4IDKA

Hiv-1 reverse transcriptase with bound fragment at the 428 site
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 161
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4idkA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4idkA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4idkA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4idkA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4idkA05
4CEOA 1QAIA 1U09A 4Q44A 1D5AA 2WONA 3SQ0A 3T5HA 5HRNA 4BWJA 4BACA 2DY4A 4EYIB 4LH5A 5JS1A 1RT4A 4H4OA 3I5BA 3OYNA 3ZT2A 2FVQA 4IFVB 1S9GB 4QWEA 2ZQBA 4DLGA 1HMVB 2AGOA 2F8SA 4DSIA 3I0SA 1EXQA 4J2BA 4QOZB 1RA6A 3TQ1A 2BQRA 1S6PA 4N76A 4DTUA 1SUQB 3KJVB 1NJXA 3VQSA 4AHCA 4TLRA 3CIZA 3PY8A 1S1WB 2JEIA 4O3NA 1S1UB 3V81B 4PUOB 4ZVEA 2XI3A 1RDRA 2EHGA 1XR7A 4M3ZA 1FXXA 1S0MA 3QZ7A 3OHBA 2UVWA 4CJFA 3VN5A 5J2NA 2YNFB 1NK0A 3L8BA 1ZYQA 4IR9A 3AO3A 4IG3B 2XY8A 2OPSB 4DFPA 3DLRA 3S9HA 2FVSA 5KFEA 3O3FA 3NAIA 4L8RB 4GVMA 2OZSA 1RT1A 2W42A 3V1RA 4E0DA 1HPZB 3THVA 3OS1A 5J2MA 3QIPB 3VQPA 1HQUB 4URQU 2FBXA 3AO5A 3OYAA 4LH4A 3RR7A 3ZSYA 5L1LA 1GOAA 3OYEA 4JUZA 4MQ3A 4IBNA 4KFBA 1TAUA 3ZT4A 2OPQA 3E01A 1L3VA 5KT5A 4ED6A 4IRCA 3PX6A 1VSMA 1DLOB 2OYQA 3C6UA 3VQ6A 1T8EA 3V9ZA 4C8LA 3AO4A 3MXMA 1LWEA 5L1KA 4JV1A 1RBTA 4CEDA 2OA8A 1C1CB 1L5UA 5T14A 4KREA 5KFZA 1LWFB 2G8IA 5FROA 4ZVHA 3K59A 4N5SA 1HNVA 4FJHA 4CJWA 1XWLA 2QKBA 4KKOA 1TKTA 2OH2A 3RAQA 3ZSQA 2XGQA 1JKHB 4TQRA 4IH7A 3RMCA 1LW2A 1EETA 4DLEA 2RKIB 5EWEA 4CESA 2O4GA 4DQIA 2KQ2A 4EP4A 3H5UA 3KK1A 2EX3A 3OS2A 4KV8A 4B3OA 3PW7A 1X9MA 1LAVA 2HHVA 5C42B 1ZBFA 4KHUA 1N4LA 2KZZA 2VG5B 3NFAA 1S6QA 3NH0A 2W8LA 4E7LA 1JXEA 4F4YA 2XCPA 2X74A 1JXLA 4FS2A 1S49A 2F96A 2FLPA 3PW2A 2C2RA 5KFSA 5DK5A 4B9NA 3HK2A 3VQAA 3TAFA 4J2AA 1SKWA 4TQSA 2WOMA 4MIBA 4I2QB 3AA4A 3V4IB 4O0JA 4CJVA 1Y97A 2WCXA 5F8MA 4DG1B 4RZRA 1RT6B 3H08A 4CGDA 4AHRA 2GIQA 4ED0A 3N6LA 4K4YA 2E4LA 3MEGB 2B6AA 4QWBA 4ZPDA 4IG0A 4J9SA 5KRSA 1REVA 1WSIA 4DU4A 3HVRA 3V9SA 2G8WA 2W9AA 3IRXB 4XIUA 1XR6A 2RDIA 4MIAA 3VA0A 2HHTA 3KK2B 5KG3A 4CEEA 3SJJA 2D7SA 5KFOA 3VQDA 5KGXA 3IG1A 1X9SA 3OSNA 3AO1A 2RDJA 1C0UB 3SUOA 5DG7A 2IAJA 4LSNA 2DPJA 2AGPA 4MFBA 4PQUA 2G8KA 3L2QA 4NLXA 3N6MA 3SUQA 1IH7A 2ZE2A 4O5BA 3PR5B 5C25B 1YTUA 1TKZB 2KFZA 1NK7A 4Z4CA 2WHOA 4AHSA 1FK9B 4QWAA 3ZSXA 3G6XA 4BE2A 4KTWA 4CHNA 1RTHA 3AVFA 3DLHA 1RT3B 4LSLA 4BE1A 3FRZA 3V1QA 2Y1IA 3V6JA 4AHUA 4F3OA 4MKAA 4LQ9A 4K4TA 4NLWA 1TL1A 3OYHA 4KHNA 3DRSA 3BDPA 1SH2A 4NCGB 1D9FA 2V4QA 4IFYA 1L3TA 4NYFA 2HMIB 2C2EA 1C6VA 1B9FA 5KFGA 3HM9A 4M94A 2JEFA 4AILC 1IKVA 5EWGA 3MEEB 5C24A 4TYAA 5KFBA 1K6YA 4CEAA 4M45A 5JXSA 5HBMB 1VRTA 2IC3B 5KI6A 3RTVA 5KT4A 4W5RA 4GW6A 3TANA 4O4GB 3O4NA 5HP1B 4RW6A 5CZ1A 2ILZA 1QTMA 1ZBHA 4ZVFA 4C8KA 4FJMA 2FVRA 3UPFA 4HUEA 1VK0A 3TVKA 4EO6A 1RTIB 5KFDA 3VQ5A 4EBEA 2P51A 3GIMA 4I2PA 3KLFB 1BIZA 3NGZA 3AVGA 4CGJA 1U48A 4ECXA 4CFDA 4FLZA 4Q43A 4LY7A 3CQ8A 4FM2A 1ZBUA 1JLGA 1S9GA 2RF2B 4RW9A 3TAQA 3F9KA 3KHLA 5HRSA 1ASWA 2YNIB 3AA2A 4FK0A 1TP7A 3OYCA 2VG6A 5J1EA 2XCAA 1N5YA 1VSDA 1S1XA 3KJVA 2R8KA 4J2EA 5KFPA 4IR1A 4DQQA 3MR6A 2G8VA 1RILA 3OL6A 3SFGA 2W9CB 4K4XA 3GV8B 1R0AB 3DRRA 4IKAA 3PW4A 3U3YA 1JL1A 1S1UA 5FDLA 4FXDA 4KHYA 4RU9A 4K50A 3MR5A 5SWMA 3Q8SB 1XC9A 1KLMB 4Z4EA 4CEZA 3HVWA 1HJRA 4YFUA 2PYLA 1IG9A 3QEVA 2Z1JA 4ED2A 3D45A 3NKYA 2GIRA 3ZSVA 5HROA 3QYYA 1HRHA 3OYJA 2HWIA 4CJ5A 1HPZA 3HO1A 4B9LA 1BQMB 3DRPA 3CO9A 5KG4A 3RB4A 2HNDB 2V9WA 3HVTA 4Y2CA 3LALA 1CXUA 3RRHA 3KLGB 1NK6A 4DTRA 1X1PA 3VQ8A 1W0HA 3QLHA 4E7KA 1TVRB 3SPZA 3M8PA 3OVNA 3CDUA 2PZSA 4NYZA 3NGYA 4B9VA 4IQXA 1S10A 4OKEA 2C2DA 3AVMA 3SUNA 3PW5A 4ZP6A 1C1AA 1TGOA 1NK4A 1NJYA 1LWFA 2I1RA 3KHHA 3CJ3A 1UWBB 1S9EB 3HSTB 1S97A 4YQWA 4WFZA 4I7FB 3VQ7A 3NDKA 3HP6A 3RB6A 4O44B 4CJRA 2VG7B 4N41A 1TKXB 1S4FA 2RKIA 4O3OA 5F8LA 3DI6B 3RWUA 1WSHA 1KTQA 3AA3A 2FJWA 4BE0A 4FJIA 4KI6A 4CEQA 1KHVA 1BQNA 5C42A 1C0MA 4AHVA 3T1AA 2DFEA 4RUAA 1TL3B 2VG5A 3DLEA 2OPPB 4NLUA 5F8IA 1KVAA 1XHXA 3DLBA 4ID5A 1RTJB 3GIKA 3ZSWA 3V6DA 4RNOA 4J9NA 2IBKA 2O5DA 3H5XA 1RNHA 4IRKA 3AVIA 3AVCA 3IN5A 2R2SA 2ZKUA 1LWCA 4HHTA 4J9QA 1S48A 1DTQB 2R2TA 3L2VA 4NLPA 1ZTWA 2ASLA 1J5OB 4B9MA 1C1BA 1ZETA 4TY8A 5F8GA 1KFDA 1U45A 2B5JB 4KE5A 2X6NA 1BISA 4DL2A 1RT5A 4J9OA 2YNHB 3GYNA 2E6MA 2IOCA 3V4IA 5CYMA 1GX6A 1BIUA 1ASVA 2R8JA 3V6HA 4O3QA 3KIOA 3B6PA 4RNHA 3JSMB 2BQUA 1WSJA 1WAFA 5E41A 4BDZA 4B08A 4JV2A 4CJUA 1T03B 1MU2A 2YNGB 3IRXA 3DLGA 1U04A 1VSEA 3CJ0A 3KK2A 3PO5A 5J2PB 3VQEA 4BWMA 4E3SA 2XY6A 1JLBA 5CYQA 1RTDB 4ECQA 1T05B 4QWDA 3S3OA 3M8QB 1C0UA 1S5JA 3LP2B 4DL5A 4IRDA 2W8KA 4Y2AA 3CM5A 2HNYB 1HNIB 3MFIA 5I42B 1TKZA 4DEZA 3I5CA 1S1VB 4CECA 4CK2A 3OYFA 1TKDA 1UOCA 5KFAA 4FJGA 1FK9A 4W5NA 3HP9A 3HYFA 1QSLA 4CGHA 3CJ5A 4B9UA 4RW7B 3E51A 1N6QA 1RT3A 3QZ8A 3QO9A 1YVFA 3LP3A 2O4IA 3NF7A 4M3RA 4CF0A 3AVNA 4C8MA 2IMWP 1SH3A 3DOKA 2ASDA 4FJKA 4ECRA 3ZT3A 4DS5A 4NCGA 4W5OA 3M8RA 1Q8IA 3MEDB 1TK8A 4FLXA 1KRPA 3MEEA 3TAEA 4ZHRB 1RBUA 1EP4B 1RDCA 4N47A 3K5MA 1IKWB 3DDKA 2FC0A 5D3GB 2IA6A 4RW4B 3DLKB 1D0EA 