3VQAA

Hiv-1 in core domain in complex with 1-benzothiophen-6-amine 1,1-dioxide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
152
structure length
141
Chain Sequence
b'SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 52
structure length 141
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqaA00
1RDBA 2EX3A 3QETA 1SL2A 4KHQA 4FZZA 2KZMA 3VQQA 5T7BA 3SYZA 3HJFA 5J2PA 1JXBA 1D9FA 1IKYA 4DG1A 4LY7A 5HP1A 4E3SA 4CJEA 2I5JA 1KTQA 3K5OA 4Z4FA 1KCFA 1CZ9A 2YNGA 3IG1A 3KD5E 4DTNA 3RR7A 1RBTA 4CFAA 4OKKA 1BHLA 4DLEA 1D8YA 3V9ZA 3AO5A 4M45A 3PX6A 4W5RA 3LAKA 1S6QA 4CECA 4DFMA 4TSXA 1NK6A 1S9GA 2ITGA 4IG0A 4BWMA 3SCXA 1TK8A 4HUEA 4FLYA 3SPYA 1C0UA 3SJJA 4M3UA 4CJ5A 3RMAA 2P1JA 4CHNA 4J2EA 4CERA 4CHOA 4FJXA 4KV8A 4KKOA 3AA4A 4DFKA 4KHSA 1B92A 4OJRA 5C25A 4MFBA 4RW8A 3K58A 1ASUA 3S3NA 1BQNA 2HHVA 3AVJA 2BE2A 4PUOA 3NAEA 1VSFA 4O0JA 2BGGA 3M8QA 4OLBA 1NJYA 1GOAA 1UA0A 4FJJA 1RILA 4CF2A 4DU4A 3QEVA 4Y1CA 3OS2A 3CQ8A 2KFNA 4RW7A 4H4OA 2E4LA 4CJ4A 4IKFA 1WSJA 4CJSA 4N5SA 1T8EA 1J5OA 1YTUA 1CZBA 2Y1IA 3CG7A 3V9UA 4FM1A 2YHBA 1N5YA 3AVKA 2G8HA 1HNIA 3LP0A 3LWLA 3VQ9A 4BE0A 4FLVA 4IFYA 4CHQA 2KTQA 1ASVA 3AO2A 4CJTA 5HRSA 1A5VA 3P5JA 3NH2A 1S1UA 1S9EA 2RN2A 4XIUA 3QESA 2PYLA 4FJ8A 4HCBA 2D0AA 1VSMA 1G15A 1L3SA 2HHXA 3PO5A 3AO1A 1HYZA 3RMCA 4IG3A 5J2NA 2B6AA 4IBNA 4KHYA 3OJUA 3DLHA 4HTUA 3WNFA 2HVIA 1I3AA 1R0AA 1JLGA 3RWUA 4E7IA 3DRSA 2ATQA 3TAEA 3VQ5A 4I2QA 4OGCA 4FJIA 3H08A 4LSNA 4FJMA 2QK9A 4F2RA 4DSJA 1HQEA 4E7HA 2XRIA 4Z4CA 3TAGA 3SQ0A 2DY4A 4AHTA 4HHTA 2A1SA 4K8ZA 4Q0BA 4CEDA 3KK3A 4GW6A 4FLUA 3ITHA 4N41A 1WSIA 2ZQBA 4DS4A 2KW4A 3L2UA 3ZSQA 5JS1A 5FDLA 4EZ6A 4FYDA 1RT7A 3C95A 1VRTA 4CGGA 4PWDA 3BDPA 1RT6A 1FK9A 1J53A 4J2AA 1SUQA 1BCMA 4W5OA 3SNNA 4FLTA 2YNFA 1LAVA 4DMNA 1J54A 1SKWA 2QXFA 4FK4A 4KREA 3OS0A 5I3UA 3NF7A 4E1MA 1QE1A 1NK0A 3KKSA 2Z1HA 2G8WA 4B9LA 1KLMA 3SPZA 3VA0A 1L5UA 3LDSA 3LANA 2FBXA 1BIZA 3OYCA 2BDPA 4E0DA 3DLEA 2QKKA 3V9SA 1BI4A 1QSSA 4C8KA 4FJGA 3NH0A 2P51A 2X6SA 3SV4A 1JL1A 4RW9A 3DLBA 1WAJA 1X9WA 4DSFA 1RT3A 5KGXA 1U04A 1RBSA 2XY5A 3LALA 3V4IA 3VQCA 3MEEA 4CF0A 1Q9XA 1KRPA 4CJ3A 2Y1JA 2D0CA 4PA1A 3KD1E 3K2PA 5K14A 1JLQA 4NYFA 2HNZA 3DLRA 4C8NA 3OJSA 4LH5A 1RT5A 4E19A 4DF8A 4DWIA 2GUIA 2VWKA 1QHTA 2DFEA 4CJKA 3OYHA 3ULDA 4DTOA 3QEXA 3K59A 1IO2A 1B9DA 1I39A 4CIFA 3P1GA 4DS5A 4CEZA 4O0IA 4DQSA 5DK5A 1NJZA 3TAFA 4KPYA 4B9MA 1RTDA 3G10A 2KFZA 3JYTA 4FLXA 3PX0A 1NKCA 2G8KA 2X6NA 2HNYA 4EP4A 1Z26A 4IDKA 3VN5A 4KI6A 2HHTA 3AO4A 1RDAA 3SZ2A 2JGUA 1BI4B 3NH1A 3ZT2A 3A2FA 4FK2A 2G8UA 4GVMA 3AA3A 3CFPA 2F96A 4FCYA 4C8OA 3HPOA 1T7PA 2DFFA 4RG8A 3PY8A 3QIPA 3B6PA 2XY6A 2AJQA 2PY5A 3HPGA 4CJFA 4DTSA 3O4NA 1LWCA 1C6VA 1NOZA 3JSMA 4Z4GA 2VWJA 5KI6A 3U3YA 4FJ7A 1HYSA 1RDCA 2KZZA 1YTAA 4WE1A 4H4MA 1TKZA 3VQEA 3L2QA 4CF9A 5FROA 1D9DA 1DTQA 2OA8A 2IGIA 4KHUA 3IRXA 4C8MA 2PZSA 3THVA 5HLFA 3KLHA 3TI0A 1WAFA 4EZ9A 3HK2A 3TAQA 2FC0A 4LH4A 1U4BA 3ZSOA 1N6QA 1EKEA 4BE2A 4HUGA 3VQ4A 4CESA 3SUNA 5C42A 1S6PA 4L8RB 1VSDA 4PY5A 1VK0A 3SV3A 1FXXA 1RTHA 3QO9A 1T03A 3KK2A 2B4JA 4LSLA 3MXMA 1HPZA 3O3GA 4PQUA 1CXQA 3SQ4A 3K5LA 3DRPA 3HVRA 4DTXA 1C0TA 3HSTB 1BIUA 3D45A 2ETJA 3VQ8A 1WLJA 3I0SA 1TL3A 4O44A 2P5GA 3LP3A 4O5BA 4FJNA 3O3FA 3HP9A 5J1EA 1XHZA 2HB5A 3E01A 4JRPA 1F21A 4FZXC 3QERA 2XHBA 3LP1A 1W0HA 4B8CA 3OYLA 4DFPA 3RRGA 3EYZA 2NUBA 4W5QA 1UA1A 2W42A 4BDZA 1LWEA 1T05A 4M3ZA 1WSEA 4I9LA 3AVIA 3ISNC 3NGIA 1IH7A 4DTUA 3CM5A 1X9MA 4AHUA 4CHYA 3SUQA 1S1XA 1BQMA 1U45A 3ZCMA 3MECA 3NHGA 1XI1A 4NCBA 3TANA 1TGOA 1JLEA 1YVUA 3PO4A 3WNEA 1NOYA 1TKXA 5KGWA 2FBYA 1KVCA 4M41A 4CIEA 1KLNA 5C24A 1NJXA 4CJLA 2VG7A 3F9KA 2IDOA 2YNHA 3MXJA 4M3TA 4B9NA 3T19A 3AV9A 4YFUA 4CIGA 2G8IA 5J2MA 1KVAA 3NGZA 4CF1A 1TAQA 5KRSA 1JLAA 4AHCA 4FJ5A 4CF8A 1SL0A 3S3MA 1C1BA 1L3VA 1ZYQA 4CJUA 2YKMA 4E1NA 4FXDA 4KI4A 4FJLA 3AVFA 1JLCA 3G0ZA 2YHAA 1VRUA 2R7YA 4FLZA 4CHPA 3SUOA 4C8LA 3LAMA 1QTMA 3L2WA 3V9WA 5J2QA 1RBUA 3PUFA 2FBTA 1IKWA 1KFDA 2E6LA 4CFCA 4DSIA 4FVMA 4NCAA 3LPTA 1CXUA 3WNHA 3ZSVA 4KFBA 1SKSA 2HHWA 1LV5A 3OS1A 3TWHA 2X74A 5CY4A 4OPKA 4DSKA 4KO0A 1JLBA 4CCHA 2WOMA 2P5OA 3QIOA 4ZHRA 1BCOA 1L3TA 3VA3A 4H8KA 2O4GA 3L2RA 1QSLA 2IAJA 5KRTA 1Z25A 4BE1A 3DI6A 3HP6A 1DTTA 2OPSA 1HJRA 1RT4A 3NGYA 4KTWA 1KFSA 2YV0X 3HYFA 5CYQA 4M42A 4OLAA 1HNVA 3PX4A 1C1CA 3VQBA 1S5JA 1GOCA 1RTIA 4FJ9A 4F3OA 3UIQA 1NK4A 2G8VA 4E7KA 3ZSXA 3NCIA 1SV5A 1NK7A 1WSGA 4ID5A 1ZBLA 2ZE2A 1WN7A 3RR8A 4W5NA 4CK3A 1EXQA 4OGEA 3F73A 1J9AA 4Q5VA 3RRHA 3L8BA 1WSFA 3O4QA 5HRRA 4DQQA 3PV8A 3QEPA 4O55A 1BL3A 4HCCA 3BGRA 3TABA 3V1QA 2RKIA 1JKHA 4E89A 3KLGA 3EZ5A 4ICLA 4CJRA 4CEOA 4JS5A 1QS4A 1RCHA 3AVHA 4KB1A 4J2BA 2HVHA 1HRHA 3CYMA 4FJKA 1FKPA 4Y1DA 1C0MA 3DLGA 1TVRA 3KLIA 3RMBA 4DU3A 4QCLA 4FM2A 1RT1A 4FW1A 3OYJA 2Z1JA 1U47A 3NDKA 2OPPA 2Z1IA 4M3RA 1LAWA 1LWFA 4DTMA 4AHVA 4DQPA 1Q9YA 4R5PA 3ZT4A 2X78A 1NKBA 2HMIA 4W5TA 3OYGA 3OYDA 1MU2A 4M3YA 3ZT0A 2D0BA 4NCGA 5CZ1A 3HT3A 1VSLA 1ZBHA 3OYFA 1TV6A 1L3UA 3AVNA 3V1RA 2PYJA 1W9HA 3OYAA 3DYAA 1JL2A 3CFRA 1O1WA 3CFOA 3I0RA 3DLKA 3P83D 4IFVA 4FW2A 2BANA 3SUPA 1TAUA 3OY9A 4GMJB 3M8RA 3LZJA 1JXEA 4JS4A 4DSLA 1GOBA 2IOCA 3FFIA 2GBZA 1NK5A 1XHXA 4YNQA 1ZBFA 3AVBA 4DTRA 1NK8A 3M8PA 3L3VA 1RT2A 1TKDA 2FBVA 4CFDA 2IC3A 4ID1A 4I2PA 1KSPA 2A1RA 4ELUA 3RTVA 1TL1A 3LWMA 4KRFA 3D0PA 3EY1A 2DFHA 2HHUA 1JLFA 3LZIA 3SQ1A 1RBVA 4EP5A 3O3HA 3VQPA 3S9HA 3AO3A 1ZBIA 2O4IA 3NFAA 1HQUA 2LSNA 1EP4A 1XC9A 4QOZB 1FKOA 4N47A 2WONA 5HRNA 4I9QA 3DOLA 3L2VA 2Q3SA 4BDPA 2HHQA 4I7FA 1WSHA 2HNDA 3KJVA 3LP2A 3VQ6A 4FM0A 4OPJA 1A5WA 2EHGA 5SWMA 4F3TA 1NK9A 4ELVA 1CLQA 3QNNA 1Y97A 3TAMA 1Q8IA 3OYIA 2IS3A 3C94A 1ITGA 4HUFA 4AILC 4CK1A 4Z0UA 1UWBA 3AVAA 5DMRA 4ZTJA 4MQ3A 3K5MA 2OZSA 4FK0A 1BISA 3QEWA 4B9SA 1X9SA 1KVBA 5HROA 1TKTA 1REVA 1RDDA 1HMVA 3CM6A 4Z4HA 4DF4A 1IG9A 3ZSZA 2Z1GA 4AH9A 1DLOA 3K5NA 3MAQA 3TAPA 3AVLA 4N76A 3C6UA 5FRMA 4CEQA 3ALYA 1VSIA 3IAYA 1LW2A 1IKXA 3DMJA 4G1QA 4KTZA 3QEIA 3NE6A 2F8SA 4Z4IA 3C6TA 4B9TA 1U49A 1VSKA 5I42A 4OVLA 1NKEA 3L3UA 2YKNA 3M8SA 2VG6A 5KTQA 1S1WA 2YNIA 3ZSWA 4AHRA 4CGHA 2KQ2A 4AHSA 4UQGA 4FJHA 4CJQA 3HVTA 4J2DA 3VQAA 3AA2A 3V9XA 1UAXA 5HRPA 4DSEA 3DM2A 2OZMA 4KB0A 1QQCA 3AA5X 4F2SA 3HPHA 4DTPA 4DFJA 1IKVA 4DQRA 4F8RA 3WNGA 4CEBA 4CGFA 4ZTFA 4KTQA 5CYMA 3ASMA 4FZYA 2HW3A 4DLGA 1VSJA 2B5JA 4BWJA 4FLWA 3KTQA 1UOCA 4ELTA 2G8FA 3B6OA 4O4GA 4QAGA 4CJVA 5E41A 4CFBA 1VSEA 4Z4EA 4B08A 3QNOA 2HHSA 1EETA 2DTUA 1X1PA 5CZ2A 1BGXT 2F8TA 3HXMA 3AVGA 5JS2A 1HYVA 3AVMA 4DTJA 4RW6A 4B3OA 1YT3A 3AVCA 3NBPA 3HM9A 2E6MA 2OPRA 3OYEA 3KIOA 3U6FA 3MEGA 3SI6A 5D3GA 3ZSRA 4CGJA 3KLEA 3V6DA 1SL1A 5HBMA 4CEEA 1SKRA 2ZD1A 4E7LA 4DU1A 1TK5A 1QSYA 4M3XA 1XWLA 3T3FA 3MEDA 4B8AB 1RTJA 4B9UA 2OYQA 3KK1A 4BACA 3RMDA 3I8DA 4KHNA 1RNHA 2XY8A 4CEFA 3DOKA 1ZBUA 3OYMA 3IS9A 2XO7A 3HL8A 3U3GA 1U48A 3DRRA 3QINA 1VSHA 4B9VA 2JLEA 3OYBA 2XY7A 4CK2A 3OVNA 2VG5A 3ZT1A 4CEAA 3V81A 1C1AA 3S3OA 4CGIA 4LD0A 3TARA 3NF6A 3OYNA 4M3WA 3HO1A 4KHWA 1S1VA 3V1OA 4JRQA 1A5XA 1EX4A 5EU7A 4E7JA 4N56A 1S1TA 2RPIA 3LPUA 2GV9A 3NF9A 4CJWA 4NYNA 3QLHA 2QKBA 1B9FA 2D5RA 2RF2A 3K57A 4BDYA 3KLFA 4JLHA 3NF8A 3OYKA 1TK0A 1D5AA 1K6YA 4CHZA 3KKRA 3T1AA 4CJPA 4DQIA 4F4KA 4RW4A 3SQ2A 1WNSA 1NJWA 3TR8A 3ZT3A 5SZTA 4K8XA 2OPQA 4OKEA 3VQ7A 4OKJA 1LW0A 3MXIA 5FRNA 3ZSYA 1RBRA 4HVJA 4CE9A 3VQDA 4KAZA 1ASWA 4CGDA
chains in the Genus database with same CATH superfamily
1RDBA 5KPRA 4KHQA 3C6HA 5T7BA 1OH6A 2CGKA 4DG1A 4WCEL 3A5NC 2I5JA 4IO9L 2O8EA 4Z4FA 1KCFA 1CZ9A 2NRTA 3KD5E 3GG4A 1ZC6A 3V9ZA 4G9ZA 4IXCA 3CCLN 3LAKA 3SK3A 1NK6A 1S9GA 4IG0A 2UUAK 4IOAL 2EWSA 4FLYA 2AP1A 1YIJN 3SJJA 4CJ5A 3VEOA 3RMAA 4CERA 4CHOA 1K8KB 3MK6A 3CPEA 5AQRA 4H5WA 5C25A 2NRWA 4RW8A 1ASUA 3S3NA 1BQNA 3ZYYX 2HHVA 3AVJA 3MX5A 4K43A 3VEZA 1NWKA 1XMOK 3M8QA 4C23A 2BGGA 1GOAA 4IO8A 1YITN 1RILA 2P9UB 2VGMA 4KH5A 3SAHA 4CJ4A 1XC3A 1WSJA 1VQ5N 2QWRA 5C2FA 3SBGA 4B1XB 3QFPA 5BRFA 1ASVA 5HRSA 1A5VA 3NH2A 3T7ZA 3QESA 4FPBA 4HCBA 1L3SA 1IBKK 4KHYA 4IBNA 2HVIA 3BY5A 1FW6A 3RWUA 3RVCA 3J7YP 3VQ5A 4FJIA 4FJMA 4LSNA 4CZIA 1T3VA 4WFAL 4F2RA 2DY4A 3SQ0A 2OTLN 1OKJA 1X3MA 4DS4A 3L2UA 3K0SA 1QQMA 5FDLA 5BR9A 4YOWA 1VRTA 4IEIA 4PWDA 3BDPA 4J2AA 3I55N 4FK4A 3HM8A 1J5EK 4E1MA 1NK0A 3CF5L 3KKSA 2Z1HA 2P9NB 2BDPA 4A2AA 1LCUA 3Q7BA 4E0DA 3V9SA 1SQKA 4FJGA 3CCEN 1S3XA 1JL1A 3BEXA 4OPHA 3CD6N 1R59O 3T1HK 4LF9K 2O8BB 3D2FB 3WEEB 2XY5A 3V4IA 4LF5K 2Y1JA 2D0CA 2E2QA 4A57A 3K2PA 5K14A 4U67L 3OJSA 3EO3A 4LH5A 4E19A 1D4XA 3QEXA 3MCAB 3D6RA 1B9DA 3BZKA 1YJ9N 4BR5A 3FGUA 3G10A 4FLXA 4KI6A 4IDKA 2ASPA 4BC2A 3A2FA 1N33K 3HPOA 1T7PA 3B6PA 2WUSA 1XUPO 4DTSA 1LWCA 4YORA 1NOZA 4EHTA 4BVOA 2VWJA 5KI6A 4FJ7A 3HOSA 4DV3K 5FROA 1VAZA 2IGIA 3R1XA 4KHUA 3IRXA 2GX9A 4C8MA 4OX9K 4GV6A 5JVGL 3TI0A 4EZ9A 1YI2N 4NB4A 1EKEA 5M1OA 4BE2A 1QVGM 3SUNA 4L8RB 4PY5A 3SV3A 1RTHA 3J8AA 1T03A 2B4JA 3O6WA 3MXMA 2HBMA 1CXQA 2NRVA 