3AVHA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avhA00
1C0UA 4F8RA 4HTUA 3TANA 2IC3A 4B9MA 4B9VA 4E7JA 3P83D 1DTTA 4DF4A 4FJMA 4LSNA 4EZ6A 4Q0BA 4CF2A 2F8TA 1C6VA 3G10A 4CF1A 1A5WA 1BIZA 2Z1HA 1EP4A 4E1MA 1VSMA 3NHGA 1RBVA 2B5JA 2OPRA 4FW1A 4CEBA 3O4NA 4HVJA 3KLFA 1DLOA 3OYNA 3NH2A 1N5YA 2KQ2A 4CGHA 4CHNA 2O4IA 4I2PA 5C25A 1Z25A 2PYLA 4ZTFA 4KHQA 1WSFA 3KLHA 3U3GA 1HRHA 3EZ5A 3M8QA 4HCBA 3NH1A 1ITGA 3LPUA 4FJLA 1KVBA 3VQCA 3TARA 1NKBA 2YNHA 3JYTA 1SUQA 3ITHA 4B9UA 3PO4A 4ZHRA 1BCOA 3U3YA 1UA0A 4CJUA 4DSLA 4NCBA 1R0AA 3AA2A 3L2RA 1SV5A 3ULDA 1S1TA 1VSKA 3NBPA 4I9LA 1KRPA 4CEEA 4IFVA 5CZ1A 3WNGA 4CF9A 4Z4CA 1QHTA 3TWHA 1TK8A 3OY9A 4PUOA 4O5BA 1LWFA 1TKDA 2HHWA 3P1GA 3AA3A 3AVIA 1TV6A 3K57A 4OJRA 4F3OA 3QINA 4F3TA 3I0RA 3OYIA 4KKOA 2IS3A 3KJVA 4FZYA 1RNHA 2P51A 1NJXA 4FCYA 3RRGA 1LW0A 1J53A 4DSEA 3PY8A 3ZT1A 1RTDA 2WONA 1XWLA 3MECA 3LP3A 2YNIA 1L3UA 5J2MA 3DLHA 5CYQA 1NK5A 3L2QA 1LWCA 3DI6A 4N47A 1NK6A 4FK4A 4CERA 1J5OA 3SPZA 1TKTA 3ZT3A 4FJIA 5CZ2A 2O4GA 4F2RA 2ATQA 4IG0A 1REVA 1TK0A 2A1RA 5E41A 3QNOA 2HHUA 3RMBA 4YNQA 4BDYA 4E19A 3HXMA 2D0CA 4FLXA 1RT3A 1I3AA 2G8HA 3NF7A 3AVKA 3ASMA 1KVAA 4GW6A 4CJ4A 1Q9YA 4AHTA 4ELUA 3OYDA 2BGGA 4G1QA 2DTUA 3AVHA 2G8KA 4Z4FA 4OVLA 4N56A 4F2SA 3DRRA 3DYAA 5CY4A 2GV9A 1O1WA 3ALYA 4LD0A 3K5MA 3QETA 1FXXA 3CFRA 3VQAA 1IG9A 4FJXA 4CGGA 1LAVA 1X9MA 3ZSZA 2DY4A 4QAGA 3ZT4A 1QSSA 1LWEA 1U04A 4E1NA 3V6DA 4FJ7A 3NDKA 3O3FA 5KRSA 1IKWA 2RN2A 1TL3A 5I3UA 2EX3A 3QLHA 2D0BA 5SWMA 4R5PA 2HVIA 1X9WA 2E6LA 3L2WA 4DMNA 4GVMA 4E0DA 3ZSWA 1GOBA 1RTIA 3HPHA 4W5OA 3VQ8A 3PV8A 4C8OA 5DMRA 3RMAA 3B6PA 4FXDA 4DTJA 3SNNA 2FBTA 3WNFA 3K58A 1CZBA 4FM1A 4FW2A 3V1RA 1ZYQA 1UWBA 2YKMA 1BI4A 4RW6A 1L5UA 1QTMA 4KAZA 2HHSA 2YV0X 3KLEA 4CIEA 1UA1A 3TAMA 3KLIA 4M3TA 3S9HA 1B9DA 3DMJA 1VRTA 4DS5A 4CGJA 1F21A 3MAQA 3LPTA 3QEIA 1RILA 4EP4A 3VQDA 4H4OA 4Z4HA 2GBZA 3OYBA 2RKIA 1JL2A 3QIOA 1JKHA 5FDLA 1JLCA 1T7PA 4PWDA 4PA1A 1SL2A 4AHSA 2OZMA 1CXUA 2X74A 1LAWA 4LY7A 4CIGA 3OYLA 1NK0A 3HJFA 2W42A 2PZSA 4OPKA 2G8UA 2QK9A 1ZBHA 3SCXA 4AH9A 5HP1A 3K2PA 5C24A 2QXFA 1HQUA 1JLFA 5FROA 3KD1E 4IG3A 4CFAA 4M3UA 1KCFA 4CEAA 1RDCA 4M3ZA 1A5VA 1Z26A 4BDPA 2FBYA 1UOCA 2XY8A 5CYMA 4AILC 3S3NA 2BDPA 4QCLA 4H8KA 3MXIA 5HBMA 4CE9A 4KB1A 1HYSA 3DM2A 4DQSA 4E89A 1KSPA 1JLGA 4I2QA 3OJUA 3UIQA 4BACA 2D5RA 1C1CA 3MEDA 3HM9A 3CYMA 3HP9A 1I39A 3MXMA 3DLBA 4FLWA 4W5QA 4DFKA 2E4LA 4CEOA 4O44A 3IAYA 1NK7A 2Y1JA 2HVHA 3PO5A 4W5NA 2PYJA 1IKVA 3CFOA 2G8FA 5KRTA 1JLAA 1VSLA 2Q3SA 1RT2A 5HLFA 1JLBA 1S6PA 4JLHA 1S5JA 3AVJA 4DSKA 3PUFA 1QSLA 3LAKA 3SUQA 3PX6A 1JXEA 3OYMA 4MQ3A 4FZXC 5HRRA 1RBTA 4B9LA 4DQRA 3DRSA 1G15A 2IDOA 1BCMA 3KIOA 2ZD1A 4EP5A 4IDKA 4DTXA 3SUOA 1HNIA 4J2EA 4O55A 1VSIA 2VG6A 3AV9A 3S3OA 1NJYA 3IRXA 4KFBA 5J2QA 1TVRA 4CIFA 5KGWA 4M42A 5I42A 3JSMA 2ZE2A 4CGIA 4FJ9A 1CXQA 1KVCA 3NF9A 4CJEA 2NUBA 3KK1A 4PY5A 4CECA 3D0PA 3V9WA 1KLNA 2YNGA 1C0TA 3OS0A 3ZSOA 2JGUA 2D0AA 3ZSXA 2IAJA 3AA5X 5J2PA 4CEFA 3SQ2A 2FBXA 1BQMA 3MEGA 2DFHA 3NAEA 1NK8A 3EY1A 1VRUA 4Z4EA 4BE2A 1VSDA 2KZZA 2HNZA 2X78A 3AVGA 4DLGA 3OYAA 4DQQA 4WE1A 2G8WA 4DSFA 4DWIA 4KTQA 2VWJA 4B8AB 1FKPA 3SQ0A 2OPSA 4I7FA 3KLGA 3QERA 1LW2A 5KI6A 3V9UA 4CK2A 3TAPA 4IFYA 4IKFA 4K8XA 4BWMA 4RW9A 4KHNA 1A5XA 3VQQA 4OGEA 4CFDA 3KD5E 3SV3A 2HNYA 1WSJA 3V9SA 1U4BA 3CG7A 1K6YA 4DSIA 1NJZA 1RDAA 2A1SA 4CEZA 3LP2A 3V9ZA 4N76A 4K8ZA 3OYEA 3EYZA 4KHUA 2KTQA 4FLVA 1J9AA 4FM0A 4FK0A 3RR7A 5J1EA 2DFEA 1HPZA 3ZSQA 3K5LA 1HQEA 1QSYA 2HB5A 4ICLA 4CK3A 4FJJA 1ZBIA 1JLEA 1WAFA 3S3MA 3AVLA 2KW4A 1WSGA 4CJFA 4CJRA 3FFIA 3KKSA 4RG8A 3LWLA 2ITGA 1L3VA 1S1UA 3RR8A 1VK0A 4CJWA 3PX0A 3HSTB 3C6UA 1EKEA 4NYNA 4F4KA 2B6AA 4HHTA 4KI6A 4E3SA 2XY7A 3KKRA 5SZTA 4KV8A 1VSEA 4CEDA 2IOCA 1WAJA 3M8SA 4XIUA 1EX4A 4CFBA 4NCAA 2IGIA 2AJQA 1N6QA 1C1BA 3VA0A 1S6QA 1GOCA 4C8MA 4KI4A 3VA3A 1Q8IA 3ZCMA 1ASVA 1SKRA 3VQ9A 4CK1A 1RBSA 1WNSA 1RT6A 4E7LA 3TABA 4B9SA 4DSJA 5HRPA 1NKEA 3VQ7A 1D9DA 1RDBA 4CJLA 3V4IA 1SKSA 2YHAA 2X6NA 3OVNA 4CFCA 1NJWA 5K14A 1VSFA 4KHYA 4FZZA 4O0IA 3WNHA 4Y1CA 3VQ4A 5HRNA 1KLMA 4M3WA 4CHZA 1JXBA 3DLGA 4RW8A 1RDDA 4E7HA 3TAEA 3CM6A 3U6FA 3KK3A 3E01A 5HRSA 4FJKA 2HW3A 4CESA 4LH4A 1RT7A 2BE2A 3P5JA 1NK9A 2HHXA 3QO9A 5DK5A 3ZT2A 3SQ4A 4OKEA 3OYGA 1XC9A 1WSIA 3LAMA 4W5TA 4HUEA 4FLUA 2FC0A 2XHBA 1QQCA 4AHRA 1U48A 4QOZB 3O3HA 3LWMA 3TR8A 3K59A 3ZT0A 2XY5A 4CEQA 2HHVA 4FVMA 3CFPA 2XRIA 2LSNA 4NYFA 4M3XA 3QNNA 2YNFA 1Q9XA 2OYQA 1ZBFA 2GUIA 3AO3A 4DS4A 1TL1A 3AVBA 3M8RA 2HHTA 4C8KA 3HYFA 1ZBUA 4FJ8A 3O3GA 1BISA 3F9KA 3SPYA 1HNVA 2OPPA 4CJSA 4DTSA 3AO4A 3NFAA 4RW4A 1UAXA 4BE0A 3CQ8A 1WSEA 3AVCA 3KK2A 3RTVA 1CLQA 1EETA 3C94A 1D9FA 4Z0UA 3DOKA 3CM5A 3DLEA 4O0JA 4KTWA 3K5NA 4J2AA 1YVUA 1C0MA 1B9FA 5C42A 4DTRA 4DQIA 5JS2A 4Z4IA 4CJKA 3NE6A 4DLEA 4DQPA 3T3FA 3V1QA 1ASUA 2X6SA 4NCGA 3H08A 4AHVA 1BL3A 1IKYA 3AVNA 3HPOA 4E7KA 4DU4A 4M3RA 4CHPA 3QEXA 1RT4A 1KTQA 4FM2A 1X9SA 4LH5A 1RT5A 4H4MA 4CF8A 1ZBLA 4C8LA 2F8SA 5JS1A 3VQPA 3NF8A 4W5RA 3IS9A 3AA4A 4KHSA 3SYZA 4Z4GA 2KZMA 4KPYA 4ID5A 4LSLA 1RTJA 1X1PA 4CJPA 1NOYA 2QKKA 3L3VA 4IBNA 3C95A 1Y97A 4J2BA 5FRNA 1RBRA 1IH7A 3O4QA 1YTUA 4CHOA 4DTPA 4ELVA 2Z1GA 2G8IA 5EU7A 1BIUA 4DFJA 3QEVA 3SUPA 1BGXT 3HK2A 4CGFA 4B9NA 3QEWA 2P1JA 1XHZA 1HJRA 3G0ZA 4AHCA 4YFUA 4HUFA 4FLTA 4J2DA 3L3UA 4KTZA 3OYJA 3PX4A 4C8NA 4Y1DA 3RMDA 3QIPA 4CHYA 3BGRA 4BDZA 1HYVA 4DFPA 3VQBA 3NCIA 5HROA 2QKBA 1HMVA 4HCCA 3SI6A 3L2VA 4KRFA 4Q5VA 1TAUA 2I5JA 4JS4A 4B08A 1TK5A 3VQEA 1KFSA 2BANA 3MEEA 2WOMA 3TAGA 4BWJA 3NGIA 4BE1A 4KB0A 3LZJA 1ASWA 3HVTA 2KFZA 1IKXA 4M45A 1RBUA 3QEPA 4GMJB 1W0HA 3DOLA 3TAQA 3AVFA 1C1AA 1D8YA 4CCHA 4FYDA 5KTQA 3AVMA 4PQUA 1WN7A 4OGCA 4OLBA 3LDSA 4CJQA 3V9XA 3VN5A 3RWUA 3HPGA 1YT3A 4CJ5A 3WNEA 4FJNA 1TGOA 3OYKA 3NGYA 1T03A 2PY5A 3D45A 3ZSRA 4CHQA 1DTQA 4OKKA 4CGDA 1WLJA 3HVRA 4N5SA 1YTAA 3BDPA 1HYZA 1QE1A 3IG1A 3LALA 3OS2A 4FLYA 2P5GA 2RPIA 3I0SA 3OYHA 2VG7A 3I8DA 4O4GA 3TI0A 3RRHA 3SZ2A 1JLQA 1FK9A 1CZ9A 3MXJA 3NH0A 1LV5A 1JL1A 1TAQA 1XI1A 2OA8A 3DLKA 4DTNA 3OYFA 1NKCA 4DU1A 4DFMA 1GOAA 1RTHA 1TKZA 3LP0A 5KGXA 3V81A 4B3OA 1VSHA 2B4JA 3ZSYA 3HP6A 3C6TA 1S9EA 3ZSVA 4DG1A 2G8VA 4OKJA 2VWKA 3F73A 4ZTJA 3DRPA 1VSJA 3L2UA 2ZQBA 3NGZA 1SKWA 4ELTA 2KFNA 3HL8A 2OPQA 4CF0A 3LANA 4AHUA 3OYCA 3SV4A 4CJTA 4KHWA 1W9HA 2E6MA 1J54A 4B8CA 4JRPA 4L8RB 3SQ1A 1SL1A 1L3SA 1NOZA 3NF6A 2RF2A 3L8BA 5D3GA 1U45A 1S1XA 1SL0A 4FJ5A 2JLEA 1QS4A 2VG5A 1B92A 1U49A 4B9TA 1TKXA 3KTQA 4DTUA 4CJ3A 4E7IA 4MFBA 2YKNA 3AO2A 4M41A 2HMIA 3VQ6A 2XY6A 3LP1A 1U47A 1L3TA 3T1AA 1BHLA 2P5OA 2HNDA 4DF8A 1RT1A 1BI4B 2ETJA 2Z1JA 4M3YA 1MU2A 3A2FA 3QESA 1RCHA 4FJGA 3OS1A 4I9QA 4N41A 2XO7A 4DU3A 4CJVA 1WSHA 3LZIA 3VQ5A 4JS5A 5J2NA 3RMCA 3SUNA 1T05A 3T19A 1D5AA 2OZSA 1KFDA 3ISNC 2HHQA 1NK4A 4ID1A 4KREA 1FKOA 3DLRA 4KO0A 3V1OA 4DTOA 1XHXA 3B6OA 3AVAA 1T8EA 3THVA 1S1VA 4FLZA 3AO1A 2FBVA 2EHGA 5T7BA 4EZ9A 2Z1IA 5FRMA 4DTMA 1S9GA 3OJSA 2F96A 2R7YA 4FJHA 1IO2A 3HT3A 3K5OA 4OPJA 4RW7A 3SJJA 4UQGA 2YHBA 3M8PA 4OLAA 2Y1IA 3AO5A 4TSXA 2DFFA 1BQNA 4HUGA 1S1WA 1EXQA 3HO1A 4JRQA 3TAFA 4FK2A
chains in the Genus database with same CATH superfamily
3HTVA 1C0UA 3NMUA 4HTUA 4B9MA 4B9VA 3Q7CA 4LSNA 3R1XA 4CF1A 1A5WA 1ZXOA 2Z1HA 1EP4A 3K59A 3D2FB 3DXMA 3KLFA 3CIPA 3OYNA 4PHTX 2PYLA 1QHAA 4ZTFA 5GINA 3EZ5A 3VTHA 3U3GA 1HRHA 1KAZA 3I8BA 3M8QA 4BRNA 3NH1A 1ITGA 1KVBA 4B9UA 3JYTA 1SUQA 3ITHA 4ZHRA 3CC2N 4CJUA 3J7YP 4JD2B 3ULDA 1JCFA 3TWHA 4Z4CA 3H3OB 2HHWA 2E2PA 1NGJA 2O8FB 3K57A 1OVQA 1ATRA 4F3OA 4JYAK 3QINA 3I0RA 2IS3A 3C6AA 4U67L 3WQTA 4FCYA 1LW0A 1J53A 4DSEA 3SBTA 3ENHA 3N4PA 3CC4N 2VGNA 3JS6A 2UUBK 3HRGA 5CYQA 3L2QA 1NK5A 4N47A 1NK6A 4V19S 4CERA 3MWPA 1J5OA 3ZT3A 2ATQA 4OO1J 3RSEA 2A1RA 3M6GA 4YNQA 4FLXA 3THXA 1RT3A 5IWAK 2G8HA 3FZLA 3ASMA 1KVAA 4ELUA 2BGGA 4AHTA 1NU0A 4G1QA 2H3GX 3AVHA 4DUZK 2G8KA 3CCEN 3DRRA 4LD0A 5CY4A 1FXXA 4CZJA 3A5OC 5FLXO 2QWOA 1X9MA 3DXKB 1ESVA 4JNEA 3EE8A 4E1NA 4FJ7A 2F7TA 2E20A 3O3FA 4LF9K 2RN2A 3BEXA 3EO3A 4BROA 4QS8A 5AZIA 4GVMA 1RTIA 5DMRA 4FXDA 3B6PA 2E1YA 3K58A 1CZBA 3KLEA 4M3TA 3SAGA 4DS5A 1SAZA 3VQDA 4H4OA 3UKRA 4B3SK 2GBZA 4QS9A 1KXPA 3I56N 1SL2A 3IFRA 2F9WA 5I9EB 2QK9A 4A5BA 3SCXA 4AH9A 5C24A 4FWLA 5FROA 2P9KA 3KD1E 4IG3A 3G6EN 4HTLA 3H3NO 1S72N 4M3ZA 3OTOK 4BDPA 4JKBA 3S3NA 2XY8A 3AARA 4JHDB 4CE9A 1HYSA 3A5NC 1BWFO 3DM2A 3WXKA 4DQSA 1KSPA 1QVFM 3CYMA 3DLBA 4W5QA 4MLEA 4B3MK 3O80A 2Y1JA 2HVHA 1U6ZA 2Q97A 5BR9A 1QZ6A 5KRTA 1JLAA 1S6PA 4B1WB 3K9KA 4BQLA 3PUFA 2KLAA 1QSLA 1NMDA 1WUAA 3A8YA 5EY4A 4BRMA 1BCMA 4IEEA 4DTXA 4EP5A 2VG6A 3K0SA 5J2QA 2IVOA 4CJEA 1NGHA 4IEIA 3FFKB 1KLNA 2O8EB 2YNGA 4DR3K 3J80O 3JAMO 3DJCA 3ZSXA 2IAJA 5J2PA 4CEFA 3MEGA 2DFHA 2VQEK 1NK8A 4Z4EA 5M1KA 2KZZA 3ZYYX 1Z05A 4DQQA 4K43A 1ZBSA 2OPSA 3TAPA 3CCQN 3VQQA 3SV3A 1VHXA 1K6YA 5F2RA 3EYZA 2ITMA 4KHUA 4FM0A 3IKMA 3F5TA 4DB3A 1HQEA 