3VQAA

Hiv-1 in core domain in complex with 1-benzothiophen-6-amine 1,1-dioxide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
152
structure length
141
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 52
structure length 141
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqaA00
3MEEA 4MQ3A 1HJRA 4I7FA 4YFUA 3TAQA 3V1OA 1Q9XA 1TGOA 2YHBA 4NCAA 4W5OA 5J2QA 3JYTA 5D3GA 1NJZA 4CF2A 2OA8A 4DSIA 4Y1DA 5HBMA 3OJSA 1ZBIA 1ASWA 2DFFA 3KTQA 1TKZA 3SCXA 1WLJA 1QE1A 1RT3A 4OPJA 2HNZA 3ZSOA 1S6QA 1I39A 4RW6A 4ICLA 1SL0A 1LV5A 4Z4FA 4Z4IA 2VWKA 2E4LA 4CF9A 3V4IA 2IS3A 3C95A 1TKXA 4RW9A 4FZYA 1ZBLA 4CHOA 3PV8A 1S9EA 1VSLA 2A1RA 3H08A 3NGZA 4BDPA 2EHGA 5J1EA 3CFRA 1LAWA 3V1RA 3VQ8A 4E7IA 1SV5A 4DTUA 2G8HA 1WSIA 3EZ5A 1TK5A 2IAJA 4LH5A 1C0MA 1FKPA 5HRRA 3VQBA 5HRPA 3SNNA 1U49A 3IG1A 3LAMA 4NYNA 1BIUA 4CGIA 1HNVA 1Z25A 3AVGA 5I3UA 3SUPA 1WN7A 3HSTB 4OKJA 2P51A 3TI0A 4F2SA 3DRPA 3K59A 4KB1A 2HVIA 2HHQA 2ZE2A 4CHYA 3VA3A 3DLKA 4KHNA 4FJJA 1YTUA 3VQ6A 4M3WA 4KV8A 3OYBA 4IKFA 4H8KA 3PUFA 4ELVA 4PA1A 4KHWA 4BE1A 2QK9A 1SL2A 2RKIA 3LPTA 4DS5A 2HVHA 4CJPA 4F8RA 1EETA 3KK2A 4CEAA 4I9LA 2I5JA 1NOYA 4W5TA 3DOKA 2D0AA 4H4OA 4Z4GA 2DFEA 3WNEA 4CGHA 3SQ2A 1BGXT 4C8LA 3ALYA 1S1UA 5KGWA 3HT3A 4CJRA 2IGIA 1BL3A 1D9FA 3L8BA 3S3MA 3OJUA 1Z26A 2D0CA 1VRTA 1TL1A 3AO3A 3HYFA 2KFNA 2YV0X 4FLZA 5CY4A 3DLBA 4FJGA 3KLGA 1SUQA 1S1XA 3MAQA 1NK8A 4EZ6A 4BE2A 3ITHA 3ZT1A 3KKSA 4F3OA 1RT5A 1VSEA 4CFAA 5KRSA 5SWMA 1EP4A 3L2UA 3QINA 1LWCA 3QEIA 2G8UA 4DQSA 1BQMA 4E19A 4DU4A 1JL1A 3PY8A 4ZTFA 3KJVA 2YHAA 2QKKA 1FK9A 2XY8A 4CFDA 1QTMA 3PX0A 1EKEA 2B4JA 2QKBA 4M3TA 4N5SA 4L8RB 2R7YA 4OKEA 4DF8A 1KVBA 3M8QA 3HP6A 3HXMA 3AVBA 4PY5A 2EX3A 2XY5A 1SKWA 4DTPA 1K6YA 3U3YA 4Z0UA 4ID1A 3OYKA 3SQ4A 3IS9A 4KFBA 1ITGA 4DLEA 3MXJA 1REVA 3THVA 3HO1A 2D5RA 4CEDA 1JLAA 2RF2A 4PQUA 1HPZA 1UA1A 4C8KA 4EP4A 1TV6A 4BE0A 1IKYA 4O0IA 4N47A 3AA4A 1IG9A 4M3RA 2YNIA 1IKXA 3KLHA 4E7LA 1D9DA 1WAFA 3KLEA 4CJKA 2QXFA 4DFKA 3BGRA 1BCMA 4BWMA 3ISNC 5C25A 4DTSA 3QEXA 1NK9A 1T7PA 3LP2A 4CIFA 5DMRA 3ZCMA 4AHRA 3O3GA 4B9LA 4QCLA 3NFAA 1VSKA 3QO9A 1S6PA 2HHUA 4FCYA 4Y1CA 2X6SA 3OYGA 4DQPA 4FJKA 5JS1A 2G8KA 4DTJA 3OYEA 3NH0A 4AH9A 1A5WA 4C8MA 3VQ5A 3ZSXA 2E6LA 2YKMA 5J2PA 4ELTA 4KRFA 3NF6A 3QNNA 2XY7A 2BGGA 1NK0A 1RBVA 1RT1A 1RT2A 4AHTA 4UQGA 2XO7A 3RMDA 1UWBA 4DSFA 2HMIA 2OZMA 1EXQA 1X1PA 3DLRA 1TL3A 4CJLA 3ZT4A 1UA0A 5HRSA 1UOCA 4QAGA 3TANA 3PO4A 1IKVA 3I0SA 1HNIA 2X74A 1CXUA 1ASUA 3LDSA 1KFDA 3T1AA 2FBVA 1BI4B 4KTZA 3O4NA 3RRHA 3CG7A 1Q9YA 3NF8A 5J2NA 2O4GA 1C6VA 4CJ5A 4ZHRA 4AILC 4M41A 4M45A 3DRRA 4O44A 1ZBFA 4IG0A 4FJLA 2KZZA 1XHXA 5HP1A 4M3XA 1U45A 4FYDA 2KFZA 5HRNA 1KVAA 5CYQA 1RBTA 3V1QA 4CGFA 4F2RA 1VSFA 3K58A 1CZ9A 1WNSA 1Q8IA 4EP5A 4CK1A 3OS0A 4DQRA 1JLEA 2G8VA 1LAVA 4M3YA 3VQAA 1TVRA 4I2QA 4O0JA 3QESA 4KKOA 3AVCA 1O1WA 4CJQA 1RBSA 3AVMA 4CECA 4OPKA 1CLQA 4DU1A 3MXMA 4B3OA 4FJMA 4CE9A 5CYMA 4OJRA 1LWEA 1GOAA 3U3GA 4CEEA 1Y97A 3OS1A 3EY1A 1S1VA 2BANA 4FZXC 3ZSQA 4PWDA 1JLQA 1WAJA 1D8YA 4J2EA 1JLFA 3CM6A 4Z4EA 1RTJA 1J54A 3DI6A 5FDLA 2NUBA 4OGEA 1J9AA 4CJ4A 4DTRA 1NJYA 4F3TA 3LZJA 3QERA 2ZD1A 4E1NA 4FVMA 3V6DA 3C6TA 4FXDA 3DM2A 4FJ7A 4JRPA 1NK6A 3OYLA 1I3AA 3EYZA 4RW8A 4AHSA 2VWJA 3SUNA 1TAQA 1U48A 1RTHA 4J2DA 2X78A 1YVUA 3NGIA 3K5NA 1LW0A 2VG6A 1L3SA 4O5BA 1ZBUA 1NKEA 1C0TA 4KHSA 3QIOA 4CJFA 1TK0A 3JSMA 2PYJA 1IKWA 4FLTA 1S1WA 2JLEA 3SUQA 1HQUA 4HCBA 4KTQA 4CGDA 4CEOA 1QHTA 4CFBA 3P1GA 1B9DA 4B9MA 3TAFA 3FFIA 4FJ8A 3AVFA 4G1QA 4FLXA 4DFMA 4I9QA 3A2FA 1WSGA 3SYZA 1WSJA 2ETJA 2RN2A 3ZT3A 4CF8A 3DRSA 4BACA 3QNOA 1SKRA 1L3VA 4JLHA 5C42A 4OKKA 4JS5A 3TAGA 1L5UA 4KTWA 3S9HA 2XHBA 4KI4A 1YT3A 3AA3A 4DQIA 5SZTA 4PUOA 1RT4A 4CERA 4KO0A 4DS4A 4CJUA 1XC9A 3TAEA 3IRXA 3SJJA 4LD0A 3P83D 4M3UA 3LANA 1VSJA 4KI6A 1ZBHA 4LH4A 1RCHA 4NCGA 3SPYA 1L3UA 5KI6A 1KSPA 3K2PA 2YNFA 1LWFA 3LP3A 3OS2A 1BIZA 1JL2A 1BI4A 4M3ZA 1VSHA 3T19A 3TABA 3S3NA 1X9WA 1QSSA 1VSIA 2XY6A 1C0UA 4AHUA 4CHNA 4KHQA 3AO1A 4N56A 4M42A 3HPGA 4KHUA 4EZ9A 1JKHA 1MU2A 3T3FA 5HROA 3QEVA 1FKOA 1KCFA 4DFPA 3RMBA 3NDKA 4HUFA 3HK2A 3HPOA 4IFYA 3AV9A 4HHTA 3NH2A 1U4BA 3MEGA 4CEBA 3PX6A 5C24A 3NHGA 1S1TA 3SV4A 3QETA 4HTUA 1X9MA 2P1JA 3LP0A 3HM9A 4C8OA 4DSKA 1W9HA 3NGYA 3AA2A 4JS4A 4K8ZA 2HHWA 3OYJA 2HHTA 2ATQA 4TSXA 3RTVA 1SKSA 1JLGA 3CYMA 4E7JA 1B92A 3WNFA 1RBUA 1RT7A 3VQ9A 1UAXA 3L2QA 1J53A 2P5OA 1GOCA 3ZSYA 1DTQA 3AVHA 4E7KA 3DLHA 4FM0A 1RTDA 3OYDA 1CXQA 1N6QA 4CJTA 4CESA 3B6PA 1HYZA 2IC3A 2Z1HA 5HLFA 4RW4A 4O4GA 3OYFA 1L3TA 3KD5E 2Z1IA 1BCOA 3UIQA 3E01A 2PYLA 4GW6A 2VG5A 4FJ9A 3KLIA 2Y1IA 2ITGA 1LW2A 2O4IA 1BQNA 3CM5A 4DU3A 4DSJA 1KVCA 2B6AA 3B6OA 4HUEA 4DQQA 1JLCA 3KLFA 4Q5VA 3AVKA 3TAMA 3VN5A 4OLAA 1VSDA 3HPHA 4DSLA 3SQ0A 4LSNA 3AO4A 3DYAA 4N41A 3NBPA 2D0BA 2LSNA 5KRTA 3AVIA 3TARA 1KFSA 4F4KA 4Q0BA 3K5OA 2AJQA 3QLHA 3RR7A 4FJ5A 1DLOA 1XHZA 3KD1E 3NE6A 4DTOA 3RRGA 4CHQA 3AVNA 4CIEA 2KQ2A 3I8DA 3LALA 4DMNA 1S5JA 3SQ1A 3LAKA 4CHPA 4BDYA 4LSLA 1XWLA 4E1MA 4KREA 1QQCA 2P5GA 5E41A 5FRMA 3P5JA 4KPYA 2KW4A 3VQDA 5CZ1A 3AVAA 4B9SA 4H4MA 3V9ZA 2VG7A 2GBZA 4DFJA 3AA5X 1NK4A 4J2BA 1EX4A 1NKBA 4WE1A 1VSMA 4NCBA 1GOBA 4CIGA 3HL8A 4CEQA 4FM1A 1N5YA 3KK1A 3DLGA 1HRHA 2FBTA 3HVTA 3KKRA 3OYHA 3M8RA 3O3FA 1J5OA 4FZZA 1XI1A 3VQ4A 2HW3A 3LZIA 4HUGA 3BDPA 3VA0A 3SPZA 3DOLA 5EU7A 4K8XA 4FW1A 2RPIA 3QEPA 4FK0A 3AO2A 3WNGA 3LWMA 1HYSA 1RDAA 4JRQA 3S3OA 1T03A 1HQEA 4OVLA 2G8FA 4N76A 1FXXA 5KGXA 2Z1JA 4B08A 2DY4A 3SV3A 4FLYA 4E0DA 3MEDA 1NJXA 4FJHA 3VQEA 2OPQA 3SI6A 4FJIA 2OZSA 4QOZB 3DMJA 3SZ2A 4B9TA 4IDKA 5K14A 4YNQA 4FLWA 2FBXA 2A1SA 4W5RA 4RG8A 3IAYA 3NF7A 4J2AA 4DTMA 4CCHA 4B9NA 2FBYA 1R0AA 1U47A 4CJEA 3K5LA 3VQPA 4E89A 3QIPA 1BHLA 3M8PA 4MFBA 4FK4A 3L3VA 4CF1A 2BDPA 2B5JA 3OY9A 1SL1A 3I0RA 2W42A 4C8NA 1D5AA 2G8IA 3C94A 4ELUA 1BISA 4GVMA 3C6UA 3D45A 5T7BA 3OYCA 1IO2A 2G8WA 3LP1A 3MECA 3CFOA 3V81A 5J2MA 4FLUA 1B9FA 4DF4A 1C1AA 1T8EA 2DFHA 3VQ7A 4DG1A 2F8SA 3OYIA 2Y1JA 3L2VA 1QS4A 4Z4CA 2YKNA 3ZSRA 4CJSA 1RDCA 4CFCA 1NJWA 1RTIA 2Q3SA 2OPSA 1DTTA 3V9WA 3D0PA 5I42A 3V9SA 3CQ8A 1ZYQA 4LY7A 4KHYA 3TAPA 3ZT0A 3PX4A 3ULDA 4FLVA 3OVNA 3DLEA 3O3HA 3CFPA 1WSEA 1WSHA 3ZT2A 3OYMA 2HHSA 2KZMA 1YTAA 3ZSZA 1KTQA 2X6NA 3OYAA 1TKDA 1VK0A 4IG3A 2Z1GA 3HVRA 2WOMA 2YNHA 4FJNA 4OLBA 2FC0A 1F21A 4CHZA 1NKCA 4DWIA 3F9KA 4RW7A 3RMCA 4FW2A 3TWHA 4ZTJA 3RMAA 4KAZA 4NYFA 3KIOA 5KTQA 3M8SA 4DSEA 3ZSWA 3O4QA 3WNHA 1JXBA 2JGUA 2OPPA 1WSFA 4DTXA 3LWLA 4Z4HA 1TK8A 3HJFA 2KTQA 1TKTA 2HHXA 2DTUA 3QEWA 1KLNA 1G15A 3K5MA 3RWUA 3U6FA 4BDZA 4IBNA 4CF0A 1KLMA 3ZSVA 4O55A 1T05A 3AVLA 3HP9A 1KRPA 3RR8A 4CK2A 3G10A 2HB5A 4KB0A 4FK2A 3NF9A 4CEZA 3VQQA 5FRNA 1X9SA 2WONA 3OYNA 4W5QA 4B8CA 1U04A 1A5VA 4DTNA 1RDDA 2BE2A 2OPRA 1NK7A 3NCIA 3L2WA 1IH7A 1NK5A 2PY5A 2OYQA 3PO5A 5FROA 2XRIA 4B9VA 4CGGA 3MXIA 1RT6A 4AHVA 3K57A 4E7HA 4ID5A 2HHVA 3F73A 4W5NA 1JXEA 3AO5A 2HNYA 3L3UA 1HYVA 3LPUA 1QSLA 3NAEA 1JLBA 2E6MA 1CZBA 2GV9A 2ZQBA 4B8AB 1C1BA 1RDBA 3SUOA 2PZSA 1S9GA 3G0ZA 4HCCA 1A5XA 1W0HA 1VRUA 2YNGA 4IFVA 1QSYA 4E3SA 2F8TA 4XIUA 3AVJA 4BWJA 3VQCA 1RBRA 1ASVA 5DK5A 4AHCA 4CGJA 4I2PA 4CK3A 2HNDA 4OGCA 4R5PA 3NH1A 4DLGA 3L2RA 3KK3A 1C1CA 3V9XA 3ASMA 1RNHA 3V9UA 2IOCA 1TAUA 2F96A 5CZ2A 4FM2A 4CJ3A 1HMVA 2GUIA 2IDOA 5JS2A 4CJWA 4CEFA 4CJVA 1RILA 4B9UA 4HVJA 1NOZA 3TR8A 4GMJB 4FJXA
chains in the Genus database with same CATH superfamily
4MQ3A 1ZXOA 1HJRA 4IJNA 5F1XA 4YFUA 1WB9A 3C0BA 3CETA 1NMNA 1HR0K 4BR2A 2YHWA 1TKZA 4YOYA 1QE1A 4BRFA 1S6QA 5AQWA 4JI7K 3HM8A 2ZWHA 3IDHA 1TKXA 5H1SQ 5BRHA 3VGMA 2G8HA 4FPBA 3V1RA 1SV5A 3EZ5A 2IAJA 4LH5A 5HRPA 5I3UA 3MCPA 3SUPA 4OKJA 4F2SA 5EVZA 4HTLA 2ZE2A 5AQKA 4KHNA 3VQ6A 1NGFA 4JN4A 4WFAL 4CZIA 4BE1A 2HVHA 4CJPA 4F8RA 4FOIA 2E1ZA 2GELA 1KAZA 5KGWA 2IGIA 4BRIA 3S3MA 1Z26A 1VRTA 4WQ4A 3AO3A 3KVGA 2KFNA 3DLBA 2P9UA 3CCUN 4EZ6A 3ITHA 3KKSA 5KRSA 2G8UA 3VEVA 1LWCA 4E19A 3PY8A 4ZTFA 2YHAA 1IBLK 2XY8A 4CFDA 3MN5A 1QTMA 3PX0A 4NLCA 4M3TA 2Q2RA 5I9EB 3OA9A 2Q0UA 3AVBA 3OTOK 2E20A 4Z0UA 2YHYA 5M1KA 3OYKA 2E2NA 4GV9A 4DLEA 1GLFO 1Q18A 2D5RA 4CEDA 1JLAA 2RF2A 3CC2N 4PQUA 4C8KA 4EP4A 1IKYA 3AA4A 4WCEL 1IG9A 4M3RA 4B1YB 4E7LA 1WAFA 3KLEA 2QXFA 4DFKA 1EQYA 1BCMA 5C25A 4DTSA 2IIRA 4YDUC 3LP2A 1HUXA 1VSKA 1S6PA 4I6MB 4FCYA 2HBLA 5IWAK 5J2PA 4KRFA 5JLFA 4FWKA 1RBVA 1UWBA 1YJWN 4E1JA 1EXQA 1X1PA 3CCLN 4CBXA 4F9OA 5HRSA 3BZCA 4H03B 3I0SA 1S72N 3RSEA 1Z05A 3FE1A 1QHAA 5HL7L 2O8BA 3RRHA 4KTZA 4CZLA 3CJ9A 4FJLA 5M1FA 2KZZA 1XHXA 4LC9B 4JI2K 1KVAA 3SJHA 3V1QA 5AQHA 3EZWA 1CZ9A 2A6AA 5JLHA 2AA4A 3BY5A 1TVRA 3VERA 2WTUA 5C12A 1P90A 1E4GT 1O1WA 1CLQA 4OPKA 3HZ6A 3CXCM 3BUZB 1CZAN 4CE9A 4O8KA 1LWEA 3U3GA 3R3LA 4B3RK 2NRXA 3ZSQA 1YIJN 2NNWA 4QS7A 1YF5L 1RGIA 1WAJA 4BG8A 1J54A 4F3TA 4KHPK 4OGEA 2WFBA 3AY9A 3MX2A 3SK3A 3CHWA 4FVMA 5EOYA 2P9KB 4HWIA 3QERA 3DM2A 3V6DA 4FXDA 4FJ7A 4ILJA 4RW8A 4AHSA 2VWJA 3O1WA 1TAQA 