4DR6K

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 28
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr6K00
4V19S 4JYAK 4LF7K 4X66K 4DUYK 2UU9K 4JI2K 2UXCK 2UXDK 2F4VK 4X65K 4OX9K 4DR6K 1IBMK 2UUAK 4GKKK 1J5EK 4JI4K 1XMOK 4JI8K 4JI3K 3J80O 4K0KK 5IT9O 5LMNK 1N33K 4DR1K 4LFAK 3T1HK 4CVNE 1N34K 4DV0K 5IWAK 4JI5K 4DUZK 2HHHK 1IBLK 2E5LK 4CW7B 4JV5K 1HNZK 1HNXK 4JI6K 4KHPK 4YY3K 4B3RK 1N36K 3J81O 4LFBK 4NXMK 4DV3K 1XNQK 2VQEK 3J7YP 3JAMO 4GKJK 3OTOK 4DV1K 4DR4K 4LF8K 2UUBK 4JI0K 1N32K 1XMQK 4DV4K 4DV7K 4X64K 1I94K 1HNWK 4B3SK 2VQFK 4DV6K 2ZM6K 1FJGK 5LL6Z 3J7AP 4YHHK 4JI7K 5LMUK 4NXNK 1XNRK 5A2QO 4B3TK 4DV2K 4LF5K 2UXBK 4X62K 1HR0K 5FLXO 4DR3K 4LF4K 4JI1K 4DR5K 3T1YK 5BR8K 4DV5K 4B3MK 4AQYK 4DR2K 5AJ3K 4LF6K 4LFCK 2UUCK 4LF9K 1IBKK 4DR7K
chains in the Genus database with same CATH superfamily
1XWLA 4ILHA 2WTUA 1VSEA 1Y64A 2I5JA 4WQ4A 3FGUA 4K43A 4J2EA 1S6QA 1RDWX 4JKGB 4X65K 1U45A 1RBRA 5SWMA 3ULEA 2P9NB 3ZX0A 3SI6A 3VQDA 5CZ1A 3EKUA 1GLDG 2HHUA 4B1ZA 1L3UA 5LMNK 5CY4A 3THWA 3QIPA 5M1KA 4DV0K 3ID8A 4FJ7A 1IKVA 1DEJA 1GLJO 4PKIA 2HHHK 1T05A 2E88A 4A5AA 1MDUB 2HNZA 1SQKA 1CXQA 4JS4A 1TAQA 1N8RO 4KHNA 3U3YA 1WBBA 3DRPA 3LDPA 3AGKA 1K8KA 4I6MA 1N36K 2FLOA 4FZZA 4KAZA 3E01A 3HZ6A 3L8BA 2O8BB 4EHTA 1EWRA 3E66A 3BEXA 2E8AA 3GE1A 1M1KO 1S9GA 4O4GA 4E7IA 3VEZA 2P9LB 4H5NA 2VQEK 4IKFA 3JAMO 3VQ4A 2E1ZA 1F21A 3ISNC 4Z4IA 1JLFA 1IKWA 3VQ8A 1SUQA 2KTQA 5AQFA 1BO5O 3ATVA 3K9KA 4YOUA 3B6PA 3IAYA 3VTIA 1YIJN 3ZLJA 3T69A 1QZ5A 2F9WA 4CEZA 3I0SA 2OTJN 4JKCA 2CGLA 4B8CA 3OHRA 3VQBA 4WQ5C 4Z94A 4RW8A 1OVYA 4BGAA 3W0LA 1RT3A 1VK0A 3QBWA 3CQXA 2FBXA 4FO0A 3TAMA 4DR3K 3SQ2A 4LH5A 4DS5A 3TU5A 3SV4A 4KPYA 4O8KA 4H5VA 3BZKA 1X1PA 3SPZA 4FZXC 3IFRA 4GNIA 4AILC 2O8DA 1IKYA 4IEEA 1JLAA 3CM5A 3MXIA 1NOZA 4PL7A 3WNEA 4O55A 3KHYA 3VQPA 3K57A 1JKHA 1YJ9N 3AVCA 3DOKA 2QKKA 5J2QA 5AQUA 4DLGA 2D0OA 4DKWA 3VF4A 4M3XA 1QTMA 1C0FA 4KBOA 1IKXA 3O4QA 5D3GA 1GOCA 3MK6A 1GLCG 5AQOA 5AQJA 1X9WA 1S1WA 2HBMA 1L3VA 4KH5A 3SUOA 1S1XA 4CFAA 5BRDA 3QEWA 1RBUA 1Q86O 4DQ8A 4K42A 3WEEB 3QICA 1W2BM 3HI0A 2P9PA 3WQUA 5JLHA 3O3HA 1HX1A 1S1UA 2CGKA 1S1TA 5AZJA 1WOQA 2NRTA 3LZJA 2FBYA 3LL3A 1QSLA 3F73A 1NK0A 1MU2A 4GV9A 5M1FA 2E6MA 2YX6A 4EP4A 4HCCA 2ZD1A 1ESVA 3IRXA 4C8MA 5KPZA 1G15A 4B3SK 1XUPO 1C1AA 4MQ3A 4BRQA 3MN6A 3KKRA 5AQWA 3TAQA 1CZBA 3O4WA 4H03B 3V1OA 5BRHA 2HBKA 2HNDA 4BWMA 2QW9A 4BQLA 2RF2A 5M1OA 3G4SN 5AR0A 3I0RA 2NLXA 1HR0K 4Z0UA 3WQTA 5FLXO 4EZ6A 3BZCA 4F3TA 3Q7BA 3O6WA 1TKDA 3TANA 1NK9A 3DAWA 2B4JA 2Q2RA 4Y1CA 4JAXA 5HL7L 1IBKK 2B5JA 2EWSA 3H3OB 4JYAK 3DXKB 3LPTA 1DKGD 5AQLA 1OKJA 1NKEA 4B9TA 4H5RA 4JKHA 4AHUA 1GLBG 2NRHA 4GVMA 3S9HA 3MWPA 3MN7A 3LM2A 1LAWA 5CR4A 3KVGA 3C6TA 2J4RA 3DLKA 5JLFA 1XMOK 4NCAA 1SAZA 5AQZA 4M3WA 1ILYA 4C23A 1O1WA 1KSPA 3O3FA 3QMLA 5KRTA 1RTIA 4OPHA 3DXMB 4YOXA 2QWPA 3ZT1A 4PKGA 2YHYA 5EY4A 3AY9A 4B1VA 3K59A 2FF6A 2E5LK 2OTLN 4CJTA 4CW7B 1EETA 2VYPA 2WFBA 1OH7A 1BWFO 4FWSA 1YTUA 4WFAL 2O8FB 2YHAA 2OPRA 4YDUA 3LAKA 5ELZA 3VQAA 4CJKA 4EAHD 4CHQA 1NLVA 3OYFA 3R9PA 4CJQA 3KLIA 3LAMA 4FCYA 4XEIA 4DV3K 1NK7A 3CERA 3H6EA 3GL1A 5DM6L 4CJEA 3OTOK 1L3SA 3L2QA 3HP6A 4DTOA 1J53A 3T3FA 3DJCA 3M3ZA 3VESA 3JXUA 1SL2A 3AAPA 3DLBA 1LAVA 3K2PA 3SQ1A 3DLEA 3O9TA 5EU7A 3G25A 3V6DA 4FL9A 1U6ZA 3CCRN 2QK9A 4FPAA 2D5RA 4CGIA 3A5LC 3TTDA 1Z25A 4A57A 3J7AP 4DFJA 4YHHK 4FJJA 1ZYQA 4WQ4C 2HHQA 4CEOA 5KPRA 1RNHA 3M8RA 2RE2A 3AA2A 4G1QA 3BF3A 4U67L 5GIPA 3JYTA 4FJXA 1J54A 2UXBK 3KZBA 4CK2A 4B1XB 3HOSA 4CJRA 1WLJA 4WFNL 2IDOA 4N41A 1KXPA 3PSFA 5AJ3K 4IJAA 3EYZA 5AQNA 3HOTA 3LDNA 1H1VA 3LP1A 2PZSA 1VQ7N 3AVHA 3HM8A 3NF8A 3C6AA 1KCFA 4BRGA 3HSTB 5AQGA 4DWIA 5J2MA 3B8AX 4B9VA 4OX9K 3U4LA 3VQEA 2ZJRL 4FK0A 4DQPA 3A8YA 3AA4A 3C65A 1BQNA 4M63C 3TTCA 2BGGA 2D0AA 4BC3A 3GOIA 1QQCA 3ID6A 4CVNE 5JVHL 4H5TA 4XH1A 1HKBA 4JI5K 5CZ2A 4DUZK 4IZ9A 2P9UA 3LANA 3TTFA 2A1RA 2WONA 4H5WA 3ZSVA 1NJZA 4I9LA 3CXCM 4JV5K 1IG9A 3KTQA 4BR0A 2D0PA 3DLGA 4BVPA 4H0XB 2ZGYA 4E7KA 4JKFA 1QE1A 1TKZA 1NGCA 4CJ7A 3CQYA 3RSEB 4B9SA 4BRNA 3NDKA 3OW2M 4JKAA 2DFEA 2KKZA 3KK2A 3AO3A 3G10A 1D4XA 3OS1A 3QERA 4DV1K 1XQSC 2ASPA 2G8VA 5BN9A 1Q9YA 5CYMA 5HROA 3P38A 2PYJA 3PO5A 1CXUA 3HVTA 5B8HA 3P31A 3SUPA 3U9DA 1C0GA 1NGHA 4DHYA 4JEPA 3P39A 3SQ0A 3DXKA 2FSNA 2ZM6K 4A59A 3O3GA 4HUGA 1RDCA 5LL6Z 4M3ZA 3AVIA 2E1YA 3D2EB 4Q0BA 4CBWA 3BP8A 5CE3A 4CZHA 1HLUA 3O5BA 3TSUA 2P5GA 1VQMN 4H0YB 3D6RA 3QESA 3NAEA 2YKNA 2RHKA 3ZSXA 3VEWA 3ZT0A 3LP0A 4DSLA 1U47A 3CFPA 4DV5K 5MLCQ 2O8CB 4CIGA 5FPMA 2VG5A 3AVJA 3QNNA 3O9UA 1NK5A 1KFSA 4M41A 1I39A 1WSIA 3VQ7A 4E1JA 2GUPA 3AARA 1LV5A 3TAEA 4CJWA 3UKUB 2AA4A 4OPJA 4YOTA 1NBWA 5KGWA 1BHLA 4JI8K 2IVPA 3ZEUA 1RDAA 4JI3K 4KHUA 4NYFA 3CJ1A 3OYMA 2GEMA 3KD1E 2ZE2A 4RG8A 4CZGA 4BY9C 3HPOA 2HHVA 1TV6A 3TSQA 4YOYA 2EHGA 4PQUA 1JLEA 4BACA 4PHTX 4U7BA 3FZHA 1ZBUA 3VF6A 3V9UA 3CFRA 1A5VA 1QSYA 3CJ7A 