2ETJA

Crystal structure of ribonuclease hii (ec 3.1.26.4) (rnase hii) (tm0915) from thermotoga maritima at 1.74 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
221
structure length
211
Chain Sequence
MGIDELYKKEFGIVAGVDEAGRGCLAGPVVAAAVVLEKEIEAKRERLLDEIMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKPSFVLVDGKGIELSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRMYPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPVLELLTDDLLREFFEKGLISENRFERILNLLGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Ribonuclease HII (EC 3.1.26.4) (RNase HII) (tm0915) from THERMOTOGA MARITIMA at 1.74 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Ribonuclease HII
total genus 68
structure length 211
sequence length 221
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2etjA00
4DS4A 4O5BA 3U3GA 2Q3SA 2VG6A 4KI6A 3ZSRA 1VSIA 1UAXA 3LPUA 3NF6A 1BQNA 2BANA 2YNHA 4CIGA 3OYCA 4KKOA 3CFRA 5CYMA 3KKSA 1S1WA 4DLGA 1NK8A 4E0DA 1D5AA 1RDCA 3L3VA 3LP0A 4I2QA 1YT3A 1JXBA 3OYAA 4YFUA 1REVA 3DRPA 4HHTA 1NK7A 3ZT2A 2KFZA 2WOMA 4FJ8A 4E1MA 3ZSYA 1S1VA 4XIUA 1RT5A 3RR7A 4DSFA 1JLGA 1GOBA 1NOZA 4W5TA 4E7JA 1LWEA 3V1RA 3NAEA 5HLFA 4FZXC 1SL2A 4R5PA 4CCHA 4CEOA 3OY9A 3NHGA 3B6OA 4CF0A 1RTJA 1QSSA 1D9FA 1KRPA 3VQCA 1Z26A 2GV9A 2B4JA 4DTSA 3AVJA 3CFPA 4DQRA 3LP1A 3MXMA 4LD0A 3THVA 3AVAA 2XHBA 3C95A 4CK3A 1X1PA 4C8OA 3C6UA 2IC3A 5CZ2A 2BE2A 5J1EA 2YNFA 3SUOA 2Z1HA 3ITHA 3OYHA 4OLBA 4HCCA 4W5RA 3KK3A 4WE1A 1D8YA 1UA1A 3C94A 4RW6A 1NKCA 4B9NA 3IRXA 4DF8A 1CZ9A 5FROA 3ZSZA 4CFAA 1HYVA 2BDPA 3PO4A 4HCBA 1S6QA 1TKXA 4CHPA 1J5OA 2HHUA 2KTQA 3C6TA 1EP4A 1RT7A 2QKKA 1X9WA 3S3OA 1KFDA 2D0CA 4KTZA 4MFBA 4DFJA 3V4IA 4KHSA 3HO1A 1HNVA 2A1RA 4KO0A 4CGHA 4JS4A 2Y1JA 3SNNA 1L3SA 2HHSA 1HYZA 3OYFA 4FVMA 3PY8A 1N6QA 4FW1A 1K6YA 1CXQA 3VN5A 4I7FA 1XHZA 4BWJA 4M42A 1EX4A 2D0BA 2WONA 3T1AA 4KAZA 4QAGA 3DMJA 3AA3A 3P83D 3V6DA 1A5XA 1WSFA 4FLVA 3DLBA 4Z4IA 1ITGA 3OYLA 2HB5A 3NGZA 1J53A 1VK0A 3H08A 2FC0A 4IG0A 4DTPA 1RBVA 3M8RA 2IGIA 2HHXA 3QEXA 4Z0UA 3AA5X 4AHSA 1ZYQA 3VQ9A 3DLKA 5I42A 2O4IA 3MEEA 2FBTA 3AA2A 4Z4HA 3QEIA 4F2RA 3NBPA 1NK4A 2KZMA 3DOKA 4DU3A 1JLQA 3L2QA 4B8AB 3K5OA 5SWMA 3FFIA 1S1TA 2YKMA 3VQ5A 4BE1A 4DQIA 3DLEA 4ZHRA 3SQ2A 1FK9A 4Q0BA 4ICLA 5CYQA 3TARA 4K8ZA 1J54A 4OJRA 2RF2A 4CERA 1BI4A 1XI1A 1XC9A 3NFAA 3HK2A 3WNFA 4CGIA 4DF4A 1X9MA 3PV8A 2XY5A 3K5NA 4CHNA 2GBZA 4B08A 3MECA 3NGYA 3JYTA 1YTAA 3KLIA 3NF9A 4IDKA 1CXUA 3L2WA 3LALA 4GMJB 2FBXA 1R0AA 2DFEA 3EY1A 2IS3A 2E6MA 4AH9A 4CJEA 1Q9XA 4DSIA 2ZQBA 2G8UA 3OYEA 3QIOA 2DFFA 1IKXA 4FK0A 4LH4A 3NH1A 3WNGA 1ASVA 4E19A 3AVLA 4HUGA 3QLHA 3UIQA 3DLGA 2Y1IA 2PY5A 3AO4A 3AV9A 1QSLA 1FXXA 3OYIA 3NGIA 1SKWA 3QNNA 2RN2A 5FRMA 4E7KA 1ASUA 5C24A 3L2UA 4C8MA 2ETJA 4O44A 1RT2A 3DYAA 4AHCA 3MAQA 3SV3A 3SUPA 4N41A 3TABA 2QK9A 2KFNA 4CGFA 4LSLA 3KIOA 3T19A 5KRTA 3IS9A 3KTQA 3OYBA 3TAGA 4K8XA 4CJQA 1RBTA 4MQ3A 4J2DA 3TR8A 4AILC 1NK0A 1HJRA 1WSIA 3U3YA 3BGRA 4DTMA 3DLRA 4QCLA 3S3MA 3OYMA 1GOCA 1BGXT 2P1JA 3HT3A 1B92A 3SI6A 4FJLA 3NE6A 4PQUA 4W5NA 2IDOA 4DSEA 4UQGA 3EZ5A 1RT3A 3HP9A 3V9XA 3SUQA 1EETA 1C1BA 3TAFA 3O4NA 3HVRA 4FK4A 5KTQA 1WN7A 3QEVA 4OPJA 4CK2A 2NUBA 1IG9A 1W9HA 2B5JA 2A1SA 3ZT3A 3RWUA 4CJFA 3O3FA 3F73A 1VRUA 1IKWA 4C8NA 2OZMA 3PUFA 4FLTA 4C8KA 3D45A 4KHYA 5HRNA 1RDDA 3MEGA 4HVJA 4E7IA 3LDSA 3SV4A 4DTNA 2XO7A 2Z1GA 1NK6A 2G8IA 2P5OA 3VQPA 2F8TA 4FW2A 3K5MA 4DTJA 3SQ4A 3VQ7A 5HROA 1QS4A 3ISNC 4CFDA 4CJ3A 4C8LA 1JLFA 2E6LA 3AVMA 4N56A 3AVNA 1RBSA 4NCGA 1T03A 1TK8A 1TKTA 1KCFA 3RRGA 1VSFA 1KVBA 1QE1A 1QTMA 3P1GA 4CJVA 3TI0A 4DG1A 5D3GA 1LW2A 4DTOA 2E4LA 1BHLA 4NYFA 3KLGA 4F3OA 3MXJA 3QESA 1LW0A 4FYDA 4H4MA 4O0JA 4FLUA 4KHNA 1S1UA 3ALYA 3ZSQA 4B9UA 1JKHA 1RT4A 3DI6A 1S5JA 1RTDA 1U48A 3V9WA 4E7LA 1DTTA 1VSKA 1KSPA 3IAYA 1VSEA 4EP4A 1D9DA 3QEPA 2DY4A 5HBMA 1GOAA 4FJ9A 1ZBIA 2OYQA 3LAKA 3VQDA 3VQQA 4Y1DA 1SUQA 1SL1A 1L3TA 2KZZA 3ZSXA 3HJFA 4M3XA 2OPSA 4CJUA 4CJPA 4OKEA 3AA4A 2F8SA 3OVNA 3QIPA 4DQQA 3AVCA 1ZBHA 5SZTA 4RW7A 1TVRA 4KB0A 2HW3A 3RRHA 4DFKA 4Q5VA 4FZYA 4KHQA 3AVBA 3AO1A 3NH2A 3AVGA 1JLAA 3A2FA 4CHQA 1DTQA 3VQEA 4CIFA 1WSGA 3AO3A 3L3UA 4O55A 4N5SA 1IKYA 1RDBA 5JS2A 3VQ6A 3LWMA 4BDZA 4PWDA 1C0TA 1BIUA 4OVLA 3EYZA 4CGDA 4L8RB 4KI4A 3OJSA 4CHYA 5I3UA 3AVKA 4BE0A 1T05A 3NCIA 3U6FA 1VSLA 4BDPA 3VQ8A 2B6AA 1WNSA 2QXFA 3QEWA 3DLHA 3KKRA 4FCYA 4ELUA 4RG8A 4CECA 2GUIA 3KLEA 4BACA 3ULDA 3RMCA 1NK9A 2PZSA 4I9QA 2VWKA 1NJYA 5KI6A 1T7PA 3F9KA 4CK1A 3KD1E 4EZ6A 1LWFA 2LSNA 4ID5A 4H8KA 3OYGA 2JLEA 2W42A 1LAVA 2OPRA 2FBVA 3NF8A 4DFPA 1TAQA 1TL3A 2IOCA 3KK1A 1U4BA 5J2QA 3DM2A 2Z1JA 3HPHA 4IFVA 3HM9A 1SKRA 1FKPA 3KK2A 2OPPA 4I9LA 1JLCA 1L3UA 1JXEA 2YNIA 1L3VA 1VRTA 5KRSA 1BL3A 1VSDA 1U49A 4KTQA 1S1XA 4IBNA 4RW4A 2ATQA 1LV5A 3SJJA 1UWBA 4CEBA 3IG1A 5JS1A 4E7HA 1KVAA 2G8FA 1YTUA 3V1OA 3G10A 3LPTA 5T7BA 1SV5A 2R7YA 3V81A 5J2MA 3L2RA 2F96A 4CF2A 4DSKA 2PYLA 2I5JA 1TK0A 3M8PA 4F2SA 4M3YA 3LZIA 4NCBA 1RTIA 4Z4CA 1RBUA 1ZBUA 3MEDA 4YNQA 4DTRA 3LWLA 4DLEA 3TAEA 4CGGA 3SUNA 1B9DA 1S9EA 3SPZA 4CEQA 2HNDA 1VSMA 3VQAA 1O1WA 4CFBA 1Y97A 2YHAA 4CEZA 1QSYA 2EX3A 1F21A 1RCHA 3HSTB 1NKBA 4W5QA 1UOCA 2HHVA 4FM2A 4M3TA 3AVIA 5FDLA 1NJWA 1CLQA 3LZJA 4HUEA 1BISA 4KFBA 3SYZA 1TGOA 2VG7A 4CF8A 3K59A 1Z25A 1RNHA 4J2BA 3QNOA 3B6PA 3LP3A 4Z4EA 3L8BA 3KJVA 4CF1A 5HRRA 4OKJA 1BI4B 4ELTA 4NCAA 3CQ8A 4HTUA 1IH7A 1TAUA 2PYJA 1QHTA 1ZBLA 2G8VA 3G0ZA 3D0PA 3QERA 3SQ0A 4TSXA 2ZD1A 2VG5A 1NKEA 4B9TA 4OKKA 4FLZA 3KLFA 2HHQA 3AVHA 3M8QA 4HUFA 1TKDA 4ZTFA 2X78A 4F8RA 1J9AA 3PX0A 5HP1A 4CEAA 4CFCA 3RMAA 2P51A 1A5VA 1A5WA 1S6PA 4FJIA 3L2VA 1JL2A 4FJNA 4CIEA 4EP5A 1T8EA 1YVUA 3SCXA 2BGGA 4KV8A 4B9SA 3CM5A 4FJ5A 4CJ5A 5KGXA 4OLAA 2YNGA 4M45A 4BE2A 4E3SA 2DTUA 1XWLA 1HQEA 2HNYA 2G8WA 4DMNA 3TAPA 3OYKA 2XRIA 3V9SA 1FKOA 3K2PA 3OYNA 3KLHA 4M3UA 1BQMA 4CEFA 3OS2A 2HHWA 1XHXA 4CEDA 3VQ4A 1DLOA 4B9MA 4CHZA 1WSJA 2OPQA 4CJKA 5EU7A 4Z4GA 1WSEA 1KVCA 1WSHA 1TKZA 4CJ4A 4E89A 1C6VA 4ELVA 2YKNA 3WNHA 3ZSOA 4M3ZA 3O4QA 1CZBA 4IG3A 1HQUA 4FM0A 3PX4A 4J2AA 4AHVA 3DRRA 4DQPA 1BCOA 1EKEA 2RKIA 2FBYA 4LY7A 4IFYA 2G8HA 3PO5A 5DK5A 4DU1A 4FJKA 2G8KA 4DU4A 1C1CA 3NH0A 1KTQA 4JLHA 4M3RA 1HNIA 4W5OA 3OJUA 4QOZB 3HP6A 1N5YA 3AVFA 4FLXA 3V9UA 3K5LA 1VSHA 3PX6A 4CJSA 4OPKA 1S9GA 4CJWA 1G15A 3LAMA 4KREA 1HYSA 1LAWA 1HMVA 2XY7A 1U47A 1ASWA 4N76A 4G1QA 4BDYA 3O3GA 1I3AA 3V9ZA 3HL8A 3VA3A 4M3WA 3OYJA 1U04A 4DTUA 4KTWA 4JS5A 4KB1A 4Y1CA 1TV6A 1RTHA 2HMIA 4KPYA 2AJQA 1IKVA 1ZBFA 3ZCMA 4KRFA 3ASMA 1X9SA 3DOLA 3HYFA 5KGWA 5CZ1A 1KLNA 1RBRA 4CE9A 4FM1A 1WAFA 4FJJA 3HXMA 5DMRA 4FLYA 2RPIA 4AHTA 3OS1A 3DRSA 3ZT4A 5K14A 3ZT1A 4F3TA 5C25A 5FRNA 4FJMA 5CY4A 1RDAA 4M41A 1MU2A 4RW8A 4B3OA 3V1QA 3S9HA 1Q9YA 2X6NA 4PA1A 2KW4A 3KD5E 4FJ7A 1BIZA 1JL1A 3P5JA 3MXIA 1EXQA 3O3HA 2Z1IA 3NF7A 2X74A 2OA8A 5J2NA 4CGJA 3HVTA 1QQCA 3I0RA 3TAQA 3RMDA 1BCMA 4CESA 1KFSA 4JRQA 4FJXA 4O4GA 1C1AA 4B9VA 3E01A 3SZ2A 3RR8A 4DSJA 4B8CA 3CFOA 2ITGA 4LH5A 4GVMA 3TANA 4KHUA 1RT1A 2P5GA 3AO2A 1VSJA 3ZSWA 4ZTJA 4RW9A 3JSMA 2XY6A 4OGEA 3HPOA 4Z4FA 2X6SA 3M8SA 4FXDA 4DTXA 2D5RA 4F4KA 1HRHA 1TL1A 2XY8A 3VQBA 3ZT0A 1NJXA 1WAJA 4LSNA 3K57A 4DWIA 4N47A 4FK2A 1B9FA 5E41A 2JGUA 2DFHA 3QO9A 4ID1A 4FJHA 3OYDA 2D0AA 5HRPA 1NJZA 4KHWA 4FLWA 1RT6A 2OZSA 1KLMA 1C0MA 3LP2A 4OGCA 3T3FA 4CHOA 3OS0A 4FJGA 3SPYA 4FZZA 2HVIA 2ZE2A 3RMBA 4DS5A 2O4GA 4CJRA 2EHGA 5HRSA 1UA0A 4IKFA 3NDKA 3CG7A 1L5UA 4AHRA 1SL0A 3AO5A 2IAJA 3QINA 3K58A 2QKBA 1W0HA 1HPZA 1Q8IA 2KQ2A 2HHTA 4I2PA 4CJLA 3CM6A 3VA0A 4DFMA 1WLJA 1IO2A 1NK5A 1JLBA 3I0SA 4O0IA 2HNZA 1SKSA 2HVHA 1U45A 2YV0X 3LANA 3RTVA 3S3NA 2YHBA 3CYMA 5J2PA 3SQ1A 4PUOA 4BWMA 3WNEA 2VWJA 4DQSA 1NOYA 1LWCA 3BDPA 4J2EA 4E1NA 5C42A 1I39A 4H4OA 4AHUA 3I8DA 1RILA 1JLEA 3HPGA 4GW6A 4CF9A 4EZ9A 3QETA 3TAMA 4PY5A 4JRPA 1TK5A 4NYNA 4DSLA 3TWHA 4CEEA 3ZSVA 4CJTA 4B9LA 1C0UA
