1DLOA

Human immunodeficiency virus type 1
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of unliganded HIV-1 reverse transcriptase at 2.7 A resolution: implications of conformational changes for polymerization and inhibition mechanisms.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 REVERSE TRANSCRIPTASE
total genus 129
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1dloA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dloA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dloA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dloA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1dloA05
1RTHA 2GBZA 5FROA 1S10A 4EZ9A 1TL3A 3JSMB 1JLFB 1OS5A 4KHYA 1N56A 3SUNA 4XIUA 5C25A 3NKYA 4DFJA 5F9LA 1HQEB 1HYSA 4ED1A 5KGWA 1SUQA 2HVHA 3VQ7A 1XR6A 4W5QA 2JEGA 4M95A 3QLHB 1RTDA 4L8RB 1BI4A 3IG1B 3M9MB 4B9TA 4YMEA 5EDWA 3DOLB 3ZCMA 2XGQA 2OPSB 1U45A 3ICLA 4IRCA 2D3ZA 4J9OA 1S9EA 4JRQA 5JUMA 1NK4A 2OPRB 1TV6B 4ED7A 1U48A 5KT5A 1NK9A 3FFIB 3C94A 1C0MA 1LAVA 3MEGB 1NK5A 1RT6B 4NRTA 1KLMB 1S1TA 5F8NA 4O55A 2Z1GA 4NCGA 4FJ5A 1WSFA 3DLKA 1EP4A 5K14A 3G6XA 1VSDA 1IKVA 2BQRA 1IH7A 1KVCA 3NAEA 1TKZA 2YNHB 1TGOA 1X9SA 2WK4A 3QESA 4DTUA 4KB1A 3EPIA 2V4RA 2V0NA 4MIAA 4MK8A 2YV0X 2VWJA 2DFEA 4C8MA 2VA3A 3QGHA 3KLGB 4ECYA 4URGA 1VSHA 4CFAA 3ZSOA 4DSKA 1U49A 3QINA 4F8RA 2R8JA 3MXIA 1RT5A 1JKHA 5KFLA 4H54A 2IAJB 3C95A 3DRRB 4N5SA 4CERA 4RNFA 3KLEB 1RA7A 4B9NA 1JLGB 5DQHA 4CE9A 1S1VA 3SCXA 4CJUA 3DRSA 5C5JA 3LDSA 2G8UA 2FVPA 5F8JA 4NCGB 3WNHA 4NLWA 4U6PA 4DFKA 3DYAA 4WE1A 5KFDA 3HT3A 2W7PA 5KRTA 1XWLA 1NJZA 4ZP8A 5EU7A 3TVKA 4Q0BB 4TN2A 2R8GA 3DOKA 5KFTA 4O3PA 4O4RA 2OPSA 3AO1A 1RCHA 4DS5A 4WFYA 3KD1E 2QV6A 4CF9A 1IKYA 3DOLA 4KHNA 3I0RB 4MKAA 3RR7A 3FRZA 1CZ9A 5KFSA 4CGDA 1GOCA 1F21A 3KKSA 4J9LA 2OYQA 1LWCB 1NOZA 4C8LA 3AO4A 2BDPA 1JXEA 3NF8A 3TR8A 2YKMA 3T3FA 5CY4A 1TL3B 4ID5A 4DF4A 3EYZA 1BQNA 1QHTA 4TSXA 2HHQA 2IJFA 3AVHA 2VWKA 4ELVA 2UVUA 4J2EA 3MECB 4W5NA 3MEDA 3NH2A 3KLFA 1KTQA 3CDEA 2BQUA 1NK6A 3SPZA 2XI3A 2OH2A 3LWMA 3MECA 4ZP6A 2J6UA 4KTWA 4Q45A 1SKRA 2WTFA 4CJQA 3NDKA 5FDLB 4Y2CA 3H5UA 3M9OB 2VG5A 3EY1A 2UUTA 1C0TA 3CQ8A 1S1TB 1U4BA 1TK0A 4YP3A 4DMNA 3MEGA 4RW6A 4IBNA 2G8VA 2HVIA 1WSHA 4FJ7A 5KFMA 5KG0A 1MMLA 3LP2A 5JXSA 2D3UA 3E51A 4DL6A 4X2BA 3OS2A 4ZVGA 3DLGB 3VQAA 2R2TA 4QWCA 3KNAA 1BI4B 3NFAA 2W9CB 1NHUA 1RBSA 1RTIA 1YVUA 4IFVB 3MEEA 2PYJA 4CJWA 1T03A 4M3YA 4CEAA 4K4YA 4DU4A 3SV3A 3CG7A 5F8MA 3DMJA 1RTDB 1KVBA 4OLBA 4ED3A 3F9KA 3NGYA 4KV8A 3M8PB 2WOMB 4IDKB 3PX6A 1KLNA 4OGCA 4I2QB 2W8KA 4MFBA 3S3MA 3HP6A 4CJKA 4Q5VA 2GUIA 4LSNB 2ASDA 3AA4A 3PW7A 2YKNA 4FLVA 2BR0A 2X6NA 1JLAA 1EKEA 4MIBA 4AHTA 3OYNA 3N6LA 3IGVA 4KKOB 3E01B 3KK3A 1ZYQA 3G10A 1UWBA 4Q44A 4I2PB 1WAJA 5KFGA 3QERA 3ISNC 3ZT3A 1JLCB 1RT6A 2VG7A 1UWBB 3OVNA 3MR6A 4NLRA 4FJIA 4CEFA 3K5NA 4ECZA 3MXJA 3FFIA 1L3VA 1K1QA 3RBEA 1VSLA 4DL5A 3PV8A 1HPZA 4DLEA 3B6OA 3PVXA 1TK5A 4ZVFA 3NGZA 3OYHA 1BHLA 1EXQA 4LQ9A 1SKWA 2QKKA 1S6PA 3KTQA 2YNIA 1RAJA 4QW9A 3NF6A 3TAMA 4H8KA 1UAXA 3FDSA 4Z0UA 3CDUA 2GC8A 2JEIA 3KMQA 1WN7A 4OPJA 1X9MA 5J1EB 3T5KA 3P83D 1NK0A 3AA2A 5SWMA 3DRSB 5KG4A 4CECA 3HP9A 2PZSA 1D0EA 1HQUA 4M3TA 1HMVA 4QWEA 1RT4B 1RTJB 3LP0B 4K8XA 4FJNA 2O5DA 3H5YA 2HNZB 1QE1B 4CJ3A 1L3TA 4ED2A 2QXFA 2F8EX 2UVRA 1JLBA 4K4WA 3KLIB 1NHVA 5KT3A 4RNNA 4Z4GA 4FJMA 4M3UA 1RT1B 2D41A 3CFPA 2IM3A 1QUVA 4XO0A 4Z4CA 2PY5A 3KJVB 1TQLA 1S6PB 4NCBA 4BE0A 4FLTA 2UVVA 2EHGA 4O44A 4NLXA 3PO4A 4CEQA 1UA0A 1RT3B 3MR3A 3WNGA 3V6HA 2XRIA 1TKTA 2BE2B 1BL3A 4ZMMA 1ZBHA 4KAIA 3HPGA 2HHVA 2VG7B 4EO6A 3TAQA 4ECXA 2HW3A 5DQGA 3VQQA 3QZ8A 4C8OA 2V4QA 3TQ1A 5J2NB 1XR7A 4I9QA 3SYZA 2B5JA 4GC6A 1KHWA 5EWFA 2HNZA 4ZVEA 1RBTA 4ZTFA 2LSNA 4FJGA 3EZUA 3GV7B 3DMJB 4CIFA 1HNVA 2Z1JA 2C2EA 4K4TA 4FW2A 3LALA 4FZYA 3OYLA 1N5YA 4QWBA 1REVB 4F3OA 4NLOA 2DPIA 1EP4B 1NOYA 1C1AA 4BDZA 3AVMA 4NRUA 4WFXA 1CLQA 3AO5A 2G8HA 2CJQA 2IJNA 3O3GA 2A1RA 2UVWA 4AHSA 4Z4FA 3Q8PB 1T94A 5F8GA 4ECVA 3OL9A 1N4LA 3L8BA 4WZQA 5KFZA 1J9AA 1S6QB 2HHSA 4DFPA 3HM9A 2HNYB 4TQRA 4KREA 4KHRA 1QSLA 4JRPA 1FK9B 4HCBA 2AJQA 3HVTA 3Q8RB 2HNYA 3IRXB 3AVKA 3CFRA 3WNEA 2C2RA 3KK1B 2O4GA 1TK8A 3LP2B 2E9TA 4EYHB 2HB5A 3NE6A 3DRRA 4RW6B 3BSOA 4ECRA 3CJ0A 4IG0A 3PZPA 4N56A 4FJJA 2IM0A 2JEFA 3LPTA 2B43A 3ZT2A 3QNNA 2XCPA 3ZSYA 2W42A 1QSSA 3RWUA 1WNSA 2ILYA 4NYFA 3G6YA 1S1WB 2WHOA 4WXWA 1HYSB 4FK4A 3V6KA 2RF2A 3L3UA 1NKEA 4I7FB 4KI6A 3MR2A 3CJ3A 1QQCA 1XR5A 2P1JA 4E89A 3O3FA 3L2VA 3H5SA 3KHHA 5DGAA 4PWDA 5HP1A 1Z25A 2OPPB 2XO7A 1U09A 1VSMA 2B5JB 1C2PA 4BE1A 4F3TA 1TVRB 1RT4A 4DF8A 3HPOA 1D9DA 1BIZA 3DRPB 1S1XA 4OLAA 1IKWA 5KG1A 3QIPB 1CXQA 3H2LA 4LSLA 3OYJA 4LH5A 5C24B 1SH2A 3S9HA 3DI6B 5L1JA 4ID1A 2G8WA 3C6TB 4H4MB 5DLFA 3GV5B 5K14B 1WLJA 1BCMA 2C22A 5EWGA 4OKKA 4HUFA 4FLXA 3V6JA 3OJSA 3C6UA 3NHGA 2RKIA 1S9GA 4JLHA 2Z1IA 3VQSA 4PA1A 1JL1A 4O5BA 5F8HA 2D7SA 1K1SA 4B9UA 4RW9B 3H4DA 1S9GB 1NJYA 3B6PA 3HJFA 2AGOA 1D9FA 1C0UB 4RW9A 4CK3A 4NLSA 4RG8A 4ECWA 2R7YA 1KVAA 1TKXB 1J5OB 3QETA 1KCFA 4RUCA 2IAJA 4NLVA 4RUAA 4AHVA 1U04A 4E0DA 3RMCA 1SH0A 