4DR6K

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr6K00
2UUCK 2UXDK 4JI2K 1J5EK 1N36K 3J80O 2UXBK 4DV6K 4LF6K 5IT9O 2UU9K 4YHHK 4X66K 4DR5K 1XMQK 4LFBK 4JI6K 4DR4K 5IWAK 2VQEK 1XNQK 4AQYK 3T1YK 4GKKK 1IBMK 2UUAK 2ZM6K 3JAMO 5LMUK 4B3RK 1HR0K 4JI1K 4GKJK 2HHHK 5AJ3K 4JI4K 3J81O 1HNXK 4JI8K 1N33K 5BR8K 4DR3K 4DR1K 1I94K 4X64K 1HNWK 4DV1K 4V19S 4X62K 4DR2K 4DUYK 4K0KK 3OTOK 1HNZK 5FLXO 4B3TK 4DV5K 1XNRK 4JYAK 4DV0K 4CVNE 4DV2K 4YY3K 2VQFK 4B3SK 2E5LK 4DV7K 3T1HK 4X65K 4JI5K 5A2QO 2UXCK 4DV4K 3J7YP 4B3MK 4LF5K 1N34K 1IBKK 1FJGK 1XMOK 2UUBK 4OX9K 5LL6Z 3J7AP 4DUZK 4JI7K 4DR6K 4NXNK 4JV5K 4CW7B 4LF4K 5LMNK 4KHPK 4LFAK 2F4VK 4JI0K 4LF9K 4LFCK 4DV3K 1N32K 4NXMK 4DR7K 4JI3K 1IBLK 4LF8K 4LF7K
chains in the Genus database with same CATH superfamily
3SQ0A 3MAQA 4DSFA 3SUNA 1NKCA 3QNNA 2RN2A 5DMRA 4FLTA 4CJ4A 3VQDA 1NGCA 2UXBK 2HHQA 4KREA 4IDKA 4DU4A 1RTIA 1NOZA 4LH5A 2UU9K 4WFNL 3VETA 1QQCA 3I8BA 2IDOA 3DXKB 5AQXA 4DR5K 3KTQA 2VG6A 4JHDA 1VSLA 3K2PA 1YITN 3ULDA 4NLBA 2UUAK 1T05A 2ZGYA 5HRSA 3CPEA 1KLMA 4CEEA 4CERA 3AY9A 3PO4A 2BGGA 1GLEG 1YT3A 1YIJN 3SMSA 4W5RA 3O1BA 4Z4FA 2B4JA 3THXA 3DM2A 4KHQA 1HNXK 3U3GA 1RBUA 5HROA 3C6AA 2ZD1A 3J7ZO 3NH2A 3EL2A 4CBWA 5TKWA 3KHYA 3TAFA 1SL2A 4JYAK 5B8HA 4BDPA 3AVBA 4DV2K 1WSJA 1KD1O 3TSPA 1X3MA 2A5XA 3DOKA 3MCAB 3U4LA 4BRAA 3C94A 4QS8A 3A5NC 3CC7N 4DV4K 3E9OA 3L2RA 4BY9C 4XEIA 4CJLA 3SUPA 1NGJA 4CESA 1UA0A 2D0CA 2HBJA 3CCRN 3FZKA 3MK6A 4FJLA 4DWIA 3LAMA 2P9IA 4MDBA 1EX4A 1VK0A 2A3ZA 2VYPA 3O4QA 3TU5A 3J7AP 4IO8A 3OS1A 4M7YA 3I0RA 1HNIA 4DFMA 2VWKA 4FLYA 1TV6A 4FWSA 4L3QA 4WQ4A 4LF4K 2YNFA 5AZIA 3TTCA 3GOIA 1BDGA 3H46O 2VGMA 4ICLA 5HP1A 3DLRA 4Z94A 1BIZA 2X78A 3LZJA 5BREA 3O3HA 1EWQA 1O1WA 1G15A 3V9SA 2Q97A 4XH5A 4CECA 2B5JA 3CYMA 1N6QA 1ILYA 2CH5A 3LM2A 2E6LA 1RNHA 1SS6A 3NF8A 2QWLA 2ZJQL 3BZCA 4K8ZA 1RFQA 2YCHA 5M1OA 4KH6A 4CK2A 3IMXA 1NWKA 5JS1A 2E1YA 4WF9L 4QAGA 2D5RA 2YHYA 3OYDA 2P9IB 4KHNA 2A42A 2KQ2A 3HO1A 1JLGA 1YTAA 5FPMA 3MN7A 3TI0A 1XNQK 3PV8A 4E1MA 4AHVA 1GLBG 2YKMA 1TYQA 4BRGA 3SJJA 2D0OA 3AO3A 1HR0K 1ZBSA 3K5LA 3HYFA 4FJHA 4CI6A 4CGJA 4CEQA 4H8KA 4PL7A 1ASUA 1WBDA 4FK2A 5AZIB 1OH8A 1YTUA 4EFHA 4KTZA 4HUFA 5F1XA 3OYCA 1I94K 1A5WA 1S9GA 4CZKA 2P9LB 3ZSXA 4JKCA 5CE3A 1YJWN 2NRWA 2O8BB 4JKGA 1JCFA 1C0TA 5LJWA 4CEAA 1IKVA 3DI6A 3M8SA 3U3YA 3T1HK 5A2QO 2P9SA 5HRPA 2QM1A 1RTJA 3MXIA 3LP1A 4O44A 3VPZA 4JNEA 1SAZA 3P39A 1HQEA 1WSEA 2IIRA 3ZX2A 4FSVA 1U4BA 1QQMA 4AM6A 3NGZA 4I2PA 3CJ7A 1QVGM 4OGCA 3IFRA 1VSEA 4IG0A 3KLGA 1TL3A 2YI1A 3LALA 3KKRA 3VEOA 1EXQA 1T8EA 4CFDA 1YJNN 3THWA 4C8LA 4FWRA 1BG3A 2X6NA 1VRTA 4OPKA 2DPNA 3VQEA 4A57A 2V7ZA 4B3OA 4AF1A 1EETA 4IBNA 2P5GA 4OPJA 2O8EB 3U8XA 4Z0UA 3JYTA 1YVUA 4A61A 3LANA 5AQOA 4LF9K 3ENHA 4NXMK 3I55N 4JKFA 5C12A 4FLZA 2Y1JA 2YHBA 4CEFA 1QHTA 4HUEA 2ATQA 4CEOA 1HYVA 2OTJN 4J2AA 3DOLA 3C7NB 3O9QA 3SI6A 3KIOA 3SPYA 2P9SB 3VOVA 5HL7L 2KFNA 3D2EA 4KHYA 4MFBA 1S6PA 2YX6A 3SK3A 4CF9A 4N47A 5BN9A 3CHWA 4AHUA 1JJ2M 2I7PA 3HK2A 1H1VA 4BDYA 2A41A 1A5XA 1TUUA 4CZIA 5JVGL 2O4GA 4MLEA 5T7BA 4NCGA 2FBVA 4JKAA 4IFEA 3BP8A 4BGAA 3P83D 4BE1A 4ISEA 3THWB 1KCFA 3F5TA 2WONA 1BHLA 1Q8IA 3TWHA 1BQNA 3OYNA 2O8DA 4JI8K 4E7IA 4NCAA 4AILC 4A62A 2YHAA 1RTHA 1MWKA 1QQOA 3MWTA 3KLFA 5KGWA 3BDPA 1TKZA 3ALYA 3DLLL 3MMVA 3OHRA 1HPZA 1TKTA 3TR8A 2E8AA 3D2EB 1GLJO 4E1NA 2OTLN 2OPPA 1VAZA 3LPUA 4DTSA 2NRVA 3A2FA 2GV9A 3VEVA 3OYEA 1FK9A 3LAKA 1BUPA 3CETA 2P9KA 4CZJA 3FZMA 1YI2N 2G8IA 3R8EA 1Y64A 4MQ3A 5CY4A 3B8AX 3VTHA 4KHWA 1LWEA 3QETA 3VERA 3K5MA 3S3MA 5EXWA 2KZZA 1UOCA 3R3LA 2O8DB 3LDLA 1BGXT 4E3SA 3D6RA 3HJFA 3KLIA 2HW3A 3CCQN 2E1ZA 4AM7A 3NH1A 3CCUN 1FXXA 4CGIA 1XWLA 4I9QA 3HM8A 1YHQN 1B92A 3T1AA 3G25A 4DQSA 3ISNC 4H0YB 3AVCA 2QTDA 4W5TA 4LF8K 3I56N 4BWJA 4DQ8A 4HUGA 5KTQA 2XY5A 4GVMA 3EE9A 4J2EA 3DMJA 4FZXC 3HT3A 3PO5A 3ZEUB 1BOTO 3VESA 4M3XA 3ZT4A 3M1FA 4N41A 5I42A 1IV0A 4BRCA 5BR9A 4CHPA 2AP1A 2P9KB 5FROA 3V4IA 3O8MA 2EHGA 3VN5A 4GV9A 5KRTA 4AQYK 4KTWA 1K8KA 4H0PA 3NGIA 3VEWA 3KK3A 4A59A 4B3RK 2PYJA 2D1KA 1T6DA 4KTQA 3T19A 1UAXA 1JXBA 3MDQA 3MX5A 4CZLA 4W5NA 3D2FA 4BRDA 3LDPA 3CJAA 5KRSA 1NK6A 4Z4HA 3AO4A 1N33K 4JEPA 4DR1K 3SUOA 4K42A 1XC3A 1U2VA 2A1RA 1V4TA 3KWIA 4CZFA 4B8AB 2GTDA 3OS0A 4ISGA 2BDPA 4BR4A 3C6HA 3VQCA 2RKIA 4W5OA 3WEEA 2DFHA 4A5AA 4EAHD 1HKBA 1VSIA 3U9DA 1WOQA 1NGIA 4M3YA 2G8KA 1Q18A 3BY5A 3OYLA 1R0AA 4RG8A 3O1WA 4FYDA 3DYAA 1VQMN 2P5OA 4CZHA 4KPYA 1U45A 2HHTA 1DGKN 1S1XA 4BR7A 3KD5E 3HXMA 3OY9A 2FSKA 4OKJA 4BRNA 4H4MA 1KVBA 1S6QA 2BTFA 5LMNK 2GBZA 4FM2A 3O3FA 1IG9A 3L3VA 4JI0K 4DQQA 1U2VB 1RGIA 3H6EA 1WSFA 4U7BA 3AARA 3UKRA 3AVJA 2HF3A 4XH4A 3V9WA 3THVA 2OANA 4FJ9A 1KAYA 4CHQA 3M8RA 4FLXA 2W6LA 2HHWA 3CJCA 2QWPA 4LF6K 3O9RA 2X6SA 4NYNA 2KFZA 1ZBFA 4G9ZA 4JKDA 3CFRA 5M1NA 1ITGA 3V1RA 1ESVA 1GOBA 3PY8A 4FK0A 5TKYA 1KXPA 5LMUK 4BG8A 3K5NA 3ID8A 5J2QA 4K8XA 1EQYA 