3AVHA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
molecule keywords Integrase
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avhA00
4LSNA 4CGJA 4CEZA 5J2NA 2DFEA 2OPSA 5D3GA 1EP4A 1Q9XA 3OYJA 1XWLA 1NOYA 5JS1A 3PO5A 4C8NA 4ELVA 1XHXA 3VQ4A 3ITHA 1X9SA 3DLBA 1O1WA 1JLBA 2PY5A 5SWMA 2KTQA 2HHXA 5CYQA 2G8FA 5KRTA 4DWIA 4OKKA 4O0IA 4M3WA 1I3AA 3HVTA 1KFDA 3K2PA 3OVNA 1IO2A 3QIPA 1TL1A 2KW4A 4GVMA 2G8KA 1BI4B 1RBSA 4RW4A 2G8WA 3DLHA 1JXBA 3SV3A 1CZ9A 1VSKA 3WNEA 4CFDA 3QEPA 2PYJA 1BGXT 1TK8A 2OYQA 4OPJA 3KLFA 4NYNA 1TAUA 1D8YA 4C8MA 1B92A 3AO5A 1HMVA 3OJUA 3RWUA 3NBPA 1QHTA 2EX3A 3ZSXA 3OYFA 3QEXA 5CZ2A 1N5YA 3ZT0A 3TAEA 3T1AA 1HRHA 3ASMA 3ISNC 1C1BA 1HYVA 1SKWA 4IFYA 1ZBIA 4DSLA 4F2RA 4EP5A 3OYBA 1S6QA 1UWBA 4ICLA 2D0CA 4TSXA 1I39A 4GW6A 4BWMA 2D0BA 3VQ7A 4RW6A 1SKSA 2ZD1A 4Z4FA 1QTMA 4FZXC 1R0AA 1NKBA 3V1RA 4CIFA 4Z4EA 4KFBA 4FM0A 2X6SA 4CHZA 1UAXA 2RN2A 4FK2A 3DM2A 4B9MA 1S1UA 1ZBHA 1BI4A 4K8XA 4O44A 2XHBA 4O5BA 2ZE2A 3IRXA 1RCHA 4LH4A 1VSHA 4E7JA 4DTOA 1D9FA 3DLRA 1WAFA 4KTWA 4DFJA 3PV8A 3ZSOA 1JLEA 2OPQA 3VQEA 4CEOA 1FKOA 4W5TA 3HYFA 4CHPA 3SCXA 1GOCA 4JS4A 4BACA 3KJVA 4BDZA 3L8BA 4M45A 3VQBA 4CGDA 3NGZA 1BL3A 2KQ2A 4FLXA 4DF4A 2G8VA 1TK5A 4CGFA 1SV5A 1LWFA 4CHNA 3KKSA 2P1JA 4MFBA 5C25A 3KD5E 4DSIA 1X9MA 4B8CA 3HT3A 2RKIA 1XHZA 4M41A 4E1NA 3HSTB 4NYFA 1VRTA 4BDYA 1L3VA 1VRUA 1VSMA 2HHUA 2IS3A 3H08A 1NJZA 1ZBFA 4B8AB 3S9HA 3HM9A 3SUNA 2VG6A 3AVGA 2ATQA 4RW7A 3HPOA 1IH7A 3TAFA 4B9VA 1RT3A 3VQQA 3NF7A 3OYCA 4CJ4A 1RDDA 3LP1A 3VQ8A 2QKBA 2W42A 5J2QA 5HLFA 5CYMA 2YNFA 1D9DA 1S1XA 2OZMA 4FJKA 3QEVA 2I5JA 3AVBA 4FW1A 2YKNA 1GOAA 3M8SA 4JS5A 1HNIA 4ID5A 1NK0A 1RNHA 5C42A 4CJQA 4KHNA 1RBUA 2YHAA 2KZMA 4FXDA 2XY7A 2IAJA 3CFOA 2PZSA 1W0HA 4N47A 2NUBA 3C6UA 4CK2A 3IAYA 2PYLA 2FBYA 2HNZA 3OYGA 1JKHA 3AVNA 3QINA 1ZBLA 4BE2A 1YT3A 1REVA 5HRPA 5HP1A 1J54A 1JLCA 3ZSQA 1IKWA 3OS0A 4OLBA 3KTQA 2GV9A 1UA0A 3JYTA 3K5MA 3LP0A 1WSEA 2HW3A 3KLGA 4KPYA 1S6PA 4AHUA 4EP4A 2QKKA 4CJEA 3KK1A 3CFRA 4OGCA 4AHTA 2IGIA 4CGHA 1YVUA 4FJ5A 1JLFA 4HCBA 3CQ8A 1WSFA 3SUPA 5FDLA 3L2VA 2D0AA 1NK7A 1WSIA 4CF8A 3UIQA 4RW9A 4CJ3A 1BCMA 3C6TA 4ELUA 5HRRA 1J9AA 4F3TA 2R7YA 4N56A 3HP6A 2O4IA 1RT7A 2IOCA 3L3UA 3PUFA 5J2PA 2D5RA 3ULDA 4IKFA 1C0UA 3TANA 3V9WA 1RDBA 4KREA 4CJLA 3SV4A 4FJGA 4Q5VA 2HNYA 3K5LA 2ITGA 2Z1IA 4E19A 3TAGA 3TAPA 4DQIA 4M3RA 3L2WA 1QSLA 2KFZA 4DQRA 4AHSA 4AILC 1L3SA 4B08A 3SI6A 3AO1A 1N6QA 2E4LA 4DSEA 4DU3A 4KI4A 3TAQA 1B9DA 3OYHA 1CZBA 4CEEA 3SQ4A 3SYZA 3VQ9A 3KLEA 1CXQA 3TR8A 3ZCMA 4DU4A 1QQCA 3V6DA 4E3SA 4FVMA 3RMCA 2HHQA 3NF6A 1FXXA 3K59A 4UQGA 4W5OA 1EKEA 3NHGA 4FK0A 4YNQA 3SJJA 4Z4HA 4FZZA 4N76A 4OKJA 4BE1A 4E0DA 1WNSA 1J5OA 1KVCA 4DTRA 1RILA 4KTZA 1SL2A 3HPGA 3BGRA 3A2FA 4FLTA 4KB1A 1NK9A 3ZT4A 1U47A 1KLNA 2B4JA 4RW8A 5FROA 3JSMA 4FM1A 2OZSA 1WLJA 3WNHA 4AHVA 3ALYA 2JGUA 1BIUA 3G10A 3CM5A 4JRPA 3DMJA 4DTMA 5J2MA 4L8RB 3MEEA 1KTQA 3HPHA 4B9TA 3V9UA 3V81A 2YNGA 3AVKA 1LAVA 2A1RA 4CJSA 3MEGA 3AVFA 3NFAA 1KLMA 3ZT3A 2HMIA 4RG8A 1T7PA 3LWLA 4CFAA 3L2QA 3VQ6A 4CEFA 3DLEA 4M3TA 1A5VA 4HVJA 3AO2A 4DTJA 3EYZA 4FM2A 3KLHA 3G0ZA 1NKEA 2P5GA 1A5WA 2IDOA 2BDPA 1ZYQA 2HHWA 2O4GA 4E7LA 3AVIA 1S1TA 5C24A 3CG7A 4FLYA 1LWCA 2E6MA 4J2EA 3TI0A 3V1OA 1RT5A 3S3MA 1BQMA 4CK1A 4Y1CA 3VA3A 2HHSA 1QS4A 1ZBUA 2G8UA 4OLAA 2HVHA 1A5XA 4Z4GA 1IG9A 3O4NA 1WSGA 3AVAA 3VA0A 1CLQA 4CF9A 4CJVA 4CESA 3C94A 1BQNA 3OS2A 3OYKA 3MEDA 5KGWA 1Q8IA 4DTSA 1C1CA 5FRNA 4HUFA 3TARA 1K6YA 4O55A 4B9LA 4DQPA 3AO3A 3V9SA 1LAWA 3HK2A 1IKXA 3V4IA 2Y1IA 1C0MA 4I2PA 2ZQBA 4O0JA 3HJFA 1ASWA 3PX0A 3RMDA 3DRSA 1JLQA 3MXMA 1HPZA 2FBTA 3IS9A 3LP2A 3NDKA 3MXJA 1IKYA 4FW2A 1D5AA 3P1GA 4Z0UA 4CGGA 3OYDA 3KK3A 4E7IA 4DFKA 3SZ2A 1NJXA 4F2SA 1RBTA 1KRPA 2BGGA 3V9ZA 3QESA 4LSLA 3QO9A 3DYAA 3V9XA 2F96A 3KLIA 3NCIA 3DOLA 4CEAA 4FLVA 1C0TA 1F21A 3ZSVA 5E41A 3LDSA 3WNGA 4E7KA 4DTNA 4KKOA 5HRSA 3VQPA 4PA1A 1HQUA 1L5UA 4DQSA 4J2DA 4DTXA 5KTQA 3VQAA 1L3UA 3AVHA 4FK4A 4IBNA 4O4GA 3D0PA 3I8DA 4DU1A 4I9QA 4M3XA 3AV9A 1VSIA 2HHVA 1VSLA 2Q3SA 2DFFA 1UA1A 4ELTA 1YTUA 2B6AA 3QIOA 4ZHRA 1U4BA 4LY7A 3KD1E 2ETJA 4PQUA 2XY5A 3B6PA 3MXIA 3OYIA 3RTVA 4PUOA 1HYSA 4H4OA 1KSPA 3DRRA 1S1VA 5T7BA 3OYNA 3KK2A 3RMAA 4C8OA 4AH9A 4JRQA 1Q9YA 4K8ZA 4ZTFA 1NK6A 1VSJA 2IC3A 4CF2A 4KHYA 1RBRA 3SUOA 4BDPA 4DSJA 4CJ5A 2E6LA 3HL8A 4FJNA 1L3TA 1C6VA 4B3OA 1W9HA 3U6FA 1LW0A 1RT4A 1Z25A 3KKRA 1JXEA 3P5JA 4WE1A 4OVLA 1LW2A 4BWJA 3E01A 3PX4A 3QNOA 3KIOA 4EZ6A 4KTQA 3HVRA 4FJ8A 2Z1GA 4LH5A 4AHCA 1JLAA 4HUEA 3OY9A 3ZSZA 1T8EA 3AA3A 3NH1A 3NE6A 3VN5A 2YNIA 2JLEA 3K5NA 1EETA 4OGEA 4BE0A 1MU2A 4DLEA 3I0RA 4KHUA 1CXUA 4W5NA 1KCFA 3VQ5A 3M8RA 3DI6A 4FLUA 3T19A 1QSSA 1RTIA 3LZIA 4M3ZA 1TV6A 4J2BA 1IKVA 1EXQA 1KVBA 4KB0A 1VSEA 4HCCA 5FRMA 1TKDA 4DMNA 1WSHA 2KFNA 5KI6A 1RT6A 3QETA 4HHTA 3RRGA 3VQDA 4KAZA 4H4MA 3TAMA 4PWDA 5HBMA 4DF8A 3DLGA 4JLHA 4R5PA 4CJWA 4YFUA 2X78A 3OYEA 1NOZA 4M3YA 2FBXA 1C1AA 4KHSA 4FJLA 4FLZA 1S1WA 4KHQA 3F9KA 3O3HA 4FJIA 1BIZA 3LZJA 1NK8A 4M42A 3RMBA 2HVIA 3PY8A 3RRHA 4W5QA 4OJRA 2X74A 2VWJA 3AO4A 3HXMA 4Z4CA 1QE1A 1U48A 1NKCA 2XRIA 2EHGA 3DRPA 4CJUA 4B9SA 3ZSWA 3AA2A 4CHOA 1SUQA 3QERA 1YTAA 4DSFA 4EZ9A 3DOKA 3OS1A 3BDPA 4N41A 4ID1A 1TL3A 3LWMA 4CHYA 4CEBA 4QOZB 2YKMA 2G8HA 2AJQA 3C95A 3SPYA 3EY1A 1TKZA 1JL2A 3AVLA 3NF8A 2Y1JA 3ZT2A 5JS2A 2WOMA 4CGIA 1X9WA 3T3FA 4CF0A 4B9NA 3TABA 4Q0BA 3MAQA 4FCYA 1ASUA 3RR7A 3PO4A 4C8LA 1NJYA 3CFPA 4KO0A 3NGYA 3V1QA 3THVA 2QXFA 4FYDA 3NGIA 1HJRA 1WN7A 4AHRA 1U49A 2BE2A 4B9UA 1BCOA 3LP3A 1S9GA 3LANA 4FZYA 2YV0X 1TKXA 3U3GA 5I42A 4H8KA 1QSYA 2Z1JA 1UOCA 3MECA 1J53A 1HQEA 2F8SA 1TK0A 5KGXA 4KI6A 4CEQA 3L2UA 4E7HA 3U3YA 3QEIA 1BHLA 3LALA 2KZZA 4DQQA 4F8RA 4I7FA 3S3NA 2OA8A 2GUIA 3RR8A 1LV5A 3OYLA 1HYZA 4CIGA 5J1EA 3NF9A 2HB5A 1GOBA 1SL0A 1U45A 1S9EA 1TAQA 4N5SA 1RTDA 4FLWA 4FJJA 2A1SA 3QLHA 1NK4A 4J2AA 4FJMA 4FJHA 2RF2A 3O4QA 3SQ1A 2OPRA 1NJWA 4E89A 4IDKA 2Z1HA 2HHTA 1SKRA 1TKTA 1VSDA 1Z26A 4Z4IA 2QK9A 3ZSRA 2DFHA 2YHBA 1VK0A 2DTUA 4FJ7A 2BANA 5EU7A 3WNFA 3I0SA 3NH0A 1DLOA 1JLGA 3TWHA 3ZT1A 4CECA 4Y1DA 4DTPA 4FJXA 4CCHA 4NCBA 1XI1A 1VSFA 3M8QA 1U04A 1BISA 4DSKA 1RTJA 3M8PA 1HNVA 5DMRA 3VQCA 2XY6A 1ITGA 2OPPA 3LAKA 2VG7A 2FC0A 4HUGA 2B5JA 4M3UA 2DY4A 1ASVA 3K5OA 1RT2A 5DK5A 4DFMA 3S3OA 1RDAA 1RBVA 5K14A 1WAJA 2GBZA 3K57A 3LPTA 5SZTA 3D45A 3AVJA 1DTQA 3LAMA 4CERA 2P51A 4CF1A 3CM6A 1G15A 4GMJB 4DS5A 3OYMA 4C8KA 2YNHA 4IG0A 4LD0A 2G8IA 3FFIA 2HNDA 2F8TA 4CK3A 1T05A 3O3GA 2XO7A 4CJKA 3QNNA 3SQ2A 1RT1A 4I2QA 3AA5X 3DLKA 5I3UA 1S5JA 1FKPA 1LWEA 3NH2A 2WONA 3P83D 1SL1A 2LSNA 2VG5A 2XY8A 4IG3A 4QAGA 4DTUA 4E1MA 5HROA 3SQ0A 5KRSA 4DLGA 3SNNA 1T03A 4CIEA 4QCLA 1TGOA 4CE9A 2FBVA 4CJRA 5HRNA 4ZTJA 2RPIA 4NCAA 4KHWA 4KRFA 1JL1A 3IG1A 3B6OA 1RTHA 3L3VA 5CY4A 1EX4A 1X1PA 2VWKA 1RDCA 3CYMA 5CZ1A 4DG1A 4OPKA 4DS4A 4G1QA 3SUQA 1DTTA 4MQ3A 2P5OA 3OJSA 3AVCA 1B9FA 3OYAA 4PY5A 3AA4A 1KVAA 4CJTA 1TVRA 1XC9A 1NK5A 3LPUA 3QEWA 3ZSYA 3HO1A 4F4KA 4XIUA 4KV8A 4CJPA 4CFCA 1Y97A 4F3OA 4CHQA 4I9LA 4IFVA 3O3FA 4CEDA 4HTUA 3AVMA 3HP9A 3NAEA 3L2RA 1WSJA 4FJ9A 4W5RA 4NCGA 4OKEA 3F73A 1FK9A 4CJFA 4DFPA 1KFSA 3EZ5A 2X6NA 3K58A 3SPZA 4CFBA 3PX6A
chains in the Genus database with same CATH superfamily
2A6AA 4JKFA 1HKGA 4CEZA 5J2NA 2DFEA 5D3GA 1OVQA 4AM6A 4C8NA 1X9SA 3DLBA 5SWMA 3VOVA 5KRTA 1VQNN 4OKKA 4M3WA 3L4QA 1I3AA 3HVTA 4NXNK 2D1KA 4ISFA 3ENHA 4GVMA 1J5EK 4XEIA 4BC2A 1JXBA 3WNEA 1VQKN 2AP1A 4KH4A 4O8UA 4IEEA 3KLFA 4JV5K 3QFUA 1TAUA 4C8MA 3BEXA 3IKMA 3NBPA 1HNWK 3OYFA 5CZ2A 3ULEA 3DXMB 2ITMA 1VQ9N 1HYVA 1SKWA 4IFYA 2P9PB 1BA0A 3OYBA 4ICLA 2D0CA 4GW6A 1SKSA 2D0BA 3VQ7A 4RW6A 4Z4FA 4FOEA 1R0AA 1NKBA 4CIFA 4AM7A 2HBMA 2X6SA 2RN2A 3DM2A 4B9MA 3BY5A 3AGKA 2ZE2A 4H03B 2P9IA 3VEZA 1T6CA 1VSHA 4DTOA 1WAFA 3VEYA 1ESVA 5E26A 4B1UB 4BR7A 3ZSOA 4JI3K 4W5TA 1KC8O 1R59O 4BDZA 3L8BA 3WXMB 4CGDA 2ZJQL 1BL3A 2G8VA 1SV5A 4CHNA 2P1JA 2RKIA 3HOSA 1VRTA 4JI1K 3FZFA 4CZFA 1ZBFA 3S9HA 3SUNA 2VG6A 3E9OA 2ATQA 1DT9A 3I55N 5J2QA 3MN6A 4FW1A 3FFKB 2YKNA 3M8SA 4JS5A 4ID5A 3T1HK 4BRGA 4C23A 5IT9O 3H6EA 1GLJO 4FWMA 1VQ7N 1W0HA 4H0XB 3AVNA 1ZBLA 3WXLA 5HRPA 1JLCA 3ZSQA 4OLBA 4DV2K 2GV9A 5AQLA 1UA0A 1WUAA 5HL7L 3JYTA 1LOTB 3K5MA 4X64K 2HW3A 3KLGA 3NMUA 3QBWA 1VQ4N 4CJEA 4AHTA 4CGHA 1I94K 1YVUA 4FJ5A 2FXUA 4LF8K 3CIPA 2E88A 2KLAA 4RW9A 1IG8A 4O5FA 4CJ3A 5AFUA 2VQFK 3C6TA 3WEEB 1J9AA 1LCUA 4F3TA 3HP6A 2IOCA 2UUBK 5C12A 2UXDK 3V9WA 3SV4A 4FJGA 2HNYA 3AGRA 2Z1IA 3A5LC 3TAGA 2UUAK 1ZC6A 4C1NI 4JKEA 1L3SA 2OTLN 1N6QA 3G4SN 3TAQA 1B9DA 3SQ4A 1NGEA 1NWKA 4B9QA 3C0BA 3NHGA 4W5OA 1EKEA 2Q0UA 3O08A 4YNQA 4WYBA 5BRHA 1YAGA 4BE1A 5GINA 1KVCA 3R3LA 4DTRA 3HPGA 3A2FA 4FLTA 1NK9A 1U47A 2B4JA 3GOIA 4BR2A 2YHYA 3VPZA 3DMJA 5GAEP 5J2MA 5MLCQ 2NRTA 3V9UA 3VESA 3V81A 4CJSA 2Q2RA 3NFAA 4BRKA 4DR7K 3ZT3A 4CBUA 3CC4N 4JN4A 3DLEA 4HVJA 4WFNL 4PKIA 4FM2A 4FWPA 4B3MK 