4CEQA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ceqA00
3PV8A 3ZT0A 1EP4A 2RN2A 3RMDA 3MXMA 3K5LA 1K6YA 3DMJA 4Z4HA 2GV9A 2YKNA 1KLMA 3DOLA 1UOCA 4IG3A 3WNHA 2QXFA 3SV4A 1ITGA 3LAKA 4UQGA 3MAQA 4O0JA 2WONA 3QNNA 2F8TA 4JS4A 1U49A 1RT2A 3IS9A 4FW1A 3PO5A 1Q8IA 3E01A 4IBNA 4FJIA 3AVIA 4LY7A 2R7YA 3RR7A 3ZSQA 3LZJA 1LWEA 1XC9A 2HMIA 3VQ6A 4M3TA 1SUQA 4CGIA 3OYNA 4FJ7A 4DLGA 4B9UA 4KRFA 3OYFA 1U47A 1A5XA 1D9DA 2IAJA 2I5JA 1KSPA 3K5MA 1BI4B 1JLAA 1NK6A 4KHSA 1U45A 4PWDA 4CF0A 4KHNA 4KHYA 2KZMA 1CZ9A 4M3YA 5DK5A 1WSFA 1IO2A 1RT4A 2OPSA 3TANA 4CHNA 2B6AA 4CGDA 1SKRA 1HNVA 3KK2A 3CQ8A 2BE2A 4IG0A 3TAPA 4F2RA 3V9SA 5KTQA 3RWUA 1NOYA 2OA8A 1G15A 4KV8A 1RBVA 4NYFA 3AA2A 3SPYA 5CYMA 3SUNA 4CK2A 3WNFA 3M8QA 1D9FA 1GOCA 3MECA 4N41A 4CEBA 3HPHA 4GVMA 1VSIA 4B3OA 3AVHA 3AVBA 3NGYA 5T7BA 3I8DA 1QSYA 4K8XA 4FW2A 4CIGA 2HVHA 4E3SA 4Q0BA 1C0MA 2PYJA 3U6FA 5JS1A 2KQ2A 1S1WA 2XY7A 1YTUA 1TL1A 2RPIA 4CEZA 1B9DA 4CHOA 3KKSA 4OKKA 4W5NA 2XY6A 2FBVA 3AVKA 2D0BA 4B9TA 4RG8A 1NJZA 3AO3A 4EZ9A 4CJLA 2KFNA 1J53A 2OYQA 3TARA 4C8MA 2IGIA 3C95A 4B9SA 4FM0A 2VWJA 1HQUA 4FLTA 4DTXA 1LW0A 4FJNA 1IKWA 5KRSA 4HUFA 4OLBA 1ZBUA 2E6MA 4CF8A 1QSLA 3HM9A 2A1SA 4E89A 1VRTA 3KLEA 4DQRA 2Z1JA 3VQ8A 1RT3A 1D8YA 4RW6A 2ITGA 2G8KA 1NJWA 2P5OA 4FJJA 3O4QA 1U48A 4CJKA 4OPKA 1QHTA 1L3SA 1I3AA 3T3FA 3SUQA 3ALYA 1QTMA 4FJ8A 3QEVA 4LSLA 4O55A 2D5RA 3SUOA 4GMJB 1MU2A 3HXMA 3D45A 4KB0A 1TVRA 2KFZA 3K2PA 1BQNA 3V6DA 4Z4FA 4Y1CA 1QE1A 4AHRA 1T05A 1S1XA 4PQUA 1L3VA 3CFOA 4FK4A 2G8IA 3C6UA 3RTVA 2O4GA 4CF1A 2OPRA 4CJTA 4E7IA 1KVBA 2ZE2A 4KB1A 4N76A 3HPGA 1FKOA 2YHAA 4KKOA 5JS2A 4N56A 4DFPA 4OJRA 4BE2A 4W5RA 3LP3A 3L8BA 2JLEA 4FJGA 4PA1A 3ZSWA 1QQCA 3OYJA 3LP2A 3SQ1A 1CXUA 3V1OA 4HTUA 4O44A 4BACA 3AVLA 3KK3A 4FM1A 5KI6A 4CJQA 1VSJA 3F73A 5J2MA 3HJFA 3OYGA 4AHSA 4CEQA 2G8UA 3LP1A 3F9KA 1ZBFA 3QIOA 3O3HA 1SL0A 2PZSA 1ZBHA 3L3VA 1RBRA 2LSNA 2P5GA 4H8KA 4ZTJA 3NAEA 4CJ4A 1RDAA 4Z4CA 3TWHA 1XHZA 4DQPA 4DSIA 5KGWA 4CFDA 3P5JA 2YKMA 3VQDA 3RMCA 4C8NA 4FJKA 3OYHA 4CGJA 1NKEA 3G10A 1F21A 3DLKA 3QERA 1ZBLA 1S1VA 3VQ5A 3D0PA 1X9MA 3V9XA 2Q3SA 3MXIA 4EZ6A 4KTQA 1IKYA 4BE1A 1S1TA 4FZZA 3AVJA 3AVGA 1TK0A 4M45A 3LWLA 4ICLA 1NJXA 4ELTA 4E7HA 4WE1A 1U04A 3VQPA 5HLFA 4AILC 1LAWA 3SPZA 1SL2A 1HQEA 3ZSRA 4CF2A 2F96A 3M8SA 2AJQA 3HPOA 2FBYA 4JRPA 2ZQBA 1L5UA 1HYSA 1GOAA 1VSMA 3V1QA 4AHCA 1BIUA 4CIFA 1IH7A 4E7JA 1SKSA 1RT1A 2PY5A 4DQIA 4M3WA 3OYDA 4DS5A 3V81A 1WSIA 2HNYA 3PO4A 4CK1A 4BWMA 4J2BA 3LAMA 5CZ1A 3RRGA 3T1AA 1ASUA 2XY8A 4H4OA 4CEAA 3C6TA 4I9QA 3KD5E 4IKFA 4CK3A 3VQBA 5KGXA 4DMNA 3OJSA 3NDKA 1RTIA 1U4BA 2Y1IA 1JLQA 3WNGA 1J5OA 3IRXA 4FK0A 4NCAA 1B9FA 3EZ5A 3TI0A 3V9ZA 4JLHA 1HYZA 4CF9A 4FLXA 4LH5A 3SCXA 3G0ZA 4FJMA 3CG7A 4FM2A 4CEFA 3NH0A 3U3GA 4ID5A 1O1WA 4HHTA 1TV6A 3LALA 4MFBA 4CJFA 4CEDA 3SNNA 2P1JA 2D0CA 4FJ9A 1Z26A 2B4JA 3QEPA 3LDSA 1EKEA 4F8RA 1D5AA 4DTRA 2G8WA 4G1QA 3QEXA 1UWBA 3HYFA 4CFAA 2HB5A 3P1GA 3VQEA 3OS2A 3RMBA 4KI6A 3EY1A 4JRQA 5J2PA 2VG7A 1UAXA 2E4LA 1JKHA 1VRUA 3O3FA 3L2RA 2JGUA 4FLWA 4ID1A 5HRNA 3B6PA 3SQ4A 4CJ3A 5CYQA 1ASVA 3HL8A 3KD1E 3I0RA 3THVA 3OS0A 4KO0A 3HSTB 4CHYA 1WNSA 1RTJA 2GBZA 3ZSOA 4CEOA 3K57A 3K58A 2DFFA 4DQSA 1EXQA 1Z25A 2Z1IA 1C1BA 3OYMA 3ISNC 3ULDA 2BGGA 3V1RA 1IG9A 4FJLA 1TK8A 4HUGA 2ETJA 2YV0X 1S1UA 3OYBA 3VA3A 1X9WA 1BCOA 1BL3A 4KTZA 2IOCA 3DLEA 4IFVA 4ZTFA 1HJRA 3DLRA 3TR8A 4LSNA 4CHPA 2F8SA 1ZBIA 1QSSA 1WSEA 2YNFA 3V4IA 3PX0A 1EETA 3SV3A 4HUEA 2KW4A 2YNHA 3AO5A 1RDBA 4FCYA 4AHUA 1NKBA 4DTUA 4Y1DA 4CJSA 3ASMA 4B8CA 3ZT1A 1C1AA 3QINA 1J9AA 2OPQA 3HVTA 5FRNA 1BISA 4M42A 1RTHA 4RW9A 4R5PA 3KLFA 2XHBA 2DY4A 4KFBA 3NCIA 4HCCA 1KTQA 5C42A 3TABA 4CECA 4O0IA 3NE6A 4LH4A 1TKDA 3L2UA 2OPPA 3LANA 1JLCA 2HHSA 3AA5X 4TSXA 2QK9A 1BI4A 3HVRA 3NGZA 1DTTA 4FJ5A 1SL1A 1KVAA 3HT3A 5FDLA 4AH9A 1XHXA 2BDPA 2HHXA 3O3GA 1C6VA 4PY5A 3OYKA 4DTOA 1JL2A 1R0AA 2HNZA 3VQCA 1NJYA 4ELUA 1TAUA 4FVMA 2D0AA 5FRMA 2ATQA 2EHGA 1FKPA 4RW7A 4DTPA 1NKCA 4DFKA 1B92A 3ZSXA 1UA0A 3HO1A 3KLIA 1I39A 4EP4A 1JLBA 4N47A 5J2NA 1FXXA 1LAVA 1T8EA 3VQQA 1S5JA 2EX3A 2XRIA 5E41A 3PX6A 2X6SA 1JLFA 3C94A 2G8VA 1N5YA 3QETA 4IDKA 4EP5A 3AO2A 4C8OA 4DFMA 4DSFA 4KPYA 5KRTA 2O4IA 1QS4A 2IC3A 1BGXT 3QO9A 1BCMA 4NCGA 1LW2A 1YVUA 4OGCA 4CJVA 4KAZA 4J2DA 1WSGA 4BDZA 4FJXA 4DG1A 4M41A 4PUOA 5J1EA 2Z1GA 3ZSYA 2RF2A 4AHVA 1C1CA 2YNGA 4E7KA 1CLQA 3RR8A 1DLOA 3FFIA 3QNOA 2NUBA 1SKWA 4I9LA 4F3TA 3IG1A 3K59A 4KREA 3S3OA 1IKVA 4C8LA 2G8FA 4DSKA 4M3RA 4GW6A 1KLNA 4DU3A 4DU1A 3OYLA 3KLGA 4Z4EA 3OJUA 4CIEA 1ZYQA 2KZZA 4B8AB 1L3UA 4L8RB 4B9LA 2X74A 3ZT2A 4DF8A 4CJ5A 2DTUA 2X6NA 3SQ0A 4I2QA 4RW8A 4FLYA 1TK5A 3DLBA 2GUIA 4BE0A 4YFUA 4O5BA 4XIUA 3KJVA 4DTMA 3SUPA 1XWLA 4FLVA 5HROA 2HW3A 3PY8A 4DF4A 1VSFA 4DTNA 3L2VA 3QEIA 1HMVA 3CYMA 1LWCA 3NGIA 1IKXA 4B9NA 3JSMA 4CCHA 3VA0A 5DMRA 3VQAA 4CJRA 4E0DA 4CGFA 5C25A 1HPZA 1Y97A 1RNHA 3H08A 5CZ2A 3L2WA 4B9VA 1BIZA 2PYLA 4DSJA 3B6OA 3TAFA 3S3MA 4M3XA 5C24A 4DLEA 4N5SA 3MEDA 3AO1A 3CM6A 2YHBA 4QOZB 1TKZA 4RW4A 3NF9A 4CERA 1SV5A 3NF7A 4DTSA 3ZSVA 5D3GA 1NK8A 1WAFA 4KHQA 2DFHA 3A2FA 1S9EA 1J54A 1RTDA 1JXEA 3CM5A 1KRPA 2QKKA 4CFBA 4E1MA 3S9HA 3DRPA 3O4NA 4CHZA 4DFJA 3SQ2A 1UA1A 4BDPA 1S9GA 3AVAA 4AHTA 2HHQA 3KKRA 4OVLA 3ZT3A 1RBTA 1WSJA 3TAMA 3DM2A 2VG5A 2XO7A 1NOZA 4KTWA 5EU7A 4H4MA 3T19A 1VSKA 1KCFA 2G8HA 1HNIA 4FK2A 4O4GA 1VSEA 2WOMA 3NF6A 4B9MA 4M3UA 3OYIA 2KTQA 1VSLA 4CESA 2HHWA 3QESA 1EX4A 3HK2A 3WNEA 3RMAA 3TAQA 1XI1A 1X1PA 4FJHA 1GOBA 4F3OA 1WAJA 5HRRA 1VK0A 4CGHA 4OGEA 3HP6A 4FZXC 1DTQA 3BGRA 4CJWA 1RT5A 4JS5A 2Z1HA 4W5OA 4W5QA 3OYEA 4FZYA 4K8ZA 1RDDA 4KHUA 5HBMA 3NH2A 1HRHA 3KTQA 1LV5A 1WSHA 5SZTA 1S6PA 1TAQA 2ZD1A 4B08A 5I42A 4F2SA 4E1NA 3LP0A 3OVNA 3JYTA 3TAGA 3OYAA 4NYNA 4LD0A 3NH1A 4CE9A 1VSHA 3AVNA 1X9SA 3PX4A 3LZIA 2OZMA 1A5VA 1RT6A 3VQ7A 3L2QA 2IDOA 1NK0A 2X78A 3EYZA 4M3ZA 1RBSA 1RILA 2YNIA 2HHTA 4Z0UA 1YT3A 4W5TA 1T7PA 3LPTA 2Y1JA 3MEGA 3DRSA 2E6LA 4E19A 2VG6A 3AA4A 3AV9A 2A1RA 3PUFA 4I2PA 1JL1A 3VN5A 3V9UA 5FROA 1TKXA 2FBTA 4NCBA 5J2QA 3K5OA 4DQQA 2HHVA 3NBPA 4CHQA 3BDPA 1VSDA 2HNDA 3M8PA 5K14A 3S3NA 4Z4GA 3TAEA 1L3TA 5CY4A 4CEEA 3DYAA 3LPUA 3ZCMA 4CJUA 3SZ2A 1NK5A 4C8KA 1KVCA 3I0SA 1NK7A 2QKBA 4ZHRA 1WLJA 2RKIA 1W9HA 1C0TA 3DRRA 3M8RA 2VWKA 3SYZA 4MQ3A 3AVFA 4CJPA 1JLEA 4QCLA 4I7FA 1RDCA 4HCBA 2BANA 1KFSA 3U3YA 3NHGA 3L3UA 4DWIA 1BQMA 4F4KA 3AVMA 3VQ9A 3AO4A 3V9WA 2XY5A 1Q9XA 4KI4A 1FK9A 2OZSA 4Z4IA 1A5WA 1CXQA 1HYVA 3KIOA 3MEEA 4OKJA 1RCHA 3K5NA 4ELVA 2W42A 3OYCA 1JLGA 3MXJA 4DS4A 1TL3A 3AVCA 1RT7A 4IFYA 1REVA 4FXDA 4DTJA 2B5JA 4CJEA 4HVJA 1KFDA 4DU4A 3IAYA 3DI6A 1LWFA 1ASWA 3DOKA 4BWJA 3NFAA 4YNQA 4DSEA 1T03A 3VQ4A 3AA3A 3QEWA 4CGGA 3OY9A 4CFCA 4Q5VA 1W0HA 5HRSA 3DLGA 5HRPA 3OS1A 4J2EA 4OLAA 5I3UA 4FYDA 1WN7A 3ZSZA 1Q9YA 4OPJA 3P83D 1S6QA 4DSLA 2DFEA 3QLHA 3ZT4A 2FC0A 1CZBA 1TGOA 1TKTA 3ITHA 3HP9A 1NK9A 3UIQA 2P51A 3SJJA 4J2AA 4FLZA 3KLHA 4KHWA 1BHLA 1JXBA 1C0UA 4BDYA 5SWMA 2FBXA 1RBUA 2IS3A 3QIPA 3CFPA 3DLHA 3CFRA 3LWMA 2HHUA 4FLUA 3KK1A 1N6QA 3NF8A 4OKEA 3RRHA 3SI6A 2HVIA 4QAGA 4E7LA 1NK4A 5HP1A 1YTAA
chains in the Genus database with same CATH superfamily
3ZT0A 1EP4A 1K6YA 3PSIA 2YKNA 1UOCA 2QXFA 4WFBL 3LAKA 4UQGA 5GINA 2CH5A 2NRXA 4EAHD 4JS4A 1ILYA 1Q8IA 3E01A 3AVIA 1NM1A 1XC9A 3VOVA 3BF1A 4MDAA 5F0XA 3TTFA 4DR2K 4B1VA 3OYNA 4B9UA 4KRFA 3O1WA 3M5RA 4JKAA 4KHSA 2IVNA 4KHNA 2FSNA 2AP1A 5DK5A 4JNEA 2QEXN 3TANA 1SKRA 3KK2A 4F2RA 1NOYA 1TYQA 4CK2A 3WNFA 3M8QA 1GOCA 2E88A 3MECA 4CEBA 3HPHA 1QSYA 3AVBA 2HMPA 3MN7A 4IWVA 1C0MA 2PYJA 4AF1A 2KQ2A 2W6LA 2HBMA 2YJEA 1B9DA 3KKSA 2XY6A 2FXUA 4B9TA 3DWLA 2O8EA 4CJLA 2OYQA 3C7NB 3DJCA 4C8MA 4FM0A 5MLCQ 3A8YA 1K9MO 4FJNA 5KRSA 1QVGM 4OLBA 4CF8A 2E6MA 3HZ6A 1QSLA 3Q7BA 4DQRA 4JK9A 2Z1JA 3VQ8A 4GV3A 4RW6A 3J81O 2YJFA 3O4QA 3SUQA 3MN6A 4GMJB 4LF7K 1MU2A 5JMVA 1K8KA 3VEOA 1YJNN 5EOYA 1ATRA 4Y1CA 3CFOA 4YDUA 3CERA 3C6AA 1TUUA 4FL9A 3J80O 2D0PA 2NRZA 2YHAA 4N56A 4BE2A 3L8BA 4JKCA 2HBLA 1CZAN 4I6MA 1QQNA 3ID6A 4IZ9A 1NGCA 4IOAL 3CJCA 4CJQA 3HJFA 4AHSA 4BC2A 5KPRA 3QIOA 3MN9A 1ZBHA 2PZSA 2P5GA 4ZTJA 4CJ4A 3OBWA 3PIPL 3P5JA 4JD2A 4BC3A 1YF5L 4C8NA 4CGJA 3G10A 3DLKA 1S1TA 3AVJA 3AVGA 1D4XA 4DV1K 5HLFA 4FWSA 3SPZA 2UUCK 4CF2A 4WQ5C 1SKSA 4E7JA 1RT1A 4DUYK 2CGJA 3V81A 4WQ4C 3U9ZA 4BWMA 3CIPA 3RRGA 4YY3K 3EE9A 2XY8A 3C6TA 3KD5E 5BPLA 3DXMA 4FWOA 2ZGYA 3NDKA 1J5OA 4FK0A 4JI0K 1YVNA 1B9FA 3EZ5A 3TI0A 1P90A 4FLXA 4LH5A 3NH0A 2E1ZA 3OW2M 4ID5A 2NRHA 3LALA 4CZLA 2D0CA 2GX9A 3SMPA 5BN8A 1VQ5N 3ZLJA 2E1YA 3LDSA 1EKEA 2G8WA 4G1QA 3QEXA 3HYFA 3RMBA 3TU5A 5AZJA 4A61A 3WXKA 3QFUA 2V52B 5HRNA 4CJ3A 3QICA 1EO1A 1J5EK 3HL8A 3P31A 3THVA 4DV2K 1W7AA 3HSTB 3R1XA 3ZSOA 2ASMA 1M90O 4DQSA 1KC8O 3ISNC 1P8ZA 3EN9A 1YI2N 4YORA 1Q7YO 1IG9A 4FJLA 3R6MA 1BCOA 1BL3A 4KTZA 3OA9A 1ZBIA 5GAEP 3DAWA 3PX0A 2KW4A 1RDBA 1NKBA 4OO1J 3QINA 2OPQA 1BISA 