1D4XA 1IKYA 3MWPA 5M1KA 2CGKA 3U6FA 3AO1A 4M45A 4RWTA 3OS2A 3VA3A 1WSIA 5CR4A 3JSMA 2P9UA 5C15A 2UYTA 4EHUA 4DV1K 3O6WA 4FPBA 1Y97A 4IEEA 1JXEA 1R59O 1NGGA 3K9JA 3HSTB 1IKXA 4DKWA 1BCOA 4DV5K 3OBYA 4CJ7A 3QIPA 3OA9A 4QOZB 2VQFK 4CJ5A 4WQ4C 4FW2A 3N4PA 1A5VA 2NNWA 1OKJA 1BO5O 4DB3A 3GL1A 4B9SA 2NUBA 3DRPA 2P51A 3S9HA 3IKMA 4I6MA 1VQ5N 3GDQA 1BI4A 4H5NA 5GINA 2VG5A 5AQMA 3NH0A 4E7HA 4BROA 5D3GA 4CD3A 1XC9A 1RDCA 3AVNA 3CF5L 3RR7A 4Q0BA 3V81A 1HYZA 1Q81O 1X1PA 4AHSA 4OKEA 3NCIA 4NO7A 1J53A 3DWLA 3HP9A 3PX0A 1NJXA 1HYSA 3RRGA 4DTJA 4ISFA 1NOYA 2GWJA 4JKHA 3LDQA 2P9UB 5J2NA 3VQ5A 2FSNA 3DXKA 1S3XA 4FLWA 2Q1NA 1YAGA 3TAPA 4UY8O 4FW1A 3ZSOA 4CJKA 4DSLA 1HKGA 1NGHA 4E1JA 3ITHA 4JI2K 3VENA 3VQ8A 4HTUA 3Q7CA 3O80A 3HPOA 1ASVA 1C6VA 2ITMA 4BRKA 1NGDA 2F7TA 3I33A 1NKEA 4HCCA 1GOAA 3CCSN 3UB5A 4JI6K 1JLQA 1VQ7N 3EO3A 4XIUA 3RVCA 4YOTA 3QDKA 4PKGA 4O4GA 3T1YK 5GAHP 5I9EB 2F96A 3DRRA 1VQ8N 3G4SN 2F9WA 2NRTA 2NRZA 3WQTA 2EX3A 2YNHA 5BPLA 3SV3A 4WYBA 4C23A 1DLOA 3J81O 1MA9B 4E7JA 4AH9A 4IKFA 1RT6A 4E89A 3M6GA 3LL3A 3FLCO 4RTFD 1L5UA 4V19S 1SUQA 4K0KK 4LSLA 4N56A 4OO1J 2OA8A 3MXMA 3SBGA 1T7PA 3IG1A 2J4RA 4FWMA 5KI6A 4O8KA 1RT2A 3HRGA 4Y0WA 1VSHA 4DTNA 3HOTA 1TVRA 3CD6N 4O5FA 2DFFA 3AVAA 3P1GA 1S9EA 1X3NA 1W2BM 1JL2A 1NJZA 3SJHA 3S3NA 5LL6Z 3TPQA 1FKOA 4BR2A 4CJEA 4BGBA 4FJKA 3W3DA 1D5AA 1QHAA 1WAFA 1ZYQA 2W42A 2Z1JA 2OZMA 5AFUA 4FK4A 4CHYA 1C1AA 4C8OA 1T6CA 4CFCA 3HZ6A 4DCHA 2E2PA 4BC3A 5BRDA 3CM5A 3OJUA 1RT3A 1QSSA 2QXFA 4OLAA 2NRHA 4ELVA 4FJNA 3AV9A 1N36K 1EP4A 5AQUA 3R9PA 1SKWA 5AQIA 3DLHA 4H5WA 5IT9O 4DTUA 2A6AA 3QEXA 2OPQA 4PUOA 4X66K 1OVQA 2KKZA 2FLOA 2FBTA 1KFSA 1KFDA 3NF7A 2YNIA 2VWJA 4L8RB 4H03B 2VG7A 4C8KA 1C1BA 3C65A 3AA5X 2HB5A 3C95A 3G71N 2P9LA 1NG9A 1EKEA 5CYQA 4JRPA 5EY4A 2O8BA 1I39A 3MEDA 3GE1A 4JI4K 4M3WA 4DTMA 3SNNA 3HL8A 5BR8K 3P4IA 5AQWA 3EEQA 5KQ8A 4X64K 4C1NK 1HNWK 2HHVA 1VQ6N 3ZT0A 3CCMN 3TAQA 5J2MA 3TAEA 4BR0A 5FLXO 1QVFM 1HX1A 3TSUA 1EO1A 1EWRA 3S41A 1GLAG 2ZGZA 1RBVA 4B9QA 3DLBA 3CMAN 2HSTA 2HNDA 4OLBA 1VSFA 4A2AA 3TABA 3RR8A 2O8EA 4MO4A 4C8MA 2I5JA 2LSNA 3LP0A 4FM0A 1BA1A 3K5OA 4JI7K 3C6TA 3NVMA 4KO0A 4B8CA 3R6MA 3C7NA 4M3RA 5JLFA 2RE2A 3H3NO 1LWCA 3LM9A 4Z4GA 2ITGA 4RW9A 3OJSA 3VEXA 1D9FA 1QSYA 4FXDA 3VEYA 4B1ZA 4M3UA 4JI3K 5J2PA 3ZSYA 3KLEA 3SMPA 1WAJA 5AQTA 4KI4A 2FF3B 4G1QA 2E2NA 1OH6A 5AFUH 1X9JA 4CF8A 1OVYA 5C25A 3SAHA 1QZ5A 3TTFA 1YVNA 1XQSC 1KRPA 3EKSA 4AHTA 4CE9A 5AQZA 3SQ1A 3TTDA 5AQRA 3IAYA 2KZMA 1IBMK 4DF8A 2P9PB 3H1QA 4FJXA 3JAMO 1TL1A 1G99A 3F2KA 2V51B 4FM1A 2PBDA 1HQUA 3F73A 2RF2A 3D7EO 1YJ9N 3WNFA 2A1SA 4LH4A 4IZ9A 1NK9A 1NMNA 2WBNA 4WFBL 4O0IA 3CPWM 4HWIA 5EX5A 1Z26A 1OH5A 4IEIA 3QFPA 4A2BA 3ZETA 4B9TA 1YXQA 1E4GT 2VCPA 4YOYA 3WNEA 4BREA 3H08A 4DV0K 4DMNA 1U47A 4DV7K 2HF4A 1U48A 1DTTA 2XO7A 1REVA 3H1VX 4Q5VA 4HVJA 1KVAA 1KAXA 1WNSA 3ENOA 3MECA 3QB0A 4IFVA 2NZTA 1RDAA 3RTVA 2UUBK 2GUIA 4FWKA 2RPIA 4B08A 3K0SA 3QMLA 2E2QA 4CJRA 2QW9A 3CMEN 4KRFA 2Q3SA 5J1EA 4NXNK 4DF4A 1CXQA 1DTQA 2CGLA 3TSQA 3CM6A 2HBLA 2QI2A 3ZEUA 1RT4A 4LC9B 4B1VA 4K43A 4LSNA 5KGXA 3MCPA 1Q86O 5C10A 3ZETB 5AQYA 4DR7K 3EY1A 3HSCA 3CCLN 3A0IX 1LAWA 3HPHA 3PLAA 1CLQA 1VRUA 3CI5A 1HKCA 1NK8A 1K9MO 4FLVA 4ILGB 3L0QA 4DTOA 5JMVA 1V4SA 5C24A 3ZT2A 4DSEA 1CZ9A 4OVLA 2RHKA 1NK4A 1Q7YO 2X74A 1NM1A 2ZQBA 4CJWA 3PUFA 2EWSA 4JK8A 4EP5A 3HVTA 4H0OA 2VQEK 3WXJA 4CJPA 3VTIA 4FJ5A 2D0BA 4I9LA 3VF6A 3A5MC 1W0HA 3VEZA 4EZ9A 4CJ3A 3NBPA 3DJCA 5KPZA 4DTXA 3DLEA 3V9XA 4GV3A 5M1PA 4CZMA 2WC9A 5BN8A 1MDUB 1L3TA 4CCHA 5ADXA 1S5JA 4B1YB 4X62K 4B1WB 4Z4EA 3IRXA 2Z1HA 2QWNA 3NF9A 2QK9A 1QE1A 1K8AO 1J9AA 1D9DA 3BEXA 3BUZB 1M90O 3AAQA 4O8UA 4BE0A 3L4QA 1RILA 1TK8A 3NGYA 1NJYA 2QEXN 1T03A 1NK7A 2ZJPL 1FJGK 1ASWA 1ZBIA 3HBTA 2FSJA 2WTUA 1N5YA 4F4KA 3EN9A 4CBUA 2O8FA 4J2DA 2JWLA 1Z05A 4F2SA 1ZBLA 1QSLA 3EYZA 4FO0A 1SQKA 1D8YA 1C0GA 3T69A 4GV6A 5E26A 5EU7A 4E0DA 4JV5K 3F9MA 3P5JA 3CJ9A 1LWFA 3FR0A 3H3OB 4DFPA 1UWBA 4NCBA 5AQHA 3T7ZA 2ZE2A 2F4VK 3I0SA 2CH6A 3ULEA 1VQ9N 1VSMA 3KD1E 1OH7A 4KBOA 4CJSA 3NE6A 1RDUA 3LP2A 4H5TA 3SLCA 1KAZA 3NVKA 3KZBA 1S72N 1Q82O 4KB1A 4I7FA 1B9FA 1NKBA 3CJ1A 5BRFA 2O8FB 4EIAA 4B1UB 4CHZA 2YV0X 3B6PA 3WT0A 4F8RA 4RW6A 2IOCA 3RMAA 3CFOA 4FJIA 3AGKA 2V52B 3AAPA 5AQLA 3ULEB 3NAEA 3E66A 2G8VA 2G8UA 5AQVA 1P8ZA 2OCEA 5GADP 4B9VA 2FC0A 1KTQA 4B3TK 4ZHRA 4IJNA 2XY6A 1WB9A 4CVNE 3ZYYX 2P9NA 4YDUA 1SV5A 4BQLA 4FOEA 3KKSA 1HUXA 1JKHA 3RMDA 1N34K 3RSEB 1GLFO 3K57A 3NDKA 1J54A 3IUCA 4PA1A 5AR0A 3J8AA 2VWBA 4J8FA 5HLFA 1SKSA 4CZGA 4DQPA 4FOIA 4N5SA 1WSGA 5GAGP 3QBWA 1F21A 4GNIA 4CHNA 4BACA 5C42A 2OZSA 1SZ2A 4FJ7A 4DTRA 1I3AA 3CG7A 1IKWA 1SL0A 2ETJA 3OYKA 3ZCMA 5C0YA 3AVIA 4WE1A 2P9NB 4FPAA 3K58A 3CC4N 4K41A 4C1NI 1X9WA 2G8FA 3KK1A 3KK7A 3LDSA 3OW2M 3L6QA 3OYAA 3QIOA 4CF2A 1VQPN 4IOAL 3D0PA 4KFBA 2I7NA 3QEPA 2HHSA 1WSHA 3IDHA 3AGRA 3FZLA 2IVPA 4GMJB 4DR4K 