3AVHA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avhA00
4DSFA 1O1WA 3L2VA 3TARA 1D8YA 4DFKA 3M8PA 4KHSA 1BI4B 1XHXA 5FRMA 2BGGA 4KTWA 3JYTA 3KK3A 2ETJA 1LWEA 4N5SA 3KLGA 1HNIA 4DFJA 3QETA 2KZZA 2PZSA 2YV0X 1BGXT 1HRHA 3TWHA 4KHNA 1W9HA 5KTQA 4CHYA 4HHTA 3AVIA 4OKJA 1KVAA 2EHGA 4DLGA 4FLVA 4DF4A 4HVJA 1Y97A 5DMRA 4CJSA 1HQUA 4CIEA 2DTUA 1U4BA 1YT3A 1S6PA 4FJMA 1RT1A 4DTRA 1U47A 1QS4A 4KKOA 1NK4A 2ZD1A 4W5NA 1VSIA 1MU2A 1X9SA 1UWBA 4HUEA 4FJNA 4W5QA 4FLTA 4OLAA 2ZQBA 4E19A 1QHTA 1XHZA 1S1XA 1SV5A 2XY5A 4OJRA 4BE2A 1ZBIA 1RBTA 3VQEA 2X6NA 1HYVA 1SL2A 3SQ1A 3KLEA 3HJFA 4CFAA 3HT3A 3PX4A 1QTMA 1TKDA 1S9GA 1WN7A 3DRPA 1T7PA 4CCHA 2KFZA 4BDYA 3O4QA 3ZT3A 2QK9A 3C94A 4C8OA 4CJ4A 3OJSA 4DQQA 3ITHA 4ELUA 4Z4FA 3SV3A 1Z25A 2D0BA 3OYEA 3B6OA 5KRTA 4IBNA 1YTUA 3RR7A 3LP0A 1L5UA 1D5AA 2R7YA 4EP5A 3PX6A 3SCXA 1DLOA 4CIGA 1JXEA 4B9VA 2KFNA 4CGJA 1HJRA 3OS1A 4CEBA 4AHTA 4XIUA 3QEXA 1NJWA 1WSGA 1N6QA 4DSLA 4M3UA 2JLEA 3VQ8A 3LZJA 3T3FA 3RMAA 3F9KA 1RTJA 3AA5X 4DQSA 4M3WA 3HP6A 4F3TA 4CJLA 5T7BA 2KQ2A 1NJZA 3G0ZA 3LANA 1XWLA 4C8NA 3DI6A 2DFEA 4I2PA 3HSTB 4E89A 1A5VA 3L2QA 2YNGA 3KLFA 3VA0A 4BDPA 1RNHA 4Z0UA 1Q9XA 4RG8A 1KLNA 4J2EA 4FK2A 3LPTA 2PYLA 2W42A 2G8IA 4J2BA 4W5RA 2ATQA 4B9MA 3QEPA 1YVUA 1KLMA 4J2AA 3HK2A 1IH7A 2GV9A 4ELTA 4CJRA 3D0PA 1UAXA 3DMJA 3ZSWA 1KCFA 3OYAA 3S3NA 4FYDA 2RPIA 2E6LA 1JKHA 4I9LA 4O5BA 4CF8A 4CHPA 1RDBA 1NJXA 3DRRA 5JS1A 4E7KA 4B08A 4IG0A 2HW3A 4FXDA 2Z1HA 1BISA 1VSLA 3SUOA 5C42A 1UA1A 1REVA 3O3HA 4CEAA 3LP2A 4CJPA 4DS5A 4DTXA 1CXQA 2HB5A 4Z4HA 1SKWA 4CJKA 4OVLA 1XI1A 2YHAA 3TAGA 1IKWA 2G8VA 3AA3A 4DF8A 4BDZA 4HUGA 1RT2A 3KD1E 3QIOA 1QSYA 4KHWA 1BQMA 4LY7A 3SUPA 1HQEA 4DS4A 1EP4A 1LAVA 2Z1JA 3MAQA 2BE2A 2FBYA 4AILC 1G15A 3SUQA 2IDOA 5KGWA 2G8FA 4B8AB 1TKXA 3V1RA 1JXBA 3TAFA 3CG7A 1X9MA 1WSFA 3B6PA 1FXXA 5JS2A 4HUFA 4GW6A 4F2RA 3DLGA 5CZ1A 3NGZA 4QAGA 2X74A 2OYQA 4N76A 2XY8A 5SWMA 1VK0A 3DYAA 3CYMA 4BE0A 4F8RA 3ZT0A 5I42A 3KKSA 4MFBA 3KK2A 3PO4A 1U49A 3TANA 4FJGA 2Y1JA 5J2QA 4Z4IA 1RT4A 5HP1A 1NK8A 1LWFA 3DLHA 1ZBHA 5I3UA 3QEWA 3G10A 4BE1A 4CHZA 4Z4GA 1BIZA 1TV6A 3L8BA 2QKBA 1C1BA 1ASVA 2FBVA 4OGCA 4I2QA 4CEZA 3K5OA 3EZ5A 1U48A 1RBUA 1ZBUA 3T1AA 1CZBA 1L3VA 4Z4EA 2IAJA 3V9UA 4Y1DA 3DRSA 3V9WA 4FJHA 4I9QA 4KRFA 2VWJA 4CF2A 4EZ6A 3LPUA 4C8KA 4CERA 3LAKA 3QESA 1T05A 3UIQA 2OPRA 4B8CA 3SQ0A 4DTSA 5D3GA 3QEVA 2YNIA 3SNNA 4PQUA 4E3SA 3O4NA 2DFHA 3ZSOA 3FFIA 4CGIA 3BDPA 3A2FA 2PY5A 3OYHA 4AHVA 4B3OA 3AA4A 3OYLA 5EU7A 3AO3A 3KLHA 3E01A 4QCLA 1IKYA 3NFAA 5J2NA 2WOMA 4CJVA 4CF1A 3ULDA 1Q9YA 1YTAA 1VSDA 2RKIA 2WONA 4CESA 4FZZA 4DLEA 2HHQA 5CYQA 3SQ2A 1JLQA 4CEFA 4E7IA 4JLHA 2KW4A 4F2SA 4Q5VA 2D0AA 3AVJA 3CM6A 5CY4A 3ZT4A 4CJUA 4Y1CA 3M8RA 4DWIA 1ZBLA 3U6FA 3SV4A 1QSSA 3CM5A 4NCAA 2X78A 3NF7A 4KFBA 4CJEA 1RDDA 4E7JA 2OZSA 4DSJA 3OYIA 4FVMA 3MECA 1C0UA 5KGXA 4KV8A 3HXMA 1HYZA 2AJQA 2VG6A 4PA1A 3DLKA 3V9SA 3S3OA 2F8TA 3AA2A 4Q0BA 1BCMA 3S9HA 3O3FA 1HNVA 1RTHA 3HL8A 4I7FA 2XY6A 4PWDA 4FK0A 1VSEA 1LW2A 2ZE2A 2HHWA 3AVNA 3RMCA 3RWUA 1NK5A 1WSIA 4YFUA 3LZIA 1J5OA 4W5TA 5E41A 2HNDA 3QEIA 1TKZA 1Q8IA 1NK6A 2QXFA 1ZYQA 5HLFA 2XHBA 1C1CA 1X9WA 4B9LA 4H4MA 5HRPA 3QO9A 3O3GA 2IOCA 4O4GA 4PY5A 4BWMA 3V1OA 1NOZA 3KIOA 2HNZA 4M45A 5CYMA 1LWCA 2HHXA 3RMBA 2FBTA 1WNSA 1RCHA 5C25A 3U3YA 1LAWA 2D5RA 3P5JA 3WNGA 1QE1A 2Q3SA 3WNHA 4DFPA 4OLBA 4FJLA 4B9NA 2YHBA 2IC3A 3AVFA 1JLEA 5J2PA 4AHSA 3QINA 4JS5A 1VRTA 1SUQA 3LDSA 4HCCA 3C95A 3CFPA 4FJ7A 2F96A 1JLAA 3L3VA 2B4JA 4DQIA 1S1WA 3ZSVA 2YKNA 5SZTA 2XY7A 4KHUA 1VRUA 3NBPA 1NKCA 3KTQA 5KRSA 1DTQA 4ID5A 3HP9A 3ZSRA 3IAYA 3VQPA 2GUIA 4FW2A 4DU1A 4M3RA 1J54A 4GMJB 3OYGA 3EY1A 4DTPA 2G8UA 3H08A 1WAJA 3IS9A 1FK9A 3NF6A 3KKRA 2B5JA 3OYKA 4KREA 3V9XA 1NK9A 4IKFA 5FRNA 3BGRA 3QNOA 3CQ8A 1NK7A 3ZSQA 4DMNA 2OPQA 3OYMA 1IKVA 2X6SA 4E7LA 1DTTA 3AO1A 4WE1A 3NH2A 3OY9A 3HPHA 5HRSA 2I5JA 1C0MA 4NYFA 4ZTFA 1JL2A 3WNFA 3RRHA 4C8LA 4CHQA 4W5OA 4FM1A 3I8DA 1S1VA 1BIUA 1EXQA 1D9FA 1ASUA 3NGYA 3LP1A 3NAEA 1C1AA 4EP4A 1TAQA 3MXMA 3LWLA 1NOYA 3TAEA 4ID1A 4O0IA 4AHRA 3MEDA 5FROA 3KJVA 2Z1GA 1L3SA 2PYJA 3VA3A 4IG3A 3TAPA 3MEEA 3VQDA 4CIFA 1RTDA 4OPJA 2HHUA 1RBVA 4JS4A 4R5PA 1RBSA 4FW1A 2YKMA 3VQ5A 1RDAA 3CFOA 3HVRA 4FLXA 4FLWA 5HROA 1NK0A 4E0DA 4HCBA 2HHTA 4FLZA 2P51A 3D45A 1XC9A 1TK8A 2YNFA 2VWKA 3L3UA 1KSPA 3L2UA 2HMIA 2D0CA 3AO4A 1UA0A 1U45A 1NKBA 4FJJA 4CGHA 4FK4A 1VSJA 4RW4A 4M3TA 3ALYA 3OYBA 4CHNA 4FLUA 4K8ZA 4IFYA 4IDKA 4E7HA 1BHLA 4CK1A 4RW7A 4CFCA 1B9DA 4LH4A 3K57A 4DTNA 1N5YA 3TAQA 2A1RA 1HYSA 1BCOA 5DK5A 4JRQA 1TAUA 2OPPA 4NYNA 4DG1A 1CZ9A 5J1EA 5HBMA 3DLBA 4RW8A 4ZTJA 3LALA 3VQAA 3DLRA 3ZT1A 5KI6A 4DU3A 4DTJA 2O4GA 1HPZA 1JLFA 3MXIA 1C0TA 4CJQA 2ITGA 2FBXA 3AV9A 1TGOA 4F3OA 4CGDA 5CZ2A 3SUNA 4FJ8A 1SKRA 3ZSZA 1ITGA 1WSJA 1TK0A 1IG9A 1BL3A 1FKOA 3P83D 1S9EA 3QIPA 1HMVA 3VQ4A 1TKTA 1T8EA 3DOLA 2OZMA 4FZYA 2KZMA 2XO7A 4NCBA 1KTQA 3AVHA 1BI4A 1LW0A 1X1PA 3AVAA 4GVMA 3K5NA 4HTUA 3U3GA 2P5GA 4FJIA 4FM2A 4KTQA 4K8XA 4CK2A 5HRNA 3V81A 4RW6A 1RBRA 1EKEA 3VQQA 1I39A 1W0HA 4B9SA 2E6MA 3V6DA 1U04A 3KLIA 1RILA 4LSLA 4O44A 4NCGA 2G8WA 3OJUA 1UOCA 1VSHA 3SJJA 2F8SA 3ZSYA 1KVCA 1B9FA 2JGUA 4AH9A 3OYDA 3F73A 3DLEA 3OYCA 3SPZA 1TL1A 4FJ5A 4KHYA 4OPKA 2P1JA 3RMDA 3TAMA 3JSMA 3VQ7A 2EX3A 3RTVA 4OGEA 4DTUA 1D9DA 3L2RA 3VN5A 1IO2A 3NGIA 3SI6A 2G8HA 1FKPA 1SKSA 3HYFA 3NF9A 3RRGA 1IKXA 2NUBA 4C8MA 1QQCA 1S5JA 3AVCA 1GOCA 3QLHA 3ZT2A 3NCIA 2P5OA 3V4IA 3OYFA 4RW9A 3PUFA 2BDPA 2HHVA 3IG1A 4KTZA 4M41A 4FM0A 1RT5A 2HVHA 4EZ9A 4CJTA 3VQ6A 4CGFA 4N56A 4CEQA 2VG7A 1L3TA 4MQ3A 3HO1A 1VSKA 4ELVA 5HRRA 3C6UA 4JRPA 4FCYA 3ASMA 3EYZA 4J2DA 1ASWA 4CF9A 4F4KA 4H4OA 3AVLA 2KTQA 3OYJA 3AVKA 2IS3A 4LH5A 3K58A 5J2MA 3TABA 1T03A 4KB0A 3TR8A 4DQRA 1A5XA 4DSIA 2YNHA 1WSHA 1Z26A 2VG5A 3T19A 3ZSXA 4CECA 3PV8A 3PX0A 2RN2A 1KVBA 1QSLA 2A1SA 1JLCA 3VQBA 3HPGA 4KAZA 4KPYA 4KHQA 4BACA 3OVNA 3OS2A 3HPOA 1L3UA 5FDLA 4FZXC 1K6YA 1KFDA 2Z1IA 4Z4CA 3S3MA 1WAFA 1KRPA 3KD5E 3AVGA 4CE9A 2E4LA 4N47A 4G1QA 2DFFA 4TSXA 4DU4A 2GBZA 1EX4A 3NH1A 2XRIA 2HHSA 3SYZA 3P1GA 3MXJA 1J53A 1CXUA 1JLGA 3VQCA 3L2WA 3AVBA 3SZ2A 3TI0A 4FJ9A 1RT6A 3DM2A 3M8SA 3LWMA 4ICLA 3CFRA 1EETA 3MEGA 1JLBA 1LV5A 1WSEA 3K5LA 3RR8A 4O0JA 2FC0A 3THVA 3AO2A 4LD0A 5C24A 1ZBFA 1R0AA 3KK1A 2B6AA 3V1QA 4CGGA 3VQ9A 4DFMA 2QKKA 1C6VA 4M3YA 1BQNA 2IGIA 3NDKA 1TK5A 4DSKA 1VSFA 1WLJA 1GOAA 4AHUA 3K59A 3QERA 4PUOA 1VSMA 4DTMA 4N41A 1SL0A 4UQGA 2HNYA 3LP3A 4CF0A 3I0RA 1GOBA 3NH0A 4CK3A 1CLQA 1RT3A 4E1MA 3SPYA 4E1NA 1RT7A 3HM9A 1NKEA 4CEDA 1JL1A 4FJXA 3WNEA 4DSEA 3NE6A 1J9AA 5K14A 1TVRA 4CJWA 4CFDA 1S1TA 4YNQA 3V9ZA 2OA8A 3NF8A 1S6QA 4ZHRA 4BWJA 3SQ4A 4KI6A 4B9TA 1B92A 4OKEA 3K5MA 3PO5A 2DY4A 1I3AA 1A5WA 3LAMA 3ISNC 3M8QA 2BANA 4CEOA 4FLYA 4AHCA 4M3XA 4CHOA 4OKKA 1SL1A 2Y1IA 3OS0A 2O4IA 3DOKA 3QNNA 4M3ZA 1TL3A 1S1UA 3AO5A 4L8RB 2OPSA 1NJYA 4KB1A 3K2PA 4CJFA 4QOZB 1RTIA 4CEEA 2LSNA 4DQPA 3AVMA 4KO0A 1RDCA 3OYNA 4H8KA 4LSNA 1F21A 3NHGA 4CJ5A 4DTOA 2G8KA 3ZCMA 3HVTA 4O55A 4CFBA 1KFSA 3I0SA 2RF2A 3C6TA 3IRXA 4CJ3A 4B9UA 4KI4A 4M42A 4IFVA 4FJKA 2HVIA 3PY8A
chains in the Genus database with same CATH superfamily
3L2VA 3TARA 3LDOA 4DFKA 1Q81O 5FRMA 4KTWA 3JYTA 3KK3A 1LWEA 4DV6K 4DFJA 1NGDA 1BGXT 3O9RA 3O8MA 4CHYA 3QFUA 3WT0A 3EE8A 4FLVA 2V51B 1VQPN 4DF4A 1Y97A 4CJSA 1HQUA 3R3LA 5BN9A 4WYBA 4FJMA 1QS4A 4KKOA 3FZLA 3VMFB 2ZD1A 4YDUC 1MU2A 1X9SA 4FJNA 1X3NA 4FLTA 3WUHA 1SV5A 1HPMA 4B1ZA 4CFAA 3A5NC 3HT3A 3E66A 4BDYA 2QK9A 3UKUA 2A41A 4BRFA 2D0OA 4WQ4C 3OBYA 3SV3A 4KHPK 3PSFA 2OCEA 5KRTA 3RR7A 1HR0K 3SCXA 4KB1A 3OS1A 3G71N 3F9KA 1OKJA 4DQSA 4F3TA 1NJZA 3G0ZA 3O9SA 3CCUN 1U2VB 1XWLA 3IUCA 3DI6A 4C8NA 4BR7A 3HSTB 4BR0A 1A5VA 1BUPA 1HNZK 4Z0UA 1YF5L 1KLNA 4J2EA 5BN8A 2F4VK 4IO9L 5GINA 2W42A 1HUXA 2ATQA 3EE9A 4ELTA 1GLJO 1UAXA 2RPIA 3SK3A 1VQ9N 4NO7A 1G99A 5JS1A 3D2FB 4IG0A 4FXDA 1VSLA 3WQUA 1H1VA 3LP2A 4CJPA 2YHWA 4FVUA 4K0KK 4BRAA 4CJKA 4O8UA 2YHAA 3TAGA 1BA1A 4JKGA 4BDZA 3KD1E 1RT2A 4KHWA 5AQNA 1NGBA 3H3OB 4A2AA 2NRHA 2Q36A 3B6PA 3DXKA 4F2RA 5CZ1A 4QAGA 2CH5A 4B3RK 2X74A 3JXUA 2OYQA 4H5RA 3O5BA 5SWMA 1VK0A 3DYAA 3CYMA 3ZT0A 5I42A 1NGEA 1E3MA 1U49A 4FJGA 4Z4IA 1WBBA 1RT4A 4JHDA 2VGMA 2V7YA 2HF3A 5GAGP 3DLHA 3L4QA 1VQON 4CHZA 4BRHA 4CEZA 5AQKA 3K5OA 3EZ5A 2KHOA 1RBUA 1CZBA 4Y1DA 4I9QA 4CERA 3LAKA 1IV0A 3OTOK 4B8CA 4DTSA 4O5FA 3SNNA 2YNIA 3NMUA 1OH6A 2Q31A 4PQUA 3ZSOA 4CGIA 5KPZA 3BDPA 4AHVA 1YJNN 3AA4A 3OYLA 2HF4A 3TTCA 3VERA 1IKYA 2WOMA 4CJVA 4J8FA 4DLEA 5CYQA 1JLQA 4CEFA 4E7IA 4GVEA 1BO5O 4KH6A 1Y64A 4IJAA 3M3ZA 3U6FA 3CM5A 4NCAA 3NF7A 2OZSA 4E7JA 2AJQA 3V9SA 2F8TA 3AA2A 1BCMA 1HNVA 1NGJA 3E9LA 1LW2A 2ZE2A 4IXCA 1DGKN 4YFUA 4KH5A 4YOXA 5E41A 2HNDA 4H5NA 3QEIA 2P9SA 1TKZA 2QXFA 4E1JA 3QO9A 3C0BA 3CC7N 2CGKA 4KBOA 5AFUH 2HHXA 1WNSA 3WNGA 3WNHA 1ATNA 3A0IX 4FJLA 3AVFA 1BG3A 1VRTA 4HCCA 3CFPA 1JLAA 3ZX2A 