2IDOA 4YDUC 3SLCA 1GLAG 5C24A 4LF5K 1RT5A 3CERA 3MK6A 1ZBUA 5JVHL 4YOTA 4Z4GA 1IG9A 5IWAK 3AVAA 3WXIA 5BPNA 3MEDA 5FRNA 4HUFA 2FF3B 1Y64A 3AO3A 3V9SA 2ZQBA 3EN9A 1DKGD 3H45C 3IS9A 3MXJA 3WT0A 4DSLA 1NJXA 1C0GA 4H5NA 3OYDA 4F2SA 2BGGA 1RBTA 3V9ZA 3DJCA 3QESA 2IVNA 4FLVA 1C0TA 1F21A 4KKOA 4IFEA 3U8XA 5KTQA 4FOIA 4UY8O 4RWTA 5I9EB 4HWIA 5F1XA 3D0PA 4B1XB 4EHTA 1E3MA 3AV9A 1YXQA 2UXCK 3QIOA 3HSCA 4IO8A 3T1YK 3TPQA 4PQUA 2KHOA 2QWMA 3UKUA 4WCEL 5JICA 3SBGA 1O13A 4H4OA 1S1VA 3KK2A 1X3MA 4BRAA 4AH9A 1NBWA 4JAXA 4GV6A 1NK6A 2O8BB 1HX1A 3MCPA 2A40A 1ZBSA 3HL8A 4PKGA 1ATNA 4BVPA 1QQMA 3P5JA 2Z1GA 1JLAA 3OY9A 3AA3A 1K8KA 3NH1A 5E84A 4BRFA 4KHUA 4W5NA 4FLUA 1QSSA 1VQON 3FZHA 1TV6A 4J2BA 1EXQA 3TTCA 3CCLN 4HTLA 4FWQA 1KQSM 4BRCA 5KI6A 1RT6A 3I33A 3RRGA 4DF8A 1Z6RA 4YFUA 5M1OA 4WQ4C 4FJIA 4BREA 3RSEB 3THYB 3HM8A 2OTJN 2X74A 3K0SA 3O9UA 3HXMA 4H5TA 4B9SA 3ZSWA 2QXLA 3QERA 3A8YA 4EZ9A 3BDPA 4N41A 3RVCA 1TL3A 4CHYA 5KPTA 2AJQA 2G8HA 4A5BA 3SPYA 1QVFM 3NF8A 4NXMK 3B8AX 5JS2A 2WOMA 3T3FA 5BR9A 4IJAA 4Q0BA 1NLVA 3MAQA 4NLCA 3RR7A 3KWIA 4KO0A 3NGYA 3NGIA 1FW6A 1NU0A 4BC3A 1BCOA 4FZYA 1TKXA 4CZKA 4FSVA 3ZX2A 1J53A 3CC2N 3L0QA 2F8SA 3QEIA 4I7FA 3S3NA 2OA8A 3MX2A 2F4VK 1LV5A 3NF9A 1BO5O 1TAQA 4N5SA 1RTDA 4FLWA 1BOTO 1XMOK 4FJHA 3SQ1A 1XNQK 4DR6K 1NJWA 4E89A 2Z1HA 3CJAA 1VSDA 4WFAL 4Z4IA 2O8CA 4FWRA 2QK9A 4CBWA 2DTUA 2BTFA 3LL3A 2BANA 4LF4K 3WNFA 3I0SA 5LJWA 1YJ9N 1IJJA 4CECA 4BRMA 3TSQA 4CCHA 1XI1A 1E4GT 4NCBA 5AQXA 1U04A 4DSKA 4GKJK 3VQCA 2XY6A 1ITGA 2ZF5O 4M3UA 4HUGA 2B5JA 4IOCL 3K5OA 1RDAA 2HBLA 3LPTA 4BRIA 5SZTA 3D45A 3AVJA 4CERA 4IWVA 4LD0A 4IG0A 2G8IA 2F8TA 3O3GA 4JKCA 5I3UA 5BPLA 3P83D 2LSNA 5HROA 4QAGA 1T03A 4PWDA 2CGJA 4ZTJA 4NCAA 3A5NC 3D2EB 2FSKA 4OPKA 1OH7A 5AQFA 2GX9A 4JK8A 3OYAA 4PY5A 3AA4A 5FPNA 1XC9A 1TVRA 3LPUA 3QEWA 3ZSYA 4BR5A 5LY3A 2FLOA 4CFCA 3AVMA 3L2RA 3PIPL 4W5RA 4DFPA 3K58A 4LSNA 3I56N 3PLAA 3VMFB 2OPSA 1NOYA 3CCMN 5JS1A 3PO5A 4LFCK 4ELVA 3VQ4A 1JLBA 2YHWA 4KH6A 4DWIA 3O9SA 4FPBA 3K2PA 4U7BA 2KW4A 2G8KA 4CD3A 4IOXA 4CZHA 1CZ9A 1VSKA 1BGXT 2OYQA 4OPJA 2QI2A 1B92A 1HMVA 3RWUA 2EX3A 3ZSXA 2O8FA 1HRHA 1YF5L 4FO0A 2NRHA 1IBLK 1QZ5A 4EP5A 2Q97A 1UWBA 3V1RA 4MLEA 4GV9A 3VEVA 3ID8A 4K8XA 2QA4N 2XHBA 4O5BA 5CHIA 1D9FA 4E7JA 2QWPA 4DFJA 3VQEA 4CEOA 4LFAK 3SCXA 1GOCA 2NLXA 4JS4A 4MO4A 3KJVA 2W6KA 3KK7A 3CQYA 2UXBK 4YOXA 5ADXA 4FLXA 4LC9B 5JLFA 4DF4A 1TK5A 1RFQA 3O9RA 3EZWA 5AQVA 3KKSA 1Z05A 4I6MA 3THWB 1X9MA 3HT3A 1XHZA 2HHUA 3GDQA 3H08A 1S3XA 1IH7A 3TAFA 3NF7A 1RDDA 3LDQA 3VQ8A 2QKBA 5HLFA 2YNFA 3EL2A 1S1XA 2OZMA 4BRLA 2I5JA 1GOAA 5C42A 5AQUA 4CJQA 2YHAA 3E9LA 5AQYA 4FXDA 3VEWA 3CFOA 2PZSA 2NUBA 3DXMA 2PYLA 4K0KK 3OYGA 4WQ5C 3QINA 1WOQA 4BE2A 1REVA 5HP1A 4DV3K 3LDNA 2YCHA 5AQIA 2E1YA 4H0PA 4IXCA 1WSEA 3J7YP 4KPYA 1S6PA 4AHUA 3O80A 1JLFA 3SMPA 4HCBA 3SUPA 1WSIA 4BR4A 4CF8A 2CH6A 1BCMA 3FZKA 5HRRA 3WQUA 4GKKK 3R9PA 3J7AP 5J2PA 4IKFA 4BRQA 1C0UA 5ADXH 3K5LA 2ITGA 4FL9A 4MO5A 4IDHA 4E19A 4YOUA 3L2WA 1DEJA 1GLBG 2KFZA 3JXUA 4PL7A 4JEPA 5C10A 2GTDA 2E4LA 3E66A 1CZBA 3CXCM 2NRRA 4BRHA 3KLEA 3PSIA 4CBXA 4DR3K 1QQCA 5C0YA 2VYPA 4FVMA 3RMCA 2HHQA 3NF6A 5AQHA 4UQGA 4NLBA 4A2AA 4FK0A 5AZIB 4Z4HA 4FPAA 4OKJA 5FPEA 2O8BA 1J5OA 3J7ZO 5M1FA 4KTZA 1GLCG 2V7ZA 4KB1A 5BRDA 3Q7BA 5FROA 2OZSA 1WLJA 4AHVA 3ALYA 1VQ8N 4JRPA 1ATSA 3MEEA 1KTQA 3HPHA 4B9TA 4JHDA 3AVKA 3AVFA 1NNEA 3CF5L 3G25A 1KLMA 3W3DA 2BH1A 1T7PA 3A0IX 4CFAA 5C15A 3L2QA 4H0VB 3TTDA 4M3TA 5GIOA 5AQWA 3U9ZA 3G0ZA 1NKEA 2PAVA 2HHHK 2HHWA 2O4GA 4DUZK 3AVIA 3CG7A 2OANA 1YJNN 4J2EA 4JI8K 1BQMA 4CK1A 4KH5A 3VA3A 2HHSA 1M90O 4JKBA 4JI7K 4OLAA 2HVHA 4BR9A 1A5XA 1WSGA 5JMVA 1CLQA 4CF9A 3CJBA 4CESA 3OS2A 1SZ2A 3GG4A 4BY9C 4DTSA 1K6YA 1NGCA 2WUSA 3HK2A 2Y1IA 3V4IA 4ILGB 3HJFA 1ASWA 5TKYA 1RDUA 3W0LA 2O8EA 3NDKA 4FW2A 4Z0UA 3KK3A 4E7IA 4DR1K 3QO9A 2IVPA 3DYAA 3EKUA 3KLIA 5BRFA 3DOLA 5E41A 3LDSA 4DR4K 1L5UA 3BP8A 2YHXA 3ZYYX 2VQEK 4J2DA 4DTXA 5EX5A 3VQAA 1L3UA 3AVHA 1VQ6N 3VF4A 3EKSA 1P8ZA 4WFBL 4B1YB 3MX5A 1NGAA 2ETJA 3B6PA 4JD2B 1HYSA 1C0FA 3DRRA 4EFHA 5T7BA 3RMAA 4C8OA 3FLCO 3QDKA 4ZTFA 4R79A 2IC3A 3D2FB 4JI2K 4DSJA 4CJ5A 5AQNA 1L3TA 3SAGA 3U6FA 3K9JA 1LW0A 1Z25A 3KKRA 3UKRB 1JXEA 5I42A 4KI6A 4FWNA 5GADP 3QNOA 3KIOA 1T8EA 3ZSZA 1KAXA 3BZKA 3NE6A 3VN5A 4BC5A 2YNIA 2JLEA 1EETA 1N36K 1KAZA 2P9SA 4DLEA 5EXWA 5BPMA 1HNXK 3VQ5A 4V19S 3DI6A 1TUYA 1RTIA 3OTOK 3CJCA 1KVBA 4X62K 5FRMA 3A5OC 2P9UB 1TKDA 2DPNA 4IJNA 3QETA 5EVZA 4CJWA 4FJLA 4YOYA 4KHQA 3F9KA 5FLXO 3P4IA 5FPMA 2PBDA 3AO4A 2XRIA 4CJUA 5GAGP 3ZEUA 3AA2A 1SUQA 3SBTA 1MDUB 3IFRA 3TSUA 4CEBA 4YOWA 5GIPA 2E1ZA 3J8AA 1OH8A 1JL2A 2W6LA 3T69A 1G99A 1BU6O 1X9WA 5KQ8A 5AQTA 4FCYA 3SJHA 4C8LA 1N34K 1NJYA 4EIAA 3CFPA 2O8CB 3QFPA 2VCPA 1HJRA 1WN7A 1U49A 4ILHA 4B9UA 3LANA 1OVYA 4H8KA 1IBMK 3MECA 5LMUK 3L2UA 2KZZA 2P9SB 4DQQA 4B1VA 3OYLA 4CIGA 1GOBA 4J2AA 3KWGA 2RF2A 2OPRA 1SKRA 1XC3A 3M6GA 4JKAA 1VK0A 3L6QA 4H5RA 3VGMA 3H3OB 3VGKA 4DTPA 2ASMA 3M8PA 1BDGA 1NGIA 4H0TB 1RT2A 5DK5A 3O6WA 3DWLA 3SMSA 1GLFO 1DTQA 4JK9A 3UKUB 4C8KA 4OPHA 1T05A 2XO7A 3DLKA 1S5JA 1FKPA 4LFBK 1BWFO 4IG3A 3SNNA 1NGHA 4CIEA 1CZAN 3JS6A 1EQYA 3IG1A 5CY4A 4M3ZA 2KKZA 3LM9A 3ENOA 4I6MB 3OJSA 1B9FA 3KZBA 4YORA 4CJTA 1HNZK 4XIUA 5AZJB 1NJIO 3AARA 4GV3A 2HOEA 1U2VB 2O8DA 1Y97A 4CHQA 4I9LA 4IFVA 3F5TA 3UB5A 3NAEA 3WXJA 2F9WA 3R1XA 4NCGA 4OKEA 4CJFA 4BRDA 1XNRK 4CFBA 3PX6A 4CGJA 4PL8A 1EP4A 3EEQA 1K9MO 3ITHA 3DXKA 4M7XA 2PY5A 5CYQA 1FJGK 1XUPO 4O0IA 1YVNA 2F7TA 1IO2A 3QIPA 1TL1A 4JI5K 4RW4A 5AQOA 3ZETB 3TU5A 2PYJA 3TSPA 3U9DA 1TK8A 2AA4A 4NYNA 4JI0K 3AO5A 3OJUA 1N8RO 1QHTA 5BREA 1N5YA 3ZT0A 3TAEA 4A57A 3MCAB 3ISNC 1KAYA 1C1BA 4QS7A 4F2RA 3HI0A 1S6QA 2P9UA 4TSXA 2GEMA 1QTMA 1HJOA 4FZXC 4BGAA 4Z4EA 1S72N 1S1UA 1BI4A 2O8DB 4O44A 4YDUA 3H46O 3LDPA 4L3QA 3Q7CA 2Q1NA 3DLRA 4FWSA 4KTWA 5AZIA 5CR4A 3PV8A 2E5LK 1JLEA 2OPQA 3WEEA 4O8KA 1FKOA 3F9MA 4CHPA 4BACA 4MLHA 3ZX3A 3D2FA 3DXKB 4M45A 4OPAA 3NGZA 2D0OA 2YX6A 4JI6K 3BUZB 2CGLA 4CGFA 4JK7A 1XQSC 3KD5E 4DSIA 4M41A 4E1NA 3HSTB 4JI4K 4IO9L 4K25A 4BDYA 1VRUA 1L3VA 4RCHA 1VQPN 3AAPA 3HM9A 4RW7A 3AVGA 3HPOA 4B9VA 3VQQA 3WQTA 4CJ4A 1YITN 3LP1A 1EO1A 2W42A 5CYMA 1VQMN 4BQZA 2FSJA 5M1NA 3ENBA 1GLEG 3AVBA 5AR0A 4KHNA 2KZMA 4K43A 2XY7A 2RHKA 1W97L 4B1WB 3CC7N 4CK2A 3IAYA 3HBTA 2HNZA 1JKHA 1YT3A 1J54A 3CCJN 1IKWA 3KTQA 1J6ZA 2GWJA 3LDLA 3LP0A 4EP4A 3KK1A 4OGCA 2IGIA 1D4XA 3UE5A 3CCSN 2QTDA 1WSFA 1YJWN 3L2VA 1NK7A 4FWKA 1T3VA 1GLDG 1M1KO 4ELUA 4GY2B 5GAHP 2R7YA 2P9PA 4N56A 2O4IA 1RT7A 3L3UA 3PUFA 2VWBA 4CVNE 3TANA 5AQGA 1Q82O 1RDBA 2FSNA 4KREA 1QHAA 4CJLA 2ASPA 4MDAA 1DGKN 2NNWA 4YOVA 1Q81O 3BF3A 4M3RA 4LF6K 1QSLA 3THWA 1V4TA 3VGLA 4DU3A 4KI4A 3SYZA 3VQ9A 1CXQA 3V6DA 2YJFA 4E3SA 3E9PA 2V7YA 5C2FA 1FXXA 2GELA 4PHTX 5AQKA 2WFBA 2ZJPL 4FZZA 4N76A 3M5RA 1SL2A 1OH6A 3BGRA 1XMQK 1KLNA 4K42A 4RW8A 3JSMA 4YY3K 3RTVA 4DTMA 1ZBHA 2JGUA 1BIUA 3G10A 4X65K 3NVMA 1NGFA 5M1QA 3H1QA 4A59A 5M1PA 1VHXA 4YHHK 4QS9A 2HMIA 4RG8A 4KHPK 3VQ6A 3HRGA 5HOOA 1A5VA 3AO2A 4RTFD 3CJ1A 1A5WA 3GE1A 3NVKA 2BDPA 2NRXA 2HBJA 4E7LA 1S1TA 5LJVA 2Q0RA 1TUUA 1LWCA 3EE9A 2E6MA 3TI0A 3S41A 3G6EN 4DQ8A 1QQNA 4CZGA 1QS4A 2NRWA 2HBKA 4H0YB 3VA0A 3LDOA 4A61A 4CJVA 3M1FA 1BQNA 3H3NO 5KGWA 5JLHA 1C1CA 3OW2M 3OBWA 1IKXA 4ISGA 1C0MA 4I2PA 4BR0A 3EE8A 4ILJA 4O0JA 3PX0A 3RMDA 3DRSA 1HPZA 2FBTA 3LP2A 4DV0K 4DV4K 1IKYA 4DFKA 3P1GA 4CGGA 2BUPA 3SZ2A 4LF9K 1KRPA 2GUPA 2F96A 3NCIA 4GNIA 3CCUN 4E7KA 1SQKA 5HRSA 3VQPA 4PA1A 1HQUA 4FVUA 3MDQA 5EOYA 3ZETA 3MMVA 2V52B 4FK4A 4IBNA 4M3XA 1VSIA 4JKHA 2HHVA 2Q3SA 4ELTA 5TKWA 1YTUA 2B6AA 1NMNA 4ZHRA 4LY7A 4DKWA 2XY5A 3SAHA 3MXIA 3RSEA 1HUXA 3C65A 3OYNA 2UU9K 1Q86O 3D6RA 1Q9YA 4KHYA 4CF2A 3SUOA 4BRNA 1T6DA 1C6VA 1W9HA 4H5VA 2A3ZA 3O9TA 2QWRA 4DHYA 4BWJA 3PX4A 4OVLA 3QBXA 3HVRA 2QWNA 4HUEA 3K5NA 1MU2A 3I0RA 1HKCA 2D0PA 5KPRA 1CXUA 3M8RA 4CZMA 3T19A 4CJ7A 1IKVA 4HCCA 1WSHA 2KFNA 1NMDA 3R8EA 1GLLO 3QICA 4HHTA 4KAZA 5BN8A 3U4LA 3TAMA 3DLLL 4JLHA 4WF9L 1NOZA 2FBXA 1C1AA 4KHSA 1E4FT 4FLZA 1S1WA 3LZJA 2I7NA 1BA1A 1NK8A 3RMBA 4M42A 4OJRA 1QE1A 1Q18A 2EHGA 3CHWA 3ATVA 1U6ZA 5AQZA 4QS8A 4DSFA 3DOKA 5LMNK 3LWMA 3P39A 3C6AA 4QOZB 3CPEA 3C95A 1JCFA 5AJ3K 3EY1A 2CH5A 3O8MA 2CGKA 5DM6L 3CI5A 1SAZA 2Y1JA 3ZT2A 4CF0A 4B9NA 2JWLA 2O8FB 1ASUA 3PO4A 4DV7K 3V1QA 4BG8A 4FYDA 2YV0X 3IMXA 1HQEA 4CEQA 2VGMA 4DB3A 4E7HA 3U3YA 3LALA 1QVGM 3RR8A 2NRVA 5J1EA 1X9JA 1SL0A 1VQLN 1S9EA 1EWRA 1EWQA 4FJJA 2A1SA 3E1YA 4G9ZA 1TYQB 2HF4A 2V51B 2J4RA 4PKHA 2NRZA 1TKTA 1Z26A 3C6HA 3ZSRA 4Z94A 2A42A 1NG9A 4FJ7A 4J8FA 5AQRA 3NH0A 2WBNA 1DLOA 3TWHA 3ZT1A 1MWKA 4FJXA 2VGNA 1VSFA 3LM2A 1RTJA 1HNVA 3CMAN 3KHYA 2VG7A 2FC0A 2ZM6K 5M1KA 1RBVA 4C1NK 5K14A 2GBZA 3ZEUB 4DUYK 3VF6A 1K73O 1NGBA 1G15A 4GMJB 2YNHA 2HNDA 3K9KA 4CJKA 4BG9A 1RT1A 2W40A 5DM7L 1LWEA 3JAMO 3NH2A 1SL1A 2Q31A 4DTUA 4E1MA 4QCLA 2P9KB 5KRSA 4DLGA 