5LY3A 3L3UA 3WQUA 5BRHA 4CK3A 1JLEA 4C8NA 1QS4A 4O0JA 5GAEP 3OYBA 1XUPO 2Z1GA 3K9KA 4FJJA 1KC8O 1ZC6A 2ASPA 5CZ1A 3ZSVA 4JI1K 4ZTJA 3MN5A 2JLEA 4YOUA 5AJ3K 1NK5A 3VQ6A 4JK9A 3AA2A 1CXUA 4YOXA 5CZ2A 1L3UA 4KI6A 3MXJA 1ZXOA 5BPNA 1RCHA 4H0TB 4ID1A 1X9SA 3F9KA 4GVEA 1GLCG 2YJFA 2Q0UA 2PY5A 1TUYA 1JLBA 2E5LK 2Q2RA 4CIEA 4YFUA 3DRSA 1IBKK 3AVLA 4H0XB 3GG4A 1UA1A 2KTQA 2O8CA 4U67L 5FRMA 4M7XA 2GUPA 3HM9A 1TAQA 3SPZA 3LPTA 4GY2B 4M3ZA 4KV8A 3HOSA 3CCJN 3E9PA 1U6ZA 4K25A 2HNZA 3ASMA 3WXKA 3AVMA 3EZ5A 4FWOA 4CEZA 5AZJB 1DEJA 4JS5A 3PX4A 4CJQA 5FDLA 3SQ4A 5HRNA 2FBXA 3QEVA 2YHWA 4KB0A 1NMDA 4B9NA 4IXCA 4H5VA 1W7AA 4ID5A 4EHTA 4DS4A 1VSDA 1Q9YA 3VQ9A 1U49A 3VF2A 4BQZA 1NLVA 2PAVA 3MN9A 4R79A 4DQRA 4FVMA 4DV6K 2KW4A 2PYLA 2O8CB 3HI0A 2QWRA 1VHXA 4O5BA 1C0FA 1XMQK 4PL8A 4MO5A 4IDHA 5JLHA 4YOWA 2WOMA 1HJOA 2B6AA 3VQ7A 1BIUA 5AQFA 1LAVA 3LDNA 3UE5A 3PX6A 3MX2A 3L2QA 1BQMA 3SBTA 4B9MA 3TAMA 2D0AA 3ATVA 4AHRA 4WFAL 4OGEA 4B9LA 4CJFA 4KH4A 2HMPA 5JS2A 2IAJA 4Y1CA 3EZWA 4JHDB 1WLJA 1LOTB 4DR3K 3E9LA 3OYJA 1GLDG 3FZFA 1NGBA 2HBMA 4FZYA 3SYZA 1NGFA 3VF4A 5AQPA 4CJUA 1WBBA 2HHXA 3ID6A 4Y1DA 2QWMA 2PZSA 1TK5A 5C2DA 1JCEA 4KKOA 4JS4A 3THXB 4BVPA 3OYMA 3T3FA 2XY8A 2Q0RA 3QBXA 3QESA 1NGEA 2BANA 5KPTA 3O9UA 4KH5A 4DFKA 5LJVA 3DXMA 5AQGA 1LV5A 2YKNA 3CCVN 5CYMA 3EKUA 3QINA 3SAFA 1NK0A 4BDZA 2BUPA 3VQPA 4CFBA 4DU3A 3LWLA 4M63C 4OJRA 5DK5A 4XH1A 4ELTA 3L2WA 5FPEA 3R1XA 4ELUA 4HCBA 2AJQA 4WCEL 4KHPK 1WUAA 4BR9A 2W41A 3VGMA 4CJTA 1YUWA 5HRRA 4JLHA 4DV3K 1N32K 3UIQA 3M8QA 2V7YA 3DAWA 2QWOA 3FGUA 2UXDK 2P9PA 1NJIO 4CGFA 1KQSM 4B9UA 4CF0A 3FZHA 5C2FA 1QQNA 3OYIA 1BU6O 3O5BA 4CEBA 3OYGA 4BC4A 3AVGA 3EE8A 3LP3A 1BWFO 3DXMB 3FFKB 3HVRA 1RT5A 5AQJA 1L3SA 4EZ6A 3CC2N 1O13A 1IG8A 3L4IA 1HNVA 1IO2A 1KSPA 3ATUA 3CJBA 1ATSA 2HMIA 4FVUA 2ZM6K 1HLUA 4ILHA 3TANA 2F8TA 3KJVA 4FJGA 1TAUA 3QO9A 1XHXA 3MEGA 4CK1A 1N8RO 4M42A 1J6ZA 4YORA 5FRNA 4E19A 4IFYA 2HHUA 3OVNA 1RT7A 3ZSRA 4DTPA 3O4WA 1VQNN 5E84A 5FPDA 4IWVA 4FWNA 4M3TA 1E4FT 3WXMB 2Y1IA 4DR2K 1S1VA 4DUYK 1TYQB 5F2RA 1MU2A 1S1WA 4YNQA 1T3VA 2YJEA 3V9ZA 1B9DA 4CGGA 1XHZA 1T44A 3E01A 4BWMA 4IOCL 3WUHA 2D4WA 3V9UA 4WQ5C 1GOCA 3DLGA 3PSFA 4A5BA 4N76A 4OKKA 3G10A 4NB4A 4JRQA 3HTVA 3CQYA 5EOYA 2YHXA 2F9TA 3ZSWA 4PKHA 2FF6A 1X9MA 4JKGB 4GW6A 1K73O 3WNHA 4RW7A 4JKEA 1RTDA 4DR6K 4KHUA 3RWUA 1J5OA 1QZ6A 2IC3A 3KVGA 4IJAA 4HHTA 5AQKA 5H1SQ 1ZBUA 4BE2A 2GWKA 3QNOA 3JXUA 3CCEN 5M1FA 1C1CA 1TKXA 3A8YA 3AO5A 4PY5A 1VQKN 2NRRA 4LFCK 4ILJA 4F2RA 3ENBA 1IBLK 3AVHA 3DLKA 4O55A 1L3VA 1NGAA 4FJMA 1J5EK 2ZJRL 1LW0A 1HPMA 4DG1A 3K59A 5GIPA 4DQIA 3SQ2A 1DT9A 3L2UA 3NHGA 4DSKA 4LD0A 3RMBA 1W9HA 4DU1A 4UQGA 1HMVA 1IH7A 3ZSZA 3CERA 3BF3A 3V6DA 2FXUA 3KWGA 3VGLA 4QS7A 4YDUC 4CEDA 3CXCM 3KK2A 5K14A 2GELA 1Z25A 3VQAA 4DHYA 3S3OA 2XHBA 3VQ4A 2DFEA 1WN7A 2HHHK 2QKKA 1TGOA 3FE1A 3WXLA 1K6YA 4B1XB 2E20A 2P1JA 3QLHA 2QWQA 3PIOL 2E4LA 4DLGA 2YNGA 2HOEA 3OTOK 3KLHA 1ZBHA 3JS6A 4FL9A 2BE2A 2ZF5O 3PIPL 3TARA 4H5RA 1KLNA 4Z4IA 5F0XA 2Z1IA 1DKGD 3CQXA 4NLCA 4JN4A 3OYFA 2NRXA 4HTLA 2KLAA 1RDWX 5SZTA 1BA0A 1FKPA 5HOOA 4I2QA 4CFAA 4CHOA 1XMOK 3CQ8A 2G8WA 4F9OA 5I3UA 4CIGA 3TAGA 3O08A 1S1UA 1VQLN 1S1TA 4IOXA 2GEMA 2WUSA 5DM7L 3L2VA 2W6KA 1ATNA 3MEEA 5CHIA 3W0LA 1SKRA 4BRMA 1JCGA 4CW7B 3CFPA 4H0VB 1FW6A 4EP4A 3O9TA 4JD2A 4RW8A 2DTUA 3SUQA 4MDAA 3NFAA 2G8HA 5KPRA 2R7YA 5AQSA 4BRHA 4JAXA 2Q31A 4FWPA 2UUCK 4PQUA 1BL3A 1C0UA 3FFIA 4J2BA 2O4IA 2JGUA 3QICA 1BISA 2XRIA 5AQNA 1JLAA 5FPNA 3J80O 1RDBA 3OYHA 3GBTA 4PKIA 3ZLJA 4KAZA 4YHHK 2OPRA 3QEWA 4LFBK 4WQ5A 2HVIA 3P31A 5IWAK 3VA0A 3V1QA 3C6UA 4DS5A 4GKKK 3E1YA 3WNGA 4QS9A 4IO9L 1MWMA 1NBWA 1VQ4N 3M3ZA 3QEIA 4PHTX 4GKJK 1VSJA 2IGIA 3A5OC 2CGJA 5HBMA 1GLLO 4JD2B 4W5QA 2IS3A 3WXIA 3U9ZA 1LW2A 3G6EN 3RSEA 1IJJA 2NLXA 5SWMA 4IG3A 1RBTA 4DSIA 3BZKA 3HPGA 1K8KB 2A40A 4CF1A 1HNZK 2HBKA 3HP6A 1XNRK 5M1QA 4YY3K 3D2FB 1TKDA 2HVHA 5KQDA 4X65K 4JI5K 2UXCK 3J7YP 4F3OA 4B3MK 3UKUA 4BRFA 4LF5K 3OBWA 1W97L 5ELZA 3SCXA 3PSIA 2AA4A 1HJRA 3H45C 3O9SA 1RDDA 4FWQA 4OX9K 3O3GA 3RRHA 4BRPA 4YOVA 4DFJA 4CBXA 4FJ8A 2E2OA 3WEEB 2KHOA 1NU0A 3D45A 3SAGA 4MLHA 4FLUA 3IS9A 1E3MA 3SV4A 1QTMA 1TK0A 4DLEA 4BC2A 3RMCA 5ADXH 3NF6A 4LFAK 5E41A 1SL1A 2F8SA 4BC5A 5MLCQ 1RBRA 3ZT1A 1RBSA 3ZX0A 2QKBA 3THYA 1U04A 2FBYA 4LF7K 1VSKA 1XI1A 4LY7A 5AQQA 3LWMA 3V1OA 1CZAN 4NYFA 3LZIA 3P38A 4QCLA 4CZEA 3UKUB 3BGRA 4CIFA 2PFUA 4E7KA 4RW4A 3C0BA 4BRQA 4KHSA 2E6MA 3AA3A 2BH1A 3ZX3A 1VQON 4RCHA 4H4OA 3UKRB 4R5PA 3VMFB 3QERA 1NJWA 1ATRA 3AVFA 4BRIA 3B6OA 1CZBA 4Z4CA 3Q7BA 2OPSA 3AO2A 2XY7A 3M8PA 4CGHA 2IVNA 3BF1A 3L8BA 4FZZA 3QFUA 3ZSQA 4M41A 3O4NA 3I8DA 2JWKA 4CGDA 2VGNA 5EVZA 5GIOA 4BVOA 3SZ2A 1P90A 4CJVA 1KVCA 5JVHL 4E7LA 1S22A 4BG9A 3CIPA 4BRLA 2Q36A 3THYB 1JLCA 4DSJA 5DM6L 3AA4A 2W40A 2ASMA 2WFBA 4OPHA 5JICA 3M5RA 1NNEA 1YF5L 3VGKA 4B3SK 4CD1A 2QA4N 1M1KO 3ZT3A 1JL1A 2GX9A 2ZWHA 3N4QA 1BCMA 2D0PA 2OYQA 5AZJA 4JK7A 2DY4A 2ASOA 3LDOA 3VQQA 2H3GX 2QXLA 3MN6A 1RT1A 4FCYA 4AHCA 4ZTFA 1HRHA 4DUZK 3VQBA 4BR5A 4F3TA 3A5LC 2HNYA 4FWLA 2IVOA 4OPAA 3G0ZA 1JLFA 5BPMA 2E88A 1Z6RA 4I6MB 1LCUA 4PWDA 1BI4B 4TSXA 1Q9XA 1C0MA 3AVKA 3NMUA 4JKBA