5BPLA 2HB5A 1QSYA 4LF4K 4A59A 1W97L 1E4GT 4JK9A 1JLEA 3S3MA 1HKCA 3FFIA 4RG8A 4R79A 1OH6A 4CJWA 4YOUA 2ZWHA 3PX0A 3HSTB 1EKEA 4KI6A 3O9RA 4E3SA 3KKRA 3M8SA 4CEDA 4XIUA 4CFBA 2AJQA 1C1BA 3TSQA 4C8MA 4NLCA 3ZCMA 1VAZA 3VQ9A 1RBSA 1WNSA 2OTLN 1VQMN 5FPEA 2ZJQL 1NGCA 1OH8A 1D9DA 4DR7K 1Y64A 3V4IA 1SKSA 2X6NA 1Q82O 1VSFA 4FZZA 4O0IA 4Y1CA 2Q0UA 3KHYA 1KLMA 1JXBA 3DLGA 3TAEA 2HW3A 3R9PA 3SQ4A 3VTIA 4W5TA 2FC0A 3KZBA 5M1NA 1QQCA 2XHBA 4AF1A 3LWMA 2FXUA 3O6WA 2HHVA 4FVMA 3CFPA 2XRIA 4NYFA 4BRAA 4M3XA 5AFUA 1Q9XA 1ZBFA 3AVBA 1N36K 2NRWA 2D0PA 3HYFA 1ZBUA 3O3GA 3VETA 3F9KA 3SPYA 4CJSA 3H6EA 4RW4A 4CI6A 4BE0A 4CBWA 3AVCA 3KK2A 3C94A 3TTCA 4Z0UA 3DOKA 4KTWA 1YVUA 1C0MA 5C42A 4DTRA 4LFCK 3NE6A 4DQPA 2X6SA 4NCGA 3HPOA 4DU4A 4LH5A 1RT5A 4PKGA 4CF8A 4DUYK 3J8AA 3AA4A 2W6KA 1BU6O 4ID5A 3WUHA 1RTJA 3A0IX 3L3VA 1Y97A 5FRNA 1IH7A 4CHOA 4DTPA 3IDHA 4I6MA 2UXCK 2Z1GA 1BIUA 3QEVA 4OPAA 4B9QA 4CGFA 4B9NA 5IT9O 1HJRA 5GIPA 4BR7A 5DM7L 3OYJA 2HBMA 1NNEA 4KHPK 2PFUA 3NCIA 2QKBA 3L2VA 1VQ6N 4BRGA 1ASWA 1RBUA 2IVNA 2CGLA 4B1ZA 3DOLA 3TAQA 1D8YA 5AFUH 4CCHA 4A62A 5JVGL 5E26A 4JKGB 3H46O 5KTQA 1WN7A 2E2QA 4OLBA 5AQXA 3LDSA 3CHWA 3V9XA 2PY5A 3NGYA 2HSTA 3D45A 3TTFA 3ID6A 4CGDA 1YF5L 1WLJA 4C1NK 3C65A 3BDPA 1LCUA 3I0SA 2VG7A 4H0XB 2RE2A 3TI0A 1VQKN 3RRHA 1JLQA 4K42A 1XI1A 5LL6Z 4IO9L 5EX5A 4DFMA 4CVNE 5KGXA 5HOOA 2P9UA 3HP6A 4DG1A 4J8FA 3ATVA 3CF5L 4ELTA 4Y0WA 2KFNA 2ZM6K 5C12A 4JV5K 3D2EB 1Q18A 3MX2A 5AQUA 4G9ZA 4X66K 3SQ1A 4MO5A 5C15A 3NF6A 2QWNA 2RF2A 4B1YB 2W41A 4FJ5A 1SL0A 2VG5A 2W40A 4B9TA 4DTUA 1QQNA 4DCHA 2P9SA 3AO2A 4M41A 2XY6A 1U47A 1L3TA 1OH5A 2HNDA 1BI4B 4B1XB 3A2FA 1RCHA 1IBMK 3VEZA 1C0FA 4JS5A 3VQ5A 1T05A 2GWKA 5CHIA 1NK4A 4CZGA 2V7ZA 4YY3K 3AVAA 1T8EA 4B1VA 2A3ZA 5FRMA 3ENBA 4OPJA 2FF6A 2YHBA 2Y1IA 3AO5A 4H0TB 4HUGA 4DHYA 4JRQA 3TAFA 3ULEA 3TANA 2IC3A 5BRDA 4E7JA 4LF7K 1C6VA 3G10A 1BIZA 5C10A 4E1MA 3NHGA 1VSMA 4CEBA 4HVJA 3R6MA 2O4IA 4CHNA 1KAXA 4I2PA 5C25A 1WSFA 4HCBA 1P8ZA 4FJLA 1NKBA 3D6RA 1LOTB 3PO4A 1BCOA 3U3YA 1UA0A 4DSLA 4JK8A 1R0AA 3L2RA 3FZHA 3O9UA 1S1TA 4EIAA 3NBPA 4CEEA 4IFVA 3WNGA 3CPEA 3OY9A 4O5BA 1TKDA 4CJ7A 4FL9A 3P1GA 1TV6A 3DWLA 4OJRA 3OYIA 1VQ9N 3KJVA 5AQVA 4KH5A 1NGBA 4YDUC 1RTDA 3O9SA 2WONA 1XWLA 3LP3A 2NRTA 3VGMA 5FPNA 5J2MA 2QWPA 1M90O 1TKTA 1VQLN 4FJIA 2D1KA 1REVA 3OBWA 4RWTA 3RMBA 4BDYA 5AQQA 3HXMA 2D0CA 1N8RO 3NF7A 4GW6A 2HF4A 5AR0A 4N56A 4F2SA 3O1WA 3CFRA 1EQYA 2AP1A 4H0YB 5JLFA 1IG9A 2HBKA 5AQSA 5M1QA 1MDUB 4QAGA 3ZT4A 1LWEA 3V6DA 2Q1NA 5KRSA 1IKWA 1TL3A 2EX3A 3QLHA 2D0BA 5SWMA 2HVIA 2KHOA 3C7NB 4DMNA 4E0DA 1GOBA 3B8AX 3WNFA 4WCEL 1BDGA 4FW2A 3V1RA 1UWBA 1ZYQA 4KAZA 3L4IA 2HHSA 4FWKA 2YV0X 3E1YA 2E2NA 5FPDA 4FWOA 4CGJA 3QEIA 1RILA 1TUUA 4EP4A 5AQMA 2YHYA 1JKHA 5FDLA 3WXJA 4AHSA 5ADXA 4CIGA 2HF3A 1LAWA 3OYLA 2FLOA 2OTJN 3OBYA 4XH4A 4X65K 5HP1A 4DV1K 2I7NA 1JLFA 3FR0A 4JKFA 1KCFA 5BRHA 3OA9A 2BDPA 4AILC 3P31A 4WQ4C 1CZAN 5HBMA 3P38A 3DLLL 4FO0A 4H0VB 4I2QA 5EXWA 4BACA 2D5RA 1C1CA 3MXMA 2QEXN 4CEOA 4L3QA 3PO5A 2FSJA 4PKIA 4MO4A 1XC3A 3AAQA 1RT2A 5HLFA 2CGJA 3BF1A 3VERA 1JXEA 3OYMA 4MQ3A 4FZXC 4B9LA 1RBTA 4JK7A 1VQNN 4DQRA 3TSPA 1HKBA 2IDOA 1MWMA 5CR4A 4M7YA 1XNQK 4CIFA 4M42A 4IOAL 4CGIA 1KVCA 3NF9A 3KK1A 4PL8A 3D0PA 3ATUA 4ILGB 4JKDA 3ZSOA 2JGUA 4B1UB 2E2OA 4A2BA 3K9JA 2FBXA 1P90A 1VRUA 3CCVN 4BE2A 4BQZA 5AZJB 5ADXH 2X78A 5BN9A 3CJAA 4WE1A 2G8WA 4DWIA 4KTQA 2VWJA 1FKPA 3SQ0A 3AGRA 3KLGA 3QERA 3TSUA 5KI6A 1N32K 3VF6A 4CK2A 1K8KA 4IKFA 4BWMA 3CERA 4CFDA 4CD1A 3CG7A 4BRHA 2A1SA 3V9ZA 5MLCQ 4FOEA 3OYEA 3MCPA 1HNZK 1NGEA 4KH4A 2E88A 2WTUA 4O8KA 3ZETA 5J1EA 2DFEA 3ZSQA 4H5RA 4ICLA 3WXIA 5TKWA 3EL2A 3LDPA 4BG9A 5AQPA 1WSGA 2KW4A 2P9LB 3AVLA 4CJRA 3KKSA 2P9IB 1VK0A 3C6UA 3HI0A 1ZC6A 4LFBK 1EWRA 2IOCA 1EX4A 1X3NA 2IGIA 1N6QA 3VA0A 3VA3A 1Q8IA 2IVPA 3GDQA 3ZEUA 4DV6K 3W0LA 1RT6A 5HRPA 3SMSA 1E4FT 1RDBA 1NJWA 4CFCA 4CZLA 3WNHA 4M3WA 5AQRA 1OH7A 2UUAK 4YDUA 4RW8A 4WFNL 1RDDA 3CM6A 3U6FA 4FJKA 4CESA 1RT7A 3LAMA 2ASPA 4FLUA 3QBXA 4AHRA 2O8CA 2QWRA 3TR8A 2XY5A 4H5TA 4BGAA 4A57A 2LSNA 2YHXA 2YNFA 3MCAB 2HHTA 2GUIA 2P9PA 3M8RA 5F1XA 1BISA 2WFBA 4DTSA 3NFAA 1UAXA 5C2DA 1WSEA 4M63C 3J7ZO 1U2VA 3GG4A 3J81O 1CLQA 3BUZB 1EETA 1WBBA 1WOQA 1GLEG 3DLEA 2JWLA 3K5NA 4J2AA 3HOSA 3V1QA 4BRDA 1L3VA 3H08A 4E7KA 5BREA 4DKWA 4CHPA 4GKJK 1RT4A 1KTQA 4FM2A 4YORA 4H4MA 4C8LA 1ZBLA 5JS1A 4KHSA 4Z4GA 5AQTA 3IS9A 3A5MC 2HOEA 3TTDA 3SYZA 4KPYA 4GY2B 4LSLA 1X1PA 4IBNA 3EKSA 4J2BA 1YTUA 4H5NA 4ELVA 1BGXT 3VEWA 1XHZA 4HUFA 4FLTA 1YITN 4JEPA 3H1QA 3DXMB 5C0YA 3PIPL 4CHYA 3CD6N 4BDZA 4XH1A 4F9OA 5HROA 4HCCA 4B08A 1M1KO 1KFSA 4PKHA 3MEEA 2WOMA 4BE1A 3LZJA 3EZWA 4M45A 4WQ4A 4FYDA 3I33A 4OGCA 5AQOA 2HBJA 3C0BA 4CJ5A 3WEEA 3WNEA 3W3DA 1TGOA 3OYKA 4NB4A 2QXLA 4CHQA 4OKKA 3M1FA 4FPBA 3HVRA 4DR2K 3Q7BA 4FWQA 2RPIA 2WBNA 3SJHA 1BA0A 2WUSA 4H0PA 3EEQA 4O4GA 4BRIA 3SZ2A 3MXJA 3NH0A 1TAQA 3DLKA 3RSEB 1HKGA 3CJ1A 4B3OA 3VOVA 2A41A 3ZSVA 4JI7K 3THXB 2VWKA 5EOYA 3F73A 4ZTJA 1NGIA 3DRPA 3NGZA 2GTDA 2ZGYA 2NRHA 2OPQA 4AHUA 1GLLO 4EHTA 1W9HA 5KQ8A 1J54A 3JXUA 4B8CA 1XMOK 4L8RB 5D3GA 1YXQA 1VQON 2VCPA 2CH5A 1TKXA 4BR2A 5AZIB 3MWTA 2IIRA 4FWRA 4KBOA 1RT1A 1K9MO 4M3YA 2NRZA 1VQ4N 4FJGA 4I9QA 2XO7A 4DU3A 3THYA 3RMCA 4OX9K 3J7AP 3THWA 2HHQA 3SMPA 2W6LA 3UKRB 3DLRA 3V1OA 3B6OA 3HBTA 5T7BA 4NO7A 1YJWN 2NNWA 2R7YA 2F96A 3HT3A 5FPMA 3PSFA 3M8PA 3NVMA 4OLAA 2P9KB 2DFFA 4CZHA 1S1WA 3HO1A 2NZTA 1YHQN 5LMUK 1HNWK 3T1HK 1DTTA 4FJMA 4Q0BA 4CF2A 2F8TA 1EO1A 4Z4FA 4GVEA 1RBVA 4YHHK 4FW1A 3O4NA 4DV7K 1MA9B 2KQ2A 1Z25A 4BR4A 3WT0A 3ZX2A 3PIOL 1SQKA 1Q86O 3VQCA 1WB9A 1VQPN 4NCBA 3AA2A 1SV5A 1VSKA 4I9LA 4CF9A 4JN4A 1QHTA 4DV3K 2FF3B 3CJCA 2NRRA 1LWFA 5M1FA 4BRKA 5C2FA 3AA3A 3AVIA 1QVGM 4KKOA 1RNHA 3LL3A 2P51A 3RRGA 2UU9K 5JICA 3ZT1A 3MECA 2YNIA 4EFHA 3U9DA 1L3UA 3DLHA 3LDQA 3DI6A 3G25A 3F9MA 5CZ2A 4K25A 2HHUA 5A2QO 2NRVA 2GUPA 4E19A 5BPNA 1I3AA 4DR4K 4YOXA 3AVKA 4CJ4A 5AJ3K 4K0KK 2A5XA 3GE1A 3IMXA 4PL7A 2HHHK 3DYAA 3K5MA 2GV9A 3QETA 2BTFA 3VQAA 1HNXK 4FJXA 1LAVA 2DY4A 4BRLA 4IOCL 2NLXA 1X9JA 3NDKA 5I3UA 1I94K 4CZKA 3KK7A 3MMVA 1X9WA 2E6LA 5LY3A 3L2WA 3HZ6A 1G99A 3U8XA 4W5OA 4C8OA 3HPHA 3PV8A 3VQ8A 3MN6A 4DTJA 3SNNA 1QTMA 2KKZA 3EKUA 5GAEP 1OVYA 3TAMA 3ID8A 3S9HA 1B9DA 3DMJA 4BY9C 5BPMA 4B3RK 3F2KA 1F21A 3MAQA 3LPTA 5LMNK 4Z4HA 3OYBA 4H5WA 1JLCA 1T7PA 4PWDA 3EE9A 4KH6A 2CGKA 5AQWA 2ASMA 2PAVA 5E84A 1CXUA 4LY7A 4WQ5C 2PZSA 1ZBHA 3K2PA 4YOTA 1NGDA 4IDHA 4CFAA 4CEAA 1RDCA 1Z26A 2YI1A 3FGUA 1UOCA 3E9PA 5CYMA 4QCLA 4C1NI 1Q81O 4H8KA 3MXIA 3T1YK 3VGKA 4KB1A 1SZ2A 4RTFD 4E89A 1JLGA 3OJUA 1E3MA 3D2FA 3HP9A 1I39A 4FLWA 4DFKA 4O44A 1RFQA 3IAYA 1NK7A 2YCHA 4A61A 4IFEA 1TUYA 2A6AA 2Q3SA 3BF3A 1KQSM 1JLBA 1S5JA 3AVJA 4DSKA 3P4IA 3E9OA 4JI4K 3LAKA 3O08A 5M1OA 3PX6A 3SUQA 5HRRA 1KC8O 5BR8K 2HMPA 3DRSA 5KQDA 1G15A 3CQYA 1ILYA 3KVGA 2ZD1A 4IDKA 1HNIA 3FE1A 2O8FA 4O55A 3H1VX 3UKUA 3AV9A 3S3OA 1NJYA 4KFBA 1TVRA 3O1BA 4IOXA 5I42A 3JSMA 4DV0K 4FJ9A 1GLJO 3LDNA 2NUBA 3LM2A 3E9LA 3VPZA 4CECA 3V9WA 1C0TA 3OS0A 2D0AA 4I6MB 3NAEA 2HNZA 4BC5A 3D7EO 4DSFA 4A2AA 3V9UA 3CCLN 1GLAG 4K8XA 1GLCG 4RW9A 1A5XA 4OGEA 4CZEA 3KD5E 4NLBA 3PLAA 4O5FA 2HNYA 1WSJA 3V9SA 4DSIA 1RDAA 4IJAA 4CEZA 3LP2A 4N76A 4K8ZA 5AQFA 3FZMA 2KTQA 1IV0A 1QQOA 1J9AA 3DXKA 4JKAA 4FK0A 3RR7A 4GV9A 1HPZA 3O8MA 3K5LA 4FJJA 4CK3A 1OKJA 1WAFA 4WYBA 4BR5A 1S1UA 3RR8A 2EWSA 5AQJA 4ILJA 4F4KA 2B6AA 4HHTA 3BY5A 4NCAA 1WAJA 1K8AO 4JI5K 3T7ZA 2D4WA 1C0GA 2V52B 2ZGZA 4ISGA 4CW7B 4KI4A 1ASVA 1SKRA 4B9SA 4MDAA 2E8AA 4DSJA 4MLHA 2VGMA 2P9UB 4BVPA 1NKEA 1TYQA 1NGFA 3VQ7A 3CI5A 4CJLA 4FK4A 2YHAA 2UUCK 5HRNA 4OPHA 5AQGA 3E01A 5HRSA 3P5JA 1NK9A 4OKEA 1XC9A 1HJOA 4HUEA 4JHDA 1U48A 4QOZB 1JCGA 3QFPA 2FSNA 5KPZA 1J6ZA 2P9SB 1XUPO 1SS6A 2OYQA 3AO3A 4DS4A 1TL1A 3VF4A 4C8KA 3EN9A 2OPPA 2GX9A 3L0QA 3AO4A 3WXLA 5AQNA 3HSCA 1NBWA 2JWKA 5ELZA 3RTVA 4YOVA 5TKYA 4O0JA 3CETA 3U9ZA 1B9FA 5JS2A 4CJKA 3T3FA 4AHVA 3AVNA 5DM6L 3QEXA 2ZJRL 1IG8A 2F8SA 4W5RA 4CBUA 2KZMA 4CJPA 1NOYA 2VWBA 4IXCA 2O8EA 2O8DA 3ULEB 1BUPA 5EU7A 3M3ZA 4DFJA 3P39A 3HK2A 2P1JA 4DR1K 4LF8K 3PX4A 4C8NA 3QIPA 3BGRA 1NWKA 3CQXA 1YAGA 4FPAA 1HYVA 4WQ5A 3VQBA 2QI2A 2I5JA 2OCEA 4MDBA 4EAHD 3CMAN 2BANA 4BWJA 3NGIA 3FLCO 1IKXA 3QEPA 4GMJB 3UKUB 3AVFA 3G4SN 3AVMA 2ASOA 3VN5A 1MWKA 2A40A 4FJNA 4WF9L 3SAHA 1DTQA 1BA1A 4YOYA 3DAWA 1S3XA 4N5SA 1HYZA 3LALA 3OS2A 1EWQA 4FLYA 4RCHA 2P5GA 4E1JA 3OYHA 4M7XA 4JI2K 3R8EA 4WFBL 3I8DA 3R3LA 2QWLA 1LV5A 1CZ9A 1JL1A 3VGLA 3MDQA 4JKCA 4DTNA 1GOAA 3LP0A 3C6TA 1S9EA 4JKEA 3VF2A 4OKJA 1W2BM 1SKWA 3HL8A 3G71N 5B8HA 3OYCA 2F4VK 4CJTA 3QB0A 4KHWA 4NXNK 5JMVA 1SL1A 1L3SA 3L8BA 1U45A 2WC9A 2O8BA 2JLEA 1QS4A 1B92A 1KD1O 2QM1A 4E7IA 4MFBA 3AY9A 1DGKN 5BRFA 3VQ6A 2HMIA 3AGKA 3LP1A 1BHLA 3GOIA 2QWQA 2P5OA 1IBKK 4DF8A 4IJNA 4DV4K 2ETJA 3L6QA 1BG3A 1MU2A 3QESA 2RHKA 5LJVA 4CJVA 3LZIA 5J2NA 