3VQAA

Hiv-1 in core domain in complex with 1-benzothiophen-6-amine 1,1-dioxide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
152
structure length
141
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
total genus 52
structure length 141
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqaA00
5FROA 1IH7A 4DS4A 1RILA 3I0RA 1QSYA 2I5JA 3K58A 4LH4A 4M42A 1Y97A 1CZ9A 4FJ9A 2AJQA 3LDSA 4BE1A 4DQQA 4KB1A 2RPIA 5HRNA 1L3SA 1TK0A 2PZSA 2HMIA 3LP3A 4FLUA 4OGEA 3ZSYA 4HTUA 2KQ2A 4Z4CA 1QS4A 5KGXA 5T7BA 2OA8A 4CHYA 2PYLA 4KRFA 3AVCA 2B5JA 1L3TA 4KI4A 2GV9A 1KLNA 1VSKA 3MXJA 1JL1A 1HPZA 2VG5A 3NF9A 1NK8A 3BDPA 4FJKA 4E3SA 1RBUA 4DTUA 2D0CA 4AHTA 3NCIA 3PV8A 2YNGA 1K6YA 2X78A 4CF2A 1QTMA 1SL1A 2G8KA 3OYKA 4E1NA 1BIZA 1C0MA 4DLGA 2IS3A 1XWLA 2DFEA 3DRPA 4CEOA 4F4KA 3C95A 4AHUA 1NJWA 3H08A 2OPRA 1QSSA 3AVAA 5C24A 3KD1E 4F8RA 4E19A 4H4MA 2D0AA 3HYFA 3WNEA 2ETJA 2HVHA 4QCLA 1CXUA 3OYLA 1RT4A 4CHZA 4KHNA 3LPUA 3DI6A 5K14A 4F3OA 4IFVA 4NYNA 5KRTA 1JLAA 3QIPA 4CFCA 5J1EA 3SQ1A 4E7HA 3KLIA 5J2NA 3ZSZA 3HVRA 4Y1CA 4Z4HA 3NGZA 4KHSA 1IO2A 2NUBA 3HP6A 3S3NA 1SKSA 4CK2A 2YKMA 4UQGA 1F21A 1TL3A 3LP2A 3QLHA 3LZIA 3KJVA 4HHTA 1QSLA 1RBTA 1WSHA 4OPJA 3D45A 3NH0A 3KK2A 1EX4A 3CQ8A 4FJHA 1O1WA 1HRHA 2X6SA 2P51A 4KV8A 3VQDA 1UWBA 2VG7A 4CJWA 3KLHA 3B6PA 1RDDA 4I2QA 3RRHA 3B6OA 4CEAA 3KK3A 2RF2A 4DFKA 3QNNA 4EZ6A 5D3GA 4M3UA 4E89A 4C8NA 1ZBUA 3PO5A 4CJ3A 4B8AB 3CM6A 1NK4A 1X9SA 1J5OA 4E7IA 1KSPA 1L5UA 1NK0A 1U04A 3HSTB 4N76A 4M45A 1WSJA 1HNVA 4NCAA 3OJUA 3A2FA 4E1MA 4Q0BA 1C6VA 4FM0A 2VG6A 3C94A 1NK6A 5KRSA 1N5YA 1BHLA 4N5SA 4FJNA 4CK1A 3MXMA 4NCBA 4CE9A 2O4IA 4J2DA 1S5JA 3SJJA 3OS1A 4CGFA 2DY4A 1ZBHA 1EETA 2F8TA 1WN7A 3DLRA 3T1AA 4KTWA 4CESA 3NF7A 2IOCA 3K5OA 4RW8A 1NOZA 4FM1A 3QEIA 1QQCA 4W5NA 2OPQA 4HVJA 3S3OA 3ZSXA 3TI0A 1WLJA 4K8XA 1VSMA 4IBNA 1EP4A 3AA3A 3AO1A 2PYJA 3K57A 2IGIA 1VK0A 1LW2A 1JLBA 3M8SA 4AILC 4ELTA 1NJXA 1JLEA 1C0TA 1W0HA 1KLMA 4FLVA 1NK9A 1B9DA 3P1GA 1UA0A 1MU2A 2FBYA 4AHVA 4FZXC 1S6QA 5CYQA 2FC0A 5CYMA 1LAVA 3RMAA 3F9KA 4KKOA 1TK5A 3CFOA 3QEPA 4YNQA 2XY5A 3MAQA 4LSLA 4J2BA 3TAPA 4W5QA 2EHGA 3OS2A 4I9LA 4CEBA 3CFPA 4CF9A 5I42A 4M41A 4FJGA 1EXQA 4N56A 1RBSA 4Y1DA 4EP5A 1CZBA 1VSDA 3HP9A 1RTHA 3NH1A 3HO1A 4B9SA 1T8EA 4HCBA 3RMCA 3NGIA 3DRRA 3OYCA 3M8PA 4BE0A 3DYAA 3RR8A 4RW4A 4DQIA 2XRIA 1GOAA 3AO4A 3LPTA 4CERA 4ZTJA 3G10A 3THVA 3ZSVA 3L3VA 3AVHA 4RW6A 4HCCA 4OVLA 4PUOA 4E7LA 2HNYA 3TARA 2HHSA 1KCFA 3NGYA 2IC3A 1VSIA 1VRTA 1TAQA 2QXFA 3M8QA 2FBXA 4O55A 5DMRA 3V1RA 3L2UA 3QETA 3HK2A 4Z4GA 3SCXA 4B9TA 1YTUA 3IS9A 3AVMA 3VQ6A 1C1BA 4BACA 3OYGA 4PY5A 3WNGA 1SUQA 4CJVA 3DOLA 5HRSA 3O3HA 1X9WA 1TV6A 3ISNC 2XHBA 3OYEA 3PX0A 3VQBA 3LWLA 3PO4A 1Q9YA 2HHQA 1S1TA 3QIOA 3UIQA 1HQEA 1HYZA 4CFAA 4FW1A 2DFFA 3MECA 4FLWA 4KI6A 2YHAA 3AO5A 3P83D 3HVTA 2O4GA 1U49A 4W5TA 1X1PA 3V81A 2WONA 3OJSA 5J2PA 2LSNA 1JLCA 4KFBA 4CIEA 4CK3A 4AHCA 2D5RA 4DG1A 4CGJA 4E7JA 4E0DA 1XI1A 5FDLA 3ZT0A 4W5RA 4NYFA 3SQ4A 2YNHA 4DSIA 3O3GA 4OKKA 3KIOA 4BWJA 2B6AA 4OLBA 4PQUA 3RR7A 4O0IA 1D8YA 3VQ5A 3SQ2A 4CF8A 1KTQA 4DMNA 4DQSA 4CJPA 3HJFA 4DTPA 2HHWA 2F8SA 2E4LA 2HHTA 4CGGA 4XIUA 4DSFA 1DTQA 1U48A 4N41A 1RTDA 2HW3A 1T03A 3WNHA 3ZSQA 1JL2A 4CJQA 4B9UA 1RDAA 4FJ5A 1W9HA 1WSFA 1RDCA 4E7KA 3D0PA 1VSLA 4AH9A 2G8IA 1C1CA 1WSIA 2BE2A 3AVBA 3AO2A 4FLZA 3KLEA 5DK5A 4C8KA 4FK4A 4C8MA 2B4JA 4ZHRA 4B9NA 3DLKA 3OYFA 3MEDA 1S1WA 1BCOA 4M3TA 2HVIA 3QESA 1C1AA 2YKNA 1UOCA 3DLBA 2QKKA 4K8ZA 4AHRA 4RW7A 3ZT1A 3SUQA 3CG7A 4B9VA 4G1QA 4JRPA 3TAGA 2XY8A 3KKSA 3ZT3A 2G8HA 4BDPA 2ZD1A 4DF8A 4JLHA 4C8OA 5J2QA 1RBVA 3K5LA 2E6MA 1FKOA 4FK2A 1KRPA 1SV5A 1TKTA 4WE1A 3OYDA 3QNOA 3OY9A 4FJLA 1U45A 4O5BA 5HRRA 1S9EA 1BCMA 4HUFA 3TWHA 4CJTA 5HRPA 2G8FA 2Z1HA 3NFAA 3KD5E 4CJ4A 5SZTA 4ELUA 4CEDA 4CJEA 3LWMA 4B8CA 2GUIA 4KHUA 1Z26A 1C0UA 4MQ3A 3O3FA 5HLFA 1SL0A 2KZZA 4OGCA 4I2PA 4DU4A 4KREA 1S1VA 4KHQA 4IG0A 4DQRA 4FZZA 4ELVA 3ULDA 3DM2A 2XY7A 1IKYA 4PWDA 4CJ5A 2P5GA 3U3YA 3SYZA 5J2MA 1VRUA 3SQ0A 3SNNA 4EP4A 4CHNA 3KTQA 3AVJA 4CHOA 2VWJA 3E01A 1RT3A 3HL8A 4HUEA 4F2SA 4CJKA 3JSMA 4DWIA 1J54A 3DLHA 4PA1A 1S9GA 5KGWA 4YFUA 4FJIA 2ZQBA 1SL2A 1ASWA 1NK5A 4F3TA 1JXEA 2G8WA 3IAYA 5HBMA 1G15A 2X6NA 3HPGA 1RBRA 4CIFA 3V6DA 4ICLA 1LW0A 1HNIA 3S3MA 1FXXA 4IDKA 2HNDA 1HQUA 1YTAA 3EY1A 1TGOA 3MXIA 4B08A 5FRNA 1ZBIA 4QOZB 1JKHA 2YNIA 1L3VA 3VQPA 1BISA 2Z1JA 1IKWA 2Z1GA 2OZMA 4JRQA 3SV3A 4DU1A 4M3ZA 1D9FA 1DLOA 1ASVA 3ZCMA 5CZ1A 1NKEA 3OYMA 3JYTA 4KHYA 4HUGA 4F2RA 5C42A 4JS5A 2IAJA 1Z25A 1TKDA 2HHXA 1KVCA 2QK9A 4CFBA 2A1SA 3AA2A 1X9MA 2G8UA 4ID5A 3AA5X 4FLXA 4DTJA 1RNHA 3ASMA 3T19A 3OYBA 2KFZA 4DQPA 2YNFA 3LAKA 4B3OA 4BE2A 3QEWA 4OLAA 3CM5A 2OYQA 3I0SA 1KVBA 1QHTA 1LAWA 1HMVA 3OYHA 4IG3A 3V1QA 3SUNA 4DFPA 3TR8A 3CYMA 3VQ9A 3QEXA 2KW4A 3M8RA 4FCYA 3LALA 1S1UA 4FLTA 1JLQA 3FFIA 3L2QA 4KHWA 1ASUA 3VQ7A 1SKRA 2OZSA 2ZE2A 1BIUA 1I3AA 1RT1A 3NAEA 4ZTFA 3K59A 1RTIA 3RMDA 3RTVA 1UA1A 4FJMA 1BL3A 1XC9A 3TAMA 3DRSA 4DSJA 1HYSA 2QKBA 3AVLA 3NBPA 4Z0UA 3DLEA 3VQQA 4DSKA 1T05A 4CF0A 4KTQA 1ITGA 4FM2A 3IRXA 3ZSWA 1ZBLA 2W42A 1VSJA 4CGDA 4GMJB 1WNSA 4MFBA 3AVIA 3RMBA 4ID1A 5CZ2A 1XHZA 4RG8A 3OYIA 3BGRA 4Z4IA 4M3XA 2KZMA 2F96A 1B92A 2EX3A 3HT3A 3V9XA 4KB0A 4FYDA 2JGUA 4DTOA 2BGGA 4LH5A 4DTNA 3LANA 4CEZA 3AVNA 1TKXA 3NHGA 2VWKA 4KTZA 5KTQA 3SUPA 3SPZA 3DOKA 3OYJA 4DLEA 2RKIA 3LAMA 1A5XA 2P1JA 5CY4A 3AVFA 3HPHA 3VA3A 3NH2A 3DMJA 4OJRA 3DLGA 3OS0A 1D5AA 3NE6A 4DFMA 3LP1A 1NJZA 4DSLA 3QERA 4B9MA 4CJRA 4DS5A 1FKPA 4DTXA 1WAJA 3U3GA 1L3UA 3PY8A 1J53A 3VQ4A 2PY5A 4I9QA 1Q8IA 2YV0X 3K5NA 4DTMA 1T7PA 1BQNA 3RWUA 4OKEA 3ZSRA 1JLFA 4FJ8A 3VQ8A 1HYVA 1REVA 4IFYA 4CEQA 3KLFA 3V1OA 4CIGA 3HM9A 3TAQA 3U6FA 3TAEA 2P5OA 3L3UA 1KVAA 3KKRA 3L2VA 2OPPA 4CGIA 4Z4FA 4CJLA 1A5VA 1RCHA 4LY7A 4KAZA 2KTQA 1DTTA 1WSGA 3NF8A 2HNZA 1RT2A 3SI6A 1TAUA 3V9SA 1A5WA 1KFDA 2X74A 2WOMA 4CJSA 3EZ5A 2IDOA 4DFJA 3G0ZA 4DF4A 3AVGA 1VSEA 4OPKA 1RT6A 1U47A 4KPYA 3AVKA 4R5PA 2GBZA 3AA4A 3O4QA 4Q5VA 1R0AA 1JXBA 3OYNA 3TAFA 1NKCA 3OVNA 4C8LA 1GOBA 1NJYA 3ALYA 2BANA 1CLQA 3L8BA 1HJRA 3QINA 3QO9A 4CGHA 4W5OA 3SV4A 5I3UA 1N6QA 1BGXT 3L2RA 1ZYQA 2G8VA 4FLYA 1TKZA 2Q3SA 3V9WA 5JS2A 4B9LA 3ZSOA 4NCGA 1YT3A 4M3RA 1KFSA 3AV9A 1WSEA 1FK9A 4FXDA 3ZT4A 1J9AA 1NKBA 3RRGA 5KI6A 3P5JA 2RN2A 3K5MA 1LWFA 4AHSA 3HXMA 2DFHA 4CEFA 1UAXA 4O4GA 1JLGA 4N47A 3VQCA 4O0JA 4CJUA 2FBVA 1NOYA 4CCHA 2ATQA 4CF1A 2R7YA 1RTJA 2HB5A 4LSNA 3VA0A 4H8KA 1TVRA 4FJJA 3VN5A 1Q9XA 1U4BA 3S9HA 3TANA 1BQMA 1LWEA 4TSXA 3T3FA 3I8DA 1TK8A 1D9DA 3KLGA 2XO7A 3EYZA 3L2WA 1RDBA 1TL1A 3ITHA 4CHQA 1BI4B 4DU3A 3PX6A 1VSFA 1WAFA 1IG9A 4CJFA 3V9UA 2FBTA 3C6TA 3O4NA 1RT7A 1YVUA 1RT5A 2JLEA 4DTSA 3KK1A 3AO3A 3QEVA 4J2EA 5JS1A 1BI4A 5SWMA 3C6UA 3SUOA 1LWCA 1S1XA 1EKEA 1GOCA 4BDYA 3NF6A 2BDPA 4BWMA 3V9ZA 3VQEA 3F73A 4OKJA 4QAGA 5E41A 4LD0A 2YHBA 4I7FA 3HPOA 4BDZA 4DSEA 3SPYA 2HHUA 2Z1IA 3VQAA 1IKXA 4GW6A 1NK7A 1LV5A 4L8RB 1B9FA 2ITGA 2E6LA 5HP1A 1IKVA 4CEEA 3LP0A 3CFRA 2Y1JA 4FK0A 4Z4EA 1I39A 4M3WA 4CHPA 4IKFA 5EU7A 1S6PA 4RW9A 4FVMA 3TABA 4J2AA 4GVMA 1VSHA 3PUFA 5FRMA 3MEGA 1ZBFA 3K2PA 4H4OA 2OPSA 4O44A 2HHVA 4M3YA 3OYAA 3LZJA 3PX4A 4KO0A 5C25A 3V4IA 4FJXA 4FZYA 1XHXA 3WNFA 1QE1A 4CECA 2D0BA 4FW2A 4DTRA 2KFNA 2A1RA 4EZ9A 3NDKA 3IG1A 3SZ2A 5HROA 4FJ7A 2DTUA 3ZT2A 2XY6A 2Y1IA 4CFDA 1CXQA 1SKWA 4JS4A 3MEEA
chains in the Genus database with same CATH superfamily
5HL7L 1IH7A 5JLHA 4DS4A 4A62A 2JWKA 1QSYA 3MDQA 2I5JA 4LH4A 4KH4A 3LDSA 4BE1A 4CD3A 1L3SA 4CI6A 3P38A 5CHIA 2PZSA 3VTHA 1DT9A 1NBWA 4BR4A 4JV5K 4H5WA 2B5JA 1L3TA 2GV9A 1VSKA 4BC5A 1VQKN 2OTJN 1NK8A 2QWRA 4E3SA 1RBUA 4DTUA 3H3NO 5IT9O 2P9LB 4H5RA 4BREA 4E1NA 1BIZA 1C0GA 4CEOA 1XWLA 4BGAA 3CCLN 4AHUA 1NJWA 1QSSA 5TKYA 1IV0A 5C24A 3WNEA 5I9EB 3OYLA 4JKEA 5AZIB 1YIJN 4IFVA 2ASPA 4NYNA 1JLAA 4CFCA 4EHTA 4BY9C 4IO9L 4H0VB 3KLIA 3O9RA 5J2NA 3HVRA 2O8EA 2WBNA 3LZIA 1HKBA 1QSLA 4G9ZA 1WSHA 3CETA 1EX4A 4JHDB 1HRHA 3A5OC 2P51A 3KLHA 4CJWA 3CCMN 5D3GA 1SZ2A 2QW9A 4CJ3A 4B8AB 4E7IA 4FWNA 1U04A 3HSTB 1WSJA 4BRHA 1C6VA 4FM0A 1ATNA 5KRSA 5KPZA 2CGJA 4FJNA 3MXMA 4B1UB 4KTWA 3CC4N 1Q81O 3CJ9A 3NF7A 2IVNA 4B9QA 4FM1A 4W5NA 1QQCA 2OPQA 1YJNN 4CZEA 3E9PA 2UUBK 1NG9A 3TI0A 1NNEA 1EP4A 3L4QA 3AO1A 2PYJA 3SAHA 1LW2A 3KZBA 2Q2RA 3ZX0A 5AQTA 1KLMA 4IOCL 2O8BB 1XNRK 3SJHA 1UA0A 3THYB 4GV3A 4BRIA 4A2AA 4NLBA 3CERA 4LSLA 5C15A 4W5QA 3OS2A 5I42A 4FJGA 5AQYA 1ZBSA 1RBSA 3GL1A 1VSDA 1X9JA 3HP9A 4AM6A 4EP5A 1T8EA 1IG8A 3GDQA 3RMCA 3DRRA 3FFKB 3OYCA 3M8PA 3TSPA 4BE0A 3G4SN 4RW4A 4DQIA 4RW6A 1TYQA 2HHSA 3V1RA 4FVUA 5M1FA 3HK2A 3L2UA 1J5EK 4Z4GA 4B9TA 4KH6A 3EO3A 1N32K 4BACA 1C1BA 2QXLA 4JEPA 5BRFA 5AQPA 3DOLA 3DXMA 3O3HA 1X9WA 1Q9YA 2HHQA 5BRHA 3QIOA 1K8AO 3UIQA 4CFAA 4B3TK 4L3QA 2A40A 3P31A 1U49A 2WC9A 3V81A 3QFUA 5AFUA 1JLCA 3D2EA 4CGJA 4NYFA 2HF4A 2HSTA 3O08A 1IBMK 4KH5A 3RR7A 4O0IA 3C7NB 4DQSA 3HSCA 1RDWX 4CJPA 