4CEQA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ceqA00
2Z1HA 3KKSA 3OVNA 2DFFA 2IAJA 2W42A 4KV8A 4L8RB 1WSIA 3RTVA 4FJ9A 1KLMA 1I3AA 3VQAA 2P5OA 1RT2A 2BANA 1IKXA 3L2RA 4DFKA 1ZBFA 2HHXA 4E7IA 1L3VA 2DY4A 2HHQA 3DLHA 1JXBA 3KLHA 2FC0A 1VSMA 4CJPA 4FW2A 4CGFA 4CIEA 4LSNA 2XY6A 1BQNA 4FM1A 2JLEA 4CEEA 2I5JA 3HVTA 4DTMA 3DLGA 5C24A 3CFPA 3PY8A 3QEVA 4KHWA 4DTXA 3NGIA 4N56A 4B3OA 1KTQA 2OPQA 3OYEA 4E7KA 1QSLA 3SUOA 1XI1A 4DTNA 2IS3A 3KJVA 4FZZA 3OYLA 4OVLA 1JLGA 3CQ8A 3FFIA 1Z25A 4LY7A 2YNHA 3L2QA 4EZ9A 1TAQA 4DF8A 3SQ1A 4CE9A 4FLVA 3DLRA 4JLHA 1U04A 1KFDA 4I7FA 1FXXA 4FXDA 3ZT0A 3K5MA 2Z1IA 1JLBA 4E89A 3DRRA 3HXMA 4DLEA 3VA0A 3TAFA 3OYIA 3U3GA 4CJEA 4OKKA 4KREA 3IS9A 5E41A 4NCAA 4FJ8A 2BGGA 4CK3A 2OPPA 2RN2A 3ZCMA 2IDOA 3AVCA 4DF4A 4O0JA 3MXMA 1EKEA 1SV5A 4KTQA 3A2FA 4FJ7A 3V1QA 1RCHA 2BE2A 3O4QA 1EP4A 3AA3A 4DMNA 1EX4A 2VG5A 1VSJA 2XRIA 4H8KA 3NE6A 1CXQA 2G8IA 4CHQA 3DMJA 4N76A 4KO0A 4DQRA 3QETA 4Z4IA 5J2NA 4IG3A 4PUOA 1NK9A 1T03A 1BGXT 4DFJA 3SUNA 1BHLA 1UWBA 5T7BA 2PY5A 3ZSRA 4OLAA 4CEBA 2QKBA 1KVAA 3BGRA 3QEPA 4R5PA 2YKNA 2HNZA 3NCIA 3D0PA 1ZYQA 4CJLA 3SPYA 4JS5A 2F96A 1C0TA 1XHXA 1QHTA 3VQQA 3NHGA 4M3TA 4AHVA 4M3RA 3LZIA 4HUEA 4N5SA 4FW1A 4CGIA 2BDPA 3T3FA 1QE1A 3OS0A 3HM9A 4KB1A 2GBZA 3AVJA 1S9EA 4LSLA 1U45A 1QSSA 3L3VA 3OJUA 2FBXA 1YVUA 3U6FA 3KK3A 3OYMA 3HL8A 3O3FA 4PWDA 1KFSA 1NJYA 4FLXA 3G0ZA 3SJJA 3PUFA 1NK8A 1L3UA 4FCYA 1W9HA 4DSFA 2VWKA 4N47A 1RTDA 5HP1A 4KTZA 5CYQA 4AHRA 1HMVA 3HP9A 4CF1A 5JS1A 3O3GA 4PY5A 3OYDA 1RDBA 4H4MA 2QKKA 1NJXA 4B9VA 1S1UA 3AVNA 4HUGA 1S1TA 3SV4A 3K57A 3SNNA 4FZXC 2KW4A 3H08A 4CJFA 3SZ2A 2HHTA 3HO1A 1C1CA 4E3SA 5CZ2A 5CYMA 1VSFA 4DQIA 4DSLA 4Z4FA 1TKXA 3NGYA 1JLAA 1VSLA 2EX3A 1HJRA 2YKMA 4CHNA 4M3UA 2ATQA 4OGEA 2ITGA 3ZT4A 3HPHA 1WSHA 2HNYA 3DYAA 5DK5A 3U3YA 2ZE2A 1JLCA 4HVJA 4CHOA 3HK2A 4CEFA 3AVFA 4Z4EA 1EETA 1LWCA 3MEEA 1VSKA 2RPIA 2EHGA 3T19A 3O3HA 4CESA 3MXIA 1VRUA 3DRSA 3KKRA 2R7YA 3M8RA 3QINA 2KQ2A 4W5TA 4BACA 3V4IA 2P1JA 4G1QA 3B6OA 1LAWA 3P5JA 4CEOA 4BE2A 4KHSA 4DQSA 4DTPA 3IRXA 2IC3A 1FKPA 5KGWA 1L3SA 2WOMA 3PO4A 3AO4A 3DLBA 3EYZA 1WAFA 3EY1A 2D5RA 3LALA 2O4IA 3AVGA 1IKWA 1RBTA 2A1SA 2G8KA 3ISNC 3TR8A 1BI4A 3CG7A 4F4KA 2IOCA 4ID1A 2D0CA 1JL2A 4FZYA 4DTSA 1NOZA 4F2SA 3DI6A 1IKYA 4E7LA 4C8MA 5KRTA 4NYFA 4FJNA 1S5JA 1YTUA 1ZBLA 1ZBIA 2FBYA 3AO2A 4AHCA 4AHUA 5KTQA 4FK0A 4B9UA 1RT5A 2YHBA 4CJQA 3OYAA 3KK2A 4DS5A 3IG1A 1NOYA 3RRGA 3AVAA 3NF8A 4O0IA 3V9ZA 2PZSA 2HHVA 1UA1A 3AVIA 2Y1IA 2ETJA 4DG1A 1Q8IA 4LH4A 3KD1E 1RT3A 3LPTA 3ZSVA 1S1XA 4O5BA 3B6PA 3ZSXA 4CEDA 1S6QA 2P51A 1CZ9A 2YHAA 4RW7A 1HRHA 1REVA 3OJSA 4B9SA 1JLQA 1QSYA 4KI4A 3TWHA 4O55A 2GV9A 1N6QA 4B8CA 4J2EA 4M3WA 1NJWA 3RMAA 3CYMA 3VQEA 3HSTB 3QIPA 4BDPA 3RWUA 5FRNA 2ZD1A 1ITGA 2DFHA 4OJRA 3C6TA 5HBMA 1JXEA 4CFBA 3RMDA 3SPZA 2HMIA 3AVBA 2XY8A 4DLGA 1J53A 3T1AA 3TI0A 4J2AA 4FJXA 3I0RA 3QEWA 4W5RA 1CZBA 4DSIA 4NCBA 4CJSA 2F8TA 3RMCA 1DLOA 2GUIA 3O4NA 5HRNA 1XHZA 1RBUA 4CGDA 1BIUA 1ZBUA 3THVA 2XHBA 4CFCA 4JRPA 3ZSOA 3OS1A 3NDKA 3LP2A 4C8LA 1LW2A 3V9WA 3SCXA 1TKDA 2DTUA 4CJTA 4HCCA 4FJKA 3PX6A 1BCMA 4F3TA 4CF0A 5HRSA 2A1RA 5KI6A 3HPOA 3NBPA 3LWLA 1L3TA 1KVBA 1WSGA 4TSXA 3OY9A 1NK0A 3VQDA 3PO5A 3M8QA 3TAMA 3V6DA 2RKIA 1T7PA 1SKWA 2KFNA 4XIUA 1LAVA 4E1NA 4OPKA 4BE0A 1WSFA 3WNGA 4KTWA 3L2UA 4C8KA 1TV6A 4DSJA 4F3OA 4IBNA 3BDPA 1N5YA 1RTHA 4CF9A 4AH9A 4KAZA 4DTUA 1F21A 1QQCA 4DQQA 4MFBA 4CIGA 1WNSA 4WE1A 4BWJA 1RDAA 4JS4A 1C0UA 1C0MA 4W5OA 4M3YA 2HHUA 4CEZA 4CFAA 2O4GA 1VSEA 3KLEA 4FK4A 1C6VA 3OYJA 4OKEA 1X9SA 1RBSA 3AO5A 3SQ2A 3UIQA 4FJJA 3NH2A 5J2QA 1KSPA 2HVIA 3K58A 3KLGA 4CJ3A 4DFMA 4K8ZA 1K6YA 1DTTA 4O44A 5KGXA 3ASMA 1IG9A 4FJGA 1RBVA 1WSJA 3DOKA 1SKRA 4FJLA 3LDSA 1BCOA 1BL3A 1C1BA 2ZQBA 5JS2A 4FLTA 4IFYA 3SQ0A 1U47A 3V9SA 1TKTA 1BQMA 1RILA 4CEQA 3L8BA 3TAEA 4E0DA 3NAEA 2P5GA 2KZMA 1NKEA 3ZSZA 1ZBHA 5J1EA 3K59A 1A5XA 4CJUA 4K8XA 1WN7A 4FLWA 3AVKA 4QAGA 3S3NA 3OYNA 1FKOA 3LP1A 4OLBA 1HQUA 1W0HA 3F9KA 4YFUA 2XY5A 2X78A 5DMRA 2DFEA 1D9FA 3TAPA 3VN5A 1RT7A 4BDYA 4Q0BA 4MQ3A 3HJFA 4AILC 1G15A 2OZMA 3LWMA 4ELUA 3VQCA 4E1MA 3ZSQA 3LAKA 2F8SA 1Y97A 1S1VA 2XO7A 1JKHA 1VSHA 2YNGA 4CJ5A 1VRTA 3IAYA 4FJ5A 3OYCA 4LD0A 2QXFA 2X74A 4FVMA 1GOCA 3K5OA 1RDDA 1GOBA 4NCGA 4PA1A 4CJ4A 4ELTA 3ZT2A 3SV3A 1Q9XA 4I9QA 3MECA 2FBTA 3ALYA 2Z1GA 3VQ4A 4JRQA 2YNFA 3WNEA 4BE1A 1SL2A 1RDCA 1LV5A 1Z26A 1EXQA 4Z4CA 1NKCA 4E7JA 5HROA 4Z0UA 1YT3A 1TK5A 3PX4A 2HB5A 1S1WA 3VQ8A 1BIZA 4CJRA 3AA4A 4IDKA 5EU7A 4CGJA 4RW9A 2PYJA 3PX0A 3C94A 4DQPA 2B4JA 2FBVA 3L2WA 3SUPA 4ZTJA 1X1PA 2OYQA 2Q3SA 4IKFA 4CHYA 1TK8A 1B9FA 3PV8A 4OPJA 3NH1A 4DTOA 1S6PA 5CY4A 3AA5X 4GVMA 3CFRA 2D0AA 3I8DA 1J54A 3C6UA 3DLEA 4KFBA 3ITHA 3HYFA 4CJWA 1C1AA 1B92A 1LWEA 3OYGA 3NF6A 2WONA 1ASWA 5C25A 1D5AA 4BDZA 3QERA 5FDLA 3TAGA 1TL3A 1JL1A 4E19A 1X9WA 1KRPA 5J2MA 2VWJA 4FLUA 3D45A 2Z1JA 1UAXA 3JYTA 2OPRA 4HTUA 4I2PA 3OYBA 4Q5VA 4HUFA 4B9MA 1TK0A 1RT1A 1D9DA 4KRFA 4QOZB 2OA8A 3KIOA 4EP4A 3K5NA 3ZSWA 4CHZA 2VG6A 4QCLA 3NF9A 4CJVA 2YNIA 3AVLA 4DFPA 3VQ9A 1BISA 4FM0A 5I3UA 4ZHRA 2G8HA 3DLKA 4W5QA 4F8RA 4DTJA 3QESA 4CIFA 4RG8A 3HPGA 4DSKA 1MU2A 1T8EA 3AO3A 4F2RA 2HHSA 3ULDA 3L3UA 1BI4B 4KB0A 3ZT1A 4OKJA 1XWLA 4FLZA 2HHWA 1RT6A 3V1OA 4CJKA 4KPYA 3VQ6A 3AA2A 3LAMA 5SZTA 3OYHA 2OPSA 3QLHA 3I0SA 3ZT3A 4RW6A 4CF8A 3LPUA 4FM2A 3NF7A 3RMBA 2G8WA 4H4OA 4DWIA 2KTQA 2HVHA 4ELVA 4EZ6A 1TVRA 3S3OA 1JLEA 3AV9A 3CM5A 3P1GA 3C95A 3CM6A 1QS4A 1S9GA 5K14A 3TARA 3S3MA 1HYVA 1LW0A 3VQPA 3K2PA 3KLIA 3KLFA 1SL1A 3K5LA 2NUBA 4DU3A 4ICLA 3JSMA 4EP5A 4UQGA 3TAQA 1KLNA 1HPZA 3RR7A 1DTQA 3LP3A 4FJHA 2B6AA 1UOCA 4CF2A 4YNQA 1I39A 1J5OA 2JGUA 4KKOA 1VK0A 1NJZA 1NK7A 4AHTA 1A5VA 1WAJA 1ASUA 3E01A 4BWMA 4CECA 4CHPA 4FYDA 1B9DA 3WNHA 3QNNA 1Q9YA 4CFDA 3VA3A 1WLJA 2YV0X 3DM2A 2LSNA 4DU4A 2XY7A 1U49A 4B9NA 4PQUA 1A5WA 2B5JA 4CGHA 3QNOA 1KCFA 5HLFA 1CLQA 4C8NA 1T05A 4FJIA 1TAUA 4DSEA 3MXJA 1HNIA 2E6LA 4IFVA 2D0BA 3OYKA 1D8YA 4KHNA 4E7HA 3SUQA 4ID5A 3LP0A 1NK6A 4GW6A 4M45A 4HCBA 5FROA 3VQBA 1NK5A 2RF2A 3P83D 1CXUA 3RR8A 4RW4A 4C8OA 3L2VA 4N41A 3V1RA 2KZZA 2IGIA 4Z4GA 3M8PA 3HT3A 3S9HA 4DS4A 4B8AB 4W5NA 1LWFA 4FJMA 1NKBA 2PYLA 3SI6A 3VQ7A 1X9MA 3G10A 3QIOA 5J2PA 2OZSA 3LANA 4I2QA 3V9XA 4KHYA 4I9LA 2G8UA 1HNVA 1HQEA 3F73A 5D3GA 3KD5E 1VSIA 1KVCA 3DOLA 3WNFA 1O1WA 1HYZA 4OGCA 3MEGA 1U4BA 1SUQA 3HVRA 3AO1A 4CCHA 4M3ZA 5FRMA 1FK9A 1RTJA 2E4LA 2X6SA 3DRPA 4HHTA 4B9TA 1IKVA 4O4GA 4CK1A 1TKZA 5HRRA 2Y1JA 3AVHA 3QO9A 4RW8A 4Y1CA 1YTAA 3EZ5A 3TABA 4ZTFA 3VQ5A 3OYFA 2VG7A 3V81A 1U48A 5HRPA 1SKSA 2E6MA 4CK2A 1RT4A 3LZJA 4DU1A 3TANA 3KTQA 4B08A 1J9AA 4IG0A 1NK4A 3RRHA 5KRSA 3M8SA 2X6NA 4KHUA 4CEAA 3OS2A 4GMJB 1RTIA 3AVMA 4Y1DA 1UA0A 1TL1A 2QK9A 4CERA 1R0AA 2G8FA 3NFAA 4KI6A 1ASVA 2HNDA 4J2DA 4CGGA 3QEXA 1JLFA 3ZSYA 1HYSA 3V9UA 1RBRA 1TGOA 5SWMA 3MEDA 2G8VA 4FK2A 1QTMA 1XC9A 4NYNA 4M41A 4FLYA 2AJQA 5I42A 3CFOA 4DTRA 4KHQA 4M3XA 2KFZA 1GOAA 4M42A 4LH5A 1RNHA 3NGZA 1SL0A 5C42A 3HP6A 4B9LA 2HW3A 3KK1A 1IO2A 1WSEA 1L5UA 4J2BA 3NH0A 3SQ4A 5CZ1A 4AHSA 4Z4HA 1VSDA 3MAQA 3QEIA 3SYZA 1IH7A
chains in the Genus database with same CATH superfamily
2Z1HA 3OVNA 2W42A 1J5EK 5BREA 1KLMA 1RT2A 4RCHA 1L3VA 3DLHA 2FC0A 4CIEA 4LSNA 2HBKA 4KHWA 1SZ2A 2Q0RA 4B3OA 4I6MA 4E7KA 1T44A 1QSLA 4BG9A 4DTNA 3T1HK 2P9KA 3FFIA 2YNHA 3L2QA 1XNQK 1TAQA 5CHIA 1U04A 4K43A 5C15A 3K5MA 3OYIA 3O9TA 2OPPA 3VGMA 4BR0A 1NGGA 1JCFA 3CIPA 4H5VA 3DLLL 2O8CB 4FJ7A 5FLXO 5AZJB 2ITMA 3AA3A 4DMNA 2XRIA 2IVPA 1YXQA 4IG3A 1YI2N 2JWKA 3PLAA 3MN7A 1Q81O 3L0QA 1KVAA 4FL9A 4B1XB 4DR3K 5AZJA 4GV6A 3BGRA 1OH7A 2GELA 2F9TA 2F96A 3E66A 3L6QA 3J81O 4IO9L 4AHVA 4A61A 1KAZA 4FW1A 4GV9A 3E1YA 3T3FA 2GBZA 3AVJA 2FBXA 3U6FA 3KK3A 3OYMA 3O3FA 1KFSA 3WT0A 3C7NA 1NJYA 3LDNA 3QFUA 4FLXA 1L3UA 3ATVA 3NMUA 2P9IA 4KTZA 3JS6A 3WUHA 3LL3A 3CJBA 4PY5A 2FF3B 3OYDA 1RDBA 4H4MA 3AVNA 4MLHA 4YOXA 1QZ6A 3SNNA 3B8AX 4E3SA 3HZ6A 5CYMA 3NGYA 1XC3A 4BR9A 1VSLA 2YKMA 5AQWA 4CHNA 4M3UA 4CVNE 2ZE2A 4CHOA 3I55N 4Z4EA 3QBXA 4JI7K 3BY5A 3T19A 3MXIA 1VRUA 2KKZA 4B1WB 4G1QA 5E26A 3DXKA 4KHSA 4PKIA 4DQSA 3TTFA 2D5RA 4JI2K 2G8KA 1MWMA 5C10A 1QVGM 2E2QA 3DXMA 3G4SN 2D0CA 1JL2A 4FZYA 4ILGB 1NOZA 2NZTA 4FJNA 1YTUA 4AHCA 1RT5A 5AQIA 5HL7L 2HHVA 2PZSA 4MO5A 4MLEA 4LH4A 3UE5A 4X66K 2WUSA 4DV6K 4RW7A 1HRHA 2YJEA 2WTUA 5KPZA 4B8CA 4IEIA 3QIPA 4JYAK 1C0GA 4OJRA 3RMDA 3CC4N 1RDUA 2V51B 2XY8A 5IWAK 4I6MB 1HLUA 3I0RA 3QEWA 4NCBA 4LF9K 1DLOA 3ZETB 1XHZA 4CGDA 1BA0A 2QXLA 3VETA 3ZX2A 5AQUA 4H5TA 3OS1A 3VTHA 4C8LA 3V9WA 3P38A 4KH4A 2Q36A 3SCXA 5LJVA 4HCCA 1IBMK 5AQQA 2A1RA 3UKRA 3LWLA 1L3TA 1KVBA 3O9RA 1SAZA 3SMPA 1WSGA 3F9MA 1U2VA 4OPAA 3PO5A 3O9SA 2KFNA 4O8KA 2GTDA 4BE0A 1WSFA 3WNGA 4C8KA 4DSJA 4IBNA 4FPAA 4CF9A 4CIGA 3QMLA 4WFNL 1W2BM 5JVHL 3JAMO 1RDAA 2HHUA 3O1WA 4M3YA 1VSEA 5C2DA 3UIQA 2HVIA 3K58A 4CJ3A 3MX2A 4DFMA 1ESVA 