1DLOA

Human immunodeficiency virus type 1
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
556
structure length
556
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 REVERSE TRANSCRIPTASE
publication title Structure of unliganded HIV-1 reverse transcriptase at 2.7 A resolution: implications of conformational changes for polymerization and inhibition mechanisms.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 129
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1dloA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dloA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dloA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dloA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1dloA05
3QESA 4EO6A 2KZMA 4F4YA 4FJGA 3RB6A 2HNDA 1JLBA 3NF8A 3NF7A 4JV2A 4C8LA 4RW8A 4KO0B 4KHMA 3AVIA 3PJXA 5L1LA 3FFIA 3BGRB 3D0PA 2YNIA 5JS2A 1SV5A 3OS2A 4M94A 3QINA 4DL5A 3OYIA 3DLBA 2QE5A 2JC0A 3SCXA 3V9SA 1C1BB 1QE1B 2VG7A 1U49A 3N6MA 3I0SA 4IH6A 1T05B 5I3UB 4DEZA 1HYVA 4FLZA 1U04A 4KAZA 4QWDA 4CEAA 4TXSA 3SJJA 1RT5A 4DFMA 4C8NA 3KLGB 3IN5A 1T03A 4QOZB 5KT2A 4TYBA 3KKSA 5KFBA 1QHTA 4FJ9A 1LWFA 3MEGB 1J54A 4CJLA 3KLEB 3C6UB 2HHSA 1N48A 5FRNA 1RT6A 2D0CA 1CXQA 1S9FA 5KFUA 1L3UA 4MQ3A 3KK1A 5KG0A 4OVLA 3NH2A 4B3OB 3LP2A 4LH4A 3TABA 3VQ7A 4ZPBA 4ECTA 4BE2A 4J2EA 3QZ8A 2KFZA 4IR1A 1DLOA 4IDKB 3HL8A 4FZZA 3K58A 3G6VA 2F8EX 3V81B 4KV8A 1IKWB 1YVUA 5DQGA 4O3NA 2RN2A 3T1AA 3EZ5A 4QCLA 2RPIA 1D9DA 1R0AA 2RDJA 3L3UA 1J5OA 5D3GB 3V6HA 4ED2A 1BQNA 1N6QB 1LV5A 4LSLA 3VQ5A 5C42B 3KHRA 4DFJA 1LW0B 3MEEB 3FQLA 5HROA 3C94A 4R5PA 4E7KA 3S3OA 4TN2A 4CIFA 2FLPA 4ZP6A 4CK2A 1RT3B 1X9MA 2E6MA 2F8TA 2ATQA 3MR3A 3E01B 3ULDA 1BL3A 2HNYB 3TAEA 2HB5A 2C22A 3KNAA 4DQQA 1X9WA 4O3OA 1C1CB 4DTNA 1HYSB 4KO0A 1HQUB 3V9WA 3NF9A 4Q43A 1GOCA 3BGRA 3IRXA 4TY8B 5KG5A 4CJEA 3SPZA 3EZUA 5F8LA 4Z4GA 1BCOA 4TYAA 2JEGA 2RKIB 2Q3SA 4N41A 3RB4A 5SZTA 2G8VA 4HTUA 2OH2A 3CDEA 1C1BA 3KKRA 1BIZA 3SUQA 3CFOA 1ZBIA 1C6VA 4W5OA 1T05A 5I3UA 4KHWA 1SL2A 3MR2A 5J2NB 2D0AA 2BR0A 1SKSA 2HAIA 3ZSVA 5F8MA 5CY4A 3NGZA 3O4NA 4B9MA 3PX0A 4IG0B 1HPZB 1NK4A 3N6NA 3BSCA 4KHUA 2ASLA 3MEGA 3KLEA 1KLMB 3C6UA 1K1QA 1T7PA 3NGDA 3K5NA 4E7IA 3I5BA 4DTSA 1VRUA 2YHAA 4NLQA 1RT1B 4B3OA 2IC3B 2QK9A 1C0TB 3H5YA 3E51A 1REVB 1C2PA 4CFAA 4RW7B 3VQPA 1RYSA 3H5UA 4QWEA 3VQBA 4N56A 3V81A 4ID5B 1IKWA 1UA1A 3T5KA 2XY7A 5T7BA 2HWIA 1EXQA 4ZP9A 3PR4A 5D3GA 1JLCB 5C42A 3OSNA 3RR7A 1LW0A 4TQSA 1JLGB 1EETB 4RW6A 4ED3A 5C24B 3NAHA 4WZMA 3DRRB 1RT3A 1T8EA 2YNFB 2W9CB 1T3NA 3CWJA 1UA0A 3E01A 5F9LA 4O3PA 2HNYA 2D3UA 4FJ5A 4GC7A 1C1CA 1HYSA 1HQUA 2HW3A 4BDZA 3PX6A 4M42A 3F73A 3HP9A 4JUZA 1S1VB 1NK0A 4EYIB 4DL2A 2HHQA 2AGQA 4YMEA 2RKIA 2EC0A 3ZT1A 2KFNA 5FROA 1A5WA 4EZ9A 3OYDA 3KIOA 3HO1A 4NLXA 4EYHB 4RW4B 2X6SA 5EDWA 1NK9A 2VWKA 5J2NA 2ILZA 4AILC 2NUBA 4DU1A 3LDSA 4FCYA 2P51A 1QSYA 4F4ZA 2QXFA 4FK0A 3CJ3A 4EO8A 4HUEA 1HYZA 4IG0A 1HPZA 3DM2B 4WYWA 5KFIA 4ZPCA 5C5JA 3PW2A 4KI6A 4FLVA 2Z1IA 4DSLA 3K2PA 2Z1HA 3U6FA 4H8KA 1RTHB 1IM4A 3KHGA 1X1PA 4NRUA 3SFUA 4NLGA 2W7OA 4FJ8A 2IC3A 4KAIA 1C0TA 5DG9A 3RRGA 3JYTB 1REVA 4H4MB 3PO5A 4AHTA 3M8QB 4XPEA 4I2QB 1D9FA 3OL8A 2BE2B 4ICLB 2B6AB 3GIMA 4ID5A 5E41A 5KFOA 4ZTFA 2R8JA 5DK5A 1JLCA 3H4DA 3NFAA 4IRCA 1JLGA 4JV1A 1EETA 3G6XA 3AO5A 4C8OA 5C24A 2FBTA 3DRRA 4CJPA 2YNFA 4I9QA 2W9CA 1SH0A 4O3QA 5HRNA 2ZD1B 4EBDA 4I2PB 3GQCA 4Q8FA 4EZ6A 4F2SA 4ZHRB 1IKVB 3RB3A 4TQRA 3OLAA 3IS9B 1DTTB 1S1VA 3GIKA 4WE1B 3TVKA 4LY7A 1HNVB 2X74A 1NNDA 4ZPAA 1HQEB 3KK3B 2FBYA 2W9BB 3CG7A 1Q9XA 3P5JA 4E3SA 2IA6A 2HNZB 4B9UA 1FK9B 3L2WA 2OYQA 2HHVA 4BDPA 5KRSA 5DGAA 1TL1B 4C8MA 3RB0A 2UVWA 2B43A 1F21A 4NYNA 3WNFA 1IG9A 4F8RA 4OJRA 1JLQB 4B9TA 4HCCA 1TQLA 4PQUB 1VK0A 1KRPA 2R7YA 3DM2A 3LWMA 2JLEA 5KTQA 4DTOA 1HNIB 2AGOA 1RTHA 2YNHB 3L2UA 1ZBFA 4F50A 3OYNA 3DLRA 3QLHB 1KFDA 5KT3A 3JYTA 1RILA 4R8UA 4H4MA 1QUVA 1QAJA 3OYEA 3M8QA 1VSFA 4I2QA 1O1WA 2UUTA 4ECRA 3K5LA 4HKQA 2BE2A 4FJNA 2W8LA 2B6AA 4ICLA 3G0ZA 1RBUA 3MF5A 3LP3A 1W25A 5DLFA 2FC0A 3H40A 3RAXA 1CZ9A 4FLWA 4KB1A 4YQWA 4HUFA 4DQRA 4KI4A 3LZIA 3HVRA 3PW5A 3GIIA 2XI3A 3FFIB 2GUIA 3AO2A 4KB0A 4DTJA 3THVA 1SV5B 3D5MA 4K50A 2ZD1A 2Z1JA 4KB7A 4I2PA 4GVMA 1NKBA 4CJ3A 4ZHRA 1IKVA 4OPJA 1WNEA 1KVCA 1RDBA 3IS9A 3RMCA 1DTTA 4ECWA 3WNGA 1A5XA 1TV6B 5KFCA 1HMVB 5L9XA 4WE1A 1XHZA 1HNVA 3QNOA 3FQKA 1HQEA 3KK3A 4MK9A 4Z0UA 2W9BA 2DPIA 4FM1A 4ELTA 2HNZA 4QWAA 1WSEA 4IFYB 2OZSA 1FK9A 3HPHA 4OLBA 4O5BA 4Y3CA 1IH7A 1TL1A 4CHNA 3ZSOA 1JLQA 2D41A 3HPOA 2W9AA 1UOCA 3AVHA 2XY8A 4LH5A 3ICLA 3C6TB 4ZTJA 3LP2B 1CLQA 4IBNA 1HNIA 3AVCA 1S48A 4FLUA 3BSOA 5SWMA 5FRMA 2YNHA 4H4OB 3CJ0A 5KFXA 3OHBA 3T3FA 2G8UA 3DDKA 3QLHA 3LANA 2KW4A 1QTMA 1R0AB 3SQ1A 4G3IA 3G86A 5KT7A 2HWHA 1NOYA 3I0RB 3NBPB 2XHBA 3ZT4A 4CEEA 4ED1A 4CJSA 2B5JB 3LP1B 5KFGA 4OPKA 1RDAA 4J9SA 1YTAA 4F3OA 3OYHA 2AGPA 4ECSA 3Q8PB 1RBTA 3UIQA 4ZVGA 4R0EA 5KI6A 4AHRA 2FJXA 3BSNA 4E7HA 1JIHA 1TVRB 4O55A 2V9WA 1RDCA 2LSNA 3IRXB 4Z4EA 1X9SA 2OPRB 2OPPB 4CHYA 1ZTTA 4CEFA 5KG3A 3MR5A 1XWLA 1RTJB 1UWBB 1TK5A 3NF6A 1U45A 4CEQA 4CEDA 3TAGA 