4CEQA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ceqA00
1RILA 3P83D 4DLEA 4Q0BA 1BL3A 2E6LA 1Z26A 3K58A 1NKBA 3V1QA 5J2MA 2DTUA 4HCBA 3WNEA 1X9WA 4I7FA 4KKOA 3RTVA 3AA2A 4Z4GA 3ZT4A 3EZ5A 2YNGA 2YNHA 2FBVA 5HRSA 4FXDA 3TR8A 1GOCA 3AA3A 3L2UA 1XHXA 4CESA 1IKVA 1NK6A 4N76A 4K8XA 3LANA 2HHVA 1QSSA 3G0ZA 1JLCA 1SL2A 1BI4B 1RTIA 2KQ2A 3C6UA 4FW2A 3KK2A 3L2RA 4ELUA 2DFHA 4ZHRA 5KRTA 2P5OA 5HRRA 3DI6A 4DSIA 4FJNA 1RTHA 1VK0A 2RKIA 4IFVA 1QHTA 3NDKA 3AO4A 4DTUA 3CM6A 2E6MA 4KHYA 2E4LA 3ZSOA 2KZZA 2D0BA 3KLFA 1NJZA 1VSHA 1TAUA 4DU1A 3VQQA 5J2QA 3MEDA 4DQIA 1VSLA 1JLFA 1VSEA 2RPIA 3DM2A 4CIFA 3RMCA 2JGUA 3AVIA 1TK5A 4CGGA 4M3ZA 3SUNA 1IKXA 2ZE2A 1D8YA 4RW8A 2IDOA 4CF1A 3LP1A 4FCYA 3V4IA 4FLYA 3VQDA 4ELTA 2O4IA 1HPZA 4DU3A 1FK9A 4DQSA 1NK0A 3RR8A 2BGGA 3OYJA 3O4NA 5E41A 3F9KA 3VQ4A 1ASWA 3OYLA 4H4OA 1RBTA 2BANA 1VSMA 2X78A 2HNDA 3LAKA 4TSXA 3TANA 4CJLA 3BGRA 4CEAA 3AVLA 1NK8A 4FJLA 1EXQA 4OKJA 2AJQA 3MAQA 4FJ9A 2PYLA 1HQEA 3HL8A 4FVMA 4CFBA 3SCXA 2G8VA 4FK0A 1G15A 1JXEA 4W5QA 4CHNA 2HW3A 2XY8A 4KREA 4OPKA 3AVNA 4QAGA 1JL2A 3DLRA 3ZT1A 1S5JA 4B9MA 4NCGA 4F3OA 3B6OA 4B8AB 4PQUA 4M3XA 4B8CA 4GMJB 4CEQA 4CFDA 5J1EA 1BIZA 1LAWA 1RBUA 4CECA 4FJXA 4Z4FA 1Q9XA 3BDPA 3LPTA 1RTDA 4FZZA 2GUIA 4DWIA 1C0UA 1A5XA 4CK2A 3EYZA 3IAYA 1UOCA 1UWBA 1C1AA 2G8UA 4FJ5A 1S1VA 3NHGA 2QKKA 5CZ2A 4E7HA 4FLXA 3RMAA 3ZT3A 1XI1A 4NCBA 1N5YA 3SUPA 2ZQBA 5K14A 1TV6A 3NH2A 3S3OA 4C8LA 4MFBA 3OS2A 2OPPA 3K5LA 1D9DA 4F8RA 4E7KA 1ITGA 4O0JA 1IH7A 4GW6A 4DFPA 2G8FA 3HJFA 1TKXA 3OYIA 4CEEA 3JYTA 4OGCA 3HO1A 3CYMA 3VQAA 4CGJA 3C95A 1WNSA 4DF4A 1X9MA 1ZBHA 3DLKA 1TGOA 3LP2A 3NF8A 3KLGA 4FJMA 4JRPA 4IBNA 1KCFA 1A5WA 2KZMA 2XY5A 4O55A 4W5OA 3DOLA 5DMRA 3DRRA 3AO5A 1NK4A 1LW0A 3T19A 1HYZA 3KKSA 3VQ5A 3WNGA 4CJEA 1WAFA 4OGEA 2O4GA 1J54A 1S9EA 3V1RA 3SV3A 4BDPA 3QEVA 3ASMA 5FDLA 4E1MA 1L3SA 1L3TA 1HYSA 3AVBA 1VSJA 4AHUA 1WLJA 1RNHA 3QEWA 4HCCA 1T8EA 4F2SA 3A2FA 4H4MA 4E1NA 2PYJA 1NK7A 4J2EA 4DS5A 5HRNA 3L8BA 1N6QA 1RDBA 1X1PA 4FJKA 3AVJA 4CERA 1RBSA 4I9LA 3SQ1A 3LWMA 5KI6A 1CXQA 2Z1IA 3ALYA 5KRSA 4I2QA 1J9AA 3K5MA 1SUQA 5EU7A 4CEBA 2G8KA 2G8IA 3NF7A 3SUQA 4FJJA 4DQPA 3DLEA 4M3TA 2G8HA 4DSEA 4W5TA 3QERA 1ZBIA 3KIOA 3TABA 3RR7A 4CF2A 3AVKA 3WNFA 5HRPA 3K57A 1VSKA 3DMJA 2A1SA 3TAGA 4IFYA 5KGXA 4B9UA 3D45A 4DTXA 1R0AA 4EP5A 3NBPA 3T3FA 1CZ9A 4CGHA 2F8SA 4DSLA 4OLBA 1U04A 1ZBFA 1TKDA 2OYQA 1FXXA 3KKRA 4Z4IA 1WSEA 1C6VA 3HP9A 5SWMA 4DTMA 1VSDA 3DLGA 5CY4A 4FLUA 2FC0A 2WOMA 5HLFA 3HP6A 3G10A 4HUGA 3OYAA 4LSNA 3C94A 2B6AA 4DQQA 3PUFA 4CJ3A 2FBXA 4CHPA 4CJUA 3OS1A 3PV8A 4E19A 4JRQA 3ZT2A 3PY8A 4Z4CA 3LZJA 2HVHA 4RW4A 1B9DA 3TI0A 2G8WA 3V9XA 1LWEA 4J2AA 2HHWA 1RCHA 3ITHA 1B9FA 1NJXA 4CHQA 4CIGA 4FJ7A 4M3RA 4B9VA 1S1TA 1S1UA 3OVNA 4BWMA 4I9QA 2HMIA 4KHWA 4DSJA 3K5NA 3MXMA 1RDDA 3LALA 2XY6A 1JLBA 4CJWA 1K6YA 1SV5A 4Z0UA 4HVJA 4DTPA 2XRIA 1T05A 3SPZA 4FJIA 3O3HA 3DLBA 4E3SA 4F3TA 3QEPA 2YNFA 2LSNA 3MEGA 2VG5A 1BI4A 4LD0A 3ZSVA 4FM1A 4LY7A 3SNNA 3E01A 1WSGA 3L3UA 3QLHA 4IKFA 1XWLA 4MQ3A 1TL1A 4OKKA 5I42A 4LH4A 1UAXA 2HB5A 4FJ8A 3I8DA 1WAJA 4N5SA 2KTQA 2R7YA 1EX4A 4RG8A 1LWCA 3OYDA 2RF2A 4ID5A 1LV5A 4I2PA 4CFCA 1J53A 4C8NA 4PUOA 3CFRA 4QOZB 1IO2A 1GOBA 1O1WA 4AHCA 1NKEA 4KPYA 1SL0A 3HPGA 3V1OA 1NOYA 1QQCA 2YV0X 1WSIA 3KLIA 2X6NA 4B9NA 4FYDA 1RBRA 4M3YA 4DG1A 1JKHA 3M8QA 3VQ8A 1S1WA 2YHAA 4DTOA 1S9GA 2KW4A 1Y97A 3LAMA 5HROA 1L3UA 3NH1A 3V9UA 5HP1A 5CYMA 2QKBA 2HNZA 4B9TA 1FKOA 3ZSQA 1RDCA 3ZSZA 4CGDA 2X6SA 3OYKA 2HHTA 4CJVA 3SUOA 1QTMA 1C1CA 3V81A 2HHQA 1U45A 3RRGA 3MXJA 2OZSA 3NGZA 4FW1A 4BACA 1X9SA 1BGXT 5KGWA 4CEZA 5JS2A 4N56A 4DQRA 3DLHA 4E7IA 2FBYA 4BDYA 3AVCA 3CFOA 4CCHA 4CK1A 4ID1A 3L2QA 1NOZA 1WN7A 4FJHA 2GBZA 1S6PA 4FM2A 2Q3SA 4C8MA 4KHQA 4CF8A 2WONA 1BISA 2PY5A 3K2PA 5C25A 1JLGA 3OYBA 3SYZA 3TAPA 3IRXA 4BE1A 2IAJA 2Y1JA 4NYNA 1NKCA 3EY1A 4DTJA 3QINA 1Q8IA 3DOKA 3QIPA 4O5BA 2EX3A 1KRPA 3VN5A 1Q9YA 2X74A 4BDZA 4E0DA 3ZSRA 4CFAA 3DRPA 3M8PA 2ITGA 3VA3A 4FZYA 4E89A 3L2VA 3RRHA 1XC9A 4KHUA 4Z4EA 4PY5A 1UA1A 3AVMA 4KO0A 4Y1DA 1KVAA 3O3GA 1CZBA 4AH9A 3ZT0A 1U48A 4CHOA 4KTZA 3O4QA 4DF8A 4OPJA 2HHXA 3OJSA 3PX4A 4FK4A 4R5PA 2EHGA 4ZTFA 3ZSXA 1HYVA 3MEEA 1HNVA 1ZBUA 3HVRA 1B92A 1TKZA 3DRSA 1ZYQA 4CJTA 2IC3A 2DFEA 4CJQA 2RN2A 4O4GA 1NJWA 3V9SA 1RT5A 4O44A 2VWKA 3ZCMA 3K59A 1RBVA 1W0HA 4FLZA 5T7BA 4EZ6A 3HVTA 1WSHA 4N41A 3NGIA 1I3AA 4PWDA 3CG7A 1NK5A 4RW6A 2XY7A 3LPUA 4CF9A 3TARA 3NGYA 4EP4A 4OVLA 3QNOA 1QSYA 3ULDA 3OYHA 2IS3A 3PO4A 4CK3A 4PA1A 1ASVA 1LAVA 3WNHA 3V9ZA 1J5OA 2Y1IA 2ATQA 1S6QA 4CJPA 4E7JA 3MXIA 4CHZA 5JS1A 5HBMA 3QEIA 3TWHA 4AILC 2FBTA 1JLQA 2Z1GA 4DTNA 2F96A 4LH5A 4N47A 4JS4A 2QK9A 4KHNA 4CJRA 4W5RA 3TAMA 3LP0A 2DY4A 4W5NA 1RT7A 4KTWA 3VQEA 4UQGA 3HSTB 1TK8A 1YTUA 3DYAA 2PZSA 3SI6A 3NF9A 3FFIA 1RT3A 3KLHA 1SKWA 1KSPA 3SPYA 4F2RA 3NAEA 4DU4A 4CHYA 3VA0A 1JL1A 5FRNA 3KTQA 2VG7A 3TAEA 3I0RA 2HHUA 3ZSWA 1C1BA 5C24A 2ETJA 1KLMA 4ZTJA 1T03A 4OLAA 1KFSA 3LDSA 4KB1A 4FLWA 3CM5A 4HHTA 3VQPA 4CGFA 3HPHA 3KJVA 5I3UA 3AVAA 4CJKA 5FRMA 3KD1E 1LWFA 2KFNA 1NJYA 4M41A 1JLAA 4Z4HA 4YNQA 3V9WA 3S9HA 4QCLA 4B9SA 3THVA 3HK2A 1QSLA 3RMDA 3P5JA 4ICLA 4ELVA 4KHSA 3M8SA 3K5OA 4DLGA 1RT4A 1TKTA 1EP4A 4B9LA 3ISNC 3C6TA 2Z1HA 4NYFA 3LZIA 3SQ2A 4J2BA 5CYQA 4CJSA 3SQ4A 1BQMA 3P1GA 5CZ1A 4XIUA 1WSJA 2ZD1A 3RMBA 4C8KA 2OPQA 3AVHA 4IG3A 2W42A 1U4BA 4EZ9A 4DTRA 2OPRA 1DLOA 2HHSA 3NFAA 4YFUA 3S3NA 1RT6A 1RDAA 3OYNA 4CJFA 4DSKA 4L8RB 1DTQA 2OPSA 4CEDA 4KI4A 1C0MA 2IOCA 4AHVA 4DFJA 1BCOA 1SL1A 4KFBA 5FROA 2BE2A 3QNNA 1CXUA 3PX6A 4M3WA 4B3OA 3IG1A 2OZMA 3F73A 4M45A 5SZTA 2F8TA 1EETA 1KVCA 2XO7A 3LP3A 4LSLA 1S1XA 2QXFA 3I0SA 1NK9A 5D3GA 3QO9A 1U47A 1HRHA 3VQBA 3OYEA 3NE6A 4KV8A 1XHZA 2P5GA 1VSIA 4KI6A 3AVFA 4JS5A 2HNYA 3VQ9A 2IGIA 4BE2A 3B6PA 4H8KA 2VWJA 2BDPA 1QE1A 2JLEA 4KB0A 2NUBA 1EKEA 3ZSYA 1HNIA 4B08A 5KTQA 4CJ4A 2GV9A 2OA8A 3SJJA 3NH0A 4CGIA 1HMVA 1IKWA 4OKEA 3M8RA 2HVIA 1HJRA 5J2NA 1TL3A 3H08A 4AHTA 3TAQA 1T7PA 3UIQA 1JXBA 4BWJA 1SKSA 3RWUA 1KVBA 1D9FA 2YNIA 2KFZA 3SQ0A 2XHBA 3AA4A 3AV9A 3KLEA 4DS4A 3SV4A 1ASUA 4FM0A 1A5VA 4FK2A 2D5RA 1RT2A 3HXMA 2Z1JA 1SKRA 1RTJA 4Q5VA 3AA5X 4FZXC 1KFDA 3HT3A 4HUEA 3TAFA 1C0TA 5DK5A 4KRFA 1YVUA 1VRTA 1JLEA 2D0AA 4DFMA 1DTTA 4CF0A 3NCIA 4NCAA 1TVRA 2B4JA 1VSFA 4AHSA 4BE0A 1KLNA 1I39A 1YTAA 4HUFA 3SZ2A 1MU2A 3VQ7A 1FKPA 4K8ZA 3AVGA 3U3GA 3PX0A 3KK3A 4Y1CA 3L3VA 1ZBLA 3V6DA 3CFPA 3VQ6A 3HYFA 4CJ5A 4IDKA 3T1AA 1YT3A 3JSMA 4IG0A 1QS4A 4KAZA 3CQ8A 3IS9A 1WSFA 4RW7A 4WE1A 3QESA 3QEXA 4HTUA 3AO3A 3KK1A 3AO1A 4RW9A 4DSFA 1TK0A 3D0PA 1GOAA 1BHLA 3OYFA 1BCMA 3O3FA 4DFKA 1HQUA 3U6FA 3L2WA 4F4KA 1U49A 3QIOA 1CLQA 1L3VA 4G1QA 2A1RA 3KD5E 1IKYA 2VG6A 4KTQA 4CEFA 1LW2A 3OYCA 1RT1A 1F21A 3PO5A 4DTSA 1BQNA 4M3UA 4JLHA 2DFFA 1W9HA 2YKMA 4FJGA 4GVMA 3OYMA 4J2DA 1IG9A 4FLVA 1Z25A 4CEOA 4CE9A 4DMNA 5C42A 5J2PA 1KTQA 2B5JA 2YKNA 3U3YA 3LWLA 4FLTA 4C8OA 1VRUA 3HPOA 1D5AA 3VQCA 3QETA 2P51A 3OY9A 3AO2A 1REVA 4CIEA 3OYGA 3OJUA 4E7LA 3S3MA 1L5UA 1TAQA 1BIUA 3HM9A 3MECA 2I5JA 4M42A 3OS0A 1UA0A 4O0IA 3NF6A 4OJRA 2D0CA 2YHBA 4AHRA 2P1JA
chains in the Genus database with same CATH superfamily
1RDWX 3P83D 4DLEA 2E6LA 1Z26A 3K58A 1NKBA 3D2EB 1NGFA 3WNEA 4I7FA 4Z4GA 4IXCA 3EZ5A 2YNGA 2YNHA 2GTDA 1XHXA 5AJ3K 4N76A 2JWKA 3LANA 1QSSA 3G0ZA 1BI4B 1RTIA 1C0GA 1VK0A 3VF2A 4JI4K 4LF8K 3AO4A 2GWJA 1QVGM 2WUSA 2KZZA 4BRNA 1VSHA 5BRHA 1H1VA 4BRHA 2RPIA 3DM2A 5FPNA 4JKAA 4BVPA 1TK5A 4DR7K 3VGLA 3THWA 3V4IA 4FLYA 2BTFA 1VQMN 2O4IA 1NK0A 3OYJA 3F9KA 4H4OA 2WTUA 3MAQA 3SCXA 3W3DA 4FK0A 1G15A 4B1YB 2HW3A 3C6AA 4CJ7A 4B9MA 4BREA 2A6AA 4B8CA 4CEQA 1HNXK 1YJWN 1LAWA 4FJXA 1K73O 2ZJQL 2GUIA 1C0UA 3EYZA 1NGAA 2G8UA 3CI5A 5M1QA 1WUAA 4E7HA 3RMAA 3CPEA 3SUPA 3NH2A 4MFBA 3PLAA 3OS2A 4XH4A 2OPPA 3KZBA 1D9DA 4F8RA 4E7KA 4O0JA 1IH7A 4MO4A 3F9MA 4CEEA 2E1YA 3JYTA 1N34K 1ZBHA 4JI7K 3LP2A 3J7YP 4ISEA 4Y0WA 5HL7L 3ATVA 3AAPA 4JKDA 5DMRA 1ZXOA 1NK4A 4CZMA 3VQ5A 1WAFA 3JS6A 4NXNK 1S9EA 3V1RA 3SV3A 1YHQN 2E1ZA 4E1MA 4YOVA 1HYSA 1DGKN 3O4WA 3G71N 3SBGA 1RNHA 4PKIA 4E1JA 4F2SA 3A2FA 5BR8K 2PYJA 3CXCM 4IOCL 1N6QA 3MN6A 3SQ1A 3RVCA 3ALYA 1ESVA 4WQ4C 3K5MA 2G8KA 3NF7A 3K9KA 3SUQA 2G8HA 2P9LB 4DSEA 1W2BM 3K57A 1VSKA 1TYQA 3DMJA 4DR5K 4IFYA 4B9UA 3D45A 4EP5A 2E2OA 1E3MA 4DSLA 4OLBA 3C65A 2ITMA 1U04A 1FXXA 3KKRA 4DTMA 3FFKB 4NB4A 4HUGA 3HBTA 4LSNA 3LDQA 4DQQA 3PUFA 5IT9O 2FBXA 4CJUA 4E19A 4IOAL 1RDUA 5EVZA 3V9XA 5AZIA 4J2AA 4FJ7A 4CIGA 4JKHA 1VQ7N 1S1UA 5BPNA 4FPAA 4KHWA 1XMQK 3LALA 1JLBA 3HRGA 3CMAN 5CR4A 4E3SA 2IVOA 2YJFA 4LY7A 3QLHA 2IIRA 2NRZA 4OKKA 2QWMA 4LH4A 1UAXA 5B8HA 3L6QA 2HBMA 4RG8A 1LWCA 2RF2A 4BC4A 1LV5A 4C8NA 4PUOA 4QOZB 5CE3A 4AHCA 3ZYYX 1NKEA 2UUCK 4KPYA 3KLIA 4L3QA 2X6NA 1JCFA 5F0XA 3M8QA 4FWMA 2YHAA 3VQ8A 2KW4A 3LAMA 3NH1A 1Q18A 1FKOA 4CJVA 4WFBL 1C1CA 3V81A 4WCEL 2OZSA 3U4LA 4BVOA 3SBTA 4BR0A 4CEZA 