2O8CA 1Q86O 1DTTA 1WSJA 1R59O 3LDSA 5JS2A 3V9SA 1TKTA 4CEQA 1RILA 3WXJA 3L8BA 3TAEA 1NKEA 3VEWA 3K59A 4G9ZA 1WN7A 3IUCA 1IBKK 4NLBA 3S3NA 1W0HA 4WQ5C 2V52B 4BRFA 4X64K 4JI6K 2XY5A 2DFEA 3Q7CA 3SAFA 1G15A 2OZMA 1RGIA 2A40A 3ZSQA 4YY3K 1NGHA 2UUCK 4FJ5A 5E84A 3OYCA 2NRTA 4FVMA 2YJFA 3FFKB 4JI4K 1NBWA 4IZ9A 3ZT2A 4I9QA 2FBTA 4IWVA 3VQ4A 4JRQA 2RE2A 5M1NA 1RDCA 1LV5A 1EXQA 1NKCA 5HROA 3JXUA 3QDKA 5M1KA 1TUYA 2HB5A 4JD2B 3RVCA 1BIZA 4IDKA 2HF4A 2QWNA 4FWMA 2PYJA 4C23A 4ZTJA 3L2WA 1X1PA 5MLCQ 3NH1A 4RTFD 3CFRA 3I8DA 1ZXOA 3DLEA 4JD2A 4AM7A 3H45C 5C25A 5FDLA 5H1SQ 1TL3A 1JL1A 4E19A 1X9WA 5J2MA 2ZGYA 2OPRA 4HUFA 3CMEN 3P31A 3HI0A 3CCVN 4BRKA 2D1KA 4QCLA 2ASMA 4DFPA 3VQ9A 2WC9A 4ZHRA 3FZHA 4F8RA 2E1YA 1VQMN 4CIFA 3HPGA 2P9NA 4A2BA 3ULDA 3L3UA 1BI4B 4OKJA 3CCMN 2HHWA 1RT6A 2OTJN 5SZTA 3I0SA 4BC4A 2G8WA 4H4OA 4BR2A 2HVHA 4CZEA 4EZ6A 3S3OA 5K14A 1IV0A 5JVGL 1LW0A 2QTDA 1WOQA 3S3MA 3KLIA 4DHYA 1SL1A 2QW9A 4CZLA 5GADP 4DU3A 4IXCA 3UKRB 1JCEA 1DTQA 3LP3A 1RDWX 4LFAK 3BP8A 1EWQA 3TTDA 4R79A 1NJZA 4AHTA 4CECA 1ASUA 4FYDA 4CHPA 1LCUA 1Q9YA 4CFDA 2YV0X 4PQUA 3EE8A 4DU4A 3OBYA 4FWNA 4FJIA 4WFBL 3EKUA 2NRHA 4IFVA 3DWLA 4DV4K 3OYKA 1D8YA 1QQMA 1NK5A 2AA4A 4C8OA 4JI5K 3L2VA 1IG8A 4FWQA 4BC5A 2F4VK 3M8PA 3S9HA 1GLEG 4CI6A 1X9MA 5AQZA 1BO5O 4I2QA 1VQNN 1HQEA 1H1VA 3KD5E 1VSIA 4OGCA 1HYZA 2E1ZA 1SUQA 4BQLA 3AY9A 4Z4GA 1FK9A 4HHTA 4H5NA 3TABA 1Z05A 3I33A 3VQ5A 4CJ7A 1SKSA 2E6MA 4CK2A 4GKKK 1RT4A 3O9UA 3LZJA 4DU1A 3ENHA 1NK4A 5KRSA 2X6NA 4CEAA 3IFRA 4GMJB 1TUUA 2A41A 4DV1K 1HNZK 1E3MA 3O1BA 3QB0A 1ASVA 3ZSYA 2VCPA 1QTMA 4FLYA 4K42A 3U8XA 3FR0A 1SL0A 1VQ7N 3KK1A 1IO2A 3K9JA 4J2BA 3NH0A 3ID6A 4AHSA 2DPNA 2WFBA 4V19S 3SJHA 5KPRA 3MAQA 3M5RA 4DV2K 1I94K 1S22A 4U7BA 1WSIA 3P4IA 4BVOA 4EIAA 5BRDA 1N32K 2HHQA 3KLHA 1E4GT 4FW2A 4CGFA 3O08A 2YHWA 4FM1A 1K8KA 3T7ZA 3HVTA 4DTMA 3QEVA 3IKMA 3WXLA 4DTXA 3THWB 1KTQA 4RWTA 2FSJA 2OPQA 4JKGA 3LDPA 3PSIA 3R9PA 4JK8A 3H1VX 3SUOA 1VQON 1XI1A 4XH5A 3OYLA 1JLGA 4DF8A 3SQ1A 2P9PA 4CE9A 2CH6A 4A5AA 1KFDA 4YDUA 1DKGD 2ASPA 4E89A 3VF6A 3DRRA 3VA0A 4JEPA 3IS9A 5E41A 2BGGA 3AVCA 4DF4A 4O0JA 2GX9A 2VWBA 4KTQA 1CZAN 1RCHA 3O4QA 4BREA 1EP4A 1VSJA 4H8KA 2ZM6K 4CHQA 3F5TA 4KO0A 4JK9A 1NK9A 2BUPA 2P9LB 3FGUA 3EEQA 1BHLA 1UWBA 5T7BA 2PY5A 4CEBA 2QKBA 5AFUH 4H0YB 5LJWA 3QEPA 3KHYA 3D0PA 2FSNA 1ZYQA 4CJLA 3VESA 3SPYA 4FWLA 1P90A 4WQ4A 1C0TA 3HSCA 4DR1K 4HUEA 4N5SA 4CGIA 2Q2RA 2D4WA 3H6EA 4KB1A 1U45A 3G0ZA 1NK8A 1W9HA 2QWRA 5CYQA 4AHRA 1HMVA 3MK6A 3O3GA 3UKUB 4HUGA 3ULEA 1VSFA 5F1XA 1GLFO 2EX3A 3DYAA 5DK5A 1GLJO 4KBOA 3THYB 5AR0A 3ULEB 5AQSA 1EETA 1LWCA 3ZX3A 4CESA 2R7YA 2D0PA 1J6ZA 2KQ2A 4YOVA 4BACA 4KH5A 1LAWA 1OH6A 1FKPA 1L3SA 4H5WA 2FF6A 3PO4A 3EY1A 1BWFO 2O4IA 5I9EB 3AVGA 1YVNA 1IKWA 1RBTA 2A1SA 5EVZA 3TR8A 3PIPL 4WYBA 1TYQA 4QS9A 3SMSA 4JKDA 5KRTA 1ZBLA 5KTQA 4FK0A 4B9UA 5D3GA 3O6WA 2IVOA 1UA1A 4JV5K 4DG1A 1RT3A 2KLAA 1S3XA 4CEDA 4WQ5A 1S6QA 1CZ9A 3UB5A 3I8BA 3OJSA 4KI4A 2O8FB 2GV9A 3IMXA 1N6QA 3AGKA 3RMAA 3H46O 2KHOA 3CYMA 3VQEA 2D0OA 2QI2A 2ZD1A 5HBMA 3C6TA 2HMIA 3SLCA 4DLGA 4J2AA 4DSIA 1WB9A 4YOUA 5HRNA 3QICA 1ZBUA 3C6AA 4JNEA 2XHBA 4CFCA 4BC2A 4EAHD 1Q18A 3LP2A 2ZGZA 5AQNA 1TKDA 2DTUA 4CJTA 3NVMA 4HTLA 5FPDA 3PX6A 1BCMA 2OTLN 4CF0A 5HRSA 4BVPA 2W41A 2V7ZA 3M8QA 3THWA 4OPKA 1BG3A 4KTWA 4PL8A 4F3OA 3VGLA 4KAZA 1WNSA 2Q1NA 3EL2A 1BA1A 1Z6RA 1C0MA 4CEZA 4CFAA 3GE1A 4FK4A 4YOYA 3AO5A 3SQ2A 4CZKA 3KK7A 2F9WA 1K6YA 3A5MC 5AQMA 4O44A 2E8AA 3ASMA 1RBVA 3DOKA 1BCOA 1BL3A 1BQMA 3NAEA 2A5XA 3ZSZA 1ZBHA 4K0KK 1A5XA 2UU9K 4FLWA 4OLBA 3J8AA 3LP1A 1HQUA 2X78A 1D9FA 3VN5A 4BDYA 1JJ2M 3LWMA 3OW2M 4ELUA 4E1MA 1NGIA 3LAKA 2F8SA 1Y97A 1VSHA 3FZKA 1YJ9N 4CJ5A 3IAYA 3OHRA 2X74A 2UXDK 1GOCA 1HX1A 3K5OA 1RDDA 3SAGA 5GIOA 2NRZA 1VQPN 3ALYA 1SL2A 4Z4CA 1VQKN 4E7JA 3MWPA 4Z0UA 3PX4A 2RHKA 1S1WA 3VQ8A 5CR4A 4CJRA 3AA4A 1RFQA 5EU7A 3C94A 3VEYA 4DQPA 4HWIA 4IKFA 2OYQA 1NJIO 1NMDA 3PV8A 4DTOA 3T1YK 4AF1A 4QS7A 4CJWA 3CQYA 1LWEA 4BDZA 4WFAL 3TAGA 5BPNA 4JKEA 1KRPA 3GBTA 2VWJA 3E9LA 3JYTA 3GDQA 3TSUA 3OYBA 4B1VA 2E20A 4CBXA 3WEEA 3ZETA 1TK0A 1D9DA 3A5LC 3KIOA 4CHZA 4CZHA 2VG6A 4CJVA 2YNIA 4Z94A 5AQTA 3CF5L 2G8HA 3DLKA 4W5QA 3ZYYX 3QESA 2VQEK 4DSKA 4IO8A 3AO3A 3AAPA 3TPQA 3VMFB 4L3QA 3SK3A 4F9OA 1GLBG 1QZ5A 3AA2A 2OPSA 1N33K 3BUZB 4DWIA 5BR9A 4ELVA 2CGLA 1TVRA 5BRHA 3P1GA 3CM6A 1QS4A 4CZGA 1XQSC 3JSMA 2IIRA 2ZWHA 4UQGA 4JKFA 5EOYA 3M6GA 4FJHA 2B6AA 1UOCA 2JGUA 1NMNA 5EX5A 4KKOA 5AQRA 2O8EB 5M1OA 1WAJA 3E01A 3H3OB 1B9DA 3WNHA 4BRLA 1WLJA 3SBGA 4FWRA 4B9NA 2B5JA 4CGHA 3QNOA 5HLFA 1K8AO 2P9SB 1CLQA 4C8NA 3MXJA 4NLCA 3G25A 4E7HA 3SUQA 3LP0A 1NK6A 4GW6A 2RF2A 3RR8A 1N34K 4N41A 3HBTA 3HT3A 4B8AB 1LWFA 1NKBA 2PYLA 5GAEP 3QIOA 5J2PA 3A5OC 3P39A 4I9LA 3F73A 1KVCA 1NGFA 1O1WA 1U4BA 5FRMA 1RTJA 3WXKA 1YJNN 4B3MK 1TKZA 2Y1JA 5GINA 3AVHA 4Y1CA 4BR4A 3EZ5A 1NU0A 4BRCA 4YOTA 3OYFA 2VG7A 5HRPA 1NM1A 4PKHA 4DR6K 1P8ZA 3KTQA 2UXBK 3WQUA 4B08A 3W0LA 3M8SA 4KHUA 3AVMA 4H0TB 4Y1DA 1TL1A 3MN5A 1K9MO 4CERA 1R0AA 3NFAA 2FLOA 4J2DA 1VQ9N 1V4TA 2CGJA 5SWMA 2V7YA 3MEDA 5I42A 3CFOA 2KFZA 1RNHA 4B9LA 2HW3A 4JI3K 4LC9B 2UXCK 1L5UA 1QQOA 3SQ4A 4CBWA 2ZF5O 5ADXH 4H0XB 3QEIA 4ILHA 3K9KA 1ATRA 4FWKA 1IH7A 3QNNA 3NVKA 4JKCA 3KKSA 2DFFA 2IAJA 3RTVA 5AFUA 4FJ9A 1I3AA 3VQAA 3L2RA 2BANA 4DFKA 2HHXA 2DY4A 3R6MA 4NXMK 2E2NA 3VOVA 3G71N 1VSMA 1BUPA 4JAXA 4B1ZA 4CJPA 2XY6A 3VEOA 1BQNA 2JLEA 3DLGA 3CFPA 4NB4A 3NGIA 1U6ZA 2HF3A 3M3ZA 3EE9A 4GVEA 3CQ8A 1D4XA 5EXWA 4FLVA 3DLRA 3L4IA 5FPNA 4JLHA 3CMAN 4B3TK 2Q97A 4CZFA 2Z1IA 1JLBA 4DLEA 3TAFA 4KREA 3MWTA 4OKKA 4NCAA 4PHTX 1HKBA 2IDOA 3MXMA 1EKEA 1SV5A 3A2FA 1U2VB 1LOTB 3V1QA 2FSKA 1EX4A 2G8IA 3HOSA 4CD3A 3CCQN 3C6HA 4Z4IA 5J2NA 1YITN 4PUOA 1ATSA 1T03A 3O5BA 4DFJA 3CXCM 4C1NK 3CC2N 4BRPA 1VQ6N 5AQPA 4JKAA 4JS5A 3GL1A 2OCEA 1XHXA 1QHTA 3NHGA 4BY9C 5AQOA 2BTFA 2BDPA 3OS0A 3HM9A 1QSSA 3BF3A 2HBJA 4M7YA 1YVUA 3OJUA 3PUFA 3GG4A 4DSFA 2HOEA 2VWKA 1RTDA 5HP1A 3HP9A 5JS1A 3MN9A 1QHAA 5LMNK 4CW7B 2QKKA 1NJXA 4B9VA 1S1UA 2GWJA 1S1TA 2QM1A 3K57A 3OBWA 3SV4A 2KW4A 2H3GX 3H08A 4CJFA 3SZ2A 3O80A 3MX5A 5JMVA 3HO1A 4DSLA 2P9SA 4Z4FA 1TKXA 2P9IB 4H0VB 4DUZK 3O8MA 1OH8A 3ZT4A 5CE3A 4FWOA 1W97L 4HVJA 5AQKA 3HK2A 1HKCA 3AVFA 3DXKB 4EHTA 4BRGA 4B9QA 1VSKA 2RPIA 2EHGA 5M1QA 3CCUN 3QINA 4W5TA 3V4IA 2P1JA 4DR5K 3P5JA 2A6AA 4CEOA 4FOIA 4JI0K 2IC3A 4ILJA 5KGWA 3U9DA 3D2EB 2WOMA 4K25A 1WAFA 2VYPA 3N4PA 1FJGK 1BI4A 3CG7A 4F4KA 2JWLA 4ID1A 1HUXA 1OVYA 1YUWA 4E7LA 4OX9K 1M90O 2NRWA 1HNXK 4JKGB 1ZBIA 2FBYA 3AO2A 1WUAA 1XUPO 4AHUA 2YHBA 4ISFA 4DS5A 1NOYA 3AVAA 3V9ZA 4O0IA 2Y1IA 3KD1E 3LPTA 1S1XA 3ZSXA 1REVA 3FZMA 4B9SA 1JLQA 1MA9B 1QSYA 3TWHA 4O55A 3KWGA 1NGEA 5BPLA 4WQ4C 2KZZA 5FRNA 1ITGA 5BR8K 3EN9A 5EY4A 1J53A 3TI0A 4W5RA 1ZBSA 3VF2A 4A59A 2O8DA 5C12A 3O4NA 1RBUA 3THVA 4XEIA 4KH6A 3KWIA 5F0XA 3NDKA 3D6RA 4IJNA 3MCPA 4FJKA 1DGKN 2O8BA 4BRMA 3HPOA 4A62A 1NK0A 3FE1A 2CGKA 3VQDA 4C1NI 2RKIA 1SKWA 4XIUA 2AP1A 1KC8O 1N5YA 2P9KB 1RTHA 4AH9A 1F21A 1QQCA 3R8EA 4MFBA 4BWJA 4JS4A 3VEZA 2O4GA 4MO4A 1C6VA 4H0PA 3UKUA 1RBSA 4LFCK 4GV3A 3NH2A 1KSPA 3VEVA 2PBDA 3KLGA 4K8ZA 1OH5A 1JCGA 2O8EA 5KGXA 1IG9A 2QWOA 1ATNA 1SKRA 4FJLA 3CHWA 4ELTA 4FLTA 3N4QA 3SQ0A 4BR7A 4E0DA 2P5GA 2VGNA 4AM6A 5J1EA 4K8XA 4CJUA 3AVKA 4QAGA 1FKOA 3F9KA 2W6KA 5DMRA 1SQKA 2VQFK 4MQ3A 4FOEA 4AILC 2QWLA 2QWQA 3OA9A 5LL6Z 3SBTA 1S1VA 2XO7A 2YNGA 1M1KO 2YX6A 4LD0A 4CD1A 3MN6A 1V4SA 3CCRN 4CJ4A 4PA1A 1Q9XA 1TYQB 3CPEA 1W7AA 1QVFM 1YT3A 1TK5A 1NGJA 4WCEL 3KVGA 2Q3SA 3D2EA 4CHYA 3AA5X 4B1UB 3C6UA 3ITHA 1C1AA 3VPZA 4U67L 3OYGA 2WONA 2F8TA 3A8YA 4CBUA 3CCSN 4EHUA 4FLUA 3D45A 4LF4K 4HTUA 4I2PA 5AQYA 4PL7A 4B9MA 4B3SK 4A5BA 2W6LA 3EZWA 4EP4A 1OKJA 2ZJPL 1YHQN 3ZSWA 2E5LK 3CJ1A 1K73O 5I3UA 4ISGA 1T8EA 2P9LA 4BROA 4KB0A 3ZT1A 1GLCG 4LF7K 1XWLA 3V1OA 1HKGA 5JLFA 4A57A 3VQ6A 3LAMA 2NRXA 3CQXA 4RW6A 4CF8A 4JI1K 3RMBA 2KTQA 1KXPA 4OO1J 5DM7L 1S72N 4BDPA 3AV9A 2P9UB 4FJJA 4NXNK 3C95A 1T6CA 4A2AA 3BF1A 4DV5K 4J8FA 4EP5A 2ZJRL 1KAXA 3TAQA 1KLNA 1HPZA 3RSEA 3RR7A 3VENA 3U9ZA 2UUBK 1J5OA 2P9UA 3TSPA 1VK0A 1A5VA 3VA3A 4JI8K 2O8DB 3DM2A 2LSNA 1E4FT 1U49A 3HM8A 2UYTA 1TAUA 1HR0K 1DEJA 4BRHA 1ZC6A 3CJAA 4KHNA 2WBNA 2YCHA 5A2QO 2O8BB 4HCBA 1XNRK 3VQBA 3THYA 4RW4A 1X3NA 4DUYK 4DS4A 1NLVA 4IJAA 4W5NA 3EO3A 4FJMA 3MCAB 5AZIA 3LANA 3CC7N 1MWKA 3V9XA 3FZLA 2G8UA 1HNVA 3DOLA 3WNFA 5LY3A 1HJOA 3AO1A 4CCHA 4M3ZA 4B9TA 4BC3A 4O4GA 2HBLA 2NRRA 4CK1A 4ZTFA 1Y64A 3E9OA 3QO9A 4RW8A 1VQLN 3C7NB 1U48A 1NNEA 4BRDA 4GY2B 2HHTA 2HSTA 1J9AA 4IG0A 3AAQA 1MDUB 5ELZA 3OS2A 1RTIA 1UA0A 3QFPA 4KI6A 4CGGA 3V9UA 1TGOA 4LF6K 2NRVA 4NYNA 5GAHP 2AJQA 2OANA 4DTRA 1DT9A 4LH5A 3NGZA 3GOIA 5C42A 4BG8A 5M1FA 3M1FA 5CZ1A 4DCHA 3PIOL 4JKBA 4Z4HA 3K0SA 1X9JA 2ASOA 1K8KB 5AJ3K 3DJCA 4FSVA 4L8RB 4KV8A 3LDOA 1NGCA 4YHHK 4M63C 2P5OA 1IKXA 3LM9A 1ZBFA 4Y0WA 4E7IA 5JLHA 1VQ4N 