3AVHA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/inhibitor
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avhA00
4HTUA 2G8VA 4E7JA 4DF4A 3VQDA 1GOCA 3HVRA 1O1WA 2FBTA 1ASWA 3HXMA 1N5YA 1SL2A 4KHNA 1T05A 4JS5A 4CJ3A 4CK2A 3S9HA 4CHPA 4DG1A 1NK8A 4ELTA 5SZTA 2E4LA 4FK2A 1JLQA 1GOBA 1RDCA 1WLJA 4KV8A 1SKRA 1WSEA 1T03A 4QOZB 1C6VA 1D5AA 1HYZA 3D45A 3HPGA 4CHQA 4CF2A 4N76A 3IRXA 1NK5A 5HRPA 3V9WA 3O3FA 1CXUA 1F21A 2YKMA 1J53A 2ITGA 4J2EA 3MXJA 4M41A 3TARA 2ZE2A 4KI6A 2DFHA 3VQCA 4LSNA 3SPZA 1BIZA 3V6DA 3KLFA 1TKZA 4I9LA 1L3TA 5T7BA 4F3TA 1TKDA 5KGWA 4CJFA 3TABA 2VG5A 4FLTA 4GMJB 4CGJA 3LWLA 4CFAA 4O55A 3V4IA 4FZXC 2B4JA 4O0IA 4RG8A 4PY5A 4ID5A 2HHVA 4CEEA 1SL0A 3IS9A 3L3VA 1RTIA 4W5RA 1CZBA 3DRRA 3NH2A 4E7LA 4M3YA 4DFMA 3A2FA 1TKTA 3CM6A 4Z4EA 1J5OA 1X9MA 1TAQA 4Z4HA 5DK5A 2LSNA 1Q9XA 1FK9A 1K6YA 2D0AA 4F2SA 3TR8A 3ASMA 3B6PA 1J9AA 1WSJA 4CE9A 3MEGA 4DF8A 1HYVA 2EHGA 4FJKA 3RMDA 3V1RA 3AA5X 3VQ9A 1NK6A 4XIUA 2KQ2A 4I2QA 2QKKA 3QNNA 4FJXA 5J2QA 2DFEA 1XWLA 4E7KA 2F8TA 3AVMA 4FK0A 5HRRA 1WSHA 1EX4A 3F73A 1NKBA 4Z4IA 3S3NA 2KZZA 1HJRA 4I2PA 3HVTA 1U45A 3LDSA 1LV5A 3V1OA 1QS4A 2GUIA 3OYLA 3E01A 3ZSRA 1MU2A 3PV8A 2QK9A 1KFSA 3DRPA 3KK2A 1QTMA 5I42A 3NAEA 4EZ6A 2ZD1A 3AA2A 3KLHA 1CLQA 4CJRA 1VSHA 4MQ3A 4TSXA 3CYMA 3DYAA 4F2RA 3PX0A 4K8XA 4DMNA 4PUOA 2HMIA 2VG7A 1IH7A 4FVMA 4HHTA 4NCAA 1BI4B 2OPSA 4OKEA 5E41A 4CFCA 4G1QA 4FLXA 1XC9A 4M45A 4F8RA 2KFZA 3QERA 4N56A 1B9DA 4MFBA 5FROA 4DTRA 3RMBA 3LAMA 1HMVA 4M3UA 1EETA 2D0CA 1HNIA 2Y1JA 4CGFA 1XI1A 4FJMA 4PWDA 1S1WA 4E89A 1KLNA 4C8OA 4FJJA 4CK1A 3ALYA 1KFDA 1IO2A 5HROA 1IKWA 1KVBA 1B9FA 1RT6A 3I0SA 1U4BA 3RR7A 1RBUA 4CF8A 4OPKA 3OYBA 3IAYA 1X9SA 3BGRA 4K8ZA 4OKJA 3MXIA 2YNGA 4CCHA 4CJWA 2YKNA 3QEIA 1HYSA 3AO5A 4CERA 3PY8A 2XY8A 3RRHA 1JLFA 3ZSVA 4FJNA 3AVBA 1TV6A 4Z4CA 4KPYA 4PQUA 4FM2A 1TKXA 3F9KA 4AHSA 4BDZA 1BCOA 5CYMA 3NDKA 3SV4A 4FJHA 3OYFA 3AVKA 4IG0A 1SKSA 3PUFA 1Q8IA 2HNZA 4CEBA 4RW9A 3O3HA 3U6FA 2P1JA 4C8KA 2G8UA 2RN2A 2KFNA 1C0UA 1UWBA 1VSKA 1BIUA 4M3RA 4DU4A 4OKKA 1ZBHA 1XHXA 2F96A 4ZTFA 2P5GA 4IFYA 4OLAA 3DLGA 3I0RA 3K5OA 1QSLA 5KTQA 3AVGA 2OPRA 3HJFA 2P51A 4I7FA 3AVFA 4NYFA 4CJKA 3V9UA 1JKHA 1JL2A 2D0BA 3AV9A 4CJQA 3ITHA 1JLBA 4HUFA 4DU3A 4KB1A 3PO4A 4DTXA 4HUEA 4BDYA 3DLKA 3ZSOA 3C94A 1S1TA 3K58A 3KLIA 4IDKA 3KLGA 3VA0A 3QO9A 3ZSQA 2FC0A 3V9SA 3ZT2A 4NCGA 4CJ5A 3OS0A 3MECA 1EKEA 3ZSYA 4CF1A 3P5JA 3TAFA 5HBMA 3HPOA 1UA1A 1J54A 4DSEA 3PO5A 2Z1GA 4FJIA 3AVJA 2X6SA 5CY4A 3T1AA 3K5LA 4DQRA 1WSGA 1NJZA 4RW4A 4JRQA 3LWMA 3L2UA 4KHQA 5FRMA 4O0JA 4KAZA 1C1BA 3OYGA 2RPIA 3LAKA 3EZ5A 4E19A 4E7IA 3TANA 5I3UA 1DTQA 1RDDA 2Z1IA 3KK1A 3VN5A 4DLGA 2HNDA 4L8RB 4CFDA 4CEFA 3NH1A 4KTZA 3OS1A 1ASVA 3OS2A 2G8KA 3CQ8A 2XO7A 2RF2A 5CYQA 1SL1A 3TAPA 1HQUA 5J1EA 2YHBA 1S9GA 3G10A 3L2RA 3K2PA 4CJVA 1W0HA 1WAFA 2ZQBA 4B9SA 4HVJA 4M3XA 4LD0A 2XY7A 1D9FA 3NGYA 3B6OA 3SQ1A 1D8YA 3OYNA 4FM0A 1NOYA 4KHSA 4CEOA 3K59A 3AVCA 4I9QA 2DY4A 1NJYA 3JSMA 4KKOA 3SPYA 2IDOA 5HP1A 4FLUA 3RRGA 3LANA 3SZ2A 1LAWA 1L3UA 5D3GA 3SV3A 3TI0A 3D0PA 3O4QA 2R7YA 4FW2A 3K5NA 4PA1A 4KHYA 2HVHA 4B8CA 5FRNA 1LW2A 3NF9A 4CJ4A 1HRHA 3ZT3A 3HP6A 4H8KA 3H08A 4BE1A 3BDPA 2EX3A 4WE1A 3WNFA 3ULDA 3THVA 1YTUA 4FJ9A 1BQMA 4JLHA 5FDLA 3KIOA 3K57A 1ZYQA 2VG6A 3MAQA 4DSKA 3U3GA 4CJUA 3QEVA 3QEXA 5HLFA 1RTDA 3KD5E 4H4MA 2WOMA 2OPPA 3CFRA 4DTPA 4E3SA 3V81A 3WNHA 4OJRA 1IKVA 3TWHA 3SQ0A 3QLHA 1S1VA 2IS3A 3AO2A 3UIQA 4M42A 3DRSA 4CHNA 3L8BA 3DLHA 3OVNA 1SUQA 3SQ4A 3TAMA 4OGEA 1QE1A 4J2AA 4AHVA 2XRIA 3MEDA 4O4GA 4BACA 4ELVA 2FBYA 4Z4GA 3OYIA 4CGGA 3QESA 1RBVA 3DOLA 1TK0A 1TK8A 4J2DA 4H4OA 2X78A 3C95A 2NUBA 5KGXA 3NHGA 3HO1A 1REVA 1ZBFA 2E6LA 4HUGA 2HB5A 1BGXT 4N5SA 3NH0A 4FLZA 4CFBA 4DFPA 3SCXA 3VQ5A 2KTQA 3DMJA 4NYNA 2G8HA 2OA8A 3HSTB 1L5UA 4DQPA 4M3TA 3L2WA 4JRPA 1KVAA 4CECA 2G8IA 3LPUA 3ZSXA 1ZBIA 4FJLA 2OZSA 5KRSA 3DOKA 1Q9YA 1VSLA 2O4GA 4CIEA 4CK3A 5HRSA 4M3WA 1VSJA 3ZSWA 2VWKA 2YNHA 1X1PA 5KRTA 4FYDA 1LWEA 2Z1HA 3VQ8A 4B8AB 1QQCA 1RDBA 3AA3A 3NFAA 4LSLA 1U04A 3NCIA 4BE0A 1FKPA 1G15A 4CGHA 3KLEA 4CEQA 1S1XA 3VQPA 1VRUA 3JYTA 1RT7A 1BL3A 4B9NA 3VQBA 1RBTA 4CJTA 3ZSZA 4C8NA 1U48A 5JS1A 4B3OA 1RDAA 1TVRA 3DLEA 4ID1A 4LH4A 4RW8A 5JS2A 3LP1A 1TL3A 1YT3A 4DTJA 4DTNA 1YTAA 3G0ZA 3LZJA 2FBXA 2XY6A 4ELUA 1S5JA 3OYEA 2YHAA 1ASUA 1TL1A 4ZTJA 4KHUA 1U49A 3LP2A 1TAUA 4FJ5A 2A1SA 1Z25A 4Y1DA 1LW0A 3DI6A 4HCCA 1DTTA 1S6QA 4W5TA 1NK9A 4NCBA 4KI4A 4FXDA 4YNQA 1WAJA 5J2MA 1RT2A 2VWJA 3OY9A 2GV9A 2QKBA 1KLMA 3VA3A 2A1RA 3FFIA 4DTOA 3L2QA 1QHTA 4EP5A 2PYJA 3HL8A 4F4KA 1YVUA 4IFVA 2JGUA 3I8DA 1W9HA 4KFBA 1TGOA 1BI4A 4KTWA 4R5PA 3RMCA 4OLBA 2HHQA 3CFPA 2HHUA 3OYJA 4CF0A 2ATQA 2BANA 3AA4A 3CFOA 5EU7A 2W42A 1KSPA 1VSMA 1RBRA 3WNGA 2QXFA 4DTUA 2Q3SA 1R0AA 3LZIA 1WSFA 3TAEA 4CIGA 4RW6A 2BGGA 2F8SA 1BHLA 1RNHA 1BISA 4QCLA 1SKWA 3OYAA 3OYMA 3P83D 3QIOA 5J2NA 3SQ2A 2BDPA 4Z4FA 3QIPA 2B5JA 1RT1A 4CHZA 4YFUA 4Q5VA 3SUNA 1NJWA 1VRTA 4Y1CA 4CEZA 4DTMA 4M3ZA 4KB0A 4EP4A 1JXBA 4DFJA 1FXXA 4J2BA 4OVLA 3SJJA 5SWMA 3M8QA 1VK0A 3VQ7A 4B9MA 2YNFA 3IG1A 1QSSA 4B9VA 3NF7A 2X6NA 4BWJA 3K5MA 2HVIA 1I39A 4DS5A 1RTHA 3AVIA 4AHTA 3HK2A 1RCHA 1VSDA 1GOAA 2I5JA 1HNVA 3C6TA 4GW6A 3OJUA 2WONA 4DQSA 4CJLA 1BQNA 1NK0A 3SI6A 4BDPA 1S6PA 4N47A 1I3AA 4LY7A 1RT4A 1JLGA 2KW4A 3KKSA 4IG3A 1NKEA 2PYLA 3KD1E 4BWMA 3LP3A 3DM2A 3OYDA 2FBVA 3HYFA 1HPZA 4OGCA 3AVAA 3NBPA 4E1MA 1Y97A 3KKRA 1RTJA 1ZBLA 1N6QA 2O4IA 3M8SA 3AVLA 2E6MA 1LWFA 3ZCMA 1XHZA 3NGIA 3OYHA 1EP4A 3EY1A 2G8FA 3VQ4A 1S9EA 4CJEA 4CIFA 1X9WA 3CM5A 1NJXA 2D5RA 1BCMA 1UOCA 1WN7A 4C8LA 5KI6A 1L3VA 4B9LA 1NKCA 4KRFA 3NF6A 2HHXA 1TK5A 1VSIA 2OYQA 3VQEA 3RMAA 3LPTA 4FZZA 1D9DA 2HHSA 4AHRA 3M8PA 4Z0UA 4CESA 5C24A 1RT3A 4CF9A 2AJQA 1JLCA 4O44A 3T3FA 2HHWA 3ZT0A 1NK7A 3S3MA 2P5OA 4DS4A 5HRNA 4CEAA 3RR8A 4DSFA 3QNOA 4IKFA 1VSFA 2X74A 3MXMA 1T7PA 2PZSA 2PY5A 4B08A 4FLWA 3SUOA 4AHUA 4FJ8A 2RKIA 3O4NA 1L3SA 4DQQA 3AO4A 4OPJA 3C6UA 3AO1A 3CG7A 1T8EA 4DU1A 4CHOA 4DSIA 4DTSA 3NF8A 4E1NA 4O5BA 4FM1A 2Z1JA 1NK4A 1B92A 2YV0X 2G8WA 4CJPA 4FW1A 3L2VA 5CZ1A 2KZMA 1UAXA 3QEWA 2DTUA 1Z26A 3AVNA 4Q0BA 3HP9A 4F3OA 2XHBA 4EZ9A 4DSLA 4CEDA 2IAJA 4CGIA 4FJ7A 3KJVA 3SNNA 4FLYA 4FZYA 2JLEA 1IKXA 3OYCA 1IG9A 4E0DA 4KTQA 1JL1A 2YNIA 3TAQA 2HNYA 1A5WA 2XY5A 1ITGA 3S3OA 3HPHA 2HHTA 4N41A 4ICLA 3SUQA 1RBSA 1SV5A 1VSEA 4DLEA 1QSYA 1KCFA 4FLVA 5CZ2A 1C1CA 1KTQA 3LALA 3NE6A 1JLEA 1JXEA 4KO0A 4E7HA 3DLBA 2HW3A 4AH9A 3VQQA 4KHWA 2IOCA 3AO3A 3P1GA 3V1QA 4CGDA 3PX6A 3U3YA 3QETA 2ETJA 4W5NA 4BE2A 1C0MA 3VQAA 4DQIA 3OYKA 2BE2A 1UA0A 4HCBA 1LAVA 5C25A 3PX4A 4FJGA 4AILC 3LP0A 3T19A 3SYZA 3AVHA 4C8MA 4CJSA 3V9ZA 4RW7A 3NGZA 4DSJA 1C0TA 4AHCA 5C42A 1U47A 3KTQA 1WNSA 1ZBUA 1CZ9A 3ISNC 3L3UA 3ZT4A 3V9XA 2DFFA 1NOZA 3VQ6A 4W5OA 4DFKA 3HM9A 1DLOA 4GVMA 4B9UA 2OPQA 1S1UA 1EXQA 1CXQA 4IBNA 5DMRA 1A5VA 1A5XA 4KREA 1IKYA 3DLRA 4CHYA 4UQGA 3O3GA 2IC3A 4DWIA 2GBZA 5J2PA 2B6AA 1LWCA 1RILA 4B9TA 4LH5A 3QINA 3OJSA 3QEPA 3ZT1A 4ZHRA 1KRPA 1FKOA 1WSIA 3MEEA 3KK3A 4JS4A 3RTVA 3TAGA 1C1AA 3WNEA 3HT3A 1RT5A 3RWUA 2IGIA 5K14A 1HQEA 4W5QA 4FCYA 2Y1IA 1KVCA 3M8RA 4FK4A 1JLAA 3EYZA 2OZMA 3SUPA 4QAGA
chains in the Genus database with same CATH superfamily
2G8VA 3TTCA 3I8BA 4DF4A 2FSNA 2QI2A 3FZKA 5JLHA 3CJBA 3EN9A 2ZJPL 3C7NB 1ASWA 3RVCA 1T05A 1ZXOA 4CK2A 3S9HA 4CHPA 4BVPA 1RDCA 4KV8A 1IG8A 1N34K 1NWKA 5AQUA 3KK7A 3V9WA 3O3FA 3HI0A 5AFUA 1J53A 5BRFA 3MXJA 3P31A 2ZE2A 4LSNA 3RSEB 1BIZA 3H3NO 2HBLA 4DCHA 1HKCA 3TABA 4FLTA 4FZXC 2HMPA 4RG8A 2HHVA 1NM1A 3L3VA 3VGMA 4W5RA 4M3YA 1S22A 4A2AA 4DV0K 4B3SK 4XIUA 2QKKA 5TKWA 3AVMA 5HRRA 3C7NA 3HVTA 1U45A 5EY4A 5M1KA 3OYLA 3HSCA 2ZGZA 1KFSA 3KK2A 1U2VB 1X9JA 1VSHA 2Q0UA 2A6AA 3CYMA 4FL9A 2VG7A 1IH7A 4FVMA 1R59O 1KXPA 1YJWN 4BR0A 4FLXA 3CQYA 4M45A 3N4PA 4N56A 5KPRA 4H0VB 3CQXA 2E2PA 3CHWA 4PWDA 4CK1A 2V7YA 1IKWA 1B9FA 3O9RA 3GDQA 4OPKA 1XUPO 3OYBA 2A5XA 3BGRA 2YNGA 3QEIA 1HYSA 3AO5A 1OH8A 4YOTA 4DR4K 2GWKA 5CYMA 1NJIO 4FJHA 3OYFA 3VEYA 4IG0A 4CEBA 4RW9A 5KPZA 1VSKA 4K25A 1O13A 1W97L 3AVGA 4PHTX 4I7FA 3AV9A 1JLBA 3PO4A 4HUEA 3DLKA 2E88A 3CCRN 4XH1A 3OS0A 2IVPA 4O5FA 1EKEA 2AA4A 3ZSYA 5DM6L 3TAFA 4FJIA 2UXCK 2Z1GA 3AVJA 4JKCA 1V4SA 4BGAA 5FRMA 4KAZA 1GLBG 2RPIA 2F4VK 1RDDA 3KK1A 3VN5A 1Z05A 4JI4K 3LL3A 3OS1A 1ASVA 1YAGA 3H46O 3CC4N 2XO7A 2RF2A 5CYQA 1HQUA 2YHBA 1S9GA 4B9SA 5AQZA 4LD0A 2XY7A 1D8YA 3LDNA 4FM0A 4KHSA 3K59A 4GKKK 4I9QA 2DY4A 1HR0K 3LDPA 3MN6A 4YOWA 4FLUA 1TYQB 3TI0A 4JV5K 4JI2K 4IO8A 2R7YA 4WQ5A 4KHYA 4PA1A 3NF9A 1HRHA 3ZT3A 4H8KA 1T3VA 4BE1A 3BDPA 3R1XA 3THVA 2P9SB 3MDQA 3HOSA 4DSKA 3QEXA 3QEVA 4KHPK 3MN5A 4H4MA 3CFRA 3V81A 4OPAA 4IOAL 4OJRA 5B8HA 3QLHA 2V7ZA 4F9OA 2UYTA 2P9UA 5JLFA 3BF1A 3UIQA 2JWLA 1QE1A 4Z4GA 3H1VX 1BG3A 2F9TA 2Q36A 3HO1A 3C95A 5LMUK 3QMLA 4HUGA 2HB5A 3NH0A 4CZJA 5AQVA 4CFBA 4DFPA 4Z94A 3SCXA 3OW2M 3VQ5A 4B1ZA 