4DR6K

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr6K00
1N36K 4DR3K 5FLXO 1IBMK 4DV2K 4CW7B 4DUYK 4V19S 4JI7K 4JI4K 2F4VK 4DR7K 3J7YP 5A2QO 3J80O 4DV5K 4JI3K 4JI0K 4NXNK 4X65K 1FJGK 4LF8K 4AQYK 5LMNK 4DV4K 2UUAK 4B3SK 1XMOK 4DR2K 4LF4K 3J7AP 4X64K 4DV3K 4DR6K 4JI8K 4JI5K 4LF7K 3T1HK 4DR5K 4NXMK 4LFCK 4JYAK 4LFBK 5LL6Z 4K0KK 4LFAK 1HR0K 5IWAK 4YHHK 2UUBK 1J5EK 3T1YK 1XNRK 4JI1K 1IBLK 1N33K 4DUZK 2E5LK 2UXCK 3J81O 4JI2K 4LF9K 4DR4K 2VQFK 4OX9K 5BR8K 5IT9O 1HNXK 2HHHK 1HNZK 3JAMO 3OTOK 1I94K 2UU9K 4DV6K 4B3MK 2UXBK 4JI6K 4LF6K 1XNQK 4B3RK 4GKKK 4DV0K 4KHPK 2VQEK 4X66K 2ZM6K 4YY3K 4X62K 1HNWK 1IBKK 4DV7K 1N34K 5AJ3K 1N32K 1XMQK 4JV5K 5LMUK 2UXDK 4DV1K 4B3TK 4CVNE 4DR1K 4LF5K 4GKJK 2UUCK
chains in the Genus database with same CATH superfamily
5FPNA 1H1VA 3B6PA 4FWOA 1LCUA 1QS4A 3ZSQA 2G8HA 3P5JA 3TU5A 4KI6A 5M1NA 1I39A 4JI4K 1X3NA 3QIOA 4YDUA 2YHXA 1WNSA 1D8YA 3UKRB 3RRHA 3KD5E 4BR7A 2YNHA 2YNFA 4HTUA 1W0HA 4GNIA 2XRIA 2XY6A 1BQMA 3C95A 2V51B 4BRKA 2HMIA 4IOXA 4DG1A 2ZJPL 2FBYA 3DXMA 3S9HA 5JLHA 1LWFA 3DM2A 1NJYA 1I3AA 2HNYA 3LANA 1KAYA 4OGCA 2E1ZA 4O5BA 3TAGA 2P9NA 3ZSXA 3HO1A 4UY8O 4FZYA 1J9AA 3CCEN 4IJAA 1OH8A 4O55A 2OYQA 1BISA 4FJLA 3UIQA 2ZGZA 3CJAA 3OS0A 3FZHA 1R59O 4CBWA 4NLBA 3V6DA 2CGKA 5M1FA 2NNWA 1GLCG 2CGLA 3O3HA 2O8BA 3VGMA 4U67L 3I0SA 4FXDA 3D45A 2RHKA 4FWMA 3DLKA 1KD1O 4BRGA 4ILHA 1C0UA 2PYJA 1IKXA 1XHXA 4PKHA 2A3ZA 1ZBFA 3MAQA 3FFKB 3QMLA 3H3OB 1S72N 1U04A 1WAFA 2VWKA 4KV8A 5LY3A 4DTXA 4O0JA 1Z05A 3AVLA 4NYNA 3THVA 2YV0X 3PO5A 4Q5VA 4O5FA 1V4SA 3ITHA 4KHPK 2VQEK 1WAJA 3TABA 3LP3A 4YY3K 3AVNA 2A1SA 1S3XA 2WOMA 4CJLA 3AO2A 3ZSRA 4PA1A 4DV1K 2O8EB 2KLAA 1NK4A 1J54A 3ZT1A 5C0YA 3THYA 2B4JA 3EY1A 5F2RA 3VQ4A 3PO4A 2W6KA 3DLGA 1RCHA 3U9ZA 5H1SQ 1OKJA 2YJEA 4BRIA 3K59A 4FYDA 5AR0A 3ZX3A 1X1PA 1JLFA 4GV3A 3PLAA 4NCBA 1A5WA 1UA0A 1C6VA 2F9TA 3VQ5A 4LF8K 2D0PA 4CHYA 5AQLA 4AQYK 4CGDA 5LMNK 4DQRA 4GV6A 3GBTA 3RMBA 1BHLA 4PKIA 1KCFA 5KGXA 3VQ7A 4CJWA 4JKFA 1QHAA 1NKBA 3DLBA 3G10A 3GDQA 4LF4K 5AQIA 3J7AP 3IRXA 4B1ZA 3OYBA 1TUUA 4PQUA 2FLOA 2E88A 3KVGA 4W5RA 4HUFA 2CGJA 4IDKA 5EY4A 3AA4A 3HPOA 1L5UA 5CZ1A 5LL6Z 2IC3A 5GIOA 4BC2A 2YHAA 1L3TA 4IOAL 1J53A 4FLYA 3AVKA 4YHHK 4KTQA 3LDPA 3QO9A 4FSVA 4ISEA 5T7BA 5E84A 2XO7A 4JS4A 1N33K 2UXCK 2JWLA 4LF9K 5E41A 3KK1A 4CEFA 1HNXK 4ZTJA 5JMVA 4ZHRA 1Q86O 2QKBA 4CJ4A 1RDWX 1BI4B 4IWVA 3SUNA 3A5NC 4QAGA 2ZE2A 1U49A 1Q9XA 4GKKK 3WQUA 1DT9A 3VERA 1TKZA 5JS2A 3L8BA 3ZETB 2YKMA 3VQEA 3CI5A 4JRQA 3OYCA 2VGNA 3DJCA 3UKUB 1NU0A 3OYIA 4QS8A 1WB9A 2V7YA 3BY5A 4YORA 3T19A 3DI6A 3IFRA 4OKJA 4CBUA 4YNQA 4BRQA 3QNOA 3WNFA 5CR4A 1YAGA 3V9UA 1NGHA 1XC3A 1DGKN 3L6QA 2WFBA 4BQLA 2FF6A 2KW4A 5CYQA 3VEYA 4CJUA 1SL1A 1UWBA 4L8RB 3L4IA 4JN4A 4BWMA 1ZXOA 3EN9A 3VQ8A 2HHTA 3CCQN 1WSJA 2D0AA 1NKCA 3NGZA 2B5JA 2FBVA 1K73O 4H0XB 1EO1A 3OYMA 2FSNA 2O8DA 1BU6O 4DWIA 3OYAA 1NGEA 3G71N 3HK2A 5SWMA 4Z94A 5GAHP 4DR6K 4DS4A 4CFAA 3HT3A 2HNZA 4CZLA 4HUEA 3E66A 3OYFA 1EKEA 3HBTA 4HHTA 2QWQA 4E19A 4DFPA 2X6NA 5ADXH 4RTFD 4AM7A 2PFUA 1ATRA 3KKSA 3WNEA 2PYLA 4ILJA 4CF0A 4BDZA 3TAFA 2HBMA 3TTFA 2D0OA 3F2KA 3LWMA 3HRGA 1NGDA 5HL7L 3QEVA 3M8SA 5AQXA 2R7YA 2HHHK 3RRGA 1C1AA 1HNZK 3AO3A 4OVLA 1B92A 1L3SA 2DPNA 2V52B 3O4QA 3DXMB 3QICA 4JI6K 2A41A 3AVBA 2HHXA 5AQMA 1T03A 4M41A 3MEEA 1RDUA 4WCEL 3KK7A 3ZYYX 4M45A 3ULEA 1HKGA 2P9NB 4E1MA 3EZ5A 4Y0WA 1F21A 1KVAA 1FW6A 3O4WA 5EU7A 4CGGA 4GW6A 5EVZA 1CZAN 3K0SA 1TK0A 2O8BB 4AHVA 3KJVA 3S3OA 1S22A 2FF3B 5HROA 4CZEA 3QIPA 4IXCA 1Z26A 3AY9A 3CFOA 4CZHA 4EIAA 1IBMK 3MCAB 4IO9L 3EYZA 1VHXA 2F8TA 4IFEA 2F4VK 1S1TA 4CEEA 4LD0A 4PUOA 3J7YP 3L2QA 1NNEA 5GAEP 3CXCM 4DV5K 2P9IB 1S9EA 2E2NA 3E9LA 3DOKA 4FJXA 1W9HA 4EFHA 2HB5A 1NGCA 3R1XA 3ZT0A 4XEIA 2X78A 3CF5L 4H5VA 1HKBA 4B08A 4B9VA 5CZ2A 3VTHA 3HM9A 3THYB 2NRVA 3O80A 4FJ9A 4WQ4A 1WN7A 2QWMA 3AVCA 3C94A 1BCOA 4ISGA 2OZSA 5BR9A 3HSTB 3QETA 1IV0A 3SUOA 4WE1A 4J2DA 1JLBA 4OKEA 3OS2A 2CH5A 1UOCA 2VCPA 3H3NO 3JAMO 1X9SA 1YTUA 4BROA 4BRMA 1HNIA 4JKHA 1EXQA 4H5NA 3T7ZA 3SAFA 1S1XA 4FWLA 4BY9C 3NDKA 3LP1A 4W5NA 2FBTA 3OA9A 3OYGA 1ZYQA 3V9ZA 3W0LA 4KRFA 1TL3A 2HHSA 3GG4A 4YDUC 3NE6A 1E4GT 1TYQB 4EZ9A 3WEEA 1HNWK 2PBDA 1LW2A 2P9KA 1KVCA 4CEBA 1BIZA 4DTNA 1GLDG 1LW0A 1E3MA 4E7IA 1ILYA 4R79A 2VYPA 3OYLA 5JVHL 4BRHA 3FLCO 4OPJA 1D4XA 3CJ1A 3PIOL 2WONA 4Z0UA 2P9LB 4CW7B 3BZKA 4N56A 4M3UA 3FFIA 1KAZA 3VA0A 4KHSA 4I7FA 3DOLA 4PKGA 4XH5A 4GV9A 4X65K 1Y64A 5LJWA 1WSIA 2DFHA 2Q0UA 4AHSA 3SCXA 1ESVA 1IH7A 3NF7A 4FJJA 2VG5A 4PL8A 1TVRA 1N6QA 4GY2B 2A42A 4IOCL 4B3SK 2BDPA 2O8FA 3HZ6A 2QW9A 4CEOA 2NZTA 5HLFA 1XMOK 2W42A 4OPKA 4IO8A 4I2QA 3I55N 3I0RA 3S41A 1RT2A 1HX1A 1YITN 3L2VA 4DFJA 4JI5K 3MDQA 3EL2A 3FE1A 4DSFA 2D5RA 4YOWA 3K9KA 4BR2A 5C24A 2P5GA 3HTVA 1S6PA 5FDLA 3T1YK 4ID5A 1LAWA 3M6GA 3RMCA 3AVJA 2E5LK 1TK8A 1SKSA 4OX9K 3BZCA 3K5LA 5HRRA 2Z1JA 1QQNA 1VQKN 4FWQA 