1ASWA 5KRSA 4RTFD 1XHZA 2XO7A 3V81A 2JWLA 4O44A 4B1UB 1CZAN 3THXA 1T6DA 5HBMA 4JI0K 3QNOA 4BRHA 4PUOA 4Z4FA 4DV4K 4A2AA 1RTJA 3THVA 5LY3A 1YHQN 2DY4A 2A5XA 3VQ9A 4KI4A 1WBDA 1T8EA 3A2FA 3TWHA 1VRTA 1FK9A 2Z1IA 5CHIA 1TK0A 4J2BA 2P51A 4IXCA 3R1XA 3ENHA 2IS3A 1SKWA 3OYDA 2IVNA 4DV2K 1VQON 3AVKA 1VSHA 4W5QA 1LW0A 1WNSA 4KTWA 2QWQA 3SLCA 2P9IA 1ATSA 4A62A 4JI1K 3SAGA 4CEQA 1OH8A 5GAGP 3T1YK 1VQLN 1DT9A 3VEYA 5AQPA 4DLEA 2O8EA 5KTQA 4OPAA 1B9DA 5SZTA 1Q8IA 4CJFA 4QCLA 4FLTA 4AH9A 2VGMA 5FPEA 1TYQB 3O4NA 5EOYA 1BGXT 3OBYA 2HHXA 3CCEN 3VMFB 3C7NB 1J6ZA 2RPIA 3V1RA 4RCHA 4FJLA 5TKYA 4C8NA 1LW2A 2D1KA 4QS7A 1UAXA 3L0QA 1A5XA 4K8XA 3J8AA 1BG3A 4B9LA 4Z4HA 4H4OA 4DG1A 4BC4A 4IOAL 4CEDA 4DTMA 3PIPL 4B9MA 4CFBA 1W9HA 2FSJA 2YI1A 1RT6A 3SNNA 5AQRA 5HP1A 3H08A 5HRSA 3VQQA 5K14A 2XY5A 3QIOA 3OS0A 3LALA 1YITN 1W97L 2WC9A 3MEDA 3OYEA 1RCHA 3PSIA 3RRGA 5DMRA 3D2EA 4CGDA 3CM6A 1XC9A 3VETA 1BL3A 3KJVA 4CBXA 1HYZA 4YOVA 2OPSA 2ZJQL 1B92A 4BRMA 3DOLA 3ZSZA 1C1BA 1QHAA 2OANA 1C0TA 1NGIA 3CCVN 1OH6A 1TAUA 4PY5A 4CHOA 1EX4A 3E9OA 3RRHA 4LD0A 3LM9A 3AA3A 4BR4A 3SYZA 1HQEA 4IFVA 4CGHA 1HKGA 5LMUK 1UA0A 1QQNA 1XNRK 4B3TK 4GV6A 1U2VA 5GADP 3ZETA 3QETA 3AVGA 2W41A 5HRPA 3CCQN 3SBGA 4DS4A 4CE9A 1NU0A 4LFCK 4ILJA 4DSFA 3HRGA 4DR7K 4HUFA 4YNQA 3OYNA 2ETJA 4PA1A 1W7AA 2KZZA 1NMDA 3D2FA 1KRPA 1NKCA 4F8RA 1X9JA 4N47A 1S72N 4ELUA 3THYB 2PAVA 3AA5X 1YF5L 3IDHA 3AO1A 5I42A 1RBVA 1YUWA 4K0KK 4JLHA 3VGKA 4JD2A 3MEEA 3M1FA 4FLYA 4NYNA 2GTDA 4H4MA 4DQRA 5E84A 5IWAK 2HBLA 1LWFA 3OYGA 2G8WA 3UKRB 3CD6N 3A5NC 1KVCA 4JK8A 4PWDA 2QA4N 1SS6A 1KLMA 4C1NI 3O9SA 4CZKA 4CF9A 4CZLA 3EE9A 3KLEA 3O9RA 5AQTA 3G6EN 3VF2A 3NF7A 2HMIA 1KFDA 1DGKN 3R6MA 3VENA 4GY2B 3VN5A 4CF1A 1QHTA 5AQIA 2V52B 5E26A 5C2FA 3D0PA 2WBNA 1S5JA 4HHTA 1N32K 1DLOA 5FPDA 1EWQA 2DPNA 3ZX3A 3HT3A 4DQSA 3QLHA 4AF1A 3DLRA 1BDGA 2KLAA 3IG1A 3AVFA 3K5NA 1HMVA 4CFDA 4F3OA 3IS9A 1J9AA 3O8MA 4ISFA 3RMCA 4DU3A 1FXXA 2ZJPL 3AVLA 4FVUA 2NNWA 4OJRA 4CJPA 4N76A 1VQ6N 2BANA 4IO8A 4JHDB 3UE5A 5JICA 3KLHA 4LF4K 1BI4B 4DR5K 1U04A 4MDAA 1ASUA 3ZX2A 1G99A 2BUPA 3ALYA 5M1QA 3T19A 3BUZB 3SAFA 4FWPA 2VWKA 2ZGZA 5ADXA 1YI2N 4HTUA 3WT0A 4JKGA 4LC9B 4E7JA 4WE1A 2P9NA 3UIQA 2F4VK 3P83D 1MWMA 3CJ9A 1JCGA 3SJJA 4B1WB 2HW3A 5KQ8A 2YNFA 1WB9A 1JCFA 3CHWA 3AO4A 3KWGA 1BUPA 1WAJA 3MMVA 3M8SA 3QDKA 3BDPA 2F9TA 5JS2A 3IMXA 3NVKA 3RMAA 2ASOA 3AVMA 3FZKA 4DSIA 4CF2A 4OGCA 4CF8A 4DQQA 3SMSA 1HNXK 3NH2A 1Q7YO 3AVNA 4XH5A 1WSEA 2WOMA 5AQYA 2O8BA 3OA9A 2X6NA 1HNVA 1QZ6A 2P9LA 2BTFA 3L2RA 3FFIA 4JS5A 4DTJA 1BIUA 2E20A 3HJFA 3PV8A 4FK4A 4RW7A 4DR4K 3KLGA 3EO3A 4IWVA 1BA0A 4UQGA 1FKPA 4BR7A 4CEEA 4CHNA 2F8SA 1VSLA 3EN9A 1YXQA 4O0IA 4BRLA 1RFQA 1HNWK 4CGJA 4FXDA 1WSHA 1QVFM 1BISA 5CYQA 1HYSA 1U49A 4M3TA 1LCUA 3TSPA 4W5RA 2GBZA 4B1YB 5AFUH 2IC3A 1NMNA 4A5BA 4DSJA 2Q31A 3IUCA 3DWLA 1SV5A 2KFZA 3VERA 1BIZA 3OVNA 4B3OA 1RDDA 2A3ZA 4E7LA 1NGBA 3V1QA 3LWLA 3KK7A 2XHBA 4FLZA 2X74A 3NCIA 3L3VA 2VG6A 4OLAA 2GUIA 1TUUA 3O80A 2FF3B 4DF8A 2P9KB 2YJEA 2NRXA 2P1JA 4BE0A 4GVEA 4V19S 1NNEA 1Q18A 4YOWA 4CJSA 4DSEA 2G8IA 3I56N 3NF9A 1RBTA 2I7PA 5H1SQ 4A2BA 2QWNA 2Z1GA 4AM6A 4G9ZA 3FZLA 4GKKK 1J5EK 1K9MO 4JK9A 1ITGA 4FOIA 3SQ4A 2OZSA 1XHXA 4ELTA 3SK3A 4DR1K 4XIUA 3MXMA 2YNHA 2VCPA 3OBWA 4R79A 2G8KA 4OKKA 1N34K 1T3VA 1VQKN 1N6QA 4YORA 3EZ5A 2AJQA 3HPHA 1GLLO 2DFHA 3WEEA 2OYQA 4OKEA 3U6FA 4OLBA 1YVUA 2QWMA 2OPQA 2DFFA 1IO2A 3WXIA 4KRFA 1NGFA 4LSNA 1RDUA 3J81O 4FM0A 2V51B 4CZEA 3KK3A 3RMBA 4CZFA 4K41A 4FJIA 1UA1A 4F2SA 4NXMK 1VQ8N 3TARA 2V7YA 2YJFA 1S22A 5DK5A 2HBJA 4DFKA 4CEBA 2Q36A 3CCSN 4LF8K 4AHRA 3PX6A 1JLBA 1KAYA 1C0MA 3HM9A 4B9NA 3AVBA 5J2NA 2PYLA 4KO0A 3PUFA 4DV6K 1MA9B 2YKMA 2VGNA 4KTZA 1KQSM 3ZT3A 4O5BA 2RKIA 4NO7A 5I9EB 1NJIO 1D5AA 1NGDA 4X62K 5FDLA 1YJNN 3D45A 3C6UA 2FBVA 3NH0A 4KFBA 1RTHA 3AV9A 4PL8A 2YNIA 4DSKA 3V9XA 1JXBA 3WNHA 3P1GA 4CZMA 4CI6A 3NGYA 3L4QA 5KGXA 3C95A 3P5JA 2P9SB 2YV0X 4DTUA 4FLWA 2JGUA 4X66K 3CQ8A 1WSGA 1M90O 4BRKA 2Q3SA 4L8RB 2UXDK 3V9SA 1Q9XA 3CFOA 5AQKA 4J2AA 2GWJA 1IBMK 1BCOA 3QINA 1RTDA 3O9QA 4JKDA 3F2KA 1HNIA 3QEXA 3DXMA 2QM1A 1S6PA 3TAFA 1A5WA 3MCPA 1IJJA 3H3NO 2YHWA 2HSTA 3CIPA 1NM1A 4JRQA 4BRDA 4CGFA 2CH5A 3OYHA 1QVGM 3CCLN 3BF1A 3NH1A 5LJVA 2BH1A 3U8XA 2G8FA 2CGJA 1D9DA 2O8FA 3HBTA 4W5OA 4Z4CA 3MX2A 2ZF5O 4AM7A 4CEFA 4JI6K 3HO1A 4CZIA 4YY3K 4M7YA 1C6VA 2XY8A 1KLNA 3PX0A 4Y1DA 4IEIA 4L3QA 4DTSA 1REVA 1K8KB 4I6MB 1LOTB 2YHXA 5F0XA 1XC3A 2KQ2A 2Z1JA 3LDSA 1BQMA 4CK1A 4KHSA 5BRFA 3OYIA 3PO4A 4LY7A 3PX4A 4Z4EA 3A0IX 4KREA 4FJ9A 4DV7K 1HPMA 3ATUA 4DCHA 4X64K 3CF5L 2P9KA 1YJWN 2KFNA 4BGBA 5BREA 4DTPA 4HWIA 3QBXA 1ZBSA 4IDHA 4JNEA 2NRRA 3HXMA 3R3LA 3L2WA 4ICLA 1GLEG 1OH5A 5E41A 1S9EA 4KHYA 4O5FA 4FLVA 4OVLA 2BE2A 4HCBA 2DTUA 3SJHA 4FJ8A 5M1PA 5BR9A 4BR2A 5BPLA 2QI2A 4B3MK 5C15A 4JKEA 3RVCA 3WNFA 2UUCK 4RW6A 2ASMA 4O8UA 4GV3A 3N4PA 4Z4GA 4FWOA 3DLLL 