4NYNA 3DLLL 2G8HA 4DQPA 1VQON 3L2WA 3E1YA 5AQSA 2G8IA 2E1ZA 4B1YB 5KRSA 3DOKA 4CK3A 3ZSWA 2E20A 4LF7K 2YNHA 1LWEA 4B8AB 3VQ8A 1RDBA 3NFAA 2VYPA 4JKFA 3VQPA 4KH6A 5AQXA 4PKHA 4WQ4A 4ISFA 3PLAA 1MWMA 5JICA 1TVRA 4RW8A 4LH4A 5AQJA 1TL3A 4ELUA 2FBXA 5AFUH 2NRVA 2P9LA 1YVNA 3EEQA 1TAUA 4Y1DA 3DI6A 1S6QA 3WT0A 4KI4A 1WAJA 1KLMA 3VA3A 3ZETA 3L2QA 1QHTA 3QFPA 1TGOA 1JJ2M 3CCJN 2HHUA 3GOIA 3AA4A 5HOOA 2W42A 5EU7A 1VSMA 4X64K 2BGGA 4RW6A 2F8SA 4OO1J 1BISA 3WXIA 3OYAA 4Z4FA 2B5JA 4CHZA 4I6MB 4YFUA 1NGHA 4FSVA 4Y1CA 2ITMA 2NRHA 4DFJA 3M8QA 3VQ7A 1QSSA 4B9VA 1ATSA 3THYB 1NMNA 3FE1A 1HNVA 2YI1A 3C6TA 2WONA 4BG9A 3LDOA 4CD1A 4DR1K 4IG3A 4DV7K 4U7BA 3LP3A 4BVOA 2ASOA 2FBVA 4IEEA 1H1VA 2O4IA 4C1NI 3NGIA 4B1VA 4CIFA 3WUHA 1X9WA 4BRMA 5AZIB 1WN7A 4C8LA 5AZJB 4B9LA 1NKCA 4KRFA 2CGJA 4YHHK 2PFUA 4IJNA 2OYQA 3ZX3A 3RMAA 2HHSA 4AHRA 1RT3A 2AJQA 1JLCA 3T3FA 2HHWA 3LDLA 2P5OA 4CEAA 3RR8A 4DSFA 4IKFA 2OTJN 2HHHK 3EE8A 3SUOA 2QWMA 5GAGP 1L3SA 3AO4A 3C65A 4DV5K 3THYA 4CHOA 4DTSA 4E1NA 2OANA 4CJPA 1GLEG 3L2VA 3MMVA 2UUAK 5FPEA 4CEDA 4JHDB 3W3DA 2IAJA 3J7YP 1N33K 3A0IX 4FZYA 3BP8A 3TAQA 2QM1A 2XY5A 3S3OA 1DEJA 4ICLA 3SUQA 4DLEA 4FLVA 4XEIA 3CJCA 4H0XB 4KO0A 4E7HA 2HW3A 4BRLA 4AH9A 3CI5A 5GINA 2IOCA 3P1GA 3U3YA 1LOTB 1VQLN 2ETJA 4DQIA 4CZIA 5C25A 4FVUA 4RW7A 1C0TA 4AHCA 4V19S 1ZBUA 1CZ9A 4BQZA 3O9QA 3VQ6A 4DFKA 2FSKA 4H0OA 4B9UA 5E84A 4LFAK 1IV0A 1HNWK 1J5EK 4IBNA 4KREA 1IKYA 3DLRA 5AQWA 4CHYA 2IC3A 3AAQA 1OVQA 4YDUA 1VQ7N 3UE5A 4LH5A 1YF5L 3CJ1A 3WXLA 3VOVA 1WSIA 4MDAA 3KK3A 3TAGA 3D2EB 1QQOA 4W5QA 1HQEA 2QWRA 2W6LA 3S41A 5AQMA 3J7ZO 4HTUA 2Q2RA 1GOCA 4KHNA 1SL2A 1FW6A 4JS5A 4CJ3A 1NK8A 3MN9A 2WTUA 2E4LA 4FK2A 4BR4A 4FWKA 2CH5A 1WSEA 1T03A 4BRHA 1D5AA 5BRHA 4CF2A 3D2FB 3IRXA 1NK5A 3SAFA 3E9OA 4J2EA 1D4XA 2O8FB 4EHUA 3KLFA 1QZ6A 1L3TA 1TKDA 4JN4A 4GMJB 3LWLA 4O0IA 4ID5A 4LF9K 4BR2A 5GADP 3SLCA 2D0PA 3NH2A 1OVYA 4BRQA 5M1QA 2FXUA 1J5OA 5GAHP 4IOCL 4GY2B 5DK5A 1K6YA 3D2EA 3FZMA 1VQMN 4CE9A 1WSJA 3MEGA 4B1XB 2EHGA 2A3ZA 2D4WA 3V1RA 3AA5X 4JD2B 3DXMA 3VQ9A 1XMOK 3CJ9A 4I2QA 1MDUB 4E7KA 1I94K 1NKBA 3F73A 4CZEA 4QS8A 4A2BA 3UKUB 2UUCK 3LDSA 3FLCO 1QS4A 2QXLA 3ZSRA 1MU2A 3PV8A 3DRPA 3KWIA 1QTMA 3D2FA 3KLHA 1K73O 1CLQA 3OTOK 3DYAA 4F2RA 2O8FA 4DMNA 3OA9A 2HMIA 4HHTA 3FGUA 4OKEA 2BTFA 3QERA 2GEMA 4DTRA 4DV4K 1QQNA 3RMBA 4CZMA 1HMVA 4ISGA 2A41A 2D0CA 1HNIA 2Y1JA 4FJMA 4K41A 3AY9A 4LF4K 4E89A 5KQDA 4CI6A 1IO2A 5HROA 3T1YK 3MX2A 3U4LA 1RT6A 1BU6O 3RR7A 2KHOA 1K9MO 2O8DB 2P9IA 4K8ZA 4OKJA 1Q82O 2YKNA 2VGMA 3UKRB 4AM6A 4CERA 2XY8A 1HNZK 3AVBA 3CJAA 4Z4CA 2HBJA 2WC9A 2O8BA 1TKXA 4BDZA 1BCOA 4KH4A 2QWNA 3NDKA 1VQPN 4X62K 2FF3B 2RN2A 2IIRA 1C0UA 1UWBA 4DU4A 1BIUA 2F96A 1NU0A 4ZTFA 4IFYA 2P5GA 3I0RA 2ASPA 3K5OA 5KTQA 2P51A 2HBKA 1QQMA 2D0BA 3ITHA 5M1PA 4BQLA 3G71N 4FPAA 4KB1A 3F2KA 3ZSOA 3C94A 1W7AA 3VA0A 3V9SA 2FC0A 4CJ5A 1G99A 2ZF5O 3FZHA 4PL8A 1RDUA 2GELA 3ID8A 5HBMA 1J54A 3IUCA 5CY4A 5FPMA 4A61A 3K5LA 3FZFA 4RW4A 4O8UA 4JRQA 3L2UA 2E1YA 3OHRA 1C1BA 3OYGA 4E19A 4PKIA 5I3UA 2Z1IA 5GIOA 4LF8K 1N8RO 2HNDA 3QB0A 4JI1K 4CEFA 3NH1A 4KTZA 2QA4N 5EOYA 5J1EA 2NRTA 1VHXA 3GG4A 1WAFA 4H0PA 2I7PA 1IBLK 3SQ1A 3OYNA 4H5NA 1NOYA 3TU5A 4CEOA 3AVCA 3CETA 2Q1NA 5FPDA 3GE1A 3JSMA 4FWOA 4JAXA 5AQYA 5HP1A 3RRGA 1KD1O 3PSFA 4MLEA 3H45C 3O4QA 4BRIA 2HVHA 4CJ4A 3HP6A 5C0YA 3QBWA 4BRCA 3EKSA 4WE1A 3WNFA 5JVHL 1X3MA 5EXWA 2YHYA 3MN7A 4QS7A 1RTDA 3KD5E 2WOMA 3VF4A 4GV6A 3EL2A 3WNHA 3SQ0A 1S1VA 2IS3A 3AO2A 3DRSA 3A5OC 1XNRK 3OVNA 3EO3A 4J2AA 4JK8A 3MEDA 4O4GA 3RSEA 3OYIA 2ZJRL 5FLXO 1TK8A 1TK0A 1QVFM 4H4OA 2X78A 5KGXA 2NUBA 3NHGA 3TSUA 1REVA 2E6LA 4FLZA 3G6EN 2KTQA 1NGJA 5KPTA 2A42A 2OA8A 3HSTB 4M3TA 2VQEK 3LPUA 3ZSXA 4KH5A 3ENHA 2OZSA 2QWQA 4EHTA 2O4GA 4CIEA 1NGGA 2VWKA 2OTLN 5KRTA 4FYDA 2Z1HA 1QQCA 3HZ6A 1FKPA 4FWQA 4CEQA 3VQBA 2YCHA 5AQQA 5FPNA 1U48A 5JS1A 1NGCA 1RDAA 3DLEA 4ID1A 3LP1A 4IZ9A 4JKDA 2PAVA 4DTNA 3LZJA 4MO4A 1DGKN 1HNXK 3L4IA 1S5JA 1ASUA 1TL1A 3SAHA 3LP2A 4BREA 4FJ5A 1Z25A 1U2VA 4HTLA 1DTTA 3VENA 4W5TA 4FXDA 3IDHA 1RT2A 3EZWA 2QKBA 2D1KA 3FR0A 3FFIA 3QICA 5ADXA 4EP5A 2PYJA 3HL8A 4F4KA 4IFVA 3I8DA 3C6AA 4KFBA 3OYJA 3CCEN 2BANA 1KSPA 3WNGA 2Q3SA 1R0AA 2VWBA 3L6QA 3TAEA 1RNHA 4U67L 3R6MA 3TTDA 5J2NA 2UU9K 1XQSC 4Q5VA 3SUNA 1NJWA 2D0OA 1ATRA 4CEZA 2E2QA 4M3ZA 3QBXA 3MWTA 4EP4A 1JXBA 4J2BA 3SJJA 1MWKA 3SJHA 4DS5A 1RTHA 3AVIA 3ULEB 2DPNA 1VSDA 1NBWA 1GOAA 4DQSA 4CJLA 3SI6A 4CBXA 1RT4A 1JLGA 3KKSA 4MDBA 2PYLA 3VF6A 3P4IA 3DM2A 3HYFA 1HPZA 3ZEUB 4OGCA 3NBPA 4M7XA 1EWQA 4AF1A 5MLCQ 4H5TA 1LWFA 3O8MA 3E9LA 4BR7A 3W0LA 1S9EA 1NJXA 4CJ7A 1YJNN 3LPTA 4LF6K 3EE9A 3T7ZA 1Z6RA 1QHAA 3C0BA 3DXKB 4B1WB 3S3MA 4XH5A 5HRNA 1CZAN 3MXMA 2V51B 2X74A 2W6KA 2PY5A 2H3GX 5AQLA 2Q31A 4DQQA 4OPJA 2FSJA 4DU1A 3NF8A 1VQ4N 4FW1A 1SS6A 2E8AA 5CZ1A 3SK3A 4M63C 3QEWA 4J8FA 4K42A 1Z26A 4BRPA 5BREA 3HP9A 4F3OA 4CGIA 4FJ7A 3BZKA 1E3MA 1BDGA 3HTVA 3CCMN 2JLEA 1IG9A 4E0DA 1TYQA 3MX5A 1JL1A 1A5WA 3HPHA 4DR6K 4N41A 1RBSA 5AQFA 1QSYA 1YXQA 4ILJA 2P9SA 4JKEA 1KTQA 2J4RA 3TSPA 5AQPA 2E2OA 1RDWX 2BUPA 5AQOA 3OYKA 4A5BA 1LAVA 4FJGA 4BRFA 1OH5A 3AVHA 4C8MA 3K9KA 3V9ZA 4DSJA 3VTHA 5BPMA 1U47A 3L3UA 3V9XA 5LL6Z 1NOZA 2Q97A 1Q18A 1GLJO 3ZX2A 3J7AP 2P9NB 2V52B 4UQGA 3PIPL 3R3LA 4B9TA 3OJSA 1IJJA 1KRPA 1C1AA 1RT5A 2IGIA 4YORA 2Y1IA 3VEOA 2VGNA 3AGKA 3VETA 3SUPA 4AHUA 4NCAA 1K8KB 3HVRA 1O1WA 2FBTA 4C1NK 3VERA 4ELTA 4DR2K 4DG1A 3SMSA 5SZTA 2NNWA 5AJ3K 3F5TA 3HPGA 4JKGB 3ZYYX 4N76A 3VMFB 1F21A 2QW9A 2YKMA 3WXMB 2ITGA 1VQ6N 4KI6A 3VQCA 1C0GA 3V6DA 4I9LA 2O8EB 2P9KB 5T7BA 4DV2K 4F3TA 2GUPA 3PSIA 5A2QO 5KGWA 4CJFA 3IFRA 4CGJA 4CFAA 4O55A 3V4IA 4NO7A 4PY5A 2P9NA 1Q81O 1CZBA 3DRRA 4E7LA 3NMUA 2WFBA 4FOEA 3CM6A 1TAQA 4Z4HA 2LSNA 1Q9XA 1FK9A 4I6MA 1GLAG 3ASMA 1J9AA 1S3XA 4X66K 4FJKA 5F1XA 3RMDA 2BH1A 4EFHA 4EIAA 1T6DA 1K8KA 2DFEA 3VGLA 5J2QA 3H3OB 2IVOA 4FK0A 4IXCA 5C10A 4Z4IA 2EWSA 3S3NA 1HJRA 4E1JA 1LV5A 2GUIA 4BRNA 2KKZA 3E01A 2QK9A 4FWLA 4DR5K 5ADXH 5I42A 3NAEA 1KC8O 2ZD1A 4EZ6A 2WUSA 3O4WA 4CJRA 3F9MA 4TSXA 2F7TA 1S72N 4PUOA 1T44A 1EWRA 2O8CB 1KAZA 4WFNL 2P9KA 1BI4B 3J8AA 3M1FA 4GNIA 2OPSA 5AZIA 4G1QA 4CFCA 4F8RA 5TKYA 5AZJA 2KFZA 3O5BA 1B9DA 4MFBA 5FROA 5BR8K 1S1WA 3WQUA 1KLNA 2ZGYA 4DKWA 3A5MC 4IO9L 4LF5K 1KVBA 1HUXA 3MWPA 1RBUA 5EX5A 1HKBA 4CF8A 4WFBL 3IAYA 3E66A 2IVNA 4FWRA 3T69A 4CCHA 4DHYA 4DV6K 3QDKA 3RRHA 3LM9A 4FJNA 1TV6A 4BC4A 4KPYA 4B3TK 4PQUA 4AHSA 1HX1A 1BOTO 3KZBA 3WEEB 1V4TA 3O3HA 4C8KA 2G8UA 2KFNA 4JHDA 2UXBK 4OKKA 4DUZK 3DLGA 5M1NA 3CF5L 2OPRA 3HJFA 3AVFA 3CMAN 4CJKA 3V9UA 1E4GT 1JL2A 4PKGA 1NG9A 4HUFA 3WQTA 4BG8A 3H6EA 4BDYA 1N32K 1S1TA 3Q7CA 1WBDA 3KLIA 4IDKA 3HM8A 4NCGA 3CJ7A 3P5JA 4GVEA 3T1AA 2X6SA 4B3MK 4KHQA 3LWMA 3H1QA 4O0JA 2CH6A 1DTQA 3SMPA 2VCPA 4DLGA 4L8RB 4JK7A 4CFDA 2G8KA 3CQ8A 1ILYA 1VQ5N 1SL1A 4GV9A 5JMVA 1KAYA 3L2RA 3K2PA 4CJVA 1W0HA 2ZQBA 4HVJA 4M3XA 1D9FA 3B6OA 2QTDA 2YHWA 1NJYA 4KKOA 3LANA 1LAWA 5D3GA 1T6CA 3ENBA 2A40A 4FW2A 3K5NA 5FRNA 1LW2A 3AARA 4G9ZA 5GIPA 3H08A 2EX3A 3ULDA 2NZTA 1TUYA 4JLHA 4M7YA 5FDLA 3CCQN 3KIOA 3Q7BA 3K57A 1ZYQA 2VG6A 3MAQA 3U3GA 4CJUA 4YOXA 3DWLA 4DTPA 4UY8O 4E3SA 3KVGA 3TWHA 2FLOA 1U6ZA 3VEXA 3DLHA 1Q7YO 4L3QA 1SUQA 3TAMA 4OGEA 1ZBSA 4AHVA 2XRIA 3CPEA 4OPHA 4BACA 2GWJA 3DOLA 5BN8A 1XMQK 4IEIA 3O08A 3IMXA 3I33A 3DMJA 3AGRA 4FPBA 4DR3K 3MCAB 5BPNA 1VSLA 1X3NA 3ID6A 5HRSA 4M3WA 3GBTA 1VSJA 1SZ2A 1X1PA 1NMDA 3NVMA 4AQYK 4BRGA 3NCIA 4CGHA 4JD2A 1S1XA 1VRUA 3JYTA 1RT7A 1BL3A 4CZGA 4Y0WA 1RBTA 4YOVA 4B3OA 3UKUA 3BF3A 3C6HA 4DTJA 1YTAA 3G0ZA 3SAGA 2YHAA 4ZTJA 4KHUA 1U49A 5AR0A 1BUPA 1SQKA 1LW0A 4BGBA 1NK9A 4NCBA 4YNQA 2VWJA 3CD6N 2A1RA 2E2NA 2HHQA 4KTWA 3D7EO 4R5PA 1VAZA 4CF0A 2ATQA 2HSTA 3CFOA 2P9PB 3MCPA 4DTUA 2QXFA 2Q0RA 4QCLA 3K9JA 1BHLA 1RT1A 1VRTA 4DTMA 4KB0A 2F9WA 2O8DA 1FXXA 4OVLA 5SWMA 4B9MA 2YNFA 3NF7A 3UKRA 4YOYA 2HVIA 5CHIA 4JK9A 5AQGA 3HK2A 1RCHA 2I5JA 3O9TA 3LM2A 1BQNA 2YJEA 4BDPA 1IBKK 3NVKA 3ATUA 1EO1A 4LY7A 4C23A 4RCHA 2KW4A 3CMEN 3OYDA 2HBMA 4FWMA 4E1MA 1Y97A 4NXNK 3KKRA 1RTJA 4R79A 1ZBLA 1N6QA 5C15A 4JI7K 2E6MA 4FWPA 3ZCMA 2HF3A 5M1OA 1XHZA 3OYHA 3A5NC 3EY1A 2G8FA 1Q86O 3CM5A 4CD3A 3TTFA 1TK5A 1VSIA 4LFCK 4XH4A 2P9PA 4JI8K 2KLAA 4Z0UA 4CF9A 1YUWA 3ZT0A 1NK7A 2RHKA 1KQSM 2W41A 3R8EA 5M1FA 3O6WA 4A5AA 1T7PA 2PZSA 4FLWA 1BO5O 4FJ8A 2RKIA 3O4NA 3C6UA 3AO1A 3CG7A 1T8EA 5C12A 4H5VA 4CZFA 1NK4A 4FM1A 3VEVA 1B92A 2G8WA 3N4QA 2KZMA 1UAXA 2DTUA 1J6ZA 2XHBA 4EZ9A 5F0XA 4FWSA 3OYCA 5C2DA 1YJ9N 1BA0A 3U9ZA 1NNEA 1ITGA 4CVNE 4KBOA 3D6RA 1VSEA 2QWLA 1TUUA 1C1CA 1JXEA 4IJAA 3DLBA 4BR9A 4JI0K 3O1WA 4KHWA 3V1QA 3PX6A 4CGDA 4H5WA 1NGDA 3QETA 3A5LC 2OCEA 1C0MA 1OKJA 5GAEP 1UA0A 2BE2A 4WFAL 4AILC 3LP0A 3SYZA 4CJSA 4B1UB 3NGZA 3FFKB 1WNSA 3ISNC 3ZT4A 2YJFA 4W5OA 3HM9A 1DLOA 4EAHD 3CCVN 2OPQA 1S1UA 1CXQA 5DMRA 1A5VA 1A5XA 4DWIA 3O3GA 2YHXA 2GBZA 5J2PA 2B6AA 1RILA 3IKMA 2NRXA 