1JXBA 2O8FA 3O4WA 4CEEA 2I5JA 3PY8A 4GKJK 5C24A 1X3MA 5JICA 1NGBA 4N56A 3VEXA 1T6DA 3OYEA 5BN9A 5FPMA 2IS3A 3KJVA 4FZZA 3WQTA 4OVLA 4EZ9A 1Z25A 4LY7A 4AQYK 2I7NA 1HNWK 5F2RA 1WBBA 2I7PA 4I7FA 1FXXA 2BH1A 4FWPA 5KQDA 4FXDA 3ZT0A 3HXMA 3U3GA 3VTIA 4CJEA 2A3ZA 4FJ8A 4CK3A 2RN2A 3ZCMA 3LDLA 5AQGA 2YHYA 3CJCA 5AQVA 3VGKA 2BE2A 2VG5A 3NE6A 1CXQA 4LF8K 3DMJA 4N76A 4DQRA 1BOTO 3RSEB 4CZIA 3QETA 4FPBA 5AQXA 4BR5A 2CH5A 1BGXT 2YHXA 3E9PA 2P9NB 3SUNA 3ZSRA 4OLAA 3ZLJA 1NGAA 3S41A 2YKNA 4R5PA 2HNZA 3NCIA 3G6EN 3TSQA 1VQ5N 3VQQA 4M3TA 3CCLN 3LZIA 4M3RA 4YORA 4BGAA 1QE1A 4LSLA 1S9EA 2NNWA 3L3VA 3HL8A 4PWDA 5GAGP 3SJJA 2PAVA 3ATUA 4FCYA 2Q0UA 4N47A 1G99A 2HMPA 4CF1A 3CCEN 4FZXC 3ID8A 5BN8A 4O5FA 3D2FA 1C1CA 5CZ2A 4DQIA 4JHDA 1JLAA 4IEEA 1HJRA 2ATQA 4OGEA 5GIPA 2ITGA 4DB3A 1WSHA 2HNYA 3HPHA 4YDUC 3U3YA 1T3VA 1JLCA 1VQ8N 5IT9O 4CEFA 3D2FB 3MEEA 4JHDB 3C0BA 1YJWN 5C0YA 1YIJN 3O3HA 3WEEB 2A42A 3DRSA 3KKRA 3M8RA 3A5NC 4UY8O 4DV0K 4MDBA 3CI5A 3B6OA 4BE2A 4DTPA 3IRXA 3J80O 3PSFA 3AO4A 3DLBA 3EYZA 4KHPK 4BRNA 3LALA 3R1XA 4JK7A 3ISNC 1KAYA 2IOCA 4DTSA 4F2SA 3DI6A 1IKYA 4H5RA 4C8MA 4NYFA 1EQYA 1S5JA 3CERA 3TTCA 1IBLK 4PKGA 3KZBA 4FWSA 4CJQA 3OYAA 3KK2A 5BRFA 3IG1A 3RRGA 3NF8A 1O13A 3AVIA 2ETJA 1Q8IA 1VAZA 5DM6L 3ZSVA 2EWSA 4O5BA 3B6PA 3L4QA 3LM2A 4CZJA 2P51A 3WXIA 2YHAA 3ZEUB 2VGMA 5KPTA 2E2OA 3CETA 4J2EA 2FXUA 4M3WA 3H3NO 1NJWA 4NO7A 3D7EO 2NLXA 3FLCO 3HSTB 3RWUA 2DFHA 3SPZA 1JXEA 4CFBA 2ZJQL 3AVBA 1NG9A 4M7XA 1XMOK 1ILYA 4FJXA 3T1AA 3ZEUA 1CZBA 1KD1O 4CJSA 3J7ZO 3THXA 1HPMA 3RMCA 2GUIA 2YI1A 1BIUA 2UUAK 4JRPA 3ZSOA 1LW2A 3MDQA 2QEXN 2PFUA 4XH4A 4YOWA 4F3TA 1OVQA 5M1PA 4DKWA 5B8HA 3THXB 4IOAL 5KI6A 5LMUK 3NBPA 1Q82O 4TSXA 3OY9A 3J7AP 3V6DA 3TAMA 1T7PA 1LAVA 4E1NA 1NGDA 3L2UA 1TV6A 4ISEA 3BDPA 4IDHA 4H0OA 4DTUA 2E88A 4DQQA 4CZMA 2P9PB 3CCJN 4WE1A 3DAWA 1C0UA 3AGRA 3HTVA 3QBWA 3R3LA 4W5OA 3KLEA 4BRAA 1X9SA 4OKEA 5FPEA 2HHHK 5J2QA 4DR7K 3HRGA 4OPHA 4FJGA 3BZCA 1C1BA 2ZQBA 2GEMA 1U47A 4IFYA 2F7TA 5AQLA 4E1JA 3T69A 2J4RA 2KZMA 5TKYA 4H03B 4B1YB 1N36K 3IDHA 4BRIA 3OYNA 3EKSA 3VF4A 4YFUA 2E2PA 3TAPA 1RT7A 3J7YP 4Q0BA 3HJFA 5BPMA 3VQCA 2IVNA 3SAHA 1JKHA 4O8UA 1VRTA 1EWRA 2QXFA 4QS8A 5AZIB 1C0FA 4DV7K 1GOBA 4NCGA 1GLAG 3OTOK 3SV3A 3MECA 2HBMA 2Z1GA 2GWKA 2YNFA 3WNEA 4BE1A 4BQZA 1EO1A 1Z26A 2W40A 1Q7YO 4CGJA 4RW9A 3PX0A 2B4JA 2FBVA 3SUPA 1KQSM 1TK8A 1B9FA 3ENBA 4OPJA 1S6PA 5CY4A 2QWMA 4GVMA 2D0AA 1J54A 4KFBA 3HYFA 3AARA 3MMVA 1WBDA 1B92A 3QERA 3NF6A 1ASWA 5AQHA 1D5AA 2QA4N 4BGBA 2Z1JA 1UAXA 3O9QA 5AQFA 4Q5VA 4DQ8A 4IOCL 3ENOA 4JKHA 1RT1A 4KRFA 4QOZB 2OA8A 3K5NA 1QQNA 3NF9A 1FW6A 3AVLA 1BISA 4FM0A 5TKWA 4DTJA 3VERA 4RG8A 1MU2A 4F2RA 1GLLO 2HHSA 4X65K 4BRQA 4FLZA 4K41A 4IOXA 4CJKA 2QWPA 4KPYA 1SS6A 3C65A 3OYHA 3QLHA 3ZT3A 3LPUA 4FM2A 3NF7A 4WF9L 4XH1A 1JLEA 3CM5A 4EFHA 4JN4A 1S9GA 3F2KA 3TARA 1HYVA 3VQPA 3K2PA 3KLFA 3K5LA 2NUBA 4ICLA 1GLDG 2GUPA 1BU6O 4YNQA 4CF2A 1I39A 5AQJA 5KQ8A 3CJ9A 1NK7A 4BWMA 1NWKA 3Q7BA 2XY7A 1VHXA 4FVUA 1A5WA 4LFBK 1KCFA 1BDGA 1T05A 4DR2K 3LDQA 4LF5K 4DSEA 1HNIA 2E6LA 4GNIA 3BZKA 2D0BA 3BEXA 4ID5A 4M45A 5FROA 3WXMB 3TU5A 3P83D 1CXUA 3V1RA 4B3RK 1YAGA 2IGIA 1IJJA 1N8RO 3W3DA 3SI6A 3VQ7A 3G10A 2OZSA 4KHYA 3CPWM 1YF5L 1XMQK 4IFEA 4DV3K 3MEGA 3HOTA 3HVRA 2X6SA 3DRPA 2E4LA 1IKVA 5HRRA 2Q31A 1YTAA 3V81A 3TANA 3FZFA 3CD6N 3RRHA 4MDAA 3U4LA 3H1QA 2QK9A 2G8FA 2HNDA 4FO0A 3QEXA 1JLFA 1HYSA 1RBRA 2G8VA 4FK2A 1XC9A 4M41A 4M3XA 4KHQA 1GOAA 3CJ7A 5ADXA 5HOOA 4M42A 4DR4K 3HP6A 4X62K 1WSEA 3A0IX 5C2FA 3DXMB 1VSDA 3ZX0A 3I56N 3SYZA 3OYJA
chains in the Genus database with same CATH topology
2Z1HA 3KKSA 3OVNA 2DFFA 2IAJA 2W42A 4KV8A 4L8RB 1WSIA 3RTVA 4FJ9A 1KLMA 1I3AA 3VQAA 2P5OA 1RT2A 2BANA 1IKXA 3L2RA 4DFKA 1ZBFA 2HHXA 4E7IA 1L3VA 2DY4A 2HHQA 3DLHA 1JXBA 3KLHA 2FC0A 1VSMA 4CJPA 4FW2A 4CGFA 4CIEA 4LSNA 2XY6A 1BQNA 4FM1A 2JLEA 4CEEA 2I5JA 3HVTA 4DTMA 3DLGA 5C24A 3CFPA 3PY8A 3QEVA 4KHWA 4DTXA 3NGIA 4N56A 4B3OA 1KTQA 2OPQA 3OYEA 4E7KA 1QSLA 3SUOA 1XI1A 4DTNA 2IS3A 3KJVA 4FZZA 3OYLA 4OVLA 1JLGA 3CQ8A 3FFIA 1Z25A 4LY7A 2YNHA 3L2QA 4EZ9A 1TAQA 4DF8A 3SQ1A 4CE9A 4FLVA 3DLRA 4JLHA 1U04A 1KFDA 4I7FA 1FXXA 4FXDA 3ZT0A 3K5MA 2Z1IA 1JLBA 4E89A 3DRRA 3HXMA 4DLEA 3VA0A 3TAFA 3OYIA 3U3GA 4CJEA 4OKKA 4KREA 3IS9A 5E41A 4NCAA 4FJ8A 2BGGA 4CK3A 2OPPA 2RN2A 3ZCMA 2IDOA 3AVCA 4DF4A 4O0JA 3MXMA 1EKEA 1SV5A 4KTQA 3A2FA 4FJ7A 3V1QA 1RCHA 2BE2A 3O4QA 1EP4A 3AA3A 4DMNA 1EX4A 2VG5A 1VSJA 2XRIA 4H8KA 3NE6A 1CXQA 2G8IA 4CHQA 3DMJA 4N76A 4KO0A 4DQRA 3QETA 4Z4IA 5J2NA 4IG3A 4PUOA 1NK9A 1T03A 1BGXT 4DFJA 3SUNA 1BHLA 1UWBA 5T7BA 2PY5A 3ZSRA 4OLAA 4CEBA 2QKBA 1KVAA 3BGRA 3QEPA 4R5PA 2YKNA 2HNZA 3NCIA 3D0PA 1ZYQA 4CJLA 3SPYA 4JS5A 2F96A 1C0TA 1XHXA 1QHTA 3VQQA 3NHGA 4M3TA 4AHVA 4M3RA 3LZIA 4HUEA 4N5SA 4FW1A 4CGIA 2BDPA 3T3FA 1QE1A 3OS0A 3HM9A 4KB1A 2GBZA 3AVJA 1S9EA 4LSLA 1U45A 1QSSA 3L3VA 3OJUA 2FBXA 1YVUA 3U6FA 3KK3A 3OYMA 3HL8A 3O3FA 4PWDA 1KFSA 1NJYA 4FLXA 3G0ZA 3SJJA 3PUFA 1NK8A 1L3UA 4FCYA 1W9HA 4DSFA 2VWKA 4N47A 1RTDA 5HP1A 4KTZA 5CYQA 4AHRA 1HMVA 3HP9A 4CF1A 5JS1A 3O3GA 4PY5A 3OYDA 1RDBA 4H4MA 2QKKA 1NJXA 4B9VA 1S1UA 3AVNA 4HUGA 1S1TA 3SV4A 3K57A 3SNNA 4FZXC 2KW4A 3H08A 4CJFA 3SZ2A 2HHTA 3HO1A 1C1CA 4E3SA 5CZ2A 5CYMA 1VSFA 4DQIA 4DSLA 4Z4FA 1TKXA 3NGYA 1JLAA 1VSLA 2EX3A 1HJRA 2YKMA 4CHNA 4M3UA 2ATQA 4OGEA 2ITGA 3ZT4A 3HPHA 1WSHA 2HNYA 3DYAA 5DK5A 3U3YA 2ZE2A 1JLCA 4HVJA 4CHOA 3HK2A 4CEFA 3AVFA 4Z4EA 1EETA 1LWCA 3MEEA 1VSKA 2RPIA 2EHGA 3T19A 3O3HA 4CESA 3MXIA 1VRUA 3DRSA 3KKRA 2R7YA 3M8RA 3QINA 2KQ2A 4W5TA 4BACA 3V4IA 2P1JA 4G1QA 3B6OA 1LAWA 3P5JA 4CEOA 4BE2A 4KHSA 4DQSA 4DTPA 3IRXA 2IC3A 1FKPA 5KGWA 1L3SA 2WOMA 3PO4A 3AO4A 3DLBA 3EYZA 1WAFA 3EY1A 2D5RA 3LALA 2O4IA 3AVGA 1IKWA 1RBTA 2A1SA 2G8KA 3ISNC 3TR8A 1BI4A 3CG7A 4F4KA 2IOCA 4ID1A 2D0CA 1JL2A 4FZYA 4DTSA 1NOZA 4F2SA 3DI6A 1IKYA 4E7LA 4C8MA 5KRTA 4NYFA 4FJNA 1S5JA 1YTUA 1ZBLA 1ZBIA 2FBYA 3AO2A 4AHCA 4AHUA 5KTQA 4FK0A 4B9UA 1RT5A 2YHBA 4CJQA 3OYAA 3KK2A 4DS5A 3IG1A 1NOYA 3RRGA 3AVAA 3NF8A 4O0IA 3V9ZA 2PZSA 2HHVA 1UA1A 3AVIA 2Y1IA 2ETJA 4DG1A 1Q8IA 4LH4A 3KD1E 1RT3A 3LPTA 3ZSVA 1S1XA 4O5BA 3B6PA 3ZSXA 4CEDA 1S6QA 2P51A 1CZ9A 2YHAA 4RW7A 1HRHA 1REVA 3OJSA 4B9SA 1JLQA 1QSYA 4KI4A 3TWHA 4O55A 2GV9A 1N6QA 4B8CA 4J2EA 4M3WA 1NJWA 3RMAA 3CYMA 3VQEA 3HSTB 3QIPA 4BDPA 3RWUA 5FRNA 2ZD1A 1ITGA 2DFHA 4OJRA 3C6TA 5HBMA 1JXEA 4CFBA 3RMDA 3SPZA 2HMIA 3AVBA 2XY8A 4DLGA 1J53A 3T1AA 3TI0A 4J2AA 4FJXA 3I0RA 3QEWA 4W5RA 1CZBA 4DSIA 4NCBA 4CJSA 2F8TA 3RMCA 1DLOA 2GUIA 3O4NA 5HRNA 1XHZA 1RBUA 4CGDA 1BIUA 1ZBUA 3THVA 2XHBA 4CFCA 4JRPA 3ZSOA 3OS1A 3NDKA 3LP2A 4C8LA 1LW2A 3V9WA 3SCXA 1TKDA 2DTUA 4CJTA 4HCCA 4FJKA 3PX6A 1BCMA 4F3TA 4CF0A 5HRSA 2A1RA 5KI6A 3HPOA 3NBPA 3LWLA 1L3TA 1KVBA 1WSGA 4TSXA 3OY9A 1NK0A 3VQDA 3PO5A 3M8QA 3TAMA 3V6DA 2RKIA 1T7PA 1SKWA 2KFNA 4XIUA 1LAVA 4E1NA 4OPKA 4BE0A 1WSFA 3WNGA 4KTWA 3L2UA 4C8KA 1TV6A 4DSJA 4F3OA 4IBNA 3BDPA 1N5YA 1RTHA 4CF9A 4AH9A 4KAZA 4DTUA 1F21A 1QQCA 4DQQA 4MFBA 4CIGA 1WNSA 4WE1A 4BWJA 1RDAA 4JS4A 1C0UA 1C0MA 4W5OA 4M3YA 2HHUA 4CEZA 4CFAA 2O4GA 1VSEA 3KLEA 4FK4A 1C6VA 3OYJA 4OKEA 1X9SA 1RBSA 3AO5A 3SQ2A 3UIQA 4FJJA 3NH2A 5J2QA 1KSPA 2HVIA 3K58A 3KLGA 4CJ3A 4DFMA 4K8ZA 1K6YA 1DTTA 4O44A 5KGXA 3ASMA 1IG9A 4FJGA 1RBVA 1WSJA 3DOKA 1SKRA 4FJLA 3LDSA 1BCOA 1BL3A 1C1BA 2ZQBA 5JS2A 4FLTA 4IFYA 3SQ0A 1U47A 3V9SA 1TKTA 1BQMA 1RILA 4CEQA 3L8BA 3TAEA 4E0DA 3NAEA 2P5GA 2KZMA 1NKEA 3ZSZA 1ZBHA 5J1EA 3K59A 1A5XA 4CJUA 4K8XA 1WN7A 4FLWA 3AVKA 4QAGA 3S3NA 3OYNA 1FKOA 3LP1A 4OLBA 1HQUA 1W0HA 3F9KA 4YFUA 2XY5A 2X78A 5DMRA 2DFEA 1D9FA 3TAPA 3VN5A 1RT7A 4BDYA 4Q0BA 4MQ3A 3HJFA 4AILC 1G15A 2OZMA 3LWMA 4ELUA 3VQCA 4E1MA 3ZSQA 3LAKA 2F8SA 1Y97A 1S1VA 2XO7A 1JKHA 1VSHA 2YNGA 4CJ5A 1VRTA 3IAYA 4FJ5A 3OYCA 4LD0A 2QXFA 2X74A 4FVMA 1GOCA 3K5OA 1RDDA 1GOBA 4NCGA 4PA1A 4CJ4A 4ELTA 3ZT2A 3SV3A 1Q9XA 4I9QA 3MECA 2FBTA 3ALYA 2Z1GA 3VQ4A 4JRQA 2YNFA 3WNEA 4BE1A 1SL2A 1RDCA 1LV5A 1Z26A 1EXQA 4Z4CA 1NKCA 4E7JA 5HROA 4Z0UA 1YT3A 1TK5A 3PX4A 2HB5A 1S1WA 3VQ8A 1BIZA 4CJRA 3AA4A 4IDKA 5EU7A 4CGJA 4RW9A 2PYJA 3PX0A 3C94A 4DQPA 2B4JA 2FBVA 3L2WA 3SUPA 4ZTJA 1X1PA 2OYQA 2Q3SA 4IKFA 4CHYA 1TK8A 1B9FA 3PV8A 4OPJA 3NH1A 4DTOA 1S6PA 5CY4A 3AA5X 4GVMA 3CFRA 2D0AA 3I8DA 1J54A 3C6UA 3DLEA 4KFBA 3ITHA 3HYFA 4CJWA 1C1AA 1B92A 1LWEA 3OYGA 3NF6A 2WONA 1ASWA 5C25A 1D5AA 4BDZA 3QERA 5FDLA 3TAGA 1TL3A 1JL1A 4E19A 1X9WA 1KRPA 5J2MA 2VWJA 4FLUA 3D45A 2Z1JA 1UAXA 3JYTA 2OPRA 4HTUA 4I2PA 3OYBA 4Q5VA 4HUFA 4B9MA 1TK0A 1RT1A 1D9DA 4KRFA 4QOZB 2OA8A 3KIOA 4EP4A 3K5NA 3ZSWA 4CHZA 2VG6A 4QCLA 3NF9A 4CJVA 2YNIA 3AVLA 4DFPA 3VQ9A 1BISA 4FM0A 5I3UA 4ZHRA 2G8HA 3DLKA 4W5QA 4F8RA 4DTJA 3QESA 4CIFA 4RG8A 3HPGA 4DSKA 1MU2A 1T8EA 3AO3A 4F2RA 2HHSA 3ULDA 3L3UA 1BI4B 4KB0A 3ZT1A 4OKJA 1XWLA 4FLZA 2HHWA 1RT6A 3V1OA 4CJKA 4KPYA 3VQ6A 3AA2A 3LAMA 5SZTA 3OYHA 