2ETJA

Crystal structure of ribonuclease hii (ec 3.1.26.4) (rnase hii) (tm0915) from thermotoga maritima at 1.74 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
221
structure length
211
Chain Sequence
MGIDELYKKEFGIVAGVDEAGRGCLAGPVVAAAVVLEKEIEAKRERLLDEIMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKPSFVLVDGKGIELSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRMYPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPVLELLTDDLLREFFEKGLISENRFERILNLLGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease HII
publication title Crystal structure of Ribonuclease HII (EC 3.1.26.4) (RNase HII) (tm0915) from THERMOTOGA MARITIMA at 1.74 A resolution
rcsb
source organism Thermotoga maritima
total genus 68
structure length 211
sequence length 221
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2etjA00
3RMDA 1L5UA 2IDOA 1RDAA 4DSKA 1RT4A 3K5NA 4B08A 3EY1A 3L3UA 4RW4A 3WNEA 5HBMA 3RRGA 3KIOA 3OYAA 1RT5A 3D45A 2YNHA 3DM2A 4BE0A 3V6DA 3MEEA 3KK1A 3KLIA 4DMNA 3WNGA 4B8AB 2E4LA 2OA8A 5FRNA 1YTUA 4J2AA 3QEXA 4M3ZA 3OS0A 3DLBA 2AJQA 4JRQA 4AHRA 4KTZA 4M3UA 2D5RA 1W0HA 2JGUA 2XY8A 4CFDA 1N5YA 1L3VA 3L3VA 1KFSA 3HVRA 2DY4A 4FJLA 2P1JA 4F3OA 3I0SA 4FJ7A 3OYNA 4NCBA 4KAZA 4DSEA 4DTOA 3OYKA 4N47A 5HRNA 1RTJA 1A5XA 2FBYA 3LP2A 4NYFA 3VQQA 3EZ5A 4E19A 3MECA 3OYLA 4CHNA 2W42A 4DF4A 1D8YA 3AA2A 3QINA 1UA1A 4FJ8A 1SL0A 2QK9A 4Z4HA 4N5SA 1JLGA 4AHTA 4AHCA 4RW8A 4CGJA 4DTNA 1LW0A 4KRFA 1HQEA 4O0IA 4DQSA 3ZSYA 1IKWA 1TKXA 4CEQA 3MAQA 3VQAA 4DTXA 1TAUA 4W5NA 1EX4A 3ZSRA 3NGYA 4Q0BA 4RW6A 1LW2A 2G8WA 1IG9A 2GV9A 2BGGA 3RR7A 3B6PA 4B8CA 4FJHA 5HRSA 4Y1DA 4OLBA 4CHZA 1HYSA 4F2SA 4HCCA 3OJSA 4F8RA 4NCAA 1JL1A 2XRIA 3JSMA 4R5PA 1HMVA 3V9XA 4HCBA 4M3WA 4Z4IA 3P5JA 3SNNA 4YFUA 2A1RA 4DU1A 1VSKA 4E0DA 1IO2A 1LWCA 4C8MA 3DOLA 4CEZA 5K14A 4FLYA 4FLUA 4FJNA 3LANA 4FK0A 5C24A 3AA5X 4ID5A 2YNGA 4CESA 2XO7A 3QNNA 5KTQA 2RPIA 3SUOA 1BCMA 1GOCA 1HQUA 3P83D 4OKKA 3VQEA 5CZ2A 3ZT2A 3S3NA 1NJZA 4DU4A 1RT2A 4M45A 4BWMA 1U45A 2KZZA 2HMIA 3PX4A 3V9UA 2R7YA 4CJ4A 2YNFA 3NH2A 4CJPA 4B9LA 3DLGA 3BDPA 4I9LA 3CQ8A 1WSGA 4CGIA 3THVA 3TAQA 1TL1A 3LWLA 3QETA 2FC0A 4MQ3A 2EHGA 4KTQA 4CHYA 3NCIA 3QNOA 2Z1GA 3F73A 3S3MA 1NOZA 3ZT1A 1S1XA 4BDYA 2XHBA 3RMBA 4HUFA 1REVA 4Q5VA 1XHXA 4FLVA 2RN2A 4IFVA 1NJXA 5HP1A 1Q8IA 1IKYA 3TANA 1NK7A 3NHGA 4FW2A 5JS1A 3ZT0A 1RTDA 1EKEA 3AA4A 1WSHA 4W5QA 3LZIA 1VRTA 3VQ8A 3CFRA 1TK0A 2WOMA 4E7JA 3IS9A 3DRPA 4B9TA 5DK5A 1NOYA 4ELUA 1S1VA 4DWIA 1VSMA 1RDDA 4DG1A 4H4OA 4KI4A 4IG0A 1G15A 3KKSA 1MU2A 3K57A 1X9MA 3HK2A 2IS3A 4OJRA 3KD1E 2ZQBA 1UA0A 3I8DA 2HHSA 3TAEA 3ZSXA 1JKHA 3QESA 2HB5A 2OPSA 2ZE2A 3TR8A 4PWDA 1RT3A 1ITGA 4DS5A 1T05A 1ZYQA 1ZBUA 4E7KA 4CHQA 3AO4A 3ASMA 2JLEA 3K5OA 4CE9A 2IC3A 1T8EA 3LZJA 3MXMA 4DSLA 1DTQA 3ZSQA 1QSYA 3MEDA 4I2QA 4CERA 1U48A 3HP6A 4I9QA 5FRMA 2DTUA 4QAGA 2YKNA 3TAGA 3QEPA 1QQCA 2Z1IA 3TAPA 4CEOA 4FZXC 2GBZA 3AVJA 3TWHA 1C1AA 3VQ4A 3AVNA 4KKOA 1LAVA 3HSTB 4FCYA 4FK2A 1XC9A 4C8KA 3AO5A 1RILA 1Z26A 1I39A 3NE6A 2PY5A 4J2BA 1U47A 3NF9A 3OY9A 3AVCA 4PUOA 3HO1A 1BCOA 1C1CA 1VSDA 2HHQA 3QEVA 3QLHA 1ASUA 4CECA 1RBRA 5KGXA 4HUEA 2DFFA 4W5RA 1S5JA 4OGEA 4RG8A 3KLHA 4JS4A 4LD0A 5I3UA 3DLEA 1KLMA 3BGRA 3U3GA 1JLBA 1RTHA 3QIOA 4FJKA 5JS2A 2G8VA 3KLFA 4CJQA 1S1WA 1S6PA 3CM5A 4CEBA 1B92A 3KLGA 3KJVA 3CFPA 1NJWA 1D9FA 3TABA 2P5OA 2ZD1A 4FZZA 4CCHA 3AA3A 1L3SA 5C25A 3RWUA 1VRUA 4LH5A 4QOZB 5J1EA 3DOKA 4NCGA 3F9KA 3AO1A 2Z1JA 1QS4A 4FW1A 3AVAA 1ZBLA 3LP3A 1C0MA 3JYTA 4E7IA 2FBXA 3LPUA 3C6TA 1XHZA 4C8NA 4CIFA 4DTJA 3SQ2A 3MXIA 3SUNA 3L2UA 2F8TA 2P51A 4CK2A 1SKWA 2D0BA 4JRPA 3VQCA 3OYBA 3CM6A 1JLEA 1UWBA 3HVTA 3DYAA 2QKBA 1RT7A 2RF2A 2OPRA 3AO3A 1SL2A 2HNYA 2LSNA 4LSNA 2O4GA 3KD5E 1RNHA 4E3SA 4B9NA 3HT3A 4M3XA 4M3RA 3HP9A 1JL2A 3SUPA 1FKOA 1T7PA 3HJFA 3ALYA 4F3TA 4KHQA 2ITGA 1Q9YA 4CF1A 3SYZA 4HVJA 3KKRA 2Z1HA 4TSXA 3LALA 5FROA 3AO2A 4CJTA 2YHBA 4CGHA 3RTVA 3V9WA 4FYDA 3EYZA 1BI4B 4FJ5A 4CJ5A 4KTWA 4G1QA 4IKFA 4F4KA 4HUGA 4CJRA 2Y1JA 2P5GA 4CJ3A 1T03A 3V9ZA 3OYHA 3G10A 1RDBA 4E7LA 1FKPA 4IBNA 3T1AA 1ZBIA 1LWFA 4ZTJA 1TKDA 3MEGA 1QSSA 3DMJA 4FLZA 1K6YA 1JXEA 4IFYA 4LH4A 1YVUA 3IRXA 2GUIA 4B9SA 1RBVA 1B9FA 3FFIA 4BE1A 3VA3A 4DQRA 2HHTA 3DRRA 4CGGA 1TAQA 4PA1A 1TL3A 4GW6A 2HNDA 4CJUA 4E7HA 1CZ9A 3AVMA 4DTUA 4CIGA 1TK8A 1I3AA 1WSIA 2HVHA 2IOCA 4DF8A 5DMRA 4O55A 3NGIA 3QERA 4CJEA 3L2RA 4DS4A 2KW4A 4DFMA 5KGWA 3NF8A 4FJJA 1NK8A 1JLQA 3VA0A 3RR8A 3KTQA 1CXUA 2YV0X 2HHWA 1FXXA 4Z4EA 3NF6A 4OVLA 4FM1A 1S6QA 2B4JA 4DFPA 1C0TA 3QO9A 2X78A 1RBSA 4WE1A 5CY4A 4CJWA 4CHPA 4BWJA 1TVRA 2Y1IA 3SQ4A 1HNVA 2O4IA 4FM0A 1SKRA 1BISA 3PUFA 3L2WA 4KREA 1A5VA 3K5LA 3H08A 2EX3A 2VWJA 1FK9A 3K2PA 3C6UA 4O5BA 4DSIA 3NH1A 2G8KA 4OPJA 2HVIA 1DTTA 1KSPA 2BDPA 3LP1A 1NKCA 1VSFA 2B6AA 1R0AA 1NK0A 2FBVA 5J2QA 1L3UA 5CZ1A 3M8QA 2X74A 4B9UA 2KFZA 4CFAA 5C42A 1KTQA 3PV8A 2OPQA 1VSLA 2VG7A 4CJLA 4I2PA 3AVIA 4Z4FA 3AVFA 3TARA 4MFBA 2VWKA 5I42A 4KFBA 4B3OA 1C6VA 3LAMA 3V1OA 4CEAA 1KVBA 3TAMA 3ZSZA 2G8FA 3M8RA 4ZTFA 3KK3A 4CF9A 1BQNA 3DI6A 3O4QA 1SKSA 3PY8A 4FJXA 1J5OA 4FLTA 1ASVA 4CFBA 5T7BA 3NGZA 3AVGA 3L8BA 5HLFA 3OYMA 2BE2A 3P1GA 4K8ZA 1KVAA 1S1TA 1U04A 3SCXA 5SWMA 4C8OA 1B9DA 1BIZA 1RBUA 5CYMA 3ZT3A 4DU3A 4UQGA 1VSIA 3T3FA 4JLHA 1KFDA 2YKMA 5D3GA 4AH9A 2X6NA 3SQ1A 1WSJA 3NFAA 4PY5A 4ELVA 4BDZA 3OYFA 1EP4A 3HPGA 4CIEA 3AVHA 1XWLA 2VG6A 3E01A 5CYQA 1JXBA 1JLAA 4KHYA 1J9AA 4PQUA 4DFKA 3VQ9A 1CLQA 4DQQA 4DTRA 1BHLA 2E6LA 4CFCA 4HHTA 4EP4A 3U3YA 3TAFA 3S3OA 2PYJA 2A1SA 5J2PA 4OKJA 4H8KA 2KTQA 1WLJA 2YHAA 1X9WA 5KRSA 2I5JA 4CK3A 3RRHA 3MXJA 1NJYA 4J2DA 4DLEA 4C8LA 4CF0A 1TKZA 3LPTA 4GMJB 3NF7A 3QIPA 4H4MA 3S9HA 4CF2A 4Z0UA 1U49A 1HRHA 3WNHA 1NK6A 4EZ6A 4K8XA 2E6MA 1VSEA 4FJGA 2HHXA 3I0RA 2XY6A 4DQIA 4M3TA 4DSFA 3PO4A 3PX6A 3CYMA 3V4IA 5J2NA 1IH7A 3KK2A 1HYZA 1UOCA 2QXFA 2G8IA 4BDPA 1TK5A 1KRPA 3PO5A 3DLKA 4DLGA 1S9GA 4DTMA 3HPOA 4DTPA 4M41A 2HW3A 4E89A 5EU7A 4EP5A 1VK0A 3NAEA 2PZSA 2G8HA 3OJUA 4M42A 1VSHA 4EZ9A 3ITHA 4FLXA 3SV4A 4KB0A 1CZBA 2DFHA 4CEFA 1J53A 1BGXT 3TI0A 1Q9XA 4FJ9A 3OS2A 1X9SA 2IAJA 1CXQA 4OLAA 1C0UA 1ZBFA 3VQ6A 4ZHRA 1BI4A 2RKIA 3OVNA 1LV5A 4FVMA 4XIUA 1ASWA 2VG5A 4E1MA 1KVCA 1JLCA 1RBTA 3ZSOA 3LDSA 3VQDA 4AHUA 4CJSA 3OYJA 2KZMA 4IDKA 2PYLA 2HHUA 4DFJA 1BIUA 1SUQA 4Y1CA 1YT3A 1HJRA 4CHOA 4KHWA 1JLFA 3SQ0A 3VN5A 1RDCA 4F2RA 1RT6A 4KO0A 4FM2A 3OYDA 1Y97A 1Z25A 1UAXA 2HNZA 4Z4GA 2X6SA 3V81A 2OZMA 3HPHA 4KI6A 3LWMA 4AILC 3K59A 3CG7A 3SPZA 4DQPA 4W5TA 3RMAA 4M3YA 3OYGA 1QHTA 4CGDA 3IAYA 4CF8A 1LWEA 3HYFA 3HL8A 4RW9A 3U6FA 1GOAA 3DLRA 3L2QA 1KLNA 4RW7A 5E41A 4AHVA 1NK5A 2IGIA 1EETA 1D5AA 4CGFA 4O4GA 3PX0A 4OGCA 2D0CA 3NBPA 4FZYA 4OPKA 1L3TA 3NDKA 2QKKA 1SL1A 2DFEA 4CEEA 1KCFA 1LAWA 3VQBA 3O4NA 4HTUA 5HROA 1A5WA 3SI6A 2YNIA 4GVMA 1TGOA 1F21A 4B9MA 2NUBA 3V1QA 2OPPA 1RT1A 3SUQA 4O0JA 5J2MA 5SZTA 4KPYA 5KRTA 1SV5A 1NK4A 4ELTA 3K58A 1HNIA 1QE1A 3VQ7A 3WNFA 4LY7A 3HXMA 4CJVA 1RCHA 2FBTA 3ZCMA 3KLEA 3DLHA 3C95A 3G0ZA 4KHUA 1IKVA 3CFOA 5HRPA 3HM9A 2BANA 3V9SA 3T19A 3ULDA 4BE2A 1X1PA 3SZ2A 5HRRA 1EXQA 4L8RB 4E1NA 3IG1A 4ID1A 4FLWA 1NKBA 2ETJA 1ZBHA 1HYVA 3AVLA 3O3HA 3C94A 4W5OA 5KI6A 3V1RA 3ZSWA 4DSJA 1QSLA 3L2VA 1WAFA 1WN7A 2KQ2A 2WONA 4OKEA 2OZSA 4Z4CA 1QTMA 2ATQA 2OYQA 1D9DA 3OYCA 2XY5A 4O44A 2F8SA 3QEIA 4IG3A 3K5MA 1WAJA 3ISNC 3ZSVA 1S1UA 4N56A 1N6QA 4FK4A 4DTSA 3NH0A 3ZT4A 1W9HA 3D0PA 1WSFA 3AVKA 4FJIA 1TKTA 1WSEA 3OYIA 3A2FA 1BL3A 1VSJA 4CK1A 1C1BA 4BACA 3SV3A 2B5JA 1XI1A 1DLOA 1NK9A 1NKEA 1HPZA 4CJFA 4KV8A 1S9EA 3B6OA 4LSLA 4N76A 1U4BA 4FJMA 4CJKA 2Q3SA 4KB1A 1J54A 1O1WA 5FDLA 3VQ5A 3SJJA 4I7FA 1TV6A 3AVBA 4YNQA 3RMCA 4KHSA 3LP0A 1IKXA 4QCLA 4J2EA 2KFNA 4ICLA 4NYNA 3SPYA 1BQMA 3DRSA 2G8UA 4JS5A 4B9VA 4N41A 4FXDA 3QEWA 2HHVA 1GOBA 3UIQA 3O3FA 4CEDA 3VQPA 4AHSA 3O3GA 1WNSA 1YTAA 3LAKA 1RTIA 4KHNA 3OYEA 3M8SA 2D0AA 3AV9A 3OS1A 2XY7A 2F96A 3M8PA
chains in the Genus database with same CATH superfamily