2P5OA 4E89A 4DUYK 5T7BA 1VAZA 5DM7L 2BDPA 4OGEA 3CCUN 1RT2A 3HL8A 4RWTA 4NCGA 1KTQA 1YTAA 2F8TA 4RW9A 2A40A 2LSNA 3K9JA 3VTHA 1TK8A 2UUAK 3H1QA 4H0TB 1BCMA 4IO9L 3QFUA 1N33K 3WNGA 5AQHA 3CJCA 3T1HK 3NBPA 3V9ZA 1T03A 4A61A 3HPGA 1R0AA 4FLXA 3I8DA 1VSMA 5GIOA 1C0UA 3K58A 4HUEA 1HNZK 1L5UA 4MDBA 1X9MA 2ZQBA 3RR8A 3SCXA 3T1AA 4W5NA 4N5SA 3RSEA 1NK8A 2P9PB 5C0YA 4E19A 3LDQA 1K6YA 1SKSA 3F9MA 1S3XA 5ADXH 1T6CA 4CK3A 3DMJA 1EKEA 4ILGB 3TAGA 4FW2A 3ULDA 2HB5A 4FVMA 1KAZA 3OYBA 2PY5A 5AZJB 2E2PA 3BY5A 4I7FA 1V4SA 3L2VA 3ENBA 3N4QA 1IH7A 1ZBHA 3LWMA 2Q1NA 4DTNA 5HRRA 3NGIA 3ZYYX 5AZIB 2Q97A 2F7TA 4DFPA 1I94K 5KI6A 3H46O 4MO5A 1WAFA 3QEPA 2XRIA 4FM2A 5AQQA 4BRIA 4E3SA 1TK5A 4M42A 1YT3A 4FJMA 5JVGL 4BWJA 2O8CA 4BE1A 4FOEA 4EHUA 1EP4A 5F1XA 2AP1A 3UB5A 4BREA 4CERA 4DR2K 4AQYK 5GINA 4LF9K 5BPMA 4MLEA 3TABA 2HF4A 1FKOA 3M6GA 4FYDA 1XI1A 1ZC6A 1WUAA 3UKUA 4FLUA 2ZWHA 1RDBA 4CJ4A 1Z05A 1NGEA 3CMAN 4E0DA 1JXEA 2W6LA 4KB0A 1RBSA 1Y97A 5GAHP 3DYAA 4CD1A 3TAPA 4KHWA 1HRHA 1BU6O 2Y1JA 2D0CA 3CYMA 4IOXA 4BDPA 2GV9A 2W40A 4B9UA 3KIOA 1YVNA 3HVRA 4M3RA 2E2OA 3J80O 1GOAA 2V7ZA 4H0OA 1NG9A 4LFAK 4ELVA 3AAQA 3MN9A 4K8ZA 3U9ZA 4DQIA 1Z6RA 3L4IA 1IBLK 2PBDA 3VPZA 1HPZA 1KVAA 2F96A 4H0VB 1BA1A 4EZ9A 1T44A 3CJBA 4DFMA 3VGMA 3ZSYA 4KKOA 1CZ9A 5EXWA 1TKTA 3S3NA 3QFPA 3NF6A 3M8PA 3OYKA 2X6SA 5EX5A 1XNQK 3WXKA 4GKJK 3CC2N 2EX3A 4CEAA 5AQSA 5HRNA 4CJ3A 4ISGA 4AHVA 4CIEA 4MFBA 4H0PA 4I2QA 3A5OC 2YHBA 4BR9A 5AQXA 4CCHA 4GMJB 1ZXOA 2ATQA 3LP3A 3BGRA 4FWNA 3SZ2A 3KWIA 4WF9L 1J5OA 3VQCA 3K5LA 4E7HA 1TUYA 3JSMA 3CC7N 2IIRA 3HK2A 2ITGA 3JS6A 2E6LA 2HF3A 3FZFA 4C8LA 4FWQA 4XH4A 3H1VX 1GLAG 2D0BA 1VQ4N 1SL0A 3QEVA 2H3GX 3NVMA 3NE6A 4B08A 4WCEL 1TYQA 4JN4A 4E1NA 4JRPA 1JLGA 3MECA 2HVIA 3CPEA 2IGIA 1ATRA 4AHCA 3C7NA 4KH6A 1LWEA 4QS8A 4C1NK 5FRNA 1TL3A 3B6OA 2Y1IA 4Y0WA 4DR6K 4KTQA 3WXLA 4BQZA 1NWKA 4ZTFA 4LSLA 2KHOA 3TR8A 1IG8A 3IKMA 2IAJA 4BG8A 3CG7A 3VQ5A 1Q81O 1OVQA 3ZSOA 3VA3A 2QWOA 1JL1A 4BRCA 1NGJA 2R7YA 1UOCA 3EZWA 1B9FA 2OPPA 3M5RA 4CF0A 3MWTA 3E1YA 3MN5A 2QEXN 3MXJA 5AZIA 2I7NA 2P9UB 3HTVA 3HP9A 4CHYA 3CPWM 1E4FT 4CHZA 5I3UA 4KHPK 4JK7A 5C12A 4RW4A 1VQ5N 1HUXA 4BRFA 1EO1A 2NRZA 4ZTJA 4EP5A 2IOCA 3WXMB 4CJUA 2FSKA 1VQPN 4ISEA 3WXJA 4B8AB 3L3UA 4IG0A 4O0JA 1Q82O 1DTTA 2JLEA 4BVOA 5FPNA 2VWJA 3SBTA 1JCEA 4LH4A 2G8UA 3LDLA 1DTQA 2YNGA 4KHQA 4WFBL 5KQDA 1VSKA 2W6KA 3DRRA 1QQOA 3TPQA 5M1NA 1U4BA 2FC0A 4BDZA 4HVJA 3OYCA 3SUQA 1E3MA 4FW1A 3L6QA 2UYTA 1E4GT 3PIOL 2HHWA 1WN7A 3F9KA 3NMUA 1NK4A 1ZBFA 3CC4N 2HHTA 3HSCA 1KC8O 1L3TA 5FROA 1JLQA 2HVHA 4ZHRA 5HLFA 4FWKA 4M45A 1QS4A 4FJGA 1NOYA 3I55N 4JI2K 2Q0RA 1VSIA 4Q5VA 3I33A 1RILA 4IFYA 3LPUA 3THYA 1KVBA 3GG4A 5LJWA 3LZIA 4R5PA 4FWMA 4J8FA 2E4LA 4CIFA 1CLQA 4QOZB 4W5TA 1IV0A 4E1MA 3E9LA 4UY8O 3ZEUB 4FJ5A 1GLFO 3FLCO 3FZMA 1EXQA 4M7XA 3HYFA 1D8YA 1KAXA 3UKRA 1VHXA 1RGIA 3OS2A 4FJKA 3VGLA 1ZBIA 5BPNA 1VSFA 2OCEA 4FWRA 4F2RA 4BRPA 3ZCMA 1C1CA 3M8QA 2NRVA 3ITHA 3ZSRA 3QO9A 2IVOA 3VA0A 5JMVA 3S3MA 3OYLA 1LWCA 2QXFA 3V4IA 4FM1A 3R8EA 1SL1A 3WUHA 3FFKB 2CH6A 1TVRA 2KW4A 3THXB 1QQMA 3G71N 1NJXA 2HNYA 2NUBA 1SZ2A 3KKSA 3SUNA 2VQFK 3KLFA 2PFUA 4F4KA 3DRSA 4N56A 4HTLA 4NB4A 1X3NA 4MLHA 4M3UA 5J2PA 2A1SA 4WYBA 4OPKA 3C0BA 2ITMA 4FJNA 4NXNK 5AQMA 5C42A 5J1EA 3DI6A 2G8HA 4JHDA 4PKHA 3DLHA 2E2QA 1BI4A 1K73O 4EFHA 2VG7A 4DU1A 3O08A 4CGGA 2KZMA 3K0SA 1W0HA 4ID1A 2P9IB 4DTXA 4MO4A 3P4IA 1KD1O 4DMNA 3AGRA 2D4WA 2NRWA 2QTDA 3RMDA 2O4GA 3SPYA 1ATNA 1RT4A 3H45C 3K5MA 3PLAA 2YCHA 2O8EB 2GX9A 1JLCA 5KPTA 4CJVA 2UU9K 4J2DA 1NKBA 3CCMN 4IBNA 2UXCK 4FWLA 3L2UA 1NGAA 4WQ5A 3QEIA 2HOEA 4JI4K 1U48A 3O1BA 1X9SA 5JS1A 1VQ9N 4C8KA 4CJLA 5IT9O 3EKSA 1N5YA 5HOOA 1V4TA 5C25A 1FW6A 1TL1A 2HMPA 4CECA 4OO1J 1RT5A 2JWKA 2OZMA 2WUSA 3FR0A 4H8KA 4ID5A 4CFCA 3AVAA 5EVZA 2QWLA 1D9FA 2XY6A 3CMEN 4LFBK 3ULEB 3K5OA 4F9OA 4YFUA 1SKRA 3MDQA 3E9PA 2A42A 1I3AA 3OJUA 2E2NA 3MX5A 3RR7A 3F5TA 3THWB 3GDQA 4BDYA 4BC2A 3J7ZO 4IFEA 1XMQK 2QKBA 1RT7A 3CETA 2QWRA 4CZJA 2RN2A 4AHSA 4NLBA 4BROA 3TI0A 3V9WA 3DM2A 3FE1A 4B9QA 4CJ5A 3LDOA 4FZYA 2W42A 4CESA 4CD3A 5A2QO 3ZT4A 3VOVA 3C6HA 2VWBA 4I9QA 3ZSWA 1NK6A 1S1VA 3EE8A 3S3OA 1U2VB 4IDKA 1P8ZA 3ZETB 3EL2A 4QAGA 3G0ZA 4BE2A 4FK2A 3AO5A 3VQ6A 3MEGA 4NLCA 1NJYA 4LF6K 2FXUA 1RT1A 4FJHA 3ZSQA 4LF7K 1HQUA 4DTRA 1BOTO 1HYVA 4FPBA 5AFUA 3RWUA 4QS9A 4FSVA 4IG3A 3T7ZA 3A5MC 2X78A 4KI6A 3ENOA 1TKXA 3D2FB 3SMPA 3U3GA 2O4IA 4IOCL 3GBTA 2A41A 1P90A 5F2RA 4OKJA 1T7PA 3C94A 3NFAA 3AO2A 3Q7CA 4JKBA 3NHGA 3CI5A 4BR5A 5TKWA 4AHTA 1ASVA 4KB1A 4JD2B 1R59O 4CBUA 3NGZA 4DF4A 2XY7A 1VSDA 3OY9A 3VEXA 2O8DB 2HHSA 1VSJA 3VEVA 5C10A 3KK1A 4EIAA 4TSXA 3OYJA 5C24A 4B3RK 4IJNA 2A6AA 3S41A 4BG9A 3ZT2A 4DB3A 1VQNN 3LP2A 1VRUA 2GELA 2NZTA 2Z1HA 3MCAB 3ASMA 1NJWA 3J7YP 4KV8A 1K8AO 1GOBA 3EEQA 3EY1A 1WSJA 3RTVA 2UUBK 4C8OA 4GW6A 3KD5E 1ZBLA 2OA8A 2GWKA 4BRAA 3OYAA 1X3MA 2QXLA 1UWBA 3O1WA 5FRMA 2B6AA 3SV3A 3W3DA 1FJGK 3SAHA 1Z26A 1HKCA 5BN8A 1EQYA 4I2PA 4M3YA 4KH4A 4NCBA 4JI7K 2FBTA 1QSSA 3MAQA 4BC5A 4CHPA 1JL2A 5C2DA 5GAEP 3PY8A 3CJAA 3I8BA 1TGOA 1JJ2M 4LF5K 5AQVA 2Q0UA 1HJRA 1HJOA 4YDUC 3D7EO 4DU4A 3OJSA 3QB0A 1WSFA 4K25A 1O13A 2P9SA 1NGGA 5BR8K 3CCJN 1MWKA 3VEOA 1YAGA