2OPSA 3QLHA 3I0SA 3ZT3A 4RW6A 4CF8A 3LPUA 4FM2A 3NF7A 3RMBA 2G8WA 4H4OA 4DWIA 2KTQA 2HVHA 4ELVA 4EZ6A 1TVRA 3S3OA 1JLEA 3AV9A 3CM5A 3P1GA 3C95A 3CM6A 1QS4A 1S9GA 5K14A 3TARA 3S3MA 1HYVA 1LW0A 3VQPA 3K2PA 3KLIA 3KLFA 1SL1A 3K5LA 2NUBA 4DU3A 4ICLA 3JSMA 4EP5A 4UQGA 3TAQA 1KLNA 1HPZA 3RR7A 1DTQA 3LP3A 4FJHA 2B6AA 1UOCA 4CF2A 4YNQA 1I39A 1J5OA 2JGUA 4KKOA 1VK0A 1NJZA 1NK7A 4AHTA 1A5VA 1WAJA 1ASUA 3E01A 4BWMA 4CECA 4CHPA 4FYDA 1B9DA 3WNHA 3QNNA 1Q9YA 4CFDA 3VA3A 1WLJA 2YV0X 3DM2A 2LSNA 4DU4A 2XY7A 1U49A 4B9NA 4PQUA 1A5WA 2B5JA 4CGHA 3QNOA 1KCFA 5HLFA 1CLQA 4C8NA 1T05A 4FJIA 1TAUA 4DSEA 3MXJA 1HNIA 2E6LA 4IFVA 2D0BA 3OYKA 1D8YA 4KHNA 4E7HA 3SUQA 4ID5A 3LP0A 1NK6A 4GW6A 4M45A 4HCBA 5FROA 3VQBA 1NK5A 2RF2A 3P83D 1CXUA 3RR8A 4RW4A 4C8OA 3L2VA 4N41A 3V1RA 2KZZA 2IGIA 4Z4GA 3M8PA 3HT3A 3S9HA 4DS4A 4B8AB 4W5NA 1LWFA 4FJMA 1NKBA 2PYLA 3SI6A 3VQ7A 1X9MA 3G10A 3QIOA 5J2PA 2OZSA 3LANA 4I2QA 3V9XA 4KHYA 4I9LA 2G8UA 1HNVA 1HQEA 3F73A 5D3GA 3KD5E 1VSIA 1KVCA 3DOLA 3WNFA 1O1WA 1HYZA 4OGCA 3MEGA 1U4BA 1SUQA 3HVRA 3AO1A 4CCHA 4M3ZA 5FRMA 1FK9A 1RTJA 2E4LA 2X6SA 3DRPA 4HHTA 4B9TA 1IKVA 4O4GA 4CK1A 1TKZA 5HRRA 2Y1JA 3AVHA 3QO9A 4RW8A 4Y1CA 1YTAA 3EZ5A 3TABA 4ZTFA 3VQ5A 3OYFA 2VG7A 3V81A 1U48A 5HRPA 1SKSA 2E6MA 4CK2A 1RT4A 3LZJA 4DU1A 3TANA 3KTQA 4B08A 1J9AA 4IG0A 1NK4A 3RRHA 5KRSA 3M8SA 2X6NA 4KHUA 4CEAA 3OS2A 4GMJB 1RTIA 3AVMA 4Y1DA 1UA0A 1TL1A 2QK9A 4CERA 1R0AA 2G8FA 3NFAA 4KI6A 1ASVA 2HNDA 4J2DA 4CGGA 3QEXA 1JLFA 3ZSYA 1HYSA 3V9UA 1RBRA 1TGOA 5SWMA 3MEDA 2G8VA 4FK2A 1QTMA 1XC9A 4NYNA 4M41A 4FLYA 2AJQA 5I42A 3CFOA 4DTRA 4KHQA 4M3XA 2KFZA 1GOAA 4M42A 4LH5A 1RNHA 3NGZA 1SL0A 5C42A 3HP6A 4B9LA 2HW3A 3KK1A 1IO2A 1WSEA 1L5UA 4J2BA 3NH0A 3SQ4A 5CZ1A 4AHSA 4Z4HA 1VSDA 3MAQA 3QEIA 3SYZA 1IH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z1H A;  3KKS A;  3OVN A;  2DFF A;  2IAJ A;  2W42 A;  4KV8 A;  4L8R B;  1WSI A;  3RTV A;  4FJ9 A;  1KLM A;  1I3A A;  3VQA A;  2P5O A;  1RT2 A;  2BAN A;  1IKX A;  3L2R A;  4DFK A;  1ZBF A;  2HHX A;  4E7I A;  1L3V A;  2DY4 A;  2HHQ A;  3DLH A;  1JXB A;  3KLH A;  2FC0 A;  1VSM A;  4CJP A;  4FW2 A;  4CGF A;  4CIE A;  4LSN A;  2XY6 A;  1BQN A;  4FM1 A;  2JLE A;  4CEE A;  2I5J A;  3HVT A;  4DTM A;  3DLG A;  5C24 A;  3CFP A;  3PY8 A;  3QEV A;  4KHW A;  4DTX A;  3NGI A;  4N56 A;  4B3O A;  1KTQ A;  2OPQ A;  3OYE A;  4E7K A;  1QSL A;  3SUO A;  1XI1 A;  4DTN A;  2IS3 A;  3KJV A;  4FZZ A;  3OYL A;  4OVL A;  1JLG A;  3CQ8 A;  3FFI A;  1Z25 A;  4LY7 A;  2YNH A;  3L2Q A;  4EZ9 A;  1TAQ A;  4DF8 A;  3SQ1 A;  4CE9 A;  4FLV A;  3DLR A;  4JLH A;  1U04 A;  1KFD A;  4I7F A;  1FXX A;  4FXD A;  3ZT0 A;  3K5M A;  2Z1I A;  1JLB A;  4E89 A;  3DRR A;  3HXM A;  4DLE A;  3VA0 A;  3TAF A;  3OYI A;  3U3G A;  4CJE A;  4OKK A;  4KRE A;  3IS9 A;  5E41 A;  4NCA A;  4FJ8 A;  2BGG A;  4CK3 A;  2OPP A;  2RN2 A;  3ZCM A;  2IDO A;  3AVC A;  4DF4 A;  4O0J A;  3MXM A;  1EKE A;  1SV5 A;  4KTQ A;  3A2F A;  4FJ7 A;  3V1Q A;  1RCH A;  2BE2 A;  3O4Q A;  1EP4 A;  3AA3 A;  4DMN A;  1EX4 A;  2VG5 A;  1VSJ A;  2XRI A;  4H8K A;  3NE6 A;  1CXQ A;  2G8I A;  4CHQ A;  3DMJ A;  4N76 A;  4KO0 A;  4DQR A;  3QET A;  4Z4I A;  5J2N A;  4IG3 A;  4PUO A;  1NK9 A;  1T03 A;  1BGX T;  4DFJ A;  3SUN A;  1BHL A;  1UWB A;  5T7B A;  2PY5 A;  3ZSR A;  4OLA A;  4CEB A;  2QKB A;  1KVA A;  3BGR A;  3QEP A;  4R5P A;  2YKN A;  2HNZ A;  3NCI A;  3D0P A;  1ZYQ A;  4CJL A;  3SPY A;  4JS5 A;  2F96 A;  1C0T A;  1XHX A;  1QHT A;  3VQQ A;  3NHG A;  4M3T A;  4AHV A;  4M3R A;  3LZI A;  4HUE A;  4N5S A;  4FW1 A;  4CGI A;  2BDP A;  3T3F A;  1QE1 A;  3OS0 A;  3HM9 A;  4KB1 A;  2GBZ A;  3AVJ A;  1S9E A;  4LSL A;  1U45 A;  1QSS A;  3L3V A;  3OJU A;  2FBX A;  1YVU A;  3U6F A;  3KK3 A;  3OYM A;  3HL8 A;  3O3F A;  4PWD A;  1KFS A;  1NJY A;  4FLX A;  3G0Z A;  3SJJ A;  3PUF A;  1NK8 A;  1L3U A;  4FCY A;  1W9H A;  4DSF A;  2VWK A;  4N47 A;  1RTD A;  5HP1 A;  4KTZ A;  5CYQ A;  4AHR A;  1HMV A;  3HP9 A;  4CF1 A;  5JS1 A;  3O3G A;  4PY5 A;  3OYD A;  1RDB A;  4H4M A;  2QKK A;  1NJX A;  4B9V A;  1S1U A;  3AVN A;  4HUG A;  1S1T A;  3SV4 A;  3K57 A;  3SNN A;  4FZX C;  2KW4 A;  3H08 A;  4CJF A;  3SZ2 A;  2HHT A;  3HO1 A;  1C1C A;  4E3S A;  5CZ2 A;  5CYM A;  1VSF A;  4DQI A;  4DSL A;  4Z4F A;  1TKX A;  3NGY A;  1JLA A;  1VSL A;  2EX3 A;  1HJR A;  2YKM A;  4CHN A;  4M3U A;  2ATQ A;  4OGE A;  2ITG A;  3ZT4 A;  3HPH A;  1WSH A;  2HNY A;  3DYA A;  5DK5 A;  3U3Y A;  2ZE2 A;  1JLC A;  4HVJ A;  4CHO A;  3HK2 A;  4CEF A;  3AVF A;  4Z4E A;  1EET A;  1LWC A;  3MEE A;  1VSK A;  2RPI A;  2EHG A;  3T19 A;  3O3H A;  4CES A;  3MXI A;  1VRU A;  3DRS A;  3KKR A;  2R7Y A;  3M8R A;  3QIN A;  2KQ2 A;  4W5T A;  4BAC A;  3V4I A;  2P1J A;  4G1Q A;  3B6O A;  1LAW A;  3P5J A;  4CEO A;  4BE2 A;  4KHS A;  4DQS A;  4DTP A;  3IRX A;  2IC3 A;  1FKP A;  5KGW A;  1L3S A;  2WOM A;  3PO4 A;  3AO4 A;  3DLB A;  3EYZ A;  1WAF A;  3EY1 A;  2D5R A;  3LAL A;  2O4I A;  3AVG A;  1IKW A;  1RBT A;  2A1S A;  2G8K A;  3ISN C;  3TR8 A;  1BI4 A;  3CG7 A;  4F4K A;  2IOC A;  4ID1 A;  2D0C A;  1JL2 A;  4FZY A;  4DTS A;  1NOZ A;  4F2S A;  3DI6 A;  1IKY A;  4E7L A;  4C8M A;  5KRT A;  4NYF A;  4FJN A;  1S5J A;  1YTU A;  1ZBL A;  1ZBI A;  2FBY A;  3AO2 A;  4AHC A;  4AHU A;  5KTQ A;  4FK0 A;  4B9U A;  1RT5 A;  2YHB A;  4CJQ A;  3OYA A;  3KK2 A;  4DS5 A;  3IG1 A;  1NOY A;  3RRG A;  3AVA A;  3NF8 A;  4O0I A;  3V9Z A;  2PZS A;  2HHV A;  1UA1 A;  3AVI A;  2Y1I A;  2ETJ A;  4DG1 A;  1Q8I A;  4LH4 A;  3KD1 E;  1RT3 A;  3LPT A;  3ZSV A;  1S1X A;  4O5B A;  3B6P A;  3ZSX A;  4CED A;  1S6Q A;  2P51 A;  1CZ9 A;  2YHA A;  4RW7 A;  1HRH A;  1REV A;  3OJS A;  4B9S A;  1JLQ A;  1QSY A;  4KI4 A;  3TWH A;  4O55 A;  2GV9 A;  1N6Q A;  4B8C A;  4J2E A;  4M3W A;  1NJW A;  3RMA A;  3CYM A;  3VQE A;  3HST B;  3QIP A;  4BDP A;  3RWU A;  5FRN A;  2ZD1 A;  1ITG A;  2DFH A;  4OJR A;  3C6T A;  5HBM A;  1JXE A;  4CFB A;  3RMD A;  3SPZ A;  2HMI A;  3AVB A;  2XY8 A;  4DLG A;  1J53 A;  3T1A A;  3TI0 A;  4J2A A;  4FJX A;  3I0R A;  3QEW A;  4W5R A;  1CZB A;  4DSI A;  4NCB A;  4CJS A;  2F8T A;  3RMC A;  1DLO A;  2GUI A;  3O4N A;  5HRN A;  1XHZ A;  1RBU A;  4CGD A;  1BIU A;  1ZBU A;  3THV A;  2XHB A;  4CFC A;  4JRP A;  3ZSO A;  3OS1 A;  3NDK A;  3LP2 A;  4C8L A;  1LW2 A;  3V9W A;  3SCX A;  1TKD A;  2DTU A;  4CJT A;  4HCC A;  4FJK A;  3PX6 A;  1BCM A;  4F3T A;  4CF0 A;  5HRS A;  2A1R A;  5KI6 A;  3HPO A;  3NBP A;  3LWL A;  1L3T A;  1KVB A;  1WSG A;  4TSX A;  3OY9 A;  1NK0 A;  3VQD A;  3PO5 A;  3M8Q A;  3TAM A;  3V6D A;  2RKI A;  1T7P A;  1SKW A;  2KFN A;  4XIU A;  1LAV A;  4E1N A;  4OPK A;  4BE0 A;  1WSF A;  3WNG A;  4KTW A;  3L2U A;  4C8K A;  1TV6 A;  4DSJ A;  4F3O A;  4IBN A;  3BDP A;  1N5Y A;  1RTH A;  4CF9 A;  4AH9 A;  4KAZ A;  4DTU A;  1F21 A;  1QQC A;  4DQQ A;  4MFB A;  4CIG A;  1WNS A;  4WE1 A;  4BWJ A;  1RDA A;  4JS4 A;  1C0U A;  1C0M A;  4W5O A;  4M3Y A;  2HHU A;  4CEZ A;  4CFA A;  2O4G A;  1VSE A;  3KLE A;  4FK4 A;  1C6V A;  3OYJ A;  4OKE A;  1X9S A;  1RBS A;  3AO5 A;  3SQ2 A;  3UIQ A;  4FJJ A;  3NH2 A;  5J2Q A;  1KSP A;  2HVI A;  3K58 A;  3KLG A;  4CJ3 A;  4DFM A;  4K8Z A;  1K6Y A;  1DTT A;  4O44 A;  5KGX A;  3ASM A;  1IG9 A;  4FJG A;  1RBV A;  1WSJ A;  3DOK A;  1SKR A;  4FJL A;  3LDS A;  1BCO A;  1BL3 A;  1C1B A;  2ZQB A;  5JS2 A;  4FLT A;  4IFY A;  3SQ0 A;  1U47 A;  3V9S A;  1TKT A;  1BQM A;  1RIL A;  4CEQ A;  3L8B A;  3TAE A;  4E0D A;  3NAE A;  2P5G A;  2KZM A;  1NKE A;  3ZSZ A;  1ZBH A;  5J1E A;  3K59 A;  1A5X A;  4CJU A;  4K8X A;  1WN7 A;  4FLW A;  3AVK A;  4QAG A;  3S3N A;  3OYN A;  1FKO A;  3LP1 A;  4OLB A;  1HQU A;  1W0H A;  3F9K A;  4YFU A;  2XY5 A;  2X78 A;  5DMR A;  2DFE A;  1D9F A;  3TAP A;  3VN5 A;  1RT7 A;  4BDY A;  4Q0B A;  4MQ3 A;  3HJF A;  4AIL C;  1G15 A;  2OZM A;  3LWM A;  4ELU A;  3VQC A;  4E1M A;  3ZSQ A;  3LAK A;  2F8S A;  1Y97 A;  1S1V A;  2XO7 A;  1JKH A;  1VSH A;  2YNG A;  4CJ5 A;  1VRT A;  3IAY A;  4FJ5 A;  3OYC A;  4LD0 A;  2QXF A;  2X74 A;  4FVM A;  1GOC A;  3K5O A;  1RDD A;  1GOB A;  4NCG A;  4PA1 A;  4CJ4 A;  4ELT A;  3ZT2 A;  3SV3 A;  1Q9X A;  4I9Q A;  3MEC A;  2FBT A;  3ALY A;  2Z1G A;  3VQ4 A;  4JRQ A;  2YNF A;  3WNE A;  4BE1 A;  1SL2 A;  1RDC A;  1LV5 A;  1Z26 A;  1EXQ A;  4Z4C A;  1NKC A;  4E7J A;  5HRO A;  4Z0U A;  1YT3 A;  1TK5 A;  3PX4 A;  2HB5 A;  1S1W A;  3VQ8 A;  1BIZ A;  4CJR A;  3AA4 A;  4IDK A;  5EU7 A;  4CGJ A;  4RW9 A;  2PYJ A;  3PX0 A;  3C94 A;  4DQP A;  2B4J A;  2FBV A;  3L2W A;  3SUP A;  4ZTJ A;  1X1P A;  2OYQ A;  2Q3S A;  4IKF A;  4CHY A;  1TK8 A;  1B9F A;  3PV8 A;  4OPJ A;  3NH1 A;  4DTO A;  1S6P A;  5CY4 A;  3AA5 X;  4GVM A;  3CFR A;  2D0A A;  3I8D A;  1J54 A;  3C6U A;  3DLE A;  4KFB A;  3ITH A;  3HYF A;  4CJW A;  1C1A A;  