XI3A 1XR7A 2BANA 1GOCA 2E4LA 3TAGA 1J9AA 3V6DA 3VA0A 4RW7A 1N5YA 1JXBA 1RT1A 1RTJB 4FK0A 4O3NA 2AX0A 4RW8B 5FDLB 1DLOB 1RTDA 2G8FA 4B08A 5KFIA 1DTTA 1KVAA 1XWLA 4PA1A 3OL9A 5C24B 4B9MA 4DLGA 4U7CA 4DQRA 3DLGA 2XO7A 4DTUA 1L3TA 4N56A 2YHAA 1C0TA 3HK2A 1D0EA 5KG4A 2GBZA 2R8KA 4O3SA 3PW4A 4NLPA 4ZPDA 1VRTB 3H5XA 3OYGA 1BIZA 4DL2A 3NF7A 3M9OB 1KLNA 1X9MA 3SPYA 3ZT3A 1T03B 1IM4A 2G8VA 4F3OA 3QGHA 1TQLA 1ZYQA 3LWLA 3PZPA 3CO9A 2BE2A 3GIJA 1S49A 1IKVB 4IFVB 4TY9A 2KZMA 2VWKA 3I0RA 4OJRA 3VQBA 4B9NA 1RT2A 2Y1JA 3M8PA 2YNHB 4KFBB 4M42A 4FW2A 2YKNB 4HCCA 3PR4A 4MK9A 2VG5B 3ZSRA 4EP4A 3EZUA 4I2QA 1NK0A 3BGRA 2J6TA 5KFXA 4M3WA 1JXLA 3PVXA 3SQ1A 1SL2A 1LWFB 4NCGA 4F8RA 5CY4A 4CJRA 1S1WA 4CECA 3AVGA 4O3QA 4M95A 3RB3A 1MMLA 1ZTWA 1RBRA 2HNZA 4Z4EA 5F8IA 1HNIB 4IG3A 1EP4A 4ECRA 4CJPA 2OPSA 3QLHA 1LWCB 1UWBB 2XRIA 5SZTA 3I5BA 4Q0BB 3H5YA 2G8HA 4U6PA 3TQ1A 1QSSA 4KSEB 4AHSA 4DMNA 3N6MA 2B4JA 5KFPA 2W7OA 3BSNA 1SV5B 4H8KA 4AHTA 3KMQA 3KLVA 5DLFA 5DGAA 2BANB 3EZ5A 3RMAA 2WONA 2AGOA 4F4WA 4DTSA 5DLGA 3OJUA 1XI1A 5D3GB 1LW2A 2ETJA 3SV4A 3L8BA 4NRUA 1C0TB 3LPTA 4BACA 2CJQA 2QKBA 3OL8A 3OYMA 1QE1A 1GX6A 1B9DA 4CJ3A 1Z4UA 4GMJB 3RAXA 4ZVFA 2FVRA 4OVLA 3DI6B 3AO1A 3A2FA 2DPIA 3EPGA 3OYIA 4E1NA 4ED6A 1YVFA 1RT7A 3CM5A 2BE2B 4ZPBA 4CF1A 1HYVA 4QAGA 3M9NB 1JLAB 3LPUA 3VQPA 2RF2A 1S6QB 4J9OA 4OGEA 3M8PB 1T94A 1SKSA 1I39A 3P1GA 3HYFA 4CCHA 1QS4A 3O3FA 4CF8A 1RCHA 3CFRA 4F4ZA 2UVWA 1QSLA 3DLEA 3KJVA 1WAFA 5KI6A 1RDAA 4B9LA 3IG1B 4PWDB 2ZQBA 1S5JA 2D0CA 5KT7A 1VSFA 2KW4A 1S6PA 2YNFA 5KG6A 2OZMA 3ZT2A 5DGBA 3TWHA 1S9EA 2HNZB 4EYHB 5T14A 3G6XA 2FLPA 2W9AA 2YHBA 1N48A 1EP4B 1EETA 2VG7B 4M3TA 2FJVA 2PZSA 3NGYA 4ZPAA 1BQNA 4FJJA 5KG0A 4CEAA 3UQSA 4TYAA 2IC3A 4EYIB 1YTAA 1LAVA 5KT5A 5F8LA 3TI0A 4FK2A 4CHQA 3RTVA 1S9FA 4K4XA 4NZ0A 3LAKA 1BHLA 4FM2A 2R8JA 4XO0A 3RBDA 2B43A 1UOCA 5E41A 4RNHA 4I2PA 4YR3A 2IDOA 3PO5A 2V4RA 4ECUA 3KTQA 4NLVA 4H4OA 2FBYA 2W9BB 1TAQA 4RW4B 3V1OA 3HXMA 2Z1JA 3ZCMA 1C0UA 1ASUA 3MR2A 5C42B 5KFKA 1JLEA 3IAYA 4OPKA 1VSLA 5KGXA 1NJWA 2HWIA 4O3RA 2R2UA 1U45A 4JV1A 4TYBA 1S10A 2YNIB 3C6TA 5JS1A 4CFDA 1S1UA 1ASWA 2HMIA 2NUBA 1RAJA 3ITHA 4TY8B 3L2UA 3LP0B 1BI4B 1LAWA 1FK9A 1RT3A 4NYZA 3ZSZA 3DLHA 4IFYB 4WXWA 3O3GA 2EHGA 2RDIA 1QSYA 1C0MA 4K4WA 3IS9A 1MU2B 5J2QA 1LW0B 3D28A 5J2PA 3C94A 4NLUA 3HVAA 4O0IA 4URQU 2FBVA 3U6FA 4X2BA 3PX0A 4ED8A 3T5HA 3QYYA 3FQLA 1W0HA 4FJIA 2JLEA 3CG7A 4ZP7A 3HPGA 4LSLA 4JRQA 4DSEA 3MR3A 3MR5A 1UAXA 5L1JA 3V4IA 3E01A 3QNNA 1KTQA 3M8QB 3C6UA 3FFIA 2XC9A 4DSIA 2OPRA 1WSIA 4WE1B 4CHPA 1S1TA 1TL3A 4DL7A 4GW6A 1EETB 1SH2A 3ASMA 4CJWA 3KK3A 4BWJA 4RNFA 1BQNB 4Q45A 4IH5A 4QPXA 2C2RA 1IG9A 2FBXA 3CFPA 2G8IA 4KKOA 3NH0A 1ASVA 4AH9A 1HPZA 1TVRB 4R5PB 2GIRA 5K14B 4YP3A 3AA2A 4RNNA 3ZSXA 1KLMB 4FLVA 3KHHA 2EX3A 4B8AB 4KTZA 4RU9A 4I7FB 4I2PB 3KLHA 3MF5A 1Q9YA 2JC0A 3LAMA 1RDBA 3K5OA 4Z4GA 1K1QA 2FVSA 3V9ZA 2DFFA 3O3HA 3S3NA 4DFPA 3CWJA 2IM1A 3VQQA 2R2TA 1SH0A 4IDKB 1A5WA 3G10A 3HP6A 2KZZA 1RT5A 3LP1B 1HYSA 3KHLA 4CK2A 4CJVA 2ZKUA 4TXSA 4RW8A 3LP2B 3PY8A 5FDLA 1DLOA 1S1XB 3QIPB 2HHWA 1RYRA 4Z4IA 4DFKA 4KB1A 3B6OA 2B5JA 4KBIA 5C24A 4FXDA 4CJKA 4CJFA 2E6MA 2JC1A 4EZ6A 3T3FA 5HROB 2JEIA 2ZE2B 5HRRA 3DM2B 2FVPA 3LALA 2JEJA 4KB0A 5J2QB 4B9SA 1VRTA 3EPIA 3DRSB 3AVBA 5KFRA 1C2PA 4YQWA 4CHZA 3UIQA 4GC6A 4O44B 1T03A 1IKXA 3NBPB 2RN2A 3KIOA 4JUZA 1HNVB 4EO8A 4MK8A 2XI2A 1ZBUA 3H5SA 3F9KA 4ECXA 4DS5A 2WB4A 2HW3A 3QETA 2AU0A 3NAEA 3LP3A 1IKVA 4IFVA 1T05B 4CHOA 2R8IA 2E9RX 4IH7A 4DSJA 3TR8A 4NCAA 3V4IB 2YNHA 4DSLA 1SUQB 3C6UB 1VSKA 2YKNA 1RBVA 3KLFB 4YR2A 4O5BA 3T1AA 1ZETA 4O4GB 2IM0A 2VG5A 5FROA 3DLKB 4L8RB 4K8XA 4QWAA 2D5RA 3Q8RB 4DEZA 1ZBLA 3CJ0A 3OY9A 3OYHA 1KCFA 5L1IA 2V4QA 4J9QA 4K4YA 4FJ5A 4NLDA 4ED3A 3SZ2A 3DYAB 4KKOB 2P51A 1REVB 3PO4A 2D7SA 2HHXA 1RT6B 2VG6A 1HNIA 3S3MA 4RUAA 4IR1A 2B6AB 1TKXB 2ATLA 4KI4A 3D5MA 3SUNA 1VRUB 1NHUA 1LWCA 1UWBA 3PW5A 1RBTA 3VQCA 4B8CA 1Z26A 4K4ZA 3QZ8A 1IKWB 4J9LA 3DRPA 4Y2AA 4BE0A 3QERA 1L3UA 3ALYA 4F4KA 4ED7A 4PQUB 5C25B 1U48A 4J9PA 3BSOA 1JXEA 2ILZA 1SV5A 5KT4A 3AO4A 1WAJA 4HYKA 4CIGA 2R7YA 1HQUB 1HYSB 4CHNA 3D0PA 1RTIA 3FQKA 1IO2A 1J5OB 3HPHA 4K50A 2GUIA 3PW0A 4ECQA 2B5JB 1FKPB 3THVA 2OPPA 4LSNA 1RA7A 1TV6B 3MR6A 4KHRA 4CGJA 4EBDA 1F21A 4GC7A 5D3GA 4ECTA 3AVMA 3V6JA 5KFEA 4CK3A 4ECWA 2RDJA 5FRNA 1JIHA 3TAMB 3OYNA 1DTQB 4Z4CA 4CGGA 3N6LA 3KLGB 1RDCA 3V9WA 4FJNA 5KFMA 1IKXB 5JS2A 1N6QA 4ELTA 3DI6A 4KHYA 3QINA 3V1QA 4NLQA 4KPYA 1JLAA 4TSXA 1S6QA 3CDEA 2WCXA 5L1LA 2FVCA 4NLGA 3OYEA 1RA6A 4IH6A 2C2EA 3K59A 3CJ3A 2Q3SA 2FLNA 2ALZA 1C1BA 3OYDA 3UPFA 2C2DA 4DU3A 3IG1A 4PWDA 3O4NA 1JLBA 3PJXA 3CIZA 3KMSA 4EP5A 3SYZA 1TKZB 3OL7A 4E89A 4KV8B 3L3UA 3NE6A 3AVKA 1HYZA 2VG6B 3AO2A 4NLRA 3KD1E 5KFLA 1SKWA 