1DLOA

Human immunodeficiency virus type 1
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 REVERSE TRANSCRIPTASE
publication title Structure of unliganded HIV-1 reverse transcriptase at 2.7 A resolution: implications of conformational changes for polymerization and inhibition mechanisms.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 129
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1dloA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dloA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dloA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dloA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1dloA05
1FKPA 1NK6A 1NK5A 4KPYA 3MFHA 4FYDA 3QZ7A 2PZSA 1J53A 3SQ0A 4F4XA 1EX4A 4CEOA 1VSKA 3T1AA 4CECA 1XWLA 4ZHRB 2AGOA 3VQ4A 3IGVA 4GVMA 2YNIA 1BQNB 4FBUA 2E6LA 1NKEA 3LP0B 4DSEA 2FVSA 4OJRA 3VQ5A 1RBRA 2UUTA 4FLXA 5T14A 4FS1A 1S49A 1RTJA 2Z1IA 1ZTWA 2HHTA 3H5SA 4EYHB 3ZSYA 1QAIA 4M3ZA 1N4LA 3PX0A 5HBMA 4Q8EA 3T5JA 2DY4A 4I7FA 4ZTJA 4WYWA 4ECVA 3DMJB 4KB7A 4Z4EA 4KHMA 3V4IB 4YR2A 4TYBA 2RDJA 1MU2A 3QERA 3V6KA 3KLIB 1ZTTA 1RILA 3KIOA 1UWBA 3KHGA 3K5OA 4IOBA 4W5NA 2YKNA 2KQ2A 4XO0A 5K14B 4CGDA 4E7JA 4DL3A 2WOMA 1D1UA 4ZP7A 5HP1A 2YNFA 3LPUA 2Z1GA 4K4VA 3HP6A 5J2MA 4K50A 1JLAA 1HYVA 4TQSA 4FJ9A 4AILC 4CEEA 3QEVA 4FK4A 5KFVA 4QWBA 4NLVA 3U3GA 4IH5A 4HKQA 4Q43A 2UVVA 3VQCA 3SFGA 5KTQA 3KK2A 1Z26A 4DEZA 1ZBIA 2ASJA 4E89A 2RKIA 3MR6A 2R8IA 3RBDA 3OYJA 3L3VA 2DFFA 4CJVA 2VG5A 4DLGA 3V1QA 2R8GA 4K4WA 4J9QA 4MK9A 2HHUA 5F9LA 4ECXA 4FJ7A 2VG7A 4TXSA 4F3OA 4PQUB 5KFXA 4NLQA 2JC1A 4ZPDA 3DRRB 3T19A 1JLEA 4I2PB 3AO1A 4R5PA 2GBZA 3MTKA 3NFAA 1QSYA 2IAJA 2D3UA 3PJXA 3TAFA 1KLMA 4PY5A 3THVA 4O3QA 5KFQA 1NK8A 2AJQA 1B9FA 3C6TA 1GOCA 1S4FA 4J9KA 2XRIA 3VQEA 4Z4IA 1C0TB 5KFZA 3GILA 3H5YA 2RPIA 3LP2A 5I42B 4KREA 1T05A 3AVHA 4DU3A 1G15A 4O4GA 4IRCA 1IKYB 3PO4A 4CIGA 3CFOA 2OPSB 1GOAA 4RG8A 4K4YA 2E4LA 1X1PA 2C2EA 3L3UA 2ATLA 3Q8PB 1C0MA 4FK2A 2I5JB 5KT7A 3HPOA 3GV8B 4FXDA 2UVWA 5KG1A 1LWEA 2P1JA 4W5RA 4O55A 4DTOA 4DL4A 3NAHA 1QHTA 2B5JB 3MEGB 2EC0A 1N5YB 2HHVA 1RTHB 4Z4GA 2P51A 3V1OA 3C94A 1NJYA 2HNDB 2C28A 4GMJB 4M3WA 1EXQA 4KHYA 4NZ0A 3DLGB 4PWDB 1SH0A 1S1WA 3RRHA 2FJVA 2XHBA 4O0JA 2O4GA 5KFAA 1UAXA 1K1QA 4TY9A 5FDLB 3MR3A 2XY8A 4RNMA 3AVLA 4RZRA 2WRMA 1DLOA 2CJQA 4E1MA 4EBEA 1F21A 1WLJA 3QETA 3IS9A 1RBSA 4IFVB 3NF9A 3EYZA 3SPYA 4J9RA 3AVBA 4I2QB 1I6JA 1JLCA 5JS2A 1YTUA 1JLGB 4LY7A 2PYLA 1KVAA 3TAMA 3VQ9A 2FBTA 1C2PA 2UVUA 1KHWA 3ITHA 5EUHA 5L1JA 1BIUA 2RDIA 1TV6B 4NYZA 1DTTB 2AU0A 3M8PA 1RT4B 1N48A 3FQLA 3HVTA 4KI6A 3VQAA 4FW2A 3FFIB 4C8OA 2D7SA 1WSIA 4EYIB 4B3OA 4AHUA 3LPTA 3NAIA 1QQCA 5KT4A 3KMSA 5DLGA 3DLKA 1S10A 3DYAB 4RW8B 4E7LA 4H4OA 4QW9A 1JKHB 4FM0A 2OZSA 4MKBA 2IC3A 3JYTB 2G8IA 4MFBB 3KHHA 3NDKA 5KFUA 3QGIA 2QKKA 3RB6A 1S0NA 2AGQA 1RT6B 3KLGB 1RDRA 4KFBB 1FXXA 3CJ4A 4B9UA 3MEDA 4MKAA 2AQ4A 3SUNA 2C2DA 3QIPB 2W8KA 4RUAA 4BWJA 4IDKB 3K58A 3GV7B 4WE1A 2HB5A 3I0SB 4ELVA 4OLBA 3GQCA 4QW8A 3KLFB 1S1VA 4Q44A 3DRPB 2PYJA 2VA2A 1LWFA 1O1WA 3HK2A 5T7BA 5J2NB 3GIMA 2BRKA 1TKZB 1RDCA 4CJ3A 4ELUA 3AVIA 5FROA 3BREA 4O3PA 4U7CA 4CHPA 4DWIA 3C95A 2ASDA 3KHRA 2FVCA 4CJRA 2XCAA 1WNEA 2IM2A 4NLRA 4Y2CA 4WZQA 4R8UB 1HYSB 1J9AA 1RTDA 3EPIA 2QKBA 1KTQA 4YFUA 4ZPBA 5KFEA 1VSEA 3L2WA 2GV9A 2GIQA 4FW1A 4DU1A 5C25A 3H08A 1N6QA 3SI8A 4N56A 5J2PB 3PX6A 4KO0B 1SV5A 4R0EA 1T3NA 4RW7A 4JV1A 4F8RA 3NBPA 3NE6A 4FM2A 4MIBA 2DPIA 1CZ9A 1C1BA 2B4JA 3M8QB 2HHQA 3OYEA 2ASLA 2VG6A 4FLZA 1VRUB 3KLVA 1RT5B 2YHBA 1NOYA 1X9SA 1LWCA 4KBIA 4H4MA 1WSEA 4E1NA 3RR8A 1TVRA 4KTQA 5KFPA 3M8RA 2FVQA 3NF6A 3RWUA 2OZMA 1R0AA 4Q5VA 1S5JA 2XGQA 3HXMA 4RNOA 3OS2A 4CGGA 5KRSA 3ASMA 3DOKA 4K4TA 5SZTA 4ED1A 4IG0B 4I9LA 3MF5A 4E19A 4YP3A 1REVB 3OVNA 1L3VA 4NLGA 3SQ4A 3UR0A 2IM1A 2YV0X 3ZSWA 5KFRA 3BSCA 1UOCA 4B8AB 2E9RX 4NLSA 1S6QA 5KFMA 2DFHA 4DSJA 4KHQA 5CZ1A 1SL0A 3V9SA 3LZJA 1IKXA 3PV8A 1RT3B 4WFYA 2HWIA 1ZBLA 3AA5X 3LWMA 3SUQA 1UA1A 2YKMA 3VQ8A 4E7IA 4O3OA 4IG3A 2ZE2B 3O3FA 1FK9A 4URSA 3P83D 3NH0A 4NLWA 2HHXA 3ICLA 5HROA 3AVFA 4B9VA 1WSGA 4FJXA 1Q9YA 4KSEB 2XY6A 3U3YA 4NLDA 3B6OA 4HUEA 4CCHA 2BANB 3DLEB 3HHKA 2BR0A 1JL2A 3NGZA 4M45A 3KLHA 3NGIA 3P1GA 2X78A 2ATQA 1S1UA 1S9EB 4OGCA 2Q3SA 4XPCA 5C42A 1TL1A 5KT2A 4ZVHA 3OYHA 4YNQA 1U09A 4K4XA 1YVUA 3V81A 3SQ2A 4IKFA 3NF7A 1HQEB 1S1TA 3G6VA 1RYSA 3IRXB 1ASUA 4O0IA 4J2BA 4CJUA 4PUOB 4Q0BB 2J6SA 1SKWA 4AHVA 1CLQA 1BQMB 3TQ1A 3HYFA 3HPHA 2FLPA 3LDSA 3MECB 3NCIA 3GIIA 4J2EA 3E01A 4FS2A 3C6UB 2WB4A 4CJWA 3DOLB 3ZT1A 1C1CB 1EP4B 5JS1A 1KFSA 5CY4A 1ZYQA 3V6HA 4IR9A 3SYZA 2HW3A 3KLEA 3SQ1A 1SKSA 4RNFA 2OPQA 4CEAA 5HLFB 3KK3A 1U49A 3VQDA 1A5XA 4IRKA 1JLQB 3F73A 1JXLA 1JLBA 1L3TA 1RT1A 4WYLA 4CHQA 5KT5A 4O5BA 4XIUA 1IKWB 1RTIA 4NRUA 1NK9A 4URGA 4ZVEA 2EHGA 3AVMA 2F8TA 3JSMA 4CEDA 2YNIB 4HUFA 1KSPA 4WXWA 2UVRA 3SZ2A 4KB0A 4M3RA 3KHLA 4HYKA 3HO1A 4ZVGA 3I0RA 3UQSA 1RTJB 3AVJA 1Z25A 3DLRA 4IH7A 4CFCA 5FRNA 3MXIA 1BI4A 4N41A 1QTMA 3L8BA 3NF8A 3DLHA 2R8KA 3GIJA 3L2QA 4I7FB 4NLPA 5KFGA 1HNVB 3ZT3A 1XC9A 4B9SA 2J6TA 4QPXA 2A1SA 4W5OA 