3HJFA 2NRWA 3JAMO 4N41A 2HW3A 1T03A 1QVGM 3VTIA 4PHTX 4E7KA 4AH9A 1V4SA 2QWPA 4C8KA 4FK4A 4U7BA 2B4JA 4K41A 3OYFA 4YOYA 3MEDA 1K8KB 1UOCA 4YORA 3H46O 4IEIA 5BPNA 1BDGA 1SAZA 5J2QA 1RBVA 2ASMA 2E6MA 3SK3A 1Q82O 4WE1A 3OYDA 3T69A 5AZIA 4CBWA 4O5BA 3TWHA 3D2FA 1HUXA 5SZTA 1Z26A 1SL0A 2RE2A 4OX9K 1HJOA 4I2PA 4KREA 4KHQA 4DQRA 4FZZA 2P5GA 2E2PA 4CJKA 1J54A 5BR9A 3AGRA 4BRLA 4YFUA 1HNXK 4DV6K 3F2KA 4F3TA 4E1JA 3V6DA 3HPGA 1RBRA 3EY1A 1ZBIA 1YTAA 1TGOA 3O9TA 2CH5A 4QOZB 1E3MA 2Z1JA 2P9UB 2Z1GA 2V52B 4JRQA 3WT0A 4M3ZA 1DLOA 3ZCMA 4WQ5C 4F2RA 2UXBK 4JS5A 1P8ZA 1KVCA 4CFBA 3AA2A 2GUPA 2KFZA 3T19A 4BRAA 3FZKA 4DQPA 3FZHA 2QWQA 3I0SA 1KVBA 1HMVA 4IG3A 5AZJB 2KW4A 3M8RA 3CMEN 5AR0A 1JLQA 3GE1A 1E4FT 4HTLA 1ASUA 2BUPA 2IVOA 5AQGA 2OZSA 2ZE2A 5EX5A 4ZTFA 3U4LA 2ZGYA 1UA1A 2E5LK 4FJMA 3LDPA 1XC9A 2WFBA 5AFUH 2P9IA 3TPQA 3VQQA 1ZBLA 5FLXO 2UU9K 2P9IB 3M5RA 1WNSA 4MFBA 3AVIA 4FWRA 5CZ2A 1XHZA 3RSEA 2OCEA 3BGRA 4Z4IA 4M3XA 5AQVA 5FPDA 3OTOK 2Q31A 5F0XA 2HBKA 4A59A 3D7EO 4FYDA 4DTOA 3NHGA 3OBYA 1NGHA 2RKIA 1KAXA 1J6ZA 1TUYA 3NH2A 3DLGA 4DFMA 4NXMK 4IO8A 3K9KA 4A5BA 4DV5K 1NJZA 2HMPA 4QS7A 2YHXA 1FKPA 4DTXA 4JI8K 4LC9B 1J53A 3U9DA 1YAGA 4QS9A 3FLCO 3HM8A 1NJIO 3K5NA 3RWUA 1BQNA 1JLFA 3VQ8A 1HYVA 1REVA 4H0TB 4IFYA 4LFAK 4CEQA 3KLFA 3V1OA 3TAEA 2P5OA 3KKRA 4DR4K 4Z4FA 1GLCG 4C1NI 3V9SA 4CJSA 2IDOA 3Q7BA 3J7ZO 2O8FA 2P9SB 4Q5VA 1JXBA 1NKCA 3ULEB 1WBBA 5F2RA 3L8BA 4CGHA 3QO9A 3N4QA 1KD1O 1BA1A 1TKZA 5JS2A 4FL9A 3P39A 5LY3A 3C6AA 1WSEA 3H1QA 4Y0WA 1LWFA 3HXMA 4BRDA 2V7YA 1YJWN 4O4GA 1NOYA 4CCHA 1RTJA 2HB5A 4B1ZA 5KQ8A 1Q9XA 5JLFA 3I8DA 1YI2N 5EVZA 2XO7A 3WEEB 3WUHA 3L2WA 3PX6A 1BI4B 5F1XA 2OTLN 1HR0K 2FBTA 3C6TA 5AJ3K 1RT5A 3KK1A 3AO3A 3QEVA 1BI4A 3I56N 5SWMA 3C6UA 5GAGP 1N8RO 4YHHK 4BWMA 3V9ZA 3F73A 4OKJA 1U6ZA 4JKAA 2NRTA 2A42A 3VQAA 4L8RB 3JS6A 3LP0A 4M3WA 4CBXA 2ITMA 4IKFA 5EU7A 4GVMA 1VSHA 2GELA 4RWTA 3K2PA 5EOYA 1G99A 4FWOA 3WNFA 2W41A 4A2BA 4FO0A 3J8AA 2JWLA 3AY9A 4MDBA 3ENOA 2DTUA 2P9LA 2XY6A 3U8XA 2Y1IA 4FWPA 2ZM6K 4FPAA 3MEEA 1RILA 2Q0RA 3I0RA 3EL2A 3A8YA 2P9NA 1Y97A 2AJQA 2RPIA 1D4XA 3E9LA 1TK0A 4BG9A 3LP3A 3WXMB 4OGEA 4HTUA 2KQ2A 1HNZK 1V4TA 4Z4CA 1QS4A 5M1KA 3QFPA 2E88A 5T7BA 2PYLA 3AVCA 2V51B 4CD1A 1KLNA 3MXJA 1JL1A 1HPZA 1XMOK 3NF9A 4X66K 4IOXA 4FOIA 3E66A 1K6YA 1N33K 1MWKA 4DLGA 1C0MA 2IS3A 3QB0A 3H08A 4EFHA 3B8AX 4BRFA 4F8RA 3KD1E 4H4MA 2D0AA 4JK8A 4PL8A 4QCLA 2WUSA 2HHHK 1RT4A 4CHZA 4KHNA 3LPUA 3TSUA 5J1EA 3ZSZA 3MN5A 4Z4HA 5DM6L 4KHSA 2NUBA 4J2BA 1F21A 3IFRA 1RBTA 4GV9A 4OPJA 5AQOA 1O1WA 4KV8A 3MWTA 1UWBA 3RRHA 4I2QA 4B3OA 3B6OA 4CEAA 1Z05A 2D0OA 4DFKA 3QNNA 4LF7K 1KC8O 4M3UA 4E89A 3AGKA 1X9SA 4IEEA 1J5OA 4JD2B 1L5UA 3OJUA 3THYA 3BF1A 4Q0BA 3F9MA 4K43A 2VG6A 4WQ5A 4N5SA 4DUZK 4LF5K 2ZWHA 3EZWA 4CK1A 2YCHA 4NCBA 1S5JA 3VETA 2ZJQL 2DY4A 5KPRA 4LF6K 2F8TA 1WN7A 2YX6A 4CESA 4DV0K 3R6MA 3BP8A 1NOZA 1GLFO 5AQNA 4HVJA 3S3OA 3ZSXA 4DR5K 5AQHA 3TSQA 3AA3A 1VK0A 2FXUA 4AILC 4ELTA 1NJXA 1JLEA 4FLVA 1NK9A 1B9DA 1NWKA 2FBYA 4AHVA 4B1YB 4FZXC 3MN9A 3CD6N 5CYQA 1LAVA 3F9KA 3EKSA 3QEPA 4YNQA 3MAQA 1VQNN 4BC3A 2PBDA 3O6WA 3H3OB 4CF9A 2GWKA 4DHYA 3O9QA 5BN9A 2QWLA 4M63C 5JVGL 3NGIA 4FJHA 3WXLA 2NRRA 4NLCA 4ZTJA 4GKKK 3G10A 3THVA 4HCCA 4I6MB 2GX9A 4E7LA 2HNYA 3CJ7A 3NGYA 4OPHA 5MLCQ 4F3OA 2QXFA 2FBXA 4BRQA 4FSVA 3SCXA 4BROA 3VQ6A 3OYGA 4PY5A 4CJVA 5IWAK 4H0PA 1MA9B 1TV6A 3OYEA 3PX0A 3VQBA 4CJ7A 3LWLA 1LOTB 4BR5A 1X3MA 2E1YA 4V19S 2YHAA 4PKGA 4B3MK 3HVTA 4DV2K 1S72N 2EWSA 1X1PA 1U2VA 3IMXA 2WONA 5J2PA 2A5XA 4CK3A 1IJJA 2F9WA 5FDLA 3O3GA 3D2EB 4OKKA 3R9PA 3VEYA 4A57A 2B6AA 4OLBA 1D8YA 3VQ5A 4CF8A 1QVFM 3BF3A 2F8SA 2E4LA 1U48A 3ZSQA 3I33A 1JL2A 4B9UA 3T7ZA 4JI5K 4FJ5A 1WSFA 3D0PA 2G8IA 4JHDA 2BE2A 3GBTA 3AO2A 3UKUA 3KLEA 4ZHRA 4BR2A 4LF4K 1BCOA 4FOEA 2YKNA 2QKKA 4K8ZA 4AHRA 3ZT1A 4EIAA 3CG7A 4B9VA 4G1QA 3TAGA 3MX2A 1GLEG 2G8HA 1YJ9N 2FLOA 4BDPA 4JLHA 3G71N 3K5LA 5TKWA 2NZTA 1SV5A 3FZMA 2VGMA 4JYAK 4FJLA 1U45A 5BRDA 2YI1A 5HRPA 4CEDA 4CJEA 3LWMA 2GUIA 3SBTA 4KHUA 4CZMA 5HLFA 2KZZA 4OGCA 4CZJA 5LMNK 4ELVA 3DM2A 4PWDA 3SYZA 4M7YA 2YHYA 1VRUA 4JAXA 4WFNL 3KTQA 3E01A 1RT3A 3JSMA 1S9GA 5KGWA 3VEXA 5CE3A 3IAYA 3LDLA 5HBMA 1G15A 2FF6A 2X6NA 4CIFA 2KFNA 4ICLA 1FXXA 4IDKA 1VQ4N 5AQQA 1NGEA 3MXIA 1JKHA 1RDUA 1IKWA 3CHWA 3SV3A 4IJAA 5CZ1A 1NKEA 3JYTA 5C42A 3GOIA 3LM2A 1TKDA 1VAZA 2QK9A 3IUCA 5CR4A 3EN9A 1TYQB 4ID5A 1RNHA 2W6LA 4ISEA 3HOSA 3ASMA 3LAKA 2VGNA 2OYQA 2O8CA 3FE1A 1QHTA 3OYHA 2NRXA 2E2QA 1NGIA 3CYMA 5A2QO 3QEXA 4YOXA 2O8CB 4FCYA 4FLTA 3FFIA 1Q7YO 4WQ4C 3VQ7A 3PLAA 5LJVA 3K59A 1RTIA 5ADXH 2P9KA 1GLDG 3W3DA 2NRHA 3TAMA 3DRSA 3CF5L 3QBWA 4JNEA 1T05A 4CF0A 4KTQA 1ITGA 4DQ8A 1ATRA 4CZFA 4IXCA 3OYIA 2EX3A 3HT3A 1YITN 3ZX3A 4DTNA 1OH6A 3DOKA 3OYJA 5ADXA 5CY4A 3LAMA 1A5XA 2G8WA 3HPHA 1NU0A 5LL6Z 3NE6A 1NMDA 3LP1A 4DV7K 2BH1A 4B9MA 2IIRA 2P9PA 4CJRA 4DR1K 1WAJA 3VGMA 1BU6O 3VQ4A 2PY5A 4I9QA 1Q8IA 2YV0X 1T7PA 1NM1A 2GEMA 4PKHA 4JI7K 2ZJPL 1NLVA 3C7NA 3L2VA 2OPPA 3VF4A 4LFCK 2QTDA 1A5VA 3CC2N 3TTCA 3WXIA 1TAUA 2HBJA 1A5WA 2WOMA 3UKRB 4DF4A 1U47A 4ISGA 3AVKA 4R5PA 4YOWA 3O4QA 4MO4A 3OYNA 4BGBA 1GOBA 5BREA 2PAVA 2BANA 4ILHA 3SV4A 5I3UA 1N6QA 1BGXT 2G8VA 1P90A 1X3NA 4FLYA 4H5NA 1EWRA 4M3RA 1KFSA 3AV9A 3SAFA 3ZT4A 3A5NC 3RRGA 3O5BA 3P5JA 3K5MA 1VQ5N 4CEFA 4K42A 4CJUA 2FBVA 4EAHD 4GNIA 4CF1A 3OBWA 5GINA 1U4BA 3CI5A 4M7XA 3S9HA 1YUWA 3QBXA 3KLGA 4DU3A 3ITHA 1WAFA 1IG9A 4YOTA 2KLAA 3CIPA 2JLEA 5JS1A 1VQ9N 4B1WB 1S1XA 1QQMA 2BDPA 3C65A 2E2OA 3J7AP 4QAGA 3CJ1A 5E41A 2HF3A 4LD0A 2HHUA 3HPOA 4DSEA 1YF5L 1IKXA 4GW6A 2E6LA 4JI1K 3CCVN 4FK0A 3CMAN 2NRVA 4JK9A 4J2AA 4XH4A 1XNQK 3M6GA 5BPLA 1ZBFA 2OPSA 3AAPA 2HHVA 5GAEP 4M3YA 3PX4A 4FJXA 4FZYA 1QE1A 3PSIA 2D0BA 4DTRA 5HOOA 3IG1A 3NDKA 1K9MO 3ZT2A 1CXQA 4JS4A 1QZ5A 4F9OA 3ID6A 2YJFA 3T1HK 1CZ9A 2J4RA 1NGGA 1EWQA 2HMIA 4FLUA 3ZSYA 3C0BA 4QS8A 5KGXA 4CHYA 3LDNA 4KI4A 1ESVA 2AA4A 1KXPA 3CCSN 5BPMA 3BDPA 2D0CA 3NCIA 3H45C 3PV8A 2X78A 4CF2A 2G8KA 4F4KA 1VQON 3C95A 1NGBA 3UE5A 2OPRA 3AVAA 4B1XB 4K25A 3HYFA 2ETJA 2HVHA 1CXUA 3CPWM 4FWMA 2ZJRL 5ELZA 1T6CA 5KRTA 3O1BA 3ENHA 3QIPA 2F9TA 3EEQA 4Y1CA 1IO2A 4AM7A 3HP6A 3S3NA 1SKSA 4CK2A 2YKMA 4UQGA 1TL3A 3LP2A 3QLHA 4HHTA 3FZLA 3KJVA 1N34K 3D45A 3NH0A 3KK2A 3CQ8A 1NGCA 4NB4A 4X65K 2VG7A 1RDDA 5GIOA 4YY3K 3R8EA 1WB9A 2E20A 3PO5A 1ZBUA 3VESA 3CM6A 1KSPA 4CZIA 1NK0A 4NCAA 4M45A 5EY4A 5DM7L 1BUPA 1DGKN 3OHRA 1IBKK 1NK6A 1N5YA 4PKIA 4CE9A 4WQ4A 3SJJA 3OS1A 4CGFA 1ZBHA 3DLRA 3H1VX 3M1FA 5AQXA 3T1AA 4K0KK 2ZF5O 2IOCA 5KQDA 3ULEA 3U9ZA 4BRKA 1VQ6N 1WLJA 1VSMA 3CJCA 1RFQA 3CC7N 4BRPA 1JLBA 3M8SA 3KWGA 2HBMA 1W0HA 1ZC6A 1H1VA 3P1GA 1MU2A 1S6QA 3UB5A 2XY5A 3VGKA 3CCJN 3TAPA 4J8FA 4I9LA 5GAHP 3VF2A 1EXQA 1U2VB 4N56A 3G25A 4Y1DA 1CZBA 4JI0K 3HO1A 3O80A 2QA4N 4YOUA 4HCBA 3K0SA 3DYAA 2Q1NA 4B3SK 4CERA 3AO4A 3LPTA 1M90O 2P9NB 3PIOL 3WQTA 3TARA 3JXUA 3M8QA 4I6MA 4O55A 2YHWA 3IS9A 3AVMA 3L6QA 1SUQA 5HRSA 3CXCM 3ISNC 4JN4A 3TTFA 2IVPA 2CH6A 1VQPN 1OH8A 2DFFA 4KI6A 3UKUB 2A6AA 3BY5A 2OANA 2UXDK 3VGLA 1S3XA 3VEVA 2QWNA 2LSNA 1BOTO 4KFBA 4O8KA 4AHCA 4GV6A 2D5RA 4E7JA 3ZT0A 1OVYA 4DSIA 3KIOA 4EHUA 4PQUA 2F7TA 1KTQA 2VQFK 5AQSA 5AQMA 4DTPA 2HHWA 3ZETA 4H0YB 4MDAA 5M1NA 1RTDA 3WNHA 4BG8A 4CJQA 1RDAA 3ZETB 4ILJA 2QM1A 1EQYA 1WSIA 3AVBA 1N36K 5AQLA 1OKJA 4C8MA 5FPMA 3OW2M 3DLKA 4DV3K 1S1WA 4M3TA 4WFBL 3QESA 1C1AA 3DLBA 4NO7A 4C23A 4XH5A 4RW7A 2QEXN 3MX5A 4JRPA 2XY8A 3KKSA 3O8MA 3ZT3A 3C6HA 2ZD1A 3MMVA 1HNWK 1DKGD 4C8OA 1CZAN 4FK2A 3ID8A 2O8DB 2AP1A 3OY9A 5GIPA 2O8DA 3NFAA 3KD5E 2RHKA 1YHQN 4ELUA 5LMUK 1JJ2M 1KAYA 4DU4A 1JCEA 3ULDA 3W0LA 1IKYA 2O8BA 3SQ0A 3SNNA 4EP4A 4CHNA 3AVJA 4CHOA 4DWIA 4BQZA 4FJIA 3NVMA 2ZQBA 1ASWA 1NK5A 1JXEA 3S3MA 4X62K 1LW0A 1HNIA 1WOQA 5FRNA 2HNDA 3MWPA 1HYSA 4B08A 2I7NA 3O4WA 3VQPA 1RGIA 2P9KB 2OZMA 4R79A 4HWIA 4DU1A 1ASVA 3OYMA 4HUGA 2HHXA 4H5TA 3KK7A 3AA5X 4FLXA 4OLAA 2YNFA 4BE2A 3OA9A 5FPEA 4A5AA 3QEWA 1XC3A 2GWJA 2KHOA 1OH5A 2VCPA 3V1QA 3SUNA 3TR8A 3VQ9A 4BC2A 3WXJA 3BEXA 1TUUA 4IZ9A 1SKRA 1BIUA 1I3AA 4LFBK 1XQSC 2F4VK 2VQEK 3RMDA 3RTVA 1YVNA 3DWLA 3P4IA 1BL3A 4DSJA 3HOTA 2QKBA 3AVLA 3R3LA 4ILGB 4Z0UA 3DLEA 2WTUA 1WUAA 1VQ8N 4H0XB 4FM2A 3IRXA 3THWA 1QHAA 2W42A 1VSJA 2VWBA 1NGDA 4ID1A 3WXKA 4RG8A 2KZMA 2F96A 3CJAA 3MK6A 4MLEA 3V9XA 4KB0A 2A41A 2JGUA 3HI0A 4CEZA 3SUPA 2VWKA 5KTQA 3SPZA 4XEIA 3E1YA 5AQUA 3VA3A 3OS0A 4OJRA 4DB3A 3BZKA 2Q36A 4JI6K 4DSLA 3KHYA 4BRMA 1L3UA 3U3GA 2QI2A 3O9SA 3J80O 3S41A 3ZSRA 3FGUA 3VEZA 4FJ8A 4AF1A 4CZLA 4CIGA 3TAQA 3U6FA 1LCUA 3DAWA 3HRGA 4DR7K 3DJCA 4LY7A 4KAZA 2KTQA 1DTTA 1WSGA 3NF8A 4CZGA 5B8HA 3L0QA 1JCGA 3EZ5A 2X74A 4KPYA 3G0ZA 1VSEA 4OPKA 5E84A 2UUAK 2GBZA 3AA4A 1R0AA 4FWKA 3CPEA 1NJYA 3ALYA 1CLQA 4U67L 3VF6A 1HJRA 4W5OA 3L2RA 4DR3K 3SMSA 4CZKA 3R1XA 1KQSM 4JD2A 3HTVA 4N47A 4O0JA 1W97L 2ATQA 1ILYA 3SLCA 2R7YA 1T3VA 4LSNA 5AQRA 3FZFA 4H8KA 1TVRA 4FJJA 3VN5A 3BZCA 