1Q9YA 3KK3B 2BANB 4CJLA 4WZQA 4FLUA 1XI1A 3NHGA 4F3TA 1K1QA 3LANA 4CJPA 2HWHA 1DTTB 4E1MA 5FRNA 4QCLA 5HP1A 4DF8A 4O55A 3Q8PB 4FJLA 2R2RA 1NKCA 3L3UA 1FKOA 3GIIA 3WNGA 1IKYA 1RTIA 3H4DA 4HUGA 1C0TB 3K5LA 4YNQA 4KO0A 1VRUB 4BDPA 5DQIA 3FSIA 4CGIA 5SZTA 4B9TA 4CK1A 3K57A 2HW3A 4M42A 1LW0B 1HARA 2PY5A 3LP0B 4FW1A 3DYAB 3HXMA 4F4ZA 3EZ5A 4HKQA 5DQHA 2I5JB 1JLCB 1HQEB 5KFMA 3G10A 1LV5A 1XR5A 1F21A 4EBDA 4CJSA 4KRFA 3SI6A 1L3SA 2W9CA 4OPJA 1WN7A 4OVLA 3TAPA 4K4WA 3OYBA 4EEYA 2FLLA 4F8RA 1YT3A 4W5QA 3I0RA 1FKPB 1JXBA 4RUCA 3NF6A 5J2QA 1NJWA 1U47A 5HRRA 3M8SA 3T19A 1KLMA 4FZYA 3KLHB 3PO4A 4FK4A 3PX0A 4HVJA 2XGPA 3F73A 2VA3A 4OKJA 2QK9A 1BI4A 3H5SA 2ITGA 4MH8A 2W9BB 2Z1GA 4Z4HA 4CGFA 1JLFA 4Q0BB 4ED1A 4FBUA 4WE1A 4CERA 4DSLA 2HHUA 3FFIA 2HNDA 3OYGA 3CDEA 3OYKA 2ILYA 3OL9A 3KLGA 4ZP8A 4NZ0A 1Q9XA 4RNMA 5KFLA 4NLTA 2R8IA 4OJRA 2P5OA 4ICLA 3K2PA 4IKFA 4W5TA 3NBPA 2R2UA 3NF9A 3KMQA 3PHEA 1JLAB 3IS9B 4EO8A 2D3UA 4J9RA 1JX4A 4F4KA 1RT2A 4C8OA 1W25A 3KD1E 4FBTA 4FLTA 4HTUA 1QE1B 2HVHA 5KG7A 3OHAA 3SZ2A 4I7FA 2DPIA 2BE2A 2JC1A 3CWJA 2YKMB 3BSNA 4JRPA 1IKXA 3BREA 2V0NA 4ECSA 1TKXA 2R8GA 1WNSA 1KCFA 4IDKB 1Z26A 3RRGA 3PW0A 1WSFA 2ASJA 1KLNA 5I3UA 2IJFA 4WYWA 3BSCA 1BL3A 1TV6A 4K8ZA 3VQ4A 3DMJB 4FZZA 1SV5A 1BHLA 3OJUA 3CVKA 4FS1A 2HNZA 3NAHA 1JLQA 4J9PA 3KLEB 4TXSA 2YKNA 1RT7A 1NNDA 4ZPBA 1DTQA 2W7PA 3PJWA 2XRIA 5KRTA 3KHGA 2DTUA 4JS4A 3S3MA 3LWLA 2D3ZA 2G8FA 2UVUA 2B5JA 5CY4A 2F8TA 4DL6A 2D5RA 3MF5A 3HL8A 4C8NA 1KSPA 4KSEB 3T5JA 3CYMA 4KAIA 1RT4B 4H4OB 3GILA 1IO2A 3BGRB 1C2PA 3AVJA 4CIGA 2AU0A 1HYSA 4OGCA 4ELTA 1T03A 3I0SB 3TAMA 1HYZA 3ISNC 4TYBA 2YNGA 3GV5B 1RYSA 1S6PB 3HT3A 3AVHA 5KFVA 3PZPA 2IM0A 4Q5VA 3OYDA 4DL7A 1RTDA 4H4MB 3JYTA 4JS5A 4OGEA 3M8QA 3LDSA 3IGNA 1WSEA 3LP2A 2BDPA 1JLEB 3DOLB 2P5GA 5L1JA 4ELUA 3OL8A 5J2NB 1IM4A 3BSOA 1QSSA 1S1VA 4ECVA 4ZTJA 1RAJA 3C95A 4DTOA 3BQ0A 3OYLA 2UVVA 3H2LA 4IFVA 4G1QB 1T3NA 4Q45A 4K4UA 1HMVA 1RT1B 2ZD1B 1UAXA 3NF8A 5J2MB 2KZMA 1SUQA 5KFHA 3SQ2A 3GV7B 4KHMA 5KT7A 3VQQA 1NK5A 1S1WA 2VWKA 3MECB 4M41A 1CLQA 2OPQB 3E01B 3V81A 4PUOA 1ASUA 2B4JA 3OJSA 1JIHA 5KG2A 3CFOA 1RA7A 3CFPA 2R7YA 1LWEB 4RW4A 2YNFA 2IJNA 5KGWA 2IM3A 5KFNA 3OLBA 3RR8A 4IG3A 5F8HA 3QGGA 2OPSA 4NRUA 4R5PB 1DTTA 3OL7A 3KLIB 3Q8RB 3SV3A 1Z25A 1HNVB 3SYZA 3V9XA 4I9LA 3OS0A 4KKOB 1KFSA 2FBTA 1WSGA 1X9WA 3T3FA 3FQLA 5KFYA 2FLNA 5KG1A 1C0TA 3QIPA 1HQUA 2XHBA 3QEPA 1NOZA 3A2FA 1WLJA 1EETB 2EC0A 1UA0A 1SL2A 1RBSA 3KK1B 4CJ4A 1VSIA 1A5XA 4KV8B 4OLBA 1NOYA 4NCBA 1DLOA 1HQEA 1VSKA 3RB0A 3BQ1A 2WTFA 1CZ9A 1RDDA 5FRMA 1I3AA 3CG7A 1S6QB 4ZPAA 3HJFA 4R8UB 2AX1A 1QHTA 4RNFA 2QE5A 1C1CA 2PYJA 3M9MB 4F2RA 3U6FA 2AQ4A 3CJ2A 1YVUA 3VQBA 4ED7A 3ITHB 4NLRA 1JKHA 3QNNA 2G8HA 4MK7A 1QS4A 5DQGA 2WOMB 3MR2A 4J9KA 5L1IA 1VSFA 2HB5A 2W7OA 4K4VA 3UDLA 1TQLA 3U3GA 3UQSA 3KHRA 5KFFA 4DTSA 1REVB 2YHBA 2AWZA 2UUWA 4DWIA 2ALZA 4DTJA 1S9FA 4PWDB 2YV0X 3SCXA 2FVPA 5HLFB 4M3XA 4XO0A 3BR9A 2X6SA 4O0IA 2OPRB 2AX0A 1SKRA 4YR2A 4FLVA 5DLFA 3VA3A 3NL0A 3ICLA 3HKWA 1B9DA 2G8UA 4FM1A 4NLGA 3ZSOA 2IAJB 2D0BA 4MFBB 4Q8FA 1QUVA 4HCBA 4FVMA 4ID1A 2J6UA 5KT2A 4I2QA 4CHQA 4DG1A 1RT6A 4NRTA 3DM2B 2VWJA 3MEGA 1WAJA 4XPEA 1RCHA 3KKSA 1RTHB 1S0NA 3MAQA 2QKKA 1GOCA 4KB1A 4ZPCA 2KFNA 4LSLB 3NH1A 4N56A 2UUTA 4E7HA 4CCHA 2IM2A 4U7CA 2E6LA 1U49A 3RBDA 4CJEA 4Y3CA 3DRSB 4OL8A 4ED3A 4IFYB 3T5LA 2WRMA 3SV4A 2NUBA 3BQ2A 4BDYA 4DFJA 1G15A 3DMJA 4H8KA 3EPGA 4IH6A 5KG6A 4MK8A 1IKVB 2J6TA 2KW4A 3NMAA 5C24B 4CHYA 3V9WA 3OLAA 3L3VA 1LAWA 4EZ9A 2YHAA 4DL3A 5C25A 2XY5A 3KLEA 2D0AA 2Y1JA 1CZBA 2DFFA 1J9AA 4TSXA 4DSJA 3WNEA 3C94A 4CF1A 3O4QA 4RW6B 4FM0A 4LD0A 5T7BA 4JLHA 2FJVA 1BCOA 3GQCA 1JL2A 1NHUA 4NLVA 3RBEA 3ASMA 4I2PB 4GC7A 3KTQA 3T5KA 5KFJA 4NLSA 4KB0A 4ZP9A 3S3NA 4KI4A 3BGRA 3ZSZA 4M95A 4B8CA 3SQ4A 4DFMA 4B8AB 4X2BA 1JLGB 4O3SA 4RW9B 1XHZA 2QV6A 3KD5E 2HMIA 3M9NB 4F2SA 1BCMA 4CEBA 4ELVA 4NLOA 3QEXA 2VG6B 5J1EB 4U6PA 4DL4A 1N5YB 1S1XB 4KB7A 1SL0A 2HHQA 4DSFA 5HBMA 3AVBA 2IC3A 4RW8B 4E89A 3DRRB 2GBZA 2GUIA 4H4MA 4O4GA 4DF4A 4FYDA 3FDSA 3PVXA 3TR8A 5FDLB 1WNEA 4RNNA 4KHQA 1CXQA 3NGDA 5KFWA 1JLEA 1SL1A 3DOLA 4FJXA 4EZ6A 3SQ1A 4FW2A 4FJJA 2ATQA 4DQSA 4CF8A 1SKSA 3V6KA 3KLFA 3H4BA 3LWMA 4KTQA 5KFTA 1MMLA 4QW8A 1W9HA 3SI8A 4CJ3A 4FJ9A 1QSYA 3AO2A 2RF2A 3V1OA 4G1QA 5HROB 1S1TB 2YNIA 2B43A 2ZD1A 1NKEA 3L2UA 1KVCA 3EZUA 1L3UA 4Z4GA 3DRPB 4NLDA 2HHWA 4DU1A 3M9OB 1QQCA 3QIOA 1I6JA 4J9LA 4G3IA 3HVTB 1R0AA 3SPYA 3HPHA 3MECA 2FBYA 3QLHB 3M8PB 5HRPA 4FK2A 4DSEA 4EYHB 3LZIA 4YP3A 5JS2A 2KTQA 3WNHA 5KFXA 3K5OA 4QW9A 3UIQA 4R5PA 3H59A 1GOBA 4JRQA 3KLIA 4YR3A 1NJZA 3G6YA 3D5MA 2CJQA 1I39A 1Z4UA 4CFCA 4B9SA 3TARA 5DG8A 3K5NA 3KOAA 5DLGA 5DMRA 3OY9A 1BQMA 4EBCA 4KHSA 3VQCA 3LZJA 3LP1B 1EKEA 4PA1A 5EWFA 2XO7A 2JC0A 3H5YA 4Z4FA 4AHTA 1BGXT 1BQNB 1TVRA 1TAQA 2FVCA 3DLEB 4ID5B 3MXIA 4NLQA 3V6DB 1OS5A 4CIFA 3HPOA 3I5AA 4R8UA 4ECUA 3ZCMA 4MK9A 2VA2A 4FJ7A 3QGHA 3C6TB 3L2RA 2R8HA 1RDAA 1LWCB 5CZ2A 4KTZA 5C5JA 4E7JA 3EYZA 1UWBA 1S9EA 2ETJA 4LQ3A 1C1BB 3HPGA 2D41A 4TY8B 4YR0A 3P5JA 3ITHA 4O44A 4CJQA 4CF9A 