chains in the Genus database with same CATH topology
4V19S 4JYAK 4LF7K 4X66K 4DUYK 2UU9K 4JI2K 2UXCK 2UXDK 2F4VK 4X65K 4OX9K 4DR6K 1IBMK 2UUAK 4GKKK 1J5EK 4JI4K 1XMOK 4JI8K 4JI3K 3J80O 4K0KK 5IT9O 5LMNK 1N33K 4DR1K 4LFAK 3T1HK 4CVNE 1N34K 4DV0K 5IWAK 4JI5K 4DUZK 2HHHK 1IBLK 2E5LK 4CW7B 4JV5K 1HNZK 1HNXK 4JI6K 4KHPK 4YY3K 4B3RK 1N36K 3J81O 4LFBK 4NXMK 4DV3K 1XNQK 2VQEK 3J7YP 3JAMO 4GKJK 3OTOK 4DV1K 4DR4K 4LF8K 2UUBK 4JI0K 1N32K 1XMQK 4DV4K 4DV7K 4X64K 1I94K 1HNWK 4B3SK 2VQFK 4DV6K 2ZM6K 1FJGK 5LL6Z 3J7AP 4YHHK 4JI7K 5LMUK 4NXNK 1XNRK 5A2QO 4B3TK 4DV2K 4LF5K 2UXBK 4X62K 1HR0K 5FLXO 4DR3K 4LF4K 4JI1K 4DR5K 3T1YK 5BR8K 4DV5K 4B3MK 4AQYK 4DR2K 5AJ3K 4LF6K 4LFCK 2UUCK 4LF9K 1IBKK 4DR7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V19 S;  4JYA K;  4LF7 K;  4X66 K;  4DUY K;  2UU9 K;  4JI2 K;  2UXC K;  2UXD K;  2F4V K;  4X65 K;  4OX9 K;  4DR6 K;  1IBM K;  2UUA K;  4GKK K;  1J5E K;  4JI4 K;  1XMO K;  4JI8 K;  4JI3 K;  3J80 O;  4K0K K;  5IT9 O;  5LMN K;  1N33 K;  4DR1 K;  4LFA K;  3T1H K;  4CVN E;  1N34 K;  4DV0 K;  5IWA K;  4JI5 K;  4DUZ K;  2HHH K;  1IBL K;  2E5L K;  4CW7 B;  4JV5 K;  1HNZ K;  1HNX K;  4JI6 K;  4KHP K;  4YY3 K;  4B3R K;  1N36 K;  3J81 O;  4LFB K;  4NXM K;  4DV3 K;  1XNQ K;  2VQE K;  3J7Y P;  3JAM O;  4GKJ K;  3OTO K;  4DV1 K;  4DR4 K;  4LF8 K;  2UUB K;  4JI0 K;  1N32 K;  1XMQ K;  4DV4 K;  4DV7 K;  4X64 K;  1I94 K;  1HNW K;  4B3S K;  2VQF K;  4DV6 K;  2ZM6 K;  1FJG K;  5LL6 Z;  3J7A P;  4YHH K;  4JI7 K;  5LMU K;  4NXN K;  1XNR K;  5A2Q O;  4B3T K;  4DV2 K;  4LF5 K;  2UXB K;  4X62 K;  1HR0 K;  5FLX O;  4DR3 K;  4LF4 K;  4JI1 K;  4DR5 K;  3T1Y K;  5BR8 K;  4DV5 K;  4B3M K;  4AQY K;  4DR2 K;  5AJ3 K;  4LF6 K;  4LFC K;  2UUC K;  4LF9 K;  1IBK K;  4DR7 K; 
#chains in the Genus database with same CATH topology
 1XWL A;  4ILH A;  2WTU A;  1VSE A;  1Y64 A;  2I5J A;  4WQ4 A;  3FGU A;  4K43 A;  4J2E A;  1S6Q A;  1RDW X;  4JKG B;  4X65 K;  1U45 A;  1RBR A;  5SWM A;  3ULE A;  2P9N B;  3ZX0 A;  3SI6 A;  3VQD A;  5CZ1 A;  3EKU A;  1GLD G;  2HHU A;  4B1Z A;  1L3U A;  5LMN K;  5CY4 A;  3THW A;  3QIP A;  5M1K A;  4DV0 K;  3ID8 A;  4FJ7 A;  1IKV A;  1DEJ A;  1GLJ O;  4PKI A;  2HHH K;  1T05 A;  2E88 A;  4A5A A;  1MDU B;  2HNZ A;  1SQK A;  1CXQ A;  4JS4 A;  1TAQ A;  1N8R O;  4KHN A;  3U3Y A;  1WBB A;  3DRP A;  3LDP A;  3AGK A;  1K8K A;  4I6M A;  1N36 K;  2FLO A;  4FZZ A;  4KAZ A;  3E01 A;  3HZ6 A;  3L8B A;  2O8B B;  4EHT A;  1EWR A;  3E66 A;  3BEX A;  2E8A A;  3GE1 A;  1M1K O;  1S9G A;  4O4G A;  4E7I A;  3VEZ A;  2P9L B;  4H5N A;  2VQE K;  4IKF A;  3JAM O;  3VQ4 A;  2E1Z A;  1F21 A;  3ISN C;  4Z4I A;  1JLF A;  1IKW A;  3VQ8 A;  1SUQ A;  2KTQ A;  5AQF A;  1BO5 O;  3ATV A;  3K9K A;  4YOU A;  3B6P A;  3IAY A;  3VTI A;  1YIJ N;  3ZLJ A;  3T69 A;  1QZ5 A;  2F9W A;  4CEZ A;  3I0S A;  2OTJ N;  4JKC A;  2CGL A;  4B8C A;  3OHR A;  3VQB A;  4WQ5 C;  4Z94 A;  4RW8 A;  1OVY A;  4BGA A;  3W0L A;  1RT3 A;  1VK0 A;  3QBW A;  3CQX A;  2FBX A;  4FO0 A;  3TAM A;  4DR3 K;  3SQ2 A;  4LH5 A;  4DS5 A;  3TU5 A;  3SV4 A;  4KPY A;  4O8K A;  4H5V A;  3BZK A;  1X1P A;  3SPZ A;  4FZX C;  3IFR A;  4GNI A;  4AIL C;  2O8D A;  1IKY A;  4IEE A;  1JLA A;  3CM5 A;  3MXI A;  1NOZ A;  4PL7 A;  3WNE A;  4O55 A;  3KHY A;  3VQP A;  3K57 A;  1JKH A;  1YJ9 N;  3AVC A;  3DOK A;  2QKK A;  5J2Q A;  5AQU A;  4DLG A;  2D0O A;  4DKW A;  3VF4 A;  4M3X A;  1QTM A;  1C0F A;  4KBO A;  1IKX A;  3O4Q A;  5D3G A;  1GOC A;  3MK6 A;  1GLC G;  5AQO A;  5AQJ A;  1X9W A;  1S1W A;  2HBM A;  1L3V A;  4KH5 A;  3SUO A;  1S1X A;  4CFA A;  5BRD A;  3QEW A;  1RBU A;  1Q86 O;  4DQ8 A;  4K42 A;  3WEE B;  3QIC A;  1W2B M;  3HI0 A;  2P9P A;  3WQU A;  5JLH A;  3O3H A;  1HX1 A;  1S1U A;  2CGK A;  1S1T A;  5AZJ A;  1WOQ A;  2NRT A;  3LZJ A;  2FBY A;  3LL3 A;  1QSL A;  3F73 A;  1NK0 A;  1MU2 A;  4GV9 A;  5M1F A;  2E6M A;  2YX6 A;  4EP4 A;  4HCC A;  2ZD1 A;  1ESV A;  3IRX A;  4C8M A;  5KPZ A;  1G15 A;  4B3S K;  1XUP O;  1C1A A;  4MQ3 A;  4BRQ A;  3MN6 A;  3KKR A;  5AQW A;  3TAQ A;  1CZB A;  3O4W A;  4H03 B;  3V1O A;  5BRH A;  2HBK A;  2HND A;  4BWM A;  2QW9 A;  4BQL A;  2RF2 A;  5M1O A;  3G4S N;  5AR0 A;  3I0R A;  2NLX A;  1HR0 K;  4Z0U A;  3WQT A;  5FLX O;  4EZ6 A;  3BZC A;  4F3T A;  3Q7B A;  3O6W A;  1TKD A;  3TAN A;  1NK9 A;  3DAW A;  2B4J A;  2Q2R A;  4Y1C A;  4JAX A;  5HL7 L;  1IBK K;  2B5J A;  2EWS A;  3H3O B;  4JYA K;  3DXK B;  3LPT A;  1DKG D;  5AQL A;  1OKJ A;  1NKE A;  4B9T A;  4H5R A;  4JKH A;  4AHU A;  1GLB G;  2NRH A;  