3VQAA

Hiv-1 in core domain in complex with 1-benzothiophen-6-amine 1,1-dioxide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
152
structure length
141
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 52
structure length 141
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqaA00
3OYFA 2DY4A 3SCXA 3WNFA 3SQ4A 3DOLA 2D0BA 3LZJA 4W5QA 4HTUA 4CF0A 1TAQA 4FJXA 3L2WA 5DMRA 4NCAA 3K5MA 3MEDA 1TVRA 5EU7A 3KD1E 4CGDA 5HRPA 4W5OA 2E6LA 4F2RA 4B8CA 4Z4FA 2HHTA 3QO9A 1RNHA 3K58A 3MXIA 1ITGA 3HYFA 2YNGA 4IG3A 1F21A 2WONA 4FJJA 1U48A 1L3VA 3QEWA 2BGGA 4IFYA 3AVIA 3BGRA 4IFVA 4CJEA 5HROA 2A1RA 4FW2A 4ICLA 1TKXA 1NK7A 4FJHA 1LW2A 4NCBA 1LV5A 2G8VA 4CGJA 4J2DA 3PX0A 4CJQA 4FLZA 3TAPA 3KKRA 3M8PA 5KI6A 1ASVA 3NFAA 1ZBFA 2KFNA 1RBTA 3KLGA 1C1CA 3OYIA 3DLGA 1WSHA 4LSNA 3C94A 1C1AA 1C6VA 1HJRA 3DM2A 5KGXA 3AO4A 1Q8IA 1EP4A 4CGIA 2PYJA 3PV8A 4CEQA 4E7IA 5HRNA 1NJYA 4B9MA 2XO7A 3G0ZA 3HPGA 3EY1A 3HM9A 3AO3A 2DFEA 3L2VA 1C0TA 3V9ZA 4B9VA 3ZSZA 4HHTA 1KTQA 4Y1DA 3U3YA 1S1TA 1KFSA 4KHWA 1I3AA 3OYLA 2FBVA 2FBTA 4CIGA 3C95A 1KSPA 4M42A 2B4JA 2G8HA 2RF2A 2FC0A 3NF7A 3C6UA 2Y1JA 3HPOA 2DFFA 2P1JA 2D5RA 5CYQA 3MXJA 4CFAA 4BE0A 4KREA 3O3HA 3RRHA 1YTUA 3MEEA 3VQAA 5HBMA 3OYGA 3P1GA 1XC9A 4YFUA 5D3GA 1GOBA 4CJLA 4CGFA 4AHCA 1WN7A 4FM1A 3PX6A 4DQQA 4KRFA 4DSFA 4M3WA 1A5VA 1YVUA 3DLEA 4KKOA 2EX3A 3S3OA 4FJKA 4M3RA 1QHTA 4FK2A 1X1PA 4FW1A 1WSEA 4CHOA 4CJRA 3ALYA 3VQQA 1IH7A 5FRMA 4Z4HA 2BANA 3U6FA 2HNYA 1RCHA 3D45A 3V4IA 4CHYA 3SZ2A 1C0MA 1W9HA 2BE2A 2WOMA 5FDLA 4H8KA 4JS4A 2IS3A 1SL0A 2HHQA 4HCBA 4IBNA 5KRSA 1TK8A 4N76A 3HVTA 1IKXA 2KTQA 1WLJA 4FZXC 4OVLA 4PA1A 4O44A 3OYAA 1HQEA 2KW4A 3M8SA 4FCYA 1X9SA 2HHSA 1NK5A 1Z26A 4Z4CA 3O3GA 1N5YA 4KPYA 3JYTA 3NE6A 5C25A 1VSKA 2KQ2A 2RPIA 3IG1A 4CK2A 3ASMA 1IG9A 4B9UA 1XWLA 4HUFA 2HB5A 1HNVA 1BHLA 4CF9A 2F96A 4HVJA 2ZD1A 1BQNA 4BWJA 4B9LA 1I39A 3QNOA 3NGIA 3RTVA 4CF2A 5JS1A 4EP4A 4OLBA 1JLQA 3CYMA 3OYBA 2XY5A 4K8XA 3OYDA 1MU2A 4GVMA 2RN2A 3ISNC 4CEDA 2HMIA 2G8WA 4OKJA 4LH4A 3AVBA 4M3XA 3O3FA 3HSTB 4AHTA 1ZBIA 4J2EA 2HHXA 1VSLA 5HRSA 1SL1A 3QIOA 3EZ5A 4KO0A 2Z1JA 4C8OA 1RT4A 4FJMA 1RT2A 1KLNA 1U04A 1XI1A 4B9SA 4AILC 4Q5VA 1JL1A 1SKWA 4AHVA 3AA3A 5CZ2A 2HVIA 3ZSQA 3U3GA 4J2AA 4OJRA 3OYKA 4DFPA 1U4BA 2AJQA 3TR8A 1XHXA 4FJ7A 4HUGA 3WNEA 4DSEA 4DU3A 4IKFA 2B5JA 3V81A 5HRRA 2Z1IA 4CEOA 1WNSA 3M8RA 4CGHA 2R7YA 2HNDA 1TL1A 1VSEA 3B6PA 4Z4IA 4EP5A 3TARA 3TWHA 1HPZA 3OYHA 1U49A 4CJWA 2OPPA 5T7BA 5CZ1A 1REVA 3L2UA 1QSLA 3D0PA 1NJWA 3QLHA 2YHAA 4DG1A 4E3SA 1HYSA 2X6NA 5FROA 3MEGA 3THVA 3HO1A 1KLMA 4ZTJA 4DSIA 1S1XA 1RT7A 4I9LA 4B08A 1TL3A 1L3UA 3DLHA 4CESA 4AH9A 3NGZA 4M41A 4DFJA 4CF8A 2QK9A 3KLEA 3VQ7A 4DQSA 3B6OA 4ELVA 4QCLA 1CLQA 1EX4A 3RMBA 3VQPA 1RBSA 3LPTA 3SJJA 3L3UA 2VWKA 4J2BA 4LSLA 1EETA 4E7LA 3ULDA 2HW3A 1CZBA 3QERA 1BIUA 4FZYA 1IKWA 2VG7A 1GOCA 4KFBA 3SV4A 1WSIA 4KAZA 2F8TA 4C8MA 4KHNA 4KHSA 1TKDA 4RW6A 4OPKA 4E7JA 1BGXT 1HMVA 1BI4A 3VQ6A 4JLHA 1TV6A 1KCFA 2VG6A 4I7FA 4KTWA 4M45A 4WE1A 1VRUA 2XRIA 4H4MA 3T1AA 4CEBA 3SQ2A 3TAQA 3F9KA 4CJ4A 2OYQA 3CFOA 3K2PA 5SWMA 3AO1A 1TKZA 2YHBA 1RT5A 2P5OA 4W5NA 3LWMA 3LANA 4O4GA 3K5OA 3LZIA 2OPSA 4ELTA 4DQIA 3V1QA 3IAYA 1RILA 3CQ8A 4DS5A 2OPQA 3V9XA 1RTJA 3ITHA 3HP9A 1O1WA 1EXQA 2NUBA 4B8AB 1BL3A 3DLKA 4FLWA 3LP2A 2QXFA 3T19A 3AVNA 3V1RA 1RDDA 3LWLA 4JRPA 1D9DA 1WAJA 3SUNA 1JLCA 3RMAA 5KRTA 1Q9XA 3DRRA 2IOCA 2E6MA 3ZT0A 1NKEA 2PYLA 1VSFA 4OGEA 4E1MA 1KVBA 3S3MA 3P5JA 4EZ9A 3WNGA 4DTUA 3OVNA 4LY7A 3JSMA 2O4GA 3L8BA 3VQEA 1TKTA 1VSJA 1VRTA 4GMJB 3QIPA 4BE1A 3SYZA 4RW4A 2EHGA 1NKCA 1IO2A 4DU4A 3TABA 1JLFA 5J2NA 3AA2A 4NCGA 3AVLA 3L3VA 1TGOA 3SI6A 3PO5A 4FJ5A 1LWFA 3ZSVA 4F3TA 5C24A 3DRSA 1S6QA 2I5JA 3P83D 3H08A 4CJSA 4CHQA 4B3OA 5K14A 3OS0A 1JXBA 2GUIA 4DTJA 4KTQA 4CGGA 4CJVA 5DK5A 1QSYA 1BI4B 4CFCA 4CJTA 2W42A 4DU1A 2HHWA 4JRQA 4XIUA 3WNHA 3ZT2A 1A5WA 4ZHRA 1NK8A 4Y1CA 1BIZA 3VQ4A 3AO2A 3O4QA 4RW9A 3SUQA 4FJLA 3V9SA 3NDKA 3TAEA 1RTDA 2XY7A 3HP6A 3ZT1A 4CE9A 4DFKA 5J1EA 3HPHA 1J5OA 4DSLA 4HCCA 1X9WA 4Z4GA 1T03A 4B9NA 4F3OA 1WAFA 1JLGA 3OYMA 1KRPA 1VK0A 1W0HA 2FBXA 4F4KA 2DFHA 4ID1A 3ZT4A 3E01A 4CJUA 4CEZA 4KHYA 1G15A 3F73A 4R5PA 4M3TA 1A5XA 1CZ9A 2FBYA 1D9FA 4KI6A 4FJGA 4CIFA 2PY5A 4RW7A 2BDPA 3VN5A 4LD0A 3RWUA 1JLAA 5SZTA 3T3FA 4DF8A 3KKSA 4L8RB 3QINA 2G8KA 2X74A 3L2RA 1JLEA 4E7HA 1D5AA 2HHUA 2QKKA 1YT3A 1BCOA 4NYNA 1YTAA 1WSJA 4I2PA 3MECA 3QETA 4PQUA 1U47A 1HNIA 3VQ5A 1UA1A 1U45A 1SL2A 1ZBUA 3HJFA 2YNIA 3CM5A 1QSSA 2YV0X 2E4LA 4DTOA 1RT3A 3KJVA 2O4IA 4I2QA 2HNZA 1DTQA 2OPRA 3VQCA 4CHNA 4DTXA 4B9TA 3CM6A 3KK3A 3CG7A 3NF9A 3QNNA 2LSNA 3K59A 4BACA 3OYEA 4ZTFA 1S9EA 1VSIA 3FFIA 4MQ3A 3AVAA 4O5BA 4CFDA 2G8UA 4DWIA 1RT1A 3AVMA 2VWJA 1NK0A 2G8FA 4G1QA 1BQMA 3SNNA 1BCMA 2IGIA 1WSFA 1D8YA 3LP1A 1J9AA 3S9HA 2Z1GA 1NOZA 3DYAA 1IKYA 1RBVA 4C8NA 1NK6A 4PY5A 3ZSOA 1TK5A 2B6AA 5CYMA 1HYZA 1XHZA 1ASWA 1T7PA 3ZSYA 1ZYQA 4O0IA 1JXEA 4KB1A 5J2QA 1RTIA 2Q3SA 3LP3A 1QE1A 4DF4A 3SQ1A 1UAXA 2KFZA 2IAJA 3OY9A 4K8ZA 3KTQA 4CF1A 2P5GA 3QESA 4E7KA 2D0AA 4M3UA 4FXDA 3QEIA 5J2MA 5KGWA 4DSKA 4RG8A 3QEVA 4CJKA 1ZBLA 3OJUA 1LW0A 1VSHA 4FJ8A 2P51A 4F2SA 3DLRA 2HVHA 1T05A 1CXQA 2YNHA 3NH2A 4DQRA 1C0UA 1J53A 3AVKA 3LP0A 3DOKA 2IC3A 4NYFA 1FXXA 3HK2A 1RDCA 5J2PA 3L2QA 4FJ9A 3KLFA 3TI0A 3DMJA 1NJZA 5C42A 1S9GA 4TSXA 4N5SA 1NOYA 3AVGA 3OS1A 1DTTA 3K57A 1KVAA 2YKNA 4DLGA 3HVRA 2ZQBA 3IRXA 1CXUA 3AO5A 1VSMA 4BDZA 3AVJA 4FJIA 3VQDA 2JLEA 4RW8A 3VA0A 3S3NA 4O0JA 4KHQA 3KLIA 2X78A 1QS4A 3LPUA 4AHRA 3SV3A 1J54A 3QEXA 2DTUA 4E19A 1S1UA 4HUEA 1BISA 2JGUA 4CEEA 3PUFA 3HT3A 4OLAA 5JS2A 4FLVA 5I3UA 3I8DA 3A2FA 4FLXA 1KFDA 3NBPA 1S6PA 1S5JA 1RDBA 3OYCA 4DLEA 4FLUA 1QTMA 4FK0A 2HHVA 1HYVA 2ITGA 4CEAA 3NH0A 4FJNA 1ZBHA 3G10A 4CFBA 1NJXA 3MAQA 1Q9YA 1SV5A 4FM0A 2YKMA 4CCHA 1JKHA 3AVCA 1IKVA 3VA3A 4F8RA 3HXMA 3V6DA 4I9QA 4DTMA 1L3TA 1QQCA 2ATQA 3I0RA 4IG0A 3TAMA 3KIOA 4AHUA 1FKPA 1Y97A 4N47A 3LDSA 5HLFA 1R0AA 1NK9A 4KI4A 2XY8A 3ZSXA 3NAEA 3QEPA 4CIEA 2XY6A 4DSJA 4AHSA 1S1VA 4Z0UA 1K6YA 1TK0A 4OKKA 3OYNA 2QKBA 2ZE2A 2ETJA 1ASUA 4CJ3A 4BE2A 4KTZA 3HL8A 2F8SA 1UWBA 4FVMA 5I42A 2IDOA 3V9WA 3RMDA 3VQ8A 1HRHA 3O4NA 4BWMA 3RMCA 4OKEA 4ID5A 1RBUA 1X9MA 4KB0A 1C1BA 4FK4A 4W5RA 3SUPA 4CK1A 4CERA 1L5UA 4M3YA 4QOZB 4QAGA 3LAMA 1T8EA 4KV8A 3M8QA 2Y1IA 3KD5E 3KK2A 2GV9A 3TAGA 3EYZA 3KLHA 4C8KA 1VSDA 3SQ0A 3AVFA 4Z4EA 4IDKA 1RBRA 3RR7A 4DS4A 1RT6A 1FKOA 4UQGA 5HP1A 1EKEA 3TAFA 1NKBA 1TAUA 3IS9A 4DMNA 4FLTA 3RRGA 3TANA 3CFPA 1KVCA 1B9FA 2XHBA 1LWCA 1LAWA 4DTSA 3MXMA 1Z25A 3NF8A 3PO4A 3RR8A 1WSGA 4C8LA 3I0SA 3DRPA 4EZ6A 3AA5X 3SPYA 4GW6A 1B92A 1N6QA 4KHUA 3V9UA 3DI6A 1GOAA 1DLOA 4CJ5A 4E1NA 3KK1A 2PZSA 2VG5A 4W5TA 3K5NA 4CK3A 3K5LA 4BDPA 1FK9A 1JLBA 3DLBA 4PWDA 2Z1HA 3SUOA 1HQUA 3VQBA 5E41A 4Q0BA 3AA4A 3LAKA 2KZZA 4LH5A 3OYJA 4OPJA 5KTQA 3ZT3A 4FLYA 4DTNA 2OA8A 4ELUA 4CJPA 4OGCA 4PUOA 2D0CA 5FRNA 1JL2A 3LALA 3SPZA 4CHZA 1LAVA 1SUQA 3BDPA 5CY4A 1RDAA 3ZSWA 3PX4A 1LWEA 4O55A 3OJSA 1UA0A 3UIQA 3PY8A 4E0DA 3NHGA 2YNFA 1SKRA 3C6TA 4FM2A 4N41A 4BDYA 4MFBA 3ZSRA 3AV9A 3CFRA 1B9DA 1L3SA 3VQ9A 4CECA 2GBZA 3NGYA 2KZMA 4FYDA 2G8IA 3V1OA 3NF6A 1UOCA 1RTHA 1NK4A 4JS5A 3OS2A 3AVHA 4H4OA 1S1WA 4M3ZA 4CHPA 2OZSA 2OZMA 4YNQA 4N56A 4DQPA 4CJFA 4DTPA 4CEFA 2X6SA 4E89A 4FZZA 3ZCMA 3NH1A 1SKSA 2RKIA 4DFMA 4DTRA 3NCIA 2A1SA
chains in the Genus database with same CATH superfamily
5BPNA 1BA1A 3DOLA 4NXNK 3EO3A 5CE3A 5DMRA 4CGDA 2HHTA 3MXIA 3PLAA 1XC3A 2YNGA 1F21A 2BGGA 3QEWA 3BGRA 2A1RA 4ICLA 1TKXA 4CJQA 3TAPA 1ASVA 1HLUA 3NFAA 1RBTA 1C1CA 3A0IX 3DLGA 1WSHA 4R79A 1C1AA 3DM2A 1EO1A 2O8DA 1Q8IA 1EP4A 2YHXA 1QZ5A 3T1HK 2P9IA 1N8RO 2KFZA 3ZSZA 1KTQA 4Y1DA 1KFSA 1I3AA 2FBVA 3C95A 4M42A 3A5OC 1RFQA 3F2KA 2DFFA 5EY4A 5ADXH 3MXJA 1VQ5N 3D7EO 3O9UA 3RRHA 3WQTA 5GAGP 1XC9A 4AHCA 4FM1A 3PX6A 3MWPA 4KRFA 3DLEA 4FJKA 4M3RA 4IWVA 3LM2A 2P9SA 1IH7A 3U6FA 2QEXN 5KPRA 4CHYA 1SL0A 4JN4A 4HCBA 1OVYA 3P39A 3MMVA 1QQMA 2O8DB 1TK8A 3HVTA 2FSNA 5BPMA 4O44A 3M8SA 1NGEA 2P9IB 3WT0A 1N5YA 3JYTA 5GAEP 3ASMA 3VENA 1HPMA 4B9UA 4PKGA 2J4RA 4CF9A 4B9LA 3QNOA 3H3NO 5JS1A 4EP4A 3UKRA 3OYBA 1YF5L 1VQON 1MU2A 4GVMA 5DM7L 2YJEA 4LH4A 3H45C 1K8AO 2P9SB 1SL1A 3EZ5A 1M1KO 1RT4A 1KLNA 1XI1A 4IOAL 4H03B 2NRRA 1NGBA 1SKWA 4AHVA 3AA3A 3ZSQA 3SLCA 1XHXA 3CMEN 4DU3A 3PSIA 2Z1IA 3HBTA 2O8BB 2ZM6K 4EP5A 2WFBA 2OPPA 5T7BA 4X64K 5CZ1A 1RDUA 3G71N 1NJWA 3TU5A 1HYSA 2X6NA 4MDBA 3THVA 1T6DA 3F5TA 3O9RA 4B08A 1L3UA 4M41A 4K41A 3VQ7A 4DQSA 4ELVA 1EX4A 4H5NA 3RMBA 2VYPA 3VQPA 2GTDA 4CZLA 3KHYA 4E7LA 4LF6K 2F8TA 3EE9A 4C8MA 1M90O 3VMFB 4KHNA 4KHSA 3VQ6A 4CEBA 4MDAA 4WE1A 1JJ2M 2XRIA 3SQ2A 1WUAA 2A42A 3F9KA 3K2PA 5LJWA 3A5MC 2QTDA 4B1UB 3CI5A 3LANA 3QDKA 5C0YA 4FWKA 1H1VA 3IAYA 1RILA 3SAHA 3CQ8A 3V9XA 3I55N 5AQZA 2QXFA 1XMQK 3AVNA 3U9DA 2KKZA 3THXA 5KRTA 1Q9XA 3DRRA 1VQ4N 1NKEA 1XNQK 2QWNA 3S3MA 3P5JA 4DTUA 2O4GA 3L8BA 