chains in the Genus database with same CATH superfamily
4DS4A 1GLFO 1TAUA 1VSIA 3QFUA 5J2QA 2F9TA 1BQNA 4IO9L 4CIGA 5DM6L 3KKSA 3AGRA 3TTDA 4YFUA 2ZGZA 2KFZA 4YY3K 2QW9A 1JLGA 1GOBA 1NOZA 4E7JA 1OVQA 5KPRA 3IFRA 4DB3A 3JAMO 4CEOA 1VQPN 3E9PA 5HL7L 2GV9A 3FZHA 2ZWHA 4YOWA 1X1PA 2HSTA 2IC3A 3H45C 4B1XB 2YHXA 5J1EA 5GIPA 2VGMA 1D8YA 4B3MK 2UXCK 5EVZA 1J5OA 4NXNK 4C23A 1RT7A 2QKKA 2E1ZA 4WFNL 2D0CA 3HBTA 4MFBA 4DFJA 2A1RA 4JS4A 5ADXA 2W6KA 3CMAN 1HUXA 3THWA 3VEXA 2BUPA 4FVMA 4DV2K 3CPWM 4JKHA 4GV9A 3VN5A 3AA3A 3P83D 3V6DA 3DLBA 3WXIA 2GEMA 3OTOK 1T3VA 1J53A 4K25A 1NGIA 4DTPA 3ZETA 4A2BA 3EE9A 5TKYA 2YJEA 4PL8A 4BRLA 1EO1A 1WUAA 4A5BA 4F2RA 5AQNA 3L2QA 1NGDA 2YKMA 3CCEN 1NGJA 4K8ZA 5JMVA 2QA4N 1QQMA 4KH6A 3K5NA 3NGYA 1DGKN 3KLIA 2VGNA 1YF5L 2FBXA 2E6MA 2ZQBA 3OYEA 3QIOA 4PKHA 2DFFA 3O08A 1IKXA 4IZ9A 4JD2A 4LH4A 4E19A 2YJFA 3UIQA 2PY5A 4JV5K 3AO4A 3AV9A 1VQNN 2RN2A 4DV0K 5C24A 4BR7A 1RT2A 4AHCA 4CGFA 3KTQA 3NMUA 3CCRN 4K8XA 3LM9A 1RBTA 3PSIA 4WFBL 3U3YA 3BGRA 4B1VA 2NRZA 4FJLA 4GV3A 2Q31A 2QWLA 1RDWX 4ISGA 1RT3A 4ILGB 3QEVA 5BPMA 2JWKA 5AQPA 4CJFA 1VRUA 4C8NA 3PUFA 4H5RA 1Z6RA 4M7XA 5HRNA 4KHYA 1NK6A 2FLOA 5BN8A 1TYQB 2F8TA 3A8YA 3K5MA 3ISNC 4CJ3A 4YHHK 1ESVA 1RBSA 3RRGA 3CC4N 1QE1A 3P1GA 1M90O 3VERA 2QM1A 4H0XB 3THXB 4BGAA 1BHLA 3KLGA 4FO0A 1YIJN 2J4RA 4B9QA 1JKHA 3DI6A 2NZTA 3CQYA 2O8DA 4EAHD 3I56N 3V9WA 4U67L 1DTTA 1KSPA 1D9DA 3MN6A 4H5WA 5GIOA 1G99A 3LAKA 3VQDA 3C7NB 3ENHA 4O8KA 3CCVN 3CI5A 1JCGA 4DR6K 1QZ5A 5SZTA 2HW3A 3MWPA 1OH7A 2FF6A 1I94K 2IVOA 1DTQA 4IOAL 1WSGA 3VQ6A 1Q86O 2CGJA 3EYZA 3CJ1A 3H6EA 3OJSA 4H0VB 4CHYA 3AVKA 4QS8A 3U6FA 5C0YA 3QEWA 2KZMA 3HRGA 4CECA 3KLEA 4I9QA 1WOQA 3O9SA 4C1NK 4CK1A 4H0OA 5ELZA 4GY2B 4DFPA 5AQUA 1U4BA 1SQKA 2CGKA 3OBYA 4IFVA 2O8CA 4RWTA 1L3UA 1U2VA 4DR1K 2QWQA 1VRTA 3J8AA 3O9RA 2Q97A 3O9TA 4IBNA 3SJJA 3ZEUA 4E7HA 4DV7K 1KVAA 2E2PA 1YTUA 3V1OA 3LPTA 1SV5A 4FWQA 3L6QA 2P9PA 3THWB 5GAGP 2I5JA 4M3YA 4BRFA 4NCBA 5JLHA 4YNQA 2WUSA 4QS9A 4CGGA 3SPZA 1QZ6A 2HNDA 2IIRA 4IOXA 3SAGA 1RCHA 2AP1A 3ZX0A 4LF8K 4FM2A 1CLQA 3CC2N 1TGOA 4ILHA 3QNOA 4IFEA 3L8BA 3VF4A 4AF1A 1FJGK 1QHTA 3H1QA 2EWSA 3CCSN 3SQ0A 4TSXA 2HMPA 4OKKA 4FWKA 4FLZA 3WXLA 1DKGD 1TUUA 4F8RA 3PX0A 5HP1A 5M1NA 1YI2N 1RFQA 3E9LA 1T8EA 2A40A 4A61A 4KV8A 5AQTA 5KGXA 4OLAA 1XWLA 4DR5K 1VQ5N 4MDBA 3A5OC 1BO5O 1BQMA 2HHWA 3OS2A 3UB5A 3FLCO 4CEDA 4BRIA 3QDKA 3VQ4A 2V52B 4CZEA 1WSEA 4CJ4A 4M3ZA 2VQEK 4JI7K 2FF3B 1HQUA 3I8BA 4FM0A 2A5XA 3DRRA 4DQPA 3GDQA 3ZEUB 1T44A 4DU1A 3D6RA 4FL9A 1KTQA 4JLHA 2E2QA 4M7YA 2ASMA 4XH5A 3MCPA 4CJSA 4B1UB 3PX6A 2GUPA 1HYSA 3V9ZA 4ISEA 1K73O 4DTUA 4KB1A 4Y1CA 1TV6A 5JLFA 2HMIA 2AJQA 4WQ5A 4KRFA 5DM7L 4AM6A 5KGWA 1YUWA 4KH5A 3VMFB 2VWBA 4JK7A 5AQOA 2RPIA 4K0KK 1VQ7N 4BR4A 3DRSA 3QB0A 4BRDA 5CY4A 3AAQA 3Q7BA 3THXA 1Q9YA 2DPNA 2KW4A 1XQSC 4YDUC 1NJIO 3SMPA 3J7AP 3MXIA 1EXQA 2O8CB 3NF7A 3FFKB 4Z94A 4UY8O 1QQCA 3TAQA 2W6LA 1KFSA 4JRQA 2PBDA 4FPAA 2ASPA 5LJVA 1J6ZA 4GVMA 3TANA 4CZKA 2P5GA 3AO2A 4OX9K 1ZC6A 5F0XA 5FPMA 3HPOA 3T7ZA 3LDNA 2D5RA 4F4KA 1TL1A 2XY8A 4FK2A 1GLJO 1WAJA 3K57A 5FLXO 2JGUA 1QVGM 2UYTA 1VQ6N 4FJHA 3OYDA 1RGIA 2D0AA 1NJZA 4FLWA 1C0MA 1KLMA 3LP2A 4OGCA 4FJGA 4CHOA 3OS0A 3SPYA 4DR2K 4FZZA 2HVIA 2ZE2A 4DS5A 5HRSA 4X66K 1UA0A 4IKFA 4IEEA 3NDKA 3CG7A 1L5UA 3AO5A 3H46O 3HOTA 3CETA 3CM6A 5C15A 1NK5A 3CPEA 1JLBA 1V4SA 2HNZA 5F1XA 2HVHA 3RTVA 4JKEA 2WTUA 1LWCA 1BWFO 4H4OA 3P39A 4AHUA 3I8DA 5ADXH 4EZ9A 3QETA 4PY5A 3SJHA 5TKWA 3ZSVA 1C0UA 2E88A 2Q3SA 3ZSRA 1KRPA 3CFPA 3CFRA 3IMXA 3SBTA 1RDCA 3L3VA 4FSVA 4O5FA 4JEPA 1JXBA 1VQLN 4MLEA 3ZSYA 1S1VA 4XIUA 4DQ8A 2BTFA 4DSFA 5M1FA 1LWEA 4WCEL 1SL2A 3OY9A 3NHGA 3B6OA 3CCLN 5M1PA 4JN4A 4DTSA 3AVJA 3MXMA 2P9KB 3THVA 3VEWA 4WFAL 3AVAA 3EZWA 4C8OA 4MLHA 1HKBA 2P9KA 5CZ2A 1NGAA 2BE2A 2P9UB 1KD1O 4HCCA 4W5RA 5B8HA 4JI6K 1CZAN 4B9NA 5FROA 2ZJRL 1HYVA 2E20A 1TKXA 4X65K 2HHUA 2A41A 1MWKA 3DXMA 1EP4A 3P38A 1GLLO 1X9WA 4JI2K 4JKCA 1KFDA 3EKUA 1IV0A 3OYFA 1NLVA 1YJ9N 3PY8A 1XMOK 4FW1A 1KXPA 4BWJA 3DMJA 4FLVA 4OO1J 4Z4IA 1K8KA 2HB5A 4ISFA 2FC0A 5AQQA 3G6EN 4BR9A 1RDUA 3QEXA 1ZYQA 3DLKA 5I42A 3MEEA 4KH4A 1NK4A 3DOKA 1JLQA 4X64K 1M1KO 4IEIA 1S1TA 4DQIA 1VQ9N 3DLEA 3SQ2A 4Q0BA 4CERA 1XC9A 3HK2A 3PLAA 1X9MA 1HJOA 4CHNA 4BRPA 2O8BA 3MECA 4MDAA 2YI1A 1YTAA 4FWSA 3NF9A 3ULEB 1CXUA 2UXDK 4GMJB 5BRFA 4DSIA 5C2DA 4FK0A 3NVKA 1NGCA 3NH1A 3WNGA 3AVLA 3VEOA 3DLGA 3KVGA 4BRMA 1FXXA 3OYIA 3NGIA 3MAQA 4JI8K 3THYA 3SUPA 4N41A 3TABA 2KFNA 5KRTA 4LSLA 3T19A 1GLCG 3TPQA 4LF5K 4AILC 2V7YA 1HJRA 1WSIA 2HBJA 3DLRA 1ATSA 4I6MB 2P1JA 4W5NA 1NNEA 3EZ5A 1C1BA 3TAFA 3VEVA 1WN7A 2NUBA 4BGBA 3LL3A 3VENA 2GX9A 3ZT3A 3RWUA 3O3FA 2ZM6K 3C0BA 3MEGA 4HVJA 4E7IA 3LDSA 3SV4A 2P5OA 2AA4A 4FW2A 3SQ4A 4C8LA 4CFDA 3AVMA 4JKFA 4X62K 1VQKN 4NCGA 1T03A 1KCFA 3G4SN 1VSFA 1KVBA 4WQ4A 5D3GA 2E4LA 4NYFA 4F3OA 4BRHA 3C65A 4FYDA 4O0JA 4KHNA 1NG9A 1S1UA 5AQZA 2QWPA 3MX5A 1U48A 1NMNA 2O8BB 4CZLA 1HKCA 1VSEA 3CJ9A 5AR0A 1IJJA 5HBMA 4IJAA 4Y1DA 3VOVA 3SBGA 2HF3A 5BPLA 1SZ2A 1SUQA 1SL1A 1Q81O 1L3TA 1VQ8N 2KZZA 4CJUA 3SAHA 2F8SA 3OVNA 2P9IB 4KB0A 4CZMA 4DFKA 5AQJA 4FZYA 4KHQA 5GAEP 5AZJA 3AO1A 3NH2A 3AVGA 2UUBK 4O55A 5CHIA 5JS2A 1DT9A 2D4WA 4PWDA 3ZX2A 1JJ2M 4DHYA 2QWNA 4KI4A 4DV1K 4LF7K 5I3UA 4BE0A 1C0GA 4BDPA 2B6AA 1WNSA 2QXFA 5BREA 3KKRA 5AJ3K 4ELUA 5FPEA 2PZSA 4CZJA 1NJYA 4GVEA 1YAGA 3CXCM 4ID5A 1FW6A 4FWOA 1MDUB 3MX2A 1GLEG 2A42A 3HPHA 1SKRA 2YNIA 5E26A 1VSDA 1S1XA 2IVPA 1LV5A 3DXKA 1ATNA 4CEBA 2P9IA 1D4XA 2F96A 4CF2A 4HTLA 3LZIA 4PL7A 2YHWA 1RBUA 1ZBUA 3LWLA 4DLEA 3TAEA 1NM1A 4CEQA 3UKRA 3VEZA 1Y97A 4CEZA 1ILYA 1QSYA 1NWKA 1F21A 2EX3A 3DWLA 4AQYK 2HHVA 4LFAK 1NJWA 4JKAA 1E4FT 3J81O 4HUEA 4KFBA 3SYZA 2OANA 1GLDG 4EFHA 4Z4EA 3B6PA 1IBLK 2ZJPL 4ELTA 4GKJK 2I7NA 4HTUA 1IH7A 3QICA 3P31A 3D0PA 3QERA 2VG5A 4L3QA 1SAZA 4B9TA 1LCUA 4CJ7A 4YOUA 4R79A 3KLFA 2HHQA 3AVHA 3M8QA 5AQKA 2ZJQL 3O80A 4ZTFA 2X78A 3R1XA 3T1HK 4CFCA 3RMAA 3R3LA 1W2BM 4CD1A 1YVUA 1QHAA 4B9SA 2O8EB 2YNGA 4BRNA 4E3SA 3F2KA 3VF6A 3WT0A 4BC4A 3OYKA 3V9SA 4BVPA 1FKOA 3K2PA 3OYNA 4CEFA 1XHXA 2WBNA 1WBBA 1DLOA 4IDHA 4B9MA 5EU7A 5CE3A 1TKZA 4E89A 4WQ4C 1C6VA 4ELVA 2YKNA 3WNHA 3CCUN 3H3NO 4B3RK 4AHVA 4H0PA 1EKEA 3D2EB 4XH1A 4LY7A 3PO5A 2G8KA 3J7ZO 2E2OA 4JAXA 4J8FA 3VTIA 5KPZA 1HNIA 3M1FA 3KWIA 4QOZB 3HP6A 2O8FA 3V9UA 4KREA 4CJWA 4CW7B 2YX6A 4YOYA 1HMVA 2XY7A 1U47A 3TSQA 4BDYA 4JI5K 1I3AA 2FSKA 3OYJA 1N32K 4JS5A 4PHTX 3IUCA 1X9JA 4KPYA 1NGFA 4FWNA 4B3SK 5CZ1A 4B1WB 4CE9A 2Q2RA 3CQXA 5DMRA 3VESA 4FLYA 5AQFA 4JI0K 4MO5A 4BR2A 4JK9A 5K14A 1BA0A 3J80O 5FRNA 4FJMA 1RDAA 3H1VX 3HOSA 4B3OA 2NRVA 3S9HA 3N4QA 4JI4K 1P8ZA 4B3TK 3Q7CA 3WXMB 4BRCA 4CGJA 3ZYYX 2O8EA 1BA1A 5EY4A 2NNWA 2IVNA 3U8XA 4A2AA 3PIOL 3SMSA 1EWQA 4B8CA 4LH5A 1S3XA 4FOEA 1RT1A 3EO3A 4GNIA 5C2FA 2XY6A 4OGEA 2QWOA 4FXDA 2H3GX 3G71N 3TTCA 4ID1A 5M1KA 2E8AA 3MDQA 3DJCA 4I6MA 2O4GA 4RTFD 4H5NA 2QEXN 4FWRA 4XEIA 3QFPA 3QINA 1JCEA 5AQGA 3K58A 1HPZA 2HHTA 4LF4K 5GINA 1TYQA 4DFMA 2HF4A 3I0SA 3JXUA 1U45A 2YV0X 3UKUA 2YHBA 3WNEA 