4GVM A;  3S9H A;  3MWP A;  3MN7 A;  3LM2 A;  1LAW A;  5CR4 A;  3KVG A;  3C6T A;  2J4R A;  3DLK A;  5JLF A;  1XMO K;  4NCA A;  1SAZ A;  5AQZ A;  4M3W A;  1ILY A;  4C23 A;  1O1W A;  1KSP A;  3O3F A;  3QML A;  5KRT A;  1RTI A;  4OPH A;  3DXM B;  4YOX A;  2QWP A;  3ZT1 A;  4PKG A;  2YHY A;  5EY4 A;  3AY9 A;  4B1V A;  3K59 A;  2FF6 A;  2E5L K;  2OTL N;  4CJT A;  4CW7 B;  1EET A;  2VYP A;  2WFB A;  1OH7 A;  1BWF O;  4FWS A;  1YTU A;  4WFA L;  2O8F B;  2YHA A;  2OPR A;  4YDU A;  3LAK A;  5ELZ A;  3VQA A;  4CJK A;  4EAH D;  4CHQ A;  1NLV A;  3OYF A;  3R9P A;  4CJQ A;  3KLI A;  3LAM A;  4FCY A;  4XEI A;  4DV3 K;  1NK7 A;  3CER A;  3H6E A;  3GL1 A;  5DM6 L;  4CJE A;  3OTO K;  1L3S A;  3L2Q A;  3HP6 A;  4DTO A;  1J53 A;  3T3F A;  3DJC A;  3M3Z A;  3VES A;  3JXU A;  1SL2 A;  3AAP A;  3DLB A;  1LAV A;  3K2P A;  3SQ1 A;  3DLE A;  3O9T A;  5EU7 A;  3G25 A;  3V6D A;  4FL9 A;  1U6Z A;  3CCR N;  2QK9 A;  4FPA A;  2D5R A;  4CGI A;  3A5L C;  3TTD A;  1Z25 A;  4A57 A;  3J7A P;  4DFJ A;  4YHH K;  4FJJ A;  1ZYQ A;  4WQ4 C;  2HHQ A;  4CEO A;  5KPR A;  1RNH A;  3M8R A;  2RE2 A;  3AA2 A;  4G1Q A;  3BF3 A;  4U67 L;  5GIP A;  3JYT A;  4FJX A;  1J54 A;  2UXB K;  3KZB A;  4CK2 A;  4B1X B;  3HOS A;  4CJR A;  1WLJ A;  4WFN L;  2IDO A;  4N41 A;  1KXP A;  3PSF A;  5AJ3 K;  4IJA A;  3EYZ A;  5AQN A;  3HOT A;  3LDN A;  1H1V A;  3LP1 A;  2PZS A;  1VQ7 N;  3AVH A;  3HM8 A;  3NF8 A;  3C6A A;  1KCF A;  4BRG A;  3HST B;  5AQG A;  4DWI A;  5J2M A;  3B8A X;  4B9V A;  4OX9 K;  3U4L A;  3VQE A;  2ZJR L;  4FK0 A;  4DQP A;  3A8Y A;  3AA4 A;  3C65 A;  1BQN A;  4M63 C;  3TTC A;  2BGG A;  2D0A A;  4BC3 A;  3GOI A;  1QQC A;  3ID6 A;  4CVN E;  5JVH L;  4H5T A;  4XH1 A;  1HKB A;  4JI5 K;  5CZ2 A;  4DUZ K;  4IZ9 A;  2P9U A;  3LAN A;  3TTF A;  2A1R A;  2WON A;  4H5W A;  3ZSV A;  1NJZ A;  4I9L A;  3CXC M;  4JV5 K;  1IG9 A;  3KTQ A;  4BR0 A;  2D0P A;  3DLG A;  4BVP A;  4H0X B;  2ZGY A;  4E7K A;  4JKF A;  1QE1 A;  1TKZ A;  1NGC A;  4CJ7 A;  3CQY A;  3RSE B;  4B9S A;  4BRN A;  3NDK A;  3OW2 M;  4JKA A;  2DFE A;  2KKZ A;  3KK2 A;  3AO3 A;  3G10 A;  1D4X A;  3OS1 A;  3QER A;  4DV1 K;  1XQS C;  2ASP A;  2G8V A;  5BN9 A;  1Q9Y A;  5CYM A;  5HRO A;  3P38 A;  2PYJ A;  3PO5 A;  1CXU A;  3HVT A;  5B8H A;  3P31 A;  3SUP A;  3U9D A;  1C0G A;  1NGH A;  4DHY A;  4JEP A;  3P39 A;  3SQ0 A;  3DXK A;  2FSN A;  2ZM6 K;  4A59 A;  3O3G A;  4HUG A;  1RDC A;  5LL6 Z;  4M3Z A;  3AVI A;  2E1Y A;  3D2E B;  4Q0B A;  4CBW A;  3BP8 A;  5CE3 A;  4CZH A;  1HLU A;  3O5B A;  3TSU A;  2P5G A;  1VQM N;  4H0Y B;  3D6R A;  3QES A;  3NAE A;  2YKN A;  2RHK A;  3ZSX A;  3VEW A;  3ZT0 A;  3LP0 A;  4DSL A;  1U47 A;  3CFP A;  4DV5 K;  5MLC Q;  2O8C B;  4CIG A;  5FPM A;  2VG5 A;  3AVJ A;  3QNN A;  3O9U A;  1NK5 A;  1KFS A;  4M41 A;  1I39 A;  1WSI A;  3VQ7 A;  4E1J A;  2GUP A;  3AAR A;  1LV5 A;  3TAE A;  4CJW A;  3UKU B;  2AA4 A;  4OPJ A;  4YOT A;  1NBW A;  5KGW A;  1BHL A;  4JI8 K;  2IVP A;  3ZEU A;  1RDA A;  4JI3 K;  4KHU A;  4NYF A;  3CJ1 A;  3OYM A;  2GEM A;  3KD1 E;  2ZE2 A;  4RG8 A;  4CZG A;  4BY9 C;  3HPO A;  2HHV A;  1TV6 A;  3TSQ A;  4YOY A;  2EHG A;  4PQU A;  1JLE A;  4BAC A;  4PHT X;  4U7B A;  3FZH A;  1ZBU A;  3VF6 A;  3V9U A;  3CFR A;  1A5V A;  1QSY A;  3CJ7 A;  1ASW A;  5KRS A;  4RTF D;  1XHZ A;  2XO7 A;  3V81 A;  2JWL A;  4O44 A;  4B1U B;  1CZA N;  3THX A;  1T6D A;  5HBM A;  4JI0 K;  3QNO A;  4BRH A;  4PUO A;  4Z4F A;  4DV4 K;  4A2A A;  1RTJ A;  3THV A;  5LY3 A;  1YHQ N;  2DY4 A;  2A5X A;  3VQ9 A;  4KI4 A;  1WBD A;  1T8E A;  3A2F A;  3TWH A;  1VRT A;  1FK9 A;  2Z1I A;  5CHI A;  1TK0 A;  4J2B A;  2P51 A;  4IXC A;  3R1X A;  3ENH A;  2IS3 A;  1SKW A;  3OYD A;  2IVN A;  4DV2 K;  1VQO N;  3AVK A;  1VSH A;  4W5Q A;  1LW0 A;  1WNS A;  4KTW A;  2QWQ A;  3SLC A;  2P9I A;  1ATS A;  4A62 A;  4JI1 K;  3SAG A;  4CEQ A;  1OH8 A;  5GAG P;  3T1Y K;  1VQL N;  1DT9 A;  3VEY A;  5AQP A;  4DLE A;  2O8E A;  5KTQ A;  4OPA A;  1B9D A;  5SZT A;  1Q8I A;  4CJF A;  4QCL A;  4FLT A;  4AH9 A;  2VGM A;  5FPE A;  1TYQ B;  3O4N A;  5EOY A;  1BGX T;  3OBY A;  2HHX A;  3CCE N;  3VMF B;  3C7N B;  1J6Z A;  2RPI A;  3V1R A;  4RCH A;  4FJL A;  5TKY A;  4C8N A;  1LW2 A;  2D1K A;  4QS7 A;  1UAX A;  3L0Q A;  1A5X A;  4K8X A;  3J8A A;  1BG3 A;  4B9L A;  4Z4H A;  4H4O A;  4DG1 A;  4BC4 A;  4IOA L;  4CED A;  4DTM A;  3PIP L;  4B9M A;  4CFB A;  1W9H A;  2FSJ A;  2YI1 A;  1RT6 A;  3SNN A;  5AQR A;  5HP1 A;  3H08 A;  5HRS A;  3VQQ A;  5K14 A;  2XY5 A;  3QIO A;  3OS0 A;  3LAL A;  1YIT N;  1W97 L;  2WC9 A;  3MED A;  3OYE A;  1RCH A;  3PSI A;  3RRG A;  5DMR A;  3D2E A;  4CGD A;  3CM6 A;  1XC9 A;  3VET A;  1BL3 A;  3KJV A;  4CBX A;  1HYZ A;  4YOV A;  2OPS A;  2ZJQ L;  1B92 A;  4BRM A;  3DOL A;  3ZSZ A;  1C1B A;  1QHA A;  2OAN A;  1C0T A;  1NGI A;  3CCV N;  1OH6 A;  1TAU A;  