3VQ6A 4O3NA 5F9NA 1MU2B 4MQ3A 3OYNA 3KKRA 2F96A 1SH2A 3OHAA 1UWBB 3AO5A 3TI0A 3V6JA 1QUVA 1VRTA 3G6YA 3KMQA 3SI6A 4YR0A 1TL3A 1RNHA 4Z0UA 3IN5A 2WOMB 5KFBA 2R7YA 3TABA 4LSLA 3BSAA 5HP1B 3KJVA 1RA7A 5HRSA 2FVPA 3RB0A 2IA6A 3H2LA 1S6PA 3T5KA 4FLTA 4ECRA 2W9AA 3QESA 1S9GB 5HLFA 4Z4FA 3AA2A 4DL7A 1TQLA 2W42A 1D9FA 3KK2B 4RW6B 3QGGA 2JGUA 3L2VA 3WNHA 2VG5B 4ECQA 1LW2B 4DQIA 3IAYA 2FBXA 5F8JA 3EPGA 4LQ9A 3LP0A 3HVWA 4CEBA 1XR5A 4ID5A 5CYQA 2F8EX 3RMCA 5KGWA 1UA0A 3FQKA 5KG6A 4R5PB 1JLFA 3BR9A 4JV0A 4CJ5A 3LWLA 4KHWA 2IM3A 3V6DB 1KLMB 4KE5A 5KG7A 1WNSA 3QEWA 3ZSXA 1XHXA 3HVAA 3C6TB 4LH5A 1W9HA 1NK0A 2IS3A 3NAEA 4E7HA 4G1QA 3DMJA 3LP2B 3PW2A 3OYIA 3SFUA 1T05B 3SJJA 3RB4A 4JUZA 4YMEA 4O4GB 3OYLA 4ICLA 4F2SA 1TKTB 4FZZA 2YNGA 2ILYA 4CEZA 4E0DA 4FJLA 4JRQA 3NL0A 5KGXA 5EWGA 3H59A 3G10A 2X6SA 4WXOA 1LWEB 2G8UA 4RW4A 3LANA 1WAJA 1HMVA 2Y1JA 1QE1A 2XCPA 4E3SA 2B6AB 4HCCA 5EU7A 5FRMA 1HRHA 3O3GA 4AHCA 2C2RA 1NKCA 2ITGA 2OPRA 3OY9A 1GX6A 1WSHA 5SWMA 3NMAA 1I3AA 1EETA 3LP1B 4CJTA 3D45A 3AV9A 4NCGA 1QAJA 1S1XA 1HNIB 4EO8A 1ZBFA 1LW0A 4CGHA 5I3UA 3TWHA 1DLOB 1L5UA 3CDEA 2FBYA 5CYMA 3OL6A 4W5TA 4ECUA 4CF0A 1T7PA 3OYGA 2XO7A 1VK0A 4J9NA 3H4BA 4B9MA 2B43A 3QEIA 3CFPA 1C0TA 2BQRA 3KK1A 3IG1A 1JLCB 2J6UA 3DDKA 3OSPA 3U6FA 4Y2AA 3TAMB 3HL8A 2HNYA 1Z4UA 4J9MA 3I5AA 1RDBA 4NRTA 2KFZA 4GC7A 5DK5A 1XHZA 1ASWA 4FJ8A 1N56A 4O4RA 4L8RB 1DTQA 4B3OB 3PUFA 4KI4A 5KG2A 5L1KA 4JS5A 4KV8A 3N6NA 3DLKB 2E9ZA 5EWEA 3QLHA 4KTWA 2B5JA 4ELTA 3HKWA 4HUGA 1HPZA 2OPPA 2IC3B 2UUWA 3AO4A 1X9WA 4HHTA 3TANA 3DLGA 5F8MA 5JUMA 5EDWA 1NHVA 2JEIA 3OYFA 2BDPA 1IG9A 3CJ0A 2QXFA 3MEDB 5FDLA 3KOAA 4CGFA 1EKEA 1KRPA 3VQSA 1NJZA 4Y1CA 1RDAA 4CHYA 4WE1B 4F3TA 4DQQA 3OSNA 1S1VB 3NGDA 5DQGA 3KD5E 4DMNA 1LWFB 4KAIA 2WTFA 4CHOA 4NLOA 3OL7A 2C22A 2YHAA 3AA3A 4NLYA 3T5HA 3AO3A 3I5CA 4IBNA 3HJFA 4QWEA 3K5NA 4FK0A 3S3MA 1D5AA 3LP3A 4DFPA 1RTDB 1JXBA 1RCHA 4CF2A 4DL6A 3RAXA 2XI2A 1T8EA 2FJXA 4F4YA 2GUIA 3QNOA 3QINA 3FRZA 5C25B 2XY5A 3N6MA 5KG0A 1N6QB 3HT3A 5HRNA 1SV5B 3CG7A 4RW7B 5C5JA 2IJFA 3NBPB 4BDYA 4WFXA 1NHUA 4B9NA 1C1BB 4G3IA 2XI3A 2HHWA 3RBEA 4M42A 3Q8RB 2G8FA 2DTUA 4HCBA 2VG6B 4IFYB 2HMIA 3KLGA 3MEEA 2QK9A 1L3UA 1LWCB 3PW7A 3OHBA 4H4MB 1LAVA 3TAPA 4NYNA 3QIPA 3WNEA 1SUQA 2RF2A 3ZSRA 1R0AB 4CJQA 4DQRA 4CJPA 4M3YA 3MAQA 4KHSA 4Y1DA 3DOKB 2VWJA 2KZMA 2A1RA 3RRGA 1RA6A 4H54A 4QCLA 3BGRA 5C24B 4LQ3A 4CESA 4F4KA 5KFIA 5KFTA 1C0UB 4DTJA 3E51A 4K8XA 4J2AA 4TLRA 3CO9A 4LSNA 3AVCA 3M9OB 2JEGA 1S6QB 4YR3A 2YNHA 4CF1A 1XR6A 1IKXB 1HYSA 4CJFA 1HQUB 4DQSA 4DTXA 2LSNA 3D28A 4RW9A 3OYDA 3K5LA 4TY8A 1S48A 3QO9A 2W7PA 4Q8FA 4IG3B 1RT2A 3BJYA 3CVKA 4KKOA 4WFZA 5J2PA 3H4DA 1FK9B 4FZXC 1JX4A 3VQBA 5HROB 3DLBA 2W9CB 1FKOA 3SUOA 3CJ5A 1NK4A 2R8HA 1WN7A 4CGIA 2D41A 3ZT2A 4OLAA 3SPZA 1NNDA 4CEFA 4MK7A 3PW4A 2W9BB 4DTSA 4FJIA 4FJMA 2AX0A 1J5OA 3QIDA 3K59A 4ECSA 4Y34A 1S1UB 2P5OA 2WONA 2HAIA 5C42B 1TL1B 1TKXA 4EEYA 1WSFA 4KHRA 5J1EB 3V81B 2BRLA 5F8NA 2XWYA 3SCXA 4DG1A 2G8WA 1S1TB 1C1AA 3QGHA 4N76A 3DM2B 3TAEA 1CXUA 3ZSQA 3AVAA 5DG9A 2XGPA 3OYKA 4UQGA 3OJSA 4OL8A 3ISND 5JXSA 1NJWA 4Z4HA 3E01B 4K4ZA 3ZT0A 2D0CA 3CM6A 4PA1A 4NCAA 5DG8A 1T94A 4DS5A 1T03A 1SL1A 1IKVB 1WAFA 3G6XA 3KLEB 2ZD1B 1Y97A 4FM1A 4M3XA 3ALYA 2OPQB 1HYZA 1LAWA 2KTQA 5KFOA 4Y3CA 1JLBB 3KNAA 5KFLA 1TAQA 1XR7A 1VSDA 5KT3A 3OJUA 1MMLA 2BE2A 4IR1A 1BISA 3JSMB 3DLEA 4CHNA 2FJWA 3OLBA 4FJ5A 2DPJA 4O3RA 1NOZA 3I0RB 2AWZA 3AO2A 5D3GA 2V0NA 1S9EA 1HJRA 1TK8A 1FKPB 1RDDA 4Z4CA 2G8KA 2IDOA 3MR2A 4DFKA 4CF8A 3AA4A 5KG4A 3MXJA 1ZBHA 3CWJA 4DF4A 4O3SA 3IRXA 2VA3A 2F8SA 5KG3A 3T5LA 1RBTA 5J2QA 2NUBA 5F8IA 4J9LA 1VRTB 3DRSA 1OS5A 1B9DA 4CFAA 3MECA 1TL3B 3PVXA 5HBMB 4KB1A 4LSLB 3A2FA 2D0BA 4TSXA 4RUCA 3DOLA 3KJVB 3VA0A 1C1CA 3RMBA 3QYYA 4FJHA 5F8HA 4U6PA 4OPJA 1S6PB 4GC6A 2HNZA 4M41A 1X9MA 3MXMA 4XPEA 4QAGA 1JLQA 4O44A 2AX1A 1BHLA 4KHUA 4CF9A 5KFFA 3PR4A 3OLAA 2YKNB 3BSNA 1RT7A 4NLXA 4CEQA 4OPKA 3CQ8A 3SNNA 1IKWA 5DMRA 3KD1E 2I1RA 2JC0A 2AGPA 1C6VA 3DI6A 2FC0A 2OH2A 2YNFB 3I8DA 4CJSA 5J2MB 2HHSA 5F8LA 4ID5B 5CYQB 1JLAB 3RMAA 3H5UA 1JLFB 4CJLA 2BQUA 4ECTA 3LZIA 4JRPA 4DTPA 4F50A 4J9SA 3FSIA 4OVLA 3H5XA 4YQWA 4Q45A 2KW4A 2EX3A 4ZP9A 5KFDA 4AH9A 4FLVA 4M3UA 4CJEA 2RKIB 1HNVA 1KCFA 4ZHRA 4FJGA 4G1QB 1KLNA 3KKSA 1I39A 3M9NB 1BQNA 2VG7B 3BDPA 4ICLB 3ZT4A 2D3ZA 4DTRA 4DSFA 4N47A 1JLEB 2R2TA 2YNGB 2V4QA 5KFCA 3QZ8A 3TAQA 2IAJB 4ED0A 4JLHA 2BQ3A 1LV5A 5DGBA 4F4WA 4FCYA 1U48A 2X6NA 4TQRA 1VSLA 3PO5A 4RW4B 1BGXT 4NYFA 2V4RA 1HMVB 1QE1B 4BACA 2JLEA 3V4IA 1S9GA 4DLEA 3KLIA 3BQ2A 4RW6A 5CZ2A 4DL5A 3CIZA 1ASVA 2OPRB 5K14A 1EETB 3UIQA 1LW2A 3OL8A 4DS4A 1TK0A 2BGGA 4NCGB 3O4QA 1S1XB 4FVMA 4DTUA 1LW0B 4ECZA 1S0OA 5I3UB 4N5SA 4B08A 3V6DA 3RAQA 5CYMB 1GX5A 2X74A 4MH8A 1TK5A 1HARA 3FDSA 3PW5A 2W8LA 4EBCA 3TAGA 1S1WB 4CK2A 3KK1B 2FLLA 4QOZB 3IG1B 4DQPA 3AVKA 5DG7A 1BL3A 3QIOA 3HVRA 1D9DA 1CZBA 3O4NA 4J9PA 2HNYB 3VQ7A 4ED8A 4CIFA 4PQUA 4C8LA 3DRRA 1TKTA 1W0HA 2Z1JA 4I2PA 1A5VA 3PJWA 1XI1A 4LH4A 4OKEA 3SV3A 4ED6A 3IS9B 3M8SA 2IOCA 4C8MA 1DTQB 4QWAA 1ITGA 1YTAA 4CERA 1ZETA 4ZMMA 4TN2A 3NH1A 