2YNFB 4E7IA 4CF0A 5L1LA 4M3XA 3DLEB 3BREA 3VQCA 5CYQA 4PWDB 3RB4A 1SL1A 4FK0A 3RAQA 2KFNA 5KFPA 1SL2A 4E7KA 4FJKA 4M42A 5T7BA 1KFSA 4LSNA 4KHQA 3P1GA 1LAWA 5I42B 3PX4A 4KBIA 4K4VA 5KFYA 5HRRA 5C42A 3EZ5A 4DSEA 4O4GB 4IH5A 2DFFA 4MH8A 4FJXA 5KFIA 2RDIA 5L1KA 3GYNA 4FLWA 5F8IA 3SPYA 3ALYA 4E7HA 4O44B 3L2WA 1U47A 1XC9A 3VQ6A 4AILC 3FQKA 1FXXA 2YKMB 3EPGA 2HNDA 1RT3A 5HRSA 4BWMA 2OPRA 5DLGA 4ELUA 5KFWA 4KB0A 3T5LA 5KFAA 3LWLA 2GIRA 1TKXA 1N48A 4K4ZA 3I0RA 2QE5A 4CHPA 1FKOB 3V1RA 1VRUB 2JGUA 4LQ3A 2VG6A 1S0OA 1C1CB 3PR4A 3PY8A 4CK1A 4CHQA 3G0ZA 3QO9A 4FM1A 1S49A 4I2QA 1MU2A 4FS2A 5J2MB 3U3GA 3QLHA 3HO1A 4G1QB 4PUOA 3BR9A 4RW8B 1IO2A 3I5AA 5KFVA 1LV5A 1HNVB 5KT7A 3NAHA 1I3AA 1RNHA 3OJUA 4J9RA 1LWFA 3TAFA 1TVRA 4WXOA 4FM2A 4J2AA 4HVJA 2FJWA 1GX5A 4FK2A 5KFOA 3ASMA 1EETA 3K59A 3LZIA 2J6TA 1DTQA 1LW2B 1RDCA 1N6QB 2FLNA 3PW4A 4E7JA 1X9WA 3DLHA 4I9LA 3L3VA 5JS1A 1BQMA 4IKAA 1Y97A 4HUGA 2Y1JA 1DLOA 3SQ4A 3SJJA 1TKZB 2YNHA 2AQ4A 4JS5A 2R8IA 3H5XA 4E1MA 4IRKA 1HJRA 3LPUA 3PX0A 1CSJA 2OZSA 4FVMA 4FZXC 3BQ0A 2IBKA 4HYKA 4CGJA 3IS9A 3H59A 4O0IA 1X1PA 4JV1A 4DTNA 1KLMA 1J5OA 2CKWA 3OL6A 2IOCA 4Z4EA 1B9FA 2BE2A 4F2SA 2JC0A 3FQLA 5KFXA 1Z26A 1RDRA 3UQSA 3PJXA 3PR5B 3G6VA 4GMJB 1JLQA 1RT2A 4Y2AA 1GOAA 2OPQA 1XHZA 3CM5A 3MXMA 4IR9A 2I1RA 4IG3B 3OSNA 1C1BB 4QOZB 1LW2A 2HWHA 3JYTA 4OGEA 2WOMA 1VK0A 5DQIA 4IQXA 3HK2A 3D5MA 3HVWA 2YKNB 4HCCA 4WE1B 1KSPA 2ASJA 1K6YA 3KLHB 1TL1B 1YTAA 4KHMA 3OHBA 3IN5A 4GVMA 4RW8A 1NJXA 1REVA 3HKWA 2FBXA 3M8RA 3T19A 4MKBA 3QIPA 3KLHA 4FJLA 1CZBA 4KTZA 2ZKUA 1VSKA 4ICLB 2FVQA 3PW5A 2XI2A 4W5OA 4QAGA 4YFUA 5DG7A 4NLUA 3LAKA 4DSIA 2D5RA 2ITGA 4YR3A 4DSFA 4MK9A 1VRTB 3K5LA 4CJ4A 5KT6A 2DFHA 4DQRA 3SI6A 4LY7A 5D3GB 3OY9A 2AGQA 3DLGA 1WSEA 4Q0BA 2VG6B 4J9SA 5KRSA 2AX0A 1RDBA 1QAIA 3QEPA 3UDLA 1JLEB 2KW4A 4FCYA 4BWJA 3C6UB 4Y34A 4IG0B 2D0CA 2FVSA 2F8SA 4CHZA 5KI6A 1Q9XA 2XY7A 4HTUA 1T3NA 3D28A 2B4JA 4TQSA 1ZETA 2W8LA 4FLYA 1ZTTA 2B6AB 4WYLA 1RT5B 4ZHRA 1S48A 4ZPDA 4FM0A 3GIJA 3PJWA 5DGBA 3AVLA 2GV9A 1HNIB 4DTRA 4EYIB 2FLLA 3KHLA 4KB7A 2ATQA 3AV9A 1D8YA 1LWFB 1HMVB 3H4BA 3V9UA 4O3NA 4OKJA 5CYQB 2WONA 3LZJA 3D0PA 4TY8B 2I5JA 1BCOA 3DDKA 5HRNA 3RTVA 1IG9A 4DWIA 4FXDA 4N76A 4EP5A 2IS3A 4KHSA 3LP1A 2IC3B 5C25B 2BRLA 2OZMA 4CFBA 2X74A 3NH1A 3NGIA 3SI8A 1D1UA 1JLFA 2JEJA 2YHAA 4CF2A 1RTHB 3OL8A 3ZSRA 4J9KA 3O3HA 4ZHRB 1RDDA 3ZT0A 4R0EA 3QIOA 4DQIA 4J9PA 3ZT4A 4F4XA 3QIDA 4CEBA 4UQGA 1T8EA 4F4KA 4H4OA 4CGHA 3PUFA 4OKEA 1FKPB 2OA8A 1JLQB 1RT2B 4CEDA 3OYKA 1KRPA 4YR0A 2JC1A 4B3OB 1JLEA 2P5GA 3M8SA 3MF5A 4BDYA 3KLVA 4QCLA 5KT4A 3GIKA 3O4QA 1SUQB 5KFJA 4B8CA 4DFMA 1S1XB 3QEVA 3AVAA 2AWZA 5KFCA 1J54A 4IKFA 4NZ0A 1S1UB 4O4GA 2RF2B 1I6JA 5L9XA 1QE1A 2GIQA 1DTQB 4AHRA 1ITGA 4URQU 4JV0A 3KK2B 3GV8B 4ICLA 1LW0A 3HHKA 2EC0A 4DL7A 4M94A 4QPXA 3NGDA 3F73A 4ID5B 1QAJA 4DEZA 3NBPB 5J2PA 3CM6A 3PW0A 4ECSA 1S5JA 4CEZA 1BGXT 2AGPA 3S3NA 4FS1A 3NMAA 3H08A 4CESA 4FJ9A 1LWCA 1Q9YA 3V1QA 3V81A 1T03B 1JXLA 4R8UB 2ZD1B 1C1CA 3GQCA 4TYAA 5KFHA 3M8QB 3TWHA 2Z1HA 1FKOA 3V4IB 1T05B 3ULDA 3M8QA 1UOCA 3SQ1A 4KO0A 3HVAA 4FLZA 4DL2A 2IMWP 3BSCA 2R2SA 1LWEB 3I5CA 3H98A 4B9MA 3IG1A 2YHBA 3HSTB 4CJ5A 3GIMA 3QEWA 1RYSA 4RW4B 3OS1A 2HAIA 1JLGA 2XGPA 5C24A 1QSYA 1RA6A 1HQEA 4FW1A 3DRPA 4RNHA 3T5HA 4XPEA 4ECUA 4W5TA 3C6TA 3E01A 3KK3B 3K5MA 5KFNA 1N5YB 2I5JB 4RNOA 3KLFB 1RBRA 4URSA 3QEXA 1TL1A 4LD0A 3OS0A 3VQ4A 3U6FA 1IKXB 4E1NA 4NLQA 4CIEA 3KK2A 3KHGA 5C42B 4B9VA 3KOAA 4CK2A 3A2FA 3V9SA 5HROA 4TY9A 1TKTB 3K58A 2PYLA 3DLKB 3SV4A 1HPZB 1W25A 3OHAA 3OYCA 1BQNB 1W0HA 4EO8A 1A5XA 3CJ5A 1G15A 3L2UA 1L3SA 4DTJA 3RR8A 1C0UA 4EZ6A 4DQPA 4BE2A 3CIZA 4FZZA 3GILA 3QGIA 5D3GA 4CGIA 4OPKA 2E6LA 5EWEA 2RPIA 4GC7A 4KHWA 1SL0A 2WRMA 2W9BA 2BGGA 3LP0A 3BDPA 3THVA 3N6MA 3I0SB 3DOKB 3HYFA 1JLBB 4DSLA 3ZSVA 2FLPA 2W9AA 3SFGA 2G8FA 2R8HA 4CHNA 4DU3A 2WCXA 3OYGA 4CF1A 5KFFA 4K4XA 3DI6A 4KV8B 3NF7A 4WFZA 3HPHA 4J2DA 2XC9A 3AVGA 1IKWB 2WB4A 1NK7A 3K2PA 4K8ZA 3BJYA 5CYMA 4F2RA 4EBEA 3SZ2A 2HHUA 1KHVA 1QS4A 4YNQA 3OL7A 2FJXA 1HARA 3UIQA 3VQ8A 1HNIA 3GIIA 4NYNA 4OJRA 4RW7B 2HMIA 5F8LA 3AO2A 5KGXA 1GOBA 2ASLA 3PHEA 3KD5E 1QTMA 3AVIA 3OYAA 3RMDA 1S1WA 1IKVB 3LAMA 2DY4A 4CJEA 2AX1A 5HBMA 4KI4A 3DM2B 5J2QA 5F9NA 4ED6A 4ED8A 4O3OA 1TP7A 4CJVA 2EX3A 3OYEA 5HBMB 1R0AB 4CJLA 3DLRA 4M3ZA 5KT2A 1XHXA 4B3OA 5DMRA 4FYDA 4E19A 1JIHA 1Z4UA 4J9MA 3P5JA 4GW6A 1N6QA 3VQPA 4KE5A 2XY5A 3MAQA 2FVCA 3ZT1A 4IDKA 1EETB 3MEDB 3TAPA 1ZBLA 1BISA 2E6MA 1NK8A 1BQMB 3OYIA 3TANA 2VA2A 1RILA 1RTJA 4QW8A 3LP3A 3VN5A 2P51A 4O0JA 4KTQA 3TARA 4J9QA 4IOBA 5J1EA 1TAUA 5FRMA 4KFBA 5HRPA 5KFQA 3NL0A 4OL8A 2JLEA 3JSMA 4EBDA 3ZSQA 1VRUA 1IKYB 3AA5X 1MU2B 4OVLA 1C1BA 1YVFA 4DL3A 3ZSZA 4AHUA 3IAYA 1BIUA 2C2DA 3UR0A 3KKRA 1DTTB 3CFOA 4CJFA 1NJWA 3BSNA 4IG3A 1NKCA 3ITHA 4F4WA 3CJ2A 2O4IA 3AVJA 4QWAA 4R5PB 3DM2A 5J2QB 2FVRA 5KFUA 2VG5B 5SZTA 1L3UA 5FDLA 3OLBA 4AHCA 4JUZA 3RBDA 3KLEA 3NH0A 4F4ZA 4DTXA 3QEIA 4R5PA 3V9XA 2W7OA 4B08A 3SQ0A 3VQEA 3N6NA 3KLIA 3MFIA 1W9HA 4M41A 1I39A 2E4LA 3TI0A 5DG9A 1JLAB 1XI1A 2FBYA 1SH3A 1S97A 2XHBA 3RRGA 2YNGB 