3VQAA

Hiv-1 in core domain in complex with 1-benzothiophen-6-amine 1,1-dioxide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
152
structure length
141
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
total genus 52
structure length 141
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqaA00
4DSFA 3B6OA 1T7PA 3RR7A 4KHSA 3L2QA 1ASWA 1QE1A 4CEBA 4KPYA 1DLOA 4BDZA 3V9SA 4B9MA 3C94A 2RF2A 2XO7A 2OA8A 4B3OA 3IAYA 3RR8A 1NK5A 1KVBA 1U04A 3ZCMA 4CJPA 4J2DA 2DFHA 1VSMA 4CIEA 4CHQA 3QETA 4ELUA 1D5AA 4CGFA 1S9GA 3P83D 3HXMA 4C8MA 3JSMA 3MEDA 4F2SA 2YV0X 1VSJA 2VG5A 2X6NA 5KRTA 4CEAA 5FDLA 2EX3A 3MAQA 2HHUA 3AA2A 2YHAA 3ZSWA 2E6MA 2HVHA 5SZTA 4DS5A 1JLBA 3V9WA 3HPGA 2HHQA 3QNOA 1S6PA 4DG1A 3OJUA 4BWJA 1LV5A 4CF1A 4DFKA 2G8UA 4E0DA 4RG8A 4OKKA 2R7YA 4OKJA 4AHSA 4DFMA 1LWFA 4CF9A 4BE0A 4GW6A 4FZZA 2HHTA 1NKEA 3IG1A 2RKIA 4H4OA 4OGCA 1RBTA 4PA1A 5C42A 3NAEA 1HYZA 3RMCA 1TV6A 1U47A 1X9WA 2D0CA 2PY5A 4LSNA 3U3GA 5KI6A 3ISNC 4CEFA 5CZ1A 1VSFA 3KD5E 1SUQA 1C0MA 2DFFA 3M8PA 3V81A 1SL1A 3KLGA 4ZTJA 4Z4FA 3OYMA 4FLVA 3M8RA 5DK5A 2O4GA 4FW2A 5CY4A 4M41A 3SJJA 3RTVA 1SV5A 1ZBFA 5FRNA 1UWBA 2XRIA 3NH2A 2YKNA 1KFSA 3U3YA 4FZXC 3A2FA 5KGWA 1F21A 1QQCA 4B08A 2I5JA 3ZSYA 4BE2A 3DRRA 4Q5VA 3NF6A 4B9UA 2XY6A 3SQ2A 3S9HA 4DQIA 1S5JA 4KO0A 1ASVA 2JLEA 3ASMA 3ZT2A 2G8VA 4GMJB 1HNIA 1B9DA 1IKXA 4FK2A 2WOMA 5HBMA 3PO4A 4NYFA 4FLTA 5HRSA 3ZSRA 4ELVA 4Z4IA 3H08A 3SNNA 3BDPA 1XWLA 4FVMA 1B9FA 3SZ2A 2DY4A 4B9LA 3L2VA 4AHVA 4KAZA 4CK1A 4DTOA 3VN5A 3LZJA 4AH9A 2LSNA 4MQ3A 3KLFA 1NOZA 4F2RA 2HHWA 3CFPA 4E7JA 1HNVA 4OLBA 2X74A 1BGXT 3LZIA 1BQNA 4RW9A 4B8AB 3V9XA 1C1CA 3TAMA 1JL1A 1Q9YA 4O55A 2X78A 1RBVA 4FJLA 4E19A 2KFNA 1RILA 1TL3A 1UAXA 3FFIA 4LH4A 4FW1A 1FXXA 3OYGA 3KLHA 3O3GA 3NCIA 4N5SA 2RN2A 2Q3SA 3ULDA 1J9AA 3QEPA 3L2RA 4DTRA 2G8HA 4NYNA 4DSEA 3RWUA 4E89A 2VWJA 1UOCA 1J53A 3HP6A 3KJVA 4Z4GA 3QO9A 3QEVA 3QEXA 1QSYA 1BI4B 1W0HA 2X6SA 3E01A 3K5MA 3VA0A 3CM6A 4AILC 4FJGA 3VQPA 4B9NA 1BL3A 4M3TA 4ID1A 1TAUA 1X9MA 2FC0A 2P5OA 1KVCA 4FK0A 4BE1A 1RT5A 4KI6A 4OJRA 1VSLA 4HUEA 3THVA 4CERA 4FLUA 4O4GA 4DTNA 3M8QA 2Y1JA 3ZSXA 1ZBUA 2HMIA 1D9DA 3ZSVA 4DF8A 4M42A 3TAQA 1MU2A 2DFEA 1L3SA 1TK5A 2HNZA 5K14A 3RRHA 4UQGA 3CG7A 1NJWA 4CEZA 5HP1A 4O5BA 4CJFA 2YNFA 2PYJA 1SKRA 5FRMA 2IC3A 4FJ5A 1RTDA 1TGOA 2OYQA 1HYSA 1EX4A 2OPRA 4C8LA 3O4NA 4E7LA 2HVIA 4KHQA 2KZZA 2QKBA 4RW8A 4CJ3A 4IFVA 2YKMA 3DRSA 1RCHA 3LDSA 5J2MA 4JS4A 3VQ6A 3TAEA 4CFAA 1RDCA 4FJJA 4CJVA 1WNSA 4IFYA 4IG0A 4EP4A 1TAQA 3RMAA 1VK0A 5FROA 1NK9A 1YT3A 4F3TA 4CECA 2HNYA 2ZQBA 1A5XA 4C8NA 1Q8IA 3OS0A 4CJLA 1S1VA 1VSKA 3C95A 3CQ8A 3DYAA 4FM0A 4HUFA 3SQ1A 1TL1A 1R0AA 4IKFA 3V6DA 5SWMA 4E7IA 1WSJA 1IKYA 3QIPA 1DTTA 4M3ZA 4KB0A 3JYTA 3B6PA 3TR8A 2BGGA 4F8RA 4BACA 1ITGA 1C0UA 3IS9A 4CHNA 3AVNA 3AO3A 3AVKA 1LAVA 4CEOA 3K2PA 4K8ZA 2E4LA 3C6TA 4CIGA 3SV4A 3VQ5A 3L3UA 3WNHA 3EY1A 2P1JA 4H8KA 1TVRA 4KI4A 4M3YA 3VQQA 5HRNA 3U6FA 1C6VA 4CJTA 4RW4A 3LAMA 3ZT1A 1QS4A 4KV8A 2GUIA 3DOKA 3PUFA 1S6QA 1WSHA 2ITGA 5CZ2A 2WONA 1SL0A 1IKVA 3HK2A 1UA1A 4M45A 4E7HA 3VQ9A 4CJRA 4FJXA 4N76A 2HB5A 3OJSA 4Q0BA 2P51A 3KKSA 4KKOA 4W5OA 3S3MA 4FLZA 2IOCA 4N41A 1WLJA 2G8WA 3KD1E 1IO2A 1VSDA 4PY5A 1U45A 2QK9A 4CF0A 1LW0A 4OPKA 2KTQA 3O4QA 4DQRA 3OS1A 3KK1A 1Q9XA 3CFRA 4KREA 4W5NA 4M3RA 3OYNA 3OYBA 1RT6A 4E1NA 4ZHRA 3HPOA 4HUGA 2F8TA 4WE1A 4CGDA 4LY7A 3L2WA 1RBUA 4RW7A 2OPQA 4DTUA 3MEGA 4FJKA 4Z4HA 4FM1A 1BCOA 1XI1A 1WN7A 3VQEA 4PUOA 4FLYA 3VA3A 1QTMA 1VSIA 4HTUA 2HHSA 2G8KA 1KLMA 4KTQA 1GOAA 3C6UA 1FKPA 2B6AA 4MFBA 4AHUA 4QAGA 1A5WA 3D45A 4OPJA 3TWHA 3DLHA 2IS3A 4G1QA 4BWMA 3NHGA 5JS2A 3VQDA 1WSEA 4W5QA 3NFAA 3AVCA 1TKZA 1JLAA 3V1RA 4CHPA 1BHLA 1HPZA 3NDKA 3NGZA 3SUNA 1NK4A 2E6LA 1QSLA 4DSKA 3K58A 1JLQA 1X1PA 1JL2A 3AVGA 2YNHA 5HROA 1KLNA 4FJNA 4M3XA 4DU3A 4CGIA 3QEWA 4KHUA 5J1EA 4IG3A 1RT2A 2P5GA 4FZYA 3OYLA 2A1RA 3DLRA 3OYCA 3HM9A 3SUOA 1NJXA 1S1UA 4L8RB 5I3UA 1NOYA 5CYMA 4C8KA 3LP2A 3PY8A 3KK3A 4CJ4A 1REVA 2NUBA 3I0RA 4JS5A 4HCCA 3CFOA 2KW4A 2D5RA 3VQ4A 3HYFA 3HT3A 1NKBA 1J54A 2OPPA 3DLEA 3CYMA 3F73A 1RTJA 3TARA 2FBVA 3ZT4A 3AVHA 2O4IA 4DTPA 3SV3A 3HPHA 1RTHA 3NH0A 3SQ4A 1O1WA 1VRUA 3HL8A 5DMRA 2B5JA 1JLFA 4E7KA 2YNIA 4I9QA 3TABA 1LWEA 3LAKA 3VQCA 1S9EA 3EZ5A 2IDOA 3L8BA 1TK8A 1NKCA 4CGGA 4FJHA 1NK6A 1ZBHA 1CLQA 3F9KA 3QESA 3ZT0A 4DQSA 4DSLA 4R5PA 1LW2A 2VG7A 5KTQA 1GOBA 3KLEA 3DI6A 4CHOA 2W42A 3HSTB 4AHCA 4F3OA 5JS1A 3SYZA 1I3AA 2Z1HA 4IBNA 4Z0UA 5J2PA 1NK7A 3KTQA 4DTSA 3ITHA 3AVAA 1DTQA 3K5NA 1WSIA 4CFDA 1NJYA 4PWDA 3OVNA 1CZBA 4OKEA 3OYJA 4CFBA 3KKRA 3AA3A 2Z1IA 2KQ2A 5CYQA 1VSHA 4DF4A 4M3UA 2RPIA 2HHVA 3PX0A 1FKOA 3K5LA 2Z1GA 3SUPA 5KGXA 1QHTA 1C1BA 3ZSOA 4XIUA 3OYAA 1BCMA 4Z4EA 1S1WA 1C1AA 3DLKA 4HHTA 3K5OA 1TK0A 4DTJA 3DOLA 2FBXA 3AVMA 3AA4A 1CXUA 3V1QA 5KRSA 4LD0A 1A5VA 5E41A 3OYFA 4AHTA 3TAFA 3PO5A 4I2PA 1JXBA 3DM2A 1SKSA 3S3NA 1WSGA 4FJ9A 4ZTFA 3ZSQA 2B4JA 3AO2A 4NCBA 4KHNA 3V4IA 1TKTA 3VQ7A 4W5RA 1UA0A 4FXDA 3QIOA 3K59A 2VWKA 3QINA 2BDPA 4OGEA 4I2QA 3DLGA 3NF9A 1ZBLA 1ZBIA 4B9VA 3LPUA 3LWLA 1RT1A 3LPTA 1HYVA 2G8FA 3SPYA 2D0AA 3AVLA 4OLAA 4CCHA 4HCBA 4I7FA 1BQMA 1GOCA 4J2BA 3OS2A 2F8SA 3O3HA 4N56A 4J2AA 2KZMA 1HMVA 2FBTA 1HJRA 3AVIA 4B8CA 1EETA 4CE9A 1JLCA 3NBPA 5I42A 3LP3A 1G15A 4DS4A 1HQUA 2IAJA 1XC9A 1VSEA 4AHRA 1VRTA 3RMDA 3L3VA 3NGYA 4CEQA 1EKEA 4CF2A 1TKDA 3NH1A 1CXQA 3OYEA 2HNDA 3MXJA 4CESA 1Z26A 2YNGA 3DRPA 2XHBA 4EZ6A 1KVAA 1SL2A 3K57A 3L2UA 4PQUA 1RDBA 4KHYA 4CJSA 2HHXA 1NK0A 4CJKA 3AO4A 3QNNA 1WAFA 3M8SA 1KCFA 1S1TA 1LWCA 5J2QA 1LAWA 2VG6A 3OYIA 3NE6A 3NF8A 3NGIA 2JGUA 4FJ7A 2GBZA 2A1SA 4DSJA 1FK9A 4CIFA 1L3VA 3QERA 4DFPA 4CK3A 4FJIA 1Z25A 2ETJA 1SKWA 3TANA 4BDPA 4DMNA 4B9TA 3AV9A 3VQ8A 1KFDA 4Z4CA 3MXMA 3VQBA 1T8EA 3HVRA 2XY5A 3TAPA 3BGRA 4DSIA 2ATQA 3MECA 4W5TA 1T03A 3CM5A 1S1XA 5HRRA 1L3UA 1HRHA 3QEIA 4CGHA 4DU1A 1D9FA 4DLGA 1YVUA 4H4MA 1BISA 4CHYA 4JRQA 4FJ8A 3WNGA 4Y1DA 2ZE2A 1JLGA 1BIUA 4CGJA 3G10A 4FCYA 1XHXA 4EZ9A 1ZYQA 1QSSA 4DLEA 4ICLA 2XY7A 4KTWA 4FJMA 1EP4A 2IGIA 3LWMA 3O3FA 1RDDA 4DQQA 2BANA 3HP9A 4CF8A 3SCXA 4F4KA 3KIOA 4C8OA 2KFZA 1Y97A 3SQ0A 2D0BA 4DFJA 4KFBA 3UIQA 4KB1A 1D8YA 4OVLA 1RTIA 3P5JA 3TAGA 4JLHA 3PX6A 4YNQA 4B9SA 1RT3A 4NCGA 3VQAA 2ZD1A 3KLIA 3AVFA 4K8XA 4QOZB 3OYHA 3AO5A 3I0SA 1HQEA 1RDAA 3ZT3A 3SI6A 3SPZA 1U49A 2HW3A 3LP1A 4DTXA 1U48A 4FK4A 3HVTA 1RBRA 2F96A 3DLBA 3G0ZA 5HLFA 3V9ZA 3S3OA 3HJFA 1T05A 1C0TA 4NCAA 3PV8A 3ZSZA 4KRFA 1U4BA 2GV9A 5HRPA 2PZSA 1J5OA 1RT4A 1KRPA 1W9HA 5D3GA 1JKHA 3OYDA 3NF7A 3LANA 4LSLA 1TKXA 2QKKA 4JRPA 3AVJA 4CJ5A 1WAJA 3EYZA 4FM2A 4CFCA 4E3SA 1BI4A 3OY9A 1K6YA 1IG9A 3P1GA 1NJZA 2Z1JA 3LP0A 1BIZA 3ALYA 3AO1A 4RW6A 1RNHA 3WNFA 3I8DA 3T19A 2PYLA 3QLHA 1EXQA 3T3FA 4O0JA 3T1AA 1YTUA 4DU4A 3PX4A 3WNEA 4M3WA 1NK8A 1JXEA 1XHZA 1IH7A 1N6QA 1B92A 2YHBA 4GVMA 4FLWA 5J2NA 1WSFA 4CJWA 2EHGA 1KTQA 4EP5A 4DTMA 4CK2A 1YTAA 4KTZA 4E1MA 3OYKA 4BDYA 2AJQA 4IDKA 3IRXA 4CHZA 4ID5A 2Y1IA 3TI0A 1KSPA 2DTUA 3AA5X 1JLEA 5C25A 4J2EA 3V1OA 2G8IA 3RMBA 4QCLA 4DQPA 5EU7A 1I39A 4HVJA 3KK2A 4CJQA 1L3TA 1RT7A 4CJUA 4FLXA 1X9SA 2OZSA 4ELTA 1ASUA 4YFUA 3V9UA 1L5UA 4LH5A 4KHWA 2OPSA 2XY8A 4Y1CA 3MXIA 5C24A 1RBSA 3HO1A 2BE2A 4O44A 3RRGA 4CEDA 4CJEA 1IKWA 3SUQA 4CEEA 4FYDA 4N47A 3MEEA 4I9LA 3D0PA 3DMJA 3LALA 4O0IA 1CZ9A 2FBYA 3AVBA 1N5YA 4TSXA 2QXFA 2OZMA 4DWIA 5T7BA
chains in the Genus database with same CATH superfamily
5GADP 3WXMB 1NMNA 4R79A 4I6MA 1YJNN 3ZCMA 4J2DA 4CJPA 4GNIA 4CIEA 4CHQA 5IWAK 3A0IX 4JI8K 2VG5A 4YDUC 5KRTA 4KBOA 5FDLA 2HHUA 4A57A 2E6MA 4H5WA 5SZTA 3TSPA 3QB0A 3CXCM 1S6PA 1VQ4N 1LV5A 2R7YA 3THWA 4BE0A 1NKEA 4KH5A 4OGCA 5C12A 5C42A 4B9TA 3RMCA 4YOTA 2PY5A 4CEFA 3D2EA 2D4WA 3E9OA 3ATVA 3VEZA 3RTVA 5FRNA 4LFCK 1KFSA 3WXKA 4DV7K 1QQCA 4BE2A 4AQYK 4B1ZA 3ZYYX 4IWVA 2WOMA 3PO4A 2P9UA 4FLTA 4Z4IA 3MN7A 1XWLA 2HF3A 3CETA 2DY4A 4KAZA 4AHVA 3LZJA 4H0TB 3KLFA 2F4VK 1ESVA 2ZJRL 2X74A 1BGXT 3MN6A 1P90A 3O9QA 3THXA 4CZHA 3KK7A 1C1CA 1NWKA 4O55A 2CGJA 3QEPA 1J9AA 1MWKA 3HP6A 4DR3K 2KLAA 4BR0A 3MX5A 4AILC 3HRGA 4BR7A 4FJGA 4B9NA 3U9ZA 4ID1A 5M1KA 3G4SN 1VSLA 4O8KA 4CERA 4FWSA 2Y1JA 1ZBUA 4DF8A 4FWPA 1MU2A 2A40A 4A2BA 1HNZK 2O8CA 5K14A 5FPMA 4BGAA 3RRHA 3NVKA 3O9TA 5HP1A 4O5BA 1M90O 1SKRA 2OYQA 1ILYA 1SS6A 1NGCA 3GBTA 3O6WA 4JI7K 3LDSA 3VQ6A 3TAEA 4FJJA 4F3TA 4CD1A 3VEVA 3C95A 4BGBA 4FM0A 4IKFA 3OBYA 3JAMO 5SWMA 1IKYA 3QIPA 1EWQA 3JYTA 3U9DA 4JK8A 1ITGA 3IS9A 3AVNA 3AVKA 3K2PA 4CIGA 5AQSA 4X66K 3L3UA 1JCFA 2CH6A 1TVRA 1C6VA 4CJTA 4RW4A 2HHHK 2V7YA 4YORA 4BRKA 3J7ZO 3VQ9A 4Q0BA 3KKSA 4KKOA 3RSEB 4W5OA 3LDNA 4FOIA 3PIPL 4LF4K 1WOQA 3BZCA 4YHHK 2UYTA 2QW9A 4CF0A 2KTQA 3O4QA 2NNWA 1Q9XA 3KK1A 3CFRA 4IJAA 2WUSA 4E1NA 4ZHRA 2WC9A 2QWRA 3OW2M 3VGLA 2QEXN 3MEGA 4DR2K 3VQEA 4FLYA 3OTOK 4BRNA 3RSEA 2G8KA 4GV6A 1GLEG 3UKRA 4OPJA 3TWHA 3DLHA 1BOTO 5LL6Z 4WQ5C 3NFAA 3AVCA 5AQGA 4CHPA 3SQ4A 1HUXA 3NGZA 2E6LA 