4RW9A 3KLFA 3O9RA 4NB4A 3CD6N 2QM1A 4KFBA 4BRHA 4CECA 4LH4A 3LANA 1SQKA 1JLCA 3J8AA 2QK9A 2FSKA 3HVRA 3NGZA 1KVAA 3ULEA 3O3GA 1C6VA 3ZX3A 3E9OA 4FVMA 1WUAA 3UB5A 3CCSN 5FRMA 4DFKA 4WCEL 1UA0A 1JLBA 4N47A 1VQ7N 5E41A 2EX3A 2XRIA 3PX6A 2G8VA 2X6SA 3C94A 4BG9A 4BGAA 3ENBA 4C8OA 3AO2A 4DSFA 4LF9K 3QBWA 3QO9A 2IC3A 2YHXA 1LW2A 4CJVA 4FJXA 5AQRA 1OH6A 1CLQA 2Z1GA 3ZSYA 2RF2A 3G25A 2NUBA 3EE8A 5FPNA 5BRDA 3K59A 3S3OA 5AQJA 2G8FA 3ID8A 4LFBK 1YJ9N 2UU9K 4GW6A 2QWPA 4JKGB 3OJUA 2KZZA 4B8AB 1L3UA 3EL2A 4O8UA 4O5BA 2HF3A 3QEIA 3NGIA 1LWCA 3JSMA 2ASOA 3R3LA 4CJRA 3L2WA 4B9VA 5CZ2A 1V4SA 4FWQA 3Q7CA 5C24A 3KHYA 2QA4N 1SV5A 3NF7A 4CZGA 4DR6K 5AQKA 4KHQA 5D3GA 1IBKK 4G9ZA 3ZYYX 2O8DA 2P9IB 3ATVA 4BDPA 1S9GA 5AQPA 3TPQA 4AHTA 3ZT3A 3TAMA 1VAZA 2OTJN 5EU7A 4H4MA 4FWLA 3H45C 4IEEA 2J4RA 1GLJO 3O1BA 4FWNA 2HHWA 5TKYA 1N36K 5AQYA 4OGEA 3VENA 2HOEA 2HHHK 4GV9A 2Z1HA 4W5OA 4W5QA 3OYEA 4H0OA 5M1FA 1HRHA 1LV5A 1TAQA 4YHHK 1FW6A 4B08A 3LP0A 5E26A 3JYTA 3TAGA 1OVQA 4M63C 1VSHA 1X9SA 3HM8A 1A5VA 1RT6A 1NK0A 1HLUA 4JN4A 2P9LA 4Z0UA 1YT3A 1NJIO 3LPTA 4CZEA 1ZC6A 3DRSA 4FPBA 2VG6A 2NRWA 3AV9A 3BUZB 4BRFA 4U7BA 2GWKA 2YHWA 5J2QA 3K5OA 5AQZA 3FR0A 4DQQA 4EFHA 2HHVA 3BDPA 2HNDA 5K14A 4Z4GA 4CEEA 3DYAA 4CJUA 4WQ4A 1NK7A 1QQOA 2ITMA 3SYZA 1NNEA 4CJPA 4FOEA 3T7ZA 1NMDA 3IFRA 4I7FA 3H3OB 2BANA 2CGKA 4HCBA 4CZIA 3L3UA 4IJNA 1BQMA 1WOQA 3V9WA 2XY5A 4DR1K 1FK9A 3G4SN 1HYVA 4OKJA 5BPMA 5EVZA 4BR5A 1HPMA 3FZFA 3JXUA 4DTJA 1DGKN 3DI6A 2NRRA 3E9LA 4FYDA 3M1FA 3EKUA 4LF4K 4IO8A 4PHTX 4JEPA 4DSLA 3ZT4A 3LDPA 1NLVA 1SAZA 3LL3A 3SJJA 3UE5A 4M7XA 3P4IA 1BUPA 5AQMA 2P9SA 2IS3A 4BRAA 4JI4K 1YITN 3MX5A 1M1KO 3MDQA 4BQZA 2E20A 1BA0A 4B1ZA 2VQEK 4E7LA 3OTOK 3E9PA 3PV8A 3JS6A 5FPEA 4IG3A 4B3MK 4O0JA 3QNNA 3O6WA 1U49A 1RT2A 3IS9A 3HBTA 4FJIA 3RR7A 1LWEA 3SBGA 4M3TA 3VQ6A 4LF8K 4HTLA 1SUQA 4DLGA 1E4FT 1G99A 4FVUA 1JLAA 1NK6A 4PWDA 4CF0A 1Q82O 3PIOL 4KHYA 1BA1A 4M3YA 5FPMA 4BRPA 1IO2A 2OPSA 2EWSA 2Q31A 4CGDA 4LF5K 3CQ8A 3D2FB 1QVFM 5KTQA 1G15A 4NYFA 1GLDG 3U9DA 1KAYA 2Q0UA 5CYMA 4N41A 2KKZA 3CPWM 4GVMA 5BRFA 4B3OA 3AVHA 3NGYA 5T7BA 3EEQA 3CHWA 3U6FA 4OX9K 1S1WA 4CEZA 4CHOA 3GOIA 3KVGA 4OKKA 4W5NA 3AVKA 1S22A 3ZETA 2FF6A 4EZ9A 1NMNA 5BR9A 2UUBK 2IGIA 1U2VB 4B9SA 1XUPO 2P9NA 1IKWA 3OHRA 4HUFA 4A2AA 4DHYA 2A1SA 3THWB 2UYTA 1RT3A 2ITGA 2OANA 2G8KA 4CJKA 4DV5K 1QHTA 3TSPA 3ALYA 4FJ8A 4LSLA 2A5XA 3ATUA 3D45A 5AFUA 3WQTA 1TVRA 4KB0A 2KFZA 3V6DA 1BQNA 4AM6A 1QE1A 1T6CA 1T05A 1S1XA 4GKJK 4FK4A 2G8IA 3C6UA 3RTVA 2O4GA 3LDLA 4CF1A 2QWLA 3VEWA 1FKOA 5JS2A 2E2NA 4OJRA 1JCEA 3N4PA 4IO9L 2JLEA 4JI3K 1XC3A 4FJGA 1QQCA 3OYJA 4DV6K 5GIOA 1IG8A 3AVLA 3BZKA 5KI6A 1VSJA 1LCUA 3CPEA 1RBRA 3CC4N 1BG3A 4H8KA 2AA4A 1RDAA 3D2EB 3TWHA 3AAPA 3B8AX 3C7NA 3QERA 1ZBLA 3D0PA 1X9MA 2Q3SA 2HF4A 3MXIA 4CVNE 4BE1A 4FZZA 1TK0A 1T6DA 5JVGL 3BF3A 1HQEA 3FGUA 3M8SA 4BC4A 4JRPA 1L5UA 3E1YA 1HYSA 1GOAA 3V1QA 1YTUA 4CIFA 1BIUA 4DQIA 3DXKB 1HNZK 4M3WA 3HI0A 4DS5A 3PO4A 1WSIA 2I7NA 4BR4A 3THXA 5CZ1A 1XQSC 1ASUA 4H4OA 1IBMK 3O5BA 2GUPA 3VGMA 4L3QA 5B8HA 1U4BA 1XNRK 1JLQA 3U8XA 3WNGA 3IRXA 1WBBA 4CZKA 3V9ZA 3SCXA 1HYZA 4CF9A 3CCVN 3G0ZA 4FJMA 4FM2A 4JHDA 5AZIA 4IEIA 1O1WA 4B3TK 4CJFA 3WEEB 2P1JA 3VMFB 1Z26A 4BR9A 4NLBA 2P9PB 1UWBA 4CFAA 3VQEA 1ESVA 1QQMA 3EY1A 4KH4A 2UXCK 3G71N 4AQYK 4JRQA 2WFBA 1JKHA 3O3FA 1SZ2A 2JGUA 4ID1A 1RDUA 3I55N 2VGNA 1NGFA 3SQ4A 5IT9O 1YUWA 4CBUA 3KD1E 4B3RK 2HBKA 1WNSA 4CEOA 3QB0A 3CF5L 1Z6RA 4K41A 3V1RA 4H0YB 1TK8A 3RSEA 4YOWA 2YV0X 2GEMA 3O4WA 5AQUA 2IOCA 3DLEA 4IFVA 3WUHA 1VQLN 4BRNA 1EETA 3SV3A 3CQXA 2YNHA 4IOXA 4AHUA 4CJSA 3ASMA 2FLOA 5FRNA 4M42A 1RTHA 5AQXA 5C42A 3EO3A 2QWQA 4O0IA 3L2UA 4OPAA 2W40A 1U6ZA 4XH4A 5EX5A 1BI4A 1HKGA 1Q86O 1SL1A 5FDLA 4ISFA 4MO4A 3VF4A 3ZX0A 4AH9A 5AFUH 4A5BA 3OYKA 4DTOA 1NJYA 1R0AA 3SBTA 2NRVA 1W97L 3VQCA 4NXNK 1ZBSA 3VGKA 2EHGA 1HKBA 4IOCL 3KLIA 1I39A 1FXXA 5C15A 1S5JA 2QWOA 1JLFA 1XMQK 2O8CB 2NLXA 4B1WB 2O4IA 3T1HK 1NG9A 1NGGA 4NCGA 1BGXT 1YVUA 2UXBK 1Y64A 4BDZA 4DG1A 2QXLA 3EKSA 4QS8A 4E7KA 4FOIA 3RR8A 3QNOA 4DV0K 4I9LA 3IG1A 4KREA 4C8LA 4PL8A 4DSKA 2HBJA 4WFAL 2JWLA 4JYAK 1NU0A 4JKBA 5LMNK 1TYQB 5LMUK 4DF8A 5AQOA 4F9OA 1TK5A 2GUIA 3C0BA 3WXMB 4YFUA 3KJVA 5JVHL 4BE0A 2BTFA 5HROA 4DF4A 1VSFA 3L2VA 1HMVA 4B9NA 4A57A 5DMRA 1GLCG 3VQAA 1K8AO 2O8EB 1Y97A 3H08A 2GELA 2PYLA 3B6OA 3TAFA 4M3XA 4K43A 2PFUA 1FJGK 4QOZB 1TKZA 4RW4A 3NF9A 2UXDK 3C65A 4CZHA 1HR0K 1WAFA 2DFHA 3A2FA 1S9EA 1J54A 3FZMA 1JXEA 4HWIA 3UKUA 1RTDA 1KRPA 2QKKA 3GE1A 2ZJQL 2HHQA 1WSJA 5M1KA 5FLXO 4B9QA 3T19A 1VSKA 3CMAN 1KCFA 2G8HA 4JI8K 1VSEA 2WOMA 3LDQA 3IDHA 3NF6A 4B9MA 4M3UA 1VSLA 4KHPK 3HK2A 3RMAA 3TAQA 1X1PA 4FJHA 4F3OA 3LM9A 3QBXA 4JK7A 4FZXC 3BGRA 4JKGA 1T44A 4WF9L 4X65K 4FZYA 4K8ZA 2P9UA 2D0OA 1S6PA 3IMXA 2ZD1A 3HSCA 3OYAA 4NYNA 4CI6A 1OH7A 5AR0A 3L2QA 1RBSA 4JD2B 3CJBA 2E6LA 4E19A 4I2PA 1WB9A 1GLBG 5FROA 2FBTA 1YJWN 4FO0A 2P9IA 3S3NA 3VTIA 1DT9A 5CY4A 3S41A 2FSJA 4C8KA 3I0SA 3ZEUA 1WLJA 2RKIA 4DCHA 1C0TA 3MWTA 2VWKA 1YHQN 3VERA 3DXMB 4GVEA 2YX6A 1V4TA 3VF2A 4BRDA 1VQ4N 4DWIA 2GWJA 3VQ9A 1Q9XA 1A5WA 3KIOA 3K5NA 1KAXA 4BRQA 3OYCA 2W42A 3NVKA 1EQYA 5AQWA 4FXDA 4CJEA 4HVJA 1KFDA 3IAYA 5BREA 4YNQA 1T03A 3VQ4A 3AA3A 4BR2A 5AZJB 3OY9A 4CFCA 1W0HA 3DLGA 3OS1A 4EIAA 5I3UA 1R59O 3AY9A 4XEIA 2PBDA 3VEZA 2DFEA 2FC0A 1CZBA 3GBTA 1MA9B 4E1JA 3UIQA 2RE2A 2P51A 4J2AA 3KWGA 1BHLA 4BDYA 2FBXA 2E2OA 3CFPA 1Q81O 3NF8A 3CI5A 4QAGA 5CHIA 3RMDA 2RN2A 2A40A 1BO5O 3K5LA 3DMJA 1KLMA 1OH8A 3SV4A 3WNHA 4GY2B 5F1XA 4ISGA 1RDWX 2F8TA 1N33K 4FW1A 4WYBA 3PO5A 4IBNA 4LY7A 2R7YA 2V7ZA 5CE3A 3LZJA 1ATSA 4LF6K 4B1YB 3OYFA 1D9DA 1A5XA 4BRMA 2IAJA 1KSPA 1IJJA 1U45A 3ULEB 1CZ9A 3C6HA 1WSFA 1RT4A 4IJAA 4CHNA 5KPTA 1HNVA 2BE2A 3TAPA 2ZF5O 2OA8A 3AA2A 2CGLA 2UUAK 1OVYA 1VSIA 4FPAA 4E3SA 5JS1A 4C1NI 4Z94A 2XY7A 4LC9B 3T1YK 4RG8A 1NJZA 3AO3A 4NLCA 1J53A 2IVOA 3TARA 5BRHA 3HRGA 3C95A 4AM7A 2VWJA 1HQUA 1ZBUA 3I56N 3FFKB 3KLEA 1GLLO 5EXWA 1NJWA 2P5OA 4FJJA 4WQ5A 1U48A 4JKEA 1VQ9N 3NVMA 1IV0A 1QTMA 3SUOA 2D5RA 4BROA 4DV4K 3K2PA 4AHRA 4BY9C 4JI2K 1KVBA 4KH6A 3HPGA 3FZLA 4DFPA 4IDHA 4W5RA 3U4LA 2E2PA 3ZSWA 4MO5A 2YI1A 3LP2A 3D2FA 4BR0A 5C0YA 2WC9A 4O44A 3SJHA 2O8DB 4JK8A 3F73A 3OYGA 4CEQA 1S3XA 3F9KA 5C10A 1ZBFA 1SL0A 1JCGA 4DQPA 1XHZA 1KAZA 2YKMA 4CJ7A 1YAGA 3O9SA 3WXJA 3HTVA 1NKEA 1DKGD 3A0IX 1F21A 4DR5K 3VQ5A 3VPZA 4RTFD 1ZXOA 4QS7A 4M45A 3LWLA 1NJXA 5JLFA 4WE1A 1U04A 3VQPA 1LAWA 3ZSRA 2F96A 1VHXA 2AJQA 3HPOA 1VSMA 4AHCA 3HOTA 3SK3A 4ISEA 2E8AA 4GV6A 1BWFO 1NBWA 3WT0A 3OBYA 3OYDA 2HNYA 3JAMO 1JJ2M 4IXCA 5M1OA 2HSTA 3LAMA 3K9JA 5GAHP 4I9QA 4CEAA 2VCPA 4YDUC 3VQBA 5KGXA 3OJSA 1RTIA 3SAGA 3WQUA 2I7PA 3U3GA 5FPDA 4U67L 4HHTA 3SNNA 4DR4K 4FJ9A 3QEPA 2P9KB 3ENHA 1D5AA 4DTRA 1WBDA 3THYA 4KI6A 4X64K 1UAXA 3G6EN 3L2RA 3D2EA 2IIRA 3B6PA 5CYQA 2RHKA 2ZWHA 4EHUA 3OS0A 2O8BA 4FWKA 1RTJA 3O9TA 3GL1A 3K57A 1Z25A 2Z1IA 1C1BA 5GADP 3A5MC 2BGGA 4YOXA 3P38A 4YOTA 2E5LK 4HUGA 3R9PA 2ETJA 1S1UA 3OYBA 3VA3A 3DXKA 3UKRB 2YHYA 4ZTFA 3DLRA 4CHPA 1QSSA 1WSEA 3V4IA 3VESA 3AO5A 4RWTA 4DUZK 4FCYA 4Y1DA 4B8CA 3ZT1A 4H5NA 5JLHA 2XHBA 2DY4A 1KTQA 1BOTO 1TKDA 3BP8A 3NE6A 2OPPA 2Q1NA 2HHSA 3AA5X 4TSXA 4C23A 2P9SB 5KPZA 5DM6L 4FJ5A 3WEEA 4DR3K 1XHXA 2BDPA 4PY5A 3RVCA 4B1UB 4YOVA 4PKIA 1TAUA 2F9TA 2P9PA 3TSQA 2ATQA 1FKPA 4RW7A 1B92A 3ZSXA 4A59A 1KD1O 4EP4A 5J2NA 5AQFA 1X3MA 3GDQA 5ADXH 1N5YA 5AQVA 3CMEN 4KPYA 1LOTB 4OGCA 2NZTA 2A42A 4J2DA 2QWRA 2PAVA 5AQIA 4M41A 4PUOA 3F2KA 4PL7A 1DLOA 3J7ZO 3L4IA 1HX1A 3FFIA 5AQSA 5JICA 5C2DA 3D6RA 4QS9A 2Q2RA 4H0TB 4M3RA 3PLAA 1KLNA 1OKJA 4DU3A 4DU1A 3OYLA 3KLGA 5M1NA 3D7EO 5M1QA 1QZ5A 4M7YA 3ZT2A 4CJ5A 2X6NA 2DTUA 3SQ0A 4RW8A 4FLYA 4DTMA 4UY8O 1XWLA 4FLVA 3M6GA 4MDBA 3CYMA 4CCHA 1IKXA 3VA0A 1W2BM 2W41A 3ZETB 5C25A 1HPZA 1T3VA 1BIZA 2VGMA 3O9UA 4DLEA 3AO1A 3QFPA 4C1NK 4CERA 4B1XB 3MN5A 4DTSA 1X9JA 3ZSVA 1NK8A 5HOOA 3CM5A 3MMVA 4H5WA 2OCEA 5HL7L 4CFBA 3LDNA 3O8MA 4E1MA 4CHZA 4X66K 5AQNA 3AVAA 2O8CA 3KKRA 4OVLA 1O13A 5AQTA 3DM2A 2XO7A 2JWKA 1NOZA 4KTWA 4H0VB 1HNIA 4FK2A 4FWMA 4JI6K 4O4GA 1GLFO 4YOYA 3OYIA 4CESA 2O8FB 3AGKA 1XI1A 1WAJA 1NGBA 3FLCO 5HRRA 4CBWA 1VK0A 4CGHA 4JKHA 4CW7B 1DTQA 1RT5A 3TTCA 4JS5A 4BREA 5HBMA 3KTQA 1WSHA 5SZTA 1NGDA 4LD0A 3NH1A 4CE9A 3PX4A 5M1PA 2OZMA 5TKWA 1HKCA 2IDOA 4M3ZA 3EYZA 1RILA 2YNIA 4JAXA 2NRTA 4W5TA 1T7PA 5KQDA 3FZHA 5AQLA 3AA4A 2A1RA 2CH6A 3CC2N 2Q36A 4BR7A 3CXCM 3SAHA 3NBPA 3M8PA 3TAEA 1L3TA 5BPNA 3L6QA 3LPUA 3SZ2A 1NK5A 1C0FA 3DLLL 4ZHRA 3THXB 3DRRA 4MQ3A 2QWMA 1RDCA 4V19S 1VQON 1KFSA 3VTHA 2ZGZA 4F4KA 2H3GX 3AVMA 3AO4A 4JHDB 5AZIB 4Z4IA 3MEEA 4ELVA 1RCHA 4DS4A 3H6EA 1TL3A 3AVCA 4IFYA 2WBNA 4K25A 4KH5A 1LWFA 3DOKA 4BWJA 3NFAA 2ZM6K 4Q5VA 2HHTA 2QI2A 4OLAA 1WN7A 3P83D 4BRIA 1S6QA 3QLHA 4H5VA 3IUCA 3J7AP 3NMUA 4CZJA 2A41A 3H46O 1TGOA 1TKTA 3ITHA 3AAQA 3HP9A 1NK9A 4KHWA 1JXBA 2ZJPL 