1B92 A;  1LWE A;  3OYG A;  3NF6 A;  2WON A;  1ASW A;  5C25 A;  1D5A A;  4BDZ A;  3QER A;  5FDL A;  3TAG A;  1TL3 A;  1JL1 A;  4E19 A;  1X9W A;  1KRP A;  5J2M A;  2VWJ A;  4FLU A;  3D45 A;  2Z1J A;  1UAX A;  3JYT A;  2OPR A;  4HTU A;  4I2P A;  3OYB A;  4Q5V A;  4HUF A;  4B9M A;  1TK0 A;  1RT1 A;  1D9D A;  4KRF A;  4QOZ B;  2OA8 A;  3KIO A;  4EP4 A;  3K5N A;  3ZSW A;  4CHZ A;  2VG6 A;  4QCL A;  3NF9 A;  4CJV A;  2YNI A;  3AVL A;  4DFP A;  3VQ9 A;  1BIS A;  4FM0 A;  5I3U A;  4ZHR A;  2G8H A;  3DLK A;  4W5Q A;  4F8R A;  4DTJ A;  3QES A;  4CIF A;  4RG8 A;  3HPG A;  4DSK A;  1MU2 A;  1T8E A;  3AO3 A;  4F2R A;  2HHS A;  3ULD A;  3L3U A;  1BI4 B;  4KB0 A;  3ZT1 A;  4OKJ A;  1XWL A;  4FLZ A;  2HHW A;  1RT6 A;  3V1O A;  4CJK A;  4KPY A;  3VQ6 A;  3AA2 A;  3LAM A;  5SZT A;  3OYH A;  2OPS A;  3QLH A;  3I0S A;  3ZT3 A;  4RW6 A;  4CF8 A;  3LPU A;  4FM2 A;  3NF7 A;  3RMB A;  2G8W A;  4H4O A;  4DWI A;  2KTQ A;  2HVH A;  4ELV A;  4EZ6 A;  1TVR A;  3S3O A;  1JLE A;  3AV9 A;  3CM5 A;  3P1G A;  3C95 A;  3CM6 A;  1QS4 A;  1S9G A;  5K14 A;  3TAR A;  3S3M A;  1HYV A;  1LW0 A;  3VQP A;  3K2P A;  3KLI A;  3KLF A;  1SL1 A;  3K5L A;  2NUB A;  4DU3 A;  4ICL A;  3JSM A;  4EP5 A;  4UQG A;  3TAQ A;  1KLN A;  1HPZ A;  3RR7 A;  1DTQ A;  3LP3 A;  4FJH A;  2B6A A;  1UOC A;  4CF2 A;  4YNQ A;  1I39 A;  1J5O A;  2JGU A;  4KKO A;  1VK0 A;  1NJZ A;  1NK7 A;  4AHT A;  1A5V A;  1WAJ A;  1ASU A;  3E01 A;  4BWM A;  4CEC A;  4CHP A;  4FYD A;  1B9D A;  3WNH A;  3QNN A;  1Q9Y A;  4CFD A;  3VA3 A;  1WLJ A;  2YV0 X;  3DM2 A;  2LSN A;  4DU4 A;  2XY7 A;  1U49 A;  4B9N A;  4PQU A;  1A5W A;  2B5J A;  4CGH A;  3QNO A;  1KCF A;  5HLF A;  1CLQ A;  4C8N A;  1T05 A;  4FJI A;  1TAU A;  4DSE A;  3MXJ A;  1HNI A;  2E6L A;  4IFV A;  2D0B A;  3OYK A;  1D8Y A;  4KHN A;  4E7H A;  3SUQ A;  4ID5 A;  3LP0 A;  1NK6 A;  4GW6 A;  4M45 A;  4HCB A;  5FRO A;  3VQB A;  1NK5 A;  2RF2 A;  3P83 D;  1CXU A;  3RR8 A;  4RW4 A;  4C8O A;  3L2V A;  4N41 A;  3V1R A;  2KZZ A;  2IGI A;  4Z4G A;  3M8P A;  3HT3 A;  3S9H A;  4DS4 A;  4B8A B;  4W5N A;  1LWF A;  4FJM A;  1NKB A;  2PYL A;  3SI6 A;  3VQ7 A;  1X9M A;  3G10 A;  3QIO A;  5J2P A;  2OZS A;  3LAN A;  4I2Q A;  3V9X A;  4KHY A;  4I9L A;  2G8U A;  1HNV A;  1HQE A;  3F73 A;  5D3G A;  3KD5 E;  1VSI A;  1KVC A;  3DOL A;  3WNF A;  1O1W A;  1HYZ A;  4OGC A;  3MEG A;  1U4B A;  1SUQ A;  3HVR A;  3AO1 A;  4CCH A;  4M3Z A;  5FRM A;  1FK9 A;  1RTJ A;  2E4L A;  2X6S A;  3DRP A;  4HHT A;  4B9T A;  1IKV A;  4O4G A;  4CK1 A;  1TKZ A;  5HRR A;  2Y1J A;  3AVH A;  3QO9 A;  4RW8 A;  4Y1C A;  1YTA A;  3EZ5 A;  3TAB A;  4ZTF A;  3VQ5 A;  3OYF A;  2VG7 A;  3V81 A;  1U48 A;  5HRP A;  1SKS A;  2E6M A;  4CK2 A;  1RT4 A;  3LZJ A;  4DU1 A;  3TAN A;  3KTQ A;  4B08 A;  1J9A A;  4IG0 A;  1NK4 A;  3RRH A;  5KRS A;  3M8S A;  2X6N A;  4KHU A;  4CEA A;  3OS2 A;  4GMJ B;  1RTI A;  3AVM A;  4Y1D A;  1UA0 A;  1TL1 A;  2QK9 A;  4CER A;  1R0A A;  2G8F A;  3NFA A;  4KI6 A;  1ASV A;  2HND A;  4J2D A;  4CGG A;  3QEX A;  1JLF A;  3ZSY A;  1HYS A;  3V9U A;  1RBR A;  1TGO A;  5SWM A;  3MED A;  2G8V A;  4FK2 A;  1QTM A;  1XC9 A;  4NYN A;  4M41 A;  4FLY A;  2AJQ A;  5I42 A;  3CFO A;  4DTR A;  4KHQ A;  4M3X A;  2KFZ A;  1GOA A;  4M42 A;  4LH5 A;  1RNH A;  3NGZ A;  1SL0 A;  5C42 A;  3HP6 A;  4B9L A;  2HW3 A;  3KK1 A;  1IO2 A;  1WSE A;  1L5U A;  4J2B A;  3NH0 A;  3SQ4 A;  5CZ1 A;  4AHS A;  4Z4H A;  1VSD A;  3MAQ A;  3QEI A;  3SYZ A;  1IH7 A; 
#chains in the Genus database with same CATH topology
 2Z1H A;  3OVN A;  2W42 A;  1J5E K;  5BRE A;  1KLM A;  1RT2 A;  4RCH A;  1L3V A;  3DLH A;  2FC0 A;  4CIE A;  4LSN A;  2HBK A;  4KHW A;  1SZ2 A;  2Q0R A;  4B3O A;  4I6M A;  4E7K A;  1T44 A;  1QSL A;  4BG9 A;  4DTN A;  3T1H K;  2P9K A;  3FFI A;  2YNH A;  3L2Q A;  1XNQ K;  1TAQ A;  5CHI A;  1U04 A;  4K43 A;  5C15 A;  3K5M A;  3OYI A;  3O9T A;  2OPP A;  3VGM A;  4BR0 A;  1NGG A;  1JCF A;  3CIP A;  4H5V A;  3DLL L;  2O8C B;  4FJ7 A;  5FLX O;  5AZJ B;  2ITM A;  3AA3 A;  4DMN A;  2XRI A;  2IVP A;  1YXQ A;  4IG3 A;  1YI2 N;  2JWK A;  3PLA A;  3MN7 A;  1Q81 O;  3L0Q A;  1KVA A;  4FL9 A;  4B1X B;  4DR3 K;  5AZJ A;  4GV6 A;  3BGR A;  1OH7 A;  2GEL A;  2F9T A;  2F96 A;  3E66 A;  3L6Q A;  3J81 O;  4IO9 L;  4AHV A;  4A61 A;  1KAZ A;  4FW1 A;  4GV9 A;  3E1Y A;  3T3F A;  2GBZ A;  3AVJ A;  2FBX A;  3U6F A;  3KK3 A;  3OYM A;  3O3F A;  1KFS A;  3WT0 A;  3C7N A;  1NJY A;  3LDN A;  3QFU A;  4FLX A;  1L3U A;  3ATV A;  3NMU A;  2P9I A;  4KTZ A;  3JS6 A;  3WUH A;  3LL3 A;  3CJB A;  4PY5 A;  2FF3 B;  3OYD A;  1RDB A;  4H4M A;  3AVN A;  4MLH A;  4YOX A;  1QZ6 A;  3SNN A;  3B8A X;  4E3S A;  3HZ6 A;  5CYM A;  3NGY A;  1XC3 A;  4BR9 A;  1VSL A;  2YKM A;  5AQW A;  4CHN A;  4M3U A;  4CVN E;  2ZE2 A;  4CHO A;  3I55 N;  4Z4E A;  3QBX A;  4JI7 K;  3BY5 A;  3T19 A;  3MXI A;  1VRU A;  2KKZ A;  4B1W B;  4G1Q A;  5E26 A;  3DXK A;  4KHS A;  4PKI A;  4DQS A;  3TTF A;  2D5R A;  4JI2 K;  2G8K A;  1MWM A;  5C10 A;  1QVG M;  2E2Q A;  3DXM A;  3G4S N;  2D0C A;  1JL2 A;  4FZY A;  4ILG B;  1NOZ A;  2NZT A;  4FJN A;  1YTU A;  4AHC A;  1RT5 A;  5AQI A;  5HL7 L;  2HHV A;  2PZS A;  4MO5 A;  4MLE A;  4LH4 A;  3UE5 A;  4X66 K;  2WUS A;  4DV6 K;  4RW7 A;  1HRH A;  2YJE A;  2WTU A;  5KPZ A;  4B8C A;  4IEI A;  3QIP A;  4JYA K;  1C0G A;  4OJR A;  3RMD A;  3CC4 N;  1RDU A;  2V51 B;  2XY8 A;  5IWA K;  4I6M B;  1HLU A;  3I0R A;  3QEW A;  4NCB A;  4LF9 K;  1DLO A;  3ZET B;  1XHZ A;  4CGD A;  1BA0 A;  2QXL A;  3VET A;  3ZX2 A;  5AQU A;  4H5T A;  3OS1 A;  3VTH A;  4C8L A;  3V9W A;  3P38 A;  4KH4 A;  2Q36 A;  3SCX A;  5LJV A;  4HCC A;  1IBM K;  5AQQ A;  2A1R A;  3UKR A;  3LWL A;  1L3T A;  1KVB A;  3O9R A;  1SAZ A;  3SMP A;  1WSG A;  3F9M A;  1U2V A;  4OPA A;  3PO5 A;  3O9S A;  2KFN A;  4O8K A;  2GTD A;  4BE0 A;  1WSF A;  3WNG A;  4C8K A;  4DSJ A;  4IBN A;  4FPA A;  4CF9 A;  4CIG A;  3QML A;  4WFN L;  1W2B M;  5JVH L;  3JAM O;  1RDA A;  2HHU A;  3O1W A;  4M3Y A;  1VSE A;  5C2D A;  3UIQ A;  2HVI A;  3K58 A;  4CJ3 A;  3MX2 A;  4DFM A;  1ESV A;  2O8C A;  1Q86 O;  1DTT A;  1WSJ A;  1R59 O;  3LDS A;  5JS2 A;  3V9S A;  1TKT A;  4CEQ A;  1RIL A;  3WXJ A;  3L8B A;  3TAE A;  1NKE A;  3VEW A;  3K59 A;  4G9Z A;  1WN7 A;  3IUC A;  1IBK K;  4NLB A;  3S3N A;  1W0H A;  4WQ5 C;  2V52 B;  4BRF A;  4X64 K;  4JI6 K;  2XY5 A;  2DFE A;  3Q7C A;  3SAF A;  1G15 A;  2OZM A;  1RGI A;  2A40 A;  3ZSQ A;  4YY3 K;  1NGH A;  2UUC K;  4FJ5 A;  5E84 A;  3OYC A;  2NRT A;  4FVM A;  2YJF A;  3FFK B;  4JI4 K;  1NBW A;  4IZ9 A;  3ZT2 A;  4I9Q A;  2FBT A;  4IWV A;  3VQ4 A;  4JRQ A;  2RE2 A;  5M1N A;  1RDC A;  1LV5 A;  1EXQ A;  1NKC A;  5HRO A;  3JXU A;  3QDK A;  5M1K A;  1TUY A;  2HB5 A;  4JD2 B;  3RVC A;  1BIZ A;  4IDK A;  2HF4 A;  2QWN A;  4FWM A;  2PYJ A;  4C23 A;  4ZTJ A;  3L2W A;  1X1P A;  5MLC Q;  3NH1 A;  4RTF D;  3CFR A;  3I8D A;  1ZXO A;  3DLE A;  4JD2 A;  4AM7 A;  3H45 C;  5C25 A;  5FDL A;  5H1S Q;  1TL3 A;  1JL1 A;  4E19 A;  1X9W A;  5J2M A;  2ZGY A;  2OPR A;  4HUF A;  3CME N;  3P31 A;  3HI0 A;  3CCV N;  4BRK A;  2D1K A;  4QCL A;  2ASM A;  4DFP A;  3VQ9 A;  2WC9 A;  4ZHR A;  3FZH A;  4F8R A;  2E1Y A;  1VQM N;  4CIF A;  3HPG A;  2P9N A;  4A2B A;  3ULD A;  3L3U A;  1BI4 B;  4OKJ A;  3CCM N;  2HHW A;  1RT6 A;  2OTJ N;  5SZT A;  3I0S A;  4BC4 A;  2G8W A;  4H4O A;  4BR2 A;  2HVH A;  4CZE A;  4EZ6 A;  3S3O A;  5K14 A;  1IV0 A;  5JVG L;  1LW0 A;  2QTD A;  1WOQ A;  3S3M A;  3KLI A;  4DHY A;  1SL1 A;  2QW9 A;  4CZL A;  5GAD P;  4DU3 A;  4IXC A;  3UKR B;  1JCE A;  1DTQ A;  3LP3 A;  1RDW X;  4LFA K;  3BP8 A;  1EWQ A;  3TTD A;  4R79 A;  1NJZ A;  4AHT A;  4CEC A;  1ASU A;  4FYD A;  4CHP A;  1LCU A;  1Q9Y A;  4CFD A;  2YV0 X;  4PQU A;  3EE8 A;  4DU4 A;  3OBY A;  4FWN A;  4FJI A;  4WFB L;  3EKU A;  2NRH A;  4IFV A;  3DWL A;  4DV4 K;  3OYK A;  1D8Y A;  1QQM A;  1NK5 A;  2AA4 A;  4C8O A;  4JI5 K;  3L2V A;  1IG8 A;  4FWQ A;  4BC5 A;  2F4V K;  3M8P A;  3S9H A;  1GLE G;  4CI6 A;  1X9M A;  5AQZ A;  1BO5 O;  4I2Q A;  1VQN N;  1HQE A;  1H1V A;  3KD5 E;  1VSI A;  4OGC A;  1HYZ A;  2E1Z A;  1SUQ A;  4BQL A;  3AY9 A;  4Z4G A;  1FK9 A;  4HHT A;  4H5N A;  3TAB A;  1Z05 A;  3I33 A;  3VQ5 A;  4CJ7 A;  1SKS A;  2E6M A;  4CK2 A;  4GKK K;  1RT4 A;  3O9U A;  3LZJ A;  4DU1 A;  3ENH A;  1NK4 A;  5KRS A;  2X6N A;  4CEA A;  3IFR A;  4GMJ B;  1TUU A;  2A41 A;  4DV1 K;  1HNZ K;  1E3M A;  3O1B A;  3QB0 A;  1ASV A;  3ZSY A;  2VCP A;  1QTM A;  4FLY A;  4K42 A;  3U8X A;  3FR0 A;  1SL0 A;  1VQ7 N;  3KK1 A;  1IO2 A;  3K9J A;  4J2B A;  3NH0 A;  3ID6 A;  4AHS A;  2DPN A;  2WFB A;  4V19 S;  3SJH A;  5KPR A;  3MAQ A;  3M5R A;  4DV2 K;  1I94 K;  1S22 A;  4U7B A;  1WSI A;  3P4I A;  4BVO A;  4EIA A;  5BRD A;  1N32 K;  2HHQ A;  3KLH