3ZSVA 2QEXN 2UUBK 5AFUA 1NKCA 1Q7YO 4ID5A 3ZSRA 4FOEA 3IAYA 2GUIA 1BOTO 4DU1A 4KH4A 4JKGB 3P39A 4GMJB 3CC2N 2G8UA 2W40A 3IS9A 1FK9A 4BR2A 1K9MO 3M1FA 3V9XA 4IKFA 2ASPA 3QNOA 3CQ8A 1NGFA 3DXKB 3OYMA 3DXMA 1IBKK 4JV5K 1DTTA 4WE1A 3NH2A 3OY9A 3HPHA 4DHYA 3IKMA 2RE2A 4C8LA 4W5OA 1ASUA 2I7NA 3CJ9A 3QMLA 4JHDB 3SBGA 1TAQA 5BPMA 2HBKA 3EZWA 4AHRA 3KJVA 2PYJA 4IG3A 3MEEA 4YOWA 1GLLO 2GWKA 3ATVA 1RBVA 4GY2B 3J81O 4BC4A 4GV3A 1VQ4N 3HVRA 4E0DA 4FLWA 2QA4N 2QWQA 2VWKA 4JKHA 1GLFO 2QWPA 1U45A 1QVGM 1NKBA 4CGHA 5KQDA 4FK4A 4K41A 2AP1A 1FJGK 3OYBA 4FLUA 2D4WA 1K8AO 2E2OA 2W6KA 4JKEA 1B9DA 3CMEN 1N5YA 3TAQA 4BR5A 2A1RA 1HYSA 3HI0A 4YY3K 3DLBA 3L4IA 4DTJA 3VEOA 1JLFA 3Q7BA 3O80A 2QWLA 3WXKA 4CI6A 3TSPA 1N36K 5AQMA 1IG9A 2P9SB 3F5TA 3ZYYX 3VQ4A 1HMVA 2OZMA 1YJ9N 5GAEP 2P9UA 3AVHA 3AVAA 4DR2K 4XH4A 4KHUA 3U4LA 2P5GA 4FJIA 4K8XA 3CPEA 5C12A 3H3NO 2E20A 1OVYA 3CJ1A 1W0HA 4JI2K 3KLIA 4NCGA 4MLHA 4NLCA 1B9FA 4AH9A 5GIOA 3BZKA 1C0GA 5M1QA 3VQ7A 4JI3K 1IO2A 3SI6A 4BGBA 3WXLA 2YJEA 2NUBA 3V4IA 3OYFA 4RW9A 3PUFA 3J7AP 3IG1A 4FM0A 4EZ9A 3GOIA 4N56A 1VSKA 4A57A 5HRRA 3C6UA 4FCYA 3EYZA 4IOAL 3GE1A 3AVLA 3DXMB 2IS3A 4LH5A 4K25A 3O9UA 3VGMA 3K0SA 5J2MA 3TR8A 4DQRA 1BU6O 5EXWA 3PV8A 3ZSXA 1JLCA 3HPGA 4KHQA 1L3UA 4FZXC 1KRPA 1WAFA 3O9QA 5AQPA 2OANA 4TSXA 2GBZA 2O8BA 2HHSA 5AQSA 3CMAN 3FZHA 3MXJA 2E1YA 1JLGA 4DV4K 5BPLA 4MDBA 4LC9B 4DR3K 1EETA 1LV5A 3T1YK 4PL7A 4CZIA 3THVA 5C24A 3KK1A 2B6AA 4WFBL 3N4QA 1KQSM 4M3YA 2IGIA 4PUOA 1GOAA 5AQOA 3K59A 2V7ZA 1VSMA 4N41A 2HNYA 4M7XA 1GOBA 1NKEA 4CEDA 4CW7B 4CZKA 1JJ2M 5K14A 2YI1A 4ZHRA 4JI0K 1B92A 2HBJA 1A5WA 3ISNC 2VWBA 3C7NA 4CZFA 3ID8A 1MDUB 2NRVA 3SAGA 4M3ZA 4L8RB 3FZKA 2ZJRL 1ZXOA 4CZJA 4DQPA 3NHGA 4DTOA 3ZCMA 1NM1A 2F8SA 3C6TA 4BRLA 4JI8K 1V4TA 4IFEA 4H5TA 5ELZA 4LF6K 2P9UB 2ETJA 3R1XA 4N5SA 2IVNA 5LY3A 2YV0X 3TWHA 4KHNA 1W9HA 4DLGA 3H1QA 5DMRA 4HVJA 1YT3A 1S6PA 1RT1A 1U47A 4B1YB 3ZX0A 1NK4A 3VEVA 1VSIA 3G25A 1UWBA 4WQ5A 4E19A 1XHZA 1S1XA 4OJRA 4BE2A 3CHWA 4CVNE 1ZBSA 4BRDA 1VAZA 3CI5A 3SQ1A 3HJFA 4A5AA 3PX4A 1S9GA 3DRPA 1P90A 3DWLA 3MMVA 4FOIA 3THWA 3C94A 4CJ4A 5F0XA 4DQQA 3ITHA 1ILYA 1WB9A 2WTUA 1Z25A 3UKRA 3A5MC 3A8YA 4IBNA 1YTUA 1T44A 1D5AA 3VESA 4AHTA 4XIUA 1NJWA 4UY8O 1C0FA 3CJ7A 1RTJA 3AA5X 1W7AA 4M3WA 3HP6A 4NLBA 2KQ2A 3LANA 4I2PA 3C65A 3L2QA 3I56N 2F9TA 4FK2A 3H45C 4QS9A 2G8IA 4J2BA 2O8BB 1YVUA 4J2AA 2P9NA 1IH7A 3J80O 3TTFA 4FWQA 1JCGA 3D0PA 4B3SK 4FYDA 3ZSWA 3OYAA 3BY5A 4BQZA 5C0YA 4I9LA 4O5BA 3DRRA 2FF6A 4B08A 3FLCO 1Q86O 5LMUK 1BISA 2AA4A 4R79A 3W3DA 3O3HA 1SKWA 4OVLA 3ZLJA 4RCHA 1IKWA 4JK7A 2G8VA 1DEJA 1YHQN 1HJOA 4NXMK 3SAFA 4LY7A 1HQEA 4DS4A 1EP4A 1NMDA 2A5XA 3FE1A 3SUQA 5BPNA 1N33K 4B8AB 1TKXA 3V1RA 1JXBA 1VQMN 4BQLA 3TAFA 3CG7A 1QQMA 5BR9A 3DLGA 2QWNA 3C7NB 2XY8A 4DV1K 4F8RA 4C1NI 3HZ6A 5E26A 4RTFD 2KKZA 4BRIA 3KK2A 3TANA 1XNRK 1V4SA 3O6WA 4BRPA 2Q2RA 4CZHA 3HM8A 3IDHA 1ZBHA 3G10A 4BE1A 1GLCG 5LJWA 3L8BA 1ASVA 2FBVA 3T1AA 2ZJQL 2IAJA 3V9UA 3VGLA 2VWJA 4EZ6A 4C8KA 4IEEA 3D6RA 2YX6A 4E3SA 4AF1A 3FZMA 1M90O 2VQEK 3VTHA 3W0LA 1SAZA 3ZX3A 5C2FA 3E01A 4QCLA 1Q9YA 4CF1A 3ENHA 4A61A 1VSDA 2RKIA 4CESA 2HHQA 3SQ2A 2GTDA 1RDWX 2D0AA 3AVJA 3CM6A 5CY4A 5KPTA 4DWIA 1ZBLA 3CETA 3E9PA 1J6ZA 3OYIA 3IMXA 4KV8A 3HXMA 3THWB 1HYZA 4BY9C 2QWOA 3NVMA 4PA1A 3DLKA 3UKRB 4M63C 3O3FA 2XY6A 3AVNA 1NK5A 4W5TA 3QBXA 5CHIA 4DR7K 4PKIA 1C1CA 4B9LA 4IOXA 5HRPA 4U67L 2IOCA 4V19S 3IFRA 5HL7L 2ZM6K 2HNZA 2PFUA 5AZIA 4M45A 5CYMA 2OTLN 3T7ZA 3KZBA 3LDPA 2P9NB 4FSVA 4ISEA 5C25A 2D5RA 3OHRA 1QE1A 4DFPA 1JLEA 1XUPO 2CGJA 4JS5A 1SUQA 3LDSA 4BC2A 2W41A 2ASOA 4FPBA 5DM6L 3L3VA 4IJNA 2XY7A 4JI6K 1KC8O 1DTQA 2Q97A 4NB4A 4JD2A 3VQPA 1EO1A 4ILJA 4JYAK 3AAPA 4DTPA 3H08A 3NF6A 1EQYA 2B5JA 1NK9A 1BWFO 1NK7A 3ZSQA 3F9MA 1VHXA 5EOYA 5AQTA 3OA9A 4DMNA 3FR0A 3AO1A 4NYFA 1T6DA 1JL2A 3WNFA 4CHQA 3I8DA 4YOTA 1EXQA 4BRKA 1D9FA 5A2QO 3LP1A 3NAEA 3WXJA 4FWOA 5CR4A 1NOYA 4CZEA 4ID1A 4O0IA 3U8XA 2GUPA 2Z1GA 3VA3A 3TAPA 4GKKK 3VQDA 1HLUA 2HHUA 1HKGA 4JS4A 1XQSC 4BC5A 3VF2A 2YKMA 2NRZA 3CFOA 1WBDA 5HROA 4JKAA 3JS6A 2P51A 3D45A 1XC9A 1Q18A 2YNFA 3L3UA 1UA0A 5FPDA 1IG8A 1VSJA 4RW4A 1NG9A 5HOOA 3ALYA 4M3TA 4K8ZA 4IFYA 4BG8A 4RW7A 4CFCA 4LF5K 4LH4A 2YHXA 3EEQA 5DK5A 5DM7L 4DG1A 4B9QA 5J1EA 1NJIO 3ENOA 4RW8A 2P9IA 4WCEL 3DJCA 3CQYA 4JI7K 4DB3A 1HPZA 5GAHP 2ITGA 3QFPA 3VEZA 1OH5A 4F3OA 1DT9A 5CZ2A 3SUNA 4FJ8A 1SKRA 4FWKA 3ZSZA 4GNIA 5C10A 1BL3A 2KZMA 1IBMK 5TKYA 1BI4A 1LW0A 2JWKA 3KHYA 4HTUA 5JMVA 4FM2A 4OX9K 3QB0A 3G6EN 1I39A 5AZIB 2E6MA 3V6DA 4LSLA 4O44A 3OJUA 1UOCA 1VSHA 4WQ5C 1KVCA 1SS6A 2FSNA 3OYCA 4FJ5A 3RMDA 3JSMA 1XMQK 2EX3A 3SAHA 4OGEA 2NRRA 2G8HA 1FKPA 5AQHA 1SKSA 2NRXA 1X3MA 4IDHA 3NF9A 3RRGA 1IKXA 2HMPA 1QQCA 1S5JA 4C23A 4IEIA 3NCIA 2P5OA 4JD2B 4OPHA 2HHVA 4JK9A 1RT5A 2HVHA 3HTVA 3VQ6A 2D0PA 2VG7A 1BA0A 4ELVA 4EAHD 2A42A 1NBWA 2CH6A 4FWMA 3CCJN 4H4OA 4F4KA 2KTQA 2IVPA 1RFQA 3K58A 4KB0A 4H0TB 2A1SA 4KPYA 4H03B 3CQXA 3AARA 3OVNA 2J4RA 3OBWA 3P38A 4G1QA 3EO3A 1EWQA 3NH1A 1ZC6A 2HSTA 5LMNK 4JKCA 3LL3A 3P1GA 1CXUA 3SZ2A 1YUWA 2NNWA 4IOCL 1JLBA 1WSEA 3K5LA 3LM2A 3R9PA 3M5RA 3CJCA 4CZGA 4DUZK 2P9LA 1C6VA 3ATUA 3I8BA 4PWDA 2RHKA 3QERA 3MDQA 4UQGA 3LP3A 5BRDA 3NH0A 4E1NA 4FJXA 3JAMO 1JL1A 4DSEA 3SMSA 4CJWA 1XC3A 1TVRA 3SQ4A 1XNQK 4OKEA 2P9IB 3K5MA 4CEOA 4OKKA 2O4IA 3OS0A 1S1UA 1W2BM 3G4SN 4QOZB 2LSNA 3OYNA 1RDCA 1KD1O 4H8KA 2G8KA 4CFBA 4O55A 3I0SA 2RF2A 3IRXA 2VYPA 4B9UA 4FJKA 2HVIA 1O1WA 4B3MK 4KHSA 2E2NA 1BI4B 1E4FT 1XHXA 2BGGA 4A59A 1YJWN 3VGKA 2KZZA 5KTQA 1KVAA 4DV5K 4CIEA 2FLOA 3L6QA 2P9PA 3DAWA 4HUEA 5AQRA 2ZQBA 1QHTA 4DV3K 3KVGA 5KQ8A 4JI4K 2XY5A 1ZBIA 2E2QA 3MN7A 3VQEA 2X6NA 3KLEA 4FWPA 2UXCK 1QTMA 4CCHA 1WN7A 5LJVA 1T7PA 2E8AA 3SBTA 2IVOA 4C8OA 5IWAK 4ELUA 2ITMA 2D0BA 3OYEA 3B6OA 4FO0A 4AM6A 1N8RO 4BRGA 1L5UA 2PAVA 3PX6A 2KFNA 2ASMA 1DLOA 1JXEA 3ZEUA 4CGJA 2QKKA 4DSLA 1ATSA 3OW2M 2JLEA 3SLCA 3LZJA 3T3FA 2ZGZA 1WUAA 1TUUA 3MCAB 4BR4A 5T7BA 4EIAA 4E89A 2YNGA 4DR1K 4BDPA 1RNHA 4RG8A 3GL1A 5AQUA 3QICA 4W5RA 4B9MA 3HK2A 1KLMA 3BF1A 4CJRA 3S3NA 3DMJA 3CC4N 4IWVA 2JWLA 4GV9A 3A5LC 4FWNA 2E6LA 1JKHA 4CF8A 3U9DA 4CHPA 1U6ZA 4E7KA 2Z1HA 1REVA 1P8ZA 2YHYA 3C6AA 4BRCA 3WXMB 3A5OC 2P9LB 4B1XB 1YXQA 4DTXA 1CXQA 2HB5A 1XI1A 3TSUA 3AA3A 3ENBA 3J7ZO 3PIOL 4C1NK 1XMOK 1LAVA 2Z1JA 1X9JA 4AILC 2IDOA 3QDKA 5GIPA 1WSFA 5JS2A 1FXXA 4HUFA 2WC9A 3ID6A 4OO1J 3BP8A 4N76A 5M1KA 1LOTB 2VQFK 1SZ2A 3VENA 4MFBA 3PO4A 3MN6A 3CXCM 2UYTA 3D2EA 3CJBA 5J2QA 1NK8A 1LWFA 4AQYK 5I3UA 3QEWA 1NU0A 4Z4GA 4GKJK 1BIZA 1TV6A 2QKBA 4I2QA 4Z4EA 1T6CA 3DRSA 3V9WA 4KRFA 4CF2A 1NGHA 3QESA 1T05A 3UIQA 4FPAA 2OPRA 3SQ0A 5D3GA 3O4NA 3WEEA 2Q1NA 3FFIA 2ZJPL 3A2FA 4GV6A 4B3OA 2P9PB 5EU7A 3AO3A 5AQWA 3KLHA 4I6MA 3VEYA 4U7BA 1W97L 2WONA 2DPNA 4MDAA 3ZT4A 4CJUA 4Y1CA 3SV4A 2X78A 4KFBA 1KXPA 4ISGA 4LFCK 5AQLA 3S3OA 3THXA 4YORA 3S9HA 1SQKA 1RTHA 4I7FA 4A62A 1VSEA 3MX5A 2Q0RA 3RMCA 3RWUA 3ZEUB 1J5OA 5TKWA 1NK6A 1ZYQA 5HLFA 2UUAK 1QZ6A 4H4MA 4O4GA 1MA9B 4BWMA 2QW9A 1NOZA 2FBTA 4PKGA 1S3XA 4LF8K 2YCHA 3U3YA 1LAWA 1ESVA 2NZTA 4JN4A 2YHBA 3DLLL 2IC3A 4B1UB 4AHSA 4FJ7A 3E9OA 4DQIA 2BH1A 1S1WA 4PKHA 2YKNA 5SZTA 1VRUA 3NBPA 4MO5A 3KTQA 5KRSA 3HP9A 5F2RA 4K43A 1J54A 3EY1A 3VEXA 3CD6N 1WAJA 3KKRA 4KREA 2A40A 5FRNA 3R6MA 2HBMA 3BGRA 3K9JA 2OPQA 2X6SA 4FWSA 2I5JA 3L0QA 4O8KA 4FM1A 1RGIA 1S1VA 5LL6Z 1BIUA 4DR4K 3J7YP 3D2EB 1NGGA 1IJJA 3ULEA 1JCFA 3TAEA 3MEDA 5FROA 2UXDK 3O1WA 4DV7K 4OPJA 3AGKA 4R5PA 1RBSA 1NK0A 2HHTA 2V52B 5AR0A 4FLZA 3WEEB 3RSEA 1KSPA 2HMIA 1J5EK 3M6GA 4I6MB 4LFBK 4CHNA 3EL2A 4IDKA 1BHLA 5EX5A 1BCOA 4JRQA 2OPPA 1CZ9A 4ILGB 4ZTJA 3LALA 3VQAA 5BRHA 4CD1A 3O4WA 5KI6A 4DU3A 3CCEN 3MXIA 3THXB 1I94K 2FBXA 4CGDA 2O8EA 5FPNA 1ITGA 5BR8K 5GADP 3QIPA 3CIPA 1T8EA 1S9EA 4FZYA 1TKTA 2P9KA 3DOLA 3MX2A 2FXUA 2XO7A 4NCBA 1KTQA 4XH1A 2CGLA 1X1PA 3K5NA 4KTQA 4BVPA 3V81A 4RW6A 1RBRA 3VQQA 1RILA 2G8WA 4JAXA 3SJJA 3ZSYA 4ILHA 4FWLA 2JGUA 3OYDA 1TL1A 3C6HA 4KHYA 4OPKA 4BRMA 4DTUA 3RTVA 1BDGA 1D9DA 3VN5A 3NGIA 3HYFA 4C8MA 1GOCA 3QLHA 1OH8A 2BDPA 2W6LA 4M41A 4KTZA 5AQXA 1Z05A 5M1NA 1OVQA 4CJTA 2UUCK 1L3TA 4CEQA 3HO1A 4BREA 5B8HA 4JRPA 4X65K 3ASMA 4Z94A 4BGAA 4J2DA 4CJ7A 3CF5L 1O13A 4EHUA 1KAYA 3H1VX 4WF9L 2E2PA 1T03A 3TABA 4AM7A 4IZ9A 4DSIA 3AAQA 2VG5A 3PX0A 1QSLA 1D4XA 2RN2A 3VQBA 3FZFA 3HOSA 2QWRA 4BACA 5FDLA 3MN9A 1K6YA 1KFDA 2Z1IA 4Z4CA 3S3MA 4CE9A 2O8DA 3ULEB 4N47A 5M1FA 2QWMA 2XRIA 3EN9A 1WOQA 4HTLA 2I7PA 4DR5K 2NRWA 1NGCA 3AVBA 3TI0A 5ADXH 3DM2A 3M8SA 3LWMA 2E5LK 3CFRA 3MEGA 1MWKA 4A5BA 5JLFA 3RR8A 2FC0A 1R0AA 3RSEB 3V1QA 4CGGA 3BZCA 1TK5A 3P4IA 1SL0A 5C2DA 5ADXA 3EKSA 4CF0A 3I0RA 4BG9A 2A3ZA 1CLQA 1RT3A 5MLCQ 1RT7A 3WNEA 3NE6A 4DQ8A 4YNQA 4CFDA 2OA8A 2FSKA 3NF8A 1S6QA 2QTDA 4H0VB 3TTDA 4PL8A 4B9TA 3PO5A 4CBUA 3LAMA 3M8QA 4LF7K 2BANA 4FLYA 4M3XA 4H0PA 4CHOA 2Y1IA 3AO5A 2BUPA 1NJYA 3K2PA 4CJFA 4CEEA 