1C0UA 4MLEA 5SWMA 1RBUA 1HNXK 3QIPA 3DLHA 5ELZA 3CJAA 3KK1A 1N6QA 3RRHA 5LL6Z 5GIPA 3CCLN 5A2QO 3RSEB 4PKHA 4B3SK 3TTDA 5HP1A 1YTAA 3KK7A 3MXMA 4Z4HA 2GV9A 5LJWA 3DOLA 1Z05A 3CC7N 4BRGA 1ITGA 3CJ1A 1VQPN 2F9WA 1XMOK 3AARA 3O08A 4NO7A 3MAQA 2WONA 3J7YP 1QZ6A 1KXPA 1K8KB 3ZSQA 2HMIA 4CGIA 4FJ7A 1YXQA 4ILHA 1U47A 2I5JA 4OPHA 1E3MA 2F7TA 1BI4B 3K5MA 3MCAB 2KZMA 4DB3A 2B6AA 5IWAK 4I6MB 4IG0A 3VGLA 3P39A 2VQFK 3V9SA 3RWUA 2F4VK 4KV8A 1RBVA 1VQKN 3SPYA 4JI7K 1D9FA 3SUNA 2BUPA 3E66A 3BEXA 2QWNA 3I8DA 4K8XA 2HVHA 4FW2A 1MWKA 4CIGA 2BH1A 2VYPA 4CBXA 4JKDA 1TL1A 2RPIA 2FBVA 2D0BA 5AQQA 2KFNA 1N8RO 1NGIA 4YOUA 3FE1A 4FLTA 4DTXA 1LW0A 4O8KA 3HM9A 4ILJA 1VRTA 4E89A 1D8YA 1S72N 3CCJN 4RCHA 4OPKA 2GTDA 1L3SA 1I3AA 5EY4A 3T3FA 3HOSA 3QEVA 4O55A 3A5LC 1N32K 3HXMA 4Z4FA 4H03B 3CCQN 4PQUA 1L3VA 3WXLA 2OPRA 3EZWA 4CJTA 4E7IA 3AGRA 3LM2A 2ZE2A 1K73O 3CJ7A 4KB1A 4N76A 4KKOA 3LP3A 4DV7K 1X3NA 4IFEA 4PA1A 3K9KA 2A3ZA 3SQ1A 1CXUA 3H3NO 3V1OA 4HTUA 1MWMA 3UKUB 4BACA 4FM1A 4H0PA 4A2BA 3KK3A 5J2MA 5GAGP 2W6KA 2G8UA 3LP1A 4A5AA 3O3HA 3L3VA 2LSNA 3NAEA 4Z4CA 4DSIA 5CR4A 5KGWA 4CFDA 1KQSM 3VQDA 1C0GA 3RMCA 4FJKA 3OYHA 1GLAG 1S1VA 5F2RA 3LDOA 3V9XA 2ZJRL 4EZ6A 4JI5K 4KTQA 1IKYA 1HJOA 4ELTA 1IBLK 4ICLA 4E7HA 4AILC 1SL2A 5I9EB 3VEYA 4JV5K 2FBYA 2ZQBA 1IH7A 3WXIA 2P9UB 2PY5A 4CK1A 4GKKK 4J2BA 3T1AA 3CCMN 1YIJN 2KLAA 4CK3A 2WTUA 4IKFA 4DR7K 3MX2A 4DMNA 2Y1IA 4NCAA 4H5RA 4JLHA 4FWRA 3QMLA 3CG7A 4CEFA 3CQYA 1TV6A 5BN9A 4MFBA 4CEDA 2KHOA 2B4JA 4X62K 4F8RA 4JI1K 2HB5A 3P1GA 3OS2A 5H1SQ 3ZEUB 1HNWK 5J2PA 2VG7A 2E4LA 3VETA 1VRUA 4FLWA 3MK6A 1ASVA 3PSFA 3I0RA 5LY3A 4KO0A 4CHYA 2GBZA 3K58A 5AQGA 2DFFA 1EXQA 3OYMA 3ULDA 5BR8K 2Q97A 4CZMA 1X9WA 1HJRA 3TR8A 2F8SA 4LSNA 3KWIA 2YNFA 3L0QA 4HUEA 3BZCA 2IVPA 1I94K 3H1VX 3I33A 4DTUA 4MLHA 1C1AA 1J9AA 5AQHA 3HVTA 4NXMK 1TUYA 4R5PA 1OH5A 3O9QA 3NCIA 4HCCA 3TABA 1SS6A 2DPNA 4BRCA 3CJ9A 4ILGB 1J6ZA 1DTTA 3HT3A 5ADXA 2HHXA 4DQ8A 1JL2A 2P9KA 2HNZA 4ELUA 2NNWA 2D0AA 3ENOA 3MWPA 3F5TA 4DTPA 1NKCA 3HO1A 1LAVA 1T8EA 1VQ6N 3VQQA 4R79A 4EHTA 4BRKA 3QETA 4IDKA 4EP5A 4DFMA 3GG4A 5KRTA 1GLEG 1QS4A 2YCHA 1BCMA 4KAZA 4BVOA 1WSGA 4CD1A 5J1EA 2A6AA 4AHVA 1C1CA 2YNGA 1N34K 1U2VA 1SKWA 4F3TA 4K42A 1ATNA 1IKVA 1QHAA 2QW9A 3UKRA 3THWA 4Z4EA 4CIEA 1ZYQA 4LFAK 4J8FA 4L8RB 4B9LA 2X74A 3BY5A 4BG8A 3IKMA 4I2QA 4Y0WA 4BRLA 1MDUB 1XNQK 3DLBA 1EWQA 4XIUA 2D4WA 3SUPA 2HW3A 3PY8A 4DTNA 2V51B 3H1QA 1RGIA 3L4QA 2VWBA 2P9LB 4CGFA 4DKWA 4E0DA 5C2FA 1RNHA 4DSJA 3S3MA 5E84A 4N5SA 3MEDA 3CM6A 2YHBA 1BDGA 1H1VA 3VEXA 3S9HA 3DRPA 3O4NA 1UA1A 4DFJA 3SQ2A 2Q0RA 1RBTA 3KZBA 3CETA 2VG5A 4GNIA 3A5NC 5LJVA 2FF3B 1DEJA 1NGAA 2KTQA 4XH1A 3QESA 1EX4A 3WNEA 4DV3K 1GOBA 4JKFA 3W0LA 4CZFA 5C12A 3HP6A 3A5OC 1VQNN 4BVPA 3N4QA 4CJWA 2E2QA 1RDDA 4KHUA 3NH2A 4BC5A 1NGHA 5I42A 3TSUA 4O5FA 4F2SA 4E1NA 3OVNA 2ASPA 4BQLA 1NGJA 3AVNA 3VEVA 3LZIA 3VQ7A 3T69A 2D1KA 2X78A 3M3ZA 1EWRA 2Y1JA 3MEGA 3PUFA 4H0XB 1JL1A 3VN5A 3W3DA 3V9UA 1TKXA 2QTDA 3QDKA 4NCBA 4H5TA 4CHQA 1VSDA 1Q18A 2WUSA 4XH5A 3ZCMA 3CCRN 1KVCA 4BGBA 2QKBA 4FSVA 1W9HA 3M8RA 3AVFA 1HUXA 1JLEA 4PKGA 2OTLN 4QCLA 1BU6O 3I8BA 4A62A 1E4GT 2O8FA 3U3YA 3SLCA 3NHGA 1NWKA 4KI4A 3R8EA 4FWPA 4KBOA 2OZSA 1CXQA 4WFNL 1JLGA 3MXJA 3O80A 1RT7A 1REVA 3FZKA 2B5JA 4DU4A 1ASWA 4DSEA 3THYB 4LFCK 3QEWA 4CGGA 1RFQA 3K0SA 5HRSA 5HRPA 5DM7L 4J2EA 3MCPA 1VQMN 3ZSZA 1Q9YA 4OPJA 3CCEN 4K0KK 2O8BB 1VQ8N 1NGEA 3VF6A 3F9MA 3KLHA 4FLZA 3ZX2A 5KQ8A 3CFRA 3LWMA 3CCUN 4CD3A 2HHUA 3SMSA 4FLUA 2HVIA 2V7YA 4OKEA 3SI6A 3SAFA 1JCFA 5AJ3K 4Q0BA 1NK4A 2P9NB
chains in the Genus database with same CATH topology
3PV8A 3ZT0A 1EP4A 2RN2A 3RMDA 3MXMA 3K5LA 1K6YA 3DMJA 4Z4HA 2GV9A 2YKNA 1KLMA 3DOLA 1UOCA 4IG3A 3WNHA 2QXFA 3SV4A 1ITGA 3LAKA 4UQGA 3MAQA 4O0JA 2WONA 3QNNA 2F8TA 4JS4A 1U49A 1RT2A 3IS9A 4FW1A 3PO5A 1Q8IA 3E01A 4IBNA 4FJIA 3AVIA 4LY7A 2R7YA 3RR7A 3ZSQA 3LZJA 1LWEA 1XC9A 2HMIA 3VQ6A 4M3TA 1SUQA 4CGIA 3OYNA 4FJ7A 4DLGA 4B9UA 4KRFA 3OYFA 1U47A 1A5XA 1D9DA 2IAJA 2I5JA 1KSPA 3K5MA 1BI4B 1JLAA 1NK6A 4KHSA 1U45A 4PWDA 4CF0A 4KHNA 4KHYA 2KZMA 1CZ9A 4M3YA 5DK5A 1WSFA 1IO2A 1RT4A 2OPSA 3TANA 4CHNA 2B6AA 4CGDA 1SKRA 1HNVA 3KK2A 3CQ8A 2BE2A 4IG0A 3TAPA 4F2RA 3V9SA 5KTQA 3RWUA 1NOYA 2OA8A 1G15A 4KV8A 1RBVA 4NYFA 3AA2A 3SPYA 5CYMA 3SUNA 4CK2A 3WNFA 3M8QA 1D9FA 1GOCA 3MECA 4N41A 4CEBA 3HPHA 4GVMA 1VSIA 4B3OA 3AVHA 3AVBA 3NGYA 5T7BA 3I8DA 1QSYA 4K8XA 4FW2A 4CIGA 2HVHA 4E3SA 4Q0BA 1C0MA 2PYJA 3U6FA 5JS1A 2KQ2A 1S1WA 2XY7A 1YTUA 1TL1A 2RPIA 4CEZA 1B9DA 4CHOA 3KKSA 4OKKA 4W5NA 2XY6A 2FBVA 3AVKA 2D0BA 4B9TA 4RG8A 1NJZA 3AO3A 4EZ9A 4CJLA 2KFNA 1J53A 2OYQA 3TARA 4C8MA 2IGIA 3C95A 4B9SA 4FM0A 2VWJA 1HQUA 4FLTA 4DTXA 1LW0A 4FJNA 1IKWA 5KRSA 4HUFA 4OLBA 1ZBUA 2E6MA 4CF8A 1QSLA 3HM9A 2A1SA 4E89A 1VRTA 3KLEA 4DQRA 2Z1JA 3VQ8A 1RT3A 1D8YA 4RW6A 2ITGA 2G8KA 1NJWA 2P5OA 4FJJA 3O4QA 1U48A 4CJKA 4OPKA 1QHTA 1L3SA 1I3AA 3T3FA 3SUQA 3ALYA 1QTMA 4FJ8A 3QEVA 4LSLA 4O55A 2D5RA 3SUOA 4GMJB 1MU2A 3HXMA 3D45A 4KB0A 1TVRA 2KFZA 3K2PA 1BQNA 3V6DA 4Z4FA 4Y1CA 1QE1A 4AHRA 1T05A 1S1XA 4PQUA 1L3VA 3CFOA 4FK4A 2G8IA 3C6UA 3RTVA 2O4GA 4CF1A 2OPRA 4CJTA 4E7IA 1KVBA 2ZE2A 4KB1A 4N76A 3HPGA 1FKOA 2YHAA 4KKOA 5JS2A 4N56A 4DFPA 4OJRA 4BE2A 4W5RA 3LP3A 3L8BA 2JLEA 4FJGA 4PA1A 3ZSWA 1QQCA 3OYJA 3LP2A 3SQ1A 1CXUA 3V1OA 4HTUA 4O44A 4BACA 3AVLA 3KK3A 4FM1A 5KI6A 4CJQA 1VSJA 3F73A 5J2MA 3HJFA 3OYGA 4AHSA 4CEQA 2G8UA 3LP1A 3F9KA 1ZBFA 3QIOA 3O3HA 1SL0A 2PZSA 1ZBHA 3L3VA 1RBRA 2LSNA 2P5GA 4H8KA 4ZTJA 3NAEA 4CJ4A 1RDAA 4Z4CA 3TWHA 1XHZA 4DQPA 4DSIA 5KGWA 4CFDA 3P5JA 2YKMA 3VQDA 3RMCA 4C8NA 4FJKA 3OYHA 4CGJA 1NKEA 3G10A 1F21A 3DLKA 3QERA 1ZBLA 1S1VA 3VQ5A 3D0PA 1X9MA 3V9XA 2Q3SA 3MXIA 4EZ6A 4KTQA 1IKYA 4BE1A 1S1TA 4FZZA 3AVJA 3AVGA 1TK0A 4M45A 3LWLA 4ICLA 1NJXA 4ELTA 4E7HA 4WE1A 1U04A 3VQPA 5HLFA 4AILC 1LAWA 3SPZA 1SL2A 1HQEA 3ZSRA 4CF2A 2F96A 3M8SA 2AJQA 3HPOA 2FBYA 4JRPA 2ZQBA 1L5UA 1HYSA 1GOAA 1VSMA 3V1QA 4AHCA 1BIUA 4CIFA 1IH7A 4E7JA 1SKSA 1RT1A 2PY5A 4DQIA 4M3WA 3OYDA 4DS5A 3V81A 1WSIA 2HNYA 3PO4A 4CK1A 4BWMA 4J2BA 3LAMA 5CZ1A 3RRGA 3T1AA 1ASUA 2XY8A 4H4OA 4CEAA 3C6TA 4I9QA 3KD5E 4IKFA 4CK3A 3VQBA 5KGXA 4DMNA 3OJSA 3NDKA 1RTIA 1U4BA 2Y1IA 1JLQA 3WNGA 1J5OA 3IRXA 4FK0A 4NCAA 1B9FA 3EZ5A 3TI0A 3V9ZA 4JLHA 1HYZA 4CF9A 4FLXA 4LH5A 3SCXA 3G0ZA 4FJMA 3CG7A 4FM2A 4CEFA 3NH0A 3U3GA 4ID5A 1O1WA 4HHTA 1TV6A 3LALA 4MFBA 4CJFA 4CEDA 3SNNA 2P1JA 2D0CA 4FJ9A 1Z26A 2B4JA 3QEPA 3LDSA 1EKEA 4F8RA 1D5AA 4DTRA 2G8WA 4G1QA 3QEXA 1UWBA 3HYFA 4CFAA 2HB5A 3P1GA 3VQEA 3OS2A 3RMBA 4KI6A 3EY1A 4JRQA 5J2PA 2VG7A 1UAXA 2E4LA 1JKHA 1VRUA 3O3FA 3L2RA 2JGUA 4FLWA 4ID1A 5HRNA 3B6PA 3SQ4A 4CJ3A 5CYQA 1ASVA 3HL8A 3KD1E 3I0RA 3THVA 3OS0A 4KO0A 3HSTB 4CHYA 1WNSA 1RTJA 2GBZA 3ZSOA 4CEOA 3K57A 3K58A 2DFFA 4DQSA 1EXQA 1Z25A 2Z1IA 1C1BA 3OYMA 3ISNC 3ULDA 2BGGA 3V1RA 1IG9A 4FJLA 1TK8A 4HUGA 2ETJA 2YV0X 1S1UA 3OYBA 3VA3A 1X9WA 1BCOA 1BL3A 4KTZA 2IOCA 3DLEA 4IFVA 4ZTFA 1HJRA 3DLRA 3TR8A 4LSNA 4CHPA 2F8SA 1ZBIA 1QSSA 1WSEA 2YNFA 3V4IA 3PX0A 1EETA 3SV3A 4HUEA 2KW4A 2YNHA 3AO5A 1RDBA 4FCYA 4AHUA 1NKBA 4DTUA 4Y1DA 4CJSA 3ASMA 4B8CA 3ZT1A 1C1AA 3QINA 1J9AA 2OPQA 3HVTA 5FRNA 1BISA 4M42A 1RTHA 4RW9A 4R5PA 3KLFA 2XHBA 2DY4A 4KFBA 3NCIA 4HCCA 1KTQA 5C42A 3TABA 4CECA 4O0IA 3NE6A 4LH4A 1TKDA 3L2UA 2OPPA 3LANA 1JLCA 2HHSA 3AA5X 4TSXA 2QK9A 1BI4A 3HVRA 3NGZA 1DTTA 4FJ5A 1SL1A 1KVAA 3HT3A 5FDLA 4AH9A 1XHXA 2BDPA 2HHXA 3O3GA 1C6VA 4PY5A 3OYKA 4DTOA 1JL2A 1R0AA 2HNZA 3VQCA 1NJYA 4ELUA 1TAUA 4FVMA 2D0AA 5FRMA 2ATQA 2EHGA 1FKPA 4RW7A 4DTPA 1NKCA 4DFKA 1B92A 3ZSXA 1UA0A 3HO1A 3KLIA 1I39A 4EP4A 1JLBA 4N47A 5J2NA 1FXXA 1LAVA 1T8EA 3VQQA 1S5JA 2EX3A 2XRIA 5E41A 3PX6A 2X6SA 1JLFA 3C94A 2G8VA 1N5YA 3QETA 4IDKA 4EP5A 3AO2A 4C8OA 4DFMA 4DSFA 4KPYA 5KRTA 2O4IA 1QS4A 2IC3A 1BGXT 3QO9A 1BCMA 4NCGA 1LW2A 1YVUA 4OGCA 4CJVA 4KAZA 4J2DA 1WSGA 4BDZA 4FJXA 4DG1A 4M41A 4PUOA 5J1EA 2Z1GA 3ZSYA 2RF2A 4AHVA 1C1CA 2YNGA 4E7KA 1CLQA 3RR8A 1DLOA 3FFIA 3QNOA 2NUBA 1SKWA 4I9LA 4F3TA 3IG1A 3K59A 4KREA 3S3OA 1IKVA 4C8LA 2G8FA 4DSKA 4M3RA 4GW6A 1KLNA 4DU3A 4DU1A 3OYLA 3KLGA 4Z4EA 3OJUA 4CIEA 1ZYQA 2KZZA 4B8AB 1L3UA 4L8RB 4B9LA 2X74A 3ZT2A 4DF8A 4CJ5A 2DTUA 2X6NA 3SQ0A 4I2QA 4RW8A 4FLYA 1TK5A 3DLBA 2GUIA 4BE0A 4YFUA 4O5BA 4XIUA 3KJVA 4DTMA 3SUPA 1XWLA 4FLVA 5HROA 2HW3A 3PY8A 4DF4A 1VSFA 4DTNA 3L2VA 3QEIA 1HMVA 3CYMA 1LWCA 3NGIA 1IKXA 4B9NA 3JSMA 4CCHA 3VA0A 5DMRA 3VQAA 4CJRA 4E0DA 4CGFA 5C25A 1HPZA 1Y97A 1RNHA 3H08A 5CZ2A 3L2WA 4B9VA 1BIZA 2PYLA 4DSJA 3B6OA 3TAFA 3S3MA 4M3XA 5C24A 4DLEA 4N5SA 3MEDA 3AO1A 3CM6A 2YHBA 4QOZB 1TKZA 4RW4A 3NF9A 4CERA 1SV5A 3NF7A 4DTSA 3ZSVA 5D3GA 1NK8A 1WAFA 4KHQA 2DFHA 3A2FA 1S9EA 1J54A 1RTDA 1JXEA 3CM5A 1KRPA 2QKKA 4CFBA 4E1MA 3S9HA 3DRPA 3O4NA 4CHZA 4DFJA 3SQ2A 1UA1A 4BDPA 1S9GA 3AVAA 4AHTA 2HHQA 3KKRA 4OVLA 3ZT3A 1RBTA 1WSJA 3TAMA 3DM2A 2VG5A 2XO7A 1NOZA 