4DR2K 3RMDA 1BWFO 2CGLA 4IOAL 3L3UA 3JS6A 1HX1A 2D1KA 3KLIA 2E4LA 5JICA 1N34K 3WQUA 3L3VA 5BRFA 2P1JA 1FJGK 4JK8A 1YJNN 4XH5A 4DSEA 4BR2A 2GEMA 4N47A 3LP2A 4NYFA 4JD2A 4JKEA 3VGLA 3OYLA 3AA2A 3QINA 4FJ8A 1JLGA 4AHTA 1Q81O 4CGJA 3ZEUB 4KRFA 5F2RA 2DPNA 3ZSYA 1EX4A 4Q0BA 4RW6A 3U9ZA 3IKMA 3LM9A 5AFUH 4DR3K 1TUUA 3VENA 1NG9A 5C15A 4F2SA 1HYSA 4HCCA 2E20A 4DUZK 3GE1A 1JL1A 5BPLA 3GOIA 4JK7A 5M1PA 1GLDG 4JHDB 2VYPA 2ZJQL 3MCAB 3SNNA 4DU1A 3HBTA 4FLUA 3DOLA 2E8AA 1SS6A 5AQPA 3JXUA 5C24A 4ID5A 2YNGA 3QNNA 1BCMA 4OKKA 3VQEA 4EIAA 3CCMN 3ZT2A 3THXB 3S3NA 1NJZA 2KZZA 1RT2A 4M45A 4DR5K 3A5LC 2J4RA 4CJPA 4EHTA 3BDPA 3CQ8A 3TAQA 4JN4A 3QNOA 3F73A 4B1ZA 1YHQN 2XHBA 3RMBA 4HUFA 1XHXA 3CF5L 1N33K 3IMXA 2RN2A 4IFVA 2UXBK 1IKYA 3TANA 1RTDA 1M90O 2ASMA 3IS9A 4B9TA 2BTFA 5DK5A 4FOEA 1S1VA 4ELUA 1RDDA 4IG0A 4KH4A 1MU2A 1X9MA 2IS3A 2O8BB 4PKGA 3ZSXA 3H1VX 4CI6A 2HB5A 3EZWA 4BRFA 4JKCA 1RT3A 1ITGA 3EN9A 4CZIA 2Q31A 4JNEA 1T8EA 4CE9A 3MXMA 3ZSQA 4I9QA 1U48A 1ILYA 2YKNA 4BRDA 3TAGA 1QQCA 4CEOA 3AVJA 3VQ4A 3AVNA 2Q36A 3HSTB 4FCYA 4C8KA 1Z26A 3NE6A 1I39A 4J2BA 4PUOA 3SMSA 3QEVA 3ENOA 5A2QO 4CECA 5KGXA 3VF2A 1RBRA 5I3UA 1S5JA 4OGEA 4RG8A 2GWKA 4LD0A 3U4LA 1O13A 1KC8O 3BGRA 2FLOA 3QIOA 5JS2A 1HNWK 1DGKN 2EWSA 1TYQA 1S1WA 1E4GT 1KAXA 5AQOA 3KLGA 3GBTA 2QW9A 3TABA 2ZD1A 5J1EA 3THYA 4GV9A 1K8KA 2Z1JA 1QS4A 3AARA 2E1ZA 3JYTA 2FBXA 4DTJA 3T69A 2P51A 1SKWA 3TSQA 3CCQN 2P9IA 3O9TA 3J81O 4NXNK 5AQYA 3HT3A 4BR9A 4F3TA 3HJFA 2UXDK 2ITGA 4FWRA 4BQZA 3E1YA 4CF1A 1YI2N 4TSXA 2NLXA 5FROA 3AO2A 4CJTA 3V9WA 3RTVA 4DR7K 2E2OA 3HSCA 2ZF5O 4G1QA 1YJWN 4IKFA 5C0YA 4CJRA 4HWIA 2Y1JA 1T03A 3WXKA 4E7LA 1E4FT 2GUIA 1RBVA 1HJOA 3WT0A 1TK8A 4DTUA 4CIGA 4IJNA 3QDKA 3QERA 3DXKA 3L2RA 1X9JA 1W7AA 3NVMA 5JLFA 5AQIA 2YV0X 4K42A 2HHWA 1C0FA 2B4JA 4WE1A 2O4IA 1TVRA 4JKHA 2PFUA 4WQ5A 2EX3A 2QWLA 1HLUA 4M7XA 4FO0A 4ILJA 4BRHA 1EWRA 1VSFA 2B6AA 2FBVA 1NWKA 3M8QA 4FWMA 5BRHA 4CZKA 3A0IX 2V7ZA 3PV8A 4CJLA 4J8FA 3AVIA 4Z4FA 3AVFA 4JYAK 3TTFA 3TARA 5I42A 4JI7K 3ZX0A 3LAMA 2F7TA 1KVBA 3KK3A 3O4QA 1SKSA 2KKZA 1J5OA 4K8ZA 3O9SA 3SCXA 1B9DA 2RE2A 1NGGA 5CYMA 3ZT3A 4JLHA 4DHYA 4IDHA 2YKMA 3CPWM 5D3GA 3KZBA 4PY5A 3SAHA 3CQYA 3OYFA 3HPGA 4CIEA 3AAPA 1Z05A 2VG6A 3E01A 4Z94A 4GNIA 4L3QA 4CFCA 4AM6A 4YOWA 4H8KA 3O9UA 2I5JA 4CK3A 4C8LA 1TKZA 3SJHA 4GMJB 5IWAK 4K8XA 2E6MA 2HF3A 5KPZA 4B1VA 2HOEA 3LM2A 4M3TA 2QWMA 4DSFA 1YIJN 3PX6A 2G8IA 1UOCA 2QXFA 3PO5A 4WQ4C 4DTPA 4M41A 2V51B 4IWVA 4O8KA 3NAEA 4M42A 3CCLN 5EVZA 1EWQA 4KB1A 5EOYA 3SV4A 2DFHA 4CEFA 1BGXT 4BVOA 1CXQA 4OLAA 1GLJO 1NGCA 4ZHRA 5ADXA 5C12A 3HRGA 3O1WA 4E1MA 1V4SA 3R9PA 3ZSOA 4AHUA 3OYJA 3BY5A 4IDKA 3CIPA 4CHOA 3SQ0A 1RT6A 3A5NC 4LF4K 3OYDA 1Y97A 3HPHA 3LWMA 3UKUA 3K59A 4DQPA 3SPZA 1QHTA 4E1JA 2W6LA 4CGFA 3ZLJA 2D0CA 1L3TA 4BC5A 4JI1K 3NDKA 3VEZA 1SL1A 2QI2A 1KCFA 3SK3A 1MA9B 4GVMA 4B9MA 2WBNA 3V1QA 4ELTA 2QA4N 1QE1A 3PSFA 3VQ7A 3HXMA 3CC4N 3SMPA 3DXKB 4YOYA 3ZCMA 3KLEA 3WXMB 1WOQA 3C95A 3G0ZA 1IKVA 3CFOA 1K8AO 4BE2A 3D2EA 1HUXA 4CBXA 1EXQA 4L8RB 1QQOA 2YHWA 4FLWA 1ZBHA 1HYVA 4XH1A 2NRXA 5AQVA 1HPMA 3V1RA 1HKGA 1QTMA 4I6MA 1N36K 2XY5A 3F5TA 2F8SA 3VEOA 1HKCA 1WAJA 3MWPA 3ZSVA 4JKDA 4FK4A 4B1UB 3AVKA 4JI0K 2UYTA 3CJCA 3O1BA 1VSJA 3A2FA 5FPMA 1NK9A 4QOZB 2B5JA 1HPZA 1U4BA 4PL7A 3AVBA 4YNQA 1J5EK 4JKFA 1IKXA 4JI8K 4B1YB 4NXMK 2OANA 2G8UA 1BQMA 4FXDA 4K41A 3O3FA 1WNSA 1YTAA 4XEIA 1RTIA 3M8SA 2AA4A 5TKWA 3E9OA 2F96A 2IDOA 1RDAA 2IVPA 4DSKA 1XNQK 4DQ8A 3FFKB 3WXJA 3OHRA 3MEEA 3KK1A 4DMNA 5FRNA 4B8AB 1YTUA 3QFUA 3OS0A 4DV5K 4WFBL 4LF8K 3H6EA 2D5RA 2JGUA 1N5YA 1KFSA 5AQRA 5GAEP 1OVYA 3C6AA 4FJ7A 3OYNA 1IBMK 5FLXO 4KAZA 4DTOA 3OYKA 3MN7A 1NMDA 4C1NK 4JKGA 1RTJA 1A5XA 1MDUB 4E19A 3A5MC 4DF4A 1D8YA 3ENHA 4OX9K 4RW8A 1LW0A 3S41A 4O0IA 1TKXA 4DTXA 1TAUA 3ZSRA 3FZLA 3K9KA 1IG9A 4IO8A 3O9RA 4JEPA 3RR7A 4FJHA 4Y1DA 4CHZA 2OTLN 5LJWA 3HOTA 2XRIA 1HMVA 4M3WA 3P5JA 1NGHA 3WXIA 2FSNA 3U8XA 3VF6A 3H46O 2A6AA 4C8MA 5K14A 1E3MA 4LF5K 4FK0A 5AQHA 4BRCA 5KTQA 2RPIA 4FWNA 1YVNA 1J6ZA 4BWMA 2ZGYA 2HMIA 2HMPA 3PX4A 3V9UA 1T6DA 2PBDA 2YJEA 1W97L 4GKKK 4I9LA 2GWJA 1IV0A 3LWLA 3QETA 2Q97A 2EHGA 3UB5A 4YOVA 1REVA 1XQSC 4FLVA 4KTQA 4DCHA 1NJXA 2D0OA 1Q8IA 3HM8A 4JK9A 5JS1A 3ZT0A 1EKEA 3AA4A 3O6WA 3P38A 4E7JA 1NOYA 4EFHA 1VSMA 1G15A 3D6RA 4H5WA 5AQUA 3F2KA 2Q0RA 4BGAA 5AQLA 3KD1E 2ZQBA 3I8DA 3PIOL 3D2EB 1JKHA 3QESA 2O8FB 4NB4A 5BPMA 2Q1NA 4DS5A 1T05A 2JLEA 3K5OA 2IC3A 1DTQA 4BRQA 4YY3K 4CERA 3HP6A 3G4SN 3MWTA 4QAGA 4I6MB 4FZXC 3TWHA 1C1AA 1XC9A 3AO5A 3VERA 5KQDA 2E2QA 1U47A 3OY9A 1VSDA 3HTVA 3CJ7A 3WEEB 4HUEA 4V19S 4B1WB 1MWMA 1JLBA 2G8VA 1NGBA 3KLFA 3W3DA 5FPDA 4CEBA 1XMQK 1HR0K 1D9FA 1BU6O 5M1FA 3CFPA 3VETA 1S3XA 4LH5A 3DOKA 2P9KA 4NCGA 3F9KA 3AO1A 1X3NA 1DT9A 1QQNA 4FW1A 5BN9A 3GDQA 4E7IA 4CIFA 3MN9A 3L2UA 2D0BA 4DUYK 3VQCA 3CM6A 2PAVA 1Q18A 2YHXA 4CZFA 1SL2A 2QEXN 5M1KA 2HNYA 4H5RA 4E3SA 4M3RA 1JL2A 3SUPA 1T7PA 5AZIB 4KHQA 4WYBA 4HVJA 3LALA 2P9SA 2YHBA 1OH7A 1BI4B 4FJ5A 1BA1A 2KHOA 4KTWA 4F4KA 3MX5A 4HUGA 4QS9A 4JI5K 4YDUA 3OYHA 3G10A 5H1SQ 1KAYA 3CERA 1QSSA 4BY9C 3ID8A 1K6YA 1JXEA 3CJ1A 4LH4A 4B9SA 3FFIA 4BREA 2VGNA 2KLAA 4CGGA 3CJAA 4DWIA 1CZ9A 3AVMA 2IOCA 2O8EA 5DMRA 4A57A 3NMUA 1N32K 2KW4A 5KGWA 3NF8A 3KTQA 4ILGB 1FXXA 1GLLO 3VMFB 4IOCL 2AP1A 4CJWA 1H1VA 1RBSA 2X78A 3KWIA 1BISA 2NRRA 3ATUA 4KREA 3K5LA 2VWJA 3H3OB 4M7YA 3FZFA 5AQKA 4OPJA 2HVIA 1DTTA 3LP1A 1NK0A 1L3UA 1HNXK 4WFNL 3J7AP 3OTOK 3FZKA 4B9UA 4BRPA 5C42A 1KTQA 2HBLA 2O8CA 2OPQA 3D2FB 4KHPK 4CZMA 1C6VA 4AF1A 5AZJA 4CEAA 3ZSZA 2G8FA 5CHIA 1NGDA 4CF9A 3DI6A 4FJXA 3PY8A 4G9ZA 4CVNE 3BUZB 3F9MA 3IDHA 5T7BA 3L8BA 5HLFA 2BE2A 2P9UA 3P1GA 1KVAA 1S1TA 3KHYA 4UQGA 4PKHA 1KXPA 3K0SA 2X6NA 3M6GA 2NZTA 4K43A 3VGMA 1YF5L 3NFAA 5MLCQ 1XWLA 5CYQA 1JXBA 2QXLA 4K25A 4KHYA 1NLVA 5GADP 4DQQA 4B3RK 2E6LA 4HHTA 4EP4A 5F0XA 5LMNK 2PYJA 4OKJA 4DV3K 3KVGA 1WLJA 2KTQA 2YHAA 1NJYA 3LDPA 4DLEA 3EKUA 2F9WA 3N4QA 3QIPA 1ATRA 4DR1K 4BGBA 4Z0UA 4EZ6A 1HRHA 4GKJK 3LDNA 3VEYA 3J7ZO 5CR4A 4FJGA 3I0RA 2XY6A 4DQIA 4CJ7A 2CGJA 3PO4A 3V4IA 5J2NA 1VQ7N 2ZJPL 3C7NA 5DM6L 1KRPA 1NJIO 4DLGA 1WBDA 4DTMA 3DXMA 5EU7A 5M1QA 4EP5A 4IO9L 2G8HA 4GVEA 4FLXA 4A2AA 1J53A 4IFEA 3BP8A 1X9SA 3THWA 2P9KB 4GY2B 1ESVA 3VQ6A 1XMOK 3OVNA 1LV5A 2A5XA 4FVMA 4ISFA 1IG8A 3G71N 1KVCA 3VQDA 4CJSA 2PYLA 3AGKA 1BIUA 4CZGA 1SUQA 4KHWA 1HJRA 1JLFA 2UUAK 3SBTA 3VN5A 4WQ5C 1RDCA 1D4XA 3HI0A 4JD2B 4FM2A 4FPBA 4KH6A 3MDQA 3V81A 2BH1A 2E5LK 4KI6A 4W5TA 3RMAA 2NNWA 3OYGA 4H5NA 3IAYA 4BRMA 2E2PA 3HYFA 2P9SB 4RW9A 5AQFA 1GOAA 3DLRA 3WXLA 1KLNA 4O4GA 4YORA 5BREA 1NGAA 1QQMA 1ZXOA 4JKAA 1VQON 4CEEA 5HL7L 5LMUK 1A5WA 3SI6A 3CHWA 5FPNA 3SUQA 1XUPO 5SZTA 4BRLA 1NK4A 2QWQA 3K58A 2P9PA 4H5TA 1NGEA 3WNFA 2D4WA 4OPHA 5BR9A 3DLHA 4KHUA 3C65A 2IVNA 3ULDA 3SZ2A 5AQWA 3EE8A 2Q0UA 4ID1A 4MO4A 1NKBA 4EAHD 3M1FA 3PSIA 5KI6A 3D7EO 1QSLA 4JI4K 2IVOA 1U6ZA 1BG3A 2KQ2A 2WONA 3A5OC 3CETA 4CBWA 3K5MA 1VAZA 4FVUA 2W6KA 3E9LA 3ZT4A 3L6QA 4WFAL 1WSFA 3D0PA 1WSEA 4MLEA 1BL3A 4CK1A 1XI1A 4KV8A 4LSLA 1BUPA 4FJMA 2Q3SA 2A40A 1O1WA 4Y0WA 5C2FA 4I7FA 1TV6A 2WTUA 1NU0A 2KFNA 4ICLA 3GG4A 3DRSA 5F1XA 1HKBA 4JS5A 1BOTO 1GOBA 4CEDA 3P39A 4AHSA 3O3GA 4BC2A 4KHNA 2D0AA 2PY5A 2XY7A 4CD1A 2VCPA 2ZM6K 1RT4A 3K5NA 4B08A 3CCVN 4RW4A 3WNEA 3D45A 2W40A 1TYQB 2YNHA 3DM2A 4BE0A 1ZC6A 2OA8A 4MO5A 3QEXA 4J2AA 3OA9A 4JRQA 4KTZA 3QBXA 3THYB 1K8KB 2XY8A 4DKWA 4FJLA 3O5BA 4NCBA 4OPAA 5HRNA 3ID6A 3VQQA 2CH6A 4BVPA 2P9IB 4CHNA 1Z6RA 2W42A 4DV2K 3DXMB 1SL0A 4YOUA 4N5SA 3QICA 5DM7L 3R8EA 4CZEA 2UUBK 1HQEA 4DQSA 3R3LA 3UKRA 3NGYA 4DR6K 1I94K 2G8WA 2BGGA 4A5BA 4B8CA 4OLBA 3OJSA 4F8RA 4R5PA 3V9XA 2H3GX 4Z4IA 2E2NA 4YFUA 2HBJA 1RGIA 3CC2N 4E0DA 1LWCA 4CEZA 3M5RA 4B3MK 4B3TK 3LANA 5LL6Z 4FJNA 4XH4A 3AA5X 4BR4A 4CESA 2XO7A 3SUOA 3P83D 4H5VA 1HQUA 1U45A 2ASOA 1OH6A 2WFBA 1V4TA 5GAHP 4M63C 4BG9A 4CJ4A 2HHTA 4B9LA 1WSGA 4CGIA 2FC0A 4CHYA 1YJ9N 2Z1GA 5E84A 1NOZA 3ZT1A 1S1XA 4BDYA 3S3MA 3CD6N 1K73O 4Q5VA 3P4IA 1GLBG 1NK7A 2P9PB 1WSHA 1VRTA 3VQ8A 3CFRA 1TK0A 5JLHA 3DRPA 3FGUA 4DG1A 3VESA 3KKSA 4OJRA 2NRTA 1UA0A 1U2VA 2UU9K 3WUHA 2OPSA 2ZE2A 5KQ8A 1ZYQA 4E7KA 4CHQA 3AO4A 3ASMA 3BF3A 2CGKA 3R1XA 2D0PA 2RHKA 2GBZA 3VEXA 4FWLA 4FK2A 4H03B 3HO1A 3NF9A 3AVCA 1KQSM 2HHQA 1C1CA 3DLLL 4ISEA 3QFPA 2DFFA 3KLHA 3U3GA 1RTHA 4FJKA 1LOTB 4CJQA 4BQLA 2UUCK 1S6PA 2IIRA 1B92A 3M3ZA 5GINA 3KJVA 4PL8A 3FE1A 1L3SA 5C25A 1WBBA 1VRUA 1GLEG 1K9MO 2NRHA 1RDWX 3AVAA 1C0MA 1IBLK 3E66A 1Q82O 3LPUA 5GAGP 3DJCA 3EO3A 3ENBA 3MXIA 3SUNA 4CK2A 4R79A 3OYBA 1UWBA 4A5AA 1RT7A 2OPRA 3CMEN 1ATSA 2LSNA 4LSNA 1RNHA 3ZEUA 3HP9A 1FKOA 3J7YP 3FLCO 1Q9YA 4IOXA 3SYZA 1S22A 2FSJA 3KKRA 2Z1HA 3IFRA 2Q2RA 2F4VK 3VEVA 3CCUN 4BRKA 2P5GA 2GUPA 5BN8A 5GIOA 3V9ZA 4UY8O 1RDBA 1ZBIA 1X3MA 1FKPA 3T1AA 4BC3A 1TKDA 3MEGA 4CBUA 1YVUA 2JWKA 4BE1A 1TAQA 4PA1A 3UKUB 1TL3A 4CJUA 5C10A 4E7HA 3CC7N 1OH5A 3THXA 2HVHA 5FPEA 3CJBA 3NGIA 4DS4A 4DFMA 4FJJA 2YJFA 1JLQA 3RR8A 1CXUA 3NF6A 4OVLA 4FM1A 1S6QA 4DFPA 1GLFO 1C0TA 3RVCA 2Y1IA 5CY4A 3SQ4A 4PHTX 1HNVA 4FM0A 2A42A 2ZJRL 3VF4A 2WC9A 3H08A 1FK9A 3K2PA 5LJVA 3C6UA 2FXUA 4DSIA 3CQXA 2G8KA 2BDPA 5IT9O 2A3ZA 3O80A 5M1OA 4LFCK 2X74A 3I56N 2NRWA 2KFZA 4CFAA 3ZYYX 3BF1A 4CW7B 3CPEA 4I2PA 4X66K 4MFBA 4B3OA 4FOIA 5GIPA 3V1OA 5AQGA 1BO5O 2E1YA 1GLCG 1EQYA 1BQNA 1YITN 4CFBA 1S72N 3OYMA 4DR4K 4OO1J 3SAGA 4RWTA 1VQ5N 1U04A 4ISGA 3OBYA 2QTDA 5SWMA 4C8OA 1BIZA 4DU3A 1VSIA 3TSPA 4NO7A 3QBWA 4ELVA 1EP4A 3AVHA 4NLCA 1R59O 4CZJA 1JLAA 1J9AA 4H0VB 2FSKA 4PQUA 3VQ9A 4DTRA 3TAFA 3QMLA 3S3OA 1CZAN 2A1SA 3CJ9A 5J2PA 4LFBK 4WCEL 4J2DA 1X9WA 5KRSA 3TTDA 4RTFD 4CF0A 2WUSA 3LPTA 2I7NA 3S9HA 1NK6A 3TSUA 4YDUC 4MDBA 4A62A 4U67L 3P31A 4BG8A 3CYMA 4QS7A 3KK2A 1NGJA 1DKGD 1TK5A 3DLKA 3FZMA 3C0BA 4GV6A 5EX5A 4BR7A 3R6MA 4E89A 3CXCM 3OJUA 1VSHA 1VQ9N 4EZ9A 5AFUA 4FJ9A 4BRIA 4JV5K 3OS2A 2IAJA 1ZBFA 4WF9L 4XIUA 1ASWA 4BRNA 1JLCA 1RBTA 4DFJA 4Y1CA 1YT3A 4JKGB 4F2RA 2YCHA 4H0YB 4KO0A 4Z4GA 1Z25A 2HNZA 