chains in the Genus database with same CATH topology
2UUCK 2UXDK 4JI2K 1J5EK 1N36K 3J80O 2UXBK 4DV6K 4LF6K 5IT9O 2UU9K 4YHHK 4X66K 4DR5K 1XMQK 4LFBK 4JI6K 4DR4K 5IWAK 2VQEK 1XNQK 4AQYK 3T1YK 4GKKK 1IBMK 2UUAK 2ZM6K 3JAMO 5LMUK 4B3RK 1HR0K 4JI1K 4GKJK 2HHHK 5AJ3K 4JI4K 3J81O 1HNXK 4JI8K 1N33K 5BR8K 4DR3K 4DR1K 1I94K 4X64K 1HNWK 4DV1K 4V19S 4X62K 4DR2K 4DUYK 4K0KK 3OTOK 1HNZK 5FLXO 4B3TK 4DV5K 1XNRK 4JYAK 4DV0K 4CVNE 4DV2K 4YY3K 2VQFK 4B3SK 2E5LK 4DV7K 3T1HK 4X65K 4JI5K 5A2QO 2UXCK 4DV4K 3J7YP 4B3MK 4LF5K 1N34K 1IBKK 1FJGK 1XMOK 2UUBK 4OX9K 5LL6Z 3J7AP 4DUZK 4JI7K 4DR6K 4NXNK 4JV5K 4CW7B 4LF4K 5LMNK 4KHPK 4LFAK 2F4VK 4JI0K 4LF9K 4LFCK 4DV3K 1N32K 4NXMK 4DR7K 4JI3K 1IBLK 4LF8K 4LF7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC K;  2UXD K;  4JI2 K;  1J5E K;  1N36 K;  3J80 O;  2UXB K;  4DV6 K;  4LF6 K;  5IT9 O;  2UU9 K;  4YHH K;  4X66 K;  4DR5 K;  1XMQ K;  4LFB K;  4JI6 K;  4DR4 K;  5IWA K;  2VQE K;  1XNQ K;  4AQY K;  3T1Y K;  4GKK K;  1IBM K;  2UUA K;  2ZM6 K;  3JAM O;  5LMU K;  4B3R K;  1HR0 K;  4JI1 K;  4GKJ K;  2HHH K;  5AJ3 K;  4JI4 K;  3J81 O;  1HNX K;  4JI8 K;  1N33 K;  5BR8 K;  4DR3 K;  4DR1 K;  1I94 K;  4X64 K;  1HNW K;  4DV1 K;  4V19 S;  4X62 K;  4DR2 K;  4DUY K;  4K0K K;  3OTO K;  1HNZ K;  5FLX O;  4B3T K;  4DV5 K;  1XNR K;  4JYA K;  4DV0 K;  4CVN E;  4DV2 K;  4YY3 K;  2VQF K;  4B3S K;  2E5L K;  4DV7 K;  3T1H K;  4X65 K;  4JI5 K;  5A2Q O;  2UXC K;  4DV4 K;  3J7Y P;  4B3M K;  4LF5 K;  1N34 K;  1IBK K;  1FJG K;  1XMO K;  2UUB K;  4OX9 K;  5LL6 Z;  3J7A P;  4DUZ K;  4JI7 K;  4DR6 K;  4NXN K;  4JV5 K;  4CW7 B;  4LF4 K;  5LMN K;  4KHP K;  4LFA K;  2F4V K;  4JI0 K;  4LF9 K;  4LFC K;  4DV3 K;  1N32 K;  4NXM K;  4DR7 K;  4JI3 K;  1IBL K;  4LF8 K;  4LF7 K; 
#chains in the Genus database with same CATH topology
 3SQ0 A;  3MAQ A;  4DSF A;  3SUN A;  1NKC A;  3QNN A;  2RN2 A;  5DMR A;  4FLT A;  4CJ4 A;  3VQD A;  1NGC A;  2UXB K;  2HHQ A;  4KRE A;  4IDK A;  4DU4 A;  1RTI A;  1NOZ A;  4LH5 A;  2UU9 K;  4WFN L;  3VET A;  1QQC A;  3I8B A;  2IDO A;  3DXK B;  5AQX A;  4DR5 K;  3KTQ A;  2VG6 A;  4JHD A;  1VSL A;  3K2P A;  1YIT N;  3ULD A;  4NLB A;  2UUA K;  1T05 A;  2ZGY A;  5HRS A;  3CPE A;  1KLM A;  4CEE A;  4CER A;  3AY9 A;  3PO4 A;  2BGG A;  1GLE G;  1YT3 A;  1YIJ N;  3SMS A;  4W5R A;  3O1B A;  4Z4F A;  2B4J A;  3THX A;  3DM2 A;  4KHQ A;  1HNX K;  3U3G A;  1RBU A;  5HRO A;  3C6A A;  2ZD1 A;  3J7Z O;  3NH2 A;  3EL2 A;  4CBW A;  5TKW A;  3KHY A;  3TAF A;  1SL2 A;  4JYA K;  5B8H A;  4BDP A;  3AVB A;  4DV2 K;  1WSJ A;  1KD1 O;  3TSP A;  1X3M A;  2A5X A;  3DOK A;  3MCA B;  3U4L A;  4BRA A;  3C94 A;  4QS8 A;  3A5N C;  3CC7 N;  4DV4 K;  3E9O A;  3L2R A;  4BY9 C;  4XEI A;  4CJL A;  3SUP A;  1NGJ A;  4CES A;  1UA0 A;  2D0C A;  2HBJ A;  3CCR N;  3FZK A;  3MK6 A;  4FJL A;  4DWI A;  3LAM A;  2P9I A;  4MDB A;  1EX4 A;  1VK0 A;  2A3Z A;  2VYP A;  3O4Q A;  3TU5 A;  3J7A P;  4IO8 A;  3OS1 A;  4M7Y A;  3I0R A;  1HNI A;  4DFM A;  2VWK A;  4FLY A;  1TV6 A;  4FWS A;  4L3Q A;  4WQ4 A;  4LF4 K;  2YNF A;  5AZI A;  3TTC A;  3GOI A;  1BDG A;  3H46 O;  2VGM A;  4ICL A;  5HP1 A;  3DLR A;  4Z94 A;  1BIZ A;  2X78 A;  3LZJ A;  5BRE A;  3O3H A;  1EWQ A;  1O1W A;  1G15 A;  3V9S A;  2Q97 A;  4XH5 A;  4CEC A;  2B5J A;  3CYM A;  1N6Q A;  1ILY A;  2CH5 A;  3LM2 A;  2E6L A;  1RNH A;  1SS6 A;  3NF8 A;  2QWL A;  2ZJQ L;  3BZC A;  4K8Z A;  1RFQ A;  2YCH A;  5M1O A;  4KH6 A;  4CK2 A;  3IMX A;  1NWK A;  5JS1 A;  2E1Y A;  4WF9 L;  4QAG A;  2D5R A;  2YHY A;  3OYD A;  2P9I B;  4KHN A;  2A42 A;  2KQ2 A;  3HO1 A;  1JLG A;  1YTA A;  5FPM A;  3MN7 A;  3TI0 A;  1XNQ K;  3PV8 A;  4E1M A;  4AHV A;  1GLB G;  2YKM A;  1TYQ A;  4BRG A;  3SJJ A;  2D0O A;  3AO3 A;  1HR0 K;  1ZBS A;  3K5L A;  3HYF A;  4FJH A;  4CI6 A;  4CGJ A;  4CEQ A;  4H8K A;  4PL7 A;  1ASU A;  1WBD A;  4FK2 A;  5AZI B;  1OH8 A;  1YTU A;  4EFH A;  4KTZ A;  4HUF A;  5F1X A;  3OYC A;  1I94 K;  1A5W A;  1S9G A;  4CZK A;  2P9L B;  3ZSX A;  4JKC A;  5CE3 A;  1YJW N;  2NRW A;  2O8B B;  4JKG A;  1JCF A;  1C0T A;  5LJW A;  4CEA A;  1IKV A;  3DI6 A;  3M8S A;  3U3Y A;  3T1H K;  5A2Q O;  2P9S A;  5HRP A;  2QM1 A;  1RTJ A;  3MXI A;  3LP1 A;  4O44 A;  3VPZ A;  4JNE A;  1SAZ A;  3P39 A;  1HQE A;  1WSE A;  2IIR A;  3ZX2 A;  4FSV A;  1U4B A;  1QQM A;  4AM6 A;  3NGZ A;  4I2P A;  3CJ7 A;  1QVG M;  4OGC A;  3IFR A;  1VSE A;  4IG0 A;  3KLG A;  1TL3 A;  2YI1 A;  3LAL A;  3KKR A;  3VEO A;  1EXQ A;  1T8E A;  4CFD A;  1YJN N;  3THW A;  4C8L A;  4FWR A;  1BG3 A;  2X6N A;  1VRT A;  4OPK A;  2DPN