3MFHA 3LAKA 2VG7A 4HUFA 1RT5B 4DU3A 3ZT1A 3QESA 3RMDA 2HHXA 5CYMB 2F8EX 3DI6A 4M3WA 4E19A 1U4BA 2UVRA 1KVBA 2QXFA 1TK5A 3V9UA 1SH0A 2JEJA 4J9MA 3QETA 4KHRA 4WXWA 1TL3A 2OPPA 4PWDA 3KLVA 1MU2B 1RTJA 4DQRA 3VQ9A 5HLFA 4DTPA 3DLGB 1VSJA 2JGUA 2OPRA 3EY1A 2AGQA 3QNOA 2E9TA 1JLBB 5CYQB 5K14B 5DG9A 4KPYA 1J5OA 3QEIA 2WONB 4M3YA 3MR3A 4F50A 3TWHA 5KFIA 5KFQA 2GC8A 3BJYA 2HAIA 3IAYA 1D1UA 3ZSRA 2YNHA 4FLWA 4E7IA 5F8JA 3PJXA 5EU7A 2A1RA 4Y34A 2WB4A 4JV0A 2WK4A 1J53A 5EUHA 2RPIA 3HVAA 2IS3A 3DM2A 4O4RA 4WFXA 1N56A 3JSMA 2BRKA 3NE6A 4DMNA 1N6QB 3NAEA 4RG8A 3QINA 3KMSA 3QO9B 1ZBIA 2XC9A 2GV9A 2XI2A 3PR4A 2HHSA 4CEFA 3RB3A 3DOKB 1HYVA 5J2PA 1RBRA 4KBIA 2C28A 1VSHA 1QAJA 1T94A 5KG5A 5KT6A 1T05A 3RAXA 5KG0A 4M3UA 5KFRA 3AV9A 4DTXA 4ECWA 4DQPA 4FCYA 4HYKA 3NGIA 4OKKA 3L2WA 4NYNA 1RBVA 2HNYA 4FJ5A 1HNIA 5I42A 5F8NA 3AVKA 3LPTA 4XPCA 1D9DA 4RW7A 3QGIA 3NCIA 2E9ZA 4F4XA 1FKOB 2JEGA 4IH5A 1D8YA 4DTMA 1IKYB 4QPXA 4OPKA 3QERA 3BSAA 1O1WA 4KO0B 3G0ZA 1EX4A 2BRLA 3FQKA 3OSPA 4I9QA 2Z1IA 2IGIA 4CFBA 3MEDA 3CM6A 4KFBB 4Z4IA 4URGA 2ATLA 4CHOA 2E9RX 5DGAA 4ZHRA 4TY9A 4O3RA 4GMJB 3C6UB 1EP4A 1NK9A 2BR0A 4IOBA 1IKWA 4QAGA 2CKWA 3D0PA 5D3GA 3DLKA 3CFRA 3KK3A 1KHWA 2BANA 4Y1CA 4KHWA 4RW8A 1ITGA 2IDOA 4CIEA 1A5WA 4CJTA 2C22A 2BQ3A 3CJ4A 3B6OA 3I0RB 1J54A 3AVAA 1VSLA 1TKTB 3H40A 2XWYA 5J2QB 3P1GA 4CK3A 2RN2A 3SNNA 3IGVA 2JLEA 1LW2B 4CFAA 1VRUA 3ULDA 3QIDA 4ECTA 1LW0A 2V4RA 3LP0A 3MXJA 3DYAA 4WYLA 3ZT0A 4NLYA 1BI4B 3RMAA 4B3OB 3MTKA 1S1TA 2FBVA 2I5JA 3HHKA 4ED8A 1UA1A 1JLCA 4URSA 4E1NA 4ZVGA 3ALYA 5F9NA 1YTAA 4CJKA 3LAMA 1A5VA 4AH9A 4YMEA 4F4WA 1JLFB 4O3PA 4WE1B 1NK8A 3FFIB 3G6VA 3PV8A 1NKBA 4ECYA 4OLAA 1ZBLA 3N6NA 4M3TA 3AVLA 3QEWA 3CDWA 2Q3SA 5DGBA 1T7PA 3ISND 4J2DA 3O3HA 3G86A 4WXOA 1ZTTA 1FKPA 1TK0A 4ICLB 4CE9A 5JUMA 4WFYA 3P83D 4FLYA 3NBPB 2XY7A 3KLHA 3KKRA 3WNFA 4GC6A 2DFHA 1RT2B 3AA5X 4TN2A 3UR0A 3EPIA 4FJ8A 2B6AB 4Q8EA 4K4SA 4CHPA 4IG0B 2P1JA 2W9BA 2BE2B 4CHZA 2Z1HA 1RYRA 1CSJA 4K8XA 2HVIA 1IKXB 3LP1A 4Q0BA 4DSKA 1N48A 3K58A 3TABA 3O3GA 4ECZA 3PUFA 5EDWA 2A1SA 5I3UB 1B92A 1TV6B 5KFCA 3IG1B 3PX4A 3SFUA 5KFKA 5KFUA 3TAGA 1NHVA 4CGGA 3Q8QB 1SV5B 4DTNA 4LSNB 4PQUB 4ZTFA 3NH2A 1JLAA 3IS9A 4Y1DA 2HNZB 5KT3A 1JLQB 2ZE2B 4K4ZA 3C6TA 1RDBA 2YKNB 1RT7B 3OYIA 1GX5A 3KNAA 2D0CA 2J6SA 3GIJA 4Z0UA 2AJQA 1QE1A 1S0OA 3OYMA 4QWCA 2X78A 2BGGA 4ZP7A 2YKMA 2OZMA 5KTQA 2FJXA 4EP5A 3I8DA 4IDKA 3SUPA 1TL1B 4KAZA 4UQGA 4WZMA 4NCAA 3LPUA 4R0EA 5L9XA 3D28A 1HYSB 4ZMMA 4MKBA 4PY5A 3TI0A 2LSNA 4FZXC 3TAMB 4DS4A 4H54A 3RMBA 4FJNA 4HCCA 1VRTB 5F9LA 2IM1A 1K1SA 4CF2A 3H98A 5K14A 3JYTB 4DFKA
chains in the Genus database with same CATH superfamily
1U09A 1D5AA 2XMWA 3CD6S 1J6ZA 4BACA 2DY4A 2LU2A 4LH5A 2X1AA 1RT4A 4H4OA 1ZH5A 1GTHA 1KOHA 4JI4K 2FVQA 3W5ZA 5LSOA 4IFVB 4YDUC 2ZQBA 4JP8A 2BJ7A 2VHGA 3I0SA 3CDBA 4QOZB 2Q6BA 4DTUA 3KJVB 4IOCL 5AJ3F 1KC8O 1H72C 1RWOB 3D66A 2LQJA 3ZTRA 4EIAA 1BXNA 2I7PA 3FGUA 4WFAQ 1G1XA 3RBZA 1JCGA 2EFPA 2HBQB 3N79A 1ZC6A 5AQNA 3R5JB 1S1UB 3I56N 3SSSA 4JKGB 4ZVEA 1RDRA 4KBOA 4M3ZA 2CNKB 4IUFA 3VN5A 5J2NA 3ZO7A 2YNFB 2RSQA 3NMUA 1VQON 1ZYQA 1V3RA 1WC0A 4IG3B 1LXNA 2XY8A 2OPSB 5D4OA 2M4MA 3TZWA 4CBWA 1VAZA 2MKYA 4TU8A 2XNRA 3NAIA 3R3LA 2XBPA 2G13A 5EHHA 4WFAL 4FXVA 3OS1A 3QIPB 3E3XA 2CQ1A 1HQUB 2B4PA 4URQU 2P2CB 1NM2A 2BJ9A 5L1LA 4UZCA 4U67Q 3NOCA 1BUPA 4OPAA 3OYEA 5FLXY 3CXCM 4JUZA 4KFBA 2KVIA 3RG6A 2ZEJA 5FPEA 4JI3K 1L3VA 5KT5A 5T7LB 4FF2A 3PX6A 4W90B 1B4SA 2NRVA 3CMQA 3IA0A 1T95A 5L1KA 4JV1A 3MN6A 3WXIA 4CEDA 1U1MA 2OA8A 3G82B 1Y11A 2UXBK 3J7ZT 1MMNA 5IWAF 4GV3A 1WBBA 4K59A 1N36J 3D0GE 1S6OA 3O1WA 2WVCA 2MZ1A 3SAFA 1GXTA 4U67L 2XGQA 1VK3A 2LXUA 3R2DJ 4DQIA 2O4GA 2KQ2A 2O8CA 3JTPA 3N5BA 3MPWA 4BR9A 3MTJA 4OX9K 3THXA 4B3OA 1ZBFA 3M2VA 2VG5B 2B4VA 3ZTSA 2XS7A 4E7LA 3TA0A 1N32K 1AFJA 3VQTA 2XCPA 4RU2A 1F1BB 3CCJN 4LRFA 2NXNA 2F8MA 2C2RA 2BV3A 3N4PA 3R5BA 4OHZA 2ZH9A 2BYCA 1GTEA 3CCSS 1Y97A 2CXEA 4RZRA 4DCOB 1X4HA 4DV6F 1RT6B 3H08A 3N6LA 2E4LA 4YB5A 1GMUA 3C66A 2G0JA 3EXYA 2ZDPA 1REVA 1F5CA 4FWNA 3CCTA 3I6PA 4YS2A 3V9SA 2G8WA 4LVNP 3UCGA 3IRXB 4XIUA 5K5MA 1XNQJ 2HK3A 4LF7F 3KK2B 2A40A 4CEEA 1IV0A 2KJVA 3SJJA 2D7SA 2CADA 1JK9B 4CZIA 3VGTA 4LF5J 4LSNA 1OPIA 2AT1B 2FQQB 6FD1A 4CLZA 3L2QA 1CEZA 5ETOA 1X60A 1T9YA 4KGVB 3BGOP 1WF2A 3TUPA 4A62A 4Z4CA 1HWKA 4AHSA 4QWAA 2DIUA 2DT9A 3VEVA 4CD1A 5A8KB 4BG9A 1YVNA 4KTWA 1RTHA 3AVFA 1NGDA 2Z57B 1U6BA 4PWUA 1UW9A 2Y1IA 2YX1A 4CI6A 1SQGA 2EFQA 1W7WA 4W92B 1TL1A 5GAHU 2HURA 1U7LA 2HFOA 1YG0A 3OTDA 1SH2A 5BYRA 3W65A 2MQPA 1B9FA 2KH9A 2QM1A 1PJ5A 2VQFK 3D6MB 1RAFB 4TYAA 5KFBA 4CEAA 4M45A 5LJVA 3FVYA 3RTVA 4LFAK 4MLHA 5HK4A 4GW6A 1VK8A 1OH5A 3CMES 2ROPA 3HCXA 5CZ1A 2PSZA 3SDEA 1QTMA 1DGKN 2KI2A 3UPFA 4ZN3A 5E3PA 4FZVA 1MWQA 3IAS9 5KFDA 1RP5A 2DHHA 1Y5NB 1HX1A 3O1BA 1CJKA 2GVDA 3NGZA 4IOAL 1U48A 2AHOB 1NM1A 4LY7A 4RUBA 4FM2A 1NEEA 3MM9B 1S9GA 5I3PA 1QM9A 4I68A 4LSZB 3GDQA 4CBUA 4FK0A 2DGQA 1TP7A 4FYXB 3DFEA 4ER8A 4B3TJ 4A61A 4DQQA 3C3LA 1BWVA 3OL6A 4I1TA 3OA9A 4BRQA 3SFGA 1VQLS 4UT4A 1R0AB 2XYPB 4IKAA 