1VQMN 4BGAA 4CJKA 3MN9A 3P31A 2YX6A 3RVCA 3DRPA 2BUPA 2E6LA 1ZBUA 4CK2A 1BG3A 1HMVA 3QEWA 1JCFA 4FM2A 3TAEA 3V9SA 1A5XA 4DSIA 4H4MA 4CJVA 1M1KO 4BR5A 4O0IA 1NBWA 3C6AA 3BUZB 2HF4A 2E1YA 3SPZA 4B9NA 4BDYA 5M1PA 5SZTA 3HPHA 4FVMA 4E7LA 1D9DA 5AFUA 4GVMA 2KKZA 4N76A 5AQPA 5C15A 2UUCK 5GADP 4CJSA 3KLIA 3AO5A 2Q1NA 1N8RO 3LDLA 1U6ZA 2HBJA 4DV2K 1RBSA 3THWB 3BEXA 4N41A 3CCLN 3FZLA 2E2QA 1YXQA 3K57A 2Q31A 3J80O 3OYNA 2YHBA 1FJGK 5EOYA 3NGIA 4DMNA 1OVYA 4BACA 3C6UA 4CGIA 3VEWA 4CK1A 5AQJA 3JXUA 3VMFB 2UUAK 1HYVA 3VQCA 4K42A 4BREA 3IUCA 3OYEA 3MMVA 3VGKA 3WUHA 4DU1A 3P83D 4BVPA 4H03B 5BREA 3KK2A 3TWHA 4JLHA 4EAHD 5AQHA 4Z4FA 3QDKA 3D2EA 4CJTA 1QTMA 3TSPA 3AVFA 1TKDA 2RE2A 3CD6N 2BTFA 2RF2A 1DTTA 3O5BA 4C1NI 3TAPA 4FLUA 1LV5A 1W7AA 5AQRA 3TAQA 4CESA 4CJ5A 4BRNA 4CF9A 2YNIA 2E2PA 2QWNA 4DUZK 3ULDA 5LJVA 4DQIA 2VWJA 2FSJA 3CPWM 3AVHA 3CCMN 3O1BA 3RMAA 1GLJO 3AVAA 1E4FT 2Y1IA 1I94K 4AHRA 5D3GA 3NCIA 1ASUA 4PY5A 4KB1A 4DQ8A 2ASPA 3O9RA 3IAYA 3MK6A 3C65A 2Z1HA 1QQOA 5AQWA 1VSHA 2ZJQL 3CJ7A 2F96A 3LL3A 5M1OA 1EETA 1WLJA 3K9JA 2EHGA 3KWGA 4DF4A 1GLLO 4X62K 5I42A 4IDHA 1TAQA 4J2EA 1HPZA 3IS9A 4BVOA 1XMQK 1LWEA 1IJJA 4CFDA 1D9FA 4F3OA 4LSLA 4MDBA 4BC5A 3P39A 4DU3A 1W2BM 4B3TK 1RT4A 1C0MA 4Z4IA 4A61A 1QSLA 1TKTA 5FLXO 5F0XA 1ZBLA 3LZJA 2KTQA 2YNGA 1YUWA 1TKXA 2XY7A 4JKCA 3IDHA 3M5RA 4QCLA 3SQ4A 3RSEA 2Z1IA 1RBTA 2QXLA 4CFCA 4LC9B 1QSSA 2ITGA 3CJBA 4BC3A 3V1RA 3ZX0A 5JVGL 3OS1A 2WC9A 1OH6A 1RT1A 3J8AA 4FOEA 5FPEA 4B8CA 4OLBA 4OLAA 4MDAA 2AA4A 4H4OA 3WEEB 4CJ7A 5GIPA 4EP5A 3CIPA 4DLEA 1KTQA 3OYJA 4WQ5A 5KRSA 1HKCA 3QBXA 3MWTA 4IEIA 1VQ8N 1BQNA 3CQYA 3TR8A 1Q8IA 3SV4A 3EE9A 4LFBK 1V4TA 3I33A 2IDOA 3NF9A 4AILC 3L2RA 3OYKA 2GX9A 4MQ3A 4DTRA 4JI1K 2HHUA 1T3VA 2QWPA 4C8LA 4DQPA 3DYAA 4PHTX 4WFNL 3KTQA 3NHGA 2HBKA 4FK4A 2VQFK 3K58A 4F9OA 3VF4A 4DS5A 2V7ZA 3KWIA 1VQPN 2P51A 1K8AO 1NGGA 2O8FB 4WFBL 4IFYA 3LZIA 4MO4A 3VF2A 3L2WA 3THXA 1G15A 4CECA 5AZJA 1OH7A 3FGUA 1XWLA 4FPBA 2IS3A 1WBBA 4CCHA 4CBXA 3LDQA 4BGBA 3L2UA 2XY8A 1NGIA 3ENOA 1OH5A 4Y1CA 1UAXA 1N34K 1EWQA 3CCUN 4KHUA 3MN6A 4BRDA 3KLEA 3ZCMA 4C1NK 1RT3A 5LMUK 1ATSA 2JWKA 3TARA 2OPSA 3CQXA 3PX6A 4M7YA 4AHUA 1UA1A 4H0VB 4W5OA 1TAUA 4CZGA 4A62A 1NGAA 1N36K 4JI7K 3SMPA 3GOIA 3VQPA 5AQNA 2OPRA 5KGWA 3U3GA 4O8UA 4WQ4C 2HHQA 1D5AA 2Q3SA 4DV4K 1XHZA 4CD3A 1ZBIA 4FW2A 3CETA 4BR9A 2LSNA 3I8BA 2W40A 2J4RA 3U4LA 4B1XB 2A40A 4DSJA 4BRCA 3KZBA 4JD2A 1QHTA 4JI8K 5BPMA 4IEEA 3B6OA 1WSHA 4CI6A 3UE5A 4JYAK 3D0PA 3V81A 3H1VX 1JLCA 4H8KA 3WXLA 2FBXA 3O9UA 4CE9A 4KHQA 5C10A 1IKWA 3M8QA 1YVUA 1MWMA 3H45C 3QNNA 4JKGB 5AQTA 1IBLK 3V4IA 3TTCA 3SQ1A 3R3LA 2HHWA 3NGYA 3AAPA 2RPIA 3TSQA 4E1NA 4FJ7A 2D0BA 3ZEUA 2IVPA 3L0QA 4IJNA 4JKAA 3TAMA 4CJQA 2KFZA 4BG9A 4DHYA 3KKRA 2QTDA 4DV6K 3CC4N 2O4GA 4FWSA 5CYMA 3FZMA 2P5OA 4JKBA 4K25A 1FK9A 3PSFA 4FW1A 3W3DA 1KRPA 3CMAN 2ZD1A 3R6MA 1MWKA 3IKMA 3D2EB 3SUQA 1XC9A 4IG3A 4FWPA 3EE8A 3CHWA 3CFPA 4U7BA 3EKUA 3J7ZO 2P9SA 1DKGD 1NM1A 4E7JA 4NYFA 5FPMA 1YI2N 1RDCA 5DK5A 2YHYA 4CEQA 5JLFA 2KHOA 5C2FA 1BDGA 3D7EO 1MU2A 3VEOA 4B8AB 4FJGA 2F7TA 5KQDA 3M1FA 4LF5K 4GKJK 2IIRA 3SLCA 5CE3A 4KBOA 3HVRA 4DR3K 1NGJA 1NGFA 4IKFA 4CEZA 4ELVA 5ADXA 2VWBA 4M63C 3KLGA 3AGRA 1SS6A 4CZMA 4B1UB 4BE2A 4HCBA 4DB3A 4NXNK 4JI0K 4CIFA 1GOCA 1J6ZA 4I6MA 3KK3A 4JHDA 3O3GA 2G8WA 3G25A 3MWPA 3CERA 4CJFA 3RR8A 5BN8A 2VGMA 1NOYA 1T05A 4JNEA 4L3QA 4AH9A 2ITMA 2X74A 1ATNA 3CMEN 3K5NA 2Q97A 3HP9A 3F5TA 5DM7L 3VEZA 1J5OA 1GOAA 1KLMA 1VAZA 5C25A 4FLWA 1JKHA 3L3UA 1RT5A 2P1JA 1HR0K 2NRHA 1RFQA 1K6YA 2GWKA 4J2AA 1S1VA 1X9MA 3DAWA 3RSEB 3TTDA 3F73A 2A6AA 4QOZB 4FJNA 4HVJA 1S1WA 1P8ZA 2DFEA 3OYDA 3VEVA 2QK9A 1WSFA 2ATQA 4Z4EA 4Q0BA 4K8XA 3G4SN 3SK3A 4XH1A 5BPNA 4M7XA 5AQZA 2PZSA 4FJKA 1YVNA 4CHPA 1KSPA 2GBZA 5FPDA 5TKWA 3OHRA 1VQ4N 1QVGM 1KXPA 4OKKA 2ZF5O 1NK8A 2Q36A 1HQEA 2O8CA 4UQGA 2Y1JA 3SI6A 1HYSA 4KPYA 4AF1A 4DV7K 3KLFA 4ELTA 3HXMA 4FOIA 1VQ7N 1XI1A 1RTIA 1W97L 1U45A 2BANA 2HOEA 4FZZA 4CHOA 3C0BA 2ZGYA 1VRUA 3E9OA 3HPGA 3ZSWA 5FRMA 1BCMA 1TV6A 3O9TA 2AJQA 4B9MA 3SUPA 3MXIA 4KTWA 2GUIA 4V19S 4FVUA 2ZQBA 2HSTA 1CZ9A 1RNHA 2KZMA 2ZJRL 1S9GA 1BO5O 3NH2A 1KLNA 2HVHA 3EKSA 4EP4A 4E7HA 4I2PA 3NFAA 1WBDA 4ZTFA 3O3FA 4AM6A 4CF2A 2EWSA 4CZKA 3PY8A 1SQKA 4JS5A 3MEGA 1CLQA 5EXWA 5AQSA 4X64K 4DV3K 1BA0A 3I8DA 4FK2A 1EP4A 4XH4A 3NVMA 1KAXA 3D6RA 2ZWHA 4G9ZA 2NRWA 1GLEG 4NXMK 3ZSYA 4DU4A 3RTVA 3LAMA 5KI6A 4LFAK 1QVFM 3PUFA 3HL8A 1P90A 1C0GA 1J5EK 1JLQA 5AQUA 2UYTA 4CD1A 3E9PA 5KPZA 4KHYA 1DEJA 1Q82O 1EQYA 2OPQA 4CHNA 4JKDA 1R0AA 4QS7A 4EHUA 2E20A 4R5PA 2D4WA 3ZT4A 5KPRA 2ETJA 4KH6A 4B1VA 4OJRA 1REVA 1VQNN 3QBWA 1TGOA 3VN5A 1VQON 3WXJA 1VK0A 1N5YA 4M3ZA 4CZIA 1NK5A 3BDPA 5J2PA 2RN2A 5HOOA 3OW2M 2QWRA 3S3MA 1RDBA 3AO4A 3O9QA 5TKYA 4B9LA 1U48A 4JD2B 3C7NA 2BE2A 4J2BA 3ATUA 4RW7A 3PV8A 4KAZA 4CZJA 4DF8A 3NBPA 2E8AA 4Y1DA 3VQAA 1U2VA 5KRTA 3CPEA 