4PY5 A;  4CHO A;  1EX4 A;  3E9O A;  3RRH A;  4LD0 A;  3LM9 A;  3AA3 A;  4BR4 A;  3SYZ A;  1HQE A;  4IFV A;  4CGH A;  1HKG A;  5LMU K;  1UA0 A;  1QQN A;  1XNR K;  4B3T K;  4GV6 A;  1U2V A;  5GAD P;  3ZET A;  3QET A;  3AVG A;  2W41 A;  5HRP A;  3CCQ N;  3SBG A;  4DS4 A;  4CE9 A;  1NU0 A;  4LFC K;  4ILJ A;  4DSF A;  3HRG A;  4DR7 K;  4HUF A;  4YNQ A;  3OYN A;  2ETJ A;  4PA1 A;  1W7A A;  2KZZ A;  1NMD A;  3D2F A;  1KRP A;  1NKC A;  4F8R A;  1X9J A;  4N47 A;  1S72 N;  4ELU A;  3THY B;  2PAV A;  3AA5 X;  1YF5 L;  3IDH A;  3AO1 A;  5I42 A;  1RBV A;  1YUW A;  4K0K K;  4JLH A;  3VGK A;  4JD2 A;  3MEE A;  3M1F A;  4FLY A;  4NYN A;  2GTD A;  4H4M A;  4DQR A;  5E84 A;  5IWA K;  2HBL A;  1LWF A;  3OYG A;  2G8W A;  3UKR B;  3CD6 N;  3A5N C;  1KVC A;  4JK8 A;  4PWD A;  2QA4 N;  1SS6 A;  1KLM A;  4C1N I;  3O9S A;  4CZK A;  4CF9 A;  4CZL A;  3EE9 A;  3KLE A;  3O9R A;  5AQT A;  3G6E N;  3VF2 A;  3NF7 A;  2HMI A;  1KFD A;  1DGK N;  3R6M A;  3VEN A;  4GY2 B;  3VN5 A;  4CF1 A;  1QHT A;  5AQI A;  2V52 B;  5E26 A;  5C2F A;  3D0P A;  2WBN A;  1S5J A;  4HHT A;  1N32 K;  1DLO A;  5FPD A;  1EWQ A;  2DPN A;  3ZX3 A;  3HT3 A;  4DQS A;  3QLH A;  4AF1 A;  3DLR A;  1BDG A;  2KLA A;  3IG1 A;  3AVF A;  3K5N A;  1HMV A;  4CFD A;  4F3O A;  3IS9 A;  1J9A A;  3O8M A;  4ISF A;  3RMC A;  4DU3 A;  1FXX A;  2ZJP L;  3AVL A;  4FVU A;  2NNW A;  4OJR A;  4CJP A;  4N76 A;  1VQ6 N;  2BAN A;  4IO8 A;  4JHD B;  3UE5 A;  5JIC A;  3KLH A;  4LF4 K;  1BI4 B;  4DR5 K;  1U04 A;  4MDA A;  1ASU A;  3ZX2 A;  1G99 A;  2BUP A;  3ALY A;  5M1Q A;  3T19 A;  3BUZ B;  3SAF A;  4FWP A;  2VWK A;  2ZGZ A;  5ADX A;  1YI2 N;  4HTU A;  3WT0 A;  4JKG A;  4LC9 B;  4E7J A;  4WE1 A;  2P9N A;  3UIQ A;  2F4V K;  3P83 D;  1MWM A;  3CJ9 A;  1JCG A;  3SJJ A;  4B1W B;  2HW3 A;  5KQ8 A;  2YNF A;  1WB9 A;  1JCF A;  3CHW A;  3AO4 A;  3KWG A;  1BUP A;  1WAJ A;  3MMV A;  3M8S A;  3QDK A;  3BDP A;  2F9T A;  5JS2 A;  3IMX A;  3NVK A;  3RMA A;  2ASO A;  3AVM A;  3FZK A;  4DSI A;  4CF2 A;  4OGC A;  4CF8 A;  4DQQ A;  3SMS A;  1HNX K;  3NH2 A;  1Q7Y O;  3AVN A;  4XH5 A;  1WSE A;  2WOM A;  5AQY A;  2O8B A;  3OA9 A;  2X6N A;  1HNV A;  1QZ6 A;  2P9L A;  2BTF A;  3L2R A;  3FFI A;  4JS5 A;  4DTJ A;  1BIU A;  2E20 A;  3HJF A;  3PV8 A;  4FK4 A;  4RW7 A;  4DR4 K;  3KLG A;  3EO3 A;  4IWV A;  1BA0 A;  4UQG A;  1FKP A;  4BR7 A;  4CEE A;  4CHN A;  2F8S A;  1VSL A;  3EN9 A;  1YXQ A;  4O0I A;  4BRL A;  1RFQ A;  1HNW K;  4CGJ A;  4FXD A;  1WSH A;  1QVF M;  1BIS A;  5CYQ A;  1HYS A;  1U49 A;  4M3T A;  1LCU A;  3TSP A;  4W5R A;  2GBZ A;  4B1Y B;  5AFU H;  2IC3 A;  1NMN A;  4A5B A;  4DSJ A;  2Q31 A;  3IUC A;  3DWL A;  1SV5 A;  2KFZ A;  3VER A;  1BIZ A;  3OVN A;  4B3O A;  1RDD A;  2A3Z A;  4E7L A;  1NGB A;  3V1Q A;  3LWL A;  3KK7 A;  2XHB A;  4FLZ A;  2X74 A;  3NCI A;  3L3V A;  2VG6 A;  4OLA A;  2GUI A;  1TUU A;  3O80 A;  2FF3 B;  4DF8 A;  2P9K B;  2YJE A;  2NRX A;  2P1J A;  4BE0 A;  4GVE A;  4V19 S;  1NNE A;  1Q18 A;  4YOW A;  4CJS A;  4DSE A;  2G8I A;  3I56 N;  3NF9 A;  1RBT A;  2I7P A;  5H1S Q;  4A2B A;  2QWN A;  2Z1G A;  4AM6 A;  4G9Z A;  3FZL A;  4GKK K;  1J5E K;  1K9M O;  4JK9 A;  1ITG A;  4FOI A;  3SQ4 A;  2OZS A;  1XHX A;  4ELT A;  3SK3 A;  4DR1 K;  4XIU A;  3MXM A;  2YNH A;  2VCP A;  3OBW A;  4R79 A;  2G8K A;  4OKK A;  1N34 K;  1T3V A;  1VQK N;  1N6Q A;  4YOR A;  3EZ5 A;  2AJQ A;  3HPH A;  1GLL O;  2DFH A;  3WEE A;  2OYQ A;  4OKE A;  3U6F A;  4OLB A;  1YVU A;  2QWM A;  2OPQ A;  2DFF A;  1IO2 A;  3WXI A;  4KRF A;  1NGF A;  4LSN A;  1RDU A;  3J81 O;  4FM0 A;  2V51 B;  4CZE A;  3KK3 A;  3RMB A;  4CZF A;  4K41 A;  4FJI A;  1UA1 A;  4F2S A;  4NXM K;  1VQ8 N;  3TAR A;  2V7Y A;  2YJF A;  1S22 A;  5DK5 A;  2HBJ A;  4DFK A;  4CEB A;  2Q36 A;  3CCS N;  4LF8 K;  4AHR A;  3PX6 A;  1JLB A;  1KAY A;  1C0M A;  3HM9 A;  4B9N A;  3AVB A;  5J2N A;  2PYL A;  4KO0 A;  3PUF A;  4DV6 K;  1MA9 B;  2YKM A;  2VGN A;  4KTZ A;  1KQS M;  3ZT3 A;  4O5B A;  2RKI A;  4NO7 A;  5I9E B;  1NJI O;  1D5A A;  1NGD A;  4X62 K;  5FDL A;  1YJN N;  3D45 A;  3C6U A;  2FBV A;  3NH0 A;  4KFB A;  1RTH A;  3AV9 A;  4PL8 A;  2YNI A;  4DSK A;  3V9X A;  1JXB A;  3WNH A;  3P1G A;  4CZM A;  4CI6 A;  3NGY A;  3L4Q A;  5KGX A;  3C95 A;  3P5J A;  2P9S B;  2YV0 X;  4DTU A;  4FLW A;  2JGU A;  4X66 K;  3CQ8 A;  1WSG A;  1M90 O;  4BRK A;  2Q3S A;  4L8R B;  2UXD K;  3V9S A;  1Q9X A;  3CFO A;  5AQK A;  4J2A A;  2GWJ A;  1IBM K;  1BCO A;  3QIN A;  1RTD A;  3O9Q A;  4JKD A;  3F2K A;  1HNI A;  3QEX A;  3DXM A;  2QM1 A;  1S6P A;  3TAF A;  1A5W A;  3MCP A;  1IJJ A;  3H3N O;  2YHW A;  2HST A;  3CIP A;  1NM1 A;  4JRQ A;  4BRD A;  4CGF A;  2CH5 A;  3OYH A;  1QVG M;  3CCL N;  3BF1 A;  3NH1 A;  5LJV A;  2BH1 A;  3U8X A;  2G8F A;  2CGJ A;  1D9D A;  2O8F A;  3HBT A;  4W5O A;  4Z4C A;  3MX2 A;  2ZF5 O;  4AM7 