1DLOA

Human immunodeficiency virus type 1
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 REVERSE TRANSCRIPTASE
publication title Structure of unliganded HIV-1 reverse transcriptase at 2.7 A resolution: implications of conformational changes for polymerization and inhibition mechanisms.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 129
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1dloA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dloA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dloA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dloA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1dloA05
3CFRA 4ECZA 2HNDA 3NL0A 1CZBA 3GIIA 2OPPA 2BGGA 4Q0BB 2AJQA 4Q0BA 1HQUA 4B9TA 2JEIA 4NLUA 4LH5A 4CCHA 1JLEA 1QTMA 1EETB 3OS2A 2RN2A 1EETA 5KG1A 4FM1A 1VRTB 3H5SA 1GOAA 2G8WA 4WYLA 4F3TA 4FBTA 1VRTA 1CSJA 3KJVB 4IR9A 5KFTA 1VSEA 2J6UA 3GV7B 1BGXT 1JLCB 3VQ8A 1JLCA 3CJ4A 3LAKA 4U7CA 4WYWA 3NAHA 4AHSA 4KHUA 5DG9A 4W5NA 3QEPA 2ZE2B 2W42A 1JXBA 3SFUA 1TGOA 4Z4GA 5K14B 4ECYA 1S6QB 2ATLA 2QKKA 1C1CA 1TL1B 3NE6A 3BGRB 4I2PB 4ECTA 4OLBA 3BGRA 4I2PA 2R2TA 3H08A 3TARA 3S3OA 4FZYA 1RBSA 4FLXA 3I5AA 4BE0A 2ITGA 3NBPB 4F4YA 2XGPA 4E7JA 4OGCA 3CM6A 3QGIA 3K2PA 5C24A 2I5JB 3PW7A 3P83D 2XY7A 2EC0A 3AA4A 4J2BA 1L3UA 3C6UB 3CIZA 3C6UA 3N6LA 2HMIB 4CGFA 1ZETA 2HMIA 4YMEA 3L2VA 3KTQA 3QYYA 1HQEB 3H59A 2VG5A 3CDEA 1HQEA 4QW9A 4IFYB 1S9EB 1S9EA 1NK5A 2IM2A 4KPYA 3SPYA 3G6YA 4DS4A 2BANB 4ZMMA 4B8AB 1W0HA 1UA0A 4IDKB 4CEFA 1BQMA 4Y2AA 4IDKA 5DLGA 1RBRA 4YNQA 2HVHA 4DMNA 1SKRA 4N41A 1IG9A 3MEGB 4HCCA 4ZP8A 1X9MA 1S9GA 3MEGA 3C6TB 4KHNA 3C6TA 1KCFA 5EUHA 5FRMA 4FJ5A 3SFGA 3QIDA 2E4LA 5KFCA 1TK8A 2A1SA 3KIOA 4TY9A 3U3GA 4DL4A 4AHRA 4PWDB 4N47A 5EDWA 4PWDA 3I8DA 1RT6B 4LQ3A 1J54A 1QSYA 4QCLA 3QETA 4NCGB 1CLQA 4NCGA 4ED6A 1RT3A 5J2MB 3VQEA 4GVMA 2ILYA 3QEWA 3V6DB 4F50A 4WXOA 5JUMA 3ZSVA 3E51A 2Z1JA 4O3RA 5DQHA 3VA0A 4GC6A 3DRRB 1TKZA 2IM1A 1ASWA 1TKDA 4NLSA 3T5LA 3A2FA 5KGWA 1FKPB 3NHGA 2YHAA 4BDYA 4EBDA 4K4ZA 5KGXA 5HLFB 4XO0A 4JV0A 5HLFA 1KLMA 3M9NB 4B9NA 1L3TA 1C6VA 5KTQA 3KD5E 2GV9A 2W9CA 4YR2A 1JKHB 3CYMA 4BWJA 1JKHA 4ECVA 4OLAA 4HTUA 3TQ1A 4Q8FA 1UAXA 4DQRA 1IH7A 4NLXA 3DRSB 5KFVA 3PW0A 4H54A 3RWUA 5FDLA 4RG8A 4CHQA 3TAPA 4FLVA 2D0CA 3SQ0A 4FCYA 2UUWA 1C1BB 1LW0B 3OSNA 1C1BA 1LW0A 3NGDA 3V81B 4RW8B 3V81A 2YKMA 3CJ5A 4M41A 3I5BA 5L1JA 3RRGA 3OY9A 1R0AB 3QGGA 3IN5A 4KB1A 3CDWA 2X78A 3HXMA 4KREA 3HVRA 3K5MA 2FVQA 3RAQA 2BE2B 3HP9A 3H5XA 2BE2A 3H5UA 2R8JA 2IA6A 1BCMA 3JSMA 3EZUA 4Z4FA 2P5GA 2BQUA 1T3NA 1GX5A 1JX4A 1S4FA 4CFBA 5F8JA 5KFXA 3BSAA 1LW2A 3DOLB 1C0UB 4B9LA 3B6PA 3S3MA 1C0UA 4KI4A 4FJ7A 3SUQA 2AX0A 2OPRB 1EX4A 2OPRA 3AA5X 1LWEA 3F9KA 3G10A 2WONB 2QV6A 1RYSA 2KZZA 1J9AA 3QIPA 3OVNA 4PA1A 1RBTA 1S1XB 4FK0A 1TVRB 1S1XA 2PYLA 2D3ZA 3M8QA 5I42B 1TAUA 2RKIA 3DDKA 5I42A 2EHGA 2YV0X 4AHVA 4FJMA 4RUAA 5KT7A 2BQRA 4OPKA 3PO4A 1N5YA 4I9LA 4CF0A 3HPOA 1VSMA 1L5UA 4IBNA 3QLHA 4DFKA 3PX6A 4J9MA 5KG3A 5EWFA 3OYLA 3SQ1A 5C25B 2ZD1A 1FXXA 3ICLA 2HNZB 5KG4A 1RT5B 3BQ2A 4H4MA 4F3OA 4MKAA 2W8LA 3NMAA 4DTMA 2C28A 2RDIA 2VA2A 1QS4A 4J9LA 1O1WA 2VG6A 3ZSWA 1JLFA 4J9QA 2R8IA 4NLVA 3BJYA 2R7YA 3B6OA 5EWEA 3PX0A 3FQKA 4IOBA 4B8CA 1IKYA 5EWGA 2IM0A 4CEBA 4RW7B 1Q9XA 1BCOA 5I3UB 1RYRA 4H8KA 5I3UA 4Y1DA 1J5OB 1UOCA 1RA7A 1J5OA 3Q8PB 4JV2A 5KFQA 2RF2B 2V4QA 3NF9A 1NNDA 4DSIA 5L9XA 1D1UA 4DQQA 2YNHB 4J9PA 2B43A 1KLNA 4HKQA 4IG3B 3RR7A 1B92A 2JGUA 4DSEA 4FLWA 3NDKA 4W5TA 2E9ZA 4N56A 1RT7B 3VQBA 2HB5A 4ICLA 2HHUA 1RT7A 4NCBA 3CFOA 5KFMA 4E7LA 2BRKA 4M3XA 4O3OA 1U47A 3KHRA 1EP4B 3K57A 1NJYA 3QERA 5J2QA 1BIZA 3KLHB 3BDPA 3LP3A 4J9OA 4KTWA 1YTAA 3KLVA 2WB4A 1BHLA 3RTVA 1SKSA 4KRFA 1NHUA 4M3YA 5KFAA 3ULDA 4M3WA 4KB0A 2XWYA 5DLFA 3AA2A 1RDCA 5T14A 4JV1A 4Z4EA 5KFIA 3ZT0A 4N5SA 4CEEA 1NK0A 5HRSA 3DOKA 3I0SB 1XWLA 4CHNA 3I0SA 1L3SA 4I2QB 5D3GA 4I2QA 5F8HA 2G8UA 3RB3A 3LP2B 1C0TB 4FYDA 3LP2A 1C0TA 3VQQA 4RW6B 3DLBA 5KT2A 2FBTA 4RW6A 4ZPBA 5KFEA 3RB6A 3GIKA 4IRDA 4CHZA 4FJ8A 5J2NB 1IM4A 4IH7A 1QUVA 3CG7A 1BISA 3TI0A 4H4OB 4MIBA 4O3NA 3V1RA 4KE5A 4DTXA 2A1RA 4KBIA 2WRMA 2FBXA 1D5AA 3EPIA 4EBCA 5C42A 4FK4A 4CGGA 2GC8A 4CJTA 5KFLA 2FVSA 4PQUB 3SJJA 4DL7A 2HHTA 2RPIA 4K4WA 3KLEB 1NK9A 4JRPA 4DTRA 3KLEA 3VQ4A 4X2BA 5KFWA 4HVJA 4KHWA 4K4TA 4C8NA 1N6QB 3DRPA 2B5JA 4IFVB 1N6QA 1XR5A 2XY6A 4IFVA 4F4XA 3PJWA 3V6HA 1UA1A 2UVVA 5KFJA 3UDLA 4E7IA 3PJXA 4DEZA 1REVA 4ECXA 4FJNA 4E7KA 1U09A 4QWAA 1Q9YA 1HNIB 1T05B 5SZTA 3EYZA 2BQ3A 4BDZA 1JLGB 1HNIA 1T05A 4B3OA 5JS1A 4AHCA 1TKTA 2JLEA 3HK2A 2X74A 4NYZA 4J2DA 3KK1B 4DF4A 4FJXA 3G0ZA 4LSLB 3ZSOA 2XY8A 3SI6A 3RBDA 4GMJB 4TQSA 1TQLA 1S9FA 5J1EB 3HVWA 1HARA 1IKXA 4FXDA 4ID5B 2OA8A 3MECA 4DSKA 4LQ9A 4CFDA 4J9RA 1JLAB 3L2WA 1GOCA 4CIFA 1JLAA 5DMRA 2QXFA 3HVTB 1RILA 3MXJA 3QEXA 3FDSA 3BREA 2E9RX 1IO2A 3NH2A 2IBKA 4ZHRB 1W9HA 4ZHRA 1KFSA 1WLJA 3OYGA 2AX1A 4J9SA 1NOYA 1G15A 5KFRA 3KHGA 2AU0A 1VSKA 3KJVA 2BDPA 4U6PA 4W5QA 2R2RA 4DQIA 3SQ2A 4ZP7A 4DL3A 4K8XA 3OYJA 2FJXA 5EU7A 3Q8SB 3IG1B 4O0JA 3IGNA 1RNHA 3VQSA 2KZMA 3IG1A 2GBZA 