2O8EB 4KO0A 1F21A 4CJ5A 3LDQA 3HVTA 1GLBG 4M42A 2P9KB 4DSFA 1D8YA 3M8PA 3THYA 3VF4A 3KLGA 1HNIA 3QETA 2PZSA 1HRHA 4HHTA 3AVIA 4OKJA 3KWGA 2EHGA 1YITN 2DTUA 5JVHL 1U4BA 1YVNA 3TSQA 4DTRA 4W5NA 2NRTA 4H5WA 4W5QA 5C15A 4OLAA 5AQIA 3UKUB 1RBTA 1DKGD 1HYVA 3TU5A 4WFAL 2GEMA 1SL2A 4NXNK 3BF3A 1TKDA 2KFZA 5BRFA 3O08A 3O4QA 3ZT3A 3CPWM 3OJSA 4Z4FA 5AQJA 3KWIA 3LP0A 2R7YA 4EP5A 4B9VA 4CIGA 1HJRA 4CEBA 1N6QA 4M3UA 3QEXA 1WSGA 5H1SQ 2A6AA 3SMPA 3VQ8A 3MK6A 3RMAA 4CJLA 2DFEA 3LDLA 3VA0A 4MLEA 3KLFA 1MWMA 3UB5A 2E88A 1Q9XA 2O8DB 3LPTA 2PYLA 3O1BA 2F7TA 3QEPA 2GV9A 5AQVA 3NVKA 1KCFA 1NNEA 2O8CA 1NJXA 1RDBA 1QHAA 2HW3A 3SUOA 4H5VA 5C42A 1UA1A 3CERA 1GLDG 2IIRA 4CEAA 4JI5K 4YOVA 4DS5A 4Z4HA 1IBLK 3CCRN 4B1WB 3R8EA 3MN5A 4DF8A 3QBWA 4HUGA 3QIOA 1QSYA 1BQMA 3SUPA 2KLAA 3I55N 3MAQA 2BE2A 2FBYA 4JKBA 2G8FA 1G15A 5KGWA 4JNEA 1GLEG 1X9MA 4GW6A 4BVOA 3NGZA 3BUZB 4BE0A 3GBTA 1T3VA 3KKSA 1YI2N 5CE3A 2Y1JA 5HP1A 1QVFM 1GLAG 2FF3B 5I9EB 1C1BA 4OGCA 3U9ZA 1U48A 1ZBUA 1L3VA 3LM9A 3THYB 2HHHK 4FJHA 3LPUA 2QI2A 2ZGYA 3F2KA 3FGUA 3QEVA 4FWRA 2DFHA 2GWJA 2PY5A 3OYHA 4BR9A 4JK8A 3CCLN 3NFAA 5J2NA 3VPZA 3ULDA 1YTAA 1NMNA 1VQKN 4FZZA 2GX9A 4F2SA 4JLHA 2KW4A 4YOUA 4Q5VA 4YDUA 1FW6A 3M8RA 1QSSA 4CJEA 4DSJA 1RDDA 4FVMA 3MECA 1C0UA 5KGXA 2EWSA 3BEXA 2VG6A 4Q0BA 4QS7A 2ZF5O 3HL8A 1K8KA 3WQTA 4FK0A 4WFNL 2HHWA 3P31A 4K42A 1WSIA 3N4PA 3LZIA 4WQ4A 1Q8IA 1QQNA 5IT9O 2FSJA 2NLXA 2WFBA 3K9KA 2XHBA 1X9WA 4RWTA 3O3GA 4PY5A 3V1OA 3KIOA 4YOYA 4JI1K 1LWCA 5AZJA 3RMBA 5AJ3K 1RCHA 3P5JA 2Q3SA 3KK7A 4OLBA 4X62K 4B9NA 3CCSN 5J2PA 3QINA 2H3GX 4DUYK 4DKWA 2O8CB 3C95A 3MWPA 2F96A 4IO8A 2GELA 2B4JA 3HRGA 4CZLA 1R59O 2WBNA 3GG4A 5JICA 4FW2A 1QZ5A 4M3RA 3S41A 3OYGA 3T69A 3OYKA 4OPAA 1VQ7N 4XH5A 1IKVA 4YHHK 1QQOA 4E7LA 5F1XA 5HRSA 1C0MA 4ZTFA 3ZETA 1VQNN 3RRHA 1JCEA 1KAXA 4XEIA 5EVZA 5JLHA 3CCMN 4BRQA 3VEWA 2O8FA 3NGYA 1C1AA 4EP4A 3MXMA 3LWLA 4CBXA 5EY4A 3T1HK 1TUYA 5AQGA 4BC3A 1L3SA 2VCPA 1LCUA 1OH7A 4CIFA 1Z6RA 1RTDA 2UXBK 5JVGL 4FW1A 3VQ5A 2D1KA 1RDAA 4FLXA 4HCBA 4X66K 4CD3A 4CZMA 1HNWK 1M1KO 4JKDA 3CJAA 1TK8A 1N34K 3L2UA 2D0CA 3AO4A 4JKFA 4DV2K 4FJJA 4E7HA 1TYQA 4CK1A 1YIJN 3K57A 4DTNA 1YAGA 1TAUA 1E4GT 2ZWHA 3AGRA 4NYNA 1K73O 1RDUA 3VTIA 3CCQN 5HBMA 1EWRA 2WUSA 3O9TA 3HOTA 5M1PA 5AQYA 3DLRA 3ZT1A 1VQ8N 5AQZA 3J8AA 2O4GA 4H0OA 1C0TA 4CJQA 1HKBA 5FPEA 4DR6K 3AV9A 1K8KB 1TGOA 3AY9A 1WSJA 1TK0A 1S72N 1FKOA 3P83D 3Q7CA 3TPQA 4FL9A 3E1YA 4H0XB 4LF9K 2HBLA 4GVMA 3U3GA 4CK2A 5HRNA 1EKEA 1NGAA 1NLVA 3B8AX 4F9OA 2VGNA 5AZJB 4B9SA 4L3QA 3H6EA 1U04A 4HWIA 4JEPA 3WXIA 4PHTX 3CCVN 2E1ZA 5AQFA 3F73A 3SPZA 3DLEA 3GDQA 4A2BA 2YJFA 2P1JA 3TAMA 4Y0WA 3RVCA 2OTJN 3L2RA 1N32K 1Q82O 3AVCA 3ZT2A 1VQ5N 3VOVA 5AQQA 3EKUA 4CGFA 1HX1A 4MQ3A 3PIPL 1VQ6N 3MCPA 4EFHA 1ASWA 2PBDA 4CF9A 5E84A 4LFAK 3OYJA 3AVKA 1A5XA 3ZETB 2YNHA 1WSHA 1Z26A 3T19A 4CECA 1S22A 1KVBA 4KAZA 5M1OA 2QM1A 3OS2A 3HPOA 1U2VA 1NGIA 2O8FB 3H46O 4BROA 3KD5E 3AVGA 2E4LA 2DFFA 4DU4A 4EHTA 1EX4A 3HSCA 4CBWA 3I33A 3SYZA 1J53A 4M7YA 3VQCA 4X64K 3L2WA 4FJ9A 2HOEA 1ATRA 1RT6A 5KPRA 1CZAN 4ICLA 3D2FA 3LDNA 2F9WA 5FLXO 4O0JA 4ISFA 1HKCA 5BREA 3AO2A 4LD0A 2QXLA 1ZBFA 3PSIA 3VQ9A 4DV0K 4DFMA 4DCHA 4QS8A 3SJHA 3D7EO 4BRNA 1BQNA 1HNXK 3NDKA 4DSKA 1VSFA 1WLJA 4AHUA 3VETA 3PLAA 4DTMA 4G9ZA 3VF6A 1TYQB 3HBTA 4CK3A 4E1MA 3SPYA 3HM9A 1J9AA 3V9ZA 3FFKB 3UE5A 3MWTA 1S1TA 4B1VA 4KI6A 4BWJA 4B3TK 2Q0UA 2DY4A 1I3AA 4AHCA 4H0YB 1SL1A 3DOKA 3QNNA 1TL3A 2OPSA 1NWKA 1VQLN 4MO4A 1RTIA 1KAZA 2BTFA 3AVMA 4LF4K 4LSNA 2UU9K 1KFSA 4KI4A 4CJ3A 5FPMA 4IFVA 3PY8A
chains in the Genus database with same CATH topology
4DSFA 1O1WA 3L2VA 3TARA 1D8YA 4DFKA 3M8PA 4KHSA 1BI4B 1XHXA 5FRMA 2BGGA 4KTWA 3JYTA 3KK3A 2ETJA 1LWEA 4N5SA 3KLGA 1HNIA 4DFJA 3QETA 2KZZA 2PZSA 2YV0X 1BGXT 1HRHA 3TWHA 4KHNA 1W9HA 5KTQA 4CHYA 4HHTA 3AVIA 4OKJA 1KVAA 2EHGA 4DLGA 4FLVA 4DF4A 4HVJA 1Y97A 5DMRA 4CJSA 1HQUA 4CIEA 2DTUA 1U4BA 1YT3A 1S6PA 4FJMA 1RT1A 4DTRA 1U47A 1QS4A 4KKOA 1NK4A 2ZD1A 4W5NA 1VSIA 1MU2A 1X9SA 1UWBA 4HUEA 4FJNA 4W5QA 4FLTA 4OLAA 2ZQBA 4E19A 1QHTA 1XHZA 1S1XA 1SV5A 2XY5A 4OJRA 4BE2A 1ZBIA 1RBTA 3VQEA 2X6NA 1HYVA 1SL2A 3SQ1A 3KLEA 3HJFA 4CFAA 3HT3A 3PX4A 1QTMA 1TKDA 1S9GA 1WN7A 3DRPA 1T7PA 4CCHA 2KFZA 4BDYA 3O4QA 3ZT3A 2QK9A 3C94A 4C8OA 4CJ4A 3OJSA 4DQQA 3ITHA 4ELUA 4Z4FA 3SV3A 1Z25A 2D0BA 3OYEA 3B6OA 5KRTA 4IBNA 1YTUA 3RR7A 3LP0A 1L5UA 1D5AA 2R7YA 4EP5A 3PX6A 3SCXA 1DLOA 4CIGA 1JXEA 4B9VA 2KFNA 4CGJA 1HJRA 3OS1A 4CEBA 4AHTA 4XIUA 3QEXA 1NJWA 1WSGA 1N6QA 4DSLA 4M3UA 2JLEA 3VQ8A 3LZJA 3T3FA 3RMAA 3F9KA 1RTJA 3AA5X 4DQSA 4M3WA 3HP6A 4F3TA 4CJLA 5T7BA 2KQ2A 1NJZA 3G0ZA 3LANA 1XWLA 4C8NA 3DI6A 2DFEA 4I2PA 3HSTB 4E89A 1A5VA 3L2QA 2YNGA 3KLFA 3VA0A 4BDPA 1RNHA 4Z0UA 1Q9XA 4RG8A 1KLNA 4J2EA 4FK2A 3LPTA 2PYLA 2W42A 2G8IA 4J2BA 4W5RA 2ATQA 4B9MA 3QEPA 1YVUA 1KLMA 4J2AA 3HK2A 1IH7A 2GV9A 4ELTA 4CJRA 3D0PA 1UAXA 3DMJA 3ZSWA 1KCFA 3OYAA 3S3NA 4FYDA 2RPIA 2E6LA 1JKHA 4I9LA 4O5BA 4CF8A 4CHPA 1RDBA 1NJXA 3DRRA 5JS1A 4E7KA 4B08A 4IG0A 2HW3A 4FXDA 2Z1HA 1BISA 1VSLA 3SUOA 5C42A 1UA1A 1REVA 3O3HA 4CEAA 3LP2A 4CJPA 4DS5A 4DTXA 1CXQA 2HB5A 4Z4HA 1SKWA 4CJKA 4OVLA 1XI1A 2YHAA 3TAGA 1IKWA 2G8VA 3AA3A 4DF8A 4BDZA 4HUGA 1RT2A 3KD1E 3QIOA 1QSYA 4KHWA 1BQMA 4LY7A 3SUPA 1HQEA 4DS4A 1EP4A 1LAVA 2Z1JA 3MAQA 2BE2A 2FBYA 4AILC 1G15A 3SUQA 2IDOA 5KGWA 2G8FA 4B8AB 1TKXA 3V1RA 1JXBA 3TAFA 3CG7A 1X9MA 1WSFA 3B6PA 1FXXA 5JS2A 4HUFA 4GW6A 4F2RA 3DLGA 5CZ1A 3NGZA 4QAGA 2X74A 2OYQA 4N76A 2XY8A 5SWMA 1VK0A 3DYAA 3CYMA 4BE0A 4F8RA 3ZT0A 5I42A 3KKSA 4MFBA 3KK2A 3PO4A 1U49A 3TANA 4FJGA 2Y1JA 5J2QA 4Z4IA 1RT4A 5HP1A 1NK8A 1LWFA 3DLHA 1ZBHA 5I3UA 3QEWA 3G10A 4BE1A 4CHZA 4Z4GA 1BIZA 1TV6A 3L8BA 2QKBA 1C1BA 1ASVA 2FBVA 4OGCA 4I2QA 4CEZA 3K5OA 3EZ5A 1U48A 1RBUA 1ZBUA 3T1AA 1CZBA 1L3VA 4Z4EA 2IAJA 3V9UA 4Y1DA 3DRSA 3V9WA 4FJHA 4I9QA 4KRFA 2VWJA 4CF2A 4EZ6A 3LPUA 4C8KA 4CERA 3LAKA 3QESA 1T05A 3UIQA 2OPRA 4B8CA 3SQ0A 4DTSA 5D3GA 3QEVA 2YNIA 3SNNA 4PQUA 4E3SA 3O4NA 2DFHA 3ZSOA 3FFIA 4CGIA 3BDPA 3A2FA 2PY5A 3OYHA 4AHVA 4B3OA 3AA4A 3OYLA 5EU7A 3AO3A 3KLHA 3E01A 4QCLA 1IKYA 3NFAA 5J2NA 2WOMA 4CJVA 4CF1A 3ULDA 1Q9YA 1YTAA 1VSDA 2RKIA 2WONA 4CESA 4FZZA 4DLEA 2HHQA 5CYQA 3SQ2A 1JLQA 4CEFA 4E7IA 4JLHA 2KW4A 4F2SA 4Q5VA 2D0AA 3AVJA 3CM6A 5CY4A 3ZT4A 4CJUA 4Y1CA 3M8RA 4DWIA 1ZBLA 3U6FA 3SV4A 1QSSA 3CM5A 4NCAA 2X78A 3NF7A 4KFBA 4CJEA 1RDDA 4E7JA 2OZSA 4DSJA 3OYIA 4FVMA 3MECA 1C0UA 5KGXA 4KV8A 3HXMA 1HYZA 2AJQA 2VG6A 4PA1A 3DLKA 3V9SA 3S3OA 2F8TA 3AA2A 4Q0BA 1BCMA 3S9HA 3O3FA 1HNVA 1RTHA 3HL8A 4I7FA 2XY6A 4PWDA 4FK0A 1VSEA 1LW2A 2ZE2A 2HHWA 3AVNA 3RMCA 3RWUA 1NK5A 1WSIA 4YFUA 3LZIA 1J5OA 4W5TA 5E41A 2HNDA 3QEIA 1TKZA 1Q8IA 1NK6A 2QXFA 1ZYQA 5HLFA 2XHBA 1C1CA 1X9WA 4B9LA 4H4MA 5HRPA 3QO9A 3O3GA 2IOCA 4O4GA 4PY5A 4BWMA 3V1OA 1NOZA 3KIOA 2HNZA 4M45A 5CYMA 1LWCA 2HHXA 3RMBA 2FBTA 1WNSA 1RCHA 5C25A 3U3YA 1LAWA 2D5RA 3P5JA 3WNGA 1QE1A 2Q3SA 3WNHA 4DFPA 4OLBA 4FJLA 4B9NA 2YHBA 2IC3A 3AVFA 1JLEA 5J2PA 4AHSA 3QINA 4JS5A 1VRTA 1SUQA 3LDSA 4HCCA 3C95A 3CFPA 4FJ7A 2F96A 1JLAA 3L3VA 2B4JA 4DQIA 1S1WA 3ZSVA 2YKNA 5SZTA 2XY7A 4KHUA 1VRUA 3NBPA 1NKCA 3KTQA 5KRSA 1DTQA 4ID5A 3HP9A 3ZSRA 3IAYA 3VQPA 2GUIA 4FW2A 4DU1A 4M3RA 1J54A 4GMJB 3OYGA 3EY1A 4DTPA 2G8UA 3H08A 1WAJA 3IS9A 1FK9A 3NF6A 3KKRA 2B5JA 3OYKA 4KREA 3V9XA 1NK9A 4IKFA 5FRNA 3BGRA 3QNOA 3CQ8A 1NK7A 3ZSQA 4DMNA 2OPQA 3OYMA 1IKVA 2X6SA 4E7LA 1DTTA 3AO1A 4WE1A 3NH2A 3OY9A 3HPHA 5HRSA 2I5JA 1C0MA 4NYFA 4ZTFA 1JL2A 3WNFA 3RRHA 4C8LA 4CHQA 4W5OA 4FM1A 3I8DA 1S1VA 1BIUA 1EXQA 1D9FA 1ASUA 3NGYA 3LP1A 3NAEA 1C1AA 4EP4A 1TAQA 3MXMA 3LWLA 1NOYA 3TAEA 4ID1A 4O0IA 4AHRA 3MEDA 5FROA 3KJVA 2Z1GA 1L3SA 2PYJA 3VA3A 4IG3A 3TAPA 3MEEA 3VQDA 4CIFA 1RTDA 4OPJA 2HHUA 1RBVA 4JS4A 4R5PA 1RBSA 4FW1A 2YKMA 3VQ5A 1RDAA 3CFOA 3HVRA 4FLXA 4FLWA 5HROA 1NK0A 4E0DA 4HCBA 2HHTA 4FLZA 2P51A 3D45A 1XC9A 1TK8A 2YNFA 2VWKA 3L3UA 1KSPA 3L2UA 2HMIA 2D0CA 3AO4A 1UA0A 1U45A 1NKBA 4FJJA 4CGHA 4FK4A 1VSJA 4RW4A 4M3TA 3ALYA 3OYBA 4CHNA 4FLUA 4K8ZA 4IFYA 4IDKA 4E7HA 1BHLA 4CK1A 4RW7A 4CFCA 1B9DA 4LH4A 3K57A 4DTNA 1N5YA 3TAQA 2A1RA 1HYSA 1BCOA 5DK5A 4JRQA 1TAUA 2OPPA 4NYNA 4DG1A 1CZ9A 5J1EA 5HBMA 3DLBA 4RW8A 4ZTJA 3LALA 3VQAA 3DLRA 3ZT1A 5KI6A 4DU3A 4DTJA 2O4GA 1HPZA 1JLFA 3MXIA 1C0TA 4CJQA 2ITGA 2FBXA 3AV9A 1TGOA 4F3OA 4CGDA 5CZ2A 3SUNA 4FJ8A 1SKRA 3ZSZA 1ITGA 1WSJA 1TK0A 1IG9A 1BL3A 1FKOA 3P83D 1S9EA 3QIPA 1HMVA 3VQ4A 1TKTA 1T8EA 3DOLA 2OZMA 4FZYA 2KZMA 2XO7A 4NCBA 1KTQA 3AVHA 1BI4A 1LW0A 1X1PA 3AVAA 4GVMA 3K5NA 4HTUA 3U3GA 2P5GA 4FJIA 4FM2A 4KTQA 4K8XA 4CK2A 5HRNA 3V81A 4RW6A 1RBRA 1EKEA 3VQQA 1I39A 1W0HA 4B9SA 2E6MA 3V6DA 1U04A 3KLIA 1RILA 4LSLA 4O44A 4NCGA 2G8WA 3OJUA 1UOCA 1VSHA 3SJJA 2F8SA 3ZSYA 1KVCA 1B9FA 2JGUA 4AH9A 3OYDA 3F73A 3DLEA 3OYCA 3SPZA 1TL1A 4FJ5A 4KHYA 4OPKA 2P1JA 3RMDA 3TAMA 3JSMA 3VQ7A 2EX3A 3RTVA 4OGEA 4DTUA 