3DRSB 2R8KA 4CGJA 3KJVB 1RDRA 1HRHA 3SQ2A 3HM9A 1TV6A 3NAEA 1S10A 1HMVA 2WHOA 2CKWA 1Z26A 3SQ4A 4FBTA 1S0NA 3OHAA 1TKTA 3VQ8A 4DU3A 3Q8QB 4KFBB 3HJFA 1LW2B 3ZT2A 3OLBA 4RUCA 3OYGA 4J9KA 4CJVA 4IFYA 4FJ7A 3DI6B 3DOKB 3H98A 4DWIA 2IS3A 1ZYQA 4CFDA 4OGEA 3VQSA 1S6PA 3Q8RB 3PUFA 2IM3A 2FVQA 4Y2AA 4K8XA 1VRUB 1S6QB 3C6TA 4I7FB 1EP4B 1WLJA 2VG6B 3L2VA 4KHYA 4MK7A 4F4KA 1RT7B 1JXBA 1ITGA 1YT3A 3AO3A 5CZ1A 4H4OA 3ZCMA 2RF2B 3MXMA 1SL1A 2YNGB 4NLUA 1ZTWA 1S9GB 2E9RX 3TQ1A 1HARA 5F8HA 3OL6A 4CF9A 4ELVA 3L3VA 1TAQA 3F9KA 4IKFA 4F4XA 3I0RA 3CDUA 3NBPA 3QEXA 4FJKA 3CDWA 4W5NA 4RW6B 2IM1A 3LZJA 3SUNA 5CYMB 1NKEA 1NK6A 2B5JA 3LP1A 4OLAA 3ISND 2FLLA 3MTKA 3NCIA 4K4WA 2JEIA 4RZRA 5KFSA 3VQCA 3QEPA 3QO9A 3NHGA 3GILA 1TVRA 3VQAA 3SZ2A 3EPIA 2QKBA 3OJUA 2VG5B 3RBEA 4FM2A 2FBXA 2OPRA 2OPPA 1NK5A 3V6DB 1S9EB 1RTJA 1UWBA 2XGQA 1W9HA 3PX4A 3NDKA 2O4GA 4BACA 1GX6A 2ITGA 3RMBA 3OYJA 4FS1A 5KFWA 3DRSA 4BWMA 3KJVA 4NRTA 4MIBA 4CJ5A 5KFHA 3OL9A 4KFBA 4J9QA 1LW2A 3AVKA 3M8PA 3V6JA 4BWJA 3NKYA 1RA7A 3RMAA 4CHOA 3CFPA 4QW9A 2GIRA 3OYAA 1SUQB 4FZYA 3TARA 3DI6A 3DOKA 2AQ4A 3T19A 2DTUA 3KHLA 1L3TA 4DFPA 4B9VA 2A1SA 1YVFA 1TK0A 1S6QA 1S1WB 4I7FA 1EP4A 4CHQA 3HHKA 3PJWA 4IRKA 2VG6A 3ZSWA 3V4IB 3NAIA 2V0NA 1RT7A 2ETJA 3QERA 4ECXA 4O4GB 4FBUA 4FK4A 4RNHA 4F3TA 5K14A 4DSFA 2RF2A 4LD0A 1JLEB 2YNGA 5KGWA 4DQSA 4OL8A 3TI0A 4RNFA 3M9MB 4Z4FA 1QS4A 2XCAA 2WTFA 4DQIA 1S9GA 1ZETA 4CGIA 2ALZA 4LQ3A 5KGXA 3VQDA 2XY6A 4RW9B 1D0EA 2R2SA 2FVSA 3MECB 5L1IA 4AHCA 1QSLA 1A5VA 5CYMA 3HK2A 4CEBA 4Z4IA 3PR5B 4N47A 4E19A 3RAQA 3V1OA 3C95A 3O3GA 3NE6A 2D7SA 3ISNC 3KMSA 3BREA 5DQIA 3NH0A 4PA1A 1T94A 5JXSA 4ELUA 1CSJA 3VQ9A 4CF2A 1QSSA 1XR5A 1SKWA 2VG5A 2AX1A 2R2UA 3V6DA 4ECVA 2W8KA 1S9EA 4XPCA 3KLFA 1VSKA 4CGGA 3Q8SB 4FW1A 4NYFA 1LWEA 2YKMA 3KLVA 1NOZA 4ECYA 2P5OA 4NLVA 1JKHB 3K5MA 3VQ4A 3N6LA 1B9FA 3ZSZA 3KMQA 2XGPA 1B92A 3CVKA 2X6NA 5KFVA 4O3RA 2JGUA 2UVRA 3BQ0A 4B8AB 2JEFA 4KE5A 3H59A 3KHHA 1SUQA 4M95A 5KG6A 3TAMB 3FRZA 3CJ5A 1N56A 3DLHA 1FXXA 4CJQA 4DTRA 2ASJA 3ITHB 1Z25A 1TP7A 1S1WA 1W0HA 4XIUA 3VQ6A 4U7CA 3V4IA 2OPQB 3EYZA 3CJ2A 1S4FA 5J2MB 4R8UB 4OKEA 3HVAA 4O44B 2HMIB 4O4GA 4ZVFA 3OYKA 4CEOA 4WXWA 1JLEA 4NLRA 3L8BA 1JX4A 3SUPA 2D5RA 2RDIA 4CF0A 3PO4A 2R2RA 5J1EB 4DL4A 2WOMB 4RW9A 4CHPA 3FSIA 2ZKUA 1WAJA 4W5QA 3SQ0A 1JL1A 1S1TB 2BANB 1QQCA 3D28A 5KFEA 2BQRA 1BCMA 3MECA 3CQ8A 2ASDA 3HT3A 2HVIA 4NLTA 3UQSA 1I39A 4EBCA 4QWBA 1S1UB 2B4JA 5DQHA 4KHRA 4AHUA 1BI4B 5KRTA 3H2LA 1RCHA 3BR9A 2OPSA 3G6YA 1Y97A 3KTQA 1NJZA 4KKOB 1RAJA 3O3FA 3S3NA 4CCHA 5EWGA 5F8IA 1L5UA 1KLNA 4KTWA 3B6PA 4IOBA 2WK4A 3GV8B 2I5JB 4URSA 4I9LA 4CGHA 1XR6A 2BRKA 3VA0A 3DOLB 1VSIA 3TWHA 2HHTA 3QEWA 4CECA 5KG1A 4DSIA 1JKHA 4M3ZA 4IFVB 5KFMA 5DMRA 1IKXB 4M3UA 5C25B 2BQ3A 5EUHA 4X2BA 4Q0BB 3CM5A 2C2RA 3V1RA 5HP1B 3ZT3A 3BQ1A 1D1UA 2UUWA 3SI8A 1WSIA 3M8SA 4AHVA 3TAMA 3MFIA 3V9ZA 3KOAA 1NK8A 1BGXT 1GOBA 1LWCB 3QGIA 4NZ0A 3ITHA 3ALYA 2WCXA 4CFCA 3MXIA 1S97A 1SKRA 3AA3A 2OPQA 4ZVEA 3DLGB 5J2MA 2IOCA 4O44A 2HMIA 1TKXB 1LAVA 4HHTA 1SH2A 1TKDA 4ED0A 5J2QB 2R8HA 3EY1A 1BIUA 4J2DA 4RG8A 5KFDA 4MKAA 3AA2A 4W5RA 4CFBA 5J1EA 2IAJB 3QYYA 2YV0X 3RTVA 2WOMA 3LPUA 1S1TA 2BANA 2WONB 1U4BA 3AVJA 3AO4A 2IJNA 2ZE2B 1RNHA 2FVRA 3HVTB 1S49A 5DG7A 1JXEA 5I42A 3RR8A 1TAUA 1S1UA 3V1QA 3VQQA 1BI4A 3K59A 1GOAA 3GV7B 4KKOA 4NCGB 1TKZB 2IJFA 3SV4A 4E7JA 1Q8IA 1FKOB 3QGGA 5KG2A 3K57A 4IG3B 5KFJA 4CJRA 1TKTB 3VQEA 4CF1A 5L1JA 3FDSA 2I5JA 4CHZA 3DOLA 1DTQA 4OKJA 4LQ9A 4NLWA 1RBRA 2WRMA 3AO1A 2R8GA 1EX4A 2IDOA 1WN7A 4IFVA 1S6PB 3AVLA 3OYFA 1IKXA 4FZXC 3ZT0A 3DRPB 4KREA 4NLDA 2IM0A 2HVHA 5C25A 3CJ4A 3SPYA 3TAPA 1BHLA 4E0DA 2O5DA 4K4SA 3NGYA 1C0UB 4Q0BA 4QW8A 4E1NA 4DL6A 3KLHA 1K6YA 1S5JA 3GV5B 2PYLA 3DYAB 5HP1A 3T5HA 2IMWP 3IG1B 4J2BA 4ED8A 3SNNA 1LWCA 4F2RA 2J6UA 1IKYB 5F8JA 4GMJB 1J53A 3ASMA 3OY9A 4PWDA 2P1JA 4KRFA 2ATLA 4EP4A 4ZP8A 3DLGA 3KLIB 3LP0B 4G1QB 3HVWA 1TKXA 3AV9A 3QGHA 1KSPA 3UDLA 2C2DA 1VSLA 5J2QA 4GC6A 4FM0A 4FJMA 2FBVA 2IAJA 3KD5E 1FKPB 5EWEA 2G8WA 1KFSA 3QO9B 2WONA 4JV0A 1NJXA 1ASVA 1B9DA 4WFZA 3G10A 4J9RA 2VWJA 2Y1JA 2ZE2A 3L2RA 4HVJA 3MEDB 3HVTA 2XWYA 5KFQA 3NH1A 1WSFA 3I8DA 3ZSQA 1EKEA 2FJWA 3KD1E 1KHVA 3H08A 2BQUA 5DG8A 3S3MA 1D5AA 2UVUA 4NCGA 4B08A 2FVCA 4DTUA 1TKZA 1VSMA 3BSAA 1FKOA 4IG3A 1ZBHA 4KSEB 2ZQBA 4CJWA 3UPFA 2PY5A 3M8PB 3HPGA 2GC8A 3CFRA 4MK8A 3VA3A 2F96A 4IRDA 5KFLA 1WSJA 4M3XA 4CE9A 1I3AA 4PUOB 4IR9A 3U3YA 4J9MA 3MR6A 5KFYA 4M3WA 3DRPA 3LPTA 3V9XA 4XO0A 3SYZA 1C0UA 2GV9A 4WXOA 3DYAA 1GX5A 2J6SA 2HHWA 4Q44A 4CK3A 1NJYA 4E89A 3IG1A 2E6LA 5K14B 3IGNA 3CYMA 3TAQA 5EU7A 4E1MA 1IKYA 4JLHA 4KHQA 1TK8A 3AA4A 2G8HA 3H5SA 4ECQA 3QIPB 3KLIA 5KG4A 3LP0A 4G1QA 1KVAA 4UQGA 1NJWA 5KFZA 3WNHA 4ZVHA 1BQMA 4M3RA 4O3SA 1NKCA 4C8KA 4DTXA 2EHGA 5KFTA 3BQ2A 1FKPA 1RDDA 4ZPDA 3WNEA 4K4VA 4FJJA 4DTPA 3M8RA 3SV3A 2R2TA 5KFNA 4Q5VA 2G8IA 4JS4A 3MEDA 1RTIB 1WAFA 3SFGA 1OS5A 2E9TA 2AJQA 3I5AA 4KTQA 2GIQA 3KLFB 3KK2B 3PV8A 4CGDA 1U09A 3QIDA 4Y1CA 1D8YA 2ILYA 4EBEA 3OS1A 1LWEB 4NLSA 3EPGA 3HP6A 1N4LA 2A1RA 2YKMB 5KFRA 4ECZA 2DY4A 1XI1A 3I5CA 4CERA 4CIGA 