3SQ4A 5BRDA 2ZM6K 1VQ9N 1BIUA 3D45A 3VQ8A 4BR7A 1TL3A 3ZETB 4LFBK 4HTLA 3CQYA 3I8BA 1HLUA 3E01A 3QERA 3LP1A 3WUHA 1W0HA 3OYLA 5AQMA 3EYZA 2NUBA 4W5QA 3HTVA 4I9LA 3CCSN 2O8FA 1X9MA 4AHUA 4CHYA 2QWLA 1S1XA 3ZCMA 3MECA 3SAGA 3NHGA 3BUZB 4BR0A 1YVUA 1NOYA 2V7YA 5KGWA 1KVCA 1BUPA 2ZGYA 3F9KA 1QHAA 2HF3A 5ADXA 1E4GT 1KVAA 1SL0A 4FWSA 3S3MA 1L3VA 4E1NA 3ZEUA 4BREA 2IVPA 1QTMA 3L2WA 3V9WA 2CGLA 1KFDA 4NCAA 2E6LA 4DSIA 1Q18A 3ZSVA 4KFBA 5CY4A 2NLXA 4B1UB 4KO0A 1JLBA 4DKWA 4F9OA 2NRHA 3H46O 2GWKA 1L3TA 3VA3A 3L2RA 1Y64A 4BRFA 5KRTA 4JD2A 4BE1A 3DI6A 3HP6A 4EHUA 2OPSA 1RT4A 5CYQA 3WXJA 5AZIB 1RDUA 5JLFA 1HNVA 4GV3A 3IKMA 3LDLA 1GOCA 5CE3A 1RTIA 4FJ9A 4F3OA 3UIQA 1NK4A 2F7TA 4JV5K 1NK7A 2QEXN 4ID5A 4W5NA 2ZE2A 3RR8A 4OGEA 2P9IB 4Q5VA 3L8BA 5LL6Z 3I56N 4IEEA 2GUPA 2RKIA 3V1QA 3E1YA 1QS4A 3H6EA 4J2BA 3CYMA 2CH6A 1C0MA 2D0OA 4CZFA 4DU3A 4QCLA 1SS6A 4B1WB 2P9LA 1WOQA 2Z1JA 4M3RA 4AHVA 4R5PA 4M3YA 1VQKN 4JK9A 5LY3A 1VSLA 2PYJA 4MLEA 4YOYA 3UKRA 3DXMB 4IJNA 3DLKA 3P83D 4X62K 3VETA 3M8RA 2Q0RA 1GOBA 2IOCA 2GBZA 1NK5A 1ZBFA 2AA4A 3VPZA 3L3VA 3SMSA 2IC3A 4I2PA 1KSPA 5GAGP 4ELUA 5AQQA 1TL1A 4KRFA 1KAXA 5AJ3K 1RBVA 1U6ZA 1XC9A 4QOZB 2WONA 3MX2A 1NU0A 1Z05A 3L2VA 2Q3SA 4BDPA 4I7FA 2YJEA 4BGBA 4OPJA 1A5WA 3FE1A 2EHGA 2P9KB 3O08A 4QS9A 4ELVA 4BGAA 3KZBA 3VTIA 3OYIA 3THYB 2IS3A 1TYQA 4YDUC 4Z0UA 1UWBA 3AVAA 5DMRA 4MQ3A 3K5MA 2OZSA 1BISA 2QM1A 5HROA 2IIRA 1QVFM 3CM6A 4C8OA 1IG9A 3TAPA 5FRMA 3VGKA 2A3ZA 4FWMA 4KTZA 1XNQK 1U2VB 4MDBA 5LJVA 4Z4IA 2YHYA 3P38A 5CR4A 1U49A 1MA9B 4DB3A 1DGKN 1BDGA 3IFRA 2VG6A 1BA1A 3HK2A 3A8YA 4FJHA 4J2DA 3AA2A 3ULEB 4DSEA 3DM2A 2OZMA 4KB0A 4BC3A 3AA5X 1K9MO 3AARA 4DQRA 3HI0A 1JCFA 4CGFA 4B3SK 4NLCA 1ILYA 1GLCG 4KTQA 5CYMA 4B9QA 5ELZA 1C0FA 1OVQA 2B5JA 4FLWA 3B6OA 4O4GA 4QAGA 4CJVA 4Z4EA 2HHSA 2DTUA 2ZJRL 1X1PA 2F8TA 2QTDA 3AVGA 3ID6A 3AVMA 3AVCA 3VEWA 5BR8K 1IV0A 3KIOA 3VEYA 4KHPK 4JI1K 3SI6A 5D3GA 1TUYA 4CGJA 4CEEA 4JI6K 1XWLA 5C2DA 2FF6A 1RTJA 4B9UA 1H1VA 4LC9B 3D7EO 1C0GA 2O8CB 3OYMA 3U3GA 4H0PA 4B9VA 1WUAA 2JLEA 3OYBA 2XY7A 2VG5A 1HKBA 3VTHA 3WXLA 4CGIA 4LD0A 3TTFA 5AQJA 3LL3A 1GLJO 4CJ7A 4DQ8A 3D2EB 4E7JA 3LPUA 2RPIA 1E4FT 4CZGA 4CJWA 3L4QA 2O8DA 1HR0K 3K57A 3KLFA 1KQSM 1HNWK 1D5AA 3KKRA 3JXUA 1MWMA 2E2PA 1NJWA 2PFUA 1YJNN 4BRMA 3MXIA 3VEXA 4CGDA 1NG9A 3TTCA 3HJFA 1JXBA 1IKYA 4LY7A 3EZWA 1KTQA 3K5OA 3T69A 1NGJA 1BHLA 5AZJB 1NGEA 3AO5A 4W5RA 1S6QA 4H0TB 4CECA 3C7NA 4DV5K 2UXBK 2QWOA 1X3NA 3EE8A 4HUEA 3LDQA 2I7NA 4H0VB 4WQ5C 4M7YA 2P1JA 4CHNA 4H03B 2E20A 1EWRA 4FJXA 3AA4A 4MFBA 5AQXA 4CBUA 1VSFA 4O0JA 2RE2A 4IOCL 2Q97A 4Y1CA 4X65K 2KFNA 4H4OA 2E4LA 4IKFA 1T8EA 4CJSA 4V19S 1YTUA 4FM1A 1N5YA 3AVKA 3LWLA 3VGMA 3U9DA 3J81O 1TUUA 4B3MK 2RN2A 4JI8K 2PYLA 4FJ8A 2D0AA 1BO5O 1HYZA 1P90A 5J2NA 3PLAA 3WNFA 4FWQA 3AAQA 2W40A 4E7IA 4H0XB 2ATQA 4BRQA 3TAEA 2OTJN 4FWOA 3VF6A 3CERA 1GLDG 2QK9A 5AQLA 4DV0K 4HHTA 3O9QA 4FWRA 4Q0BA 3KK3A 3P31A 4JKGA 2ZQBA 4FYDA 3CMEN 3C95A 1RT6A 2UUCK 1BCMA 3SNNA 2HBJA 2YNFA 1LAVA 4BR9A 4FLTA 3M3ZA 2QXFA 3H1VX 3E66A 2BH1A 4JI5K 1QE1A 2G8WA 3OYCA 2FBXA 1BIZA 1QQNA 1QSSA 1BOTO 3NH0A 1X9WA 4BRDA 5FPMA 4I6MA 3A0IX 1U04A 3F5TA 3H3NO 3VQCA 1Q9XA 1KRPA 3CC7N 4CJ3A 4PA1A 2HNZA 3DLRA 1RT5A 5A2QO 4CJKA 3OYHA 5KPTA 5BRHA 4DS5A 1NBWA 1NKCA 2X6NA 1Z26A 1SAZA 2BUPA 5TKYA 3AO4A 1RDAA 1BI4B 4GVEA 4JD2B 3ZT2A 3VF4A 4GVMA 2G8UA 1DKGD 3QIPA 2XY6A 3NMUA 2AJQA 4CJFA 3JSMA 1BG3A 1HJOA 1D9DA 4R79A 1DTQA 2PZSA 1V4SA 2A42A 3KLHA 4ISFA 1WAFA 3TAQA 4LH4A 3ZSOA 1N6QA 2VGNA 5TKWA 3VQ4A 4ILJA 3JAMO 1FJGK 1S6PA 1HPZA 3O3GA 4PQUA 3ENBA 1NNEA 3K5LA 3DRPA 3CCUN 4LF4K 2A40A 1S72N 4C1NI 5DM7L 3MWTA 1GLAG 2QI2A 2WFBA 5AFUH 2HB5A 4JRPA 1F21A 3CCMN 4FZXC 2XHBA 4KBOA 4DFPA 3RRGA 3VEVA 4AF1A 2W6KA 4CD1A 2V52B 5M1PA 3NGIA 4DTUA 1NM1A 1BQMA 3QBXA 4RTFD 4JKAA 1XI1A 4NCBA 4AM7A 4DV7K 3TANA 1TGOA 3PO4A 3WNEA 4M41A 1KLNA 3FR0A 3MXJA 2G8IA 5JMVA 3NGZA 4JI7K 2P9SB 4FJ5A 3FZKA 1C1BA 3N4QA 1ZYQA 4CJUA 3DXKA 2E5LK 1JLCA 3SUOA 2R7YA 1VRUA 3P39A 5AQOA 2UYTA 4CZLA 5J2QA 1OH8A 1IKWA 3LDPA 4DV2K 4GY2B 3AGKA 1LV5A 2Q36A 3TWHA 2WOMA 2P5OA 4ZHRA 1BCOA 2DPNA 2O4GA 4BR2A 3O9UA 1NGHA 5KQDA 1Z25A 3DLLL 2A41A 1K73O 4KTWA 2VQEK 4M42A 2YV0X 2W6LA 3GDQA 4K41A 4OLAA 4CZKA 3PX4A 1S5JA 2QW9A 3CCVN 5BPMA 4E7KA 2F4VK 3ZSXA 1SV5A 4MLHA 1WSGA 1WN7A 4MO4A 1EXQA 3CI5A 3F73A 1WSFA 3O4QA 5HRRA 5CHIA 4DQQA 3FZLA 1BL3A 1O13A 4JS5A 5KPZA 4CJRA 5AQKA 2YHWA 4H5RA 4NXNK 1HRHA 3KHYA 1TVRA 3KLIA 4L3QA 1YXQA 4FW1A 4PKIA 4A2BA 2Q0UA 1U47A 3NDKA 2OPPA 2Z1IA 4DQPA 1LWFA 4DTMA 1YJWN 3ZT4A 2X78A 4W5TA 2I7PA 2NRXA 1VQ6N 3HT3A 3FZMA 2HBKA 3OYFA 5EOYA 3O9TA 3AVNA 1W9HA 3DYAA 1JL2A 1Q86O 1NGFA 1P8ZA 1O1WA 3I0RA 4IFVA 4FW2A 4JNEA 2BANA 3G4SN 3LZJA 1JXEA 2UXCK 3FFIA 4YNQA 1NK8A 1RT2A 1TKDA 4UY8O 2FBVA 3THWA 4ID1A 1NMNA 2HHUA 1T44A 4AQYK 2O8DB 1XQSC 4EP5A 3O3HA 3VQPA 1VQ7N 1HQUA 1FKOA 4N47A 4I9QA 4ISEA 5GADP 3KJVA 1RDWX 2Q2RA 3FZFA 3VQ6A 3CHWA 1ATNA 1N8RO 4BVPA 2PAVA 1Q8IA 1YHQN 3K9KA 4AILC 4RCHA 5FPNA 2FLOA 1KVBA 3A5OC 2E88A 4Z4HA 5AQFA 4AH9A 3MAQA 3ALYA 1VSIA 3IAYA 3QEIA 2F8SA 3C6TA 3DAWA 4WYBA 3VESA 4B9TA 4JKFA 4K0KK 2IVOA 1X9JA 1VQON 3L3UA 3M8SA 5F2RA 4AHRA 4WF9L 4AHSA 3UKUB 3HVTA 4WQ4A 3HBTA 1NGGA 3CPWM 1UAXA 3V9XA 3EEQA 4F2SA 3HPHA 4DFJA 1XNRK 4F8RA 3WNGA 1K8AO 1J6ZA 4MDAA 3J80O 2HSTA 4DLGA 3KTQA 4ELTA 3KVGA 3QMLA 3GL1A 3RSEA 4DR2K 1VSEA 3SJHA 4B08A 3OA9A 1EETA 3ZX3A 1BGXT 1HYVA 4RW6A 2E6MA 2OPRA 3OYEA 5BN8A 3QB0A 3ZSRA 3KLEA 2E1YA 4AM6A 5AQZA 1TK5A 4E7LA 1NGDA 4BROA 1QSYA 4M3XA 3T3FA 4B8AB 3ZX2A 4JK8A 4KHNA 4BR4A 2XY8A 2NRZA 3DOKA 4FOIA 5GAHP 1QQOA 1U48A 2A6AA 3QINA 2QA4N 1VSHA 3HZ6A 3OVNA 3HO1A 1S1VA 4JKGB 4GKKK 2HOEA 5EVZA 5EU7A 4N56A 1S1TA 3NF9A 4BDYA 2RF2A 4JLHA 3BZCA 4JKDA 3T1AA 4F4KA 3SQ2A 1MDUB 5JVHL 1G99A 2OPQA 4OKJA 1LW0A 2P9PB 4KAZA 1ASWA 2EX3A 1SL2A 2KZMA 3VQQA 5J2PA 1D9FA 5M1KA 4JYAK 2KLAA 5FLXO 4CJEA 5M1NA 3SLCA 2YJFA 4DTNA 4B3TK 3RR7A 1RBTA 4DR6K 4OKKA 1D8YA 4YOXA 4M45A 3PX6A 3T1YK 1NLVA 3KK7A 4DFMA 3OTOK 4BRIA 4BWMA 3B8AX 3SPYA 3TU5A 5C12A 1C0UA 2Q1NA 3J7AP 2FSKA 1WBBA 4KV8A 4KKOA 4DFKA 4KHSA 4OJRA 5BREA 4FWKA 4NXMK 4PUOA 3NAEA 3M6GA 4OLBA 3BP8A 4BC5A 2O8EB 3EKSA 4FJJA 3O1BA 4CF2A 4DU4A 3QEVA 3OS2A 4H5VA 5B8HA 4N5SA 1J5OA 4DR7K 4DV1K 3V9UA 2YHBA 4BE0A 2KTQA 4FLVA 4IFYA 4CHQA 4Y0WA 4CJTA 3OBYA 4BQZA 1S1UA 3QBWA 1S9EA 3ENHA 4BRAA 1VSMA 3E9OA 2HHXA 4U7BA 3AO1A 2P9NA 3RMCA 2B6AA 3OJUA 3VMFB 4LFAK 1I3AA 1N36K 1QZ6A 3DRSA 3H08A 4Z94A 1HKGA 3TAGA 2O8BA 4Z4CA 1HUXA 5AR0A 4AHTA 2A1SA 3D2FA 3WEEA 4CEDA 4FLUA 3SMPA 3ZSQA 4KH6A 5AQUA 1YF5L 2WBNA 4CGGA 4WFBL 1FK9A 3ATVA 2HBLA 4FL9A 4JI0K 1SUQA 4NLBA 1SKWA 2ZGZA 4KREA 3OS0A 5I3UA 3FLCO 1KLMA 3VA0A 3LANA 4PKGA 4CZMA 2QKKA 4C8KA 1N34K 3VENA 2P51A 4LF8K 3SV4A 4RW9A 3DLBA 5E84A 4DSFA 3DJCA 4BQLA 5KGXA 1RBSA 3LALA 3MEEA 3AY9A 1IJJA 4NYFA 5BPNA 3GE1A 2GUIA 1QHTA 2DFEA 4DTOA 4CIFA 2NRRA 4CEZA 4KPYA 1RTDA 2KFZA 1KXPA 4BY9C 2G8KA 2UXDK 4EP4A 2HHTA 2JGUA 3NH1A 1JCEA 3CFPA 4M7XA 3L0QA 4JKBA 3BF3A 4FCYA 2DFFA 4RG8A 3PY8A 2D4WA 3W3DA 4DR3K 3C65A 1C6VA 3ZETA 3U3YA 3CJ7A 1RDCA 2E2OA 1YTAA 4WE1A 2RHKA 3WQTA 1HYSA 3L2QA 2KZZA 4CF9A 3G25A 3THVA 5E26A 4B1YB 2VQFK 3MWPA 5LJWA 4HUGA 2OCEA 4CESA 1VSDA 3KK2A 1YUWA 4C1NK 4M63C 4XH1A 2OANA 2IVNA 1C0TA 3HSTB 3F9MA 1GLBG 2ETJA 1NJIO 4PL8A 3LP3A 4O5BA 2WTUA 4EAHD 3QFUA 3H45C 3C0BA 3CCRN 1LWEA 4O5FA 2BTFA 4PHTX 3AVIA 1IH7A 4PKHA 3SUQA 1MWKA 2YX6A 5ADXH 4LF6K 2NZTA 3THWB 3CCQN 1JLEA 1TKXA 3HRGA 4CIEA 1VQLN 5C24A 4CJLA 2IDOA 5EY4A 4M3TA 4B9NA 3AV9A 3LDOA 4YFUA 5J2MA 5AZIA 4CZJA 5KRSA 4MO5A 4E1JA 1JLAA 4HWIA 4AHCA 2YKMA 4KI4A 1CZAN 2FXUA 2YHAA 3G0ZA 1SZ2A 3WXKA 4JHDA 3TSQA 4CFCA 5MLCQ 2P9IA 3LPTA 3WNHA 1SKSA 2HHWA 2O8FB 3CXCM 5LMUK 4DSKA 1W7AA 5C15A 4CCHA 3QIOA 4H8KA 4J8FA 5C0YA 1DTTA 1KFSA 3GBTA 3NGYA 4H5TA 4NO7A 4GNIA 3THXA 1C1CA 5EXWA 1HX1A 1NMDA 3MMVA 1NGBA 3ZEUB 2G8VA 1Q7YO 4DV6K 1ZBLA 2V51B 4CVNE 4O8KA 3DXMA 4O55A 4BRPA 3VF2A 3HSCA 3L6QA 3E9PA 4DR5K 5GIOA 2VWBA 3BGRA 3EZ5A 4QS7A 4ICLA 4CEOA 1RCHA 3AVHA 4KB1A 4OPAA 1BWFO 3W0LA 3L4IA 2HVHA 4FJKA 4Y1DA 3DLGA 3WXIA 3RMBA 1RT1A 3FZHA 4BRHA 3OYJA 5AQTA 3OYGA 1MU2A 3KWGA 2D0BA 4YHHK 1ZBHA 1L3UA 3CFRA 1NGAA 3AAPA 3CFOA 3PIPL 5AQSA 3THYA 4JS4A 1XHXA 1YVNA 3AVBA 4DTRA 3WT0A 4FOEA 1LOTB 4JKCA 3RTVA 4O8UA 2P9LB 1U2VA 3LZIA 3SQ1A 3R8EA 3OW2M 3S9HA 2O4IA 2LSNA 1EP4A 4CZHA 5HRNA 3DOLA 2HNDA 2GELA 2KKZA 3ULEA 4B3RK 4F3TA 3UKRB 4IFEA 3CETA 1CLQA 3C94A 3IDHA 3ZX0A 4HUFA 4CK1A 3MN7A 4FK0A 1X9SA 1REVA 1RDDA 1HMVA 4DF4A 3ZSZA 2Z1GA 3K5NA 4N76A 4CEQA 1ESVA 1LW2A 4G1QA 3NE6A 5AQNA 2YI1A 3TSUA 4UQGA 2KQ2A 3VQAA 3IUCA 3VERA 4JI4K 3O80A 4CEBA 1TYQB 2O8CA 1VHXA 3H3OB 3LDNA 3QNOA 3Q7CA 1IBLK 5CZ2A 5JS2A 4B3OA 1VQNN 1ZBSA 4DR4K 3D2EA 5GINA 3EE9A 3U6FA 3MEGA 3R3LA 4RWTA 3V6DA 2E1ZA 1SL1A 3M5RA 4WQ4C 2ZJPL 3MEDA 4IOXA 4BACA 3U8XA 1XMQK 4A61A 2XO7A 1KAYA 3HL8A 3CCJN 1V4TA 3CC2N 4CK2A 3ZT1A 4CEAA 1C1AA 3M1FA 