3VQEA 1VRTA 4HTLA 3SYZA 4RW4A 1IO2A 4A61A 5J2NA 3SI6A 4F3TA 1VAZA 5C24A 4CHQA 3P83D 3WXLA 5AR0A 4FWQA 5K14A 2GX9A 3OA9A 4KTQA 4BREA 1QQNA 4JRQA 3MK6A 4BVOA 3M5RA 5IWAK 4JI5K 3AO2A 3O4QA 3O8MA 4RW9A 3DLLL 3HP6A 4DUYK 4Z4GA 3OYMA 3E01A 3BZCA 4CEZA 4ISFA 3F73A 4R5PA 3CJAA 4M3TA 2UUAK 1QHAA 4FJGA 4CIFA 5BRDA 1IBLK 2EWSA 3RWUA 1JLAA 5TKYA 3AY9A 4L8RB 2NRVA 1JLEA 4BRAA 5AQYA 4NYNA 4I2PA 3CHWA 4IEIA 1FW6A 2DPNA 4PQUA 2CGJA 1UA1A 1ZBUA 1DT9A 5M1KA 3EE8A 1RT3A 3KJVA 4CZFA 4DTXA 4B9TA 1QQOA 3TTFA 2LSNA 5M1FA 3K59A 5B8HA 1VSIA 2HBLA 3AVAA 4MQ3A 2G8UA 1NK0A 3SNNA 1BCMA 2ZJQL 1D8YA 1WBBA 4IEEA 2Z1GA 1RBVA 4FSVA 2Q0UA 4ILJA 4PY5A 2QW9A 5CYMA 1ASWA 4BGAA 3CCMN 1ZYQA 3LDLA 4BC4A 3VEVA 4JHDA 2ZJRL 3LP3A 4DF4A 3SQ1A 1UAXA 4CF1A 1XQSC 3QEIA 5J2MA 3SBGA 3GE1A 4FVUA 1O13A 5BREA 4F2SA 3LP0A 4NYFA 4FJ9A 3L2QA 4NXMK 3TI0A 4AM6A 4TSXA 5GIOA 3AVGA 5C2DA 1U6ZA 1ATRA 3D2FA 3CPEA 3DAWA 1VSMA 2P9PA 3AVJA 5AQKA 2JLEA 4RW8A 3S3NA 3UKUB 4O0JA 2V52B 3FLCO 2X78A 2QWMA 4AHRA 3QEXA 2P9KA 4JK8A 1S1UA 4ISGA 1BISA 3WXIA 1VQ6N 3R9PA 3HT3A 1WBDA 3A2FA 4U67L 4AQYK 1QTMA 1VQNN 2HHVA 5AQFA 1V4TA 4JKEA 4F8RA 5EVZA 3PIPL 1QQCA 2ATQA 4WQ5C 4IG0A 2QWLA 4AHUA 4KHPK 4KI4A 3NAEA 3QEPA 1C0FA 1S1VA 2QKBA 2ZE2A 1ASUA 4BE2A 4GKJK 2F8SA 4CBUA 5KQDA 1VQPN 3RMDA 1N32K 2NZTA 3VQ8A 2P9PB 1X9MA 3ZEUA 4W5RA 2QI2A 4CK1A 4CERA 4QAGA 4RCHA 4UY8O 3KD5E 3TAGA 3MDQA 3SQ0A 4Z4EA 4DS4A 4UQGA 1EKEA 4FOEA 1TAUA 2E5LK 4DMNA 3O6WA 3TANA 1B9FA 1DGKN 4H0PA 1LAWA 1NLVA 2XHBA 2ASOA 3J81O 1N6QA 3AGKA 1B92A 3WQUA 4KHUA 2IVOA 1GLJO 4CJ5A 4E1NA 5KPZA 3K5LA 1JLBA 2NRXA 5I9EB 2Z1HA 2ASMA 1NBWA 4Q0BA 3AA4A 2V7ZA 3OYJA 2W40A 4OPJA 3ZT3A 4DTNA 1VQMN 4PL7A 1KAZA 4NO7A 1JL2A 2Q2RA 1IBMK 5BRFA 4H5VA 1LWEA 1UA0A 3PY8A 3E9OA 5AQXA 5LMNK 3NHGA 4CZIA 1SKRA 1VQLN 4BDYA 4N41A 3VEWA 1J5EK 4I6MA 3SK3A 4WQ4A 1XUPO 3HI0A 1IG8A 3VTHA 4CHPA 1LOTB 4CJFA 2X6SA 4PL8A 4E89A 4CD1A 4FWMA 1NJIO 3CJ1A 2RKIA 4ILHA 3ZX3A 4DTRA 3NCIA 4DFMA 1U2VA 3SQ4A 1JCFA 1TAQA 4FPBA 3L2WA 4NCAA 5EU7A 4W5OA 3ULEA 3QO9A 3K58A 1ITGA 4DV0K 4DB3A 2HHHK 4FJJA 3AVIA 4IFVA 2NRTA 5FLXO 1NK7A 3U4LA 1LW2A 3FGUA 4LF5K 1YJ9N 4CGJA 3PX0A 4FLZA 1QVGM 1NGGA 1ZBFA 2KFNA 3KLGA 2IVPA 2A5XA 2A41A 3C94A 1C6VA 4FWSA 3KWGA 2PYJA 2H3GX 1NJYA 3G0ZA 3EY1A 5AQQA 3L2VA 4BRPA 2UU9K 4Z94A 4JKGA 1S1TA 3ZETA 4KHWA 4PKIA 2B4JA 2FC0A 3C6UA 1BWFO 2PBDA 3VF6A 3HPOA 2Y1JA 1YJNN 3IDHA 4ISEA 4FL9A 2BTFA 1YAGA 3A8YA 4CFAA 3ULEB 4BRQA 1YTUA 3MEEA 3OYGA 5D3GA 2V7YA 3WXMB 3LDOA 3HRGA 1BUPA 4CJLA 4QS8A 4M3WA 1A5VA 1YVUA 5AQVA 4FK2A 1X1PA 3ATVA 1WSEA 3ALYA 3D45A 3LDNA 5AQSA 1W9HA 2BE2A 2A3ZA 3EZWA 5FDLA 1OKJA 5AQIA 5KRSA 4N76A 4H0OA 4LF7K 1IKXA 1WLJA 4PA1A 4A2AA 1HQEA 2KW4A 4FCYA 1T44A 1VSKA 2W6KA 3CJCA 1HKCA 4X62K 3CCUN 2RE2A 1GLAG 3B8AX 4HVJA 3NGIA 3RTVA 4CF2A 3CYMA 1RDWX 2XY5A 3ISNC 4CEDA 2G8WA 5AQUA 3H3OB 3QICA 1TUYA 3CIPA 1ZBIA 2CGLA 4J2EA 4BRFA 3O1BA 4KO0A 4C8OA 1RT2A 5BR9A 1U04A 1HNZK 4AILC 1JL1A 4BRKA 5CZ2A 2D4WA 1NMNA 5HRRA 3J7ZO 4CGHA 2KHOA 1TL1A 3CCVN 3OYHA 2CH5A 2YHYA 5CHIA 2E20A 2O8CA 2PAVA 3QLHA 4E3SA 4LF8K 3TSPA 1KLMA 3K9KA 4DSIA 1SS6A 1JCEA 1RT7A 4OX9K 4YDUC 4CESA 3VEOA 2HBJA 4DFJA 4CF8A 4DR2K 3WEEB 1CLQA 1RBSA 3RSEB 2D0OA 3CCLN 1EETA 2HW3A 4FWOA 5AQLA 1BIUA 1IKWA 1GOCA 4KFBA 3SV4A 1TKDA 4OPKA 4E7JA 5AQNA 3QMLA 3NMUA 1TV6A 1KCFA 4KTWA 4A59A 3MN7A 1VRUA 1EWQA 3VGMA 3AO1A 1TKZA 3DXKA 3K5OA 2E2NA 2OPSA 1LCUA 3V1QA 2O8CB 4DS5A 4M63C 4LF9K 1RTJA 3ITHA 1EXQA 1OH6A 1BL3A 3DLKA 5EX5A 3T19A 2E2PA 3V1RA 1RDDA 1YITN 1S22A 3SUNA 1JLCA 5EXWA 4HWIA 5BN9A 1S3XA 3ZT0A 1Z6RA 2ITMA 1VSFA 3JSMA 4DUZK 4GMJB 1VSJA 4GV9A 3P38A 3TABA 1HNWK 3AA2A 4NCGA 3AVLA 3L3VA 4BRIA 4WFAL 1S6QA 2I5JA 5MLCQ 4B3OA 4AM7A 4CGGA 5DK5A 4DU1A 4CFCA 3VERA 1NNEA 1T6CA 3H6EA 4Y1CA 1NK8A 3MN5A 1XMOK 3DXKB 1RTDA 3TAEA 2VCPA 4XEIA 5E26A 5AQWA 3HPHA 1KC8O 4OPAA 1JLGA 1VK0A 4EAHD 4ID1A 3CXCM 4KHYA 1G15A 1NU0A 1YUWA 2QWQA 2BDPA 3VN5A 5SZTA 3L2RA 5BR8K 3AAQA 1YT3A 3ZX2A 3MECA 1MWKA 3VQ5A 4B1ZA 1U45A 1SL2A 2F4VK 3NVKA 1I94K 3VGLA 2QWPA 4I2QA 2HNZA 2OPRA 3VQCA 4LC9B 2O4IA 3CG7A 1DKGD 3OYEA 4EIAA 5ADXA 4IZ9A 5GIPA 4O5BA 1RT1A 3AVMA 2VWJA 2G8FA 3H46O 2WTUA 2JWKA 1WSFA 3NVMA 4M7XA 3J7AP 1NOZA 2UUBK 3DYAA 1IKYA 2B6AA 1HYZA 3ZSYA 3SAFA 1YVNA 5J2QA 1RTIA 1QE1A 4DV2K 3UKRB 2IAJA 4E7KA 1BG3A 1SQKA 2VQEK 4DSKA 2QWRA 1KXPA 1LW0A 1VSHA 2P51A 4ILGB 4FJ8A 3KVGA 3DLRA 2HVHA 2YNHA 3NH2A 1J53A 3AVKA 4C1NI 2IC3A 3C0BA 4YOVA 5J2PA 3FZKA 5C42A 1NOYA 4PHTX 1KVAA 2YKNA 3HVRA 3AO5A 2BUPA 1K73O 3VQDA 4KHQA 3KLIA 1QS4A 1ZC6A 3SV3A 1J54A 3CJ7A 2QXLA 3D6RA 2ZWHA 2JGUA 1Q81O 4FLVA 3VPZA 1KFDA 3NBPA 1S5JA 3OYCA 4B3RK 3WUHA 3NH0A 3OTOK 2BH1A 4CFBA 1Q9YA 4CCHA 2YKMA 1JKHA 3AVCA 3U9ZA 4CZEA 4DTMA 4I9QA 1L3TA 3CCEN 3I0RA 3I56N 3KIOA 1R0AA 4N47A 2XY8A 3RVCA 2NLXA 4LFBK 4AHSA 2Q36A 2HF3A 4Z0UA 1K6YA 4CJ3A 2E1ZA 1NGJA 1Q18A 4BR2A 2IDOA 2AA4A 4DCHA 4OKEA 4ID5A 2VGMA 1JCGA 1G99A 1L5UA 3LAMA 3BY5A 3FZMA 1J6ZA 2VWBA 3CQXA 4BG9A 4IDKA 4F9OA 4BRCA 3RR7A 1RT6A 3F9MA 3TAFA 2GELA 3THXB 1K8KA 2FSJA 4DV6K 4IO9L 4DTSA 3MXMA 3RR8A 3NF8A 1DEJA 3AA5X 5AZIA 3V9UA 3DI6A 1GOAA 1BO5O 3KK1A 4JK7A 2VG5A 3KK7A 3K5NA 4CK3A 3A5LC 3DLBA 1HQUA 2WBNA 2KZZA 2OA8A 4CJPA 4CBXA 4OGCA 1Y64A 2D0CA 4CZHA 5FRNA 3ZYYX 1HUXA 4FWPA 1LAVA 4H5RA 4CHZA 5CY4A 4IOXA 3UIQA 3OJSA 4JI4K 5GINA 3AV9A 1L3SA 3BUZB 3VQ9A 3E9LA 4CECA 4BC5A 3NF6A 4BRHA 1NK4A 1K8KB 3AVHA 3H1QA 3A5NC 2OZSA 4DR6K 4YNQA 4IO8A 4DQPA 4WFNL 4FZZA 2QA4N 2A6AA 2IIRA 2A1SA 3OYFA 3SCXA 1YXQA 4CJ7A 3E1YA 2D0BA 3KZBA 2O8EA 4CF0A 5JLHA 4NLCA 3K5MA 2V51B 1TVRA 1N34K 3KD1E 5HRPA 3C7NA 4F2RA 4Z4FA 3CF5L 3R6MA 1VQ9N 3HYFA 4IG3A 2W41A 3M3ZA 4NB4A 5HROA 3HOTA 4FJHA 3R3LA 4NCBA 3Q7BA 5TKWA 3THWA 3K0SA 1LV5A 4J2DA 1TUUA 2WC9A 2GWJA 3M8PA 4JHDB 1NG9A 3CQYA 4CVNE 1HJRA 1HNXK 3AO4A 4BR7A 4CEQA 2XO7A 4B3MK 2DFEA 1BOTO 2VGNA 4B9VA 3U3YA 4JKHA 3CCRN 2Q1NA 3OYLA 4CIGA 1KSPA 2RF2A 3VF2A 2P1JA 2D5RA 5CYQA 3ZX0A 3TSUA 3C7NB 1NM1A 1HKBA 3VQAA 4YOXA 4O8KA 3D2FB 4YFUA 1GOBA 3UE5A 3Q7CA 5M1OA 4DSFA 5AQJA 4KKOA 5AQPA 4B9QA 3FE1A 5ELZA 3AGRA 1TYQA 4FW1A 4CHOA 2P9KB 4CJRA 3C6AA 4JI1K 4DR5K 5FRMA 2BANA 3V4IA 2HNYA 1RCHA 2W6LA 4H8KA 4JS4A 2HHQA 2HSTA 3OYAA 3MCAB 1XNRK 1NK5A 1Z26A 4Z4CA 3O3GA 4KPYA 3NE6A 2RPIA 3IG1A 4JAXA 1IG9A 2GWKA 4H0XB 3QBXA 2HB5A 1HNVA 1BHLA 5M1QA 4IJNA 2AP1A 3SMPA 1BQNA 2FXUA 4B1VA 4OLBA 4K8XA 2IVNA 2RN2A 3ZEUB 3J8AA 4DV7K 3AVBA 1K9MO 1TYQB 1VHXA 3HSTB 3E66A 2HHXA 1VSLA 3CPWM 5HRSA 3QBWA 4FJMA 2Z1JA 4KH4A 1Z05A 4B9SA 4GV3A 5AQRA 3ID6A 2F9WA 3M1FA 3R1XA 2HVIA 5FPEA 5H1SQ 4J2AA 3CERA 3WXJA 4DFPA 3QFUA 1U4BA 2AJQA 3TR8A 5AFUH 4HUGA 3WNEA 3P31A 2B5JA 3V81A 1EQYA 3VETA 4GY2B 1WNSA 3ID8A 4Z4IA 3B6PA 2O8FA 1HPZA 3H1VX 1U49A 4CJWA 1REVA 3L2UA 5C2FA 4DG1A 1E3MA 4IOCL 2OTLN 3BP8A 1VQ8N 4H5TA 3DLHA 1TL3A 3NGZA 3VTIA 2QK9A 4BRDA 3B6OA 4A57A 3LPTA 4H5WA 1KAXA 3ULDA 3QERA 2UXBK 4I6MB 2VG7A 4KAZA 4MLEA 4EFHA 4KBOA 1BI4A 1IJJA 4IDHA 4JLHA 2Q0RA 2FF6A 4CJ4A 2YHBA 1RT5A 3SJHA 4A5BA 2ZGYA 1U2VB 5GADP 3HTVA 5CR4A 2PFUA 2OPQA 4M7YA 2NNWA 3HSCA 2NUBA 4B8AB 4Y0WA 4FLWA 3LP2A 2YHWA 4JRPA 1D9DA 1WAJA 4QS7A 4GV6A 3TSQA 3RMAA 2HBMA 1KVBA 2HF4A 4EZ9A 3OVNA 3DXMA 5AQGA 1MDUB 1TKTA 4KH6A 2EHGA 4CZJA 3ZLJA 5AFUA 1LWFA 3ZSVA 3DRSA 4CJSA 4JI7K 1KD1O 3OS0A 4DTJA 2GUIA 4CJVA 1BI4B 4CJTA 2W42A 2HHWA 2JWLA 4XIUA 3WNHA 4JYAK 3ZT2A 4WQ5A 3CJBA 3FZFA 3O9QA 4FJLA 1YJWN 2XY7A 3ZT1A 4CE9A 4JKGB 3ZETB 1NGFA 4DFKA 1J5OA 2CGKA 4HCCA 1KRPA 3MWTA 3O4WA 2DFHA 3ZT4A 3AARA 2ZGZA 1A5XA 1D9FA 3G25A 3GOIA 1FJGK 5JVGL 1ESVA 4EHTA 1ZBSA 4DF8A 5E84A 3QINA 5JVHL 2G8KA 2HHUA 1D5AA 3P4IA 4CZKA 1D4XA 2YI1A 4KH5A 1IBKK 1U47A 2UYTA 3O9SA 3OBYA 2YNIA 3CM5A 3CMAN 1Q82O 1QSSA 1DTQA 4CHNA 4WFBL 3CM6A 3KK3A 5KQ8A 4BACA 3MN9A 3T69A 2FSKA 4DWIA 4CFDA 4DKWA 1GLCG 4BRNA 1BQMA 4YORA 3S9HA 4YOUA 4C8NA 2F7TA 1TK5A 4H0TB 4O0IA 3VOVA 4KB1A 3HM8A 1YHQN 4B3SK 4FWRA 2ASPA 3QESA 2OTJN 4CBWA 1HR0K 4FXDA 5KGWA 4RG8A 4L3QA 4BR9A 3LM9A 3TTDA 1CXQA 4DQRA 1N33K 1RDCA 4BGBA 3DMJA 1NJZA 1S9GA 3OS1A 1DTTA 3K57A 2ZQBA 4O8UA 3IRXA 1SAZA 3CC4N 4B1XB 4FWLA 5AQHA 3LPUA 2E1YA 3I33A 2DTUA 4DV1K 3CCQN 1CZAN 4JI6K 5JS2A 5BPLA 3I8DA 5I3UA 4JV5K 4E1JA 4BRMA 4FK0A 4FLUA 4DLEA 1HYVA 4FJNA 1ZBHA 1NJXA 3TTCA 4FM0A 3VGKA 3VA3A 1QVFM 4JI0K 1FKPA 1Y97A 5HLFA 1NK9A 2NRHA 4WF9L 4CIEA 3L0QA 4RWTA 4OKKA 2ETJA 5AQOA 2F9TA 1UWBA 1ATNA 3V9WA 1HRHA 3S41A 5A2QO 3RMCA 1RBUA 4BG8A 4KB0A 1C1BA 4FK4A 3SUPA 4QOZB 4KV8A 3M8QA 4WCEL 4FOIA 3KK2A 1NMDA 3EYZA 1VSDA 1WOQA 4B1YB 3EN9A 4BRGA 3PIOL 3CETA 1NKBA 4LFCK 3BF1A 3N4PA 1Q7YO 1BDGA 1LWCA 3BF3A 5GAHP 1ATSA 1Z25A 1WSGA 3DRPA 4EZ6A 2O8BA 3SPYA 3DJCA 3CCSN 3IFRA 2PZSA 3J80O 4W5TA 4IJAA 4BDPA 1FK9A 3SMSA 2GUPA 5E41A 3JS6A 2P9LA 2QWOA 2HOEA 4FLYA 1MA9B 4JKAA 1GLBG 4PUOA 4BY9C 1GLEG 4K43A 1SUQA 3BDPA 4QS9A 4E0DA 1P90A 3C6TA 3CFRA 4MLHA 1B9DA 3IMXA 5FPDA 3OHRA 3C65A 3NGYA 4FYDA 2G8IA 3V1OA 2Q31A 1UOCA 1RTHA 4DHYA 5LL6Z 3OS2A 3IKMA 2HMPA 