1YJTA 3O2IA 3VPZA 2AJFE 4DBQA 3CC4S 3OTCA 2GQCA 4LR8A 4K50A 4Y2KA 1T9TA 4CLTA 1KQKA 1KLMB 3GFHA 3NLCA 3I55N 1HJRA 3CJRA 3BN4A 5IXUA 2PYLA 4C2MA 1FEHA 1OSCA 1SI9A 2GIRA 2GW8A 1ZA1B 2BX6A 1HPZA 3HO1A 4B9LA 3UKRA 5AQTA 4OHXA 4MO5A 3A13A 4TVAB 2HNDB 2V9WA 2CRLA 3RRHA 3PXGa 2DD8S 4ZIWA 4K2XA 1J5EJ 4K0KK 1OQ6A 5EN1A 3CDUA 1ZBSA 1F2HA 4FF4A 3DU5A 4G6VB 4IQXA 4OKEA 2DHAA 1AROP 4JI1K 1D09B 1C1AA 2KXNB 2VJVA 3D2EA 1FERA 4JI5K 3DXSX 5E3AA 2B3TB 1FJGJ 1QQMA 4WFZA 4I7FB 2PMZD 4M7XA 3VQ7A 3NDKA 1GNKA 4N41A 3TX8A 4KHPJ 2F3JA 2J9DE 2ZF5O 5F8LA 3DI6B 3CJSA 2ABYA 4L72B 2UUCJ 3M4XA 2DR5A 2NZCA 2HZCA 4LBPA 3QJJA 2PA3A 2E1PA 1VQNS 3JAMY 5F8IA 1KVAA 3DLBA 1RTJB 2VASA 4OQJA 1S5ZA 1RNHA 4IRKA 3AVIA 5EXWA 2R2SA 4ENOA 1CBKA 1CS4A 2M7SA 3NVKA 1LWCA 4J9QA 1WOPA 2R2TA 4JKAA 1J5OB 3W3DA 5A8WA 2CIMA 3VHQA 1ZETA 2B5JB 1XMQK 2X6NA 4DL2A 4LFBJ 4V19J 3GYNA 1Q86O 1U6ZA 3CETA 2IOCA 3V4IA 2IVMA 1GX6A 1SPBP 2KT3A 1HUXA 1BIUA 1N36F 5K8NA 4X4SA 3KUEA 1CQNA 3JSMB 4B3MK 4DR4J 2VQEJ 1T03B 1MU2A 1REGX 2FYXA 4P10A 2YNGB 1PGZA 2Q6CA 4USUA 1QUPA 2OELA 5J2PB 2EFNA 1TYQB 3QRRA 3VAGA 4E3SA 1JLBA 1JJ2R 1RTDB 2O3DA 4ECQA 1U1KA 4QWDA 2QWPA 2M5YA 3O9SA 4H5TA 1TKZA 4CECA 2VJUA 3NCQA 5HVFA 5KFAA 3HP9A 2HBKA 3HYFA 2AYGA 2OD6A 4ZCMA 1RT3A 3QZ8A 1H1VA 2RUGA 3NF7A 4A8KA 4M3RA 1NGBA 4X65J 3KG4A 1K9MO 3RRKA 1SH3A 3DOKA 2ASDA 4FJKA 2Q97A 3I32A 4ECRA 3ZT3A 4ZVSB 1UZHA 4W5OA 2JVRA 1RZMA 3MEDB 3TVZA 4G65A 3RU0A 3MI7X 5DO2A 4FF1A 4ZHRB 1XNQF 3K5MA 1IKWB 2XMVA 3AAQA 1DJ0A 2FC0A 2B51A 1D0EA 1Q9YA 2BANB 3T9NA 2G1DA 4WF9Q 2MHNA 4M5KA 3W60A 4F3TA 1NB2A 3LANA 4LF5F 2LFVA 4NI2B 3BPDA 4X64K 2W2OP 5AQOA 3WNGA 1C0TB 3WXLA 1ZXOA 5ETMA 4BDPA 2NRWA 1NDCA 4ISFA 3EXCX 4M42A 4FW1A 3DYAB 3EJMA 3T69A 3CJCA 3AXMA 3GIRA 5DQHA 3U27A 2I5JB 4WF9L 1CJVB 3FRYA 3CCRS 1CPZA 3I4PA 1LV5A 5HMYA 1HBUB 4JI7K 4CJSA 2YWFA 2W9CA 4OPJA 2LKZA 4E98A 3VOVA 1HNWK 4K4WA 1XK8A 3S7RA 1IG8A 1QZ5A 1UWAA 1SQEA 4M5DA 1CJUB 4DPYA 4Z7YA 2FF3B 3DNCA 4DPXA 4WWSA 5HRRA 2F9TA 1VC0A 2E8AA 4CLWA 2OGUA 3MX2A 3PX0A 1RGIA 4PG7A 1AA1B 3NS5A 3CHWA 3MMAB 2MEWA 1BI4A 1P9QC 1Y5LB 4MH8A 4DX5A 2BE7D 2W9BB 2Z1GA 2ZHOA 5LJWA 2A3JA 4CGFA 1JLFA 4DSLA 2QWOA 2YVSA 3W8PA 3TX0A 4B3TF 3SCJE 4IKFA 5M2PA 5K20B 3MAAA 5E84A 4X4PA 2QA4S 4USHA 1YX2A 2D3UA 4J9RA 1JX4A 2BXJA 5GAGI 2IPOB 3VAHA 3KD1E 4FBTA 3FZLA 5DDRC 3OVSA 1QE1B 3RAMA 4LRAA 2EC2A 1KKHA 5B0EA 2Z2ZA 2JC1A 4DL0C 1S7HA 1VQPN 4JRPA 3FCHA 2VODA 4O23A 1TKXA 4C97A 2JZ5A 1PBAA 2W41A 1HBOA 4DZ6A 3L95X 3PW0A 1UZDA 2IJFA 3A3OB 3BSCA 1TV6A 4K8ZA 2DXFA 3DXMA 4FZZA 5BPNA 2P9LA 2Y3YA 4USMA 1RHUB 2CGLA 3MAHA 3UNYA 3OW2M 2HNZA 1JLQA 1KOOA 3A3PB 2MJUA 1J5EF 3BZQA 3FKBA 1DTQA 2F8HA 1SZ2A 2PAVA 1BQXA 4GVBA 1ATSA 5H9FJ 3KHGA 1DKGD 4JS4A 2B9YA 4CYUA 2UVUA 2NXJA 3CCSN 2DO0A 2UU9K 2MQ8A 1MA9B 3HL8A 1FJGF 2RAQA 3CYMA 1HHTP 4KAIA 1N52B 4FWQA 2F9DA 3V5RA 3H2VE 3BGRB 4FYVB 4BR7A 4CIGA 3HOSA 2AU0A 1HYSA 3BB5A 4KHPF 1RUSA 4ELTA 3CJ8A 1VI7A 3CE8A 3AGKA 4BC7A 4TYBA 2YI1A 3HT3A 3GV5B 3M8WA 2UUCF 4Z37A 4KH5A 4EU0A 3M8QA 3LDSA 1X4FA 1XUPO 2DYAA 3VAFA 4LC9B 2KFYA 4UUXA 4MIWA 1JLEB 3DOLB 3UNGC 1GMWA 3D3BJ 2Q1NA 1IM4A 3VAIA 3EO3A 1V5IB 1IBKK 3H0PA 3H2LA 4IFVA 1H38A 3FSYA 4G1QB 1HLWA 3BN7A 4LFBF 3J7AP 2F4VK 2OANA 2ZD1B 1UAXA 5J2MB 3AD7C 3T1YJ 3B8AX 2XHWA 4DV7J 3DLJA 2YTCA 2FY1A 2QEXS 1ZPVA 3BKTA 4ZVPB 4JI6J 2Z2YB 1NK5A 4DR4F 4M41A 2VQEF 4DV5K 2WSEC 2OPQB 2V2KA 4FWOA 1TZ0A 3I87A 3AXKA 4ZPVR 1JIHA 1RA7A 4LFCK 3CFPA 4RW4A 3QGPA 4QIGA 2CVEA 2YNFA 2IJNA 2IM3A 2FJAB 3Q8YA 2DH8A 4IG3A 1G99A 1YF5L 2OPSA 2D4WA 3CMEN 3BEGB 3OL7A 3OR2B 1HPMA 3SYZA 3V9XA 2F7TA 1C4AA 3FZHA 1G4CA 2Q79A 1WSGA 3MCMA 1KVIA 1RWKB 3QIPA 2VDHA 1HQUA 2XHBA 3PYGA 3A2FA 3SBTA 1RK8A 2EC0A 5GAEP 1Q78A 4E1JA 4OJHA 2NRHA 3VEZA 3KK1B 4CJ4A 1VSIA 2R7XA 2A3ZA 1XMBA 4PXBA 3HHLD 3IR7B 4OLBA 5T7LA 4X65F 4W4MA 1CZ9A 3JSRA 3IBWA 3KUHA 3NVMA 1VQLN 1HKBA 1NGAA 2J7WA 2PD1A 3G82A 4RNFA 1FXRA 1FI4A 2QE5A 3THPA 3CC4N 4ZVUB 4F2RA 3U6FA 3LM9A 1SJFA 2AQ4A 4H5VA 4LF9J 1YVUA 3KDNA 4EHUA 1DFDA 3VQBA 2VCPA 4CT9A 3D1HA 1Y5IB 4J9KA 2WOMB 3MR2A 2E1MC 1X5TA 2P9UB 1MWKA 4K4VA 3D9BA 4NXNK 4DTSA 3R27A 2E2QA 1U6FA 2A18A 3CB4A 3BR9A 3N01A 1G7CB 2ZOFA 4O0IA 2E2NA 2OPRB 2E1RA 2H65B 5HI7A 3NL0A 1JWWA 2HFNA 3CNQP 1RAOA 4JI2J 2GUPA 4FM1A 2VB6A 4CO3A 3W66A 4C0HA 2I38A 1MLAA 2KN4A 4P2MA 4PABA 1WWHA 2KG1A 2R4FA 1RKIA 1H2UX 2VICA 1RT6A 4X4UA 2JVOA 3OUYB 2KT5A 1WAJA 3M6VA 1RAAB 2B9EA 1S0NA 2HBLA 1TUGB 4HTJA 1UFWA 3NH1A 1K73O 3FUYA 4CCHA 3UD5A 4ES1A 1U2RA 3IWXA 3ZTQA 4CJEA 4OL8A 4C1NI 3BBCA 3QT7A 2WRMA 2ERRA 1VQNN 2ZH6A 3W2VB 5KG6A 1MDUB 4MK8A 2EWSA 3V9WA 4BLGA 1LAWA 1LK7A 4EZ9A 1K0VA 2KT2A 3KLEA 4EUVA 2XY5A 5LMUJ 1D9AA 2QG9B 3SSRA 1FVQA 1FRHA 2AIRB 4FM0A 4NXMJ 5T7BA 1FJEB 4JLHA 2FJVA 3QAUA 3AH6A 4EWTA 4ZLPA 3R2CJ 2BACA 2YKAA 1S99A 1N33K 4KB0A 2ZH2A 1JLGB 2P6SA 2CPHA 4JAXA 4AL5A 2VG6B 4DV3J 4MKYA 1J2VA 3QQCD 4DSFA 4G1IA 5DDQC 1DZ5A 5A76A 4RW8B 3P39A 2A6MA 1T44A 3BBBA 4DF4A 2NXEA 2K1RB 2XYGB 1T02A 5FDLB 2Q43A 2XSJB 4RNNA 3R5AA 1CXQA 3EEQA 1P90A 5M2RA 4NASA 4H0VB 4QYZK 5DETA 4FW2A 4OYPA 2ATQA 2VBWA 5IT4A 