4DR6K

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr6K00
3J7YP 1XNRK 1IBMK 2HHHK 5FLXO 2UU9K 4B3SK 1J5EK 4B3MK 4DUZK 4DV4K 4LF6K 1IBLK 1N33K 4JI1K 5LL6Z 5LMNK 4CW7B 4DR1K 4DR5K 4LFCK 3J80O 4DV6K 4AQYK 4JYAK 4DV0K 1N32K 4DV7K 5IT9O 4YHHK 4X66K 1I94K 2E5LK 2UXBK 4LF7K 4CVNE 4LF4K 1HNXK 3T1YK 4B3TK 2UUCK 5IWAK 4YY3K 4JI0K 4DV1K 3OTOK 5A2QO 1N34K 4JI4K 4LF5K 4JV5K 4NXNK 5AJ3K 4DR4K 4V19S 3J7AP 4OX9K 4DR7K 2UUAK 1HNZK 2F4VK 4GKKK 4DR3K 2ZM6K 4LF8K 1XNQK 3J81O 4JI6K 4X65K 4DV5K 4DV2K 4JI5K 4DR6K 4DUYK 4LF9K 4X62K 4JI3K 2VQFK 4LFBK 4JI8K 4JI2K 4DR2K 2UUBK 3JAMO 4JI7K 1FJGK 1HR0K 4X64K 1HNWK 4GKJK 2VQEK 1XMOK 4LFAK 4KHPK 1IBKK 1N36K 4K0KK 4DV3K 3T1HK 2UXCK 1XMQK 5BR8K 2UXDK 4B3RK 5LMUK 4NXMK
chains in the Genus database with same CATH superfamily
3J7YP 2P9SA 3CC4N 4K25A 3J8AA 1EWQA 1C1BA 1WSGA 1WOQA 1J6ZA 3P4IA 2WONA 3HVRA 4B9NA 4LF6K 3LL3A 4CE9A 5AQHA 4K8XA 1JL2A 1HX1A 4B9UA 4BR4A 3EE9A 4CESA 4DR1K 1L3TA 3CFOA 4JS4A 3D2EA 4IFYA 4DKWA 2A1SA 5F0XA 3MWPA 4K42A 2YHWA 4OKJA 2AA4A 3AAQA 4CBWA 3O9TA 1W9HA 4H03B 1DKGD 5C2DA 3IUCA 3FE1A 3O5BA 3P31A 3ZX0A 3FZLA 2PYJA 4GV6A 2HB5A 5ADXA 3ZT2A 3E9PA 3KKSA 2HHWA 1BQMA 3QFUA 2ZE2A 4KREA 1ASUA 1R59O 2IS3A 2QWPA 3AVLA 3QETA 1X3NA 3RMAA 1BL3A 5B8HA 4CFBA 4GNIA 4IEIA 5AJ3K 2IAJA 2Q31A 2YJEA 1NMNA 4DR7K 1YTUA 3T69A 4FZXC 3NBPA 1JXEA 5BN9A 2ZWHA 1RBVA 4DS5A 3EEQA 3SK3A 1QQNA 5I9EB 5CZ2A 1VRUA 4IG0A 3DLBA 2F9WA 3VQ8A 4CJSA 4FW1A 2RPIA 5I3UA 1OH5A 2QM1A 4Q0BA 3PX6A 3NFAA 4AILC 1ATNA 1KFDA 3S3OA 4CECA 4ELVA 3M3ZA 2Y1IA 1NK7A 3O80A 2EX3A 4YDUC 4CGDA 1I39A 2D1KA 1VSHA 4Z4EA 4F3TA 3O1WA 4CJPA 1BA0A 3PSFA 2F96A 4DU1A 3L3VA 3HP9A 1A5WA 2HHSA 1GOCA 3DLKA 3NF9A 4ILGB 3ZX3A 3MN9A 4R5PA 4JKCA 3O4WA 3LDSA 2GELA 3KLIA 4KH6A 1C0TA 1EKEA 5J1EA 3PX4A 5SZTA 3FFKB 3LALA 5M1PA 4CJQA 2B5JA 4CJLA 4Y0WA 3TAMA 1D8YA 2V7YA 1BCMA 4ISGA 1EP4A 1OH6A 1E4GT 4BC2A 5KQDA 3RWUA 2AP1A 2V51B 3E01A 4JI1K 2I7NA 1LWEA 3DRSA 1ZBHA 5CYQA 1KSPA 3HSTB 1RDDA 1HPZA 3MXMA 3D0PA 4OO1J 3ZSWA 1KD1O 5AQYA 4UQGA 2NRZA 5JICA 3OS2A 2G8FA 1GLLO 1BQNA 3QMLA 2E88A 1L3UA 1VQNN 1CXQA 5EOYA 1ASVA 3VQDA 4FLUA 3DXKA 4B3TK 2OYQA 1O1WA 2E2QA 5IWAK 3S9HA 4B1UB 2NNWA 1VQ7N 5KRSA 4Z4FA 5BREA 1TYQB 1RT5A 1NBWA 3VEZA 3L2WA 4F8RA 4CK1A 2ZGZA 1NJIO 4GKKK 1K8AO 3V4IA 5E26A 3QIPA 3AVAA 3TWHA 1NK4A 5H1SQ 1HRHA 1HYVA 3MCAB 4B1ZA 2P5OA 1T03A 3DOLA 2O8BA 3SQ0A 3VQ7A 5AZJA 4W5NA 2WC9A 4B1VA 4BRPA 1TAUA 2UUBK 3QINA 2B6AA 4JI7K 2XY5A 4PY5A 3V9ZA 3TI0A 3FZHA 3D7EO 3SLCA 4GKJK 1GLEG 5AQFA 3K58A 3EZWA 1CZAN 4EP4A 2ZF5O 3HTVA 4ZTFA 3VEXA 5EY4A 1TGOA 2D4WA 3MXIA 3IMXA 2A40A 4AHCA 3U4LA 4KTWA 2YX6A 4MQ3A 3V9XA 1NGFA 5AQIA 4OPJA 2I5JA 3HPGA 2BE2A 4LD0A 2OANA 3CM6A 4KKOA 5BPLA 4KRFA 5GAGP 3HK2A 4CJ5A 3UB5A 4BRNA 2HVIA 2FBYA 3WNEA 4BGBA 3VENA 2VCPA 4H5NA 4FJIA 4KHQA 3G25A 2XY6A 3WXMB 3KD1E 3C6UA 4DSEA 2FF3B 2YKNA 3PIOL 4M41A 1QSLA 3VQ9A 2HMIA 1CXUA 4CIFA 3AVMA 1NWKA 3O1BA 3SJHA 2HW3A 2FC0A 1HNXK 3OBWA 4MLEA 4YY3K 2HBLA 4JI0K 2GEMA 4CF8A 2DPNA 2YV0X 1VHXA 2BDPA 3RRGA 3HPHA 3DWLA 4ELUA 3T1AA 1BWFO 3SBTA 4DQQA 4RW9A 5C12A 1U47A 3P38A 5C15A 4CIGA 2O8CA 3CCEN 4A5BA 4LSLA 2NLXA 1BDGA 2NZTA 2GX9A 2Z1HA 4X65K 4DV5K 4H0PA 4O0IA 4HTLA 4HVJA 3G6EN 3ENOA 3AO4A 4E1JA 4N56A 4BE2A 1WSHA 4HWIA 4OPKA 4X62K 4BG8A 2VQFK 1BOTO 4Z4IA 3FGUA 1EXQA 3AVGA 4DQPA 3C6TA 2HHVA 3OJSA 3U9ZA 4H4MA 1NK0A 3QICA 4CJKA 4WFNL 3G0ZA 1NK8A 1TL1A 4IOAL 1RNHA 4FWPA 3BF1A 1NNEA 1VSKA 2P9LB 3IRXA 4CJWA 4E1NA 2KW4A 3L2RA 1TAQA 3ULDA 3QLHA 4DV3K 4IBNA 3TAGA 3VEWA 1LV5A 2E2NA 4NYNA 2KZMA 4F9OA 3TABA 2JLEA 4JRQA 4A5AA 5KI6A 4RCHA 1KTQA 1YIJN 1QTMA 4FWNA 4DV4K 3DAWA 2WUSA 4M7XA 4AHTA 3TAQA 2HHQA 3C0BA 1VQ4N 5DK5A 4CGFA 5LMNK 3LM2A 1S9GA 3CCJN 4Y1CA 3AA5X 3M5RA 4DV6K 4FK2A 2OCEA 3THXA 2O8FA 1X3MA 1N32K 3MCPA 2BUPA 3QERA 4A57A 1W7AA 1MU2A 2PY5A 4ISEA 2QWRA 4PKGA 3EY1A 3VGLA 2NRTA 1RT6A 4PKIA 3V1RA 2LSNA 1NJXA 2E4LA 3WQTA 3K0SA 4JHDA 5M1QA 3VGMA 4C8OA 4C8NA 1NOYA 3VQQA 4M3TA 3O3GA 4F4KA 4RW8A 1Z25A 3OJUA 4CF1A 4ICLA 1Q9XA 3IAYA 4CHPA 4KTZA 4BGAA 3RMDA 1ILYA 1NK6A 2QXFA 1LOTB 3A5LC 4BRHA 4DTNA 4JK9A 4CEAA 4DSJA 2HHXA 3CI5A 4XIUA 4KH4A 1TVRA 3EYZA 3V81A 3JAMO 3LP3A 2P9KA 1ZBIA 3U9DA 1DLOA 4DLGA 3ZT3A 1WSEA 3OYMA 2P9NB 4FL9A 1VRTA 4N47A 2QKBA 1GLAG 4K0KK 5C0YA 3T1HK 4WQ5A 5BR8K 2GTDA 2NUBA 3VEOA 5AQQA 3AY9A 4FWOA 4YOUA 4I6MA 4ILJA 1MDUB 3RMCA 4H0VB 1NK9A 4BC4A 3W3DA 3IS9A 3CC7N 3ULEA 3M8QA 1HKBA 2CGKA 3H45C 3WEEB 3OW2M 3G10A 4ISFA 4YOWA 3I8BA 3IG1A 2QK9A 1Y97A 1XWLA 3BZCA 2FBVA 4CF9A 1JKHA 5IT9O 4KO0A 2ZGYA 4JK7A 1NKEA 1SKSA 3BY5A 3NGYA 3AGRA 4AM7A 4O55A 4JKGB 3WXLA 4BREA 4DQSA 2V52B 5GAHP 3VQ5A 1N34K 3LP0A 4N5SA 3ID6A 4NXNK 4FLZA 4IFEA 4EZ6A 3QO9A 3KWIA 4XH4A 3O08A 3MEEA 2E2PA 3AVCA 4GV9A 3LWMA 1Z05A 4CGIA 3EKSA 4I7FA 5AQLA 3TPQA 4KI4A 1QQMA 2W41A 4DR3K 2ZM6K 1NGDA 4ZTJA 2WOMA 4E7HA 1BCOA 3LZJA 3BGRA 1XUPO 1WUAA 3O9SA 3CCSN 4B9MA 5FDLA 