4CEQA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ceqA00
3QIPA 3V9SA 1HJRA 4DU1A 1IG9A 1EP4A 1R0AA 1I3AA 3DRSA 4KAZA 3NFAA 3EY1A 4FLVA 4ZTFA 2YNFA 2YHAA 3MEGA 4CJWA 3I8DA 1LWEA 3O4NA 2O4IA 4JLHA 4EP5A 4FM0A 3DLHA 4CHNA 1ITGA 1C6VA 4BDZA 4K8XA 3ZSOA 1S1UA 1RT6A 1X9MA 2OZMA 4DTUA 1MU2A 2Z1JA 2F96A 4F3TA 3K2PA 1VRTA 3V1OA 3KJVA 3SV3A 1RT1A 4CF1A 3CG7A 1NK4A 3QIOA 3LAKA 3TAGA 2E6LA 3RMAA 3LPUA 1T03A 1J53A 4C8LA 3CFOA 3LAMA 3SUQA 1JLFA 2O4GA 3AVHA 3PV8A 2IS3A 3I0RA 3ZSQA 4Q0BA 5EU7A 4DF8A 4FZZA 4LY7A 3IAYA 1BQNA 4CIEA 3OYLA 4CGHA 3OY9A 3LWLA 4HUFA 2YHBA 1FXXA 5SWMA 3DOLA 4CK2A 4B3OA 3AO2A 4OKJA 5J2NA 3V4IA 4DG1A 3HVTA 4C8MA 2RPIA 3K5LA 1ZBLA 4CHQA 2DTUA 4BE2A 4UQGA 3DYAA 1RDBA 4KPYA 3ZSRA 1TVRA 3HPGA 3RRHA 2G8WA 1L3SA 3LP2A 2DFFA 1SKSA 2EHGA 4FLWA 1SKWA 2PYJA 3HO1A 5HRPA 3LDSA 1BL3A 4FLZA 2RN2A 2GV9A 4F2RA 4DS5A 3MAQA 3NE6A 2BDPA 4EP4A 4DQIA 4KHNA 4J2AA 4KTQA 4FJ5A 4DLEA 4E0DA 2G8VA 5C42A 1HNVA 3TAEA 5CYQA 2RKIA 3OS2A 1HNIA 1TKTA 3NHGA 3PY8A 1S9EA 1VSLA 3KK3A 3RWUA 1BIUA 1JLGA 3BGRA 2RF2A 3OJSA 3EYZA 3NF9A 4GMJB 2OZSA 2KFZA 2KZZA 4CIGA 2HNYA 1LV5A 1CXUA 4F8RA 4H4MA 3DRPA 4CJTA 2FC0A 3LP0A 1S1VA 2ZQBA 3MXJA 1C1CA 3QLHA 5J1EA 3OYJA 3QEWA 4ZTJA 3AVCA 1WSFA 1WNSA 3AA5X 4IFVA 3ZSYA 1KFDA 1U47A 1KLNA 2Z1IA 3KK2A 3DM2A 3AV9A 4Z0UA 2YKMA 1WSIA 4R5PA 2OPSA 4BE1A 1NJYA 2KFNA 5HBMA 3VQBA 4DLGA 4OGEA 3O3HA 1IKXA 1X1PA 4B9SA 1KTQA 3AA4A 3AVGA 5HRSA 3SI6A 3MXMA 2G8FA 3K5NA 3PO4A 4O0IA 5J2MA 3CM6A 4HCCA 2E6MA 1HYZA 4OVLA 1BHLA 3NCIA 4DQQA 4DTRA 2D0CA 1HQUA 2Y1JA 3C95A 3RRGA 3TAMA 1UAXA 3DOKA 4I9QA 4OPKA 2YV0X 5C25A 3OYGA 3PX0A 2HHTA 2ATQA 4KKOA 3RR7A 4RW8A 3DLGA 3HJFA 3AO5A 3ZT2A 4BACA 3ITHA 3L2RA 2XHBA 4DF4A 4Z4EA 3SNNA 4CFBA 1NKBA 3M8RA 1JL1A 3AVAA 1FKPA 3RMDA 4FJ8A 1CLQA 4E89A 4CGFA 1TK5A 4JS4A 4JRPA 2OYQA 4G1QA 4CEQA 3QETA 2X78A 1TGOA 1U49A 1JLQA 2I5JA 3QNNA 1KCFA 1L3TA 4ELTA 4KREA 2JGUA 1KVBA 3EZ5A 2HVHA 4W5TA 2PYLA 2OPRA 2WONA 1QHTA 3SCXA 1FKOA 3TR8A 1N6QA 4Y1DA 4CEAA 4PA1A 2R7YA 2LSNA 4DSIA 1I39A 1VSKA 2XY8A 1NK5A 1QSSA 4E7LA 4CERA 4AHCA 4KB0A 4AHSA 2F8TA 3KLHA 2F8SA 3ZSXA 4CJ4A 5T7BA 1BI4B 4FM1A 4FM2A 3MXIA 3SJJA 4FLUA 2HHXA 1C0TA 3L8BA 3HYFA 5FROA 1A5XA 4B8CA 4FXDA 5JS1A 2WOMA 2A1RA 3M8QA 3ZSZA 1KVCA 3AO1A 4DQSA 2QKKA 2BANA 3SUPA 3B6OA 2DFEA 1NK9A 3CFPA 3QNOA 1QSLA 4AHVA 1TKDA 2KTQA 4GW6A 3ISNC 1NJWA 5CYMA 3C94A 2P5OA 4CIFA 1UA0A 3HVRA 2D0AA 3VQ6A 4CJ5A 3U3GA 4CFDA 1W0HA 4DU4A 4BE0A 3KIOA 2X74A 2XO7A 4DFMA 1JL2A 2GBZA 3NF7A 4GVMA 4CEFA 5E41A 4IG0A 1HPZA 1SL2A 4Q5VA 1VRUA 3VA0A 2VG6A 3OYCA 3HL8A 4LSLA 1D5AA 2VG7A 4DMNA 3I0SA 4FJIA 4J2EA 3QERA 1L5UA 3MEDA 1YTAA 1QTMA 1X9SA 2IDOA 1LAWA 3NAEA 3ZT4A 4ZHRA 2XY5A 4FJ7A 5D3GA 3PUFA 2X6NA 2DY4A 5KI6A 3LPTA 3ZCMA 3M8SA 2HNDA 2ZD1A 4O44A 3AVFA 3T1AA 1XHXA 2G8UA 4DSJA 4CF8A 1C1AA 2Z1GA 1RBUA 5HRRA 3VQ7A 1LAVA 4Z4CA 3LWMA 4E7KA 4DTNA 3BDPA 1NKCA 4BDPA 4NCGA 4KHWA 4CJEA 4KHUA 1F21A 3L3VA 4BDYA 4DFJA 4RW6A 3VQEA 2QXFA 4N47A 4FJMA 3VN5A 5CZ1A 4O4GA 3SPYA 1RTIA 3KLGA 1T8EA 1KFSA 1KLMA 4PY5A 1RT3A 3RTVA 3V9WA 4M3TA 4KTZA 4DTXA 4OJRA 3VQCA 4LH4A 4CHYA 4Y1CA 1NJZA 1Q9XA 3K5MA 3TARA 3AVIA 3VQPA 3LP3A 4FJGA 3TAQA 1QE1A 3NH2A 4BWMA 1S1XA 4Z4GA 1RTJA 3F9KA 3C6TA 4B9VA 1SL0A 1TL1A 3WNEA 3K5OA 1N5YA 1RTDA 4ID5A 3T3FA 4KRFA 5KTQA 3RMBA 1BIZA 4FW2A 3K58A 3OVNA 2HHQA 4KHQA 2XY6A 3O3GA 1JXBA 1ASWA 3O4QA 5CY4A 4RW4A 3T19A 3ZT3A 3OYNA 2YNHA 3HP6A 3KKSA 1HYSA 3KD1E 1GOAA 1D9FA 1DTQA 1YT3A 2NUBA 4CJFA 3KK1A 4DQPA 4OLBA 3M8PA 3NF6A 4N5SA 3VQDA 4H8KA 3OYHA 3OYBA 4XIUA 1NK6A 1RBSA 3SUNA 1RDDA 5I42A 4NCAA 1REVA 4CHZA 2HHUA 1TL3A 3V9XA 2JLEA 4I2QA 1NK0A 4ELUA 3U3YA 5DK5A 5JS2A 3RMCA 4FJJA 4CJLA 3LALA 2HHSA 3G0ZA 3F73A 3THVA 4CJVA 1TV6A 1SKRA 1U48A 1JLAA 3QEVA 4JRQA 4N76A 2VWJA 2HHWA 1S5JA 1ASVA 2FBXA 4DSLA 2DFHA 1VSJA 5HRNA 3OYEA 1W9HA 1KSPA 1CZ9A 4YNQA 4CHOA 4EZ6A 2AJQA 3AA3A 4CFAA 1BISA 3AVJA 4QOZB 4HCBA 1YTUA 3OYDA 5J2QA 4B9MA 1EXQA 2ETJA 4M41A 4JS5A 4RW7A 3NH1A 4KHYA 1J54A 4FLYA 4KI6A 3B6PA 3V6DA 1NK8A 4FJ9A 3ZT0A 4FK2A 4CECA 2HNZA 3AVBA 2HW3A 1S1WA 4DSKA 2BE2A 4E7HA 3K57A 3PX4A 4ELVA 2QK9A 2YNGA 4DWIA 2E4LA 3MECA 4PQUA 1NJXA 4W5RA 4MQ3A 4B8AB 3DLEA 1RT5A 5KGXA 3P5JA 4FYDA 4CGGA 4FJNA 3DLKA 1QS4A 5FDLA 2HVIA 1RT2A 2QKBA 4B9NA 4KI4A 4TSXA 1U45A 1LWFA 3AVLA 4CHPA 1XHZA 2YKNA 4BWJA 3ZT1A 4CK3A 3OYKA 3LP1A 4Z4HA 5C24A 1RBVA 1J9AA 2G8KA 3VQ5A 3HT3A 3HPOA 3JYTA 1C1BA 3AVNA 4DSFA 4CJUA 3NDKA 1XWLA 3V9ZA 1LWCA 3PX6A 4CCHA 3OYFA 4NYNA 4O55A 2GUIA 4CEZA 1EX4A 2ZE2A 2Q3SA 1KVAA 1U4BA 3VQ8A 3QESA 2OPPA 1VSIA 3V1RA 1TK8A 3ALYA 3E01A 3O3FA 1WAFA 1FK9A 1SUQA 3WNGA 3DI6A 4FW1A 4KTWA 2G8HA 1BQMA 1GOCA 3SZ2A 4J2DA 1TAUA 4PWDA 2VWKA 3DLRA 4CEBA 1B9DA 1RBRA 4QAGA 3TAFA 1LW0A 2Z1HA 3OS0A 4HHTA 1QQCA 3IS9A 4M3RA 1WSEA 3WNHA 4I7FA 2W42A 3SV4A 4F2SA 3KLFA 3PO5A 2IAJA 1HYVA 3AA2A 1DTTA 4AHUA 4B9TA 1EKEA 2IOCA 4KV8A 1RT4A 4B9UA 2Y1IA 3RR8A 3AO4A 4RW9A 2ITGA 3NGYA 2P1JA 3S3NA 4WE1A 4ID1A 4E1MA 2P5GA 3ULDA 2KZMA 3V81A 4C8KA 4CEDA 3VQAA 3ZSVA 3CFRA 4QCLA 4KFBA 3HPHA 3SQ4A 1XC9A 1CZBA 1RBTA 3QO9A 3OJUA 3VQ9A 4O5BA 1JXEA 4M3WA 3TAPA 1BGXT 1O1WA 5FRNA 4F3OA 5K14A 4AH9A 4OPJA 3LZIA 1IKVA 3DMJA 4FLTA 4FJLA 3VA3A 4FCYA 4CESA 4DTJA 4KB1A 3U6FA 4CEEA 1TKZA 3HK2A 1XI1A 1S1TA 2PZSA 1BCOA 4AHTA 4DTPA 2BGGA 3SYZA 4FZXC 2X6SA 4FK0A 1U04A 3SQ0A 1S6QA 2KQ2A 5CZ2A 1LW2A 4CE9A 1VSMA 4FK4A 3A2FA 4DTOA 5J2PA 1VSFA 2YNIA 1JLBA 1NOZA 1G15A 1RILA 1B9FA 4HTUA 1NK7A 3TANA 3K59A 1ZBUA 4CEOA 3D45A 4LSNA 4OKKA 1A5WA 5KGWA 1GOBA 4I9LA 3QEIA 3IRXA 4M42A 4ICLA 4W5QA 1L3VA 3LZJA 3NBPA 4DS4A 1VK0A 5I3UA 3L2VA 1QSYA 1WLJA 2FBVA 4LD0A 4AHRA 1ZBFA 1UWBA 4CGJA 4OLAA 3L3UA 3AVMA 3CQ8A 4DTMA 4FJKA 1IKWA 3SQ1A 1JLCA 1NKEA 1VSHA 4HUGA 3UIQA 3OYAA 2HHVA 1A5VA 4H4OA 4N41A 1RDCA 4W5OA 1Y97A 2IGIA 1T7PA 5SZTA 4IG3A 3WNFA 3OYIA 4K8ZA 3CYMA 4J2BA 1ZYQA 1BI4A 4W5NA 1J5OA 3C6UA 4CGDA 3S3OA 1RDAA 4HUEA 3KKRA 5DMRA 3S3MA 2HMIA 3KLEA 2B5JA 4CJSA 4CJQA 3NGIA 3NF8A 4CF0A 2G8IA 2D5RA 3OS1A 3ZSWA 1L3UA 1D8YA 1DLOA 1HRHA 4FVMA 1WSGA 2P51A 4IFYA 1HQEA 1TKXA 3DRRA 2B4JA 3D0PA 4EZ9A 2OA8A 4NYFA 4E1NA 4DTSA 4IDKA 4CF9A 1ZBHA 1JKHA 4E19A 3L2WA 3IG1A 3TI0A 1SL1A 1TAQA 4M3UA 4O0JA 3JSMA 4N56A 4FZYA 4FLXA 5FRMA 4KO0A 3V1QA 1Q8IA 3LANA 1IKYA 1RT7A 1RTHA 4DQRA 4RG8A 4IKFA 3HXMA 4HVJA 1JLEA 3ASMA 3L2QA 1S6PA 4LH5A 4MFBA 4YFUA 1NOYA 4Z4FA 1UA1A 1SV5A 1RCHA 1WSJA 4L8RB 4E3SA 4AILC 3P1GA 4OGCA 3G10A 3QEXA 3QEPA 3SPZA 3FFIA 3KTQA 1ZBIA 4CJ3A 4B08A 4E7IA 1EETA 3CM5A 4M3XA 2IC3A 3DLBA 2HB5A 1IH7A 1Z25A 2FBTA 4OKEA 4CJPA 4DSEA 3TWHA 1X9WA 4FJXA 3HM9A 4DFPA 1Q9YA 1WN7A 3SQ2A 1K6YA 4CFCA 3S9HA 4CK1A 3NGZA 1C0UA 5HLFA 4Z4IA 4E7JA 1VSEA 1KRPA 2B6AA 1RNHA 5KRTA 5HP1A 1TK0A 3VQ4A 2XY7A 3KD5E 1CXQA 3HP9A 3OYMA 2VG5A 3V9UA 3TABA 4NCBA 3HSTB 4CF2A 4FJHA 1Z26A 1B92A 4CJKA 1VSDA 1YVUA 2XRIA 4CGIA 2KW4A 3QINA 4PUOA 4M3YA 2OPQA 3P83D 2PY5A 2FBYA 4DFKA 4M3ZA 1C0MA 2D0BA 1UOCA 4IBNA 4I2PA 5KRSA 3KLIA 4M45A 1ASUA 3L2UA 5HROA 3NH0A 1T05A 1D9DA 3SUOA 4C8OA 4KHSA 1BCMA 3MEEA 2A1SA 4DU3A 3H08A 1HMVA 3VQQA 4CJRA 4B9LA 4C8NA 3AVKA 3AO3A 1IO2A 1S9GA 4F4KA 1WSHA 1WAJA 2EX3A
chains in the Genus database with same CATH superfamily
3V9SA 3O80A 4JI0K 1EP4A 4IXCA 3DRSA 4LFAK 4ZTFA 4CJWA 4DR5K 3O4NA 4EP5A 4CHNA 1ITGA 1MU2A 3K2PA 1VRTA 2CH6A 3V1OA 4CD3A 3SV3A 3PLAA 2D4WA 3ULEA 4CBXA 1J53A 3SUQA 1JLFA 4BQZA 3PV8A 2GELA 2IS3A 2YJEA 5BRHA 5MLCQ 4DF8A 2F9WA 3MWPA 4CIEA 2D1KA 3LWLA 3G71N 5GIOA 3TSUA 5BPLA 4BVPA 4CHQA 5KPZA 3GBTA 4KPYA 3ZSRA 3LP2A 1SKSA 5DM7L 5KPRA 2QWRA 5HRPA 4JD2A 4RTFD 4BRHA 4JKBA 3G4SN 2IVNA 4IJAA 1HNVA 1RDWX 5CYQA 2RKIA 3TAEA 3PY8A 3OBYA 1S9EA 3KK3A 3BGRA 3OJSA 2KZZA 3NF9A 2KFZA 3J7ZO 3C7NA 4JV5K 3DRPA 4O5FA 4EHUA 3TU5A 3LP0A 2ZQBA 1Q18A 2Q0UA 3QLHA 4FL9A 3OYJA 3AVCA 4EHTA 3AV9A 4BE1A 4X64K 4CZFA 5HBMA 3VQBA 4OGEA 2PBDA 4B9SA 5HRSA 3AA4A 3AGKA 3MXMA 4O0IA 5J2MA 3CM6A 1HYZA 1NGEA 2UU9K 2IVPA 3MN7A 3VGKA 2HBMA 1HQUA 3TAMA 4YOUA 1BO5O 1YF5L 3DOKA 4NO7A 1HKBA 2YV0X 4LF5K 5C25A 4KHPK 3HJFA 3AO5A 3ZT2A 2A3ZA 3VEXA 3L2RA 2XHBA 4Z4EA 1M90O 3AVAA 3RMDA 4FWNA 5FLXO 4JS4A 1TK5A 3A5LC 3WQUA 2OYQA 1TGOA 3IKMA 2JGUA 1NLVA 4CEAA 5AQZA 1VSKA 1XC3A 3MWTA 2QWOA 1XMQK 4FM2A 5T7BA 1KXPA 4FLUA 1NBWA 2HHXA 3L8BA 5FROA 3LM2A 2A1RA 4DR2K 1KVCA 3LDQA 2BANA 3B6OA 1TUUA 3QNOA 4B1WB 1TKDA 2NRZA 1NJWA 2QWPA 4GV3A 3KWGA 4FSVA 2D0AA 4YY3K 2X74A 2NRHA 5F1XA 5JVHL 4CEFA 5E41A 1OH8A 1SL2A 5KPTA 3OYCA 4J2EA 3CMEN 1S3XA 1WBDA 4FJ7A 2XY5A 5D3GA 3PUFA 2X6NA 5AQPA 2VQEK 3ZCMA 3M8SA 3H45C 1VQ7N 2QEXN 4CF8A 1RBUA 2FSKA 2ASOA 1LAVA 4Z4CA 4E7KA 4KHUA 3MN6A 4DFJA 3E9LA 3L6QA 3VN5A 1T8EA 4JNEA 1KFSA 4PY5A 1RT3A 4JI2K 3RTVA 3O9QA 4KTZA 4DTXA 4OJRA 4G9ZA 3CC7N 3FZMA 2CGJA 4DUYK 4BRCA 2AP1A 3ATVA 4FJGA 4IEIA 4BRIA 4BWMA 4Z4GA 1RTJA 4B9VA 1DT9A 3QICA 5AQVA 2F7TA 1OVQA 5KTQA 1YJNN 3VETA 2XY6A 5EX5A 1U49A 1JXBA 3T19A 2QXLA 3KD1E 1P8ZA 1GOAA 1K8KB 2GWKA 