1SKSA 3KKFA 3LWMA 3O3LA 2ZBRA 1X4DA 4ES2A 1W9HA 1DQAA 3LF0A 3MM9A 2K3KA 3BF4A 3F2KA 5HROB 2MZQA 1KONA 1KVCA 5LJ3Y 2DHGA 3FC9A 4CLPA 1VBKA 3M9OB 4KH1B 4QQBA 3QIOA 1R0AA 2MGZB 3HPHA 3MECA 2YKQA 5F2RA 1SS6A 2FBYA 3S1TA 1X7VA 3H3OB 4FKXA 3QLHB 3M8PB 1E6YB 2QJ3A 1XIQA 3NGKA 1X31C 1RQ0A 5B0DA 2DXEA 4NX9A 2CQBA 1K8AT 1U1PA 2MSTA 1R59O 2QYGA 1YJUA 5KFXA 3K5OA 3IFEA 4YR3A 4F36A 1NJZA 3G6YA 2ZH8A 5GMKa 4QOTA 1VIOA 4GVLA 5GMDA 1Z4UA 1U8WA 2MZJA 2BW7A 2J8SA 7FD1A 4B9SA 4ZJQA 3TARA 1QAXA 5LT5A 3KOAA 3US5A 4F9OA 4I6WA 1W2BM 3BYRA 4EBCA 3HRGA 3LZJA 3LP1B 2RNEA 5EWFA 1Q4RA 5ADXH 1JXVA 2BJ8A 3MMJA 3CCRN 1BQNB 3T1YF 1KQSR 2FVCA 4DV7F 5ETSA 5AZIA 3CCLN 4ID5B 2QFJA 3V6DB 4JI6F 3G71S 4HDGA 2VA2A 4DQ8A 2CFXA 3QGHA 2E1AA 4K8RA 3O9QA 4KR0B 4A2BA 4CDIA 3ZZOA 2O8BB 3CGIA 3T6BA 2B7CB 1WKKA 1MG7A 2NYIA 5E7OB 1C1BB 2GQQA 2D41A 4YR0A 3TEHB 4CJQA 1I94K 4WP8A 4DU3A 1RT5B 1YDLA 2HEKA 3GSDA 3PYEA 1SC6A 4KJIA 3DN9A 2C2OB 5CYMB 3DI6A 4PHTX 4C11B 1KVBA 4FKYA 5B0FA 1KC8T 4KHRA 4OYOA 2KU7A 2P9IB 1RTJA 2PMHA 3VQ9A 4DR2K 5HLFA 1DEJA 3DLGB 2JGUA 3PTWA 4YOUA 8RUCA 4Y00A 1YSJA 4DI6A 3J7A1 3HD2A 2HBZB 1J5OA 1F9FA 4M3YA 3OTEA 2QA4N 2EKNA 3MM7B 5KFQA 4FN5A 3Q2TC 3BBFA 2E1YA 2A1RA 5F8JA 3PJXA 4IEEA 4DR3J 5EUHA 2DR6A 2HYIB 2EG1A 1P8GA 4H0PA 4LF9F 5T41A 2W4PA 4WFXA 5AFUH 1YRUA 3JSMA 2BRKA 4UQTA 4RO0A 4RG8A 5BRHA 4ZVQB 3FEYB 3R97A 2GV9A 2GIFA 4NEZA 2RHQB 2XI2A 4A2AA 4CEFA 5THWA 5J2PA 3JS6A 2C28A 1GXLA 1QAJA 2ZVIA 3ISZA 2NUHA 5KG0A 5CHIA 4BRNA 4HYKA 5A8RB 3EMTA 4CZCA 3L2WA 4LRCA 4LRDA 5ETVA 4FJ5A 4FNIA 3I9V9 5JLFA 4MAKA 4JI2F 4YDDB 2UUAK 4LF1A 5I9EB 3NCIA 3E9OA 1GLFO 4IH5A 2EEYA 2RH3A 4CT8A 3QERA 4LF6K 2AEJA 1EX4A 2LDIA 3OSPA 1HD1A 3CJ1A 3NGRA 2Z1IA 2IGIA 4CFBA 3MEDA 3IUCA 5DDOC 4CQ1A 1B0VA 2W6KA 3OV7A 3CI5A 3AJ2A 4CHOA 2Z2MA 5DGAA 1WEYA 4ZHRA 3FNNA 4TY9A 4GMJB 3Q86A 4JK9A 2BR0A 1GLAG 3MM8B 1S22A 1IKWA 4WYBA 2CKWA 1DT9A 2BANA 1NMDA 4Y1CA 3X1LB 2V8GA 4I4BA 4N8OA 2IDOA 2Z30B 2GHWA 3B6OA 2UV8G 3AVAA 4DR7K 1VSLA 2EI5A 5J2QB 2EK6A 1VQYA 4C3LA 5LMUF 1YI2S 2DH7A 1YJRA 1IBLJ 2H3EB 3FK4A 2FGCA 2ZNZA 2D1KA 1ZOTA 4NXMF 1VGYA 3MXJA 3DYAA 4DV4K 3ZT0A 1NB7A 2I5JA 1CJVA 2A42A 3ALYA 4WQ4A 3LAMA 3E9LA 4ZDNA 5CZXA 2BKOA 2E1ZA 1HBUA 2KL8A 1NK8A 2MKSA 1NKBA 5F1XA 4LBHA 4EI2A 1N5VA 5C2FA 1KS2A 1R8PA 3JQKA 5DGBA 4DV3F 1TK0A 5JUMA 3FZFA 1O5JA 2I6WA 3F44A 3LL3A 2DFHA 3M5RA 1X0PA 2G4BA 3AA5X 2R7SA 4CZFA 2E44A 3UN3A 3QFPA 2P1JA 2CQIA 2W9BA 4CHZA 2P9EA 2QZ8A 5BR8K 4K8XA 1IKXB 1UVLA 1OYDA 1N48A 3K58A 3TABA 1F9HA 3HBTA 4ECZA 2A1SA 5GADP 2E66A 1KDNA 3O4WA 1AZSB 1UJ6A 5KFCA 3SFUA 5KFKA 4DV1J 3ENAA 1NHVA 4DTNA 4E2FB 2GAHC 1AXQA 5M1PA 1AFIA 4K4ZA 2P8IA 1BE4A 2YKNB 2X1FA 2D0CA 2B0GA 1QE1A 4TLQA 1S0OA 2ZJRL 4LF8K 2CJKA 2XS5A 3J7ZO 4ILLA 1MWZA 3QFHA 2Q0RA 2AMCB 1S72N 4AM7A 3U02A 2AP1A 3SUPA 3SBMA 2H5JB 3HHLA 2L41A 5AQRA 5DJBA 1X4BA 2M8DB 2BH1A 3D28A 4ZMMA 5RUBA 2LSNA 2OTLN 4FZXC 3RMBA 4HCCA 4F0MA 5E3RA 3N28A 3BM7A 3ZYYX 3TJAA 3QBWA 3GE1A 1OWXA 3H98A 3RSEB 4MJKA 3JYTB 4C48A 1RHMB 5G0RB 3A8IA 1UEVA 1AW0A 3L09A 2R7VA 4P2XA 5JS1A 3SMSA 3I8BA 2P9KB 5E26A 3OHRA 1F60B 3L7OA 3QSIA 2WVBA 4DLGA 3R1HA 3O9RA 4DSIA 4FOIA 4J2BA 1SUQB 3P8BB 4AHCA 4M5GA 5AE1A 1S1WB 2MLXA 2HRTA 2J76E 3FR0A 3Q7CA 1XR7A 2L9DA 4M63A 3ZXWA 3H8YA 3OHBA 1RSCA 1UEUA 4CJFA 4L3QA 4A4JA 3L8BA 3AO3A 4QIEA 1YKWA 4LMZA 5KQ8A 1EB0A 4CJ7A 2EW9A 2Y1RI 2UP1A 4YY3J 1U0HB 1WD6A 2FVSA 1UTAA 3O3FA 1NPRA 3J80O 2W42A 1KQFB 4DR3F 5J2MA 2FBXA 3N4WA 3AO5A 3QT6A 1U2CA 4C8YA 1SCJB 1GOAA 4EAHD 2ZH5A 2Z2LA 2V34A 1TAUA 1RHKB 2OPQA 3BV8A 2RE1A 3ZETA 3M8ZA 1DBDA 4IRCA 4Y0WA 3OFGA 4V1Ak 1DLOB 2OTJS 3QSYB 3VF0B 1T8EA 2H54B 1EARA 3MXMA 1C1CB 2HF4A 4FXWA 2VKRA 1LWFB 3PEHA 5KFZA 3OR2A 2XEXA 3K59A 1WC3A 4FJHA 1NXIA 2YWKA 1H6KX 1XWLA 2QKBA 1TKTA 1OH8A 3B78A 1SJ1A 3TZXA 3J80U 4TQRA 3CERA 3RMCA 3JXOA 4DLEA 4CESA 1S77D 3KK1A 3G9CA 2CJYB 1PYSB 1X9MA 2LQBA 2HHVA 5C42B 1SXLA 2LXFA 1SIZA 4KHUA 1N4LA 4FDFA 1RWVB 3CCES 3W8GA 4DV0K 4BGBA 4XDDA 3W9HA 2OFHX 2QW9A 2X74A 4PG6A 5BPLA 3K0JA 3PW2A 2DGXA 4GKKJ 3BR8A 1HI1A 3O9TA 3GLJA 4UW2A 1W26A 3TAFA 3H1QA 3CJQA 2WOMA 4I2QB 1FNMA 3AA4A 4O0JA 4CJVA 4JI0J 2GIQA 2MQQA 5H9EK 2MQLA 4AXIA 2FHKA 4QWBA 2RMLA 2GGPB 4IG0A 2LDYA 3M2RA 5GIPA 5LMNK 4J9SA 4B1XB 1IBLF 1WSIA 3RBXA 2ZM6F 3HVRA 3FBBA 1YGYA 4DR1J 1XQIA 1PO6A 1WORA 1XR6A 4MIAA 3HI0A 3VA0A 1FNXH 2EFGA 1KD1T 3QWPA 2ZOMA 2CPJA 3W5YA 5AXLA 3G71N 5DG7A 1O13A 2V7YA 2AGPA 4PQUA 4YHHJ 3HFVA 3N6MA 4JKCA 4DPOA 5C25B 1YTUA 4NZ7A 2KFZA 2WSCC 3OUYA 2WHOA 1FK9B 2M88A 1NGHA 4DV2K 4BE2A 1N34K 3EVOA 2OAUA 1FWLA 1RWNB 3QBXA 3OXLA 3MMCB 4YDUA 4K4TA 2F4FA 1MMDA 3OFEA 4A8QA 3CCUS 4OZ5A 4KHNA 3BDPA 2GNKA 1KP6A 4NYFA 1RWWB 3CD7A 2HMIB 3HI9A 2C2EA 1C6VA 3W2VA 4HACB 4UZBA 4X4TA 3KG0A 5JXSA 2F40A 1VRTA 2RHSB 3DWLA 4W5RA 1Y0HA 2JJ4D 3AAWB 4DV1F 4OYWA 3UD3P 2J7KA 3O4NA 3UCUP 5HP1B 4ES3A 2AV5A 2Q1LA 1OKJA 5A0YB 4HUEA 1VK0A 5AQJA 1QQNA 1ITPA 2GFFA 1VIXA 4ZN1A 1BIZA 4IZ9A 2FHJA 2U1AA 2V94A 2DTJA 2ROEA 3GG4A 4CFDA 3CPWR 1W97L 2GAGC 1JLGA 1WELA 2RF2B 2DNQA 3OBYA 3TAQA 3F9KA 3J80Y 1LK5A 3EGNA 1VQ9S 2VG6A 3OYCA 