4CEQA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ceqA00
3P83D 1EKEA 2YNFA 2IC3A 2B5JA 1B9DA 4CJ4A 5J1EA 4FLWA 1SL2A 2HMIA 5J2MA 3PO4A 3LAMA 3G0ZA 5E41A 1NK6A 4B3OA 4CCHA 3A2FA 1RBSA 3G10A 3IS9A 1BQNA 2HVIA 1R0AA 1GOBA 4O44A 1JLCA 3OY9A 3OJUA 1CZ9A 1Z26A 2VG7A 3VQ8A 4XIUA 4C8LA 4E7LA 1TAUA 1VSHA 4CIGA 4FM2A 1TKZA 3CFOA 3QO9A 4IFVA 4BE0A 3VQPA 1Z25A 2ZQBA 3ZSZA 1VSFA 4CK1A 3NGIA 2LSNA 2YKMA 3DLGA 2DY4A 2FBXA 3QESA 5C42A 3AVLA 1W0HA 2WOMA 4CJKA 3NCIA 1LW0A 1VSKA 4FW1A 1ZBLA 3O4QA 3DLKA 3V4IA 1N5YA 3PX6A 3O3GA 3OYHA 4B9LA 2ZE2A 3AVFA 4CERA 3K5MA 1NJZA 3LP1A 1W9HA 3NBPA 3OYDA 3OS2A 2O4GA 3OS0A 1VSDA 3V9UA 5DMRA 4DFPA 4FJIA 3CM5A 4FLZA 4CGFA 5HBMA 4B9VA 1QS4A 3NF6A 5C25A 5I42A 4KHUA 2OPPA 1IKWA 2FC0A 4KV8A 2EX3A 1QSSA 4AILC 1RNHA 1S1VA 1JXBA 3PY8A 1NKEA 4N41A 1TL1A 1SKSA 1Y97A 2IGIA 1IKXA 1BIZA 4LY7A 4OKJA 3MEGA 4CFDA 4CJTA 4E3SA 3V81A 4C8KA 2F8TA 2KFZA 4CF2A 3TAFA 1B9FA 1NJYA 4J2AA 3B6OA 1NK8A 4Z4GA 1TV6A 1IKVA 3QIOA 1S9EA 4M3XA 3LPUA 2HHVA 4KHSA 4J2EA 1DTQA 4DLGA 4C8NA 4BDPA 4FLYA 1KVBA 4KO0A 5C24A 1RCHA 3VQBA 4W5TA 2O4IA 1HJRA 4Q5VA 2G8HA 4EZ6A 4M3WA 3SUPA 4DSKA 3U3GA 4CHZA 1L5UA 2QKKA 2G8KA 1BCMA 4N5SA 2X6SA 2KZZA 5CY4A 1A5WA 1C1AA 1HNVA 4Z0UA 3ZSXA 2A1RA 1LV5A 4M42A 1FKOA 3SUOA 1RDCA 1X1PA 4FJGA 3AV9A 3AO5A 2ITGA 5FDLA 3SYZA 2B6AA 3CM6A 3NGYA 3NDKA 3AO2A 4OKEA 1WSFA 2XY5A 2RPIA 4LH5A 1BCOA 5FRMA 2QK9A 4DSLA 4DTOA 2KFNA 3AVHA 3O4NA 1TGOA 1VSMA 3VQDA 2XY8A 3KK2A 4HTUA 4Y1CA 2P1JA 4E7IA 1TK0A 3DOLA 4F2RA 1KVAA 1S1WA 1RBRA 4DSJA 1HQEA 3M8PA 3QNOA 1L3TA 3HK2A 3AVIA 4DTPA 4CHOA 4CJ3A 2KTQA 4YNQA 1J54A 1NK0A 1LWFA 1L3VA 1LWCA 2FBTA 3L2RA 3SQ2A 5HP1A 4DSIA 3LZIA 4IG0A 2KZMA 3TAQA 1JLFA 2JGUA 4C8MA 1ITGA 3NH1A 4FLXA 4DTJA 4O0IA 1QTMA 3IRXA 4CHNA 3OYJA 4NCBA 2DFHA 3MECA 3L2UA 3RWUA 4NYNA 3OYEA 3CQ8A 1IH7A 3VA3A 1U45A 4HUFA 2B4JA 4AHCA 4CHYA 3OYGA 4DQQA 3SCXA 4DF8A 1NOYA 4FJ7A 4E1MA 4QOZB 3I0RA 4CGDA 4CGHA 4JRPA 3M8QA 4DMNA 4OKKA 3EZ5A 4FLVA 2QKBA 1Q9YA 3AVMA 2D0AA 1IG9A 4LD0A 4M3UA 3T3FA 2RF2A 1FKPA 2OA8A 3HL8A 1N6QA 4PY5A 3DMJA 4FW2A 4RW7A 4DTNA 3T19A 4TSXA 4CIEA 1ZYQA 1NKBA 3AVJA 3OYAA 1XC9A 3KLIA 3D45A 4CJ5A 2HB5A 1ASUA 1RTIA 3NF8A 5KTQA 3PX4A 2DFFA 4DG1A 4KB0A 4GW6A 4CF8A 3PV8A 4WE1A 1SL1A 4DQSA 3NAEA 1YVUA 2X74A 4CF0A 3CG7A 2A1SA 3CFPA 4AHUA 5J2NA 2PZSA 1VRTA 3S9HA 3T1AA 4KI4A 3KKRA 3RMAA 1S1XA 1EETA 3DYAA 3TAEA 4DWIA 4OVLA 1QSLA 4FK2A 1UAXA 3LP3A 4I9QA 2IAJA 4KKOA 1VSEA 1NK4A 2BGGA 3L3VA 1LW2A 4FJ8A 4CIFA 3HPGA 4Q0BA 4CFAA 3RR8A 2X78A 3AA4A 2R7YA 5HROA 4FVMA 4ZTFA 1D9FA 3BDPA 2QXFA 3KK3A 1S1UA 2HW3A 4LH4A 3HVTA 3KLEA 4FJHA 3U3YA 2Q3SA 1NKCA 3ZSOA 1HYZA 4CJVA 4PA1A 3LALA 4B9NA 1IO2A 1Q8IA 2XO7A 4HHTA 1RBUA 1QSYA 2F8SA 3H08A 5HRSA 3AVGA 4AHVA 3SPZA 1HPZA 1JLEA 1RT6A 4ID1A 3NF9A 4FCYA 4ELUA 3HYFA 2HHWA 4DTMA 3QEXA 3M8SA 4KHWA 3SQ0A 4K8ZA 1S6QA 2Z1IA 4E7JA 1C0TA 1QE1A 2IOCA 3QEIA 4C8OA 1GOCA 1WAFA 2BANA 3ZSWA 3NE6A 3K57A 4OLAA 3CYMA 4KPYA 2P51A 4CJSA 2WONA 2YNIA 4OJRA 5KI6A 4W5OA 5HRRA 2Z1GA 2G8IA 1ZBHA 4CJPA 4OLBA 3ALYA 2NUBA 4BDZA 4ELVA 3I8DA 1JKHA 4AHRA 3JSMA 1J5OA 4N76A 4CEZA 1VSIA 3VA0A 3B6PA 3OJSA 4KRFA 3QLHA 3NH2A 2G8WA 2HHUA 1JXEA 3S3OA 3JYTA 1KCFA 1U4BA 4CGJA 3V6DA 4FJXA 1BI4B 1JLGA 1WSEA 3QERA 4Z4EA 5KGWA 3VN5A 3V9SA 1VSLA 4PQUA 3F9KA 1U47A 1S9GA 3ITHA 4CJLA 3OS1A 1RDBA 3SNNA 2HHSA 4CK2A 1T7PA 2RKIA 3K2PA 5CYQA 5J2PA 1UA0A 4EP5A 2GV9A 5KRSA 2VWJA 4E7HA 4KHYA 3AO1A 2YNGA 3TABA 4DSFA 1BI4A 5JS2A 5EU7A 3TANA 4CEEA 1RT7A 4UQGA 3SV3A 1TL3A 3P1GA 3VQEA 3ZSRA 4MQ3A 4O0JA 1T8EA 2AJQA 4L8RB 4KTWA 1TKDA 4CF9A 4J2BA 4CEFA 1KRPA 4CE9A 4CEOA 4FM0A 4KI6A 3K58A 3VQAA 1NJWA 4CGGA 3K59A 4FJLA 3S3MA 4DLEA 4CJEA 4FM1A 3MEDA 3WNEA 4F8RA 4H8KA 3WNHA 4HCCA 4CK3A 2Z1JA 1U04A 4CECA 3SI6A 2HHQA 4EZ9A 2HHXA 2IDOA 3KLHA 3QNNA 4KHQA 3LANA 3HO1A 3U6FA 1RTHA 3MXMA 2X6NA 1XWLA 4F3TA 4DQIA 3MEEA 4K8XA 3ZT4A 3PO5A 3L2WA 5T7BA 3TAPA 1NK7A 2E6MA 3ZSVA 3DLBA 3IG1A 3C95A 2ZD1A 4QCLA 1EP4A 4ICLA 1C6VA 4KB1A 1TK5A 2FBYA 4CESA 2YHBA 1UWBA 4W5RA 3NGZA 1KSPA 4FZZA 1HQUA 1NOZA 3L3UA 3WNGA 3V9ZA 3C6TA 1RT4A 2KQ2A 2XRIA 4DTXA 4B9SA 1DTTA 4H4OA 4FJ9A 4CHPA 1HYVA 1CXUA 4RW8A 3LP0A 3AA3A 1X9SA 4KTQA 3K5OA 1SUQA 3QINA 3E01A 3DRRA 5KGXA 3VQ5A 4W5NA 1NK9A 4DFKA 4O55A 2D0BA 3HPOA 2YKNA 3SPYA 3V1OA 1SL0A 3AO4A 4FJNA 3KKSA 3RRGA 1VSJA 1CLQA 3O3HA 3O3FA 4DU4A 3ZT1A 1LAVA 3HT3A 4KREA 1VRUA 4CEDA 1RT1A 1UA1A 4AH9A 4R5PA 4B8CA 4IBNA 4IG3A 2XHBA 1MU2A 3F73A 4BE2A 1T05A 3ASMA 1C1CA 3TWHA 3SUNA 4FK0A 4M3YA 2VG5A 4DFMA 2DTUA 4DTSA 1KFSA 1A5VA 1K6YA 2XY7A 4J2DA 4CJWA 4HCBA 4OPKA 4FK4A 3KK1A 1S5JA 3V1RA 3QETA 3ZT0A 4E89A 1TKTA 4BACA 3SJJA 4E19A 3KTQA 3OYFA 4CJQA 1S6PA 3QEWA 1J53A 1IKYA 1D5AA 1WSHA 4JRQA 4CEQA 3NFAA 3KLGA 4E7KA 2OZSA 3LAKA 2I5JA 2JLEA 4H4MA 4Z4CA 4FYDA 4DSEA 4DS5A 4B9TA 1YTUA 2Z1HA 1JLBA 2BE2A 3DI6A 4E1NA 2BDPA 1LAWA 5JS1A 3ZT3A 2ATQA 4HVJA 1NJXA 1L3UA 1XHXA 2D0CA 1D8YA 4DQRA 5DK5A 4FLTA 3P5JA 1BQMA 1D9DA 4MFBA 1WSJA 1I39A 1HMVA 3ULDA 4KAZA 4DQPA 3KD5E 1F21A 1I3AA 3ZSQA 3L2VA 4FJKA 4AHTA 3NHGA 3IAYA 1U49A 3C6UA 3DRSA 4DS4A 3CFRA 3AVAA 5SWMA 5SZTA 4I9LA 3DLRA 2Y1JA 4IFYA 5KRTA 3HVRA 5CYMA 4IKFA 2G8UA 3HP6A 4G1QA 4M3TA 3TARA 3KJVA 3EY1A 1L3SA 3AA2A 1HNIA 3VQ4A 1WLJA 3TR8A 4DFJA 1Q9XA 1QQCA 4FXDA 2YV0X 4OGCA 4B9UA 3LWLA 4BDYA 1ASVA 4Y1DA 3QEVA 4FJ5A 1YTAA 1RBTA 4OPJA 2W42A 4GMJB 3K5LA 1DLOA 1GOAA 3RMCA 2PYLA 4Z4IA 2HVHA 1EX4A 4LSLA 4LSNA 1RT3A 2E4LA 3M8RA 1O1WA 3AA5X 1ASWA 3DOKA 1TK8A 4M3RA 4DF4A 1XI1A 2DFEA 1ZBIA 4JS5A 3LPTA 1TKXA 2FBVA 1FK9A 5D3GA 4M45A 3NF7A 2P5GA 1RILA 3LP2A 4CEAA 2PYJA 4FJMA 4FLUA 2PY5A 4DTUA 2HNDA 5FROA 3OYLA 1BISA 1TAQA 1RT2A 1HYSA 1RDDA 4ID5A 3LWMA 4BE1A 4CEBA 4CHQA 3L2QA 3TI0A 4RW6A 4ZHRA 3NH0A 3QEPA 1BHLA 1KVCA 1QHTA 2KW4A 1J9AA 2OZMA 4N47A 1WSGA 2VG6A 4KTZA 1C1BA 1CZBA 3I0SA 1KTQA 1G15A 1TVRA 3BGRA 1T03A 4O4GA 3VQ9A 3HPHA 4W5QA 2F96A 1JLAA 3KIOA 1KLNA 2OYQA 3D0PA 1SKRA 4BWMA 4E0DA 4B8AB 3HXMA 4I2QA 3LDSA 2Y1IA 2GBZA 1FXXA 3DLEA 5CZ2A 3V1QA 5FRNA 3AVCA 4AHSA 3HJFA 3AO3A 3SV4A 3ZT2A 1WN7A 1B92A 1JL2A 4F2SA 2OPRA 3MAQA 4FZYA 3AVBA 4ELTA 4NYFA 2OPQA 3SZ2A 2HHTA 2RN2A 1X9WA 4KFBA 4KHNA 4PWDA 3KD1E 1BGXT 3PUFA 5CZ1A 3KLFA 3DLHA 3RMBA 4CJRA 3V9XA 3K5NA 4IDKA 3THVA 1XHZA 1WNSA 3RTVA 2YNHA 1RTDA 4F3OA 3SUQA 4JS4A 3AVKA 1RDAA 3ZCMA 4OGEA 3SQ4A 2EHGA 2VWKA 2HNYA 3ZSYA 4CJUA 4HUEA 4DTRA 4I7FA 2YHAA 3WNFA 3TAGA 1NK5A 2HNZA 4CF1A 4PUOA 5J2QA 4NCAA 1CXQA 4RG8A 3SQ1A 4F4KA 4RW9A 4BWJA 5HRPA 3OYCA 3S3NA 1VK0A 3L8BA 1UOCA 4CJFA 2G8VA 2ETJA 2GUIA 4QAGA 1JLQA 3LZJA 2XY6A 3RR7A 3TAMA 3AVNA 1BIUA 4Z4HA 4CFBA 3MXIA 4Z4FA 4DU1A 4B9MA 3RRHA 4JLHA 3VQCA 1EXQA 1WAJA 3VQ7A 4N56A 3OYMA 1JL1A 4ZTJA 4EP4A 1ZBUA 3DM2A 1C0MA 4GVMA 3EYZA 2D5RA 3OVNA 2G8FA 3OYBA 4DU3A 3ISNC 4O5BA 5K14A 1S1TA 5I3UA 2E6LA 3RMDA 1RT5A 1C0UA 4B08A 1HRHA 4CFCA 3UIQA 1WSIA 1KFDA 4NCGA 5HRNA 2OPSA 1RTJA 3HP9A 1KLMA 3MXJA 3OYKA 3HM9A 1LWEA 1RBVA 3VQQA 1X9MA 4I2PA 1YT3A 3HSTB 1U48A 3C94A 1SV5A 3OYNA 4HUGA 1A5XA 4YFUA 1ZBFA 3FFIA 4RW4A 5HLFA 3QIPA 4M41A 2P5OA 4FJJA 3DRPA 4CGIA 3V9WA 4FZXC 3PX0A 2IS3A 1REVA 3VQ6A 1BL3A 4M3ZA 3OYIA 1SKWA
chains in the Genus database with same CATH superfamily
3P83D 3DLLL 1EKEA 2IC3A 2B5JA 1IBLK 5J1EA 1RBSA 4DUZK 4CZLA 1BQNA 2HVIA 1GOBA 4O44A 2VQEK 3MDQA 1DEJA 1GLCG 1Z26A 3VQ8A 4C8LA 3CCRN 4ISEA 4DR5K 3CFOA 4IFVA 4BE0A 2ZQBA 3ZSZA 2LSNA 2DY4A 2FBXA 3QESA 1W0HA 4CJKA 3VETA 1VSKA 4YOYA 2YJFA 3PX6A 3O3GA 3OYHA 2ZE2A 1XC3A 3AVFA 1NJZA 3K5MA 3CJBA 3NBPA 1HUXA 3OS0A 3OS2A 1VSDA 3V9UA 2JWKA 1XMQK 3D2FB 2A41A 1D4XA 3CM5A 3TTFA 3NF6A 5I42A 3F2KA 2FC0A 4KV8A 4JK7A 1TL1A 4N41A 2FF3B 1OH7A 2I7NA 3D2FA 4CZFA 4LY7A 2KFZA 4CFDA 4C8KA 1NJYA 3B6OA 1QQNA 5GIPA 1NGGA 2HHVA 4QS9A 3E9PA 4DLGA 4MLEA 4BDPA 1NJIO 4KO0A 5C24A 4BRHA 1HJRA 4M3WA 2UUBK 1BA0A 1BCMA 2OANA 2KZZA 2A1RA 1C1AA 4Z0UA 3SYZA 3CM6A 2CH6A 5BPLA 4OKEA 2XY5A 5AJ3K 3O1WA 1O13A 5FRMA 3SMSA 3THYB 3AVHA 2P1JA 1S1WA 3R6MA 2F9WA 1HQEA 2QWNA 5AFUH 4JKGB 3MK6A 2KTQA 1LWFA 3OBYA 4JKHA 3VF2A 3SBTA 3THYA 3LZIA 4BQZA 3I56N 3WUHA 3NH1A 4DTJA 4JKGA 4WQ5A 3WXLA 3L2UA 3E9LA 5BRDA 3CHWA 1IH7A 2B4JA 4CHYA 4WQ4A 4Y0WA 4FJ7A 3QMLA 2PAVA 4QOZB 3M8QA 2QKBA 4F9OA 1IG9A 4GV3A 3T3FA 2OA8A 4FW2A 4IDHA 4TSXA 3MN6A 3AVJA 4O5FA 1XC9A 4B1WB 3SAGA 1BO5O 2E88A 4H0OA 1EWQA 4B1VA 1YVUA 4JI8K 4KI4A 3RMAA 2W41A 1S1XA 1EETA 3DYAA 4OVLA 1QSLA 4FK2A 3EZWA 4AM7A 4I9QA 1BU6O 2VCPA 1NK4A 4E1JA 3L3VA 3SAFA 5GAEP 5AQQA 2X78A 4A61A 3BDPA 2F4VK 2HW3A 3HZ6A 3KK3A 3KLEA 2OTLN 4PA1A 2E1YA 1R59O 1S22A 4FO0A 5AQVA 2ZF5O 4ID1A 3NF9A 4ELUA 5AQOA 3IFRA 2I7PA 4K8ZA 4E7JA 3HI0A 1C0TA 2E8AA 2QWOA 3LDNA 4BR9A 1GLFO 3GE1A 2WONA 5I9EB 4OJRA 5CHIA 2HHHK 3EN9A 5HRRA 4CJPA 4OLBA 3ALYA 2NUBA 4AHRA 4BGAA 4CEZA 1VSIA 3VA0A 3MN9A 3LM2A 1JXEA 1KCFA 1WSEA 3QERA 1S9GA 3ITHA 4CJLA 5AQKA 1RDBA 3SNNA 4LF6K 2RKIA 5J2PA 4NO7A 3WT0A 4BC3A 3TABA 3AGRA 5HOOA 1U6ZA 2IVNA 3ID8A 