1D9FA 4N5SA 3D2EB 3OYHA 3VF6A 3HSCA 3SUNA 1RDDA 1EO1A 4CHZA 3V9XA 4I2QA 1NK0A 2ZJRL 5FPNA 3F73A 3R9PA 5AR0A 1N36K 4IWVA 2A6AA 4RCHA 4JKFA 1BOTO 1S5JA 2FBXA 1VSJA 2RE2A 1CZ9A 5JLFA 4H0XB 5M1QA 4CZMA 3HOTA 4AM7A 1YTUA 4FO0A 5AQWA 4M41A 4B9MA 3NH1A 1XUPO 4FLYA 3CC2N 5C0YA 2QWMA 3ZT0A 2E5LK 2HNZA 3AVBA 2HW3A 1K8AO 4DSKA 2Q1NA 3K57A 2YNGA 4DWIA 4PQUA 4B8AB 1RT5A 3HZ6A 4GKKK 3P5JA 4C1NK 4CGGA 3DLKA 1QS4A 5AFUA 1RT2A 4B9NA 1U45A 1LWFA 3AVLA 1XHZA 1HJOA 1C1BA 4DV7K 3NDKA 4GY2B 1YAGA 3V9ZA 2Q3SA 2ZE2A 1VQKN 1U4BA 4JYAK 3U9ZA 2IVOA 1HKGA 4I6MB 2G8HA 1WAFA 4FW1A 3DLRA 5M1KA 1B9DA 3TAFA 3FGUA 4CJ7A 4A62A 2KKZA 2UXDK 3KLFA 3WQTA 2VYPA 3MX2A 1W2BM 3PO5A 3AA2A 3ZETA 4B9TA 4WE1A 3TSQA 3F9MA 4ID1A 4K25A 1VQ5N 5HOOA 5C2DA 1RFQA 3HPHA 1XC9A 3C6HA 2UUAK 3VQ9A 1JXEA 1BGXT 3RSEA 4F3OA 4FJLA 1NJIO 1X9JA 4O8UA 3IUCA 3CCMN 2D0PA 3VMFB 4CW7B 2BGGA 4FZXC 3UKUB 1U04A 2KQ2A 2CH5A 5CZ2A 4CE9A 4BVOA 2NLXA 2WUSA 1VSFA 1G15A 1B9FA 1ZBUA 4CEOA 3D45A 4LSNA 4OKKA 3QEIA 3J80O 3ZX2A 3LZJA 1VK0A 5I3UA 3L2VA 1S72N 1QSYA 2FBVA 4AHRA 1UWBA 4JKGA 1NGIA 2HOEA 3R3LA 1VSHA 4HUGA 2ASMA 4A61A 3OYAA 4B3SK 1T7PA 4AF1A 3WNFA 1BI4A 3NVMA 3KWIA 4HUEA 2HMIA 4M7YA 4IOAL 3KLEA 2OCEA 4CF0A 3VF2A 2BH1A 2D5RA 2RHKA 1LCUA 1L3UA 3TTDA 2P9UA 4DKWA 3D0PA 4NYFA 3O9TA 2NRTA 2UUCK 1ZBHA 1JKHA 4WQ5C 3E9PA 4GVEA 3JSMA 4FLXA 4H0VB 3CCSN 3ENBA 1RT7A 4DQRA 2O8CB 4HVJA 3WXIA 4LH5A 2QWQA 2HBJA 1HUXA 3QEXA 3FFIA 2HF3A 3DLBA 4XH4A 3TWHA 1IJJA 1K6YA 3CJ9A 3S9HA 4CK1A 2NRRA 3I56N 1FJGK 1GLEG 4FOIA 4Z4IA 3WEEA 3U8XA 1Z26A 1B92A 2KW4A 4M3YA 2O8EB 1C0MA 4IBNA 4I2PA 2P9SB 1NGJA 3KLIA 3OBWA 1ASUA 1BCMA 1JCGA 4DU3A 2KHOA 3H08A 5GAHP 3DJCA 3HRGA 3CJ7A 3QIPA 1P90A 1HJRA 1MA9B 1IG9A 5CR4A 3G25A 4KAZA 4JK8A 3I8DA 3SAFA 2O4IA 1GLFO 1C6VA 2YCHA 4K8XA 3ZSOA 3LDNA 4DV1K 1RT1A 4CF1A 1NK4A 3LAKA 2E6LA 3RMAA 4C8LA 3LAMA 3O5BA 2O4GA 3AVHA 3I0RA 3ZSQA 5EU7A 4DR3K 2O8DA 3OY9A 2YHBA 3J8AA 4B3OA 4OKJA 3V4IA 3QDKA 4C8MA 4JI3K 3K5LA 2NRVA 1ZBLA 1IV0A 2DTUA 4BE2A 3H3OB 2G8WA 3HPGA 1L3SA 4FLWA 2PYJA 3EZWA 1SKWA 1BL3A 2QM1A 2YHWA 4F2RA 3L4QA 2BDPA 4DQIA 2F4VK 4FJ5A 3UKRA 4JN4A 4E0DA 5C42A 4Y0WA 1NGCA 4BRLA 4EFHA 1IG8A 4QS8A 4CZIA 3RWUA 1JLGA 2OZSA 3LDPA 1WB9A 2I7PA 2HNYA 4OO1J 4F8RA 2FC0A 3MXJA 4JI1K 1C1CA 5J1EA 3QEWA 3AA5X 1KLNA 2Z1IA 1NJYA 4R5PA 2YKMA 1WSIA 3KHYA 4FWMA 4B1XB 1X1PA 3SI6A 3C65A 3ULEB 4HCCA 1LOTB 2E6MA 4OVLA 2P9IA 1DEJA 2D0CA 2VGMA 3D7EO 3C95A 1SZ2A 4YOTA 3T1HK 4BC2A 4I9QA 4OPKA 3T7ZA 3OYGA 2HHTA 2E88A 3RVCA 3DLGA 4BACA 3ITHA 3CI5A 3SNNA 1NKBA 2QWNA 1FKPA 4ISFA 4CGFA 4G1QA 4A57A 1KAYA 3QETA 4JD2B 1JLQA 3QNNA 2HVHA 3EZ5A 1ESVA 2PYLA 3SCXA 1QHTA 1FKOA 2R7YA 4PA1A 1OH7A 3CIPA 5AQQA 3DXMA 2YX6A 2YI1A 4CERA 1QVFM 4AHSA 3KLHA 2VWBA 3ZSXA 1SS6A 3C7NB 3MXIA 1C0TA 4GV9A 1A5XA 4FXDA 5JS1A 2WOMA 4YORA 2QKKA 2P9NB 1NGGA 5AQFA 2OTJN 3ISNC 4BRPA 4CIFA 3O1BA 3CXCM 2GWJA 1U6ZA 3HVRA 3VF4A 5BRFA 3KIOA 3CPWM 2WFBA 4FWPA 2GBZA 1HPZA 3CCJN 4K0KK 5GAGP 3I0SA 4H5TA 5AFUH 4FJIA 1L5UA 3D2FA 1SQKA 3MEDA 1BG3A 4IOXA 4BGBA 2IDOA 3ZT4A 4ZHRA 4IZ9A 2DY4A 2UXCK 2GTDA 3LPTA 2HNDA 2ZD1A 1QQOA 3AVFA 3ID6A 2Z1GA 4CZJA 3BDPA 3LWMA 3AAQA 4MDBA 1E4FT 3L3VA 3THXA 4LF8K 4RW6A 3VQEA 2ZJQL 1NGHA 2QXFA 5CZ1A 3O4WA 5A2QO 3V9WA 4M3TA 2V7YA 3N4QA 4CHYA 2O8FA 3R6MA 3K5MA 3VQPA 3SAGA 3VEOA 1QE1A 3BP8A 5M1PA 5GIPA 3TAQA 4JKDA 3F9KA 2FXUA 3C6AA 3EE9A 1TL1A 3K5OA 1N5YA 1RTDA 4ID5A 1VAZA 5LL6Z 4CZHA 3RMBA 1BIZA 3AARA 3K58A 3OVNA 2HHQA 4KHQA 2OANA 3O3GA 3O4QA 5CY4A 4AILC 3ZT3A 5DM6L 3ID8A 3OYNA 2YNHA 1HYSA 5E84A 1XNQK 1DTQA 1YT3A 3KK1A 3VQDA 3OYBA 3L0QA 4LC9B 1NK6A 1RBSA 1REVA 3NVKA 2JLEA 4ELUA 1OKJA 3JS6A 3LALA 3G0ZA 4JI5K 3THVA 4H5WA 4YDUA 2E20A 1JLAA 3SAHA 5JLHA 4ILHA 2VWJA 2W40A 1ASVA 4E1JA 4DSLA 2DFHA 5HRNA 1RDUA 4YNQA 4CFAA 4ILGB 3AVJA 4HCBA 3OYDA 2HBLA 1EXQA 2ETJA 5M1OA 1MWKA 3V6DA 4IOCL 3E66A 4FK2A 4YOVA 4CECA 5JMVA 2P9PA 4BROA 2AA4A 4JK7A 2PAVA 3P38A 3PX4A 4DB3A 1NJXA 1YIJN 3DLEA 3Q7BA 5KGXA 4FYDA 5B8HA 4FJNA 2HVIA 1ATSA 3U4LA 4TSXA 4CHPA 4BWJA 4CK3A 4H0PA 4C23A 4K41A 4A5BA 4Z4HA 5EXWA 4JAXA 3JYTA 4DSFA 3AVNA 4H5VA 4CJUA 3EE8A 1XWLA 1LWCA 3PX6A 3OYFA 4CEZA 4BG9A 1EX4A 3H46O 4BC3A 3VQ8A 5KQ8A 3QESA 3V1RA 4PWDA 3O3FA 1SUQA 3MN5A 4KTWA 4J2DA 3SZ2A 4CEBA 4QAGA 4H0TB 3IS9A 4M3RA 3SV4A 2W42A 4F2SA 5AJ3K 4DR1K 2V7ZA 1HYVA 3SJHA 1EKEA 1RT4A 3N4PA 3RR8A 4RW9A 2ITGA 2P1JA 4BR0A 5C10A 3V81A 4C8KA 4CEDA 2A42A 1EWRA 4MO5A 4BR2A 5C12A 3OJUA 5BN8A 4M3WA 4JKAA 4CZLA 1NNEA 4OPJA 4KB1A 4CESA 2UUBK 4GV6A 1BA0A 1S1TA 3LL3A 1BCOA 4AHTA 2ZF5O 4YOYA 4DTPA 1YHQN 2X6SA 3SQ0A 1LW2A 3OHRA 1VSMA 4FK4A 3A2FA 2HHHK 1NOZA 1XQSC 1W97L 1NK7A 3TANA 3K59A 3MN9A 3S41A 4DR6K 3MCAB 1GOBA 4M42A 4PL8A 4H5RA 4LD0A 3SK3A 1D4XA 3K9JA 3CQ8A 4DTMA 3SQ1A 1JLCA 3BF3A 1ATNA 4H4OA 4N41A 1RDCA 5AQYA 5AQTA 4IG3A 3E1YA 4M7XA 3P4IA 4A2AA 3CYMA 5AZJA 1VQON 4W5NA 1J5OA 3H3NO 3S3OA 2QTDA 3KKRA 5DMRA 1VQMN 3QB0A 4CJSA 2GX9A 4CJQA 4DV3K 3P39A 3ZSWA 1FW6A 1G99A 1HPMA 1WSGA 2ITMA 3RSEB 1TKXA 4EZ9A 3B8AX 1VHXA 4E1NA 4DTSA 3ZEUA 4JHDA 4WFBL 1TAQA 3CF5L 4WQ4C 4M3UA 4O0JA 3THWB 4N56A 3JXUA 4KO0A 1M1KO 1Q8IA 1KD1O 1N8RO 1CZAN 3QFPA 3H1VX 4NXMK 1SV5A 3MDQA 3SPZA 3G10A 3QBXA 1ZBIA 4E7IA 2A41A 2IC3A 2CGLA 3BZKA 5LJVA 2FBTA 1Z25A 4CJPA 1MWMA 4NLCA 4LFBK 4B1VA 4DFPA 1Q9YA 3SQ2A 1T44A 1BU6O 3NGZA 2O8BA 4CI6A 4JKGB 4E7JA 1KRPA 3OA9A 5AQKA 5HP1A 1VQ9N 4X65K 1TK0A 3KD5E 3HP9A 3OYMA 3TABA 4FJHA 3HOSA 3AAPA 1ATRA 1YVUA 2OPQA 1T05A 1D9DA 3L2UA 4KHSA 3MEEA 3VQQA 3EL2A 1YJ9N 3AVKA 1IO2A 1OVYA 1N32K 1WSEA 1WAJA 3O3HA 1OH5A 2A5XA 3EN9A 3NFAA 4FLVA 2YNFA 3MEGA 1LWEA 4FM0A 3IMXA 3AY9A 1S1UA 1X9MA 1K8KA 4DTUA 1U2VA 1HNWK 2F96A 4F3TA 1NU0A 3D2EA 4PKHA 3KJVA 3LM9A 3TAGA 3SLCA 3CCEN 3CFOA 2FSNA 2J4RA 5F2RA 4JI4K 4FZZA 3IAYA 1BQNA 4Z94A 4CGHA 4HUFA 3DOLA 3AO2A 2V51B 4MLEA 3WEEB 5J2NA 3E9OA 3SBTA 3VEYA 1RDBA 1TVRA 3VPZA 2DFFA 2EHGA 3BEXA 3HO1A 3LDSA 5M1FA 2P9LA 2HSTA 1ILYA 4FLZA 1VQNN 1Q7YO 4IEEA 3MAQA 4KHNA 4J2AA 2JWLA 2G8VA 2E2OA 1HNIA 1TKTA 4OPHA 3NHGA 1VSLA 3BF1A 5GINA 1BIUA 4KBOA 3EYZA 2RF2A 3CCQN 5FPDA 1CXUA 1Y64A 4H4MA 5I9EB 4JI8K 4PKIA 3THYA 1WNSA 4IFVA 4JKHA 4IO8A 4DU1A 4MO4A 3DM2A 3KK2A 4X66K 2HF4A 2OPSA 3R8EA 3SBGA 3QFUA 2OTLN 2H3GX 3AVGA 1SAZA 2NRWA 1GLBG 5GAEP 3VESA 3L4IA 1YVNA 1BHLA 4DTRA 2ZJPL 2Y1JA 3RRGA 5ADXA 1YI2N 2NRXA 4AQYK 3CETA 3PX0A 2ATQA 3RR7A 4RW8A 3CJCA 3VOVA 4CFBA 4FJ8A 4E89A 1H1VA 4JRPA 4CEQA 2X78A 2I5JA 4KREA 1KCFA 2WONA 1N6QA 3GE1A 1I39A 1NK5A 2XY8A 1S22A 3DLLL 2W6LA 4E7LA 4AHCA 2F8TA 2F8SA 3WT0A 4CJ4A 4V19S 4FM1A 1GLCG 3SJJA 3HYFA 1GLDG 4B8CA 4U67L 1Q81O 4B1YB 1E4GT 2DFEA 3CCLN 3CFPA 3O6WA 4WQ5A 4WFAL 4DV2K 1QSLA 1YUWA 4JKCA 5BRDA 4GW6A 3O9UA 1RGIA 3C94A 4FWSA 5AQSA 2P9IB 5AZIB 4JI7K 4BR4A 1W0HA 4DHYA 4BE0A 4DFMA 1JL2A 1YXQA 3VEWA 4GVMA 3FLCO 4BRDA 4Q5VA 2VG6A 1EQYA 3EKSA 4PHTX 2VG7A 4DMNA 3QERA 5AQJA 4WCEL 5M1NA 1YTAA 5AQXA 3H1QA 1QVGM 4LF9K 5AQIA 5LMNK 2UYTA 4O44A 3T1AA 3CCVN 3J81O 4DSJA 3DXMB 3TSPA 1V4TA 4NCGA 4KHWA 1F21A 2ZM6K 4IO9L 4BDYA 2YHXA 5KQDA 1YITN 4N47A 4FJMA 3SPYA 1RTIA 4LH4A 1KC8O 4B9QA 1NJZA 1Q9XA 3TARA 3AVIA 4DV0K 4LFCK 4BC5A 5JVGL 1S1XA 4DCHA 1SL0A 3WNEA 3T3FA 2VCPA 4FW2A 3NMUA 2HMPA 2Q36A 4FWKA 3D6RA 4BRMA 3KZBA 3MMVA 3KKSA 3WXKA 2NUBA 2ZWHA 4DQPA 4OLBA 3NF6A 3D2FB 1NGAA 2DPNA 5AQGA 5AQUA 4NCAA 2HHUA 4WYBA 1GLAG 4FJJA 2HHSA 3CHWA 1TV6A 5JICA 2WTUA 4JRQA 4N76A 5AQMA 3M3ZA 5BREA 2HHWA 2P9SA 3THXB 1KSPA 1W9HA 4CHOA 2AJQA 5LY3A 3AA3A 1TYQA 1BISA 4QOZB 5J2QA 4MDAA 4BRGA 1J54A 3O9SA 2O8FB 4ISEA 3QBWA 3SMPA 3CQXA 3ATUA 1S1WA 2BE2A 3ZLJA 4ELVA 2E4LA 4MQ3A 3GDQA 4DV4K 4KI4A 3A5OC 2YKNA 2QA4N 3OYKA 4BRQA 3I55N 4OPAA 4FVUA 5C24A 1J9AA 4BY9C 3VQ5A 3HT3A 3HPOA 5BN9A 2HBKA 3FE1A 2F9TA 3PSIA 4NYNA 4O55A 2VGNA 2GUIA 4CD1A 1KVAA 2BTFA 3E01A 1BQMA 1TAUA 3KVGA 2VWKA 1RBRA 3T1YK 1NG9A 1LW0A 2Z1HA 3VENA 1HR0K 3LDLA 4I7FA 3WNHA 3CMAN 2IAJA 1DTTA 1VQ6N 4B9UA 3HTVA 3AO4A 3S3NA 3CCUN 2P9PB 4E1MA 2P5GA 2IIRA 3ULDA 2KZMA 3VQAA 3ZSVA 4KFBA 1RBTA 3QO9A 5GADP 4FOEA 1O1WA 3ENOA 5FRNA 4B3RK 5K14A 4AH9A 3LZIA 4FLTA 3K9KA 3VA3A 4B3MK 1T6CA 3MCPA 2CGKA 2P9KA 3I8BA 1TKZA 4O8KA 1XI1A 3SYZA 4FK0A 1S6QA 3EKUA 4JK9A 4EAHD 1C0GA 4FPAA 4DTOA 2YNIA 4BQLA 1JLBA 2E2NA 4YDUC 4AM6A 1R59O 3FZLA 4IJNA 3TPQA 1BA1A 3IRXA 2PFUA 4ICLA 4MLHA 3NBPA 1NM1A 1WLJA 4CGJA 4OLAA 3L3UA 4BRKA 1IKWA 4BR5A 1WOQA 1NKEA 3UIQA 2HHVA 2IGIA 4HWIA 5SZTA 3OYIA 1ZYQA 4BR9A 3C6UA 4CGDA 1RDAA 3S3MA 3NGIA 3NF8A 2G8IA 4BR7A 4LF6K 2WBNA 4M63C 4JI6K 5AQNA 2P51A 4FWRA 2P9NA 2B4JA 4CVNE 3DXKA 2OA8A 4IDKA 3PIOL 3GG4A 1IBMK 4E19A 3L2WA 3HM8A 3MK6A 5FRMA 3V1QA 1IKYA 2ASPA 4RG8A 3WXJA 1T6DA 3HXMA 1JLEA 3ASMA 5C15A 3L2QA 1S6PA 1NOYA 1UA1A 4L8RB 1RCHA 3QEPA 3UB5A 3KTQA 4CJ3A 2FF3B 4B08A 1EETA 2D0OA 3M5RA 2EWSA 4M3XA 1NMDA 4H0YB 1J6ZA 4FJXA 3U9DA 4DSEA 3HM9A 5AQHA 1C0UA 3WUHA 2GEMA 4K42A 1VSEA 1IBKK 2B6AA 5KRTA 3M6GA 3EEQA 4KH5A 3VQ4A 2VG5A 4DR7K 3V9UA 