3D7EO 4CE9A 2FBVA 2RPIA 4KHWA 3T7ZA 2W41A 3L3VA 4DG1A 1X1PA 2A41A 4U67L 2P5OA 1ATRA 1W7AA 1JCGA 1KVAA 1NK5A 4F4KA 3HTVA 4KV8A 4CJPA 4F3OA 4JHDB 3O3FA 4HTUA 3HP9A 1ILYA 4GVEA 4A2BA 3VEOA 3MN5A 4FJ9A 4BROA 3FGUA 1FK9A 5B8HA 3EZ5A 3SPZA 2QWLA 4H5WA 3DAWA 1HKBA 4CI6A 4AF1A 2ZGZA 3CD6N 1MWMA 1Q9XA 3OYJA 1XWLA 1T44A 1NM1A 1XHXA 4MDBA 1O1WA 3O4WA 4BQLA 1JJ2M 2P9LA 2KTQA 3BZCA 2HHXA 3CETA 2G8FA 5AQPA 1WBBA 3OVNA 1KFDA 2NZTA 3L4IA 2P9NB 3ZLJA 5KQDA 1BI4B 1RBSA 2YI1A 2G8WA 3DLHA 3QEPA 3SV3A 4CFDA 1D8YA 4FWOA 2HMPA 3QEXA 1QQOA 2P9KA 5AQSA 3T1AA 3MWTA 3ASMA 5FPDA 1ZBIA 4IZ9A 3ULEB 5LL6Z 2O8EB 4BWMA 1I39A 2IVOA 2ZD1A 3R6MA 4KFBA 1S22A 4FM0A 5BR8K 4CHZA 1UAXA 4FK2A 4BGBA 3O1WA 5F0XA 4JNEA 3IRXA 4F9OA 1RCHA 4LH4A 1YIJN 3OBYA 4XH4A 5AQMA 3HYFA 3VQBA 2KQ2A 1NGJA 3EO3A 1LWFA 4MFBA 3UKRA 5C25A 4CD1A 4B8CA 4NYFA 4EAHD 1VSMA 2E8AA 2IS3A 1NJZA 4B8AB 5JVGL 2A5XA 1RT3A 4DR5K 3OYCA 5BN9A 1D9DA 4FJKA 1HR0K 1N32K 5H1SQ 3QEVA 3ATUA 3VEXA 1VAZA 1HNIA 3GL1A 1NK0A 1RNHA 3OA9A 1RBUA 4OO1J 3VERA 2IAJA 3AAQA 4N47A 3C6UA 2FBYA 2HSTA 2RE2A 3OS0A 3A5MC 2P9LB 2QEXN 2QKKA 3CFRA 3FR0A 2P9NA 3CCEN 4JD2A 3CQ8A 5FDLA 2D0AA 3UIQA 3BF1A 3VTHA 2QWOA 3THYA 2GWKA 2D5RA 3ULDA 4KBOA 3J81O 4Q5VA 3FE1A 3TAPA 4DQIA 1MA9B 4DQRA 4AHSA 4AILC 4B08A 3SI6A 3AO1A 4LF7K 4DSEA 4CZJA 3HZ6A 3OYHA 4E1JA 4CEEA 1YHQN 1HPMA 1K8KB 4M63C 4DCHA 3TR8A 3ZCMA 4DU4A 3GBTA 4WQ4A 3K59A 1IV0A 5AQQA 3VETA 3SJJA 1KXPA 1OKJA 1KD1O 1YUWA 3D2EA 4E0DA 1WNSA 2E20A 3M3ZA 3CCQN 1RILA 1Q7YO 3WXKA 3ZT4A 4FM1A 4B3RK 3WNHA 3CM5A 1NGGA 4L8RB 2YNGA 1LAVA 2A1RA 3MEGA 2ASOA 5CE3A 4DV5K 3LWLA 2E2QA 2F9TA 4CEFA 4DV6K 1TYQA 2EWSA 3EYZA 4DTJA 3KLHA 2P5GA 1ZYQA 1IBKK 4AQYK 4FLYA 3V1OA 4IEIA 5AQJA 3S3MA 4Y1CA 3AY9A 1QZ6A 2G8UA 5EY4A 3VF2A 2E2PA 3O4NA 4FWLA 3C94A 3VTIA 3OYKA 2E2NA 4BC4A 5F2RA 5AZJA 2JWKA 2ZJRL 2WTUA 1Q8IA 3TARA 4O55A 4B9LA 4DQPA 3SK3A 1LAWA 3O9QA 3MXMA 1JLQA 1U2VA 1D5AA 3THXA 4LSLA 3V9XA 2DY4A 4CEAA 3ZSVA 3WNGA 4DTNA 3FZLA 3ID6A 3HOTA 2E2OA 3OHRA 3VENA 4DQSA 2I7PA 4O4GA 4I9QA 3CMEN 3I8DA 4DU1A 1OH5A 1RDWX 1VSLA 2DFFA 1UA1A 2QW9A 3CJ9A 4DR2K 1U4BA 4A62A 3KD1E 4CZLA 3OYIA 4PUOA 4NO7A 1ZXOA 1KSPA 4K41A 2WC9A 4JRQA 4K8ZA 1VSJA 1RBRA 4BDPA 2E6LA 4FJNA 2QWQA 4B3OA 1RGIA 1RT4A 5C2DA 4WE1A 1LW2A 1WB9A 3E01A 4EZ6A 4KTQA 2IIRA 4FJ8A 2H3GX 4LH5A 4AHCA 4XH1A 1NGDA 4OGEA 3N4PA 4BE0A 4CZEA 1KCFA 2HF3A 1N33K 3LZIA 4KB0A 1W2BM 3QB0A 1VSEA 3C7NA 4DMNA 3O5BA 3CQXA 3MWPA 4NB4A 3THXB 3VQDA 4H4MA 5HBMA 3DLGA 3CJ7A 3P31A 4CZIA 4R5PA 2X78A 4EHUA 3OYEA 4M3YA 3O3HA 1BIZA 2QM1A 4JKGA 1VQ5N 3PY8A 2HVIA 3RRHA 4W5QA 1H1VA 2VWJA 2D4WA 1U48A 4Z4CA 1NKCA 5KPZA 3DRPA 3N4QA 3F2KA 3PIOL 4CHOA 4A5AA 1YTAA 3OS1A 3FZMA 4ID1A 2YKMA 1TKZA 3QMLA 2UUCK 3AVLA 4CGIA 5A2QO 3TABA 3TTFA 3THVA 2QXFA 4AHRA 2BE2A 3LP3A 3O1BA 2UYTA 1S9GA 3U3GA 1QSYA 2Z1JA 1UOCA 1TK0A 5KGXA 4X66K 1BHLA 4F8RA 2GUIA 3PSFA 3SAFA 1HYZA 3C7NB 2HB5A 1U45A 3P38A 3QLHA 1NK4A 4FJMA 5AFUH 3O4QA 3G71N 4IDKA 4B1ZA 2HHTA 1X3NA 3MN9A 2DFHA 2YHBA 4XH5A 5EU7A 1JLGA 3I8BA 1JCEA 1HLUA 4Y1DA 3M8QA 3J80O 1BISA 2FF6A 4BRPA 5DMRA 4B3SK 2OPPA 3LAKA 1ASVA 2P9IB 3S3OA 4DFMA 1WAJA 1K8AO 2YJEA 3K57A 3CCRN 1WBDA 4WQ5A 4H0OA 3ZX0A 4Y0WA 3LAMA 3CPWM 2P51A 4CF1A 4OX9K 3CM6A 1P90A 4DS5A 3OYMA 2ZGYA 3MN7A 3FFIA 4CK3A 5ELZA 3QNNA 3SQ2A 1V4SA 4I2QA 4B3TK 1SS6A 2ZWHA 3AA5X 4ISEA 2WONA 3SQ0A 2VG5A 2XY8A 3IDHA 4JYAK 3IUCA 1TGOA 1BUPA 4CJRA 5HRNA 4KRFA 1JL1A 3B6OA 1RTHA 1EX4A 5CZ1A 2VWKA 1RDCA 3CYMA 4DS4A 1YI2N 2Q36A 4G1QA 4JKGB 1DTTA 4MQ3A 3SUQA 3H1VX 3AVCA 2PFUA 4M7YA 3HO1A 4CW7B 4DV1K 4JKDA 4BVOA 4CEDA 1BG3A 2OCEA 3KVGA 1WSJA 4IOAL 3F73A 3CCVN 1KFSA 2X6NA 3WUHA
chains in the Genus database with same CATH topology
4LSNA 4CGJA 4CEZA 5J2NA 2DFEA 2OPSA 5D3GA 1EP4A 1Q9XA 3OYJA 1XWLA 1NOYA 5JS1A 3PO5A 4C8NA 4ELVA 1XHXA 3VQ4A 3ITHA 1X9SA 3DLBA 1O1WA 1JLBA 2PY5A 5SWMA 2KTQA 2HHXA 5CYQA 2G8FA 5KRTA 4DWIA 4OKKA 4O0IA 4M3WA 1I3AA 3HVTA 1KFDA 3K2PA 3OVNA 1IO2A 3QIPA 1TL1A 2KW4A 4GVMA 2G8KA 1BI4B 1RBSA 4RW4A 2G8WA 3DLHA 1JXBA 3SV3A 1CZ9A 1VSKA 3WNEA 4CFDA 3QEPA 2PYJA 1BGXT 1TK8A 2OYQA 4OPJA 3KLFA 4NYNA 1TAUA 1D8YA 4C8MA 1B92A 3AO5A 1HMVA 3OJUA 3RWUA 3NBPA 1QHTA 2EX3A 3ZSXA 3OYFA 3QEXA 5CZ2A 1N5YA 3ZT0A 3TAEA 3T1AA 1HRHA 3ASMA 3ISNC 1C1BA 1HYVA 1SKWA 4IFYA 1ZBIA 4DSLA 4F2RA 4EP5A 3OYBA 1S6QA 1UWBA 4ICLA 2D0CA 4TSXA 1I39A 4GW6A 4BWMA 2D0BA 3VQ7A 4RW6A 1SKSA 2ZD1A 4Z4FA 1QTMA 4FZXC 1R0AA 1NKBA 3V1RA 4CIFA 4Z4EA 4KFBA 4FM0A 2X6SA 4CHZA 1UAXA 2RN2A 4FK2A 3DM2A 4B9MA 1S1UA 1ZBHA 1BI4A 4K8XA 4O44A 2XHBA 4O5BA 2ZE2A 3IRXA 1RCHA 4LH4A 1VSHA 4E7JA 4DTOA 1D9FA 3DLRA 1WAFA 4KTWA 4DFJA 3PV8A 3ZSOA 1JLEA 2OPQA 3VQEA 4CEOA 1FKOA 4W5TA 3HYFA 4CHPA 3SCXA 1GOCA 4JS4A 4BACA 3KJVA 4BDZA 3L8BA 4M45A 3VQBA 4CGDA 3NGZA 1BL3A 2KQ2A 4FLXA 4DF4A 2G8VA 1TK5A 4CGFA 1SV5A 1LWFA 4CHNA 3KKSA 2P1JA 4MFBA 5C25A 3KD5E 4DSIA 1X9MA 4B8CA 3HT3A 2RKIA 1XHZA 4M41A 4E1NA 3HSTB 4NYFA 1VRTA 4BDYA 1L3VA 1VRUA 1VSMA 2HHUA 2IS3A 3H08A 1NJZA 1ZBFA 4B8AB 3S9HA 3HM9A 3SUNA 2VG6A 3AVGA 2ATQA 4RW7A 3HPOA 1IH7A 3TAFA 4B9VA 1RT3A 3VQQA 3NF7A 3OYCA 4CJ4A 1RDDA 3LP1A 3VQ8A 2QKBA 2W42A 5J2QA 5HLFA 5CYMA 2YNFA 1D9DA 1S1XA 2OZMA 4FJKA 3QEVA 2I5JA 3AVBA 4FW1A 2YKNA 1GOAA 3M8SA 4JS5A 1HNIA 4ID5A 1NK0A 1RNHA 5C42A 4CJQA 4KHNA 1RBUA 2YHAA 2KZMA 4FXDA 2XY7A 2IAJA 3CFOA 2PZSA 1W0HA 4N47A 2NUBA 3C6UA 4CK2A 3IAYA 2PYLA 2FBYA 2HNZA 3OYGA 1JKHA 3AVNA 3QINA 1ZBLA 4BE2A 1YT3A 1REVA 5HRPA 5HP1A 1J54A 1JLCA 3ZSQA 1IKWA 3OS0A 4OLBA 3KTQA 2GV9A 1UA0A 3JYTA 3K5MA 3LP0A 1WSEA 2HW3A 3KLGA 4KPYA 1S6PA 4AHUA 4EP4A 2QKKA 4CJEA 3KK1A 3CFRA 4OGCA 4AHTA 2IGIA 4CGHA 1YVUA 4FJ5A 1JLFA 4HCBA 3CQ8A 1WSFA 3SUPA 5FDLA 3L2VA 2D0AA 1NK7A 1WSIA 4CF8A 3UIQA 4RW9A 4CJ3A 1BCMA 3C6TA 4ELUA 5HRRA 1J9AA 4F3TA 2R7YA 4N56A 3HP6A 2O4IA 1RT7A 2IOCA 3L3UA 3PUFA 5J2PA 2D5RA 3ULDA 4IKFA 1C0UA 3TANA 3V9WA 1RDBA 4KREA 4CJLA 3SV4A 4FJGA 4Q5VA 2HNYA 3K5LA 2ITGA 2Z1IA 4E19A 3TAGA 3TAPA 4DQIA 4M3RA 3L2WA 1QSLA 2KFZA 4DQRA 4AHSA 4AILC 1L3SA 4B08A 3SI6A 3AO1A 1N6QA 2E4LA 4DSEA 4DU3A 4KI4A 3TAQA 1B9DA 3OYHA 1CZBA 4CEEA 3SQ4A 3SYZA 3VQ9A 3KLEA 1CXQA 3TR8A 3ZCMA 4DU4A 1QQCA 3V6DA 4E3SA 4FVMA 3RMCA 2HHQA 3NF6A 1FXXA 3K59A 4UQGA 4W5OA 1EKEA 3NHGA 4FK0A 4YNQA 3SJJA 4Z4HA 4FZZA 4N76A 4OKJA 4BE1A 4E0DA 1WNSA 1J5OA 1KVCA 4DTRA 1RILA 4KTZA 1SL2A 3HPGA 3BGRA 3A2FA 4FLTA 4KB1A 1NK9A 3ZT4A 1U47A 1KLNA 2B4JA 4RW8A 5FROA 3JSMA 4FM1A 2OZSA 1WLJA 3WNHA 4AHVA 3ALYA 2JGUA 1BIUA 3G10A 3CM5A 4JRPA 3DMJA 4DTMA 5J2MA 4L8RB 3MEEA 1KTQA 3HPHA 4B9TA 3V9UA 3V81A 2YNGA 3AVKA 1LAVA 2A1RA 4CJSA 3MEGA 3AVFA 3NFAA 1KLMA 3ZT3A 2HMIA 4RG8A 1T7PA 3LWLA 4CFAA 3L2QA 3VQ6A 4CEFA 3DLEA 4M3TA 1A5VA 4HVJA 3AO2A 4DTJA 3EYZA 4FM2A 3KLHA 3G0ZA 1NKEA 2P5GA 1A5WA 2IDOA 2BDPA 1ZYQA 2HHWA 2O4GA 4E7LA 3AVIA 1S1TA 5C24A 3CG7A 4FLYA 1LWCA 2E6MA 4J2EA 3TI0A 3V1OA 1RT5A 3S3MA 1BQMA 4CK1A 4Y1CA 3VA3A 2HHSA 1QS4A 1ZBUA 2G8UA 4OLAA 2HVHA 1A5XA 4Z4GA 1IG9A 3O4NA 1WSGA 3AVAA 3VA0A 1CLQA 4CF9A 4CJVA 4CESA 3C94A 1BQNA 3OS2A 3OYKA 3MEDA 5KGWA 1Q8IA 4DTSA 1C1CA 5FRNA 4HUFA 3TARA 1K6YA 4O55A 4B9LA 4DQPA 3AO3A 3V9SA 1LAWA 3HK2A 1IKXA 3V4IA 2Y1IA 1C0MA 4I2PA 2ZQBA 4O0JA 3HJFA 1ASWA 3PX0A 3RMDA 3DRSA 1JLQA 3MXMA 1HPZA 2FBTA 3IS9A 3LP2A 3NDKA 3MXJA 1IKYA 4FW2A 1D5AA 3P1GA 4Z0UA 4CGGA 3OYDA 3KK3A 4E7IA 4DFKA 3SZ2A 1NJXA 4F2SA 1RBTA 1KRPA 2BGGA 3V9ZA 3QESA 4LSLA 3QO9A 3DYAA 3V9XA 2F96A 3KLIA 3NCIA 3DOLA 4CEAA 4FLVA 1C0TA 1F21A 3ZSVA 5E41A 3LDSA 3WNGA 4E7KA 4DTNA 4KKOA 5HRSA 3VQPA 4PA1A 1HQUA 1L5UA 4DQSA 4J2DA 4DTXA 5KTQA 3VQAA 1L3UA 3AVHA 4FK4A 4IBNA 4O4GA 3D0PA 3I8DA 4DU1A 4I9QA 4M3XA 3AV9A 1VSIA 2HHVA 1VSLA 2Q3SA 2DFFA 1UA1A 4ELTA 1YTUA 2B6AA 3QIOA 4ZHRA 1U4BA 4LY7A 3KD1E 2ETJA 4PQUA 2XY5A 3B6PA 3MXIA 3OYIA 3RTVA 4PUOA 1HYSA 4H4OA 1KSPA 3DRRA 1S1VA 5T7BA 3OYNA 3KK2A 3RMAA 4C8OA 4AH9A 4JRQA 1Q9YA 4K8ZA 4ZTFA 1NK6A 1VSJA 2IC3A 4CF2A 4KHYA 1RBRA 3SUOA 4BDPA 4DSJA 4CJ5A 2E6LA 3HL8A 4FJNA 1L3TA 1C6VA 4B3OA 1W9HA 3U6FA 1LW0A 1RT4A 1Z25A 3KKRA 1JXEA 3P5JA 4WE1A 4OVLA 1LW2A 4BWJA 3E01A 3PX4A 3QNOA 3KIOA 4EZ6A 4KTQA 3HVRA 4FJ8A 2Z1GA 4LH5A 4AHCA 1JLAA 4HUEA 3OY9A 3ZSZA 1T8EA 3AA3A 3NH1A 3NE6A 3VN5A 2YNIA 2JLEA 3K5NA 1EETA 4OGEA 4BE0A 1MU2A 4DLEA 3I0RA 4KHUA 1CXUA 4W5NA 1KCFA 3VQ5A 3M8RA 3DI6A 4FLUA 3T19A 1QSSA 1RTIA 3LZIA 4M3ZA 1TV6A 4J2BA 1IKVA 1EXQA 1KVBA 4KB0A 1VSEA 4HCCA 5FRMA 1TKDA 4DMNA 1WSHA 2KFNA 5KI6A 1RT6A 3QETA 4HHTA 3RRGA 3VQDA 4KAZA 4H4MA 3TAMA 4PWDA 5HBMA 4DF8A 3DLGA 4JLHA 4R5PA 4CJWA 4YFUA 2X78A 3OYEA 1NOZA 4M3YA 2FBXA 1C1AA 4KHSA 4FJLA 4FLZA 1S1WA 4KHQA 3F9KA 3O3HA 4FJIA 1BIZA 3LZJA 1NK8A 4M42A 3RMBA 2HVIA 3PY8A 3RRHA 4W5QA 4OJRA 2X74A 2VWJA 3AO4A 3HXMA 4Z4CA 1QE1A 1U48A 1NKCA 2XRIA 2EHGA 3DRPA 4CJUA 4B9SA 3ZSWA 3AA2A 4CHOA 1SUQA 3QERA 1YTAA 4DSFA 4EZ9A 3DOKA 3OS1A 3BDPA 4N41A 4ID1A 1TL3A 3LWMA 4CHYA 4CEBA 4QOZB 2YKMA 2G8HA 2AJQA 3C95A 3SPYA 3EY1A 1TKZA 1JL2A 3AVLA 3NF8A 2Y1JA 