3WQTA 1K8KB 3OHRA 3SV3A 1T8EA 4BRCA 2AJQA 3CJ9A 4MQ3A 4O0JA 1NGFA 5LJWA 3O80A 4KTWA 3CCVN 1TKDA 4J2BA 3SK3A 1KRPA 4CE9A 1YAGA 2A40A 3O4WA 2P9IB 4EHTA 2QWQA 1FJGK 4DLEA 4FM1A 1K8KA 5BRFA 4CECA 4K43A 3SI6A 3G6EN 3W0LA 5AQFA 4JNEA 1BG3A 5A2QO 4JKEA 3GG4A 1KAZA 3C95A 1C6VA 4KB1A 2YHBA 5AQIA 4W5RA 1YI2N 2P9UB 2ASMA 4FZZA 1HQUA 3EO3A 3U8XA 3C6TA 4H5RA 4DTXA 4B9SA 4FJ9A 2YHYA 4H0PA 2QWLA 3LP0A 4KTQA 3QINA 4OPAA 5KGXA 1QHAA 1X3MA 4DFKA 3A5LC 3FZLA 2D0BA 3OTOK 1SL0A 4FJNA 2ZJQL 4JAXA 3KKSA 1CLQA 1RT1A 4AH9A 3WEEB 4BE2A 3ZETB 3UB5A 4M3YA 4JI4K 4FK4A 4DV7K 1U2VA 1S5JA 1SQKA 3V1RA 3ZT0A 1TKTA 3WEEA 5IT9O 4CJQA 1S6PA 2IIRA 3ZETA 1J53A 1Q86O 3MWTA 4JI1K 4E7KA 3L0QA 1MA9B 4Z4CA 4H4MA 4FYDA 5FLXO 4E1NA 2BDPA 2HBMA 5JS1A 4JK9A 1NJXA 4FWQA 4DQRA 2O8DB 4MFBA 4GKKK 1WSJA 3H3OB 5AQYA 4WFNL 3N4PA 4DQPA 4B3TK 1U49A 3C6UA 4I6MA 1IBKK 3GBTA 2QEXN 3HSCA 3O08A 3TSUA 5SZTA 4IFYA 2O8DA 3HVRA 1Q18A 1TYQB 3KJVA 1VQON 3AA2A 3VQ4A 2NNWA 1WLJA 3TR8A 4DFJA 1Q9XA 4OGCA 2E2QA 2YJEA 3LWLA 1ASVA 3HRGA 4OPJA 2W42A 3PSFA 5AFUA 1GOAA 1EX4A 2E4LA 1TYQA 1TK8A 2O8CB 3QB0A 1RFQA 2WC9A 4GNIA 2DFEA 3BY5A 3CQXA 2FBVA 2PY5A 4BRMA 1TAQA 1RDDA 4FPBA 3NVKA 1P90A 2D1KA 5F1XA 4BE1A 4CEBA 4CHQA 3L2QA 3ATUA 1TUUA 4ZHRA 1KVCA 1QHTA 3EE8A 4G9ZA 1CZBA 1G15A 4A5BA 1KLNA 1JLAA 3D0PA 1SKRA 4E0DA 2E2OA 3FZKA 3THWB 1FXXA 1Y64A 3V1QA 3ZT2A 2OPRA 3MAQA 3SZ2A 2D4WA 3VTHA 4KHNA 2Q1NA 1KC8O 4IEEA 3KLFA 2HMPA 4CJRA 3THWA 2HBLA 1H1VA 4YOUA 4GKJK 1HNXK 2O8BB 1OH5A 2EHGA 4CJUA 4HUEA 4DV3K 5F2RA 1CXQA 4A59A 3VEYA 4BRIA 4LF5K 3S3NA 3R9PA 1VK0A 4CJFA 5AZIB 2G8VA 3LZJA 5M1FA 2XY6A 2O8BA 2QI2A 1M90O 4Z4HA 5GINA 3D2EB 2DPNA 1JL1A 5AZIA 4EP4A 1C0MA 2D5RA 3VEVA 2YI1A 2E6LA 1BOTO 4BG8A 3FZFA 2ASPA 4CFCA 3D2EA 1C0GA 3UIQA 3HM9A 5AQLA 3QBWA 4M7XA 3VQQA 1LWEA 4K42A 4A62A 4I2PA 3HSTB 4BRAA 4HUGA 5AR0A 3FFIA 4IXCA 4JEPA 4FJJA 3O9QA 4CGIA 3PX0A 5C10A 3VQ6A 1Z05A 4DQ8A 2HMIA 3NVMA 1JCGA 3DXMB 3VMFB 3LAMA 5E41A 1E3MA 4B3RK 3G10A 1JLCA 3OY9A 3O5BA 1Q82O 3VEOA 1CZ9A 4C1NK 1YXQA 3UKUB 1GLAG 2E20A 3PLAA 3DXMA 3FGUA 1Q7YO 1TKZA 3QO9A 1EQYA 4BGBA 1VSFA 2YKMA 4PL7A 3NCIA 1ZBLA 4B9LA 3O4QA 3DLKA 3V4IA 3UKUA 4CERA 3E1YA 3A0IX 1HJOA 3OYDA 4ILGB 2PFUA 4BRLA 5DMRA 1NNEA 4JI2K 2WFBA 4FLZA 4CGFA 4B1ZA 1QS4A 5C25A 3G25A 2OPPA 1QSSA 3CI5A 2YHXA 5AQRA 3TTDA 4YDUA 3PY8A 1NKEA 3MMVA 2IGIA 4DR3K 1IKXA 1BIZA 4B9QA 3MEGA 2Q97A 4CJTA 2F7TA 2ZJPL 1B9FA 1IKVA 2ZM6K 4B1UB 3GL1A 1KVBA 3VQBA 5BN8A 2O4IA 4Q5VA 1QQMA 4DSKA 3U3GA 4CHZA 4DV2K 3BF3A 4QS7A 1HNVA 1VQ8N 3GDQA 1LV5A 1RDCA 3N4QA 2B6AA 3AO2A 1ATSA 1N34K 4LH5A 4BRDA 2UXDK 2QK9A 4DTOA 4U67L 3QETA 2V7YA 3VQDA 1TK0A 4HTUA 4Y1CA 2E2PA 3P4IA 3DOLA 3KK7A 4DTPA 5E84A 4YNQA 1J54A 1L3VA 5CE3A 2KZMA 4BRGA 1JLFA 3QICA 5F0XA 4C8MA 3E66A 5ADXA 4FLXA 3ZLJA 2BH1A 3CPWM 3OYJA 3QFPA 3MECA 4DR2K 3CQ8A 1HKBA 1U45A 4DQQA 3SCXA 4DF8A 3TTCA 5BPMA 2QW9A 4CGDA 4CGHA 5JVGL 1Q9YA 3CD6N 3AVMA 4IOAL 4M3UA 5IWAK 2RF2A 4X66K 1T6DA 3DMJA 5LJVA 1ZYQA 4CIEA 1NKBA 5KPRA 3C6AA 3RVCA 4CJ5A 5AQGA 3CMEN 4DG1A 4KB0A 4GW6A 2OTJN 1YF5L 3PV8A 3T7ZA 1N8RO 2A1SA 3CFPA 3LDLA 2PZSA 1VRTA 3KKRA 3OA9A 3TAEA 4DWIA 3ATVA 2QA4N 3LP3A 2IAJA 4CJ7A 1LW2A 4FJ8A 4CIFA 3HPGA 3KD5E 3AA4A 3PIPL 1GLDG 3KWIA 4LH4A 3LALA 3MN5A 4HHTA 2VWBA 1IBMK 2BTFA 3H08A 3LL3A 4M7YA 4AHVA 3SPZA 1HPZA 4FCYA 1RT6A 5E26A 2HHWA 3HYFA 3MCAB 1HX1A 4KHWA 1QE1A 2O8FB 2IOCA 1GOCA 2BANA 3CC7N 1WOQA 3NE6A 4CD1A 2Q2RA 4CJSA 5JMVA 5AQPA 2YNIA 4CBXA 5FPDA 2Z1GA 4DKWA 1ZBHA 4NXMK 4ELVA 4V19S 3I8DA 3JSMA 1J5OA 2O8FA 2HBJA 1G99A 3QLHA 3ZX3A 1NGIA 3S3OA 3JYTA 4FJXA 3V6DA 4BR2A 1XNRK 1BI4B 1JLGA 4BC5A 4Z4EA 3A8YA 1X9JA 3VN5A 3ZYYX 3V9SA 4PQUA 3F9KA 2Q31A 2HHSA 5CYQA 1UA0A 3K9JA 2GV9A 4FPAA 3M6GA 3AO1A 1BI4A 4DUYK 5EU7A 3A5OC 3TANA 1TL3A 1VHXA 3ZSRA 5AQHA 3VERA 3HM8A 3WXKA 4L8RB 3T1HK 1ESVA 1NJWA 3K59A 3MEDA 4IFEA 4F8RA 4H8KA 4HCCA 3DAWA 1U04A 2HHQA 3MCPA 3TU5A 1SS6A 4EZ9A 2HHXA 2IDOA 5M1KA 1I94K 3QNNA 4KHQA 3HO1A 1JCEA 3U6FA 5GIOA 5AQSA 4F3TA 3SLCA 1YIJN 2QWMA 4K8XA 3L2WA 3UE5A 5T7BA 3DLBA 3IG1A 4KBOA 2ZD1A 4ICLA 3NGZA 1NOZA 3L3UA 2J4RA 2P9SB 1RT4A 1DTTA 4H4OA 4BQLA 4RW8A 3AA3A 3AGKA 3E01A 3DRRA 1NK9A 4FWSA 5AQZA 5BR9A 3HOTA 1NGAA 3HPOA 2YKNA 3BP8A 2E2NA 3H6EA 3R3LA 2P9SA 4JK8A 3O3FA 4KREA 1UA1A 4R5PA 3ENBA 4IBNA 2XHBA 1MU2A 4JN4A 4A57A 2CH5A 2V52B 2D0PA 4DFMA 1VQKN 4BRQA 4DTSA 1A5VA 1K6YA 2GWJA 3P38A 1BA1A 3CETA 4BACA 3SJJA 4FWLA 4E19A 3QEWA 4BRPA 1D5AA 4JI6K 3AARA 3J81O 2OZSA 2I5JA 2JLEA 3C6HA 2VGNA 1VQ4N 4B9TA 5KQDA 3I55N 3DI6A 4EFHA 2ATQA 1OVYA 5M1PA 4HVJA 2D0CA 3U9ZA 1BQMA 1D9DA 3ULEB 1HMVA 1Q81O 4KAZA 3ZSQA 5LMNK 4AHTA 3NHGA 1QVGM 3DRSA 1WUAA 4LFAK 5SWMA 2YX6A 2P9PB 1XUPO 3Q7BA 3HP6A 3ULEA 3VOVA 4M3TA 2WTUA 3R8EA 5M1OA 2H3GX 1DT9A 2YV0X 5TKWA 4B9UA 4BDYA 4Y1DA 4FJ5A 1YTAA 4GMJB 2HVHA 3JS6A 4LSLA 4LSNA 1RT3A 2NRZA 4RCHA 3LPTA 1WBDA 5D3GA 1FK9A 4WF9L 2P5GA 2ITMA 4FLUA 3VEWA 4DCHA 4X65K 5LL6Z 2HF4A 3TI0A 4RW6A 3JXUA 1BHLA 5EOYA 1J9AA 4BR7A 4N47A 2VG6A 4KTZA 1C1BA 1KTQA 5MLCQ 3KIOA 2OYQA 5AQTA 4B8AB 4BREA 2GBZA 5M1NA 2YCHA 3AVCA 3HJFA 1NBWA 2P9IA 4O8UA 1IJJA 1JL2A 4FZYA 4ELTA 4NYFA 4A5AA 2HHTA 2RN2A 3KD1E 3DLHA 3M1FA 4CI6A 1VQMN 1HKGA 3O9RA 3SUQA 3AVKA 3ZCMA 4X64K 2VWKA 5H1SQ 3ZSYA 2YHAA 2HNZA 4CF1A 1VQPN 4JHDB 3BEXA 5J2QA 4NCAA 1T3VA 3FFKB 2NRHA 4NXNK 4BWJA 3L8BA 1UOCA 2GUIA 1NWKA 4NLBA 2P9UA 3AVNA 4GY2B 3A5NC 4CFBA 3G4SN 1ATRA 3RRHA 3ENHA 3C7NB 3ZEUB 3VQ7A 3CCSN 3F5TA 4ZTJA 1ZBUA 3DM2A 3DWLA 1OH8A 4WFAL 3ISNC 5K14A 1S1TA 1KD1O 4YORA 4B08A 3DXKB 1LCUA 1WSIA 3C7NA 3HP9A 1RTJA 1X9MA 1KLMA 3UKRB 3RSEB 3C94A 1SV5A 3OYNA 4YFUA 4YOWA 5HLFA 3DRPA 3EEQA 4BVOA 2IS3A 1IV0A 3OYIA 5JICA 2YNFA 1B9DA 1SL2A 1K8AO 3PO4A 3G0ZA 1NK6A 5EXWA 4B3OA 4CCHA 4DV5K 2A42A 3OJUA 1YHQN 4XIUA 3MWPA 4LC9B 4E7LA 1VSHA 1E4FT 4CIGA 4FM2A 1Z25A 3DLGA 4RWTA 5C12A 5C42A 3AVLA 4FW1A 4JI5K 2CGLA 4WQ5C 1N5YA 4L3QA 2O4GA 3VF4A 4DFPA 4WQ4C 4FJIA 2ZGYA 5HBMA 5FPMA 4B9VA 1DKGD 2VQFK 2EX3A 3WQUA 4AILC 1RNHA 3NMUA 1S1VA 2HF3A 1K73O 2RE2A 1SKSA 2F8TA 2O8CA 3V81A 1VQ9N 3O1BA 4B3SK 3J7AP 2NLXA 2Q36A 5DM7L 4C1NI 1DGKN 4CF2A 3TAFA 4J2AA 4WCEL 1NK8A 3WXJA 1TV6A 3H1VX 3QIOA 4M3XA 4MO4A 4J2EA 1DTQA 4FLYA 4IJNA 2G8HA 4EZ6A 1L5UA 2QKKA 5CY4A 1A5WA 3ZSXA 1FKOA 1MDUB 1X1PA 3AV9A 3AO5A 2ITGA 5FDLA 4MO5A 3NGYA 3NDKA 1WSFA 2RPIA 1BCOA 4CBUA 4DSLA 2Q0UA 2KFNA 1TGOA 1VSMA 4E7IA 1RGIA 4K0KK 4ILHA 1NU0A 1KVAA 4Z94A 4DSJA 3M8PA 3QNOA 1L3TA 1RDWX 2WUSA 3L4QA 4H0YB 3HK2A 4CHOA 2NRWA 1LWCA 2FBTA 3O9UA 4DSIA 5LMUK 3K0SA 2GELA 4DV6K 2JGUA 1QTMA 2WBNA 1YJ9N 5C15A 4H5WA 3RWUA 3VA3A 3L4IA 4AHCA 1NOYA 1XNQK 4ISFA 4E1MA 2HSTA 4BRNA 4JRPA 4OKKA 3EZ5A 3T1YK 3PIOL 3H1QA 4CZJA 1QQOA 5BREA 4ISGA 3HL8A 4MLHA 4PY5A 5C0YA 4H0TB 3T19A 4CVNE 3EKSA 2HB5A 3LM9A 1JCFA 1ASUA 1KXPA 1RTIA 1W97L 3NF8A 5KTQA 1VQLN 4CF8A 5EVZA 1S3XA 4WE1A 1SL1A 4LF9K 2X74A 4FWOA 4AHUA 5J2NA 3T1AA 5C2DA 3BF1A 1UAXA 1VSEA 3D6RA 2BGGA 4Q0BA 2E1ZA 4CFAA 3RR8A 3H46O 2R7YA 3CCUN 4FVMA 4FJHA 4DR4K 4B9NA 2XO7A 1Q8IA 2O8EB 1QSYA 3AVGA 2V51B 1YJNN 1JLEA 1VQNN 1XQSC 4K41A 1YUWA 2Z1IA 4FL9A 3QEIA 2NRVA 1WAFA 3K57A 3ZSWA 4C8OA 3CYMA 2P51A 3FR0A 2W40A 5KI6A 4W5OA 3AAQA 4BDZA 1TUYA 1JKHA 3KVGA 1S72N 3NH2A 2G8WA 1XMOK 1U4BA 4LFBK 5KGWA 2FSNA 1KAYA 2NZTA 1WBBA 3OS1A 1NLVA 1T7PA 2ZJRL 4CZGA 2V7ZA 3W3DA 1OKJA 4EP5A 5KRSA 3VGLA 2UU9K 3CPEA 3AY9A 1NGJA 3QBXA 4DV4K 4JYAK 2UUAK 4CEEA 1RT7A 4UQGA 4RTFD 1BUPA 1CZAN 4B1XB 3A5MC 4FM0A 3VQAA 5JLFA 4CGGA 4FWPA 3CCMN 4BR4A 4CJEA 3WNEA 3WNHA 1QZ6A 4CK3A 1MWKA 2Z1JA 4FOIA 1RTHA 3MXMA 4UY8O 1V4SA 1XWLA 4DQIA 4BY9C 3MEEA 3ZT4A 3PO5A 1NGHA 1NK7A 2E6MA 3ZSVA 1EP4A 3C0BA 1TK5A 2CGJA 2FBYA 5ELZA 1BDGA 2KQ2A 4CHPA 1HYVA 3CC4N 1NMNA 1X9SA 3K5OA 4AM6A 4W5NA 4LF7K 4BR0A 4O55A 3V1OA 4KHPK 2W6LA 1VSJA 3CQYA 3O3HA 3I8BA 3ZT1A 1VRUA 5M1QA 1W2BM 4B8CA 4IG3A 1T05A 4HWIA 3ASMA 1NGEA 3SUNA 3TWHA 1HPMA 3J80O 2VG5A 1KFSA 4MDAA 3T69A 4CJWA 4OPKA 4BRKA 3SMPA 4A2BA 3OYFA 5C2FA 4JRQA 1WSHA 4CEQA 3NFAA 3KLGA 3CJ7A 3ZX2A 1GLEG 5KQ8A 1LAWA 1L3UA 5DK5A 4FLTA 4DV0K 5GADP 1F21A 1I3AA 3L2VA 3WXMB 3VEXA 4FJKA 3IAYA 4YOTA 4LFCK 4DS4A 3AVAA 4I9LA 2Y1JA 3VTIA 5CYMA 2G8UA 3EE9A 3J7ZO 3TARA 3TSPA 1HNIA 1QQCA 3QEVA 4EAHD 1J6ZA 4BC2A 1RBTA 3K5LA 2A6AA 3CC2N 1DLOA 1KAXA 1VAZA 3ID6A 3O8MA 3M8RA 1NGCA 1ASWA 3DOKA 3HTVA 4M3RA 1MWMA 5KPZA 3CCJN 4JS5A 4AQYK 2ZWHA 3OBWA 3LP2A 5FPNA 4FJMA 4DR7K 4IWVA 4DTUA 1QZ5A 2HNDA 5AQUA 1HYSA 1RT2A 3LWMA 4PL8A 2IVOA 4BG9A 3NH0A 4YOXA 4KH6A 2KW4A 4DR1K 2QXLA 4KH5A 1WB9A 3BGRA 4JV5K 3GOIA 4BWMA 3LDSA 3DLEA 1K9MO 5FRNA 3KWGA 3AO3A 4F2SA 4BR5A 5AQNA 3VESA 3H3NO 4PWDA 4BRFA 2BUPA 2GUPA 3PUFA 3RMBA 3V9XA 1XHZA 1WNSA 1Z6RA 3RTVA 5KPTA 1RTDA 4F3OA 4OGEA 3KHYA 4FOEA 3VPZA 4I7FA 3WNFA 2QTDA 2VYPA 3M3ZA 4RG8A 3SQ1A 3U9DA 2KKZA 3VENA 2ETJA 1JLQA 3SAHA 3RR7A 4IJAA 3TAMA 4DR6K 1BIUA 4HTLA 4LF8K 4YDUC 3MXIA 4B9MA 3IDHA 3VGMA 2UUCK 3MX5A 1EXQA 1WAJA 3VQCA 5JLHA 4N56A 