4YB7A 1VSDA 2R8KA 3KJQB 3MR6A 2G8VA 2UXDK 1LKZA 2J5AA 4WKRA 2IVNA 1RAEB 4I6MA 3POTB 4JKHA 2P9PA 3VZHA 2C3OA 5FDLA 4QIFA 4RU9A 2C2NA 5FJ4A 5SWMA 1FRIA 4B3SJ 4AQYK 3VZIA 3O5BA 3PIOQ 4GKJJ 1IG9A 4EGLA 2Y1LB 5FD1A 2ALYB 3A8KA 2Z1JA 3D45A 1OY8A 5HROA 1BA0A 1HRHA 4DR6K 2MKKA 1M1GA 1NSQA 1YJVA 1BQMB 3ENWA 1UMJA 3SMPA 3GG0A 3MMVA 2I0XA 3RB4A 1OIAA 2Y0SD 2MGZA 2C1EB 4J9VA 2HFZA 4Y2CA 1NK6A 3FCWA 1SQKA 1X1PA 3VQ8A 3QLHA 2DB1A 3SPZA 3M8PA 3VAMA 2M8HA 3NGYA 1YIJS 1Y10A 5AQKA 2HSTA 3PIOL 1S10A 4ZIVA 3SUNA 5CHCB 2B56A 4LF4J 4F04B 1H74A 3GJSB 1JJCB 3KHHA 2H48B 1HBNB 3HSTB 1S97A 1YI2N 4OI1A 2VGMA 3HP6A 4O44B 3J7YP 2YWGA 2PEHA 1M1HA 5F3ZA 2QRRA 1S4FA 3LPYA 2RKIA 4O3OA 4AYBD 4YY3F 2M3DA 2MSSA 2V52B 3KXDA 1N34J 1RFQA 1WSHA 4M7YA 3AA3A 3AY9A 3GMGA 1FW6A 1OO0B 5EX5A 4BE0A 4FJIA 1G2EA 1BQNA 4WIQA 4AHVA 2J9CA 2WVEA 2DFEA 4RUAA 1TL3B 4ANEA 2VDIA 2H5EA 1XC3A 3K9KA 2B4OA 4ID5A 3FZ2A 3V6DA 4E8UA 1FNOA 1NSKL 4K5SA 6FDRA 3H5XA 1UFLA 2VONA 3A5LC 1NDKA 2OMLA 2MTLA 5LXRA 4DB3A 4HHTA 2O8BA 2H4WB 4P73A 3L2VA 4JI8K 2UUBK 1RTZA 2BM0A 1C1BA 1LCUA 1U45A 2CZVC 2E5LJ 4KE5A 3M7VA 3G87A 4HT5A 1RT5A 4J9OA 3D7SB 2E6MA 2JFDA 5CYMA 1Y64A 1SQFA 4DHYA 2KRBA 4C11A 3B6PA 4RNHA 1FDDA 1XTZA 2QWLA 1WAFA 3DC2A 4ZPWR 2K7KA 5E41A 4B08A 4JV2A 3GWCA 2FZCB 2NCKL 5F0WA 3DLGA 1WSVA 1VSEA 1T3OA 3AARA 4BWMA 1H0HB 3MN9A 5KPRA 2UXDJ 1C0UA 1ZM4A 4I0WA 1S5JA 3LP2B 2Q36A 2XWXA 3MM7A 1NH7A 3A1YG 4IRDA 1R8CA 3D2WA 4OIXA 4GKKF 5I42B 1SC1B 4U96A 4CH0S 4CK2A 1FVSA 3OYFA 2LECA 1EQ0A 2CPEA 2C2ZB 4CGHA 3CJ5A 2Y8YA 3TOQA 5JJBA 3PRDA 5AJ3K 1NO8A 4CO4A 1HI8A 4OO1J 2ASYA 2FXUA 4JI0F 5L46A 2MKIA 1YZ6A 1NU4A 4BGAA 1LEOA 2E20A 4NCGA 2ZH7A 5HL7Q 4JD2B 4WFNQ 1Q8IA 2GHVC 3CCZA 4OI4A 3GFZA 1TK8A 3LGMA 3RZAA 4DR1F 3U7JA 1TL5A 1KRPA 1WSRA 3AJ1A 3MEEA 4PXDA 3TAEA 4NYPA 1EP4B 2CJ9A 2CYYA 3IXQA 4FWLA 5M1QA 3HZ6A 5A8RA 4PKDB 5D3GB 2IA6A 3DLKB 3C15A 2H5IB 4WZQA 1FXLA 1KBRA 5GAGU 1K1QA 3VF2A 1DTTB 4YHHF 4DF8A 4FYWB 3FMBA 4C98A 4O55A 2QLJB 1UEKA 3HHEA 4FJLA 2R2RA 1NKCA 3OTBA 1RTIA 5HL7L 4HUGA 4WFNL 1UETA 4YNQA 1VRUB 5DQIA 4B9TA 4CGIA 2HW3A 3K57A 4CK1A 1LW0B 1RU1A 1Q5YA 4QS7A 3NNHA 4F4ZA 4ILRA 5F3TA 1XQSC 1QY7A 3GR0A 1JLCB 4YEAA 3W62A 2V69A 4BRPA 3TO8A 5IWAK 2VD3A 1V3SA 4OVLA 2W40A 3TJ8A 2FLLA 1YT3A 5GAEI 4J7CA 1FKPB 1GXUA 1FD8A 3SXLA 4RUCA 2E7VA 5J2QA 3KZBA 4FZYA 1NU0A 2ZDOA 3VGLA 3PO4A 3MM6B 4FK4A 4PR6A 3EL2A 4HVJA 2HVZA 4UOCA 2VA3A 4PWWA 4OHYA 4OKJA 3KK7A 2ITGA 2OIHA 2CUYA 1HNXJ 4S0MA 1FESA 4CZGA 4CNZA 3P6YC 4FBUA 2XMJA 2A2CA 1NBWA 3OYGA 3CDEA 4L74A 3OYKA 5A6WA 3KLGA 2HQGA 1WB9A 2OTJN 1HKGA 2CPFA 1WTBA 2R8IA 4OJRA 2P5OA 2IIRA 4W5TA 3C2PA 3TUIC 4DV6K 2XB2D 3PHEA 5AQLA 1CJTB 1DQ8A 1JLAB 3IS9B 4EO8A 5BR9A 4F4KA 4TKTA 4C8OA 1VMBA 1W25A 4USTA 4FWRA 1IJEB 3R1XA 2V63A 3VERA 1TUUA 3K8VA 4OPHA 3HT0A 3OQ2A 4A8YA 1B3TA 3SZ2A 4Y2IA 4A57A 4B3SF 4HVZA 1IKXA 3BREA 4LF7K 4GKJF 2R8GA 4BC9A 1RACB 1WHWA 4CLFA 2XG8A 1TFWA 2V50A 1Z26A 3RRGA 3MD1A 3PNIA 2X3DA 2QLBB 2NR0A 1KLNA 1BL3A 1OSDA 1YRTA 3DMJB 3HTVA 3CCEN 3OJUA 3CVKA 2ZKTA 1LFWA 3NAHA 4QU7A 2GVZB 5ITHA 2YKNA 2HQCA 3M2UB 2W7PA 3PJWA 4O5FA 1RADB 2XRIA 2DTUA 2G8FA 4LF4F 1Q81O 3FFKB 2O8EB 2D5RA 2M52A 2HBYB 3MF5A 4CM0A 1RB0A 5D8HB 2XTJP 3IC1A 3R6MA 3ELHA 2GHPA 4ZJLA 1C2PA 2P9NB 5LL6d 6AT1B 2ZBPA 2CG8A 2MY8A 1HYZA 3ISNC 3DJCA 3DOMB 3FZMA 3M32A 2PDAA 2EFVA 3THYB 1VQKS 4ZK7M 3OYDA 4DL7A 1V3ZA 2DKOB 4A5AA 4H4MB 3JYTA 3BO2A 4JS5A 2GX8A 4OGEA 5G0RA 1U8SA 1T0TV 3U1NA 5L1JA 4AL6A 2KRRA 3KHYA 4JB8B 1ZZFA 2F63A 1S1VA 3JQJA 3DGPA 4ECVA 1RAJA 3C95A 1DY3A 2G2YA 2WFBA 2E5LF 3OYLA 2UVVA 1PG5B 2FZKB 3D3CJ 2DVIA 4K4UA 4BRMA 1RT1B 4HLBA 4WQ5C 1WC6A 1SUQA 3CCUN 5KFHA 3U9DA 4DMZA 4KHMA 2EK1A 1EJ7L 1S1WA 2YQ3A 4M8LA 5HOOA 1ASUA 2EG2A 2B4JA 2NSCA 3OJSA 5AE2A 1R6VA 4PG8A 5KG2A 1LWEB 5KGWA 1FKAF 4NRUA 2OJ3A 2CH5A 2YHXA 4R5PB 5CR4A 4CO2A 1Z25A 1HNVB 1U0HA 1OVQA 5ADXA 4I9LA 4OHVA 2NUUG 4KKOB 1O8BA 1YZ7A 1KFSA 3GR1A 1CQMA 3FQLA 2O8DB 1DHMA 3CCVS 2ZGYA 4BQLA 2JX2A 1PCAA 2V4JA 1N0VC 4L75A 1HLUA 1VQ9N 4NCBA 1DLOA 1HQEA 3RB0A 1V9OA 1H3DA 2BOAA 3TSUA 5ETRA 3CG7A 3IAM9 1S6QB 1U2VB 1GLJO 2MYFA 4ZPAA 2F9WA 4R8UB 4JKDA 2KKZA 1C1CA 4LIRA 1VC6A 3CJ2A 1N8RT 1UFKA 1JJHA 1RGVA 3TUJC 3ITHB 3BKUA 3D0HE 1QS4A 4XAKA 2W2QP 5DQGA 5L1IA 1QHAA 2HB5A 4BCAA 3QFUA 1YUWA 2W7OA 3R5CA 3UDLA 4PXCA 5FLXU 1B0PA 3UQSA 3W7BA 3GFYA 5IT0A 2J7UA 2D9PA 2UUWA 4DWIA 4PWDB 4OI0A 3SCXA 1IWGA 1OH7A 2AX0A 2PA8D 2QA1A 4YOVA 3W2WB 3KUGA 3HKWA 5AFUA 3EWGA 4NLGA 3IM9A 3V2UC 2IAJB 2D0BA 4JK8A 4Q8FA 1PILA 4FVMA 1N36K 4ID1A 1M1KO 2J6UA 4I2QA 5KAKA 1VQ5N 4NRTA 1K8AO 3DM2B 2ZBQA 2DGSA 4J90A 2C2MB 2V5HG 1YTYA 2GGPA 5CD4H 1RCHA 4JYAJ 4A47A 3KKSA 1R27B 2HZAA 3ZC4A 5CYJA 2UUTA 5M1OA 4E7HA 1FHTA 3OT9A 4U7CA 2QX0A 2X1BA 4ED3A 1HNXF 4IFYB 3BPSP 3BQ2A 2W4CA 4IDHA 3EPGA 1HFEL 2VOOA 2KW4A 3NMAA 4QS8A 2IVFB 2MXYA 2YHAA 5J1PA 4DL3A 2GELA 4UY8O 5C25A 3M30A 2D0AA 1KVKA 4NPOA 1CZBA 1WG5A 3THWA 1O6XA 3HDSA 2BEFA 3GOIA 2LQ8A 4DSJA 3C94A 4OLOA 4RW6B 4B17A 1VQ4S 4A8OA 4C23A 3MMCA 4NLVA 3RBEA 1S76D 1EHWA 1FRLA 4GC7A 3KTQA 1UVIA 4NLSA 2G2OA 2JFKA 2QLXA 4X2BA 