1D5AA 1TYQB 3O4WA 3ISNC 4ID1A 1FKOA 1QQMA 2UXDK 3ZX3A 4DTOA 3CJBA 4XH5A 1S1VA 3AO1A 5JLHA 3OHRA 2QA4N 3CXCM 1NMNA 3GL1A 1S9GA 4FJHA 2CH6A 5CE3A 3K5OA 3SJJA 3NVKA 4CBXA 4UQGA 1T44A 4TSXA 1EXQA 1TK8A 4FK2A 3N4QA 4DV5K 4F8RA 3FZKA 3P83D 4DF4A 4CZIA 4EZ6A 5JVHL 4IO8A 5AQLA 3HM8A 2B5JA 2OPRA 5F0XA 1DLOA 5AQZA 3LM9A 3NH2A 4FWPA 1N5YA 4CGHA 1BOTO 4KHQA 3LDLA 3KLHA 3LPUA 1VQ8N 1RDUA 3TARA 2HBLA 2YNHA 4BR9A 4CZFA 2AA4A 1HUXA 2E1ZA 1KRPA 5CZ1A 4Z94A 2Q36A 4JKGA 4GNIA 1RGIA 1KAYA 4PUOA 5H1SQ 3WQUA 2YJEA 5AQIA 4FOIA 4F3TA 4QS7A 2O8DB 4FZYA 4NXMK 3VEVA 1NJXA 1YIJN 1FW6A 3PY8A 3BZKA 1HX1A 3TPQA 1LWCA 2UYTA 3SPZA 3QDKA 2J4RA 2O4GA 2QW9A 4IG0A 4F2RA 3SLCA 1TK0A 1ATNA 5E41A 3QNOA 1K8KB 5AQKA 1Q9YA 3VEOA 3OYDA 1IJJA 2DTUA 4OVLA 5M1PA 4BGBA 3SAFA 5AQHA 3D2EA 3ALYA 1O1WA 4X62K 4CGGA 3ZSZA 3ZETB 1QSSA 1U04A 2Q2RA 3KWIA 3LDOA 4XEIA 3QMLA 4AM6A 3O9TA 4BG8A 3KWGA 3IUCA 4R5PA 4ISFA 1T6CA 3ZSWA 1NGAA 4JKHA 3RMAA 4ISEA 2FBTA 4FM1A 1L5UA 2YKMA 1BI4A 4RW6A 4BVOA 4GKKK 4CIEA 1UA1A 3KLIA 2P9NA 1VRTA 3ZEUB 4O8UA 4BRCA 2RKIA 1JL2A 3QIOA 4H0OA 1W7AA 2GEMA 4PA1A 3WXMB 2OZMA 2X74A 1NK0A 3HJFA 1GLBG 2W42A 4JI3K 4OPKA 2G8UA 2Q0RA 2O8BB 2QXFA 1HQUA 2OANA 4M3UA 1A5VA 2GWJA 2FBYA 4LF5K 2O8CB 3FZFA 1GLFO 3UIQA 3MN5A 1JJ2M 1WBDA 3PSIA 3MEDA 3HM9A 2P9PB 1VQ5N 2E4LA 2QWMA 3HOTA 4W5NA 4U7BA 2PYJA 1IKVA 1D4XA 3CFOA 2G8FA 1VSLA 2Q31A 3H45C 4K41A 1FJGK 2VYPA 1U2VB 4JLHA 4JAXA 4BRQA 3L4QA 3TU5A 4H03B 3MN7A 4GV6A 2ZF5O 4CD3A 3CC7N 4BC4A 3KIOA 3SUOA 4J2EA 4DR5K 3QBWA 1VSIA 3MN9A 3IRXA 5KGWA 4BC2A 2ZE2A 1CXQA 2PBDA 3MK6A 4PY5A 2NRXA 1Q7YO 3A5LC 3UE5A 4DQ8A 3AA5X 3SQ2A 1BQMA 3RVCA 4B3TK 3EY1A 1VSDA 3T69A 3AVGA 4DLGA 3OYAA 3CJ9A 1NLVA 3CCRN 4B8AB 4I7FA 4H5VA 4UY8O 1LW2A 4IFYA 4KHNA 2FSKA 2I7PA 3VEXA 2E5LK 1NGGA 3AAPA 4EHUA 4DV2K 1U4BA 1NJZA 5LJWA 4FLVA 4BRPA 4FSVA 1ZBIA 3WEEB 3C7NA 4CJFA 1HLUA 4LFAK 3UB5A 3LWLA 2ITGA 1NG9A 4JI1K 4NYNA 3CCSN 2GELA 4FVUA 2XY7A 5SZTA 4KV8A 1VSEA 1NM1A 1V4SA 1S6QA 1GOCA 3GBTA 2A42A 3QFUA 2VQFK 4CZMA 4CK1A 4E7LA 3TABA 4IWVA 4KHYA 3OVNA 5K14A 3VQ4A 4CHZA 4E7HA 4C23A 3C6HA 3KK3A 1JCEA 4JI8K 1XNRK 4LH4A 2YX6A 2BE2A 3M5RA 2HHXA 3O9QA 3QO9A 5DK5A 3ZT2A 3OYGA 1WSIA 5AQYA 1S22A 3O3HA 1HPMA 3ZT0A 4CEQA 4YOWA 3QNNA 1N33K 3E66A 2YHWA 2P9NB 4FJ8A 1YVNA 3MX5A 1HNVA 3S41A 4ILHA 3ZLJA 3THYB 3CQ8A 1N34K 3ZX0A 1DEJA 1ATSA 2DPNA 4JI6K 1D9FA 3CM5A 3THWB 1GLDG 1IBLK 4Z4IA 4DQIA 4BRFA 4DLEA 1ASUA 4BC3A 1BL3A 1IKYA 1T6DA 4M3RA 3CCJN 4JD2A 1X9SA 1NJIO 3VQPA 3NF8A 3VEYA 3BZCA 4AM7A 3CJ7A 2QKKA 1T3VA 2V7YA 3C95A 1XMQK 1RBRA 3O4QA 5KPRA 1XQSC 4BREA 2G8IA 3SUPA 5AZJA 3QEWA 3G0ZA 4AHCA 4YFUA 4J2DA 1RDWX 3L3UA 4KTZA 4Y1DA 3RMDA 4DFPA 1V4TA 1HMVA 1TAUA 3SI6A 4KRFA 4Q5VA 4FWMA 4JS4A 1TK5A 3VQEA 3TAGA 3CCUN 4KB0A 3QICA 3HVTA 2KFZA 5GADP 1YJ9N 1J5EK 1W0HA 4FWSA 1C1AA 4IZ9A 4PQUA 4CJQA 1DT9A 3RWUA 3HPGA 4A5AA 3OW2M 1YT3A 1YUWA 1YI2N 3O5BA 1T03A 2F9TA 2P9LA 3ZSRA 5HL7L 4BR0A 1YJNN 2P9IA 3BP8A 1R59O 1YTAA 1QE1A 3IG1A 2BUPA 3ENOA 3CCMN 4GV3A 1DKGD 1FK9A 3VESA 1K73O 3CMEN 2OA8A 3VMFB 4FWNA 1HR0K 3OYFA 1NKCA 4DU1A 1RTHA 1TKZA 3V81A 4JI0K 1VSHA 2B4JA 3ZSYA 2ZJPL 2QTDA 2G8VA 3VENA 1VSJA 3L2UA 2ZQBA 3CPWM 4LF6K 4LC9B 4CF0A 3LANA 3SBGA 5GAHP 2YJFA 3SV4A 5GIOA 1Z6RA 2E6MA 4X64K 4JRPA 1NOZA 5GAGP 1X3MA 1S1XA 4HWIA 1U49A 3KTQA 4CJ3A 2YKNA 4DR6K 4WFAL 1BO5O 2UXBK 3T1AA 1VQ7N 1QZ5A 5KPTA 2Z1JA 3OS1A 1O13A 4N41A 3SUNA 1WSHA 3T19A 2OZSA 1KFDA 3SK3A 4KREA 4KO0A 1XHXA 3U4LA 3THVA 2V51B 4FLZA 2FBVA 2EHGA 4EZ9A 2D0OA 5BN8A 2Z1IA 4DTMA 3I55N 3OJSA 1IO2A 4RW7A 4AQYK 2BH1A 1H1VA 5EVZA 1BQNA
chains in the Genus database with same CATH topology
1C0UA 4F8RA 4HTUA 3TANA 2IC3A 4B9MA 4B9VA 4E7JA 3P83D 1DTTA 4DF4A 4FJMA 4LSNA 4EZ6A 4Q0BA 4CF2A 2F8TA 1C6VA 3G10A 4CF1A 1A5WA 1BIZA 2Z1HA 1EP4A 4E1MA 1VSMA 3NHGA 1RBVA 2B5JA 2OPRA 4FW1A 4CEBA 3O4NA 4HVJA 3KLFA 1DLOA 3OYNA 3NH2A 1N5YA 2KQ2A 4CGHA 4CHNA 2O4IA 4I2PA 5C25A 1Z25A 2PYLA 4ZTFA 4KHQA 1WSFA 3KLHA 3U3GA 1HRHA 3EZ5A 3M8QA 4HCBA 3NH1A 1ITGA 3LPUA 4FJLA 1KVBA 3VQCA 3TARA 1NKBA 2YNHA 3JYTA 1SUQA 3ITHA 4B9UA 3PO4A 4ZHRA 1BCOA 3U3YA 1UA0A 4CJUA 4DSLA 4NCBA 1R0AA 3AA2A 3L2RA 1SV5A 3ULDA 1S1TA 1VSKA 3NBPA 4I9LA 1KRPA 4CEEA 4IFVA 5CZ1A 3WNGA 4CF9A 4Z4CA 1QHTA 3TWHA 1TK8A 3OY9A 4PUOA 4O5BA 1LWFA 1TKDA 2HHWA 3P1GA 3AA3A 3AVIA 1TV6A 3K57A 4OJRA 4F3OA 3QINA 4F3TA 3I0RA 3OYIA 4KKOA 2IS3A 3KJVA 4FZYA 1RNHA 2P51A 1NJXA 4FCYA 3RRGA 1LW0A 1J53A 4DSEA 3PY8A 3ZT1A 1RTDA 2WONA 1XWLA 3MECA 3LP3A 2YNIA 1L3UA 5J2MA 3DLHA 5CYQA 1NK5A 3L2QA 1LWCA 3DI6A 4N47A 1NK6A 4FK4A 4CERA 1J5OA 3SPZA 1TKTA 3ZT3A 4FJIA 5CZ2A 2O4GA 4F2RA 2ATQA 4IG0A 1REVA 1TK0A 2A1RA 5E41A 3QNOA 2HHUA 3RMBA 4YNQA 4BDYA 4E19A 3HXMA 2D0CA 4FLXA 1RT3A 1I3AA 2G8HA 3NF7A 3AVKA 3ASMA 1KVAA 4GW6A 4CJ4A 1Q9YA 4AHTA 4ELUA 3OYDA 2BGGA 4G1QA 2DTUA 3AVHA 2G8KA 4Z4FA 4OVLA 4N56A 4F2SA 3DRRA 3DYAA 5CY4A 2GV9A 1O1WA 3ALYA 4LD0A 3K5MA 3QETA 1FXXA 3CFRA 3VQAA 1IG9A 4FJXA 4CGGA 1LAVA 1X9MA 3ZSZA 2DY4A 4QAGA 3ZT4A 1QSSA 1LWEA 1U04A 4E1NA 3V6DA 4FJ7A 3NDKA 3O3FA 5KRSA 1IKWA 2RN2A 1TL3A 5I3UA 2EX3A 3QLHA 2D0BA 5SWMA 4R5PA 2HVIA 1X9WA 2E6LA 3L2WA 4DMNA 4GVMA 4E0DA 3ZSWA 1GOBA 1RTIA 3HPHA 4W5OA 3VQ8A 3PV8A 4C8OA 5DMRA 3RMAA 3B6PA 4FXDA 4DTJA 3SNNA 2FBTA 3WNFA 3K58A 1CZBA 4FM1A 4FW2A 3V1RA 1ZYQA 1UWBA 2YKMA 1BI4A 4RW6A 1L5UA 1QTMA 4KAZA 2HHSA 2YV0X 3KLEA 4CIEA 1UA1A 3TAMA 3KLIA 4M3TA 3S9HA 1B9DA 3DMJA 1VRTA 4DS5A 4CGJA 1F21A 3MAQA 3LPTA 3QEIA 1RILA 4EP4A 3VQDA 4H4OA 4Z4HA 2GBZA 3OYBA 2RKIA 1JL2A 3QIOA 1JKHA 5FDLA 1JLCA 1T7PA 4PWDA 4PA1A 1SL2A 4AHSA 2OZMA 1CXUA 2X74A 1LAWA 4LY7A 4CIGA 3OYLA 1NK0A 3HJFA 2W42A 2PZSA 4OPKA 2G8UA 2QK9A 1ZBHA 3SCXA 4AH9A 5HP1A 3K2PA 5C24A 2QXFA 1HQUA 1JLFA 5FROA 3KD1E 4IG3A 4CFAA 4M3UA 1KCFA 4CEAA 1RDCA 4M3ZA 1A5VA 1Z26A 4BDPA 2FBYA 1UOCA 2XY8A 5CYMA 4AILC 3S3NA 2BDPA 4QCLA 4H8KA 3MXIA 5HBMA 4CE9A 4KB1A 1HYSA 3DM2A 4DQSA 4E89A 1KSPA 1JLGA 4I2QA 3OJUA 3UIQA 4BACA 2D5RA 1C1CA 3MEDA 3HM9A 3CYMA 3HP9A 1I39A 3MXMA 3DLBA 4FLWA 4W5QA 4DFKA 2E4LA 4CEOA 4O44A 3IAYA 1NK7A 2Y1JA 2HVHA 3PO5A 4W5NA 2PYJA 1IKVA 3CFOA 2G8FA 5KRTA 1JLAA 1VSLA 2Q3SA 1RT2A 5HLFA 1JLBA 1S6PA 4JLHA 1S5JA 3AVJA 4DSKA 3PUFA 1QSLA 3LAKA 3SUQA 3PX6A 1JXEA 3OYMA 4MQ3A 4FZXC 5HRRA 1RBTA 4B9LA 4DQRA 3DRSA 1G15A 2IDOA 1BCMA 3KIOA 2ZD1A 4EP5A 4IDKA 4DTXA 3SUOA 1HNIA 4J2EA 4O55A 1VSIA 2VG6A 3AV9A 3S3OA 1NJYA 3IRXA 4KFBA 5J2QA 1TVRA 4CIFA 5KGWA 4M42A 5I42A 3JSMA 2ZE2A 4CGIA 4FJ9A 1CXQA 1KVCA 3NF9A 4CJEA 2NUBA 3KK1A 4PY5A 4CECA 3D0PA 3V9WA 1KLNA 2YNGA 1C0TA 3OS0A 3ZSOA 2JGUA 2D0AA 3ZSXA 2IAJA 3AA5X 5J2PA 4CEFA 3SQ2A 2FBXA 1BQMA 3MEGA 2DFHA 3NAEA 1NK8A 3EY1A 1VRUA 4Z4EA 4BE2A 1VSDA 2KZZA 2HNZA 2X78A 3AVGA 4DLGA 3OYAA 4DQQA 4WE1A 2G8WA 4DSFA 4DWIA 4KTQA 2VWJA 4B8AB 1FKPA 3SQ0A 2OPSA 4I7FA 3KLGA 3QERA 1LW2A 5KI6A 3V9UA 4CK2A 3TAPA 4IFYA 4IKFA 4K8XA 4BWMA 4RW9A 4KHNA 1A5XA 3VQQA 4OGEA 4CFDA 3KD5E 3SV3A 2HNYA 1WSJA 3V9SA 1U4BA 3CG7A 1K6YA 4DSIA 1NJZA 1RDAA 2A1SA 4CEZA 3LP2A 3V9ZA 4N76A 4K8ZA 3OYEA 3EYZA 4KHUA 2KTQA 4FLVA 1J9AA 4FM0A 4FK0A 3RR7A 5J1EA 2DFEA 1HPZA 3ZSQA 3K5LA 1HQEA 1QSYA 2HB5A 4ICLA 4CK3A 4FJJA 1ZBIA 1JLEA 1WAFA 3S3MA 3AVLA 2KW4A 1WSGA 4CJFA 4CJRA 3FFIA 3KKSA 4RG8A 3LWLA 2ITGA 1L3VA 1S1UA 3RR8A 1VK0A 4CJWA 3PX0A 3HSTB 3C6UA 1EKEA 4NYNA 4F4KA 2B6AA 4HHTA 4KI6A 4E3SA 2XY7A 3KKRA 5SZTA 4KV8A 1VSEA 4CEDA 2IOCA 1WAJA 3M8SA 4XIUA 1EX4A 4CFBA 4NCAA 2IGIA 2AJQA 1N6QA 1C1BA 3VA0A 1S6QA 1GOCA 4C8MA 4KI4A 3VA3A 1Q8IA 3ZCMA 1ASVA 1SKRA 3VQ9A 4CK1A 1RBSA 1WNSA 1RT6A 4E7LA 3TABA 4B9SA 4DSJA 5HRPA 1NKEA 3VQ7A 1D9DA 1RDBA 4CJLA 3V4IA 1SKSA 2YHAA 2X6NA 3OVNA 4CFCA 1NJWA 5K14A 1VSFA 4KHYA 4FZZA 4O0IA 3WNHA 4Y1CA 3VQ4A 5HRNA 1KLMA 4M3WA 4CHZA 1JXBA 3DLGA 4RW8A 1RDDA 4E7HA 3TAEA 3CM6A 3U6FA 3KK3A 3E01A 5HRSA 4FJKA 2HW3A 4CESA 4LH4A 1RT7A 2BE2A 3P5JA 1NK9A 2HHXA 3QO9A 5DK5A 3ZT2A 3SQ4A 4OKEA 3OYGA 1XC9A 1WSIA 3LAMA 4W5TA 4HUEA 4FLUA 2FC0A 2XHBA 1QQCA 4AHRA 1U48A 4QOZB 3O3HA 3LWMA 3TR8A 3K59A 3ZT0A 2XY5A 4CEQA 2HHVA 4FVMA 3CFPA 2XRIA 2LSNA 4NYFA 4M3XA 3QNNA 2YNFA 1Q9XA 2OYQA 1ZBFA 2GUIA 3AO3A 4DS4A 1TL1A 3AVBA 3M8RA 2HHTA 4C8KA 3HYFA 1ZBUA 4FJ8A 3O3GA 1BISA 3F9KA 3SPYA 1HNVA 2OPPA 4CJSA 4DTSA 3AO4A 3NFAA 4RW4A 1UAXA 4BE0A 3CQ8A 1WSEA 3AVCA 3KK2A 3RTVA 1CLQA 1EETA 3C94A 1D9FA 4Z0UA 3DOKA 3CM5A 3DLEA 4O0JA 4KTWA 3K5NA 4J2AA 1YVUA 1C0MA 1B9FA 5C42A 4DTRA 4DQIA 5JS2A 4Z4IA 4CJKA 3NE6A 4DLEA 4DQPA 3T3FA 3V1QA 1ASUA 2X6SA 4NCGA 3H08A 4AHVA 1BL3A 1IKYA 3AVNA 3HPOA 4E7KA 4DU4A 4M3RA 4CHPA 3QEXA 1RT4A 1KTQA 4FM2A 1X9SA 4LH5A 1RT5A 4H4MA 4CF8A 1ZBLA 4C8LA 2F8SA 5JS1A 3VQPA 3NF8A 4W5RA 3IS9A 3AA4A 4KHSA 3SYZA 4Z4GA 2KZMA 4KPYA 4ID5A 4LSLA 1RTJA 1X1PA 4CJPA 1NOYA 2QKKA 3L3VA 4IBNA 3C95A 1Y97A 4J2BA 5FRNA 1RBRA 1IH7A 3O4QA 1YTUA 4CHOA 4DTPA 4ELVA 2Z1GA 2G8IA 5EU7A 1BIUA 4DFJA 3QEVA 3SUPA 1BGXT 3HK2A 4CGFA 4B9NA 3QEWA 2P1JA 1XHZA 1HJRA 3G0ZA 4AHCA 4YFUA 4HUFA 