3TANA 2P9SA 1BQMA 2V7ZA 4TSXA 2UUCK 1D9DA 3ZYYX 3EYZA 5AQZA 1RDBA 1TL1A 4CHQA 3V9UA 3O4NA 4DTSA 1YVUA 1Y64A 3TU5A 3WQUA 3DXKA 1LWCA 4H03B 2BTFA 3H6EA 3NF6A 4BC4A 4H5VA 3VQEA 3SPYA 3CCUN 2YHBA 2Z1IA 5C12A 1LV5A 1NK7A 4B1VA 1B9FA 5HP1A 4CEEA 4Z4EA 5H1SQ 5JMVA 1GLAG 4FVMA 3TABA 1SS6A 5FRMA 3MEGA 1GLBG 4O44A 3OYAA 3LZJA 4JKGB 5C25A 4X64K 3V4IA 1XHXA 1OVQA 1HLUA 4EZ9A 5M1PA 3SZ2A 5HROA 4FJ7A 1HPMA 3D6RA 1SKWA 4KHYA 5FROA 3O1WA 4LF8K 3LM9A 3K58A 4M42A 1GLJO 4FJ9A 4AQYK 4DQQA 4KB1A 2FF3B 5HRNA 2H3GX 5E26A 3HZ6A 3DXMB 1S22A 3E9OA 2OA8A 4KRFA 4BRNA 4WF9L 2VG5A 4FPBA 4FJKA 3VEOA 4AHTA 4BQLA 2YNGA 1QTMA 1SL1A 3OYKA 2DFEA 3DRPA 3ATVA 4RTFD 3KVGA 1Z6RA 2W40A 4E19A 4O5FA 3LDOA 1KAZA 5K14A 3DI6A 2O8EB 2VYPA 5AQFA 2KKZA 3SQ1A 4E7HA 3NGZA 3CQXA 2BGGA 2E8AA 1JCFA 4DV4K 2X6SA 4GVEA 4BVOA 3VQDA 4DKWA 5LJWA 3RR8A 3B6PA 4EZ6A 1XUPO 1ZXOA 5JICA 3KK3A 2RF2A 3T1YK 3QMLA 4C8NA 1NK4A 4JKFA 5KPTA 2HOEA 2D1KA 4N76A 1HNVA 1SQKA 3A2FA 4E1MA 3C94A 4MLHA 4ISFA 1BHLA 4KBOA 1T6DA 2O4IA 1K73O 4J2DA 2A3ZA 3NMUA 1EETA 4DR6K 4CW7B 3IDHA 3NVKA 1NGJA 4JI3K 5EXWA 3K5OA 4RW8A 3QEIA 4JI4K 1R59O 4PL7A 4K8XA 4IBNA 4JKCA 3LDQA 3K57A 2IGIA 4BR9A 3MN6A 3VOVA 5FPNA 4A61A 1C0TA 5AZJA 1ATSA 1Q86O 2FC0A 5CYMA 4IFEA 3RMAA 4KKOA 1TK5A 5JVHL 3CFOA 5BR8K 3SAGA 3CCEN 2EHGA 4CEBA 3CFPA 3VEWA 3EE9A 4M41A 3VERA 3NH1A 2P9UA 1I94K 1RTHA 1Q18A 2ZGZA 4B9SA 4CVNE 2Q0UA 1MDUB 1GOAA 2XRIA 3ZSVA 3L3VA 3AVHA 4OVLA 4PUOA 3MCPA 4NXNK 1KCFA 1VSIA 1VRTA 2IC3A 1TAQA 3THXB 5DMRA 3QETA 1YTUA 1C0FA 4GKJK 3WNGA 2XHBA 3A5LC 3PO4A 1S1TA 1WBDA 1HQEA 1HYZA 5AQKA 4FW1A 3MECA 4FLWA 3AO5A 3AARA 3P83D 3J81O 2O4GA 4W5TA 4JKGA 3F5TA 4DCHA 3OJSA 2CGKA 4CIEA 4DG1A 4E0DA 1XI1A 4W5RA 1NMNA 1HKCA 1BA0A 2YNHA 3SQ4A 1E4GT 4BWJA 3SBGA 1NGFA 4MO5A 3SQ2A 4DMNA 2DPNA 4O8UA 3RSEB 2HHTA 4CGGA 2QWOA 3N4PA 1DTQA 4XIUA 4DSFA 3EE8A 3ZX2A 1W9HA 1RDCA 5GADP 1VSLA 3O9UA 1C1CA 4FLZA 5DK5A 1K8KA 4B9NA 3ATUA 2HVIA 3SUQA 4B3RK 5C2FA 3KWIA 1W2BM 4OPAA 4DF8A 1FKOA 1IBLK 1KRPA 1TKTA 3D2FB 3QNOA 1T44A 4HUFA 5HRRA 1S9EA 1BCMA 2G8FA 4CJTA 3HBTA 2Z1HA 2CGLA 4CJ4A 4B8CA 1C0UA 4MQ3A 3O3FA 1EO1A 2O8FB 1S1VA 3FR0A 4IG0A 4JI2K 3ZEUB 1HX1A 2XY7A 4CJ5A 4Z94A 3U3YA 5J2MA 4IWVA 2VWJA 4JKDA 3HL8A 4HUEA 4F2SA 4DR2K 3IKMA 3DLHA 3GG4A 4PA1A 4GY2B 4BRGA 2YJEA 1SL2A 4JK7A 3VPZA 4BVPA 5C0YA 3K9JA 4XH1A 3SMPA 1HQUA 2FSKA 2YNIA 1L3VA 1BISA 5M1QA 2E2NA 3ENBA 1D9FA 3AAQA 2IAJA 3QICA 1Z25A 4IDHA 4JKBA 2A1SA 3EKUA 3WEEA 1X9MA 2G8UA 4DTJA 1NGAA 3OYBA 4JKHA 2NLXA 3QDKA 3CM5A 1LAWA 4DFPA 4H0OA 4WCEL 3TTDA 1W7AA 3LALA 1S1UA 1BG3A 3L2QA 4KHWA 4KHPK 1RT1A 3NAEA 1BO5O 4FWLA 3VMFB 4C1NK 3RVCA 1M1KO 4CZHA 4BRCA 4RCHA 3NBPA 1VHXA 4IOAL 4DSKA 2PFUA 4BR0A 3PSFA 4IJNA 3ZSWA 2I7PA 4CGDA 4GMJB 3RMBA 5M1OA 5AQJA 3BUZB 2E1ZA 2FSJA 4LF9K 1B92A 2NNWA 3PIPL 3THXA 4LH5A 3LANA 3AVNA 1TKXA 4KTZA 4DLEA 2HBLA 4YDUA 3UKRA 2P1JA 3A5MC 3AVFA 3DMJA 1D5AA 1OH7A 1QZ6A 3CCQN 4CBUA 3QERA 4DS5A 1VQMN 3PY8A 1QQNA 2ASOA 3DLLL 4DTMA 4OKEA 2D0PA 4DUYK 4FWSA 4WFAL 2QWMA 3J7YP 3HM9A 1XMQK 3L3UA 1KVAA 4CGIA 4CJLA 1RCHA 1YXQA 2HNZA 1RT2A 3SI6A 1KFDA 3LL3A 4DFJA 3AVGA 1RT6A 1HKGA 3L4IA 3TAFA 3OVNA 3I8BA 4C8LA 2P9PB 4WYBA 3QINA 4OO1J 1ZYQA 3MN7A 2Q3SA 3V9WA 4B9LA 3ZSOA 4NCGA 1YT3A 1FK9A 3VENA 4FXDA 1J9AA 1NKBA 5KI6A 4YDUC 2RN2A 4AHSA 2DFHA 2GTDA 1MWMA 1UAXA 4BR7A 1JLGA 3VQCA 1O13A 3CCRN 1FW6A 3VA0A 3I55N 1LWEA 3T3FA 5BN8A 2FSNA 3G6EN 1FJGK 5AQIA 1VSFA 3M3ZA 1GLLO 4CJFA 1TK8A 1RT7A 2D4WA 4J2EA 4YOVA 3ZEUA 3Q7CA 3SUOA 1EKEA 1GOCA 5C2DA 1QQOA 4BDYA 2UXCK 3CJBA 3DXKB 4I7FA 4BDZA 5C10A 3A0IX 2W6KA 1BWFO 2ITGA 1IKVA 3CFRA 3MCAB 2Y1JA 1I39A 4FWQA 3ZLJA 4CHPA 1S6PA 4RW9A 4DV1K 3PUFA 3CQYA 5AQWA 4H4OA 1DEJA 4KO0A 4UY8O 2NRZA 3THWB 1VQLN 4CECA 4FW2A 2A1RA 2Q97A 2UYTA 1VQ7N 4CFDA
chains in the Genus database with same CATH topology
5FROA 1IH7A 4DS4A 1RILA 3I0RA 1QSYA 2I5JA 3K58A 4LH4A 4M42A 1Y97A 1CZ9A 4FJ9A 2AJQA 3LDSA 4BE1A 4DQQA 4KB1A 2RPIA 5HRNA 1L3SA 1TK0A 2PZSA 2HMIA 3LP3A 4FLUA 4OGEA 3ZSYA 4HTUA 2KQ2A 4Z4CA 1QS4A 5KGXA 5T7BA 2OA8A 4CHYA 2PYLA 4KRFA 3AVCA 2B5JA 1L3TA 4KI4A 2GV9A 1KLNA 1VSKA 3MXJA 1JL1A 1HPZA 2VG5A 3NF9A 1NK8A 3BDPA 4FJKA 4E3SA 1RBUA 4DTUA 2D0CA 4AHTA 3NCIA 3PV8A 2YNGA 1K6YA 2X78A 4CF2A 1QTMA 1SL1A 2G8KA 3OYKA 4E1NA 1BIZA 1C0MA 4DLGA 2IS3A 1XWLA 2DFEA 3DRPA 4CEOA 4F4KA 3C95A 4AHUA 1NJWA 3H08A 2OPRA 1QSSA 3AVAA 5C24A 3KD1E 4F8RA 4E19A 4H4MA 2D0AA 3HYFA 3WNEA 2ETJA 2HVHA 4QCLA 1CXUA 3OYLA 1RT4A 4CHZA 4KHNA 3LPUA 3DI6A 5K14A 4F3OA 4IFVA 4NYNA 5KRTA 1JLAA 3QIPA 4CFCA 5J1EA 3SQ1A 4E7HA 3KLIA 5J2NA 3ZSZA 3HVRA 4Y1CA 4Z4HA 3NGZA 4KHSA 1IO2A 2NUBA 3HP6A 3S3NA 1SKSA 4CK2A 2YKMA 4UQGA 1F21A 1TL3A 3LP2A 3QLHA 3LZIA 3KJVA 4HHTA 1QSLA 1RBTA 1WSHA 4OPJA 3D45A 3NH0A 3KK2A 1EX4A 3CQ8A 4FJHA 1O1WA 1HRHA 2X6SA 2P51A 4KV8A 3VQDA 1UWBA 2VG7A 4CJWA 3KLHA 3B6PA 1RDDA 4I2QA 3RRHA 3B6OA 4CEAA 3KK3A 2RF2A 4DFKA 3QNNA 4EZ6A 5D3GA 4M3UA 4E89A 4C8NA 1ZBUA 3PO5A 4CJ3A 4B8AB 3CM6A 1NK4A 1X9SA 1J5OA 4E7IA 1KSPA 1L5UA 1NK0A 1U04A 3HSTB 4N76A 4M45A 1WSJA 1HNVA 4NCAA 3OJUA 3A2FA 4E1MA 4Q0BA 1C6VA 4FM0A 2VG6A 3C94A 1NK6A 5KRSA 1N5YA 1BHLA 4N5SA 4FJNA 4CK1A 3MXMA 4NCBA 4CE9A 2O4IA 4J2DA 1S5JA 3SJJA 3OS1A 4CGFA 2DY4A 1ZBHA 1EETA 2F8TA 1WN7A 3DLRA 3T1AA 4KTWA 4CESA 3NF7A 2IOCA 3K5OA 4RW8A 1NOZA 4FM1A 3QEIA 1QQCA 4W5NA 2OPQA 4HVJA 3S3OA 3ZSXA 3TI0A 1WLJA 4K8XA 1VSMA 4IBNA 1EP4A 3AA3A 3AO1A 2PYJA 3K57A 2IGIA 1VK0A 1LW2A 1JLBA 3M8SA 4AILC 4ELTA 1NJXA 1JLEA 1C0TA 1W0HA 1KLMA 4FLVA 1NK9A 1B9DA 3P1GA 1UA0A 1MU2A 2FBYA 4AHVA 4FZXC 1S6QA 5CYQA 2FC0A 5CYMA 1LAVA 3RMAA 3F9KA 4KKOA 1TK5A 3CFOA 3QEPA 4YNQA 2XY5A 3MAQA 4LSLA 4J2BA 3TAPA 4W5QA 2EHGA 3OS2A 4I9LA 4CEBA 3CFPA 4CF9A 5I42A 4M41A 4FJGA 1EXQA 4N56A 1RBSA 4Y1DA 4EP5A 1CZBA 1VSDA 3HP9A 1RTHA 3NH1A 3HO1A 4B9SA 1T8EA 4HCBA 3RMCA 3NGIA 3DRRA 3OYCA 3M8PA 4BE0A 3DYAA 3RR8A 4RW4A 4DQIA 2XRIA 1GOAA 3AO4A 3LPTA 4CERA 4ZTJA 3G10A 3THVA 3ZSVA 3L3VA 3AVHA 4RW6A 4HCCA 4OVLA 4PUOA 4E7LA 2HNYA 3TARA 2HHSA 1KCFA 3NGYA 2IC3A 1VSIA 1VRTA 1TAQA 2QXFA 3M8QA 2FBXA 4O55A 5DMRA 3V1RA 3L2UA 3QETA 3HK2A 4Z4GA 3SCXA 4B9TA 1YTUA 3IS9A 3AVMA 3VQ6A 1C1BA 4BACA 3OYGA 4PY5A 3WNGA 1SUQA 4CJVA 3DOLA 5HRSA 3O3HA 1X9WA 1TV6A 3ISNC 2XHBA 3OYEA 3PX0A 3VQBA 3LWLA 3PO4A 1Q9YA 2HHQA 1S1TA 3QIOA 3UIQA 1HQEA 1HYZA 4CFAA 4FW1A 2DFFA 3MECA 4FLWA 4KI6A 2YHAA 3AO5A 3P83D 3HVTA 2O4GA 1U49A 4W5TA 1X1PA 3V81A 2WONA 3OJSA 5J2PA 2LSNA 1JLCA 4KFBA 4CIEA 4CK3A 4AHCA 2D5RA 4DG1A 4CGJA 4E7JA 4E0DA 1XI1A 5FDLA 3ZT0A 4W5RA 4NYFA 3SQ4A 2YNHA 4DSIA 3O3GA 4OKKA 3KIOA 4BWJA 2B6AA 4OLBA 4PQUA 3RR7A 4O0IA 1D8YA 3VQ5A 3SQ2A 4CF8A 1KTQA 4DMNA 4DQSA 4CJPA 3HJFA 4DTPA 2HHWA 2F8SA 2E4LA 2HHTA 4CGGA 4XIUA 4DSFA 1DTQA 1U48A 4N41A 1RTDA 2HW3A 1T03A 3WNHA 3ZSQA 1JL2A 4CJQA 4B9UA 1RDAA 4FJ5A 1W9HA 1WSFA 1RDCA 4E7KA 3D0PA 1VSLA 4AH9A 2G8IA 1C1CA 1WSIA 2BE2A 3AVBA 3AO2A 4FLZA 3KLEA 5DK5A 4C8KA 4FK4A 4C8MA 2B4JA 4ZHRA 4B9NA 3DLKA 3OYFA 3MEDA 1S1WA 1BCOA 4M3TA 2HVIA 3QESA 1C1AA 2YKNA 1UOCA 3DLBA 2QKKA 4K8ZA 4AHRA 4RW7A 3ZT1A 3SUQA 3CG7A 4B9VA 4G1QA 4JRPA 3TAGA 2XY8A 3KKSA 3ZT3A 2G8HA 4BDPA 2ZD1A 4DF8A 4JLHA 4C8OA 5J2QA 1RBVA 3K5LA 2E6MA 1FKOA 4FK2A 1KRPA 1SV5A 1TKTA 4WE1A 3OYDA 3QNOA 3OY9A 4FJLA 1U45A 4O5BA 5HRRA 1S9EA 1BCMA 4HUFA 3TWHA 4CJTA 5HRPA 2G8FA 2Z1HA 3NFAA 3KD5E 4CJ4A 5SZTA 4ELUA 4CEDA 4CJEA 3LWMA 4B8CA 2GUIA 4KHUA 1Z26A 1C0UA 4MQ3A 3O3FA 5HLFA 1SL0A 2KZZA 4OGCA 4I2PA 4DU4A 4KREA 1S1VA 4KHQA 4IG0A 4DQRA 4FZZA 4ELVA 3ULDA 3DM2A 2XY7A 1IKYA 4PWDA 4CJ5A 2P5GA 3U3YA 3SYZA 5J2MA 1VRUA 3SQ0A 3SNNA 4EP4A 4CHNA 3KTQA 3AVJA 4CHOA 2VWJA 3E01A 1RT3A 3HL8A 4HUEA 4F2SA 4CJKA 3JSMA 4DWIA 1J54A 3DLHA 4PA1A 1S9GA 5KGWA 4YFUA 4FJIA 2ZQBA 1SL2A 1ASWA 1NK5A 4F3TA 1JXEA 2G8WA 3IAYA 5HBMA 1G15A 2X6NA 3HPGA 1RBRA 4CIFA 3V6DA 4ICLA 1LW0A 1HNIA 3S3MA 1FXXA 4IDKA 2HNDA 1HQUA 1YTAA 3EY1A 1TGOA 3MXIA 4B08A 5FRNA 1ZBIA 4QOZB 1JKHA 2YNIA 1L3VA 3VQPA 1BISA 2Z1JA 1IKWA 2Z1GA 2OZMA 4JRQA 3SV3A 4DU1A 4M3ZA 1D9FA 1DLOA 1ASVA 3ZCMA 5CZ1A 1NKEA 3OYMA 3JYTA 4KHYA 4HUGA 4F2RA 5C42A 4JS5A 2IAJA 1Z25A 1TKDA 2HHXA 1KVCA 2QK9A 4CFBA 2A1SA 3AA2A 1X9MA 2G8UA 4ID5A 3AA5X 4FLXA 4DTJA 1RNHA 3ASMA 3T19A 3OYBA 2KFZA 4DQPA 2YNFA 3LAKA 4B3OA 4BE2A 3QEWA 4OLAA 3CM5A 2OYQA 3I0SA 1KVBA 1QHTA 1LAWA 1HMVA 3OYHA 4IG3A 3V1QA 3SUNA 4DFPA 3TR8A 3CYMA 3VQ9A 3QEXA 2KW4A 3M8RA 4FCYA 3LALA 1S1UA 4FLTA 1JLQA 3FFIA 3L2QA 4KHWA 1ASUA 3VQ7A 1SKRA 2OZSA 2ZE2A 1BIUA 1I3AA 1RT1A 3NAEA 4ZTFA 3K59A 1RTIA 3RMDA 3RTVA 1UA1A 4FJMA 1BL3A 1XC9A 3TAMA 3DRSA 4DSJA 1HYSA 2QKBA 3AVLA 3NBPA 4Z0UA 3DLEA 3VQQA 4DSKA 1T05A 4CF0A 4KTQA 1ITGA 4FM2A 3IRXA 3ZSWA 1ZBLA 2W42A 1VSJA 4CGDA 4GMJB 1WNSA 4MFBA 3AVIA 3RMBA 4ID1A 5CZ2A 1XHZA 4RG8A 3OYIA 3BGRA 4Z4IA 4M3XA 2KZMA 2F96A 1B92A 2EX3A 3HT3A 3V9XA 4KB0A 4FYDA 2JGUA 4DTOA 2BGGA 4LH5A 4DTNA 3LANA 4CEZA 3AVNA 1TKXA 3NHGA 2VWKA 4KTZA 5KTQA 3SUPA 3SPZA 3DOKA 3OYJA 4DLEA 2RKIA 3LAMA 1A5XA 2P1JA 5CY4A 