1QSLA 4H03B 2YX6A 1X1PA 1JL2A 3VF2A 3QEWA 2P5GA 2UXCK 1OVYA 3SUOA 3C6HA 1V4SA 1NOYA 3LP2A 4BRPA 1J5EK 3CFOA 3VQ4A 4B1UB 2Q2RA 3F73A 4JKDA 4YOXA 2HMPA 4MDAA 2O4IA 2ZGZA 2ITMA 1RTHA 3E1YA 2GEMA 3DJCA 1O1WA 2B5JA 2QM1A 3TABA 3EZ5A 4FJHA 2IDOA 5F2RA 4FL9A 3QESA 3ZT0A 4DQSA 5KTQA 2Q1NA 3DI6A 4CHOA 2W42A 3UKUA 5F1XA 4BQLA 2ZJPL 4F3OA 4DKWA 1XMQK 3A5MC 3KTQA 3AVAA 1YXQA 3D6RA 4CFDA 4WFBL 3THYB 4CVNE 2OCEA 1Z6RA 3OYJA 2HBJA 5KPRA 2KQ2A 3THWB 4DV5K 1N36K 5M1PA 4M3UA 2RPIA 1S1WA 3V1QA 4Y0WA 3PIOL 2PAVA 1A5VA 3VF6A 1TYQB 3KWIA 4IO8A 3UB5A 1JXBA 1SKSA 2Q36A 3WXLA 3CCQN 4ZTFA 1KD1O 3ZSQA 2B4JA 3THYA 3SBGA 1QQNA 4BR9A 4FXDA 3BUZB 3K59A 4OGEA 3DLGA 4QS8A 3NF9A 4MLHA 3LPUA 3LWLA 2G8FA 3SPYA 2D0AA 1ZBSA 1NJIO 4CCHA 3OS2A 3O3HA 4J2AA 2KZMA 1HMVA 2FBTA 3AVIA 3EKUA 1EETA 1JLCA 3MN9A 5CR4A 3CJCA 1VSEA 3L3VA 1Q86O 2CGLA 3OYEA 4DV4K 3C7NA 5AQJA 3L2UA 3SMPA 4CJSA 2HHXA 3OHRA 4JKEA 4PKGA 1E4GT 1IV0A 1IBLK 3MK6A 1LWCA 2VG6A 3OYIA 4CZMA 2RE2A 3NF8A 3NGIA 4FJ7A 5TKYA 4DSJA 2E1ZA 2ETJA 4JNEA 2OTJN 4DMNA 3AV9A 3VQ8A 1IBMK 3CD6N 1W7AA 4AM7A 1EQYA 3R9PA 4OPAA 4IEIA 3CM5A 1S1XA 4JKAA 5HRRA 4CZEA 3QEIA 4CGHA 4DLGA 1YVUA 4H4MA 4CHYA 2UU9K 5AQHA 1BO5O 2ZE2A 1BIUA 3G25A 3HI0A 1KXPA 4ICLA 4DLEA 1S72N 4FJMA 2IGIA 4LF5K 4F4KA 4RTFD 3FLCO 3SQ0A 2D0BA 3LM9A 5KQDA 3P5JA 1RT3A 3CPEA 2ZD1A 3AVFA 4QOZB 1RDAA 3SPZA 5AFUA 1HKBA 3L4IA 4DTXA 1RBRA 2F96A 4CZIA 5HLFA 3S3OA 3PV8A 3ZSZA 5AQOA 1U4BA 4GKJK 1MA9B 1GLAG 3E66A 3OYDA 1MWMA 3EYZA 3P1GA 4IXCA 5LJVA 3AO1A 1RNHA 3WNFA 5HOOA 2V52B 4WQ4C 4A59A 3T3FA 3H1VX 2HBMA 4O8UA 3VF4A 3WNEA 4M3WA 1NK8A 2F7TA 4DV1K 1IH7A 1N6QA 1WSFA 1YVNA 2EHGA 5AQXA 3WXJA 3PSFA 3O9RA 3AGRA 3TI0A 1KSPA 1JLEA 2HSTA 5C25A 4KHPK 3V1OA 2G8IA 3RMBA 4CBUA 3KK2A 2HF4A 3A5OC 2GWJA 1X9SA 3UKRB 4LH5A 1VQ6N 2OPSA 3MXIA 4CD3A 3R6MA 4CZKA 4CJEA 2P9NB 2FBYA 5AQUA 5GINA 3IKMA 4DWIA 5T7BA 1T7PA 4CJ7A 4JAXA 4BVPA 5AQQA 3L2QA 3PLAA 1ASWA 4BY9C 4DHYA 5AQYA 3U8XA 2BUPA 4KPYA 1DLOA 3LDOA 4BDZA 3V9SA 2RF2A 3O9SA 4ILHA 2XO7A 5C2DA 4B3OA 4IJNA 3RR8A 1QHAA 1KVBA 1U04A 2DFHA 3L6QA 3QETA 4ELUA 1D5AA 4CGFA 2P9NA 3HXMA 4C8MA 3JSMA 2EWSA 2YV0X 3QDKA 4DV2K 3IDHA 1HNWK 2YHAA 3HPGA 5B8HA 4RG8A 4OKKA 1RFQA 4AHSA 1LWFA 2QWNA 2HHTA 2RKIA 1X9JA 4H4OA 4PA1A 2GX9A 1U47A 1X9WA 3QBWA 1JJ2M 3ISNC 3SAFA 1SUQA 5AQPA 3M8RA 5DK5A 2O4GA 1Y64A 1ZBFA 2E5LK 1UWBA 2XRIA 3U3YA 3A2FA 4B08A 3ZSYA 4Q5VA 3NF6A 2XY6A 3S9HA 4DQIA 4LF9K 4BRQA 3CCLN 2HVHA 2G8VA 4FK2A 1IKXA 4WQ5A 3LDQA 5HBMA 4NYFA 5HRSA 3ZSRA 4K42A 4ELVA 3SNNA 3L2VA 2LSNA 4MQ3A 4FVUA 1NOZA 1NNEA 3SAGA 1BQNA 3TSQA 4FW1A 1FXXA 3O3GA 4BRIA 2G8HA 3RWUA 2VWJA 1H1VA 1IG8A 5ELZA 5FPNA 4NB4A 1DT9A 4Z4GA 5JVGL 5KPZA 3QEXA 2QWQA 1KC8O 3HOSA 3DLLL 2O8BB 5F0XA 3O80A 2QWPA 2W41A 3VPZA 4M3TA 2ASPA 3IUCA 3THVA 4FLUA 1WUAA 3ZSXA 2HMIA 1FJGK 3ZSVA 1EWRA 1DGKN 3TAQA 1L3SA 2VWBA 3CG7A 4YOWA 4CJFA 4B3SK 2YNFA 3WQUA 3DWLA 2IC3A 2E2PA 3THXB 1EX4A 3CQYA 4C8LA 4E7LA 4RCHA 2HVIA 4KHQA 5EXWA 2QKBA 2A6AA 4DR6K 3DRSA 4JV5K 3K9KA 5J2MA 1E4FT 4CFAA 5BR9A 4IG0A 5FROA 1A5XA 2CH5A 4A61A 3ENBA 3OS0A 1VQ5N 1S1VA 4K25A 3SQ1A 4HUFA 1TL1A 1NU0A 4M3ZA 4KB0A 4FWQA 1KQSM 1GLJO 4DR4K 1LAVA 4CEOA 2E4LA 1J6ZA 2GUPA 4MO4A 3VQ5A 1NGEA 4X62K 1QVFM 4KI4A 3ZX2A 4G9ZA 3CC7N 2D1KA 4KV8A 2GUIA 4DV3K 1S6QA 1WSHA 1QQOA 3HK2A 1ZXOA 2QI2A 3TTFA 4E7HA 4CJRA 4FJXA 4XH1A 1WBDA 4FLZA 3I55N 2G8WA 4A5AA 3J8AA 5BPLA 3WQTA 3T1YK 3HZ6A 2QK9A 4OPKA 4DQRA 4B1VA 4KREA 5EX5A 3HPOA 4XH5A 2O8EA 2F8TA 4LY7A 5GAGP 4DTUA 2KHOA 4PUOA 3VA3A 1QTMA 4KTQA 3FZMA 4H0PA 1JLAA 3NDKA 1HPZA 5C2FA 4V19S 2PFUA 2VGNA 3O9UA 1ATNA 4FJNA 3BF1A 4KHUA 4FZYA 2A1RA 4NLCA 1NJXA 1S1UA 4L8RB 1OVQA 5CYMA 3CI5A 3P4IA 2HOEA 3KK3A 1REVA 2NUBA 2D5RA 1ZC6A 3HYFA 1NKBA 3GOIA 3O8MA 3QFPA 2BTFA 3TARA 2FBVA 2NRVA 3DAWA 3SV3A 5AQRA 3NH0A 1TYQA 1VQKN 2YNIA 1LWEA 2ZGYA 1ZBHA 4B3RK 1TK8A 4ISGA 4CGGA 1NK6A 1YIJN 4DCHA 2HBLA 4AHCA 5JS1A 3SYZA 3HSCA 1OH7A 3TTDA 2Z1HA 5J2PA 4DTSA 5AJ3K 1DTQA 2PBDA 1WSIA 1K8AO 2QWOA 5AQWA 4EIAA 3OVNA 1SQKA 2P9PA 2Z1IA 2FF6A 1YAGA 4AM6A 3W3DA 2Z1GA 3G71N 3SUPA 1N33K 5KGXA 2FSJA 1C1BA 3ZSOA 1O13A 3K5OA 1TK0A 3T69A 2FBXA 3AA4A 3AVMA 3DOLA 1CXUA 4JN4A 3VESA 3MWPA 4YOUA 4I2PA 1MDUB 1HX1A 4NCBA 2ZJQL 1GLDG 2E1YA 1TKTA 3VQ7A 4W5RA 4FOEA 2BDPA 2HBKA 1RDUA 4L3QA 3UKUB 1KAZA 2RHKA 4FWRA 4OLAA 3ULEB 4JHDB 3CJAA 3CHWA 4CE9A 4IO9L 1XC9A 1G15A 1HQUA 3L0QA 1VRTA 5IT9O 4CEQA 3AAQA 3AGKA 1TKDA 1CXQA 3G6EN 2HNDA 3MXJA 2YNGA 1KVAA 4HWIA 4KHYA 2QWMA 2AP1A 1VQON 1NK0A 2E8AA 3QNNA 2CGKA 4DUYK 2NZTA 3H1QA 1HNXK 2JGUA 2A1SA 4GV3A 1FK9A 4CIFA 1L3VA 3O4WA 5GIOA 4DFPA 4FJIA 1Z25A 3TANA 4CZLA 3ZLJA 1KFDA 4Z4CA 3LDLA 4B1XB 1DEJA 4IOXA 3BGRA 2ATQA 3MECA 1L3UA 4FJ8A 3FFKB 3WNGA 4GKKK 2WFBA 4CGJA 1D4XA 3CCRN 3WUHA 1S22A 4BVOA 1QSSA 4KTWA 2UXBK 2BANA 4CF8A 2KFZA 4KB1A 4DFJA 4KFBA 1GLBG 1RTIA 3PX6A 3DXMA 4NCGA 4WCEL 1YITN 5M1FA 3AO5A 3I0SA 1HQEA 3ZT3A 1U49A 2HW3A 3LP1A 1U48A 3WEEB 5AZJB 4FO0A 5M1NA 5LY3A 1V4TA 3V9ZA 3HJFA 3S41A 4NCAA 4H5TA 1VHXA 2GV9A 1J5OA 2IVOA 5D3GA 1JKHA 1NGJA 5DM6L 2O8DA 4YOVA 4RWTA 3EN9A 4CFCA 1SAZA 4E3SA 5AZIA 3DXMB 1BI4A 3H3OB 4H0XB 1NJZA 2Z1JA 3LP0A 1BIZA 4DV0K 4O0JA 3T1AA 1QVGM 3VEWA 3PX4A 5BREA 2E20A 1XHZA 3SLCA 1HLUA 4DV6K 2O8BA 3QFUA 1YTAA 4WYBA 4CHZA 4ID5A 2DTUA 4ISEA 3AA5X 3D7EO 3C6AA 5BR8K 4QCLA 1I39A 2OZSA 3V9UA 4YY3K 4Y1CA 4CZJA 3RRGA 1ATSA 3SUQA 4CEEA 4N47A 3MEEA 3DMJA 1CZ9A 3AVBA 4CZFA 1YHQN 4DSFA 3B6OA 3RR7A 5FPEA 4KHSA 4JI3K 5C0YA 1QE1A 4PHTX 2NRTA 4CEBA 4A62A 4B9MA 1C0GA 2UUCK 2OA8A 5AQVA 3WT0A 5BRFA 3BEXA 4JKHA 1VSMA 2P9LB 4F2SA 1VSJA 2X6NA 3ZSWA 1JLBA 2E2NA 3V9WA 2HHQA 1T44A 3QNOA 4E0DA 3QICA 4BWJA 2O8FB 4DFKA 4IOCL 2G8UA 2F9TA 4OKJA 4CF9A 4FZZA 4GW6A 4JK7A 3FR0A 5CHIA 3IG1A 3NAEA 1RBTA 1TV6A 3OBWA 3U3GA 3KD5E 5CZ1A 4FWNA 1C0MA 1SL1A 4Z4FA 4FLVA 3GL1A 4FW2A 4M41A 3SJJA 1SV5A 4OO1J 2YKNA 2NRXA 2O8CB 5KGWA 4YOYA 2I5JA 3DRRA 1S5JA 1QZ5A 4KO0A 1ASVA 1LOTB 3ASMA 3ZT2A 1YJWN 4GMJB 4H5RA 3VGKA 1KAXA 5GAEP 3H08A 3BDPA 5EOYA 3SZ2A 4I6MB 4B9LA 3CIPA 3VN5A 4FSVA 4AH9A 2HHWA 4E7JA 2Q97A 2P9SA 4OLBA 3ID6A 5EVZA 3LZIA 4RW9A 3V9XA 5DM7L 3TAMA 1WB9A 1Q9YA 5AQLA 1RBVA 3UE5A 1RILA 1UAXA 4LH4A 2I7NA 2Q3SA 3L2RA 4DTRA 1NM1A 1BUPA 4E89A 3A8YA 2GELA 3H46O 4NXNK 4QS7A 3KJVA 3QEVA 1BI4B 1W0HA 2X6SA 1TUYA 1BL3A 1GLFO 4FK0A 1KVCA 4BE1A 5EY4A 1YI2N 3AARA 4HUEA 4DTNA 2YI1A 2P9IA 2DFEA 2HNZA 1NJWA 4CEZA 1OKJA 1RTDA 1TGOA 2FF3B 2P9UB 2OPRA 2KZZA 1BWFO 4RW8A 4CJ3A 2WTUA 4BREA 3CMAN 4JS4A 1EO1A 1RDCA 4IFYA 3RMAA 3HTVA 1IJJA 1YT3A 4CECA 5E84A 4C8NA 1Q8IA 3CQ8A 3DYAA 1BA1A 3V6DA 4E7IA 1WSJA 1DTTA 5AFUH 3B6PA 2QWLA 3SAHA 2GTDA 2NRWA 3M5RA 3SBTA 4BACA 1VQPN 4F8RA 2O8EB 4CHNA 3D2EB 2A5XA 5BPMA 3CCSN 3CC2N 3P38A 2P1JA 4M7YA 3VQQA 3EEQA 3MWTA 3J81O 3LAMA 3ZT1A 3CCJN 3PUFA 4PKIA 5CZ2A 4BG9A 2WONA 1IKVA 3HBTA 1UA1A 5I9EB 4M45A 1VQLN 2HB5A 2P51A 5CE3A 2IOCA 3EZWA 4MO5A 3I33A 4N41A 1XMOK 3ATUA 1IO2A 3TTCA 3GE1A 4K43A 4A5BA 4NO7A 4AF1A 1VSDA 4PY5A 1U45A 2IIRA 2YJEA 3O1BA 3OS1A 5BN9A 3WXIA 2FSNA 1RT6A 3KWGA 4HUGA 3L2WA 4RW7A 2V51B 4JKCA 4GY2B 4Z4HA 4FJKA 1BCOA 1XI1A 3ZX0A 1VSIA 4HTUA 1KLMA 4X65K 1GOAA 4AHUA 2B6AA 4MFBA 4QAGA 1A5WA 3D45A 2IS3A 4G1QA 4BWMA 3NHGA 3VQDA 2F9WA 3V1RA 1U6ZA 3C7NB 2NRHA 4JK9A 4WQ4A 1JCGA 1JLQA 3AVGA 4XEIA 4BRGA 4EAHD 1K8KB 1KLNA 3CJ9A 2ASOA 5BRHA 4DU3A 3N4QA 4CGIA 1RT2A 2P9IB 3JS6A 3BY5A 1NMDA 3DLRA 3HM9A 4O5FA 5I3UA 3KHYA 4C8KA 3PY8A 3I0RA 4HCCA 2KW4A 2P9PB 2D0PA 1J54A 2YJFA 3CYMA 1RTJA 4J8FA 3ZT4A 3AVHA 4BRLA 1U2VB 5H1SQ 4Z94A 1VRUA 5DMRA 1JLFA 3VMFB 4DQ8A 3LAKA 1NKCA 4MDBA 3A5NC 5FLXO 4DSLA 5LMNK 4R5PA 3KLEA 3CQXA 3FZHA 3AY9A 2H3GX 4IBNA 4Z0UA 1NK7A 3ITHA 3A5LC 1T6DA 3EE9A 4OKEA 1BU6O 4A2AA 2E88A 3P39A 4BQZA 1VSHA 5CYQA 4DF4A 1BCMA 1C1AA 4DTJA 3MN5A 2QXLA 1SZ2A 4LD0A 5E41A 3OYFA 4X64K 1WSGA 2JWKA 3KVGA 3V4IA 2VWKA 4I2QA 1Q81O 4B9VA 2P9KA 3AVLA 1DKGD 4JKGA 3EKSA 1BQMA 1GOCA 4J2BA 4H0VB 2F8SA 4N56A 3CMEN 5I42A 3FGUA 4DS4A 2IAJA 1IBKK 3NGYA 4CF2A 1EKEA 3NH1A 4CESA 1Z26A 3DXKB 4BRDA 4EZ6A 1RDBA 4LF6K 3CCMN 4CJKA 1HKCA 2OANA 3SMSA 5KPTA 1BDGA 4BR4A 1WAFA 1S1TA 2W6KA 3HM8A 5J2QA 2VQFK 1LAWA 1X3MA 4H0YB 3ZX3A 3F2KA 3MCAB 4U67L 3OA9A 4CK3A 1VQNN 1SKWA 4BDPA 3E9PA 3MXMA 1T6CA 3VQBA 1T8EA 3HVRA 3VOVA 3TAPA 2YCHA 4BG8A 5AQKA 4IDHA 4DU1A 3IFRA 3O1WA 2BH1A 3CPWM 4JD2A 4JKGB 4FCYA 1NGGA 1Q82O 1XHXA 1ZYQA 3Q7CA 3VENA 1CZAN 1EP4A 3O3FA 4HTLA 1RDDA 2W6LA 3HP9A 3SCXA 4FWMA 3FZFA 3UIQA 1RGIA 3FZKA 1YUWA 3TAGA 4YNQA 4B9SA 3VEOA 3MCPA 4FWOA 3KLIA 4K8XA 3J7AP 4BC5A 4JD2B 3Q7BA 4FK4A 3HVTA 3G0ZA 1XQSC 1NBWA 1T05A 1C0TA 4KRFA 5HRPA 4KH4A 1RT4A 1KRPA 5KQ8A 3NF7A 4LSLA 1TKXA 4JRPA 4CJ5A 1GLCG 1VQMN 1N34K 3C65A 3W0LA 5AQNA 1ATRA 3ALYA 4RW6A 3I8DA 4B1YB 3QLHA 4CI6A 1TUUA 3BP8A 3J80O 4IZ9A 4JI4K 1JXEA 2FXUA 4M7XA 4JI6K 4GVMA 4FLWA 4CJWA 4EHUA 1VQ8N 1KTQA 3KZBA 4EP5A 2ZF5O 4E1MA 4KTZA 3F9MA 3OYKA 2AJQA 4IDKA 3DXKA 3WEEA 4BC2A 4DQPA 2VGMA 1RT7A 4FLXA 4ELTA 1ASUA 4JYAK 