A;  4CEF A;  4JI6 K;  3HO1 A;  4CZI A;  4YY3 K;  4M7Y A;  1C6V A;  2XY8 A;  1KLN A;  3PX0 A;  4Y1D A;  4IEI A;  4L3Q A;  4DTS A;  1REV A;  1K8K B;  4I6M B;  1LOT B;  2YHX A;  5F0X A;  1XC3 A;  2KQ2 A;  2Z1J A;  3LDS A;  1BQM A;  4CK1 A;  4KHS A;  5BRF A;  3OYI A;  3PO4 A;  4LY7 A;  3PX4 A;  4Z4E A;  3A0I X;  4KRE A;  4FJ9 A;  4DV7 K;  1HPM A;  3ATU A;  4DCH A;  4X64 K;  3CF5 L;  2P9K A;  1YJW N;  2KFN A;  4BGB A;  5BRE A;  4DTP A;  4HWI A;  3QBX A;  1ZBS A;  4IDH A;  4JNE A;  2NRR A;  3HXM A;  3R3L A;  3L2W A;  4ICL A;  1GLE G;  1OH5 A;  5E41 A;  1S9E A;  4KHY A;  4O5F A;  4FLV A;  4OVL A;  2BE2 A;  4HCB A;  2DTU A;  3SJH A;  4FJ8 A;  5M1P A;  5BR9 A;  4BR2 A;  5BPL A;  2QI2 A;  4B3M K;  5C15 A;  4JKE A;  3RVC A;  3WNF A;  2UUC K;  4RW6 A;  2ASM A;  4O8U A;  4GV3 A;  3N4P A;  4Z4G A;  4FWO A;  3DLL L;  2P5O A;  4E89 A;  4DUY K;  5T7B A;  1VAZ A;  5DM7 L;  2BDP A;  4OGE A;  3CCU N;  1RT2 A;  3HL8 A;  4RWT A;  4NCG A;  1KTQ A;  1YTA A;  2F8T A;  4RW9 A;  2A40 A;  2LSN A;  3K9J A;  3VTH A;  1TK8 A;  2UUA K;  3H1Q A;  4H0T B;  1BCM A;  4IO9 L;  3QFU A;  1N33 K;  3WNG A;  5AQH A;  3CJC A;  3T1H K;  3NBP A;  3V9Z A;  1T03 A;  4A61 A;  3HPG A;  1R0A A;  4FLX A;  3I8D A;  1VSM A;  5GIO A;  1C0U A;  3K58 A;  4HUE A;  1HNZ K;  1L5U A;  4MDB A;  1X9M A;  2ZQB A;  3RR8 A;  3SCX A;  3T1A A;  4W5N A;  4N5S A;  3RSE A;  1NK8 A;  2P9P B;  5C0Y A;  4E19 A;  3LDQ A;  1K6Y A;  1SKS A;  3F9M A;  1S3X A;  5ADX H;  1T6C A;  4CK3 A;  3DMJ A;  1EKE A;  4ILG B;  3TAG A;  4FW2 A;  3ULD A;  2HB5 A;  4FVM A;  1KAZ A;  3OYB A;  2PY5 A;  5AZJ B;  2E2P A;  3BY5 A;  4I7F A;  1V4S A;  3L2V A;  3ENB A;  3N4Q A;  1IH7 A;  1ZBH A;  3LWM A;  2Q1N A;  4DTN A;  5HRR A;  3NGI A;  3ZYY X;  5AZI B;  2Q97 A;  2F7T A;  4DFP A;  1I94 K;  5KI6 A;  3H46 O;  4MO5 A;  1WAF A;  3QEP A;  2XRI A;  4FM2 A;  5AQQ A;  4BRI A;  4E3S A;  1TK5 A;  4M42 A;  1YT3 A;  4FJM A;  5JVG L;  4BWJ A;  2O8C A;  4BE1 A;  4FOE A;  4EHU A;  1EP4 A;  5F1X A;  2AP1 A;  3UB5 A;  4BRE A;  4CER A;  4DR2 K;  4AQY K;  5GIN A;  4LF9 K;  5BPM A;  4MLE A;  3TAB A;  2HF4 A;  1FKO A;  3M6G A;  4FYD A;  1XI1 A;  1ZC6 A;  1WUA A;  3UKU A;  4FLU A;  2ZWH A;  1RDB A;  4CJ4 A;  1Z05 A;  1NGE A;  3CMA N;  4E0D A;  1JXE A;  2W6L A;  4KB0 A;  1RBS A;  1Y97 A;  5GAH P;  3DYA A;  4CD1 A;  3TAP A;  4KHW A;  1HRH A;  1BU6 O;  2Y1J A;  2D0C A;  3CYM A;  4IOX A;  4BDP A;  2GV9 A;  2W40 A;  4B9U A;  3KIO A;  1YVN A;  3HVR A;  4M3R A;  2E2O A;  3J80 O;  1GOA A;  2V7Z A;  4H0O A;  1NG9 A;  4LFA K;  4ELV A;  3AAQ A;  3MN9 A;  4K8Z A;  3U9Z A;  4DQI A;  1Z6R A;  3L4I A;  1IBL K;  2PBD A;  3VPZ A;  1HPZ A;  1KVA A;  2F96 A;  4H0V B;  1BA1 A;  4EZ9 A;  1T44 A;  3CJB A;  4DFM A;  3VGM A;  3ZSY A;  4KKO A;  1CZ9 A;  5EXW A;  1TKT A;  3S3N A;  3QFP A;  3NF6 A;  3M8P A;  3OYK A;  2X6S A;  5EX5 A;  1XNQ K;  3WXK A;  4GKJ K;  3CC2 N;  2EX3 A;  4CEA A;  5AQS A;  5HRN A;  4CJ3 A;  4ISG A;  4AHV A;  4CIE A;  4MFB A;  4H0P A;  4I2Q A;  3A5O C;  2YHB A;  4BR9 A;  5AQX A;  4CCH A;  4GMJ B;  1ZXO A;  2ATQ A;  3LP3 A;  3BGR A;  4FWN A;  3SZ2 A;  3KWI A;  4WF9 L;  1J5O A;  3VQC A;  3K5L A;  4E7H A;  1TUY A;  3JSM A;  3CC7 N;  2IIR A;  3HK2 A;  2ITG A;  3JS6 A;  2E6L A;  2HF3 A;  3FZF A;  4C8L A;  4FWQ A;  4XH4 A;  3H1V X;  1GLA G;  2D0B A;  1VQ4 N;  1SL0 A;  3QEV A;  2H3G X;  3NVM A;  3NE6 A;  4B08 A;  4WCE L;  1TYQ A;  4JN4 A;  4E1N A;  4JRP A;  1JLG A;  3MEC A;  2HVI A;  3CPE A;  2IGI A;  1ATR A;  4AHC A;  3C7N A;  4KH6 A;  1LWE A;  4QS8 A;  4C1N K;  5FRN A;  1TL3 A;  3B6O A;  2Y1I A;  4Y0W A;  4DR6 K;  4KTQ A;  3WXL A;  4BQZ A;  1NWK A;  4ZTF A;  4LSL A;  2KHO A;  3TR8 A;  1IG8 A;  3IKM A;  2IAJ A;  4BG8 A;  3CG7 A;  3VQ5 A;  1Q81 O;  1OVQ A;  3ZSO A;  3VA3 A;  2QWO A;  1JL1 A;  4BRC A;  1NGJ A;  2R7Y A;  1UOC A;  3EZW A;  1B9F A;  2OPP A;  3M5R A;  4CF0 A;  3MWT A;  3E1Y A;  3MN5 A;  2QEX N;  3MXJ A;  5AZI A;  2I7N A;  2P9U B;  3HTV A;  3HP9 A;  4CHY A;  3CPW M;  1E4F T;  4CHZ A;  5I3U A;  4KHP K;  4JK7 A;  5C12 A;  4RW4 A;  1VQ5 N;  1HUX A;  4BRF A;  1EO1 A;  2NRZ A;  4ZTJ A;  4EP5 A;  2IOC A;  3WXM B;  4CJU A;  2FSK A;  1VQP N;  4ISE A;  3WXJ A;  4B8A B;  3L3U A;  4IG0 A;  4O0J A;  1Q82 O;  1DTT A;  2JLE A;  4BVO A;  5FPN A;  2VWJ A;  3SBT A;  1JCE A;  4LH4 A;  2G8U A;  3LDL A;  1DTQ A;  2YNG A;  4KHQ A;  4WFB L;  5KQD A;  1VSK A;  2W6K A;  3DRR A;  1QQO A;  3TPQ A;  5M1N A;  1U4B A;  2FC0 A;  4BDZ A;  4HVJ A;  3OYC A;  3SUQ A;  1E3M A;  4FW1 A;  3L6Q A;  2UYT A;  1E4G T;  3PIO L;  2HHW A;  1WN7 A;  3F9K A;  3NMU A;  1NK4 A;  1ZBF A;  3CC4 N;  2HHT A;  3HSC A;  1KC8 O;  1L3T A;  5FRO A;  1JLQ A;  2HVH A;  4ZHR A;  5HLF A;  4FWK A;  4M45 A;  1QS4 A;  4FJG A;  1NOY A;  3I55 N;  4JI2 K;  2Q0R A;  1VSI A;  4Q5V A;  3I33 A;  1RIL A;  4IFY A;  3LPU A;  3THY A;  1KVB A;  3GG4 A;  5LJW A;  3LZI A;  4R5P A;  4FWM A;  4J8F A;  2E4L A;  4CIF A;  1CLQ A;  4QOZ B;  4W5T A;  1IV0 A;  4E1M A;  3E9L A;  4UY8 O;  3ZEU B;  4FJ5 A;  1GLF O;  3FLC O;  3FZM A;  1EXQ A;  4M7X A;  3HYF A;  1D8Y A;  1KAX A;  3UKR A;  1VHX A;  1RGI A;  3OS2 A;  4FJK A;  3VGL A;  1ZBI A;  5BPN A;  1VSF A;  2OCE A;  4FWR A;  4F2R A;  4BRP A;  3ZCM A;  1C1C A;  3M8Q A;  2NRV A;  3ITH A;  3ZSR A;  3QO9 A;  2IVO A;  3VA0 A;  5JMV A;  3S3M A;  3OYL A;  1LWC A;  2QXF A;  3V4I A;  4FM1 A;  3R8E A;  1SL1 A;  3WUH A;  3FFK B;  2CH6 A;  1TVR A;  2KW4 A;  3THX B;  1QQM A;  3G71 N;  1NJX A;  2HNY A;  2NUB A;  1SZ2 A;  3KKS A;  3SUN A;  2VQF K;  3KLF A;  2PFU A;  4F4K A;  3DRS A;  4N56 A;  4HTL A;  4NB4 A;  1X3N A;  4MLH A;  4M3U A;  5J2P A;  2A1S A;  4WYB A;  4OPK A;  3C0B A;  2ITM A;  4FJN A;  4NXN K;  5AQM A;  5C42 A;  5J1E A;  3DI6 A;  2G8H A;  4JHD A;  4PKH A;  3DLH A;  2E2Q A;  1BI4 A;  1K73 O;  4EFH A;  2VG7 A;  4DU1 A;  3O08 A;  4CGG A;  2KZM A;  3K0S A;  1W0H A;  4ID1 A;  2P9I B;  4DTX A;  4MO4 A;  3P4I A;  1KD1 O;  4DMN A;  3AGR A;  2D4W A;  2NRW A;  2QTD A;  3RMD A;  2O4G A;  3SPY A;  1ATN A;  1RT4 A;  3H45 C;  3K5M A;  3PLA A;  2YCH A;  2O8E B;  2GX9 A;  1JLC A;  5KPT A;  4CJV A;  2UU9 K;  4J2D A;  1NKB A;  3CCM N;  4IBN A;  2UXC K;  4FWL A;  3L2U A;  1NGA A;  4WQ5 A;  3QEI A;  2HOE A;  4JI4 K;  1U48 A;  3O1B A;  1X9S A;  5JS1 A;  1VQ9 N;  4C8K A;  4CJL A;  5IT9 O;  3EKS A;  1N5Y A;  5HOO A;  1V4T A;  5C25 A;  1FW6 A;  1TL1 A;  2HMP A;  4CEC A;  4OO1 J;  1RT5 A;  2JWK A;  2OZM A;  2WUS A;  3FR0 A;  4H8K A;  4ID5 A;  4CFC A;  3AVA A;  5EVZ A;  2QWL A;  1D9F A;  2XY6 A;  3CME N;  4LFB K;  3ULE B;  3K5O A;  4F9O A;  4YFU A;  1SKR A;  3MDQ A;  3E9P A;  2A42 A;  1I3A A;  3OJU A;  2E2N A;  3MX5 A;  3RR7 A;  3F5T A;  3THW B;  3GDQ A;  4BDY A;  4BC2 A;  3J7Z O;  4IFE A;  1XMQ K;  2QKB A;  1RT7 A;  3CET A;  2QWR A;  4CZJ A;  2RN2 A;  4AHS A;  4NLB A;  4BRO A;  3TI0 A;  3V9W A;  3DM2 A;  3FE1 A;  4B9Q A;  4CJ5 A;  3LDO A;  4FZY A;  2W42 A;  4CES A;  4CD3 A;  5A2Q O;  3ZT4 A;  3VOV A;  3C6H A;  2VWB A;  4I9Q A;  3ZSW A;  1NK6 A;  1S1V A;  3EE8 A;  3S3O A;  1U2V B;  4IDK A;  1P8Z A;  3ZET B;  3EL2 A;  4QAG A;  3G0Z A;  4BE2 A;  4FK2 A;  3AO5 A;  3VQ6 A;  3MEG A;  4NLC A;  1NJY A;  4LF6 K;  2FXU A;  1RT1 A;  4FJH A;  3ZSQ A;  4LF7 K;  1HQU A;  4DTR A;  1BOT O;  1HYV A;  4FPB A;  5AFU A;  3RWU A;  4QS9 A;  4FSV A;  4IG3 A;  3T7Z A;  3A5M C;  2X78 A;  4KI6 A;  3ENO A;  1TKX A;  3D2F B;  3SMP A;  3U3G A;  2O4I A;  4IOC L;  3GBT A;  2A41 A;  1P90 A;  5F2R A;  4OKJ A;  1T7P A;  3C94 A;  3NFA A;  3AO2 A;  3Q7C A;  4JKB A;  3NHG A;  3CI5 A;  4BR5 A;  5TKW A;  4AHT A;  1ASV A;  4KB1 A;  4JD2 B;  1R59 O;  4CBU A;  3NGZ A;  4DF4 A;  2XY7 A;  1VSD A;  3OY9 A;  3VEX A;  2O8D B;  2HHS A;  1VSJ A;  3VEV A;  5C10 A;  3KK1 A;  4EIA A;  4TSX A;  3OYJ A;  5C24 A;  4B3R K;  4IJN A;  2A6A A;  3S41 A;  4BG9 A;  3ZT2 A;  4DB3 A;  1VQN N;  3LP2 A;  1VRU A;  2GEL A;  2NZT A;  2Z1H A;  3MCA B;  3ASM A;  1NJW A;  3J7Y P;  4KV8 A;  1K8A O;  1GOB A;  3EEQ A;  3EY1 A;  1WSJ A;  3RTV A;  2UUB K;  4C8O A;  4GW6 A;  3KD5 E;  1ZBL A;  2OA8 A;  2GWK A;  4BRA A;  3OYA A;  1X3M A;  2QXL A;  1UWB A;  3O1W A;  5FRM A;  2B6A A;  3SV3 A;  3W3D A;  1FJG K;  3SAH A;  1Z26 A;  1HKC A;  5BN8 A;  1EQY A;  4I2P A;  4M3Y A;  4KH4 A;  4NCB A;  4JI7 K;  2FBT A;  1QSS A;  3MAQ A;  4BC5 A;  4CHP A;  1JL2 A;  5C2D A;  5GAE P;  3PY8 A;  3CJA A;  3I8B A;  1TGO A;  1JJ2 M;  4LF5 K;  5AQV A;  2Q0U A;  1HJR A;  1HJO A;  4YDU C;  3D7E O;  4DU4 A;  3OJS A;  3QB0 A;  1WSF A;  4K25 A;  1O13 A;  2P9S A;  1NGG A;  5BR8 K;  3CCJ N;  1MWK A;  3VEO A;  1YAG A; 
#chains in the Genus database with same CATH homology
 4V19 S;  4JYA K;  4LF7 K;  4X66 K;  4DUY K;  2UU9 K;  4JI2 K;  2UXC K;  2UXD K;  2F4V K;  4X65 K;  4OX9 K;  4DR6 K;  1IBM K;  2UUA K;  4GKK K;  1J5E K;  4JI4 K;  1XMO K;  4JI8 K;  4JI3 K;  3J80 O;  4K0K K;  5IT9 O;  5LMN K;  1N33 K;  4DR1 K;  4LFA K;  3T1H K;  4CVN E;  1N34 K;  4DV0 K;  5IWA K;  4JI5 K;  4DUZ K;  2HHH K;  1IBL K;  2E5L K;  4CW7 B;  4JV5 K;  1HNZ K;  1HNX K;  4JI6 K;  4KHP K;  4YY3 K;  4B3R K;  1N36 K;  3J81 O;  4LFB K;  4NXM K;  4DV3 K;  1XNQ K;  2VQE K;  3J7Y P;  3JAM O;  4GKJ K;  3OTO K;  4DV1 K;  4DR4 K;  4LF8 K;  2UUB K;  4JI0 K;  1N32 K;  1XMQ K;  4DV4 K;  4DV7 K;  4X64 K;  1I94 K;  1HNW K;  4B3S K;  2VQF K;  4DV6 K;  2ZM6 K;  1FJG K;  5LL6 Z;  3J7A P;  4YHH K;  4JI7 K;  5LMU K;  4NXN K;  1XNR K;  5A2Q O;  4B3T K;  4DV2 K;  4LF5 K;  2UXB K;  4X62 K;  1HR0 K;  5FLX O;  4DR3 K;  4LF4 K;  4JI1 K;  4DR5 K;  3T1Y K;  5BR8 K;  4DV5 K;  4B3M K;  4AQY K;  4DR2 K;  5AJ3 K;  4LF6 K;  4LFC K;  2UUC K;  4LF9 K;  1IBK K;  4DR7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...