2OZMA 4MLHA 1P90A 1WB9A 3CG7A 1C0GA 5M1NA 4M3YA 4CGDA 4JI6K 4CF8A 1LWEA 3HL8A 5E26A 4RCHA 5E41A 3Q7CA 2VQFK 4AHVA 1NK5A 3EE9A 4OGCA 3NBPA 4FZYA 2O8DA 5AQTA 1NGIA 4FSVA 1M1KO 2DFEA 4FWQA 3CCSN 3O4NA 5HROA 1P8ZA 1TGOA 2V52B 3SLCA 1F21A 2OPPA 4O0JA 3EL2A 4KPYA 5KRTA 1SV5A 5LY3A 4H0TB 1HNIA 4CJVA 2FBTA 5HRPA 2BANA 5KPTA 3V9SA 3DWLA 1X1PA 4DV4K 5HRRA 1QVFM 4E1NA 4X64K 2ETJA 3AVLA 4W5OA 4DSJA 1QZ6A 3L2VA 1ZBSA 1WN7A 1JJ2M 4Z4CA 2OYQA 2ATQA 3OYCA 1EO1A 2QWPA 4JI3K 4IG3A 3ISNC 1S1UA 4N56A 1T6CA 1NBWA 4FWSA 1HNZK 3L0QA 2VQEK 2YHYA 4FJIA 4BACA 3SV3A 1C1BA 4M3UA 1DLOA 4N76A 1S9EA 3B6OA 1Y64A 4CJKA 4FWOA 2P9LA 5FDLA 3RMCA 4DV7K 3O4WA 3LP0A 1FW6A 3ATVA 4QCLA 4LF6K 4J2EA 3CCRN 2JWLA 4NYNA 4X65K 3W0LA 2YI1A 3QEWA 1JCEA 4DV6K 3G25A 5AQNA 3VQPA 3E9PA 3LAKA 3AV9A 3O8MA 2P5OA 3M8PA 1L5UA 1BDGA 3EY1A 5HBMA 4JI2K 3RRGA 1QVGM 3KIOA 3OYAA 1RT5A 3V6DA 3WNGA 2AJQA 4M3ZA 3VEWA 3DLBA 2P9NA 4AHRA 1W0HA 4CFDA 1L3VA 4LFAK 3HVRA 2DY4A 4F3OA 4BR0A 3I0SA 3PLAA 3T1HK 1GLAG 2FBYA 3EZ5A 5EXWA 1VHXA 3MECA 3T1YK 3TPQA 1UA1A 2QK9A 4Z4HA 4AHCA 4DTNA 1IKWA 3TTCA 4CEQA 3MAQA 1KAZA 3VQAA 5EY4A 4W5NA 5JVGL 2ASPA 1LW2A 3I33A 2GV9A 3B6PA 5HRSA 4H0PA 3MK6A 4F9OA 2QWRA 3ULEA 4NCAA 3CCEN 3VTIA 3JSMA 3MN6A 4HCBA 1RDUA 2A1RA 3L4QA 1VSKA 1IO2A 4FLYA 3HZ6A 4FL9A 1GOCA 5CZ2A 3PIPL 4DU4A 2O8EB 1MWKA 3CMAN 2R7YA 4BRAA 2O8DB 2YNFA 3NH2A 3DLGA 3THVA 3ZX2A 1TL1A 4MQ3A 3NCIA 4AM7A 4O8UA 4A2BA 1JCFA 5HP1A 3J8AA 3NHGA 4FW2A 5JMVA 1OVQA 3LZIA 1JCGA 4W5QA 3MMVA 2WOMA 4JKBA 4KI4A 4H4OA 4MDAA 3K57A 3HK2A 5CE3A 4BC4A 2HHSA 3TAEA 5BRDA 3ZETA 2O8CB 1IBKK 3TR8A 4PWDA 5AZJB 2HBMA 1ZBUA 3LZJA 4DSLA 2DTUA 1QSYA 3MEDA 4I2QA 1VQ8N 5FRMA 3QEPA 3TAPA 2Z1IA 3ZX3A 2P9UB 4KKOA 1OH8A 1LAVA 1RILA 4O5FA 4X62K 3Q7BA 1BCOA 3HOSA 4IXCA 3QLHA 1ASUA 4W5RA 4JS4A 4IZ9A 3DLEA 1KLMA 2ZWHA 3BEXA 2P9LB 4DV0K 4DB3A 1W2BM 1LCUA 5AR0A 3CM5A 3VTHA 3NVKA 1NJWA 4FZZA 4BR5A 4CCHA 3AA3A 2BUPA 3RWUA 3BZKA 1G99A 1SAZA 4QS8A 5AQSA 1Q86O 3LDOA 1KD1O 2OTJN 1ZBLA 3LP3A 2ZGZA 3C6TA 1XHZA 4C8NA 3SQ2A 2F8TA 1YUWA 4JRPA 1JLEA 3HVTA 3DYAA 3C7NB 2QKBA 2RF2A 4CD3A 3AO3A 3KD5E 2O4GA 4B9NA 1OKJA 5TKYA 4M3XA 3ALYA 3H45C 2P9NB 4HTLA 4CGHA 3THWB 4FYDA 3EYZA 4CJ5A 4CJ3A 1Q7YO 5ADXH 4BRGA 4IBNA 5HOOA 2QWNA 1LWFA 4KH5A 4ZTJA 1VQPN 2GX9A 3DMJA 3I8BA 4FLZA 4IFYA 5C2DA 2QM1A 3IRXA 3A8YA 1B9FA 3VA3A 4DQRA 4WQ4A 3DRRA 4GW6A 2HNDA 3H3NO 1I3AA 1WSIA 3OBWA 4DF8A 3RSEA 4O55A 4CJEA 3JAMO 3H1QA 2FF3B 4LF9K 1NK8A 1VQNN 3VA0A 4Z4EA 3ULEB 4A59A 4DV1K 4JAXA 2GELA 3QO9A 4CHPA 4BWJA 2YX6A 2QWOA 3B8AX 3FZHA 1SKRA 3PUFA 3L2WA 1A5VA 4AQYK 1RFQA 4O5BA 5AJ3K 3NH1A 3EKSA 1KSPA 2GTDA 3L4IA 1NKCA 1R0AA 5J2QA 5B8HA 3CI5A 5CZ1A 2ITMA 2NRZA 2VWBA 1NGFA 1DEJA 4C1NI 2O8FA 3O08A 1VSLA 2VG7A 3EEQA 3QB0A 2VWKA 4KFBA 3DAWA 3TAMA 3M8RA 4ZTFA 4FWKA 3N4PA 4FLTA 1ASVA 2HF4A 3NGZA 3AVGA 1ATNA 1QZ5A 1RBUA 3T3FA 4NLBA 1KFDA 4AH9A 1NM1A 3WEEA 4IJAA 3SQ1A 1WSJA 4U7BA 3LDLA 3U9DA 4BDZA 3ZETB 2FF6A 4DFKA 1CLQA 1BHLA 3U3YA 5I9EB 5AQQA 3RRHA 3MXJA 3IUCA 2UXCK 3NF7A 4H4MA 1U49A 4CF2A 3WNHA 1VSEA 3I55N 5BPNA 2HHXA 3AGRA 3C6HA 3MCPA 2CH5A 1IH7A 1QHAA 1HYZA 4A61A 1BA0A 4BDPA 1S9GA 3HPOA 2OCEA 4B9QA 2HW3A 1VK0A 3UE5A 2PZSA 5AZIA 3O9QA 3ITHA 4KB0A 3VOVA 1CZBA 3J80O 4YHHK 3TI0A 3CCJN 1Q9XA 4IEEA 3MX2A 1C0UA 1BI4A 2RKIA 1VQ6N 2VG5A 4CZHA 1SZ2A 3LDSA 2KZMA 4BROA 2HHUA 1N8RO 2HBKA 1VQMN 5BR8K 1WUAA 4EHUA 2W41A 4ILHA 1SQKA 3T7ZA 4JHDA 4C23A 3LL3A 1UAXA 2X6SA 3AAQA 4AILC 3FR0A 5JVHL 5ELZA 3UKRB 3U6FA 4GV3A 3MN5A 3L2QA 4H0OA 4RW7A 3G6EN 4LF7K 3KWGA 2IGIA 1EETA 1D5AA 3PX0A 1NNEA 2I7PA 3SAFA 4OPKA 2E88A 2F9TA 2QKKA 1LAWA 3VQBA 5AQXA 4HTUA 2YNIA 1TUYA 2NUBA 4IEIA 4K0KK 1RT1A 5J2MA 1XC3A 4LY7A 1RCHA 3RSEB 3VPZA 3K9JA 3VGKA 3KK7A 5AQJA 2HSTA 3HM9A 2O8BA 3LDQA 3D2FA 3T19A 3TU5A 1IJJA 3IG1A 5KPRA 4CZLA 1VQ4N 3O3HA 3C94A 3ZSWA 4B1XB 4YOXA 1WAFA 4OKEA 2OZSA 2VGMA 4FWPA 1D9DA 2V7YA 4O44A 3QEIA 4B3SK 1N6QA 1T3VA 4DTSA 3NH0A 1YXQA 1W9HA 1TKTA 5AQZA 3OYIA 1U2VB 1NKEA 4CJFA 3GL1A 1VQLN 4PKIA 2A41A 1J54A 3OW2M 2NRVA 3VQ5A 3SJJA 4YOTA 4FPAA 4KHSA 1NMNA 3SPYA 4N41A 4KBOA 4B9VA 2HHVA 3WQTA 1T44A 4H0XB 3SBGA 3UIQA 3BZCA 1VQKN 1XNRK 2HHHK 5AQMA 1YAGA 4LC9B 3OYEA 3OS1A 3AY9A
chains in the Genus database with same CATH topology
3RMDA 1L5UA 2IDOA 1RDAA 4DSKA 1RT4A 3K5NA 4B08A 3EY1A 3L3UA 4RW4A 3WNEA 5HBMA 3RRGA 3KIOA 3OYAA 1RT5A 3D45A 2YNHA 3DM2A 4BE0A 3V6DA 3MEEA 3KK1A 3KLIA 4DMNA 3WNGA 4B8AB 2E4LA 2OA8A 5FRNA 1YTUA 4J2AA 3QEXA 4M3ZA 3OS0A 3DLBA 2AJQA 4JRQA 4AHRA 4KTZA 4M3UA 2D5RA 1W0HA 2JGUA 2XY8A 4CFDA 1N5YA 1L3VA 3L3VA 1KFSA 3HVRA 2DY4A 4FJLA 2P1JA 4F3OA 3I0SA 4FJ7A 3OYNA 4NCBA 4KAZA 4DSEA 4DTOA 3OYKA 4N47A 5HRNA 1RTJA 1A5XA 2FBYA 3LP2A 4NYFA 3VQQA 3EZ5A 4E19A 3MECA 3OYLA 4CHNA 2W42A 4DF4A 1D8YA 3AA2A 3QINA 1UA1A 4FJ8A 1SL0A 2QK9A 4Z4HA 4N5SA 1JLGA 4AHTA 4AHCA 4RW8A 4CGJA 4DTNA 1LW0A 4KRFA 1HQEA 4O0IA 4DQSA 3ZSYA 1IKWA 1TKXA 4CEQA 3MAQA 3VQAA 4DTXA 1TAUA 4W5NA 1EX4A 3ZSRA 3NGYA 4Q0BA 4RW6A 1LW2A 2G8WA 1IG9A 2GV9A 2BGGA 3RR7A 3B6PA 4B8CA 4FJHA 5HRSA 4Y1DA 4OLBA 4CHZA 1HYSA 4F2SA 4HCCA 3OJSA 4F8RA 4NCAA 1JL1A 2XRIA 3JSMA 4R5PA 1HMVA 3V9XA 4HCBA 4M3WA 4Z4IA 3P5JA 3SNNA 4YFUA 2A1RA 4DU1A 1VSKA 4E0DA 1IO2A 1LWCA 4C8MA 3DOLA 4CEZA 5K14A 4FLYA 4FLUA 4FJNA 3LANA 4FK0A 5C24A 3AA5X 4ID5A 2YNGA 4CESA 2XO7A 3QNNA 5KTQA 2RPIA 3SUOA 1BCMA 1GOCA 1HQUA 3P83D 4OKKA 3VQEA 5CZ2A 3ZT2A 3S3NA 1NJZA 4DU4A 1RT2A 4M45A 4BWMA 1U45A 2KZZA 2HMIA 3PX4A 3V9UA 2R7YA 4CJ4A 2YNFA 3NH2A 4CJPA 4B9LA 3DLGA 3BDPA 4I9LA 3CQ8A 1WSGA 4CGIA 3THVA 3TAQA 1TL1A 3LWLA 3QETA 2FC0A 4MQ3A 2EHGA 4KTQA 4CHYA 3NCIA 3QNOA 2Z1GA 3F73A 3S3MA 1NOZA 3ZT1A 1S1XA 4BDYA 2XHBA 3RMBA 4HUFA 1REVA 4Q5VA 1XHXA 4FLVA 2RN2A 4IFVA 1NJXA 5HP1A 1Q8IA 1IKYA 3TANA 1NK7A 3NHGA 4FW2A 5JS1A 3ZT0A 1RTDA 1EKEA 3AA4A 1WSHA 4W5QA 3LZIA 1VRTA 3VQ8A 3CFRA 1TK0A 2WOMA 4E7JA 3IS9A 3DRPA 4B9TA 5DK5A 1NOYA 4ELUA 1S1VA 4DWIA 1VSMA 1RDDA 4DG1A 4H4OA 4KI4A 4IG0A 1G15A 3KKSA 1MU2A 3K57A 1X9MA 3HK2A 2IS3A 4OJRA 3KD1E 2ZQBA 1UA0A 3I8DA 2HHSA 3TAEA 3ZSXA 1JKHA 3QESA 2HB5A 2OPSA 2ZE2A 3TR8A 4PWDA 1RT3A 1ITGA 4DS5A 1T05A 1ZYQA 1ZBUA 4E7KA 4CHQA 3AO4A 3ASMA 2JLEA 3K5OA 4CE9A 2IC3A 1T8EA 3LZJA 3MXMA 4DSLA 1DTQA 3ZSQA 1QSYA 3MEDA 4I2QA 4CERA 1U48A 3HP6A 4I9QA 5FRMA 2DTUA 4QAGA 2YKNA 3TAGA 3QEPA 1QQCA 2Z1IA 3TAPA 4CEOA 4FZXC 2GBZA 3AVJA 3TWHA 1C1AA 3VQ4A 3AVNA 4KKOA 1LAVA 3HSTB 4FCYA 4FK2A 1XC9A 4C8KA 3AO5A 1RILA 1Z26A 1I39A 3NE6A 2PY5A 4J2BA 1U47A 3NF9A 3OY9A 3AVCA 4PUOA 3HO1A 1BCOA 1C1CA 1VSDA 2HHQA 3QEVA 3QLHA 1ASUA 4CECA 1RBRA 5KGXA 4HUEA 2DFFA 4W5RA 1S5JA 4OGEA 4RG8A 3KLHA 4JS4A 4LD0A 5I3UA 3DLEA 1KLMA 3BGRA 3U3GA 1JLBA 1RTHA 3QIOA 4FJKA 5JS2A 2G8VA 3KLFA 4CJQA 1S1WA 1S6PA 3CM5A 4CEBA 1B92A 3KLGA 3KJVA 3CFPA 1NJWA 1D9FA 3TABA 2P5OA 2ZD1A 4FZZA 4CCHA 3AA3A 1L3SA 5C25A 3RWUA 1VRUA 4LH5A 4QOZB 5J1EA 3DOKA 4NCGA 3F9KA 3AO1A 2Z1JA 1QS4A 4FW1A 3AVAA 1ZBLA 3LP3A 1C0MA 3JYTA 4E7IA 2FBXA 3LPUA 3C6TA 1XHZA 4C8NA 4CIFA 4DTJA 3SQ2A 3MXIA 3SUNA 3L2UA 2F8TA 2P51A 4CK2A 1SKWA 2D0BA 4JRPA 3VQCA 3OYBA 3CM6A 1JLEA 1UWBA 3HVTA 3DYAA 2QKBA 1RT7A 2RF2A 2OPRA 3AO3A 1SL2A 2HNYA 2LSNA 4LSNA 2O4GA 3KD5E 1RNHA 4E3SA 4B9NA 3HT3A 4M3XA 4M3RA 3HP9A 1JL2A 3SUPA 1FKOA 1T7PA 3HJFA 3ALYA 4F3TA 4KHQA 2ITGA 1Q9YA 4CF1A 3SYZA 4HVJA 3KKRA 2Z1HA 4TSXA 3LALA 5FROA 3AO2A 4CJTA 2YHBA 4CGHA 3RTVA 3V9WA 4FYDA 3EYZA 1BI4B 4FJ5A 4CJ5A 4KTWA 4G1QA 4IKFA 4F4KA 4HUGA 4CJRA 2Y1JA 2P5GA 4CJ3A 1T03A 3V9ZA 3OYHA 3G10A 1RDBA 4E7LA 1FKPA 4IBNA 3T1AA 1ZBIA 1LWFA 4ZTJA 1TKDA 3MEGA 1QSSA 3DMJA 4FLZA 1K6YA 1JXEA 4IFYA 4LH4A 1YVUA 3IRXA 2GUIA 4B9SA 1RBVA 1B9FA 3FFIA 4BE1A 3VA3A 4DQRA 2HHTA 3DRRA 4CGGA 1TAQA 4PA1A 1TL3A 4GW6A 2HNDA 4CJUA 4E7HA 1CZ9A 3AVMA 4DTUA 4CIGA 1TK8A 1I3AA 1WSIA 2HVHA 2IOCA 4DF8A 5DMRA 4O55A 3NGIA 3QERA 4CJEA 3L2RA 4DS4A 2KW4A 4DFMA 5KGWA 3NF8A 4FJJA 1NK8A 1JLQA 3VA0A 3RR8A 3KTQA 1CXUA 2YV0X 2HHWA 1FXXA 4Z4EA 3NF6A 4OVLA 4FM1A 1S6QA 2B4JA 4DFPA 1C0TA 3QO9A 2X78A 1RBSA 4WE1A 5CY4A 4CJWA 4CHPA 4BWJA 1TVRA 2Y1IA 3SQ4A 1HNVA 2O4IA 4FM0A 1SKRA 1BISA 3PUFA 3L2WA 4KREA 1A5VA 3K5LA 3H08A 2EX3A 2VWJA 1FK9A 3K2PA 3C6UA 4O5BA 4DSIA 3NH1A 2G8KA 4OPJA 2HVIA 1DTTA 1KSPA 2BDPA 3LP1A 1NKCA 1VSFA 2B6AA 1R0AA 1NK0A 2FBVA 5J2QA 1L3UA 5CZ1A 3M8QA 2X74A 4B9UA 2KFZA 4CFAA 5C42A 1KTQA 3PV8A 2OPQA 1VSLA 2VG7A 4CJLA 4I2PA 3AVIA 4Z4FA 3AVFA 3TARA 4MFBA 2VWKA 5I42A 4KFBA 4B3OA 1C6VA 3LAMA 3V1OA 4CEAA 1KVBA 3TAMA 3ZSZA 2G8FA 3M8RA 4ZTFA 3KK3A 4CF9A 1BQNA 3DI6A 3O4QA 1SKSA 3PY8A 4FJXA 1J5OA 4FLTA 1ASVA 4CFBA 5T7BA 3NGZA 3AVGA 3L8BA 5HLFA 3OYMA 2BE2A 3P1GA 4K8ZA 1KVAA 1S1TA 1U04A 3SCXA 5SWMA 4C8OA 1B9DA 1BIZA 1RBUA 5CYMA 3ZT3A 4DU3A 4UQGA 1VSIA 3T3FA 4JLHA 1KFDA 2YKMA 5D3GA 4AH9A 2X6NA 3SQ1A 1WSJA 3NFAA 4PY5A 4ELVA 4BDZA 3OYFA 1EP4A 3HPGA 4CIEA 3AVHA 1XWLA 2VG6A 3E01A 5CYQA 1JXBA 1JLAA 4KHYA 1J9AA 4PQUA 4DFKA 3VQ9A 1CLQA 4DQQA 4DTRA 1BHLA 2E6LA 4CFCA 4HHTA 4EP4A 3U3YA 3TAFA 3S3OA 2PYJA 2A1SA 5J2PA 4OKJA 4H8KA 2KTQA 1WLJA 2YHAA 1X9WA 5KRSA 2I5JA 