5BN9A 4JKAA 1TUUA 1LW0A 5CR4A 4CBUA 1JCEA 4IOCL 1TK0A 3JSMA 3L6QA 4X65K 4GNIA 4FLTA 2JLEA 4CZJA 3SUQA 1HQUA 4WFBL 2FF3B 3IUCA 2P9IB 1OKJA 4H0OA 2P9SA 1WSGA 1WSJA 3ZT3A 1SKRA 1L5UA 4OKKA 2Q97A 1DKGD 2XHBA 4DQIA 3J7YP 3O9SA 1BA1A 2WUSA 3TAEA 4LD0A 3VESA 3KZBA 1VSJA 4LH4A 1LWFA 3VEOA 2HHHK 1BI4A 3PSIA 4LF6K 3VTIA 3CCEN 2HSTA 4DV7K 1VSIA 3UKUB 5FPMA 1VQLN 4YOWA 1MU2A 3T3FA 3QEVA 2I7NA 4FWOA 2A41A 4IFYA 3MEGA 1M90O 3LP0A 4DSKA 4C8OA 3WXLA 3NGYA 3AA2A 4JS4A 1YITN 2ATQA 4TSXA 3OW2M 1RBUA 3L0QA 1NLVA 4BVPA 4H0PA 3VQ9A 2P5OA 4E7KA 4BRPA 4CESA 2YX6A 5A2QO 1L3TA 2YHXA 2UUAK 1NGGA 4FJ9A 3C65A 4H0XB 3DJCA 1BQNA 3CM5A 4DU3A 4HUEA 1TYQB 5LL6Z 3FZMA 4Q5VA 3VN5A 4B1WB 1VSDA 3HPHA 2HMPA 3EKSA 1DLOA 1W97L 4A2AA 3LALA 4DMNA 3LAKA 3AAQA 5TKYA 4LSLA 4CHPA 4E1MA 3VF6A 5E41A 4CBWA 1GLEG 1T6DA 3D2FB 1EWRA 4B9SA 3R8EA 2VG7A 2GBZA 3ZX3A 4BRQA 4J2BA 4CIGA 3HL8A 4CEQA 4JI6K 3DXMA 4FM1A 1HRHA 4WQ5A 2P9LA 1J5OA 1XI1A 3VQ4A 2HW3A 3U8XA 4JD2B 3SPZA 3DOLA 4PKHA 4B1XB 4AF1A 3L4IA 1BDGA 5ELZA 3S3OA 4H5WA 5TKWA 1T03A 2QW9A 4N76A 1FXXA 4K41A 1XMOK 3SV3A 3E9PA 4E0DA 3MEDA 1O13A 3SZ2A 3BF3A 4W5RA 2A1SA 4DV0K 2QWMA 3NF7A 4CCHA 4B9NA 2E2QA 3VQPA 3QIPA 3I33A 4CF1A 3OY9A 3QICA 2VQFK 3OBWA 4AM6A 1YHQN 1C1AA 3THYB 3OYIA 3L2VA 4Z4CA 4BR0A 1RTIA 1NJWA 2OPSA 3V9WA 2VYPA 4LY7A 3TAPA 3CPWM 1BA0A 3ZETB 4BY9C 4JK9A 1WSEA 3ZT2A 3OYMA 3CIPA 1BWFO 1TKDA 1VK0A 3HVRA 2YNHA 1KC8O 1WUAA 5AQTA 3M8SA 4BRAA 4EIAA 3O4QA 3WNHA 4K42A 1EO1A 1TKTA 2HHXA 2DTUA 3QEWA 4IZ9A 4JI0K 1G15A 4IBNA 4CF0A 1KLMA 1U2VA 3ZSVA 1KRPA 3HP9A 4KI6A 4KHUA 4KB0A 2QWNA 4CK2A 2HB5A 3VQQA 4W5QA 1N8RO 1XQSC 4QS8A 5CE3A 4IEEA 3L2WA 4B9VA 2VWBA 1SZ2A 5KQDA 3CC4N 2P9NA 3K57A 4E7HA 2HHVA 3L3UA 2A3ZA 1OH5A 4FL9A 3WXMB 1C1BA 2PZSA 3SUOA 2O8DB 4B9QA 4HCCA 3RVCA 3G71N 4JAXA 3BP8A 4CGJA 4I2PA 4CK3A 5KQ8A 4FJJA 1I94K 2CGKA 4B3MK 1C1CA 3ASMA 2IOCA 4FM2A 4CJ3A 1IG8A 1QQOA 5AZJB 1BU6O 3TTDA 4CEFA 1RILA 4CJVA 3HOSA 4HVJA 1NOZA 4BR7A 4GMJB 3MEEA 1X3MA 3TAQA 4I7FA 3V1OA 2YHBA 4NCAA 4W5OA 5J2QA 1ATNA 3JYTA 5D3GA 4DSIA 5HBMA 2FSJA 1ASWA 3VEYA 1HX1A 2DFFA 4ISGA 4BGAA 3PSFA 3SCXA 1WLJA 5C2DA 4LF4K 1GLJO 3MN6A 2HNZA 1I39A 1SL0A 3CC7N 2ZJRL 3ENHA 4CF9A 2E4LA 2IS3A 3A5MC 3C95A 4RW9A 4CHOA 3PV8A 2A1RA 3NGZA 3CFRA 4DTUA 1WSIA 1TK5A 5AQMA 3FZHA 3VQBA 3CJBA 5B8HA 4NYNA 4BC4A 1HNVA 4CGIA 1WN7A 3A8YA 3DRPA 3K59A 4KB1A 2HHQA 1TUYA 3CJCA 4CHYA 3DLKA 1YTUA 3M6GA 4DV3K 3CMAN 4M3WA 2W41A 4KV8A 4H8KA 3SLCA 3HI0A 3PUFA 4PA1A 3LPTA 4A5AA 3LDLA 4CZHA 1EETA 3KHYA 4I9LA 2I5JA 4W5TA 4JI3K 3WNEA 3SQ2A 1Y64A 3ALYA 1S1UA 4RWTA 1JCFA 1OVYA 3C7NB 3BF1A 5AQVA 1TL1A 3B8AX 3SBTA 5BR9A 3UE5A 4FLZA 5CY4A 4BC2A 4X62K 4FWMA 4FJGA 1SUQA 1NK8A 4BE2A 4F3OA 1VSEA 3L2UA 3QINA 4CVNE 2O8EB 4DQSA 1BQMA 3F9MA 3H1QA 4IEIA 4JKHA 2ITMA 2CH6A 4DR3K 4N5SA 2R7YA 4DF8A 5JVHL 3TSQA 4Z94A 3HXMA 2EX3A 3OBYA 2XY5A 1VQMN 4DTPA 1GLAG 1K6YA 3U3YA 4H5TA 4ID1A 3SQ4A 4KFBA 1ITGA 3P31A 2ZM6K 3THVA 1NNEA 4PKGA 3HBTA 4N47A 2RE2A 1VAZA 5ADXH 1X3NA 1NK9A 4M7XA 1S3XA 4AHRA 4B9LA 3NFAA 4JI4K 3QO9A 1SAZA 3OYGA 5JS1A 4FJKA 2G8KA 4DTJA 3IFRA 4FVUA 4C8MA 1G99A 2RHKA 2YKMA 3I56N 4FOEA 1RT1A 3RMDA 2HMIA 2OZMA 4LF7K 1UA0A 1UOCA 1K73O 3CJAA 3TANA 3PO4A 4DV2K 1IKVA 1GLLO 5BN8A 1HNIA 5M1PA 3M5RA 4BRDA 3T1AA 2FBVA 1BI4B 1KAXA 3CG7A 4MDAA 5KPZA 4CJ5A 4AILC 4C1NI 5AQJA 3SAHA 1QZ5A 4YOXA 1RBTA 1HLUA 4CK1A 1JLEA 1LAVA 3VQAA 3EO3A 3QESA 1C0GA 4EHUA 4CJQA 4B1UB 1RBSA 3A0IX 3AVMA 4FJMA 4OJRA 2OTJN 5LY3A 3EY1A 2BANA 4CJ7A 3W3DA 2HOEA 1D8YA 4J2EA 3CM6A 4DTRA 2GWJA 3FGUA 4X66K 2YI1A 2JWLA 3JS6A 4YY3K 3EYZA 3LL3A 3SUNA 4EFHA 1U48A 2HF3A 1MDUB 3ZEUA 1YVUA 2EWSA 4O5BA 1ZBUA 3H45C 4KHSA 3QIOA 2PYJA 4KTQA 1FJGK 5BREA 3P1GA 1B9DA 4B9MA 4WQ5C 3IMXA 4DV6K 4FLXA 4DFMA 4I9QA 1ZBSA 5AQFA 3A2FA 3SYZA 3THWB 4RTFD 2ETJA 2RN2A 3LM2A 5AQGA 3DRSA 4CF8A 1L3VA 5C42A 3TAGA 4DUYK 4KTWA 3S9HA 3AA3A 4BRLA 2V7YA 4CJUA 3F5TA 3LANA 4X64K 1RCHA 3SPYA 1L3UA 5KI6A 1KSPA 2HBMA 2YNFA 3H6EA 1BIZA 1JL2A 1KAYA 1VSHA 4MO5A 3T19A 3TABA 4IOXA 3FZKA 4K0KK 3EE8A 4FWRA 3CCSN 4AHUA 3HPGA 5M1NA 3JXUA 4EZ9A 2IVOA 3W0LA 1W2BM 3RMBA 4JHDB 2NRZA 4HHTA 1VHXA 3IKMA 4XH5A 3PX6A 5C24A 3NHGA 4HTUA 3HM9A 5EY4A 5FPNA 2HHWA 1OVQA 3OYJA 5AZIB 3CYMA 3MWTA 2HBKA 2BUPA 1GOCA 1DTQA 5AFUA 3MCAB 1RTDA 1CXQA 1N6QA 1KQSM 3B6PA 3E1YA 4MDBA 1K8KB 1DEJA 2Z1HA 3CJ1A 4RW4A 5HLFA 3PLAA 3ZX0A 1LW2A 2O4IA 4DSJA 2B6AA 3B6OA 5LJWA 1M1KO 3KLFA 3AVKA 4EHTA 4MLHA 2ZGZA 4PKIA 4OLAA 3D7EO 4DSLA 2P9PB 2KKZA 3SQ0A 3AO4A 4N41A 2LSNA 5KRTA 3AVIA 3AARA 3K5OA 2AJQA 3QLHA 4FJ5A 4AM7A 4IWVA 4BRMA 3LDOA 3I8DA 2BGGA 3SQ1A 4BDYA 4XH1A 3MMVA 3G25A 3O9TA 1NMDA 2KW4A 3VQDA 3L4QA 4H4MA 5AQRA 3V9ZA 1NKBA 3T69A 4R79A 1NU0A 3D2EA 3VEZA 2FBTA 3O3FA 2F7TA 4JKGB 3VA0A 4FW1A 2RPIA 3GL1A 3QEPA 3WNGA 1RDAA 3WEEB 5DM6L 2D4WA 4OVLA 5GAEP 5IT9O 2WBNA 5KGXA 4B08A 4CD1A 3EEQA 1WOQA 3U4LA 1FW6A 4FJIA 2OZSA 4QOZB 4OPAA 5F2RA 4IDKA 1NGEA 2QA4N 2E5LK 4FLWA 2FBXA 3ULEB 4RG8A 3P39A 2FBYA 3AGKA 4FO0A 5GAHP 4E89A 4CZKA 1XNQK 2BDPA 1SL1A 3I0RA 1D5AA 3C94A 3D45A 1IO2A 2CH5A 3LP1A 3C6HA 3ID6A 5J2MA 1K9MO 2F8SA 3QMLA 1VQON 5AQQA 3R6MA 1QS4A 3V9SA 3CQ8A 1ATSA 3ZT0A 3PX4A 3ULDA 4FLVA 4WF9L 3O3HA 3N4QA 2O8CA 2KZMA 1YTAA 1KTQA 3H46O 2E2PA 3OYAA 4IG3A 4FJNA 4CHZA 4IFEA 3F9KA 4NYFA 5GIOA 2ASMA 1WSFA 3SMSA 2KTQA 4ILGB 5MLCQ 3U6FA 4KH5A 1T05A 5C2FA 3SBGA 5FRNA 3NF9A 4NLBA 2WONA 3N4PA 3QBXA 4YOVA 4B8CA 4AQYK 3KD1E 3NCIA 4CI6A 2PY5A 3A5OC 3DLLL 3MDQA 3J8AA 4LFCK 1QQNA 3F73A 3LPUA 1HKBA 1QSLA 3VF4A 1HNZK 1JLBA 2ZQBA 4FWLA 1S9GA 3UKRA 1VRUA 4XIUA 4BWJA 5HOOA 5C0YA 4R5PA 3NH1A 4OGCA 3J7AP 5AQZA 2HBJA 3V9XA 1BO5O 1RNHA 1QVGM 1HMVA 1T3VA 2GUIA 5AR0A 5KPRA 1ILYA 2VGMA 2QTDA 2A42A 1XMQK 3CPEA 2NZTA 3TR8A 2KHOA 4FJXA 3CJ7A 4A5BA 1Q9XA 1TGOA 2Q1NA 3THXB 1NJZA 4JKEA 2QEXN 4Y1DA 3OJSA 3O8MA 1ZBIA 3KTQA 4RW6A 3AGRA 4Z4FA 4Z4IA 2VWKA 4LF8K 4BQZA 4FZYA 1ZBLA 1S9EA 1VSLA 3H08A 4BDPA 5J1EA 3VQ8A 4E7IA 4O5FA 3SNNA 3FZLA 4JEPA 1U49A 5BRDA 3LAMA 1BIUA 3PIPL 2A40A 3DXKB 3HSTB 2P51A 3CF5L 2NRTA 2HVIA 3VA3A 4FWQA 3C6AA 3VMFB 3OYBA 4G9ZA 4KHWA 2QK9A 1SL2A 1YI2N 4DV1K 1VQ4N 2FXUA 3KK2A 5C15A 2V51B 2QXLA 2ZJPL 1NOYA 3DOKA 4Z4GA 4K43A 3EKUA 4JNEA 2BTFA 1BGXT 1VQ7N 3HT3A 3VGKA 4CJRA 3SAFA 1BL3A 1D9FA 3L8BA 1BG3A 3OJUA 4I6MA 3HYFA 2I7PA 5AQOA 3KLGA 1S1XA 3ZT1A 1ZC6A 3QEIA 4YDUA 5GINA 4DU4A 3E9OA 1JL1A 4JKCA 1FK9A 3H1VX 2B4JA 1S22A 3HSCA 2QWPA 4L8RB 4NXNK 3M8QA 3HP6A 4DR5K 4DB3A 4DR6K 4PY5A 1SKWA 4ISFA 3IS9A 3GBTA 2FF6A 3A5NC 3ID8A 1HJOA 1REVA 4WQ4C 4V19S 3HO1A 4BVOA 1UA1A 1TV6A 2FSKA 4BE0A 2YNIA 3KLHA 3BGRA 3QEXA 4BWMA 3ISNC 3GOIA 1T7PA 4CIFA 3ZCMA 4QCLA 1VQ8N 5BPMA 3OYEA 2P9UB 4B1ZA 1A5WA 1LOTB 5JICA 1N36K 2E6LA 3K9KA 3I55N 4ELTA 1Q82O 3QNNA 1RT2A 4AHTA 4DSFA 3DLRA 4CJLA 4BRNA 5LJVA 3ZT4A 3WQUA 4JK7A 2P9KA 1CXUA 1ASUA 3R9PA 1YXQA 3LDSA 1KFDA 1QZ6A 3O4NA 2KLAA 3NF8A 3LDQA 1QQMA 2O4GA 4ZHRA 3DRRA 5GAGP 4O44A 1YJ9N 4IG0A 3TTFA 1U45A 3CCMN 4FYDA 2P9IA 5HRNA 2KFZA 4CZEA 1NM1A 5CYQA 4F2RA 1VSFA 5AJ3K 1Q86O 3K58A 4DQRA 5E26A 4EP5A 3QFUA 3OS0A 4M3YA 4I2QA 4PL7A 3O08A 4FWNA 4KKOA 5AQSA 3AVCA 2QM1A 4DU1A 3MXMA 4B3OA 2IVPA 5CYMA 1GOAA 4CEEA 1VQ6N 1S1VA 4FZXC 4BG9A 4PWDA 4OO1J 4MO4A 1BUPA 1JLFA 4CJ4A 4DUZK 2NUBA 3LZJA 4GKKK 1BOTO 3C6TA 2F9WA 4JKFA 4JRPA 1NK6A 3RSEB 2E2OA 3UKUA 4J2DA 1RTHA 2PBDA 2W40A 4BR5A 1W7AA 2O8BB 2X78A 4DCHA 4MLEA 2VG6A 5EXWA 1L3SA 4LF9K 3VETA 1C0TA 4CJFA 5KPTA 1IKWA 1S1WA 3SMPA 1U6ZA 3S41A 3TSUA 1NGHA 2D0OA 3FFIA 2E8AA 4FJ8A 4PL8A 3AVFA 4G1QA 1EWQA 4CZMA 4JS5A 1QVFM 4DHYA 3VGLA 5SZTA 4OX9K 1RDWX 4CERA 4DS4A 3D2EB 4M3UA 4FWSA 3P83D 1ZBHA 3DAWA 4NCGA 3VEWA 3HOTA 1TYQA 3U9DA 3FFKB 2GUPA 3LDNA 3K2PA 3M1FA 3OS2A 3S3NA 1QSSA 1H1VA 1C0UA 4EAHD 3T1HK 4KHQA 1YVNA 3AO1A 4N56A 5EX5A 3WQTA 3H3OB 1IJJA 4UY8O 1FKOA 1KCFA 2YJEA 3NDKA 4KH4A 1U4BA 3AV9A 3G6EN 5JVGL 3SV4A 2P1JA 3D2FA 4K8ZA 2HHTA 4NXMK 5BR8K 1SKSA 3WT0A 4E7JA 1B92A 2GTDA 3WNFA 3L2QA 1UAXA 2P9SB 1J53A 3DLHA 4FM0A 4NB4A 3OYDA 3CMEN 2UYTA 4CJTA 2NRWA 4JD2A 1DT9A 4BC3A 4LFBK 2D1KA 5GADP 2PYLA 4GW6A 3DWLA 2Y1IA 2ITGA 4FPAA 1KVCA 3UB5A 1J5EK 3TAMA 3KWGA 4LSNA 1X9JA 3NBPA 4BQLA 4Q0BA 4WFNL 3RR7A 2BH1A 1VQ5N 1XHZA 5AQNA 4U7BA 3NE6A 4DTOA 4C1NK 4CHQA 3AVNA 4CIEA 1HKCA 2KQ2A 2FLOA 1XWLA 1OH7A 1QQCA 2PFUA 5FRMA 3P5JA 4KPYA 5CZ1A 5FPEA 4DFJA 4K25A 4WE1A 4WYBA 1VSMA 4NCBA 1JJ2M 3KK1A 4RCHA 3SAGA 3THYA 3HVTA 3KKRA 1JCGA 1VQNN 4HUGA 1MWKA 4FK0A 3AO2A 3ZETA 3CCRN 3LWMA 1HYSA 2DPNA 2G8FA 3UKRB 4CZGA 3QFPA 1XUPO 3QBWA 2Z1JA 2DY4A 4FLYA 3T1YK 4JI5K 3VQEA 3SI6A 3NVMA 4O8UA 3DMJA 4B9TA 3TPQA 3CI5A 3IAYA 4B3TK 5BPNA 4DTMA 5AQPA 3M8PA 4FK4A 1SS6A 2B5JA 4JI8K 2W42A 4C8NA 4ELUA 2IVNA 3C6UA 3DXMB 3CFOA 4FLUA 4DF4A 4DG1A 2Y1JA 2P9LB 4DQ8A 4CJSA 1RDCA 4CFCA 2O8DA 4Y0WA 1DTTA 1ZYQA 3D0PA 2ASPA 4KHYA 3H3NO 2NRRA 3LM9A 3O9UA 3O9RA 3OVNA 3DLEA 1YAGA 1N34K 2X6NA 3VENA 3EL2A 2WOMA 5AZJA 2FC0A 4DWIA 2UXDK 4U67L 1VQPN 1HKGA 4RW7A 4ZTJA 3TWHA 3RMAA 4BR9A 