3OYMA 4O5BA 4ILJA 1HRHA 3OYKA 3MXJA 1RBVA 1YT3A 1U48A 4FWKA 1A5XA 3LDQA 4R79A 1ZBFA 2QWPA 4RW4A 3VF6A 4M41A 2P5OA 2A5XA 3S41A 3V9WA 4FZXC 1REVA 4M3ZA 1SKWA 4CJ4A 4FLWA 2D0OA 4OX9K 5J2MA 4CD3A 3A2FA 3IS9A 5JVHL 4B1YB 3O9TA 1R0AA 4A2AA 2VG7A 1YITN 4MDBA 3IUCA 1OH6A 4IEIA 1TAUA 1GLLO 1NMDA 5AZJB 3J7YP 3VQPA 3B8AX 4CK1A 1SZ2A 3NGIA 3E9OA 1ZC6A 2A3ZA 4LF4K 5AQJA 2WOMA 4J2DA 1LW0A 4AF1A 3FE1A 2P9PA 3LP1A 1W9HA 5BR8K 1N32K 2AA4A 5AZJA 3THXB 4JD2B 1OVQA 2PBDA 1HLUA 1IKWA 2FXUA 1JXBA 4OPHA 3THXA 3BZCA 3I33A 1Y97A 4JD2A 1IG8A 3IKMA 4OKJA 4E3SA 4CZKA 4CZHA 3TSQA 4GV9A 4Z4GA 1S9EA 3LPUA 1E4GT 4KHSA 4FWNA 4C8NA 3Q7CA 1J5EK 1VQ7N 1ATNA 4W5TA 1RCHA 4FVUA 3P31A 3SUPA 2G8KA 4N5SA 2X6SA 4PHTX 4M42A 3SUOA 5EY4A 4FJGA 2OCEA 2P9LB 3O4NA 2XY8A 3KK2A 2ZGZA 3MN7A 4F2RA 1RBRA 2GTDA 2NRTA 3AVIA 4CJ3A 3F9MA 2P9LA 1NK0A 3BZKA 3L2RA 3SQ2A 5HP1A 4IG0A 3TAQA 4J8FA 4H5NA 1ITGA 4O0IA 3IRXA 3JAMO 2YHWA 3CJAA 3PSIA 4JHDA 4CHNA 4NCBA 2NRRA 2DFHA 4JI0K 4NYNA 4X62K 3OYEA 4HUFA 3OYGA 3I0RA 2QM1A 4DMNA 4PKIA 4FLVA 3CCEN 4XH4A 2D0AA 3ZEUA 4LD0A 4IO8A 4JI7K 3VEZA 5BRHA 1FKPA 2W6KA 1N6QA 2P9KB 3HOSA 4RW7A 4DTNA 1U2VB 5B8HA 4H0XB 3OYAA 3KLIA 3D45A 3DXKA 3PX4A 2DFFA 3UKRA 3SJHA 3RSEA 2P9KA 4DQSA 3NAEA 4CF0A 3CG7A 3LDPA 3O9SA 4H5TA 3S9HA 2F9TA 2JWLA 4DB3A 3WXIA 4KKOA 3CJCA 5GAHP 1NGBA 1VQ5N 5HROA 4ZTFA 1D9FA 2QXFA 2ASOA 1S1UA 3CIPA 4H0VB 3HVTA 4I6MB 3U3YA 2Q3SA 1NKCA 3QFUA 1HYZA 3ZSOA 4CJVA 1IO2A 4YY3K 1RBUA 5ADXH 2F8SA 4BVPA 5HRSA 3L6QA 3ZX0A 4DTMA 2KHOA 3QEXA 3M8SA 3SQ0A 1S6QA 4IOXA 4OLAA 1YJWN 4KPYA 2FLOA 2GWKA 5BPNA 3CXCM 4XEIA 2G8IA 3BUZB 3CMAN 1V4TA 4FWRA 4N76A 3B6PA 4GVEA 3OJSA 4KRFA 2HHUA 4CGJA 2VGMA 5AQMA 1VSLA 1U47A 3K9KA 4CK2A 5HL7L 3K2PA 2HBKA 2VWJA 4KHYA 4E7HA 1HNWK 2YNGA 4DSFA 2UYTA 5JS2A 3P1GA 3CCLN 3VQEA 4CF9A 4FWMA 4CEFA 4CEOA 4KI6A 3K58A 4FJLA 1GLBG 3S3MA 3CCQN 4GV6A 3IMXA 1X3NA 3U4LA 3KLHA 3G71N 3LANA 4PKGA 2X6NA 3H45C 3OW2M 4DV1K 4QS8A 3TAPA 4U7BA 3EL2A 3HBTA 1GLJO 4QCLA 2FSJA 4CESA 4XH1A 1UWBA 1KSPA 1YVNA 3WNGA 3V9ZA 2XRIA 2RHKA 5EX5A 4CZIA 1CXUA 1N33K 2FSKA 1SUQA 2KLAA 2AP1A 3VQ5A 1M1KO 3M5RA 3SPYA 3AO4A 4CZMA 3AAPA 3RRGA 1BWFO 4DU4A 1LAVA 3HT3A 4CEDA 4IOCL 1VQ6N 3F73A 1T44A 1KQSM 1C1CA 3FLCO 4JKDA 4FK0A 2DTUA 2XY7A 4CBWA 4YOVA 4HCBA 3SBGA 4JKAA 3KK1A 1FW6A 2EWSA 4CZEA 4E89A 3KTQA 5GAGP 1IKYA 2IVPA 2Q0RA 5AQWA 4K25A 1N36K 3LAKA 4DSEA 4DS5A 1YTUA 2Z1HA 1JLBA 2BE2A 4DHYA 3VGKA 1EO1A 3R1XA 3ZT3A 1XHXA 1D8YA 3P5JA 3C65A 3KZBA 1NGDA 3ULDA 1I39A 4BC4A 4NB4A 4OO1J 2UXBK 5CR4A 3DJCA 4JKFA 3LDOA 5LY3A 3CFRA 4JI3K 2O8EA 3CERA 3DLRA 5KRTA 4IKFA 4G1QA 3D7EO 3EY1A 1L3SA 3ENOA 2FF6A 4FXDA 3RMCA 4Z4IA 4FSVA 2PYLA 3O6WA 1T6CA 4WYBA 4IZ9A 1O1WA 2CGKA 3AA5X 4DF4A 4JKBA 4H5VA 4EHUA 1XI1A 1ZBIA 4WFBL 1TKXA 4M45A 3NF7A 1W7AA 1RILA 4CEAA 2PYJA 1SAZA 4C23A 1HR0K 5FROA 3EKUA 1BISA 3FZMA 3OYLA 4CW7B 4ID5A 2NRXA 4EIAA 3QEPA 4H03B 2OZMA 1WSGA 3I0SA 3J8AA 1TVRA 1T03A 4O4GA 3VQ9A 3HPHA 4W5QA 2F96A 4IO9L 3HXMA 4I2QA 2Y1IA 4KH4A 1JJ2M 5CZ2A 3QDKA 4AHSA 3FZHA 3SV4A 1WN7A 1B92A 1ILYA 3AVBA 2OPQA 1X9WA 3CJ1A 4KFBA 4KHUA 1BGXT 5CZ1A 3MX2A 3K5NA 1P8ZA 4IDKA 3THVA 2YNHA 3CF5L 2HOEA 4JS4A 5AQXA 1LOTB 1RDAA 3SQ4A 4DTRA 2HNYA 3TAGA 1NK5A 4PUOA 2E5LK 5DM6L 4F4KA 4RW9A 3OYCA 5HRPA 1ZXOA 4QAGA 1HKCA 4NLCA 1NM1A 4O8KA 2P9NB 2QWRA 4Z4FA 4DU1A 4JLHA 2UXCK 1QVFM 1EWRA 5BN9A 4GVMA 3EYZA 2G8FA 3OVNA 1C0FA 3OYBA 4DU3A 5TKYA 5I3UA 4YHHK 3RMDA 1RT5A 2GX9A 2P9NA 4M63C 1C0UA 5FPEA 1NG9A 2GEMA 1KFDA 4NCGA 5HRNA 2OPSA 1ZBSA 4PKHA 4XH5A 4B3MK 4JKCA 3TPQA 1RDUA 3QIPA 4BROA 3P39A 1HNZK 1BL3A
chains in the Genus database with same CATH topology
3P83D 1EKEA 2YNFA 2IC3A 2B5JA 1B9DA 4CJ4A 5J1EA 4FLWA 1SL2A 2HMIA 5J2MA 3PO4A 3LAMA 3G0ZA 5E41A 1NK6A 4B3OA 4CCHA 3A2FA 1RBSA 3G10A 3IS9A 1BQNA 2HVIA 1R0AA 1GOBA 4O44A 1JLCA 3OY9A 3OJUA 1CZ9A 1Z26A 2VG7A 3VQ8A 4XIUA 4C8LA 4E7LA 1TAUA 1VSHA 4CIGA 4FM2A 1TKZA 3CFOA 3QO9A 4IFVA 4BE0A 3VQPA 1Z25A 2ZQBA 3ZSZA 1VSFA 4CK1A 3NGIA 2LSNA 2YKMA 3DLGA 2DY4A 2FBXA 3QESA 5C42A 3AVLA 1W0HA 2WOMA 4CJKA 3NCIA 1LW0A 1VSKA 4FW1A 1ZBLA 3O4QA 3DLKA 3V4IA 1N5YA 3PX6A 3O3GA 3OYHA 4B9LA 2ZE2A 3AVFA 4CERA 3K5MA 1NJZA 3LP1A 1W9HA 3NBPA 3OYDA 3OS2A 2O4GA 3OS0A 1VSDA 3V9UA 5DMRA 4DFPA 4FJIA 3CM5A 4FLZA 4CGFA 5HBMA 4B9VA 1QS4A 3NF6A 5C25A 5I42A 4KHUA 2OPPA 1IKWA 2FC0A 4KV8A 2EX3A 1QSSA 4AILC 1RNHA 1S1VA 1JXBA 3PY8A 1NKEA 4N41A 1TL1A 1SKSA 1Y97A 2IGIA 1IKXA 1BIZA 4LY7A 4OKJA 3MEGA 4CFDA 4CJTA 4E3SA 3V81A 4C8KA 2F8TA 2KFZA 4CF2A 3TAFA 1B9FA 1NJYA 4J2AA 3B6OA 1NK8A 4Z4GA 1TV6A 1IKVA 3QIOA 1S9EA 4M3XA 3LPUA 2HHVA 4KHSA 4J2EA 1DTQA 4DLGA 4C8NA 4BDPA 4FLYA 1KVBA 4KO0A 5C24A 1RCHA 3VQBA 4W5TA 2O4IA 1HJRA 4Q5VA 2G8HA 4EZ6A 4M3WA 3SUPA 4DSKA 3U3GA 4CHZA 1L5UA 2QKKA 2G8KA 1BCMA 4N5SA 2X6SA 2KZZA 5CY4A 1A5WA 1C1AA 1HNVA 4Z0UA 3ZSXA 2A1RA 1LV5A 4M42A 1FKOA 3SUOA 1RDCA 1X1PA 4FJGA 3AV9A 3AO5A 2ITGA 5FDLA 3SYZA 2B6AA 3CM6A 3NGYA 3NDKA 3AO2A 4OKEA 1WSFA 2XY5A 2RPIA 4LH5A 1BCOA 5FRMA 2QK9A 4DSLA 4DTOA 2KFNA 3AVHA 3O4NA 1TGOA 1VSMA 3VQDA 2XY8A 3KK2A 4HTUA 4Y1CA 2P1JA 4E7IA 1TK0A 3DOLA 4F2RA 1KVAA 1S1WA 1RBRA 4DSJA 1HQEA 3M8PA 3QNOA 1L3TA 3HK2A 3AVIA 4DTPA 4CHOA 4CJ3A 2KTQA 4YNQA 1J54A 1NK0A 1LWFA 1L3VA 1LWCA 2FBTA 3L2RA 3SQ2A 5HP1A 4DSIA 3LZIA 4IG0A 2KZMA 3TAQA 1JLFA 2JGUA 4C8MA 1ITGA 3NH1A 4FLXA 4DTJA 4O0IA 1QTMA 3IRXA 4CHNA 3OYJA 4NCBA 2DFHA 3MECA 3L2UA 3RWUA 4NYNA 3OYEA 3CQ8A 1IH7A 3VA3A 1U45A 4HUFA 2B4JA 4AHCA 4CHYA 3OYGA 4DQQA 3SCXA 4DF8A 1NOYA 4FJ7A 4E1MA 4QOZB 3I0RA 4CGDA 4CGHA 4JRPA 3M8QA 4DMNA 4OKKA 3EZ5A 4FLVA 2QKBA 1Q9YA 3AVMA 2D0AA 1IG9A 4LD0A 4M3UA 3T3FA 2RF2A 1FKPA 2OA8A 3HL8A 1N6QA 4PY5A 3DMJA 4FW2A 4RW7A 4DTNA 3T19A 4TSXA 4CIEA 1ZYQA 1NKBA 3AVJA 3OYAA 1XC9A 3KLIA 3D45A 4CJ5A 2HB5A 1ASUA 1RTIA 3NF8A 5KTQA 3PX4A 2DFFA 4DG1A 4KB0A 4GW6A 4CF8A 3PV8A 4WE1A 1SL1A 4DQSA 3NAEA 1YVUA 2X74A 4CF0A 3CG7A 2A1SA 3CFPA 4AHUA 5J2NA 2PZSA 1VRTA 3S9HA 3T1AA 4KI4A 3KKRA 3RMAA 1S1XA 1EETA 3DYAA 3TAEA 4DWIA 4OVLA 1QSLA 4FK2A 1UAXA 3LP3A 4I9QA 2IAJA 4KKOA 1VSEA 1NK4A 2BGGA 3L3VA 1LW2A 4FJ8A 4CIFA 3HPGA 4Q0BA 4CFAA 3RR8A 2X78A 3AA4A 2R7YA 5HROA 4FVMA 4ZTFA 1D9FA 3BDPA 2QXFA 3KK3A 1S1UA 2HW3A 4LH4A 3HVTA 3KLEA 4FJHA 3U3YA 2Q3SA 1NKCA 3ZSOA 1HYZA 4CJVA 4PA1A 3LALA 4B9NA 1IO2A 1Q8IA 2XO7A 4HHTA 1RBUA 1QSYA 2F8SA 3H08A 5HRSA 3AVGA 4AHVA 3SPZA 1HPZA 1JLEA 1RT6A 4ID1A 3NF9A 4FCYA 4ELUA 3HYFA 2HHWA 4DTMA 3QEXA 3M8SA 4KHWA 3SQ0A 4K8ZA 1S6QA 2Z1IA 4E7JA 1C0TA 1QE1A 2IOCA 3QEIA 4C8OA 1GOCA 1WAFA 2BANA 3ZSWA 3NE6A 3K57A 4OLAA 3CYMA 4KPYA 2P51A 4CJSA 2WONA 2YNIA 4OJRA 5KI6A 4W5OA 5HRRA 2Z1GA 2G8IA 1ZBHA 4CJPA 4OLBA 3ALYA 2NUBA 4BDZA 4ELVA 3I8DA 1JKHA 4AHRA 3JSMA 1J5OA 4N76A 4CEZA 1VSIA 3VA0A 3B6PA 3OJSA 4KRFA 3QLHA 3NH2A 2G8WA 2HHUA 1JXEA 3S3OA 3JYTA 1KCFA 1U4BA 4CGJA 3V6DA 4FJXA 1BI4B 1JLGA 1WSEA 3QERA 4Z4EA 5KGWA 3VN5A 3V9SA 1VSLA 4PQUA 3F9KA 1U47A 1S9GA 3ITHA 4CJLA 3OS1A 1RDBA 3SNNA 2HHSA 4CK2A 1T7PA 2RKIA 3K2PA 5CYQA 5J2PA 1UA0A 4EP5A 2GV9A 5KRSA 2VWJA 4E7HA 4KHYA 3AO1A 2YNGA 3TABA 4DSFA 1BI4A 5JS2A 5EU7A 3TANA 4CEEA 1RT7A 4UQGA 3SV3A 1TL3A 3P1GA 3VQEA 3ZSRA 4MQ3A 4O0JA 1T8EA 2AJQA 4L8RB 4KTWA 1TKDA 4CF9A 4J2BA 4CEFA 1KRPA 4CE9A 4CEOA 4FM0A 4KI6A 3K58A 3VQAA 1NJWA 4CGGA 3K59A 4FJLA 3S3MA 4DLEA 4CJEA 4FM1A 3MEDA 3WNEA 4F8RA 4H8KA 3WNHA 4HCCA 4CK3A 2Z1JA 1U04A 4CECA 3SI6A 2HHQA 4EZ9A 2HHXA 2IDOA 3KLHA 3QNNA 4KHQA 3LANA 3HO1A 3U6FA 1RTHA 3MXMA 2X6NA 1XWLA 4F3TA 4DQIA 3MEEA 4K8XA 3ZT4A 3PO5A 3L2WA 5T7BA 3TAPA 1NK7A 2E6MA 3ZSVA 3DLBA 3IG1A 3C95A 2ZD1A 4QCLA 1EP4A 4ICLA 1C6VA 4KB1A 1TK5A 2FBYA 4CESA 2YHBA 1UWBA 4W5RA 3NGZA 1KSPA 4FZZA 1HQUA 1NOZA 3L3UA 3WNGA 3V9ZA 3C6TA 1RT4A 2KQ2A 2XRIA 4DTXA 4B9SA 1DTTA 4H4OA 4FJ9A 4CHPA 1HYVA 1CXUA 4RW8A 3LP0A 3AA3A 1X9SA 4KTQA 3K5OA 1SUQA 3QINA 3E01A 3DRRA 5KGXA 3VQ5A 4W5NA 1NK9A 4DFKA 4O55A 2D0BA 3HPOA 2YKNA 3SPYA 3V1OA 1SL0A 3AO4A 4FJNA 3KKSA 3RRGA 1VSJA 1CLQA 3O3HA 3O3FA 4DU4A 3ZT1A 1LAVA 3HT3A 4KREA 1VRUA 4CEDA 1RT1A 1UA1A 4AH9A 4R5PA 4B8CA 4IBNA 4IG3A 2XHBA 1MU2A 3F73A 4BE2A 1T05A 3ASMA 1C1CA 3TWHA 3SUNA 4FK0A 4M3YA 2VG5A 4DFMA 2DTUA 4DTSA 1KFSA 1A5VA 1K6YA 2XY7A 4J2DA 4CJWA 4HCBA 4OPKA 4FK4A 3KK1A 1S5JA 3V1RA 3QETA 3ZT0A 4E89A 1TKTA 4BACA 3SJJA 4E19A 3KTQA 3OYFA 4CJQA 1S6PA 3QEWA 1J53A 1IKYA 1D5AA 1WSHA 4JRQA 4CEQA 3NFAA 3KLGA 4E7KA 2OZSA 3LAKA 2I5JA 2JLEA 4H4MA 4Z4CA 4FYDA 4DSEA 4DS5A 4B9TA 1YTUA 2Z1HA 1JLBA 2BE2A 3DI6A 4E1NA 2BDPA 1LAWA 5JS1A 3ZT3A 2ATQA 4HVJA 1NJXA 1L3UA 1XHXA 2D0CA 1D8YA 4DQRA 5DK5A 4FLTA 3P5JA 1BQMA 1D9DA 4MFBA 1WSJA 1I39A 1HMVA 3ULDA 4KAZA 4DQPA 3KD5E 1F21A 1I3AA 3ZSQA 3L2VA 4FJKA 4AHTA 3NHGA 3IAYA 1U49A 3C6UA 3DRSA 4DS4A 3CFRA 3AVAA 5SWMA 5SZTA 4I9LA 3DLRA 2Y1JA 4IFYA 5KRTA 3HVRA 5CYMA 4IKFA 2G8UA 3HP6A 4G1QA 4M3TA 3TARA 3KJVA 3EY1A 1L3SA 3AA2A 1HNIA 3VQ4A 1WLJA 3TR8A 4DFJA 1Q9XA 1QQCA 4FXDA 2YV0X 4OGCA 4B9UA 3LWLA 4BDYA 1ASVA 4Y1DA 3QEVA 