3ZT2A 5JS2A 2WOMA 4CGIA 1X9WA 3T3FA 4CF0A 4B9NA 3TABA 4Q0BA 3MAQA 4FCYA 1ASUA 3RR7A 3PO4A 4C8LA 1NJYA 3CFPA 4KO0A 3NGYA 3V1QA 3THVA 2QXFA 4FYDA 3NGIA 1HJRA 1WN7A 4AHRA 1U49A 2BE2A 4B9UA 1BCOA 3LP3A 1S9GA 3LANA 4FZYA 2YV0X 1TKXA 3U3GA 5I42A 4H8KA 1QSYA 2Z1JA 1UOCA 3MECA 1J53A 1HQEA 2F8SA 1TK0A 5KGXA 4KI6A 4CEQA 3L2UA 4E7HA 3U3YA 3QEIA 1BHLA 3LALA 2KZZA 4DQQA 4F8RA 4I7FA 3S3NA 2OA8A 2GUIA 3RR8A 1LV5A 3OYLA 1HYZA 4CIGA 5J1EA 3NF9A 2HB5A 1GOBA 1SL0A 1U45A 1S9EA 1TAQA 4N5SA 1RTDA 4FLWA 4FJJA 2A1SA 3QLHA 1NK4A 4J2AA 4FJMA 4FJHA 2RF2A 3O4QA 3SQ1A 2OPRA 1NJWA 4E89A 4IDKA 2Z1HA 2HHTA 1SKRA 1TKTA 1VSDA 1Z26A 4Z4IA 2QK9A 3ZSRA 2DFHA 2YHBA 1VK0A 2DTUA 4FJ7A 2BANA 5EU7A 3WNFA 3I0SA 3NH0A 1DLOA 1JLGA 3TWHA 3ZT1A 4CECA 4Y1DA 4DTPA 4FJXA 4CCHA 4NCBA 1XI1A 1VSFA 3M8QA 1U04A 1BISA 4DSKA 1RTJA 3M8PA 1HNVA 5DMRA 3VQCA 2XY6A 1ITGA 2OPPA 3LAKA 2VG7A 2FC0A 4HUGA 2B5JA 4M3UA 2DY4A 1ASVA 3K5OA 1RT2A 5DK5A 4DFMA 3S3OA 1RDAA 1RBVA 5K14A 1WAJA 2GBZA 3K57A 3LPTA 5SZTA 3D45A 3AVJA 1DTQA 3LAMA 4CERA 2P51A 4CF1A 3CM6A 1G15A 4GMJB 4DS5A 3OYMA 4C8KA 2YNHA 4IG0A 4LD0A 2G8IA 3FFIA 2HNDA 2F8TA 4CK3A 1T05A 3O3GA 2XO7A 4CJKA 3QNNA 3SQ2A 1RT1A 4I2QA 3AA5X 3DLKA 5I3UA 1S5JA 1FKPA 1LWEA 3NH2A 2WONA 3P83D 1SL1A 2LSNA 2VG5A 2XY8A 4IG3A 4QAGA 4DTUA 4E1MA 5HROA 3SQ0A 5KRSA 4DLGA 3SNNA 1T03A 4CIEA 4QCLA 1TGOA 4CE9A 2FBVA 4CJRA 5HRNA 4ZTJA 2RPIA 4NCAA 4KHWA 4KRFA 1JL1A 3IG1A 3B6OA 1RTHA 3L3VA 5CY4A 1EX4A 1X1PA 2VWKA 1RDCA 3CYMA 5CZ1A 4DG1A 4OPKA 4DS4A 4G1QA 3SUQA 1DTTA 4MQ3A 2P5OA 3OJSA 3AVCA 1B9FA 3OYAA 4PY5A 3AA4A 1KVAA 4CJTA 1TVRA 1XC9A 1NK5A 3LPUA 3QEWA 3ZSYA 3HO1A 4F4KA 4XIUA 4KV8A 4CJPA 4CFCA 1Y97A 4F3OA 4CHQA 4I9LA 4IFVA 3O3FA 4CEDA 4HTUA 3AVMA 3HP9A 3NAEA 3L2RA 1WSJA 4FJ9A 4W5RA 4NCGA 4OKEA 3F73A 1FK9A 4CJFA 4DFPA 1KFSA 3EZ5A 2X6NA 3K58A 3SPZA 4CFBA 3PX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSN A;  4CGJ A;  4CEZ A;  5J2N A;  2DFE A;  2OPS A;  5D3G A;  1EP4 A;  1Q9X A;  3OYJ A;  1XWL A;  1NOY A;  5JS1 A;  3PO5 A;  4C8N A;  4ELV A;  1XHX A;  3VQ4 A;  3ITH A;  1X9S A;  3DLB A;  1O1W A;  1JLB A;  2PY5 A;  5SWM A;  2KTQ A;  2HHX A;  5CYQ A;  2G8F A;  5KRT A;  4DWI A;  4OKK A;  4O0I A;  4M3W A;  1I3A A;  3HVT A;  1KFD A;  3K2P A;  3OVN A;  1IO2 A;  3QIP A;  1TL1 A;  2KW4 A;  4GVM A;  2G8K A;  1BI4 B;  1RBS A;  4RW4 A;  2G8W A;  3DLH A;  1JXB A;  3SV3 A;  1CZ9 A;  1VSK A;  3WNE A;  4CFD A;  3QEP A;  2PYJ A;  1BGX T;  1TK8 A;  2OYQ A;  4OPJ A;  3KLF A;  4NYN A;  1TAU A;  1D8Y A;  4C8M A;  1B92 A;  3AO5 A;  1HMV A;  3OJU A;  3RWU A;  3NBP A;  1QHT A;  2EX3 A;  3ZSX A;  3OYF A;  3QEX A;  5CZ2 A;  1N5Y A;  3ZT0 A;  3TAE A;  3T1A A;  1HRH A;  3ASM A;  3ISN C;  1C1B A;  1HYV A;  1SKW A;  4IFY A;  1ZBI A;  4DSL A;  4F2R A;  4EP5 A;  3OYB A;  1S6Q A;  1UWB A;  4ICL A;  2D0C A;  4TSX A;  1I39 A;  4GW6 A;  4BWM A;  2D0B A;  3VQ7 A;  4RW6 A;  1SKS A;  2ZD1 A;  4Z4F A;  1QTM A;  4FZX C;  1R0A A;  1NKB A;  3V1R A;  4CIF A;  4Z4E A;  4KFB A;  4FM0 A;  2X6S A;  4CHZ A;  1UAX A;  2RN2 A;  4FK2 A;  3DM2 A;  4B9M A;  1S1U A;  1ZBH A;  1BI4 A;  4K8X A;  4O44 A;  2XHB A;  4O5B A;  2ZE2 A;  3IRX A;  1RCH A;  4LH4 A;  1VSH A;  4E7J A;  4DTO A;  1D9F A;  3DLR A;  1WAF A;  4KTW A;  4DFJ A;  3PV8 A;  3ZSO A;  1JLE A;  2OPQ A;  3VQE A;  4CEO A;  1FKO A;  4W5T A;  3HYF A;  4CHP A;  3SCX A;  1GOC A;  4JS4 A;  4BAC A;  3KJV A;  4BDZ A;  3L8B A;  4M45 A;  3VQB A;  4CGD A;  3NGZ A;  1BL3 A;  2KQ2 A;  4FLX A;  4DF4 A;  2G8V A;  1TK5 A;  4CGF A;  1SV5 A;  1LWF A;  4CHN A;  3KKS A;  2P1J A;  4MFB A;  5C25 A;  3KD5 E;  4DSI A;  1X9M A;  4B8C A;  3HT3 A;  2RKI A;  1XHZ A;  4M41 A;  4E1N A;  3HST B;  4NYF A;  1VRT A;  4BDY A;  1L3V A;  1VRU A;  1VSM A;  2HHU A;  2IS3 A;  3H08 A;  1NJZ A;  1ZBF A;  4B8A B;  3S9H A;  3HM9 A;  3SUN A;  2VG6 A;  3AVG A;  2ATQ A;  4RW7 A;  3HPO A;  1IH7 A;  3TAF A;  4B9V A;  1RT3 A;  3VQQ A;  3NF7 A;  3OYC A;  4CJ4 A;  1RDD A;  3LP1 A;  3VQ8 A;  2QKB A;  2W42 A;  5J2Q A;  5HLF A;  5CYM A;  2YNF A;  1D9D A;  1S1X A;  2OZM A;  4FJK A;  3QEV A;  2I5J A;  3AVB A;  4FW1 A;  2YKN A;  1GOA A;  3M8S A;  4JS5 A;  1HNI A;  4ID5 A;  1NK0 A;  1RNH A;  5C42 A;  4CJQ A;  4KHN A;  1RBU A;  2YHA A;  2KZM A;  4FXD A;  2XY7 A;  2IAJ A;  3CFO A;  2PZS A;  1W0H A;  4N47 A;  2NUB A;  3C6U A;  4CK2 A;  3IAY A;  2PYL A;  2FBY A;  2HNZ A;  3OYG A;  1JKH A;  3AVN A;  3QIN A;  1ZBL A;  4BE2 A;  1YT3 A;  1REV A;  5HRP A;  5HP1 A;  1J54 A;  1JLC A;  3ZSQ A;  1IKW A;  3OS0 A;  4OLB A;  3KTQ A;  2GV9 A;  1UA0 A;  3JYT A;  3K5M A;  3LP0 A;  1WSE A;  2HW3 A;  3KLG A;  4KPY A;  1S6P A;  4AHU A;  4EP4 A;  2QKK A;  4CJE A;  3KK1 A;  3CFR A;  4OGC A;  4AHT A;  2IGI A;  4CGH A;  1YVU A;  4FJ5 A;  1JLF A;  4HCB A;  3CQ8 A;  1WSF A;  3SUP A;  5FDL A;  3L2V A;  2D0A A;  1NK7 A;  1WSI A;  4CF8 A;  3UIQ A;  4RW9 A;  4CJ3 A;  1BCM A;  3C6T A;  4ELU A;  5HRR A;  1J9A A;  4F3T A;  2R7Y A;  4N56 A;  3HP6 A;  2O4I A;  1RT7 A;  2IOC A;  3L3U A;  3PUF A;  5J2P A;  2D5R A;  3ULD A;  4IKF A;  1C0U A;  3TAN A;  3V9W A;  1RDB A;  4KRE A;  4CJL A;  3SV4 A;  4FJG A;  4Q5V A;  2HNY A;  3K5L A;  2ITG A;  2Z1I A;  4E19 A;  3TAG A;  3TAP A;  4DQI A;  4M3R A;  3L2W A;  1QSL A;  2KFZ A;  4DQR A;  4AHS A;  4AIL C;  1L3S A;  4B08 A;  3SI6 A;  3AO1 A;  1N6Q A;  2E4L A;  4DSE A;  4DU3 A;  4KI4 A;  3TAQ A;  1B9D A;  3OYH A;  1CZB A;  4CEE A;  3SQ4 A;  3SYZ A;  3VQ9 A;  3KLE A;  1CXQ A;  3TR8 A;  3ZCM A;  4DU4 A;  1QQC A;  3V6D A;  4E3S A;  4FVM A;  3RMC A;  2HHQ A;  3NF6 A;  1FXX A;  3K59 A;  4UQG A;  4W5O A;  1EKE A;  3NHG A;  4FK0 A;  4YNQ A;  3SJJ A;  4Z4H A;  4FZZ A;  4N76 A;  4OKJ A;  4BE1 A;  4E0D A;  1WNS A;  1J5O A;  1KVC A;  4DTR A;  1RIL A;  4KTZ A;  1SL2 A;  3HPG A;  3BGR A;  3A2F A;  4FLT A;  4KB1 A;  1NK9 A;  3ZT4 A;  1U47 A;  1KLN A;  2B4J A;  4RW8 A;  5FRO A;  3JSM A;  4FM1 A;  2OZS A;  1WLJ A;  3WNH A;  4AHV A;  3ALY A;  2JGU A;  1BIU A;  3G10 A;  3CM5 A;  4JRP A;  3DMJ A;  4DTM A;  5J2M A;  4L8R B;  3MEE A;  1KTQ A;  3HPH A;  4B9T A;  3V9U A;  3V81 A;  2YNG A;  3AVK A;  1LAV A;  2A1R A;  4CJS A;  3MEG A;  3AVF A;  3NFA A;  1KLM A;  3ZT3 A;  2HMI A;  4RG8 A;  1T7P A;  3LWL A;  4CFA A;  3L2Q A;  3VQ6 A;  4CEF A;  3DLE A;  4M3T A;  1A5V A;  4HVJ A;  3AO2 A;  4DTJ A;  3EYZ A;  4FM2 A;  3KLH A;  3G0Z A;  1NKE A;  2P5G A;  1A5W A;  2IDO A;  2BDP A;  1ZYQ A;  2HHW A;  2O4G A;  4E7L A;  3AVI A;  1S1T A;  5C24 A;  3CG7 A;  4FLY A;  1LWC A;  2E6M A;  4J2E A;  3TI0 A;  3V1O A;  1RT5 A;  3S3M A;  1BQM A;  4CK1 A;  4Y1C A;  3VA3 A;  2HHS A;  1QS4 A;  1ZBU A;  2G8U A;  4OLA A;  2HVH A;  1A5X A;  4Z4G A;  1IG9 A;  3O4N A;  1WSG A;  3AVA A;  3VA0 A;  1CLQ A;  4CF9 A;  4CJV A;  4CES A;  3C94 A;  1BQN A;  3OS2 A;  3OYK A;  3MED A;  5KGW A;  1Q8I A;  4DTS A;  1C1C A;  5FRN A;  4HUF A;  3TAR A;  1K6Y A;  4O55 A;  4B9L A;  4DQP A;  3AO3 A;  3V9S A;  1LAW A;  3HK2 A;  1IKX A;  3V4I A;  2Y1I A;  1C0M A;  4I2P A;  2ZQB A;  4O0J A;  3HJF A;  1ASW A;  3PX0 A;  3RMD A;  3DRS A;  1JLQ A;  3MXM A;  1HPZ A;  2FBT A;  3IS9 A;  3LP2 A;  3NDK A;  3MXJ A;  1IKY A;  4FW2 A;  1D5A A;  3P1G A;  4Z0U A;  4CGG A;  3OYD A;  3KK3 A;  4E7I A;  4DFK A;  3SZ2 A;  1NJX A;  4F2S A;  1RBT A;  1KRP A;  2BGG A;  3V9Z A;  3QES A;  4LSL A;  3QO9 A;  3DYA A;  3V9X A;  2F96 A;  3KLI A;  3NCI A;  3DOL A;  4CEA A;  4FLV A;  1C0T A;  1F21 A;  3ZSV A;  5E41 A;  3LDS A;  3WNG A;  4E7K A;  4DTN A;  4KKO A;  5HRS A;  3VQP A;  4PA1 A;  1HQU A;  1L5U A;  4DQS A;  4J2D A;  4DTX A;  5KTQ A;  3VQA A;  1L3U A;  3AVH A;  4FK4 A;  4IBN A;  4O4G A;  3D0P A;  3I8D A;  4DU1 A;  4I9Q A;  4M3X A;  3AV9 A;  1VSI A;  2HHV A;  1VSL A;  2Q3S A;  2DFF A;  1UA1 A;  4ELT A;  1YTU A;  2B6A A;  3QIO A;  4ZHR A;  1U4B A;  4LY7 A;  3KD1 E;  2ETJ A;  4PQU A;  2XY5 A;  3B6P A;  3MXI A;  3OYI A;  3RTV A;  4PUO A;  1HYS A;  4H4O A;  1KSP A;  3DRR A;  1S1V A;  5T7B A;  3OYN A;  3KK2 A;  3RMA A;  4C8O A;  4AH9 A;  4JRQ A;  1Q9Y A;  4K8Z A;  4ZTF A;  1NK6 A;  1VSJ A;  2IC3 A;  4CF2 A;  4KHY A;  1RBR A;  3SUO A;  4BDP A;  4DSJ A;  4CJ5 A;  2E6L A;  3HL8 A;  4FJN A;  1L3T A;  1C6V A;  4B3O A;  1W9H A;  3U6F A;  1LW0 A;  1RT4 A;  1Z25 A;  3KKR A;  1JXE A;  3P5J A;  4WE1 A;  4OVL A;  1LW2 A;  4BWJ A;  3E01 A;  3PX4 A;  3QNO A;  3KIO A;  4EZ6 A;  4KTQ A;  3HVR A;  4FJ8 A;  2Z1G A;  4LH5 A;  4AHC A;  1JLA A;  4HUE A;  3OY9 A;  3ZSZ A;  1T8E A;  3AA3 A;  3NH1 A;  3NE6 A;  3VN5 A;  2YNI A;  2JLE A;  3K5N A;  1EET A;  4OGE A;  4BE0 A;  1MU2 A;  4DLE A;  3I0R A;  4KHU A;  1CXU A;  4W5N A;  1KCF A;  3VQ5 A;  3M8R A;  3DI6 A;  4FLU A;  3T19 A;  1QSS A;  1RTI A;  3LZI A;  4M3Z A;  1TV6 A;  4J2B A;  1IKV A;  1EXQ A;  1KVB A;  4KB0 A;  1VSE A;  4HCC A;  5FRM A;  1TKD A;  4DMN A;  1WSH A;  2KFN A;  5KI6 