1P8ZA 4DQRA 3K0SA 2FBYA 2FF6A 4PL8A 3WT0A 3ATUA 2Q3SA 4AM7A 4IEIA 4CF8A 3JXUA 1YF5L 5CHIA 2PY5A 3K2PA 3IFRA 3OYBA 5M1NA 3HTVA 3LDLA 3EY1A 3W0LA 2P9NA 3QIPA 1J5EK 4DR1K 2E8AA 4XEIA 2HOEA 2VCPA 5AZJA 4E89A 1MA9B 4CZJA 3CCLN 4OPJA 2UUAK 3PX4A 2UUBK 2EHGA 1HYVA 1HNVA 3DRSA 3HOSA 4CJQA 2OANA 4O4GA 4B1XB 1NJWA 2GX9A 4WYBA 1Z05A 2UXDK 4O44A 4DR3K 3M6GA 3L0QA 1NGIA 1RBVA 1TYQB 3BP8A 4NXMK 3MMVA 3VF6A 3CG7A 4GKJK 4IJAA 4RW6A 2XY7A 1NG9A 4EP4A 3QNOA 1VQKN 3ULDA 3KHYA 3OYHA 4QS7A 4O8UA 1LAVA 3CJAA 2ATQA 3EE8A 4CJPA 3MXIA 5JS1A 4DUYK 3QEIA 5FPDA 2Z1GA 4DTNA 2DY4A 3IUCA 1RT7A 3G25A 3WUHA 3DYAA 3SI6A 1VQ8N 3NF9A 2A42A 1SKWA 3GG4A 4F2RA 5FRNA 1XQSC 4CZEA 3KTQA 4GV3A 1C1BA 2ETJA 2HMPA 4CZHA 4BR9A 3CM5A 5LY3A 5KPZA 5JVGL 2VWBA 4Z94A 4CJKA 5FRMA 1N32K 4JD2A 5DM7L 1LWFA 2KFNA 4QCLA 3V9WA 4Z4HA 4WF9L 4B9SA 2FXUA 4JHDB 5KPTA 1YITN 3THVA 4OX9K 1BDGA 2Z1HA 5LMUK 4CJSA 1BQMA 1HKBA 3P1GA 5CZ1A 4XIUA 1WSJA 2RHKA 3UKUA 3FGUA 4YFUA 4CJFA 4DSKA 4DFJA 1BCOA 3VENA 4CVNE 4IOXA 3GE1A 3UE5A 4M45A 5FLXO 3QFUA 4MLHA 2F8TA 2XO7A 2PFUA 2QXFA 2WC9A 3G4SN 4BQZA 2P5GA 3VQBA 1ATSA 1Q81O 4DV3K 3PIPL 4LFCK 2ASMA 5AQHA 1EKEA 1HNIA 4ISFA 3SJJA 1IKWA 2JWLA 3CJ9A 1T7PA 4JEPA 3RWUA 2OTJN 1D9FA 2KFZA 2YNIA 4JKFA 3CCMN 3SV4A 1ASUA 1A5VA 1GLFO 1RT2A 3JAMO 2Z1JA 5M1KA 2WFBA 5DK5A 3OBWA 1YVUA 4NCAA 1VSFA 1XUPO 2O8CB 2V51B 1I39A 1KLNA 4HUFA 4FWSA 3VGMA 3AVGA 4BG8A 2YHXA 5LJVA 5BREA 4I6MA 3SAGA 3L3VA 1GLJO 3T1AA 1NGCA 4IG0A 3CCQN 4KAZA 1OH6A 2OCEA 3AO1A 5BRFA 4DSFA 1DT9A 1GOAA 1BCMA 3CJBA 3O3FA 1CLQA 3R6MA 3IDHA 2QW9A 1L3VA 1GLLO 5ELZA 1BQNA 4OO1J 2YKMA 5AQUA 4GKKK 5AQWA 4FLVA 3AARA 4CEOA 5C10A 4WFAL 3U3YA 1KTQA 3HPOA 5FPEA 4BRGA 4JK9A 3QETA 1IV0A 3ENHA 1UA0A 3QICA 1W7AA 1HX1A 2W6LA 3V1QA 4HCBA 3VMFB 2QWOA 3AA2A 2CGJA 5HRSA 3TR8A 4JI5K 3L2UA 3CPWM 1K8AO 2HHVA 1IKVA 4A59A 4JD2B 3L2RA 2KQ2A 3C6UA 3KK2A 5HOOA 4KHPK 2O8FB 5BPLA 4ZHRA 5HRRA 1V4SA 2RKIA 3EE9A 4C1NI 4DTUA 2BH1A 2E4LA 2D0BA 1VQ9N 1TAUA 5TKYA 1LCUA 3AVIA 3SUNA 2NLXA 2IDOA 1OH7A 3LP1A 4AF1A 4FCYA 3UKUB 3BY5A 4ELTA 2FSNA 3O4NA 3OYLA 3A5NC 3TANA 2BANA 2HNDA 4CJLA 3AVLA 3DLLL 1EXQA 4OKJA 2AJQA 1U6ZA 2PYLA 2EWSA 4QAGA 3WQTA 4F3OA 4M3XA 1M1KO 3I33A 2A5XA 4Z4FA 1Q9XA 3LPTA 4DWIA 1KXPA 1GLCG 1UWBA 4WFNL 1S1VA 4LF5K 4FLXA 2ZJRL 1N5YA 2ZQBA 4CD1A 1TV6A 5C2FA 5AQYA 3K5LA 1ITGA 2ZGZA 2D0PA 4GW6A 2G8FA 3HO1A 3CYMA 3C95A 5KQDA 4BRQA 4JRPA 4IBNA 1KCFA 1A5WA 4O55A 3A5LC 4W5OA 3AO5A 1JJ2M 5M1PA 1YI2N 1LW0A 3T19A 1HYZA 2HSTA 3AGKA 4CJEA 1BA1A 4OGEA 1J54A 3ASMA 5FDLA 2QWQA 3THXA 3AVBA 3U9ZA 4HCCA 2QI2A 3O1WA 4BRAA 5HRNA 3DXKA 4U7BA 3CQXA 3AVJA 4A5AA 5KI6A 5KRSA 4X65K 4A57A 4DV2K 2D4WA 3A8YA 4CEBA 4FJJA 3LM9A 4BRDA 4M3TA 4RCHA 1DEJA 3CCVN 2PAVA 3MN5A 3QERA 1ZBIA 4CF2A 1NNEA 1IG8A 2A1SA 5KGXA 3D6RA 4DTXA 1CZ9A 4CGHA 1TKDA 3VEVA 2O8DA 4Z4IA 1WSEA 4A2BA 3NVMA 3EN9A 5HLFA 3HP6A 3OYAA 1N33K 2B6AA 4ILJA 3OS1A 4JRQA 4LF7K 3PY8A 4Z4CA 1NWKA 2HHWA 1RCHA 3IKMA 1B9FA 3M5RA 4BR5A 3WXKA 5AQVA 1NM1A 4BWMA 4I9QA 2HMIA 4JI2K 2E2NA 1RDDA 3CC4N 2XY6A 4CJWA 2QA4N 1T05A 2XRIA 3FE1A 3O3HA 3AGRA 4F3TA 2LSNA 1HKGA 4LD0A 4IKFA 2CH5A 3EL2A 1Q82O 1E4FT 4FJ8A 3I8DA 3ZETA 5ADXA 1QZ5A 3VEXA 4ID5A 1VAZA 3C0BA 4FOEA 3CFRA 1GOBA 3WEEA 2UXCK 4AM6A 1SZ2A 2YV0X 1WSIA 1QQOA 4B9NA 1RBRA 4DG1A 2P9PA 3LDOA 2V7ZA 4DTOA 1S9GA 5HROA 1L3UA 4BC2A 5CYMA 3CCEN 5BN8A 4B9TA 1D4XA 3OYKA 2HHTA 3NGZA 3QDKA 3C7NB 4GVEA 5JS2A 1VQNN 4N56A 1VQ6N 4BDYA 3AVCA 3CIPA 4CK1A 2QWLA 2CH6A 3E66A 1NGHA 5GAEP 1C0FA 2WONA 1R59O 5C25A 3SYZA 4H0VB 3VETA 5AQRA 2UYTA 1Q8IA 3THXB 4O5BA 3J8AA 2EX3A 1NBWA 3VN5A 3VF4A 2X74A 4BDZA 4E0DA 4CFAA 2ITGA 4C1NK 3H6EA 3WXLA 3DXKB 1XC9A 4KHUA 4PY5A 1VHXA 4KO0A 1KVAA 1CZBA 5M1OA 2O8EA 1N8RO 4ZTFA 3HVRA 1SQKA 2IC3A 2RN2A 1YVNA 3LDPA 1S3XA 3V9SA 3K59A 1W0HA 4FLZA 3MX5A 4N41A 4JI8K 2Q31A 3NGIA 4PWDA 1NK5A 3LPUA 4RTFD 4CF9A 3ENBA 3NGYA 4OVLA 2VGNA 2P9KA 3AY9A 4OPHA 4EFHA 2O8DB 1NGDA 3WNHA 3V9ZA 2Y1IA 4DV6K 1S6QA 1LOTB 3H3OB 3CCRN 5MLCQ 5HBMA 3E9LA 4DUZK 2FBTA 1EWQA 4ILHA 5EOYA 4KHNA 4CJRA 3TAMA 4JI3K 4KTWA 3VQEA 4UQGA 1ZC6A 5AQSA 1M90O 4H5WA 1TUYA 1K9MO 3NAEA 4DU4A 3NMUA 2HHUA 1HR0K 2FSJA 4A62A 4ZTJA 1XNQK 4FLWA 4AQYK 3THWB 2ZJPL 1YIJN 1WB9A 2O8BA 5I3UA 3KD1E 5AQZA 4DKWA 2HBKA 3EEQA 4H03B 1NJYA 4M41A 1JLAA 4YNQA 3S9HA 3HK2A 4ELVA 3ZETB 4KHSA 4DLGA 1RT4A 5AQPA 4F9OA 3O08A 5JLHA 2D0OA 3K9JA 4MLEA 1Q7YO 3RMBA 3WEEB 3OW2M 4A5BA 1DLOA 2KHOA 3NFAA 2NZTA 2E2QA 3OYNA 1DTQA 4KI4A 1C0MA 2IOCA 2P9PB 3FZFA 1KAXA 5GAGP 3MK6A 1MWKA 3QNNA 5AQQA 3PX6A 4NLBA 4B3OA 5F1XA 1G99A 3ZEUA 3N4QA 5SZTA 3J7AP 4LSLA 1S1XA 5D3GA 3O5BA 3NVKA 1HRHA 3TTFA 4KV8A 2QXLA 4KI6A 2IGIA 4K25A 4H8KA 2AP1A 4QS8A 3NH0A 4CGIA 3I8BA 4OKEA 4AHTA 3QMLA 2V7YA 3LL3A 3AA4A 3AV9A 3VERA 3EKUA 3KLEA 2ZM6K 4DS4A 2D5RA 3HXMA 3HOTA 4Q5VA 2KLAA 3CF5L 4IO8A 4HUEA 3SAFA 3KWIA 1VRTA 4YORA 1BOTO 4JKCA 2E5LK 2B4JA 2VGMA 1YTAA 2P9UA 1MU2A 3U3GA 5EXWA 3KK3A 2O8EB 1OKJA 4DCHA 1GLDG 1OVQA 4H5NA 1ZBLA 3CFPA 5GIOA 2Q0RA 1HJOA 3OTOK 3JSMA 2AA4A 1HLUA 3I56N 3IS9A 4RW7A 2F9WA 5AQOA 2QM1A 4FWOA 3D0PA 4DV1K 3OYFA 2CGKA 3L2WA 1QHAA 3QIOA 3L4IA 3KD5E 1IKYA 2VG6A 5A2QO 3OYCA 4M3UA 4FJGA 1EWRA 2P9KB 4DV4K 3E9PA 3KVGA 4J2DA 5J2PA 4CE9A 2B5JA 4FOIA 4X64K 3LWLA 4FLTA 5AQIA 2YX6A 2P51A 3T69A 4DR2K 4CIEA 3S3MA 3OYGA 2E88A 2NRHA 1IBKK 1BIUA 2F4VK 3OS0A 4OJRA 3KIOA 4YDUA 4AHRA 2P1JA 3TU5A 5AZIB 3FZMA 2NRRA 1BL3A 4K42A 5J2MA 3RTVA 3ZT4A 2FBVA 4FXDA 5JMVA 4CESA 4FO0A 5AFUH 4K8XA 2O8BB 3H3NO 1JLCA 1SL2A 4FW2A 3P39A 5KRTA 4FJNA 4JKGA 1JCEA 4IFVA 1QHTA 3VEYA 1T6DA 3VQQA 3RMCA 1VSEA 4CIFA 1X3MA 3MCPA 4M3ZA 1D8YA 1IKXA 2ZE2A 4RW8A 4CF1A 4V19S 3VQDA 4DV5K 4JI1K 2BGGA 5E41A 5J2QA 1ASWA 3LAKA 1VSMA 4TSXA 3CCSN 5AQMA 4CEAA 1BG3A 1NK8A 2ASPA 4FJLA 3KWGA 4FJ9A 2HF3A 1HQEA 3HL8A 4FVMA 4CFBA 3ZEUB 3H1VX 1JXEA 1OVYA 4J8FA 4CHNA 4W5QA 4OPKA 1X3NA 1S5JA 1KAZA 3DWLA 3LM2A 3B6OA 4B8AB 4GMJB 1RBUA 3PSFA 3MDQA 3G6EN 3BDPA 4JI0K 4JV5K 1A5XA 1NGGA 1UOCA 3ID6A 5DM6L 4FJ5A 1WOQA 3R8EA 3UKRA 5CZ2A 5AQLA 2QKKA 1XI1A 4NCBA 5K14A 3S3OA 4BRMA 3CJ7A 3ZLJA 4HWIA 3QBXA 1FW6A 2I7PA 4DFPA 2P9NB 4FWPA 3OYIA 1J6ZA 3VQAA 1X9MA 1VQLN 3NF8A 1X9JA 3KLGA 5AR0A 5AZJB 2KZMA 3FZKA 2HF4A 2XY5A 3DRRA 3Q7CA 5I9EB 4BR4A 4M63C 2HHHK 4BRLA 3WNGA 3C6HA 1K8KA 2YHWA 4A2AA 3QEVA 1L3TA 5LMNK 1VSJA 4AHUA 3QEWA 1T8EA 3SJHA 4E1NA 1NK7A 4DS5A 3L8BA 1RDBA 5C2DA 2ASOA 4CERA 1T3VA 3LWMA 3THYA 1CXQA 2Z1IA 4I2QA 2H3GX 5EU7A 3FLCO 5GAHP 2VYPA 3DLEA 4BROA 4W5TA 2CGLA 3TABA 3RR7A 3AVKA 3WNFA 5HRPA 3DXMA 5EX5A 1R0AA 3NBPA 1HUXA 2P9IA 2QWRA 4PKHA 1IBLK 1YJ9N 3BUZB 1ATRA 4IWVA 2OYQA 1C6VA 3HP9A 4B3SK 1VSDA 4FLUA 2FC0A 4M7YA 3G10A 3VTIA 3C94A 5LJWA 4CJ3A 4CHPA 4CBXA 3PV8A 2YCHA 3AAQA 3ZT2A 4RW4A 1B9DA 3TI0A 4IJNA 3OHRA 3ITHA 1GLBG 2ZGYA 3H45C 4CHQA 3PIOL 4M3RA 3J81O 4B9VA 3D7EO 3D2EA 4H5TA 4DSJA 1S22A 3R3LA 4HVJA 4Z0UA 3DLBA 2YJEA 3SMPA 3FZLA 3QEPA 1IJJA 3OBYA 2VG5A 1BI4A 3VEZA 3R9PA 3ZSVA 4FM1A 3E01A 2Q2RA 4MQ3A 1TL1A 4CD3A 3IMXA 2PBDA 2HB5A 2QWPA 2GUPA 1WAJA 4N5SA 1MWMA 1EX4A 3OYDA 4LC9B 2P9SA 1GLAG 5AQTA 3MX2A 4IFEA 2W6KA 2QWNA 1I94K 1IO2A 3O8MA 1SL0A 4FYDA 3MN7A 4M3YA 1JKHA 3UKRB 3R1XA 2QKBA 5HP1A 1OH8A 2HNZA 1QQNA 3ZSZA 4K41A 2X6SA 2HHQA 2W40A 1QTMA 3SUOA 1WBBA 5KPRA 3RRGA 3MXJA 3E1YA 1V4TA 4FW1A 1X9SA 1BGXT 3U8XA 5KGWA 4YDUC 3DLHA 2QTDA 4E7IA 3VEOA 4KH5A 3CFOA 3N4PA 4ID1A 3L2QA 1WN7A 1NGJA 2GBZA 4C8MA 4I6MB 4JYAK 1BISA 2J4RA 1K8KB 4FWNA 4DR4K 3TAPA 2Y1JA 4NYNA 4H0PA 3CMEN 4K43A 1VQON 3QINA 1KRPA 4CZKA 4GV9A 3DRPA 4FWKA 1DKGD 3L2VA 3WXJA 4AH9A 3O3GA 3THYB 2HHXA 3O4QA 4DF8A 3ZSXA 1ZBUA 1ZYQA 2DFEA 3L4QA 4DV7K 3M3ZA 4JNEA 4B9QA 1RT5A 3ZCMA 1XMOK 4BC5A 4H0YB 5T7BA 3CHWA 1WSHA 3HVTA 4LF4K 2DPNA 1I3AA 4X62K 4DHYA 2P9IB 2GWKA 3TSQA 4LF6K 2D1KA 1QSYA 4JK7A 4CK3A 4PA1A 1VQ5N 2ZWHA 4CHZA 4B3MK 4AILC 2P9LA 2QK9A 4JS4A 4W5RA 3LP0A 3UB5A 3QB0A 4CW7B 3CD6N 4W5NA 3GL1A 3ZX0A 3HSTB 5JVHL 1TK8A 3FFIA 1RT3A 1KSPA 4FWQA 4MDAA 4BRFA 4CHYA 3VA0A 1ZBSA 4EAHD 1T03A 4OLAA 4KB1A 4HHTA 3VQPA 3HPHA 3KJVA 3AVAA 3SMSA 2A3ZA 4PL7A 1BA0A 3RMDA 4YY3K 3H1QA 3K5OA 3M8SA 1EP4A 4B9LA 3ISNC 4J2BA 3SQ2A 1NLVA 2P9SB 4B1ZA 2Q0UA 3SQ4A 1BO5O 4EHUA 2NRXA 2WBNA 1XC3A 2ZD1A 4C8KA 4JKEA 3AVHA 4EIAA 4EZ9A 4DTRA 1U2VA 2HHSA 1TUUA 3S3NA 1RT6A 4CEDA 1SL1A 3O6WA 3OA9A 3I55N 4KFBA 5FROA 2UU9K 3TSUA 1CXUA 1ILYA 4M3WA 3IG1A 2OZMA 2F9TA 3QFPA 1T6CA 1N36K 1EETA 1KVCA 3CETA 2VQFK 3I0SA 1NK9A 3QO9A 3GOIA 3OYEA 1VSIA 4BE2A 2BDPA 2VWJA 4KH4A 2JLEA 3A0IX 2NUBA 3ZSYA 4B08A 5KTQA 1Q86O 2OA8A 4KBOA 2HVIA 3DJCA 2A41A 3H08A 3TAQA 3UIQA 1JXBA 2GEMA 3BF3A 2XHBA 3LDNA 2Q97A 4RWTA 1SKRA 2GELA 4FZXC 4GNIA 1DTTA 4CF0A 4JK8A 1YXQA 3O9QA 4AHSA 4CZIA 1FKPA 2QEXN 1NMDA 4Y1CA 4YOXA 1T44A 5AQGA 5BRDA 4O8KA 3VQ6A 2FLOA 1YT3A 3F5TA 3CQ8A 4WE1A 1WSFA 3QESA 3WXMB 4HTUA 1TK0A 4F4KA 1BHLA 1HQUA 3T7ZA 3VGKA 5JLFA 1U49A 4G1QA 2A1RA 4KTQA 4CEFA 3BEXA 1RT1A 1F21A 4DTSA 3D2FA 4JKBA 1W9HA 