4JKCA 4G9ZA 2OZMA 3NH1A 3D0PA 2UXDK 3TPQA 2DY4A 2E88A 3WNFA 3MX5A 3LZJA 3JXUA 4W5QA 4HTUA 2YCHA 4A2BA 4BR0A 3HZ6A 4FJXA 4LF4K 2P9LB 3MEDA 2UUCK 2E6LA 3C6HA 4B8CA 1OVQA 5LY3A 1RNHA 4MO5A 3CC7N 4JI3K 2I7NA 2WONA 1W7AA 1U48A 1L3VA 4IFYA 4CJEA 4FW2A 2G8VA 3KKRA 3EKSA 5KI6A 3L4IA 4BRLA 4YDUA 3LDPA 3VEZA 3OYIA 4LSNA 5KGXA 5BN8A 2E2QA 4CGIA 3PV8A 4E7IA 3R8EA 5HRNA 4B9MA 3HPGA 3CC2N 3HM9A 5KPTA 3AO3A 1C0TA 5M1NA 3V9ZA 4YY3K 4HHTA 2FBTA 4IXCA 5JICA 2G8HA 3NF7A 4JEPA 3SBTA 4JKDA 4BE0A 1W2BM 4KREA 3O3HA 3VF4A 3E9PA 5HBMA 3P1GA 1EWRA 4CGFA 1WN7A 5LJVA 4DQQA 1BU6O 2EX3A 3S3OA 3BZKA 5F0XA 1QHTA 3THYA 4JI8K 5LMUK 2E8AA 3VQQA 4Z4HA 3M6GA 4BQLA 3HOSA 4K42A 3SZ2A 1C0MA 2WOMA 4B1WB 3L4QA 2IS3A 3N4QA 2D1KA 4IBNA 2KTQA 3OBWA 4FZXC 4OVLA 3W0LA 1X9SA 2HHSA 1ZXOA 2NRZA 2I7PA 5C25A 2KQ2A 2CH6A 4CK2A 2YX6A 4JD2A 1XWLA 4HUFA 3CJ9A 4MO4A 4XH4A 2F96A 4BC3A 2ZD1A 4BWJA 4BC2A 4DR1K 1I39A 5JLFA 1Q86O 3LL3A 1JLQA 4WQ4C 3OYDA 2HMIA 4OKJA 3THYB 4M3XA 4K0KK 5C12A 3O3FA 4AHTA 1N36K 4CW7B 1GLFO 3QIOA 4DR4K 4Q5VA 4YOWA 3U3GA 3G4SN 4OJRA 3OYKA 4U7BA 4FJ7A 4DSEA 4IKFA 4CEOA 3M8RA 2R7YA 2HNDA 1VSEA 5AZIB 3TARA 1X3NA 1BA0A 3TWHA 3UKUA 4JD2B 4JK9A 3O1WA 4O5FA 2GEMA 3T1YK 2A40A 1QSLA 3WXKA 2YHAA 1NGHA 5FROA 3MEGA 3HO1A 1R59O 4ZTJA 4CD3A 1S1XA 4I9LA 1W97L 4AH9A 3KLEA 4QCLA 5HOOA 3I8BA 3QB0A 4DV4K 3O80A 3SJJA 2FLOA 3L3UA 2VWKA 3ATUA 4J2BA 4LSLA 1S72N 3EEQA 1CZBA 2WUSA 4FZYA 1HX1A 1WSIA 2ZF5O 3CCJN 4DR7K 3ENHA 4RW6A 1KAYA 1BGXT 2P9NA 1HMVA 1WB9A 4BVPA 1QZ6A 4I7FA 4M45A 2VG6A 3T1AA 5AQTA 1SKSA 4H4MA 4EHUA 3TAQA 2OYQA 3CFOA 1RGIA 4C23A 5SWMA 4W5NA 2P5OA 3LWMA 2ZJPL 4O4GA 3LZIA 4ELTA 4DQIA 4FO0A 2O8EB 4DQ8A 4V19S 2OANA 3HP9A 3T7ZA 1O1WA 5JMVA 4OO1J 3FZLA 3LWLA 1NGCA 5M1PA 2IOCA 2E6MA 2PYLA 4OGEA 4E1MA 3WNGA 4LY7A 3QIPA 4BE1A 3THWB 1NKCA 1E4FT 4DU4A 1JLFA 1YI2N 5AQMA 4K25A 1TGOA 2NRWA 3PO5A 4FJ5A 3G6EN 4GKKK 3H08A 1MWMA 1JXBA 4YOTA 2P9NB 2HBKA 4JNEA 1QSYA 4AF1A 5AJ3K 1A5WA 4ZHRA 4DV3K 1BIZA 3VQ4A 3SUQA 3V9SA 3NDKA 5AZJA 4FWNA 3BEXA 5J1EA 4DSLA 1ILYA 1X9WA 3GBTA 1T03A 4B9NA 4F3OA 2QM1A 1WAFA 1W0HA 2FBXA 4F4KA 4CI6A 1X3MA 5F2RA 4CJUA 3AAPA 1CZ9A 2FBYA 3JAMO 4KI6A 1VQ7N 2PY5A 4RW7A 1HKGA 4LD0A 3EL2A 2FF3B 3T3FA 3KKSA 2X74A 4E7HA 3O5BA 2QKKA 3GL1A 1BCOA 1YTAA 1WSJA 3QETA 1YIJN 1HNIA 4A5AA 3VESA 3L6QA 5HL7L 3HJFA 1T3VA 2YV0X 2E4LA 4DTOA 3CD6N 5FPNA 3FR0A 3NF9A 3VEYA 4JKFA 3QNNA 3PSFA 4ZTFA 4YOYA 4LFAK 3LDQA 1S9EA 3FFIA 5AZJB 4G1QA 5C10A 4JKBA 1GLDG 2IGIA 2YJFA 3LP1A 1J9AA 1HJOA 1NK6A 3ZSOA 3D2EA 1XHZA 1T7PA 1JXEA 2Q3SA 3MCPA 4YHHK 1IV0A 4NLBA 5BRHA 3OY9A 4K8ZA 3KTQA 4JI2K 2P5GA 2D0AA 4M3UA 3U8XA 3QEVA 5FPMA 2KLAA 4C1NK 1NGDA 4CJKA 3OJUA 1ZBLA 4CZGA 3K9JA 1T05A 1C0UA 3DOKA 1FXXA 2Q97A 3HK2A 4FPAA 3GDQA 4OPHA 3KLFA 3DWLA 4H0VB 4N5SA 1KQSM 5DM6L 2P9UA 3KWIA 4DLGA 3ENBA 1CXUA 2VQFK 4BDZA 2RHKA 2O8FB 4FJIA 3VA0A 3ENOA 3UB5A 3O08A 4GNIA 3D2EB 4E19A 4HUEA 4CZMA 4CEEA 3PUFA 4OLAA 4RTFD 2D0PA 4FLXA 1S6PA 1RDBA 4X66K 1OH7A 2ITGA 4CEAA 3G10A 1VQKN 3EKUA 3MAQA 5EOYA 1SV5A 1NGAA 1IKVA 4WYBA 3HXMA 3V6DA 1OH5A 1NWKA 3TAMA 3LDSA 3ZSXA 1V4SA 2XY6A 4DSJA 4BR4A 1TK0A 3OYNA 1OH8A 2P9UB 2E2OA 3HL8A 3MX2A 4KTZA 2UXCK 4FVMA 5I42A 3OW2M 2OCEA 1P8ZA 4BWMA 3O4NA 3W3DA 4XH1A 4M3YA 1T8EA 4BR5A 3J7YP 4PKHA 2Y1IA 2GV9A 4IFEA 3KLHA 3QFPA 4C8KA 3AVFA 5C15A 1RBRA 3O9TA 1FKOA 5HP1A 1GLLO 3FZHA 3IS9A 1NGIA 4FLTA 3RRGA 1X9JA 5IT9O 3CFPA 1KVCA 3GG4A 3FFKB 3DXMB 4GVEA 3PO4A 4DR3K 4C8LA 3I0SA 4H0YB 4GW6A 4DV5K 1DLOA 1SZ2A 4X65K 4PWDA 3SUOA 3VQBA 3LAKA 3MN6A 4LH5A 5KTQA 4ELUA 3LALA 3WEEA 3SPZA 3ZSWA 1RDAA 3VEXA 3PX4A 4O55A 3RSEA 4BQZA 4XH5A 2YNFA 4A62A 4FM2A 4MFBA 3ZSRA 2GBZA 2KZMA 3SAGA 3IUCA 1E4GT 4BROA 1C0GA 4JS5A 4H4OA 1S1WA 4M3ZA 4N56A 4B3TK 5F1XA 4J8FA 4DTPA 4CEFA 3ZCMA
chains in the Genus database with same CATH topology
3OYFA 2DY4A 3SCXA 3WNFA 3SQ4A 3DOLA 2D0BA 3LZJA 4W5QA 4HTUA 4CF0A 1TAQA 4FJXA 3L2WA 5DMRA 4NCAA 3K5MA 3MEDA 1TVRA 5EU7A 3KD1E 4CGDA 5HRPA 4W5OA 2E6LA 4F2RA 4B8CA 4Z4FA 2HHTA 3QO9A 1RNHA 3K58A 3MXIA 1ITGA 3HYFA 2YNGA 4IG3A 1F21A 2WONA 4FJJA 1U48A 1L3VA 3QEWA 2BGGA 4IFYA 3AVIA 3BGRA 4IFVA 4CJEA 5HROA 2A1RA 4FW2A 4ICLA 1TKXA 1NK7A 4FJHA 1LW2A 4NCBA 1LV5A 2G8VA 4CGJA 4J2DA 3PX0A 4CJQA 4FLZA 3TAPA 3KKRA 3M8PA 5KI6A 1ASVA 3NFAA 1ZBFA 2KFNA 1RBTA 3KLGA 1C1CA 3OYIA 3DLGA 1WSHA 4LSNA 3C94A 1C1AA 1C6VA 1HJRA 3DM2A 5KGXA 3AO4A 1Q8IA 1EP4A 4CGIA 2PYJA 3PV8A 4CEQA 4E7IA 5HRNA 1NJYA 4B9MA 2XO7A 3G0ZA 3HPGA 3EY1A 3HM9A 3AO3A 2DFEA 3L2VA 1C0TA 3V9ZA 4B9VA 3ZSZA 4HHTA 1KTQA 4Y1DA 3U3YA 1S1TA 1KFSA 4KHWA 1I3AA 3OYLA 2FBVA 2FBTA 4CIGA 3C95A 1KSPA 4M42A 2B4JA 2G8HA 2RF2A 2FC0A 3NF7A 3C6UA 2Y1JA 3HPOA 2DFFA 2P1JA 2D5RA 5CYQA 3MXJA 4CFAA 4BE0A 4KREA 3O3HA 3RRHA 1YTUA 3MEEA 3VQAA 5HBMA 3OYGA 3P1GA 1XC9A 4YFUA 5D3GA 1GOBA 4CJLA 4CGFA 4AHCA 1WN7A 4FM1A 3PX6A 4DQQA 4KRFA 4DSFA 4M3WA 1A5VA 1YVUA 3DLEA 4KKOA 2EX3A 3S3OA 4FJKA 4M3RA 1QHTA 4FK2A 1X1PA 4FW1A 1WSEA 4CHOA 4CJRA 3ALYA 3VQQA 1IH7A 5FRMA 4Z4HA 2BANA 3U6FA 2HNYA 1RCHA 3D45A 3V4IA 4CHYA 3SZ2A 1C0MA 1W9HA 2BE2A 2WOMA 5FDLA 4H8KA 4JS4A 2IS3A 1SL0A 2HHQA 4HCBA 4IBNA 5KRSA 1TK8A 4N76A 3HVTA 1IKXA 2KTQA 1WLJA 4FZXC 4OVLA 4PA1A 4O44A 3OYAA 1HQEA 2KW4A 3M8SA 4FCYA 1X9SA 2HHSA 1NK5A 1Z26A 4Z4CA 3O3GA 1N5YA 4KPYA 3JYTA 3NE6A 5C25A 1VSKA 2KQ2A 2RPIA 3IG1A 4CK2A 3ASMA 1IG9A 4B9UA 1XWLA 4HUFA 2HB5A 1HNVA 1BHLA 4CF9A 2F96A 4HVJA 2ZD1A 1BQNA 4BWJA 4B9LA 1I39A 3QNOA 3NGIA 3RTVA 4CF2A 5JS1A 4EP4A 4OLBA 1JLQA 3CYMA 3OYBA 2XY5A 4K8XA 3OYDA 1MU2A 4GVMA 2RN2A 3ISNC 4CEDA 2HMIA 2G8WA 4OKJA 4LH4A 3AVBA 4M3XA 3O3FA 3HSTB 4AHTA 1ZBIA 4J2EA 2HHXA 1VSLA 5HRSA 1SL1A 3QIOA 3EZ5A 4KO0A 2Z1JA 4C8OA 1RT4A 4FJMA 1RT2A 1KLNA 1U04A 1XI1A 4B9SA 4AILC 4Q5VA 1JL1A 1SKWA 4AHVA 3AA3A 5CZ2A 2HVIA 3ZSQA 3U3GA 4J2AA 4OJRA 3OYKA 4DFPA 1U4BA 2AJQA 3TR8A 1XHXA 4FJ7A 4HUGA 3WNEA 4DSEA 4DU3A 4IKFA 2B5JA 3V81A 5HRRA 2Z1IA 4CEOA 1WNSA 3M8RA 4CGHA 2R7YA 2HNDA 1TL1A 1VSEA 3B6PA 4Z4IA 4EP5A 3TARA 3TWHA 1HPZA 3OYHA 1U49A 4CJWA 2OPPA 5T7BA 5CZ1A 1REVA 3L2UA 1QSLA 3D0PA 1NJWA 3QLHA 2YHAA 4DG1A 4E3SA 1HYSA 2X6NA 5FROA 3MEGA 3THVA 3HO1A 1KLMA 4ZTJA 4DSIA 1S1XA 1RT7A 4I9LA 4B08A 1TL3A 1L3UA 3DLHA 4CESA 4AH9A 3NGZA 4M41A 4DFJA 4CF8A 2QK9A 3KLEA 3VQ7A 4DQSA 3B6OA 4ELVA 4QCLA 1CLQA 1EX4A 3RMBA 3VQPA 1RBSA 3LPTA 3SJJA 3L3UA 2VWKA 4J2BA 4LSLA 1EETA 4E7LA 3ULDA 2HW3A 1CZBA 3QERA 1BIUA 4FZYA 1IKWA 2VG7A 1GOCA 4KFBA 3SV4A 1WSIA 4KAZA 2F8TA 4C8MA 4KHNA 4KHSA 1TKDA 4RW6A 4OPKA 4E7JA 1BGXT 1HMVA 1BI4A 3VQ6A 4JLHA 1TV6A 1KCFA 2VG6A 4I7FA 4KTWA 4M45A 4WE1A 1VRUA 2XRIA 4H4MA 3T1AA 4CEBA 3SQ2A 3TAQA 3F9KA 4CJ4A 2OYQA 3CFOA 3K2PA 5SWMA 3AO1A 1TKZA 2YHBA 1RT5A 2P5OA 4W5NA 3LWMA 3LANA 4O4GA 3K5OA 3LZIA 2OPSA 4ELTA 4DQIA 3V1QA 3IAYA 1RILA 3CQ8A 4DS5A 2OPQA 3V9XA 1RTJA 3ITHA 3HP9A 1O1WA 1EXQA 2NUBA 4B8AB 1BL3A 3DLKA 4FLWA 3LP2A 2QXFA 3T19A 3AVNA 3V1RA 1RDDA 3LWLA 4JRPA 1D9DA 1WAJA 3SUNA 1JLCA 3RMAA 5KRTA 1Q9XA 3DRRA 2IOCA 2E6MA 3ZT0A 1NKEA 2PYLA 1VSFA 4OGEA 4E1MA 1KVBA 3S3MA 3P5JA 4EZ9A 3WNGA 4DTUA 3OVNA 4LY7A 3JSMA 2O4GA 3L8BA 3VQEA 1TKTA 1VSJA 1VRTA 4GMJB 3QIPA 4BE1A 3SYZA 4RW4A 2EHGA 1NKCA 1IO2A 4DU4A 3TABA 1JLFA 5J2NA 3AA2A 4NCGA 3AVLA 3L3VA 1TGOA 3SI6A 3PO5A 4FJ5A 1LWFA 3ZSVA 4F3TA 5C24A 3DRSA 1S6QA 2I5JA 3P83D 3H08A 4CJSA 4CHQA 4B3OA 5K14A 3OS0A 1JXBA 2GUIA 4DTJA 4KTQA 4CGGA 4CJVA 5DK5A 1QSYA 1BI4B 4CFCA 4CJTA 2W42A 4DU1A 2HHWA 4JRQA 4XIUA 3WNHA 3ZT2A 1A5WA 4ZHRA 1NK8A 4Y1CA 1BIZA 3VQ4A 3AO2A 3O4QA 4RW9A 3SUQA 4FJLA 3V9SA 3NDKA 3TAEA 1RTDA 2XY7A 3HP6A 3ZT1A 4CE9A 4DFKA 5J1EA 3HPHA 1J5OA 4DSLA 4HCCA 1X9WA 4Z4GA 1T03A 4B9NA 4F3OA 1WAFA 1JLGA 3OYMA 1KRPA 1VK0A 1W0HA 2FBXA 4F4KA 2DFHA 4ID1A 3ZT4A 3E01A 4CJUA 4CEZA 4KHYA 1G15A 3F73A 4R5PA 4M3TA 1A5XA 1CZ9A 2FBYA 1D9FA 4KI6A 4FJGA 4CIFA 2PY5A 4RW7A 2BDPA 3VN5A 4LD0A 3RWUA 1JLAA 5SZTA 3T3FA 4DF8A 3KKSA 4L8RB 3QINA 2G8KA 2X74A 3L2RA 1JLEA 4E7HA 1D5AA 2HHUA 2QKKA 1YT3A 1BCOA 4NYNA 1YTAA 1WSJA 4I2PA 3MECA 3QETA 4PQUA 1U47A 1HNIA 3VQ5A 1UA1A 1U45A 1SL2A 1ZBUA 3HJFA 2YNIA 3CM5A 1QSSA 2YV0X 2E4LA 4DTOA 1RT3A 3KJVA 2O4IA 4I2QA 2HNZA 1DTQA 2OPRA 3VQCA 4CHNA 4DTXA 4B9TA 3CM6A 3KK3A 3CG7A 3NF9A 3QNNA 2LSNA 3K59A 4BACA 3OYEA 4ZTFA 1S9EA 1VSIA 3FFIA 4MQ3A 3AVAA 4O5BA 4CFDA 2G8UA 4DWIA 1RT1A 3AVMA 2VWJA 1NK0A 2G8FA 4G1QA 1BQMA 3SNNA 1BCMA 2IGIA 1WSFA 1D8YA 3LP1A 1J9AA 3S9HA 2Z1GA 1NOZA 3DYAA 1IKYA 1RBVA 4C8NA 1NK6A 4PY5A 3ZSOA 1TK5A 2B6AA 5CYMA 1HYZA 1XHZA 1ASWA 1T7PA 3ZSYA 1ZYQA 4O0IA 1JXEA 4KB1A 5J2QA 1RTIA 2Q3SA 3LP3A 1QE1A 4DF4A 3SQ1A 1UAXA 2KFZA 2IAJA 3OY9A 4K8ZA 3KTQA 4CF1A 2P5GA 3QESA 4E7KA 2D0AA 4M3UA 4FXDA 3QEIA 5J2MA 5KGWA 4DSKA 4RG8A 3QEVA 4CJKA 1ZBLA 3OJUA 1LW0A 1VSHA 4FJ8A 2P51A 4F2SA 3DLRA 2HVHA 1T05A 1CXQA 2YNHA 3NH2A 4DQRA 1C0UA 1J53A 3AVKA 3LP0A 3DOKA 2IC3A 4NYFA 1FXXA 3HK2A 1RDCA 5J2PA 3L2QA 4FJ9A 3KLFA 3TI0A 3DMJA 1NJZA 5C42A 1S9GA 4TSXA 4N5SA 1NOYA 3AVGA 3OS1A 1DTTA 3K57A 1KVAA 2YKNA 4DLGA 