3UE5A 4CF2A 3O08A 5AZJB 5ADXH 3QINA 2PY5A 2FBYA 4UY8O 1C0FA 2D0BA 1UOCA 2Q0RA 5BR9A 4C8OA 3SUOA 3FZKA 1HMVA 4CJRA 4B9LA 4C8NA 1KAZA 3AO3A 3ZEUB 4JHDB 4F4KA 1WSHA 3PSFA 3ZYYX 1R0AA 1I3AA 3EY1A 2NNWA 2YHAA 4JLHA 3DLHA 4BDZA 1RT6A 2OZMA 1YJWN 2Z1JA 3CG7A 3QIOA 4NB4A 3GOIA 3LPUA 1T03A 4H5NA 2O8BB 4Q0BA 4FPBA 4LY7A 4L3QA 1K73O 3OYLA 5EOYA 4WF9L 2E2QA 5SWMA 1FXXA 4CK2A 4CZKA 4DG1A 3HVTA 2RPIA 4PKGA 4UQGA 3TTFA 3DYAA 3J7AP 3RRHA 5BPNA 1VQ4N 2Q31A 2RN2A 2GV9A 4GKJK 4DS5A 3NE6A 4EP4A 1J5EK 4LF7K 4KTQA 3VEVA 4DLEA 3CJAA 3PIPL 1XNRK 2E2PA 3OS2A 3ZETB 2E1ZA 1DGKN 4GMJB 4CIGA 1LV5A 4CJTA 1S1VA 4F9OA 4ZTJA 1WSFA 3A5NC 3ZSYA 1KFDA 1U47A 4Z0UA 2KFNA 1Z6RA 1U2VB 5EY4A 4DLGA 1IKXA 4DR4K 1KTQA 2G8FA 3PO4A 3K5NA 4DQ8A 4XH5A 1HX1A 1E3MA 3NCIA 4DQQA 3F2KA 1UAXA 1GLJO 4KKOA 2E8AA 4B1ZA 4DF4A 3VTIA 1V4SA 5AQOA 3M8RA 1JL1A 1TUYA 1CLQA 5H1SQ 2P9LB 3C0BA 4ELTA 1L3TA 1KVBA 4W5TA 2OPRA 4QCLA 4BREA 4JKEA 3TR8A 1QZ5A 4Y1DA 3HI0A 2LSNA 1Q86O 4DSIA 5BPMA 4A59A 4X62K 4A2BA 1QSSA 3I33A 1HLUA 1JCFA 4KB0A 1BI4B 4OX9K 2W6KA 3THYB 1QHAA 4BRFA 3QMLA 4ISGA 3M8QA 3ZSZA 3AO1A 4DQSA 2NZTA 1NK9A 3SUPA 4A5AA 3F5TA 1WUAA 4AHVA 2P9UB 4WQ4A 1QZ6A 2KTQA 1I94K 5IWAK 5CYMA 2E1YA 2P5OA 5CE3A 1UA0A 4YOWA 3VQ6A 4CJ5A 4CFDA 3U3GA 4DU4A 3LDOA 3SMSA 3AGRA 2XO7A 3BZCA 3NF7A 4IG0A 4NLBA 3VA0A 1VRUA 1N33K 3CQYA 3CC4N 2Q2RA 2YHYA 3HL8A 4LSLA 5C2FA 1D5AA 3K0SA 3CJ1A 5LMUK 4EIAA 1QTMA 1X9SA 1LAWA 3VEZA 3NAEA 3T69A 5KI6A 3R1XA 3MX5A 1XHXA 2G8UA 2FF6A 1NWKA 1Z05A 4BC4A 3VQ7A 1C1AA 5HRRA 3WXLA 4DTNA 1NKCA 4BDPA 1X3MA 4CJEA 4QS7A 3G6EN 4QS9A 3CD6N 4O4GA 3KLGA 5BR8K 1KLMA 3BY5A 5HL7L 5ELZA 2Q97A 3VQCA 4CZEA 1KQSM 4Y1CA 3THWA 1NMNA 2A40A 3LP3A 1VQPN 3OW2M 3NH2A 1HNZK 1KAXA 3C6TA 5AQLA 4BG8A 4K43A 4KRFA 3CJBA 1VQ8N 1ASWA 4RW4A 3HP6A 4ILJA 3Q7CA 4CJFA 3M8PA 3ZX3A 1DKGD 4H8KA 4XEIA 1T3VA 5F0XA 4XIUA 4JEPA 5I42A 1TL3A 3U3YA 2WC9A 5DK5A 3A5MC 5JS2A 4CJLA 3J7YP 3RMCA 2V52B 3DWLA 4CJVA 1SKRA 4I6MA 1U48A 2O8DB 3H6EA 3QEVA 3TTCA 4BGAA 3OYEA 1BUPA 3VTHA 4EZ6A 4KH4A 2FSJA 4CBUA 4J8FA 1IBLK 4JS5A 4RW7A 4KHYA 4XH1A 2BUPA 4PL7A 4KI6A 3B6PA 1NK8A 3O9RA 4FJ9A 3UKRB 4E7HA 2QK9A 3MECA 5LJWA 4W5RA 5E26A 3W0LA 4IDHA 4C1NI 2JWKA 5FDLA 1JJ2M 2QKBA 3IDHA 4RWTA 3ZT1A 1WBBA 3LP1A 1RBVA 1Q82O 2G8KA 1ZBSA 4HTLA 3UKUA 3HBTA 2VQFK 2GUPA 4CCHA 2QI2A 3OTOK 4LF4K 3P31A 3WXMB 2OPPA 1VSIA 3VGLA 1TK8A 3ALYA 3TAPA 1EWQA 5FPEA 1FK9A 3WNGA 3DI6A 1GOCA 5IT9O 4CBWA 3OS0A 4HHTA 1QQCA 1TYQB 1QQMA 2ZGZA 5TKWA 1W7AA 4AHUA 2IOCA 4KV8A 4DV6K 2Y1IA 3NGYA 4CZGA 4U7BA 4NXNK 1X3NA 1VQLN 3CFRA 4H0OA 3O8MA 3VERA 5CHIA 3SQ4A 5EVZA 1CZBA 3FR0A 1XMOK 1O13A 4O5BA 1ZXOA 1IKVA 3DMJA 1HKCA 4FCYA 4DTJA 1NGBA 3U6FA 4CEEA 2QWLA 3HK2A 4BRNA 2PZSA 4GNIA 5FPMA 1BWFO 3FZFA 2O8CA 5J2PA 1RILA 4HTUA 3FFKB 4BRAA 1BDGA 5TKYA 1A5WA 5KGWA 4I9LA 2UXBK 4KH6A 1L3VA 4W5QA 3EO3A 4DS4A 3GL1A 4H03B 1ZBFA 3O1WA 1ZC6A 3VGMA 3ZX0A 3AVMA 4FJKA 4B1UB 1A5VA 4W5OA 1Y97A 1N34K 1JCEA 1NGFA 4K8ZA 4J2BA 2O8EA 4YHHK 1GLLO 2B5JA 2QW9A 3OS1A 4B3TK 1D8YA 1DLOA 1HRHA 4FVMA 4IFYA 1HQEA 3DRRA 1HNXK 4CF9A 2P9KB 3TI0A 4DUZK 3IG1A 5AZIA 1SL1A 4FZYA 3LANA 1RTHA 4IKFA 1MDUB 1QQNA 4R79A 4WFNL 2I7NA 4MFBA 4YFUA 4Z4FA 2YJFA 1WSJA 4E3SA 3P1GA 4OGCA 1OH6A 4YOXA 3CM5A 3CCRN 2KLAA 5AQRA 2HB5A 4FWQA 1IH7A 4OKEA 4IFEA 3CPEA 1X9WA 1WN7A 3A0IX 4CFCA 5HLFA 3IFRA 3BUZB 1RNHA 1NGDA 2XY7A 4DV5K 1CXQA 3CERA 3DAWA 4NCBA 3HSTB 4CJKA 3JAMO 1VSDA 4CGIA 2XRIA 4PUOA 3P83D 3KK7A 4DFKA 4M3ZA 2ZGYA 5KRSA 4M45A 5HROA 3NH0A 1K9MO 3FZHA 2FLOA 4FWOA 3ENHA 3DXKB 3W3DA 1S9GA 3A8YA 2A1SA 4FWLA 3M1FA 2W41A 2EX3A
chains in the Genus database with same CATH topology
3QIPA 3V9SA 1HJRA 4DU1A 1IG9A 1EP4A 1R0AA 1I3AA 3DRSA 4KAZA 3NFAA 3EY1A 4FLVA 4ZTFA 2YNFA 2YHAA 3MEGA 4CJWA 3I8DA 1LWEA 3O4NA 2O4IA 4JLHA 4EP5A 4FM0A 3DLHA 4CHNA 1ITGA 1C6VA 4BDZA 4K8XA 3ZSOA 1S1UA 1RT6A 1X9MA 2OZMA 4DTUA 1MU2A 2Z1JA 2F96A 4F3TA 3K2PA 1VRTA 3V1OA 3KJVA 3SV3A 1RT1A 4CF1A 3CG7A 1NK4A 3QIOA 3LAKA 3TAGA 2E6LA 3RMAA 3LPUA 1T03A 1J53A 4C8LA 3CFOA 3LAMA 3SUQA 1JLFA 2O4GA 3AVHA 3PV8A 2IS3A 3I0RA 3ZSQA 4Q0BA 5EU7A 4DF8A 4FZZA 4LY7A 3IAYA 1BQNA 4CIEA 3OYLA 4CGHA 3OY9A 3LWLA 4HUFA 2YHBA 1FXXA 5SWMA 3DOLA 4CK2A 4B3OA 3AO2A 4OKJA 5J2NA 3V4IA 4DG1A 3HVTA 4C8MA 2RPIA 3K5LA 1ZBLA 4CHQA 2DTUA 4BE2A 4UQGA 3DYAA 1RDBA 4KPYA 3ZSRA 1TVRA 3HPGA 3RRHA 2G8WA 1L3SA 3LP2A 2DFFA 1SKSA 2EHGA 4FLWA 1SKWA 2PYJA 3HO1A 5HRPA 3LDSA 1BL3A 4FLZA 2RN2A 2GV9A 4F2RA 4DS5A 3MAQA 3NE6A 2BDPA 4EP4A 4DQIA 4KHNA 4J2AA 4KTQA 4FJ5A 4DLEA 4E0DA 2G8VA 5C42A 1HNVA 3TAEA 5CYQA 2RKIA 3OS2A 1HNIA 1TKTA 3NHGA 3PY8A 1S9EA 1VSLA 3KK3A 3RWUA 1BIUA 1JLGA 3BGRA 2RF2A 3OJSA 3EYZA 3NF9A 4GMJB 2OZSA 2KFZA 2KZZA 4CIGA 2HNYA 1LV5A 1CXUA 4F8RA 4H4MA 3DRPA 4CJTA 2FC0A 3LP0A 1S1VA 2ZQBA 3MXJA 1C1CA 3QLHA 5J1EA 3OYJA 3QEWA 4ZTJA 3AVCA 1WSFA 1WNSA 3AA5X 4IFVA 3ZSYA 1KFDA 1U47A 1KLNA 2Z1IA 3KK2A 3DM2A 3AV9A 4Z0UA 2YKMA 1WSIA 4R5PA 2OPSA 4BE1A 1NJYA 2KFNA 5HBMA 3VQBA 4DLGA 4OGEA 3O3HA 1IKXA 1X1PA 4B9SA 1KTQA 3AA4A 3AVGA 5HRSA 3SI6A 3MXMA 2G8FA 3K5NA 3PO4A 4O0IA 5J2MA 3CM6A 4HCCA 2E6MA 1HYZA 4OVLA 1BHLA 3NCIA 4DQQA 4DTRA 2D0CA 1HQUA 2Y1JA 3C95A 3RRGA 3TAMA 1UAXA 3DOKA 4I9QA 4OPKA 2YV0X 5C25A 3OYGA 3PX0A 2HHTA 2ATQA 4KKOA 3RR7A 4RW8A 3DLGA 3HJFA 3AO5A 3ZT2A 4BACA 3ITHA 3L2RA 2XHBA 4DF4A 4Z4EA 3SNNA 4CFBA 1NKBA 3M8RA 1JL1A 3AVAA 1FKPA 3RMDA 4FJ8A 1CLQA 4E89A 4CGFA 1TK5A 4JS4A 4JRPA 2OYQA 4G1QA 4CEQA 3QETA 2X78A 1TGOA 1U49A 1JLQA 2I5JA 3QNNA 1KCFA 1L3TA 4ELTA 4KREA 2JGUA 1KVBA 3EZ5A 2HVHA 4W5TA 2PYLA 2OPRA 2WONA 1QHTA 3SCXA 1FKOA 3TR8A 1N6QA 4Y1DA 4CEAA 4PA1A 2R7YA 2LSNA 4DSIA 1I39A 1VSKA 2XY8A 1NK5A 1QSSA 4E7LA 4CERA 4AHCA 4KB0A 4AHSA 2F8TA 3KLHA 2F8SA 3ZSXA 4CJ4A 5T7BA 1BI4B 4FM1A 4FM2A 3MXIA 3SJJA 4FLUA 2HHXA 1C0TA 3L8BA 3HYFA 5FROA 1A5XA 4B8CA 4FXDA 5JS1A 2WOMA 2A1RA 3M8QA 3ZSZA 1KVCA 3AO1A 4DQSA 2QKKA 2BANA 3SUPA 3B6OA 2DFEA 1NK9A 3CFPA 3QNOA 1QSLA 4AHVA 1TKDA 2KTQA 4GW6A 3ISNC 1NJWA 5CYMA 3C94A 2P5OA 4CIFA 1UA0A 3HVRA 2D0AA 3VQ6A 4CJ5A 3U3GA 4CFDA 1W0HA 4DU4A 4BE0A 3KIOA 2X74A 2XO7A 4DFMA 1JL2A 2GBZA 3NF7A 4GVMA 4CEFA 5E41A 4IG0A 1HPZA 1SL2A 4Q5VA 1VRUA 3VA0A 2VG6A 3OYCA 3HL8A 4LSLA 1D5AA 2VG7A 4DMNA 3I0SA 4FJIA 4J2EA 3QERA 1L5UA 3MEDA 1YTAA 1QTMA 1X9SA 2IDOA 1LAWA 3NAEA 3ZT4A 4ZHRA 2XY5A 4FJ7A 5D3GA 3PUFA 2X6NA 2DY4A 5KI6A 3LPTA 3ZCMA 3M8SA 2HNDA 2ZD1A 4O44A 3AVFA 3T1AA 1XHXA 2G8UA 4DSJA 4CF8A 1C1AA 2Z1GA 1RBUA 5HRRA 3VQ7A 1LAVA 4Z4CA 3LWMA 4E7KA 4DTNA 3BDPA 1NKCA 4BDPA 4NCGA 4KHWA 4CJEA 4KHUA 1F21A 3L3VA 4BDYA 4DFJA 4RW6A 3VQEA 2QXFA 4N47A 4FJMA 3VN5A 5CZ1A 4O4GA 3SPYA 1RTIA 3KLGA 1T8EA 1KFSA 1KLMA 4PY5A 1RT3A 3RTVA 3V9WA 4M3TA 4KTZA 4DTXA 4OJRA 3VQCA 4LH4A 4CHYA 4Y1CA 1NJZA 1Q9XA 3K5MA 3TARA 3AVIA 3VQPA 3LP3A 4FJGA 3TAQA 1QE1A 3NH2A 4BWMA 1S1XA 4Z4GA 1RTJA 3F9KA 3C6TA 4B9VA 1SL0A 1TL1A 3WNEA 3K5OA 1N5YA 1RTDA 4ID5A 3T3FA 4KRFA 5KTQA 3RMBA 1BIZA 4FW2A 3K58A 3OVNA 2HHQA 4KHQA 2XY6A 3O3GA 1JXBA 1ASWA 3O4QA 5CY4A 4RW4A 3T19A 3ZT3A 3OYNA 2YNHA 3HP6A 3KKSA 1HYSA 3KD1E 1GOAA 1D9FA 1DTQA 1YT3A 2NUBA 4CJFA 3KK1A 4DQPA 4OLBA 3M8PA 3NF6A 4N5SA 3VQDA 4H8KA 3OYHA 3OYBA 4XIUA 1NK6A 1RBSA 3SUNA 1RDDA 5I42A 4NCAA 1REVA 4CHZA 2HHUA 1TL3A 3V9XA 2JLEA 4I2QA 1NK0A 4ELUA 3U3YA 5DK5A 5JS2A 3RMCA 4FJJA 4CJLA 3LALA 2HHSA 3G0ZA 3F73A 3THVA 4CJVA 1TV6A 1SKRA 1U48A 1JLAA 3QEVA 4JRQA 4N76A 2VWJA 2HHWA 1S5JA 1ASVA 2FBXA 4DSLA 2DFHA 1VSJA 5HRNA 3OYEA 1W9HA 1KSPA 1CZ9A 4YNQA 4CHOA 4EZ6A 2AJQA 3AA3A 4CFAA 1BISA 3AVJA 4QOZB 4HCBA 1YTUA 3OYDA 5J2QA 4B9MA 1EXQA 2ETJA 4M41A 4JS5A 4RW7A 3NH1A 4KHYA 1J54A 4FLYA 4KI6A 3B6PA 3V6DA 1NK8A 4FJ9A 3ZT0A 4FK2A 4CECA 2HNZA 3AVBA 2HW3A 1S1WA 4DSKA 2BE2A 4E7HA 3K57A 3PX4A 4ELVA 2QK9A 2YNGA 4DWIA 2E4LA 3MECA 4PQUA 1NJXA 4W5RA 4MQ3A 4B8AB 3DLEA 1RT5A 5KGXA 3P5JA 4FYDA 4CGGA 4FJNA 3DLKA 1QS4A 5FDLA 2HVIA 1RT2A 2QKBA 4B9NA 4KI4A 4TSXA 1U45A 1LWFA 3AVLA 4CHPA 1XHZA 2YKNA 4BWJA 3ZT1A 4CK3A 3OYKA 3LP1A 4Z4HA 5C24A 1RBVA 1J9AA 2G8KA 3VQ5A 3HT3A 3HPOA 3JYTA 1C1BA 3AVNA 4DSFA 4CJUA 3NDKA 1XWLA 3V9ZA 1LWCA 3PX6A 4CCHA 3OYFA 4NYNA 4O55A 2GUIA 4CEZA 1EX4A 2ZE2A 2Q3SA 1KVAA 1U4BA 3VQ8A 3QESA 2OPPA 1VSIA 3V1RA 1TK8A 3ALYA 3E01A 3O3FA 1WAFA 1FK9A 1SUQA 3WNGA 3DI6A 4FW1A 4KTWA 2G8HA 1BQMA 1GOCA 3SZ2A 4J2DA 1TAUA 4PWDA 2VWKA 3DLRA 4CEBA 1B9DA 1RBRA 4QAGA 3TAFA 1LW0A 2Z1HA 3OS0A 4HHTA 1QQCA 3IS9A 4M3RA 1WSEA 3WNHA 4I7FA 2W42A 3SV4A 4F2SA 3KLFA 3PO5A 2IAJA 1HYVA 3AA2A 1DTTA 4AHUA 4B9TA 1EKEA 2IOCA 4KV8A 1RT4A 4B9UA 2Y1IA 3RR8A 3AO4A 4RW9A 2ITGA 3NGYA 2P1JA 3S3NA 4WE1A 4ID1A 4E1MA 2P5GA 3ULDA 2KZMA 3V81A 4C8KA 4CEDA 3VQAA 3ZSVA 3CFRA 4QCLA 4KFBA 3HPHA 3SQ4A 1XC9A 1CZBA 1RBTA 3QO9A 3OJUA 3VQ9A 4O5BA 1JXEA 4M3WA 3TAPA 1BGXT 1O1WA 5FRNA 4F3OA 5K14A 4AH9A 4OPJA 3LZIA 1IKVA 3DMJA 4FLTA 4FJLA 3VA3A 4FCYA 4CESA 4DTJA 4KB1A 3U6FA 4CEEA 1TKZA 3HK2A 1XI1A 1S1TA 2PZSA 1BCOA 4AHTA 4DTPA 2BGGA 3SYZA 4FZXC 2X6SA 4FK0A 