3OYMA 2RE2A 3E9OA 3J80O 3CC7N 5C42A 2YKNA 5TKWA 3F2KA 5E84A 3OY9A 1Y64A 1REVA 3VEWA 3VPZA 3ZX2A 1TAQA 3HM9A 3MECA 5M1FA 2I5JA 3HM8A 4O0IA 3ENOA 1RILA 4BRIA 3VOVA 4H0TB 4Q0BA 2DTUA 1X9WA 5AQNA 4KKOA 2ZF5O 2FF3B 1JCGA 1GOCA 3AA3A 4KH6A 1NK6A 4BR7A 4EHTA 4ELUA 2DFHA 4DSIA 2P5OA 3DI6A 3MWTA 1RTHA 3B8AX 3NDKA 4LF9K 3CM6A 2E6MA 4KHYA 3ZSOA 3KLFA 1NJZA 1NGBA 4DU1A 3MEDA 4BGBA 4DQIA 1VSLA 1JLFA 2JGUA 4CGGA 1U2VB 1QVFM 5C12A 1HPZA 4DU3A 1FK9A 4DQSA 3RR8A 4UY8O 1HNWK 3VQ4A 1RBTA 2X78A 5AQXA 4JHDA 2W41A 3BGRA 2NNWA 3A5OC 3O9RA 2G8VA 4JAXA 3QBWA 1BWFO 2XY8A 4KREA 3AVNA 1JL2A 3DLRA 3ZT1A 4NCGA 4YHHK 4PQUA 3PSIA 4CFDA 5J1EA 1BIZA 4CECA 1RTDA 4FZZA 2FSKA 1YJNN 4CK2A 3ULEA 3IAYA 3EO3A 1C1AA 3ID8A 3NHGA 3A5MC 3ZT3A 4NO7A 3S41A 4C8LA 4BY9C 4FWRA 3HJFA 1IBMK 1TKXA 4BRCA 4R79A 4OGCA 1FJGK 5GADP 4CGJA 4DF4A 1WNSA 3DLKA 1TGOA 3TPQA 4YOWA 4IEEA 4FJMA 1SS6A 4U67L 3DOLA 4B1VA 3VTHA 1HPMA 4FL9A 5FPMA 3KKSA 1KQSM 2O4GA 5AQKA 4BDPA 3TTDA 1L3SA 1WLJA 3O1BA 4OPAA 2A40A 3BZCA 2NRWA 4H4MA 5KQ8A 4J2EA 1X1PA 4FJKA 2O8CA 3D2FB 1RBSA 4I9LA 4B1WB 1E4GT 1EQYA 1J9AA 1RGIA 1SUQA 2G8IA 4XH1A 3Q7BA 4DQPA 1VQPN 1W97L 4MDBA 4FWLA 4BG9A 4BQLA 3P31A 3TAGA 4WQ5A 4YOUA 4BGAA 4LFBK 3T3FA 2F8SA 4FSVA 1ZBFA 5SWMA 3DLGA 5CY4A 2WOMA 3HSCA 4GY2B 2V52B 3TSPA 3WXIA 3BF1A 4O5FA 4YOTA 3LZJA 2HVHA 2G8WA 1LWEA 1NJXA 1S1TA 3CCJN 3OVNA 5GINA 4CZFA 3K5NA 3RSEA 1NGEA 4XH5A 4YOYA 3MXMA 4C23A 1K6YA 1SV5A 3M1FA 4ILGB 5AQFA 4DTPA 3SPZA 4FJIA 4H0OA 2YNFA 3MEGA 2O8FA 2IVNA 3SNNA 1WSGA 3L3UA 1XWLA 1BUPA 5I42A 1S72N 4DR6K 3SLCA 2KTQA 2R7YA 2YHYA 4B1UB 4I2PA 1RFQA 4CFCA 3EKSA 1J53A 4QS9A 1O1WA 3HPGA 3V1OA 1NOYA 1EO1A 3ULEB 1QQCA 3MN9A 4CZGA 1S1WA 1Y97A 3V9UA 2F7TA 3ZSQA 1RDCA 4CGDA 1BU6O 3H46O 1U45A 4BACA 3GDQA 1NU0A 4CCHA 2NRVA 1NOZA 4FJHA 1HNZK 1QZ6A 1S6PA 2I7NA 2P9UB 4FM2A 5BPMA 4CZLA 4KHQA 4BC3A 1NMNA 1JLGA 1OH5A 3IRXA 4BE1A 2IAJA 1NKCA 4DTJA 3DOKA 3O9SA 1Q9YA 4G9ZA 3ZSRA 1SAZA 3M8PA 3FR0A 3VA3A 4FZYA 5LL6Z 4CBUA 5F2RA 3RRHA 4Z4EA 2E20A 1UA1A 3AVMA 5E26A 4Y1DA 1U48A 4DV0K 3ZT0A 4CHOA 4KTZA 4BR2A 3OJSA 4FK4A 4R5PA 3MEEA 4FPBA 1B92A 1TKZA 2BUPA 4CJTA 5JICA 2VWKA 2Q36A 4EZ6A 2HBJA 3MCAB 1P90A 3CC2N 3TARA 1GLEG 2IS3A 3PO4A 1ASVA 2IVPA 1J5OA 1YUWA 4E7JA 3TWHA 1JLQA 2F96A 4LH5A 4N47A 2OTLN 4K0KK 4H5VA 4JKGB 3WQUA 5AFUA 1HKCA 1YTUA 5C0YA 2PZSA 2E2PA 1QQMA 3KLHA 3SPYA 3CQYA 4DQ8A 3SAHA 4B3RK 1JL1A 4BRKA 2VG7A 5IWAK 3TAEA 3I0RA 3ZSWA 3HI0A 5C24A 1KLMA 1KFSA 3O80A 4H0XB 3RSEB 3LDSA 4ISGA 4CGFA 2VQEK 3CERA 3EZWA 3CJCA 3MWPA 1XNRK 1QSLA 3P5JA 4ICLA 5AQJA 3J7ZO 1TKTA 5BN9A 4NYFA 3C6TA 3LZIA 4H5RA 5CYQA 1Z6RA 4WQ4A 2OPQA 4HTLA 4IG3A 2W42A 1U4BA 3U9DA 3CJ1A 2OPRA 3P4IA 2Q1NA 5ADXH 1RDAA 4L8RB 3ZX3A 2OPSA 4AHVA 5BR9A 1O13A 4CBWA 2BE2A 2NRTA 5GIPA 4DB3A 3F73A 3BZKA 3LP3A 4IZ9A 3VESA 4IO9L 1U47A 1XHZA 3NE6A 4WQ5C 4FVUA 1ATNA 3AVFA 4JS5A 2UXBK 2HNYA 3VQ9A 4GV6A 3TTCA 3B6PA 1QE1A 4KB0A 4CJ4A 2GV9A 1HMVA 4LFAK 3M8RA 1HJRA 5J2NA 1WBDA 1TL3A 4BWJA 1SKSA 1KVBA 3HZ6A 3SQ0A 4PKGA 3O9TA 1KC8O 3T1YK 1KD1O 4CI6A 4FM0A 4FK2A 5EY4A 3C7NA 1RTJA 3AA5X 1KFDA 3HT3A 3TAFA 1C0TA 4M7XA 4KRFA 5H1SQ 3FZHA 1JLEA 3KK7A 2D0AA 4DFMA 3NCIA 4X66K 1TVRA 4BE0A 3SZ2A 3VQ7A 4K8ZA 3PX0A 3SK3A 3GBTA 3V6DA 2YI1A 3HYFA 4CJ5A 4IDKA 4JI6K 1QS4A 3DAWA 1MDUB 3QEXA 3P38A 3AO3A 3KK1A 4RW9A 4DFKA 4PHTX 3U6FA 1YAGA 3T1HK 3DXMB 1LW2A 3CCUN 3PO5A 4B3TK 1KAYA 4IDHA 4JLHA 2DFFA 2HBLA 4GVMA 1VQ4N 4BRPA 1IG9A 1NJIO 1Z25A 4JN4A 4A61A 4DMNA 1CZAN 4C8OA 1VRUA 1D5AA 3VQCA 4MO5A 3O9UA 3OJUA 3AO2A 4E7LA 1L5UA 5C15A 4M42A 4NLCA 2KKZA 3NF6A 2D0CA 2YHBA
chains in the Genus database with same CATH topology
1RILA 3P83D 4DLEA 4Q0BA 1BL3A 2E6LA 1Z26A 3K58A 1NKBA 3V1QA 5J2MA 2DTUA 4HCBA 3WNEA 1X9WA 4I7FA 4KKOA 3RTVA 3AA2A 4Z4GA 3ZT4A 3EZ5A 2YNGA 2YNHA 2FBVA 5HRSA 4FXDA 3TR8A 1GOCA 3AA3A 3L2UA 1XHXA 4CESA 1IKVA 1NK6A 4N76A 4K8XA 3LANA 2HHVA 1QSSA 3G0ZA 1JLCA 1SL2A 1BI4B 1RTIA 2KQ2A 3C6UA 4FW2A 3KK2A 3L2RA 4ELUA 2DFHA 4ZHRA 5KRTA 2P5OA 5HRRA 3DI6A 4DSIA 4FJNA 1RTHA 1VK0A 2RKIA 4IFVA 1QHTA 3NDKA 3AO4A 4DTUA 3CM6A 2E6MA 4KHYA 2E4LA 3ZSOA 2KZZA 2D0BA 3KLFA 1NJZA 1VSHA 1TAUA 4DU1A 3VQQA 5J2QA 3MEDA 4DQIA 1VSLA 1JLFA 1VSEA 2RPIA 3DM2A 4CIFA 3RMCA 2JGUA 3AVIA 1TK5A 4CGGA 4M3ZA 3SUNA 1IKXA 2ZE2A 1D8YA 4RW8A 2IDOA 4CF1A 3LP1A 4FCYA 3V4IA 4FLYA 3VQDA 4ELTA 2O4IA 1HPZA 4DU3A 1FK9A 4DQSA 1NK0A 3RR8A 2BGGA 3OYJA 3O4NA 5E41A 3F9KA 3VQ4A 1ASWA 3OYLA 4H4OA 1RBTA 2BANA 1VSMA 2X78A 2HNDA 3LAKA 4TSXA 3TANA 4CJLA 3BGRA 4CEAA 3AVLA 1NK8A 4FJLA 1EXQA 4OKJA 2AJQA 3MAQA 4FJ9A 2PYLA 1HQEA 3HL8A 4FVMA 4CFBA 3SCXA 2G8VA 4FK0A 1G15A 1JXEA 4W5QA 4CHNA 2HW3A 2XY8A 4KREA 4OPKA 3AVNA 4QAGA 1JL2A 3DLRA 3ZT1A 1S5JA 4B9MA 4NCGA 4F3OA 3B6OA 4B8AB 4PQUA 4M3XA 4B8CA 4GMJB 4CEQA 4CFDA 5J1EA 1BIZA 1LAWA 1RBUA 4CECA 4FJXA 4Z4FA 1Q9XA 3BDPA 3LPTA 1RTDA 4FZZA 2GUIA 4DWIA 1C0UA 1A5XA 4CK2A 3EYZA 3IAYA 1UOCA 1UWBA 1C1AA 2G8UA 4FJ5A 1S1VA 3NHGA 2QKKA 5CZ2A 4E7HA 4FLXA 3RMAA 3ZT3A 1XI1A 4NCBA 1N5YA 3SUPA 2ZQBA 5K14A 1TV6A 3NH2A 3S3OA 4C8LA 4MFBA 3OS2A 2OPPA 3K5LA 1D9DA 4F8RA 4E7KA 1ITGA 4O0JA 1IH7A 4GW6A 4DFPA 2G8FA 3HJFA 1TKXA 3OYIA 4CEEA 3JYTA 4OGCA 3HO1A 3CYMA 3VQAA 4CGJA 3C95A 1WNSA 4DF4A 1X9MA 1ZBHA 3DLKA 1TGOA 3LP2A 3NF8A 3KLGA 4FJMA 4JRPA 4IBNA 1KCFA 1A5WA 2KZMA 2XY5A 4O55A 4W5OA 3DOLA 5DMRA 3DRRA 3AO5A 1NK4A 1LW0A 3T19A 1HYZA 3KKSA 3VQ5A 3WNGA 4CJEA 1WAFA 4OGEA 2O4GA 1J54A 1S9EA 3V1RA 3SV3A 4BDPA 3QEVA 3ASMA 5FDLA 4E1MA 1L3SA 1L3TA 1HYSA 3AVBA 1VSJA 4AHUA 1WLJA 1RNHA 3QEWA 4HCCA 1T8EA 4F2SA 3A2FA 4H4MA 4E1NA 2PYJA 1NK7A 4J2EA 4DS5A 5HRNA 3L8BA 1N6QA 1RDBA 1X1PA 4FJKA 3AVJA 4CERA 1RBSA 4I9LA 3SQ1A 3LWMA 5KI6A 1CXQA 2Z1IA 3ALYA 5KRSA 4I2QA 1J9AA 3K5MA 1SUQA 5EU7A 4CEBA 2G8KA 2G8IA 3NF7A 3SUQA 4FJJA 4DQPA 3DLEA 4M3TA 2G8HA 4DSEA 4W5TA 3QERA 1ZBIA 3KIOA 3TABA 3RR7A 4CF2A 3AVKA 3WNFA 5HRPA 3K57A 1VSKA 3DMJA 2A1SA 3TAGA 4IFYA 5KGXA 4B9UA 3D45A 4DTXA 1R0AA 4EP5A 3NBPA 3T3FA 1CZ9A 4CGHA 2F8SA 4DSLA 4OLBA 1U04A 1ZBFA 1TKDA 2OYQA 1FXXA 3KKRA 4Z4IA 1WSEA 1C6VA 3HP9A 5SWMA 4DTMA 1VSDA 3DLGA 5CY4A 4FLUA 2FC0A 2WOMA 5HLFA 3HP6A 3G10A 4HUGA 3OYAA 4LSNA 3C94A 2B6AA 4DQQA 3PUFA 4CJ3A 2FBXA 4CHPA 4CJUA 3OS1A 3PV8A 4E19A 4JRQA 3ZT2A 3PY8A 4Z4CA 3LZJA 2HVHA 4RW4A 1B9DA 3TI0A 2G8WA 3V9XA 1LWEA 4J2AA 2HHWA 1RCHA 3ITHA 1B9FA 1NJXA 4CHQA 4CIGA 4FJ7A 4M3RA 4B9VA 1S1TA 1S1UA 3OVNA 4BWMA 4I9QA 2HMIA 4KHWA 4DSJA 3K5NA 3MXMA 1RDDA 3LALA 2XY6A 1JLBA 4CJWA 1K6YA 1SV5A 4Z0UA 4HVJA 4DTPA 2XRIA 1T05A 3SPZA 4FJIA 3O3HA 3DLBA 4E3SA 4F3TA 3QEPA 2YNFA 2LSNA 3MEGA 2VG5A 1BI4A 4LD0A 3ZSVA 4FM1A 4LY7A 3SNNA 3E01A 1WSGA 3L3UA 3QLHA 4IKFA 1XWLA 4MQ3A 1TL1A 4OKKA 5I42A 4LH4A 1UAXA 2HB5A 4FJ8A 3I8DA 1WAJA 4N5SA 2KTQA 2R7YA 1EX4A 4RG8A 1LWCA 3OYDA 2RF2A 4ID5A 1LV5A 4I2PA 4CFCA 1J53A 4C8NA 4PUOA 3CFRA 4QOZB 1IO2A 1GOBA 1O1WA 4AHCA 1NKEA 4KPYA 1SL0A 3HPGA 3V1OA 1NOYA 1QQCA 2YV0X 1WSIA 3KLIA 2X6NA 4B9NA 4FYDA 1RBRA 4M3YA 4DG1A 1JKHA 3M8QA 3VQ8A 1S1WA 2YHAA 4DTOA 1S9GA 2KW4A 1Y97A 3LAMA 5HROA 1L3UA 3NH1A 3V9UA 5HP1A 5CYMA 2QKBA 2HNZA 4B9TA 1FKOA 3ZSQA 1RDCA 3ZSZA 4CGDA 2X6SA 3OYKA 2HHTA 4CJVA 3SUOA 1QTMA 1C1CA 3V81A 2HHQA 1U45A 3RRGA 3MXJA 2OZSA 3NGZA 4FW1A 4BACA 1X9SA 1BGXT 5KGWA 4CEZA 5JS2A 4N56A 4DQRA 3DLHA 4E7IA 2FBYA 4BDYA 3AVCA 3CFOA 4CCHA 4CK1A 4ID1A 3L2QA 1NOZA 1WN7A 4FJHA 2GBZA 1S6PA 4FM2A 2Q3SA 4C8MA 4KHQA 4CF8A 2WONA 1BISA 2PY5A 3K2PA 5C25A 1JLGA 3OYBA 3SYZA 3TAPA 3IRXA 4BE1A 2IAJA 2Y1JA 4NYNA 1NKCA 3EY1A 4DTJA 3QINA 1Q8IA 3DOKA 3QIPA 4O5BA 2EX3A 1KRPA 3VN5A 1Q9YA 2X74A 4BDZA 4E0DA 3ZSRA 4CFAA 3DRPA 3M8PA 2ITGA 3VA3A 4FZYA 4E89A 3L2VA 3RRHA 1XC9A 4KHUA 4Z4EA 4PY5A 1UA1A 3AVMA 4KO0A 4Y1DA 1KVAA 3O3GA 1CZBA 4AH9A 3ZT0A 1U48A 4CHOA 4KTZA 3O4QA 4DF8A 4OPJA 2HHXA 3OJSA 3PX4A 4FK4A 4R5PA 2EHGA 4ZTFA 3ZSXA 1HYVA 3MEEA 1HNVA 1ZBUA 3HVRA 1B92A 1TKZA 3DRSA 1ZYQA 4CJTA 2IC3A 2DFEA 4CJQA 2RN2A 4O4GA 1NJWA 3V9SA 1RT5A 4O44A 2VWKA 3ZCMA 3K59A 1RBVA 1W0HA 4FLZA 5T7BA 4EZ6A 3HVTA 1WSHA 4N41A 3NGIA 1I3AA 4PWDA 3CG7A 1NK5A 4RW6A 2XY7A 3LPUA 4CF9A 3TARA 3NGYA 4EP4A 4OVLA 3QNOA 1QSYA 3ULDA 3OYHA 2IS3A 3PO4A 4CK3A 4PA1A 1ASVA 1LAVA 3WNHA 3V9ZA 1J5OA 2Y1IA 2ATQA 1S6QA 4CJPA 4E7JA 3MXIA 4CHZA 5JS1A 5HBMA 3QEIA 3TWHA 4AILC 2FBTA 1JLQA 2Z1GA 4DTNA 2F96A 4LH5A 4N47A 4JS4A 2QK9A 4KHNA 4CJRA 4W5RA 3TAMA 3LP0A 2DY4A 4W5NA 1RT7A 4KTWA 3VQEA 4UQGA 3HSTB 1TK8A 1YTUA 3DYAA 2PZSA 3SI6A 3NF9A 3FFIA 1RT3A 3KLHA 1SKWA 1KSPA 3SPYA 4F2RA 3NAEA 4DU4A 4CHYA 3VA0A 1JL1A 5FRNA 3KTQA 2VG7A 3TAEA 3I0RA 2HHUA 3ZSWA 1C1BA 5C24A 2ETJA 1KLMA 4ZTJA 1T03A 4OLAA 1KFSA 3LDSA 4KB1A 4FLWA 3CM5A 4HHTA 3VQPA 4CGFA 3HPHA 3KJVA 5I3UA 3AVAA 4CJKA 5FRMA 3KD1E 1LWFA 2KFNA 1NJYA 4M41A 1JLAA 4Z4HA 4YNQA 3V9WA 3S9HA 4QCLA 4B9SA 3THVA 3HK2A 1QSLA 3RMDA 3P5JA 4ICLA 4ELVA 4KHSA 3M8SA 3K5OA 4DLGA 1RT4A 1TKTA 1EP4A 4B9LA 3ISNC 3C6TA 2Z1HA 4NYFA 3LZIA 3SQ2A 4J2BA 5CYQA 4CJSA 3SQ4A 1BQMA 3P1GA 