4IFYA 4PQUB 4RW7A 4RU9A 3OYBA 5T14A 3BSAA 2RN2A 2IA6A 4NLYA 3KHRA 4CJPA 1S0MA 3AVCA 4CF8A 2WONB 3MFHA 4DU1A 3RMAA 5KG7A 4Y1DA 3L2QA 3Q8SB 5KFRA 5HLFB 3RMBA 1HQUB 5CZ1A 5FRNA 4CJTA 3G86A 4DS4A 4ELTA 3T5JA 4G3IA 4ZPAA 1ZBIA 1RTIB 3I8DA 2C28A 4CEEA 4K4UA 4DTOA 4Y1CA 1VSFA 4CCHA 2E9ZA 1LWEA 4M3RA 3PW2A 2BANB 2BQ3A 2R2UA 1HYVA 4TLRA 3JYTB 3V4IA 1T05A 3OLAA 3VA3A 3I5BA 4ZPBA 4IRDA 1ZTWA 5DG8A 4CIGA 3NCIA 4QWDA 3RB3A 4H4MA 1ZBUA 4FJHA 4NLTA 4TXSA 3MTKA 4Q8FA 2D0BA 4DLGA 4F4YA 4ZP9A 1JLCA 3OSPA 4J9NA 1DLOB 5KTQA 3AA3A 4CHYA 4E3SA 4HUEA 4C8KA 1NNDA 4MK7A 4Q43A 5E41A 1EX4A 4Z4HA 1VRTA 4CFDA 1VSEA 4M45A 3M8PA 2FC0A 1SV5A 5I3UA 4DSJA 1IKXA 2G8IA 4KFBB 1ASVA 4IH6A 4XPCA 3QYYA 4DQQA 1RT7A 4YR2A 2B6AA 2Q3SA 4CGGA 1FKPA 2HHTA 4H4OB 2KFZA 3DLBA 4ZVHA 3KIOA 5J2MA 1ZBFA 2W9CA 3QO9B 4Z4IA 5KG2A 3PO5A 3ITHB 4W5RA 4G1QA 2J6SA 3NF9A 1JL2A 4CJSA 4KO0B 4DG1A 3HXMA 4HKQA 2ZD1A 3V9ZA 2NUBA 1HYZA 3SNNA 4RNMA 3VQ9A 3VQ5A 2IC3A 4DTPA 3TAEA 4JS4A 4K50A 4O3SA 3CVKA 3FSIA 3NBPA 5J2PB 3KMSA 5JS2A 2X6SA 4BDPA 5KG3A 3SUQA 1RT7B 3H40A 4DQSA 3MR5A 2YNGA 4IFYB 3QZ7A 1B92A 5I3UB 5HROB 3D45A 4NYZA 2G8KA 2IDOA 2F8TA 3AVNA 3V6DB 2QK9A 4IH7A 1RYRA 1LW0B 4FJ8A 3OYMA 3V6DA 4RZRA 1WAFA 2KZZA 2X78A 4CHOA 3RAXA 3KLGA 5HP1B 1WSJA 2ZQBA 1S0NA 4MQ3A 2IM1A 2HHWA 3Q8QB 4KRFA 2ALZA 4EP4A 3U3YA 3MEEB 1RBVA 1J53A 3S3OA 3DLEA 1R0AA 3T1AA 3CYMA 2BANA 4FBTA 4K4SA 3CWJA 4E7LA 1CXUA 4WYWA 4KKOA 4Y3CA 2W9BB 3BGRB 2HWIA 4RW4A 3BGRA 1DTTA 1TV6A 3CO9A 5KG6A 3SFUA 1S9FA 1ASWA 2RKIB 2DTUA 4ECTA 3QGGA 4DTSA 2HNDB 3AO3A 2R2RA 3IGNA 1B9DA 4EEYA 4TY8A 4Q8EA 4M3WA 4LSLB 5CYMB 2BRKA 3BQ2A 3SUOA 4NCAA 2DPJA 1VSIA 5CZ2A 1TKDA 1S1VB 2ATLA 4PUOB 3WNFA 4PY5A 1YTUA 4LH4A 4NLPA 4B9LA 5KG5A 4KPYA 1WSGA 4WZMA 4BACA 2OPQB 3M9NB 4N47A 1HRHA 1A5VA 1IM4A 2OPPA 2IGIA 3TAGA 2KQ2A 3K57A 3VQBA 2FJVA 2D0AA 5EUHA 3L2RA 4KHUA 1C6VA 1T7PA 2ETJA 3HL8A 1WNEA 3RB6A 3OYFA 4I7FA 3VA0A 3SUPA 2P5OA 2QKBA 4AH9A 3VQDA 3QNOA 4O3QA 2XCAA 4KSEB 3V1OA 4NLGA 3OYDA 2Y1IA 4B9SA 3KJVA 3V9WA 2V9WA 3ISND 5KFBA 5KFKA 4CEOA 1ASUA 4J2BA 1L5UA 1A5WA 4MFBB 4YQWA 4DL4A 1YT3A 1S6QA 3KK1A 1O1WA 1VSJA 1RBUA 4R8UA 4JV2A 4NLDA 4CFCA 1RDAA 4KAZA 3V81B 3SQ2A 1NKBA 2HMIB 3LP1B 1JXBA 1SKSA 1D5AA 3NAIA 4CGFA 4IR1A 4ZTJA 4IFVA 4ECQA 4CJRA 4ZPCA 3RRHA 2ZE2B 1KFDA 2YNFA 1UA1A 4ZP7A 3O4NA 4PQUA 3TABA 5HLFA 1JX4A 1JKHB 2KZMA 3AVFA 5L1IA 3TAMB 2XY8A 2ZE2A 1SV5B 3K5OA 4HHTA 2ILZA 3BQ1A 4U7CA 1S1UA 2R8KA 4ED0A 5J2NA 2A1SA 1TAQA 4C8NA 3CJ4A 3RB0A 3I0SA 5DK5A 4FBUA 4FLUA 2XY6A 2YNIB 2F96A 2KTQA 2IM2A 5KFEA 4TYBA 2E9RX 4DG1B 2RDJA 4N41A 3HVRA 4F50A 2XWYA 2AU0A 3DYAB 2FBVA 4O3RA 4B8AB 3CDWA 4I2PA 2UUWA 1C0TB 3UPFA 3ZSXA 2HHXA 1Q8IA 4EBCA 3AVBA 5I42A 3IRXA 2FBTA 3HVTB 3LANA 1GX6A 3IS9B 3ZSWA 1RT1A 1S9EB 4DTMA 1FK9A 1S4FA 1WSIA
chains in the Genus database with same CATH superfamily
3MMAB 5I3PA 1FDDA 1TZ0A 1FRMA 3JSMB 4P71A 1S10A 2O8FB 2ZNYA 3AH6A 1NMEB 2R4FA 1CC7A 4M63C 2XZWA 3C19A 4QZVB 2I6WA 3W2VB 5C25A 2HRUA 4PWUA 4JI0K 1F3FA 2O67A 2HVHA 4JD2B 1BUXA 1WG1A 1VQ8S 3MMBA 4WWSA 2XMAA 4X84A 3TEGA 1YJRA 3FEYB 3DXSX 3Q2TC 1BI4A 3W2WB 4OQJA 5EDWA 3MUMP 1FJEB 2E1ZA 1W2BR 4A62A 1DZ5A 3MHYA 3ZCMA 1U2VB 2E44A 2D3ZA 3LQVA 1D3WA 1NK4A 1X4AA 3D1OA 4ED4A 1HI8A 1U48A 1YRUA 3C94A 4X4OA 1C0MA 3AOCA 2XNQA 2HYIB 4J9VA 1NK5A 1RT6B 5F8NA 2XSFA 4DR7K 2CJXB 1WSFA 3Q8YA 1IJFB 1EP4A 5K14A 2W6KA 3D66A 2BQRA 1IH7A 4CO3A 3NNAA 2CUYA 1TKZA 2YNHB 2PFFB 1JJ4A 2EI5A 1TGOA 4LFCK 3BEXA 4KB1A 1WI6A 3RSEA 2R7TA 1HKCA 3TP2A 4MIAA 1N32J 4RX6A 2VA3A 3KLGB 4DSKA 3H1QA 4F8RA 1YZ7A 2R8JA 5CE3A 4AL7A 1GMVA 3THWB 2IAJB 3KKFA 2H3EB 5H1SV 5LL6d 3DRRB 2VQFF 4WU3A 4ZS6A 4CERA 3VTHA 2YKAA 3D1HA 1S1VA 2DH7A 1F2GA 3LDSA 4I6WA 2EKYA 3I55N 4GV3A 4DUYF 1B4SA 2AW0A 2YCHA 1N32F 3NOGA 2W7PA 4N8OA 1I3OB 1NJZA 2G1HA 1ICEB 2L3MA 2DHHA 3VR1A 3IM9A 3CPEA 3CHWA 3W9IA 1VS3A 4ZLJA 2R8GA 5KFTA 2OFGX 1RCHA 4HT5A 2DB1A 4HTJA 1XNQK 3KD1E 2QV6A 4CF9A 1IKYA 2YWEA 4H5VA 4CBWA 3CCMN 3RR7A 3FRZA 5KFSA 1T9XA 1GOCA 4J9LA 3AO4A 4YY3F 1JXEA 4ATNA 2YQ3A 4M5LA 4M7YA 2YKMA 1J6ZA 3BDEA 5A2QO 4DF4A 4DHYA 1QHTA 4TSXA 2HHQA 3KJQB 1FVSA 4OZ2A 2DHGA 3J7YP 1ZZFA 2GVZA 2VWKA 4WIIA 4J2EA 5C12A 3NH2A 5ETTA 2QTWA 2NSCA 3CDEA 1U8WA 2BQUA 3SPZA 4DBQA 3LWMA 3MECA 4IO9Q 2J6UA 4KTWA 2ASPA 4ETXA 1WSRA 1A6LA 4FN5A 1XERA 4DR3J 3Q8UA 3CJ7A 4IWVA 2ZZMA 3DGPA 3KWIA 2F4VK 3CJBA 1VQ5N 4X65F 4C7QA 1YJ9N 3HFKA 2MJNA 4GVLA 5KFMA 5LJ3Y 2ROGA 3ZC4A 1KP6A 1HR0K 3CCTA 2FHJD 2DGOA 4DL6A 3IM8A 4MDBA 1FE0A 4ZVGA 1V3ZA 3DOMA 2W9CB 2BE7D 1F1BB 5JVGQ 3V5RA 2DGQA 2J9CA 4C4WA 4WQ5C 4M3YA 3TZYA 3SBTA 4ETZA 4CEAA 4Y2IA 3R8YA 5IQQA 1KVBA 1FX2A 3NGYA 3M32A 1FFGB 2KYZA 1KLNA 1Q86T 4OGCA 2VDHA 2PIIA 2B7BB 3LDOA 2VIHA 2CNKB 1PJ5A 2BJDA 3AA4A 1V5IB 3A8JA 2BR0A 2ZH7A 2ZBQA 4AHTA 1VAZA 2GO9A 3DRYA 1U2RA 3KK3A 2GHWA 3HHLB 4DV6F 1T9YA 1XTZA 2W25A 3ZETA 2CG8A 3UKRA 2GA7A 3OR2B 2D3OR 1HR0F 3I31A 4JI7K 3ZT3A 4JYAK 2D4WA 3MR6A 5GAGP 1OWXA 1L3VA 2JOQA 4DPXA 1UZHA 1MDUB 3H3OB 4OZ3A 4JI4F 4J7CA 3NVMA 3WX4A 4OX9F 3PVXA 2RT3A 3OYHA 1Q18A 2QKKA 3MCPA 1RBAA 4A8XA 1S6PA 1YIJS 1RAJA 4CZGA 3M1VA 3ENQA 4OIXA 