3AVGA 1KHVA 4C8MA 1MU2B 3RMAA 2ZE2A 4M3RA 5KG0A 3NF7A 2FJVA 4R5PB 3NAEA 5K14A 1S6QA 4EP5A 4R5PA 4DTUA 4QPXA 5JS2A 3FSIA 5KG5A 3QGHA 3V6JA 1TL1A 4URSA 3PV8A 1ZTTA 1RT4B 4O5BA 5DG7A 4QWDA 2ILZA 4TYBA 4JS5A 4DG1B 4LSNB 1S48A 4CFAA 4DG1A 3VA3A 4LSNA 4FLTA 3RB4A 4WFYA 4TQRA 1U48A 5KG7A 4CFCA 1QAJA 3V1QA 4LH4A 4CF8A 3NBPA 1IKWB 1IKWA 3QO9B 4DLGA 2I5JA 4K4YA 3QO9A 4CJFA 1X9SA 3L2RA 3CJ2A 1RTHB 1RTHA 4W5OA 3K58A 3HO1A 2IJFA 5DQGA 3OS0A 2Z1IA 1K6YA 4CGDA 3MF5A 2FVRA 1Q8IA 4E0DA 4IFYA 2G8KA 2OPSB 2AGPA 1TL3B 3V9XA 1TL3A 2BANA 2I1RA 2R8GA 3V9ZA 4YP3A 1NKBA 1I3AA 4CEZA 1TK5A 4EO8A 2E6LA 4CJKA 4J2EA 4HUFA 5L1IA 2DY4A 1HJRA 3SUPA 3AVCA 3I5CA 3M8PB 5E41A 4MQ3A 2HHVA 3BSCA 1YVUA 4KTQA 4KHSA 3M8PA 2RDJA 4B9SA 2ALZA 3VQ9A 1S0MA 3SZ2A 3IRXB 2KFZA 4IKAA 4AHUA 3DMJB 1RBUA 1WSGA 4C8KA 1S0NA 4M95A 3MTKA 4KHYA 1HYSB 4NYNA 3KD1E 1HYSA 1RT6A 4NRUA 2YHBA 3ZCMA 4DTNA 1WAJA 2PZSA 4Q5VA 4J9KA 3NH0A 1S49A 2FBYA 3QEIA 1WSEA 5J2MA 4G1QB 4DTSA 4JUZA 4RNMA 3OYFA 2V4RA 3V6DA 4RW4B 3T19A 2E9TA 4E1NA 1KHWA 1HPZB 5SWMA 2FC0A 2DFFA 1HPZA 5DGBA 4OKEA 4F4KA 3MEDB 3DRRA 3I0RB 3AO3A 3I0RA 5KG2A 3AO1A 1FKPA 5KFSA 3AVJA 4CIGA 2O4IA 1J53A 4CJSA 2R2UA 1N4LA 3RMDA 4XPEA 1ITGA 4B9UA 3NH1A 4PUOB 2VA3A 4C8OA 4PUOA 4O3SA 1X1PA 2F8TA 2X6SA 3PR4A 3MEEB 3MEEA 3AVAA 1VSFA 2R8HA 5KFKA 3GIJA 2JC0A 3DRSA 2OYQA 4M94A 1TKXB 4MIAA 3DLEB 4CF1A 2C2DA 4KKOB 5DQIA 4KKOA 2KQ2A 4Y1CA 3LZJA 4QOZB 1RDBA 4HUGA 1CZ9A 3GQCA 1NKEA 4RW8A 4CJUA 3ITHB 3KNAA 4BACA 1LAVA 1R0AA 5C5JA 5KFOA 3PR5B 3UQSA 2X6NA 5F9NA 2HW3A 2IAJB 4EYIB 1QHTA 1WSIA 3V9SA 3EZ5A 2P5OA 2Y1IA 4RZRA 1S5JA 4DF8A 2WCXA 3LALA 1JL2A 2XY5A 4F4WA 3M9OB 3AVFA 5KFZA 2V9WA 5FROA 3DOLA 2DFHA 3KK3B 4GC7A 3KK3A 3LDSA 3KKSA 4ECSA 4DL5A 2W7PA 4O44B 4E1MA 3AO5A 2AQ4A 4CK1A 3KHLA 4B9VA 3HPGA 3LANA 1RCHA 3OYAA 1SL1A 4L8RB 1XR7A 2WONA 3ZT1A 1TVRA 2D41A 4RU9A 5KFUA 3BQ0A 2ASDA 1SUQB 3N6MA 3OYHA 1SUQA 3VQ5A 3MR5A 4Z0UA 2IS3A 1RDDA 3LPTA 3OYEA 1F21A 4DFMA 1S1TB 2BR0A 5FRNA 1S1TA 1NOZA 5C25A 1TK0A 1C2PA 5KFGA 2IGIA 2HNZA 2HAIA 5F8NA 1RT5A 4KO0B 4KO0A 3K5LA 2HVIA 4ZP6A 2B6AB 2CKWA 4ZVHA 3OLAA 3LPUA 3CQ8A 1NJZA 5CYMB 1RA6A 3C94A 5CYMA 4J2AA 1S6PB 3SV4A 3FRZA 1JLQB 5HP1B 1S6PA 4HUEA 2DTUA 1JLQA 4KB7A 4M42A 4JS4A 3HSTB 4WXWA 3KOAA 3QZ7A 4ECUA 2YNIB 1T94A 2YNIA 4IKFA 4TYAA 1UWBB 3QEVA 1QE1B 1UWBA 3T3FA 4RW7A 1QE1A 2DPIA 1JLBB 3WNEA 1JLBA 4OPJA 3PVXA 3NF8A 2RF2A 1KVAA 2Y1JA 3LAMA 4CJ5A 4NLDA 3NF6A 4CJEA 3IS9B 3LZIA 5KFDA 3IS9A 4CK3A 2YNHA 2ASJA 3OL9A 4RUCA 4O4RA 3SYZA 2JEJA 4IG3A 2VWKA 1K1QA 4DS5A 5CYQB 4NYFA 3SUOA 5CYQA 3CJ3A 4Z4CA 5KFNA 3VQAA 4MFBB 3PZPA 2J6TA 4FJKA 4URGA 3DLHA 3LP0B 4Y34A 1EP4A 2F8SA 3HT3A 4FLYA 3KLHA 3NGIA 3AV9A 4ZVGA 3V6KA 4KHQA 1S97A 2AGQA 3HL8A 4CHPA 3T1AA 4RW9B 1DTQB 3HKWA 1DTQA 2DFEA 3L8BA 2KFNA 5F8GA 1NJXA 2BRLA 4CEQA 1A5XA 4DSJA 1LWCB 1Z26A 5HROB 3OJUA 5HROA 3ZSYA 1NK6A 3IAYA 4R0EA 2G8FA 1QQCA 3AVBA 1T03B 1T03A 4ED7A 4CK2A 1LWFB 4MK9A 1LWFA 1OS5A 3D28A 4WFZA 1IKVB 1L3VA 1IKVA 5J2NA 3DM2B 3TAMB 4FJLA 3DM2A 3TAMA 2IOCA 4FK2A 4DQSA 3NKYA 1KVBA 4O0IA 4F2SA 4H4OA 2G8IA 1Z4UA 3Q8RB 3FQLA 3SNNA 1YVFA 3T5HA 3ZSXA 3DI6B 4IH5A 3AVIA 4PQUA 1VSLA 3SV3A 1ZBUA 4NLOA 2PYJA 4RNHA 3AVMA 4NZ0A 2FLLA 2B4JA 3HM9A 4DFPA 4CESA 2D0BA 3M9MB 4ID1A 2IC3B 2C2EA 1TP7A 3IGVA 3OLBA 4RNOA 1U04A 3MFHA 3M8SA 4K8ZA 2D3UA 2UVWA 5KT6A 4KFBB 2YNFB 4KFBA 5CZ1A 2YNFA 1FK9B 1S1WB 2W9AA 3K59A 4NLRA 1FK9A 1S1WA 4E19A 4I7FB 3RMCA 1JLGA 2UVUA 4I7FA 2ETJA 3FFIB 2JC1A 1JXLA 4E7HA 1FKOB 3KK1A 2XC9A 3U3YA 3GV5B 1YTUA 2Q3SA 4LSLA 4ELUA 1XHZA 4NLGA 4FW2A 4ECWA 1MMLA 4FS1A 1VRUB 2WOMB 2WOMA 4EBEA 5J1EA 3KLFB 4Y3CA 1HNVB 4ID5A 4CEAA 1HNVA 3CFPA 4O55A 4O3PA 3MXMA 1S1VB 3RR8A 1S1VA 4OVLA 4CEOA 3HVTA 2JEFA 4DLEA 4FJHA 1WSFA 4TSXA 5KT4A 3AA3A 4MK7A 3PW4A 2HNDB 4FZZA 3TWHA 2OPPB 3PUFA 1HQUB 3PHEA 1JLEB 2PY5A 2XGQA 3DLKB 1TAQA 1XR6A 3D0PA 4OJRA 3DLKA 2IDOA 1RTDB 2FLNA 1RTDA 4KSEB 1MU2A 2Z1HA 3WNHA 1RTIB 4CJWA 4W5RA 3CVKA 3P1GA 1RTIA 4FLZA 3NAIA 2FJWA 3ZSZA 5F9LA 4JRQA 2D0AA 3AVHA 4LD0A 1T7PA 4WE1B 1HYZA 3OYNA 1SKWA 3TVKA 4WE1A 1NKCA 3U6FA 5KI6A 1RT1B 1RT4A 1RT1A 3KLIB 2XHBA 4CHOA 1KSPA 3KLIA 3RMBA 2G8HA 3BSOA 4DSLA 1C1CB 4FM2A 3TANA 4ZVEA 3QZ8A 4G3IA 3S3NA 1SH2A 4ECRA 5KT5A 4GW6A 1U45A 1ZBIA 4Q44A 1QSSA 3RBEA 2XCPA 1WAFA 3MXIA 1B9DA 3QNNA 3H98A 4DWIA 2D7SA 4FJ9A 1C1AA 4WZMA 4QWEA 5F8LA 3MR3A 4YQWA 1SL0A 5CZ2A 1RBVA 3ZSRA 5C24B 4DFJA 4BE2A 3V9WA 3O3GA 4TN2A 3UPFA 3L3VA 2OPSA 4URQU 1HYVA 2VWJA 3OJSA 2R2SA 4DL6A 1A5VA 3OYBA 2XCAA 4NLYA 4K4SA 2VG5B 3GV8B 3WNFA 1RDRA 2OZSA 3QINA 1ZBHA 1ASUA 1RTJB 2D5RA 1RTJA 5KRSA 1XC9A 1QSLA 3C95A 4Z4IA 4RNFA 4AILC 3G6VA 2YNGB 1KVCA 2YNGA 1ZBLA 4O4GB 1BQMB 1NJWA 4O4GA 3PY8A 4OL8A 3KK2B 3ZSQA 4FLUA 3IRXA 3THVA 3KK2A 1W25A 2FVCA 3DMJA 4XPCA 2NUBA 1S9GB 3SPZA 1SH0A 4AHTA 4Q45A 4R8UB 3QESA 4R8UA 4ED8A 3HP6A 1WSJA 4FW1A 3GIMA 4F4ZA 2CJQA 3VQDA 2FLPA 4FZXC 1Y97A 1D8YA 4TXSA 5KFFA 3G86A 4G1QA 3CJ0A 1B9FA 3AVNA 3CM5A 4RW4A 2AWZA 3T5JA 3ISND 4M3UA 3K5NA 4ED2A 1BIUA 3EY1A 2KTQA 2AGOA 3MEDA 1ASVA 1RT3B 3KHHA 4K4UA 4NCAA 4QWCA 3ALYA 1RDAA 4CJLA 4DTOA 1S10A 4I9QA 1LAWA 4CF9A 