5CZ1A 4XIUA 1WSJA 2ZD1A 3RMBA 4C8KA 2OPQA 3AVHA 4IG3A 2W42A 1U4BA 4EZ9A 4DTRA 2OPRA 1DLOA 2HHSA 3NFAA 4YFUA 3S3NA 1RT6A 1RDAA 3OYNA 4CJFA 4DSKA 4L8RB 1DTQA 2OPSA 4CEDA 4KI4A 1C0MA 2IOCA 4AHVA 4DFJA 1BCOA 1SL1A 4KFBA 5FROA 2BE2A 3QNNA 1CXUA 3PX6A 4M3WA 4B3OA 3IG1A 2OZMA 3F73A 4M45A 5SZTA 2F8TA 1EETA 1KVCA 2XO7A 3LP3A 4LSLA 1S1XA 2QXFA 3I0SA 1NK9A 5D3GA 3QO9A 1U47A 1HRHA 3VQBA 3OYEA 3NE6A 4KV8A 1XHZA 2P5GA 1VSIA 4KI6A 3AVFA 4JS5A 2HNYA 3VQ9A 2IGIA 4BE2A 3B6PA 4H8KA 2VWJA 2BDPA 1QE1A 2JLEA 4KB0A 2NUBA 1EKEA 3ZSYA 1HNIA 4B08A 5KTQA 4CJ4A 2GV9A 2OA8A 3SJJA 3NH0A 4CGIA 1HMVA 1IKWA 4OKEA 3M8RA 2HVIA 1HJRA 5J2NA 1TL3A 3H08A 4AHTA 3TAQA 1T7PA 3UIQA 1JXBA 4BWJA 1SKSA 3RWUA 1KVBA 1D9FA 2YNIA 2KFZA 3SQ0A 2XHBA 3AA4A 3AV9A 3KLEA 4DS4A 3SV4A 1ASUA 4FM0A 1A5VA 4FK2A 2D5RA 1RT2A 3HXMA 2Z1JA 1SKRA 1RTJA 4Q5VA 3AA5X 4FZXC 1KFDA 3HT3A 4HUEA 3TAFA 1C0TA 5DK5A 4KRFA 1YVUA 1VRTA 1JLEA 2D0AA 4DFMA 1DTTA 4CF0A 3NCIA 4NCAA 1TVRA 2B4JA 1VSFA 4AHSA 4BE0A 1KLNA 1I39A 1YTAA 4HUFA 3SZ2A 1MU2A 3VQ7A 1FKPA 4K8ZA 3AVGA 3U3GA 3PX0A 3KK3A 4Y1CA 3L3VA 1ZBLA 3V6DA 3CFPA 3VQ6A 3HYFA 4CJ5A 4IDKA 3T1AA 1YT3A 3JSMA 4IG0A 1QS4A 4KAZA 3CQ8A 3IS9A 1WSFA 4RW7A 4WE1A 3QESA 3QEXA 4HTUA 3AO3A 3KK1A 3AO1A 4RW9A 4DSFA 1TK0A 3D0PA 1GOAA 1BHLA 3OYFA 1BCMA 3O3FA 4DFKA 1HQUA 3U6FA 3L2WA 4F4KA 1U49A 3QIOA 1CLQA 1L3VA 4G1QA 2A1RA 3KD5E 1IKYA 2VG6A 4KTQA 4CEFA 1LW2A 3OYCA 1RT1A 1F21A 3PO5A 4DTSA 1BQNA 4M3UA 4JLHA 2DFFA 1W9HA 2YKMA 4FJGA 4GVMA 3OYMA 4J2DA 1IG9A 4FLVA 1Z25A 4CEOA 4CE9A 4DMNA 5C42A 5J2PA 1KTQA 2B5JA 2YKNA 3U3YA 3LWLA 4FLTA 4C8OA 1VRUA 3HPOA 1D5AA 3VQCA 3QETA 2P51A 3OY9A 3AO2A 1REVA 4CIEA 3OYGA 3OJUA 4E7LA 3S3MA 1L5UA 1TAQA 1BIUA 3HM9A 3MECA 2I5JA 4M42A 3OS0A 1UA0A 4O0IA 3NF6A 4OJRA 2D0CA 2YHBA 4AHRA 2P1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RIL A;  3P83 D;  4DLE A;  4Q0B A;  1BL3 A;  2E6L A;  1Z26 A;  3K58 A;  1NKB A;  3V1Q A;  5J2M A;  2DTU A;  4HCB A;  3WNE A;  1X9W A;  4I7F A;  4KKO A;  3RTV A;  3AA2 A;  4Z4G A;  3ZT4 A;  3EZ5 A;  2YNG A;  2YNH A;  2FBV A;  5HRS A;  4FXD A;  3TR8 A;  1GOC A;  3AA3 A;  3L2U A;  1XHX A;  4CES A;  1IKV A;  1NK6 A;  4N76 A;  4K8X A;  3LAN A;  2HHV A;  1QSS A;  3G0Z A;  1JLC A;  1SL2 A;  1BI4 B;  1RTI A;  2KQ2 A;  3C6U A;  4FW2 A;  3KK2 A;  3L2R A;  4ELU A;  2DFH A;  4ZHR A;  5KRT A;  2P5O A;  5HRR A;  3DI6 A;  4DSI A;  4FJN A;  1RTH A;  1VK0 A;  2RKI A;  4IFV A;  1QHT A;  3NDK A;  3AO4 A;  4DTU A;  3CM6 A;  2E6M A;  4KHY A;  2E4L A;  3ZSO A;  2KZZ A;  2D0B A;  3KLF A;  1NJZ A;  1VSH A;  1TAU A;  4DU1 A;  3VQQ A;  5J2Q A;  3MED A;  4DQI A;  1VSL A;  1JLF A;  1VSE A;  2RPI A;  3DM2 A;  4CIF A;  3RMC A;  2JGU A;  3AVI A;  1TK5 A;  4CGG A;  4M3Z A;  3SUN A;  1IKX A;  2ZE2 A;  1D8Y A;  4RW8 A;  2IDO A;  4CF1 A;  3LP1 A;  4FCY A;  3V4I A;  4FLY A;  3VQD A;  4ELT A;  2O4I A;  1HPZ A;  4DU3 A;  1FK9 A;  4DQS A;  1NK0 A;  3RR8 A;  2BGG A;  3OYJ A;  3O4N A;  5E41 A;  3F9K A;  3VQ4 A;  1ASW A;  3OYL A;  4H4O A;  1RBT A;  2BAN A;  1VSM A;  2X78 A;  2HND A;  3LAK A;  4TSX A;  3TAN A;  4CJL A;  3BGR A;  4CEA A;  3AVL A;  1NK8 A;  4FJL A;  1EXQ A;  4OKJ A;  2AJQ A;  3MAQ A;  4FJ9 A;  2PYL A;  1HQE A;  3HL8 A;  4FVM A;  4CFB A;  3SCX A;  2G8V A;  4FK0 A;  1G15 A;  1JXE A;  4W5Q A;  4CHN A;  2HW3 A;  2XY8 A;  4KRE A;  4OPK A;  3AVN A;  4QAG A;  1JL2 A;  3DLR A;  3ZT1 A;  1S5J A;  4B9M A;  4NCG A;  4F3O A;  3B6O A;  4B8A B;  4PQU A;  4M3X A;  4B8C A;  4GMJ B;  4CEQ A;  4CFD A;  5J1E A;  1BIZ A;  1LAW A;  1RBU A;  4CEC A;  4FJX A;  4Z4F A;  1Q9X A;  3BDP A;  3LPT A;  1RTD A;  4FZZ A;  2GUI A;  4DWI A;  1C0U A;  1A5X A;  4CK2 A;  3EYZ A;  3IAY A;  1UOC A;  1UWB A;  1C1A A;  2G8U A;  4FJ5 A;  1S1V A;  3NHG A;  2QKK A;  5CZ2 A;  4E7H A;  4FLX A;  3RMA A;  3ZT3 A;  1XI1 A;  4NCB A;  1N5Y A;  3SUP A;  2ZQB A;  5K14 A;  1TV6 A;  3NH2 A;  3S3O A;  4C8L A;  4MFB A;  3OS2 A;  2OPP A;  3K5L A;  1D9D A;  4F8R A;  4E7K A;  1ITG A;  4O0J A;  1IH7 A;  4GW6 A;  4DFP A;  2G8F A;  3HJF A;  1TKX A;  3OYI A;  4CEE A;  3JYT A;  4OGC A;  3HO1 A;  3CYM A;  3VQA A;  4CGJ A;  3C95 A;  1WNS A;  4DF4 A;  1X9M A;  1ZBH A;  3DLK A;  1TGO A;  3LP2 A;  3NF8 A;  3KLG A;  4FJM A;  4JRP A;  4IBN A;  1KCF A;  1A5W A;  2KZM A;  2XY5 A;  4O55 A;  4W5O A;  3DOL A;  5DMR A;  3DRR A;  3AO5 A;  1NK4 A;  1LW0 A;  3T19 A;  1HYZ A;  3KKS A;  3VQ5 A;  3WNG A;  4CJE A;  1WAF A;  4OGE A;  2O4G A;  1J54 A;  1S9E A;  3V1R A;  3SV3 A;  4BDP A;  3QEV A;  3ASM A;  5FDL A;  4E1M A;  1L3S A;  1L3T A;  1HYS A;  3AVB A;  1VSJ A;  4AHU A;  1WLJ A;  1RNH A;  3QEW A;  4HCC A;  1T8E A;  4F2S A;  3A2F A;  4H4M A;  4E1N A;  2PYJ A;  1NK7 A;  4J2E A;  4DS5 A;  5HRN A;  3L8B A;  1N6Q A;  1RDB A;  1X1P A;  4FJK A;  3AVJ A;  4CER A;  1RBS A;  4I9L A;  3SQ1 A;  3LWM A;  5KI6 A;  1CXQ A;  2Z1I A;  3ALY A;  5KRS A;  4I2Q A;  1J9A A;  3K5M A;  1SUQ A;  5EU7 A;  4CEB A;  2G8K A;  2G8I A;  3NF7 A;  3SUQ A;  4FJJ A;  4DQP A;  3DLE A;  4M3T A;  2G8H A;  4DSE A;  4W5T A;  3QER A;  1ZBI A;  3KIO A;  3TAB A;  3RR7 A;  4CF2 A;  3AVK A;  3WNF A;  5HRP A;  3K57 A;  1VSK A;  3DMJ A;  2A1S A;  3TAG A;  4IFY A;  5KGX A;  4B9U A;  3D45 A;  4DTX A;  1R0A A;  4EP5 A;  3NBP A;  3T3F A;  1CZ9 A;  4CGH A;  2F8S A;  4DSL A;  4OLB A;  1U04 A;  1ZBF A;  1TKD A;  2OYQ A;  1FXX A;  3KKR A;  4Z4I A;  1WSE A;  1C6V A;  3HP9 A;  5SWM A;  4DTM A;  1VSD A;  3DLG A;  5CY4 A;  4FLU A;  2FC0 A;  2WOM A;  5HLF A;  3HP6 A;  3G10 A;  4HUG A;  3OYA A;  4LSN A;  3C94 A;  2B6A A;  4DQQ A;  3PUF A;  4CJ3 A;  2FBX A;  4CHP A;  4CJU A;  3OS1 A;  3PV8 A;  4E19 A;  4JRQ A;  3ZT2 A;  3PY8 A;  4Z4C A;  3LZJ A;  2HVH A;  4RW4 A;  1B9D A;  3TI0 A;  2G8W A;  3V9X A;  1LWE A;  4J2A A;  2HHW A;  1RCH A;  3ITH A;  1B9F A;  1NJX A;  4CHQ A;  4CIG A;  4FJ7 A;  4M3R A;  4B9V A;  1S1T A;  1S1U A;  3OVN A;  4BWM A;  4I9Q A;  2HMI A;  4KHW A;  4DSJ A;  3K5N A;  3MXM A;  1RDD A;  3LAL A;  2XY6 A;  1JLB A;  4CJW A;  1K6Y A;  1SV5 A;  4Z0U A;  4HVJ A;  4DTP A;  2XRI A;  1T05 A;  3SPZ A;  4FJI A;  3O3H A;  3DLB A;  4E3S A;  4F3T A;  3QEP A;  2YNF A;  2LSN A;  3MEG A;  2VG5 A;  1BI4 A;  4LD0 A;  3ZSV A;  4FM1 A;  4LY7 A;  3SNN A;  3E01 A;  1WSG A;  3L3U A;  3QLH A;  4IKF A;  1XWL A;  4MQ3 A;  1TL1 A;  4OKK A;  5I42 A;  4LH4 A;  1UAX A;  2HB5 A;  4FJ8 A;  3I8D A;  1WAJ A;  4N5S A;  2KTQ A;  2R7Y A;  1EX4 A;  4RG8 A;  1LWC A;  3OYD A;  2RF2 A;  4ID5 A;  1LV5 A;  4I2P A;  4CFC A;  1J53 A;  4C8N A;  4PUO A;  3CFR A;  4QOZ B;  1IO2 A;  1GOB A;  1O1W A;  4AHC A;  1NKE A;  4KPY A;  1SL0 A;  3HPG A;  3V1O A;  1NOY A;  1QQC A;  2YV0 X;  1WSI A;  3KLI A;  2X6N A;  4B9N A;  4FYD A;  1RBR A;  4M3Y A;  4DG1 A;  1JKH A;  3M8Q A;  3VQ8 A;  1S1W A;  2YHA A;  4DTO A;  1S9G A;  2KW4 A;  1Y97 A;  3LAM A;  5HRO A;  1L3U A;  3NH1 A;  3V9U A;  5HP1 A;  5CYM A;  2QKB A;  2HNZ A;  4B9T A;  1FKO A;  3ZSQ A;  1RDC A;  3ZSZ A;  4CGD A;  2X6S A;  3OYK A;  2HHT A;  4CJV A;  3SUO A;  1QTM A;  1C1C A;  3V81 A;  2HHQ A;  1U45 A;  3RRG A;  3MXJ A;  2OZS A;  3NGZ A;  4FW1 A;  4BAC A;  1X9S A;  1BGX T;  5KGW A;  4CEZ A;  5JS2 A;  4N56 A;  4DQR A;  3DLH A;  4E7I A;  2FBY A;  4BDY A;  3AVC A;  3CFO A;  4CCH A;  4CK1 A;  4ID1 A;  3L2Q A;  1NOZ A;  1WN7 A;  4FJH A;  2GBZ A;  1S6P A;  4FM2 A;  2Q3S A;  4C8M A;  4KHQ A;  4CF8 A;  2WON A;  1BIS A;  2PY5 A;  3K2P A;  5C25 A;  1JLG A;  3OYB A;  3SYZ A;  3TAP A;  3IRX A;  4BE1 A;  2IAJ A;  2Y1J A;  4NYN A;  1NKC A;  3EY1 A;  4DTJ A;  3QIN A;  1Q8I A;  3DOK A;  3QIP A;  4O5B A;  2EX3 A;  1KRP A;  3VN5 A;  1Q9Y A;  2X74 A;  4BDZ A;  4E0D A;  3ZSR A;  4CFA A;  3DRP A;  3M8P A;  2ITG A;  3VA3 A;  4FZY A;  4E89 A;  3L2V A;  3RRH A;  1XC9 A;  4KHU A;  4Z4E A;  4PY5 A;  1UA1 A;  3AVM A;  4KO0 A;  4Y1D A;  1KVA A;  3O3G A;  1CZB A;  4AH9 A;  3ZT0 A;  1U48 A;  4CHO A;  4KTZ A;  3O4Q A;  4DF8 A;  4OPJ A;  2HHX A;  3OJS A;  3PX4 A;  4FK4 A;  4R5P A;  2EHG A;  4ZTF A;  3ZSX A;  1HYV A;  3MEE A;  1HNV A;  1ZBU A;  3HVR A;  1B92 A;  1TKZ A;  3DRS A;  1ZYQ A;  4CJT A;  2IC3 A;  2DFE A;  4CJQ A;  2RN2 A;  4O4G A;  1NJW A;  3V9S A;  1RT5 A;  4O44 A;  2VWK A;  3ZCM A;  3K59 A;  1RBV A;  1W0H A;  4FLZ A;  5T7B A;  4EZ6 A;  3HVT A;  1WSH A;  4N41 A;  3NGI A;  1I3A A;  4PWD A;  3CG7 A;  1NK5 A;  4RW6 A;  2XY7 A;  3LPU A;  4CF9 A;  3TAR A;  3NGY A;  4EP4 A;  4OVL A;  3QNO A;  1QSY A;  3ULD A;  3OYH A;  2IS3 A;  3PO4 A;  4CK3 A;  4PA1 A;  1ASV A;  1LAV A;  3WNH A;  3V9Z A;  1J5O A;  2Y1I A;  2ATQ A;  1S6Q A;  4CJP A;  4E7J A;  3MXI A;  4CHZ A;  5JS1 A;  5HBM A;  3QEI A;  3TWH A;  4AIL C;  2FBT A;  1JLQ A;  2Z1G A;  4DTN A;  2F96 A;  4LH5 A;  4N47 A;  4JS4 A;  2QK9 A;  4KHN A;  4CJR A;  4W5R A;  3TAM A;  3LP0 A;  2DY4 A;  4W5N A;  1RT7 A;  4KTW A;  3VQE A;  