3VPZA 3ZT1A 1JCGA 5AQTA 3L4QA 5JVGL 1FKOA 3OBYA 3MEEA 3RWUA 3HT3A 1NGAA 3HRGA 5AQHA 3TPQA 5AQRA 1NLVA 3O9UA 4BRKA 1P90A 3JAMO 4QAGA 4C8OA 4YY3K 4E7JA 3VQDA 1N5YA 3HXMA 4LC9B 4NLBA 3P38A 3J81O 1JLQA 1GOBA 1WLJA 4CZLA 1SKRA 3CCUN 3BUZB 4QS9A 4QOZB 1C6VA 4CHQA 1HYZA 3D45A 1C0FA 2P9UB 5HRPA 4WQ5C 1CXUA 3QFUA 4IOXA 5BR9A 4M41A 3TARA 1WBBA 2DFHA 3SPZA 1TKZA 1YI2N 3T1HK 2VG5A 3E9PA 3KWGA 3CCSN 2E5LK 5DM7L 2B4JA 3AAPA 1RGIA 4CEEA 5LJVA 1SL0A 4BC2A 1BA1A 3IS9A 1RTIA 4DB3A 2VQFK 4DFMA 3A2FA 1TKTA 4WF9L 4Z4EA 1X9MA 2D0AA 3G4SN 4F2SA 3TR8A 5I9EB 3B6PA 2NRRA 1HYVA 5BN9A 4DF8A 1NK6A 2KQ2A 5IWAK 3QNNA 4FJXA 1KAXA 1XWLA 2F8TA 3WXKA 1WSHA 3ULEA 1EX4A 5KQ8A 4PL7A 2KZZA 4I2PA 4DR7K 4LFBK 3V1OA 2P9LB 1WUAA 1JCFA 4O8KA 4DUYK 2I7NA 2GX9A 3L0QA 3AA2A 3ZEUA 4MQ3A 1IBMK 3PX0A 3ZETB 1QVGM 4K8XA 5LY3A 4H0TB 4WYBA 4WQ4C 1SAZA 5E41A 1XC9A 2YX6A 1XNQK 5H1SQ 3LAMA 4M3UA 1EETA 4K0KK 1XI1A 4CGFA 4BROA 4FJJA 5EVZA 3ALYA 1KFDA 4NXMK 1VQ9N 3DXKA 4BRDA 3I0SA 3CPWM 1U4BA 3O80A 1X9SA 3K0SA 3O9SA 3MXIA 4H03B 2FF6A 4ILHA 4CJWA 3J80O 3PY8A 1JLFA 3ZSVA 3VF2A 3CCLN 4FM2A 3F9KA 3SV4A 3VEWA 2JWKA 3AVKA 1MA9B 1SKSA 1VQKN 3PUFA 1Q8IA 2HNZA 3U6FA 2UUBK 2P1JA 3ENOA 4H0YB 5AQIA 5LJWA 1M90O 4M3RA 4JI6K 1ZBHA 4OLAA 1XHXA 5AQNA 1QSLA 2UXDK 4JNEA 4NYFA 1DKGD 1P8ZA 1JKHA 4CJQA 2QWOA 4WCEL 4DU3A 4DTXA 2ZM6K 3DAWA 4FWNA 3K58A 4BC3A 4A57A 3KLGA 1VQ8N 3QO9A 1ESVA 3ZSQA 3ZT2A 4AM7A 3MECA 5ELZA 4CF1A 3HPOA 1UA1A 3PO5A 4DSEA 4DQRA 1NJZA 1WSGA 3TANA 3LAKA 3EZ5A 4E7IA 4JEPA 3CIPA 3OS2A 3SBGA 3FZLA 4JKBA 3TAPA 3JXUA 3G10A 3O1BA 3VTIA 3NGYA 4A59A 3SPYA 2IDOA 1NGFA 1NGBA 3SZ2A 3TSQA 1L3UA 4CBWA 3SV3A 3D0PA 1HKGA 4B8CA 4JKHA 1HJOA 1YTUA 4FJ9A 1BQMA 5HLFA 2OPPA 1IKVA 4JKGA 1YHQN 4M42A 4CHNA 3L8BA 3SQ4A 1WB9A 4ELVA 2FBYA 4CBUA 4DV3K 2O8EA 4CGGA 3QESA 1RBVA 4J2DA 1EQYA 3ATVA 1ZBFA 4OX9K 3UB5A 4N5SA 1BGXT 3ZX0A 3U9DA 1BWFO 3ZLJA 1L5UA 4JRPA 1KVAA 4CECA 3KHYA 1ZBIA 4FJLA 1Q9YA 2W40A 4MLHA 1YITN 4A62A 3AA3A 4LSLA 1U04A 4BE0A 1G15A 4BC5A 3KLEA 5E26A 4B9NA 4JKAA 4YOUA 4CJTA 4BR5A 4YDUC 3ZSZA 4C8NA 1HLUA 2NRZA 3THWB 2ZJQL 5JS2A 1YT3A 4CZHA 2XY6A 3OYEA 4IWVA 2ASMA 2A1SA 3VESA 3BY5A 2QWPA 4HCCA 3JS6A 2NLXA 3WXJA 1JCEA 3OY9A 3B8AX 2GV9A 5J2MA 4DTOA 5CE3A 2O8CA 1YVUA 2JGUA 1W9HA 3CXCM 3RMCA 1BI4A 4OLBA 3CFPA 3CC7N 1RBRA 1FJGK 4BY9C 1Y64A 3GL1A 1XC3A 4CW7B 3LZIA 1WSFA 5AQKA 4CIGA 2QEXN 1SKWA 4NB4A 3OYMA 3P83D 2AP1A 3QIOA 3SQ2A 2BDPA 4JYAK 1RFQA 3QIPA 4B3RK 4ISEA 4IDHA 3DXMB 1VK0A 1VQNN 3IG1A 4BWJA 2X6NA 5BRDA 1OH6A 3HBTA 3K5MA 3THXB 3CERA 1I39A 4AHTA 4H5RA 4GW6A 3OJUA 1ZC6A 3THWA 4B9QA 1NK0A 1S6PA 4N47A 1I3AA 4K43A 3WEEA 1NKEA 3KD1E 4BWMA 3CC2N 3U8XA 4FOIA 4NLCA 3AVAA 3EKUA 3M8SA 3AVLA 1OH7A 3PIOL 1EP4A 3VQ4A 4CJEA 2D5RA 1BCMA 1UOCA 3VEZA 5KI6A 1L3VA 4RWTA 3NF6A 2HHXA 1E4FT 3VQEA 2CGLA 4FZZA 1D9DA 4HWIA 2GTDA 3M8PA 4CESA 5C24A 4CZKA 4JI3K 2NRWA 4GKJK 3M3ZA 2RE2A 4O44A 1YIJN 5C2FA 3LDQA 4DS4A 1N36K 1ATNA 3QNOA 1VSFA 2P9IB 5CR4A 4B08A 2HOEA 2WBNA 1NGEA 4IFEA 3THXA 3MK6A 4ILGB 2O8BB 4DSIA 1GLDG 2CGKA 4O5BA 2Z1JA 2YV0X 3OBWA 4FO0A 1GLLO 1K8AO 4Q0BA 3AVNA 4DSLA 1GLFO 3KJVA 1DT9A 3SNNA 4FLYA 1IKXA 4KTQA 2YNIA 5IT9O 2HNYA 2HF4A 4MO5A 2HHTA 1GLCG 3BZCA 3BEXA 4DV1K 5F2RA 1SV5A 3M6GA 1KCFA 1M1KO 3HOTA 5CZ2A 3LALA 5HL7L 3NE6A 1JLEA 3VQQA 3AO3A 5BPLA 1LCUA 4W5NA 1QZ5A 4BE2A 3VQAA 4JI5K 4HCBA 3G25A 3PX4A 2PBDA 3T19A 3DJCA 4RTFD 5C42A 3KTQA 4X65K 2DFFA 3R9PA 3M5RA 3SBTA 5LMNK 4GVMA 2ZWHA 1EXQA 3A8YA 4DQ8A 3I56N 4BRAA 1WOQA 1LWCA 4GV3A 3QINA 3QEPA 4ZHRA 1NGIA 1HPMA 3RTVA 3P39A 4JS4A 3VGKA 1W2BM 3WNEA 5K14A 4FCYA 1KVCA 3M8RA 4FK4A 1JLAA 3EYZA 2OZMA 3I55N
chains in the Genus database with same CATH topology
4HTUA 2G8VA 4E7JA 4DF4A 3VQDA 1GOCA 3HVRA 1O1WA 2FBTA 1ASWA 3HXMA 1N5YA 1SL2A 4KHNA 1T05A 4JS5A 4CJ3A 4CK2A 3S9HA 4CHPA 4DG1A 1NK8A 4ELTA 5SZTA 2E4LA 4FK2A 1JLQA 1GOBA 1RDCA 1WLJA 4KV8A 1SKRA 1WSEA 1T03A 4QOZB 1C6VA 1D5AA 1HYZA 3D45A 3HPGA 4CHQA 4CF2A 4N76A 3IRXA 1NK5A 5HRPA 3V9WA 3O3FA 1CXUA 1F21A 2YKMA 1J53A 2ITGA 4J2EA 3MXJA 4M41A 3TARA 2ZE2A 4KI6A 2DFHA 3VQCA 4LSNA 3SPZA 1BIZA 3V6DA 3KLFA 1TKZA 4I9LA 1L3TA 5T7BA 4F3TA 1TKDA 5KGWA 4CJFA 3TABA 2VG5A 4FLTA 4GMJB 4CGJA 3LWLA 4CFAA 4O55A 3V4IA 4FZXC 2B4JA 4O0IA 4RG8A 4PY5A 4ID5A 2HHVA 4CEEA 1SL0A 3IS9A 3L3VA 1RTIA 4W5RA 1CZBA 3DRRA 3NH2A 4E7LA 4M3YA 4DFMA 3A2FA 1TKTA 3CM6A 4Z4EA 1J5OA 1X9MA 1TAQA 4Z4HA 5DK5A 2LSNA 1Q9XA 1FK9A 1K6YA 2D0AA 4F2SA 3TR8A 3ASMA 3B6PA 1J9AA 1WSJA 4CE9A 3MEGA 4DF8A 1HYVA 2EHGA 4FJKA 3RMDA 3V1RA 3AA5X 3VQ9A 1NK6A 4XIUA 2KQ2A 4I2QA 2QKKA 3QNNA 4FJXA 5J2QA 2DFEA 1XWLA 4E7KA 2F8TA 3AVMA 4FK0A 5HRRA 1WSHA 1EX4A 3F73A 1NKBA 4Z4IA 3S3NA 2KZZA 1HJRA 4I2PA 3HVTA 1U45A 3LDSA 1LV5A 3V1OA 1QS4A 2GUIA 3OYLA 3E01A 3ZSRA 1MU2A 3PV8A 2QK9A 1KFSA 3DRPA 3KK2A 1QTMA 5I42A 3NAEA 4EZ6A 2ZD1A 3AA2A 3KLHA 1CLQA 4CJRA 1VSHA 4MQ3A 4TSXA 3CYMA 3DYAA 4F2RA 3PX0A 4K8XA 4DMNA 4PUOA 2HMIA 2VG7A 1IH7A 4FVMA 4HHTA 4NCAA 1BI4B 2OPSA 4OKEA 5E41A 4CFCA 4G1QA 4FLXA 1XC9A 4M45A 4F8RA 2KFZA 3QERA 4N56A 1B9DA 4MFBA 5FROA 4DTRA 3RMBA 3LAMA 1HMVA 4M3UA 1EETA 2D0CA 1HNIA 2Y1JA 4CGFA 1XI1A 4FJMA 4PWDA 1S1WA 4E89A 1KLNA 4C8OA 4FJJA 4CK1A 3ALYA 1KFDA 1IO2A 5HROA 1IKWA 1KVBA 1B9FA 1RT6A 3I0SA 1U4BA 3RR7A 1RBUA 4CF8A 4OPKA 3OYBA 3IAYA 1X9SA 3BGRA 4K8ZA 4OKJA 3MXIA 2YNGA 4CCHA 4CJWA 2YKNA 3QEIA 1HYSA 3AO5A 4CERA 3PY8A 2XY8A 3RRHA 1JLFA 3ZSVA 4FJNA 3AVBA 1TV6A 4Z4CA 4KPYA 4PQUA 4FM2A 1TKXA 3F9KA 4AHSA 4BDZA 1BCOA 5CYMA 3NDKA 3SV4A 4FJHA 3OYFA 3AVKA 4IG0A 1SKSA 3PUFA 1Q8IA 2HNZA 4CEBA 4RW9A 3O3HA 3U6FA 2P1JA 4C8KA 2G8UA 2RN2A 2KFNA 1C0UA 1UWBA 1VSKA 1BIUA 4M3RA 4DU4A 4OKKA 1ZBHA 1XHXA 2F96A 4ZTFA 2P5GA 4IFYA 4OLAA 3DLGA 3I0RA 3K5OA 1QSLA 5KTQA 3AVGA 2OPRA 3HJFA 2P51A 4I7FA 3AVFA 4NYFA 4CJKA 3V9UA 1JKHA 1JL2A 2D0BA 3AV9A 4CJQA 3ITHA 1JLBA 4HUFA 4DU3A 4KB1A 3PO4A 4DTXA 4HUEA 4BDYA 3DLKA 3ZSOA 3C94A 1S1TA 3K58A 3KLIA 4IDKA 3KLGA 3VA0A 3QO9A 3ZSQA 2FC0A 3V9SA 3ZT2A 4NCGA 4CJ5A 3OS0A 3MECA 1EKEA 3ZSYA 4CF1A 3P5JA 3TAFA 5HBMA 3HPOA 1UA1A 1J54A 4DSEA 3PO5A 2Z1GA 4FJIA 3AVJA 2X6SA 5CY4A 3T1AA 3K5LA 4DQRA 1WSGA 1NJZA 4RW4A 4JRQA 3LWMA 3L2UA 4KHQA 5FRMA 4O0JA 4KAZA 1C1BA 3OYGA 2RPIA 3LAKA 3EZ5A 4E19A 4E7IA 3TANA 5I3UA 1DTQA 1RDDA 2Z1IA 3KK1A 3VN5A 4DLGA 2HNDA 4L8RB 4CFDA 4CEFA 3NH1A 4KTZA 3OS1A 1ASVA 3OS2A 2G8KA 3CQ8A 2XO7A 2RF2A 5CYQA 1SL1A 3TAPA 1HQUA 5J1EA 2YHBA 1S9GA 3G10A 3L2RA 3K2PA 4CJVA 1W0HA 1WAFA 2ZQBA 4B9SA 4HVJA 4M3XA 4LD0A 2XY7A 1D9FA 3NGYA 3B6OA 3SQ1A 1D8YA 3OYNA 4FM0A 1NOYA 4KHSA 4CEOA 3K59A 3AVCA 4I9QA 2DY4A 1NJYA 3JSMA 4KKOA 3SPYA 2IDOA 5HP1A 4FLUA 3RRGA 3LANA 3SZ2A 1LAWA 1L3UA 5D3GA 3SV3A 3TI0A 3D0PA 3O4QA 2R7YA 4FW2A 3K5NA 4PA1A 4KHYA 2HVHA 4B8CA 5FRNA 1LW2A 3NF9A 4CJ4A 1HRHA 3ZT3A 3HP6A 4H8KA 3H08A 4BE1A 3BDPA 2EX3A 4WE1A 3WNFA 3ULDA 3THVA 1YTUA 4FJ9A 1BQMA 4JLHA 5FDLA 3KIOA 3K57A 1ZYQA 2VG6A 3MAQA 4DSKA 3U3GA 4CJUA 3QEVA 3QEXA 5HLFA 1RTDA 3KD5E 4H4MA 2WOMA 2OPPA 3CFRA 4DTPA 4E3SA 3V81A 3WNHA 4OJRA 1IKVA 3TWHA 3SQ0A 3QLHA 1S1VA 2IS3A 3AO2A 3UIQA 4M42A 3DRSA 4CHNA 3L8BA 3DLHA 3OVNA 1SUQA 3SQ4A 3TAMA 4OGEA 1QE1A 4J2AA 4AHVA 2XRIA 3MEDA 4O4GA 4BACA 4ELVA 2FBYA 4Z4GA 3OYIA 4CGGA 3QESA 1RBVA 3DOLA 1TK0A 1TK8A 4J2DA 4H4OA 2X78A 3C95A 2NUBA 5KGXA 3NHGA 3HO1A 1REVA 1ZBFA 2E6LA 4HUGA 2HB5A 1BGXT 4N5SA 3NH0A 4FLZA 4CFBA 4DFPA 3SCXA 3VQ5A 2KTQA 3DMJA 4NYNA 2G8HA 2OA8A 3HSTB 1L5UA 4DQPA 4M3TA 3L2WA 4JRPA 1KVAA 4CECA 2G8IA 3LPUA 3ZSXA 1ZBIA 4FJLA 2OZSA 5KRSA 3DOKA 1Q9YA 1VSLA 2O4GA 4CIEA 4CK3A 5HRSA 4M3WA 1VSJA 3ZSWA 2VWKA 2YNHA 1X1PA 5KRTA 4FYDA 1LWEA 2Z1HA 3VQ8A 4B8AB 1QQCA 1RDBA 3AA3A 3NFAA 4LSLA 1U04A 3NCIA 4BE0A 1FKPA 1G15A 4CGHA 3KLEA 4CEQA 1S1XA 3VQPA 1VRUA 3JYTA 1RT7A 1BL3A 4B9NA 3VQBA 1RBTA 4CJTA 3ZSZA 4C8NA 1U48A 5JS1A 4B3OA 1RDAA 1TVRA 3DLEA 4ID1A 4LH4A 4RW8A 5JS2A 3LP1A 1TL3A 1YT3A 4DTJA 4DTNA 1YTAA 3G0ZA 3LZJA 2FBXA 2XY6A 4ELUA 1S5JA 3OYEA 2YHAA 1ASUA 1TL1A 4ZTJA 4KHUA 1U49A 3LP2A 1TAUA 4FJ5A 2A1SA 1Z25A 4Y1DA 1LW0A 3DI6A 4HCCA 1DTTA 1S6QA 4W5TA 1NK9A 4NCBA 4KI4A 4FXDA 4YNQA 1WAJA 5J2MA 1RT2A 2VWJA 3OY9A 2GV9A 2QKBA 1KLMA 3VA3A 2A1RA 3FFIA 4DTOA 3L2QA 1QHTA 4EP5A 2PYJA 3HL8A 4F4KA 1YVUA 4IFVA 2JGUA 3I8DA 1W9HA 4KFBA 1TGOA 1BI4A 4KTWA 4R5PA 3RMCA 4OLBA 2HHQA 3CFPA 2HHUA 3OYJA 4CF0A 2ATQA 2BANA 3AA4A 3CFOA 5EU7A 2W42A 1KSPA 1VSMA 1RBRA 3WNGA 2QXFA 4DTUA 2Q3SA 1R0AA 3LZIA 1WSFA 3TAEA 4CIGA 4RW6A 2BGGA 2F8SA 1BHLA 1RNHA 1BISA 4QCLA 1SKWA 3OYAA 3OYMA 3P83D 3QIOA 5J2NA 3SQ2A 2BDPA 4Z4FA 3QIPA 2B5JA 1RT1A 4CHZA 4YFUA 4Q5VA 3SUNA 1NJWA 1VRTA 4Y1CA 4CEZA 4DTMA 4M3ZA 4KB0A 4EP4A 1JXBA 4DFJA 1FXXA 4J2BA 4OVLA 3SJJA 5SWMA 3M8QA 1VK0A 3VQ7A 4B9MA 2YNFA 3IG1A 1QSSA 4B9VA 3NF7A 2X6NA 4BWJA 3K5MA 2HVIA 1I39A 4DS5A 1RTHA 3AVIA 4AHTA 3HK2A 1RCHA 1VSDA 1GOAA 2I5JA 1HNVA 3C6TA 4GW6A 3OJUA 2WONA 4DQSA 4CJLA 1BQNA 1NK0A 3SI6A 4BDPA 1S6PA 4N47A 1I3AA 4LY7A 1RT4A 1JLGA 2KW4A 3KKSA 4IG3A 