3FDSA 2YWKA 3W8PA 2GC8A 2JEIA 5FLXU 3P83D 2M0GB 3ID8A 5SWMA 4HH0A 1RXOB 5KG4A 3HP9A 1WOPA 1HQUA 4BRAA 2YKOA 5DS7A 5HQ8A 1RTJB 4K8XA 4FJNA 3NGUA 2HS4A 2HNZB 2J9DE 5CYJA 2X51A 2L08A 2Z2LA 4ED2A 2QXFA 3CCMS 3I8BA 2F8EX 2QWRA 5KT3A 2IIRA 4M3UA 1RT1B 1S7IA 2D41A 2IM3A 2NXUA 2LLZA 1XJWB 1TL4A 2EXUA 1S6PB 4XK8C 4NCBA 4IOCQ 1ZBTA 1XIQA 1T9TA 1BO5O 3WNGA 4DR6K 4WF9L 1Q82T 2QN6B 1FO1A 1K9MT 2HMPA 2HW3A 3ZTSA 3QT6A 3VQQA 4C8OA 4U7BA 3CXCR 2CH5A 3E9LA 3SCIE 1KVJA 3LO3A 4DV5K 2HFUA 3K9JA 2ZBPA 2HNZA 1RBTA 1MWQA 2V34A 4WP3A 2NNWA 1U02A 3GV7B 2J7KA 3OTEA 1RBLA 4TU8A 4FW2A 4FZYA 3GFXA 4OI0A 2ZM6J 4DV2F 4RLEA 4DR2J 3VZIA 1BE4A 5GAEI 2G8HA 2IJNA 3GDQA 4CTAB 4AQYK 4ANDA 4FYWB 3Q8PB 2R9LA 3OL9A 1N4LA 2QA1A 1CC8A 2CQGA 3C16B 1C4AA 2HHSA 3HM9A 2HNYB 4KREA 1X5OA 3OUYB 4JRPA 2DTJA 2YH1A 1R27B 1KQGB 3Q8RB 2HNYA 3AVKA 2O4GA 1YBUA 1FW6A 3UCUP 3NE6A 3BSOA 3CJ0A 3PZPA 1JJHA 3ENBA 3ZT2A 2Q97A 2XEXA 3ZSYA 2W42A 5DM7L 1QSSA 3ETMA 2G2OA 3AFGA 3G96A 3VEWA 1QLNA 3G6YA 1S1WB 4WXWA 2CPEA 1HYSB 2PAVA 2KKZA 3L3UA 1NKEA 3CJ3A 3T6BA 2P1JA 4L75A 2G1DA 2E7VA 4JK7A 2ITMA 2M7SA 4PKHA 3KHHA 1M1KT 1Z25A 3NY0A 3R6LB 3WX8A 2XO7A 2DITA 1N36K 3P3DA 2V51B 4F3TA 1OH8A 1RT4A 1QQMA 3SSRA 5AQYA 1DGKN 1IKWA 5K8OA 3HHDA 5KG1A 1CXQA 4CO4A 4ZVTB 2RH3A 2GMLA 2G8WA 3M2VB 5EWGA 4HUFA 2UXBJ 4B3TF 3NHGA 5AQRA 2RKIA 3GR1A 2Z1IA 3VQSA 1MMDA 4O5BA 3DCAA 1X9JA 2D7SA 5C0YA 4B9UA 2D1CA 2DHSA 1J5EJ 4UW2A 2G0CA 3JAMO 2NLWA 3KUHA 4LJMA 4JI3J 3ENHA 3BGLA 1VIXA 3C16A 1FJCA 4RG8A 1G4CA 4JI6F 3TZXA 2NCKL 3QETA 1P1TA 4NI2A 2IAJA 4RUAA 3I9V9 4E0DA 2DNNA 2VFTA 5CD4H 4LF7K 5L1LA 1RCOB 5C2FA 4MLHA 4JV5K 1EKRA 1J5EF 2V6AA 4PWDB 5ADXH 4FK0A 2P2CB 4DUZK 2G2ZA 2J5AA 2WVFA 4IXCA 5T7BA 4USUA 4ER8A 1LAWA 4AL5A 4K4VA 3HBTA 1B64A 4OPAA 5C42A 3EZ5A 3NNCA 2RAQA 3VAHA 4BRNA 4ZVRB 2KO1A 3K8WA 5KFIA 2B9WA 1FDNA 3SDEB 3GYNA 5F8IA 1U47A 5CAAA 1FEHA 4AILC 5ADZA 3EPGA 4JI6K 5H1SQ 2KT2A 5G4DA 5IT9U 3J7A1 2LU1A 5CR4A 5KFWA 5BRFA 3RYLA 3QT7A 4CLFA 3LWLA 2V8GA 3DLLL 3ZX2A 4OYOA 3K8VA 3NS7B 1KEKA 4LQ3A 3TZWA 2VHGA 3PY8A 4CHQA 1Y64A 2FHOB 2W4DA 1CJVB 4FM1A 5E2QA 4XH5A 5J2MB 3BR9A 5HQMA 1S59A 3I5AA 1LV5A 3SMSA 1HNVB 4RTFD 5KT7A 2QL9B 3NAHA 1RNHA 4FWNA 3OJUA 2DRDA 5LJWA 1TVRA 1H7WA 4HVJA 2FJWA 3TNVA 3ASMA 3LZIA 1N5TA 2CQHA 3D2FB 2QWNA 1DTQA 4F0KA 1WC3A 4AUKA 4DV1J 2XZTB 2FLNA 3PW4A 4RBUA 1NMNA 3IWNC 2YKQA 1PBAA 1R8CA 3ZZUA 2A3JA 5C2CA 1TKZB 2YNHA 2AQ4A 2R8IA 3CC7N 2MHNA 2MLZA 1VBYA 2CH6A 5BR8J 3M6VA 4NXMJ 2OZSA 4PWWA 2DNPA 1N5SA 4FZXC 5HOOA 5ETKA 4O0IA 4JV1A 3ZETB 1J5OA 1PIEA 3D3BJ 5GMKa 2PA8D 2JC0A 4EI2A 1RWXB 1Z26A 1RDRA 2QC3A 3UQSA 3PJXA 1RT2A 2VV5A 2Q0UA 1P8GA 3CM5A 4IR9A 1NBEB 4QR1A 1N36J 4IG3B 3A5OC 4BC3A 5K8NA 4ENOA 3BH7B 1IBLJ 3FE1A 1VK0A 5DQIA 2VF3A 1M1GA 1P9QC 4CO2A 4DMZA 1YTAA 4YDXA 5LT5A 3IN5A 1FRXA 3N4QA 1NJXA 2DJWA 2OJ3A 4YB1P 2CPIA 2FBXA 5GIOA 3T19A 2P9PA 3MM9A 4IO9L 2EFGA 3PW5A 3GYXB 2DY9A 1O8BA 3ENOA 3GE1A 2O8FA 4DSIA 1HWLA 3RZAA 4YR3A 4MK9A 4BRMA 2W2NP 3VEOA 3I56S 3R27A 4WFNL 3OY9A 1WSEA 3QBCA 3TJ8A 3OW2R 4J9SA 4PAAA 5BXIA 3RGIA 3FZ2A 2I7PA 1U26A 4X66K 2GEMA 2LQ5A 4CWBA 3CNQP 4S0MA 1JLEB 3IMXA 3C6UB 4Y34A 1X5SA 1HWJA 2PEBA 2FVSA 4XEIA 2CJKA 4O5FA 4CHZA 2CJYB 5KI6A 1WEYA 5LXYA 2XY7A 4HTUA 1T3NA 3D28A 2B4JA 2CAJA 4TQSA 1RB0A 2W24A 1ZETA 1O5JA 2B6AB 1YJUA 3VEVA 2AYMA 2G2YA 4ZPDA 1NPPA 1NM2A 3GJQB 1U0HA 4ZK7M 8ATCB 1HNIB 1U6FA 4DTRA 5A8KA 3KHLA 3CULA 2DRAA 4CLZA 3VETA 3B6BA 1VK3A 1HMVB 2BA9A 3H4BA 3GFHA 3GZ7A 3GCWP 1WWHA 4O3NA 4X4SA 1A9NB 2QW9A 5CYQB 2WONA 3LZJA 3BBFA 4B9QA 1ZZNA 4V19S 5EGYA 3WC0A 3DDKA 3RTVA 3GP9A 2ZGYA 4DWIA 3QSYB 4CD1A 2CDQA 4KHSA 3LP1A 4A46A 2ZH5A 1PAUB 2IJRA 3NGIA 1D1UA 2ZHOA 3I6PA 1JLFA 5KPRA 2GGPA 3D6TB 3DU6A 4GNIA 4R0EA 2A5XA 4GKJK 3BO3A 4KGKA 1B0VA 3A8EA 4J9PA 3E66A 4GKKK 2Y0BB 5M1QA 4CGHA 4OKEA 1X0PA 4CEDA 3OYKA 4M5HA 4BR9A 4JI1F 1JLEA 4USMA 4BDYA 4NA3A 2A40A 4LREA 2BW2A 4OLPA 4OJ3A 1NDCA 1SJQA 4IKFA 3SQGB 5GADP 1UETA 2ASMA 1S1UB 2RF2B 1HA1A 1I6JA 4FYXB 2VC0A 3PCOB 2E1PA 2PI5A 3SSQA 3MUVP 3H25A 2DR8A 1X5TA 4DN9A 4DL7A 3NNHA 3F73A 4ID5B 3CM6A 1S5JA 4ECSA 3QMLA 4G65A 1JCEA 2ZH1A 1EKSA 4RL1A 2X1BA 1OSDA 4HI2A 4FJ9A 2E1YA 2RVJA 1HKAA 1JXLA 4NE9C 1YKWA 2IIHA 4TYAA 5F0WA 1GLLO 4A57A 1FKOA 3V4IB 3R8EA 3SQ1A 3EMTA 1SC1B 4DL2A 2IMWP 3BSCA 4K0KF 2R2SA 2GWKA 3I5CA 3GLJA 3IC1A 5HMXA 4CJ5A 1N34K 1GXUA 1MN7A 2DNKA 1LOTB 2HAIA 1RA6A 2NS1B 1FTCA 2CXEA 4IUFA 2EWSA 2DNGA 3ZTOA 3TA0A 3DHWC 4ECUA 2AJ2A 3AAWB 3K5MA 1MWZA 2VGNA 2I5JB 5E3AA 3PHTA 1NDLA 1FWKA 1RWMB 3O9UA 2CYYA 5AXKA 1IKXB 1T9UA 4E1NA 3AHPA 3M8YA 5BYRA 2MGZA 4CK2A 3CW2C 3A2FA 3SBMA 3NGTA 3V9SA 4PKGA 3R2CJ 2PT0A 3DLKB 3D0GE 3CF5Q 1BQNB 2AEMA 1W0HA 2YHYA 4EO8A 3CC2S 2FXUA 5EOYA 4NA1A 1L3SA 3H2VE 4DX6A 5HVGA 2W4CA 4EZ6A 2GIFA 4DR1F 1WKJA 3JXOA 2AT1B 3GILA 3QGIA 1FFWB 5D3GA 4OPKA 4I64A 4F25A 4HR2A 4GC7A 2E1AA 2HKEA 1SL0A 4M8LA 3CJRA 2DNYA 3BDPA 2ZOGA 2QO3A 2MKHA 3DOKB 1FD2A 4DSLA 1VHIA 4DUYK 2WCXA 1CEZA 3OYGA 3VAGA 4FL9A 1S3XA 2M8DB 4WFZA 3PLAA 3HPHA 1EZZB 2WB4A 1NK7A 4YY3J 5CYMA 4AQYF 4F2RA 4EBEA 2HHUA 2QZ8A 2IVFB 1MWYA 1QS4A 1FHTA 5CHIA 2QL7B 3L3CA 