2VG7A 4OKKA 1I3AA 4FJLA 3V81A 4FZXC 4E7IA 2KTQA 3MEEA 2OPQB 3DRPB 4CIEA 1HMVB 3V6KA 1T3NA 2O4IA 2D0AA 4ECZA 3CJ5A 3KD5E 3F73A 4DWIA 4LQ3A 4FBTA 2X74A 3OS0A 3RMBA 3MFIA 3BR9A 4IRDA 4ID5B 3DLBA 4Z4HA 1RTIB 4KHSA 4FCYA 3PW2A 2W9BA 4RW4A 4R8UB 3CVKA 2WTFA 4AILC 1KHVA 2OPPB 4LSNB 4CF0A 4ZHRB 3GILA 5C42A 1HARA 3AA3A 4KE5A 3MEDB 3AO3A 2R2SA 3Q8PB 5KFVA 4OGCA 2YNIA 3FRZA 1CZBA 4QW9A 1S1VB 3GV5B 3WNHA 4F4YA 4RUCA 3VQSA 5KG3A 2A1SA 2Z1IA 3HO1A 4I9QA 4TY8A 3AVNA 1QHTA 1SKRA 3LP0A 2D41A 1BI4A 3HHKA 4DTPA 2AGQA 4PY5A 1N6QB 5CYQA 4K4TA 4IFYA 2HNDB 5KFSA 4WXOA 5HBMB 3P83D 4YMEA 4NRTA 4K4UA 1RBSA 1JLQB 2Y1IA 1MU2A 2ASDA 1LW0A 4DTNA 2J6UA 3NMAA 4PUOB 2BQUA 5KRTA 4K4SA 2HHQA 2JEGA 4CE9A 1QQCA 4ED1A 3SFGA 2BGGA 1C1BB 2HHTA 1RNHA 2IS3A 1JLBB 3OSNA 3ZSWA 1VSJA 4EO6A 2DFEA 4XIUA 1Z25A 3M8QA 1ZBFA 1S0MA 4UQGA 3OYJA 1BCMA 3ZT4A 4CGHA 1J54A 4WE1A 3U3YA 2D3UA 1XC9A 2O4GA 4F3TA 3DMJA 3V81B 1T7PA 4W5NA 1NK5A 4Z0UA 3MEEB 1TGOA 4ED2A 1JLCA 4JLHA 4RW9B 4J9NA 1S4FA 4R5PA 1TVRA 4KHWA 5K14A 3SUOA 3QEXA 3QEVA 1KLMA 1QAIA 3KLEB 3C95A 3N6NA 4I7FA 1SL0A 3H2LA 4CERA 1VSIA 3QO9B 4CEFA 3NF9A 2XHBA 1YT3A 3L2WA 1SH3A 1RDRA 5DK5A 4O3OA 4IBNA 4CGIA 1Q9XA 2G8WA 1KVCA 3KKRA 4RG8A 2YNGB 1CXUA 3HL8A 4AHVA 4B9TA 1WSHA 5DQIA 4IDKA 5I42B 2WOMB 4JS5A 2HHSA 4G1QB 2ATQA 4CJTA 4E1MA 3LP1A 4N47A 4KHNA 3HM9A 3RRHA 2UVVA 3LP2A 3KHGA 3TAEA 1S1XA 3QGGA 3QIPA 4EZ9A 5DMRA 4B9VA 1RTHB 1C6VA 3PUFA 2KFZA 1KSPA 3NDKA 3G86A 5KTQA 2J6SA 4HTUA 3DRRB 5I3UB 5HP1B 3QESA 5CYQB 4DSFA 2G8UA 5HROA 5FRMA 3SPZA 3H5UA 3LWMA 2ZE2A 5F9NA 3Q8QB 2DPJA 3DM2A 1WLJA 2PY5A 4Q8EA 3JSMB 1WSJA 4C8LA 2ILYA 4KI6A 3HVRA 3G0ZA 3JYTB 4FM1A 4KAIA 4N5SA 3SI6A 3DRSA 4M3RA 3AA5X 2W8KA 1VSEA 4URGA 1NHVA 4O44A 3NBPA 4FJ7A 1X9WA 1HNVA 3HSTB 4W5OA 4CFAA 4FLTA 3OJSA 3HT3A 3MECB 4ZMMA 4M3UA 4DL5A 1EXQA 3KLIB 3T5JA 1T05A 3H40A 1KFDA 5KFGA 2JGUA 3NGIA 2OZSA 3FDSA 1SUQA 4FLZA 2QXFA 3MAQA 1GX5A 1L3VA 2HWHA 3KLFA 3CM6A 4O4GA 4CEOA 1X9SA 5KFBA 1TK8A 2GV9A 3DLKA 3HVTB 1VK0A 3BQ0A 3VQAA 2F8SA 3VA3A 3DMJB 4XPCA 3CDWA 2FBTA 3QZ7A 1S0NA 2DY4A 1EKEA 1JLCB 3GIKA 3QEPA 2BQRA 1ZTTA 3DYAA 2OYQA 3G6YA 1REVA 4E3SA 4E19A 4FVMA 3AV9A 3VN5A 1RT6A 3LZIA 2B6AA 3CFOA 1TKXA 4E0DA 2XY6A 4CJ5A 1VRUA 2QV6A 3O4QA 2AGPA 1N4LA 3OS2A 1IKWA 4OL8A 3UR0A 3OHBA 1K6YA 3SUQA 2XGQA 4Z4FA 2HAIA 1D9FA 2XGPA 3IGNA 2IMWP 4PQUA 2UVUA 3MXJA 4CEEA 5C25A 4DQQA 3CJ2A 4DU1A 4CJLA 5KFJA 5F9LA 3T19A 1TKDA 3DOLA 3L2RA 4DL3A 4ECVA 1HQUA 4MFBA 3ISNC 3OYLA 2UUTA 4ED0A 2KQ2A 5KFCA 4IG0A 3BQ2A 4B9UA 1J5OA 2HHVA 4EBCA 4OKJA 3K57A 4QW8A 4CFCA 4NYFA 3HKWA 4C8KA 3HJFA 1FKPA 1TAUA 4HUEA 1TV6A 5KFOA 2HVIA 2Z1GA 4G3IA 1S97A 2XY5A 3TARA 4C8OA 3S3OA 4ZTJA 1HRHA 3QIDA 4DG1B 4FZZA 1HQEB 3KK1B 3VQ6A 3TAMA 4LD0A 3LZJA 1DTQA 4ECYA 4ZVHA 2F8EX 2IM2A 3KLGA 1WSGA 4FJHA 3M9MB 3MTKA 1TKTA 4DTXA 3K5LA 4CJSA 3WNFA 5EWFA 4KTQA 5KFWA 1LWEB 4ECSA 3AA4A 4CESA 4EEYA 5KFAA 4B3OB 3NCIA 3CQ8A 4CF2A 2HNYB 4FS2A 1RYSA 1C1AA 3DOKB 2YKMB 4J9KA 4W5TA 4KO0B 2W9CA 5KT2A 5J2MB 1U09A 4ZP8A 4J9RA 4KREA 4IRKA 5KT3A 3TABA 2I1RA 1FKOB 4MK7A 5DQHA 4TN2A 2OA8A 1D5AA 5EUHA 4DTMA 4Y34A 4F50A 2HHUA 2QE5A 4BDYA 1RT4B 3BSCA 3DDKA 1TKZA 3SCXA 4KV8A 4FM0A 5JXSA 1JL2A 4MQ3A 1KHWA 1JLFB 1TP7A 1NJYA 1BQMB 1JL1A 4DFMA 3VQEA 3VQ5A 1S9GB 4E7HA 2F96A 4DTOA 4QWEA 4FJ8A 2IM3A 3GV7B 2OPQA 4IOBA 3NKYA 5KFTA 4CHYA 4R0EA 2WK4A 3AVIA 2DFHA 1HMVA 1JX4A 3VQ8A 3RMDA 4CJQA 4M94A 3QEIA 2JEFA 4FK4A 4YR0A 4AHUA 3NAHA 3K5NA 3DOLB 3RB0A 1O1WA 4RNMA 2XWYA 4WZQA 4ID5A 4MFBB 4TQRA 4JS4A 2BRKA 5F8NA 3NAIA 4E7LA 2XCAA 4URSA 1ZBHA 1WN7A 4IG0B 4Y3CA 3I0SB 4ID1A 3SFUA 1CZ9A 2UVRA 4R8UA 1NKBA 3GYNA 4AHRA 3FSIA 3IRXB 2IGIA 4K8ZA 3MEGB 3BSAA 5C5JA 2W7PA 4ZHRA 4DL6A 4FYDA 3VQ4A 4MH8A 2AWZA 2GIQA 3OS1A 3MEDA 2HB5A 1NK7A 4OLBA 3NF8A 1S1VA 3TAFA 3NH2A 2F8TA 3RB4A 2P5OA 5J2NA 4ICLB 3IGVA 1A5VA 4FJXA 1TKTB 2ZD1B 1NJZA 4LH5A 4FLXA 4N76A 4TLRA 3EYZA 4W5RA 2HNDA 2RKIB 1QUVA 2W42A 5HBMA 2IAJA 1GOBA 4ZPCA 1R0AB 1JLQA 3V6HA 2QK9A 4Y1CA 2PYJA 4PUOA 4CK1A 3G6VA 4DS4A 3I8DA 3H4BA 1I6JA 3OYFA 4E7JA 4AHCA 1UA1A 3OSPA 2W9CB 4O3PA 4HCBA 4CJ4A 4DLEA 5J1EB 1JLGA 1U04A 5EWEA 4KHQA 2IJFA 4RW6B 3PHEA 3MFHA 4CJUA 4H4MA 3E51A 3RB6A 4QWBA 1JKHB 3M8SA 4DF4A 1XR6A 3EY1A 1CSJA 4WFXA 4NLYA 4OKEA 5L1KA 2KFNA 4MIAA 2W8LA 4QCLA 3NFAA 4W5QA 4RW9A 2CKWA 4NLSA 5F8GA 3KNAA 3ZT0A 4FLWA 4M41A 5HLFB 4LQ9A 3IN5A 4CJEA 3SNNA 5CYMB 2VWJA 3KLEA 4FS1A 4JV0A 5HRPA 3ISND 3NL0A 4FZYA 2I5JB 4DL4A 3QO9A 1A5XA 2V0NA 1S48A 2BQ3A 1BISA 1YVUA 2ASLA 2G8KA 1IKYB 4O55A 2YNGA 3MXMA 3LANA 4HVJA 5F8MA 2IA6A 5I42A 2WOMA 1B9FA 4KB7A 2AX1A 4G1QA 4WYWA 5DQGA 3T5KA 2UUWA 3V6DB 3HP9A 2GC8A 4RW7B 4LY7A 4ELUA 1N5YB 1RT1B 3RMCA 3V1RA 4C8NA 1RTDB 3NHGA 1RTHA 4IR9A 4OLAA 1Y97A 1DTTB 5J2NB 2AQ4A 4CEBA 5JUMA 4CEQA 3DRRA 1YTUA 