4KTWA 5EU7A 4H4MA 3T19A 1VSKA 1KCFA 2G8HA 1HNIA 4FK2A 4O4GA 1VSEA 2WOMA 3NF6A 4B9MA 4M3UA 3OYIA 2KTQA 1VSLA 4CESA 2HHWA 3QESA 1EX4A 3HK2A 3WNEA 3RMAA 3TAQA 1XI1A 1X1PA 4FJHA 1GOBA 4F3OA 1WAJA 5HRRA 1VK0A 4CGHA 4OGEA 3HP6A 4FZXC 1DTQA 3BGRA 4CJWA 1RT5A 4JS5A 2Z1HA 4W5OA 4W5QA 3OYEA 4FZYA 4K8ZA 1RDDA 4KHUA 5HBMA 3NH2A 1HRHA 3KTQA 1LV5A 1WSHA 5SZTA 1S6PA 1TAQA 2ZD1A 4B08A 5I42A 4F2SA 4E1NA 3LP0A 3OVNA 3JYTA 3TAGA 3OYAA 4NYNA 4LD0A 3NH1A 4CE9A 1VSHA 3AVNA 1X9SA 3PX4A 3LZIA 2OZMA 1A5VA 1RT6A 3VQ7A 3L2QA 2IDOA 1NK0A 2X78A 3EYZA 4M3ZA 1RBSA 1RILA 2YNIA 2HHTA 4Z0UA 1YT3A 4W5TA 1T7PA 3LPTA 2Y1JA 3MEGA 3DRSA 2E6LA 4E19A 2VG6A 3AA4A 3AV9A 2A1RA 3PUFA 4I2PA 1JL1A 3VN5A 3V9UA 5FROA 1TKXA 2FBTA 4NCBA 5J2QA 3K5OA 4DQQA 2HHVA 3NBPA 4CHQA 3BDPA 1VSDA 2HNDA 3M8PA 5K14A 3S3NA 4Z4GA 3TAEA 1L3TA 5CY4A 4CEEA 3DYAA 3LPUA 3ZCMA 4CJUA 3SZ2A 1NK5A 4C8KA 1KVCA 3I0SA 1NK7A 2QKBA 4ZHRA 1WLJA 2RKIA 1W9HA 1C0TA 3DRRA 3M8RA 2VWKA 3SYZA 4MQ3A 3AVFA 4CJPA 1JLEA 4QCLA 4I7FA 1RDCA 4HCBA 2BANA 1KFSA 3U3YA 3NHGA 3L3UA 4DWIA 1BQMA 4F4KA 3AVMA 3VQ9A 3AO4A 3V9WA 2XY5A 1Q9XA 4KI4A 1FK9A 2OZSA 4Z4IA 1A5WA 1CXQA 1HYVA 3KIOA 3MEEA 4OKJA 1RCHA 3K5NA 4ELVA 2W42A 3OYCA 1JLGA 3MXJA 4DS4A 1TL3A 3AVCA 1RT7A 4IFYA 1REVA 4FXDA 4DTJA 2B5JA 4CJEA 4HVJA 1KFDA 4DU4A 3IAYA 3DI6A 1LWFA 1ASWA 3DOKA 4BWJA 3NFAA 4YNQA 4DSEA 1T03A 3VQ4A 3AA3A 3QEWA 4CGGA 3OY9A 4CFCA 4Q5VA 1W0HA 5HRSA 3DLGA 5HRPA 3OS1A 4J2EA 4OLAA 5I3UA 4FYDA 1WN7A 3ZSZA 1Q9YA 4OPJA 3P83D 1S6QA 4DSLA 2DFEA 3QLHA 3ZT4A 2FC0A 1CZBA 1TGOA 1TKTA 3ITHA 3HP9A 1NK9A 3UIQA 2P51A 3SJJA 4J2AA 4FLZA 3KLHA 4KHWA 1BHLA 1JXBA 1C0UA 4BDYA 5SWMA 2FBXA 1RBUA 2IS3A 3QIPA 3CFPA 3DLHA 3CFRA 3LWMA 2HHUA 4FLUA 3KK1A 1N6QA 3NF8A 4OKEA 3RRHA 3SI6A 2HVIA 4QAGA 4E7LA 1NK4A 5HP1A 1YTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PV8 A;  3ZT0 A;  1EP4 A;  2RN2 A;  3RMD A;  3MXM A;  3K5L A;  1K6Y A;  3DMJ A;  4Z4H A;  2GV9 A;  2YKN A;  1KLM A;  3DOL A;  1UOC A;  4IG3 A;  3WNH A;  2QXF A;  3SV4 A;  1ITG A;  3LAK A;  4UQG A;  3MAQ A;  4O0J A;  2WON A;  3QNN A;  2F8T A;  4JS4 A;  1U49 A;  1RT2 A;  3IS9 A;  4FW1 A;  3PO5 A;  1Q8I A;  3E01 A;  4IBN A;  4FJI A;  3AVI A;  4LY7 A;  2R7Y A;  3RR7 A;  3ZSQ A;  3LZJ A;  1LWE A;  1XC9 A;  2HMI A;  3VQ6 A;  4M3T A;  1SUQ A;  4CGI A;  3OYN A;  4FJ7 A;  4DLG A;  4B9U A;  4KRF A;  3OYF A;  1U47 A;  1A5X A;  1D9D A;  2IAJ A;  2I5J A;  1KSP A;  3K5M A;  1BI4 B;  1JLA A;  1NK6 A;  4KHS A;  1U45 A;  4PWD A;  4CF0 A;  4KHN A;  4KHY A;  2KZM A;  1CZ9 A;  4M3Y A;  5DK5 A;  1WSF A;  1IO2 A;  1RT4 A;  2OPS A;  3TAN A;  4CHN A;  2B6A A;  4CGD A;  1SKR A;  1HNV A;  3KK2 A;  3CQ8 A;  2BE2 A;  4IG0 A;  3TAP A;  4F2R A;  3V9S A;  5KTQ A;  3RWU A;  1NOY A;  2OA8 A;  1G15 A;  4KV8 A;  1RBV A;  4NYF A;  3AA2 A;  3SPY A;  5CYM A;  3SUN A;  4CK2 A;  3WNF A;  3M8Q A;  1D9F A;  1GOC A;  3MEC A;  4N41 A;  4CEB A;  3HPH A;  4GVM A;  1VSI A;  4B3O A;  3AVH A;  3AVB A;  3NGY A;  5T7B A;  3I8D A;  1QSY A;  4K8X A;  4FW2 A;  4CIG A;  2HVH A;  4E3S A;  4Q0B A;  1C0M A;  2PYJ A;  3U6F A;  5JS1 A;  2KQ2 A;  1S1W A;  2XY7 A;  1YTU A;  1TL1 A;  2RPI A;  4CEZ A;  1B9D A;  4CHO A;  3KKS A;  4OKK A;  4W5N A;  2XY6 A;  2FBV A;  3AVK A;  2D0B A;  4B9T A;  4RG8 A;  1NJZ A;  3AO3 A;  4EZ9 A;  4CJL A;  2KFN A;  1J53 A;  2OYQ A;  3TAR A;  4C8M A;  2IGI A;  3C95 A;  4B9S A;  4FM0 A;  2VWJ A;  1HQU A;  4FLT A;  4DTX A;  1LW0 A;  4FJN A;  1IKW A;  5KRS A;  4HUF A;  4OLB A;  1ZBU A;  2E6M A;  4CF8 A;  1QSL A;  3HM9 A;  2A1S A;  4E89 A;  1VRT A;  3KLE A;  4DQR A;  2Z1J A;  3VQ8 A;  1RT3 A;  1D8Y A;  4RW6 A;  2ITG A;  2G8K A;  1NJW A;  2P5O A;  4FJJ A;  3O4Q A;  1U48 A;  4CJK A;  4OPK A;  1QHT A;  1L3S A;  1I3A A;  3T3F A;  3SUQ A;  3ALY A;  1QTM A;  4FJ8 A;  3QEV A;  4LSL A;  4O55 A;  2D5R A;  3SUO A;  4GMJ B;  1MU2 A;  3HXM A;  3D45 A;  4KB0 A;  1TVR A;  2KFZ A;  3K2P A;  1BQN A;  3V6D A;  4Z4F A;  4Y1C A;  1QE1 A;  4AHR A;  1T05 A;  1S1X A;  4PQU A;  1L3V A;  3CFO A;  4FK4 A;  2G8I A;  3C6U A;  3RTV A;  2O4G A;  4CF1 A;  2OPR A;  4CJT A;  4E7I A;  1KVB A;  2ZE2 A;  4KB1 A;  4N76 A;  3HPG A;  1FKO A;  2YHA A;  4KKO A;  5JS2 A;  4N56 A;  4DFP A;  4OJR A;  4BE2 A;  4W5R A;  3LP3 A;  3L8B A;  2JLE A;  4FJG A;  4PA1 A;  3ZSW A;  1QQC A;  3OYJ A;  3LP2 A;  3SQ1 A;  1CXU A;  3V1O A;  4HTU A;  4O44 A;  4BAC A;  3AVL A;  3KK3 A;  4FM1 A;  5KI6 A;  4CJQ A;  1VSJ A;  3F73 A;  5J2M A;  3HJF A;  3OYG A;  4AHS A;  4CEQ A;  2G8U A;  3LP1 A;  3F9K A;  1ZBF A;  3QIO A;  3O3H A;  1SL0 A;  2PZS A;  1ZBH A;  3L3V A;  1RBR A;  2LSN A;  2P5G A;  4H8K A;  4ZTJ A;  3NAE A;  4CJ4 A;  1RDA A;  4Z4C A;  3TWH A;  1XHZ A;  4DQP A;  4DSI A;  5KGW A;  4CFD A;  3P5J A;  2YKM A;  3VQD A;  3RMC A;  4C8N A;  4FJK A;  3OYH A;  4CGJ A;  1NKE A;  3G10 A;  1F21 A;  3DLK A;  3QER A;  1ZBL A;  1S1V A;  3VQ5 A;  3D0P A;  1X9M A;  3V9X A;  2Q3S A;  3MXI A;  4EZ6 A;  4KTQ A;  1IKY A;  4BE1 A;  1S1T A;  4FZZ A;  3AVJ A;  3AVG A;  1TK0 A;  4M45 A;  3LWL A;  4ICL A;  1NJX A;  4ELT A;  4E7H A;  4WE1 A;  1U04 A;  3VQP A;  5HLF A;  4AIL C;  1LAW A;  3SPZ A;  1SL2 A;  1HQE A;  3ZSR A;  4CF2 A;  2F96 A;  3M8S A;  2AJQ A;  3HPO A;  2FBY A;  4JRP A;  2ZQB A;  1L5U A;  1HYS A;  1GOA A;  1VSM A;  3V1Q A;  4AHC A;  1BIU A;  4CIF A;  1IH7 A;  4E7J A;  1SKS A;  1RT1 A;  2PY5 A;  4DQI A;  4M3W A;  3OYD A;  4DS5 A;  3V81 A;  1WSI A;  2HNY A;  3PO4 A;  4CK1 A;  4BWM A;  4J2B A;  3LAM A;  5CZ1 A;  3RRG A;  3T1A A;  1ASU A;  2XY8 A;  4H4O A;  4CEA A;  3C6T A;  4I9Q A;  3KD5 E;  4IKF A;  4CK3 A;  3VQB A;  5KGX A;  4DMN A;  3OJS A;  3NDK A;  1RTI A;  1U4B A;  2Y1I A;  1JLQ A;  3WNG A;  1J5O A;  3IRX A;  4FK0 A;  4NCA A;  1B9F A;  3EZ5 A;  3TI0 A;  3V9Z A;  4JLH A;  1HYZ A;  4CF9 A;  4FLX A;  4LH5 A;  3SCX A;  3G0Z A;  4FJM A;  3CG7 A;  4FM2 A;  4CEF A;  3NH0 A;  3U3G A;  4ID5 A;  1O1W A;  4HHT A;  1TV6 A;  3LAL A;  4MFB A;  4CJF A;  4CED A;  3SNN A;  2P1J A;  2D0C A;  4FJ9 A;  1Z26 A;  2B4J A;  3QEP A;  3LDS A;  1EKE A;  4F8R A;  1D5A A;  4DTR A;  2G8W A;  4G1Q A;  3QEX A;  1UWB A;  3HYF A;  4CFA A;  2HB5 A;  3P1G A;  3VQE A;  3OS2 A;  3RMB A;  4KI6 A;  3EY1 A;  4JRQ A;  5J2P A;  2VG7 A;  1UAX A;  2E4L A;  1JKH A;  1VRU A;  3O3F A;  3L2R A;  2JGU A;  4FLW A;  4ID1 A;  5HRN A;  3B6P A;  3SQ4 A;  4CJ3 A;  5CYQ A;  1ASV A;  3HL8 A;  3KD1 E;  3I0R A;  3THV A;  3OS0 A;  4KO0 A;  3HST B;  4CHY A;  1WNS A;  1RTJ A;  2GBZ A;  3ZSO A;  4CEO A;  3K57 A;  3K58 A;  2DFF A;  4DQS A;  1EXQ A;  1Z25 A;  2Z1I A;  1C1B A;  3OYM A;  3ISN C;  3ULD A;  2BGG A;  3V1R A;  1IG9 A;  4FJL A;  1TK8 A;  4HUG A;  2ETJ A;  2YV0 X;  1S1U A;  3OYB A;  3VA3 A;  1X9W A;  1BCO A;  1BL3 A;  4KTZ A;  2IOC A;  3DLE A;  4IFV A;  4ZTF A;  1HJR A;  3DLR A;  3TR8 A;  4LSN A;  4CHP A;  2F8S A;  1ZBI A;  1QSS A;  1WSE A;  2YNF A;  3V4I A;  3PX0 A;  1EET A;  3SV3 A;  4HUE A;  2KW4 A;  2YNH A;  3AO5 A;  1RDB A;  4FCY A;  4AHU A;  1NKB A;  4DTU A;  4Y1D A;  4CJS A;  3ASM A;  4B8C A;  3ZT1 A;  1C1A A;  3QIN A;  1J9A A;  2OPQ A;  3HVT A;  5FRN A;  1BIS A;  4M42 A;  1RTH A;  4RW9 A;  4R5P A;  3KLF A;  2XHB A;  2DY4 A;  4KFB A;  3NCI A;  4HCC A;  1KTQ A;  5C42 A;  3TAB A;  4CEC A;  4O0I A;  3NE6 A;  4LH4 A;  1TKD A;  3L2U A;  2OPP A;  3LAN A;  1JLC A;  2HHS A;  3AA5 X;  4TSX A;  2QK9 A;  1BI4 A;  3HVR A;  3NGZ A;  1DTT A;  4FJ5 A;  1SL1 A;  1KVA A;  3HT3 A;  5FDL A;  4AH9 A;  1XHX A;  2BDP A;  2HHX A;  3O3G A;  1C6V A;  4PY5 A;  3OYK A;  4DTO A;  1JL2 A;  1R0A A;  2HNZ A;  3VQC A;  1NJY A;  4ELU A;  1TAU A;  4FVM A;  2D0A A;  5FRM A;  2ATQ A;  2EHG A;  1FKP A;  4RW7 A;  4DTP A;  1NKC A;  4DFK A;  1B92 A;  3ZSX A;  1UA0 A;  3HO1 A;  3KLI A;  1I39 A;  4EP4 A;  1JLB A;  4N47 A;  5J2N A;  1FXX A;  1LAV A;  1T8E A;  3VQQ A;  1S5J A;  2EX3 A;  2XRI A;  5E41 A;  3PX6 A;  2X6S A;  1JLF A;  3C94 A;  2G8V A;  1N5Y A;  3QET A;  4IDK A;  4EP5 A;  3AO2 A;  4C8O A;  4DFM A;  4DSF A;  4KPY A;  5KRT A;  2O4I A;  1QS4 A;  2IC3 A;  1BGX T;  3QO9 A;  1BCM A;  4NCG A;  1LW2 A;  1YVU A;  4OGC A;  4CJV A;  4KAZ A;  4J2D A;  1WSG A;  4BDZ A;  4FJX A;  4DG1 A;  4M41 A;  4PUO A;  5J1E A;  2Z1G A;  3ZSY A;  2RF2 A;  4AHV A;  1C1C A;  2YNG A;  4E7K A;  1CLQ A;  3RR8 A;  1DLO A;  3FFI A;  3QNO A;  2NUB A;  1SKW A;  4I9L A;  4F3T A;  3IG1 A;  3K59 A;  4KRE A;  3S3O A;  1IKV A;  4C8L A;  2G8F A;  4DSK A;  4M3R A;  4GW6 A;  1KLN A;  4DU3 A;  4DU1 A;  3OYL A;  3KLG A;  4Z4E A;  3OJU A;  4CIE A;  1ZYQ A;  2KZZ A;  4B8A B;  1L3U A;  4L8R B;  4B9L A;  2X74 A;  3ZT2 A;  4DF8 A;  4CJ5 A;  2DTU A;  2X6N A;  3SQ0 A;  4I2Q A;  4RW8 A;  4FLY A;  1TK5 A;  3DLB A;  2GUI A;  4BE0 A;  4YFU A;  4O5B A;  4XIU A;  3KJV A;  4DTM A;  3SUP A;  1XWL A;  4FLV A;  5HRO A;  2HW3 A;  3PY8 A;  