1N48A 1KTQA 2GIRA 1Z25A 3OYMA 4ZP9A 3L2UA 1SH3A 1TKZB 3VQPA 4CJ4A 3N6NA 4K4XA 2Z1GA 4EEYA 4CGJA 4NLTA 5KG6A 1RAJA 3PX4A 2O5DA 4NLPA 1U4BA 4IQXA 3PO5A 1TKXA 3K5OA 3DLEA 1KLMB 4CGHA 2GIQA 3HYFA 2W9CB 4OKKA 4IRKA 3S9HA 1S0OA 3QIOA 1JXEA 5DG8A 2HHWA 3SI8A 4ZPCA 4FJIA 4NLWA 3F73A 4DU4A 4ZPDA 4NLQA 5FDLB 3ITHA 4HYKA 2OH2A 2P1JA 4WFXA 1D0EA 1WSHA 4DTPA 3HPHA 2P51A 4IR1A 4XIUA 3CO9A 2IAJA 2C22A 2QE5A 2YKMB 4DQPA 4CJVA 2W7OA 4CIEA 4K50A 3VQ6A 3T5KA 3NGZA 1YT3A 3PW5A 2EX3A 2XO7A 4M3TA 3UR0A 4N76A 3ZT4A 4KV8B 3OYIA 4KV8A 4EYHB 4C8LA 1BQNB 4RNNA 4B08A 1BQNA 4DL2A 4CEDA 2G8VA 1DTTB 1DTTA 3O4NA 4QAGA 3JSMB 5KT3A 5HRNA 4O44A 4IH6A 3LWLA 4M3ZA 3ZT2A 5T7BA 1LW2B 4MK8A 4FM0A 2VG7B 4KHMA 4CJRA 2VG7A 4DU1A 3CDUA 3BR9A 2WTFA 1WNEA 3DLRA 4KTZA 3MFIA 4OGEA 4MKBA 3P5JA 3OL7A 2XRIA 1ZYQA 3VN5A 5L1KA 3O3HA 1VK0A 1LWEB 4DTJA 2HHQA 3TAEA 3AO2A 2E6MA 2HHSA 4HHTA 3HVAA 3QIPB 2OZMA 3EPGA 2QK9A 3V4IB 3V4IA 4FJJA 3HHKA 1KRPA 3MR2A 4Q8EA 3M8QB 3G6XA 4F8RA 1K1SA 2RKIB 4DSFA 4YR0A 1NHVA 1N5YB 2HHXA 2W9BB 3AO4A 2FVPA 2W9BA 3AVLA 2XI2A 3QLHB 2GUIA 4BE1A 3DLGB 3MAQA 1S1UB 3DLGA 3OYCA 2ZD1B 2B6AA 1S1UA 3OSPA 1D9FA 3BSNA 1BI4B 4JLHA 4ED0A 1BI4A 2HWIA 3GILA 5HP1A 2JEGA 2HNYB 2HNYA 4H4MB 3SQ4A 3DYAB 3RB0A 4IRCA 1T8EA 3KLGB 3DYAA 3KLGA 3GYNA 2XI3A 4TLRA 2ASLA 3H2LA 2VG6B 4ELVA 1JLFB 3OS1A 3VQ7A 2KW4A 1GOBA 2UUTA 3D5MA 4E89A 5KFPA 2IM3A 5DGAA 1VSHA 3ZT3A 2IJNA 1X9WA 4J9NA 4AH9A 1IKYB 1D9DA 2F96A 1QAIA 1BL3A 1JL1A 4QW8A 3RAXA 2O4GA 4ED3A 4CECA 4KI6A 4TY8B 4TY8A 4ED1A 5L1LA 3AVKA 3ISNC 3V1OA 2C2RA 3PW2A 3VQCA 3LWMA 5F8IA 3D45A 4F2RA 2F8EX 2UVRA 1U49A 4MFBA 3M8RA 2OPQB 1HMVB 2OPQA 4ZTJA 1HMVA 3LP0A 4ICLB 1I6JA 1WNSA 4E3SA 1NK4A 1N56A 3KMSA 4K4VA 3TAFA 4CGIA 4CHYA 1GX6A 3NCIA 4HCBA 4EP4A 3QNOA 3OL6A 5KRTA 1ZBFA 1RT2B 4M45A 4RW9A 1TV6B 5J2QB 1RT2A 5KFYA 3RRHA 3BQ1A 1TV6A 3CWJA 3KMQA 4WZQA 3OHAA 1CXUA 1WN7A 3HJFA 1SV5B 1LWCA 2ATQA 5HRRA 1SV5A 1VSIA 4EO6A 4B9MA 4KAZA 4LY7A 4KAIA 3TAGA 4CJPA 2W8KA 3H40A 4Y2CA 3KKRA 3DOKB 3V9UA 1I39A 3OYKA 3UIQA 4ZTFA 2J6SA 3OHBA 3O4QA 5D3GB 4CE9A 4CF2A 2R8KA 3H5YA 4FVMA 3TR8A 1VSJA 4CJ3A 3MR6A 5KFBA 1DLOB 2IMWP 1C0MA 1NK8A 4BDPA 2ZKUA 1DLOA 5HRPA 1JIHA 3L3UA 3L2QA 3DI6A 4CJQA 2QKBA 4YR3A 4ZVFA 4NRTA 2V0NA 3NFAA 3H4BA 1EKEA 5F8MA 3NGYA 3LP1B 4ELTA 3O3FA 3LP1A 1SL2A 5C42B 4FBUA 4IG0B 3OL8A 4IG0A 1XHXA 2FBVA 4CERA 2IC3A 2DPJA 4YFUA 1NK7A 1CXQA 4QWBA 4OKJA 5CY4A 2HWHA 1KFDA 1VSDA 4EZ9A 3DRPB 2B5JB 3Q8QB 1A5WA 3TABA 4FJGA 4KHRA 3FFIA 3ASMA 5DK5A 4EZ6A 1XI1A 1FKOA 2WHOA 1REVB 1EXQA 3JYTB 3OYDA 4UQGA 3JYTA 4MH8A 2ZQBA 5KFHA 1ZTWA 4Z4HA 4B3OB 1VRUA 4Q43A 1TKTB 3SCXA 3KLFA 4DU3A 4FS2A 3E01B 2YKNB 3E01A 5JXSA 2YKNA 5HBMB 4PY5A 4ZPAA 5HBMA 4BWMA 4ECQA 1LV5A 5J2PB 5J2PA 1IKXB 3WNGA 3H4DA 3SUNA 3MECB 2LSNA 2WK4A 4O3QA 1HRHA 3TAQA
chains in the Genus database with same CATH superfamily
4X4PA 2HRUA 2HS0A 2DH9A 2HNDA 1SPBP 1CZBA 3DXMB 3GIIA 1FDBA 2OPPA 1UWAA 3L4BC 2BGGA 4TU9A 4Q0BA 2JEIA 2ZGYA 3OTOF 2CDRB 3P49B 4NB4A 3OS2A 2WB1D 4ZCIA 1EKSA 4F3TA 4WYLA 4FBTA 2BKPA 3QRPA 3B4DA 2E1AA 2DIVA 2J6UA 1JLCA 1WOPA 4KHUA 5IT9Y 4ZPTR 4CP5A 3IMXA 4HTJA 2SXLA 4YHHF 5JVGQ 4KIAA 4AM7A 2W42A 2HBRB 1MNEA 1UVKA 2JNJA 2BXJA 2VPXB 3U02A 2H5EA 1LKZA 2NXCA 2CPYA 1C1CA 2IMOA 3NE6A 3BGRB 3CDBA 5FIIA 4Q2LA 2IYGA 7FDRA 4FLXA 3I5AA 2VONA 3R9LA 1SZ2A 5AXKA 5T41A 3MM8B 3QATA 3CCJN 1TZ0A 4ILMA 2GX9A 3AA4A 1AZSB 2HVDA 1FVQA 5CH7B 1L3UA 2E8AA 5D0RA 3CIZA 3CPEA 4EAHD 4CZKA 2BACA 5BPLA 4CGFA 1ZETA 2F7VA 3H59A 3FR0A 3D54A 3WXLA 3DNCA 2HFSA 2QLJB 3O2IA 3N5FA 4DS4A 4CZFA 1UA0A 5JVGL 5GAHU 4IDKA 3EXCX 2Q31A 3QB0A 5LL6d 1VJQA 2GO9A 1S9GA 3MEGA 3SLCA 1KCFA 3JQJA 2GTDA 1UCNA 1YQHA 4EI2A 5E7OB 4IUFA 3QIDA 2UXBK 1TK8A 4B1VA 4PRFA 3KIOA 4JV5K 4BGBA 1M1HA 4LFAK 5EDWA 2P6SA 1VLYA 2QMXA 4PEOA 1T44A 2W40A 2B4OA 4P71A 1SC4B 2DVIA 1TL5A 1CLQA 3WXIA 4LR9A 3R5BA 4BRPA 2CGKA 5J2MB 3CDAA 1NB2A 3QEWA 2QWRA 4WXOA 2O8DB 3E51A 1CQNA 4ZVQB 4MDAA 1NEEA 5DQHA 4GC6A 1NSQA 4ZIVA 1TKZA 2IM1A 5A8KA 1M5HA 4OZJA 2E66A 3HOSA 3NHGA 3MCSA 3BS9A 1X4GA 4EBDA 4I69A 4K4ZA 3RAMA 4XO0A 2BOAA 1VAZA 4LT6A 3AFGA 1L3TA 5KTQA 3KD5E 4YR2A 3X1LB 4JKCA 3CYMA 3Q22A 4QS8A 4ECVA 1R7IA 4OLAA 4JI0F 4EMDA 4NLXA 1SJ4P 5LMUK 1K73T 4DR2K 4H54A 5GAEP 5FDLA 3RWUA 4RG8A 4ISGA 3BP8A 4YY3K 2ZVIA 1X0FA 2I8EA 2UUWA 2LQJA 3J7YP 1LW0B 3NGDA 2ROEA 2GUPA 3V81A 2R7UA 3L0QA 1EJ7L 2LLZA 4JI4J 5LY3A 4J91A 4M41A 3H6EA 2PEHA 3OY9A 3QGGA 2GAHC 4X65F 3ZETA 2OTJN 2BE2B 3HP9A 2NCKL 2ZH7A 3VAJA 3F9MA 2R8JA 1H73A 2IA6A 3JSMA 3EZUA 2B7CB 1NGFA 2XQCA 4H0VB 4CFBA 4JBCA 5KFXA 4LF9F 2AA4A 3D0HE 5EX0A 5LMNJ 3B6PA 3S3MA 2IVOA 4BR0A 5AXNA 1WKKA 1D4XA 3I55N 2FQQB 3BGFA 3G10A 2J9CA 3ZTSA 1WF0A 2O8FA 4C1NK 2KZZA 4PA1A 4OV6A 3AOAA 5B08A 4FK0A 2J7WA 1TAUA 5I42B 1X5OA 3GLJA 3QSYB 2UUCF 4OPKA 2O8EA 4I9LA 1KTVA 1VSMA 2Z30B 2E1RA 4IBNA 4WKRA 4FYXB 3H25A 1NLVA 3TSPA 4E98A 4YOVA 3THWB 1NGAA 3ICLA 3AOBA 2YX7A 3FGUA 1FE0A 5IZHA 3HULA 1O0PA 1M5KC 4DTMA 4BQLA 3M2VA 4J9LA 4CH1A 1O1WA 3VGUA 2FPHX 1JLFA 2CNKB 3TJAA 1NNEA 5ITHA 5G0RA 4CLTA 2Q43A 1U7LA 2ZZNA 2ZH5A 1IKYA 3NS7B 1V3SA 2P8IA 1BCOA 1NO8A 