1L5UA 4KHWA 3K0SA 2O8DB 2XY8A 5C24A 1RBSA 2BE2A 5AZIB 3R8EA 1IKWA 4FYDA 4I9LA 3H6EA 3LALA 1N5YA 5JMVA 4TSXA 4C1NK 4JI2K 4M63C 3EE8A 1W2BM 2FLOA 3C94A 3IAYA 3CJ1A 1NK5A 2VQEK 2KKZA 3PSIA 1S9GA 3P83D 3VEYA 3MEDA 1NGBA 4CEAA 2EX3A 3MAQA 3AA2A 4DS5A 4BROA 4DG1A 3OJUA 4CF1A 2YHXA 2P9SB 2A42A 4LF7K 4DFMA 3VTIA 1OH5A 2Q0UA 3B8AX 1HYZA 2D0CA 3TU5A 3E9LA 4LSNA 5KI6A 1K73O 1VSFA 2DFFA 3M8PA 3C0BA 2QA4N 3V81A 3KLGA 4ZTJA 4LFBK 2E2OA 4BC4A 3OYMA 5CY4A 1FW6A 3NH2A 4JI0K 1HKGA 3K9JA 4FZXC 3QMLA 1F21A 4EFHA 4WF9L 4BRCA 3FE1A 4B9UA 3SQ2A 2Q31A 2JLEA 1HNIA 1B9DA 4MLEA 4FWKA 4KH6A 1E3MA 2A41A 1BG3A 3SK3A 4FVMA 1B9FA 4XH4A 2ZM6K 4CK1A 4DTOA 4F2RA 3CFPA 1HNVA 1HPMA 2AA4A 4B8AB 2YHYA 1JL1A 4JI1K 4FJLA 2X78A 4E19A 5C15A 3RVCA 3CF5L 2KFNA 1TL3A 3KLHA 3FFIA 3NCIA 3OYGA 2UXDK 3ULDA 1W97L 4N5SA 2RN2A 1K8KA 4NYNA 4DSEA 1VAZA 1UOCA 1J53A 4FPAA 3QO9A 1QSYA 3VA0A 3E01A 3K5MA 3CM6A 1GLLO 3VQPA 1TAUA 1X9MA 2FC0A 4PL7A 2P5OA 1RT5A 3ZEUB 3AAPA 4OJRA 4KI6A 4LF8K 4FPBA 3CERA 4O4GA 3M8QA 1D9DA 4B3MK 4M42A 1NGAA 1TK5A 4UQGA 1Q18A 2PYJA 5FRMA 4FJ5A 1HYSA 1HR0K 2W40A 3HOTA 3O4NA 3R1XA 4IFVA 3O08A 2YKMA 5C10A 1RCHA 1XC3A 4CJVA 1WNSA 4EP4A 1NK9A 1TAQA 1VK0A 4WFNL 2HNYA 2ZQBA 3ENHA 5HL7L 3VETA 4CJLA 1VSKA 1R0AA 2JWLA 3ZETB 2ZWHA 2BGGA 2NRZA 3TR8A 3O5BA 5AQTA 1C0UA 4CBWA 3AO3A 4BR2A 5JLFA 4K8ZA 3C6TA 3SV4A 1R59O 3VTHA 3EY1A 3WNHA 4H8KA 4M3YA 2O8FA 5HRNA 3U6FA 3R3LA 5AQFA 1QS4A 1K9MO 3LL3A 3DOKA 4IFEA 2ITGA 1SL0A 2OTLN 1NGDA 4N76A 4DR5K 3OJSA 3S3MA 3CC4N 3CJ7A 2I7PA 1WLJA 4BC3A 3KD1E 1N32K 1NGHA 1VQ9N 3M3ZA 1LW0A 5AQZA 4W5NA 4M3RA 3M6GA 3OYNA 3OYBA 3P31A 4WE1A 4CGDA 1YF5L 1RBUA 1N8RO 2OPQA 4FM1A 1WN7A 3BF3A 5ADXA 2HHSA 3I8BA 5MLCQ 4PKHA 1FKPA 3C6UA 1U2VA 5AQIA 5JS2A 1WSEA 4W5QA 4OPHA 1TKZA 3SUNA 1BHLA 1NK4A 3JXUA 2YHWA 4DSKA 1QZ6A 3K58A 3I56N 2YNHA 5HROA 1M1KO 4M3XA 3QBXA 5J1EA 4IG3A 5AR0A 3OYLA 5AQMA 1NG9A 3MX2A 3OYCA 1HJOA 2VYPA 4BRAA 3TPQA 4H5NA 4WFAL 1XNRK 4BRHA 2VCPA 5E26A 3D2FA 3NMUA 4CJ4A 4JS5A 4B1WB 3CCEN 3HT3A 1QQMA 2OPPA 3DLEA 4K41A 4U7BA 3CJBA 4F9OA 4DTPA 3HPHA 3EO3A 5JICA 4K0KK 3HL8A 4E7KA 4DUZK 4I9QA 5AZJA 3VQCA 4ILGB 1S9EA 5M1OA 3L8BA 3U4LA 1CLQA 3F9KA 1LW2A 2VG7A 1GOBA 1NLVA 3HSTB 4NLBA 2IVNA 1I3AA 1NGIA 3H45C 3FZLA 4H0OA 3VERA 1NJYA 3K5NA 4PWDA 3T7ZA 1CZBA 4CFBA 3KKRA 1BA0A 2D0OA 3AA3A 3TSUA 3MDQA 1XNQK 4CZGA 2HHVA 5JLHA 1FKOA 3PX0A 3K5LA 1Q7YO 1QHTA 4XIUA 1C0FA 3OYAA 4Z4EA 5BRDA 3DLKA 3GG4A 5JVHL 5BN8A 4HHTA 4NXMK 3VEXA 5BPNA 3D2FB 4FWLA 5M1QA 5KRSA 3PO5A 3TAFA 4AHTA 3DM2A 4QS9A 3LDPA 3L4QA 3S3NA 4FJ9A 4ISFA 3AO2A 4KHNA 1RDWX 1UA0A 3QIOA 3QINA 1LCUA 5A2QO 4IOAL 1T3VA 1NGFA 1ZBLA 1ZBIA 3ENOA 1RT1A 3LPTA 1HYVA 4HCBA 4E1JA 4I7FA 4UY8O 4B8CA 1HJRA 3NBPA 4JEPA 3LP3A 4AHRA 3RMDA 4LC9B 5LJWA 2QTDA 2UUBK 3DRPA 2XHBA 1SL2A 3K57A 4PQUA 3AO4A 2E2QA 4PL8A 2A3ZA 3NVMA 3M8SA 1KCFA 3ULEA 1S3XA 1OH6A 4OX9K 4JHDA 3NE6A 5ADXH 2GBZA 3F5TA 4CBXA 1G99A 3QERA 3ZEUA 2P9KB 4GVEA 3J7YP 3M1FA 2XY5A 2J4RA 1X3NA 4DSIA 4W5TA 1T03A 1HRHA 3T1HK 2NRRA 1D9FA 3CCUN 1BISA 4IEEA 4JRQA 4Y1DA 1JLGA 3G10A 4EZ9A 3IMXA 2XY7A 2WBNA 2FSKA 3LWMA 4EHTA 1JCEA 4H5VA 1WBBA 4DQQA 1I94K 3KIOA 4C8OA 4GV9A 1Y97A 4B9QA 3CCVN 1YJ9N 1P8ZA 1D8YA 4OVLA 2DPNA 4JLHA 3VQAA 3ZETA 4YDUA 2Q0RA 3OYHA 3SI6A 3H3NO 2NLXA 3DLBA 3MMVA 4JKFA 3N4PA 3EL2A 5GAHP 2GWKA 2PZSA 1W9HA 3LANA 2QKKA 3AVJA 4BR5A 1WAJA 4FM2A 4ILJA 3OY9A 1K6YA 4DR1K 1IG9A 5GIPA 4BRFA 2PYLA 3T19A 1VQ7N 1EXQA 3SJHA 3VGMA 1YTUA 4DU4A 4C1NI 5TKWA 5LMUK 2IVPA 1KAYA 1B92A 2YHBA 5J2NA 4DR7K 2UUAK 4DTMA 2ASMA 4JKBA 4CK2A 4BDYA 4CW7B 3IRXA 1OH8A 2Y1IA 4B3TK 4LFAK 4J2EA 2V7ZA 4DB3A 3GDQA 3ID8A 5EU7A 4HVJA 4CJQA 1L3TA 4CJUA 4YFUA 4BRMA 1Z05A 1XUPO 2P9LA 4C23A 3HO1A 4O44A 4CEDA 3LM2A 3D0PA 4O0IA 4JI5K 2QXFA 5FPDA 2OZMA 3BZKA
chains in the Genus database with same CATH topology
4DSFA 3B6OA 1T7PA 3RR7A 4KHSA 3L2QA 1ASWA 1QE1A 4CEBA 4KPYA 1DLOA 4BDZA 3V9SA 4B9MA 3C94A 2RF2A 2XO7A 2OA8A 4B3OA 3IAYA 3RR8A 1NK5A 1KVBA 1U04A 3ZCMA 4CJPA 4J2DA 2DFHA 1VSMA 4CIEA 4CHQA 3QETA 4ELUA 1D5AA 4CGFA 1S9GA 3P83D 3HXMA 4C8MA 3JSMA 3MEDA 4F2SA 2YV0X 1VSJA 2VG5A 2X6NA 5KRTA 4CEAA 5FDLA 2EX3A 3MAQA 2HHUA 3AA2A 2YHAA 3ZSWA 2E6MA 2HVHA 5SZTA 4DS5A 1JLBA 3V9WA 3HPGA 2HHQA 3QNOA 1S6PA 4DG1A 3OJUA 4BWJA 1LV5A 4CF1A 4DFKA 2G8UA 4E0DA 4RG8A 4OKKA 2R7YA 4OKJA 4AHSA 4DFMA 1LWFA 4CF9A 4BE0A 4GW6A 4FZZA 2HHTA 1NKEA 3IG1A 2RKIA 4H4OA 4OGCA 1RBTA 4PA1A 5C42A 3NAEA 1HYZA 3RMCA 1TV6A 1U47A 1X9WA 2D0CA 2PY5A 4LSNA 3U3GA 5KI6A 3ISNC 4CEFA 5CZ1A 1VSFA 3KD5E 1SUQA 1C0MA 2DFFA 3M8PA 3V81A 1SL1A 3KLGA 4ZTJA 4Z4FA 3OYMA 4FLVA 3M8RA 5DK5A 2O4GA 4FW2A 5CY4A 4M41A 3SJJA 3RTVA 1SV5A 1ZBFA 5FRNA 1UWBA 2XRIA 3NH2A 2YKNA 1KFSA 3U3YA 4FZXC 3A2FA 5KGWA 1F21A 1QQCA 4B08A 2I5JA 3ZSYA 4BE2A 3DRRA 4Q5VA 3NF6A 4B9UA 2XY6A 3SQ2A 3S9HA 4DQIA 1S5JA 4KO0A 1ASVA 2JLEA 3ASMA 3ZT2A 2G8VA 4GMJB 1HNIA 1B9DA 1IKXA 4FK2A 2WOMA 5HBMA 3PO4A 4NYFA 4FLTA 5HRSA 3ZSRA 4ELVA 4Z4IA 3H08A 3SNNA 3BDPA 1XWLA 4FVMA 1B9FA 3SZ2A 2DY4A 4B9LA 3L2VA 4AHVA 4KAZA 4CK1A 4DTOA 3VN5A 3LZJA 4AH9A 2LSNA 4MQ3A 3KLFA 1NOZA 4F2RA 2HHWA 3CFPA 4E7JA 1HNVA 4OLBA 2X74A 1BGXT 3LZIA 1BQNA 4RW9A 4B8AB 3V9XA 1C1CA 3TAMA 1JL1A 1Q9YA 4O55A 2X78A 1RBVA 4FJLA 4E19A 2KFNA 1RILA 1TL3A 1UAXA 3FFIA 4LH4A 4FW1A 1FXXA 3OYGA 3KLHA 3O3GA 3NCIA 4N5SA 2RN2A 2Q3SA 3ULDA 1J9AA 3QEPA 3L2RA 4DTRA 2G8HA 4NYNA 4DSEA 3RWUA 4E89A 2VWJA 1UOCA 1J53A 3HP6A 3KJVA 4Z4GA 3QO9A 3QEVA 3QEXA 1QSYA 1BI4B 1W0HA 2X6SA 3E01A 3K5MA 3VA0A 3CM6A 4AILC 4FJGA 3VQPA 4B9NA 1BL3A 4M3TA 4ID1A 1TAUA 1X9MA 2FC0A 2P5OA 1KVCA 4FK0A 4BE1A 1RT5A 4KI6A 4OJRA 1VSLA 4HUEA 3THVA 4CERA 4FLUA 4O4GA 4DTNA 3M8QA 2Y1JA 3ZSXA 1ZBUA 2HMIA 1D9DA 3ZSVA 4DF8A 4M42A 3TAQA 1MU2A 2DFEA 1L3SA 1TK5A 2HNZA 5K14A 3RRHA 4UQGA 3CG7A 1NJWA 4CEZA 5HP1A 4O5BA 4CJFA 2YNFA 2PYJA 1SKRA 5FRMA 2IC3A 4FJ5A 1RTDA 1TGOA 2OYQA 1HYSA 1EX4A 2OPRA 4C8LA 3O4NA 4E7LA 2HVIA 4KHQA 2KZZA 2QKBA 4RW8A 4CJ3A 4IFVA 2YKMA 3DRSA 1RCHA 3LDSA 5J2MA 4JS4A 3VQ6A 3TAEA 4CFAA 1RDCA 4FJJA 4CJVA 1WNSA 4IFYA 4IG0A 4EP4A 1TAQA 3RMAA 1VK0A 5FROA 1NK9A 1YT3A 4F3TA 4CECA 2HNYA 2ZQBA 1A5XA 4C8NA 1Q8IA 3OS0A 4CJLA 1S1VA 1VSKA 3C95A 3CQ8A 3DYAA 4FM0A 4HUFA 3SQ1A 1TL1A 1R0AA 4IKFA 3V6DA 5SWMA 4E7IA 1WSJA 1IKYA 3QIPA 1DTTA 4M3ZA 4KB0A 3JYTA 3B6PA 3TR8A 2BGGA 4F8RA 4BACA 1ITGA 1C0UA 3IS9A 4CHNA 3AVNA 3AO3A 3AVKA 1LAVA 4CEOA 3K2PA 4K8ZA 2E4LA 3C6TA 4CIGA 3SV4A 3VQ5A 3L3UA 3WNHA 3EY1A 2P1JA 4H8KA 1TVRA 4KI4A 4M3YA 3VQQA 5HRNA 3U6FA 1C6VA 4CJTA 4RW4A 3LAMA 3ZT1A 1QS4A 4KV8A 2GUIA 3DOKA 3PUFA 1S6QA 1WSHA 2ITGA 5CZ2A 2WONA 1SL0A 1IKVA 3HK2A 1UA1A 4M45A 4E7HA 3VQ9A 4CJRA 4FJXA 4N76A 2HB5A 3OJSA 4Q0BA 2P51A 3KKSA 4KKOA 4W5OA 3S3MA 4FLZA 2IOCA 4N41A 1WLJA 2G8WA 3KD1E 1IO2A 1VSDA 4PY5A 1U45A 2QK9A 4CF0A 1LW0A 4OPKA 2KTQA 3O4QA 4DQRA 3OS1A 3KK1A 1Q9XA 3CFRA 4KREA 4W5NA 4M3RA 3OYNA 3OYBA 1RT6A 4E1NA 4ZHRA 3HPOA 4HUGA 2F8TA 4WE1A 4CGDA 4LY7A 3L2WA 1RBUA 4RW7A 2OPQA 4DTUA 3MEGA 4FJKA 4Z4HA 4FM1A 1BCOA 1XI1A 1WN7A 3VQEA 4PUOA 4FLYA 3VA3A 1QTMA 1VSIA 4HTUA 2HHSA 2G8KA 1KLMA 4KTQA 1GOAA 3C6UA 1FKPA 2B6AA 4MFBA 4AHUA 4QAGA 1A5WA 3D45A 4OPJA 3TWHA 3DLHA 2IS3A 4G1QA 4BWMA 3NHGA 5JS2A 3VQDA 1WSEA 4W5QA 3NFAA 3AVCA 1TKZA 1JLAA 3V1RA 4CHPA 1BHLA 1HPZA 3NDKA 3NGZA 3SUNA 1NK4A 2E6LA 1QSLA 4DSKA 3K58A 1JLQA 1X1PA 1JL2A 3AVGA 2YNHA 5HROA 1KLNA 4FJNA 4M3XA 4DU3A 4CGIA 3QEWA 4KHUA 5J1EA 4IG3A 1RT2A 2P5GA 4FZYA 3OYLA 2A1RA 3DLRA 3OYCA 3HM9A 3SUOA 1NJXA 1S1UA 4L8RB 5I3UA 1NOYA 5CYMA 4C8KA 3LP2A 3PY8A 3KK3A 4CJ4A 1REVA 2NUBA 3I0RA 4JS5A 4HCCA 3CFOA 2KW4A 2D5RA 3VQ4A 3HYFA 3HT3A 1NKBA 1J54A 2OPPA 3DLEA 3CYMA 3F73A 1RTJA 3TARA 2FBVA 3ZT4A 3AVHA 2O4IA 4DTPA 3SV3A 3HPHA 1RTHA 3NH0A 3SQ4A 1O1WA 1VRUA 3HL8A 5DMRA 2B5JA 1JLFA 4E7KA 2YNIA 4I9QA 3TABA 1LWEA 3LAKA 3VQCA 1S9EA 3EZ5A 2IDOA 3L8BA 1TK8A 1NKCA 4CGGA 4FJHA 1NK6A 1ZBHA 1CLQA 3F9KA 3QESA 3ZT0A 4DQSA 4DSLA 4R5PA 1LW2A 2VG7A 5KTQA 1GOBA 3KLEA 3DI6A 4CHOA 2W42A 3HSTB 4AHCA 4F3OA 5JS1A 3SYZA 1I3AA 2Z1HA 4IBNA 4Z0UA 5J2PA 1NK7A 3KTQA 4DTSA 3ITHA 3AVAA 1DTQA 3K5NA 1WSIA 4CFDA 1NJYA 4PWDA 3OVNA 1CZBA 4OKEA 3OYJA 4CFBA 3KKRA 3AA3A 2Z1IA 2KQ2A 5CYQA 1VSHA 4DF4A 4M3UA 2RPIA 2HHVA 3PX0A 1FKOA 3K5LA 2Z1GA 3SUPA 5KGXA 1QHTA 1C1BA 3ZSOA 4XIUA 3OYAA 1BCMA 4Z4EA 1S1WA 1C1AA 3DLKA 4HHTA 3K5OA 1TK0A 4DTJA 3DOLA 2FBXA 3AVMA 3AA4A 1CXUA 3V1QA 5KRSA 4LD0A 1A5VA 5E41A 3OYFA 4AHTA 3TAFA 3PO5A 4I2PA 1JXBA 3DM2A 1SKSA 3S3NA 1WSGA 4FJ9A 4ZTFA 3ZSQA 2B4JA 3AO2A 4NCBA 4KHNA 3V4IA 1TKTA 3VQ7A 4W5RA 1UA0A 4FXDA 3QIOA 3K59A 2VWKA 3QINA 2BDPA 4OGEA 4I2QA 3DLGA 3NF9A 1ZBLA 1ZBIA 4B9VA 3LPUA 3LWLA 1RT1A 3LPTA 1HYVA 2G8FA 3SPYA 2D0AA 3AVLA 4OLAA 4CCHA 4HCBA 4I7FA 1BQMA 1GOCA 4J2BA 3OS2A 2F8SA 3O3HA 4N56A 4J2AA 2KZMA 1HMVA 2FBTA 1HJRA 3AVIA 4B8CA 1EETA 4CE9A 1JLCA 3NBPA 5I42A 3LP3A 1G15A 4DS4A 1HQUA 2IAJA 1XC9A 1VSEA 4AHRA 1VRTA 3RMDA 3L3VA 3NGYA 4CEQA 1EKEA 4CF2A 1TKDA 3NH1A 1CXQA 3OYEA 2HNDA 3MXJA 