A;  3VQE A;  4A57 A;  2V7Z A;  4B3O A;  4AF1 A;  1EET A;  4IBN A;  2P5G A;  4OPJ A;  2O8E B;  3U8X A;  4Z0U A;  3JYT A;  1YVU A;  4A61 A;  3LAN A;  5AQO A;  4LF9 K;  3ENH A;  4NXM K;  3I55 N;  4JKF A;  5C12 A;  4FLZ A;  2Y1J A;  2YHB A;  4CEF A;  1QHT A;  4HUE A;  2ATQ A;  4CEO A;  1HYV A;  2OTJ N;  4J2A A;  3DOL A;  3C7N B;  3O9Q A;  3SI6 A;  3KIO A;  3SPY A;  2P9S B;  3VOV A;  5HL7 L;  2KFN A;  3D2E A;  4KHY A;  4MFB A;  1S6P A;  2YX6 A;  3SK3 A;  4CF9 A;  4N47 A;  5BN9 A;  3CHW A;  4AHU A;  1JJ2 M;  2I7P A;  3HK2 A;  1H1V A;  4BDY A;  2A41 A;  1A5X A;  1TUU A;  4CZI A;  5JVG L;  2O4G A;  4MLE A;  5T7B A;  4NCG A;  2FBV A;  4JKA A;  4IFE A;  3BP8 A;  4BGA A;  3P83 D;  4BE1 A;  4ISE A;  3THW B;  1KCF A;  3F5T A;  2WON A;  1BHL A;  1Q8I A;  3TWH A;  1BQN A;  3OYN A;  2O8D A;  4JI8 K;  4E7I A;  4NCA A;  4AIL C;  4A62 A;  2YHA A;  1RTH A;  1MWK A;  1QQO A;  3MWT A;  3KLF A;  5KGW A;  3BDP A;  1TKZ A;  3ALY A;  3DLL L;  3MMV A;  3OHR A;  1HPZ A;  1TKT A;  3TR8 A;  2E8A A;  3D2E B;  1GLJ O;  4E1N A;  2OTL N;  2OPP A;  1VAZ A;  3LPU A;  4DTS A;  2NRV A;  3A2F A;  2GV9 A;  3VEV A;  3OYE A;  1FK9 A;  3LAK A;  1BUP A;  3CET A;  2P9K A;  4CZJ A;  3FZM A;  1YI2 N;  2G8I A;  3R8E A;  1Y64 A;  4MQ3 A;  5CY4 A;  3B8A X;  3VTH A;  4KHW A;  1LWE A;  3QET A;  3VER A;  3K5M A;  3S3M A;  5EXW A;  2KZZ A;  1UOC A;  3R3L A;  2O8D B;  3LDL A;  1BGX T;  4E3S A;  3D6R A;  3HJF A;  3KLI A;  2HW3 A;  3CCQ N;  2E1Z A;  4AM7 A;  3NH1 A;  3CCU N;  1FXX A;  4CGI A;  1XWL A;  4I9Q A;  3HM8 A;  1YHQ N;  1B92 A;  3T1A A;  3G25 A;  4DQS A;  3ISN C;  4H0Y B;  3AVC A;  2QTD A;  4W5T A;  4LF8 K;  3I56 N;  4BWJ A;  4DQ8 A;  4HUG A;  5KTQ A;  2XY5 A;  4GVM A;  3EE9 A;  4J2E A;  3DMJ A;  4FZX C;  3HT3 A;  3PO5 A;  3ZEU B;  1BOT O;  3VES A;  4M3X A;  3ZT4 A;  3M1F A;  4N41 A;  5I42 A;  1IV0 A;  4BRC A;  5BR9 A;  4CHP A;  2AP1 A;  2P9K B;  5FRO A;  3V4I A;  3O8M A;  2EHG A;  3VN5 A;  4GV9 A;  5KRT A;  4AQY K;  4KTW A;  1K8K A;  4H0P A;  3NGI A;  3VEW A;  3KK3 A;  4A59 A;  4B3R K;  2PYJ A;  2D1K A;  1T6D A;  4KTQ A;  3T19 A;  1UAX A;  1JXB A;  3MDQ A;  3MX5 A;  4CZL A;  4W5N A;  3D2F A;  4BRD A;  3LDP A;  3CJA A;  5KRS A;  1NK6 A;  4Z4H A;  3AO4 A;  1N33 K;  4JEP A;  4DR1 K;  3SUO A;  4K42 A;  1XC3 A;  1U2V A;  2A1R A;  1V4T A;  3KWI A;  4CZF A;  4B8A B;  2GTD A;  3OS0 A;  4ISG A;  2BDP A;  4BR4 A;  3C6H A;  3VQC A;  2RKI A;  4W5O A;  3WEE A;  2DFH A;  4A5A A;  4EAH D;  1HKB A;  1VSI A;  3U9D A;  1WOQ A;  1NGI A;  4M3Y A;  2G8K A;  1Q18 A;  3BY5 A;  3OYL A;  1R0A A;  4RG8 A;  3O1W A;  4FYD A;  3DYA A;  1VQM N;  2P5O A;  4CZH A;  4KPY A;  1U45 A;  2HHT A;  1DGK N;  1S1X A;  4BR7 A;  3KD5 E;  3HXM A;  3OY9 A;  2FSK A;  4OKJ A;  4BRN A;  4H4M A;  1KVB A;  1S6Q A;  2BTF A;  5LMN K;  2GBZ A;  4FM2 A;  3O3F A;  1IG9 A;  3L3V A;  4JI0 K;  4DQQ A;  1U2V B;  1RGI A;  3H6E A;  1WSF A;  4U7B A;  3AAR A;  3UKR A;  3AVJ A;  2HF3 A;  4XH4 A;  3V9W A;  3THV A;  2OAN A;  4FJ9 A;  1KAY A;  4CHQ A;  3M8R A;  4FLX A;  2W6L A;  2HHW A;  3CJC A;  2QWP A;  4LF6 K;  3O9R A;  2X6S A;  4NYN A;  2KFZ A;  1ZBF A;  4G9Z A;  4JKD A;  3CFR A;  5M1N A;  1ITG A;  3V1R A;  1ESV A;  1GOB A;  3PY8 A;  4FK0 A;  5TKY A;  1KXP A;  5LMU K;  4BG8 A;  3K5N A;  3ID8 A;  5J2Q A;  4K8X A;  1EQY A;  1D4X A;  1IKY A;  3MWP A;  5M1K A;  2CGK A;  3U6F A;  3AO1 A;  4M45 A;  4RWT A;  3OS2 A;  3VA3 A;  1WSI A;  5CR4 A;  3JSM A;  2P9U A;  5C15 A;  2UYT A;  4EHU A;  4DV1 K;  3O6W A;  4FPB A;  1Y97 A;  4IEE A;  1JXE A;  1R59 O;  1NGG A;  3K9J A;  3HST B;  1IKX A;  4DKW A;  1BCO A;  4DV5 K;  3OBY A;  4CJ7 A;  3QIP A;  3OA9 A;  4QOZ B;  2VQF K;  4CJ5 A;  4WQ4 C;  4FW2 A;  3N4P A;  1A5V A;  2NNW A;  1OKJ A;  1BO5 O;  4DB3 A;  3GL1 A;  4B9S A;  2NUB A;  3DRP A;  2P51 A;  3S9H A;  3IKM A;  4I6M A;  1VQ5 N;  3GDQ A;  1BI4 A;  4H5N A;  5GIN A;  2VG5 A;  5AQM A;  3NH0 A;  4E7H A;  4BRO A;  5D3G A;  4CD3 A;  1XC9 A;  1RDC A;  3AVN A;  3CF5 L;  3RR7 A;  4Q0B A;  3V81 A;  1HYZ A;  1Q81 O;  1X1P A;  4AHS A;  4OKE A;  3NCI A;  4NO7 A;  1J53 A;  3DWL A;  3HP9 A;  3PX0 A;  1NJX A;  1HYS A;  3RRG A;  4DTJ A;  4ISF A;  1NOY A;  2GWJ A;  4JKH A;  3LDQ A;  2P9U B;  5J2N A;  3VQ5 A;  2FSN A;  3DXK A;  1S3X A;  4FLW A;  2Q1N A;  1YAG A;  3TAP A;  4UY8 O;  4FW1 A;  3ZSO A;  4CJK A;  4DSL A;  1HKG A;  1NGH A;  4E1J A;  3ITH A;  4JI2 K;  3VEN A;  3VQ8 A;  4HTU A;  3Q7C A;  3O80 A;  3HPO A;  1ASV A;  1C6V A;  2ITM A;  4BRK A;  1NGD A;  2F7T A;  3I33 A;  1NKE A;  4HCC A;  1GOA A;  3CCS N;  3UB5 A;  4JI6 K;  1JLQ A;  1VQ7 N;  3EO3 A;  4XIU A;  3RVC A;  4YOT A;  3QDK A;  4PKG A;  4O4G A;  3T1Y K;  5GAH P;  5I9E B;  2F96 A;  3DRR A;  1VQ8 N;  3G4S N;  2F9W A;  2NRT A;  2NRZ A;  3WQT A;  2EX3 A;  2YNH A;  5BPL A;  3SV3 A;  4WYB A;  4C23 A;  1DLO A;  