4UQG A;  3HST B;  1TK8 A;  1YTU A;  3DYA A;  2PZS A;  3SI6 A;  3NF9 A;  3FFI A;  1RT3 A;  3KLH A;  1SKW A;  1KSP A;  3SPY A;  4F2R A;  3NAE A;  4DU4 A;  4CHY A;  3VA0 A;  1JL1 A;  5FRN A;  3KTQ A;  2VG7 A;  3TAE A;  3I0R A;  2HHU A;  3ZSW A;  1C1B A;  5C24 A;  2ETJ A;  1KLM A;  4ZTJ A;  1T03 A;  4OLA A;  1KFS A;  3LDS A;  4KB1 A;  4FLW A;  3CM5 A;  4HHT A;  3VQP A;  4CGF A;  3HPH A;  3KJV A;  5I3U A;  3AVA A;  4CJK A;  5FRM A;  3KD1 E;  1LWF A;  2KFN A;  1NJY A;  4M41 A;  1JLA A;  4Z4H A;  4YNQ A;  3V9W A;  3S9H A;  4QCL A;  4B9S A;  3THV A;  3HK2 A;  1QSL A;  3RMD A;  3P5J A;  4ICL A;  4ELV A;  4KHS A;  3M8S A;  3K5O A;  4DLG A;  1RT4 A;  1TKT A;  1EP4 A;  4B9L A;  3ISN C;  3C6T A;  2Z1H A;  4NYF A;  3LZI A;  3SQ2 A;  4J2B A;  5CYQ A;  4CJS A;  3SQ4 A;  1BQM A;  3P1G A;  5CZ1 A;  4XIU A;  1WSJ A;  2ZD1 A;  3RMB A;  4C8K A;  2OPQ A;  3AVH A;  4IG3 A;  2W42 A;  1U4B A;  4EZ9 A;  4DTR A;  2OPR A;  1DLO A;  2HHS A;  3NFA A;  4YFU A;  3S3N A;  1RT6 A;  1RDA A;  3OYN A;  4CJF A;  4DSK A;  4L8R B;  1DTQ A;  2OPS A;  4CED A;  4KI4 A;  1C0M A;  2IOC A;  4AHV A;  4DFJ A;  1BCO A;  1SL1 A;  4KFB A;  5FRO A;  2BE2 A;  3QNN A;  1CXU A;  3PX6 A;  4M3W A;  4B3O A;  3IG1 A;  2OZM A;  3F73 A;  4M45 A;  5SZT A;  2F8T A;  1EET A;  1KVC A;  2XO7 A;  3LP3 A;  4LSL A;  1S1X A;  2QXF A;  3I0S A;  1NK9 A;  5D3G A;  3QO9 A;  1U47 A;  1HRH A;  3VQB A;  3OYE A;  3NE6 A;  4KV8 A;  1XHZ A;  2P5G A;  1VSI A;  4KI6 A;  3AVF A;  4JS5 A;  2HNY A;  3VQ9 A;  2IGI A;  4BE2 A;  3B6P A;  4H8K A;  2VWJ A;  2BDP A;  1QE1 A;  2JLE A;  4KB0 A;  2NUB A;  1EKE A;  3ZSY A;  1HNI A;  4B08 A;  5KTQ A;  4CJ4 A;  2GV9 A;  2OA8 A;  3SJJ A;  3NH0 A;  4CGI A;  1HMV A;  1IKW A;  4OKE A;  3M8R A;  2HVI A;  1HJR A;  5J2N A;  1TL3 A;  3H08 A;  4AHT A;  3TAQ A;  1T7P A;  3UIQ A;  1JXB A;  4BWJ A;  1SKS A;  3RWU A;  1KVB A;  1D9F A;  2YNI A;  2KFZ A;  3SQ0 A;  2XHB A;  3AA4 A;  3AV9 A;  3KLE A;  4DS4 A;  3SV4 A;  1ASU A;  4FM0 A;  1A5V A;  4FK2 A;  2D5R A;  1RT2 A;  3HXM A;  2Z1J A;  1SKR A;  1RTJ A;  4Q5V A;  3AA5 X;  4FZX C;  1KFD A;  3HT3 A;  4HUE A;  3TAF A;  1C0T A;  5DK5 A;  4KRF A;  1YVU A;  1VRT A;  1JLE A;  2D0A A;  4DFM A;  1DTT A;  4CF0 A;  3NCI A;  4NCA A;  1TVR A;  2B4J A;  1VSF A;  4AHS A;  4BE0 A;  1KLN A;  1I39 A;  1YTA A;  4HUF A;  3SZ2 A;  1MU2 A;  3VQ7 A;  1FKP A;  4K8Z A;  3AVG A;  3U3G A;  3PX0 A;  3KK3 A;  4Y1C A;  3L3V A;  1ZBL A;  3V6D A;  3CFP A;  3VQ6 A;  3HYF A;  4CJ5 A;  4IDK A;  3T1A A;  1YT3 A;  3JSM A;  4IG0 A;  1QS4 A;  4KAZ A;  3CQ8 A;  3IS9 A;  1WSF A;  4RW7 A;  4WE1 A;  3QES A;  3QEX A;  4HTU A;  3AO3 A;  3KK1 A;  3AO1 A;  4RW9 A;  4DSF A;  1TK0 A;  3D0P A;  1GOA A;  1BHL A;  3OYF A;  1BCM A;  3O3F A;  4DFK A;  1HQU A;  3U6F A;  3L2W A;  4F4K A;  1U49 A;  3QIO A;  1CLQ A;  1L3V A;  4G1Q A;  2A1R A;  3KD5 E;  1IKY A;  2VG6 A;  4KTQ A;  4CEF A;  1LW2 A;  3OYC A;  1RT1 A;  1F21 A;  3PO5 A;  4DTS A;  1BQN A;  4M3U A;  4JLH A;  2DFF A;  1W9H A;  2YKM A;  4FJG A;  4GVM A;  3OYM A;  4J2D A;  1IG9 A;  4FLV A;  1Z25 A;  4CEO A;  4CE9 A;  4DMN A;  5C42 A;  5J2P A;  1KTQ A;  2B5J A;  2YKN A;  3U3Y A;  3LWL A;  4FLT A;  4C8O A;  1VRU A;  3HPO A;  1D5A A;  3VQC A;  3QET A;  2P51 A;  3OY9 A;  3AO2 A;  1REV A;  4CIE A;  3OYG A;  3OJU A;  4E7L A;  3S3M A;  1L5U A;  1TAQ A;  1BIU A;  3HM9 A;  3MEC A;  2I5J A;  4M42 A;  3OS0 A;  1UA0 A;  4O0I A;  3NF6 A;  4OJR A;  2D0C A;  2YHB A;  4AHR A;  2P1J A; 
#chains in the Genus database with same CATH topology
 1RDW X;  3P83 D;  4DLE A;  2E6L A;  1Z26 A;  3K58 A;  1NKB A;  3D2E B;  1NGF A;  3WNE A;  4I7F A;  4Z4G A;  4IXC A;  3EZ5 A;  2YNG A;  2YNH A;  2GTD A;  1XHX A;  5AJ3 K;  4N76 A;  2JWK A;  3LAN A;  1QSS A;  3G0Z A;  1BI4 B;  1RTI A;  1C0G A;  1VK0 A;  3VF2 A;  4JI4 K;  4LF8 K;  3AO4 A;  2GWJ A;  1QVG M;  2WUS A;  2KZZ A;  4BRN A;  1VSH A;  5BRH A;  1H1V A;  4BRH A;  2RPI A;  3DM2 A;  5FPN A;  4JKA A;  4BVP A;  1TK5 A;  4DR7 K;  3VGL A;  3THW A;  3V4I A;  4FLY A;  2BTF A;  1VQM N;  2O4I A;  1NK0 A;  3OYJ A;  3F9K A;  4H4O A;  2WTU A;  3MAQ A;  3SCX A;  3W3D A;  4FK0 A;  1G15 A;  4B1Y B;  2HW3 A;  3C6A A;  4CJ7 A;  4B9M A;  4BRE A;  2A6A A;  4B8C A;  4CEQ A;  1HNX K;  1YJW N;  1LAW A;  4FJX A;  1K73 O;  2ZJQ L;  2GUI A;  1C0U A;  3EYZ A;  1NGA A;  2G8U A;  3CI5 A;  5M1Q A;  1WUA A;  4E7H A;  3RMA A;  3CPE A;  3SUP A;  3NH2 A;  4MFB A;  3PLA A;  3OS2 A;  4XH4 A;  2OPP A;  3KZB A;  1D9D A;  4F8R A;  4E7K A;  4O0J A;  1IH7 A;  4MO4 A;  3F9M A;  4CEE A;  2E1Y A;  3JYT A;  1N34 K;  1ZBH A;  4JI7 K;  3LP2 A;  3J7Y P;  4ISE A;  4Y0W A;  5HL7 L;  3ATV A;  3AAP A;  4JKD A;  5DMR A;  1ZXO A;  1NK4 A;  4CZM A;  3VQ5 A;  1WAF A;  3JS6 A;  4NXN K;  1S9E A;  3V1R A;  3SV3 A;  1YHQ N;  2E1Z A;  4E1M A;  4YOV A;  1HYS A;  1DGK N;  3O4W A;  3G71 N;  3SBG A;  1RNH A;  4PKI A;  4E1J A;  4F2S A;  3A2F A;  5BR8 K;  2PYJ A;  3CXC M;  4IOC L;  1N6Q A;  3MN6 A;  3SQ1 A;  3RVC A;  3ALY A;  1ESV A;  4WQ4 C;  3K5M A;  2G8K A;  3NF7 A;  3K9K A;  3SUQ A;  2G8H A;  2P9L B;  4DSE A;  1W2B M;  3K57 A;  1VSK A;  1TYQ A;  3DMJ A;  4DR5 K;  4IFY A;  4B9U A;  3D45 A;  4EP5 A;  2E2O A;  1E3M A;  4DSL A;  4OLB A;  3C65 A;  2ITM A;  1U04 A;  1FXX A;  3KKR A;  4DTM A;  3FFK B;  4NB4 A;  4HUG A;  3HBT A;  4LSN A;  3LDQ A;  4DQQ A;  3PUF A;  5IT9 O;  2FBX A;  4CJU A;  4E19 A;  4IOA L;  1RDU A;  5EVZ A;  3V9X A;  5AZI A;  4J2A A;  4FJ7 A;  4CIG A;  4JKH A;  1VQ7 N;  1S1U A;  5BPN A;  4FPA A;  4KHW A;  1XMQ K;  3LAL A;  1JLB A;  3HRG A;  3CMA N;  5CR4 A;  4E3S A;  2IVO A;  2YJF A;  4LY7 A;  3QLH A;  2IIR A;  2NRZ A;  4OKK A;  2QWM A;  4LH4 A;  1UAX A;  5B8H A;  3L6Q A;  2HBM A;  4RG8 A;  1LWC A;  2RF2 A;  4BC4 A;  1LV5 A;  4C8N A;  4PUO A;  4QOZ B;  5CE3 A;  4AHC A;  3ZYY X;  1NKE A;  2UUC K;  4KPY A;  3KLI A;  4L3Q A;  2X6N A;  1JCF A;  5F0X A;  3M8Q A;  4FWM A;  2YHA A;  3VQ8 A;  2KW4 A;  3LAM A;  3NH1 A;  1Q18 A;  1FKO A;  4CJV A;  4WFB L;  1C1C A;  3V81 A;  4WCE L;  2OZS A;  3U4L A;  4BVO A;  3SBT A;  4BR0 A;  4CEZ A;  1P8Z A;  4DQR A;  3K0S A;  2FBY A;  2FF6 A;  4PL8 A;  3WT0 A;  3ATU A;  2Q3S A;  4AM7 A;  4IEI A;  4CF8 A;  3JXU A;  1YF5 L;  5CHI A;  2PY5 A;  3K2P A;  3IFR A;  3OYB A;  5M1N A;  3HTV A;  3LDL A;  3EY1 A;  3W0L A;  2P9N A;  3QIP A;  1J5E K;  4DR1 K;  2E8A A;  4XEI A;  2HOE A;  2VCP A;  5AZJ A;  4E89 A;  1MA9 B;  4CZJ A;  3CCL N;  4OPJ A;  2UUA K;  3PX4 A;  2UUB K;  2EHG A;  1HYV A;  1HNV A;  3DRS A;  3HOS A;  4CJQ A;  2OAN A;  4O4G A;  4B1X B;  1NJW A;  2GX9 A;  4WYB A;  1Z05 A;  2UXD K;  4O44 A;  4DR3 K;  3M6G A;  3L0Q A;  1NGI A;  1RBV A;  1TYQ B;  3BP8 A;  4NXM K;  3MMV A;  3VF6 A;  3CG7 A;  4GKJ K;  4IJA A;  4RW6 A;  2XY7 A;  1NG9 A;  4EP4 A;  3QNO A;  1VQK N;  3ULD A;  3KHY A;  3OYH A;  4QS7 A;  4O8U A;  1LAV A;  3CJA A;  2ATQ A;  3EE8 A;  4CJP A;  3MXI A;  5JS1 A;  4DUY K;  3QEI A;  5FPD A;  2Z1G A;  4DTN A;  2DY4 A;  3IUC A;  1RT7 A;  3G25 A;  3WUH A;  3DYA A;  3SI6 A;  1VQ8 N;  3NF9 A;  2A42 A;  1SKW A;  3GG4 A;  4F2R A;  5FRN A;  1XQS C;  4CZE A;  3KTQ A;  4GV3 A;  1C1B A;  2ETJ A;  2HMP A;  4CZH A;  4BR9 A;  3CM5 A;  5LY3 A;  5KPZ A;  5JVG L;  2VWB A;  4Z94 A;  4CJK A;  5FRM A;  1N32 K;  4JD2 A;  5DM7 L;  1LWF A;  2KFN A;  4QCL A;  3V9W A;  4Z4H A;  4WF9 L;  4B9S A;  2FXU A;  4JHD B;  5KPT A;  1YIT N;  3THV A;  4OX9 K;  1BDG A;  2Z1H A;  5LMU K;  4CJS A;  1BQM A;  1HKB A;  3P1G A;  5CZ1 A;  4XIU A;  1WSJ A;  2RHK A;  3UKU A;  3FGU A;  4YFU A;  4CJF A;  4DSK A;  4DFJ A;  1BCO A;  3VEN A;  4CVN E;  4IOX A;  3GE1 A;  3UE5 A;  4M45 A;  5FLX O;  3QFU A;  4MLH A;  2F8T A;  2XO7 A;  2PFU A;  2QXF A;  2WC9 A;  3G4S N;  4BQZ A;  2P5G A;  3VQB A;  1ATS A;  1Q81 O;  4DV3 K;  3PIP L;  4LFC K;  2ASM A;  5AQH A;  1EKE A;  1HNI A;  4ISF A;  3SJJ A;  1IKW A;  2JWL A;  3CJ9 A;  1T7P A;  4JEP A;  3RWU A;  2OTJ N;  1D9F A;  2KFZ A;  2YNI A;  4JKF A;  3CCM N;  3SV4 A;  1ASU A;  1A5V A;  1GLF O;  1RT2 A;  3JAM O;  2Z1J A;  5M1K A;  2WFB A;  5DK5 A;  3OBW A;  1YVU A;  4NCA A;  1VSF A;  1XUP O;  2O8C B;  2V51 B;  1I39 A;  1KLN A;  4HUF A;  4FWS A;  3VGM A;  3AVG A;  4BG8 A;  2YHX A;  5LJV A;  5BRE A;  4I6M A;  3SAG A;  3L3V A;  1GLJ O;  3T1A A;  1NGC A;  4IG0 A;  3CCQ N;  4KAZ A;  1OH6 A;  2OCE A;  3AO1 A;  5BRF A;  4DSF A;  1DT9 A;  1GOA A;  1BCM A;  3CJB A;  3O3F A;  1CLQ A;  3R6M A;  3IDH A;  2QW9 A;  1L3V A;  1GLL O;  5ELZ A;  1BQN A;  4OO1 J;  2YKM A;  5AQU A;  4GKK K;  5AQW A;  4FLV A;  3AAR A;  4CEO A;  5C10 A;  4WFA L;  3U3Y A;  1KTQ A;  3HPO A;  5FPE A;  4BRG A;  4JK9 A;  3QET A;  1IV0 A;  3ENH A;  1UA0 A;  3QIC A;  1W7A A;  1HX1 A;  2W6L A;  3V1Q A;  4HCB A;  3VMF B;  2QWO A;  3AA2 A;  2CGJ A;  5HRS A;  3TR8 A;  4JI5 