4FJ5A 1YTAA 1RBTA 4OPJA 2W42A 4GMJB 3K5LA 1DLOA 1GOAA 3RMCA 2PYLA 4Z4IA 2HVHA 1EX4A 4LSLA 4LSNA 1RT3A 2E4LA 3M8RA 1O1WA 3AA5X 1ASWA 3DOKA 1TK8A 4M3RA 4DF4A 1XI1A 2DFEA 1ZBIA 4JS5A 3LPTA 1TKXA 2FBVA 1FK9A 5D3GA 4M45A 3NF7A 2P5GA 1RILA 3LP2A 4CEAA 2PYJA 4FJMA 4FLUA 2PY5A 4DTUA 2HNDA 5FROA 3OYLA 1BISA 1TAQA 1RT2A 1HYSA 1RDDA 4ID5A 3LWMA 4BE1A 4CEBA 4CHQA 3L2QA 3TI0A 4RW6A 4ZHRA 3NH0A 3QEPA 1BHLA 1KVCA 1QHTA 2KW4A 1J9AA 2OZMA 4N47A 1WSGA 2VG6A 4KTZA 1C1BA 1CZBA 3I0SA 1KTQA 1G15A 1TVRA 3BGRA 1T03A 4O4GA 3VQ9A 3HPHA 4W5QA 2F96A 1JLAA 3KIOA 1KLNA 2OYQA 3D0PA 1SKRA 4BWMA 4E0DA 4B8AB 3HXMA 4I2QA 3LDSA 2Y1IA 2GBZA 1FXXA 3DLEA 5CZ2A 3V1QA 5FRNA 3AVCA 4AHSA 3HJFA 3AO3A 3SV4A 3ZT2A 1WN7A 1B92A 1JL2A 4F2SA 2OPRA 3MAQA 4FZYA 3AVBA 4ELTA 4NYFA 2OPQA 3SZ2A 2HHTA 2RN2A 1X9WA 4KFBA 4KHNA 4PWDA 3KD1E 1BGXT 3PUFA 5CZ1A 3KLFA 3DLHA 3RMBA 4CJRA 3V9XA 3K5NA 4IDKA 3THVA 1XHZA 1WNSA 3RTVA 2YNHA 1RTDA 4F3OA 3SUQA 4JS4A 3AVKA 1RDAA 3ZCMA 4OGEA 3SQ4A 2EHGA 2VWKA 2HNYA 3ZSYA 4CJUA 4HUEA 4DTRA 4I7FA 2YHAA 3WNFA 3TAGA 1NK5A 2HNZA 4CF1A 4PUOA 5J2QA 4NCAA 1CXQA 4RG8A 3SQ1A 4F4KA 4RW9A 4BWJA 5HRPA 3OYCA 3S3NA 1VK0A 3L8BA 1UOCA 4CJFA 2G8VA 2ETJA 2GUIA 4QAGA 1JLQA 3LZJA 2XY6A 3RR7A 3TAMA 3AVNA 1BIUA 4Z4HA 4CFBA 3MXIA 4Z4FA 4DU1A 4B9MA 3RRHA 4JLHA 3VQCA 1EXQA 1WAJA 3VQ7A 4N56A 3OYMA 1JL1A 4ZTJA 4EP4A 1ZBUA 3DM2A 1C0MA 4GVMA 3EYZA 2D5RA 3OVNA 2G8FA 3OYBA 4DU3A 3ISNC 4O5BA 5K14A 1S1TA 5I3UA 2E6LA 3RMDA 1RT5A 1C0UA 4B08A 1HRHA 4CFCA 3UIQA 1WSIA 1KFDA 4NCGA 5HRNA 2OPSA 1RTJA 3HP9A 1KLMA 3MXJA 3OYKA 3HM9A 1LWEA 1RBVA 3VQQA 1X9MA 4I2PA 1YT3A 3HSTB 1U48A 3C94A 1SV5A 3OYNA 4HUGA 1A5XA 4YFUA 1ZBFA 3FFIA 4RW4A 5HLFA 3QIPA 4M41A 2P5OA 4FJJA 3DRPA 4CGIA 3V9WA 4FZXC 3PX0A 2IS3A 1REVA 3VQ6A 1BL3A 4M3ZA 3OYIA 1SKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P83 D;  1EKE A;  2YNF A;  2IC3 A;  2B5J A;  1B9D A;  4CJ4 A;  5J1E A;  4FLW A;  1SL2 A;  2HMI A;  5J2M A;  3PO4 A;  3LAM A;  3G0Z A;  5E41 A;  1NK6 A;  4B3O A;  4CCH A;  3A2F A;  1RBS A;  3G10 A;  3IS9 A;  1BQN A;  2HVI A;  1R0A A;  1GOB A;  4O44 A;  1JLC A;  3OY9 A;  3OJU A;  1CZ9 A;  1Z26 A;  2VG7 A;  3VQ8 A;  4XIU A;  4C8L A;  4E7L A;  1TAU A;  1VSH A;  4CIG A;  4FM2 A;  1TKZ A;  3CFO A;  3QO9 A;  4IFV A;  4BE0 A;  3VQP A;  1Z25 A;  2ZQB A;  3ZSZ A;  1VSF A;  4CK1 A;  3NGI A;  2LSN A;  2YKM A;  3DLG A;  2DY4 A;  2FBX A;  3QES A;  5C42 A;  3AVL A;  1W0H A;  2WOM A;  4CJK A;  3NCI A;  1LW0 A;  1VSK A;  4FW1 A;  1ZBL A;  3O4Q A;  3DLK A;  3V4I A;  1N5Y A;  3PX6 A;  3O3G A;  3OYH A;  4B9L A;  2ZE2 A;  3AVF A;  4CER A;  3K5M A;  1NJZ A;  3LP1 A;  1W9H A;  3NBP A;  3OYD A;  3OS2 A;  2O4G A;  3OS0 A;  1VSD A;  3V9U A;  5DMR A;  4DFP A;  4FJI A;  3CM5 A;  4FLZ A;  4CGF A;  5HBM A;  4B9V A;  1QS4 A;  3NF6 A;  5C25 A;  5I42 A;  4KHU A;  2OPP A;  1IKW A;  2FC0 A;  4KV8 A;  2EX3 A;  1QSS A;  4AIL C;  1RNH A;  1S1V A;  1JXB A;  3PY8 A;  1NKE A;  4N41 A;  1TL1 A;  1SKS A;  1Y97 A;  2IGI A;  1IKX A;  1BIZ A;  4LY7 A;  4OKJ A;  3MEG A;  4CFD A;  4CJT A;  4E3S A;  3V81 A;  4C8K A;  2F8T A;  2KFZ A;  4CF2 A;  3TAF A;  1B9F A;  1NJY A;  4J2A A;  3B6O A;  1NK8 A;  4Z4G A;  1TV6 A;  1IKV A;  3QIO A;  1S9E A;  4M3X A;  3LPU A;  2HHV A;  4KHS A;  4J2E A;  1DTQ A;  4DLG A;  4C8N A;  4BDP A;  4FLY A;  1KVB A;  4KO0 A;  5C24 A;  1RCH A;  3VQB A;  4W5T A;  2O4I A;  1HJR A;  4Q5V A;  2G8H A;  4EZ6 A;  4M3W A;  3SUP A;  4DSK A;  3U3G A;  4CHZ A;  1L5U A;  2QKK A;  2G8K A;  1BCM A;  4N5S A;  2X6S A;  2KZZ A;  5CY4 A;  1A5W A;  1C1A A;  1HNV A;  4Z0U A;  3ZSX A;  2A1R A;  1LV5 A;  4M42 A;  1FKO A;  3SUO A;  1RDC A;  1X1P A;  4FJG A;  3AV9 A;  3AO5 A;  2ITG A;  5FDL A;  3SYZ A;  2B6A A;  3CM6 A;  3NGY A;  3NDK A;  3AO2 A;  4OKE A;  1WSF A;  2XY5 A;  2RPI A;  4LH5 A;  1BCO A;  5FRM A;  2QK9 A;  4DSL A;  4DTO A;  2KFN A;  3AVH A;  3O4N A;  1TGO A;  1VSM A;  3VQD A;  2XY8 A;  3KK2 A;  4HTU A;  4Y1C A;  2P1J A;  4E7I A;  1TK0 A;  3DOL A;  4F2R A;  1KVA A;  1S1W A;  1RBR A;  4DSJ A;  1HQE A;  3M8P A;  3QNO A;  1L3T A;  3HK2 A;  3AVI A;  4DTP A;  4CHO A;  4CJ3 A;  2KTQ A;  4YNQ A;  1J54 A;  1NK0 A;  1LWF A;  1L3V A;  1LWC A;  2FBT A;  3L2R A;  3SQ2 A;  5HP1 A;  4DSI A;  3LZI A;  4IG0 A;  2KZM A;  3TAQ A;  1JLF A;  2JGU A;  4C8M A;  1ITG A;  3NH1 A;  4FLX A;  4DTJ A;  4O0I A;  1QTM A;  3IRX A;  4CHN A;  3OYJ A;  4NCB A;  2DFH A;  3MEC A;  3L2U A;  3RWU A;  4NYN A;  3OYE A;  3CQ8 A;  1IH7 A;  3VA3 A;  1U45 A;  4HUF A;  2B4J A;  4AHC A;  4CHY A;  3OYG A;  4DQQ A;  3SCX A;  4DF8 A;  1NOY A;  4FJ7 A;  4E1M A;  4QOZ B;  3I0R A;  4CGD A;  4CGH A;  4JRP A;  3M8Q A;  4DMN A;  4OKK A;  3EZ5 A;  4FLV A;  2QKB A;  1Q9Y A;  3AVM A;  2D0A A;  1IG9 A;  4LD0 A;  4M3U A;  3T3F A;  2RF2 A;  1FKP A;  2OA8 A;  3HL8 A;  1N6Q A;  4PY5 A;  3DMJ A;  4FW2 A;  4RW7 A;  4DTN A;  3T19 A;  4TSX A;  4CIE A;  1ZYQ A;  1NKB A;  3AVJ A;  3OYA A;  1XC9 A;  3KLI A;  3D45 A;  4CJ5 A;  2HB5 A;  1ASU A;  1RTI A;  3NF8 A;  5KTQ A;  3PX4 A;  2DFF A;  4DG1 A;  4KB0 A;  4GW6 A;  4CF8 A;  3PV8 A;  4WE1 A;  1SL1 A;  4DQS A;  3NAE A;  1YVU A;  2X74 A;  4CF0 A;  3CG7 A;  2A1S A;  3CFP A;  4AHU A;  5J2N A;  2PZS A;  1VRT A;  3S9H A;  3T1A A;  4KI4 A;  3KKR A;  3RMA A;  1S1X A;  1EET A;  3DYA A;  3TAE A;  4DWI A;  4OVL A;  1QSL A;  4FK2 A;  1UAX A;  3LP3 A;  4I9Q A;  2IAJ A;  4KKO A;  1VSE A;  1NK4 A;  2BGG A;  3L3V A;  1LW2 A;  4FJ8 A;  4CIF A;  3HPG A;  4Q0B A;  4CFA A;  3RR8 A;  2X78 A;  3AA4 A;  2R7Y A;  5HRO A;  4FVM A;  4ZTF A;  1D9F A;  3BDP A;  2QXF A;  3KK3 A;  1S1U A;  2HW3 A;  4LH4 A;  3HVT A;  3KLE A;  4FJH A;  3U3Y A;  2Q3S A;  1NKC A;  3ZSO A;  1HYZ A;  4CJV A;  4PA1 A;  3LAL A;  4B9N A;  1IO2 A;  1Q8I A;  2XO7 A;  4HHT A;  1RBU A;  1QSY A;  2F8S A;  3H08 A;  5HRS A;  3AVG A;  4AHV A;  3SPZ A;  1HPZ A;  1JLE A;  1RT6 A;  4ID1 A;  3NF9 A;  4FCY A;  4ELU A;  3HYF A;  2HHW A;  4DTM A;  3QEX A;  3M8S A;  4KHW A;  3SQ0 A;  4K8Z A;  1S6Q A;  2Z1I A;  4E7J A;  1C0T A;  1QE1 A;  2IOC A;  3QEI A;  4C8O A;  1GOC A;  1WAF A;  2BAN A;  3ZSW A;  3NE6 A;  3K57 A;  4OLA A;  3CYM A;  4KPY A;  2P51 A;  4CJS A;  2WON A;  2YNI A;  4OJR A;  5KI6 A;  4W5O A;  5HRR A;  2Z1G A;  2G8I A;  1ZBH A;  4CJP A;  4OLB A;  3ALY A;  2NUB A;  4BDZ A;  4ELV A;  3I8D A;  1JKH A;  4AHR A;  3JSM A;  1J5O A;  4N76 A;  4CEZ A;  1VSI A;  3VA0 A;  3B6P A;  3OJS A;  4KRF A;  3QLH A;  3NH2 A;  2G8W A;  2HHU A;  1JXE A;  3S3O A;  3JYT A;  1KCF A;  1U4B A;  4CGJ A;  3V6D A;  4FJX A;  1BI4 B;  1JLG A;  1WSE A;  3QER A;  4Z4E A;  5KGW A;  3VN5 A;  3V9S A;  1VSL A;  4PQU A;  3F9K A;  1U47 A;  1S9G A;  3ITH A;  4CJL A;  3OS1 A;  1RDB A;  3SNN A;  2HHS A;  4CK2 A;  1T7P A;  2RKI A;  3K2P A;  5CYQ A;  5J2P A;  1UA0 A;  4EP5 A;  2GV9 A;  5KRS A;  2VWJ A;  4E7H A;  4KHY A;  3AO1 A;  2YNG A;  3TAB A;  4DSF A;  1BI4 A;  5JS2 A;  5EU7 A;  3TAN A;  4CEE A;  1RT7 A;  4UQG A;  3SV3 A;  1TL3 A;  3P1G A;  3VQE A;  3ZSR A;  4MQ3 A;  4O0J A;  1T8E A;  2AJQ A;  4L8R B;  4KTW A;  1TKD A;  4CF9 A;  4J2B A;  4CEF A;  1KRP A;  4CE9 A;  4CEO A;  4FM0 A;  4KI6 A;  3K58 A;  3VQA A;  1NJW A;  4CGG A;  3K59 A;  4FJL A;  3S3M A;  4DLE A;  4CJE A;  4FM1 A;  3MED A;  3WNE A;  4F8R A;  4H8K A;  3WNH A;  4HCC A;  4CK3 A;  2Z1J A;  1U04 A;  4CEC A;  3SI6 A;  2HHQ A;  4EZ9 A;  2HHX A;  2IDO A;  3KLH A;  3QNN A;  4KHQ A;  3LAN A;  3HO1 A;  3U6F A;  1RTH A;  3MXM A;  2X6N A;  1XWL A;  4F3T A;  4DQI A;  3MEE A;  4K8X A;  3ZT4 A;  3PO5 A;  3L2W A;  5T7B A;  3TAP A;  1NK7 A;  2E6M A;  3ZSV A;  3DLB A;  3IG1 A;  3C95 A;  2ZD1 A;  4QCL A;  1EP4 A;  4ICL A;  1C6V A;  4KB1 A;  1TK5 A;  2FBY A;  4CES A;  2YHB A;  1UWB A;  4W5R A;  3NGZ A;  1KSP A;  4FZZ A;  1HQU A;  1NOZ A;  3L3U A;  3WNG A;  3V9Z A;  3C6T A;  1RT4 A;  2KQ2 A;  2XRI A;  4DTX A;  4B9S A;  1DTT A;  4H4O A;  4FJ9 A;  4CHP A;  1HYV A;  1CXU A;  4RW8 A;  3LP0 A;  3AA3 A;  1X9S A;  4KTQ A;  3K5O A;  1SUQ A;  3QIN A;  3E01 A;  3DRR A;  5KGX A;  3VQ5 A;  4W5N A;  1NK9 A;  4DFK A;  4O55 A;  2D0B A;  3HPO A;  2YKN A;  3SPY A;  3V1O A;  1SL0 A;  3AO4 A;  4FJN A;  3KKS A;  3RRG A;  1VSJ A;  1CLQ A;  3O3H A;  3O3F A;  4DU4 A;  3ZT1 A;  1LAV A;  3HT3 A;  4KRE A;  1VRU A;  4CED A;  1RT1 A;  1UA1 A;  4AH9 A;  4R5P A;  4B8C A;  4IBN A;  4IG3 A;  2XHB A;  1MU2 A;  3F73 A;  4BE2 A;  1T05 A;  3ASM A;  1C1C A;  3TWH A;  3SUN A;  4FK0 A;  4M3Y A;  2VG5 A;  4DFM A;  2DTU A;  4DTS A;  1KFS A;  1A5V A;  1K6Y A;  2XY7 A;  4J2D A;  4CJW A;  4HCB A;  4OPK A;  4FK4 A;  3KK1 A;  1S5J A;  3V1R A;  3QET A;  3ZT0 A;  4E89 A;  1TKT A;  4BAC A;  3SJJ A;  4E19 A;  3KTQ A;  3OYF A;  4CJQ A;  1S6P A;  3QEW A;  1J53 A;  1IKY A;  1D5A A;  1WSH A;  4JRQ A;  4CEQ A;  3NFA A;  3KLG A;  4E7K A;  2OZS A;  3LAK A;  2I5J A;  