4G1QA 1YIJN 4A59A 2XY5A 1BWFO 3KD1E 4IFVA 3CM5A 3C6HA 4CIGA 1IG8A 4CVNE 1C1CA 3O6WA 2O8DB 5BRHA 4H0YB 1VSIA 1FXXA 1JLGA 2RKIA 3VQDA 4WQ5C 2VG7A 3H08A 3B8AX 3QFUA 4DR7K 3CJCA 3BF3A 3K2PA 4DSEA 1EWRA 3AVMA 3A0IX 3ZETA 1RBRA 3AA3A 4CIEA 4BRPA 5BPLA 1MA9B 3UKUA 1VQLN 4A2AA 3VQBA 3TPQA 4H5WA 1CZBA 3QERA 3HJFA 4JRPA 3QEIA 5C2DA 2I7PA 3SAGA 2P9SB 3O08A 4E1JA 1VSFA 1JLAA 4H0PA 3WXKA 1QQMA 4RG8A 3PX4A 4KKOA 4IG0A 4C8NA 1GLAG 4E89A 2QWOA 1HYZA 3QB0A 2G8VA 1HPMA 3T1HK 1KQSM 2FC0A 3QEPA 5DMRA 3F9KA 4F2SA 4FJMA 4KO0A 3ULEB 2YHWA 5KQ8A 1XQSC 3GE1A 1YJ9N 1QZ5A 4DSKA 2XHBA 3KHYA 2D0CA 5CHIA 2QM1A 4JHDB 1RGIA 3VF6A 3MX2A 4LY7A 3H46O 5IT9O 4NCAA 4BRFA 3AO1A 1JL1A 5F1XA 1SZ2A 5ELZA 4FJHA 4O8KA 3PSIA 4O4GA 1VRTA 1HQUA 2OCEA 3ENHA 3AA5X 1FKPA 1JJ2M 1A5VA 4CGJA 1BGXT 4CFBA 3CCVN 1M90O 1HRHA 2KQ2A 4X66K 1YTAA 3WXMB 3P4IA 1K8KA 1IO2A 1ASVA 2CH6A 1T8EA 1IKYA 4K41A 2NLXA 3DLRA 1VQ9N 4DQQA 2X6SA 1LWCA 4MO5A 1NMNA 5BN9A 4DTMA 4CJPA 3NAEA 3MN5A 1QZ6A 3KLHA 3E1YA 3OVNA 4FZXC 3VTIA 4FLXA 3U3YA 4F2RA 4HCCA 5BRDA 1JCGA 4BG8A 2OTLN 1KFDA 2NRZA 4FL9A 5A2QO 4CHZA 4JI3K 1Y97A 3MXMA 4F3TA 1Q18A 3LDNA 1RBUA 4DTUA 4ISFA 1C0TA 3S3NA 3ID8A 1HJOA 5B8HA 2O8CB 5AQGA 4A5BA 3VEXA 3HOTA 4M42A 1NK6A 1SL2A 1NG9A 3E01A 1X3MA 4FJ5A 2OTJN 2P9UA 3CYMA 3QFPA 5BRFA 2H3GX 2W41A 4C23A 3ZSZA 4LFCK 3DXKA 5IWAK 4B1YB 2P9IA 3HI0A 3C6TA 4CERA 4FCYA 3LM9A 3DLEA 4BWJA 5AQYA 1ASWA 4DKWA 4B9UA 1C1BA 3PX0A 3G6EN 4DCHA 1RDDA 2HHVA 2P9KB 1O1WA 5FROA 4B9TA 3H6EA 3J81O 2G8UA 1NJZA 4C8OA 2DY4A 3R9PA 4FM0A 3HSCA 5BR8K 3DWLA 3LM2A 3IMXA 3D2FA 4GMJB 3OTOK 2UU9K 4JK9A 5GAGP 1NJXA 2HNDA 1S6QA 3CCRN 1JXBA 1Z6RA 4F8RA 3HYFA 1RTHA 2HF3A 3T1AA 1Q81O 3VQ9A 3QEXA 3FZFA 3NF8A 2ASOA 3ISNC 1KVBA 3AVGA 1L3UA 1N32K 1SUQA 5J2MA 3OJSA 4K43A 3VGLA 3KIOA 4FLVA 3EO3A 3ENBA 3DMJA 2G8FA 2YJFA 5FRNA 3SBGA 4XIUA 4LH5A 1NK9A 1CXQA 5M1KA 4EZ6A 3BF1A 3OBYA 5AQOA 3N4QA 4A2BA 2OA8A 1CXUA 1Q9YA 1TYQA 1NJWA 2GUPA 2EX3A 4EHTA 3C7NB 1ZBHA 1MDUB 3ZX2A 4FM1A 1VSEA 4O44A 2GELA 4OPHA 1RTJA 4BRAA 3Q7CA 4CHQA 2OPPA 1U2VB 4YFUA 3SV3A 4DTPA 1BIUA 1WOQA 2YI1A 3V1OA 4FJIA 4JKEA 2P9LA 4JK8A 4I9LA 1JL2A 2NRRA 3V9XA 1ZC6A 2Q0RA 2E4LA 5GINA 1B9FA 2E6MA 4DQSA 3CQ8A 2OZMA 2WUSA 3HM8A 3RMDA 3SPYA 4CF1A 4FPAA 3M8PA 1SL0A 2VG6A 2WTUA 2I5JA 5HRPA 4FWKA 3QINA 2QWLA 1S5JA 3JSMA 2D1KA 5CY4A 1SKWA 5AQVA 1BOTO 4CJ3A 3VQQA 4H0OA 3EEQA 4B3MK 1IKVA 3SJJA 2UXBK 4CZFA 3ZSOA 4C8KA 4KHWA 4CJRA 1NK0A 1SV5A 2P9PA 3A2FA 4ID1A 2IGIA 1U4BA 3WNHA 4NLCA 3TSUA 4NB4A 1VSDA 4OPAA 4DTJA 3AVIA 4ILGB 4NCGA 2NRXA 3AGKA 5MLCQ 4E7KA 4JV5K 4RCHA 3OYHA 2UXDK 1RBVA 3CC7N 4M3WA 1NWKA 1YF5L 3OBWA 2YCHA 2I7NA 4DR1K 4B3OA 1OVQA 3DLHA 2KFNA 4K8ZA 4RWTA 3ASMA 4M3TA 3MX5A 4CGHA 5KPTA 2HVIA 1ZBSA 3ZSVA 3LWLA 3P1GA 3SZ2A 1YJWN 1WSEA 3CJ9A 1VSLA 3U9DA 1Q7YO 4MFBA 1HNVA 3K5MA 4IBNA 3OY9A 2ASMA 1U47A 4CK3A 1NJIO 3QLHA 4H5TA 3A5MC 3L4QA 3SJHA 1K8KB 2IVNA 1WSGA 3LPUA 3L3VA 5AZIA 3M3ZA 4QS9A 4CJEA 3AAQA 3THWA 2QI2A 3MCPA 2IOCA 2HW3A 1NGBA 4LF7K 2DTUA 4DR5K 4ELUA 3ZT3A 4K0KK 1RT6A 1EX4A 1YJNN 3VESA 4KH4A 4KHNA 3SQ2A 3NVKA 4FLTA 3LAKA 3ALYA 4JEPA 3AARA 4KH5A 2KZZA 4AHTA 2DFFA 3AV9A 3HOSA 3A5OC 1DTQA 4BDPA 1T6DA 1NOZA 4BC4A 4FWRA 4MLHA 3IG1A 2Z1GA 4OO1J 3MECA 4LH4A 3UKRA 4CGFA 4RW9A 1RDAA 4KB0A 5EX5A 4JK7A 5HRNA 2P9UB 4DFMA 1JCEA 4NO7A 5C12A 1B9DA 2ZM6K 3V1QA 4J8FA 4H5RA 2BGGA 3DXKB 5AJ3K 4FK0A 2GWJA 4A5AA 4Z4HA 3VPZA 1JLEA 1BA1A 1HUXA 1QE1A 5J2QA 4HUGA 2AP1A 4BRLA 4RW4A 3F9MA 3VQ6A 3NMUA 1X9JA 4KREA 4JAXA 5E26A 3MEDA 3VENA 2PAVA 1VSKA 4WFAL 2F9WA 4B9SA 3CG7A 3AA2A 3FR0A 2QKKA 4FJ8A 3D2FB 3FZKA 1L3VA 5AQFA 1DLOA 3LALA 3ZT2A 4BE1A 1KFSA 5HBMA 2QA4N 3JS6A 3O1WA 3RR7A 4B1WB 1QQCA 3WXIA 4DSLA 4W5QA 3I56N 1S1UA 3V9WA 3SAHA 1YT3A 4B9QA 1HJRA 4CEAA 2PY5A 3NH1A 4KFBA 3A5LC 1X9WA 1RTDA 2Q2RA 3P38A 5I9EB 5JICA 3LDSA 3WNGA 1TUYA 1Z25A 1RILA 4IZ9A 3DRRA 1NK7A 1TL1A 3THXB 5AZJB 1WUAA 3LPTA 4YOUA 3MN7A 4HWIA 1O13A 5C42A 3G0ZA 3DLLL 3O4NA 3PIPL 2GTDA 5JS1A 3A8YA 2O8EA 5HRSA 1QSYA 3ATVA 1XNRK 2NUBA 3SQ0A 3UB5A 1XUPO 5M1QA 3U8XA 2FSKA 4HTLA 4E3SA 1GOBA 2NRTA 3BP8A 5K14A 3GL1A 1LAVA 3VA3A 3SYZA 2QEXN 3CM6A 3CCSN 3LDOA 3SBTA 4YOXA 4LF6K 4N47A 4RW6A 4A57A 3TANA 2A1RA 5AQQA 4DTSA 4YOYA 1FKOA 2GEMA 2W6LA 1RT7A 1TK5A 3Q7BA 1T44A 1IBKK 2IVOA 2JLEA 4DTOA 3NF6A 2O4IA 2JGUA 3WQTA 3CC2N 1NMDA 3EZWA 3MXJA 1VQ6N 3BGRA 3H1QA 1C0FA 3O9SA 2A5XA 5I3UA 4LSNA 4TSXA 4C8MA 5J1EA 3M8RA 4DUYK 3HP6A 1BL3A 2GV9A 4E0DA 3LP0A 5J2NA 3SMSA 1VQ5N 1GLFO 1HLUA 5HP1A 4FO0A 3T3FA 1T6CA 2P9PB 4M3XA 4M3RA 1BUPA 3NH0A 1SAZA 4DFKA 3DRSA 1BI4A 2HBLA 4Z4CA 2IAJA 4DR2K 3ZEUB 2HMPA 4BE0A 4OGEA 3CCJN 3ID6A 1LOTB 5AFUH 3R8EA 3SNNA 4M3YA 4FWNA 4BR0A 1G99A 4I9QA 4CEDA 1VSJA 3N4PA 2UUBK 4BR4A 3T69A 1KC8O 4MLEA 4RW8A 4ICLA 3LP2A 5AQKA 1JXEA 1NKEA 4JI2K 2FXUA 4WYBA 3VETA 3JYTA 3QESA 4DR4K 2YKNA 1T7PA 2WBNA 1K9MO 4PWDA 4KTZA 3OJUA 4N5SA 4AHCA 3K5OA 3TI0A 4PL7A 4KI4A 4BQZA 4F4KA 1YHQN 1XNQK 5AZIB 4FLZA 4GVEA 4B3RK 2B6AA 4DV0K 2BH1A 4W5TA 1IG9A 3RWUA 3ZLJA 4I6MB 5KTQA 4YOVA 1GLBG 1NLVA 3U6FA 3CFRA 2QXFA 4CF8A 2E2OA 4JKGA 2G8IA 4WF9L 2F8SA 1SKRA 3HVTA 3WT0A 1VSMA 4DLGA 2G8KA 3O8MA 4H0TB 1ITGA 2OANA 3VOVA 4YOTA 4Z4GA 5DM6L