2ASOA 4DSEA 1D4XA 3ZSWA 2PAVA 1JXBA 2JGUA 2OPPA 1TK8A 1V4SA 3LWLA 5LMNK 3HJFA 1DGKN 1KLNA 4BGBA 3RWUA 2UUCK 4BDZA 3PIOL 4O55A 4H5NA 2OCEA 4FK2A 2CGJA 3VEXA 1HPMA 2GEMA 4A62A 3BEXA 1A5VA 1J6ZA 4DTNA 2BE2A 2OPRA 1NK7A 1NK5A 2OYQA 5M1QA 3PO5A 1LCUA 4CGGA 3MXIA 4JKDA 4W5NA 1JXEA 3AO5A 2HNYA 3CCQN 3O9QA 3NAEA 2E6MA 2UXBK 2GV9A 4B8AB 3G0ZA 1A5XA 2YNGA 1QSYA 3VQCA 3MK6A 1RBRA 1ASVA 4JI1K 4AHCA 4DLGA 2HNDA 3L2RA 1TAUA 2F96A 5CZ2A 2IDOA 5JS2A 4CJWA 4IO8A 3EN9A 4M7YA 2UXCK 3Q7BA 5FPDA 2VCPA 2E1YA 1U2VB 2QWQA 1NGIA 4CF2A 2OA8A 1NWKA 3C7NA 4IJAA 3MX5A 5AQUA 4OPJA 1RT3A 3ZSOA 2GX9A 4BRGA 4A57A 4ICLA 1LV5A 2P9NB 2F4VK 3FLCO 4ILHA 1NGAA 2W6LA 3V4IA 4YHHK 2V7ZA 2O8EA 3M3ZA 2EHGA 3JAMO 3FZFA 1LAWA 2E88A 4BRKA 3P38A 5HRRA 1C0MA 1FKPA 3IG1A 3AVGA 1Z25A 2F9TA 3NMUA 3TI0A 3ZYYX 5BRFA 4IKFA 4ELVA 2RKIA 4DS5A 3VF2A 4CEAA 4IDHA 2D0AA 4H4OA 4OPHA 4LFAK 3GDQA 2DFEA 4CZFA 4CGHA 3CD6N 1XC3A 5C10A 4C8LA 3K9JA 4J8FA 2D0CA 1Q81O 3U9ZA 2YV0X 1NGBA 3O1BA 3TSPA 3QB0A 3MAQA 2WC9A 4PHTX 1RT5A 3F2KA 4CFAA 5SWMA 1EP4A 1GLBG 2QKKA 3KJVA 5F0XA 1EKEA 5AQYA 1NGCA 2QKBA 3ENBA 3KK7A 2O8FA 2ZF5O 2VGNA 4YOTA 3VPZA 4OKEA 1OH6A 1KVBA 3T7ZA 4A2BA 3TU5A 3MN9A 3E9LA 3WXIA 4JKBA 4BREA 3HTVA 1HNWK 4B3SK 3TTCA 4CD3A 3MXJA 1HPZA 2J4RA 4O0IA 4BRHA 3P4IA 1IKXA 5AFUH 4DKWA 1D9DA 4CJKA 5DMRA 3O3GA 2HHUA 2QWLA 1HNXK 4Y1CA 2X6SA 4DQPA 3OHRA 2Q0RA 5AQXA 3NH0A 4AH9A 3VQ5A 4H5RA 3ZSXA 3NF6A 2XY7A 1NK0A 4UQGA 2XO7A 4JYAK 2QWRA 3CERA 1TL3A 4FSVA 4QAGA 3ENOA 4DV4K 3J80O 2X74A 2QWOA 1Q9YA 1RDUA 5J2NA 3NVKA 4H0YB 1C6VA 4M41A 4M45A 1ZBFA 4XEIA 2A5XA 5HP1A 4M3XA 5DM7L 4CGFA 1WNSA 1GLDG 1Q8IA 2G8VA 3THWA 2YCHA 4O0JA 1KD1O 3O4WA 1K8AO 3ATUA 4CECA 3KWIA 3O80A 3CQYA 3J7ZO 1Y97A 3OS1A 2OANA 3R1XA 1JLQA 4DR2K 3EE9A 4Z4EA 1RTJA 3DI6A 5FDLA 4A59A 1J9AA 4YORA 1NJYA 2ZD1A 4E1NA 3OYLA 1I3AA 2CGLA 5GIPA 1WBBA 4BRCA 4JV5K 1SQKA 1Q7YO 3NGIA 3GE1A 3K5NA 4JHDA 5FLXO 1NKEA 3FR0A 4XH4A 2QI2A 4GVEA 4HCBA 5AQIA 5AZIA 4CGDA 4CEOA 1QHTA 4CFBA 3TAFA 2D0PA 3QDKA 2NRVA 3K0SA 2ZGYA 3QNOA 1Z6RA 4BACA 1IBMK 4JLHA 1K8KA 1GLCG 2UUBK 2FSNA 1MWMA 1VQKN 4KI4A 1YT3A 1IV0A 4PUOA 1RT4A 4KO0A 1XC9A 3IRXA 3SJJA 2ZJQL 3WXJA 3LP3A 4M3ZA 1P8ZA 3J81O 1X9WA 2P9PA 1E3MA 2XY6A 4CHNA 1WBDA 4M42A 1XNRK 2V52B 4L3QA 4IXCA 1JKHA 3ZEUB 4H0TB 5HROA 4DFPA 4HUFA 3HK2A 4BROA 3HPOA 3NH2A 4CEBA 1X9MA 3QETA 1S1TA 1YUWA 1C0FA 1W9HA 5JMVA 3RTVA 1JLGA 4H5VA 3Q7CA 5M1OA 5AQLA 1RT7A 4NO7A 5E84A 3ZSYA 3AVHA 3CCJN 3BZKA 5ADXA 1HYZA 2IC3A 4JKGA 2HF4A 4O4GA 3OYFA 4GV6A 3KD5E 2Z1IA 1BCOA 3UIQA 3E01A 2VG5A 3KLIA 4ISEA 1N32K 3WEEA 4DQQA 2AP1A 1JLCA 5CHIA 2GWKA 3VOVA 3ZX2A 1ESVA 4GKJK 3DYAA 2D0BA 4KH6A 1KFSA 3O6WA 3TARA 4F4KA 1VQ9N 1V4TA 1NBWA 3ULEA 3RRGA 1S5JA 1E4FT 4KREA 2UU9K 4A61A 2P5GA 4DV5K 3LDPA 3GG4A 3AVAA 1NK4A 3AA5X 1EX4A 1GOBA 1N5YA 3DLGA 3M8RA 4CW7B 1IBKK 3OYHA 4FZZA 4KBOA 4DR7K 3LZIA 4IO9L 3BDPA 5EU7A 4C23A 4K8XA 3WUHA 1NGDA 4JRQA 1RFQA 1HQEA 1KXPA 1NJXA 1OH8A 3HRGA 4FJHA 2OPQA 5K14A 4YNQA 1NG9A 4J2AA 1R0AA 4H0VB 1U47A 1MA9B 4CJEA 3K5LA 3O5BA 4MFBA 1BHLA 3L3VA 3ATVA 4M63C 2G8IA 1BISA 4GVMA 3OYCA 2G8WA 5T7BA 3MECA 3V81A 1ATRA 1B9FA 1T6CA 3AAPA 2DFHA 3VQ7A 1T8EA 2Q36A 4QS9A 3MWPA 2YKNA 3ZSRA 2Q3SA 5I42A 3D6RA 2W6KA 3VTHA 3WXKA 2OTLN 3CFPA 1WSHA 1YJNN 2HHSA 3ZSZA 1NJIO 2Z1GA 4OLBA 2H3GX 1F21A 1NKCA 4GY2B 4BC5A 3RMCA 4FW2A 4DR4K 4KAZA 1R59O 3KIOA 5KTQA 2VQEK 4YOUA 3CQXA 4DTXA 4Z4HA 2NRHA 2Q31A 4DR1K 3K5MA 5LMUK 4JK8A 3RR8A 3AVLA 3THXA 3ZLJA 3G10A 2JWKA 4CEZA 4IOAL 1X9SA 3OYNA 5BPLA 1U04A 1RDDA 1IH7A 5FROA 2XRIA 3G4SN 1NGJA 1RT6A 4AHVA 4ID5A 4LF5K 1HYVA 1CZBA 1N33K 1RDBA 3MN7A 1W0HA 4IFVA 3I8BA 4E3SA 2F8TA 3E66A 3AVJA 5DK5A 4BR4A 3A5LC 2NLXA 3CCVN 2O8CB 3KK3A 3DXKA 4FWPA 4GV3A 3V9UA 2O8FB 4B9UA 1T44A 4B1VA 2YJFA
chains in the Genus database with same CATH topology
3MEEA 4MQ3A 1HJRA 4I7FA 4YFUA 3TAQA 3V1OA 1Q9XA 1TGOA 2YHBA 4NCAA 4W5OA 5J2QA 3JYTA 5D3GA 1NJZA 4CF2A 2OA8A 4DSIA 4Y1DA 5HBMA 3OJSA 1ZBIA 1ASWA 2DFFA 3KTQA 1TKZA 3SCXA 1WLJA 1QE1A 1RT3A 4OPJA 2HNZA 3ZSOA 1S6QA 1I39A 4RW6A 4ICLA 1SL0A 1LV5A 4Z4FA 4Z4IA 2VWKA 2E4LA 4CF9A 3V4IA 2IS3A 3C95A 1TKXA 4RW9A 4FZYA 1ZBLA 4CHOA 3PV8A 1S9EA 1VSLA 2A1RA 3H08A 3NGZA 4BDPA 2EHGA 5J1EA 3CFRA 1LAWA 3V1RA 3VQ8A 4E7IA 1SV5A 4DTUA 2G8HA 1WSIA 3EZ5A 1TK5A 2IAJA 4LH5A 1C0MA 1FKPA 5HRRA 3VQBA 5HRPA 3SNNA 1U49A 3IG1A 3LAMA 4NYNA 1BIUA 4CGIA 1HNVA 1Z25A 3AVGA 5I3UA 3SUPA 1WN7A 3HSTB 4OKJA 2P51A 3TI0A 4F2SA 3DRPA 3K59A 4KB1A 2HVIA 2HHQA 2ZE2A 4CHYA 3VA3A 3DLKA 4KHNA 4FJJA 1YTUA 3VQ6A 4M3WA 4KV8A 3OYBA 4IKFA 4H8KA 3PUFA 4ELVA 4PA1A 4KHWA 4BE1A 2QK9A 1SL2A 2RKIA 3LPTA 4DS5A 2HVHA 4CJPA 4F8RA 1EETA 3KK2A 4CEAA 4I9LA 2I5JA 1NOYA 4W5TA 3DOKA 2D0AA 4H4OA 4Z4GA 2DFEA 3WNEA 4CGHA 3SQ2A 1BGXT 4C8LA 3ALYA 1S1UA 5KGWA 3HT3A 4CJRA 2IGIA 1BL3A 1D9FA 3L8BA 3S3MA 3OJUA 1Z26A 2D0CA 1VRTA 1TL1A 3AO3A 3HYFA 2KFNA 2YV0X 4FLZA 5CY4A 3DLBA 4FJGA 3KLGA 1SUQA 1S1XA 3MAQA 1NK8A 4EZ6A 4BE2A 3ITHA 3ZT1A 3KKSA 4F3OA 1RT5A 1VSEA 4CFAA 5KRSA 5SWMA 1EP4A 3L2UA 3QINA 1LWCA 3QEIA 2G8UA 4DQSA 1BQMA 4E19A 4DU4A 1JL1A 3PY8A 4ZTFA 3KJVA 2YHAA 2QKKA 1FK9A 2XY8A 4CFDA 1QTMA 3PX0A 1EKEA 2B4JA 2QKBA 4M3TA 4N5SA 4L8RB 2R7YA 4OKEA 4DF8A 1KVBA 3M8QA 3HP6A 3HXMA 3AVBA 4PY5A 2EX3A 2XY5A 1SKWA 4DTPA 1K6YA 3U3YA 4Z0UA 4ID1A 3OYKA 3SQ4A 3IS9A 4KFBA 1ITGA 4DLEA 3MXJA 1REVA 3THVA 3HO1A 2D5RA 4CEDA 1JLAA 2RF2A 4PQUA 1HPZA 1UA1A 4C8KA 4EP4A 1TV6A 4BE0A 1IKYA 4O0IA 4N47A 3AA4A 1IG9A 4M3RA 2YNIA 1IKXA 3KLHA 4E7LA 1D9DA 1WAFA 3KLEA 4CJKA 2QXFA 4DFKA 3BGRA 1BCMA 4BWMA 3ISNC 5C25A 4DTSA 3QEXA 1NK9A 1T7PA 3LP2A 4CIFA 5DMRA 3ZCMA 4AHRA 3O3GA 4B9LA 4QCLA 3NFAA 1VSKA 3QO9A 1S6PA 2HHUA 4FCYA 4Y1CA 2X6SA 3OYGA 4DQPA 4FJKA 5JS1A 2G8KA 4DTJA 3OYEA 3NH0A 4AH9A 1A5WA 4C8MA 3VQ5A 3ZSXA 2E6LA 2YKMA 5J2PA 4ELTA 4KRFA 3NF6A 3QNNA 2XY7A 2BGGA 1NK0A 1RBVA 1RT1A 1RT2A 4AHTA 4UQGA 2XO7A 3RMDA 1UWBA 4DSFA 2HMIA 2OZMA 1EXQA 1X1PA 3DLRA 1TL3A 4CJLA 3ZT4A 1UA0A 5HRSA 1UOCA 4QAGA 3TANA 3PO4A 1IKVA 3I0SA 1HNIA 2X74A 1CXUA 1ASUA 3LDSA 1KFDA 3T1AA 2FBVA 1BI4B 4KTZA 3O4NA 3RRHA 3CG7A 1Q9YA 3NF8A 5J2NA 2O4GA 1C6VA 4CJ5A 4ZHRA 4AILC 4M41A 4M45A 3DRRA 4O44A 1ZBFA 4IG0A 4FJLA 2KZZA 1XHXA 5HP1A 4M3XA 1U45A 4FYDA 2KFZA 5HRNA 1KVAA 5CYQA 1RBTA 3V1QA 4CGFA 4F2RA 1VSFA 3K58A 1CZ9A 1WNSA 1Q8IA 4EP5A 4CK1A 3OS0A 4DQRA 1JLEA 2G8VA 1LAVA 4M3YA 3VQAA 1TVRA 4I2QA 4O0JA 3QESA 4KKOA 3AVCA 1O1WA 4CJQA 1RBSA 3AVMA 4CECA 4OPKA 1CLQA 4DU1A 3MXMA 4B3OA 4FJMA 4CE9A 5CYMA 4OJRA 1LWEA 1GOAA 3U3GA 4CEEA 1Y97A 3OS1A 3EY1A 1S1VA 2BANA 4FZXC 3ZSQA 4PWDA 1JLQA 1WAJA 1D8YA 4J2EA 1JLFA 3CM6A 4Z4EA 1RTJA 1J54A 3DI6A 5FDLA 2NUBA 4OGEA 1J9AA 4CJ4A 4DTRA 1NJYA 4F3TA 3LZJA 3QERA 2ZD1A 4E1NA 4FVMA 3V6DA 3C6TA 4FXDA 3DM2A 4FJ7A 4JRPA 1NK6A 3OYLA 1I3AA 3EYZA 4RW8A 4AHSA 2VWJA 3SUNA 1TAQA 1U48A 1RTHA 4J2DA 2X78A 1YVUA 3NGIA 3K5NA 1LW0A 2VG6A 1L3SA 4O5BA 1ZBUA 1NKEA 1C0TA 4KHSA 3QIOA 4CJFA 1TK0A 3JSMA 2PYJA 1IKWA 4FLTA 1S1WA 2JLEA 3SUQA 1HQUA 4HCBA 4KTQA 4CGDA 4CEOA 1QHTA 4CFBA 3P1GA 1B9DA 4B9MA 3TAFA 3FFIA 4FJ8A 3AVFA 4G1QA 4FLXA 4DFMA 4I9QA 3A2FA 1WSGA 3SYZA 1WSJA 2ETJA 2RN2A 3ZT3A 4CF8A 3DRSA 4BACA 3QNOA 1SKRA 1L3VA 4JLHA 5C42A 4OKKA 4JS5A 3TAGA 1L5UA 4KTWA 3S9HA 2XHBA 4KI4A 1YT3A 3AA3A 4DQIA 5SZTA 4PUOA 1RT4A 4CERA 4KO0A 4DS4A 4CJUA 1XC9A 3TAEA 3IRXA 3SJJA 4LD0A 3P83D 4M3UA 3LANA 1VSJA 4KI6A 1ZBHA 4LH4A 1RCHA 4NCGA 3SPYA 1L3UA 5KI6A 1KSPA 3K2PA 2YNFA 1LWFA 3LP3A 3OS2A 1BIZA 1JL2A 1BI4A 4M3ZA 1VSHA 3T19A 3TABA 3S3NA 1X9WA 1QSSA 1VSIA 2XY6A 1C0UA 4AHUA 4CHNA 4KHQA 3AO1A 4N56A 4M42A 3HPGA 4KHUA 4EZ9A 1JKHA 1MU2A 3T3FA 5HROA 3QEVA 1FKOA 1KCFA 4DFPA 3RMBA 3NDKA 4HUFA 3HK2A 3HPOA 4IFYA 3AV9A 4HHTA 3NH2A 1U4BA 3MEGA 4CEBA 3PX6A 5C24A 3NHGA 1S1TA 3SV4A 3QETA 4HTUA 1X9MA 2P1JA 3LP0A 3HM9A 4C8OA 4DSKA 1W9HA 3NGYA 3AA2A 4JS4A 4K8ZA 2HHWA 3OYJA 2HHTA 2ATQA 4TSXA 3RTVA 1SKSA 1JLGA 3CYMA 4E7JA 1B92A 3WNFA 1RBUA 1RT7A 3VQ9A 1UAXA 3L2QA 1J53A 2P5OA 1GOCA 3ZSYA 1DTQA 3AVHA 4E7KA 3DLHA 4FM0A 1RTDA 3OYDA 1CXQA 1N6QA 4CJTA 4CESA 3B6PA 1HYZA 2IC3A 2Z1HA 5HLFA 4RW4A 4O4GA 3OYFA 1L3TA 3KD5E 2Z1IA 1BCOA 3UIQA 3E01A 2PYLA 4GW6A 2VG5A 4FJ9A 3KLIA 2Y1IA 2ITGA 1LW2A 2O4IA 1BQNA 3CM5A 4DU3A 4DSJA 1KVCA 2B6AA 3B6OA 4HUEA 4DQQA 1JLCA 3KLFA 4Q5VA 3AVKA 3TAMA 3VN5A 4OLAA 1VSDA 3HPHA 4DSLA 3SQ0A 4LSNA 3AO4A 3DYAA 4N41A 3NBPA 2D0BA 2LSNA 5KRTA 3AVIA 3TARA 1KFSA 4F4KA 4Q0BA 3K5OA 2AJQA 3QLHA 3RR7A 4FJ5A 1DLOA 1XHZA 3KD1E 3NE6A 4DTOA 3RRGA 4CHQA 3AVNA 4CIEA 2KQ2A 3I8DA 3LALA 4DMNA 1S5JA 3SQ1A 3LAKA 4CHPA 4BDYA 4LSLA 1XWLA 4E1MA 4KREA 1QQCA 2P5GA 5E41A 5FRMA 3P5JA 4KPYA 2KW4A 3VQDA 5CZ1A 3AVAA 4B9SA 4H4MA 3V9ZA 2VG7A 2GBZA 4DFJA 3AA5X 1NK4A 4J2BA 1EX4A 1NKBA 4WE1A 1VSMA 4NCBA 1GOBA 4CIGA 3HL8A 4CEQA 4FM1A 1N5YA 3KK1A 3DLGA 1HRHA 2FBTA 3HVTA 3KKRA 3OYHA 3M8RA 3O3FA 1J5OA 4FZZA 1XI1A 3VQ4A 2HW3A 3LZIA 4HUGA 3BDPA 3VA0A 3SPZA 3DOLA 5EU7A 4K8XA 4FW1A 2RPIA 3QEPA 4FK0A 3AO2A 3WNGA 3LWMA 