1NKEA 2PYLA 3KD1E 4BWMA 3LP3A 3DM2A 3OYDA 2FBVA 3HYFA 1HPZA 4OGCA 3AVAA 3NBPA 4E1MA 1Y97A 3KKRA 1RTJA 1ZBLA 1N6QA 2O4IA 3M8SA 3AVLA 2E6MA 1LWFA 3ZCMA 1XHZA 3NGIA 3OYHA 1EP4A 3EY1A 2G8FA 3VQ4A 1S9EA 4CJEA 4CIFA 1X9WA 3CM5A 1NJXA 2D5RA 1BCMA 1UOCA 1WN7A 4C8LA 5KI6A 1L3VA 4B9LA 1NKCA 4KRFA 3NF6A 2HHXA 1TK5A 1VSIA 2OYQA 3VQEA 3RMAA 3LPTA 4FZZA 1D9DA 2HHSA 4AHRA 3M8PA 4Z0UA 4CESA 5C24A 1RT3A 4CF9A 2AJQA 1JLCA 4O44A 3T3FA 2HHWA 3ZT0A 1NK7A 3S3MA 2P5OA 4DS4A 5HRNA 4CEAA 3RR8A 4DSFA 3QNOA 4IKFA 1VSFA 2X74A 3MXMA 1T7PA 2PZSA 2PY5A 4B08A 4FLWA 3SUOA 4AHUA 4FJ8A 2RKIA 3O4NA 1L3SA 4DQQA 3AO4A 4OPJA 3C6UA 3AO1A 3CG7A 1T8EA 4DU1A 4CHOA 4DSIA 4DTSA 3NF8A 4E1NA 4O5BA 4FM1A 2Z1JA 1NK4A 1B92A 2YV0X 2G8WA 4CJPA 4FW1A 3L2VA 5CZ1A 2KZMA 1UAXA 3QEWA 2DTUA 1Z26A 3AVNA 4Q0BA 3HP9A 4F3OA 2XHBA 4EZ9A 4DSLA 4CEDA 2IAJA 4CGIA 4FJ7A 3KJVA 3SNNA 4FLYA 4FZYA 2JLEA 1IKXA 3OYCA 1IG9A 4E0DA 4KTQA 1JL1A 2YNIA 3TAQA 2HNYA 1A5WA 2XY5A 1ITGA 3S3OA 3HPHA 2HHTA 4N41A 4ICLA 3SUQA 1RBSA 1SV5A 1VSEA 4DLEA 1QSYA 1KCFA 4FLVA 5CZ2A 1C1CA 1KTQA 3LALA 3NE6A 1JLEA 1JXEA 4KO0A 4E7HA 3DLBA 2HW3A 4AH9A 3VQQA 4KHWA 2IOCA 3AO3A 3P1GA 3V1QA 4CGDA 3PX6A 3U3YA 3QETA 2ETJA 4W5NA 4BE2A 1C0MA 3VQAA 4DQIA 3OYKA 2BE2A 1UA0A 4HCBA 1LAVA 5C25A 3PX4A 4FJGA 4AILC 3LP0A 3T19A 3SYZA 3AVHA 4C8MA 4CJSA 3V9ZA 4RW7A 3NGZA 4DSJA 1C0TA 4AHCA 5C42A 1U47A 3KTQA 1WNSA 1ZBUA 1CZ9A 3ISNC 3L3UA 3ZT4A 3V9XA 2DFFA 1NOZA 3VQ6A 4W5OA 4DFKA 3HM9A 1DLOA 4GVMA 4B9UA 2OPQA 1S1UA 1EXQA 1CXQA 4IBNA 5DMRA 1A5VA 1A5XA 4KREA 1IKYA 3DLRA 4CHYA 4UQGA 3O3GA 2IC3A 4DWIA 2GBZA 5J2PA 2B6AA 1LWCA 1RILA 4B9TA 4LH5A 3QINA 3OJSA 3QEPA 3ZT1A 4ZHRA 1KRPA 1FKOA 1WSIA 3MEEA 3KK3A 4JS4A 3RTVA 3TAGA 1C1AA 3WNEA 3HT3A 1RT5A 3RWUA 2IGIA 5K14A 1HQEA 4W5QA 4FCYA 2Y1IA 1KVCA 3M8RA 4FK4A 1JLAA 3EYZA 2OZMA 3SUPA 4QAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HTU A;  2G8V A;  4E7J A;  4DF4 A;  3VQD A;  1GOC A;  3HVR A;  1O1W A;  2FBT A;  1ASW A;  3HXM A;  1N5Y A;  1SL2 A;  4KHN A;  1T05 A;  4JS5 A;  4CJ3 A;  4CK2 A;  3S9H A;  4CHP A;  4DG1 A;  1NK8 A;  4ELT A;  5SZT A;  2E4L A;  4FK2 A;  1JLQ A;  1GOB A;  1RDC A;  1WLJ A;  4KV8 A;  1SKR A;  1WSE A;  1T03 A;  4QOZ B;  1C6V A;  1D5A A;  1HYZ A;  3D45 A;  3HPG A;  4CHQ A;  4CF2 A;  4N76 A;  3IRX A;  1NK5 A;  5HRP A;  3V9W A;  3O3F A;  1CXU A;  1F21 A;  2YKM A;  1J53 A;  2ITG A;  4J2E A;  3MXJ A;  4M41 A;  3TAR A;  2ZE2 A;  4KI6 A;  2DFH A;  3VQC A;  4LSN A;  3SPZ A;  1BIZ A;  3V6D A;  3KLF A;  1TKZ A;  4I9L A;  1L3T A;  5T7B A;  4F3T A;  1TKD A;  5KGW A;  4CJF A;  3TAB A;  2VG5 A;  4FLT A;  4GMJ B;  4CGJ A;  3LWL A;  4CFA A;  4O55 A;  3V4I A;  4FZX C;  2B4J A;  4O0I A;  4RG8 A;  4PY5 A;  4ID5 A;  2HHV A;  4CEE A;  1SL0 A;  3IS9 A;  3L3V A;  1RTI A;  4W5R A;  1CZB A;  3DRR A;  3NH2 A;  4E7L A;  4M3Y A;  4DFM A;  3A2F A;  1TKT A;  3CM6 A;  4Z4E A;  1J5O A;  1X9M A;  1TAQ A;  4Z4H A;  5DK5 A;  2LSN A;  1Q9X A;  1FK9 A;  1K6Y A;  2D0A A;  4F2S A;  3TR8 A;  3ASM A;  3B6P A;  1J9A A;  1WSJ A;  4CE9 A;  3MEG A;  4DF8 A;  1HYV A;  2EHG A;  4FJK A;  3RMD A;  3V1R A;  3AA5 X;  3VQ9 A;  1NK6 A;  4XIU A;  2KQ2 A;  4I2Q A;  2QKK A;  3QNN A;  4FJX A;  5J2Q A;  2DFE A;  1XWL A;  4E7K A;  2F8T A;  3AVM A;  4FK0 A;  5HRR A;  1WSH A;  1EX4 A;  3F73 A;  1NKB A;  4Z4I A;  3S3N A;  2KZZ A;  1HJR A;  4I2P A;  3HVT A;  1U45 A;  3LDS A;  1LV5 A;  3V1O A;  1QS4 A;  2GUI A;  3OYL A;  3E01 A;  3ZSR A;  1MU2 A;  3PV8 A;  2QK9 A;  1KFS A;  3DRP A;  3KK2 A;  1QTM A;  5I42 A;  3NAE A;  4EZ6 A;  2ZD1 A;  3AA2 A;  3KLH A;  1CLQ A;  4CJR A;  1VSH A;  4MQ3 A;  4TSX A;  3CYM A;  3DYA A;  4F2R A;  3PX0 A;  4K8X A;  4DMN A;  4PUO A;  2HMI A;  2VG7 A;  1IH7 A;  4FVM A;  4HHT A;  4NCA A;  1BI4 B;  2OPS A;  4OKE A;  5E41 A;  4CFC A;  4G1Q A;  4FLX A;  1XC9 A;  4M45 A;  4F8R A;  2KFZ A;  3QER A;  4N56 A;  1B9D A;  4MFB A;  5FRO A;  4DTR A;  3RMB A;  3LAM A;  1HMV A;  4M3U A;  1EET A;  2D0C A;  1HNI A;  2Y1J A;  4CGF A;  1XI1 A;  4FJM A;  4PWD A;  1S1W A;  4E89 A;  1KLN A;  4C8O A;  4FJJ A;  4CK1 A;  3ALY A;  1KFD A;  1IO2 A;  5HRO A;  1IKW A;  1KVB A;  1B9F A;  1RT6 A;  3I0S A;  1U4B A;  3RR7 A;  1RBU A;  4CF8 A;  4OPK A;  3OYB A;  3IAY A;  1X9S A;  3BGR A;  4K8Z A;  4OKJ A;  3MXI A;  2YNG A;  4CCH A;  4CJW A;  2YKN A;  3QEI A;  1HYS A;  3AO5 A;  4CER A;  3PY8 A;  2XY8 A;  3RRH A;  1JLF A;  3ZSV A;  4FJN A;  3AVB A;  1TV6 A;  4Z4C A;  4KPY A;  4PQU A;  4FM2 A;  1TKX A;  3F9K A;  4AHS A;  4BDZ A;  1BCO A;  5CYM A;  3NDK A;  3SV4 A;  4FJH A;  3OYF A;  3AVK A;  4IG0 A;  1SKS A;  3PUF A;  1Q8I A;  2HNZ A;  4CEB A;  4RW9 A;  3O3H A;  3U6F A;  2P1J A;  4C8K A;  2G8U A;  2RN2 A;  2KFN A;  1C0U A;  1UWB A;  1VSK A;  1BIU A;  4M3R A;  4DU4 A;  4OKK A;  1ZBH A;  1XHX A;  2F96 A;  4ZTF A;  2P5G A;  4IFY A;  4OLA A;  3DLG A;  3I0R A;  3K5O A;  1QSL A;  5KTQ A;  3AVG A;  2OPR A;  3HJF A;  2P51 A;  4I7F A;  3AVF A;  4NYF A;  4CJK A;  3V9U A;  1JKH A;  1JL2 A;  2D0B A;  3AV9 A;  4CJQ A;  3ITH A;  1JLB A;  4HUF A;  4DU3 A;  4KB1 A;  3PO4 A;  4DTX A;  4HUE A;  4BDY A;  3DLK A;  3ZSO A;  3C94 A;  1S1T A;  3K58 A;  3KLI A;  4IDK A;  3KLG A;  3VA0 A;  3QO9 A;  3ZSQ A;  2FC0 A;  3V9S A;  3ZT2 A;  4NCG A;  4CJ5 A;  3OS0 A;  3MEC A;  1EKE A;  3ZSY A;  4CF1 A;  3P5J A;  3TAF A;  5HBM A;  3HPO A;  1UA1 A;  1J54 A;  4DSE A;  3PO5 A;  2Z1G A;  4FJI A;  3AVJ A;  2X6S A;  5CY4 A;  3T1A A;  3K5L A;  4DQR A;  1WSG A;  1NJZ A;  4RW4 A;  4JRQ A;  3LWM A;  3L2U A;  4KHQ A;  5FRM A;  4O0J A;  4KAZ A;  1C1B A;  3OYG A;  2RPI A;  3LAK A;  3EZ5 A;  4E19 A;  4E7I A;  3TAN A;  5I3U A;  1DTQ A;  1RDD A;  2Z1I A;  3KK1 A;  3VN5 A;  4DLG A;  2HND A;  4L8R B;  4CFD A;  4CEF A;  3NH1 A;  4KTZ A;  3OS1 A;  1ASV A;  3OS2 A;  2G8K A;  3CQ8 A;  2XO7 A;  2RF2 A;  5CYQ A;  1SL1 A;  3TAP A;  1HQU A;  5J1E A;  2YHB A;  1S9G A;  3G10 A;  3L2R A;  3K2P A;  4CJV A;  1W0H A;  1WAF A;  2ZQB A;  4B9S A;  4HVJ A;  4M3X A;  4LD0 A;  2XY7 A;  1D9F A;  3NGY A;  3B6O A;  3SQ1 A;  1D8Y A;  3OYN A;  4FM0 A;  1NOY A;  4KHS A;  4CEO A;  3K59 A;  3AVC A;  4I9Q A;  2DY4 A;  1NJY A;  3JSM A;  4KKO A;  3SPY A;  2IDO A;  5HP1 A;  4FLU A;  3RRG A;  3LAN A;  3SZ2 A;  1LAW A;  1L3U A;  5D3G A;  3SV3 A;  3TI0 A;  3D0P A;  3O4Q A;  2R7Y A;  4FW2 A;  3K5N A;  4PA1 A;  4KHY A;  2HVH A;  4B8C A;  5FRN A;  1LW2 A;  3NF9 A;  4CJ4 A;  1HRH A;  3ZT3 A;  3HP6 A;  4H8K A;  3H08 A;  4BE1 A;  3BDP A;  2EX3 A;  4WE1 A;  3WNF A;  3ULD A;  3THV A;  1YTU A;  4FJ9 A;  1BQM A;  4JLH A;  5FDL A;  3KIO A;  3K57 A;  1ZYQ A;  2VG6 A;  3MAQ A;  4DSK A;  3U3G A;  4CJU A;  3QEV A;  3QEX A;  5HLF A;  1RTD A;  3KD5 E;  4H4M A;  2WOM A;  2OPP A;  3CFR A;  4DTP A;  4E3S A;  3V81 A;  3WNH A;  4OJR A;  1IKV A;  3TWH A;  3SQ0 A;  3QLH A;  1S1V A;  2IS3 A;  3AO2 A;  3UIQ A;  4M42 A;  3DRS A;  4CHN A;  3L8B A;  3DLH A;  3OVN A;  1SUQ A;  3SQ4 A;  3TAM A;  4OGE A;  1QE1 A;  4J2A A;  4AHV A;  2XRI A;  3MED A;  4O4G A;  4BAC A;  4ELV A;  2FBY A;  4Z4G A;  3OYI A;  4CGG A;  3QES A;  1RBV A;  3DOL A;  1TK0 A;  1TK8 A;  4J2D A;  4H4O A;  2X78 A;  3C95 A;  2NUB A;  5KGX A;  3NHG A;  3HO1 A;  1REV A;  1ZBF A;  2E6L A;  4HUG A;  2HB5 A;  1BGX T;  4N5S A;  3NH0 A;  4FLZ A;  4CFB A;  4DFP A;  3SCX A;  3VQ5 A;  2KTQ A;  3DMJ A;  4NYN A;  2G8H A;  2OA8 A;  3HST B;  1L5U A;  4DQP A;  4M3T A;  3L2W A;  4JRP A;  1KVA A;  4CEC A;  2G8I A;  3LPU A;  3ZSX A;  1ZBI A;  4FJL A;  2OZS A;  5KRS A;  3DOK A;  1Q9Y A;  1VSL A;  2O4G A;  4CIE A;  4CK3 A;  5HRS A;  4M3W A;  1VSJ A;  3ZSW A;  2VWK A;  2YNH A;  1X1P A;  5KRT A;  4FYD A;  1LWE A;  2Z1H A;  3VQ8 A;  4B8A B;  1QQC A;  1RDB A;  3AA3 A;  3NFA A;  4LSL A;  1U04 A;  3NCI A;  4BE0 A;  1FKP A;  1G15 A;  4CGH A;  3KLE A;  4CEQ A;  1S1X A;  3VQP A;  1VRU A;  3JYT A;  1RT7 A;  1BL3 A;  4B9N A;  3VQB A;  1RBT A;  4CJT A;  3ZSZ A;  4C8N A;  1U48 A;  5JS1 A;  4B3O A;  1RDA A;  1TVR A;  3DLE A;  4ID1 A;  4LH4 A;  4RW8 A;  5JS2 A;  3LP1 A;  1TL3 A;  1YT3 A;  4DTJ A;  4DTN A;  1YTA A;  3G0Z A;  3LZJ A;  2FBX A;  2XY6 A;  4ELU A;  1S5J A;  3OYE A;  2YHA A;  1ASU A;  1TL1 A;  4ZTJ A;  4KHU A;  1U49 A;  3LP2 A;  1TAU A;  4FJ5 A;  2A1S A;  1Z25 A;  4Y1D A;  1LW0 A;  3DI6 A;  4HCC A;  1DTT A;  1S6Q A;  4W5T A;  1NK9 A;  4NCB A;  4KI4 A;  4FXD A;  4YNQ A;  1WAJ A;  5J2M A;  1RT2 A;  2VWJ A;  3OY9 A;  2GV9 A;  2QKB A;  1KLM A;  3VA3 A;  2A1R A;  3FFI A;  4DTO A;  3L2Q A;  1QHT A;  4EP5 A;  2PYJ A;  3HL8 A;  4F4K A;  1YVU A;  4IFV A;  2JGU A;  3I8D A;  1W9H A;  4KFB A;  1TGO A;  1BI4 A;  4KTW A;  4R5P A;  3RMC A;  4OLB A;  2HHQ A;  3CFP A;  2HHU A;  3OYJ A;  4CF0 A;  2ATQ A;  2BAN A;  3AA4 A;  3CFO A;  5EU7 A;  2W42 A;  1KSP A;  1VSM A;  1RBR A;  3WNG A;  2QXF A;  4DTU A;  2Q3S A;  1R0A A;  3LZI A;  1WSF