4DTJA 3G71N 1L3VA 3VQPA 4BRGA 4FJXA 2KZZA 5CR4A 4Z4GA 3E9LA 4BE1A 2Z1JA 2XO7A 1KLMA 2ASOA 5E41A 2GBZA 3NF8A 3HM9A 1ZXOA 3PO5A 3LZIA 4JKDA 4BDZA 1QQCA 1YUWA 5I42A 3OYJA 3VESA 3ZETB 4WCEL 3SI6A 4RTFD 4CJ4A 3L2UA 4I2QA 2G8VA 4LFAK 4KHPK 2HNYA 5CHIA 2X6SA 4CZKA 1BU6O 3A5MC 1IBKK 3ZX2A 3DYAA 2H3GX 4AHUA 3N4PA 1QZ5A 4CK2A 2O8DB 3I0SA 4CEDA 3TTCA 3U6FA 2VG7A 1VQLN 4B3MK 1HKGA 2A3ZA 4FLXA 1FK9A 1SZ2A 1NJWA 1NU0A 3NVKA 4CD3A 1NGCA 2HF3A 4CD1A 1BIZA 3QEXA 4IOXA 3PUFA 3L3UA 4EHUA 5E84A 2IVNA 1KVCA 4OLAA 4BE0A 4DF4A 3UE5A 2PYLA 3F2KA 1ZBUA 4XH1A 3CJCA 3EE8A 4DFMA 5KGXA 5EU7A 5T7BA 4B08A 2E20A 1RCHA 1QSSA 3F5TA 4BRKA 4KHUA 4FVMA 4GMJB 3DLEA 1KQSM 1CLQA 1RDUA 1REVA 4HUFA 1BI4B 1JLAA 3F9MA 2UUAK 3S3MA 4E19A 3ZSOA 2Y1JA 3QNNA 4WQ5C 4W5TA 5GADP 5HBMA 1A5VA 1T7PA 3NH1A 4CZJA 3AARA 1NKBA 4DMNA 1TYQA 4J2AA 3C95A 1EX4A 3C6HA 3M1FA 3TSQA 1WBDA 1JCFA 4FLWA 1VSEA 3B8AX 1S6PA 4JEPA 1W97L 2VWKA 4OKKA 1WB9A 3CXCM 1VQ8N 4JKHA 3CCUN 4OGEA 3H3OB 4ID5A 1HUXA 4KHSA 2HOEA 5JMVA 3OYEA 3DLHA 1RT4A 4CEZA 1W2BM 2FBTA 3JSMA 1NM1A 1OVQA 1UAXA 1J54A 1ZYQA 4BVPA 2OPPA 3VF4A 4NXMK 2G8UA 3ISNC 3DRRA 4H0YB 3DMJA 1IBMK 2O4GA 2R7YA 2CGLA 2RHKA 4H0TB 3SUNA 1L5UA 3LANA 1D4XA 3C94A 2GUIA 2E1ZA 1W0HA 3ATVA 1ITGA 2QWMA 4LC9B 5LJWA 1MWKA 1X1PA 5AQWA 4F2RA 2DFHA 3KK3A 1T05A 4DV7K 1NKCA 3KTQA 1OVYA 1LW2A 1JJ2M 2W6LA 3CHWA 2HNDA 3QNOA 1BIUA 4LF7K 1S9EA 2OZMA 4LF4K 4FJHA 3VQEA 1VQ5N 4O44A 5EXWA 3ALYA 1CZ9A 1RILA 4B8AB 3H1QA 1J9AA 3OTOK 4BDPA 4JV5K 3OYGA 4OLBA 4FWKA 3AO1A 1WN7A 4BQLA 3QEWA 4BRCA 3ZT1A 3FZMA 1T6CA 3AO3A 4A61A 3CIPA 3KZBA 2ASPA 4FWQA 3ZSQA 3CCRN 2RE2A 3M8SA 4IKFA 3BF3A 1RGIA 4LFBK 3J7ZO 1TUUA 3OYLA 1XC3A 5LY3A 1NGAA 4CHOA 4Y1DA 2XRIA 3THVA 1TKXA 3C7NB 4NCAA 3K9JA 1UA1A 2Q3SA 1S72N 3CETA 3AO5A 3ZSYA 3CCVN 3BUZB 4YOVA 2W42A 3KKRA 1N6QA 5AQSA 4XEIA 4CFCA 1T8EA 1NJZA 1B92A 1HYZA 4K41A 5AQRA 1XMQK 3S3NA 2KTQA 3THWB 2P9UB 1JLBA 4CJ3A 4AM6A 2NRVA 3KD5E 4C23A 2YNFA 1IG8A 1EETA 3ZT0A 4BDYA 2ETJA 2P9LA 3VPZA 3AVKA 3CPEA 3VEVA 1Y64A 3QEIA 5AQPA 1R0AA 1YTAA 2QWQA 3VQ4A 2NRRA 3AVBA 2ZQBA 1V4TA 3D2FB 4EP5A 5HP1A 1HYSA 4NYFA 1C0MA 4CZIA 2GWJA 3R1XA 1P90A 3K5MA 1HNVA 3LDQA 3SV3A 3QBWA 3R9PA 2G8IA 3SQ1A 4H4OA 2ZJPL 1B9DA 4KTQA 4IFVA 3U3YA 3OYDA 4Q5VA 4CHZA 4W5QA 3V6DA 1U2VB 3KK7A 4WYBA 2PAVA 4L3QA 5A2QO 2NRXA 5JS1A 4ZHRA 4FWSA 5AQJA 4DFPA 3PLAA 4CHYA 4V19S 4QOZB 3T19A 3L4IA 3U8XA 3M8PA 1HNZK 4PHTX 4GW6A 2RN2A 1SKRA 2J4RA 1WSIA 3FLCO 3ASMA 3E1YA 4KFBA 3UKUB 1QSYA 3O3HA 3GE1A 4BRMA 4TSXA 2HVHA 3VEYA 5C10A 3L0QA 3WXKA 1S22A 3MMVA 5AQTA 1YJWN 4LF9K 2JWKA 3KLGA 3CC2N 2BGGA 1KXPA 3SJJA 1K73O 3RR7A 3VQAA 3FR0A 3QFPA 5FRMA 2NRWA 3AVIA 4FM0A 3VERA 1FJGK 5AQMA 4FJ5A 2FSJA 2D0CA 1XHXA 4E3SA 3TSPA 1VQKN 4DQ8A 3R8EA 1D9FA 1S1XA 1UOCA 1TUYA 5KPRA 3KWGA 2XHBA 2E2OA 4FJ8A 4YORA 3MWTA 2YHBA 5HLFA 2ZJQL 1NOZA 1KFSA 3SYZA 4RW4A 5LMUK 2A6AA 3BP8A 3OS0A 4LY7A 3T7ZA 3LP1A 1QE1A 2P9NA 3O9UA 2E1YA 3OYIA 4A62A 4FJGA 2UYTA 4M3ZA 4H0OA 2Q97A 1D5AA 4FCYA 1YT3A 4RW7A 3P83D 4BRLA 3TAPA 5AQGA 1SKWA 2ZJRL 4CW7B 4FJ9A 1Z6RA 4QS8A 3WNGA 3VQ6A 3VF6A 4YNQA 2HHUA 3F9KA 4B9QA 3HVTA 1D9DA 3PO4A 4M42A 1YVNA 4MFBA 4YHHK 1TK0A 5JLHA 2NRHA 1P8ZA 1Z26A 1S1WA 1HJRA 3LDNA 4OJRA 1QHTA 2ZD1A 4FOIA 2FSNA 5AZIB 3PV8A 2BTFA 5FPDA 2OA8A 5KQ8A 4CFDA 4EZ9A 4B1XB 4CI6A 1OH8A 4N41A 1U6ZA 3VMFB 3K2PA 5EX5A 3CCLN 1KAZA 3FZKA 2E6MA 4FSVA 4KH5A 3ZEUB 3SUQA 4FJKA 5J2NA 4JKGA 5AFUH 2FLOA 4H0XB 4J2EA 4PQUA 5FPMA 1HKCA 3J81O 1WLJA 3M6GA 3AVHA 3H6EA 4OKEA 4DSKA 5HRPA 1DGKN 4DV2K 4JI5K 3LDPA 1NGEA 2HNZA 4DR6K 1EWRA 1RDCA 1SL0A 4B1YB 4CZHA 5FRNA 5C25A 1DEJA 1SV5A 2BANA 4JI2K 5K14A 1RTHA 4IG3A 4OVLA 2IC3A 3AAPA 3MN6A 4YFUA 3GL1A 3V9UA 1U45A 4GVMA 3HI0A 4MLHA 5DM6L 4CJRA 4DU3A 4KI6A 4H5VA 3OYKA 3AVNA 4DTUA 1IV0A 4CBXA 1IKWA 3CMAN 2PZSA 4BR9A 2UXDK 2B4JA 1HQEA 5LJVA 2F8TA 3CPWM 4FJ7A 3H1VX 2HHHK 4IXCA 1RT7A 1Q82O 4BR7A 3NCIA 4E89A 4DUZK 4JK8A 3SZ2A 4JRPA 2OZSA 3AV9A 3WXIA 4FJLA 1E4FT 1ZC6A 2KFZA 1FKOA 2O8DA 3QIOA 1VSFA 3H3NO 3OHRA 3F73A 3QDKA 4A2AA 4DV0K 3CMEN 4JYAK 3I8DA 1WAFA 2WFBA 3RR8A 3SCXA 3ITHA 2X78A 4DF8A 4KAZA 4W5OA 1LW0A 4C1NK 1U48A 1K8KB 1IH7A 3MX2A 3A5OC 1NGBA 4J2BA 5TKWA 5HRRA 3A2FA 5F1XA 1SS6A 4CJVA 1SAZA 2O8EB 2E6LA 1YHQN 4CEFA 3A5NC 2IIRA 4O5FA 2D0PA 4OX9K 1RDBA 4GY2B 1Q18A 3L2QA 4FJJA 5KPTA 2VGMA 4LF8K 4CEQA 2E8AA 2YI1A 4CGGA 1BG3A 2Q1NA 3AA2A 4B9LA 4HUGA 4QAGA 2KFNA 4JD2B 2HSTA 1BI4A 3R6MA 3SV4A 1UA0A 2X74A 4JI3K 2GV9A 4O0JA 4XH5A 3HOTA 2Q2RA 4DR2K 3SBGA 4EHTA 1J5OA 2QA4N 4CJUA 3LDOA 2ITMA 1TK8A 3CJBA 4DTXA 3TU5A 2QWOA 5JVGL 2YHYA 1J53A 4DB3A 1XMOK 4CF2A 4CBUA 3D6RA 1A5XA 1QQOA 3MN7A 4B9SA 4DTMA 3DLRA 4OPHA 4M3XA 2F7TA 1X9WA 3HL8A 1E3MA 1QVFM 1ASWA 4ID1A 1JXBA 3DM2A 1XNRK 4JHDB 4M3YA 3CERA 1JCGA 4NLCA 5TKYA 5GAEP 2A5XA 4Z0UA 1RDAA 4NO7A 3SPZA 4CJTA 4Z4HA 3HYFA 3NDKA 1VSLA 5AR0A 3G4SN 4MDAA 3OYHA 4DTPA 3TANA 4PL8A 4LH4A 5KGWA 1OH7A 2QEXN 