4KV8B 3QLHB 3S9HA 5I42A 3GV5B 1CXQA 3RR7A 4ZPAA 1HPZB 2OPPB 3O3HA 2B6AA 1IKYA 3ITHB 4EZ9A 5KFHA 4J2DA 4IH6A 2OPSA 1SL2A 4FJNA 2QV6A 3TVKA 1VSJA 2ILZA 3M8PB 3GIKA 4DSLA 3HVTB 4EZ6A 1IM4A 3LP1A 1J54A 3ULDA 2I5JA 2HVIA 3OYAA 1U45A 4E7KA 3CJ3A 3MR5A 3NHGA 1HNIA 2WCXA 2KZZA 1RBUA 1VSFA 1QSLA 2IJNA 5EWFA 4H4OB 2PY5A 1SH3A 3MEGA 1N5YA 1RTHA 4HVJA 3LAKA 2HNDA 2WK4A 1WSJA 4PWDA 3QEPA 3UPFA 4X2BA 3UDLA 2VWKA 3VQQA 4JV2A 4RNHA 4ZTFA 3OYCA 2IGIA 4ED7A 1U47A 1QSSA 3CM5A 4ED3A 5KG5A 3L2UA 3HP9A 2O4IA 3CJ2A 2ALZA 3OL9A 3CDUA 1KVCA 4CHZA 4IFVA 3CFRA 4BE1A 4EBDA 2CKWA 3SUPA 1KFDA 2IMWP 1Q8IA 5KFNA 3HM9A 4I2QA 1JLGA 4RNNA 3AVGA 4CJKA 3PX4A 1Q9XA 4DTMA 2FBVA 4KHNA 3TARA 5DGAA 2D5RA 1TV6A 3OS0A 1DTTA 4RU9A 2XY7A 1RT4A 4BE0A 3D5MA 2R2UA 1CSJA 2ZQBA 3ZSVA 5KFSA 3G86A 2HMIB 3FFIA 3S3OA 4BDZA 3RTVA 4I9QA 4MIAA 3MEEB 4CGJA 1S0MA 2FVRA 4AHRA 1SUQB 3SV4A 4NCBA 5L9XA 3DYAA 2RF2B 4RW8A 2ZKUA 4BDPA 1JL1A 4QWCA 1JKHA 3BSOA 1IH7A 1U4BA 3JYTA 3ZSZA 4MFBA 4EP4A 4MK8A 4NLTA 2QE5A 2O5DA 5KI6A 1GOBA 3S3NA 3BGRB 1VSHA 1QS4A 3PR5B 1RT6A 4FJKA 3ISNC 4DSIA 4KFBA 5F8GA 4CIEA 2JEJA 1TVRB 2GIRA 1RYRA 2R8JA 1NK7A 4J9OA 4LSNB 1K6YA 1NJXA 4IDKA 4BE2A 2YNHB 3MFIA 3IGNA 3F9KA 4ECYA 1BIZA 3I5BA 1RBVA 3VN5A 4ZP6A 4F2RA 3I0SA 4FLWA 4B9TA 3Q8QB 3KLFA 4RW9B 3DRPA 4TY8B 1YT3A 3QO9B 3NGYA 1VSIA 3KTQA 3L2RA 2JEFA 1RT2B 5J2NA 1W25A 4CK3A 4F4ZA 4B8CA 1TKZA 4KKOB 4EO6A 5L1LA 2R2SA 2WHOA 1YVFA 1TKDA 3H98A 1TP7A 1FKOB 3V9WA 1S9FA 4FBTA 1L3SA 3OS1A 4R8UA 4IFYA 3T3FA 2IM0A 3K57A 2YKMB 2E6MA 3EY1A 2P5GA 1J5OB 3EZUA 4CK1A 2G8HA 4QWDA 1A5WA 4KO0A 3PHEA 1TGOA 3QNNA 4K8ZA 2WONB 1TKXB 5KFJA 4BWMA 4KAZA 3M8QA 4DL2A 4KRFA 3WNGA 3GYNA 2D0AA 1TAUA 5C24A 3ZSOA 1D8YA 4AHTA 1VRUA 1RT5A 1IO2A 4DG1B 4OKJA 2ETJA 4B9LA 1C0UA 1VSMA 4ID1A 4ZVFA 2OYQA 4DU4A 4IQXA 2XC9A 4LD0A 4M3TA 3KLHB 3Q8SB 4HTUA 3V1RA 2Y1IA 1HQUA 1B92A 2E9TA 4IG0A 4KTZA 3HSTB 3PY8A 1REVA 5KFYA 4DSKA 1T03B 5HRRA 3EZ5A 3BQ1A 3M9MB 4OGEA 3B6PA 2HWHA 1KVBA 1D0EA 2GC8A 2G8VA 3BQ0A 3N6LA 2W9CA 4GW6A 5KFWA 4K4UA 4WZMA 4EP5A 4FLYA 5DQHA 2FLNA 2BE2B 1RT3A 1U04A 2IBKA 1JXEA 5E41A 2W9BA 4M95A 3VA3A 4URQU 4JS4A 3OYMA 2Z1HA 4NLUA 1ZBUA 2ZE2A 1SKRA 4K4SA 3P5JA 4W5QA 2KFNA 1RAJA 5HRPA 3CDWA 5D3GB 4ECWA 2V9WA 4OKKA 4DFMA 3RB3A 4FJJA 3KK3B 3D0PA 4CE9A 4ED2A 1BCOA 3G0ZA 4DFJA 3V9XA 5J1EA 4M94A 1RT1B 5DQIA 2W7OA 1RTIB 2BANA 3CYMA 5DLFA 5L1IA 4FZYA 3DM2A 3V9ZA 5J2QB 3H40A 1S97A 3DRSB 3ZCMA 3QEXA 3HPGA 2RN2A 1BI4B 4ZPCA 4IKAA 4FLUA 3OYBA 4CFBA 3LAMA 3NH2A 4DF8A 2HVHA 1HQEA 1IKVA 3AVNA 2HNZB 4PUOA 4DTNA 2ZD1A 4Q0BA 3K5MA 2DFEA 3PW0A 1K1SA 5KT6A 1BQMA 3LALA 3TR8A 4CJ4A 4O44B 4ZP8A 4H8KA 1RT7B 3RMDA 1NKBA 5KFKA 3VQPA 3NKYA 3C6UA 4CFDA 3DI6B 3V9UA 2R2RA 1BCMA 3PZPA 4C8KA 3WNFA 1EP4A 5KRTA 3K2PA 1KHVA 4TYAA 4AHSA 4IRDA 4C8NA 2OA8A 1JIHA
chains in the Genus database with same CATH superfamily
3AB2B 1NK6A 1FTRA 1RABB 5F41A 2PZSA 1J53A 1H7WA 4F4XA 4CECA 3T1AA 4RWXA 1HW9A 1XWLA 3D66A 3VQ4A 1X8DA 2YNIA 1WG4A 1BQNB 4JI3F 3VGUA 1NKEA 3LP0B 2FVSA 4OJRA 4FLXA 2UUTA 1YBAA 2B4PA 1S49A 1KD1T 2OSQA 2Z1IA 1K9MO 3BPSP 1CS4B 3HLUA 4P7VA 1ZTWA 2HHTA 3H5SA 2P9PA 3ZSYA 2YKPA 3ZYYX 3H1VX 2ABYA 4ZTJA 3HSDA 4OX9K 3DMJB 2DCUB 4Z4EA 2GVZB 1ZM3A 4EUVA 1OWXA 1JJ2R 2QM1A 1GXTA 1EKSA 2HIYA 1F1BB 2KQ2A 5K14B 4DL3A 1NLVA 2WOMA 1D1UA 4ZA1A 1UJ6A 4K4VA 5CHIA 4DZDA 2GQCA 4IO9L 5GAGP 1JLAA 1VMBA 3UD4P 1Q86T 3M1VA 3J80Y 4TQSA 4FJ9A 2Z2YB 4FK4A 3IP0A 4WK1A 3THXA 4HKQA 2UVVA 5KTQA 4OI3A 5GAEP 3L3VA 2VG5A 3HMJG 4QS8A 2Y9HA 5F9LA 1F2HA 4H5TA 4F3OA 4JI0J 5KFXA 1SIWB 2JC1A 4ZPDA 3DRRB 3BKTA 1NSKL 4R5PA 1RSCA 3L3CA 4F36A 2IAJA 1KLMA 1PJ5A 4O3QA 3THVA 4NL5A 5FIIA 1I5OB 3UE2A 2QMXA 4FOEA 2IA0A 1JJHA 2LFVA 1C0TB 5KFZA 3TZXA 3GILA 3H5YA 1GLEG 2R7WA 4A2BA 1FRLA 1U0HB 3O1LA 1T05A 4DV1F 1HNWJ 4KREA 4DU3A 4O4GA 3PO4A 1CULA 2QGFB 2V63A 5IT9O 4CIGA 3J7Z5 3CFOA 2OAUA 4HI1A 2OPSB 1GOAA 3FJ2A 1RI7A 2WVFA 4LF7F 2PI5A 3EDQB 5J1PA 4JKCA 4OYXA 3KG1A 2ZWHA 5KT7A 1N88A 2E29A 4J90A 1N33K 4DR2J 3FCVA 5KG1A 4OYIA 1LK7A 2LVWA 3A8KA 1ATNA 5JVHQ 2J0SD 3NAHA 4B02A 3UN2A 1KAZA 4ILMA 2HHVA 1WJ9A 3LW5C 3MCMA 3CW2C 4U8YA 3DLGB 1UCNA 1SH0A 1S1WA 3PSFA 2BVZA 4O0JA 4JI8J 2XEXA 4DN9A 5IT9U 3BEXA 3B6BA 4ED4A 3CJBA 4RNMA 1OVYA 2VFRA 1DKGD 2CQGA 2XZDB 2C2NA 1WLJA 1ZXOA 1S6OA 2JNJA 3T69A 2Z2ZA 3N9UC 3NF9A 2MGZA 2GO9A 3EYZA 2JRSA 2W41A 3ENHA 4JK9A 1R27B 4I2QB 1I6JA 1JLCA 4LR8A 4ERDA 5JS2A 4LY7A 3IFRA 3C15A 1VQPN 1KVAA 3VQ9A 2FBTA 2QL9B 1Y5IB 5L1JA 3VF6A 2AU0A 3M8PA 3M2RA 4DV7F 3HVTA 4KI6A 5GAEI 3QPIA 2HS4A 2EPIA 2ZJPQ 3AQPA 4F0HA 3PNIA 4E7LA 5E3CA 4QW9A 4OZNA 2RAQA 1FJ7A 2OZSA 4JI7J 2J5AA 3FLCO 2G8IA 2A3JA 4MFBB 3KHHA 1NPPA 3NDKA 2DGVA 2G13A 5KFUA 1OPZA 3QGIA 4LUBA 1X4CA 1W7AA 2QKKA 1U1OA 2AGQA 1S77D 5DJBA 4KFBB 5CCMA 2E2QA 3MEDA 2QL7B 4M7YA 3SUNA 4JHDA 1FXLA 1YJ9N 2P8IA 3WEEA 2IRUA 2E5HA 1WEXA 5AQFA 3VEOA 3AOBA 2CPDA 4BRLA 4NO7A 1NB7A 1APSA 2W4PA 4JNEA 1S1VA 4IO8A 3DRPB 3CXCM 2O8FB 1LWFA 4QIWD 2E2PA 2BRKA 3ZZTA 4ELUA 4CJ3A 3AVIA 2JVOA 1FDAA 2FHJA 2PA3A 4DWIA 3C95A 1AFJA 2FVCA 4DV3F 5IT4A 2COLA 1XIQA 1NXIA 2KU7A 4WZQA 4XH1A 1QAXA 1KTQA 5MAOA 