K;  3L2U A;  3CPW M;  1K8A O;  2HHV A;  1IKV A;  4A59 A;  4JD2 B;  3L2R A;  2KQ2 A;  3C6U A;  3KK2 A;  5HOO A;  4KHP K;  2O8F B;  5BPL A;  4ZHR A;  5HRR A;  1V4S A;  2RKI A;  3EE9 A;  4C1N I;  4DTU A;  2BH1 A;  2E4L A;  2D0B A;  1VQ9 N;  1TAU A;  5TKY A;  1LCU A;  3AVI A;  3SUN A;  2NLX A;  2IDO A;  1OH7 A;  3LP1 A;  4AF1 A;  4FCY A;  3UKU B;  3BY5 A;  4ELT A;  2FSN A;  3O4N A;  3OYL A;  3A5N C;  3TAN A;  2BAN A;  2HND A;  4CJL A;  3AVL A;  3DLL L;  1EXQ A;  4OKJ A;  2AJQ A;  1U6Z A;  2PYL A;  2EWS A;  4QAG A;  3WQT A;  4F3O A;  4M3X A;  1M1K O;  3I33 A;  2A5X A;  4Z4F A;  1Q9X A;  3LPT A;  4DWI A;  1KXP A;  1GLC G;  1UWB A;  4WFN L;  1S1V A;  4LF5 K;  4FLX A;  2ZJR L;  1N5Y A;  2ZQB A;  4CD1 A;  1TV6 A;  5C2F A;  5AQY A;  3K5L A;  1ITG A;  2ZGZ A;  2D0P A;  4GW6 A;  2G8F A;  3HO1 A;  3CYM A;  3C95 A;  5KQD A;  4BRQ A;  4JRP A;  4IBN A;  1KCF A;  1A5W A;  4O55 A;  3A5L C;  4W5O A;  3AO5 A;  1JJ2 M;  5M1P A;  1YI2 N;  1LW0 A;  3T19 A;  1HYZ A;  2HST A;  3AGK A;  4CJE A;  1BA1 A;  4OGE A;  1J54 A;  3ASM A;  5FDL A;  2QWQ A;  3THX A;  3AVB A;  3U9Z A;  4HCC A;  2QI2 A;  3O1W A;  4BRA A;  5HRN A;  3DXK A;  4U7B A;  3CQX A;  3AVJ A;  4A5A A;  5KI6 A;  5KRS A;  4X65 K;  4A57 A;  4DV2 K;  2D4W A;  3A8Y A;  4CEB A;  4FJJ A;  3LM9 A;  4BRD A;  4M3T A;  4RCH A;  1DEJ A;  3CCV N;  2PAV A;  3MN5 A;  3QER A;  1ZBI A;  4CF2 A;  1NNE A;  1IG8 A;  2A1S A;  5KGX A;  3D6R A;  4DTX A;  1CZ9 A;  4CGH A;  1TKD A;  3VEV A;  2O8D A;  4Z4I A;  1WSE A;  4A2B A;  3NVM A;  3EN9 A;  5HLF A;  3HP6 A;  3OYA A;  1N33 K;  2B6A A;  4ILJ A;  3OS1 A;  4JRQ A;  4LF7 K;  3PY8 A;  4Z4C A;  1NWK A;  2HHW A;  1RCH A;  3IKM A;  1B9F A;  3M5R A;  4BR5 A;  3WXK A;  5AQV A;  1NM1 A;  4BWM A;  4I9Q A;  2HMI A;  4JI2 K;  2E2N A;  1RDD A;  3CC4 N;  2XY6 A;  4CJW A;  2QA4 N;  1T05 A;  2XRI A;  3FE1 A;  3O3H A;  3AGR A;  4F3T A;  2LSN A;  1HKG A;  4LD0 A;  4IKF A;  2CH5 A;  3EL2 A;  1Q82 O;  1E4F T;  4FJ8 A;  3I8D A;  3ZET A;  5ADX A;  1QZ5 A;  3VEX A;  4ID5 A;  1VAZ A;  3C0B A;  4FOE A;  3CFR A;  1GOB A;  3WEE A;  2UXC K;  4AM6 A;  1SZ2 A;  2YV0 X;  1WSI A;  1QQO A;  4B9N A;  1RBR A;  4DG1 A;  2P9P A;  3LDO A;  2V7Z A;  4DTO A;  1S9G A;  5HRO A;  1L3U A;  4BC2 A;  5CYM A;  3CCE N;  5BN8 A;  4B9T A;  1D4X A;  3OYK A;  2HHT A;  3NGZ A;  3QDK A;  3C7N B;  4GVE A;  5JS2 A;  1VQN N;  4N56 A;  1VQ6 N;  4BDY A;  3AVC A;  3CIP A;  4CK1 A;  2QWL A;  2CH6 A;  3E66 A;  1NGH A;  5GAE P;  1C0F A;  2WON A;  1R59 O;  5C25 A;  3SYZ A;  4H0V B;  3VET A;  5AQR A;  2UYT A;  1Q8I A;  3THX B;  4O5B A;  3J8A A;  2EX3 A;  1NBW A;  3VN5 A;  3VF4 A;  2X74 A;  4BDZ A;  4E0D A;  4CFA A;  2ITG A;  4C1N K;  3H6E A;  3WXL A;  3DXK B;  1XC9 A;  4KHU A;  4PY5 A;  1VHX A;  4KO0 A;  1KVA A;  1CZB A;  5M1O A;  2O8E A;  1N8R O;  4ZTF A;  3HVR A;  1SQK A;  2IC3 A;  2RN2 A;  1YVN A;  3LDP A;  1S3X A;  3V9S A;  3K59 A;  1W0H A;  4FLZ A;  3MX5 A;  4N41 A;  4JI8 K;  2Q31 A;  3NGI A;  4PWD A;  1NK5 A;  3LPU A;  4RTF D;  4CF9 A;  3ENB A;  3NGY A;  4OVL A;  2VGN A;  2P9K A;  3AY9 A;  4OPH A;  4EFH A;  2O8D B;  1NGD A;  3WNH A;  3V9Z A;  2Y1I A;  4DV6 K;  1S6Q A;  1LOT B;  3H3O B;  3CCR N;  5MLC Q;  5HBM A;  3E9L A;  4DUZ K;  2FBT A;  1EWQ A;  4ILH A;  5EOY A;  4KHN A;  4CJR A;  3TAM A;  4JI3 K;  4KTW A;  3VQE A;  4UQG A;  1ZC6 A;  5AQS A;  1M90 O;  4H5W A;  1TUY A;  1K9M O;  3NAE A;  4DU4 A;  3NMU A;  2HHU A;  1HR0 K;  2FSJ A;  4A62 A;  4ZTJ A;  1XNQ K;  4FLW A;  4AQY K;  3THW B;  2ZJP L;  1YIJ N;  1WB9 A;  2O8B A;  5I3U A;  3KD1 E;  5AQZ A;  4DKW A;  2HBK A;  3EEQ A;  4H03 B;  1NJY A;  4M41 A;  1JLA A;  4YNQ A;  3S9H A;  3HK2 A;  4ELV A;  3ZET B;  4KHS A;  4DLG A;  1RT4 A;  5AQP A;  4F9O A;  3O08 A;  5JLH A;  2D0O A;  3K9J A;  4MLE A;  1Q7Y O;  3RMB A;  3WEE B;  3OW2 M;  4A5B A;  1DLO A;  2KHO A;  3NFA A;  2NZT A;  2E2Q A;  3OYN A;  1DTQ A;  4KI4 A;  1C0M A;  2IOC A;  2P9P B;  3FZF A;  1KAX A;  5GAG P;  3MK6 A;  1MWK A;  3QNN A;  5AQQ A;  3PX6 A;  4NLB A;  4B3O A;  5F1X A;  1G99 A;  3ZEU A;  3N4Q A;  5SZT A;  3J7A P;  4LSL A;  1S1X A;  5D3G A;  3O5B A;  3NVK A;  1HRH A;  3TTF A;  4KV8 A;  2QXL A;  4KI6 A;  2IGI A;  4K25 A;  4H8K A;  2AP1 A;  4QS8 A;  3NH0 A;  4CGI A;  3I8B A;  4OKE A;  4AHT A;  3QML A;  2V7Y A;  3LL3 A;  3AA4 A;  3AV9 A;  3VER A;  3EKU A;  3KLE A;  2ZM6 K;  4DS4 A;  2D5R A;  3HXM A;  3HOT A;  4Q5V A;  2KLA A;  3CF5 L;  4IO8 A;  4HUE A;  3SAF A;  3KWI A;  1VRT A;  4YOR A;  1BOT O;  4JKC A;  2E5L K;  2B4J A;  2VGM A;  1YTA A;  2P9U A;  1MU2 A;  3U3G A;  5EXW A;  3KK3 A;  2O8E B;  1OKJ A;  4DCH A;  1GLD G;  1OVQ A;  4H5N A;  1ZBL A;  3CFP A;  5GIO A;  2Q0R A;  1HJO A;  3OTO K;  3JSM A;  2AA4 A;  1HLU A;  3I56 N;  3IS9 A;  4RW7 A;  2F9W A;  5AQO A;  2QM1 A;  4FWO A;  3D0P A;  4DV1 K;  3OYF A;  2CGK A;  3L2W A;  1QHA A;  3QIO A;  3L4I A;  3KD5 E;  1IKY A;  2VG6 A;  5A2Q O;  3OYC A;  4M3U A;  4FJG A;  1EWR A;  2P9K B;  4DV4 K;  3E9P A;  3KVG A;  4J2D A;  5J2P A;  4CE9 A;  2B5J A;  4FOI A;  4X64 K;  3LWL A;  4FLT A;  5AQI A;  2YX6 A;  2P51 A;  3T69 A;  4DR2 K;  4CIE A;  3S3M A;  3OYG A;  2E88 A;  2NRH A;  1IBK K;  1BIU A;  2F4V K;  3OS0 A;  4OJR A;  3KIO A;  4YDU A;  4AHR A;  2P1J A;  3TU5 A;  5AZI B;  3FZM A;  2NRR A;  1BL3 A;  4K42 A;  5J2M A;  3RTV A;  3ZT4 A;  2FBV A;  4FXD A;  5JMV A;  4CES A;  4FO0 A;  5AFU H;  4K8X A;  2O8B B;  3H3N O;  1JLC A;  1SL2 A;  4FW2 A;  3P39 A;  5KRT A;  4FJN A;  4JKG A;  1JCE A;  4IFV A;  1QHT A;  3VEY A;  1T6D A;  3VQQ A;  3RMC A;  1VSE A;  4CIF A;  1X3M A;  3MCP A;  4M3Z A;  1D8Y A;  1IKX A;  2ZE2 A;  4RW8 A;  4CF1 A;  4V19 S;  3VQD A;  4DV5 K;  4JI1 K;  2BGG A;  5E41 A;  5J2Q A;  1ASW A;  3LAK A;  1VSM A;  4TSX A;  3CCS N;  5AQM A;  4CEA A;  1BG3 A;  1NK8 A;  2ASP A;  4FJL A;  3KWG A;  4FJ9 A;  2HF3 A;  1HQE A;  3HL8 A;  4FVM A;  4CFB A;  3ZEU B;  3H1V X;  1JXE A;  1OVY A;  4J8F A;  4CHN A;  4W5Q A;  4OPK A;  1X3N A;  1S5J A;  1KAZ A;  3DWL A;  3LM2 A;  3B6O A;  4B8A B;  4GMJ B;  1RBU A;  3PSF A;  3MDQ A;  3G6E N;  3BDP A;  4JI0 K;  4JV5 K;  1A5X A;  1NGG A;  1UOC A;  3ID6 A;  5DM6 L;  4FJ5 A;  1WOQ A;  3R8E A;  3UKR A;  5CZ2 A;  5AQL A;  2QKK A;  1XI1 A;  4NCB A;  5K14 A;  3S3O A;  4BRM A;  3CJ7 A;  3ZLJ A;  4HWI A;  3QBX A;  1FW6 A;  2I7P A;  4DFP A;  2P9N B;  4FWP A;  3OYI A;  1J6Z A;  3VQA A;  1X9M A;  1VQL N;  3NF8 A;  1X9J A;  3KLG A;  5AR0 A;  5AZJ B;  2KZM A;  3FZK A;  2HF4 A;  2XY5 A;  3DRR A;  3Q7C A;  5I9E B;  4BR4 A;  4M63 C;  2HHH K;  4BRL A;  3WNG A;  3C6H A;  1K8K A;  2YHW A;  4A2A A;  3QEV A;  1L3T A;  5LMN K;  1VSJ A;  4AHU A;  3QEW A;  1T8E A;  3SJH A;  4E1N A;  1NK7 A;  4DS5 A;  3L8B A;  1RDB A;  5C2D A;  2ASO A;  4CER A;  1T3V A;  3LWM A;  3THY A;  1CXQ A;  2Z1I A;  4I2Q A;  2H3G X;  5EU7 A;  3FLC O;  5GAH P;  2VYP A;  3DLE A;  4BRO A;  4W5T A;  2CGL A;  3TAB A;  3RR7 A;  3AVK A;  3WNF A;  5HRP A;  3DXM A;  5EX5 A;  1R0A A;  3NBP A;  1HUX A;  2P9I A;  2QWR A;  4PKH A;  1IBL K;  1YJ9 N;  3BUZ B;  1ATR A;  4IWV A;  2OYQ A;  1C6V A;  3HP9 A;  4B3S K;  1VSD A;  4FLU A;  2FC0 A;  4M7Y A;  3G10 A;  3VTI A;  3C94 A;  5LJW A;  4CJ3 A;  4CHP A;  4CBX A;  3PV8 A;  2YCH A;  3AAQ A;  3ZT2 A;  4RW4 A;  1B9D A;  3TI0 A;  4IJN A;  3OHR A;  3ITH A;  1GLB G;  2ZGY A;  3H45 C;  4CHQ A;  3PIO L;  4M3R A;  3J81 O;  4B9V A;  3D7E O;  3D2E A;  4H5T A;  4DSJ A;  1S22 A;  3R3L A;  4HVJ A;  4Z0U A;  3DLB A;  2YJE A;  3SMP A;  3FZL A;  3QEP A;  1IJJ A;  3OBY A;  2VG5 A;  1BI4 A;  3VEZ A;  3R9P A;  3ZSV A;  4FM1 A;  3E01 A;  2Q2R A;  4MQ3 A;  1TL1 A;  4CD3 A;  3IMX A;  2PBD A;  2HB5 A;  2QWP A;  2GUP A;  1WAJ A;  4N5S A;  1MWM A;  1EX4 A;  3OYD A;  4LC9 B;  2P9S A;  1GLA G;  5AQT A;  3MX2 A;  4IFE A;  2W6K A;  2QWN A;  1I94 K;  1IO2 A;  3O8M A;  1SL0 A;  4FYD A;  3MN7 A;  4M3Y A;  1JKH A;  3UKR B;  3R1X A;  2QKB A;  5HP1 A;  1OH8 A;  2HNZ A;  1QQN A;  3ZSZ A;  4K41 A;  2X6S A;  2HHQ A;  2W40 A;  1QTM A;  3SUO A;  1WBB A;  5KPR A;  3RRG A;  3MXJ A;  3E1Y A;  1V4T A;  4FW1 A;  1X9S A;  1BGX T;  3U8X A;  5KGW A;  4YDU C;  3DLH A;  2QTD A;  4E7I A;  3VEO A;  4KH5 A;  3CFO A;  3N4P A;  4ID1 A;  3L2Q A;  1WN7 A;  1NGJ A;  2GBZ A;  4C8M A;  4I6M B;  4JYA K;  1BIS A;  2J4R A;  1K8K B;  4FWN A;  4DR4 K;  3TAP A;  2Y1J A;  4NYN A;  4H0P A;  3CME N;  4K43 A;  1VQO N;  3QIN A;  1KRP A;  4CZK A;  4GV9 A;  3DRP A;  4FWK A;  1DKG D;  3L2V A;  3WXJ A;  4AH9 A;  3O3G A;  3THY B;  2HHX A;  3O4Q A;  4DF8 A;  3ZSX A;  1ZBU A;  1ZYQ A;  2DFE A;  3L4Q A;  4DV7 K;  3M3Z A;  4JNE A;  4B9Q A;  1RT5 A;  3ZCM A;  1XMO K;  4BC5 A;  4H0Y B;  5T7B A;  3CHW A;  1WSH A;  3HVT A;  4LF4 K;  2DPN A;  1I3A A;  4X62 K;  4DHY A;  2P9I B;  2GWK A;  3TSQ A;  4LF6 K;  2D1K A;  1QSY A;  4JK7 