chains in the Genus database with same CATH topology
1N36K 4DR3K 5FLXO 1IBMK 4DV2K 4CW7B 4DUYK 4V19S 4JI7K 4JI4K 2F4VK 4DR7K 3J7YP 5A2QO 3J80O 4DV5K 4JI3K 4JI0K 4NXNK 4X65K 1FJGK 4LF8K 4AQYK 5LMNK 4DV4K 2UUAK 4B3SK 1XMOK 4DR2K 4LF4K 3J7AP 4X64K 4DV3K 4DR6K 4JI8K 4JI5K 4LF7K 3T1HK 4DR5K 4NXMK 4LFCK 4JYAK 4LFBK 5LL6Z 4K0KK 4LFAK 1HR0K 5IWAK 4YHHK 2UUBK 1J5EK 3T1YK 1XNRK 4JI1K 1IBLK 1N33K 4DUZK 2E5LK 2UXCK 3J81O 4JI2K 4LF9K 4DR4K 2VQFK 4OX9K 5BR8K 5IT9O 1HNXK 2HHHK 1HNZK 3JAMO 3OTOK 1I94K 2UU9K 4DV6K 4B3MK 2UXBK 4JI6K 4LF6K 1XNQK 4B3RK 4GKKK 4DV0K 4KHPK 2VQEK 4X66K 2ZM6K 4YY3K 4X62K 1HNWK 1IBKK 4DV7K 1N34K 5AJ3K 1N32K 1XMQK 4JV5K 5LMUK 2UXDK 4DV1K 4B3TK 4CVNE 4DR1K 4LF5K 4GKJK 2UUCK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 K;  4DR3 K;  5FLX O;  1IBM K;  4DV2 K;  4CW7 B;  4DUY K;  4V19 S;  4JI7 K;  4JI4 K;  2F4V K;  4DR7 K;  3J7Y P;  5A2Q O;  3J80 O;  4DV5 K;  4JI3 K;  4JI0 K;  4NXN K;  4X65 K;  1FJG K;  4LF8 K;  4AQY K;  5LMN K;  4DV4 K;  2UUA K;  4B3S K;  1XMO K;  4DR2 K;  4LF4 K;  3J7A P;  4X64 K;  4DV3 K;  4DR6 K;  4JI8 K;  4JI5 K;  4LF7 K;  3T1H K;  4DR5 K;  4NXM K;  4LFC K;  4JYA K;  4LFB K;  5LL6 Z;  4K0K K;  4LFA K;  1HR0 K;  5IWA K;  4YHH K;  2UUB K;  1J5E K;  3T1Y K;  1XNR K;  4JI1 K;  1IBL K;  1N33 K;  4DUZ K;  2E5L K;  2UXC K;  3J81 O;  4JI2 K;  4LF9 K;  4DR4 K;  2VQF K;  4OX9 K;  5BR8 K;  5IT9 O;  1HNX K;  2HHH K;  1HNZ K;  3JAM O;  3OTO K;  1I94 K;  2UU9 K;  4DV6 K;  4B3M K;  2UXB K;  4JI6 K;  4LF6 K;  1XNQ K;  4B3R K;  4GKK K;  4DV0 K;  4KHP K;  2VQE K;  4X66 K;  2ZM6 K;  4YY3 K;  4X62 K;  1HNW K;  1IBK K;  4DV7 K;  1N34 K;  5AJ3 K;  1N32 K;  1XMQ K;  4JV5 K;  5LMU K;  2UXD K;  4DV1 K;  4B3T K;  4CVN E;  4DR1 K;  4LF5 K;  4GKJ K;  2UUC K; 
#chains in the Genus database with same CATH topology
 5FPN A;  1H1V A;  3B6P A;  4FWO A;  1LCU A;  1QS4 A;  3ZSQ A;  2G8H A;  3P5J A;  3TU5 A;  4KI6 A;  5M1N A;  1I39 A;  4JI4 K;  1X3N A;  3QIO A;  4YDU A;  2YHX A;  1WNS A;  1D8Y A;  3UKR B;  3RRH A;  3KD5 E;  4BR7 A;  2YNH A;  2YNF A;  4HTU A;  1W0H A;  4GNI A;  2XRI A;  2XY6 A;  1BQM A;  3C95 A;  2V51 B;  4BRK A;  2HMI A;  4IOX A;  4DG1 A;  2ZJP L;  2FBY A;  3DXM A;  3S9H A;  5JLH A;  1LWF A;  3DM2 A;  1NJY A;  1I3A A;  2HNY A;  3LAN A;  1KAY A;  4OGC A;  2E1Z A;  4O5B A;  3TAG A;  2P9N A;  3ZSX A;  3HO1 A;  4UY8 O;  4FZY A;  1J9A A;  3CCE N;  4IJA A;  1OH8 A;  4O55 A;  2OYQ A;  1BIS A;  4FJL A;  3UIQ A;  2ZGZ A;  3CJA A;  3OS0 A;  3FZH A;  1R59 O;  4CBW A;  4NLB A;  3V6D A;  2CGK A;  5M1F A;  2NNW A;  1GLC G;  2CGL A;  3O3H A;  2O8B A;  3VGM A;  4U67 L;  3I0S A;  4FXD A;  3D45 A;  2RHK A;  4FWM A;  3DLK A;  1KD1 O;  4BRG A;  4ILH A;  1C0U A;  2PYJ A;  1IKX A;  1XHX A;  4PKH A;  2A3Z A;  1ZBF A;  3MAQ A;  3FFK B;  3QML A;  3H3O B;  1S72 N;  1U04 A;  1WAF A;  2VWK A;  4KV8 A;  5LY3 A;  4DTX A;  4O0J A;  1Z05 A;  3AVL A;  4NYN A;  3THV A;  2YV0 X;  3PO5 A;  4Q5V A;  4O5F A;  1V4S A;  3ITH A;  4KHP K;  2VQE K;  1WAJ A;  3TAB A;  3LP3 A;  4YY3 K;  3AVN A;  2A1S A;  1S3X A;  2WOM A;  4CJL A;  3AO2 A;  3ZSR A;  4PA1 A;  4DV1 K;  2O8E B;  2KLA A;  1NK4 A;  1J54 A;  3ZT1 A;  5C0Y A;  3THY A;  2B4J A;  3EY1 A;  5F2R A;  3VQ4 A;  3PO4 A;  2W6K A;  3DLG A;  1RCH A;  3U9Z A;  5H1S Q;  1OKJ A;  2YJE A;  4BRI A;  3K59 A;  4FYD A;  5AR0 A;  3ZX3 A;  1X1P A;  1JLF A;  4GV3 A;  3PLA A;  4NCB A;  1A5W A;  1UA0 A;  1C6V A;  2F9T A;  3VQ5 A;  4LF8 K;  2D0P A;  4CHY A;  5AQL A;  4AQY K;  4CGD A;  5LMN K;  4DQR A;  4GV6 A;  3GBT A;  3RMB A;  1BHL A;  4PKI A;  1KCF A;  5KGX A;  3VQ7 A;  4CJW A;  4JKF A;  1QHA A;  1NKB A;  3DLB A;  3G10 A;  3GDQ A;  4LF4 K;  5AQI A;  3J7A P;  3IRX A;  4B1Z A;  3OYB A;  1TUU A;  4PQU A;  2FLO A;  2E88 A;  3KVG A;  4W5R A;  4HUF A;  2CGJ A;  4IDK A;  5EY4 A;  3AA4 A;  3HPO A;  1L5U A;  5CZ1 A;  5LL6 Z;  2IC3 A;  5GIO A;  4BC2 A;  2YHA A;  1L3T A;  4IOA L;  1J53 A;  4FLY A;  3AVK A;  4YHH K;  4KTQ A;  3LDP A;  3QO9 A;  4FSV A;  4ISE A;  5T7B A;  5E84 A;  2XO7 A;  4JS4 A;  1N33 K;  2UXC K;  2JWL A;  4LF9 K;  5E41 A;  3KK1 A;  4CEF A;  1HNX K;  4ZTJ A;  5JMV A;  4ZHR A;  1Q86 O;  2QKB A;  4CJ4 A;  1RDW X;  1BI4 B;  4IWV A;  3SUN A;  3A5N C;  4QAG A;  2ZE2 A;  1U49 A;  1Q9X A;  4GKK K;  3WQU A;  1DT9 A;  3VER A;  1TKZ A;  5JS2 A;  3L8B A;  3ZET B;  2YKM A;  3VQE A;  3CI5 A;  4JRQ A;  3OYC A;  2VGN A;  3DJC A;  3UKU B;  1NU0 A;  3OYI A;  4QS8 A;  1WB9 A;  2V7Y A;  3BY5 A;  4YOR A;  3T19 A;  3DI6 A;  3IFR A;  4OKJ A;  4CBU A;  4YNQ A;  4BRQ A;  3QNO A;  3WNF A;  5CR4 