5I3UA 4J2DA 3DLGB 5HP1A 4F2RA 5KG7A 4BWMA 3WNGA 2FLLA 4CF9A 5DG8A 1W25A 4JV2A 2IAJB 3UDLA 3JSMA 3OYCA 3JYTA 4YFUA 2Z1HA 2XY8A 3QGIA 2ITGA 2LSNA 3L3VA 3V9UA 3ZSOA 2C28A 3ZT1A 3WNEA 3MECA 4FJ9A 1XHXA 3KLIA 2E9ZA 3OYKA 1JLGB 1X1PA 3V9SA 3I0RB 1WNSA 1RT2B 4FBUA 4DQPA 3RWUA 3PV8A 3H4DA 4BDZA 4H4MB 3GV8B 1N56A 1BCOA 3ULDA 4JRPA 3PR5B 1CLQA 1U4BA 3OLAA 4DSKA 3HVTA 3RR8A 4Y2CA 1S0OA 1TK0A 4I2QB 2WHOA 1NOZA 4FLYA 1T8EA 3BGRB 1ZBIA 2D3ZA 1RBUA 3HPOA 4NCGB 3OL6A 1HJRA 2V9WA 1BL3A 4FJGA 3ZSYA 1S1WB 4DFJA 4FW1A 4KTWA 5KFUA 3H98A 4Y1DA 2RPIA 4CGDA 4LH4A 4IG3B 3TAPA 2DTUA 4FJKA 4WFZA 4IKAA 2OPSB 4NYNA 3QLHB 1B92A 3GIIA 4FJMA 3V9XA 4IKFA 1BGXT 1WNEA 3BREA 5KFFA 2BRLA 3CDUA 4QWCA 3OVNA 4DTRA 3TANA 2XY7A 4BE2A 4CEDA 3B6PA 4KHMA 4NCBA 5KFHA 1NNDA
chains in the Genus database with same CATH superfamily
3D0HE 5KFYA 2V67A 1QTMA 4XH4A 2NXUA 4A5BA 5EXWA 2ZBQA 1FFSB 5GAHI 1HQ2A 2P9PB 4CLWA 3KG0A 4CZEA 4ZLLA 5CZ1A 2WONB 4WWSA 3OTCA 3RR7A 1ZH5A 1A0OB 4OPJA 2WVDA 2YX1A 2EC0A 1TUGB 5KG2A 2QA4N 1YRTA 2J7KA 4JB8B 4B1UB 5DRKA 2HHPA 9ATCB 5ETNA 3CYMA 4F67A 1ZZFA 3R1HA 4DR5J 1UEUA 2KL8A 1SL1A 3FBBA 1X4DA 1XHZA 1VC0A 4C6AA 1K9MO 2AYEA 1LQ9A 1RADB 4OYAA 4DX6A 3HSZA 4QR2A 2M2BA 3L3CA 2VFUA 4DR3K 1EIYB 1U0SA 3VQ9A 3NS5A 1FNOA 3SQ4A 4X4QA 1RT7B 4F02A 1WSEA 1B7YB 1N33F 1YJ7A 1RLDA 1ZZNA 2RF2B 3DOKA 2GELA 3BN4A 3K58A 2NRHA 1Y64A 2ABYA 2KHOA 2AP1A 3LDSA 3ZZYA 1D8YA 2B4UA 3DLEB 4O0JA 2IBKA 4LF4F 4CT8A 3KKSA 3DOMB 1FKOA 2PO4A 4USKA 1Q8IA 3EE8A 1TK5A 2ZH8A 4HHTA 5HMXA 1C4AA 2PSZA 4YNQA 3OHAA 4ZVGA 1HI8A 1WC3A 2GMLA 4G1IA 3MZIA 1ZPWX 2E5JA 2V69A 4M5GA 1LEOA 4H5TA 4A61A 2NXNA 2XCPA 1X4HA 4UOHA 4A48A 2HVHA 3FZ2A 3NOCA 2O67A 4CO2A 5EDWA 3C65A 3OYBA 3Q8SB 3CIPA 2BW2A 1RAOA 2OIHA 4RL1A 2CA9A 4WYLA 4LF4K 3WHIA 3FGUA 3THWA 3AVAA 2DH9A 1C1CB 4M3XA 2UXCF 2DHSA 4JKAA 4E7KA 1H3DA 2QLFB 4F9OA 1JLEB 1CJVB 2C22A 4ILGB 4DCPB 3GG0A 1XR5A 1KAZA 3PFOA 3H90A 2AEFA 3K8WA 4GVLA 2HMIB 4RZRA 3ZX3A 1WDTA 4ANEA 4L6V3 5EU7A 3L2QA 3L2VA 3QSIA 2K1RA 4KRFA 4J2EA 3K17A 3PIOQ 4FXWA 2RKIA 2FJWA 3DLRA 1NK8A 3EGVA 3MGJA 1YBTA 3BJYA 4EMDA 1H1VA 4BE1A 4RLEA 4NLXA 4UQTA 1LV5A 4LR9A 2OSRA 1LNQA 1TMJA 4G65A 1FE4A 4HTIA 4HHHA 4AM6A 1H74A 4K4VA 5E3RA 2UXCK 3NGZA 2D9PA 5J1EA 3AVCA 1X5PA 3D68A 1UFKA 3TAQA 4OX9J 1Z6RA 2X51A 1NSQA 1NKEA 4RW6A 3AXMA 4J9UE 3HVWA 1QHAA 4RTFD 3CJ7A 4F4XA 3NS7B 3CULA 2P8IA 2HLUA 1VQKS 1HPZB 3MOZA 1S77D 3A5LC 1WBBA 1VQLN 5HLFA 4QR1A 5CYMA 4L75A 4KRWA 3HSDA 3G71N 2VPYB 4ALZA 3NMRA 1RHQB 1SQGA 2EFQA 2BDPA 1L3SA 1KS2A 1OSCA 3GIMA 2FLOA 5CZXA 2IVNA 5AQHA 1Y7PA 4M3YA 3I9ZA 1RT5B 2YV0X 2HEKA 2ZJPL 2BANA 1GOCA 3V6DA 3CCWA 2BZ2A 3D2FA 1RTJB 2UUCF 5AQWA 4AE5A 2UXBF 1XWLA 2LQJA 1NGCA 4JKGB 4ED4A 1QDUB 3EZOA 4DQRA 2QC3A 3DLGA 1L3TA 4N56A 2HBQB 3LA0A 3KZBA 3HK2A 3WQPA 1D0EA 5KPZA 3MMAB 2J7UA 3KJFB 4NLPA 3H5XA 2P9IA 1BIZA 1X9MA 1U02A 2KJWA 1ZYQA 3GYXB 3LWLA 1MN7A 3ELHA 4NOHA 2DIUA 4BRAA 3PZPA 1S49A 1IKVB 2KZMA 2DNOA 2P9LA 3TZXA 4OX6A 5SUHA 4WU2A 2Y1JA 4YDUC 1X60A 1PCAA 4BROA 2W4CA 2XMAA 4FW2A 2YKNB 4HCCA 1V4SA 3EL2A 2QO3A 1FF2A 3PR4A 3P5TL 1P8ZA 2UUCK 1Q7LB 2UXBK 4LFCK 1VK3A 4EP4A 3ZXWA 1ZM2A 3GFZA 3O8WA 3MWBA 3OTEA 5H1SV 3KUEA 4M3WA 4KIAA 5RUBA 4OZJA 3MD3A 1LWFB 3NCQA 4F8RA 4LBPA 5HATA 4YHHK 1YVNA 4W90B 1NGIA 3MM9A 4O3QA 4M95A 2CPFA 2HNZA 1HNIB 2DGOA 2V5HG 4IEEA 2ZZTA 3QLHA 2F8MA 1F60B 4PQAA 2FDNA 3CJTA 5IM0B 2VC0A 1DARA 3WXMB 3TQ1A 3HTVA 1YGYA 1WDDA 4KSEB 3HZ6A 2DRAA 4NI2A 3N6MA 2PEHA 2MLZA 2W7OA 4LJMA 1SV5B 3CMAN 2PD1A 5ETOA 1CJUB 2M7SA 2P9PA 2J0XA 2DISA 2BJ8A 2D9OA 2WONA 2AGOA 4F4WA 3FC9A 2KYZA 3KUHA 2VBWA 3OJUA 5IFMA 2A2DA 2QWLA 5GAGP 2OELA 3DWLA 3TO8A 1VI7A 1PAEX 4BS2A 4OI6A 1IBLJ 3LTOA 1M1HA 3T41A 3AJ1A 4K0KJ 3LPTA 1RDUA 4JI2J 2CJQA 1I5OB 1GFWB 3HLUA 4AXJA 2QKBA 3OL8A 3OYMA 2CPDA 1B9DA 3DLJA 4CJ3A 4BRCA 4DV2F 3GSIA 3HF5A 3B8HA 4B1ZA 4MO4A 4I6WA 4ZVFA 5HK4A 2FVRA 3AO1A 3WZ0A 2H65B 4USUA 3OYIA 3BBBA 4ED6A 1RT7A 2BE2B 5AQUA 2B4VA 1U26A 2ZBPA 5A2QY 1HYVA 3MCMA 3VQPA 2RF2A 2W2MP 4L3NA 2WUSA 2Q43A 1HA1A 3RW7A 5C2DA 4Y2KA 1R43A 4CF8A 1ZM3A 2BBEA 3DLEA 1KQKA 3EN9A 4CLPA 2SXLA 3DOMA 3R5DA 4B9LA 2D0CA 3TX0A 2KW4A 2GUPA 5AQFA 3FZKA 3M6UA 2OZMA 3P3DA 3D6HB 3VAMA 1UVIA 2FJEB 4CZHA 3TWHA 3DLLQ 3EGWB 2C3UA 1HBMB 2FLPA 3G6XA 2XB2D 1IR0A 1XBWA 1N48A 1EP4B 1EETA 4J9VA 1HNXJ 2ROGA 5M2UA 4CEAA 2HGNA 3K8VA 4FZVA 3TI0A 4K4XA 1I94F 1B70B 2R8JA 3AJDA 1WKLA 2P9UB 4XO0A 2B43A 4I2PA 2IDOA 3OR2B 2M8HA 4LC9B 3I9V9 3KTQA 4NLVA 5AQXA 2DNRA 4EIAA 3H45C 1YJNN 3W60A 2EBEA 4ILHA 4ILLA 3DRYA 2V8VA 3U1LA 1AA1B 1JLEA 4OPKA 1NJWA 4O3RA 2R2UA 1CJVA 3M2RB 2LQ5A 4JV1A 3PJ9A 4U96A 2YNIB 1Y9OA 3H2VE 2DT9A 1GH8A 2YY3A 2V2QA 4BC7A 1ASWA 2HMIA 2MKSA 3C19A 3IA0A 4UY85 2DH7A 1BI4B 3QBXA 1IUJA 2CZ4A 1HNWF 1I94K 2UXDF 4ETXA 2JZ5A 