4CESA 1Z26A 2YNGA 3DRPA 2XHBA 4EZ6A 1KVAA 1SL2A 3K57A 3L2UA 4PQUA 1RDBA 4KHYA 4CJSA 2HHXA 1NK0A 4CJKA 3AO4A 3QNNA 1WAFA 3M8SA 1KCFA 1S1TA 1LWCA 5J2QA 1LAWA 2VG6A 3OYIA 3NE6A 3NF8A 3NGIA 2JGUA 4FJ7A 2GBZA 2A1SA 4DSJA 1FK9A 4CIFA 1L3VA 3QERA 4DFPA 4CK3A 4FJIA 1Z25A 2ETJA 1SKWA 3TANA 4BDPA 4DMNA 4B9TA 3AV9A 3VQ8A 1KFDA 4Z4CA 3MXMA 3VQBA 1T8EA 3HVRA 2XY5A 3TAPA 3BGRA 4DSIA 2ATQA 3MECA 4W5TA 1T03A 3CM5A 1S1XA 5HRRA 1L3UA 1HRHA 3QEIA 4CGHA 4DU1A 1D9FA 4DLGA 1YVUA 4H4MA 1BISA 4CHYA 4JRQA 4FJ8A 3WNGA 4Y1DA 2ZE2A 1JLGA 1BIUA 4CGJA 3G10A 4FCYA 1XHXA 4EZ9A 1ZYQA 1QSSA 4DLEA 4ICLA 2XY7A 4KTWA 4FJMA 1EP4A 2IGIA 3LWMA 3O3FA 1RDDA 4DQQA 2BANA 3HP9A 4CF8A 3SCXA 4F4KA 3KIOA 4C8OA 2KFZA 1Y97A 3SQ0A 2D0BA 4DFJA 4KFBA 3UIQA 4KB1A 1D8YA 4OVLA 1RTIA 3P5JA 3TAGA 4JLHA 3PX6A 4YNQA 4B9SA 1RT3A 4NCGA 3VQAA 2ZD1A 3KLIA 3AVFA 4K8XA 4QOZB 3OYHA 3AO5A 3I0SA 1HQEA 1RDAA 3ZT3A 3SI6A 3SPZA 1U49A 2HW3A 3LP1A 4DTXA 1U48A 4FK4A 3HVTA 1RBRA 2F96A 3DLBA 3G0ZA 5HLFA 3V9ZA 3S3OA 3HJFA 1T05A 1C0TA 4NCAA 3PV8A 3ZSZA 4KRFA 1U4BA 2GV9A 5HRPA 2PZSA 1J5OA 1RT4A 1KRPA 1W9HA 5D3GA 1JKHA 3OYDA 3NF7A 3LANA 4LSLA 1TKXA 2QKKA 4JRPA 3AVJA 4CJ5A 1WAJA 3EYZA 4FM2A 4CFCA 4E3SA 1BI4A 3OY9A 1K6YA 1IG9A 3P1GA 1NJZA 2Z1JA 3LP0A 1BIZA 3ALYA 3AO1A 4RW6A 1RNHA 3WNFA 3I8DA 3T19A 2PYLA 3QLHA 1EXQA 3T3FA 4O0JA 3T1AA 1YTUA 4DU4A 3PX4A 3WNEA 4M3WA 1NK8A 1JXEA 1XHZA 1IH7A 1N6QA 1B92A 2YHBA 4GVMA 4FLWA 5J2NA 1WSFA 4CJWA 2EHGA 1KTQA 4EP5A 4DTMA 4CK2A 1YTAA 4KTZA 4E1MA 3OYKA 4BDYA 2AJQA 4IDKA 3IRXA 4CHZA 4ID5A 2Y1IA 3TI0A 1KSPA 2DTUA 3AA5X 1JLEA 5C25A 4J2EA 3V1OA 2G8IA 3RMBA 4QCLA 4DQPA 5EU7A 1I39A 4HVJA 3KK2A 4CJQA 1L3TA 1RT7A 4CJUA 4FLXA 1X9SA 2OZSA 4ELTA 1ASUA 4YFUA 3V9UA 1L5UA 4LH5A 4KHWA 2OPSA 2XY8A 4Y1CA 3MXIA 5C24A 1RBSA 3HO1A 2BE2A 4O44A 3RRGA 4CEDA 4CJEA 1IKWA 3SUQA 4CEEA 4FYDA 4N47A 3MEEA 4I9LA 3D0PA 3DMJA 3LALA 4O0IA 1CZ9A 2FBYA 3AVBA 1N5YA 4TSXA 2QXFA 2OZMA 4DWIA 5T7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DSF A;  3B6O A;  1T7P A;  3RR7 A;  4KHS A;  3L2Q A;  1ASW A;  1QE1 A;  4CEB A;  4KPY A;  1DLO A;  4BDZ A;  3V9S A;  4B9M A;  3C94 A;  2RF2 A;  2XO7 A;  2OA8 A;  4B3O A;  3IAY A;  3RR8 A;  1NK5 A;  1KVB A;  1U04 A;  3ZCM A;  4CJP A;  4J2D A;  2DFH A;  1VSM A;  4CIE A;  4CHQ A;  3QET A;  4ELU A;  1D5A A;  4CGF A;  1S9G A;  3P83 D;  3HXM A;  4C8M A;  3JSM A;  3MED A;  4F2S A;  2YV0 X;  1VSJ A;  2VG5 A;  2X6N A;  5KRT A;  4CEA A;  5FDL A;  2EX3 A;  3MAQ A;  2HHU A;  3AA2 A;  2YHA A;  3ZSW A;  2E6M A;  2HVH A;  5SZT A;  4DS5 A;  1JLB A;  3V9W A;  3HPG A;  2HHQ A;  3QNO A;  1S6P A;  4DG1 A;  3OJU A;  4BWJ A;  1LV5 A;  4CF1 A;  4DFK A;  2G8U A;  4E0D A;  4RG8 A;  4OKK A;  2R7Y A;  4OKJ A;  4AHS A;  4DFM A;  1LWF A;  4CF9 A;  4BE0 A;  4GW6 A;  4FZZ A;  2HHT A;  1NKE A;  3IG1 A;  2RKI A;  4H4O A;  4OGC A;  1RBT A;  4PA1 A;  5C42 A;  3NAE A;  1HYZ A;  3RMC A;  1TV6 A;  1U47 A;  1X9W A;  2D0C A;  2PY5 A;  4LSN A;  3U3G A;  5KI6 A;  3ISN C;  4CEF A;  5CZ1 A;  1VSF A;  3KD5 E;  1SUQ A;  1C0M A;  2DFF A;  3M8P A;  3V81 A;  1SL1 A;  3KLG A;  4ZTJ A;  4Z4F A;  3OYM A;  4FLV A;  3M8R A;  5DK5 A;  2O4G A;  4FW2 A;  5CY4 A;  4M41 A;  3SJJ A;  3RTV A;  1SV5 A;  1ZBF A;  5FRN A;  1UWB A;  2XRI A;  3NH2 A;  2YKN A;  1KFS A;  3U3Y A;  4FZX C;  3A2F A;  5KGW A;  1F21 A;  1QQC A;  4B08 A;  2I5J A;  3ZSY A;  4BE2 A;  3DRR A;  4Q5V A;  3NF6 A;  4B9U A;  2XY6 A;  3SQ2 A;  3S9H A;  4DQI A;  1S5J A;  4KO0 A;  1ASV A;  2JLE A;  3ASM A;  3ZT2 A;  2G8V A;  4GMJ B;  1HNI A;  1B9D A;  1IKX A;  4FK2 A;  2WOM A;  5HBM A;  3PO4 A;  4NYF A;  4FLT A;  5HRS A;  3ZSR A;  4ELV A;  4Z4I A;  3H08 A;  3SNN A;  3BDP A;  1XWL A;  4FVM A;  1B9F A;  3SZ2 A;  2DY4 A;  4B9L A;  3L2V A;  4AHV A;  4KAZ A;  4CK1 A;  4DTO A;  3VN5 A;  3LZJ A;  4AH9 A;  2LSN A;  4MQ3 A;  3KLF A;  1NOZ A;  4F2R A;  2HHW A;  3CFP A;  4E7J A;  1HNV A;  4OLB A;  2X74 A;  1BGX T;  3LZI A;  1BQN A;  4RW9 A;  4B8A B;  3V9X A;  1C1C A;  3TAM A;  1JL1 A;  1Q9Y A;  4O55 A;  2X78 A;  1RBV A;  4FJL A;  4E19 A;  2KFN A;  1RIL A;  1TL3 A;  1UAX A;  3FFI A;  4LH4 A;  4FW1 A;  1FXX A;  3OYG A;  3KLH A;  3O3G A;  3NCI A;  4N5S A;  2RN2 A;  2Q3S A;  3ULD A;  1J9A A;  3QEP A;  3L2R A;  4DTR A;  2G8H A;  4NYN A;  4DSE A;  3RWU A;  4E89 A;  2VWJ A;  1UOC A;  1J53 A;  3HP6 A;  3KJV A;  4Z4G A;  3QO9 A;  3QEV A;  3QEX A;  1QSY A;  1BI4 B;  1W0H A;  2X6S A;  3E01 A;  3K5M A;  3VA0 A;  3CM6 A;  4AIL C;  4FJG A;  3VQP A;  4B9N A;  1BL3 A;  4M3T A;  4ID1 A;  1TAU A;  1X9M A;  2FC0 A;  2P5O A;  1KVC A;  4FK0 A;  4BE1 A;  1RT5 A;  4KI6 A;  4OJR A;  1VSL A;  4HUE A;  3THV A;  4CER A;  4FLU A;  4O4G A;  4DTN A;  3M8Q A;  2Y1J A;  3ZSX A;  1ZBU A;  2HMI A;  1D9D A;  3ZSV A;  4DF8 A;  4M42 A;  3TAQ A;  1MU2 A;  2DFE A;  1L3S A;  1TK5 A;  2HNZ A;  5K14 A;  3RRH A;  4UQG A;  3CG7 A;  1NJW A;  4CEZ A;  5HP1 A;  4O5B A;  4CJF A;  2YNF A;  2PYJ A;  1SKR A;  5FRM A;  2IC3 A;  4FJ5 A;  1RTD A;  1TGO A;  2OYQ A;  1HYS A;  1EX4 A;  2OPR A;  4C8L A;  3O4N A;  4E7L A;  2HVI A;  4KHQ A;  2KZZ A;  2QKB A;  4RW8 A;  4CJ3 A;  4IFV A;  2YKM A;  3DRS A;  1RCH A;  3LDS A;  5J2M A;  4JS4 A;  3VQ6 A;  3TAE A;  4CFA A;  1RDC A;  4FJJ A;  4CJV A;  1WNS A;  4IFY A;  4IG0 A;  4EP4 A;  1TAQ A;  3RMA A;  1VK0 A;  5FRO A;  1NK9 A;  1YT3 A;  4F3T A;  4CEC A;  2HNY A;  2ZQB A;  1A5X A;  4C8N A;  1Q8I A;  3OS0 A;  4CJL A;  1S1V A;  1VSK A;  3C95 A;  3CQ8 A;  3DYA A;  4FM0 A;  4HUF A;  3SQ1 A;  1TL1 A;  1R0A A;  4IKF A;  3V6D A;  5SWM A;  4E7I A;  1WSJ A;  1IKY A;  3QIP A;  1DTT A;  4M3Z A;  4KB0 A;  3JYT A;  3B6P A;  3TR8 A;  2BGG A;  4F8R A;  4BAC A;  1ITG A;  1C0U A;  3IS9 A;  4CHN A;  3AVN A;  3AO3 A;  3AVK A;  1LAV A;  4CEO A;  3K2P A;  4K8Z A;  2E4L A;  3C6T A;  4CIG A;  3SV4 A;  3VQ5 A;  3L3U A;  3WNH A;  3EY1 A;  2P1J A;  4H8K A;  1TVR A;  4KI4 A;  4M3Y A;  3VQQ A;  5HRN A;  3U6F A;  1C6V A;  4CJT A;  4RW4 A;  3LAM A;  3ZT1 A;  1QS4 A;  4KV8 A;  2GUI A;  3DOK A;  3PUF A;  1S6Q A;  1WSH A;  2ITG A;  5CZ2 A;  2WON A;  1SL0 A;  1IKV A;  3HK2 A;  1UA1 A;  4M45 A;  4E7H A;  3VQ9 A;  4CJR A;  4FJX A;  4N76 A;  2HB5 A;  3OJS A;  4Q0B A;  2P51 A;  3KKS A;  4KKO A;  4W5O A;  3S3M A;  4FLZ A;  2IOC A;  4N41 A;  1WLJ A;  2G8W A;  3KD1 E;  1IO2 A;  1VSD A;  4PY5 A;  1U45 A;  2QK9 A;  4CF0 A;  1LW0 A;  4OPK A;  2KTQ A;  3O4Q A;  4DQR A;  3OS1 A;  3KK1 A;  1Q9X A;  3CFR A;  4KRE A;  4W5N A;  4M3R A;  3OYN A;  3OYB A;  1RT6 A;  4E1N A;  4ZHR A;  3HPO A;  4HUG A;  2F8T A;  4WE1 A;  4CGD A;  4LY7 A;  3L2W A;  1RBU A;  4RW7 A;  2OPQ A;  4DTU A;  3MEG A;  4FJK A;  4Z4H A;  4FM1 A;  1BCO A;  1XI1 A;  1WN7 A;  3VQE A;  4PUO A;  4FLY A;  3VA3 A;  1QTM A;  1VSI A;  4HTU A;  2HHS A;  2G8K A;  1KLM A;  4KTQ A;  1GOA A;  3C6U A;  1FKP A;  2B6A A;  4MFB A;  4AHU A;  4QAG A;  1A5W A;  3D45 A;  4OPJ A;  3TWH A;  3DLH A;  2IS3 A;  4G1Q A;  4BWM A;  3NHG A;  5JS2 A;  3VQD A;  1WSE A;  4W5Q A;  3NFA A;  3AVC A;  1TKZ A;  1JLA A;  3V1R A;  4CHP A;  1BHL A;  1HPZ A;  3NDK A;  3NGZ A;  3SUN A;  1NK4 A;  2E6L A;  1QSL A;  4DSK A;  3K58 A;  1JLQ A;  1X1P A;  1JL2 A;  3AVG A;  2YNH A;  5HRO A;  1KLN A;  4FJN A;  4M3X A;  4DU3 A;  4CGI A;  3QEW A;  4KHU A;  5J1E A;  4IG3 A;  1RT2 A;  2P5G A;  4FZY A;  3OYL A;  2A1R A;  3DLR A;  3OYC A;  3HM9 A;  3SUO A;  1NJX A;  1S1U A;  4L8R B;  5I3U A;  1NOY A;  5CYM A;  4C8K A;  3LP2 A;  3PY8 A;  3KK3 A;  4CJ4 A;  1REV A;  2NUB A;  3I0R A;  4JS5 A;  4HCC A;  3CFO A;  2KW4 A;  2D5R A;  3VQ4 A;  3HYF A;  3HT3 A;  1NKB A;  1J54 A;  2OPP A;  3DLE A;  3CYM A;  3F73 A;  1RTJ A;  3TAR A;  2FBV A;  3ZT4 A;  3AVH A;  2O4I A;  4DTP A;  3SV3 A;  3HPH A;  1RTH A;  3NH0 A;  3SQ4 A;  1O1W A;  1VRU A;  3HL8 A;  5DMR A;  2B5J A;  1JLF A;  4E7K A;  2YNI A;  4I9Q A;  3TAB A;  1LWE A;  3LAK A;  3VQC A;  1S9E A;  3EZ5 A;  2IDO A;  3L8B A;  1TK8 A;  1NKC A;  4CGG A;  4FJH A;  1NK6 A;  1ZBH A;  1CLQ A;  3F9K A;  3QES A;  3ZT0 A;  4DQS A;  4DSL A;  4R5P A;  1LW2 A;  2VG7 A;  5KTQ A;  1GOB A;  3KLE A;  3DI6 A;  4CHO A;  2W42 A;  3HST B;  4AHC A;  4F3O A;  5JS1 A;  3SYZ A;  1I3A A;  2Z1H A;  4IBN A;  4Z0U A;  5J2P A;  1NK7 A;  3KTQ A;  4DTS A;  3ITH A;  3AVA A;  1DTQ A;  3K5N A;  1WSI A;  4CFD A;  1NJY A;  4PWD A;  3OVN A;  1CZB A;  4OKE A;  3OYJ A;  4CFB A;  3KKR A;  3AA3 A;  2Z1I A;  2KQ2 A;  5CYQ A;  1VSH A;  4DF4 A;  4M3U A;  2RPI A;  2HHV A;  3PX0 A;  1FKO A;  3K5L A;  2Z1G A;  3SUP A;  5KGX A;  1QHT A;  1C1B A;  3ZSO A;  4XIU A;  3OYA A;  1BCM A;  4Z4E A;  1S1W A;  1C1A A;  3DLK A;  4HHT A;  3K5O A;  1TK0 A;  4DTJ A;  3DOL A;  2FBX A;  3AVM A;  3AA4 A;  1CXU A;  3V1Q A;  5KRS A;  4LD0 A;  1A5V A;  5E41 A;  3OYF A;  4AHT A;  3TAF A;  3PO5 A;  4I2P A;  1JXB A;  3DM2 A;  1SKS A;  3S3N A;  1WSG A;  4FJ9 A;  4ZTF A;  3ZSQ A;  2B4J A;  3AO2 A;  4NCB A;  4KHN A;  3V4I A;  1TKT A;  3VQ7 A;  4W5R A;  1UA0 A;  4FXD A;  3QIO A;  3K59 A;  2VWK A;  3QIN A;  2BDP A;  4OGE A;  4I2Q A;  3DLG A;  3NF9 A;  1ZBL A;  1ZBI A;  4B9V A;  3LPU A;  3LWL A;  1RT1 A;  3LPT A;  1HYV A;  2G8F A;  3SPY A;  2D0A A;  3AVL A;  4OLA A;  4CCH A;  4HCB A;  4I7F A;  1BQM A;  1GOC A;  4J2B A;  3OS2 A;  2F8S A;  3O3H A;  4N56 A;  4J2A A;  2KZM A;  1HMV A;  2FBT A;  1HJR A;  3AVI A;  4B8C A;  1EET A;  4CE9 A;  1JLC A;  3NBP A;  5I42 A;  3LP3 A;  1G15 A;  4DS4 A;  1HQU A;  2IAJ A;  1XC9 A;  1VSE A;  4AHR A;  1VRT A;  3RMD A;  3L3V A;  3NGY A;  4CEQ A;  1EKE A;  4CF2 A;  1TKD A;  3NH1 A;  1CXQ A;  3OYE A;  2HND A;  3MXJ A;  4CES A;  1Z26 A;  2YNG A;  3DRP A;  2XHB A;  4EZ6 A;  1KVA A;  1SL2 A;  3K57 A;  3L2U A;  4PQU A;  1RDB A;  4KHY A;  4CJS A;  2HHX A;  1NK0 A;  4CJK A;  3AO4 A;  3QNN A;  1WAF A;  3M8S A;  1KCF A;  1S1T A;  1LWC A;  5J2Q A;  1LAW A;  2VG6 A;  3OYI A;  3NE6 A;  3NF8 A;  3NGI A;  2JGU A;  4FJ7 A;  2GBZ A;  2A1S A;  4DSJ A;  1FK9 A;  4CIF A;  1L3V A;  3QER A;  4DFP A;  4CK3 A;  4FJI A;  1Z25 A;  2ETJ A;  1SKW A;  3TAN A;  4BDP A;  4DMN A;  4B9T A;  3AV9 A;  3VQ8 A;  1KFD A;  4Z4C A;  3MXM A;  3VQB A;  1T8E A;  3HVR A;  2XY5 A;  3TAP A;  3BGR A;  4DSI A;  2ATQ A;  3MEC A;  4W5T A;  1T03 A;  3CM5 A;  1S1X A;  5HRR A;  1L3U A;  1HRH A;  3QEI A;  4CGH A;  4DU1 A;  1D9F A;  4DLG A;  1YVU A;  4H4M A;  1BIS A;  4CHY A;  4JRQ A;  4FJ8 A;  3WNG A;  4Y1D A;  2ZE2 A;  1JLG A;  1BIU A;  4CGJ A;  3G10 A;  4FCY A;  1XHX A;  4EZ9 A;  1ZYQ A;  1QSS A;  4DLE A;  4ICL A;  2XY7 A;  4KTW A;  4FJM A;  1EP4 A;  2IGI A;  3LWM A;  3O3F A;  1RDD A;  4DQQ A;  2BAN A;  3HP9 A;  4CF8 A;  3SCX A;  4F4K A;  3KIO A;  4C8O A;  2KFZ A;  1Y97 A;  3SQ0 A;  2D0B A;  4DFJ A;  4KFB A;  3UIQ A;  4KB1 A;  1D8Y A;  4OVL A;  1RTI A;  3P5J A;  3TAG A;  4JLH A;  3PX6 A;  4YNQ A;  4B9S A;  1RT3 A;  4NCG A;  3VQA A;  2ZD1 A;  3KLI A;  3AVF A;  4K8X A;  4QOZ B;  3OYH A;  3AO5 A;  3I0S A;  1HQE A;  1RDA A;  3ZT3 A;  3SI6 A;  3SPZ A;  1U49 A;  2HW3 A;  3LP1 A;  4DTX A;  1U48 A;  4FK4 A;  3HVT A;  1RBR A;  2F96 A;  3DLB A;  3G0Z A;  5HLF A;  3V9Z A;  3S3O A;  3HJF A;  1T05 A;  1C0T A;  4NCA A;  3PV8 A;  3ZSZ A;  4KRF A;  1U4B A;  2GV9 A;  5HRP A;  2PZS A;  1J5O A;  1RT4 A;  1KRP A;  1W9H A;  5D3G A;  1JKH A;  3OYD A;  3NF7 A;  3LAN A;  4LSL A;  1TKX A;  2QKK A;  4JRP A;  3AVJ A;  4CJ5 A;  1WAJ A;  3EYZ A;  4FM2 A;  4CFC A;  4E3S A;  1BI4 A;  3OY9 A;  1K6Y A;  1IG9 A;  3P1G A;  1NJZ A;  2Z1J A;  3LP0 A;  1BIZ A;  3ALY A;  3AO1 A;  4RW6 A;  1RNH A;  3WNF A;  3I8D A;  3T19 A;  2PYL A;  3QLH A;  1EXQ A;  3T3F A;  4O0J A;  3T1A A;  1YTU A;  4DU4 A;  3PX4 A;  3WNE A;  4M3W A;  1NK8 A;  1JXE A;  1XHZ A;  1IH7 A;  1N6Q A;  1B92 A;  2YHB A;  4GVM A;  4FLW A;  5J2N A;  1WSF A;  4CJW A;  2EHG A;  1KTQ A;  4EP5 A;  4DTM A;  4CK2 A;  1YTA A;  4KTZ A;  4E1M A;  3OYK A;  4BDY A;  2AJQ A;  4IDK A;  3IRX A;  4CHZ A;  4ID5 A;  2Y1I A;  3TI0 A;  1KSP A;  2DTU A;  3AA5 X;  1JLE A;  5C25 A;  4J2E A;  3V1O A;  2G8I A;  3RMB A;  4QCL A;  4DQP A;  5EU7 A;  1I39 A;  4HVJ A;  3KK2 A;  4CJQ A;  1L3T A;  1RT7 A;  4CJU A;  4FLX A;  1X9S A;  2OZS A;  4ELT A;  1ASU A;  4YFU A;  3V9U A;  1L5U A;  4LH5 A;  4KHW A;  2OPS A;  2XY8 A;  4Y1C A;  3MXI A;  5C24 A;  1RBS A;  3HO1 A;  2BE2 A;  4O44 A;  3RRG A;  4CED A;  4CJE A;  1IKW A;  3SUQ A;  4CEE A;  4FYD A;  4N47 A;  3MEE A;  4I9L A;  3D0P A;  3DMJ A;  3LAL A;  4O0I A;  1CZ9 A;  2FBY A;  3AVB A;  1N5Y A;  4TSX A;  2QXF A;  2OZM A;  4DWI A;  5T7B A; 
#chains in the Genus database with same CATH topology
 5GAD P;  3WXM B;  1NMN A;  4R79 A;  4I6M A;  1YJN N;  3ZCM A;  4J2D A;  4CJP A;  4GNI A;  4CIE A;  4CHQ A;  5IWA K;  3A0I X;  4JI8 K;  2VG5 A;  4YDU C;  5KRT A;  4KBO A;  5FDL A;  2HHU A;  4A57 A;  2E6M A;  4H5W A;  5SZT A;  3TSP A;  3QB0 A;  3CXC M;  1S6P A;  1VQ4 N;  1LV5 A;  2R7Y A;  3THW A;  4BE0 A;  1NKE A;  4KH5 A;  4OGC A;  5C12 A;  5C42 A;  4B9T A;  3RMC A;  4YOT A;  2PY5 A;  4CEF A;  3D2E A;  2D4W A;  3E9O A;  3ATV A;  3VEZ A;  3RTV A;  5FRN A;  4LFC K;  1KFS A;  3WXK A;  4DV7 K;  1QQC A;  4BE2 A;  4AQY K;  4B1Z A;  3ZYY X;  4IWV A;  2WOM A;  3PO4 A;  2P9U A;  4FLT A;  4Z4I A;  3MN7 A;  1XWL A;  2HF3 A;  3CET A;  2DY4 A;  4KAZ A;  4AHV A;  3LZJ A;  4H0T B;  3KLF A;  2F4V K;  1ESV A;  2ZJR L;  2X74 A;  1BGX T;  3MN6 A;  1P90 A;  3O9Q A;  3THX A;  4CZH A;  3KK7 A;  1C1C A;  1NWK A;  4O55 A;  2CGJ A;  3QEP A;  1J9A A;  1MWK A;  3HP6 A;  4DR3 K;  2KLA A;  4BR0 A;  3MX5 A;  4AIL C;  3HRG A;  4BR7 A;  4FJG A;  4B9N A;  3U9Z A;  4ID1 A;  5M1K A;  3G4S N;  1VSL A;  4O8K A;  4CER A;  4FWS A;  2Y1J A;  1ZBU A;  4DF8 A;  4FWP A;  1MU2 A;  2A40 A;  4A2B A;  1HNZ K;  2O8C A;  5K14 A;  5FPM A;  4BGA A;  3RRH A;  3NVK A;  3O9T A;  5HP1 A;  4O5B A;  1M90 O;  1SKR A;  2OYQ A;  1ILY A;  1SS6 A;  1NGC A;  3GBT A;  3O6W A;  4JI7 K;  3LDS A;  3VQ6 A;  3TAE A;  4FJJ A;  4F3T A;  4CD1 A;  3VEV A;  3C95 A;  4BGB A;  4FM0 A;  4IKF A;  3OBY A;  3JAM O;  5SWM A;  1IKY A;  3QIP A;  1EWQ A;  3JYT A;  3U9D A;  4JK8 A;  1ITG A;  3IS9 A;  3AVN A;  3AVK A;  3K2P A;  4CIG A;  5AQS A;  4X66 K;  3L3U A;  1JCF A;  2CH6 A;  1TVR A;  1C6V A;  4CJT A;  4RW4 A;  2HHH K;  2V7Y A;  4YOR A;  4BRK A;  3J7Z O;  3VQ9 A;  4Q0B A;  3KKS A;  4KKO A;  3RSE B;  4W5O A;  3LDN A;  4FOI A;  3PIP L;  4LF4 K;  1WOQ A;  3BZC A;  4YHH K;  2UYT A;  2QW9 A;  4CF0 A;  2KTQ A;  3O4Q A;  2NNW A;  1Q9X A;  3KK1 A;  3CFR A;  4IJA A;  2WUS A;  4E1N A;  4ZHR A;  2WC9 A;  2QWR A;  3OW2 M;  3VGL A;  2QEX N;  3MEG A;  4DR2 K;  3VQE A;  4FLY A;  3OTO K;  4BRN A;  3RSE A;  2G8K A;  4GV6 A;  1GLE G;  3UKR A;  4OPJ A;  3TWH A;  3DLH A;  1BOT O;  5LL6 Z;  4WQ5 C;  3NFA A;  3AVC A;  5AQG A;  4CHP A;  3SQ4 A;  1HUX A;  3NGZ A;  2E6L A;  1QSL A;  4H03 B;  2YX6 A;  1X1P A;  1JL2 A;  3VF2 A;  3QEW A;  2P5G A;  2UXC K;  1OVY A;  3SUO A;  3C6H A;  1V4S A;  1NOY A;  3LP2 A;  4BRP A;  1J5E K;  3CFO A;  3VQ4 A;  4B1U B;  2Q2R A;  3F73 A;  4JKD A;  4YOX A;  2HMP A;  4MDA A;  2O4I A;  2ZGZ A;  2ITM A;  1RTH A;  3E1Y A;  2GEM A;  3DJC A;  1O1W A;  2B5J A;  2QM1 A;  3TAB A;  3EZ5 A;  4FJH A;  2IDO A;  5F2R A;  4FL9 A;  3QES A;  3ZT0 A;  4DQS A;  5KTQ A;  2Q1N A;  3DI6 A;  4CHO A;  2W42 A;  3UKU A;  5F1X A;  4BQL A;  2ZJP L;  4F3O A;  4DKW A;  1XMQ K;  3A5M C;  3KTQ A;  3AVA A;  1YXQ A;  3D6R A;  4CFD A;  4WFB L;  3THY B;  4CVN E;  2OCE A;  1Z6R A;  3OYJ A;  2HBJ A;  5KPR A;  2KQ2 A;  3THW B;  4DV5 K;  1N36 K;  5M1P A;  4M3U A;  2RPI A;  1S1W A;  3V1Q A;  4Y0W A;  3PIO L;  2PAV A;  1A5V A;  3VF6 A;  1TYQ B;  3KWI A;  4IO8 A;  3UB5 A;  1JXB A;  1SKS A;  2Q36 A;  3WXL A;  3CCQ N;  4ZTF A;  1KD1 O;  3ZSQ A;  2B4J A;  3THY A;  3SBG A;  1QQN A;  4BR9 A;  4FXD A;  3BUZ B;  3K59 A;  4OGE A;  3DLG A;  4QS8 A;  3NF9 A;  4MLH A;  3LPU A;  3LWL A;  2G8F A;  3SPY A;  2D0A A;  1ZBS A;  1NJI O;  4CCH A;  3OS2 A;  3O3H A;  4J2A A;  2KZM A;  1HMV A;  2FBT A;  3AVI A;  3EKU A;  1EET A;  1JLC A;  3MN9 A;  5CR4 A;  3CJC A;  1VSE A;  3L3V A;  1Q86 O;  2CGL A;  3OYE A;  4DV4 K;  3C7N A;  5AQJ A;  3L2U A;  3SMP A;  4CJS A;  2HHX A;  3OHR A;  4JKE A;  4PKG A;  1E4G T;  1IV0 A;  1IBL K;  3MK6 A;  1LWC A;  2VG6 A;  3OYI A;  4CZM A;  2RE2 A;  3NF8 A;  3NGI A;  4FJ7 A;  5TKY A;  4DSJ A;  2E1Z A;  2ETJ A;  4JNE A;  2OTJ N;  4DMN A;  3AV9 A;  3VQ8 A;  1IBM K;  3CD6 N;  1W7A A;  4AM7 A;  1EQY A;  3R9P A;  4OPA A;  4IEI A;  3CM5 A;  1S1X A;  4JKA A;  5HRR A;  4CZE A;  3QEI A;  4CGH A;  4DLG A;  1YVU A;  4H4M A;  4CHY A;  2UU9 K;  5AQH A;  1BO5 O;  2ZE2 A;  1BIU A;  3G25 A;  3HI0 A;  1KXP A;  4ICL A;  4DLE A;  1S72 N;  4FJM A;  2IGI A;  4LF5 K;  4F4K A;  4RTF D;  3FLC O;  3SQ0 A;  2D0B A;  3LM9 A;  5KQD A;  3P5J A;  1RT3 A;  3CPE A;  2ZD1 A;  3AVF A;  4QOZ B;  1RDA A;  3SPZ A;  5AFU A;  1HKB A;  3L4I A;  4DTX A;  1RBR A;  2F96 A;  4CZI A;  5HLF A;  3S3O A;  3PV8 A;  3ZSZ A;  5AQO A;  1U4B A;  4GKJ K;  1MA9 B;  1GLA G;  3E66 A;  3OYD A;  1MWM A;  3EYZ A;  3P1G A;  4IXC A;  5LJV A;  3AO1 A;  1RNH A;  3WNF A;  5HOO A;  2V52 B;  4WQ4 C;  4A59 A;  3T3F A;  3H1V X;  2HBM A;  4O8U A;  3VF4 A;  3WNE A;  4M3W A;  1NK8 A;  2F7T A;  4DV1 K;  1IH7 A;  1N6Q A;  1WSF A;  1YVN A;  2EHG A;  5AQX A;  3WXJ A;  3PSF A;  3O9R A;  3AGR A;  3TI0 A;  1KSP A;  1JLE A;  2HST A;  5C25 A;  4KHP K;  3V1O A;  2G8I A;  3RMB A;  4CBU A;  3KK2 A;  2HF4 A;  3A5O C;  2GWJ A;  1X9S A;  3UKR B;  4LH5 A;  1VQ6 N;  2OPS A;  3MXI A;  4CD3 A;  3R6M A;  4CZK A;  4CJE A;  2P9N B;  2FBY A;  5AQU A;  5GIN A;  3IKM A;  4DWI A;  5T7B A;  1T7P A;  4CJ7 A;  4JAX A;  4BVP A;  5AQQ A;  3L2Q A;  3PLA A;  1ASW A;  4BY9 C;  4DHY A;  5AQY A;  3U8X A;  2BUP A;  4KPY