4ZPBA 2GV9A 4G1IA 3R7BB 2GIQA 4DU1A 3SBGA 3LGNA 1WBBA 3SI8A 1RWVB 4N56A 3FZLA 3TZWA 4KO0B 4RW7A 3B54A 1CJTB 2UUBK 1U1QA 3NE6A 2ZNYA 3G87A 5F3TA 3MEKA 4GO5X 3M8QB 4JI1J 1YRTA 2VBZA 4FLZA 1S72N 4B3SK 3KLVA 2F9WA 2L9NA 2IIHA 2O66A 1LWCA 2OGUA 2F9JA 3UNGC 1TVRA 2CPXA 2GFFA 2XGQA 3H45C 4RNOA 1X5PA 3OS2A 4BRAA 4CGGA 2D3OR 2B56A 2RS8A 2VL1A 3MF5A 4DUZF 1REVB 1PO6A 2XB2D 3OVNA 1L3VA 2O8EA 3SQ4A 1NSPA 1OSCA 5KFRA 3R1LA 1N32J 3BSCA 3HFZB 1UOCA 4B8AB 1S5ZA 2F4VK 2RILA 3NS5A 3B82A 3ZFVA 1KBRA 1IKXA 1JXVA 4WFYA 5CD4A 5IWAK 1VISA 1HD0A 2OFHX 2PN6A 2F1FA 4JI6F 4LFCJ 1FJGK 4FNIA 2DO0A 4RKUC 3O3FA 1DARA 5C10A 3SMPA 3CD7A 2I8EA 1G3OA 4LF4K 5ETQA 3NH0A 3AVFA 1I51B 3MOJB 4FVCA 4DR6J 3CJ9A 1Q9YA 3E3XA 2XY6A 1GLCG 3EVWA 4PXDA 5FPDA 2BR0A 2ZITA 3NGZA 5A76A 4M45A 3P1GA 3ULEB 1S9EB 1AROP 4CO3A 2Q3SA 1TL1A 2Q2RA 4X4UA 3GR0A 4DR5K 4CI6A 1JMTA 5B0CA 4YNQA 3CB4A 1YVUA 2D1CA 3AHPA 1B64A 3NP5A 5BPNA 1ASUA 2D4WA 3UCZP 4O0IA 2WZ1A 4PUOB 2J6SA 4AHVA 2DGOA 1R59O 4FVUA 2X1GA 3TQ1A 2FJAB 1KC8T 4M63C 1Q5VA 3UDCA 2FLPA 4UUWA 4MDAA 1L3KA 3E01A 2IJRA 1ZZNA 1VC5A 2BJ8A 4BRCA 3DOLB 2MLXA 3MMBA 2E1MC 5L39A 4YHHF 3V6HA 4IR9A 4FKYA 1FD2A 3SYZA 3BGFA 2HW3A 3KLEA 1YHQN 3D0IE 1EX8A 2GVDB 3T6JA 1SKSA 2WAQD 4CEAA 2VQEJ 1U49A 2C2KB 1A5XA 1AUDA 3F73A 1TFWA 3EUNA 4OZ3A 3MURP 4B1YB 4XIUA 2IHR1 4NMLA 1RISA 2HOEA 3LDNA 4HUFA 4KB0A 5JLFA 4MO4A 3ZEUB 2O8CA 4DXLA 1UP1A 3I0RA 1RTJB 3SEOA 1Z25A 4IH7A 1Q16B 3QMLA 1BI4A 3CD6S 1C4AA 1HQ2A 4OJ3A 2R8KA 4NLPA 5KFGA 2NRHA 2YHYA 3ZT3A 1XC9A 4C2MA 4OX9F 4B9SA 4LFBK 4FN5A 4W5OA 2KRBA 4DX6A 1NJIO 1MU2B 3OYNA 3MM5B 3RAMA 1SH2A 4JP8A 4RPFA 3KMQA 4DUTA 1NG9A 2XNQA 1TL3A 4Z0UA 2WVCA 3BSAA 3HSJA 2CNKB 5HRSA 2ZH2A 3RB0A 3MCNA 4YDDB 1O8BA 3RSEB 1S6PA 4FLTA 1WKJA 5HLFA 4L75A 4UY8T 4QQBA 3WQTA 5C0YA 4OPAA 1MWQA 3WNHA 3CCMS 2DGXA 1LW2B 1XBWA 4OYOA 5DM6L 1B0PA 4B3RJ 2FBXA 3AGKA 3OTOK 3UW1A 1OYEA 4CO2A 3HVWA 5CYQA 3FQKA 1FVQA 1ZM9A 3D1OA 3NGUA 4DPUA 2HZCA 2C3YA 4KHWA 2QLFB 4FL9A 2IM3A 3D1HA 4CDIA 1VC6A 4L6V3 3C6TB 1W9HA 5F2RA 5LL6d 1V5VA 5DM7Q 2QWOA 4BY9C 4YOEA 5ETPA 5JMVA 5U47A 3PW2A 2J8SA 3RB4A 4YMEA 2HK3A 3TX0A 2K7JA 2DRDA 3R97A 1MMNA 4F2SA 4CBUA 2ILYA 1HR0K 3VGTA 4CEZA 2QA4S 1E6YA 2FGOA 2I9SA 3TW0A 5EWGA 2UXCK 1KAXA 3FC9A 1N33F 4WXOA 3OR1A 1WAJA 1BUPA 3JAMY 2A3ZA 1N8RO 1F9HA 3I31A 2B6AB 4YDXA 4ZLJA 2OPRA 3CCRS 2RRAA 2B9EA 1QY7A 5SWMA 3D45A 4NCGA 4PPZA 2C42A 4CGHA 5BN9A 2N3OA 3EZWA 4ZPVR 4WFNL 3TWHA 4QOTA 2W1BA 3BY5A 4NA2A 4Z2XA 4P2FA 3VERA 4W5TA 4CF0A 1VK0A 2E1CA 4B9MA 1CC8A 5IFMA 2BQRA 2V4JB 3U6FA 5DZ6A 5EX0A 2VJVA 2P6SA 3I4HX 4FJ8A 2NPIA 1VBXA 1ROFA 4O4RA 3WBZA 3DCAA 3RZAA 1DTQA 4B3OB 5L1KA 2KG1A 3N6NA 5K8MA 5EWEA 2CG4A 4BRKA 3VMFB 3CCJS 4ELTA 1YITN 4JYAK 1HBNB 2IC3B 2J0QD 2ZHBA 4GVBA 1VFJA 2ASPA 3U1NA 3ULHA 1VQ7S 2DVIA 1HIYA 3EVMA 5EDWA 3OYFA 2J0WA 4G9ZA 8AT1B 4DPOA 2DK2A 4JKAA 1T44A 4AQYK 5CCLA 2OJ3A 1KRPA 2NZTA 4XH4A 4CM0A 4FWSA 2AYGA 4WE1B 4MJKA 3VEYA 3TSQA 1JQGA 5B08A 5AQWA 3W3DA 4HHHA 4KAIA 1EZZB 3R2DJ 2GQQA 4NLOA 5LSOA 3T5HA 3VAGA 3AO3A 3I5CA 4B9QA 4YY3K 4WKYA 1P8ZA 4BBYA 3J81U 5ADXH 4CRJA 2FJBB 3RAXA 2FJXA 4F4YA 4J8FA 2YJFA 3FRZA 5C25B 4C97A 4JI2K 1KR4A 3GLJA 3W9IA 4IXCA 4QR1A 2M0GB 4WFXA 2UUBF 1NCLA 2NLWA 1NO8A 3GMGA 4J9UE 2G8FA 2DTUA 4YUDA 3CQYA 2AZ3A 2POKA 5FLXO 4B3SF 1HNXK 1UVLA 5AE3A 3KLGA 2KKZA 1WF2A 2QK9A 2X1FA 1L3UA 3OHBA 1LAVA 2GX9A 1GLDG 3G71S 2OEJA 2RF2A 4LBPA 2EI5A 1R0AB 2J9EA 4CJQA 1YI2S 2R42A 3P38A 4KHSA 2PSZA 3DOKB 2VWJA 2KHOA 4C0BA 1FT8A 1RA6A 5GMDA 4X64K 3EGWB 4K5SA 4QYZJ 2GNKA 1T0TV 3PDNA 5KFIA 4WP3A 5KFTA 1YDLA 4TU9A 2DH9A 3E51A 3O8WA 4TLRA 3OVSA 1FO1A 2MKJA 3CO9A 5E3PA 3AVCA 6AT1B 1VQYA 4Y65A 3J7ZT 2F4VF 2PEBA 4YR3A 4CF1A 2DNKA 3VZHA 4LRAA 1HYSA 2VYPA 4FSVA 5IWAF 3K5LA 1S48A 2W7PA 1U0SA 1WTBA 1FJGF 1HNZJ 3IO1A 2N7YA 4KKOA 4WFZA 3CPWR 4ILRA 3M2VB 4LF4F 3VGSA 4CO0A 1JX4A 1YTYA 1FKOA 4QR0A 4CGIA 3L7PA 3ZT2A 1ZAWA 1NNDA 1VC0A 2HQFA 1F5BA 3JTOA 4KY3A 3QIDA 1W2BR 4KHPK 2ZM6J 2FHOB 1Y5NB 2P5OA 3TRGA 5C42B 4DR5F 4W4MA 3BZCA 2BRLA 3SCXA 1WORA 5AZIB 2PFDA 4DG1A 2VU5A 1DRZA 3QGHA 1SC4B 3DM2B 4B17A 2V50A 3FCWA 3ZSQA 3HDSA 1RGIA 5BYQA 2J7KA 5BR9A 5DG9A 4AM7A 3KJFB 1NGDA 5JXSA 3H46O 3K2YA 5AZJA 2PT0A 3NEKA 1R8HA 2BE7D 5DG8A 5D0HA 2J9CA 2A0FB 4H0TB 5GAEU 4HR2A 2OP5A 3OFGA 1YJVA 4IO1A 3PIOL 3MPDA 2OPQB 1R8BA 5HMYA 3T1YK 1RU2A 4Y3CA 1YIJN 1XR7A 4GKJK 2BE2A 2YY3A 1Q8KA 3JSMB 3NMRA 2IYGA 2GELA 2FJWA 9RUBA 3OLBA 2BACA 2DPJA 4MIWA 3F41A 3D2FB 2AWZA 4NA3A 1FKPB 3GE9A 3KWGA 3S1TA 3ENWA 2G8KA 3CCSN 2V51B 4DV2J 3QFHA 2VD3A 3MXJA 1TFYA 1ZBHA 3CWJA 2ITMA 1WB9A 5CZVA 3IRXA 4LFBF 2F8SA 5KG3A 4FWLA 1V4TA 2ZOFA 2B8PA 4ATNA 5J2QA 5H9EK 2IVFB 2NUBA 2HBMA 4J9LA 2FJEB 1VRTB 3FK4A 1YSJA 4CFAA 3MECA 4DV0J 5HBMB 1MDUB 3A2FA 4RUCA 3VA0A 3L4BC 1FRMA 1C1CA 2AJFE 3UDEA 4OPJA 1ULRA 7FD1A 1X9MA 2NXCA 4XPEA 2AX1A 1BHLA 4KHUA 4L76A 4U95A 3OLAA 2YKNB 4LR9A 4P52A 1RT7A 2W4DA 4NLXA 1KD1O 1X0PA 2W6LA 4OPKA 3W9JA 2ZUAA 4A8SA 4K59A 2YX1A 2JC0A 1G6BA 2AGPA 2ZC3A 1C6VA 3DI6A 3C16B 1SJQA 2FC0A 4B3MK 2HFSA 3OTOF 3I8DA 1TUYA 5JVGL 5J2MB 1DAXA 2DIUA 3THWA 4Y2MA 5IC6B 4KGVB 4B3TJ 