3AVBA 4YNQA 4IKAA 3P1GA 2HHUA 4WZQA 3OSPA 1HJRA 1ASWA 4JRPA 2HHXA 1ZBUA 4DU4A 3AVNA 4PUOA 1QE1A 4IH7A 1S0OA 3DMJB 4K8ZA 2KZZA 3BDPA 4M3TA 5JS1A 1N5YB 4ECUA 1KHWA 2OZMA 3OYLA 1SL0A 3PHEA 1KCFA 3S9HA 3KLGA 1VRTB 2DFEA 4CESA 4H54A 4DFKA 3U3GA 1VSJA 2Z1GA 3T5LA 3SUOA 4EEYA 1SH3A 4E7LA 3IAYA 4O4RA 3OL7A 3LAMA 4CK1A 3O3HA 3AVGA 2VA3A 4KHSA 5F9NA 4FS2A 2CJQA 3QIPA 3H4BA 4URQU 3VN5A 3MAQA 5HRSA 4IDKA 4AHSA 4DSKA 4YR3A 3AVMA 3OYCA 4B8CA 4MH8A 4LSNB 2WB4A 3BJYA 5CZ2A 2XY5A 2AX0A 4Y2CA 2DPJA 1JLAB 1C0MA 4FLTA 1N6QA 2OPSB 4Y1DA 5HRRA 4NCBA 4CJFA 1RBSA 3MEEA 4QWCA 4DSJA 3AVAA 4J9OA 4FLXA 1RTIA 2QV6A 3UR0A 2E4LA 4K4YA 1TGOA 4K4XA 3KK2A 2VA2A 2IM2A 4K4ZA 4NYZA 4RU9A 4N5SA 2BDPA 4L8RB 4RNMA 1S0MA 4TY8A 4WFXA 4BE0A 4DF4A 1RT4B 4ED7A 4Q45A 2UVVA 4TY9A 1IO2A 1L3SA 1QAIA 4HUGA 3GYNA 4CF8A 2BGGA 4URGA 3LAKA 3DMJA 4NLPA 4FJLA 1N5YA 3GIJA 1RBVA 4CGFA 4DL7A 4O0IA 4J9LA 2KQ2A 3RWUA 4WFYA 1VRTA 2W42A 4F4WA 4DG1B 2XI2A 2DFFA 4KPYA 1NHVA 4QPXA 2F8SA 2I1RA 1LAWA 3ZSYA 1VSEA 3DLKB 2PYJA 4IH5A 4MKBA 2G8FA 3TR8A 2OA8A 3HKWA 1KLMA 5DLGA 4YFUA 3NL0A 4CJTA 5KG7A 5HLFB 4DLGA 1RYRA 5KT5A 1RT1A 4U6PA 2FVPA 3HXMA 3DLEB 4DS4A 3M9OB 5F8GA 3AVFA 4O0JA 1S1XB 2EX3A 4RW7A 1UAXA 4RNNA 5DGBA 4PY5A 5I42B 1NK7A 4LSNA 4HYKA 4M45A 3RMDA 1JLAA 5T14A 5KFAA 1WSHA 2GBZA 1RT2B 3A2FA 4Y34A 4CJKA 3QEVA 2QKKA 4ID1A 3AA5X 4NCAA 4FK2A 4MFBB 2D3ZA 1C1AA 4FYDA 3OS0A 2X78A 2AU0A 2PZSA 4N76A 1DTQB 4K4TA 3HYFA 4ZP7A 3TAFA 1KVBA 1RT4A 5J2PB 3OYBA 4Z4HA 3B6OA 4Z4CA 1TL3B 5HBMB 2YHBA 3KLHB 3RRHA 2YKNB 5CYQB 4M41A 4RW4A 4IQXA 3ZSXA 3MFHA 3LALA 3O4QA 4GW6A 4CEZA 3T5JA 1VSDA 2XRIA 4HCBA 4KHNA 1VSHA 4DG1A 3HSTB 2V4QA 3IGVA 3QNNA 1MU2B 1RA6A 2D0BA 4CIEA 4PWDB 3DLKA 1XC9A 4M3YA 1XHXA 2C28A 1Q9YA 4KBIA 1JLFB 4FW2A 3K5OA 5KFPA 5HLFA 4ED6A 1CXUA 1ZBLA 3PW0A 3QETA 2G8KA 3D45A 4DQPA 2Y1IA 4FJXA 4FVMA 1I6JA 4J9NA 2J6TA 3DLEA 3SI6A 5KFFA 2DFHA 1S1XA 2V4RA 4K4UA 3MXJA 4QAGA 3V9UA 4EP5A 3JSMB 5KT4A 1JXLA 2E9ZA 4FJIA 4JS5A 5FDLB 4KTZA 3CM6A 2IGIA 1XR7A 3NMAA 1RTDB 4BDYA 1RT2A 3QEIA 2W7PA 2O4IA 3OJSA 3PW7A 2HNDB 1JLBB 1BISA 4RW8B 4DLEA 2YNIB 4MFBA 3RBDA 5F8NA 4DTMA 2XO7A 1L3VA 4YR0A 1U47A 2XCPA 3PZPA 5KT6A 3OYMA 4FXDA 4DS5A 5L1KA 4J9PA 4TSXA 2VG7B 4RNOA 4AH9A 3I0SB 1U48A 1YTUA 5J2PA 1MMLA 1Z4UA 2IBKA 3H5XA 4B9NA 1RT5B 2JEJA 3V6KA 4OKKA 1TL3A 3PW4A 4B9SA 5HBMA 1T03B 4YP3A 2YKNA 5CYQA 4DF8A 2AWZA 3M9NB 4W5TA 3PY8A 4NLOA 1JL2A 4FLYA 1LWFB 3QZ7A 3QIOA 1RT6B 4WYLA 3NGIA 4PQUA 4MIAA 3PVXA 4DL3A 1MU2A 3KK1B 4CJUA 5KFKA 4B9LA 4J2AA 4RUAA 3CIZA 4OGCA 4JRQA 1DLOB 1JLFA 2FJVA 3TANA 2XC9A 1BQMB 1WSGA 3OVNA 4FJHA 2JC1A 5EWFA 5JUMA 4Q8EA 1ASUA 4KV8B 3ZSRA 1J9AA 5HRPA 3L2QA 4NLYA 1J5OB 4DSEA 1NHUA 1WNSA 4TLRA 1BQNB 4LSLB 3LWLA 4ZMMA 2KTQA 2P5GA 3JSMA 4DMNA 1K1SA 5HROB 5FDLA 2BRLA 1KTQA 4R5PB 3CO9A 4CJ4A 4BE1A 2FLNA 2C2EA 1CZBA 2R8IA 1G15A 3P83D 4YR2A 1RTDA
chains in the Genus database with same CATH superfamily
4DHYA 2CZ4A 3RBZA 1JLBA 5CD4H 3PCOB 3NF7A 1HNZJ 5AQJA 3FZKA 4KHMA 1V6HA 3D0PA 1Z1ZA 2M52A 2YNIA 4CDIA 3I4HX 3QDKA 2GAHC 3OS2A 4DL5A 1KBRA 2PSZA 2RRAA 1FJGK 3OYIA 2Y1RI 2BVZA 2JC0A 5HQ8A 3V9SA 2MGZB 2KG1A 1WBDA 1C1BB 3TEHB 1U49A 3I0SA 3FE1A 4DEZA 1U04A 3RVCA 3MHYA 1FDBA 3VAKA 2EFVA 3ZZ0A 1ZBSA 4C8NA 3KLGB 2NZCA 3IN5A 3M1VB 1VBXA 4QOZB 2VB6A 3QATA 2E1ZA 4RBTA 2ZZNA 4F25A 5KT2A 4OYXA 5ADZA 5KFBA 4N8OA 4FJ9A 1RHQB 3HDSA 4F67A 3EZWA 2ZEJA 3MEGB 4CJLA 3KLEB 1N48A 1FESA 3SSSA 4CZFA 4MQ3A 5KG0A 4OVLA 3NH2A 4WK1A 3FGUA 2P9NB 4BE2A 1P1TA 3K58A 4I6AA 2UUAK 1Q8LA 4K25A 2RPIA 1D9DA 3VTIA 3PKMA 3H1QA 5D3GB 3Q7BA 1BQNA 3VQ5A 2RQMA 1U6ZA 5C42B 3QRQA 1HQ2A 4TKTA 1LW0B 3MEEB 3FQLA 1NGCA 2RUGA 3S3OA 2UXCF 3D9BA 1VCTA 4ZCKA 4QR1A 3QFHA 1M1HA 2C22A 4O3OA 1C1CB 4DTNA 2A0FB 2DGTA 4KO0A 3V9WA 2XQCA 3BGRA 3G8SA 4CI0B 5AQWA 2MSTA 1APSA 3KG1A 4CJEA 5F8LA 4DV2K 1Q78A 4C3LA 2GZOA 1VQPN 4X4QA 3CJ8A 4LF2A 3M8WA 5A8KA 4TYAA 2KVQE 4N41A 3RB4A 1NJIO 4HTUA 3CDEA 1YHQN 5G0RA 4B17A 3WXIA 4BC3A 4BR4A 4W5OA 5I3UA 1FRLA 2DGSA 5AXKA 5JICA 1BQXA 1PJ7A 4QS7A 3ZSVA 3GPAA 3NGZA 1PC4A 1SJQA 3PX0A 4DV4K 3ZTPA 4IG0B 4U9RA 4BVOA 5IT4A 2VFVA 3BSCA 1TUWA 4KHUA 4ZPTR 4RUHA 2FHKA 1KLMB 3K9KA 4E7IA 3W9IA 2YHAA 1GXUA 1YJ9N 4NLQA 2AF6A 4F4AA 2K8GA 1C0TB 2C2MB 5E3CA 4V19S 3M7VA 4ISGA 4LSZB 2D4WA 3SK3A 1RYSA 1TELA 1CPZA 2E1RA 2EC2A 1IKWA 1QAXA 1UWAA 2R42A 3VAMA 3S1TA 3OSNA 4WZMA 4NZ6A 4OHYA 2KVIA 4HR2A 1RT3A 1T8EA 4NEYA 2YNFB 1GLBG 1T3NA 4O3PA 4OZ0A 1NGFA 4GC7A 5CR4A 5BPMA 1HQUA 4AT1B 2QEXN 4BDZA 2YH1A 4M42A 4LFAF 1RLCL 3S41A 1S1VB 3NXZA 1F9EB 4ZVQB 1X4CA 2RKIA 2BOPA 2IMOA 1AFIA 2QMUB 4EZ9A 3M2VA 4NLXA 4EYHB 2KFYA 2X6SA 1DHMA 1YJUA 5J2NA 3FSYA 2NUBA 5E3PA 3VQTA 2PMHA 4I6MA 5AQNA 2RS2A 4E98A 5J1NA 1RWVB 2DNNA 1HPZA 4JI7K 2P9UA 4ZPCA 2QJ3A 3MCMA 4FLVA 2V51B 1G3OA 1RTHB 3KHGA 1FXDA 2HFUA 3R3TA 1EQYA 4NXNK 5DG9A 3U4LA 4NO7A 1REVA 5CCMA 3JAMY 3PO5A 4QYZJ 3A8JA 2P9KA 3VEYA 4I2QB 2Z2ZA 4DCJB 3H46O 4HTLA 2L08A 2BE2B 4ICLB 4ID5A 2V94A 1QVFM 4ZVRB 2Z2LA 3GBTA 2HBJA 1JLCA 1DKGD 1RAOA 3NFAA 3HX9A 1S79A 2DH7A 3P6YC 1JLGA 1EETA 3G6XA 3AO5A 2FBTA 2DR7A 5IWAJ 4CJPA 4DDFA 2HVZA 3GL1A 3ET6B 2W9CA 2A41A 