4FLTA 4J2DA 3L3UA 4KTZA 3OYJA 3PX4A 4C8NA 4Y1DA 3RMDA 3QIPA 4CHYA 3BGRA 4BDZA 1HYVA 4DFPA 3VQBA 3NCIA 5HROA 2QKBA 1HMVA 4HCCA 3SI6A 3L2VA 4KRFA 4Q5VA 1TAUA 2I5JA 4JS4A 4B08A 1TK5A 3VQEA 1KFSA 2BANA 3MEEA 2WOMA 3TAGA 4BWJA 3NGIA 4BE1A 4KB0A 3LZJA 1ASWA 3HVTA 2KFZA 1IKXA 4M45A 1RBUA 3QEPA 4GMJB 1W0HA 3DOLA 3TAQA 3AVFA 1C1AA 1D8YA 4CCHA 4FYDA 5KTQA 3AVMA 4PQUA 1WN7A 4OGCA 4OLBA 3LDSA 4CJQA 3V9XA 3VN5A 3RWUA 3HPGA 1YT3A 4CJ5A 3WNEA 4FJNA 1TGOA 3OYKA 3NGYA 1T03A 2PY5A 3D45A 3ZSRA 4CHQA 1DTQA 4OKKA 4CGDA 1WLJA 3HVRA 4N5SA 1YTAA 3BDPA 1HYZA 1QE1A 3IG1A 3LALA 3OS2A 4FLYA 2P5GA 2RPIA 3I0SA 3OYHA 2VG7A 3I8DA 4O4GA 3TI0A 3RRHA 3SZ2A 1JLQA 1FK9A 1CZ9A 3MXJA 3NH0A 1LV5A 1JL1A 1TAQA 1XI1A 2OA8A 3DLKA 4DTNA 3OYFA 1NKCA 4DU1A 4DFMA 1GOAA 1RTHA 1TKZA 3LP0A 5KGXA 3V81A 4B3OA 1VSHA 2B4JA 3ZSYA 3HP6A 3C6TA 1S9EA 3ZSVA 4DG1A 2G8VA 4OKJA 2VWKA 3F73A 4ZTJA 3DRPA 1VSJA 3L2UA 2ZQBA 3NGZA 1SKWA 4ELTA 2KFNA 3HL8A 2OPQA 4CF0A 3LANA 4AHUA 3OYCA 3SV4A 4CJTA 4KHWA 1W9HA 2E6MA 1J54A 4B8CA 4JRPA 4L8RB 3SQ1A 1SL1A 1L3SA 1NOZA 3NF6A 2RF2A 3L8BA 5D3GA 1U45A 1S1XA 1SL0A 4FJ5A 2JLEA 1QS4A 2VG5A 1B92A 1U49A 4B9TA 1TKXA 3KTQA 4DTUA 4CJ3A 4E7IA 4MFBA 2YKNA 3AO2A 4M41A 2HMIA 3VQ6A 2XY6A 3LP1A 1U47A 1L3TA 3T1AA 1BHLA 2P5OA 2HNDA 4DF8A 1RT1A 1BI4B 2ETJA 2Z1JA 4M3YA 1MU2A 3A2FA 3QESA 1RCHA 4FJGA 3OS1A 4I9QA 4N41A 2XO7A 4DU3A 4CJVA 1WSHA 3LZIA 3VQ5A 4JS5A 5J2NA 3RMCA 3SUNA 1T05A 3T19A 1D5AA 2OZSA 1KFDA 3ISNC 2HHQA 1NK4A 4ID1A 4KREA 1FKOA 3DLRA 4KO0A 3V1OA 4DTOA 1XHXA 3B6OA 3AVAA 1T8EA 3THVA 1S1VA 4FLZA 3AO1A 2FBVA 2EHGA 5T7BA 4EZ9A 2Z1IA 5FRMA 4DTMA 1S9GA 3OJSA 2F96A 2R7YA 4FJHA 1IO2A 3HT3A 3K5OA 4OPJA 4RW7A 3SJJA 4UQGA 2YHBA 3M8PA 4OLAA 2Y1IA 3AO5A 4TSXA 2DFFA 1BQNA 4HUGA 1S1WA 1EXQA 3HO1A 4JRQA 3TAFA 4FK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C0U A;  4F8R A;  4HTU A;  3TAN A;  2IC3 A;  4B9M A;  4B9V A;  4E7J A;  3P83 D;  1DTT A;  4DF4 A;  4FJM A;  4LSN A;  4EZ6 A;  4Q0B A;  4CF2 A;  2F8T A;  1C6V A;  3G10 A;  4CF1 A;  1A5W A;  1BIZ A;  2Z1H A;  1EP4 A;  4E1M A;  1VSM A;  3NHG A;  1RBV A;  2B5J A;  2OPR A;  4FW1 A;  4CEB A;  3O4N A;  4HVJ A;  3KLF A;  1DLO A;  3OYN A;  3NH2 A;  1N5Y A;  2KQ2 A;  4CGH A;  4CHN A;  2O4I A;  4I2P A;  5C25 A;  1Z25 A;  2PYL A;  4ZTF A;  4KHQ A;  1WSF A;  3KLH A;  3U3G A;  1HRH A;  3EZ5 A;  3M8Q A;  4HCB A;  3NH1 A;  1ITG A;  3LPU A;  4FJL A;  1KVB A;  3VQC A;  3TAR A;  1NKB A;  2YNH A;  3JYT A;  1SUQ A;  3ITH A;  4B9U A;  3PO4 A;  4ZHR A;  1BCO A;  3U3Y A;  1UA0 A;  4CJU A;  4DSL A;  4NCB A;  1R0A A;  3AA2 A;  3L2R A;  1SV5 A;  3ULD A;  1S1T A;  1VSK A;  3NBP A;  4I9L A;  1KRP A;  4CEE A;  4IFV A;  5CZ1 A;  3WNG A;  4CF9 A;  4Z4C A;  1QHT A;  3TWH A;  1TK8 A;  3OY9 A;  4PUO A;  4O5B A;  1LWF A;  1TKD A;  2HHW A;  3P1G A;  3AA3 A;  3AVI A;  1TV6 A;  3K57 A;  4OJR A;  4F3O A;  3QIN A;  4F3T A;  3I0R A;  3OYI A;  4KKO A;  2IS3 A;  3KJV A;  4FZY A;  1RNH A;  2P51 A;  1NJX A;  4FCY A;  3RRG A;  1LW0 A;  1J53 A;  4DSE A;  3PY8 A;  3ZT1 A;  1RTD A;  2WON A;  1XWL A;  3MEC A;  3LP3 A;  2YNI A;  1L3U A;  5J2M A;  3DLH A;  5CYQ A;  1NK5 A;  3L2Q A;  1LWC A;  3DI6 A;  4N47 A;  1NK6 A;  4FK4 A;  4CER A;  1J5O A;  3SPZ A;  1TKT A;  3ZT3 A;  4FJI A;  5CZ2 A;  2O4G A;  4F2R A;  2ATQ A;  4IG0 A;  1REV A;  1TK0 A;  2A1R A;  5E41 A;  3QNO A;  2HHU A;  3RMB A;  4YNQ A;  4BDY A;  4E19 A;  3HXM A;  2D0C A;  4FLX A;  1RT3 A;  1I3A A;  2G8H A;  3NF7 A;  3AVK A;  3ASM A;  1KVA A;  4GW6 A;  4CJ4 A;  1Q9Y A;  4AHT A;  4ELU A;  3OYD A;  2BGG A;  4G1Q A;  2DTU A;  3AVH A;  2G8K A;  4Z4F A;  4OVL A;  4N56 A;  4F2S A;  3DRR A;  3DYA A;  5CY4 A;  2GV9 A;  1O1W A;  3ALY A;  4LD0 A;  3K5M A;  3QET A;  1FXX A;  3CFR A;  3VQA A;  1IG9 A;  4FJX A;  4CGG A;  1LAV A;  1X9M A;  3ZSZ A;  2DY4 A;  4QAG A;  3ZT4 A;  1QSS A;  1LWE A;  1U04 A;  4E1N A;  3V6D A;  4FJ7 A;  3NDK A;  3O3F A;  5KRS A;  1IKW A;  2RN2 A;  1TL3 A;  5I3U A;  2EX3 A;  3QLH A;  2D0B A;  5SWM A;  4R5P A;  2HVI A;  1X9W A;  2E6L A;  3L2W A;  4DMN A;  4GVM A;  4E0D A;  3ZSW A;  1GOB A;  1RTI A;  3HPH A;  4W5O A;  3VQ8 A;  3PV8 A;  4C8O A;  5DMR A;  3RMA A;  3B6P A;  4FXD A;  4DTJ A;  3SNN A;  2FBT A;  3WNF A;  3K58 A;  1CZB A;  4FM1 A;  4FW2 A;  3V1R A;  1ZYQ A;  1UWB A;  2YKM A;  1BI4 A;  4RW6 A;  1L5U A;  1QTM A;  4KAZ A;  2HHS A;  2YV0 X;  3KLE A;  4CIE A;  1UA1 A;  3TAM A;  3KLI A;  4M3T A;  3S9H A;  1B9D A;  3DMJ A;  1VRT A;  4DS5 A;  4CGJ A;  1F21 A;  3MAQ A;  3LPT A;  3QEI A;  1RIL A;  4EP4 A;  3VQD A;  4H4O A;  4Z4H A;  2GBZ A;  3OYB A;  2RKI A;  1JL2 A;  3QIO A;  1JKH A;  5FDL A;  1JLC A;  1T7P A;  4PWD A;  4PA1 A;  1SL2 A;  4AHS A;  2OZM A;  1CXU A;  2X74 A;  1LAW A;  4LY7 A;  4CIG A;  3OYL A;  1NK0 A;  3HJF A;  2W42 A;  2PZS A;  4OPK A;  2G8U A;  2QK9 A;  1ZBH A;  3SCX A;  4AH9 A;  5HP1 A;  3K2P A;  5C24 A;  2QXF A;  1HQU A;  1JLF A;  5FRO A;  3KD1 E;  4IG3 A;  4CFA A;  4M3U A;  1KCF A;  4CEA A;  1RDC A;  4M3Z A;  1A5V A;  1Z26 A;  4BDP A;  2FBY A;  1UOC A;  2XY8 A;  5CYM A;  4AIL C;  3S3N A;  2BDP A;  4QCL A;  4H8K A;  3MXI A;  5HBM A;  4CE9 A;  4KB1 A;  1HYS A;  3DM2 A;  4DQS A;  4E89 A;  1KSP A;  1JLG A;  4I2Q A;  3OJU A;  3UIQ A;  4BAC A;  2D5R A;  1C1C A;  3MED A;  3HM9 A;  3CYM A;  3HP9 A;  1I39 A;  3MXM A;  3DLB A;  4FLW A;  4W5Q A;  4DFK A;  2E4L A;  4CEO A;  4O44 A;  3IAY A;  1NK7 A;  2Y1J A;  2HVH A;  3PO5 A;  4W5N A;  2PYJ A;  1IKV A;  3CFO A;  2G8F A;  5KRT A;  1JLA A;  1VSL A;  2Q3S A;  1RT2 A;  5HLF A;  1JLB A;  1S6P A;  4JLH A;  1S5J A;  3AVJ A;  4DSK A;  3PUF A;  1QSL A;  3LAK A;  3SUQ A;  3PX6 A;  1JXE A;  3OYM A;  4MQ3 A;  4FZX C;  5HRR A;  1RBT A;  4B9L A;  4DQR A;  3DRS A;  1G15 A;  2IDO A;  1BCM A;  3KIO A;  2ZD1 A;  4EP5 A;  4IDK A;  4DTX A;  3SUO A;  1HNI A;  4J2E A;  4O55 A;  1VSI A;  2VG6 A;  3AV9 A;  3S3O A;  1NJY A;  3IRX A;  4KFB A;  5J2Q A;  1TVR A;  4CIF A;  5KGW A;  4M42 A;  5I42 A;  3JSM A;  2ZE2 A;  4CGI A;  4FJ9 A;  1CXQ A;  1KVC A;  3NF9 A;  4CJE A;  2NUB A;  3KK1 A;  4PY5 A;  4CEC A;  3D0P A;  3V9W A;  1KLN A;  2YNG A;  1C0T A;  3OS0 A;  3ZSO A;  2JGU A;  2D0A A;  3ZSX A;  2IAJ A;  3AA5 X;  5J2P A;  4CEF A;  3SQ2 A;  2FBX A;  1BQM A;  3MEG A;  2DFH A;  3NAE A;  1NK8 A;  3EY1 A;  1VRU A;  4Z4E A;  4BE2 A;  1VSD A;  2KZZ A;  2HNZ A;  2X78 A;  3AVG A;  4DLG A;  3OYA A;  4DQQ A;  4WE1 A;  2G8W A;  4DSF A;  4DWI A;  4KTQ A;  2VWJ A;  4B8A B;  1FKP A;  3SQ0 A;  2OPS A;  4I7F A;  3KLG A;  3QER A;  1LW2 A;  5KI6 A;  3V9U A;  4CK2 A;  3TAP A;  4IFY A;  4IKF A;  4K8X A;  4BWM A;  4RW9 A;  4KHN A;  1A5X A;  3VQQ A;  4OGE A;  4CFD A;  3KD5 E;  3SV3 A;  2HNY A;  1WSJ A;  3V9S A;  1U4B A;  3CG7 A;  1K6Y A;  4DSI A;  1NJZ A;  1RDA A;  2A1S A;  4CEZ A;  3LP2 A;  3V9Z A;  4N76 A;  4K8Z A;  3OYE A;  3EYZ A;  4KHU A;  2KTQ A;  4FLV A;  1J9A A;  4FM0 A;  4FK0 A;  3RR7 A;  5J1E A;  2DFE A;  1HPZ A;  3ZSQ A;  3K5L A;  1HQE A;  1QSY A;  2HB5 A;  4ICL A;  4CK3 A;  4FJJ A;  1ZBI A;  1JLE A;  1WAF A;  3S3M A;  3AVL A;  2KW4 A;  1WSG A;  4CJF A;  4CJR A;  3FFI A;  3KKS A;  4RG8 A;  3LWL A;  2ITG A;  1L3V A;  1S1U A;  3RR8 A;  1VK0 A;  4CJW A;  3PX0 A;  3HST B;  3C6U A;  1EKE A;  4NYN A;  4F4K A;  2B6A A;  4HHT A;  4KI6 A;  4E3S A;  2XY7 A;  3KKR A;  5SZT A;  4KV8 A;  1VSE A;  4CED A;  2IOC A;  1WAJ A;  3M8S A;  4XIU A;  1EX4 A;  4CFB A;  4NCA A;  2IGI A;  2AJQ A;  1N6Q A;  1C1B A;  3VA0 A;  1S6Q A;  1GOC A;  4C8M A;  4KI4 A;  3VA3 A;  1Q8I A;  3ZCM A;  1ASV A;  1SKR A;  3VQ9 A;  4CK1 A;  1RBS A;  1WNS A;  1RT6 A;  4E7L A;  3TAB A;  4B9S A;  4DSJ A;  5HRP A;  1NKE A;  3VQ7 A;  1D9D A;  1RDB A;  4CJL A;  3V4I A;  1SKS A;  2YHA A;  2X6N A;  3OVN A;  4CFC A;  1NJW A;  5K14 A;  1VSF A;  4KHY A;  4FZZ A;  4O0I A;  3WNH A;  4Y1C A;  3VQ4 A;  5HRN A;  1KLM A;  4M3W A;  4CHZ A;  1JXB A;  3DLG A;  4RW8 A;  1RDD A;  4E7H A;  3TAE A;  3CM6 A;  3U6F A;  3KK3 A;  3E01 A;  5HRS A;  4FJK A;  2HW3 A;  4CES A;  4LH4 A;  1RT7 A;  2BE2 A;  3P5J A;  1NK9 A;  2HHX A;  3QO9 A;  5DK5 A;  3ZT2 A;  3SQ4 A;  4OKE A;  3OYG A;  1XC9 A;  1WSI A;  3LAM A;  4W5T A;  4HUE A;  4FLU A;  2FC0 A;  2XHB A;  1QQC A;  4AHR A;  1U48 A;  4QOZ B;  3O3H A;  3LWM A;  3TR8 A;  3K59 A;  3ZT0 A;  2XY5 A;  4CEQ A;  2HHV A;  4FVM A;  3CFP A;  2XRI A;  2LSN A;  4NYF A;  4M3X A;  3QNN A;  2YNF A;  1Q9X A;  2OYQ A;  1ZBF A;  2GUI A;  3AO3 A;  4DS4 A;  1TL1 A;  3AVB A;  3M8R A;  2HHT A;  4C8K A;  3HYF A;  1ZBU A;  4FJ8 A;  3O3G A;  1BIS A;  3F9K A;  3SPY A;  1HNV A;  2OPP A;  4CJS A;  4DTS A;  3AO4 A;  3NFA A;  4RW4 A;  1UAX A;  4BE0 A;  3CQ8 A;  1WSE A;  3AVC A;  3KK2 A;  3RTV A;  1CLQ A;  1EET A;  3C94 A;  1D9F A;  4Z0U A;  3DOK A;  3CM5 A;  3DLE A;  4O0J A;  4KTW A;  3K5N A;  4J2A A;  1YVU A;  1C0M A;  