2IBOA 1GLLO 4ECTA 3LZIA 1ESVA 4JRPA 4F50A 4A8WA 3FSIA 2ZWOA 2KW4A 4ER8A 2QJ3A 2GAGC 4ZP9A 4AH9A 2RKIB 2WTUA 1H98A 2B9YA 1NHKL 3RG6A 1BQNA 2MMYA 1HX1A 4O8KA 2YWEA 4CH1A 3OW2R 3ZT4A 4H0OA 3M6XA 4RWWA 1T9XA 1HWUA 4OYZA 4IDHA 1HR0F 4A59A 4JLHA 2KXFA 5FJ4A 4Z7YA 5DGBA 4FCYA 2UXCF 3N5BA 2X6NA 3MMCB 3ENBA 2DBBA 5M1QA 4AT1B 3OD2A 5AQYA 2MKSA 1Q5YA 2GVZA 3SCKE 4CT9A 1S9GA 4E1JA 2IDLA 2VONA 3CD6N 1K73T 2MKCA 3W2WA 4EHUA 4DL5A 2DT9A 4C48A 4EWTA 5K14A 3R5JB 2HBQB 3OL8A 4HEA9 2ZHAA 4WFAQ 4DS4A 1M5OC 4H5NA 1TK0A 3W8GA 1FJCA 1S1XB 1LEOA 1LW0B 1H74A 1SBRA 1OH5A 3V6DA 5I3PA 5CYMB 3PM9A 3I8BA 1XNQJ 2W8LA 4GNIA 4CK2A 2FLLA 3VHQA 4DQPA 3VQTA 3IMQJ 3AVKA 2NLXA 3HVRA 1CZBA 3O4NA 2CQPA 4C8LA 2VQFJ 1LFPA 3DRRA 1TKTA 5LMUK 2P2CB 3N5FA 4DX8H 4LH4A 4ZCLA 2CZ4A 3IS9B 2EFVA 4M7XA 3WDOA 4QWAA 1HPMA 4A8YA 2GV1A 1YTAA 4PG5A 3MM7B 3T9ZA 1ZAVA 4KV8B 1J6ZA 4F7VA 3A8JA 3QLHB 1U0HA 1CXQA 2OPPB 2I0XA 4JYAF 3O3HA 3ITHB 2MSSA 4J2DA 2OPSA 1SL2A 1VSJA 2FHKA 3FVYA 5A6PA 3VPZA 1U45A 1H3DA 3AODA 2DH7A 3M05A 1HNIA 4QR2A 4AQYF 1VSFA 1QSLA 5EWFA 1WI8A 1HBOB 2V6AA 4JB8B 3J7AN 2U1AA 1WSJA 2VDIA 4P7TA 2AD9A 2IVMA 1KONA 1H2VZ 3QFWA 4NXMK 4RNHA 4ZTFA 5AXNA 4FDFA 5B0AA 5AJ3J 3CM5A 4YY3F 5ITHA 4ED3A 3L2UA 2UXBJ 1IBCB 3HP9A 3LDPA 3MM6B 2C2ZB 2ALZA 1JJ2M 3SUPA 4ETXA 2YWFA 1KS2A 2P9GA 1AW0A 2CPIA 2LQ5A 4I2QA 2F65A 2H9ZA 3WIUA 1KEKA 4RNNA 4CH0S 4CJKA 2DHSA 1U7LA 4JI2F 2MZJA 4LR7A 2CYYA 2D69A 4ID8A 5CR4A 3C14B 4H5WA 2CRLA 4BQZA 4BE0A 3D5MA 2R2UA 4LRCA 3ZSVA 1XJWB 2P9LB 3G86A 4FPIA 3K9JA 4MAKA 5JVHL 1HNXF 3RTVA 2CQ3A 3QDKA 3X1LB 4OYWA 1SUQB 4CLUA 1JL1A 4QWCA 1JJCB 4IYQA 1VK3A 1U4BA 2BXJA 1NU0A 2MQOA 4MFBA 4DR1J 3I82A 4MLHA 2DNZA 1Q95G 3EXYA 2QE5A 3GFHA 3OQ2A 1AZSB 4X62J 2E1YA 3PKYA 4X64F 1XERA 3ISNC 3I9V9 4KFBA 3PIPL 4OPHA 3P6YC 4CIEA 4ZKAA 3HOSA 2KT2A 4J9OA 4LSNB 1CC7A 3VV2B 1NJXA 2YNHB 3MFIA 2MDAA 4ECYA 1RBVA 3VN5A 2Z56B 4DCPB 3A3NB 3ENOA 3DRPA 4K2XA 4ZOSA 1VSIA 4K41A 1CJVB 4FZVA 4CK3A 4F4ZA 5L1LA 3BV8A 4K0KJ 1O13A 2ZJPL 3OS1A 3IFEA 1YJNS 2D0OA 4CLLA 4BC4A 2IM0A 3EN9A 2YKMB 2YH1A 3EZUA 3QNWB 3BBBA 1ZC6A 2G8HA 3AD9C 1VHXA 4KHPF 4KO0A 1RQ0A 1TGOA 4X66K 1TKXB 2LDIA 4OZ5A 5KFJA 5ETNA 3M8QA 4DL2A 2H5EA 2LECA 2QX0A 4OI4A 3H90A 3GYNA 4B1ZA 1D8YA 1MLAA 1D4XA 1WEZA 4CZHA 5CD4H 4OJGA 1Y7PA 1HWKA 2BX6A 4ZVFA 2OYQA 2ZZNA 3C3LA 4CYUA 4IQXA 4DU4A 1DURA 4OLOA 4DJBA 2CQDA 4HTUA 4ZDNA 3JSBA 2G0IA 3B8AX 3V1RA 3EGVA 4IEEA 2Y1IA 3GONA 3R9PA 1B92A 1ZZFA 1REVA 3JSYA 4C6AA 2Q79A 5KFYA 2NRRA 5LJ5Y 2H4WB 1TTHB 2LQ8A 2XMKA 4OGEA 1YI2N 2BJ1A 1U8SA 1Z6RA 1KVBA 4KBOA 3BQ0A 3H3OB 3D2EB 4CZFA 1OMSA 1FRJA 3T1YF 3DLJA 1BQXA 3U1LA 3VVTA 1T95A 2FLNA 1U04A 4GKJF 2IBKA 3U02A 2AKWB 3R5DA 5HQ8A 3Q83A 2R7TA 3J81j 3OYMA 2Z1HA 1VQ4S 4W90B 1ZBUA 1SKRA 1F9FA 3H42A 1RAJA 5HRPA 3CDWA 5D3GB 2V9WA 3J80U 2OLWA 4LFAJ 1VQ6N 1ZPWX 2H51B 4CE9A 4ED2A 2HZVA 3G8TA 4WF9Q 5HN0A 3DDIA 1RWXB 3FZKA 1RT1B 3NCPA 5A8RB 1KC8O 1RTIB 1WSVA 4JKEA 4ZVTB 3CYMA 5L1IA 1KKHA 1X7VA 4JOUA 1NGGA 1JNRB 3ULEA 3H40A 1R8AA 3GG1A 3DRSB 4DZ6A 3BEGB 4CTAB 2RN2A 2DNYA 2PC6A 4HVZA 3OYBA 3M32B 3S01A 4X4VA 3G6EN 1VQMN 2XTJP 5H1SV 3HCXA 1IKVA 3QJPA 4BRNA 4PUOA 4DTNA 3K5MA 5D6GA 2DFEA 4LF9K 2VKZG 3P8BB 4O44B 2UU9J 3PEJA 2JL9A 3RU0A 3U8XA 3AJ1A 5G0RB 1YWXA 3NKYA 2JSXA 2A2DA 4B3MF 3WNFA 5DRKA 4JI4K 5KRTA 3K2PA 4KGMA 1R6YA 2O67A 3KZBA 2GVDA 1J5EK 5F0UA 4M5GA 1EWRA 4KPYA 3MFHA 4FYDA 3ZTQA 3T7ZA 3KJQB 2KH9A 4RBUA 4CEOA 1NZ8A 2BKPA 4N8NA 4LIWA 4BGAA 2CADA 4J91A 5L46A 2GA7A 3IGVA 5IQ6A 1HKAA 4FBUA 1UFLA 3ZEUA 4FS1A 4JI5K 2PMHA 1RTJA 2RH3A 2JHEA 2F3JA 4XK8C 2V8HA 3PX0A 4UY8O 3H0PA 2V2VA 2DY4A 1GH8A 3SAFA 3NS6A 2LEBA 1YQHA 5K5MA 3U4LA 2KXNB 1K9MT 3AOAA 1XNRJ 4WYWA 2Z0GA 1KN6A 4KHMA 2KDOA 1NBEB 1GAOA 2XYHB 3GJTB 3IC1A 1GXLA 1MU2A 3MM5A 3CC4N 1RILA 3K5OA 4USIA 2RU9A 5FPNA 2CAJA 1G1XA 2YNFA 3LPUA 2Z1GA 2N3LA 3HP6A 1DZ5A 4K50A 4UOCA 1PJ7A 1HYVA 1U25A 4F67A 4HACB 3RSEA 4X4QA 3P45B 4CEEA 3QEVA 3HM8A 5M1PA 1RHJB 1NGIA 2GTDA 2VCPA 3VQCA 1YXQA 2VH7A 3SFGA 2BW7A 1NLKL 3E9PA 2ASJA 2U2FA 3ZTOA 3RBDA 2YKAA 2DFFA 3A12A 4DLGA 2ATCB 4K25A 3V1QA 4K4WA 5C2FA 3D0HE 1NNEA 2VG7A 2ZOGA 1FCAA 5HOOA 3CGIA 5BJRA 4NLQA 3T19A 3UI3A 1JLEA 1FXRA 1T9VA 3OT9A 3MTKA 2HRUA 3CMAN 5LMUF 1QSYA 1FE0A 3TAFA 5KQ8A 1R0CB 4PY5A 4NE9C 1NK8A 1DBDA 1B9FA 3C6TA 2XRIA 3VQEA 4IFEA 3M6GA 3DXKA 2DNOA 2KHCA 5I42B 2ZBCA 2QIFA 2LDYA 3QAUA 2DEJA 4IRCA 2V2QA 3AH6A 2KRRA 4PKIA 3OR2B 2FZCB 4DX5A 4K4YA 1CJUA 2Y3YA 3L3UA 1XN9A 3Q8PB 1FHTA 1KQSR 4FXDA 3BGUA 3HHLD 2F7VA 4W5RA 5JMNA 4DTOA 4DL4A 2GGPA 1IBMJ 1QHTA 2B5JB 3TYTA 2DY1A 3G8QA 4C0OC 2GJ2A 1RTHB 3QICA 4Z4GA 4H5RA 4M1KA 3MXHP 3V1OA 3C94A 2HNDB 5RUBA 1S7IA 4KHYA 4PWDB 4ANCA 4NYOA 4M5HA 2O4GA 2MZSA 5KFAA 3I9ZA 2QRRA 1UAXA 2BYCA 2O8BB 4DR7J 3MR3A 1U1PA 4NXMF 2DHXA 3FGVA 2BEFA 2VPWB 3QBXA 4EBEA 5DM7L 4DL0C 4LJMA 3QB0A 4ZPTR 2O8DB 4LF5K 2P6TA 2BKNA 2FTRA 2LQJA 4GRSA 3AVBA 3IWLA 5HATA 2UXDJ 1YTUA 1JLGB 2V4JA 2PYLA 2LLZA 3TA1A 3WZ0A 1X9JA 1C2PA 3A8IA 1PG5B 2WBMA 3GFYA 2GEMA 4PR6A 5EN1A 3TJ9A 1KOOA 1N54B 3ILOA 3QFPA 3W8PA 3NNHA 1GMWD 4BG9A 2HFUA 3VQAA 4C8OA 2ZVSA 2D7SA 1VRQC 1VOMA 4EYIB 4B3OA 