1D9DA 3L2RA 3VN5A 1IO2A 3NGIA 3SI6A 2G8HA 1FKPA 1SKSA 3HYFA 3NF9A 3RRGA 1IKXA 2NUBA 4C8MA 1QQCA 1S5JA 3AVCA 1GOCA 3QLHA 3ZT2A 3NCIA 2P5OA 3V4IA 3OYFA 4RW9A 3PUFA 2BDPA 2HHVA 3IG1A 4KTZA 4M41A 4FM0A 1RT5A 2HVHA 4EZ9A 4CJTA 3VQ6A 4CGFA 4N56A 4CEQA 2VG7A 1L3TA 4MQ3A 3HO1A 1VSKA 4ELVA 5HRRA 3C6UA 4JRPA 4FCYA 3ASMA 3EYZA 4J2DA 1ASWA 4CF9A 4F4KA 4H4OA 3AVLA 2KTQA 3OYJA 3AVKA 2IS3A 4LH5A 3K58A 5J2MA 3TABA 1T03A 4KB0A 3TR8A 4DQRA 1A5XA 4DSIA 2YNHA 1WSHA 1Z26A 2VG5A 3T19A 3ZSXA 4CECA 3PV8A 3PX0A 2RN2A 1KVBA 1QSLA 2A1SA 1JLCA 3VQBA 3HPGA 4KAZA 4KPYA 4KHQA 4BACA 3OVNA 3OS2A 3HPOA 1L3UA 5FDLA 4FZXC 1K6YA 1KFDA 2Z1IA 4Z4CA 3S3MA 1WAFA 1KRPA 3KD5E 3AVGA 4CE9A 2E4LA 4N47A 4G1QA 2DFFA 4TSXA 4DU4A 2GBZA 1EX4A 3NH1A 2XRIA 2HHSA 3SYZA 3P1GA 3MXJA 1J53A 1CXUA 1JLGA 3VQCA 3L2WA 3AVBA 3SZ2A 3TI0A 4FJ9A 1RT6A 3DM2A 3M8SA 3LWMA 4ICLA 3CFRA 1EETA 3MEGA 1JLBA 1LV5A 1WSEA 3K5LA 3RR8A 4O0JA 2FC0A 3THVA 3AO2A 4LD0A 5C24A 1ZBFA 1R0AA 3KK1A 2B6AA 3V1QA 4CGGA 3VQ9A 4DFMA 2QKKA 1C6VA 4M3YA 1BQNA 2IGIA 3NDKA 1TK5A 4DSKA 1VSFA 1WLJA 1GOAA 4AHUA 3K59A 3QERA 4PUOA 1VSMA 4DTMA 4N41A 1SL0A 4UQGA 2HNYA 3LP3A 4CF0A 3I0RA 1GOBA 3NH0A 4CK3A 1CLQA 1RT3A 4E1MA 3SPYA 4E1NA 1RT7A 3HM9A 1NKEA 4CEDA 1JL1A 4FJXA 3WNEA 4DSEA 3NE6A 1J9AA 5K14A 1TVRA 4CJWA 4CFDA 1S1TA 4YNQA 3V9ZA 2OA8A 3NF8A 1S6QA 4ZHRA 4BWJA 3SQ4A 4KI6A 4B9TA 1B92A 4OKEA 3K5MA 3PO5A 2DY4A 1I3AA 1A5WA 3LAMA 3ISNC 3M8QA 2BANA 4CEOA 4FLYA 4AHCA 4M3XA 4CHOA 4OKKA 1SL1A 2Y1IA 3OS0A 2O4IA 3DOKA 3QNNA 4M3ZA 1TL3A 1S1UA 3AO5A 4L8RB 2OPSA 1NJYA 4KB1A 3K2PA 4CJFA 4QOZB 1RTIA 4CEEA 2LSNA 4DQPA 3AVMA 4KO0A 1RDCA 3OYNA 4H8KA 4LSNA 1F21A 3NHGA 4CJ5A 4DTOA 2G8KA 3ZCMA 3HVTA 4O55A 4CFBA 1KFSA 3I0SA 2RF2A 3C6TA 3IRXA 4CJ3A 4B9UA 4KI4A 4M42A 4IFVA 4FJKA 2HVIA 3PY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DSF A;  1O1W A;  3L2V A;  3TAR A;  1D8Y A;  4DFK A;  3M8P A;  4KHS A;  1BI4 B;  1XHX A;  5FRM A;  2BGG A;  4KTW A;  3JYT A;  3KK3 A;  2ETJ A;  1LWE A;  4N5S A;  3KLG A;  1HNI A;  4DFJ A;  3QET A;  2KZZ A;  2PZS A;  2YV0 X;  1BGX T;  1HRH A;  3TWH A;  4KHN A;  1W9H A;  5KTQ A;  4CHY A;  4HHT A;  3AVI A;  4OKJ A;  1KVA A;  2EHG A;  4DLG A;  4FLV A;  4DF4 A;  4HVJ A;  1Y97 A;  5DMR A;  4CJS A;  1HQU A;  4CIE A;  2DTU A;  1U4B A;  1YT3 A;  1S6P A;  4FJM A;  1RT1 A;  4DTR A;  1U47 A;  1QS4 A;  4KKO A;  1NK4 A;  2ZD1 A;  4W5N A;  1VSI A;  1MU2 A;  1X9S A;  1UWB A;  4HUE A;  4FJN A;  4W5Q A;  4FLT A;  4OLA A;  2ZQB A;  4E19 A;  1QHT A;  1XHZ A;  1S1X A;  1SV5 A;  2XY5 A;  4OJR A;  4BE2 A;  1ZBI A;  1RBT A;  3VQE A;  2X6N A;  1HYV A;  1SL2 A;  3SQ1 A;  3KLE A;  3HJF A;  4CFA A;  3HT3 A;  3PX4 A;  1QTM A;  1TKD A;  1S9G A;  1WN7 A;  3DRP A;  1T7P A;  4CCH A;  2KFZ A;  4BDY A;  3O4Q A;  3ZT3 A;  2QK9 A;  3C94 A;  4C8O A;  4CJ4 A;  3OJS A;  4DQQ A;  3ITH A;  4ELU A;  4Z4F A;  3SV3 A;  1Z25 A;  2D0B A;  3OYE A;  3B6O A;  5KRT A;  4IBN A;  1YTU A;  3RR7 A;  3LP0 A;  1L5U A;  1D5A A;  2R7Y A;  4EP5 A;  3PX6 A;  3SCX A;  1DLO A;  4CIG A;  1JXE A;  4B9V A;  2KFN A;  4CGJ A;  1HJR A;  3OS1 A;  4CEB A;  4AHT A;  4XIU A;  3QEX A;  1NJW A;  1WSG A;  1N6Q A;  4DSL A;  4M3U A;  2JLE A;  3VQ8 A;  3LZJ A;  3T3F A;  3RMA A;  3F9K A;  1RTJ A;  3AA5 X;  4DQS A;  4M3W A;  3HP6 A;  4F3T A;  4CJL A;  5T7B A;  2KQ2 A;  1NJZ A;  3G0Z A;  3LAN A;  1XWL A;  4C8N A;  3DI6 A;  2DFE A;  4I2P A;  3HST B;  4E89 A;  1A5V A;  3L2Q A;  2YNG A;  3KLF A;  3VA0 A;  4BDP A;  1RNH A;  4Z0U A;  1Q9X A;  4RG8 A;  1KLN A;  4J2E A;  4FK2 A;  3LPT A;  2PYL A;  2W42 A;  2G8I A;  4J2B A;  4W5R A;  2ATQ A;  4B9M A;  3QEP A;  1YVU A;  1KLM A;  4J2A A;  3HK2 A;  1IH7 A;  2GV9 A;  4ELT A;  4CJR A;  3D0P A;  1UAX A;  3DMJ A;  3ZSW A;  1KCF A;  3OYA A;  3S3N A;  4FYD A;  2RPI A;  2E6L A;  1JKH A;  4I9L A;  4O5B A;  4CF8 A;  4CHP A;  1RDB A;  1NJX A;  3DRR A;  5JS1 A;  4E7K A;  4B08 A;  4IG0 A;  2HW3 A;  4FXD A;  2Z1H A;  1BIS A;  1VSL A;  3SUO A;  5C42 A;  1UA1 A;  1REV A;  3O3H A;  4CEA A;  3LP2 A;  4CJP A;  4DS5 A;  4DTX A;  1CXQ A;  2HB5 A;  4Z4H A;  1SKW A;  4CJK A;  4OVL A;  1XI1 A;  2YHA A;  3TAG A;  1IKW A;  2G8V A;  3AA3 A;  4DF8 A;  4BDZ A;  4HUG A;  1RT2 A;  3KD1 E;  3QIO A;  1QSY A;  4KHW A;  1BQM A;  4LY7 A;  3SUP A;  1HQE A;  4DS4 A;  1EP4 A;  1LAV A;  2Z1J A;  3MAQ A;  2BE2 A;  2FBY A;  4AIL C;  1G15 A;  3SUQ A;  2IDO A;  5KGW A;  2G8F A;  4B8A B;  1TKX A;  3V1R A;  1JXB A;  3TAF A;  3CG7 A;  1X9M A;  1WSF A;  3B6P A;  1FXX A;  5JS2 A;  4HUF A;  4GW6 A;  4F2R A;  3DLG A;  5CZ1 A;  3NGZ A;  4QAG A;  2X74 A;  2OYQ A;  4N76 A;  2XY8 A;  5SWM A;  1VK0 A;  3DYA A;  3CYM A;  4BE0 A;  4F8R A;  3ZT0 A;  5I42 A;  3KKS A;  4MFB A;  3KK2 A;  3PO4 A;  1U49 A;  3TAN A;  4FJG A;  2Y1J A;  5J2Q A;  4Z4I A;  1RT4 A;  5HP1 A;  1NK8 A;  1LWF A;  3DLH A;  1ZBH A;  5I3U A;  3QEW A;  3G10 A;  4BE1 A;  4CHZ A;  4Z4G A;  1BIZ A;  1TV6 A;  3L8B A;  2QKB A;  1C1B A;  1ASV A;  2FBV A;  4OGC A;  4I2Q A;  4CEZ A;  3K5O A;  3EZ5 A;  1U48 A;  1RBU A;  1ZBU A;  3T1A A;  1CZB A;  1L3V A;  4Z4E A;  2IAJ A;  3V9U A;  4Y1D A;  3DRS A;  3V9W A;  4FJH A;  4I9Q A;  4KRF A;  2VWJ A;  4CF2 A;  4EZ6 A;  3LPU A;  4C8K A;  4CER A;  3LAK A;  3QES A;  1T05 A;  3UIQ A;  2OPR A;  4B8C A;  3SQ0 A;  4DTS A;  5D3G A;  3QEV A;  2YNI A;  3SNN A;  4PQU A;  4E3S A;  3O4N A;  2DFH A;  3ZSO A;  3FFI A;  4CGI A;  3BDP A;  3A2F A;  2PY5 A;  3OYH A;  4AHV A;  4B3O A;  3AA4 A;  3OYL A;  5EU7 A;  3AO3 A;  3KLH A;  3E01 A;  4QCL A;  1IKY A;  3NFA A;  5J2N A;  2WOM A;  4CJV A;  4CF1 A;  3ULD A;  1Q9Y A;  1YTA A;  1VSD A;  2RKI A;  2WON A;  4CES A;  4FZZ A;  4DLE A;  2HHQ A;  5CYQ A;  3SQ2 A;  1JLQ A;  4CEF A;  4E7I A;  4JLH A;  2KW4 A;  4F2S A;  4Q5V A;  2D0A A;  3AVJ A;  3CM6 A;  5CY4 A;  3ZT4 A;  4CJU A;  4Y1C A;  3M8R A;  4DWI A;  1ZBL A;  3U6F A;  3SV4 A;  1QSS A;  3CM5 A;  4NCA A;  2X78 A;  3NF7 A;  4KFB A;  4CJE A;  1RDD A;  4E7J A;  2OZS A;  4DSJ A;  3OYI A;  4FVM A;  3MEC A;  1C0U A;  5KGX A;  4KV8 A;  3HXM A;  1HYZ A;  2AJQ A;  2VG6 A;  4PA1 A;  3DLK A;  3V9S A;  3S3O A;  2F8T A;  3AA2 A;  4Q0B A;  1BCM A;  3S9H A;  3O3F A;  1HNV A;  1RTH A;  3HL8 A;  4I7F A;  2XY6 A;  4PWD A;  4FK0 A;  1VSE A;  1LW2 A;  2ZE2 A;  2HHW A;  3AVN A;  3RMC A;  3RWU A;  1NK5 A;  1WSI A;  4YFU A;  3LZI A;  1J5O A;  4W5T A;  5E41 A;  2HND A;  3QEI A;  1TKZ A;  1Q8I A;  1NK6 A;  2QXF A;  1ZYQ A;  5HLF A;  2XHB A;  1C1C A;  1X9W A;  4B9L A;  4H4M A;  5HRP A;  3QO9 A;  3O3G A;  2IOC A;  4O4G A;  4PY5 A;  4BWM A;  3V1O A;  1NOZ A;  3KIO A;  2HNZ A;  4M45 A;  5CYM A;  1LWC A;  2HHX A;  3RMB A;  2FBT A;  1WNS A;  1RCH A;  5C25 A;  3U3Y A;  1LAW A;  2D5R A;  3P5J A;  3WNG A;  1QE1 A;  2Q3S A;  3WNH A;  4DFP A;  4OLB A;  4FJL A;  4B9N A;  2YHB A;  2IC3 A;  3AVF A;  1JLE A;  5J2P A;  4AHS A;  3QIN A;  4JS5 A;  1VRT A;  1SUQ A;  3LDS A;  4HCC A;  3C95 A;  3CFP A;  4FJ7 A;  2F96 A;  1JLA A;  3L3V A;  2B4J A;  4DQI A;  1S1W A;  3ZSV A;  2YKN A;  5SZT A;  2XY7 A;  4KHU A;  1VRU A;  3NBP A;  1NKC A;  3KTQ A;  5KRS A;  1DTQ A;  4ID5 A;  3HP9 A;  3ZSR A;  3IAY A;  3VQP A;  2GUI A;  4FW2 A;  4DU1 A;  4M3R A;  1J54 A;  4GMJ B;  3OYG A;  3EY1 A;  4DTP A;  2G8U A;  3H08 A;  1WAJ A;  3IS9 A;  1FK9 A;  3NF6 A;  3KKR A;  2B5J A;  3OYK A;  4KRE A;  3V9X A;  1NK9 A;  4IKF A;  5FRN A;  3BGR A;  3QNO A;  3CQ8 A;  1NK7 A;  3ZSQ A;  4DMN A;  2OPQ A;  3OYM A;  1IKV A;  2X6S A;  4E7L A;  1DTT A;  3AO1 A;  4WE1 A;  3NH2 A;  3OY9 A;  3HPH A;  5HRS A;  2I5J A;  1C0M A;  4NYF A;  4ZTF A;  1JL2 A;  3WNF A;  3RRH A;  4C8L A;  4CHQ A;  4W5O A;  4FM1 A;  3I8D A;  1S1V A;  1BIU A;  1EXQ A;  1D9F A;  1ASU A;  3NGY A;  3LP1 A;  3NAE A;  1C1A A;  4EP4 A;  1TAQ A;  3MXM A;  3LWL A;  1NOY A;  3TAE A;  4ID1 A;  4O0I A;  4AHR A;  3MED A;  5FRO A;  3KJV A;  2Z1G A;  1L3S A;  2PYJ A;  3VA3 A;  4IG3 A;  3TAP A;  3MEE A;  3VQD A;  4CIF A;  1RTD A;  4OPJ A;  2HHU A;  1RBV A;  4JS4 A;  4R5P A;  1RBS A;  4FW1 A;  2YKM A;  3VQ5 A;  1RDA A;  3CFO A;  3HVR A;  4FLX A;  4FLW A;  5HRO A;  1NK0 A;  4E0D A;  4HCB A;  2HHT A;  4FLZ A;  2P51 A;  3D45 A;  1XC9 A;  1TK8 A;  2YNF A;  2VWK A;  3L3U A;  1KSP A;  3L2U A;  2HMI A;  2D0C A;  3AO4 A;  1UA0 A;  1U45 A;  1NKB A;  4FJJ A;  4CGH A;  4FK4 A;  1VSJ A;  4RW4 A;  4M3T A;  3ALY A;  3OYB A;  4CHN A;  4FLU A;  4K8Z A;  4IFY A;  4IDK A;  4E7H A;  1BHL A;  4CK1 A;  4RW7 A;  4CFC A;  1B9D A;  4LH4 A;  3K57 A;  4DTN A;  1N5Y A;  3TAQ A;  2A1R A;  1HYS A;  1BCO A;  5DK5 A;  4JRQ A;  1TAU A;  2OPP A;  4NYN A;  4DG1 A;  1CZ9 A;  5J1E A;  5HBM A;  3DLB A;  4RW8 A;  4ZTJ A;  3LAL A;  3VQA A;  3DLR A;  3ZT1 A;  5KI6 A;  4DU3 A;  4DTJ A;  2O4G A;  1HPZ A;  1JLF A;  3MXI A;  1C0T A;  4CJQ A;  2ITG A;  2FBX A;  3AV9 A;  1TGO A;  4F3O A;  