A;  3TAE A;  4CIG A;  4RW6 A;  2BGG A;  2F8S A;  1BHL A;  1RNH A;  1BIS A;  4QCL A;  1SKW A;  3OYA A;  3OYM A;  3P83 D;  3QIO A;  5J2N A;  3SQ2 A;  2BDP A;  4Z4F A;  3QIP A;  2B5J A;  1RT1 A;  4CHZ A;  4YFU A;  4Q5V A;  3SUN A;  1NJW A;  1VRT A;  4Y1C A;  4CEZ A;  4DTM A;  4M3Z A;  4KB0 A;  4EP4 A;  1JXB A;  4DFJ A;  1FXX A;  4J2B A;  4OVL A;  3SJJ A;  5SWM A;  3M8Q A;  1VK0 A;  3VQ7 A;  4B9M A;  2YNF A;  3IG1 A;  1QSS A;  4B9V A;  3NF7 A;  2X6N A;  4BWJ A;  3K5M A;  2HVI A;  1I39 A;  4DS5 A;  1RTH A;  3AVI A;  4AHT A;  3HK2 A;  1RCH A;  1VSD A;  1GOA A;  2I5J A;  1HNV A;  3C6T A;  4GW6 A;  3OJU A;  2WON A;  4DQS A;  4CJL A;  1BQN A;  1NK0 A;  3SI6 A;  4BDP A;  1S6P A;  4N47 A;  1I3A A;  4LY7 A;  1RT4 A;  1JLG A;  2KW4 A;  3KKS A;  4IG3 A;  1NKE A;  2PYL A;  3KD1 E;  4BWM A;  3LP3 A;  3DM2 A;  3OYD A;  2FBV A;  3HYF A;  1HPZ A;  4OGC A;  3AVA A;  3NBP A;  4E1M A;  1Y97 A;  3KKR A;  1RTJ A;  1ZBL A;  1N6Q A;  2O4I A;  3M8S A;  3AVL A;  2E6M A;  1LWF A;  3ZCM A;  1XHZ A;  3NGI A;  3OYH A;  1EP4 A;  3EY1 A;  2G8F A;  3VQ4 A;  1S9E A;  4CJE A;  4CIF A;  1X9W A;  3CM5 A;  1NJX A;  2D5R A;  1BCM A;  1UOC A;  1WN7 A;  4C8L A;  5KI6 A;  1L3V A;  4B9L A;  1NKC A;  4KRF A;  3NF6 A;  2HHX A;  1TK5 A;  1VSI A;  2OYQ A;  3VQE A;  3RMA A;  3LPT A;  4FZZ A;  1D9D A;  2HHS A;  4AHR A;  3M8P A;  4Z0U A;  4CES A;  5C24 A;  1RT3 A;  4CF9 A;  2AJQ A;  1JLC A;  4O44 A;  3T3F A;  2HHW A;  3ZT0 A;  1NK7 A;  3S3M A;  2P5O A;  4DS4 A;  5HRN A;  4CEA A;  3RR8 A;  4DSF A;  3QNO A;  4IKF A;  1VSF A;  2X74 A;  3MXM A;  1T7P A;  2PZS A;  2PY5 A;  4B08 A;  4FLW A;  3SUO A;  4AHU A;  4FJ8 A;  2RKI A;  3O4N A;  1L3S A;  4DQQ A;  3AO4 A;  4OPJ A;  3C6U A;  3AO1 A;  3CG7 A;  1T8E A;  4DU1 A;  4CHO A;  4DSI A;  4DTS A;  3NF8 A;  4E1N A;  4O5B A;  4FM1 A;  2Z1J A;  1NK4 A;  1B92 A;  2YV0 X;  2G8W A;  4CJP A;  4FW1 A;  3L2V A;  5CZ1 A;  2KZM A;  1UAX A;  3QEW A;  2DTU A;  1Z26 A;  3AVN A;  4Q0B A;  3HP9 A;  4F3O A;  2XHB A;  4EZ9 A;  4DSL A;  4CED A;  2IAJ A;  4CGI A;  4FJ7 A;  3KJV A;  3SNN A;  4FLY A;  4FZY A;  2JLE A;  1IKX A;  3OYC A;  1IG9 A;  4E0D A;  4KTQ A;  1JL1 A;  2YNI A;  3TAQ A;  2HNY A;  1A5W A;  2XY5 A;  1ITG A;  3S3O A;  3HPH A;  2HHT A;  4N41 A;  4ICL A;  3SUQ A;  1RBS A;  1SV5 A;  1VSE A;  4DLE A;  1QSY A;  1KCF A;  4FLV A;  5CZ2 A;  1C1C A;  1KTQ A;  3LAL A;  3NE6 A;  1JLE A;  1JXE A;  4KO0 A;  4E7H A;  3DLB A;  2HW3 A;  4AH9 A;  3VQQ A;  4KHW A;  2IOC A;  3AO3 A;  3P1G A;  3V1Q A;  4CGD A;  3PX6 A;  3U3Y A;  3QET A;  2ETJ A;  4W5N A;  4BE2 A;  1C0M A;  3VQA A;  4DQI A;  3OYK A;  2BE2 A;  1UA0 A;  4HCB A;  1LAV A;  5C25 A;  3PX4 A;  4FJG A;  4AIL C;  3LP0 A;  3T19 A;  3SYZ A;  3AVH A;  4C8M A;  4CJS A;  3V9Z A;  4RW7 A;  3NGZ A;  4DSJ A;  1C0T A;  4AHC A;  5C42 A;  1U47 A;  3KTQ A;  1WNS A;  1ZBU A;  1CZ9 A;  3ISN C;  3L3U A;  3ZT4 A;  3V9X A;  2DFF A;  1NOZ A;  3VQ6 A;  4W5O A;  4DFK A;  3HM9 A;  1DLO A;  4GVM A;  4B9U A;  2OPQ A;  1S1U A;  1EXQ A;  1CXQ A;  4IBN A;  5DMR A;  1A5V A;  1A5X A;  4KRE A;  1IKY A;  3DLR A;  4CHY A;  4UQG A;  3O3G A;  2IC3 A;  4DWI A;  2GBZ A;  5J2P A;  2B6A A;  1LWC A;  1RIL A;  4B9T A;  4LH5 A;  3QIN A;  3OJS A;  3QEP A;  3ZT1 A;  4ZHR A;  1KRP A;  1FKO A;  1WSI A;  3MEE A;  3KK3 A;  4JS4 A;  3RTV A;  3TAG A;  1C1A A;  3WNE A;  3HT3 A;  1RT5 A;  3RWU A;  2IGI A;  5K14 A;  1HQE A;  4W5Q A;  4FCY A;  2Y1I A;  1KVC A;  3M8R A;  4FK4 A;  1JLA A;  3EYZ A;  2OZM A;  3SUP A;  4QAG A; 
#chains in the Genus database with same CATH topology
 2G8V A;  3TTC A;  3I8B A;  4DF4 A;  2FSN A;  2QI2 A;  3FZK A;  5JLH A;  3CJB A;  3EN9 A;  2ZJP L;  3C7N B;  1ASW A;  3RVC A;  1T05 A;  1ZXO A;  4CK2 A;  3S9H A;  4CHP A;  4BVP A;  1RDC A;  4KV8 A;  1IG8 A;  1N34 K;  1NWK A;  5AQU A;  3KK7 A;  3V9W A;  3O3F A;  3HI0 A;  5AFU A;  1J53 A;  5BRF A;  3MXJ A;  3P31 A;  2ZE2 A;  4LSN A;  3RSE B;  1BIZ A;  3H3N O;  2HBL A;  4DCH A;  1HKC A;  3TAB A;  4FLT A;  4FZX C;  2HMP A;  4RG8 A;  2HHV A;  1NM1 A;  3L3V A;  3VGM A;  4W5R A;  4M3Y A;  1S22 A;  4A2A A;  4DV0 K;  4B3S K;  4XIU A;  2QKK A;  5TKW A;  3AVM A;  5HRR A;  3C7N A;  3HVT A;  1U45 A;  5EY4 A;  5M1K A;  3OYL A;  3HSC A;  2ZGZ A;  1KFS A;  3KK2 A;  1U2V B;  1X9J A;  1VSH A;  2Q0U A;  2A6A A;  3CYM A;  4FL9 A;  2VG7 A;  1IH7 A;  4FVM A;  1R59 O;  1KXP A;  1YJW N;  4BR0 A;  4FLX A;  3CQY A;  4M45 A;  3N4P A;  4N56 A;  5KPR A;  4H0V B;  3CQX A;  2E2P A;  3CHW A;  4PWD A;  4CK1 A;  2V7Y A;  1IKW A;  1B9F A;  3O9R A;  3GDQ A;  4OPK A;  1XUP O;  3OYB A;  2A5X A;  3BGR A;  2YNG A;  3QEI A;  1HYS A;  3AO5 A;  1OH8 A;  4YOT A;  4DR4 K;  2GWK A;  5CYM A;  1NJI O;  4FJH A;  3OYF A;  3VEY A;  4IG0 A;  4CEB A;  4RW9 A;  5KPZ A;  1VSK A;  4K25 A;  1O13 A;  1W97 L;  3AVG A;  4PHT X;  4I7F A;  3AV9 A;  1JLB A;  3PO4 A;  4HUE A;  3DLK A;  2E88 A;  3CCR N;  4XH1 A;  3OS0 A;  2IVP A;  4O5F A;  1EKE A;  2AA4 A;  3ZSY A;  5DM6 L;  3TAF A;  4FJI A;  2UXC K;  2Z1G A;  3AVJ A;  4JKC A;  1V4S A;  4BGA A;  5FRM A;  4KAZ A;  1GLB G;  2RPI A;  2F4V K;  1RDD A;  3KK1 A;  3VN5 A;  1Z05 A;  4JI4 K;  3LL3 A;  3OS1 A;  1ASV A;  1YAG A;  3H46 O;  3CC4 N;  2XO7 A;  2RF2 A;  5CYQ A;  1HQU A;  2YHB A;  1S9G A;  4B9S A;  5AQZ A;  4LD0 A;  2XY7 A;  1D8Y A;  3LDN A;  4FM0 A;  4KHS A;  3K59 A;  4GKK K;  4I9Q A;  2DY4 A;  1HR0 K;  3LDP A;  3MN6 A;  4YOW A;  4FLU A;  1TYQ B;  3TI0 A;  4JV5 K;  4JI2 K;  4IO8 A;  2R7Y A;  4WQ5 A;  4KHY A;  4PA1 A;  3NF9 A;  1HRH A;  3ZT3 A;  4H8K A;  1T3V A;  4BE1 A;  3BDP A;  3R1X A;  3THV A;  2P9S B;  3MDQ A;  3HOS A;  4DSK A;  3QEX A;  3QEV A;  4KHP K;  3MN5 A;  4H4M A;  3CFR A;  3V81 A;  4OPA A;  4IOA L;  4OJR A;  5B8H A;  3QLH A;  2V7Z A;  4F9O A;  2UYT A;  2P9U A;  5JLF A;  3BF1 A;  3UIQ A;  2JWL A;  1QE1 A;  4Z4G A;  3H1V X;  1BG3 A;  2F9T A;  2Q36 A;  3HO1 A;  3C95 A;  5LMU K;  3QML A;  4HUG A;  2HB5 A;  3NH0 A;  4CZJ A;  5AQV A;  4CFB A;  4DFP A;  4Z94 A;  3SCX A;  3OW2 M;  3VQ5 A;  4B1Z A;  4NYN A;  3DLL L;  2G8H A;  4DQP A;  1VQO N;  3L2W A;  3E1Y A;  5AQS A;  2G8I A;  2E1Z A;  4B1Y B;  5KRS A;  3DOK A;  4CK3 A;  3ZSW A;  2E20 A;  4LF7 K;  2YNH A;  1LWE A;  4B8A B;  3VQ8 A;  1RDB A;  3NFA A;  2VYP A;  4JKF A;  3VQP A;  4KH6 A;  5AQX A;  4PKH A;  4WQ4 A;  4ISF A;  3PLA A;  1MWM A;  5JIC A;  1TVR A;  4RW8 A;  4LH4 A;  5AQJ A;  1TL3 A;  4ELU A;  2FBX A;  5AFU H;  2NRV A;  2P9L A;  1YVN A;  3EEQ A;  1TAU A;  4Y1D A;  3DI6 A;  1S6Q A;  3WT0 A;  4KI4 A;  1WAJ A;  1KLM A;  3VA3 A;  3ZET A;  3L2Q A;  1QHT A;  3QFP A;  1TGO A;  1JJ2 M;  3CCJ N;  2HHU A;  3GOI A;  3AA4 A;  5HOO A;  2W42 A;  5EU7 A;  1VSM A;  4X64 K;  2BGG A;  4RW6 A;  2F8S A;  4OO1 J;  1BIS A;  3WXI A;  3OYA A;  4Z4F A;  2B5J A;  4CHZ A;  4I6M B;  4YFU A;  1NGH A;  4FSV A;  4Y1C A;  2ITM A;  2NRH A;  4DFJ A;  3M8Q A;  3VQ7 A;  1QSS A;  4B9V A;  1ATS A;  3THY B;  1NMN A;  3FE1 A;  1HNV A;  2YI1 A;  3C6T A;  2WON A;  4BG9 A;  3LDO A;  4CD1 A;  4DR1 K;  4IG3 A;  4DV7 K;  4U7B A;  3LP3 A;  4BVO A;  2ASO A;  2FBV A;  4IEE A;  1H1V A;  2O4I A;  4C1N I;  3NGI A;  4B1V A;  4CIF A;  3WUH A;  1X9W A;  4BRM A;  5AZI B;  1WN7 A;  4C8L A;  5AZJ B;  4B9L A;  1NKC A;  4KRF A;  2CGJ A;  4YHH K;  2PFU A;  4IJN A;  2OYQ A;  3ZX3 A;  3RMA A;  2HHS A;  4AHR A;  1RT3 A;  2AJQ A;  1JLC A;  3T3F A;  2HHW A;  3LDL A;  2P5O A;  4CEA A;  3RR8 A;  4DSF A;  4IKF A;  2OTJ N;  2HHH K;  3EE8 A;  3SUO A;  2QWM A;  5GAG P;  1L3S A;  3AO4 A;  3C65 A;  4DV5 K;  3THY A;  4CHO A;  4DTS A;  4E1N A;  2OAN A;  4CJP A;  1GLE G;  3L2V A;  3MMV A;  2UUA K;  5FPE A;  4CED A;  4JHD B;  3W3D A;  2IAJ A;  3J7Y P;  1N33 K;  3A0I X;  4FZY A;  3BP8 A;  3TAQ A;  2QM1 A;  2XY5 A;  3S3O A;  1DEJ A;  4ICL A;  3SUQ A;  4DLE A;  4FLV A;  4XEI A;  3CJC A;  4H0X B;  4KO0 A;  4E7H A;  2HW3 A;  4BRL A;  4AH9 A;  3CI5 A;  5GIN A;  2IOC A;  3P1G A;  3U3Y A;  1LOT B;  1VQL N;  2ETJ A;  4DQI A;  4CZI A;  5C25 A;  4FVU A;  4RW7 A;  1C0T A;  4AHC A;  4V19 S;  1ZBU A;  1CZ9 A;  4BQZ A;  3O9Q A;  3VQ6 A;  4DFK A;  2FSK A;  4H0O A;  4B9U A;  5E84 A;  4LFA K;  1IV0 A;  1HNW K;  1J5E K;  4IBN A;  4KRE A;  1IKY A;  3DLR A;  5AQW A;  4CHY A;  2IC3 A;  3AAQ A;  1OVQ A;  4YDU A;  1VQ7 N;  3UE5 A;  4LH5 A;  1YF5 L;  3CJ1 A;  3WXL A;  3VOV A;  1WSI A;  4MDA A;  3KK3 A;  3TAG A;  3D2E B;  1QQO A;  4W5Q A;  1HQE A;  2QWR A;  2W6L A;  3S41 A;  5AQM A;  3J7Z O;  4HTU A;  2Q2R A;  1GOC A;  4KHN A;  1SL2 A;  1FW6 A;  4JS5 A;  4CJ3 A;  1NK8 A;  3MN9 A;  2WTU A;  2E4L A;  4FK2 A;  4BR4 A;  4FWK A;  2CH5 A;  1WSE A;  1T03 A;  4BRH A;  1D5A A;  5BRH A;  4CF2 A;  3D2F B;  3IRX A;  1NK5 A;  3SAF A;  3E9O A;  4J2E A;  1D4X A;  2O8F B;  4EHU A;  3KLF A;  1QZ6 A;  1L3T A;  1TKD A;  4JN4 A;  4GMJ B;  