A;  1DLO A;  3LDO A;  4BDZ A;  3V9S A;  2RF2 A;  3O9S A;  4ILH A;  2XO7 A;  5C2D A;  4B3O A;  4IJN A;  3RR8 A;  1QHA A;  1KVB A;  1U04 A;  2DFH A;  3L6Q A;  3QET A;  4ELU A;  1D5A A;  4CGF A;  2P9N A;  3HXM A;  4C8M A;  3JSM A;  2EWS A;  2YV0 X;  3QDK A;  4DV2 K;  3IDH A;  1HNW K;  2YHA A;  3HPG A;  5B8H A;  4RG8 A;  4OKK A;  1RFQ A;  4AHS A;  1LWF A;  2QWN A;  2HHT A;  2RKI A;  1X9J A;  4H4O A;  4PA1 A;  2GX9 A;  1U47 A;  1X9W A;  3QBW A;  1JJ2 M;  3ISN C;  3SAF A;  1SUQ A;  5AQP A;  3M8R A;  5DK5 A;  2O4G A;  1Y64 A;  1ZBF A;  2E5L K;  1UWB A;  2XRI A;  3U3Y A;  3A2F A;  4B08 A;  3ZSY A;  4Q5V A;  3NF6 A;  2XY6 A;  3S9H A;  4DQI A;  4LF9 K;  4BRQ A;  3CCL N;  2HVH A;  2G8V A;  4FK2 A;  1IKX A;  4WQ5 A;  3LDQ A;  5HBM A;  4NYF A;  5HRS A;  3ZSR A;  4K42 A;  4ELV A;  3SNN A;  3L2V A;  2LSN A;  4MQ3 A;  4FVU A;  1NOZ A;  1NNE A;  3SAG A;  1BQN A;  3TSQ A;  4FW1 A;  1FXX A;  3O3G A;  4BRI A;  2G8H A;  3RWU A;  2VWJ A;  1H1V A;  1IG8 A;  5ELZ A;  5FPN A;  4NB4 A;  1DT9 A;  4Z4G A;  5JVG L;  5KPZ A;  3QEX A;  2QWQ A;  1KC8 O;  3HOS A;  3DLL L;  2O8B B;  5F0X A;  3O80 A;  2QWP A;  2W41 A;  3VPZ A;  4M3T A;  2ASP A;  3IUC A;  3THV A;  4FLU A;  1WUA A;  3ZSX A;  2HMI A;  1FJG K;  3ZSV A;  1EWR A;  1DGK N;  3TAQ A;  1L3S A;  2VWB A;  3CG7 A;  4YOW A;  4CJF A;  4B3S K;  2YNF A;  3WQU A;  3DWL A;  2IC3 A;  2E2P A;  3THX B;  1EX4 A;  3CQY A;  4C8L A;  4E7L A;  4RCH A;  2HVI A;  4KHQ A;  5EXW A;  2QKB A;  2A6A A;  4DR6 K;  3DRS A;  4JV5 K;  3K9K A;  5J2M A;  1E4F T;  4CFA A;  5BR9 A;  4IG0 A;  5FRO A;  1A5X A;  2CH5 A;  4A61 A;  3ENB A;  3OS0 A;  1VQ5 N;  1S1V A;  4K25 A;  3SQ1 A;  4HUF A;  1TL1 A;  1NU0 A;  4M3Z A;  4KB0 A;  4FWQ A;  1KQS M;  1GLJ O;  4DR4 K;  1LAV A;  4CEO A;  2E4L A;  1J6Z A;  2GUP A;  4MO4 A;  3VQ5 A;  1NGE A;  4X62 K;  1QVF M;  4KI4 A;  3ZX2 A;  4G9Z A;  3CC7 N;  2D1K A;  4KV8 A;  2GUI A;  4DV3 K;  1S6Q A;  1WSH A;  1QQO A;  3HK2 A;  1ZXO A;  2QI2 A;  3TTF A;  4E7H A;  4CJR A;  4FJX A;  4XH1 A;  1WBD A;  4FLZ A;  3I55 N;  2G8W A;  4A5A A;  3J8A A;  5BPL A;  3WQT A;  3T1Y K;  3HZ6 A;  2QK9 A;  4OPK A;  4DQR A;  4B1V A;  4KRE A;  5EX5 A;  3HPO A;  4XH5 A;  2O8E A;  2F8T A;  4LY7 A;  5GAG P;  4DTU A;  2KHO A;  4PUO A;  3VA3 A;  1QTM A;  4KTQ A;  3FZM A;  4H0P A;  1JLA A;  3NDK A;  1HPZ A;  5C2F A;  4V19 S;  2PFU A;  2VGN A;  3O9U A;  1ATN A;  4FJN A;  3BF1 A;  4KHU A;  4FZY A;  2A1R A;  4NLC A;  1NJX A;  1S1U A;  4L8R B;  1OVQ A;  5CYM A;  3CI5 A;  3P4I A;  2HOE A;  3KK3 A;  1REV A;  2NUB A;  2D5R A;  1ZC6 A;  3HYF A;  1NKB A;  3GOI A;  3O8M A;  3QFP A;  2BTF A;  3TAR A;  2FBV A;  2NRV A;  3DAW A;  3SV3 A;  5AQR A;  3NH0 A;  1TYQ A;  1VQK N;  2YNI A;  1LWE A;  2ZGY A;  1ZBH A;  4B3R K;  1TK8 A;  4ISG A;  4CGG A;  1NK6 A;  1YIJ N;  4DCH A;  2HBL A;  4AHC A;  5JS1 A;  3SYZ A;  3HSC A;  1OH7 A;  3TTD A;  2Z1H A;  5J2P A;  4DTS A;  5AJ3 K;  1DTQ A;  2PBD A;  1WSI A;  1K8A O;  2QWO A;  5AQW A;  4EIA A;  3OVN A;  1SQK A;  2P9P A;  2Z1I A;  2FF6 A;  1YAG A;  4AM6 A;  3W3D A;  2Z1G A;  3G71 N;  3SUP A;  1N33 K;  5KGX A;  2FSJ A;  1C1B A;  3ZSO A;  1O13 A;  3K5O A;  1TK0 A;  3T69 A;  2FBX A;  3AA4 A;  3AVM A;  3DOL A;  1CXU A;  4JN4 A;  3VES A;  3MWP A;  4YOU A;  4I2P A;  1MDU B;  1HX1 A;  4NCB A;  2ZJQ L;  1GLD G;  2E1Y A;  1TKT A;  3VQ7 A;  4W5R A;  4FOE A;  2BDP A;  2HBK A;  1RDU A;  4L3Q A;  3UKU B;  1KAZ A;  2RHK A;  4FWR A;  4OLA A;  3ULE B;  4JHD B;  3CJA A;  3CHW A;  4CE9 A;  4IO9 L;  1XC9 A;  1G15 A;  1HQU A;  3L0Q A;  1VRT A;  5IT9 O;  4CEQ A;  3AAQ A;  3AGK A;  1TKD A;  1CXQ A;  3G6E N;  2HND A;  3MXJ A;  2YNG A;  1KVA A;  4HWI A;  4KHY A;  2QWM A;  2AP1 A;  1VQO N;  1NK0 A;  2E8A A;  3QNN A;  2CGK A;  4DUY K;  2NZT A;  3H1Q A;  1HNX K;  2JGU A;  2A1S A;  4GV3 A;  1FK9 A;  4CIF A;  1L3V A;  3O4W A;  5GIO A;  4DFP A;  4FJI A;  1Z25 A;  3TAN A;  4CZL A;  3ZLJ A;  1KFD A;  4Z4C A;  3LDL A;  4B1X B;  1DEJ A;  4IOX A;  3BGR A;  2ATQ A;  3MEC A;  1L3U A;  4FJ8 A;  3FFK B;  3WNG A;  4GKK K;  2WFB A;  4CGJ A;  1D4X A;  3CCR N;  3WUH A;  1S22 A;  4BVO A;  1QSS A;  4KTW A;  2UXB K;  2BAN A;  4CF8 A;  2KFZ A;  4KB1 A;  4DFJ A;  4KFB A;  1GLB G;  1RTI A;  3PX6 A;  3DXM A;  4NCG A;  4WCE L;  1YIT N;  5M1F A;  3AO5 A;  3I0S A;  1HQE A;  3ZT3 A;  1U49 A;  2HW3 A;  3LP1 A;  1U48 A;  3WEE B;  5AZJ B;  4FO0 A;  5M1N A;  5LY3 A;  1V4T A;  3V9Z A;  3HJF A;  3S41 A;  4NCA A;  4H5T A;  1VHX A;  2GV9 A;  1J5O A;  2IVO A;  5D3G A;  1JKH A;  1NGJ A;  5DM6 L;  2O8D A;  4YOV A;  4RWT A;  3EN9 A;  4CFC A;  1SAZ A;  4E3S A;  5AZI A;  3DXM B;  1BI4 A;  3H3O B;  4H0X B;  1NJZ A;  2Z1J A;  3LP0 A;  1BIZ A;  4DV0 K;  4O0J A;  3T1A A;  1QVG M;  3VEW A;  3PX4 A;  5BRE A;  2E20 A;  1XHZ A;  3SLC A;  1HLU A;  4DV6 K;  2O8B A;  3QFU A;  1YTA A;  4WYB A;  4CHZ A;  4ID5 A;  2DTU A;  4ISE A;  3AA5 X;  3D7E O;  3C6A A;  5BR8 K;  4QCL A;  1I39 A;  2OZS A;  3V9U A;  4YY3 K;  4Y1C A;  4CZJ A;  3RRG A;  1ATS A;  3SUQ A;  4CEE A;  4N47 A;  3MEE A;  3DMJ A;  1CZ9 A;  3AVB A;  4CZF A;  1YHQ N;  4DSF A;  3B6O A;  3RR7 A;  5FPE A;  4KHS A;  4JI3 K;  5C0Y A;  1QE1 A;  4PHT X;  2NRT A;  4CEB A;  4A62 A;  4B9M A;  1C0G A;  2UUC K;  2OA8 A;  5AQV A;  3WT0 A;  5BRF A;  3BEX A;  4JKH A;  1VSM A;  2P9L B;  4F2S A;  1VSJ A;  2X6N A;  3ZSW A;  1JLB A;  2E2N A;  3V9W A;  2HHQ A;  1T44 A;  3QNO A;  4E0D A;  3QIC A;  4BWJ A;  2O8F B;  4DFK A;  4IOC L;  2G8U A;  2F9T A;  4OKJ A;  4CF9 A;  4FZZ A;  4GW6 A;  4JK7 A;  3FR0 A;  5CHI A;  3IG1 A;  3NAE A;  1RBT A;  1TV6 A;  3OBW A;  3U3G A;  3KD5 E;  5CZ1 A;  4FWN A;  1C0M A;  1SL1 A;  4Z4F A;  4FLV A;  3GL1 A;  4FW2 A;  4M41 A;  3SJJ A;  1SV5 A;  4OO1 J;  2YKN A;  2NRX A;  2O8C B;  5KGW A;  4YOY A;  2I5J A;  3DRR A;  1S5J A;  1QZ5 A;  4KO0 A;  1ASV A;  1LOT B;  3ASM A;  3ZT2 A;  1YJW N;  4GMJ B;  4H5R A;  3VGK A;  1KAX A;  5GAE P;  3H08 A;  3BDP A;  5EOY A;  3SZ2 A;  4I6M B;  4B9L A;  3CIP A;  3VN5 A;  4FSV A;  4AH9 A;  2HHW A;  4E7J A;  2Q97 A;  2P9S A;  4OLB A;  3ID6 A;  5EVZ A;  3LZI A;  4RW9 A;  3V9X A;  5DM7 L;  3TAM A;  1WB9 A;  1Q9Y A;  5AQL A;  1RBV A;  3UE5 A;  1RIL A;  1UAX A;  4LH4 A;  2I7N A;  2Q3S A;  3L2R A;  4DTR A;  1NM1 A;  1BUP A;  4E89 A;  3A8Y A;  2GEL A;  3H46 O;  4NXN K;  4QS7 A;  3KJV A;  3QEV A;  1BI4 B;  1W0H A;  2X6S A;  1TUY A;  1BL3 A;  1GLF O;  4FK0 A;  1KVC A;  4BE1 A;  5EY4 A;  1YI2 N;  3AAR A;  4HUE A;  4DTN A;  2YI1 A;  2P9I A;  2DFE A;  2HNZ A;  1NJW A;  4CEZ A;  1OKJ A;  1RTD A;  1TGO A;  2FF3 B;  2P9U B;  2OPR A;  2KZZ A;  1BWF O;  4RW8 A;  4CJ3 A;  2WTU A;  4BRE A;  3CMA N;  4JS4 A;  1EO1 A;  1RDC A;  4IFY A;  3RMA A;  3HTV A;  1IJJ A;  1YT3 A;  4CEC A;  5E84 A;  4C8N A;  1Q8I A;  3CQ8 A;  3DYA A;  1BA1 A;  3V6D A;  4E7I A;  1WSJ A;  1DTT A;  5AFU H;  3B6P A;  2QWL A;  3SAH A;  2GTD A;  2NRW A;  3M5R A;  3SBT A;  4BAC A;  1VQP N;  4F8R A;  2O8E B;  4CHN A;  3D2E B;  2A5X A;  5BPM A;  3CCS N;  3CC2 N;  3P38 A;  2P1J A;  4M7Y A;  3VQQ A;  3EEQ A;  3MWT A;  3J81 O;  3LAM A;  3ZT1 A;  3CCJ N;  3PUF A;  4PKI A;  5CZ2 A;  4BG9 A;  2WON A;  1IKV A;  3HBT A;  1UA1 A;  5I9E B;  4M45 A;  1VQL N;  2HB5 A;  2P51 A;  5CE3 A;  2IOC A;  3EZW A;  4MO5 A;  3I33 A;  4N41 A;  1XMO K;  3ATU A;  1IO2 A;  3TTC A;  3GE1 A;  4K43 A;  4A5B A;  4NO7 A;  4AF1 A;  1VSD A;  4PY5 A;  1U45 A;  2IIR A;  2YJE A;  3O1B A;  3OS1 A;  5BN9 A;  3WXI A;  2FSN A;  1RT6 A;  3KWG A;  4HUG A;  3L2W A;  4RW7 A;  2V51 B;  4JKC A;  4GY2 B;  4Z4H A;  4FJK A;  1BCO A;  1XI1 A;  3ZX0 A;  1VSI A;  4HTU A;  1KLM A;  4X65 K;  1GOA A;  4AHU A;  2B6A A;  4MFB A;  4QAG A;  1A5W A;  3D45 A;  2IS3 A;  4G1Q A;  4BWM A;  3NHG A;  3VQD A;  2F9W A;  3V1R A;  1U6Z A;  3C7N B;  2NRH A;  4JK9 A;  4WQ4 A;  1JCG A;  1JLQ A;  3AVG A;  4XEI A;  4BRG A;  4EAH D;  1K8K B;  1KLN A;  3CJ9 A;  2ASO A;  5BRH A;  4DU3 A;  3N4Q A;  4CGI A;  1RT2 A;  2P9I B;  3JS6 A;  3BY5 A;  1NMD A;  3DLR A;  3HM9 A;  4O5F A;  5I3U A;  3KHY A;  4C8K A;  3PY8 A;  3I0R A;  4HCC A;  2KW4 A;  2P9P B;  2D0P A;  1J54 A;  2YJF A;  3CYM A;  1RTJ A;  4J8F A;  3ZT4 A;  3AVH A;  4BRL A;  1U2V B;  5H1S Q;  4Z94 A;  1VRU A;  5DMR A;  1JLF A;  3VMF B;  4DQ8 A;  3LAK A;  1NKC A;  4MDB A;  3A5N C;  5FLX O;  4DSL A;  5LMN K;  4R5P A;  3KLE A;  3CQX A;  3FZH A;  3AY9 A;  2H3G X;  4IBN A;  4Z0U A;  1NK7 A;  3ITH A;  3A5L C;  1T6D A;  3EE9 A;  4OKE A;  1BU6 O;  4A2A A;  2E88 A;  3P39 A;  4BQZ A;  1VSH A;  5CYQ A;  4DF4 A;  1BCM A;  1C1A A;  4DTJ A;  3MN5 A;  2QXL A;  1SZ2 A;  4LD0 A;  5E41 A;  3OYF A;  4X64 K;  1WSG A;  2JWK A;  3KVG A;  3V4I A;  2VWK A;  4I2Q A;  1Q81 O;  4B9V A;  2P9K A;  3AVL A;  1DKG D;  4JKG A;  3EKS A;  1BQM A;  1GOC A;  4J2B A;  4H0V B;  2F8S A;  4N56 A;  3CME N;  5I42 A;  3FGU A;  4DS4 