3M7VA 4RW8B 3W5ZA 1JKHB 3O5BA 1RBOB 1HBNA 2IC3A 4ISFA 2OIHA 1DQ8A 2YWKA 3AQOA 1S0NA 1RDRA 1FXXA 5BYRA 4A57A 2C2DA 1BUXA 4F3MA 4CD3A 2V8PA 5B09A 4RUAA 1N34J 1ZH5A 3F56A 1GMVA 3GV7B 4WE1A 4ELVA 1RWWB 4PEOA 3GQCA 2AIRB 3KLFB 4MKYA 4Q44A 2A10A 2VA2A 3VENA 4CI0B 3HK2A 1IBKK 5GMEA 5J2NB 2G2YA 2GUPA 3GIMA 1M1GA 1TKZB 1RDCA 2E44A 4WKRA 5HJXA 4O3PA 3TX8A 2ASOA 4X65K 2V68A 2DRAA 2DHGA 3KHRA 2J7WA 1VQ9S 2XCAA 2W24A 4Y2CA 4R8UB 2RT3A 2HRTA 4YFUA 4FWKA 5D0EA 3MAHA 3DDNA 3G4SS 4P2SA 4BG8A 5C25A 1VQ8N 4FWOA 5J2PB 5AXLA 5CHCB 1T3NA 4R0EA 4F8RA 4X66F 4MIBA 2DPIA 2B4JA 4ZCMA 2ASLA 3J7ZO 1VRUB 1VQKN 4BRHA 1NOYA 5IQQA 4OX6A 1IR0A 3CDBA 4WCEQ 3ID8A 3NF6A 3RWUA 1AB8A 3OBIA 2EFGA 1R0AA 3ZTRA 4Q5VA 2HPUA 4A8KA 3AA8A 3DOKA 4K4TA 1XMOJ 1UJ5A 4ED1A 5GADP 1SJ4P 3AD7C 2WBNA 4E19A 4NLGA 3I56N 1VGYA 1I1GA 2XZTB 4NASA 4O5FA 2YV0X 2JZ5A 1OVQA 5L8RC 4DSJA 1D3WA 5CZ1A 1SL0A 3V9SA 3EVOA 3VAKA 5AQJA 4K43A 1RT3B 3AY0A 2D74B 1GK8A 3VQ8A 1QZ6A 4E7IA 1OIAA 1PJ6A 4HTJA 4PQAA 3Q0AA 5IV4A 4URSA 3VCDA 3M2VA 4DV6K 5H9FK 1JB0C 4A47A 1NDPA 4B9VA 3RGIA 1VHIA 2M7SA 2XMVA 4PRFA 4KSEB 2B3TB 4TKTA 3U3YA 1HBMB 5M1NA 3CIMA 4CCHA 1FDNA 3DLEB 2Q66A 4PKGA 2I7PA 2P9IB 3PLAA 2XQCA 4ES2A 2AMCB 3R6MA 4PKHA 3NGIA 4UZCA 2AJ2A 3N4PA 5BR8J 5CQGA 1R6VA 2M3DA 3W1YC 1LNQA 4QS7A 5C42A 3I6PA 1WG1A 2DGWA 3OYHA 2O3DA 5A2QY 3CF5Q 4S0MA 2Q0RA 4ZVPB 3O9TA 3SQ2A 5AZIA 2XM3A 4U8VA 1RYSA 2MJNA 5BRDA 4CJUA 3LOUA 1V9OA 4LF9F 2QA4G 1XMQK 5AQKA 4C3LA 2FHMA 1U24A 1YK9A 5IC4B 2BBEA 3GIIA 5C2CA 4FS2A 1JK9B 2NUHA 2WB4A 2MYFA 3EE9A 1U8WA 5IM0B 4C1NK 4DV5J 4M5NA 5JS1A 1KFSA 5CY4A 4JI4F 4ITSA 4DV4K 1M5KC 3SQ1A 8ATCB 1J5EF 2OPQA 1Y00A 2EK6A 3KK3A 2Q1NA 4CZJA 1L3TA 1BD6A 2DRBA 5KT5A 2PA8D 5GADI 1GTHA 2F4FA 4NRUA 1NK9A 4URGA 2EHGA 2F8TA 3SJHA 3JSMA 2HBJA 4CEDA 4WXWA 3SZ2A 1JWWA 4PWUA 1NGBA 3IBWA 2YQ3A 3O4WA 4NYPA 3JS6A 3HO1A 4P72A 3QRPA 4JI5F 3AVJA 3DLRA 2N82B 4CWBA 3UD3P 5FRNA 2C3PA 1CVJA 3GIRA 3DLHA 3L2QA 4I7FB 3A8EA 1HNVB 3JQKA 4OFZA 1A6LA 2QMUB 4WQ5A 3VQ6A 3Q86A 4H4KC 1U6FA 4O3NA 1S99A 5A6WA 3VAIA 4MQ3A 3OHAA 3ET6B 1UWBB 3AO5A 3V6JA 1QUVA 1VRTA 3G6YA 3VGLA 4C11B 4YR0A 3R8YA 5KFBA 3CC2N 1NJIT 4LF8F 1F60B 3MTJA 4WBFA 4BRPA 3GYXB 1RA7A 2E5LK 4JKFA 2IA6A 3H2LA 2GHPA 2VHGA 2XLJA 2W9AA 1W2BM 2DNHA 1X4BA 5AQPA 1TQLA 2W42A 4RW6B 1M5SA 4NEYA 1KAYA 3C8YA 4DQIA 4JAXA 3IAYA 4P2MA 3C16A 1Q4RA 5IS2A 3DLLQ 1E6VB 1UA0A 5KQDA 2FHJD 3BR9A 3GJQB 2DR8A 1LCUA 3GG0A 3TEGA 4KE5A 1MSWD 3QEWA 3ZSXA 3HVAA 4LH5A 3QRRA 3FE1A 4KQZA 1NK0A 4GKKJ 2RMLA 1ATSA 3FEZA 1OH8A 5CABA 3Q8VA 4YB1P 3LP2B 3OYIA 3CCQN 3ZZRA 1P27B 1Q0NA 4EMDA 4CZEA 1OY6A 3CJ1A 4FXVA 2F63A 5C2GA 2E1RA 3G82B 5KGXA 3TNVA 4LF6F 3H59A 1QTNB 3G10A 3MMCA 2X6SA 1F5CA 1I94J 2G8UA 3E9LA 1VQPS 3LANA 1TMMA 4CQ1A 2MQQA 2AV5A 5IXUA 2Y1JA 4DHYA 2PFUA 5FRMA 2DTJA 1X4EA 1NKCA 2Z57B 3WQUA 3R9LA 1N8RT 4RL1A 4MKVA 4CJTA 1F0XA 5AQHA 1QAJA 3C19A 4G6VB 1S1XA 3O44A 4EO8A 2ZGYA 1LW0A 5KPRA 1DLOB 3WQPA 2GW8A 3HI9A 3QAEA 3W62A 3P5TL 2FBYA 2UUAK 3CSKA 2QWNA 5CYMA 3OL6A 2CZ9A 4LF5F 3J7AP 1T7PA 1WHVA 2XO7A 3OYGA 3H4BA 2B43A 1UPPA 1QAYA 4AL7A 1G2EA 2VODA 3OSPA 3ZX0A 3PXGa 2JWKA 1KNZA 2LXFA 3TAMB 2ZBPA 1YJ9S 1RDBA 4NRTA 2DH8A 3L95X 2KFZA 4DR4J 2XS2A 2F7TA 1B7FA 3DU6A 2W2QP 3TUIC 3KKFA 3SSRA 3POTB 1H0HB 1K47A 2ZWPA 2WSCC 3MM7A 4KV8A 1N36J 5KPTA 3EGZA 3MCAB 3QLHA 4KTWA 4CH7A 4HUGA 2OPPA 1QD1A 5A0YA 1RB0A 2UUWA 3AO4A 3UN5A 4WFAL 1DEJA 4XDDA 2VB6A 4WQ4C 1PYTA 2K8GA 4Y28C 5AQLA 2HS0A 5F8MA 1NHVA 4LVOP 4DUYK 1IG9A 4PPDA 3F5TA 1H2UX 5FDLA 3ZO7A 3KOAA 3SDEB 5LM7E 3CJRA 1HBOA 4Y1CA 3HRGA 3ZLJA 1S72S 3KD5E 2Y0BB 4NZ6A 2WTFA 2IVYA 1IBKF 1URRA 3AA3A 1OY9A 1YVNA 2XHCA 4ILLA 3HJFA 4ZK7M 4X65F 4QWEA 4LC9B 4BRDA 3K5NA 1PGZA 3N79A 1SI9A 2CPFA 4KJIA 4NI2B 3KYLA 1D5AA 3MM6A 3S41A 3LP3A 4DFPA 2A40A 1RTDB 1RCHA 3EEQA 2KJWA 4DL6A 4PABA 3E66A 4OI2A 5E2QA 3EKSA 3QNOA 1Q82O 3O9UA 3QINA 4NWBA 3N6MA 5KG0A 3MI7X 2X3GA 1SAZA 3HT3A 2A6AA 5HRNA 1SV5B 5C5JA 3NBPB 3W66A 2IPOB 4OZ2A 2VFTA 5AQVA 1NHUA 2X1AA 4B9NA 1VQ5N 2XI3A 3C14A 4NXNK 2Y0SD 2P9LA 4HCBA 2QA2A 2RHSB 3J7A1 4PG4A 2C3MA 3M2UA 3PW7A 2R9LA 4H4MB 2V5HG 3TAPA 4NYNA 3QIPA 1SUQA 4BR2A 1PCAA 1NH7A 1TL5A 4DQRA 4CJPA 1OY8A 4Y1DA 3AB4B 2KZMA 3SK3A 4H54A 4QCLA 1BO5O 1AZSA 1UEKA 5C24B 2KKHA 4QZVB 4CESA 2F40A 1NPRA 5IT9Y 1C0UB 2RHQB 3HI0A 3L0QA 3OFHA 1M0SA 4J2AA 4F25A 4Q2LA 4LSNA 2JEGA 5B8HA 1S6QB 2KXHA 2YNHA 3MPWA 2P9UA 2B4UA 1NH8A 3FCHA 1MMDA 1ACMB 4CJFA 4DQSA 5A8WB 4C3KA 4HDGA 2K1RB 3D28A 4YDUC 4IG3B 2V2ZA 3CVKA 1FK9B 1HFEL 3LM9A 2DPNA 1R7IA 3SSQA 1Q78A 3QWPA 5I9EB 3SUOA 1NK4A 4F02A 2PMZD 2OTJN 2D41A 3AAWB 3UCGA 3JQMA 4MK7A 2JLFA 2OEMA 3SIPB 1BA1A 2W9BB 2KG0A 3K59A 4ECSA 2YWWA 4Y34A 3HFVA 2J76E 3M6VA 2ZH3A 1YHQS 3GP9A 1TKXA 1SKUB 1RTZA 4DQ8A 4OV1A 4EEYA 2EVZA 4FWPA 2FF6A 1PYSB 2LU1A 3V81B 4M5KA 2CJ9A 3QT8A 3W5YA 1TMJA 2G8WA 1AFIA 3KUEA 4UF4A 1EO1A 4ED5A 3TAEA 3PYGA 1D8ZA 1XMQF 2XGPA 3OYKA 2WFBA 4UQGA 2HBZB 4OL8A 2QN6B 3Q7CA 1NJWA 4Z4HA 3TOQA 3ZT0A 4FF1A 2D0CA 3QQCD 3F2KA 1FX4A 4PA1A 4DS5A 2RS2A 4LBHA 1HUXA 3EE3A 4DV4F 1TUGB 4UUXA 4P74A 2CPEA 3SQGA 1Y97A 4M3XA 3ALYA 1GLBG 4HHJA 3CI5A 