3ZETB 3BDPA 5KQ8A 5C42A 1I39A 4GW6A 4CF9A 5AQSA 3TAMA 4JRPA 4NYNA 3AY9A 1N36K 4B9LA 4FWLA 4LF6K 2NRRA 3LDQA 3LPUA 1BG3A 3NF6A 3O1BA 3MK6A 5CYMA 1S1WA 3LP0A 4DR4K 4BRKA 1REVA 3DRPA 3EE8A 4HHTA 3ZT2A 1NK7A 2WOMA 4XH4A 4E1MA 2YCHA 1HKGA 5M1QA 3V1RA 4R5PA 3GBTA 4NB4A 2QWRA 3KHYA 1D9FA 3VQCA 4YDUA 3LP1A 4LD0A 4CBWA 1EWRA 3I33A 2XHBA 4CK3A 4K43A 3C6UA 3SUOA 2YNFA 3ITHA 1Y64A 3O9QA 3OYHA 2RHKA 1UA1A 4RW6A 1NKCA 3KWGA 3M5RA 2BDPA 4CFAA 3PO4A 1BDGA 1S6QA 4CHPA 4HCBA 3WEEB 3C6TA 4BC5A 1WB9A 1GLAG 4GV6A 4KHSA 3V4IA 1ZXOA 4KO0A 2Y1JA 2P9NA 3K0SA 1K6YA 1CXQA 1XHZA 4M42A 2NRXA 3T1AA 4EIAA 4GKKK 1A5XA 3ID8A 2O8FB 1HPMA 3OYLA 1VK0A 5AQXA 4H0YB 4IG0A 3M8RA 2IGIA 2HHXA 3AA5X 4AHSA 3VQ9A 2FBTA 3AA2A 4Z4HA 3QEIA 4BE1A 2P9PB 2UUAK 1FK9A 5CYQA 1J54A 3R6MA 3SAFA 1OH8A 4A62A 2XY5A 1XC3A 4B08A 2CH5A 3L2WA 4IDKA 4BR5A 3LALA 4EHUA 3O9UA 1R0AA 2DFEA 3EY1A 4AH9A 4BRAA 4CJEA 1Q9XA 2G8UA 1ATRA 3HI0A 1QSLA 1SKWA 3QNNA 1YITN 4C8MA 3SV3A 4CZFA 3KIOA 3D7EO 3IS9A 5AQWA 4H5VA 4MQ3A 4J2DA 2HBLA 1SS6A 3OBWA 1N8RO 4DTMA 3FGUA 3S3MA 1GOCA 2D0PA 1B92A 4DSEA 3B8AX 5GADP 3HP9A 3V9XA 3SUQA 1EETA 3O4NA 5KTQA 4O8UA 2PAVA 1IG9A 1W9HA 2B5JA 3CD6N 1KQSM 1YHQN 3D45A 3P4IA 1RDDA 1LOTB 2XO7A 4DV5K 2QXLA 2G8IA 3VQPA 3HTVA 4DTJA 5HROA 3VQ7A 3FE1A 2E6LA 4N56A 3AVNA 4CZIA 5BR8K 1IG8A 1QTMA 4CJVA 1HX1A 2FXUA 1LW2A 4DTOA 3BY5A 3GOIA 3MXJA 3QESA 3ZSQA 1RT4A 1S5JA 4E7LA 4JK8A 1VSKA 4BQZA 4EP4A 4JNEA 2CH6A 1ZBIA 1GOAA 3VQQA 1OVYA 4JKGA 3HJFA 2OPSA 4OKEA 4B1ZA 3D2FB 3AVCA 1ZBHA 4RW7A 1QQNA 3JS6A 3RRHA 3A0IX 4Q5VA 3AVBA 4CBUA 1JLAA 4CHQA 4CIFA 4BG9A 3AO3A 3L3UA 1IKYA 3IDHA 3LWMA 4BDZA 1XNQK 2FSJA 3BZCA 1N33K 3G25A 1NGHA 2GUIA 3ULDA 4F9OA 4NLBA 5KI6A 1T7PA 3F9KA 3KD1E 4EZ6A 2Q36A 1LWFA 4H8KA 3OYGA 2W42A 1LAVA 2FBVA 4CBXA 2IOCA 3KK1A 4DV6K 1U2VB 2Z1JA 3HM9A 2OPPA 5IWAK 5AQIA 1JXEA 5KRSA 1BL3A 1U49A 3O1WA 2ATQA 3FZKA 5AZIA 4DV3K 5JS1A 3IG1A 2G8FA 3V81A 2ASOA 3RSEA 3L2RA 5LL6Z 5J2MA 1H1VA 4DSKA 1DEJA 2PYLA 2F7TA 4Z4CA 3MEDA 4DTRA 3LM2A 3K9KA 1S9EA 5EXWA 3VQAA 4FVUA 4CFBA 4CZHA 2YHAA 3CC7N 1UOCA 1O13A 4M3TA 5FDLA 3LZJA 1BISA 4AM7A 3GE1A 4CF8A 3K59A 1Z25A 1RNHA 4J2BA 3LP3A 4BQLA 2JWLA 4CF1A 5HRRA 1BI4B 2I7PA 3WXJA 4NCAA 4JKDA 2KHOA 2PYJA 1ZBLA 3GL1A 3FR0A 5AFUH 1TKDA 3QMLA 4IWVA 3U9DA 1J9AA 3OA9A 2V51B 2P51A 3VGKA 1S6PA 2GWJA 2CGLA 4FJNA 4EP5A 5M1OA 3SCXA 2BGGA 2Q0UA 4FJ5A 1MA9B 4M45A 1HQEA 2HNYA 3HM8A 3D2FA 3K9JA 2OTJN 3KLHA 4M3UA 3EKSA 2HBKA 1XUPO 2QWMA 2ZF5O 4FOIA 4CHZA 2OPQA 4Z4GA 3ZSOA 1HNZK 3O4QA 3UKUB 4J2AA 3AARA 3MWTA 2HOEA 2RKIA 4IFYA 2G8HA 5JVHL 3ATVA 4JYAK 4DU4A 4LF9K 3U9ZA 3DLLL 4M3RA 4W5OA 3CCMN 3OJUA 1Q82O 4BREA 3AVFA 3HSCA 3K5LA 4OPKA 1G15A 1LAWA 1NBWA 4N76A 3O3GA 1U04A 4KTWA 3OHRA 1XNRK 4KHPK 3R8EA 3O5BA 3ZCMA 1ZBFA 3R9PA 3ASMA 3HYFA 1KLNA 1Z05A 3CCJN 4FM1A 1WAFA 4FJJA 3HXMA 1YVNA 3ZT4A 3ZT1A 5C25A 3HZ6A 4M41A 1MU2A 4RW8A 3KD5E 2X6NA 4PA1A 4FJ7A 1BIZA 4ILJA 3VGMA 1T6CA 5BN9A 2Z1IA 4BR0A 3HVTA 4CVNE 3RMDA 4CESA 5BPNA 3BP8A 1BOTO 5MLCQ 1YXQA 4B9VA 3E01A 4JKGB 3ZSWA 3SLCA 3JSMA 3CJCA 3L4QA 2VCPA 2GTDA 4Z4FA 2X6SA 3M8SA 2Q0RA 1BU6O 3T69A 4DTXA 2P9UA 3ZT0A 1NJXA 4V19S 4N47A 1B9FA 4BROA 2DFHA 1EQYA 3QO9A 4JD2B 1RT6A 2GWKA 3F5TA 3QBXA 2OZSA 3VF2A 1VQON 1KAXA 2PFUA 2EHGA 1V4TA 5IT9O 4H5TA 4LC9B 2QKBA 1Q8IA 4I2PA 4JI1K 4CZGA 3VA0A 4JHDB 1WLJA 1IO2A 4O0IA 4YOVA 1SKSA 3SQ1A 4PUOA 3NVMA 2VWJA 4DQSA 4J2EA 1NOYA 3EL2A 3DXMB 1OKJA 4E1NA 1JLEA 3HPGA 4KBOA 1TK5A 3CJ7A 5E84A 4DSLA 3TWHA 1JCFA 2E5LK 2P9SA 3O8MA 3U3GA 4O5BA 2VG6A 4KI6A 1UAXA 3OYCA 2BANA 2YNHA 4FPBA 4DLGA 4E0DA 4KKOA 1NK8A 1D5AA 4I2QA 1YT3A 1YJNN 4K42A 3OYAA 1P90A 5AQHA 4FJ8A 3RR7A 1RT5A 5BRHA 4W5TA 5HLFA 3NAEA 4FZXC 3FZFA 1OH5A 4CCHA 3BEXA 3F9MA 5C10A 3E1YA 5EOYA 2P9LA 4CF0A 1RTJA 3TSUA 1QSSA 2UXBK 1Z26A 2B4JA 4DQRA 1E4GT 3C95A 5AQLA 2Z1HA 4OLBA 3KK3A 4WE1A 3C94A 2W41A 5AQMA 3N4PA 3IRXA 3KZBA 1CZ9A 3ZSZA 4DF8A 2KTQA 5LY3A 2E2NA 1IBKK 3W3DA 3S3OA 4LFBK 3HO1A 5I9EB 4KTZA 5KQDA 1HNVA 1L3SA 4CGHA 3SNNA 2HHSA 5AZIB 2OTLN 1HYZA 1N6QA 3S41A 1GLBG 4I7FA 4Y0WA 1K8AO 1EX4A 2D0BA 2WONA 2E1YA 3CJBA 4KAZA 4QAGA 2WFBA 1WSFA 1ITGA 4WQ5C 3NGZA 4E1JA 2NRTA 2W40A 3H08A 2D1KA 3A5MC 1RBVA 3VTHA 4Z0UA 2O4IA 3NBPA 4DU3A 2VQFK 1NGEA 1X3MA 3K5OA 3SK3A 4K41A 4B8AB 5SWMA 3FFIA 4DUZK 2FSNA 3VQ5A 1NGBA 5LJWA 4ZHRA 3WXKA 4ICLA 3TARA 3MMVA 4RCHA 4OJRA 2RF2A 1BI4A 3IKMA 1XI1A 3NFAA 3WNFA 4CGIA 4DUYK 4DF4A 3PV8A 2GBZA 3JYTA 4JI3K 3PIPL 2IS3A 3H3OB 3ENOA 2HHHK 4PKGA 5LMUK 4BY9C 1ASVA 4HUGA 3QLHA 2Y1IA 3VETA 4CI6A 3KK7A 3ID6A 2P9NB 4JKBA 5FRMA 4E7KA 1ASUA 3L2UA 1HLUA 2ETJA 4O44A 4LFCK 3DYAA 5AQYA 4CD3A 2QK9A 3OYBA 3TAGA 5AQVA 4CJQA 3CJAA 3WQUA 3TR8A 1NK0A 4QCLA 3OYMA 1BGXT 4B1YB 3HT3A 1KAZA 3SI6A 2NRWA 3NE6A 4PQUA 2IDOA 5CR4A 4UQGA 4U7BA 4FK4A 3BF1A 3HVRA 3VGLA 2P9LB 4OPJA 3FZMA 4CK2A 1QVFM 2A1SA 3F73A 3LDOA 1IKWA 2OZMA 4FLTA 4C8KA 2OCEA 3MN7A 4DTNA 2KLAA 2Z1GA 4JHDA 4G9ZA 4DR7K 1QS4A 3ENBA 4FWMA 1JLFA 1TK8A 2UU9K 1TKTA 1BUPA 3M3ZA 3TI0A 1Q18A 5FPDA 4DG1A 4PKIA 1LW0A 4H4MA 1VAZA 4FLUA 1T6DA 3ALYA 4B9UA 1RTDA 3CERA 4MO4A 3IAYA 3M6GA 3TU5A 4A57A 5BRDA 1NGGA 3QEPA 2DY4A 4H0TB 4FJ9A 2OYQA 5C12A 4C1NI 1N34K 2WC9A 3ZSXA 4M3XA 4CJPA 3DXKB 3FZLA 3AA4A 3QIPA 1VHXA 4DQQA 5AFUA 1TVRA 3U4LA 2QI2A 1J5EK 1K8KB 2P9SB 4BVOA 5H1SQ 3CF5L 3ATUA 4OPHA 2NRHA 3A2FA 3VQEA 1KC8O 4NXMK 3WUHA 3DAWA 4N5SA 1RDBA 1C0TA 1BIUA 4OVLA 3UKRB 4CGDA 4L8RB 4M63C 1T05A 3C7NA 3NCIA 1VSLA 3A5LC 3VQ8A 1S72N 3DLHA 4FCYA 4RG8A 1NK9A 2F9WA 4BACA 3RMCA 1W7AA 3MCAB 3L4IA 3WQTA 4DKWA 2VWKA 5LMNK 4IO8A 3W0LA 1QQOA 3RSEB 2LSNA 2JLEA 3UE5A 2OPRA 3BUZB 3NF8A 1TAQA 1TL3A 3C6AA 4FWPA 3BZKA 3DM2A 5EX5A 3O6WA 1FKPA 3KK2A 4I9LA 1JLCA 1L3VA 2HBMA 1TUYA 2QTDA 4RW4A 4KTQA 2VYPA 1UWBA 3MN9A 1OH6A 4DCHA 3EEQA 3G10A 5T7BA 2R7YA 2ITMA 4IXCA 4F2SA 1TK0A 3M8PA 5FPNA 1RTIA 1E3MA 3SUNA 1B9DA 1K9MO 4YOXA 1VSMA 3ZLJA 1O1WA 4YORA 4YOTA 1WBDA 1U6ZA 3HSTB 4A5AA 1NKBA 4W5QA 3AVIA 3CIPA 1W97L 4BC2A 2V7ZA 2VG7A 4DV4K 3BF3A 3GG4A 5JICA 3KJVA 4OKJA 4IJNA 2UUCK 3CQ8A 3A5NC 2G8VA 3G0ZA 2ZD1A 2KKZA 1NKEA 4HUFA 2A3ZA 3E9OA 1X3NA 4CEAA 3PSFA 1A5VA 1A5WA 4FJIA 3L2VA 1JL2A 4CIEA 1Q7YO 3LDLA 1NU0A 3CM5A 3L0QA 4CJ5A 2F4VK 1S22A 3TSPA 4BE2A 2DTUA 2G8WA 3AGKA 4DMNA 3TAPA 2XRIA 5HOOA 2ZGYA 1HR0K 1WSJA 3O4WA 4CJKA 1WSHA 1KVCA 3C6HA 5BR9A 5F2RA 1CZBA 4IG3A 4NLCA 3D2EA 3PX4A 1BCOA 4WF9L 5A2QO 2FBYA 1XMQK 5DK5A 4FJKA 2GELA 1C1CA 2YHYA 3NH0A 1YJWN 5AZJB 1R59O 4A59A 1N5YA 1IBMK 4FLXA 1VSHA 1S9GA 3LAMA 5KPTA 3AAPA 5AQRA 3J7YP 1ASWA 4G1QA 3VA3A 2A6AA 3HL8A 1VQ4N 4M3WA 3EN9A 3LDPA 1RTHA 1IKVA 1X9SA 3DOLA 3MN5A 3QBWA 1RBRA 4AHTA 4DR3K 3OS1A 3OW2M 4F3TA 4H03B 3CCQN 5JVGL 3V1QA 4QS7A 2O8DB 1JL1A 3P5JA 5GAHP 3CMEN 4WYBA 3O3HA 3ULEA 3T1YK 4EHTA 2OA8A 2X74A 1ZBSA 5J2NA 3ZX3A 3I0RA 1MWMA 1BCMA 4BC3A 4FJXA 3VEYA 4O4GA 3VPZA 1NMDA 1HNXK 1C1AA 4DSJA 3SZ2A 3RR8A 3CFOA 2ITGA 4KHUA 1C0FA 4IOCL 1VSJA 4ZTJA 4RW9A 1HRHA 3I55N 3VQBA 3WEEA 4LSNA 4DWIA 5E41A 2NLXA 4NO7A 3CHWA 5HRPA 4KHWA 3T3FA 3E66A 3RMBA 4CJRA 4BRQA 4AHRA 1SL0A 3THYB 2IAJA 4BRGA 1W0HA 2KQ2A 4CJLA 2BH1A 2D0OA 3TTFA 3LANA 3S3NA 3CYMA 5J2PA 4BG8A 1VQMN 4BWMA 1KAYA 2RE2A 1RILA 4OPAA 4HWIA 1HNWK 3RVCA 2Q1NA 4CEEA 4CJTA
chains in the Genus database with same CATH topology