A;  2IAJ A;  1IBK K;  3NGY A;  4CF2 A;  1EKE A;  3NH1 A;  4CES A;  1Z26 A;  3DXK B;  4BRD A;  4EZ6 A;  1RDB A;  4LF6 K;  3CCM N;  4CJK A;  1HKC A;  2OAN A;  3SMS A;  5KPT A;  1BDG A;  4BR4 A;  1WAF A;  1S1T A;  2W6K A;  3HM8 A;  5J2Q A;  2VQF K;  1LAW A;  1X3M A;  4H0Y B;  3ZX3 A;  3F2K A;  3MCA B;  4U67 L;  3OA9 A;  4CK3 A;  1VQN N;  1SKW A;  4BDP A;  3E9P A;  3MXM A;  1T6C A;  3VQB A;  1T8E A;  3HVR A;  3VOV A;  3TAP A;  2YCH A;  4BG8 A;  5AQK A;  4IDH A;  4DU1 A;  3IFR A;  3O1W A;  2BH1 A;  3CPW M;  4JD2 A;  4JKG B;  4FCY A;  1NGG A;  1Q82 O;  1XHX A;  1ZYQ A;  3Q7C A;  3VEN A;  1CZA N;  1EP4 A;  3O3F A;  4HTL A;  1RDD A;  2W6L A;  3HP9 A;  3SCX A;  4FWM A;  3FZF A;  3UIQ A;  1RGI A;  3FZK A;  1YUW A;  3TAG A;  4YNQ A;  4B9S A;  3VEO A;  3MCP A;  4FWO A;  3KLI A;  4K8X A;  3J7A P;  4BC5 A;  4JD2 B;  3Q7B A;  4FK4 A;  3HVT A;  3G0Z A;  1XQS C;  1NBW A;  1T05 A;  1C0T A;  4KRF A;  5HRP A;  4KH4 A;  1RT4 A;  1KRP A;  5KQ8 A;  3NF7 A;  4LSL A;  1TKX A;  4JRP A;  4CJ5 A;  1GLC G;  1VQM N;  1N34 K;  3C65 A;  3W0L A;  5AQN A;  1ATR A;  3ALY A;  4RW6 A;  3I8D A;  4B1Y B;  3QLH A;  4CI6 A;  1TUU A;  3BP8 A;  3J80 O;  4IZ9 A;  4JI4 K;  1JXE A;  2FXU A;  4M7X A;  4JI6 K;  4GVM A;  4FLW A;  4CJW A;  4EHU A;  1VQ8 N;  1KTQ A;  3KZB A;  4EP5 A;  2ZF5 O;  4E1M A;  4KTZ A;  3F9M A;  3OYK A;  2AJQ A;  4IDK A;  3DXK A;  3WEE A;  4BC2 A;  4DQP A;  2VGM A;  1RT7 A;  4FLX A;  4ELT A;  1ASU A;  4JYA K;  1L5U A;  4KHW A;  3K0S A;  2O8D B;  2XY8 A;  5C24 A;  1RBS A;  2BE2 A;  5AZI B;  3R8E A;  1IKW A;  4FYD A;  4I9L A;  3H6E A;  3LAL A;  1N5Y A;  5JMV A;  4TSX A;  4C1N K;  4JI2 K;  4M63 C;  3EE8 A;  1W2B M;  2FLO A;  3C94 A;  3IAY A;  3CJ1 A;  1NK5 A;  2VQE K;  2KKZ A;  3PSI A;  1S9G A;  3P83 D;  3VEY A;  3MED A;  1NGB A;  4CEA A;  2EX3 A;  3MAQ A;  3AA2 A;  4DS5 A;  4BRO A;  4DG1 A;  3OJU A;  4CF1 A;  2YHX A;  2P9S B;  2A42 A;  4LF7 K;  4DFM A;  3VTI A;  1OH5 A;  2Q0U A;  3B8A X;  1HYZ A;  2D0C A;  3TU5 A;  3E9L A;  4LSN A;  5KI6 A;  1K73 O;  1VSF A;  2DFF A;  3M8P A;  3C0B A;  2QA4 N;  3V81 A;  3KLG A;  4ZTJ A;  4LFB K;  2E2O A;  4BC4 A;  3OYM A;  5CY4 A;  1FW6 A;  3NH2 A;  4JI0 K;  1HKG A;  3K9J A;  4FZX C;  3QML A;  1F21 A;  4EFH A;  4WF9 L;  4BRC A;  3FE1 A;  4B9U A;  3SQ2 A;  2Q31 A;  2JLE A;  1HNI A;  1B9D A;  4MLE A;  4FWK A;  4KH6 A;  1E3M A;  2A41 A;  1BG3 A;  3SK3 A;  4FVM A;  1B9F A;  4XH4 A;  2ZM6 K;  4CK1 A;  4DTO A;  4F2R A;  3CFP A;  1HNV A;  1HPM A;  2AA4 A;  4B8A B;  2YHY A;  1JL1 A;  4JI1 K;  4FJL A;  2X78 A;  4E19 A;  5C15 A;  3RVC A;  3CF5 L;  2KFN A;  1TL3 A;  3KLH A;  3FFI A;  3NCI A;  3OYG A;  2UXD K;  3ULD A;  1W97 L;  4N5S A;  2RN2 A;  1K8K A;  4NYN A;  4DSE A;  1VAZ A;  1UOC A;  1J53 A;  4FPA A;  3QO9 A;  1QSY A;  3VA0 A;  3E01 A;  3K5M A;  3CM6 A;  1GLL O;  3VQP A;  1TAU A;  1X9M A;  2FC0 A;  4PL7 A;  2P5O A;  1RT5 A;  3ZEU B;  3AAP A;  4OJR A;  4KI6 A;  4LF8 K;  4FPB A;  3CER A;  4O4G A;  3M8Q A;  1D9D A;  4B3M K;  4M42 A;  1NGA A;  1TK5 A;  4UQG A;  1Q18 A;  2PYJ A;  5FRM A;  4FJ5 A;  1HYS A;  1HR0 K;  2W40 A;  3HOT A;  3O4N A;  3R1X A;  4IFV A;  3O08 A;  2YKM A;  5C10 A;  1RCH A;  1XC3 A;  4CJV A;  1WNS A;  4EP4 A;  1NK9 A;  1TAQ A;  1VK0 A;  4WFN L;  2HNY A;  2ZQB A;  3ENH A;  5HL7 L;  3VET A;  4CJL A;  1VSK A;  1R0A A;  2JWL A;  3ZET B;  2ZWH A;  2BGG A;  2NRZ A;  3TR8 A;  3O5B A;  5AQT A;  1C0U A;  4CBW A;  3AO3 A;  4BR2 A;  5JLF A;  4K8Z A;  3C6T A;  3SV4 A;  1R59 O;  3VTH A;  3EY1 A;  3WNH A;  4H8K A;  4M3Y A;  2O8F A;  5HRN A;  3U6F A;  3R3L A;  5AQF A;  1QS4 A;  1K9M O;  3LL3 A;  3DOK A;  4IFE A;  2ITG A;  1SL0 A;  2OTL N;  1NGD A;  4N76 A;  4DR5 K;  3OJS A;  3S3M A;  3CC4 N;  3CJ7 A;  2I7P A;  1WLJ A;  4BC3 A;  3KD1 E;  1N32 K;  1NGH A;  1VQ9 N;  3M3Z A;  1LW0 A;  5AQZ A;  4W5N A;  4M3R A;  3M6G A;  3OYN A;  3OYB A;  3P31 A;  4WE1 A;  4CGD A;  1YF5 L;  1RBU A;  1N8R O;  2OPQ A;  4FM1 A;  1WN7 A;  3BF3 A;  5ADX A;  2HHS A;  3I8B A;  5MLC Q;  4PKH A;  1FKP A;  3C6U A;  1U2V A;  5AQI A;  5JS2 A;  1WSE A;  4W5Q A;  4OPH A;  1TKZ A;  3SUN A;  1BHL A;  1NK4 A;  3JXU A;  2YHW A;  4DSK A;  1QZ6 A;  3K58 A;  3I56 N;  2YNH A;  5HRO A;  1M1K O;  4M3X A;  3QBX A;  5J1E A;  4IG3 A;  5AR0 A;  3OYL A;  5AQM A;  1NG9 A;  3MX2 A;  3OYC A;  1HJO A;  2VYP A;  4BRA A;  3TPQ A;  4H5N A;  4WFA L;  1XNR K;  4BRH A;  2VCP A;  5E26 A;  3D2F A;  3NMU A;  4CJ4 A;  4JS5 A;  4B1W B;  3CCE N;  3HT3 A;  1QQM A;  2OPP A;  3DLE A;  4K41 A;  4U7B A;  3CJB A;  4F9O A;  4DTP A;  3HPH A;  3EO3 A;  5JIC A;  4K0K K;  3HL8 A;  4E7K A;  4DUZ K;  4I9Q A;  5AZJ A;  3VQC A;  4ILG B;  1S9E A;  5M1O A;  3L8B A;  3U4L A;  1CLQ A;  3F9K A;  1LW2 A;  2VG7 A;  1GOB A;  1NLV A;  3HST B;  4NLB A;  2IVN A;  1I3A A;  1NGI A;  3H45 C;  3FZL A;  4H0O A;  3VER A;  1NJY A;  3K5N A;  4PWD A;  3T7Z A;  1CZB A;  4CFB A;  3KKR A;  1BA0 A;  2D0O A;  3AA3 A;  3TSU A;  3MDQ A;  1XNQ K;  4CZG A;  2HHV A;  5JLH A;  1FKO A;  3PX0 A;  3K5L A;  1Q7Y O;  1QHT A;  4XIU A;  1C0F A;  3OYA A;  4Z4E A;  5BRD A;  3DLK A;  3GG4 A;  5JVH L;  5BN8 A;  4HHT A;  4NXM K;  3VEX A;  5BPN A;  3D2F B;  4FWL A;  5M1Q A;  5KRS A;  3PO5 A;  3TAF A;  4AHT A;  3DM2 A;  4QS9 A;  3LDP A;  3L4Q A;  3S3N A;  4FJ9 A;  4ISF A;  3AO2 A;  4KHN A;  1RDW X;  1UA0 A;  3QIO A;  3QIN A;  1LCU A;  5A2Q O;  4IOA L;  1T3V A;  1NGF A;  1ZBL A;  1ZBI A;  3ENO A;  1RT1 A;  3LPT A;  1HYV A;  4HCB A;  4E1J A;  4I7F A;  4UY8 O;  4B8C A;  1HJR A;  3NBP A;  4JEP A;  3LP3 A;  4AHR A;  3RMD A;  4LC9 B;  5LJW A;  2QTD A;  2UUB K;  3DRP A;  2XHB A;  1SL2 A;  3K57 A;  4PQU A;  3AO4 A;  2E2Q A;  4PL8 A;  2A3Z A;  3NVM A;  3M8S A;  1KCF A;  3ULE A;  1S3X A;  1OH6 A;  4OX9 K;  4JHD A;  3NE6 A;  5ADX H;  2GBZ A;  3F5T A;  4CBX A;  1G99 A;  3QER A;  3ZEU A;  2P9K B;  4GVE A;  3J7Y P;  3M1F A;  2XY5 A;  2J4R A;  1X3N A;  4DSI A;  4W5T A;  1T03 A;  1HRH A;  3T1H K;  2NRR A;  1D9F A;  3CCU N;  1BIS A;  4IEE A;  4JRQ A;  4Y1D A;  1JLG A;  3G10 A;  4EZ9 A;  3IMX A;  2XY7 A;  2WBN A;  2FSK A;  3LWM A;  4EHT A;  1JCE A;  4H5V A;  1WBB A;  4DQQ A;  1I94 K;  3KIO A;  4C8O A;  4GV9 A;  1Y97 A;  4B9Q A;  3CCV N;  1YJ9 N;  1P8Z A;  1D8Y A;  4OVL A;  2DPN A;  4JLH A;  3VQA A;  3ZET A;  4YDU A;  2Q0R A;  3OYH A;  3SI6 A;  3H3N O;  2NLX A;  3DLB A;  3MMV A;  4JKF A;  3N4P A;  3EL2 A;  5GAH P;  2GWK A;  2PZS A;  1W9H A;  3LAN A;  2QKK A;  3AVJ A;  4BR5 A;  1WAJ A;  4FM2 A;  4ILJ A;  3OY9 A;  1K6Y A;  4DR1 K;  1IG9 A;  5GIP A;  4BRF A;  2PYL A;  3T19 A;  1VQ7 N;  1EXQ A;  3SJH A;  3VGM A;  1YTU A;  4DU4 A;  4C1N I;  5TKW A;  5LMU K;  2IVP A;  1KAY A;  1B92 A;  2YHB A;  5J2N A;  4DR7 K;  2UUA K;  4DTM A;  2ASM A;  4JKB A;  4CK2 A;  4BDY A;  4CW7 B;  3IRX A;  1OH8 A;  2Y1I A;  4B3T K;  4LFA K;  4J2E A;  2V7Z A;  4DB3 A;  3GDQ A;  3ID8 A;  5EU7 A;  4HVJ A;  4CJQ A;  1L3T A;  4CJU A;  4YFU A;  4BRM A;  1Z05 A;  1XUP O;  2P9L A;  4C23 A;  3HO1 A;  4O44 A;  4CED A;  3LM2 A;  3D0P A;  4O0I A;  4JI5 K;  2QXF A;  5FPD A;  2OZM A;  3BZK A; 
#chains in the Genus database with same CATH homology
 4DSF A;  3B6O A;  1T7P A;  3RR7 A;  4KHS A;  3L2Q A;  1ASW A;  1QE1 A;  4CEB A;  4KPY A;  1DLO A;  4BDZ A;  3V9S A;  4B9M A;  3C94 A;  2RF2 A;  2XO7 A;  2OA8 A;  4B3O A;  3IAY A;  3RR8 A;  1NK5 A;  1KVB A;  1U04 A;  3ZCM A;  4CJP A;  4J2D A;  2DFH A;  1VSM A;  4CIE A;  4CHQ A;  3QET A;  4ELU A;  1D5A A;  4CGF A;  1S9G A;  3P83 D;  3HXM A;  4C8M A;  3JSM A;  3MED A;  4F2S A;  2YV0 X;  1VSJ A;  2VG5 A;  2X6N A;  5KRT A;  4CEA A;  5FDL A;  2EX3 A;  3MAQ A;  2HHU A;  3AA2 A;  2YHA A;  3ZSW A;  2E6M A;  2HVH A;  5SZT A;  4DS5 A;  1JLB A;  3V9W A;  3HPG A;  2HHQ A;  3QNO A;  1S6P A;  4DG1 A;  3OJU A;  4BWJ A;  1LV5 A;  4CF1 A;  4DFK A;  2G8U A;  4E0D A;  4RG8 A;  4OKK A;  2R7Y A;  4OKJ A;  4AHS A;  4DFM A;  1LWF A;  4CF9 A;  4BE0 A;  4GW6 A;  4FZZ A;  2HHT A;  1NKE A;  3IG1 A;  2RKI A;  4H4O A;  4OGC A;  1RBT A;  4PA1 A;  5C42 A;  3NAE A;  1HYZ A;  3RMC A;  1TV6 A;  1U47 A;  1X9W A;  2D0C A;  2PY5 A;  4LSN A;  3U3G A;  5KI6 A;  3ISN C;  4CEF A;  5CZ1 A;  1VSF A;  3KD5 E;  1SUQ A;  1C0M A;  2DFF A;  3M8P A;  3V81 A;  1SL1 A;  3KLG A;  4ZTJ A;  4Z4F A;  3OYM A;  4FLV A;  3M8R A;  5DK5 A;  2O4G A;  4FW2 A;  5CY4 A;  4M41 A;  3SJJ A;  3RTV A;  1SV5 A;  1ZBF A;  5FRN A;  1UWB A;  2XRI A;  3NH2 A;  2YKN A;  1KFS A;  3U3Y A;  4FZX C;  3A2F A;  5KGW A;  1F21 A;  1QQC A;  4B08 A;  2I5J A;  3ZSY A;  4BE2 A;  3DRR A;  4Q5V A;  3NF6 A;  4B9U A;  2XY6 A;  3SQ2 A;  3S9H A;  4DQI A;  1S5J A;  4KO0 A;  1ASV A;  2JLE A;  3ASM A;  3ZT2 A;  2G8V A;  4GMJ B;  1HNI A;  1B9D A;  1IKX A;  4FK2 A;  2WOM A;  5HBM A;  3PO4 A;  4NYF A;  4FLT A;  5HRS A;  3ZSR A;  4ELV A;  4Z4I A;  3H08 A;  3SNN A;  3BDP