3TARA 2ZF5O 1IBMK 3NF6A 3OYNA 4M3WA 1EO1A 1W2BM 2VYPA 3V1OA 1A5XA 1EX4A 1VQ8N 3MN6A 5AQYA 1EWQA 3TTDA 5AZJA 4BRGA 3QLHA 2QKBA 1QZ5A 1B9FA 2D5RA 3NF8A 1K6YA 4CHZA 4CJPA 4RW4A 3TR8A 3ZT3A 5JLHA 4OKEA 4CI6A 3ZSYA 1RBRA 4CE9A 4FWPA 3VQDA 2JWLA 4BRCA 3QETA 4FZZA 5AQVA 3SYZA 1RGIA 5HP1A 1GLFO 4E3SA 2J4RA 3NVKA 2YNGA 3IG1A 4YOVA 5C10A 1N32K 3EN9A 3PSFA 4CFAA 4DLEA 4A62A 2HF4A 4K25A 3EL2A 4IDHA 3VOVA 4TSXA 2ITGA 3O9SA 3SCXA 2GWJA 1TK8A 4M3UA 4J2EA 1OVYA 4JI2K 5AQPA 4B1ZA 2E2NA 5BPLA 1B92A 3K58A 1E3MA 2BE2A 4JKHA 1NJYA 1UA0A 3CQ8A 4RW7A 2WC9A 4FPAA 1CZBA 2Y1IA 3CG7A 5AQIA 2G8HA 2GTDA 1HNIA 3LP0A 3VQ9A 3C7NB 3AO2A 2F9TA 3P5JA 1VQMN 3O8MA 5FPDA 4XIUA 4A5BA 3O9RA 1G15A 3U4LA 5KQ8A 3PO5A 4IG3A 3S41A 3DLHA 4HTUA 4XH5A 2E8AA 1R0AA 1JLGA 1VQPN 3O4WA 5GAEP 4I2QA 4OGCA 3C6AA 1W97L 4FWLA 4DSJA 1HQEA 2F9WA 2XRIA 3BF1A 4E7HA 4BRLA 3UE5A 4K8ZA 4FO0A 4GW6A 4XEIA 3ITHA 4N41A 1WSIA 2KW4A 5JS1A 4EZ6A 1RT7A 1J53A 5HOOA 4W5OA 4WFNL 4DMNA 1J54A 3QDKA 3NF7A 4IJAA 2UUBK 4B9LA 3CJ9A 3ID8A 3SPZA 2W41A 3LDSA 1L5UA 5IWAK 3DLEA 1BI4A 3OHRA 1IG8A 4CZEA 2X6SA 3MDQA 1WAJA 4CBXA 1JJ2M 1HPMA 1RT3A 3SAFA 4CF0A 1S22A 4FSVA 3OBWA 3KD1E 4JK7A 1JLQA 4C8NA 5AQGA 5LMNK 4DF8A 4JHDB 4DWIA 4DCHA 2GEMA 1OH5A 2VWKA 3ULDA 2ITMA 3K59A 1IO2A 5F0XA 1I39A 3P1GA 5AQWA 5AQHA 4O0IA 4DQSA 5DK5A 1NJZA 3TAFA 4B9MA 3JYTA 3PX0A 2HNYA 2QWNA 2HMPA 1K8KA 3VN5A 3SZ2A 4QS8A 2JWKA 2VCPA 3ENOA 4FK2A 3AA3A 2F96A 3CJCA 4I6MB 3THXB 3HPGA 2PY5A 3O4NA 4DUYK 4Z4GA 2D1KA 2P9UA 3LM9A 4H4MA 1TKZA 3VQEA 2OA8A 3CJAA 3TSPA 5HLFA 3A5LC 4YOUA 2FC0A 4CD3A 1U4BA 4FWNA 5C42A 1M1KO 3FFKB 1VK0A 4A5AA 1FXXA 3QO9A 5JICA 4LSLA 3H1QA 2FF3B 3PSIA 4CBWA 3HVRA 4DTXA 4XH4A 3A5MC 1WLJA 3I0SA 3CJBA 2CH5A 1VQ4N 3TPQA 4O44A 2P5GA 3ZLJA 2P9SA 4FJNA 3O3FA 3HP9A 5J1EA 1XHZA 3WQUA 4B8CA 3PIOL 1UA1A 2W42A 4BDZA 1T05A 4M3ZA 1WSEA 1Q82O 3IMXA 3ISNC 5AFUA 3CM5A 4ISGA 1U45A 4LF7K 1DEJA 1YAGA 2ZWHA 1HKCA 3WXMB 2FBYA 1NJXA 2VG7A 2YNHA 3T19A 4CIGA 1RFQA 4H0YB 4CF1A 1TAQA 4CF8A 3F2KA 4A59A 4FXDA 2QWPA 4FJLA 3AVFA 4FLZA 4CHPA 4C8LA 1Z6RA 3LAMA 4H5NA 1RBUA 4YY3K 3PUFA 2FBTA 2V7ZA 4FVMA 2FSJA 1CXUA 1BU6O 3OS1A 3JS6A 2X74A 4OPKA 2ASMA 4PL7A 2H3GX 3MN5A 5EX5A 1Q81O 4BRKA 1QSLA 3CMAN 2IAJA 3I33A 2QXLA 4JN4A 1ZXOA 1DT9A 1HJRA 3HYFA 2D0PA 3VQBA 1GLLO 5F1XA 2A5XA 3DXKB 4EFHA 4JKEA 3NCIA 4DUZK 2HHHK 4CK3A 1J9AA 3RRHA 3QEPA 3PV8A 4HCCA 1HNZK 3P4IA 3TABA 4E89A 1JKHA 3KLGA 4B1VA 3GOIA 3QICA 4GV9A 2CGJA 1FKPA 3KWIA 4K42A 4FM2A 1NGCA 1ATRA 5M1QA 4H0OA 1LAWA 3R6MA 4LFCK 1Q9YA 1NKBA 4JI3K 2HMIA 3OYDA 3CQXA 3ZT0A 4X64K 1KC8O 4NCGA 5CZ1A 3DWLA 1TV6A 3ATUA 3V1RA 3OYAA 1BA0A 4ILHA 4BG8A 4YDUA 3SUPA 1TAUA 3SBTA 3OY9A 2PBDA 4GMJB 4DR1K 4DSLA 4OO1J 3M8PA 2ASOA 2QWQA 4CFDA 4GKJK 2A1RA 3G6EN 3LWMA 1T6CA 3D0PA 4ILGB 3O5BA 2FSNA 3EY1A 3N4PA 2DFHA 1JLFA 5IT9O 5DM6L 5BN9A 3AO3A 1ZBIA 3NFAA 3MCPA 3UB5A 2HHQA 1WSHA 3UKUA 3O1WA 3LP2A 4FM0A 2YHXA 3MN9A 5SWMA 3U9ZA 1NK9A 4IWVA 3QNNA 1Y97A 3TAMA 1ITGA 4ZTJA 2QWMA 3QEWA 4B9SA 3G71N 1TKTA 3E9LA 4X66K 5M1FA 1NGIA 1DLOA 3K9JA 3AVLA 3C6UA 3NVMA 5H1SQ 1IKXA 3DMJA 1VSKA 5I42A 1KAZA 4OVLA 1NKEA 4FVUA 2YKNA 2KHOA 5KTQA 1S1WA 2YNIA 3ZSWA 4CGHA 4CJQA 5HL7L 1WB9A 4KH4A 5HRPA 1QQCA 3J7ZO 4DTPA 1EQYA 3CC4N 4JEPA 1IKVA 4ZTFA 2ZJQL 1JCGA 4IZ9A 3ASMA 4FZYA 2HW3A 4BG9A 1VSJA 1T6DA 4BWJA 3VGLA 1UOCA 3LM2A 2G8FA 5E41A 2Q31A 4YOTA 4CFBA 1I94K 5I9EB 3HXMA 3CJ1A 4DTJA 1YT3A 3NBPA 3HM9A 1GLEG 2NNWA 4JAXA 3AGRA 1OH7A 5HBMA 1ATSA 1SKRA 2ZD1A 4DU1A 3HOTA 4BC4A 2YCHA 4DHYA 2OYQA 3KK1A 3RMDA 1M90O 3I8DA 1KD1O 1RNHA 4CEFA 1WBDA 2P9PA 1ZBUA 3R9PA 3IS9A 3DRRA 3V81A 3S3OA 4DV4K 3RSEB 1HNXK 4KHWA 4JRQA 3CIPA 5FPEA 3EKUA 4EIAA 2GV9A 4NYNA 4BRNA 1TK0A 3OYKA 4WQ5A 2UU9K 5GIPA 4DQIA 1WNSA 5SZTA 4K8XA 3VQ7A 4CW7B 2P9KA 5FRNA 4HVJA
chains in the Genus database with same CATH topology
1RDBA 2EX3A 3QETA 1SL2A 4KHQA 4FZZA 2KZMA 3VQQA 5T7BA 3SYZA 3HJFA 5J2PA 1JXBA 1D9FA 1IKYA 4DG1A 4LY7A 5HP1A 4E3SA 4CJEA 2I5JA 1KTQA 3K5OA 4Z4FA 1KCFA 1CZ9A 2YNGA 3IG1A 3KD5E 4DTNA 3RR7A 1RBTA 4CFAA 4OKKA 1BHLA 4DLEA 1D8YA 3V9ZA 3AO5A 4M45A 3PX6A 4W5RA 3LAKA 1S6QA 4CECA 4DFMA 4TSXA 1NK6A 1S9GA 2ITGA 4IG0A 4BWMA 3SCXA 1TK8A 4HUEA 4FLYA 3SPYA 1C0UA 3SJJA 4M3UA 4CJ5A 3RMAA 2P1JA 4CHNA 4J2EA 4CERA 4CHOA 4FJXA 4KV8A 4KKOA 3AA4A 4DFKA 4KHSA 1B92A 4OJRA 5C25A 4MFBA 4RW8A 3K58A 1ASUA 3S3NA 1BQNA 2HHVA 3AVJA 2BE2A 4PUOA 3NAEA 1VSFA 4O0JA 2BGGA 3M8QA 4OLBA 1NJYA 1GOAA 1UA0A 4FJJA 1RILA 4CF2A 4DU4A 3QEVA 4Y1CA 3OS2A 3CQ8A 2KFNA 4RW7A 4H4OA 2E4LA 4CJ4A 4IKFA 1WSJA 4CJSA 4N5SA 1T8EA 1J5OA 1YTUA 1CZBA 2Y1IA 3CG7A 3V9UA 4FM1A 2YHBA 1N5YA 3AVKA 2G8HA 1HNIA 3LP0A 3LWLA 3VQ9A 4BE0A 4FLVA 4IFYA 4CHQA 2KTQA 1ASVA 3AO2A 4CJTA 5HRSA 1A5VA 3P5JA 3NH2A 1S1UA 1S9EA 2RN2A 4XIUA 3QESA 2PYLA 4FJ8A 4HCBA 2D0AA 1VSMA 1G15A 1L3SA 2HHXA 3PO5A 3AO1A 1HYZA 3RMCA 4IG3A 5J2NA 2B6AA 4IBNA 4KHYA 3OJUA 3DLHA 4HTUA 3WNFA 2HVIA 1I3AA 1R0AA 1JLGA 3RWUA 4E7IA 3DRSA 2ATQA 3TAEA 3VQ5A 4I2QA 4OGCA 4FJIA 3H08A 4LSNA 4FJMA 2QK9A 4F2RA 4DSJA 1HQEA 4E7HA 2XRIA 4Z4CA 3TAGA 3SQ0A 2DY4A 4AHTA 4HHTA 2A1SA 4K8ZA 4Q0BA 4CEDA 3KK3A 4GW6A 4FLUA 3ITHA 4N41A 1WSIA 2ZQBA 4DS4A 2KW4A 3L2UA 3ZSQA 5JS1A 5FDLA 4EZ6A 4FYDA 1RT7A 3C95A 1VRTA 4CGGA 4PWDA 3BDPA 1RT6A 1FK9A 1J53A 4J2AA 1SUQA 1BCMA 4W5OA 3SNNA 4FLTA 2YNFA 1LAVA 4DMNA 1J54A 1SKWA 2QXFA 4FK4A 4KREA 3OS0A 5I3UA 3NF7A 4E1MA 1QE1A 1NK0A 3KKSA 2Z1HA 2G8WA 4B9LA 1KLMA 3SPZA 3VA0A 1L5UA 3LDSA 3LANA 2FBXA 1BIZA 3OYCA 2BDPA 4E0DA 3DLEA 2QKKA 3V9SA 1BI4A 1QSSA 4C8KA 4FJGA 3NH0A 2P51A 2X6SA 3SV4A 1JL1A 4RW9A 3DLBA 1WAJA 1X9WA 4DSFA 1RT3A 5KGXA 1U04A 1RBSA 2XY5A 3LALA 3V4IA 3VQCA 3MEEA 4CF0A 1Q9XA 1KRPA 4CJ3A 2Y1JA 2D0CA 4PA1A 3KD1E 3K2PA 5K14A 1JLQA 4NYFA 2HNZA 3DLRA 4C8NA 3OJSA 4LH5A 1RT5A 4E19A 4DF8A 4DWIA 2GUIA 2VWKA 1QHTA 2DFEA 4CJKA 3OYHA 3ULDA 4DTOA 3QEXA 3K59A 1IO2A 1B9DA 1I39A 4CIFA 3P1GA 4DS5A 4CEZA 4O0IA 4DQSA 5DK5A 1NJZA 3TAFA 4KPYA 4B9MA 1RTDA 3G10A 2KFZA 3JYTA 4FLXA 3PX0A 1NKCA 2G8KA 2X6NA 2HNYA 4EP4A 1Z26A 4IDKA 3VN5A 4KI6A 2HHTA 3AO4A 1RDAA 3SZ2A 2JGUA 1BI4B 3NH1A 3ZT2A 3A2FA 4FK2A 2G8UA 4GVMA 3AA3A 3CFPA 2F96A 4FCYA 4C8OA 3HPOA 1T7PA 2DFFA 4RG8A 3PY8A 3QIPA 3B6PA 2XY6A 2AJQA 2PY5A 3HPGA 4CJFA 4DTSA 3O4NA 1LWCA 1C6VA 1NOZA 3JSMA 4Z4GA 2VWJA 5KI6A 3U3YA 4FJ7A 1HYSA 1RDCA 2KZZA 1YTAA 4WE1A 4H4MA 1TKZA 3VQEA 3L2QA 4CF9A 5FROA 1D9DA 1DTQA 2OA8A 2IGIA 4KHUA 3IRXA 4C8MA 2PZSA 3THVA 5HLFA 3KLHA 3TI0A 1WAFA 4EZ9A 3HK2A 3TAQA 2FC0A 4LH4A 1U4BA 3ZSOA 1N6QA 1EKEA 4BE2A 4HUGA 3VQ4A 4CESA 3SUNA 5C42A 1S6PA 4L8RB 1VSDA 4PY5A 1VK0A 3SV3A 1FXXA 1RTHA 3QO9A 1T03A 3KK2A 2B4JA 4LSLA 3MXMA 1HPZA 3O3GA 4PQUA 1CXQA 3SQ4A 3K5LA 3DRPA 3HVRA 4DTXA 1C0TA 3HSTB 1BIUA 3D45A 2ETJA 3VQ8A 1WLJA 3I0SA 1TL3A 4O44A 2P5GA 3LP3A 4O5BA 4FJNA 3O3FA 3HP9A 5J1EA 1XHZA 2HB5A 3E01A 4JRPA 1F21A 4FZXC 3QERA 2XHBA 3LP1A 1W0HA 4B8CA 3OYLA 4DFPA 3RRGA 3EYZA 2NUBA 4W5QA 1UA1A 2W42A 4BDZA 1LWEA 1T05A 4M3ZA 1WSEA 4I9LA 3AVIA 3ISNC 3NGIA 1IH7A 4DTUA 3CM5A 1X9MA 4AHUA 4CHYA 3SUQA 1S1XA 1BQMA 1U45A 3ZCMA 3MECA 3NHGA 1XI1A 4NCBA 3TANA 1TGOA 1JLEA 1YVUA 3PO4A 3WNEA 1NOYA 1TKXA 5KGWA 2FBYA 1KVCA 4M41A 4CIEA 1KLNA 5C24A 1NJXA 4CJLA 2VG7A 3F9KA 2IDOA 2YNHA 3MXJA 4M3TA 4B9NA 3T19A 3AV9A 4YFUA 4CIGA 2G8IA 5J2MA 1KVAA 3NGZA 4CF1A 1TAQA 5KRSA 1JLAA 4AHCA 4FJ5A 4CF8A 1SL0A 3S3MA 1C1BA 1L3VA 1ZYQA 4CJUA 2YKMA 4E1NA 4FXDA 4KI4A 4FJLA 3AVFA 1JLCA 3G0ZA 2YHAA 1VRUA 2R7YA 4FLZA 4CHPA 3SUOA 4C8LA 3LAMA 1QTMA 3L2WA 3V9WA 5J2QA 1RBUA 3PUFA 2FBTA 1IKWA 1KFDA 2E6LA 4CFCA 4DSIA 4FVMA 4NCAA 3LPTA 1CXUA 3WNHA 3ZSVA 4KFBA 1SKSA 2HHWA 1LV5A 3OS1A 3TWHA 2X74A 5CY4A 4OPKA 4DSKA 4KO0A 1JLBA 4CCHA 2WOMA 2P5OA 3QIOA 4ZHRA 1BCOA 1L3TA 3VA3A 4H8KA 2O4GA 3L2RA 1QSLA 2IAJA 5KRTA 1Z25A 4BE1A 3DI6A 3HP6A 1DTTA 2OPSA 1HJRA 1RT4A 3NGYA 4KTWA 1KFSA 2YV0X 3HYFA 5CYQA 4M42A 4OLAA 1HNVA 3PX4A 1C1CA 3VQBA 1S5JA 1GOCA 1RTIA 4FJ9A 4F3OA 3UIQA 1NK4A 2G8VA 4E7KA 3ZSXA 3NCIA 1SV5A 1NK7A 1WSGA 4ID5A 1ZBLA 2ZE2A 1WN7A 3RR8A 4W5NA 4CK3A 1EXQA 4OGEA 3F73A 1J9AA 4Q5VA 3RRHA 3L8BA 1WSFA 3O4QA 5HRRA 4DQQA 3PV8A 3QEPA 4O55A 1BL3A 4HCCA 3BGRA 3TABA 3V1QA 2RKIA 1JKHA 4E89A 3KLGA 3EZ5A 4ICLA 4CJRA 4CEOA 4JS5A 1QS4A 1RCHA 3AVHA 4KB1A 4J2BA 2HVHA 1HRHA 3CYMA 4FJKA 1FKPA 4Y1DA 1C0MA 3DLGA 1TVRA 3KLIA 3RMBA 4DU3A 4QCLA 4FM2A 1RT1A 4FW1A 3OYJA 2Z1JA 1U47A 3NDKA 2OPPA 2Z1IA 4M3RA 1LAWA 1LWFA 4DTMA 4AHVA 4DQPA 1Q9YA 4R5PA 3ZT4A 2X78A 1NKBA 2HMIA 4W5TA 3OYGA 3OYDA 1MU2A 4M3YA 3ZT0A 2D0BA 4NCGA 5CZ1A 3HT3A 1VSLA 1ZBHA 3OYFA 1TV6A 1L3UA 3AVNA 3V1RA 2PYJA 1W9HA 3OYAA 3DYAA 1JL2A 3CFRA 1O1WA 3CFOA 3I0RA 3DLKA 3P83D 4IFVA 4FW2A 2BANA 3SUPA 1TAUA 3OY9A 4GMJB 3M8RA 3LZJA 1JXEA 4JS4A 4DSLA 1GOBA 2IOCA 3FFIA 2GBZA 1NK5A 1XHXA 4YNQA 1ZBFA 3AVBA 4DTRA 1NK8A 3M8PA 3L3VA 1RT2A 1TKDA 2FBVA 4CFDA 2IC3A 4ID1A 4I2PA 1KSPA 2A1RA 4ELUA 3RTVA 1TL1A 3LWMA 4KRFA 3D0PA 3EY1A 2DFHA 2HHUA 1JLFA 3LZIA 3SQ1A 1RBVA 4EP5A 3O3HA 3VQPA 