2YWFA 1C0MA 4WF9Q 5HVGA 4U67L 4WU3A 5ETLA 3P38A 3L4BC 5F2RA 4NLUA 1X5OA 4ISEA 2JVRA 4O0IA 4URQU 2FBVA 4YN3B 4X2BA 2ZHAA 5JICA 2F4FA 5A8RB 4USMA 3QYYA 3FQLA 2G2OA 4MTPA 4Y6IA 3CC4N 1UETA 2JLEA 3CMES 2PE8A 4GRSA 3O9QA 3O1WA 4USWA 3W0LA 4KH6A 1KTQA 1XNRK 1YJ9S 1WSIA 5CH7B 4WE1B 2BA9A 1FDNA 4UT4A 1HNWK 2CNOB 2UXDK 1S76D 3G96A 3RRKA 2FBXA 3U4LA 1HPZA 1J2VA 2GIRA 3AA2A 1YITN 1V3RA 2DNGA 1KLMB 4LR8A 3SSRA 4FLVA 2E7VA 4QBUA 2EX3A 4JI0J 1RP5A 2PIIA 4X4TA 2POKA 4IOAL 4HR2A 4OLPA 1BHNA 2JVOA 2QA1A 2Z57B 3UFCX 4EK2A 2VBZA 4KHPJ 4HVZA 4GKJF 4JI3F 3C7NB 5CYJA 3IAM9 1SH0A 4HH1A 3M8WA 3OR1B 3HDSA 3NGRA 3EJMA 2KZZA 1RT5A 3OTOJ 2XTJP 3LP2B 3TSPA 3QIPB 2N4DA 4CH7A 4KB1A 4CLUA 4KBIA 4JKGA 5ETMA 2YHWA 1NM1A 1WC0A 4DV7J 4CJKA 1Z1ZA 5HROB 3T3FA 1AT1B 2BJ1A 4P2FA 2ZH1A 5HRRA 3MMAA 2FVPA 2UV8A 2G0JA 1M5VC 3ONQA 2CQGA 3DRSB 3AVBA 2VU5A 4CHZA 4O44B 1IKXA 3KIOA 1FRLA 5AJ3J 1DFDA 4UOFA 4GKJK 4DU7A 4A4JA 1Q81T 4BC4A 2WB4A 1DQ8A 2YPYA 4PWUA 3NAEA 1BWVA 4GV9A 3G25A 1IKVA 1GQEA 5FPDA 5LL6d 3O9UA 2FZKB 2AJFE 4DSJA 3TR8A 2UUBF 3NLCA 3V4IB 3LPEA 3PYEA 3C6UB 2RS8A 4LIRA 2YKNA 4O5BA 1ZETA 3K0SA 4P6QA 3R5BA 3CCMN 4O4GB 2ROPA 1S7HA 2ZZMA 4K8XA 3ZZTA 3Q8RB 4DEZA 1ZBLA 3AGRA 3W2WB 3LDPA 1HKBA 5BR8J 5L1IA 3BKFA 4ED3A 5CE3A 3DYAB 2QWMA 1BWFO 3PO4A 2FTRA 2LQ9A 2HHXA 1RT6B 2YJEA 2VG6A 1HNIA 4QS9A 3WBZA 4IR1A 1TKXB 4KQZA 3D5MA 3SUNA 2YKAA 3VVUA 2RUSA 4B8CA 1Z26A 3D2WA 5L39A 5IM0A 3QZ8A 4LVOP 4Y2AA 5AQVA 1BUXA 5DM6L 1L3UA 2ASYA 3CCLS 5ELZA 1W2IA 1NM2A 4F4KA 4ED7A 3MWPA 3S7RA 2UUBK 3VGLA 1DJ0A 4A8FA 1CZAN 4J9PA 3BH6B 1SV5A 1EJ7L 2KU7A 1LCUA 3AO4A 3IR6B 2VKRA 2QXLA 1CJUA 2YHYA 3OFHA 1RTIA 4PL8A 1M5SA 2OP5A 3HPHA 1PYSB 4K50A 3CDBA 3PW0A 1U1MA 4EBDA 4OFZA 3V6JA 5KFEA 3CCSS 2BH1A 1ACMB 3P5BP 1VQOS 5GAGI 2KYXA 3LDOA 1MWZA 3TAMB 2V8GA 2OJ3A 3GE1A 4FYVB 3UVJB 5AQLA 1NMDA 5CCMA 4CGGA 3N6LA 4ISFA 4BRGA 2V51B 1FX2A 3KUGA 2ZGZA 4FJNA 2ZM6F 5JS2A 4ELTA 3L6QA 4UF4A 3VPZA 4KHYA 2RB7A 3CCZA 3QINA 4A2AA 2ZWOA 2DD8S 4MAKA 2GTDA 2DHXA 1AW0A 1VAZA 4HLBA 4NLGA 2FVCA 4M63C 5IV4A 4LFAK 4IH6A 1X9JA 1SI9A 1FNXH 3K59A 3D6TB 1KONA 2Q3SA 2FLNA 3EVMA 4QPTA 2MPUA 3OYDA 3QAEA 4OI4A 3VHQA 3O4NA 3PJXA 2Z2YB 1F0XA 2VCPA 4EP5A 2CQDA 3CC2S 3CT9A 1HYZA 1HBMA 5ETSA 1WC5A 1SKWA 1E3MA 3MMJA 1ATSA 4FZXC 2KTQA 1LKZA 2R7SA 2ZM6K 3ETOA 4ZVTB 2MQPA 3WQUA 1N54B 3UNYA 2I2YA 1T3NA 2O4IA 2Z2LA 3LO3A 2A6OA 2P5VA 4LQ3A 3JTPA 4CLSA 4EUVA 2K7KA 3W8PA 1RHRB 3OR2A 4IRDA 3LL3A 2IRXA 5FPMA 2RQCA 5DZ7A 3CVKA 5GIOA 3SBMA 3D2EB 4DPYA 4LSNB 4IUFA 4ZHRB 3GILA 1PG5B 2QA4G 3AA3A 3G8TA 4KE5A 2E2QA 4DR3J 1FD2A 3M2RA 2PFFB 2YNIA 3BZQA 2E8AA 2GAHC 4OJGA 4JBCA 3AD9C 2KXNB 1ZM9A 1T6DA 4I9QA 5BYSA 1SKRA 3VAFA 1BI4A 4NASA 3G6EN 2AGQA 4DTPA 3QBCA 1N6QB 1NU0A 5KQDA 4K4TA 2HYIB 5KFSA 2C3PA 3OFFA 3IWXA 3QRPA 1RAAB 4YMEA 5CA5A 4EI2A 1RBSA 4XTTA 4I67A 4DTNA 3NMAA 1O0PA 1VQ4N 2CPHA 2VFVA 2HVZA 5LMNJ 2VASA 1D09B 5A8RA 2BGGA 3LOUA 3HCXA 4EGLA 1U6ZA 2HHTA 2ASOA 3GE9A 3OSNA 1BA1A 1VSJA 1N0VC 1ZBFA 5F0WA 2DY9A 1WC4A 2IA0A 1BCMA 3ZT4A 3OPKA 4CGHA 4B1VA 3PKYA 4WE1A 2D3UA 2VBXA 3V81B 4OI0A 4W5NA 3J7YU 3FZBA 1NSPA 1TGOA 1FXLA 4LF4J 3WX8A 3M3ZA 4RCHA 3UCUP 4HHUA 3WXIA 1VQ7N 3SUOA 3E66A 3GPAA 1KLMA 3PEHA 3KLEB 4CM2A 2OKQA 3C95A 3C2PA 1SL0A 3UN3A 4S0MA 3QO9B 2XS5A 1PGZA 1FDDA 3NF9A 1CBKA 1VQ8S 2XHBA 2RE1A 2YX4A 3KKRA 3C7NA 1B0TA 4DV6J 1WOSA 4AHVA 2DHGA 1JB0C 4X4RA 3CJAA 1GAOA 3GG1A 2A3ZA 5IZHA 1XTZA 5IOLA 2ATQA 1TL5A 1WC1A 4KHNA 3HM9A 1VQ5S 2UVVA 2F7VA 1YTYA 4DZ6A 3LP2A 5I3QA 3QIPA 3RBZA 4B9VA 1RTHB 3VF0B 2A6AA 1G1XA 5EN1A 3NDKA 2Q1LA 3BN7A 3FK4A 3U7JA 1NCLA 4HTUA 5I3UB 5M1QA 5HP1B 3CE8A 5CYQB 5HROA 4CNYA 2KT2A 2KJVA 1UVMA 2RDDA 1WLJA 3S6EA 2EK1A 1WSJA 2ILYA 3JYTB 2Q6BA 2C2ZB 4N5SA 4WFBL 4RBTA 1ESVA 3DRSA 1A6LA 4M3RA 2W8KA 4O44A 1X4BA 5H9EK 2OMOA 1X9WA 3OJSA 1HHQA 1F5BA 1RFQA 3KLIB 1W2BM 1KFDA 4FWQA 2BM0A 1UEKA 4LMZA 3IKMA 3DU5A 3FDSA 2Y8YA 4WFNL 2QXFA 2Q0UA 2UV8G 3CM6A 4O4GA 1WUAA 4ZN3A 1TK8A 2GV9A 1OY6A 2CQIA 2F8SA 1FCAA 3DMJB 3W2WA 5KPTA 2FBTA 3LGNA 4CD1A 2DY4A 5GAHU 3CCQS 1JLCB 1JJ4A 3QEPA 1RACB 2BQRA 1FX4A 3DYAA 4L76A 3CJSA 3CJCA 2OYQA 3ENHA 2V94A 5D8HB 4FVMA 1RT6A 4WKYA 2R7XA 1NSKL 2MY7A 1TKXA 5DZ6A 5U47A 4CJ5A 1PYTA 2MTLA 2XMVA 3O4QA 1PJ7A 3WX4A 2CNLB 4PXEA 3OS2A 2OANA 3OHBA 2VQEJ 1WELA 1HHTP 1N5TA 1ZXOA 4Z4FA 2QL7B 3AH6A 1D9FA 2XGPA 2UVUA 4CEEA 5KFJA 2YQ0A 2G13A 1TKDA 4CZCA 1RHKB 3L2RA 4MFBA 2M9KA 1HWLA 3O2IA 4OX7A 1CULA 1HI1A 4OKJA 4QW8A 2E2NA 1MNEA 2MXYA 3TR5A 4R0JA 3QT6A 2QA2A 1TAUA 3D7EO 1WJ9A 2LYVA 4G3IA 3TARA 4AL5A 3S3OA 4H0OA 1HRHA 3QB0A 3QIDA 2H1YA 3DU6A 4FZZA 3WIVA 2IRYA 2KH9A 3TAMA 1DBDA 1UZDA 1RI7A 1HHSA 3UVJA 1VQMN 2V4JA 3CEDA 4CP5A 3MTKA 2UUCJ 1Y4ZB 2CJKA 3K5LA 2QFJA 3UO0A 4LFCJ 5JVGL 3J7ZT 5EWFA 2P9CA 2CJYB 1UJ6A 4ETZA 3BGLA 