A;  1XWL A;  4FVM A;  1B9F A;  3SZ2 A;  2DY4 A;  4B9L A;  3L2V A;  4AHV A;  4KAZ A;  4CK1 A;  4DTO A;  3VN5 A;  3LZJ A;  4AH9 A;  2LSN A;  4MQ3 A;  3KLF A;  1NOZ A;  4F2R A;  2HHW A;  3CFP A;  4E7J A;  1HNV A;  4OLB A;  2X74 A;  1BGX T;  3LZI A;  1BQN A;  4RW9 A;  4B8A B;  3V9X A;  1C1C A;  3TAM A;  1JL1 A;  1Q9Y A;  4O55 A;  2X78 A;  1RBV A;  4FJL A;  4E19 A;  2KFN A;  1RIL A;  1TL3 A;  1UAX A;  3FFI A;  4LH4 A;  4FW1 A;  1FXX A;  3OYG A;  3KLH A;  3O3G A;  3NCI A;  4N5S A;  2RN2 A;  2Q3S A;  3ULD A;  1J9A A;  3QEP A;  3L2R A;  4DTR A;  2G8H A;  4NYN A;  4DSE A;  3RWU A;  4E89 A;  2VWJ A;  1UOC A;  1J53 A;  3HP6 A;  3KJV A;  4Z4G A;  3QO9 A;  3QEV A;  3QEX A;  1QSY A;  1BI4 B;  1W0H A;  2X6S A;  3E01 A;  3K5M A;  3VA0 A;  3CM6 A;  4AIL C;  4FJG A;  3VQP A;  4B9N A;  1BL3 A;  4M3T A;  4ID1 A;  1TAU A;  1X9M A;  2FC0 A;  2P5O A;  1KVC A;  4FK0 A;  4BE1 A;  1RT5 A;  4KI6 A;  4OJR A;  1VSL A;  4HUE A;  3THV A;  4CER A;  4FLU A;  4O4G A;  4DTN A;  3M8Q A;  2Y1J A;  3ZSX A;  1ZBU A;  2HMI A;  1D9D A;  3ZSV A;  4DF8 A;  4M42 A;  3TAQ A;  1MU2 A;  2DFE A;  1L3S A;  1TK5 A;  2HNZ A;  5K14 A;  3RRH A;  4UQG A;  3CG7 A;  1NJW A;  4CEZ A;  5HP1 A;  4O5B A;  4CJF A;  2YNF A;  2PYJ A;  1SKR A;  5FRM A;  2IC3 A;  4FJ5 A;  1RTD A;  1TGO A;  2OYQ A;  1HYS A;  1EX4 A;  2OPR A;  4C8L A;  3O4N A;  4E7L A;  2HVI A;  4KHQ A;  2KZZ A;  2QKB A;  4RW8 A;  4CJ3 A;  4IFV A;  2YKM A;  3DRS A;  1RCH A;  3LDS A;  5J2M A;  4JS4 A;  3VQ6 A;  3TAE A;  4CFA A;  1RDC A;  4FJJ A;  4CJV A;  1WNS A;  4IFY A;  4IG0 A;  4EP4 A;  1TAQ A;  3RMA A;  1VK0 A;  5FRO A;  1NK9 A;  1YT3 A;  4F3T A;  4CEC A;  2HNY A;  2ZQB A;  1A5X A;  4C8N A;  1Q8I A;  3OS0 A;  4CJL A;  1S1V A;  1VSK A;  3C95 A;  3CQ8 A;  3DYA A;  4FM0 A;  4HUF A;  3SQ1 A;  1TL1 A;  1R0A A;  4IKF A;  3V6D A;  5SWM A;  4E7I A;  1WSJ A;  1IKY A;  3QIP A;  1DTT A;  4M3Z A;  4KB0 A;  3JYT A;  3B6P A;  3TR8 A;  2BGG A;  4F8R A;  4BAC A;  1ITG A;  1C0U A;  3IS9 A;  4CHN A;  3AVN A;  3AO3 A;  3AVK A;  1LAV A;  4CEO A;  3K2P A;  4K8Z A;  2E4L A;  3C6T A;  4CIG A;  3SV4 A;  3VQ5 A;  3L3U A;  3WNH A;  3EY1 A;  2P1J A;  4H8K A;  1TVR A;  4KI4 A;  4M3Y A;  3VQQ A;  5HRN A;  3U6F A;  1C6V A;  4CJT A;  4RW4 A;  3LAM A;  3ZT1 A;  1QS4 A;  4KV8 A;  2GUI A;  3DOK A;  3PUF A;  1S6Q A;  1WSH A;  2ITG A;  5CZ2 A;  2WON A;  1SL0 A;  1IKV A;  3HK2 A;  1UA1 A;  4M45 A;  4E7H A;  3VQ9 A;  4CJR A;  4FJX A;  4N76 A;  2HB5 A;  3OJS A;  4Q0B A;  2P51 A;  3KKS A;  4KKO A;  4W5O A;  3S3M A;  4FLZ A;  2IOC A;  4N41 A;  1WLJ A;  2G8W A;  3KD1 E;  1IO2 A;  1VSD A;  4PY5 A;  1U45 A;  2QK9 A;  4CF0 A;  1LW0 A;  4OPK A;  2KTQ A;  3O4Q A;  4DQR A;  3OS1 A;  3KK1 A;  1Q9X A;  3CFR A;  4KRE A;  4W5N A;  4M3R A;  3OYN A;  3OYB A;  1RT6 A;  4E1N A;  4ZHR A;  3HPO A;  4HUG A;  2F8T A;  4WE1 A;  4CGD A;  4LY7 A;  3L2W A;  1RBU A;  4RW7 A;  2OPQ A;  4DTU A;  3MEG A;  4FJK A;  4Z4H A;  4FM1 A;  1BCO A;  1XI1 A;  1WN7 A;  3VQE A;  4PUO A;  4FLY A;  3VA3 A;  1QTM A;  1VSI A;  4HTU A;  2HHS A;  2G8K A;  1KLM A;  4KTQ A;  1GOA A;  3C6U A;  1FKP A;  2B6A A;  4MFB A;  4AHU A;  4QAG A;  1A5W A;  3D45 A;  4OPJ A;  3TWH A;  3DLH A;  2IS3 A;  4G1Q A;  4BWM A;  3NHG A;  5JS2 A;  3VQD A;  1WSE A;  4W5Q A;  3NFA A;  3AVC A;  1TKZ A;  1JLA A;  3V1R A;  4CHP A;  1BHL A;  1HPZ A;  3NDK A;  3NGZ A;  3SUN A;  1NK4 A;  2E6L A;  1QSL A;  4DSK A;  3K58 A;  1JLQ A;  1X1P A;  1JL2 A;  3AVG A;  2YNH A;  5HRO A;  1KLN A;  4FJN A;  4M3X A;  4DU3 A;  4CGI A;  3QEW A;  4KHU A;  5J1E A;  4IG3 A;  1RT2 A;  2P5G A;  4FZY A;  3OYL A;  2A1R A;  3DLR A;  3OYC A;  3HM9 A;  3SUO A;  1NJX A;  1S1U A;  4L8R B;  5I3U A;  1NOY A;  5CYM A;  4C8K A;  3LP2 A;  3PY8 A;  3KK3 A;  4CJ4 A;  1REV A;  2NUB A;  3I0R A;  4JS5 A;  4HCC A;  3CFO A;  2KW4 A;  2D5R A;  3VQ4 A;  3HYF A;  3HT3 A;  1NKB A;  1J54 A;  2OPP A;  3DLE A;  3CYM A;  3F73 A;  1RTJ A;  3TAR A;  2FBV A;  3ZT4 A;  3AVH A;  2O4I A;  4DTP A;  3SV3 A;  3HPH A;  1RTH A;  3NH0 A;  3SQ4 A;  1O1W A;  1VRU A;  3HL8 A;  5DMR A;  2B5J A;  1JLF A;  4E7K A;  2YNI A;  4I9Q A;  3TAB A;  1LWE A;  3LAK A;  3VQC A;  1S9E A;  3EZ5 A;  2IDO A;  3L8B A;  1TK8 A;  1NKC A;  4CGG A;  4FJH A;  1NK6 A;  1ZBH A;  1CLQ A;  3F9K A;  3QES A;  3ZT0 A;  4DQS A;  4DSL A;  4R5P A;  1LW2 A;  2VG7 A;  5KTQ A;  1GOB A;  3KLE A;  3DI6 A;  4CHO A;  2W42 A;  3HST B;  4AHC A;  4F3O A;  5JS1 A;  3SYZ A;  1I3A A;  2Z1H A;  4IBN A;  4Z0U A;  5J2P A;  1NK7 A;  3KTQ A;  4DTS A;  3ITH A;  3AVA A;  1DTQ A;  3K5N A;  1WSI A;  4CFD A;  1NJY A;  4PWD A;  3OVN A;  1CZB A;  4OKE A;  3OYJ A;  4CFB A;  3KKR A;  3AA3 A;  2Z1I A;  2KQ2 A;  5CYQ A;  1VSH A;  4DF4 A;  4M3U A;  2RPI A;  2HHV A;  3PX0 A;  1FKO A;  3K5L A;  2Z1G A;  3SUP A;  5KGX A;  1QHT A;  1C1B A;  3ZSO A;  4XIU A;  3OYA A;  1BCM A;  4Z4E A;  1S1W A;  1C1A A;  3DLK A;  4HHT A;  3K5O A;  1TK0 A;  4DTJ A;  3DOL A;  2FBX A;  3AVM A;  3AA4 A;  1CXU A;  3V1Q A;  5KRS A;  4LD0 A;  1A5V A;  5E41 A;  3OYF A;  4AHT A;  3TAF A;  3PO5 A;  4I2P A;  1JXB A;  3DM2 A;  1SKS A;  3S3N A;  1WSG A;  4FJ9 A;  4ZTF A;  3ZSQ A;  2B4J A;  3AO2 A;  4NCB A;  4KHN A;  3V4I A;  1TKT A;  3VQ7 A;  4W5R A;  1UA0 A;  4FXD A;  3QIO A;  3K59 A;  2VWK A;  3QIN A;  2BDP A;  4OGE A;  4I2Q A;  3DLG A;  3NF9 A;  1ZBL A;  1ZBI A;  4B9V A;  3LPU A;  3LWL A;  1RT1 A;  3LPT A;  1HYV A;  2G8F A;  3SPY A;  2D0A A;  3AVL A;  4OLA A;  4CCH A;  4HCB A;  4I7F A;  1BQM A;  1GOC A;  4J2B A;  3OS2 A;  2F8S A;  3O3H A;  4N56 A;  4J2A A;  2KZM A;  1HMV A;  2FBT A;  1HJR A;  3AVI A;  4B8C A;  1EET A;  4CE9 A;  1JLC A;  3NBP A;  5I42 A;  3LP3 A;  1G15 A;  4DS4 A;  1HQU A;  2IAJ A;  1XC9 A;  1VSE A;  4AHR A;  1VRT A;  3RMD A;  3L3V A;  3NGY A;  4CEQ A;  1EKE A;  4CF2 A;  1TKD A;  3NH1 A;  1CXQ A;  3OYE A;  2HND A;  3MXJ A;  4CES A;  1Z26 A;  2YNG A;  3DRP A;  2XHB A;  4EZ6 A;  1KVA A;  1SL2 A;  3K57 A;  3L2U A;  4PQU A;  1RDB A;  4KHY A;  4CJS A;  2HHX A;  1NK0 A;  4CJK A;  3AO4 A;  3QNN A;  1WAF A;  3M8S A;  1KCF A;  1S1T A;  1LWC A;  5J2Q A;  1LAW A;  2VG6 A;  3OYI A;  3NE6 A;  3NF8 A;  3NGI A;  2JGU A;  4FJ7 A;  2GBZ A;  2A1S A;  4DSJ A;  1FK9 A;  4CIF A;  1L3V A;  3QER A;  4DFP A;  4CK3 A;  4FJI A;  1Z25 A;  2ETJ A;  1SKW A;  3TAN A;  4BDP A;  4DMN A;  4B9T A;  3AV9 A;  3VQ8 A;  1KFD A;  4Z4C A;  3MXM A;  3VQB A;  1T8E A;  3HVR A;  2XY5 A;  3TAP A;  3BGR A;  4DSI A;  2ATQ A;  3MEC A;  4W5T A;  1T03 A;  3CM5 A;  1S1X A;  5HRR A;  1L3U A;  1HRH A;  3QEI A;  4CGH A;  4DU1 A;  1D9F A;  4DLG A;  1YVU A;  4H4M A;  1BIS A;  4CHY A;  4JRQ A;  4FJ8 A;  3WNG A;  4Y1D A;  2ZE2 A;  1JLG A;  1BIU A;  4CGJ A;  3G10 A;  4FCY A;  1XHX A;  4EZ9 A;  1ZYQ A;  1QSS A;  4DLE A;  4ICL A;  2XY7 A;  4KTW A;  4FJM A;  1EP4 A;  2IGI A;  3LWM A;  3O3F A;  1RDD A;  4DQQ A;  2BAN A;  3HP9 A;  4CF8 A;  3SCX A;  4F4K A;  3KIO A;  4C8O A;  2KFZ A;  1Y97 A;  3SQ0 A;  2D0B A;  4DFJ A;  4KFB A;  3UIQ A;  4KB1 A;  1D8Y A;  4OVL A;  1RTI A;  3P5J A;  3TAG A;  4JLH A;  3PX6 A;  4YNQ A;  4B9S A;  1RT3 A;  4NCG A;  3VQA A;  2ZD1 A;  3KLI A;  3AVF A;  4K8X A;  4QOZ B;  3OYH A;  3AO5 A;  3I0S A;  1HQE A;  1RDA A;  3ZT3 A;  3SI6 A;  3SPZ A;  1U49 A;  2HW3 A;  3LP1 A;  4DTX A;  1U48 A;  4FK4 A;  3HVT A;  1RBR A;  2F96 A;  3DLB A;  3G0Z A;  5HLF A;  3V9Z A;  3S3O A;  3HJF A;  1T05 A;  1C0T A;  4NCA A;  3PV8 A;  3ZSZ A;  4KRF A;  1U4B A;  2GV9 A;  5HRP A;  2PZS A;  1J5O A;  1RT4 A;  1KRP A;  1W9H A;  5D3G A;  1JKH A;  3OYD A;  3NF7 A;  3LAN A;  4LSL A;  1TKX A;  2QKK A;  4JRP A;  3AVJ A;  4CJ5 A;  1WAJ A;  3EYZ A;  4FM2 A;  4CFC A;  4E3S A;  1BI4 A;  3OY9 A;  1K6Y A;  1IG9 A;  3P1G A;  1NJZ A;  2Z1J A;  3LP0 A;  1BIZ A;  3ALY A;  3AO1 A;  4RW6 A;  1RNH A;  3WNF A;  3I8D A;  3T19 A;  2PYL A;  3QLH A;  1EXQ A;  3T3F A;  4O0J A;  3T1A A;  1YTU A;  4DU4 A;  3PX4 A;  3WNE A;  4M3W A;  1NK8 A;  1JXE A;  1XHZ A;  1IH7 A;  1N6Q A;  1B92 A;  2YHB A;  4GVM A;  4FLW A;  5J2N A;  1WSF A;  4CJW A;  2EHG A;  1KTQ A;  4EP5 A;  4DTM A;  4CK2 A;  1YTA A;  4KTZ A;  4E1M A;  3OYK A;  4BDY A;  2AJQ A;  4IDK A;  3IRX A;  4CHZ A;  4ID5 A;  2Y1I A;  3TI0 A;  1KSP A;  2DTU A;  3AA5 X;  1JLE A;  5C25 A;  4J2E A;  3V1O A;  2G8I A;  3RMB A;  4QCL A;  4DQP A;  5EU7 A;  1I39 A;  4HVJ A;  3KK2 A;  4CJQ A;  1L3T A;  1RT7 A;  4CJU A;  4FLX A;  1X9S A;  2OZS A;  4ELT A;  1ASU A;  4YFU A;  3V9U A;  1L5U A;  4LH5 A;  4KHW A;  2OPS A;  2XY8 A;  4Y1C A;  3MXI A;  5C24 A;  1RBS A;  3HO1 A;  2BE2 A;  4O44 A;  3RRG A;  4CED A;  4CJE A;  1IKW A;  3SUQ A;  4CEE A;  4FYD A;  4N47 A;  3MEE A;  4I9L A;  3D0P A;  3DMJ A;  3LAL A;  4O0I A;  1CZ9 A;  2FBY A;  3AVB A;  1N5Y A;  4TSX A;  2QXF A;  2OZM A;  4DWI A;  5T7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...