4JN4A 4O3QA 5HMYA 4LVNP 5AXNA 2E29A 2GVDA 2DITA 2OCEA 1RHMB 4C11B 2UU9F 3GQCA 2QWOA 4I0WA 2CQBA 1FERA 4FWRA 1GMWA 2NXJA 4ZPAA 1HQEB 2KB2A 1Q9XA 1AROP 4EIAA 2OSQA 1XNQF 2OTJS 2D74B 2LEPA 4DR2K 3W5ZA 3L2WA 2OYQA 1UCNA 3RB0A 2UVWA 3WX4A 2IRYA 1JLQB 4RBVA 1CULB 1FE0A 1TQLA 4OZ1A 1VK0A 2Q31A 4A8MP 3K9JA 3DM2A 4DTOA 3PIPQ 4BRQA 4DPXA 2P9LA 2L41A 3WEEB 2AGOA 4O8UA 4P9SA 2YNHB 1FWLA 1O0PA 1HKAA 3OYNA 4AM6A 2VFUA 4FNIA 2W4PA 2CDQA 3R5CA 4H4MA 5A8RB 3OYEA 2NUHA 3C6HA 5H9FJ 3K5LA 4M7XA 4FJNA 3FZFA 2B6AA 5B0CA 1W25A 5DLFA 5BR8J 1ZA1B 4OV1A 2ZITA 3BB5A 3RAXA 1KD1T 2BUPA 3MZIA 1IVZA 2B7BB 3BGUA 4DQRA 4KI4A 1RABB 3ENQA 3THXA 1H38A 3O44A 2VBZA 4KB0A 2ZWHA 1JCEA 3THVA 1GXTA 1MWYA 3AA9A 2ZD1A 4AD6A 2OD6A 2UV8A 1U0HB 4C97A 2W24A 4P6QA 2OI2A 2JLGA 1WNEA 1KVCA 3IS9A 3WNGA 3OHRA 4B3SK 2O8DA 1A5XA 2V34A 1WKLA 1I3OB 4Z0UA 2YWGA 2W9BA 1HJOA 4OPHA 3CIPA 2EPIA 1ZA2B 2HNZA 1M0SA 1RAAB 4OLBA 1FK9A 4XDDA 1AW0A 2A1BA 1YG0A 3CI5A 3ZSOA 2CVEA 3ICLA 3C6TB 2OP5A 5LM7E 1HNIA 1H1VA 2CH6A 3L9ZA 2GJFA 3DGVA 1SIWB 1VQOS 5EGYA 3MM5A 3DDKA 1SC6A 3LANA 2FJAB 2YXLA 1XERA 1R0AB 4PXDA 2ZH1A 2VOPA 1K8AO 3IA0A 4DBQA 3I6PA 2HQIA 2P2CB 3D1HA 5AZJB 1D09B 5AJ3K 4OLPA 2PD1A 1XMBA 2B5JB 2H9ZA 1BWEA 4OPKA 4Y6IA 1YTAA 4F3OA 2W25A 4P2XA 2WC9A 3Q8PB 2BJ7A 3BF1A 4ZVGA 3EWGA 4YB1P 4JAXA 2PC6A 3RJMB 1JIHA 4ZLNA 4WF9Q 5GADP 2JWLA 2LSNA 2EWHA 2OPPB 5L9NA 2XNQA 1XWLA 1UWBB 4WKRA 3R1LA 3CCZA 1U45A 2M7SA 4CEQA 4BLGA 1TV6A 3NAEA 1S10A 1HBUB 4F2RA 4FBTA 4DU3A 4PQAA 4M5JA 1LW2B 5BN9A 2NLWA 2H4WB 3N5FA 4RUCA 3AD7C 4DUZF 3MMBB 4IFYA 4CJVA 3H98A 3WBZA 1ZYQA 4JYAF 3IAM9 4RWTA 3PUFA 2IM3A 4IFEA 3G25A 4WP3A 1WLJA 1EP4B 3PTWA 2I7NA 3L2VA 4BREA 2C2NA 3EJMA 5MAOA 4LRBA 1RT7B 3H3NO 1M1GA 1YT3A 4M5IA 3I55N 4IO9Q 1BLUA 3DXMA 5AXMA 4H4OA 3FRYA 1SL1A 5ETSA 4DV3F 3TW0A 1ZTWA 1HARA 4ELVA 1W2BM 3F9KA 3K7RA 3VVUA 4H0TB 3B78A 3CDUA 1D8ZA 5GADU 2AEFA 3QEXA 4FJKA 1QVFR 4RW6B 2IM1A 3ZXWA 3IUCA 3MTKA 4K4WA 1T11A 2LMIA 3VQCA 2M9KA 1TVRA 3K0SA 1WB9A 4Y0FA 2QKBA 3OJUA 1WUAA 4CYUB 5A2QY 5AQRA 3JXOA 1NK5A 4K0KF 2U1AA 2VBXA 3NDKA 2F63A 2VOOA 3E3XA 3WXKA 3RMBA 3VEOA 4OQJA 2ADCA 1U1PA 5C2CA 3KJVA 5ETPA 4DR7F 4MIBA 3OR1B 3H0PA 4ANDA 3V6JA 2RVJA 1RA7A 2XLIA 5HSPA 4NMXA 2KRRA 1HNZK 1TL4A 2GIRA 3UKRA 3TARA 4YUDA 3DOKA 1ZAXA 4PHTX 2NYIA 1RAGB 2FUG9 4C8YA 3IWNC 5ETMA 3DLLL 2IVOA 1NGEA 1MW7A 3HT0A 4DFPA 2E2PA 3PYDA 2IRXA 5CQGA 1TK0A 4BGBA 5CZXA 4CHQA 3NS6A 3PJWA 3WUHA 3ZSWA 3D54A 1HWJA 3LTOA 4IJAA 3IMXA 1HA1A 4DR6K 4YDDB 3KNGA 1JLEB 1Q8KA 4A5AA 2ABYA 2MKHA 4RNFA 3M9MB 1IXKA 1ZETA 4IOAQ 2BKPA 1M5VC 2NQPA 2XY6A 3T6BA 1HHQA 4BR5A 3DNCA 3TUPA 5C2GA 4AHCA 4B1WB 1Q82T 1PCAA 2UUBJ 3O3GA 3NE6A 2D7SA 1EZZB 2BBEA 2NRWA 5DQIA 5JXSA 1WWHA 2QWPA 3VQ9A 1CS4A 4GV9A 2VG5A 2R2UA 3M32B 3V6DA 2O8EA 2W8KA 3D7SB 1Q5YA 1S9EA 2RQCA 3KVGA 4A2BA 2G0IA 3BGLA 3CPEA 1U2VA 5ETKA 1NGBA 3KLFA 1NGIA 3RU0A 1I94J 2N7CA 3VVTA 4NYFA 2YKMA 1GLEG 3CJ1A 1NOZA 1MN9A 2L48A 1UFWA 4NLVA 1NGDA 3ZSZA 2VV5A 4Y2MA 1PO6A 4F0KA 1VR6A 1P27B 5KFVA 4JKAA 2XMUA 2VC0A 2UVRA 3QFPA 4C7QA 2MSSA 1SUQA 3EGWB 3RSEA 5KG6A 3QSYB 4TU8A 3TAMB 3MM9B 4CVNE 1H74A 3H2UB 4DTRA 1TP7A 2VDHA 1KNZA 4QOTA 4ZVSB 1OH7A 3ZZTA 2R7VA 3S01A 3K8VA 1MG7A 1YRUA 1CLFA 2OANA 4LF5K 3BEGB 4YOUA 2J8SA 4W90B 4JI1F 3C46A 4DL4A 4JK8A 3R1XA 4FVUA 4UUXA 2WOMB 2ZKUA 1S1TB 2BANB 2BQRA 3NGUA 2FYXA 2CGKA 4ZJOA 3US5A 4NLTA 3AJ2A 3ENAA 4KHRA 1BI4B 4FXVA 5BJRA 3HRGA 3F9MA 2OPSA 1Y97A 1NJZA 1S3XA 2M2BA 2A6AA 3S3NA 4UY8O 1JB0C 4MLHA 1W2IA 5F8IA 4KTWA 3B6PA 2KJWA 3HTVA 3CJRA 2XSFA 1XK8A 2HQ3A 2WK4A 2C3PA 3C7NB 4O5FA 2I5JB 4I9LA 2GVZB 1HFEL 2BRKA 2EI5A 3AD9C 3B4MA 3GJTB 3TWHA 4CZKA 1K8KA 1DGKN 2LQ9A 1W7AA 4DSIA 2F4VF 3MOZA 5HVHA 1JKHA 1CJUB 1HBOB 2QYGA 1EQ0A 4JKHA 5KFMA 1NO8A 4GVEA 4M3UA 3FZ2A 4KR0B 2BQ3A 2MQMA 2C2RA 3TSUA 2UUWA 3KOAA 2XMTA 4JK7A 3G71S 4YB5A 1GOBA 3O3LA 3QGIA 3X1LB 1K73T 4M63A 3ALYA 4CJ7A 3MXIA 4IEIA 1SKRA 2AJ0A 4ZKAA 3AA3A 5KOXA 2OIHA 1GFWB 4O44A 4IZ9A 2MZ1A 2B4UA 4NA2A 3VALA 4HHTA 1SH2A 3R9PA 7FD1A 2QA1A 4OMFG 2R8HA 1BIUA 2ASOA 4CI6A 5J1EA 3T1YF 2MHEA 4Z37A 3BY5A 3LPUA 2VFRA 2IVYA 1YBUA 4X65F 2ZE2B 4IDHA 5DZ7A 2NRTA 4K7QA 5I42A 3RR8A 2XO6A 3V1QA 1LEOA 1IBCB 4DI6A 5LMNJ 2HG4A 4PG8A 3LM9A 4CLKA 2A42A 4QYZK 4KKOA 4V19J 5GMEA 2G1DA 3SV4A 4JK9A 3K57A 1FKOB 4MO4A 3JQKA 4IG3B 5CAAA 2KYXA 5KFJA 1TKTB 4J5OA 3VQEA 5D0RA 2LXUA 2M3DA 2QO3A 1FI4A 2P9IA 3DOLA 4WFAQ 5E2QA 2BW7A 1Q1KA 2W4CA 1SC1B 5IWAK 3AO1A 5SUHA 1U6BA 1S6PB 1U1OA 2AJFE 3OYFA 3Q83A 1IKXA 3CJSA 4KREA 2IM0A 4YN3B 3BR8A 4QW8A 2OTJN 2L3MA 3DYAB 2B9WA 5E5NA 2DYAA 3VAFA 4WF9L 3H20A 2J0XA 1T3VA 4J2BA 4ED8A 3SNNA 3OR2A 1WC3A 1CJVA 1U0SA 3K8WA 4MIWA 1NB2A 2M4MA 2X1BA 4GMJB 1S5ZA 4B3TK 2P1JA 3LDLA 2ATLA 3QJLA 4HI1A 3T9ZA 4G1QB 3LDPA 2ZZTA 3ZX2A 4LBPA 2YWFA 1N33J 4JOUA 1VSLA 4LBHA 3M8ZA 4FJMA 1K9MO 2IAJA 3VZHA 5EWEA 1PYSB 4JV0A 1B9DA 3B8HA 3TSPA 3MM6B 4J9RA 4YHHJ 3HVTA 3L4QA 2DR6A 1EKEA 5ETOA 4USTA 5DG8A 4G9ZA 4CLPA 1RU1A 3ELHA 3LDOA 4NCGA 4DX5A 1TKZA 1VLYA 3QBXA 3FSXA 2ZBIA 4Q7AA 4IO9L 3DRXA 3QAEA 5BR8K 1HR0F 2ZQBA 4CJWA 2FHOB 3HPGA 2MQLA 4QBUA 1OPIA 1WEYA 2NRXA 4M3XA 4A62A 2C1EB 