A;  1RT6 A;  3QET A;  4HHT A;  3RRG A;  3VQD A;  4KAZ A;  4H4M A;  3TAM A;  4PWD A;  5HBM A;  4DF8 A;  3DLG A;  4JLH A;  4R5P A;  4CJW A;  4YFU A;  2X78 A;  3OYE A;  1NOZ A;  4M3Y A;  2FBX A;  1C1A A;  4KHS A;  4FJL A;  4FLZ A;  1S1W A;  4KHQ A;  3F9K A;  3O3H A;  4FJI A;  1BIZ A;  3LZJ A;  1NK8 A;  4M42 A;  3RMB A;  2HVI A;  3PY8 A;  3RRH A;  4W5Q A;  4OJR A;  2X74 A;  2VWJ A;  3AO4 A;  3HXM A;  4Z4C A;  1QE1 A;  1U48 A;  1NKC A;  2XRI A;  2EHG A;  3DRP A;  4CJU A;  4B9S A;  3ZSW A;  3AA2 A;  4CHO A;  1SUQ A;  3QER A;  1YTA A;  4DSF A;  4EZ9 A;  3DOK A;  3OS1 A;  3BDP A;  4N41 A;  4ID1 A;  1TL3 A;  3LWM A;  4CHY A;  4CEB A;  4QOZ B;  2YKM A;  2G8H A;  2AJQ A;  3C95 A;  3SPY A;  3EY1 A;  1TKZ A;  1JL2 A;  3AVL A;  3NF8 A;  2Y1J A;  3ZT2 A;  5JS2 A;  2WOM A;  4CGI A;  1X9W A;  3T3F A;  4CF0 A;  4B9N A;  3TAB A;  4Q0B A;  3MAQ A;  4FCY A;  1ASU A;  3RR7 A;  3PO4 A;  4C8L A;  1NJY A;  3CFP A;  4KO0 A;  3NGY A;  3V1Q A;  3THV A;  2QXF A;  4FYD A;  3NGI A;  1HJR A;  1WN7 A;  4AHR A;  1U49 A;  2BE2 A;  4B9U A;  1BCO A;  3LP3 A;  1S9G A;  3LAN A;  4FZY A;  2YV0 X;  1TKX A;  3U3G A;  5I42 A;  4H8K A;  1QSY A;  2Z1J A;  1UOC A;  3MEC A;  1J53 A;  1HQE A;  2F8S A;  1TK0 A;  5KGX A;  4KI6 A;  4CEQ A;  3L2U A;  4E7H A;  3U3Y A;  3QEI A;  1BHL A;  3LAL A;  2KZZ A;  4DQQ A;  4F8R A;  4I7F A;  3S3N A;  2OA8 A;  2GUI A;  3RR8 A;  1LV5 A;  3OYL A;  1HYZ A;  4CIG A;  5J1E A;  3NF9 A;  2HB5 A;  1GOB A;  1SL0 A;  1U45 A;  1S9E A;  1TAQ A;  4N5S A;  1RTD A;  4FLW A;  4FJJ A;  2A1S A;  3QLH A;  1NK4 A;  4J2A A;  4FJM A;  4FJH A;  2RF2 A;  3O4Q A;  3SQ1 A;  2OPR A;  1NJW A;  4E89 A;  4IDK A;  2Z1H A;  2HHT A;  1SKR A;  1TKT A;  1VSD A;  1Z26 A;  4Z4I A;  2QK9 A;  3ZSR A;  2DFH A;  2YHB A;  1VK0 A;  2DTU A;  4FJ7 A;  2BAN A;  5EU7 A;  3WNF A;  3I0S A;  3NH0 A;  1DLO A;  1JLG A;  3TWH A;  3ZT1 A;  4CEC A;  4Y1D A;  4DTP A;  4FJX A;  4CCH A;  4NCB A;  1XI1 A;  1VSF A;  3M8Q A;  1U04 A;  1BIS A;  4DSK A;  1RTJ A;  3M8P A;  1HNV A;  5DMR A;  3VQC A;  2XY6 A;  1ITG A;  2OPP A;  3LAK A;  2VG7 A;  2FC0 A;  4HUG A;  2B5J A;  4M3U A;  2DY4 A;  1ASV A;  3K5O A;  1RT2 A;  5DK5 A;  4DFM A;  3S3O A;  1RDA A;  1RBV A;  5K14 A;  1WAJ A;  2GBZ A;  3K57 A;  3LPT A;  5SZT A;  3D45 A;  3AVJ A;  1DTQ A;  3LAM A;  4CER A;  2P51 A;  4CF1 A;  3CM6 A;  1G15 A;  4GMJ B;  4DS5 A;  3OYM A;  4C8K A;  2YNH A;  4IG0 A;  4LD0 A;  2G8I A;  3FFI A;  2HND A;  2F8T A;  4CK3 A;  1T05 A;  3O3G A;  2XO7 A;  4CJK A;  3QNN A;  3SQ2 A;  1RT1 A;  4I2Q A;  3AA5 X;  3DLK A;  5I3U A;  1S5J A;  1FKP A;  1LWE A;  3NH2 A;  2WON A;  3P83 D;  1SL1 A;  2LSN A;  2VG5 A;  2XY8 A;  4IG3 A;  4QAG A;  4DTU A;  4E1M A;  5HRO A;  3SQ0 A;  5KRS A;  4DLG A;  3SNN A;  1T03 A;  4CIE A;  4QCL A;  1TGO A;  4CE9 A;  2FBV A;  4CJR A;  5HRN A;  4ZTJ A;  2RPI A;  4NCA A;  4KHW A;  4KRF A;  1JL1 A;  3IG1 A;  3B6O A;  1RTH A;  3L3V A;  5CY4 A;  1EX4 A;  1X1P A;  2VWK A;  1RDC A;  3CYM A;  5CZ1 A;  4DG1 A;  4OPK A;  4DS4 A;  4G1Q A;  3SUQ A;  1DTT A;  4MQ3 A;  2P5O A;  3OJS A;  3AVC A;  1B9F A;  3OYA A;  4PY5 A;  3AA4 A;  1KVA A;  4CJT A;  1TVR A;  1XC9 A;  1NK5 A;  3LPU A;  3QEW A;  3ZSY A;  3HO1 A;  4F4K A;  4XIU A;  4KV8 A;  4CJP A;  4CFC A;  1Y97 A;  4F3O A;  4CHQ A;  4I9L A;  4IFV A;  3O3F A;  4CED A;  4HTU A;  3AVM A;  3HP9 A;  3NAE A;  3L2R A;  1WSJ A;  4FJ9 A;  4W5R A;  4NCG A;  4OKE A;  3F73 A;  1FK9 A;  4CJF A;  4DFP A;  1KFS A;  3EZ5 A;  2X6N A;  3K58 A;  3SPZ A;  4CFB A;  3PX6 A; 
#chains in the Genus database with same CATH topology
 2A6A A;  4JKF A;  1HKG A;  4CEZ A;  5J2N A;  2DFE A;  5D3G A;  1OVQ A;  4AM6 A;  4C8N A;  1X9S A;  3DLB A;  5SWM A;  3VOV A;  5KRT A;  1VQN N;  4OKK A;  4M3W A;  3L4Q A;  1I3A A;  3HVT A;  4NXN K;  2D1K A;  4ISF A;  3ENH A;  4GVM A;  1J5E K;  4XEI A;  4BC2 A;  1JXB A;  3WNE A;  1VQK N;  2AP1 A;  4KH4 A;  4O8U A;  4IEE A;  3KLF A;  4JV5 K;  3QFU A;  1TAU A;  4C8M A;  3BEX A;  3IKM A;  3NBP A;  1HNW K;  3OYF A;  5CZ2 A;  3ULE A;  3DXM B;  2ITM A;  1VQ9 N;  1HYV A;  1SKW A;  4IFY A;  2P9P B;  1BA0 A;  3OYB A;  4ICL A;  2D0C A;  4GW6 A;  1SKS A;  2D0B A;  3VQ7 A;  4RW6 A;  4Z4F A;  4FOE A;  1R0A A;  1NKB A;  4CIF A;  4AM7 A;  2HBM A;  2X6S A;  2RN2 A;  3DM2 A;  4B9M A;  3BY5 A;  3AGK A;  2ZE2 A;  4H03 B;  2P9I A;  3VEZ A;  1T6C A;  1VSH A;  4DTO A;  1WAF A;  3VEY A;  1ESV A;  5E26 A;  4B1U B;  4BR7 A;  3ZSO A;  4JI3 K;  4W5T A;  1KC8 O;  1R59 O;  4BDZ A;  3L8B A;  3WXM B;  4CGD A;  2ZJQ L;  1BL3 A;  2G8V A;  1SV5 A;  4CHN A;  2P1J A;  2RKI A;  3HOS A;  1VRT A;  4JI1 K;  3FZF A;  4CZF A;  1ZBF A;  3S9H A;  3SUN A;  2VG6 A;  3E9O A;  2ATQ A;  1DT9 A;  3I55 N;  5J2Q A;  3MN6 A;  4FW1 A;  3FFK B;  2YKN A;  3M8S A;  4JS5 A;  4ID5 A;  3T1H K;  4BRG A;  4C23 A;  5IT9 O;  3H6E A;  1GLJ O;  4FWM A;  1VQ7 N;  1W0H A;  4H0X B;  3AVN A;  1ZBL A;  3WXL A;  5HRP A;  1JLC A;  3ZSQ A;  4OLB A;  4DV2 K;  2GV9 A;  5AQL A;  1UA0 A;  1WUA A;  5HL7 L;  3JYT A;  1LOT B;  3K5M A;  4X64 K;  2HW3 A;  3KLG A;  3NMU A;  3QBW A;  1VQ4 N;  4CJE A;  4AHT A;  4CGH A;  1I94 K;  1YVU A;  4FJ5 A;  2FXU A;  4LF8 K;  3CIP A;  2E88 A;  2KLA A;  4RW9 A;  1IG8 A;  4O5F A;  4CJ3 A;  5AFU A;  2VQF K;  3C6T A;  3WEE B;  1J9A A;  1LCU A;  4F3T A;  3HP6 A;  2IOC A;  2UUB K;  5C12 A;  2UXD K;  3V9W A;  3SV4 A;  4FJG A;  2HNY A;  3AGR A;  2Z1I A;  3A5L C;  3TAG A;  2UUA K;  1ZC6 A;  4C1N I;  4JKE A;  1L3S A;  2OTL N;  1N6Q A;  3G4S N;  3TAQ A;  1B9D A;  3SQ4 A;  1NGE A;  1NWK A;  4B9Q A;  3C0B A;  3NHG A;  4W5O A;  1EKE A;  2Q0U A;  3O08 A;  4YNQ A;  4WYB A;  5BRH A;  1YAG A;  4BE1 A;  5GIN A;  1KVC A;  3R3L A;  4DTR A;  3HPG A;  3A2F A;  4FLT A;  1NK9 A;  1U47 A;  2B4J A;  3GOI A;  4BR2 A;  2YHY A;  3VPZ A;  3DMJ A;  5GAE P;  5J2M A;  5MLC Q;  2NRT A;  3V9U A;  3VES A;  3V81 A;  4CJS A;  2Q2R A;  3NFA A;  4BRK A;  4DR7 K;  3ZT3 A;  4CBU A;  3CC4 N;  4JN4 A;  3DLE A;  4HVJ A;  4WFN L;  4PKI A;  4FM2 A;  4FWP A;  4B3M K;  2IDO A;  4YDU C;  3SLC A;  1GLA G;  5C24 A;  4LF5 K;  1RT5 A;  3CER A;  3MK6 A;  1ZBU A;  5JVH L;  4YOT A;  4Z4G A;  1IG9 A;  5IWA K;  3AVA A;  3WXI A;  5BPN A;  3MED A;  5FRN A;  4HUF A;  2FF3 B;  1Y64 A;  3AO3 A;  3V9S A;  2ZQB A;  3EN9 A;  1DKG D;  3H45 C;  3IS9 A;  3MXJ A;  3WT0 A;  4DSL A;  1NJX A;  1C0G A;  4H5N A;  3OYD A;  4F2S A;  2BGG A;  1RBT A;  3V9Z A;  3DJC A;  3QES A;  2IVN A;  4FLV A;  1C0T A;  1F21 A;  4KKO A;  4IFE A;  3U8X A;  5KTQ A;  4FOI A;  4UY8 O;  4RWT A;  5I9E B;  4HWI A;  5F1X A;  3D0P A;  4B1X B;  4EHT A;  1E3M A;  3AV9 A;  1YXQ A;  2UXC K;  3QIO A;  3HSC A;  4IO8 A;  3T1Y K;  3TPQ A;  4PQU A;  2KHO A;  2QWM A;  3UKU A;  4WCE L;  5JIC A;  3SBG A;  1O13 A;  4H4O A;  1S1V A;  3KK2 A;  1X3M A;  4BRA A;  4AH9 A;  1NBW A;  4JAX A;  4GV6 A;  1NK6 A;  2O8B B;  1HX1 A;  3MCP A;  2A40 A;  1ZBS A;  3HL8 A;  4PKG A;  1ATN A;  4BVP A;  1QQM A;  3P5J A;  2Z1G A;  1JLA A;  3OY9 A;  3AA3 A;  1K8K A;  3NH1 A;  5E84 A;  4BRF A;  4KHU A;  4W5N A;  4FLU A;  1QSS A;  1VQO N;  3FZH A;  1TV6 A;  4J2B A;  1EXQ A;  3TTC A;  3CCL N;  4HTL A;  4FWQ A;  1KQS M;  4BRC A;  5KI6 A;  1RT6 A;  3I33 A;  3RRG A;  4DF8 A;  1Z6R A;  4YFU A;  5M1O A;  4WQ4 C;  4FJI A;  4BRE A;  3RSE B;  3THY B;  3HM8 A;  2OTJ N;  2X74 A;  3K0S A;  3O9U A;  3HXM A;  4H5T A;  4B9S A;  3ZSW A;  2QXL A;  3QER A;  3A8Y A;  4EZ9 A;  3BDP A;  4N41 A;  3RVC A;  1TL3 A;  4CHY A;  5KPT A;  2AJQ A;  2G8H A;  4A5B A;  3SPY A;  1QVF M;  3NF8 A;  4NXM K;  3B8A X;  5JS2 A;  2WOM A;  3T3F A;  5BR9 A;  4IJA A;  4Q0B A;  1NLV A;  3MAQ A;  4NLC A;  3RR7 A;  3KWI A;  4KO0 A;  3NGY A;  3NGI A;  1FW6 A;  1NU0 A;  4BC3 A;  1BCO A;  4FZY A;  1TKX A;  4CZK A;  4FSV A;  3ZX2 A;  1J53 A;  3CC2 N;  3L0Q A;  2F8S A;  3QEI A;  4I7F A;  3S3N A;  2OA8 A;  3MX2 A;  2F4V K;  1LV5 A;  3NF9 A;  1BO5 O;  1TAQ A;  4N5S A;  1RTD A;  4FLW A;  1BOT O;  1XMO K;  4FJH A;  3SQ1 A;  1XNQ K;  4DR6 K;  1NJW A;  4E89 A;  2Z1H A;  3CJA A;  1VSD A;  4WFA L;  4Z4I A;  2O8C A;  4FWR A;  2QK9 A;  4CBW A;  2DTU A;  2BTF A;  3LL3 A;  2BAN A;  4LF4 K;  3WNF A;  3I0S A;  5LJW A;  1YJ9 N;  1IJJ A;  4CEC A;  4BRM A;  3TSQ A;  4CCH A;  1XI1 A;  1E4G T;  4NCB A;  5AQX A;  1U04 A;  4DSK A;  4GKJ K;  3VQC A;  2XY6 A;  1ITG A;  2ZF5 O;  4M3U A;  4HUG A;  2B5J A;  4IOC L;  3K5O A;  1RDA A;  2HBL A;  3LPT A;  4BRI A;  5SZT A;  3D45 A;  3AVJ A;  4CER A;  4IWV A;  4LD0 A;  4IG0 A;  2G8I A;  2F8T A;  3O3G A;  4JKC A;  5I3U A;  5BPL A;  3P83 D;  2LSN A;  5HRO A;  4QAG A;  1T03 A;  4PWD A;  2CGJ A;  4ZTJ A;  4NCA A;  3A5N C;  3D2E B;  2FSK A;  4OPK A;  1OH7 A;  5AQF A;  2GX9 A;  4JK8 A;  3OYA A;  4PY5 A;  3AA4 A;  5FPN A;  1XC9 A;  1TVR A;  3LPU A;  3QEW A;  3ZSY A;  4BR5 A;  5LY3 A;  2FLO