4DS4A 4O5BA 3U3GA 2Q3SA 2VG6A 4KI6A 3ZSRA 1VSIA 1UAXA 3LPUA 3NF6A 1BQNA 2BANA 2YNHA 4CIGA 3OYCA 4KKOA 3CFRA 5CYMA 3KKSA 1S1WA 4DLGA 1NK8A 4E0DA 1D5AA 1RDCA 3L3VA 3LP0A 4I2QA 1YT3A 1JXBA 3OYAA 4YFUA 1REVA 3DRPA 4HHTA 1NK7A 3ZT2A 2KFZA 2WOMA 4FJ8A 4E1MA 3ZSYA 1S1VA 4XIUA 1RT5A 3RR7A 4DSFA 1JLGA 1GOBA 1NOZA 4W5TA 4E7JA 1LWEA 3V1RA 3NAEA 5HLFA 4FZXC 1SL2A 4R5PA 4CCHA 4CEOA 3OY9A 3NHGA 3B6OA 4CF0A 1RTJA 1QSSA 1D9FA 1KRPA 3VQCA 1Z26A 2GV9A 2B4JA 4DTSA 3AVJA 3CFPA 4DQRA 3LP1A 3MXMA 4LD0A 3THVA 3AVAA 2XHBA 3C95A 4CK3A 1X1PA 4C8OA 3C6UA 2IC3A 5CZ2A 2BE2A 5J1EA 2YNFA 3SUOA 2Z1HA 3ITHA 3OYHA 4OLBA 4HCCA 4W5RA 3KK3A 4WE1A 1D8YA 1UA1A 3C94A 4RW6A 1NKCA 4B9NA 3IRXA 4DF8A 1CZ9A 5FROA 3ZSZA 4CFAA 1HYVA 2BDPA 3PO4A 4HCBA 1S6QA 1TKXA 4CHPA 1J5OA 2HHUA 2KTQA 3C6TA 1EP4A 1RT7A 2QKKA 1X9WA 3S3OA 1KFDA 2D0CA 4KTZA 4MFBA 4DFJA 3V4IA 4KHSA 3HO1A 1HNVA 2A1RA 4KO0A 4CGHA 4JS4A 2Y1JA 3SNNA 1L3SA 2HHSA 1HYZA 3OYFA 4FVMA 3PY8A 1N6QA 4FW1A 1K6YA 1CXQA 3VN5A 4I7FA 1XHZA 4BWJA 4M42A 1EX4A 2D0BA 2WONA 3T1AA 4KAZA 4QAGA 3DMJA 3AA3A 3P83D 3V6DA 1A5XA 1WSFA 4FLVA 3DLBA 4Z4IA 1ITGA 3OYLA 2HB5A 3NGZA 1J53A 1VK0A 3H08A 2FC0A 4IG0A 4DTPA 1RBVA 3M8RA 2IGIA 2HHXA 3QEXA 4Z0UA 3AA5X 4AHSA 1ZYQA 3VQ9A 3DLKA 5I42A 2O4IA 3MEEA 2FBTA 3AA2A 4Z4HA 3QEIA 4F2RA 3NBPA 1NK4A 2KZMA 3DOKA 4DU3A 1JLQA 3L2QA 4B8AB 3K5OA 5SWMA 3FFIA 1S1TA 2YKMA 3VQ5A 4BE1A 4DQIA 3DLEA 4ZHRA 3SQ2A 1FK9A 4Q0BA 4ICLA 5CYQA 3TARA 4K8ZA 1J54A 4OJRA 2RF2A 4CERA 1BI4A 1XI1A 1XC9A 3NFAA 3HK2A 3WNFA 4CGIA 4DF4A 1X9MA 3PV8A 2XY5A 3K5NA 4CHNA 2GBZA 4B08A 3MECA 3NGYA 3JYTA 1YTAA 3KLIA 3NF9A 4IDKA 1CXUA 3L2WA 3LALA 4GMJB 2FBXA 1R0AA 2DFEA 3EY1A 2IS3A 2E6MA 4AH9A 4CJEA 1Q9XA 4DSIA 2ZQBA 2G8UA 3OYEA 3QIOA 2DFFA 1IKXA 4FK0A 4LH4A 3NH1A 3WNGA 1ASVA 4E19A 3AVLA 4HUGA 3QLHA 3UIQA 3DLGA 2Y1IA 2PY5A 3AO4A 3AV9A 1QSLA 1FXXA 3OYIA 3NGIA 1SKWA 3QNNA 2RN2A 5FRMA 4E7KA 1ASUA 5C24A 3L2UA 4C8MA 2ETJA 4O44A 1RT2A 3DYAA 4AHCA 3MAQA 3SV3A 3SUPA 4N41A 3TABA 2QK9A 2KFNA 4CGFA 4LSLA 3KIOA 3T19A 5KRTA 3IS9A 3KTQA 3OYBA 3TAGA 4K8XA 4CJQA 1RBTA 4MQ3A 4J2DA 3TR8A 4AILC 1NK0A 1HJRA 1WSIA 3U3YA 3BGRA 4DTMA 3DLRA 4QCLA 3S3MA 3OYMA 1GOCA 1BGXT 2P1JA 3HT3A 1B92A 3SI6A 4FJLA 3NE6A 4PQUA 4W5NA 2IDOA 4DSEA 4UQGA 3EZ5A 1RT3A 3HP9A 3V9XA 3SUQA 1EETA 1C1BA 3TAFA 3O4NA 3HVRA 4FK4A 5KTQA 1WN7A 3QEVA 4OPJA 4CK2A 2NUBA 1IG9A 1W9HA 2B5JA 2A1SA 3ZT3A 3RWUA 4CJFA 3O3FA 3F73A 1VRUA 1IKWA 4C8NA 2OZMA 3PUFA 4FLTA 4C8KA 3D45A 4KHYA 5HRNA 1RDDA 3MEGA 4HVJA 4E7IA 3LDSA 3SV4A 4DTNA 2XO7A 2Z1GA 1NK6A 2G8IA 2P5OA 3VQPA 2F8TA 4FW2A 3K5MA 4DTJA 3SQ4A 3VQ7A 5HROA 1QS4A 3ISNC 4CFDA 4CJ3A 4C8LA 1JLFA 2E6LA 3AVMA 4N56A 3AVNA 1RBSA 4NCGA 1T03A 1TK8A 1TKTA 1KCFA 3RRGA 1VSFA 1KVBA 1QE1A 1QTMA 3P1GA 4CJVA 3TI0A 4DG1A 5D3GA 1LW2A 4DTOA 2E4LA 1BHLA 4NYFA 3KLGA 4F3OA 3MXJA 3QESA 1LW0A 4FYDA 4H4MA 4O0JA 4FLUA 4KHNA 1S1UA 3ALYA 3ZSQA 4B9UA 1JKHA 1RT4A 3DI6A 1S5JA 1RTDA 1U48A 3V9WA 4E7LA 1DTTA 1VSKA 1KSPA 3IAYA 1VSEA 4EP4A 1D9DA 3QEPA 2DY4A 5HBMA 1GOAA 4FJ9A 1ZBIA 2OYQA 3LAKA 3VQDA 3VQQA 4Y1DA 1SUQA 1SL1A 1L3TA 2KZZA 3ZSXA 3HJFA 4M3XA 2OPSA 4CJUA 4CJPA 4OKEA 3AA4A 2F8SA 3OVNA 3QIPA 4DQQA 3AVCA 1ZBHA 5SZTA 4RW7A 1TVRA 4KB0A 2HW3A 3RRHA 4DFKA 4Q5VA 4FZYA 4KHQA 3AVBA 3AO1A 3NH2A 3AVGA 1JLAA 3A2FA 4CHQA 1DTQA 3VQEA 4CIFA 1WSGA 3AO3A 3L3UA 4O55A 4N5SA 1IKYA 1RDBA 5JS2A 3VQ6A 3LWMA 4BDZA 4PWDA 1C0TA 1BIUA 4OVLA 3EYZA 4CGDA 4L8RB 4KI4A 3OJSA 4CHYA 5I3UA 3AVKA 4BE0A 1T05A 3NCIA 3U6FA 1VSLA 4BDPA 3VQ8A 2B6AA 1WNSA 2QXFA 3QEWA 3DLHA 3KKRA 4FCYA 4ELUA 4RG8A 4CECA 2GUIA 3KLEA 4BACA 3ULDA 3RMCA 1NK9A 2PZSA 4I9QA 2VWKA 1NJYA 5KI6A 1T7PA 3F9KA 4CK1A 3KD1E 4EZ6A 1LWFA 2LSNA 4ID5A 4H8KA 3OYGA 2JLEA 2W42A 1LAVA 2OPRA 2FBVA 3NF8A 4DFPA 1TAQA 1TL3A 2IOCA 3KK1A 1U4BA 5J2QA 3DM2A 2Z1JA 3HPHA 4IFVA 3HM9A 1SKRA 1FKPA 3KK2A 2OPPA 4I9LA 1JLCA 1L3UA 1JXEA 2YNIA 1L3VA 1VRTA 5KRSA 1BL3A 1VSDA 1U49A 4KTQA 1S1XA 4IBNA 4RW4A 2ATQA 1LV5A 3SJJA 1UWBA 4CEBA 3IG1A 5JS1A 4E7HA 1KVAA 2G8FA 1YTUA 3V1OA 3G10A 3LPTA 5T7BA 1SV5A 2R7YA 3V81A 5J2MA 3L2RA 2F96A 4CF2A 4DSKA 2PYLA 2I5JA 1TK0A 3M8PA 4F2SA 4M3YA 3LZIA 4NCBA 1RTIA 4Z4CA 1RBUA 1ZBUA 3MEDA 4YNQA 4DTRA 3LWLA 4DLEA 3TAEA 4CGGA 3SUNA 1B9DA 1S9EA 3SPZA 4CEQA 2HNDA 1VSMA 3VQAA 1O1WA 4CFBA 1Y97A 2YHAA 4CEZA 1QSYA 2EX3A 1F21A 1RCHA 3HSTB 1NKBA 4W5QA 1UOCA 2HHVA 4FM2A 4M3TA 3AVIA 5FDLA 1NJWA 1CLQA 3LZJA 4HUEA 1BISA 4KFBA 3SYZA 1TGOA 2VG7A 4CF8A 3K59A 1Z25A 1RNHA 4J2BA 3QNOA 3B6PA 3LP3A 4Z4EA 3L8BA 3KJVA 4CF1A 5HRRA 4OKJA 1BI4B 4ELTA 4NCAA 3CQ8A 4HTUA 1IH7A 1TAUA 2PYJA 1QHTA 1ZBLA 2G8VA 3G0ZA 3D0PA 3QERA 3SQ0A 4TSXA 2ZD1A 2VG5A 1NKEA 4B9TA 4OKKA 4FLZA 3KLFA 2HHQA 3AVHA 3M8QA 4HUFA 1TKDA 4ZTFA 2X78A 4F8RA 1J9AA 3PX0A 5HP1A 4CEAA 4CFCA 3RMAA 2P51A 1A5VA 1A5WA 1S6PA 4FJIA 3L2VA 1JL2A 4FJNA 4CIEA 4EP5A 1T8EA 1YVUA 3SCXA 2BGGA 4KV8A 4B9SA 3CM5A 4FJ5A 4CJ5A 5KGXA 4OLAA 2YNGA 4M45A 4BE2A 4E3SA 2DTUA 1XWLA 1HQEA 2HNYA 2G8WA 4DMNA 3TAPA 3OYKA 2XRIA 3V9SA 1FKOA 3K2PA 3OYNA 3KLHA 4M3UA 1BQMA 4CEFA 3OS2A 2HHWA 1XHXA 4CEDA 3VQ4A 1DLOA 4B9MA 4CHZA 1WSJA 2OPQA 4CJKA 5EU7A 4Z4GA 1WSEA 1KVCA 1WSHA 1TKZA 4CJ4A 4E89A 1C6VA 4ELVA 2YKNA 3WNHA 3ZSOA 4M3ZA 3O4QA 1CZBA 4IG3A 1HQUA 4FM0A 3PX4A 4J2AA 4AHVA 3DRRA 4DQPA 1BCOA 1EKEA 2RKIA 2FBYA 4LY7A 4IFYA 2G8HA 3PO5A 5DK5A 4DU1A 4FJKA 2G8KA 4DU4A 1C1CA 3NH0A 1KTQA 4JLHA 4M3RA 1HNIA 4W5OA 3OJUA 4QOZB 3HP6A 1N5YA 3AVFA 4FLXA 3V9UA 3K5LA 1VSHA 3PX6A 4CJSA 4OPKA 1S9GA 4CJWA 1G15A 3LAMA 4KREA 1HYSA 1LAWA 1HMVA 2XY7A 1U47A 1ASWA 4N76A 4G1QA 4BDYA 3O3GA 1I3AA 3V9ZA 3HL8A 3VA3A 4M3WA 3OYJA 1U04A 4DTUA 4KTWA 4JS5A 4KB1A 4Y1CA 1TV6A 1RTHA 2HMIA 4KPYA 2AJQA 1IKVA 1ZBFA 3ZCMA 4KRFA 3ASMA 1X9SA 3DOLA 3HYFA 5KGWA 5CZ1A 1KLNA 1RBRA 4CE9A 4FM1A 1WAFA 4FJJA 3HXMA 5DMRA 4FLYA 2RPIA 4AHTA 3OS1A 3DRSA 3ZT4A 5K14A 3ZT1A 4F3TA 5C25A 5FRNA 4FJMA 5CY4A 1RDAA 4M41A 1MU2A 4RW8A 4B3OA 3V1QA 3S9HA 1Q9YA 2X6NA 4PA1A 2KW4A 3KD5E 4FJ7A 1BIZA 1JL1A 3P5JA 3MXIA 1EXQA 3O3HA 2Z1IA 3NF7A 2X74A 2OA8A 5J2NA 4CGJA 3HVTA 1QQCA 3I0RA 3TAQA 3RMDA 1BCMA 4CESA 1KFSA 4JRQA 4FJXA 4O4GA 1C1AA 4B9VA 3E01A 3SZ2A 3RR8A 4DSJA 4B8CA 3CFOA 2ITGA 4LH5A 4GVMA 3TANA 4KHUA 1RT1A 2P5GA 3AO2A 1VSJA 3ZSWA 4ZTJA 4RW9A 3JSMA 2XY6A 4OGEA 3HPOA 4Z4FA 2X6SA 3M8SA 4FXDA 4DTXA 2D5RA 4F4KA 1HRHA 1TL1A 2XY8A 3VQBA 3ZT0A 1NJXA 1WAJA 4LSNA 3K57A 4DWIA 4N47A 4FK2A 1B9FA 5E41A 2JGUA 2DFHA 3QO9A 4ID1A 4FJHA 3OYDA 2D0AA 5HRPA 1NJZA 4KHWA 4FLWA 1RT6A 2OZSA 1KLMA 1C0MA 3LP2A 4OGCA 3T3FA 4CHOA 3OS0A 4FJGA 3SPYA 4FZZA 2HVIA 2ZE2A 3RMBA 4DS5A 2O4GA 4CJRA 2EHGA 5HRSA 1UA0A 4IKFA 3NDKA 3CG7A 1L5UA 4AHRA 1SL0A 3AO5A 2IAJA 3QINA 3K58A 2QKBA 1W0HA 1HPZA 1Q8IA 2KQ2A 2HHTA 4I2PA 4CJLA 3CM6A 3VA0A 4DFMA 1WLJA 1IO2A 1NK5A 1JLBA 3I0SA 4O0IA 2HNZA 1SKSA 2HVHA 1U45A 2YV0X 3LANA 3RTVA 3S3NA 2YHBA 3CYMA 5J2PA 3SQ1A 4PUOA 4BWMA 3WNEA 2VWJA 4DQSA 1NOYA 1LWCA 3BDPA 4J2EA 4E1NA 5C42A 1I39A 4H4OA 4AHUA 3I8DA 1RILA 1JLEA 3HPGA 4GW6A 4CF9A 4EZ9A 3QETA 3TAMA 4PY5A 4JRPA 1TK5A 4NYNA 4DSLA 3TWHA 4CEEA 3ZSVA 4CJTA 4B9LA 1C0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DS4 A;  4O5B A;  3U3G A;  2Q3S A;  2VG6 A;  4KI6 A;  3ZSR A;  1VSI A;  1UAX A;  3LPU A;  3NF6 A;  1BQN A;  2BAN A;  2YNH A;  4CIG A;  3OYC A;  4KKO A;  3CFR A;  5CYM A;  3KKS A;  1S1W A;  4DLG A;  1NK8 A;  4E0D A;  1D5A A;  1RDC A;  3L3V A;  3LP0 A;  4I2Q A;  1YT3 A;  1JXB A;  3OYA A;  4YFU A;  1REV A;  3DRP A;  4HHT A;  1NK7 A;  3ZT2 A;  2KFZ A;  2WOM A;  4FJ8 A;  4E1M A;  3ZSY A;  1S1V A;  4XIU A;  1RT5 A;  3RR7 A;  4DSF A;  1JLG A;  1GOB A;  1NOZ A;  4W5T A;  4E7J A;  1LWE A;  3V1R A;  3NAE A;  5HLF A;  4FZX C;  1SL2 A;  4R5P A;  4CCH A;  4CEO A;  3OY9 A;  3NHG A;  3B6O