4NA2A 5I3UA 2JFDA 5MAOA 3Q8PB 3HZ6A 2A3JA 1QLNA 3VAMA 2IFXA 1NNDA 4DV6F 4DSIA 1X4CA 4NX9A 5L9XA 3U9ZA 1M0SA 2O01C 1N33F 3ZZPA 2CZ4A 1OH6A 2YWFA 4HKQA 4IG3B 1TFYA 4PPZA 2DHHA 3NDKA 1NPPA 4OLOA 3G4SS 3ULHA 2P9LB 4CLYA 5KFMA 1Z6RA 4X4SA 2BYCA 2E1CA 1U47A 2HFVA 5AE3A 2DGUA 3GYXB 3QERA 1Q81O 4PABA 3BDPA 4KTWA 3MUTP 3C66A 4LFBF 2WB4A 2HWTA 3CO0P 1VBZA 4OHXA 1WB9A 5M1KA 1NMEB 4USVA 1RWUA 1NHUA 5KFAA 4M3WA 1GQEA 1RDCA 5T14A 1XQSC 4FF3A 5JICA 4LF8K 3H8YA 1MLAA 1HW8A 2CQHA 1PC5A 3H3NO 2DCUB 5HRSA 2CWXA 1FI4A 1XWLA 4DUZK 4I2QB 5D3GA 1C0TB 1FX4A 2FBTA 1X4BA 3VETA 3FK4A 4BVPA 4BR5A 1U0SA 2CZVC 2O8BB 5DS7A 4OYMA 2H5IB 2AEMA 1R59O 4MIBA 3V1RA 4KE5A 3GPAA 2A1RA 4HT7A 3MCPA 3AT1B 3EPIA 2Q66A 1IR0A 1Q18A 5D0GA 1S72S 3G4SN 1WI6A 2GC8A 4NI2B 1R43A 5F41A 4CJTA 2ZKTA 1EQYA 3SJJA 3J80O 4USWA 4LF7J 1PJ5A 3KLEB 4K4WA 4X2BA 1YRTA 4OJHA 4HVJA 4DDFA 4KHWA 2LQBA 4C8NA 2WZ1A 2EFPA 4RO0A 3V6HA 5EVZA 4A47A 1X60A 1NLKL 2UVVA 3GJTB 4MAKA 3PJXA 5AFUA 4LF5J 2Z8QA 3L9ZA 1RAIB 5AQPA 4QWAA 2CQ4A 5FLXY 1JLGB 1HNIA 1T05A 4AHCA 5IT9O 4GV3A 3HK2A 1MWMA 2KO1A 3SCLE 3S8SA 2QFIA 3SK3A 3K0SA 1WOSA 2DH8A 3C14A 1YBAA 4G1IA 3SI6A 3F5TA 4GMJB 3J7A1 2V2KA 1BA1A 1IKXA 3AJDA 4FXDA 1YVNA 3I87A 2RRNA 3FBBA 2H1YA 2QYCA 3GB0A 4J9RA 2I38A 2NNWA 5DMRA 3HVTB 3M2UA 3QEXA 3DXMA 3BREA 2E9RX 1CC7A 1IO2A 3NH2A 1IV0A 5JMNA 4ZHRB 3CCSN 2B8QA 1AT1B 3OYGA 1FXLA 5KFRA 2AU0A 1S72N 3G96A 4OHYA 3SQ2A 4K8XA 4P2MA 5HQLA 2CDQA 2FJXA 3P45B 2P9KB 3Q8SB 3IG1B 4O0JA 1Q95G 3IGNA 2KG0A 1NDCA 1RHUB 4M3RA 5KG0A 4ANEA 2FJVA 3QPIA 3D6MB 1ZTTA 1VIXA 1YJ7A 2QEXS 4FOEA 2ILZA 3T1YK 2MQMA 3PJ9A 4LSNB 2GWKA 1S48A 4CFAA 2VQFJ 1LOUA 4X62J 1O6XA 3CERA 1IKWB 1XMOK 3QO9B 4DLGA 1U24A 1VQ8S 1X9SA 3L2RA 3CJ2A 1RTHB 2WSFC 2EFNA 3C0BA 3K58A 3HO1A 5BYSA 3O1WA 2NRHA 4BBYA 3MF5A 3PYGA 3OTCA 3CQXA 2AGPA 2J4RA 2O1PA 2RJZA 2YH1A 1MWZA 4BRKA 2E20A 1TL3B 3RG6A 2OCEA 2XMMA 1NGBA 2QA4N 2J76E 1QD1A 2XYGB 3AJ2A 2RAQA 2YWHA 4HUFA 5CYJA 5L1IA 2XHCA 2LU2A 3I5CA 4IZ9A 2BA9A 3M8PB 2ZF5O 3QGPA 5HMYA 4BRIA 4KHSA 1OH7A 4KGMA 3SZ2A 4JP8A 4IKAA 3VOVA 2VFVA 2CH5A 1S0NA 2X1AA 1BDGA 1HYSB 4LFCJ 4DV7K 3KD1E 4CZJA 3OFEA 1N52B 3MM7A 4NRUA 2YHBA 3JTOA 3A3OB 4N8NA 2XHWA 3T9ZA 4B17A 1S49A 2ABYA 1WSEA 1JQGA 5J2MA 2M52A 5B0FA 3UVJA 4JUZA 3GG1A 4M5HA 1RU2A 1FE4A 2ZDOA 4NL5A 2EBEA 2DFFA 3AD9C 4OKEA 5IM0B 1G3OA 3CTRA 3I0RB 3AO3A 2H5JB 1SQFA 2ADBA 1F3FA 4DX8H 4CIGA 4QJVA 3DLJA 2XZDB 4ETZA 2CQGA 2DNQA 1ITGA 4PUOB 4O3SA 1X1PA 5H9EK 3A4TA 1HNZK 1VSFA 3GIJA 1HR0F 4NXNJ 1S6OA 3OTDA 4MIAA 4CF1A 4PYDA 4WCEQ 4DX5A 5DQIA 2JHEA 3HHLB 1VBXA 4Y1CA 1GT8A 1HD1A 1V4SA 3WEEB 4FVCA 4V1Ak 4RBUA 5BN8A 4JYAJ 4CJUA 4LIRA 2K3KA 3KNAA 1U2RA 2BMBA 1XMQK 5C5JA 3HHLC 5KFOA 3UQSA 3A12A 2X6NA 3HCXA 1HBMB 3ZZTA 1NSPA 1FTRA 1WSIA 3L09A 4FYVB 4DF8A 3LALA 4LREA 1DQ9A 2LA4A 3MCNA 1P1TA 1GLDG 5KOXA 3GCWP 2DFHA 3SAFA 2XNRA 3KK3B 1N34K 4WK1A 3JSYA 2QLBB 4DL5A 1D8ZA 4ATNA 5GAGU 4O44B 4KJIA 2W2OP 1B0PA 1FRMA 2DNOA 4BC5A 4L8RB 4ZVPB 3ZT1A 1ICEB 4RU9A 1OH8A 2EC2A 2VBZA 4I0WA 2ASDA 1SUQB 2QX0A 4USHA 3N6MA 2UUAJ 3MR5A 1RDDA 4DBQA 1AW0A 3EJMA 3OYEA 4DX7A 2ACYA 1F21A 3R9PA 3UE5A 1VQPN 3N4PA 4YB5A 3I4PA 1S1TB 2BR0A 4P2FA 2J0XA 1M5SA 3THWA 4Y65A 3D4JA 2YX1A 4HTIA 3V2UC 5D77A 1IUJA 4ZJOA 4KO0A 4LC9B 4YOXA 3K5LA 3BBBA 2X3DA 4LF4J 2GQQA 3CQ8A 2KT2A 5M1OA 3JTPA 2QWNA 5CYMB 1JLQB 3MX2A 2DTUA 4JS4A 2AZ3A 3HSTB 2E7WA 4OJGA 3CCQN 2E88A 5M1NA 4ECUA 1JJHA 3KG0A 4KHPJ 4DR7K 3QEVA 1CJKB 4ZCKA 2DPIA 3WNEA 2NR0A 4HI2A 2WVEA 3GP9A 1P1LA 3O9SA 1M1KO 2XTJP 3W0LA 3AAQA 4CK3A 4YB6A 3SQGB 1EO1A 4O4RA 4PR6A 3OFGA 3ENQA 4IG3A 1U8WA 1LOTB 3M6XA 1HI1A 1K1QA 3CCVS 3BDEA 3GSDA 2ZJPQ 4DCJB 4OX9F 1HWKA 2HFUA 2P9LA 2KFYA 2DRAA 4WU2A 2X1FA 5F0UA 2J6TA 1HA1A 2GHWA 2V34A 4Y34A 2F8SA 4CD1A 2O67A 2UXDK 2VBWA 4IFEA 2ZM6F 2NZTA 4CDIA 2EKNA 4ZVGA 2LU1A 2V94A 1YG0A 2UXBF 4RW9B 1EB0A 2KRRA 5L8RC 4JV5F 4LFAF 5F8GA 4B3SF 1NJXA 2XBPA 4ISEA 3IUCA 1LWCB 3OJUA 3ZSYA 1VLOA 5CE3A 4R0EA 3ZEUB 4LF9J 2P9PB 3OV7A 2A1BA 2G8FA 3F0NA 3CF5Q 2A2CA 3KJFB 1T03A 2ZJPL 4DR1K 5JMVA 1N5TA 2V8DA 3SAHA 1LWFA 3D28A 2J9EA 3UR3C 5FLXO 2O8BA 5ETVA 5LJWA 5AZJB 3NKYA 1KVBA 4BRAA 4O0IA 1RI7A 2FHOB 1Z4UA 5HL7Q 1NBWA 1KONA 3FQLA 1YVFA 5HN0A 2CIMA 4WIIA 1YZ7A 3AVIA 4NI2A 2V50A 4NWBA 5J1PA 4H0YB 4A8OA 5LMUF 2JL9A 1YIJS 4RNHA 4YY3F 4NZ0A 2B4JA 4DFPA 4CESA 5TKYA 1H3DA 1Q82T 1OQ6A 3C7NA 3M9MB 4ID1A 5IV3A 2OTLS 4USMA 3J7YI 3HFKA 2BH1A 3M8SA 2D1KA 3Q8YA 5KT6A 1NM1A 5DDQC 4FWOA 3CCUS 1HWJA 1XERA 5CZ1A 4NLRA 2FHJD 1JLGA 4OI6A 4JI6K 2LQ9A 4ZN3A 3T9NA 1FKOB 4KH6A 3LQVA 4CO1A 3AQPA 3U3YA 4QIFA 1U1KA 1RFQA 4ELUA 3IP0A 1TYQB 4JI3J 1RISA 3R1LA 4P6QA 4DR4K 2ZWPA 2WOMA 1HNVB 5C0YA 4UZCA 2XLJA 4CEAA 2MZSA 3CFPA 2PFDA 4KRWA 4OVLA 2FF6A 1CG2A 3MN6A 2KJWA 3HVTA 3PRVA 2YX6A 2QG9B 4HHUA 5FPMA 2CQ3A 4LIWA 5JVHQ 4FJHA 4TSXA 3AA3A 3PW4A 4JI7F 3IDHA 2YPYA 1JLEB 2PY5A 3N5BA 2LCWA 4AQYK 2M3DA 1RTDB 1Y5NB 2XS2A 1GLJO 4KSEB 1RTIB 3CVKA 3VMFB 2OTLN 2FJWA 3QAEA 4JRQA 3AVHA 4PQAA 3RUBL 4WE1A 3B8AX 3O4WA 3CCUN 2Y0SD 3VGLA 2GNKA 3U9DA 1ZAVA 4OZ3A 4DZ6A 2CNLB 4CHOA 1NB7A 2QTWA 4DU7A 3IR6B 3C65A 4FM2A 2E5IA 3HI9A 4IOCQ 