4CK3A 3RRHA 3MXJA 1NJYA 4J2DA 4DLEA 4C8LA 4CF0A 1TKZA 3LPTA 4GMJB 3NF7A 3QIPA 4H4MA 3S9HA 4CF2A 4Z0UA 1U49A 1HRHA 3WNHA 1NK6A 4EZ6A 4K8XA 2E6MA 1VSEA 4FJGA 2HHXA 3I0RA 2XY6A 4DQIA 4M3TA 4DSFA 3PO4A 3PX6A 3CYMA 3V4IA 5J2NA 1IH7A 3KK2A 1HYZA 1UOCA 2QXFA 2G8IA 4BDPA 1TK5A 1KRPA 3PO5A 3DLKA 4DLGA 1S9GA 4DTMA 3HPOA 4DTPA 4M41A 2HW3A 4E89A 5EU7A 4EP5A 1VK0A 3NAEA 2PZSA 2G8HA 3OJUA 4M42A 1VSHA 4EZ9A 3ITHA 4FLXA 3SV4A 4KB0A 1CZBA 2DFHA 4CEFA 1J53A 1BGXT 3TI0A 1Q9XA 4FJ9A 3OS2A 1X9SA 2IAJA 1CXQA 4OLAA 1C0UA 1ZBFA 3VQ6A 4ZHRA 1BI4A 2RKIA 3OVNA 1LV5A 4FVMA 4XIUA 1ASWA 2VG5A 4E1MA 1KVCA 1JLCA 1RBTA 3ZSOA 3LDSA 3VQDA 4AHUA 4CJSA 3OYJA 2KZMA 4IDKA 2PYLA 2HHUA 4DFJA 1BIUA 1SUQA 4Y1CA 1YT3A 1HJRA 4CHOA 4KHWA 1JLFA 3SQ0A 3VN5A 1RDCA 4F2RA 1RT6A 4KO0A 4FM2A 3OYDA 1Y97A 1Z25A 1UAXA 2HNZA 4Z4GA 2X6SA 3V81A 2OZMA 3HPHA 4KI6A 3LWMA 4AILC 3K59A 3CG7A 3SPZA 4DQPA 4W5TA 3RMAA 4M3YA 3OYGA 1QHTA 4CGDA 3IAYA 4CF8A 1LWEA 3HYFA 3HL8A 4RW9A 3U6FA 1GOAA 3DLRA 3L2QA 1KLNA 4RW7A 5E41A 4AHVA 1NK5A 2IGIA 1EETA 1D5AA 4CGFA 4O4GA 3PX0A 4OGCA 2D0CA 3NBPA 4FZYA 4OPKA 1L3TA 3NDKA 2QKKA 1SL1A 2DFEA 4CEEA 1KCFA 1LAWA 3VQBA 3O4NA 4HTUA 5HROA 1A5WA 3SI6A 2YNIA 4GVMA 1TGOA 1F21A 4B9MA 2NUBA 3V1QA 2OPPA 1RT1A 3SUQA 4O0JA 5J2MA 5SZTA 4KPYA 5KRTA 1SV5A 1NK4A 4ELTA 3K58A 1HNIA 1QE1A 3VQ7A 3WNFA 4LY7A 3HXMA 4CJVA 1RCHA 2FBTA 3ZCMA 3KLEA 3DLHA 3C95A 3G0ZA 4KHUA 1IKVA 3CFOA 5HRPA 3HM9A 2BANA 3V9SA 3T19A 3ULDA 4BE2A 1X1PA 3SZ2A 5HRRA 1EXQA 4L8RB 4E1NA 3IG1A 4ID1A 4FLWA 1NKBA 2ETJA 1ZBHA 1HYVA 3AVLA 3O3HA 3C94A 4W5OA 5KI6A 3V1RA 3ZSWA 4DSJA 1QSLA 3L2VA 1WAFA 1WN7A 2KQ2A 2WONA 4OKEA 2OZSA 4Z4CA 1QTMA 2ATQA 2OYQA 1D9DA 3OYCA 2XY5A 4O44A 2F8SA 3QEIA 4IG3A 3K5MA 1WAJA 3ISNC 3ZSVA 1S1UA 4N56A 1N6QA 4FK4A 4DTSA 3NH0A 3ZT4A 1W9HA 3D0PA 1WSFA 3AVKA 4FJIA 1TKTA 1WSEA 3OYIA 3A2FA 1BL3A 1VSJA 4CK1A 1C1BA 4BACA 3SV3A 2B5JA 1XI1A 1DLOA 1NK9A 1NKEA 1HPZA 4CJFA 4KV8A 1S9EA 3B6OA 4LSLA 4N76A 1U4BA 4FJMA 4CJKA 2Q3SA 4KB1A 1J54A 1O1WA 5FDLA 3VQ5A 3SJJA 4I7FA 1TV6A 3AVBA 4YNQA 3RMCA 4KHSA 3LP0A 1IKXA 4QCLA 4J2EA 2KFNA 4ICLA 4NYNA 3SPYA 1BQMA 3DRSA 2G8UA 4JS5A 4B9VA 4N41A 4FXDA 3QEWA 2HHVA 1GOBA 3UIQA 3O3FA 4CEDA 3VQPA 4AHSA 3O3GA 1WNSA 1YTAA 3LAKA 1RTIA 4KHNA 3OYEA 3M8SA 2D0AA 3AV9A 3OS1A 2XY7A 2F96A 3M8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMD A;  1L5U A;  2IDO A;  1RDA A;  4DSK A;  1RT4 A;  3K5N A;  4B08 A;  3EY1 A;  3L3U A;  4RW4 A;  3WNE A;  5HBM A;  3RRG A;  3KIO A;  3OYA A;  1RT5 A;  3D45 A;  2YNH A;  3DM2 A;  4BE0 A;  3V6D A;  3MEE A;  3KK1 A;  3KLI A;  4DMN A;  3WNG A;  4B8A B;  2E4L A;  2OA8 A;  5FRN A;  1YTU A;  4J2A A;  3QEX A;  4M3Z A;  3OS0 A;  3DLB A;  2AJQ A;  4JRQ A;  4AHR A;  4KTZ A;  4M3U A;  2D5R A;  1W0H A;  2JGU A;  2XY8 A;  4CFD A;  1N5Y A;  1L3V A;  3L3V A;  1KFS A;  3HVR A;  2DY4 A;  4FJL A;  2P1J A;  4F3O A;  3I0S A;  4FJ7 A;  3OYN A;  4NCB A;  4KAZ A;  4DSE A;  4DTO A;  3OYK A;  4N47 A;  5HRN A;  1RTJ A;  1A5X A;  2FBY A;  3LP2 A;  4NYF A;  3VQQ A;  3EZ5 A;  4E19 A;  3MEC A;  3OYL A;  4CHN A;  2W42 A;  4DF4 A;  1D8Y A;  3AA2 A;  3QIN A;  1UA1 A;  4FJ8 A;  1SL0 A;  2QK9 A;  4Z4H A;  4N5S A;  1JLG A;  4AHT A;  4AHC A;  4RW8 A;  4CGJ A;  4DTN A;  1LW0 A;  4KRF A;  1HQE A;  4O0I A;  4DQS A;  3ZSY A;  1IKW A;  1TKX A;  4CEQ A;  3MAQ A;  3VQA A;  4DTX A;  1TAU A;  4W5N A;  1EX4 A;  3ZSR A;  3NGY A;  4Q0B A;  4RW6 A;  1LW2 A;  2G8W A;  1IG9 A;  2GV9 A;  2BGG A;  3RR7 A;  3B6P A;  4B8C A;  4FJH A;  5HRS A;  4Y1D A;  4OLB A;  4CHZ A;  1HYS A;  4F2S A;  4HCC A;  3OJS A;  4F8R A;  4NCA A;  1JL1 A;  2XRI A;  3JSM A;  4R5P A;  1HMV A;  3V9X A;  4HCB A;  4M3W A;  4Z4I A;  3P5J A;  3SNN A;  4YFU A;  2A1R A;  4DU1 A;  1VSK A;  4E0D A;  1IO2 A;  1LWC A;  4C8M A;  3DOL A;  4CEZ A;  5K14 A;  4FLY A;  4FLU A;  4FJN A;  3LAN A;  4FK0 A;  5C24 A;  3AA5 X;  4ID5 A;  2YNG A;  4CES A;  2XO7 A;  3QNN A;  5KTQ A;  2RPI A;  3SUO A;  1BCM A;  1GOC A;  1HQU A;  3P83 D;  4OKK A;  3VQE A;  5CZ2 A;  3ZT2 A;  3S3N A;  1NJZ A;  4DU4 A;  1RT2 A;  4M45 A;  4BWM A;  1U45 A;  2KZZ A;  2HMI A;  3PX4 A;  3V9U A;  2R7Y A;  4CJ4 A;  2YNF A;  3NH2 A;  4CJP A;  4B9L A;  3DLG A;  3BDP A;  4I9L A;  3CQ8 A;  1WSG A;  4CGI A;  3THV A;  3TAQ A;  1TL1 A;  3LWL A;  3QET A;  2FC0 A;  4MQ3 A;  2EHG A;  4KTQ A;  4CHY A;  3NCI A;  3QNO A;  2Z1G A;  3F73 A;  3S3M A;  1NOZ A;  3ZT1 A;  1S1X A;  4BDY A;  2XHB A;  3RMB A;  4HUF A;  1REV A;  4Q5V A;  1XHX A;  4FLV A;  2RN2 A;  4IFV A;  1NJX A;  5HP1 A;  1Q8I A;  1IKY A;  3TAN A;  1NK7 A;  3NHG A;  4FW2 A;  5JS1 A;  3ZT0 A;  1RTD A;  1EKE A;  3AA4 A;  1WSH A;  4W5Q A;  3LZI A;  1VRT A;  3VQ8 A;  3CFR A;  1TK0 A;  2WOM A;  4E7J A;  3IS9 A;  3DRP A;  4B9T A;  5DK5 A;  1NOY A;  4ELU A;  1S1V A;  4DWI A;  1VSM A;  1RDD A;  4DG1 A;  4H4O A;  4KI4 A;  4IG0 A;  1G15 A;  3KKS A;  1MU2 A;  3K57 A;  1X9M A;  3HK2 A;  2IS3 A;  4OJR A;  3KD1 E;  2ZQB A;  1UA0 A;  3I8D A;  2HHS A;  3TAE A;  3ZSX A;  1JKH A;  3QES A;  2HB5 A;  2OPS A;  2ZE2 A;  3TR8 A;  4PWD A;  1RT3 A;  1ITG A;  4DS5 A;  1T05 A;  1ZYQ A;  1ZBU A;  4E7K A;  4CHQ A;  3AO4 A;  3ASM A;  2JLE A;  3K5O A;  4CE9 A;  2IC3 A;  1T8E A;  3LZJ A;  3MXM A;  4DSL A;  1DTQ A;  3ZSQ A;  1QSY A;  3MED A;  4I2Q A;  4CER A;  1U48 A;  3HP6 A;  4I9Q A;  5FRM A;  2DTU A;  4QAG A;  2YKN A;  3TAG A;  3QEP A;  1QQC A;  2Z1I A;  3TAP A;  4CEO A;  4FZX C;  2GBZ A;  3AVJ A;  3TWH A;  1C1A A;  3VQ4 A;  3AVN A;  4KKO A;  1LAV A;  3HST B;  4FCY A;  4FK2 A;  1XC9 A;  4C8K A;  3AO5 A;  1RIL A;  1Z26 A;  1I39 A;  3NE6 A;  2PY5 A;  4J2B A;  1U47 A;  3NF9 A;  3OY9 A;  3AVC A;  4PUO A;  3HO1 A;  1BCO A;  1C1C A;  1VSD A;  2HHQ A;  3QEV A;  3QLH A;  1ASU A;  4CEC A;  1RBR A;  5KGX A;  4HUE A;  2DFF A;  4W5R A;  1S5J A;  4OGE A;  4RG8 A;  3KLH A;  4JS4 A;  4LD0 A;  5I3U A;  3DLE A;  1KLM A;  3BGR A;  3U3G A;  1JLB A;  1RTH A;  3QIO A;  4FJK A;  5JS2 A;  2G8V A;  3KLF A;  4CJQ A;  1S1W A;  1S6P A;  3CM5 A;  4CEB A;  1B92 A;  3KLG A;  3KJV A;  3CFP A;  1NJW A;  1D9F A;  3TAB A;  2P5O A;  2ZD1 A;  4FZZ A;  4CCH A;  3AA3 A;  1L3S A;  5C25 A;  3RWU A;  1VRU A;  4LH5 A;  4QOZ B;  5J1E A;  3DOK A;  4NCG A;  3F9K A;  3AO1 A;  2Z1J A;  1QS4 A;  4FW1 A;  3AVA A;  1ZBL A;  3LP3 A;  1C0M A;  3JYT A;  4E7I A;  2FBX A;  3LPU A;  3C6T A;  1XHZ A;  4C8N A;  4CIF A;  4DTJ A;  3SQ2 A;  3MXI A;  3SUN A;  3L2U A;  2F8T A;  2P51 A;  4CK2 A;  1SKW A;  2D0B A;  4JRP A;  3VQC A;  3OYB A;  3CM6 A;  1JLE A;  1UWB A;  3HVT A;  3DYA A;  2QKB A;  1RT7 A;  2RF2 A;  2OPR A;  3AO3 A;  1SL2 A;  2HNY A;  2LSN A;  4LSN A;  2O4G A;  3KD5 E;  1RNH A;  4E3S A;  4B9N A;  3HT3 A;  4M3X A;  4M3R A;  3HP9 A;  1JL2 A;  3SUP A;  1FKO A;  1T7P A;  3HJF A;  3ALY A;  4F3T A;  4KHQ A;  2ITG A;  1Q9Y A;  4CF1 A;  3SYZ A;  4HVJ A;  3KKR A;  2Z1H A;  4TSX A;  3LAL A;  5FRO A;  3AO2 A;  4CJT A;  2YHB A;  4CGH A;  3RTV A;  3V9W A;  4FYD A;  3EYZ A;  1BI4 B;  4FJ5 A;  4CJ5 A;  4KTW A;  4G1Q A;  4IKF A;  4F4K A;  4HUG A;  4CJR A;  2Y1J A;  2P5G A;  4CJ3 A;  1T03 A;  3V9Z A;  3OYH A;  3G10 A;  1RDB A;  4E7L A;  1FKP A;  4IBN A;  3T1A A;  1ZBI A;  1LWF A;  4ZTJ A;  1TKD A;  3MEG A;  1QSS A;  3DMJ A;  4FLZ A;  1K6Y A;  1JXE A;  4IFY A;  4LH4 A;  1YVU A;  3IRX A;  2GUI A;  4B9S A;  1RBV A;  1B9F A;  3FFI A;  4BE1 A;  3VA3 A;  4DQR A;  2HHT A;  3DRR A;  4CGG A;  1TAQ A;  4PA1 A;  1TL3 A;  4GW6 A;  2HND A;  4CJU A;  4E7H A;  1CZ9 A;  3AVM A;  4DTU A;  4CIG A;  1TK8 A;  1I3A A;  1WSI A;  2HVH A;  2IOC A;  4DF8 A;  5DMR A;  4O55 A;  3NGI A;  3QER A;  4CJE A;  3L2R A;  4DS4 A;  2KW4 A;  4DFM A;  5KGW A;  3NF8 A;  4FJJ A;  1NK8 A;  1JLQ A;  3VA0 A;  3RR8 A;  3KTQ A;  1CXU A;  2YV0 X;  2HHW A;  1FXX A;  4Z4E A;  3NF6 A;  4OVL A;  4FM1 A;  1S6Q A;  2B4J A;  4DFP A;  1C0T A;  3QO9 A;  2X78 A;  1RBS A;  4WE1 A;  5CY4 A;  4CJW A;  4CHP A;  4BWJ A;  1TVR A;  2Y1I A;  3SQ4 A;  1HNV A;  2O4I A;  4FM0 A;  1SKR A;  1BIS A;  3PUF A;  3L2W A;  4KRE A;  1A5V A;  3K5L A;  3H08 A;  2EX3 A;  2VWJ A;  1FK9 A;  3K2P A;  3C6U A;  4O5B A;  4DSI A;  3NH1 A;  2G8K A;  4OPJ A;  2HVI A;  1DTT A;  1KSP A;  2BDP A;  3LP1 A;  1NKC A;  1VSF A;  2B6A A;  1R0A A;  1NK0 A;  2FBV A;  5J2Q A;  1L3U A;  5CZ1 A;  3M8Q A;  2X74 A;  4B9U A;  2KFZ A;  4CFA A;  5C42 A;  1KTQ A;  3PV8 A;  2OPQ A;  1VSL A;  2VG7 A;  4CJL A;  4I2P A;  3AVI A;  4Z4F A;  3AVF A;  3TAR A;  4MFB A;  2VWK A;  5I42 A;  4KFB A;  4B3O A;  1C6V A;  3LAM A;  3V1O A;  4CEA A;  1KVB A;  3TAM A;  3ZSZ A;  2G8F A;  3M8R A;  4ZTF A;  3KK3 A;  4CF9 A;  1BQN A;  3DI6 A;  3O4Q A;  1SKS A;  3PY8 A;  4FJX A;  1J5O A;  4FLT A;  1ASV A;  4CFB A;  5T7B A;  3NGZ A;  3AVG A;  3L8B A;  5HLF A;  3OYM A;  2BE2 A;  3P1G A;  4K8Z A;  1KVA A;  1S1T A;  1U04 A;  3SCX A;  5SWM A;  4C8O A;  1B9D A;  1BIZ A;  1RBU A;  5CYM A;  3ZT3 A;  4DU3 A;  4UQG A;  1VSI A;  3T3F A;  4JLH A;  