2FJXA 5AE3A 2DGXA 1FJ7A 3GG1A 5F8LA 2K1RA 1HPMA 3UKUB 4W4MA 3KD5E 4Q2MA 5ETVA 4WJBA 1VQKN 3RMDA 1QD1A 4ZVOB 1Q7YO 2AJ1A 3JS6A 1U7LA 3Q7BA 1MWMA 5HBMA 4AXIA 1V3SA 2K2PA 1TP7A 2RUSA 1TUYA 1NAQA 3BF3A 3R6MA 5HBMB 3OYEA 1FI4A 3FEZA 4DUTA 4M3ZA 1YZ6A 1OH6A 2B9YA 1XHXA 4NXNF 4FYDA 2C2ZB 2V8HA 3OVAA 1Z4UA 4C6AA 4Q2LA 4J8FA 3I82A 3P5JA 1WG4A 1N6QA 2HGMA 4F4AA 3VQPA 4UT4A 3ZT1A 3MPVA 1EETB 3MEDB 2E6MA 1BQMB 2DR5A 1VQOS 1UTAA 4DU8A 2VA2A 3TX8A 2B0GA 2A6OA 3W0LA 1YRXA 4LF9F 2P51A 2P9SB 3TARA 2C2OB 4WK1A 5FRMA 2HGLA 5HRPA 3NL0A 5BRHA 3SCJE 2YHWA 3F2KA 2JLEA 1MMNA 3L4BC 1KVIA 3QFPA 3AA5X 1RE1B 1HBUA 1YVFA 2E2QA 3A12A 4AHUA 1ESVA 2HBKA 2PBDA 3GJSB 2YI1A 2RQ4A 3EO3A 1KQSM 2Z57B 2FC8A 2ACMA 5I3QA 3NGRA 4JI8K 1F5AA 4U9RA 1HJOA 3D54A 4KGMA 4IG3A 3BSNA 3ZZTA 4F4WA 5DZ7A 1UCNA 3W66A 3MTJA 2OAUA 4QWAA 4R5PB 3MMCA 2UP1A 3U1LA 1L3UA 4JUZA 3RBDA 4YOVA 3A1YG 2ZWOA 2XLKA 4DTXA 3D2EA 1VIOA 4WCEQ 2W7OA 4JI4J 4B08A 3VQEA 3KLIA 2NR0A 1NDKA 4M41A 1I39A 4CZEA 2E4LA 4OI1A 3L4IA 5DG9A 1JLAB 5T41A 1XI1A 2ZH6A 1SH3A 4Q7AA 3RRGA 2YNGB 2ZZNA 2ZBCA 1WC5A 4PQUB 4RU9A 4GY2B 1P6TA 3CETA 2IA6A 1DT9A 2XO6A 3KHRA 2Y9HA 3AVCA 3MFHA 4DU1A 3OR1A 5KG7A 4Y1DA 3L2QA 3Q8SB 3RMBA 2GELA 5CZ1A 4M7XA 2Q2RA 5FRNA 4DS4A 2DR9A 4ELTA 3W7BA 3T5JA 3L6QA 1G6BA 4ZPAA 1RTIB 2OO4A 1WORA 2BBEA 4CO0A 5A6PA 2ZVSA 2HF4A 3MN7A 5B7WA 4NLBA 3T9NA 2D74B 3PW2A 2HQIA 2NZCA 4DPTA 3V4IA 1NDPA 4CZKA 1M5VC 3I5BA 3A4TA 2E7WA 2B8QA 2EK1A 1BWFO 2WAQD 2YX6A 4P74A 2GNKA 2KXFA 2L48A 3K7RA 2KT5A 1G3OA 2HZAA 3MTKA 4DLGA 3L7UA 1JLCA 3L95X 4CM2A 2K3IA 1KNZA 3SQGA 1NXIA 2P9KB 4E3SA 3CD6S 4MK7A 4Q43A 4WFAL 3ETOA 3VGMA 3T6JA 5A76A 1VSEA 2W40A 5HVHA 5FJ4A 2BE9B 3E8OA 1VQMN 5I3UA 2CDRB 4DSJA 5CABA 4FWKA 2G8IA 4KFBB 2H65B 2V4JB 2GVDB 2HHTA 2MDAA 2O8BA 4ZVHA 3KIOA 4OPHA 1UVKA 3IBFB 5J2MA 2YJEA 1F0XA 1B3TA 3EGNA 4PG4A 3AA9A 3FGVA 3D6FB 2ZH9A 4Y6IA 4KH0B 2YXLA 5A8WA 4KJIA 4CJSA 2ZD1A 5SUHA 4JI2J 2M9KA 3CJTA 3VQ9A 3QSIA 4B3SK 4E2FB 4DTPA 4GVBB 1S0VA 5AQLA 3Q22A 4JS4A 1YWXA 2P6SA 3FSIA 3NBPA 2KXNB 2KXHA 2HFOA 3H40A 1LXJA 1NM1A 2RHKA 1W7AA 2XSJA 4NYZA 3HLUA 5I9EB 2G8KA 4I69A 3TWZA 4K2XA 4IH7A 4DXLA 3FUYA 2FB0A 3GL1A 4I6MB 1XQSC 4RO0A 3V6DA 3QAEA 2KZZA 1OPIA 2NXNA 2KG1A 3EJMA 3WQPA 3R5DA 1FNMA 2IM1A 2EFNA 3A5MC 1YJVA 2ALZA 4YB5A 1J53A 4DV4F 2GS8A 3MM6A 4LIWA 3OBYA 2MQNA 1DBDA 5HO4A 4ZCLA 4D3GA 3T1AA 2BANA 3M1FA 4OI2A 4KKOA 3MDFA 4OJ1A 2ZDOA 3GB0A 1DTTA 1TV6A 2QGFB 4ZJLA 4DZDA 4A5AA 3EGWB 1QY7A 2RKIB 1TMMA 3OUYA 3QGGA 3C14B 3M2VA 2FPHX 3IGNA 1J2VA 1S72S 1VDHA 3OTOJ 3CCJS 5DDPC 3MD3A 5AQXA 3MZIA 1OY6A 1H3DA 4NCAA 2DPJA 1TKDA 5H9EK 1RQ0A 1YTUA 4NLPA 1GH8A 3O1LA 5DDRC 4WYBA 4N47A 2NYHA 4A8YA 2AZ1A 1A5VA 4NLCA 5LMNF 2QRRA 2R7WA 2D0AA 3O2IA 3BKUA 1WNEA 2ZBIA 2MKKA 3FC9A 2H5IB 1TUVA 2C2KB 3THYA 1B70B 4BROA 3VQDA 4ZPWR 4KSEB 3V1OA 2PN6A 5KFKA 2UUBF 3VENA 4ANCA 2FGOA 3G87A 4JKBA 2D9OA 3PIPQ 1A5WA 2BMBA 5M1PA 3CJQA 3M2UA 1UAWA 1VSJA 2LMIA 2H4WB 4R8UA 4CFCA 5IM0A 3FRYA 3DU5A 1TL7B 1UJ4A 1UPMB 1PYOB 2VC1A 2KM8C 1DARA 3NAIA 3RRHA 1YAGA 2ZE2B 2E1RA 2QA4S 2M2BA 4WK3A 4RUBA 3BGUA 1NHKL 3TAMB 2K8GA 2LVWA 1SV5B 3G71N 3PRBA 3K5OA 2G13A 1CS4A 3N0VA 2QWQA 4JI7J 2W2MP 1HUXA 1IBMF 4X65K 1TAQA 3JTNA 3FZMA 3HD1A 3PYDA 4FBUA 4DR2K 4GKJJ 2XY6A 2DNLA 2GX9A 4TYBA 4A61A 3HVRA 4F50A 2XWYA 2FF6A 3WC2A 4A8OA 2FBVA 4B8AB 2IRXA 5DRKA 4DI6A 1C0TB 3UPFA 4EBCA 1YGYA 2OEMA 3P5BP 3LANA 2FTRA 3ZSWA 1RT1A 2CPHA 1FK9A 5IWAK 2KYXA 3HX9A 2GUPA 2QIFA 4BR5A 3W61A 1UVLA 1TL3A 3WXLA 3MPYA 1VQ9N 1UMJA 1OS5A 4KGVB 2DKOB 3EE9A 4KHYA 5IV3A 3R1XA 5IV4A 4XIUA 3FZKA 2VFSA 4O8UA 2HQFA 5F9LA 4ED1A 1H38A 1O51A 4M95A 3TUZC 2DGSA 4NI2B 2DH9A 1HW8A 3HSZA 1LKZA 3CJ1A 3DKDA 3DOLB 3D6MB 4ZCIA 4AE5A 1WSVA 5FLXO 4ES3A 2OKQA 4IRCA 1HBOA 3T1YK 2OPRB 2WVDA 2LXUA 3MM5B 5KT5A 2K7JA 5IC4B 1NK9A 2V8VA 1LAVA 1HD0A 2O8EB 4NRTA 1KLMB 1X31C 4OYIA 5M1KA 1FX4A 2COLA 3IMQJ 2FSJA 4HHUA 3NVKA 2DEJA 3G6XA 3CCRS 1Z05A 1WBBA 3NAEA 1GXTA 3QESA 3ONQA 5LY3A 2V4RA 2VWJA 2DFEA 4C97A 1OO0B 4C8MA 5B08A 3G6ES 4ECYA 4DV2J 1U49A 3B8AX 1VQ7S 3MXIA 4BY9C 1JKHA 4RCHA 3G25A 3TW0A 3MN6A 1U1QA 3C95A 2UU9J 4N5SA 3ZFVA 4BLGA 1VQKS 1K44A 4B9NA 1JLGB 3SCXA 3W62A 4CLKA 1KD1O 4LFCJ 2FQQB 2FVPA 3KUGA 4Y2MA 2NRWA 3WNHA 4FF4A 4WE1A 2B9XA 5KFDA 3ZEUB 3AY9A 5KRTA 2E2PA 1XWLA 4FSVA 1LQ9A 4K7QA 2IDLA 4ZP8A 1RZMA 3C6AA 1HBOB 1EWQA 2CIMA 3CCSN 1Y5IB 4X62J 3QRPA 3G4SN 3AB4B 5D4NA 3RJMB 3A8IA 4IZ9A 4CM0A 3CMQA 3UVJA 3DOLA 1OJ4A 1CZ9A 3CQXA 4P2XA 3HZ6A 2YBVA 4DCJB 4C8LA 1NOZA 3NF8A 3DWLA 3OVBA 2LQ9A 1JXVA 2B4VA 1TL3B 3MM6B 3MX2A 3EYZA 1B7YB 2K06A 3I4PA 2UVUA 3MECB 4ZKAA 1MWKA 1Y11A 3KLFA 1KTQA 3LPEA 2DR6A 2Z2YB 1HHSA 4CVNE 4FOEA 3P5TL 3H2UB 4QQBA 1WHVA 1QTNB 2N4DA 4OLOA 2LKZA 5D4PA 2JHEA 4Q45A 4CJQA 2BZ2A 1C0TA 4BBYA 4WQ5A 6FDRA 5IWAJ 3QT8A 3IXQA 4ES1A 3P49B 1XN9A 4YP3A 2HRTA 4Z7YA 2WW8A 2X1GA 2KVQE 3N5FA 3MCAB 1MMLA 2EFPA 2WVEA 2QYCA 2WTUA 1OVQA 2WUSA 3FGUA 4X2BA 2F8HA 3PTWA 2MZRA 4A8FA 3VQAA 2BUPA 4QWCA 2MEWA 3KNAA 5MLCQ 3NFAA 5B0AA 1V5VA 5BRDA 2MQOA 1RBSA 1KVKA 3CQYA 2GJIA 3GPAA 1VHXA 2A2DA 2F4VJ 2IVMA 3MEEA 1NGAA 1T03A 5C15A 1EARA 2IPOB 