3DHXA 4LBPA 1VQLS 1SH2A 1FWLA 3WT0A 1ZBIA 1QSSA 4D3GA 4CBUA 5JVHL 2XCPA 2G0JA 1WAFA 3MXIA 4G6VB 2D7SA 5HJXA 4FJ9A 1Q7LB 1DBDA 4QWEA 2MLXA 1SXLA 3CC2S 2V6AA 5AXLA 4BG8A 3O3GA 4JI8F 4HLBA 1RWMB 1HIYA 2FUG9 4DV1K 2N3OA 3Q7CA 4NXMJ 2R2SA 4WU3A 2J9DA 3WC0A 2NRTA 4Z94A 2OZSA 2CZ9A 3QINA 1ZBHA 3T41A 3NGSA 1N0VC 1FRXA 1XC9A 1NH8A 3SSRA 2ZNYA 2YNGA 2FSKA 4FSVA 1NJWA 4M8LA 4NZ6A 3PY8A 4FLUA 2L9NA 2QWLA 3KK2A 1VHIA 1W25A 4PKGA 2XMKA 2B0GA 2V4JB 3BPDA 4IOCL 3TTCA 1VQ5S 4Q45A 3QESA 3VAIA 3GIMA 5LM7E 5E3QA 4XDDA 3VQDA 1D8YA 3QBXA 3T6BA 1WDTA 4OFZA 3CJ9A 2EBGA 3CM5A 1QQOA 3M1VB 5ADZA 1BIUA 3EY1A 1VQLN 3BKTA 2KTQA 1GXTA 2AGOA 2NYHA 1KVJA 2Y3YA 4LF8F 3KHHA 4QWCA 3ALYA 1RDAA 5AFUH 4DTOA 2V8PA 4EWTA 4I9QA 1P9YA 4BRGA 4CF9A 3OYMA 4DUZF 3GFHA 1WF2A 1YJ9N 4OZNA 4B9QA 1SH3A 3CC2N 3VEOA 4QZVB 4CJ4A 1NH7A 4NLTA 2KRBA 2MHNA 3GYGA 1DAXA 3PO5A 2NRVA 3K5OA 2RSQA 1ZH5A 1WHWA 3W2VB 2GIQA 1NJIT 3HHLA 4CLSA 4OKKA 4IRKA 2HBQB 5EXWA 5L38A 2HHWA 2BV3A 4FJIA 4NLWA 1KXPA 2OH2A 4ZN1A 4WFXA 1D0EA 3FEZA 3VAHA 2P51A 4XIUA 4IR1A 4CZIA 1HBMA 2QE5A 2F63A 1E6VA 3QT5A 4CJVA 4CIEA 2RS8A 3T5KA 4FOIA 5ETTA 1YT3A 3ZNJ1 2NUUG 1RSCA 3SDEB 1BQNA 4K8RA 4LSZB 3D6HB 3H2UB 5KT3A 4O44A 3MMCB 3QT6A 4DQ8A 4KHMA 4GO7X 2Z2LA 4DPWA 1UKUA 3BO4A 3P5JA 3OL7A 5L1KA 3PM9A 4DTJA 2F4VJ 3MN7A 2E6MA 4FKXA 2CGLA 1KN6A 2MLYA 4B3RK 2CQCA 3HHKA 1X4EA 2QJ3A 3D67A 1M1KT 5ETOA 3GONA 2RKIB 1NHVA 1N5YB 2HVEA 1C4AA 2HEKA 1FFSB 2H51B 5LSRA 2CG4A 4BE1A 3DLGB 3MAQA 3OYCA 1S1UA 3ZX2A 1SQKA 2NPIA 9RUBA 1D9FA 3O80A 1BI4B 2OUGA 3RW6A 4DR3J 3HRGA 4K41A 2ZUAA 4H4MB 2EW9A 3RB0A 3DYAA 4FDFA 1XNQK 4QS9A 3KLGA 4TLRA 4IQMA 2ASLA 4ELVA 3T1YF 2UUTA 5KFPA 2IM3A 1CJKA 3W8GA 4GNIA 3Q7BA 3ZT3A 3W5YA 1UJ6A 1QAIA 4QW8A 4ED3A 4JKGB 4KI6A 2CXEA 4C0BA 3L3CA 4TY8A 4X4UA 3SQGA 3I33A 1WBBA 3CJCA 2QWOA 1YHQN 1YKWA 3ENBA 4A2AA 2C2RA 2CQ1A 3PW2A 3VQCA 3G6EN 1VQ7S 2HURA 2NLXA 2UVRA 2HIYA 1N8RO 1RWOB 3R3TA 2NQPA 4JI5K 1T9UA 4NOHA 2OPQB 1HMVB 2VOPA 5BR8F 2IDEA 2MKHA 3R5JB 3KMSA 3EDRB 4Q7AA 3VEWA 4CHYA 1LNQA 4DV0K 3QNOA 3OL6A 4B3TJ 3IR7B 1R8CA 2CPDA 4RW9A 1TV6B 5KFYA 1MN9A 3CWJA 1FEHA 4DV7F 2JLGA 5SUHA 1HUXA 1R27B 1LWCA 4B9MA 1XEZA 1IN0A 4LY7A 1GMVA 4BC9A 2P9UA 4DCOB 2HBLA 2AJ2A 4ZS6A 5AZIB 2EFOA 1HWUA 3DJCA 4PG5A 4HACB 2HG4A 3AARA 3KKRA 3DOKB 3V9UA 3OYKA 1C0GA 4M5IA 4CE9A 2VQEJ 1P90A 4CF2A 5AZJA 2R8KA 4IO1A 1XNRJ 2C3UA 5AQOA 2QZ8A 4DV5K 2JJ4D 1VSJA 5KFBA 1DLOB 4LRFA 2ZKUA 5THWA 5HRPA 1JIHA 4GKKK 2RE1A 4CJQA 4U8YA 5E2QA 1WF1A 3FSYA 2CPIA 3PKYA 3CCWA 5HI7A 3SSSA 5F8MA 5AQYA 3CJAA 4DV4J 4IG0A 5D0EA 2W2MP 2WBMA 1XHXA 4DV3K 2KI2A 2E2OA 2GIFA 2XEXA 3TTDA 3VTHA 4YFUA 1YDLA 2FJAB 2Q6BA 1XMQF 2AP6A 3E9PA 4HVZA 3QT7A 3DRPB 2VODA 1A5WA 4FJGA 4ILRA 4KHRA 4EZ6A 3ZFVA 1FKOA 2WHOA 2AT1B 1REVB 1EXQA 3JYTB 2R7QA 4RX6A 3ENVA 1VOMA 4MH8A 3PNIA 4JD2B 3P39A 2DGVA 3VAKA 4DI6A 5CABA 4FS2A 1N34F 2YCHA 4PY5A 4BWMA 5E84A 1OSDA 1PC4A 5J2PA 3CE8A 4EGLA 3CC4S 1YTYA 3MECB 4AL7A 3CFRA 4FWRA 1X5TA 1RAEB 4M7XA 3NL0A 3GG4A 4K5SA 1JLEA 1QTMA 2RN2A 1EETA 4YORA 3H5SA 2G8WA 2LVWA 1VRTA 4M5KA 1NMNA 4WTYA 2GW8A 2XNQA 1VSEA 4H5WA 3OR1A 3GV7B 2JFKA 3LAKA 4WYWA 3NAHA 3ZTQA 1F3VA 4A8WA 4YS2A 3D6FB 2ZE2B 1R3NA 3QEPA 2BJ1A 1JXBA 3SFUA 2CPHA 4I6AA 4J9VA 1ZS6A 3ZNUA 2NXUA 1U25A 4MMOA 3WX8A 2A10A 3M7VA 4I2PA 3I9V9 1UJ4A 3R3LA 2RUSA 4BE0A 1CULB 1VQNS 4KR0B 2WBNA 3VENA 4DR7F 4E7JA 1VBKA 3CM6A 3OXLA 3CCLS 2I5JB 2W1BA 3PW7A 4JKBA 1U6ZA 3C6UB 5AQVA 4FF1A 1IVZA 2HMIB 1ZXOA 3SQOP 3V5RA 3L2VA 1S5ZA 3BF3A 3QYYA 4TKTA 1XBWA 3CC4N 4LRBA 1HQEA 3R7NB 4QW9A 3ILIA 4FNHA 1QAXA 2CUYA 3K9KA 1S9EA 4Y2MA 3G6YA 1IBKJ 4UW2A 1W0HA 3QT8A 4CEFA 4CNYA 4Y2AA 3THXA 2OD6A 1WUAA 2HVHA 4N41A 1HLUA 1IG9A 4ZP8A 4DR2J 2V4JA 3SCIE 2FHKA 3C6TB 2N82B 4KHNA 5EUHA 4BLGA 3MAAB 4FJ5A 3EKSA 3AB2B 2UXDF 4OJ1A 5KFCA 3CMAS 4LBHA 4WP9A 2A1SA 4ZLLA 3U3GA 3O9TA 4DL4A 4AHRA 3HM8A 4PWDA 3QSIA 1N32F 3LDPA 3GOIA 3M1VA 4LQ3A 1RK8A 1QSYA 5GAGI 3CETA 2OKQA 4NCGA 2PD1A 4KC5A 3VERA 4ED6A 3VQEA 2D69A 5A2QY 4G9ZA 1SQEA 1VQNN 1SI9A 2P9CA 1HNXJ 5DDRC 1H6KX 1WC0A 3MDQA 4O3RA 3CCLN 2OMLA 1FJGJ 4DR1F 1APSA 1ASWA 4NLSA 1FKPB 2YHAA 4ZCLA 4DZDA 4HEA9 5HLFB 1HNWJ 4B9NA 4OZLA 2MZQA 1JKHB 4M7YA 3M8ZA 4FNIA 3RJMB 3TQ1A 4HTUA 1UAXA 2PGCA 2ROGA 2H4WB 3SBMA 5GINA 2HQIA 1OVYA 2AD9A 1A7GE 1HKBA 2O3DA 4CHQA 4FLVA 2OFGX 1XTZA 4FCYA 4ES2A 3I4HX 1C1BB 4DPTA 3CD0A 3E66A 4OHWA 3J81U 3PYDA 3MMJA 3TW0A 5L1JA 2IVPA 4NMXA 3E1YA 4NA3A 3IN5A 3CMAN 4KB1A 2W2QP 5H1SV 2HQ3A 3HXMA 3HVRA 2FB0A 3K5MA 2FVQA 4ZPWR 2WSCC 4X64K 2YY3A 1BCMA 1NHKL 2VF3A 5T7LA 2EWHA 2P5GA 1T3NA 4ZITA 5K8OA 2XZWA 4JI6F 2IVYA 5F8JA 2EI5A 5H9FK 2PSZA 1VQYA 4IXCA 1C0UB 2AJ4A 4JKDA 2B4VA 4ZCMA 2L41A 1OY6A 1Z1ZA 1EX4A 2OPRA 2XMTA 3KXDA 1KAZA 2RRAA 1J5EJ 1NPKA 4DR5K 2MMYA 1RBTA 1S1XB 3MMBB 2D3ZA 2UV8A 2LQ5A 2MSSA 1TR0A 2RKIA 4AHVA 1H7WA 4RUAA 5KT7A 4QU7A 1N5YA 4CZCA 5EX5A 1ZPVA 4FYYB 3HPOA 3UDCA 4JN4A 4GKJK 1OKJA 2LEBA 1RWWB 4J9MA 1B7YB 3SQ1A 1U0HB 5IOLA 2G0CA 1FXXA 2RUGA 3TYTA 4AQYF 5GIOA 1N8RT 5KG4A 3ENHA 1RT5B 1WEXA 2DGXA 2OIHA 4H4MA 1N36J 3DHWC 4F3OA 2W8LA 3NMAA 1CC8A 4HHHA 3MMAB 2RDIA 4MLEA 3AGKA 5AQLA 