1HYSA 1RDAA 4JRQA 3S3OA 1T03A 1HQEA 4OVLA 2G8FA 4N76A 1FXXA 5KGXA 2Z1JA 4B08A 2DY4A 3SV3A 4FLYA 4E0DA 3MEDA 1NJXA 4FJHA 3VQEA 2OPQA 3SI6A 4FJIA 2OZSA 4QOZB 3DMJA 3SZ2A 4B9TA 4IDKA 5K14A 4YNQA 4FLWA 2FBXA 2A1SA 4W5RA 4RG8A 3IAYA 3NF7A 4J2AA 4DTMA 4CCHA 4B9NA 2FBYA 1R0AA 1U47A 4CJEA 3K5LA 3VQPA 4E89A 3QIPA 1BHLA 3M8PA 4MFBA 4FK4A 3L3VA 4CF1A 2BDPA 2B5JA 3OY9A 1SL1A 3I0RA 2W42A 4C8NA 1D5AA 2G8IA 3C94A 4ELUA 1BISA 4GVMA 3C6UA 3D45A 5T7BA 3OYCA 1IO2A 2G8WA 3LP1A 3MECA 3CFOA 3V81A 5J2MA 4FLUA 1B9FA 4DF4A 1C1AA 1T8EA 2DFHA 3VQ7A 4DG1A 2F8SA 3OYIA 2Y1JA 3L2VA 1QS4A 4Z4CA 2YKNA 3ZSRA 4CJSA 1RDCA 4CFCA 1NJWA 1RTIA 2Q3SA 2OPSA 1DTTA 3V9WA 3D0PA 5I42A 3V9SA 3CQ8A 1ZYQA 4LY7A 4KHYA 3TAPA 3ZT0A 3PX4A 3ULDA 4FLVA 3OVNA 3DLEA 3O3HA 3CFPA 1WSEA 1WSHA 3ZT2A 3OYMA 2HHSA 2KZMA 1YTAA 3ZSZA 1KTQA 2X6NA 3OYAA 1TKDA 1VK0A 4IG3A 2Z1GA 3HVRA 2WOMA 2YNHA 4FJNA 4OLBA 2FC0A 1F21A 4CHZA 1NKCA 4DWIA 3F9KA 4RW7A 3RMCA 4FW2A 3TWHA 4ZTJA 3RMAA 4KAZA 4NYFA 3KIOA 5KTQA 3M8SA 4DSEA 3ZSWA 3O4QA 3WNHA 1JXBA 2JGUA 2OPPA 1WSFA 4DTXA 3LWLA 4Z4HA 1TK8A 3HJFA 2KTQA 1TKTA 2HHXA 2DTUA 3QEWA 1KLNA 1G15A 3K5MA 3RWUA 3U6FA 4BDZA 4IBNA 4CF0A 1KLMA 3ZSVA 4O55A 1T05A 3AVLA 3HP9A 1KRPA 3RR8A 4CK2A 3G10A 2HB5A 4KB0A 4FK2A 3NF9A 4CEZA 3VQQA 5FRNA 1X9SA 2WONA 3OYNA 4W5QA 4B8CA 1U04A 1A5VA 4DTNA 1RDDA 2BE2A 2OPRA 1NK7A 3NCIA 3L2WA 1IH7A 1NK5A 2PY5A 2OYQA 3PO5A 5FROA 2XRIA 4B9VA 4CGGA 3MXIA 1RT6A 4AHVA 3K57A 4E7HA 4ID5A 2HHVA 3F73A 4W5NA 1JXEA 3AO5A 2HNYA 3L3UA 1HYVA 3LPUA 1QSLA 3NAEA 1JLBA 2E6MA 1CZBA 2GV9A 2ZQBA 4B8AB 1C1BA 1RDBA 3SUOA 2PZSA 1S9GA 3G0ZA 4HCCA 1A5XA 1W0HA 1VRUA 2YNGA 4IFVA 1QSYA 4E3SA 2F8TA 4XIUA 3AVJA 4BWJA 3VQCA 1RBRA 1ASVA 5DK5A 4AHCA 4CGJA 4I2PA 4CK3A 2HNDA 4OGCA 4R5PA 3NH1A 4DLGA 3L2RA 3KK3A 1C1CA 3V9XA 3ASMA 1RNHA 3V9UA 2IOCA 1TAUA 2F96A 5CZ2A 4FM2A 4CJ3A 1HMVA 2GUIA 2IDOA 5JS2A 4CJWA 4CEFA 4CJVA 1RILA 4B9UA 4HVJA 1NOZA 3TR8A 4GMJB 4FJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEE A;  4MQ3 A;  1HJR A;  4I7F A;  4YFU A;  3TAQ A;  3V1O A;  1Q9X A;  1TGO A;  2YHB A;  4NCA A;  4W5O A;  5J2Q A;  3JYT A;  5D3G A;  1NJZ A;  4CF2 A;  2OA8 A;  4DSI A;  4Y1D A;  5HBM A;  3OJS A;  1ZBI A;  1ASW A;  2DFF A;  3KTQ A;  1TKZ A;  3SCX A;  1WLJ A;  1QE1 A;  1RT3 A;  4OPJ A;  2HNZ A;  3ZSO A;  1S6Q A;  1I39 A;  4RW6 A;  4ICL A;  1SL0 A;  1LV5 A;  4Z4F A;  4Z4I A;  2VWK A;  2E4L A;  4CF9 A;  3V4I A;  2IS3 A;  3C95 A;  1TKX A;  4RW9 A;  4FZY A;  1ZBL A;  4CHO A;  3PV8 A;  1S9E A;  1VSL A;  2A1R A;  3H08 A;  3NGZ A;  4BDP A;  2EHG A;  5J1E A;  3CFR A;  1LAW A;  3V1R A;  3VQ8 A;  4E7I A;  1SV5 A;  4DTU A;  2G8H A;  1WSI A;  3EZ5 A;  1TK5 A;  2IAJ A;  4LH5 A;  1C0M A;  1FKP A;  5HRR A;  3VQB A;  5HRP A;  3SNN A;  1U49 A;  3IG1 A;  3LAM A;  4NYN A;  1BIU A;  4CGI A;  1HNV A;  1Z25 A;  3AVG A;  5I3U A;  3SUP A;  1WN7 A;  3HST B;  4OKJ A;  2P51 A;  3TI0 A;  4F2S A;  3DRP A;  3K59 A;  4KB1 A;  2HVI A;  2HHQ A;  2ZE2 A;  4CHY A;  3VA3 A;  3DLK A;  4KHN A;  4FJJ A;  1YTU A;  3VQ6 A;  4M3W A;  4KV8 A;  3OYB A;  4IKF A;  4H8K A;  3PUF A;  4ELV A;  4PA1 A;  4KHW A;  4BE1 A;  2QK9 A;  1SL2 A;  2RKI A;  3LPT A;  4DS5 A;  2HVH A;  4CJP A;  4F8R A;  1EET A;  3KK2 A;  4CEA A;  4I9L A;  2I5J A;  1NOY A;  4W5T A;  3DOK A;  2D0A A;  4H4O A;  4Z4G A;  2DFE A;  3WNE A;  4CGH A;  3SQ2 A;  1BGX T;  4C8L A;  3ALY A;  1S1U A;  5KGW A;  3HT3 A;  4CJR A;  2IGI A;  1BL3 A;  1D9F A;  3L8B A;  3S3M A;  3OJU A;  1Z26 A;  2D0C A;  1VRT A;  1TL1 A;  3AO3 A;  3HYF A;  2KFN A;  2YV0 X;  4FLZ A;  5CY4 A;  3DLB A;  4FJG A;  3KLG A;  1SUQ A;  1S1X A;  3MAQ A;  1NK8 A;  4EZ6 A;  4BE2 A;  3ITH A;  3ZT1 A;  3KKS A;  4F3O A;  1RT5 A;  1VSE A;  4CFA A;  5KRS A;  5SWM A;  1EP4 A;  3L2U A;  3QIN A;  1LWC A;  3QEI A;  2G8U A;  4DQS A;  1BQM A;  4E19 A;  4DU4 A;  1JL1 A;  3PY8 A;  4ZTF A;  3KJV A;  2YHA A;  2QKK A;  1FK9 A;  2XY8 A;  4CFD A;  1QTM A;  3PX0 A;  1EKE A;  2B4J A;  2QKB A;  4M3T A;  4N5S A;  4L8R B;  2R7Y A;  4OKE A;  4DF8 A;  1KVB A;  3M8Q A;  3HP6 A;  3HXM A;  3AVB A;  4PY5 A;  2EX3 A;  2XY5 A;  1SKW A;  4DTP A;  1K6Y A;  3U3Y A;  4Z0U A;  4ID1 A;  3OYK A;  3SQ4 A;  3IS9 A;  4KFB A;  1ITG A;  4DLE A;  3MXJ A;  1REV A;  3THV A;  3HO1 A;  2D5R A;  4CED A;  1JLA A;  2RF2 A;  4PQU A;  1HPZ A;  1UA1 A;  4C8K A;  4EP4 A;  1TV6 A;  4BE0 A;  1IKY A;  4O0I A;  4N47 A;  3AA4 A;  1IG9 A;  4M3R A;  2YNI A;  1IKX A;  3KLH A;  4E7L A;  1D9D A;  1WAF A;  3KLE A;  4CJK A;  2QXF A;  4DFK A;  3BGR A;  1BCM A;  4BWM A;  3ISN C;  5C25 A;  4DTS A;  3QEX A;  1NK9 A;  1T7P A;  3LP2 A;  4CIF A;  5DMR A;  3ZCM A;  4AHR A;  3O3G A;  4B9L A;  4QCL A;  3NFA A;  1VSK A;  3QO9 A;  1S6P A;  2HHU A;  4FCY A;  4Y1C A;  2X6S A;  3OYG A;  4DQP A;  4FJK A;  5JS1 A;  2G8K A;  4DTJ A;  3OYE A;  3NH0 A;  4AH9 A;  1A5W A;  4C8M A;  3VQ5 A;  3ZSX A;  2E6L A;  2YKM A;  5J2P A;  4ELT A;  4KRF A;  3NF6 A;  3QNN A;  2XY7 A;  2BGG A;  1NK0 A;  1RBV A;  1RT1 A;  1RT2 A;  4AHT A;  4UQG A;  2XO7 A;  3RMD A;  1UWB A;  4DSF A;  2HMI A;  2OZM A;  1EXQ A;  1X1P A;  3DLR A;  1TL3 A;  4CJL A;  3ZT4 A;  1UA0 A;  5HRS A;  1UOC A;  4QAG A;  3TAN A;  3PO4 A;  1IKV A;  3I0S A;  1HNI A;  2X74 A;  1CXU A;  1ASU A;  3LDS A;  1KFD A;  3T1A A;  2FBV A;  1BI4 B;  4KTZ A;  3O4N A;  3RRH A;  3CG7 A;  1Q9Y A;  3NF8 A;  5J2N A;  2O4G A;  1C6V A;  4CJ5 A;  4ZHR A;  4AIL C;  4M41 A;  4M45 A;  3DRR A;  4O44 A;  1ZBF A;  4IG0 A;  4FJL A;  2KZZ A;  1XHX A;  5HP1 A;  4M3X A;  1U45 A;  4FYD A;  2KFZ A;  5HRN A;  1KVA A;  5CYQ A;  1RBT A;  3V1Q A;  4CGF A;  4F2R A;  1VSF A;  3K58 A;  1CZ9 A;  1WNS A;  1Q8I A;  4EP5 A;  4CK1 A;  3OS0 A;  4DQR A;  1JLE A;  2G8V A;  1LAV A;  4M3Y A;  3VQA A;  1TVR A;  4I2Q A;  4O0J A;  3QES A;  4KKO A;  3AVC A;  1O1W A;  4CJQ A;  1RBS A;  3AVM A;  4CEC A;  4OPK A;  1CLQ A;  4DU1 A;  3MXM A;  4B3O A;  4FJM A;  4CE9 A;  5CYM A;  4OJR A;  1LWE A;  1GOA A;  3U3G A;  4CEE A;  1Y97 A;  3OS1 A;  3EY1 A;  1S1V A;  2BAN A;  4FZX C;  3ZSQ A;  4PWD A;  1JLQ A;  1WAJ A;  1D8Y A;  4J2E A;  1JLF A;  3CM6 A;  4Z4E A;  1RTJ A;  1J54 A;  3DI6 A;  5FDL A;  2NUB A;  4OGE A;  1J9A A;  4CJ4 A;  4DTR A;  1NJY A;  4F3T A;  3LZJ A;  3QER A;  2ZD1 A;  4E1N A;  4FVM A;  3V6D A;  3C6T A;  4FXD A;  3DM2 A;  4FJ7 A;  4JRP A;  1NK6 A;  3OYL A;  1I3A A;  3EYZ A;  4RW8 A;  4AHS A;  2VWJ A;  3SUN A;  1TAQ A;  1U48 A;  1RTH A;  4J2D A;  2X78 A;  1YVU A;  3NGI A;  3K5N A;  1LW0 A;  2VG6 A;  1L3S A;  4O5B A;  1ZBU A;  1NKE A;  1C0T A;  4KHS A;  3QIO A;  4CJF A;  1TK0 A;  3JSM A;  2PYJ A;  1IKW A;  4FLT A;  1S1W A;  2JLE A;  3SUQ A;  1HQU A;  4HCB A;  4KTQ A;  4CGD A;  4CEO A;  1QHT A;  4CFB A;  3P1G A;  1B9D A;  4B9M A;  3TAF A;  3FFI A;  4FJ8 A;  3AVF A;  4G1Q A;  4FLX A;  4DFM A;  4I9Q A;  3A2F A;  1WSG A;  3SYZ A;  1WSJ A;  2ETJ A;  2RN2 A;  3ZT3 A;  4CF8 A;  3DRS A;  4BAC A;  3QNO A;  1SKR A;  1L3V A;  4JLH A;  5C42 A;  4OKK A;  4JS5 A;  3TAG A;  1L5U A;  4KTW A;  3S9H A;  2XHB A;  4KI4 A;  1YT3 A;  3AA3 A;  4DQI A;  5SZT A;  4PUO A;  1RT4 A;  4CER A;  4KO0 A;  4DS4 A;  4CJU A;  1XC9 A;  3TAE A;  3IRX A;  3SJJ A;  4LD0 A;  3P83 D;  4M3U A;  3LAN A;  1VSJ A;  4KI6 A;  1ZBH A;  4LH4 A;  1RCH A;  4NCG A;  3SPY A;  1L3U A;  5KI6 A;  1KSP A;  3K2P A;  2YNF A;  1LWF A;  3LP3 A;  3OS2 A;  1BIZ A;  1JL2 A;  1BI4 A;  4M3Z A;  1VSH A;  3T19 A;  3TAB A;  3S3N A;  1X9W A;  1QSS A;  1VSI A;  2XY6 A;  1C0U A;  4AHU A;  4CHN A;  4KHQ A;  3AO1 A;  4N56 A;  4M42 A;  3HPG A;  4KHU A;  4EZ9 A;  1JKH A;  1MU2 A;  3T3F A;  5HRO A;  3QEV A;  1FKO A;  1KCF A;  4DFP A;  3RMB A;  3NDK A;  4HUF A;  3HK2 A;  3HPO A;  4IFY A;  3AV9 A;  4HHT A;  3NH2 A;  1U4B A;  3MEG A;  4CEB A;  3PX6 A;  5C24 A;  3NHG A;  1S1T A;  3SV4 A;  3QET A;  4HTU A;  1X9M A;  2P1J A;  3LP0 A;  3HM9 A;  4C8O A;  4DSK A;  1W9H A;  3NGY A;  3AA2 A;  4JS4 A;  4K8Z A;  2HHW A;  3OYJ A;  2HHT A;  2ATQ A;  4TSX A;  3RTV A;  1SKS A;  1JLG A;  3CYM A;  4E7J A;  1B92 A;  3WNF A;  1RBU A;  1RT7 A;  3VQ9 A;  1UAX A;  3L2Q A;  1J53 A;  2P5O A;  1GOC A;  3ZSY A;  1DTQ A;  3AVH A;  4E7K A;  3DLH A;  4FM0 A;  1RTD A;  3OYD A;  1CXQ A;  1N6Q A;  4CJT A;  4CES A;  3B6P A;  1HYZ A;  2IC3 A;  2Z1H A;  5HLF A;  4RW4 A;  4O4G A;  3OYF A;  1L3T A;  3KD5 E;  2Z1I A;  1BCO A;  3UIQ A;  3E01 A;  2PYL A;  4GW6 A;  2VG5 A;  4FJ9 A;  3KLI A;  2Y1I A;  2ITG A;  1LW2 A;  2O4I A;  1BQN A;  3CM5 A;  4DU3 A;  4DSJ A;  1KVC A;  2B6A A;  3B6O A;  4HUE A;  4DQQ A;  1JLC A;  3KLF A;  4Q5V A;  3AVK A;  3TAM A;  3VN5 A;  4OLA A;  1VSD A;  3HPH A;  4DSL A;  3SQ0 A;  4LSN A;  3AO4 A;  3DYA A;  4N41 A;  3NBP A;  2D0B A;  2LSN A;  5KRT A;  3AVI A;  3TAR A;  1KFS A;  4F4K A;  4Q0B A;  3K5O A;  2AJQ A;  3QLH A;  3RR7 A;  4FJ5 A;  1DLO A;  1XHZ A;  3KD1 E;  3NE6 A;  4DTO A;  3RRG