3HVRA 2ZQBA 3IRXA 1CXUA 3AO5A 1VSMA 4BDZA 3AVJA 4FJIA 3VQDA 2JLEA 4RW8A 3VA0A 3S3NA 4O0JA 4KHQA 3KLIA 2X78A 1QS4A 3LPUA 4AHRA 3SV3A 1J54A 3QEXA 2DTUA 4E19A 1S1UA 4HUEA 1BISA 2JGUA 4CEEA 3PUFA 3HT3A 4OLAA 5JS2A 4FLVA 5I3UA 3I8DA 3A2FA 4FLXA 1KFDA 3NBPA 1S6PA 1S5JA 1RDBA 3OYCA 4DLEA 4FLUA 1QTMA 4FK0A 2HHVA 1HYVA 2ITGA 4CEAA 3NH0A 4FJNA 1ZBHA 3G10A 4CFBA 1NJXA 3MAQA 1Q9YA 1SV5A 4FM0A 2YKMA 4CCHA 1JKHA 3AVCA 1IKVA 3VA3A 4F8RA 3HXMA 3V6DA 4I9QA 4DTMA 1L3TA 1QQCA 2ATQA 3I0RA 4IG0A 3TAMA 3KIOA 4AHUA 1FKPA 1Y97A 4N47A 3LDSA 5HLFA 1R0AA 1NK9A 4KI4A 2XY8A 3ZSXA 3NAEA 3QEPA 4CIEA 2XY6A 4DSJA 4AHSA 1S1VA 4Z0UA 1K6YA 1TK0A 4OKKA 3OYNA 2QKBA 2ZE2A 2ETJA 1ASUA 4CJ3A 4BE2A 4KTZA 3HL8A 2F8SA 1UWBA 4FVMA 5I42A 2IDOA 3V9WA 3RMDA 3VQ8A 1HRHA 3O4NA 4BWMA 3RMCA 4OKEA 4ID5A 1RBUA 1X9MA 4KB0A 1C1BA 4FK4A 4W5RA 3SUPA 4CK1A 4CERA 1L5UA 4M3YA 4QOZB 4QAGA 3LAMA 1T8EA 4KV8A 3M8QA 2Y1IA 3KD5E 3KK2A 2GV9A 3TAGA 3EYZA 3KLHA 4C8KA 1VSDA 3SQ0A 3AVFA 4Z4EA 4IDKA 1RBRA 3RR7A 4DS4A 1RT6A 1FKOA 4UQGA 5HP1A 1EKEA 3TAFA 1NKBA 1TAUA 3IS9A 4DMNA 4FLTA 3RRGA 3TANA 3CFPA 1KVCA 1B9FA 2XHBA 1LWCA 1LAWA 4DTSA 3MXMA 1Z25A 3NF8A 3PO4A 3RR8A 1WSGA 4C8LA 3I0SA 3DRPA 4EZ6A 3AA5X 3SPYA 4GW6A 1B92A 1N6QA 4KHUA 3V9UA 3DI6A 1GOAA 1DLOA 4CJ5A 4E1NA 3KK1A 2PZSA 2VG5A 4W5TA 3K5NA 4CK3A 3K5LA 4BDPA 1FK9A 1JLBA 3DLBA 4PWDA 2Z1HA 3SUOA 1HQUA 3VQBA 5E41A 4Q0BA 3AA4A 3LAKA 2KZZA 4LH5A 3OYJA 4OPJA 5KTQA 3ZT3A 4FLYA 4DTNA 2OA8A 4ELUA 4CJPA 4OGCA 4PUOA 2D0CA 5FRNA 1JL2A 3LALA 3SPZA 4CHZA 1LAVA 1SUQA 3BDPA 5CY4A 1RDAA 3ZSWA 3PX4A 1LWEA 4O55A 3OJSA 1UA0A 3UIQA 3PY8A 4E0DA 3NHGA 2YNFA 1SKRA 3C6TA 4FM2A 4N41A 4BDYA 4MFBA 3ZSRA 3AV9A 3CFRA 1B9DA 1L3SA 3VQ9A 4CECA 2GBZA 3NGYA 2KZMA 4FYDA 2G8IA 3V1OA 3NF6A 1UOCA 1RTHA 1NK4A 4JS5A 3OS2A 3AVHA 4H4OA 1S1WA 4M3ZA 4CHPA 2OZSA 2OZMA 4YNQA 4N56A 4DQPA 4CJFA 4DTPA 4CEFA 2X6SA 4E89A 4FZZA 3ZCMA 3NH1A 1SKSA 2RKIA 4DFMA 4DTRA 3NCIA 2A1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYF A;  2DY4 A;  3SCX A;  3WNF A;  3SQ4 A;  3DOL A;  2D0B A;  3LZJ A;  4W5Q A;  4HTU A;  4CF0 A;  1TAQ A;  4FJX A;  3L2W A;  5DMR A;  4NCA A;  3K5M A;  3MED A;  1TVR A;  5EU7 A;  3KD1 E;  4CGD A;  5HRP A;  4W5O A;  2E6L A;  4F2R A;  4B8C A;  4Z4F A;  2HHT A;  3QO9 A;  1RNH A;  3K58 A;  3MXI A;  1ITG A;  3HYF A;  2YNG A;  4IG3 A;  1F21 A;  2WON A;  4FJJ A;  1U48 A;  1L3V A;  3QEW A;  2BGG A;  4IFY A;  3AVI A;  3BGR A;  4IFV A;  4CJE A;  5HRO A;  2A1R A;  4FW2 A;  4ICL A;  1TKX A;  1NK7 A;  4FJH A;  1LW2 A;  4NCB A;  1LV5 A;  2G8V A;  4CGJ A;  4J2D A;  3PX0 A;  4CJQ A;  4FLZ A;  3TAP A;  3KKR A;  3M8P A;  5KI6 A;  1ASV A;  3NFA A;  1ZBF A;  2KFN A;  1RBT A;  3KLG A;  1C1C A;  3OYI A;  3DLG A;  1WSH A;  4LSN A;  3C94 A;  1C1A A;  1C6V A;  1HJR A;  3DM2 A;  5KGX A;  3AO4 A;  1Q8I A;  1EP4 A;  4CGI A;  2PYJ A;  3PV8 A;  4CEQ A;  4E7I A;  5HRN A;  1NJY A;  4B9M A;  2XO7 A;  3G0Z A;  3HPG A;  3EY1 A;  3HM9 A;  3AO3 A;  2DFE A;  3L2V A;  1C0T A;  3V9Z A;  4B9V A;  3ZSZ A;  4HHT A;  1KTQ A;  4Y1D A;  3U3Y A;  1S1T A;  1KFS A;  4KHW A;  1I3A A;  3OYL A;  2FBV A;  2FBT A;  4CIG A;  3C95 A;  1KSP A;  4M42 A;  2B4J A;  2G8H A;  2RF2 A;  2FC0 A;  3NF7 A;  3C6U A;  2Y1J A;  3HPO A;  2DFF A;  2P1J A;  2D5R A;  5CYQ A;  3MXJ A;  4CFA A;  4BE0 A;  4KRE A;  3O3H A;  3RRH A;  1YTU A;  3MEE A;  3VQA A;  5HBM A;  3OYG A;  3P1G A;  1XC9 A;  4YFU A;  5D3G A;  1GOB A;  4CJL A;  4CGF A;  4AHC A;  1WN7 A;  4FM1 A;  3PX6 A;  4DQQ A;  4KRF A;  4DSF A;  4M3W A;  1A5V A;  1YVU A;  3DLE A;  4KKO A;  2EX3 A;  3S3O A;  4FJK A;  4M3R A;  1QHT A;  4FK2 A;  1X1P A;  4FW1 A;  1WSE A;  4CHO A;  4CJR A;  3ALY A;  3VQQ A;  1IH7 A;  5FRM A;  4Z4H A;  2BAN A;  3U6F A;  2HNY A;  1RCH A;  3D45 A;  3V4I A;  4CHY A;  3SZ2 A;  1C0M A;  1W9H A;  2BE2 A;  2WOM A;  5FDL A;  4H8K A;  4JS4 A;  2IS3 A;  1SL0 A;  2HHQ A;  4HCB A;  4IBN A;  5KRS A;  1TK8 A;  4N76 A;  3HVT A;  1IKX A;  2KTQ A;  1WLJ A;  4FZX C;  4OVL A;  4PA1 A;  4O44 A;  3OYA A;  1HQE A;  2KW4 A;  3M8S A;  4FCY A;  1X9S A;  2HHS A;  1NK5 A;  1Z26 A;  4Z4C A;  3O3G A;  1N5Y A;  4KPY A;  3JYT A;  3NE6 A;  5C25 A;  1VSK A;  2KQ2 A;  2RPI A;  3IG1 A;  4CK2 A;  3ASM A;  1IG9 A;  4B9U A;  1XWL A;  4HUF A;  2HB5 A;  1HNV A;  1BHL A;  4CF9 A;  2F96 A;  4HVJ A;  2ZD1 A;  1BQN A;  4BWJ A;  4B9L A;  1I39 A;  3QNO A;  3NGI A;  3RTV A;  4CF2 A;  5JS1 A;  4EP4 A;  4OLB A;  1JLQ A;  3CYM A;  3OYB A;  2XY5 A;  4K8X A;  3OYD A;  1MU2 A;  4GVM A;  2RN2 A;  3ISN C;  4CED A;  2HMI A;  2G8W A;  4OKJ A;  4LH4 A;  3AVB A;  4M3X A;  3O3F A;  3HST B;  4AHT A;  1ZBI A;  4J2E A;  2HHX A;  1VSL A;  5HRS A;  1SL1 A;  3QIO A;  3EZ5 A;  4KO0 A;  2Z1J A;  4C8O A;  1RT4 A;  4FJM A;  1RT2 A;  1KLN A;  1U04 A;  1XI1 A;  4B9S A;  4AIL C;  4Q5V A;  1JL1 A;  1SKW A;  4AHV A;  3AA3 A;  5CZ2 A;  2HVI A;  3ZSQ A;  3U3G A;  4J2A A;  4OJR A;  3OYK A;  4DFP A;  1U4B A;  2AJQ A;  3TR8 A;  1XHX A;  4FJ7 A;  4HUG A;  3WNE A;  4DSE A;  4DU3 A;  4IKF A;  2B5J A;  3V81 A;  5HRR A;  2Z1I A;  4CEO A;  1WNS A;  3M8R A;  4CGH A;  2R7Y A;  2HND A;  1TL1 A;  1VSE A;  3B6P A;  4Z4I A;  4EP5 A;  3TAR A;  3TWH A;  1HPZ A;  3OYH A;  1U49 A;  4CJW A;  2OPP A;  5T7B A;  5CZ1 A;  1REV A;  3L2U A;  1QSL A;  3D0P A;  1NJW A;  3QLH A;  2YHA A;  4DG1 A;  4E3S A;  1HYS A;  2X6N A;  5FRO A;  3MEG A;  3THV A;  3HO1 A;  1KLM A;  4ZTJ A;  4DSI A;  1S1X A;  1RT7 A;  4I9L A;  4B08 A;  1TL3 A;  1L3U A;  3DLH A;  4CES A;  4AH9 A;  3NGZ A;  4M41 A;  4DFJ A;  4CF8 A;  2QK9 A;  3KLE A;  3VQ7 A;  4DQS A;  3B6O A;  4ELV A;  4QCL A;  1CLQ A;  1EX4 A;  3RMB A;  3VQP A;  1RBS A;  3LPT A;  3SJJ A;  3L3U A;  2VWK A;  4J2B A;  4LSL A;  1EET A;  4E7L A;  3ULD A;  2HW3 A;  1CZB A;  3QER A;  1BIU A;  4FZY A;  1IKW A;  2VG7 A;  1GOC A;  4KFB A;  3SV4 A;  1WSI A;  4KAZ A;  2F8T A;  4C8M A;  4KHN A;  4KHS A;  1TKD A;  4RW6 A;  4OPK A;  4E7J A;  1BGX T;  1HMV A;  1BI4 A;  3VQ6 A;  4JLH A;  1TV6 A;  1KCF A;  2VG6 A;  4I7F A;  4KTW A;  4M45 A;  4WE1 A;  1VRU A;  2XRI A;  4H4M A;  3T1A A;  4CEB A;  3SQ2 A;  3TAQ A;  3F9K A;  4CJ4 A;  2OYQ A;  3CFO A;  3K2P A;  5SWM A;  3AO1 A;  1TKZ A;  2YHB A;  1RT5 A;  2P5O A;  4W5N A;  3LWM A;  3LAN A;  4O4G A;  3K5O A;  3LZI A;  2OPS A;  4ELT A;  4DQI A;  3V1Q A;  3IAY A;  1RIL A;  3CQ8 A;  4DS5 A;  2OPQ A;  3V9X A;  1RTJ A;  3ITH A;  3HP9 A;  1O1W A;  1EXQ A;  2NUB A;  4B8A B;  1BL3 A;  3DLK A;  4FLW A;  3LP2 A;  2QXF A;  3T19 A;  3AVN A;  3V1R A;  1RDD A;  3LWL A;  4JRP A;  1D9D A;  1WAJ A;  3SUN A;  1JLC A;  3RMA A;  5KRT A;  1Q9X A;  3DRR A;  2IOC A;  2E6M A;  3ZT0 A;  1NKE A;  2PYL A;  1VSF A;  4OGE A;  4E1M A;  1KVB A;  3S3M A;  3P5J A;  4EZ9 A;  3WNG A;  4DTU A;  3OVN A;  4LY7 A;  3JSM A;  2O4G A;  3L8B A;  3VQE A;  1TKT A;  1VSJ A;  1VRT A;  4GMJ B;  3QIP A;  4BE1 A;  3SYZ A;  4RW4 A;  2EHG A;  1NKC A;  1IO2 A;  4DU4 A;  3TAB A;  1JLF A;  5J2N A;  3AA2 A;  4NCG A;  3AVL A;  3L3V A;  1TGO A;  3SI6 A;  3PO5 A;  4FJ5 A;  1LWF A;  3ZSV A;  4F3T A;  5C24 A;  3DRS A;  1S6Q A;  2I5J A;  3P83 D;  3H08 A;  4CJS A;  4CHQ A;  4B3O A;  5K14 A;  3OS0 A;  1JXB A;  2GUI A;  4DTJ A;  4KTQ A;  4CGG A;  4CJV A;  5DK5 A;  1QSY A;  1BI4 B;  4CFC A;  4CJT A;  2W42 A;  4DU1 A;  2HHW A;  4JRQ A;  4XIU A;  3WNH A;  3ZT2 A;  1A5W A;  4ZHR A;  1NK8 A;  4Y1C A;  1BIZ A;  3VQ4 A;  3AO2 A;  3O4Q A;  4RW9 A;  3SUQ A;  4FJL A;  3V9S A;  3NDK A;  3TAE A;  1RTD A;  2XY7 A;  3HP6 A;  3ZT1 A;  4CE9 A;  4DFK A;  5J1E A;  3HPH A;  1J5O A;  4DSL A;  4HCC A;  1X9W A;  4Z4G A;  1T03 A;  4B9N A;  4F3O A;  1WAF A;  1JLG A;  3OYM A;  1KRP A;  1VK0 A;  1W0H A;  2FBX A;  4F4K A;  2DFH A;  4ID1 A;  3ZT4 A;  3E01 A;  4CJU A;  4CEZ A;  4KHY A;  1G15 A;  3F73 A;  4R5P A;  4M3T A;  1A5X A;  1CZ9 A;  2FBY A;  1D9F A;  4KI6 A;  4FJG A;  4CIF A;  2PY5 A;  4RW7 A;  2BDP A;  3VN5 A;  4LD0 A;  3RWU A;  1JLA A;  5SZT A;  3T3F A;  4DF8 A;  3KKS A;  4L8R B;  3QIN A;  2G8K A;  2X74 A;  3L2R A;  1JLE A;  4E7H A;  1D5A A;  2HHU A;  2QKK A;  1YT3 A;  1BCO A;  4NYN A;  1YTA A;  1WSJ A;  4I2P A;  3MEC A;  3QET A;  4PQU A;  1U47 A;  1HNI A;  3VQ5 A;  1UA1 A;  1U45 A;  1SL2 A;  1ZBU A;  3HJF A;  2YNI A;  3CM5 A;  1QSS A;  2YV0 X;  2E4L A;  4DTO A;  1RT3 A;  3KJV A;  2O4I A;  4I2Q A;  2HNZ A;  1DTQ A;  2OPR A;  3VQC A;  4CHN A;  4DTX A;  4B9T A;  3CM6 A;  3KK3 A;  3CG7 A;  3NF9 A;  3QNN A;  2LSN A;  3K59 A;  4BAC A;  3OYE A;  4ZTF A;  1S9E A;  1VSI A;  3FFI A;  4MQ3 A;  3AVA A;  4O5B A;  4CFD A;  2G8U A;  4DWI A;  1RT1 A;  3AVM A;  2VWJ A;  1NK0 A;  2G8F A;  4G1Q A;  1BQM A;  3SNN A;  1BCM A;  2IGI A;  1WSF A;  1D8Y A;  3LP1 A;  1J9A A;  3S9H A;  2Z1G A;  1NOZ A;  3DYA A;  1IKY A;  1RBV A;  4C8N A;  1NK6 A;  4PY5 A;  3ZSO A;  1TK5 A;  2B6A A;  5CYM A;  1HYZ A;  1XHZ A;  1ASW A;  1T7P