4DF4 A;  1VSF A;  4DTN A;  3L2V A;  3QEI A;  1HMV A;  3CYM A;  1LWC A;  3NGI A;  1IKX A;  4B9N A;  3JSM A;  4CCH A;  3VA0 A;  5DMR A;  3VQA A;  4CJR A;  4E0D A;  4CGF A;  5C25 A;  1HPZ A;  1Y97 A;  1RNH A;  3H08 A;  5CZ2 A;  3L2W A;  4B9V A;  1BIZ A;  2PYL A;  4DSJ A;  3B6O A;  3TAF A;  3S3M A;  4M3X A;  5C24 A;  4DLE A;  4N5S A;  3MED A;  3AO1 A;  3CM6 A;  2YHB A;  4QOZ B;  1TKZ A;  4RW4 A;  3NF9 A;  4CER A;  1SV5 A;  3NF7 A;  4DTS A;  3ZSV A;  5D3G A;  1NK8 A;  1WAF A;  4KHQ A;  2DFH A;  3A2F A;  1S9E A;  1J54 A;  1RTD A;  1JXE A;  3CM5 A;  1KRP A;  2QKK A;  4CFB A;  4E1M A;  3S9H A;  3DRP A;  3O4N A;  4CHZ A;  4DFJ A;  3SQ2 A;  1UA1 A;  4BDP A;  1S9G A;  3AVA A;  4AHT A;  2HHQ A;  3KKR A;  4OVL A;  3ZT3 A;  1RBT A;  1WSJ A;  3TAM A;  3DM2 A;  2VG5 A;  2XO7 A;  1NOZ A;  4KTW A;  5EU7 A;  4H4M A;  3T19 A;  1VSK A;  1KCF A;  2G8H A;  1HNI A;  4FK2 A;  4O4G A;  1VSE A;  2WOM A;  3NF6 A;  4B9M A;  4M3U A;  3OYI A;  2KTQ A;  1VSL A;  4CES A;  2HHW A;  3QES A;  1EX4 A;  3HK2 A;  3WNE A;  3RMA A;  3TAQ A;  1XI1 A;  1X1P A;  4FJH A;  1GOB A;  4F3O A;  1WAJ A;  5HRR A;  1VK0 A;  4CGH A;  4OGE A;  3HP6 A;  4FZX C;  1DTQ A;  3BGR A;  4CJW A;  1RT5 A;  4JS5 A;  2Z1H A;  4W5O A;  4W5Q A;  3OYE A;  4FZY A;  4K8Z A;  1RDD A;  4KHU A;  5HBM A;  3NH2 A;  1HRH A;  3KTQ A;  1LV5 A;  1WSH A;  5SZT A;  1S6P A;  1TAQ A;  2ZD1 A;  4B08 A;  5I42 A;  4F2S A;  4E1N A;  3LP0 A;  3OVN A;  3JYT A;  3TAG A;  3OYA A;  4NYN A;  4LD0 A;  3NH1 A;  4CE9 A;  1VSH A;  3AVN A;  1X9S A;  3PX4 A;  3LZI A;  2OZM A;  1A5V A;  1RT6 A;  3VQ7 A;  3L2Q A;  2IDO A;  1NK0 A;  2X78 A;  3EYZ A;  4M3Z A;  1RBS A;  1RIL A;  2YNI A;  2HHT A;  4Z0U A;  1YT3 A;  4W5T A;  1T7P A;  3LPT A;  2Y1J A;  3MEG A;  3DRS A;  2E6L A;  4E19 A;  2VG6 A;  3AA4 A;  3AV9 A;  2A1R A;  3PUF A;  4I2P A;  1JL1 A;  3VN5 A;  3V9U A;  5FRO A;  1TKX A;  2FBT A;  4NCB A;  5J2Q A;  3K5O A;  4DQQ A;  2HHV A;  3NBP A;  4CHQ A;  3BDP A;  1VSD A;  2HND A;  3M8P A;  5K14 A;  3S3N A;  4Z4G A;  3TAE A;  1L3T A;  5CY4 A;  4CEE A;  3DYA A;  3LPU A;  3ZCM A;  4CJU A;  3SZ2 A;  1NK5 A;  4C8K A;  1KVC A;  3I0S A;  1NK7 A;  2QKB A;  4ZHR A;  1WLJ A;  2RKI A;  1W9H A;  1C0T A;  3DRR A;  3M8R A;  2VWK A;  3SYZ A;  4MQ3 A;  3AVF A;  4CJP A;  1JLE A;  4QCL A;  4I7F A;  1RDC A;  4HCB A;  2BAN A;  1KFS A;  3U3Y A;  3NHG A;  3L3U A;  4DWI A;  1BQM A;  4F4K A;  3AVM A;  3VQ9 A;  3AO4 A;  3V9W A;  2XY5 A;  1Q9X A;  4KI4 A;  1FK9 A;  2OZS A;  4Z4I A;  1A5W A;  1CXQ A;  1HYV A;  3KIO A;  3MEE A;  4OKJ A;  1RCH A;  3K5N A;  4ELV A;  2W42 A;  3OYC A;  1JLG A;  3MXJ A;  4DS4 A;  1TL3 A;  3AVC A;  1RT7 A;  4IFY A;  1REV A;  4FXD A;  4DTJ A;  2B5J A;  4CJE A;  4HVJ A;  1KFD A;  4DU4 A;  3IAY A;  3DI6 A;  1LWF A;  1ASW A;  3DOK A;  4BWJ A;  3NFA A;  4YNQ A;  4DSE A;  1T03 A;  3VQ4 A;  3AA3 A;  3QEW A;  4CGG A;  3OY9 A;  4CFC A;  4Q5V A;  1W0H A;  5HRS A;  3DLG A;  5HRP A;  3OS1 A;  4J2E A;  4OLA A;  5I3U A;  4FYD A;  1WN7 A;  3ZSZ A;  1Q9Y A;  4OPJ A;  3P83 D;  1S6Q A;  4DSL A;  2DFE A;  3QLH A;  3ZT4 A;  2FC0 A;  1CZB A;  1TGO A;  1TKT A;  3ITH A;  3HP9 A;  1NK9 A;  3UIQ A;  2P51 A;  3SJJ A;  4J2A A;  4FLZ A;  3KLH A;  4KHW A;  1BHL A;  1JXB A;  1C0U A;  4BDY A;  5SWM A;  2FBX A;  1RBU A;  2IS3 A;  3QIP A;  3CFP A;  3DLH A;  3CFR A;  3LWM A;  2HHU A;  4FLU A;  3KK1 A;  1N6Q A;  3NF8 A;  4OKE A;  3RRH A;  3SI6 A;  2HVI A;  4QAG A;  4E7L A;  1NK4 A;  5HP1 A;  1YTA A; 
#chains in the Genus database with same CATH topology
 3ZT0 A;  1EP4 A;  1K6Y A;  3PSI A;  2YKN A;  1UOC A;  2QXF A;  4WFB L;  3LAK A;  4UQG A;  5GIN A;  2CH5 A;  2NRX A;  4EAH D;  4JS4 A;  1ILY A;  1Q8I A;  3E01 A;  3AVI A;  1NM1 A;  1XC9 A;  3VOV A;  3BF1 A;  4MDA A;  5F0X A;  3TTF A;  4DR2 K;  4B1V A;  3OYN A;  4B9U A;  4KRF A;  3O1W A;  3M5R A;  4JKA A;  4KHS A;  2IVN A;  4KHN A;  2FSN A;  2AP1 A;  5DK5 A;  4JNE A;  2QEX N;  3TAN A;  1SKR A;  3KK2 A;  4F2R A;  1NOY A;  1TYQ A;  4CK2 A;  3WNF A;  3M8Q A;  1GOC A;  2E88 A;  3MEC A;  4CEB A;  3HPH A;  1QSY A;  3AVB A;  2HMP A;  3MN7 A;  4IWV A;  1C0M A;  2PYJ A;  4AF1 A;  2KQ2 A;  2W6L A;  2HBM A;  2YJE A;  1B9D A;  3KKS A;  2XY6 A;  2FXU A;  4B9T A;  3DWL A;  2O8E A;  4CJL A;  2OYQ A;  3C7N B;  3DJC A;  4C8M A;  4FM0 A;  5MLC Q;  3A8Y A;  1K9M O;  4FJN A;  5KRS A;  1QVG M;  4OLB A;  4CF8 A;  2E6M A;  3HZ6 A;  1QSL A;  3Q7B A;  4DQR A;  4JK9 A;  2Z1J A;  3VQ8 A;  4GV3 A;  4RW6 A;  3J81 O;  2YJF A;  3O4Q A;  3SUQ A;  3MN6 A;  4GMJ B;  4LF7 K;  1MU2 A;  5JMV A;  1K8K A;  3VEO A;  1YJN N;  5EOY A;  1ATR A;  4Y1C A;  3CFO A;  4YDU A;  3CER A;  3C6A A;  1TUU A;  4FL9 A;  3J80 O;  2D0P A;  2NRZ A;  2YHA A;  4N56 A;  4BE2 A;  3L8B A;  4JKC A;  2HBL A;  1CZA N;  4I6M A;  1QQN A;  3ID6 A;  4IZ9 A;  1NGC A;  4IOA L;  3CJC A;  4CJQ A;  3HJF A;  4AHS A;  4BC2 A;  5KPR A;  3QIO A;  3MN9 A;  1ZBH A;  2PZS A;  2P5G A;  4ZTJ A;  4CJ4 A;  3OBW A;  3PIP L;  3P5J A;  4JD2 A;  4BC3 A;  1YF5 L;  4C8N A;  4CGJ A;  3G10 A;  3DLK A;  1S1T A;  3AVJ A;  3AVG A;  1D4X A;  4DV1 K;  5HLF A;  4FWS A;  3SPZ A;  2UUC K;  4CF2 A;  4WQ5 C;  1SKS A;  4E7J A;  1RT1 A;  4DUY K;  2CGJ A;  3V81 A;  4WQ4 C;  3U9Z A;  4BWM A;  3CIP A;  3RRG A;  4YY3 K;  3EE9 A;  2XY8 A;  3C6T A;  3KD5 E;  5BPL A;  3DXM A;  4FWO A;  2ZGY A;  3NDK A;  1J5O A;  4FK0 A;  4JI0 K;  1YVN A;  1B9F A;  3EZ5 A;  3TI0 A;  1P90 A;  4FLX A;  4LH5 A;  3NH0 A;  2E1Z A;  3OW2 M;  4ID5 A;  2NRH A;  3LAL A;  4CZL A;  2D0C A;  2GX9 A;  3SMP A;  5BN8 A;  1VQ5 N;  3ZLJ A;  2E1Y A;  3LDS A;  1EKE A;  2G8W A;  4G1Q A;  3QEX A;  3HYF A;  3RMB A;  3TU5 A;  5AZJ A;  4A61 A;  3WXK A;  3QFU A;  2V52 B;  5HRN A;  4CJ3 A;  3QIC A;  1EO1 A;  1J5E K;  3HL8 A;  3P31 A;  3THV A;  4DV2 K;  1W7A A;  3HST B;  3R1X A;  3ZSO A;  2ASM A;  1M90 O;  4DQS A;  1KC8 O;  3ISN C;  1P8Z A;  3EN9 A;  1YI2 N;  4YOR A;  1Q7Y O;  1IG9 A;  4FJL A;  3R6M A;  1BCO A;  1BL3 A;  4KTZ A;  3OA9 A;  1ZBI A;  5GAE P;  3DAW A;  3PX0 A;  2KW4 A;  1RDB A;  1NKB A;  4OO1 J;  3QIN A;  2OPQ A;  1BIS A;  4RW9 A;  3KLF A;  3O9R A;  4NB4 A;  3CD6 N;  2QM1 A;  4KFB A;  4BRH A;  4CEC A;  4LH4 A;  3LAN A;  1SQK A;  1JLC A;  3J8A A;  2QK9 A;  2FSK A;  3HVR A;  3NGZ A;  1KVA A;  3ULE A;  3O3G A;  1C6V A;  3ZX3 A;  3E9O A;  4FVM A;  1WUA A;  3UB5 A;  3CCS N;  5FRM A;  4DFK A;  4WCE L;  1UA0 A;  1JLB A;  4N47 A;  1VQ7 N;  5E41 A;  2EX3 A;  2XRI A;  3PX6 A;  2G8V A;  2X6S A;  3C94 A;  4BG9 A;  4BGA A;  3ENB A;  4C8O A;  3AO2 A;  4DSF A;  4LF9 K;  3QBW A;  3QO9 A;  2IC3 A;  2YHX A;  1LW2 A;  4CJV A;  4FJX A;  5AQR A;  1OH6 A;  1CLQ A;  2Z1G A;  3ZSY A;  2RF2 A;  3G25 A;  2NUB A;  3EE8 A;  5FPN A;  5BRD A;  3K59 A;  3S3O A;  5AQJ A;  2G8F A;  3ID8 A;  4LFB K;  1YJ9 N;  2UU9 K;  4GW6 A;  2QWP A;  4JKG B;  3OJU A;  2KZZ A;  4B8A B;  1L3U A;  3EL2 A;  4O8U A;  4O5B A;  2HF3 A;  3QEI A;  3NGI A;  1LWC A;  3JSM A;  2ASO A;  3R3L A;  4CJR A;  3L2W A;  4B9V A;  5CZ2 A;  1V4S A;  4FWQ A;  3Q7C A;  5C24 A;  3KHY A;  2QA4 N;  1SV5 A;  3NF7 A;  4CZG A;  4DR6 K;  5AQK A;  4KHQ A;  5D3G A;  1IBK K;  4G9Z A;  3ZYY X;  2O8D A;  2P9I B;  3ATV A;  4BDP A;  1S9G A;  5AQP A;  3TPQ A;  4AHT A;  3ZT3 A;  3TAM A;  1VAZ A;  2OTJ N;  5EU7 A;  4H4M A;  4FWL A;  3H45 C;  4IEE A;  2J4R A;  1GLJ O;  3O1B A;  4FWN A;  2HHW A;  5TKY A;  1N36 K;  5AQY A;  4OGE A;  3VEN A;  2HOE A;  2HHH K;  4GV9 A;  2Z1H A;  4W5O A;  4W5Q A;  3OYE A;  4H0O A;  5M1F A;  1HRH A;  1LV5 A;  1TAQ A;  4YHH K;  1FW6 A;  4B08 A;  3LP0 A;  5E26 A;  3JYT A;  3TAG A;  1OVQ A;  4M63 C;  1VSH A;  1X9S A;  3HM8 A;  1A5V A;  1RT6 A;  1NK0 A;  1HLU A;  4JN4 A;  2P9L A;  4Z0U A;  1YT3 A;  1NJI O;  3LPT A;  4CZE A;  1ZC6 A;  3DRS A;  4FPB A;  2VG6 A;  2NRW A;  3AV9 A;  3BUZ B;  4BRF A;  4U7B A;  2GWK A;  2YHW A;  5J2Q A;  3K5O A;  5AQZ A;  3FR0 A;  4DQQ A;  4EFH A;  2HHV A;  3BDP A;  2HND A;  5K14 A;  4Z4G A;  4CEE A;  3DYA A;  4CJU A;  4WQ4 A;  1NK7 A;  1QQO A;  2ITM A;  3SYZ A;  1NNE A;  4CJP A;  4FOE A;  3T7Z A;  1NMD A;  3IFR A;  4I7F A;  3H3O B;  2BAN A;  2CGK A;  4HCB A;  4CZI A;  3L3U A;  4IJN A;  1BQM A;  1WOQ A;  3V9W A;  2XY5 A;  4DR1 K;  1FK9 A;  3G4S N;  1HYV A;  4OKJ A;  5BPM A;  5EVZ A;  4BR5 A;  1HPM A;  3FZF A;  3JXU A;  4DTJ A;  1DGK N;  3DI6 A;  2NRR A;  3E9L A;  4FYD A;  3M1F A;  3EKU A;  4LF4 K;  4IO8 A;  4PHT X;  4JEP A;  4DSL A;  3ZT4 A;  3LDP A;  1NLV A;  1SAZ A;  3LL3 A;  3SJJ A;  3UE5 A;  4M7X A;  3P4I A;  1BUP A;  5AQM A;  2P9S A;  2IS3 A;  4BRA A;  4JI4 K;  1YIT N;  3MX5 A;  1M1K O;  3MDQ A;  4BQZ A;  2E20 A;  1BA0 A;  4B1Z A;  2VQE K;  4E7L A;  3OTO K;  3E9P A;  3PV8 A;  3JS6 A;  5FPE A;  4IG3 A;  4B3M K;  4O0J A;  3QNN A;  3O6W A;  1U49 A;  1RT2 A;  3IS9 A;  3HBT