4YOXA 4KHYA 3B6OA 3O9RA 2IGIA 3ZCMA 4CGJA 4JKAA 3OVNA 3QESA 3MN5A 2FXUA 4QS9A 2DFFA 3JS6A 5J2MA 4IJAA 4K8ZA 2YKMA 4DHYA 2ITGA 3HXMA 5BN8A 3Q7CA 3KVGA 4PA1A 4E0DA 3I55N 1U49A 2D0AA 4H8KA 2KHOA 1UWBA 1WSFA 3DLGA 1VQ9N 4LF5K 1X9JA 1BO5O 3VF2A 2A1RA 2YNGA 3B6PA 3Q7BA 3K5OA 2WBNA 3KK1A 3J7AP 4ELTA 4KHNA 1HMVA 2F4VK 4BVOA 1DTTA 4I6MB 3U3GA 4WFBL 2P9IB 3VQBA 1ZBSA 2JGUA 4RW6A 5HRSA 1LAWA 1RBTA 5BR9A 3RSEB 4CZFA 3WUHA 4AHRA 1MWMA 3EL2A 3ULEB 3KLFA 5FPNA 1LAVA 3ID8A 2BH1A 3OBYA 5BRHA 1RTDA 2YHXA 1M90O 4CGHA 3GG4A 4A2BA 4BG9A 3E9OA 1TKDA 3H08A 1TKZA 3HM8A 4WE1A 1RTJA 1IKYA 2PBDA 5KPZA 2OPRA 5BPMA 3P5JA 3I56N 3CFRA 3DOKA 1YAGA 3IDHA 3GDQA 4G9ZA 4HTUA 3KHYA 4FYDA 2P51A 2P9PB 1YJ9N 1LCUA 4CJFA 4BQZA 3C7NA 5DMRA 2W40A 5CYMA 3UKRB 3P1GA 3AGKA 1C1AA 3NGIA 4PUOA 1QVGM 2AJQA 2D0BA 1BUPA 1YITN 3IFRA 1KCFA 4BR5A 3HZ6A 4I9QA 3THWA 2P9UA 3HOSA 4NCGA 2W6KA 1IG9A 4WQ4A 1RBRA 4O8KA 2QI2A 3TAEA 3O4NA 1JCEA 5AQNA 2F8SA 5C42A 4UY8O 1S1TA 5AQVA 1IKVA 2HBMA 2I7PA 4CVNE 3KLHA 3KIOA 3D2FA 2Z1GA 5FPEA 3OS1A 1FW6A 1JLQA 3THYB 4FXDA 4DV1K 4H5RA 1BHLA 1Q7YO 4DCHA 3C65A 1NLVA 3L4QA 1ZBFA 1NMDA 3ATUA 1C6VA 4BR2A 3ENBA 4CHNA 1RT3A 3NAEA 1GLDG 3CQYA 4E1MA 3O6WA 3K57A 4C1NI 3DXMB 4BRQA 3WNHA 5BRDA 1YXQA 1U2VA 3SNNA 2QWLA 3QEPA 5CZ1A 4O5BA 4EAHD 2YNHA 1VQ6N 1NGHA 4B1WB 4DUYK 1X9MA 5CE3A 3HRGA 4PL7A 4HUEA 3VTIA 1KLNA 4CZGA 3MECA 3UKUA 1C1CA 4IDHA 2P9SB 1HQUA 4KPYA 4CJEA 1GLCG 4C8MA 4JKFA 4RWTA 2A41A 4Z94A 3HO1A 1SQKA 3FFIA 3NVMA 1LWFA 2EHGA 1EO1A 1T6DA 3SAFA 1N36K 3OYAA 4KB0A 1H1VA 2UXCK 4CIEA 3D45A 3D2EB 1Q8IA 1GOBA 3MXJA 4FK4A 4CERA 3JXUA 4FPBA 3MAQA 3CF5L 4DS4A 3CM5A 3AA4A 1WBBA 4BWMA 2CH5A 5EVZA 1JLFA 3K5NA 3N4QA 4CEOA 3RVCA 1N33K 3CJ9A 5AQUA 2HHTA 4FM1A 3MDQA 2EWSA 1C0FA 4IZ9A 4DU4A 1ATSA 1KVAA 5ADXH 1JLGA 3LPTA 1RBUA 3CG7A 4ILHA 4F3OA 3W0LA 4FJMA 3CQXA 2QTDA 3FZFA 4RG8A 4M63C 3ZLJA 3PY8A 2YCHA 5M1OA 3SUOA 3T3FA 2FBXA 1NJYA 1VQMN 4WF9L 2F9TA 2DFEA 3V1QA 3T1YK 3NE6A 1TK5A 1WSJA 2HF4A 2FF6A 1S6QA 3VA0A 3I0RA 3CQ8A 3TTDA 2DY4A 4BACA 3AO2A 3MX5A 4E7JA 4JLHA 3HJFA 4DR4K 3SMPA 3OYNA 4OPAA 2Q0UA 3I33A 4HHTA 1GLJO 3GBTA 1VAZA 5AZIA 3TARA 4FLYA 3GOIA 3TSUA 2DTUA 5HROA 2YHAA 5M1NA 1VSDA 2CH6A 1WAJA 4JI6K 4DFKA 4FK0A 4NLBA 1RBSA 5CY4A 3LAMA 2ATQA 4I9LA 3ZSZA 5AFUA 4OGCA 2A42A 1NG9A 1NGIA 4HCBA 1YJNN 3PSIA 2VG5A 4U67L 3K59A 4M3UA 3NH0A 5AQOA 3A0IX 4DSIA 4JI8K 2IDOA 3ZEUA 4DTRA 4CCHA 4BY9C 4JKEA 4WQ4C 3WNFA 3ZSRA 4CFAA 1HR0K 3HSCA 4MO4A 2YJFA 4DFJA 4NCBA 3AA3A 3NHGA 3HP6A 4BC5A 3EZ5A 4BRFA 1YF5L 5M1KA 3LAKA 2JWLA 5AQZA 2QKKA 4AH9A 4FZZA 1KAYA 1OKJA 4JNEA 2VWBA 3KLEA 3VN5A 3H46O 2UU9K 4QCLA 1VQPN 1J5EK 5C2FA 3CCQN 4PKHA 3VQCA 3L6QA 3DXKB 1IKXA 2G8WA 4K43A 4BR0A 4L8RB 4JS5A 1GLFO 1WNSA 2HBJA 1HPMA 4C8KA 3LDLA 4CF0A 4BRDA 4DQIA 4B9VA 1RFQA 1FKPA 1Q81O 4FZYA 1NGGA 1BA1A 3KJVA 3TAFA 1V4SA 1HNIA 4WFAL 5ELZA 2QXLA 3E66A 3CJ1A 5KTQA 3NGZA 4HCCA 3JYTA 4QS7A 3O3FA 1S3XA 4H5WA 1LWCA 1YVUA 3AVJA 4FWRA 4DTSA 2O8BB 3PX0A 5AZJB 1C0GA 1K8KA 3OA9A 3DRPA 1BGXT 5JS2A 3V9SA 1S1UA 3VETA 3OY9A 5GIPA 4U7BA 3WT0A 4F2SA 3CCMN 1RT2A 5F2RA 3DI6A 3WXJA 2O8EA 4LSNA 3O8MA 5AQKA 4CHQA 3WEEA 1KVBA 2IVOA 4GVEA 3SQ2A 2YNIA 2IVPA 2PFUA 2VG6A 3SPYA 4FVUA 3MK6A 1G15A 3IKMA 3SAGA 1GLBG 4B8CA 2D5RA 1Q86O 1S5JA 4MDBA 3VOVA 5SWMA 4X64K 3M8RA 1ZBLA 3EO3A 1HNWK 1L3SA 4CEEA 1RTIA 1VSIA 4JD2A 4EFHA 4DTOA 4KB1A 1BISA 1DTQA 3OYBA 4J8FA 3ZYYX 4FJNA 5JLFA 3CFPA 5GINA 2OTLN 1X9SA 4AHSA 1FXXA 3DLLL 5FLXO 4B3SK 4R79A 4JKBA 4MO5A 3SMSA 1IBLK 1G99A 3SAHA 3UIQA 2G8HA 1XQSC 3MEGA 2XY7A 4AHVA 4DR5K 4LFCK 2X6NA 4FWMA 2GWKA 3RTVA 4CZEA 1T3VA 4YOTA 1S1VA 4FWLA 1TKTA 2VYPA 3EN9A 4LH5A 3PIPL 5AQXA 4GV3A 1I94K 3ZETA 2O8CB 2UXBK 3VTHA 5M1FA 4BWJA 1RT1A 2Q36A 3NF6A 2IOCA 1Q9YA 4H5TA 1N8RO 3DJCA 4JI4K 5HRNA 3NH2A 3ZSXA 1C0UA 4YOYA 1HLUA 1RDWX 3SQ4A 4CZMA 1B9FA 4M3RA 1KC8O 5MLCQ 4BROA 4M3WA 1F21A 4DWIA 2VWJA 2WTUA 4BC3A 3OYCA 3O9QA 3CYMA 3L2VA 1JL1A 2VGNA 1KAXA 2OPSA 3K9KA 1SUQA 4DLEA 5BRFA 4FLVA 4E7LA 4N76A 4JAXA 1MA9B 2P5GA 5D3GA 5DM7L 4E7IA 2P9IA 2KQ2A 4IDKA 4AF1A 4E7KA 1GOAA 4CEBA 3HPOA 3NMUA 5BPNA 3LPUA 3RSEA 2VQEK 4FLTA 4C8LA 1I3AA 2O4IA 3V1OA 1QHAA 1U04A 1ESVA 1QZ6A 3O4QA 2OPQA 4B3OA 3QEVA 4NB4A 1QS4A 3BEXA 3THXB 3CD6N 2O8FB 5HL7L 3EKUA 2KLAA 5FROA 1N5YA 1ATRA 4DSLA 2QW9A 4IJNA 3CJ7A 1IO2A 3C6AA 3RMBA 1O13A 3HBTA 4IOCL 5LL6Z 2RKIA 4FOEA 5HOOA 1YI2N 1NGJA 3TR8A 4EIAA 4DQRA 4A59A 4J2DA 1VK0A 4IO9L 3J80O 2P9PA 3HT3A 4YDUA 4Z4CA 4AQYK 2KKZA 3ZSVA 2Z1IA 3LWLA 3V9WA 1SL1A 2HMPA 1TV6A 3UKRA 4FM2A 4IEEA 4X66K 3RRHA 1M1KO 3NF7A 5J2PA 1XC9A 3K5LA 2E5LK 2ASMA 2Q0RA 3OYFA 3S41A 2OTJN 2UUCK 4BRAA 1HJOA 4DG1A 4B9TA 3AVFA 3ENHA 1T44A 1VSMA 4I2PA 1VSJA 2D0OA 3LM9A 3TTFA 1JLEA 2GUPA 2CGJA 4KV8A 2V7ZA 4CZLA 3VGKA 4G1QA 4O8UA 1XNQK 4IWVA 2G8KA 3THYA 2P9KB 1K6YA 3BZKA 1NK5A 1SL2A 3LP2A 4KBOA 3VA3A 2RF2A 3L8BA 5J2QA 5GIOA 1XHZA 4CJ7A 4PWDA 1K9MO 2QWNA 3QB0A 1EQYA 5KRTA 1KRPA 2XY8A 3R3LA 1IJJA 4W5RA 4CK3A 1TL3A 3QBXA 4DSFA 1VQON 5JVHL 3CJAA 3DXMA 4IO8A 4JN4A 4BRIA 3SUPA 3BDPA 2FSKA 3P39A 3WQUA 2HBKA 5C24A 3KK2A 4M7YA 4O4GA 1CZBA 2P1JA 3ZT4A 3MEDA 4FW2A 4FO0A 1JLCA 4KHWA 1XI1A 4FPAA 4M45A 4B3RK 3A8YA 1DT9A 1U4BA