3J81 O;  1MA9 B;  4E7J A;  4AH9 A;  4IKF A;  1RT6 A;  4E89 A;  3M6G A;  3LL3 A;  3FLC O;  4RTF D;  1L5U A;  4V19 S;  1SUQ A;  4K0K K;  4LSL A;  4N56 A;  4OO1 J;  2OA8 A;  3MXM A;  3SBG A;  1T7P A;  3IG1 A;  2J4R A;  4FWM A;  5KI6 A;  4O8K A;  1RT2 A;  3HRG A;  4Y0W A;  1VSH A;  4DTN A;  3HOT A;  1TVR A;  3CD6 N;  4O5F A;  2DFF A;  3AVA A;  3P1G A;  1S9E A;  1X3N A;  1W2B M;  1JL2 A;  1NJZ A;  3SJH A;  3S3N A;  5LL6 Z;  3TPQ A;  1FKO A;  4BR2 A;  4CJE A;  4BGB A;  4FJK A;  3W3D A;  1D5A A;  1QHA A;  1WAF A;  1ZYQ A;  2W42 A;  2Z1J A;  2OZM A;  5AFU A;  4FK4 A;  4CHY A;  1C1A A;  4C8O A;  1T6C A;  4CFC A;  3HZ6 A;  4DCH A;  2E2P A;  4BC3 A;  5BRD A;  3CM5 A;  3OJU A;  1RT3 A;  1QSS A;  2QXF A;  4OLA A;  2NRH A;  4ELV A;  4FJN A;  3AV9 A;  1N36 K;  1EP4 A;  5AQU A;  3R9P A;  1SKW A;  5AQI A;  3DLH A;  4H5W A;  5IT9 O;  4DTU A;  2A6A A;  3QEX A;  2OPQ A;  4PUO A;  4X66 K;  1OVQ A;  2KKZ A;  2FLO A;  2FBT A;  1KFS A;  1KFD A;  3NF7 A;  2YNI A;  2VWJ A;  4L8R B;  4H03 B;  2VG7 A;  4C8K A;  1C1B A;  3C65 A;  3AA5 X;  2HB5 A;  3C95 A;  3G71 N;  2P9L A;  1NG9 A;  1EKE A;  5CYQ A;  4JRP A;  5EY4 A;  2O8B A;  1I39 A;  3MED A;  3GE1 A;  4JI4 K;  4M3W A;  4DTM A;  3SNN A;  3HL8 A;  5BR8 K;  3P4I A;  5AQW A;  3EEQ A;  5KQ8 A;  4X64 K;  4C1N K;  1HNW K;  2HHV A;  1VQ6 N;  3ZT0 A;  3CCM N;  3TAQ A;  5J2M A;  3TAE A;  4BR0 A;  5FLX O;  1QVF M;  1HX1 A;  3TSU A;  1EO1 A;  1EWR A;  3S41 A;  1GLA G;  2ZGZ A;  1RBV A;  4B9Q A;  3DLB A;  3CMA N;  2HST A;  2HND A;  4OLB A;  1VSF A;  4A2A A;  3TAB A;  3RR8 A;  2O8E A;  4MO4 A;  4C8M A;  2I5J A;  2LSN A;  3LP0 A;  4FM0 A;  1BA1 A;  3K5O A;  4JI7 K;  3C6T A;  3NVM A;  4KO0 A;  4B8C A;  3R6M A;  3C7N A;  4M3R A;  5JLF A;  2RE2 A;  3H3N O;  1LWC A;  3LM9 A;  4Z4G A;  2ITG A;  4RW9 A;  3OJS A;  3VEX A;  1D9F A;  1QSY A;  4FXD A;  3VEY A;  4B1Z A;  4M3U A;  4JI3 K;  5J2P A;  3ZSY A;  3KLE A;  3SMP A;  1WAJ A;  5AQT A;  4KI4 A;  2FF3 B;  4G1Q A;  2E2N A;  1OH6 A;  5AFU H;  1X9J A;  4CF8 A;  1OVY A;  5C25 A;  3SAH A;  1QZ5 A;  3TTF A;  1YVN A;  1XQS C;  1KRP A;  3EKS A;  4AHT A;  4CE9 A;  5AQZ A;  3SQ1 A;  3TTD A;  5AQR A;  3IAY A;  2KZM A;  1IBM K;  4DF8 A;  2P9P B;  3H1Q A;  4FJX A;  3JAM O;  1TL1 A;  1G99 A;  3F2K A;  2V51 B;  4FM1 A;  2PBD A;  1HQU A;  3F73 A;  2RF2 A;  3D7E O;  1YJ9 N;  3WNF A;  2A1S A;  4LH4 A;  4IZ9 A;  1NK9 A;  1NMN A;  2WBN A;  4WFB L;  4O0I A;  3CPW M;  4HWI A;  5EX5 A;  1Z26 A;  1OH5 A;  4IEI A;  3QFP A;  4A2B A;  3ZET A;  4B9T A;  1YXQ A;  1E4G T;  2VCP A;  4YOY A;  3WNE A;  4BRE A;  3H08 A;  4DV0 K;  4DMN A;  1U47 A;  4DV7 K;  2HF4 A;  1U48 A;  1DTT A;  2XO7 A;  1REV A;  3H1V X;  4Q5V A;  4HVJ A;  1KVA A;  1KAX A;  1WNS A;  3ENO A;  3MEC A;  3QB0 A;  4IFV A;  2NZT A;  1RDA A;  3RTV A;  2UUB K;  2GUI A;  4FWK A;  2RPI A;  4B08 A;  3K0S A;  3QML A;  2E2Q A;  4CJR A;  2QW9 A;  3CME N;  4KRF A;  2Q3S A;  5J1E A;  4NXN K;  4DF4 A;  1CXQ A;  1DTQ A;  2CGL A;  3TSQ A;  3CM6 A;  2HBL A;  2QI2 A;  3ZEU A;  1RT4 A;  4LC9 B;  4B1V A;  4K43 A;  4LSN A;  5KGX A;  3MCP A;  1Q86 O;  5C10 A;  3ZET B;  5AQY A;  4DR7 K;  3EY1 A;  3HSC A;  3CCL N;  3A0I X;  1LAW A;  3HPH A;  3PLA A;  1CLQ A;  1VRU A;  3CI5 A;  1HKC A;  1NK8 A;  1K9M O;  4FLV A;  4ILG B;  3L0Q A;  4DTO A;  5JMV A;  1V4S A;  5C24 A;  3ZT2 A;  4DSE A;  1CZ9 A;  4OVL A;  2RHK A;  1NK4 A;  1Q7Y O;  2X74 A;  1NM1 A;  2ZQB A;  4CJW A;  3PUF A;  2EWS A;  4JK8 A;  4EP5 A;  3HVT A;  4H0O A;  2VQE K;  3WXJ A;  4CJP A;  3VTI A;  4FJ5 A;  2D0B A;  4I9L A;  3VF6 A;  3A5M C;  1W0H A;  3VEZ A;  4EZ9 A;  4CJ3 A;  3NBP A;  3DJC A;  5KPZ A;  4DTX A;  3DLE A;  3V9X A;  4GV3 A;  5M1P A;  4CZM A;  2WC9 A;  5BN8 A;  1MDU B;  1L3T A;  4CCH A;  5ADX A;  1S5J A;  4B1Y B;  4X62 K;  4B1W B;  4Z4E A;  3IRX A;  2Z1H A;  2QWN A;  3NF9 A;  2QK9 A;  1QE1 A;  1K8A O;  1J9A A;  1D9D A;  3BEX A;  3BUZ B;  1M90 O;  3AAQ A;  4O8U A;  4BE0 A;  3L4Q A;  1RIL A;  1TK8 A;  3NGY A;  1NJY A;  2QEX N;  1T03 A;  1NK7 A;  2ZJP L;  1FJG K;  1ASW A;  1ZBI A;  3HBT A;  2FSJ A;  2WTU A;  1N5Y A;  4F4K A;  3EN9 A;  4CBU A;  2O8F A;  4J2D A;  2JWL A;  1Z05 A;  4F2S A;  1ZBL A;  1QSL A;  3EYZ A;  4FO0 A;  1SQK A;  1D8Y A;  1C0G A;  3T69 A;  4GV6 A;  5E26 A;  5EU7 A;  4E0D A;  4JV5 K;  3F9M A;  3P5J A;  3CJ9 A;  1LWF A;  3FR0 A;  3H3O B;  4DFP A;  1UWB A;  4NCB A;  5AQH A;  3T7Z A;  2ZE2 A;  2F4V K;  3I0S A;  2CH6 A;  3ULE A;  1VQ9 N;  1VSM A;  3KD1 E;  1OH7 A;  4KBO A;  4CJS A;  3NE6 A;  1RDU A;  3LP2 A;  4H5T A;  3SLC A;  1KAZ A;  3NVK A;  3KZB A;  1S72 N;  1Q82 O;  4KB1 A;  4I7F A;  1B9F A;  1NKB A;  3CJ1 A;  5BRF A;  2O8F B;  4EIA A;  4B1U B;  4CHZ A;  2YV0 X;  3B6P A;  3WT0 A;  4F8R A;  4RW6 A;  2IOC A;  3RMA A;  3CFO A;  4FJI A;  3AGK A;  2V52 B;  3AAP A;  5AQL A;  3ULE B;  3NAE A;  