3AVFA 3HPHA 3VA3A 3NH2A 3DMJA 4OJRA 3DLGA 3OS0A 1D5AA 3NE6A 4DFMA 3LP1A 1NJZA 4DSLA 3QERA 4B9MA 4CJRA 4DS5A 1FKPA 4DTXA 1WAJA 3U3GA 1L3UA 3PY8A 1J53A 3VQ4A 2PY5A 4I9QA 1Q8IA 2YV0X 3K5NA 4DTMA 1T7PA 1BQNA 3RWUA 4OKEA 3ZSRA 1JLFA 4FJ8A 3VQ8A 1HYVA 1REVA 4IFYA 4CEQA 3KLFA 3V1OA 4CIGA 3HM9A 3TAQA 3U6FA 3TAEA 2P5OA 3L3UA 1KVAA 3KKRA 3L2VA 2OPPA 4CGIA 4Z4FA 4CJLA 1A5VA 1RCHA 4LY7A 4KAZA 2KTQA 1DTTA 1WSGA 3NF8A 2HNZA 1RT2A 3SI6A 1TAUA 3V9SA 1A5WA 1KFDA 2X74A 2WOMA 4CJSA 3EZ5A 2IDOA 4DFJA 3G0ZA 4DF4A 3AVGA 1VSEA 4OPKA 1RT6A 1U47A 4KPYA 3AVKA 4R5PA 2GBZA 3AA4A 3O4QA 4Q5VA 1R0AA 1JXBA 3OYNA 3TAFA 1NKCA 3OVNA 4C8LA 1GOBA 1NJYA 3ALYA 2BANA 1CLQA 3L8BA 1HJRA 3QINA 3QO9A 4CGHA 4W5OA 3SV4A 5I3UA 1N6QA 1BGXT 3L2RA 1ZYQA 2G8VA 4FLYA 1TKZA 2Q3SA 3V9WA 5JS2A 4B9LA 3ZSOA 4NCGA 1YT3A 4M3RA 1KFSA 3AV9A 1WSEA 1FK9A 4FXDA 3ZT4A 1J9AA 1NKBA 3RRGA 5KI6A 3P5JA 2RN2A 3K5MA 1LWFA 4AHSA 3HXMA 2DFHA 4CEFA 1UAXA 4O4GA 1JLGA 4N47A 3VQCA 4O0JA 4CJUA 2FBVA 1NOYA 4CCHA 2ATQA 4CF1A 2R7YA 1RTJA 2HB5A 4LSNA 3VA0A 4H8KA 1TVRA 4FJJA 3VN5A 1Q9XA 1U4BA 3S9HA 3TANA 1BQMA 1LWEA 4TSXA 3T3FA 3I8DA 1TK8A 1D9DA 3KLGA 2XO7A 3EYZA 3L2WA 1RDBA 1TL1A 3ITHA 4CHQA 1BI4B 4DU3A 3PX6A 1VSFA 1WAFA 1IG9A 4CJFA 3V9UA 2FBTA 3C6TA 3O4NA 1RT7A 1YVUA 1RT5A 2JLEA 4DTSA 3KK1A 3AO3A 3QEVA 4J2EA 5JS1A 1BI4A 5SWMA 3C6UA 3SUOA 1LWCA 1S1XA 1EKEA 1GOCA 4BDYA 3NF6A 2BDPA 4BWMA 3V9ZA 3VQEA 3F73A 4OKJA 4QAGA 5E41A 4LD0A 2YHBA 4I7FA 3HPOA 4BDZA 4DSEA 3SPYA 2HHUA 2Z1IA 3VQAA 1IKXA 4GW6A 1NK7A 1LV5A 4L8RB 1B9FA 2ITGA 2E6LA 5HP1A 1IKVA 4CEEA 3LP0A 3CFRA 2Y1JA 4FK0A 4Z4EA 1I39A 4M3WA 4CHPA 4IKFA 5EU7A 1S6PA 4RW9A 4FVMA 3TABA 4J2AA 4GVMA 1VSHA 3PUFA 5FRMA 3MEGA 1ZBFA 3K2PA 4H4OA 2OPSA 4O44A 2HHVA 4M3YA 3OYAA 3LZJA 3PX4A 4KO0A 5C25A 3V4IA 4FJXA 4FZYA 1XHXA 3WNFA 1QE1A 4CECA 2D0BA 4FW2A 4DTRA 2KFNA 2A1RA 4EZ9A 3NDKA 3IG1A 3SZ2A 5HROA 4FJ7A 2DTUA 3ZT2A 2XY6A 2Y1IA 4CFDA 1CXQA 1SKWA 4JS4A 3MEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FRO A;  1IH7 A;  4DS4 A;  1RIL A;  3I0R A;  1QSY A;  2I5J A;  3K58 A;  4LH4 A;  4M42 A;  1Y97 A;  1CZ9 A;  4FJ9 A;  2AJQ A;  3LDS A;  4BE1 A;  4DQQ A;  4KB1 A;  2RPI A;  5HRN A;  1L3S A;  1TK0 A;  2PZS A;  2HMI A;  3LP3 A;  4FLU A;  4OGE A;  3ZSY A;  4HTU A;  2KQ2 A;  4Z4C A;  1QS4 A;  5KGX A;  5T7B A;  2OA8 A;  4CHY A;  2PYL A;  4KRF A;  3AVC A;  2B5J A;  1L3T A;  4KI4 A;  2GV9 A;  1KLN A;  1VSK A;  3MXJ A;  1JL1 A;  1HPZ A;  2VG5 A;  3NF9 A;  1NK8 A;  3BDP A;  4FJK A;  4E3S A;  1RBU A;  4DTU A;  2D0C A;  4AHT A;  3NCI A;  3PV8 A;  2YNG A;  1K6Y A;  2X78 A;  4CF2 A;  1QTM A;  1SL1 A;  2G8K A;  3OYK A;  4E1N A;  1BIZ A;  1C0M A;  4DLG A;  2IS3 A;  1XWL A;  2DFE A;  3DRP A;  4CEO A;  4F4K A;  3C95 A;  4AHU A;  1NJW A;  3H08 A;  2OPR A;  1QSS A;  3AVA A;  5C24 A;  3KD1 E;  4F8R A;  4E19 A;  4H4M A;  2D0A A;  3HYF A;  3WNE A;  2ETJ A;  2HVH A;  4QCL A;  1CXU A;  3OYL A;  1RT4 A;  4CHZ A;  4KHN A;  3LPU A;  3DI6 A;  5K14 A;  4F3O A;  4IFV A;  4NYN A;  5KRT A;  1JLA A;  3QIP A;  4CFC A;  5J1E A;  3SQ1 A;  4E7H A;  3KLI A;  5J2N A;  3ZSZ A;  3HVR A;  4Y1C A;  4Z4H A;  3NGZ A;  4KHS A;  1IO2 A;  2NUB A;  3HP6 A;  3S3N A;  1SKS A;  4CK2 A;  2YKM A;  4UQG A;  1F21 A;  1TL3 A;  3LP2 A;  3QLH A;  3LZI A;  3KJV A;  4HHT A;  1QSL A;  1RBT A;  1WSH A;  4OPJ A;  3D45 A;  3NH0 A;  3KK2 A;  1EX4 A;  3CQ8 A;  4FJH A;  1O1W A;  1HRH A;  2X6S A;  2P51 A;  4KV8 A;  3VQD A;  1UWB A;  2VG7 A;  4CJW A;  3KLH A;  3B6P A;  1RDD A;  4I2Q A;  3RRH A;  3B6O A;  4CEA A;  3KK3 A;  2RF2 A;  4DFK A;  3QNN A;  4EZ6 A;  5D3G A;  4M3U A;  4E89 A;  4C8N A;  1ZBU A;  3PO5 A;  4CJ3 A;  4B8A B;  3CM6 A;  1NK4 A;  1X9S A;  1J5O A;  4E7I A;  1KSP A;  1L5U A;  1NK0 A;  1U04 A;  3HST B;  4N76 A;  4M45 A;  1WSJ A;  1HNV A;  4NCA A;  3OJU A;  3A2F A;  4E1M A;  4Q0B A;  1C6V A;  4FM0 A;  2VG6 A;  3C94 A;  1NK6 A;  5KRS A;  1N5Y A;  1BHL A;  4N5S A;  4FJN A;  4CK1 A;  3MXM A;  4NCB A;  4CE9 A;  2O4I A;  4J2D A;  1S5J A;  3SJJ A;  3OS1 A;  4CGF A;  2DY4 A;  1ZBH A;  1EET A;  2F8T A;  1WN7 A;  3DLR A;  3T1A A;  4KTW A;  4CES A;  3NF7 A;  2IOC A;  3K5O A;  4RW8 A;  1NOZ A;  4FM1 A;  3QEI A;  1QQC A;  4W5N A;  2OPQ A;  4HVJ A;  3S3O A;  3ZSX A;  3TI0 A;  1WLJ A;  4K8X A;  1VSM A;  4IBN A;  1EP4 A;  3AA3 A;  3AO1 A;  2PYJ A;  3K57 A;  2IGI A;  1VK0 A;  1LW2 A;  1JLB A;  3M8S A;  4AIL C;  4ELT A;  1NJX A;  1JLE A;  1C0T A;  1W0H A;  1KLM A;  4FLV A;  1NK9 A;  1B9D A;  3P1G A;  1UA0 A;  1MU2 A;  2FBY A;  4AHV A;  4FZX C;  1S6Q A;  5CYQ A;  2FC0 A;  5CYM A;  1LAV A;  3RMA A;  3F9K A;  4KKO A;  1TK5 A;  3CFO A;  3QEP A;  4YNQ A;  2XY5 A;  3MAQ A;  4LSL A;  4J2B A;  3TAP A;  4W5Q A;  2EHG A;  3OS2 A;  4I9L A;  4CEB A;  3CFP A;  4CF9 A;  5I42 A;  4M41 A;  4FJG A;  1EXQ A;  4N56 A;  1RBS A;  4Y1D A;  4EP5 A;  1CZB A;  1VSD A;  3HP9 A;  1RTH A;  3NH1 A;  3HO1 A;  4B9S A;  1T8E A;  4HCB A;  3RMC A;  3NGI A;  3DRR A;  3OYC A;  3M8P A;  4BE0 A;  3DYA A;  3RR8 A;  4RW4 A;  4DQI A;  2XRI A;  1GOA A;  3AO4 A;  3LPT A;  4CER A;  4ZTJ A;  3G10 A;  3THV A;  3ZSV A;  3L3V A;  3AVH A;  4RW6 A;  4HCC A;  4OVL A;  4PUO A;  4E7L A;  2HNY A;  3TAR A;  2HHS A;  1KCF A;  3NGY A;  2IC3 A;  1VSI A;  1VRT A;  1TAQ A;  2QXF A;  3M8Q A;  2FBX A;  4O55 A;  5DMR A;  3V1R A;  3L2U A;  3QET A;  3HK2 A;  4Z4G A;  3SCX A;  4B9T A;  1YTU A;  3IS9 A;  3AVM A;  3VQ6 A;  1C1B A;  4BAC A;  3OYG A;  4PY5 A;  3WNG A;  1SUQ A;  4CJV A;  3DOL A;  5HRS A;  3O3H A;  1X9W A;  1TV6 A;  3ISN C;  2XHB A;  3OYE A;  3PX0 A;  3VQB A;  3LWL A;  3PO4 A;  1Q9Y A;  2HHQ A;  1S1T A;  3QIO A;  3UIQ A;  1HQE A;  1HYZ A;  4CFA A;  4FW1 A;  2DFF A;  3MEC A;  4FLW A;  4KI6 A;  2YHA A;  3AO5 A;  3P83 D;  3HVT A;  2O4G A;  1U49 A;  4W5T A;  1X1P A;  3V81 A;  2WON A;  3OJS A;  5J2P A;  2LSN A;  1JLC A;  4KFB A;  4CIE A;  4CK3 A;  4AHC A;  2D5R A;  4DG1 A;  4CGJ A;  4E7J A;  4E0D A;  1XI1 A;  5FDL A;  3ZT0 A;  4W5R A;  4NYF A;  3SQ4 A;  2YNH A;  4DSI A;  3O3G A;  4OKK A;  3KIO A;  4BWJ A;  2B6A A;  4OLB A;  4PQU A;  3RR7 A;  4O0I A;  1D8Y A;  3VQ5 A;  3SQ2 A;  4CF8 A;  1KTQ A;  4DMN A;  4DQS A;  4CJP A;  3HJF A;  4DTP A;  2HHW A;  2F8S A;  2E4L A;  2HHT A;  4CGG A;  4XIU A;  4DSF A;  1DTQ A;  1U48 A;  4N41 A;  1RTD A;  2HW3 A;  1T03 A;  3WNH A;  3ZSQ A;  1JL2 A;  4CJQ A;  4B9U A;  1RDA A;  4FJ5 A;  1W9H A;  1WSF A;  1RDC A;  4E7K A;  3D0P A;  1VSL A;  4AH9 A;  2G8I A;  1C1C A;  1WSI A;  2BE2 A;  3AVB A;  3AO2 A;  4FLZ A;  3KLE A;  5DK5 A;  4C8K A;  4FK4 A;  4C8M A;  2B4J A;  4ZHR A;  4B9N A;  3DLK A;  3OYF A;  3MED A;  1S1W A;  1BCO A;  4M3T A;  2HVI A;  3QES A;  1C1A A;  2YKN A;  1UOC A;  3DLB A;  2QKK A;  4K8Z A;  4AHR A;  4RW7 A;  3ZT1 A;  3SUQ A;  3CG7 A;  4B9V A;  4G1Q A;  4JRP A;  3TAG A;  2XY8 A;  3KKS A;  3ZT3 A;  2G8H A;  4BDP A;  2ZD1 A;  4DF8 A;  4JLH A;  4C8O A;  5J2Q A;  1RBV A;  3K5L A;  2E6M A;  1FKO A;  4FK2 A;  1KRP A;  1SV5 A;  1TKT A;  4WE1 A;  3OYD A;  3QNO A;  3OY9 A;  4FJL A;  1U45 A;  4O5B A;  5HRR A;  1S9E A;  1BCM A;  4HUF A;  3TWH A;  4CJT A;  5HRP A;  2G8F A;  2Z1H A;  3NFA A;  3KD5 E;  4CJ4 A;  5SZT A;  4ELU A;  4CED A;  4CJE A;  3LWM A;  4B8C A;  2GUI A;  4KHU A;  1Z26 A;  1C0U A;  4MQ3 A;  3O3F A;  5HLF A;  1SL0 A;  2KZZ A;  4OGC A;  4I2P A;  4DU4 A;  4KRE A;  1S1V A;  4KHQ A;  4IG0 A;  4DQR A;  4FZZ A;  4ELV A;  3ULD A;  3DM2 A;  2XY7 A;  1IKY A;  4PWD A;  4CJ5 A;  2P5G A;  3U3Y A;  3SYZ A;  5J2M A;  1VRU A;  3SQ0 A;  3SNN A;  4EP4 A;  4CHN A;  3KTQ A;  3AVJ A;  4CHO A;  2VWJ A;  3E01 A;  1RT3 A;  3HL8 A;  4HUE A;  4F2S A;  4CJK A;  3JSM A;  4DWI A;  1J54 A;  3DLH A;  4PA1 A;  1S9G A;  5KGW A;  4YFU A;  4FJI A;  2ZQB A;  1SL2 A;  1ASW A;  1NK5 A;  4F3T A;  1JXE A;  2G8W A;  3IAY A;  5HBM A;  1G15 A;  2X6N A;  3HPG A;  1RBR A;  4CIF A;  3V6D A;  4ICL A;  1LW0 A;  1HNI A;  3S3M A;  1FXX A;  4IDK A;  2HND A;  1HQU A;  1YTA A;  3EY1 A;  1TGO A;  3MXI A;  4B08 A;  5FRN A;  1ZBI A;  4QOZ B;  1JKH A;  2YNI A;  1L3V A;  3VQP A;  1BIS A;  2Z1J A;  1IKW A;  2Z1G A;  2OZM A;  4JRQ A;  3SV3 A;  4DU1 A;  4M3Z A;  1D9F A;  1DLO A;  1ASV A;  3ZCM A;  5CZ1 A;  1NKE A;  3OYM A;  3JYT A;  4KHY A;  4HUG A;  4F2R A;  5C42 A;  4JS5 A;  2IAJ A;  1Z25 A;  1TKD A;  2HHX A;  1KVC A;  2QK9 A;  4CFB A;  2A1S A;  3AA2 A;  1X9M A;  2G8U A;  4ID5 A;  3AA5 X;  4FLX A;  4DTJ A;  1RNH A;  3ASM A;  3T19 A;  3OYB A;  2KFZ A;  4DQP A;  2YNF A;  3LAK A;  4B3O A;  4BE2 A;  3QEW A;  4OLA A;  3CM5 A;  2OYQ A;  3I0S A;  1KVB A;  1QHT A;  1LAW A;  1HMV A;  3OYH A;  4IG3 A;  3V1Q A;  3SUN A;  4DFP A;  3TR8 A;  3CYM A;  3VQ9 A;  3QEX A;  2KW4 A;  3M8R A;  4FCY A;  3LAL A;  1S1U A;  4FLT A;  1JLQ A;  3FFI A;  3L2Q A;  4KHW A;  1ASU A;  3VQ7 A;  1SKR A;  2OZS A;  2ZE2 A;  1BIU A;  1I3A A;  1RT1 A;  3NAE