chains in the Genus database with same CATH topology
3J7YP 1XNRK 1IBMK 2HHHK 5FLXO 2UU9K 4B3SK 1J5EK 4B3MK 4DUZK 4DV4K 4LF6K 1IBLK 1N33K 4JI1K 5LL6Z 5LMNK 4CW7B 4DR1K 4DR5K 4LFCK 3J80O 4DV6K 4AQYK 4JYAK 4DV0K 1N32K 4DV7K 5IT9O 4YHHK 4X66K 1I94K 2E5LK 2UXBK 4LF7K 4CVNE 4LF4K 1HNXK 3T1YK 4B3TK 2UUCK 5IWAK 4YY3K 4JI0K 4DV1K 3OTOK 5A2QO 1N34K 4JI4K 4LF5K 4JV5K 4NXNK 5AJ3K 4DR4K 4V19S 3J7AP 4OX9K 4DR7K 2UUAK 1HNZK 2F4VK 4GKKK 4DR3K 2ZM6K 4LF8K 1XNQK 3J81O 4JI6K 4X65K 4DV5K 4DV2K 4JI5K 4DR6K 4DUYK 4LF9K 4X62K 4JI3K 2VQFK 4LFBK 4JI8K 4JI2K 4DR2K 2UUBK 3JAMO 4JI7K 1FJGK 1HR0K 4X64K 1HNWK 4GKJK 2VQEK 1XMOK 4LFAK 4KHPK 1IBKK 1N36K 4K0KK 4DV3K 3T1HK 2UXCK 1XMQK 5BR8K 2UXDK 4B3RK 5LMUK 4NXMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y P;  1XNR K;  1IBM K;  2HHH K;  5FLX O;  2UU9 K;  4B3S K;  1J5E K;  4B3M K;  4DUZ K;  4DV4 K;  4LF6 K;  1IBL K;  1N33 K;  4JI1 K;  5LL6 Z;  5LMN K;  4CW7 B;  4DR1 K;  4DR5 K;  4LFC K;  3J80 O;  4DV6 K;  4AQY K;  4JYA K;  4DV0 K;  1N32 K;  4DV7 K;  5IT9 O;  4YHH K;  4X66 K;  1I94 K;  2E5L K;  2UXB K;  4LF7 K;  4CVN E;  4LF4 K;  1HNX K;  3T1Y K;  4B3T K;  2UUC K;  5IWA K;  4YY3 K;  4JI0 K;  4DV1 K;  3OTO K;  5A2Q O;  1N34 K;  4JI4 K;  4LF5 K;  4JV5 K;  4NXN K;  5AJ3 K;  4DR4 K;  4V19 S;  3J7A P;  4OX9 K;  4DR7 K;  2UUA K;  1HNZ K;  2F4V K;  4GKK K;  4DR3 K;  2ZM6 K;  4LF8 K;  1XNQ K;  3J81 O;  4JI6 K;  4X65 K;  4DV5 K;  4DV2 K;  4JI5 K;  4DR6 K;  4DUY K;  4LF9 K;  4X62 K;  4JI3 K;  2VQF K;  4LFB K;  4JI8 K;  4JI2 K;  4DR2 K;  2UUB K;  3JAM O;  4JI7 K;  1FJG K;  1HR0 K;  4X64 K;  1HNW K;  4GKJ K;  2VQE K;  1XMO K;  4LFA K;  4KHP K;  1IBK K;  1N36 K;  4K0K K;  4DV3 K;  3T1H K;  2UXC K;  1XMQ K;  5BR8 K;  2UXD K;  4B3R K;  5LMU K;  4NXM K; 
#chains in the Genus database with same CATH topology
 3J7Y P;  2P9S A;  3CC4 N;  4K25 A;  3J8A A;  1EWQ A;  1C1B A;  1WSG A;  1WOQ A;  1J6Z A;  3P4I A;  2WON A;  3HVR A;  4B9N A;  4LF6 K;  3LL3 A;  4CE9 A;  5AQH A;  4K8X A;  1JL2 A;  1HX1 A;  4B9U A;  4BR4 A;  3EE9 A;  4CES A;  4DR1 K;  1L3T A;  3CFO A;  4JS4 A;  3D2E A;  4IFY A;  4DKW A;  2A1S A;  5F0X A;  3MWP A;  4K42 A;  2YHW A;  4OKJ A;  2AA4 A;  3AAQ A;  4CBW A;  3O9T A;  1W9H A;  4H03 B;  1DKG D;  5C2D A;  3IUC A;  3FE1 A;  3O5B A;  3P31 A;  3ZX0 A;  3FZL A;  2PYJ A;  4GV6 A;  2HB5 A;  5ADX A;  3ZT2 A;  3E9P A;  3KKS A;  2HHW A;  1BQM A;  3QFU A;  2ZE2 A;  4KRE A;  1ASU A;  1R59 O;  2IS3 A;  2QWP A;  3AVL A;  3QET A;  1X3N A;  3RMA A;  1BL3 A;  5B8H A;  4CFB A;  4GNI A;  4IEI A;  5AJ3 K;  2IAJ A;  2Q31 A;  2YJE A;  1NMN A;  4DR7 K;  1YTU A;  3T69 A;  4FZX C;  3NBP A;  1JXE A;  5BN9 A;  2ZWH A;  1RBV A;  4DS5 A;  3EEQ A;  3SK3 A;  1QQN A;  5I9E B;  5CZ2 A;  1VRU A;  4IG0 A;  3DLB A;  2F9W A;  3VQ8 A;  4CJS A;  4FW1 A;  2RPI A;  5I3U A;  1OH5 A;  2QM1 A;  4Q0B A;  3PX6 A;  3NFA A;  4AIL C;  1ATN A;  1KFD A;  3S3O A;  4CEC A;  4ELV A;  3M3Z A;  2Y1I A;  1NK7 A;  3O80 A;  2EX3 A;  4YDU C;  4CGD A;  1I39 A;  2D1K A;  1VSH A;  4Z4E A;  4F3T A;  3O1W A;  4CJP A;  1BA0 A;  3PSF A;  2F96 A;  4DU1 A;  3L3V A;  3HP9 A;  1A5W A;  2HHS A;  1GOC A;  3DLK A;  3NF9 A;  4ILG B;  3ZX3 A;  3MN9 A;  4R5P A;  4JKC A;  3O4W A;  3LDS A;  2GEL A;  3KLI A;  4KH6 A;  1C0T A;  1EKE A;  5J1E A;  3PX4 A;  5SZT A;  3FFK B;  3LAL A;  5M1P A;  4CJQ A;  2B5J A;  4CJL A;  4Y0W A;  3TAM A;  1D8Y A;  2V7Y A;  1BCM A;  4ISG A;  1EP4 A;  1OH6 A;  1E4G T;  4BC2 A;  5KQD A;  3RWU A;  2AP1 A;  2V51 B;  3E01 A;  4JI1 K;  2I7N A;  1LWE A;  3DRS A;  1ZBH A;  5CYQ A;  1KSP A;  3HST B;  1RDD A;  1HPZ A;  3MXM A;  3D0P A;  4OO1 J;  3ZSW A;  1KD1 O;  5AQY A;  4UQG A;  2NRZ A;  5JIC A;  3OS2 A;  2G8F A;  1GLL O;  1BQN A;  3QML A;  2E88 A;  1L3U A;  1VQN N;  1CXQ A;  5EOY A;  1ASV A;  3VQD A;  4FLU A;  3DXK A;  4B3T K;  2OYQ A;  1O1W A;  2E2Q A;  5IWA K;  3S9H A;  4B1U B;  2NNW A;  1VQ7 N;  5KRS A;  4Z4F A;  5BRE A;  1TYQ B;  1RT5 A;  1NBW A;  3VEZ A;  3L2W A;  4F8R A;  4CK1 A;  2ZGZ A;  1NJI O;  4GKK K;  1K8A O;  3V4I A;  5E26 A;  3QIP A;  3AVA A;  3TWH A;  1NK4 A;  5H1S Q;  1HRH A;  1HYV A;  3MCA B;  4B1Z A;  2P5O A;  1T03 A;  3DOL A;  2O8B A;  3SQ0 A;  3VQ7 A;  5AZJ A;  4W5N A;  2WC9 A;  4B1V A;  4BRP A;  1TAU A;  2UUB K;  3QIN A;  2B6A A;  4JI7 K;  2XY5 A;  4PY5 A;  3V9Z A;  3TI0 A;  3FZH A;  3D7E O;  3SLC A;  4GKJ K;  1GLE G;  5AQF A;  3K58 A;  3EZW A;  1CZA N;  4EP4 A;  2ZF5 O;  3HTV A;  4ZTF A;  3VEX A;  5EY4 A;  1TGO A;  2D4W A;  3MXI A;  3IMX A;  2A40 A;  4AHC A;  3U4L A;  4KTW A;  2YX6 A;  4MQ3 A;  3V9X