1B9F A;  5C42 A;  4DTR A;  4DQI A;  5JS2 A;  4Z4I A;  4CJK A;  3NE6 A;  4DLE A;  4DQP A;  3T3F A;  3V1Q A;  1ASU A;  2X6S A;  4NCG A;  3H08 A;  4AHV A;  1BL3 A;  1IKY A;  3AVN A;  3HPO A;  4E7K A;  4DU4 A;  4M3R A;  4CHP A;  3QEX A;  1RT4 A;  1KTQ A;  4FM2 A;  1X9S A;  4LH5 A;  1RT5 A;  4H4M A;  4CF8 A;  1ZBL A;  4C8L A;  2F8S A;  5JS1 A;  3VQP A;  3NF8 A;  4W5R A;  3IS9 A;  3AA4 A;  4KHS A;  3SYZ A;  4Z4G A;  2KZM A;  4KPY A;  4ID5 A;  4LSL A;  1RTJ A;  1X1P A;  4CJP A;  1NOY A;  2QKK A;  3L3V A;  4IBN A;  3C95 A;  1Y97 A;  4J2B A;  5FRN A;  1RBR A;  1IH7 A;  3O4Q A;  1YTU A;  4CHO A;  4DTP A;  4ELV A;  2Z1G A;  2G8I A;  5EU7 A;  1BIU A;  4DFJ A;  3QEV A;  3SUP A;  1BGX T;  3HK2 A;  4CGF A;  4B9N A;  3QEW A;  2P1J A;  1XHZ A;  1HJR A;  3G0Z A;  4AHC A;  4YFU A;  4HUF A;  4FLT A;  4J2D A;  3L3U A;  4KTZ A;  3OYJ A;  3PX4 A;  4C8N A;  4Y1D A;  3RMD A;  3QIP A;  4CHY A;  3BGR A;  4BDZ A;  1HYV A;  4DFP A;  3VQB A;  3NCI A;  5HRO A;  2QKB A;  1HMV A;  4HCC A;  3SI6 A;  3L2V A;  4KRF A;  4Q5V A;  1TAU A;  2I5J A;  4JS4 A;  4B08 A;  1TK5 A;  3VQE A;  1KFS A;  2BAN A;  3MEE A;  2WOM A;  3TAG A;  4BWJ A;  3NGI A;  4BE1 A;  4KB0 A;  3LZJ A;  1ASW A;  3HVT A;  2KFZ A;  1IKX A;  4M45 A;  1RBU A;  3QEP A;  4GMJ B;  1W0H A;  3DOL A;  3TAQ A;  3AVF A;  1C1A A;  1D8Y A;  4CCH A;  4FYD A;  5KTQ A;  3AVM A;  4PQU A;  1WN7 A;  4OGC A;  4OLB A;  3LDS A;  4CJQ A;  3V9X A;  3VN5 A;  3RWU A;  3HPG A;  1YT3 A;  4CJ5 A;  3WNE A;  4FJN A;  1TGO A;  3OYK A;  3NGY A;  1T03 A;  2PY5 A;  3D45 A;  3ZSR A;  4CHQ A;  1DTQ A;  4OKK A;  4CGD A;  1WLJ A;  3HVR A;  4N5S A;  1YTA A;  3BDP A;  1HYZ A;  1QE1 A;  3IG1 A;  3LAL A;  3OS2 A;  4FLY A;  2P5G A;  2RPI A;  3I0S A;  3OYH A;  2VG7 A;  3I8D A;  4O4G A;  3TI0 A;  3RRH A;  3SZ2 A;  1JLQ A;  1FK9 A;  1CZ9 A;  3MXJ A;  3NH0 A;  1LV5 A;  1JL1 A;  1TAQ A;  1XI1 A;  2OA8 A;  3DLK A;  4DTN A;  3OYF A;  1NKC A;  4DU1 A;  4DFM A;  1GOA A;  1RTH A;  1TKZ A;  3LP0 A;  5KGX A;  3V81 A;  4B3O A;  1VSH A;  2B4J A;  3ZSY A;  3HP6 A;  3C6T A;  1S9E A;  3ZSV A;  4DG1 A;  2G8V A;  4OKJ A;  2VWK A;  3F73 A;  4ZTJ A;  3DRP A;  1VSJ A;  3L2U A;  2ZQB A;  3NGZ A;  1SKW A;  4ELT A;  2KFN A;  3HL8 A;  2OPQ A;  4CF0 A;  3LAN A;  4AHU A;  3OYC A;  3SV4 A;  4CJT A;  4KHW A;  1W9H A;  2E6M A;  1J54 A;  4B8C A;  4JRP A;  4L8R B;  3SQ1 A;  1SL1 A;  1L3S A;  1NOZ A;  3NF6 A;  2RF2 A;  3L8B A;  5D3G A;  1U45 A;  1S1X A;  1SL0 A;  4FJ5 A;  2JLE A;  1QS4 A;  2VG5 A;  1B92 A;  1U49 A;  4B9T A;  1TKX A;  3KTQ A;  4DTU A;  4CJ3 A;  4E7I A;  4MFB A;  2YKN A;  3AO2 A;  4M41 A;  2HMI A;  3VQ6 A;  2XY6 A;  3LP1 A;  1U47 A;  1L3T A;  3T1A A;  1BHL A;  2P5O A;  2HND A;  4DF8 A;  1RT1 A;  1BI4 B;  2ETJ A;  2Z1J A;  4M3Y A;  1MU2 A;  3A2F A;  3QES A;  1RCH A;  4FJG A;  3OS1 A;  4I9Q A;  4N41 A;  2XO7 A;  4DU3 A;  4CJV A;  1WSH A;  3LZI A;  3VQ5 A;  4JS5 A;  5J2N A;  3RMC A;  3SUN A;  1T05 A;  3T19 A;  1D5A A;  2OZS A;  1KFD A;  3ISN C;  2HHQ A;  1NK4 A;  4ID1 A;  4KRE A;  1FKO A;  3DLR A;  4KO0 A;  3V1O A;  4DTO A;  1XHX A;  3B6O A;  3AVA A;  1T8E A;  3THV A;  1S1V A;  4FLZ A;  3AO1 A;  2FBV A;  2EHG A;  5T7B A;  4EZ9 A;  2Z1I A;  5FRM A;  4DTM A;  1S9G A;  3OJS A;  2F96 A;  2R7Y A;  4FJH A;  1IO2 A;  3HT3 A;  3K5O A;  4OPJ A;  4RW7 A;  3SJJ A;  4UQG A;  2YHB A;  3M8P A;  4OLA A;  2Y1I A;  3AO5 A;  4TSX A;  2DFF A;  1BQN A;  4HUG A;  1S1W A;  1EXQ A;  3HO1 A;  4JRQ A;  3TAF A;  4FK2 A; 
#chains in the Genus database with same CATH topology
 3HTV A;  1C0U A;  3NMU A;  4HTU A;  4B9M A;  4B9V A;  3Q7C A;  4LSN A;  3R1X A;  4CF1 A;  1A5W A;  1ZXO A;  2Z1H A;  1EP4 A;  3K59 A;  3D2F B;  3DXM A;  3KLF A;  3CIP A;  3OYN A;  4PHT X;  2PYL A;  1QHA A;  4ZTF A;  5GIN A;  3EZ5 A;  3VTH A;  3U3G A;  1HRH A;  1KAZ A;  3I8B A;  3M8Q A;  4BRN A;  3NH1 A;  1ITG A;  1KVB A;  4B9U A;  3JYT A;  1SUQ A;  3ITH A;  4ZHR A;  3CC2 N;  4CJU A;  3J7Y P;  4JD2 B;  3ULD A;  1JCF A;  3TWH A;  4Z4C A;  3H3O B;  2HHW A;  2E2P A;  1NGJ A;  2O8F B;  3K57 A;  1OVQ A;  1ATR A;  4F3O A;  4JYA K;  3QIN A;  3I0R A;  2IS3 A;  3C6A A;  4U67 L;  3WQT A;  4FCY A;  1LW0 A;  1J53 A;  4DSE A;  3SBT A;  3ENH A;  3N4P A;  3CC4 N;  2VGN A;  3JS6 A;  2UUB K;  3HRG A;  5CYQ A;  3L2Q A;  1NK5 A;  4N47 A;  1NK6 A;  4V19 S;  4CER A;  3MWP A;  1J5O A;  3ZT3 A;  2ATQ A;  4OO1 J;  3RSE A;  2A1R A;  3M6G A;  4YNQ A;  4FLX A;  3THX A;  1RT3 A;  5IWA K;  2G8H A;  3FZL A;  3ASM A;  1KVA A;  4ELU A;  2BGG A;  4AHT A;  1NU0 A;  4G1Q A;  2H3G X;  3AVH A;  4DUZ K;  2G8K A;  3CCE N;  3DRR A;  4LD0 A;  5CY4 A;  1FXX A;  4CZJ A;  3A5O C;  5FLX O;  2QWO A;  1X9M A;  3DXK B;  1ESV A;  4JNE A;  3EE8 A;  4E1N A;  4FJ7 A;  2F7T A;  2E20 A;  3O3F A;  4LF9 K;  2RN2 A;  3BEX A;  3EO3 A;  4BRO A;  4QS8 A;  5AZI A;  4GVM A;  1RTI A;  5DMR A;  4FXD A;  3B6P A;  2E1Y A;  3K58 A;  1CZB A;  3KLE A;  4M3T A;  3SAG A;  4DS5 A;  1SAZ A;  3VQD A;  4H4O A;  3UKR A;  4B3S K;  2GBZ A;  4QS9 A;  1KXP A;  3I56 N;  1SL2 A;  3IFR A;  2F9W A;  5I9E B;  2QK9 A;  4A5B A;  3SCX A;  4AH9 A;  5C24 A;  4FWL A;  5FRO A;  2P9K A;  3KD1 E;  4IG3 A;  3G6E N;  4HTL A;  3H3N O;  1S72 N;  4M3Z A;  3OTO K;  4BDP A;  4JKB A;  3S3N A;  2XY8 A;  3AAR A;  4JHD B;  4CE9 A;  1HYS A;  3A5N C;  1BWF O;  3DM2 A;  3WXK A;  4DQS A;  1KSP A;  1QVF M;  3CYM A;  3DLB A;  4W5Q A;  4MLE A;  4B3M K;  3O80 A;  2Y1J A;  2HVH A;  1U6Z A;  2Q97 A;  5BR9 A;  1QZ6 A;  5KRT A;  1JLA A;  1S6P A;  4B1W B;  3K9K A;  4BQL A;  3PUF A;  2KLA A;  1QSL A;  1NMD A;  1WUA A;  3A8Y A;  5EY4 A;  4BRM A;  1BCM A;  4IEE A;  4DTX A;  4EP5 A;  2VG6 A;  3K0S A;  5J2Q A;  2IVO A;  4CJE A;  1NGH A;  4IEI A;  3FFK B;  1KLN A;  2O8E B;  2YNG A;  4DR3 K;  3J80 O;  3JAM O;  3DJC A;  3ZSX A;  2IAJ A;  5J2P A;  4CEF A;  3MEG A;  2DFH A;  2VQE K;  1NK8 A;  4Z4E A;  5M1K A;  2KZZ A;  3ZYY X;  1Z05 A;  4DQQ A;  4K43 A;  1ZBS A;  2OPS A;  3TAP A;  3CCQ N;  3VQQ A;  3SV3 A;  1VHX A;  1K6Y A;  5F2R A;  3EYZ A;  2ITM A;  4KHU A;  4FM0 A;  3IKM A;  3F5T A;  4DB3 A;  1HQE A;  5BPL A;  2HB5 A;  1QSY A;  4LF4 K;  4A59 A;  1W97 L;  1E4G T;  4JK9 A;  1JLE A;  3S3M A;  1HKC A;  3FFI A;  4RG8 A;  4R79 A;  1OH6 A;  4CJW A;  4YOU A;  2ZWH A;  3PX0 A;  3HST B;  1EKE A;  4KI6 A;  3O9R A;  4E3S A;  3KKR A;  3M8S A;  4CED A;  4XIU A;  4CFB A;  2AJQ A;  1C1B A;  3TSQ A;  4C8M A;  4NLC A;  3ZCM A;  1VAZ A;  3VQ9 A;  1RBS A;  1WNS A;  2OTL N;  1VQM N;  5FPE A;  2ZJQ L;  1NGC A;  1OH8 A;  1D9D A;  4DR7 K;  1Y64 A;  3V4I A;  1SKS A;  2X6N A;  1Q82 O;  1VSF A;  4FZZ A;  4O0I A;  4Y1C A;  2Q0U A;  3KHY A;  1KLM A;  1JXB A;  3DLG A;  3TAE A;  2HW3 A;  3R9P A;  3SQ4 A;  3VTI A;  4W5T A;  2FC0 A;  3KZB A;  5M1N A;  1QQC A;  2XHB A;  4AF1 A;  3LWM A;  2FXU A;  3O6W A;  2HHV A;  4FVM A;  3CFP A;  2XRI A;  4NYF A;  4BRA A;  4M3X A;  5AFU A;  1Q9X A;  1ZBF A;  3AVB A;  1N36 K;  2NRW A;  2D0P A;  3HYF A;  1ZBU A;  3O3G A;  3VET A;  3F9K A;  3SPY A;  4CJS A;  3H6E A;  4RW4 A;  4CI6 A;  4BE0 A;  4CBW A;  3AVC A;  3KK2 A;  3C94 A;  3TTC A;  4Z0U A;  3DOK A;  4KTW A;  1YVU A;  1C0M A;  5C42 A;  4DTR A;  4LFC K;  3NE6 A;  4DQP A;  2X6S A;  4NCG A;  3HPO A;  4DU4 A;  4LH5 A;  1RT5 A;  4PKG A;  4CF8 A;  4DUY K;  3J8A A;  3AA4 A;  2W6K A;  1BU6 O;  4ID5 A;  3WUH A;  1RTJ A;  3A0I X;  3L3V A;  1Y97 A;  5FRN A;  1IH7 A;  4CHO A;  4DTP A;  3IDH A;  4I6M A;  2UXC K;  2Z1G A;  1BIU A;  3QEV A;  4OPA A;  4B9Q A;  4CGF A;  4B9N A;  5IT9 O;  1HJR A;  5GIP A;  4BR7 A;  5DM7 L;  3OYJ A;  2HBM A;  1NNE A;  4KHP K;  2PFU A;  3NCI A;  2QKB A;  3L2V A;  1VQ6 N;  4BRG A;  1ASW A;  1RBU A;  2IVN A;  2CGL A;  4B1Z A;  3DOL A;  3TAQ A;  1D8Y A;  5AFU H;  4CCH A;  4A62 A;  5JVG L;  5E26 A;  4JKG B;  3H46 O;  5KTQ A;  1WN7 A;  2E2Q A;  4OLB A;  5AQX A;  3LDS A;  3CHW A;  3V9X A;  2PY5 A;  3NGY A;  2HST A;  3D45 A;  3TTF A;  3ID6 A;  4CGD A;  1YF5 L;  1WLJ A;  4C1N K;  3C65 A;  3BDP A;  1LCU A;  3I0S A;  2VG7 A;  4H0X B;  2RE2 A;  3TI0 A;  1VQK N;  3RRH A;  1JLQ A;  4K42 A;  1XI1 A;  5LL6 Z;  4IO9 L;  5EX5 A;  4DFM A;  4CVN E;  5KGX A;  5HOO A;  2P9U A;  3HP6 A;  4DG1 A;  4J8F A;  3ATV A;  3CF5 L;  4ELT A;  4Y0W A;  2KFN A;  2ZM6 K;  5C12 A;  4JV5 K;  3D2E B;  1Q18 A;  3MX2 A;  5AQU A;  4G9Z A;  4X66 K;  3SQ1 A;  4MO5 A;  5C15 A;  3NF6 A;  2QWN A;  2RF2 A;  4B1Y B;  2W41 A;  4FJ5 A;  1SL0 A;  2VG5 A;  2W40 A;  4B9T A;  4DTU A;  1QQN A;  4DCH A;  2P9S A;  3AO2 A;  4M41 A;  2XY6 A;  1U47 A;  1L3T A;  1OH5 A;  2HND A;  1BI4 B;  4B1X B;  3A2F A;  1RCH A;  1IBM K;  3VEZ A;  1C0F A;  4JS5 A;  3VQ5 A;  1T05 A;  2GWK A;  5CHI A;  1NK4 A;  4CZG A;  2V7Z A;  4YY3 K;  3AVA A;  1T8E A;  4B1V A;  2A3Z A;  5FRM A;  3ENB A;  4OPJ A;  2FF6 A;  2YHB A;  2Y1I