1U04A 3SQ0A 1S6QA 2KQ2A 5CZ2A 1LW2A 4CE9A 1VSMA 4FK4A 3A2FA 4DTOA 5J2PA 1VSFA 2YNIA 1JLBA 1NOZA 1G15A 1RILA 1B9FA 4HTUA 1NK7A 3TANA 3K59A 1ZBUA 4CEOA 3D45A 4LSNA 4OKKA 1A5WA 5KGWA 1GOBA 4I9LA 3QEIA 3IRXA 4M42A 4ICLA 4W5QA 1L3VA 3LZJA 3NBPA 4DS4A 1VK0A 5I3UA 3L2VA 1QSYA 1WLJA 2FBVA 4LD0A 4AHRA 1ZBFA 1UWBA 4CGJA 4OLAA 3L3UA 3AVMA 3CQ8A 4DTMA 4FJKA 1IKWA 3SQ1A 1JLCA 1NKEA 1VSHA 4HUGA 3UIQA 3OYAA 2HHVA 1A5VA 4H4OA 4N41A 1RDCA 4W5OA 1Y97A 2IGIA 1T7PA 5SZTA 4IG3A 3WNFA 3OYIA 4K8ZA 3CYMA 4J2BA 1ZYQA 1BI4A 4W5NA 1J5OA 3C6UA 4CGDA 3S3OA 1RDAA 4HUEA 3KKRA 5DMRA 3S3MA 2HMIA 3KLEA 2B5JA 4CJSA 4CJQA 3NGIA 3NF8A 4CF0A 2G8IA 2D5RA 3OS1A 3ZSWA 1L3UA 1D8YA 1DLOA 1HRHA 4FVMA 1WSGA 2P51A 4IFYA 1HQEA 1TKXA 3DRRA 2B4JA 3D0PA 4EZ9A 2OA8A 4NYFA 4E1NA 4DTSA 4IDKA 4CF9A 1ZBHA 1JKHA 4E19A 3L2WA 3IG1A 3TI0A 1SL1A 1TAQA 4M3UA 4O0JA 3JSMA 4N56A 4FZYA 4FLXA 5FRMA 4KO0A 3V1QA 1Q8IA 3LANA 1IKYA 1RT7A 1RTHA 4DQRA 4RG8A 4IKFA 3HXMA 4HVJA 1JLEA 3ASMA 3L2QA 1S6PA 4LH5A 4MFBA 4YFUA 1NOYA 4Z4FA 1UA1A 1SV5A 1RCHA 1WSJA 4L8RB 4E3SA 4AILC 3P1GA 4OGCA 3G10A 3QEXA 3QEPA 3SPZA 3FFIA 3KTQA 1ZBIA 4CJ3A 4B08A 4E7IA 1EETA 3CM5A 4M3XA 2IC3A 3DLBA 2HB5A 1IH7A 1Z25A 2FBTA 4OKEA 4CJPA 4DSEA 3TWHA 1X9WA 4FJXA 3HM9A 4DFPA 1Q9YA 1WN7A 3SQ2A 1K6YA 4CFCA 3S9HA 4CK1A 3NGZA 1C0UA 5HLFA 4Z4IA 4E7JA 1VSEA 1KRPA 2B6AA 1RNHA 5KRTA 5HP1A 1TK0A 3VQ4A 2XY7A 3KD5E 1CXQA 3HP9A 3OYMA 2VG5A 3V9UA 3TABA 4NCBA 3HSTB 4CF2A 4FJHA 1Z26A 1B92A 4CJKA 1VSDA 1YVUA 2XRIA 4CGIA 2KW4A 3QINA 4PUOA 4M3YA 2OPQA 3P83D 2PY5A 2FBYA 4DFKA 4M3ZA 1C0MA 2D0BA 1UOCA 4IBNA 4I2PA 5KRSA 3KLIA 4M45A 1ASUA 3L2UA 5HROA 3NH0A 1T05A 1D9DA 3SUOA 4C8OA 4KHSA 1BCMA 3MEEA 2A1SA 4DU3A 3H08A 1HMVA 3VQQA 4CJRA 4B9LA 4C8NA 3AVKA 3AO3A 1IO2A 1S9GA 4F4KA 1WSHA 1WAJA 2EX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QIP A;  3V9S A;  1HJR A;  4DU1 A;  1IG9 A;  1EP4 A;  1R0A A;  1I3A A;  3DRS A;  4KAZ A;  3NFA A;  3EY1 A;  4FLV A;  4ZTF A;  2YNF A;  2YHA A;  3MEG A;  4CJW A;  3I8D A;  1LWE A;  3O4N A;  2O4I A;  4JLH A;  4EP5 A;  4FM0 A;  3DLH A;  4CHN A;  1ITG A;  1C6V A;  4BDZ A;  4K8X A;  3ZSO A;  1S1U A;  1RT6 A;  1X9M A;  2OZM A;  4DTU A;  1MU2 A;  2Z1J A;  2F96 A;  4F3T A;  3K2P A;  1VRT A;  3V1O A;  3KJV A;  3SV3 A;  1RT1 A;  4CF1 A;  3CG7 A;  1NK4 A;  3QIO A;  3LAK A;  3TAG A;  2E6L A;  3RMA A;  3LPU A;  1T03 A;  1J53 A;  4C8L A;  3CFO A;  3LAM A;  3SUQ A;  1JLF A;  2O4G A;  3AVH A;  3PV8 A;  2IS3 A;  3I0R A;  3ZSQ A;  4Q0B A;  5EU7 A;  4DF8 A;  4FZZ A;  4LY7 A;  3IAY A;  1BQN A;  4CIE A;  3OYL A;  4CGH A;  3OY9 A;  3LWL A;  4HUF A;  2YHB A;  1FXX A;  5SWM A;  3DOL A;  4CK2 A;  4B3O A;  3AO2 A;  4OKJ A;  5J2N A;  3V4I A;  4DG1 A;  3HVT A;  4C8M A;  2RPI A;  3K5L A;  1ZBL A;  4CHQ A;  2DTU A;  4BE2 A;  4UQG A;  3DYA A;  1RDB A;  4KPY A;  3ZSR A;  1TVR A;  3HPG A;  3RRH A;  2G8W A;  1L3S A;  3LP2 A;  2DFF A;  1SKS A;  2EHG A;  4FLW A;  1SKW A;  2PYJ A;  3HO1 A;  5HRP A;  3LDS A;  1BL3 A;  4FLZ A;  2RN2 A;  2GV9 A;  4F2R A;  4DS5 A;  3MAQ A;  3NE6 A;  2BDP A;  4EP4 A;  4DQI A;  4KHN A;  4J2A A;  4KTQ A;  4FJ5 A;  4DLE A;  4E0D A;  2G8V A;  5C42 A;  1HNV A;  3TAE A;  5CYQ A;  2RKI A;  3OS2 A;  1HNI A;  1TKT A;  3NHG A;  3PY8 A;  1S9E A;  1VSL A;  3KK3 A;  3RWU A;  1BIU A;  1JLG A;  3BGR A;  2RF2 A;  3OJS A;  3EYZ A;  3NF9 A;  4GMJ B;  2OZS A;  2KFZ A;  2KZZ A;  4CIG A;  2HNY A;  1LV5 A;  1CXU A;  4F8R A;  4H4M A;  3DRP A;  4CJT A;  2FC0 A;  3LP0 A;  1S1V A;  2ZQB A;  3MXJ A;  1C1C A;  3QLH A;  5J1E A;  3OYJ A;  3QEW A;  4ZTJ A;  3AVC A;  1WSF A;  1WNS A;  3AA5 X;  4IFV A;  3ZSY A;  1KFD A;  1U47 A;  1KLN A;  2Z1I A;  3KK2 A;  3DM2 A;  3AV9 A;  4Z0U A;  2YKM A;  1WSI A;  4R5P A;  2OPS A;  4BE1 A;  1NJY A;  2KFN A;  5HBM A;  3VQB A;  4DLG A;  4OGE A;  3O3H A;  1IKX A;  1X1P A;  4B9S A;  1KTQ A;  3AA4 A;  3AVG A;  5HRS A;  3SI6 A;  3MXM A;  2G8F A;  3K5N A;  3PO4 A;  4O0I A;  5J2M A;  3CM6 A;  4HCC A;  2E6M A;  1HYZ A;  4OVL A;  1BHL A;  3NCI A;  4DQQ A;  4DTR A;  2D0C A;  1HQU A;  2Y1J A;  3C95 A;  3RRG A;  3TAM A;  1UAX A;  3DOK A;  4I9Q A;  4OPK A;  2YV0 X;  5C25 A;  3OYG A;  3PX0 A;  2HHT A;  2ATQ A;  4KKO A;  3RR7 A;  4RW8 A;  3DLG A;  3HJF A;  3AO5 A;  3ZT2 A;  4BAC A;  3ITH A;  3L2R A;  2XHB A;  4DF4 A;  4Z4E A;  3SNN A;  4CFB A;  1NKB A;  3M8R A;  1JL1 A;  3AVA A;  1FKP A;  3RMD A;  4FJ8 A;  1CLQ A;  4E89 A;  4CGF A;  1TK5 A;  4JS4 A;  4JRP A;  2OYQ A;  4G1Q A;  4CEQ A;  3QET A;  2X78 A;  1TGO A;  1U49 A;  1JLQ A;  2I5J A;  3QNN A;  1KCF A;  1L3T A;  4ELT A;  4KRE A;  2JGU A;  1KVB A;  3EZ5 A;  2HVH A;  4W5T A;  2PYL A;  2OPR A;  2WON A;  1QHT A;  3SCX A;  1FKO A;  3TR8 A;  1N6Q A;  4Y1D A;  4CEA A;  4PA1 A;  2R7Y A;  2LSN A;  4DSI A;  1I39 A;  1VSK A;  2XY8 A;  1NK5 A;  1QSS A;  4E7L A;  4CER A;  4AHC A;  4KB0 A;  4AHS A;  2F8T A;  3KLH A;  2F8S A;  3ZSX A;  4CJ4 A;  5T7B A;  1BI4 B;  4FM1 A;  4FM2 A;  3MXI A;  3SJJ A;  4FLU A;  2HHX A;  1C0T A;  3L8B A;  3HYF A;  5FRO A;  1A5X A;  4B8C A;  4FXD A;  5JS1 A;  2WOM A;  2A1R A;  3M8Q A;  3ZSZ A;  1KVC A;  3AO1 A;  4DQS A;  2QKK A;  2BAN A;  3SUP A;  3B6O A;  2DFE A;  1NK9 A;  3CFP A;  3QNO A;  1QSL A;  4AHV A;  1TKD A;  2KTQ A;  4GW6 A;  3ISN C;  1NJW A;  5CYM A;  3C94 A;  2P5O A;  4CIF A;  1UA0 A;  3HVR A;  2D0A A;  3VQ6 A;  4CJ5 A;  3U3G A;  4CFD A;  1W0H A;  4DU4 A;  4BE0 A;  3KIO A;  2X74 A;  2XO7 A;  4DFM A;  1JL2 A;  2GBZ A;  3NF7 A;  4GVM A;  4CEF A;  5E41 A;  4IG0 A;  1HPZ A;  1SL2 A;  4Q5V A;  1VRU A;  3VA0 A;  2VG6 A;  3OYC A;  3HL8 A;  4LSL A;  1D5A A;  2VG7 A;  4DMN A;  3I0S A;  4FJI A;  4J2E A;  3QER A;  1L5U A;  3MED A;  1YTA A;  1QTM A;  1X9S A;  2IDO A;  1LAW A;  3NAE A;  3ZT4 A;  4ZHR A;  2XY5 A;  4FJ7 A;  5D3G A;  3PUF A;  2X6N A;  2DY4 A;  5KI6 A;  3LPT A;  3ZCM A;  3M8S A;  2HND A;  2ZD1 A;  4O44 A;  3AVF A;  3T1A A;  1XHX A;  2G8U A;  4DSJ A;  4CF8 A;  1C1A A;  2Z1G A;  1RBU A;  5HRR A;  3VQ7 A;  1LAV A;  4Z4C A;  3LWM A;  4E7K A;  4DTN A;  3BDP A;  1NKC A;  4BDP A;  4NCG A;  4KHW A;  4CJE A;  4KHU A;  1F21 A;  3L3V A;  4BDY A;  4DFJ A;  4RW6 A;  3VQE A;  2QXF A;  4N47 A;  4FJM A;  3VN5 A;  5CZ1 A;  4O4G A;  3SPY A;  1RTI A;  3KLG A;  1T8E A;  1KFS A;  1KLM A;  4PY5 A;  1RT3 A;  3RTV A;  3V9W A;  4M3T A;  4KTZ A;  4DTX A;  4OJR A;  3VQC A;  4LH4 A;  4CHY A;  4Y1C A;  1NJZ A;  1Q9X A;  3K5M A;  3TAR A;  3AVI A;  3VQP A;  3LP3 A;  4FJG A;  3TAQ A;  1QE1 A;  3NH2 A;  4BWM A;  1S1X A;  4Z4G A;  1RTJ A;  3F9K A;  3C6T A;  4B9V A;  1SL0 A;  1TL1 A;  3WNE A;  3K5O A;  1N5Y A;  1RTD A;  4ID5 A;  3T3F A;  4KRF A;  5KTQ A;  3RMB A;  1BIZ A;  4FW2 A;  3K58 A;  3OVN A;  2HHQ A;  4KHQ A;  2XY6 A;  3O3G A;  1JXB A;  1ASW A;  3O4Q A;  5CY4 A;  4RW4 A;  3T19 A;  3ZT3 A;  3OYN A;  2YNH A;  3HP6 A;  3KKS A;  1HYS A;  3KD1 E;  1GOA A;  1D9F A;  1DTQ A;  1YT3 A;  2NUB A;  4CJF A;  3KK1 A;  4DQP A;  4OLB A;  3M8P A;  3NF6 A;  4N5S A;  3VQD A;  4H8K A;  3OYH A;  3OYB A;  4XIU A;  1NK6 A;  1RBS A;  3SUN A;  1RDD A;  5I42 A;  4NCA A;  1REV A;  4CHZ A;  2HHU A;  1TL3 A;  3V9X A;  2JLE A;  4I2Q A;  1NK0 A;  4ELU A;  3U3Y A;  5DK5 A;  5JS2 A;  3RMC A;  4FJJ A;  4CJL A;  3LAL A;  2HHS A;  3G0Z A;  3F73 A;  3THV A;  4CJV A;  1TV6 A;  1SKR A;  1U48 A;  1JLA A;  3QEV A;  4JRQ A;  4N76 A;  2VWJ A;  2HHW A;  1S5J A;  1ASV A;  2FBX A;  4DSL A;  2DFH A;  1VSJ A;  5HRN A;  3OYE A;  1W9H A;  1KSP A;  1CZ9 A;  4YNQ A;  4CHO A;  4EZ6 A;  2AJQ A;  3AA3 A;  4CFA A;  1BIS A;  3AVJ A;  4QOZ B;  4HCB A;  1YTU A;  3OYD A;  5J2Q A;  4B9M A;  1EXQ A;  2ETJ A;  4M41 A;  4JS5 A;  4RW7 A;  3NH1 A;  4KHY A;  1J54 A;  4FLY A;  4KI6 A;  3B6P A;  3V6D A;  1NK8 A;  4FJ9 A;  3ZT0 A;  4FK2 A;  4CEC A;  2HNZ A;  3AVB A;  2HW3 A;  1S1W A;  4DSK A;  2BE2 A;  4E7H A;  3K57 A;  3PX4 A;  4ELV A;  2QK9 A;  2YNG A;  4DWI A;  2E4L A;  3MEC A;  4PQU A;  1NJX A;  4W5R A;  4MQ3 A;  4B8A B;  3DLE A;  1RT5 A;  5KGX A;  3P5J A;  4FYD A;  4CGG A;  4FJN A;  3DLK A;  1QS4 A;  5FDL A;  2HVI A;  1RT2 A;  2QKB A;  4B9N A;  4KI4 A;  4TSX A;  1U45 A;  1LWF A;  3AVL A;  4CHP A;  1XHZ A;  2YKN A;  4BWJ A;  3ZT1 A;  4CK3 A;  3OYK A;  3LP1 A;  4Z4H A;  5C24 A;  1RBV A;  1J9A A;  2G8K A;  3VQ5 A;  3HT3 A;  3HPO A;  3JYT A;  1C1B A;  3AVN A;  4DSF A;  4CJU A;  3NDK A;  1XWL A;  3V9Z A;  1LWC A;  3PX6 A;  4CCH A;  3OYF A;  4NYN A;  4O55 A;  2GUI A;  4CEZ A;  1EX4 A;  2ZE2 A;  2Q3S A;  1KVA A;  1U4B A;  3VQ8 A;  3QES A;  2OPP A;  1VSI A;  3V1R A;  1TK8 A;  3ALY A;  3E01 A;  3O3F A;  1WAF A;  1FK9 A;  1SUQ A;  3WNG A;  3DI6 A;  4FW1 A;  4KTW A;  2G8H A;  1BQM A;  1GOC A;  3SZ2 A;  4J2D A;  1TAU A;  4PWD A;  2VWK A;  3DLR A;  4CEB A;  1B9D A;  1RBR A;  4QAG A;  3TAF A;  1LW0 A;  2Z1H A;  3OS0 A;  4HHT A;  1QQC A;  