3S9HA 3AO3A 1ZBIA 2O4IA 3NFAA 1HQUA 2LSNA 1EP4A 1XC9A 4QOZB 1FKOA 4N47A 2WONA 5HRNA 4I9QA 3DOLA 3L2VA 2Q3SA 4BDPA 2HHQA 4I7FA 1WSHA 2HNDA 3KJVA 3LP2A 3VQ6A 4FM0A 4OPJA 1A5WA 2EHGA 5SWMA 4F3TA 1NK9A 4ELVA 1CLQA 3QNNA 1Y97A 3TAMA 1Q8IA 3OYIA 2IS3A 3C94A 1ITGA 4HUFA 4AILC 4CK1A 4Z0UA 1UWBA 3AVAA 5DMRA 4ZTJA 4MQ3A 3K5MA 2OZSA 4FK0A 1BISA 3QEWA 4B9SA 1X9SA 1KVBA 5HROA 1TKTA 1REVA 1RDDA 1HMVA 3CM6A 4Z4HA 4DF4A 1IG9A 3ZSZA 2Z1GA 4AH9A 1DLOA 3K5NA 3MAQA 3TAPA 3AVLA 4N76A 3C6UA 5FRMA 4CEQA 3ALYA 1VSIA 3IAYA 1LW2A 1IKXA 3DMJA 4G1QA 4KTZA 3QEIA 3NE6A 2F8SA 4Z4IA 3C6TA 4B9TA 1U49A 1VSKA 5I42A 4OVLA 1NKEA 3L3UA 2YKNA 3M8SA 2VG6A 5KTQA 1S1WA 2YNIA 3ZSWA 4AHRA 4CGHA 2KQ2A 4AHSA 4UQGA 4FJHA 4CJQA 3HVTA 4J2DA 3VQAA 3AA2A 3V9XA 1UAXA 5HRPA 4DSEA 3DM2A 2OZMA 4KB0A 1QQCA 3AA5X 4F2SA 3HPHA 4DTPA 4DFJA 1IKVA 4DQRA 4F8RA 3WNGA 4CEBA 4CGFA 4ZTFA 4KTQA 5CYMA 3ASMA 4FZYA 2HW3A 4DLGA 1VSJA 2B5JA 4BWJA 4FLWA 3KTQA 1UOCA 4ELTA 2G8FA 3B6OA 4O4GA 4QAGA 4CJVA 5E41A 4CFBA 1VSEA 4Z4EA 4B08A 3QNOA 2HHSA 1EETA 2DTUA 1X1PA 5CZ2A 1BGXT 2F8TA 3HXMA 3AVGA 5JS2A 1HYVA 3AVMA 4DTJA 4RW6A 4B3OA 1YT3A 3AVCA 3NBPA 3HM9A 2E6MA 2OPRA 3OYEA 3KIOA 3U6FA 3MEGA 3SI6A 5D3GA 3ZSRA 4CGJA 3KLEA 3V6DA 1SL1A 5HBMA 4CEEA 1SKRA 2ZD1A 4E7LA 4DU1A 1TK5A 1QSYA 4M3XA 1XWLA 3T3FA 3MEDA 4B8AB 1RTJA 4B9UA 2OYQA 3KK1A 4BACA 3RMDA 3I8DA 4KHNA 1RNHA 2XY8A 4CEFA 3DOKA 1ZBUA 3OYMA 3IS9A 2XO7A 3HL8A 3U3GA 1U48A 3DRRA 3QINA 1VSHA 4B9VA 2JLEA 3OYBA 2XY7A 4CK2A 3OVNA 2VG5A 3ZT1A 4CEAA 3V81A 1C1AA 3S3OA 4CGIA 4LD0A 3TARA 3NF6A 3OYNA 4M3WA 3HO1A 4KHWA 1S1VA 3V1OA 4JRQA 1A5XA 1EX4A 5EU7A 4E7JA 4N56A 1S1TA 2RPIA 3LPUA 2GV9A 3NF9A 4CJWA 4NYNA 3QLHA 2QKBA 1B9FA 2D5RA 2RF2A 3K57A 4BDYA 3KLFA 4JLHA 3NF8A 3OYKA 1TK0A 1D5AA 1K6YA 4CHZA 3KKRA 3T1AA 4CJPA 4DQIA 4F4KA 4RW4A 3SQ2A 1WNSA 1NJWA 3TR8A 3ZT3A 5SZTA 4K8XA 2OPQA 4OKEA 3VQ7A 4OKJA 1LW0A 3MXIA 5FRNA 3ZSYA 1RBRA 4HVJA 4CE9A 3VQDA 4KAZA 1ASWA 4CGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RDB A;  2EX3 A;  3QET A;  1SL2 A;  4KHQ A;  4FZZ A;  2KZM A;  3VQQ A;  5T7B A;  3SYZ A;  3HJF A;  5J2P A;  1JXB A;  1D9F A;  1IKY A;  4DG1 A;  4LY7 A;  5HP1 A;  4E3S A;  4CJE A;  2I5J A;  1KTQ A;  3K5O A;  4Z4F A;  1KCF A;  1CZ9 A;  2YNG A;  3IG1 A;  3KD5 E;  4DTN A;  3RR7 A;  1RBT A;  4CFA A;  4OKK A;  1BHL A;  4DLE A;  1D8Y A;  3V9Z A;  3AO5 A;  4M45 A;  3PX6 A;  4W5R A;  3LAK A;  1S6Q A;  4CEC A;  4DFM A;  4TSX A;  1NK6 A;  1S9G A;  2ITG A;  4IG0 A;  4BWM A;  3SCX A;  1TK8 A;  4HUE A;  4FLY A;  3SPY A;  1C0U A;  3SJJ A;  4M3U A;  4CJ5 A;  3RMA A;  2P1J A;  4CHN A;  4J2E A;  4CER A;  4CHO A;  4FJX A;  4KV8 A;  4KKO A;  3AA4 A;  4DFK A;  4KHS A;  1B92 A;  4OJR A;  5C25 A;  4MFB A;  4RW8 A;  3K58 A;  1ASU A;  3S3N A;  1BQN A;  2HHV A;  3AVJ A;  2BE2 A;  4PUO A;  3NAE A;  1VSF A;  4O0J A;  2BGG A;  3M8Q A;  4OLB A;  1NJY A;  1GOA A;  1UA0 A;  4FJJ A;  1RIL A;  4CF2 A;  4DU4 A;  3QEV A;  4Y1C A;  3OS2 A;  3CQ8 A;  2KFN A;  4RW7 A;  4H4O A;  2E4L A;  4CJ4 A;  4IKF A;  1WSJ A;  4CJS A;  4N5S A;  1T8E A;  1J5O A;  1YTU A;  1CZB A;  2Y1I A;  3CG7 A;  3V9U A;  4FM1 A;  2YHB A;  1N5Y A;  3AVK A;  2G8H A;  1HNI A;  3LP0 A;  3LWL A;  3VQ9 A;  4BE0 A;  4FLV A;  4IFY A;  4CHQ A;  2KTQ A;  1ASV A;  3AO2 A;  4CJT A;  5HRS A;  1A5V A;  3P5J A;  3NH2 A;  1S1U A;  1S9E A;  2RN2 A;  4XIU A;  3QES A;  2PYL A;  4FJ8 A;  4HCB A;  2D0A A;  1VSM A;  1G15 A;  1L3S A;  2HHX A;  3PO5 A;  3AO1 A;  1HYZ A;  3RMC A;  4IG3 A;  5J2N A;  2B6A A;  4IBN A;  4KHY A;  3OJU A;  3DLH A;  4HTU A;  3WNF A;  2HVI A;  1I3A A;  1R0A A;  1JLG A;  3RWU A;  4E7I A;  3DRS A;  2ATQ A;  3TAE A;  3VQ5 A;  4I2Q A;  4OGC A;  4FJI A;  3H08 A;  4LSN A;  4FJM A;  2QK9 A;  4F2R A;  4DSJ A;  1HQE A;  4E7H A;  2XRI A;  4Z4C A;  3TAG A;  3SQ0 A;  2DY4 A;  4AHT A;  4HHT A;  2A1S A;  4K8Z A;  4Q0B A;  4CED A;  3KK3 A;  4GW6 A;  4FLU A;  3ITH A;  4N41 A;  1WSI A;  2ZQB A;  4DS4 A;  2KW4 A;  3L2U A;  3ZSQ A;  5JS1 A;  5FDL A;  4EZ6 A;  4FYD A;  1RT7 A;  3C95 A;  1VRT A;  4CGG A;  4PWD A;  3BDP A;  1RT6 A;  1FK9 A;  1J53 A;  4J2A A;  1SUQ A;  1BCM A;  4W5O A;  3SNN A;  4FLT A;  2YNF A;  1LAV A;  4DMN A;  1J54 A;  1SKW A;  2QXF A;  4FK4 A;  4KRE A;  3OS0 A;  5I3U A;  3NF7 A;  4E1M A;  1QE1 A;  1NK0 A;  3KKS A;  2Z1H A;  2G8W A;  4B9L A;  1KLM A;  3SPZ A;  3VA0 A;  1L5U A;  3LDS A;  3LAN A;  2FBX A;  1BIZ A;  3OYC A;  2BDP A;  4E0D A;  3DLE A;  2QKK A;  3V9S A;  1BI4 A;  1QSS A;  4C8K A;  4FJG A;  3NH0 A;  2P51 A;  2X6S A;  3SV4 A;  1JL1 A;  4RW9 A;  3DLB A;  1WAJ A;  1X9W A;  4DSF A;  1RT3 A;  5KGX A;  1U04 A;  1RBS A;  2XY5 A;  3LAL A;  3V4I A;  3VQC A;  3MEE A;  4CF0 A;  1Q9X A;  1KRP A;  4CJ3 A;  2Y1J A;  2D0C A;  4PA1 A;  3KD1 E;  3K2P A;  5K14 A;  1JLQ A;  4NYF A;  2HNZ A;  3DLR A;  4C8N A;  3OJS A;  4LH5 A;  1RT5 A;  4E19 A;  4DF8 A;  4DWI A;  2GUI A;  2VWK A;  1QHT A;  2DFE A;  4CJK A;  3OYH A;  3ULD A;  4DTO A;  3QEX A;  3K59 A;  1IO2 A;  1B9D A;  1I39 A;  4CIF A;  3P1G A;  4DS5 A;  4CEZ A;  4O0I A;  4DQS A;  5DK5 A;  1NJZ A;  3TAF A;  4KPY A;  4B9M A;  1RTD A;  3G10 A;  2KFZ A;  3JYT A;  4FLX A;  3PX0 A;  1NKC A;  2G8K A;  2X6N A;  2HNY A;  4EP4 A;  1Z26 A;  4IDK A;  3VN5 A;  4KI6 A;  2HHT A;  3AO4 A;  1RDA A;  3SZ2 A;  2JGU A;  1BI4 B;  3NH1 A;  3ZT2 A;  3A2F A;  4FK2 A;  2G8U A;  4GVM A;  3AA3 A;  3CFP A;  2F96 A;  4FCY A;  4C8O A;  3HPO A;  1T7P A;  2DFF A;  4RG8 A;  3PY8 A;  3QIP A;  3B6P A;  2XY6 A;  2AJQ A;  2PY5 A;  3HPG A;  4CJF A;  4DTS A;  3O4N A;  1LWC A;  1C6V A;  1NOZ A;  3JSM A;  4Z4G A;  2VWJ A;  5KI6 A;  3U3Y A;  4FJ7 A;  1HYS A;  1RDC A;  2KZZ A;  1YTA A;  4WE1 A;  4H4M A;  1TKZ A;  3VQE A;  3L2Q A;  4CF9 A;  5FRO A;  1D9D A;  1DTQ A;  2OA8 A;  2IGI A;  4KHU A;  3IRX A;  4C8M A;  2PZS A;  3THV A;  5HLF A;  3KLH A;  3TI0 A;  1WAF A;  4EZ9 A;  3HK2 A;  3TAQ A;  2FC0 A;  4LH4 A;  1U4B A;  3ZSO A;  1N6Q A;  1EKE A;  4BE2 A;  4HUG A;  3VQ4 A;  4CES A;  3SUN A;  5C42 A;  1S6P A;  4L8R B;  1VSD A;  4PY5 A;  1VK0 A;  3SV3 A;  1FXX A;  1RTH A;  3QO9 A;  1T03 A;  3KK2 A;  2B4J A;  4LSL A;  3MXM A;  1HPZ A;  3O3G A;  4PQU A;  1CXQ A;  3SQ4 A;  3K5L A;  3DRP A;  3HVR A;  4DTX A;  1C0T A;  3HST B;  1BIU A;  3D45 A;  2ETJ A;  3VQ8 A;  1WLJ A;  3I0S A;  1TL3 A;  4O44 A;  2P5G A;  3LP3 A;  4O5B A;  4FJN A;  3O3F A;  3HP9 A;  5J1E A;  1XHZ A;  2HB5 A;  3E01 A;  4JRP A;  1F21 A;  4FZX C;  3QER A;  2XHB A;  3LP1 A;  1W0H A;  4B8C A;  3OYL A;  4DFP A;  3RRG A;  3EYZ A;  2NUB A;  4W5Q A;  1UA1 A;  2W42 A;  4BDZ A;  1LWE A;  1T05 A;  4M3Z A;  1WSE A;  4I9L A;  3AVI A;  3ISN C;  3NGI A;  1IH7 A;  4DTU A;  3CM5 A;  1X9M A;  4AHU A;  4CHY A;  3SUQ A;  1S1X A;  1BQM A;  1U45 A;  3ZCM A;  3MEC A;  3NHG A;  1XI1 A;  4NCB A;  3TAN A;  1TGO A;  1JLE A;  1YVU A;  3PO4 A;  3WNE A;  1NOY A;  1TKX A;  5KGW A;  2FBY A;  1KVC A;  4M41 A;  4CIE A;  1KLN A;  5C24 A;  1NJX A;  4CJL A;  2VG7 A;  3F9K A;  2IDO A;  2YNH A;  3MXJ A;  4M3T A;  4B9N A;  3T19 A;  3AV9 A;  4YFU A;  4CIG A;  2G8I A;  5J2M A;  1KVA A;  3NGZ A;  4CF1 A;  1TAQ A;  5KRS A;  1JLA A;  4AHC A;  4FJ5 A;  4CF8 A;  1SL0 A;  3S3M A;  1C1B A;  1L3V A;  1ZYQ A;  4CJU A;  2YKM A;  4E1N A;  4FXD A;  4KI4 A;  4FJL A;  3AVF A;  1JLC A;  3G0Z A;  2YHA A;  1VRU A;  2R7Y A;  4FLZ A;  4CHP A;  3SUO A;  4C8L A;  3LAM A;  1QTM A;  3L2W A;  3V9W A;  5J2Q A;  1RBU A;  3PUF A;  2FBT A;  1IKW A;  1KFD A;  2E6L A;  4CFC A;  4DSI A;  4FVM A;  4NCA A;  3LPT A;  1CXU A;  3WNH A;  3ZSV A;  4KFB A;  1SKS A;  2HHW A;  1LV5 A;  3OS1 A;  3TWH A;  2X74 A;  5CY4 A;  4OPK A;  4DSK A;  4KO0 A;  1JLB A;  4CCH A;  2WOM A;  2P5O A;  3QIO A;  4ZHR A;  1BCO A;  1L3T A;  3VA3 A;  4H8K A;  2O4G A;  3L2R A;  1QSL A;  2IAJ A;  5KRT A;  1Z25 A;  4BE1 A;  3DI6 A;  3HP6 A;  1DTT A;  2OPS A;  1HJR A;  1RT4 A;  3NGY A;  4KTW A;  1KFS A;  2YV0 X;  3HYF A;  5CYQ A;  4M42 A;  4OLA A;  1HNV A;  3PX4 A;  1C1C A;  3VQB A;  1S5J A;  1GOC A;  1RTI A;  4FJ9 A;  4F3O A;  3UIQ A;  1NK4 A;  2G8V A;  4E7K A;  3ZSX A;  3NCI A;  1SV5 A;  1NK7 A;  1WSG A;  4ID5 A;  1ZBL A;  2ZE2 A;  1WN7 A;  3RR8 A;  4W5N A;  4CK3 A;  1EXQ A;  4OGE A;  3F73 A;  1J9A A;  4Q5V A;  3RRH A;  3L8B A;  1WSF A;  3O4Q A;  5HRR A;  4DQQ A;  3PV8 A;  3QEP A;  4O55 A;  1BL3 A;  4HCC A;  3BGR A;  3TAB A;  3V1Q A;  2RKI A;  1JKH A;  4E89 A;  3KLG A;  3EZ5 A;  4ICL A;  4CJR A;  4CEO A;  4JS5 A;  1QS4 A;  1RCH A;  3AVH A;  4KB1 A;  4J2B A;  2HVH A;  1HRH A;  3CYM A;  4FJK A;  1FKP A;  4Y1D A;  1C0M A;  3DLG A;  1TVR A;  3KLI A;  3RMB A;  4DU3 A;  4QCL A;  4FM2 A;  1RT1 A;  4FW1 A;  3OYJ A;  2Z1J A;  1U47 A;  3NDK A;  2OPP A;  2Z1I A;  4M3R A;  1LAW A;  1LWF A;  4DTM A;  4AHV A;  4DQP A;  1Q9Y A;  4R5P A;  3ZT4 A;  2X78 A;  1NKB A;  2HMI A;  4W5T A;  3OYG A;  3OYD A;  1MU2 