1XNQK 2L08A 4RW9B 1EAYC 3RGIA 2HMIA 1JJ2M 3WXKA 1RKJA 4HACA 4P9SA 4NLOA 3QEXA 5A2QO 5J1EB 4DL4A 2V2VA 3HSZA 1AUSL 1N5YB 3L4IA 3IKMA 3ZZRA 2HHQA 1UPPA 4UOGA 4LF5K 4Y65A 2GBZA 3EE9A 4YN3B 3GE9A 2GUIA 4DR5J 1E6VB 3D1QA 3TR8A 4ETZA 3VTIA 2CPYA 1FWKA 5KFWA 4LUBA 3CQXA 1SL1A 3AOCA 1U1LA 3BO3A 4N8NA 4FJJA 4AXJA 3NS6A 4DQSA 2COLA 3V6KA 3LA0A 4OZ2A 2I8EA 3H4BA 4KTQA 3HOTA 3L3CA 2R7QA 4CJ3A 2RF2A 2E2PA 5C10A 1S1TB 4LR7A 3LGHA 4PCQA 1V6HA 2ZWPA 5TKYA 3WEEB 1U24A 3L2UA 3DRPB 5A2QU 1HI0P 2HHWA 1QQCA 4ED4A 5IT9O 3HVTB 1SJQA 3POTA 5AXNA 2YBVA 5HMWA 1WC1A 4OYMA 4DSEA 4LF2A 2CPDA 3P31A 3LZIA 2LU1A 1WUAA 1BG3A 3WNHA 2HPUA 4TNOA 1GOBA 3H59A 3KLIA 2C3YA 2CJQA 3O1LA 1HW9A 4ZLLA 3GJQB 5DG8A 2CG4A 5DLGA 1Q0NA 3OY9A 1BQMA 3G8TA 1Z1ZA 3CD5A 5D0RA 4MTPA 4B3TK 5IT9U 3GJRB 3K2YA 3H5YA 1WF0A 3WC0A 1H7WA 2XZTB 1BGXT 5AQFA 1M5VC 3DLEB 3SBGA 4XTTA 3HZEA 3MXIA 3MOJB 3EM1A 2I2YA 1FD2A 1K47A 2V6AA 3HSDA 3PJ9A 3ZCMA 4CZKA 2WBNA 3C6TB 5AQXA 4ZKAA 1JNRB 1CC8A 4K42A 1HBNA 4ZITA 1HBMA 4MLEA 1IM6A 3QMLA 3P5JA 4J37A 4O44A 1Z2ZA 4CF9A 3MFHA 2GA7A 3LAKA 4GY2B 1M5KC 3QESA 2QSWA 1GMWD 2HHXA 3J7Z5 3A5NC 4AE5A 2WW4A 4E19A 1C0GA 2FIUA 3L0QA 4IJNA 3R5GA 3ZTPA 1TK5A 3G2XA 3QATA 2JEJA 2BBEA 4J9MA 1TL3A 3B54A 4KRWA 3JAMO 5HQLA 1J5EK 5IOLA 3I4HX 3EICA 1VSJA 2GEMA 4X4RA 3PLAA 2B4UA 4I6AA 2AGQA 5K8PA 3SLCA 3FEXB 2M0GB 5E2QA 3RVCA 4KY3A 1B0TA 1FJGK 2MQOA 3MR3A 4F50A 4A8SA 3TWHA 1FJ7A 1X0FA 3TA2A 4E7IA 2WB4A 4JV0A 2WK4A 1J53A 4RKUC 1RI7A 4KHPK 2DR7A 1XJWB 1N56A 1WG1A 3AQOA 3NAEA 3J81Y 2UUCK 3KMSA 3C46A 4PG4A 2XC9A 3G6ES 2M2BA 4HH0A 2U2FA 3JAMU 3UCZP 4ZOSA 4A59A 2GV1A 2XLIA 3E9PA 3RB3A 3CCMS 1HYVA 2KKHA 2CQGA 4KBIA 1VSHA 1JMTA 4I69A 2HWTA 4O8KA 4M3UA 4IOAQ 4CTAB 1WI8A 5A2QY 2XS2A 1N88A 2XZWA 4DN9A 3NGIA 2PBDA 1VQ6N 5I42A 2HQ3A 4LFBK 1LOTB 3AVKA 4BHQA 3LPTA 2IRYA 4ZS6A 3EX7B 2NQPA 2KB2A 1D9DA 2E9ZA 3I82A 4C7QA 3LDNA 1D8YA 2P9SB 2NPIA 1IKYB 4XDCA 3QAEA 4DR4K 3QFWA 3O08A 2VQEK 3ZTOA 2ASPA 4I64A 2BRLA 2YWEA 3FQKA 4JYAF 4RTFD 1Q5VA 1GLBG 2HHHJ 4I9QA 4F3QA 4U9RA 4EFHA 2DRBA 3CM6A 4KFBB 2J8AA 3B6BA 2ATLA 1BWEA 2E9RX 3NRBA 4O3RA 4OJ3A 1EP4A 5JLHA 3BGLA 1Q18A 1RXOB 3GYXB 5D3GA 2NRXA 3DLKA 2HVEA 3CFRA 5IT9Y 3ZZPA 1ITGA 3MPUB 4ANCA 2C3UA 2BQ3A 3CJ4A 1IN0A 1OVYA 1VHXA 2XWYA 1SVDA 1IR0A 3B4MA 4CK3A 4OV6A 2RQKA 4CFAA 5TKWA 1VRUA 1Y3JA 2LEPA 1LW0A 4LRBA 2O8FB 4X65K 3P5BP 4WYLA 1Y3KA 1MROB 2AEMA 3RMAA 4B3OB 2YQ0A 2VFSA 3QT8A 1BMQB 2G0IA 3HHKA 1UA1A 1JLCA 1UW4A 3UN5A 5ADZA 3PEJA 3U4LA 3EVMA 1YTAA 4F4WA 3C7NA 4WE1B 3G6VA 3PV8A 1NJIO 3AVLA 2RUSA 5LJ5Y 3MURP 2Q3SA 3MOZA 1R3NA 4WXOA 3T6JA 1FKPA 2ZJQQ 1TFYA 4K7QA 3NBPB 1WC4A 1XNRJ 4PQAA 1XMOJ 3R6GB 4DR5F 4J8FA 5L9NA 4GC6A 1RT2B 3VETA 2L48A 3MM6A 1RWXB 4BBYA 3GCWP 4ZCLA 1U0SA 3B82A 3HJVA 2BJDA 4CZLA 2ACMA 3EGZA 2BE2B 5GINA 3KJNB 3CJAA 2VPWB 3G96A 1RYRA 2FHOB 4RBTA 3ZEUB 1VLYA 2ZJQL 1T9VA 2HVDA 1Q53A 3M6UA 1IJJA 3PUFA 3MGJA 2J4RA 5EDWA 4BRKA 5I3UB 2G0CA 3PX4A 3TVYA 3BP8A 2BJEA 3TAGA 1GFWB 4JKEA 1ZBTA 3Q8QB 3TSPA 1SV5B 2ZITA 4LSNB 1IQTA 4ZCKA 2EPIA 2JDJA 1CJTA 1JLAA 3IS9A 2R9LA 5KT3A 4QJVA 3OTOJ 1RDBA 1RT7B 3OYIA 2J6SA 2YWHA 1N5TA 2AJQA 1MN9A 2VPXB 4QWCA 1ZM9A 3DDIA 2DRAA 2VBXA 4BR5A 4B1WB 4EP5A 3I8DA 3ZZ0A 4ITSA 1ATNA 1TL1B 2DNRA 3ZLJA 1RISA 2WTUA 5H1SQ 3LPUA 4R0EA 1HHQA 2Q31A 2IVYA 4PY5A 4BC3A 3TI0A 1JNZB 3TAMB 4DS4A 4H54A 4M5JA 3I56S 3WQTA 1NNEA 4ZVTB 3MM5B 1GLCG 4Y2MA 2NZ4A 1K1SA 4KH0B 1QVFM 5K14A 1RCXB 4DFKA 4CEOA 1QAIA 2XSFA 4BC5A 2ZZNA 3U1LA 5BN9A 2WONA 3SQ0A 3T5HA 3SK3A 3OBWA 3QRQA 5BREA 3Q89A 3IM8A 1Q82O 4F0HA 4FPAA 3DHWC 2JLFA 1YJWS 2DCLA 3I5BA 3OYNA 3ZT2A 2P9NA 1S9GB 4QWEA 1A6LA 3GL1A 2AGOA 2F8SA 2VV5A 4BREA 3TQ1A 3DOMA 4OMFG 5LSRA 1NJXA 3UW1A 4TLRA 2VPYB 3THYA 3CIZA 1YQHA 2FB0A 2H4YB 1Y00A 4OYAA 2BUNA 1WKLA 4O3NA 2JEIA 3MWTA 1WBDA 1Y4ZB 4JHDB 3V81B 4U7UK 4CH7A 1KD1O 1HWIA 1Y9OA 5L39A 4I56A 2DGTA 3QZ7A 5H9FK 4CLLA 2JRSA 4MDBA 3A5OC 4ILGB 4OZNA 2WVDA 1X8DA 1YITS 4DFPA 2ZFHA 3DLRA 2DNYA 3CD6N 1VQ4N 3IR6B 3I31A 4NA1A 5IV3A 1X3NA 4GVMA 2OZSA 1RT1A 3VGVA 1HPZB 1B70B 3QPIA 3VQPA 1JCFA 5AQHA 2EXUA 4X62J 3UKRB 2FJBB 3P3DA 3RR7A 3ZSYA 4H5RA 4MQ3A 3ZT4A 1URRA 2KHDA 2MKJA 1CZAN 1VSMA 5EOYA 3C6UA 4HI1A 4C8LA 5AQIA 1LWEA 1RBTA 1HNZJ 3EUNA 2EBGA 3VTHA 2DEJA 1SC3B 3D2EB 1YRXA 4X4OA 2GJFA 1L5UA 5T14A 2RRAA 4KREA 4GO7X 1R8AA 2G8IA 4ZVHA 3CJTA 4N5SA 1HNVA 2E7XA 4CJWA 3CC7S 4KKOA 4CD3A 2OI2A 3MXHP 2OH2A 3RAQA 3ZX3A 3ZSQA 3MWBA 2O8DA 4UTGA 4IH7A 3BH6B 1LW2A 3MUMP 3QJLA 2FUG9 3IO1A 3HFKA 1V4SA 3H5UA 3T1YK 4F02A 1PBUA 3OS2A 4DV7K 2J0XA 4FVUA 5K8OA 4JI6K 1LAVA 2E29A 4QR1A 2K8GA 1SIWB 1S57A 3NFAA 1S6QA 3NH0A 4QR2A 2HHHF 4L3KA 1K44A 4USKA 1NAQA 4HEA9 3CF5Q 1U1NA 2ZOGA 3J7YI 3M1VB 4YOWA 4FS2A 1CS4B 2WZ1A 1S49A 2MKCA 3RW7A 2RHKA 5KFSA 5DK5A 4IQMA 5A8WB 3IDHA 4C3MA 4J2AA 1SKWA 4P74A 3V4IB 1F0XA 2WCXA 3QNWB 4CGDA 3KFWX 4AHRA 4ED0A 4Q2LA 4Q7AA 3MEGB 1KQGB 2PFDA 2B6AA 3X3UA 3D6RA 4OHWA 2K06A 2AD9A 2D0PA 4EFAC 4DU4A 3CF5L 1KQSM 4CBXA 2ROGA 4OZJA 2W9AA 2RDIA 2E5JA 2LCWA 3IWNC 3VQDA 4RBUA 5GVQA 3IG1A 1X9SA 3AO1A 4X4QA 2P5VA 3SUOA 5FIIA 2IAJA 4C9DA 4DOZA 