A;  4CHQ A;  3AVN A;  4CIE A;  2KQ2 A;  3I8D A;  3LAL A;  4DMN A;  1S5J A;  3SQ1 A;  3LAK A;  4CHP A;  4BDY A;  4LSL A;  1XWL A;  4E1M A;  4KRE A;  1QQC A;  2P5G A;  5E41 A;  5FRM A;  3P5J A;  4KPY A;  2KW4 A;  3VQD A;  5CZ1 A;  3AVA A;  4B9S A;  4H4M A;  3V9Z A;  2VG7 A;  2GBZ A;  4DFJ A;  3AA5 X;  1NK4 A;  4J2B A;  1EX4 A;  1NKB A;  4WE1 A;  1VSM A;  4NCB A;  1GOB A;  4CIG A;  3HL8 A;  4CEQ A;  4FM1 A;  1N5Y A;  3KK1 A;  3DLG A;  1HRH A;  2FBT A;  3HVT A;  3KKR A;  3OYH A;  3M8R A;  3O3F A;  1J5O A;  4FZZ A;  1XI1 A;  3VQ4 A;  2HW3 A;  3LZI A;  4HUG A;  3BDP A;  3VA0 A;  3SPZ A;  3DOL A;  5EU7 A;  4K8X A;  4FW1 A;  2RPI A;  3QEP A;  4FK0 A;  3AO2 A;  3WNG A;  3LWM A;  1HYS A;  1RDA A;  4JRQ A;  3S3O A;  1T03 A;  1HQE A;  4OVL A;  2G8F A;  4N76 A;  1FXX A;  5KGX A;  2Z1J A;  4B08 A;  2DY4 A;  3SV3 A;  4FLY A;  4E0D A;  3MED A;  1NJX A;  4FJH A;  3VQE A;  2OPQ A;  3SI6 A;  4FJI A;  2OZS A;  4QOZ B;  3DMJ A;  3SZ2 A;  4B9T A;  4IDK A;  5K14 A;  4YNQ A;  4FLW A;  2FBX A;  2A1S A;  4W5R A;  4RG8 A;  3IAY A;  3NF7 A;  4J2A A;  4DTM A;  4CCH A;  4B9N A;  2FBY A;  1R0A A;  1U47 A;  4CJE A;  3K5L A;  3VQP A;  4E89 A;  3QIP A;  1BHL A;  3M8P A;  4MFB A;  4FK4 A;  3L3V A;  4CF1 A;  2BDP A;  2B5J A;  3OY9 A;  1SL1 A;  3I0R A;  2W42 A;  4C8N A;  1D5A A;  2G8I A;  3C94 A;  4ELU A;  1BIS A;  4GVM A;  3C6U A;  3D45 A;  5T7B A;  3OYC A;  1IO2 A;  2G8W A;  3LP1 A;  3MEC A;  3CFO A;  3V81 A;  5J2M A;  4FLU A;  1B9F A;  4DF4 A;  1C1A A;  1T8E A;  2DFH A;  3VQ7 A;  4DG1 A;  2F8S A;  3OYI A;  2Y1J A;  3L2V A;  1QS4 A;  4Z4C A;  2YKN A;  3ZSR A;  4CJS A;  1RDC A;  4CFC A;  1NJW A;  1RTI A;  2Q3S A;  2OPS A;  1DTT A;  3V9W A;  3D0P A;  5I42 A;  3V9S A;  3CQ8 A;  1ZYQ A;  4LY7 A;  4KHY A;  3TAP A;  3ZT0 A;  3PX4 A;  3ULD A;  4FLV A;  3OVN A;  3DLE A;  3O3H A;  3CFP A;  1WSE A;  1WSH A;  3ZT2 A;  3OYM A;  2HHS A;  2KZM A;  1YTA A;  3ZSZ A;  1KTQ A;  2X6N A;  3OYA A;  1TKD A;  1VK0 A;  4IG3 A;  2Z1G A;  3HVR A;  2WOM A;  2YNH A;  4FJN A;  4OLB A;  2FC0 A;  1F21 A;  4CHZ A;  1NKC A;  4DWI A;  3F9K A;  4RW7 A;  3RMC A;  4FW2 A;  3TWH A;  4ZTJ A;  3RMA A;  4KAZ A;  4NYF A;  3KIO A;  5KTQ A;  3M8S A;  4DSE A;  3ZSW A;  3O4Q A;  3WNH A;  1JXB A;  2JGU A;  2OPP A;  1WSF A;  4DTX A;  3LWL A;  4Z4H A;  1TK8 A;  3HJF A;  2KTQ A;  1TKT A;  2HHX A;  2DTU A;  3QEW A;  1KLN A;  1G15 A;  3K5M A;  3RWU A;  3U6F A;  4BDZ A;  4IBN A;  4CF0 A;  1KLM A;  3ZSV A;  4O55 A;  1T05 A;  3AVL A;  3HP9 A;  1KRP A;  3RR8 A;  4CK2 A;  3G10 A;  2HB5 A;  4KB0 A;  4FK2 A;  3NF9 A;  4CEZ A;  3VQQ A;  5FRN A;  1X9S A;  2WON A;  3OYN A;  4W5Q A;  4B8C A;  1U04 A;  1A5V A;  4DTN A;  1RDD A;  2BE2 A;  2OPR A;  1NK7 A;  3NCI A;  3L2W A;  1IH7 A;  1NK5 A;  2PY5 A;  2OYQ A;  3PO5 A;  5FRO A;  2XRI A;  4B9V A;  4CGG A;  3MXI A;  1RT6 A;  4AHV A;  3K57 A;  4E7H A;  4ID5 A;  2HHV A;  3F73 A;  4W5N A;  1JXE A;  3AO5 A;  2HNY A;  3L3U A;  1HYV A;  3LPU A;  1QSL A;  3NAE A;  1JLB A;  2E6M A;  1CZB A;  2GV9 A;  2ZQB A;  4B8A B;  1C1B A;  1RDB A;  3SUO A;  2PZS A;  1S9G A;  3G0Z A;  4HCC A;  1A5X A;  1W0H A;  1VRU A;  2YNG A;  4IFV A;  1QSY A;  4E3S A;  2F8T A;  4XIU A;  3AVJ A;  4BWJ A;  3VQC A;  1RBR A;  1ASV A;  5DK5 A;  4AHC A;  4CGJ A;  4I2P A;  4CK3 A;  2HND A;  4OGC A;  4R5P A;  3NH1 A;  4DLG A;  3L2R A;  3KK3 A;  1C1C A;  3V9X A;  3ASM A;  1RNH A;  3V9U A;  2IOC A;  1TAU A;  2F96 A;  5CZ2 A;  4FM2 A;  4CJ3 A;  1HMV A;  2GUI A;  2IDO A;  5JS2 A;  4CJW A;  4CEF A;  4CJV A;  1RIL A;  4B9U A;  4HVJ A;  1NOZ A;  3TR8 A;  4GMJ B;  4FJX A; 
#chains in the Genus database with same CATH topology
 4MQ3 A;  1ZXO A;  1HJR A;  4IJN A;  5F1X A;  4YFU A;  1WB9 A;  3C0B A;  3CET A;  1NMN A;  1HR0 K;  4BR2 A;  2YHW A;  1TKZ A;  4YOY A;  1QE1 A;  4BRF A;  1S6Q A;  5AQW A;  4JI7 K;  3HM8 A;  2ZWH A;  3IDH A;  1TKX A;  5H1S Q;  5BRH A;  3VGM A;  2G8H A;  4FPB A;  3V1R A;  1SV5 A;  3EZ5 A;  2IAJ A;  4LH5 A;  5HRP A;  5I3U A;  3MCP A;  3SUP A;  4OKJ A;  4F2S A;  5EVZ A;  4HTL A;  2ZE2 A;  5AQK A;  4KHN A;  3VQ6 A;  1NGF A;  4JN4 A;  4WFA L;  4CZI A;  4BE1 A;  2HVH A;  4CJP A;  4F8R A;  4FOI A;  2E1Z A;  2GEL A;  1KAZ A;  5KGW A;  2IGI A;  4BRI A;  3S3M A;  1Z26 A;  1VRT A;  4WQ4 A;  3AO3 A;  3KVG A;  2KFN A;  3DLB A;  2P9U A;  3CCU N;  4EZ6 A;  3ITH A;  3KKS A;  5KRS A;  2G8U A;  3VEV A;  1LWC A;  4E19 A;  3PY8 A;  4ZTF A;  2YHA A;  1IBL K;  2XY8 A;  4CFD A;  3MN5 A;  1QTM A;  3PX0 A;  4NLC A;  4M3T A;  2Q2R A;  5I9E B;  3OA9 A;  2Q0U A;  3AVB A;  3OTO K;  2E20 A;  4Z0U A;  2YHY A;  5M1K A;  3OYK A;  2E2N A;  4GV9 A;  4DLE A;  1GLF O;  1Q18 A;  2D5R A;  4CED A;  1JLA A;  2RF2 A;  3CC2 N;  4PQU A;  4C8K A;  4EP4 A;  1IKY A;  3AA4 A;  4WCE L;  1IG9 A;  4M3R A;  4B1Y B;  4E7L A;  1WAF A;  3KLE A;  2QXF A;  4DFK A;  1EQY A;  1BCM A;  5C25 A;  4DTS A;  2IIR A;  4YDU C;  3LP2 A;  1HUX A;  1VSK A;  1S6P A;  4I6M B;  4FCY A;  2HBL A;  5IWA K;  5J2P A;  4KRF A;  5JLF A;  4FWK A;  1RBV A;  1UWB A;  1YJW N;  4E1J A;  1EXQ A;  1X1P A;  3CCL N;  4CBX A;  4F9O A;  5HRS A;  3BZC A;  4H03 B;  3I0S A;  1S72 N;  3RSE A;  1Z05 A;  3FE1 A;  1QHA A;  5HL7 L;  2O8B A;  3RRH A;  4KTZ A;  4CZL A;  3CJ9 A;  4FJL A;  5M1F A;  2KZZ A;  1XHX A;  4LC9 B;  4JI2 K;  1KVA A;  3SJH A;  3V1Q A;  5AQH A;  3EZW A;  1CZ9 A;  2A6A A;  5JLH A;  2AA4 A;  3BY5 A;  1TVR A;  3VER A;  2WTU A;  5C12 A;  1P90 A;  1E4G T;  1O1W A;  1CLQ A;  4OPK A;  3HZ6 A;  3CXC M;  3BUZ B;  1CZA N;  4CE9 A;  4O8K A;  1LWE A;  3U3G A;  3R3L A;  4B3R K;  2NRX A;  3ZSQ A;  1YIJ N;  2NNW A;  4QS7 A;  1YF5 L;  1RGI A;  1WAJ A;  4BG8 A;  1J54 A;  4F3T A;  4KHP K;  4OGE A;  2WFB A;  3AY9 A;  3MX2 A;  3SK3 A;  3CHW A;  4FVM A;  5EOY A;  2P9K B;  4HWI A;  3QER A;  3DM2 A;  3V6D A;  4FXD A;  4FJ7 A;  4ILJ A;  4RW8 A;  4AHS A;  2VWJ A;  3O1W A;  1TAQ A;  5BN9 A;  4JKA A;  1TUU A;  1LW0 A;  5CR4 A;  4CBU A;  1JCE A;  4IOC L;  1TK0 A;  3JSM A;  3L6Q A;  4X65 K;  4GNI A;  4FLT A;  2JLE A;  4CZJ A;  3SUQ A;  1HQU A;  4WFB L;  2FF3 B;  3IUC A;  2P9I B;  1OKJ A;  4H0O A;  2P9S A;  1WSG A;  1WSJ A;  3ZT3 A;  1SKR A;  1L5U A;  4OKK A;  2Q97 A;  1DKG D;  2XHB A;  4DQI A;  3J7Y P;  3O9S A;  1BA1 A;  2WUS A;  3TAE A;  4LD0 A;  3VES A;  3KZB A;  1VSJ A;  4LH4 A;  1LWF A;  3VEO A;  2HHH K;  1BI4 A;  3PSI A;  4LF6 K;  3VTI A;  3CCE N;  2HST A;  4DV7 K;  1VSI A;  3UKU B;  5FPM A;  1VQL N;  4YOW A;  1MU2 A;  3T3F A;  3QEV A;  2I7N A;  4FWO A;  2A41 A;  4IFY A;  3MEG A;  1M90 O;  3LP0 A;  4DSK A;  4C8O A;  3WXL A;  3NGY A;  3AA2 A;  4JS4 A;  1YIT N;  2ATQ A;  4TSX A;  3OW2 M;  1RBU A;  3L0Q A;  1NLV A;  4BVP A;  4H0P A;  3VQ9 A;  2P5O A;  4E7K A;  4BRP A;  4CES A;  2YX6 A;  5A2Q O;  1L3T A;  2YHX A;  2UUA K;  1NGG A;  4FJ9 A;  3C65 A;  4H0X B;  3DJC A;  1BQN A;  3CM5 A;  4DU3 A;  4HUE A;  1TYQ B;  5LL6 Z;  3FZM A;  4Q5V A;  3VN5 A;  4B1W B;  1VSD A;  3HPH A;  2HMP A;  3EKS A;  1DLO A;  1W97 L;  4A2A A;  3LAL A;  4DMN A;  3LAK A;  3AAQ A;  5TKY A;  4LSL A;  4CHP A;  4E1M A;  3VF6 A;  5E41 A;  4CBW A;  1GLE G;  1T6D A;  3D2F B;  1EWR A;  4B9S A;  3R8E A;  2VG7 A;  2GBZ A;  3ZX3 A;  4BRQ A;  4J2B A;  4CIG A;  3HL8 A;  4CEQ A;  4JI6 K;  3DXM A;  4FM1 A;  1HRH A;  4WQ5 A;  2P9L A;  1J5O A;  1XI1 A;  3VQ4 A;  2HW3 A;  3U8X A;  4JD2 B;  3SPZ A;  3DOL A;  4PKH A;  4B1X B;  4AF1 A;  3L4I A;  1BDG A;  5ELZ A;  3S3O A;  4H5W A;  5TKW A;  1T03 A;  2QW9 A;  4N76 A;  1FXX A;  4K41 A;  1XMO K;  3SV3 A;  3E9P A;  4E0D A;  3MED A;  1O13 A;  3SZ2 A;  3BF3 A;  4W5R A;  2A1S A;  4DV0 K;  2QWM A;  3NF7 A;  4CCH A;  4B9N A;  2E2Q A;  3VQP A;  3QIP A;  3I33 A;  4CF1 A;  3OY9 A;  3QIC A;  2VQF K;  3OBW A;  4AM6 A;  1YHQ N;  1C1A A;  3THY B;  3OYI A;  3L2V A;  4Z4C A;  4BR0 A;  1RTI A;  1NJW A;  2OPS A;  3V9W A;  2VYP A;  4LY7 A;  3TAP A;  3CPW M;  1BA0 A;  3ZET B;  4BY9 C;  4JK9 A;  1WSE A;  3ZT2 A;  3OYM A;  3CIP A;  1BWF O;  1TKD A;  1VK0 A;  3HVR A;  2YNH A;  1KC8 O;  1WUA A;  5AQT A;  3M8S A;  4BRA A;  4EIA A;  3O4Q A;  3WNH A;  4K42 A;  1EO1 A;  1TKT A;  2HHX A;  2DTU A;  3QEW A;  4IZ9 A;  4JI0 K;  1G15 A;  4IBN A;  4CF0 A;  1KLM A;  1U2V A;  3ZSV A;  1KRP A;  3HP9 A;  4KI6 A;  4KHU A;  4KB0 A;  2QWN A;  4CK2 A;  2HB5 A;  3VQQ A;  4W5Q A;  1N8R O;  1XQS C;  4QS8 A;  5CE3 A;  4IEE A;  3L2W A;  4B9V A;  2VWB A;  1SZ2 A;  5KQD A;  3CC4 N;  2P9N A;  3K57 A;  4E7H A;  2HHV A;  3L3U A;  2A3Z A;  1OH5 A;  4FL9 A;  3WXM B;  1C1B A;  2PZS A;  3SUO A;  2O8D B;  4B9Q A;  4HCC A;  3RVC A;  3G71 N;  4JAX A;  3BP8 A;  4CGJ A;  4I2P A;  4CK3 A;  5KQ8 A;  4FJJ A;  1I94 K;  2CGK A;  4B3M K;  1C1C A;  3ASM A;  2IOC A;  4FM2 A;  4CJ3 A;  1IG8 A;  1QQO A;  5AZJ B;  1BU6 O;  3TTD A;  4CEF A;  1RIL A;  4CJV A;  3HOS A;  4HVJ A;  1NOZ A;  