4CGD A;  5CZ2 A;  3SUN A;  4FJ8 A;  1SKR A;  3ZSZ A;  1ITG A;  1WSJ A;  1TK0 A;  1IG9 A;  1BL3 A;  1FKO A;  3P83 D;  1S9E A;  3QIP A;  1HMV A;  3VQ4 A;  1TKT A;  1T8E A;  3DOL A;  2OZM A;  4FZY A;  2KZM A;  2XO7 A;  4NCB A;  1KTQ A;  3AVH A;  1BI4 A;  1LW0 A;  1X1P A;  3AVA A;  4GVM A;  3K5N A;  4HTU A;  3U3G A;  2P5G A;  4FJI A;  4FM2 A;  4KTQ A;  4K8X A;  4CK2 A;  5HRN A;  3V81 A;  4RW6 A;  1RBR A;  1EKE A;  3VQQ A;  1I39 A;  1W0H A;  4B9S A;  2E6M A;  3V6D A;  1U04 A;  3KLI A;  1RIL A;  4LSL A;  4O44 A;  4NCG A;  2G8W A;  3OJU A;  1UOC A;  1VSH A;  3SJJ A;  2F8S A;  3ZSY A;  1KVC A;  1B9F A;  2JGU A;  4AH9 A;  3OYD A;  3F73 A;  3DLE A;  3OYC A;  3SPZ A;  1TL1 A;  4FJ5 A;  4KHY A;  4OPK A;  2P1J A;  3RMD A;  3TAM A;  3JSM A;  3VQ7 A;  2EX3 A;  3RTV A;  4OGE A;  4DTU A;  1D9D A;  3L2R A;  3VN5 A;  1IO2 A;  3NGI A;  3SI6 A;  2G8H A;  1FKP A;  1SKS A;  3HYF A;  3NF9 A;  3RRG A;  1IKX A;  2NUB A;  4C8M A;  1QQC A;  1S5J A;  3AVC A;  1GOC A;  3QLH A;  3ZT2 A;  3NCI A;  2P5O A;  3V4I A;  3OYF A;  4RW9 A;  3PUF A;  2BDP A;  2HHV A;  3IG1 A;  4KTZ A;  4M41 A;  4FM0 A;  1RT5 A;  2HVH A;  4EZ9 A;  4CJT A;  3VQ6 A;  4CGF A;  4N56 A;  4CEQ A;  2VG7 A;  1L3T A;  4MQ3 A;  3HO1 A;  1VSK A;  4ELV A;  5HRR A;  3C6U A;  4JRP A;  4FCY A;  3ASM A;  3EYZ A;  4J2D A;  1ASW A;  4CF9 A;  4F4K A;  4H4O A;  3AVL A;  2KTQ A;  3OYJ A;  3AVK A;  2IS3 A;  4LH5 A;  3K58 A;  5J2M A;  3TAB A;  1T03 A;  4KB0 A;  3TR8 A;  4DQR A;  1A5X A;  4DSI A;  2YNH A;  1WSH A;  1Z26 A;  2VG5 A;  3T19 A;  3ZSX A;  4CEC A;  3PV8 A;  3PX0 A;  2RN2 A;  1KVB A;  1QSL A;  2A1S A;  1JLC A;  3VQB A;  3HPG A;  4KAZ A;  4KPY A;  4KHQ A;  4BAC A;  3OVN A;  3OS2 A;  3HPO A;  1L3U A;  5FDL A;  4FZX C;  1K6Y A;  1KFD A;  2Z1I A;  4Z4C A;  3S3M A;  1WAF A;  1KRP A;  3KD5 E;  3AVG A;  4CE9 A;  2E4L A;  4N47 A;  4G1Q A;  2DFF A;  4TSX A;  4DU4 A;  2GBZ A;  1EX4 A;  3NH1 A;  2XRI A;  2HHS A;  3SYZ A;  3P1G A;  3MXJ A;  1J53 A;  1CXU A;  1JLG A;  3VQC A;  3L2W A;  3AVB A;  3SZ2 A;  3TI0 A;  4FJ9 A;  1RT6 A;  3DM2 A;  3M8S A;  3LWM A;  4ICL A;  3CFR A;  1EET A;  3MEG A;  1JLB A;  1LV5 A;  1WSE A;  3K5L A;  3RR8 A;  4O0J A;  2FC0 A;  3THV A;  3AO2 A;  4LD0 A;  5C24 A;  1ZBF A;  1R0A A;  3KK1 A;  2B6A A;  3V1Q A;  4CGG A;  3VQ9 A;  4DFM A;  2QKK A;  1C6V A;  4M3Y A;  1BQN A;  2IGI A;  3NDK A;  1TK5 A;  4DSK A;  1VSF A;  1WLJ A;  1GOA A;  4AHU A;  3K59 A;  3QER A;  4PUO A;  1VSM A;  4DTM A;  4N41 A;  1SL0 A;  4UQG A;  2HNY A;  3LP3 A;  4CF0 A;  3I0R A;  1GOB A;  3NH0 A;  4CK3 A;  1CLQ A;  1RT3 A;  4E1M A;  3SPY A;  4E1N A;  1RT7 A;  3HM9 A;  1NKE A;  4CED A;  1JL1 A;  4FJX A;  3WNE A;  4DSE A;  3NE6 A;  1J9A A;  5K14 A;  1TVR A;  4CJW A;  4CFD A;  1S1T A;  4YNQ A;  3V9Z A;  2OA8 A;  3NF8 A;  1S6Q A;  4ZHR A;  4BWJ A;  3SQ4 A;  4KI6 A;  4B9T A;  1B92 A;  4OKE A;  3K5M A;  3PO5 A;  2DY4 A;  1I3A A;  1A5W A;  3LAM A;  3ISN C;  3M8Q A;  2BAN A;  4CEO A;  4FLY A;  4AHC A;  4M3X A;  4CHO A;  4OKK A;  1SL1 A;  2Y1I A;  3OS0 A;  2O4I A;  3DOK A;  3QNN A;  4M3Z A;  1TL3 A;  1S1U A;  3AO5 A;  4L8R B;  2OPS A;  1NJY A;  4KB1 A;  3K2P A;  4CJF A;  4QOZ B;  1RTI A;  4CEE A;  2LSN A;  4DQP A;  3AVM A;  4KO0 A;  1RDC A;  3OYN A;  4H8K A;  4LSN A;  1F21 A;  3NHG A;  4CJ5 A;  4DTO A;  2G8K A;  3ZCM A;  3HVT A;  4O55 A;  4CFB A;  1KFS A;  3I0S A;  2RF2 A;  3C6T A;  3IRX A;  4CJ3 A;  4B9U A;  4KI4 A;  4M42 A;  4IFV A;  4FJK A;  2HVI A;  3PY8 A; 
#chains in the Genus database with same CATH topology
 3L2V A;  3TAR A;  3LDO A;  4DFK A;  1Q81 O;  5FRM A;  4KTW A;  3JYT A;  3KK3 A;  1LWE A;  4DV6 K;  4DFJ A;  1NGD A;  1BGX T;  3O9R A;  3O8M A;  4CHY A;  3QFU A;  3WT0 A;  3EE8 A;  4FLV A;  2V51 B;  1VQP N;  4DF4 A;  1Y97 A;  4CJS A;  1HQU A;  3R3L A;  5BN9 A;  4WYB A;  4FJM A;  1QS4 A;  4KKO A;  3FZL A;  3VMF B;  2ZD1 A;  4YDU C;  1MU2 A;  1X9S A;  4FJN A;  1X3N A;  4FLT A;  3WUH A;  1SV5 A;  1HPM A;  4B1Z A;  4CFA A;  3A5N C;  3HT3 A;  3E66 A;  4BDY A;  2QK9 A;  3UKU A;  2A41 A;  4BRF A;  2D0O A;  4WQ4 C;  3OBY A;  3SV3 A;  4KHP K;  3PSF A;  2OCE A;  5KRT A;  3RR7 A;  1HR0 K;  3SCX A;  4KB1 A;  3OS1 A;  3G71 N;  3F9K A;  1OKJ A;  4DQS A;  4F3T A;  1NJZ A;  3G0Z A;  3O9S A;  3CCU N;  1U2V B;  1XWL A;  3IUC A;  3DI6 A;  4C8N A;  4BR7 A;  3HST B;  4BR0 A;  1A5V A;  1BUP A;  1HNZ K;  4Z0U A;  1YF5 L;  1KLN A;  4J2E A;  5BN8 A;  2F4V K;  4IO9 L;  5GIN A;  2W42 A;  1HUX A;  2ATQ A;  3EE9 A;  4ELT A;  1GLJ O;  1UAX A;  2RPI A;  3SK3 A;  1VQ9 N;  4NO7 A;  1G99 A;  5JS1 A;  3D2F B;  4IG0 A;  4FXD A;  1VSL A;  3WQU A;  1H1V A;  3LP2 A;  4CJP A;  2YHW A;  4FVU A;  4K0K K;  4BRA A;  4CJK A;  4O8U A;  2YHA A;  3TAG A;  1BA1 A;  4JKG A;  4BDZ A;  3KD1 E;  1RT2 A;  4KHW A;  5AQN A;  1NGB A;  3H3O B;  4A2A A;  2NRH A;  2Q36 A;  3B6P A;  3DXK A;  4F2R A;  5CZ1 A;  4QAG A;  2CH5 A;  4B3R K;  2X74 A;  3JXU A;  2OYQ A;  4H5R A;  3O5B A;  5SWM A;  1VK0 A;  3DYA A;  3CYM A;  3ZT0 A;  5I42 A;  1NGE A;  1E3M A;  1U49 A;  4FJG A;  4Z4I A;  1WBB A;  1RT4 A;  4JHD A;  2VGM A;  2V7Y A;  2HF3 A;  5GAG P;  3DLH A;  3L4Q A;  1VQO N;  4CHZ A;  4BRH A;  4CEZ A;  5AQK A;  3K5O A;  3EZ5 A;  2KHO A;  1RBU A;  1CZB A;  4Y1D A;  4I9Q A;  4CER A;  3LAK A;  1IV0 A;  3OTO K;  4B8C A;  4DTS A;  4O5F A;  3SNN A;  2YNI A;  3NMU A;  1OH6 A;  2Q31 A;  4PQU A;  3ZSO A;  4CGI A;  5KPZ A;  3BDP A;  4AHV A;  1YJN N;  3AA4 A;  3OYL A;  2HF4 A;  3TTC A;  3VER A;  1IKY A;  2WOM A;  4CJV A;  4J8F A;  4DLE A;  5CYQ A;  1JLQ A;  4CEF A;  4E7I A;  4GVE A;  1BO5 O;  4KH6 A;  1Y64 A;  4IJA A;  3M3Z A;  3U6F A;  3CM5 A;  4NCA A;  3NF7 A;  2OZS A;  4E7J A;  2AJQ A;  3V9S A;  2F8T A;  3AA2 A;  1BCM A;  1HNV A;  1NGJ A;  3E9L A;  1LW2 A;  2ZE2 A;  4IXC A;  1DGK N;  4YFU A;  4KH5 A;  4YOX A;  5E41 A;  2HND A;  4H5N A;  3QEI A;  2P9S A;  1TKZ A;  2QXF A;  4E1J A;  3QO9 A;  3C0B A;  3CC7 N;  2CGK A;  4KBO A;  5AFU H;  2HHX A;  1WNS A;  3WNG A;  3WNH A;  1ATN A;  3A0I X;  4FJL A;  3AVF A;  1BG3 A;  1VRT A;  4HCC A;  3CFP A;  1JLA A;  3ZX2 A;  3ZSV A;  2QEX N;  2UUB K;  5AFU A;  1NKC A;  1Q7Y O;  4ID5 A;  3ZSR A;  4FOE A;  3IAY A;  2GUI A;  1BOT O;  4DU1 A;  4KH4 A;  4JKG B;  3P39 A;  4GMJ B;  3CC2 N;  2G8U A;  2W40 A;  3IS9 A;  1FK9 A;  4BR2 A;  1K9M O;  3M1F A;  3V9X A;  4IKF A;  2ASP A;  3QNO A;  3CQ8 A;  1NGF A;  3DXK B;  3OYM A;  3DXM A;  1IBK K;  4JV5 K;  1DTT A;  4WE1 A;  3NH2 A;  3OY9 A;  3HPH A;  4DHY A;  3IKM A;  2RE2 A;  4C8L A;  4W5O A;  1ASU A;  2I7N A;  3CJ9 A;  3QML A;  4JHD B;  3SBG A;  1TAQ A;  5BPM A;  2HBK A;  3EZW A;  4AHR A;  3KJV A;  2PYJ A;  4IG3 A;  3MEE A;  4YOW A;  1GLL O;  2GWK A;  3ATV A;  1RBV A;  4GY2 B;  3J81 O;  4BC4 A;  4GV3 A;  1VQ4 N;  3HVR A;  4E0D A;  4FLW A;  2QA4 N;  2QWQ A;  2VWK A;  4JKH A;  1GLF O;  2QWP A;  1U45 A;  1QVG M;  1NKB A;  4CGH A;  5KQD A;  4FK4 A;  4K41 A;  2AP1 A;  1FJG K;  3OYB A;  4FLU A;  2D4W A;  1K8A O;  2E2O A;  2W6K A;  4JKE A;  1B9D A;  3CME N;  1N5Y A;  3TAQ A;  4BR5 A;  2A1R A;  1HYS A;  3HI0 A;  4YY3 K;  3DLB A;  3L4I A;  4DTJ A;  3VEO A;  1JLF A;  3Q7B A;  3O80 A;  2QWL A;  3WXK A;  4CI6 A;  3TSP A;  1N36 K;  5AQM A;  1IG9 A;  2P9S B;  3F5T A;  3ZYY X;  3VQ4 A;  1HMV A;  2OZM A;  1YJ9 N;  5GAE P;  2P9U A;  3AVH A;  3AVA A;  4DR2 K;  4XH4 A;  4KHU A;  3U4L A;  2P5G A;  4FJI A;  4K8X A;  3CPE A;  5C12 A;  3H3N O;  2E20 A;  1OVY A;  3CJ1 A;  1W0H A;  4JI2 K;  3KLI A;  4NCG A;  4MLH A;  4NLC A;  1B9F A;  4AH9 A;  5GIO A;  3BZK A;  1C0G A;  5M1Q A;  3VQ7 A;  4JI3 K;  1IO2 A;  3SI6 A;  4BGB A;  3WXL A;  2YJE A;  2NUB A;  3V4I A;  3OYF A;  4RW9 A;  3PUF A;  3J7A P;  3IG1 A;  4FM0 A;  4EZ9 A;  3GOI A;  4N56 A;  1VSK A;  4A57 A;  5HRR A;  3C6U A;  4FCY A;  3EYZ A;  4IOA L;  3GE1 A;  3AVL A;  3DXM B;  2IS3 A;  4LH5 A;  4K25 A;  3O9U A;  3VGM A;  3K0S A;  5J2M A;  3TR8 A;  4DQR A;  1BU6 O;  5EXW A;  3PV8 A;  3ZSX A;  1JLC A;  3HPG A;  4KHQ A;  1L3U A;  4FZX C;  1KRP A;  1WAF A;  3O9Q A;  5AQP A;  2OAN A;  4TSX A;  2GBZ A;  2O8B A;  2HHS A;  5AQS A;  3CMA N;  3FZH A;  3MXJ A;  2E1Y A;  1JLG A;  4DV4 K;  5BPL A;  4MDB A;  4LC9 B;  4DR3 K;  1EET A;  1LV5 A;  3T1Y K;  4PL7 A;  4CZI A;  3THV A;  5C24 A;  3KK1 A;  2B6A A;  4WFB L;  3N4Q A;  1KQS M;  4M3Y A;  2IGI A;  4PUO A;  1GOA A;  5AQO A;  3K59 A;  2V7Z A;  1VSM A;  4N41 A;  2HNY A;  4M7X A;  1GOB A;  1NKE A;  4CED A;  4CW7 B;  4CZK A;  1JJ2 M;  5K14 A;  2YI1 A;  4ZHR A;  4JI0 K;  1B92 A;  2HBJ A;  1A5W A;  3ISN C;  2VWB A;  3C7N A;  4CZF A;  3ID8 A;  1MDU B;  2NRV A;  3SAG A;  4M3Z A;  4L8R B;  3FZK A;  2ZJR L;  1ZXO A;  4CZJ A;  4DQP A;  3NHG A;  4DTO A;  3ZCM A;  1NM1 A;  2F8S A;  3C6T A;  4BRL A;  4JI8 K;  1V4T A;  4IFE A;  4H5T A;  5ELZ A;  4LF6 