1CJKB 2KTQA 3D2EA 1YUWA 3RBZA 5KT3A 3OJUA 1MMLA 3I96A 1FWPA 3TU5A 5FPEA 3QGPA 3H2VE 5CA5A 4DMZA 1Z1ZA 4HI2A 1LQ9A 3T1HK 4FJ5A 3T41A 1IBLJ 1RAIB 2V8GA 3D6FB 4IWVA 5D3GA 2V0NA 4JV5J 3ZTPA 1P6TA 5ETRA 1TK8A 1RDDA 2H1YA 2KLAA 2YBVA 2EC2A 1LFWA 3MR2A 4OZ1A 2DXDA 3WXJA 1PYOB 5A8RA 4EI2A 2B7BB 4OMFG 3M6UA 4O3SA 4N8OA 5D0RA 4DPYA 3T5LA 4J5OA 3K8VA 1NUEA 2CJXB 2HWTA 5D78A 5F8IA 3DRSA 5HL7Q 5EVZA 1JCEA 3TJAA 2P9PB 3PVXA 2GIFA 4G1PA 2QFIA 3M32A 4KB1A 4LSLB 3KJVB 3KUHA 2AF6A 4W92B 2E5LF 3S6EA 1Z05A 1VLYA 3QYYA 2DXEA 4GC6A 4YEAA 2XBPA 3QJLA 4QAGA 5AE1A 1JLQA 4O44A 4WU2A 2JOQA 2ASYA 3MD3A 3I33A 2H4YB 3PG9A 4EAHD 3CQ8A 1IKWA 4FWMA 2ACYA 3GBTA 4USUA 4BR7A 2OH2A 4CJSA 3VOVA 3MX2A 1JLAB 3HSZA 1F3FA 4WF9L 2MEWA 4CJLA 1Q7YT 2VBWA 5AQXA 3IBFB 3PSIA 4J9SA 4BRQA 5BRHA 2QO3A 3H5XA 1ZA1B 4ZLPA 1MN9A 3K5PA 1FEEA 1HA1A 4RUHA 4FLVA 4M3UA 3O08A 4G65A 2UUCJ 4FJGA 3R7SB 2B4OA 1QM9A 3M9NB 3FFKB 5FPMA 1GNKA 4A8MP 2XMMA 4DSFA 4N47A 4JI0K 4O23A 1NM2A 2R2TA 2V4QA 5KFCA 1ZBTA 3TAQA 2IAJB 4HH0A 4ED0A 2Q31A 2BQ3A 2DEIA 2ZHOA 2NXNA 2VGMA 2ALYB 1U48A 3PO5A 1VSLA 4Q2MA 1M90T 4RW4B 1RAEB 2CVIA 4NYFA 1HMVB 4YB5A 1HNWK 3QMQA 2DNRA 5CZ2A 3CIZA 2CPYA 5GAHP 4LF8J 4ZCIA 2CIMA 2LXUA 3TUJC 3C2PA 3TA2A 4FVMA 4DTUA 4ECZA 1GTEA 4DR2K 2HLTA 1YITS 1VBYA 3OTBA 3BS9A 4X4NA 5GIPA 4I64A 2UUAF 1RK8A 3RAQA 3TA0A 3LDQA 1PIEA 2A41A 3MX5A 4BRIA 3TJ8A 3NNCA 3CCES 2HFOA 4FXWA 3R8EA 2FDNA 3FDSA 4EBCA 1S1WB 1Q81O 1AA1B 4QOZB 3TVZA 3VAHA 3UO0A 4JI8K 2DR5A 4J9PA 4ED8A 1WOQA 3CQXA 4CIFA 2F5GA 3RJMB 4C8ZA 2YKOA 1A5VA 1AYEA 1XI1A 4U7BA 4OIXA 1T02A 3SV3A 3LPYA 5E84A 3NGRA 2IOCA 2MGZB 3M8ZA 4GY2B 2XS7A 1EJ7L 3ILIA 2ZNZA 4TN2A 4H5VA 3TP2A 2RQMA 3D0GE 4BREA 1YG0A 4AL6A 2BW2A 5I42A 1OQ3A 3RR7A 4FF3A 4ZS6A 1B7YB 1HPZB 4EK2A 2MZQA 4EZ9A 5KFHA 3OR2A 2QV6A 3GCXP 3M8PB 2MHNA 4WTYA 4DSLA 3HVTB 4LF6J 3LP1A 4DUYF 2L08A 3VESA 3ULDA 2RUSA 5KOWA 2DB1A 4E7KA 3CJ3A 2IJNA 3KG4A 5GADU 2AT1B 1RTHA 1M5PC 4HVJA 2CGLA 3L6QA 5JLHA 4JI7K 4OHWA 1HKCA 2V69A 2HNDA 2W01A 2WK4A 4PWDA 3QEPA 3UPFA 4PCQA 4X2BA 4WFBQ 5DZ7A 2O8BA 3VQQA 5GAGI 3OYCA 4ED7A 1U47A 1EKRA 2ZJRQ 4EFAC 2VFUA 4OZLA 2O4IA 2J7UA 2O8DA 3CJ2A 3HHNB 3CDUA 3LGHA 1KVCA 4CHZA 3CFRA 3UN3A 5GAHI 4Y00A 2IMWP 4PXEA 1Q8IA 3HM9A 2B0GA 4JD2A 1JLGA 5HMXA 3TARA 3BF1A 1NSQA 3CMES 1F3VA 4Y0FA 3L4IA 4RU9A 3BKFA 4BGBA 3FSXA 4NXNF 3GU0A 2HMIB 2OMOA 3S3OA 1UETA 4I9QA 4MIAA 3MEEB 2IY5B 3BH7B 2A5XA 1YLXA 4WU3A 3SV4A 5L9XA 4RW8A 2ZKUA 3C6HA 1U6ZA 1JKHA 4CLWA 1S12A 3DHXA 3BSOA 1IH7A 2MKIA 1NPKA 5LXYA 1OH6A 2AJ4A 2Q1LA 4MK8A 4TU7A 2O5DA 5KI6A 2VWBA 1GOBA 3BPDA 4JI1K 1QS4A 4DSIA 3WHIA 2G4BA 3VAFA 1ZBSA 4M63A 2JEJA 1TVRB 4CNYA 4FO0A 4BE2A 5GIOA 2GMLA 3I5BA 4FLWA 1FDDA 2F9TA 5CXTA 3L7UA 3KLFA 1YT3A 3QO9B 2O8EB 3NNAA 1RT2B 5J2NA 4B8CA 1TKZA 1VI7A 1EQYA 1KQSM 1HI1A 2R2SA 1SJ3P 3D54A 2NRTA 1D09B 1TKDA 1N32K 3H98A 2HHHJ 3D6TB 3O3LA 5D0GA 2EK1A 1UFWA 4PG7A 1L3SA 4FBTA 4R8UA 1U02A 4IFYA 1WI6A 3PRBA 3K57A 2XSFA 2E6MA 3EY1A 2P5GA 3SQOP 2HQGA 2GX8A 1J5OB 1K8KB 4LFCK 4QWDA 3PHEA 4K8ZA 2WONB 3G96A 4BWMA 1YIJS 4KRFA 3PJ9A 3R1HA 1GT8A 1O5JA 3ZZ0A 1TAUA 4DR6K 1VRUA 3GZ7A 3HF5A 2ETJA 7FDRA 1KVJA 4ID1A 1BC6A 1ZA2B 4H0YB 1NGHA 1B70B 2XC9A 4M3TA 4UQTA 3U9ZA 2DNPA 2X3DA 2H65B 4DB3A 3F0NA 1HQUA 3CCSS 2E9TA 2HSTA 4KTZA 4U9RA 4DSKA 1LXJA 3BQ1A 3M9MB 3MDFA 1D0EA 3J81Y 2G8VA 3N6LA 2W9CA 4Z37A 4FLYA 1IVZA 3ZX2A 1VAZA 3GFZA 1RT3A 2QZ8A 3CTRA 2CQ2A 3VA3A 3OV7A 3T1HF 2LXIA 1QVFR 2NZ4A 3P5JA 2KFNA 2WSEC 3GPAA 2CQCA 3PHTA 3RB3A 3D0PA 1MWZA 1TYQB 1NDCA 2VQEK 4IQMA 3W2VB 3V9XA 3EXCX 5J1EA 5C2DA 1HBMA 3U27A 2QI2A 4WCEL 4FZYA 1X4HA 2P9IA 5LMNJ 4P2XA 2CGJA 2UZAA 4V19S 3ZCMA 2ZH4A 3QEXA 1K8AO 3HPGA 2PIIA 2FIUA 3FKBA 1BI4B 3OUYB 2MKKA 1UL3A 4FLUA 2VC1A 3LAMA 2Z2LA 2WVDA 2HVHA 3KK7A 3MWBA 2ZD1A 1K1SA 2XSJA 5FLXY 2CA9A 2ZBQA 4ZP8A 2VPXB 5AXKA 2QLXA 3LPEA 3OA9A 5KFKA 2IVNA 1GLJO 1ZS6A 3V9UA 2R2RA 4C8KA 3BGLA 1FW6A 1KXPA 4C8NA 2OA8A 5HLFB 2GS8A 1NK5A 3THYA 2G2OA 2QWQA 1IG8A 3QZ7A 2YX4A 1SQEA 4M5JA 3SQ0A 2HKEA 3AJDA 4FNHA 4MT1A 2AGOA 2HQ3A 1SVDA 2CNLB 4GVMA 2ACMA 5HI7A 4B3RK 3MCSA 3VQ5A 1H72C 1RBRA 1RCXB 2RUGA 4JI0F 5B0GA 3CF5L 3VF2A 3DC2A 2FUG9 3WIVA 1QAIA 2E5IA 2QLJB 2AJ1A 4I7FA 1HBUB 2HVZA 3MAAB 4A62A 2WSFC 4ECVA 1XQSC 4KB7A 2Z58B 2XMAA 3V4IB 3AA9A 1HNWF 3QERA 3V6KA 3KLIB 1Q7LB 1UWBA 4IOBA 1WEYA 4W5NA 1FNOA 1ELOA 2GHVC 2HBLA 2MQPA 4CGDA 1TUVA 1FFGB 3MMAA 2ZH1A 4ZP7A 1V3RA 4FYVB 3KFWX 4DR3J 3B8HA 3OR1B 3OBYA 4DR2F 4AILC 5KFVA 2EXUA 4RJVA 4NLVA 3U3GA 4Q43A 2GMJA 3IRWP 3CJTA 2R7QA 4DEZA 1S22A 1YJ7A 1R31A 4E89A 3MR6A 2R8IA 3OYJA 4X4OA 2R8GA 4JI3J 1VIOA 4J9QA 1SS6A 5KAKA 4ECXA 3E8OA 4JN4A 4X4SA 1MA9B 1E6VA 4JI8F 4I0WA 2D3O1 3P31A 3AO1A 2GBZA 2XWXA 1W97L 3NFAA 2D3UA 3PJXA 2E5JA 4IOCQ 5KFQA 2CJKA 2V7ZA 1GOCA 3KG0A 4OHZA 2B51A 3LP2A 2HZAA 2ZJQQ 4A61A 3AY9A 3O8MA 3AXMA 3FZMA 1T6CA 4U96A 5ETLA 1J2VA 1T11A 1H2TZ 3U1MA 4RG8A 2E4LA 5H1SQ 1X1PA 1U2VA 3G82A 4YOYA 2ATLA 2A18A 3EM1A 2H48B 2I5JB 4ZN3A 3HPOA 1XEZA 3VEVA 2P1JA 3B78A 2OUGA 3MD1A 3X3UA 2XMTA 2JFKA 4PHTX 2VF3A 2XNRA 1VR6A 1WKLA 2EC0A 2V7YA 1MG7A 1FEHA 4JI7F 4GVBB 1WDDA 3DLLL 1S6UA 