A;  4CK3 A;  4PA1 A;  1VQ5 N;  2ZWH A;  4CHZ A;  4B3M K;  4AIL C;  2P9L A;  2QK9 A;  4JS4 A;  4W5R A;  3LP0 A;  3UB5 A;  3QB0 A;  4CW7 B;  3CD6 N;  4W5N A;  3GL1 A;  3ZX0 A;  3HST B;  5JVH L;  1TK8 A;  3FFI A;  1RT3 A;  1KSP A;  4FWQ A;  4MDA A;  4BRF A;  4CHY A;  3VA0 A;  1ZBS A;  4EAH D;  1T03 A;  4OLA A;  4KB1 A;  4HHT A;  3VQP A;  3HPH A;  3KJV A;  3AVA A;  3SMS A;  2A3Z A;  4PL7 A;  1BA0 A;  3RMD A;  4YY3 K;  3H1Q A;  3K5O A;  3M8S A;  1EP4 A;  4B9L A;  3ISN C;  4J2B A;  3SQ2 A;  1NLV A;  2P9S B;  4B1Z A;  2Q0U A;  3SQ4 A;  1BO5 O;  4EHU A;  2NRX A;  2WBN A;  1XC3 A;  2ZD1 A;  4C8K A;  4JKE A;  3AVH A;  4EIA A;  4EZ9 A;  4DTR A;  1U2V A;  2HHS A;  1TUU A;  3S3N A;  1RT6 A;  4CED A;  1SL1 A;  3O6W A;  3OA9 A;  3I55 N;  4KFB A;  5FRO A;  2UU9 K;  3TSU A;  1CXU A;  1ILY A;  4M3W A;  3IG1 A;  2OZM A;  2F9T A;  3QFP A;  1T6C A;  1N36 K;  1EET A;  1KVC A;  3CET A;  2VQF K;  3I0S A;  1NK9 A;  3QO9 A;  3GOI A;  3OYE A;  1VSI A;  4BE2 A;  2BDP A;  2VWJ A;  4KH4 A;  2JLE A;  3A0I X;  2NUB A;  3ZSY A;  4B08 A;  5KTQ A;  1Q86 O;  2OA8 A;  4KBO A;  2HVI A;  3DJC A;  2A41 A;  3H08 A;  3TAQ A;  3UIQ A;  1JXB A;  2GEM A;  3BF3 A;  2XHB A;  3LDN A;  2Q97 A;  4RWT A;  1SKR A;  2GEL A;  4FZX C;  4GNI A;  1DTT A;  4CF0 A;  4JK8 A;  1YXQ A;  3O9Q A;  4AHS A;  4CZI A;  1FKP A;  2QEX N;  1NMD A;  4Y1C A;  4YOX A;  1T44 A;  5AQG A;  5BRD A;  4O8K A;  3VQ6 A;  2FLO A;  1YT3 A;  3F5T A;  3CQ8 A;  4WE1 A;  1WSF A;  3QES A;  3WXM B;  4HTU A;  1TK0 A;  4F4K A;  1BHL A;  1HQU A;  3T7Z A;  3VGK A;  5JLF A;  1U49 A;  4G1Q A;  2A1R A;  4KTQ A;  4CEF A;  3BEX A;  1RT1 A;  1F21 A;  4DTS A;  3D2F A;  4JKB A;  1W9H A;  3OYM A;  2RE2 A;  3E9O A;  3J80 O;  3CC7 N;  5C42 A;  2YKN A;  5TKW A;  3F2K A;  5E84 A;  3OY9 A;  1Y64 A;  1REV A;  3VEW A;  3VPZ A;  3ZX2 A;  1TAQ A;  3HM9 A;  3MEC A;  5M1F A;  2I5J A;  3HM8 A;  4O0I A;  3ENO A;  1RIL A;  4BRI A;  3VOV A;  4H0T B;  4Q0B A;  2DTU A;  1X9W A;  5AQN A;  4KKO A;  2ZF5 O;  2FF3 B;  1JCG A;  1GOC A;  3AA3 A;  4KH6 A;  1NK6 A;  4BR7 A;  4EHT A;  4ELU A;  2DFH A;  4DSI A;  2P5O A;  3DI6 A;  3MWT A;  1RTH A;  3B8A X;  3NDK A;  4LF9 K;  3CM6 A;  2E6M A;  4KHY A;  3ZSO A;  3KLF A;  1NJZ A;  1NGB A;  4DU1 A;  3MED A;  4BGB A;  4DQI A;  1VSL A;  1JLF A;  2JGU A;  4CGG A;  1U2V B;  1QVF M;  5C12 A;  1HPZ A;  4DU3 A;  1FK9 A;  4DQS A;  3RR8 A;  4UY8 O;  1HNW K;  3VQ4 A;  1RBT A;  2X78 A;  5AQX A;  4JHD A;  2W41 A;  3BGR A;  2NNW A;  3A5O C;  3O9R A;  2G8V A;  4JAX A;  3QBW A;  1BWF O;  2XY8 A;  4KRE A;  3AVN A;  1JL2 A;  3DLR A;  3ZT1 A;  4NCG A;  4YHH K;  4PQU A;  3PSI A;  4CFD A;  5J1E A;  1BIZ A;  4CEC A;  1RTD A;  4FZZ A;  2FSK A;  1YJN N;  4CK2 A;  3ULE A;  3IAY A;  3EO3 A;  1C1A A;  3ID8 A;  3NHG A;  3A5M C;  3ZT3 A;  4NO7 A;  3S41 A;  4C8L A;  4BY9 C;  4FWR A;  3HJF A;  1IBM K;  1TKX A;  4BRC A;  4R79 A;  4OGC A;  1FJG K;  5GAD P;  4CGJ A;  4DF4 A;  1WNS A;  3DLK A;  1TGO A;  3TPQ A;  4YOW A;  4IEE A;  4FJM A;  1SS6 A;  4U67 L;  3DOL A;  4B1V A;  3VTH A;  1HPM A;  4FL9 A;  5FPM A;  3KKS A;  1KQS M;  2O4G A;  5AQK A;  4BDP A;  3TTD A;  1L3S A;  1WLJ A;  3O1B A;  4OPA A;  2A40 A;  3BZC A;  2NRW A;  4H4M A;  5KQ8 A;  4J2E A;  1X1P A;  4FJK A;  2O8C A;  3D2F B;  1RBS A;  4I9L A;  4B1W B;  1E4G T;  1EQY A;  1J9A A;  1RGI A;  1SUQ A;  2G8I A;  4XH1 A;  3Q7B A;  4DQP A;  1VQP N;  1W97 L;  4MDB A;  4FWL A;  4BG9 A;  4BQL A;  3P31 A;  3TAG A;  4WQ5 A;  4YOU A;  4BGA A;  4LFB K;  3T3F A;  2F8S A;  4FSV A;  1ZBF A;  5SWM A;  3DLG A;  5CY4 A;  2WOM A;  3HSC A;  4GY2 B;  2V52 B;  3TSP A;  3WXI A;  3BF1 A;  4O5F A;  4YOT A;  3LZJ A;  2HVH A;  2G8W A;  1LWE A;  1NJX A;  1S1T A;  3CCJ N;  3OVN A;  5GIN A;  4CZF A;  3K5N A;  3RSE A;  1NGE A;  4XH5 A;  4YOY A;  3MXM A;  4C23 A;  1K6Y A;  1SV5 A;  3M1F A;  4ILG B;  5AQF A;  4DTP A;  3SPZ A;  4FJI A;  4H0O A;  2YNF A;  3MEG A;  2O8F A;  2IVN A;  3SNN A;  1WSG A;  3L3U A;  1XWL A;  1BUP A;  5I42 A;  1S72 N;  4DR6 K;  3SLC A;  2KTQ A;  2R7Y A;  2YHY A;  4B1U B;  4I2P A;  1RFQ A;  4CFC A;  3EKS A;  1J53 A;  4QS9 A;  1O1W A;  3HPG A;  3V1O A;  1NOY A;  1EO1 A;  3ULE B;  1QQC A;  3MN9 A;  4CZG A;  1S1W A;  1Y97 A;  3V9U A;  2F7T A;  3ZSQ A;  1RDC A;  4CGD A;  1BU6 O;  3H46 O;  1U45 A;  4BAC A;  3GDQ A;  1NU0 A;  4CCH A;  2NRV A;  1NOZ A;  4FJH A;  1HNZ K;  1QZ6 A;  1S6P A;  2I7N A;  2P9U B;  4FM2 A;  5BPM A;  4CZL A;  4KHQ A;  4BC3 A;  1NMN A;  1JLG A;  1OH5 A;  3IRX A;  4BE1 A;  2IAJ A;  1NKC A;  4DTJ A;  3DOK A;  3O9S A;  1Q9Y A;  4G9Z A;  3ZSR A;  1SAZ A;  3M8P A;  3FR0 A;  3VA3 A;  4FZY A;  5LL6 Z;  4CBU A;  5F2R A;  3RRH A;  4Z4E A;  2E20 A;  1UA1 A;  3AVM A;  5E26 A;  4Y1D A;  1U48 A;  4DV0 K;  3ZT0 A;  4CHO A;  4KTZ A;  4BR2 A;  3OJS A;  4FK4 A;  4R5P A;  3MEE A;  4FPB A;  1B92 A;  1TKZ A;  2BUP A;  4CJT A;  5JIC A;  2VWK A;  2Q36 A;  4EZ6 A;  2HBJ A;  3MCA B;  1P90 A;  3CC2 N;  3TAR A;  1GLE G;  2IS3 A;  3PO4 A;  1ASV A;  2IVP A;  1J5O A;  1YUW A;  4E7J A;  3TWH A;  1JLQ A;  2F96 A;  4LH5 A;  4N47 A;  2OTL N;  4K0K K;  4H5V A;  4JKG B;  3WQU A;  5AFU A;  1HKC A;  1YTU A;  5C0Y A;  2PZS A;  2E2P A;  1QQM A;  3KLH A;  3SPY A;  3CQY A;  4DQ8 A;  3SAH A;  4B3R K;  1JL1 A;  4BRK A;  2VG7 A;  5IWA K;  3TAE A;  3I0R A;  3ZSW A;  3HI0 A;  5C24 A;  1KLM A;  1KFS A;  3O80 A;  4H0X B;  3RSE B;  3LDS A;  4ISG A;  4CGF A;  2VQE K;  3CER A;  3EZW A;  3CJC A;  3MWP A;  1XNR K;  1QSL A;  3P5J A;  4ICL A;  5AQJ A;  3J7Z O;  1TKT A;  5BN9 A;  4NYF A;  3C6T A;  3LZI A;  4H5R A;  5CYQ A;  1Z6R A;  4WQ4 A;  2OPQ A;  4HTL A;  4IG3 A;  2W42 A;  1U4B A;  3U9D A;  3CJ1 A;  2OPR A;  3P4I A;  2Q1N A;  5ADX H;  1RDA A;  4L8R B;  3ZX3 A;  2OPS A;  4AHV A;  5BR9 A;  1O13 A;  4CBW A;  2BE2 A;  2NRT A;  5GIP A;  4DB3 A;  3F73 A;  3BZK A;  3LP3 A;  4IZ9 A;  3VES A;  4IO9 L;  1U47 A;  1XHZ A;  3NE6 A;  4WQ5 C;  4FVU A;  1ATN A;  3AVF A;  4JS5 A;  2UXB K;  2HNY A;  3VQ9 A;  4GV6 A;  3TTC A;  3B6P A;  1QE1 A;  4KB0 A;  4CJ4 A;  2GV9 A;  1HMV A;  4LFA K;  3M8R A;  1HJR A;  5J2N A;  1WBD A;  1TL3 A;  4BWJ A;  1SKS A;  1KVB A;  3HZ6 A;  3SQ0 A;  4PKG A;  3O9T A;  1KC8 O;  3T1Y K;  1KD1 O;  4CI6 A;  4FM0 A;  4FK2 A;  5EY4 A;  3C7N A;  1RTJ A;  3AA5 X;  1KFD A;  3HT3 A;  3TAF A;  1C0T A;  4M7X A;  4KRF A;  5H1S Q;  3FZH A;  1JLE A;  3KK7 A;  2D0A A;  4DFM A;  3NCI A;  4X66 K;  1TVR A;  4BE0 A;  3SZ2 A;  3VQ7 A;  4K8Z A;  3PX0 A;  3SK3 A;  3GBT A;  3V6D A;  2YI1 A;  3HYF A;  4CJ5 A;  4IDK A;  4JI6 K;  1QS4 A;  3DAW A;  1MDU B;  3QEX A;  3P38 A;  3AO3 A;  3KK1 A;  4RW9 A;  4DFK A;  4PHT X;  3U6F A;  1YAG A;  3T1H K;  3DXM B;  1LW2 A;  3CCU N;  3PO5 A;  4B3T K;  1KAY A;  4IDH A;  4JLH A;  2DFF A;  2HBL A;  4GVM A;  1VQ4 N;  4BRP A;  1IG9 A;  1NJI O;  1Z25 A;  4JN4 A;  4A61 A;  4DMN A;  1CZA N;  4C8O A;  1VRU A;  1D5A A;  3VQC A;  4MO5 A;  3O9U A;  3OJU A;  3AO2 A;  4E7L A;  1L5U A;  5C15 A;  4M42 A;  4NLC A;  2KKZ A;  3NF6 A;  2D0C A;  2YHB A; 
#chains in the Genus database with same CATH homology
 1RIL A;  3P83 D;  4DLE A;  4Q0B A;  1BL3 A;  2E6L A;  1Z26 A;  3K58 A;  1NKB A;  3V1Q A;  5J2M A;  2DTU A;  4HCB A;  3WNE A;  1X9W A;  4I7F A;  4KKO A;  3RTV A;  3AA2 A;  4Z4G A;  3ZT4 A;  3EZ5 A;  2YNG A;  2YNH A;  2FBV A;  5HRS A;  4FXD A;  3TR8 A;  1GOC A;  3AA3 A;  3L2U A;  1XHX A;  4CES A;  1IKV A;  1NK6 A;  4N76 A;  4K8X A;  3LAN A;  2HHV A;  1QSS A;  3G0Z A;  1JLC A;  1SL2 A;  1BI4 B;  1RTI A;  2KQ2 A;  3C6U A;  4FW2 A;  3KK2 A;  3L2R A;  4ELU A;  2DFH A;  4ZHR A;  5KRT A;  2P5O A;  5HRR A;  3DI6 A;  4DSI A;  4FJN A;  1RTH A;  1VK0 A;  2RKI A;  4IFV A;  1QHT A;  3NDK A;  3AO4 A;  4DTU A;  3CM6 A;  2E6M A;  4KHY A;  2E4L A;  3ZSO A;  2KZZ A;  2D0B A;  3KLF A;  1NJZ A;  1VSH A;  1TAU A;  4DU1 A;  3VQQ A;  5J2Q A;  3MED A;  4DQI A;  1VSL A;  1JLF A;  1VSE A;  2RPI A;  3DM2 A;  4CIF A;  3RMC A;  2JGU A;  3AVI A;  1TK5 A;  4CGG A;  4M3Z A;  3SUN A;  1IKX A;  2ZE2 A;  1D8Y A;  4RW8 A;  2IDO A;  4CF1 A;  3LP1 A;  4FCY A;  3V4I A;  4FLY A;  3VQD A;  4ELT A;  2O4I A;  1HPZ A;  4DU3 A;  1FK9 A;  4DQS A;  1NK0 A;  3RR8 A;  2BGG A;  3OYJ A;  3O4N A;  5E41 A;  3F9K A;  3VQ4 A;  1ASW A;  3OYL A;  4H4O A;  1RBT A;  2BAN A;  1VSM A;  2X78 A;  2HND A;  3LAK A;  4TSX A;  3TAN A;  4CJL A;  3BGR A;  4CEA A;  3AVL A;  1NK8 A;  4FJL A;  1EXQ A;  4OKJ A;  2AJQ A;  3MAQ A;  4FJ9 A;  2PYL A;  1HQE A;  3HL8 A;  4FVM A;  4CFB A;  3SCX A;  2G8V A;  4FK0 A;  1G15 A;  1JXE A;  4W5Q A;  4CHN A;  2HW3 A;  2XY8 A;  4KRE A;  4OPK A;  3AVN A;  4QAG A;  1JL2 A;  3DLR A;  3ZT1 A;  1S5J A;  4B9M A;  4NCG A;  4F3O A;  3B6O A;  4B8A B;  4PQU A;  4M3X A;  4B8C A;  4GMJ B;  4CEQ A;  4CFD A;  5J1E A;  1BIZ A;  1LAW A;  1RBU A;  4CEC A;  