2QL9B 3CMES 1JJ2R 3RVCA 3BJYA 2R7YA 2H48B 2XSFA 3CC7S 3B6OA 4DPXA 2LFVA 2X1GA 3PX0A 4IOBA 3CD6S 3GR0A 5EWGA 3AA8A 3LF0A 2IM0A 5D78A 4CEBA 2CNNB 1RWNB 5E3RA 3UD4P 4Y1DA 1J5OB 4HI1A 2B7BB 5BYQA 4JV2A 2EK1A 3MI7X 4K43A 2RF2B 2UXCK 3NF9A 4DV1F 2YNHB 2B43A 2E5LJ 1B92A 3ZZZA 2JGUA 3SMZA 3DAWA 4FLWA 3C19A 2HF3A 1YITS 1RT7B 3VQBA 1HBUB 5E3CA 4M3XA 1F5BA 4O3OA 2QFJA 2CJKA 5DDPC 2GQ2A 2NRWA 3HF5A 7FD1A 4OYIA 2RB7A 3KLHB 5AQIA 3KLVA 2BUPA 3RTVA 1BHLA 3EX7B 2GMHA 4IEEA 2E29A 2VC0A 2GHPA 2KKHA 4KQZA 3TR5A 2XWYA 5DLFA 3MPUB 1RWVB 3QJJA 4JV1A 4ISFA 3CC7N 1CS4A 2HZAA 3ZT0A 3PACA 1ESVA 1NK0A 3MWTA 3DOKA 2E7XA 1RWKB 3CD6N 4CHNA 3I0SA 4HR2A 1Y10A 3HSJA 3LP2B 1U2FA 5IWAK 4FYDA 4DPYA 3EE9A 3AXMA 3NXZA 1HBNB 4RW6A 3D1QA 3GIKA 3QJLA 4CHZA 3KHYA 2LDYA 1NRKA 3GZ7A 2F9WA 3E2EA 3ELHA 3TI0A 4H4OB 5I9EB 1Y00A 2VH7A 3SXLA 2PIIA 5DM6Q 1D5AA 3TRGA 4KH5A 4I6MA 3DWLA 1EWQA 4CLKA 3FRYA 3M1FA 2XLKA 4CT9A 5KFLA 7AT1B 4CIOA 2X7IA 3CJ7A 3POTB 3EGVA 4IOAQ 1HKAA 3H20A 3D3BJ 1N6QB 1ZZFA 3BKFA 2A6OA 3DRPA 2PMWA 4IFVA 4F4XA 2QO3A 4KGKA 1YJWS 4AM6A 2DJWA 3UDLA 1GEHA 1YJUA 1W97L 1REVA 2IDLA 2VPWB 4ECXA 4FJNA 1UEKA 4DUYK 4E7KA 4JD2A 4RUBA 1H1VA 4NYZA 4A46A 4J2DA 3KK1B 3G82B 4DF4A 4USTA 2XY8A 3RBDA 4BCAA 1XMOJ 5DM6L 4TQSA 4H0XB 2XS5A 2DIUA 2ZH6A 2KDOA 2F7TA 2HS3A 4PWUA 2OA8A 3MECA 5M1FA 1GTHA 1TL7A 4LQ9A 2KHDA 4A57A 4MO4A 4CFDA 1JLAB 2LDIA 3IM8A 1GOCA 4IOAL 2QXFA 1RILA 4JHDB 3MXJA 1YZ6A 1Y0HA 2IBKA 4WK3A 1CJTB 3A3PB 3OFFA 1KFSA 1B0VA 2AX1A 4MO5A 2D1CA 3W3SA 3O8WA 3N0VA 3KDNA 2B56A 3KHGA 2BDPA 2VFRA 4ZP7A 1F1BB 3LDNA 5EU7A 1KQGB 4P73A 1KDNA 2AEFA 1T11A 1CVJA 4YOWA 2LEPA 2QWQA 3IAS9 2P9SB 2ZE2A 4R5PB 3S6EA 4QPXA 5JS2A 3FSIA 4DR6F 5D4PA 5KG5A 4QYRA 2MB0B 5AQHA 5DG7A 4QWDA 3LH2S 2YWKA 4TYBA 2HQDA 3NCQA 3I8BA 4JS5A 3AODA 4ILJA 3GU0A 3OTEA 3ZZUA 2GGPA 4DG1A 4FLTA 1XNQF 1E4GT 2P6TA 1CULA 3DKDA 1TUGB 3V1QA 4PKHA 3JAMU 4CF8A 1BY9A 1BUPA 4WJBA 2Z4PA 2EWSA 3H2VE 2V69A 2I5JA 3DLLQ 3PFEA 1RHKB 2IJFA 2V2ZA 2DRBA 4X4VA 2F40A 2AJ1A 2FVRA 4E0DA 5A2QO 1URRA 2O66A 2R7WA 3OBYA 3MWPA 1N33K 2N7CA 1U02A 2GO8A 1I3AA 1HNZJ 4EO8A 3EMTA 4CJKA 3ATVA 2WAQD 1HJRA 3TX8A 3SUPA 3AVCA 1JK9B 1F5CA 2HHVA 4KTQA 2ZBQA 2GFFA 2QXLA 3MAAA 2VJVA 3ZZYA 3DGVA 3IRXB 4LJMA 3BUZB 3ILOA 3DMJB 1RBUA 5AQKA 2KVIA 4C8KA 3CCRS 2DNYA 3TJ8A 4DV0F 3DLLL 3D2EB 1WAJA 2PZSA 4Q5VA 2GJFA 3FEXB 3ENOA 2HPUA 2F1FA 1HJOA 2FBYA 4G1QB 4DTSA 3VF6A 2V4RA 3N01A 3T19A 2E9TA 3P5BP 4E1NA 3CCES 5SWMA 1WEZA 2FC0A 4GRSA 2RU3A 1HPZA 3LL3A 1PBAA 4OI2A 2HGLA 1NGIA 5KG2A 3C15B 3AO1A 2ZWOA 1FKPA 3WQTA 1J53A 3QRQA 5HMZA 2GMLA 4X66J 5CHIA 3NH1A 4EU0A 2R7SA 2F8TA 2KKZA 2YVSA 2WVBA 2QMUB 5B0DA 4B02A 1QUPA 3PR4A 1R6VA 1VMBA 3BPSP 3BBFA 3MEEA 4ZJQA 4DV5F 2JC0A 4R79A 2CVEA 1TKXB 2MKSA 4KKOB 2Q6CA 4U95A 4WWSA 3M6GA 3KZBA 1QVGR 4P2SA 3LO3A 1CZ9A 4DV2J 1NKEA 2A3ZA 3CXCR 3OW2R 2CNOB 5AQNA 3ZX3A 4A5BA 4I4BA 1LAVA 8ATCB 3KNGA 3VVUA 2R3VA 4DV3F 2WVCA 3PR5B 1NBEB 2HW3A 4EYIB 3M5RA 4BR9A 3CCRN 2OSRA 2Z56B 3H0PA 3V9SA 2Y1IA 5DM7Q 3NLCA 2WCXA 2XY5A 5GADP 3OA9A 3CUNA 2P9GA 1R8AA 1UVMA 3TZWA 4U8VA 2QLXA 4F36A 1U1NA 2GJ2A 4ECSA 1RAHB 4JI2J 1T02A 4E1MA 1HHQA 1F9HA 2VOOA 3F2KA 3CJKA 3TU5A 3PRBA 4B9VA 3LANA 3OYAA 3O6QA 4PAAA 4H0TB 3M2RA 4CLWA 4K0KJ 3TEGA 2DTJA 3MMBA 3TSQA 1HWIA 5M2RA 3BQ0A 3VF4A 5CCLA 4Z0UA 2VKZG 2IS3A 2A6MA 2V9KA 5HVHA 4RWWA 1DKGD 1EWRA 3BEXA 5FRNA 3DRYA 1NOZA 4JI4K 5DM7L 1K8AO 2DRDA 3DXSX 1BD6A 2RU9A 3QWPA 3N28A 2IGIA 4C2MA 4Y2KA 1NGDA 1RT5A 1FFWB 1ZC6A 4BR4A 4M5DB 1IBMF 3OLAA 2B6AB 2CKWA 4ZVHA 1U1PA 4K2JA 4WFAL 1NJZA 1RA6A 3THPA 3C94A 1S6PB 4OZ2A 3SV4A 3FRZA 5HP1B 4HUEA 4M42A 2FIUA 4IDHA 4WXWA 5LMNK 3K17A 3QZ7A 2A6AA 3EDQB 2YKOA 3RSEA 1T94A 2YNIA 3X3UA 5D4OA 4IKFA 2GS8A 1VQ6S 3WUHA 1UWBB 2J9DE 1QE1B 3JXUA 3BN7A 3OHRA 1JLBB 4B3MF 1D09B 1RADB 2MEWA 3M32B 2N4CA 2RF2A 1RWXB 1KVAA 5BRDA 2YKAA 3LAMA 4CJ5A 3MD1A 3U7JA 2DR5A 3NF6A 1HHSA 5H1SQ 3IS9A 2YNHA 2ASJA 2R7OA 2IVMA 4DS5A 1V5IB 2YBVA 4FPAA 5GMKa 4RPFA 5AQGA 5A8RB 5CYQA 3CJ3A 1HBUA 4FKYA 2NUHA 4Z4CA 5KFNA 3VQAA 2HZCA 3NGUA 4FJKA 3LP0B 3HT3A 2Q36A 3CEDA 1N0UA 3KLHA 4LF2A 2DNNA 4DN9A 2L9WA 4GVBA 1X31C 3VALA 1BG3A 3V6KA 2NXEA 4P72A 2F8MA 4PCQA 1UFWA 3THYB 1HX1A 3AHPA 3L4QA 2AGQA 5B0AA 3T1AA 1DTQB 3DC2A 2QRRA 1EAYC 2BRLA 4CEQA 2B9EA 3CI5A 5MLCV 2ZBIA 4DSJA 1F0XA 5HROA 5IV4A 4X84A 1VQ6N 1U1MA 4A8MP 4TLQA 2XMWA 3P38A 2K7KA 2CJYB 1HBNA 1TUVA 3GCXP 3ILLA 4ZPVR 2B9YA 4WFZA 3EZWA 1JJ2M 1IKVA 4DR4J 3DM2B 4FJLA 1U8SA 3TAMA 4DQSA 3UD5A 3GTYX 4F2SA 4H4OA 2G8IA 4OX6A 2AZ1A 4RTFD 1GAOA 3DXBA 2V5HG 5AQMA 2NSBA 3T5HA 2JLFA 3ZSXA 3SBTA 2E1PA 2FZKB 4XH1A 3MM5A 2DNMA 1K9MO 3UDEA 1G2EA 2F5GA 1T9TA 4C4WA 1PJ6A 3AVMA 3HM9A 2GEMA 2DO4A 2PEBA 4R0JA 1TP7A 3IGVA 4RNOA 3B4MA 2D3UA 3EN9A 1FD2A 2HK2A 4KFBB 2YNFB 3DDIA 1X4DA 1S1WB 3RU0A 4Z2XA 1FK9A 2RHQB 3RMCA 4I7FA 4BR2A 3IO1A 5F2RA 3UN2A 3KK1A 2M88A 4YUDA 4X64F 2UV8G 1MSWD 3PRDA 4LBIA 4B1YB 1UZHA 4FW2A 5AQSA 2DGTA 4EBEA 3KLFB 4DL0C 4Y3CA 4V19X 5HMWA 1NUEA 1BQXA 2CQDA 4O55A 3O9UA 3MXMA 2DT9A 3GL1A 1S1VA 3BYRA 1L3KA 4K42A 4P7TA 4JHDA 2NZCA 5IFMA 1CJTA 4C11A 4DR5F 3R2CJ 3R1XA 1VQON 2DR7A 1E4FT 