4BR7 A;  4GMJ B;  3MEE A;  1X3M A;  3TAQ A;  4I7F A;  3V1O A;  2YHB A;  4NCA A;  4W5O A;  5J2Q A;  1ATN A;  3JYT A;  5D3G A;  4DSI A;  5HBM A;  2FSJ A;  1ASW A;  3VEY A;  1HX1 A;  2DFF A;  4ISG A;  4BGA A;  3PSF A;  3SCX A;  1WLJ A;  5C2D A;  4LF4 K;  1GLJ O;  3MN6 A;  2HNZ A;  1I39 A;  1SL0 A;  3CC7 N;  2ZJR L;  3ENH A;  4CF9 A;  2E4L A;  2IS3 A;  3A5M C;  3C95 A;  4RW9 A;  4CHO A;  3PV8 A;  2A1R A;  3NGZ A;  3CFR A;  4DTU A;  1WSI A;  1TK5 A;  5AQM A;  3FZH A;  3VQB A;  3CJB A;  5B8H A;  4NYN A;  4BC4 A;  1HNV A;  4CGI A;  1WN7 A;  3A8Y A;  3DRP A;  3K59 A;  4KB1 A;  2HHQ A;  1TUY A;  3CJC A;  4CHY A;  3DLK A;  1YTU A;  3M6G A;  4DV3 K;  3CMA N;  4M3W A;  2W41 A;  4KV8 A;  4H8K A;  3SLC A;  3HI0 A;  3PUF A;  4PA1 A;  3LPT A;  4A5A A;  3LDL A;  4CZH A;  1EET A;  3KHY A;  4I9L A;  2I5J A;  4W5T A;  4JI3 K;  3WNE A;  3SQ2 A;  1Y64 A;  3ALY A;  1S1U A;  4RWT A;  1JCF A;  1OVY A;  3C7N B;  3BF1 A;  5AQV A;  1TL1 A;  3B8A X;  3SBT A;  5BR9 A;  3UE5 A;  4FLZ A;  5CY4 A;  4BC2 A;  4X62 K;  4FWM A;  4FJG A;  1SUQ A;  1NK8 A;  4BE2 A;  4F3O A;  1VSE A;  3L2U A;  3QIN A;  4CVN E;  2O8E B;  4DQS A;  1BQM A;  3F9M A;  3H1Q A;  4IEI A;  4JKH A;  2ITM A;  2CH6 A;  4DR3 K;  4N5S A;  2R7Y A;  4DF8 A;  5JVH L;  3TSQ A;  4Z94 A;  3HXM A;  2EX3 A;  3OBY A;  2XY5 A;  1VQM N;  4DTP A;  1GLA G;  1K6Y A;  3U3Y A;  4H5T A;  4ID1 A;  3SQ4 A;  4KFB A;  1ITG A;  3P31 A;  2ZM6 K;  3THV A;  1NNE A;  4PKG A;  3HBT A;  4N47 A;  2RE2 A;  1VAZ A;  5ADX H;  1X3N A;  1NK9 A;  4M7X A;  1S3X A;  4AHR A;  4B9L A;  3NFA A;  4JI4 K;  3QO9 A;  1SAZ A;  3OYG A;  5JS1 A;  4FJK A;  2G8K A;  4DTJ A;  3IFR A;  4FVU A;  4C8M A;  1G99 A;  2RHK A;  2YKM A;  3I56 N;  4FOE A;  1RT1 A;  3RMD A;  2HMI A;  2OZM A;  4LF7 K;  1UA0 A;  1UOC A;  1K73 O;  3CJA A;  3TAN A;  3PO4 A;  4DV2 K;  1IKV A;  1GLL O;  5BN8 A;  1HNI A;  5M1P A;  3M5R A;  4BRD A;  3T1A A;  2FBV A;  1BI4 B;  1KAX A;  3CG7 A;  4MDA A;  5KPZ A;  4CJ5 A;  4AIL C;  4C1N I;  5AQJ A;  3SAH A;  1QZ5 A;  4YOX A;  1RBT A;  1HLU A;  4CK1 A;  1JLE A;  1LAV A;  3VQA A;  3EO3 A;  3QES A;  1C0G A;  4EHU A;  4CJQ A;  4B1U B;  1RBS A;  3A0I X;  3AVM A;  4FJM A;  4OJR A;  2OTJ N;  5LY3 A;  3EY1 A;  2BAN A;  4CJ7 A;  3W3D A;  2HOE A;  1D8Y A;  4J2E A;  3CM6 A;  4DTR A;  2GWJ A;  3FGU A;  4X66 K;  2YI1 A;  2JWL A;  3JS6 A;  4YY3 K;  3EYZ A;  3LL3 A;  3SUN A;  4EFH A;  1U48 A;  2HF3 A;  1MDU B;  3ZEU A;  1YVU A;  2EWS A;  4O5B A;  1ZBU A;  3H45 C;  4KHS A;  3QIO A;  2PYJ A;  4KTQ A;  1FJG K;  5BRE A;  3P1G A;  1B9D A;  4B9M A;  4WQ5 C;  3IMX A;  4DV6 K;  4FLX A;  4DFM A;  4I9Q A;  1ZBS A;  5AQF A;  3A2F A;  3SYZ A;  3THW B;  4RTF D;  2ETJ A;  2RN2 A;  3LM2 A;  5AQG A;  3DRS A;  4CF8 A;  1L3V A;  5C42 A;  3TAG A;  4DUY K;  4KTW A;  3S9H A;  3AA3 A;  4BRL A;  2V7Y A;  4CJU A;  3F5T A;  3LAN A;  4X64 K;  1RCH A;  3SPY A;  1L3U A;  5KI6 A;  1KSP A;  2HBM A;  2YNF A;  3H6E A;  1BIZ A;  1JL2 A;  1KAY A;  1VSH A;  4MO5 A;  3T19 A;  3TAB A;  4IOX A;  3FZK A;  4K0K K;  3EE8 A;  4FWR A;  3CCS N;  4AHU A;  3HPG A;  5M1N A;  3JXU A;  4EZ9 A;  2IVO A;  3W0L A;  1W2B M;  3RMB A;  4JHD B;  2NRZ A;  4HHT A;  1VHX A;  3IKM A;  4XH5 A;  3PX6 A;  5C24 A;  3NHG A;  4HTU A;  3HM9 A;  5EY4 A;  5FPN A;  2HHW A;  1OVQ A;  3OYJ A;  5AZI B;  3CYM A;  3MWT A;  2HBK A;  2BUP A;  1GOC A;  1DTQ A;  5AFU A;  3MCA B;  1RTD A;  1CXQ A;  1N6Q A;  1KQS M;  3B6P A;  3E1Y A;  4MDB A;  1K8K B;  1DEJ A;  2Z1H A;  3CJ1 A;  4RW4 A;  5HLF A;  3PLA A;  3ZX0 A;  1LW2 A;  2O4I A;  4DSJ A;  2B6A A;  3B6O A;  5LJW A;  1M1K O;  3KLF A;  3AVK A;  4EHT A;  4MLH A;  2ZGZ A;  4PKI A;  4OLA A;  3D7E O;  4DSL A;  2P9P B;  2KKZ A;  3SQ0 A;  3AO4 A;  4N41 A;  2LSN A;  5KRT A;  3AVI A;  3AAR A;  3K5O A;  2AJQ A;  3QLH A;  4FJ5 A;  4AM7 A;  4IWV A;  4BRM A;  3LDO A;  3I8D A;  2BGG A;  3SQ1 A;  4BDY A;  4XH1 A;  3MMV A;  3G25 A;  3O9T A;  1NMD A;  2KW4 A;  3VQD A;  3L4Q A;  4H4M A;  5AQR A;  3V9Z A;  1NKB A;  3T69 A;  4R79 A;  1NU0 A;  3D2E A;  3VEZ A;  2FBT A;  3O3F A;  2F7T A;  4JKG B;  3VA0 A;  4FW1 A;  2RPI A;  3GL1 A;  3QEP A;  3WNG A;  1RDA A;  3WEE B;  5DM6 L;  2D4W A;  4OVL A;  5GAE P;  5IT9 O;  2WBN A;  5KGX A;  4B08 A;  4CD1 A;  3EEQ A;  1WOQ A;  3U4L A;  1FW6 A;  4FJI A;  2OZS A;  4QOZ B;  4OPA A;  5F2R A;  4IDK A;  1NGE A;  2QA4 N;  2E5L K;  4FLW A;  2FBX A;  3ULE B;  4RG8 A;  3P39 A;  2FBY A;  3AGK A;  4FO0 A;  5GAH P;  4E89 A;  4CZK A;  1XNQ K;  2BDP A;  1SL1 A;  3I0R A;  1D5A A;  3C94 A;  3D45 A;  1IO2 A;  2CH5 A;  3LP1 A;  3C6H A;  3ID6 A;  5J2M A;  1K9M O;  2F8S A;  3QML A;  1VQO N;  5AQQ A;  3R6M A;  1QS4 A;  3V9S A;  3CQ8 A;  1ATS A;  3ZT0 A;  3PX4 A;  3ULD A;  4FLV A;  4WF9 L;  3O3H A;  3N4Q A;  2O8C A;  2KZM A;  1YTA A;  1KTQ A;  3H46 O;  2E2P A;  3OYA A;  4IG3 A;  4FJN A;  4CHZ A;  4IFE A;  3F9K A;  4NYF A;  5GIO A;  2ASM A;  1WSF A;  3SMS A;  2KTQ A;  4ILG B;  5MLC Q;  3U6F A;  4KH5 A;  1T05 A;  5C2F A;  3SBG A;  5FRN A;  3NF9 A;  4NLB A;  2WON A;  3N4P A;  3QBX A;  4YOV A;  4B8C A;  4AQY K;  3KD1 E;  3NCI A;  4CI6 A;  2PY5 A;  3A5O C;  3DLL L;  3MDQ A;  3J8A A;  4LFC K;  1QQN A;  3F73 A;  3LPU A;  1HKB A;  1QSL A;  3VF4 A;  1HNZ K;  1JLB A;  2ZQB A;  4FWL A;  1S9G A;  3UKR A;  1VRU A;  4XIU A;  4BWJ A;  5HOO A;  5C0Y A;  4R5P A;  3NH1 A;  4OGC A;  3J7A P;  5AQZ A;  2HBJ A;  3V9X A;  1BO5 O;  1RNH A;  1QVG M;  1HMV A;  1T3V A;  2GUI A;  5AR0 A;  5KPR A;  1ILY A;  2VGM A;  2QTD A;  2A42 A;  1XMQ K;  3CPE A;  2NZT A;  3TR8 A;  2KHO A;  4FJX A;  3CJ7 A;  4A5B A;  1Q9X A;  1TGO A;  2Q1N A;  3THX B;  1NJZ A;  4JKE A;  2QEX N;  4Y1D A;  3OJS A;  3O8M A;  1ZBI A;  3KTQ A;  4RW6 A;  3AGR A;  4Z4F A;  4Z4I A;  2VWK A;  4LF8 K;  4BQZ A;  4FZY A;  1ZBL A;  1S9E A;  1VSL A;  3H08 A;  4BDP A;  5J1E A;  3VQ8 A;  4E7I A;  4O5F A;  3SNN A;  3FZL A;  4JEP A;  1U49 A;  5BRD A;  3LAM A;  1BIU A;  3PIP L;  2A40 A;  3DXK B;  3HST B;  2P51 A;  3CF5 L;  2NRT A;  2HVI A;  3VA3 A;  4FWQ A;  3C6A A;  3VMF B;  3OYB A;  4G9Z A;  4KHW A;  2QK9 A;  1SL2 A;  1YI2 N;  4DV1 K;  1VQ4 N;  2FXU A;  3KK2 A;  5C15 A;  2V51 B;  2QXL A;  2ZJP L;  1NOY A;  3DOK A;  4Z4G A;  4K43 A;  3EKU A;  4JNE A;  2BTF A;  1BGX T;  1VQ7 N;  3HT3 A;  3VGK A;  4CJR A;  3SAF A;  1BL3 A;  1D9F A;  3L8B A;  1BG3 A;  3OJU A;  4I6M A;  3HYF A;  2I7P A;  5AQO A;  3KLG A;  1S1X A;  3ZT1 A;  1ZC6 A;  3QEI A;  4YDU A;  5GIN A;  4DU4 A;  3E9O A;  1JL1 A;  4JKC A;  1FK9 A;  3H1V X;  2B4J A;  1S22 A;  3HSC A;  2QWP A;  4L8R B;  4NXN K;  3M8Q A;  3HP6 A;  4DR5 K;  4DB3 A;  4DR6 K;  4PY5 A;  1SKW A;  4ISF A;  3IS9 A;  3GBT A;  2FF6 A;  3A5N C;  3ID8 A;  1HJO A;  1REV A;  4WQ4 C;  4V19 S;  3HO1 A;  4BVO A;  1UA1 A;  1TV6 A;  2FSK A;  4BE0 A;  2YNI A;  3KLH A;  3BGR A;  3QEX A;  4BWM A;  3ISN C;  3GOI A;  1T7P A;  4CIF A;  3ZCM A;  4QCL A;  1VQ8 N;  5BPM A;  3OYE A;  2P9U B;  4B1Z A;  1A5W A;  1LOT B;  5JIC A;  1N36 K;  2E6L A;  3K9K A;  3I55 N;  4ELT A;  1Q82 O;  3QNN A;  1RT2 A;  4AHT A;  4DSF A;  3DLR A;  4CJL A;  4BRN A;  5LJV A;  3ZT4 A;  3WQU A;  4JK7 A;  2P9K A;  1CXU A;  1ASU A;  3R9P A;  1YXQ A;  3LDS A;  1KFD A;  1QZ6 A;  3O4N A;  2KLA A;  3NF8 A;  3LDQ A;  1QQM A;  2O4G A;  4ZHR A;  3DRR A;  5GAG P;  4O44 A;  1YJ9 N;  4IG0 A;  3TTF A;  1U45 A;  3CCM N;  4FYD A;  2P9I A;  5HRN A;  2KFZ A;  4CZE A;  1NM1 A;  5CYQ A;  4F2R A;  1VSF A;  5AJ3 K;  1Q86 O;  3K58 A;  4DQR A;  5E26 A;  4EP5 A;  3QFU A;  3OS0 A;  4M3Y A;  4I2Q A;  4PL7 A;  3O08 A;  4FWN A;  4KKO A;  5AQS A;  3AVC A;  2QM1 A;  4DU1 A;  3MXM A;  4B3O A;  2IVP A;  5CYM A;  1GOA A;  4CEE A;  1VQ6 N;  1S1V A;  4FZX C;  4BG9 A;  4PWD A;  4OO1 J;  4MO4 A;  1BUP A;  1JLF A;  4CJ4 A;  4DUZ K;  2NUB A;  3LZJ A;  4GKK K;  1BOT O;  3C6T A;  2F9W A;  4JKF A;  4JRP A;  1NK6 A;  3RSE B;  2E2O A;  3UKU A;  4J2D A;  1RTH A;  2PBD A;  2W40 A;  4BR5 A;  1W7A A;  2O8B B;  2X78 A;  4DCH A;  4MLE A;  2VG6 A;  5EXW A;  1L3S A;  4LF9 K;  3VET A;  1C0T A;  4CJF A;  5KPT A;  1IKW A;  1S1W A;  3SMP A;  1U6Z A;  3S41 A;  3TSU A;  1NGH A;  2D0O A;  3FFI A;  2E8A A;  4FJ8 A;  4PL8 A;  3AVF A;  4G1Q A;  1EWQ A;  4CZM A;  4JS5 A;  1QVF M;  4DHY A;  3VGL A;  5SZT A;  4OX9 K;  1RDW X;  4CER A;  4DS4 A;  3D2E B;  4M3U A;  4FWS A;  3P83 D;  1ZBH A;  3DAW A;  4NCG A;  3VEW A;  3HOT A;  1TYQ A;  3U9D A;  3FFK B;  2GUP A;  3LDN A;  3K2P A;  3M1F A;  3OS2 A;  3S3N A;  1QSS A;  1H1V A;  1C0U A;  4EAH D;  3T1H K;  4KHQ A;  1YVN A;  3AO1 A;  4N56 A;  5EX5 A;  3WQT A;  3H3O B;  1IJJ A;  4UY8 O;  1FKO A;  1KCF A;  2YJE A;  3NDK A;  4KH4 A;  1U4B A;  3AV9 A;  3G6E N;  5JVG L;  3SV4 A;  2P1J A;  3D2F A;  4K8Z A;  2HHT A;  4NXM K;  5BR8 K;  1SKS A;  3WT0 A;  4E7J A;  1B92 A;  2GTD A;  3WNF A;  3L2Q A;  1UAX A;  2P9S B;  