2JLE A;  4H4M A;  4Z4C A;  4FYD A;  4DSE A;  4DS5 A;  4B9T A;  1YTU A;  2Z1H A;  1JLB A;  2BE2 A;  3DI6 A;  4E1N A;  2BDP A;  1LAW A;  5JS1 A;  3ZT3 A;  2ATQ A;  4HVJ A;  1NJX A;  1L3U A;  1XHX A;  2D0C A;  1D8Y A;  4DQR A;  5DK5 A;  4FLT A;  3P5J A;  1BQM A;  1D9D A;  4MFB A;  1WSJ A;  1I39 A;  1HMV A;  3ULD A;  4KAZ A;  4DQP A;  3KD5 E;  1F21 A;  1I3A A;  3ZSQ A;  3L2V A;  4FJK A;  4AHT A;  3NHG A;  3IAY A;  1U49 A;  3C6U A;  3DRS A;  4DS4 A;  3CFR A;  3AVA A;  5SWM A;  5SZT A;  4I9L A;  3DLR A;  2Y1J A;  4IFY A;  5KRT A;  3HVR A;  5CYM A;  4IKF A;  2G8U A;  3HP6 A;  4G1Q A;  4M3T A;  3TAR A;  3KJV A;  3EY1 A;  1L3S A;  3AA2 A;  1HNI A;  3VQ4 A;  1WLJ A;  3TR8 A;  4DFJ A;  1Q9X A;  1QQC A;  4FXD A;  2YV0 X;  4OGC A;  4B9U A;  3LWL A;  4BDY A;  1ASV A;  4Y1D A;  3QEV A;  4FJ5 A;  1YTA A;  1RBT A;  4OPJ A;  2W42 A;  4GMJ B;  3K5L A;  1DLO A;  1GOA A;  3RMC A;  2PYL A;  4Z4I A;  2HVH A;  1EX4 A;  4LSL A;  4LSN A;  1RT3 A;  2E4L A;  3M8R A;  1O1W A;  3AA5 X;  1ASW A;  3DOK A;  1TK8 A;  4M3R A;  4DF4 A;  1XI1 A;  2DFE A;  1ZBI A;  4JS5 A;  3LPT A;  1TKX A;  2FBV A;  1FK9 A;  5D3G A;  4M45 A;  3NF7 A;  2P5G A;  1RIL A;  3LP2 A;  4CEA A;  2PYJ A;  4FJM A;  4FLU A;  2PY5 A;  4DTU A;  2HND A;  5FRO A;  3OYL A;  1BIS A;  1TAQ A;  1RT2 A;  1HYS A;  1RDD A;  4ID5 A;  3LWM A;  4BE1 A;  4CEB A;  4CHQ A;  3L2Q A;  3TI0 A;  4RW6 A;  4ZHR A;  3NH0 A;  3QEP A;  1BHL A;  1KVC A;  1QHT A;  2KW4 A;  1J9A A;  2OZM A;  4N47 A;  1WSG A;  2VG6 A;  4KTZ A;  1C1B A;  1CZB A;  3I0S A;  1KTQ A;  1G15 A;  1TVR A;  3BGR A;  1T03 A;  4O4G A;  3VQ9 A;  3HPH A;  4W5Q A;  2F96 A;  1JLA A;  3KIO A;  1KLN A;  2OYQ A;  3D0P A;  1SKR A;  4BWM A;  4E0D A;  4B8A B;  3HXM A;  4I2Q A;  3LDS A;  2Y1I A;  2GBZ A;  1FXX A;  3DLE A;  5CZ2 A;  3V1Q A;  5FRN A;  3AVC A;  4AHS A;  3HJF A;  3AO3 A;  3SV4 A;  3ZT2 A;  1WN7 A;  1B92 A;  1JL2 A;  4F2S A;  2OPR A;  3MAQ A;  4FZY A;  3AVB A;  4ELT A;  4NYF A;  2OPQ A;  3SZ2 A;  2HHT A;  2RN2 A;  1X9W A;  4KFB A;  4KHN A;  4PWD A;  3KD1 E;  1BGX T;  3PUF A;  5CZ1 A;  3KLF A;  3DLH A;  3RMB A;  4CJR A;  3V9X A;  3K5N A;  4IDK A;  3THV A;  1XHZ A;  1WNS A;  3RTV A;  2YNH A;  1RTD A;  4F3O A;  3SUQ A;  4JS4 A;  3AVK A;  1RDA A;  3ZCM A;  4OGE A;  3SQ4 A;  2EHG A;  2VWK A;  2HNY A;  3ZSY A;  4CJU A;  4HUE A;  4DTR A;  4I7F A;  2YHA A;  3WNF A;  3TAG A;  1NK5 A;  2HNZ A;  4CF1 A;  4PUO A;  5J2Q A;  4NCA A;  1CXQ A;  4RG8 A;  3SQ1 A;  4F4K A;  4RW9 A;  4BWJ A;  5HRP A;  3OYC A;  3S3N A;  1VK0 A;  3L8B A;  1UOC A;  4CJF A;  2G8V A;  2ETJ A;  2GUI A;  4QAG A;  1JLQ A;  3LZJ A;  2XY6 A;  3RR7 A;  3TAM A;  3AVN A;  1BIU A;  4Z4H A;  4CFB A;  3MXI A;  4Z4F A;  4DU1 A;  4B9M A;  3RRH A;  4JLH A;  3VQC A;  1EXQ A;  1WAJ A;  3VQ7 A;  4N56 A;  3OYM A;  1JL1 A;  4ZTJ A;  4EP4 A;  1ZBU A;  3DM2 A;  1C0M A;  4GVM A;  3EYZ A;  2D5R A;  3OVN A;  2G8F A;  3OYB A;  4DU3 A;  3ISN C;  4O5B A;  5K14 A;  1S1T A;  5I3U A;  2E6L A;  3RMD A;  1RT5 A;  1C0U A;  4B08 A;  1HRH A;  4CFC A;  3UIQ A;  1WSI A;  1KFD A;  4NCG A;  5HRN A;  2OPS A;  1RTJ A;  3HP9 A;  1KLM A;  3MXJ A;  3OYK A;  3HM9 A;  1LWE A;  1RBV A;  3VQQ A;  1X9M A;  4I2P A;  1YT3 A;  3HST B;  1U48 A;  3C94 A;  1SV5 A;  3OYN A;  4HUG A;  1A5X A;  4YFU A;  1ZBF A;  3FFI A;  4RW4 A;  5HLF A;  3QIP A;  4M41 A;  2P5O A;  4FJJ A;  3DRP A;  4CGI A;  3V9W A;  4FZX C;  3PX0 A;  2IS3 A;  1REV A;  3VQ6 A;  1BL3 A;  4M3Z A;  3OYI A;  1SKW A; 
#chains in the Genus database with same CATH topology
 3P83 D;  3DLL L;  1EKE A;  2IC3 A;  2B5J A;  1IBL K;  5J1E A;  1RBS A;  4DUZ K;  4CZL A;  1BQN A;  2HVI A;  1GOB A;  4O44 A;  2VQE K;  3MDQ A;  1DEJ A;  1GLC G;  1Z26 A;  3VQ8 A;  4C8L A;  3CCR N;  4ISE A;  4DR5 K;  3CFO A;  4IFV A;  4BE0 A;  2ZQB A;  3ZSZ A;  2LSN A;  2DY4 A;  2FBX A;  3QES A;  1W0H A;  4CJK A;  3VET A;  1VSK A;  4YOY A;  2YJF A;  3PX6 A;  3O3G A;  3OYH A;  2ZE2 A;  1XC3 A;  3AVF A;  1NJZ A;  3K5M A;  3CJB A;  3NBP A;  1HUX A;  3OS0 A;  3OS2 A;  1VSD A;  3V9U A;  2JWK A;  1XMQ K;  3D2F B;  2A41 A;  1D4X A;  3CM5 A;  3TTF A;  3NF6 A;  5I42 A;  3F2K A;  2FC0 A;  4KV8 A;  4JK7 A;  1TL1 A;  4N41 A;  2FF3 B;  1OH7 A;  2I7N A;  3D2F A;  4CZF A;  4LY7 A;  2KFZ A;  4CFD A;  4C8K A;  1NJY A;  3B6O A;  1QQN A;  5GIP A;  1NGG A;  2HHV A;  4QS9 A;  3E9P A;  4DLG A;  4MLE A;  4BDP A;  1NJI O;  4KO0 A;  5C24 A;  4BRH A;  1HJR A;  4M3W A;  2UUB K;  1BA0 A;  1BCM A;  2OAN A;  2KZZ A;  2A1R A;  1C1A A;  4Z0U A;  3SYZ A;  3CM6 A;  2CH6 A;  5BPL A;  4OKE A;  2XY5 A;  5AJ3 K;  3O1W A;  1O13 A;  5FRM A;  3SMS A;  3THY B;  3AVH A;  2P1J A;  1S1W A;  3R6M A;  2F9W A;  1HQE A;  2QWN A;  5AFU H;  4JKG B;  3MK6 A;  2KTQ A;  1LWF A;  3OBY A;  4JKH A;  3VF2 A;  3SBT A;  3THY A;  3LZI A;  4BQZ A;  3I56 N;  3WUH A;  3NH1 A;  4DTJ A;  4JKG A;  4WQ5 A;  3WXL A;  3L2U A;  3E9L A;  5BRD A;  3CHW A;  1IH7 A;  2B4J A;  4CHY A;  4WQ4 A;  4Y0W A;  4FJ7 A;  3QML A;  2PAV A;  4QOZ B;  3M8Q A;  2QKB A;  4F9O A;  1IG9 A;  4GV3 A;  3T3F A;  2OA8 A;  4FW2 A;  4IDH A;  4TSX A;  3MN6 A;  3AVJ A;  4O5F A;  1XC9 A;  4B1W B;  3SAG A;  1BO5 O;  2E88 A;  4H0O A;  1EWQ A;  4B1V A;  1YVU A;  4JI8 K;  4KI4 A;  3RMA A;  2W41 A;  1S1X A;  1EET A;  3DYA A;  4OVL A;  1QSL A;  4FK2 A;  3EZW A;  4AM7 A;  4I9Q A;  1BU6 O;  2VCP A;  1NK4 A;  4E1J A;  3L3V A;  3SAF A;  5GAE P;  5AQQ A;  2X78 A;  4A61 A;  3BDP A;  2F4V K;  2HW3 A;  3HZ6 A;  3KK3 A;  3KLE A;  2OTL N;  4PA1 A;  2E1Y A;  1R59 O;  1S22 A;  4FO0 A;  5AQV A;  2ZF5 O;  4ID1 A;  3NF9 A;  4ELU A;  5AQO A;  3IFR A;  2I7P A;  4K8Z A;  4E7J A;  3HI0 A;  1C0T A;  2E8A A;  2QWO A;  3LDN A;  4BR9 A;  1GLF O;  3GE1 A;  2WON A;  5I9E B;  4OJR A;  5CHI A;  2HHH K;  3EN9 A;  5HRR A;  4CJP A;  4OLB A;  3ALY A;  2NUB A;  4AHR A;  4BGA A;  4CEZ A;  1VSI A;  3VA0 A;  3MN9 A;  3LM2 A;  1JXE A;  1KCF A;  1WSE A;  3QER A;  1S9G A;  3ITH A;  4CJL A;  5AQK A;  1RDB A;  3SNN A;  4LF6 K;  2RKI A;  5J2P A;  4NO7 A;  3WT0 A;  4BC3 A;  3TAB A;  3AGR A;  5HOO A;  1U6Z A;  2IVN A;  3ID8 A;  3WQT A;  1K8K B;  3OHR A;  3SV3 A;  1T8E A;  4BRC A;  2AJQ A;  3CJ9 A;  4MQ3 A;  4O0J A;  1NGF A;  5LJW A;  3O80 A;  4KTW A;  3CCV N;  1TKD A;  4J2B A;  3SK3 A;  1KRP A;  4CE9 A;  1YAG A;  2A40 A;  3O4W A;  2P9I B;  4EHT A;  2QWQ A;  1FJG K;  4DLE A;  4FM1 A;  1K8K A;  5BRF A;  4CEC A;  4K43 A;  3SI6 A;  3G6E N;  3W0L A;  5AQF A;  4JNE A;  1BG3 A;  5A2Q O;  4JKE A;  3GG4 A;  1KAZ A;  3C95 A;  1C6V A;  4KB1 A;  2YHB A;  5AQI A;  4W5R A;  1YI2 N;  2P9U B;  2ASM A;  4FZZ A;  1HQU A;  3EO3 A;  3U8X A;  3C6T A;  4H5R A;  4DTX A;  4B9S A;  4FJ9 A;  2YHY A;  4H0P A;  2QWL A;  3LP0 A;  4KTQ A;  3QIN A;  4OPA A;  5KGX A;  1QHA A;  1X3M A;  4DFK A;  3A5L C;  3FZL A;  2D0B A;  3OTO K;  1SL0 A;  4FJN A;  2ZJQ L;  4JAX A;  3KKS A;  1CLQ A;  1RT1 A;  4AH9 A;  3WEE B;  4BE2 A;  3ZET B;  3UB5 A;  4M3Y A;  4JI4 K;  4FK4 A;  4DV7 K;  1U2V A;  1S5J A;  1SQK A;  3V1R A;  3ZT0 A;  1TKT A;  3WEE A;  5IT9 O;  4CJQ A;  1S6P A;  2IIR A;  3ZET A;  1J53 A;  1Q86 O;  3MWT A;  4JI1 K;  4E7K A;  3L0Q A;  1MA9 B;  4Z4C A;  4H4M A;  4FYD A;  5FLX O;  4E1N A;  2BDP A;  2HBM A;  5JS1 A;  4JK9 A;  1NJX A;  4FWQ A;  4DQR A;  2O8D B;  4MFB A;  4GKK K;  1WSJ A;  3H3O B;  5AQY A;  4WFN L;  3N4P A;  4DQP A;  4B3T K;  1U49 A;  3C6U A;  4I6M A;  1IBK K;  3GBT A;  2QEX N;  3HSC A;  3O08 A;  3TSU A;  5SZT A;  4IFY A;  2O8D A;  3HVR A;  1Q18 A;  1TYQ B;  3KJV A;  1VQO N;  3AA2 A;  3VQ4 A;  2NNW A;  1WLJ A;  3TR8 A;  4DFJ A;  1Q9X A;  4OGC A;  2E2Q A;  2YJE A;  3LWL A;  1ASV A;  3HRG A;  4OPJ A;  2W42 A;  3PSF A;  5AFU A;  1GOA A;  1EX4 A;  2E4L A;  1TYQ A;  1TK8 A;  2O8C B;  3QB0 A;  1RFQ A;  2WC9 A;  4GNI A;  2DFE A;  3BY5 A;  3CQX A;  2FBV A;  2PY5 A;  4BRM A;  1TAQ A;  1RDD A;  4FPB A;  3NVK A;  1P90 A;  2D1K A;  5F1X A;  4BE1 A;  4CEB A;  4CHQ A;  3L2Q A;  3ATU A;  1TUU A;  4ZHR A;  1KVC A;  1QHT A;  3EE8 A;  4G9Z A;  1CZB A;  1G15 A;  4A5B A;  1KLN A;  1JLA A;  3D0P A;  1SKR A;  4E0D A;  2E2O A;  3FZK A;  3THW B;  1FXX A;  1Y64 A;  3V1Q A;  3ZT2 A;  2OPR A;  3MAQ A;  3SZ2 A;  2D4W A;  3VTH A;  4KHN A;  2Q1N A;  1KC8 O;  4IEE A;  3KLF A;  2HMP A;  4CJR A;  3THW A;  2HBL A;  1H1V A;  4YOU A;  4GKJ K;  1HNX K;  2O8B B;  1OH5 A;  2EHG A;  4CJU A;  4HUE A;  4DV3 K;  5F2R A;  1CXQ A;  4A59 A;  3VEY A;  4BRI A;  4LF5 K;  3S3N A;  3R9P A;  1VK0 A;  4CJF A;  5AZI B;  2G8V A;  3LZJ A;  5M1F A;  2XY6 A;  2O8B A;  2QI2 A;  1M90 O;  4Z4H A;  5GIN A;  3D2E B;  2DPN A;  1JL1 A;  5AZI A;  4EP4 A;  1C0M A;  2D5R A;  3VEV A;  2YI1 A;  2E6L A;  1BOT O;  4BG8 A;  3FZF A;  2ASP A;  4CFC A;  3D2E A;  1C0G A;  3UIQ A;  3HM9 A;  5AQL A;  3QBW A;  4M7X A;  3VQQ A;  1LWE A;  4K42 