A;  4FJI A;  3RR7 A;  1LWE A;  3SBG A;  4M3T A;  3VQ6 A;  4LF8 K;  4HTL A;  1SUQ A;  4DLG A;  1E4F T;  1G99 A;  4FVU A;  1JLA A;  1NK6 A;  4PWD A;  4CF0 A;  1Q82 O;  3PIO L;  4KHY A;  1BA1 A;  4M3Y A;  5FPM A;  4BRP A;  1IO2 A;  2OPS A;  2EWS A;  2Q31 A;  4CGD A;  4LF5 K;  3CQ8 A;  3D2F B;  1QVF M;  5KTQ A;  1G15 A;  4NYF A;  1GLD G;  3U9D A;  1KAY A;  2Q0U A;  5CYM A;  4N41 A;  2KKZ A;  3CPW M;  4GVM A;  5BRF A;  4B3O A;  3AVH A;  3NGY A;  5T7B A;  3EEQ A;  3CHW A;  3U6F A;  4OX9 K;  1S1W A;  4CEZ A;  4CHO A;  3GOI A;  3KVG A;  4OKK A;  4W5N A;  3AVK A;  1S22 A;  3ZET A;  2FF6 A;  4EZ9 A;  1NMN A;  5BR9 A;  2UUB K;  2IGI A;  1U2V B;  4B9S A;  1XUP O;  2P9N A;  1IKW A;  3OHR A;  4HUF A;  4A2A A;  4DHY A;  2A1S A;  3THW B;  2UYT A;  1RT3 A;  2ITG A;  2OAN A;  2G8K A;  4CJK A;  4DV5 K;  1QHT A;  3TSP A;  3ALY A;  4FJ8 A;  4LSL A;  2A5X A;  3ATU A;  3D45 A;  5AFU A;  3WQT A;  1TVR A;  4KB0 A;  2KFZ A;  3V6D A;  1BQN A;  4AM6 A;  1QE1 A;  1T6C A;  1T05 A;  1S1X A;  4GKJ K;  4FK4 A;  2G8I A;  3C6U A;  3RTV A;  2O4G A;  3LDL A;  4CF1 A;  2QWL A;  3VEW A;  1FKO A;  5JS2 A;  2E2N A;  4OJR A;  1JCE A;  3N4P A;  4IO9 L;  2JLE A;  4JI3 K;  1XC3 A;  4FJG A;  1QQC A;  3OYJ A;  4DV6 K;  5GIO A;  1IG8 A;  3AVL A;  3BZK A;  5KI6 A;  1VSJ A;  1LCU A;  3CPE A;  1RBR A;  3CC4 N;  1BG3 A;  4H8K A;  2AA4 A;  1RDA A;  3D2E B;  3TWH A;  3AAP A;  3B8A X;  3C7N A;  3QER A;  1ZBL A;  3D0P A;  1X9M A;  2Q3S A;  2HF4 A;  3MXI A;  4CVN E;  4BE1 A;  4FZZ A;  1TK0 A;  1T6D A;  5JVG L;  3BF3 A;  1HQE A;  3FGU A;  3M8S A;  4BC4 A;  4JRP A;  1L5U A;  3E1Y A;  1HYS A;  1GOA A;  3V1Q A;  1YTU A;  4CIF A;  1BIU A;  4DQI A;  3DXK B;  1HNZ K;  4M3W A;  3HI0 A;  4DS5 A;  3PO4 A;  1WSI A;  2I7N A;  4BR4 A;  3THX A;  5CZ1 A;  1XQS C;  1ASU A;  4H4O A;  1IBM K;  3O5B A;  2GUP A;  3VGM A;  4L3Q A;  5B8H A;  1U4B A;  1XNR K;  1JLQ A;  3U8X A;  3WNG A;  3IRX A;  1WBB A;  4CZK A;  3V9Z A;  3SCX A;  1HYZ A;  4CF9 A;  3CCV N;  3G0Z A;  4FJM A;  4FM2 A;  4JHD A;  5AZI A;  4IEI A;  1O1W A;  4B3T K;  4CJF A;  3WEE B;  2P1J A;  3VMF B;  1Z26 A;  4BR9 A;  4NLB A;  2P9P B;  1UWB A;  4CFA A;  3VQE A;  1ESV A;  1QQM A;  3EY1 A;  4KH4 A;  2UXC K;  3G71 N;  4AQY K;  4JRQ A;  2WFB A;  1JKH A;  3O3F A;  1SZ2 A;  2JGU A;  4ID1 A;  1RDU A;  3I55 N;  2VGN A;  1NGF A;  3SQ4 A;  5IT9 O;  1YUW A;  4CBU A;  3KD1 E;  4B3R K;  2HBK A;  1WNS A;  4CEO A;  3QB0 A;  3CF5 L;  1Z6R A;  4K41 A;  3V1R A;  4H0Y B;  1TK8 A;  3RSE A;  4YOW A;  2YV0 X;  2GEM A;  3O4W A;  5AQU A;  2IOC A;  3DLE A;  4IFV A;  3WUH A;  1VQL N;  4BRN A;  1EET A;  3SV3 A;  3CQX A;  2YNH A;  4IOX A;  4AHU A;  4CJS A;  3ASM A;  2FLO A;  5FRN A;  4M42 A;  1RTH A;  5AQX A;  5C42 A;  3EO3 A;  2QWQ A;  4O0I A;  3L2U A;  4OPA A;  2W40 A;  1U6Z A;  4XH4 A;  5EX5 A;  1BI4 A;  1HKG A;  1Q86 O;  1SL1 A;  5FDL A;  4ISF A;  4MO4 A;  3VF4 A;  3ZX0 A;  4AH9 A;  5AFU H;  4A5B A;  3OYK A;  4DTO A;  1NJY A;  1R0A A;  3SBT A;  2NRV A;  1W97 L;  3VQC A;  4NXN K;  1ZBS A;  3VGK A;  2EHG A;  1HKB A;  4IOC L;  3KLI A;  1I39 A;  1FXX A;  5C15 A;  1S5J A;  2QWO A;  1JLF A;  1XMQ K;  2O8C B;  2NLX A;  4B1W B;  2O4I A;  3T1H K;  1NG9 A;  1NGG A;  4NCG A;  1BGX T;  1YVU A;  2UXB K;  1Y64 A;  4BDZ A;  4DG1 A;  2QXL A;  3EKS A;  4QS8 A;  4E7K A;  4FOI A;  3RR8 A;  3QNO A;  4DV0 K;  4I9L A;  3IG1 A;  4KRE A;  4C8L A;  4PL8 A;  4DSK A;  2HBJ A;  4WFA L;  2JWL A;  4JYA K;  1NU0 A;  4JKB A;  5LMN K;  1TYQ B;  5LMU K;  4DF8 A;  5AQO A;  4F9O A;  1TK5 A;  2GUI A;  3C0B A;  3WXM B;  4YFU A;  3KJV A;  5JVH L;  4BE0 A;  2BTF A;  5HRO A;  4DF4 A;  1VSF A;  3L2V A;  1HMV A;  4B9N A;  4A57 A;  5DMR A;  1GLC G;  3VQA A;  1K8A O;  2O8E B;  1Y97 A;  3H08 A;  2GEL A;  2PYL A;  3B6O A;  3TAF A;  4M3X A;  4K43 A;  2PFU A;  1FJG K;  4QOZ B;  1TKZ A;  4RW4 A;  3NF9 A;  2UXD K;  3C65 A;  4CZH A;  1HR0 K;  1WAF A;  2DFH A;  3A2F A;  1S9E A;  1J54 A;  3FZM A;  1JXE A;  4HWI A;  3UKU A;  1RTD A;  1KRP A;  2QKK A;  3GE1 A;  2ZJQ L;  2HHQ A;  1WSJ A;  5M1K A;  5FLX O;  4B9Q A;  3T19 A;  1VSK A;  3CMA N;  1KCF A;  2G8H A;  4JI8 K;  1VSE A;  2WOM A;  3LDQ A;  3IDH A;  3NF6 A;  4B9M A;  4M3U A;  1VSL A;  4KHP K;  3HK2 A;  3RMA A;  3TAQ A;  1X1P A;  4FJH A;  4F3O A;  3LM9 A;  3QBX A;  4JK7 A;  4FZX C;  3BGR A;  4JKG A;  1T44 A;  4WF9 L;  4X65 K;  4FZY A;  4K8Z A;  2P9U A;  2D0O A;  1S6P A;  3IMX A;  2ZD1 A;  3HSC A;  3OYA A;  4NYN A;  4CI6 A;  1OH7 A;  5AR0 A;  3L2Q A;  1RBS A;  4JD2 B;  3CJB A;  2E6L A;  4E19 A;  4I2P A;  1WB9 A;  1GLB G;  5FRO A;  2FBT A;  1YJW N;  4FO0 A;  2P9I A;  3S3N A;  3VTI A;  1DT9 A;  5CY4 A;  3S41 A;  2FSJ A;  4C8K A;  3I0S A;  3ZEU A;  1WLJ A;  2RKI A;  4DCH A;  1C0T A;  3MWT A;  2VWK A;  1YHQ N;  3VER A;  3DXM B;  4GVE A;  2YX6 A;  1V4T A;  3VF2 A;  4BRD A;  1VQ4 N;  4DWI A;  2GWJ A;  3VQ9 A;  1Q9X A;  1A5W A;  3KIO A;  3K5N A;  1KAX A;  4BRQ A;  3OYC A;  2W42 A;  3NVK A;  1EQY A;  5AQW A;  4FXD A;  4CJE A;  4HVJ A;  1KFD A;  3IAY A;  5BRE A;  4YNQ A;  1T03 A;  3VQ4 A;  3AA3 A;  4BR2 A;  5AZJ B;  3OY9 A;  4CFC A;  1W0H A;  3DLG A;  3OS1 A;  4EIA A;  5I3U A;  1R59 O;  3AY9 A;  4XEI A;  2PBD A;  3VEZ A;  2DFE A;  2FC0 A;  1CZB A;  3GBT A;  1MA9 B;  4E1J A;  3UIQ A;  2RE2 A;  2P51 A;  4J2A A;  3KWG A;  1BHL A;  4BDY A;  2FBX A;  2E2O A;  3CFP A;  1Q81 O;  3NF8 A;  3CI5 A;  4QAG A;  5CHI A;  3RMD A;  2RN2 A;  2A40 A;  1BO5 O;  3K5L A;  3DMJ A;  1KLM A;  1OH8 A;  3SV4 A;  3WNH A;  4GY2 B;  5F1X A;  4ISG A;  1RDW X;  2F8T A;  1N33 K;  4FW1 A;  4WYB A;  3PO5 A;  4IBN A;  4LY7 A;  2R7Y A;  2V7Z A;  5CE3 A;  3LZJ A;  1ATS A;  4LF6 K;  4B1Y B;  3OYF A;  1D9D A;  1A5X A;  4BRM A;  2IAJ A;  1KSP A;  1IJJ A;  1U45 A;  3ULE B;  1CZ9 A;  3C6H A;  1WSF A;  1RT4 A;  4IJA A;  4CHN A;  5KPT A;  1HNV A;  2BE2 A;  3TAP A;  2ZF5 O;  2OA8 A;  3AA2 A;  2CGL A;  2UUA K;  1OVY A;  1VSI A;  4FPA A;  4E3S A;  5JS1 A;  4C1N I;  4Z94 A;  2XY7 A;  4LC9 B;  3T1Y K;  4RG8 A;  1NJZ A;  3AO3 A;  4NLC A;  1J53 A;  2IVO A;  3TAR A;  5BRH A;  3HRG A;  3C95 A;  4AM7 A;  2VWJ A;  1HQU A;  1ZBU A;  3I56 N;  3FFK B;  3KLE A;  1GLL O;  5EXW A;  1NJW A;  2P5O A;  4FJJ A;  4WQ5 A;  1U48 A;  4JKE A;  1VQ9 N;  3NVM A;  1IV0 A;  1QTM A;  3SUO A;  2D5R A;  4BRO A;  4DV4 K;  3K2P A;  4AHR A;  4BY9 C;  4JI2 K;  1KVB A;  4KH6 A;  3HPG A;  3FZL A;  4DFP A;  4IDH A;  4W5R A;  3U4L A;  2E2P A;  3ZSW A;  4MO5 A;  2YI1 A;  3LP2 A;  3D2F A;  4BR0 A;  5C0Y A;  2WC9 A;  4O44 A;  3SJH A;  2O8D B;  4JK8 A;  3F73 A;  3OYG A;  4CEQ A;  1S3X A;  3F9K A;  5C10 A;  1ZBF A;  1SL0 A;  1JCG A;  4DQP A;  1XHZ A;  1KAZ A;  2YKM A;  4CJ7 A;  1YAG A;  3O9S A;  3WXJ A;  3HTV A;  1NKE A;  1DKG D;  3A0I X;  1F21 A;  4DR5 K;  3VQ5 A;  3VPZ A;  4RTF D;  1ZXO A;  4QS7 A;  4M45 A;  3LWL A;  1NJX A;  5JLF A;  4WE1 A;  1U04 A;  3VQP A;  1LAW A;  3ZSR A;  2F96 A;  1VHX A;  2AJQ A;  3HPO A;  1VSM A;  4AHC A;  3HOT A;  3SK3 A;  4ISE A;  2E8A A;  4GV6 A;  1BWF O;  1NBW A;  3WT0 A;  3OBY A;  3OYD A;  2HNY A;  3JAM O;  1JJ2 M;  4IXC A;  5M1O A;  2HST A;  3LAM A;  3K9J A;  5GAH P;  4I9Q A;  4CEA A;  2VCP A;  4YDU C;  3VQB A;  5KGX A;  3OJS A;  1RTI A;  3SAG A;  3WQU A;  2I7P A;  3U3G A;  5FPD A;  4U67 L;  4HHT A;  3SNN A;  4DR4 K;  4FJ9 A;  3QEP A;  2P9K B;  3ENH A;  1D5A A;  4DTR A;  1WBD A;  3THY A;  4KI6 A;  4X64 K;  1UAX A;  3G6E N;  3L2R A;  3D2E A;  2IIR A;  3B6P A;  5CYQ A;  2RHK A;  2ZWH A;  4EHU A;  3OS0 A;  2O8B A;  4FWK A;  1RTJ A;  3O9T A;  3GL1 A;  3K57 A;  1Z25 A;  2Z1I A;  1C1B A;  5GAD P;  3A5M C;  2BGG A;  4YOX A;  3P38 A;  4YOT A;  2E5L K;  4HUG A;  3R9P A;  2ETJ A;  1S1U A;  3OYB A;  3VA3 A;  3DXK A;  3UKR B;  2YHY A;  4ZTF A;  3DLR A;  4CHP A;  1QSS A;  1WSE A;  3V4I A;  3VES A;  3AO5 A;  4RWT A;  4DUZ K;  4FCY A;  4Y1D A;  4B8C A;  3ZT1 A;  4H5N A;  5JLH A;  2XHB A;  2DY4 A;  1KTQ A;  1BOT O;  1TKD A;  3BP8 A;  3NE6 A;  2OPP A;  2Q1N A;  2HHS A;  3AA5 X;  4TSX A;  4C23 A;  2P9S B;  5KPZ A;  5DM6 L;  4FJ5 A;  3WEE A;  4DR3 K;  1XHX A;  2BDP A;  4PY5 A;  3RVC A;  4B1U B;  4YOV A;  4PKI A;  1TAU A;  2F9T A;  2P9P A;  3TSQ A;  2ATQ A;  1FKP A;  4RW7 A;  1B92 A;  3ZSX A;  4A59 A;  1KD1 O;  4EP4 A;  5J2N A;  5AQF A;  1X3M A;  3GDQ A;  5ADX H;  1N5Y A;  5AQV A;  3CME N;  4KPY A;  1LOT B;  4OGC A;  2NZT A;  2A42 A;  4J2D A;  2QWR A;  2PAV A;  5AQI A;  4M41 A;  4PUO A;  3F2K A;  4PL7 A;  1DLO A;  3J7Z O;  3L4I A;  1HX1 A;  3FFI A;  5AQS A;  5JIC A;  5C2D A;  3D6R A;  4QS9 A;  2Q2R A;  4H0T B;  4M3R A;  3PLA A;  1KLN A;  1OKJ A;  4DU3 A;  4DU1 A;  3OYL A;  3KLG A;  5M1N A;  3D7E O;  5M1Q A;  1QZ5 A;  4M7Y A;  3ZT2 A;  4CJ5 A;  2X6N A;  2DTU A;  3SQ0 A;  4RW8 A;  4FLY A;  4DTM A;  4UY8 O;  1XWL A;  4FLV A;  3M6G