A;  3ZSY A;  1ZYQ A;  4O0I A;  1JXE A;  4KB1 A;  5J2Q A;  1RTI A;  2Q3S A;  3LP3 A;  1QE1 A;  4DF4 A;  3SQ1 A;  1UAX A;  2KFZ A;  2IAJ A;  3OY9 A;  4K8Z A;  3KTQ A;  4CF1 A;  2P5G A;  3QES A;  4E7K A;  2D0A A;  4M3U A;  4FXD A;  3QEI A;  5J2M A;  5KGW A;  4DSK A;  4RG8 A;  3QEV A;  4CJK A;  1ZBL A;  3OJU A;  1LW0 A;  1VSH A;  4FJ8 A;  2P51 A;  4F2S A;  3DLR A;  2HVH A;  1T05 A;  1CXQ A;  2YNH A;  3NH2 A;  4DQR A;  1C0U A;  1J53 A;  3AVK A;  3LP0 A;  3DOK A;  2IC3 A;  4NYF A;  1FXX A;  3HK2 A;  1RDC A;  5J2P A;  3L2Q A;  4FJ9 A;  3KLF A;  3TI0 A;  3DMJ A;  1NJZ A;  5C42 A;  1S9G A;  4TSX A;  4N5S A;  1NOY A;  3AVG A;  3OS1 A;  1DTT A;  3K57 A;  1KVA A;  2YKN A;  4DLG A;  3HVR A;  2ZQB A;  3IRX A;  1CXU A;  3AO5 A;  1VSM A;  4BDZ A;  3AVJ A;  4FJI A;  3VQD A;  2JLE A;  4RW8 A;  3VA0 A;  3S3N A;  4O0J A;  4KHQ A;  3KLI A;  2X78 A;  1QS4 A;  3LPU A;  4AHR A;  3SV3 A;  1J54 A;  3QEX A;  2DTU A;  4E19 A;  1S1U A;  4HUE A;  1BIS A;  2JGU A;  4CEE A;  3PUF A;  3HT3 A;  4OLA A;  5JS2 A;  4FLV A;  5I3U A;  3I8D A;  3A2F A;  4FLX A;  1KFD A;  3NBP A;  1S6P A;  1S5J A;  1RDB A;  3OYC A;  4DLE A;  4FLU A;  1QTM A;  4FK0 A;  2HHV A;  1HYV A;  2ITG A;  4CEA A;  3NH0 A;  4FJN A;  1ZBH A;  3G10 A;  4CFB A;  1NJX A;  3MAQ A;  1Q9Y A;  1SV5 A;  4FM0 A;  2YKM A;  4CCH A;  1JKH A;  3AVC A;  1IKV A;  3VA3 A;  4F8R A;  3HXM A;  3V6D A;  4I9Q A;  4DTM A;  1L3T A;  1QQC A;  2ATQ A;  3I0R A;  4IG0 A;  3TAM A;  3KIO A;  4AHU A;  1FKP A;  1Y97 A;  4N47 A;  3LDS A;  5HLF A;  1R0A A;  1NK9 A;  4KI4 A;  2XY8 A;  3ZSX A;  3NAE A;  3QEP A;  4CIE A;  2XY6 A;  4DSJ A;  4AHS A;  1S1V A;  4Z0U A;  1K6Y A;  1TK0 A;  4OKK A;  3OYN A;  2QKB A;  2ZE2 A;  2ETJ A;  1ASU A;  4CJ3 A;  4BE2 A;  4KTZ A;  3HL8 A;  2F8S A;  1UWB A;  4FVM A;  5I42 A;  2IDO A;  3V9W A;  3RMD A;  3VQ8 A;  1HRH A;  3O4N A;  4BWM A;  3RMC A;  4OKE A;  4ID5 A;  1RBU A;  1X9M A;  4KB0 A;  1C1B A;  4FK4 A;  4W5R A;  3SUP A;  4CK1 A;  4CER A;  1L5U A;  4M3Y A;  4QOZ B;  4QAG A;  3LAM A;  1T8E A;  4KV8 A;  3M8Q A;  2Y1I A;  3KD5 E;  3KK2 A;  2GV9 A;  3TAG A;  3EYZ A;  3KLH A;  4C8K A;  1VSD A;  3SQ0 A;  3AVF A;  4Z4E A;  4IDK A;  1RBR A;  3RR7 A;  4DS4 A;  1RT6 A;  1FKO A;  4UQG A;  5HP1 A;  1EKE A;  3TAF A;  1NKB A;  1TAU A;  3IS9 A;  4DMN A;  4FLT A;  3RRG A;  3TAN A;  3CFP A;  1KVC A;  1B9F A;  2XHB A;  1LWC A;  1LAW A;  4DTS A;  3MXM A;  1Z25 A;  3NF8 A;  3PO4 A;  3RR8 A;  1WSG A;  4C8L A;  3I0S A;  3DRP A;  4EZ6 A;  3AA5 X;  3SPY A;  4GW6 A;  1B92 A;  1N6Q A;  4KHU A;  3V9U A;  3DI6 A;  1GOA A;  1DLO A;  4CJ5 A;  4E1N A;  3KK1 A;  2PZS A;  2VG5 A;  4W5T A;  3K5N A;  4CK3 A;  3K5L A;  4BDP A;  1FK9 A;  1JLB A;  3DLB A;  4PWD A;  2Z1H A;  3SUO A;  1HQU A;  3VQB A;  5E41 A;  4Q0B A;  3AA4 A;  3LAK A;  2KZZ A;  4LH5 A;  3OYJ A;  4OPJ A;  5KTQ A;  3ZT3 A;  4FLY A;  4DTN A;  2OA8 A;  4ELU A;  4CJP A;  4OGC A;  4PUO A;  2D0C A;  5FRN A;  1JL2 A;  3LAL A;  3SPZ A;  4CHZ A;  1LAV A;  1SUQ A;  3BDP A;  5CY4 A;  1RDA A;  3ZSW A;  3PX4 A;  1LWE A;  4O55 A;  3OJS A;  1UA0 A;  3UIQ A;  3PY8 A;  4E0D A;  3NHG A;  2YNF A;  1SKR A;  3C6T A;  4FM2 A;  4N41 A;  4BDY A;  4MFB A;  3ZSR A;  3AV9 A;  3CFR A;  1B9D A;  1L3S A;  3VQ9 A;  4CEC A;  2GBZ A;  3NGY A;  2KZM A;  4FYD A;  2G8I A;  3V1O A;  3NF6 A;  1UOC A;  1RTH A;  1NK4 A;  4JS5 A;  3OS2 A;  3AVH A;  4H4O A;  1S1W A;  4M3Z A;  4CHP A;  2OZS A;  2OZM A;  4YNQ A;  4N56 A;  4DQP A;  4CJF A;  4DTP A;  4CEF A;  2X6S A;  4E89 A;  4FZZ A;  3ZCM A;  3NH1 A;  1SKS A;  2RKI A;  4DFM A;  4DTR A;  3NCI A;  2A1S A; 
#chains in the Genus database with same CATH topology
 5BPN A;  1BA1 A;  3DOL A;  4NXN K;  3EO3 A;  5CE3 A;  5DMR A;  4CGD A;  2HHT A;  3MXI A;  3PLA A;  1XC3 A;  2YNG A;  1F21 A;  2BGG A;  3QEW A;  3BGR A;  2A1R A;  4ICL A;  1TKX A;  4CJQ A;  3TAP A;  1ASV A;  1HLU A;  3NFA A;  1RBT A;  1C1C A;  3A0I X;  3DLG A;  1WSH A;  4R79 A;  1C1A A;  3DM2 A;  1EO1 A;  2O8D A;  1Q8I A;  1EP4 A;  2YHX A;  1QZ5 A;  3T1H K;  2P9I A;  1N8R O;  2KFZ A;  3ZSZ A;  1KTQ A;  4Y1D A;  1KFS A;  1I3A A;  2FBV A;  3C95 A;  4M42 A;  3A5O C;  1RFQ A;  3F2K A;  2DFF A;  5EY4 A;  5ADX H;  3MXJ A;  1VQ5 N;  3D7E O;  3O9U A;  3RRH A;  3WQT A;  5GAG P;  1XC9 A;  4AHC A;  4FM1 A;  3PX6 A;  3MWP A;  4KRF A;  3DLE A;  4FJK A;  4M3R A;  4IWV A;  3LM2 A;  2P9S A;  1IH7 A;  3U6F A;  2QEX N;  5KPR A;  4CHY A;  1SL0 A;  4JN4 A;  4HCB A;  1OVY A;  3P39 A;  3MMV A;  1QQM A;  2O8D B;  1TK8 A;  3HVT A;  2FSN A;  5BPM A;  4O44 A;  3M8S A;  1NGE A;  2P9I B;  3WT0 A;  1N5Y A;  3JYT A;  5GAE P;  3ASM A;  3VEN A;  1HPM A;  4B9U A;  4PKG A;  2J4R A;  4CF9 A;  4B9L A;  3QNO A;  3H3N O;  5JS1 A;  4EP4 A;  3UKR A;  3OYB A;  1YF5 L;  1VQO N;  1MU2 A;  4GVM A;  5DM7 L;  2YJE A;  4LH4 A;  3H45 C;  1K8A O;  2P9S B;  1SL1 A;  3EZ5 A;  1M1K O;  1RT4 A;  1KLN A;  1XI1 A;  4IOA L;  4H03 B;  2NRR A;  1NGB A;  1SKW A;  4AHV A;  3AA3 A;  3ZSQ A;  3SLC A;  1XHX A;  3CME N;  4DU3 A;  3PSI A;  2Z1I A;  3HBT A;  2O8B B;  2ZM6 K;  4EP5 A;  2WFB A;  2OPP A;  5T7B A;  4X64 K;  5CZ1 A;  1RDU A;  3G71 N;  1NJW A;  3TU5 A;  1HYS A;  2X6N A;  4MDB A;  3THV A;  1T6D A;  3F5T A;  3O9R A;  4B08 A;  1L3U A;  4M41 A;  4K41 A;  3VQ7 A;  4DQS A;  4ELV A;  1EX4 A;  4H5N A;  3RMB A;  2VYP A;  3VQP A;  2GTD A;  4CZL A;  3KHY A;  4E7L A;  4LF6 K;  2F8T A;  3EE9 A;  4C8M A;  1M90 O;  3VMF B;  4KHN A;  4KHS A;  3VQ6 A;  4CEB A;  4MDA A;  4WE1 A;  1JJ2 M;  2XRI A;  3SQ2 A;  1WUA A;  2A42 A;  3F9K A;  3K2P A;  5LJW A;  3A5M C;  2QTD A;  4B1U B;  3CI5 A;  3LAN A;  3QDK A;  5C0Y A;  4FWK A;  1H1V A;  3IAY A;  1RIL A;  3SAH A;  3CQ8 A;  3V9X A;  3I55 N;  5AQZ A;  2QXF A;  1XMQ K;  3AVN A;  3U9D A;  2KKZ A;  3THX A;  5KRT A;  1Q9X A;  3DRR A;  1VQ4 N;  1NKE A;  1XNQ K;  2QWN A;  3S3M A;  3P5J A;  4DTU A;  2O4G A;  3L8B A;  3VQE A;  1VRT A;  4HTL A;  3SYZ A;  4RW4 A;  1IO2 A;  4A61 A;  5J2N A;  3SI6 A;  4F3T A;  1VAZ A;  5C24 A;  4CHQ A;  3P83 D;  3WXL A;  5AR0 A;  4FWQ A;  5K14 A;  2GX9 A;  3OA9 A;  4KTQ A;  4BRE A;  1QQN A;  4JRQ A;  3MK6 A;  4BVO A;  3M5R A;  5IWA K;  4JI5 K;  3AO2 A;  3O4Q A;  3O8M A;  4RW9 A;  3DLL L;  3HP6 A;  4DUY K;  4Z4G A;  3OYM A;  3E01 A;  3BZC A;  4CEZ A;  4ISF A;  3F73 A;  4R5P A;  3CJA A;  4M3T A;  2UUA K;  1QHA A;  4FJG A;  4CIF A;  5BRD A;  1IBL K;  2EWS A;  3RWU A;  1JLA A;  5TKY A;  3AY9 A;  4L8R B;  2NRV A;  1JLE A;  4BRA A;  5AQY A;  4NYN A;  4I2P A;  3CHW A;  4IEI A;  1FW6 A;  2DPN A;  4PQU A;  2CGJ A;  1UA1 A;  1ZBU A;  1DT9 A;  5M1K A;  3EE8 A;  1RT3 A;  3KJV A;  4CZF A;  4DTX A;  4B9T A;  1QQO A;  3TTF A;  2LSN A;  5M1F A;  3K59 A;  5B8H A;  1VSI A;  2HBL A;  3AVA A;  4MQ3 A;  2G8U A;  1NK0 A;  3SNN A;  1BCM A;  2ZJQ L;  1D8Y A;  1WBB A;  4IEE A;  2Z1G A;  1RBV A;  4FSV A;  2Q0U A;  4ILJ A;  4PY5 A;  2QW9 A;  5CYM A;  1ASW A;  4BGA A;  3CCM N;  1ZYQ A;  3LDL A;  4BC4 A;  3VEV A;  4JHD A;  2ZJR L;  3LP3 A;  4DF4 A;  3SQ1 A;  1UAX A;  4CF1 A;  1XQS C;  3QEI A;  5J2M A;  3SBG A;  3GE1 A;  4FVU A;  1O13 A;  5BRE A;  4F2S A;  3LP0 A;  4NYF A;  4FJ9 A;  3L2Q A;  4NXM K;  3TI0 A;  4AM6 A;  4TSX A;  5GIO A;  3AVG A;  5C2D A;  1U6Z A;  1ATR A;  3D2F A;  3CPE A;  3DAW A;  1VSM A;  2P9P A;  3AVJ A;  5AQK A;  2JLE A;  4RW8 A;  3S3N A;  3UKU B;  4O0J A;  2V52 B;  3FLC O;  2X78 A;  2QWM A;  4AHR A;  3QEX A;  2P9K A;  4JK8 A;  1S1U A;  4ISG A;  1BIS A;  3WXI A;  1VQ6 N;  3R9P A;  3HT3 A;  1WBD A;  3A2F A;  4U67 L;  4AQY K;  1QTM A;  1VQN N;  2HHV A;  5AQF A;  1V4T A;  4JKE A;  4F8R A;  5EVZ A;  3PIP L;  1QQC A;  2ATQ A;  4WQ5 C;  4IG0 A;  2QWL A;  4AHU A;  4KHP K;  4KI4 A;  3NAE A;  3QEP A;  1C0F A;  1S1V A;  2QKB A;  2ZE2 A;  1ASU A;  4BE2 A;  4GKJ K;  2F8S A;  4CBU A;  5KQD A;  1VQP N;  3RMD A;  1N32 K;  2NZT A;  3VQ8 A;  2P9P B;  1X9M A;  3ZEU A;  4W5R A;  2QI2 A;  4CK1 A;  4CER A;  4QAG A;  4RCH A;  4UY8 O;  3KD5 E;  3TAG A;  3MDQ A;  3SQ0 A;  4Z4E A;  4DS4 A;  4UQG A;  1EKE A;  4FOE A;  1TAU A;  2E5L K;  4DMN A;  3O6W A;  3TAN A;  1B9F A;  1DGK N;  4H0P A;  1LAW A;  1NLV A;  2XHB A;  2ASO A;  3J81 O;  1N6Q A;  3AGK A;  1B92 A;  3WQU A;  4KHU A;  2IVO A;  1GLJ O;  4CJ5 A;  4E1N A;  5KPZ A;  3K5L A;  1JLB A;  2NRX A;  5I9E B;  2Z1H A;  2ASM A;  1NBW A;  4Q0B A;  3AA4 A;  2V7Z A;  3OYJ A;  2W40 A;  4OPJ A;  3ZT3 A;  4DTN A;  1VQM N;  4PL7 A;  1KAZ A;  4NO7 A;  1JL2 A;  2Q2R A;  1IBM K;  5BRF A;  4H5V A;  1LWE A;  1UA0 A;  3PY8 A;  3E9O A;  5AQX A;  5LMN K;  3NHG A;  4CZI A;  1SKR A;  1VQL N;  4BDY A;  4N41 A;  3VEW A;  1J5E K;  4I6M A;  3SK3 A;  4WQ4 A;  1XUP O;  3HI0 A;  1IG8 A;  3VTH A;  4CHP A;  1LOT B;  4CJF A;  2X6S A;  4PL8 A;  4E89 A;  4CD1 A;  4FWM A;  1NJI O;  3CJ1 A;  2RKI A;  4ILH A;  3ZX3 A;  4DTR A;  3NCI A;  