A;  4ZTF A;  3K59 A;  1RTI A;  3RMD A;  3RTV A;  1UA1 A;  4FJM A;  1BL3 A;  1XC9 A;  3TAM A;  3DRS A;  4DSJ A;  1HYS A;  2QKB A;  3AVL A;  3NBP A;  4Z0U A;  3DLE A;  3VQQ A;  4DSK A;  1T05 A;  4CF0 A;  4KTQ A;  1ITG A;  4FM2 A;  3IRX A;  3ZSW A;  1ZBL A;  2W42 A;  1VSJ A;  4CGD A;  4GMJ B;  1WNS A;  4MFB A;  3AVI A;  3RMB A;  4ID1 A;  5CZ2 A;  1XHZ A;  4RG8 A;  3OYI A;  3BGR A;  4Z4I A;  4M3X A;  2KZM A;  2F96 A;  1B92 A;  2EX3 A;  3HT3 A;  3V9X A;  4KB0 A;  4FYD A;  2JGU A;  4DTO A;  2BGG A;  4LH5 A;  4DTN A;  3LAN A;  4CEZ A;  3AVN A;  1TKX A;  3NHG A;  2VWK A;  4KTZ A;  5KTQ A;  3SUP A;  3SPZ A;  3DOK A;  3OYJ A;  4DLE A;  2RKI A;  3LAM A;  1A5X A;  2P1J A;  5CY4 A;  3AVF A;  3HPH A;  3VA3 A;  3NH2 A;  3DMJ A;  4OJR A;  3DLG A;  3OS0 A;  1D5A A;  3NE6 A;  4DFM A;  3LP1 A;  1NJZ A;  4DSL A;  3QER A;  4B9M A;  4CJR A;  4DS5 A;  1FKP A;  4DTX A;  1WAJ A;  3U3G A;  1L3U A;  3PY8 A;  1J53 A;  3VQ4 A;  2PY5 A;  4I9Q A;  1Q8I A;  2YV0 X;  3K5N A;  4DTM A;  1T7P A;  1BQN A;  3RWU A;  4OKE A;  3ZSR A;  1JLF A;  4FJ8 A;  3VQ8 A;  1HYV A;  1REV A;  4IFY A;  4CEQ A;  3KLF A;  3V1O A;  4CIG A;  3HM9 A;  3TAQ A;  3U6F A;  3TAE A;  2P5O A;  3L3U A;  1KVA A;  3KKR A;  3L2V A;  2OPP A;  4CGI A;  4Z4F A;  4CJL A;  1A5V A;  1RCH A;  4LY7 A;  4KAZ A;  2KTQ A;  1DTT A;  1WSG A;  3NF8 A;  2HNZ A;  1RT2 A;  3SI6 A;  1TAU A;  3V9S A;  1A5W A;  1KFD A;  2X74 A;  2WOM A;  4CJS A;  3EZ5 A;  2IDO A;  4DFJ A;  3G0Z A;  4DF4 A;  3AVG A;  1VSE A;  4OPK A;  1RT6 A;  1U47 A;  4KPY A;  3AVK A;  4R5P A;  2GBZ A;  3AA4 A;  3O4Q A;  4Q5V A;  1R0A A;  1JXB A;  3OYN A;  3TAF A;  1NKC A;  3OVN A;  4C8L A;  1GOB A;  1NJY A;  3ALY A;  2BAN A;  1CLQ A;  3L8B A;  1HJR A;  3QIN A;  3QO9 A;  4CGH A;  4W5O A;  3SV4 A;  5I3U A;  1N6Q A;  1BGX T;  3L2R A;  1ZYQ A;  2G8V A;  4FLY A;  1TKZ A;  2Q3S A;  3V9W A;  5JS2 A;  4B9L A;  3ZSO A;  4NCG A;  1YT3 A;  4M3R A;  1KFS A;  3AV9 A;  1WSE A;  1FK9 A;  4FXD A;  3ZT4 A;  1J9A A;  1NKB A;  3RRG A;  5KI6 A;  3P5J A;  2RN2 A;  3K5M A;  1LWF A;  4AHS A;  3HXM A;  2DFH A;  4CEF A;  1UAX A;  4O4G A;  1JLG A;  4N47 A;  3VQC A;  4O0J A;  4CJU A;  2FBV A;  1NOY A;  4CCH A;  2ATQ A;  4CF1 A;  2R7Y A;  1RTJ A;  2HB5 A;  4LSN A;  3VA0 A;  4H8K A;  1TVR A;  4FJJ A;  3VN5 A;  1Q9X A;  1U4B A;  3S9H A;  3TAN A;  1BQM A;  1LWE A;  4TSX A;  3T3F A;  3I8D A;  1TK8 A;  1D9D A;  3KLG A;  2XO7 A;  3EYZ A;  3L2W A;  1RDB A;  1TL1 A;  3ITH A;  4CHQ A;  1BI4 B;  4DU3 A;  3PX6 A;  1VSF A;  1WAF A;  1IG9 A;  4CJF A;  3V9U A;  2FBT A;  3C6T A;  3O4N A;  1RT7 A;  1YVU A;  1RT5 A;  2JLE A;  4DTS A;  3KK1 A;  3AO3 A;  3QEV A;  4J2E A;  5JS1 A;  1BI4 A;  5SWM A;  3C6U A;  3SUO A;  1LWC A;  1S1X A;  1EKE A;  1GOC A;  4BDY A;  3NF6 A;  2BDP A;  4BWM A;  3V9Z A;  3VQE A;  3F73 A;  4OKJ A;  4QAG A;  5E41 A;  4LD0 A;  2YHB A;  4I7F A;  3HPO A;  4BDZ A;  4DSE A;  3SPY A;  2HHU A;  2Z1I A;  3VQA A;  1IKX A;  4GW6 A;  1NK7 A;  1LV5 A;  4L8R B;  1B9F A;  2ITG A;  2E6L A;  5HP1 A;  1IKV A;  4CEE A;  3LP0 A;  3CFR A;  2Y1J A;  4FK0 A;  4Z4E A;  1I39 A;  4M3W A;  4CHP A;  4IKF A;  5EU7 A;  1S6P A;  4RW9 A;  4FVM A;  3TAB A;  4J2A A;  4GVM A;  1VSH A;  3PUF A;  5FRM A;  3MEG A;  1ZBF A;  3K2P A;  4H4O A;  2OPS A;  4O44 A;  2HHV A;  4M3Y A;  3OYA A;  3LZJ A;  3PX4 A;  4KO0 A;  5C25 A;  3V4I A;  4FJX A;  4FZY A;  1XHX A;  3WNF A;  1QE1 A;  4CEC A;  2D0B A;  4FW2 A;  4DTR A;  2KFN A;  2A1R A;  4EZ9 A;  3NDK A;  3IG1 A;  3SZ2 A;  5HRO A;  4FJ7 A;  2DTU A;  3ZT2 A;  2XY6 A;  2Y1I A;  4CFD A;  1CXQ A;  1SKW A;  4JS4 A;  3MEE A; 
#chains in the Genus database with same CATH topology
 5HL7 L;  1IH7 A;  5JLH A;  4DS4 A;  4A62 A;  2JWK A;  1QSY A;  3MDQ A;  2I5J A;  4LH4 A;  4KH4 A;  3LDS A;  4BE1 A;  4CD3 A;  1L3S A;  4CI6 A;  3P38 A;  5CHI A;  2PZS A;  3VTH A;  1DT9 A;  1NBW A;  4BR4 A;  4JV5 K;  4H5W A;  2B5J A;  1L3T A;  2GV9 A;  1VSK A;  4BC5 A;  1VQK N;  2OTJ N;  1NK8 A;  2QWR A;  4E3S A;  1RBU A;  4DTU A;  3H3N O;  5IT9 O;  2P9L B;  4H5R A;  4BRE A;  4E1N A;  1BIZ A;  1C0G A;  4CEO A;  1XWL A;  4BGA A;  3CCL N;  4AHU A;  1NJW A;  1QSS A;  5TKY A;  1IV0 A;  5C24 A;  3WNE A;  5I9E B;  3OYL A;  4JKE A;  5AZI B;  1YIJ N;  4IFV A;  2ASP A;  4NYN A;  1JLA A;  4CFC A;  4EHT A;  4BY9 C;  4IO9 L;  4H0V B;  3KLI A;  3O9R A;  5J2N A;  3HVR A;  2O8E A;  2WBN A;  3LZI A;  1HKB A;  1QSL A;  4G9Z A;  1WSH A;  3CET A;  1EX4 A;  4JHD B;  1HRH A;  3A5O C;  2P51 A;  3KLH A;  4CJW A;  3CCM N;  5D3G A;  1SZ2 A;  2QW9 A;  4CJ3 A;  4B8A B;  4E7I A;  4FWN A;  1U04 A;  3HST B;  1WSJ A;  4BRH A;  1C6V A;  4FM0 A;  1ATN A;  5KRS A;  5KPZ A;  2CGJ A;  4FJN A;  3MXM A;  4B1U B;  4KTW A;  3CC4 N;  1Q81 O;  3CJ9 A;  3NF7 A;  2IVN A;  4B9Q A;  4FM1 A;  4W5N A;  1QQC A;  2OPQ A;  1YJN N;  4CZE A;  3E9P A;  2UUB K;  1NG9 A;  3TI0 A;  1NNE A;  1EP4 A;  3L4Q A;  3AO1 A;  2PYJ A;  3SAH A;  1LW2 A;  3KZB A;  2Q2R A;  3ZX0 A;  5AQT A;  1KLM A;  4IOC L;  2O8B B;  1XNR K;  3SJH A;  1UA0 A;  3THY B;  4GV3 A;  4BRI A;  4A2A A;  4NLB A;  3CER A;  4LSL A;  5C15 A;  4W5Q A;  3OS2 A;  5I42 A;  4FJG A;  5AQY A;  1ZBS A;  1RBS A;  3GL1 A;  1VSD A;  1X9J A;  3HP9 A;  4AM6 A;  4EP5 A;  1T8E A;  1IG8 A;  3GDQ A;  3RMC A;  3DRR A;  3FFK B;  3OYC A;  3M8P A;  3TSP A;  4BE0 A;  3G4S N;  4RW4 A;  4DQI A;  4RW6 A;  1TYQ A;  2HHS A;  3V1R A;  4FVU A;  5M1F A;  3HK2 A;  3L2U A;  1J5E K;  4Z4G A;  4B9T A;  4KH6 A;  3EO3 A;  1N32 K;  4BAC A;  1C1B A;  2QXL A;  4JEP A;  5BRF A;  5AQP A;  3DOL A;  3DXM A;  3O3H A;  1X9W A;  1Q9Y A;  2HHQ A;  5BRH A;  3QIO A;  1K8A O;  3UIQ A;  4CFA A;  4B3T K;  4L3Q A;  2A40 A;  3P31 A;  1U49 A;  2WC9 A;  3V81 A;  3QFU A;  5AFU A;  1JLC A;  3D2E A;  4CGJ A;  4NYF A;  2HF4 A;  2HST A;  3O08 A;  1IBM K;  4KH5 A;  3RR7 A;  4O0I A;  3C7N B;  4DQS A;  3HSC A;  1RDW X;  4CJP A;  3HJF A;  2NRW A;  3JAM O;  4N41 A;  2HW3 A;  1T03 A;  1QVG M;  3VTI A;  4PHT X;  4E7K A;  4AH9 A;  1V4S A;  2QWP A;  4C8K A;  4FK4 A;  4U7B A;  2B4J A;  4K41 A;  3OYF A;  4YOY A;  3MED A;  1K8K B;  1UOC A;  4YOR A;  3H46 O;  4IEI A;  5BPN A;  1BDG A;  1SAZ A;  5J2Q A;  1RBV A;  2ASM A;  2E6M A;  3SK3 A;  1Q82 O;  4WE1 A;  3OYD A;  3T69 A;  5AZI A;  4CBW A;  4O5B A;  3TWH A;  3D2F A;  1HUX A;  5SZT A;  1Z26 A;  1SL0 A;  2RE2 A;  4OX9 K;  1HJO A;  4I2P A;  4KRE A;  4KHQ A;  4DQR A;  4FZZ A;  2P5G A;  2E2P A;  4CJK A;  1J54 A;  5BR9 A;  3AGR A;  4BRL A;  4YFU A;  1HNX K;  4DV6 K;  3F2K A;  4F3T A;  4E1J A;  3V6D A;  3HPG A;  1RBR A;  3EY1 A;  1ZBI A;  1YTA A;  1TGO A;  3O9T A;  2CH5 A;  4QOZ B;  1E3M A;  2Z1J A;  2P9U B;  2Z1G A;  2V52 B;  4JRQ A;  3WT0 A;  4M3Z A;  1DLO A;  3ZCM A;  4WQ5 C;  4F2R A;  2UXB K;  4JS5 A;  1P8Z A;  1KVC A;  4CFB A;  3AA2 A;  2GUP A;  2KFZ A;  3T19 A;  4BRA A;  3FZK A;  4DQP A;  3FZH A;  2QWQ A;  3I0S A;  1KVB A;  1HMV A;  4IG3 A;  5AZJ B;  2KW4 A;  3M8R A;  3CME N;  5AR0 A;  1JLQ A;  3GE1 A;  1E4F T;  4HTL A;  1ASU A;  2BUP A;  2IVO A;  5AQG A;  2OZS A;  2ZE2 A;  5EX5 A;  4ZTF A;  3U4L A;  2ZGY A;  1UA1 A;  2E5L K;  4FJM A;  3LDP A;  1XC9 A;  2WFB A;  5AFU H;  2P9I A;  3TPQ A;  3VQQ A;  1ZBL A;  5FLX O;  2UU9 K;  2P9I B;  3M5R A;  1WNS A;  4MFB A;  3AVI A;  4FWR A;  5CZ2 A;  1XHZ A;  3RSE A;  2OCE A;  3BGR A;  4Z4I A;  4M3X A;  5AQV A;  5FPD A;  3OTO K;  2Q31 A;  5F0X A;  2HBK A;  4A59 A;  3D7E O;  4FYD A;  4DTO A;  3NHG A;  3OBY A;  1NGH A;  2RKI A;  1KAX A;  1J6Z A;  1TUY A;  3NH2 A;  3DLG A;  4DFM A;  4NXM K;  4IO8 A;  3K9K A;  4A5B A;  4DV5 K;  1NJZ A;  2HMP A;  4QS7 A;  2YHX A;  1FKP A;  4DTX A;  4JI8 K;  4LC9 B;  1J53 A;  3U9D A;  1YAG A;  4QS9 A;  3FLC O;  3HM8 A;  1NJI O;  3K5N A;  3RWU A;  1BQN A;  1JLF A;  3VQ8 A;  1HYV A;  1REV A;  4H0T B;  4IFY A;  4LFA K;  4CEQ A;  3KLF A;  3V1O A;  3TAE A;  2P5O A;  3KKR A;  4DR4 K;  4Z4F A;  1GLC G;  4C1N I;  3V9S A;  4CJS A;  2IDO A;  3Q7B A;  3J7Z O;  2O8F A;  2P9S B;  4Q5V A;  1JXB A;  1NKC A;  3ULE B;  1WBB A;  5F2R A;  3L8B A;  4CGH A;  3QO9 A;  3N4Q A;  1KD1 O;  1BA1 A;  1TKZ A;  5JS2 A;  4FL9 A;  3P39 A;  5LY3 A;  3C6A A;  1WSE A;  3H1Q A;  4Y0W A;  1LWF A;  3HXM A;  4BRD A;  2V7Y A;  1YJW N;  4O4G A;  1NOY A;  4CCH A;  1RTJ A;  2HB5 A;  4B1Z A;  5KQ8 A;  1Q9X A;  5JLF A;  3I8D A;  1YI2 N;  5EVZ A;  2XO7 A;  3WEE B;  3WUH A;  3L2W A;  3PX6 A;  1BI4 B;  5F1X A;  2OTL N;  1HR0 K;  2FBT A;  3C6T A;  5AJ3 K;  1RT5 A;  3KK1 A;  3AO3 A;  3QEV A;  1BI4 A;  3I56 N;  5SWM A;  3C6U A;  5GAG P;  1N8R O;  4YHH K;  4BWM A;  3V9Z A;  3F73 A;  4OKJ A;  1U6Z A;  4JKA A;  2NRT A;  2A42 A;  3VQA A;  4L8R B;  3JS6 A;  3LP0 A;  4M3W A;  4CBX A;  2ITM A;  4IKF A;  5EU7 A;  4GVM A;  1VSH A;  2GEL A;  4RWT A;  3K2P A;  5EOY A;  1G99 A;  4FWO A;  3WNF A;  2W41 A;  4A2B A;  4FO0 