A;  4MDB A;  3CYM A;  4CCH A;  1IKX A;  3VA0 A;  1W2B M;  2W41 A;  3ZET B;  5C25 A;  1HPZ A;  1T3V A;  1BIZ A;  2VGM A;  3O9U A;  4DLE A;  3AO1 A;  3QFP A;  4C1N K;  4CER A;  4B1X B;  3MN5 A;  4DTS A;  1X9J A;  3ZSV A;  1NK8 A;  5HOO A;  3CM5 A;  3MMV A;  4H5W A;  2OCE A;  5HL7 L;  4CFB A;  3LDN A;  3O8M A;  4E1M A;  4CHZ A;  4X66 K;  5AQN A;  3AVA A;  2O8C A;  3KKR A;  4OVL A;  1O13 A;  5AQT A;  3DM2 A;  2XO7 A;  2JWK A;  1NOZ A;  4KTW A;  4H0V B;  1HNI A;  4FK2 A;  4FWM A;  4JI6 K;  4O4G A;  1GLF O;  4YOY A;  3OYI A;  4CES A;  2O8F B;  3AGK A;  1XI1 A;  1WAJ A;  1NGB A;  3FLC O;  5HRR A;  4CBW A;  1VK0 A;  4CGH A;  4JKH A;  4CW7 B;  1DTQ A;  1RT5 A;  3TTC A;  4JS5 A;  4BRE A;  5HBM A;  3KTQ A;  1WSH A;  5SZT A;  1NGD A;  4LD0 A;  3NH1 A;  4CE9 A;  3PX4 A;  5M1P A;  2OZM A;  5TKW A;  1HKC A;  2IDO A;  4M3Z A;  3EYZ A;  1RIL A;  2YNI A;  4JAX A;  2NRT A;  4W5T A;  1T7P A;  5KQD A;  3FZH A;  5AQL A;  3AA4 A;  2A1R A;  2CH6 A;  3CC2 N;  2Q36 A;  4BR7 A;  3CXC M;  3SAH A;  3NBP A;  3M8P A;  3TAE A;  1L3T A;  5BPN A;  3L6Q A;  3LPU A;  3SZ2 A;  1NK5 A;  1C0F A;  3DLL L;  4ZHR A;  3THX B;  3DRR A;  4MQ3 A;  2QWM A;  1RDC A;  4V19 S;  1VQO N;  1KFS A;  3VTH A;  2ZGZ A;  4F4K A;  2H3G X;  3AVM A;  3AO4 A;  4JHD B;  5AZI B;  4Z4I A;  3MEE A;  4ELV A;  1RCH A;  4DS4 A;  3H6E A;  1TL3 A;  3AVC A;  4IFY A;  2WBN A;  4K25 A;  4KH5 A;  1LWF A;  3DOK A;  4BWJ A;  3NFA A;  2ZM6 K;  4Q5V A;  2HHT A;  2QI2 A;  4OLA A;  1WN7 A;  3P83 D;  4BRI A;  1S6Q A;  3QLH A;  4H5V A;  3IUC A;  3J7A P;  3NMU A;  4CZJ A;  2A41 A;  3H46 O;  1TGO A;  1TKT A;  3ITH A;  3AAQ A;  3HP9 A;  1NK9 A;  4KHW A;  1JXB A;  2ZJP L;  1C0U A;  4MLE A;  5SWM A;  1RBU A;  1HNX K;  3QIP A;  3DLH A;  5ELZ A;  3CJA A;  3KK1 A;  1N6Q A;  3RRH A;  5LL6 Z;  5GIP A;  3CCL N;  5A2Q O;  3RSE B;  4PKH A;  4B3S K;  3TTD A;  5HP1 A;  1YTA A;  3KK7 A;  3MXM A;  4Z4H A;  2GV9 A;  5LJW A;  3DOL A;  1Z05 A;  3CC7 N;  4BRG A;  1ITG A;  3CJ1 A;  1VQP N;  2F9W A;  1XMO K;  3AAR A;  3O08 A;  4NO7 A;  3MAQ A;  2WON A;  3J7Y P;  1QZ6 A;  1KXP A;  1K8K B;  3ZSQ A;  2HMI A;  4CGI A;  4FJ7 A;  1YXQ A;  4ILH A;  1U47 A;  2I5J A;  4OPH A;  1E3M A;  2F7T A;  1BI4 B;  3K5M A;  3MCA B;  2KZM A;  4DB3 A;  2B6A A;  5IWA K;  4I6M B;  4IG0 A;  3VGL A;  3P39 A;  2VQF K;  3V9S A;  3RWU A;  2F4V K;  4KV8 A;  1RBV A;  1VQK N;  3SPY A;  4JI7 K;  1D9F A;  3SUN A;  2BUP A;  3E66 A;  3BEX A;  2QWN A;  3I8D A;  4K8X A;  2HVH A;  4FW2 A;  1MWK A;  4CIG A;  2BH1 A;  2VYP A;  4CBX A;  4JKD A;  1TL1 A;  2RPI A;  2FBV A;  2D0B A;  5AQQ A;  2KFN A;  1N8R O;  1NGI A;  4YOU A;  3FE1 A;  4FLT A;  4DTX A;  1LW0 A;  4O8K A;  3HM9 A;  4ILJ A;  1VRT A;  4E89 A;  1D8Y A;  1S72 N;  3CCJ N;  4RCH A;  4OPK A;  2GTD A;  1L3S A;  1I3A A;  5EY4 A;  3T3F A;  3HOS A;  3QEV A;  4O55 A;  3A5L C;  1N32 K;  3HXM A;  4Z4F A;  4H03 B;  3CCQ N;  4PQU A;  1L3V A;  3WXL A;  2OPR A;  3EZW A;  4CJT A;  4E7I A;  3AGR A;  3LM2 A;  2ZE2 A;  1K73 O;  3CJ7 A;  4KB1 A;  4N76 A;  4KKO A;  3LP3 A;  4DV7 K;  1X3N A;  4IFE A;  4PA1 A;  3K9K A;  2A3Z A;  3SQ1 A;  1CXU A;  3H3N O;  3V1O A;  4HTU A;  1MWM A;  3UKU B;  4BAC A;  4FM1 A;  4H0P A;  4A2B A;  3KK3 A;  5J2M A;  5GAG P;  2W6K A;  2G8U A;  3LP1 A;  4A5A A;  3O3H A;  3L3V A;  2LSN A;  3NAE A;  4Z4C A;  4DSI A;  5CR4 A;  5KGW A;  4CFD A;  1KQS M;  3VQD A;  1C0G A;  3RMC A;  4FJK A;  3OYH A;  1GLA G;  1S1V A;  5F2R A;  3LDO A;  3V9X A;  2ZJR L;  4EZ6 A;  4JI5 K;  4KTQ A;  1IKY A;  1HJO A;  4ELT A;  1IBL K;  4ICL A;  4E7H A;  4AIL C;  1SL2 A;  5I9E B;  3VEY A;  4JV5 K;  2FBY A;  2ZQB A;  1IH7 A;  3WXI A;  2P9U B;  2PY5 A;  4CK1 A;  4GKK K;  4J2B A;  3T1A A;  3CCM N;  1YIJ N;  2KLA A;  4CK3 A;  2WTU A;  4IKF A;  4DR7 K;  3MX2 A;  4DMN A;  2Y1I A;  4NCA A;  4H5R A;  4JLH A;  4FWR A;  3QML A;  3CG7 A;  4CEF A;  3CQY A;  1TV6 A;  5BN9 A;  4MFB A;  4CED A;  2KHO A;  2B4J A;  4X62 K;  4F8R A;  4JI1 K;  2HB5 A;  3P1G A;  3OS2 A;  5H1S Q;  3ZEU B;  1HNW K;  5J2P A;  2VG7 A;  2E4L A;  3VET A;  1VRU A;  4FLW A;  3MK6 A;  1ASV A;  3PSF A;  3I0R A;  5LY3 A;  4KO0 A;  4CHY A;  2GBZ A;  3K58 A;  5AQG A;  2DFF A;  1EXQ A;  3OYM A;  3ULD A;  5BR8 K;  2Q97 A;  4CZM A;  1X9W A;  1HJR A;  3TR8 A;  2F8S A;  4LSN A;  3KWI A;  2YNF A;  3L0Q A;  4HUE A;  3BZC A;  2IVP A;  1I94 K;  3H1V X;  3I33 A;  4DTU A;  4MLH A;  1C1A A;  1J9A A;  5AQH A;  3HVT A;  4NXM K;  1TUY A;  4R5P A;  1OH5 A;  3O9Q A;  3NCI A;  4HCC A;  3TAB A;  1SS6 A;  2DPN A;  4BRC A;  3CJ9 A;  4ILG B;  1J6Z A;  1DTT A;  3HT3 A;  5ADX A;  2HHX A;  4DQ8 A;  1JL2 A;  2P9K A;  2HNZ A;  4ELU A;  2NNW A;  2D0A A;  3ENO A;  3MWP A;  3F5T A;  4DTP A;  1NKC A;  3HO1 A;  1LAV A;  1T8E A;  1VQ6 N;  3VQQ A;  4R79 A;  4EHT A;  4BRK A;  3QET A;  4IDK A;  4EP5 A;  4DFM A;  3GG4 A;  5KRT A;  1GLE G;  1QS4 A;  2YCH A;  1BCM A;  4KAZ A;  4BVO A;  1WSG A;  4CD1 A;  5J1E A;  2A6A A;  4AHV A;  1C1C A;  2YNG A;  1N34 K;  1U2V A;  1SKW A;  4F3T A;  4K42 A;  1ATN A;  1IKV A;  1QHA A;  2QW9 A;  3UKR A;  3THW A;  4Z4E A;  4CIE A;  1ZYQ A;  4LFA K;  4J8F A;  4L8R B;  4B9L A;  2X74 A;  3BY5 A;  4BG8 A;  3IKM A;  4I2Q A;  4Y0W A;  4BRL A;  1MDU B;  1XNQ K;  3DLB A;  1EWQ A;  4XIU A;  2D4W A;  3SUP A;  2HW3 A;  3PY8 A;  4DTN A;  2V51 B;  3H1Q A;  1RGI A;  3L4Q A;  2VWB A;  2P9L B;  4CGF A;  4DKW A;  4E0D A;  5C2F A;  1RNH A;  4DSJ A;  3S3M A;  5E84 A;  4N5S A;  3MED A;  3CM6 A;  2YHB A;  1BDG A;  1H1V A;  3VEX A;  3S9H A;  3DRP A;  3O4N A;  1UA1 A;  4DFJ A;  3SQ2 A;  2Q0R A;  1RBT A;  3KZB A;  3CET A;  2VG5 A;  4GNI A;  3A5N C;  5LJV A;  2FF3 B;  1DEJ A;  1NGA A;  2KTQ A;  4XH1 A;  3QES A;  1EX4 A;  3WNE A;  4DV3 K;  1GOB A;  4JKF A;  3W0L A;  4CZF A;  5C12 A;  3HP6 A;  3A5O C;  1VQN N;  4BVP A;  3N4Q A;  4CJW A;  2E2Q A;  1RDD A;  4KHU A;  3NH2 A;  4BC5 A;  1NGH A;  5I42 A;  3TSU A;  4O5F A;  4F2S A;  4E1N A;  3OVN A;  2ASP A;  4BQL A;  1NGJ A;  3AVN A;  3VEV A;  3LZI A;  3VQ7 A;  3T69 A;  2D1K A;  2X78 A;  3M3Z A;  1EWR A;  2Y1J A;  3MEG A;  3PUF A;  4H0X B;  1JL1 A;  3VN5 A;  3W3D A;  3V9U A;  1TKX A;  2QTD A;  3QDK A;  4NCB A;  4H5T A;  4CHQ A;  1VSD A;  1Q18 A;  2WUS A;  4XH5 A;  3ZCM A;  3CCR N;  1KVC A;  4BGB A;  2QKB A;  4FSV A;  1W9H A;  3M8R A;  3AVF A;  1HUX A;  1JLE A;  4PKG A;  2OTL N;  4QCL A;  1BU6 O;  3I8B A;  4A62 A;  1E4G T;  2O8F A;  3U3Y A;  3SLC A;  3NHG A;  1NWK A;  4KI4 A;  3R8E A;  4FWP A;  4KBO A;  2OZS A;  1CXQ A;  4WFN L;  1JLG A;  3MXJ A;  3O80 A;  1RT7 A;  1REV A;  3FZK A;  2B5J A;  4DU4 A;  1ASW A;  4DSE A;  3THY B;  4LFC K;  3QEW A;  4CGG A;  1RFQ A;  3K0S A;  5HRS A;  5HRP A;  5DM7 L;  4J2E A;  3MCP A;  1VQM N;  3ZSZ A;  1Q9Y A;  4OPJ A;  3CCE N;  4K0K K;  2O8B B;  1VQ8 N;  1NGE A;  3VF6 A;  3F9M A;  3KLH A;  4FLZ A;  3ZX2 A;  5KQ8 A;  3CFR A;  3LWM A;  3CCU N;  4CD3 A;  2HHU A;  3SMS A;  4FLU A;  2HVI A;  2V7Y A;  4OKE A;  3SI6 A;  3SAF A;  1JCF A;  5AJ3 K;  4Q0B A;  1NK4 A;  2P9N B; 
#chains in the Genus database with same CATH homology
 3PV8 A;  3ZT0 A;  1EP4 A;  2RN2 A;  3RMD A;  3MXM A;  3K5L A;  1K6Y A;  3DMJ A;  4Z4H A;  2GV9 A;  2YKN A;  1KLM A;  3DOL A;  1UOC A;  4IG3 A;  3WNH A;  2QXF A;  3SV4 A;  1ITG A;  3LAK A;  4UQG A;  3MAQ A;  4O0J A;  2WON A;  3QNN A;  2F8T A;  4JS4 A;  1U49 A;  1RT2 A;  3IS9 A;  4FW1 A;  3PO5 A;  1Q8I A;  3E01 A;  4IBN A;  4FJI A;  3AVI A;  4LY7 A;  2R7Y A;  3RR7 A;  3ZSQ A;  3LZJ A;  1LWE A;  1XC9 A;  2HMI A;  3VQ6 A;  4M3T A;  1SUQ A;  4CGI A;  3OYN A;  4FJ7 A;  4DLG A;  4B9U A;  4KRF A;  3OYF A;  1U47 A;  1A5X A;  1D9D A;  2IAJ A;  2I5J A;  1KSP A;  3K5M A;  1BI4 B;  1JLA A;  1NK6 A;  4KHS A;  1U45 A;  4PWD A;  4CF0 A;  4KHN A;  4KHY A;  2KZM A;  1CZ9 A;  4M3Y A;  5DK5 A;  1WSF A;  1IO2 A;  1RT4 A;  2OPS A;  3TAN A;  4CHN A;  2B6A A;  4CGD A;  1SKR A;  1HNV A;  3KK2 A;  3CQ8 A;  2BE2 A;  4IG0 A;  3TAP A;  4F2R A;  3V9S A;  5KTQ A;  3RWU A;  1NOY A;  2OA8 A;  1G15 A;  4KV8 A;  1RBV A;  4NYF A;  3AA2 A;  3SPY A;  5CYM A;  3SUN A;  4CK2 A;  3WNF A;  3M8Q A;  1D9F A;  1GOC A;  3MEC A;  4N41 A;  4CEB A;  3HPH A;  4GVM A;  1VSI A;  4B3O A;  3AVH A;  3AVB A;  3NGY A;  5T7B A;  3I8D A;  1QSY A;  4K8X A;  4FW2 A;  4CIG A;  2HVH A;  4E3S A;  4Q0B A;  1C0M A;  2PYJ A;  3U6F A;  5JS1 A;  2KQ2 A;  1S1W A;  2XY7 A;  1YTU A;  1TL1 A;  2RPI A;  4CEZ A;  1B9D A;  4CHO A;  3KKS A;  4OKK A;  4W5N A;  2XY6 A;  2FBV A;  3AVK A;  2D0B A;  4B9T A;  4RG8 A;  1NJZ A;  3AO3 A;  4EZ9 A;  4CJL A;  2KFN A;  1J53 A;  2OYQ A;  3TAR A;  4C8M A;  2IGI A;  3C95 A;  4B9S A;  4FM0 A;  2VWJ A;  1HQU A;  4FLT A;  4DTX A;  1LW0 A;  4FJN A;  1IKW A;  5KRS A;  4HUF A;  4OLB A;  1ZBU A;  2E6M A;  4CF8 A;  1QSL A;  3HM9 A;  2A1S A;  4E89 A;  