1J53 A;  3DLH A;  4FM0 A;  4NB4 A;  3OYD A;  3CME N;  2UYT A;  4CJT A;  2NRW A;  4JD2 A;  1DT9 A;  4BC3 A;  4LFB K;  2D1K A;  5GAD P;  2PYL A;  4GW6 A;  3DWL A;  2Y1I A;  2ITG A;  4FPA A;  1KVC A;  3UB5 A;  1J5E K;  3TAM A;  3KWG A;  4LSN A;  1X9J A;  3NBP A;  4BQL A;  4Q0B A;  4WFN L;  3RR7 A;  2BH1 A;  1VQ5 N;  1XHZ A;  5AQN A;  4U7B A;  3NE6 A;  4DTO A;  4C1N K;  4CHQ A;  3AVN A;  4CIE A;  1HKC A;  2KQ2 A;  2FLO A;  1XWL A;  1OH7 A;  1QQC A;  2PFU A;  5FRM A;  3P5J A;  4KPY A;  5CZ1 A;  5FPE A;  4DFJ A;  4K25 A;  4WE1 A;  4WYB A;  1VSM A;  4NCB A;  1JJ2 M;  3KK1 A;  4RCH A;  3SAG A;  3THY A;  3HVT A;  3KKR A;  1JCG A;  1VQN N;  4HUG A;  1MWK A;  4FK0 A;  3AO2 A;  3ZET A;  3CCR N;  3LWM A;  1HYS A;  2DPN A;  2G8F A;  3UKR B;  4CZG A;  3QFP A;  1XUP O;  3QBW A;  2Z1J A;  2DY4 A;  4FLY A;  3T1Y K;  4JI5 K;  3VQE A;  3SI6 A;  3NVM A;  4O8U A;  3DMJ A;  4B9T A;  3TPQ A;  3CI5 A;  3IAY A;  4B3T K;  5BPN A;  4DTM A;  5AQP A;  3M8P A;  4FK4 A;  1SS6 A;  2B5J A;  4JI8 K;  2W42 A;  4C8N A;  4ELU A;  2IVN A;  3C6U A;  3DXM B;  3CFO A;  4FLU A;  4DF4 A;  4DG1 A;  2Y1J A;  2P9L B;  4DQ8 A;  4CJS A;  1RDC A;  4CFC A;  2O8D A;  4Y0W A;  1DTT A;  1ZYQ A;  3D0P A;  2ASP A;  4KHY A;  3H3N O;  2NRR A;  3LM9 A;  3O9U A;  3O9R A;  3OVN A;  3DLE A;  1YAG A;  1N34 K;  2X6N A;  3VEN A;  3EL2 A;  2WOM A;  5AZJ A;  2FC0 A;  4DWI A;  2UXD K;  4U67 L;  1VQP N;  1HKG A;  4RW7 A;  4ZTJ A;  3TWH A;  3RMA A;  4BR9 A;  2ASO A;  4DSE A;  1D4X A;  3ZSW A;  2PAV A;  1JXB A;  2JGU A;  2OPP A;  1TK8 A;  1V4S A;  3LWL A;  5LMN K;  3HJF A;  1DGK N;  1KLN A;  4BGB A;  3RWU A;  2UUC K;  4BDZ A;  3PIO L;  4O55 A;  4H5N A;  2OCE A;  4FK2 A;  2CGJ A;  3VEX A;  1HPM A;  2GEM A;  4A62 A;  3BEX A;  1A5V A;  1J6Z A;  4DTN A;  2BE2 A;  2OPR A;  1NK7 A;  1NK5 A;  2OYQ A;  5M1Q A;  3PO5 A;  1LCU A;  4CGG A;  3MXI A;  4JKD A;  4W5N A;  1JXE A;  3AO5 A;  2HNY A;  3CCQ N;  3O9Q A;  3NAE A;  2E6M A;  2UXB K;  2GV9 A;  4B8A B;  3G0Z A;  1A5X A;  2YNG A;  1QSY A;  3VQC A;  3MK6 A;  1RBR A;  1ASV A;  4JI1 K;  4AHC A;  4DLG A;  2HND A;  3L2R A;  1TAU A;  2F96 A;  5CZ2 A;  2IDO A;  5JS2 A;  4CJW A;  4IO8 A;  3EN9 A;  4M7Y A;  2UXC K;  3Q7B A;  5FPD A;  2VCP A;  2E1Y A;  1U2V B;  2QWQ A;  1NGI A;  4CF2 A;  2OA8 A;  1NWK A;  3C7N A;  4IJA A;  3MX5 A;  5AQU A;  4OPJ A;  1RT3 A;  3ZSO A;  2GX9 A;  4BRG A;  4A57 A;  4ICL A;  1LV5 A;  2P9N B;  2F4V K;  3FLC O;  4ILH A;  1NGA A;  2W6L A;  3V4I A;  4YHH K;  2V7Z A;  2O8E A;  3M3Z A;  2EHG A;  3JAM O;  3FZF A;  1LAW A;  2E88 A;  4BRK A;  3P38 A;  5HRR A;  1C0M A;  1FKP A;  3IG1 A;  3AVG A;  1Z25 A;  2F9T A;  3NMU A;  3TI0 A;  3ZYY X;  5BRF A;  4IKF A;  4ELV A;  2RKI A;  4DS5 A;  3VF2 A;  4CEA A;  4IDH A;  2D0A A;  4H4O A;  4OPH A;  4LFA K;  3GDQ A;  2DFE A;  4CZF A;  4CGH A;  3CD6 N;  1XC3 A;  5C10 A;  4C8L A;  3K9J A;  4J8F A;  2D0C A;  1Q81 O;  3U9Z A;  2YV0 X;  1NGB A;  3O1B A;  3TSP A;  3QB0 A;  3MAQ A;  2WC9 A;  4PHT X;  1RT5 A;  3F2K A;  4CFA A;  5SWM A;  1EP4 A;  1GLB G;  2QKK A;  3KJV A;  5F0X A;  1EKE A;  5AQY A;  1NGC A;  2QKB A;  3ENB A;  3KK7 A;  2O8F A;  2ZF5 O;  2VGN A;  4YOT A;  3VPZ A;  4OKE A;  1OH6 A;  1KVB A;  3T7Z A;  4A2B A;  3TU5 A;  3MN9 A;  3E9L A;  3WXI A;  4JKB A;  4BRE A;  3HTV A;  1HNW K;  4B3S K;  3TTC A;  4CD3 A;  3MXJ A;  1HPZ A;  2J4R A;  4O0I A;  4BRH A;  3P4I A;  1IKX A;  5AFU H;  4DKW A;  1D9D A;  4CJK A;  5DMR A;  3O3G A;  2HHU A;  2QWL A;  1HNX K;  4Y1C A;  2X6S A;  4DQP A;  3OHR A;  2Q0R A;  5AQX A;  3NH0 A;  4AH9 A;  3VQ5 A;  4H5R A;  3ZSX A;  3NF6 A;  2XY7 A;  1NK0 A;  4UQG A;  2XO7 A;  4JYA K;  2QWR A;  3CER A;  1TL3 A;  4FSV A;  4QAG A;  3ENO A;  4DV4 K;  3J80 O;  2X74 A;  2QWO A;  1Q9Y A;  1RDU A;  5J2N A;  3NVK A;  4H0Y B;  1C6V A;  4M41 A;  4M45 A;  1ZBF A;  4XEI A;  2A5X A;  5HP1 A;  4M3X A;  5DM7 L;  4CGF A;  1WNS A;  1GLD G;  1Q8I A;  2G8V A;  3THW A;  2YCH A;  4O0J A;  1KD1 O;  3O4W A;  1K8A O;  3ATU A;  4CEC A;  3KWI A;  3O80 A;  3CQY A;  3J7Z O;  1Y97 A;  3OS1 A;  2OAN A;  3R1X A;  1JLQ A;  4DR2 K;  3EE9 A;  4Z4E A;  1RTJ A;  3DI6 A;  5FDL A;  4A59 A;  1J9A A;  4YOR A;  1NJY A;  2ZD1 A;  4E1N A;  3OYL A;  1I3A A;  2CGL A;  5GIP A;  1WBB A;  4BRC A;  4JV5 K;  1SQK A;  1Q7Y O;  3NGI A;  3GE1 A;  3K5N A;  4JHD A;  5FLX O;  1NKE A;  3FR0 A;  4XH4 A;  2QI2 A;  4GVE A;  4HCB A;  5AQI A;  5AZI A;  4CGD A;  4CEO A;  1QHT A;  4CFB A;  3TAF A;  2D0P A;  3QDK A;  2NRV A;  3K0S A;  2ZGY A;  3QNO A;  1Z6R A;  4BAC A;  1IBM K;  4JLH A;  1K8K A;  1GLC G;  2UUB K;  2FSN A;  1MWM A;  1VQK N;  4KI4 A;  1YT3 A;  1IV0 A;  4PUO A;  1RT4 A;  4KO0 A;  1XC9 A;  3IRX A;  3SJJ A;  2ZJQ L;  3WXJ A;  3LP3 A;  4M3Z A;  1P8Z A;  3J81 O;  1X9W A;  2P9P A;  1E3M A;  2XY6 A;  4CHN A;  1WBD A;  4M42 A;  1XNR K;  2V52 B;  4L3Q A;  4IXC A;  1JKH A;  3ZEU B;  4H0T B;  5HRO A;  4DFP A;  4HUF A;  3HK2 A;  4BRO A;  3HPO A;  3NH2 A;  4CEB A;  1X9M A;  3QET A;  1S1T A;  1YUW A;  1C0F A;  1W9H A;  5JMV A;  3RTV A;  1JLG A;  4H5V A;  3Q7C A;  5M1O A;  5AQL A;  1RT7 A;  4NO7 A;  5E84 A;  3ZSY A;  3AVH A;  3CCJ N;  3BZK A;  5ADX A;  1HYZ A;  2IC3 A;  4JKG A;  2HF4 A;  4O4G A;  3OYF A;  4GV6 A;  3KD5 E;  2Z1I A;  1BCO A;  3UIQ A;  3E01 A;  2VG5 A;  3KLI A;  4ISE A;  1N32 K;  3WEE A;  4DQQ A;  2AP1 A;  1JLC A;  5CHI A;  2GWK A;  3VOV A;  3ZX2 A;  1ESV A;  4GKJ K;  3DYA A;  2D0B A;  4KH6 A;  1KFS A;  3O6W A;  3TAR A;  4F4K A;  1VQ9 N;  1V4T A;  1NBW A;  3ULE A;  3RRG A;  1S5J A;  1E4F T;  4KRE A;  2UU9 K;  4A61 A;  2P5G A;  4DV5 K;  3LDP A;  3GG4 A;  3AVA A;  1NK4 A;  3AA5 X;  1EX4 A;  1GOB A;  1N5Y A;  3DLG A;  3M8R A;  4CW7 B;  1IBK K;  3OYH A;  4FZZ A;  4KBO A;  4DR7 K;  3LZI A;  4IO9 L;  3BDP A;  5EU7 A;  4C23 A;  4K8X A;  3WUH A;  1NGD A;  4JRQ A;  1RFQ A;  1HQE A;  1KXP A;  1NJX A;  1OH8 A;  3HRG A;  4FJH A;  2OPQ A;  5K14 A;  4YNQ A;  1NG9 A;  4J2A A;  1R0A A;  4H0V B;  1U47 A;  1MA9 B;  4CJE A;  3K5L A;  3O5B A;  4MFB A;  1BHL A;  3L3V A;  3ATV A;  4M63 C;  2G8I A;  1BIS A;  4GVM A;  3OYC A;  2G8W A;  5T7B A;  3MEC A;  3V81 A;  1ATR A;  1B9F A;  1T6C A;  3AAP A;  2DFH A;  3VQ7 A;  1T8E A;  2Q36 A;  4QS9 A;  3MWP A;  2YKN A;  3ZSR A;  2Q3S A;  5I42 A;  3D6R A;  2W6K A;  3VTH A;  3WXK A;  2OTL N;  3CFP A;  1WSH A;  1YJN N;  2HHS A;  3ZSZ A;  1NJI O;  2Z1G A;  4OLB A;  2H3G X;  1F21 A;  1NKC A;  4GY2 B;  4BC5 A;  3RMC A;  4FW2 A;  4DR4 K;  4KAZ A;  1R59 O;  3KIO A;  5KTQ A;  2VQE K;  4YOU A;  3CQX A;  4DTX A;  4Z4H A;  2NRH A;  2Q31 A;  4DR1 K;  3K5M A;  5LMU K;  4JK8 A;  3RR8 A;  3AVL A;  3THX A;  3ZLJ A;  3G10 A;  2JWK A;  4CEZ A;  4IOA L;  1X9S A;  3OYN A;  5BPL A;  1U04 A;  1RDD A;  1IH7 A;  5FRO A;  2XRI A;  3G4S N;  1NGJ A;  1RT6 A;  4AHV A;  4ID5 A;  4LF5 K;  1HYV A;  1CZB A;  1N33 K;  1RDB A;  3MN7 A;  1W0H A;  4IFV A;  3I8B A;  4E3S A;  2F8T A;  3E66 A;  3AVJ A;  5DK5 A;  4BR4 A;  3A5L C;  2NLX A;  3CCV N;  2O8C B;  3KK3 A;  3DXK A;  4FWP A;  4GV3 A;  3V9U A;  2O8F B;  4B9U A;  1T44 A;  4B1V A;  2YJF A; 
#chains in the Genus database with same CATH homology
 3MEE A;  4MQ3 A;  1HJR A;  4I7F A;  4YFU A;  3TAQ A;  3V1O A;  1Q9X A;  1TGO A;  2YHB A;  4NCA A;  4W5O A;  5J2Q A;  3JYT A;  5D3G A;  1NJZ A;  4CF2 A;  2OA8 A;  4DSI A;  4Y1D A;  5HBM A;  3OJS A;  1ZBI A;  1ASW A;  2DFF A;  3KTQ A;  1TKZ A;  3SCX A;  1WLJ A;  1QE1 A;  1RT3 A;  4OPJ A;  2HNZ A;  3ZSO A;  1S6Q A;  1I39 A;  4RW6 A;  4ICL A;  1SL0 A;  1LV5 A;  4Z4F A;  4Z4I A;  2VWK A;  2E4L A;  4CF9 A;  3V4I A;  2IS3 A;  3C95 A;  1TKX A;  4RW9 A;  4FZY A;  1ZBL A;  4CHO A;  3PV8 A;  1S9E A;  1VSL A;  2A1R A;  3H08 A;  3NGZ A;  4BDP A;  2EHG A;  5J1E A;  3CFR A;  1LAW A;  3V1R A;  3VQ8 A;  4E7I A;  1SV5 A;  4DTU A;  2G8H A;  1WSI A;  3EZ5 A;  1TK5 A;  2IAJ A;  4LH5 A;  1C0M A;  1FKP A;  5HRR A;  3VQB A;  5HRP A;  3SNN A;  1U49 A;  3IG1 A;  3LAM A;  4NYN A;  1BIU A;  4CGI A;  1HNV A;  1Z25 A;  3AVG A;  5I3U A;  3SUP A;  1WN7 A;  3HST B;  4OKJ A;  2P51 A;  3TI0 A;  4F2S A;  3DRP A;  3K59 A;  4KB1 A;  2HVI A;  2HHQ A;  2ZE2 A;  4CHY A;  3VA3 A;  3DLK A;  4KHN A;  4FJJ A;  1YTU A;  3VQ6 A;  4M3W A;  4KV8 A;  3OYB A;  4IKF A;  4H8K A;  3PUF A;  4ELV A;  4PA1 A;  4KHW A;  4BE1 A;  2QK9 A;  1SL2 A;  2RKI A;  3LPT A;  4DS5 A;  2HVH A;  4CJP A;  4F8R A;  1EET A;  3KK2 A;  4CEA A;  4I9L A;  2I5J A;  1NOY A;  4W5T A;  3DOK A;  2D0A A;  4H4O A;  4Z4G A;  2DFE A;  3WNE A;  4CGH A;  3SQ2 A;  1BGX T;  4C8L A;  3ALY A;  1S1U A;  5KGW A;  3HT3 A;  4CJR A;  2IGI A;  1BL3 A;  1D9F A;  3L8B A;  3S3M A;  3OJU A;  1Z26 A;  2D0C A;  1VRT A;  1TL1 A;  3AO3 A;  3HYF A;  2KFN A;  2YV0 X;  4FLZ A;  5CY4 A;  3DLB A;  4FJG A;  3KLG A;  1SUQ A;  1S1X A;  3MAQ A;  1NK8 A;  4EZ6 A;  4BE2 A;  3ITH A;  3ZT1 