A;  1YAG A;  3V9U A;  1NGH A;  1XC3 A;  1DGK N;  3L6Q A;  2WFB A;  4BQL A;  2FF6 A;  2KW4 A;  5CYQ A;  3VEY A;  4CJU A;  1SL1 A;  1UWB A;  4L8R B;  3L4I A;  4JN4 A;  4BWM A;  1ZXO A;  3EN9 A;  3VQ8 A;  2HHT A;  3CCQ N;  1WSJ A;  2D0A A;  1NKC A;  3NGZ A;  2B5J A;  2FBV A;  1K73 O;  4H0X B;  1EO1 A;  3OYM A;  2FSN A;  2O8D A;  1BU6 O;  4DWI A;  3OYA A;  1NGE A;  3G71 N;  3HK2 A;  5SWM A;  4Z94 A;  5GAH P;  4DR6 K;  4DS4 A;  4CFA A;  3HT3 A;  2HNZ A;  4CZL A;  4HUE A;  3E66 A;  3OYF A;  1EKE A;  3HBT A;  4HHT A;  2QWQ A;  4E19 A;  4DFP A;  2X6N A;  5ADX H;  4RTF D;  4AM7 A;  2PFU A;  1ATR A;  3KKS A;  3WNE A;  2PYL A;  4ILJ A;  4CF0 A;  4BDZ A;  3TAF A;  2HBM A;  3TTF A;  2D0O A;  3F2K A;  3LWM A;  3HRG A;  1NGD A;  5HL7 L;  3QEV A;  3M8S A;  5AQX A;  2R7Y A;  2HHH K;  3RRG A;  1C1A A;  1HNZ K;  3AO3 A;  4OVL A;  1B92 A;  1L3S A;  2DPN A;  2V52 B;  3O4Q A;  3DXM B;  3QIC A;  4JI6 K;  2A41 A;  3AVB A;  2HHX A;  5AQM A;  1T03 A;  4M41 A;  3MEE A;  1RDU A;  4WCE L;  3KK7 A;  3ZYY X;  4M45 A;  3ULE A;  1HKG A;  2P9N B;  4E1M A;  3EZ5 A;  4Y0W A;  1F21 A;  1KVA A;  1FW6 A;  3O4W A;  5EU7 A;  4CGG A;  4GW6 A;  5EVZ A;  1CZA N;  3K0S A;  1TK0 A;  2O8B B;  4AHV A;  3KJV A;  3S3O A;  1S22 A;  2FF3 B;  5HRO A;  4CZE A;  3QIP A;  4IXC A;  1Z26 A;  3AY9 A;  3CFO A;  4CZH A;  4EIA A;  1IBM K;  3MCA B;  4IO9 L;  3EYZ A;  1VHX A;  2F8T A;  4IFE A;  2F4V K;  1S1T A;  4CEE A;  4LD0 A;  4PUO A;  3J7Y P;  3L2Q A;  1NNE A;  5GAE P;  3CXC M;  4DV5 K;  2P9I B;  1S9E A;  2E2N A;  3E9L A;  3DOK A;  4FJX A;  1W9H A;  4EFH A;  2HB5 A;  1NGC A;  3R1X A;  3ZT0 A;  4XEI A;  2X78 A;  3CF5 L;  4H5V A;  1HKB A;  4B08 A;  4B9V A;  5CZ2 A;  3VTH A;  3HM9 A;  3THY B;  2NRV A;  3O80 A;  4FJ9 A;  4WQ4 A;  1WN7 A;  2QWM A;  3AVC A;  3C94 A;  1BCO A;  4ISG A;  2OZS A;  5BR9 A;  3HST B;  3QET A;  1IV0 A;  3SUO A;  4WE1 A;  4J2D A;  1JLB A;  4OKE A;  3OS2 A;  2CH5 A;  1UOC A;  2VCP A;  3H3N O;  3JAM O;  1X9S A;  1YTU A;  4BRO A;  4BRM A;  1HNI A;  4JKH A;  1EXQ A;  4H5N A;  3T7Z A;  3SAF A;  1S1X A;  4FWL A;  4BY9 C;  3NDK A;  3LP1 A;  4W5N A;  2FBT A;  3OA9 A;  3OYG A;  1ZYQ A;  3V9Z A;  3W0L A;  4KRF A;  1TL3 A;  2HHS A;  3GG4 A;  4YDU C;  3NE6 A;  1E4G T;  1TYQ B;  4EZ9 A;  3WEE A;  1HNW K;  2PBD A;  1LW2 A;  2P9K A;  1KVC A;  4CEB A;  1BIZ A;  4DTN A;  1GLD G;  1LW0 A;  1E3M A;  4E7I A;  1ILY A;  4R79 A;  2VYP A;  3OYL A;  5JVH L;  4BRH A;  3FLC O;  4OPJ A;  1D4X A;  3CJ1 A;  3PIO L;  2WON A;  4Z0U A;  2P9L B;  4CW7 B;  3BZK A;  4N56 A;  4M3U A;  3FFI A;  1KAZ A;  3VA0 A;  4KHS A;  4I7F A;  3DOL A;  4PKG A;  4XH5 A;  4GV9 A;  4X65 K;  1Y64 A;  5LJW A;  1WSI A;  2DFH A;  2Q0U A;  4AHS A;  3SCX A;  1ESV A;  1IH7 A;  3NF7 A;  4FJJ A;  2VG5 A;  4PL8 A;  1TVR A;  1N6Q A;  4GY2 B;  2A42 A;  4IOC L;  4B3S K;  2BDP A;  2O8F A;  3HZ6 A;  2QW9 A;  4CEO A;  2NZT A;  5HLF A;  1XMO K;  2W42 A;  4OPK A;  4IO8 A;  4I2Q A;  3I55 N;  3I0R A;  3S41 A;  1RT2 A;  1HX1 A;  1YIT N;  3L2V A;  4DFJ A;  4JI5 K;  3MDQ A;  3EL2 A;  3FE1 A;  4DSF A;  2D5R A;  4YOW A;  3K9K A;  4BR2 A;  5C24 A;  2P5G A;  3HTV A;  1S6P A;  5FDL A;  3T1Y K;  4ID5 A;  1LAW A;  3M6G A;  3RMC A;  3AVJ A;  2E5L K;  1TK8 A;  1SKS A;  4OX9 K;  3BZC A;  3K5L A;  5HRR A;  2Z1J A;  1QQN A;  1VQK N;  4FWQ A;  1VQM N;  4BGA A;  4CJK A;  3MN9 A;  3P31 A;  2YX6 A;  3RVC A;  3DRP A;  2BUP A;  2E6L A;  1ZBU A;  4CK2 A;  1BG3 A;  1HMV A;  3QEW A;  1JCF A;  4FM2 A;  3TAE A;  3V9S A;  1A5X A;  4DSI A;  4H4M A;  4CJV A;  1M1K O;  4BR5 A;  4O0I A;  1NBW A;  3C6A A;  3BUZ B;  2HF4 A;  2E1Y A;  3SPZ A;  4B9N A;  4BDY A;  5M1P A;  5SZT A;  3HPH A;  4FVM A;  4E7L A;  1D9D A;  5AFU A;  4GVM A;  2KKZ A;  4N76 A;  5AQP A;  5C15 A;  2UUC K;  5GAD P;  4CJS A;  3KLI A;  3AO5 A;  2Q1N A;  1N8R O;  3LDL A;  1U6Z A;  2HBJ A;  4DV2 K;  1RBS A;  3THW B;  3BEX A;  4N41 A;  3CCL N;  3FZL A;  2E2Q A;  1YXQ A;  3K57 A;  2Q31 A;  3J80 O;  3OYN A;  2YHB A;  1FJG K;  5EOY A;  3NGI A;  4DMN A;  1OVY A;  4BAC A;  3C6U A;  4CGI A;  3VEW A;  4CK1 A;  5AQJ A;  3JXU A;  3VMF B;  2UUA K;  1HYV A;  3VQC A;  4K42 A;  4BRE A;  3IUC A;  3OYE A;  3MMV A;  3VGK A;  3WUH A;  4DU1 A;  3P83 D;  4BVP A;  4H03 B;  5BRE A;  3KK2 A;  3TWH A;  4JLH A;  4EAH D;  5AQH A;  4Z4F A;  3QDK A;  3D2E A;  4CJT A;  1QTM A;  3TSP A;  3AVF A;  1TKD A;  2RE2 A;  3CD6 N;  2BTF A;  2RF2 A;  1DTT A;  3O5B A;  4C1N I;  3TAP A;  4FLU A;  1LV5 A;  1W7A A;  5AQR A;  3TAQ A;  4CES A;  4CJ5 A;  4BRN A;  4CF9 A;  2YNI A;  2E2P A;  2QWN A;  4DUZ K;  3ULD A;  5LJV A;  4DQI A;  2VWJ A;  2FSJ A;  3CPW M;  3AVH A;  3CCM N;  3O1B A;  3RMA A;  1GLJ O;  3AVA A;  1E4F T;  2Y1I A;  1I94 K;  4AHR A;  5D3G A;  3NCI A;  1ASU A;  4PY5 A;  4KB1 A;  4DQ8 A;  2ASP A;  3O9R A;  3IAY A;  3MK6 A;  3C65 A;  2Z1H A;  1QQO