A;  3AO5 A;  4H0T B;  4HUG A;  4DHY A;  4JRQ A;  3TAF A;  3ULE A;  3TAN A;  2IC3 A;  5BRD A;  4E7J A;  4LF7 K;  1C6V A;  3G10 A;  1BIZ A;  5C10 A;  4E1M A;  3NHG A;  1VSM A;  4CEB A;  4HVJ A;  3R6M A;  2O4I A;  4CHN A;  1KAX A;  4I2P A;  5C25 A;  1WSF A;  4HCB A;  1P8Z A;  4FJL A;  1NKB A;  3D6R A;  1LOT B;  3PO4 A;  1BCO A;  3U3Y A;  1UA0 A;  4DSL A;  4JK8 A;  1R0A A;  3L2R A;  3FZH A;  3O9U A;  1S1T A;  4EIA A;  3NBP A;  4CEE A;  4IFV A;  3WNG A;  3CPE A;  3OY9 A;  4O5B A;  1TKD A;  4CJ7 A;  4FL9 A;  3P1G A;  1TV6 A;  3DWL A;  4OJR A;  3OYI A;  1VQ9 N;  3KJV A;  5AQV A;  4KH5 A;  1NGB A;  4YDU C;  1RTD A;  3O9S A;  2WON A;  1XWL A;  3LP3 A;  2NRT A;  3VGM A;  5FPN A;  5J2M A;  2QWP A;  1M90 O;  1TKT A;  1VQL N;  4FJI A;  2D1K A;  1REV A;  3OBW A;  4RWT A;  3RMB A;  4BDY A;  5AQQ A;  3HXM A;  2D0C A;  1N8R O;  3NF7 A;  4GW6 A;  2HF4 A;  5AR0 A;  4N56 A;  4F2S A;  3O1W A;  3CFR A;  1EQY A;  2AP1 A;  4H0Y B;  5JLF A;  1IG9 A;  2HBK A;  5AQS A;  5M1Q A;  1MDU B;  4QAG A;  3ZT4 A;  1LWE A;  3V6D A;  2Q1N A;  5KRS A;  1IKW A;  1TL3 A;  2EX3 A;  3QLH A;  2D0B A;  5SWM A;  2HVI A;  2KHO A;  3C7N B;  4DMN A;  4E0D A;  1GOB A;  3B8A X;  3WNF A;  4WCE L;  1BDG A;  4FW2 A;  3V1R A;  1UWB A;  1ZYQ A;  4KAZ A;  3L4I A;  2HHS A;  4FWK A;  2YV0 X;  3E1Y A;  2E2N A;  5FPD A;  4FWO A;  4CGJ A;  3QEI A;  1RIL A;  1TUU A;  4EP4 A;  5AQM A;  2YHY A;  1JKH A;  5FDL A;  3WXJ A;  4AHS A;  5ADX A;  4CIG A;  2HF3 A;  1LAW A;  3OYL A;  2FLO A;  2OTJ N;  3OBY A;  4XH4 A;  4X65 K;  5HP1 A;  4DV1 K;  2I7N A;  1JLF A;  3FR0 A;  4JKF A;  1KCF A;  5BRH A;  3OA9 A;  2BDP A;  4AIL C;  3P31 A;  4WQ4 C;  1CZA N;  5HBM A;  3P38 A;  3DLL L;  4FO0 A;  4H0V B;  4I2Q A;  5EXW A;  4BAC A;  2D5R A;  1C1C A;  3MXM A;  2QEX N;  4CEO A;  4L3Q A;  3PO5 A;  2FSJ A;  4PKI A;  4MO4 A;  1XC3 A;  3AAQ A;  1RT2 A;  5HLF A;  2CGJ A;  3BF1 A;  3VER A;  1JXE A;  3OYM A;  4MQ3 A;  4FZX C;  4B9L A;  1RBT A;  4JK7 A;  1VQN N;  4DQR A;  3TSP A;  1HKB A;  2IDO A;  1MWM A;  5CR4 A;  4M7Y A;  1XNQ K;  4CIF A;  4M42 A;  4IOA L;  4CGI A;  1KVC A;  3NF9 A;  3KK1 A;  4PL8 A;  3D0P A;  3ATU A;  4ILG B;  4JKD A;  3ZSO A;  2JGU A;  4B1U B;  2E2O A;  4A2B A;  3K9J A;  2FBX A;  1P90 A;  1VRU A;  3CCV N;  4BE2 A;  4BQZ A;  5AZJ B;  5ADX H;  2X78 A;  5BN9 A;  3CJA A;  4WE1 A;  2G8W A;  4DWI A;  4KTQ A;  2VWJ A;  1FKP A;  3SQ0 A;  3AGR A;  3KLG A;  3QER A;  3TSU A;  5KI6 A;  1N32 K;  3VF6 A;  4CK2 A;  1K8K A;  4IKF A;  4BWM A;  3CER A;  4CFD A;  4CD1 A;  3CG7 A;  4BRH A;  2A1S A;  3V9Z A;  5MLC Q;  4FOE A;  3OYE A;  3MCP A;  1HNZ K;  1NGE A;  4KH4 A;  2E88 A;  2WTU A;  4O8K A;  3ZET A;  5J1E A;  2DFE A;  3ZSQ A;  4H5R A;  4ICL A;  3WXI A;  5TKW A;  3EL2 A;  3LDP A;  4BG9 A;  5AQP A;  1WSG A;  2KW4 A;  2P9L B;  3AVL A;  4CJR A;  3KKS A;  2P9I B;  1VK0 A;  3C6U A;  3HI0 A;  1ZC6 A;  4LFB K;  1EWR A;  2IOC A;  1EX4 A;  1X3N A;  2IGI A;  1N6Q A;  3VA0 A;  3VA3 A;  1Q8I A;  2IVP A;  3GDQ A;  3ZEU A;  4DV6 K;  3W0L A;  1RT6 A;  5HRP A;  3SMS A;  1E4F T;  1RDB A;  1NJW A;  4CFC A;  4CZL A;  3WNH A;  4M3W A;  5AQR A;  1OH7 A;  2UUA K;  4YDU A;  4RW8 A;  4WFN L;  1RDD A;  3CM6 A;  3U6F A;  4FJK A;  4CES A;  1RT7 A;  3LAM A;  2ASP A;  4FLU A;  3QBX A;  4AHR A;  2O8C A;  2QWR A;  3TR8 A;  2XY5 A;  4H5T A;  4BGA A;  4A57 A;  2LSN A;  2YHX A;  2YNF A;  3MCA B;  2HHT A;  2GUI A;  2P9P A;  3M8R A;  5F1X A;  1BIS A;  2WFB A;  4DTS A;  3NFA A;  1UAX A;  5C2D A;  1WSE A;  4M63 C;  3J7Z O;  1U2V A;  3GG4 A;  3J81 O;  1CLQ A;  3BUZ B;  1EET A;  1WBB A;  1WOQ A;  1GLE G;  3DLE A;  2JWL A;  3K5N A;  4J2A A;  3HOS A;  3V1Q A;  4BRD A;  1L3V A;  3H08 A;  4E7K A;  5BRE A;  4DKW A;  4CHP A;  4GKJ K;  1RT4 A;  1KTQ A;  4FM2 A;  4YOR A;  4H4M A;  4C8L A;  1ZBL A;  5JS1 A;  4KHS A;  4Z4G A;  5AQT A;  3IS9 A;  3A5M C;  2HOE A;  3TTD A;  3SYZ A;  4KPY A;  4GY2 B;  4LSL A;  1X1P A;  4IBN A;  3EKS A;  4J2B A;  1YTU A;  4H5N A;  4ELV A;  1BGX T;  3VEW A;  1XHZ A;  4HUF A;  4FLT A;  1YIT N;  4JEP A;  3H1Q A;  3DXM B;  5C0Y A;  3PIP L;  4CHY A;  3CD6 N;  4BDZ A;  4XH1 A;  4F9O A;  5HRO A;  4HCC A;  4B08 A;  1M1K O;  1KFS A;  4PKH A;  3MEE A;  2WOM A;  4BE1 A;  3LZJ A;  3EZW A;  4M45 A;  4WQ4 A;  4FYD A;  3I33 A;  4OGC A;  5AQO A;  2HBJ A;  3C0B A;  4CJ5 A;  3WEE A;  3WNE A;  3W3D A;  1TGO A;  3OYK A;  4NB4 A;  2QXL A;  4CHQ A;  4OKK A;  3M1F A;  4FPB A;  3HVR A;  4DR2 K;  3Q7B A;  4FWQ A;  2RPI A;  2WBN A;  3SJH A;  1BA0 A;  2WUS A;  4H0P A;  3EEQ A;  4O4G A;  4BRI A;  3SZ2 A;  3MXJ A;  3NH0 A;  1TAQ A;  3DLK A;  3RSE B;  1HKG A;  3CJ1 A;  4B3O A;  3VOV A;  2A41 A;  3ZSV A;  4JI7 K;  3THX B;  2VWK A;  5EOY A;  3F73 A;  4ZTJ A;  1NGI A;  3DRP A;  3NGZ A;  2GTD A;  2ZGY A;  2NRH A;  2OPQ A;  4AHU A;  1GLL O;  4EHT A;  1W9H A;  5KQ8 A;  1J54 A;  3JXU A;  4B8C A;  1XMO K;  4L8R B;  5D3G A;  1YXQ A;  1VQO N;  2VCP A;  2CH5 A;  1TKX A;  4BR2 A;  5AZI B;  3MWT A;  2IIR A;  4FWR A;  4KBO A;  1RT1 A;  1K9M O;  4M3Y A;  2NRZ A;  1VQ4 N;  4FJG A;  4I9Q A;  2XO7 A;  4DU3 A;  3THY A;  3RMC A;  4OX9 K;  3J7A P;  3THW A;  2HHQ A;  3SMP A;  2W6L A;  3UKR B;  3DLR A;  3V1O A;  3B6O A;  3HBT A;  5T7B A;  4NO7 A;  1YJW N;  2NNW A;  2R7Y A;  2F96 A;  3HT3 A;  5FPM A;  3PSF A;  3M8P A;  3NVM A;  4OLA A;  2P9K B;  2DFF A;  4CZH A;  1S1W A;  3HO1 A;  2NZT A;  1YHQ N;  5LMU K;  1HNW K;  3T1H K;  1DTT A;  4FJM A;  4Q0B A;  4CF2 A;  2F8T A;  1EO1 A;  4Z4F A;  4GVE A;  1RBV A;  4YHH K;  4FW1 A;  3O4N A;  4DV7 K;  1MA9 B;  2KQ2 A;  1Z25 A;  4BR4 A;  3WT0 A;  3ZX2 A;  3PIO L;  1SQK A;  1Q86 O;  3VQC A;  1WB9 A;  1VQP N;  4NCB A;  3AA2 A;  1SV5 A;  1VSK A;  4I9L A;  4CF9 A;  4JN4 A;  1QHT A;  4DV3 K;  2FF3 B;  3CJC A;  2NRR A;  1LWF A;  5M1F A;  4BRK A;  5C2F A;  3AA3 A;  3AVI A;  1QVG M;  4KKO A;  1RNH A;  3LL3 A;  2P51 A;  3RRG A;  2UU9 K;  5JIC A;  3ZT1 A;  3MEC A;  2YNI A;  4EFH A;  3U9D A;  1L3U A;  3DLH A;  3LDQ A;  3DI6 A;  3G25 A;  3F9M A;  5CZ2 A;  4K25 A;  2HHU A;  5A2Q O;  2NRV A;  2GUP A;  4E19 A;  5BPN A;  1I3A A;  4DR4 K;  4YOX A;  3AVK A;  4CJ4 A;  5AJ3 K;  4K0K K;  2A5X A;  3GE1 A;  3IMX A;  4PL7 A;  2HHH K;  3DYA A;  3K5M A;  2GV9 A;  3QET A;  2BTF A;  3VQA A;  1HNX K;  4FJX A;  1LAV A;  2DY4 A;  4BRL A;  4IOC L;  2NLX A;  1X9J A;  3NDK A;  5I3U A;  1I94 K;  4CZK A;  3KK7 A;  3MMV A;  1X9W A;  2E6L A;  5LY3 A;  3L2W A;  3HZ6 A;  1G99 A;  3U8X A;  4W5O A;  4C8O A;  3HPH A;  3PV8 A;  3VQ8 A;  3MN6 A;  4DTJ A;  3SNN A;  1QTM A;  2KKZ A;  3EKU A;  5GAE P;  1OVY A;  3TAM A;  3ID8 A;  3S9H A;  1B9D A;  3DMJ A;  4BY9 C;  5BPM A;  4B3R K;  3F2K A;  1F21 A;  3MAQ A;  3LPT A;  5LMN K;  4Z4H A;  3OYB A;  4H5W A;  1JLC A;  1T7P A;  4PWD A;  3EE9 A;  4KH6 A;  2CGK A;  5AQW A;  2ASM A;  2PAV A;  5E84 A;  1CXU A;  4LY7 A;  4WQ5 C;  2PZS A;  1ZBH A;  3K2P A;  4YOT A;  1NGD A;  4IDH A;  4CFA A;  4CEA A;  1RDC A;  1Z26 A;  2YI1 A;  3FGU A;  1UOC A;  3E9P A;  5CYM A;  4QCL A;  4C1N I;  1Q81 O;  4H8K A;  3MXI A;  3T1Y K;  3VGK A;  4KB1 A;  1SZ2 A;  4RTF D;  4E89 A;  1JLG A;  3OJU A;  1E3M A;  3D2F A;  3HP9 A;  1I39 A;  4FLW A;  4DFK A;  4O44 A;  1RFQ A;  3IAY A;  1NK7 A;  2YCH A;  4A61 A;  4IFE A;  1TUY A;  2A6A A;  2Q3S A;  3BF3 A;  1KQS M;  1JLB A;  1S5J A;  3AVJ A;  4DSK A;  3P4I A;  3E9O A;  4JI4 K;  3LAK A;  3O08 A;  5M1O A;  3PX6 A;  3SUQ A;  5HRR A;  1KC8 O;  5BR8 K;  2HMP A;  3DRS A;  5KQD A;  1G15 A;  3CQY A;  1ILY A;  3KVG A;  2ZD1 A;  4IDK A;  1HNI A;  3FE1 A;  2O8F A;  4O55 A;  3H1V X;  3UKU A;  3AV9 A;  3S3O A;  1NJY A;  4KFB A;  1TVR A;  3O1B A;  4IOX A;  5I42 A;  3JSM A;  4DV0 K;  4FJ9 A;  1GLJ O;  3LDN A;  2NUB A;  3LM2 A;  3E9L A;  3VPZ A;  4CEC A;  3V9W A;  1C0T A;  3OS0 A;  2D0A A;  4I6M B;  3NAE A;  2HNZ A;  4BC5 A;  3D7E O;  4DSF A;  4A2A A;  3V9U A;  3CCL N;  1GLA G;  4K8X A;  1GLC G;  4RW9 A;  1A5X A;  4OGE A;  4CZE A;  3KD5 E;  4NLB A;  3PLA A;  4O5F A;  2HNY A;  1WSJ A;  3V9S A;  4DSI A;  1RDA A;  4IJA A;  4CEZ A;  3LP2 A;  4N76 A;  4K8Z A;  5AQF A;  3FZM A;  2KTQ A;  1IV0 A;  1QQO A;  1J9A A;  3DXK A;  4JKA A;  4FK0 A;  3RR7 A;  4GV9 A;  1HPZ A;  3O8M A;  3K5L A;  4FJJ A;  4CK3 A;  1OKJ A;  1WAF A;  4WYB A;  4BR5 A;  1S1U A;  3RR8 A;  2EWS A;  5AQJ A;  4ILJ A;  4F4K A;  2B6A A;  4HHT A;  3BY5 A;  4NCA A;  1WAJ A;  1K8A O;  4JI5 K;  3T7Z A;  2D4W A;  1C0G A;  2V52 B;  2ZGZ A;  4ISG A;  4CW7 B;  4KI4 A;  1ASV A;  1SKR A;  4B9S A;  4MDA A;  2E8A A;  4DSJ A;  4MLH A;  2VGM A;  2P9U B;  4BVP A;  1NKE A;  1TYQ A;  1NGF A;  3VQ7 A;  3CI5 A;  4CJL A;  4FK4 A;  2YHA A;  2UUC K;  5HRN A;  4OPH A;  5AQG A;  3E01 A;  5HRS A;  3P5J A;  1NK9 A;  4OKE A;  1XC9 A;  1HJO A;  4HUE A;  4JHD A;  1U48 A;  4QOZ B;  1JCG A;  3QFP A;  2FSN