7FD1A 4CW7B 3ET6B 2HNYB 3POTB 4FS2A 4PPDA 2HZVA 3BM7A 4I0WA 1SJ1A 4YHHJ 2YKMB 2XYHB 3Q23A 4W5TA 5BXIA 1H2UX 1QZ6A 3JSRA 4KO0B 5KT2A 1U09A 3R7SB 4KREA 3CPEA 1T44A 8AT1B 4LIWA 1U1RA 3R5CA 5EUHA 4Y34A 2QE5A 1ILYA 3TSQA 3BSCA 1K47A 2LKZA 3SCXA 2ZKTA 4XK8C 1JLFB 1NJYA 1BQMB 3T9NA 3M8ZA 1JL1A 3VQ5A 3AD7C 4CT9A 5J1PA 3I33A 3UD3P 1HW8A 5CR4A 1GTHA 2QWPA 3SQGB 2MZTA 4BBYA 1SIWB 1VBKA 3IRWP 2AJ4A 2DFHA 5AXLA 1JX4A 1HNZF 2BJ9A 1GLEG 4M94A 4FK4A 3A8YA 5BPLA 5LXRA 3TWZA 4ZIWA 3RB0A 2XWYA 1FWPA 3DFEA 4JS4A 4E7LA 1ZBHA 4URSA 1TUWA 3I0SB 3CF5Q 3SFUA 3PACA 1CZ9A 1KD1T 3ZEUB 1NMNA 5A0YB 3QPIA 3D2EA 3FSIA 4OYOA 3TA0A 4K8ZA 1UVJA 4ZHRA 4BC3A 3X3UA 4DL6A 4MH8A 5KAKA 2HB5A 1NK7A 2FXUA 4BHQA 3OVBA 2YWGA 3EVOA 2MKCA 1NZ8A 2CADA 2HBZB 4MYUA 1IWAA 1A5VA 3D6RA 3ETMA 2V7ZA 1LXJA 2FYXA 3GJTB 3KXDA 4LH5A 4N76A 1B0VA 3MN7A 2ASMA 4W5RA 4OO1J 3THXB 1KN6A 3P4UB 2VDHA 1RWMB 1HD0A 4DBQA 2BUNA 3W8GA 3VAGA 3HHLD 2DCUB 5KOXA 3V6HA 2NRZA 3CJBA 5AQIA 3G6VA 2R9LA 1I6JA 4MLHA 4E7JA 1Z2ZA 4UUWA 4JI8J 1UA1A 4BQLA 1F6TA 3OSPA 4LF8F 5LOQA 4U8YA 2O8EB 2DGQA 1KWMA 2VKZG 1IJEB 1VGYA 2NRTA 4JI4J 4DV1J 1ZC6A 3J81Y 5EWEA 2J0QD 2IJFA 3ZTSA 4O23A 1SQEA 1YKWA 3M8SA 1E6YB 1XR6A 3EY1A 3CW2C 4WFXA 4C2MA 4IO8A 4V19S 1N52B 4OKEA 2JWNA 1DHMA 2W8LA 3ZX2A 3NFAA 5D15A 5GINA 2BXJA 5F8GA 4P2XA 5K9FA 4LQ9A 3SNNA 2HFOA 3KLEA 4FS1A 5HRPA 4A8KA 2ZH6A 3QO9A 5IWAF 4LF8K 1WHYA 4ZVQB 1YRXA 1S72S 2DRDA 1U1LA 1EX8A 3J80Y 1HBNA 2BQ3A 1IKYB 4O55A 4YB5A 3SXLA 5EY4A 1NZAA 4BRIA 4USHA 5B7WA 2AX1A 4JK8A 1S4EA 5IXUA 2ZOMA 5IT9U 4RW7B 1RQ0A 2VUGA 4FVCA 3V1RA 4C8NA 1RAHB 1SVDA 4ATNA 5B0CA 1RTHA 4IR9A 4OLAA 2JLGA 1VYAA 4CEBA 3TTCA 5DDPC 5L9NA 1YTUA 3V5RA 5I3UA 3D7SB 5HP1A 4F2RA 5KG7A 3WNGA 1VQKN 2FIUA 4K8RA 1IBMF 4CF9A 5I3PA 2IAJB 1AROP 3JYTA 2RQ4A 1XNRJ 3SAGA 3ULHA 1IVZA 2HGLA 4OLOA 4Q2MA 4PCQA 2KT5A 1JJCB 4FJ9A 4LF9F 3ZTPA 3KLIA 4CWBA 2WTUA 2PC6A 3GL1A 4DUYF 3NS6A 3PV8A 4BDZA 4H4MB 4DV3J 1X3MA 3THYB 3NGTA 3RR8A 4JKCA 1U6BA 1TK0A 4I2QB 2WHOA 3CD6N 2EFOA 4IOCL 3HFKA 4WK3A 3CPWR 1HJRA 4EHUA 2IDLA 1IBMK 1BL3A 3HSGA 1XNQJ 1WSRA 1RU1A 3CJKB 5LSRA 1S1WB 2I6WA 4FW1A 5KFUA 3MHYA 4C23A 4C3KA 4DR6F 2QZ8A 4HEA9 4LH4A 4IG3B 2EFGA 4H5NA 4AYBD 4FVUA 1RAIB 4FJMA 3JTNA 3V9XA 4IKFA 3K0JA 4LREA 3BREA 2AJ0A 2KM8B 4JKDA 3CDUA 2GX8A 4DTRA 4LF9K 2J4RA 2VHGA 3BYRA 1G99A 3TZWA 4CEDA 1EQYA 3KYLA 3PCOB 5LJVA 2KG1A 2G1DA 1RE1B 3AVJA 4CI0B 1JCGA 4BR2A 3HD2A 3R5GA 4CNZA 5GAEP 1NPRA 2CQ2A 4FKXA 4TLQA 3P5JA 2LFVA 2NXJA 2QGFB 1RWNB 2OUGA 5ITHA 3B4MA 4OPAA 4Y0FA 1JWWA 4OJ3A 3NEKA 4GVMA 1LW2B 5HRNA 2CWKA 2MKKA 4DR6K 3KHRA 2O5DA 1C4CA 4N41A 1QE1B 4Q8FA 4M5LA 4M5MA 2CQ0A 2EXUA 5LXYA 3VEOA 3D1OA 4B3SF 2YBVA 1EWRA 5KFNA 1QZ5A 3O9SA 4N8NA 2AZ1A 3ET6A 3KG1A 2HNYA 2DTJA 3POTA 1NK6A 3QMQA 2X78A 4BRLA 3IMXA 2YKMA 2KM8C 3E2EA 2A6MA 3KKFA 3HSCA 4KO0A 3KJVB 1Q95G 1L5UA 4DN9A 3CJ1A 1RCOB 1NJIT 2P9EA 2C2OB 2KN4A 2BR0A 4ILRA 3EKUA 3TW0A 4KH5A 1JLFA 4F2SA 3QEWA 2CPXA 1BQMA 3SUPA 2ASJA 4NMXA 2ACMA 3IBWA 4DR1J 1FXXA 3R8YA 2FJBB 5LMUJ 4KHUA 4CFBA 1FVQA 2NRWA 3SQGA 5C7PA 4QIGA 1YIJS 4B3SK 1R27B 2CIMA 1YX2A 5A8KB 3ZZZA 3T7ZA 1XMQF 4FLUA 3O6QA 1URNA 2BJEA 4A57A 2HMPA 4H54A 2KRRA 3FSYA 4HKQA 3BDEA 1U49A 3EVWA 4MIBA 1FRXA 4H4OB 4A8QA 4B17A 1S99A 1R8HA 3I0SA 1GT8A 1IWGA 3ZEUA 5A0YA 3K2PA 3R7BB 1TL1A 1RILA 2ZUAA 4MKBA 1Q5YA 4C0HA 3KHYA 4QOZB 1RCXB 4ZTFA 2FHMA 2BACA 4LFAJ 3J81O 3SJJA 2P5GA 1JNRB 1FK9B 3HD1A 5SWMA 1Y3JA 3I5AA 4FYWB 1XMQK 4DQIA 1RGIA 4NLOA 1VSMA 4B1YB 1H73A 1SPBP 1U47A 2G0IA 3Q2TC 1FI4A 2EG2A 4DUTA 2WB1D 4CGFA 2B9WA 2AV5A 3MXIA 4QS8A 3K7RA 4DV4F 9RUBA 1KRPA 5E3CA 2O8EA 1X5TA 4WTOB 5KFZA 4LSLB 5D4NA 1VSHA 3E01B 4KFBA 3GQCA 3T1HJ 3ZSQA 1PBUA 4DTJA 1X31C 3QNOA 1MROB 3CETA 4ZP9A 1E6YA 3J80O 1NGJA 3T5LA 1WOQA 1ATNA 4WZMA 3VWSA 1W7AA 2VWBA 5KT6A 4DZDA 3H59A 3I6PA 2PMWA 2MZSA 2FJXA 2X6NA 3NH1A 3MEKA 4M45A 3GTYX 3FVYA 1XMOF 1R59O 2ZZNA 4QWDA 3IBCB 3KK2B 4YS2A 2DIVA 2HF4A 3KLHB 4H5WA 2IJNA 3V2UC 3U3GA 4Q0BA 1D9DA 2QRRA 4OZ0A 2ZH3A 1WI6A 4DV4K 2X3GA 4DR7F 4IRCA 3MR7A 1HLUA 5HL7Q 3CMEN 3L4IA 1IKYA 1R0BG 4EBEA 2DNKA 3JTOA 3T6JA 3P8BB 3H42A 4J2AA 2XI3A 5EX5A 1VQSA 3TAGA 1OPIA 4P73A 4RW7A 1YJ9N 4CLKA 1JXBA 4FK0A 2E1RA 4O3NA 1N32F 5FDLB 4PABA 2G8FA 4B08A 1IBKF 5KFIA 1KVAA 4PA1A 3L95X 3OL9A 2KVIA 4U7CA 4BRDA 2VB6A 4WQ4C 2QLJB 3AAPA 2CAJA 1XMOK 1GMUA 1C0TA 5K8MA 3VV2B 2R8KA 4C8ZA 3PW4A 2L9NA 3VGKA 1VRTB 4A8SA 1OJ4A 2E1YA 1Q16B 1IN0A 2XMWA 3MPWA 5AZIB 1KLNA 3CQYA 3M30B 1ZOTA 3ZT3A 5D78A 2B7CB 2DO0A 4F3OA 3R2DJ 1OIAA 3ENWA 3VMFB 3CO9A 4AXIA 4X4VA 3KK7A 3EMTA 2GS8A 3W61A 2M3DA 3W7BA 4M42A 3M8YA 3DN9A 2APOA 1OVQA 4NXNK 1N32K 4MK9A 3X1LB 1IBKK 4FF2A 1UVLA 1YJNS 4HACB 4I2QA 1SAZA 2J6TA 5KFXA 4LRAA 3R5JB 1JXLA 3LGHA 4H4KC 2ZBCA 2V63A 3WXJA 3BGFA 3RW6A 3CJKA 1KR4A 