A;  4CFC A;  3AVM A;  3L2R A;  3PIP L;  4W5R A;  4DFP A;  3K58 A;  4LSN A;  3I56 N;  3PLA A;  3VMF B;  2OPS A;  1NOY A;  3CCM N;  5JS1 A;  3PO5 A;  4LFC K;  4ELV A;  3VQ4 A;  1JLB A;  2YHW A;  4KH6 A;  4DWI A;  3O9S A;  4FPB A;  3K2P A;  4U7B A;  2KW4 A;  2G8K A;  4CD3 A;  4IOX A;  4CZH A;  1CZ9 A;  1VSK A;  1BGX T;  2OYQ A;  4OPJ A;  2QI2 A;  1B92 A;  1HMV A;  3RWU A;  2EX3 A;  3ZSX A;  2O8F A;  1HRH A;  1YF5 L;  4FO0 A;  2NRH A;  1IBL K;  1QZ5 A;  4EP5 A;  2Q97 A;  1UWB A;  3V1R A;  4MLE A;  4GV9 A;  3VEV A;  3ID8 A;  4K8X A;  2QA4 N;  2XHB A;  4O5B A;  5CHI A;  1D9F A;  4E7J A;  2QWP A;  4DFJ A;  3VQE A;  4CEO A;  4LFA K;  3SCX A;  1GOC A;  2NLX A;  4JS4 A;  4MO4 A;  3KJV A;  2W6K A;  3KK7 A;  3CQY A;  2UXB K;  4YOX A;  5ADX A;  4FLX A;  4LC9 B;  5JLF A;  4DF4 A;  1TK5 A;  1RFQ A;  3O9R A;  3EZW A;  5AQV A;  3KKS A;  1Z05 A;  4I6M A;  3THW B;  1X9M A;  3HT3 A;  1XHZ A;  2HHU A;  3GDQ A;  3H08 A;  1S3X A;  1IH7 A;  3TAF A;  3NF7 A;  1RDD A;  3LDQ A;  3VQ8 A;  2QKB A;  5HLF A;  2YNF A;  3EL2 A;  1S1X A;  2OZM A;  4BRL A;  2I5J A;  1GOA A;  5C42 A;  5AQU A;  4CJQ A;  2YHA A;  3E9L A;  5AQY A;  4FXD A;  3VEW A;  3CFO A;  2PZS A;  2NUB A;  3DXM A;  2PYL A;  4K0K K;  3OYG A;  4WQ5 C;  3QIN A;  1WOQ A;  4BE2 A;  1REV A;  5HP1 A;  4DV3 K;  3LDN A;  2YCH A;  5AQI A;  2E1Y A;  4H0P A;  4IXC A;  1WSE A;  3J7Y P;  4KPY A;  1S6P A;  4AHU A;  3O80 A;  1JLF A;  3SMP A;  4HCB A;  3SUP A;  1WSI A;  4BR4 A;  4CF8 A;  2CH6 A;  1BCM A;  3FZK A;  5HRR A;  3WQU A;  4GKK K;  3R9P A;  3J7A P;  5J2P A;  4IKF A;  4BRQ A;  1C0U A;  5ADX H;  3K5L A;  2ITG A;  4FL9 A;  4MO5 A;  4IDH A;  4E19 A;  4YOU A;  3L2W A;  1DEJ A;  1GLB G;  2KFZ A;  3JXU A;  4PL7 A;  4JEP A;  5C10 A;  2GTD A;  2E4L A;  3E66 A;  1CZB A;  3CXC M;  2NRR A;  4BRH A;  3KLE A;  3PSI A;  4CBX A;  4DR3 K;  1QQC A;  5C0Y A;  2VYP A;  4FVM A;  3RMC A;  2HHQ A;  3NF6 A;  5AQH A;  4UQG A;  4NLB A;  4A2A A;  4FK0 A;  5AZI B;  4Z4H A;  4FPA A;  4OKJ A;  5FPE A;  2O8B A;  1J5O A;  3J7Z O;  5M1F A;  4KTZ A;  1GLC G;  2V7Z A;  4KB1 A;  5BRD A;  3Q7B A;  5FRO A;  2OZS A;  1WLJ A;  4AHV A;  3ALY A;  1VQ8 N;  4JRP A;  1ATS A;  3MEE A;  1KTQ A;  3HPH A;  4B9T A;  4JHD A;  3AVK A;  3AVF A;  1NNE A;  3CF5 L;  3G25 A;  1KLM A;  3W3D A;  2BH1 A;  1T7P A;  3A0I X;  4CFA A;  5C15 A;  3L2Q A;  4H0V B;  3TTD A;  4M3T A;  5GIO A;  5AQW A;  3U9Z A;  3G0Z A;  1NKE A;  2PAV A;  2HHH K;  2HHW A;  2O4G A;  4DUZ K;  3AVI A;  3CG7 A;  2OAN A;  1YJN N;  4J2E A;  4JI8 K;  1BQM A;  4CK1 A;  4KH5 A;  3VA3 A;  2HHS A;  1M90 O;  4JKB A;  4JI7 K;  4OLA A;  2HVH A;  4BR9 A;  1A5X A;  1WSG A;  5JMV A;  1CLQ A;  4CF9 A;  3CJB A;  4CES A;  3OS2 A;  1SZ2 A;  3GG4 A;  4BY9 C;  4DTS A;  1K6Y A;  1NGC A;  2WUS A;  3HK2 A;  2Y1I A;  3V4I A;  4ILG B;  3HJF A;  1ASW A;  5TKY A;  1RDU A;  3W0L A;  2O8E A;  3NDK A;  4FW2 A;  4Z0U A;  3KK3 A;  4E7I A;  4DR1 K;  3QO9 A;  2IVP A;  3DYA A;  3EKU A;  3KLI A;  5BRF A;  3DOL A;  5E41 A;  3LDS A;  4DR4 K;  1L5U A;  3BP8 A;  2YHX A;  3ZYY X;  2VQE K;  4J2D A;  4DTX A;  5EX5 A;  3VQA A;  1L3U A;  3AVH A;  1VQ6 N;  3VF4 A;  3EKS A;  1P8Z A;  4WFB L;  4B1Y B;  3MX5 A;  1NGA A;  2ETJ A;  3B6P A;  4JD2 B;  1HYS A;  1C0F A;  3DRR A;  4EFH A;  5T7B A;  3RMA A;  4C8O A;  3FLC O;  3QDK A;  4ZTF A;  4R79 A;  2IC3 A;  3D2F B;  4JI2 K;  4DSJ A;  4CJ5 A;  5AQN A;  1L3T A;  3SAG A;  3U6F A;  3K9J A;  1LW0 A;  1Z25 A;  3KKR A;  3UKR B;  1JXE A;  5I42 A;  4KI6 A;  4FWN A;  5GAD P;  3QNO A;  3KIO A;  1T8E A;  3ZSZ A;  1KAX A;  3BZK A;  3NE6 A;  3VN5 A;  4BC5 A;  2YNI A;  2JLE A;  1EET A;  1N36 K;  1KAZ A;  2P9S A;  4DLE A;  5EXW A;  5BPM A;  1HNX K;  3VQ5 A;  4V19 S;  3DI6 A;  1TUY A;  1RTI A;  3OTO K;  3CJC A;  1KVB A;  4X62 K;  5FRM A;  3A5O C;  2P9U B;  1TKD A;  2DPN A;  4IJN A;  3QET A;  5EVZ A;  4CJW A;  4FJL A;  4YOY A;  4KHQ A;  3F9K A;  5FLX O;  3P4I A;  5FPM A;  2PBD A;  3AO4 A;  2XRI A;  4CJU A;  5GAG P;  3ZEU A;  3AA2 A;  1SUQ A;  3SBT A;  1MDU B;  3IFR A;  3TSU A;  4CEB A;  4YOW A;  5GIP A;  2E1Z A;  3J8A A;  1OH8 A;  1JL2 A;  2W6L A;  3T69 A;  1G99 A;  1BU6 O;  1X9W A;  5KQ8 A;  5AQT A;  4FCY A;  3SJH A;  4C8L A;  1N34 K;  1NJY A;  4EIA A;  3CFP A;  2O8C B;  3QFP A;  2VCP A;  1HJR A;  1WN7 A;  1U49 A;  4ILH A;  4B9U A;  3LAN A;  1OVY A;  4H8K A;  1IBM K;  3MEC A;  5LMU K;  3L2U A;  2KZZ A;  2P9S B;  4DQQ A;  4B1V A;  3OYL A;  4CIG A;  1GOB A;  4J2A A;  3KWG A;  2RF2 A;  2OPR A;  1SKR A;  1XC3 A;  3M6G A;  4JKA A;  1VK0 A;  3L6Q A;  4H5R A;  3VGM A;  3H3O B;  3VGK A;  4DTP A;  2ASM A;  3M8P A;  1BDG A;  1NGI A;  4H0T B;  1RT2 A;  5DK5 A;  3O6W A;  3DWL A;  3SMS A;  1GLF O;  1DTQ A;  4JK9 A;  3UKU B;  4C8K A;  4OPH A;  1T05 A;  2XO7 A;  3DLK A;  1S5J A;  1FKP A;  4LFB K;  1BWF O;  4IG3 A;  3SNN A;  1NGH A;  4CIE A;  1CZA N;  3JS6 A;  1EQY A;  3IG1 A;  5CY4 A;  4M3Z A;  2KKZ A;  3LM9 A;  3ENO A;  4I6M B;  3OJS A;  1B9F A;  3KZB A;  4YOR A;  4CJT A;  1HNZ K;  4XIU A;  5AZJ B;  1NJI O;  3AAR A;  4GV3 A;  2HOE A;  1U2V B;  2O8D A;  1Y97 A;  4CHQ A;  4I9L A;  4IFV A;  3F5T A;  3UB5 A;  3NAE A;  3WXJ A;  2F9W A;  3R1X A;  4NCG A;  4OKE A;  4CJF A;  4BRD A;  1XNR K;  4CFB A;  3PX6 A;  4CGJ A;  4PL8 A;  1EP4 A;  3EEQ A;  1K9M O;  3ITH A;  3DXK A;  4M7X A;  2PY5 A;  5CYQ A;  1FJG K;  1XUP O;  4O0I A;  1YVN A;  2F7T A;  1IO2 A;  3QIP A;  1TL1 A;  4JI5 K;  4RW4 A;  5AQO A;  3ZET B;  3TU5 A;  2PYJ A;  3TSP A;  3U9D A;  1TK8 A;  2AA4 A;  4NYN A;  4JI0 K;  3AO5 A;  3OJU A;  1N8R O;  1QHT A;  5BRE A;  1N5Y A;  3ZT0 A;  3TAE A;  4A57 A;  3MCA B;  3ISN C;  1KAY A;  1C1B A;  4QS7 A;  4F2R A;  3HI0 A;  1S6Q A;  2P9U A;  4TSX A;  2GEM A;  1QTM A;  1HJO A;  4FZX C;  4BGA A;  4Z4E A;  1S72 N;  1S1U A;  1BI4 A;  2O8D B;  4O44 A;  4YDU A;  3H46 O;  3LDP A;  4L3Q A;  3Q7C A;  2Q1N A;  3DLR A;  4FWS A;  4KTW A;  5AZI A;  5CR4 A;  3PV8 A;  2E5L K;  1JLE A;  2OPQ A;  3WEE A;  4O8K A;  1FKO A;  3F9M A;  4CHP A;  4BAC A;  4MLH A;  3ZX3 A;  3D2F A;  3DXK B;  4M45 A;  4OPA A;  3NGZ A;  2D0O A;  2YX6 A;  4JI6 K;  3BUZ B;  2CGL A;  4CGF A;  4JK7 A;  1XQS C;  3KD5 E;  4DSI A;  4M41 A;  4E1N A;  3HST B;  4JI4 K;  4IO9 L;  4K25 A;  4BDY A;  1VRU A;  1L3V A;  4RCH A;  1VQP N;  3AAP A;  3HM9 A;  4RW7 A;  3AVG A;  3HPO A;  4B9V A;  3VQQ A;  3WQT A;  4CJ4 A;  1YIT N;  3LP1 A;  1EO1 A;  2W42 A;  5CYM A;  1VQM N;  4BQZ A;  2FSJ A;  5M1N A;  3ENB A;  1GLE G;  3AVB A;  5AR0 A;  4KHN A;  2KZM A;  4K43 A;  2XY7 A;  2RHK A;  1W97 L;  4B1W B;  3CC7 N;  4CK2 A;  3IAY A;  3HBT A;  2HNZ A;  1JKH A;  1YT3 A;  1J54 A;  3CCJ N;  1IKW A;  3KTQ A;  1J6Z A;  2GWJ A;  3LDL A;  3LP0 A;  4EP4 A;  3KK1 A;  4OGC A;  2IGI A;  1D4X A;  3UE5 A;  3CCS N;  2QTD A;  1WSF A;  1YJW N;  3L2V A;  1NK7 A;  4FWK A;  1T3V A;  1GLD G;  1M1K O;  4ELU A;  4GY2 B;  5GAH P;  2R7Y A;  2P9P A;  4N56 A;  2O4I A;  1RT7 A;  3L3U A;  3PUF A;  2VWB A;  4CVN E;  3TAN A;  5AQG A;  1Q82 O;  1RDB A;  2FSN A;  4KRE A;  1QHA A;  4CJL A;  2ASP A;  4MDA A;  1DGK N;  2NNW A;  4YOV A;  1Q81 O;  3BF3 A;  4M3R A;  4LF6 K;  1QSL A;  3THW A;  1V4T A;  3VGL A;  4DU3 A;  4KI4 A;  3SYZ A;  3VQ9 A;  1CXQ A;  3V6D A;  2YJF A;  4E3S A;  3E9P A;  2V7Y A;  5C2F A;  1FXX A;  2GEL A;  4PHT X;  5AQK A;  2WFB A;  2ZJP L;  4FZZ A;  4N76 A;  3M5R A;  1SL2 A;  1OH6 A;  3BGR A;  1XMQ K;  1KLN A;  4K42 A;  4RW8 A;  3JSM A;  4YY3 K;  3RTV A;  4DTM A;  1ZBH A;  2JGU A;  1BIU A;  3G10 A;  4X65 K;  3NVM A;  1NGF A;  5M1Q A;  3H1Q A;  4A59 A;  5M1P A;  1VHX A;  4YHH K;  4QS9 A;  2HMI A;  4RG8 A;  4KHP K;  3VQ6 A;  3HRG A;  5HOO A;  1A5V A;  3AO2 A;  4RTF D;  3CJ1 A;  1A5W A;  3GE1 A;  3NVK A;  2BDP A;  2NRX A;  2HBJ A;  4E7L A;  1S1T A;  5LJV A;  2Q0R A;  1TUU A;  1LWC A;  3EE9 A;  2E6M A;  3TI0 A;  3S41 A;  3G6E N;  4DQ8 A;  1QQN A;  4CZG A;  1QS4 A;  2NRW A;  2HBK A;  4H0Y B;  3VA0 A;  3LDO A;  4A61 A;  4CJV A;  3M1F A;  1BQN A;  3H3N O;  5KGW A;  5JLH A;  1C1C A;  3OW2 M;  3OBW A;  1IKX A;  4ISG A;  1C0M A;  4I2P A;  4BR0 A;  3EE8 A;  4ILJ A;  4O0J A;  3PX0 A;  3RMD A;  3DRS A;  1HPZ A;  2FBT A;  3LP2 A;  4DV0 K;  4DV4 K;  1IKY A;  4DFK A;  3P1G A;  4CGG A;  2BUP A;  3SZ2 A;  4LF9 K;  1KRP A;  2GUP A;  2F96 A;  3NCI A;  4GNI A;  3CCU N;  4E7K A;  1SQK A;  5HRS A;  3VQP A;  4PA1 A;  1HQU A;  4FVU A;  3MDQ A;  5EOY A;  3ZET A;  3MMV A;  2V52 B;  4FK4 A;  4IBN A;  4M3X A;  1VSI A;  4JKH A;  2HHV A;  2Q3S A;  4ELT A;  5TKW A;  1YTU A;  2B6A A;  1NMN A;  4ZHR A;  4LY7 A;  4DKW A;  2XY5 A;  3SAH A;  3MXI A;  3RSE A;  1HUX A;  3C65 A;  3OYN A;  2UU9 K;  1Q86 O;  3D6R A;  1Q9Y A;  4KHY A;  4CF2 A;  3SUO A;  4BRN A;  1T6D A;  1C6V A;  1W9H A;  4H5V A;  2A3Z A;  3O9T A;  2QWR A;  4DHY A;  4BWJ A;  3PX4 A;  