4FJX A;  4Z4F A;  1Q9X A;  3BDP A;  3LPT A;  1RTD A;  4FZZ A;  2GUI A;  4DWI A;  1C0U A;  1A5X A;  4CK2 A;  3EYZ A;  3IAY A;  1UOC A;  1UWB A;  1C1A A;  2G8U A;  4FJ5 A;  1S1V A;  3NHG A;  2QKK A;  5CZ2 A;  4E7H A;  4FLX A;  3RMA A;  3ZT3 A;  1XI1 A;  4NCB A;  1N5Y A;  3SUP A;  2ZQB A;  5K14 A;  1TV6 A;  3NH2 A;  3S3O A;  4C8L A;  4MFB A;  3OS2 A;  2OPP A;  3K5L A;  1D9D A;  4F8R A;  4E7K A;  1ITG A;  4O0J A;  1IH7 A;  4GW6 A;  4DFP A;  2G8F A;  3HJF A;  1TKX A;  3OYI A;  4CEE A;  3JYT A;  4OGC A;  3HO1 A;  3CYM A;  3VQA A;  4CGJ A;  3C95 A;  1WNS A;  4DF4 A;  1X9M A;  1ZBH A;  3DLK A;  1TGO A;  3LP2 A;  3NF8 A;  3KLG A;  4FJM A;  4JRP A;  4IBN A;  1KCF A;  1A5W A;  2KZM A;  2XY5 A;  4O55 A;  4W5O A;  3DOL A;  5DMR A;  3DRR A;  3AO5 A;  1NK4 A;  1LW0 A;  3T19 A;  1HYZ A;  3KKS A;  3VQ5 A;  3WNG A;  4CJE A;  1WAF A;  4OGE A;  2O4G A;  1J54 A;  1S9E A;  3V1R A;  3SV3 A;  4BDP A;  3QEV A;  3ASM A;  5FDL A;  4E1M A;  1L3S A;  1L3T A;  1HYS A;  3AVB A;  1VSJ A;  4AHU A;  1WLJ A;  1RNH A;  3QEW A;  4HCC A;  1T8E A;  4F2S A;  3A2F A;  4H4M A;  4E1N A;  2PYJ A;  1NK7 A;  4J2E A;  4DS5 A;  5HRN A;  3L8B A;  1N6Q A;  1RDB A;  1X1P A;  4FJK A;  3AVJ A;  4CER A;  1RBS A;  4I9L A;  3SQ1 A;  3LWM A;  5KI6 A;  1CXQ A;  2Z1I A;  3ALY A;  5KRS A;  4I2Q A;  1J9A A;  3K5M A;  1SUQ A;  5EU7 A;  4CEB A;  2G8K A;  2G8I A;  3NF7 A;  3SUQ A;  4FJJ A;  4DQP A;  3DLE A;  4M3T A;  2G8H A;  4DSE A;  4W5T A;  3QER A;  1ZBI A;  3KIO A;  3TAB A;  3RR7 A;  4CF2 A;  3AVK A;  3WNF A;  5HRP A;  3K57 A;  1VSK A;  3DMJ A;  2A1S A;  3TAG A;  4IFY A;  5KGX A;  4B9U A;  3D45 A;  4DTX A;  1R0A A;  4EP5 A;  3NBP A;  3T3F A;  1CZ9 A;  4CGH A;  2F8S A;  4DSL A;  4OLB A;  1U04 A;  1ZBF A;  1TKD A;  2OYQ A;  1FXX A;  3KKR A;  4Z4I A;  1WSE A;  1C6V A;  3HP9 A;  5SWM A;  4DTM A;  1VSD A;  3DLG A;  5CY4 A;  4FLU A;  2FC0 A;  2WOM A;  5HLF A;  3HP6 A;  3G10 A;  4HUG A;  3OYA A;  4LSN A;  3C94 A;  2B6A A;  4DQQ A;  3PUF A;  4CJ3 A;  2FBX A;  4CHP A;  4CJU A;  3OS1 A;  3PV8 A;  4E19 A;  4JRQ A;  3ZT2 A;  3PY8 A;  4Z4C A;  3LZJ A;  2HVH A;  4RW4 A;  1B9D A;  3TI0 A;  2G8W A;  3V9X A;  1LWE A;  4J2A A;  2HHW A;  1RCH A;  3ITH A;  1B9F A;  1NJX A;  4CHQ A;  4CIG A;  4FJ7 A;  4M3R A;  4B9V A;  1S1T A;  1S1U A;  3OVN A;  4BWM A;  4I9Q A;  2HMI A;  4KHW A;  4DSJ A;  3K5N A;  3MXM A;  1RDD A;  3LAL A;  2XY6 A;  1JLB A;  4CJW A;  1K6Y A;  1SV5 A;  4Z0U A;  4HVJ A;  4DTP A;  2XRI A;  1T05 A;  3SPZ A;  4FJI A;  3O3H A;  3DLB A;  4E3S A;  4F3T A;  3QEP A;  2YNF A;  2LSN A;  3MEG A;  2VG5 A;  1BI4 A;  4LD0 A;  3ZSV A;  4FM1 A;  4LY7 A;  3SNN A;  3E01 A;  1WSG A;  3L3U A;  3QLH A;  4IKF A;  1XWL A;  4MQ3 A;  1TL1 A;  4OKK A;  5I42 A;  4LH4 A;  1UAX A;  2HB5 A;  4FJ8 A;  3I8D A;  1WAJ A;  4N5S A;  2KTQ A;  2R7Y A;  1EX4 A;  4RG8 A;  1LWC A;  3OYD A;  2RF2 A;  4ID5 A;  1LV5 A;  4I2P A;  4CFC A;  1J53 A;  4C8N A;  4PUO A;  3CFR A;  4QOZ B;  1IO2 A;  1GOB A;  1O1W A;  4AHC A;  1NKE A;  4KPY A;  1SL0 A;  3HPG A;  3V1O A;  1NOY A;  1QQC A;  2YV0 X;  1WSI A;  3KLI A;  2X6N A;  4B9N A;  4FYD A;  1RBR A;  4M3Y A;  4DG1 A;  1JKH A;  3M8Q A;  3VQ8 A;  1S1W A;  2YHA A;  4DTO A;  1S9G A;  2KW4 A;  1Y97 A;  3LAM A;  5HRO A;  1L3U A;  3NH1 A;  3V9U A;  5HP1 A;  5CYM A;  2QKB A;  2HNZ A;  4B9T A;  1FKO A;  3ZSQ A;  1RDC A;  3ZSZ A;  4CGD A;  2X6S A;  3OYK A;  2HHT A;  4CJV A;  3SUO A;  1QTM A;  1C1C A;  3V81 A;  2HHQ A;  1U45 A;  3RRG A;  3MXJ A;  2OZS A;  3NGZ A;  4FW1 A;  4BAC A;  1X9S A;  1BGX T;  5KGW A;  4CEZ A;  5JS2 A;  4N56 A;  4DQR A;  3DLH A;  4E7I A;  2FBY A;  4BDY A;  3AVC A;  3CFO A;  4CCH A;  4CK1 A;  4ID1 A;  3L2Q A;  1NOZ A;  1WN7 A;  4FJH A;  2GBZ A;  1S6P A;  4FM2 A;  2Q3S A;  4C8M A;  4KHQ A;  4CF8 A;  2WON A;  1BIS A;  2PY5 A;  3K2P A;  5C25 A;  1JLG A;  3OYB A;  3SYZ A;  3TAP A;  3IRX A;  4BE1 A;  2IAJ A;  2Y1J A;  4NYN A;  1NKC A;  3EY1 A;  4DTJ A;  3QIN A;  1Q8I A;  3DOK A;  3QIP A;  4O5B A;  2EX3 A;  1KRP A;  3VN5 A;  1Q9Y A;  2X74 A;  4BDZ A;  4E0D A;  3ZSR A;  4CFA A;  3DRP A;  3M8P A;  2ITG A;  3VA3 A;  4FZY A;  4E89 A;  3L2V A;  3RRH A;  1XC9 A;  4KHU A;  4Z4E A;  4PY5 A;  1UA1 A;  3AVM A;  4KO0 A;  4Y1D A;  1KVA A;  3O3G A;  1CZB A;  4AH9 A;  3ZT0 A;  1U48 A;  4CHO A;  4KTZ A;  3O4Q A;  4DF8 A;  4OPJ A;  2HHX A;  3OJS A;  3PX4 A;  4FK4 A;  4R5P A;  2EHG A;  4ZTF A;  3ZSX A;  1HYV A;  3MEE A;  1HNV A;  1ZBU A;  3HVR A;  1B92 A;  1TKZ A;  3DRS A;  1ZYQ A;  4CJT A;  2IC3 A;  2DFE A;  4CJQ A;  2RN2 A;  4O4G A;  1NJW A;  3V9S A;  1RT5 A;  4O44 A;  2VWK A;  3ZCM A;  3K59 A;  1RBV A;  1W0H A;  4FLZ A;  5T7B A;  4EZ6 A;  3HVT A;  1WSH A;  4N41 A;  3NGI A;  1I3A A;  4PWD A;  3CG7 A;  1NK5 A;  4RW6 A;  2XY7 A;  3LPU A;  4CF9 A;  3TAR A;  3NGY A;  4EP4 A;  4OVL A;  3QNO A;  1QSY A;  3ULD A;  3OYH A;  2IS3 A;  3PO4 A;  4CK3 A;  4PA1 A;  1ASV A;  1LAV A;  3WNH A;  3V9Z A;  1J5O A;  2Y1I A;  2ATQ A;  1S6Q A;  4CJP A;  4E7J A;  3MXI A;  4CHZ A;  5JS1 A;  5HBM A;  3QEI A;  3TWH A;  4AIL C;  2FBT A;  1JLQ A;  2Z1G A;  4DTN A;  2F96 A;  4LH5 A;  4N47 A;  4JS4 A;  2QK9 A;  4KHN A;  4CJR A;  4W5R A;  3TAM A;  3LP0 A;  2DY4 A;  4W5N A;  1RT7 A;  4KTW A;  3VQE A;  4UQG A;  3HST B;  1TK8 A;  1YTU A;  3DYA A;  2PZS A;  3SI6 A;  3NF9 A;  3FFI A;  1RT3 A;  3KLH A;  1SKW A;  1KSP A;  3SPY A;  4F2R A;  3NAE A;  4DU4 A;  4CHY A;  3VA0 A;  1JL1 A;  5FRN A;  3KTQ A;  2VG7 A;  3TAE A;  3I0R A;  2HHU A;  3ZSW A;  1C1B A;  5C24 A;  2ETJ A;  1KLM A;  4ZTJ A;  1T03 A;  4OLA A;  1KFS A;  3LDS A;  4KB1 A;  4FLW A;  3CM5 A;  4HHT A;  3VQP A;  4CGF A;  3HPH A;  3KJV A;  5I3U A;  3AVA A;  4CJK A;  5FRM A;  3KD1 E;  1LWF A;  2KFN A;  1NJY A;  4M41 A;  1JLA A;  4Z4H A;  4YNQ A;  3V9W A;  3S9H A;  4QCL A;  4B9S A;  3THV A;  3HK2 A;  1QSL A;  3RMD A;  3P5J A;  4ICL A;  4ELV A;  4KHS A;  3M8S A;  3K5O A;  4DLG A;  1RT4 A;  1TKT A;  1EP4 A;  4B9L A;  3ISN C;  3C6T A;  2Z1H A;  4NYF A;  3LZI A;  3SQ2 A;  4J2B A;  5CYQ A;  4CJS A;  3SQ4 A;  1BQM A;  3P1G A;  5CZ1 A;  4XIU A;  1WSJ A;  2ZD1 A;  3RMB A;  4C8K A;  2OPQ A;  3AVH A;  4IG3 A;  2W42 A;  1U4B A;  4EZ9 A;  4DTR A;  2OPR A;  1DLO A;  2HHS A;  3NFA A;  4YFU A;  3S3N A;  1RT6 A;  1RDA A;  3OYN A;  4CJF A;  4DSK A;  4L8R B;  1DTQ A;  2OPS A;  4CED A;  4KI4 A;  1C0M A;  2IOC A;  4AHV A;  4DFJ A;  1BCO A;  1SL1 A;  4KFB A;  5FRO A;  2BE2 A;  3QNN A;  1CXU A;  3PX6 A;  4M3W A;  4B3O A;  3IG1 A;  2OZM A;  3F73 A;  4M45 A;  5SZT A;  2F8T A;  1EET A;  1KVC A;  2XO7 A;  3LP3 A;  4LSL A;  1S1X A;  2QXF A;  3I0S A;  1NK9 A;  5D3G A;  3QO9 A;  1U47 A;  1HRH A;  3VQB A;  3OYE A;  3NE6 A;  4KV8 A;  1XHZ A;  2P5G A;  1VSI A;  4KI6 A;  3AVF A;  4JS5 A;  2HNY A;  3VQ9 A;  2IGI A;  4BE2 A;  3B6P A;  4H8K A;  2VWJ A;  2BDP A;  1QE1 A;  2JLE A;  4KB0 A;  2NUB A;  1EKE A;  3ZSY A;  1HNI A;  4B08 A;  5KTQ A;  4CJ4 A;  2GV9 A;  2OA8 A;  3SJJ A;  3NH0 A;  4CGI A;  1HMV A;  1IKW A;  4OKE A;  3M8R A;  2HVI A;  1HJR A;  5J2N A;  1TL3 A;  3H08 A;  4AHT A;  3TAQ A;  1T7P A;  3UIQ A;  1JXB A;  4BWJ A;  1SKS A;  3RWU A;  1KVB A;  1D9F A;  2YNI A;  2KFZ A;  3SQ0 A;  2XHB A;  3AA4 A;  3AV9 A;  3KLE A;  4DS4 A;  3SV4 A;  1ASU A;  4FM0 A;  1A5V A;  4FK2 A;  2D5R A;  1RT2 A;  3HXM A;  2Z1J A;  1SKR A;  1RTJ A;  4Q5V A;  3AA5 X;  4FZX C;  1KFD A;  3HT3 A;  4HUE A;  3TAF A;  1C0T A;  5DK5 A;  4KRF A;  1YVU A;  1VRT A;  1JLE A;  2D0A A;  4DFM A;  1DTT A;  4CF0 A;  3NCI A;  4NCA A;  1TVR A;  2B4J A;  1VSF A;  4AHS A;  4BE0 A;  1KLN A;  1I39 A;  1YTA A;  4HUF A;  3SZ2 A;  1MU2 A;  3VQ7 A;  1FKP A;  4K8Z A;  3AVG A;  3U3G A;  3PX0 A;  3KK3 A;  4Y1C A;  3L3V A;  1ZBL A;  3V6D A;  3CFP A;  3VQ6 A;  3HYF A;  4CJ5 A;  4IDK A;  3T1A A;  1YT3 A;  3JSM A;  4IG0 A;  1QS4 A;  4KAZ A;  3CQ8 A;  3IS9 A;  1WSF A;  4RW7 A;  4WE1 A;  3QES A;  3QEX A;  4HTU A;  3AO3 A;  3KK1 A;  3AO1 A;  4RW9 A;  4DSF A;  1TK0 A;  3D0P A;  1GOA A;  1BHL A;  3OYF A;  1BCM A;  3O3F A;  4DFK A;  1HQU A;  3U6F A;  3L2W A;  4F4K A;  1U49 A;  3QIO A;  1CLQ A;  1L3V A;  4G1Q A;  2A1R A;  3KD5 E;  1IKY A;  2VG6 A;  4KTQ A;  4CEF A;  1LW2 A;  3OYC A;  1RT1 A;  1F21 A;  3PO5 A;  4DTS A;  1BQN A;  4M3U A;  4JLH A;  2DFF A;  1W9H A;  2YKM A;  4FJG A;  4GVM A;  3OYM A;  4J2D A;  1IG9 A;  4FLV A;  1Z25 A;  4CEO A;  4CE9 A;  4DMN A;  5C42 A;  5J2P A;  1KTQ A;  2B5J A;  2YKN A;  3U3Y A;  3LWL A;  4FLT A;  4C8O A;  1VRU A;  3HPO A;  1D5A A;  3VQC A;  3QET A;  2P51 A;  3OY9 A;  3AO2 A;  1REV A;  4CIE A;  3OYG A;  3OJU A;  4E7L A;  3S3M A;  1L5U A;  1TAQ A;  1BIU A;  3HM9 A;  3MEC A;  2I5J A;  4M42 A;  3OS0 A;  1UA0 A;  4O0I A;  3NF6 A;  4OJR A;  2D0C A;  2YHB A;  4AHR A;  2P1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...