A;  5KPZ A;  1J6Z A;  2P9S B;  1XUP O;  1SS6 A;  2OYQ A;  3AO3 A;  4DS4 A;  1TL1 A;  3VF4 A;  4C8K A;  3EN9 A;  2OPP A;  2GX9 A;  3L0Q A;  3AO4 A;  3WXL A;  5AQN A;  3HSC A;  1NBW A;  2JWK A;  5ELZ A;  3RTV A;  4YOV A;  5TKY A;  4O0J A;  3CET A;  3U9Z A;  1B9F A;  5JS2 A;  4CJK A;  3T3F A;  4AHV A;  3AVN A;  5DM6 L;  3QEX A;  2ZJR L;  1IG8 A;  2F8S A;  4W5R A;  4CBU A;  2KZM A;  4CJP A;  1NOY A;  2VWB A;  4IXC A;  2O8E A;  2O8D A;  3ULE B;  1BUP A;  5EU7 A;  3M3Z A;  4DFJ A;  3P39 A;  3HK2 A;  2P1J A;  4DR1 K;  4LF8 K;  3PX4 A;  4C8N A;  3QIP A;  3BGR A;  1NWK A;  3CQX A;  1YAG A;  4FPA A;  1HYV A;  4WQ5 A;  3VQB A;  2QI2 A;  2I5J A;  2OCE A;  4MDB A;  4EAH D;  3CMA N;  2BAN A;  4BWJ A;  3NGI A;  3FLC O;  1IKX A;  3QEP A;  4GMJ B;  3UKU B;  3AVF A;  3G4S N;  3AVM A;  2ASO A;  3VN5 A;  1MWK A;  2A40 A;  4FJN A;  4WF9 L;  3SAH A;  1DTQ A;  1BA1 A;  4YOY A;  3DAW A;  1S3X A;  4N5S A;  1HYZ A;  3LAL A;  3OS2 A;  1EWQ A;  4FLY A;  4RCH A;  2P5G A;  4E1J A;  3OYH A;  4M7X A;  4JI2 K;  3R8E A;  4WFB L;  3I8D A;  3R3L A;  2QWL A;  1LV5 A;  1CZ9 A;  1JL1 A;  3VGL A;  3MDQ A;  4JKC A;  4DTN A;  1GOA A;  3LP0 A;  3C6T A;  1S9E A;  4JKE A;  3VF2 A;  4OKJ A;  1W2B M;  1SKW A;  3HL8 A;  3G71 N;  5B8H A;  3OYC A;  2F4V K;  4CJT A;  3QB0 A;  4KHW A;  4NXN K;  5JMV A;  1SL1 A;  1L3S A;  3L8B A;  1U45 A;  2WC9 A;  2O8B A;  2JLE A;  1QS4 A;  1B92 A;  1KD1 O;  2QM1 A;  4E7I A;  4MFB A;  3AY9 A;  1DGK N;  5BRF A;  3VQ6 A;  2HMI A;  3AGK A;  3LP1 A;  1BHL A;  3GOI A;  2QWQ A;  2P5O A;  1IBK K;  4DF8 A;  4IJN A;  4DV4 K;  2ETJ A;  3L6Q A;  1BG3 A;  1MU2 A;  3QES A;  2RHK A;  5LJV A;  4CJV A;  3LZI A;  5J2N A;  1D5A A;  1TYQ B;  3O4W A;  3ISN C;  4ID1 A;  1FKO A;  1QQM A;  2UXD K;  3ZX3 A;  4DTO A;  3CJB A;  4XH5 A;  1S1V A;  3AO1 A;  5JLH A;  3OHR A;  2QA4 N;  3CXC M;  1NMN A;  3GL1 A;  1S9G A;  4FJH A;  2CH6 A;  5CE3 A;  3K5O A;  3SJJ A;  3NVK A;  4CBX A;  4UQG A;  1T44 A;  4TSX A;  1EXQ A;  1TK8 A;  4FK2 A;  3N4Q A;  4DV5 K;  4F8R A;  3FZK A;  3P83 D;  4DF4 A;  4CZI A;  4EZ6 A;  5JVH L;  4IO8 A;  5AQL A;  3HM8 A;  2B5J A;  2OPR A;  5F0X A;  1DLO A;  5AQZ A;  3LM9 A;  3NH2 A;  4FWP A;  1N5Y A;  4CGH A;  1BOT O;  4KHQ A;  3LDL A;  3KLH A;  3LPU A;  1VQ8 N;  1RDU A;  3TAR A;  2HBL A;  2YNH A;  4BR9 A;  4CZF A;  2AA4 A;  1HUX A;  2E1Z A;  1KRP A;  5CZ1 A;  4Z94 A;  2Q36 A;  4JKG A;  4GNI A;  1RGI A;  1KAY A;  4PUO A;  5H1S Q;  3WQU A;  2YJE A;  5AQI A;  4FOI A;  4F3T A;  4QS7 A;  2O8D B;  4FZY A;  4NXM K;  3VEV A;  1NJX A;  1YIJ N;  1FW6 A;  3PY8 A;  3BZK A;  1HX1 A;  3TPQ A;  1LWC A;  2UYT A;  3SPZ A;  3QDK A;  2J4R A;  2O4G A;  2QW9 A;  4IG0 A;  4F2R A;  3SLC A;  1TK0 A;  1ATN A;  5E41 A;  3QNO A;  1K8K B;  5AQK A;  1Q9Y A;  3VEO A;  3OYD A;  1IJJ A;  2DTU A;  4OVL A;  5M1P A;  4BGB A;  3SAF A;  5AQH A;  3D2E A;  3ALY A;  1O1W A;  4X62 K;  4CGG A;  3ZSZ A;  3ZET B;  1QSS A;  1U04 A;  2Q2R A;  3KWI A;  3LDO A;  4XEI A;  3QML A;  4AM6 A;  3O9T A;  4BG8 A;  3KWG A;  3IUC A;  4R5P A;  4ISF A;  1T6C A;  3ZSW A;  1NGA A;  4JKH A;  3RMA A;  4ISE A;  2FBT A;  4FM1 A;  1L5U A;  2YKM A;  1BI4 A;  4RW6 A;  4BVO A;  4GKK K;  4CIE A;  1UA1 A;  3KLI A;  2P9N A;  1VRT A;  3ZEU B;  4O8U A;  4BRC A;  2RKI A;  1JL2 A;  3QIO A;  4H0O A;  1W7A A;  2GEM A;  4PA1 A;  3WXM B;  2OZM A;  2X74 A;  1NK0 A;  3HJF A;  1GLB G;  2W42 A;  4JI3 K;  4OPK A;  2G8U A;  2Q0R A;  2O8B B;  2QXF A;  1HQU A;  2OAN A;  4M3U A;  1A5V A;  2GWJ A;  2FBY A;  4LF5 K;  2O8C B;  3FZF A;  1GLF O;  3UIQ A;  3MN5 A;  1JJ2 M;  1WBD A;  3PSI A;  3MED A;  3HM9 A;  2P9P B;  1VQ5 N;  2E4L A;  2QWM A;  3HOT A;  4W5N A;  4U7B A;  2PYJ A;  1IKV A;  1D4X A;  3CFO A;  2G8F A;  1VSL A;  2Q31 A;  3H45 C;  4K41 A;  1FJG K;  2VYP A;  1U2V B;  4JLH A;  4JAX A;  4BRQ A;  3L4Q A;  3TU5 A;  4H03 B;  3MN7 A;  4GV6 A;  2ZF5 O;  4CD3 A;  3CC7 N;  4BC4 A;  3KIO A;  3SUO A;  4J2E A;  4DR5 K;  3QBW A;  1VSI A;  3MN9 A;  3IRX A;  5KGW A;  4BC2 A;  2ZE2 A;  1CXQ A;  2PBD A;  3MK6 A;  4PY5 A;  2NRX A;  1Q7Y O;  3A5L C;  3UE5 A;  4DQ8 A;  3AA5 X;  3SQ2 A;  1BQM A;  3RVC A;  4B3T K;  3EY1 A;  1VSD A;  3T69 A;  3AVG A;  4DLG A;  3OYA A;  3CJ9 A;  1NLV A;  3CCR N;  4B8A B;  4I7F A;  4H5V A;  4UY8 O;  1LW2 A;  4IFY A;  4KHN A;  2FSK A;  2I7P A;  3VEX A;  2E5L K;  1NGG A;  3AAP A;  4EHU A;  4DV2 K;  1U4B A;  1NJZ A;  5LJW A;  4FLV A;  4BRP A;  4FSV A;  1ZBI A;  3WEE B;  3C7N A;  4CJF A;  1HLU A;  4LFA K;  3UB5 A;  3LWL A;  2ITG A;  1NG9 A;  4JI1 K;  4NYN A;  3CCS N;  2GEL A;  4FVU A;  2XY7 A;  5SZT A;  4KV8 A;  1VSE A;  1NM1 A;  1V4S A;  1S6Q A;  1GOC A;  3GBT A;  2A42 A;  3QFU A;  2VQF K;  4CZM A;  4CK1 A;  4E7L A;  3TAB A;  4IWV A;  4KHY A;  3OVN A;  5K14 A;  3VQ4 A;  4CHZ A;  4E7H A;  4C23 A;  3C6H A;  3KK3 A;  1JCE A;  4JI8 K;  1XNR K;  4LH4 A;  2YX6 A;  2BE2 A;  3M5R A;  2HHX A;  3O9Q A;  3QO9 A;  5DK5 A;  3ZT2 A;  3OYG A;  1WSI A;  5AQY A;  1S22 A;  3O3H A;  1HPM A;  3ZT0 A;  4CEQ A;  4YOW A;  3QNN A;  1N33 K;  3E66 A;  2YHW A;  2P9N B;  4FJ8 A;  1YVN A;  3MX5 A;  1HNV A;  3S41 A;  4ILH A;  3ZLJ A;  3THY B;  3CQ8 A;  1N34 K;  3ZX0 A;  1DEJ A;  1ATS A;  2DPN A;  4JI6 K;  1D9F A;  3CM5 A;  3THW B;  1GLD G;  1IBL K;  4Z4I A;  4DQI A;  4BRF A;  4DLE A;  1ASU A;  4BC3 A;  1BL3 A;  1IKY A;  1T6D A;  4M3R A;  3CCJ N;  4JD2 A;  1X9S A;  1NJI O;  3VQP A;  3NF8 A;  3VEY A;  3BZC A;  4AM7 A;  3CJ7 A;  2QKK A;  1T3V A;  2V7Y A;  3C95 A;  1XMQ K;  1RBR A;  3O4Q A;  5KPR A;  1XQS C;  4BRE A;  2G8I A;  3SUP A;  5AZJ A;  3QEW A;  3G0Z A;  4AHC A;  4YFU A;  4J2D A;  1RDW X;  3L3U A;  4KTZ A;  4Y1D A;  3RMD A;  4DFP A;  1V4T A;  1HMV A;  1TAU A;  3SI6 A;  4KRF A;  4Q5V A;  4FWM A;  4JS4 A;  1TK5 A;  3VQE A;  3TAG A;  3CCU N;  4KB0 A;  3QIC A;  3HVT A;  2KFZ A;  5GAD P;  1YJ9 N;  1J5E K;  1W0H A;  4FWS A;  1C1A A;  4IZ9 A;  4PQU A;  4CJQ A;  1DT9 A;  3RWU A;  3HPG A;  4A5A A;  3OW2 M;  1YT3 A;  1YUW A;  1YI2 N;  3O5B A;  1T03 A;  2F9T A;  2P9L A;  3ZSR A;  5HL7 L;  4BR0 A;  1YJN N;  2P9I A;  3BP8 A;  1R59 O;  1YTA A;  1QE1 A;  3IG1 A;  2BUP A;  3ENO A;  3CCM N;  4GV3 A;  1DKG D;  1FK9 A;  3VES A;  1K73 O;  3CME N;  2OA8 A;  3VMF B;  4FWN A;  1HR0 K;  3OYF A;  1NKC A;  4DU1 A;  1RTH A;  1TKZ A;  3V81 A;  4JI0 K;  1VSH A;  2B4J A;  3ZSY A;  2ZJP L;  2QTD A;  2G8V A;  3VEN A;  1VSJ A;  3L2U A;  2ZQB A;  3CPW M;  4LF6 K;  4LC9 B;  4CF0 A;  3LAN A;  3SBG A;  5GAH P;  2YJF A;  3SV4 A;  5GIO A;  1Z6R A;  2E6M A;  4X64 K;  4JRP A;  1NOZ A;  5GAG P;  1X3M A;  1S1X A;  4HWI A;  1U49 A;  3KTQ A;  4CJ3 A;  2YKN A;  4DR6 K;  4WFA L;  1BO5 O;  2UXB K;  3T1A A;  1VQ7 N;  1QZ5 A;  5KPT A;  2Z1J A;  3OS1 A;  1O13 A;  4N41 A;  3SUN A;  1WSH A;  3T19 A;  2OZS A;  1KFD A;  3SK3 A;  4KRE A;  4KO0 A;  1XHX A;  3U4L A;  3THV A;  2V51 B;  4FLZ A;  2FBV A;  2EHG A;  4EZ9 A;  2D0O A;  5BN8 A;  2Z1I A;  4DTM A;  3I55 N;  3OJS A;  1IO2 A;  4RW7 A;  4AQY K;  2BH1 A;  1H1V A;  5EVZ A;  1BQN A; 
#chains in the Genus database with same CATH homology
 1C0U A;  4F8R A;  4HTU A;  3TAN A;  2IC3 A;  4B9M A;  4B9V A;  4E7J A;  3P83 D;  1DTT A;  4DF4 A;  4FJM A;  4LSN A;  4EZ6 A;  4Q0B A;  4CF2 A;  2F8T A;  1C6V A;  3G10 A;  4CF1 A;  1A5W A;  1BIZ A;  2Z1H A;  1EP4 A;  4E1M A;  1VSM A;  3NHG A;  1RBV A;  2B5J A;  2OPR A;  4FW1 A;  4CEB A;  3O4N A;  4HVJ A;  3KLF A;  1DLO A;  3OYN A;  3NH2 A;  1N5Y A;  2KQ2 A;  4CGH A;  4CHN A;  2O4I A;  4I2P A;  5C25 A;  1Z25 A;  2PYL A;  4ZTF A;  4KHQ A;  1WSF A;  3KLH A;  3U3G A;  1HRH A;  3EZ5 A;  3M8Q A;  4HCB A;  3NH1 A;  1ITG A;  3LPU A;  4FJL A;  1KVB A;  3VQC A;  3TAR A;  1NKB A;  2YNH A;  3JYT A;  1SUQ A;  3ITH A;  4B9U A;  3PO4 A;  4ZHR A;  1BCO A;  3U3Y A;  1UA0 A;  4CJU A;  4DSL A;  4NCB A;  1R0A A;  3AA2 A;  3L2R A;  1SV5 A;  3ULD A;  1S1T A;  1VSK A;  3NBP A;  4I9L A;  1KRP A;  4CEE A;  4IFV A;  5CZ1 A;  3WNG A;  4CF9 A;  4Z4C A;  1QHT A;  3TWH A;  1TK8 A;  3OY9 A;  4PUO A;  4O5B A;  1LWF A;  1TKD A;  2HHW A;  3P1G A;  3AA3 A;  3AVI A;  1TV6 A;  3K57 A;  4OJR A;  4F3O A;  3QIN A;  4F3T A;  3I0R A;  3OYI A;  4KKO A;  2IS3 A;  3KJV A;  4FZY A;  1RNH A;  2P51 A;  1NJX A;  4FCY A;  3RRG A;  1LW0 A;  1J53 A;  4DSE A;  3PY8 A;  3ZT1 A;  1RTD A;  2WON A;  1XWL A;  3MEC A;  3LP3 A;  2YNI A;  1L3U A;  5J2M A;  3DLH A;  5CYQ A;  1NK5 A;  3L2Q A;  1LWC A;  3DI6 A;  4N47 A;  1NK6 A;  4FK4 A;  4CER A;  1J5O A;  3SPZ A;  1TKT A;  3ZT3 A;  4FJI A;  5CZ2 A;  2O4G A;  4F2R A;  2ATQ A;  4IG0 A;  1REV A;  1TK0 A;  2A1R A;  5E41 A;  3QNO A;  2HHU A;  3RMB A;  4YNQ A;  4BDY A;  4E19 A;  3HXM A;  2D0C A;  4FLX A;  1RT3 A;  1I3A A;  2G8H A;  3NF7 A;  3AVK A;  3ASM A;  1KVA A;  4GW6 A;  4CJ4 A;  1Q9Y A;  4AHT A;  4ELU A;  3OYD A;  