4OVL A;  3QBX A;  3HVR A;  2QWN A;  4HUE A;  3K5N A;  1MU2 A;  3I0R A;  1HKC A;  2D0P A;  5KPR A;  1CXU A;  3M8R A;  4CZM A;  3T19 A;  4CJ7 A;  1IKV A;  4HCC A;  1WSH A;  2KFN A;  1NMD A;  3R8E A;  1GLL O;  3QIC A;  4HHT A;  4KAZ A;  5BN8 A;  3U4L A;  3TAM A;  3DLL L;  4JLH A;  4WF9 L;  1NOZ A;  2FBX A;  1C1A A;  4KHS A;  1E4F T;  4FLZ A;  1S1W A;  3LZJ A;  2I7N A;  1BA1 A;  1NK8 A;  3RMB A;  4M42 A;  4OJR A;  1QE1 A;  1Q18 A;  2EHG A;  3CHW A;  3ATV A;  1U6Z A;  5AQZ A;  4QS8 A;  4DSF A;  3DOK A;  5LMN K;  3LWM A;  3P39 A;  3C6A A;  4QOZ B;  3CPE A;  3C95 A;  1JCF A;  5AJ3 K;  3EY1 A;  2CH5 A;  3O8M A;  2CGK A;  5DM6 L;  3CI5 A;  1SAZ A;  2Y1J A;  3ZT2 A;  4CF0 A;  4B9N A;  2JWL A;  2O8F B;  1ASU A;  3PO4 A;  4DV7 K;  3V1Q A;  4BG8 A;  4FYD A;  2YV0 X;  3IMX A;  1HQE A;  4CEQ A;  2VGM A;  4DB3 A;  4E7H A;  3U3Y A;  3LAL A;  1QVG M;  3RR8 A;  2NRV A;  5J1E A;  1X9J A;  1SL0 A;  1VQL N;  1S9E A;  1EWR A;  1EWQ A;  4FJJ A;  2A1S A;  3E1Y A;  4G9Z A;  1TYQ B;  2HF4 A;  2V51 B;  2J4R A;  4PKH A;  2NRZ A;  1TKT A;  1Z26 A;  3C6H A;  3ZSR A;  4Z94 A;  2A42 A;  1NG9 A;  4FJ7 A;  4J8F A;  5AQR A;  3NH0 A;  2WBN A;  1DLO A;  3TWH A;  3ZT1 A;  1MWK A;  4FJX A;  2VGN A;  1VSF A;  3LM2 A;  1RTJ A;  1HNV A;  3CMA N;  3KHY A;  2VG7 A;  2FC0 A;  2ZM6 K;  5M1K A;  1RBV A;  4C1N K;  5K14 A;  2GBZ A;  3ZEU B;  4DUY K;  3VF6 A;  1K73 O;  1NGB A;  1G15 A;  4GMJ B;  2YNH A;  2HND A;  3K9K A;  4CJK A;  4BG9 A;  1RT1 A;  2W40 A;  5DM7 L;  1LWE A;  3JAM O;  3NH2 A;  1SL1 A;  2Q31 A;  4DTU A;  4E1M A;  4QCL A;  2P9K B;  5KRS A;  4DLG A;  3D7E O;  4CE9 A;  2FBV A;  2RPI A;  4KHW A;  3T7Z A;  2W41 A;  3L3V A;  4DG1 A;  1X1P A;  2A41 A;  4U67 L;  2P5O A;  1ATR A;  1W7A A;  1JCG A;  1KVA A;  1NK5 A;  4F4K A;  3HTV A;  4KV8 A;  4CJP A;  4F3O A;  4JHD B;  3O3F A;  4HTU A;  3HP9 A;  1ILY A;  4GVE A;  4A2B A;  3VEO A;  3MN5 A;  4FJ9 A;  4BRO A;  3FGU A;  1FK9 A;  5B8H A;  3EZ5 A;  3SPZ A;  2QWL A;  4H5W A;  3DAW A;  1HKB A;  4CI6 A;  4AF1 A;  2ZGZ A;  3CD6 N;  1MWM A;  1Q9X A;  3OYJ A;  1XWL A;  1T44 A;  1NM1 A;  1XHX A;  4MDB A;  1O1W A;  3O4W A;  4BQL A;  1JJ2 M;  2P9L A;  2KTQ A;  3BZC A;  2HHX A;  3CET A;  2G8F A;  5AQP A;  1WBB A;  3OVN A;  1KFD A;  2NZT A;  3L4I A;  2P9N B;  3ZLJ A;  5KQD A;  1BI4 B;  1RBS A;  2YI1 A;  2G8W A;  3DLH A;  3QEP A;  3SV3 A;  4CFD A;  1D8Y A;  4FWO A;  2HMP A;  3QEX A;  1QQO A;  2P9K A;  5AQS A;  3T1A A;  3MWT A;  3ASM A;  5FPD A;  1ZBI A;  4IZ9 A;  3ULE B;  5LL6 Z;  2O8E B;  4BWM A;  1I39 A;  2IVO A;  2ZD1 A;  3R6M A;  4KFB A;  1S22 A;  4FM0 A;  5BR8 K;  4CHZ A;  1UAX A;  4FK2 A;  4BGB A;  3O1W A;  5F0X A;  4JNE A;  3IRX A;  4F9O A;  1RCH A;  4LH4 A;  1YIJ N;  3OBY A;  4XH4 A;  5AQM A;  3HYF A;  3VQB A;  2KQ2 A;  1NGJ A;  3EO3 A;  1LWF A;  4MFB A;  3UKR A;  5C25 A;  4CD1 A;  4B8C A;  4NYF A;  4EAH D;  1VSM A;  2E8A A;  2IS3 A;  1NJZ A;  4B8A B;  5JVG L;  2A5X A;  1RT3 A;  4DR5 K;  3OYC A;  5BN9 A;  1D9D A;  4FJK A;  1HR0 K;  1N32 K;  5H1S Q;  3QEV A;  3ATU A;  3VEX A;  1VAZ A;  1HNI A;  3GL1 A;  1NK0 A;  1RNH A;  3OA9 A;  1RBU A;  4OO1 J;  3VER A;  2IAJ A;  3AAQ A;  4N47 A;  3C6U A;  2FBY A;  2HST A;  2RE2 A;  3OS0 A;  3A5M C;  2P9L B;  2QEX N;  2QKK A;  3CFR A;  3FR0 A;  2P9N A;  3CCE N;  4JD2 A;  3CQ8 A;  5FDL A;  2D0A A;  3UIQ A;  3BF1 A;  3VTH A;  2QWO A;  3THY A;  2GWK A;  2D5R A;  3ULD A;  4KBO A;  3J81 O;  4Q5V A;  3FE1 A;  3TAP A;  4DQI A;  1MA9 B;  4DQR A;  4AHS A;  4AIL C;  4B08 A;  3SI6 A;  3AO1 A;  4LF7 K;  4DSE A;  4CZJ A;  3HZ6 A;  3OYH A;  4E1J A;  4CEE A;  1YHQ N;  1HPM A;  1K8K B;  4M63 C;  4DCH A;  3TR8 A;  3ZCM A;  4DU4 A;  3GBT A;  4WQ4 A;  3K59 A;  1IV0 A;  5AQQ A;  3VET A;  3SJJ A;  1KXP A;  1OKJ A;  1KD1 O;  1YUW A;  3D2E A;  4E0D A;  1WNS A;  2E20 A;  3M3Z A;  3CCQ N;  1RIL A;  1Q7Y O;  3WXK A;  3ZT4 A;  4FM1 A;  4B3R K;  3WNH A;  3CM5 A;  1NGG A;  4L8R B;  2YNG A;  1LAV A;  2A1R A;  3MEG A;  2ASO A;  5CE3 A;  4DV5 K;  3LWL A;  2E2Q A;  2F9T A;  4CEF A;  4DV6 K;  1TYQ A;  2EWS A;  3EYZ A;  4DTJ A;  3KLH A;  2P5G A;  1ZYQ A;  1IBK K;  4AQY K;  4FLY A;  3V1O A;  4IEI A;  5AQJ A;  3S3M A;  4Y1C A;  3AY9 A;  1QZ6 A;  2G8U A;  5EY4 A;  3VF2 A;  2E2P A;  3O4N A;  4FWL A;  3C94 A;  3VTI A;  3OYK A;  2E2N A;  4BC4 A;  5F2R A;  5AZJ A;  2JWK A;  2ZJR L;  2WTU A;  1Q8I A;  3TAR A;  4O55 A;  4B9L A;  4DQP A;  3SK3 A;  1LAW A;  3O9Q A;  3MXM A;  1JLQ A;  1U2V A;  1D5A A;  3THX A;  4LSL A;  3V9X A;  2DY4 A;  4CEA A;  3ZSV A;  3WNG A;  4DTN A;  3FZL A;  3ID6 A;  3HOT A;  2E2O A;  3OHR A;  3VEN A;  4DQS A;  2I7P A;  4O4G A;  4I9Q A;  3CME N;  3I8D A;  4DU1 A;  1OH5 A;  1RDW X;  1VSL A;  2DFF A;  1UA1 A;  2QW9 A;  3CJ9 A;  4DR2 K;  1U4B A;  4A62 A;  3KD1 E;  4CZL A;  3OYI A;  4PUO A;  4NO7 A;  1ZXO A;  1KSP A;  4K41 A;  2WC9 A;  4JRQ A;  4K8Z A;  1VSJ A;  1RBR A;  4BDP A;  2E6L A;  4FJN A;  2QWQ A;  4B3O A;  1RGI A;  1RT4 A;  5C2D A;  4WE1 A;  1LW2 A;  1WB9 A;  3E01 A;  4EZ6 A;  4KTQ A;  2IIR A;  4FJ8 A;  2H3G X;  4LH5 A;  4AHC A;  4XH1 A;  1NGD A;  4OGE A;  3N4P A;  4BE0 A;  4CZE A;  1KCF A;  2HF3 A;  1N33 K;  3LZI A;  4KB0 A;  1W2B M;  3QB0 A;  1VSE A;  3C7N A;  4DMN A;  3O5B A;  3CQX A;  3MWP A;  4NB4 A;  3THX B;  3VQD A;  4H4M A;  5HBM A;  3DLG A;  3CJ7 A;  3P31 A;  4CZI A;  4R5P A;  2X78 A;  4EHU A;  3OYE A;  4M3Y A;  3O3H A;  1BIZ A;  2QM1 A;  4JKG A;  1VQ5 N;  3PY8 A;  2HVI A;  3RRH A;  4W5Q A;  1H1V A;  2VWJ A;  2D4W A;  1U48 A;  4Z4C A;  1NKC A;  5KPZ A;  3DRP A;  3N4Q A;  3F2K A;  3PIO L;  4CHO A;  4A5A A;  1YTA A;  3OS1 A;  3FZM A;  4ID1 A;  2YKM A;  1TKZ A;  3QML A;  2UUC K;  3AVL A;  4CGI A;  5A2Q O;  3TAB A;  3TTF A;  3THV A;  2QXF A;  4AHR A;  2BE2 A;  3LP3 A;  3O1B A;  2UYT A;  1S9G A;  3U3G A;  1QSY A;  2Z1J A;  1UOC A;  1TK0 A;  5KGX A;  4X66 K;  1BHL A;  4F8R A;  2GUI A;  3PSF A;  3SAF A;  1HYZ A;  3C7N B;  2HB5 A;  1U45 A;  3P38 A;  3QLH A;  1NK4 A;  4FJM A;  5AFU H;  3O4Q A;  3G71 N;  4IDK A;  4B1Z A;  2HHT A;  1X3N A;  3MN9 A;  2DFH A;  2YHB A;  4XH5 A;  5EU7 A;  1JLG A;  3I8B A;  1JCE A;  1HLU A;  4Y1D A;  3M8Q A;  3J80 O;  1BIS A;  2FF6 A;  4BRP A;  5DMR A;  4B3S K;  2OPP A;  3LAK A;  1ASV A;  2P9I B;  3S3O A;  4DFM A;  1WAJ A;  1K8A O;  2YJE A;  3K57 A;  3CCR N;  1WBD A;  4WQ5 A;  4H0O A;  3ZX0 A;  4Y0W A;  3LAM A;  3CPW M;  2P51 A;  4CF1 A;  4OX9 K;  3CM6 A;  1P90 A;  4DS5 A;  3OYM A;  2ZGY A;  3MN7 A;  3FFI A;  4CK3 A;  5ELZ A;  3QNN A;  3SQ2 A;  1V4S A;  4I2Q A;  4B3T K;  1SS6 A;  2ZWH A;  3AA5 X;  4ISE A;  2WON A;  3SQ0 A;  2VG5 A;  2XY8 A;  3IDH A;  4JYA K;  3IUC A;  1TGO A;  1BUP A;  4CJR A;  5HRN A;  4KRF A;  1JL1 A;  3B6O A;  1RTH A;  1EX4 A;  5CZ1 A;  2VWK A;  1RDC A;  3CYM A;  4DS4 A;  1YI2 N;  2Q36 A;  4G1Q A;  4JKG B;  1DTT A;  4MQ3 A;  3SUQ A;  3H1V X;  3AVC A;  2PFU A;  4M7Y A;  3HO1 A;  4CW7 B;  4DV1 K;  4JKD A;  4BVO A;  4CED A;  1BG3 A;  2OCE A;  3KVG A;  1WSJ A;  4IOA L;  3F73 A;  3CCV N;  1KFS A;  2X6N A;  3WUH A; 
#chains in the Genus database with same CATH homology
 4LSN A;  4CGJ A;  4CEZ A;  5J2N A;  2DFE A;  2OPS A;  5D3G A;  1EP4 A;  1Q9X A;  3OYJ A;  1XWL A;  1NOY A;  5JS1 A;  3PO5 A;  4C8N A;  4ELV A;  1XHX A;  3VQ4 A;  3ITH A;  1X9S A;  3DLB A;  1O1W A;  1JLB A;  2PY5 A;  5SWM A;  2KTQ A;  2HHX A;  5CYQ A;  2G8F A;  5KRT A;  4DWI A;  4OKK A;  4O0I A;  4M3W A;  1I3A A;  3HVT A;  1KFD A;  3K2P A;  3OVN A;  1IO2 A;  3QIP A;  1TL1 A;  2KW4 A;  4GVM A;  2G8K A;  1BI4 B;  1RBS A;  4RW4 A;  2G8W A;  3DLH A;  1JXB A;  3SV3 A;  1CZ9 A;  1VSK A;  3WNE A;  4CFD A;  3QEP A;  2PYJ A;  1BGX T;  1TK8 A;  2OYQ A;  4OPJ A;  3KLF A;  4NYN A;  1TAU A;  1D8Y A;  4C8M A;  1B92 A;  3AO5 A;  1HMV A;  3OJU A;  3RWU A;  3NBP A;  1QHT A;  2EX3 A;  3ZSX A;  3OYF A;  3QEX A;  5CZ2 A;  1N5Y A;  3ZT0 A;  3TAE A;  3T1A A;  1HRH A;  3ASM A;  3ISN C;  1C1B A;  1HYV A;  1SKW A;  4IFY A;  1ZBI A;  4DSL A;  4F2R A;  4EP5 A;  3OYB A;  1S6Q A;  1UWB A;  4ICL A;  2D0C A;  4TSX A;  1I39 A;  4GW6 A;  4BWM A;  2D0B A;  3VQ7 A;  4RW6 A;  1SKS A;  2ZD1 A;  4Z4F A;  1QTM A;  4FZX C;  1R0A A;  1NKB A;  3V1R A;  4CIF A;  4Z4E A;  4KFB A;  4FM0 A;  2X6S A;  4CHZ A;  1UAX A;  2RN2 A;  4FK2 A;  3DM2 A;  4B9M A;  1S1U A;  1ZBH A;  1BI4 A;  4K8X A;  4O44 A;  2XHB A;  4O5B A;  2ZE2 A;  3IRX A;  1RCH A;  4LH4 A;  1VSH A;  4E7J A;  4DTO A;  1D9F A;  3DLR A;  1WAF A;  4KTW A;  4DFJ A;  3PV8 A;  3ZSO A;  1JLE A;  2OPQ A;  3VQE A;  4CEO A;  1FKO A;  4W5T A;  3HYF A;  4CHP A;  3SCX A;  1GOC A;  4JS4 A;  4BAC A;  3KJV A;  4BDZ A;  3L8B A;  4M45 A;  3VQB A;  4CGD A;  3NGZ A;  1BL3 A;  2KQ2 A;  4FLX A;  4DF4 A;  2G8V A;  1TK5 A;  4CGF A;  1SV5 A;  1LWF A;  4CHN A;  3KKS A;  2P1J A;  4MFB A;  5C25 A;  3KD5 