4DFM A;  1U2V A;  3SQ4 A;  1JCF A;  1TAQ A;  4FPB A;  3L2W A;  4NCA A;  5EU7 A;  4W5O A;  3ULE A;  3QO9 A;  3K58 A;  1ITG A;  4DV0 K;  4DB3 A;  2HHH K;  4FJJ A;  3AVI A;  4IFV A;  2NRT A;  5FLX O;  1NK7 A;  3U4L A;  1LW2 A;  3FGU A;  4LF5 K;  1YJ9 N;  4CGJ A;  3PX0 A;  4FLZ A;  1QVG M;  1NGG A;  1ZBF A;  2KFN A;  3KLG A;  2IVP A;  2A5X A;  2A41 A;  3C94 A;  1C6V A;  4FWS A;  3KWG A;  2PYJ A;  2H3G X;  1NJY A;  3G0Z A;  3EY1 A;  5AQQ A;  3L2V A;  4BRP A;  2UU9 K;  4Z94 A;  4JKG A;  1S1T A;  3ZET A;  4KHW A;  4PKI A;  2B4J A;  2FC0 A;  3C6U A;  1BWF O;  2PBD A;  3VF6 A;  3HPO A;  2Y1J A;  1YJN N;  3IDH A;  4ISE A;  4FL9 A;  2BTF A;  1YAG A;  3A8Y A;  4CFA A;  3ULE B;  4BRQ A;  1YTU A;  3MEE A;  3OYG A;  5D3G A;  2V7Y A;  3WXM B;  3LDO A;  3HRG A;  1BUP A;  4CJL A;  4QS8 A;  4M3W A;  1A5V A;  1YVU A;  5AQV A;  4FK2 A;  1X1P A;  3ATV A;  1WSE A;  3ALY A;  3D45 A;  3LDN A;  5AQS A;  1W9H A;  2BE2 A;  2A3Z A;  3EZW A;  5FDL A;  1OKJ A;  5AQI A;  5KRS A;  4N76 A;  4H0O A;  4LF7 K;  1IKX A;  1WLJ A;  4PA1 A;  4A2A A;  1HQE A;  2KW4 A;  4FCY A;  1T44 A;  1VSK A;  2W6K A;  3CJC A;  1HKC A;  4X62 K;  3CCU N;  2RE2 A;  1GLA G;  3B8A X;  4HVJ A;  3NGI A;  3RTV A;  4CF2 A;  3CYM A;  1RDW X;  2XY5 A;  3ISN C;  4CED A;  2G8W A;  5AQU A;  3H3O B;  3QIC A;  1TUY A;  3CIP A;  1ZBI A;  2CGL A;  4J2E A;  4BRF A;  3O1B A;  4KO0 A;  4C8O A;  1RT2 A;  5BR9 A;  1U04 A;  1HNZ K;  4AIL C;  1JL1 A;  4BRK A;  5CZ2 A;  2D4W A;  1NMN A;  5HRR A;  3J7Z O;  4CGH A;  2KHO A;  1TL1 A;  3CCV N;  3OYH A;  2CH5 A;  2YHY A;  5CHI A;  2E20 A;  2O8C A;  2PAV A;  3QLH A;  4E3S A;  4LF8 K;  3TSP A;  1KLM A;  3K9K A;  4DSI A;  1SS6 A;  1JCE A;  1RT7 A;  4OX9 K;  4YDU C;  4CES A;  3VEO A;  2HBJ A;  4DFJ A;  4CF8 A;  4DR2 K;  3WEE B;  1CLQ A;  1RBS A;  3RSE B;  2D0O A;  3CCL N;  1EET A;  2HW3 A;  4FWO A;  5AQL A;  1BIU A;  1IKW A;  1GOC A;  4KFB A;  3SV4 A;  1TKD A;  4OPK A;  4E7J A;  5AQN A;  3QML A;  3NMU A;  1TV6 A;  1KCF A;  4KTW A;  4A59 A;  3MN7 A;  1VRU A;  1EWQ A;  3VGM A;  3AO1 A;  1TKZ A;  3DXK A;  3K5O A;  2E2N A;  2OPS A;  1LCU A;  3V1Q A;  2O8C B;  4DS5 A;  4M63 C;  4LF9 K;  1RTJ A;  3ITH A;  1EXQ A;  1OH6 A;  1BL3 A;  3DLK A;  5EX5 A;  3T19 A;  2E2P A;  3V1R A;  1RDD A;  1YIT N;  1S22 A;  3SUN A;  1JLC A;  5EXW A;  4HWI A;  5BN9 A;  1S3X A;  3ZT0 A;  1Z6R A;  2ITM A;  1VSF A;  3JSM A;  4DUZ K;  4GMJ B;  1VSJ A;  4GV9 A;  3P38 A;  3TAB A;  1HNW K;  3AA2 A;  4NCG A;  3AVL A;  3L3V A;  4BRI A;  4WFA L;  1S6Q A;  2I5J A;  5MLC Q;  4B3O A;  4AM7 A;  4CGG A;  5DK5 A;  4DU1 A;  4CFC A;  3VER A;  1NNE A;  1T6C A;  3H6E A;  4Y1C A;  1NK8 A;  3MN5 A;  1XMO K;  3DXK B;  1RTD A;  3TAE A;  2VCP A;  4XEI A;  5E26 A;  5AQW A;  3HPH A;  1KC8 O;  4OPA A;  1JLG A;  1VK0 A;  4EAH D;  4ID1 A;  3CXC M;  4KHY A;  1G15 A;  1NU0 A;  1YUW A;  2QWQ A;  2BDP A;  3VN5 A;  5SZT A;  3L2R A;  5BR8 K;  3AAQ A;  1YT3 A;  3ZX2 A;  3MEC A;  1MWK A;  3VQ5 A;  4B1Z A;  1U45 A;  1SL2 A;  2F4V K;  3NVK A;  1I94 K;  3VGL A;  2QWP A;  4I2Q A;  2HNZ A;  2OPR A;  3VQC A;  4LC9 B;  2O4I A;  3CG7 A;  1DKG D;  3OYE A;  4EIA A;  5ADX A;  4IZ9 A;  5GIP A;  4O5B A;  1RT1 A;  3AVM A;  2VWJ A;  2G8F A;  3H46 O;  2WTU A;  2JWK A;  1WSF A;  3NVM A;  4M7X A;  3J7A P;  1NOZ A;  2UUB K;  3DYA A;  1IKY A;  2B6A A;  1HYZ A;  3ZSY A;  3SAF A;  1YVN A;  5J2Q A;  1RTI A;  1QE1 A;  4DV2 K;  3UKR B;  2IAJ A;  4E7K A;  1BG3 A;  1SQK A;  2VQE K;  4DSK A;  2QWR A;  1KXP A;  1LW0 A;  1VSH A;  2P51 A;  4ILG B;  4FJ8 A;  3KVG A;  3DLR A;  2HVH A;  2YNH A;  3NH2 A;  1J53 A;  3AVK A;  4C1N I;  2IC3 A;  3C0B A;  4YOV A;  5J2P A;  3FZK A;  5C42 A;  1NOY A;  4PHT X;  1KVA A;  2YKN A;  3HVR A;  3AO5 A;  2BUP A;  1K73 O;  3VQD A;  4KHQ A;  3KLI A;  1QS4 A;  1ZC6 A;  3SV3 A;  1J54 A;  3CJ7 A;  2QXL A;  3D6R A;  2ZWH A;  2JGU A;  1Q81 O;  4FLV A;  3VPZ A;  1KFD A;  3NBP A;  1S5J A;  3OYC A;  4B3R K;  3WUH A;  3NH0 A;  3OTO K;  2BH1 A;  4CFB A;  1Q9Y A;  4CCH A;  2YKM A;  1JKH A;  3AVC A;  3U9Z A;  4CZE A;  4DTM A;  4I9Q A;  1L3T A;  3CCE N;  3I0R A;  3I56 N;  3KIO A;  1R0A A;  4N47 A;  2XY8 A;  3RVC A;  2NLX A;  4LFB K;  4AHS A;  2Q36 A;  2HF3 A;  4Z0U A;  1K6Y A;  4CJ3 A;  2E1Z A;  1NGJ A;  1Q18 A;  4BR2 A;  2IDO A;  2AA4 A;  4DCH A;  4OKE A;  4ID5 A;  2VGM A;  1JCG A;  1G99 A;  1L5U A;  3LAM A;  3BY5 A;  3FZM A;  1J6Z A;  2VWB A;  3CQX A;  4BG9 A;  4IDK A;  4F9O A;  4BRC A;  3RR7 A;  1RT6 A;  3F9M A;  3TAF A;  2GEL A;  3THX B;  1K8K A;  2FSJ A;  4DV6 K;  4IO9 L;  4DTS A;  3MXM A;  3RR8 A;  3NF8 A;  1DEJ A;  3AA5 X;  5AZI A;  3V9U A;  3DI6 A;  1GOA A;  1BO5 O;  3KK1 A;  4JK7 A;  2VG5 A;  3KK7 A;  3K5N A;  4CK3 A;  3A5L C;  3DLB A;  1HQU A;  2WBN A;  2KZZ A;  2OA8 A;  4CJP A;  4CBX A;  4OGC A;  1Y64 A;  2D0C A;  4CZH A;  5FRN A;  3ZYY X;  1HUX A;  4FWP A;  1LAV A;  4H5R A;  4CHZ A;  5CY4 A;  4IOX A;  3UIQ A;  3OJS A;  4JI4 K;  5GIN A;  3AV9 A;  1L3S A;  3BUZ B;  3VQ9 A;  3E9L A;  4CEC A;  4BC5 A;  3NF6 A;  4BRH A;  1NK4 A;  1K8K B;  3AVH A;  3H1Q A;  3A5N C;  2OZS A;  4DR6 K;  4YNQ A;  4IO8 A;  4DQP A;  4WFN L;  4FZZ A;  2QA4 N;  2A6A A;  2IIR A;  2A1S A;  3OYF A;  3SCX A;  1YXQ A;  4CJ7 A;  3E1Y A;  2D0B A;  3KZB A;  2O8E A;  4CF0 A;  5JLH A;  4NLC A;  3K5M A;  2V51 B;  1TVR A;  1N34 K;  3KD1 E;  5HRP A;  3C7N A;  4F2R A;  4Z4F A;  3CF5 L;  3R6M A;  1VQ9 N;  3HYF A;  4IG3 A;  2W41 A;  3M3Z A;  4NB4 A;  5HRO A;  3HOT A;  4FJH A;  3R3L A;  4NCB A;  3Q7B A;  5TKW A;  3THW A;  3K0S A;  1LV5 A;  4J2D A;  1TUU A;  2WC9 A;  2GWJ A;  3M8P A;  4JHD B;  1NG9 A;  3CQY A;  4CVN E;  1HJR A;  1HNX K;  3AO4 A;  4BR7 A;  4CEQ A;  2XO7 A;  4B3M K;  2DFE A;  1BOT O;  2VGN A;  4B9V A;  3U3Y A;  4JKH A;  3CCR N;  2Q1N A;  3OYL A;  4CIG A;  1KSP A;  2RF2 A;  3VF2 A;  2P1J A;  2D5R A;  5CYQ A;  3ZX0 A;  3TSU A;  3C7N B;  1NM1 A;  1HKB A;  3VQA A;  4YOX A;  4O8K A;  3D2F B;  4YFU A;  1GOB A;  3UE5 A;  3Q7C A;  5M1O A;  4DSF A;  5AQJ A;  4KKO A;  5AQP A;  4B9Q A;  3FE1 A;  5ELZ A;  3AGR A;  1TYQ A;  4FW1 A;  4CHO A;  2P9K B;  4CJR A;  3C6A A;  4JI1 K;  4DR5 K;  5FRM A;  2BAN A;  3V4I A;  2HNY A;  1RCH A;  2W6L A;  4H8K A;  4JS4 A;  2HHQ A;  2HST A;  3OYA A;  3MCA B;  1XNR K;  1NK5 A;  1Z26 A;  4Z4C A;  3O3G A;  4KPY A;  3NE6 A;  2RPI A;  3IG1 A;  4JAX A;  1IG9 A;  2GWK A;  4H0X B;  3QBX A;  2HB5 A;  1HNV A;  1BHL A;  5M1Q A;  4IJN A;  2AP1 A;  3SMP A;  1BQN A;  2FXU A;  4B1V A;  4OLB A;  4K8X A;  2IVN A;  2RN2 A;  3ZEU B;  3J8A A;  4DV7 K;  3AVB A;  1K9M O;  1TYQ B;  1VHX A;  3HST B;  3E66 A;  2HHX A;  1VSL A;  3CPW M;  5HRS A;  3QBW A;  4FJM A;  2Z1J A;  4KH4 A;  1Z05 A;  4B9S A;  4GV3 A;  5AQR A;  3ID6 A;  2F9W A;  3M1F A;  3R1X A;  2HVI A;  5FPE A;  5H1S Q;  4J2A A;  3CER A;  3WXJ A;  4DFP A;  3QFU A;  1U4B A;  2AJQ A;  3TR8 A;  5AFU H;  4HUG A;  3WNE A;  3P31 A;  2B5J A;  3V81 A;  1EQY A;  3VET A;  4GY2 B;  1WNS A;  3ID8 A;  4Z4I A;  3B6P A;  2O8F A;  1HPZ A;  3H1V X;  1U49 A;  4CJW A;  1REV A;  3L2U A;  5C2F A;  4DG1 A;  1E3M A;  4IOC L;  2OTL N;  3BP8 A;  1VQ8 N;  4H5T A;  3DLH A;  1TL3 A;  3NGZ A;  3VTI A;  2QK9 A;  4BRD A;  3B6O A;  4A57 A;  3LPT A;  4H5W A;  1KAX A;  3ULD A;  3QER A;  2UXB K;  4I6M B;  2VG7 A;  4KAZ A;  4MLE A;  4EFH A;  4KBO A;  1BI4 A;  1IJJ A;  4IDH A;  4JLH A;  2Q0R A;  2FF6 A;  4CJ4 A;  2YHB A;  1RT5 A;  3SJH A;  4A5B A;  2ZGY A;  1U2V B;  5GAD P;  3HTV A;  5CR4 A;  2PFU A;  2OPQ A;  4M7Y A;  2NNW A;  3HSC A;  2NUB A;  4B8A B;  4Y0W A;  4FLW A;  3LP2 A;  2YHW A;  4JRP A;  1D9D A;  1WAJ A;  4QS7 A;  4GV6 A;  3TSQ A;  3RMA A;  2HBM A;  1KVB A;  2HF4 A;  4EZ9 A;  3OVN A;  3DXM A;  5AQG A;  1MDU B;  1TKT A;  4KH6 A;  2EHG A;  4CZJ A;  3ZLJ A;  5AFU A;  1LWF A;  3ZSV A;  3DRS A;  4CJS A;  4JI7 K;  1KD1 O;  3OS0 A;  4DTJ A;  2GUI A;  4CJV A;  1BI4 B;  4CJT A;  2W42 A;  2HHW A;  2JWL A;  4XIU A;  3WNH A;  4JYA K;  3ZT2 A;  4WQ5 A;  3CJB A;  3FZF A;  3O9Q A;  4FJL A;  1YJW N;  2XY7 A;  3ZT1 A;  4CE9 A;  4JKG B;  3ZET B;  1NGF A;  4DFK A;  1J5O A;  2CGK A;  4HCC A;  1KRP A;  3MWT A;  3O4W A;  2DFH A;  3ZT4 A;  3AAR A;  2ZGZ A;  1A5X A;  1D9F A;  3G25 A;  3GOI A;  1FJG K;  5JVG L;  1ESV A;  4EHT A;  1ZBS A;  4DF8 A;  5E84 A;  3QIN A;  5JVH L;  2G8K A;  2HHU A;  1D5A A;  3P4I A;  4CZK A;  1D4X A;  2YI1 A;  4KH5 A;  1IBK K;  1U47 A;  2UYT A;  3O9S A;  3OBY A;  2YNI A;  3CM5 A;  3CMA N;  1Q82 O;  1QSS A;  1DTQ A;  4CHN A;  4WFB L;  3CM6 A;  3KK3 A;  5KQ8 A;  4BAC A;  3MN9 A;  3T69 A;  2FSK A;  4DWI A;  4CFD A;  4DKW A;  1GLC G;  4BRN A;  1BQM A;  4YOR A;  3S9H A;  4YOU A;  4C8N A;  2F7T A;  1TK5 A;  4H0T B;  4O0I A;  3VOV A;  4KB1 A;  3HM8 A;  1YHQ N;  4B3S K;  4FWR A;  2ASP A;  3QES A;  2OTJ N;  4CBW A;  1HR0 K;  4FXD A;  5KGW A;  4RG8 A;  