A;  3J8A A;  2JWL A;  3AY9 A;  4MDB A;  3ENO A;  2DTU A;  2P9L A;  2XY6 A;  3U8X A;  2Y1I A;  4FWP A;  2ZM6 K;  4FPA A;  3MEE A;  1RIL A;  2Q0R A;  3I0R A;  3EL2 A;  3A8Y A;  2P9N A;  1Y97 A;  2AJQ A;  2RPI A;  1D4X A;  3E9L A;  1TK0 A;  4BG9 A;  3LP3 A;  3WXM B;  4OGE A;  4HTU A;  2KQ2 A;  1HNZ K;  1V4T A;  4Z4C A;  1QS4 A;  5M1K A;  3QFP A;  2E88 A;  5T7B A;  2PYL A;  3AVC A;  2V51 B;  4CD1 A;  1KLN A;  3MXJ A;  1JL1 A;  1HPZ A;  1XMO K;  3NF9 A;  4X66 K;  4IOX A;  4FOI A;  3E66 A;  1K6Y A;  1N33 K;  1MWK A;  4DLG A;  1C0M A;  2IS3 A;  3QB0 A;  3H08 A;  4EFH A;  3B8A X;  4BRF A;  4F8R A;  3KD1 E;  4H4M A;  2D0A A;  4JK8 A;  4PL8 A;  4QCL A;  2WUS A;  2HHH K;  1RT4 A;  4CHZ A;  4KHN A;  3LPU A;  3TSU A;  5J1E A;  3ZSZ A;  3MN5 A;  4Z4H A;  5DM6 L;  4KHS A;  2NUB A;  4J2B A;  1F21 A;  3IFR A;  1RBT A;  4GV9 A;  4OPJ A;  5AQO A;  1O1W A;  4KV8 A;  3MWT A;  1UWB A;  3RRH A;  4I2Q A;  4B3O A;  3B6O A;  4CEA A;  1Z05 A;  2D0O A;  4DFK A;  3QNN A;  4LF7 K;  1KC8 O;  4M3U A;  4E89 A;  3AGK A;  1X9S A;  4IEE A;  1J5O A;  4JD2 B;  1L5U A;  3OJU A;  3THY A;  3BF1 A;  4Q0B A;  3F9M A;  4K43 A;  2VG6 A;  4WQ5 A;  4N5S A;  4DUZ K;  4LF5 K;  2ZWH A;  3EZW A;  4CK1 A;  2YCH A;  4NCB A;  1S5J A;  3VET A;  2ZJQ L;  2DY4 A;  5KPR A;  4LF6 K;  2F8T A;  1WN7 A;  2YX6 A;  4CES A;  4DV0 K;  3R6M A;  3BP8 A;  1NOZ A;  1GLF O;  5AQN A;  4HVJ A;  3S3O A;  3ZSX A;  4DR5 K;  5AQH A;  3TSQ A;  3AA3 A;  1VK0 A;  2FXU A;  4AIL C;  4ELT A;  1NJX A;  1JLE A;  4FLV A;  1NK9 A;  1B9D A;  1NWK A;  2FBY A;  4AHV A;  4B1Y B;  4FZX C;  3MN9 A;  3CD6 N;  5CYQ A;  1LAV A;  3F9K A;  3EKS A;  3QEP A;  4YNQ A;  3MAQ A;  1VQN N;  4BC3 A;  2PBD A;  3O6W A;  3H3O B;  4CF9 A;  2GWK A;  4DHY A;  3O9Q A;  5BN9 A;  2QWL A;  4M63 C;  5JVG L;  3NGI A;  4FJH A;  3WXL A;  2NRR A;  4NLC A;  4ZTJ A;  4GKK K;  3G10 A;  3THV A;  4HCC A;  4I6M B;  2GX9 A;  4E7L A;  2HNY A;  3CJ7 A;  3NGY A;  4OPH A;  5MLC Q;  4F3O A;  2QXF A;  2FBX A;  4BRQ A;  4FSV A;  3SCX A;  4BRO A;  3VQ6 A;  3OYG A;  4PY5 A;  4CJV A;  5IWA K;  4H0P A;  1MA9 B;  1TV6 A;  3OYE A;  3PX0 A;  3VQB A;  4CJ7 A;  3LWL A;  1LOT B;  4BR5 A;  1X3M A;  2E1Y A;  4V19 S;  2YHA A;  4PKG A;  4B3M K;  3HVT A;  4DV2 K;  1S72 N;  2EWS A;  1X1P A;  1U2V A;  3IMX A;  2WON A;  5J2P A;  2A5X A;  4CK3 A;  1IJJ A;  2F9W A;  5FDL A;  3O3G A;  3D2E B;  4OKK A;  3R9P A;  3VEY A;  4A57 A;  2B6A A;  4OLB A;  1D8Y A;  3VQ5 A;  4CF8 A;  1QVF M;  3BF3 A;  2F8S A;  2E4L A;  1U48 A;  3ZSQ A;  3I33 A;  1JL2 A;  4B9U A;  3T7Z A;  4JI5 K;  4FJ5 A;  1WSF A;  3D0P A;  2G8I A;  4JHD A;  2BE2 A;  3GBT A;  3AO2 A;  3UKU A;  3KLE A;  4ZHR A;  4BR2 A;  4LF4 K;  1BCO A;  4FOE A;  2YKN A;  2QKK A;  4K8Z A;  4AHR A;  3ZT1 A;  4EIA A;  3CG7 A;  4B9V A;  4G1Q A;  3TAG A;  3MX2 A;  1GLE G;  2G8H A;  1YJ9 N;  2FLO A;  4BDP A;  4JLH A;  3G71 N;  3K5L A;  5TKW A;  2NZT A;  1SV5 A;  3FZM A;  2VGM A;  4JYA K;  4FJL A;  1U45 A;  5BRD A;  2YI1 A;  5HRP A;  4CED A;  4CJE A;  3LWM A;  2GUI A;  3SBT A;  4KHU A;  4CZM A;  5HLF A;  2KZZ A;  4OGC A;  4CZJ A;  5LMN K;  4ELV A;  3DM2 A;  4PWD A;  3SYZ A;  4M7Y A;  2YHY A;  1VRU A;  4JAX A;  4WFN L;  3KTQ A;  3E01 A;  1RT3 A;  3JSM A;  1S9G A;  5KGW A;  3VEX A;  5CE3 A;  3IAY A;  3LDL A;  5HBM A;  1G15 A;  2FF6 A;  2X6N A;  4CIF A;  2KFN A;  4ICL A;  1FXX A;  4IDK A;  1VQ4 N;  5AQQ A;  1NGE A;  3MXI A;  1JKH A;  1RDU A;  1IKW A;  3CHW A;  3SV3 A;  4IJA A;  5CZ1 A;  1NKE A;  3JYT A;  5C42 A;  3GOI A;  3LM2 A;  1TKD A;  1VAZ A;  2QK9 A;  3IUC A;  5CR4 A;  3EN9 A;  1TYQ B;  4ID5 A;  1RNH A;  2W6L A;  4ISE A;  3HOS A;  3ASM A;  3LAK A;  2VGN A;  2OYQ A;  2O8C A;  3FE1 A;  1QHT A;  3OYH A;  2NRX A;  2E2Q A;  1NGI A;  3CYM A;  5A2Q O;  3QEX A;  4YOX A;  2O8C B;  4FCY A;  4FLT A;  3FFI A;  1Q7Y O;  4WQ4 C;  3VQ7 A;  3PLA A;  5LJV A;  3K59 A;  1RTI A;  5ADX H;  2P9K A;  1GLD G;  3W3D A;  2NRH A;  3TAM A;  3DRS A;  3CF5 L;  3QBW A;  4JNE A;  1T05 A;  4CF0 A;  4KTQ A;  1ITG A;  4DQ8 A;  1ATR A;  4CZF A;  4IXC A;  3OYI A;  2EX3 A;  3HT3 A;  1YIT N;  3ZX3 A;  4DTN A;  1OH6 A;  3DOK A;  3OYJ A;  5ADX A;  5CY4 A;  3LAM A;  1A5X A;  2G8W A;  3HPH A;  1NU0 A;  5LL6 Z;  3NE6 A;  1NMD A;  3LP1 A;  4DV7 K;  2BH1 A;  4B9M A;  2IIR A;  2P9P A;  4CJR A;  4DR1 K;  1WAJ A;  3VGM A;  1BU6 O;  3VQ4 A;  2PY5 A;  4I9Q A;  1Q8I A;  2YV0 X;  1T7P A;  1NM1 A;  2GEM A;  4PKH A;  4JI7 K;  2ZJP L;  1NLV A;  3C7N A;  3L2V A;  2OPP A;  3VF4 A;  4LFC K;  2QTD A;  1A5V A;  3CC2 N;  3TTC A;  3WXI A;  1TAU A;  2HBJ A;  1A5W A;  2WOM A;  3UKR B;  4DF4 A;  1U47 A;  4ISG A;  3AVK A;  4R5P A;  4YOW A;  3O4Q A;  4MO4 A;  3OYN A;  4BGB A;  1GOB A;  5BRE A;  2PAV A;  2BAN A;  4ILH A;  3SV4 A;  5I3U A;  1N6Q A;  1BGX T;  2G8V A;  1P90 A;  1X3N A;  4FLY A;  4H5N A;  1EWR A;  4M3R A;  1KFS A;  3AV9 A;  3SAF A;  3ZT4 A;  3A5N C;  3RRG A;  3O5B A;  3P5J A;  3K5M A;  1VQ5 N;  4CEF A;  4K42 A;  4CJU A;  2FBV A;  4EAH D;  4GNI A;  4CF1 A;  3OBW A;  5GIN A;  1U4B A;  3CI5 A;  4M7X A;  3S9H A;  1YUW A;  3QBX A;  3KLG A;  4DU3 A;  3ITH A;  1WAF A;  1IG9 A;  4YOT A;  2KLA A;  3CIP A;  2JLE A;  5JS1 A;  1VQ9 N;  4B1W B;  1S1X A;  1QQM A;  2BDP A;  3C65 A;  2E2O A;  3J7A P;  4QAG A;  3CJ1 A;  5E41 A;  2HF3 A;  4LD0 A;  2HHU A;  3HPO A;  4DSE A;  1YF5 L;  1IKX A;  4GW6 A;  2E6L A;  4JI1 K;  3CCV N;  4FK0 A;  3CMA N;  2NRV A;  4JK9 A;  4J2A A;  4XH4 A;  1XNQ K;  3M6G A;  5BPL A;  1ZBF A;  2OPS A;  3AAP A;  2HHV A;  5GAE P;  4M3Y A;  3PX4 A;  4FJX A;  4FZY A;  1QE1 A;  3PSI A;  2D0B A;  4DTR A;  5HOO A;  3IG1 A;  3NDK A;  1K9M O;  3ZT2 A;  1CXQ A;  4JS4 A;  1QZ5 A;  4F9O A;  3ID6 A;  2YJF A;  3T1H K;  1CZ9 A;  2J4R A;  1NGG A;  1EWQ A;  2HMI A;  4FLU A;  3ZSY A;  3C0B A;  4QS8 A;  5KGX A;  4CHY A;  3LDN A;  4KI4 A;  1ESV A;  2AA4 A;  1KXP A;  3CCS N;  5BPM A;  3BDP A;  2D0C A;  3NCI A;  3H45 C;  3PV8 A;  2X78 A;  4CF2 A;  2G8K A;  4F4K A;  1VQO N;  3C95 A;  1NGB A;  3UE5 A;  2OPR A;  3AVA A;  4B1X B;  4K25 A;  3HYF A;  2ETJ A;  2HVH A;  1CXU A;  3CPW M;  4FWM A;  2ZJR L;  5ELZ A;  1T6C A;  5KRT A;  3O1B A;  3ENH A;  3QIP A;  2F9T A;  3EEQ A;  4Y1C A;  1IO2 A;  4AM7 A;  3HP6 A;  3S3N A;  1SKS A;  4CK2 A;  2YKM A;  4UQG A;  1TL3 A;  3LP2 A;  3QLH A;  4HHT A;  3FZL A;  3KJV A;  1N34 K;  3D45 A;  3NH0 A;  3KK2 A;  3CQ8 A;  1NGC A;  4NB4 A;  4X65 K;  2VG7 A;  1RDD A;  5GIO A;  4YY3 K;  3R8E A;  1WB9 A;  2E20 A;  3PO5 A;  1ZBU A;  3VES A;  3CM6 A;  1KSP A;  4CZI A;  1NK0 A;  4NCA A;  4M45 A;  5EY4 A;  5DM7 L;  1BUP A;  1DGK N;  3OHR A;  1IBK K;  1NK6 A;  1N5Y A;  4PKI A;  4CE9 A;  4WQ4 A;  3SJJ A;  3OS1 A;  4CGF A;  1ZBH A;  3DLR A;  3H1V X;  3M1F A;  5AQX A;  3T1A A;  4K0K K;  2ZF5 O;  2IOC A;  5KQD A;  3ULE A;  3U9Z A;  4BRK A;  1VQ6 N;  1WLJ A;  1VSM A;  3CJC A;  1RFQ A;  3CC7 N;  4BRP A;  1JLB A;  3M8S A;  3KWG A;  2HBM A;  1W0H A;  1ZC6 A;  1H1V A;  3P1G A;  1MU2 A;  1S6Q A;  3UB5 A;  2XY5 A;  3VGK A;  3CCJ N;  3TAP A;  4J8F A;  4I9L A;  5GAH P;  3VF2 A;  1EXQ A;  1U2V B;  4N56 A;  3G25 A;  4Y1D A;  1CZB A;  4JI0 K;  3HO1 A;  3O80 A;  2QA4 N;  4YOU A;  4HCB A;  3K0S A;  3DYA A;  2Q1N A;  4B3S K;  4CER A;  3AO4 A;  3LPT A;  1M90 O;  2P9N B;  3PIO L;  3WQT A;  3TAR A;  3JXU A;  3M8Q A;  4I6M A;  4O55 A;  2YHW A;  3IS9 A;  3AVM A;  3L6Q A;  1SUQ A;  5HRS A;  3CXC M;  3ISN C;  4JN4 A;  3TTF A;  2IVP A;  2CH6 A;  1VQP N;  1OH8 A;  2DFF A;  4KI6 A;  3UKU B;  2A6A A;  3BY5 A;  2OAN A;  2UXD K;  3VGL A;  1S3X A;  3VEV A;  2QWN A;  2LSN A;  1BOT O;  4KFB A;  4O8K A;  4AHC A;  4GV6 A;  2D5R A;  4E7J A;  3ZT0 A;  1OVY A;  4DSI A;  3KIO A;  4EHU A;  4PQU A;  2F7T A;  1KTQ A;  2VQF K;  5AQS A;  5AQM A;  4DTP A;  2HHW A;  3ZET A;  4H0Y B;  4MDA A;  5M1N A;  1RTD A;  3WNH A;  4BG8 A;  4CJQ A;  1RDA A;  3ZET B;  4ILJ A;  2QM1 A;  1EQY A;  1WSI A;  3AVB A;  1N36 K;  5AQL A;  1OKJ A;  4C8M A;  5FPM A;  3OW2 M;  3DLK A;  4DV3 K;  1S1W A;  4M3T A;  4WFB L;  3QES A;  1C1A A;  3DLB A;  4NO7 A;  4C23 A;  4XH5 A;  4RW7 A;  2QEX N;  3MX5 A;  4JRP A;  2XY8 A;  3KKS A;  3O8M A;  3ZT3 A;  3C6H A;  2ZD1 A;  3MMV A;  1HNW K;  1DKG D;  4C8O A;  1CZA N;  4FK2 A;  3ID8 A;  2O8D B;  2AP1 A;  3OY9 A;  5GIP A;  2O8D A;  3NFA A;  3KD5 E;  2RHK A;  1YHQ N;  4ELU A;  5LMU K;  1JJ2 M;  1KAY A;  4DU4 A;  1JCE A;  3ULD A;  3W0L A;  1IKY A;  2O8B A;  3SQ0 A;  3SNN A;  4EP4 A;  4CHN A;  3AVJ A;  4CHO A;  4DWI A;  4BQZ A;  4FJI A;  3NVM A;  2ZQB A;  1ASW A;  1NK5 A;  1JXE A;  3S3M A;  4X62 K;  1LW0 A;  1HNI A;  1WOQ A;  5FRN A;  2HND A;  3MWP A;  1HYS A;  4B08 A;  2I7N A;  3O4W A;  3VQP A;  1RGI A;  2P9K B;  2OZM A;  4R79 A;  4HWI A;  4DU1 A;  1ASV A;  3OYM A;  4HUG A;  2HHX A;  4H5T A;  3KK7 A;  3AA5 X;  4FLX A;  4OLA A;  2YNF A;  4BE2 