A;  4M3Y A;  3ZT0 A;  2D0B A;  4NCG A;  5CZ1 A;  3HT3 A;  1VSL A;  1ZBH A;  3OYF A;  1TV6 A;  1L3U A;  3AVN A;  3V1R A;  2PYJ A;  1W9H A;  3OYA A;  3DYA A;  1JL2 A;  3CFR A;  1O1W A;  3CFO A;  3I0R A;  3DLK A;  3P83 D;  4IFV A;  4FW2 A;  2BAN A;  3SUP A;  1TAU A;  3OY9 A;  4GMJ B;  3M8R A;  3LZJ A;  1JXE A;  4JS4 A;  4DSL A;  1GOB A;  2IOC A;  3FFI A;  2GBZ A;  1NK5 A;  1XHX A;  4YNQ A;  1ZBF A;  3AVB A;  4DTR A;  1NK8 A;  3M8P A;  3L3V A;  1RT2 A;  1TKD A;  2FBV A;  4CFD A;  2IC3 A;  4ID1 A;  4I2P A;  1KSP A;  2A1R A;  4ELU A;  3RTV A;  1TL1 A;  3LWM A;  4KRF A;  3D0P A;  3EY1 A;  2DFH A;  2HHU A;  1JLF A;  3LZI A;  3SQ1 A;  1RBV A;  4EP5 A;  3O3H A;  3VQP A;  3S9H A;  3AO3 A;  1ZBI A;  2O4I A;  3NFA A;  1HQU A;  2LSN A;  1EP4 A;  1XC9 A;  4QOZ B;  1FKO A;  4N47 A;  2WON A;  5HRN A;  4I9Q A;  3DOL A;  3L2V A;  2Q3S A;  4BDP A;  2HHQ A;  4I7F A;  1WSH A;  2HND A;  3KJV A;  3LP2 A;  3VQ6 A;  4FM0 A;  4OPJ A;  1A5W A;  2EHG A;  5SWM A;  4F3T A;  1NK9 A;  4ELV A;  1CLQ A;  3QNN A;  1Y97 A;  3TAM A;  1Q8I A;  3OYI A;  2IS3 A;  3C94 A;  1ITG A;  4HUF A;  4AIL C;  4CK1 A;  4Z0U A;  1UWB A;  3AVA A;  5DMR A;  4ZTJ A;  4MQ3 A;  3K5M A;  2OZS A;  4FK0 A;  1BIS A;  3QEW A;  4B9S A;  1X9S A;  1KVB A;  5HRO A;  1TKT A;  1REV A;  1RDD A;  1HMV A;  3CM6 A;  4Z4H A;  4DF4 A;  1IG9 A;  3ZSZ A;  2Z1G A;  4AH9 A;  1DLO A;  3K5N A;  3MAQ A;  3TAP A;  3AVL A;  4N76 A;  3C6U A;  5FRM A;  4CEQ A;  3ALY A;  1VSI A;  3IAY A;  1LW2 A;  1IKX A;  3DMJ A;  4G1Q A;  4KTZ A;  3QEI A;  3NE6 A;  2F8S A;  4Z4I A;  3C6T A;  4B9T A;  1U49 A;  1VSK A;  5I42 A;  4OVL A;  1NKE A;  3L3U A;  2YKN A;  3M8S A;  2VG6 A;  5KTQ A;  1S1W A;  2YNI A;  3ZSW A;  4AHR A;  4CGH A;  2KQ2 A;  4AHS A;  4UQG A;  4FJH A;  4CJQ A;  3HVT A;  4J2D A;  3VQA A;  3AA2 A;  3V9X A;  1UAX A;  5HRP A;  4DSE A;  3DM2 A;  2OZM A;  4KB0 A;  1QQC A;  3AA5 X;  4F2S A;  3HPH A;  4DTP A;  4DFJ A;  1IKV A;  4DQR A;  4F8R A;  3WNG A;  4CEB A;  4CGF A;  4ZTF A;  4KTQ A;  5CYM A;  3ASM A;  4FZY A;  2HW3 A;  4DLG A;  1VSJ A;  2B5J A;  4BWJ A;  4FLW A;  3KTQ A;  1UOC A;  4ELT A;  2G8F A;  3B6O A;  4O4G A;  4QAG A;  4CJV A;  5E41 A;  4CFB A;  1VSE A;  4Z4E A;  4B08 A;  3QNO A;  2HHS A;  1EET A;  2DTU A;  1X1P A;  5CZ2 A;  1BGX T;  2F8T A;  3HXM A;  3AVG A;  5JS2 A;  1HYV A;  3AVM A;  4DTJ A;  4RW6 A;  4B3O A;  1YT3 A;  3AVC A;  3NBP A;  3HM9 A;  2E6M A;  2OPR A;  3OYE A;  3KIO A;  3U6F A;  3MEG A;  3SI6 A;  5D3G A;  3ZSR A;  4CGJ A;  3KLE A;  3V6D A;  1SL1 A;  5HBM A;  4CEE A;  1SKR A;  2ZD1 A;  4E7L A;  4DU1 A;  1TK5 A;  1QSY A;  4M3X A;  1XWL A;  3T3F A;  3MED A;  4B8A B;  1RTJ A;  4B9U A;  2OYQ A;  3KK1 A;  4BAC A;  3RMD A;  3I8D A;  4KHN A;  1RNH A;  2XY8 A;  4CEF A;  3DOK A;  1ZBU A;  3OYM A;  3IS9 A;  2XO7 A;  3HL8 A;  3U3G A;  1U48 A;  3DRR A;  3QIN A;  1VSH A;  4B9V A;  2JLE A;  3OYB A;  2XY7 A;  4CK2 A;  3OVN A;  2VG5 A;  3ZT1 A;  4CEA A;  3V81 A;  1C1A A;  3S3O A;  4CGI A;  4LD0 A;  3TAR A;  3NF6 A;  3OYN A;  4M3W A;  3HO1 A;  4KHW A;  1S1V A;  3V1O A;  4JRQ A;  1A5X A;  1EX4 A;  5EU7 A;  4E7J A;  4N56 A;  1S1T A;  2RPI A;  3LPU A;  2GV9 A;  3NF9 A;  4CJW A;  4NYN A;  3QLH A;  2QKB A;  1B9F A;  2D5R A;  2RF2 A;  3K57 A;  4BDY A;  3KLF A;  4JLH A;  3NF8 A;  3OYK A;  1TK0 A;  1D5A A;  1K6Y A;  4CHZ A;  3KKR A;  3T1A A;  4CJP A;  4DQI A;  4F4K A;  4RW4 A;  3SQ2 A;  1WNS A;  1NJW A;  3TR8 A;  3ZT3 A;  5SZT A;  4K8X A;  2OPQ A;  4OKE A;  3VQ7 A;  4OKJ A;  1LW0 A;  3MXI A;  5FRN A;  3ZSY A;  1RBR A;  4HVJ A;  4CE9 A;  3VQD A;  4KAZ A;  1ASW A;  4CGD A; 
#chains in the Genus database with same CATH topology
 1RDB A;  5KPR A;  4KHQ A;  3C6H A;  5T7B A;  1OH6 A;  2CGK A;  4DG1 A;  4WCE L;  3A5N C;  2I5J A;  4IO9 L;  2O8E A;  4Z4F A;  1KCF A;  1CZ9 A;  2NRT A;  3KD5 E;  3GG4 A;  1ZC6 A;  3V9Z A;  4G9Z A;  4IXC A;  3CCL N;  3LAK A;  3SK3 A;  1NK6 A;  1S9G A;  4IG0 A;  2UUA K;  4IOA L;  2EWS A;  4FLY A;  2AP1 A;  1YIJ N;  3SJJ A;  4CJ5 A;  3VEO A;  3RMA A;  4CER A;  4CHO A;  1K8K B;  3MK6 A;  3CPE A;  5AQR A;  4H5W A;  5C25 A;  2NRW A;  4RW8 A;  1ASU A;  3S3N A;  1BQN A;  3ZYY X;  2HHV A;  3AVJ A;  3MX5 A;  4K43 A;  3VEZ A;  1NWK A;  1XMO K;  3M8Q A;  4C23 A;  2BGG A;  1GOA A;  4IO8 A;  1YIT N;  1RIL A;  2P9U B;  2VGM A;  4KH5 A;  3SAH A;  4CJ4 A;  1XC3 A;  1WSJ A;  1VQ5 N;  2QWR A;  5C2F A;  3SBG A;  4B1X B;  3QFP A;  5BRF A;  1ASV A;  5HRS A;  1A5V A;  3NH2 A;  3T7Z A;  3QES A;  4FPB A;  4HCB A;  1L3S A;  1IBK K;  4KHY A;  4IBN A;  2HVI A;  3BY5 A;  1FW6 A;  3RWU A;  3RVC A;  3J7Y P;  3VQ5 A;  4FJI A;  4FJM A;  4LSN A;  4CZI A;  1T3V A;  4WFA L;  4F2R A;  2DY4 A;  3SQ0 A;  2OTL N;  1OKJ A;  1X3M A;  4DS4 A;  3L2U A;  3K0S A;  1QQM A;  5FDL A;  5BR9 A;  4YOW A;  1VRT A;  4IEI A;  4PWD A;  3BDP A;  4J2A A;  3I55 N;  4FK4 A;  3HM8 A;  1J5E K;  4E1M A;  1NK0 A;  3CF5 L;  3KKS A;  2Z1H A;  2P9N B;  2BDP A;  4A2A A;  1LCU A;  3Q7B A;  4E0D A;  3V9S A;  1SQK A;  4FJG A;  3CCE N;  1S3X A;  1JL1 A;  3BEX A;  4OPH A;  3CD6 N;  1R59 O;  3T1H K;  4LF9 K;  2O8B B;  3D2F B;  3WEE B;  2XY5 A;  3V4I A;  4LF5 K;  2Y1J A;  2D0C A;  2E2Q A;  4A57 A;  3K2P A;  5K14 A;  4U67 L;  3OJS A;  3EO3 A;  4LH5 A;  4E19 A;  1D4X A;  3QEX A;  3MCA B;  3D6R A;  1B9D A;  3BZK A;  1YJ9 N;  4BR5 A;  3FGU A;  3G10 A;  4FLX A;  4KI6 A;  4IDK A;  2ASP A;  4BC2 A;  3A2F A;  1N33 K;  3HPO A;  1T7P A;  3B6P A;  2WUS A;  1XUP O;  4DTS A;  1LWC A;  4YOR A;  1NOZ A;  4EHT A;  4BVO A;  2VWJ A;  5KI6 A;  4FJ7 A;  3HOS A;  4DV3 K;  5FRO A;  1VAZ A;  2IGI A;  3R1X A;  4KHU A;  3IRX A;  2GX9 A;  4C8M A;  4OX9 K;  4GV6 A;  5JVG L;  3TI0 A;  4EZ9 A;  1YI2 N;  4NB4 A;  1EKE A;  5M1O A;  4BE2 A;  1QVG M;  3SUN A;  4L8R B;  4PY5 A;  3SV3 A;  1RTH A;  3J8A A;  1T03 A;  2B4J A;  3O6W A;  3MXM A;  2HBM A;  1CXQ A;  2NRV A;  3SQ4 A;  5BRD A;  2ZM6 K;  1VQ9 N;  1BIU A;  3D45 A;  3VQ8 A;  4BR7 A;  1TL3 A;  3ZET B;  4LFB K;  4HTL A;  3CQY A;  3I8B A;  1HLU A;  3E01 A;  3QER A;  3LP1 A;  3WUH A;  1W0H A;  3OYL A;  5AQM A;  3EYZ A;  2NUB A;  4W5Q A;  3HTV A;  4I9L A;  3CCS N;  2O8F A;  1X9M A;  4AHU A;  4CHY A;  2QWL A;  1S1X A;  3ZCM A;  3MEC A;  3SAG A;  3NHG A;  3BUZ B;  4BR0 A;  1YVU A;  1NOY A;  2V7Y A;  5KGW A;  1KVC A;  1BUP A;  2ZGY A;  3F9K A;  1QHA A;  2HF3 A;  5ADX A;  1E4G T;  1KVA A;  1SL0 A;  4FWS A;  3S3M A;  1L3V A;  4E1N A;  3ZEU A;  4BRE A;  2IVP A;  1QTM A;  3L2W A;  3V9W A;  2CGL A;  1KFD A;  4NCA A;  2E6L A;  4DSI A;  1Q18 A;  3ZSV A;  4KFB A;  5CY4 A;  2NLX A;  4B1U B;  4KO0 A;  1JLB A;  4DKW A;  4F9O A;  2NRH A;  3H46 O;  2GWK A;  1L3T A;  3VA3 A;  3L2R A;  1Y64 A;  4BRF A;  5KRT A;  4JD2 A;  4BE1 A;  3DI6 A;  3HP6 A;  4EHU A;  2OPS A;  1RT4 A;  5CYQ A;  3WXJ A;  5AZI B;  1RDU A;  5JLF A;  1HNV A;  4GV3 A;  3IKM A;  3LDL A;  1GOC A;  5CE3 A;  1RTI A;  4FJ9 A;  4F3O A;  3UIQ A;  1NK4 A;  2F7T A;  4JV5 K;  1NK7 A;  2QEX N;  4ID5 A;  4W5N A;  2ZE2 A;  3RR8 A;  4OGE A;  2P9I B;  4Q5V A;  3L8B A;  5LL6 Z;  3I56 N;  4IEE A;  2GUP A;  2RKI A;  3V1Q A;  3E1Y A;  1QS4 A;  3H6E A;  4J2B A;  3CYM A;  2CH6 A;  1C0M A;  2D0O A;  4CZF A;  4DU3 A;  4QCL A;  1SS6 A;  4B1W B;  2P9L A;  1WOQ A;  2Z1J A;  4M3R A;  4AHV A;  4R5P A;  4M3Y A;  1VQK N;  4JK9 A;  5LY3 A;  1VSL A;  2PYJ A;  4MLE A;  4YOY A;  3UKR A;  3DXM B;  4IJN A;  3DLK A;  3P83 D;  4X62 K;  3VET A;  3M8R A;  2Q0R A;  1GOB A;  2IOC A;  2GBZ A;  1NK5 A;  1ZBF A;  2AA4 A;  3VPZ A;  3L3V A;  3SMS A;  2IC3 A;  4I2P A;  1KSP A;  5GAG P;  4ELU A;  5AQQ A;  1TL1 A;  4KRF A;  1KAX A;  5AJ3 K;  1RBV A;  1U6Z A;  1XC9 A;  4QOZ B;  2WON A;  3MX2 A;  1NU0 A;  1Z05 A;  3L2V A;  2Q3S A;  4BDP A;  4I7F A;  2YJE A;  4BGB A;  4OPJ A;  1A5W A;  3FE1 A;  2EHG A;  2P9K B;  3O08 A;  4QS9 A;  4ELV A;  4BGA A;  3KZB A;  3VTI A;  3OYI A;  3THY B;  2IS3 A;  1TYQ A;  4YDU C;  4Z0U A;  1UWB A;  3AVA A;  5DMR A;  4MQ3 A;  3K5M A;  2OZS A;  1BIS A;  2QM1 A;  5HRO A;  2IIR A;  1QVF M;  3CM6 A;  4C8O A;  1IG9 A;  3TAP A;  5FRM A;  3VGK A;  2A3Z A;  4FWM A;  4KTZ A;  1XNQ K;  1U2V B;  4MDB A;  5LJV A;  4Z4I A;  2YHY A;  3P38 A;  5CR4 A;  1U49 A;  1MA9 B;  4DB3 A;  1DGK N;  1BDG A;  3IFR A;  2VG6 A;  1BA1 A;  3HK2 A;  3A8Y A;  4FJH A;  4J2D A;  3AA2 A;  3ULE B;  4DSE A;  3DM2 A;  2OZM A;  4KB0 A;  4BC3 A;  3AA5 X;  1K9M O;  3AAR A;  4DQR A;  3HI0 A;  1JCF A;  4CGF A;  4B3S K;  4NLC A;  1ILY A;  1GLC G;  4KTQ A;  5CYM A;  4B9Q A;  5ELZ A;  1C0F A;  1OVQ A;  2B5J A;  4FLW A;  3B6O A;  4O4G A;  4QAG A;  4CJV A;  4Z4E A;  2HHS A;  2DTU A;  2ZJR L;  1X1P A;  2F8T A;  2QTD A;  3AVG A;  3ID6 A;  3AVM A;  3AVC A;  3VEW A;  5BR8 K;  1IV0 A;  3KIO A;  3VEY A;  4KHP K;  4JI1 K;  3SI6 A;  5D3G A;  1TUY A;  4CGJ A;  4CEE A;  4JI6 K;  1XWL A;  5C2D