1KFD A;  2YKM A;  5D3G A;  4AH9 A;  2X6N A;  3SQ1 A;  1WSJ A;  3NFA A;  4PY5 A;  4ELV A;  4BDZ A;  3OYF A;  1EP4 A;  3HPG A;  4CIE A;  3AVH A;  1XWL A;  2VG6 A;  3E01 A;  5CYQ A;  1JXB A;  1JLA A;  4KHY A;  1J9A A;  4PQU A;  4DFK A;  3VQ9 A;  1CLQ A;  4DQQ A;  4DTR A;  1BHL A;  2E6L A;  4CFC A;  4HHT A;  4EP4 A;  3U3Y A;  3TAF A;  3S3O A;  2PYJ A;  2A1S A;  5J2P A;  4OKJ A;  4H8K A;  2KTQ A;  1WLJ A;  2YHA A;  1X9W A;  5KRS A;  2I5J A;  4CK3 A;  3RRH A;  3MXJ A;  1NJY A;  4J2D A;  4DLE A;  4C8L A;  4CF0 A;  1TKZ A;  3LPT A;  4GMJ B;  3NF7 A;  3QIP A;  4H4M A;  3S9H A;  4CF2 A;  4Z0U A;  1U49 A;  1HRH A;  3WNH A;  1NK6 A;  4EZ6 A;  4K8X A;  2E6M A;  1VSE A;  4FJG A;  2HHX A;  3I0R A;  2XY6 A;  4DQI A;  4M3T A;  4DSF A;  3PO4 A;  3PX6 A;  3CYM A;  3V4I A;  5J2N A;  1IH7 A;  3KK2 A;  1HYZ A;  1UOC A;  2QXF A;  2G8I A;  4BDP A;  1TK5 A;  1KRP A;  3PO5 A;  3DLK A;  4DLG A;  1S9G A;  4DTM A;  3HPO A;  4DTP A;  4M41 A;  2HW3 A;  4E89 A;  5EU7 A;  4EP5 A;  1VK0 A;  3NAE A;  2PZS A;  2G8H A;  3OJU A;  4M42 A;  1VSH A;  4EZ9 A;  3ITH A;  4FLX A;  3SV4 A;  4KB0 A;  1CZB A;  2DFH A;  4CEF A;  1J53 A;  1BGX T;  3TI0 A;  1Q9X A;  4FJ9 A;  3OS2 A;  1X9S A;  2IAJ A;  1CXQ A;  4OLA A;  1C0U A;  1ZBF A;  3VQ6 A;  4ZHR A;  1BI4 A;  2RKI A;  3OVN A;  1LV5 A;  4FVM A;  4XIU A;  1ASW A;  2VG5 A;  4E1M A;  1KVC A;  1JLC A;  1RBT A;  3ZSO A;  3LDS A;  3VQD A;  4AHU A;  4CJS A;  3OYJ A;  2KZM A;  4IDK A;  2PYL A;  2HHU A;  4DFJ A;  1BIU A;  1SUQ A;  4Y1C A;  1YT3 A;  1HJR A;  4CHO A;  4KHW A;  1JLF A;  3SQ0 A;  3VN5 A;  1RDC A;  4F2R A;  1RT6 A;  4KO0 A;  4FM2 A;  3OYD A;  1Y97 A;  1Z25 A;  1UAX A;  2HNZ A;  4Z4G A;  2X6S A;  3V81 A;  2OZM A;  3HPH A;  4KI6 A;  3LWM A;  4AIL C;  3K59 A;  3CG7 A;  3SPZ A;  4DQP A;  4W5T A;  3RMA A;  4M3Y A;  3OYG A;  1QHT A;  4CGD A;  3IAY A;  4CF8 A;  1LWE A;  3HYF A;  3HL8 A;  4RW9 A;  3U6F A;  1GOA A;  3DLR A;  3L2Q A;  1KLN A;  4RW7 A;  5E41 A;  4AHV A;  1NK5 A;  2IGI A;  1EET A;  1D5A A;  4CGF A;  4O4G A;  3PX0 A;  4OGC A;  2D0C A;  3NBP A;  4FZY A;  4OPK A;  1L3T A;  3NDK A;  2QKK A;  1SL1 A;  2DFE A;  4CEE A;  1KCF A;  1LAW A;  3VQB A;  3O4N A;  4HTU A;  5HRO A;  1A5W A;  3SI6 A;  2YNI A;  4GVM A;  1TGO A;  1F21 A;  4B9M A;  2NUB A;  3V1Q A;  2OPP A;  1RT1 A;  3SUQ A;  4O0J A;  5J2M A;  5SZT A;  4KPY A;  5KRT A;  1SV5 A;  1NK4 A;  4ELT A;  3K58 A;  1HNI A;  1QE1 A;  3VQ7 A;  3WNF A;  4LY7 A;  3HXM A;  4CJV A;  1RCH A;  2FBT A;  3ZCM A;  3KLE A;  3DLH A;  3C95 A;  3G0Z A;  4KHU A;  1IKV A;  3CFO A;  5HRP A;  3HM9 A;  2BAN A;  3V9S A;  3T19 A;  3ULD A;  4BE2 A;  1X1P A;  3SZ2 A;  5HRR A;  1EXQ A;  4L8R B;  4E1N A;  3IG1 A;  4ID1 A;  4FLW A;  1NKB A;  2ETJ A;  1ZBH A;  1HYV A;  3AVL A;  3O3H A;  3C94 A;  4W5O A;  5KI6 A;  3V1R A;  3ZSW A;  4DSJ A;  1QSL A;  3L2V A;  1WAF A;  1WN7 A;  2KQ2 A;  2WON A;  4OKE A;  2OZS A;  4Z4C A;  1QTM A;  2ATQ A;  2OYQ A;  1D9D A;  3OYC A;  2XY5 A;  4O44 A;  2F8S A;  3QEI A;  4IG3 A;  3K5M A;  1WAJ A;  3ISN C;  3ZSV A;  1S1U A;  4N56 A;  1N6Q A;  4FK4 A;  4DTS A;  3NH0 A;  3ZT4 A;  1W9H A;  3D0P A;  1WSF A;  3AVK A;  4FJI A;  1TKT A;  1WSE A;  3OYI A;  3A2F A;  1BL3 A;  1VSJ A;  4CK1 A;  1C1B A;  4BAC A;  3SV3 A;  2B5J A;  1XI1 A;  1DLO A;  1NK9 A;  1NKE A;  1HPZ A;  4CJF A;  4KV8 A;  1S9E A;  3B6O A;  4LSL A;  4N76 A;  1U4B A;  4FJM A;  4CJK A;  2Q3S A;  4KB1 A;  1J54 A;  1O1W A;  5FDL A;  3VQ5 A;  3SJJ A;  4I7F A;  1TV6 A;  3AVB A;  4YNQ A;  3RMC A;  4KHS A;  3LP0 A;  1IKX A;  4QCL A;  4J2E A;  2KFN A;  4ICL A;  4NYN A;  3SPY A;  1BQM A;  3DRS A;  2G8U A;  4JS5 A;  4B9V A;  4N41 A;  4FXD A;  3QEW A;  2HHV A;  1GOB A;  3UIQ A;  3O3F A;  4CED A;  3VQP A;  4AHS A;  3O3G A;  1WNS A;  1YTA A;  3LAK A;  1RTI A;  4KHN A;  3OYE A;  3M8S A;  2D0A A;  3AV9 A;  3OS1 A;  2XY7 A;  2F96 A;  3M8P A; 
#chains in the Genus database with same CATH topology
 4DR2 K;  3RMD A;  1BWF O;  2CGL A;  4IOA L;  3L3U A;  3JS6 A;  1HX1 A;  2D1K A;  3KLI A;  2E4L A;  5JIC A;  1N34 K;  3WQU A;  3L3V A;  5BRF A;  2P1J A;  1FJG K;  4JK8 A;  1YJN N;  4XH5 A;  4DSE A;  4BR2 A;  2GEM A;  4N47 A;  3LP2 A;  4NYF A;  4JD2 A;  4JKE A;  3VGL A;  3OYL A;  3AA2 A;  3QIN A;  4FJ8 A;  1JLG A;  4AHT A;  1Q81 O;  4CGJ A;  3ZEU B;  4KRF A;  5F2R A;  2DPN A;  3ZSY A;  1EX4 A;  4Q0B A;  4RW6 A;  3U9Z A;  3IKM A;  3LM9 A;  5AFU H;  4DR3 K;  1TUU A;  3VEN A;  1NG9 A;  5C15 A;  4F2S A;  1HYS A;  4HCC A;  2E20 A;  4DUZ K;  3GE1 A;  1JL1 A;  5BPL A;  3GOI A;  4JK7 A;  5M1P A;  1GLD G;  4JHD B;  2VYP A;  2ZJQ L;  3MCA B;  3SNN A;  4DU1 A;  3HBT A;  4FLU A;  3DOL A;  2E8A A;  1SS6 A;  5AQP A;  3JXU A;  5C24 A;  4ID5 A;  2YNG A;  3QNN A;  1BCM A;  4OKK A;  3VQE A;  4EIA A;  3CCM N;  3ZT2 A;  3THX B;  3S3N A;  1NJZ A;  2KZZ A;  1RT2 A;  4M45 A;  4DR5 K;  3A5L C;  2J4R A;  4CJP A;  4EHT A;  3BDP A;  3CQ8 A;  3TAQ A;  4JN4 A;  3QNO A;  3F73 A;  4B1Z A;  1YHQ N;  2XHB A;  3RMB A;  4HUF A;  1XHX A;  3CF5 L;  1N33 K;  3IMX A;  2RN2 A;  4IFV A;  2UXB K;  1IKY A;  3TAN A;  1RTD A;  1M90 O;  2ASM A;  3IS9 A;  4B9T A;  2BTF A;  5DK5 A;  4FOE A;  1S1V A;  4ELU A;  1RDD A;  4IG0 A;  4KH4 A;  1MU2 A;  1X9M A;  2IS3 A;  2O8B B;  4PKG A;  3ZSX A;  3H1V X;  4CI6 A;  2HB5 A;  3EZW A;  4BRF A;  4JKC A;  1RT3 A;  1ITG A;  3EN9 A;  4CZI A;  2Q31 A;  4JNE A;  1T8E A;  4CE9 A;  3MXM A;  3ZSQ A;  4I9Q A;  1U48 A;  1ILY A;  2YKN A;  4BRD A;  3TAG A;  1QQC A;  4CEO A;  3AVJ A;  3VQ4 A;  3AVN A;  2Q36 A;  3HST B;  4FCY A;  4C8K A;  1Z26 A;  3NE6 A;  1I39 A;  4J2B A;  4PUO A;  3SMS A;  3QEV A;  3ENO A;  5A2Q O;  4CEC A;  5KGX A;  3VF2 A;  1RBR A;  5I3U A;  1S5J A;  4OGE A;  4RG8 A;  2GWK A;  4LD0 A;  3U4L A;  1O13 A;  1KC8 O;  3BGR A;  2FLO A;  3QIO A;  5JS2 A;  1HNW K;  1DGK N;  2EWS A;  1TYQ A;  1S1W A;  1E4G T;  1KAX A;  5AQO A;  3KLG A;  3GBT A;  2QW9 A;  3TAB A;  2ZD1 A;  5J1E A;  3THY A;  4GV9 A;  1K8K A;  2Z1J A;  1QS4 A;  3AAR A;  2E1Z A;  3JYT A;  2FBX A;  4DTJ A;  3T69 A;  2P51 A;  1SKW A;  3TSQ A;  3CCQ N;  2P9I A;  3O9T A;  3J81 O;  4NXN K;  5AQY A;  3HT3 A;  4BR9 A;  4F3T A;  3HJF A;  2UXD K;  2ITG A;  4FWR A;  4BQZ A;  3E1Y A;  4CF1 A;  1YI2 N;  4TSX A;  2NLX A;  5FRO A;  3AO2 A;  4CJT A;  3V9W A;  3RTV A;  4DR7 K;  2E2O A;  3HSC A;  2ZF5 O;  4G1Q A;  1YJW N;  4IKF A;  5C0Y A;  4CJR A;  4HWI A;  2Y1J A;  1T03 A;  3WXK A;  4E7L A;  1E4F T;  2GUI A;  1RBV A;  1HJO A;  3WT0 A;  1TK8 A;  4DTU A;  4CIG A;  4IJN A;  3QDK A;  3QER A;  3DXK A;  3L2R A;  1X9J A;  1W7A A;  3NVM A;  5JLF A;  5AQI A;  2YV0 X;  4K42 A;  2HHW A;  1C0F A;  2B4J A;  4WE1 A;  2O4I A;  1TVR A;  4JKH A;  2PFU A;  4WQ5 A;  2EX3 A;  2QWL A;  1HLU A;  4M7X A;  4FO0 A;  4ILJ A;  4BRH A;  1EWR A;  1VSF A;  2B6A A;  2FBV A;  1NWK A;  3M8Q A;  4FWM A;  5BRH A;  4CZK A;  3A0I X;  2V7Z A;  3PV8 A;  4CJL A;  4J8F A;  3AVI A;  4Z4F A;  3AVF A;  4JYA K;  3TTF A;  3TAR A;  5I42 A;  4JI7 K;  3ZX0 A;  3LAM A;  2F7T A;  1KVB A;  3KK3 A;  3O4Q A;  1SKS A;  2KKZ A;  1J5O A;  4K8Z A;  3O9S A;  3SCX A;  1B9D A;  2RE2 A;  1NGG A;  5CYM A;  3ZT3 A;  4JLH A;  4DHY A;  4IDH A;  2YKM A;  3CPW M;  5D3G A;  3KZB A;  4PY5 A;  3SAH A;  3CQY A;  3OYF A;  3HPG A;  4CIE A;  3AAP A;  1Z05 A;  2VG6 A;  3E01 A;  4Z94 A;  4GNI A;  4L3Q A;  4CFC A;  4AM6 A;  4YOW A;  4H8K A;  3O9U A;  2I5J A;  4CK3 A;  4C8L A;  1TKZ A;  3SJH A;  4GMJ B;  5IWA K;  4K8X A;  2E6M A;  2HF3 A;  5KPZ A;  4B1V A;  2HOE A;  3LM2 A;  4M3T A;  2QWM A;  4DSF A;  1YIJ N;  3PX6 A;  2G8I A;  1UOC A;  2QXF A;  3PO5 A;  4WQ4 C;  4DTP A;  4M41 A;  2V51 B;  4IWV A;  4O8K A;  3NAE A;  4M42 A;  3CCL N;  5EVZ A;  1EWQ A;  4KB1 A;  5EOY A;  3SV4 A;  2DFH A;  4CEF A;  1BGX T;  4BVO A;  1CXQ A;  4OLA A;  1GLJ O;  1NGC A;  4ZHR A;  5ADX A;  5C12 A;  3HRG A;  3O1W A;  4E1M A;  1V4S A;  3R9P A;  3ZSO A;  4AHU A;  3OYJ A;  3BY5 A;  4IDK A;  3CIP A;  4CHO A;  3SQ0 A;  1RT6 A;  3A5N C;  4LF4 K;  3OYD A;  1Y97 A;  3HPH A;  3LWM A;  3UKU A;  3K59 A;  4DQP A;  3SPZ A;  1QHT A;  4E1J A;  2W6L A;  4CGF A;  3ZLJ A;  2D0C A;  1L3T A;  4BC5 A;  4JI1 K;  3NDK A;  3VEZ A;  1SL1 A;  2QI2 A;  1KCF A;  3SK3 A;  1MA9 B;  4GVM A;  4B9M A;  2WBN A;  3V1Q A;  4ELT A;  2QA4 N;  1QE1 A;  3PSF A;  3VQ7 A;  3HXM A;  3CC4 N;  3SMP A;  3DXK B;  4YOY A;  3ZCM A;  3KLE A;  3WXM B;  1WOQ A;  3C95 A;  3G0Z A;  1IKV A;  3CFO A;  1K8A O;  4BE2 A;  3D2E A;  1HUX A;  4CBX A;  1EXQ A;  4L8R B;  1QQO A;  2YHW A;  4FLW A;  1ZBH A;  1HYV A;  4XH1 A;  2NRX A;  5AQV A;  1HPM A;  3V1R A;  1HKG A;  1QTM A;  4I6M A;  1N36 K;  2XY5 A;  3F5T A;  2F8S A;  3VEO A;  1HKC A;  1WAJ A;  3MWP A;  3ZSV A;  4JKD A;  4FK4 A;  4B1U B;  3AVK A;  4JI0 K;  2UYT A;  3CJC A;  3O1B A;  1VSJ A;  3A2F A;  5FPM A;  1NK9 A;  4QOZ B;  2B5J A;  1HPZ A;  1U4B A;  4PL7 A;  3AVB A;  4YNQ A;  1J5E K;  