A;  4CF0 A;  1RTJ A;  1QSS A;  1D9F A;  1KRP A;  3VQC A;  1Z26 A;  2GV9 A;  2B4J A;  4DTS A;  3AVJ A;  3CFP A;  4DQR A;  3LP1 A;  3MXM A;  4LD0 A;  3THV A;  3AVA A;  2XHB A;  3C95 A;  4CK3 A;  1X1P A;  4C8O A;  3C6U A;  2IC3 A;  5CZ2 A;  2BE2 A;  5J1E A;  2YNF A;  3SUO A;  2Z1H A;  3ITH A;  3OYH A;  4OLB A;  4HCC A;  4W5R A;  3KK3 A;  4WE1 A;  1D8Y A;  1UA1 A;  3C94 A;  4RW6 A;  1NKC A;  4B9N A;  3IRX A;  4DF8 A;  1CZ9 A;  5FRO A;  3ZSZ A;  4CFA A;  1HYV A;  2BDP A;  3PO4 A;  4HCB A;  1S6Q A;  1TKX A;  4CHP A;  1J5O A;  2HHU A;  2KTQ A;  3C6T A;  1EP4 A;  1RT7 A;  2QKK A;  1X9W A;  3S3O A;  1KFD A;  2D0C A;  4KTZ A;  4MFB A;  4DFJ A;  3V4I A;  4KHS A;  3HO1 A;  1HNV A;  2A1R A;  4KO0 A;  4CGH A;  4JS4 A;  2Y1J A;  3SNN A;  1L3S A;  2HHS A;  1HYZ A;  3OYF A;  4FVM A;  3PY8 A;  1N6Q A;  4FW1 A;  1K6Y A;  1CXQ A;  3VN5 A;  4I7F A;  1XHZ A;  4BWJ A;  4M42 A;  1EX4 A;  2D0B A;  2WON A;  3T1A A;  4KAZ A;  4QAG A;  3DMJ A;  3AA3 A;  3P83 D;  3V6D A;  1A5X A;  1WSF A;  4FLV A;  3DLB A;  4Z4I A;  1ITG A;  3OYL A;  2HB5 A;  3NGZ A;  1J53 A;  1VK0 A;  3H08 A;  2FC0 A;  4IG0 A;  4DTP A;  1RBV A;  3M8R A;  2IGI A;  2HHX A;  3QEX A;  4Z0U A;  3AA5 X;  4AHS A;  1ZYQ A;  3VQ9 A;  3DLK A;  5I42 A;  2O4I A;  3MEE A;  2FBT A;  3AA2 A;  4Z4H A;  3QEI A;  4F2R A;  3NBP A;  1NK4 A;  2KZM A;  3DOK A;  4DU3 A;  1JLQ A;  3L2Q A;  4B8A B;  3K5O A;  5SWM A;  3FFI A;  1S1T A;  2YKM A;  3VQ5 A;  4BE1 A;  4DQI A;  3DLE A;  4ZHR A;  3SQ2 A;  1FK9 A;  4Q0B A;  4ICL A;  5CYQ A;  3TAR A;  4K8Z A;  1J54 A;  4OJR A;  2RF2 A;  4CER A;  1BI4 A;  1XI1 A;  1XC9 A;  3NFA A;  3HK2 A;  3WNF A;  4CGI A;  4DF4 A;  1X9M A;  3PV8 A;  2XY5 A;  3K5N A;  4CHN A;  2GBZ A;  4B08 A;  3MEC A;  3NGY A;  3JYT A;  1YTA A;  3KLI A;  3NF9 A;  4IDK A;  1CXU A;  3L2W A;  3LAL A;  4GMJ B;  2FBX A;  1R0A A;  2DFE A;  3EY1 A;  2IS3 A;  2E6M A;  4AH9 A;  4CJE A;  1Q9X A;  4DSI A;  2ZQB A;  2G8U A;  3OYE A;  3QIO A;  2DFF A;  1IKX A;  4FK0 A;  4LH4 A;  3NH1 A;  3WNG A;  1ASV A;  4E19 A;  3AVL A;  4HUG A;  3QLH A;  3UIQ A;  3DLG A;  2Y1I A;  2PY5 A;  3AO4 A;  3AV9 A;  1QSL A;  1FXX A;  3OYI A;  3NGI A;  1SKW A;  3QNN A;  2RN2 A;  5FRM A;  4E7K A;  1ASU A;  5C24 A;  3L2U A;  4C8M A;  2ETJ A;  4O44 A;  1RT2 A;  3DYA A;  4AHC A;  3MAQ A;  3SV3 A;  3SUP A;  4N41 A;  3TAB A;  2QK9 A;  2KFN A;  4CGF A;  4LSL A;  3KIO A;  3T19 A;  5KRT A;  3IS9 A;  3KTQ A;  3OYB A;  3TAG A;  4K8X A;  4CJQ A;  1RBT A;  4MQ3 A;  4J2D A;  3TR8 A;  4AIL C;  1NK0 A;  1HJR A;  1WSI A;  3U3Y A;  3BGR A;  4DTM A;  3DLR A;  4QCL A;  3S3M A;  3OYM A;  1GOC A;  1BGX T;  2P1J A;  3HT3 A;  1B92 A;  3SI6 A;  4FJL A;  3NE6 A;  4PQU A;  4W5N A;  2IDO A;  4DSE A;  4UQG A;  3EZ5 A;  1RT3 A;  3HP9 A;  3V9X A;  3SUQ A;  1EET A;  1C1B A;  3TAF A;  3O4N A;  3HVR A;  4FK4 A;  5KTQ A;  1WN7 A;  3QEV A;  4OPJ A;  4CK2 A;  2NUB A;  1IG9 A;  1W9H A;  2B5J A;  2A1S A;  3ZT3 A;  3RWU A;  4CJF A;  3O3F A;  3F73 A;  1VRU A;  1IKW A;  4C8N A;  2OZM A;  3PUF A;  4FLT A;  4C8K A;  3D45 A;  4KHY A;  5HRN A;  1RDD A;  3MEG A;  4HVJ A;  4E7I A;  3LDS A;  3SV4 A;  4DTN A;  2XO7 A;  2Z1G A;  1NK6 A;  2G8I A;  2P5O A;  3VQP A;  2F8T A;  4FW2 A;  3K5M A;  4DTJ A;  3SQ4 A;  3VQ7 A;  5HRO A;  1QS4 A;  3ISN C;  4CFD A;  4CJ3 A;  4C8L A;  1JLF A;  2E6L A;  3AVM A;  4N56 A;  3AVN A;  1RBS A;  4NCG A;  1T03 A;  1TK8 A;  1TKT A;  1KCF A;  3RRG A;  1VSF A;  1KVB A;  1QE1 A;  1QTM A;  3P1G A;  4CJV A;  3TI0 A;  4DG1 A;  5D3G A;  1LW2 A;  4DTO A;  2E4L A;  1BHL A;  4NYF A;  3KLG A;  4F3O A;  3MXJ A;  3QES A;  1LW0 A;  4FYD A;  4H4M A;  4O0J A;  4FLU A;  4KHN A;  1S1U A;  3ALY A;  3ZSQ A;  4B9U A;  1JKH A;  1RT4 A;  3DI6 A;  1S5J A;  1RTD A;  1U48 A;  3V9W A;  4E7L A;  1DTT A;  1VSK A;  1KSP A;  3IAY A;  1VSE A;  4EP4 A;  1D9D A;  3QEP A;  2DY4 A;  5HBM A;  1GOA A;  4FJ9 A;  1ZBI A;  2OYQ A;  3LAK A;  3VQD A;  3VQQ A;  4Y1D A;  1SUQ A;  1SL1 A;  1L3T A;  2KZZ A;  3ZSX A;  3HJF A;  4M3X A;  2OPS A;  4CJU A;  4CJP A;  4OKE A;  3AA4 A;  2F8S A;  3OVN A;  3QIP A;  4DQQ A;  3AVC A;  1ZBH A;  5SZT A;  4RW7 A;  1TVR A;  4KB0 A;  2HW3 A;  3RRH A;  4DFK A;  4Q5V A;  4FZY A;  4KHQ A;  3AVB A;  3AO1 A;  3NH2 A;  3AVG A;  1JLA A;  3A2F A;  4CHQ A;  1DTQ A;  3VQE A;  4CIF A;  1WSG A;  3AO3 A;  3L3U A;  4O55 A;  4N5S A;  1IKY A;  1RDB A;  5JS2 A;  3VQ6 A;  3LWM A;  4BDZ A;  4PWD A;  1C0T A;  1BIU A;  4OVL A;  3EYZ A;  4CGD A;  4L8R B;  4KI4 A;  3OJS A;  4CHY A;  5I3U A;  3AVK A;  4BE0 A;  1T05 A;  3NCI A;  3U6F A;  1VSL A;  4BDP A;  3VQ8 A;  2B6A A;  1WNS A;  2QXF A;  3QEW A;  3DLH A;  3KKR A;  4FCY A;  4ELU A;  4RG8 A;  4CEC A;  2GUI A;  3KLE A;  4BAC A;  3ULD A;  3RMC A;  1NK9 A;  2PZS A;  4I9Q A;  2VWK A;  1NJY A;  5KI6 A;  1T7P A;  3F9K A;  4CK1 A;  3KD1 E;  4EZ6 A;  1LWF A;  2LSN A;  4ID5 A;  4H8K A;  3OYG A;  2JLE A;  2W42 A;  1LAV A;  2OPR A;  2FBV A;  3NF8 A;  4DFP A;  1TAQ A;  1TL3 A;  2IOC A;  3KK1 A;  1U4B A;  5J2Q A;  3DM2 A;  2Z1J A;  3HPH A;  4IFV A;  3HM9 A;  1SKR A;  1FKP A;  3KK2 A;  2OPP A;  4I9L A;  1JLC A;  1L3U A;  1JXE A;  2YNI A;  1L3V A;  1VRT A;  5KRS A;  1BL3 A;  1VSD A;  1U49 A;  4KTQ A;  1S1X A;  4IBN A;  4RW4 A;  2ATQ A;  1LV5 A;  3SJJ A;  1UWB A;  4CEB A;  3IG1 A;  5JS1 A;  4E7H A;  1KVA A;  2G8F A;  1YTU A;  3V1O A;  3G10 A;  3LPT A;  5T7B A;  1SV5 A;  2R7Y A;  3V81 A;  5J2M A;  3L2R A;  2F96 A;  4CF2 A;  4DSK A;  2PYL A;  2I5J A;  1TK0 A;  3M8P A;  4F2S A;  4M3Y A;  3LZI A;  4NCB A;  1RTI A;  4Z4C A;  1RBU A;  1ZBU A;  3MED A;  4YNQ A;  4DTR A;  3LWL A;  4DLE A;  3TAE A;  4CGG A;  3SUN A;  1B9D A;  1S9E A;  3SPZ A;  4CEQ A;  2HND A;  1VSM A;  3VQA A;  1O1W A;  4CFB A;  1Y97 A;  2YHA A;  4CEZ A;  1QSY A;  2EX3 A;  1F21 A;  1RCH A;  3HST B;  1NKB A;  4W5Q A;  1UOC A;  2HHV A;  4FM2 A;  4M3T A;  3AVI A;  5FDL A;  1NJW A;  1CLQ A;  3LZJ A;  4HUE A;  1BIS A;  4KFB A;  3SYZ A;  1TGO A;  2VG7 A;  4CF8 A;  3K59 A;  1Z25 A;  1RNH A;  4J2B A;  3QNO A;  3B6P A;  3LP3 A;  4Z4E A;  3L8B A;  3KJV A;  4CF1 A;  5HRR A;  4OKJ A;  1BI4 B;  4ELT A;  4NCA A;  3CQ8 A;  4HTU A;  1IH7 A;  1TAU A;  2PYJ A;  1QHT A;  1ZBL A;  2G8V A;  3G0Z A;  3D0P A;  3QER A;  3SQ0 A;  4TSX A;  2ZD1 A;  2VG5 A;  1NKE A;  4B9T A;  4OKK A;  4FLZ A;  3KLF A;  2HHQ A;  3AVH A;  3M8Q A;  4HUF A;  1TKD A;  4ZTF A;  2X78 A;  4F8R A;  1J9A A;  3PX0 A;  5HP1 A;  4CEA A;  4CFC A;  3RMA A;  2P51 A;  1A5V A;  1A5W A;  1S6P A;  4FJI A;  3L2V A;  1JL2 A;  4FJN A;  4CIE A;  4EP5 A;  1T8E A;  1YVU A;  3SCX A;  2BGG A;  4KV8 A;  4B9S A;  3CM5 A;  4FJ5 A;  4CJ5 A;  5KGX A;  4OLA A;  2YNG A;  4M45 A;  4BE2 A;  4E3S A;  2DTU A;  1XWL A;  1HQE A;  2HNY A;  2G8W A;  4DMN A;  3TAP A;  3OYK A;  2XRI A;  3V9S A;  1FKO A;  3K2P A;  3OYN A;  3KLH A;  4M3U A;  1BQM A;  4CEF A;  3OS2 A;  2HHW A;  1XHX A;  4CED A;  3VQ4 A;  1DLO A;  4B9M A;  4CHZ A;  1WSJ A;  2OPQ A;  4CJK A;  5EU7 A;  4Z4G A;  1WSE A;  1KVC A;  1WSH A;  1TKZ A;  4CJ4 A;  4E89 A;  1C6V A;  4ELV A;  2YKN A;  3WNH A;  3ZSO A;  4M3Z A;  3O4Q A;  1CZB A;  4IG3 A;  1HQU A;  4FM0 A;  3PX4 A;  4J2A A;  4AHV A;  3DRR A;  4DQP A;  1BCO A;  1EKE A;  2RKI A;  2FBY A;  4LY7 A;  4IFY A;  2G8H A;  3PO5 A;  5DK5 A;  4DU1 A;  4FJK A;  2G8K A;  4DU4 A;  1C1C A;  3NH0 A;  1KTQ A;  4JLH A;  4M3R A;  1HNI A;  4W5O A;  3OJU A;  4QOZ B;  3HP6 A;  