3LWL A;  4O0I A;  4ID5 A;  4LF9 K;  4BR2 A;  5GAD P;  3SLC A;  2D0P A;  3NH2 A;  1OVY A;  4BRQ A;  5M1Q A;  2FXU A;  1J5O A;  5GAH P;  4IOC L;  4GY2 B;  5DK5 A;  1K6Y A;  3D2E A;  3FZM A;  1VQM N;  4CE9 A;  1WSJ A;  3MEG A;  4B1X B;  2EHG A;  2A3Z A;  2D4W A;  3V1R A;  3AA5 X;  4JD2 B;  3DXM A;  3VQ9 A;  1XMO K;  3CJ9 A;  4I2Q A;  1MDU B;  4E7K A;  1I94 K;  1NKB A;  3F73 A;  4CZE A;  4QS8 A;  4A2B A;  3UKU B;  2UUC K;  3LDS A;  3FLC O;  1QS4 A;  2QXL A;  3ZSR A;  1MU2 A;  3PV8 A;  3DRP A;  3KWI A;  1QTM A;  3D2F A;  3KLH A;  1K73 O;  1CLQ A;  3OTO K;  3DYA A;  4F2R A;  2O8F A;  4DMN A;  3OA9 A;  2HMI A;  4HHT A;  3FGU A;  4OKE A;  2BTF A;  3QER A;  2GEM A;  4DTR A;  4DV4 K;  1QQN A;  3RMB A;  4CZM A;  1HMV A;  4ISG A;  2A41 A;  2D0C A;  1HNI A;  2Y1J A;  4FJM A;  4K41 A;  3AY9 A;  4LF4 K;  4E89 A;  5KQD A;  4CI6 A;  1IO2 A;  5HRO A;  3T1Y K;  3MX2 A;  3U4L A;  1RT6 A;  1BU6 O;  3RR7 A;  2KHO A;  1K9M O;  2O8D B;  2P9I A;  4K8Z A;  4OKJ A;  1Q82 O;  2YKN A;  2VGM A;  3UKR B;  4AM6 A;  4CER A;  2XY8 A;  1HNZ K;  3AVB A;  3CJA A;  4Z4C A;  2HBJ A;  2WC9 A;  2O8B A;  1TKX A;  4BDZ A;  1BCO A;  4KH4 A;  2QWN A;  3NDK A;  1VQP N;  4X62 K;  2FF3 B;  2RN2 A;  2IIR A;  1C0U A;  1UWB A;  4DU4 A;  1BIU A;  2F96 A;  1NU0 A;  4ZTF A;  4IFY A;  2P5G A;  3I0R A;  2ASP A;  3K5O A;  5KTQ A;  2P51 A;  2HBK A;  1QQM A;  2D0B A;  3ITH A;  5M1P A;  4BQL A;  3G71 N;  4FPA A;  4KB1 A;  3F2K A;  3ZSO A;  3C94 A;  1W7A A;  3VA0 A;  3V9S A;  2FC0 A;  4CJ5 A;  1G99 A;  2ZF5 O;  3FZH A;  4PL8 A;  1RDU A;  2GEL A;  3ID8 A;  5HBM A;  1J54 A;  3IUC A;  5CY4 A;  5FPM A;  4A61 A;  3K5L A;  3FZF A;  4RW4 A;  4O8U A;  4JRQ A;  3L2U A;  2E1Y A;  3OHR A;  1C1B A;  3OYG A;  4E19 A;  4PKI A;  5I3U A;  2Z1I A;  5GIO A;  4LF8 K;  1N8R O;  2HND A;  3QB0 A;  4JI1 K;  4CEF A;  3NH1 A;  4KTZ A;  2QA4 N;  5EOY A;  5J1E A;  2NRT A;  1VHX A;  3GG4 A;  1WAF A;  4H0P A;  2I7P A;  1IBL K;  3SQ1 A;  3OYN A;  4H5N A;  1NOY A;  3TU5 A;  4CEO A;  3AVC A;  3CET A;  2Q1N A;  5FPD A;  3GE1 A;  3JSM A;  4FWO A;  4JAX A;  5AQY A;  5HP1 A;  3RRG A;  1KD1 O;  3PSF A;  4MLE A;  3H45 C;  3O4Q A;  4BRI A;  2HVH A;  4CJ4 A;  3HP6 A;  5C0Y A;  3QBW A;  4BRC A;  3EKS A;  4WE1 A;  3WNF A;  5JVH L;  1X3M A;  5EXW A;  2YHY A;  3MN7 A;  4QS7 A;  1RTD A;  3KD5 E;  2WOM A;  3VF4 A;  4GV6 A;  3EL2 A;  3WNH A;  3SQ0 A;  1S1V A;  2IS3 A;  3AO2 A;  3DRS A;  3A5O C;  1XNR K;  3OVN A;  3EO3 A;  4J2A A;  4JK8 A;  3MED A;  4O4G A;  3RSE A;  3OYI A;  2ZJR L;  5FLX O;  1TK8 A;  1TK0 A;  1QVF M;  4H4O A;  2X78 A;  5KGX A;  2NUB A;  3NHG A;  3TSU A;  1REV A;  2E6L A;  4FLZ A;  3G6E N;  2KTQ A;  1NGJ A;  5KPT A;  2A42 A;  2OA8 A;  3HST B;  4M3T A;  2VQE K;  3LPU A;  3ZSX A;  4KH5 A;  3ENH A;  2OZS A;  2QWQ A;  4EHT A;  2O4G A;  4CIE A;  1NGG A;  2VWK A;  2OTL N;  5KRT A;  4FYD A;  2Z1H A;  1QQC A;  3HZ6 A;  1FKP A;  4FWQ A;  4CEQ A;  3VQB A;  2YCH A;  5AQQ A;  5FPN A;  1U48 A;  5JS1 A;  1NGC A;  1RDA A;  3DLE A;  4ID1 A;  3LP1 A;  4IZ9 A;  4JKD A;  2PAV A;  4DTN A;  3LZJ A;  4MO4 A;  1DGK N;  1HNX K;  3L4I A;  1S5J A;  1ASU A;  1TL1 A;  3SAH A;  3LP2 A;  4BRE A;  4FJ5 A;  1Z25 A;  1U2V A;  4HTL A;  1DTT A;  3VEN A;  4W5T A;  4FXD A;  3IDH A;  1RT2 A;  3EZW A;  2QKB A;  2D1K A;  3FR0 A;  3FFI A;  3QIC A;  5ADX A;  4EP5 A;  2PYJ A;  3HL8 A;  4F4K A;  4IFV A;  3I8D A;  3C6A A;  4KFB A;  3OYJ A;  3CCE N;  2BAN A;  1KSP A;  3WNG A;  2Q3S A;  1R0A A;  2VWB A;  3L6Q A;  3TAE A;  1RNH A;  4U67 L;  3R6M A;  3TTD A;  5J2N A;  2UU9 K;  1XQS C;  4Q5V A;  3SUN A;  1NJW A;  2D0O A;  1ATR A;  4CEZ A;  2E2Q A;  4M3Z A;  3QBX A;  3MWT A;  4EP4 A;  1JXB A;  4J2B A;  3SJJ A;  1MWK A;  3SJH A;  4DS5 A;  1RTH A;  3AVI A;  3ULE B;  2DPN A;  1VSD A;  1NBW A;  1GOA A;  4DQS A;  4CJL A;  3SI6 A;  4CBX A;  1RT4 A;  1JLG A;  3KKS A;  4MDB A;  2PYL A;  3VF6 A;  3P4I A;  3DM2 A;  3HYF A;  1HPZ A;  3ZEU B;  4OGC A;  3NBP A;  4M7X A;  1EWQ A;  4AF1 A;  5MLC Q;  4H5T A;  1LWF A;  3O8M A;  3E9L A;  4BR7 A;  3W0L A;  1S9E A;  1NJX A;  4CJ7 A;  1YJN N;  3LPT A;  4LF6 K;  3EE9 A;  3T7Z A;  1Z6R A;  1QHA A;  3C0B A;  3DXK B;  4B1W B;  3S3M A;  4XH5 A;  5HRN A;  1CZA N;  3MXM A;  2V51 B;  2X74 A;  2W6K A;  2PY5 A;  2H3G X;  5AQL A;  2Q31 A;  4DQQ A;  4OPJ A;  2FSJ A;  4DU1 A;  3NF8 A;  1VQ4 N;  4FW1 A;  1SS6 A;  2E8A A;  5CZ1 A;  3SK3 A;  4M63 C;  3QEW A;  4J8F A;  4K42 A;  1Z26 A;  4BRP A;  5BRE A;  3HP9 A;  4F3O A;  4CGI A;  4FJ7 A;  3BZK A;  1E3M A;  1BDG A;  3HTV A;  3CCM N;  2JLE A;  1IG9 A;  4E0D A;  1TYQ A;  3MX5 A;  1JL1 A;  1A5W A;  3HPH A;  4DR6 K;  4N41 A;  1RBS A;  5AQF A;  1QSY A;  1YXQ A;  4ILJ A;  2P9S A;  4JKE A;  1KTQ A;  2J4R A;  3TSP A;  5AQP A;  2E2O A;  1RDW X;  2BUP A;  5AQO A;  3OYK A;  4A5B A;  1LAV A;  4FJG A;  4BRF A;  1OH5 A;  3AVH A;  4C8M A;  3K9K A;  3V9Z A;  4DSJ A;  3VTH A;  5BPM A;  1U47 A;  3L3U A;  3V9X A;  5LL6 Z;  1NOZ A;  2Q97 A;  1Q18 A;  1GLJ O;  3ZX2 A;  3J7A P;  2P9N B;  2V52 B;  4UQG A;  3PIP L;  3R3L A;  4B9T A;  3OJS A;  1IJJ A;  1KRP A;  1C1A A;  1RT5 A;  2IGI A;  4YOR A;  2Y1I A;  3VEO A;  2VGN A;  3AGK A;  3VET A;  3SUP A;  4AHU A;  4NCA A;  1K8K B;  3HVR A;  1O1W A;  2FBT A;  4C1N K;  3VER A;  4ELT A;  4DR2 K;  4DG1 A;  3SMS A;  5SZT A;  2NNW A;  5AJ3 K;  3F5T A;  3HPG A;  4JKG B;  3ZYY X;  4N76 A;  3VMF B;  1F21 A;  2QW9 A;  2YKM A;  3WXM B;  2ITG A;  1VQ6 N;  4KI6 A;  3VQC A;  1C0G A;  3V6D A;  4I9L A;  2O8E B;  2P9K B;  5T7B A;  4DV2 K;  4F3T A;  2GUP A;  3PSI A;  5A2Q O;  5KGW A;  4CJF A;  3IFR A;  4CGJ A;  4CFA A;  4O55 A;  3V4I A;  4NO7 A;  4PY5 A;  2P9N A;  1Q81 O;  1CZB A;  3DRR A;  4E7L A;  3NMU A;  2WFB A;  4FOE A;  3CM6 A;  1TAQ A;  4Z4H A;  2LSN A;  1Q9X A;  1FK9 A;  4I6M A;  1GLA G;  3ASM A;  1J9A A;  1S3X A;  4X66 K;  4FJK A;  5F1X A;  3RMD A;  2BH1 A;  4EFH A;  4EIA A;  1T6D A;  1K8K A;  2DFE A;  3VGL A;  5J2Q A;  3H3O B;  2IVO A;  4FK0 A;  4IXC A;  5C10 A;  4Z4I A;  2EWS A;  3S3N A;  1HJR A;  4E1J A;  1LV5 A;  2GUI A;  4BRN A;  2KKZ A;  3E01 A;  2QK9 A;  4FWL A;  4DR5 K;  5ADX H;  5I42 A;  3NAE A;  1KC8 O;  2ZD1 A;  4EZ6 A;  2WUS A;  3O4W A;  4CJR A;  3F9M A;  4TSX A;  2F7T A;  1S72 N;  4PUO A;  1T44 A;  1EWR A;  2O8C B;  1KAZ A;  4WFN L;  2P9K A;  1BI4 B;  3J8A A;  3M1F A;  4GNI A;  2OPS A;  5AZI A;  4G1Q A;  4CFC A;  4F8R A;  5TKY A;  5AZJ A;  2KFZ A;  3O5B A;  1B9D A;  4MFB A;  5FRO A;  5BR8 K;  1S1W A;  3WQU A;  1KLN A;  2ZGY A;  4DKW A;  3A5M C;  4IO9 L;  4LF5 K;  1KVB A;  1HUX A;  3MWP A;  1RBU A;  5EX5 A;  1HKB A;  4CF8 A;  4WFB L;  3IAY A;  3E66 A;  2IVN A;  4FWR A;  3T69 A;  4CCH A;  4DHY A;  4DV6 K;  3QDK A;  3RRH A;  3LM9 A;  4FJN A;  1TV6 A;  4BC4 A;  4KPY A;  4B3T K;  4PQU A;  4AHS A;  1HX1 A;  1BOT O;  3KZB A;  3WEE B;  1V4T A;  3O3H A;  4C8K A;  2G8U A;  2KFN A;  4JHD A;  2UXB K;  4OKK A;  4DUZ K;  3DLG A;  5M1N A;  3CF5 L;  2OPR A;  3HJF A;  3AVF A;  3CMA N;  4CJK A;  3V9U A;  1E4G T;  1JL2 A;  4PKG A;  1NG9 A;  4HUF A;  3WQT A;  4BG8 A;  3H6E A;  4BDY A;  1N32 K;  1S1T A;  3Q7C A;  1WBD A;  3KLI A;  4IDK A;  3HM8 A;  4NCG A;  3CJ7 A;  3P5J A;  4GVE A;  3T1A A;  2X6S A;  4B3M K;  4KHQ A;  3LWM A;  3H1Q A;  4O0J A;  2CH6 A;  1DTQ A;  3SMP A;  2VCP A;  4DLG A;  4L8R B;  4JK7 A;  4CFD A;  2G8K A;  3CQ8 A;  1ILY A;  1VQ5 N;  1SL1 A;  4GV9 A;  5JMV A;  1KAY A;  3L2R A;  3K2P A;  4CJV A;  1W0H A;  2ZQB A;  4HVJ A;  4M3X A;  1D9F A;  3B6O A;  2QTD A;  2YHW A;  1NJY A;  4KKO A;  3LAN A;  1LAW A;  5D3G A;  1T6C A;  3ENB A;  2A40 A;  4FW2 A;  3K5N A;  5FRN A;  1LW2 A;  3AAR A;  4G9Z A;  5GIP A;  3H08 A;  2EX3 A;  3ULD A;  2NZT A;  1TUY A;  4JLH A;  4M7Y A;  5FDL A;  3CCQ N;  3KIO A;  3Q7B A;  3K57 A;  1ZYQ A;  2VG6 A;  3MAQ A;  3U3G A;  4CJU A;  4YOX A;  3DWL A;  4DTP A;  4UY8 O;  4E3S A;  3KVG A;  3TWH A;  2FLO A;  1U6Z A;  3VEX A;  3DLH A;  1Q7Y O;  4L3Q A;  1SUQ A;  3TAM A;  4OGE A;  1ZBS A;  4AHV A;  2XRI A;  3CPE A;  4OPH A;  4BAC A;  2GWJ A;  3DOL A;  5BN8 A;  1XMQ K;  4IEI A;  3O08 A;  3IMX A;  3I33 A;  3DMJ A;  3AGR A;  4FPB A;  4DR3 K;  3MCA B;  5BPN A;  1VSL A;  1X3N A;  3ID6 A;  5HRS A;  4M3W A;  3GBT A;  1VSJ A;  1SZ2 A;  1X1P A;  1NMD A;  3NVM A;  4AQY K;  4BRG A;  3NCI A;  4CGH A;  4JD2 A;  1S1X A;  1VRU A;  3JYT A;  1RT7 A;  1BL3 A;  4CZG A;  4Y0W A;  1RBT A;  4YOV A;  4B3O A;  3UKU A;  3BF3 A;  3C6H A;  4DTJ A;  1YTA A;  3G0Z A;  3SAG A;  2YHA A;  4ZTJ A;  4KHU A;  1U49 A;  5AR0 A;  1BUP A;  1SQK A;  1LW0 A;  4BGB A;  1NK9 A;  4NCB A;  4YNQ A;  2VWJ A;  3CD6 N;  2A1R A;  2E2N A;  2HHQ A;  4KTW A;  3D7E O;  4R5P A;  1VAZ A;  4CF0 A;  2ATQ A;  2HST A;  3CFO A;  2P9P B;  3MCP A;  4DTU A;  2QXF A;  2Q0R A;  4QCL A;  3K9J A;  1BHL A;  1RT1 A;  1VRT