A;  1NGF A;  5AQI A;  4OPJ A;  2I5J A;  3HPG A;  2BE2 A;  4LD0 A;  2OAN A;  3CM6 A;  4KKO A;  5BPL A;  4KRF A;  5GAG P;  3HK2 A;  4CJ5 A;  3UB5 A;  4BRN A;  2HVI A;  2FBY A;  3WNE A;  4BGB A;  3VEN A;  2VCP A;  4H5N A;  4FJI A;  4KHQ A;  3G25 A;  2XY6 A;  3WXM B;  3KD1 E;  3C6U A;  4DSE A;  2FF3 B;  2YKN A;  3PIO L;  4M41 A;  1QSL A;  3VQ9 A;  2HMI A;  1CXU A;  4CIF A;  3AVM A;  1NWK A;  3O1B A;  3SJH A;  2HW3 A;  2FC0 A;  1HNX K;  3OBW A;  4MLE A;  4YY3 K;  2HBL A;  4JI0 K;  2GEM A;  4CF8 A;  2DPN A;  2YV0 X;  1VHX A;  2BDP A;  3RRG A;  3HPH A;  3DWL A;  4ELU A;  3T1A A;  1BWF O;  3SBT A;  4DQQ A;  4RW9 A;  5C12 A;  1U47 A;  3P38 A;  5C15 A;  4CIG A;  2O8C A;  3CCE N;  4A5B A;  4LSL A;  2NLX A;  1BDG A;  2NZT A;  2GX9 A;  2Z1H A;  4X65 K;  4DV5 K;  4H0P A;  4O0I A;  4HTL A;  4HVJ A;  3G6E N;  3ENO A;  3AO4 A;  4E1J A;  4N56 A;  4BE2 A;  1WSH A;  4HWI A;  4OPK A;  4X62 K;  4BG8 A;  2VQF K;  1BOT O;  4Z4I A;  3FGU A;  1EXQ A;  3AVG A;  4DQP A;  3C6T A;  2HHV A;  3OJS A;  3U9Z A;  4H4M A;  1NK0 A;  3QIC A;  4CJK A;  4WFN L;  3G0Z A;  1NK8 A;  1TL1 A;  4IOA L;  1RNH A;  4FWP A;  3BF1 A;  1NNE A;  1VSK A;  2P9L B;  3IRX A;  4CJW A;  4E1N A;  2KW4 A;  3L2R A;  1TAQ A;  3ULD A;  3QLH A;  4DV3 K;  4IBN A;  3TAG A;  3VEW A;  1LV5 A;  2E2N A;  4NYN A;  2KZM A;  4F9O A;  3TAB A;  2JLE A;  4JRQ A;  4A5A A;  5KI6 A;  4RCH A;  1KTQ A;  1YIJ N;  1QTM A;  4FWN A;  4DV4 K;  3DAW A;  2WUS A;  4M7X A;  4AHT A;  3TAQ A;  2HHQ A;  3C0B A;  1VQ4 N;  5DK5 A;  4CGF A;  5LMN K;  3LM2 A;  1S9G A;  3CCJ N;  4Y1C A;  3AA5 X;  3M5R A;  4DV6 K;  4FK2 A;  2OCE A;  3THX A;  2O8F A;  1X3M A;  1N32 K;  3MCP A;  2BUP A;  3QER A;  4A57 A;  1W7A A;  1MU2 A;  2PY5 A;  4ISE A;  2QWR A;  4PKG A;  3EY1 A;  3VGL A;  2NRT A;  1RT6 A;  4PKI A;  3V1R A;  2LSN A;  1NJX A;  2E4L A;  3WQT A;  3K0S A;  4JHD A;  5M1Q A;  3VGM A;  4C8O A;  4C8N A;  1NOY A;  3VQQ A;  4M3T A;  3O3G A;  4F4K A;  4RW8 A;  1Z25 A;  3OJU A;  4CF1 A;  4ICL A;  1Q9X A;  3IAY A;  4CHP A;  4KTZ A;  4BGA A;  3RMD A;  1ILY A;  1NK6 A;  2QXF A;  1LOT B;  3A5L C;  4BRH A;  4DTN A;  4JK9 A;  4CEA A;  4DSJ A;  2HHX A;  3CI5 A;  4XIU A;  4KH4 A;  1TVR A;  3EYZ A;  3V81 A;  3JAM O;  3LP3 A;  2P9K A;  1ZBI A;  3U9D A;  1DLO A;  4DLG A;  3ZT3 A;  1WSE A;  3OYM A;  2P9N B;  4FL9 A;  1VRT A;  4N47 A;  2QKB A;  1GLA G;  4K0K K;  5C0Y A;  3T1H K;  4WQ5 A;  5BR8 K;  2GTD A;  2NUB A;  3VEO A;  5AQQ A;  3AY9 A;  4FWO A;  4YOU A;  4I6M A;  4ILJ A;  1MDU B;  3RMC A;  4H0V B;  1NK9 A;  4BC4 A;  3W3D A;  3IS9 A;  3CC7 N;  3ULE A;  3M8Q A;  1HKB A;  2CGK A;  3H45 C;  3WEE B;  3OW2 M;  3G10 A;  4ISF A;  4YOW A;  3I8B A;  3IG1 A;  2QK9 A;  1Y97 A;  1XWL A;  3BZC A;  2FBV A;  4CF9 A;  1JKH A;  5IT9 O;  4KO0 A;  2ZGY A;  4JK7 A;  1NKE A;  1SKS A;  3BY5 A;  3NGY A;  3AGR A;  4AM7 A;  4O55 A;  4JKG B;  3WXL A;  4BRE A;  4DQS A;  2V52 B;  5GAH P;  3VQ5 A;  1N34 K;  3LP0 A;  4N5S A;  3ID6 A;  4NXN K;  4FLZ A;  4IFE A;  4EZ6 A;  3QO9 A;  3KWI A;  4XH4 A;  3O08 A;  3MEE A;  2E2P A;  3AVC A;  4GV9 A;  3LWM A;  1Z05 A;  4CGI A;  3EKS A;  4I7F A;  5AQL A;  3TPQ A;  4KI4 A;  1QQM A;  2W41 A;  4DR3 K;  2ZM6 K;  1NGD A;  4ZTJ A;  2WOM A;  4E7H A;  1BCO A;  3LZJ A;  3BGR A;  1XUP O;  1WUA A;  3O9S A;  3CCS N;  4B9M A;  5FDL A;  4DTJ A;  3G71 N;  1L3V A;  3VQP A;  4BRG A;  4FJX A;  2KZZ A;  5CR4 A;  4Z4G A;  3E9L A;  4BE1 A;  2Z1J A;  2XO7 A;  1KLM A;  2ASO A;  5E41 A;  2GBZ A;  3NF8 A;  3HM9 A;  1ZXO A;  3PO5 A;  3LZI A;  4JKD A;  4BDZ A;  1QQC A;  1YUW A;  5I42 A;  3OYJ A;  3VES A;  3ZET B;  4WCE L;  3SI6 A;  4RTF D;  4CJ4 A;  3L2U A;  4I2Q A;  2G8V A;  4LFA K;  4KHP K;  2HNY A;  5CHI A;  2X6S A;  4CZK A;  1BU6 O;  3A5M C;  1IBK K;  3ZX2 A;  3DYA A;  2H3G X;  4AHU A;  3N4P A;  1QZ5 A;  4CK2 A;  2O8D B;  3I0S A;  4CED A;  3TTC A;  3U6F A;  2VG7 A;  1VQL N;  4B3M K;  1HKG A;  2A3Z A;  4FLX A;  1FK9 A;  1SZ2 A;  1NJW A;  1NU0 A;  3NVK A;  4CD3 A;  1NGC A;  2HF3 A;  4CD1 A;  1BIZ A;  3QEX A;  4IOX A;  3PUF A;  3L3U A;  4EHU A;  5E84 A;  2IVN A;  1KVC A;  4OLA A;  4BE0 A;  4DF4 A;  3UE5 A;  2PYL A;  3F2K A;  1ZBU A;  4XH1 A;  3CJC A;  3EE8 A;  4DFM A;  5KGX A;  5EU7 A;  5T7B A;  4B08 A;  2E20 A;  1RCH A;  1QSS A;  3F5T A;  4BRK A;  4KHU A;  4FVM A;  4GMJ B;  3DLE A;  1KQS M;  1CLQ A;  1RDU A;  1REV A;  4HUF A;  1BI4 B;  1JLA A;  3F9M A;  2UUA K;  3S3M A;  4E19 A;  3ZSO A;  2Y1J A;  3QNN A;  4WQ5 C;  4W5T A;  5GAD P;  5HBM A;  1A5V A;  1T7P A;  3NH1 A;  4CZJ A;  3AAR A;  1NKB A;  4DMN A;  1TYQ A;  4J2A A;  3C95 A;  1EX4 A;  3C6H A;  3M1F A;  3TSQ A;  1WBD A;  1JCF A;  4FLW A;  1VSE A;  3B8A X;  1S6P A;  4JEP A;  1W97 L;  2VWK A;  4OKK A;  1WB9 A;  3CXC M;  1VQ8 N;  4JKH A;  3CCU N;  4OGE A;  3H3O B;  4ID5 A;  1HUX A;  4KHS A;  2HOE A;  5JMV A;  