1N5Y A;  3AVF A;  4FLX A;  3V9U A;  3K5L A;  1VSH A;  3PX6 A;  4CJS A;  4OPK A;  1S9G A;  4CJW A;  1G15 A;  3LAM A;  4KRE A;  1HYS A;  1LAW A;  1HMV A;  2XY7 A;  1U47 A;  1ASW A;  4N76 A;  4G1Q A;  4BDY A;  3O3G A;  1I3A A;  3V9Z A;  3HL8 A;  3VA3 A;  4M3W A;  3OYJ A;  1U04 A;  4DTU A;  4KTW A;  4JS5 A;  4KB1 A;  4Y1C A;  1TV6 A;  1RTH A;  2HMI A;  4KPY A;  2AJQ A;  1IKV A;  1ZBF A;  3ZCM A;  4KRF A;  3ASM A;  1X9S A;  3DOL A;  3HYF A;  5KGW A;  5CZ1 A;  1KLN A;  1RBR A;  4CE9 A;  4FM1 A;  1WAF A;  4FJJ A;  3HXM A;  5DMR A;  4FLY A;  2RPI A;  4AHT A;  3OS1 A;  3DRS A;  3ZT4 A;  5K14 A;  3ZT1 A;  4F3T A;  5C25 A;  5FRN A;  4FJM A;  5CY4 A;  1RDA A;  4M41 A;  1MU2 A;  4RW8 A;  4B3O A;  3V1Q A;  3S9H A;  1Q9Y A;  2X6N A;  4PA1 A;  2KW4 A;  3KD5 E;  4FJ7 A;  1BIZ A;  1JL1 A;  3P5J A;  3MXI A;  1EXQ A;  3O3H A;  2Z1I A;  3NF7 A;  2X74 A;  2OA8 A;  5J2N A;  4CGJ A;  3HVT A;  1QQC A;  3I0R A;  3TAQ A;  3RMD A;  1BCM A;  4CES A;  1KFS A;  4JRQ A;  4FJX A;  4O4G A;  1C1A A;  4B9V A;  3E01 A;  3SZ2 A;  3RR8 A;  4DSJ A;  4B8C A;  3CFO A;  2ITG A;  4LH5 A;  4GVM A;  3TAN A;  4KHU A;  1RT1 A;  2P5G A;  3AO2 A;  1VSJ A;  3ZSW A;  4ZTJ A;  4RW9 A;  3JSM A;  2XY6 A;  4OGE A;  3HPO A;  4Z4F A;  2X6S A;  3M8S A;  4FXD A;  4DTX A;  2D5R A;  4F4K A;  1HRH A;  1TL1 A;  2XY8 A;  3VQB A;  3ZT0 A;  1NJX A;  1WAJ A;  4LSN A;  3K57 A;  4DWI A;  4N47 A;  4FK2 A;  1B9F A;  5E41 A;  2JGU A;  2DFH A;  3QO9 A;  4ID1 A;  4FJH A;  3OYD A;  2D0A A;  5HRP A;  1NJZ A;  4KHW A;  4FLW A;  1RT6 A;  2OZS A;  1KLM A;  1C0M A;  3LP2 A;  4OGC A;  3T3F A;  4CHO A;  3OS0 A;  4FJG A;  3SPY A;  4FZZ A;  2HVI A;  2ZE2 A;  3RMB A;  4DS5 A;  2O4G A;  4CJR A;  2EHG A;  5HRS A;  1UA0 A;  4IKF A;  3NDK A;  3CG7 A;  1L5U A;  4AHR A;  1SL0 A;  3AO5 A;  2IAJ A;  3QIN A;  3K58 A;  2QKB A;  1W0H A;  1HPZ A;  1Q8I A;  2KQ2 A;  2HHT A;  4I2P A;  4CJL A;  3CM6 A;  3VA0 A;  4DFM A;  1WLJ A;  1IO2 A;  1NK5 A;  1JLB A;  3I0S A;  4O0I A;  2HNZ A;  1SKS A;  2HVH A;  1U45 A;  2YV0 X;  3LAN A;  3RTV A;  3S3N A;  2YHB A;  3CYM A;  5J2P A;  3SQ1 A;  4PUO A;  4BWM A;  3WNE A;  2VWJ A;  4DQS A;  1NOY A;  1LWC A;  3BDP A;  4J2E A;  4E1N A;  5C42 A;  1I39 A;  4H4O A;  4AHU A;  3I8D A;  1RIL A;  1JLE A;  3HPG A;  4GW6 A;  4CF9 A;  4EZ9 A;  3QET A;  3TAM A;  4PY5 A;  4JRP A;  1TK5 A;  4NYN A;  4DSL A;  3TWH A;  4CEE A;  3ZSV A;  4CJT A;  4B9L A;  1C0U A; 
#chains in the Genus database with same CATH topology
 4DS4 A;  1GLF O;  1TAU A;  1VSI A;  3QFU A;  5J2Q A;  2F9T A;  1BQN A;  4IO9 L;  4CIG A;  5DM6 L;  3KKS A;  3AGR A;  3TTD A;  4YFU A;  2ZGZ A;  2KFZ A;  4YY3 K;  2QW9 A;  1JLG A;  1GOB A;  1NOZ A;  4E7J A;  1OVQ A;  5KPR A;  3IFR A;  4DB3 A;  3JAM O;  4CEO A;  1VQP N;  3E9P A;  5HL7 L;  2GV9 A;  3FZH A;  2ZWH A;  4YOW A;  1X1P A;  2HST A;  2IC3 A;  3H45 C;  4B1X B;  2YHX A;  5J1E A;  5GIP A;  2VGM A;  1D8Y A;  4B3M K;  2UXC K;  5EVZ A;  1J5O A;  4NXN K;  4C23 A;  1RT7 A;  2QKK A;  2E1Z A;  4WFN L;  2D0C A;  3HBT A;  4MFB A;  4DFJ A;  2A1R A;  4JS4 A;  5ADX A;  2W6K A;  3CMA N;  1HUX A;  3THW A;  3VEX A;  2BUP A;  4FVM A;  4DV2 K;  3CPW M;  4JKH A;  4GV9 A;  3VN5 A;  3AA3 A;  3P83 D;  3V6D A;  3DLB A;  3WXI A;  2GEM A;  3OTO K;  1T3V A;  1J53 A;  4K25 A;  1NGI A;  4DTP A;  3ZET A;  4A2B A;  3EE9 A;  5TKY A;  2YJE A;  4PL8 A;  4BRL A;  1EO1 A;  1WUA A;  4A5B A;  4F2R A;  5AQN A;  3L2Q A;  1NGD A;  2YKM A;  3CCE N;  1NGJ A;  4K8Z A;  5JMV A;  2QA4 N;  1QQM A;  4KH6 A;  3K5N A;  3NGY A;  1DGK N;  3KLI A;  2VGN A;  1YF5 L;  2FBX A;  2E6M A;  2ZQB A;  3OYE A;  3QIO A;  4PKH A;  2DFF A;  3O08 A;  1IKX A;  4IZ9 A;  4JD2 A;  4LH4 A;  4E19 A;  2YJF A;  3UIQ A;  2PY5 A;  4JV5 K;  3AO4 A;  3AV9 A;  1VQN N;  2RN2 A;  4DV0 K;  5C24 A;  4BR7 A;  1RT2 A;  4AHC A;  4CGF A;  3KTQ A;  3NMU A;  3CCR N;  4K8X A;  3LM9 A;  1RBT A;  3PSI A;  4WFB L;  3U3Y A;  3BGR A;  4B1V A;  2NRZ A;  4FJL A;  4GV3 A;  2Q31 A;  2QWL A;  1RDW X;  4ISG A;  1RT3 A;  4ILG B;  3QEV A;  5BPM A;  2JWK A;  5AQP A;  4CJF A;  1VRU A;  4C8N A;  3PUF A;  4H5R A;  1Z6R A;  4M7X A;  5HRN A;  4KHY A;  1NK6 A;  2FLO A;  5BN8 A;  1TYQ B;  2F8T A;  3A8Y A;  3K5M A;  3ISN C;  4CJ3 A;  4YHH K;  1ESV A;  1RBS A;  3RRG A;  3CC4 N;  1QE1 A;  3P1G A;  1M90 O;  3VER A;  2QM1 A;  4H0X B;  3THX B;  4BGA A;  1BHL A;  3KLG A;  4FO0 A;  1YIJ N;  2J4R A;  4B9Q A;  1JKH A;  3DI6 A;  2NZT A;  3CQY A;  2O8D A;  4EAH D;  3I56 N;  3V9W A;  4U67 L;  1DTT A;  1KSP A;  1D9D A;  3MN6 A;  4H5W A;  5GIO A;  1G99 A;  3LAK A;  3VQD A;  3C7N B;  3ENH A;  4O8K A;  3CCV N;  3CI5 A;  1JCG A;  4DR6 K;  1QZ5 A;  5SZT A;  2HW3 A;  3MWP A;  1OH7 A;  2FF6 A;  1I94 K;  2IVO A;  1DTQ A;  4IOA L;  1WSG A;  3VQ6 A;  1Q86 O;  2CGJ A;  3EYZ A;  3CJ1 A;  3H6E A;  3OJS A;  4H0V B;  4CHY A;  3AVK A;  4QS8 A;  3U6F A;  5C0Y A;  3QEW A;  2KZM A;  3HRG A;  4CEC A;  3KLE A;  4I9Q A;  1WOQ A;  3O9S A;  4C1N K;  4CK1 A;  4H0O A;  5ELZ A;  4GY2 B;  4DFP A;  5AQU A;  1U4B A;  1SQK A;  2CGK A;  3OBY A;  4IFV A;  2O8C A;  4RWT A;  1L3U A;  1U2V A;  4DR1 K;  2QWQ A;  1VRT A;  3J8A A;  3O9R A;  2Q97 A;  3O9T A;  4IBN A;  3SJJ A;  3ZEU A;  4E7H A;  4DV7 K;  1KVA A;  2E2P A;  1YTU A;  3V1O A;  3LPT A;  1SV5 A;  4FWQ A;  3L6Q A;  2P9P A;  3THW B;  5GAG P;  2I5J A;  4M3Y A;  4BRF A;  4NCB A;  5JLH A;  4YNQ A;  2WUS A;  4QS9 A;  4CGG A;  3SPZ A;  1QZ6 A;  2HND A;  2IIR A;  4IOX A;  3SAG A;  1RCH A;  2AP1 A;  3ZX0 A;  4LF8 K;  4FM2 A;  1CLQ A;  3CC2 N;  1TGO A;  4ILH A;  3QNO A;  4IFE A;  3L8B A;  3VF4 A;  4AF1 A;  1FJG K;  1QHT A;  3H1Q A;  2EWS A;  3CCS N;  3SQ0 A;  4TSX A;  2HMP A;  4OKK A;  4FWK A;  4FLZ A;  3WXL A;  1DKG D;  1TUU A;  4F8R A;  3PX0 A;  5HP1 A;  5M1N A;  1YI2 N;  1RFQ A;  3E9L A;  1T8E A;  2A40 A;  4A61 A;  4KV8 A;  5AQT A;  5KGX A;  4OLA A;  1XWL A;  4DR5 K;  1VQ5 N;  4MDB A;  3A5O C;  1BO5 O;  1BQM A;  2HHW A;  3OS2 A;  3UB5 A;  3FLC O;  4CED A;  4BRI A;  3QDK A;  3VQ4 A;  2V52 B;  4CZE A;  1WSE A;  4CJ4 A;  4M3Z A;  2VQE K;  4JI7 K;  2FF3 B;  1HQU A;  3I8B A;  4FM0 A;  2A5X A;  3DRR A;  4DQP A;  3GDQ A;  3ZEU B;  1T44 A;  4DU1 A;  3D6R A;  4FL9 A;  1KTQ A;  4JLH A;  2E2Q A;  4M7Y A;  2ASM A;  4XH5 A;  3MCP A;  4CJS A;  4B1U B;  3PX6 A;  2GUP A;  1HYS A;  3V9Z A;  4ISE A;  1K73 O;  4DTU A;  4KB1 A;  4Y1C A;  1TV6 A;  5JLF A;  2HMI A;  2AJQ A;  4WQ5 A;  4KRF A;  5DM7 L;  4AM6 A;  5KGW A;  1YUW A;  4KH5 A;  3VMF B;  2VWB A;  4JK7 A;  5AQO A;  2RPI A;  4K0K K;  1VQ7 N;  4BR4 A;  3DRS A;  3QB0 A;  4BRD A;  5CY4 A;  3AAQ A;  3Q7B A;  3THX A;  1Q9Y A;  2DPN A;  2KW4 A;  1XQS C;  4YDU C;  1NJI O;  3SMP A;  3J7A P;  3MXI A;  1EXQ A;  2O8C B;  3NF7 A;  3FFK B;  4Z94 A;  4UY8 O;  1QQC A;  3TAQ A;  2W6L A;  1KFS A;  4JRQ A;  2PBD A;  4FPA A;  2ASP A;  5LJV A;  1J6Z A;  4GVM A;  3TAN A;  4CZK A;  2P5G A;  3AO2 A;  4OX9 K;  1ZC6 A;  5F0X A;  5FPM A;  3HPO A;  3T7Z A;  3LDN A;  2D5R A;  4F4K A;  1TL1 A;  2XY8 A;  4FK2 A;  1GLJ O;  1WAJ A;  3K57 A;  5FLX O;  2JGU A;  1QVG M;  2UYT A;  1VQ6 N;  4FJH A;  3OYD A;  1RGI A;  2D0A A;  1NJZ A;  4FLW A;  1C0M A;  1KLM A;  3LP2 A;  4OGC A;  4FJG A;  4CHO A;  3OS0 A;  3SPY A;  4DR2 K;  4FZZ A;  2HVI A;  2ZE2 A;  4DS5 A;  5HRS A;  4X66 K;  1UA0 A;  4IKF A;  4IEE A;  3NDK A;  3CG7 A;  1L5U A;  3AO5 A;  3H46 O;  3HOT A;  3CET A;  3CM6 A;  