1I3AA 3N4PA 3FVYA 5A0YA 4D3HA 2ZFHA 3MI7X 2ZBPA 3OVSA 3HSZA 4OHXA 1C0UA 4A8XA 2GV9A 1WHWA 1Q86O 3A5NC 2J6SA 4CK3A 1NJYA 2MKKA 4E89A 4LF8F 4H5TA 3QJJA 3AY9A 4KHQA 3HMJG 4LR8A 1TK8A 4L3NA 1R59O 1HUXA 2AP6A 1CZAN 3QIPB 1SCJB 1KVAA 3HD2A 3MUMP 4TLQA 5KFZA 1N8RT 3WNHA 4ZVHA 1BQMA 3SBMA 1VQON 3MWBA 3SBTA 5KFTA 1FKPA 2ZNYA 4DV0J 4FJJA 3SV3A 1SJ3P 1SAZA 1VHXA 4QS8A 1Q7YO 5LL6d 3NNAA 1WAFA 1RBLA 1NHKL 4J9VA 2FSNA 2RQ4A 4DUYJ 1Q95G 2AJQA 3KK2B 1U09A 1D8YA 4OI0A 3O1WA 2Z30B 1T9TA 1N34F 5KFRA 4ECZA 2DHGA 4TVAB 1XI1A 4X4SA 2CAJA 4IKAA 5AXLA 2JSXA 2E5HA 3P1GA 1FX2A 1YXQA 4JRPA 2W6KA 1ZBUA 2DPNA 3MM7B 1T6DA 4PUOA 4WPAA 4K8ZA 4LREA 3IWXA 2B0GA 2D1KA 5B0DA 4WFBQ 2H5EA 2LFVA 4JKDA 3CD5A 3C15A 1SL0A 4AL6A 3DU5A 3S9HA 2ZH7A 3KLGA 2DFEA 3CDBA 2A5XA 4WCEL 1YITS 5EOYA 4WQ4C 2VONA 4NWBA 2ZUAA 4A8WA 2IDEA 3T5LA 4M5HA 3SUOA 1SH3A 3IAYA 2VGMA 4C0OC 3NOCA 2NRHA 1XNRF 3ETMA 1UW4A 2G4BA 4KGKA 5FD1A 4FPRA 1RWWB 1KR4A 5B0BA 2VA3A 2EBGA 4KHSA 2JOQA 5DETA 2P9NA 5F9NA 1ZM3A 2CJQA 2U2FA 5AFUA 3IM9A 2XMKA 1KQGB 4YR3A 1X3MA 2CQ1A 2BH1A 1Y5IB 3F56A 4MH8A 3U9ZA 2Q0RA 4X66J 2HIYA 2G1HA 3MEEA 3KWGA 4PG7A 5B08A 4HTJA 1P6TA 2OKQA 3MM8B 2NRVA 5HL7Q 1YJ7A 2NNWA 4RU9A 4QIGA 3U1MA 2X51A 1S4EA 1N5VA 4BQZA 3UFCX 1VQNS 3FBCA 4DF4A 1ZBTA 4FOEA 1RT4B 5JVHQ 2MZQA 4Q45A 1O51A 4V1Ak 3TYTA 2UVVA 4TY9A 1IG8A 2F9WA 3SJHA 3ILOA 3U9DA 3DMJA 1RI7A 1N5YA 4X64J 1K73O 4OX9F 1UPPA 3OD2A 1HW8A 3ENVA 4CGFA 3R2DJ 4JV5K 2KQ2A 2W01A 2W42A 4F4WA 3MPDA 1NHVA 4PWUA 4QPXA 2I1RA 1LAWA 3I4PA 1K47A 1JWWA 2P8IA 1S0VA 1GTEA 1VRQC 1KLMA 3ISZA 3NL0A 4HHJA 1RYRA 5KT5A 5A8WB 4EHTA 3MCSA 3PSIA 3HXMA 2N82B 3DLEB 2CQGA 2QA2A 5F8GA 1S1XB 1V5IB 1UAXA 3A8IA 1PILA 2FIUA 4NE9C 3CCWA 2ZBQA 4LSNA 1OMSA 4XDCA 4M45A 4M8LA 5BREA 4K5SA 4WBFA 4Y34A 2KJVA 4OYPA 3WIVA 3DN9A 2M70A 3QEVA 2M8HA 3BV8A 3N4QA 4NCAA 4QIWD 1C1AA 1Q4RA 2EK1A 2Z8QA 4LRAA 2X78A 2A6OA 2AU0A 2PZSA 4AQYF 4YDUA 2E5LK 3MAAB 4K4TA 2EFQA 3MUTP 4IEEA 4ZOSA 4RL1A 3PM9A 2UUBK 2LQ5A 4C9DA 1KVBA 2LA4A 3SQGA 4C0BA 3OYBA 4FYYB 5AQGA 2KXHA 1P8GA 4H0YB 3THTA 3KLHB 4I6YA 2HRTA 1HI0P 3DXKB 3CJKB 4KGVB 4WQ5A 4M41A 1RUSA 4IQXA 3O4QA 4LFAJ 4P73A 1AYEA 3A5MC 2MXYA 3GDQA 3QFWA 5ELZA 4C8ZA 4QJVA 1F1BB 5HK4A 1VSHA 3CJCA 3HSTB 2V4QA 1I94K 1MU2B 3ID8A 2D0BA 2V67A 1W26A 4LF9F 4PAAA 3QWPA 3LGMA 1XHXA 2XHWA 2VUGA 5KFPA 5HLFA 4NXMF 1CXUA 1ZBLA 2OGUA 5B0AA 1PG5B 1IBKF 1I6JA 3SAHA 4J9NA 3KK7A 4WFAL 2HFOA 5KFFA 1RLDA 1WI8A 2ZHAA 2V4RA 4F0HA 5KT4A 1KQKA 1NPRA 2K3KA 3ZO7A 4DV6F 2D3O1 4H0OA 1RTDB 2EKNA 1JLBB 3LQVA 5E3RA 2CJXB 5AR0A 4ZN3A 2YNIB 9ATCB 4C6AA 2XO7A 2DBBA 2X1AA 4JI6F 1ZM2A 3HHLA 4RNOA 3R5DA 3G9CA 2UP1A 2CJKA 3I0SB 1Q79A 4FYXB 1OSDA 5J2PA 1MMLA 1WHXA 4OKKA 2V8DA 2ZWOA 4CZHA 2UU9J 2WVEA 3C0BA 3OV7A 5KPZA 4QPTA 5HO4A 3WX8A 1JCGA 3QT5A 1RWMB 3IP0A 2Q43A 1RQ0A 2UUCF 1CULA 2Q36A 4WYLA 3NGIA 5BRDA 4I64A 1SKUB 3JSYA 3CGIA 3IM8A 1GMUA 3FJ2A 4CJUA 4H0PA 4B9LA 1PJ6A 5CYJA 4JRQA 1JLFA 3G71N 3Q2SC 2O8BA 2XC9A 4L72B 1YGYA 4Q8EA 1HKCA 3ZSRA 2OAUA 3MDQA 1F60B 2XNRA 1NHUA 3TRGA 4TLRA 5IV3A 1BQNB 2K7JA 2LEBA 4ZMMA 2KTQA 2LEAA 3C66A 1K1SA 3EUNA 5FPMA 4Q2LA 1YQHA 3CO9A 3G82A 3ZZPA 2C2EA 2R8IA 2MY7A 2ZGZA 2NSBA 2YKPA 4PCQA 1YZ6A 2DNGA 2FD2A 2HYIB 1KAZA 4DR3F 3NF8A 2CADA 2CPJA 4C8LA 3SMSA 4KO0B 4BRHA 3AVIA 1WC6A 3BGRB 4CZEA 4IOCL 2B9YA 5KQ8A 4ILMA 5EVZA 3UN3A 5A8KB 3DLBA 2QE5A 3CTRA 2EG2A 1RDWX 1BMQB 1UEKA 2BV3A 3SCXA 1MWQA 2XMVA 5G0RB 5E26A 2GQQA 5I3UB 4O23A 1PSDA 2KDOA 4W98A 1HWKA 5LMNK 4DFMA 1X3NA 3NWGA 4CO2A 4TYBA 2C3YA 2CQ4A 1WOPA 4YOVA 2VGNA 3F44A 1IBMF 4P52A 1L3UA 3Q86A 2Q97A 5AQUA 3ID6A 5ADXA 4ECTA 1JQGA 2DNRA 5IQ6A 2DRAA 2F8EX 1IKWB 3HI9A 5DQGA 4O3NA 4QCLA 2XLJA 3CD7A 1R0AA 2RDJA 2K06A 1LK7A 1FRMA 4ED2A 1X31C 1N6QB 2BA9A 1YF5L 2HRYA 1IBLF 3ZX3A 3MCOA 2RNEA 4AXJA 4R5PA 4E7KA 3D6MB 2WB1D 4ZP6A 3MXHP 1SQFA 1RT3B 2PFUA 1VQ4S 2BKNA 3H6EA 3ULDA 1FJ7A 3TAEA 2HB5A 3KNAA 3L6QA 1X9WA 1HQUB 1N33K 1FXRA 4Q43A 1TUYA 5B8HA 4TY8B 3EZUA 4DCPB 1YI2S 4WFNQ 4Z4GA 1BCOA 4BVPA 2JEGA 2RKIB 2MJNA 3A3NB 4ZLPA 5SZTA 4YHHK 2NXCA 1FFGB 3SUQA 1T05A 1FDNA 1VJQA 4KHWA 2P6SA 2DHSA 5J2NB 2D0AA 4M5LA 4I6MB 2ZJQL 5CY4A 4B9MA 1ZM9A 3KYLA 4CNZA 1TFWA 1HPZB 4CZIA 2P9UB 2VQFK 2CNNB 2ASLA 4A59A 1DEJA 2V8GA 2ADBA 1EWRA 4HT7A 1AFJA 1T7PA 5HL7L 3D0GE 2QLXA 4B3OA 1AT1B 2Y1LB 3POTA 2QK9A 3ZLJA 3HCXA 3TEGA 1FNMA 3UKUA 1REVB 1M5SA 2J7KA 3W2WA 1C2PA 4CFAA 4RW7B 2P9KB 5AFUH 3H5UA 1PJ5A 4HEA9 3VQBA 4QR0A 4N56A 4JYAJ 3V81A 5JVHL 1H73A 4ID5B 1UA1A 4BRPA 3P4IA 1H2UX 2MLZA 3UN2A 5T7BA 4ZP9A 2UXDJ 2ZZMA 1JLCB 2CJYB 1X4EA 2HK2A 5HMZA 1JLGB 1EETB 4RW6A 4ED3A 4NPOA 3BO4A 1RGIA 1OY9A 3FCVA 2W9CB 1GLDG 3CWJA 3NMUA 1SJRA 2GVDB 2HVDA 2HNYA 4FJ5A 2ZBCA 4B3RF 3B4DA 3OBWA 3F73A 4CYUA 4FWLA 1R8CA 4A8FA 2H54B 5BN8A 3C65A 1KTVA 4DL2A 3W62A 2V2QA 3MMVA 2HHQA 3P31A 4DV0K 4YMEA 3ZT1A 2VJVA 4KH6A 5FROA 4A8KA 3KDOA 1FFWB 3OYDA 1X0PA 1AZSA 2LQJA 4RW4B 5IFMA 2DGQA 2VWKA 3MWPA 1RSCA 4DUYK 2ILZA 1RHUB 4K0KJ 2QXFA 5D15A 1FJGF 4EO8A 5JJBA 2ZH3A 3DM2B 1H6KX 4OZ5A 1OH5A 3PW2A 4NA3A 4KI6A 4ITSA 2P9LB 2Z1IA 4DSLA 2WTUA 1WDDA 3K2PA 2P9SB 2Z1HA 3U6FA 4DR7J 1IM4A 1X1PA 2DGOA 5FLXO 