A;  3OA9 A;  5FPE A;  4A5A A;  3QEW A;  1XC3 A;  2GWJ A;  2KHO A;  1OH5 A;  2VCP A;  3V1Q A;  3SUN A;  3TR8 A;  3VQ9 A;  4BC2 A;  3WXJ A;  3BEX A;  1TUU A;  4IZ9 A;  1SKR A;  1BIU A;  1I3A A;  4LFB K;  1XQS C;  2F4V K;  2VQE K;  3RMD A;  3RTV A;  1YVN A;  3DWL A;  3P4I A;  1BL3 A;  4DSJ A;  3HOT A;  2QKB A;  3AVL A;  3R3L A;  4ILG B;  4Z0U A;  3DLE A;  2WTU A;  1WUA A;  1VQ8 N;  4H0X B;  4FM2 A;  3IRX A;  3THW A;  1QHA A;  2W42 A;  1VSJ A;  2VWB A;  1NGD A;  4ID1 A;  3WXK A;  4RG8 A;  2KZM A;  2F96 A;  3CJA A;  3MK6 A;  4MLE A;  3V9X A;  4KB0 A;  2A41 A;  2JGU A;  3HI0 A;  4CEZ A;  3SUP A;  2VWK A;  5KTQ A;  3SPZ A;  4XEI A;  3E1Y A;  5AQU A;  3VA3 A;  3OS0 A;  4OJR A;  4DB3 A;  3BZK A;  2Q36 A;  4JI6 K;  4DSL A;  3KHY A;  4BRM A;  1L3U A;  3U3G A;  2QI2 A;  3O9S A;  3J80 O;  3S41 A;  3ZSR A;  3FGU A;  3VEZ A;  4FJ8 A;  4AF1 A;  4CZL A;  4CIG A;  3TAQ A;  3U6F A;  1LCU A;  3DAW A;  3HRG A;  4DR7 K;  3DJC A;  4LY7 A;  4KAZ A;  2KTQ A;  1DTT A;  1WSG A;  3NF8 A;  4CZG A;  5B8H A;  3L0Q A;  1JCG A;  3EZ5 A;  2X74 A;  4KPY A;  3G0Z A;  1VSE A;  4OPK A;  5E84 A;  2UUA K;  2GBZ A;  3AA4 A;  1R0A A;  4FWK A;  3CPE A;  1NJY A;  3ALY A;  1CLQ A;  4U67 L;  3VF6 A;  1HJR A;  4W5O A;  3L2R A;  4DR3 K;  3SMS A;  4CZK A;  3R1X A;  1KQS M;  4JD2 A;  3HTV A;  4N47 A;  4O0J A;  1W97 L;  2ATQ A;  1ILY A;  3SLC A;  2R7Y A;  1T3V A;  4LSN A;  5AQR A;  3FZF A;  4H8K A;  1TVR A;  4FJJ A;  3VN5 A;  3BZC A;  3TAN A;  2P9S A;  1BQM A;  2V7Z A;  4TSX A;  2UUC K;  1D9D A;  3ZYY X;  3EYZ A;  5AQZ A;  1RDB A;  1TL1 A;  4CHQ A;  3V9U A;  3O4N A;  4DTS A;  1YVU A;  1Y64 A;  3TU5 A;  3WQU A;  3DXK A;  1LWC A;  4H03 B;  2BTF A;  3H6E A;  3NF6 A;  4BC4 A;  4H5V A;  3VQE A;  3SPY A;  3CCU N;  2YHB A;  2Z1I A;  5C12 A;  1LV5 A;  1NK7 A;  4B1V A;  1B9F A;  5HP1 A;  4CEE A;  4Z4E A;  5H1S Q;  5JMV A;  1GLA G;  4FVM A;  3TAB A;  1SS6 A;  5FRM A;  3MEG A;  1GLB G;  4O44 A;  3OYA A;  3LZJ A;  4JKG B;  5C25 A;  4X64 K;  3V4I A;  1XHX A;  1OVQ A;  1HLU A;  4EZ9 A;  5M1P A;  3SZ2 A;  5HRO A;  4FJ7 A;  1HPM A;  3D6R A;  1SKW A;  4KHY A;  5FRO A;  3O1W A;  4LF8 K;  3LM9 A;  3K58 A;  4M42 A;  1GLJ O;  4FJ9 A;  4AQY K;  4DQQ A;  4KB1 A;  2FF3 B;  5HRN A;  2H3G X;  5E26 A;  3HZ6 A;  3DXM B;  1S22 A;  3E9O A;  2OA8 A;  4KRF A;  4BRN A;  4WF9 L;  2VG5 A;  4FPB A;  4FJK A;  3VEO A;  4AHT A;  4BQL A;  2YNG A;  1QTM A;  1SL1 A;  3OYK A;  2DFE A;  3DRP A;  3ATV A;  4RTF D;  3KVG A;  1Z6R A;  2W40 A;  4E19 A;  4O5F A;  3LDO A;  1KAZ A;  5K14 A;  3DI6 A;  2O8E B;  2VYP A;  5AQF A;  2KKZ A;  3SQ1 A;  4E7H A;  3NGZ A;  3CQX A;  2BGG A;  2E8A A;  1JCF A;  4DV4 K;  2X6S A;  4GVE A;  4BVO A;  3VQD A;  4DKW A;  5LJW A;  3RR8 A;  3B6P A;  4EZ6 A;  1XUP O;  1ZXO A;  5JIC A;  3KK3 A;  2RF2 A;  3T1Y K;  3QML A;  4C8N A;  1NK4 A;  4JKF A;  5KPT A;  2HOE A;  2D1K A;  4N76 A;  1HNV A;  1SQK A;  3A2F A;  4E1M A;  3C94 A;  4MLH A;  4ISF A;  1BHL A;  4KBO A;  1T6D A;  2O4I A;  1K73 O;  4J2D A;  2A3Z A;  3NMU A;  1EET A;  4DR6 K;  4CW7 B;  3IDH A;  3NVK A;  1NGJ A;  4JI3 K;  5EXW A;  3K5O A;  4RW8 A;  3QEI A;  4JI4 K;  1R59 O;  4PL7 A;  4K8X A;  4IBN A;  4JKC A;  3LDQ A;  3K57 A;  2IGI A;  4BR9 A;  3MN6 A;  3VOV A;  5FPN A;  4A61 A;  1C0T A;  5AZJ A;  1ATS A;  1Q86 O;  2FC0 A;  5CYM A;  4IFE A;  3RMA A;  4KKO A;  1TK5 A;  5JVH L;  3CFO A;  5BR8 K;  3SAG A;  3CCE N;  2EHG A;  4CEB A;  3CFP A;  3VEW A;  3EE9 A;  4M41 A;  3VER A;  3NH1 A;  2P9U A;  1I94 K;  1RTH A;  1Q18 A;  2ZGZ A;  4B9S A;  4CVN E;  2Q0U A;  1MDU B;  1GOA A;  2XRI A;  3ZSV A;  3L3V A;  3AVH A;  4OVL A;  4PUO A;  3MCP A;  4NXN K;  1KCF A;  1VSI A;  1VRT A;  2IC3 A;  1TAQ A;  3THX B;  5DMR A;  3QET A;  1YTU A;  1C0F A;  4GKJ K;  3WNG A;  2XHB A;  3A5L C;  3PO4 A;  1S1T A;  1WBD A;  1HQE A;  1HYZ A;  5AQK A;  4FW1 A;  3MEC A;  4FLW A;  3AO5 A;  3AAR A;  3P83 D;  3J81 O;  2O4G A;  4W5T A;  4JKG A;  3F5T A;  4DCH A;  3OJS A;  2CGK A;  4CIE A;  4DG1 A;  4E0D A;  1XI1 A;  4W5R A;  1NMN A;  1HKC A;  1BA0 A;  2YNH A;  3SQ4 A;  1E4G T;  4BWJ A;  3SBG A;  1NGF A;  4MO5 A;  3SQ2 A;  4DMN A;  2DPN A;  4O8U A;  3RSE B;  2HHT A;  4CGG A;  2QWO A;  3N4P A;  1DTQ A;  4XIU A;  4DSF A;  3EE8 A;  3ZX2 A;  1W9H A;  1RDC A;  5GAD P;  1VSL A;  3O9U A;  1C1C A;  4FLZ A;  5DK5 A;  1K8K A;  4B9N A;  3ATU A;  2HVI A;  3SUQ A;  4B3R K;  5C2F A;  3KWI A;  1W2B M;  4OPA A;  4DF8 A;  1FKO A;  1IBL K;  1KRP A;  1TKT A;  3D2F B;  3QNO A;  1T44 A;  4HUF A;  5HRR A;  1S9E A;  1BCM A;  2G8F A;  4CJT A;  3HBT A;  2Z1H A;  2CGL A;  4CJ4 A;  4B8C A;  1C0U A;  4MQ3 A;  3O3F A;  1EO1 A;  2O8F B;  1S1V A;  3FR0 A;  4IG0 A;  4JI2 K;  3ZEU B;  1HX1 A;  2XY7 A;  4CJ5 A;  4Z94 A;  3U3Y A;  5J2M A;  4IWV A;  2VWJ A;  4JKD A;  3HL8 A;  4HUE A;  4F2S A;  4DR2 K;  3IKM A;  3DLH A;  3GG4 A;  4PA1 A;  4GY2 B;  4BRG A;  2YJE A;  1SL2 A;  4JK7 A;  3VPZ A;  4BVP A;  5C0Y A;  3K9J A;  4XH1 A;  3SMP A;  1HQU A;  2FSK A;  2YNI A;  1L3V A;  1BIS A;  5M1Q A;  2E2N A;  3ENB A;  1D9F A;  3AAQ A;  2IAJ A;  3QIC A;  1Z25 A;  4IDH A;  4JKB A;  2A1S A;  3EKU A;  3WEE A;  1X9M A;  2G8U A;  4DTJ A;  1NGA A;  3OYB A;  4JKH A;  2NLX A;  3QDK A;  3CM5 A;  1LAW A;  4DFP A;  4H0O A;  4WCE L;  3TTD A;  1W7A A;  3LAL A;  1S1U A;  1BG3 A;  3L2Q A;  4KHW A;  4KHP K;  1RT1 A;  3NAE A;  1BO5 O;  4FWL A;  3VMF B;  4C1N K;  3RVC A;  1M1K O;  4CZH A;  4BRC A;  4RCH A;  3NBP A;  1VHX A;  4IOA L;  4DSK A;  2PFU A;  4BR0 A;  3PSF A;  4IJN A;  3ZSW A;  2I7P A;  4CGD A;  4GMJ B;  3RMB A;  5M1O A;  5AQJ A;  3BUZ B;  2E1Z A;  2FSJ A;  4LF9 K;  1B92 A;  2NNW A;  3PIP L;  3THX A;  4LH5 A;  3LAN A;  3AVN A;  1TKX A;  4KTZ A;  4DLE A;  2HBL A;  4YDU A;  3UKR A;  2P1J A;  3A5M C;  3AVF A;  3DMJ A;  1D5A A;  1OH7 A;  1QZ6 A;  3CCQ N;  4CBU A;  3QER A;  4DS5 A;  1VQM N;  3PY8 A;  1QQN A;  2ASO A;  3DLL L;  4DTM A;  4OKE A;  2D0P A;  4DUY K;  4FWS A;  4WFA L;  2QWM A;  3J7Y P;  3HM9 A;  1XMQ K;  3L3U A;  1KVA A;  4CGI A;  4CJL A;  1RCH A;  1YXQ A;  2HNZ A;  1RT2 A;  3SI6 A;  1KFD A;  3LL3 A;  4DFJ A;  3AVG A;  1RT6 A;  1HKG A;  3L4I A;  3TAF A;  3OVN A;  3I8B A;  4C8L A;  2P9P B;  4WYB A;  3QIN A;  4OO1 J;  1ZYQ A;  3MN7 A;  2Q3S A;  3V9W A;  4B9L A;  3ZSO A;  4NCG A;  1YT3 A;  1FK9 A;  3VEN A;  4FXD A;  1J9A A;  1NKB A;  5KI6 A;  4YDU C;  2RN2 A;  4AHS A;  2DFH A;  2GTD A;  1MWM A;  1UAX A;  4BR7 A;  1JLG A;  3VQC A;  1O13 A;  3CCR N;  1FW6 A;  3VA0 A;  3I55 N;  1LWE A;  3T3F A;  5BN8 A;  2FSN A;  3G6E N;  1FJG K;  5AQI A;  1VSF A;  3M3Z A;  1GLL O;  4CJF A;  1TK8 A;  1RT7 A;  2D4W A;  4J2E A;  4YOV A;  3ZEU A;  3Q7C A;  3SUO A;  1EKE A;  1GOC A;  5C2D A;  1QQO A;  4BDY A;  2UXC K;  3CJB A;  3DXK B;  4I7F A;  4BDZ A;  5C10 A;  3A0I X;  2W6K A;  1BWF O;  2ITG A;  1IKV A;  3CFR A;  3MCA B;  2Y1J A;  1I39 A;  4FWQ A;  3ZLJ A;  4CHP A;  1S6P A;  4RW9 A;  4DV1 K;  3PUF A;  3CQY A;  5AQW A;  4H4O A;  1DEJ A;  4KO0 A;  4UY8 O;  2NRZ A;  3THW B;  1VQL N;  4CEC A;  4FW2 A;  2A1R A;  2Q97 A;  2UYT A;  1VQ7 N;  4CFD A; 
#chains in the Genus database with same CATH homology
 5FRO A;  1IH7 A;  4DS4 A;  1RIL A;  3I0R A;  1QSY A;  2I5J A;  3K58 A;  4LH4 A;  4M42 A;  1Y97 A;  1CZ9 A;  4FJ9 A;  2AJQ A;  3LDS A;  4BE1 A;  4DQQ A;  4KB1 A;  2RPI A;  5HRN A;  1L3S A;  1TK0 A;  2PZS A;  2HMI A;  3LP3 A;  4FLU A;  4OGE A;  3ZSY A;  4HTU A;  2KQ2 A;  4Z4C A;  1QS4 A;  5KGX A;  5T7B A;  2OA8 A;  4CHY A;  2PYL A;  4KRF A;  3AVC A;  2B5J A;  1L3T A;  4KI4 A;  2GV9 A;  1KLN A;  1VSK A;  3MXJ A;  1JL1 A;  1HPZ A;  2VG5 A;  3NF9 A;  1NK8 A;  3BDP A;  4FJK A;  4E3S A;  1RBU A;  4DTU A;  2D0C A;  4AHT A;  3NCI A;  3PV8 A;  2YNG A;  1K6Y A;  2X78 A;  4CF2 A;  1QTM A;  1SL1 A;  2G8K A;  3OYK A;  4E1N A;  1BIZ A;  1C0M A;  4DLG A;  2IS3 A;  1XWL A;  2DFE A;  3DRP A;  4CEO A;  4F4K A;  3C95 A;  4AHU A;  1NJW A;  3H08 A;  2OPR A;  1QSS A;  3AVA A;  5C24 A;  3KD1 E;  4F8R A;  4E19 A;  4H4M A;  2D0A A;  3HYF A;  3WNE A;  2ETJ A;  2HVH A;  4QCL A;  1CXU A;  3OYL A;  1RT4 A;  4CHZ A;  4KHN A;  3LPU A;  3DI6 A;  5K14 A;  4F3O A;  4IFV A;  4NYN A;  5KRT A;  1JLA A;  3QIP A;  4CFC A;  5J1E A;  3SQ1 A;  4E7H A;  3KLI A;  5J2N A;  3ZSZ A;  3HVR A;  4Y1C A;  4Z4H A;  3NGZ A;  4KHS A;  1IO2 A;  2NUB A;  3HP6 A;  3S3N A;  1SKS A;  4CK2 A;  2YKM A;  4UQG A;  1F21 A;  1TL3 A;  3LP2 A;  3QLH A;  3LZI A;  3KJV A;  4HHT A;  1QSL A;  1RBT A;  1WSH A;  4OPJ A;  3D45 A;  3NH0 A;  3KK2 A;  1EX4 A;  3CQ8 A;  4FJH A;  1O1W A;  1HRH A;  2X6S A;  2P51 A;  4KV8 A;  3VQD A;  1UWB A;  2VG7 A;  4CJW A;  3KLH A;  3B6P A;  1RDD A;  4I2Q A;  3RRH A;  3B6O A;  4CEA A;  3KK3 A;  2RF2 A;  4DFK A;  3QNN A;  4EZ6 A;  5D3G A;  4M3U A;  4E89 A;  4C8N A;  1ZBU A;  3PO5 A;  4CJ3 A;  4B8A B;  3CM6 A;  1NK4 