A;  2FF6 A;  1RTJ A;  4B9U A;  1H1V A;  4LC9 B;  3D7E O;  1C0G A;  2O8C B;  3OYM A;  3U3G A;  4H0P A;  4B9V A;  1WUA A;  2JLE A;  3OYB A;  2XY7 A;  2VG5 A;  1HKB A;  3VTH A;  3WXL A;  4CGI A;  4LD0 A;  3TTF A;  5AQJ A;  3LL3 A;  1GLJ O;  4CJ7 A;  4DQ8 A;  3D2E B;  4E7J A;  3LPU A;  2RPI A;  1E4F T;  4CZG A;  4CJW A;  3L4Q A;  2O8D A;  1HR0 K;  3K57 A;  3KLF A;  1KQS M;  1HNW K;  1D5A A;  3KKR A;  3JXU A;  1MWM A;  2E2P A;  1NJW A;  2PFU A;  1YJN N;  4BRM A;  3MXI A;  3VEX A;  4CGD A;  1NG9 A;  3TTC A;  3HJF A;  1JXB A;  1IKY A;  4LY7 A;  3EZW A;  1KTQ A;  3K5O A;  3T69 A;  1NGJ A;  1BHL A;  5AZJ B;  1NGE A;  3AO5 A;  4W5R A;  1S6Q A;  4H0T B;  4CEC A;  3C7N A;  4DV5 K;  2UXB K;  2QWO A;  1X3N A;  3EE8 A;  4HUE A;  3LDQ A;  2I7N A;  4H0V B;  4WQ5 C;  4M7Y A;  2P1J A;  4CHN A;  4H03 B;  2E20 A;  1EWR A;  4FJX A;  3AA4 A;  4MFB A;  5AQX A;  4CBU A;  1VSF A;  4O0J A;  2RE2 A;  4IOC L;  2Q97 A;  4Y1C A;  4X65 K;  2KFN A;  4H4O A;  2E4L A;  4IKF A;  1T8E A;  4CJS A;  4V19 S;  1YTU A;  4FM1 A;  1N5Y A;  3AVK A;  3LWL A;  3VGM A;  3U9D A;  3J81 O;  1TUU A;  4B3M K;  2RN2 A;  4JI8 K;  2PYL A;  4FJ8 A;  2D0A A;  1BO5 O;  1HYZ A;  1P90 A;  5J2N A;  3PLA A;  3WNF A;  4FWQ A;  3AAQ A;  2W40 A;  4E7I A;  4H0X B;  2ATQ A;  4BRQ A;  3TAE A;  2OTJ N;  4FWO A;  3VF6 A;  3CER A;  1GLD G;  2QK9 A;  5AQL A;  4DV0 K;  4HHT A;  3O9Q A;  4FWR A;  4Q0B A;  3KK3 A;  3P31 A;  4JKG A;  2ZQB A;  4FYD A;  3CME N;  3C95 A;  1RT6 A;  2UUC K;  1BCM A;  3SNN A;  2HBJ A;  2YNF A;  1LAV A;  4BR9 A;  4FLT A;  3M3Z A;  2QXF A;  3H1V X;  3E66 A;  2BH1 A;  4JI5 K;  1QE1 A;  2G8W A;  3OYC A;  2FBX A;  1BIZ A;  1QQN A;  1QSS A;  1BOT O;  3NH0 A;  1X9W A;  4BRD A;  5FPM A;  4I6M A;  3A0I X;  1U04 A;  3F5T A;  3H3N O;  3VQC A;  1Q9X A;  1KRP A;  3CC7 N;  4CJ3 A;  4PA1 A;  2HNZ A;  3DLR A;  1RT5 A;  5A2Q O;  4CJK A;  3OYH A;  5KPT A;  5BRH A;  4DS5 A;  1NBW A;  1NKC A;  2X6N A;  1Z26 A;  1SAZ A;  2BUP A;  5TKY A;  3AO4 A;  1RDA A;  1BI4 B;  4GVE A;  4JD2 B;  3ZT2 A;  3VF4 A;  4GVM A;  2G8U A;  1DKG D;  3QIP A;  2XY6 A;  3NMU A;  2AJQ A;  4CJF A;  3JSM A;  1BG3 A;  1HJO A;  1D9D A;  4R79 A;  1DTQ A;  2PZS A;  1V4S A;  2A42 A;  3KLH A;  4ISF A;  1WAF A;  3TAQ A;  4LH4 A;  3ZSO A;  1N6Q A;  2VGN A;  5TKW A;  3VQ4 A;  4ILJ A;  3JAM O;  1FJG K;  1S6P A;  1HPZ A;  3O3G A;  4PQU A;  3ENB A;  1NNE A;  3K5L A;  3DRP A;  3CCU N;  4LF4 K;  2A40 A;  1S72 N;  4C1N I;  5DM7 L;  3MWT A;  1GLA G;  2QI2 A;  2WFB A;  5AFU H;  2HB5 A;  4JRP A;  1F21 A;  3CCM N;  4FZX C;  2XHB A;  4KBO A;  4DFP A;  3RRG A;  3VEV A;  4AF1 A;  2W6K A;  4CD1 A;  2V52 B;  5M1P A;  3NGI A;  4DTU A;  1NM1 A;  1BQM A;  3QBX A;  4RTF D;  4JKA A;  1XI1 A;  4NCB A;  4AM7 A;  4DV7 K;  3TAN A;  1TGO A;  3PO4 A;  3WNE A;  4M41 A;  1KLN A;  3FR0 A;  3MXJ A;  2G8I A;  5JMV A;  3NGZ A;  4JI7 K;  2P9S B;  4FJ5 A;  3FZK A;  1C1B A;  3N4Q A;  1ZYQ A;  4CJU A;  3DXK A;  2E5L K;  1JLC A;  3SUO A;  2R7Y A;  1VRU A;  3P39 A;  5AQO A;  2UYT A;  4CZL A;  5J2Q A;  1OH8 A;  1IKW A;  3LDP A;  4DV2 K;  4GY2 B;  3AGK A;  1LV5 A;  2Q36 A;  3TWH A;  2WOM A;  2P5O A;  4ZHR A;  1BCO A;  2DPN A;  2O4G A;  4BR2 A;  3O9U A;  1NGH A;  5KQD A;  1Z25 A;  3DLL L;  2A41 A;  1K73 O;  4KTW A;  2VQE K;  4M42 A;  2YV0 X;  2W6L A;  3GDQ A;  4K41 A;  4OLA A;  4CZK A;  3PX4 A;  1S5J A;  2QW9 A;  3CCV N;  5BPM A;  4E7K A;  2F4V K;  3ZSX A;  1SV5 A;  4MLH A;  1WSG A;  1WN7 A;  4MO4 A;  1EXQ A;  3CI5 A;  3F73 A;  1WSF A;  3O4Q A;  5HRR A;  5CHI A;  4DQQ A;  3FZL A;  1BL3 A;  1O13 A;  4JS5 A;  5KPZ A;  4CJR A;  5AQK A;  2YHW A;  4H5R A;  4NXN K;  1HRH A;  3KHY A;  1TVR A;  3KLI A;  4L3Q A;  1YXQ A;  4FW1 A;  4PKI A;  4A2B A;  2Q0U A;  1U47 A;  3NDK A;  2OPP A;  2Z1I A;  4DQP A;  1LWF A;  4DTM A;  1YJW N;  3ZT4 A;  2X78 A;  4W5T A;  2I7P A;  2NRX A;  1VQ6 N;  3HT3 A;  3FZM A;  2HBK A;  3OYF A;  5EOY A;  3O9T A;  3AVN A;  1W9H A;  3DYA A;  1JL2 A;  1Q86 O;  1NGF A;  1P8Z A;  1O1W A;  3I0R A;  4IFV A;  4FW2 A;  4JNE A;  2BAN A;  3G4S N;  3LZJ A;  1JXE A;  2UXC K;  3FFI A;  4YNQ A;  1NK8 A;  1RT2 A;  1TKD A;  4UY8 O;  2FBV A;  3THW A;  4ID1 A;  1NMN A;  2HHU A;  1T44 A;  4AQY K;  2O8D B;  1XQS C;  4EP5 A;  3O3H A;  3VQP A;  1VQ7 N;  1HQU A;  1FKO A;  4N47 A;  4I9Q A;  4ISE A;  5GAD P;  3KJV A;  1RDW X;  2Q2R A;  3FZF A;  3VQ6 A;  3CHW A;  1ATN A;  1N8R O;  4BVP A;  2PAV A;  1Q8I A;  1YHQ N;  3K9K A;  4AIL C;  4RCH A;  5FPN A;  2FLO A;  1KVB A;  3A5O C;  2E88 A;  4Z4H A;  5AQF A;  4AH9 A;  3MAQ A;  3ALY A;  1VSI A;  3IAY A;  3QEI A;  2F8S A;  3C6T A;  3DAW A;  4WYB A;  3VES A;  4B9T A;  4JKF A;  4K0K K;  2IVO A;  1X9J A;  1VQO N;  3L3U A;  3M8S A;  5F2R A;  4AHR A;  4WF9 L;  4AHS A;  3UKU B;  3HVT A;  4WQ4 A;  3HBT A;  1NGG A;  3CPW M;  1UAX A;  3V9X A;  3EEQ A;  4F2S A;  3HPH A;  4DFJ A;  1XNR K;  4F8R A;  3WNG A;  1K8A O;  1J6Z A;  4MDA A;  3J80 O;  2HST A;  4DLG A;  3KTQ A;  4ELT A;  3KVG A;  3QML A;  3GL1 A;  3RSE A;  4DR2 K;  1VSE A;  3SJH A;  4B08 A;  3OA9 A;  1EET A;  3ZX3 A;  1BGX T;  1HYV A;  4RW6 A;  2E6M A;  2OPR A;  3OYE A;  5BN8 A;  3QB0 A;  3ZSR A;  3KLE A;  2E1Y A;  4AM6 A;  5AQZ A;  1TK5 A;  4E7L A;  1NGD A;  4BRO A;  1QSY A;  4M3X A;  3T3F A;  4B8A B;  3ZX2 A;  4JK8 A;  4KHN A;  4BR4 A;  2XY8 A;  2NRZ A;  3DOK A;  4FOI A;  5GAH P;  1QQO A;  1U48 A;  2A6A A;  3QIN A;  2QA4 N;  1VSH A;  3HZ6 A;  3OVN A;  3HO1 A;  1S1V A;  4JKG B;  4GKK K;  2HOE A;  5EVZ A;  5EU7 A;  4N56 A;  1S1T A;  3NF9 A;  4BDY A;  2RF2 A;  4JLH A;  3BZC A;  4JKD A;  3T1A A;  4F4K A;  3SQ2 A;  1MDU B;  5JVH L;  1G99 A;  2OPQ A;  4OKJ A;  1LW0 A;  2P9P B;  4KAZ A;  1ASW A;  2EX3 A;  1SL2 A;  2KZM A;  3VQQ A;  5J2P A;  1D9F A;  5M1K A;  4JYA K;  2KLA A;  5FLX O;  4CJE A;  5M1N A;  3SLC A;  2YJF A;  4DTN A;  4B3T K;  3RR7 A;  1RBT A;  4DR6 K;  4OKK A;  1D8Y A;  4YOX A;  4M45 A;  3PX6 A;  3T1Y K;  1NLV A;  3KK7 A;  4DFM A;  3OTO K;  4BRI A;  4BWM A;  3B8A X;  3SPY A;  3TU5 A;  5C12 A;  1C0U A;  2Q1N A;  3J7A P;  2FSK A;  1WBB A;  4KV8 A;  4KKO A;  4DFK A;  4KHS A;  4OJR A;  5BRE A;  4FWK A;  4NXM K;  4PUO A;  3NAE A;  3M6G A;  4OLB A;  3BP8 A;  4BC5 A;  2O8E B;  3EKS A;  4FJJ A;  3O1B A;  4CF2 A;  4DU4 A;  3QEV A;  3OS2 A;  4H5V A;  5B8H A;  4N5S A;  1J5O A;  4DR7 K;  4DV1 K;  3V9U A;  2YHB A;  4BE0 A;  2KTQ A;  4FLV A;  4IFY A;  4CHQ A;  4Y0W A;  4CJT A;  3OBY A;  4BQZ A;  1S1U A;  3QBW A;  1S9E A;  3ENH A;  4BRA A;  1VSM A;  3E9O A;  2HHX A;  4U7B A;  3AO1 A;  2P9N A;  3RMC A;  2B6A A;  3OJU A;  3VMF B;  4LFA K;  1I3A A;  1N36 K;  1QZ6 A;  3DRS A;  3H08 A;  4Z94 A;  1HKG A;  3TAG A;  2O8B A;  4Z4C A;  1HUX A;  5AR0 A;  4AHT A;  2A1S A;  3D2F A;  3WEE A;  4CED A;  4FLU A;  3SMP A;  3ZSQ A;  4KH6 A;  5AQU A;  1YF5 L;  2WBN A;  4CGG A;  4WFB L;  1FK9 A;  3ATV A;  2HBL A;  4FL9 A;  4JI0 K;  1SUQ A;  4NLB A;  1SKW A;  2ZGZ A;  4KRE A;  3OS0 A;  5I3U A;  3FLC O;  1KLM A;  3VA0 A;  3LAN A;  4PKG A;  4CZM A;  2QKK A;  4C8K A;  1N34 K;  3VEN A;  2P51 A;  4LF8 K;  3SV4 A;  4RW9 A;  3DLB A;  5E84 A;  4DSF A;  3DJC A;  4BQL A;  5KGX A;  1RBS A;  3LAL A;  3MEE A;  3AY9 A;  1IJJ A;  4NYF A;  5BPN A;  3GE1 A;  2GUI A;  1QHT A;  2DFE A;  4DTO A;  4CIF A;  2NRR A;  4CEZ A;  4KPY A;  1RTD A;  2KFZ A;  1KXP A;  4BY9 C;  2G8K A;  2UXD K;  4EP4 A;  2HHT A;  2JGU A;  3NH1 A;  1JCE A;  3CFP A;  4M7X A;  3L0Q A;  4JKB A;  3BF3 A;  4FCY A;  2DFF A;  4RG8 A;  3PY8 A;  2D4W A;  3W3D A;  4DR3 K;  3C65 A;  1C6V A;  3ZET A;  3U3Y A;  3CJ7 A;  1RDC A;  2E2O A;  1YTA A;  4WE1 A;  2RHK A;  3WQT A;  1HYS A;  3L2Q A;  2KZZ A;  4CF9 A;  3G25 A;  3THV A;  5E26 A;  4B1Y B;  2VQF K;  3MWP A;  5LJW A;  4HUG A;  2OCE A;  4CES A;  1VSD A;  3KK2 A;  1YUW A;  4C1N K;  4M63 C;  4XH1 A;  2OAN A;  2IVN A;  1C0T A;  3HST B;  3F9M A;  1GLB G;  2ETJ A;  1NJI O;  4PL8 A;  3LP3 A;  4O5B A;  2WTU A;  4EAH D;  3QFU A;  3H45 C;  3C0B A;  3CCR N;  1LWE A;  4O5F A;  2BTF A;  4PHT X;  3AVI A;  1IH7 A;  4PKH A;  3SUQ A;  1MWK A;  2YX6 A;  5ADX H;  4LF6 K;  2NZT A;  3THW B;  3CCQ N;  1JLE A;  1TKX A;  3HRG A;  4CIE A;  1VQL N;  5C24 A;  4CJL A;  2IDO A;  5EY4 A;  4M3T A;  4B9N A;  3AV9 A;  3LDO A;  4YFU A;  5J2M A;  5AZI A;  4CZJ A;  5KRS A;  4MO5 A;  4E1J A;  1JLA A;  4HWI A;  4AHC A;  2YKM A;  4KI4 A;  1CZA N;  2FXU A;  2YHA A;  3G0Z A;  1SZ2 A;  3WXK A;  4JHD A;  3TSQ A;  4CFC A;  5MLC Q;  2P9I A;  3LPT A;  3WNH A;  1SKS A;  2HHW A;  2O8F B;  3CXC M;  5LMU K;  4DSK A;  1W7A A;  5C15 A;  4CCH A;  3QIO A;  4H8K A;  4J8F A;  5C0Y A;  1DTT A;  1KFS A;  3GBT A;  3NGY A;  4H5T A;  4NO7 A;  4GNI A;  3THX A;  1C1C A;  5EXW A;  1HX1 A;  1NMD A;  3MMV A;  1NGB A;  3ZEU B;  2G8V A;  1Q7Y O;  4DV6 K;  1ZBL A;  2V51 B;  4CVN E;  4O8K A;  3DXM A;  4O55 