4FJ8A 1YITN 4HT5A 2ZVIA 4UW2A 4YDXA 1REGX 2B56A 2VPZB 4FF2A 2Y3YA 4H4MB 4AHTA 1D9FA 3P8BB 1UZHA 2B6AB 1VBZA 5KFOA 2DTJA 1WJ9A 2R8JA 2O8FA 2F3JA 1EO1A 2MQ8A 4IRCA 1KC8T 4JV1A 3THXB 4M5DA 2R7SA 3DRRA 3HSDA 1F9FA 4I9QA 5FLXY 2E1CA 2UUAF 4B1UB 2ZD1B 2PA3A 4EBDA 4PZVA 5DO2A 4EZ6A 4L3KA 3RB3A 1ULRA 3IS9B 2CVIA 1UAWA 2RHQB 4GRSA 2X74A 3VGMA 4X66K 3LW5C 2FBYA 3CW2C 2W9BB 4FPBA 5E3QA 2IA6A 2HNZB 3QT7A 4B9UA 1FK9B 1EAYC 2HHVA 4BDPA 1N36F 2NRRA 1VQNN 2R7XA 4UOCA 4W92B 1F21A 2B43A 4QQBA 1O8BA 4DV2F 4PQUB 3O8WA 4AFFA 3CD0A 2CWKA 1HNIB 1DQAA 4UOHA 3TZYA 1ESVA 1PAEX 2ZVSA 1FJEB 3U8XA 3L2UA 4ETXA 3MM5B 1ZBFA 3J7AP 2HBZB 3CXCM 2HIQA 5KT3A 4ES3A 4DV4F 3AAPA 2YQ3A 1G99A 2E7WA 1SQKA 3FK4A 1QAJA 5LL6Z 4EFHA 1RKIA 3NGRA 2R7OA 3FMBA 1RBUA 1UJ6A 4USMA 3OXGA 2J9CA 4PYAA 4X62J 3R8EA 1AA1B 4JP8A 2QA4S 1T02A 3HVRA 3GIIA 4IO8A 2CQ2A 2XI3A 4P2MA 1WACA 4HACA 3IWLA 1QDUB 1SV5B 3H90A 2XTJP 2G9OA 2OD4A 4JI1J 4KB7A 2J7WA 4JNEA 4DV5F 2Q1NA 3H7HB 1IKVA 2FXUA 1E4FT 2RQKA 2ZC3A 2E7XA 3CERA 1TV6B 5KFCA 2ZNZA 4M5NA 3EDRB 1Q81O 3KK3A 2CFXA 4MK9A 3GIRA 4ELTA 3NWRA 4DX7A 3G6ES 5HJXA 1RDUA 1GEHA 4IFYB 2OZSA 4O5BA 1RWNB 2FHJD 1S7IA 3R9LA 3TUZC 2V7YA 4A8YA 4DN9A 2D41A 5THWA 2XULA 1UOCA 3AVHA 3NCRA 4ZLJA 4IBNA 2Z57B 1RAEB 1H3DA 1S48A 2E5IA 3BUZB 4FLUA 2F4VJ 3DXMB 4L3QA 4J8FA 4H4OB 5KFXA 4HHHA 3AGKA 1ZZNA 3UB5A 2BKOA 4QU7A 1VHIA 2EG1A 3NG8A 4RU2A 2MPUA 3OBYA 1FRKA 3SQ1A 3IXQA 1WOQA 2AYEA 3G86A 4LFAK 3Q8VA 3BPDA 2XHBA 4CJSA 3TQEA 4JKGA 2BJ9A 3GWCA 1N0VC 2F7VA 3OYHA 1M5OC 2GA7A 2QWNA 1RBTA 4BRMA 4BRGA 2DR5A 4HH0A 5KI6A 2FJXA 1RWOB 4E7HA 3RYLA 4PG6A 1TVRB 3OXFA 1RDCA 1NSKL 3TR5A 3LPEA 3E1YA 4Z4EA 1X9SA 5EN1A 2BXJA 4LFCF 1LWXA 1ZTTA 3TA0A 3SDEA 4IXCA 2ZM6J 3TUIC 3W2VA 3ONQA 3T1YJ 3IDHA 3NF6A 5IQQA 3KDNA 4QIVA 2V2KA 4B02A 1CC8A 3KJVB 3M6WA 3AGRA 1HMVA 3BEXA 3SQ4A 1TKTA 4IJNA 3VQ8A 3Q8QB 2YJEA 4HDHA 4LRFA 2PN6A 3MURP 2KT3A 4NEZA 3ZT2A 4KHPF 3OLBA 4FDFA 3IMQJ 2XZTB 2EFPA 5F41A 3UKRB 3DOKB 3PEHA 2GV1A 4BC7A 2MJUA 2YX1A 3VQSA 2WFBA 4NLBA 1S6PA 4YORA 3VEVA 5I9EB 2W6LA 5C2FA 2YWKA 4K8XA 4C48A 3C14A 3N01A 4BR2A 2DRDA 4MK7A 2DIVA 3M6XA 2GQCA 4XH5A 2CWXA 4LF7J 2J8AA 1DARA 2B8PA 1JJ2R 3ZCMA 3JQJA 4LF4F 1G6BA 3TQ1A 3TA1A 3VGTA 4DKWA 2UU9K 5AQSA 4WIQA 4X84A 4IKFA 4JKBA 2O67A 3I0RA 3NBPA 4FWSA 1NKEA 1NK6A 4OJ1A 3WC0A 3OPKA 3THPA 3Q8UA 1P9YA 1KKHA 4UZCA 2MQOA 2Y8YA 1AUSL 1VISA 1NZ8A 1XNQK 3NHGA 1Y64A 2DHAA 3GILA 3O9RA 3C16A 2HBRB 1CS4B 3EPIA 2VG5B 4FM2A 4FNHA 5GVQA 2FBXA 2OPRA 2KLAA 2B51A 3V6DB 2J7UA 2O8EB 1RHRB 1S9EB 1RTJA 1W9HA 4OZ2A 3PX4A 1U2VB 3E8OA 2ITGA 5K5MA 2FHMA 2VF3A 4FS1A 3GG1A 5KFWA 1YX2A 4JI7J 4CZCA 3OUYA 3R27A 2DH9A 3PDNA 3O2IA 2DR8A 4J9QA 2CPXA 2E1YA 5B7WA 3NKYA 1K44A 6AT1B 2H51B 1SUQB 4FZYA 4NXNJ 3RSEB 3ATUA 1G1XA 1YKWA 4E8UA 2AQ4A 5ETQA 5LMUF 1VFJA 4MO5A 2C3UA 3W5XA 1JNRB 4PXEA 4DJBA 2B4OA 2K1RA 3A3OB 4B9VA 2CXEA 1YVFA 3R97A 1HR0J 2VYPA 2Q6BA 2PMZD 1YVNA 4MYUA 3HHKA 2VG6A 4K8RA 4CTAA 3BKFA 1VGYA 4WK3A 4R0JA 4F3TA 4DSFA 1IN0A 1XQIA 3EICA 4KIAA 2YNGA 3CXCR 3TI0A 3D1QA 4UZBA 4DQIA 2WTFA 1QS4A 1UTAA 2KG0A 4CGIA 4LQ3A 4NB4A 2R2SA 2FVSA 1V5VA 3AY0A 2HLUA 2WVCA 2FPHX 2FZKB 2HQDA 1HNWF 4C3KA 4CEBA 2D69A 3C95A 3S8SA 4XTTA 1DQ9A 3U1LA 1XR5A 3BM7A 5H1SQ 3KG4A 4DR2J 2XS2A 2MKIA 5AJ3F 1XMOJ 5LJVA 4ECVA 2KYZA 1VQ4N 2JFKA 1VJWA 3W66A 1GLJO 3VOVA 3W3SA 1VSKA 2GHVC 3OTOJ 2A3ZA 1K8KB 1D4XA 1LFWA 4ECYA 1EKSA 3WDOA 1JKHB 3WT0A 3VZIA 3K5MA 3QRPA 3N6LA 1B9FA 1YI2N 3NEKA 3I8BA 3CVKA 4O3RA 3HLUA 4I69A 4AYBD 2JGUA 3WXLA 1KEKA 4KE5A 3MGJA 2OEKA 2CZ9A 2LXIA 3MM7A 2IVMA 1N52B 3IAS9 4J37A 3FRZA 3CCVS 3X3UA 1N34J 4EI2A 3N79A 1WG5A 1V3ZA 1FXXA 2ASMA 4CJQA 1EHWA 1NPPA 1FRXA 5HMWA 2CZVC 1W0HA 3D67A 3S6EA 5AQQA 5EX0A 5M1KA 1ACMB 1S4FA 2AJ4A 4OKEA 4O44B 3B8AX 5D78A 2A3JA 3WIUA 2E1MC 2DNMA 4ZVFA 3A8KA 3O6WA 3SCJE 4ES1A 1JX4A 2D5RA 2RDIA 2KKZA 4CO4A 3PO4A 2EFGA 2R2RA 5J1EB 3HFZB 1QUPA 4FF1A 5GAGP 4RW9A 4CHPA 1RTZA 3FSIA 4W5QA 2NREA 4JKCA 1BCMA 1PAUB 3MECA 5KPTA 2CG4A 3FEXB 4JI2F 5JVGQ 4DPTA 5HAOA 3UQSA 5E84A 1RK8A 1XNRJ 4QWBA 5DQHA 5IT9U 1RADB 3TO8A 2J0SD 4FYVB 1RCHA 1IJJA 2CIMA 5HOOA 3KUHA 4HI2A 4KKOB 1ICEB 2GHWA 1RKJA 5EWGA 1UKUA 4JYAK 1KLNA 5IT9O 3BH7B 3P96A 3J81U 2UXDK 3AARA 2IFXA 4CGHA 1XR6A 5EHHA 2P9IB 3GB0A 3DOLB 1M5HA 1VSIA 1B7FA 3QEWA 1J5EJ 2RMLA 2YBVA 4CECA 3BYPA 1BXNA 4YB6A 3IBWA 2W40A 1ZXOA 3J81O 3N5BA 3M2UA 1NBEB 1IKXB 4V19X 3M30B 2FZGB 1BWVA 5EUHA 4X2BA 3MMJA 2BACA 5MLCV 4FSVA 3ULHA 3V1RA 3R6MA 1XMQJ 2CYYA 5GAGI 1WSIA 4AHVA 3MFIA 4IWVA 1M1KO 4X4TA 4K2JA 3OR2B 1CJVB 3S7RA 1O5JA 1F5CA 2NRZA 5GAGU 2XMJA 1URRA 2VQEF 3SAGA 4I6WA 2LU1A 1HNZF 2HMIA 4H4KC 4FVCA 3O9UA 4HDGA 3L7PA 4K0KK 1TKDA 4BCAA 3EY1A 4J2DA 3MUVP 2IAJB 2YV0X 1S12A 3ZTSA 3KWIA 5CE3A 2PFFB 2OHDA 3ADAC 3EMTA 4DR7K 2FVRA 4FWKA 3HVTB 5AQIA 3M2RA 1JXEA 3U1NA 4XH4A 5LXRA 2QTDA 4LT6A 3CCLS 1WELA 4GV3A 3GV7B 4NCGB 1TKZB 2XMWA 5DZ6A 3VR1A 1UZDA 2KXNB 4E7JA 2I2YA 3R7NB 2NXEA 4CJRA 4ZVOB 5GIPA 1OVYA 3FZMA 1VHFA 4B3MJ 2R8GA 1EX4A 2MKCA 2IDOA 5A0YB 1WN7A 1KS2A 1RISA 3JS6A 4FZXC 3HD1A 3ZT0A 4CT9A 2FJBB 3D2EA 3SPYA 1X9JA 1BHLA 1RBOB 1C0UB 4Q0BA 3ILLA 2WVBA 4E1NA 