5C15 A;  1NK5 A;  3CPE A;  1JLB A;  1V4S A;  2HNZ A;  5F1X A;  2HVH A;  3RTV A;  4JKE A;  2WTU A;  1LWC A;  1BWF O;  4H4O A;  3P39 A;  4AHU A;  3I8D A;  5ADX H;  4EZ9 A;  3QET A;  4PY5 A;  3SJH A;  5TKW A;  3ZSV A;  1C0U A;  2E88 A;  2Q3S A;  3ZSR A;  1KRP A;  3CFP A;  3CFR A;  3IMX A;  3SBT A;  1RDC A;  3L3V A;  4FSV A;  4O5F A;  4JEP A;  1JXB A;  1VQL N;  4MLE A;  3ZSY A;  1S1V A;  4XIU A;  4DQ8 A;  2BTF A;  4DSF A;  5M1F A;  1LWE A;  4WCE L;  1SL2 A;  3OY9 A;  3NHG A;  3B6O A;  3CCL N;  5M1P A;  4JN4 A;  4DTS A;  3AVJ A;  3MXM A;  2P9K B;  3THV A;  3VEW A;  4WFA L;  3AVA A;  3EZW A;  4C8O A;  4MLH A;  1HKB A;  2P9K A;  5CZ2 A;  1NGA A;  2BE2 A;  2P9U B;  1KD1 O;  4HCC A;  4W5R A;  5B8H A;  4JI6 K;  1CZA N;  4B9N A;  5FRO A;  2ZJR L;  1HYV A;  2E20 A;  1TKX A;  4X65 K;  2HHU A;  2A41 A;  1MWK A;  3DXM A;  1EP4 A;  3P38 A;  1GLL O;  1X9W A;  4JI2 K;  4JKC A;  1KFD A;  3EKU A;  1IV0 A;  3OYF A;  1NLV A;  1YJ9 N;  3PY8 A;  1XMO K;  4FW1 A;  1KXP A;  4BWJ A;  3DMJ A;  4FLV A;  4OO1 J;  4Z4I A;  1K8K A;  2HB5 A;  4ISF A;  2FC0 A;  5AQQ A;  3G6E N;  4BR9 A;  1RDU A;  3QEX A;  1ZYQ A;  3DLK A;  5I42 A;  3MEE A;  4KH4 A;  1NK4 A;  3DOK A;  1JLQ A;  4X64 K;  1M1K O;  4IEI A;  1S1T A;  4DQI A;  1VQ9 N;  3DLE A;  3SQ2 A;  4Q0B A;  4CER A;  1XC9 A;  3HK2 A;  3PLA A;  1X9M A;  1HJO A;  4CHN A;  4BRP A;  2O8B A;  3MEC A;  4MDA A;  2YI1 A;  1YTA A;  4FWS A;  3NF9 A;  3ULE B;  1CXU A;  2UXD K;  4GMJ B;  5BRF A;  4DSI A;  5C2D A;  4FK0 A;  3NVK A;  1NGC A;  3NH1 A;  3WNG A;  3AVL A;  3VEO A;  3DLG A;  3KVG A;  4BRM A;  1FXX A;  3OYI A;  3NGI A;  3MAQ A;  4JI8 K;  3THY A;  3SUP A;  4N41 A;  3TAB A;  2KFN A;  5KRT A;  4LSL A;  3T19 A;  1GLC G;  3TPQ A;  4LF5 K;  4AIL C;  2V7Y A;  1HJR A;  1WSI A;  2HBJ A;  3DLR A;  1ATS A;  4I6M B;  2P1J A;  4W5N A;  1NNE A;  3EZ5 A;  1C1B A;  3TAF A;  3VEV A;  1WN7 A;  2NUB A;  4BGB A;  3LL3 A;  3VEN A;  2GX9 A;  3ZT3 A;  3RWU A;  3O3F A;  2ZM6 K;  3C0B A;  3MEG A;  4HVJ A;  4E7I A;  3LDS A;  3SV4 A;  2P5O A;  2AA4 A;  4FW2 A;  3SQ4 A;  4C8L A;  4CFD A;  3AVM A;  4JKF A;  4X62 K;  1VQK N;  4NCG A;  1T03 A;  1KCF A;  3G4S N;  1VSF A;  1KVB A;  4WQ4 A;  5D3G A;  2E4L A;  4NYF A;  4F3O A;  4BRH A;  3C65 A;  4FYD A;  4O0J A;  4KHN A;  1NG9 A;  1S1U A;  5AQZ A;  2QWP A;  3MX5 A;  1U48 A;  1NMN A;  2O8B B;  4CZL A;  1HKC A;  1VSE A;  3CJ9 A;  5AR0 A;  1IJJ A;  5HBM A;  4IJA A;  4Y1D A;  3VOV A;  3SBG A;  2HF3 A;  5BPL A;  1SZ2 A;  1SUQ A;  1SL1 A;  1Q81 O;  1L3T A;  1VQ8 N;  2KZZ A;  4CJU A;  3SAH A;  2F8S A;  3OVN A;  2P9I B;  4KB0 A;  4CZM A;  4DFK A;  5AQJ A;  4FZY A;  4KHQ A;  5GAE P;  5AZJ A;  3AO1 A;  3NH2 A;  3AVG A;  2UUB K;  4O55 A;  5CHI A;  5JS2 A;  1DT9 A;  2D4W A;  4PWD A;  3ZX2 A;  1JJ2 M;  4DHY A;  2QWN A;  4KI4 A;  4DV1 K;  4LF7 K;  5I3U A;  4BE0 A;  1C0G A;  4BDP A;  2B6A A;  1WNS A;  2QXF A;  5BRE A;  3KKR A;  5AJ3 K;  4ELU A;  5FPE A;  2PZS A;  4CZJ A;  1NJY A;  4GVE A;  1YAG A;  3CXC M;  4ID5 A;  1FW6 A;  4FWO A;  1MDU B;  3MX2 A;  1GLE G;  2A42 A;  3HPH A;  1SKR A;  2YNI A;  5E26 A;  1VSD A;  1S1X A;  2IVP A;  1LV5 A;  3DXK A;  1ATN A;  4CEB A;  2P9I A;  1D4X A;  2F96 A;  4CF2 A;  4HTL A;  3LZI A;  4PL7 A;  2YHW A;  1RBU A;  1ZBU A;  3LWL A;  4DLE A;  3TAE A;  1NM1 A;  4CEQ A;  3UKR A;  3VEZ A;  1Y97 A;  4CEZ A;  1ILY A;  1QSY A;  1NWK A;  1F21 A;  2EX3 A;  3DWL A;  4AQY K;  2HHV A;  4LFA K;  1NJW A;  4JKA A;  1E4F T;  3J81 O;  4HUE A;  4KFB A;  3SYZ A;  2OAN A;  1GLD G;  4EFH A;  4Z4E A;  3B6P A;  1IBL K;  2ZJP L;  4ELT A;  4GKJ K;  2I7N A;  4HTU A;  1IH7 A;  3QIC A;  3P31 A;  3D0P A;  3QER A;  2VG5 A;  4L3Q A;  1SAZ A;  4B9T A;  1LCU A;  4CJ7 A;  4YOU A;  4R79 A;  3KLF A;  2HHQ A;  3AVH A;  3M8Q A;  5AQK A;  2ZJQ L;  3O80 A;  4ZTF A;  2X78 A;  3R1X A;  3T1H K;  4CFC A;  3RMA A;  3R3L A;  1W2B M;  4CD1 A;  1YVU A;  1QHA A;  4B9S A;  2O8E B;  2YNG A;  4BRN A;  4E3S A;  3F2K A;  3VF6 A;  3WT0 A;  4BC4 A;  3OYK A;  3V9S A;  4BVP A;  1FKO A;  3K2P A;  3OYN A;  4CEF A;  1XHX A;  2WBN A;  1WBB A;  1DLO A;  4IDH A;  4B9M A;  5EU7 A;  5CE3 A;  1TKZ A;  4E89 A;  4WQ4 C;  1C6V A;  4ELV A;  2YKN A;  3WNH A;  3CCU N;  3H3N O;  4B3R K;  4AHV A;  4H0P A;  1EKE A;  3D2E B;  4XH1 A;  4LY7 A;  3PO5 A;  2G8K A;  3J7Z O;  2E2O A;  4JAX A;  4J8F A;  3VTI A;  5KPZ A;  1HNI A;  3M1F A;  3KWI A;  4QOZ B;  3HP6 A;  2O8F A;  3V9U A;  4KRE A;  4CJW A;  4CW7 B;  2YX6 A;  4YOY A;  1HMV A;  2XY7 A;  1U47 A;  3TSQ A;  4BDY A;  4JI5 K;  1I3A A;  2FSK A;  3OYJ A;  1N32 K;  4JS5 A;  4PHT X;  3IUC A;  1X9J A;  4KPY A;  1NGF A;  4FWN A;  4B3S K;  5CZ1 A;  4B1W B;  4CE9 A;  2Q2R A;  3CQX A;  5DMR A;  3VES A;  4FLY A;  5AQF A;  4JI0 K;  4MO5 A;  4BR2 A;  4JK9 A;  5K14 A;  1BA0 A;  3J80 O;  5FRN A;  4FJM A;  1RDA A;  3H1V X;  3HOS A;  4B3O A;  2NRV A;  3S9H A;  3N4Q A;  4JI4 K;  1P8Z A;  4B3T K;  3Q7C A;  3WXM B;  4BRC A;  4CGJ A;  3ZYY X;  2O8E A;  1BA1 A;  5EY4 A;  2NNW A;  2IVN A;  3U8X A;  4A2A A;  3PIO L;  3SMS A;  1EWQ A;  4B8C A;  4LH5 A;  1S3X A;  4FOE A;  1RT1 A;  3EO3 A;  4GNI A;  5C2F A;  2XY6 A;  4OGE A;  2QWO A;  4FXD A;  2H3G X;  3G71 N;  3TTC A;  4ID1 A;  5M1K A;  2E8A A;  3MDQ A;  3DJC A;  4I6M A;  2O4G A;  4RTF D;  4H5N A;  2QEX N;  4FWR A;  4XEI A;  3QFP A;  3QIN A;  1JCE A;  5AQG A;  3K58 A;  1HPZ A;  2HHT A;  4LF4 K;  5GIN A;  1TYQ A;  4DFM A;  2HF4 A;  3I0S A;  3JXU A;  1U45 A;  2YV0 X;  3UKU A;  2YHB A;  3WNE A;  3ZET B;  3BDP A;  5KQ8 A;  5C42 A;  1I39 A;  4GW6 A;  4CF9 A;  5AQS A;  3TAM A;  4JRP A;  4NYN A;  3AY9 A;  1N36 K;  4B9L A;  4FWL A;  4LF6 K;  2NRR A;  3LDQ A;  3LPU A;  1BG3 A;  3NF6 A;  3O1B A;  3MK6 A;  5CYM A;  1S1W A;  3LP0 A;  4DR4 K;  4BRK A;  1REV A;  3DRP A;  3EE8 A;  4HHT A;  3ZT2 A;  1NK7 A;  2WOM A;  4XH4 A;  4E1M A;  2YCH A;  1HKG A;  5M1Q A;  3V1R A;  4R5P A;  3GBT A;  4NB4 A;  2QWR A;  3KHY A;  1D9F A;  3VQC A;  4YDU A;  3LP1 A;  4LD0 A;  4CBW A;  1EWR A;  3I33 A;  2XHB A;  4CK3 A;  4K43 A;  3C6U A;  3SUO A;  2YNF A;  3ITH A;  1Y64 A;  3O9Q A;  3OYH A;  2RHK A;  1UA1 A;  4RW6 A;  1NKC A;  3KWG A;  3M5R A;  2BDP A;  4CFA A;  3PO4 A;  1BDG A;  1S6Q A;  4CHP A;  4HCB A;  3WEE B;  3C6T A;  4BC5 A;  1WB9 A;  1GLA G;  4GV6 A;  4KHS A;  3V4I A;  1ZXO A;  4KO0 A;  2Y1J A;  2P9N A;  3K0S A;  1K6Y A;  1CXQ A;  1XHZ A;  4M42 A;  2NRX A;  3T1A A;  4EIA A;  4GKK K;  1A5X A;  3ID8 A;  2O8F B;  1HPM A;  3OYL A;  1VK0 A;  5AQX A;  4H0Y B;  4IG0 A;  3M8R A;  2IGI A;  2HHX A;  3AA5 X;  4AHS A;  3VQ9 A;  2FBT A;  3AA2 A;  4Z4H A;  3QEI A;  4BE1 A;  2P9P B;  2UUA K;  1FK9 A;  5CYQ A;  1J54 A;  3R6M A;  3SAF A;  1OH8 A;  4A62 A;  2XY5 A;  1XC3 A;  4B08 A;  2CH5 A;  3L2W A;  4IDK A;  4BR5 A;  3LAL A;  4EHU A;  3O9U A;  1R0A A;  2DFE A;  3EY1 A;  4AH9 A;  4BRA A;  4CJE A;  1Q9X A;  2G8U A;  1ATR A;  3HI0 A;  1QSL A;  1SKW A;  3QNN A;  1YIT N;  4C8M A;  3SV3 A;  4CZF A;  3KIO A;  3D7E O;  3IS9 A;  5AQW A;  4H5V A;  4MQ3 A;  4J2D A;  2HBL A;  1SS6 A;  3OBW A;  1N8R O;  4DTM A;  3FGU A;  3S3M A;  1GOC A;  2D0P A;  1B92 A;  4DSE A;  3B8A X;  5GAD P;  3HP9 A;  3V9X A;  3SUQ A;  1EET A;  3O4N A;  5KTQ A;  4O8U A;  2PAV A;  1IG9 A;  1W9H A;  2B5J A;  3CD6 N;  1KQS M;  1YHQ N;  3D45 A;  3P4I A;  1RDD A;  1LOT B;  2XO7 A;  4DV5 K;  2QXL A;  2G8I A;  3VQP A;  3HTV A;  4DTJ A;  5HRO A;  3VQ7 