2BGG A;  4G1Q A;  2DTU A;  3AVH A;  2G8K A;  4Z4F A;  4OVL A;  4N56 A;  4F2S A;  3DRR A;  3DYA A;  5CY4 A;  2GV9 A;  1O1W A;  3ALY A;  4LD0 A;  3K5M A;  3QET A;  1FXX A;  3CFR A;  3VQA A;  1IG9 A;  4FJX A;  4CGG A;  1LAV A;  1X9M A;  3ZSZ A;  2DY4 A;  4QAG A;  3ZT4 A;  1QSS A;  1LWE A;  1U04 A;  4E1N A;  3V6D A;  4FJ7 A;  3NDK A;  3O3F A;  5KRS A;  1IKW A;  2RN2 A;  1TL3 A;  5I3U A;  2EX3 A;  3QLH A;  2D0B A;  5SWM A;  4R5P A;  2HVI A;  1X9W A;  2E6L A;  3L2W A;  4DMN A;  4GVM A;  4E0D A;  3ZSW A;  1GOB A;  1RTI A;  3HPH A;  4W5O A;  3VQ8 A;  3PV8 A;  4C8O A;  5DMR A;  3RMA A;  3B6P A;  4FXD A;  4DTJ A;  3SNN A;  2FBT A;  3WNF A;  3K58 A;  1CZB A;  4FM1 A;  4FW2 A;  3V1R A;  1ZYQ A;  1UWB A;  2YKM A;  1BI4 A;  4RW6 A;  1L5U A;  1QTM A;  4KAZ A;  2HHS A;  2YV0 X;  3KLE A;  4CIE A;  1UA1 A;  3TAM A;  3KLI A;  4M3T A;  3S9H A;  1B9D A;  3DMJ A;  1VRT A;  4DS5 A;  4CGJ A;  1F21 A;  3MAQ A;  3LPT A;  3QEI A;  1RIL A;  4EP4 A;  3VQD A;  4H4O A;  4Z4H A;  2GBZ A;  3OYB A;  2RKI A;  1JL2 A;  3QIO A;  1JKH A;  5FDL A;  1JLC A;  1T7P A;  4PWD A;  4PA1 A;  1SL2 A;  4AHS A;  2OZM A;  1CXU A;  2X74 A;  1LAW A;  4LY7 A;  4CIG A;  3OYL A;  1NK0 A;  3HJF A;  2W42 A;  2PZS A;  4OPK A;  2G8U A;  2QK9 A;  1ZBH A;  3SCX A;  4AH9 A;  5HP1 A;  3K2P A;  5C24 A;  2QXF A;  1HQU A;  1JLF A;  5FRO A;  3KD1 E;  4IG3 A;  4CFA A;  4M3U A;  1KCF A;  4CEA A;  1RDC A;  4M3Z A;  1A5V A;  1Z26 A;  4BDP A;  2FBY A;  1UOC A;  2XY8 A;  5CYM A;  4AIL C;  3S3N A;  2BDP A;  4QCL A;  4H8K A;  3MXI A;  5HBM A;  4CE9 A;  4KB1 A;  1HYS A;  3DM2 A;  4DQS A;  4E89 A;  1KSP A;  1JLG A;  4I2Q A;  3OJU A;  3UIQ A;  4BAC A;  2D5R A;  1C1C A;  3MED A;  3HM9 A;  3CYM A;  3HP9 A;  1I39 A;  3MXM A;  3DLB A;  4FLW A;  4W5Q A;  4DFK A;  2E4L A;  4CEO A;  4O44 A;  3IAY A;  1NK7 A;  2Y1J A;  2HVH A;  3PO5 A;  4W5N A;  2PYJ A;  1IKV A;  3CFO A;  2G8F A;  5KRT A;  1JLA A;  1VSL A;  2Q3S A;  1RT2 A;  5HLF A;  1JLB A;  1S6P A;  4JLH A;  1S5J A;  3AVJ A;  4DSK A;  3PUF A;  1QSL A;  3LAK A;  3SUQ A;  3PX6 A;  1JXE A;  3OYM A;  4MQ3 A;  4FZX C;  5HRR A;  1RBT A;  4B9L A;  4DQR A;  3DRS A;  1G15 A;  2IDO A;  1BCM A;  3KIO A;  2ZD1 A;  4EP5 A;  4IDK A;  4DTX A;  3SUO A;  1HNI A;  4J2E A;  4O55 A;  1VSI A;  2VG6 A;  3AV9 A;  3S3O A;  1NJY A;  3IRX A;  4KFB A;  5J2Q A;  1TVR A;  4CIF A;  5KGW A;  4M42 A;  5I42 A;  3JSM A;  2ZE2 A;  4CGI A;  4FJ9 A;  1CXQ A;  1KVC A;  3NF9 A;  4CJE A;  2NUB A;  3KK1 A;  4PY5 A;  4CEC A;  3D0P A;  3V9W A;  1KLN A;  2YNG A;  1C0T A;  3OS0 A;  3ZSO A;  2JGU A;  2D0A A;  3ZSX A;  2IAJ A;  3AA5 X;  5J2P A;  4CEF A;  3SQ2 A;  2FBX A;  1BQM A;  3MEG A;  2DFH A;  3NAE A;  1NK8 A;  3EY1 A;  1VRU A;  4Z4E A;  4BE2 A;  1VSD A;  2KZZ A;  2HNZ A;  2X78 A;  3AVG A;  4DLG A;  3OYA A;  4DQQ A;  4WE1 A;  2G8W A;  4DSF A;  4DWI A;  4KTQ A;  2VWJ A;  4B8A B;  1FKP A;  3SQ0 A;  2OPS A;  4I7F A;  3KLG A;  3QER A;  1LW2 A;  5KI6 A;  3V9U A;  4CK2 A;  3TAP A;  4IFY A;  4IKF A;  4K8X A;  4BWM A;  4RW9 A;  4KHN A;  1A5X A;  3VQQ A;  4OGE A;  4CFD A;  3KD5 E;  3SV3 A;  2HNY A;  1WSJ A;  3V9S A;  1U4B A;  3CG7 A;  1K6Y A;  4DSI A;  1NJZ A;  1RDA A;  2A1S A;  4CEZ A;  3LP2 A;  3V9Z A;  4N76 A;  4K8Z A;  3OYE A;  3EYZ A;  4KHU A;  2KTQ A;  4FLV A;  1J9A A;  4FM0 A;  4FK0 A;  3RR7 A;  5J1E A;  2DFE A;  1HPZ A;  3ZSQ A;  3K5L A;  1HQE A;  1QSY A;  2HB5 A;  4ICL A;  4CK3 A;  4FJJ A;  1ZBI A;  1JLE A;  1WAF A;  3S3M A;  3AVL A;  2KW4 A;  1WSG A;  4CJF A;  4CJR A;  3FFI A;  3KKS A;  4RG8 A;  3LWL A;  2ITG A;  1L3V A;  1S1U A;  3RR8 A;  1VK0 A;  4CJW A;  3PX0 A;  3HST B;  3C6U A;  1EKE A;  4NYN A;  4F4K A;  2B6A A;  4HHT A;  4KI6 A;  4E3S A;  2XY7 A;  3KKR A;  5SZT A;  4KV8 A;  1VSE A;  4CED A;  2IOC A;  1WAJ A;  3M8S A;  4XIU A;  1EX4 A;  4CFB A;  4NCA A;  2IGI A;  2AJQ A;  1N6Q A;  1C1B A;  3VA0 A;  1S6Q A;  1GOC A;  4C8M A;  4KI4 A;  3VA3 A;  1Q8I A;  3ZCM A;  1ASV A;  1SKR A;  3VQ9 A;  4CK1 A;  1RBS A;  1WNS A;  1RT6 A;  4E7L A;  3TAB A;  4B9S A;  4DSJ A;  5HRP A;  1NKE A;  3VQ7 A;  1D9D A;  1RDB A;  4CJL A;  3V4I A;  1SKS A;  2YHA A;  2X6N A;  3OVN A;  4CFC A;  1NJW A;  5K14 A;  1VSF A;  4KHY A;  4FZZ A;  4O0I A;  3WNH A;  4Y1C A;  3VQ4 A;  5HRN A;  1KLM A;  4M3W A;  4CHZ A;  1JXB A;  3DLG A;  4RW8 A;  1RDD A;  4E7H A;  3TAE A;  3CM6 A;  3U6F A;  3KK3 A;  3E01 A;  5HRS A;  4FJK A;  2HW3 A;  4CES A;  4LH4 A;  1RT7 A;  2BE2 A;  3P5J A;  1NK9 A;  2HHX A;  3QO9 A;  5DK5 A;  3ZT2 A;  3SQ4 A;  4OKE A;  3OYG A;  1XC9 A;  1WSI A;  3LAM A;  4W5T A;  4HUE A;  4FLU A;  2FC0 A;  2XHB A;  1QQC A;  4AHR A;  1U48 A;  4QOZ B;  3O3H A;  3LWM A;  3TR8 A;  3K59 A;  3ZT0 A;  2XY5 A;  4CEQ A;  2HHV A;  4FVM A;  3CFP A;  2XRI A;  2LSN A;  4NYF A;  4M3X A;  3QNN A;  2YNF A;  1Q9X A;  2OYQ A;  1ZBF A;  2GUI A;  3AO3 A;  4DS4 A;  1TL1 A;  3AVB A;  3M8R A;  2HHT A;  4C8K A;  3HYF A;  1ZBU A;  4FJ8 A;  3O3G A;  1BIS A;  3F9K A;  3SPY A;  1HNV A;  2OPP A;  4CJS A;  4DTS A;  3AO4 A;  3NFA A;  4RW4 A;  1UAX A;  4BE0 A;  3CQ8 A;  1WSE A;  3AVC A;  3KK2 A;  3RTV A;  1CLQ A;  1EET A;  3C94 A;  1D9F A;  4Z0U A;  3DOK A;  3CM5 A;  3DLE A;  4O0J A;  4KTW A;  3K5N A;  4J2A A;  1YVU A;  1C0M A;  1B9F A;  5C42 A;  4DTR A;  4DQI A;  5JS2 A;  4Z4I A;  4CJK A;  3NE6 A;  4DLE A;  4DQP A;  3T3F A;  3V1Q A;  1ASU A;  2X6S A;  4NCG A;  3H08 A;  4AHV A;  1BL3 A;  1IKY A;  3AVN A;  3HPO A;  4E7K A;  4DU4 A;  4M3R A;  4CHP A;  3QEX A;  1RT4 A;  1KTQ A;  4FM2 A;  1X9S A;  4LH5 A;  1RT5 A;  4H4M A;  4CF8 A;  1ZBL A;  4C8L A;  2F8S A;  5JS1 A;  3VQP A;  3NF8 A;  4W5R A;  3IS9 A;  3AA4 A;  4KHS A;  3SYZ A;  4Z4G A;  2KZM A;  4KPY A;  4ID5 A;  4LSL A;  1RTJ A;  1X1P A;  4CJP A;  1NOY A;  2QKK A;  3L3V A;  4IBN A;  3C95 A;  1Y97 A;  4J2B A;  5FRN A;  1RBR A;  1IH7 A;  3O4Q A;  1YTU A;  4CHO A;  4DTP A;  4ELV A;  2Z1G A;  2G8I A;  5EU7 A;  1BIU A;  4DFJ A;  3QEV A;  3SUP A;  1BGX T;  3HK2 A;  4CGF A;  4B9N A;  3QEW A;  2P1J A;  1XHZ A;  1HJR A;  3G0Z A;  4AHC A;  4YFU A;  4HUF A;  4FLT A;  4J2D A;  3L3U A;  4KTZ A;  3OYJ A;  3PX4 A;  4C8N A;  4Y1D A;  3RMD A;  3QIP A;  4CHY A;  3BGR A;  4BDZ A;  1HYV A;  4DFP A;  3VQB A;  3NCI A;  5HRO A;  2QKB A;  1HMV A;  4HCC A;  3SI6 A;  3L2V A;  4KRF A;  4Q5V A;  1TAU A;  2I5J A;  4JS4 A;  4B08 A;  1TK5 A;  3VQE A;  1KFS A;  2BAN A;  3MEE A;  2WOM A;  3TAG A;  4BWJ A;  3NGI A;  4BE1 A;  4KB0 A;  3LZJ A;  1ASW A;  3HVT A;  2KFZ A;  1IKX A;  4M45 A;  1RBU A;  3QEP A;  4GMJ B;  1W0H A;  3DOL A;  3TAQ A;  3AVF A;  1C1A A;  1D8Y A;  4CCH A;  4FYD A;  5KTQ A;  3AVM A;  4PQU A;  1WN7 A;  4OGC A;  4OLB A;  3LDS A;  4CJQ A;  3V9X A;  3VN5 A;  3RWU A;  3HPG A;  1YT3 A;  4CJ5 A;  3WNE A;  4FJN A;  1TGO A;  3OYK A;  3NGY A;  1T03 A;  2PY5 A;  3D45 A;  3ZSR A;  4CHQ A;  1DTQ A;  4OKK A;  4CGD A;  1WLJ A;  3HVR A;  4N5S A;  1YTA A;  3BDP A;  1HYZ A;  1QE1 A;  3IG1 A;  3LAL A;  3OS2 A;  4FLY A;  2P5G A;  2RPI A;  3I0S A;  3OYH A;  2VG7 A;  3I8D A;  4O4G A;  3TI0 A;  3RRH A;  3SZ2 A;  1JLQ A;  1FK9 A;  1CZ9 A;  3MXJ A;  3NH0 A;  1LV5 A;  1JL1 A;  1TAQ A;  1XI1 A;  2OA8 A;  3DLK A;  4DTN A;  3OYF A;  1NKC A;  4DU1 A;  4DFM A;  1GOA A;  1RTH A;  1TKZ A;  3LP0 A;  5KGX A;  3V81 A;  4B3O A;  1VSH A;  2B4J A;  3ZSY A;  3HP6 A;  3C6T A;  1S9E A;  3ZSV A;  4DG1 A;  2G8V A;  4OKJ A;  2VWK A;  3F73 A;  4ZTJ A;  3DRP A;  1VSJ A;  3L2U A;  2ZQB A;  3NGZ A;  1SKW A;  4ELT A;  2KFN A;  3HL8 A;  2OPQ A;  4CF0 A;  3LAN A;  4AHU A;  3OYC A;  3SV4 A;  4CJT A;  4KHW A;  1W9H A;  2E6M A;  1J54 A;  4B8C A;  4JRP A;  4L8R B;  3SQ1 A;  1SL1 A;  1L3S A;  1NOZ A;  3NF6 A;  2RF2 A;  3L8B A;  5D3G A;  1U45 A;  1S1X A;  1SL0 A;  4FJ5 A;  2JLE A;  1QS4 A;  2VG5 A;  1B92 A;  1U49 A;  4B9T A;  1TKX A;  3KTQ A;  4DTU A;  4CJ3 A;  4E7I A;  4MFB A;  2YKN A;  3AO2 A;  4M41 A;  2HMI A;  3VQ6 A;  2XY6 A;  3LP1 A;  1U47 A;  1L3T A;  3T1A A;  1BHL A;  2P5O A;  2HND A;  4DF8 A;  1RT1 A;  1BI4 B;  2ETJ A;  2Z1J A;  4M3Y A;  1MU2 A;  3A2F A;  3QES A;  1RCH A;  4FJG A;  3OS1 A;  4I9Q A;  4N41 A;  2XO7 A;  4DU3 A;  4CJV A;  1WSH A;  3LZI A;  3VQ5 A;  4JS5 A;  5J2N A;  3RMC A;  3SUN A;  1T05 A;  3T19 A;  1D5A A;  2OZS A;  1KFD A;  3ISN C;  2HHQ A;  1NK4 A;  4ID1 A;  4KRE A;  1FKO A;  3DLR A;  4KO0 A;  3V1O A;  4DTO A;  1XHX A;  3B6O A;  3AVA A;  1T8E A;  3THV A;  1S1V A;  4FLZ A;  3AO1 A;  2FBV A;  2EHG A;  5T7B A;  4EZ9 A;  2Z1I A;  5FRM A;  4DTM A;  1S9G A;  3OJS A;  2F96 A;  2R7Y A;  4FJH A;  1IO2 A;  3HT3 A;  3K5O A;  4OPJ A;  4RW7 A;  3SJJ A;  4UQG A;  2YHB A;  3M8P A;  4OLA A;  2Y1I A;  3AO5 A;  4TSX A;  2DFF A;  1BQN A;  4HUG A;  1S1W A;  1EXQ A;  3HO1 A;  4JRQ A;  3TAF A;  4FK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...