A;  5AQW A;  1VSH A;  2ZJQ L;  3CJ7 A;  2F96 A;  3LL3 A;  5M1O A;  1EET A;  1WLJ A;  3K9J A;  2EHG A;  3KWG A;  4DF4 A;  1GLL O;  4X62 K;  5I42 A;  4IDH A;  1TAQ A;  4J2E A;  1HPZ A;  3IS9 A;  4BVO A;  1XMQ K;  1LWE A;  1IJJ A;  4CFD A;  1D9F A;  4F3O A;  4LSL A;  4MDB A;  4BC5 A;  3P39 A;  4DU3 A;  1W2B M;  4B3T K;  1RT4 A;  1C0M A;  4Z4I A;  4A61 A;  1QSL A;  1TKT A;  5FLX O;  5F0X A;  1ZBL A;  3LZJ A;  2KTQ A;  2YNG A;  1YUW A;  1TKX A;  2XY7 A;  4JKC A;  3IDH A;  3M5R A;  4QCL A;  3SQ4 A;  3RSE A;  2Z1I A;  1RBT A;  2QXL A;  4CFC A;  4LC9 B;  1QSS A;  2ITG A;  3CJB A;  4BC3 A;  3V1R A;  3ZX0 A;  5JVG L;  3OS1 A;  2WC9 A;  1OH6 A;  1RT1 A;  3J8A A;  4FOE A;  5FPE A;  4B8C A;  4OLB A;  4OLA A;  4MDA A;  2AA4 A;  4H4O A;  3WEE B;  4CJ7 A;  5GIP A;  4EP5 A;  3CIP A;  4DLE A;  1KTQ A;  3OYJ A;  4WQ5 A;  5KRS A;  1HKC A;  3QBX A;  3MWT A;  4IEI A;  1VQ8 N;  1BQN A;  3CQY A;  3TR8 A;  1Q8I A;  3SV4 A;  3EE9 A;  4LFB K;  1V4T A;  3I33 A;  2IDO A;  3NF9 A;  4AIL C;  3L2R A;  3OYK A;  2GX9 A;  4MQ3 A;  4DTR A;  4JI1 K;  2HHU A;  1T3V A;  2QWP A;  4C8L A;  4DQP A;  3DYA A;  4PHT X;  4WFN L;  3KTQ A;  3NHG A;  2HBK A;  4FK4 A;  2VQF K;  3K58 A;  4F9O A;  3VF4 A;  4DS5 A;  2V7Z A;  3KWI A;  1VQP N;  2P51 A;  1K8A O;  1NGG A;  2O8F B;  4WFB L;  4IFY A;  3LZI A;  4MO4 A;  3VF2 A;  3L2W A;  3THX A;  1G15 A;  4CEC A;  5AZJ A;  1OH7 A;  3FGU A;  1XWL A;  4FPB A;  2IS3 A;  1WBB A;  4CCH A;  4CBX A;  3LDQ A;  4BGB A;  3L2U A;  2XY8 A;  1NGI A;  3ENO A;  1OH5 A;  4Y1C A;  1UAX A;  1N34 K;  1EWQ A;  3CCU N;  4KHU A;  3MN6 A;  4BRD A;  3KLE A;  3ZCM A;  4C1N K;  1RT3 A;  5LMU K;  1ATS A;  2JWK A;  3TAR A;  2OPS A;  3CQX A;  3PX6 A;  4M7Y A;  4AHU A;  1UA1 A;  4H0V B;  4W5O A;  1TAU A;  4CZG A;  4A62 A;  1NGA A;  1N36 K;  4JI7 K;  3SMP A;  3GOI A;  3VQP A;  5AQN A;  2OPR A;  5KGW A;  3U3G A;  4O8U A;  4WQ4 C;  2HHQ A;  1D5A A;  2Q3S A;  4DV4 K;  1XHZ A;  4CD3 A;  1ZBI A;  4FW2 A;  3CET A;  4BR9 A;  2LSN A;  3I8B A;  2W40 A;  2J4R A;  3U4L A;  4B1X B;  2A40 A;  4DSJ A;  4BRC A;  3KZB A;  4JD2 A;  1QHT A;  4JI8 K;  5BPM A;  4IEE A;  3B6O A;  1WSH A;  4CI6 A;  3UE5 A;  4JYA K;  3D0P A;  3V81 A;  3H1V X;  1JLC A;  4H8K A;  3WXL A;  2FBX A;  3O9U A;  4CE9 A;  4KHQ A;  5C10 A;  1IKW A;  3M8Q A;  1YVU A;  1MWM A;  3H45 C;  3QNN A;  4JKG B;  5AQT A;  1IBL K;  3V4I A;  3TTC A;  3SQ1 A;  3R3L A;  2HHW A;  3NGY A;  3AAP A;  2RPI A;  3TSQ A;  4E1N A;  4FJ7 A;  2D0B A;  3ZEU A;  2IVP A;  3L0Q A;  4IJN A;  4JKA A;  3TAM A;  4CJQ A;  2KFZ A;  4BG9 A;  4DHY A;  3KKR A;  2QTD A;  4DV6 K;  3CC4 N;  2O4G A;  4FWS A;  5CYM A;  3FZM A;  2P5O A;  4JKB A;  4K25 A;  1FK9 A;  3PSF A;  4FW1 A;  3W3D A;  1KRP A;  3CMA N;  2ZD1 A;  3R6M A;  1MWK A;  3IKM A;  3D2E B;  3SUQ A;  1XC9 A;  4IG3 A;  4FWP A;  3EE8 A;  3CHW A;  3CFP A;  4U7B A;  3EKU A;  3J7Z O;  2P9S A;  1DKG D;  1NM1 A;  4E7J A;  4NYF A;  5FPM A;  1YI2 N;  1RDC A;  5DK5 A;  2YHY A;  4CEQ A;  5JLF A;  2KHO A;  5C2F A;  1BDG A;  3D7E O;  1MU2 A;  3VEO A;  4B8A B;  4FJG A;  2F7T A;  5KQD A;  3M1F A;  4LF5 K;  4GKJ K;  2IIR A;  3SLC A;  5CE3 A;  4KBO A;  3HVR A;  4DR3 K;  1NGJ A;  1NGF A;  4IKF A;  4CEZ A;  4ELV A;  5ADX A;  2VWB A;  4M63 C;  3KLG A;  3AGR A;  1SS6 A;  4CZM A;  4B1U B;  4BE2 A;  4HCB A;  4DB3 A;  4NXN K;  4JI0 K;  4CIF A;  1GOC A;  1J6Z A;  4I6M A;  3KK3 A;  4JHD A;  3O3G A;  2G8W A;  3G25 A;  3MWP A;  3CER A;  4CJF A;  3RR8 A;  5BN8 A;  2VGM A;  1NOY A;  1T05 A;  4JNE A;  4L3Q A;  4AH9 A;  2ITM A;  2X74 A;  1ATN A;  3CME N;  3K5N A;  2Q97 A;  3HP9 A;  3F5T A;  5DM7 L;  3VEZ A;  1J5O A;  1GOA A;  1KLM A;  1VAZ A;  5C25 A;  4FLW A;  1JKH A;  3L3U A;  1RT5 A;  2P1J A;  1HR0 K;  2NRH A;  1RFQ A;  1K6Y A;  2GWK A;  4J2A A;  1S1V A;  1X9M A;  3DAW A;  3RSE B;  3TTD A;  3F73 A;  2A6A A;  4QOZ B;  4FJN A;  4HVJ A;  1S1W A;  1P8Z A;  2DFE A;  3OYD A;  3VEV A;  2QK9 A;  1WSF A;  2ATQ A;  4Z4E A;  4Q0B A;  4K8X A;  3G4S N;  3SK3 A;  4XH1 A;  5BPN A;  4M7X A;  5AQZ A;  2PZS A;  4FJK A;  1YVN A;  4CHP A;  1KSP A;  2GBZ A;  5FPD A;  5TKW A;  3OHR A;  1VQ4 N;  1QVG M;  1KXP A;  4OKK A;  2ZF5 O;  1NK8 A;  2Q36 A;  1HQE A;  2O8C A;  4UQG A;  2Y1J A;  3SI6 A;  1HYS A;  4KPY A;  4AF1 A;  4DV7 K;  3KLF A;  4ELT A;  3HXM A;  4FOI A;  1VQ7 N;  1XI1 A;  1RTI A;  1W97 L;  1U45 A;  2BAN A;  2HOE A;  4FZZ A;  4CHO A;  3C0B A;  2ZGY A;  1VRU A;  3E9O A;  3HPG A;  3ZSW A;  5FRM A;  1BCM A;  1TV6 A;  3O9T A;  2AJQ A;  4B9M A;  3SUP A;  3MXI A;  4KTW A;  2GUI A;  4V19 S;  4FVU A;  2ZQB A;  2HST A;  1CZ9 A;  1RNH A;  2KZM A;  2ZJR L;  1S9G A;  1BO5 O;  3NH2 A;  1KLN A;  2HVH A;  3EKS A;  4EP4 A;  4E7H A;  4I2P A;  3NFA A;  1WBD A;  4ZTF A;  3O3F A;  4AM6 A;  4CF2 A;  2EWS A;  4CZK A;  3PY8 A;  1SQK A;  4JS5 A;  3MEG A;  1CLQ A;  