A;  1E4G T;  4FW2 A;  4CGF A;  3O08 A;  2YHW A;  4FM1 A;  1K8K A;  3T7Z A;  3HVT A;  4DTM A;  3QEV A;  3IKM A;  3WXL A;  4DTX A;  3THW B;  1KTQ A;  4RWT A;  2FSJ A;  2OPQ A;  4JKG A;  3LDP A;  3PSI A;  3R9P A;  4JK8 A;  3H1V X;  3SUO A;  1VQO N;  1XI1 A;  4XH5 A;  3OYL A;  1JLG A;  4DF8 A;  3SQ1 A;  2P9P A;  4CE9 A;  2CH6 A;  4A5A A;  1KFD A;  4YDU A;  1DKG D;  2ASP A;  4E89 A;  3VF6 A;  3DRR A;  3VA0 A;  4JEP A;  3IS9 A;  5E41 A;  2BGG A;  3AVC A;  4DF4 A;  4O0J A;  2GX9 A;  2VWB A;  4KTQ A;  1CZA N;  1RCH A;  3O4Q A;  4BRE A;  1EP4 A;  1VSJ A;  4H8K A;  2ZM6 K;  4CHQ A;  3F5T A;  4KO0 A;  4JK9 A;  1NK9 A;  2BUP A;  2P9L B;  3FGU A;  3EEQ A;  1BHL A;  1UWB A;  5T7B A;  2PY5 A;  4CEB A;  2QKB A;  5AFU H;  4H0Y B;  5LJW A;  3QEP A;  3KHY A;  3D0P A;  2FSN A;  1ZYQ A;  4CJL A;  3VES A;  3SPY A;  4FWL A;  1P90 A;  4WQ4 A;  1C0T A;  3HSC A;  4DR1 K;  4HUE A;  4N5S A;  4CGI A;  2Q2R A;  2D4W A;  3H6E A;  4KB1 A;  1U45 A;  3G0Z A;  1NK8 A;  1W9H A;  2QWR A;  5CYQ A;  4AHR A;  1HMV A;  3MK6 A;  3O3G A;  3UKU B;  4HUG A;  3ULE A;  1VSF A;  5F1X A;  1GLF O;  2EX3 A;  3DYA A;  5DK5 A;  1GLJ O;  4KBO A;  3THY B;  5AR0 A;  3ULE B;  5AQS A;  1EET A;  1LWC A;  3ZX3 A;  4CES A;  2R7Y A;  2D0P A;  1J6Z A;  2KQ2 A;  4YOV A;  4BAC A;  4KH5 A;  1LAW A;  1OH6 A;  1FKP A;  1L3S A;  4H5W A;  2FF6 A;  3PO4 A;  3EY1 A;  1BWF O;  2O4I A;  5I9E B;  3AVG A;  1YVN A;  1IKW A;  1RBT A;  2A1S A;  5EVZ A;  3TR8 A;  3PIP L;  4WYB A;  1TYQ A;  4QS9 A;  3SMS A;  4JKD A;  5KRT A;  1ZBL A;  5KTQ A;  4FK0 A;  4B9U A;  5D3G A;  3O6W A;  2IVO A;  1UA1 A;  4JV5 K;  4DG1 A;  1RT3 A;  2KLA A;  1S3X A;  4CED A;  4WQ5 A;  1S6Q A;  1CZ9 A;  3UB5 A;  3I8B A;  3OJS A;  4KI4 A;  2O8F B;  2GV9 A;  3IMX A;  1N6Q A;  3AGK A;  3RMA A;  3H46 O;  2KHO A;  3CYM A;  3VQE A;  2D0O A;  2QI2 A;  2ZD1 A;  5HBM A;  3C6T A;  2HMI A;  3SLC A;  4DLG A;  4J2A A;  4DSI A;  1WB9 A;  4YOU A;  5HRN A;  3QIC A;  1ZBU A;  3C6A A;  4JNE A;  2XHB A;  4CFC A;  4BC2 A;  4EAH D;  1Q18 A;  3LP2 A;  2ZGZ A;  5AQN A;  1TKD A;  2DTU A;  4CJT A;  3NVM A;  4HTL A;  5FPD A;  3PX6 A;  1BCM A;  2OTL N;  4CF0 A;  5HRS A;  4BVP A;  2W41 A;  2V7Z A;  3M8Q A;  3THW A;  4OPK A;  1BG3 A;  4KTW A;  4PL8 A;  4F3O A;  3VGL A;  4KAZ A;  1WNS A;  2Q1N A;  3EL2 A;  1BA1 A;  1Z6R A;  1C0M A;  4CEZ A;  4CFA A;  3GE1 A;  4FK4 A;  4YOY A;  3AO5 A;  3SQ2 A;  4CZK A;  3KK7 A;  2F9W A;  1K6Y A;  3A5M C;  5AQM A;  4O44 A;  2E8A A;  3ASM A;  1RBV A;  3DOK A;  1BCO A;  1BL3 A;  1BQM A;  3NAE A;  2A5X A;  3ZSZ A;  1ZBH A;  4K0K K;  1A5X A;  2UU9 K;  4FLW A;  4OLB A;  3J8A A;  3LP1 A;  1HQU A;  2X78 A;  1D9F A;  3VN5 A;  4BDY A;  1JJ2 M;  3LWM A;  3OW2 M;  4ELU A;  4E1M A;  1NGI A;  3LAK A;  2F8S A;  1Y97 A;  1VSH A;  3FZK A;  1YJ9 N;  4CJ5 A;  3IAY A;  3OHR A;  2X74 A;  2UXD K;  1GOC A;  1HX1 A;  3K5O A;  1RDD A;  3SAG A;  5GIO A;  2NRZ A;  1VQP N;  3ALY A;  1SL2 A;  4Z4C A;  1VQK N;  4E7J A;  3MWP A;  4Z0U A;  3PX4 A;  2RHK A;  1S1W A;  3VQ8 A;  5CR4 A;  4CJR A;  3AA4 A;  1RFQ A;  5EU7 A;  3C94 A;  3VEY A;  4DQP A;  4HWI A;  4IKF A;  2OYQ A;  1NJI O;  1NMD A;  3PV8 A;  4DTO A;  3T1Y K;  4AF1 A;  4QS7 A;  4CJW A;  3CQY A;  1LWE A;  4BDZ A;  4WFA L;  3TAG A;  5BPN A;  4JKE A;  1KRP A;  3GBT A;  2VWJ A;  3E9L A;  3JYT A;  3GDQ A;  3TSU A;  3OYB A;  4B1V A;  2E20 A;  4CBX A;  3WEE A;  3ZET A;  1TK0 A;  1D9D A;  3A5L C;  3KIO A;  4CHZ A;  4CZH A;  2VG6 A;  4CJV A;  2YNI A;  4Z94 A;  5AQT A;  3CF5 L;  2G8H A;  3DLK A;  4W5Q A;  3ZYY X;  3QES A;  2VQE K;  4DSK A;  4IO8 A;  3AO3 A;  3AAP A;  3TPQ A;  3VMF B;  4L3Q A;  3SK3 A;  4F9O A;  1GLB G;  1QZ5 A;  3AA2 A;  2OPS A;  1N33 K;  3BUZ B;  4DWI A;  5BR9 A;  4ELV A;  2CGL A;  1TVR A;  5BRH A;  3P1G A;  3CM6 A;  1QS4 A;  4CZG A;  1XQS C;  3JSM A;  2IIR A;  2ZWH A;  4UQG A;  4JKF A;  5EOY A;  3M6G A;  4FJH A;  2B6A A;  1UOC A;  2JGU A;  1NMN A;  5EX5 A;  4KKO A;  5AQR A;  2O8E B;  5M1O A;  1WAJ A;  3E01 A;  3H3O B;  1B9D A;  3WNH A;  4BRL A;  1WLJ A;  3SBG A;  4FWR A;  4B9N A;  2B5J A;  4CGH A;  3QNO A;  5HLF A;  1K8A O;  2P9S B;  1CLQ A;  4C8N A;  3MXJ A;  4NLC A;  3G25 A;  4E7H A;  3SUQ A;  3LP0 A;  1NK6 A;  4GW6 A;  2RF2 A;  3RR8 A;  1N34 K;  4N41 A;  3HBT A;  3HT3 A;  4B8A B;  1LWF A;  1NKB A;  2PYL A;  5GAE P;  3QIO A;  5J2P A;  3A5O C;  3P39 A;  4I9L A;  3F73 A;  1KVC A;  1NGF A;  1O1W A;  1U4B A;  5FRM A;  1RTJ A;  3WXK A;  1YJN N;  4B3M K;  1TKZ A;  2Y1J A;  5GIN A;  3AVH A;  4Y1C A;  4BR4 A;  3EZ5 A;  1NU0 A;  4BRC A;  4YOT A;  3OYF A;  2VG7 A;  5HRP A;  1NM1 A;  4PKH A;  4DR6 K;  1P8Z A;  3KTQ A;  2UXB K;  3WQU A;  4B08 A;  3W0L A;  3M8S A;  4KHU A;  3AVM A;  4H0T B;  4Y1D A;  1TL1 A;  3MN5 A;  1K9M O;  4CER A;  1R0A A;  3NFA A;  2FLO A;  4J2D A;  1VQ9 N;  1V4T A;  2CGJ A;  5SWM A;  2V7Y A;  3MED A;  5I42 A;  3CFO A;  2KFZ A;  1RNH A;  4B9L A;  2HW3 A;  4JI3 K;  4LC9 B;  2UXC K;  1L5U A;  1QQO A;  3SQ4 A;  4CBW A;  2ZF5 O;  5ADX H;  4H0X B;  3QEI A;  4ILH A;  3K9K A;  1ATR A;  4FWK A;  1IH7 A;  3QNN A;  3NVK A;  4JKC A;  3KKS A;  2DFF A;  2IAJ A;  3RTV A;  5AFU A;  4FJ9 A;  1I3A A;  3VQA A;  3L2R A;  2BAN A;  4DFK A;  2HHX A;  2DY4 A;  3R6M A;  4NXM K;  2E2N A;  3VOV A;  3G71 N;  1VSM A;  1BUP A;  4JAX A;  4B1Z A;  4CJP A;  2XY6 A;  3VEO A;  1BQN A;  2JLE A;  3DLG A;  3CFP A;  4NB4 A;  3NGI A;  1U6Z A;  2HF3 A;  3M3Z A;  3EE9 A;  4GVE A;  3CQ8 A;  1D4X A;  5EXW A;  4FLV A;  3DLR A;  3L4I A;  5FPN A;  4JLH A;  3CMA N;  4B3T K;  2Q97 A;  4CZF A;  2Z1I A;  1JLB A;  4DLE A;  3TAF A;  4KRE A;  3MWT A;  4OKK A;  4NCA A;  4PHT X;  1HKB A;  2IDO A;  3MXM A;  1EKE A;  1SV5 A;  3A2F A;  1U2V B;  1LOT B;  3V1Q A;  2FSK A;  1EX4 A;  2G8I A;  3HOS A;  4CD3 A;  3CCQ N;  3C6H A;  4Z4I A;  5J2N A;  1YIT N;  4PUO A;  1ATS A;  1T03 A;  3O5B A;  4DFJ A;  3CXC M;  4C1N K;  3CC2 N;  4BRP A;  1VQ6 N;  5AQP A;  4JKA A;  4JS5 A;  3GL1 A;  2OCE A;  1XHX A;  1QHT A;  3NHG A;  4BY9 C;  5AQO A;  2BTF A;  2BDP A;  3OS0 A;  3HM9 A;  1QSS A;  3BF3 A;  2HBJ A;  4M7Y A;  1YVU A;  3OJU A;  3PUF A;  3GG4 A;  4DSF A;  2HOE A;  2VWK A;  1RTD A;  5HP1 A;  3HP9 A;  5JS1 A;  3MN9 A;  1QHA A;  5LMN K;  4CW7 B;  2QKK A;  1NJX A;  4B9V A;  1S1U A;  2GWJ A;  1S1T A;  2QM1 A;  3K57 A;  3OBW A;  3SV4 A;  2KW4 A;  2H3G X;  3H08 A;  4CJF A;  3SZ2 A;  3O80 A;  3MX5 A;  5JMV A;  3HO1 A;  4DSL A;  2P9S A;  4Z4F A;  1TKX A;  2P9I B;  4H0V B;  4DUZ K;  3O8M A;  1OH8 A;  3ZT4 A;  5CE3 A;  4FWO A;  1W97 L;  4HVJ A;  5AQK A;  3HK2 A;  1HKC A;  3AVF A;  3DXK B;  4EHT A;  4BRG A;  4B9Q A;  1VSK A;  2RPI A;  2EHG A;  5M1Q A;  3CCU N;  3QIN A;  4W5T A;  3V4I A;  2P1J A;  4DR5 K;  3P5J A;  2A6A A;  4CEO A;  4FOI A;  4JI0 K;  2IC3 A;  4ILJ A;  5KGW A;  3U9D A;  3D2E B;  2WOM A;  4K25 A;  1WAF A;  2VYP A;  3N4P A;  1FJG K;  1BI4 A;  3CG7 A;  4F4K A;  2JWL A;  4ID1 A;  1HUX A;  1OVY A;  1YUW A;  4E7L A;  4OX9 K;  1M90 O;  2NRW A;  1HNX K;  4JKG B;  1ZBI A;  2FBY A;  3AO2 A;  1WUA A;  1XUP O;  4AHU A;  2YHB A;  4ISF A;  4DS5 A;  1NOY A;  3AVA A;  3V9Z A;  4O0I A;  2Y1I A;  3KD1 E;  3LPT A;  1S1X A;  3ZSX A;  1REV A;  3FZM A;  4B9S A;  1JLQ A;  1MA9 B;  1QSY A;  3TWH A;  4O55 A;  3KWG A;  1NGE A;  5BPL A;  4WQ4 C;  2KZZ A;  5FRN A;  1ITG A;  5BR8 K;  3EN9 A;  5EY4 A;  1J53 A;  3TI0 A;  4W5R A;  1ZBS A;  3VF2 A;  4A59 A;  2O8D A;  5C12 A;  3O4N A;  1RBU A;  3THV A;  4XEI A;  4KH6 A;  3KWI A;  5F0X A;  3NDK A;  3D6R A;  4IJN A;  3MCP A;  4FJK A;  1DGK N;  2O8B A;  4BRM A;  3HPO A;  4A62 A;  1NK0 A;  3FE1 A;  2CGK A;  3VQD A;  4C1N I;  2RKI A;  1SKW A;  4XIU A;  2AP1 A;  1KC8 O;  1N5Y A;  2P9K B;  1RTH A;  4AH9 A;  1F21 A;  1QQC A;  3R8E A;  4MFB A;  4BWJ A;  4JS4 A;  3VEZ A;  2O4G A;  4MO4 A;  1C6V A;  4H0P A;  3UKU A;  1RBS A;  4LFC K;  4GV3 A;  3NH2 A;  1KSP A;  3VEV A;  2PBD A;  3KLG A;  4K8Z A;  1OH5 A;  1JCG A;  2O8E A;  5KGX A;  1IG9 A;  2QWO A;  1ATN A;  1SKR A;  4FJL A;  3CHW A;  4ELT A;  4FLT A;  3N4Q A;  3SQ0 A;  4BR7 A;  4E0D A;  2P5G A;  2VGN A;  4AM6 A;  5J1E A;  4K8X A;  4CJU A;  3AVK A;  4QAG A;  1FKO A;  3F9K A;  2W6K A;  5DMR A;  1SQK A;  2VQF K;  4MQ3 A;  4FOE A;  4AIL C;  2QWL A;  2QWQ A;  3OA9 A;  5LL6 Z;  3SBT A;  1S1V A;  2XO7 A;  2YNG A;  1M1K O;  2YX6 A;  4LD0 A;  4CD1 A;  3MN6 A;  1V4S A;  3CCR N;  4CJ4 A;  4PA1 A;  1Q9X A;  1TYQ B;  3CPE A;  1W7A A;  1QVF M;  1YT3 A;  1TK5 A;  1NGJ A;  4WCE L;  3KVG A;  2Q3S A;  3D2E A;  4CHY A;  3AA5 X;  4B1U B;  3C6U A;  3ITH A;  1C1A A;  3VPZ A;  4U67 L;  3OYG A;  2WON A;  2F8T A;  3A8Y A;  4CBU A;  3CCS N;  4EHU A;  4FLU A;  3D45 A;  4LF4 K;  4HTU A;  4I2P A;  5AQY A;  4PL7 A;  4B9M A;  4B3S K;  4A5B A;  2W6L A;  3EZW A;  4EP4 A;  1OKJ A;  2ZJP L;  1YHQ N;  3ZSW