3IS9 A;  4M3R A;  1WSE A;  3WNH A;  4I7F A;  2W42 A;  3SV4 A;  4F2S A;  3KLF A;  3PO5 A;  2IAJ A;  1HYV A;  3AA2 A;  1DTT A;  4AHU A;  4B9T A;  1EKE A;  2IOC A;  4KV8 A;  1RT4 A;  4B9U A;  2Y1I A;  3RR8 A;  3AO4 A;  4RW9 A;  2ITG A;  3NGY A;  2P1J A;  3S3N A;  4WE1 A;  4ID1 A;  4E1M A;  2P5G A;  3ULD A;  2KZM A;  3V81 A;  4C8K A;  4CED A;  3VQA A;  3ZSV A;  3CFR A;  4QCL A;  4KFB A;  3HPH A;  3SQ4 A;  1XC9 A;  1CZB A;  1RBT A;  3QO9 A;  3OJU A;  3VQ9 A;  4O5B A;  1JXE A;  4M3W A;  3TAP A;  1BGX T;  1O1W A;  5FRN A;  4F3O A;  5K14 A;  4AH9 A;  4OPJ A;  3LZI A;  1IKV A;  3DMJ A;  4FLT A;  4FJL A;  3VA3 A;  4FCY A;  4CES A;  4DTJ A;  4KB1 A;  3U6F A;  4CEE A;  1TKZ A;  3HK2 A;  1XI1 A;  1S1T A;  2PZS A;  1BCO A;  4AHT A;  4DTP A;  2BGG A;  3SYZ A;  4FZX C;  2X6S A;  4FK0 A;  1U04 A;  3SQ0 A;  1S6Q A;  2KQ2 A;  5CZ2 A;  1LW2 A;  4CE9 A;  1VSM A;  4FK4 A;  3A2F A;  4DTO A;  5J2P A;  1VSF A;  2YNI A;  1JLB A;  1NOZ A;  1G15 A;  1RIL A;  1B9F A;  4HTU A;  1NK7 A;  3TAN A;  3K59 A;  1ZBU A;  4CEO A;  3D45 A;  4LSN A;  4OKK A;  1A5W A;  5KGW A;  1GOB A;  4I9L A;  3QEI A;  3IRX A;  4M42 A;  4ICL A;  4W5Q A;  1L3V A;  3LZJ A;  3NBP A;  4DS4 A;  1VK0 A;  5I3U A;  3L2V A;  1QSY A;  1WLJ A;  2FBV A;  4LD0 A;  4AHR A;  1ZBF A;  1UWB A;  4CGJ A;  4OLA A;  3L3U A;  3AVM A;  3CQ8 A;  4DTM A;  4FJK A;  1IKW A;  3SQ1 A;  1JLC A;  1NKE A;  1VSH A;  4HUG A;  3UIQ A;  3OYA A;  2HHV A;  1A5V A;  4H4O A;  4N41 A;  1RDC A;  4W5O A;  1Y97 A;  2IGI A;  1T7P A;  5SZT A;  4IG3 A;  3WNF A;  3OYI A;  4K8Z A;  3CYM A;  4J2B A;  1ZYQ A;  1BI4 A;  4W5N A;  1J5O A;  3C6U A;  4CGD A;  3S3O A;  1RDA A;  4HUE A;  3KKR A;  5DMR A;  3S3M A;  2HMI A;  3KLE A;  2B5J A;  4CJS A;  4CJQ A;  3NGI A;  3NF8 A;  4CF0 A;  2G8I A;  2D5R A;  3OS1 A;  3ZSW A;  1L3U A;  1D8Y A;  1DLO A;  1HRH A;  4FVM A;  1WSG A;  2P51 A;  4IFY A;  1HQE A;  1TKX A;  3DRR A;  2B4J A;  3D0P A;  4EZ9 A;  2OA8 A;  4NYF A;  4E1N A;  4DTS A;  4IDK A;  4CF9 A;  1ZBH A;  1JKH A;  4E19 A;  3L2W A;  3IG1 A;  3TI0 A;  1SL1 A;  1TAQ A;  4M3U A;  4O0J A;  3JSM A;  4N56 A;  4FZY A;  4FLX A;  5FRM A;  4KO0 A;  3V1Q A;  1Q8I A;  3LAN A;  1IKY A;  1RT7 A;  1RTH A;  4DQR A;  4RG8 A;  4IKF A;  3HXM A;  4HVJ A;  1JLE A;  3ASM A;  3L2Q A;  1S6P A;  4LH5 A;  4MFB A;  4YFU A;  1NOY A;  4Z4F A;  1UA1 A;  1SV5 A;  1RCH A;  1WSJ A;  4L8R B;  4E3S A;  4AIL C;  3P1G A;  4OGC A;  3G10 A;  3QEX A;  3QEP A;  3SPZ A;  3FFI A;  3KTQ A;  1ZBI A;  4CJ3 A;  4B08 A;  4E7I A;  1EET A;  3CM5 A;  4M3X A;  2IC3 A;  3DLB A;  2HB5 A;  1IH7 A;  1Z25 A;  2FBT A;  4OKE A;  4CJP A;  4DSE A;  3TWH A;  1X9W A;  4FJX A;  3HM9 A;  4DFP A;  1Q9Y A;  1WN7 A;  3SQ2 A;  1K6Y A;  4CFC A;  3S9H A;  4CK1 A;  3NGZ A;  1C0U A;  5HLF A;  4Z4I A;  4E7J A;  1VSE A;  1KRP A;  2B6A A;  1RNH A;  5KRT A;  5HP1 A;  1TK0 A;  3VQ4 A;  2XY7 A;  3KD5 E;  1CXQ A;  3HP9 A;  3OYM A;  2VG5 A;  3V9U A;  3TAB A;  4NCB A;  3HST B;  4CF2 A;  4FJH A;  1Z26 A;  1B92 A;  4CJK A;  1VSD A;  1YVU A;  2XRI A;  4CGI A;  2KW4 A;  3QIN A;  4PUO A;  4M3Y A;  2OPQ A;  3P83 D;  2PY5 A;  2FBY A;  4DFK A;  4M3Z A;  1C0M A;  2D0B A;  1UOC A;  4IBN A;  4I2P A;  5KRS A;  3KLI A;  4M45 A;  1ASU A;  3L2U A;  5HRO A;  3NH0 A;  1T05 A;  1D9D A;  3SUO A;  4C8O A;  4KHS A;  1BCM A;  3MEE A;  2A1S A;  4DU3 A;  3H08 A;  1HMV A;  3VQQ A;  4CJR A;  4B9L A;  4C8N A;  3AVK A;  3AO3 A;  1IO2 A;  1S9G A;  4F4K A;  1WSH A;  1WAJ A;  2EX3 A; 
#chains in the Genus database with same CATH topology
 3V9S A;  3O80 A;  4JI0 K;  1EP4 A;  4IXC A;  3DRS A;  4LFA K;  4ZTF A;  4CJW A;  4DR5 K;  3O4N A;  4EP5 A;  4CHN A;  1ITG A;  1MU2 A;  3K2P A;  1VRT A;  2CH6 A;  3V1O A;  4CD3 A;  3SV3 A;  3PLA A;  2D4W A;  3ULE A;  4CBX A;  1J53 A;  3SUQ A;  1JLF A;  4BQZ A;  3PV8 A;  2GEL A;  2IS3 A;  2YJE A;  5BRH A;  5MLC Q;  4DF8 A;  2F9W A;  3MWP A;  4CIE A;  2D1K A;  3LWL A;  3G71 N;  5GIO A;  3TSU A;  5BPL A;  4BVP A;  4CHQ A;  5KPZ A;  3GBT A;  4KPY A;  3ZSR A;  3LP2 A;  1SKS A;  5DM7 L;  5KPR A;  2QWR A;  5HRP A;  4JD2 A;  4RTF D;  4BRH A;  4JKB A;  3G4S N;  2IVN A;  4IJA A;  1HNV A;  1RDW X;  5CYQ A;  2RKI A;  3TAE A;  3PY8 A;  3OBY A;  1S9E A;  3KK3 A;  3BGR A;  3OJS A;  2KZZ A;  3NF9 A;  2KFZ A;  3J7Z O;  3C7N A;  4JV5 K;  3DRP A;  4O5F A;  4EHU A;  3TU5 A;  3LP0 A;  2ZQB A;  1Q18 A;  2Q0U A;  3QLH A;  4FL9 A;  3OYJ A;  3AVC A;  4EHT A;  3AV9 A;  4BE1 A;  4X64 K;  4CZF A;  5HBM A;  3VQB A;  4OGE A;  2PBD A;  4B9S A;  5HRS A;  3AA4 A;  3AGK A;  3MXM A;  4O0I A;  5J2M A;  3CM6 A;  1HYZ A;  1NGE A;  2UU9 K;  2IVP A;  3MN7 A;  3VGK A;  2HBM A;  1HQU A;  3TAM A;  4YOU A;  1BO5 O;  1YF5 L;  3DOK A;  4NO7 A;  1HKB A;  2YV0 X;  4LF5 K;  5C25 A;  4KHP K;  3HJF A;  3AO5 A;  3ZT2 A;  2A3Z A;  3VEX A;  3L2R A;  2XHB A;  4Z4E A;  1M90 O;  3AVA A;  3RMD A;  4FWN A;  5FLX O;  4JS4 A;  1TK5 A;  3A5L C;  3WQU A;  2OYQ A;  1TGO A;  3IKM A;  2JGU A;  1NLV A;  4CEA A;  5AQZ A;  1VSK A;  1XC3 A;  3MWT A;  2QWO A;  1XMQ K;  4FM2 A;  5T7B A;  1KXP A;  4FLU A;  1NBW A;  2HHX A;  3L8B A;  5FRO A;  3LM2 A;  2A1R A;  4DR2 K;  1KVC A;  3LDQ A;  2BAN A;  3B6O A;  1TUU A;  3QNO A;  4B1W B;  1TKD A;  2NRZ A;  1NJW A;  2QWP A;  4GV3 A;  3KWG A;  4FSV A;  2D0A A;  4YY3 K;  2X74 A;  2NRH A;  5F1X A;  5JVH L;  4CEF A;  5E41 A;  1OH8 A;  1SL2 A;  5KPT A;  3OYC A;  4J2E A;  3CME N;  1S3X A;  1WBD A;  4FJ7 A;  2XY5 A;  5D3G A;  3PUF A;  2X6N A;  5AQP A;  2VQE K;  3ZCM A;  3M8S A;  3H45 C;  1VQ7 N;  2QEX N;  4CF8 A;  1RBU A;  2FSK A;  2ASO A;  1LAV A;  4Z4C A;  4E7K A;  4KHU A;  3MN6 A;  4DFJ A;  3E9L A;  3L6Q A;  3VN5 A;  1T8E A;  4JNE A;  1KFS A;  4PY5 A;  1RT3 A;  4JI2 K;  3RTV A;  3O9Q A;  4KTZ A;  4DTX A;  4OJR A;  4G9Z A;  3CC7 N;  3FZM A;  2CGJ A;  4DUY K;  4BRC A;  2AP1 A;  3ATV A;  4FJG A;  4IEI A;  4BRI A;  4BWM A;  4Z4G A;  1RTJ A;  4B9V A;  1DT9 A;  3QIC A;  5AQV A;  2F7T A;  1OVQ A;  5KTQ A;  1YJN N;  3VET A;  2XY6 A;  5EX5 A;  1U49 A;  1JXB A;  3T19 A;  2QXL A;  3KD1 E;  1P8Z A;  1GOA A;  1K8K B;  2GWK A;  1D9F A;  4N5S A;  3D2E B;  3OYH A;  3VF6 A;  3HSC A;  3SUN A;  1RDD A;  1EO1 A;  4CHZ A;  3V9X A;  4I2Q A;  1NK0 A;  2ZJR L;  5FPN A;  3F73 A;  3R9P A;  5AR0 A;  1N36 K;  4IWV A;  2A6A A;  4RCH A;  4JKF A;  1BOT O;  1S5J A;  2FBX A;  1VSJ A;  2RE2 A;  1CZ9 A;  5JLF A;  4H0X B;  5M1Q A;  4CZM A;  3HOT A;  4AM7 A;  1YTU A;  4FO0 A;  5AQW A;  4M41 A;  4B9M A;  3NH1 A;  1XUP O;  4FLY A;  3CC2 N;  5C0Y A;  2QWM A;  3ZT0 A;  2E5L K;  2HNZ A;  3AVB A;  2HW3 A;  1K8A O;  4DSK A;  2Q1N A;  3K57 A;  2YNG A;  4DWI A;  4PQU A;  4B8A B;  1RT5 A;  3HZ6 A;  4GKK K;  3P5J A;  4C1N K;  4CGG A;  3DLK A;  1QS4 A;  5AFU A;  1RT2 A;  4B9N A;  1U45 A;  1LWF A;  3AVL A;  1XHZ A;  1HJO A;  1C1B A;  4DV7 K;  3NDK A;  4GY2 B;  1YAG A;  3V9Z A;  2Q3S A;  2ZE2 A;  1VQK N;  1U4B A;  4JYA K;  3U9Z A;  2IVO A;  1HKG A;  4I6M B;  2G8H A;  1WAF A;  4FW1 A;  3DLR A;  5M1K A;  1B9D A;  3TAF A;  3FGU A;  4CJ7 A;  4A62 A;  2KKZ A;  2UXD K;  3KLF A;  3WQT A;  2VYP A;  3MX2 A;  1W2B M;  3PO5 A;  3AA2 A;  3ZET A;  4B9T A;  4WE1 A;  3TSQ A;  3F9M A;  4ID1 A;  4K25 A;  1VQ5 N;  5HOO A;  5C2D A;  1RFQ A;  3HPH A;  1XC9 A;  3C6H A;  2UUA K;  3VQ9 A;  1JXE A;  1BGX T;  3RSE A;  4F3O A;  4FJL A;  1NJI O;  1X9J A;  4O8U A;  3IUC A;  3CCM N;  2D0P A;  3VMF B;  4CW7 B;  2BGG A;  4FZX C;  3UKU B;  1U04 A;  2KQ2 A;  2CH5 A;  5CZ2 A;  4CE9 A;  4BVO A;  2NLX A;  2WUS A;  1VSF A;  1G15 A;  1B9F A;  1ZBU A;  4CEO A;  3D45 A;  4LSN A;  4OKK A;  3QEI A;  3J80 O;  3ZX2 A;  3LZJ A;  1VK0 A;  5I3U A;  3L2V A;  1S72 N;  1QSY A;  2FBV A;  4AHR A;  1UWB A;  4JKG A;  1NGI A;  2HOE A;  3R3L A;  1VSH A;  4HUG A;  2ASM A;  4A61 A;  3OYA A;  4B3S K;  1T7P A;  4AF1 A;  3WNF A;  1BI4 A;  3NVM A;  3KWI A;  4HUE A;  2HMI A;  4M7Y A;  4IOA L;  3KLE A;  2OCE A;  4CF0 A;  3VF2 A;  2BH1 A;  2D5R A;  2RHK A;  1LCU A;  1L3U A;  3TTD A;  2P9U A;  4DKW A;  3D0P A;  4NYF A;  3O9T A;  2NRT A;  2UUC K;  1ZBH A;  1JKH A;  4WQ5 C;  3E9P A;  4GVE A;  3JSM A;  4FLX A;  4H0V B;  3CCS N;  3ENB A;  1RT7 A;  4DQR A;  2O8C B;  4HVJ A;  3WXI A;  4LH5 A;  2QWQ A;  2HBJ A;  1HUX A;  3QEX A;  3FFI A;  2HF3 A;  3DLB A;  4XH4 A;  3TWH A;  1IJJ A;  1K6Y A;  3CJ9 A;  3S9H A;  4CK1 A;  2NRR A;  3I56 N;  1FJG K;  1GLE G;  4FOI A;  4Z4I A;  3WEE A;  3U8X A;  1Z26 A;  1B92 A;  2KW4 A;  4M3Y A;  2O8E B;  1C0M A;  4IBN A;  4I2P A;  2P9S B;  1NGJ A;  3KLI A;  3OBW A;  1ASU A;  1BCM A;  1JCG A;  4DU3 A;  2KHO A;  3H08 A;  5GAH P;  3DJC A;  3HRG A;  3CJ7 A;  3QIP A;  1P90 A;  1HJR A;  1MA9 B;  1IG9 A;  5CR4 A;  3G25 A;  4KAZ A;  4JK8 A;  3I8D A;  3SAF A;  2O4I A;  1GLF O;  1C6V A;  2YCH A;  4K8X A;  3ZSO A;  3LDN A;  4DV1 