4CJRA 1S1WA 3IC1A 1ZTWA 2FUG9 3BEXA 4IG3A 1MWYA 1UWBB 1VR6A 3TTDA 2GVDB 1RHMB 3H5YA 2VJUA 5DETA 2LLZA 1BE4A 3PIPQ 2HRYA 1Y5NB 1DKGD 2E5LJ 1RWVB 2L41A 3QT7A 2AP6A 4KPCA 5KFPA 2B51A 1FHTA 1H6KX 1YI2S 3P4IA 3KMQA 4A46A 3EZ5A 1VFJA 4GVBB 5GAEI 5DLGA 3L7OA 4PKGA 5H9EJ 3TEGA 3L4QA 2DCLA 4CO1A 2DR9A 1IQZA 3K89A 1LW2A 2ZC4A 3EWGA 5GIPA 2ETJA 4F3QA 3SV4A 3OTBA 4BACA 1DQAA 1HX1A 2BABA 1QE1A 1GX6A 3IM9A 4J8FA 5F3TA 2H5EA 3G9CA 3RAXA 5HANA 3SDEB 1DT9A 4M8LA 3CCLN 3DI6B 4USVA 4E1NA 4NXMJ 3VEYA 2L08A 5IT0A 4CF1A 3OFEA 4J37A 4ZLJA 4QAGA 3M9NB 1JLAB 3M8PB 4MT1A 1T94A 3QJLA 1SKSA 1N34F 3HYFA 4CCHA 3TOQA 2BOPA 3CFRA 4FKYA 3BZCA 1UTAA 2UVWA 2A1BA 3KJVA 5DDRC 4C0OC 2VQFF 1VQNS 2ZQBA 1WUUA 4B1XB 1VSFA 3LM9A 3FZFA 3FLCO 1P27B 5KG6A 4FNIA 2HVDA 5HN0A 3ZT2A 3CCSN 5AXMA 2J9CA 2YHXA 2VZ9A 5DGBA 1VQON 2R7VA 4K5RA 2AHOB 2JL9A 2CG8A 1T0TV 4P75A 5T14A 2YXLA 4C9DA 5IT4A 2VG7B 1YBAA 3NGYA 4DJBA 4MDBA 4ZPAA 1Z05A 5HMYA 5KG0A 2MDAA 3UQSA 1SIZA 1GMWA 1FE0A 3D4JA 5F8LA 5A8KA 1UJ5A 1S9FA 2QMUB 4UW2A 4JI7K 4NZ0A 2WVBA 1BHLA 3QDKA 3RBDA 1UOCA 5E41A 4YR3A 1N34K 4BC2A 2HQCA 5GADP 2V4RA 4H4OA 4UY8O 2W9BB 4C8YA 1TAQA 1X0PA 3S8SA 4KYZA 3ZCMA 1ASUA 1WB9A 1JQGA 1GXLA 3BF1A 2HWIA 1U45A 1LOTB 1S10A 2CQ3A 1AYEA 1CQMA 4A8XA 2F4VJ 1BA0A 3FMWA 2NUBA 4C3LA 4WCEL 4RJVA 1RAJA 2HS4A 3OXFA 1FK9A 5HOOA 3ZSZA 3DLHA 4WXWA 3M2VA 1KDNA 1YAGA 3JAMU 1GXUA 3ZLJA 1QUPA 2ZITA 5J2QA 2W24A 2Y1RI 2EPIA 3VZHA 2GZOA 4MJKA 4X62J 3LDQA 1Q8BA 4BREA 3D1HA 2M5YA 5BYRA 2E29A 4FJIA 4ZP7A 3BR8A 3HPGA 3D0GE 4LSLA 4JRQA 2O8FA 1OSDA 3VZIA 1Q1KA 3UR3C 3E01A 3QNNA 1FERA 5CD4A 5B08A 2C3MA 4BC9A 4WQ4A 3GIRA 1MROA 1NSAA 1AZSB 3CUNA 5E26A 4M1KA 4DL7A 4TU9A 4GW6A 4CJWA 1BQNB 4Q45A 1U1PA 4QPXA 2CUYA 2V2VA 3CFPA 4KKOA 3NH0A 1ASVA 2XYPB 1NLKL 4R5PB 3ZZPA 3D3BJ 2DXFA 3Q24A 4NA1A 4O8KA 3FZHA 5MAOA 4KTZA 4I7FB 2J9DA 3KLHA 1Q9YA 2EEYA 2JC0A 3EE3A 2OFGX 2NPIA 4JYAF 3C14B 2AA4A 3K5OA 3ZFVA 4Z4GA 2W01A 3QJPA 3GZ7A 5KQ8A 5D4PA 5IQ6A 2KKHA 3TVZA 2IM1A 3VQQA 2J9DE 4IDKB 3HP6A 4M7YA 4U8VA 2KVQE 3B54A 5IS2A 2OTJS 5EOYA 3VEXA 2K2PA 1SC6A 1EQ0A 4I64A 1YZ7A 2I7PA 4K43A 4CJVA 4AL7A 3PY8A 5FDLA 1S1XB 4DR4J 4DFKA 3B6OA 2B5JA 4LFBJ 3DDIA 1WTFA 2IYGA 2NQPA 2WSCC 4FXDA 5E3PA 1JCEA 4CVNE 4CJFA 5FD1A 1LFWA 4EZ6A 2JEIA 2ZE2B 1FDAA 2ZC3A 3DM2B 3CJQA 3MCAB 3LALA 4UUXA 2JEJA 4KB0A 4B9SA 1VRTA 2HLTA 1HKGA 5AZIA 4JYAK 3M30A 3OBWA 5TKYA 3R7NB 2E66A 3UIQA 4GC6A 3NBPB 3CDAA 3EDQB 1VQ8N 5FPNA 1CVJA 4B3TF 3H5SA 3F9KA 2WVCA 4DS5A 4JN4A 1O51A 2AU0A 3LP3A 3E3XA 4UY8T 2A5XA 3FRYA 2MZQA 2MKJA 2E9RX 4DSLA 4PXBA 1SUQB 1Q86O 4NMLA 1VQ5N 1Q53A 2K8GA 1BU6O 2IM0A 4C4WA 1LK7A 2BE7D 4L8RB 2OD6A 3NGUA 2GQ2A 4HACA 4FF1A 3M1FA 4ILJA 2L3MA 2ZJPQ 3OY9A 3OYHA 3JSBA 3CERA 4K4YA 4PWWA 4LF8J 4E1JA 4UTGA 3SZ2A 2VH7A 4WFAQ 1N36F 3B82A 1REVB 1SJFA 3S3MA 2W7AA 2B6AB 3D67A 4PXDA 2VPWB 5F0XA 1UWBA 3PW5A 2GVDA 4B3TK 5A8WB 1IKWB 2MLYA 2B8PA 3M7VA 3QERA 1KBRA 1FEHA 3MCNA 2HBRB 3TUIC 5AFUA 1U48A 1UFLA 4KBOA 5E84A 2UUAF 5KT4A 1Y10A 2R7YA 4ZVRB 3QBWA 1HYSB 3PYDA 3K2YA 1X4FA 4UOGA 4GVBA 2GUIA 1PAUB 1FW6A 3QMLA 4QOTA 4NB4A 3CCQN 1ICEB 4ECTA 1ROFA 1N36K 4GKKJ 2V9KA 4ECWA 4H0YB 3AXKA 3QICA 1SJ3P 4P72A 1JIHA 2H3GX 4P74A 2CGJA 5CCLA 1TFWA 1Q8KA 2IDEA 2L48A 3MCSA 2VPXB 5KFMA 4FPAA 5L8RC 3SDEA 4HHJA 1RKJA 3DI6A 3THPA 4WPAA 3SSSA 4NLBA 3LUYA 2G0CA 4NLQA 2E88A 2UUAK 2EWSA 1JLAA 4CTAB 4TSXA 1U2CA 5F41A 3OYEA 3OVSA 3VEVA 3R3LA 2ZH5A 1F5AA 4FNHA 1C1BA 3C6HA 2C2DA 4DU3A 1PO6A 1G4CA 4BG9A 1JLBA 4L72B 1HWUA 1KQSR 5BRHA 3PRDA 1NDKA 1FJGF 2MQMA 3OL7A 4LF9J 4KV8B 3NE6A 3OQ2A 1FT8A 3SMSA 4DPUA 4YOXA 3KD1E 2VG7A 4FJLA 1I3AA 3R6MA 4XH1A 4E7IA 2RH3A 2W4DA 4MDAA 4ZCIA 2DEJA 4PYAA 3DRPB 2H5IB 4ILMA 4B3RF 3C0BA 2Q36A 3F73A 4DCHA 1AUSL 2F9WA 3CCES 2X74A 3OS0A 4W92B 2BMBA 3BR9A 3JQJA 1VOMA 4Z4HA 1ZM4A 4KHSA 2I8EA 3PW2A 2P9GA 2W9BA 1N8RO 1VRQC 4QIEA 2XS2A 1FJGK 4AILC 1KHVA 2OPPB 2Y9HA 2NYHA 1BLUA 3PSFA 5C10A 3FJ2A 1HARA 1QQOA 4X64F 3KFWX 5HAOA 3ID6A 4OGCA 2AEMA 2WVEA 3FRZA 1CZBA 2XO6A 1I3OB 3GV5B 3WNHA 4F4YA 3U1NA 3IWNC 2GMHA 2A1SA 3HO1A 3D0IE 3AVNA 3HZGA 2D41A 2XSJB 2FSJA 4PY5A 2A41A 2HNDB 2PMZD 5HBMB 1GLLO 1VDHA 1NBWA 6FD1A 3PIPL 4USIA 5KOWA 2BQUA 4FYXB 5KRTA 4K4SA 2HHQA 4CE9A 1LXNA 2CDRB 1DRZA 1U8SA 1NDLA 3C66A 5IC6B 3GSDA 1PSDA 2I38A 2QI2A 4IYQA 3ZSWA 3JB9k 2L9DA 2Z2ZA 4X64K 1MSWD 3IM8A 1S0MA 1J54A 3OFGA 1AZSA 2GQCA 3U3YA 5K20B 2O4GA 4F3TA 5E3QA 2KO1A 1BDGA 4FWKA 3MEEB 1V4TA 1C0FA 4R5PA 1PC4A 5DDQC 2QFIA 2HIQA 4Q7AA 2COLA 5TKWA 4BRFA 2CYYA 1KQGB 1Q8LA 4I7FA 4Y2MA 2J0WA 1CG2A 4CERA 1VSIA 2Q66A 3C14A 3WXLA 4U67Q 1Q9XA 3BF4A 4TU8A 1Q79A 3I55S 2YNGB 5GVQA 1CXUA 4B9TA 2HPUA 4IDKA 4CBWA 3GWCA 4DKWA 2XMMA 3UB5A 4G1QB 1S12A 4E1MA 3AODA 3HI9A 2EG1A 1F1BB 5M1FA 3TAEA 1S1XA 4X66J 5DMRA 2DH8A 3PUFA 2KFZA 1CC8A 