4JKF A;  1IKX A;  4JI8 K;  4B1Y B;  4NXM K;  2OAN A;  2G8U A;  1BQM A;  4FXD A;  4K41 A;  3O3F A;  1WNS A;  1YTA A;  4XEI A;  1RTI A;  3M8S A;  2AA4 A;  5TKW A;  3E9O A;  2F96 A;  2IDO A;  1RDA A;  2IVP A;  4DSK A;  1XNQ K;  4DQ8 A;  3FFK B;  3WXJ A;  3OHR A;  3MEE A;  3KK1 A;  4DMN A;  5FRN A;  4B8A B;  1YTU A;  3QFU A;  3OS0 A;  4DV5 K;  4WFB L;  4LF8 K;  3H6E A;  2D5R A;  2JGU A;  1N5Y A;  1KFS A;  5AQR A;  5GAE P;  1OVY A;  3C6A A;  4FJ7 A;  3OYN A;  1IBM K;  5FLX O;  4KAZ A;  4DTO A;  3OYK A;  3MN7 A;  1NMD A;  4C1N K;  4JKG A;  1RTJ A;  1A5X A;  1MDU B;  4E19 A;  3A5M C;  4DF4 A;  1D8Y A;  3ENH A;  4OX9 K;  4RW8 A;  1LW0 A;  3S41 A;  4O0I A;  1TKX A;  4DTX A;  1TAU A;  3ZSR A;  3FZL A;  3K9K A;  1IG9 A;  4IO8 A;  3O9R A;  4JEP A;  3RR7 A;  4FJH A;  4Y1D A;  4CHZ A;  2OTL N;  5LJW A;  3HOT A;  2XRI A;  1HMV A;  4M3W A;  3P5J A;  1NGH A;  3WXI A;  2FSN A;  3U8X A;  3VF6 A;  3H46 O;  2A6A A;  4C8M A;  5K14 A;  1E3M A;  4LF5 K;  4FK0 A;  5AQH A;  4BRC A;  5KTQ A;  2RPI A;  4FWN A;  1YVN A;  1J6Z A;  4BWM A;  2ZGY A;  2HMI A;  2HMP A;  3PX4 A;  3V9U A;  1T6D A;  2PBD A;  2YJE A;  1W97 L;  4GKK K;  4I9L A;  2GWJ A;  1IV0 A;  3LWL A;  3QET A;  2Q97 A;  2EHG A;  3UB5 A;  4YOV A;  1REV A;  1XQS C;  4FLV A;  4KTQ A;  4DCH A;  1NJX A;  2D0O A;  1Q8I A;  3HM8 A;  4JK9 A;  5JS1 A;  3ZT0 A;  1EKE A;  3AA4 A;  3O6W A;  3P38 A;  4E7J A;  1NOY A;  4EFH A;  1VSM A;  1G15 A;  3D6R A;  4H5W A;  5AQU A;  3F2K A;  2Q0R A;  4BGA A;  5AQL A;  3KD1 E;  2ZQB A;  3I8D A;  3PIO L;  3D2E B;  1JKH A;  3QES A;  2O8F B;  4NB4 A;  5BPM A;  2Q1N A;  4DS5 A;  1T05 A;  2JLE A;  3K5O A;  2IC3 A;  1DTQ A;  4BRQ A;  4YY3 K;  4CER A;  3HP6 A;  3G4S N;  3MWT A;  4QAG A;  4I6M B;  4FZX C;  3TWH A;  1C1A A;  1XC9 A;  3AO5 A;  3VER A;  5KQD A;  2E2Q A;  1U47 A;  3OY9 A;  1VSD A;  3HTV A;  3CJ7 A;  3WEE B;  4HUE A;  4V19 S;  4B1W B;  1MWM A;  1JLB A;  2G8V A;  1NGB A;  3KLF A;  3W3D A;  5FPD A;  4CEB A;  1XMQ K;  1HR0 K;  1D9F A;  1BU6 O;  5M1F A;  3CFP A;  3VET A;  1S3X A;  4LH5 A;  3DOK A;  2P9K A;  4NCG A;  3F9K A;  3AO1 A;  1X3N A;  1DT9 A;  1QQN A;  4FW1 A;  5BN9 A;  3GDQ A;  4E7I A;  4CIF A;  3MN9 A;  3L2U A;  2D0B A;  4DUY K;  3VQC A;  3CM6 A;  2PAV A;  1Q18 A;  2YHX A;  4CZF A;  1SL2 A;  2QEX N;  5M1K A;  2HNY A;  4H5R A;  4E3S A;  4M3R A;  1JL2 A;  3SUP A;  1T7P A;  5AZI B;  4KHQ A;  4WYB A;  4HVJ A;  3LAL A;  2P9S A;  2YHB A;  1OH7 A;  1BI4 B;  4FJ5 A;  1BA1 A;  2KHO A;  4KTW A;  4F4K A;  3MX5 A;  4HUG A;  4QS9 A;  4JI5 K;  4YDU A;  3OYH A;  3G10 A;  5H1S Q;  1KAY A;  3CER A;  1QSS A;  4BY9 C;  3ID8 A;  1K6Y A;  1JXE A;  3CJ1 A;  4LH4 A;  4B9S A;  3FFI A;  4BRE A;  2VGN A;  2KLA A;  4CGG A;  3CJA A;  4DWI A;  1CZ9 A;  3AVM A;  2IOC A;  2O8E A;  5DMR A;  4A57 A;  3NMU A;  1N32 K;  2KW4 A;  5KGW A;  3NF8 A;  3KTQ A;  4ILG B;  1FXX A;  1GLL O;  3VMF B;  4IOC L;  2AP1 A;  4CJW A;  1H1V A;  1RBS A;  2X78 A;  3KWI A;  1BIS A;  2NRR A;  3ATU A;  4KRE A;  3K5L A;  2VWJ A;  3H3O B;  4M7Y A;  3FZF A;  5AQK A;  4OPJ A;  2HVI A;  1DTT A;  3LP1 A;  1NK0 A;  1L3U A;  1HNX K;  4WFN L;  3J7A P;  3OTO K;  3FZK A;  4B9U A;  4BRP A;  5C42 A;  1KTQ A;  2HBL A;  2O8C A;  2OPQ A;  3D2F B;  4KHP K;  4CZM A;  1C6V A;  4AF1 A;  5AZJ A;  4CEA A;  3ZSZ A;  2G8F A;  5CHI A;  1NGD A;  4CF9 A;  3DI6 A;  4FJX A;  3PY8 A;  4G9Z A;  4CVN E;  3BUZ B;  3F9M A;  3IDH A;  5T7B A;  3L8B A;  5HLF A;  2BE2 A;  2P9U A;  3P1G A;  1KVA A;  1S1T A;  3KHY A;  4UQG A;  4PKH A;  1KXP A;  3K0S A;  2X6N A;  3M6G A;  2NZT A;  4K43 A;  3VGM A;  1YF5 L;  3NFA A;  5MLC Q;  1XWL A;  5CYQ A;  1JXB A;  2QXL A;  4K25 A;  4KHY A;  1NLV A;  5GAD P;  4DQQ A;  4B3R K;  2E6L A;  4HHT A;  4EP4 A;  5F0X A;  5LMN K;  2PYJ A;  4OKJ A;  4DV3 K;  3KVG A;  1WLJ A;  2KTQ A;  2YHA A;  1NJY A;  3LDP A;  4DLE A;  3EKU A;  2F9W A;  3N4Q A;  3QIP A;  1ATR A;  4DR1 K;  4BGB A;  4Z0U A;  4EZ6 A;  1HRH A;  4GKJ K;  3LDN A;  3VEY A;  3J7Z O;  5CR4 A;  4FJG A;  3I0R A;  2XY6 A;  4DQI A;  4CJ7 A;  2CGJ A;  3PO4 A;  3V4I A;  5J2N A;  1VQ7 N;  2ZJP L;  3C7N A;  5DM6 L;  1KRP A;  1NJI O;  4DLG A;  1WBD A;  4DTM A;  3DXM A;  5EU7 A;  5M1Q A;  4EP5 A;  4IO9 L;  2G8H A;  4GVE A;  4FLX A;  4A2A A;  1J53 A;  4IFE A;  3BP8 A;  1X9S A;  3THW A;  2P9K B;  4GY2 B;  1ESV A;  3VQ6 A;  1XMO K;  3OVN A;  1LV5 A;  2A5X A;  4FVM A;  4ISF A;  1IG8 A;  3G71 N;  1KVC A;  3VQD A;  4CJS A;  2PYL A;  3AGK A;  1BIU A;  4CZG A;  1SUQ A;  4KHW A;  1HJR A;  1JLF A;  2UUA K;  3SBT A;  3VN5 A;  4WQ5 C;  1RDC A;  1D4X A;  3HI0 A;  4JD2 B;  4FM2 A;  4FPB A;  4KH6 A;  3MDQ A;  3V81 A;  2BH1 A;  2E5L K;  4KI6 A;  4W5T A;  3RMA A;  2NNW A;  3OYG A;  4H5N A;  3IAY A;  4BRM A;  2E2P A;  3HYF A;  2P9S B;  4RW9 A;  5AQF A;  1GOA A;  3DLR A;  3WXL A;  1KLN A;  4O4G A;  4YOR A;  5BRE A;  1NGA A;  1QQM A;  1ZXO A;  4JKA A;  1VQO N;  4CEE A;  5HL7 L;  5LMU K;  1A5W A;  3SI6 A;  3CHW A;  5FPN A;  3SUQ A;  1XUP O;  5SZT A;  4BRL A;  1NK4 A;  2QWQ A;  3K58 A;  2P9P A;  4H5T A;  1NGE A;  3WNF A;  2D4W A;  4OPH A;  5BR9 A;  3DLH A;  4KHU A;  3C65 A;  2IVN A;  3ULD A;  3SZ2 A;  5AQW A;  3EE8 A;  2Q0U A;  4ID1 A;  4MO4 A;  1NKB A;  4EAH D;  3M1F A;  3PSI A;  5KI6 A;  3D7E O;  1QSL A;  4JI4 K;  2IVO A;  1U6Z A;  1BG3 A;  2KQ2 A;  2WON A;  3A5O C;  3CET A;  4CBW A;  3K5M A;  1VAZ A;  4FVU A;  2W6K A;  3E9L A;  3ZT4 A;  3L6Q A;  4WFA L;  1WSF A;  3D0P A;  1WSE A;  4MLE A;  1BL3 A;  4CK1 A;  1XI1 A;  4KV8 A;  4LSL A;  1BUP A;  4FJM A;  2Q3S A;  2A40 A;  1O1W A;  4Y0W A;  5C2F A;  4I7F A;  1TV6 A;  2WTU A;  1NU0 A;  2KFN A;  4ICL A;  3GG4 A;  3DRS A;  5F1X A;  1HKB A;  4JS5 A;  1BOT O;  1GOB A;  4CED A;  3P39 A;  4AHS A;  3O3G A;  4BC2 A;  4KHN A;  2D0A A;  2PY5 A;  2XY7 A;  4CD1 A;  2VCP A;  2ZM6 K;  1RT4 A;  3K5N A;  4B08 A;  3CCV N;  4RW4 A;  3WNE A;  3D45 A;  2W40 A;  1TYQ B;  2YNH A;  3DM2 A;  4BE0 A;  1ZC6 A;  2OA8 A;  4MO5 A;  3QEX A;  4J2A A;  3OA9 A;  4JRQ A;  4KTZ A;  3QBX A;  3THY B;  1K8K B;  2XY8 A;  4DKW A;  4FJL A;  3O5B A;  4NCB A;  4OPA A;  5HRN A;  3ID6 A;  3VQQ A;  2CH6 A;  4BVP A;  2P9I B;  4CHN A;  1Z6R A;  2W42 A;  4DV2 K;  3DXM B;  1SL0 A;  4YOU A;  4N5S A;  3QIC A;  5DM7 L;  3R8E A;  4CZE A;  2UUB K;  1HQE A;  4DQS A;  3R3L A;  3UKR A;  3NGY A;  4DR6 K;  1I94 K;  2G8W A;  2BGG A;  4A5B A;  4B8C A;  4OLB A;  3OJS A;  4F8R A;  4R5P A;  3V9X A;  2H3G X;  4Z4I A;  2E2N A;  4YFU A;  2HBJ A;  1RGI A;  3CC2 N;  4E0D A;  1LWC A;  4CEZ A;  3M5R A;  4B3M K;  4B3T K;  3LAN A;  5LL6 Z;  4FJN A;  4XH4 A;  3AA5 X;  4BR4 A;  4CES A;  2XO7 A;  3SUO A;  3P83 D;  4H5V A;  1HQU A;  1U45 A;  2ASO A;  1OH6 A;  2WFB A;  1V4T A;  5GAH P;  4M63 C;  4BG9 A;  4CJ4 A;  2HHT A;  4B9L A;  1WSG A;  4CGI A;  2FC0 A;  4CHY A;  1YJ9 N;  2Z1G A;  5E84 A;  1NOZ A;  3ZT1 A;  1S1X A;  4BDY A;  3S3M A;  3CD6 N;  1K73 O;  4Q5V A;  3P4I A;  1GLB G;  1NK7 A;  2P9P B;  1WSH A;  1VRT A;  3VQ8 A;  3CFR A;  1TK0 A;  5JLH A;  3DRP A;  3FGU A;  4DG1 A;  3VES A;  3KKS A;  4OJR A;  2NRT A;  1UA0 A;  1U2V A;  2UU9 K;  3WUH A;  2OPS A;  2ZE2 A;  5KQ8 A;  1ZYQ A;  4E7K A;  4CHQ A;  3AO4 A;  3ASM A;  3BF3 A;  2CGK A;  3R1X A;  2D0P A;  2RHK A;  2GBZ A;  3VEX A;  4FWL A;  4FK2 A;  4H03 B;  3HO1 A;  3NF9 A;  3AVC A;  1KQS M;  2HHQ A;  1C1C A;  3DLL L;  4ISE A;  3QFP A;  2DFF A;  3KLH A;  3U3G A;  1RTH A;  4FJK A;  1LOT B;  4CJQ A;  4BQL A;  2UUC K;  1S6P A;  2IIR A;  1B92 A;  3M3Z A;  5GIN A;  3KJV A;  4PL8 A;  3FE1 A;  1L3S A;  5C25 A;  1WBB A;  1VRU A;  1GLE G;  1K9M O;  2NRH A;  1RDW X;  3AVA A;  1C0M A;  1IBL K;  3E66 A;  1Q82 O;  3LPU A;  5GAG P;  3DJC A;  3EO3 A;  3ENB A;  3MXI A;  3SUN A;  4CK2 A;  4R79 A;  3OYB A;  1UWB A;  4A5A A;  1RT7 A;  2OPR A;  3CME N;  1ATS A;  2LSN A;  4LSN A;  1RNH A;  3ZEU A;  3HP9 A;  1FKO A;  3J7Y P;  3FLC O;  1Q9Y A;  4IOX A;  3SYZ A;  1S22 A;  2FSJ A;  3KKR A;  2Z1H A;  3IFR A;  2Q2R A;  2F4V K;  3VEV A;  3CCU N;  4BRK A;  2P5G A;  2GUP A;  5BN8 A;  5GIO A;  3V9Z A;  4UY8 O;  1RDB A;  1ZBI A;  1X3M A;  1FKP A;  3T1A A;  4BC3 A;  1TKD A;  3MEG A;  4CBU A;  1YVU A;  2JWK A;  4BE1 A;  1TAQ A;  4PA1 A;  3UKU B;  1TL3 A;  4CJU A;  5C10 A;  4E7H A;  3CC7 N;  1OH5 A;  3THX A;  2HVH A;  5FPE A;  3CJB A;  3NGI A;  4DS4 A;  4DFM A;  4FJJ A;  2YJF A;  1JLQ A;  3RR8 A;  1CXU A;  3NF6 A;  4OVL A;  4FM1 A;  1S6Q A;  4DFP A;  1GLF O;  1C0T A;  3RVC A;  2Y1I A;  5CY4 A;  3SQ4 A;  4PHT X;  1HNV A;  4FM0 A;  2A42 A;  2ZJR L;  3VF4 A;  2WC9 A;  3H08 A;  1FK9 A;  3K2P A;  5LJV A;  3C6U A;  2FXU A;  4DSI A;  3CQX A;  2G8K A;  2BDP A;  5IT9 O;  2A3Z A;  3O80 A;  5M1O A;  4LFC K;  2X74 A;  3I56 N;  2NRW A;  2KFZ A;  4CFA A;  3ZYY X;  3BF1 A;  4CW7 B;  3CPE A;  4I2P A;  4X66 K;  4MFB A;  4B3O A;  4FOI A;  5GIP A;  3V1O A;  5AQG A;  1BO5 O;  2E1Y A;  1GLC G;  1EQY A;  