4DU4A 3TQEA 1NJIT 5F8MA 4OLBA 3F9KA 5BYSA 4KV8A 2WOMB 5GAEU 4IDKB 3PX6A 1HNWK 5GAHU 4LF5J 3KNGA 2W8KA 1RI7A 3S3MA 1IJJA 3VAJA 4CJKA 1XNRK 4LSNB 2VWBA 3THWA 1UFLA 3PW7A 5HI7A 2YKNA 4I67A 3O5TB 1SVDA 2HZVA 1CVJA 3IGVA 3E01B 2JNJA 3G10A 3FVYA 1M5HA 5F3TA 3QERA 3ISNC 1JLCB 1RT6A 2Z58B 1VQ8N 3W60A 2E5LK 2K3KA 4ZOSA 3K5NA 2ZJRL 3QDKA 1S99A 3MXJA 3PEHA 3BO4A 2V2QA 5E3CA 5IFMA 3CD0A 3T1HJ 4OX7A 1HPZA 4X66J 1UL3A 1QVGR 1FJGJ 1TK5A 2WVBA 4BRCA 1BHLA 4DV3F 3W1YC 4CI0B 3AAPA 1VQ4S 5LM7E 1QVFM 5J1NA 3HMJG 3TAMA 1BWVA 2HSTA 1GLAG 3T5KA 3MX5A 5HSPA 1NSAA 4KIAA 3DRSB 4CECA 4JD2A 4PYAA 2QLBB 1VYAA 2RU9A 2PZSA 1D0EA 3W2VA 4M3TA 3D1QA 3A3OB 3EE3A 2MTLA 3WUHA 1QE1B 4CZFA 1HNZF 1JLBA 4DV5F 3KLIB 4RNNA 4FJMA 5CQGA 4G1IA 3CFPA 2LA6A 4XO0A 4Z4CA 4KH6A 2R7UA 4JKEA 2PY5A 4U7UK 1XMOJ 3A13A 1E6YB 5G0RA 4JBCA 3MWBA 4I6YA 1RHRB 3BF4A 2WC9A 4UY85 4C3LA 4WTYA 2EFQA 3V6HA 1X0FA 2CQ4A 2CVEA 2QXLA 3U9DA 2VG7B 4QR0A 4WFBQ 5D78A 4ILHA 1R8AA 3M8WA 5J2NB 1RTZA 4I9QA 1H74A 1EQMA 1YTYA 4BGAA 1KHWA 1QAYA 3J7Z5 4DCHA 4ANEA 2CQ1A 1N5VA 2UUAJ 3SLCA 4AYBD 4ZTFA 2R3VA 1NLKL 3AQPA 3RW6A 3HSDA 1GTEA 1YF5L 3HF5A 2Z1JA 4P9SA 4Y28C 2C2EA 3LALA 2VUGA 1N5YA 1PYTA 2AF6A 4QWBA 1REVB 4QS9A 1NOYA 3AVMA 2HF3A 4NRUA 4WFXA 3SXLA 1SQEA 3B82A 3AO5A 2ZKTA 2UVWA 3UI3A 5F8GA 5A8RB 3L8BA 4WZQA 4L73A 5KFZA 2D1KA 4HHJA 1RKIA 5ETSA 4DFPA 9ATCB 4TQRA 3RU0A 4KHRA 1QSLA 5TKWA 1HHQA 5A2QY 2JDJA 2BX6A 3HVTA 2J8SA 3CFRA 2C2RA 4KBOA 2LXFA 1TK8A 3LP2B 3CCUS 1CJUB 3DXKA 1URRA 5L39A 2HB5A 3DRRA 4RW6B 1AZSB 3D6HB 4IG0A 1HNXJ 4N56A 2LEPA 1F60B 4H0YB 2KI2A 2XWXA 1NZAA 2N3OA 4H03B 2O8BB 1OIAA 1WEXA 1S7HA 2LXIA 3LGMA 2F7VA 5E3QA 1QQCA 4KI6A 4I6AA 4E89A 2P9GA 2Z2ZA 2M52A 1DAXA 5IC6B 3MM7B 5DGAA 1VQ4N 3W5ZA 5HP1A 3PRVA 2VYPA 1U09A 1VSMA 1C2PA 3R1HA 4Y0FA 1Y0HA 4DF8A 3HPOA 1D9DA 3DRPB 4ALZA 2W41A 3LH2S 3F41A 3QIPB 1XNRF 5C24B 1SH2A 3AXKA 5L1JA 4RWWA 3FNNA 4ID1A 4PXBA 5DLFA 3GV5B 5K14B 2P5VA 3TZZA 4OKKA 3UN5A 3TU5A 1F9EB 2NXEA 4ED5A 2VKRA 1S9GA 2CQDA 3DN9A 1UWAA 4PA1A 1JL1A 4RUHA 5F8HA 4A4JA 3ULEA 4RW9B 2YPYA 1X4FA 1URNA 4NZ6A 3QFHA 3NOCA 4I0WA 3B6PA 4UOCA 3R5CA 2HIQA 3HSGA 4FWMA 1KDNA 3LOUA 3B78A 2OSRA 4FP9A 3CJKA 1OQ6A 3D68A 4NLVA 2N7CA 1SQFA 3BB5A 1LWXA 3S8SA 4M3XA 3FZLA 1HBMB 2ZGZA 2RILA 1SQKA 1Y5LB 4QR2A 1JQGA 1IR2A 2NRTA 2MYFA 3EKSA 4E7KA 3EL2A 2OD6A 2BYCA 4HHHA 4JB8B 5I42B 1U1PA 4KBIA 5KFYA 2F5GA 1N54B 2RSQA 4DSEA 2DFFA 3PYFA 4MH8A 4FJXA 1QVGM 4GKJF 5A0YB 4X4PA 3SPYA 4E7HA 4BREA 5EHHA 1GMUA 3WEEB 2LP4A 1XC9A 2NXJA 3FQKA 1FXXA 2HNDA 4YDUC 5HRSA 4EU0A 3SIPB 2F9JA 3HSJA 3T5LA 5L38A 2GIRA 5B0GA 2DH8A 2CFXA 3I0RA 5AQPA 4CHPA 1FKOB 5KPTA 5DM6Q 1ZM9A 2VG6A 5IZHA 4I56A 3G0ZA 3W64A 2DNRA 3QO9A 3JQMA 1S49A 2NRXA 3O9TA 4LF6J 4I2QA 1HBUB 3QLHA 2I7NA 2NUHA 4G1QB 4RW8B 3W5YA 2VPYB 1NGGA 2WSFC 4J9RA 1FXRA 3CC4N 3TAFA 4FM2A 4J2AA 3MWPA 4DR7J 1EETA 1ELOA 3K59A 2JJ4D 2F9WA 1LW2B 3Q8VA 5B0DA 1N6QB 1JB0C 4E7JA 2BJEA 4I9LA 3L3VA 2AJ4A 2V67A 1BQMA 3SK3A 4FPIA 3VEYA 1Y97A 1RABB 4JS5A 1NGEA 3PACA 1HJRA 5GAGU 3PX0A 1N32K 4FVMA 4LF4F 2P9IB 3MGJA 1V9OA 4HYKA 2X1FA 1X1PA 2R7OA 4DTNA 3VPZA 1AZSA 1WOSA 1I94F 1WF0A 2Q31A 1F5BA 4Z4EA 2BE2A 3GE9A 1S72N 4FZVA 4PZVA 4DR2F 3FLCO 4FVCA 3BBBA 4P52A 2UUCJ 1XHZA 1BOTO 3OSNA 2Q66A 2HWHA 3JYTA 1SQGA 4C11A 3HK2A 3UKUA 3HVWA 1KSPA 4USJC 2XMJA 3KLHB 1TL1B 1VISA 2MZ1A 5HK4A 5DZ6A 2AZ3A 1REVA 1ZM4A 5MLCV 1XNQJ 2WB1D 2YWWA 3QIPA 1UEKA 3KLHA 4LF4K 1CZBA 1YBAA 3ZXWA 1X60A 4ICLB 2FVQA 4V19X 5CA5A 3P45B 4YFUA 2CADA 3BO2A 3UE2A 2BM1A 4CJ4A 4DQRA 3SI6A 1I94K 2BABA 4M5GA 3DC2A 4F04B 5D3GB 3LDQA 3DLGA 3O1BA 4F3QA 2BTFA 2H5EA 2VG6B 4CI6A 1PBUA 3M7VA 4YDDB 4YHHJ 3CE8A 2AX0A 5HQLA 4A5BA 1X3NA 3FBFA 1QAIA 4LFBK 1M1KO 2JVRA 2DNZA 4JAXA 4IG0B 2D0CA 1ACMB 4A47A 4B3SF 2P9IA 2F8SA 2Q0RA 1RAOA 4ZLPA 2P9NB 2MKCA 1Z2LA 3VERA 1RT5B 4NPOA 4ZHRA 1S48A 4C48A 2F1FA 1R0BG 3JQKA 4FM0A 2CZ4A 2QX0A 3M05A 4EYIB 3UNYA 3PSIA 2ATQA 1D8YA 4HLBA 3HM8A 5FLXY 2OI2A 4TY8B 2I5JA 1BCOA 3B4DA 4FXDA 6AT1B 3WT0A 4RWXA 2IC3B 2BRLA 2XTJP 2OZMA 2ZWPA 2X74A 4JEPA 3NH1A 2GHVC 2YHAA 1CQNA 4N8NA 4PL8A 3QPIA 1RTHB 1T3OA 4PG7A 3O3HA 3ZT0A 4LF1A 1GMWD 3HCXA 4ISFA 2L9DA 4UUWA 1YJ7A 2I2YA 1XMQF 4JI4K 2VBZA 3KZBA 1NPRA 4UOHA 4YS2A 2OA8A 2RS2A 1RT2B 1QUPA 1IR0A 2JC1A 1VR6A 3IDHA 4JI2K 2XS7A 3POTB 4KHPJ 2DEIA 1F5CA 1BA1A 7FDRA 1SUQB 5KFJA 4QPTA 1N88A 2QSWA 1NG9A 2VZ9A 5KFCA 1J54A 1RWVB 1HFEL 3F44A 4OX8A 1QE1A 3F56A 4H0TB 4TU9A 1DTQB 2FZKB 4H0PA 2QL5B 4BC5A 3GV8B 3QJJA 2DVIA 1LW0A 4YORA 3HHKA 2PO4A 3NGDA 2V7ZA 1GLBG 1QAJA 1U0SA 4PG5A 3VOVA 2AGPA 2LA4A 4IOXA 3QNWB 3H08A 1LWCA 1Q9YA 2C3PA 1WACA 3V81A 3FCHA 1T03B 2UYTA 3EXCX 3GQCA 1CPZA 3DXKB 2MQMA 4YOWA 2VOPA 3ULDA 2HGNA 1UOCA 4KO0A 3HVAA 4FLZA 1ZA2B 4PPZA 3R5JB 1LWEB 1FJGF 3H98A 1RHMB 1TELA 3HSTB 1RISA 2HSEB 2ZOMA 3NG8A 2O8DB 2DXDA 3OS1A 1QVFR 2H4YB 4NWBA 1QQNA 3C2PA 5C24A 1QSYA 1HQEA 2MQ8A 4ILRA 4JKGA 4BVOA 4OX9J 3DRPA 3R3TA 4RNHA 4PG8A 1LOUA 2KJWA 4XPEA 2DT9A 4TU7A 2MZQA 3CJAA 1PC5A 3E01A 3VV2B 5A8KB 1N5YB 1HNWJ 3KLFB 4URSA 1TL1A 4LD0A 3VQ4A 5AXNA 4NLQA 5EX3A 1X7VA 5F41A 1MROA 3MCSA 1N33F 3W3DA 2EKNA 5C42B 