1WI8A 4LF7K 3TWHA 1HQUB 3MPYA 1VQKS 1RBOB 3PHEA 4DCHA 1YF5L 4GKJF 3A0IX 3N9UC 3R5DA 4CTAA 3DLKA 2L08A 2XWXA 3WNHA 4CJWA 4FLZA 1S76D 4AXIA 4LF5K 5F9LA 2D0AA 4LD0A 3OYNA 1SKWA 5KI6A 2RH3A 1Y4ZB 1RT1A 5GAEU 3LGHA 1X0PA 3I82A 3KLIB 3R6GB 2XHBA 3D0IE 3NS5A 3J7YU 2G8HA 1R6YA 2QLFB 3ETMA 4DSLA 4M1KA 2OO4A 3TANA 5D4LA 3S41A 3S3NA 3QDKA 2QLWA 2BE7D 3Q2TC 1U45A 2LKZA 3IXQA 4PG8A 4Q44A 3FLCO 2I7PA 3QNNA 5AR0A 3H98A 3G2XA 1C1AA 5F1XA 3EE8A 3MR3A 3BY5A 1SL0A 5CZ2A 1Q5YA 3ZSRA 5I3PA 3V9WA 4TN2A 5A76A 2VWJA 2VDIA 3NGKA 4NYPA 1OWXA 1PBUA 1X8DA 5AQQA 4NLYA 2UXCF 3WNFA 5BYRA 2C2OB 3UN5A 5ETPA 1OH5A 4OLPA 2D5RA 1RTJA 4K2XA 4P74A 2ZH4A 4X4NA 4OX9K 1QY7A 4Z4IA 4RNFA 4AILC 3G6VA 1KVCA 3HFZB 4ZVTB 2XB2D 1BQMB 4O4GA 2EK6A 3HX9A 4OL8A 3NG8A 3ZSQA 4LF1A 3IRXA 1RAFB 3IM9A 3DMJA 4A59A 4XPCA 2MQPA 1I1GA 3VF0B 1SH0A 3N4QA 1IQZA 4R8UB 2ZM6K 4ED8A 3EVWA 3R8EA 2DCLA 3HP6A 1WSJA 4BC2A 4F4ZA 3D2EA 2FLPA 2BM0A 3PYEA 4FZXC 1Y97A 1RKJA 3MEKA 3TX0A 5CXTA 3Q2SC 4X62K 2QGFB 4TXSA 2OEKA 2EG1A 3TOQA 1W7AA 4G1QA 3CJ0A 4B3SK 3AA9A 2AWZA 3TUJC 4DX6A 3PDNA 1AFIA 3ISND 2CQIA 3O08A 5ETNA 4QR1A 2OGUA 3VHQA 4K4UA 4YOTA 4WIQA 2AW0A 3C15A 4KPCA 2YI1A 2QW9A 1DZ5A 1YWXA 2VYPA 1KTQA 2HHPA 2ZBCA 3F56A 1A0OB 4V19S 3CJTA 5IWAF 1GMWA 2BBEA 4JK9A 3N6NA 4K4XA 4EEYA 2YHWA 1H7XA 1AFJA 1RAJA 3PX4A 2O5DA 4NLPA 2PC6A 2WW4A 5BPNA 1TKXA 4QR0A 1XJWB 3TSUA 2W9CB 1FX2A 5AE2A 2DHXA 3T1HF 2H3GX 2IRXA 4ZPCA 4B3RJ 4DU4A 1HBOB 4NLQA 2KU7A 2OP5A 4BS2A 2Q97A 1VGYA 2AYGA 4F0MA 5KPTA 3K8WA 1WSHA 3HPHA 3R7BB 3HTVA 3QNWB 3CO9A 3DRXA 1IR1A 2MHEA 4R25A 2C22A 2XG8A 1RHQB 1VDHA 4USUA 3C16B 1VBYA 2EX3A 1K8AT 2DPNA 5K9FA 4M3TA 3TZXA 4N76A 4KV8B 3DOMB 2CFXA 1UETA 2ZH3A 4RNNA 3ETOA 4B08A 2P9IA 4CEDA 3ILJA 1DTTB 2W41A 3O4NA 4DUYF 4IH6A 1KR4A 4RCHA 4M3ZA 3W66A 3CIMA 4RR5A 4CI6A 4MK8A 4FM0A 1UFLA 2VG7B 4CBXA 2VKRA 3BR9A 4GVLA 4V19J 3P4IA 2Y1RI 2P9NA 4OMFG 3MFIA 1ZYQA 4NXNK 1PIEA 1WC3A 3VN5A 4X4OA 3MN9A 5HOOA 3AO2A 3H1QA 3HVAA 3N79A 3V4IB 1B70B 4I64A 4LF6J 1KRPA 4JI7K 4JYAK 3U1NA 1PKUA 4F8RA 2MKIA 4FWMA 4JI5J 4YR0A 5B0GA 2HHXA 2CPFA 2GVDB 3AO4A 2FVPA 2W9BA 3G71S 4A8KA 4OI0A 4A48A 4ERDA 3ZTPA 2GUIA 2RNEA 4M5DA 1QZ6A 2B6AA 2RHKA 3OSPA 4JNEA 3BSNA 4JLHA 4ED0A 3A1YG 2HWIA 3GILA 5HP1A 2JEGA 3H3OB 2LA6A 2HNYA 5ETLA 3SQ4A 4DPOA 4FPRA 2R7TA 5ETMA 2DNPA 2DB1A 2UU9F 3HSDA 3LDLA 3H2LA 2OJ3A 4W92B 2KW4A 3JS9A 2GQCA 1S12A 1VSHA 2IJNA 3BH7B 4IYQA 3EICA 4ED4A 4G1PA 2V8HA 1FXRA 2PO4A 2R9LA 2Z57B 2MGZA 1SCJB 3Q24A 1JL1A 1ZM3A 2P2CB 4CECA 2QYGA 1J27A 2LECA 4JI8K 2IBOA 4YDUA 1LFPA 2CYYA 5L1LA 3HSZA 4DB3A 1N5QA 3D7SB 3WXKA 2K2PA 1NPRA 3B82A 3LWMA 4OX7A 3Q89A 2F8EX 2YJFA 2BVZA 1EIYB 2XMUA 2VBYA 3FZHA 2OLWA 1YJNS 1UVLA 4FWQA 4GKKJ 1W2BR 3CT9A 4ZTJA 4QBUA 3LP0A 1U1LA 4MJKA 3FMBA 4LF4K 3G71N 1NK4A 1N56A 3HBTA 4FWLA 2JSXA 3TAFA 4CGIA 5HO4A 4HCBA 4PYAA 2YQ1A 4DJBA 4ZIWA 5KRTA 1RT2B 1K9MT 3OVSA 3RRHA 3I96A 4P75A 3M6UA 5FPNA 3OHAA 4KHPK 3FBEA 2OSQA 1WN7A 3V4MA 1SV5B 5HRRA 1YXQA 1VSIA 2QT7A 3TAGA 4CJPA 4LRAA 3H46O 4LVNP 1UTAA 2W8KA 2AYBA 3NY0A 4FXWA 1UEUA 2IJRA 2RE2A 3O4QA 1WBDA 1VQ4S 1CJVB 3NRBA 3MPWA 3CIPA 5DETA 1ZAWA 3F44A 4FVMA 3TR8A 4U7BA 2ZNZA 4CJ3A 1ILYA 3VWSA 3BGUA 3L2QA 3MX5A 1S57A 3I56S 2XYPB 2KHCA 1HQ2A 3LW5C 1YJNN 3NFAA 1FDNA 1EKEA 3ULEB 3O3FA 2CPEA 3LP1A 2G13A 1SL2A 3JQMA 4Y0WA 3M8YA 2Q0UA 4D3HA 5AQXA 2FF3B 3HKZD 1RP5A 1CXQA 2IIHA 1KFDA 2E2PA 4EZ9A 5A8WA 4PWWA 4AUKA 4AE5A 3W9IA 3NGTA 3ASMA 5DK5A 2VGNA 4L74A 1OMSA 4F9OA 1GNKA 3EXYA 1FXDA 4CZHA 4UQGA 5ETKA 1ZTWA 2R7RA 2PT0A 3KLFA 1IBLJ 4DU3A 2ZH9A 1FNOA 1WACA 3MN5A 2O8CA 1G6BA 2ZVSA 3E01A 2YKNA 1X4HA 2HHHJ 4ZPAA 5HBMA 2RQMA 3TUIC 3A8JA 1P8ZA 3WNGA 4Y28C 5L9NA 2IRYA 1T9YA 2WK4A 2BJ3A 3UKRB 3PCOB 3D9BA 5MLCQ 3I56N 4Q0BB 4U7UD 2CPZA 4UF4A 1HQUA 4LH5A 1Q82O 1NCLA 2VV5A 5KG1A 1CPZA 4UQTA 4JI4F 1WTBA 4HDGA 1WKJA 1BGXT 1JLCB 3VQ8A 2I9SA 2Q3PA 3CJ4A 4U7CA 1IR2A 4W5NA 1QZ5A 3DDNA 4BRFA 3A5LC 4ECYA 3Q23A 4EIAA 3FGVA 2QKKA 2L9DA 4OLBA 3BGRA 2IA0A 1NU0A 3H08A 3LM2A 5LMNF 3S3OA 1RBSA 4USJC 5EOYA 4USIA 2WBRA 4KY3A 4EUVA 2ITGA 4QQBA 2OAUA 3QJPA 2J0QD 2M5YA 3K2PA 3MM8A 3TVYA 3P83D 2XY7A 2EC0A 4J2BA 3C6AA 1AZSA 3ONQA 1IWGA 2MXYA 3N6LA 1O13A 4A4JA 1FKAF 2GHVC 2FDNA 4YMEA 3BO2A 2KT3A 4ZVUB 5F3ZA 5ADXH 4KYZA 5GIPA 1NK5A 3P4UB 3SCJE 3SPYA 2FJBB 4B8AB 1P9QC 4IDKB 4GO5X 1BQMA 5DLGA 3MAHA 1RBRA 1RBLA 4YNQA 2FGCA 1TTHB 5BR8K 2C3MA 2JZ5A 1SKRA 1ZM4A 3MEGB 1JCEA 4PG4A 4QOTA 5AE1A 1ATSA 3QFWA 1RQ0A 5GMDA 5FRMA 1TMJA 5E26A 2MQLA 3CB4A 2UZAA 1VQ9S 2E4LA 5K8MA 1SB6A 1WTFA 3VVTA 1T0TV 1VRQC 1W26A 1F6TA 3HHDA 4NASA 1FFGB 1J54A 3H42A 1ZM2A 4QCLA 4A8SA 2J7UA 3RYLA 3B78A 2QEXN 5IC4B 5C15A 4PG7A 4GVMA 4C1NI 2ILYA 3V6DB 1ATRA 4F50A 4BC3A 2O8DA 1M5VC 1OQ3A 1JCGA 4F0HA 4NXMK 2BJ7A 1NGEA 4K5RA 1W2IA 1VQ8N 4C3KA 2AKWB 2BW7A 1TKDA 2DEIA 3T5LA 5KGWA 3O1LA 1PJ7A 3EGWB 5C2CA 3BZQA 4MKYA 4BDYA 3EWGA 1UAWA 3A8IA 1SJ1A 3CJSA 1C6VA 2W9CA 5I3QA 3SSQA 4BWJA 1MMNA 1UPMB 4Q8FA 4DQRA 1IH7A 2DISA 3DRSB 3UE2A 5DJBA 1HBOA 3TAPA 1NDKA 2CJAA 2D0CA 3OTOJ 3R97A 3A5NC 1LW0A 3V81B 1KQSR 1ZBSA 4RW8B 2V8GA 1R8PA 3I5BA 4JKFA 3RRGA 1R0AB 1N5VA 3C16A 