A;  4BRP A;  3VF2 A;  3HSC A;  3L6Q A;  3E9P A;  4DR5 K;  5GIO A;  2VWB A;  3BGR A;  3EZ5 A;  4QS7 A;  4ICL A;  4CEO A;  1RCH A;  3AVH A;  4KB1 A;  4OPA A;  1BWF O;  3W0L A;  3L4I A;  2HVH A;  4FJK A;  4Y1D A;  3DLG A;  3WXI A;  3RMB A;  1RT1 A;  3FZH A;  4BRH A;  3OYJ A;  5AQT A;  3OYG A;  1MU2 A;  3KWG A;  2D0B A;  4YHH K;  1ZBH A;  1L3U A;  3CFR A;  1NGA A;  3AAP A;  3CFO A;  3PIP L;  5AQS A;  3THY A;  4JS4 A;  1XHX A;  1YVN A;  3AVB A;  4DTR A;  3WT0 A;  4FOE A;  1LOT B;  4JKC A;  3RTV A;  4O8U A;  2P9L B;  1U2V A;  3LZI A;  3SQ1 A;  3R8E A;  3OW2 M;  3S9H A;  2O4I A;  2LSN A;  1EP4 A;  4CZH A;  5HRN A;  3DOL A;  2HND A;  2GEL A;  2KKZ A;  3ULE A;  4B3R K;  4F3T A;  3UKR B;  4IFE A;  3CET A;  1CLQ A;  3C94 A;  3IDH A;  3ZX0 A;  4HUF A;  4CK1 A;  3MN7 A;  4FK0 A;  1X9S A;  1REV A;  1RDD A;  1HMV A;  4DF4 A;  3ZSZ A;  2Z1G A;  3K5N A;  4N76 A;  4CEQ A;  1ESV A;  1LW2 A;  4G1Q A;  3NE6 A;  5AQN A;  2YI1 A;  3TSU A;  4UQG A;  2KQ2 A;  3VQA A;  3IUC A;  3VER A;  4JI4 K;  3O80 A;  4CEB A;  1TYQ B;  2O8C A;  1VHX A;  3H3O B;  3LDN A;  3QNO A;  3Q7C A;  1IBL K;  5CZ2 A;  5JS2 A;  4B3O A;  1VQN N;  1ZBS A;  4DR4 K;  3D2E A;  5GIN A;  3EE9 A;  3U6F A;  3MEG A;  3R3L A;  4RWT A;  3V6D A;  2E1Z A;  1SL1 A;  3M5R A;  4WQ4 C;  2ZJP L;  3MED A;  4IOX A;  4BAC A;  3U8X A;  1XMQ K;  4A61 A;  2XO7 A;  1KAY A;  3HL8 A;  3CCJ N;  1V4T A;  3CC2 N;  4CK2 A;  3ZT1 A;  4CEA A;  1C1A A;  3M1F A;  3TAR A;  2ZF5 O;  1IBM K;  3NF6 A;  3OYN A;  4M3W A;  1EO1 A;  1W2B M;  2VYP A;  3V1O A;  1A5X A;  1EX4 A;  1VQ8 N;  3MN6 A;  5AQY A;  1EWQ A;  3TTD A;  5AZJ A;  4BRG A;  3QLH A;  2QKB A;  1QZ5 A;  1B9F A;  2D5R A;  3NF8 A;  1K6Y A;  4CHZ A;  4CJP A;  4RW4 A;  3TR8 A;  3ZT3 A;  5JLH A;  4OKE A;  4CI6 A;  3ZSY A;  1RBR A;  4CE9 A;  4FWP A;  3VQD A;  2JWL A;  4BRC A;  3QET A;  4FZZ A;  5AQV A;  3SYZ A;  1RGI A;  5HP1 A;  1GLF O;  4E3S A;  2J4R A;  3NVK A;  2YNG A;  3IG1 A;  4YOV A;  5C10 A;  1N32 K;  3EN9 A;  3PSF A;  4CFA A;  4DLE A;  4A62 A;  2HF4 A;  4K25 A;  3EL2 A;  4IDH A;  3VOV A;  4TSX A;  2ITG A;  3O9S A;  3SCX A;  2GWJ A;  1TK8 A;  4M3U A;  4J2E A;  1OVY A;  4JI2 K;  5AQP A;  4B1Z A;  2E2N A;  5BPL A;  1B92 A;  3K58 A;  1E3M A;  2BE2 A;  4JKH A;  1NJY A;  1UA0 A;  3CQ8 A;  4RW7 A;  2WC9 A;  4FPA A;  1CZB A;  2Y1I A;  3CG7 A;  5AQI A;  2G8H A;  2GTD A;  1HNI A;  3LP0 A;  3VQ9 A;  3C7N B;  3AO2 A;  2F9T A;  3P5J A;  1VQM N;  3O8M A;  5FPD A;  4XIU A;  4A5B A;  3O9R A;  1G15 A;  3U4L A;  5KQ8 A;  3PO5 A;  4IG3 A;  3S41 A;  3DLH A;  4HTU A;  4XH5 A;  2E8A A;  1R0A A;  1JLG A;  1VQP N;  3O4W A;  5GAE P;  4I2Q A;  4OGC A;  3C6A A;  1W97 L;  4FWL A;  4DSJ A;  1HQE A;  2F9W A;  2XRI A;  3BF1 A;  4E7H A;  4BRL A;  3UE5 A;  4K8Z A;  4FO0 A;  4GW6 A;  4XEI A;  3ITH A;  4N41 A;  1WSI A;  2KW4 A;  5JS1 A;  4EZ6 A;  1RT7 A;  1J53 A;  5HOO A;  4W5O A;  4WFN L;  4DMN A;  1J54 A;  3QDK A;  3NF7 A;  4IJA A;  2UUB K;  4B9L A;  3CJ9 A;  3ID8 A;  3SPZ A;  2W41 A;  3LDS A;  1L5U A;  5IWA K;  3DLE A;  1BI4 A;  3OHR A;  1IG8 A;  4CZE A;  2X6S A;  3MDQ A;  1WAJ A;  4CBX A;  1JJ2 M;  1HPM A;  1RT3 A;  3SAF A;  4CF0 A;  1S22 A;  4FSV A;  3OBW A;  3KD1 E;  4JK7 A;  1JLQ A;  4C8N A;  5AQG A;  5LMN K;  4DF8 A;  4JHD B;  4DWI A;  4DCH A;  2GEM A;  1OH5 A;  2VWK A;  3ULD A;  2ITM A;  3K59 A;  1IO2 A;  5F0X A;  1I39 A;  3P1G A;  5AQW A;  5AQH A;  4O0I A;  4DQS A;  5DK5 A;  1NJZ A;  3TAF A;  4B9M A;  3JYT A;  3PX0 A;  2HNY A;  2QWN A;  2HMP A;  1K8K A;  3VN5 A;  3SZ2 A;  4QS8 A;  2JWK A;  2VCP A;  3ENO A;  4FK2 A;  3AA3 A;  2F96 A;  3CJC A;  4I6M B;  3THX B;  3HPG A;  2PY5 A;  3O4N A;  4DUY K;  4Z4G A;  2D1K A;  2P9U A;  3LM9 A;  4H4M A;  1TKZ A;  3VQE A;  2OA8 A;  3CJA A;  3TSP A;  5HLF A;  3A5L C;  4YOU A;  2FC0 A;  4CD3 A;  1U4B A;  4FWN A;  5C42 A;  1M1K O;  3FFK B;  1VK0 A;  4A5A A;  1FXX A;  3QO9 A;  5JIC A;  4LSL A;  3H1Q A;  2FF3 B;  3PSI A;  4CBW A;  3HVR A;  4DTX A;  4XH4 A;  3A5M C;  1WLJ A;  3I0S A;  3CJB A;  2CH5 A;  1VQ4 N;  3TPQ A;  4O44 A;  2P5G A;  3ZLJ A;  2P9S A;  4FJN A;  3O3F A;  3HP9 A;  5J1E A;  1XHZ A;  3WQU A;  4B8C A;  3PIO L;  1UA1 A;  2W42 A;  4BDZ A;  1T05 A;  4M3Z A;  1WSE A;  1Q82 O;  3IMX A;  3ISN C;  5AFU A;  3CM5 A;  4ISG A;  1U45 A;  4LF7 K;  1DEJ A;  1YAG A;  2ZWH A;  1HKC A;  3WXM B;  2FBY A;  1NJX A;  2VG7 A;  2YNH A;  3T19 A;  4CIG A;  1RFQ A;  4H0Y B;  4CF1 A;  1TAQ A;  4CF8 A;  3F2K A;  4A59 A;  4FXD A;  2QWP A;  4FJL A;  3AVF A;  4FLZ A;  4CHP A;  4C8L A;  1Z6R A;  3LAM A;  4H5N A;  1RBU A;  4YY3 K;  3PUF A;  2FBT A;  2V7Z A;  4FVM A;  2FSJ A;  1CXU A;  1BU6 O;  3OS1 A;  3JS6 A;  2X74 A;  4OPK A;  2ASM A;  4PL7 A;  2H3G X;  3MN5 A;  5EX5 A;  1Q81 O;  4BRK A;  1QSL A;  3CMA N;  2IAJ A;  3I33 A;  2QXL A;  4JN4 A;  1ZXO A;  1DT9 A;  1HJR A;  3HYF A;  2D0P A;  3VQB A;  1GLL O;  5F1X A;  2A5X A;  3DXK B;  4EFH A;  4JKE A;  3NCI A;  4DUZ K;  2HHH K;  4CK3 A;  1J9A A;  3RRH A;  3QEP A;  3PV8 A;  4HCC A;  1HNZ K;  3P4I A;  3TAB A;  4E89 A;  1JKH A;  3KLG A;  4B1V A;  3GOI A;  3QIC A;  4GV9 A;  2CGJ A;  1FKP A;  3KWI A;  4K42 A;  4FM2 A;  1NGC A;  1ATR A;  5M1Q A;  4H0O A;  1LAW A;  3R6M A;  4LFC K;  1Q9Y A;  1NKB A;  4JI3 K;  2HMI A;  3OYD A;  3CQX A;  3ZT0 A;  4X64 K;  1KC8 O;  4NCG A;  5CZ1 A;  3DWL A;  1TV6 A;  3ATU A;  3V1R A;  3OYA A;  1BA0 A;  4ILH A;  4BG8 A;  4YDU A;  3SUP A;  1TAU A;  3SBT A;  3OY9 A;  2PBD A;  4GMJ B;  4DR1 K;  4DSL A;  4OO1 J;  3M8P A;  2ASO A;  2QWQ A;  4CFD A;  4GKJ K;  2A1R A;  3G6E N;  3LWM A;  1T6C A;  3D0P A;  4ILG B;  3O5B A;  2FSN A;  3EY1 A;  3N4P A;  2DFH A;  1JLF A;  5IT9 O;  5DM6 L;  5BN9 A;  3AO3 A;  1ZBI A;  3NFA A;  3MCP A;  3UB5 A;  2HHQ A;  1WSH A;  3UKU A;  3O1W A;  3LP2 A;  4FM0 A;  2YHX A;  3MN9 A;  5SWM A;  3U9Z A;  1NK9 A;  4IWV A;  3QNN A;  1Y97 A;  3TAM A;  1ITG A;  4ZTJ A;  2QWM A;  3QEW A;  4B9S A;  3G71 N;  1TKT A;  3E9L A;  4X66 K;  5M1F A;  1NGI A;  1DLO A;  3K9J A;  3AVL A;  3C6U A;  3NVM A;  5H1S Q;  1IKX A;  3DMJ A;  1VSK A;  5I42 A;  1KAZ A;  4OVL A;  1NKE A;  4FVU A;  2YKN A;  2KHO A;  5KTQ A;  1S1W A;  2YNI A;  3ZSW A;  4CGH A;  4CJQ A;  5HL7 L;  1WB9 A;  4KH4 A;  5HRP A;  1QQC A;  3J7Z O;  4DTP A;  1EQY A;  3CC4 N;  4JEP A;  1IKV A;  4ZTF A;  2ZJQ L;  1JCG A;  4IZ9 A;  3ASM A;  4FZY A;  2HW3 A;  4BG9 A;  1VSJ A;  1T6D A;  4BWJ A;  3VGL A;  1UOC A;  3LM2 A;  2G8F A;  5E41 A;  2Q31 A;  4YOT A;  4CFB A;  1I94 K;  5I9E B;  3HXM A;  3CJ1 A;  4DTJ A;  1YT3 A;  3NBP A;  3HM9 A;  1GLE G;  2NNW A;  4JAX A;  3AGR A;  1OH7 A;  5HBM A;  1ATS A;  1SKR A;  2ZD1 A;  4DU1 A;  3HOT A;  4BC4 A;  2YCH A;  4DHY A;  2OYQ A;  3KK1 A;  3RMD A;  1M90 O;  3I8D A;  1KD1 O;  1RNH A;  4CEF A;  1WBD A;  2P9P A;  1ZBU A;  3R9P A;  3IS9 A;  3DRR A;  3V81 A;  3S3O A;  4DV4 K;  3RSE B;  1HNX K;  4KHW A;  4JRQ A;  3CIP A;  5FPE A;  3EKU A;  4EIA A;  2GV9 A;  4NYN A;  4BRN A;  1TK0 A;  3OYK A;  4WQ5 A;  2UU9 K;  5GIP A;  4DQI A;  1WNS A;  5SZT A;  4K8X A;  3VQ7 A;  4CW7 B;  2P9K A;  5FRN A;  4HVJ A; 
#chains in the Genus database with same CATH homology
 1RDB A;  2EX3 A;  3QET A;  1SL2 A;  4KHQ A;  4FZZ A;  2KZM A;  3VQQ A;  5T7B A;  3SYZ A;  3HJF A;  5J2P A;  1JXB A;  1D9F A;  1IKY A;  4DG1 A;  4LY7 A;  5HP1 A;  4E3S A;  4CJE A;  2I5J A;  1KTQ A;  3K5O A;  4Z4F A;  1KCF A;  1CZ9 A;  2YNG A;  3IG1 A;  3KD5 E;  4DTN A;  3RR7 A;  1RBT A;  4CFA A;  4OKK A;  1BHL A;  4DLE A;  1D8Y A;  3V9Z A;  3AO5 A;  4M45 A;  3PX6 A;  4W5R A;  3LAK A;  1S6Q A;  4CEC A;  4DFM A;  4TSX A;  1NK6 A;  1S9G A;  2ITG A;  4IG0 A;  4BWM A;  3SCX A;  1TK8 A;  4HUE A;  4FLY A;  3SPY A;  1C0U A;  3SJJ A;  4M3U A;  4CJ5 A;  3RMA A;  2P1J A;  4CHN A;  4J2E A;  4CER A;  4CHO A;  4FJX A;  4KV8 A;  4KKO A;  3AA4 A;  4DFK A;  4KHS A;  1B92 A;  4OJR A;  5C25 A;  4MFB A;  4RW8 A;  3K58 A;  1ASU A;  3S3N A;  1BQN A;  2HHV A;  3AVJ A;  2BE2 A;  4PUO A;  3NAE A;  1VSF A;  4O0J A;  2BGG A;  3M8Q A;  4OLB A;  1NJY A;  1GOA A;  1UA0 A;  4FJJ A;  1RIL A;  4CF2 A;  4DU4 A;  3QEV A;  4Y1C A;  3OS2 A;  3CQ8 A;  2KFN A;  4RW7 A;  4H4O A;  2E4L A;  4CJ4 A;  4IKF A;  1WSJ A;  4CJS A;  4N5S A;  1T8E A;  1J5O A;  1YTU A;  1CZB A;  2Y1I A;  3CG7 A;  3V9U A;  4FM1 A;  2YHB A;  1N5Y A;  3AVK A;  2G8H A;  1HNI A;  3LP0 A;  3LWL A;  3VQ9 A;  4BE0 A;  4FLV A;  4IFY A;  4CHQ A;  2KTQ A;  1ASV A;  3AO2 A;  4CJT A;  5HRS A;  1A5V A;  3P5J A;  3NH2 A;  1S1U A;  1S9E A;  2RN2 A;  4XIU A;  3QES A;  2PYL A;  4FJ8 A;  4HCB A;  2D0A A;  1VSM A;  1G15 A;  1L3S A;  2HHX A;  3PO5 A;  3AO1 A;  1HYZ A;  3RMC A;  4IG3 A;  5J2N A;  2B6A A;  4IBN A;  4KHY A;  3OJU A;  3DLH A;  4HTU A;  3WNF A;  2HVI A;  1I3A A;  1R0A A;  1JLG A;  3RWU A;  4E7I A;  3DRS A;  2ATQ A;  3TAE A;  3VQ5 A;  4I2Q A;  4OGC