1J2VA 3KLHA 2E7VA 1K6YA 4USUA 5HP1A 2GFFA 3GONA 2IVNA 2WSFC 1HWUA 2J9DE 3UI3A 4A8OA 1C0GA 1LWCA 3MPYA 4DR1F 1XBWA 1YWXA 3OY9A 2AW0A 3SCKE 2ZH5A 3DXBA 3DLGA 1TKXA 3QGHA 2FF3B 1TUUA 4Z2XA 5J2QA 4GVLA 2VIHA 4FM0A 1FKPB 2HFVA 2ZBRA 2WONA 4LF9J 1ASVA 5F0XA 4WFZA 2KN4A 2Y1JA 2VWJA 2PE8A 4HVJA 2JVOA 1MMNA 3NH1A 1BA1A 3Q7CA 4NXMJ 2FJWA 1D9AA 2OFHX 3KD1E 3H08A 4WTOB 4B08A 2QA4N 4GKKF 4RCHA 5DRKA 5ETVA 3BSAA 2AYBA 3D6HB 1M90T 3D0HE 4X62K 1FXLA 3UPFA 3BBCA 3M8PB 4CH1A 2HEKA 3VA3A 4IRDA 3R5AA 1WSJA 4M5KA 4PXCA 3J7YP 4BRFA 2FZCB 4CE9A 4PUOB 4EFAC 2HVEA 4ED5A 2YCHA 5AQMA 2HHHF 4DR6J 3DRPA 1X4GA 5TKWA 3C15B 4JI1K 1HW9A 1VIOA 2VICA 3G6EN 2BM0A 4OI1A 3KG0A 4JI6J 1LXJA 2W2NP 3LUYA 3IGNA 5EU7A 3CCUS 3TZZA 1IKYA 4JLHA 1WSVA 2PO4A 2G8HA 3A12A 1KOHA 3OTBA 4ECQA 3DU6A 3KLIA 5KG4A 2FC8A 3L7OA 4UQGA 1NJWA 1WKKA 2OEJA 3ZNUA 1NH8A 4O3SA 1NGGA 2UUCJ 2EHGA 2YJFA 3CT9A 3L95X 1RDDA 2XYGB 2IY5B 4DTPA 3J7YI 2F4VK 1NGHA 2G8IA 4JS4A 3TVYA 2NR0A 3SFGA 2E9TA 4U67L 2GGPA 1WHVA 4W4MA 3J7YU 4LR9A 3PV8A 4JI5J 3QIDA 4Y1CA 1LWEB 1MLAA 1X5SA 3MX5A 4AXIA 4JHDA 2GJ2A 3VAIA 3ILIA 5FPNA 2HHUA 5RUBA 2MMYA 1HJRA 3SCLE 2HHXA 4DU4A 3VESA 3AVNA 4IH7A 3DMJB 2KZZA 1RCXB 5JS1A 1N5YB 4ECUA 2ZM6K 5IS2A 4LF5J 3CMAS 4EU0A 3ZC4A 1U1MA 1FHTA 3T1YK 3Q0AA 1R89A 1ZPWX 4CESA 4DFKA 4DR5J 4Y65A 2E66A 4ER8A 5IWAF 3CQXA 4O4RA 3OL7A 2VPYB 2D0PA 4PL8A 1W7WA 1MDUB 1LKZA 3NS7B 3H4BA 1GMWD 2UXBJ 1G7CB 4AHSA 3OBIA 3BPSP 5HQLA 3CCQS 1YBTA 3AVMA 2IVFB 1RBAA 3OYCA 3GYXB 4DV1J 1NCLA 3H3OB 4EMDA 4LSNB 2WB4A 2XY5A 2EBEA 2H48B 3VTHA 2F9JA 4MT1A 1N6QA 1TYQA 1FJCA 3FZHA 4FO0A 4LF7K 5HRRA 2JFDA 4RR5A 4QWCA 3AVAA 4J9OA 4FLXA 1RTIA 3UR0A 4X4VA 2E4LA 2XBPA 4P74A 5EX5A 1KVKA 2IM2A 4OIXA 2BDPA 2HBLA 1MMDA 4RNMA 1YBAA 1NUEA 3EE8A 4TY8A 3JAMU 2WBMA 2F5GA 1TR0A 3SQGB 1DQ8A 1Y5LB 4OZLA 4K42A 4HUGA 3MD3A 1Q0NA 3GYNA 3MN5A 3JAMO 2BJ1A 3T7ZA 4FJLA 3CC2S 1RBVA 5JVGL 3P5TL 1B99A 3ZZZA 4FWPA 2V7ZA 5BR8F 4DL7A 3W8GA 1Q8BA 4WFYA 2HBQB 2XMMA 2QIFA 4KPYA 1S76D 4OYBA 3LPYA 2HFSA 2WW4A 2HF4A 2E2NA 2PYJA 4MKBA 2V2VA 3TR8A 2OA8A 1WF2A 1VQ6S 1UW9A 2Z2YB 5DLGA 2L9NA 5HLFB 1SC3B 4GKJJ 2YHWA 4JI3J 4X4OA 2FVPA 2CPZA 4DS4A 1WOSA 3M6VA 4CBWA 2EX3A 2BE7D 4RW7A 1HR0K 5CABA 4U7UD 4PY5A 2DK2A 2YQ1A 1WORA 2DHXA 2AP1A 1FCAA 1UETA 1OY6A 1JLAA 5L8RC 5T14A 3C19A 3I31A 1T44A 3QNWB 2QKKA 5L46A 3OA9A 1FVSA 4CM2A 4FK2A 3OS0A 2ACMA 4N76A 2QFIA 1DTQB 2IIHA 4FYWB 1IR1A 3HHLB 4HVZA 4ZP7A 3A1YG 3AFGA 5J2PB 4YOWA 1JCFA 1KQFB 3B6OA 3KJNB 3KWMA 1Y4ZB 4B3TJ 4H5NA 2OELA 4RW4A 1XMOK 2ZJRQ 2H5IB 4CEZA 1VSDA 2YPYA 4J7CA 1VI7A 2RJZA 2V5HG 4DG1A 3R1HA 1RA6A 3OTOK 4PWDB 2GX9A 3DLKA 1XC9A 5AE1A 2HZCA 3CCTA 3O08A 3CCVN 4KBIA 1JLFB 5E3AA 2P9SA 4FW2A 3K5OA 1UFLA 3IR5B 4G1PA 2HF3A 2O8BB 3VPZA 3QETA 3D45A 4DQPA 4AL7A 4FJXA 2E2QA 2F8HA 4USKA 1P90A 1N34K 1VAZA 3WQPA 2OUGA 4ZN1A 4P71A 4FJIA 3TZWA 2C2ZB 2YH0A 3F2KA 3G82B 4KTZA 3CM6A 3AB2B 2XZDB 4BR7A 5M1NA 3IFRA 4KH0B 5DDQC 1RT2A 3QWUA 1BWFO 5LJWA 2O4IA 3PW7A 3HJVA 1NAQA 2XS7A 2LLZA 2F9DA 1O13A 2KHDA 3C3LA 2FJDB 2JDJA 2M88A 4DTMA 3O9TA 4YR0A 4OI3A 1U47A 2XCPA 5KT6A 4FXDA 2JNJA 3AOCA 1KDNA 2P9GA 4TSXA 1Q7LB 4AH9A 1XNRK 3P3DA 4K41A 1U48A 1YTUA 4F26A 3H5XA 4B9NA 2PA8D 3V6KA 1TL3A 1FRHA 3PW4A 5HBMA 4B9SA 4YP3A 1DURA 2HQCA 4I67A 3WZ0A 4DF8A 1R27B 3D2WA 1X5PA 1C0FA 3MTJA 2PBDA 1LCUA 4FLYA 3QZ7A 3QIOA 3ETOA 4ZJQA 3W8PA 2DHHA 1H0HB 4PQUA 1ZM4A 1SS6A 4DL3A 2I9SA 3PXGa 2XMAA 3P4UB 1J5EK 3OFEA 1SZ2A 1SB6A 3CIZA 1RWPB 3LA0A 2ERRA 3EEQA 1DAXA 3BGOP 1FO1A 1HI8A 1N36J 2JC1A 1FEEA 2RU9A 1XMQK 2HQFA 4DSEA 1N88A 3LWLA 4OO1J 2P5GA 3JSMA 2CQHA 5FDLA 4R5PB 4ALZA 3ENOA 5LXYA 4GO7X 1HBMA 4BE1A 9RUBA 1HWIA 3DAWA 2HAFA 1KWMA 3FEZA 1OIAA 5CD4A 3CMQA 1IWGA 2VASA 5HVGA 1UFKA 3QT6A 4EO6A 4F4YA 2ZGYA 4FJGA 2V4JA 3RB6A 2HRUA 4FXWA 3PJXA 2Y0BB 2COLA 3N28A 5CCLA 4C23A 4CZLA 3AJ1A 3JXUA 5JS2A 1SV5A 3QINA 2CPEA 2Y9HA 1LXNA 1EB0A 3CCLN 2RHSB 5KOWA 2VG7A 2D9PA 1HLUA 4IH6A 1T05B 4FLZA 3MCNA 4CEAA 3QB0A 4TXSA 4OFZA 3SJJA 1RT5A 1P8ZA 4CLWA 4RWXA 2ZH4A 2HBMA 3L4IA 1T03A 3SIPB 1FNOA 4CLSA 3OT9A 4DV5J 3HF5A 3W65A 1LWFA 1J54A 2UUBF 2HHSA 1RT6A 5A2QU 2D0CA 1CXQA 2HFZA 1U1KA 5KFUA 4BS2A 4DX8H 1SVDA 2R7RA 4B3OB 3KXDA 3J7Z5 2QYCA 3POTB 4LH4A 3TABA 4ZPBA 4B3MK 3QZ8A 3UKUB 4IR1A 1DLOA 1DJ0A 1QZ5A 1H7WA 3W2WB 4XAKA 1QY7A 2BZ2A 3G6VA 5A2QO 3ENHA 3V81B 3NGKA 1YVUA 4R25A 3QQCD 3TP2A 3T1AA 3EZ5A 3K17A 5D8HB 4AQYK 2VZ9A 2HK3A 3L3UA 1J5OA 3V6HA 3HOSA 3PACA 2KM8B 3C94A 3MMAA 4TN2A 2FLPA 4CK2A 2MDAA 1X9MA 1E6VA 2EK6A 2V69A 4YY3J 3EVMA 3P39A 5AZIA 3DHWC 1BL3A 4EAHD 2HNYB 3EVOA 1X4BA 1XIQA 1X60A 5HATA 1KP6A 1R8HA 1GOCA 1UPMB 1KVIA 4NL5A 2POKA 3ATVA 3D6TB 2HGLA 2Z56B 4ILLA 4OYZA 4NMLA 4JV5J 1SJ4P 4LF9K 4DR4J 2Q3SA 1R0BG 3J80Y 2QWQA 2DEIA 3GSDA 2W1BA 3KKRA 3TPQA 1AZSB 3KJFB 1C6VA 4NXMK 1SL2A 2PGCA 4LBIA 4PL7A 2BR0A 4LFCJ 2HAIA 5F8MA 1Y7PA 1CBKA 4LFBJ 3FCHA 2DGXA 2WAQD 1XJWB 4F02A 3MOJB 3N6NA 2SXLA 4OYMA 5GAHI 1R6YA 2HLTA 3C6UA 2AKWB 3NGDA 3Q89A 2E8AA 1RT1B 1OQ6A 5T7LA 3H5YA 3E51A 1PBAA 2VPXB 3F0NA 4QWEA 2E20A 2J0QD 3FFKB 3TUJC 3CCUN 3T5KA 2XY7A 1U2FA 3EKSA 3O1BA 3DGPA 1EXQA 4FWQA 2O8FB 1V9OA 4JI6K 