A;  4DTM A;  4KB0 A;  2F9W A;  2O8D A;  1FXX A;  4OVL A;  5SWM A;  4B9M A;  2YNF A;  3NF7 A;  3UKR A;  4YOY A;  2HVI A;  5CHI A;  4JK9 A;  5AQG A;  3HK2 A;  1RCH A;  2I5J A;  3O9T A;  3LM2 A;  1BQN A;  2YJE A;  4BDP A;  1IBK K;  3NVK A;  3ATU A;  1EO1 A;  4LY7 A;  4C23 A;  4RCH A;  2KW4 A;  3CME N;  3OYD A;  2HBM A;  4FWM A;  4E1M A;  1Y97 A;  4NXN K;  3KKR A;  1RTJ A;  4R79 A;  1ZBL A;  1N6Q A;  5C15 A;  4JI7 K;  2E6M A;  4FWP A;  3ZCM A;  2HF3 A;  5M1O A;  1XHZ A;  3OYH A;  3A5N C;  3EY1 A;  2G8F A;  1Q86 O;  3CM5 A;  4CD3 A;  3TTF A;  1TK5 A;  1VSI A;  4LFC K;  4XH4 A;  2P9P A;  4JI8 K;  2KLA A;  4Z0U A;  4CF9 A;  1YUW A;  3ZT0 A;  1NK7 A;  2RHK A;  1KQS M;  2W41 A;  3R8E A;  5M1F A;  3O6W A;  4A5A A;  1T7P A;  2PZS A;  4FLW A;  1BO5 O;  4FJ8 A;  2RKI A;  3O4N A;  3C6U A;  3AO1 A;  3CG7 A;  1T8E A;  5C12 A;  4H5V A;  4CZF A;  1NK4 A;  4FM1 A;  3VEV A;  1B92 A;  2G8W A;  3N4Q A;  2KZM A;  1UAX A;  2DTU A;  1J6Z A;  2XHB A;  4EZ9 A;  5F0X A;  4FWS A;  3OYC A;  5C2D A;  1YJ9 N;  1BA0 A;  3U9Z A;  1NNE A;  1ITG A;  4CVN E;  4KBO A;  3D6R A;  1VSE A;  2QWL A;  1TUU A;  1C1C A;  1JXE A;  4IJA A;  3DLB A;  4BR9 A;  4JI0 K;  3O1W A;  4KHW A;  3V1Q A;  3PX6 A;  4CGD A;  4H5W A;  1NGD A;  3QET A;  3A5L C;  2OCE A;  1C0M A;  1OKJ A;  5GAE P;  1UA0 A;  2BE2 A;  4WFA L;  4AIL C;  3LP0 A;  3SYZ A;  4CJS A;  4B1U B;  3NGZ A;  3FFK B;  1WNS A;  3ISN C;  3ZT4 A;  2YJF A;  4W5O A;  3HM9 A;  1DLO A;  4EAH D;  3CCV N;  2OPQ A;  1S1U A;  1CXQ A;  5DMR A;  1A5V A;  1A5X A;  4DWI A;  3O3G A;  2YHX A;  2GBZ A;  5J2P A;  2B6A A;  1RIL A;  3IKM A;  2NRX A;  3VPZ A;  3ZT1 A;  1JCG A;  5AQT A;  3L4Q A;  5JVG L;  1FKO A;  3OBY A;  3MEE A;  3RWU A;  3HT3 A;  1NGA A;  3HRG A;  5AQH A;  3TPQ A;  5AQR A;  1NLV A;  3O9U A;  4BRK A;  1P90 A;  3JAM O;  4QAG A;  4C8O A;  4YY3 K;  4E7J A;  3VQD A;  1N5Y A;  3HXM A;  4LC9 B;  4NLB A;  3P38 A;  3J81 O;  1JLQ A;  1GOB A;  1WLJ A;  4CZL A;  1SKR A;  3CCU N;  3BUZ B;  4QS9 A;  4QOZ B;  1C6V A;  4CHQ A;  1HYZ A;  3D45 A;  1C0F A;  2P9U B;  5HRP A;  4WQ5 C;  1CXU A;  3QFU A;  4IOX A;  5BR9 A;  4M41 A;  3TAR A;  1WBB A;  2DFH A;  3SPZ A;  1TKZ A;  1YI2 N;  3T1H K;  2VG5 A;  3E9P A;  3KWG A;  3CCS N;  2E5L K;  5DM7 L;  2B4J A;  3AAP A;  1RGI A;  4CEE A;  5LJV A;  1SL0 A;  4BC2 A;  1BA1 A;  3IS9 A;  1RTI A;  4DB3 A;  2VQF K;  4DFM A;  3A2F A;  1TKT A;  4WF9 L;  4Z4E A;  1X9M A;  2D0A A;  3G4S N;  4F2S A;  3TR8 A;  5I9E B;  3B6P A;  2NRR A;  1HYV A;  5BN9 A;  4DF8 A;  1NK6 A;  2KQ2 A;  5IWA K;  3QNN A;  4FJX A;  1KAX A;  1XWL A;  2F8T A;  3WXK A;  1WSH A;  3ULE A;  1EX4 A;  5KQ8 A;  4PL7 A;  2KZZ A;  4I2P A;  4DR7 K;  4LFB K;  3V1O A;  2P9L B;  1WUA A;  1JCF A;  4O8K A;  4DUY K;  2I7N A;  2GX9 A;  3L0Q A;  3AA2 A;  3ZEU A;  4MQ3 A;  1IBM K;  3PX0 A;  3ZET B;  1QVG M;  4K8X A;  5LY3 A;  4H0T B;  4WYB A;  4WQ4 C;  1SAZ A;  5E41 A;  1XC9 A;  2YX6 A;  1XNQ K;  5H1S Q;  3LAM A;  4M3U A;  1EET A;  4K0K K;  1XI1 A;  4CGF A;  4BRO A;  4FJJ A;  5EVZ A;  3ALY A;  1KFD A;  4NXM K;  1VQ9 N;  3DXK A;  4BRD A;  3I0S A;  3CPW M;  1U4B A;  3O80 A;  1X9S A;  3K0S A;  3O9S A;  3MXI A;  4H03 B;  2FF6 A;  4ILH A;  4CJW A;  3J80 O;  3PY8 A;  1JLF A;  3ZSV A;  3VF2 A;  3CCL N;  4FM2 A;  3F9K A;  3SV4 A;  3VEW A;  2JWK A;  3AVK A;  1MA9 B;  1SKS A;  1VQK N;  3PUF A;  1Q8I A;  2HNZ A;  3U6F A;  2UUB K;  2P1J A;  3ENO A;  4H0Y B;  5AQI A;  5LJW A;  1M90 O;  4M3R A;  4JI6 K;  1ZBH A;  4OLA A;  1XHX A;  5AQN A;  1QSL A;  2UXD K;  4JNE A;  4NYF A;  1DKG D;  1P8Z A;  1JKH A;  4CJQ A;  2QWO A;  4WCE L;  4DU3 A;  4DTX A;  2ZM6 K;  3DAW A;  4FWN A;  3K58 A;  4BC3 A;  4A57 A;  3KLG A;  1VQ8 N;  3QO9 A;  1ESV A;  3ZSQ A;  3ZT2 A;  4AM7 A;  3MEC A;  5ELZ A;  4CF1 A;  3HPO A;  1UA1 A;  3PO5 A;  4DSE A;  4DQR A;  1NJZ A;  1WSG A;  3TAN A;  3LAK A;  3EZ5 A;  4E7I A;  4JEP A;  3CIP A;  3OS2 A;  3SBG A;  3FZL A;  4JKB A;  3TAP A;  3JXU A;  3G10 A;  3O1B A;  3VTI A;  3NGY A;  4A59 A;  3SPY A;  2IDO A;  1NGF A;  1NGB A;  3SZ2 A;  3TSQ A;  1L3U A;  4CBW A;  3SV3 A;  3D0P A;  1HKG A;  4B8C A;  4JKH A;  1HJO A;  1YTU A;  4FJ9 A;  1BQM A;  5HLF A;  2OPP A;  1IKV A;  4JKG A;  1YHQ N;  4M42 A;  4CHN A;  3L8B A;  3SQ4 A;  1WB9 A;  4ELV A;  2FBY A;  4CBU A;  4DV3 K;  2O8E A;  4CGG A;  3QES A;  1RBV A;  4J2D A;  1EQY A;  3ATV A;  1ZBF A;  4OX9 K;  3UB5 A;  4N5S A;  1BGX T;  3ZX0 A;  3U9D A;  1BWF O;  3ZLJ A;  1L5U A;  4JRP A;  1KVA A;  4CEC A;  3KHY A;  1ZBI A;  4FJL A;  1Q9Y A;  2W40 A;  4MLH A;  1YIT N;  4A62 A;  3AA3 A;  4LSL A;  1U04 A;  4BE0 A;  1G15 A;  4BC5 A;  3KLE A;  5E26 A;  4B9N A;  4JKA A;  4YOU A;  4CJT A;  4BR5 A;  4YDU C;  3ZSZ A;  4C8N A;  1HLU A;  2NRZ A;  3THW B;  2ZJQ L;  5JS2 A;  1YT3 A;  4CZH A;  2XY6 A;  3OYE A;  4IWV A;  2ASM A;  2A1S A;  3VES A;  3BY5 A;  2QWP A;  4HCC A;  3JS6 A;  2NLX A;  3WXJ A;  1JCE A;  3OY9 A;  3B8A X;  2GV9 A;  5J2M A;  4DTO A;  5CE3 A;  2O8C A;  1YVU A;  2JGU A;  1W9H A;  3CXC M;  3RMC A;  1BI4 A;  4OLB A;  3CFP A;  3CC7 N;  1RBR A;  1FJG K;  4BY9 C;  1Y64 A;  3GL1 A;  1XC3 A;  4CW7 B;  3LZI A;  1WSF A;  5AQK A;  4CIG A;  2QEX N;  1SKW A;  4NB4 A;  3OYM A;  3P83 D;  2AP1 A;  3QIO A;  3SQ2 A;  2BDP A;  4JYA K;  1RFQ A;  3QIP A;  4B3R K;  4ISE A;  4IDH A;  3DXM B;  1VK0 A;  1VQN N;  3IG1 A;  4BWJ A;  2X6N A;  5BRD A;  1OH6 A;  3HBT A;  3K5M A;  3THX B;  3CER A;  1I39 A;  4AHT A;  4H5R A;  4GW6 A;  3OJU A;  1ZC6 A;  3THW A;  4B9Q A;  1NK0 A;  1S6P A;  4N47 A;  1I3A A;  4K43 A;  3WEE A;  1NKE A;  3KD1 E;  4BWM A;  3CC2 N;  3U8X A;  4FOI A;  4NLC A;  3AVA A;  3EKU A;  3M8S A;  3AVL A;  1OH7 A;  3PIO L;  1EP4 A;  3VQ4 A;  4CJE A;  2D5R A;  1BCM A;  1UOC A;  3VEZ A;  5KI6 A;  1L3V A;  4RWT A;  3NF6 A;  2HHX A;  1E4F T;  3VQE A;  2CGL A;  4FZZ A;  1D9D A;  4HWI A;  2GTD A;  3M8P A;  4CES A;  5C24 A;  4CZK A;  4JI3 K;  2NRW A;  4GKJ K;  3M3Z A;  2RE2 A;  4O44 A;  1YIJ N;  5C2F A;  3LDQ A;  4DS4 A;  1N36 K;  1ATN A;  3QNO A;  1VSF A;  2P9I B;  5CR4 A;  4B08 A;  2HOE A;  2WBN A;  1NGE A;  4IFE A;  3THX A;  3MK6 A;  4ILG B;  2O8B B;  4DSI A;  1GLD G;  2CGK A;  4O5B A;  2Z1J A;  2YV0 X;  3OBW A;  4FO0 A;  1GLL O;  1K8A O;  4Q0B A;  3AVN A;  4DSL A;  1GLF O;  3KJV A;  1DT9 A;  3SNN A;  4FLY A;  1IKX A;  4KTQ A;  2YNI A;  5IT9 O;  2HNY A;  2HF4 A;  4MO5 A;  2HHT A;  1GLC G;  3BZC A;  3BEX A;  4DV1 K;  5F2R A;  1SV5 A;  3M6G A;  1KCF A;  1M1K O;  3HOT A;  5CZ2 A;  3LAL A;  5HL7 L;  3NE6 A;  1JLE A;  3VQQ A;  3AO3 A;  5BPL A;  1LCU A;  4W5N A;  1QZ5 A;  4BE2 A;  3VQA A;  4JI5 K;  4HCB A;  3G25 A;  3PX4 A;  2PBD A;  3T19 A;  3DJC A;  4RTF D;  5C42 A;  3KTQ A;  4X65 K;  2DFF A;  3R9P A;  3M5R A;  3SBT A;  5LMN K;  4GVM A;  2ZWH A;  1EXQ A;  3A8Y A;  4DQ8 A;  3I56 N;  4BRA A;  1WOQ A;  1LWC A;  4GV3 A;  3QIN A;  3QEP A;  4ZHR A;  1NGI A;  1HPM A;  3RTV A;  3P39 A;  4JS4 A;  3VGK A;  1W2B M;  3WNE A;  5K14 A;  4FCY A;  1KVC A;  3M8R A;  4FK4 A;  1JLA A;  3EYZ A;  2OZM A;  3I55 N; 
#chains in the Genus database with same CATH homology
 4HTU A;  2G8V A;  4E7J A;  4DF4 A;  3VQD A;  1GOC A;  3HVR A;  1O1W A;  2FBT A;  1ASW A;  3HXM A;  1N5Y A;  1SL2 A;  4KHN A;  1T05 A;  4JS5 A;  4CJ3 A;  4CK2 A;  3S9H A;  4CHP A;  4DG1 A;  1NK8 A;  4ELT A;  5SZT A;  2E4L A;  4FK2 A;  1JLQ A;  1GOB A;  1RDC A;  1WLJ A;  4KV8 A;  1SKR A;  1WSE A;  1T03 A;  4QOZ B;  1C6V A;  1D5A A;  1HYZ A;  3D45 A;  3HPG A;  4CHQ A;  4CF2 A;  4N76 A;  3IRX A;  1NK5 A;  5HRP A;  3V9W A;  3O3F A;  1CXU A;  1F21 A;  2YKM A;  1J53 A;  2ITG A;  4J2E A;  3MXJ A;  4M41 A;  3TAR A;  2ZE2 A;  4KI6 A;  2DFH A;  3VQC A;  4LSN A;  3SPZ A;  1BIZ A;  3V6D A;  3KLF A;  1TKZ A;  4I9L A;  1L3T A;  5T7B A;  4F3T A;  1TKD A;  5KGW A;  4CJF A;  3TAB A;  2VG5 A;  4FLT A;  4GMJ B;  4CGJ A;  3LWL A;  4CFA A;  4O55 A;  3V4I A;  4FZX C;  2B4J A;  4O0I A;  4RG8 A;  4PY5 A;  4ID5 A;  2HHV A;  4CEE A;  1SL0 A;  3IS9 A;  3L3V A;  1RTI A;  4W5R A;  1CZB A;  3DRR A;  3NH2 A;  4E7L A;  4M3Y A;  4DFM A;  3A2F A;  1TKT A;  3CM6 A;  4Z4E A;  1J5O A;  1X9M A;  1TAQ A;  4Z4H A;  5DK5 A;  2LSN A;  1Q9X A;  1FK9 A;  1K6Y A;  2D0A A;  4F2S A;  3TR8 A;  3ASM A;  3B6P A;  1J9A A;  1WSJ A;  4CE9 A;  3MEG A;  4DF8 A;  1HYV A;  2EHG A;  4FJK A;  3RMD A;  3V1R A;  3AA5 X;  3VQ9 A;  1NK6 A;  4XIU A;  2KQ2 A;  4I2Q A;  2QKK A;  3QNN A;  4FJX A;  5J2Q A;  2DFE A;  1XWL A;  4E7K A;  2F8T A;  3AVM A;  4FK0 A;  5HRR A;  1WSH A;  1EX4 A;  3F73 A;  1NKB A;  4Z4I A;  3S3N A;  2KZZ A;  1HJR A;  4I2P A;  3HVT A;  1U45 A;  3LDS A;  1LV5 A;  3V1O A;  1QS4 A;  2GUI A;  3OYL A;  3E01 A;  3ZSR A;  1MU2 A;  3PV8 A;  2QK9 A;  1KFS A;  3DRP A;  3KK2 A;  1QTM A;  5I42 A;  3NAE A;  4EZ6 A;  2ZD1 A;  3AA2 A;  3KLH A;  1CLQ A;  