4NB4A 3GG1A 4LF9K 2C3MA 2ZE2A 3PR5B 4CVNE 1TKZB 9RUBA 3SAHA 2VOPA 1HR0J 3U9ZA 1XNRF 3OFFA 5HMZA 1KVJA 5AXMA 4CHNA 1XMOF 2EFOA 1VLOA 1RE1B 1RT3B 4BE1A 4OX8A 3FRZA 1FE0A 4H5NA 4AHUA 2A1BA 3A8JA 4LQ9A 4GNIA 2QWNA 4NLWA 4A8FA 1H2VZ 2OSQA 3WHIA 3OYHA 1H7XA 4A8XA 2BW2A 4IFYA 4F4AA 1IJFB 4JK7A 2RE2A 5KFGA 3HM9A 4M94A 2JEFA 1TL7A 5EWGA 2NLWA 2RRBA 4ZLNA 4JI2K 5HBMB 3OD2A 5AQQA 2IC3B 3AD8C 2NYHA 5KT4A 3TANA 2DGUA 4O4GB 5JICA 4RW6A 1T9XA 3OTOF 5E3QA 4C8KA 4FJMA 2QL7B 2F9JA 3CSKA 3TVKA 4EO6A 4YOTA 4X84A 4V19S 3VQ5A 4EBEA 2P51A 1Q8KA 3C65A 2N4CA 4DU7A 4X66J 3KLFB 5ETNA 1BD6A 1F3FA 3T1HJ 4FLZA 4Q43A 2GCFA 1U02A 3CQ8A 4RW9A 5M1NA 3OR1B 3KHLA 5HRSA 3G6EN 4BS2A 3QB0A 1RWMB 2YNIB 5J1EA 3ILIA 2IMOA 2AYEA 4C1NK 1N5YA 3KJVA 3CCMN 4IR1A 2WUSA 4EMDA 2CQ2A 3MUVP 2W9CB 2J9DA 3WIUA 2OP5A 4RCHA 2HBRB 1JL1A 1S1UA 4JKGA 3NG8A 2PFUA 4AFFA 5LMUK 4M5DB 1RJJA 4KHYA 3MR5A 2JH3A 2MB0B 1P27B 3DRXA 1JCEA 4NXMK 2YJFA 1XC9A 2RIJA 4Z4EA 1QDUB 2HFUA 4QR0A 2MMYA 2C42A 1AUDA 3QEVA 3NKYA 4B1ZA 3ZSVA 5BXIA 3QYYA 2VZ9A 2HWIA 4CJ5A 3A4TA 1KAZA 3SQGB 3WEEA 4U95A 3DRPA 2QXLA 4AT1B 4IJAA 4DV3K 3HVTA 1FRMA 3AFGA 2V51B 1G6BA 3P5TL 4DTRA 2ZHAA 1W0HA 4E7KA 1TVRB 3OVNA 4QYRA 3KYLA 4NYZA 1Q7YO 4B9VA 2DR8A 3MAAB 2NRRA 4JV5J 3PW5A 2V8VA 4DHVA 4JN4A 4BRCA 3M8YA 1Q81T 4ALZA 3CJ3A 1UWBB 4CM2A 2FY8A 3W9JA 2Q2RA 2IVPA 3FGVA 4CJRA 1LQ9A 3S41A 2VG7B 3QRPA 4C0BA 1TKXB 3HULA 2PEBA 2ZJPQ 5JVHQ 2FJWA 2CNNB 2FC9A 1ESVA 4CEQA 5LOQA 1HWJA 4X62F 2NREA 2VG5A 3DLEA 3DXMB 4NLUA 1XHXA 2P9LB 4X4VA 3ZSWA 3L6QA 2W4DA 4RNOA 3GYGA 4J9NA 1VQSA 2IBKA 2ZWHA 4DUZJ 2Z4PA 3N9UC 1DTQB 3M6GA 2E7WA 2ASLA 2JNJA 1HNZF 1WEZA 2BTFA 4UF4A 2ZJPL 1BISA 1O51A 5JVHL 3NOGA 3R8EA 2OEMA 1QVFR 3VGSA 7AT1B 1ASVA 3WT0A 3SCIE 1Z6RA 3KIOA 1FX4A 1RU2A 4M5HA 1WSJA 1GLLO 1SC4B 1N54B 1U2FA 3T7ZA 3TPQA 5F0XA 5MLCQ 1H98A 3C6HA 3IRXA 4P75A 3ATUA 3CJ0A 3KK2A 1HL6A 3PO5A 3VQEA 4RX6A 4YUDA 2XY6A 1F3VA 3SCLE 4F7VA 1T05B 3S3OA 5GAEU 3M8QB 2V8DA 3CO0P 2VBYA 4PZVA 4FP9A 2KO1A 2W8KA 4Y2AA 1VBZA 3CM5A 2OCEA 1HNIB 3MFIA 1VJWA 2HS4A 4DEZA 1UOCA 2K2PA 1PAUB 5A8KA 3R3TA 4B9UA 4RW7B 2MHEA 2EVZA 4J9UE 4PYDA 3CEDA 1RABB 3O44A 1YVFA 3SIPB 3LP3A 2AZ1A 4CF0A 5M1FA 4C8MA 3CJ9A 5D77A 5FPMA 3S6EA 3CJ7A 5AQSA 5DRKA 4A46A 2D74B 3AJDA 1NSPA 2QMXA 1K8KB 4NMLA 4CTAA 4USVA 3K8WA 2GJ2A 4RW4B 4NA3A 3KK3B 4B3RJ 5EY4A 4FLUA 5CE3A 3TRGA 5D4PA 1ICEB 2J0WA 4FWMA 5KOWA 4DR3K 3WQPA 1P1LA 4BROA 3K89A 3G8SA 4NO7A 2P9SA 1VDHA 1IKYA 3H4DA 1YJ9S 5KPTA 1HR0F 3K5LA 1IBMJ 1YJWN 3TSQA 2WB1D 2RQ4A 4DX8H 1HARA 2AYMA 2PY5A 3LP0B 3HXMA 2DHSA 4HKQA 4NE9C 3AGRA 1NSAA 3MZIA 3NNAA 1BO5O 1CC7A 2AYBA 3G10A 3UE5A 1F21A 4CO0A 4EBDA 4KRFA 2UXCJ 3R7BB 3K17A 1WN7A 3FBEA 1CG2A 3OYBA 2KHOA 2XQCA 4F8RA 2DXDA 2V67A 4CW7B 2VFRA 3ZZUA 1K0TA 5GAHP 1JXBA 1M1KT 4HTIA 4KC5A 5D0HA 3HX9A 1NJWA 4HI2A 3M8SA 1KWMA 4WP9A 3T19A 1KLMA 2MJNA 2W7AA 1YITN 1WHVA 1VQPS 3B8HA 2O8FA 2XGPA 3NS7B 1MROA 3F73A 4IOXA 2QK9A 2MZTA 4I67A 3H5SA 4X66F 3T1HF 4C4WA 3H2UB 4Q0BB 4WE1A 4DKWA 2HHUA 2HNDA 2W25A 1WOQA 1Q8LA 2CNLB 2JLGA 4ZP8A 4NZ0A 4RNMA 1TU0B 5KFLA 4NLTA 1T9UA 1ACMB 3K2PA 2BMBA 4NMXA 5IM0B 5CD4A 4UY8T 2QLWA 2FSNA 3NBPA 2QYCA 5BYSA 2R2UA 3KMQA 2YX6A 4RR5A 4U7UD 1RT2A 4WTYA 4DUYJ 5L38A 3CC7N 4GV6A 1IBLK 4FLTA 3I9ZA 1WDTA 2ZM6K 4HTUA 4PPZA 3H46O 5AQGA 5KG7A 4I7FA 2BE2A 3GSIA 3CWJA 3Q2SC 1NRKA 2V0NA 4ECSA 1WNSA 1FDNA 4JI4J 3ZEUA 1KCFA 4IDKB 3Q24A 5AQWA 4V19X 1WSFA 2FHJD 3D54A 4QZVB 2ASJA 5I3UA 3VQ4A 2BOPA 1R6YA 1DRZA 1SV5A 3MPDA 1NPKA 2AJ4A 3ZNUA 3W61A 4J9PA 3KLEB 4TXSA 3CCWA 4W98A 1RT7A 3BGFA 2KG0A 3ILOA 4UY85 3TP2A 4JV5F 3K7RA 2D3ZA 3CIMA 2B5JA 5CY4A 4EHTA 1EZZB 3CMAS 2HBJA 2G1HA 1N8RO 2DGVA 3LOUA 2O1PA 3T5JA 3H1VX 2WVFA 2NRTA 2IA0A 3GILA 4Y6IA 2CAJA 4R0JA 4OGCA 3MMBB 3P96A 1T03A 3TAMA 2YNGA 1XEZA 1S6PB 2Q3PA 3AVHA 4DV1K 5G4DA 5KFVA 4DZDA 8ATCB 1YJNS 5EX3A 4KH6A 3MM5A 2QTDA 4IEIA 4JI3J 3LGNA 4Q5VA 1TYQA 3CQYA 1RTDA 5I4MA 2MQMA 4CI0B 4P72A 4PAAA 3IGNA 1WC5A 1W7AA 2WW8A 4DUZF 2BDPA 2P5GA 4ELUA 4BVOA 2QTWA 3OL8A 4USWA 3EZOA 2UXBJ 2W01A 1QSSA 4BRHA 4BR2A 1BDGA 4DTOA 2CGJA 3A12A 1F2GA 1RWPB 4CZHA 3R6LB 1T3NA 4Q45A 3SEOA 2KZMA 2DGOA 1ZZNA 1NGJA 3W9IA 2HIQA 3SQ2A 3GV7B 4OX9J 3ATVA 5BRFA 2DPNA 1GAOA 3UB5A 3VQQA 1DQ9A 2OSRA 2VWKA 3MECB 3SCKE 3E01B 3H20A 4JHDA 3V81A 3GZ7A 3P4IA 2UV8A 1N32J 3CFOA 2R7YA 2B8QA 2VFVA 1R31A 1WDDA 3IRWP 3DDNA 5KFNA 5E3CA 3RR8A 5F8HA 1VQ7S 1QVGR 3Q8RB 4NI2A 3AODA 4YDXA 3CPWM 2EBEA 2FBTA 1X9WA 2BKNA 3VCDA 2FLNA 4QBUA 2VWBA 1C0TA 1UPMB 1M90O 3AAPA 1NOZA 5EVZA 2N82B 1EETB 2ZM6J 1SL2A 1RBSA 3QJPA 1U1RA 1A5XA 2BUPA 4LBIA 4KV8B 1Q7LB 1NOYA 1NH8A 1Z2LA 1VSKA 4BG8A 1F5AA 2YWWA 3BQ1A 2WTFA 5ETPA 5C2GA 5FRMA 5AZIB 1I3AA 5EX0A 4FL9A 2QEXN 2RVJA 2CQCA 3NGUA 2P9GA 5AT1B 1QHTA 5IQ6A 3WDOA 2AF6A 3PHTA 3OXFA 1VOMA 1F9EB 1CJUA 4B1VA 4B3RF 4YY3K 4IYQA 4NLRA 2G8HA 4MK7A 2UZAA 5M1KA 5B7WA 4MT1A 3MCPA 4BC4A 3MMAA 3WQUA 4YB1P 1TQLA 3U3GA 1EO1A 1IBMF 2QN6B 5KFFA 2YHBA 1WEXA 2AWZA 1S3XA 2ALZA 4DTJA 1S9FA 2YV0X 2ZJRQ 2EKYA 5JVGQ 5HLFB 3VEOA 4XO0A 3CULA 3ULEB 3C6AA 3N4QA 2L9WA 3Q7BA 4B9QA 2X6SA 3M1VA 4KGMA