2F4FA 1VQ9N 3ZETB 3DOMA 1T95A 4HL9A 4KREA 2E1ZA 1Q86O 2RD5C 4YHHJ 2PAVA 2BE2A 3IBFB 3H5UA 3LOUA 1Q16B 3U4LA 3AY0A 3ZYYX 1GX5A 2LXFA 1JX4A 2P9EA 3BSAA 2IPOB 3DOLB 3R6LB 2GX8A 4M63C 4B9LA 4KI4A 3Q83A 4FJ7A 2X1BA 4P2XA 5HQ8A 1RHJB 3LGMA 1UVJA 3BF1A 4PXEA 1NJIO 3CCZA 1T6CA 4PPDA 2WONB 1RYSA 1X5SA 3OVNA 1TVRB 1BWEA 2PYLA 2CGJA 2PFFB 3DDKA 8AT1B 5I42A 2EHGA 2YV0X 4FJMA 2O8EB 3OXFA 2KVQE 3PO4A 4OYZA 4CF0A 2KXHA 3U27A 1L5UA 3NMUA 4DFKA 2BEFA 3PX6A 4LF7F 3I31A 5EWFA 4BC4A 5F3TA 2DBBA 2MKKA 3R6MA 1MWYA 4HHJA 3L7PA 3P96A 2HNZB 1S4EA 2E5HA 3KUGA 3ZTRA 3BQ2A 3W9HA 4MKAA 2GJIA 3NNCA 2JVOA 2C28A 4LF5F 4QS7A 2Z58B 2ZJRQ 3M2VB 2VA2A 2H65B 4BROA 1QS4A 1I3OB 1GLLO 1SJ3P 5G0RB 4NLVA 5HK4A 4TVAB 3KJNB 4ZLPA 1G7CB 4PXCA 1KQFB 3D6TB 4YEAA 3FQKA 4ZVRB 5GMEA 1V5VA 1QHAA 1OVQA 2PN6A 4OHZA 1BOTO 1M5PC 1OJ4A 2VU5A 3WXMB 3VEZA 1WORA 2Y9HA 2ASPA 2MKCA 3BBCA 1Q9XA 2ZHAA 5I3UB 1RYRA 3TUZC 1T6DA 2G1DA 1S22A 4PHTX 1RA7A 2MQ8A 3D66A 5EY4A 1Y3JA 1ZAXA 2V4QA 1VHXA 2OFHX 5HAOA 1D1UA 3G25A 4ETXA 3RR7A 2ZH1A 3D2WA 3MPVA 4OYBA 4N56A 4JI0J 2ZJRL 2HB5A 4BRQA 3CFOA 4KGVB 4E7LA 2BRKA 4DR3K 2Z2YB 3EVOA 1RGIA 1QM9A 3KHRA 1EP4B 2V2VA 3K57A 1Z05A 1DT9A 4CLUA 2CAJA 1V3ZA 1RABB 4DUTA 4DOZA 1N32K 3CCMS 4M3YA 2ZEJA 4X65J 4X62F 4KB0A 3AA2A 1YUWA 4ZDNA 2C2KB 1PSDA 1KP6A 3B8HA 5KFIA 4N5SA 4XH4A 3QFPA 4A61A 1Q0NA 2M9KA 1L3SA 4DKWA 4NPOA 4I2QA 1WG4A 3GE1A 2G8UA 2YJEA 3ZC4A 1PYOB 1YRXA 2APOA 1CJVA 2Q1LA 1C0TA 3BB5A 2YKQA 1KQKA 3W65A 4IRDA 1WHVA 1UPPA 4FJ8A 2GWJA 3DN9A 1IM4A 1GTEA 1SIZA 3KWMA 3R2DJ 2ATCB 1QQMA 1BISA 3D1OA 4WQ4C 2W7AA 4O3NA 2CADA 3TZZA 2WRMA 4L3NA 2J7KA 4EBCA 1JWWA 3CCVN 1OPIA 5FPEA 1CZAN 4CGGA 2UUCJ 4B3TK 3GJQB 3O6WA 3SCKE 3TTFA 2HQGA 3SMPA 1Q1KA 2RPIA 1NK9A 2ZZMA 4DTRA 3KLEA 4LFCF 5KFWA 4K4TA 5LJ5Y 2PFUA 1QDUB 5GAEI 5HANA 3CNQP 3L7UA 3PJWA 1ELOA 1UA1A 4A8FA 4F3QA 4CBWA 4IO9L 3KWGA 4E7IA 5HVFA 5CA5A 3CCMN 3AQOA 1U09A 1Q9YA 1HNIB 1T05B 3EYZA 3SJHA 2W01A 2HBKA 4GV6A 1GFWB 1XNRK 3C14B 2FJDB 5AQZA 1FWKA 3J81Y 3ZSOA 3PEHA 4F04B 2GELA 2E5GA 1S9FA 5J1EB 4HH0A 1HARA 2UUBK 1S3XA 4NXNF 3HHLD 4KH0B 5DZ6A 3UKRA 3VPZA 3L2WA 3G9CA 4CIFA 3M2UB 4BC7A 1AXQA 4DV6J 1YK9A 4DV4K 1W9HA 2EFQA 1N33J 4ZHRA 1X4FA 3C8YA 1NOYA 1G15A 1UL3A 1HI0P 4JYAF 1D3WA 2R2RA 5DZ7A 4DQIA 1RHMB 2ZZTA 1Y7PA 4AT1B 3MHYA 1UVIA 4CZGA 1RHRB 2RQKA 1S7IA 3QRRA 3VTIA 2KZMA 3IG1A 2GBZA 2P9KA 3AVGA 1YIJN 1C4CA 2DXEA 4C8MA 1WG5A 4K25A 3NF7A 4DTUA 2GAGC 5HQMA 1JCFA 3V6JA 4LFBJ 2F8HA 1E6YB 4O8UA 1LK7A 5FJ4A 3VA3A 4LSNA 3RB4A 4WFYA 1GK8A 2MJUA 5C2GA 4TQRA 4CFCA 1QAJA 3M6VA 2A41A 4CO3A 3FSXA 1IKWA 3THTA 3K7RA 3QO9A 5BREA 3AD7C 1FJCA 2Q1NA 1RTHA 1CBKA 1OY8A 3IFRA 3W2WB 5DQGA 1S79A 2I0XA 5BJRA 4ID8A 4CWBA 3BF4A 1Q8IA 5IQQA 2UUAF 2ALYB 3CW2C 1TL3A 1CQMA 2I1RA 2KB2A 2V63A 3V9ZA 2HZVA 2HLTA 1TK5A 4CEZA 2K1RB 2E6LA 4MIWA 4J2EA 4PXBA 1DY3A 2Y0BB 2DY4A 4OX8A 5KPZA 5E41A 5E3PA 3BSCA 3M8PA 2W2PP 3L95X 3VQ9A 1R89A 2D3O1 2WC9A 4LF4F 3UFCX 3VAFA 5B8HA 3UCZP 3AJ1A 2GZOA 2PMHA 1WSGA 3MTKA 2OTJS 4KHYA 4F7VA 3FCVA 4NYNA 3MM7B 1HYSA 2YWGA 1HKGA 3R7SB 4XEIA 2M2BA 4WF9Q 1WHXA 1U1OA 3EGZA 1X9JA 1NAQA 1ULRA 2XYHB 2Y8YA 4AF1A 1WG1A 4KHPF 1CEZA 3UVJB 1SJRA 4IEIA 3V6DA 1ZM9A 1XC3A 4GV9A 4MLHA 3BR8A 3LA0A 4F4KA 1Q86T 3MEDB 5L46A 5IM0A 3I55S 3I0RA 3S01A 4MDBA 3E3XA 3L7OA 5KFSA 3AVJA 4CJSA 2R2UA 1N4LA 1MN7A 1Q8LA 3RMDA 3OT9A 9ATCB 1H0HB 2CPXA 2VA3A 4C8OA 4PUOA 1IBKK 4FWPA 2VJUA 5C2FA 2BJDA 2R8HA 5KFKA 2G2ZA 3DRSA 4M94A 4OZ0A 3DLEB 4J8FA 3FE1A 2NS1B 4FVUA 2KQ2A 3OPKA 4WF9L 3LZJA 4QOZB 3MUMP 2FXUA 1OPZA 3WEEA 4RW8A 4H5VA 3M05A 3MM6B 2CWKA 2DHSA 1SIWB 1R0AA 2MZJA 4BRDA 4L3QA 2HQCA 2G2OA 1P27B 1ATNA 3DXKB 1VI7A 4KT0C 1VQ5N 4LRDA 4RKUC 4M63A 1K0VA 3EZ5A 6FD1A 1S5JA 4P9SA 1JL2A 2JRSA 4F4WA 4Q2MA 3RBZA 1HNXK 2MZTA 1FO1A 5FROA 3DOLA 1FJGK 3KK3A 4H0PA 4P7VA 3ET6B 2JWLA 3KKSA 1NU4A 1GLEG 2AQ4A 4WBFA 1HNWK 2MTLA 5GAHP 3K89A 4JKAA 1IQTA 3HPGA 1XR7A 2WONA 1IWAA 3ZZOA 4CLFA 5TKWA 1HWLA 1TVRA 1RLCL 2D41A 3OFHA 2FZCB 1SUQA 3VQ5A 4FPBA 3SMSA 3TZYA 1S1TA 2X3GA 2KT5A 3JSBA 2M8DB 3PEJA 2RVJA 2U1AA 3GJRB 3W5XA 1U2CA 2HNZA 2HAIA 3VEXA 3PSIA 4KO0B 3SIPB 3ID6A 4WKYA 3LDQA 4XH5A 2DY1A 3M3ZA 2RMLA 2NRZA 2C3OA 4ZKAA 1Y5IB 4J7CA 4DR6K 4J2AA 5CYMA 4UOGA 1KQSM 1JLQA 4CNZA 4QIGA 1PAEX 1B3TA 4CJ7A 3NEKA 3IA0A 4F25A 5ETSA 3KOAA 2JOQA 4FZVA 2JWNA 2DGQA 2CA9A 3FZMA 4JI3F 3WX4A 2Z2MA 2KN4A 1J2VA 4OYAA 2D9OA 3HT0A 2NZ4A 2DD8S 2PE8A 1J5EK 2FC8A 3H90A 3PVXA 3NF8A 4NLDA 4OYWA 4CJEA 3LZIA 5KFDA 1NWKA 1LK5A 2HSEB 4RUCA 3TUPA 4NYOA 3EE3A 3GDQA 3JAMY 4NYFA 4O5FA 1HR0J 5C12A 4UOCA 5JLHA 3ISZA 4MFBB 2EFGA 4B1WB 3PZPA 1HI8A 3AH6A 3Q0AA 4URGA 3AOCA 1N36K 1EP4A 2VDHA 3NGRA 1AYEA 2QI2A 4F02A 3Q8UA 2QL7B 4FLYA 3NGIA 2KLAA 3O5BA 3A8KA 3AV9A 2JH3A 3SBGA 4CO0A 4WTOB 2GVZB 1JJ4A 3HL8A 4KBOA 4RWTA 3HKWA 5HMXA 2KFNA 4ZLJA 4PZVA 2BM1A 3CJ1A 1KOOA 1MMDA 3J7AN 1Z26A 2BTFA 4UY8O 1NK6A 3IAYA 1T3OA 4BHQA 2V7YA 3ZEUA 2P9PA 1QQCA 3AVBA 4WQ4A 1T03B 3MK6A 3ZX0A 3P5TL 1LWFB 2J8AA 2IRUA 1OS5A 1YBUA 1ZZNA 3ENAA 2WW8A 4QYZJ 4NXMF 5FPDA 4ZK7M 2E5LK 4ZA1A 4NLCA 2MPUA 3J81O 1S99A 3LPYA 2FZGB 2R7XA 1AUDA 1OSCA 3CCSS 2HQFA 5B09