3OYE A;  3DLH A;  1RT4 A;  4CEZ A;  1W2B M;  2FBT A;  3JSM A;  1NM1 A;  1OVQ A;  1UAX A;  1J54 A;  1ZYQ A;  4BVP A;  2OPP A;  3VF4 A;  4NXM K;  2G8U A;  3ISN C;  3DRR A;  4H0Y B;  3DMJ A;  1IBM K;  2O4G A;  2R7Y A;  2CGL A;  2RHK A;  4H0T B;  3SUN A;  1L5U A;  3LAN A;  1D4X A;  3C94 A;  2GUI A;  2E1Z A;  1W0H A;  3ATV A;  1ITG A;  2QWM A;  4LC9 B;  5LJW A;  1MWK A;  1X1P A;  5AQW A;  4F2R A;  2DFH A;  3KK3 A;  1T05 A;  4DV7 K;  1NKC A;  3KTQ A;  1OVY A;  1LW2 A;  1JJ2 M;  2W6L A;  3CHW A;  2HND A;  3QNO A;  1BIU A;  4LF7 K;  1S9E A;  2OZM A;  4LF4 K;  4FJH A;  3VQE A;  1VQ5 N;  4O44 A;  5EXW A;  3ALY A;  1CZ9 A;  1RIL A;  4B8A B;  3H1Q A;  1J9A A;  3OTO K;  4BDP A;  4JV5 K;  3OYG A;  4OLB A;  4FWK A;  3AO1 A;  1WN7 A;  4BQL A;  3QEW A;  4BRC A;  3ZT1 A;  3FZM A;  1T6C A;  3AO3 A;  4A61 A;  3CIP A;  3KZB A;  2ASP A;  4FWQ A;  3ZSQ A;  3CCR N;  2RE2 A;  3M8S A;  4IKF A;  3BF3 A;  1RGI A;  4LFB K;  3J7Z O;  1TUU A;  3OYL A;  1XC3 A;  5LY3 A;  1NGA A;  4CHO A;  4Y1D A;  2XRI A;  3THV A;  1TKX A;  3C7N B;  4NCA A;  3K9J A;  1UA1 A;  2Q3S A;  1S72 N;  3CET A;  3AO5 A;  3ZSY A;  3CCV N;  3BUZ B;  4YOV A;  2W42 A;  3KKR A;  1N6Q A;  5AQS A;  4XEI A;  4CFC A;  1T8E A;  1NJZ A;  1B92 A;  1HYZ A;  4K41 A;  5AQR A;  1XMQ K;  3S3N A;  2KTQ A;  3THW B;  2P9U B;  1JLB A;  4CJ3 A;  4AM6 A;  2NRV A;  3KD5 E;  4C23 A;  2YNF A;  1IG8 A;  1EET A;  3ZT0 A;  4BDY A;  2ETJ A;  2P9L A;  3VPZ A;  3AVK A;  3CPE A;  3VEV A;  1Y64 A;  3QEI A;  5AQP A;  1R0A A;  1YTA A;  2QWQ A;  3VQ4 A;  2NRR A;  3AVB A;  2ZQB A;  1V4T A;  3D2F B;  4EP5 A;  5HP1 A;  1HYS A;  4NYF A;  1C0M A;  4CZI A;  2GWJ A;  3R1X A;  1P90 A;  3K5M A;  1HNV A;  3LDQ A;  3SV3 A;  3QBW A;  3R9P A;  2G8I A;  3SQ1 A;  4H4O A;  2ZJP L;  1B9D A;  4KTQ A;  4IFV A;  3U3Y A;  3OYD A;  4Q5V A;  4CHZ A;  4W5Q A;  3V6D A;  1U2V B;  3KK7 A;  4WYB A;  2PAV A;  4L3Q A;  5A2Q O;  2NRX A;  5JS1 A;  4ZHR A;  4FWS A;  5AQJ A;  4DFP A;  3PLA A;  4CHY A;  4V19 S;  4QOZ B;  3T19 A;  3L4I A;  3U8X A;  3M8P A;  1HNZ K;  4PHT X;  4GW6 A;  2RN2 A;  1SKR A;  2J4R A;  1WSI A;  3FLC O;  3ASM A;  3E1Y A;  4KFB A;  3UKU B;  1QSY A;  3O3H A;  3GE1 A;  4BRM A;  4TSX A;  2HVH A;  3VEY A;  5C10 A;  3L0Q A;  3WXK A;  1S22 A;  3MMV A;  5AQT A;  1YJW N;  4LF9 K;  2JWK A;  3KLG A;  3CC2 N;  2BGG A;  1KXP A;  3SJJ A;  1K73 O;  3RR7 A;  3VQA A;  3FR0 A;  3QFP A;  5FRM A;  2NRW A;  3AVI A;  4FM0 A;  3VER A;  1FJG K;  5AQM A;  4FJ5 A;  2FSJ A;  2D0C A;  1XHX A;  4E3S A;  3TSP A;  1VQK N;  4DQ8 A;  3R8E A;  1D9F A;  1S1X A;  1UOC A;  1TUY A;  5KPR A;  3KWG A;  2XHB A;  2E2O A;  4FJ8 A;  4YOR A;  3MWT A;  2YHB A;  5HLF A;  2ZJQ L;  1NOZ A;  1KFS A;  3SYZ A;  4RW4 A;  5LMU K;  2A6A A;  3BP8 A;  3OS0 A;  4LY7 A;  3T7Z A;  3LP1 A;  1QE1 A;  2P9N A;  3O9U A;  2E1Y A;  3OYI A;  4A62 A;  4FJG A;  2UYT A;  4M3Z A;  4H0O A;  2Q97 A;  1D5A A;  4FCY A;  1YT3 A;  4RW7 A;  3P83 D;  4BRL A;  3TAP A;  5AQG A;  1SKW A;  2ZJR L;  4CW7 B;  4FJ9 A;  1Z6R A;  4QS8 A;  3WNG A;  3VQ6 A;  3VF6 A;  4YNQ A;  2HHU A;  3F9K A;  4B9Q A;  3HVT A;  1D9D A;  3PO4 A;  4M42 A;  1YVN A;  4MFB A;  4YHH K;  1TK0 A;  5JLH A;  2NRH A;  1P8Z A;  1Z26 A;  1S1W A;  1HJR A;  3LDN A;  4OJR A;  1QHT A;  2ZD1 A;  4FOI A;  2FSN A;  5AZI B;  3PV8 A;  2BTF A;  5FPD A;  2OA8 A;  5KQ8 A;  4CFD A;  4EZ9 A;  4B1X B;  4CI6 A;  1OH8 A;  4N41 A;  1U6Z A;  3VMF B;  3K2P A;  5EX5 A;  3CCL N;  1KAZ A;  3FZK A;  2E6M A;  4FSV A;  4KH5 A;  3ZEU B;  3SUQ A;  4FJK A;  5J2N A;  4JKG A;  5AFU H;  2FLO A;  4H0X B;  4J2E A;  4PQU A;  5FPM A;  1HKC A;  3J81 O;  1WLJ A;  3M6G A;  3AVH A;  3H6E A;  4OKE A;  4DSK A;  5HRP A;  1DGK N;  4DV2 K;  4JI5 K;  3LDP A;  1NGE A;  2HNZ A;  4DR6 K;  1EWR A;  1RDC A;  1SL0 A;  4B1Y B;  4CZH A;  5FRN A;  5C25 A;  1DEJ A;  1SV5 A;  2BAN A;  4JI2 K;  5K14 A;  1RTH A;  4IG3 A;  4OVL A;  2IC3 A;  3AAP A;  3MN6 A;  4YFU A;  3GL1 A;  3V9U A;  1U45 A;  4GVM A;  3HI0 A;  4MLH A;  5DM6 L;  4CJR A;  4DU3 A;  4KI6 A;  4H5V A;  3OYK A;  3AVN A;  4DTU A;  1IV0 A;  4CBX A;  1IKW A;  3CMA N;  2PZS A;  4BR9 A;  2UXD K;  2B4J A;  1HQE A;  5LJV A;  2F8T A;  3CPW M;  4FJ7 A;  3H1V X;  2HHH K;  4IXC A;  1RT7 A;  1Q82 O;  4BR7 A;  3NCI A;  4E89 A;  4DUZ K;  4JK8 A;  3SZ2 A;  4JRP A;  2OZS A;  3AV9 A;  3WXI A;  4FJL A;  1E4F T;  1ZC6 A;  2KFZ A;  1FKO A;  2O8D A;  3QIO A;  1VSF A;  3H3N O;  3OHR A;  3F73 A;  3QDK A;  4A2A A;  4DV0 K;  3CME N;  4JYA K;  3I8D A;  1WAF A;  2WFB A;  3RR8 A;  3SCX A;  3ITH A;  2X78 A;  4DF8 A;  4KAZ A;  4W5O A;  1LW0 A;  4C1N K;  1U48 A;  1K8K B;  1IH7 A;  3MX2 A;  3A5O C;  1NGB A;  4J2B A;  5TKW A;  5HRR A;  3A2F A;  5F1X A;  1SS6 A;  4CJV A;  1SAZ A;  2O8E B;  2E6L A;  1YHQ N;  4CEF A;  3A5N C;  2IIR A;  4O5F A;  2D0P A;  4OX9 K;  1RDB A;  4GY2 B;  1Q18 A;  