3G86A 5KTQA 4KH4A 2MKYA 4BRNA 3D3CJ 3KVGA 3L7UA 3K9KA 4I6MB 2G8UA 4KGZB 1YF5L 3SPZA 3H5UA 2HHHF 2ZE2A 3BO2A 4LBHA 2H54B 3DM2A 4Q8EA 4KI6A 2KHDA 4FM1A 1FWKA 3I96A 3SI6A 1PIEA 3TPQA 3MAHA 1VSEA 1WG5A 1EARA 2V2ZA 1NHVA 3O3LA 3VAIA 3NBPA 1S72N 2BKNA 3ENOA 3JXUA 3D54A 3GONA 3DXMB 1OPZA 2ZWPA 3MECB 4K25A 2WFBA 4IOAQ 4ZCMA 1SQKA 3CCRS 3A3OB 3N4WA 2JGUA 3TJ8A 4ZLPA 3NGIA 5DM7L 1SUQA 2J9EA 5K5MA 1L3VA 3WC2A 2ZH2A 1X9SA 2NLWA 2QEXS 1VK0A 3N4PA 4OIXA 2XMJA 1XQSC 4F04B 4KH0B 3GIKA 2HHHK 1WI8A 1JMTA 2XLIA 1MA9B 3NY0A 3G6YA 1REVA 3VN5A 1PJ6A 2B6AA 3Q0AA 4E0DA 1KKHA 2ZOFA 4BG8A 2M0GB 2QV6A 2AGPA 2XMKA 1N4LA 2DNLA 5A8WA 1IKWA 2QJ3A 3UR0A 3SUQA 2XGQA 1WF2A 3SEOA 2ZNYA 1N33K 1FEEA 2XQCA 2FSKA 1QD1A 3W5YA 4DQQA 3CJ2A 5B0AA 4CJLA 1SS6A 4GNIA 1S59A 5K8OA 4OHXA 1KC8T 1OVYA 1VK8A 4ZVPB 4ECVA 4DR5F 3ISNC 2KQ2A 4IG0A 4B9UA 3UD5A 3IFEA 4DDFA 2NYIA 4HTJA 2ZGYA 3ENBA 4NYFA 3HKWA 4C8KA 4Y2IA 5KFOA 4BRMA 5M1PA 4H0PA 2JFKA 4C8OA 2CJXB 4ZTJA 4OHYA 3MM8B 1HQEB 3I87A 4F0KA 1EAYC 3VQ6A 2CG4A 3DDNA 2DJWA 4ZJOA 3UKUB 1R0CB 2F8EX 2IM2A 4Y0WA 2A0FB 3M9MB 4NXNJ 2HFNA 1QQMA 1TKTA 1IBKJ 2Q1NA 2W40A 5KFWA 1LWEB 2MYFA 4ECSA 3U9ZA 3ATVA 4ZCLA 3MPUB 1AUDA 4B3OB 3CQ8A 4CF2A 4CTAA 3N5BA 1RYSA 5DM6Q 1E6VB 2W2PP 5HMWA 4J9KA 3O08A 3VF4A 2MJUA 3IO1A 3SMZA 3JQMA 2DYAA 3PKMA 2AT1B 2W9CA 3U1MA 5J2MB 4IRKA 2WVFA 5AQYA 4OV1A 4ZKAA 1SC3B 2YX7A 1OH5A 5HJXA 4LVNP 2HHUA 1SQFA 1RT4B 3DDKA 1U1QA 1WEYA 3WT0A 4KV8A 4FM0A 1JL2A 2EW9A 1Y11A 1TP7A 3JS9A 2N3LA 3VALA 4CZIA 4FWRA 1KEKA 3I32A 2XZDB 4DUZJ 2W2QP 1S9GB 4DTOA 4FJ8A 3MCOA 1TU0B 3GV7B 3NKYA 5KFTA 3Q22A 1K9MT 2VD3A 5I4MA 2RILA 4R0EA 2B4OA 3RMDA 4FF4A 2QG9B 2C42A 3W9JA 2Z2MA 3QFHA 4A59A 2RQKA 2P9NB 3QEIA 2JEFA 1UW9A 2HFUA 2XHCA 2PN6A 3NAHA 3GBTA 3DOLB 1O1WA 2Q97A 3T1YJ 3SCLE 3A5OC 4WZQA 1XMBA 3NAIA 1RHUB 1YHQS 2UVRA 3GP9A 3GYNA 3C8YA 4AHRA 3IRXB 2IGIA 3MEGB 2CH6A 2W4PA 4FYDA 2KT3A 4ZK7M 1KP6A 4FPIA 2YPZA 2CZ9A 3TAFA 3U27A 4WFAL 2F8TA 4LF2A 5J2NA 3CD6S 1HR0F 4YY3J 4ICLB 2VBYA 5HQLA 4C11B 2XSJA 3U9DA 1YIJN 2ZD1B 3GB0A 1WG1A 4OX9F 4YB1P 4K7QA 5G0RA 1NWKA 4DV5J 2HNDA 2BV3A 5LJWA 2W42A 5HBMA 3OVAA 4EHTA 6AT1B 3O1LA 4DS4A 4OZ5A 3VF2A 4AHCA 2JFDA 5A6WA 2OAUA 4O3PA 4CJ4A 4WQ5C 3BBCA 2PBDA 1HL6A 2HQGA 1JLGA 1RHJB 4M5JA 3D6MB 3MMBB 4KHQA 1NBEB 4ZA1A 3MCPA 4JI7J 3PHEA 4ITSA 3MFHA 4QWBA 2YCHA 1SKUB 3G87A 3UE2A 2MSSA 1HR0K 3P49B 2NRRA 2VF3A 1VHXA 2J0SD 2DGTA 4QCLA 1F3FA 4DHVA 1NG9A 2BKOA 4YOYA 3BUZB 4FLWA 3IN5A 2FZGB 4P2MA 1YK9A 4JV0A 3ISND 4DV0F 4FZYA 2I5JB 5AQOA 5LY3A 3ID8A 2YQ3A 3EX7B 2ZHBA 1S48A 1YG0A 2CPIA 3N5FA 2ASLA 5D6GA 3MURP 2DR8A 3DC2A 2YNGA 3MXMA 2ZBRA 3GLJA 4K42A 3A12A 4WTYA 1B9FA 1UPMB 4G1QA 4WYWA 5DQGA 4OJHA 2VOOA 1N5YB 1RT1B 3GYGA 2B9YA 3HZEA 1RTDB 3UN2A 3V4MA 3VTIA 3NHGA 1DTTB 4JI5J 2QSWA 3CSKA 4CEQA 3F41A 2JJ4D 4I6MA 3J8AA 2DVIA 2QL9B 2DR7A 1W25A 4JV2A 1GLCG 4DV0K 4ZDNA 3RVCA 2XY8A 2ITGA 4OMFG 2N7CA 3SIPB 3FUYA 4AD6A 3DXMA 1BD6A 3MECA 2FHKA 4ZPVR 2MQ8A 4ANDA 2A18A 3SSQA 3V9SA 2ZJQQ 1WNSA 3BKUA 1TZ0A 3GV8B 3ULDA 4JRPA 4DSKA 3BZKA 4Y2CA 2ZVIA 1NOZA 4FLYA 3BGRB 1RBUA 1C0GA 4DHYA 4NCGB 2V9WA 1ATRA 1TUVA 2ZVSA 1KQFB 3JS6A 2CVEA 3LM2A 2RPIA 4CGDA 3FEXB 2AD9A 3FZLA 4DV2K 4FJKA 1Y00A 2IVOA 4F25A 1P1LA 1BGXT 3EXCX 5KFFA 2GO9A 4AL6A 4WFBQ 2FPHX 3J7YP 4LBIA 1IBLF 3B6PA 5E3AA 4NCBA 5KFHA 3ILOA 4K0KF 3VR1A 2IOCA 2ZF5O 3M8RA 1F3VA 2DPNA 2AKWB 3ZTOA 2LEAA 5L9XA 2BJ7A 4WFYA 4FO0A 1AFJA 1C1CA 2PGCA 5B0FA 4LRBA 4WFNQ 4X65J 4WKRA 3P96A 3R6GB 4AQYJ 3LW5C 4DF8A 1HQEA 4A62A 1YRUA 4RNOA 2AZ3A 2WRMA 3UKUA 2NUHA 3S9HA 1KAYA 1GXTA 2IIHA 1NGDA 5L38A 1J53A 4P7TA 3SQ2A 2W1BA 2YKPA 4FWLA 3RSEB 1LWEA 3EGNA 1IBLK 3DXSX 3BQ1A 3HT0A 4K0KK 1M1KO 4B3OA 1RXOB 1YI2N 2KFYA 2HQIA 2BW7A 2VC1A 2CQHA 2UYTA 4JI1J 2AF6A 1VQ6S 1GOAA 1HNXF 1ZA1B 2NZTA 1KXPA 1Q4RA 5J2MA 1AXQA 1NB2A 3CMQA 4YOTA 1S6PB 2YNFB 3A8EA 4B3TJ 4O4RA 3ZETB 1RT4A 1JK9B 1OS5A 2YKOA 1OY9A 3O9TA 6FDRA 1S9EB 2XEXA 2V8PA 3QIOA 3AD8C 2X6SA 1S9GA 5KFDA 2K3IA 2W2OP 3N4QA 4IQMA 1ZA2B 5MLCV 3SI8A 2AJQA 4DX8H 1PJ5A 2DGVA 2P9NA 5C2CA 4HUGA 1FFGB 1NOYA 2VJVA 1S6UA 4WQ5A 1RLCL 5AE2A 4J9SA 3ZZOA 5JVGQ 2ASPA 2PA3A 2GA7A 4XPEA 4YDUA 3IMQJ 4KGVB 2QYCA 1HNXK 3AO5A 1QVFM 2Q3PA 2FC0A 5CZ2A 2CDQA 1VQNN 2F9TA 3IRXA 4E2FB 1C0UB 3MEGA 4KC5A 3PSIA 4C8MA 2M8DB 1K1SA 2CJBA 2E9TA 2D3O1 4JKFA 2GW8A 2NSBA 1N5VA 5HRSA 4CH1A 5EWGA 1NLVA 3BY5A 1RTJA 4LF7F 1GLJO 1NGAA 2MQLA 3EUNA 2MSTA 4ICLA 2VDIA 3ITHB 1EX4A 5F8HA 4RWXA 1DAXA 1RT3B 3PX4A 1V3ZA 2ZD1A 2YJFA 2YWEA 1AFIA 4V1Ak 5M1NA 2E1ZA 5AXKA 3IS9B 2PYLA 2W41A 4J9MA 4M5DB 1NDPA 2P6TA 1WSFA 3NVKA 1VC6A 2C3OA 2Z0GA 5J2PB 4CIFA 2H4WB 3RU0A 4U7UK 1VIXA 3VQDA 4JI6F 3RBEA 1ITGA 3AVHA 2YX6A 4JI3K 2CXEA 3VAKA 1DEJA 2D3OR 2MMYA 3H6EA 2LA6A 4BRQA 2RU3A 3ZNUA 3FCHA 1NGEA 1NO8A 4IFEA 2I7NA 