A;  2E5L K;  3CJ1 A;  1K73 O;  5I3U A;  4ISG A;  1T8E A;  2P9L A;  4BRO A;  4KB0 A;  3ZT1 A;  1GLC G;  4LF7 K;  1XWL A;  3V1O A;  1HKG A;  5JLF A;  4A57 A;  3VQ6 A;  3LAM A;  2NRX A;  3CQX A;  4RW6 A;  4CF8 A;  4JI1 K;  3RMB A;  2KTQ A;  1KXP A;  4OO1 J;  5DM7 L;  1S72 N;  4BDP A;  3AV9 A;  2P9U B;  4FJJ A;  4NXN K;  3C95 A;  1T6C A;  4A2A A;  3BF1 A;  4DV5 K;  4J8F A;  4EP5 A;  2ZJR L;  1KAX A;  3TAQ A;  1KLN A;  1HPZ A;  3RSE A;  3RR7 A;  3VEN A;  3U9Z A;  2UUB K;  1J5O A;  2P9U A;  3TSP A;  1VK0 A;  1A5V A;  3VA3 A;  4JI8 K;  2O8D B;  3DM2 A;  2LSN A;  1E4F T;  1U49 A;  3HM8 A;  2UYT A;  1TAU A;  1HR0 K;  1DEJ A;  4BRH A;  1ZC6 A;  3CJA A;  4KHN A;  2WBN A;  2YCH A;  5A2Q O;  2O8B B;  4HCB A;  1XNR K;  3VQB A;  3THY A;  4RW4 A;  1X3N A;  4DUY K;  4DS4 A;  1NLV A;  4IJA A;  4W5N A;  3EO3 A;  4FJM A;  3MCA B;  5AZI A;  3LAN A;  3CC7 N;  1MWK A;  3V9X A;  3FZL A;  2G8U A;  1HNV A;  3DOL A;  3WNF A;  5LY3 A;  1HJO A;  3AO1 A;  4CCH A;  4M3Z A;  4B9T A;  4BC3 A;  4O4G A;  2HBL A;  2NRR A;  4CK1 A;  4ZTF A;  1Y64 A;  3E9O A;  3QO9 A;  4RW8 A;  1VQL N;  3C7N B;  1U48 A;  1NNE A;  4BRD A;  4GY2 B;  2HHT A;  2HST A;  1J9A A;  4IG0 A;  3AAQ A;  1MDU B;  5ELZ A;  3OS2 A;  1RTI A;  1UA0 A;  3QFP A;  4KI6 A;  4CGG A;  3V9U A;  1TGO A;  4LF6 K;  2NRV A;  4NYN A;  5GAH P;  2AJQ A;  2OAN A;  4DTR A;  1DT9 A;  4LH5 A;  3NGZ A;  3GOI A;  5C42 A;  4BG8 A;  5M1F A;  3M1F A;  5CZ1 A;  4DCH A;  3PIO L;  4JKB A;  4Z4H A;  3K0S A;  1X9J A;  2ASO A;  1K8K B;  5AJ3 K;  3DJC A;  4FSV A;  4L8R B;  4KV8 A;  3LDO A;  1NGC A;  4YHH K;  4M63 C;  2P5O A;  1IKX A;  3LM9 A;  1ZBF A;  4Y0W A;  4E7I A;  5JLH A;  1VQ4 N;  1JXB A;  2O8F A;  3O4W A;  4CEE A;  2I5J A;  3PY8 A;  4GKJ K;  5C24 A;  1X3M A;  5JIC A;  1NGB A;  4N56 A;  3VEX A;  1T6D A;  3OYE A;  5BN9 A;  5FPM A;  2IS3 A;  3KJV A;  4FZZ A;  3WQT A;  4OVL A;  4EZ9 A;  1Z25 A;  4LY7 A;  4AQY K;  2I7N A;  1HNW K;  5F2R A;  1WBB A;  2I7P A;  4I7F A;  1FXX A;  2BH1 A;  4FWP A;  5KQD A;  4FXD A;  3ZT0 A;  3HXM A;  3U3G A;  3VTI A;  4CJE A;  2A3Z A;  4FJ8 A;  4CK3 A;  2RN2 A;  3ZCM A;  3LDL A;  5AQG A;  2YHY A;  3CJC A;  5AQV A;  3VGK A;  2BE2 A;  2VG5 A;  3NE6 A;  1CXQ A;  4LF8 K;  3DMJ A;  4N76 A;  4DQR A;  1BOT O;  3RSE B;  4CZI A;  3QET A;  4FPB A;  5AQX A;  4BR5 A;  2CH5 A;  1BGX T;  2YHX A;  3E9P A;  2P9N B;  3SUN A;  3ZSR A;  4OLA A;  3ZLJ A;  1NGA A;  3S41 A;  2YKN A;  4R5P A;  2HNZ A;  3NCI A;  3G6E N;  3TSQ A;  1VQ5 N;  3VQQ A;  4M3T A;  3CCL N;  3LZI A;  4M3R A;  4YOR A;  4BGA A;  1QE1 A;  4LSL A;  1S9E A;  2NNW A;  3L3V A;  3HL8 A;  4PWD A;  5GAG P;  3SJJ A;  2PAV A;  3ATU A;  4FCY A;  2Q0U A;  4N47 A;  1G99 A;  2HMP A;  4CF1 A;  3CCE N;  4FZX C;  3ID8 A;  5BN8 A;  4O5F A;  3D2F A;  1C1C A;  5CZ2 A;  4DQI A;  4JHD A;  1JLA A;  4IEE A;  1HJR A;  2ATQ A;  4OGE A;  5GIP A;  2ITG A;  4DB3 A;  1WSH A;  2HNY A;  3HPH A;  4YDU C;  3U3Y A;  1T3V A;  1JLC A;  1VQ8 N;  5IT9 O;  4CEF A;  3D2F B;  3MEE A;  4JHD B;  3C0B A;  1YJW N;  5C0Y A;  1YIJ N;  3O3H A;  3WEE B;  2A42 A;  3DRS A;  3KKR A;  3M8R A;  3A5N C;  4UY8 O;  4DV0 K;  4MDB A;  3CI5 A;  3B6O A;  4BE2 A;  4DTP A;  3IRX A;  3J80 O;  3PSF A;  3AO4 A;  3DLB A;  3EYZ A;  4KHP K;  4BRN A;  3LAL A;  3R1X A;  4JK7 A;  3ISN C;  1KAY A;  2IOC A;  4DTS A;  4F2S A;  3DI6 A;  1IKY A;  4H5R A;  4C8M A;  4NYF A;  1EQY A;  1S5J A;  3CER A;  3TTC A;  1IBL K;  4PKG A;  3KZB A;  4FWS A;  4CJQ A;  3OYA A;  3KK2 A;  5BRF A;  3IG1 A;  3RRG A;  3NF8 A;  1O13 A;  3AVI A;  2ETJ A;  1Q8I A;  1VAZ A;  5DM6 L;  3ZSV A;  2EWS A;  4O5B A;  3B6P A;  3L4Q A;  3LM2 A;  4CZJ A;  2P51 A;  3WXI A;  2YHA A;  3ZEU B;  2VGM A;  5KPT A;  2E2O A;  3CET A;  4J2E A;  2FXU A;  4M3W A;  3H3N O;  1NJW A;  4NO7 A;  3D7E O;  2NLX A;  3FLC O;  3HST B;  3RWU A;  2DFH A;  3SPZ A;  1JXE A;  4CFB A;  2ZJQ L;  3AVB A;  1NG9 A;  4M7X A;  1XMO K;  1ILY A;  4FJX A;  3T1A A;  3ZEU A;  1CZB A;  1KD1 O;  4CJS A;  3J7Z O;  3THX A;  1HPM A;  3RMC A;  2GUI A;  2YI1 A;  1BIU A;  2UUA K;  4JRP A;  3ZSO A;  1LW2 A;  3MDQ A;  2QEX N;  2PFU A;  4XH4 A;  4YOW A;  4F3T A;  1OVQ A;  5M1P A;  4DKW A;  5B8H A;  3THX B;  4IOA L;  5KI6 A;  5LMU K;  3NBP A;  1Q82 O;  4TSX A;  3OY9 A;  3J7A P;  3V6D A;  3TAM A;  1T7P A;  1LAV A;  4E1N A;  1NGD A;  3L2U A;  1TV6 A;  4ISE A;  3BDP A;  4IDH A;  4H0O A;  4DTU A;  2E88 A;  4DQQ A;  4CZM A;  2P9P B;  3CCJ N;  4WE1 A;  3DAW A;  1C0U A;  3AGR A;  3HTV A;  3QBW A;  3R3L A;  4W5O A;  3KLE A;  4BRA A;  1X9S A;  4OKE A;  5FPE A;  2HHH K;  5J2Q A;  4DR7 K;  3HRG A;  4OPH A;  4FJG A;  3BZC A;  1C1B A;  2ZQB A;  2GEM A;  1U47 A;  4IFY A;  2F7T A;  5AQL A;  4E1J A;  3T69 A;  2J4R A;  2KZM A;  5TKY A;  4H03 B;  4B1Y B;  1N36 K;  3IDH A;  4BRI A;  3OYN A;  3EKS A;  3VF4 A;  4YFU A;  2E2P A;  3TAP A;  1RT7 A;  3J7Y P;  4Q0B A;  3HJF A;  5BPM A;  3VQC A;  2IVN A;  3SAH A;  1JKH A;  4O8U A;  1VRT A;  1EWR A;  2QXF A;  4QS8 A;  5AZI B;  1C0F A;  4DV7 K;  1GOB A;  4NCG A;  1GLA G;  3OTO K;  3SV3 A;  3MEC A;  2HBM A;  2Z1G A;  2GWK A;  2YNF A;  3WNE A;  4BE1 A;  4BQZ A;  1EO1 A;  1Z26 A;  2W40 A;  1Q7Y O;  4CGJ A;  4RW9 A;  3PX0 A;  2B4J A;  2FBV A;  3SUP A;  1KQS M;  1TK8 A;  1B9F A;  3ENB A;  4OPJ A;  1S6P A;  5CY4 A;  2QWM A;  4GVM A;  2D0A A;  1J54 A;  4KFB A;  3HYF A;  3AAR A;  3MMV A;  1WBD A;  1B92 A;  3QER A;  3NF6 A;  1ASW A;  5AQH A;  1D5A A;  2QA4 N;  4BGB A;  2Z1J A;  1UAX A;  3O9Q A;  5AQF A;  4Q5V A;  4DQ8 A;  4IOC L;  3ENO A;  4JKH A;  1RT1 A;  4KRF A;  4QOZ B;  2OA8 A;  3K5N A;  1QQN A;  3NF9 A;  1FW6 A;  3AVL A;  1BIS A;  4FM0 A;  5TKW A;  4DTJ A;  3VER A;  4RG8 A;  1MU2 A;  4F2R A;  1GLL O;  2HHS A;  4X65 K;  4BRQ A;  4FLZ A;  4K41 A;  4IOX A;  4CJK A;  2QWP A;  4KPY A;  1SS6 A;  3C65 A;  3OYH A;  3QLH A;  3ZT3 A;  3LPU A;  4FM2 A;  3NF7 A;  4WF9 L;  4XH1 A;  1JLE A;  3CM5 A;  4EFH A;  4JN4 A;  1S9G A;  3F2K A;  3TAR A;  1HYV A;  3VQP A;  3K2P A;  3KLF A;  3K5L A;  2NUB A;  4ICL A;  1GLD G;  2GUP A;  1BU6 O;  4YNQ A;  4CF2 A;  1I39 A;  5AQJ A;  5KQ8 A;  3CJ9 A;  1NK7 A;  4BWM A;  1NWK A;  3Q7B A;  2XY7 A;  1VHX A;  4FVU A;  1A5W A;  4LFB K;  1KCF A;  1BDG A;  1T05 A;  4DR2 K;  3LDQ A;  4LF5 K;  4DSE A;  1HNI A;  2E6L A;  4GNI A;  3BZK A;  2D0B A;  3BEX A;  4ID5 A;  4M45 A;  5FRO A;  3WXM B;  3TU5 A;  3P83 D;  1CXU A;  3V1R A;  4B3R K;  1YAG A;  2IGI A;  1IJJ A;  1N8R O;  3W3D A;  3SI6 A;  3VQ7 A;  3G10 A;  2OZS A;  4KHY A;  3CPW M;  1YF5 L;  1XMQ K;  4IFE A;  4DV3 K;  3MEG A;  3HOT A;  3HVR A;  2X6S A;  3DRP A;  2E4L A;  1IKV A;  5HRR A;  2Q31 A;  1YTA A;  3V81 A;  3TAN A;  3FZF A;  3CD6 N;  3RRH A;  4MDA A;  3U4L A;  3H1Q A;  2QK9 A;  2G8F A;  2HND A;  4FO0 A;  3QEX A;  1JLF A;  1HYS A;  1RBR A;  2G8V A;  4FK2 A;  1XC9 A;  4M41 A;  4M3X A;  4KHQ A;  1GOA A;  3CJ7 A;  5ADX A;  5HOO A;  4M42 A;  4DR4 K;  3HP6 A;  4X62 K;  1WSE A;  3A0I X;  5C2F A;  3DXM B;  1VSD A;  3ZX0 A;  3I56 N;  3SYZ A;  3OYJ A; 
#chains in the Genus database with same CATH homology
 2Z1H A;  3KKS A;  3OVN A;  2DFF A;  2IAJ A;  2W42 A;  4KV8 A;  4L8R B;  1WSI A;  3RTV A;  4FJ9 A;  1KLM A;  1I3A A;  3VQA A;  2P5O A;  1RT2 A;  2BAN A;  1IKX A;  3L2R A;  4DFK A;  1ZBF A;  2HHX A;  4E7I A;  1L3V A;  2DY4 A;  2HHQ A;  3DLH A;  1JXB A;  3KLH A;  2FC0 A;  1VSM A;  4CJP A;  4FW2 A;  4CGF A;  4CIE A;  4LSN A;  2XY6 A;  1BQN A;  4FM1 A;  2JLE A;  4CEE A;  2I5J A;  3HVT A;  4DTM A;  3DLG A;  5C24 A;  3CFP A;  3PY8 A;  3QEV A;  4KHW A;  4DTX A;  3NGI A;  4N56 A;  4B3O A;  1KTQ A;  2OPQ A;  3OYE A;  4E7K A;  1QSL A;  3SUO A;  1XI1 A;  4DTN A;  2IS3 A;  3KJV A;  4FZZ A;  3OYL A;  4OVL A;  1JLG A;  3CQ8 A;  3FFI A;  1Z25 A;  4LY7 A;  2YNH A;  3L2Q A;  4EZ9 A;  1TAQ A;  4DF8 A;  3SQ1 A;  4CE9 A;  4FLV A;  3DLR A;  4JLH A;  1U04 A;  1KFD A;  4I7F A;  1FXX A;  4FXD A;  3ZT0 A;  3K5M A;  2Z1I A;  1JLB A;  4E89 A;  3DRR A;  3HXM A;  4DLE A;  3VA0 A;  3TAF A;  3OYI A;  3U3G A;  4CJE A;  4OKK A;  4KRE A;  3IS9 A;  5E41 A;  4NCA A;  4FJ8 A;  2BGG A;  4CK3 A;  2OPP A;  2RN2 A;  3ZCM A;  2IDO A;  3AVC A;  4DF4 A;  4O0J A;  3MXM A;  1EKE A;  1SV5 A;  4KTQ A;  3A2F A;  4FJ7 A;  3V1Q A;  1RCH A;  2BE2 A;  3O4Q A;  1EP4 A;  3AA3 A;  4DMN A;  1EX4 A;  2VG5 A;  1VSJ A;  2XRI A;  4H8K A;  3NE6 A;  1CXQ A;  2G8I A;  4CHQ A;  3DMJ A;  4N76 A;  4KO0 A;  4DQR A;  3QET A;  4Z4I A;  5J2N A;  4IG3 A;  4PUO A;  1NK9 A;  1T03 A;  1BGX T;  4DFJ A;  3SUN A;  1BHL A;  1UWB A;  5T7B A;  2PY5 A;  3ZSR A;  4OLA A;  4CEB A;  2QKB A;  1KVA A;  3BGR A;  3QEP A;  4R5P A;  2YKN A;  2HNZ A;  3NCI A;  3D0P A;  1ZYQ A;  4CJL A;  3SPY A;  4JS5 A;  2F96 A;  1C0T A;  1XHX A;  1QHT A;  3VQQ A;  3NHG A;  4M3T A;  4AHV A;  4M3R A;  3LZI A;  