1BQN A;  1YIT N;  4CFB A;  1S72 N;  3OYM A;  4DR4 K;  4OO1 J;  3SAG A;  4RWT A;  1VQ5 N;  1U04 A;  4ISG A;  3OBY A;  2QTD A;  5SWM A;  4C8O A;  1BIZ A;  4DU3 A;  1VSI A;  3TSP A;  4NO7 A;  3QBW A;  4ELV A;  1EP4 A;  3AVH A;  4NLC A;  1R59 O;  4CZJ A;  1JLA A;  1J9A A;  4H0V B;  2FSK A;  4PQU A;  3VQ9 A;  4DTR A;  3TAF A;  3QML A;  3S3O A;  1CZA N;  2A1S A;  3CJ9 A;  5J2P A;  4LFB K;  4WCE L;  4J2D A;  1X9W A;  5KRS A;  3TTD A;  4RTF D;  4CF0 A;  2WUS A;  3LPT A;  2I7N A;  3S9H A;  1NK6 A;  3TSU A;  4YDU C;  4MDB A;  4A62 A;  4U67 L;  3P31 A;  4BG8 A;  3CYM A;  4QS7 A;  3KK2 A;  1NGJ A;  1DKG D;  1TK5 A;  3DLK A;  3FZM A;  3C0B A;  4GV6 A;  5EX5 A;  4BR7 A;  3R6M A;  4E89 A;  3CXC M;  3OJU A;  1VSH A;  1VQ9 N;  4EZ9 A;  5AFU A;  4FJ9 A;  4BRI A;  4JV5 K;  3OS2 A;  2IAJ A;  1ZBF A;  4WF9 L;  4XIU A;  1ASW A;  4BRN A;  1JLC A;  1RBT A;  4DFJ A;  4Y1C A;  1YT3 A;  4JKG B;  4F2R A;  2YCH A;  4H0Y B;  4KO0 A;  4Z4G A;  1Z25 A;  2HNZ A;  2OZM A;  4MLH A;  1P90 A;  1WB9 A;  3CG7 A;  1C0G A;  5M1N A;  4M3Y A;  4CGD A;  4JI6 K;  4CF8 A;  1LWE A;  3HL8 A;  5E26 A;  4RCH A;  5E41 A;  3Q7C A;  2VQF K;  4AHV A;  1NK5 A;  3EE9 A;  4OGC A;  3NBP A;  4FZY A;  2O8D A;  5AQT A;  1NGI A;  4FSV A;  1M1K O;  2DFE A;  4FWQ A;  3CCS N;  3O4N A;  5HRO A;  1P8Z A;  1TGO A;  2V52 B;  3SLC A;  1F21 A;  2OPP A;  4O0J A;  3EL2 A;  4KPY A;  5KRT A;  1SV5 A;  5LY3 A;  4H0T B;  1HNI A;  4CJV A;  2FBT A;  5HRP A;  2BAN A;  5KPT A;  3V9S A;  3DWL A;  1X1P A;  4DV4 K;  5HRR A;  1QVF M;  4E1N A;  4X64 K;  2ETJ A;  3AVL A;  4W5O A;  4DSJ A;  1QZ6 A;  3L2V A;  1ZBS A;  1WN7 A;  1JJ2 M;  4Z4C A;  2OYQ A;  2ATQ A;  3OYC A;  1EO1 A;  2QWP A;  4JI3 K;  4IG3 A;  3ISN C;  1S1U A;  4N56 A;  1T6C A;  1NBW A;  4FWS A;  1HNZ K;  3L0Q A;  2VQE K;  2YHY A;  4FJI A;  4BAC A;  3SV3 A;  1C1B A;  4M3U A;  1DLO A;  4N76 A;  1S9E A;  3B6O A;  1Y64 A;  4CJK A;  4FWO A;  2P9L A;  5FDL A;  3RMC A;  4DV7 K;  3O4W A;  3LP0 A;  1FW6 A;  3ATV A;  4QCL A;  4LF6 K;  4J2E A;  3CCR N;  2JWL A;  4NYN A;  4X65 K;  3W0L A;  2YI1 A;  3QEW A;  1JCE A;  4DV6 K;  3G25 A;  5AQN A;  3VQP A;  3E9P A;  3LAK A;  3AV9 A;  3O8M A;  2P5O A;  3M8P A;  1L5U A;  1BDG A;  3EY1 A;  5HBM A;  4JI2 K;  3RRG A;  1QVG M;  3KIO A;  3OYA A;  1RT5 A;  3V6D A;  3WNG A;  2AJQ A;  4M3Z A;  3VEW A;  3DLB A;  2P9N A;  4AHR A;  1W0H A;  4CFD A;  1L3V A;  4LFA K;  3HVR A;  2DY4 A;  4F3O A;  4BR0 A;  3I0S A;  3PLA A;  3T1H K;  1GLA G;  2FBY A;  3EZ5 A;  5EXW A;  1VHX A;  3MEC A;  3T1Y K;  3TPQ A;  1UA1 A;  2QK9 A;  4Z4H A;  4AHC A;  4DTN A;  1IKW A;  3TTC A;  4CEQ A;  3MAQ A;  1KAZ A;  3VQA A;  5EY4 A;  4W5N A;  5JVG L;  2ASP A;  1LW2 A;  3I33 A;  2GV9 A;  3B6P A;  5HRS A;  4H0P A;  3MK6 A;  4F9O A;  2QWR A;  3ULE A;  4NCA A;  3CCE N;  3VTI A;  3JSM A;  3MN6 A;  4HCB A;  1RDU A;  2A1R A;  3L4Q A;  1VSK A;  1IO2 A;  4FLY A;  3HZ6 A;  4FL9 A;  1GOC A;  5CZ2 A;  3PIP L;  4DU4 A;  2O8E B;  1MWK A;  3CMA N;  2R7Y A;  4BRA A;  2O8D B;  2YNF A;  3NH2 A;  3DLG A;  3THV A;  3ZX2 A;  1TL1 A;  4MQ3 A;  3NCI A;  4AM7 A;  4O8U A;  4A2B A;  1JCF A;  5HP1 A;  3J8A A;  3NHG A;  4FW2 A;  5JMV A;  1OVQ A;  3LZI A;  1JCG A;  4W5Q A;  3MMV A;  2WOM A;  4JKB A;  4KI4 A;  4H4O A;  4MDA A;  3K57 A;  3HK2 A;  5CE3 A;  4BC4 A;  2HHS A;  3TAE A;  5BRD A;  3ZET A;  2O8C B;  1IBK K;  3TR8 A;  4PWD A;  5AZJ B;  2HBM A;  1ZBU A;  3LZJ A;  4DSL A;  2DTU A;  1QSY A;  3MED A;  4I2Q A;  1VQ8 N;  5FRM A;  3QEP A;  3TAP A;  2Z1I A;  3ZX3 A;  2P9U B;  4KKO A;  1OH8 A;  1LAV A;  1RIL A;  4O5F A;  4X62 K;  3Q7B A;  1BCO A;  3HOS A;  4IXC A;  3QLH A;  1ASU A;  4W5R A;  4JS4 A;  4IZ9 A;  3DLE A;  1KLM A;  2ZWH A;  3BEX A;  2P9L B;  4DV0 K;  4DB3 A;  1W2B M;  1LCU A;  5AR0 A;  3CM5 A;  3VTH A;  3NVK A;  1NJW A;  4FZZ A;  4BR5 A;  4CCH A;  3AA3 A;  2BUP A;  3RWU A;  3BZK A;  1G99 A;  1SAZ A;  4QS8 A;  5AQS A;  1Q86 O;  3LDO A;  1KD1 O;  2OTJ N;  1ZBL A;  3LP3 A;  2ZGZ A;  3C6T A;  1XHZ A;  4C8N A;  3SQ2 A;  2F8T A;  1YUW A;  4JRP A;  1JLE A;  3HVT A;  3DYA A;  3C7N B;  2QKB A;  2RF2 A;  4CD3 A;  3AO3 A;  3KD5 E;  2O4G A;  4B9N A;  1OKJ A;  5TKY A;  4M3X A;  3ALY A;  3H45 C;  2P9N B;  4HTL A;  4CGH A;  3THW B;  4FYD A;  3EYZ A;  4CJ5 A;  4CJ3 A;  1Q7Y O;  5ADX H;  4BRG A;  4IBN A;  5HOO A;  2QWN A;  1LWF A;  4KH5 A;  4ZTJ A;  1VQP N;  2GX9 A;  3DMJ A;  3I8B A;  4FLZ A;  4IFY A;  5C2D A;  2QM1 A;  3IRX A;  3A8Y A;  1B9F A;  3VA3 A;  4DQR A;  4WQ4 A;  3DRR A;  4GW6 A;  2HND A;  3H3N O;  1I3A A;  1WSI A;  3OBW A;  4DF8 A;  3RSE A;  4O55 A;  4CJE A;  3JAM O;  3H1Q A;  2FF3 B;  4LF9 K;  1NK8 A;  1VQN N;  3VA0 A;  4Z4E A;  3ULE B;  4A59 A;  4DV1 K;  4JAX A;  2GEL A;  3QO9 A;  4CHP A;  4BWJ A;  2YX6 A;  2QWO A;  3B8A X;  3FZH A;  1SKR A;  3PUF A;  3L2W A;  1A5V A;  4AQY K;  1RFQ A;  4O5B A;  5AJ3 K;  3NH1 A;  3EKS A;  1KSP A;  2GTD A;  3L4I A;  1NKC A;  1R0A A;  5J2Q A;  5B8H A;  3CI5 A;  5CZ1 A;  2ITM A;  2NRZ A;  2VWB A;  1NGF A;  1DEJ A;  4C1N I;  2O8F A;  3O08 A;  1VSL A;  2VG7 A;  3EEQ A;  3QB0 A;  2VWK A;  4KFB A;  3DAW A;  3TAM A;  3M8R A;  4ZTF A;  4FWK A;  3N4P A;  4FLT A;  1ASV A;  2HF4 A;  3NGZ A;  3AVG A;  1ATN A;  1QZ5 A;  1RBU A;  3T3F A;  4NLB A;  1KFD A;  4AH9 A;  1NM1 A;  3WEE A;  4IJA A;  3SQ1 A;  1WSJ A;  4U7B A;  3LDL A;  3U9D A;  4BDZ A;  3ZET B;  2FF6 A;  4DFK A;  1CLQ A;  1BHL A;  3U3Y A;  5I9E B;  5AQQ A;  3RRH A;  3MXJ A;  3IUC A;  2UXC K;  3NF7 A;  4H4M A;  1U49 A;  4CF2 A;  3WNH A;  1VSE A;  3I55 N;  5BPN A;  2HHX A;  3AGR A;  3C6H A;  3MCP A;  2CH5 A;  1IH7 A;  1QHA A;  1HYZ A;  4A61 A;  1BA0 A;  4BDP A;  1S9G A;  3HPO A;  2OCE A;  4B9Q A;  2HW3 A;  1VK0 A;  3UE5 A;  2PZS A;  5AZI A;  3O9Q A;  3ITH A;  4KB0 A;  3VOV A;  1CZB A;  3J80 O;  4YHH K;  3TI0 A;  3CCJ N;  1Q9X A;  4IEE A;  3MX2 A;  1C0U A;  1BI4 A;  2RKI A;  1VQ6 N;  2VG5 A;  4CZH A;  1SZ2 A;  3LDS A;  2KZM A;  4BRO A;  2HHU A;  1N8R O;  2HBK A;  1VQM N;  5BR8 K;  1WUA A;  4EHU A;  2W41 A;  4ILH A;  1SQK A;  3T7Z A;  4JHD A;  4C23 A;  3LL3 A;  1UAX A;  2X6S A;  3AAQ A;  4AIL C;  3FR0 A;  5JVH L;  5ELZ A;  3UKR B;  3U6F A;  4GV3 A;  3MN5 A;  3L2Q A;  4H0O A;  4RW7 A;  3G6E N;  4LF7 K;  3KWG A;  2IGI A;  1EET A;  1D5A A;  3PX0 A;  1NNE A;  2I7P A;  3SAF A;  4OPK A;  2E88 A;  2F9T A;  2QKK A;  1LAW A;  3VQB A;  5AQX A;  4HTU A;  2YNI A;  1TUY A;  2NUB A;  4IEI A;  4K0K K;  1RT1 A;  5J2M A;  1XC3 A;  4LY7 A;  1RCH A;  3RSE B;  3VPZ A;  3K9J A;  3VGK A;  3KK7 A;  5AQJ A;  2HST A;  3HM9 A;  2O8B A;  3LDQ A;  3D2F A;  3T19 A;  3TU5 A;  1IJJ A;  3IG1 A;  5KPR A;  4CZL A;  1VQ4 N;  3O3H A;  3C94 A;  3ZSW A;  4B1X B;  4YOX A;  1WAF A;  4OKE A;  2OZS A;  2VGM A;  4FWP A;  1D9D A;  2V7Y A;  4O44 A;  3QEI A;  4B3S K;  1N6Q A;  1T3V A;  4DTS A;  3NH0 A;  1YXQ A;  1W9H A;  1TKT A;  5AQZ A;  3OYI A;  1U2V B;  1NKE A;  4CJF A;  3GL1 A;  1VQL N;  4PKI A;  2A41 A;  1J54 A;  3OW2 M;  2NRV A;  3VQ5 A;  3SJJ A;  4YOT A;  4FPA A;  4KHS A;  1NMN A;  3SPY A;  4N41 A;  4KBO A;  4B9V A;  2HHV A;  3WQT A;  1T44 A;  4H0X B;  3SBG A;  3UIQ A;  3BZC A;  1VQK N;  1XNR K;  2HHH K;  5AQM A;  1YAG A;  4LC9 B;  3OYE A;  3OS1 A;  3AY9 A; 
#chains in the Genus database with same CATH homology
 3RMD A;  1L5U A;  2IDO A;  1RDA A;  4DSK A;  1RT4 A;  3K5N A;  4B08 A;  3EY1 A;  3L3U A;  4RW4 A;  3WNE A;  5HBM A;  3RRG A;  3KIO A;  3OYA A;  1RT5 A;  3D45 A;  2YNH A;  3DM2 A;  4BE0 A;  3V6D A;  3MEE A;  3KK1 A;  3KLI A;  4DMN A;  3WNG A;  4B8A B;  2E4L A;  2OA8 A;  5FRN A;  1YTU A;  4J2A A;  3QEX A;  4M3Z A;  3OS0 A;  3DLB A;  2AJQ A;  4JRQ A;  4AHR A;  4KTZ A;  4M3U A;  2D5R A;  1W0H A;  2JGU A;  2XY8 A;  4CFD A;  1N5Y A;  1L3V A;  3L3V A;  1KFS A;  3HVR A;  2DY4 A;  4FJL A;  2P1J A;  4F3O A;  3I0S A;  4FJ7 A;  3OYN A;  4NCB A;  4KAZ A;  4DSE A;  4DTO A;  3OYK A;  4N47 A;  5HRN A;  1RTJ A;  1A5X A;  2FBY A;  3LP2 A;  4NYF A;  3VQQ A;  3EZ5 A;  4E19 A;  3MEC A;  3OYL A;  4CHN A;  2W42 A;  4DF4 A;  1D8Y A;  3AA2 A;  3QIN A;  1UA1 A;  4FJ8 A;  1SL0 A;  2QK9 A;  4Z4H A;  4N5S A;  1JLG A;  4AHT A;  4AHC A;  4RW8 A;  4CGJ A;  4DTN A;  1LW0 A;  4KRF A;  1HQE A;  4O0I A;  4DQS A;  3ZSY A;  1IKW A;  1TKX A;  4CEQ A;  3MAQ A;  3VQA A;  4DTX A;  1TAU A;  4W5N A;  1EX4 A;  3ZSR A;  3NGY A;  4Q0B A;  4RW6 A;  1LW2 A;  2G8W A;  1IG9 A;  2GV9 A;  2BGG A;  3RR7 A;  3B6P A;  4B8C A;  4FJH A;  5HRS A;  4Y1D A;  4OLB A;  4CHZ A;  1HYS A;  4F2S A;  4HCC A;  3OJS A;  4F8R A;  4NCA A;  1JL1 A;  2XRI A;  3JSM A;  4R5P A;  1HMV A;  3V9X A;  4HCB A;  4M3W A;  4Z4I A;  3P5J A;  3SNN A;  4YFU A;  2A1R A;  4DU1 A;  1VSK A;  4E0D A;  1IO2 A;  1LWC A;  4C8M A;  3DOL A;  4CEZ A;  5K14 A;  4FLY A;  4FLU A;  4FJN A;  3LAN A;  4FK0 A;  5C24 A;  3AA5 X;  4ID5 A;  2YNG A;  4CES A;  2XO7 A;  3QNN A;  5KTQ A;  2RPI A;  3SUO A;  1BCM A;  1GOC