1VRT A;  3KLE A;  4DQR A;  2Z1J A;  3VQ8 A;  1RT3 A;  1D8Y A;  4RW6 A;  2ITG A;  2G8K A;  1NJW A;  2P5O A;  4FJJ A;  3O4Q A;  1U48 A;  4CJK A;  4OPK A;  1QHT A;  1L3S A;  1I3A A;  3T3F A;  3SUQ A;  3ALY A;  1QTM A;  4FJ8 A;  3QEV A;  4LSL A;  4O55 A;  2D5R A;  3SUO A;  4GMJ B;  1MU2 A;  3HXM A;  3D45 A;  4KB0 A;  1TVR A;  2KFZ A;  3K2P A;  1BQN A;  3V6D A;  4Z4F A;  4Y1C A;  1QE1 A;  4AHR A;  1T05 A;  1S1X A;  4PQU A;  1L3V A;  3CFO A;  4FK4 A;  2G8I A;  3C6U A;  3RTV A;  2O4G A;  4CF1 A;  2OPR A;  4CJT A;  4E7I A;  1KVB A;  2ZE2 A;  4KB1 A;  4N76 A;  3HPG A;  1FKO A;  2YHA A;  4KKO A;  5JS2 A;  4N56 A;  4DFP A;  4OJR A;  4BE2 A;  4W5R A;  3LP3 A;  3L8B A;  2JLE A;  4FJG A;  4PA1 A;  3ZSW A;  1QQC A;  3OYJ A;  3LP2 A;  3SQ1 A;  1CXU A;  3V1O A;  4HTU A;  4O44 A;  4BAC A;  3AVL A;  3KK3 A;  4FM1 A;  5KI6 A;  4CJQ A;  1VSJ A;  3F73 A;  5J2M A;  3HJF A;  3OYG A;  4AHS A;  4CEQ A;  2G8U A;  3LP1 A;  3F9K A;  1ZBF A;  3QIO A;  3O3H A;  1SL0 A;  2PZS A;  1ZBH A;  3L3V A;  1RBR A;  2LSN A;  2P5G A;  4H8K A;  4ZTJ A;  3NAE A;  4CJ4 A;  1RDA A;  4Z4C A;  3TWH A;  1XHZ A;  4DQP A;  4DSI A;  5KGW A;  4CFD A;  3P5J A;  2YKM A;  3VQD A;  3RMC A;  4C8N A;  4FJK A;  3OYH A;  4CGJ A;  1NKE A;  3G10 A;  1F21 A;  3DLK A;  3QER A;  1ZBL A;  1S1V A;  3VQ5 A;  3D0P A;  1X9M A;  3V9X A;  2Q3S A;  3MXI A;  4EZ6 A;  4KTQ A;  1IKY A;  4BE1 A;  1S1T A;  4FZZ A;  3AVJ A;  3AVG A;  1TK0 A;  4M45 A;  3LWL A;  4ICL A;  1NJX A;  4ELT A;  4E7H A;  4WE1 A;  1U04 A;  3VQP A;  5HLF A;  4AIL C;  1LAW A;  3SPZ A;  1SL2 A;  1HQE A;  3ZSR A;  4CF2 A;  2F96 A;  3M8S A;  2AJQ A;  3HPO A;  2FBY A;  4JRP A;  2ZQB A;  1L5U A;  1HYS A;  1GOA A;  1VSM A;  3V1Q A;  4AHC A;  1BIU A;  4CIF A;  1IH7 A;  4E7J A;  1SKS A;  1RT1 A;  2PY5 A;  4DQI A;  4M3W A;  3OYD A;  4DS5 A;  3V81 A;  1WSI A;  2HNY A;  3PO4 A;  4CK1 A;  4BWM A;  4J2B A;  3LAM A;  5CZ1 A;  3RRG A;  3T1A A;  1ASU A;  2XY8 A;  4H4O A;  4CEA A;  3C6T A;  4I9Q A;  3KD5 E;  4IKF A;  4CK3 A;  3VQB A;  5KGX A;  4DMN A;  3OJS A;  3NDK A;  1RTI A;  1U4B A;  2Y1I A;  1JLQ A;  3WNG A;  1J5O A;  3IRX A;  4FK0 A;  4NCA A;  1B9F A;  3EZ5 A;  3TI0 A;  3V9Z A;  4JLH A;  1HYZ A;  4CF9 A;  4FLX A;  4LH5 A;  3SCX A;  3G0Z A;  4FJM A;  3CG7 A;  4FM2 A;  4CEF A;  3NH0 A;  3U3G A;  4ID5 A;  1O1W A;  4HHT A;  1TV6 A;  3LAL A;  4MFB A;  4CJF A;  4CED A;  3SNN A;  2P1J A;  2D0C A;  4FJ9 A;  1Z26 A;  2B4J A;  3QEP A;  3LDS A;  1EKE A;  4F8R A;  1D5A A;  4DTR A;  2G8W A;  4G1Q A;  3QEX A;  1UWB A;  3HYF A;  4CFA A;  2HB5 A;  3P1G A;  3VQE A;  3OS2 A;  3RMB A;  4KI6 A;  3EY1 A;  4JRQ A;  5J2P A;  2VG7 A;  1UAX A;  2E4L A;  1JKH A;  1VRU A;  3O3F A;  3L2R A;  2JGU A;  4FLW A;  4ID1 A;  5HRN A;  3B6P A;  3SQ4 A;  4CJ3 A;  5CYQ A;  1ASV A;  3HL8 A;  3KD1 E;  3I0R A;  3THV A;  3OS0 A;  4KO0 A;  3HST B;  4CHY A;  1WNS A;  1RTJ A;  2GBZ A;  3ZSO A;  4CEO A;  3K57 A;  3K58 A;  2DFF A;  4DQS A;  1EXQ A;  1Z25 A;  2Z1I A;  1C1B A;  3OYM A;  3ISN C;  3ULD A;  2BGG A;  3V1R A;  1IG9 A;  4FJL A;  1TK8 A;  4HUG A;  2ETJ A;  2YV0 X;  1S1U A;  3OYB A;  3VA3 A;  1X9W A;  1BCO A;  1BL3 A;  4KTZ A;  2IOC A;  3DLE A;  4IFV A;  4ZTF A;  1HJR A;  3DLR A;  3TR8 A;  4LSN A;  4CHP A;  2F8S A;  1ZBI A;  1QSS A;  1WSE A;  2YNF A;  3V4I A;  3PX0 A;  1EET A;  3SV3 A;  4HUE A;  2KW4 A;  2YNH A;  3AO5 A;  1RDB A;  4FCY A;  4AHU A;  1NKB A;  4DTU A;  4Y1D A;  4CJS A;  3ASM A;  4B8C A;  3ZT1 A;  1C1A A;  3QIN A;  1J9A A;  2OPQ A;  3HVT A;  5FRN A;  1BIS A;  4M42 A;  1RTH A;  4RW9 A;  4R5P A;  3KLF A;  2XHB A;  2DY4 A;  4KFB A;  3NCI A;  4HCC A;  1KTQ A;  5C42 A;  3TAB A;  4CEC A;  4O0I A;  3NE6 A;  4LH4 A;  1TKD A;  3L2U A;  2OPP A;  3LAN A;  1JLC A;  2HHS A;  3AA5 X;  4TSX A;  2QK9 A;  1BI4 A;  3HVR A;  3NGZ A;  1DTT A;  4FJ5 A;  1SL1 A;  1KVA A;  3HT3 A;  5FDL A;  4AH9 A;  1XHX A;  2BDP A;  2HHX A;  3O3G A;  1C6V A;  4PY5 A;  3OYK A;  4DTO A;  1JL2 A;  1R0A A;  2HNZ A;  3VQC A;  1NJY A;  4ELU A;  1TAU A;  4FVM A;  2D0A A;  5FRM A;  2ATQ A;  2EHG A;  1FKP A;  4RW7 A;  4DTP A;  1NKC A;  4DFK A;  1B92 A;  3ZSX A;  1UA0 A;  3HO1 A;  3KLI A;  1I39 A;  4EP4 A;  1JLB A;  4N47 A;  5J2N A;  1FXX A;  1LAV A;  1T8E A;  3VQQ A;  1S5J A;  2EX3 A;  2XRI A;  5E41 A;  3PX6 A;  2X6S A;  1JLF A;  3C94 A;  2G8V A;  1N5Y A;  3QET A;  4IDK A;  4EP5 A;  3AO2 A;  4C8O A;  4DFM A;  4DSF A;  4KPY A;  5KRT A;  2O4I A;  1QS4 A;  2IC3 A;  1BGX T;  3QO9 A;  1BCM A;  4NCG A;  1LW2 A;  1YVU A;  4OGC A;  4CJV A;  4KAZ A;  4J2D A;  1WSG A;  4BDZ A;  4FJX A;  4DG1 A;  4M41 A;  4PUO A;  5J1E A;  2Z1G A;  3ZSY A;  2RF2 A;  4AHV A;  1C1C A;  2YNG A;  4E7K A;  1CLQ A;  3RR8 A;  1DLO A;  3FFI A;  3QNO A;  2NUB A;  1SKW A;  4I9L A;  4F3T A;  3IG1 A;  3K59 A;  4KRE A;  3S3O A;  1IKV A;  4C8L A;  2G8F A;  4DSK A;  4M3R A;  4GW6 A;  1KLN A;  4DU3 A;  4DU1 A;  3OYL A;  3KLG A;  4Z4E A;  3OJU A;  4CIE A;  1ZYQ A;  2KZZ A;  4B8A B;  1L3U A;  4L8R B;  4B9L A;  2X74 A;  3ZT2 A;  4DF8 A;  4CJ5 A;  2DTU A;  2X6N A;  3SQ0 A;  4I2Q A;  4RW8 A;  4FLY A;  1TK5 A;  3DLB A;  2GUI A;  4BE0 A;  4YFU A;  4O5B A;  4XIU A;  3KJV A;  4DTM A;  3SUP A;  1XWL A;  4FLV A;  5HRO A;  2HW3 A;  3PY8 A;  4DF4 A;  1VSF A;  4DTN A;  3L2V A;  3QEI A;  1HMV A;  3CYM A;  1LWC A;  3NGI A;  1IKX A;  4B9N A;  3JSM A;  4CCH A;  3VA0 A;  5DMR A;  3VQA A;  4CJR A;  4E0D A;  4CGF A;  5C25 A;  1HPZ A;  1Y97 A;  1RNH A;  3H08 A;  5CZ2 A;  3L2W A;  4B9V A;  1BIZ A;  2PYL A;  4DSJ A;  3B6O A;  3TAF A;  3S3M A;  4M3X A;  5C24 A;  4DLE A;  4N5S A;  3MED A;  3AO1 A;  3CM6 A;  2YHB A;  4QOZ B;  1TKZ A;  4RW4 A;  3NF9 A;  4CER A;  1SV5 A;  3NF7 A;  4DTS A;  3ZSV A;  5D3G A;  1NK8 A;  1WAF A;  4KHQ A;  2DFH A;  3A2F A;  1S9E A;  1J54 A;  1RTD A;  1JXE A;  3CM5 A;  1KRP A;  2QKK A;  4CFB A;  4E1M A;  3S9H A;  3DRP A;  3O4N A;  4CHZ A;  4DFJ A;  3SQ2 A;  1UA1 A;  4BDP A;  1S9G A;  3AVA A;  4AHT A;  2HHQ A;  3KKR A;  4OVL A;  3ZT3 A;  1RBT A;  1WSJ A;  3TAM A;  3DM2 A;  2VG5 A;  2XO7 A;  1NOZ A;  4KTW A;  5EU7 A;  4H4M A;  3T19 A;  1VSK A;  1KCF A;  2G8H A;  1HNI A;  4FK2 A;  4O4G A;  1VSE A;  2WOM A;  3NF6 A;  4B9M A;  4M3U A;  3OYI A;  2KTQ A;  1VSL A;  4CES A;  2HHW A;  3QES A;  1EX4 A;  3HK2 A;  3WNE A;  3RMA A;  3TAQ A;  1XI1 A;  1X1P A;  4FJH A;  1GOB A;  4F3O A;  1WAJ A;  5HRR A;  1VK0 A;  4CGH A;  4OGE A;  3HP6 A;  4FZX C;  1DTQ A;  3BGR A;  4CJW A;  1RT5 A;  4JS5 A;  2Z1H A;  4W5O A;  4W5Q A;  3OYE A;  4FZY A;  4K8Z A;  1RDD A;  4KHU A;  5HBM A;  3NH2 A;  1HRH A;  3KTQ A;  1LV5 A;  1WSH A;  5SZT A;  1S6P A;  1TAQ A;  2ZD1 A;  4B08 A;  5I42 A;  4F2S A;  4E1N A;  3LP0 A;  3OVN A;  3JYT A;  3TAG A;  3OYA A;  4NYN A;  4LD0 A;  3NH1 A;  4CE9 A;  1VSH A;  3AVN A;  1X9S A;  3PX4 A;  3LZI A;  2OZM A;  1A5V A;  1RT6 A;  3VQ7 A;  3L2Q A;  2IDO A;  1NK0 A;  2X78 A;  3EYZ A;  4M3Z A;  1RBS A;  1RIL A;  2YNI A;  2HHT A;  4Z0U A;  1YT3 A;  4W5T A;  1T7P A;  3LPT A;  2Y1J A;  3MEG A;  3DRS A;  2E6L A;  4E19 A;  2VG6 A;  3AA4 A;  3AV9 A;  2A1R A;  3PUF A;  4I2P A;  1JL1 A;  3VN5 A;  3V9U A;  5FRO A;  1TKX A;  2FBT A;  4NCB A;  5J2Q A;  3K5O A;  4DQQ A;  2HHV A;  3NBP A;  4CHQ A;  3BDP A;  1VSD A;  2HND A;  3M8P A;  5K14 A;  3S3N A;  4Z4G A;  3TAE A;  1L3T A;  5CY4 A;  4CEE A;  3DYA A;  3LPU A;  3ZCM A;  4CJU A;  3SZ2 A;  1NK5 A;  4C8K A;  1KVC A;  3I0S A;  1NK7 A;  2QKB A;  4ZHR A;  1WLJ A;  2RKI A;  1W9H A;  1C0T A;  3DRR A;  3M8R A;  2VWK A;  3SYZ A;  4MQ3 A;  3AVF A;  4CJP A;  1JLE A;  4QCL A;  4I7F A;  1RDC A;  4HCB A;  2BAN A;  1KFS A;  3U3Y A;  3NHG A;  3L3U A;  4DWI A;  1BQM A;  4F4K A;  3AVM A;  3VQ9 A;  3AO4 A;  3V9W A;  2XY5 A;  1Q9X A;  4KI4 A;  1FK9 A;  2OZS A;  4Z4I A;  1A5W A;  1CXQ A;  1HYV A;  3KIO A;  3MEE A;  4OKJ A;  1RCH A;  3K5N A;  4ELV A;  2W42 A;  3OYC A;  1JLG A;  3MXJ A;  4DS4 A;  1TL3 A;  3AVC A;  1RT7 A;  4IFY A;  1REV A;  4FXD A;  4DTJ A;  2B5J A;  4CJE A;  4HVJ A;  1KFD A;  4DU4 A;  3IAY A;  3DI6 A;  1LWF A;  1ASW A;  3DOK A;  4BWJ A;  3NFA A;  4YNQ A;  4DSE A;  1T03 A;  3VQ4 A;  3AA3 A;  3QEW A;  4CGG A;  3OY9 A;  4CFC A;  4Q5V A;  1W0H A;  5HRS A;  3DLG A;  5HRP A;  3OS1 A;  4J2E A;  4OLA A;  5I3U A;  4FYD A;  1WN7 A;  3ZSZ A;  1Q9Y A;  4OPJ A;  3P83 D;  1S6Q A;  4DSL A;  2DFE A;  3QLH A;  3ZT4 A;  2FC0 A;  1CZB A;  1TGO A;  1TKT A;  3ITH A;  3HP9 A;  1NK9 A;  3UIQ A;  2P51 A;  3SJJ A;  4J2A A;  4FLZ A;  3KLH A;  4KHW A;  1BHL A;  1JXB A;  1C0U A;  4BDY A;  5SWM A;  2FBX A;  1RBU A;  2IS3 A;  3QIP A;  3CFP A;  3DLH A;  3CFR A;  3LWM A;  2HHU A;  4FLU A;  3KK1 A;  1N6Q A;  3NF8 A;  4OKE A;  3RRH A;  3SI6 A;  2HVI A;  4QAG A;  4E7L A;  1NK4 A;  5HP1 A;  1YTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...