6FD1A 2AYGA 3KOAA 1UFWA 2ZJPQ 5HROA 4TY9A 4DV5J 1DEJA 1TKTB 2JSXA 1W25A 3I96A 3OHAA 5HJYA 2EG2A 1Q8KA 1A5XA 3HRGA 3L2UA 4DTJA 2OP5A 2DNMA 3ILIA 1AROP 2C42A 2WSCC 3H8YA 2KN4A 4BHQA 3Q23A 3T1HK 4DPYA 3CIZA 2MB0B 3J7AP 1BU6O 2F9DA 2IFXA 2RPIA 3M2RA 3HHNB 1PJ7A 2WRMA 4JK9A 2W9BA 4OYXA 3LP0A 2QSFA 3N6MA 5B09A 3I0SB 1ZM2A 1JLBB 3ZSVA 1NWKA 2W9AA 4CHNA 1RAFB 3BUZB 5IT9Y 4OHVA 2P9EA 3NF7A 2IA0A 1IKWB 4LUBA 2P9PB 2GFFA 1EB0A 2UUCF 3IO1A 2ZBRA 3FBEA 2MSSA 2MQPA 1HARA 1HNIA 1VQYA 1V4TA 3AO2A 5KGXA 5IOLA 2JLFA 2YX1A 2ASLA 3D0HE 2ZH3A 3AVIA 3OYAA 1S1WA 1HWIA 3VZHA 3LAMA 4JP8A 2DY4A 1KN6A 3M6XA 5F9NA 5J2QA 2AP6A 1KQKA 2QEXN 2Q1NA 2AP1A 4CJVA 5K5MA 4EIAA 2EX3A 1K8AO 3LM2A 1R0AB 1YQHA 1RADB 3QBXA 2PEHA 4M5MA 3QB0A 1PCAA 2M3DA 5JICA 2DGUA 4E19A 5AQMA 3KG4A 1WKLA 4J9MA 1P90A 4P72A 3OTOK 2FVCA 1QQOA 1ZBLA 2FGCA 3OYIA 2XS2A 2HG4A 4OJGA 5J1PA 1SI9A 2FZGB 1J5EK 3ULHA 1WC4A 2J76E 5L8RC 1O0PA 3IUCA 4QW8A 5M2UA 4KTQA 1VJQA 3R5AA 4DR4J 4C8ZA 2BKOA 2CWXA 3O8MA 5AQIA 2FLOA 3OA9A 1WC1A 4WPAA 4ILLA 2RRNA 1YBTA 3QQCD 4LF7J 4OVLA 1IJEB 1HNZK 2F4FA 1TMJA 3IAYA 1N8RT 4NZ7A 2AMCB 1H73A 1DQAA 1U1MA 3KKRA 2IBOA 3CFOA 2VD3A 1NJWA 3VVTA 5BJRA 3AOAA 4DR4F 1MSWD 2FVRA 3DM2A 1YDLA 4FWSA 3OLBA 3KLEA 4F4ZA 5MAOA 2JWKA 1RGVA 4P75A 2LU2A 3SCLE 3SQOP 1K8KA 3N6NA 3CCLN 4LVOP 2H5JB 3TUPA 2E7XA 2ADBA 5BPNA 3THTA 1XMQJ 3D2FA 3QICA 2FBYA 2EBGA 5EX0A 2PI4A 1LK7A 4IFYA 1YJWS 4RW7A 5T14A 2RN2A 4AD6A 3MXHP 4CJPA 1VFJA 2D69A 2FSNA 1YSJA 5KFRA 2FIUA 1PYSB 1HQUB 2VQEK 4CJTA 3G86A 4DR6F 2BUNA 3HTVA 4NX9A 4DTOA 4CCHA 1VSFA 2Z2MA 5AZIA 4O0NA 1K8KB 4IO8A 3TVZA 4ILMA 2I0XA 4UY8O 4TLRA 4OYBA 1T05A 5HMWA 5JJBA 2B56A 4J90A 2GQ2A 1KQFB 4A8MP 1D8ZA 3SAGA 3FBBA 4NXMK 5BR8K 2V50A 3CJSA 3AGRA 2VQFK 1KBRA 1TR0A 4Q8FA 4ZP9A 2NRZA 4F9OA 3ZZYA 4FVUA 1VI7A 3ZX0A 1XQIA 1CJTA 3ZTQA 5E41A 4X4QA 4BR4A 4Z4HA 1VRTA 4B3RK 3C15B 5RUBA 2QMUB 3M30A 1KC8O 5EXWA 5F2RA 2RIJA 1SV5A 5D4OA 5C2GA 3VAIA 1ASVA 4DQQA 2B6AA 2QLWA 3M8ZA 1FKPA 1GLDG 4NMXA 5GMDA 1CG2A 1ZA1B 3UE5A 1ZBFA 2W9CA 1TL7A 1KC8T 5KG2A 3PO5A 1OH5A 3ITHB 4CZHA 3CO0P 4PXDA 3NF9A 1JL2A 4DG1A 2RS8A 1RHUB 1GFWB 1U6ZA 4HKQA 4HL9A 2AEFA 3V9ZA 1HYZA 4CTAA 3O9SA 2U1AA 1IXKA 5M2PA 4YB6A 1SS6A 3KG1A 4A48A 4K50A 4O3SA 3CVKA 5J2PB 4E1JA 3THYB 5JS2A 4DQSA 3GU0A 4QIVA 1T6CA 1NRKA 2HHHJ 2VBWA 2AYEA 2F8TA 5BN9A 3V6DB 2DIVA 4I6MA 1VQ6N 2ERRA 5ETMA 3OYMA 3OVSA 1Q4RA 1AFJA 1Q78A 1WSJA 4WBFA 1S0NA 4MQ3A 3UWTA 3CCVS 2AA4A 1G7CB 5AR0A 2KU7A 3Q8QB 3U8XA 4HI1A 4CLSA 3PFEA 3QJLA 4F02A 1IBKJ 1S6UA 1XNRJ 3UD5A 3B54A 4NYOA 1RBVA 1MW7A 3MMJA 1WHWA 1OYDA 3CYMA 2VH7A 2DBBA 1VQNN 1RU2A 4FBTA 4LC9B 4K4SA 1JCFA 3NP5A 3VGVA 1S12A 1HL6A 1X4BA 3H6EA 2WZ1A 1PGZA 5IT9O 4Y3CA 2W9BB 4WFAQ 5E84A 1UPPA 2MMYA 3CO9A 2E5LJ 1IBLF 3ZTRA 4ZCKA 2O1PA 4JNEA 2EC2A 2HFZA 2WFBA 1ATRA 5LMUF 2NZ4A 5AQOA 4KT0C 1IR1A 2R2RA 1Y00A 4Q8EA 4M3WA 3BGOP 3BQ2A 1VSIA 4O8KA 1S1VB 2PD1A 2ATLA 2NRVA 3M3ZA 3R7BB 1YIJN 4L6V3 3N4PA 1CJVA 1ZPVA 1NGHA 1VQPS 1NCLA 2Q43A 3V4MA 4B1YB 2OPQB 3G6EN 1YX2A 1TL5A 2VPXB 5ELZA 2OPPA 3BY5A 2IGIA 3TAGA 5FD1A 2MQLA 2KQ2A 3VQBA 2FJVA 5EUHA 3L2RA 4KHUA 1IBLK 5AE1A 4B3MJ 2ETJA 3RSEB 3WXKA 3OYFA 4I7FA 3SUPA 3Q24A 1FFSB 2OIHA 3BGFA 2HHPA 2CQ2A 3OXGA 4NLGA 1FTRA 1KR4A 3I56N 3LDNA 5HAOA 1YLXA 5KFBA 1ASUA 1U1RA 2V69A 1DFDA 3UKRB 2KRRA 2UXDK 4U8VA 1BMQB 1JCGA 1S6QA 1O1WA 5D0HA 4FPAA 2JWLA 4NLDA 1RDAA 4KAZA 1SXLA 3V81B 2JH3A 3W2WA 2HMIB 2CZVC 1YJ9S 1D5AA 4CGFA 4ZTJA 1LCUA 4CJRA 3CSKA 1WC0A 1KFDA 4AF1A 3O4NA 4PQUA 1JX4A 2IVOA 4LRDA 5KAKA 3AVFA 4PXEA 5L1IA 4LF8K 2ZE2A 2L9WA 2YH0A 3KDOA 3C46A 3O6WA 4RPFA 1RSCA 2ILZA 3TRGA 4U7CA 2A1SA 1Q95G 4C8NA 2WBNA 1HQ2A 5I4MA 2GAHC 2B51A 3NCQA 4IQMA 5KFEA 2E9RX 4DG1B 1KONA 4X64J 2RDJA 1ZAVA 1U1NA 3POTA 2OEJA 2AU0A 1UVJA 4B1UB 5C10A 2OEKA 1Q82O 3IFRA 2C1EB 3VTIA 2HHXA 2B3TB 3WQTA 3IRXA 1HIYA 4PYDA 1O13A 3IS9B 4GO5X 2UZAA 1S9EB 4DTMA 2DYAA 4USKA 1S4FA 1WSIA 1HNWF 2ALYB 2HURA 2QYGA 1RTHA 2GBZA 5FROA 1VQ5S 4DOZA 4EZ9A 4WKYA 4EAHD 2CQCA 4XH1A 5A6WA 1N56A 3SUNA 3G4SS 3DHXA 3VGTA 4OO1J 3RG6A 4DFJA 5L46A 1HYSA 5KGWA 5DJBA 3VQ7A 7FD1A 4JI1K 2B4OA 1R6YA 2UXCF 4L8RB 4L74A 5B0BA 3Q83A 3IG1B 3H46O 3M9MB 4YMEA 3THPA 2RDDA 1XMOF 4OYMA 1W2IA 1IWGA 5K9FA 1R89A 3MM5A 2V9KA 4J9OA 4JRQA 3PYEA 3VAKA 3UCGA 1TV6B 1ITPA 3ILJA 3W63A 3DGPB 3CJ9A 1SJ3P 2I9SA 1C0GA 1YHQN 2Y1RI 2GJ2A 3MEGB 4O55A 4FJ5A 4OX9K 3O8WA 2YY3A 1SJ4P 3AQOA 3QMQA 4HT7A 4DV0K 1YJNS 2EWHA 3P39A 3DXMA 3UDVA 2ZJQQ 1KVCA 2CZ9A 1OQ3A 1X9SA 2GAGC 3RBXA 5U47A 1RP5A 1WF1A 4MK8A 5GAHP 1T9WA 1F9FA 2R7XA 2W01A 3S41A 4B3MK 3W5XA 4CFAA 2KHCA 2F9TA 3ZSOA 2M8HA 3GFZA 5ITHA 3A8KA 3MEKA 4H54A 2A3ZA 1KAXA 3JB9k 1N34J 1C4CA 1PG5B 3KLEB 2P9UA 2NPFA 4CE9A 3IBCB 5C5JA 2J8AA 2G8UA 1WG5A 5F8JA 2YQ1A 3JSRA 2PE8A 2UV8G 1FD8A 1VGYA 4NLWA 2VODA 4KY3A 2CNLB 3HT3A 3OD2A 5GINA 2QA4N 3K2YA 2HAFA 2UUAF 4Q0BB 4RKUC 2P9LA 3DOKA 1ROFA 5BR9A 4O3PA 4FF3A 3AO1A 4I1TA 1Q5YA 4FPBA 2G9OA 4KHNA 3I0RB 4MKAA 4UOFA 4CGDA 2OTLN 4JI8J 4H5RA 1O6XA 3QT5A 2OYQA 1LWCB 2BDPA 2H48B 4KHPF 1H2TZ 3GR0A 2GVDA 1BQNA 4LF6K 1REGX 2A18A 1PILA 2E5HA 4CLWA 4ELVA 3W8GA 5HATA 5EVZA 4W5NA 