4L3Q A;  4BR9 A;  3LM9 A;  3TTD A;  1CXQ A;  4DQR A;  1N33 K;  1RDC A;  4BGB A;  3DMJ A;  1NJZ A;  1S9G A;  3OS1 A;  1DTT A;  3K57 A;  2ZQB A;  4O8U A;  3IRX A;  1SAZ A;  3CC4 N;  4B1X B;  4FWL A;  5AQH A;  3LPU A;  2E1Y A;  3I33 A;  2DTU A;  4DV1 K;  3CCQ N;  1CZA N;  4JI6 K;  5JS2 A;  5BPL A;  3I8D A;  5I3U A;  4JV5 K;  4E1J A;  4BRM A;  4FK0 A;  4FLU A;  4DLE A;  1HYV A;  4FJN A;  1ZBH A;  1NJX A;  3TTC A;  4FM0 A;  3VGK A;  3VA3 A;  1QVF M;  4JI0 K;  1FKP A;  1Y97 A;  5HLF A;  1NK9 A;  2NRH A;  4WF9 L;  4CIE A;  3L0Q A;  4RWT A;  4OKK A;  2ETJ A;  5AQO A;  2F9T A;  1UWB A;  1ATN A;  3V9W A;  1HRH A;  3S41 A;  5A2Q O;  3RMC A;  1RBU A;  4BG8 A;  4KB0 A;  1C1B A;  4FK4 A;  3SUP A;  4QOZ B;  4KV8 A;  3M8Q A;  4WCE L;  4FOI A;  3KK2 A;  1NMD A;  3EYZ A;  1VSD A;  1WOQ A;  4B1Y B;  3EN9 A;  4BRG A;  3PIO L;  3CET A;  1NKB A;  4LFC K;  3BF1 A;  3N4P A;  1Q7Y O;  1BDG A;  1LWC A;  3BF3 A;  5GAH P;  1ATS A;  1Z25 A;  1WSG A;  3DRP A;  4EZ6 A;  2O8B A;  3SPY A;  3DJC A;  3CCS N;  3IFR A;  2PZS A;  3J80 O;  4W5T A;  4IJA A;  4BDP A;  1FK9 A;  3SMS A;  2GUP A;  5E41 A;  3JS6 A;  2P9L A;  2QWO A;  2HOE A;  4FLY A;  1MA9 B;  4JKA A;  1GLB G;  4PUO A;  4BY9 C;  1GLE G;  4K43 A;  1SUQ A;  3BDP A;  4QS9 A;  4E0D A;  1P90 A;  3C6T A;  3CFR A;  4MLH A;  1B9D A;  3IMX A;  5FPD A;  3OHR A;  3C65 A;  3NGY A;  4FYD A;  2G8I A;  3V1O A;  2Q31 A;  1UOC A;  1RTH A;  4DHY A;  5LL6 Z;  3OS2 A;  3IKM A;  2HMP A;  4JKC A;  4G9Z A;  2OZM A;  3NH1 A;  3D0P A;  2UXD K;  3TPQ A;  2DY4 A;  2E88 A;  3WNF A;  3MX5 A;  3LZJ A;  3JXU A;  4W5Q A;  4HTU A;  2YCH A;  4A2B A;  4BR0 A;  3HZ6 A;  4FJX A;  4LF4 K;  2P9L B;  3MED A;  2UUC K;  2E6L A;  3C6H A;  4B8C A;  1OVQ A;  5LY3 A;  1RNH A;  4MO5 A;  3CC7 N;  4JI3 K;  2I7N A;  2WON A;  1W7A A;  1U48 A;  1L3V A;  4IFY A;  4CJE A;  4FW2 A;  2G8V A;  3KKR A;  3EKS A;  5KI6 A;  3L4I A;  4BRL A;  4YDU A;  3LDP A;  3VEZ A;  3OYI A;  4LSN A;  5KGX A;  5BN8 A;  2E2Q A;  4CGI A;  3PV8 A;  4E7I A;  3R8E A;  5HRN A;  4B9M A;  3HPG A;  3CC2 N;  3HM9 A;  5KPT A;  3AO3 A;  1C0T A;  5M1N A;  3V9Z A;  4YY3 K;  4HHT A;  2FBT A;  4IXC A;  5JIC A;  2G8H A;  3NF7 A;  4JEP A;  3SBT A;  4JKD A;  4BE0 A;  1W2B M;  4KRE A;  3O3H A;  3VF4 A;  3E9P A;  5HBM A;  3P1G A;  1EWR A;  4CGF A;  1WN7 A;  5LJV A;  4DQQ A;  1BU6 O;  2EX3 A;  3S3O A;  3BZK A;  5F0X A;  1QHT A;  3THY A;  4JI8 K;  5LMU K;  2E8A A;  3VQQ A;  4Z4H A;  3M6G A;  4BQL A;  3HOS A;  4K42 A;  3SZ2 A;  1C0M A;  2WOM A;  4B1W B;  3L4Q A;  2IS3 A;  3N4Q A;  2D1K A;  4IBN A;  2KTQ A;  3OBW A;  4FZX C;  4OVL A;  3W0L A;  1X9S A;  2HHS A;  1ZXO A;  2NRZ A;  2I7P A;  5C25 A;  2KQ2 A;  2CH6 A;  4CK2 A;  2YX6 A;  4JD2 A;  1XWL A;  4HUF A;  3CJ9 A;  4MO4 A;  4XH4 A;  2F96 A;  4BC3 A;  2ZD1 A;  4BWJ A;  4BC2 A;  4DR1 K;  1I39 A;  5JLF A;  1Q86 O;  3LL3 A;  1JLQ A;  4WQ4 C;  3OYD A;  2HMI A;  4OKJ A;  3THY B;  4M3X A;  4K0K K;  5C12 A;  3O3F A;  4AHT A;  1N36 K;  4CW7 B;  1GLF O;  3QIO A;  4DR4 K;  4Q5V A;  4YOW A;  3U3G A;  3G4S N;  4OJR A;  3OYK A;  4U7B A;  4FJ7 A;  4DSE A;  4IKF A;  4CEO A;  3M8R A;  2R7Y A;  2HND A;  1VSE A;  5AZI B;  3TAR A;  1X3N A;  1BA0 A;  3TWH A;  3UKU A;  4JD2 B;  4JK9 A;  3O1W A;  4O5F A;  2GEM A;  3T1Y K;  2A40 A;  1QSL A;  3WXK A;  2YHA A;  1NGH A;  5FRO A;  3MEG A;  3HO1 A;  1R59 O;  4ZTJ A;  4CD3 A;  1S1X A;  4I9L A;  1W97 L;  4AH9 A;  3KLE A;  4QCL A;  5HOO A;  3I8B A;  3QB0 A;  4DV4 K;  3O80 A;  3SJJ A;  2FLO A;  3L3U A;  2VWK A;  3ATU A;  4J2B A;  4LSL A;  1S72 N;  3EEQ A;  1CZB A;  2WUS A;  4FZY A;  1HX1 A;  1WSI A;  2ZF5 O;  3CCJ N;  4DR7 K;  3ENH A;  4RW6 A;  1KAY A;  1BGX T;  2P9N A;  1HMV A;  1WB9 A;  4BVP A;  1QZ6 A;  4I7F A;  4M45 A;  2VG6 A;  3T1A A;  5AQT A;  1SKS A;  4H4M A;  4EHU A;  3TAQ A;  2OYQ A;  3CFO A;  1RGI A;  4C23 A;  5SWM A;  4W5N A;  2P5O A;  3LWM A;  2ZJP L;  4O4G A;  3LZI A;  4ELT A;  4DQI A;  4FO0 A;  2O8E B;  4DQ8 A;  4V19 S;  2OAN A;  3HP9 A;  3T7Z A;  1O1W A;  5JMV A;  4OO1 J;  3FZL A;  3LWL A;  1NGC A;  5M1P A;  2IOC A;  2E6M A;  2PYL A;  4OGE A;  4E1M A;  3WNG A;  4LY7 A;  3QIP A;  4BE1 A;  3THW B;  1NKC A;  1E4F T;  4DU4 A;  1JLF A;  1YI2 N;  5AQM A;  4K25 A;  1TGO A;  2NRW A;  3PO5 A;  4FJ5 A;  3G6E N;  4GKK K;  3H08 A;  1MWM A;  1JXB A;  4YOT A;  2P9N B;  2HBK A;  4JNE A;  1QSY A;  4AF1 A;  5AJ3 K;  1A5W A;  4ZHR A;  4DV3 K;  1BIZ A;  3VQ4 A;  3SUQ A;  3V9S A;  3NDK A;  5AZJ A;  4FWN A;  3BEX A;  5J1E A;  4DSL A;  1ILY A;  1X9W A;  3GBT A;  1T03 A;  4B9N A;  4F3O A;  2QM1 A;  1WAF A;  1W0H A;  2FBX A;  4F4K A;  4CI6 A;  1X3M A;  5F2R A;  4CJU A;  3AAP A;  1CZ9 A;  2FBY A;  3JAM O;  4KI6 A;  1VQ7 N;  2PY5 A;  4RW7 A;  1HKG A;  4LD0 A;  3EL2 A;  2FF3 B;  3T3F A;  3KKS A;  2X74 A;  4E7H A;  3O5B A;  2QKK A;  3GL1 A;  1BCO A;  1YTA A;  1WSJ A;  3QET A;  1YIJ N;  1HNI A;  4A5A A;  3VES A;  3L6Q A;  5HL7 L;  3HJF A;  1T3V A;  2YV0 X;  2E4L A;  4DTO A;  3CD6 N;  5FPN A;  3FR0 A;  3NF9 A;  3VEY A;  4JKF A;  3QNN A;  3PSF A;  4ZTF A;  4YOY A;  4LFA K;  3LDQ A;  1S9E A;  3FFI A;  5AZJ B;  4G1Q A;  5C10 A;  4JKB A;  1GLD G;  2IGI A;  2YJF A;  3LP1 A;  1J9A A;  1HJO A;  1NK6 A;  3ZSO A;  3D2E A;  1XHZ A;  1T7P A;  1JXE A;  2Q3S A;  3MCP A;  4YHH K;  1IV0 A;  4NLB A;  5BRH A;  3OY9 A;  4K8Z A;  3KTQ A;  4JI2 K;  2P5G A;  2D0A A;  4M3U A;  3U8X A;  3QEV A;  5FPM A;  2KLA A;  4C1N K;  1NGD A;  4CJK A;  3OJU A;  1ZBL A;  4CZG A;  3K9J A;  1T05 A;  1C0U A;  3DOK A;  1FXX A;  2Q97 A;  3HK2 A;  4FPA A;  3GDQ A;  4OPH A;  3KLF A;  3DWL A;  4H0V B;  4N5S A;  1KQS M;  5DM6 L;  2P9U A;  3KWI A;  4DLG A;  3ENB A;  1CXU A;  2VQF K;  4BDZ A;  2RHK A;  2O8F B;  4FJI A;  3VA0 A;  3ENO A;  3UB5 A;  3O08 A;  4GNI A;  3D2E B;  4E19 A;  4HUE A;  4CZM A;  4CEE A;  3PUF A;  4OLA A;  4RTF D;  2D0P A;  4FLX A;  1S6P A;  1RDB A;  4X66 K;  1OH7 A;  2ITG A;  4CEA A;  3G10 A;  1VQK N;  3EKU A;  3MAQ A;  5EOY A;  1SV5 A;  1NGA A;  1IKV A;  4WYB A;  3HXM A;  3V6D A;  1OH5 A;  1NWK A;  3TAM A;  3LDS A;  3ZSX A;  1V4S A;  2XY6 A;  4DSJ A;  4BR4 A;  1TK0 A;  3OYN A;  1OH8 A;  2P9U B;  2E2O A;  3HL8 A;  3MX2 A;  4KTZ A;  2UXC K;  4FVM A;  5I42 A;  3OW2 M;  2OCE A;  1P8Z A;  4BWM A;  3O4N A;  3W3D A;  4XH1 A;  4M3Y A;  1T8E A;  4BR5 A;  3J7Y P;  4PKH A;  2Y1I A;  2GV9 A;  4IFE A;  3KLH A;  3QFP A;  4C8K A;  3AVF A;  5C15 A;  1RBR A;  3O9T A;  1FKO A;  5HP1 A;  1GLL O;  3FZH A;  3IS9 A;  1NGI A;  4FLT A;  3RRG A;  1X9J A;  5IT9 O;  3CFP A;  1KVC A;  3GG4 A;  3FFK B;  3DXM B;  4GVE A;  3PO4 A;  4DR3 K;  4C8L A;  3I0S A;  4H0Y B;  4GW6 A;  4DV5 K;  1DLO A;  1SZ2 A;  4X65 K;  4PWD A;  3SUO A;  3VQB A;  3LAK A;  3MN6 A;  4LH5 A;  5KTQ A;  4ELU A;  3LAL A;  3WEE A;  3SPZ A;  3ZSW A;  1RDA A;  3VEX A;  3PX4 A;  4O55 A;  3RSE A;  4BQZ A;  4XH5 A;  2YNF A;  4A62 A;  4FM2 A;  4MFB A;  3ZSR A;  2GBZ A;  2KZM A;  3SAG A;  3IUC A;  1E4G T;  4BRO A;  1C0G A;  4JS5 A;  4H4O A;  1S1W A;  4M3Z A;  4N56 A;  4B3T K;  5F1X A;  4J8F A;  4DTP A;  4CEF A;  3ZCM A; 
#chains in the Genus database with same CATH homology
 3OYF A;  2DY4 A;  3SCX A;  3WNF A;  3SQ4 A;  3DOL A;  2D0B A;  3LZJ A;  4W5Q A;  4HTU A;  4CF0 A;  1TAQ A;  4FJX A;  3L2W A;  5DMR A;  4NCA A;  3K5M A;  3MED A;  1TVR A;  5EU7 A;  3KD1 E;  4CGD A;  5HRP A;  4W5O A;  2E6L A;  4F2R A;  4B8C A;  4Z4F A;  2HHT A;  3QO9 A;  1RNH A;  3K58 A;  3MXI A;  1ITG A;  3HYF A;  2YNG A;  4IG3 A;  1F21 A;  2WON A;  4FJJ A;  1U48 A;  1L3V A;  3QEW A;  2BGG A;  4IFY A;  3AVI A;  3BGR A;  4IFV A;  4CJE A;  5HRO A;  2A1R A;  4FW2 A;  4ICL A;  1TKX A;  1NK7 A;  4FJH A;  1LW2 A;  4NCB A;  1LV5 A;  2G8V A;  4CGJ A;  4J2D A;  3PX0 A;  4CJQ A;  4FLZ A;  3TAP A;  3KKR A;  3M8P A;  5KI6 A;  1ASV A;  3NFA A;  1ZBF A;  2KFN A;  1RBT A;  3KLG A;  1C1C A;  3OYI A;  3DLG A;  1WSH A;  4LSN A;  3C94 A;  1C1A A;  1C6V A;  1HJR A;  3DM2 A;  5KGX A;  3AO4 A;  1Q8I A;  1EP4 A;  4CGI A;  2PYJ A;  3PV8 A;  4CEQ A;  4E7I A;  5HRN A;  1NJY A;  4B9M A;  2XO7 A;  3G0Z A;  3HPG A;  3EY1 A;  3HM9 A;  3AO3 A;  2DFE A;  3L2V A;  1C0T A;  3V9Z A;  4B9V A;  3ZSZ A;  4HHT A;  1KTQ A;  4Y1D A;  3U3Y A;  1S1T A;  1KFS A;  4KHW A;  1I3A A;  3OYL A;  2FBV A;  2FBT A;  4CIG A;  3C95 A;  1KSP A;  4M42 A;  2B4J A;  2G8H A;  2RF2 A;  2FC0 A;  3NF7 A;  3C6U A;  2Y1J A;  3HPO A;  2DFF A;  2P1J A;  2D5R A;  5CYQ A;  3MXJ A;  4CFA A;  4BE0 A;  4KRE A;  3O3H A;  3RRH A;  1YTU A;  3MEE A;  3VQA A;  5HBM A;  3OYG A;  3P1G A;  1XC9 A;  4YFU A;  5D3G A;  1GOB A;  4CJL A;  4CGF A;  4AHC A;  1WN7 A;  4FM1 A;  3PX6 A;  4DQQ A;  4KRF A;  4DSF A;  4M3W A;  1A5V A;  1YVU A;  3DLE A;  4KKO A;  2EX3 A;  3S3O A;  4FJK A;  4M3R A;  1QHT A;  4FK2 A;  1X1P A;  4FW1 A;  1WSE A;  4CHO A;  4CJR A;  3ALY