A;  1X9S A;  1J5O A;  4E7I A;  1KSP A;  1L5U A;  1NK0 A;  1U04 A;  3HST B;  4N76 A;  4M45 A;  1WSJ A;  1HNV A;  4NCA A;  3OJU A;  3A2F A;  4E1M A;  4Q0B A;  1C6V A;  4FM0 A;  2VG6 A;  3C94 A;  1NK6 A;  5KRS A;  1N5Y A;  1BHL A;  4N5S A;  4FJN A;  4CK1 A;  3MXM A;  4NCB A;  4CE9 A;  2O4I A;  4J2D A;  1S5J A;  3SJJ A;  3OS1 A;  4CGF A;  2DY4 A;  1ZBH A;  1EET A;  2F8T A;  1WN7 A;  3DLR A;  3T1A A;  4KTW A;  4CES A;  3NF7 A;  2IOC A;  3K5O A;  4RW8 A;  1NOZ A;  4FM1 A;  3QEI A;  1QQC A;  4W5N A;  2OPQ A;  4HVJ A;  3S3O A;  3ZSX A;  3TI0 A;  1WLJ A;  4K8X A;  1VSM A;  4IBN A;  1EP4 A;  3AA3 A;  3AO1 A;  2PYJ A;  3K57 A;  2IGI A;  1VK0 A;  1LW2 A;  1JLB A;  3M8S A;  4AIL C;  4ELT A;  1NJX A;  1JLE A;  1C0T A;  1W0H A;  1KLM A;  4FLV A;  1NK9 A;  1B9D A;  3P1G A;  1UA0 A;  1MU2 A;  2FBY A;  4AHV A;  4FZX C;  1S6Q A;  5CYQ A;  2FC0 A;  5CYM A;  1LAV A;  3RMA A;  3F9K A;  4KKO A;  1TK5 A;  3CFO A;  3QEP A;  4YNQ A;  2XY5 A;  3MAQ A;  4LSL A;  4J2B A;  3TAP A;  4W5Q A;  2EHG A;  3OS2 A;  4I9L A;  4CEB A;  3CFP A;  4CF9 A;  5I42 A;  4M41 A;  4FJG A;  1EXQ A;  4N56 A;  1RBS A;  4Y1D A;  4EP5 A;  1CZB A;  1VSD A;  3HP9 A;  1RTH A;  3NH1 A;  3HO1 A;  4B9S A;  1T8E A;  4HCB A;  3RMC A;  3NGI A;  3DRR A;  3OYC A;  3M8P A;  4BE0 A;  3DYA A;  3RR8 A;  4RW4 A;  4DQI A;  2XRI A;  1GOA A;  3AO4 A;  3LPT A;  4CER A;  4ZTJ A;  3G10 A;  3THV A;  3ZSV A;  3L3V A;  3AVH A;  4RW6 A;  4HCC A;  4OVL A;  4PUO A;  4E7L A;  2HNY A;  3TAR A;  2HHS A;  1KCF A;  3NGY A;  2IC3 A;  1VSI A;  1VRT A;  1TAQ A;  2QXF A;  3M8Q A;  2FBX A;  4O55 A;  5DMR A;  3V1R A;  3L2U A;  3QET A;  3HK2 A;  4Z4G A;  3SCX A;  4B9T A;  1YTU A;  3IS9 A;  3AVM A;  3VQ6 A;  1C1B A;  4BAC A;  3OYG A;  4PY5 A;  3WNG A;  1SUQ A;  4CJV A;  3DOL A;  5HRS A;  3O3H A;  1X9W A;  1TV6 A;  3ISN C;  2XHB A;  3OYE A;  3PX0 A;  3VQB A;  3LWL A;  3PO4 A;  1Q9Y A;  2HHQ A;  1S1T A;  3QIO A;  3UIQ A;  1HQE A;  1HYZ A;  4CFA A;  4FW1 A;  2DFF A;  3MEC A;  4FLW A;  4KI6 A;  2YHA A;  3AO5 A;  3P83 D;  3HVT A;  2O4G A;  1U49 A;  4W5T A;  1X1P A;  3V81 A;  2WON A;  3OJS A;  5J2P A;  2LSN A;  1JLC A;  4KFB A;  4CIE A;  4CK3 A;  4AHC A;  2D5R A;  4DG1 A;  4CGJ A;  4E7J A;  4E0D A;  1XI1 A;  5FDL A;  3ZT0 A;  4W5R A;  4NYF A;  3SQ4 A;  2YNH A;  4DSI A;  3O3G A;  4OKK A;  3KIO A;  4BWJ A;  2B6A A;  4OLB A;  4PQU A;  3RR7 A;  4O0I A;  1D8Y A;  3VQ5 A;  3SQ2 A;  4CF8 A;  1KTQ A;  4DMN A;  4DQS A;  4CJP A;  3HJF A;  4DTP A;  2HHW A;  2F8S A;  2E4L A;  2HHT A;  4CGG A;  4XIU A;  4DSF A;  1DTQ A;  1U48 A;  4N41 A;  1RTD A;  2HW3 A;  1T03 A;  3WNH A;  3ZSQ A;  1JL2 A;  4CJQ A;  4B9U A;  1RDA A;  4FJ5 A;  1W9H A;  1WSF A;  1RDC A;  4E7K A;  3D0P A;  1VSL A;  4AH9 A;  2G8I A;  1C1C A;  1WSI A;  2BE2 A;  3AVB A;  3AO2 A;  4FLZ A;  3KLE A;  5DK5 A;  4C8K A;  4FK4 A;  4C8M A;  2B4J A;  4ZHR A;  4B9N A;  3DLK A;  3OYF A;  3MED A;  1S1W A;  1BCO A;  4M3T A;  2HVI A;  3QES A;  1C1A A;  2YKN A;  1UOC A;  3DLB A;  2QKK A;  4K8Z A;  4AHR A;  4RW7 A;  3ZT1 A;  3SUQ A;  3CG7 A;  4B9V A;  4G1Q A;  4JRP A;  3TAG A;  2XY8 A;  3KKS A;  3ZT3 A;  2G8H A;  4BDP A;  2ZD1 A;  4DF8 A;  4JLH A;  4C8O A;  5J2Q A;  1RBV A;  3K5L A;  2E6M A;  1FKO A;  4FK2 A;  1KRP A;  1SV5 A;  1TKT A;  4WE1 A;  3OYD A;  3QNO A;  3OY9 A;  4FJL A;  1U45 A;  4O5B A;  5HRR A;  1S9E A;  1BCM A;  4HUF A;  3TWH A;  4CJT A;  5HRP A;  2G8F A;  2Z1H A;  3NFA A;  3KD5 E;  4CJ4 A;  5SZT A;  4ELU A;  4CED A;  4CJE A;  3LWM A;  4B8C A;  2GUI A;  4KHU A;  1Z26 A;  1C0U A;  4MQ3 A;  3O3F A;  5HLF A;  1SL0 A;  2KZZ A;  4OGC A;  4I2P A;  4DU4 A;  4KRE A;  1S1V A;  4KHQ A;  4IG0 A;  4DQR A;  4FZZ A;  4ELV A;  3ULD A;  3DM2 A;  2XY7 A;  1IKY A;  4PWD A;  4CJ5 A;  2P5G A;  3U3Y A;  3SYZ A;  5J2M A;  1VRU A;  3SQ0 A;  3SNN A;  4EP4 A;  4CHN A;  3KTQ A;  3AVJ A;  4CHO A;  2VWJ A;  3E01 A;  1RT3 A;  3HL8 A;  4HUE A;  4F2S A;  4CJK A;  3JSM A;  4DWI A;  1J54 A;  3DLH A;  4PA1 A;  1S9G A;  5KGW A;  4YFU A;  4FJI A;  2ZQB A;  1SL2 A;  1ASW A;  1NK5 A;  4F3T A;  1JXE A;  2G8W A;  3IAY A;  5HBM A;  1G15 A;  2X6N A;  3HPG A;  1RBR A;  4CIF A;  3V6D A;  4ICL A;  1LW0 A;  1HNI A;  3S3M A;  1FXX A;  4IDK A;  2HND A;  1HQU A;  1YTA A;  3EY1 A;  1TGO A;  3MXI A;  4B08 A;  5FRN A;  1ZBI A;  4QOZ B;  1JKH A;  2YNI A;  1L3V A;  3VQP A;  1BIS A;  2Z1J A;  1IKW A;  2Z1G A;  2OZM A;  4JRQ A;  3SV3 A;  4DU1 A;  4M3Z A;  1D9F A;  1DLO A;  1ASV A;  3ZCM A;  5CZ1 A;  1NKE A;  3OYM A;  3JYT A;  4KHY A;  4HUG A;  4F2R A;  5C42 A;  4JS5 A;  2IAJ A;  1Z25 A;  1TKD A;  2HHX A;  1KVC A;  2QK9 A;  4CFB A;  2A1S A;  3AA2 A;  1X9M A;  2G8U A;  4ID5 A;  3AA5 X;  4FLX A;  4DTJ A;  1RNH A;  3ASM A;  3T19 A;  3OYB A;  2KFZ A;  4DQP A;  2YNF A;  3LAK A;  4B3O A;  4BE2 A;  3QEW A;  4OLA A;  3CM5 A;  2OYQ A;  3I0S A;  1KVB A;  1QHT A;  1LAW A;  1HMV A;  3OYH A;  4IG3 A;  3V1Q A;  3SUN A;  4DFP A;  3TR8 A;  3CYM A;  3VQ9 A;  3QEX A;  2KW4 A;  3M8R A;  4FCY A;  3LAL A;  1S1U A;  4FLT A;  1JLQ A;  3FFI A;  3L2Q A;  4KHW A;  1ASU A;  3VQ7 A;  1SKR A;  2OZS A;  2ZE2 A;  1BIU A;  1I3A A;  1RT1 A;  3NAE A;  4ZTF A;  3K59 A;  1RTI A;  3RMD A;  3RTV A;  1UA1 A;  4FJM A;  1BL3 A;  1XC9 A;  3TAM A;  3DRS A;  4DSJ A;  1HYS A;  2QKB A;  3AVL A;  3NBP A;  4Z0U A;  3DLE A;  3VQQ A;  4DSK A;  1T05 A;  4CF0 A;  4KTQ A;  1ITG A;  4FM2 A;  3IRX A;  3ZSW A;  1ZBL A;  2W42 A;  1VSJ A;  4CGD A;  4GMJ B;  1WNS A;  4MFB A;  3AVI A;  3RMB A;  4ID1 A;  5CZ2 A;  1XHZ A;  4RG8 A;  3OYI A;  3BGR A;  4Z4I A;  4M3X A;  2KZM A;  2F96 A;  1B92 A;  2EX3 A;  3HT3 A;  3V9X A;  4KB0 A;  4FYD A;  2JGU A;  4DTO A;  2BGG A;  4LH5 A;  4DTN A;  3LAN A;  4CEZ A;  3AVN A;  1TKX A;  3NHG A;  2VWK A;  4KTZ A;  5KTQ A;  3SUP A;  3SPZ A;  3DOK A;  3OYJ A;  4DLE A;  2RKI A;  3LAM A;  1A5X A;  2P1J A;  5CY4 A;  3AVF A;  3HPH A;  3VA3 A;  3NH2 A;  3DMJ A;  4OJR A;  3DLG A;  3OS0 A;  1D5A A;  3NE6 A;  4DFM A;  3LP1 A;  1NJZ A;  4DSL A;  3QER A;  4B9M A;  4CJR A;  4DS5 A;  1FKP A;  4DTX A;  1WAJ A;  3U3G A;  1L3U A;  3PY8 A;  1J53 A;  3VQ4 A;  2PY5 A;  4I9Q A;  1Q8I A;  2YV0 X;  3K5N A;  4DTM A;  1T7P A;  1BQN A;  3RWU A;  4OKE A;  3ZSR A;  1JLF A;  4FJ8 A;  3VQ8 A;  1HYV A;  1REV A;  4IFY A;  4CEQ A;  3KLF A;  3V1O A;  4CIG A;  3HM9 A;  3TAQ A;  3U6F A;  3TAE A;  2P5O A;  3L3U A;  1KVA A;  3KKR A;  3L2V A;  2OPP A;  4CGI A;  4Z4F A;  4CJL A;  1A5V A;  1RCH A;  4LY7 A;  4KAZ A;  2KTQ A;  1DTT A;  1WSG A;  3NF8 A;  2HNZ A;  1RT2 A;  3SI6 A;  1TAU A;  3V9S A;  1A5W A;  1KFD A;  2X74 A;  2WOM A;  4CJS A;  3EZ5 A;  2IDO A;  4DFJ A;  3G0Z A;  4DF4 A;  3AVG A;  1VSE A;  4OPK A;  1RT6 A;  1U47 A;  4KPY A;  3AVK A;  4R5P A;  2GBZ A;  3AA4 A;  3O4Q A;  4Q5V A;  1R0A A;  1JXB A;  3OYN A;  3TAF A;  1NKC A;  3OVN A;  4C8L A;  1GOB A;  1NJY A;  3ALY A;  2BAN A;  1CLQ A;  3L8B A;  1HJR A;  3QIN A;  3QO9 A;  4CGH A;  4W5O A;  3SV4 A;  5I3U A;  1N6Q A;  1BGX T;  3L2R A;  1ZYQ A;  2G8V A;  4FLY A;  1TKZ A;  2Q3S A;  3V9W A;  5JS2 A;  4B9L A;  3ZSO A;  4NCG A;  1YT3 A;  4M3R A;  1KFS A;  3AV9 A;  1WSE A;  1FK9 A;  4FXD A;  3ZT4 A;  1J9A A;  1NKB A;  3RRG A;  5KI6 A;  3P5J A;  2RN2 A;  3K5M A;  1LWF A;  4AHS A;  3HXM A;  2DFH A;  4CEF A;  1UAX A;  4O4G A;  1JLG A;  4N47 A;  3VQC A;  4O0J A;  4CJU A;  2FBV A;  1NOY A;  4CCH A;  2ATQ A;  4CF1 A;  2R7Y A;  1RTJ A;  2HB5 A;  4LSN A;  3VA0 A;  4H8K A;  1TVR A;  4FJJ A;  3VN5 A;  1Q9X A;  1U4B A;  3S9H A;  3TAN A;  1BQM A;  1LWE A;  4TSX A;  3T3F A;  3I8D A;  1TK8 A;  1D9D A;  3KLG A;  2XO7 A;  3EYZ A;  3L2W A;  1RDB A;  1TL1 A;  3ITH A;  4CHQ A;  1BI4 B;  4DU3 A;  3PX6 A;  1VSF A;  1WAF A;  1IG9 A;  4CJF A;  3V9U A;  2FBT A;  3C6T A;  3O4N A;  1RT7 A;  1YVU A;  1RT5 A;  2JLE A;  4DTS A;  3KK1 A;  3AO3 A;  3QEV A;  4J2E A;  5JS1 A;  1BI4 A;  5SWM A;  3C6U A;  3SUO A;  1LWC A;  1S1X A;  1EKE A;  1GOC A;  4BDY A;  3NF6 A;  2BDP A;  4BWM A;  3V9Z A;  3VQE A;  3F73 A;  4OKJ A;  4QAG A;  5E41 A;  4LD0 A;  2YHB A;  4I7F A;  3HPO A;  4BDZ A;  4DSE A;  3SPY A;  2HHU A;  2Z1I A;  3VQA A;  1IKX A;  4GW6 A;  1NK7 A;  1LV5 A;  4L8R B;  1B9F A;  2ITG A;  2E6L A;  5HP1 A;  1IKV A;  4CEE A;  3LP0 A;  3CFR A;  2Y1J A;  4FK0 A;  4Z4E A;  1I39 A;  4M3W A;  4CHP A;  4IKF A;  5EU7 A;  1S6P A;  4RW9 A;  4FVM A;  3TAB A;  4J2A A;  4GVM A;  1VSH A;  3PUF A;  5FRM A;  3MEG A;  1ZBF A;  3K2P A;  4H4O A;  2OPS A;  4O44 A;  2HHV A;  4M3Y A;  3OYA A;  3LZJ A;  3PX4 A;  4KO0 A;  5C25 A;  3V4I A;  4FJX A;  4FZY A;  1XHX A;  3WNF A;  1QE1 A;  4CEC A;  2D0B A;  4FW2 A;  4DTR A;  2KFN A;  2A1R A;  4EZ9 A;  3NDK A;  3IG1 A;  3SZ2 A;  5HRO A;  4FJ7 A;  2DTU A;  3ZT2 A;  2XY6 A;  2Y1I A;  4CFD A;  1CXQ A;  1SKW A;  4JS4 A;  3MEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...