5E0OA 1XK8A 4MAKA 3G8SA 5LSRA 4DCOB 4ZJOA 2XI3A 1I5OB 2FHMA 3CC2N 2FJAB 1R8PA 1FVQA 1RAHB 1SIWB 3OBWA 5FPEA 1SKRA 2WTFA 3THXB 3A0IX 4Y2CA 3H5UA 2DHAA 2HBYB 2C3OA 3CQ8A 1S1TB 1XBWA 2E1MC 4YY3K 2QWMA 2HVIA 4J5OA 3BZQA 1RKJA 1Y9OA 2ROPA 3E51A 3EZOA 3UW1A 1YVNA 2XZDB 1BI4B 2HLTA 4JI1J 1RTIA 1DRZA 1W2BM 3PM9A 3F0NA 2EG1A 4CJWA 1BDGA 3C0BA 3CG7A 1CQMA 3OR1B 3DMJA 1RTDB 4X4UA 4ED3A 1VCTA 3OFGA 4QBUA 3M8PB 4K8RA 3GJTB 2PMHA 2GMJA 2DGWA 1CULA 3R9PA 2V63A 2R7RA 2LEAA 4BCAA 4CDIA 1JLAA 2AIRB 4MIBA 3OYNA 4LRCA 1W7WA 4KKOB 3UN3A 2IRUA 2ZF5O 1VQLS 4C1NI 3T9ZA 2W2QP 3FZBA 1K73T 4I2PB 5CCMA 1IUJA 2O01C 4N7TA 4AXJA 1M90O 2L9NA 5E3RA 2RQKA 1WAJA 3NWGA 1IQTA 3DNCA 1UWBB 3IKMA 3OVNA 3IR5B 4CEFA 1ZXOA 2JWNA 1DURA 5HL7Q 3FFIA 3US5A 2A6AA 3RBEA 1VSLA 4DL5A 4YHHK 4K25A 4ZCMA 2F63A 2ZUAA 3PV8A 4ISEA 4DLEA 3ATUA 2VPZB 1SKWA 3KTQA 2ZC4A 2W2OP 3HHLD 2YNIA 3QRRA 2D0PA 3NF6A 2LDIA 4H8KA 1UAXA 3JAMY 2BVZA 3CDUA 3KMQA 2GVZB 1X9MA 4USTA 4JV5F 1Q81T 1NK0A 5AQSA 3AA2A 4OJHA 3HI9A 3D7EO 1U2FA 4WKRA 3G9CA 4G9ZA 1HMVA 4G1PA 4QWEA 3NEKA 3LTOA 3LP0B 2O5DA 3LGNA 3CPWM 4CBXA 3H5YA 3GYGA 3I33A 4CJ3A 1Z2ZA 1V4SA 2YKPA 3CDAA 1NHVA 4Z4GA 2Q36A 4GKKF 1LNQA 4U95A 4FKYA 3KJVB 3CT9A 3W9JA 4DV1F 5LSOA 4O44A 3O4WA 4NLXA 1SZ2A 2XS5A 3N28A 1UA0A 4H0OA 1RT3B 1K73O 2XRIA 1TKTA 1HWUA 5H9FK 2BE2B 1BL3A 4ZA1A 2M88A 4ZMMA 1ZBHA 4KAIA 3HPGA 3GMGA 5D15A 1K8AT 4EO6A 3TAQA 3C65A 4ECXA 3R97A 2CJAA 3QZ8A 2RE1A 2V4QA 2JX2A 2CWKA 1XR7A 5CD4A 5AZJB 4FOIA 2B5JA 3EZWA 4YOYA 4GC6A 3BYPA 5EWFA 5HMYA 2FZCB 2NXCA 2DNQA 4P2MA 3ZZOA 2VOOA 4B3RJ 4ZIWA 4GO7X 2ZC3A 4UUXA 1YI2S 4KHPK 2LSNA 4FJGA 3EZUA 3DMJB 3HZGA 1CULB 3K89A 2FUG9 1YXQA 1I94J 1GNKA 4F3OA 4B1ZA 2DPIA 1EP4B 4A8SA 3EEQA 1YG0A 1C1AA 2VASA 3BKTA 4EFHA 3J8AA 3MM9B 2CJQA 3P31A 2ZEJA 1WF2A 3L7OA 4TVAB 3R6GB 4AHSA 1IM6A 1T02A 4Z4FA 4OZ1A 2BJ3A 2OTLS 4F36A 2H54B 3I4HX 3VGLA 2HWTA 3MOJB 3LL3A 2EPIA 4KRWA 2OTJS 2A41A 1OY9A 2DXEA 3IRXB 3EVWA 4EHTA 3KK1B 2ZM6F 4UOGA 4EYHB 2CA9A 2VBXA 3DRXA 3JSBA 4DZ6A 4ECRA 4MO4A 4B3TK 5LOQA 3R5BA 2B43A 3HFVA 4UQTA 3QNNA 2XCPA 3CCSS 2IVPA 1AUSL 4PPDA 1WNSA 1OVYA 2ILYA 4NYFA 2ZH2A 2P9CA 3OTBA 4FK4A 2OSQA 3CD7A 5AQWA 2CJBA 4LVNP 2H9ZA 4DUZJ 5CXTA 2PFUA 3BM7A 3QFWA 5DM6L 2LQBA 2B5JB 1NGBA 1E4FT 2XHWA 2DGTA 1HNXK 1TVRB 4DPUA 2ROEA 5ETRA 4LSLA 3D2EB 3OYJA 1FESA 4LH5A 3G2XA 1FNXH 3Q0AA 3DI6B 3PJ9A 3QRQA 2ZM6K 3HKZD 1BCMA 2ZOFA 2C22A 4FLXA 1WELA 3OJSA 3D4JA 2AKWB 3BYRA 4JLHA 2B4UA 2APOA 4MT1A 3CCEN 3H4DA 1S9GB 4OHXA 4QIFA 1BA0A 2E88A 1C0UB 2HQGA 4RW9A 1S79A 3S6EA 2R7YA 2ZHBA 2OANA 1J5OB 4WIQA 2XNRA 1IBMK 3RMCA 2CPDA 1SH0A 3D7SB 2YNFB 5DDOC 4E7IA 4CF0A 2IHR1 3DLEB 5AQJA 1QDUB 2PGCA 1NU0A 5CYQA 2MKSA 3RB4A 3RAQA 2KB2A 3MWTA 1SL2A 4C98A 4FJKA 4LSNA 2QMWA 4H5WA 3PX4A 3VVUA 2BXJA 2EW9A 5HRRA 2G0IA 4IH5A 4MDAA 3KG0A 3CGIA 1OY8A 4J91A 2CQBA 2RRBA 3OHRA 3WIVA 3CCVN 4FLWA 3ALYA 4Y00A 4O44B 4UZBA 3L2WA 3UN2A 3R1LA 2PA3A 3DXMB 1CZAN 4JI7F 4ZVPB 2W1BA 3HD2A 1RT3A 3OQ2A 4LT6A 1A0OB 2EK6A 4KB0A 3H90A 3PRDA 4K4ZA 2IVNA 2QE5A 3MURP 3UVJB 1SJFA 2JGUA 4LR7A 5IS2A 2ZJQL 1H2VZ 4KC5A 2XMKA 3G71S 4AM7A 2Q3PA 3QATA 4FS2A 3U3GA 2WBRA 3HO1A 3T1YJ 1VQPN 4PUOA 1IO2A 4ID8A 3I55S 3QJPA 3BZCA 2VGMA 4HH1A 3IWLA 4LF8J 2O3DA 4NA2A 2J6TA 1G1XA 1RDCA 3KVGA 4DJBA 1X9WA 3DLHA 4ZITA 4IKAA 1B7FA 2Y1JA 3X1LB 1DLOA 1NNEA 2Z0GA 1N52B 3H5XA 4WQ4A 4IRKA 5B0FA 2MKIA 1EHWA 3BQ0A 2IBKA 4CGJA 3IS9A 3H59A 5CCLA 4LF8F 5GIPA 1F2HA 2CKWA 1ZOTA 3SCKE 1WTBA 1AB8A 4F2SA 3MDQA 5L9NA 3G6VA 3PR5B 1JLQA 2HLUA 1GOAA 1IV0A 1RCXB 4CO5A 1C1BB 4MKVA 1Q0NA 4QOZB 4NASA 1LW2A 4IQXA 4BRDA 2CNNB 4WE1B 3KK7A 2ASJA 2JLGA 3I87A 3TR5A 3ILOA 4KHMA 1VBXA 3OHBA 4GVMA 4H5NA 4RW8A 3D3CJ 3KYLA 3DDIA 5JVGL 4MKBA 1BY9A 4KTZA 3O08A 2ZKUA 4JKCA 4W5OA 2VJUA 4QAGA 5JVHL 1M5PC 4NLUA 3T7ZA 2D5RA 2ITGA 1TYQA 4G6VB 1VRTB 4QIEA 3K5LA 4WU2A 5KT6A 3M6UA 4FKXA 4LY7A 3AODA 2Y1LB 1WEZA 1J27A 4U7UD 4Q0BA 2P9LB 1WTFA 4MLEA 3SEOA 3G82B 3R5GA 3ZYYX 1S5ZA 1HI0P 2E5JA 4BWJA 1NUEA 1Y3JA 1BXNA 4A59A 1Q9XA 3VAMA 4BQZA 3DGVA 4NOHA 3FZFA 2W8LA 1ZTTA 3SBGA 3UCZP 1RLDA 2V8PA 3WHIA 1YITS 5F1XA 4LFBJ 4IJAA 4LMZA 2FLLA 2OMLA 3AV9A 4DV3K 2GQQA 3O9QA 4Y0WA 2AHOB 4YDUA 4OKJA 3VESA 3D0PA 1QJHA 1IG9A 3JTOA 3TPQA 4M5DA 4EP5A 3QAUA 4RR5A 5T7LA 4B3MF 3PNIA 4CFBA 5E33A 5KOXA 3SI8A 1R0CB 4CT8A 3ULEB 1C0FA 2X7IA 1WC6A 3OL8A 3RRKA 1RDWX 4J9KA 1FA0A 3I32A 1RDDA 4AT1B 4CZLA 4DQIA 3ZT4A 5K8PA 2J0SD 4DCPB 4UQGA 1T8EA 3BN4A 2KG0A 4F4KA 4H4OA 3H45C 4MYUA 3AJ2A 2DISA 1BWEA 3NMRA 3PUFA 1KRPA 1FE4A 4X4VA 4B3OB 2ZJPL 2P5GA 4DHVA 3MF5A 1U1LA 4C1NK 4QCLA 2UU9K 2ZH8A 3O4QA 1YJNN 4B17A 2NREA 1HW9A 4DFMA 3QEVA 2AWZA 4AL6A 4K41A 1VC6A 3CMEN 3ET6A 3M4XA 2EVZA 4NZ0A 2F8MA 5L9XA 2GIQA 1IBCB 5CHCB 5B0EA 4JK8A 1HBNA 1ITGA 1U0HB 2FJBB 4CT9A 3KK2B 4EWTA 3PFOA 3E1YA 2EC0A 4OHYA 3QBWA 4M94A 4QPXA 4XDCA 3FJ2A 3PXGa 4DEZA 5J2PA 1FDBA 1WD6A 3VHQA 4CEZA 2HS0A 3S3NA 1H72C 4FS1A 2RQCA 4C3KA 2VJVA 2NZTA 2VU5A 4CESA 1U6BA 4OFZA 4R8UB 3M1VB 5LL6Z 1C1CA 1SCJB 3TA2A 2E2OA 3M8QB 3S7RA 1KFSA 2Z1HA 3G8TA 3TWHA 2FYXA 1OH7A 2BH1A 1Q53A 5LJVA 5EN1A 3ENAA 3DJCA 2XYGB 1VQNS 3IG1A 2YHBA