3E66 A;  2G8V A;  2G8U A;  5AQV A;  1P8Z A;  2OCE A;  5GAD P;  4B9V A;  2FC0 A;  1KTQ A;  4B3T K;  4ZHR A;  4IJN A;  2XY6 A;  1WB9 A;  4CVN E;  3ZYY X;  2P9N A;  4YDU A;  1SV5 A;  4BQL A;  4FOE A;  3KKS A;  1HUX A;  1JKH A;  3RMD A;  1N34 K;  3RSE B;  1GLF O;  3K57 A;  3NDK A;  1J54 A;  3IUC A;  4PA1 A;  5AR0 A;  3J8A A;  2VWB A;  4J8F A;  5HLF A;  1SKS A;  4CZG A;  4DQP A;  4FOI A;  4N5S A;  1WSG A;  5GAG P;  3QBW A;  1F21 A;  4GNI A;  4CHN A;  4BAC A;  5C42 A;  2OZS A;  1SZ2 A;  4FJ7 A;  4DTR A;  1I3A A;  3CG7 A;  1IKW A;  1SL0 A;  2ETJ A;  3OYK A;  3ZCM A;  5C0Y A;  3AVI A;  4WE1 A;  2P9N B;  4FPA A;  3K58 A;  3CC4 N;  4K41 A;  4C1N I;  1X9W A;  2G8F A;  3KK1 A;  3KK7 A;  3LDS A;  3OW2 M;  3L6Q A;  3OYA A;  3QIO A;  4CF2 A;  1VQP N;  4IOA L;  3D0P A;  4KFB A;  2I7N A;  3QEP A;  2HHS A;  1WSH A;  3IDH A;  3AGR A;  3FZL A;  2IVP A;  4GMJ B;  4DR4 K;  5LY3 A;  3L3U A;  3WQU A;  5BRH A;  4CK3 A;  1JLE A;  4C8N A;  1QS4 A;  4O0J A;  5GAE P;  3OYB A;  1XUP O;  2Z1G A;  3K9K A;  4FJJ A;  1KC8 O;  1ZC6 A;  2ASP A;  5CZ1 A;  3ZSV A;  4JI1 K;  4ZTJ A;  3MN5 A;  2JLE A;  4YOU A;  5AJ3 K;  1NK5 A;  3VQ6 A;  4JK9 A;  3AA2 A;  1CXU A;  4YOX A;  5CZ2 A;  1L3U A;  4KI6 A;  3MXJ A;  1ZXO A;  5BPN A;  1RCH A;  4H0T B;  4ID1 A;  1X9S A;  3F9K A;  4GVE A;  1GLC G;  2YJF A;  2Q0U A;  2PY5 A;  1TUY A;  1JLB A;  2E5L K;  2Q2R A;  4CIE A;  4YFU A;  3DRS A;  1IBK K;  3AVL A;  4H0X B;  3GG4 A;  1UA1 A;  2KTQ A;  2O8C A;  4U67 L;  5FRM A;  4M7X A;  2GUP A;  3HM9 A;  1TAQ A;  3SPZ A;  3LPT A;  4GY2 B;  4M3Z A;  4KV8 A;  3HOS A;  3CCJ N;  3E9P A;  1U6Z A;  4K25 A;  2HNZ A;  3ASM A;  3WXK A;  3AVM A;  3EZ5 A;  4FWO A;  4CEZ A;  5AZJ B;  1DEJ A;  4JS5 A;  3PX4 A;  4CJQ A;  5FDL A;  3SQ4 A;  5HRN A;  2FBX A;  3QEV A;  2YHW A;  4KB0 A;  1NMD A;  4B9N A;  4IXC A;  4H5V A;  1W7A A;  4ID5 A;  4EHT A;  4DS4 A;  1VSD A;  1Q9Y A;  3VQ9 A;  1U49 A;  3VF2 A;  4BQZ A;  1NLV A;  2PAV A;  3MN9 A;  4R79 A;  4DQR A;  4FVM A;  4DV6 K;  2KW4 A;  2PYL A;  2O8C B;  3HI0 A;  2QWR A;  1VHX A;  4O5B A;  1C0F A;  1XMQ K;  4PL8 A;  4MO5 A;  4IDH A;  5JLH A;  4YOW A;  2WOM A;  1HJO A;  2B6A A;  3VQ7 A;  1BIU A;  5AQF A;  1LAV A;  3LDN A;  3UE5 A;  3PX6 A;  3MX2 A;  3L2Q A;  1BQM A;  3SBT A;  4B9M A;  3TAM A;  2D0A A;  3ATV A;  4AHR A;  4WFA L;  4OGE A;  4B9L A;  4CJF A;  4KH4 A;  2HMP A;  5JS2 A;  2IAJ A;  4Y1C A;  3EZW A;  4JHD B;  1WLJ A;  1LOT B;  4DR3 K;  3E9L A;  3OYJ A;  1GLD G;  3FZF A;  1NGB A;  2HBM A;  4FZY A;  3SYZ A;  1NGF A;  3VF4 A;  5AQP A;  4CJU A;  1WBB A;  2HHX A;  3ID6 A;  4Y1D A;  2QWM A;  2PZS A;  1TK5 A;  5C2D A;  1JCE A;  4KKO A;  4JS4 A;  3THX B;  4BVP A;  3OYM A;  3T3F A;  2XY8 A;  2Q0R A;  3QBX A;  3QES A;  1NGE A;  2BAN A;  5KPT A;  3O9U A;  4KH5 A;  4DFK A;  5LJV A;  3DXM A;  5AQG A;  1LV5 A;  2YKN A;  3CCV N;  5CYM A;  3EKU A;  3QIN A;  3SAF A;  1NK0 A;  4BDZ A;  2BUP A;  3VQP A;  4CFB A;  4DU3 A;  3LWL A;  4M63 C;  4OJR A;  5DK5 A;  4XH1 A;  4ELT A;  3L2W A;  5FPE A;  3R1X A;  4ELU A;  4HCB A;  2AJQ A;  4WCE L;  4KHP K;  1WUA A;  4BR9 A;  2W41 A;  3VGM A;  4CJT A;  1YUW A;  5HRR A;  4JLH A;  4DV3 K;  1N32 K;  3UIQ A;  3M8Q A;  2V7Y A;  3DAW A;  2QWO A;  3FGU A;  2UXD K;  2P9P A;  1NJI O;  4CGF A;  1KQS M;  4B9U A;  4CF0 A;  3FZH A;  5C2F A;  1QQN A;  3OYI A;  1BU6 O;  3O5B A;  4CEB A;  3OYG A;  4BC4 A;  3AVG A;  3EE8 A;  3LP3 A;  1BWF O;  3DXM B;  3FFK B;  3HVR A;  1RT5 A;  5AQJ A;  1L3S A;  4EZ6 A;  3CC2 N;  1O13 A;  1IG8 A;  3L4I A;  1HNV A;  1IO2 A;  1KSP A;  3ATU A;  3CJB A;  1ATS A;  2HMI A;  4FVU A;  2ZM6 K;  1HLU A;  4ILH A;  3TAN A;  2F8T A;  3KJV A;  4FJG A;  1TAU A;  3QO9 A;  1XHX A;  3MEG A;  4CK1 A;  1N8R O;  4M42 A;  1J6Z A;  4YOR A;  5FRN A;  4E19 A;  4IFY A;  2HHU A;  3OVN A;  1RT7 A;  3ZSR A;  4DTP A;  3O4W A;  1VQN N;  5E84 A;  5FPD A;  4IWV A;  4FWN A;  4M3T A;  1E4F T;  3WXM B;  2Y1I A;  4DR2 K;  1S1V A;  4DUY K;  1TYQ B;  5F2R A;  1MU2 A;  1S1W A;  4YNQ A;  1T3V A;  2YJE A;  3V9Z A;  1B9D A;  4CGG A;  1XHZ A;  1T44 A;  3E01 A;  4BWM A;  4IOC L;  3WUH A;  2D4W A;  3V9U A;  4WQ5 C;  1GOC A;  3DLG A;  3PSF A;  4A5B A;  4N76 A;  4OKK A;  3G10 A;  4NB4 A;  4JRQ A;  3HTV A;  3CQY A;  5EOY A;  2YHX A;  2F9T A;  3ZSW A;  4PKH A;  2FF6 A;  1X9M A;  4JKG B;  4GW6 A;  1K73 O;  3WNH A;  4RW7 A;  4JKE A;  1RTD A;  4DR6 K;  4KHU A;  3RWU A;  1J5O A;  1QZ6 A;  2IC3 A;  3KVG A;  4IJA A;  4HHT A;  5AQK A;  5H1S Q;  1ZBU A;  4BE2 A;  2GWK A;  3QNO A;  3JXU A;  3CCE N;  5M1F A;  1C1C A;  1TKX A;  3A8Y A;  3AO5 A;  4PY5 A;  1VQK N;  2NRR A;  4LFC K;  4ILJ A;  4F2R A;  3ENB A;  1IBL K;  3AVH A;  3DLK A;  4O55 A;  1L3V A;  1NGA A;  4FJM A;  1J5E K;  2ZJR L;  1LW0 A;  1HPM A;  4DG1 A;  3K59 A;  5GIP A;  4DQI A;  3SQ2 A;  1DT9 A;  3L2U A;  3NHG A;  4DSK A;  