E;  4DSI A;  1X9M A;  4B8C A;  3HT3 A;  2RKI A;  1XHZ A;  4M41 A;  4E1N A;  3HST B;  4NYF A;  1VRT A;  4BDY A;  1L3V A;  1VRU A;  1VSM A;  2HHU A;  2IS3 A;  3H08 A;  1NJZ A;  1ZBF A;  4B8A B;  3S9H A;  3HM9 A;  3SUN A;  2VG6 A;  3AVG A;  2ATQ A;  4RW7 A;  3HPO A;  1IH7 A;  3TAF A;  4B9V A;  1RT3 A;  3VQQ A;  3NF7 A;  3OYC A;  4CJ4 A;  1RDD A;  3LP1 A;  3VQ8 A;  2QKB A;  2W42 A;  5J2Q A;  5HLF A;  5CYM A;  2YNF A;  1D9D A;  1S1X A;  2OZM A;  4FJK A;  3QEV A;  2I5J A;  3AVB A;  4FW1 A;  2YKN A;  1GOA A;  3M8S A;  4JS5 A;  1HNI A;  4ID5 A;  1NK0 A;  1RNH A;  5C42 A;  4CJQ A;  4KHN A;  1RBU A;  2YHA A;  2KZM A;  4FXD A;  2XY7 A;  2IAJ A;  3CFO A;  2PZS A;  1W0H A;  4N47 A;  2NUB A;  3C6U A;  4CK2 A;  3IAY A;  2PYL A;  2FBY A;  2HNZ A;  3OYG A;  1JKH A;  3AVN A;  3QIN A;  1ZBL A;  4BE2 A;  1YT3 A;  1REV A;  5HRP A;  5HP1 A;  1J54 A;  1JLC A;  3ZSQ A;  1IKW A;  3OS0 A;  4OLB A;  3KTQ A;  2GV9 A;  1UA0 A;  3JYT A;  3K5M A;  3LP0 A;  1WSE A;  2HW3 A;  3KLG A;  4KPY A;  1S6P A;  4AHU A;  4EP4 A;  2QKK A;  4CJE A;  3KK1 A;  3CFR A;  4OGC A;  4AHT A;  2IGI A;  4CGH A;  1YVU A;  4FJ5 A;  1JLF A;  4HCB A;  3CQ8 A;  1WSF A;  3SUP A;  5FDL A;  3L2V A;  2D0A A;  1NK7 A;  1WSI A;  4CF8 A;  3UIQ A;  4RW9 A;  4CJ3 A;  1BCM A;  3C6T A;  4ELU A;  5HRR A;  1J9A A;  4F3T A;  2R7Y A;  4N56 A;  3HP6 A;  2O4I A;  1RT7 A;  2IOC A;  3L3U A;  3PUF A;  5J2P A;  2D5R A;  3ULD A;  4IKF A;  1C0U A;  3TAN A;  3V9W A;  1RDB A;  4KRE A;  4CJL A;  3SV4 A;  4FJG A;  4Q5V A;  2HNY A;  3K5L A;  2ITG A;  2Z1I A;  4E19 A;  3TAG A;  3TAP A;  4DQI A;  4M3R A;  3L2W A;  1QSL A;  2KFZ A;  4DQR A;  4AHS A;  4AIL C;  1L3S A;  4B08 A;  3SI6 A;  3AO1 A;  1N6Q A;  2E4L A;  4DSE A;  4DU3 A;  4KI4 A;  3TAQ A;  1B9D A;  3OYH A;  1CZB A;  4CEE A;  3SQ4 A;  3SYZ A;  3VQ9 A;  3KLE A;  1CXQ A;  3TR8 A;  3ZCM A;  4DU4 A;  1QQC A;  3V6D A;  4E3S A;  4FVM A;  3RMC A;  2HHQ A;  3NF6 A;  1FXX A;  3K59 A;  4UQG A;  4W5O A;  1EKE A;  3NHG A;  4FK0 A;  4YNQ A;  3SJJ A;  4Z4H A;  4FZZ A;  4N76 A;  4OKJ A;  4BE1 A;  4E0D A;  1WNS A;  1J5O A;  1KVC A;  4DTR A;  1RIL A;  4KTZ A;  1SL2 A;  3HPG A;  3BGR A;  3A2F A;  4FLT A;  4KB1 A;  1NK9 A;  3ZT4 A;  1U47 A;  1KLN A;  2B4J A;  4RW8 A;  5FRO A;  3JSM A;  4FM1 A;  2OZS A;  1WLJ A;  3WNH A;  4AHV A;  3ALY A;  2JGU A;  1BIU A;  3G10 A;  3CM5 A;  4JRP A;  3DMJ A;  4DTM A;  5J2M A;  4L8R B;  3MEE A;  1KTQ A;  3HPH A;  4B9T A;  3V9U A;  3V81 A;  2YNG A;  3AVK A;  1LAV A;  2A1R A;  4CJS A;  3MEG A;  3AVF A;  3NFA A;  1KLM A;  3ZT3 A;  2HMI A;  4RG8 A;  1T7P A;  3LWL A;  4CFA A;  3L2Q A;  3VQ6 A;  4CEF A;  3DLE A;  4M3T A;  1A5V A;  4HVJ A;  3AO2 A;  4DTJ A;  3EYZ A;  4FM2 A;  3KLH A;  3G0Z A;  1NKE A;  2P5G A;  1A5W A;  2IDO A;  2BDP A;  1ZYQ A;  2HHW A;  2O4G A;  4E7L A;  3AVI A;  1S1T A;  5C24 A;  3CG7 A;  4FLY A;  1LWC A;  2E6M A;  4J2E A;  3TI0 A;  3V1O A;  1RT5 A;  3S3M A;  1BQM A;  4CK1 A;  4Y1C A;  3VA3 A;  2HHS A;  1QS4 A;  1ZBU A;  2G8U A;  4OLA A;  2HVH A;  1A5X A;  4Z4G A;  1IG9 A;  3O4N A;  1WSG A;  3AVA A;  3VA0 A;  1CLQ A;  4CF9 A;  4CJV A;  4CES A;  3C94 A;  1BQN A;  3OS2 A;  3OYK A;  3MED A;  5KGW A;  1Q8I A;  4DTS A;  1C1C A;  5FRN A;  4HUF A;  3TAR A;  1K6Y A;  4O55 A;  4B9L A;  4DQP A;  3AO3 A;  3V9S A;  1LAW A;  3HK2 A;  1IKX A;  3V4I A;  2Y1I A;  1C0M A;  4I2P A;  2ZQB A;  4O0J A;  3HJF A;  1ASW A;  3PX0 A;  3RMD A;  3DRS A;  1JLQ A;  3MXM A;  1HPZ A;  2FBT A;  3IS9 A;  3LP2 A;  3NDK A;  3MXJ A;  1IKY A;  4FW2 A;  1D5A A;  3P1G A;  4Z0U A;  4CGG A;  3OYD A;  3KK3 A;  4E7I A;  4DFK A;  3SZ2 A;  1NJX A;  4F2S A;  1RBT A;  1KRP A;  2BGG A;  3V9Z A;  3QES A;  4LSL A;  3QO9 A;  3DYA A;  3V9X A;  2F96 A;  3KLI A;  3NCI A;  3DOL A;  4CEA A;  4FLV A;  1C0T A;  1F21 A;  3ZSV A;  5E41 A;  3LDS A;  3WNG A;  4E7K A;  4DTN A;  4KKO A;  5HRS A;  3VQP A;  4PA1 A;  1HQU A;  1L5U A;  4DQS A;  4J2D A;  4DTX A;  5KTQ A;  3VQA A;  1L3U A;  3AVH A;  4FK4 A;  4IBN A;  4O4G A;  3D0P A;  3I8D A;  4DU1 A;  4I9Q A;  4M3X A;  3AV9 A;  1VSI A;  2HHV A;  1VSL A;  2Q3S A;  2DFF A;  1UA1 A;  4ELT A;  1YTU A;  2B6A A;  3QIO A;  4ZHR A;  1U4B A;  4LY7 A;  3KD1 E;  2ETJ A;  4PQU A;  2XY5 A;  3B6P A;  3MXI A;  3OYI A;  3RTV A;  4PUO A;  1HYS A;  4H4O A;  1KSP A;  3DRR A;  1S1V A;  5T7B A;  3OYN A;  3KK2 A;  3RMA A;  4C8O A;  4AH9 A;  4JRQ A;  1Q9Y A;  4K8Z A;  4ZTF A;  1NK6 A;  1VSJ A;  2IC3 A;  4CF2 A;  4KHY A;  1RBR A;  3SUO A;  4BDP A;  4DSJ A;  4CJ5 A;  2E6L A;  3HL8 A;  4FJN A;  1L3T A;  1C6V A;  4B3O A;  1W9H A;  3U6F A;  1LW0 A;  1RT4 A;  1Z25 A;  3KKR A;  1JXE A;  3P5J A;  4WE1 A;  4OVL A;  1LW2 A;  4BWJ A;  3E01 A;  3PX4 A;  3QNO A;  3KIO A;  4EZ6 A;  4KTQ A;  3HVR A;  4FJ8 A;  2Z1G A;  4LH5 A;  4AHC A;  1JLA A;  4HUE A;  3OY9 A;  3ZSZ A;  1T8E A;  3AA3 A;  3NH1 A;  3NE6 A;  3VN5 A;  2YNI A;  2JLE A;  3K5N A;  1EET A;  4OGE A;  4BE0 A;  1MU2 A;  4DLE A;  3I0R A;  4KHU A;  1CXU A;  4W5N A;  1KCF A;  3VQ5 A;  3M8R A;  3DI6 A;  4FLU A;  3T19 A;  1QSS A;  1RTI A;  3LZI A;  4M3Z A;  1TV6 A;  4J2B A;  1IKV A;  1EXQ A;  1KVB A;  4KB0 A;  1VSE A;  4HCC A;  5FRM A;  1TKD A;  4DMN A;  1WSH A;  2KFN A;  5KI6 A;  1RT6 A;  3QET A;  4HHT A;  3RRG A;  3VQD A;  4KAZ A;  4H4M A;  3TAM A;  4PWD A;  5HBM A;  4DF8 A;  3DLG A;  4JLH A;  4R5P A;  4CJW A;  4YFU A;  2X78 A;  3OYE A;  1NOZ A;  4M3Y A;  2FBX A;  1C1A A;  4KHS A;  4FJL A;  4FLZ A;  1S1W A;  4KHQ A;  3F9K A;  3O3H A;  4FJI A;  1BIZ A;  3LZJ A;  1NK8 A;  4M42 A;  3RMB A;  2HVI A;  3PY8 A;  3RRH A;  4W5Q A;  4OJR A;  2X74 A;  2VWJ A;  3AO4 A;  3HXM A;  4Z4C A;  1QE1 A;  1U48 A;  1NKC A;  2XRI A;  2EHG A;  3DRP A;  4CJU A;  4B9S A;  3ZSW A;  3AA2 A;  4CHO A;  1SUQ A;  3QER A;  1YTA A;  4DSF A;  4EZ9 A;  3DOK A;  3OS1 A;  3BDP A;  4N41 A;  4ID1 A;  1TL3 A;  3LWM A;  4CHY A;  4CEB A;  4QOZ B;  2YKM A;  2G8H A;  2AJQ A;  3C95 A;  3SPY A;  3EY1 A;  1TKZ A;  1JL2 A;  3AVL A;  3NF8 A;  2Y1J A;  3ZT2 A;  5JS2 A;  2WOM A;  4CGI A;  1X9W A;  3T3F A;  4CF0 A;  4B9N A;  3TAB A;  4Q0B A;  3MAQ A;  4FCY A;  1ASU A;  3RR7 A;  3PO4 A;  4C8L A;  1NJY A;  3CFP A;  4KO0 A;  3NGY A;  3V1Q A;  3THV A;  2QXF A;  4FYD A;  3NGI A;  1HJR A;  1WN7 A;  4AHR A;  1U49 A;  2BE2 A;  4B9U A;  1BCO A;  3LP3 A;  1S9G A;  3LAN A;  4FZY A;  2YV0 X;  1TKX A;  3U3G A;  5I42 A;  4H8K A;  1QSY A;  2Z1J A;  1UOC A;  3MEC A;  1J53 A;  1HQE A;  2F8S A;  1TK0 A;  5KGX A;  4KI6 A;  4CEQ A;  3L2U A;  4E7H A;  3U3Y A;  3QEI A;  1BHL A;  3LAL A;  2KZZ A;  4DQQ A;  4F8R A;  4I7F A;  3S3N A;  2OA8 A;  2GUI A;  3RR8 A;  1LV5 A;  3OYL A;  1HYZ A;  4CIG A;  5J1E A;  3NF9 A;  2HB5 A;  1GOB A;  1SL0 A;  1U45 A;  1S9E A;  1TAQ A;  4N5S A;  1RTD A;  4FLW A;  4FJJ A;  2A1S A;  3QLH A;  1NK4 A;  4J2A A;  4FJM A;  4FJH A;  2RF2 A;  3O4Q A;  3SQ1 A;  2OPR A;  1NJW A;  4E89 A;  4IDK A;  2Z1H A;  2HHT A;  1SKR A;  1TKT A;  1VSD A;  1Z26 A;  4Z4I A;  2QK9 A;  3ZSR A;  2DFH A;  2YHB A;  1VK0 A;  2DTU A;  4FJ7 A;  2BAN A;  5EU7 A;  3WNF A;  3I0S A;  3NH0 A;  1DLO A;  1JLG A;  3TWH A;  3ZT1 A;  4CEC A;  4Y1D A;  4DTP A;  4FJX A;  4CCH A;  4NCB A;  1XI1 A;  1VSF A;  3M8Q A;  1U04 A;  1BIS A;  4DSK A;  1RTJ A;  3M8P A;  1HNV A;  5DMR A;  3VQC A;  2XY6 A;  1ITG A;  2OPP A;  3LAK A;  2VG7 A;  2FC0 A;  4HUG A;  2B5J A;  4M3U A;  2DY4 A;  1ASV A;  3K5O A;  1RT2 A;  5DK5 A;  4DFM A;  3S3O A;  1RDA A;  1RBV A;  5K14 A;  1WAJ A;  2GBZ A;  3K57 A;  3LPT A;  5SZT A;  3D45 A;  3AVJ A;  1DTQ A;  3LAM A;  4CER A;  2P51 A;  4CF1 A;  3CM6 A;  1G15 A;  4GMJ B;  4DS5 A;  3OYM A;  4C8K A;  2YNH A;  4IG0 A;  4LD0 A;  2G8I A;  3FFI A;  2HND A;  2F8T A;  4CK3 A;  1T05 A;  3O3G A;  2XO7 A;  4CJK A;  3QNN A;  3SQ2 A;  1RT1 A;  4I2Q A;  3AA5 X;  3DLK A;  5I3U A;  1S5J A;  1FKP A;  1LWE A;  3NH2 A;  2WON A;  3P83 D;  1SL1 A;  2LSN A;  2VG5 A;  2XY8 A;  4IG3 A;  4QAG A;  4DTU A;  4E1M A;  5HRO A;  3SQ0 A;  5KRS A;  4DLG A;  3SNN A;  1T03 A;  4CIE A;  4QCL A;  1TGO A;  4CE9 A;  2FBV A;  4CJR A;  5HRN A;  4ZTJ A;  2RPI A;  4NCA A;  4KHW A;  4KRF A;  1JL1 A;  3IG1 A;  3B6O A;  1RTH A;  3L3V A;  5CY4 A;  1EX4 A;  1X1P A;  2VWK A;  1RDC A;  3CYM A;  5CZ1 A;  4DG1 A;  4OPK A;  4DS4 A;  4G1Q A;  3SUQ A;  1DTT A;  4MQ3 A;  2P5O A;  3OJS A;  3AVC A;  1B9F A;  3OYA A;  4PY5 A;  3AA4 A;  1KVA A;  4CJT A;  1TVR A;  1XC9 A;  1NK5 A;  3LPU A;  3QEW A;  3ZSY A;  3HO1 A;  4F4K A;  4XIU A;  4KV8 A;  4CJP A;  4CFC A;  1Y97 A;  4F3O A;  4CHQ A;  4I9L A;  4IFV A;  3O3F A;  4CED A;  4HTU A;  3AVM A;  3HP9 A;  3NAE A;  3L2R A;  1WSJ A;  4FJ9 A;  4W5R A;  4NCG A;  4OKE A;  3F73 A;  1FK9 A;  4CJF A;  4DFP A;  1KFS A;  3EZ5 A;  2X6N A;  3K58 A;  3SPZ A;  4CFB A;  3PX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...