K;  2P9U B;  2ETJ A;  3R1X A;  4N5S A;  2IVN A;  5LY3 A;  2YV0 X;  3TWH A;  4KHN A;  1W9H A;  4DLG A;  3H1Q A;  5DMR A;  4HVJ A;  1YT3 A;  1S6P A;  1RT1 A;  1U47 A;  4B1Y B;  3ZX0 A;  1NK4 A;  3VEV A;  1VSI A;  3G25 A;  1UWB A;  4WQ5 A;  4E19 A;  1XHZ A;  1S1X A;  4OJR A;  4BE2 A;  3CHW A;  4CVN E;  1ZBS A;  4BRD A;  1VAZ A;  3CI5 A;  3SQ1 A;  3HJF A;  4A5A A;  3PX4 A;  1S9G A;  3DRP A;  1P90 A;  3DWL A;  3MMV A;  4FOI A;  3THW A;  3C94 A;  4CJ4 A;  5F0X A;  4DQQ A;  3ITH A;  1ILY A;  1WB9 A;  2WTU A;  1Z25 A;  3UKR A;  3A5M C;  3A8Y A;  4IBN A;  1YTU A;  1T44 A;  1D5A A;  3VES A;  4AHT A;  4XIU A;  1NJW A;  4UY8 O;  1C0F A;  3CJ7 A;  1RTJ A;  3AA5 X;  1W7A A;  4M3W A;  3HP6 A;  4NLB A;  2KQ2 A;  3LAN A;  4I2P A;  3C65 A;  3L2Q A;  3I56 N;  2F9T A;  4FK2 A;  3H45 C;  4QS9 A;  2G8I A;  4J2B A;  2O8B B;  1YVU A;  4J2A A;  2P9N A;  1IH7 A;  3J80 O;  3TTF A;  4FWQ A;  1JCG A;  3D0P A;  4B3S K;  4FYD A;  3ZSW A;  3OYA A;  3BY5 A;  4BQZ A;  5C0Y A;  4I9L A;  4O5B A;  3DRR A;  2FF6 A;  4B08 A;  3FLC O;  1Q86 O;  5LMU K;  1BIS A;  2AA4 A;  4R79 A;  3W3D A;  3O3H A;  1SKW A;  4OVL A;  3ZLJ A;  4RCH A;  1IKW A;  4JK7 A;  2G8V A;  1DEJ A;  1YHQ N;  1HJO A;  4NXM K;  3SAF A;  4LY7 A;  1HQE A;  4DS4 A;  1EP4 A;  1NMD A;  2A5X A;  3FE1 A;  3SUQ A;  5BPN A;  1N33 K;  4B8A B;  1TKX A;  3V1R A;  1JXB A;  1VQM N;  4BQL A;  3TAF A;  3CG7 A;  1QQM A;  5BR9 A;  3DLG A;  2QWN A;  3C7N B;  2XY8 A;  4DV1 K;  4F8R A;  4C1N I;  3HZ6 A;  5E26 A;  4RTF D;  2KKZ A;  4BRI A;  3KK2 A;  3TAN A;  1XNR K;  1V4S A;  3O6W A;  4BRP A;  2Q2R A;  4CZH A;  3HM8 A;  3IDH A;  1ZBH A;  3G10 A;  4BE1 A;  1GLC G;  5LJW A;  3L8B A;  1ASV A;  2FBV A;  3T1A A;  2ZJQ L;  2IAJ A;  3V9U A;  3VGL A;  2VWJ A;  4EZ6 A;  4C8K A;  4IEE A;  3D6R A;  2YX6 A;  4E3S A;  4AF1 A;  3FZM A;  1M90 O;  2VQE K;  3VTH A;  3W0L A;  1SAZ A;  3ZX3 A;  5C2F A;  3E01 A;  4QCL A;  1Q9Y A;  4CF1 A;  3ENH A;  4A61 A;  1VSD A;  2RKI A;  4CES A;  2HHQ A;  3SQ2 A;  2GTD A;  1RDW X;  2D0A A;  3AVJ A;  3CM6 A;  5CY4 A;  5KPT A;  4DWI A;  1ZBL A;  3CET A;  3E9P A;  1J6Z A;  3OYI A;  3IMX A;  4KV8 A;  3HXM A;  3THW B;  1HYZ A;  4BY9 C;  2QWO A;  3NVM A;  4PA1 A;  3DLK A;  3UKR B;  4M63 C;  3O3F A;  2XY6 A;  3AVN A;  1NK5 A;  4W5T A;  3QBX A;  5CHI A;  4DR7 K;  4PKI A;  1C1C A;  4B9L A;  4IOX A;  5HRP A;  4U67 L;  2IOC A;  4V19 S;  3IFR A;  5HL7 L;  2ZM6 K;  2HNZ A;  2PFU A;  5AZI A;  4M45 A;  5CYM A;  2OTL N;  3T7Z A;  3KZB A;  3LDP A;  2P9N B;  4FSV A;  4ISE A;  5C25 A;  2D5R A;  3OHR A;  1QE1 A;  4DFP A;  1JLE A;  1XUP O;  2CGJ A;  4JS5 A;  1SUQ A;  3LDS A;  4BC2 A;  2W41 A;  2ASO A;  4FPB A;  5DM6 L;  3L3V A;  4IJN A;  2XY7 A;  4JI6 K;  1KC8 O;  1DTQ A;  2Q97 A;  4NB4 A;  4JD2 A;  3VQP A;  1EO1 A;  4ILJ A;  4JYA K;  3AAP A;  4DTP A;  3H08 A;  3NF6 A;  1EQY A;  2B5J A;  1NK9 A;  1BWF O;  1NK7 A;  3ZSQ A;  3F9M A;  1VHX A;  5EOY A;  5AQT A;  3OA9 A;  4DMN A;  3FR0 A;  3AO1 A;  4NYF A;  1T6D A;  1JL2 A;  3WNF A;  4CHQ A;  3I8D A;  4YOT A;  1EXQ A;  4BRK A;  1D9F A;  5A2Q O;  3LP1 A;  3NAE A;  3WXJ A;  4FWO A;  5CR4 A;  1NOY A;  4CZE A;  4ID1 A;  4O0I A;  3U8X A;  2GUP A;  2Z1G A;  3VA3 A;  3TAP A;  4GKK K;  3VQD A;  1HLU A;  2HHU A;  1HKG A;  4JS4 A;  1XQS C;  4BC5 A;  3VF2 A;  2YKM A;  2NRZ A;  3CFO A;  1WBD A;  5HRO A;  4JKA A;  3JS6 A;  2P51 A;  3D45 A;  1XC9 A;  1Q18 A;  2YNF A;  3L3U A;  1UA0 A;  5FPD A;  1IG8 A;  1VSJ A;  4RW4 A;  1NG9 A;  5HOO A;  3ALY A;  4M3T A;  4K8Z A;  4IFY A;  4BG8 A;  4RW7 A;  4CFC A;  4LF5 K;  4LH4 A;  2YHX A;  3EEQ A;  5DK5 A;  5DM7 L;  4DG1 A;  4B9Q A;  5J1E A;  1NJI O;  3ENO A;  4RW8 A;  2P9I A;  4WCE L;  3DJC A;  3CQY A;  4JI7 K;  4DB3 A;  1HPZ A;  5GAH P;  2ITG A;  3QFP A;  3VEZ A;  1OH5 A;  4F3O A;  1DT9 A;  5CZ2 A;  3SUN A;  4FJ8 A;  1SKR A;  4FWK A;  3ZSZ A;  4GNI A;  5C10 A;  1BL3 A;  2KZM A;  1IBM K;  5TKY A;  1BI4 A;  1LW0 A;  2JWK A;  3KHY A;  4HTU A;  5JMV A;  4FM2 A;  4OX9 K;  3QB0 A;  3G6E N;  1I39 A;  5AZI B;  2E6M A;  3V6D A;  4LSL A;  4O44 A;  3OJU A;  1UOC A;  1VSH A;  4WQ5 C;  1KVC A;  1SS6 A;  2FSN A;  3OYC A;  4FJ5 A;  3RMD A;  3JSM A;  1XMQ K;  2EX3 A;  3SAH A;  4OGE A;  2NRR A;  2G8H A;  1FKP A;  5AQH A;  1SKS A;  2NRX A;  1X3M A;  4IDH A;  3NF9 A;  3RRG A;  1IKX A;  2HMP A;  1QQC A;  1S5J A;  4C23 A;  4IEI A;  3NCI A;  2P5O A;  4JD2 B;  4OPH A;  2HHV A;  4JK9 A;  1RT5 A;  2HVH A;  3HTV A;  3VQ6 A;  2D0P A;  2VG7 A;  1BA0 A;  4ELV A;  4EAH D;  2A42 A;  1NBW A;  2CH6 A;  4FWM A;  3CCJ N;  4H4O A;  4F4K A;  2KTQ A;  2IVP A;  1RFQ A;  3K58 A;  4KB0 A;  4H0T B;  2A1S A;  4KPY A;  4H03 B;  3CQX A;  3AAR A;  3OVN A;  2J4R A;  3OBW A;  3P38 A;  4G1Q A;  3EO3 A;  1EWQ A;  3NH1 A;  1ZC6 A;  2HST A;  5LMN K;  4JKC A;  3LL3 A;  3P1G A;  1CXU A;  3SZ2 A;  1YUW A;  2NNW A;  4IOC L;  1JLB A;  1WSE A;  3K5L A;  3LM2 A;  3R9P A;  3M5R A;  3CJC A;  4CZG A;  4DUZ K;  2P9L A;  1C6V A;  3ATU A;  3I8B A;  4PWD A;  2RHK A;  3QER A;  3MDQ A;  4UQG A;  3LP3 A;  5BRD A;  3NH0 A;  4E1N A;  4FJX A;  3JAM O;  1JL1 A;  4DSE A;  3SMS A;  4CJW A;  1XC3 A;  1TVR A;  3SQ4 A;  1XNQ K;  4OKE A;  2P9I B;  3K5M A;  4CEO A;  4OKK A;  2O4I A;  3OS0 A;  1S1U A;  1W2B M;  3G4S N;  4QOZ B;  2LSN A;  3OYN A;  1RDC A;  1KD1 O;  4H8K A;  2G8K A;  4CFB A;  4O55 A;  3I0S A;  2RF2 A;  3IRX A;  2VYP A;  4B9U A;  4FJK A;  2HVI A;  1O1W A;  4B3M K;  4KHS A;  2E2N A;  1BI4 B;  1E4F T;  1XHX A;  2BGG A;  4A59 A;  1YJW N;  3VGK A;  2KZZ A;  5KTQ A;  1KVA A;  4DV5 K;  4CIE A;  2FLO A;  3L6Q A;  2P9P A;  3DAW A;  4HUE A;  5AQR A;  2ZQB A;  1QHT A;  4DV3 K;  3KVG A;  5KQ8 A;  4JI4 K;  2XY5 A;  1ZBI A;  2E2Q A;  3MN7 A;  3VQE A;  2X6N A;  3KLE A;  4FWP A;  2UXC K;  1QTM A;  4CCH A;  1WN7 A;  5LJV A;  1T7P A;  2E8A A;  3SBT A;  2IVO A;  4C8O A;  5IWA K;  4ELU A;  2ITM A;  2D0B A;  3OYE A;  3B6O A;  4FO0 A;  4AM6 A;  1N8R O;  4BRG A;  1L5U A;  2PAV A;  3PX6 A;  2KFN A;  2ASM A;  1DLO A;  1JXE A;  3ZEU A;  4CGJ A;  2QKK A;  4DSL A;  1ATS A;  3OW2 M;  2JLE A;  3SLC A;  3LZJ A;  3T3F A;  2ZGZ A;  1WUA A;  1TUU A;  3MCA B;  4BR4 A;  5T7B A;  4EIA A;  4E89 A;  2YNG A;  4DR1 K;  4BDP A;  1RNH A;  4RG8 A;  3GL1 A;  5AQU A;  3QIC A;  4W5R A;  4B9M A;  3HK2 A;  1KLM A;  3BF1 A;  4CJR A;  3S3N A;  3DMJ A;  3CC4 N;  4IWV A;  2JWL A;  4GV9 A;  3A5L C;  4FWN A;  2E6L A;  1JKH A;  4CF8 A;  3U9D A;  4CHP A;  1U6Z A;  4E7K A;  2Z1H A;  1REV A;  1P8Z A;  2YHY A;  3C6A A;  4BRC A;  3WXM B;  3A5O C;  2P9L B;  4B1X B;  1YXQ A;  4DTX A;  1CXQ A;  2HB5 A;  1XI1 A;  3TSU A;  3AA3 A;  3ENB A;  3J7Z O;  3PIO L;  4C1N K;  1XMO K;  1LAV A;  2Z1J A;  1X9J A;  4AIL C;  2IDO A;  3QDK A;  5GIP A;  1WSF A;  5JS2 A;  1FXX A;  4HUF A;  2WC9 A;  3ID6 A;  4OO1 J;  3BP8 A;  4N76 A;  5M1K A;  1LOT B;  2VQF K;  1SZ2 A;  3VEN A;  4MFB A;  3PO4 A;  3MN6 A;  3CXC M;  2UYT A;  3D2E A;  3CJB A;  5J2Q A;  1NK8 A;  1LWF A;  4AQY K;  5I3U A;  3QEW A;  1NU0 A;  4Z4G A;  4GKJ K;  1BIZ A;  1TV6 A;  2QKB A;  4I2Q A;  4Z4E A;  1T6C A;  3DRS A;  3V9W A;  4KRF A;  4CF2 A;  1NGH A;  3QES A;  1T05 A;  3UIQ A;  4FPA A;  2OPR A;  3SQ0 A;  5D3G A;  3O4N A;  3WEE A;  2Q1N A;  3FFI A;  2ZJP L;  3A2F A;  4GV6 A;  4B3O A;  2P9P B;  5EU7 A;  3AO3 A;  5AQW A;  3KLH A;  4I6M A;  3VEY A;  4U7B A;  1W97 L;  2WON A;  2DPN A;  4MDA A;  3ZT4 A;  4CJU A;  4Y1C A;  3SV4 A;  2X78 A;  4KFB A;  1KXP A;  4ISG A;  4LFC K;  5AQL A;  3S3O A;  3THX A;  4YOR A;  3S9H A;  1SQK A;  1RTH A;  4I7F A;  4A62 A;  1VSE A;  3MX5 A;  2Q0R A;  3RMC A;  3RWU A;  3ZEU B;  1J5O A;  5TKW A;  1NK6 A;  1ZYQ A;  5HLF A;  2UUA K;  1QZ6 A;  4H4M A;  4O4G A;  1MA9 B;  4BWM A;  2QW9 A;  1NOZ A;  2FBT A;  4PKG A;  1S3X A;  4LF8 K;  2YCH A;  3U3Y A;  1LAW A;  1ESV A;  2NZT A;  4JN4 A;  2YHB A;  3DLL L;  2IC3 A;  4B1U B;  4AHS A;  4FJ7 A;  3E9O A;  4DQI A;  2BH1 A;  1S1W A;  4PKH A;  2YKN A;  5SZT A;  1VRU A;  3NBP A;  4MO5 A;  3KTQ A;  5KRS A;  3HP9 A;  5F2R A;  4K43 A;  1J54 A;  3EY1 A;  3VEX A;  3CD6 N;  1WAJ A;  3KKR A;  4KRE A;  2A40 A;  5FRN A;  3R6M A;  2HBM A;  3BGR A;  3K9J A;  2OPQ A;  2X6S A;  4FWS A;  2I5J A;  3L0Q A;  4O8K A;  4FM1 A;  1RGI A;  1S1V A;  5LL6 Z;  1BIU A;  4DR4 K;  3J7Y P;  3D2E B;  1NGG A;  1IJJ A;  3ULE A;  1JCF A;  3TAE A;  3MED A;  5FRO A;  2UXD K;  3O1W A;  4DV7 K;  4OPJ A;  3AGK A;  4R5P A;  1RBS A;  1NK0 A;  2HHT A;  2V52 B;  5AR0 A;  4FLZ A;  3WEE B;  3RSE A;  1KSP A;  2HMI A;  1J5E K;  3M6G A;  4I6M B;  4LFB K;  4CHN A;  3EL2 A;  4IDK A;  1BHL A;  5EX5 A;  1BCO A;  4JRQ A;  2OPP A;  1CZ9 A;  4ILG B;  4ZTJ A;  3LAL A;  3VQA A;  5BRH A;  4CD1 A;  3O4W A;  5KI6 A;  4DU3 A;  3CCE N;  3MXI A;  3THX B;  1I94 K;  2FBX A;  4CGD A;  2O8E A;  5FPN A;  1ITG A;  5BR8 