A;  4A62 A;  4I2P A;  3HST B;  4BRA A;  4HUG A;  5AR0 A;  3FFI A;  4IXC A;  4JEP A;  4FJJ A;  3O9Q A;  4CGI A;  3PX0 A;  5C10 A;  3VQ6 A;  1Z05 A;  4DQ8 A;  2HMI A;  3NVM A;  1JCG A;  3DXM B;  3VMF B;  3LAM A;  5E41 A;  1E3M A;  4B3R K;  3G10 A;  1JLC A;  3OY9 A;  3O5B A;  1Q82 O;  3VEO A;  1CZ9 A;  4C1N K;  1YXQ A;  3UKU B;  1GLA G;  2E20 A;  3PLA A;  3DXM A;  3FGU A;  1Q7Y O;  1TKZ A;  3QO9 A;  1EQY A;  4BGB A;  1VSF A;  2YKM A;  4PL7 A;  3NCI A;  1ZBL A;  4B9L A;  3O4Q A;  3DLK A;  3V4I A;  3UKU A;  4CER A;  3E1Y A;  3A0I X;  1HJO A;  3OYD A;  4ILG B;  2PFU A;  4BRL A;  5DMR A;  1NNE A;  4JI2 K;  2WFB A;  4FLZ A;  4CGF A;  4B1Z A;  1QS4 A;  5C25 A;  3G25 A;  2OPP A;  1QSS A;  3CI5 A;  2YHX A;  5AQR A;  3TTD A;  4YDU A;  3PY8 A;  1NKE A;  3MMV A;  2IGI A;  4DR3 K;  1IKX A;  1BIZ A;  4B9Q A;  3MEG A;  2Q97 A;  4CJT A;  2F7T A;  2ZJP L;  1B9F A;  1IKV A;  2ZM6 K;  4B1U B;  3GL1 A;  1KVB A;  3VQB A;  5BN8 A;  2O4I A;  4Q5V A;  1QQM A;  4DSK A;  3U3G A;  4CHZ A;  4DV2 K;  3BF3 A;  4QS7 A;  1HNV A;  1VQ8 N;  3GDQ A;  1LV5 A;  1RDC A;  3N4Q A;  2B6A A;  3AO2 A;  1ATS A;  1N34 K;  4LH5 A;  4BRD A;  2UXD K;  2QK9 A;  4DTO A;  4U67 L;  3QET A;  2V7Y A;  3VQD A;  1TK0 A;  4HTU A;  4Y1C A;  2E2P A;  3P4I A;  3DOL A;  3KK7 A;  4DTP A;  5E84 A;  4YNQ A;  1J54 A;  1L3V A;  5CE3 A;  2KZM A;  4BRG A;  1JLF A;  3QIC A;  5F0X A;  4C8M A;  3E66 A;  5ADX A;  4FLX A;  3ZLJ A;  2BH1 A;  3CPW M;  3OYJ A;  3QFP A;  3MEC A;  4DR2 K;  3CQ8 A;  1HKB A;  1U45 A;  4DQQ A;  3SCX A;  4DF8 A;  3TTC A;  5BPM A;  2QW9 A;  4CGD A;  4CGH A;  5JVG L;  1Q9Y A;  3CD6 N;  3AVM A;  4IOA L;  4M3U A;  5IWA K;  2RF2 A;  4X66 K;  1T6D A;  3DMJ A;  5LJV A;  1ZYQ A;  4CIE A;  1NKB A;  5KPR A;  3C6A A;  3RVC A;  4CJ5 A;  5AQG A;  3CME N;  4DG1 A;  4KB0 A;  4GW6 A;  2OTJ N;  1YF5 L;  3PV8 A;  3T7Z A;  1N8R O;  2A1S A;  3CFP A;  3LDL A;  2PZS A;  1VRT A;  3KKR A;  3OA9 A;  3TAE A;  4DWI A;  3ATV A;  2QA4 N;  3LP3 A;  2IAJ A;  4CJ7 A;  1LW2 A;  4FJ8 A;  4CIF A;  3HPG A;  3KD5 E;  3AA4 A;  3PIP L;  1GLD G;  3KWI A;  4LH4 A;  3LAL A;  3MN5 A;  4HHT A;  2VWB A;  1IBM K;  2BTF A;  3H08 A;  3LL3 A;  4M7Y A;  4AHV A;  3SPZ A;  1HPZ A;  4FCY A;  1RT6 A;  5E26 A;  2HHW A;  3HYF A;  3MCA B;  1HX1 A;  4KHW A;  1QE1 A;  2O8F B;  2IOC A;  1GOC A;  2BAN A;  3CC7 N;  1WOQ A;  3NE6 A;  4CD1 A;  2Q2R A;  4CJS A;  5JMV A;  5AQP A;  2YNI A;  4CBX A;  5FPD A;  2Z1G A;  4DKW A;  1ZBH A;  4NXM K;  4ELV A;  4V19 S;  3I8D A;  3JSM A;  1J5O A;  2O8F A;  2HBJ A;  1G99 A;  3QLH A;  3ZX3 A;  1NGI A;  3S3O A;  3JYT A;  4FJX A;  3V6D A;  4BR2 A;  1XNR K;  1BI4 B;  1JLG A;  4BC5 A;  4Z4E A;  3A8Y A;  1X9J A;  3VN5 A;  3ZYY X;  3V9S A;  4PQU A;  3F9K A;  2Q31 A;  2HHS A;  5CYQ A;  1UA0 A;  3K9J A;  2GV9 A;  4FPA A;  3M6G A;  3AO1 A;  1BI4 A;  4DUY K;  5EU7 A;  3A5O C;  3TAN A;  1TL3 A;  1VHX A;  3ZSR A;  5AQH A;  3VER A;  3HM8 A;  3WXK A;  4L8R B;  3T1H K;  1ESV A;  1NJW A;  3K59 A;  3MED A;  4IFE A;  4F8R A;  4H8K A;  4HCC A;  3DAW A;  1U04 A;  2HHQ A;  3MCP A;  3TU5 A;  1SS6 A;  4EZ9 A;  2HHX A;  2IDO A;  5M1K A;  1I94 K;  3QNN A;  4KHQ A;  3HO1 A;  1JCE A;  3U6F A;  5GIO A;  5AQS A;  4F3T A;  3SLC A;  1YIJ N;  2QWM A;  4K8X A;  3L2W A;  3UE5 A;  5T7B A;  3DLB A;  3IG1 A;  4KBO A;  2ZD1 A;  4ICL A;  3NGZ A;  1NOZ A;  3L3U A;  2J4R A;  2P9S B;  1RT4 A;  1DTT A;  4H4O A;  4BQL A;  4RW8 A;  3AA3 A;  3AGK A;  3E01 A;  3DRR A;  1NK9 A;  4FWS A;  5AQZ A;  5BR9 A;  3HOT A;  1NGA A;  3HPO A;  2YKN A;  3BP8 A;  2E2N A;  3H6E A;  3R3L A;  2P9S A;  4JK8 A;  3O3F A;  4KRE A;  1UA1 A;  4R5P A;  3ENB A;  4IBN A;  2XHB A;  1MU2 A;  4JN4 A;  4A57 A;  2CH5 A;  2V52 B;  2D0P A;  4DFM A;  1VQK N;  4BRQ A;  4DTS A;  1A5V A;  1K6Y A;  2GWJ A;  3P38 A;  1BA1 A;  3CET A;  4BAC A;  3SJJ A;  4FWL A;  4E19 A;  3QEW A;  4BRP A;  1D5A A;  4JI6 K;  3AAR A;  3J81 O;  2OZS A;  2I5J A;  2JLE A;  3C6H A;  2VGN A;  1VQ4 N;  4B9T A;  5KQD A;  3I55 N;  3DI6 A;  4EFH A;  2ATQ A;  1OVY A;  5M1P A;  4HVJ A;  2D0C A;  3U9Z A;  1BQM A;  1D9D A;  3ULE B;  1HMV A;  1Q81 O;  4KAZ A;  3ZSQ A;  5LMN K;  4AHT A;  3NHG A;  1QVG M;  3DRS A;  1WUA A;  4LFA K;  5SWM A;  2YX6 A;  2P9P B;  1XUP O;  3Q7B A;  3HP6 A;  3ULE A;  3VOV A;  4M3T A;  2WTU A;  3R8E A;  5M1O A;  2H3G X;  1DT9 A;  2YV0 X;  5TKW A;  4B9U A;  4BDY A;  4Y1D A;  4FJ5 A;  1YTA A;  4GMJ B;  2HVH A;  3JS6 A;  4LSL A;  4LSN A;  1RT3 A;  2NRZ A;  4RCH A;  3LPT A;  1WBD A;  5D3G A;  1FK9 A;  4WF9 L;  2P5G A;  2ITM A;  4FLU A;  3VEW A;  4DCH A;  4X65 K;  5LL6 Z;  2HF4 A;  3TI0 A;  4RW6 A;  3JXU A;  1BHL A;  5EOY A;  1J9A A;  4BR7 A;  4N47 A;  2VG6 A;  4KTZ A;  1C1B A;  1KTQ A;  5MLC Q;  3KIO A;  2OYQ A;  5AQT A;  4B8A B;  4BRE A;  2GBZ A;  5M1N A;  2YCH A;  3AVC A;  3HJF A;  1NBW A;  2P9I A;  4O8U A;  1IJJ A;  1JL2 A;  4FZY A;  4ELT A;  4NYF A;  4A5A A;  2HHT A;  2RN2 A;  3KD1 E;  3DLH A;  3M1F A;  4CI6 A;  1VQM N;  1HKG A;  3O9R A;  3SUQ A;  3AVK A;  3ZCM A;  4X64 K;  2VWK A;  5H1S Q;  3ZSY A;  2YHA A;  2HNZ A;  4CF1 A;  1VQP N;  4JHD B;  3BEX A;  5J2Q A;  4NCA A;  1T3V A;  3FFK B;  2NRH A;  4NXN K;  4BWJ A;  3L8B A;  1UOC A;  2GUI A;  1NWK A;  4NLB A;  2P9U A;  3AVN A;  4GY2 B;  3A5N C;  4CFB A;  3G4S N;  1ATR A;  3RRH A;  3ENH A;  3C7N B;  3ZEU B;  3VQ7 A;  3CCS N;  3F5T A;  4ZTJ A;  1ZBU A;  3DM2 A;  3DWL A;  1OH8 A;  4WFA L;  3ISN C;  5K14 A;  1S1T A;  1KD1 O;  4YOR A;  4B08 A;  3DXK B;  1LCU A;  1WSI A;  3C7N A;  3HP9 A;  1RTJ A;  1X9M A;  1KLM A;  3UKR B;  3RSE B;  3C94 A;  1SV5 A;  3OYN A;  4YFU A;  4YOW A;  5HLF A;  3DRP A;  3EEQ A;  4BVO A;  2IS3 A;  1IV0 A;  3OYI A;  5JIC A;  2YNF A;  1B9D A;  1SL2 A;  1K8A O;  3PO4 A;  3G0Z A;  1NK6 A;  5EXW A;  4B3O A;  4CCH A;  4DV5 K;  2A42 A;  3OJU A;  1YHQ N;  4XIU A;  3MWP A;  4LC9 B;  4E7L A;  1VSH A;  1E4F T;  4CIG A;  4FM2 A;  1Z25 A;  3DLG A;  4RWT A;  5C12 A;  5C42 A;  3AVL A;  4FW1 A;  4JI5 K;  2CGL A;  4WQ5 C;  1N5Y A;  4L3Q A;  2O4G A;  3VF4 A;  4DFP A;  4WQ4 C;  4FJI A;  2ZGY A;  5HBM A;  5FPM A;  4B9V A;  1DKG D;  2VQF K;  2EX3 A;  3WQU A;  4AIL C;  1RNH A;  3NMU A;  1S1V A;  2HF3 A;  1K73 O;  2RE2 A;  1SKS A;  2F8T A;  2O8C A;  3V81 A;  1VQ9 N;  3O1B A;  4B3S K;  3J7A P;  2NLX A;  2Q36 A;  5DM7 L;  4C1N I;  1DGK N;  4CF2 A;  3TAF A;  4J2A A;  4WCE L;  1NK8 A;  3WXJ A;  1TV6 A;  3H1V X;  3QIO A;  4M3X A;  4MO4 A;  4J2E A;  1DTQ A;  4FLY A;  4IJN A;  2G8H A;  4EZ6 A;  1L5U A;  2QKK A;  5CY4 A;  1A5W A;  3ZSX A;  1FKO A;  1MDU B;  1X1P A;  3AV9 A;  3AO5 A;  2ITG A;  5FDL A;  4MO5 A;  3NGY A;  3NDK A;  1WSF A;  2RPI A;  1BCO A;  4CBU A;  4DSL A;  2Q0U A;  2KFN A;  1TGO A;  1VSM A;  4E7I A;  1RGI A;  4K0K K;  4ILH A;  1NU0 A;  1KVA A;  4Z94 A;  4DSJ A;  3M8P A;  3QNO A;  1L3T A;  1RDW X;  2WUS A;  3L4Q A;  4H0Y B;  3HK2 A;  4CHO A;  2NRW A;  1LWC A;  2FBT A;  3O9U A;  4DSI A;  5LMU K;  3K0S A;  2GEL A;  4DV6 K;  2JGU A;  1QTM A;  2WBN A;  1YJ9 N;  5C15 A;  4H5W A;  3RWU A;  3VA3 A;  3L4I A;  4AHC A;  1NOY A;  1XNQ K;  4ISF A;  4E1M A;  2HST A;  4BRN A;  4JRP A;  4OKK A;  3EZ5 A;  3T1Y K;  3PIO L;  3H1Q A;  4CZJ A;  1QQO A;  5BRE A;  4ISG A;  3HL8 A;  4MLH A;  4PY5 A;  5C0Y A;  4H0T B;  3T19 A;  4CVN E;  3EKS A;  2HB5 A;  3LM9 A;  1JCF A;  1ASU A;  1KXP A;  1RTI A;  1W97 L;  3NF8 A;  5KTQ A;  1VQL N;  4CF8 A;  5EVZ A;  1S3X A;  4WE1 A;  1SL1 A;  4LF9 K;  2X74 A;  4FWO A;  4AHU A;  5J2N A;  3T1A A;  5C2D A;  3BF1 A;  1UAX A;  1VSE A;  3D6R A;  2BGG A;  4Q0B A;  2E1Z A;  4CFA A;  3RR8 A;  3H46 O;  2R7Y A;  3CCU N;  4FVM A;  4FJH A;  4DR4 K;  4B9N A;  2XO7 A;  1Q8I A;  2O8E B;  1QSY A;  3AVG A;  2V51 B;  1YJN N;  1JLE A;  1VQN N;  1XQS C;  4K41 A;  1YUW A;  2Z1I A;  4FL9 A;  3QEI A;  2NRV A;  1WAF A;  3K57 A;  3ZSW A;  4C8O A;  3CYM A;  2P51 A;  3FR0 A;  2W40 A;  5KI6 A;  4W5O A;  3AAQ A;  4BDZ A;  1TUY A;  1JKH A;  3KVG A;  1S72 N;  3NH2 A;  2G8W A;  1XMO K;  1U4B A;  4LFB K;  5KGW A;  2FSN A;  1KAY A;  2NZT A;  1WBB A;  3OS1 A;  1NLV A;  1T7P A;  2ZJR L;  4CZG A;  2V7Z A;  3W3D A;  1OKJ A;  4EP5 A;  5KRS A;  3VGL A;  2UU9 K;  3CPE A;  3AY9 A;  1NGJ A;  3QBX A;  4DV4 K;  4JYA K;  2UUA K;  4CEE A;  1RT7 A;  4UQG A;  4RTF D;  1BUP A;  1CZA N;  4B1X B;  3A5M C;  4FM0 A;  3VQA A;  5JLF A;  4CGG A;  4FWP A;  3CCM N;  4BR4 A;  4CJE A;  3WNE A;  3WNH A;  1QZ6 A;  4CK3 A;  1MWK A;  2Z1J A;  4FOI A;  1RTH A;  3MXM A;  4UY8 O;  1V4S A;  1XWL A;  4DQI A;  4BY9 C;  3MEE A;  3ZT4 A;  3PO5 A;  1NGH A;  1NK7 A;  2E6M A;  3ZSV A;  1EP4 A;  3C0B A;  1TK5 A;  2CGJ A;  2FBY A;  5ELZ A;  1BDG A;  2KQ2 A;  4CHP A;  1HYV A;  3CC4 N;  1NMN A;  1X9S A;  3K5O A;  4AM6 A;  4W5N A;  4LF7 K;  4BR0 A;  4O55 A;  3V1O A;  4KHP K;  2W6L A;  1VSJ A;  3CQY A;  3O3H A;  3I8B A;  3ZT1 A;  1VRU A;  5M1Q A;  1W2B M;  4B8C A;  4IG3 A;  1T05 A;  4HWI A;  3ASM A;  1NGE A;  3SUN A;  3TWH A;  1HPM A;  3J80 O;  2VG5 A;  1KFS A;  4MDA A;  3T69 A;  4CJW A;  4OPK A;  4BRK A;  3SMP A;  4A2B A;  3OYF A;  5C2F A;  4JRQ A;  1WSH A;  4CEQ A;  3NFA A;  3KLG A;  3CJ7 A;  3ZX2 A;  1GLE G;  5KQ8 A;  1LAW A;  1L3U A;  5DK5 A;  4FLT A;  4DV0 K;  5GAD P;  1F21 A;  1I3A A;  3L2V A;  3WXM B;  3VEX A;  4FJK A;  3IAY A;  4YOT A;  4LFC K;  4DS4 A;  3AVA A;  4I9L A;  2Y1J A;  3VTI A;  5CYM A;  2G8U A;  3EE9 A;  3J7Z O;  3TAR A;  3TSP A;  1HNI A;  1QQC A;  3QEV A;  4EAH D;  1J6Z A;  4BC2 A;  1RBT A;  3K5L A;  2A6A A;  3CC2 N;  1DLO A;  1KAX A;  1VAZ A;  3ID6 A;  3O8M A;  3M8R A;  1NGC A;  1ASW A;  3DOK A;  3HTV A;  4M3R A;  1MWM A;  5KPZ A;  3CCJ N;  4JS5 A;  4AQY K;  2ZWH A;  3OBW A;  3LP2 A;  5FPN A;  4FJM A;  4DR7 K;  4IWV A;  4DTU A;  1QZ5 A;  2HND A;  5AQU A;  1HYS A;  1RT2 A;  3LWM A;  4PL8 A;  2IVO A;  4BG9 A;  3NH0 A;  4YOX A;  4KH6 A;  2KW4 A;  4DR1 K;  2QXL A;  4KH5 A;  1WB9 A;  3BGR A;  4JV5 K;  3GOI A;  4BWM A;  3LDS A;  3DLE A;  1K9M O;  5FRN A;  3KWG A;  3AO3 A;  4F2S A;  4BR5 A;  5AQN A;  3VES A;  3H3N O;  4PWD A;  4BRF A;  2BUP A;  2GUP A;  3PUF A;  3RMB A;  3V9X A;  1XHZ A;  1WNS A;  1Z6R A;  3RTV A;  5KPT A;  1RTD A;  4F3O A;  4OGE A;  3KHY A;  4FOE A;  3VPZ A;  4I7F A;  3WNF A;  2QTD A;  2VYP A;  3M3Z A;  4RG8 A;  3SQ1 A;  3U9D A;  2KKZ A;  3VEN A;  2ETJ A;  1JLQ A;  3SAH A;  3RR7 A;  4IJA A;  3TAM A;  4DR6 K;  1BIU A;  4HTL A;  4LF8 K;  4YDU C;  3MXI A;  4B9M A;  3IDH A;  3VGM A;  2UUC K;  3MX5 A;  1EXQ A;  1WAJ A;  3VQC A;  5JLH A;  4N56 A;  3OYM A;  4O5B A;  4ILJ A;  1HRH A;  3OYK A;  3MXJ A;  1RBV A;  1YT3 A;  1U48 A;  4FWK A;  1A5X A;  3LDQ A;  4R79 A;  1ZBF A;  2QWP A;  4RW4 A;  3VF6 A;  4M41 A;  2P5O A;  2A5X A;  3S41 A;  3V9W A;  4FZX C;  1REV A;  4M3Z A;  1SKW A;  4CJ4 A;  4FLW A;  2D0O A;  4OX9 K;  5J2M A;  4CD3 A;  3A2F A;  3IS9 A;  5JVH L;  4B1Y B;  3O9T A;  1R0A A;  4A2A A;  2VG7 A;  1YIT N;  4MDB A;  3IUC A;  1OH6 A;  4IEI A;  1TAU A;  1GLL O;  1NMD A;  5AZJ B;  3J7Y P;  3VQP A;  3B8A X;  4CK1 A;  1SZ2 A;  3NGI A;  3E9O A;  1ZC6 A;  2A3Z A;  4LF4 K;  5AQJ A;  2WOM A;  4J2D A;  1LW0 A;  4AF1 A;  3FE1 A;  2P9P A;  3LP1 A;  1W9H A;  5BR8 K;  1N32 K;  2AA4 A;  5AZJ A;  3THX B;  4JD2 B;  1OVQ A;  2PBD A;  1HLU A;  1IKW A;  2FXU A;  1JXB A;  4OPH A;  3THX A;  3BZC A;  3I33 A;  1Y97 A;  4JD2 A;  1IG8 A;  3IKM A;  4OKJ A;  4E3S A;  4CZK A;  4CZH A;  3TSQ A;  4GV9 A;  4Z4G A;  1S9E A;  3LPU A;  1E4G T;  4KHS A;  4FWN A;  4C8N A;  3Q7C A;  1J5E K;  1VQ7 N;  1ATN A;  4W5T A;  1RCH A;  4FVU A;  3P31 A;  3SUP A;  2G8K A;  4N5S A;  2X6S A;  4PHT X;  4M42 A;  3SUO A;  5EY4 A;  4FJG A;  2OCE A;  2P9L B;  3O4N A;  2XY8 A;  3KK2 A;  2ZGZ A;  3MN7 A;  4F2R A;  1RBR A;  2GTD A;  2NRT A;  3AVI A;  4CJ3 A;  3F9M A;  2P9L A;  1NK0 A;  3BZK A;  3L2R A;  3SQ2 A;  5HP1 A;  4IG0 A;  3TAQ A;  4J8F A;  4H5N A;  1ITG A;  4O0I A;  3IRX A;  3JAM O;  2YHW A;  3CJA A;  3PSI A;  4JHD A;  4CHN A;  4NCB A;  2NRR A;  2DFH A;  4JI0 K;  4NYN A;  4X62 K;  3OYE A;  4HUF A;  3OYG A;  3I0R A;  2QM1 A;  4DMN A;  4PKI A;  4FLV A;  3CCE N;  4XH4 A;  2D0A A;  3ZEU A;  4LD0 A;  4IO8 A;  4JI7 K;  3VEZ A;  5BRH A;  1FKP A;  2W6K A;  1N6Q A;  2P9K B;  3HOS A;  4RW7 A;  4DTN A;  1U2V B;  5B8H A;  4H0X B;  3OYA A;  3KLI A;  3D45 A;  3DXK A;  3PX4 A;  2DFF A;  3UKR A;  3SJH A;  3RSE A;  2P9K A;  4DQS A;  3NAE A;  4CF0 A;  3CG7 A;  3LDP A;  3O9S A;  4H5T A;  3S9H A;  2F9T A;  2JWL A;  4DB3 A;  3WXI A;  4KKO A;  3CJC A;  5GAH P;  1NGB A;  1VQ5 N;  5HRO A;  4ZTF A;  1D9F A;  2QXF A;  2ASO A;  1S1U A;  3CIP A;  4H0V B;  3HVT A;  4I6M B;  3U3Y A;  2Q3S A;  1NKC A;  3QFU A;  1HYZ A;  3ZSO A;  4CJV A;  1IO2 A;  4YY3 K;  1RBU A;  5ADX H;  2F8S A;  4BVP A;  5HRS A;  3L6Q A;  3ZX0 A;  4DTM A;  2KHO A;  3QEX A;  3M8S A;  3SQ0 A;  1S6Q A;  4IOX A;  4OLA A;  1YJW N;  4KPY A;  2FLO A;  2GWK A;  5BPN A;  3CXC M;  4XEI A;  2G8I A;  3BUZ B;  3CMA N;  1V4T A;  4FWR A;  4N76 A;  3B6P A;  4GVE A;  3OJS A;  4KRF A;  2HHU A;  4CGJ A;  2VGM A;  5AQM A;  1VSL A;  1U47 A;  3K9K A;  4CK2 A;  5HL7 L;  3K2P A;  2HBK A;  2VWJ A;  4KHY A;  4E7H A;  1HNW K;  2YNG A;  4DSF A;  2UYT A;  5JS2 A;  3P1G A;  3CCL N;  3VQE A;  4CF9 A;  4FWM A;  4CEF A;  4CEO A;  4KI6 A;  3K58 A;  4FJL A;  1GLB G;  3S3M A;  3CCQ N;  4GV6 A;  3IMX A;  1X3N A;  3U4L A;  3KLH A;  3G71 N;  3LAN A;  4PKG A;  2X6N A;  3H45 C;  3OW2 M;  4DV1 K;  4QS8 A;  3TAP A;  4U7B A;  3EL2 A;  3HBT A;  1GLJ O;  4QCL A;  2FSJ A;  4CES A;  4XH1 A;  1UWB A;  1KSP A;  1YVN A;  3WNG A;  3V9Z A;  2XRI A;  2RHK A;  5EX5 A;  4CZI A;  1CXU A;  1N33 K;  2FSK A;  1SUQ A;  2KLA A;  2AP1 A;  3VQ5 A;  1M1K O;  3M5R A;  3SPY A;  3AO4 A;  4CZM A;  3AAP A;  3RRG A;  1BWF O;  4DU4 A;  1LAV A;  3HT3 A;  4CED A;  4IOC L;  1VQ6 N;  3F73 A;  1T44 A;  1KQS M;  1C1C A;  3FLC O;  4JKD A;  4FK0 A;  2DTU A;  2XY7 A;  4CBW A;  4YOV A;  4HCB A;  3SBG A;  4JKA A;  3KK1 A;  1FW6 A;  2EWS A;  4CZE A;  4E89 A;  3KTQ A;  5GAG P;  1IKY A;  2IVP A;  2Q0R A;  5AQW A;  4K25 A;  1N36 K;  3LAK A;  4DSE A;  4DS5 A;  1YTU A;  2Z1H A;  1JLB A;  2BE2 A;  4DHY A;  3VGK A;  1EO1 A;  3R1X A;  3ZT3 A;  1XHX A;  1D8Y A;  3P5J A;  3C65 A;  3KZB A;  1NGD A;  3ULD A;  1I39 A;  4BC4 A;  4NB4 A;  4OO1 J;  2UXB K;  5CR4 A;  3DJC A;  4JKF A;  3LDO A;  5LY3 A;  3CFR A;  4JI3 K;  2O8E A;  3CER A;  3DLR A;  5KRT A;  4IKF A;  4G1Q A;  3D7E O;  3EY1 A;  1L3S A;  3ENO A;  2FF6 A;  4FXD A;  3RMC A;  4Z4I A;  4FSV A;  2PYL A;  3O6W A;  1T6C A;  4WYB A;  4IZ9 A;  1O1W A;  2CGK A;  3AA5 X;  4DF4 A;  4JKB A;  4H5V A;  4EHU A;  1XI1 A;  1ZBI A;  4WFB L;  1TKX A;  4M45 A;  3NF7 A;  1W7A A;  1RIL A;  4CEA A;  2PYJ A;  1SAZ A;  4C23 A;  1HR0 K;  5FRO A;  3EKU A;  1BIS A;  3FZM A;  3OYL A;  4CW7 B;  4ID5 A;  2NRX A;  4EIA A;  3QEP A;  4H03 B;  2OZM A;  1WSG A;  3I0S A;  3J8A A;  1TVR A;  1T03 A;  4O4G A;  3VQ9 A;  3HPH A;  4W5Q A;  2F96 A;  4IO9 L;  3HXM A;  4I2Q A;  2Y1I A;  4KH4 A;  1JJ2 M;  5CZ2 A;  3QDK A;  4AHS A;  3FZH A;  3SV4 A;  1WN7 A;  1B92 A;  1ILY A;  3AVB A;  2OPQ A;  1X9W A;  3CJ1 A;  4KFB A;  4KHU A;  1BGX T;  5CZ1 A;  3MX2 A;  3K5N A;  1P8Z A;  4IDK A;  3THV A;  2YNH A;  3CF5 L;  2HOE A;  4JS4 A;  5AQX A;  1LOT B;  1RDA A;  3SQ4 A;  4DTR A;  2HNY A;  3TAG A;  1NK5 A;  4PUO A;  2E5L K;  5DM6 L;  4F4K A;  4RW9 A;  3OYC A;  5HRP A;  1ZXO A;  4QAG A;  1HKC A;  4NLC A;  1NM1 A;  4O8K A;  2P9N B;  2QWR A;  4Z4F A;  4DU1 A;  4JLH A;  2UXC K;  1QVF M;  1EWR A;  5BN9 A;  4GVM A;  3EYZ A;  2G8F A;  3OVN A;  1C0F A;  3OYB A;  4DU3 A;  5TKY A;  5I3U A;  4YHH K;  3RMD A;  1RT5 A;  2GX9 A;  2P9N A;  4M63 C;  1C0U A;  5FPE A;  1NG9 A;  2GEM A;  1KFD A;  4NCG A;  5HRN A;  2OPS A;  1ZBS A;  4PKH A;  4XH5 A;  4B3M K;  4JKC A;  3TPQ A;  1RDU A;  3QIP A;  4BRO A;  3P39 A;  1HNZ K;  1BL3 A; 
#chains in the Genus database with same CATH homology
 3P83 D;  1EKE A;  2YNF A;  2IC3 A;  2B5J A;  1B9D A;  4CJ4 A;  5J1E A;  4FLW A;  1SL2 A;  2HMI A;  5J2M A;  3PO4 A;  3LAM A;  3G0Z A;  5E41 A;  1NK6 A;  4B3O A;  4CCH A;  3A2F A;  1RBS A;  3G10 A;  3IS9 A;  1BQN A;  2HVI A;  1R0A A;  1GOB A;  4O44 A;  1JLC A;  3OY9 A;  3OJU A;  1CZ9 A;  1Z26 A;  2VG7 A;  3VQ8 A;  4XIU A;  4C8L A;  4E7L A;  1TAU A;  1VSH A;  4CIG A;  4FM2 A;  1TKZ A;  3CFO A;  3QO9 A;  4IFV A;  4BE0 A;  3VQP A;  1Z25 A;  2ZQB A;  3ZSZ A;  1VSF A;  4CK1 A;  3NGI A;  2LSN A;  2YKM A;  3DLG A;  2DY4 A;  2FBX A;  3QES A;  5C42 A;  3AVL A;  1W0H A;  2WOM A;  4CJK A;  3NCI A;  1LW0 A;  1VSK A;  4FW1 A;  1ZBL A;  3O4Q A;  3DLK A;  3V4I A;  1N5Y A;  3PX6 A;  3O3G A;  3OYH A;  4B9L A;  2ZE2 A;  3AVF A;  4CER A;  3K5M A;  1NJZ A;  3LP1 A;  1W9H A;  3NBP A;  3OYD A;  3OS2 A;  2O4G A;  3OS0 A;  1VSD A;  3V9U A;  5DMR A;  4DFP A;  4FJI A;  3CM5 A;  4FLZ A;  4CGF A;  5HBM A;  4B9V A;  1QS4 A;  3NF6 A;  5C25 A;  5I42 A;  4KHU A;  2OPP A;  1IKW A;  2FC0 A;  4KV8 A;  2EX3 A;  1QSS A;  4AIL C;  1RNH A;  1S1V A;  1JXB A;  3PY8 A;  1NKE A;  4N41 A;  1TL1 A;  1SKS A;  1Y97 A;  2IGI A;  1IKX A;  1BIZ A;  4LY7 A;  4OKJ A;  3MEG A;  4CFD A;  4CJT A;  4E3S A;  3V81 A;  4C8K A;  2F8T A;  2KFZ A;  4CF2 A;  3TAF A;  1B9F A;  1NJY A;  4J2A A;  3B6O A;  1NK8 A;  4Z4G A;  1TV6 A;  1IKV A;  3QIO A;  1S9E A;  4M3X A;  3LPU A;  2HHV A;  4KHS A;  4J2E A;  1DTQ A;  4DLG A;  4C8N A;  4BDP A;  4FLY A;  1KVB A;  4KO0 A;  5C24 A;  1RCH A;  3VQB A;  4W5T A;  2O4I A;  1HJR A;  4Q5V A;  2G8H A;  4EZ6 A;  4M3W A;  3SUP A;  4DSK A;  3U3G A;  4CHZ A;  1L5U A;  2QKK A;  2G8K A;  1BCM A;  4N5S A;  2X6S A;  2KZZ A;  5CY4 A;  1A5W A;  