2E5LJ 3RR7A 4TQSA 1NH7A 3GFYA 2KO1A 3NAHA 4M5DB 1HIYA 3DRRB 3WXMB 4DB3A 5KQDA 3AHPA 5IZHA 5A6PA 3PRBA 1UA0A 3E01A 3NRBA 5F9LA 3M6UA 4P2SA 1XC3A 2D3UA 4BG9A 1HYSA 1FWKA 1YTYA 3AT1B 2HW3A 1VMBA 1BU6O 3PX6A 2AMCB 1A0OB 5FPDA 1U2RA 2RE1A 4CO3A 1NK0A 2UUCK 1RB0A 4EYIB 4BHQA 1VYAA 2LVWA 1FDAA 1S99A 2AGQA 2NPFA 1R31A 4H03B 2GIFA 3DOMA 1A5WA 3GE9A 3HO1A 3KIOA 4YOTA 1QVGM 2MQPA 5EDWA 1NK9A 5AQZA 1I5OB 5AT1B 1NJIT 4AILC 1Z2ZA 3LDSA 1QSYA 4JI5K 4F4ZA 3CJ3A 4HUEA 5JMVA 2DEJA 3M8YA 1TMMA 4WYWA 1XQSC 1Z2LA 1FWPA 4N8NA 4OJHA 4QR2A 4H8KA 2NUUG 3CMAN 4NRUA 2QMXA 2APOA 4NLGA 2W7OA 2DB1A 5LMNF 5H1SV 2IC3A 4KAIA 4LJMA 3RRGA 4CLFA 4ZK7M 5LMUJ 3OL8A 1GQEA 1VOMA 1KD1O 3R2CJ 4QU6A 4P7TA 2UZAA 3TOQA 5E41A 3DWLA 3G2XA 4DR5K 5K9FA 2H5JB 2E88A 3H4DA 3TZXA 1X4FA 2OFGX 3CULA 2OLWA 1WF1A 5C24A 4ZS6A 3CCQN 4EWTA 3ENWA 2W2OP 4HACB 5HRNA 1MNEA 3MN6A 1U1RA 4JI0J 4Q8FA 2I38A 2UXBK 3PIPL 2EFNA 1IKVB 2G2YA 1XN9A 3ILJA 1VIXA 4M63C 4DV1K 2GWKA 1HNWJ 1YJWS 3GIKA 3TVKA 1IBMK 1OQ3A 4GVBA 3KK3B 5I3QA 3CG7A 4MMOA 4E3SA 2ZOGA 2KKHA 5GAEP 4CT8A 3NCPA 1N33F 2PAVA 1SI9A 5DGAA 2WBRA 3EGZA 1EIYB 1IG9A 4F8RA 4OJRA 3SXLA 4B9TA 4HCCA 1PYTA 5LSRA 2R7YA 3LWMA 2JLEA 5KTQA 1U25A 4X4RA 3CC2N 3PIOQ 1V4TA 1B0VA 1YJTA 1TL7A 3DLRA 3TVZA 5E7OB 2B7CB 3BGFA 2B8QA 5HVFA 3JYTA 1PGZA 4LF6F 1DZ5A 1GT8A 3V2UC 1RILA 5C2DA 1ROFA 3UDCA 3M8QA 1VSFA 1VQ6N 1O1WA 4FL9A 2UUTA 2B4VA 2PIIA 3G0ZA 4NX9A 3LP3A 2YHYA 2QC3A 4JKGB 1W2BR 2FC0A 1YSJA 4HUFA 3ZX0A 1F3VA 1MWKA 4USIA 4EHUA 5GAEI 3PW5A 3FFIB 3AO2A 3HULA 3HFKA 4GKJK 5AQLA 4JI3K 3SDEB 3D5MA 1VQ5S 4FF3A 4PXBA 3W2VB 4I2PA 2EW9A 3J7A1 4GVMA 1NKBA 3ENBA 4CJ3A 5GAEU 4ZHRA 4OPJA 1CJKA 5E0OA 2AD9A 1RDBA 4KH1B 3RMCA 1DTTA 1S6OA 2VHGA 4ECWA 1HMVB 1Q53A 4WE1A 1XHZA 2DXDA 1HNVA 3FQKA 3BZQA 4YS2A 2DPIA 4U96A 3QGPA 3GFHA 2DD8S 4QWAA 4Y3CA 1TL1A 4CHNA 3WQTA 5LT5A 4F36A 3CJAA 3HPOA 5CXTA 3M30A 2AJ2A 1R3NA 2I0XA 2XY8A 1YAGA 4LH5A 2DJWA 1TUVA 2V8VA 4BGAA 2W2QP 3C14B 3LP2B 1HHTP 4ZTJA 2Q6CA 1F5BA 4MLEA 3BSOA 1DRZA 2KL8A 5FRMA 3OHBA 4DUYF 2G8UA 2H3EB 2G0JA 2QWMA 4WU2A 2FSJA 3QLHA 3NGSA 4N77A 1QQNA 2HWHA 3I0RB 3LL3A 3NBPB 2XZWA 1N54B 3GG4A 5BPNA 4BROA 3ZT4A 4CEEA 1WF0A 4YOEA 2PI4A 4RWWA 1NU0A 1B7YB 2I7PA 5KFGA 2ZH6A 1RDAA 4J9SA 1H72C 3L09A 1N5TA 4ECSA 5IM0A 2VQEJ 3UIQA 1OO0B 4R0EA 3BSNA 3C16B 4L73A 4BR9A 4O55A 1GLLO 2V9WA 2GQ2A 3A5OC 3HM8A 1RAIB 4RUBA 3IRXB 2OPRB 3T1HF 4DHVA 1U1QA 2M0GB 5KG3A 3MR5A 1RTJB 2NZTA 1VQKS 5HJYA 4BC9A 3M5RA 3TAGA 5D0HA 2RDDA 2R8KA 2VQFJ 3OUYB 1HRHA 2P9CA 3KHYA 3M1FA 2WHOA 2CKWA 4LC9B 4Z7YA 1HBNA 5M2UA 3IO1A 2HZVA 3C2PA 3EO3A 1QVGR 3PSFA 3CSKA 4DWIA 4CFDA 4OGEA 3EM1A 3Q8RB 2K1RB 4JKEA 4B1VA 1NG9A 2FVQA 4Y2AA 1VRUB 4X66F 1KOOA 5L39A 2VG6B 4E2FB 4CTAB 4QYRA 4D3GA 2FTRA 2MZRA 4MDBA 1I51B 2ROEA 5CZ1A 1A6LA 3MXMA 2RS8A 3PYGA 2YNGB 2HS3A 3VGVA 4ZJLA 2AEMA 5F8HA 2P9PA 2QSWA 2HSTA 4KBOA 3D3BJ 1TAQA 4WIIA 1E6YA 1Q82O 2N4CA 4F4XA 3CDWA 1N32F 4W5NA 3LZJA 4PKHA 4WYBA 3SUNA 4JI8J 1K8AT 3LP1A 5D4LA 3HHDA 2FLLA 3NCIA 4BRNA 4O0NA 4DR1J 3UN5A 3QEPA 3TU5A 3TX0A 1N36K 4X64F 3SZ2A 4OLOA 3I32A 3RBEA 5F3TA 3W5YA 1X4AA 3BO2A 3PEJA 2QL9B 2LA6A 1WC0A 5I3PA 2XGQA 2RE2A 1IQZA 4IOXA 2O4GA 2IHR1 4DPOA 3OYJA 1X4DA 2CQ0A 2HWTA 3DRSA 1RAFB 1UJ4A 4CJ5A 5KFHA 3OL9A 1IJFB 4KFBA 2R7WA 5AQKA 3AVKA 3M8PA 2XYHB 4IOAL 4CHOA 3VAHA 4QW9A 3R5JB 4JD2A 4ZCMA 3DI6A 4PKGA 2GO8A 4J91A 4GKKJ 1T9YA 1ELOA 3AB4B 2A1SA 3P45B 1S6QA 4I7FA 3NAIA 4K5RA 4M5GA 2X1FA 2V0NA 3MCAB 2CDRB 1Y10A 3B82A 2ETJA 3QERA 3GSIA 4FK4A 2RF2A 4LD0A 3V4MA 4DQSA 2HHHJ 4PABA 5AE3A 4OL8A 1UVKA 2XCAA 5D0EA 1S9GA 3EVWA 3A3PB 3MMCA 4P7VA 3M6GA 3VGSA 4DV5K 1OYEA 3PLAA 5KGXA 3VQDA 2D9OA 5B0EA 4RW9B 3UCZP 2HGNA 3MECB 1DFDA 3A8EA 5L1IA 1QSLA 1H2VZ 3TX8A 5CYMA 4Z4IA 3DLLQ 3RAQA 2QRRA 4Y00A 3V1OA 3PNIA 3MPUB 3DHXA 2W7AA 3NH0A 3UE2A 1T94A 1CSJA 2G13A 2DRBA 4H0XB 2C3OA 2E1PA 1S72S 2DNOA 2RU3A 4XPCA 2VPWB 3FBFA 3Q8SB 2C2OB 4FW1A 2PEBA 1LWEA 3KLVA 2P5OA 2YKAA 5AQVA 4DV7F 1WI6A 4YY3K 2UXCJ 3KMQA 3M2UB 2MZSA 2AA4A 4PKDB 3BQ0A 1MN7A 1RJJA 1KN6A 3OTEA 4M95A 2KHOA 3CJ9A 4A2AA 3CJ5A 4CNYA 4C1NK 4DR4K 2DNHA 1B0PA 2GNKA 1S1WA 1H7XA 3HZ6A 2CJBA 3HFVA 4XIUA 4Y0WA 4CLLA 4U7CA 3V4IA 1SQEA 2RAQA 3EYZA 4Z94A 5D0GA 3CJ2A 4R8UB 3HVAA 2HMIB 4O4GA 2Q3PA 3OYKA 4LFCK 4WXWA 3B6BA 3PRVA 2AHOB 5DM7Q 5CZVA 2AIRB 4NLRA 2DR9A 4FOIA 4YDUC 2CPYA 1R8PA 4LFBK 3HHLD 3ZZYA 2K7KA 1WAJA 3SQ0A 1QQCA 4FZVA 5KFEA 3CQ8A 2ASDA 6FD1A 2HVIA 2GO9A 1I39A 1JJHA 3M2RB 1QLNA 2RSQA 4KGXB 4KHPK 5KRTA 1TL5A 4WQ5C 3H2LA 3BZKA 3G6YA 2GELA 2ASYA 3DDNA 1RAJA 2CPIA 4DL0C 3PJ9A 4CCHA 1YJVA 3PIOL 2FC9A 1GH8A 1L5UA 1NDCA 4IOBA 4QS9A 1Y00A 4ISEA 1JXVA 3GV8B 4WP9A 4URSA 1BA0A 3TJAA 3EGNA 2XSJA 3A5LC 1U24A 2HHTA 3FLCO 5KG1A 2BJ3A 4OYAA 4M3ZA 1U26A 3QPIA 5CA5A 5DMRA 2OJ3A 4LF4K 4K59A 3D2EB 5AQPA 3THYA 4Q0BB 5BXIA 2IDLA 5HP1B 2QG9B 3ZT3A 3BQ1A 3M8SA 1JJCB 3RBXA 2A18A 3V9ZA 1QM9A 1FF2A 3HSGA 1VC0A 1LWCB 4NZ0A 3ITHA 2C42A 3N4WA 1BHNA 2CPDA 1HNXF 2OPQA 4CRJA 4BRCA 4OV6A 4ZVEA 3DLGB 5J2MA 3FC9A 2J4RA 1TKXB 4Y2IA 4ZPWR 4M5MA 4ED0A 5J2QB 2I6WA 4RG8A 3AA2A 4W5RA 4CFBA 3QYYA 2CG8A 1VS3A 3HHLC 1OWXA 1WUUA 1EWQA 2WONB <