K;  5GAD P;  3QIP A;  3CIP A;  1T8E A;  1S9E A;  4FZY A;  1TKT A;  2P9K A;  3DOL A;  3MX2 A;  2FXU A;  2XO7 A;  4NCB A;  1KTQ A;  4XH1 A;  2CGL A;  1X1P A;  3K5N A;  4KTQ A;  4BVP A;  3V81 A;  4RW6 A;  1RBR A;  3VQQ A;  1RIL A;  2G8W A;  4JAX A;  3SJJ A;  3ZSY A;  4ILH A;  4FWL A;  2JGU A;  3OYD A;  1TL1 A;  3C6H A;  4KHY A;  4OPK A;  4BRM A;  4DTU A;  3RTV A;  1BDG A;  1D9D A;  3VN5 A;  3NGI A;  3HYF A;  4C8M A;  1GOC A;  3QLH A;  1OH8 A;  2BDP A;  2W6L A;  4M41 A;  4KTZ A;  5AQX A;  1Z05 A;  5M1N A;  1OVQ A;  4CJT A;  2UUC K;  1L3T A;  4CEQ A;  3HO1 A;  4BRE A;  5B8H A;  4JRP A;  4X65 K;  3ASM A;  4Z94 A;  4BGA A;  4J2D A;  4CJ7 A;  3CF5 L;  1O13 A;  4EHU A;  1KAY A;  3H1V X;  4WF9 L;  2E2P A;  1T03 A;  3TAB A;  4AM7 A;  4IZ9 A;  4DSI A;  3AAQ A;  2VG5 A;  3PX0 A;  1QSL A;  1D4X A;  2RN2 A;  3VQB A;  3FZF A;  3HOS A;  2QWR A;  4BAC A;  5FDL A;  3MN9 A;  1K6Y A;  1KFD A;  2Z1I A;  4Z4C A;  3S3M A;  4CE9 A;  2O8D A;  3ULE B;  4N47 A;  5M1F A;  2QWM A;  2XRI A;  3EN9 A;  1WOQ A;  4HTL A;  2I7P A;  4DR5 K;  2NRW A;  1NGC A;  3AVB A;  3TI0 A;  5ADX H;  3DM2 A;  3M8S A;  3LWM A;  2E5L K;  3CFR A;  3MEG A;  1MWK A;  4A5B A;  5JLF A;  3RR8 A;  2FC0 A;  1R0A A;  3RSE B;  3V1Q A;  4CGG A;  3BZC A;  1TK5 A;  3P4I A;  1SL0 A;  5C2D A;  5ADX A;  3EKS A;  4CF0 A;  3I0R A;  4BG9 A;  2A3Z A;  1CLQ A;  1RT3 A;  5MLC Q;  1RT7 A;  3WNE A;  3NE6 A;  4DQ8 A;  4YNQ A;  4CFD A;  2OA8 A;  2FSK A;  3NF8 A;  1S6Q A;  2QTD A;  4H0V B;  3TTD A;  4PL8 A;  4B9T A;  3PO5 A;  4CBU A;  3LAM A;  3M8Q A;  4LF7 K;  2BAN A;  4FLY A;  4M3X A;  4H0P A;  4CHO A;  2Y1I A;  3AO5 A;  2BUP A;  1NJY A;  3K2P A;  4CJF A;  4CEE A;  2O8E B;  4KO0 A;  1F21 A;  4CJ5 A;  3LDQ A;  3HVT A;  1GLB G;  4M42 A;  2P9K B;  4DSF A;  1D8Y A;  3M8P A;  3THY A;  3VF4 A;  3KLG A;  1HNI A;  3QET A;  2PZS A;  1HRH A;  4HHT A;  3AVI A;  4OKJ A;  3KWG A;  2EHG A;  1YIT N;  2DTU A;  5JVH L;  1U4B A;  1YVN A;  3TSQ A;  4DTR A;  4W5N A;  2NRT A;  4H5W A;  4W5Q A;  5C15 A;  4OLA A;  5AQI A;  3UKU B;  1RBT A;  1DKG D;  1HYV A;  3TU5 A;  4WFA L;  2GEM A;  1SL2 A;  4NXN K;  3BF3 A;  1TKD A;  2KFZ A;  5BRF A;  3O08 A;  3O4Q A;  3ZT3 A;  3CPW M;  3OJS A;  4Z4F A;  5AQJ A;  3KWI A;  3LP0 A;  2R7Y A;  4EP5 A;  4B9V A;  4CIG A;  1HJR A;  4CEB A;  1N6Q A;  4M3U A;  3QEX A;  1WSG A;  5H1S Q;  2A6A A;  3SMP A;  3VQ8 A;  3MK6 A;  3RMA A;  4CJL A;  2DFE A;  3LDL A;  3VA0 A;  4MLE A;  3KLF A;  1MWM A;  3UB5 A;  2E88 A;  1Q9X A;  2O8D B;  3LPT A;  2PYL A;  3O1B A;  2F7T A;  3QEP A;  2GV9 A;  5AQV A;  3NVK A;  1KCF A;  1NNE A;  2O8C A;  1NJX A;  1RDB A;  1QHA A;  2HW3 A;  3SUO A;  4H5V A;  5C42 A;  1UA1 A;  3CER A;  1GLD G;  2IIR A;  4CEA A;  4JI5 K;  4YOV A;  4DS5 A;  4Z4H A;  1IBL K;  3CCR N;  4B1W B;  3R8E A;  3MN5 A;  4DF8 A;  3QBW A;  4HUG A;  3QIO A;  1QSY A;  1BQM A;  3SUP A;  2KLA A;  3I55 N;  3MAQ A;  2BE2 A;  2FBY A;  4JKB A;  2G8F A;  1G15 A;  5KGW A;  4JNE A;  1GLE G;  1X9M A;  4GW6 A;  4BVO A;  3NGZ A;  3BUZ B;  4BE0 A;  3GBT A;  1T3V A;  3KKS A;  1YI2 N;  5CE3 A;  2Y1J A;  5HP1 A;  1QVF M;  1GLA G;  2FF3 B;  5I9E B;  1C1B A;  4OGC A;  3U9Z A;  1U48 A;  1ZBU A;  1L3V A;  3LM9 A;  3THY B;  2HHH K;  4FJH A;  3LPU A;  2QI2 A;  2ZGY A;  3F2K A;  3FGU A;  3QEV A;  4FWR A;  2DFH A;  2GWJ A;  2PY5 A;  3OYH A;  4BR9 A;  4JK8 A;  3CCL N;  3NFA A;  5J2N A;  3VPZ A;  3ULD A;  1YTA A;  1NMN A;  1VQK N;  4FZZ A;  2GX9 A;  4F2S A;  4JLH A;  2KW4 A;  4YOU A;  4Q5V A;  4YDU A;  1FW6 A;  3M8R A;  1QSS A;  4CJE A;  4DSJ A;  1RDD A;  4FVM A;  3MEC A;  1C0U A;  5KGX A;  2EWS A;  3BEX A;  2VG6 A;  4Q0B A;  4QS7 A;  2ZF5 O;  3HL8 A;  1K8K A;  3WQT A;  4FK0 A;  4WFN L;  2HHW A;  3P31 A;  4K42 A;  1WSI A;  3N4P A;  3LZI A;  4WQ4 A;  1Q8I A;  1QQN A;  5IT9 O;  2FSJ A;  2NLX A;  2WFB A;  3K9K A;  2XHB A;  1X9W A;  4RWT A;  3O3G A;  4PY5 A;  3V1O A;  3KIO A;  4YOY A;  4JI1 K;  1LWC A;  5AZJ A;  3RMB A;  5AJ3 K;  1RCH A;  3P5J A;  2Q3S A;  3KK7 A;  4OLB A;  4X62 K;  4B9N A;  3CCS N;  5J2P A;  3QIN A;  2H3G X;  4DUY K;  4DKW A;  2O8C B;  3C95 A;  3MWP A;  2F96 A;  4IO8 A;  2GEL A;  2B4J A;  3HRG A;  4CZL A;  1R59 O;  2WBN A;  3GG4 A;  5JIC A;  4FW2 A;  1QZ5 A;  4M3R A;  3S41 A;  3OYG A;  3T69 A;  3OYK A;  4OPA A;  1VQ7 N;  4XH5 A;  1IKV A;  4YHH K;  1QQO A;  4E7L A;  5F1X A;  5HRS A;  1C0M A;  4ZTF A;  3ZET A;  1VQN N;  3RRH A;  1JCE A;  1KAX A;  4XEI A;  5EVZ A;  5JLH A;  3CCM N;  4BRQ A;  3VEW A;  2O8F A;  3NGY A;  1C1A A;  4EP4 A;  3MXM A;  3LWL A;  4CBX A;  5EY4 A;  3T1H K;  1TUY A;  5AQG A;  4BC3 A;  1L3S A;  2VCP A;  1LCU A;  1OH7 A;  4CIF A;  1Z6R A;  1RTD A;  2UXB K;  5JVG L;  4FW1 A;  3VQ5 A;  2D1K A;  1RDA A;  4FLX A;  4HCB A;  4X66 K;  4CD3 A;  4CZM A;  1HNW K;  1M1K O;  4JKD A;  3CJA A;  1TK8 A;  1N34 K;  3L2U A;  2D0C A;  3AO4 A;  4JKF A;  4DV2 K;  4FJJ A;  4E7H A;  1TYQ A;  4CK1 A;  1YIJ N;  3K57 A;  4DTN A;  1YAG A;  1TAU A;  1E4G T;  2ZWH A;  3AGR A;  4NYN A;  1K73 O;  1RDU A;  3VTI A;  3CCQ N;  5HBM A;  1EWR A;  2WUS A;  3O9T A;  3HOT A;  5M1P A;  5AQY A;  3DLR A;  3ZT1 A;  1VQ8 N;  5AQZ A;  3J8A A;  2O4G A;  4H0O A;  1C0T A;  4CJQ A;  1HKB A;  5FPE A;  4DR6 K;  3AV9 A;  1K8K B;  1TGO A;  3AY9 A;  1WSJ A;  1TK0 A;  1S72 N;  1FKO A;  3P83 D;  3Q7C A;  3TPQ A;  4FL9 A;  3E1Y A;  4H0X B;  4LF9 K;  2HBL A;  4GVM A;  3U3G A;  4CK2 A;  5HRN A;  1EKE A;  1NGA A;  1NLV A;  3B8A X;  4F9O A;  2VGN A;  5AZJ B;  4B9S A;  4L3Q A;  3H6E A;  1U04 A;  4HWI A;  4JEP A;  3WXI A;  4PHT X;  3CCV N;  2E1Z A;  5AQF A;  3F73 A;  3SPZ A;  3DLE A;  3GDQ A;  4A2B A;  2YJF A;  2P1J A;  3TAM A;  4Y0W A;  3RVC A;  2OTJ N;  3L2R A;  1N32 K;  1Q82 O;  3AVC A;  3ZT2 A;  1VQ5 N;  3VOV A;  5AQQ A;  3EKU A;  4CGF A;  1HX1 A;  4MQ3 A;  3PIP L;  1VQ6 N;  3MCP A;  4EFH A;  1ASW A;  2PBD A;  4CF9 A;  5E84 A;  4LFA K;  3OYJ A;  3AVK A;  1A5X A;  3ZET B;  2YNH A;  1WSH A;  1Z26 A;  3T19 A;  4CEC A;  1S22 A;  1KVB A;  4KAZ A;  5M1O A;  2QM1 A;  3OS2 A;  3HPO A;  1U2V A;  1NGI A;  2O8F B;  3H46 O;  4BRO A;  3KD5 E;  3AVG A;  2E4L A;  2DFF A;  4DU4 A;  4EHT A;  1EX4 A;  3HSC A;  4CBW A;  3I33 A;  3SYZ A;  1J53 A;  4M7Y A;  3VQC A;  4X64 K;  3L2W A;  4FJ9 A;  2HOE A;  1ATR A;  1RT6 A;  5KPR A;  1CZA N;  4ICL A;  3D2F A;  3LDN A;  2F9W A;  5FLX O;  4O0J A;  4ISF A;  1HKC A;  5BRE A;  3AO2 A;  4LD0 A;  2QXL A;  1ZBF A;  3PSI A;  3VQ9 A;  4DV0 K;  4DFM A;  4DCH A;  4QS8 A;  3SJH A;  3D7E O;  4BRN A;  1BQN A;  1HNX K;  3NDK A;  4DSK A;  1VSF A;  1WLJ A;  4AHU A;  3VET A;  3PLA A;  4DTM A;  4G9Z A;  3VF6 A;  1TYQ B;  3HBT A;  4CK3 A;  4E1M A;  3SPY A;  3HM9 A;  1J9A A;  3V9Z A;  3FFK B;  3UE5 A;  3MWT A;  1S1T A;  4B1V A;  4KI6 A;  4BWJ A;  4B3T K;  2Q0U A;  2DY4 A;  1I3A A;  4AHC A;  4H0Y B;  1SL1 A;  3DOK A;  3QNN A;  1TL3 A;  2OPS A;  1NWK A;  1VQL N;  4MO4 A;  1RTI A;  1KAZ A;  2BTF A;  3AVM A;  4LF4 K;  4LSN A;  2UU9 K;  1KFS A;  4KI4 A;  4CJ3 A;  5FPM A;  4IFV A;  3PY8 A; 
#chains in the Genus database with same CATH homology
 4DSF A;  1O1W A;  3L2V A;  3TAR A;  1D8Y A;  4DFK A;  3M8P A;  4KHS A;  1BI4 B;  1XHX A;  5FRM A;  2BGG A;  4KTW A;  3JYT A;  3KK3 A;  2ETJ A;  1LWE A;  4N5S A;  3KLG A;  1HNI A;  4DFJ A;  3QET A;  2KZZ A;  2PZS A;  2YV0 X;  1BGX T;  1HRH A;  3TWH A;  4KHN A;  1W9H A;  5KTQ A;  4CHY A;  4HHT A;  3AVI A;  4OKJ A;  1KVA A;  2EHG A;  4DLG A;  4FLV A;  4DF4 A;  4HVJ A;  1Y97 A;  5DMR A;  4CJS A;  1HQU A;  4CIE A;  2DTU A;  1U4B A;  1YT3 A;  1S6P A;  4FJM A;  1RT1 A;  4DTR A;  1U47 A;  1QS4 A;  4KKO A;  1NK4 A;  2ZD1 A;  4W5N A;  1VSI A;  1MU2 A;  1X9S A;  1UWB A;  4HUE A;  4FJN A;  4W5Q A;  4FLT A;  4OLA A;  2ZQB A;  4E19 A;  1QHT A;  1XHZ A;  1S1X A;  1SV5 A;  2XY5 A;  4OJR A;  4BE2 A;  1ZBI A;  1RBT A;  3VQE A;  2X6N A;  1HYV A;  1SL2 A;  3SQ1 A;  3KLE A;  3HJF A;  4CFA A;  3HT3 A;  3PX4 A;  1QTM A;  1TKD A;  1S9G A;  1WN7 A;  3DRP A;  1T7P A;  4CCH A;  2KFZ A;  4BDY A;  3O4Q A;  3ZT3 A;  2QK9 A;  3C94 A;  4C8O A;  4CJ4 A;  3OJS A;  4DQQ A;  3ITH A;  4ELU A;  4Z4F A;  3SV3 A;  1Z25 A;  2D0B A;  3OYE A;  3B6O A;  5KRT A;  4IBN A;  1YTU A;  3RR7 A;  3LP0 A;  1L5U A;  1D5A A;  2R7Y A;  4EP5 A;  3PX6 A;  3SCX A;  1DLO A;  4CIG A;  1JXE A;  4B9V A;  2KFN A;  4CGJ A;  1HJR A;  3OS1 A;  4CEB A;  4AHT A;  4XIU A;  3QEX A;  1NJW A;  1WSG A;  1N6Q A;  4DSL A;  4M3U A;  2JLE A;  3VQ8 A;  3LZJ A;  3T3F A;  3RMA A;  3F9K A;  1RTJ A;  3AA5 X;  4DQS A;  4M3W A;  3HP6 A;  4F3T A;  4CJL A;  5T7B A;  2KQ2 A;  1NJZ A;  3G0Z A;  3LAN A;  1XWL A;  4C8N A;  3DI6 A;  2DFE A;  4I2P A;  3HST B;  4E89 A;  1A5V A;  3L2Q A;  2YNG A;  3KLF A;  3VA0 A;  4BDP A;  1RNH A;  4Z0U A;  1Q9X A;  4RG8 A;  1KLN A;  4J2E A;  4FK2 A;  3LPT A;  