A;  3KKS A;  4F3O A;  1RT5 A;  1VSE A;  4CFA A;  5KRS A;  5SWM A;  1EP4 A;  3L2U A;  3QIN A;  1LWC A;  3QEI A;  2G8U A;  4DQS A;  1BQM A;  4E19 A;  4DU4 A;  1JL1 A;  3PY8 A;  4ZTF A;  3KJV A;  2YHA A;  2QKK A;  1FK9 A;  2XY8 A;  4CFD A;  1QTM A;  3PX0 A;  1EKE A;  2B4J A;  2QKB A;  4M3T A;  4N5S A;  4L8R B;  2R7Y A;  4OKE A;  4DF8 A;  1KVB A;  3M8Q A;  3HP6 A;  3HXM A;  3AVB A;  4PY5 A;  2EX3 A;  2XY5 A;  1SKW A;  4DTP A;  1K6Y A;  3U3Y A;  4Z0U A;  4ID1 A;  3OYK A;  3SQ4 A;  3IS9 A;  4KFB A;  1ITG A;  4DLE A;  3MXJ A;  1REV A;  3THV A;  3HO1 A;  2D5R A;  4CED A;  1JLA A;  2RF2 A;  4PQU A;  1HPZ A;  1UA1 A;  4C8K A;  4EP4 A;  1TV6 A;  4BE0 A;  1IKY A;  4O0I A;  4N47 A;  3AA4 A;  1IG9 A;  4M3R A;  2YNI A;  1IKX A;  3KLH A;  4E7L A;  1D9D A;  1WAF A;  3KLE A;  4CJK A;  2QXF A;  4DFK A;  3BGR A;  1BCM A;  4BWM A;  3ISN C;  5C25 A;  4DTS A;  3QEX A;  1NK9 A;  1T7P A;  3LP2 A;  4CIF A;  5DMR A;  3ZCM A;  4AHR A;  3O3G A;  4B9L A;  4QCL A;  3NFA A;  1VSK A;  3QO9 A;  1S6P A;  2HHU A;  4FCY A;  4Y1C A;  2X6S A;  3OYG A;  4DQP A;  4FJK A;  5JS1 A;  2G8K A;  4DTJ A;  3OYE A;  3NH0 A;  4AH9 A;  1A5W A;  4C8M A;  3VQ5 A;  3ZSX A;  2E6L A;  2YKM A;  5J2P A;  4ELT A;  4KRF A;  3NF6 A;  3QNN A;  2XY7 A;  2BGG A;  1NK0 A;  1RBV A;  1RT1 A;  1RT2 A;  4AHT A;  4UQG A;  2XO7 A;  3RMD A;  1UWB A;  4DSF A;  2HMI A;  2OZM A;  1EXQ A;  1X1P A;  3DLR A;  1TL3 A;  4CJL A;  3ZT4 A;  1UA0 A;  5HRS A;  1UOC A;  4QAG A;  3TAN A;  3PO4 A;  1IKV A;  3I0S A;  1HNI A;  2X74 A;  1CXU A;  1ASU A;  3LDS A;  1KFD A;  3T1A A;  2FBV A;  1BI4 B;  4KTZ A;  3O4N A;  3RRH A;  3CG7 A;  1Q9Y A;  3NF8 A;  5J2N A;  2O4G A;  1C6V A;  4CJ5 A;  4ZHR A;  4AIL C;  4M41 A;  4M45 A;  3DRR A;  4O44 A;  1ZBF A;  4IG0 A;  4FJL A;  2KZZ A;  1XHX A;  5HP1 A;  4M3X A;  1U45 A;  4FYD A;  2KFZ A;  5HRN A;  1KVA A;  5CYQ A;  1RBT A;  3V1Q A;  4CGF A;  4F2R A;  1VSF A;  3K58 A;  1CZ9 A;  1WNS A;  1Q8I A;  4EP5 A;  4CK1 A;  3OS0 A;  4DQR A;  1JLE A;  2G8V A;  1LAV A;  4M3Y A;  3VQA A;  1TVR A;  4I2Q A;  4O0J A;  3QES A;  4KKO A;  3AVC A;  1O1W A;  4CJQ A;  1RBS A;  3AVM A;  4CEC A;  4OPK A;  1CLQ A;  4DU1 A;  3MXM A;  4B3O A;  4FJM A;  4CE9 A;  5CYM A;  4OJR A;  1LWE A;  1GOA A;  3U3G A;  4CEE A;  1Y97 A;  3OS1 A;  3EY1 A;  1S1V A;  2BAN A;  4FZX C;  3ZSQ A;  4PWD A;  1JLQ A;  1WAJ A;  1D8Y A;  4J2E A;  1JLF A;  3CM6 A;  4Z4E A;  1RTJ A;  1J54 A;  3DI6 A;  5FDL A;  2NUB A;  4OGE A;  1J9A A;  4CJ4 A;  4DTR A;  1NJY A;  4F3T A;  3LZJ A;  3QER A;  2ZD1 A;  4E1N A;  4FVM A;  3V6D A;  3C6T A;  4FXD A;  3DM2 A;  4FJ7 A;  4JRP A;  1NK6 A;  3OYL A;  1I3A A;  3EYZ A;  4RW8 A;  4AHS A;  2VWJ A;  3SUN A;  1TAQ A;  1U48 A;  1RTH A;  4J2D A;  2X78 A;  1YVU A;  3NGI A;  3K5N A;  1LW0 A;  2VG6 A;  1L3S A;  4O5B A;  1ZBU A;  1NKE A;  1C0T A;  4KHS A;  3QIO A;  4CJF A;  1TK0 A;  3JSM A;  2PYJ A;  1IKW A;  4FLT A;  1S1W A;  2JLE A;  3SUQ A;  1HQU A;  4HCB A;  4KTQ A;  4CGD A;  4CEO A;  1QHT A;  4CFB A;  3P1G A;  1B9D A;  4B9M A;  3TAF A;  3FFI A;  4FJ8 A;  3AVF A;  4G1Q A;  4FLX A;  4DFM A;  4I9Q A;  3A2F A;  1WSG A;  3SYZ A;  1WSJ A;  2ETJ A;  2RN2 A;  3ZT3 A;  4CF8 A;  3DRS A;  4BAC A;  3QNO A;  1SKR A;  1L3V A;  4JLH A;  5C42 A;  4OKK A;  4JS5 A;  3TAG A;  1L5U A;  4KTW A;  3S9H A;  2XHB A;  4KI4 A;  1YT3 A;  3AA3 A;  4DQI A;  5SZT A;  4PUO A;  1RT4 A;  4CER A;  4KO0 A;  4DS4 A;  4CJU A;  1XC9 A;  3TAE A;  3IRX A;  3SJJ A;  4LD0 A;  3P83 D;  4M3U A;  3LAN A;  1VSJ A;  4KI6 A;  1ZBH A;  4LH4 A;  1RCH A;  4NCG A;  3SPY A;  1L3U A;  5KI6 A;  1KSP A;  3K2P A;  2YNF A;  1LWF A;  3LP3 A;  3OS2 A;  1BIZ A;  1JL2 A;  1BI4 A;  4M3Z A;  1VSH A;  3T19 A;  3TAB A;  3S3N A;  1X9W A;  1QSS A;  1VSI A;  2XY6 A;  1C0U A;  4AHU A;  4CHN A;  4KHQ A;  3AO1 A;  4N56 A;  4M42 A;  3HPG A;  4KHU A;  4EZ9 A;  1JKH A;  1MU2 A;  3T3F A;  5HRO A;  3QEV A;  1FKO A;  1KCF A;  4DFP A;  3RMB A;  3NDK A;  4HUF A;  3HK2 A;  3HPO A;  4IFY A;  3AV9 A;  4HHT A;  3NH2 A;  1U4B A;  3MEG A;  4CEB A;  3PX6 A;  5C24 A;  3NHG A;  1S1T A;  3SV4 A;  3QET A;  4HTU A;  1X9M A;  2P1J A;  3LP0 A;  3HM9 A;  4C8O A;  4DSK A;  1W9H A;  3NGY A;  3AA2 A;  4JS4 A;  4K8Z A;  2HHW A;  3OYJ A;  2HHT A;  2ATQ A;  4TSX A;  3RTV A;  1SKS A;  1JLG A;  3CYM A;  4E7J A;  1B92 A;  3WNF A;  1RBU A;  1RT7 A;  3VQ9 A;  1UAX A;  3L2Q A;  1J53 A;  2P5O A;  1GOC A;  3ZSY A;  1DTQ A;  3AVH A;  4E7K A;  3DLH A;  4FM0 A;  1RTD A;  3OYD A;  1CXQ A;  1N6Q A;  4CJT A;  4CES A;  3B6P A;  1HYZ A;  2IC3 A;  2Z1H A;  5HLF A;  4RW4 A;  4O4G A;  3OYF A;  1L3T A;  3KD5 E;  2Z1I A;  1BCO A;  3UIQ A;  3E01 A;  2PYL A;  4GW6 A;  2VG5 A;  4FJ9 A;  3KLI A;  2Y1I A;  2ITG A;  1LW2 A;  2O4I A;  1BQN A;  3CM5 A;  4DU3 A;  4DSJ A;  1KVC A;  2B6A A;  3B6O A;  4HUE A;  4DQQ A;  1JLC A;  3KLF A;  4Q5V A;  3AVK A;  3TAM A;  3VN5 A;  4OLA A;  1VSD A;  3HPH A;  4DSL A;  3SQ0 A;  4LSN A;  3AO4 A;  3DYA A;  4N41 A;  3NBP A;  2D0B A;  2LSN A;  5KRT A;  3AVI A;  3TAR A;  1KFS A;  4F4K A;  4Q0B A;  3K5O A;  2AJQ A;  3QLH A;  3RR7 A;  4FJ5 A;  1DLO A;  1XHZ A;  3KD1 E;  3NE6 A;  4DTO A;  3RRG A;  4CHQ A;  3AVN A;  4CIE A;  2KQ2 A;  3I8D A;  3LAL A;  4DMN A;  1S5J A;  3SQ1 A;  3LAK A;  4CHP A;  4BDY A;  4LSL A;  1XWL A;  4E1M A;  4KRE A;  1QQC A;  2P5G A;  5E41 A;  5FRM A;  3P5J A;  4KPY A;  2KW4 A;  3VQD A;  5CZ1 A;  3AVA A;  4B9S A;  4H4M A;  3V9Z A;  2VG7 A;  2GBZ A;  4DFJ A;  3AA5 X;  1NK4 A;  4J2B A;  1EX4 A;  1NKB A;  4WE1 A;  1VSM A;  4NCB A;  1GOB A;  4CIG A;  3HL8 A;  4CEQ A;  4FM1 A;  1N5Y A;  3KK1 A;  3DLG A;  1HRH A;  2FBT A;  3HVT A;  3KKR A;  3OYH A;  3M8R A;  3O3F A;  1J5O A;  4FZZ A;  1XI1 A;  3VQ4 A;  2HW3 A;  3LZI A;  4HUG A;  3BDP A;  3VA0 A;  3SPZ A;  3DOL A;  5EU7 A;  4K8X A;  4FW1 A;  2RPI A;  3QEP A;  4FK0 A;  3AO2 A;  3WNG A;  3LWM A;  1HYS A;  1RDA A;  4JRQ A;  3S3O A;  1T03 A;  1HQE A;  4OVL A;  2G8F A;  4N76 A;  1FXX A;  5KGX A;  2Z1J A;  4B08 A;  2DY4 A;  3SV3 A;  4FLY A;  4E0D A;  3MED A;  1NJX A;  4FJH A;  3VQE A;  2OPQ A;  3SI6 A;  4FJI A;  2OZS A;  4QOZ B;  3DMJ A;  3SZ2 A;  4B9T A;  4IDK A;  5K14 A;  4YNQ A;  4FLW A;  2FBX A;  2A1S A;  4W5R A;  4RG8 A;  3IAY A;  3NF7 A;  4J2A A;  4DTM A;  4CCH A;  4B9N A;  2FBY A;  1R0A A;  1U47 A;  4CJE A;  3K5L A;  3VQP A;  4E89 A;  3QIP A;  1BHL A;  3M8P A;  4MFB A;  4FK4 A;  3L3V A;  4CF1 A;  2BDP A;  2B5J A;  3OY9 A;  1SL1 A;  3I0R A;  2W42 A;  4C8N A;  1D5A A;  2G8I A;  3C94 A;  4ELU A;  1BIS A;  4GVM A;  3C6U A;  3D45 A;  5T7B A;  3OYC A;  1IO2 A;  2G8W A;  3LP1 A;  3MEC A;  3CFO A;  3V81 A;  5J2M A;  4FLU A;  1B9F A;  4DF4 A;  1C1A A;  1T8E A;  2DFH A;  3VQ7 A;  4DG1 A;  2F8S A;  3OYI A;  2Y1J A;  3L2V A;  1QS4 A;  4Z4C A;  2YKN A;  3ZSR A;  4CJS A;  1RDC A;  4CFC A;  1NJW A;  1RTI A;  2Q3S A;  2OPS A;  1DTT A;  3V9W A;  3D0P A;  5I42 A;  3V9S A;  3CQ8 A;  1ZYQ A;  4LY7 A;  4KHY A;  3TAP A;  3ZT0 A;  3PX4 A;  3ULD A;  4FLV A;  3OVN A;  3DLE A;  3O3H A;  3CFP A;  1WSE A;  1WSH A;  3ZT2 A;  3OYM A;  2HHS A;  2KZM A;  1YTA A;  3ZSZ A;  1KTQ A;  2X6N A;  3OYA A;  1TKD A;  1VK0 A;  4IG3 A;  2Z1G A;  3HVR A;  2WOM A;  2YNH A;  4FJN A;  4OLB A;  2FC0 A;  1F21 A;  4CHZ A;  1NKC A;  4DWI A;  3F9K A;  4RW7 A;  3RMC A;  4FW2 A;  3TWH A;  4ZTJ A;  3RMA A;  4KAZ A;  4NYF A;  3KIO A;  5KTQ A;  3M8S A;  4DSE A;  3ZSW A;  3O4Q A;  3WNH A;  1JXB A;  2JGU A;  2OPP A;  1WSF A;  4DTX A;  3LWL A;  4Z4H A;  1TK8 A;  3HJF A;  2KTQ A;  1TKT A;  2HHX A;  2DTU A;  3QEW A;  1KLN A;  1G15 A;  3K5M A;  3RWU A;  3U6F A;  4BDZ A;  4IBN A;  4CF0 A;  1KLM A;  3ZSV A;  4O55 A;  1T05 A;  3AVL A;  3HP9 A;  1KRP A;  3RR8 A;  4CK2 A;  3G10 A;  2HB5 A;  4KB0 A;  4FK2 A;  3NF9 A;  4CEZ A;  3VQQ A;  5FRN A;  1X9S A;  2WON A;  3OYN A;  4W5Q A;  4B8C A;  1U04 A;  1A5V A;  4DTN A;  1RDD A;  2BE2 A;  2OPR A;  1NK7 A;  3NCI A;  3L2W A;  1IH7 A;  1NK5 A;  2PY5 A;  2OYQ A;  3PO5 A;  5FRO A;  2XRI A;  4B9V A;  4CGG A;  3MXI A;  1RT6 A;  4AHV A;  3K57 A;  4E7H A;  4ID5 A;  2HHV A;  3F73 A;  4W5N A;  1JXE A;  3AO5 A;  2HNY A;  3L3U A;  1HYV A;  3LPU A;  1QSL A;  3NAE A;  1JLB A;  2E6M A;  1CZB A;  2GV9 A;  2ZQB A;  4B8A B;  1C1B A;  1RDB A;  3SUO A;  2PZS A;  1S9G A;  3G0Z A;  4HCC A;  1A5X A;  1W0H A;  1VRU A;  2YNG A;  4IFV A;  1QSY A;  4E3S A;  2F8T A;  4XIU A;  3AVJ A;  4BWJ A;  3VQC A;  1RBR A;  1ASV A;  5DK5 A;  4AHC A;  4CGJ A;  4I2P A;  4CK3 A;  2HND A;  4OGC A;  4R5P A;  3NH1 A;  4DLG A;  3L2R A;  3KK3 A;  1C1C A;  3V9X A;  3ASM A;  1RNH A;  3V9U A;  2IOC A;  1TAU A;  2F96 A;  5CZ2 A;  4FM2 A;  4CJ3 A;  1HMV A;  2GUI A;  2IDO A;  5JS2 A;  4CJW A;  4CEF A;  4CJV A;  1RIL A;  4B9U A;  4HVJ A;  1NOZ A;  3TR8 A;  4GMJ B;  4FJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...