4HUE A;  4N5S A;  4FW1 A;  4CGI A;  2BDP A;  3T3F A;  1QE1 A;  3OS0 A;  3HM9 A;  4KB1 A;  2GBZ A;  3AVJ A;  1S9E A;  4LSL A;  1U45 A;  1QSS A;  3L3V A;  3OJU A;  2FBX A;  1YVU A;  3U6F A;  3KK3 A;  3OYM A;  3HL8 A;  3O3F A;  4PWD A;  1KFS A;  1NJY A;  4FLX A;  3G0Z A;  3SJJ A;  3PUF A;  1NK8 A;  1L3U A;  4FCY A;  1W9H A;  4DSF A;  2VWK A;  4N47 A;  1RTD A;  5HP1 A;  4KTZ A;  5CYQ A;  4AHR A;  1HMV A;  3HP9 A;  4CF1 A;  5JS1 A;  3O3G A;  4PY5 A;  3OYD A;  1RDB A;  4H4M A;  2QKK A;  1NJX A;  4B9V A;  1S1U A;  3AVN A;  4HUG A;  1S1T A;  3SV4 A;  3K57 A;  3SNN A;  4FZX C;  2KW4 A;  3H08 A;  4CJF A;  3SZ2 A;  2HHT A;  3HO1 A;  1C1C A;  4E3S A;  5CZ2 A;  5CYM A;  1VSF A;  4DQI A;  4DSL A;  4Z4F A;  1TKX A;  3NGY A;  1JLA A;  1VSL A;  2EX3 A;  1HJR A;  2YKM A;  4CHN A;  4M3U A;  2ATQ A;  4OGE A;  2ITG A;  3ZT4 A;  3HPH A;  1WSH A;  2HNY A;  3DYA A;  5DK5 A;  3U3Y A;  2ZE2 A;  1JLC A;  4HVJ A;  4CHO A;  3HK2 A;  4CEF A;  3AVF A;  4Z4E A;  1EET A;  1LWC A;  3MEE A;  1VSK A;  2RPI A;  2EHG A;  3T19 A;  3O3H A;  4CES A;  3MXI A;  1VRU A;  3DRS A;  3KKR A;  2R7Y A;  3M8R A;  3QIN A;  2KQ2 A;  4W5T A;  4BAC A;  3V4I A;  2P1J A;  4G1Q A;  3B6O A;  1LAW A;  3P5J A;  4CEO A;  4BE2 A;  4KHS A;  4DQS A;  4DTP A;  3IRX A;  2IC3 A;  1FKP A;  5KGW A;  1L3S A;  2WOM A;  3PO4 A;  3AO4 A;  3DLB A;  3EYZ A;  1WAF A;  3EY1 A;  2D5R A;  3LAL A;  2O4I A;  3AVG A;  1IKW A;  1RBT A;  2A1S A;  2G8K A;  3ISN C;  3TR8 A;  1BI4 A;  3CG7 A;  4F4K A;  2IOC A;  4ID1 A;  2D0C A;  1JL2 A;  4FZY A;  4DTS A;  1NOZ A;  4F2S A;  3DI6 A;  1IKY A;  4E7L A;  4C8M A;  5KRT A;  4NYF A;  4FJN A;  1S5J A;  1YTU A;  1ZBL A;  1ZBI A;  2FBY A;  3AO2 A;  4AHC A;  4AHU A;  5KTQ A;  4FK0 A;  4B9U A;  1RT5 A;  2YHB A;  4CJQ A;  3OYA A;  3KK2 A;  4DS5 A;  3IG1 A;  1NOY A;  3RRG A;  3AVA A;  3NF8 A;  4O0I A;  3V9Z A;  2PZS A;  2HHV A;  1UA1 A;  3AVI A;  2Y1I A;  2ETJ A;  4DG1 A;  1Q8I A;  4LH4 A;  3KD1 E;  1RT3 A;  3LPT A;  3ZSV A;  1S1X A;  4O5B A;  3B6P A;  3ZSX A;  4CED A;  1S6Q A;  2P51 A;  1CZ9 A;  2YHA A;  4RW7 A;  1HRH A;  1REV A;  3OJS A;  4B9S A;  1JLQ A;  1QSY A;  4KI4 A;  3TWH A;  4O55 A;  2GV9 A;  1N6Q A;  4B8C A;  4J2E A;  4M3W A;  1NJW A;  3RMA A;  3CYM A;  3VQE A;  3HST B;  3QIP A;  4BDP A;  3RWU A;  5FRN A;  2ZD1 A;  1ITG A;  2DFH A;  4OJR A;  3C6T A;  5HBM A;  1JXE A;  4CFB A;  3RMD A;  3SPZ A;  2HMI A;  3AVB A;  2XY8 A;  4DLG A;  1J53 A;  3T1A A;  3TI0 A;  4J2A A;  4FJX A;  3I0R A;  3QEW A;  4W5R A;  1CZB A;  4DSI A;  4NCB A;  4CJS A;  2F8T A;  3RMC A;  1DLO A;  2GUI A;  3O4N A;  5HRN A;  1XHZ A;  1RBU A;  4CGD A;  1BIU A;  1ZBU A;  3THV A;  2XHB A;  4CFC A;  4JRP A;  3ZSO A;  3OS1 A;  3NDK A;  3LP2 A;  4C8L A;  1LW2 A;  3V9W A;  3SCX A;  1TKD A;  2DTU A;  4CJT A;  4HCC A;  4FJK A;  3PX6 A;  1BCM A;  4F3T A;  4CF0 A;  5HRS A;  2A1R A;  5KI6 A;  3HPO A;  3NBP A;  3LWL A;  1L3T A;  1KVB A;  1WSG A;  4TSX A;  3OY9 A;  1NK0 A;  3VQD A;  3PO5 A;  3M8Q A;  3TAM A;  3V6D A;  2RKI A;  1T7P A;  1SKW A;  2KFN A;  4XIU A;  1LAV A;  4E1N A;  4OPK A;  4BE0 A;  1WSF A;  3WNG A;  4KTW A;  3L2U A;  4C8K A;  1TV6 A;  4DSJ A;  4F3O A;  4IBN A;  3BDP A;  1N5Y A;  1RTH A;  4CF9 A;  4AH9 A;  4KAZ A;  4DTU A;  1F21 A;  1QQC A;  4DQQ A;  4MFB A;  4CIG A;  1WNS A;  4WE1 A;  4BWJ A;  1RDA A;  4JS4 A;  1C0U A;  1C0M A;  4W5O A;  4M3Y A;  2HHU A;  4CEZ A;  4CFA A;  2O4G A;  1VSE A;  3KLE A;  4FK4 A;  1C6V A;  3OYJ A;  4OKE A;  1X9S A;  1RBS A;  3AO5 A;  3SQ2 A;  3UIQ A;  4FJJ A;  3NH2 A;  5J2Q A;  1KSP A;  2HVI A;  3K58 A;  3KLG A;  4CJ3 A;  4DFM A;  4K8Z A;  1K6Y A;  1DTT A;  4O44 A;  5KGX A;  3ASM A;  1IG9 A;  4FJG A;  1RBV A;  1WSJ A;  3DOK A;  1SKR A;  4FJL A;  3LDS A;  1BCO A;  1BL3 A;  1C1B A;  2ZQB A;  5JS2 A;  4FLT A;  4IFY A;  3SQ0 A;  1U47 A;  3V9S A;  1TKT A;  1BQM A;  1RIL A;  4CEQ A;  3L8B A;  3TAE A;  4E0D A;  3NAE A;  2P5G A;  2KZM A;  1NKE A;  3ZSZ A;  1ZBH A;  5J1E A;  3K59 A;  1A5X A;  4CJU A;  4K8X A;  1WN7 A;  4FLW A;  3AVK A;  4QAG A;  3S3N A;  3OYN A;  1FKO A;  3LP1 A;  4OLB A;  1HQU A;  1W0H A;  3F9K A;  4YFU A;  2XY5 A;  2X78 A;  5DMR A;  2DFE A;  1D9F A;  3TAP A;  3VN5 A;  1RT7 A;  4BDY A;  4Q0B A;  4MQ3 A;  3HJF A;  4AIL C;  1G15 A;  2OZM A;  3LWM A;  4ELU A;  3VQC A;  4E1M A;  3ZSQ A;  3LAK A;  2F8S A;  1Y97 A;  1S1V A;  2XO7 A;  1JKH A;  1VSH A;  2YNG A;  4CJ5 A;  1VRT A;  3IAY A;  4FJ5 A;  3OYC A;  4LD0 A;  2QXF A;  2X74 A;  4FVM A;  1GOC A;  3K5O A;  1RDD A;  1GOB A;  4NCG A;  4PA1 A;  4CJ4 A;  4ELT A;  3ZT2 A;  3SV3 A;  1Q9X A;  4I9Q A;  3MEC A;  2FBT A;  3ALY A;  2Z1G A;  3VQ4 A;  4JRQ A;  2YNF A;  3WNE A;  4BE1 A;  1SL2 A;  1RDC A;  1LV5 A;  1Z26 A;  1EXQ A;  4Z4C A;  1NKC A;  4E7J A;  5HRO A;  4Z0U A;  1YT3 A;  1TK5 A;  3PX4 A;  2HB5 A;  1S1W A;  3VQ8 A;  1BIZ A;  4CJR A;  3AA4 A;  4IDK A;  5EU7 A;  4CGJ A;  4RW9 A;  2PYJ A;  3PX0 A;  3C94 A;  4DQP A;  2B4J A;  2FBV A;  3L2W A;  3SUP A;  4ZTJ A;  1X1P A;  2OYQ A;  2Q3S A;  4IKF A;  4CHY A;  1TK8 A;  1B9F A;  3PV8 A;  4OPJ A;  3NH1 A;  4DTO A;  1S6P A;  5CY4 A;  3AA5 X;  4GVM A;  3CFR A;  2D0A A;  3I8D A;  1J54 A;  3C6U A;  3DLE A;  4KFB A;  3ITH A;  3HYF A;  4CJW A;  1C1A A;  1B92 A;  1LWE A;  3OYG A;  3NF6 A;  2WON A;  1ASW A;  5C25 A;  1D5A A;  4BDZ A;  3QER A;  5FDL A;  3TAG A;  1TL3 A;  1JL1 A;  4E19 A;  1X9W A;  1KRP A;  5J2M A;  2VWJ A;  4FLU A;  3D45 A;  2Z1J A;  1UAX A;  3JYT A;  2OPR A;  4HTU A;  4I2P A;  3OYB A;  4Q5V A;  4HUF A;  4B9M A;  1TK0 A;  1RT1 A;  1D9D A;  4KRF A;  4QOZ B;  2OA8 A;  3KIO A;  4EP4 A;  3K5N A;  3ZSW A;  4CHZ A;  2VG6 A;  4QCL A;  3NF9 A;  4CJV A;  2YNI A;  3AVL A;  4DFP A;  3VQ9 A;  1BIS A;  4FM0 A;  5I3U A;  4ZHR A;  2G8H A;  3DLK A;  4W5Q A;  4F8R A;  4DTJ A;  3QES A;  4CIF A;  4RG8 A;  3HPG A;  4DSK A;  1MU2 A;  1T8E A;  3AO3 A;  4F2R A;  2HHS A;  3ULD A;  3L3U A;  1BI4 B;  4KB0 A;  3ZT1 A;  4OKJ A;  1XWL A;  4FLZ A;  2HHW A;  1RT6 A;  3V1O A;  4CJK A;  4KPY A;  3VQ6 A;  3AA2 A;  3LAM A;  5SZT A;  3OYH A;  2OPS A;  3QLH A;  3I0S A;  3ZT3 A;  4RW6 A;  4CF8 A;  3LPU A;  4FM2 A;  3NF7 A;  3RMB A;  2G8W A;  4H4O A;  4DWI A;  2KTQ A;  2HVH A;  4ELV A;  4EZ6 A;  1TVR A;  3S3O A;  1JLE A;  3AV9 A;  3CM5 A;  3P1G A;  3C95 A;  3CM6 A;  1QS4 A;  1S9G A;  5K14 A;  3TAR A;  3S3M A;  1HYV A;  1LW0 A;  3VQP A;  3K2P A;  3KLI A;  3KLF A;  1SL1 A;  3K5L A;  2NUB A;  4DU3 A;  4ICL A;  3JSM A;  4EP5 A;  4UQG A;  3TAQ A;  1KLN A;  1HPZ A;  3RR7 A;  1DTQ A;  3LP3 A;  4FJH A;  2B6A A;  1UOC A;  4CF2 A;  4YNQ A;  1I39 A;  1J5O A;  2JGU A;  4KKO A;  1VK0 A;  1NJZ A;  1NK7 A;  4AHT A;  1A5V A;  1WAJ A;  1ASU A;  3E01 A;  4BWM A;  4CEC A;  4CHP A;  4FYD A;  1B9D A;  3WNH A;  3QNN A;  1Q9Y A;  4CFD A;  3VA3 A;  1WLJ A;  2YV0 X;  3DM2 A;  2LSN A;  4DU4 A;  2XY7 A;  1U49 A;  4B9N A;  4PQU A;  1A5W A;  2B5J A;  4CGH A;  3QNO A;  1KCF A;  5HLF A;  1CLQ A;  4C8N A;  1T05 A;  4FJI A;  1TAU A;  4DSE A;  3MXJ A;  1HNI A;  2E6L A;  4IFV A;  2D0B A;  3OYK A;  1D8Y A;  4KHN A;  4E7H A;  3SUQ A;  4ID5 A;  3LP0 A;  1NK6 A;  4GW6 A;  4M45 A;  4HCB A;  5FRO A;  3VQB A;  1NK5 A;  2RF2 A;  3P83 D;  1CXU A;  3RR8 A;  4RW4 A;  4C8O A;  3L2V A;  4N41 A;  3V1R A;  2KZZ A;  2IGI A;  4Z4G A;  3M8P A;  3HT3 A;  3S9H A;  4DS4 A;  4B8A B;  4W5N A;  1LWF A;  4FJM A;  1NKB A;  2PYL A;  3SI6 A;  3VQ7 A;  1X9M A;  3G10 A;  3QIO A;  5J2P A;  2OZS A;  3LAN A;  4I2Q A;  3V9X A;  4KHY A;  4I9L A;  2G8U A;  1HNV A;  1HQE A;  3F73 A;  5D3G A;  3KD5 E;  1VSI A;  1KVC A;  3DOL A;  3WNF A;  1O1W A;  1HYZ A;  4OGC A;  3MEG A;  1U4B A;  1SUQ A;  3HVR A;  3AO1 A;  4CCH A;  4M3Z A;  5FRM A;  1FK9 A;  1RTJ A;  2E4L A;  2X6S A;  3DRP A;  4HHT A;  4B9T A;  1IKV A;  4O4G A;  4CK1 A;  1TKZ A;  5HRR A;  2Y1J A;  3AVH A;  3QO9 A;  4RW8 A;  4Y1C A;  1YTA A;  3EZ5 A;  3TAB A;  4ZTF A;  3VQ5 A;  3OYF A;  2VG7 A;  3V81 A;  1U48 A;  5HRP A;  1SKS A;  2E6M A;  4CK2 A;  1RT4 A;  3LZJ A;  4DU1 A;  3TAN A;  3KTQ A;  4B08 A;  1J9A A;  4IG0 A;  1NK4 A;  3RRH A;  5KRS A;  3M8S A;  2X6N A;  4KHU A;  4CEA A;  3OS2 A;  4GMJ B;  1RTI A;  3AVM A;  4Y1D A;  1UA0 A;  1TL1 A;  2QK9 A;  4CER A;  1R0A A;  2G8F A;  3NFA A;  4KI6 A;  1ASV A;  2HND A;  4J2D A;  4CGG A;  3QEX A;  1JLF A;  3ZSY A;  1HYS A;  3V9U A;  1RBR A;  1TGO A;  5SWM A;  3MED A;  2G8V A;  4FK2 A;  1QTM A;  1XC9 A;  4NYN A;  4M41 A;  4FLY A;  2AJQ A;  5I42 A;  3CFO A;  4DTR A;  4KHQ A;  4M3X A;  2KFZ A;  1GOA A;  4M42 A;  4LH5 A;  1RNH A;  3NGZ A;  1SL0 A;  5C42 A;  3HP6 A;  4B9L A;  2HW3 A;  3KK1 A;  1IO2 A;  1WSE A;  1L5U A;  4J2B A;  3NH0 A;  3SQ4 A;  5CZ1 A;  4AHS A;  4Z4H A;  1VSD A;  3MAQ A;  3QEI A;  3SYZ A;  1IH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...