2PYL A;  2W42 A;  2G8I A;  4J2B A;  4W5R A;  2ATQ A;  4B9M A;  3QEP A;  1YVU A;  1KLM A;  4J2A A;  3HK2 A;  1IH7 A;  2GV9 A;  4ELT A;  4CJR A;  3D0P A;  1UAX A;  3DMJ A;  3ZSW A;  1KCF A;  3OYA A;  3S3N A;  4FYD A;  2RPI A;  2E6L A;  1JKH A;  4I9L A;  4O5B A;  4CF8 A;  4CHP A;  1RDB A;  1NJX A;  3DRR A;  5JS1 A;  4E7K A;  4B08 A;  4IG0 A;  2HW3 A;  4FXD A;  2Z1H A;  1BIS A;  1VSL A;  3SUO A;  5C42 A;  1UA1 A;  1REV A;  3O3H A;  4CEA A;  3LP2 A;  4CJP A;  4DS5 A;  4DTX A;  1CXQ A;  2HB5 A;  4Z4H A;  1SKW A;  4CJK A;  4OVL A;  1XI1 A;  2YHA A;  3TAG A;  1IKW A;  2G8V A;  3AA3 A;  4DF8 A;  4BDZ A;  4HUG A;  1RT2 A;  3KD1 E;  3QIO A;  1QSY A;  4KHW A;  1BQM A;  4LY7 A;  3SUP A;  1HQE A;  4DS4 A;  1EP4 A;  1LAV A;  2Z1J A;  3MAQ A;  2BE2 A;  2FBY A;  4AIL C;  1G15 A;  3SUQ A;  2IDO A;  5KGW A;  2G8F A;  4B8A B;  1TKX A;  3V1R A;  1JXB A;  3TAF A;  3CG7 A;  1X9M A;  1WSF A;  3B6P A;  1FXX A;  5JS2 A;  4HUF A;  4GW6 A;  4F2R A;  3DLG A;  5CZ1 A;  3NGZ A;  4QAG A;  2X74 A;  2OYQ A;  4N76 A;  2XY8 A;  5SWM A;  1VK0 A;  3DYA A;  3CYM A;  4BE0 A;  4F8R A;  3ZT0 A;  5I42 A;  3KKS A;  4MFB A;  3KK2 A;  3PO4 A;  1U49 A;  3TAN A;  4FJG A;  2Y1J A;  5J2Q A;  4Z4I A;  1RT4 A;  5HP1 A;  1NK8 A;  1LWF A;  3DLH A;  1ZBH A;  5I3U A;  3QEW A;  3G10 A;  4BE1 A;  4CHZ A;  4Z4G A;  1BIZ A;  1TV6 A;  3L8B A;  2QKB A;  1C1B A;  1ASV A;  2FBV A;  4OGC A;  4I2Q A;  4CEZ A;  3K5O A;  3EZ5 A;  1U48 A;  1RBU A;  1ZBU A;  3T1A A;  1CZB A;  1L3V A;  4Z4E A;  2IAJ A;  3V9U A;  4Y1D A;  3DRS A;  3V9W A;  4FJH A;  4I9Q A;  4KRF A;  2VWJ A;  4CF2 A;  4EZ6 A;  3LPU A;  4C8K A;  4CER A;  3LAK A;  3QES A;  1T05 A;  3UIQ A;  2OPR A;  4B8C A;  3SQ0 A;  4DTS A;  5D3G A;  3QEV A;  2YNI A;  3SNN A;  4PQU A;  4E3S A;  3O4N A;  2DFH A;  3ZSO A;  3FFI A;  4CGI A;  3BDP A;  3A2F A;  2PY5 A;  3OYH A;  4AHV A;  4B3O A;  3AA4 A;  3OYL A;  5EU7 A;  3AO3 A;  3KLH A;  3E01 A;  4QCL A;  1IKY A;  3NFA A;  5J2N A;  2WOM A;  4CJV A;  4CF1 A;  3ULD A;  1Q9Y A;  1YTA A;  1VSD A;  2RKI A;  2WON A;  4CES A;  4FZZ A;  4DLE A;  2HHQ A;  5CYQ A;  3SQ2 A;  1JLQ A;  4CEF A;  4E7I A;  4JLH A;  2KW4 A;  4F2S A;  4Q5V A;  2D0A A;  3AVJ A;  3CM6 A;  5CY4 A;  3ZT4 A;  4CJU A;  4Y1C A;  3M8R A;  4DWI A;  1ZBL A;  3U6F A;  3SV4 A;  1QSS A;  3CM5 A;  4NCA A;  2X78 A;  3NF7 A;  4KFB A;  4CJE A;  1RDD A;  4E7J A;  2OZS A;  4DSJ A;  3OYI A;  4FVM A;  3MEC A;  1C0U A;  5KGX A;  4KV8 A;  3HXM A;  1HYZ A;  2AJQ A;  2VG6 A;  4PA1 A;  3DLK A;  3V9S A;  3S3O A;  2F8T A;  3AA2 A;  4Q0B A;  1BCM A;  3S9H A;  3O3F A;  1HNV A;  1RTH A;  3HL8 A;  4I7F A;  2XY6 A;  4PWD A;  4FK0 A;  1VSE A;  1LW2 A;  2ZE2 A;  2HHW A;  3AVN A;  3RMC A;  3RWU A;  1NK5 A;  1WSI A;  4YFU A;  3LZI A;  1J5O A;  4W5T A;  5E41 A;  2HND A;  3QEI A;  1TKZ A;  1Q8I A;  1NK6 A;  2QXF A;  1ZYQ A;  5HLF A;  2XHB A;  1C1C A;  1X9W A;  4B9L A;  4H4M A;  5HRP A;  3QO9 A;  3O3G A;  2IOC A;  4O4G A;  4PY5 A;  4BWM A;  3V1O A;  1NOZ A;  3KIO A;  2HNZ A;  4M45 A;  5CYM A;  1LWC A;  2HHX A;  3RMB A;  2FBT A;  1WNS A;  1RCH A;  5C25 A;  3U3Y A;  1LAW A;  2D5R A;  3P5J A;  3WNG A;  1QE1 A;  2Q3S A;  3WNH A;  4DFP A;  4OLB A;  4FJL A;  4B9N A;  2YHB A;  2IC3 A;  3AVF A;  1JLE A;  5J2P A;  4AHS A;  3QIN A;  4JS5 A;  1VRT A;  1SUQ A;  3LDS A;  4HCC A;  3C95 A;  3CFP A;  4FJ7 A;  2F96 A;  1JLA A;  3L3V A;  2B4J A;  4DQI A;  1S1W A;  3ZSV A;  2YKN A;  5SZT A;  2XY7 A;  4KHU A;  1VRU A;  3NBP A;  1NKC A;  3KTQ A;  5KRS A;  1DTQ A;  4ID5 A;  3HP9 A;  3ZSR A;  3IAY A;  3VQP A;  2GUI A;  4FW2 A;  4DU1 A;  4M3R A;  1J54 A;  4GMJ B;  3OYG A;  3EY1 A;  4DTP A;  2G8U A;  3H08 A;  1WAJ A;  3IS9 A;  1FK9 A;  3NF6 A;  3KKR A;  2B5J A;  3OYK A;  4KRE A;  3V9X A;  1NK9 A;  4IKF A;  5FRN A;  3BGR A;  3QNO A;  3CQ8 A;  1NK7 A;  3ZSQ A;  4DMN A;  2OPQ A;  3OYM A;  1IKV A;  2X6S A;  4E7L A;  1DTT A;  3AO1 A;  4WE1 A;  3NH2 A;  3OY9 A;  3HPH A;  5HRS A;  2I5J A;  1C0M A;  4NYF A;  4ZTF A;  1JL2 A;  3WNF A;  3RRH A;  4C8L A;  4CHQ A;  4W5O A;  4FM1 A;  3I8D A;  1S1V A;  1BIU A;  1EXQ A;  1D9F A;  1ASU A;  3NGY A;  3LP1 A;  3NAE A;  1C1A A;  4EP4 A;  1TAQ A;  3MXM A;  3LWL A;  1NOY A;  3TAE A;  4ID1 A;  4O0I A;  4AHR A;  3MED A;  5FRO A;  3KJV A;  2Z1G A;  1L3S A;  2PYJ A;  3VA3 A;  4IG3 A;  3TAP A;  3MEE A;  3VQD A;  4CIF A;  1RTD A;  4OPJ A;  2HHU A;  1RBV A;  4JS4 A;  4R5P A;  1RBS A;  4FW1 A;  2YKM A;  3VQ5 A;  1RDA A;  3CFO A;  3HVR A;  4FLX A;  4FLW A;  5HRO A;  1NK0 A;  4E0D A;  4HCB A;  2HHT A;  4FLZ A;  2P51 A;  3D45 A;  1XC9 A;  1TK8 A;  2YNF A;  2VWK A;  3L3U A;  1KSP A;  3L2U A;  2HMI A;  2D0C A;  3AO4 A;  1UA0 A;  1U45 A;  1NKB A;  4FJJ A;  4CGH A;  4FK4 A;  1VSJ A;  4RW4 A;  4M3T A;  3ALY A;  3OYB A;  4CHN A;  4FLU A;  4K8Z A;  4IFY A;  4IDK A;  4E7H A;  1BHL A;  4CK1 A;  4RW7 A;  4CFC A;  1B9D A;  4LH4 A;  3K57 A;  4DTN A;  1N5Y A;  3TAQ A;  2A1R A;  1HYS A;  1BCO A;  5DK5 A;  4JRQ A;  1TAU A;  2OPP A;  4NYN A;  4DG1 A;  1CZ9 A;  5J1E A;  5HBM A;  3DLB A;  4RW8 A;  4ZTJ A;  3LAL A;  3VQA A;  3DLR A;  3ZT1 A;  5KI6 A;  4DU3 A;  4DTJ A;  2O4G A;  1HPZ A;  1JLF A;  3MXI A;  1C0T A;  4CJQ A;  2ITG A;  2FBX A;  3AV9 A;  1TGO A;  4F3O A;  4CGD A;  5CZ2 A;  3SUN A;  4FJ8 A;  1SKR A;  3ZSZ A;  1ITG A;  1WSJ A;  1TK0 A;  1IG9 A;  1BL3 A;  1FKO A;  3P83 D;  1S9E A;  3QIP A;  1HMV A;  3VQ4 A;  1TKT A;  1T8E A;  3DOL A;  2OZM A;  4FZY A;  2KZM A;  2XO7 A;  4NCB A;  1KTQ A;  3AVH A;  1BI4 A;  1LW0 A;  1X1P A;  3AVA A;  4GVM A;  3K5N A;  4HTU A;  3U3G A;  2P5G A;  4FJI A;  4FM2 A;  4KTQ A;  4K8X A;  4CK2 A;  5HRN A;  3V81 A;  4RW6 A;  1RBR A;  1EKE A;  3VQQ A;  1I39 A;  1W0H A;  4B9S A;  2E6M A;  3V6D A;  1U04 A;  3KLI A;  1RIL A;  4LSL A;  4O44 A;  4NCG A;  2G8W A;  3OJU A;  1UOC A;  1VSH A;  3SJJ A;  2F8S A;  3ZSY A;  1KVC A;  1B9F A;  2JGU A;  4AH9 A;  3OYD A;  3F73 A;  3DLE A;  3OYC A;  3SPZ A;  1TL1 A;  4FJ5 A;  4KHY A;  4OPK A;  2P1J A;  3RMD A;  3TAM A;  3JSM A;  3VQ7 A;  2EX3 A;  3RTV A;  4OGE A;  4DTU A;  1D9D A;  3L2R A;  3VN5 A;  1IO2 A;  3NGI A;  3SI6 A;  2G8H A;  1FKP A;  1SKS A;  3HYF A;  3NF9 A;  3RRG A;  1IKX A;  2NUB A;  4C8M A;  1QQC A;  1S5J A;  3AVC A;  1GOC A;  3QLH A;  3ZT2 A;  3NCI A;  2P5O A;  3V4I A;  3OYF A;  4RW9 A;  3PUF A;  2BDP A;  2HHV A;  3IG1 A;  4KTZ A;  4M41 A;  4FM0 A;  1RT5 A;  2HVH A;  4EZ9 A;  4CJT A;  3VQ6 A;  4CGF A;  4N56 A;  4CEQ A;  2VG7 A;  1L3T A;  4MQ3 A;  3HO1 A;  1VSK A;  4ELV A;  5HRR A;  3C6U A;  4JRP A;  4FCY A;  3ASM A;  3EYZ A;  4J2D A;  1ASW A;  4CF9 A;  4F4K A;  4H4O A;  3AVL A;  2KTQ A;  3OYJ A;  3AVK A;  2IS3 A;  4LH5 A;  3K58 A;  5J2M A;  3TAB A;  1T03 A;  4KB0 A;  3TR8 A;  4DQR A;  1A5X A;  4DSI A;  2YNH A;  1WSH A;  1Z26 A;  2VG5 A;  3T19 A;  3ZSX A;  4CEC A;  3PV8 A;  3PX0 A;  2RN2 A;  1KVB A;  1QSL A;  2A1S A;  1JLC A;  3VQB A;  3HPG A;  4KAZ A;  4KPY A;  4KHQ A;  4BAC A;  3OVN A;  3OS2 A;  3HPO A;  1L3U A;  5FDL A;  4FZX C;  1K6Y A;  1KFD A;  2Z1I A;  4Z4C A;  3S3M A;  1WAF A;  1KRP A;  3KD5 E;  3AVG A;  4CE9 A;  2E4L A;  4N47 A;  4G1Q A;  2DFF A;  4TSX A;  4DU4 A;  2GBZ A;  1EX4 A;  3NH1 A;  2XRI A;  2HHS A;  3SYZ A;  3P1G A;  3MXJ A;  1J53 A;  1CXU A;  1JLG A;  3VQC A;  3L2W A;  3AVB A;  3SZ2 A;  3TI0 A;  4FJ9 A;  1RT6 A;  3DM2 A;  3M8S A;  3LWM A;  4ICL A;  3CFR A;  1EET A;  3MEG A;  1JLB A;  1LV5 A;  1WSE A;  3K5L A;  3RR8 A;  4O0J A;  2FC0 A;  3THV A;  3AO2 A;  4LD0 A;  5C24 A;  1ZBF A;  1R0A A;  3KK1 A;  2B6A A;  3V1Q A;  4CGG A;  3VQ9 A;  4DFM A;  2QKK A;  1C6V A;  4M3Y A;  1BQN A;  2IGI A;  3NDK A;  1TK5 A;  4DSK A;  1VSF A;  1WLJ A;  1GOA A;  4AHU A;  3K59 A;  3QER A;  4PUO A;  1VSM A;  4DTM A;  4N41 A;  1SL0 A;  4UQG A;  2HNY A;  3LP3 A;  4CF0 A;  3I0R A;  1GOB A;  3NH0 A;  4CK3 A;  1CLQ A;  1RT3 A;  4E1M A;  3SPY A;  4E1N A;  1RT7 A;  3HM9 A;  1NKE A;  4CED A;  1JL1 A;  4FJX A;  3WNE A;  4DSE A;  3NE6 A;  1J9A A;  5K14 A;  1TVR A;  4CJW A;  4CFD A;  1S1T A;  4YNQ A;  3V9Z A;  2OA8 A;  3NF8 A;  1S6Q A;  4ZHR A;  4BWJ A;  3SQ4 A;  4KI6 A;  4B9T A;  1B92 A;  4OKE A;  3K5M A;  3PO5 A;  2DY4 A;  1I3A A;  1A5W A;  3LAM A;  3ISN C;  3M8Q A;  2BAN A;  4CEO A;  4FLY A;  4AHC A;  4M3X A;  4CHO A;  4OKK A;  1SL1 A;  2Y1I A;  3OS0 A;  2O4I A;  3DOK A;  3QNN A;  4M3Z A;  1TL3 A;  1S1U A;  3AO5 A;  4L8R B;  2OPS A;  1NJY A;  4KB1 A;  3K2P A;  4CJF A;  4QOZ B;  1RTI A;  4CEE A;  2LSN A;  4DQP A;  3AVM A;  4KO0 A;  1RDC A;  3OYN A;  4H8K A;  4LSN A;  1F21 A;  3NHG A;  4CJ5 A;  4DTO A;  2G8K A;  3ZCM A;  3HVT A;  4O55 A;  4CFB A;  1KFS A;  3I0S A;  2RF2 A;  3C6T A;  3IRX A;  4CJ3 A;  4B9U A;  4KI4 A;  4M42 A;  4IFV A;  4FJK A;  2HVI A;  3PY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...