4NLWA 3D45A 1U7LA 3MMBA 4ZPTR 2BM1A 3FFIB 1D8ZA 4JI0F 4H0XB 4LF7K 2RHQB 1UKUA 5A2QU 2OPRB 1FRMA 2IVPA 3CXCM 1S1TB 1Q18A 3PRVA 3KK3B 3BDPA 3H3NO 4NE9C 2CPEA 4KHPF 1HWKA 5KG1A 1LWFA 3TVKA 2J7WA 4MLEA 2VA3A 4TNOA 3IXQA 4A8WA 1VJQA 4ZITA 2F65A 2MHEA 4MMOA 3NGDA 3ICLA 3LF0A 3VENA 1NH7A 1XN9A 3FKBA 1M1KT 3A13A 5F8JA 5HQ8A 3RAQA 4FL9A 2I5JA 3NXZA 4JI6K 1R89A 1NK4A 2F3JA 2GVZB 2BX6A 4KAZA 3NF6A 2GJFA 5BYQA 2ZEJA 4JI0K 1RK8A 2HGMA 5GMEA 4JKBA 1XR7A 2E4LA 1J9AA 4BGAA 3SMPA 2ZNZA 1N5YA 4Z37A 1RT1A 3MM5B 2AX0A 4RW8B 4XH5A 1RTDA 1G2EA 4JNEA 5AJ3F 4KHPK 5A2QO 1DTTA 5C24B 3H46O 4OYMA 4DLGA 4GY2B 5AQJA 3OT9A 4IXCA 3HULA 4DTUA 4AUKA 2YHAA 3NVMA 1NRKA 4BRKA 3HKZD 2QMWA 1S79A 1S22A 2N4CA 4O3SA 2DHHA 2GQQA 4ZPDA 1PKUA 4X64J 4DL2A 3NF7A 3M9OB 3O8MA 4H0TB 5LL6Z 3SPYA 1J5EJ 1IM4A 3QGHA 4KGMA 3W5XA 1UW4A 3Q2SC 2BE2A 4IJNA 3GIJA 4YORA 4TY9A 2VWKA 4OJRA 4B9NA 2DNHA 2YNHB 2OTJN 3IR7B 2E2PA 4PR6A 1YQHA 1VQ9S 3ZSRA 5AJ3K 2WBRA 3FFKB 3EZUA 2JH3A 3BGRA 1B0PA 3O4WA 1SL2A 3SQ1A 3G8SA 4NCGA 1PILA 3RJMB 4CECA 4OYWA 1UVNA 3AHPA 2IVMA 1OYDA 4Z4EA 4KY3A 1EP4A 4ECRA 4CD3A 1LWCB 3I5BA 3CI5A 4U6PA 2NUUG 4LRCA 2P9SB 3BH7B 3RGIA 4DMNA 3BO3A 3SBTA 4Q2LA 2P9UA 5K8PA 3BSNA 2GFFA 2M70A 4H8KA 2KRBA 4AHTA 5DLFA 5DGAA 3O1BA 2BANB 5LJ3Y 3RMAA 3W2VB 1U2VB 2DXDA 3NMUA 1HKCA 4DTSA 5EGYA 1K44A 2BE9B 1XI1A 1X3NA 4OZLA 3NG8A 1QJHA 4B3MF 2GJIA 5IV3A 3PM9A 3MPDA 4NRUA 1K0VA 2JSXA 4IOCQ 2YWKA 1KOOA 4WJBA 3M32B 2DO4A 4RPFA 4LR7A 2HK3A 3AA8A 3FNNA 2Y0SD 3L0QA 4OVLA 3A2FA 4CLTA 2DPIA 3EPGA 1YVFA 3QFUA 3CM5A 2CQBA 2NZ4A 4OX8A 3LPUA 2HHHJ 1X4GA 4OGEA 1MMDA 1I39A 1GLAG 4LT6A 1QS4A 3B8AX 5ADXH 1EWQA 3O3FA 1RCHA 4F4ZA 5AQNA 3O44A 1W7WA 1QSLA 1FJCA 1WAFA 4RBUA 1RDAA 4PWDB 1S6PA 2YNFA 1NMEB 3ZETA 2O1PA 2MZRA 4B3MK 3ATUA 1CS4B 1HLWA 1N33J 2UU9F 1S9EA 2HNZB 2RUGA 1Q78A 2DKOB 1XJWB 3QWUA 4M3TA 2PZSA 3OXGA 1HFEL 3EEQA 4A8YA 4FJJA 4TYAA 1RAFB 1WTBA 1LAVA 2XNRA 1E4GT 4PAAA 4FK2A 4CHQA 2CJAA 4OPHA 4DR3F 4IDHA 4FM2A 2MB0B 4RNHA 3VEZA 2XZWA 1P9QC 4OZ2A 3HHLB 2ZJQL 1QVGM 2FBYA 4ES2A 2XS7A 4X4UA 4YOWA 1C0UA 2K7JA 2VICA 3MR2A 3OR1A 3N0VA 5C42B 5KFKA 3IAYA 1WEXA 4FYYB 2B3TB 3CHWA 2UU9K 3K5PA 1XQIA 4TYBA 4BVPA 2LCWA 2CH5A 1JCFA 5LMNF 4CZFA 4M5NA 2C2KB 3ITHA 4X4SA 3L2UA 3LP0B 5J1NA 1LAWA 1RT3A 4NYZA 4NL5A 1RTZA 2ZWHA 4IFYB 3O3GA 2KHCA 2UXCJ 3IS9A 5E7OB 3CCEN 4M5DA 3CCVN 1MU2B 1LW0B 4PG4A 3RZAA 5J2PA 2FC8A 5B8HA 3HVAA 3PX0A 7FDRA 4ED8A 3EXYA 1X0FA 1DURA 1W0HA 4BY9C 3W63A 3CG7A 3BKTA 4DSEA 3VF6A 5BR9A 3MR3A 1UJ4A 4PKDB 3V4IA 1HI0P 3HHLC 3C6UA 3FFIA 4N7TA 2X1FA 1CJTB 5LMNK 4CO4A 2OPRA 1S1TA 1EETB 1SH2A 3KK3A 4BWJA 4RNFA 4QQBA 4IEIA 3ADAC 1VBYA 1KVJA 2H3EB 4DV6F 2G8IA 4M5KA 1TVRB 3UDVA 4NWBA 4RNNA 3ZSXA 3KHHA 4B8AB 4RU9A 4I2PB 1OQ6A 4M63A 1RDBA 1CJKB 2FVSA 2DFFA 3A5NC 2GVZA 4DFPA 1S7IA 1WKJA 1B4SA 1RDWX 3CWJA 2R2TA 3AB2B 4PYDA 1YJWN 1W26A 2QSFA 2D0PA 1ZAWA 2Z8QA 3UW1A 3FGVA 3CCJS 2JDJA 1QVGR 3KHLA 3I4PA 3FBFA 5A6PA 3CO0P 4NX9A 3BO4A 2DGXA 3MM5A 2XM3A 4RW8A 2HHWA 1RYRA 1BC6A 2E5HA 3SK3A 2OCEA 3QGPA 4W4MA 2WC9A 5C24A 3AAWB 4DV6K 3P6YC 4ZJLA 5D0HA 1FRKA 1JXVA 3O5TB 2Y1LB 4DPWA 3EKSA 2CQ1A 1VJWA 1KTVA 1SZ2A 1K8AO 2HOEA 1VS3A 2UXBJ 2RN2A 5ETPA 4JUZA 1HNVB 4A8MP 4EO8A 4Z7CA 2XI2A 3NWRA 2LVWA 1HR0J 4QU7A 4OYZA 2HW3A 1XC3A 4DOZA 3QETA 2VFTA 3QFPA 2RVJA 1OWXA 3I55N 1R8CA 1T05B 4CHOA 1F9FA 2R8IA 4IH7A 2BVZA 4NCAA 2YNHA 3MUTP 3QNWB 5A76A 1RBVA 3KLFB 4X4PA 3T1AA 2O66A 2EFNA 2GIFA 1YXQA 5FROA 1W2BR 3DLKB 2VQEF 3GU0A 5ETRA 3CTRA 2CPJA 3A3NB 4NLDA 2V34A 3GFHA 4OQJA 2D7SA 4BR4A 4BCAA 2B8QA 2XNQA 2PFDA 1NHUA 1LWCA 4YB6A 3VQCA 4NYPA 4G1PA 4QYRA 3PLAA 4J9LA 2E2OA 4BE0A 4AFFA 2P9SA 2PT0A 3ALYA 4HT7A 5G4DA 4PQUB 5C25B 3VTHA 3CCRN 2Z30B 3BSOA 2ILZA 3U02A 1SC1B 2RSQA 2DXEA 2RU9A 1WAJA 4HYKA 3FR0A 1HQUB 4CHNA 3D0PA 1T9VA 1IO2A 1V5VA 3HBTA 3W2VA 2VQEK 4DV0J 3M6XA 4MIWA 1U2VA 2QEXN 3DHXA 4LFCF 1A9NB 3AQOA 4E98A 3CD5A 4LSNA 1WBDA 3D1QA 1TV6B 1XUPO 4KHRA 4CGJA 2E1MC 1F21A 3AVMA 4IZ9A 3TEHB 4GO5X 3TJAA 4YHHF 3OYNA 3A5MC 1IM6A 4ZJQA 3M32A 2D1CA 1RDCA 5KPRA 1Y5LB 1VBXA 1IKXB 1N6QA 3SCIE 2LQBA 1HNZK 3KNGA 4RWWA 5ADZA 4KPYA 2MHNA 2AIRB 3CDEA 5L1LA 3L9ZA 2ZDPA 1RA6A 3W1YC 3R9PA 4DI6A 3CJ3A 4DV2J 2D69A 2XLJA 3WIUA 2J8AA 1TMMA 4PWDA 1VISA 1M5PC 4PG7A 2HQ3A 3GOIA 2NCKL 3Q83A 4OYXA 2FD2A 3KMSA 2EBGA 1TKZB 1CS4A 5AQQA 4E89A 3L3UA 2HZCA 1RSCA 2VG6B 3AO2A 4NLRA 4A5AA 5KFLA 3PRBA 2VONA 3V81A 2VIHA 3R2CJ 2EFPA 3CJ9A 2OPQB 1K8AT 1I51B 3HM8A 3SJHA 3IR5B 1FJEB 3SAHA 2DR6A 1HMVB 5GMKa 4ECZA 3CJ5A 3C6AA 3KD5E 1MDUB 4IO9Q 2ZJRL 4FBTA 3MFIA 4ID5B 2GV1A 1WEZA 4F0HA 3DLBA 3HHLA 1RTIB 1NGBA 5FPEA 2VFRA 1HIYA 1D4XA 4R8UB 2WTFA 2QM1A 2A42A 3FSXA 3GMGA 3JSYA 1TYQB 5C42A 4K5SA 1I94J 2CGLA 3L7PA 4F0MA 4PL7A 3GJSB 5B0DA 2FB0A 5JMNA 3AO3A 4D3GA 2R2SA 1MWQA