4CJR A;  1VSH A;  4MQ3 A;  4TSX A;  3CYM A;  3DYA A;  4F2R A;  3PX0 A;  4K8X A;  4DMN A;  4PUO A;  2HMI A;  2VG7 A;  1IH7 A;  4FVM A;  4HHT A;  4NCA A;  1BI4 B;  2OPS A;  4OKE A;  5E41 A;  4CFC A;  4G1Q A;  4FLX A;  1XC9 A;  4M45 A;  4F8R A;  2KFZ A;  3QER A;  4N56 A;  1B9D A;  4MFB A;  5FRO A;  4DTR A;  3RMB A;  3LAM A;  1HMV A;  4M3U A;  1EET A;  2D0C A;  1HNI A;  2Y1J A;  4CGF A;  1XI1 A;  4FJM A;  4PWD A;  1S1W A;  4E89 A;  1KLN A;  4C8O A;  4FJJ A;  4CK1 A;  3ALY A;  1KFD A;  1IO2 A;  5HRO A;  1IKW A;  1KVB A;  1B9F A;  1RT6 A;  3I0S A;  1U4B A;  3RR7 A;  1RBU A;  4CF8 A;  4OPK A;  3OYB A;  3IAY A;  1X9S A;  3BGR A;  4K8Z A;  4OKJ A;  3MXI A;  2YNG A;  4CCH A;  4CJW A;  2YKN A;  3QEI A;  1HYS A;  3AO5 A;  4CER A;  3PY8 A;  2XY8 A;  3RRH A;  1JLF A;  3ZSV A;  4FJN A;  3AVB A;  1TV6 A;  4Z4C A;  4KPY A;  4PQU A;  4FM2 A;  1TKX A;  3F9K A;  4AHS A;  4BDZ A;  1BCO A;  5CYM A;  3NDK A;  3SV4 A;  4FJH A;  3OYF A;  3AVK A;  4IG0 A;  1SKS A;  3PUF A;  1Q8I A;  2HNZ A;  4CEB A;  4RW9 A;  3O3H A;  3U6F A;  2P1J A;  4C8K A;  2G8U A;  2RN2 A;  2KFN A;  1C0U A;  1UWB A;  1VSK A;  1BIU A;  4M3R A;  4DU4 A;  4OKK A;  1ZBH A;  1XHX A;  2F96 A;  4ZTF A;  2P5G A;  4IFY A;  4OLA A;  3DLG A;  3I0R A;  3K5O A;  1QSL A;  5KTQ A;  3AVG A;  2OPR A;  3HJF A;  2P51 A;  4I7F A;  3AVF A;  4NYF A;  4CJK A;  3V9U A;  1JKH A;  1JL2 A;  2D0B A;  3AV9 A;  4CJQ A;  3ITH A;  1JLB A;  4HUF A;  4DU3 A;  4KB1 A;  3PO4 A;  4DTX A;  4HUE A;  4BDY A;  3DLK A;  3ZSO A;  3C94 A;  1S1T A;  3K58 A;  3KLI A;  4IDK A;  3KLG A;  3VA0 A;  3QO9 A;  3ZSQ A;  2FC0 A;  3V9S A;  3ZT2 A;  4NCG A;  4CJ5 A;  3OS0 A;  3MEC A;  1EKE A;  3ZSY A;  4CF1 A;  3P5J A;  3TAF A;  5HBM A;  3HPO A;  1UA1 A;  1J54 A;  4DSE A;  3PO5 A;  2Z1G A;  4FJI A;  3AVJ A;  2X6S A;  5CY4 A;  3T1A A;  3K5L A;  4DQR A;  1WSG A;  1NJZ A;  4RW4 A;  4JRQ A;  3LWM A;  3L2U A;  4KHQ A;  5FRM A;  4O0J A;  4KAZ A;  1C1B A;  3OYG A;  2RPI A;  3LAK A;  3EZ5 A;  4E19 A;  4E7I A;  3TAN A;  5I3U A;  1DTQ A;  1RDD A;  2Z1I A;  3KK1 A;  3VN5 A;  4DLG A;  2HND A;  4L8R B;  4CFD A;  4CEF A;  3NH1 A;  4KTZ A;  3OS1 A;  1ASV A;  3OS2 A;  2G8K A;  3CQ8 A;  2XO7 A;  2RF2 A;  5CYQ A;  1SL1 A;  3TAP A;  1HQU A;  5J1E A;  2YHB A;  1S9G A;  3G10 A;  3L2R A;  3K2P A;  4CJV A;  1W0H A;  1WAF A;  2ZQB A;  4B9S A;  4HVJ A;  4M3X A;  4LD0 A;  2XY7 A;  1D9F A;  3NGY A;  3B6O A;  3SQ1 A;  1D8Y A;  3OYN A;  4FM0 A;  1NOY A;  4KHS A;  4CEO A;  3K59 A;  3AVC A;  4I9Q A;  2DY4 A;  1NJY A;  3JSM A;  4KKO A;  3SPY A;  2IDO A;  5HP1 A;  4FLU A;  3RRG A;  3LAN A;  3SZ2 A;  1LAW A;  1L3U A;  5D3G A;  3SV3 A;  3TI0 A;  3D0P A;  3O4Q A;  2R7Y A;  4FW2 A;  3K5N A;  4PA1 A;  4KHY A;  2HVH A;  4B8C A;  5FRN A;  1LW2 A;  3NF9 A;  4CJ4 A;  1HRH A;  3ZT3 A;  3HP6 A;  4H8K A;  3H08 A;  4BE1 A;  3BDP A;  2EX3 A;  4WE1 A;  3WNF A;  3ULD A;  3THV A;  1YTU A;  4FJ9 A;  1BQM A;  4JLH A;  5FDL A;  3KIO A;  3K57 A;  1ZYQ A;  2VG6 A;  3MAQ A;  4DSK A;  3U3G A;  4CJU A;  3QEV A;  3QEX A;  5HLF A;  1RTD A;  3KD5 E;  4H4M A;  2WOM A;  2OPP A;  3CFR A;  4DTP A;  4E3S A;  3V81 A;  3WNH A;  4OJR A;  1IKV A;  3TWH A;  3SQ0 A;  3QLH A;  1S1V A;  2IS3 A;  3AO2 A;  3UIQ A;  4M42 A;  3DRS A;  4CHN A;  3L8B A;  3DLH A;  3OVN A;  1SUQ A;  3SQ4 A;  3TAM A;  4OGE A;  1QE1 A;  4J2A A;  4AHV A;  2XRI A;  3MED A;  4O4G A;  4BAC A;  4ELV A;  2FBY A;  4Z4G A;  3OYI A;  4CGG A;  3QES A;  1RBV A;  3DOL A;  1TK0 A;  1TK8 A;  4J2D A;  4H4O A;  2X78 A;  3C95 A;  2NUB A;  5KGX A;  3NHG A;  3HO1 A;  1REV A;  1ZBF A;  2E6L A;  4HUG A;  2HB5 A;  1BGX T;  4N5S A;  3NH0 A;  4FLZ A;  4CFB A;  4DFP A;  3SCX A;  3VQ5 A;  2KTQ A;  3DMJ A;  4NYN A;  2G8H A;  2OA8 A;  3HST B;  1L5U A;  4DQP A;  4M3T A;  3L2W A;  4JRP A;  1KVA A;  4CEC A;  2G8I A;  3LPU A;  3ZSX A;  1ZBI A;  4FJL A;  2OZS A;  5KRS A;  3DOK A;  1Q9Y A;  1VSL A;  2O4G A;  4CIE A;  4CK3 A;  5HRS A;  4M3W A;  1VSJ A;  3ZSW A;  2VWK A;  2YNH A;  1X1P A;  5KRT A;  4FYD A;  1LWE A;  2Z1H A;  3VQ8 A;  4B8A B;  1QQC A;  1RDB A;  3AA3 A;  3NFA A;  4LSL A;  1U04 A;  3NCI A;  4BE0 A;  1FKP A;  1G15 A;  4CGH A;  3KLE A;  4CEQ A;  1S1X A;  3VQP A;  1VRU A;  3JYT A;  1RT7 A;  1BL3 A;  4B9N A;  3VQB A;  1RBT A;  4CJT A;  3ZSZ A;  4C8N A;  1U48 A;  5JS1 A;  4B3O A;  1RDA A;  1TVR A;  3DLE A;  4ID1 A;  4LH4 A;  4RW8 A;  5JS2 A;  3LP1 A;  1TL3 A;  1YT3 A;  4DTJ A;  4DTN A;  1YTA A;  3G0Z A;  3LZJ A;  2FBX A;  2XY6 A;  4ELU A;  1S5J A;  3OYE A;  2YHA A;  1ASU A;  1TL1 A;  4ZTJ A;  4KHU A;  1U49 A;  3LP2 A;  1TAU A;  4FJ5 A;  2A1S A;  1Z25 A;  4Y1D A;  1LW0 A;  3DI6 A;  4HCC A;  1DTT A;  1S6Q A;  4W5T A;  1NK9 A;  4NCB A;  4KI4 A;  4FXD A;  4YNQ A;  1WAJ A;  5J2M A;  1RT2 A;  2VWJ A;  3OY9 A;  2GV9 A;  2QKB A;  1KLM A;  3VA3 A;  2A1R A;  3FFI A;  4DTO A;  3L2Q A;  1QHT A;  4EP5 A;  2PYJ A;  3HL8 A;  4F4K A;  1YVU A;  4IFV A;  2JGU A;  3I8D A;  1W9H A;  4KFB A;  1TGO A;  1BI4 A;  4KTW A;  4R5P A;  3RMC A;  4OLB A;  2HHQ A;  3CFP A;  2HHU A;  3OYJ A;  4CF0 A;  2ATQ A;  2BAN A;  3AA4 A;  3CFO A;  5EU7 A;  2W42 A;  1KSP A;  1VSM A;  1RBR A;  3WNG A;  2QXF A;  4DTU A;  2Q3S A;  1R0A A;  3LZI A;  1WSF A;  3TAE A;  4CIG A;  4RW6 A;  2BGG A;  2F8S A;  1BHL A;  1RNH A;  1BIS A;  4QCL A;  1SKW A;  3OYA A;  3OYM A;  3P83 D;  3QIO A;  5J2N A;  3SQ2 A;  2BDP A;  4Z4F A;  3QIP A;  2B5J A;  1RT1 A;  4CHZ A;  4YFU A;  4Q5V A;  3SUN A;  1NJW A;  1VRT A;  4Y1C A;  4CEZ A;  4DTM A;  4M3Z A;  4KB0 A;  4EP4 A;  1JXB A;  4DFJ A;  1FXX A;  4J2B A;  4OVL A;  3SJJ A;  5SWM A;  3M8Q A;  1VK0 A;  3VQ7 A;  4B9M A;  2YNF A;  3IG1 A;  1QSS A;  4B9V A;  3NF7 A;  2X6N A;  4BWJ A;  3K5M A;  2HVI A;  1I39 A;  4DS5 A;  1RTH A;  3AVI A;  4AHT A;  3HK2 A;  1RCH A;  1VSD A;  1GOA A;  2I5J A;  1HNV A;  3C6T A;  4GW6 A;  3OJU A;  2WON A;  4DQS A;  4CJL A;  1BQN A;  1NK0 A;  3SI6 A;  4BDP A;  1S6P A;  4N47 A;  1I3A A;  4LY7 A;  1RT4 A;  1JLG A;  2KW4 A;  3KKS A;  4IG3 A;  1NKE A;  2PYL A;  3KD1 E;  4BWM A;  3LP3 A;  3DM2 A;  3OYD A;  2FBV A;  3HYF A;  1HPZ A;  4OGC A;  3AVA A;  3NBP A;  4E1M A;  1Y97 A;  3KKR A;  1RTJ A;  1ZBL A;  1N6Q A;  2O4I A;  3M8S A;  3AVL A;  2E6M A;  1LWF A;  3ZCM A;  1XHZ A;  3NGI A;  3OYH A;  1EP4 A;  3EY1 A;  2G8F A;  3VQ4 A;  1S9E A;  4CJE A;  4CIF A;  1X9W A;  3CM5 A;  1NJX A;  2D5R A;  1BCM A;  1UOC A;  1WN7 A;  4C8L A;  5KI6 A;  1L3V A;  4B9L A;  1NKC A;  4KRF A;  3NF6 A;  2HHX A;  1TK5 A;  1VSI A;  2OYQ A;  3VQE A;  3RMA A;  3LPT A;  4FZZ A;  1D9D A;  2HHS A;  4AHR A;  3M8P A;  4Z0U A;  4CES A;  5C24 A;  1RT3 A;  4CF9 A;  2AJQ A;  1JLC A;  4O44 A;  3T3F A;  2HHW A;  3ZT0 A;  1NK7 A;  3S3M A;  2P5O A;  4DS4 A;  5HRN A;  4CEA A;  3RR8 A;  4DSF A;  3QNO A;  4IKF A;  1VSF A;  2X74 A;  3MXM A;  1T7P A;  2PZS A;  2PY5 A;  4B08 A;  4FLW A;  3SUO A;  4AHU A;  4FJ8 A;  2RKI A;  3O4N A;  1L3S A;  4DQQ A;  3AO4 A;  4OPJ A;  3C6U A;  3AO1 A;  3CG7 A;  1T8E A;  4DU1 A;  4CHO A;  4DSI A;  4DTS A;  3NF8 A;  4E1N A;  4O5B A;  4FM1 A;  2Z1J A;  1NK4 A;  1B92 A;  2YV0 X;  2G8W A;  4CJP A;  4FW1 A;  3L2V A;  5CZ1 A;  2KZM A;  1UAX A;  3QEW A;  2DTU A;  1Z26 A;  3AVN A;  4Q0B A;  3HP9 A;  4F3O A;  2XHB A;  4EZ9 A;  4DSL A;  4CED A;  2IAJ A;  4CGI A;  4FJ7 A;  3KJV A;  3SNN A;  4FLY A;  4FZY A;  2JLE A;  1IKX A;  3OYC A;  1IG9 A;  4E0D A;  4KTQ A;  1JL1 A;  2YNI A;  3TAQ A;  2HNY A;  1A5W A;  2XY5 A;  1ITG A;  3S3O A;  3HPH A;  2HHT A;  4N41 A;  4ICL A;  3SUQ A;  1RBS A;  1SV5 A;  1VSE A;  4DLE A;  1QSY A;  1KCF A;  4FLV A;  5CZ2 A;  1C1C A;  1KTQ A;  3LAL A;  3NE6 A;  1JLE A;  1JXE A;  4KO0 A;  4E7H A;  3DLB A;  2HW3 A;  4AH9 A;  3VQQ A;  4KHW A;  2IOC A;  3AO3 A;  3P1G A;  3V1Q A;  4CGD A;  3PX6 A;  3U3Y A;  3QET A;  2ETJ A;  4W5N A;  4BE2 A;  1C0M A;  3VQA A;  4DQI A;  3OYK A;  2BE2 A;  1UA0 A;  4HCB A;  1LAV A;  5C25 A;  3PX4 A;  4FJG A;  4AIL C;  3LP0 A;  3T19 A;  3SYZ A;  3AVH A;  4C8M A;  4CJS A;  3V9Z A;  4RW7 A;  3NGZ A;  4DSJ A;  1C0T A;  4AHC A;  5C42 A;  1U47 A;  3KTQ A;  1WNS A;  1ZBU A;  1CZ9 A;  3ISN C;  3L3U A;  3ZT4 A;  3V9X A;  2DFF A;  1NOZ A;  3VQ6 A;  4W5O A;  4DFK A;  3HM9 A;  1DLO A;  4GVM A;  4B9U A;  2OPQ A;  1S1U A;  1EXQ A;  1CXQ A;  4IBN A;  5DMR A;  1A5V A;  1A5X A;  4KRE A;  1IKY A;  3DLR A;  4CHY A;  4UQG A;  3O3G A;  2IC3 A;  4DWI A;  2GBZ A;  5J2P A;  2B6A A;  1LWC A;  1RIL A;  4B9T A;  4LH5 A;  3QIN A;  3OJS A;  3QEP A;  3ZT1 A;  4ZHR A;  1KRP A;  1FKO A;  1WSI A;  3MEE A;  3KK3 A;  4JS4 A;  3RTV A;  3TAG A;  1C1A A;  3WNE A;  3HT3 A;  1RT5 A;  3RWU A;  2IGI A;  5K14 A;  1HQE A;  4W5Q A;  4FCY A;  2Y1I A;  1KVC A;  3M8R A;  4FK4 A;  1JLA A;  3EYZ A;  2OZM A;  3SUP A;  4QAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...