2C28A 4BC3A 4M3WA 1SQKA 3DHWC 3TZZA 3CD5A 4R79A 2DKOB 1WOOA 3C0BA 4USMA 4USVA 1K1QA 3W64A 2XY8A 3AVLA 4RZRA 2A1BA 2WRMA 1NZAA 1DLOA 3AOCA 2M5YA 2CJQA 1V3SA 4NOHA 1F21A 1X3MA 3QETA 3W3SA 2NXUA 2LA6A 4WP9A 2MZ1A 4DBQA 4J9RA 1YJUA 4DV1J 1U1LA 2QWRA 4DPXA 1C4CA 4GVLA 3ENQA 3KDNA 3TAMA 2HIQA 5ETSA 3D67A 2UVUA 3LDLA 1KHWA 4CD1A 2NRVA 4TLQA 4LF7J 1BIUA 5E33A 2RDIA 1KP6A 5HANA 1FTCA 1NAQA 4CLYA 3CCEN 1N48A 3FQLA 2OFGX 4U7UK 4AFFA 3J81O 4FW2A 3FFIB 1WSIA 3J7YP 3LPTA 3NAIA 1RGVA 1QQCA 4UOFA 3FZ2A 3O9RA 5DLGA 4H4OA 4NLCA 3H1QA 2W2MP 4FM0A 4MKBA 3JYTB 3CJCA 3P3DA 1DJ0A 1RWOB 4JI1F 3O9QA 3RB6A 3BZQA 4ZCKA 1W7WA 3KLGB 1FE4A 3CJ4A 3BO3A 4B9UA 3SDEA 1Y9OA 3R5BA 2W8KA 4M5DA 4Y6IA 4BWJA 4IDKB 1KVKA 2KVIA 2ZDPA 2HB5A 4OLBA 4QW8A 5HO4A 1DY3A 2WW4A 5HJYA 5A2QU 1O1WA 4CM2A 4QYZK 5FROA 3BREA 4U7CA 2MKYA 2M4MA 3MDQA 3CJSA 4DV7J 1N32F 4CJRA 1TL7A 1WNEA 4NI2A 3NGSA 2IM2A 3P4IA 1HYSB 1J9AA 1RTDA 2QKBA 1VBKA 1WG5A 1VSEA 3ETOA 3L2WA 4QIFA 1B4SA 2OCEA 4FW1A 3H08A 3M30B 4NB4A 2GAHC 4LFCF 3ATUA 1HNZK 1B0VA 1SV5A 3VGKA 2VFVA 3NBPA 1R3NA 4FM2A 1WC3A 2KT3A 4HT5A 5I3QA 4DR6F 2YHBA 1RT5B 3C7NB 5HVHA 4FWNA 1NMDA 4H4MA 1WSEA 2VASA 2OEKA 4E1NA 3RR8A 3WUHA 2CDRB 3MPUB 2Q6CA 3CMEN 2FVQA 3UKUB 1HLWA 2OZMA 3O6WA 3LF0A 1VQ6S 4BR0A 3IWXA 4LIRA 2SXLA 4UY85 5KRSA 2ZM6K 2PAVA 1U1KA 4KH0B 4USTA 4LVNP 4F4AA 4I9LA 1VQLN 2R7UA 3EZOA 4YP3A 1NGAA 2EFPA 2CVEA 3UR0A 3J7YI 5LSRA 4AL5A 3F9MA 4L72B 4DV3J 1VJWA 1SCJB 3TSUA 5CYJA 2E9RX 2H3EB 1S6QA 5D15A 1FX2A 2F8MA 2DFHA 4KHQA 3VGVA 5HAOA 3LZJA 3WX8A 2P9NB 1FRHA 5A8WA 5AZJB 4DPTA 5F1XA 2R7VA 4XDCA 2QLBB 3G6ES 1P90A 3GG4A 1VQMS 4O3OA 4IG3A 5K8NA 2ZE2B 3GJRB 3M1FA 2E7VA 1FK9A 2VFSA 3H2UB 1E4GT 4W98A 2HHXA 3MPVA 5D4OA 5D4PA 4PL7A 3DNCA 1URNA 3EE8A 1WSGA 2VQEF 4FJXA 1UVKA 3W0LA 5T7LB 1HI0P 1VQON 1DQ9A 3VTIA 4GO7X 3PRDA 1JL2A 2WUSA 2UYTA 3KLHA 2X78A 2ATQA 2PFFB 2E7XA 4OGCA 1K0TA 3D2WA 4XPCA 2WW8A 3THPA 5KT2A 4DUZJ 4ZVHA 4C0HA 3VZIA 5GAGU 3PKMA 4DV2K 3V81A 1HW8A 4M5MA 5M2PA 1HQEB 3G6VA 3IRXB 3IUCA 3IA0A 3D3CJ 4Q0BB 1SKWA 3HTVA 1CLQA 1WF1A 1BQMB 4ISEA 3DGVA 2OTLN 5GAHU 2QYCA 3D7SB 3HYFA 3P4UB 3LDSA 3MECB 3CCLN 3NCIA 5LSLA 4JI6J 1XC3A 4DV0K 2HG4A 4CJWA 3EX7B 2LQ9A 1WBDA 3L4QA 1C1CB 3LTOA 2CQ4A 1EP4B 4PG8A 5F0XA 1IWGA 1C0FA 3TTCA 3ZXWA 3NMUA 5C7PA 2RB7A 3CC4S 1CJKA 1Y10A 2RU3A 3VQDA 4IRKA 3IAM9 4P73A 4DX7A 4GV3A 4OO1J 1VLOA 4WYLA 4F9OA 4O5BA 1RHUB 1RZMA 3LGMA 4ZVEA 2H3GX 1Y3KA 2UVRA 3KHLA 3HBTA 4B3RF 2JH3A 2CQ1A 2OELA 2QFJA 1T3VA 2HLUA 3SSSA 1SQFA 4B3TK 4N41A 2AW0A 1QTMA 3NF8A 2HURA 4KH4A 5ADZA 2PGCA 2VGNA 1UVMA 4OYPA 2QSWA 2FC8A 1T3OA 1R8CA 2J6TA 1FF2A 3CC7N 2LU2A 3HHLC 3KKRA 2F96A 1RWKB 3CMAS 3TI0A 3FNNA 3D6HB 1RNHA 3IN5A 2H54B 1Q7YO 2OD6A 2P9KB 2R7YA 3TABA 1WSRA 3BN4A 4LSLA 5HP1B 1VYAA 4YHHJ 4GMKA 3KJVA 2KM8C 4ES3A 3CCUN 2AEJA 4KGZB 1MROB 4N77A 2W25A 1U1MA 4KH5A 1RLCL 2R7OA 1S9GB 5CE3A 3VVUA 2QYGA 1D9FA 3KK2B 1BOTO 3W2WB 2EBGA 3QGGA 2BJDA 3KWIA 5F8JA 3EPGA 2CDQA 4LQ9A 1F9EB 3LP0A 1F5AA 2XZWA 1WC1A 5KG6A 3BN7A 1M90O 2MJUA 1CS4A 5B0BA 3V6DB 1WNSA 2OD4A 1XHXA 3ISZA 1JCGA 4OX9J 1SZ2A 1K44A 1RACB 1JJ4A 2DHAA 3BUZB 1XNQK 2KN4A 3AAPA 3R2CJ 3DMJA 3SJJA 5HL7L 1GEHA 3SMSA 4NX9A 4MTPA 3OYLA 3HX9A 1TKTB 2L3MA 2VQFK 2QTDA 3UDVA 1PC4A 4FJLA 3GYGA 3NL0A 1LWEB 1RWPB 4LMZA 4RW4A 2HHPA 2YWHA 2HGMA 4USWA 1HMVA 3R7NB 3FBCA 1RLDA 4E3SA 2BZ2A 1XMBA 5E7OB 4HCCA 3TWZA 2RQKA 1YJRA 2DYAA 5EU7A 1KWMA 3OXGA 3O3GA 1V5IB 2C2RA 4O0NA 3OY9A 1GX6A 1I3AA 3CJKB 4DDFA 2EWHA 3MUVP 3AV9A 2M8DB 1HNIB 1ZBFA 1R0BG 5THWA 1BWVA 3BYRA 2E8AA 1L5UA 2NPFA 2YHXA 1A7GE 1AXQA 3CFPA 1C0TA 2ZDOA 1VK8A 3M8YA 2J6UA 1BXNA 4ZVRB 4BROA 2FGCA 2HBKA 4J9MA 1E3MA 1CQNA 4PL8A 1WUUA 2HQCA 3FBFA 1Y3JA 4TU8A 2W4CA 1ASWA 1S7HA 2BOAA 4C7QA 3UD5A 3PIPQ 3W61A 5AJ3K 1PSDA 4AXJA 3UE5A 4BLGA 4BCAA 2UXBK 4ANEA 1N33J 3UWTA 1TELA 3PUFA 4A5AA 4OHVA 2B9XA 3K9KA 1AT1B 2I6WA 4OYMA 4JS5A 3MUTP 1HJOA 3DLKB 2E9ZA 3HKWA 2V94A 1HPZA 4JKGB 1S57A 3QT6A 3DXMB 1KOHA 3MMVA 4HHTA 3N28A 3DLGA 2GZOA 2JEIA 2BDPA 2HAFA 2VPZB 5EXWA 3CJ0A 2QXFA 2CXEA 1VQ8S 5AFUH 3MCOA 4I69A 4CGFA 2E1AA 2HVDA 4PG6A 1YJWN 1WHYA 2DNGA 1NJZA 1P1LA 4MDBA 4CHYA 4F3TA 5FD1A 3CO0P 2Y8WA 1RFQA 3FBEA 4USKA 4DHVA 4DR1K 3NGDA 3R6LB 5DQGA 3BKUA 3SAGA 4DOZA 4CBWA 1VQKS 4DMNA 4X62K 3T9NA 3OL7A 1MNEA 4FWQA 1YAGA 1WTFA 2P9SB 5GVQA 4F0KA 4FK0A 3S3MA 1T8EA 4EHTA 8RUCA 3I56S 3H20A 2XY5A 3ZZYA 1N6QB 2FLOA 3RW7A 1HNZF 2CPZA 4K0KK 4IZ9A 1C1BB 2J8AA 1Q82T 2HHWA 3RBEA 3A3OB 3Q8RB 3R3TA 2VG6B 1VJQA 2HMIA 2PI4A 4ES1A 2YQ1A 1O6XA 1UPMB 3MEEA 2N4DA 2R4FA 3WNEA 5E5NA 3MN6A 3WXIA 3IR6B 4D3HA 4CP5A 4M3YA 2DGTA 2ZM6F 4WFBL 2DD8S 3J8AA 2A1RA 1HHTP 4RO0A 2VUGA 2XMWA 2NSBA 2EFNA 2O8FA 2Y8YA 4DCJB 1WKKA 2ZJRL 4F4KA 1Q8LA 1X0FA 4DTJA 4FWRA 5AQRA 5ELZA 4CYUB 2EWSA 2APOA 2CQ0A 1XR6A 1RDWX 3H3NO 4DTXA 1LKZA 1EHWA 1TUUA 1NDKA 3QO9A 4FF2A 4Q8FA 3ZNJ1 3HFKA 2BMBA 1RT2A 3CCVS 2UUBJ 3H4DA 2EW9A 3WXMB 2Z30B 1CJTA 4FZXC 2M88A 3W63A 1FNXH 3C65A 5M1OA 5HROB 1TR0A 3ID6A 3IXQA 4B3SJ 2LP4A 4OLAA 1RHKB 4CEFA 1RCOB 3NGTA 4DTSA 4FJIA 2AX0A 4FJMA 1J5OA 3M4XA 1K8KA 1GLFO 4FF4A 4XAKA 3G8SA 1S1UB 3Q89A 4KPCA 2NRZA