4LD0 A;  3RMB A;  1W9H A;  4DU1 A;  4UQG A;  1HMV A;  1IH7 A;  3ZSZ A;  3CER A;  3BF3 A;  3V6D A;  2FXU A;  3KWG A;  3VGL A;  4QS7 A;  4YDU C;  4CED A;  3CXC M;  3KK2 A;  5K14 A;  2GEL A;  1Z25 A;  3VQA A;  4DHY A;  3S3O A;  2XHB A;  3VQ4 A;  2DFE A;  1WN7 A;  2HHH K;  2QKK A;  1TGO A;  3FE1 A;  3WXL A;  1K6Y A;  4B1X B;  2E20 A;  2P1J A;  3QLH A;  2QWQ A;  3PIO L;  2E4L A;  4DLG A;  2YNG A;  2HOE A;  3OTO K;  3KLH A;  1ZBH A;  3JS6 A;  4FL9 A;  2BE2 A;  2ZF5 O;  3PIP L;  3TAR A;  4H5R A;  1KLN A;  4Z4I A;  5F0X A;  2Z1I A;  1DKG D;  3CQX A;  4NLC A;  4JN4 A;  3OYF A;  2NRX A;  4HTL A;  2KLA A;  1RDW X;  5SZT A;  1BA0 A;  1FKP A;  5HOO A;  4I2Q A;  4CFA A;  4CHO A;  1XMO K;  3CQ8 A;  2G8W A;  4F9O A;  5I3U A;  4CIG A;  3TAG A;  3O08 A;  1S1U A;  1VQL N;  1S1T A;  4IOX A;  2GEM A;  2WUS A;  5DM7 L;  3L2V A;  2W6K A;  1ATN A;  3MEE A;  5CHI A;  3W0L A;  1SKR A;  4BRM A;  1JCG A;  4CW7 B;  3CFP A;  4H0V B;  1FW6 A;  4EP4 A;  3O9T A;  4JD2 A;  4RW8 A;  2DTU A;  3SUQ A;  4MDA A;  3NFA A;  2G8H A;  5KPR A;  2R7Y A;  5AQS A;  4BRH A;  4JAX A;  2Q31 A;  4FWP A;  2UUC K;  4PQU A;  1BL3 A;  1C0U A;  3FFI A;  4J2B A;  2O4I A;  2JGU A;  3QIC A;  1BIS A;  2XRI A;  5AQN A;  1JLA A;  5FPN A;  3J80 O;  1RDB A;  3OYH A;  3GBT A;  4PKI A;  3ZLJ A;  4KAZ A;  4YHH K;  2OPR A;  3QEW A;  4LFB K;  4WQ5 A;  2HVI A;  3P31 A;  5IWA K;  3VA0 A;  3V1Q A;  3C6U A;  4DS5 A;  4GKK K;  3E1Y A;  3WNG A;  4QS9 A;  4IO9 L;  1MWM A;  1NBW A;  1VQ4 N;  3M3Z A;  3QEI A;  4PHT X;  4GKJ K;  1VSJ A;  2IGI A;  3A5O C;  2CGJ A;  5HBM A;  1GLL O;  4JD2 B;  4W5Q A;  2IS3 A;  3WXI A;  3U9Z A;  1LW2 A;  3G6E N;  3RSE A;  1IJJ A;  2NLX A;  5SWM A;  4IG3 A;  1RBT A;  4DSI A;  3BZK A;  3HPG A;  1K8K B;  2A40 A;  4CF1 A;  1HNZ K;  2HBK A;  3HP6 A;  1XNR K;  5M1Q A;  4YY3 K;  3D2F B;  1TKD A;  2HVH A;  5KQD A;  4X65 K;  4JI5 K;  2UXC K;  3J7Y P;  4F3O A;  4B3M K;  3UKU A;  4BRF A;  4LF5 K;  3OBW A;  1W97 L;  5ELZ A;  3SCX A;  3PSI A;  2AA4 A;  1HJR A;  3H45 C;  3O9S A;  1RDD A;  4FWQ A;  4OX9 K;  3O3G A;  3RRH A;  4BRP A;  4YOV A;  4DFJ A;  4CBX A;  4FJ8 A;  2E2O A;  3WEE B;  2KHO A;  1NU0 A;  3D45 A;  3SAG A;  4MLH A;  4FLU A;  3IS9 A;  1E3M A;  3SV4 A;  1QTM A;  1TK0 A;  4DLE A;  4BC2 A;  3RMC A;  5ADX H;  3NF6 A;  4LFA K;  5E41 A;  1SL1 A;  2F8S A;  4BC5 A;  5MLC Q;  1RBR A;  3ZT1 A;  1RBS A;  3ZX0 A;  2QKB A;  3THY A;  1U04 A;  2FBY A;  4LF7 K;  1VSK A;  1XI1 A;  4LY7 A;  5AQQ A;  3LWM A;  3V1O A;  1CZA N;  4NYF A;  3LZI A;  3P38 A;  4QCL A;  4CZE A;  3UKU B;  3BGR A;  4CIF A;  2PFU A;  4E7K A;  4RW4 A;  3C0B A;  4BRQ A;  4KHS A;  2E6M A;  3AA3 A;  2BH1 A;  3ZX3 A;  1VQO N;  4RCH A;  4H4O A;  3UKR B;  4R5P A;  3VMF B;  3QER A;  1NJW A;  1ATR A;  3AVF A;  4BRI A;  3B6O A;  1CZB A;  4Z4C A;  3Q7B A;  2OPS A;  3AO2 A;  2XY7 A;  3M8P A;  4CGH A;  2IVN A;  3BF1 A;  3L8B A;  4FZZ A;  3QFU A;  3ZSQ A;  4M41 A;  3O4N A;  3I8D A;  2JWK A;  4CGD A;  2VGN A;  5EVZ A;  5GIO A;  4BVO A;  3SZ2 A;  1P90 A;  4CJV A;  1KVC A;  5JVH L;  4E7L A;  1S22 A;  4BG9 A;  3CIP A;  4BRL A;  2Q36 A;  3THY B;  1JLC A;  4DSJ A;  5DM6 L;  3AA4 A;  2W40 A;  2ASM A;  2WFB A;  4OPH A;  5JIC A;  3M5R A;  1NNE A;  1YF5 L;  3VGK A;  4B3S K;  4CD1 A;  2QA4 N;  1M1K O;  3ZT3 A;  1JL1 A;  2GX9 A;  2ZWH A;  3N4Q A;  1BCM A;  2D0P A;  2OYQ A;  5AZJ A;  4JK7 A;  2DY4 A;  2ASO A;  3LDO A;  3VQQ A;  2H3G X;  2QXL A;  3MN6 A;  1RT1 A;  4FCY A;  4AHC A;  4ZTF A;  1HRH A;  4DUZ K;  3VQB A;  4BR5 A;  4F3T A;  3A5L C;  2HNY A;  4FWL A;  2IVO A;  4OPA A;  3G0Z A;  1JLF A;  5BPM A;  2E88 A;  1Z6R A;  4I6M B;  1LCU A;  4PWD A;  1BI4 B;  4TSX A;  1Q9X A;  1C0M A;  3AVK A;  3NMU A;  4JKB A; 
#chains in the Genus database with same CATH homology
 2UUC K;  2UXD K;  4JI2 K;  1J5E K;  1N36 K;  3J80 O;  2UXB K;  4DV6 K;  4LF6 K;  5IT9 O;  2UU9 K;  4YHH K;  4X66 K;  4DR5 K;  1XMQ K;  4LFB K;  4JI6 K;  4DR4 K;  5IWA K;  2VQE K;  1XNQ K;  4AQY K;  3T1Y K;  4GKK K;  1IBM K;  2UUA K;  2ZM6 K;  3JAM O;  5LMU K;  4B3R K;  1HR0 K;  4JI1 K;  4GKJ K;  2HHH K;  5AJ3 K;  4JI4 K;  3J81 O;  1HNX K;  4JI8 K;  1N33 K;  5BR8 K;  4DR3 K;  4DR1 K;  1I94 K;  4X64 K;  1HNW K;  4DV1 K;  4V19 S;  4X62 K;  4DR2 K;  4DUY K;  4K0K K;  3OTO K;  1HNZ K;  5FLX O;  4B3T K;  4DV5 K;  1XNR K;  4JYA K;  4DV0 K;  4CVN E;  4DV2 K;  4YY3 K;  2VQF K;  4B3S K;  2E5L K;  4DV7 K;  3T1H K;  4X65 K;  4JI5 K;  5A2Q O;  2UXC K;  4DV4 K;  3J7Y P;  4B3M K;  4LF5 K;  1N34 K;  1IBK K;  1FJG K;  1XMO K;  2UUB K;  4OX9 K;  5LL6 Z;  3J7A P;  4DUZ K;  4JI7 K;  4DR6 K;  4NXN K;  4JV5 K;  4CW7 B;  4LF4 K;  5LMN K;  4KHP K;  4LFA K;  2F4V K;  4JI0 K;  4LF9 K;  4LFC K;  4DV3 K;  1N32 K;  4NXM K;  4DR7 K;  4JI3 K;  1IBL K;  4LF8 K;  4LF7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...