5EXW A;  5AQS A;  4X64 K;  4DV3 K;  1BA0 A;  3I8D A;  4FK2 A;  1EP4 A;  4XH4 A;  3NVM A;  1KAX A;  3D6R A;  2ZWH A;  4G9Z A;  2NRW A;  1GLE G;  4NXM K;  3ZSY A;  4DU4 A;  3RTV A;  3LAM A;  5KI6 A;  4LFA K;  1QVF M;  3PUF A;  3HL8 A;  1P90 A;  1C0G A;  1J5E K;  1JLQ A;  5AQU A;  2UYT A;  4CD1 A;  3E9P A;  5KPZ A;  4KHY A;  1DEJ A;  1Q82 O;  1EQY A;  2OPQ A;  4CHN A;  4JKD A;  1R0A A;  4QS7 A;  4EHU A;  2E20 A;  4R5P A;  2D4W A;  3ZT4 A;  5KPR A;  2ETJ A;  4KH6 A;  4B1V A;  4OJR A;  1REV A;  1VQN N;  3QBW A;  1TGO A;  3VN5 A;  1VQO N;  3WXJ A;  1VK0 A;  1N5Y A;  4M3Z A;  4CZI A;  1NK5 A;  3BDP A;  5J2P A;  2RN2 A;  5HOO A;  3OW2 M;  2QWR A;  3S3M A;  1RDB A;  3AO4 A;  3O9Q A;  5TKY A;  4B9L A;  1U48 A;  4JD2 B;  3C7N A;  2BE2 A;  4J2B A;  3ATU A;  4RW7 A;  3PV8 A;  4KAZ A;  4CZJ A;  4DF8 A;  3NBP A;  2E8A A;  4Y1D A;  3VQA A;  1U2V A;  5KRT A;  3CPE A;  4G1Q A;  1YIJ N;  4A59 A;  2XY5 A;  1BWF O;  3KD1 E;  4IFV A;  3CM5 A;  3C6H A;  4CIG A;  1IG8 A;  4CVN E;  1C1C A;  3O6W A;  2O8D B;  5BRH A;  4H0Y B;  1VSI A;  1FXX A;  1JLG A;  2RKI A;  3VQD A;  4WQ5 C;  2VG7 A;  3H08 A;  3B8A X;  3QFU A;  4DR7 K;  3CJC A;  3BF3 A;  3K2P A;  4DSE A;  1EWR A;  3AVM A;  3A0I X;  3ZET A;  1RBR A;  3AA3 A;  4CIE A;  4BRP A;  5BPL A;  1MA9 B;  3UKU A;  1VQL N;  4A2A A;  3VQB A;  3TPQ A;  4H5W A;  1CZB A;  3QER A;  3HJF A;  4JRP A;  3QEI A;  5C2D A;  2I7P A;  3SAG A;  2P9S B;  3O08 A;  4E1J A;  1VSF A;  1JLA A;  4H0P A;  3WXK A;  1QQM A;  4RG8 A;  3PX4 A;  4KKO A;  4IG0 A;  4C8N A;  1GLA G;  4E89 A;  2QWO A;  1HYZ A;  3QB0 A;  2G8V A;  1HPM A;  3T1H K;  1KQS M;  2FC0 A;  3QEP A;  5DMR A;  3F9K A;  4F2S A;  4FJM A;  4KO0 A;  3ULE B;  2YHW A;  5KQ8 A;  1XQS C;  3GE1 A;  1YJ9 N;  1QZ5 A;  4DSK A;  2XHB A;  3KHY A;  2D0C A;  5CHI A;  2QM1 A;  4JHD B;  1RGI A;  3VF6 A;  3MX2 A;  4LY7 A;  3H46 O;  5IT9 O;  4NCA A;  4BRF A;  3AO1 A;  1JL1 A;  5F1X A;  1SZ2 A;  5ELZ A;  4FJH A;  4O8K A;  3PSI A;  4O4G A;  1VRT A;  1HQU A;  2OCE A;  3ENH A;  3AA5 X;  1FKP A;  1JJ2 M;  1A5V A;  4CGJ A;  1BGX T;  4CFB A;  3CCV N;  1M90 O;  1HRH A;  2KQ2 A;  4X66 K;  1YTA A;  3WXM B;  3P4I A;  1K8K A;  1IO2 A;  1ASV A;  2CH6 A;  1T8E A;  1IKY A;  4K41 A;  2NLX A;  3DLR A;  1VQ9 N;  4DQQ A;  2X6S A;  1LWC A;  4MO5 A;  1NMN A;  5BN9 A;  4DTM A;  4CJP A;  3NAE A;  3MN5 A;  1QZ6 A;  3KLH A;  3E1Y A;  3OVN A;  4FZX C;  3VTI A;  4FLX A;  3U3Y A;  4F2R A;  4HCC A;  5BRD A;  1JCG A;  4BG8 A;  2OTL N;  1KFD A;  2NRZ A;  4FL9 A;  5A2Q O;  4CHZ A;  4JI3 K;  1Y97 A;  3MXM A;  4F3T A;  1Q18 A;  3LDN A;  1RBU A;  4DTU A;  4ISF A;  1C0T A;  3S3N A;  3ID8 A;  1HJO A;  5B8H A;  2O8C B;  5AQG A;  4A5B A;  3VEX A;  3HOT A;  4M42 A;  1NK6 A;  1SL2 A;  1NG9 A;  3E01 A;  1X3M A;  4FJ5 A;  2OTJ N;  2P9U A;  3CYM A;  3QFP A;  5BRF A;  2H3G X;  2W41 A;  4C23 A;  3ZSZ A;  4LFC K;  3DXK A;  5IWA K;  4B1Y B;  2P9I A;  3HI0 A;  3C6T A;  4CER A;  4FCY A;  3LM9 A;  3DLE A;  4BWJ A;  5AQY A;  1ASW A;  4DKW A;  4B9U A;  1C1B A;  3PX0 A;  3G6E N;  4DCH A;  1RDD A;  2HHV A;  2P9K B;  1O1W A;  5FRO A;  4B9T A;  3H6E A;  3J81 O;  2G8U A;  1NJZ A;  4C8O A;  2DY4 A;  3R9P A;  4FM0 A;  3HSC A;  5BR8 K;  3DWL A;  3LM2 A;  3IMX A;  3D2F A;  4GMJ B;  3OTO K;  2UU9 K;  4JK9 A;  5GAG P;  1NJX A;  2HND A;  1S6Q A;  3CCR N;  1JXB A;  1Z6R A;  4F8R A;  3HYF A;  1RTH A;  2HF3 A;  3T1A A;  1Q81 O;  3VQ9 A;  3QEX A;  3FZF A;  3NF8 A;  2ASO A;  3ISN C;  1KVB A;  3AVG A;  1L3U A;  1N32 K;  1SUQ A;  5J2M A;  3OJS A;  4K43 A;  3VGL A;  3KIO A;  4FLV A;  3EO3 A;  3ENB A;  3DMJ A;  2G8F A;  2YJF A;  5FRN A;  3SBG A;  4XIU A;  4LH5 A;  1NK9 A;  1CXQ A;  5M1K A;  4EZ6 A;  3BF1 A;  3OBY A;  5AQO A;  3N4Q A;  4A2B A;  2OA8 A;  1CXU A;  1Q9Y A;  1TYQ A;  1NJW A;  2GUP A;  2EX3 A;  4EHT A;  3C7N B;  1ZBH A;  1MDU B;  3ZX2 A;  4FM1 A;  1VSE A;  4O44 A;  2GEL A;  4OPH A;  1RTJ A;  4BRA A;  3Q7C A;  4CHQ A;  2OPP A;  1U2V B;  4YFU A;  3SV3 A;  4DTP A;  1BIU A;  1WOQ A;  2YI1 A;  3V1O A;  4FJI A;  4JKE A;  2P9L A;  4JK8 A;  4I9L A;  1JL2 A;  2NRR A;  3V9X A;  1ZC6 A;  2Q0R A;  2E4L A;  5GIN A;  1B9F A;  2E6M A;  4DQS A;  3CQ8 A;  2OZM A;  2WUS A;  3HM8 A;  3RMD A;  3SPY A;  4CF1 A;  4FPA A;  3M8P A;  1SL0 A;  2VG6 A;  2WTU A;  2I5J A;  5HRP A;  4FWK A;  3QIN A;  2QWL A;  1S5J A;  3JSM A;  2D1K A;  5CY4 A;  1SKW A;  5AQV A;  1BOT O;  4CJ3 A;  3VQQ A;  4H0O A;  3EEQ A;  4B3M K;  1IKV A;  3SJJ A;  2UXB K;  4CZF A;  3ZSO A;  4C8K A;  4KHW A;  4CJR A;  1NK0 A;  1SV5 A;  2P9P A;  3A2F A;  4ID1 A;  2IGI A;  1U4B A;  3WNH A;  4NLC A;  3TSU A;  4NB4 A;  1VSD A;  4OPA A;  4DTJ A;  3AVI A;  4ILG B;  4NCG A;  2NRX A;  3AGK A;  5MLC Q;  4E7K A;  4JV5 K;  4RCH A;  3OYH A;  2UXD K;  1RBV A;  3CC7 N;  4M3W A;  1NWK A;  1YF5 L;  3OBW A;  2YCH A;  2I7N A;  4DR1 K;  