1C1A A;  1HNV A;  4Z0U A;  3ZSX A;  2A1R A;  1LV5 A;  4M42 A;  1FKO A;  3SUO A;  1RDC A;  1X1P A;  4FJG A;  3AV9 A;  3AO5 A;  2ITG A;  5FDL A;  3SYZ A;  2B6A A;  3CM6 A;  3NGY A;  3NDK A;  3AO2 A;  4OKE A;  1WSF A;  2XY5 A;  2RPI A;  4LH5 A;  1BCO A;  5FRM A;  2QK9 A;  4DSL A;  4DTO A;  2KFN A;  3AVH A;  3O4N A;  1TGO A;  1VSM A;  3VQD A;  2XY8 A;  3KK2 A;  4HTU A;  4Y1C A;  2P1J A;  4E7I A;  1TK0 A;  3DOL A;  4F2R A;  1KVA A;  1S1W A;  1RBR A;  4DSJ A;  1HQE A;  3M8P A;  3QNO A;  1L3T A;  3HK2 A;  3AVI A;  4DTP A;  4CHO A;  4CJ3 A;  2KTQ A;  4YNQ A;  1J54 A;  1NK0 A;  1LWF A;  1L3V A;  1LWC A;  2FBT A;  3L2R A;  3SQ2 A;  5HP1 A;  4DSI A;  3LZI A;  4IG0 A;  2KZM A;  3TAQ A;  1JLF A;  2JGU A;  4C8M A;  1ITG A;  3NH1 A;  4FLX A;  4DTJ A;  4O0I A;  1QTM A;  3IRX A;  4CHN A;  3OYJ A;  4NCB A;  2DFH A;  3MEC A;  3L2U A;  3RWU A;  4NYN A;  3OYE A;  3CQ8 A;  1IH7 A;  3VA3 A;  1U45 A;  4HUF A;  2B4J A;  4AHC A;  4CHY A;  3OYG A;  4DQQ A;  3SCX A;  4DF8 A;  1NOY A;  4FJ7 A;  4E1M A;  4QOZ B;  3I0R A;  4CGD A;  4CGH A;  4JRP A;  3M8Q A;  4DMN A;  4OKK A;  3EZ5 A;  4FLV A;  2QKB A;  1Q9Y A;  3AVM A;  2D0A A;  1IG9 A;  4LD0 A;  4M3U A;  3T3F A;  2RF2 A;  1FKP A;  2OA8 A;  3HL8 A;  1N6Q A;  4PY5 A;  3DMJ A;  4FW2 A;  4RW7 A;  4DTN A;  3T19 A;  4TSX A;  4CIE A;  1ZYQ A;  1NKB A;  3AVJ A;  3OYA A;  1XC9 A;  3KLI A;  3D45 A;  4CJ5 A;  2HB5 A;  1ASU A;  1RTI A;  3NF8 A;  5KTQ A;  3PX4 A;  2DFF A;  4DG1 A;  4KB0 A;  4GW6 A;  4CF8 A;  3PV8 A;  4WE1 A;  1SL1 A;  4DQS A;  3NAE A;  1YVU A;  2X74 A;  4CF0 A;  3CG7 A;  2A1S A;  3CFP A;  4AHU A;  5J2N A;  2PZS A;  1VRT A;  3S9H A;  3T1A A;  4KI4 A;  3KKR A;  3RMA A;  1S1X A;  1EET A;  3DYA A;  3TAE A;  4DWI A;  4OVL A;  1QSL A;  4FK2 A;  1UAX A;  3LP3 A;  4I9Q A;  2IAJ A;  4KKO A;  1VSE A;  1NK4 A;  2BGG A;  3L3V A;  1LW2 A;  4FJ8 A;  4CIF A;  3HPG A;  4Q0B A;  4CFA A;  3RR8 A;  2X78 A;  3AA4 A;  2R7Y A;  5HRO A;  4FVM A;  4ZTF A;  1D9F A;  3BDP A;  2QXF A;  3KK3 A;  1S1U A;  2HW3 A;  4LH4 A;  3HVT A;  3KLE A;  4FJH A;  3U3Y A;  2Q3S A;  1NKC A;  3ZSO A;  1HYZ A;  4CJV A;  4PA1 A;  3LAL A;  4B9N A;  1IO2 A;  1Q8I A;  2XO7 A;  4HHT A;  1RBU A;  1QSY A;  2F8S A;  3H08 A;  5HRS A;  3AVG A;  4AHV A;  3SPZ A;  1HPZ A;  1JLE A;  1RT6 A;  4ID1 A;  3NF9 A;  4FCY A;  4ELU A;  3HYF A;  2HHW A;  4DTM A;  3QEX A;  3M8S A;  4KHW A;  3SQ0 A;  4K8Z A;  1S6Q A;  2Z1I A;  4E7J A;  1C0T A;  1QE1 A;  2IOC A;  3QEI A;  4C8O A;  1GOC A;  1WAF A;  2BAN A;  3ZSW A;  3NE6 A;  3K57 A;  4OLA A;  3CYM A;  4KPY A;  2P51 A;  4CJS A;  2WON A;  2YNI A;  4OJR A;  5KI6 A;  4W5O A;  5HRR A;  2Z1G A;  2G8I A;  1ZBH A;  4CJP A;  4OLB A;  3ALY A;  2NUB A;  4BDZ A;  4ELV A;  3I8D A;  1JKH A;  4AHR A;  3JSM A;  1J5O A;  4N76 A;  4CEZ A;  1VSI A;  3VA0 A;  3B6P A;  3OJS A;  4KRF A;  3QLH A;  3NH2 A;  2G8W A;  2HHU A;  1JXE A;  3S3O A;  3JYT A;  1KCF A;  1U4B A;  4CGJ A;  3V6D A;  4FJX A;  1BI4 B;  1JLG A;  1WSE A;  3QER A;  4Z4E A;  5KGW A;  3VN5 A;  3V9S A;  1VSL A;  4PQU A;  3F9K A;  1U47 A;  1S9G A;  3ITH A;  4CJL A;  3OS1 A;  1RDB A;  3SNN A;  2HHS A;  4CK2 A;  1T7P A;  2RKI A;  3K2P A;  5CYQ A;  5J2P A;  1UA0 A;  4EP5 A;  2GV9 A;  5KRS A;  2VWJ A;  4E7H A;  4KHY A;  3AO1 A;  2YNG A;  3TAB A;  4DSF A;  1BI4 A;  5JS2 A;  5EU7 A;  3TAN A;  4CEE A;  1RT7 A;  4UQG A;  3SV3 A;  1TL3 A;  3P1G A;  3VQE A;  3ZSR A;  4MQ3 A;  4O0J A;  1T8E A;  2AJQ A;  4L8R B;  4KTW A;  1TKD A;  4CF9 A;  4J2B A;  4CEF A;  1KRP A;  4CE9 A;  4CEO A;  4FM0 A;  4KI6 A;  3K58 A;  3VQA A;  1NJW A;  4CGG A;  3K59 A;  4FJL A;  3S3M A;  4DLE A;  4CJE A;  4FM1 A;  3MED A;  3WNE A;  4F8R A;  4H8K A;  3WNH A;  4HCC A;  4CK3 A;  2Z1J A;  1U04 A;  4CEC A;  3SI6 A;  2HHQ A;  4EZ9 A;  2HHX A;  2IDO A;  3KLH A;  3QNN A;  4KHQ A;  3LAN A;  3HO1 A;  3U6F A;  1RTH A;  3MXM A;  2X6N A;  1XWL A;  4F3T A;  4DQI A;  3MEE A;  4K8X A;  3ZT4 A;  3PO5 A;  3L2W A;  5T7B A;  3TAP A;  1NK7 A;  2E6M A;  3ZSV A;  3DLB A;  3IG1 A;  3C95 A;  2ZD1 A;  4QCL A;  1EP4 A;  4ICL A;  1C6V A;  4KB1 A;  1TK5 A;  2FBY A;  4CES A;  2YHB A;  1UWB A;  4W5R A;  3NGZ A;  1KSP A;  4FZZ A;  1HQU A;  1NOZ A;  3L3U A;  3WNG A;  3V9Z A;  3C6T A;  1RT4 A;  2KQ2 A;  2XRI A;  4DTX A;  4B9S A;  1DTT A;  4H4O A;  4FJ9 A;  4CHP A;  1HYV A;  1CXU A;  4RW8 A;  3LP0 A;  3AA3 A;  1X9S A;  4KTQ A;  3K5O A;  1SUQ A;  3QIN A;  3E01 A;  3DRR A;  5KGX A;  3VQ5 A;  4W5N A;  1NK9 A;  4DFK A;  4O55 A;  2D0B A;  3HPO A;  2YKN A;  3SPY A;  3V1O A;  1SL0 A;  3AO4 A;  4FJN A;  3KKS A;  3RRG A;  1VSJ A;  1CLQ A;  3O3H A;  3O3F A;  4DU4 A;  3ZT1 A;  1LAV A;  3HT3 A;  4KRE A;  1VRU A;  4CED A;  1RT1 A;  1UA1 A;  4AH9 A;  4R5P A;  4B8C A;  4IBN A;  4IG3 A;  2XHB A;  1MU2 A;  3F73 A;  4BE2 A;  1T05 A;  3ASM A;  1C1C A;  3TWH A;  3SUN A;  4FK0 A;  4M3Y A;  2VG5 A;  4DFM A;  2DTU A;  4DTS A;  1KFS A;  1A5V A;  1K6Y A;  2XY7 A;  4J2D A;  4CJW A;  4HCB A;  4OPK A;  4FK4 A;  3KK1 A;  1S5J A;  3V1R A;  3QET A;  3ZT0 A;  4E89 A;  1TKT A;  4BAC A;  3SJJ A;  4E19 A;  3KTQ A;  3OYF A;  4CJQ A;  1S6P A;  3QEW A;  1J53 A;  1IKY A;  1D5A A;  1WSH A;  4JRQ A;  4CEQ A;  3NFA A;  3KLG A;  4E7K A;  2OZS A;  3LAK A;  2I5J A;  2JLE A;  4H4M A;  4Z4C A;  4FYD A;  4DSE A;  4DS5 A;  4B9T A;  1YTU A;  2Z1H A;  1JLB A;  2BE2 A;  3DI6 A;  4E1N A;  2BDP A;  1LAW A;  5JS1 A;  3ZT3 A;  2ATQ A;  4HVJ A;  1NJX A;  1L3U A;  1XHX A;  2D0C A;  1D8Y A;  4DQR A;  5DK5 A;  4FLT A;  3P5J A;  1BQM A;  1D9D A;  4MFB A;  1WSJ A;  1I39 A;  1HMV A;  3ULD A;  4KAZ A;  4DQP A;  3KD5 E;  1F21 A;  1I3A A;  3ZSQ A;  3L2V A;  4FJK A;  4AHT A;  3NHG A;  3IAY A;  1U49 A;  3C6U A;  3DRS A;  4DS4 A;  3CFR A;  3AVA A;  5SWM A;  5SZT A;  4I9L A;  3DLR A;  2Y1J A;  4IFY A;  5KRT A;  3HVR A;  5CYM A;  4IKF A;  2G8U A;  3HP6 A;  4G1Q A;  4M3T A;  3TAR A;  3KJV A;  3EY1 A;  1L3S A;  3AA2 A;  1HNI A;  3VQ4 A;  1WLJ A;  3TR8 A;  4DFJ A;  1Q9X A;  1QQC A;  4FXD A;  2YV0 X;  4OGC A;  4B9U A;  3LWL A;  4BDY A;  1ASV A;  4Y1D A;  3QEV A;  4FJ5 A;  1YTA A;  1RBT A;  4OPJ A;  2W42 A;  4GMJ B;  3K5L A;  1DLO A;  1GOA A;  3RMC A;  2PYL A;  4Z4I A;  2HVH A;  1EX4 A;  4LSL A;  4LSN A;  1RT3 A;  2E4L A;  3M8R A;  1O1W A;  3AA5 X;  1ASW A;  3DOK A;  1TK8 A;  4M3R A;  4DF4 A;  1XI1 A;  2DFE A;  1ZBI A;  4JS5 A;  3LPT A;  1TKX A;  2FBV A;  1FK9 A;  5D3G A;  4M45 A;  3NF7 A;  2P5G A;  1RIL A;  3LP2 A;  4CEA A;  2PYJ A;  4FJM A;  4FLU A;  2PY5 A;  4DTU A;  2HND A;  5FRO A;  3OYL A;  1BIS A;  1TAQ A;  1RT2 A;  1HYS A;  1RDD A;  4ID5 A;  3LWM A;  4BE1 A;  4CEB A;  4CHQ A;  3L2Q A;  3TI0 A;  4RW6 A;  4ZHR A;  3NH0 A;  3QEP A;  1BHL A;  1KVC A;  1QHT A;  2KW4 A;  1J9A A;  2OZM A;  4N47 A;  1WSG A;  2VG6 A;  4KTZ A;  1C1B A;  1CZB A;  3I0S A;  1KTQ A;  1G15 A;  1TVR A;  3BGR A;  1T03 A;  4O4G A;  3VQ9 A;  3HPH A;  4W5Q A;  2F96 A;  1JLA A;  3KIO A;  1KLN A;  2OYQ A;  3D0P A;  1SKR A;  4BWM A;  4E0D A;  4B8A B;  3HXM A;  4I2Q A;  3LDS A;  2Y1I A;  2GBZ A;  1FXX A;  3DLE A;  5CZ2 A;  3V1Q A;  5FRN A;  3AVC A;  4AHS A;  3HJF A;  3AO3 A;  3SV4 A;  3ZT2 A;  1WN7 A;  1B92 A;  1JL2 A;  4F2S A;  2OPR A;  3MAQ A;  4FZY A;  3AVB A;  4ELT A;  4NYF A;  2OPQ A;  3SZ2 A;  2HHT A;  2RN2 A;  1X9W A;  4KFB A;  4KHN A;  4PWD A;  3KD1 E;  1BGX T;  3PUF A;  5CZ1 A;  3KLF A;  3DLH A;  3RMB A;  4CJR A;  3V9X A;  3K5N A;  4IDK A;  3THV A;  1XHZ A;  1WNS A;  3RTV A;  2YNH A;  1RTD A;  4F3O A;  3SUQ A;  4JS4 A;  3AVK A;  1RDA A;  3ZCM A;  4OGE A;  3SQ4 A;  2EHG A;  2VWK A;  2HNY A;  3ZSY A;  4CJU A;  4HUE A;  4DTR A;  4I7F A;  2YHA A;  3WNF A;  3TAG A;  1NK5 A;  2HNZ A;  4CF1 A;  4PUO A;  5J2Q A;  4NCA A;  1CXQ A;  4RG8 A;  3SQ1 A;  4F4K A;  4RW9 A;  4BWJ A;  5HRP A;  3OYC A;  3S3N A;  1VK0 A;  3L8B A;  1UOC A;  4CJF A;  2G8V A;  2ETJ A;  2GUI A;  4QAG A;  1JLQ A;  3LZJ A;  2XY6 A;  3RR7 A;  3TAM A;  3AVN A;  1BIU A;  4Z4H A;  4CFB A;  3MXI A;  4Z4F A;  4DU1 A;  4B9M A;  3RRH A;  4JLH A;  3VQC A;  1EXQ A;  1WAJ A;  3VQ7 A;  4N56 A;  3OYM A;  1JL1 A;  4ZTJ A;  4EP4 A;  1ZBU A;  3DM2 A;  1C0M A;  4GVM A;  3EYZ A;  2D5R A;  3OVN A;  2G8F A;  3OYB A;  4DU3 A;  3ISN C;  4O5B A;  5K14 A;  1S1T A;  5I3U A;  2E6L A;  3RMD A;  1RT5 A;  1C0U A;  4B08 A;  1HRH A;  4CFC A;  3UIQ A;  1WSI A;  1KFD A;  4NCG A;  5HRN A;  2OPS A;  1RTJ A;  3HP9 A;  1KLM A;  3MXJ A;  3OYK A;  3HM9 A;  1LWE A;  1RBV A;  3VQQ A;  1X9M A;  4I2P A;  1YT3 A;  3HST B;  1U48 A;  3C94 A;  1SV5 A;  3OYN A;  4HUG A;  1A5X A;  4YFU A;  1ZBF A;  3FFI A;  4RW4 A;  5HLF A;  3QIP A;  4M41 A;  2P5O A;  4FJJ A;  3DRP A;  4CGI A;  3V9W A;  4FZX C;  3PX0 A;  2IS3 A;  1REV A;  3VQ6 A;  1BL3 A;  4M3Z A;  3OYI A;  1SKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...