3L2Q A;  4FJJ A;  5KPT A;  2VGM A;  4LF8 K;  4CEQ A;  2E8A A;  2YI1 A;  4CGG A;  1BG3 A;  2Q1N A;  3AA2 A;  4B9L A;  4HUG A;  4QAG A;  2KFN A;  4JD2 B;  2HST A;  1BI4 A;  3R6M A;  3SV4 A;  1UA0 A;  2X74 A;  4JI3 K;  2GV9 A;  4O0J A;  4XH5 A;  3HOT A;  2Q2R A;  4DR2 K;  3SBG A;  4EHT A;  1J5O A;  2QA4 N;  4CJU A;  3LDO A;  2ITM A;  1TK8 A;  3CJB A;  4DTX A;  3TU5 A;  2QWO A;  5JVG L;  2YHY A;  1J53 A;  4DB3 A;  1XMO K;  4CF2 A;  4CBU A;  3D6R A;  1A5X A;  1QQO A;  3MN7 A;  4B9S A;  4DTM A;  3DLR A;  4OPH A;  4M3X A;  2F7T A;  1X9W A;  3HL8 A;  1E3M A;  1QVF M;  1ASW A;  4ID1 A;  1JXB A;  3DM2 A;  1XNR K;  4JHD B;  4M3Y A;  3CER A;  1JCG A;  4NLC A;  5TKY A;  5GAE P;  2A5X A;  4Z0U A;  1RDA A;  4NO7 A;  3SPZ A;  4CJT A;  4Z4H A;  3HYF A;  3NDK A;  1VSL A;  5AR0 A;  3G4S N;  4MDA A;  3OYH A;  4DTP A;  3TAN A;  4PL8 A;  4LH4 A;  5KGW A;  1OH7 A;  2QEX N;  4YOX A;  4KHY A;  3B6O A;  3O9R A;  2IGI A;  3ZCM A;  4CGJ A;  4JKA A;  3OVN A;  3QES A;  3MN5 A;  2FXU A;  4QS9 A;  2DFF A;  3JS6 A;  5J2M A;  4IJA A;  4K8Z A;  2YKM A;  4DHY A;  2ITG A;  3HXM A;  5BN8 A;  3Q7C A;  3KVG A;  4PA1 A;  4E0D A;  3I55 N;  1U49 A;  2D0A A;  4H8K A;  2KHO A;  1UWB A;  1WSF A;  3DLG A;  1VQ9 N;  4LF5 K;  1X9J A;  1BO5 O;  3VF2 A;  2A1R A;  2YNG A;  3B6P A;  3Q7B A;  3K5O A;  2WBN A;  3KK1 A;  3J7A P;  4ELT A;  4KHN A;  1HMV A;  2F4V K;  4BVO A;  1DTT A;  4I6M B;  3U3G A;  4WFB L;  2P9I B;  3VQB A;  1ZBS A;  2JGU A;  4RW6 A;  5HRS A;  1LAW A;  1RBT A;  5BR9 A;  3RSE B;  4CZF A;  3WUH A;  4AHR A;  1MWM A;  3EL2 A;  3ULE B;  3KLF A;  5FPN A;  1LAV A;  3ID8 A;  2BH1 A;  3OBY A;  5BRH A;  1RTD A;  2YHX A;  1M90 O;  4CGH A;  3GG4 A;  4A2B A;  4BG9 A;  3E9O A;  1TKD A;  3H08 A;  1TKZ A;  3HM8 A;  4WE1 A;  1RTJ A;  1IKY A;  2PBD A;  5KPZ A;  2OPR A;  5BPM A;  3P5J A;  3I56 N;  3CFR A;  3DOK A;  1YAG A;  3IDH A;  3GDQ A;  4G9Z A;  4HTU A;  3KHY A;  4FYD A;  2P51 A;  2P9P B;  1YJ9 N;  1LCU A;  4CJF A;  4BQZ A;  3C7N A;  5DMR A;  2W40 A;  5CYM A;  3UKR B;  3P1G A;  3AGK A;  1C1A A;  3NGI A;  4PUO A;  1QVG M;  2AJQ A;  2D0B A;  1BUP A;  1YIT N;  3IFR A;  1KCF A;  4BR5 A;  3HZ6 A;  4I9Q A;  3THW A;  2P9U A;  3HOS A;  4NCG A;  2W6K A;  1IG9 A;  4WQ4 A;  1RBR A;  4O8K A;  2QI2 A;  3TAE A;  3O4N A;  1JCE A;  5AQN A;  2F8S A;  5C42 A;  4UY8 O;  1S1T A;  5AQV A;  1IKV A;  2HBM A;  2I7P A;  4CVN E;  3KLH A;  3KIO A;  3D2F A;  2Z1G A;  5FPE A;  3OS1 A;  1FW6 A;  1JLQ A;  3THY B;  4FXD A;  4DV1 K;  4H5R A;  1BHL A;  1Q7Y O;  4DCH A;  3C65 A;  1NLV A;  3L4Q A;  1ZBF A;  1NMD A;  3ATU A;  1C6V A;  4BR2 A;  3ENB A;  4CHN A;  1RT3 A;  3NAE A;  1GLD G;  3CQY A;  4E1M A;  3O6W A;  3K57 A;  4C1N I;  3DXM B;  4BRQ A;  3WNH A;  5BRD A;  1YXQ A;  1U2V A;  3SNN A;  2QWL A;  3QEP A;  5CZ1 A;  4O5B A;  4EAH D;  2YNH A;  1VQ6 N;  1NGH A;  4B1W B;  4DUY K;  1X9M A;  5CE3 A;  3HRG A;  4PL7 A;  4HUE A;  3VTI A;  1KLN A;  4CZG A;  3MEC A;  3UKU A;  1C1C A;  4IDH A;  2P9S B;  1HQU A;  4KPY A;  4CJE A;  1GLC G;  4C8M A;  4JKF A;  4RWT A;  2A41 A;  4Z94 A;  3HO1 A;  1SQK A;  3FFI A;  3NVM A;  1LWF A;  2EHG A;  1EO1 A;  1T6D A;  3SAF A;  1N36 K;  3OYA A;  4KB0 A;  1H1V A;  2UXC K;  4CIE A;  3D45 A;  3D2E B;  1Q8I A;  1GOB A;  3MXJ A;  4FK4 A;  4CER A;  3JXU A;  4FPB A;  3MAQ A;  3CF5 L;  4DS4 A;  3CM5 A;  3AA4 A;  1WBB A;  4BWM A;  2CH5 A;  5EVZ A;  1JLF A;  3K5N A;  3N4Q A;  4CEO A;  3RVC A;  1N33 K;  3CJ9 A;  5AQU A;  2HHT A;  4FM1 A;  3MDQ A;  2EWS A;  1C0F A;  4IZ9 A;  4DU4 A;  1ATS A;  1KVA A;  5ADX H;  1JLG A;  3LPT A;  1RBU A;  3CG7 A;  4ILH A;  4F3O A;  3W0L A;  4FJM A;  3CQX A;  2QTD A;  3FZF A;  4RG8 A;  4M63 C;  3ZLJ A;  3PY8 A;  2YCH A;  5M1O A;  3SUO A;  3T3F A;  2FBX A;  1NJY A;  1VQM N;  4WF9 L;  2F9T A;  2DFE A;  3V1Q A;  3T1Y K;  3NE6 A;  1TK5 A;  1WSJ A;  2HF4 A;  2FF6 A;  1S6Q A;  3VA0 A;  3I0R A;  3CQ8 A;  3TTD A;  2DY4 A;  4BAC A;  3AO2 A;  3MX5 A;  4E7J A;  4JLH A;  3HJF A;  4DR4 K;  3SMP A;  3OYN A;  4OPA A;  2Q0U A;  3I33 A;  4HHT A;  1GLJ O;  3GBT A;  1VAZ A;  5AZI A;  3TAR A;  4FLY A;  3GOI A;  3TSU A;  2DTU A;  5HRO A;  2YHA A;  5M1N A;  1VSD A;  2CH6 A;  1WAJ A;  4JI6 K;  4DFK A;  4FK0 A;  4NLB A;  1RBS A;  5CY4 A;  3LAM A;  2ATQ A;  4I9L A;  3ZSZ A;  5AFU A;  4OGC A;  2A42 A;  1NG9 A;  1NGI A;  4HCB A;  1YJN N;  3PSI A;  2VG5 A;  4U67 L;  3K59 A;  4M3U A;  3NH0 A;  5AQO A;  3A0I X;  4DSI A;  4JI8 K;  2IDO A;  3ZEU A;  4DTR A;  4CCH A;  4BY9 C;  4JKE A;  4WQ4 C;  3WNF A;  3ZSR A;  4CFA A;  1HR0 K;  3HSC A;  4MO4 A;  2YJF A;  4DFJ A;  4NCB A;  3AA3 A;  3NHG A;  3HP6 A;  4BC5 A;  3EZ5 A;  4BRF A;  1YF5 L;  5M1K A;  3LAK A;  2JWL A;  5AQZ A;  2QKK A;  4AH9 A;  4FZZ A;  1KAY A;  1OKJ A;  4JNE A;  2VWB A;  3KLE A;  3VN5 A;  3H46 O;  2UU9 K;  4QCL A;  1VQP N;  1J5E K;  5C2F A;  