A;  4FJI A;  3H08 A;  4LSN A;  4FJM A;  2QK9 A;  4F2R A;  4DSJ A;  1HQE A;  4E7H A;  2XRI A;  4Z4C A;  3TAG A;  3SQ0 A;  2DY4 A;  4AHT A;  4HHT A;  2A1S A;  4K8Z A;  4Q0B A;  4CED A;  3KK3 A;  4GW6 A;  4FLU A;  3ITH A;  4N41 A;  1WSI A;  2ZQB A;  4DS4 A;  2KW4 A;  3L2U A;  3ZSQ A;  5JS1 A;  5FDL A;  4EZ6 A;  4FYD A;  1RT7 A;  3C95 A;  1VRT A;  4CGG A;  4PWD A;  3BDP A;  1RT6 A;  1FK9 A;  1J53 A;  4J2A A;  1SUQ A;  1BCM A;  4W5O A;  3SNN A;  4FLT A;  2YNF A;  1LAV A;  4DMN A;  1J54 A;  1SKW A;  2QXF A;  4FK4 A;  4KRE A;  3OS0 A;  5I3U A;  3NF7 A;  4E1M A;  1QE1 A;  1NK0 A;  3KKS A;  2Z1H A;  2G8W A;  4B9L A;  1KLM A;  3SPZ A;  3VA0 A;  1L5U A;  3LDS A;  3LAN A;  2FBX A;  1BIZ A;  3OYC A;  2BDP A;  4E0D A;  3DLE A;  2QKK A;  3V9S A;  1BI4 A;  1QSS A;  4C8K A;  4FJG A;  3NH0 A;  2P51 A;  2X6S A;  3SV4 A;  1JL1 A;  4RW9 A;  3DLB A;  1WAJ A;  1X9W A;  4DSF A;  1RT3 A;  5KGX A;  1U04 A;  1RBS A;  2XY5 A;  3LAL A;  3V4I A;  3VQC A;  3MEE A;  4CF0 A;  1Q9X A;  1KRP A;  4CJ3 A;  2Y1J A;  2D0C A;  4PA1 A;  3KD1 E;  3K2P A;  5K14 A;  1JLQ A;  4NYF A;  2HNZ A;  3DLR A;  4C8N A;  3OJS A;  4LH5 A;  1RT5 A;  4E19 A;  4DF8 A;  4DWI A;  2GUI A;  2VWK A;  1QHT A;  2DFE A;  4CJK A;  3OYH A;  3ULD A;  4DTO A;  3QEX A;  3K59 A;  1IO2 A;  1B9D A;  1I39 A;  4CIF A;  3P1G A;  4DS5 A;  4CEZ A;  4O0I A;  4DQS A;  5DK5 A;  1NJZ A;  3TAF A;  4KPY A;  4B9M A;  1RTD A;  3G10 A;  2KFZ A;  3JYT A;  4FLX A;  3PX0 A;  1NKC A;  2G8K A;  2X6N A;  2HNY A;  4EP4 A;  1Z26 A;  4IDK A;  3VN5 A;  4KI6 A;  2HHT A;  3AO4 A;  1RDA A;  3SZ2 A;  2JGU A;  1BI4 B;  3NH1 A;  3ZT2 A;  3A2F A;  4FK2 A;  2G8U A;  4GVM A;  3AA3 A;  3CFP A;  2F96 A;  4FCY A;  4C8O A;  3HPO A;  1T7P A;  2DFF A;  4RG8 A;  3PY8 A;  3QIP A;  3B6P A;  2XY6 A;  2AJQ A;  2PY5 A;  3HPG A;  4CJF A;  4DTS A;  3O4N A;  1LWC A;  1C6V A;  1NOZ A;  3JSM A;  4Z4G A;  2VWJ A;  5KI6 A;  3U3Y A;  4FJ7 A;  1HYS A;  1RDC A;  2KZZ A;  1YTA A;  4WE1 A;  4H4M A;  1TKZ A;  3VQE A;  3L2Q A;  4CF9 A;  5FRO A;  1D9D A;  1DTQ A;  2OA8 A;  2IGI A;  4KHU A;  3IRX A;  4C8M A;  2PZS A;  3THV A;  5HLF A;  3KLH A;  3TI0 A;  1WAF A;  4EZ9 A;  3HK2 A;  3TAQ A;  2FC0 A;  4LH4 A;  1U4B A;  3ZSO A;  1N6Q A;  1EKE A;  4BE2 A;  4HUG A;  3VQ4 A;  4CES A;  3SUN A;  5C42 A;  1S6P A;  4L8R B;  1VSD A;  4PY5 A;  1VK0 A;  3SV3 A;  1FXX A;  1RTH A;  3QO9 A;  1T03 A;  3KK2 A;  2B4J A;  4LSL A;  3MXM A;  1HPZ A;  3O3G A;  4PQU A;  1CXQ A;  3SQ4 A;  3K5L A;  3DRP A;  3HVR A;  4DTX A;  1C0T A;  3HST B;  1BIU A;  3D45 A;  2ETJ A;  3VQ8 A;  1WLJ A;  3I0S A;  1TL3 A;  4O44 A;  2P5G A;  3LP3 A;  4O5B A;  4FJN A;  3O3F A;  3HP9 A;  5J1E A;  1XHZ A;  2HB5 A;  3E01 A;  4JRP A;  1F21 A;  4FZX C;  3QER A;  2XHB A;  3LP1 A;  1W0H A;  4B8C A;  3OYL A;  4DFP A;  3RRG A;  3EYZ A;  2NUB A;  4W5Q A;  1UA1 A;  2W42 A;  4BDZ A;  1LWE A;  1T05 A;  4M3Z A;  1WSE A;  4I9L A;  3AVI A;  3ISN C;  3NGI A;  1IH7 A;  4DTU A;  3CM5 A;  1X9M A;  4AHU A;  4CHY A;  3SUQ A;  1S1X A;  1BQM A;  1U45 A;  3ZCM A;  3MEC A;  3NHG A;  1XI1 A;  4NCB A;  3TAN A;  1TGO A;  1JLE A;  1YVU A;  3PO4 A;  3WNE A;  1NOY A;  1TKX A;  5KGW A;  2FBY A;  1KVC A;  4M41 A;  4CIE A;  1KLN A;  5C24 A;  1NJX A;  4CJL A;  2VG7 A;  3F9K A;  2IDO A;  2YNH A;  3MXJ A;  4M3T A;  4B9N A;  3T19 A;  3AV9 A;  4YFU A;  4CIG A;  2G8I A;  5J2M A;  1KVA A;  3NGZ A;  4CF1 A;  1TAQ A;  5KRS A;  1JLA A;  4AHC A;  4FJ5 A;  4CF8 A;  1SL0 A;  3S3M A;  1C1B A;  1L3V A;  1ZYQ A;  4CJU A;  2YKM A;  4E1N A;  4FXD A;  4KI4 A;  4FJL A;  3AVF A;  1JLC A;  3G0Z A;  2YHA A;  1VRU A;  2R7Y A;  4FLZ A;  4CHP A;  3SUO A;  4C8L A;  3LAM A;  1QTM A;  3L2W A;  3V9W A;  5J2Q A;  1RBU A;  3PUF A;  2FBT A;  1IKW A;  1KFD A;  2E6L A;  4CFC A;  4DSI A;  4FVM A;  4NCA A;  3LPT A;  1CXU A;  3WNH A;  3ZSV A;  4KFB A;  1SKS A;  2HHW A;  1LV5 A;  3OS1 A;  3TWH A;  2X74 A;  5CY4 A;  4OPK A;  4DSK A;  4KO0 A;  1JLB A;  4CCH A;  2WOM A;  2P5O A;  3QIO A;  4ZHR A;  1BCO A;  1L3T A;  3VA3 A;  4H8K A;  2O4G A;  3L2R A;  1QSL A;  2IAJ A;  5KRT A;  1Z25 A;  4BE1 A;  3DI6 A;  3HP6 A;  1DTT A;  2OPS A;  1HJR A;  1RT4 A;  3NGY A;  4KTW A;  1KFS A;  2YV0 X;  3HYF A;  5CYQ A;  4M42 A;  4OLA A;  1HNV A;  3PX4 A;  1C1C A;  3VQB A;  1S5J A;  1GOC A;  1RTI A;  4FJ9 A;  4F3O A;  3UIQ A;  1NK4 A;  2G8V A;  4E7K A;  3ZSX A;  3NCI A;  1SV5 A;  1NK7 A;  1WSG A;  4ID5 A;  1ZBL A;  2ZE2 A;  1WN7 A;  3RR8 A;  4W5N A;  4CK3 A;  1EXQ A;  4OGE A;  3F73 A;  1J9A A;  4Q5V A;  3RRH A;  3L8B A;  1WSF A;  3O4Q A;  5HRR A;  4DQQ A;  3PV8 A;  3QEP A;  4O55 A;  1BL3 A;  4HCC A;  3BGR A;  3TAB A;  3V1Q A;  2RKI A;  1JKH A;  4E89 A;  3KLG A;  3EZ5 A;  4ICL A;  4CJR A;  4CEO A;  4JS5 A;  1QS4 A;  1RCH A;  3AVH A;  4KB1 A;  4J2B A;  2HVH A;  1HRH A;  3CYM A;  4FJK A;  1FKP A;  4Y1D A;  1C0M A;  3DLG A;  1TVR A;  3KLI A;  3RMB A;  4DU3 A;  4QCL A;  4FM2 A;  1RT1 A;  4FW1 A;  3OYJ A;  2Z1J A;  1U47 A;  3NDK A;  2OPP A;  2Z1I A;  4M3R A;  1LAW A;  1LWF A;  4DTM A;  4AHV A;  4DQP A;  1Q9Y A;  4R5P A;  3ZT4 A;  2X78 A;  1NKB A;  2HMI A;  4W5T A;  3OYG A;  3OYD A;  1MU2 A;  4M3Y A;  3ZT0 A;  2D0B A;  4NCG A;  5CZ1 A;  3HT3 A;  1VSL A;  1ZBH A;  3OYF A;  1TV6 A;  1L3U A;  3AVN A;  3V1R A;  2PYJ A;  1W9H A;  3OYA A;  3DYA A;  1JL2 A;  3CFR A;  1O1W A;  3CFO A;  3I0R A;  3DLK A;  3P83 D;  4IFV A;  4FW2 A;  2BAN A;  3SUP A;  1TAU A;  3OY9 A;  4GMJ B;  3M8R A;  3LZJ A;  1JXE A;  4JS4 A;  4DSL A;  1GOB A;  2IOC A;  3FFI A;  2GBZ A;  1NK5 A;  1XHX A;  4YNQ A;  1ZBF A;  3AVB A;  4DTR A;  1NK8 A;  3M8P A;  3L3V A;  1RT2 A;  1TKD A;  2FBV A;  4CFD A;  2IC3 A;  4ID1 A;  4I2P A;  1KSP A;  2A1R A;  4ELU A;  3RTV A;  1TL1 A;  3LWM A;  4KRF A;  3D0P A;  3EY1 A;  2DFH A;  2HHU A;  1JLF A;  3LZI A;  3SQ1 A;  1RBV A;  4EP5 A;  3O3H A;  3VQP A;  3S9H A;  3AO3 A;  1ZBI A;  2O4I A;  3NFA A;  1HQU A;  2LSN A;  1EP4 A;  1XC9 A;  4QOZ B;  1FKO A;  4N47 A;  2WON A;  5HRN A;  4I9Q A;  3DOL A;  3L2V A;  2Q3S A;  4BDP A;  2HHQ A;  4I7F A;  1WSH A;  2HND A;  3KJV A;  3LP2 A;  3VQ6 A;  4FM0 A;  4OPJ A;  1A5W A;  2EHG A;  5SWM A;  4F3T A;  1NK9 A;  4ELV A;  1CLQ A;  3QNN A;  1Y97 A;  3TAM A;  1Q8I A;  3OYI A;  2IS3 A;  3C94 A;  1ITG A;  4HUF A;  4AIL C;  4CK1 A;  4Z0U A;  1UWB A;  3AVA A;  5DMR A;  4ZTJ A;  4MQ3 A;  3K5M A;  2OZS A;  4FK0 A;  1BIS A;  3QEW A;  4B9S A;  1X9S A;  1KVB A;  5HRO A;  1TKT A;  1REV A;  1RDD A;  1HMV A;  3CM6 A;  4Z4H A;  4DF4 A;  1IG9 A;  3ZSZ A;  2Z1G A;  4AH9 A;  1DLO A;  3K5N A;  3MAQ A;  3TAP A;  3AVL A;  4N76 A;  3C6U A;  5FRM A;  4CEQ A;  3ALY A;  1VSI A;  3IAY A;  1LW2 A;  1IKX A;  3DMJ A;  4G1Q A;  4KTZ A;  3QEI A;  3NE6 A;  2F8S A;  4Z4I A;  3C6T A;  4B9T A;  1U49 A;  1VSK A;  5I42 A;  4OVL A;  1NKE A;  3L3U A;  2YKN A;  3M8S A;  2VG6 A;  5KTQ A;  1S1W A;  2YNI A;  3ZSW A;  4AHR A;  4CGH A;  2KQ2 A;  4AHS A;  4UQG A;  4FJH A;  4CJQ A;  3HVT A;  4J2D A;  3VQA A;  3AA2 A;  3V9X A;  1UAX A;  5HRP A;  4DSE A;  3DM2 A;  2OZM A;  4KB0 A;  1QQC A;  3AA5 X;  4F2S A;  3HPH A;  4DTP A;  4DFJ A;  1IKV A;  4DQR A;  4F8R A;  3WNG A;  4CEB A;  4CGF A;  4ZTF A;  4KTQ A;  5CYM A;  3ASM A;  4FZY A;  2HW3 A;  4DLG A;  1VSJ A;  2B5J A;  4BWJ A;  4FLW A;  3KTQ A;  1UOC A;  4ELT A;  2G8F A;  3B6O A;  4O4G A;  4QAG A;  4CJV A;  5E41 A;  4CFB A;  1VSE A;  4Z4E A;  4B08 A;  3QNO A;  2HHS A;  1EET A;  2DTU A;  1X1P A;  5CZ2 A;  1BGX T;  2F8T A;  3HXM A;  3AVG A;  5JS2 A;  1HYV A;  3AVM A;  4DTJ A;  4RW6 A;  4B3O A;  1YT3 A;  3AVC A;  3NBP A;  3HM9 A;  2E6M A;  2OPR A;  3OYE A;  3KIO A;  3U6F A;  3MEG A;  3SI6 A;  5D3G A;  3ZSR A;  4CGJ A;  3KLE A;  3V6D A;  1SL1 A;  5HBM A;  4CEE A;  1SKR A;  2ZD1 A;  4E7L A;  4DU1 A;  1TK5 A;  1QSY A;  4M3X A;  1XWL A;  3T3F A;  3MED A;  4B8A B;  1RTJ A;  4B9U A;  2OYQ A;  3KK1 A;  4BAC A;  3RMD A;  3I8D A;  4KHN A;  1RNH A;  2XY8 A;  4CEF A;  3DOK A;  1ZBU A;  3OYM A;  3IS9 A;  2XO7 A;  3HL8 A;  3U3G A;  1U48 A;  3DRR A;  3QIN A;  1VSH A;  4B9V A;  2JLE A;  3OYB A;  2XY7 A;  4CK2 A;  3OVN A;  2VG5 A;  3ZT1 A;  4CEA A;  3V81 A;  1C1A A;  3S3O A;  4CGI A;  4LD0 A;  3TAR A;  3NF6 A;  3OYN A;  4M3W A;  3HO1 A;  4KHW A;  1S1V A;  3V1O A;  4JRQ A;  1A5X A;  1EX4 A;  5EU7 A;  4E7J A;  4N56 A;  1S1T A;  2RPI A;  3LPU A;  2GV9 A;  3NF9 A;  4CJW A;  4NYN A;  3QLH A;  2QKB A;  1B9F A;  2D5R A;  2RF2 A;  3K57 A;  4BDY A;  3KLF A;  4JLH A;  3NF8 A;  3OYK A;  1TK0 A;  1D5A A;  1K6Y A;  4CHZ A;  3KKR A;  3T1A A;  4CJP A;  4DQI A;  4F4K A;  4RW4 A;  3SQ2 A;  1WNS A;  1NJW A;  3TR8 A;  3ZT3 A;  5SZT A;  4K8X A;  2OPQ A;  4OKE A;  3VQ7 A;  4OKJ A;  1LW0 A;  3MXI A;  5FRN A;  3ZSY A;  1RBR A;  4HVJ A;  4CE9 A;  3VQD A;  4KAZ A;  1ASW A;  4CGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...