4B3O A;  1OVQ A;  3DLH A;  2KFN A;  4K8Z A;  4RWT A;  3ASM A;  4M3T A;  3MX5 A;  4CGH A;  5KPT A;  2HVI A;  1ZBS A;  3ZSV A;  3LWL A;  3P1G A;  3SZ2 A;  1YJW N;  1WSE A;  3CJ9 A;  1VSL A;  3U9D A;  1Q7Y O;  4MFB A;  1HNV A;  3K5M A;  4IBN A;  3OY9 A;  2ASM A;  1U47 A;  4CK3 A;  1NJI O;  3QLH A;  4H5T A;  3A5M C;  3L4Q A;  3SJH A;  1K8K B;  2IVN A;  1WSG A;  3LPU A;  3L3V A;  5AZI A;  3M3Z A;  4QS9 A;  4CJE A;  3AAQ A;  3THW A;  2QI2 A;  3MCP A;  2IOC A;  2HW3 A;  1NGB A;  4LF7 K;  2DTU A;  4DR5 K;  4ELU A;  3ZT3 A;  4K0K K;  1RT6 A;  1EX4 A;  1YJN N;  3VES A;  4KH4 A;  4KHN A;  3SQ2 A;  3NVK A;  4FLT A;  3LAK A;  3ALY A;  4JEP A;  3AAR A;  4KH5 A;  2KZZ A;  4AHT A;  2DFF A;  3AV9 A;  3HOS A;  3A5O C;  1DTQ A;  4BDP A;  1T6D A;  1NOZ A;  4BC4 A;  4FWR A;  4MLH A;  3IG1 A;  2Z1G A;  4OO1 J;  3MEC A;  4LH4 A;  3UKR A;  4CGF A;  4RW9 A;  1RDA A;  4KB0 A;  5EX5 A;  4JK7 A;  5HRN A;  2P9U B;  4DFM A;  1JCE A;  4NO7 A;  5C12 A;  1B9D A;  2ZM6 K;  3V1Q A;  4J8F A;  4H5R A;  2BGG A;  3DXK B;  5AJ3 K;  4FK0 A;  2GWJ A;  4A5A A;  4Z4H A;  3VPZ A;  1JLE A;  1BA1 A;  1HUX A;  1QE1 A;  5J2Q A;  4HUG A;  2AP1 A;  4BRL A;  4RW4 A;  3F9M A;  3VQ6 A;  3NMU A;  1X9J A;  4KRE A;  4JAX A;  5E26 A;  3MED A;  3VEN A;  2PAV A;  1VSK A;  4WFA L;  2F9W A;  4B9S A;  3CG7 A;  3AA2 A;  3FR0 A;  2QKK A;  4FJ8 A;  3D2F B;  3FZK A;  1L3V A;  5AQF A;  1DLO A;  3LAL A;  3ZT2 A;  4BE1 A;  1KFS A;  5HBM A;  2QA4 N;  3JS6 A;  3O1W A;  3RR7 A;  4B1W B;  1QQC A;  3WXI A;  4DSL A;  4W5Q A;  3I56 N;  1S1U A;  3V9W A;  3SAH A;  1YT3 A;  4B9Q A;  1HJR A;  4CEA A;  2PY5 A;  3NH1 A;  4KFB A;  3A5L C;  1X9W A;  1RTD A;  2Q2R A;  3P38 A;  5I9E B;  5JIC A;  3LDS A;  3WNG A;  1TUY A;  1Z25 A;  1RIL A;  4IZ9 A;  3DRR A;  1NK7 A;  1TL1 A;  3THX B;  5AZJ B;  1WUA A;  3LPT A;  4YOU A;  3MN7 A;  4HWI A;  1O13 A;  5C42 A;  3G0Z A;  3DLL L;  3O4N A;  3PIP L;  2GTD A;  5JS1 A;  3A8Y A;  2O8E A;  5HRS A;  1QSY A;  3ATV A;  1XNR K;  2NUB A;  3SQ0 A;  3UB5 A;  1XUP O;  5M1Q A;  3U8X A;  2FSK A;  4HTL A;  4E3S A;  1GOB A;  2NRT A;  3BP8 A;  5K14 A;  3GL1 A;  1LAV A;  3VA3 A;  3SYZ A;  2QEX N;  3CM6 A;  3CCS N;  3LDO A;  3SBT A;  4YOX A;  4LF6 K;  4N47 A;  4RW6 A;  4A57 A;  3TAN A;  2A1R A;  5AQQ A;  4DTS A;  4YOY A;  1FKO A;  2GEM A;  2W6L A;  1RT7 A;  1TK5 A;  3Q7B A;  1T44 A;  1IBK K;  2IVO A;  2JLE A;  4DTO A;  3NF6 A;  2O4I A;  2JGU A;  3WQT A;  3CC2 N;  1NMD A;  3EZW A;  3MXJ A;  1VQ6 N;  3BGR A;  3H1Q A;  1C0F A;  3O9S A;  2A5X A;  5I3U A;  4LSN A;  4TSX A;  4C8M A;  5J1E A;  3M8R A;  4DUY K;  3HP6 A;  1BL3 A;  2GV9 A;  4E0D A;  3LP0 A;  5J2N A;  3SMS A;  1VQ5 N;  1GLF O;  1HLU A;  5HP1 A;  4FO0 A;  3T3F A;  1T6C A;  2P9P B;  4M3X A;  4M3R A;  1BUP A;  3NH0 A;  1SAZ A;  4DFK A;  3DRS A;  1BI4 A;  2HBL A;  4Z4C A;  2IAJ A;  4DR2 K;  3ZEU B;  2HMP A;  4BE0 A;  4OGE A;  3CCJ N;  3ID6 A;  1LOT B;  5AFU H;  3R8E A;  3SNN A;  4M3Y A;  4FWN A;  4BR0 A;  1G99 A;  4I9Q A;  4CED A;  1VSJ A;  3N4P A;  2UUB K;  4BR4 A;  3T69 A;  1KC8 O;  4MLE A;  4RW8 A;  4ICL A;  3LP2 A;  5AQK A;  1JXE A;  1NKE A;  4JI2 K;  2FXU A;  4WYB A;  3VET A;  3JYT A;  3QES A;  4DR4 K;  2YKN A;  1T7P A;  2WBN A;  1K9M O;  4PWD A;  4KTZ A;  3OJU A;  4N5S A;  4AHC A;  3K5O A;  3TI0 A;  4PL7 A;  4KI4 A;  4BQZ A;  4F4K A;  1YHQ N;  1XNQ K;  5AZI B;  4FLZ A;  4GVE A;  4B3R K;  2B6A A;  4DV0 K;  2BH1 A;  4W5T A;  1IG9 A;  3RWU A;  3ZLJ A;  4I6M B;  5KTQ A;  4YOV A;  1GLB G;  1NLV A;  3U6F A;  3CFR A;  2QXF A;  4CF8 A;  2E2O A;  4JKG A;  2G8I A;  4WF9 L;  2F8S A;  1SKR A;  3HVT A;  3WT0 A;  1VSM A;  4DLG A;  2G8K A;  3O8M A;  4H0T B;  1ITG A;  2OAN A;  3VOV A;  4YOT A;  4Z4G A;  5DM6 L; 
#chains in the Genus database with same CATH homology
 1N36 K;  4DR3 K;  5FLX O;  1IBM K;  4DV2 K;  4CW7 B;  4DUY K;  4V19 S;  4JI7 K;  4JI4 K;  2F4V K;  4DR7 K;  3J7Y P;  5A2Q O;  3J80 O;  4DV5 K;  4JI3 K;  4JI0 K;  4NXN K;  4X65 K;  1FJG K;  4LF8 K;  4AQY K;  5LMN K;  4DV4 K;  2UUA K;  4B3S K;  1XMO K;  4DR2 K;  4LF4 K;  3J7A P;  4X64 K;  4DV3 K;  4DR6 K;  4JI8 K;  4JI5 K;  4LF7 K;  3T1H K;  4DR5 K;  4NXM K;  4LFC K;  4JYA K;  4LFB K;  5LL6 Z;  4K0K K;  4LFA K;  1HR0 K;  5IWA K;  4YHH K;  2UUB K;  1J5E K;  3T1Y K;  1XNR K;  4JI1 K;  1IBL K;  1N33 K;  4DUZ K;  2E5L K;  2UXC K;  3J81 O;  4JI2 K;  4LF9 K;  4DR4 K;  2VQF K;  4OX9 K;  5BR8 K;  5IT9 O;  1HNX K;  2HHH K;  1HNZ K;  3JAM O;  3OTO K;  1I94 K;  2UU9 K;  4DV6 K;  4B3M K;  2UXB K;  4JI6 K;  4LF6 K;  1XNQ K;  4B3R K;  4GKK K;  4DV0 K;  4KHP K;  2VQE K;  4X66 K;  2ZM6 K;  4YY3 K;  4X62 K;  1HNW K;  1IBK K;  4DV7 K;  1N34 K;  5AJ3 K;  1N32 K;  1XMQ K;  4JV5 K;  5LMU K;  2UXD K;  4DV1 K;  4B3T K;  4CVN E;  4DR1 K;  4LF5 K;  4GKJ K;  2UUC K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...