3CCQ N;  4PKH A;  3VQC A;  3L6Q A;  3DXK B;  1IKX A;  2G8W A;  4K43 A;  4BR0 A;  4L8R B;  4JS5 A;  1GLF O;  1WNS A;  2HBJ A;  1HPM A;  4C8K A;  3LDL A;  4CF0 A;  4BRD A;  4DQI A;  4B9V A;  1RFQ A;  1FKP A;  1Q81 O;  4FZY A;  1NGG A;  1BA1 A;  3KJV A;  3TAF A;  1V4S A;  1HNI A;  4WFA L;  5ELZ A;  2QXL A;  3E66 A;  3CJ1 A;  5KTQ A;  3NGZ A;  4HCC A;  3JYT A;  4QS7 A;  3O3F A;  1S3X A;  4H5W A;  1LWC A;  1YVU A;  3AVJ A;  4FWR A;  4DTS A;  2O8B B;  3PX0 A;  5AZJ B;  1C0G A;  1K8K A;  3OA9 A;  3DRP A;  1BGX T;  5JS2 A;  3V9S A;  1S1U A;  3VET A;  3OY9 A;  5GIP A;  4U7B A;  3WT0 A;  4F2S A;  3CCM N;  1RT2 A;  5F2R A;  3DI6 A;  3WXJ A;  2O8E A;  4LSN A;  3O8M A;  5AQK A;  4CHQ A;  3WEE A;  1KVB A;  2IVO A;  4GVE A;  3SQ2 A;  2YNI A;  2IVP A;  2PFU A;  2VG6 A;  3SPY A;  4FVU A;  3MK6 A;  1G15 A;  3IKM A;  3SAG A;  1GLB G;  4B8C A;  2D5R A;  1Q86 O;  1S5J A;  4MDB A;  3VOV A;  5SWM A;  4X64 K;  3M8R A;  1ZBL A;  3EO3 A;  1HNW K;  1L3S A;  4CEE A;  1RTI A;  1VSI A;  4JD2 A;  4EFH A;  4DTO A;  4KB1 A;  1BIS A;  1DTQ A;  3OYB A;  4J8F A;  3ZYY X;  4FJN A;  5JLF A;  3CFP A;  5GIN A;  2OTL N;  1X9S A;  4AHS A;  1FXX A;  3DLL L;  5FLX O;  4B3S K;  4R79 A;  4JKB A;  4MO5 A;  3SMS A;  1IBL K;  1G99 A;  3SAH A;  3UIQ A;  2G8H A;  1XQS C;  3MEG A;  2XY7 A;  4AHV A;  4DR5 K;  4LFC K;  2X6N A;  4FWM A;  2GWK A;  3RTV A;  4CZE A;  1T3V A;  4YOT A;  1S1V A;  4FWL A;  1TKT A;  2VYP A;  3EN9 A;  4LH5 A;  3PIP L;  5AQX A;  4GV3 A;  1I94 K;  3ZET A;  2O8C B;  2UXB K;  3VTH A;  5M1F A;  4BWJ A;  1RT1 A;  2Q36 A;  3NF6 A;  2IOC A;  1Q9Y A;  4H5T A;  1N8R O;  3DJC A;  4JI4 K;  5HRN A;  3NH2 A;  3ZSX A;  1C0U A;  4YOY A;  1HLU A;  1RDW X;  3SQ4 A;  4CZM A;  1B9F A;  4M3R A;  1KC8 O;  5MLC Q;  4BRO A;  4M3W A;  1F21 A;  4DWI A;  2VWJ A;  2WTU A;  4BC3 A;  3OYC A;  3O9Q A;  3CYM A;  3L2V A;  1JL1 A;  2VGN A;  1KAX A;  2OPS A;  3K9K A;  1SUQ A;  4DLE A;  5BRF A;  4FLV A;  4E7L A;  4N76 A;  4JAX A;  1MA9 B;  2P5G A;  5D3G A;  5DM7 L;  4E7I A;  2P9I A;  2KQ2 A;  4IDK A;  4AF1 A;  4E7K A;  1GOA A;  4CEB A;  3HPO A;  3NMU A;  5BPN A;  3LPU A;  3RSE A;  2VQE K;  4FLT A;  4C8L A;  1I3A A;  2O4I A;  3V1O A;  1QHA A;  1U04 A;  1ESV A;  1QZ6 A;  3O4Q A;  2OPQ A;  4B3O A;  3QEV A;  4NB4 A;  1QS4 A;  3BEX A;  3THX B;  3CD6 N;  2O8F B;  5HL7 L;  3EKU A;  2KLA A;  5FRO A;  1N5Y A;  1ATR A;  4DSL A;  2QW9 A;  4IJN A;  3CJ7 A;  1IO2 A;  3C6A A;  3RMB A;  1O13 A;  3HBT A;  4IOC L;  5LL6 Z;  2RKI A;  4FOE A;  5HOO A;  1YI2 N;  1NGJ A;  3TR8 A;  4EIA A;  4DQR A;  4A59 A;  4J2D A;  1VK0 A;  4IO9 L;  3J80 O;  2P9P A;  3HT3 A;  4YDU A;  4Z4C A;  4AQY K;  2KKZ A;  3ZSV A;  2Z1I A;  3LWL A;  3V9W A;  1SL1 A;  2HMP A;  1TV6 A;  3UKR A;  4FM2 A;  4IEE A;  4X66 K;  3RRH A;  1M1K O;  3NF7 A;  5J2P A;  1XC9 A;  3K5L A;  2E5L K;  2ASM A;  2Q0R A;  3OYF A;  3S41 A;  2OTJ N;  2UUC K;  4BRA A;  1HJO A;  4DG1 A;  4B9T A;  3AVF A;  3ENH A;  1T44 A;  1VSM A;  4I2P A;  1VSJ A;  2D0O A;  3LM9 A;  3TTF A;  1JLE A;  2GUP A;  2CGJ A;  4KV8 A;  2V7Z A;  4CZL A;  3VGK A;  4G1Q A;  4O8U A;  1XNQ K;  4IWV A;  2G8K A;  3THY A;  2P9K B;  1K6Y A;  3BZK A;  1NK5 A;  1SL2 A;  3LP2 A;  4KBO A;  3VA3 A;  2RF2 A;  3L8B A;  5J2Q A;  5GIO A;  1XHZ A;  4CJ7 A;  4PWD A;  1K9M O;  2QWN A;  3QB0 A;  1EQY A;  5KRT A;  1KRP A;  2XY8 A;  3R3L A;  1IJJ A;  4W5R A;  4CK3 A;  1TL3 A;  3QBX A;  4DSF A;  1VQO N;  5JVH L;  3CJA A;  3DXM A;  4IO8 A;  4JN4 A;  4BRI A;  3SUP A;  3BDP A;  2FSK A;  3P39 A;  3WQU A;  2HBK A;  5C24 A;  3KK2 A;  4M7Y A;  4O4G A;  1CZB A;  2P1J A;  3ZT4 A;  3MED A;  4FW2 A;  4FO0 A;  1JLC A;  4KHW A;  1XI1 A;  4FPA A;  4M45 A;  4B3R K;  3A8Y A;  1DT9 A;  1U4B A; 
#chains in the Genus database with same CATH homology
 3J7Y P;  1XNR K;  1IBM K;  2HHH K;  5FLX O;  2UU9 K;  4B3S K;  1J5E K;  4B3M K;  4DUZ K;  4DV4 K;  4LF6 K;  1IBL K;  1N33 K;  4JI1 K;  5LL6 Z;  5LMN K;  4CW7 B;  4DR1 K;  4DR5 K;  4LFC K;  3J80 O;  4DV6 K;  4AQY K;  4JYA K;  4DV0 K;  1N32 K;  4DV7 K;  5IT9 O;  4YHH K;  4X66 K;  1I94 K;  2E5L K;  2UXB K;  4LF7 K;  4CVN E;  4LF4 K;  1HNX K;  3T1Y K;  4B3T K;  2UUC K;  5IWA K;  4YY3 K;  4JI0 K;  4DV1 K;  3OTO K;  5A2Q O;  1N34 K;  4JI4 K;  4LF5 K;  4JV5 K;  4NXN K;  5AJ3 K;  4DR4 K;  4V19 S;  3J7A P;  4OX9 K;  4DR7 K;  2UUA K;  1HNZ K;  2F4V K;  4GKK K;  4DR3 K;  2ZM6 K;  4LF8 K;  1XNQ K;  3J81 O;  4JI6 K;  4X65 K;  4DV5 K;  4DV2 K;  4JI5 K;  4DR6 K;  4DUY K;  4LF9 K;  4X62 K;  4JI3 K;  2VQF K;  4LFB K;  4JI8 K;  4JI2 K;  4DR2 K;  2UUB K;  3JAM O;  4JI7 K;  1FJG K;  1HR0 K;  4X64 K;  1HNW K;  4GKJ K;  2VQE K;  1XMO K;  4LFA K;  4KHP K;  1IBK K;  1N36 K;  4K0K K;  4DV3 K;  3T1H K;  2UXC K;  1XMQ K;  5BR8 K;  2UXD K;  4B3R K;  5LMU K;  4NXM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...