A;  3VQQ A;  1IH7 A;  5FRM A;  4Z4H A;  2BAN A;  3U6F A;  2HNY A;  1RCH A;  3D45 A;  3V4I A;  4CHY A;  3SZ2 A;  1C0M A;  1W9H A;  2BE2 A;  2WOM A;  5FDL A;  4H8K A;  4JS4 A;  2IS3 A;  1SL0 A;  2HHQ A;  4HCB A;  4IBN A;  5KRS A;  1TK8 A;  4N76 A;  3HVT A;  1IKX A;  2KTQ A;  1WLJ A;  4FZX C;  4OVL A;  4PA1 A;  4O44 A;  3OYA A;  1HQE A;  2KW4 A;  3M8S A;  4FCY A;  1X9S A;  2HHS A;  1NK5 A;  1Z26 A;  4Z4C A;  3O3G A;  1N5Y A;  4KPY A;  3JYT A;  3NE6 A;  5C25 A;  1VSK A;  2KQ2 A;  2RPI A;  3IG1 A;  4CK2 A;  3ASM A;  1IG9 A;  4B9U A;  1XWL A;  4HUF A;  2HB5 A;  1HNV A;  1BHL A;  4CF9 A;  2F96 A;  4HVJ A;  2ZD1 A;  1BQN A;  4BWJ A;  4B9L A;  1I39 A;  3QNO A;  3NGI A;  3RTV A;  4CF2 A;  5JS1 A;  4EP4 A;  4OLB A;  1JLQ A;  3CYM A;  3OYB A;  2XY5 A;  4K8X A;  3OYD A;  1MU2 A;  4GVM A;  2RN2 A;  3ISN C;  4CED A;  2HMI A;  2G8W A;  4OKJ A;  4LH4 A;  3AVB A;  4M3X A;  3O3F A;  3HST B;  4AHT A;  1ZBI A;  4J2E A;  2HHX A;  1VSL A;  5HRS A;  1SL1 A;  3QIO A;  3EZ5 A;  4KO0 A;  2Z1J A;  4C8O A;  1RT4 A;  4FJM A;  1RT2 A;  1KLN A;  1U04 A;  1XI1 A;  4B9S A;  4AIL C;  4Q5V A;  1JL1 A;  1SKW A;  4AHV A;  3AA3 A;  5CZ2 A;  2HVI A;  3ZSQ A;  3U3G A;  4J2A A;  4OJR A;  3OYK A;  4DFP A;  1U4B A;  2AJQ A;  3TR8 A;  1XHX A;  4FJ7 A;  4HUG A;  3WNE A;  4DSE A;  4DU3 A;  4IKF A;  2B5J A;  3V81 A;  5HRR A;  2Z1I A;  4CEO A;  1WNS A;  3M8R A;  4CGH A;  2R7Y A;  2HND A;  1TL1 A;  1VSE A;  3B6P A;  4Z4I A;  4EP5 A;  3TAR A;  3TWH A;  1HPZ A;  3OYH A;  1U49 A;  4CJW A;  2OPP A;  5T7B A;  5CZ1 A;  1REV A;  3L2U A;  1QSL A;  3D0P A;  1NJW A;  3QLH A;  2YHA A;  4DG1 A;  4E3S A;  1HYS A;  2X6N A;  5FRO A;  3MEG A;  3THV A;  3HO1 A;  1KLM A;  4ZTJ A;  4DSI A;  1S1X A;  1RT7 A;  4I9L A;  4B08 A;  1TL3 A;  1L3U A;  3DLH A;  4CES A;  4AH9 A;  3NGZ A;  4M41 A;  4DFJ A;  4CF8 A;  2QK9 A;  3KLE A;  3VQ7 A;  4DQS A;  3B6O A;  4ELV A;  4QCL A;  1CLQ A;  1EX4 A;  3RMB A;  3VQP A;  1RBS A;  3LPT A;  3SJJ A;  3L3U A;  2VWK A;  4J2B A;  4LSL A;  1EET A;  4E7L A;  3ULD A;  2HW3 A;  1CZB A;  3QER A;  1BIU A;  4FZY A;  1IKW A;  2VG7 A;  1GOC A;  4KFB A;  3SV4 A;  1WSI A;  4KAZ A;  2F8T A;  4C8M A;  4KHN A;  4KHS A;  1TKD A;  4RW6 A;  4OPK A;  4E7J A;  1BGX T;  1HMV A;  1BI4 A;  3VQ6 A;  4JLH A;  1TV6 A;  1KCF A;  2VG6 A;  4I7F A;  4KTW A;  4M45 A;  4WE1 A;  1VRU A;  2XRI A;  4H4M A;  3T1A A;  4CEB A;  3SQ2 A;  3TAQ A;  3F9K A;  4CJ4 A;  2OYQ A;  3CFO A;  3K2P A;  5SWM A;  3AO1 A;  1TKZ A;  2YHB A;  1RT5 A;  2P5O A;  4W5N A;  3LWM A;  3LAN A;  4O4G A;  3K5O A;  3LZI A;  2OPS A;  4ELT A;  4DQI A;  3V1Q A;  3IAY A;  1RIL A;  3CQ8 A;  4DS5 A;  2OPQ A;  3V9X A;  1RTJ A;  3ITH A;  3HP9 A;  1O1W A;  1EXQ A;  2NUB A;  4B8A B;  1BL3 A;  3DLK A;  4FLW A;  3LP2 A;  2QXF A;  3T19 A;  3AVN A;  3V1R A;  1RDD A;  3LWL A;  4JRP A;  1D9D A;  1WAJ A;  3SUN A;  1JLC A;  3RMA A;  5KRT A;  1Q9X A;  3DRR A;  2IOC A;  2E6M A;  3ZT0 A;  1NKE A;  2PYL A;  1VSF A;  4OGE A;  4E1M A;  1KVB A;  3S3M A;  3P5J A;  4EZ9 A;  3WNG A;  4DTU A;  3OVN A;  4LY7 A;  3JSM A;  2O4G A;  3L8B A;  3VQE A;  1TKT A;  1VSJ A;  1VRT A;  4GMJ B;  3QIP A;  4BE1 A;  3SYZ A;  4RW4 A;  2EHG A;  1NKC A;  1IO2 A;  4DU4 A;  3TAB A;  1JLF A;  5J2N A;  3AA2 A;  4NCG A;  3AVL A;  3L3V A;  1TGO A;  3SI6 A;  3PO5 A;  4FJ5 A;  1LWF A;  3ZSV A;  4F3T A;  5C24 A;  3DRS A;  1S6Q A;  2I5J A;  3P83 D;  3H08 A;  4CJS A;  4CHQ A;  4B3O A;  5K14 A;  3OS0 A;  1JXB A;  2GUI A;  4DTJ A;  4KTQ A;  4CGG A;  4CJV A;  5DK5 A;  1QSY A;  1BI4 B;  4CFC A;  4CJT A;  2W42 A;  4DU1 A;  2HHW A;  4JRQ A;  4XIU A;  3WNH A;  3ZT2 A;  1A5W A;  4ZHR A;  1NK8 A;  4Y1C A;  1BIZ A;  3VQ4 A;  3AO2 A;  3O4Q A;  4RW9 A;  3SUQ A;  4FJL A;  3V9S A;  3NDK A;  3TAE A;  1RTD A;  2XY7 A;  3HP6 A;  3ZT1 A;  4CE9 A;  4DFK A;  5J1E A;  3HPH A;  1J5O A;  4DSL A;  4HCC A;  1X9W A;  4Z4G A;  1T03 A;  4B9N A;  4F3O A;  1WAF A;  1JLG A;  3OYM A;  1KRP A;  1VK0 A;  1W0H A;  2FBX A;  4F4K A;  2DFH A;  4ID1 A;  3ZT4 A;  3E01 A;  4CJU A;  4CEZ A;  4KHY A;  1G15 A;  3F73 A;  4R5P A;  4M3T A;  1A5X A;  1CZ9 A;  2FBY A;  1D9F A;  4KI6 A;  4FJG A;  4CIF A;  2PY5 A;  4RW7 A;  2BDP A;  3VN5 A;  4LD0 A;  3RWU A;  1JLA A;  5SZT A;  3T3F A;  4DF8 A;  3KKS A;  4L8R B;  3QIN A;  2G8K A;  2X74 A;  3L2R A;  1JLE A;  4E7H A;  1D5A A;  2HHU A;  2QKK A;  1YT3 A;  1BCO A;  4NYN A;  1YTA A;  1WSJ A;  4I2P A;  3MEC A;  3QET A;  4PQU A;  1U47 A;  1HNI A;  3VQ5 A;  1UA1 A;  1U45 A;  1SL2 A;  1ZBU A;  3HJF A;  2YNI A;  3CM5 A;  1QSS A;  2YV0 X;  2E4L A;  4DTO A;  1RT3 A;  3KJV A;  2O4I A;  4I2Q A;  2HNZ A;  1DTQ A;  2OPR A;  3VQC A;  4CHN A;  4DTX A;  4B9T A;  3CM6 A;  3KK3 A;  3CG7 A;  3NF9 A;  3QNN A;  2LSN A;  3K59 A;  4BAC A;  3OYE A;  4ZTF A;  1S9E A;  1VSI A;  3FFI A;  4MQ3 A;  3AVA A;  4O5B A;  4CFD A;  2G8U A;  4DWI A;  1RT1 A;  3AVM A;  2VWJ A;  1NK0 A;  2G8F A;  4G1Q A;  1BQM A;  3SNN A;  1BCM A;  2IGI A;  1WSF A;  1D8Y A;  3LP1 A;  1J9A A;  3S9H A;  2Z1G A;  1NOZ A;  3DYA A;  1IKY A;  1RBV A;  4C8N A;  1NK6 A;  4PY5 A;  3ZSO A;  1TK5 A;  2B6A A;  5CYM A;  1HYZ A;  1XHZ A;  1ASW A;  1T7P A;  3ZSY A;  1ZYQ A;  4O0I A;  1JXE A;  4KB1 A;  5J2Q A;  1RTI A;  2Q3S A;  3LP3 A;  1QE1 A;  4DF4 A;  3SQ1 A;  1UAX A;  2KFZ A;  2IAJ A;  3OY9 A;  4K8Z A;  3KTQ A;  4CF1 A;  2P5G A;  3QES A;  4E7K A;  2D0A A;  4M3U A;  4FXD A;  3QEI A;  5J2M A;  5KGW A;  4DSK A;  4RG8 A;  3QEV A;  4CJK A;  1ZBL A;  3OJU A;  1LW0 A;  1VSH A;  4FJ8 A;  2P51 A;  4F2S A;  3DLR A;  2HVH A;  1T05 A;  1CXQ A;  2YNH A;  3NH2 A;  4DQR A;  1C0U A;  1J53 A;  3AVK A;  3LP0 A;  3DOK A;  2IC3 A;  4NYF A;  1FXX A;  3HK2 A;  1RDC A;  5J2P A;  3L2Q A;  4FJ9 A;  3KLF A;  3TI0 A;  3DMJ A;  1NJZ A;  5C42 A;  1S9G A;  4TSX A;  4N5S A;  1NOY A;  3AVG A;  3OS1 A;  1DTT A;  3K57 A;  1KVA A;  2YKN A;  4DLG A;  3HVR A;  2ZQB A;  3IRX A;  1CXU A;  3AO5 A;  1VSM A;  4BDZ A;  3AVJ A;  4FJI A;  3VQD A;  2JLE A;  4RW8 A;  3VA0 A;  3S3N A;  4O0J A;  4KHQ A;  3KLI A;  2X78 A;  1QS4 A;  3LPU A;  4AHR A;  3SV3 A;  1J54 A;  3QEX A;  2DTU A;  4E19 A;  1S1U A;  4HUE A;  1BIS A;  2JGU A;  4CEE A;  3PUF A;  3HT3 A;  4OLA A;  5JS2 A;  4FLV A;  5I3U A;  3I8D A;  3A2F A;  4FLX A;  1KFD A;  3NBP A;  1S6P A;  1S5J A;  1RDB A;  3OYC A;  4DLE A;  4FLU A;  1QTM A;  4FK0 A;  2HHV A;  1HYV A;  2ITG A;  4CEA A;  3NH0 A;  4FJN A;  1ZBH A;  3G10 A;  4CFB A;  1NJX A;  3MAQ A;  1Q9Y A;  1SV5 A;  4FM0 A;  2YKM A;  4CCH A;  1JKH A;  3AVC A;  1IKV A;  3VA3 A;  4F8R A;  3HXM A;  3V6D A;  4I9Q A;  4DTM A;  1L3T A;  1QQC A;  2ATQ A;  3I0R A;  4IG0 A;  3TAM A;  3KIO A;  4AHU A;  1FKP A;  1Y97 A;  4N47 A;  3LDS A;  5HLF A;  1R0A A;  1NK9 A;  4KI4 A;  2XY8 A;  3ZSX A;  3NAE A;  3QEP A;  4CIE A;  2XY6 A;  4DSJ A;  4AHS A;  1S1V A;  4Z0U A;  1K6Y A;  1TK0 A;  4OKK A;  3OYN A;  2QKB A;  2ZE2 A;  2ETJ A;  1ASU A;  4CJ3 A;  4BE2 A;  4KTZ A;  3HL8 A;  2F8S A;  1UWB A;  4FVM A;  5I42 A;  2IDO A;  3V9W A;  3RMD A;  3VQ8 A;  1HRH A;  3O4N A;  4BWM A;  3RMC A;  4OKE A;  4ID5 A;  1RBU A;  1X9M A;  4KB0 A;  1C1B A;  4FK4 A;  4W5R A;  3SUP A;  4CK1 A;  4CER A;  1L5U A;  4M3Y A;  4QOZ B;  4QAG A;  3LAM A;  1T8E A;  4KV8 A;  3M8Q A;  2Y1I A;  3KD5 E;  3KK2 A;  2GV9 A;  3TAG A;  3EYZ A;  3KLH A;  4C8K A;  1VSD A;  3SQ0 A;  3AVF A;  4Z4E A;  4IDK A;  1RBR A;  3RR7 A;  4DS4 A;  1RT6 A;  1FKO A;  4UQG A;  5HP1 A;  1EKE A;  3TAF A;  1NKB A;  1TAU A;  3IS9 A;  4DMN A;  4FLT A;  3RRG A;  3TAN A;  3CFP A;  1KVC A;  1B9F A;  2XHB A;  1LWC A;  1LAW A;  4DTS A;  3MXM A;  1Z25 A;  3NF8 A;  3PO4 A;  3RR8 A;  1WSG A;  4C8L A;  3I0S A;  3DRP A;  4EZ6 A;  3AA5 X;  3SPY A;  4GW6 A;  1B92 A;  1N6Q A;  4KHU A;  3V9U A;  3DI6 A;  1GOA A;  1DLO A;  4CJ5 A;  4E1N A;  3KK1 A;  2PZS A;  2VG5 A;  4W5T A;  3K5N A;  4CK3 A;  3K5L A;  4BDP A;  1FK9 A;  1JLB A;  3DLB A;  4PWD A;  2Z1H A;  3SUO A;  1HQU A;  3VQB A;  5E41 A;  4Q0B A;  3AA4 A;  3LAK A;  2KZZ A;  4LH5 A;  3OYJ A;  4OPJ A;  5KTQ A;  3ZT3 A;  4FLY A;  4DTN A;  2OA8 A;  4ELU A;  4CJP A;  4OGC A;  4PUO A;  2D0C A;  5FRN A;  1JL2 A;  3LAL A;  3SPZ A;  4CHZ A;  1LAV A;  1SUQ A;  3BDP A;  5CY4 A;  1RDA A;  3ZSW A;  3PX4 A;  1LWE A;  4O55 A;  3OJS A;  1UA0 A;  3UIQ A;  3PY8 A;  4E0D A;  3NHG A;  2YNF A;  1SKR A;  3C6T A;  4FM2 A;  4N41 A;  4BDY A;  4MFB A;  3ZSR A;  3AV9 A;  3CFR A;  1B9D A;  1L3S A;  3VQ9 A;  4CEC A;  2GBZ A;  3NGY A;  2KZM A;  4FYD A;  2G8I A;  3V1O A;  3NF6 A;  1UOC A;  1RTH A;  1NK4 A;  4JS5 A;  3OS2 A;  3AVH A;  4H4O A;  1S1W A;  4M3Z A;  4CHP A;  2OZS A;  2OZM A;  4YNQ A;  4N56 A;  4DQP A;  4CJF A;  4DTP A;  4CEF A;  2X6S A;  4E89 A;  4FZZ A;  3ZCM A;  3NH1 A;  1SKS A;  2RKI A;  4DFM A;  4DTR A;  3NCI A;  2A1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...