A;  1HQU A;  3P83 D;  4OKK A;  3VQE A;  5CZ2 A;  3ZT2 A;  3S3N A;  1NJZ A;  4DU4 A;  1RT2 A;  4M45 A;  4BWM A;  1U45 A;  2KZZ A;  2HMI A;  3PX4 A;  3V9U A;  2R7Y A;  4CJ4 A;  2YNF A;  3NH2 A;  4CJP A;  4B9L A;  3DLG A;  3BDP A;  4I9L A;  3CQ8 A;  1WSG A;  4CGI A;  3THV A;  3TAQ A;  1TL1 A;  3LWL A;  3QET A;  2FC0 A;  4MQ3 A;  2EHG A;  4KTQ A;  4CHY A;  3NCI A;  3QNO A;  2Z1G A;  3F73 A;  3S3M A;  1NOZ A;  3ZT1 A;  1S1X A;  4BDY A;  2XHB A;  3RMB A;  4HUF A;  1REV A;  4Q5V A;  1XHX A;  4FLV A;  2RN2 A;  4IFV A;  1NJX A;  5HP1 A;  1Q8I A;  1IKY A;  3TAN A;  1NK7 A;  3NHG A;  4FW2 A;  5JS1 A;  3ZT0 A;  1RTD A;  1EKE A;  3AA4 A;  1WSH A;  4W5Q A;  3LZI A;  1VRT A;  3VQ8 A;  3CFR A;  1TK0 A;  2WOM A;  4E7J A;  3IS9 A;  3DRP A;  4B9T A;  5DK5 A;  1NOY A;  4ELU A;  1S1V A;  4DWI A;  1VSM A;  1RDD A;  4DG1 A;  4H4O A;  4KI4 A;  4IG0 A;  1G15 A;  3KKS A;  1MU2 A;  3K57 A;  1X9M A;  3HK2 A;  2IS3 A;  4OJR A;  3KD1 E;  2ZQB A;  1UA0 A;  3I8D A;  2HHS A;  3TAE A;  3ZSX A;  1JKH A;  3QES A;  2HB5 A;  2OPS A;  2ZE2 A;  3TR8 A;  4PWD A;  1RT3 A;  1ITG A;  4DS5 A;  1T05 A;  1ZYQ A;  1ZBU A;  4E7K A;  4CHQ A;  3AO4 A;  3ASM A;  2JLE A;  3K5O A;  4CE9 A;  2IC3 A;  1T8E A;  3LZJ A;  3MXM A;  4DSL A;  1DTQ A;  3ZSQ A;  1QSY A;  3MED A;  4I2Q A;  4CER A;  1U48 A;  3HP6 A;  4I9Q A;  5FRM A;  2DTU A;  4QAG A;  2YKN A;  3TAG A;  3QEP A;  1QQC A;  2Z1I A;  3TAP A;  4CEO A;  4FZX C;  2GBZ A;  3AVJ A;  3TWH A;  1C1A A;  3VQ4 A;  3AVN A;  4KKO A;  1LAV A;  3HST B;  4FCY A;  4FK2 A;  1XC9 A;  4C8K A;  3AO5 A;  1RIL A;  1Z26 A;  1I39 A;  3NE6 A;  2PY5 A;  4J2B A;  1U47 A;  3NF9 A;  3OY9 A;  3AVC A;  4PUO A;  3HO1 A;  1BCO A;  1C1C A;  1VSD A;  2HHQ A;  3QEV A;  3QLH A;  1ASU A;  4CEC A;  1RBR A;  5KGX A;  4HUE A;  2DFF A;  4W5R A;  1S5J A;  4OGE A;  4RG8 A;  3KLH A;  4JS4 A;  4LD0 A;  5I3U A;  3DLE A;  1KLM A;  3BGR A;  3U3G A;  1JLB A;  1RTH A;  3QIO A;  4FJK A;  5JS2 A;  2G8V A;  3KLF A;  4CJQ A;  1S1W A;  1S6P A;  3CM5 A;  4CEB A;  1B92 A;  3KLG A;  3KJV A;  3CFP A;  1NJW A;  1D9F A;  3TAB A;  2P5O A;  2ZD1 A;  4FZZ A;  4CCH A;  3AA3 A;  1L3S A;  5C25 A;  3RWU A;  1VRU A;  4LH5 A;  4QOZ B;  5J1E A;  3DOK A;  4NCG A;  3F9K A;  3AO1 A;  2Z1J A;  1QS4 A;  4FW1 A;  3AVA A;  1ZBL A;  3LP3 A;  1C0M A;  3JYT A;  4E7I A;  2FBX A;  3LPU A;  3C6T A;  1XHZ A;  4C8N A;  4CIF A;  4DTJ A;  3SQ2 A;  3MXI A;  3SUN A;  3L2U A;  2F8T A;  2P51 A;  4CK2 A;  1SKW A;  2D0B A;  4JRP A;  3VQC A;  3OYB A;  3CM6 A;  1JLE A;  1UWB A;  3HVT A;  3DYA A;  2QKB A;  1RT7 A;  2RF2 A;  2OPR A;  3AO3 A;  1SL2 A;  2HNY A;  2LSN A;  4LSN A;  2O4G A;  3KD5 E;  1RNH A;  4E3S A;  4B9N A;  3HT3 A;  4M3X A;  4M3R A;  3HP9 A;  1JL2 A;  3SUP A;  1FKO A;  1T7P A;  3HJF A;  3ALY A;  4F3T A;  4KHQ A;  2ITG A;  1Q9Y A;  4CF1 A;  3SYZ A;  4HVJ A;  3KKR A;  2Z1H A;  4TSX A;  3LAL A;  5FRO A;  3AO2 A;  4CJT A;  2YHB A;  4CGH A;  3RTV A;  3V9W A;  4FYD A;  3EYZ A;  1BI4 B;  4FJ5 A;  4CJ5 A;  4KTW A;  4G1Q A;  4IKF A;  4F4K A;  4HUG A;  4CJR A;  2Y1J A;  2P5G A;  4CJ3 A;  1T03 A;  3V9Z A;  3OYH A;  3G10 A;  1RDB A;  4E7L A;  1FKP A;  4IBN A;  3T1A A;  1ZBI A;  1LWF A;  4ZTJ A;  1TKD A;  3MEG A;  1QSS A;  3DMJ A;  4FLZ A;  1K6Y A;  1JXE A;  4IFY A;  4LH4 A;  1YVU A;  3IRX A;  2GUI A;  4B9S A;  1RBV A;  1B9F A;  3FFI A;  4BE1 A;  3VA3 A;  4DQR A;  2HHT A;  3DRR A;  4CGG A;  1TAQ A;  4PA1 A;  1TL3 A;  4GW6 A;  2HND A;  4CJU A;  4E7H A;  1CZ9 A;  3AVM A;  4DTU A;  4CIG A;  1TK8 A;  1I3A A;  1WSI A;  2HVH A;  2IOC A;  4DF8 A;  5DMR A;  4O55 A;  3NGI A;  3QER A;  4CJE A;  3L2R A;  4DS4 A;  2KW4 A;  4DFM A;  5KGW A;  3NF8 A;  4FJJ A;  1NK8 A;  1JLQ A;  3VA0 A;  3RR8 A;  3KTQ A;  1CXU A;  2YV0 X;  2HHW A;  1FXX A;  4Z4E A;  3NF6 A;  4OVL A;  4FM1 A;  1S6Q A;  2B4J A;  4DFP A;  1C0T A;  3QO9 A;  2X78 A;  1RBS A;  4WE1 A;  5CY4 A;  4CJW A;  4CHP A;  4BWJ A;  1TVR A;  2Y1I A;  3SQ4 A;  1HNV A;  2O4I A;  4FM0 A;  1SKR A;  1BIS A;  3PUF A;  3L2W A;  4KRE A;  1A5V A;  3K5L A;  3H08 A;  2EX3 A;  2VWJ A;  1FK9 A;  3K2P A;  3C6U A;  4O5B A;  4DSI A;  3NH1 A;  2G8K A;  4OPJ A;  2HVI A;  1DTT A;  1KSP A;  2BDP A;  3LP1 A;  1NKC A;  1VSF A;  2B6A A;  1R0A A;  1NK0 A;  2FBV A;  5J2Q A;  1L3U A;  5CZ1 A;  3M8Q A;  2X74 A;  4B9U A;  2KFZ A;  4CFA A;  5C42 A;  1KTQ A;  3PV8 A;  2OPQ A;  1VSL A;  2VG7 A;  4CJL A;  4I2P A;  3AVI A;  4Z4F A;  3AVF A;  3TAR A;  4MFB A;  2VWK A;  5I42 A;  4KFB A;  4B3O A;  1C6V A;  3LAM A;  3V1O A;  4CEA A;  1KVB A;  3TAM A;  3ZSZ A;  2G8F A;  3M8R A;  4ZTF A;  3KK3 A;  4CF9 A;  1BQN A;  3DI6 A;  3O4Q A;  1SKS A;  3PY8 A;  4FJX A;  1J5O A;  4FLT A;  1ASV A;  4CFB A;  5T7B A;  3NGZ A;  3AVG A;  3L8B A;  5HLF A;  3OYM A;  2BE2 A;  3P1G A;  4K8Z A;  1KVA A;  1S1T A;  1U04 A;  3SCX A;  5SWM A;  4C8O A;  1B9D A;  1BIZ A;  1RBU A;  5CYM A;  3ZT3 A;  4DU3 A;  4UQG A;  1VSI A;  3T3F A;  4JLH A;  1KFD A;  2YKM A;  5D3G A;  4AH9 A;  2X6N A;  3SQ1 A;  1WSJ A;  3NFA A;  4PY5 A;  4ELV A;  4BDZ A;  3OYF A;  1EP4 A;  3HPG A;  4CIE A;  3AVH A;  1XWL A;  2VG6 A;  3E01 A;  5CYQ A;  1JXB A;  1JLA A;  4KHY A;  1J9A A;  4PQU A;  4DFK A;  3VQ9 A;  1CLQ A;  4DQQ A;  4DTR A;  1BHL A;  2E6L A;  4CFC A;  4HHT A;  4EP4 A;  3U3Y A;  3TAF A;  3S3O A;  2PYJ A;  2A1S A;  5J2P A;  4OKJ A;  4H8K A;  2KTQ A;  1WLJ A;  2YHA A;  1X9W A;  5KRS A;  2I5J A;  4CK3 A;  3RRH A;  3MXJ A;  1NJY A;  4J2D A;  4DLE A;  4C8L A;  4CF0 A;  1TKZ A;  3LPT A;  4GMJ B;  3NF7 A;  3QIP A;  4H4M A;  3S9H A;  4CF2 A;  4Z0U A;  1U49 A;  1HRH A;  3WNH A;  1NK6 A;  4EZ6 A;  4K8X A;  2E6M A;  1VSE A;  4FJG A;  2HHX A;  3I0R A;  2XY6 A;  4DQI A;  4M3T A;  4DSF A;  3PO4 A;  3PX6 A;  3CYM A;  3V4I A;  5J2N A;  1IH7 A;  3KK2 A;  1HYZ A;  1UOC A;  2QXF A;  2G8I A;  4BDP A;  1TK5 A;  1KRP A;  3PO5 A;  3DLK A;  4DLG A;  1S9G A;  4DTM A;  3HPO A;  4DTP A;  4M41 A;  2HW3 A;  4E89 A;  5EU7 A;  4EP5 A;  1VK0 A;  3NAE A;  2PZS A;  2G8H A;  3OJU A;  4M42 A;  1VSH A;  4EZ9 A;  3ITH A;  4FLX A;  3SV4 A;  4KB0 A;  1CZB A;  2DFH A;  4CEF A;  1J53 A;  1BGX T;  3TI0 A;  1Q9X A;  4FJ9 A;  3OS2 A;  1X9S A;  2IAJ A;  1CXQ A;  4OLA A;  1C0U A;  1ZBF A;  3VQ6 A;  4ZHR A;  1BI4 A;  2RKI A;  3OVN A;  1LV5 A;  4FVM A;  4XIU A;  1ASW A;  2VG5 A;  4E1M A;  1KVC A;  1JLC A;  1RBT A;  3ZSO A;  3LDS A;  3VQD A;  4AHU A;  4CJS A;  3OYJ A;  2KZM A;  4IDK A;  2PYL A;  2HHU A;  4DFJ A;  1BIU A;  1SUQ A;  4Y1C A;  1YT3 A;  1HJR A;  4CHO A;  4KHW A;  1JLF A;  3SQ0 A;  3VN5 A;  1RDC A;  4F2R A;  1RT6 A;  4KO0 A;  4FM2 A;  3OYD A;  1Y97 A;  1Z25 A;  1UAX A;  2HNZ A;  4Z4G A;  2X6S A;  3V81 A;  2OZM A;  3HPH A;  4KI6 A;  3LWM A;  4AIL C;  3K59 A;  3CG7 A;  3SPZ A;  4DQP A;  4W5T A;  3RMA A;  4M3Y A;  3OYG A;  1QHT A;  4CGD A;  3IAY A;  4CF8 A;  1LWE A;  3HYF A;  3HL8 A;  4RW9 A;  3U6F A;  1GOA A;  3DLR A;  3L2Q A;  1KLN A;  4RW7 A;  5E41 A;  4AHV A;  1NK5 A;  2IGI A;  1EET A;  1D5A A;  4CGF A;  4O4G A;  3PX0 A;  4OGC A;  2D0C A;  3NBP A;  4FZY A;  4OPK A;  1L3T A;  3NDK A;  2QKK A;  1SL1 A;  2DFE A;  4CEE A;  1KCF A;  1LAW A;  3VQB A;  3O4N A;  4HTU A;  5HRO A;  1A5W A;  3SI6 A;  2YNI A;  4GVM A;  1TGO A;  1F21 A;  4B9M A;  2NUB A;  3V1Q A;  2OPP A;  1RT1 A;  3SUQ A;  4O0J A;  5J2M A;  5SZT A;  4KPY A;  5KRT A;  1SV5 A;  1NK4 A;  4ELT A;  3K58 A;  1HNI A;  1QE1 A;  3VQ7 A;  3WNF A;  4LY7 A;  3HXM A;  4CJV A;  1RCH A;  2FBT A;  3ZCM A;  3KLE A;  3DLH A;  3C95 A;  3G0Z A;  4KHU A;  1IKV A;  3CFO A;  5HRP A;  3HM9 A;  2BAN A;  3V9S A;  3T19 A;  3ULD A;  4BE2 A;  1X1P A;  3SZ2 A;  5HRR A;  1EXQ A;  4L8R B;  4E1N A;  3IG1 A;  4ID1 A;  4FLW A;  1NKB A;  2ETJ A;  1ZBH A;  1HYV A;  3AVL A;  3O3H A;  3C94 A;  4W5O A;  5KI6 A;  3V1R A;  3ZSW A;  4DSJ A;  1QSL A;  3L2V A;  1WAF A;  1WN7 A;  2KQ2 A;  2WON A;  4OKE A;  2OZS A;  4Z4C A;  1QTM A;  2ATQ A;  2OYQ A;  1D9D A;  3OYC A;  2XY5 A;  4O44 A;  2F8S A;  3QEI A;  4IG3 A;  3K5M A;  1WAJ A;  3ISN C;  3ZSV A;  1S1U A;  4N56 A;  1N6Q A;  4FK4 A;  4DTS A;  3NH0 A;  3ZT4 A;  1W9H A;  3D0P A;  1WSF A;  3AVK A;  4FJI A;  1TKT A;  1WSE A;  3OYI A;  3A2F A;  1BL3 A;  1VSJ A;  4CK1 A;  1C1B A;  4BAC A;  3SV3 A;  2B5J A;  1XI1 A;  1DLO A;  1NK9 A;  1NKE A;  1HPZ A;  4CJF A;  4KV8 A;  1S9E A;  3B6O A;  4LSL A;  4N76 A;  1U4B A;  4FJM A;  4CJK A;  2Q3S A;  4KB1 A;  1J54 A;  1O1W A;  5FDL A;  3VQ5 A;  3SJJ A;  4I7F A;  1TV6 A;  3AVB A;  4YNQ A;  3RMC A;  4KHS A;  3LP0 A;  1IKX A;  4QCL A;  4J2E A;  2KFN A;  4ICL A;  4NYN A;  3SPY A;  1BQM A;  3DRS A;  2G8U A;  4JS5 A;  4B9V A;  4N41 A;  4FXD A;  3QEW A;  2HHV A;  1GOB A;  3UIQ A;  3O3F A;  4CED A;  3VQP A;  4AHS A;  3O3G A;  1WNS A;  1YTA A;  3LAK A;  1RTI A;  4KHN A;  3OYE A;  3M8S A;  2D0A A;  3AV9 A;  3OS1 A;  2XY7 A;  2F96 A;  3M8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...