K;  1RT1 A;  4CF1 A;  1NK4 A;  3LAK A;  2E6L A;  3RMA A;  4C8L A;  3LAM A;  3O5B A;  2O4G A;  3AVH A;  3I0R A;  3ZSQ A;  5EU7 A;  4DR3 K;  2O8D A;  3OY9 A;  2YHB A;  3J8A A;  4B3O A;  4OKJ A;  3V4I A;  3QDK A;  4C8M A;  4JI3 K;  3K5L A;  2NRV A;  1ZBL A;  1IV0 A;  2DTU A;  4BE2 A;  3H3O B;  2G8W A;  3HPG A;  1L3S A;  4FLW A;  2PYJ A;  3EZW A;  1SKW A;  1BL3 A;  2QM1 A;  2YHW A;  4F2R A;  3L4Q A;  2BDP A;  4DQI A;  2F4V K;  4FJ5 A;  3UKR A;  4JN4 A;  4E0D A;  5C42 A;  4Y0W A;  1NGC A;  4BRL A;  4EFH A;  1IG8 A;  4QS8 A;  4CZI A;  3RWU A;  1JLG A;  2OZS A;  3LDP A;  1WB9 A;  2I7P A;  2HNY A;  4OO1 J;  4F8R A;  2FC0 A;  3MXJ A;  4JI1 K;  1C1C A;  5J1E A;  3QEW A;  3AA5 X;  1KLN A;  2Z1I A;  1NJY A;  4R5P A;  2YKM A;  1WSI A;  3KHY A;  4FWM A;  4B1X B;  1X1P A;  3SI6 A;  3C65 A;  3ULE B;  4HCC A;  1LOT B;  2E6M A;  4OVL A;  2P9I A;  1DEJ A;  2D0C A;  2VGM A;  3D7E O;  3C95 A;  1SZ2 A;  4YOT A;  3T1H K;  4BC2 A;  4I9Q A;  4OPK A;  3T7Z A;  3OYG A;  2HHT A;  2E88 A;  3RVC A;  3DLG A;  4BAC A;  3ITH A;  3CI5 A;  3SNN A;  1NKB A;  2QWN A;  1FKP A;  4ISF A;  4CGF A;  4G1Q A;  4A57 A;  1KAY A;  3QET A;  4JD2 B;  1JLQ A;  3QNN A;  2HVH A;  3EZ5 A;  1ESV A;  2PYL A;  3SCX A;  1QHT A;  1FKO A;  2R7Y A;  4PA1 A;  1OH7 A;  3CIP A;  5AQQ A;  3DXM A;  2YX6 A;  2YI1 A;  4CER A;  1QVF M;  4AHS A;  3KLH A;  2VWB A;  3ZSX A;  1SS6 A;  3C7N B;  3MXI A;  1C0T A;  4GV9 A;  1A5X A;  4FXD A;  5JS1 A;  2WOM A;  4YOR A;  2QKK A;  2P9N B;  1NGG A;  5AQF A;  2OTJ N;  3ISN C;  4BRP A;  4CIF A;  3O1B A;  3CXC M;  2GWJ A;  1U6Z A;  3HVR A;  3VF4 A;  5BRF A;  3KIO A;  3CPW M;  2WFB A;  4FWP A;  2GBZ A;  1HPZ A;  3CCJ N;  4K0K K;  5GAG P;  3I0S A;  4H5T A;  5AFU H;  4FJI A;  1L5U A;  3D2F A;  1SQK A;  3MED A;  1BG3 A;  4IOX A;  4BGB A;  2IDO A;  3ZT4 A;  4ZHR A;  4IZ9 A;  2DY4 A;  2UXC K;  2GTD A;  3LPT A;  2HND A;  2ZD1 A;  1QQO A;  3AVF A;  3ID6 A;  2Z1G A;  4CZJ A;  3BDP A;  3LWM A;  3AAQ A;  4MDB A;  1E4F T;  3L3V A;  3THX A;  4LF8 K;  4RW6 A;  3VQE A;  2ZJQ L;  1NGH A;  2QXF A;  5CZ1 A;  3O4W A;  5A2Q O;  3V9W A;  4M3T A;  2V7Y A;  3N4Q A;  4CHY A;  2O8F A;  3R6M A;  3K5M A;  3VQP A;  3SAG A;  3VEO A;  1QE1 A;  3BP8 A;  5M1P A;  5GIP A;  3TAQ A;  4JKD A;  3F9K A;  2FXU A;  3C6A A;  3EE9 A;  1TL1 A;  3K5O A;  1N5Y A;  1RTD A;  4ID5 A;  1VAZ A;  5LL6 Z;  4CZH A;  3RMB A;  1BIZ A;  3AAR A;  3K58 A;  3OVN A;  2HHQ A;  4KHQ A;  2OAN A;  3O3G A;  3O4Q A;  5CY4 A;  4AIL C;  3ZT3 A;  5DM6 L;  3ID8 A;  3OYN A;  2YNH A;  1HYS A;  5E84 A;  1XNQ K;  1DTQ A;  1YT3 A;  3KK1 A;  3VQD A;  3OYB A;  3L0Q A;  4LC9 B;  1NK6 A;  1RBS A;  1REV A;  3NVK A;  2JLE A;  4ELU A;  1OKJ A;  3JS6 A;  3LAL A;  3G0Z A;  4JI5 K;  3THV A;  4H5W A;  4YDU A;  2E20 A;  1JLA A;  3SAH A;  5JLH A;  4ILH A;  2VWJ A;  2W40 A;  1ASV A;  4E1J A;  4DSL A;  2DFH A;  5HRN A;  1RDU A;  4YNQ A;  4CFA A;  4ILG B;  3AVJ A;  4HCB A;  3OYD A;  2HBL A;  1EXQ A;  2ETJ A;  5M1O A;  1MWK A;  3V6D A;  4IOC L;  3E66 A;  4FK2 A;  4YOV A;  4CEC A;  5JMV A;  2P9P A;  4BRO A;  2AA4 A;  4JK7 A;  2PAV A;  3P38 A;  3PX4 A;  4DB3 A;  1NJX A;  1YIJ N;  3DLE A;  3Q7B A;  5KGX A;  4FYD A;  5B8H A;  4FJN A;  2HVI A;  1ATS A;  3U4L A;  4TSX A;  4CHP A;  4BWJ A;  4CK3 A;  4H0P A;  4C23 A;  4K41 A;  4A5B A;  4Z4H A;  5EXW A;  4JAX A;  3JYT A;  4DSF A;  3AVN A;  4H5V A;  4CJU A;  3EE8 A;  1XWL A;  1LWC A;  3PX6 A;  3OYF A;  4CEZ A;  4BG9 A;  1EX4 A;  3H46 O;  4BC3 A;  3VQ8 A;  5KQ8 A;  3QES A;  3V1R A;  4PWD A;  3O3F A;  1SUQ A;  3MN5 A;  4KTW A;  4J2D A;  3SZ2 A;  4CEB A;  4QAG A;  4H0T B;  3IS9 A;  4M3R A;  3SV4 A;  2W42 A;  4F2S A;  5AJ3 K;  4DR1 K;  2V7Z A;  1HYV A;  3SJH A;  1EKE A;  1RT4 A;  3N4P A;  3RR8 A;  4RW9 A;  2ITG A;  2P1J A;  4BR0 A;  5C10 A;  3V81 A;  4C8K A;  4CED A;  2A42 A;  1EWR A;  4MO5 A;  4BR2 A;  5C12 A;  3OJU A;  5BN8 A;  4M3W A;  4JKA A;  4CZL A;  1NNE A;  4OPJ A;  4KB1 A;  4CES A;  2UUB K;  4GV6 A;  1BA0 A;  1S1T A;  3LL3 A;  1BCO A;  4AHT A;  2ZF5 O;  4YOY A;  4DTP A;  1YHQ N;  2X6S A;  3SQ0 A;  1LW2 A;  3OHR A;  1VSM A;  4FK4 A;  3A2F A;  2HHH K;  1NOZ A;  1XQS C;  1W97 L;  1NK7 A;  3TAN A;  3K59 A;  3MN9 A;  3S41 A;  4DR6 K;  3MCA B;  1GOB A;  4M42 A;  4PL8 A;  4H5R A;  4LD0 A;  3SK3 A;  1D4X A;  3K9J A;  3CQ8 A;  4DTM A;  3SQ1 A;  1JLC A;  3BF3 A;  1ATN A;  4H4O A;  4N41 A;  1RDC A;  5AQY A;  5AQT A;  4IG3 A;  3E1Y A;  4M7X A;  3P4I A;  4A2A A;  3CYM A;  5AZJ A;  1VQO N;  4W5N A;  1J5O A;  3H3N O;  3S3O A;  2QTD A;  3KKR A;  5DMR A;  1VQM N;  3QB0 A;  4CJS A;  2GX9 A;  4CJQ A;  4DV3 K;  3P39 A;  3ZSW A;  1FW6 A;  1G99 A;  1HPM A;  1WSG A;  2ITM A;  3RSE B;  1TKX A;  4EZ9 A;  3B8A X;  1VHX A;  4E1N A;  4DTS A;  3ZEU A;  4JHD A;  4WFB L;  1TAQ A;  3CF5 L;  4WQ4 C;  4M3U A;  4O0J A;  3THW B;  4N56 A;  3JXU A;  4KO0 A;  1M1K O;  1Q8I A;  1KD1 O;  1N8R O;  1CZA N;  3QFP A;  3H1V X;  4NXM K;  1SV5 A;  3MDQ A;  3SPZ A;  3G10 A;  3QBX A;  1ZBI A;  4E7I A;  2A41 A;  2IC3 A;  2CGL A;  3BZK A;  5LJV A;  2FBT A;  1Z25 A;  4CJP A;  1MWM A;  4NLC A;  4LFB K;  4B1V A;  4DFP A;  1Q9Y A;  3SQ2 A;  1T44 A;  1BU6 O;  3NGZ A;  2O8B A;  4CI6 A;  4JKG B;  4E7J A;  1KRP A;  3OA9 A;  5AQK A;  5HP1 A;  1VQ9 N;  4X65 K;  1TK0 A;  3KD5 E;  3HP9 A;  3OYM A;  3TAB A;  4FJH A;  3HOS A;  3AAP A;  1ATR A;  1YVU A;  2OPQ A;  1T05 A;  1D9D A;  3L2U A;  4KHS A;  3MEE A;  3VQQ A;  3EL2 A;  1YJ9 N;  3AVK A;  1IO2 A;  1OVY A;  1N32 K;  1WSE A;  1WAJ A;  3O3H A;  1OH5 A;  2A5X A;  3EN9 A;  3NFA A;  4FLV A;  2YNF A;  3MEG A;  1LWE A;  4FM0 A;  3IMX A;  3AY9 A;  1S1U A;  1X9M A;  1K8K A;  4DTU A;  1U2V A;  1HNW K;  2F96 A;  4F3T A;  1NU0 A;  3D2E A;  4PKH A;  3KJV A;  3LM9 A;  3TAG A;  3SLC A;  3CCE N;  3CFO A;  2FSN A;  2J4R A;  5F2R A;  4JI4 K;  4FZZ A;  3IAY A;  1BQN A;  4Z94 A;  4CGH A;  4HUF A;  3DOL A;  3AO2 A;  2V51 B;  4MLE A;  3WEE B;  5J2N A;  3E9O A;  3SBT A;  3VEY A;  1RDB A;  1TVR A;  3VPZ A;  2DFF A;  2EHG A;  3BEX A;  3HO1 A;  3LDS A;  5M1F A;  2P9L A;  2HST A;  1ILY A;  4FLZ A;  1VQN N;  1Q7Y O;  4IEE A;  3MAQ A;  4KHN A;  4J2A A;  2JWL A;  2G8V A;  2E2O A;  1HNI A;  1TKT A;  4OPH A;  3NHG A;  1VSL A;  3BF1 A;  5GIN A;  1BIU A;  4KBO A;  3EYZ A;  2RF2 A;  3CCQ N;  5FPD A;  1CXU A;  1Y64 A;  4H4M A;  5I9E B;  4JI8 K;  4PKI A;  3THY A;  1WNS A;  4IFV A;  4JKH A;  4IO8 A;  4DU1 A;  4MO4 A;  3DM2 A;  3KK2 A;  4X66 K;  2HF4 A;  2OPS A;  3R8E A;  3SBG A;  3QFU A;  2OTL N;  2H3G X;  3AVG A;  1SAZ A;  2NRW A;  1GLB G;  5GAE P;  3VES A;  3L4I A;  1YVN A;  1BHL A;  4DTR A;  2ZJP L;  2Y1J A;  3RRG A;  5ADX A;  1YI2 N;  2NRX A;  4AQY K;  3CET A;  3PX0 A;  2ATQ A;  3RR7 A;  4RW8 A;  3CJC A;  3VOV A;  4CFB A;  4FJ8 A;  4E89 A;  1H1V A;  4JRP A;  4CEQ A;  2X78 A;  2I5J A;  4KRE A;  1KCF A;  2WON A;  1N6Q A;  3GE1 A;  1I39 A;  1NK5 A;  2XY8 A;  1S22 A;  3DLL L;  2W6L A;  4E7L A;  4AHC A;  2F8T A;  2F8S A;  3WT0 A;  4CJ4 A;  4V19 S;  4FM1 A;  1GLC G;  3SJJ A;  3HYF A;  1GLD G;  4B8C A;  4U67 L;  1Q81 O;  4B1Y B;  1E4G T;  2DFE A;  3CCL N;  3CFP A;  3O6W A;  4WQ5 A;  4WFA L;  4DV2 K;  1QSL A;  1YUW A;  4JKC A;  5BRD A;  4GW6 A;  3O9U A;  1RGI A;  3C94 A;  4FWS A;  5AQS A;  2P9I B;  5AZI B;  4JI7 K;  4BR4 A;  1W0H A;  4DHY A;  4BE0 A;  4DFM A;  1JL2 A;  1YXQ A;  3VEW A;  4GVM A;  3FLC O;  4BRD A;  4Q5V A;  2VG6 A;  1EQY A;  3EKS A;  4PHT X;  2VG7 A;  4DMN A;  3QER A;  5AQJ A;  4WCE L;  5M1N A;  1YTA A;  5AQX A;  3H1Q A;  1QVG M;  4LF9 K;  5AQI A;  5LMN K;  2UYT A;  4O44 A;  3T1A A;  3CCV N;  3J81 O;  4DSJ A;  3DXM B;  3TSP A;  1V4T A;  4NCG A;  4KHW A;  1F21 A;  2ZM6 K;  4IO9 L;  4BDY A;  2YHX A;  5KQD A;  1YIT N;  4N47 A;  4FJM A;  3SPY A;  1RTI A;  4LH4 A;  1KC8 O;  4B9Q A;  1NJZ A;  1Q9X A;  3TAR A;  3AVI A;  4DV0 K;  4LFC K;  4BC5 A;  5JVG L;  1S1X A;  4DCH A;  1SL0 A;  3WNE A;  3T3F A;  2VCP A;  4FW2 A;  3NMU A;  2HMP A;  2Q36 A;  4FWK A;  3D6R A;  4BRM A;  3KZB A;  3MMV A;  3KKS A;  3WXK A;  2NUB A;  2ZWH A;  4DQP A;  4OLB A;  3NF6 A;  3D2F B;  1NGA A;  2DPN A;  5AQG A;  5AQU A;  4NCA A;  2HHU A;  4WYB A;  1GLA G;  4FJJ A;  2HHS A;  3CHW A;  1TV6 A;  5JIC A;  2WTU A;  4JRQ A;  4N76 A;  5AQM A;  3M3Z A;  5BRE A;  2HHW A;  2P9S A;  3THX B;  1KSP A;  1W9H A;  4CHO A;  2AJQ A;  5LY3 A;  3AA3 A;  1TYQ A;  1BIS A;  4QOZ B;  5J2Q A;  4MDA A;  4BRG A;  1J54 A;  3O9S A;  2O8F B;  4ISE A;  3QBW A;  3SMP A;  3CQX A;  3ATU A;  1S1W A;  2BE2 A;  3ZLJ A;  4ELV A;  2E4L A;  4MQ3 A;  3GDQ A;  4DV4 K;  4KI4 A;  3A5O C;  2YKN A;  2QA4 N;  3OYK A;  4BRQ A;  3I55 N;  4OPA A;  4FVU A;  5C24 A;  1J9A A;  4BY9 C;  3VQ5 A;  3HT3 A;  3HPO A;  5BN9 A;  2HBK A;  3FE1 A;  2F9T A;  3PSI A;  4NYN A;  4O55 A;  2VGN A;  2GUI A;  4CD1 A;  1KVA A;  2BTF A;  3E01 A;  1BQM A;  1TAU A;  3KVG A;  2VWK A;  1RBR A;  3T1Y K;  1NG9 A;  1LW0 A;  2Z1H A;  3VEN A;  1HR0 K;  3LDL A;  4I7F A;  3WNH A;  3CMA N;  2IAJ A;  1DTT A;  1VQ6 N;  4B9U A;  3HTV A;  3AO4 A;  3S3N A;  3CCU N;  2P9P B;  4E1M A;  2P5G A;  2IIR A;  3ULD A;  2KZM A;  3VQA A;  3ZSV A;  4KFB A;  1RBT A;  3QO9 A;  5GAD P;  4FOE A;  1O1W A;  3ENO A;  5FRN A;  4B3R K;  5K14 A;  4AH9 A;  3LZI A;  4FLT A;  3K9K A;  3VA3 A;  4B3M K;  1T6C A;  3MCP A;  2CGK A;  2P9K A;  3I8B A;  1TKZ A;  4O8K A;  1XI1 A;  3SYZ A;  4FK0 A;  1S6Q A;  3EKU A;  4JK9 A;  4EAH D;  1C0G A;  4FPA A;  4DTO A;  2YNI A;  4BQL A;  1JLB A;  2E2N A;  4YDU C;  4AM6 A;  1R59 O;  3FZL A;  4IJN A;  3TPQ A;  1BA1 A;  3IRX A;  2PFU A;  4ICL A;  4MLH A;  3NBP A;  1NM1 A;  1WLJ A;  4CGJ A;  4OLA A;  3L3U A;  4BRK A;  1IKW A;  4BR5 A;  1WOQ A;  1NKE A;  3UIQ A;  2HHV A;  2IGI A;  4HWI A;  5SZT A;  3OYI A;  1ZYQ A;  4BR9 A;  3C6U A;  4CGD A;  1RDA A;  3S3M A;  3NGI A;  3NF8 A;  2G8I A;  4BR7 A;  4LF6 K;  2WBN A;  4M63 C;  4JI6 K;  5AQN A;  2P51 A;  4FWR A;  2P9N A;  2B4J A;  4CVN E;  3DXK A;  2OA8 A;  4IDK A;  3PIO L;  3GG4 A;  1IBM K;  4E19 A;  3L2W A;  3HM8 A;  3MK6 A;  5FRM A;  3V1Q A;  1IKY A;  2ASP A;  4RG8 A;  3WXJ A;  1T6D A;  3HXM A;  1JLE A;  3ASM A;  5C15 A;  3L2Q A;  1S6P A;  1NOY A;  1UA1 A;  4L8R B;  1RCH A;  3QEP A;  3UB5 A;  3KTQ A;  4CJ3 A;  2FF3 B;  4B08 A;  1EET A;  2D0O A;  3M5R A;  2EWS A;  4M3X A;  1NMD A;  4H0Y B;  1J6Z A;  4FJX A;  3U9D A;  4DSE A;  3HM9 A;  5AQH A;  1C0U A;  3WUH A;  2GEM A;  4K42 A;  1VSE A;  1IBK K;  2B6A A;  5KRT A;  3M6G A;  3EEQ A;  4KH5 A;  3VQ4 A;  2VG5 A;  4DR7 K;  3V9U A;  3UE5 A;  4CF2 A;  3O08 A;  5AZJ B;  5ADX H;  3QIN A;  2PY5 A;  2FBY A;  4UY8 O;  1C0F A;  2D0B A;  1UOC A;  2Q0R A;  5BR9 A;  4C8O A;  3SUO A;  3FZK A;  1HMV A;  4CJR A;  4B9L A;  4C8N A;  1KAZ A;  3AO3 A;  3ZEU B;  4JHD B;  4F4K A;  1WSH A;  3PSF A;  3ZYY X;  1R0A A;  1I3A A;  3EY1 A;  2NNW A;  2YHA A;  4JLH A;  3DLH A;  4BDZ A;  1RT6 A;  2OZM A;  1YJW N;  2Z1J A;  3CG7 A;  3QIO A;  4NB4 A;  3GOI A;  3LPU A;  1T03 A;  4H5N A;  2O8B B;  4Q0B A;  4FPB A;  4LY7 A;  4L3Q A;  1K73 O;  3OYL A;  5EOY A;  4WF9 L;  2E2Q A;  5SWM A;  1FXX A;  4CK2 A;  4CZK A;  4DG1 A;  3HVT A;  2RPI A;  4PKG A;  4UQG A;  3TTF A;  3DYA A;  3J7A P;  3RRH A;  5BPN A;  1VQ4 N;  2Q31 A;  2RN2 A;  2GV9 A;  4GKJ K;  4DS5 A;  3NE6 A;  4EP4 A;  1J5E K;  4LF7 K;  4KTQ A;  3VEV A;  4DLE A;  3CJA A;  3PIP L;  1XNR K;  2E2P A;  3OS2 A;  3ZET B;  2E1Z A;  1DGK N;  4GMJ B;  4CIG A;  1LV5 A;  4CJT A;  1S1V A;  4F9O A;  4ZTJ A;  1WSF A;  3A5N C;  3ZSY A;  1KFD A;  1U47 A;  4Z0U A;  2KFN A;  1Z6R A;  1U2V B;  5EY4 A;  4DLG A;  1IKX A;  4DR4 K;  1KTQ A;  2G8F A;  3PO4 A;  3K5N A;  4DQ8 A;  4XH5 A;  1HX1 A;  1E3M A;  3NCI A;  4DQQ A;  3F2K A;  1UAX A;  1GLJ O;  4KKO A;  2E8A A;  4B1Z A;  4DF4 A;  3VTI A;  1V4S A;  5AQO A;  3M8R A;  1JL1 A;  1TUY A;  1CLQ A;  5H1S Q;  2P9L B;  3C0B A;  4ELT A;  1L3T A;  1KVB A;  4W5T A;  2OPR A;  4QCL A;  4BRE A;  4JKE A;  3TR8 A;  1QZ5 A;  4Y1D A;  3HI0 A;  2LSN A;  1Q86 O;  4DSI A;  5BPM A;  4A59 A;  4X62 K;  4A2B A;  1QSS A;  3I33 A;  1HLU A;  1JCF A;  4KB0 A;  1BI4 B;  4OX9 K;  2W6K A;  3THY B;  1QHA A;  4BRF A;  3QML A;  4ISG A;  3M8Q A;  3ZSZ A;  3AO1 A;  4DQS A;  2NZT A;  1NK9 A;  3SUP A;  4A5A A;  3F5T A;  1WUA A;  4AHV A;  2P9U B;  4WQ4 A;  1QZ6 A;  2KTQ A;  1I94 K;  5IWA K;  5CYM A;  2E1Y A;  2P5O A;  5CE3 A;  1UA0 A;  4YOW A;  3VQ6 A;  4CJ5 A;  4CFD A;  3U3G A;  4DU4 A;  3LDO A;  3SMS A;  3AGR A;  2XO7 A;  3BZC A;  3NF7 A;  4IG0 A;  4NLB A;  3VA0 A;  1VRU A;  1N33 K;  3CQY A;  3CC4 N;  2Q2R A;  2YHY A;  3HL8 A;  4LSL A;  5C2F A;  1D5A A;  3K0S A;  3CJ1 A;  5LMU K;  4EIA A;  1QTM A;  1X9S A;  1LAW A;  3VEZ A;  3NAE A;  3T69 A;  5KI6 A;  3R1X A;  3MX5 A;  1XHX A;  2G8U A;  2FF6 A;  1NWK A;  1Z05 A;  4BC4 A;  3VQ7 A;  1C1A A;  5HRR A;  3WXL A;  4DTN A;  1NKC A;  4BDP A;  1X3M A;  4CJE A;  4QS7 A;  3G6E N;  4QS9 A;  3CD6 N;  4O4G A;  3KLG A;  5BR8 K;  1KLM A;  3BY5 A;  5HL7 L;  5ELZ A;  2Q97 A;  3VQC A;  4CZE A;  1KQS M;  4Y1C A;  3THW A;  1NMN A;  2A40 A;  3LP3 A;  1VQP N;  3OW2 M;  3NH2 A;  1HNZ K;  1KAX A;  3C6T A;  5AQL A;  4BG8 A;  4K43 A;  4KRF A;  3CJB A;  1VQ8 N;  1ASW A;  4RW4 A;  3HP6 A;  4ILJ A;  3Q7C A;  4CJF A;  3M8P A;  3ZX3 A;  1DKG D;  4H8K A;  4XEI A;  1T3V A;  5F0X A;  4XIU A;  4JEP A;  5I42 A;  1TL3 A;  3U3Y A;  2WC9 A;  5DK5 A;  3A5M C;  5JS2 A;  4CJL A;  3J7Y P;  3RMC A;  2V52 B;  3DWL A;  4CJV A;  1SKR A;  4I6M A;  1U48 A;  2O8D B;  3H6E A;  3QEV A;  3TTC A;  4BGA A;  3OYE A;  1BUP A;  3VTH A;  4EZ6 A;  4KH4 A;  2FSJ A;  4CBU A;  4J8F A;  1IBL K;  4JS5 A;  4RW7 A;  4KHY A;  4XH1 A;  2BUP A;  4PL7 A;  4KI6 A;  3B6P A;  1NK8 A;  3O9R A;  4FJ9 A;  3UKR B;  4E7H A;  2QK9 A;  3MEC A;  5LJW A;  4W5R A;  5E26 A;  3W0L A;  4IDH A;  4C1N I;  2JWK A;  5FDL A;  1JJ2 M;  2QKB A;  3IDH A;  4RWT A;  3ZT1 A;  1WBB A;  3LP1 A;  1RBV A;  1Q82 O;  2G8K A;  1ZBS A;  4HTL A;  3UKU A;  3HBT A;  2VQF K;  2GUP A;  4CCH A;  2QI2 A;  3OTO K;  4LF4 K;  3P31 A;  3WXM B;  2OPP A;  1VSI A;  3VGL A;  1TK8 A;  3ALY A;  3TAP A;  1EWQ A;  5FPE A;  1FK9 A;  3WNG A;  3DI6 A;  1GOC A;  5IT9 O;  4CBW A;  3OS0 A;  4HHT A;  1QQC A;  1TYQ B;  1QQM A;  2ZGZ A;  5TKW A;  1W7A A;  4AHU A;  2IOC A;  4KV8 A;  4DV6 K;  2Y1I A;  3NGY A;  4CZG A;  4U7B A;  4NXN K;  1X3N A;  1VQL N;  3CFR A;  4H0O A;  3O8M A;  3VER A;  5CHI A;  3SQ4 A;  5EVZ A;  1CZB A;  3FR0 A;  1XMO K;  1O13 A;  4O5B A;  1ZXO A;  1IKV A;  3DMJ A;  1HKC A;  4FCY A;  4DTJ A;  1NGB A;  3U6F A;  4CEE A;  2QWL A;  3HK2 A;  4BRN A;  2PZS A;  4GNI A;  5FPM A;  1BWF O;  3FZF A;  2O8C A;  5J2P A;  1RIL A;  4HTU A;  3FFK B;  4BRA A;  1BDG A;  5TKY A;  1A5W A;  5KGW A;  4I9L A;  2UXB K;  4KH6 A;  1L3V A;  4W5Q A;  3EO3 A;  4DS4 A;  3GL1 A;  4H03 B;  1ZBF A;  3O1W A;  1ZC6 A;  3VGM A;  3ZX0 A;  3AVM A;  4FJK A;  4B1U B;  1A5V A;  4W5O A;  1Y97 A;  1N34 K;  1JCE A;  1NGF A;  4K8Z A;  4J2B A;  2O8E A;  4YHH K;  1GLL O;  2B5J A;  2QW9 A;  3OS1 A;  4B3T K;  1D8Y A;  1DLO A;  1HRH A;  4FVM A;  4IFY A;  1HQE A;  3DRR A;  1HNX K;  4CF9 A;  2P9K B;  3TI0 A;  4DUZ K;  3IG1 A;  5AZI A;  1SL1 A;  4FZY A;  3LAN A;  1RTH A;  4IKF A;  1MDU B;  1QQN A;  4R79 A;  4WFN L;  2I7N A;  4MFB A;  4YFU A;  4Z4F A;  2YJF A;  1WSJ A;  4E3S A;  3P1G A;  4OGC A;  1OH6 A;  4YOX A;  3CM5 A;  3CCR N;  2KLA A;  5AQR A;  2HB5 A;  4FWQ A;  1IH7 A;  4OKE A;  4IFE A;  3CPE A;  1X9W A;  1WN7 A;  3A0I X;  4CFC A;  5HLF A;  3IFR A;  3BUZ B;  1RNH A;  1NGD A;  2XY7 A;  4DV5 K;  1CXQ A;  3CER A;  3DAW A;  4NCB A;  3HST B;  4CJK A;  3JAM O;  1VSD A;  4CGI A;  2XRI A;  4PUO A;  3P83 D;  3KK7 A;  4DFK A;  4M3Z A;  2ZGY A;  5KRS A;  4M45 A;  5HRO A;  3NH0 A;  1K9M O;  3FZH A;  2FLO A;  4FWO A;  3ENH A;  3DXK B;  3W3D A;  1S9G A;  3A8Y A;  2A1S A;  4FWL A;  3M1F A;  2W41 A;  2EX3 A; 
#chains in the Genus database with same CATH homology
 3QIP A;  3V9S A;  1HJR A;  4DU1 A;  1IG9 A;  1EP4 A;  1R0A A;  1I3A A;  3DRS A;  4KAZ A;  3NFA A;  3EY1 A;  4FLV A;  4ZTF A;  2YNF A;  2YHA A;  3MEG A;  4CJW A;  3I8D A;  1LWE A;  3O4N A;  2O4I A;  4JLH A;  4EP5 A;  4FM0 A;  3DLH A;  4CHN A;  1ITG A;  1C6V A;  4BDZ A;  4K8X A;  3ZSO A;  1S1U A;  1RT6 A;  1X9M A;  2OZM A;  4DTU A;  1MU2 A;  2Z1J A;  2F96 A;  4F3T A;  3K2P A;  1VRT A;  3V1O A;  3KJV A;  3SV3 A;  1RT1 A;  4CF1 A;  3CG7 A;  1NK4 A;  3QIO A;  3LAK A;  3TAG A;  2E6L A;  3RMA A;  3LPU A;  1T03 A;  1J53 A;  4C8L A;  3CFO A;  3LAM A;  3SUQ A;  1JLF A;  2O4G A;  3AVH A;  3PV8 A;  2IS3 A;  3I0R A;  3ZSQ A;  4Q0B A;  5EU7 A;  4DF8 A;  4FZZ A;  4LY7 A;  3IAY A;  1BQN A;  4CIE A;  3OYL A;  4CGH A;  3OY9 A;  3LWL A;  4HUF A;  2YHB A;  1FXX A;  5SWM A;  3DOL A;  4CK2 A;  4B3O A;  3AO2 A;  4OKJ A;  5J2N A;  3V4I A;  4DG1 A;  3HVT A;  4C8M A;  2RPI A;  3K5L A;  1ZBL A;  4CHQ A;  2DTU A;  4BE2 A;  4UQG A;  3DYA A;  1RDB A;  4KPY A;  3ZSR A;  1TVR A;  3HPG A;  3RRH A;  2G8W A;  1L3S A;  3LP2 A;  2DFF A;  1SKS A;  2EHG A;  4FLW A;  1SKW A;  2PYJ A;  3HO1 A;  5HRP A;  3LDS A;  1BL3 A;  4FLZ A;  2RN2 A;  2GV9 A;  4F2R A;  4DS5 A;  3MAQ A;  3NE6 A;  2BDP A;  4EP4 A;  4DQI A;  4KHN A;  4J2A A;  4KTQ A;  4FJ5 A;  4DLE A;  4E0D A;  2G8V A;  5C42 A;  1HNV A;  3TAE A;  5CYQ A;  2RKI A;  3OS2 A;  1HNI A;  1TKT A;  3NHG A;  3PY8 A;  1S9E A;  1VSL A;  3KK3 A;  3RWU A;  1BIU A;  1JLG A;  3BGR A;  2RF2 A;  3OJS A;  3EYZ A;  3NF9 A;  4GMJ B;  2OZS A;  2KFZ A;  2KZZ A;  4CIG A;  2HNY A;  1LV5 A;  1CXU A;  4F8R A;  4H4M A;  3DRP A;  4CJT A;  2FC0 A;  3LP0 A;  1S1V A;  2ZQB A;  3MXJ A;  1C1C A;  3QLH A;  5J1E A;  3OYJ A;  3QEW A;  4ZTJ A;  3AVC A;  1WSF A;  1WNS A;  3AA5 X;  4IFV A;  3ZSY A;  1KFD A;  1U47 A;  1KLN A;  2Z1I A;  3KK2 A;  3DM2 A;  3AV9 A;  4Z0U A;  2YKM A;  1WSI A;  4R5P A;  2OPS A;  4BE1 A;  1NJY A;  2KFN A;  5HBM A;  3VQB A;  4DLG A;  4OGE A;  3O3H A;  1IKX A;  1X1P A;  4B9S A;  1KTQ A;  3AA4 A;  3AVG A;  5HRS A;  3SI6 A;  3MXM A;  2G8F A;  3K5N A;  3PO4 A;  4O0I A;  5J2M A;  3CM6 A;  4HCC A;  2E6M A;  1HYZ A;  4OVL A;  1BHL A;  3NCI A;  4DQQ A;  4DTR A;  2D0C A;  1HQU A;  2Y1J A;  3C95 A;  3RRG A;  3TAM A;  1UAX A;  3DOK A;  4I9Q A;  4OPK A;  2YV0 X;  5C25 A;  3OYG A;  3PX0 A;  2HHT A;  2ATQ A;  4KKO A;  3RR7 A;  4RW8 A;  3DLG A;  3HJF A;  3AO5 A;  3ZT2 A;  4BAC A;  3ITH A;  3L2R A;  2XHB A;  4DF4 A;  4Z4E A;  3SNN A;  4CFB A;  1NKB A;  3M8R A;  1JL1 A;  3AVA A;  1FKP A;  3RMD A;  4FJ8 A;  1CLQ A;  4E89 A;  4CGF A;  1TK5 A;  4JS4 A;  4JRP A;  2OYQ A;  4G1Q A;  4CEQ A;  3QET A;  2X78 A;  1TGO A;  1U49 A;  1JLQ A;  2I5J A;  3QNN A;  1KCF A;  1L3T A;  4ELT A;  4KRE A;  2JGU A;  1KVB A;  3EZ5 A;  2HVH A;  4W5T A;  2PYL A;  2OPR A;  2WON A;  1QHT A;  3SCX A;  1FKO A;  3TR8 A;  1N6Q A;  4Y1D A;  4CEA A;  4PA1 A;  2R7Y A;  2LSN A;  4DSI A;  1I39 A;  1VSK A;  2XY8 A;  1NK5 A;  1QSS A;  4E7L A;  4CER A;  4AHC A;  4KB0 A;  4AHS A;  2F8T A;  3KLH A;  2F8S A;  3ZSX A;  4CJ4 A;  5T7B A;  1BI4 B;  4FM1 A;  4FM2 A;  3MXI A;  3SJJ A;  4FLU A;  2HHX A;  1C0T A;  3L8B A;  3HYF A;  5FRO A;  1A5X A;  4B8C A;  4FXD A;  5JS1 A;  2WOM A;  2A1R A;  3M8Q A;  3ZSZ A;  1KVC A;  3AO1 A;  4DQS A;  2QKK A;  2BAN A;  3SUP A;  3B6O A;  2DFE A;  1NK9 A;  3CFP A;  3QNO A;  1QSL A;  4AHV A;  1TKD A;  2KTQ A;  4GW6 A;  3ISN C;  1NJW A;  5CYM A;  3C94 A;  2P5O A;  4CIF A;  1UA0 A;  3HVR A;  2D0A A;  3VQ6 A;  4CJ5 A;  3U3G A;  4CFD A;  1W0H A;  4DU4 A;  4BE0 A;  3KIO A;  2X74 A;  2XO7 A;  4DFM A;  1JL2 A;  2GBZ A;  3NF7 A;  4GVM A;  4CEF A;  5E41 A;  4IG0 A;  1HPZ A;  1SL2 A;  4Q5V A;  1VRU A;  3VA0 A;  2VG6 A;  3OYC A;  3HL8 A;  4LSL A;  1D5A A;  2VG7 A;  4DMN A;  3I0S A;  4FJI A;  4J2E A;  3QER A;  1L5U A;  3MED A;  1YTA A;  1QTM A;  1X9S A;  2IDO A;  1LAW A;  3NAE A;  3ZT4 A;  4ZHR A;  2XY5 A;  4FJ7 A;  5D3G A;  3PUF A;  2X6N A;  2DY4 A;  5KI6 A;  3LPT A;  3ZCM A;  3M8S A;  2HND A;  2ZD1 A;  4O44 A;  3AVF A;  3T1A A;  1XHX A;  2G8U A;  4DSJ A;  4CF8 A;  1C1A A;  2Z1G A;  1RBU A;  5HRR A;  3VQ7 A;  1LAV A;  4Z4C A;  3LWM A;  4E7K A;  4DTN A;  3BDP A;  1NKC A;  4BDP A;  4NCG A;  4KHW A;  4CJE A;  4KHU A;  1F21 A;  3L3V A;  4BDY A;  4DFJ A;  4RW6 A;  3VQE A;  2QXF A;  4N47 A;  4FJM A;  3VN5 A;  5CZ1 A;  4O4G A;  3SPY A;  1RTI A;  3KLG A;  1T8E A;  1KFS A;  1KLM A;  4PY5 A;  1RT3 A;  3RTV A;  3V9W A;  4M3T A;  4KTZ A;  4DTX A;  4OJR A;  3VQC A;  4LH4 A;  4CHY A;  4Y1C A;  1NJZ A;  1Q9X A;  3K5M A;  3TAR A;  3AVI A;  3VQP A;  3LP3 A;  4FJG A;  3TAQ A;  1QE1 A;  3NH2 A;  4BWM A;  1S1X A;  4Z4G A;  1RTJ A;  3F9K A;  3C6T A;  4B9V A;  1SL0 A;  1TL1 A;  3WNE A;  3K5O A;  1N5Y A;  1RTD A;  4ID5 A;  3T3F A;  4KRF A;  5KTQ A;  3RMB A;  1BIZ A;  4FW2 A;  3K58 A;  3OVN A;  2HHQ A;  4KHQ A;  2XY6 A;  3O3G A;  1JXB A;  1ASW A;  3O4Q A;  5CY4 A;  4RW4 A;  3T19 A;  3ZT3 A;  3OYN A;  2YNH A;  3HP6 A;  3KKS A;  1HYS A;  3KD1 E;  1GOA A;  1D9F A;  1DTQ A;  1YT3 A;  2NUB A;  4CJF A;  3KK1 A;  4DQP A;  4OLB A;  3M8P A;  3NF6 A;  4N5S A;  3VQD A;  4H8K A;  3OYH A;  3OYB A;  4XIU A;  1NK6 A;  1RBS A;  3SUN A;  1RDD A;  5I42 A;  4NCA A;  1REV A;  4CHZ A;  2HHU A;  1TL3 A;  3V9X A;  2JLE A;  4I2Q A;  1NK0 A;  4ELU A;  3U3Y A;  5DK5 A;  5JS2 A;  3RMC A;  4FJJ A;  4CJL A;  3LAL A;  2HHS A;  3G0Z A;  3F73 A;  3THV A;  4CJV A;  1TV6 A;  1SKR A;  1U48 A;  1JLA A;  3QEV A;  4JRQ A;  4N76 A;  2VWJ A;  2HHW A;  1S5J A;  1ASV A;  2FBX A;  4DSL A;  2DFH A;  1VSJ A;  5HRN A;  3OYE A;  1W9H A;  1KSP A;  1CZ9 A;  4YNQ A;  4CHO A;  4EZ6 A;  2AJQ A;  3AA3 A;  4CFA A;  1BIS A;  3AVJ A;  4QOZ B;  4HCB A;  1YTU A;  3OYD A;  5J2Q A;  4B9M A;  1EXQ A;  2ETJ A;  4M41 A;  4JS5 A;  4RW7 A;  3NH1 A;  4KHY A;  1J54 A;  4FLY A;  4KI6 A;  3B6P A;  3V6D A;  1NK8 A;  4FJ9 A;  3ZT0 A;  4FK2 A;  4CEC A;  2HNZ A;  3AVB A;  2HW3 A;  1S1W A;  4DSK A;  2BE2 A;  4E7H A;  3K57 A;  3PX4 A;  4ELV A;  2QK9 A;  2YNG A;  4DWI A;  2E4L A;  3MEC A;  4PQU A;  1NJX A;  4W5R A;  4MQ3 A;  4B8A B;  3DLE A;  1RT5 A;  5KGX A;  3P5J A;  4FYD A;  4CGG A;  4FJN A;  3DLK A;  1QS4 A;  5FDL A;  2HVI A;  1RT2 A;  2QKB A;  4B9N A;  4KI4 A;  4TSX A;  1U45 A;  1LWF A;  3AVL A;  4CHP A;  1XHZ A;  2YKN A;  4BWJ A;  3ZT1 A;  4CK3 A;  3OYK A;  3LP1 A;  4Z4H A;  5C24 A;  1RBV A;  1J9A A;  2G8K A;  3VQ5 A;  3HT3 A;  3HPO A;  3JYT A;  1C1B A;  3AVN A;  4DSF A;  4CJU A;  3NDK A;  1XWL A;  3V9Z A;  1LWC A;  3PX6 A;  4CCH A;  3OYF A;  4NYN A;  4O55 A;  2GUI A;  4CEZ A;  1EX4 A;  2ZE2 A;  2Q3S A;  1KVA A;  1U4B A;  3VQ8 A;  3QES A;  2OPP A;  1VSI A;  3V1R A;  1TK8 A;  3ALY A;  3E01 A;  3O3F A;  1WAF A;  1FK9 A;  1SUQ A;  3WNG A;  3DI6 A;  4FW1 A;  4KTW A;  2G8H A;  1BQM A;  1GOC A;  3SZ2 A;  4J2D A;  1TAU A;  4PWD A;  2VWK A;  3DLR A;  4CEB A;  1B9D A;  1RBR A;  4QAG A;  3TAF A;  1LW0 A;  2Z1H A;  3OS0 A;  4HHT A;  1QQC A;  3IS9 A;  4M3R A;  1WSE A;  3WNH A;  4I7F A;  2W42 A;  3SV4 A;  4F2S A;  3KLF A;  3PO5 A;  2IAJ A;  1HYV A;  3AA2 A;  1DTT A;  4AHU A;  4B9T A;  1EKE A;  2IOC A;  4KV8 A;  1RT4 A;  4B9U A;  2Y1I A;  3RR8 A;  3AO4 A;  4RW9 A;  2ITG A;  3NGY A;  2P1J A;  3S3N A;  4WE1 A;  4ID1 A;  4E1M A;  2P5G A;  3ULD A;  2KZM A;  3V81 A;  4C8K A;  4CED A;  3VQA A;  3ZSV A;  3CFR A;  4QCL A;  4KFB A;  3HPH A;  3SQ4 A;  1XC9 A;  1CZB A;  1RBT A;  3QO9 A;  3OJU A;  3VQ9 A;  4O5B A;  1JXE A;  4M3W A;  3TAP A;  1BGX T;  1O1W A;  5FRN A;  4F3O A;  5K14 A;  4AH9 A;  4OPJ A;  3LZI A;  1IKV A;  3DMJ A;  4FLT A;  4FJL A;  3VA3 A;  4FCY A;  4CES A;  4DTJ A;  4KB1 A;  3U6F A;  4CEE A;  1TKZ A;  3HK2 A;  1XI1 A;  1S1T A;  2PZS A;  1BCO A;  4AHT A;  4DTP A;  2BGG A;  3SYZ A;  4FZX C;  2X6S A;  4FK0 A;  1U04 A;  3SQ0 A;  1S6Q A;  2KQ2 A;  5CZ2 A;  1LW2 A;  4CE9 A;  1VSM A;  4FK4 A;  3A2F A;  4DTO A;  5J2P A;  1VSF A;  2YNI A;  1JLB A;  1NOZ A;  1G15 A;  1RIL A;  1B9F A;  4HTU A;  1NK7 A;  3TAN A;  3K59 A;  1ZBU A;  4CEO A;  3D45 A;  4LSN A;  4OKK A;  1A5W A;  5KGW A;  1GOB A;  4I9L A;  3QEI A;  3IRX A;  4M42 A;  4ICL A;  4W5Q A;  1L3V A;  3LZJ A;  3NBP A;  4DS4 A;  1VK0 A;  5I3U A;  3L2V A;  1QSY A;  1WLJ A;  2FBV A;  4LD0 A;  4AHR A;  1ZBF A;  1UWB A;  4CGJ A;  4OLA A;  3L3U A;  3AVM A;  3CQ8 A;  4DTM A;  4FJK A;  1IKW A;  3SQ1 A;  1JLC A;  1NKE A;  1VSH A;  4HUG A;  3UIQ A;  3OYA A;  2HHV A;  1A5V A;  4H4O A;  4N41 A;  1RDC A;  4W5O A;  1Y97 A;  2IGI A;  1T7P A;  5SZT A;  4IG3 A;  3WNF A;  3OYI A;  4K8Z A;  3CYM A;  4J2B A;  1ZYQ A;  1BI4 A;  4W5N A;  1J5O A;  3C6U A;  4CGD A;  3S3O A;  1RDA A;  4HUE A;  3KKR A;  5DMR A;  3S3M A;  2HMI A;  3KLE A;  2B5J A;  4CJS A;  4CJQ A;  3NGI A;  3NF8 A;  4CF0 A;  2G8I A;  2D5R A;  3OS1 A;  3ZSW A;  1L3U A;  1D8Y A;  1DLO A;  1HRH A;  4FVM A;  1WSG A;  2P51 A;  4IFY A;  1HQE A;  1TKX A;  3DRR A;  2B4J A;  3D0P A;  4EZ9 A;  2OA8 A;  4NYF A;  4E1N A;  4DTS A;  4IDK A;  4CF9 A;  1ZBH A;  1JKH A;  4E19 A;  3L2W A;  3IG1 A;  3TI0 A;  1SL1 A;  1TAQ A;  4M3U A;  4O0J A;  3JSM A;  4N56 A;  4FZY A;  4FLX A;  5FRM A;  4KO0 A;  3V1Q A;  1Q8I A;  3LAN A;  1IKY A;  1RT7 A;  1RTH A;  4DQR A;  4RG8 A;  4IKF A;  3HXM A;  4HVJ A;  1JLE A;  3ASM A;  3L2Q A;  1S6P A;  4LH5 A;  4MFB A;  4YFU A;  1NOY A;  4Z4F A;  1UA1 A;  1SV5 A;  1RCH A;  1WSJ A;  4L8R B;  4E3S A;  4AIL C;  3P1G A;  4OGC A;  3G10 A;  3QEX A;  3QEP A;  3SPZ A;  3FFI A;  3KTQ A;  1ZBI A;  4CJ3 A;  4B08 A;  4E7I A;  1EET A;  3CM5 A;  4M3X A;  2IC3 A;  3DLB A;  2HB5 A;  1IH7 A;  1Z25 A;  2FBT A;  4OKE A;  4CJP A;  4DSE A;  3TWH A;  1X9W A;  4FJX A;  3HM9 A;  4DFP A;  1Q9Y A;  1WN7 A;  3SQ2 A;  1K6Y A;  4CFC A;  3S9H A;  4CK1 A;  3NGZ A;  1C0U A;  5HLF A;  4Z4I A;  4E7J A;  1VSE A;  1KRP A;  2B6A A;  1RNH A;  5KRT A;  5HP1 A;  1TK0 A;  3VQ4 A;  2XY7 A;  3KD5 E;  1CXQ A;  3HP9 A;  3OYM A;  2VG5 A;  3V9U A;  3TAB A;  4NCB A;  3HST B;  4CF2 A;  4FJH A;  1Z26 A;  1B92 A;  4CJK A;  1VSD A;  1YVU A;  2XRI A;  4CGI A;  2KW4 A;  3QIN A;  4PUO A;  4M3Y A;  2OPQ A;  3P83 D;  2PY5 A;  2FBY A;  4DFK A;  4M3Z A;  1C0M A;  2D0B A;  1UOC A;  4IBN A;  4I2P A;  5KRS A;  3KLI A;  4M45 A;  1ASU A;  3L2U A;  5HRO A;  3NH0 A;  1T05 A;  1D9D A;  3SUO A;  4C8O A;  4KHS A;  1BCM A;  3MEE A;  2A1S A;  4DU3 A;  3H08 A;  1HMV A;  3VQQ A;  4CJR A;  4B9L A;  4C8N A;  3AVK A;  3AO3 A;  1IO2 A;  1S9G A;  4F4K A;  1WSH A;  1WAJ A;  2EX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...