A;  3FE1 A;  2E6L A;  4N56 A;  3AVN A;  4CZI A;  5BR8 K;  1IG8 A;  1QTM A;  4CJV A;  1HX1 A;  2FXU A;  1LW2 A;  4DTO A;  3BY5 A;  3GOI A;  3MXJ A;  3QES A;  3ZSQ A;  1RT4 A;  1S5J A;  4E7L A;  4JK8 A;  1VSK A;  4BQZ A;  4EP4 A;  4JNE A;  2CH6 A;  1ZBI A;  1GOA A;  3VQQ A;  1OVY A;  4JKG A;  3HJF A;  2OPS A;  4OKE A;  4B1Z A;  3D2F B;  3AVC A;  1ZBH A;  4RW7 A;  1QQN A;  3JS6 A;  3RRH A;  3A0I X;  4Q5V A;  3AVB A;  4CBU A;  1JLA A;  4CHQ A;  4CIF A;  4BG9 A;  3AO3 A;  3L3U A;  1IKY A;  3IDH A;  3LWM A;  4BDZ A;  1XNQ K;  2FSJ A;  3BZC A;  1N33 K;  3G25 A;  1NGH A;  2GUI A;  3ULD A;  4F9O A;  4NLB A;  5KI6 A;  1T7P A;  3F9K A;  3KD1 E;  4EZ6 A;  2Q36 A;  1LWF A;  4H8K A;  3OYG A;  2W42 A;  1LAV A;  2FBV A;  4CBX A;  2IOC A;  3KK1 A;  4DV6 K;  1U2V B;  2Z1J A;  3HM9 A;  2OPP A;  5IWA K;  5AQI A;  1JXE A;  5KRS A;  1BL3 A;  1U49 A;  3O1W A;  2ATQ A;  3FZK A;  5AZI A;  4DV3 K;  5JS1 A;  3IG1 A;  2G8F A;  3V81 A;  2ASO A;  3RSE A;  3L2R A;  5LL6 Z;  5J2M A;  1H1V A;  4DSK A;  1DEJ A;  2PYL A;  2F7T A;  4Z4C A;  3MED A;  4DTR A;  3LM2 A;  3K9K A;  1S9E A;  5EXW A;  3VQA A;  4FVU A;  4CFB A;  4CZH A;  2YHA A;  3CC7 N;  1UOC A;  1O13 A;  4M3T A;  5FDL A;  3LZJ A;  1BIS A;  4AM7 A;  3GE1 A;  4CF8 A;  3K59 A;  1Z25 A;  1RNH A;  4J2B A;  3LP3 A;  4BQL A;  2JWL A;  4CF1 A;  5HRR A;  1BI4 B;  2I7P A;  3WXJ A;  4NCA A;  4JKD A;  2KHO A;  2PYJ A;  1ZBL A;  3GL1 A;  3FR0 A;  5AFU H;  1TKD A;  3QML A;  4IWV A;  3U9D A;  1J9A A;  3OA9 A;  2V51 B;  2P51 A;  3VGK A;  1S6P A;  2GWJ A;  2CGL A;  4FJN A;  4EP5 A;  5M1O A;  3SCX A;  2BGG A;  2Q0U A;  4FJ5 A;  1MA9 B;  4M45 A;  1HQE A;  2HNY A;  3HM8 A;  3D2F A;  3K9J A;  2OTJ N;  3KLH A;  4M3U A;  3EKS A;  2HBK A;  1XUP O;  2QWM A;  2ZF5 O;  4FOI A;  4CHZ A;  2OPQ A;  4Z4G A;  3ZSO A;  1HNZ K;  3O4Q A;  3UKU B;  4J2A A;  3AAR A;  3MWT A;  2HOE A;  2RKI A;  4IFY A;  2G8H A;  5JVH L;  3ATV A;  4JYA K;  4DU4 A;  4LF9 K;  3U9Z A;  3DLL L;  4M3R A;  4W5O A;  3CCM N;  3OJU A;  1Q82 O;  4BRE A;  3AVF A;  3HSC A;  3K5L A;  4OPK A;  1G15 A;  1LAW A;  1NBW A;  4N76 A;  3O3G A;  1U04 A;  4KTW A;  3OHR A;  1XNR K;  4KHP K;  3R8E A;  3O5B A;  3ZCM A;  1ZBF A;  3R9P A;  3ASM A;  3HYF A;  1KLN A;  1Z05 A;  3CCJ N;  4FM1 A;  1WAF A;  4FJJ A;  3HXM A;  1YVN A;  3ZT4 A;  3ZT1 A;  5C25 A;  3HZ6 A;  4M41 A;  1MU2 A;  4RW8 A;  3KD5 E;  2X6N A;  4PA1 A;  4FJ7 A;  1BIZ A;  4ILJ A;  3VGM A;  1T6C A;  5BN9 A;  2Z1I A;  4BR0 A;  3HVT A;  4CVN E;  3RMD A;  4CES A;  5BPN A;  3BP8 A;  1BOT O;  5MLC Q;  1YXQ A;  4B9V A;  3E01 A;  4JKG B;  3ZSW A;  3SLC A;  3JSM A;  3CJC A;  3L4Q A;  2VCP A;  2GTD A;  4Z4F A;  2X6S A;  3M8S A;  2Q0R A;  1BU6 O;  3T69 A;  4DTX A;  2P9U A;  3ZT0 A;  1NJX A;  4V19 S;  4N47 A;  1B9F A;  4BRO A;  2DFH A;  1EQY A;  3QO9 A;  4JD2 B;  1RT6 A;  2GWK A;  3F5T A;  3QBX A;  2OZS A;  3VF2 A;  1VQO N;  1KAX A;  2PFU A;  2EHG A;  1V4T A;  5IT9 O;  4H5T A;  4LC9 B;  2QKB A;  1Q8I A;  4I2P A;  4JI1 K;  4CZG A;  3VA0 A;  4JHD B;  1WLJ A;  1IO2 A;  4O0I A;  4YOV A;  1SKS A;  3SQ1 A;  4PUO A;  3NVM A;  2VWJ A;  4DQS A;  4J2E A;  1NOY A;  3EL2 A;  3DXM B;  1OKJ A;  4E1N A;  1JLE A;  3HPG A;  4KBO A;  1TK5 A;  3CJ7 A;  5E84 A;  4DSL A;  3TWH A;  1JCF A;  2E5L K;  2P9S A;  3O8M A;  3U3G A;  4O5B A;  2VG6 A;  4KI6 A;  1UAX A;  3OYC A;  2BAN A;  2YNH A;  4FPB A;  4DLG A;  4E0D A;  4KKO A;  1NK8 A;  1D5A A;  4I2Q A;  1YT3 A;  1YJN N;  4K42 A;  3OYA A;  1P90 A;  5AQH A;  4FJ8 A;  3RR7 A;  1RT5 A;  5BRH A;  4W5T A;  5HLF A;  3NAE A;  4FZX C;  3FZF A;  1OH5 A;  4CCH A;  3BEX A;  3F9M A;  5C10 A;  3E1Y A;  5EOY A;  2P9L A;  4CF0 A;  1RTJ A;  3TSU A;  1QSS A;  2UXB K;  1Z26 A;  2B4J A;  4DQR A;  1E4G T;  3C95 A;  5AQL A;  2Z1H A;  4OLB A;  3KK3 A;  4WE1 A;  3C94 A;  2W41 A;  5AQM A;  3N4P A;  3IRX A;  3KZB A;  1CZ9 A;  3ZSZ A;  4DF8 A;  2KTQ A;  5LY3 A;  2E2N A;  1IBK K;  3W3D A;  3S3O A;  4LFB K;  3HO1 A;  5I9E B;  4KTZ A;  5KQD A;  1HNV A;  1L3S A;  4CGH A;  3SNN A;  2HHS A;  5AZI B;  2OTL N;  1HYZ A;  1N6Q A;  3S41 A;  1GLB G;  4I7F A;  4Y0W A;  1K8A O;  1EX4 A;  2D0B A;  2WON A;  2E1Y A;  3CJB A;  4KAZ A;  4QAG A;  2WFB A;  1WSF A;  1ITG A;  4WQ5 C;  3NGZ A;  4E1J A;  2NRT A;  2W40 A;  3H08 A;  2D1K A;  3A5M C;  1RBV A;  3VTH A;  4Z0U A;  2O4I A;  3NBP A;  4DU3 A;  2VQF K;  1NGE A;  1X3M A;  3K5O A;  3SK3 A;  4K41 A;  4B8A B;  5SWM A;  3FFI A;  4DUZ K;  2FSN A;  3VQ5 A;  1NGB A;  5LJW A;  4ZHR A;  3WXK A;  4ICL A;  3TAR A;  3MMV A;  4RCH A;  4OJR A;  2RF2 A;  1BI4 A;  3IKM A;  1XI1 A;  3NFA A;  3WNF A;  4CGI A;  4DUY K;  4DF4 A;  3PV8 A;  2GBZ A;  3JYT A;  4JI3 K;  3PIP L;  2IS3 A;  3H3O B;  3ENO A;  2HHH K;  4PKG A;  5LMU K;  4BY9 C;  1ASV A;  4HUG A;  3QLH A;  2Y1I A;  3VET A;  4CI6 A;  3KK7 A;  3ID6 A;  2P9N B;  4JKB A;  5FRM A;  4E7K A;  1ASU A;  3L2U A;  1HLU A;  2ETJ A;  4O44 A;  4LFC K;  3DYA A;  5AQY A;  4CD3 A;  2QK9 A;  3OYB A;  3TAG A;  5AQV A;  4CJQ A;  3CJA A;  3WQU A;  3TR8 A;  1NK0 A;  4QCL A;  3OYM A;  1BGX T;  4B1Y B;  3HT3 A;  1KAZ A;  3SI6 A;  2NRW A;  3NE6 A;  4PQU A;  2IDO A;  5CR4 A;  4UQG A;  4U7B A;  4FK4 A;  3BF1 A;  3HVR A;  3VGL A;  2P9L B;  4OPJ A;  3FZM A;  4CK2 A;  1QVF M;  2A1S A;  3F73 A;  3LDO A;  1IKW A;  2OZM A;  4FLT A;  4C8K A;  2OCE A;  3MN7 A;  4DTN A;  2KLA A;  2Z1G A;  4JHD A;  4G9Z A;  4DR7 K;  1QS4 A;  3ENB A;  4FWM A;  1JLF A;  1TK8 A;  2UU9 K;  1TKT A;  1BUP A;  3M3Z A;  3TI0 A;  1Q18 A;  5FPD A;  4DG1 A;  4PKI A;  1LW0 A;  4H4M A;  1VAZ A;  4FLU A;  1T6D A;  3ALY A;  4B9U A;  1RTD A;  3CER A;  4MO4 A;  3IAY A;  3M6G A;  3TU5 A;  4A57 A;  5BRD A;  1NGG A;  3QEP A;  2DY4 A;  4H0T B;  4FJ9 A;  2OYQ A;  5C12 A;  4C1N I;  1N34 K;  2WC9 A;  3ZSX A;  4M3X A;  4CJP A;  3DXK B;  3FZL A;  3AA4 A;  3QIP A;  1VHX A;  4DQQ A;  5AFU A;  1TVR A;  3U4L A;  2QI2 A;  1J5E K;  1K8K B;  2P9S B;  4BVO A;  5H1S Q;  3CF5 L;  3ATU A;  4OPH A;  2NRH A;  3A2F A;  3VQE A;  1KC8 O;  4NXM K;  3WUH A;  3DAW A;  4N5S A;  1RDB A;  1C0T A;  1BIU A;  4OVL A;  3UKR B;  4CGD A;  4L8R B;  4M63 C;  1T05 A;  3C7N A;  3NCI A;  1VSL A;  3A5L C;  3VQ8 A;  1S72 N;  3DLH A;  4FCY A;  4RG8 A;  1NK9 A;  2F9W A;  4BAC A;  3RMC A;  1W7A A;  3MCA B;  3L4I A;  3WQT A;  4DKW A;  2VWK A;  5LMN K;  4IO8 A;  3W0L A;  1QQO A;  3RSE B;  2LSN A;  2JLE A;  3UE5 A;  2OPR A;  3BUZ B;  3NF8 A;  1TAQ A;  1TL3 A;  3C6A A;  4FWP A;  3BZK A;  3DM2 A;  5EX5 A;  3O6W A;  1FKP A;  3KK2 A;  4I9L A;  1JLC A;  1L3V A;  2HBM A;  1TUY A;  2QTD A;  4RW4 A;  4KTQ A;  2VYP A;  1UWB A;  3MN9 A;  1OH6 A;  4DCH A;  3EEQ A;  3G10 A;  5T7B A;  2R7Y A;  2ITM A;  4IXC A;  4F2S A;  1TK0 A;  3M8P A;  5FPN A;  1RTI A;  1E3M A;  3SUN A;  1B9D A;  1K9M O;  4YOX A;  1VSM A;  3ZLJ A;  1O1W A;  4YOR A;  4YOT A;  1WBD A;  1U6Z A;  3HST B;  4A5A A;  1NKB A;  4W5Q A;  3AVI A;  3CIP A;  1W97 L;  4BC2 A;  2V7Z A;  2VG7 A;  4DV4 K;  3BF3 A;  3GG4 A;  5JIC A;  3KJV A;  4OKJ A;  4IJN A;  2UUC K;  3CQ8 A;  3A5N C;  2G8V A;  3G0Z A;  2ZD1 A;  2KKZ A;  1NKE A;  4HUF A;  2A3Z A;  3E9O A;  1X3N A;  4CEA A;  3PSF A;  1A5V A;  1A5W A;  4FJI A;  3L2V A;  1JL2 A;  4CIE A;  1Q7Y O;  3LDL A;  1NU0 A;  3CM5 A;  3L0Q A;  4CJ5 A;  2F4V K;  1S22 A;  3TSP A;  4BE2 A;  2DTU A;  2G8W A;  3AGK A;  4DMN A;  3TAP A;  2XRI A;  5HOO A;  2ZGY A;  1HR0 K;  1WSJ A;  3O4W A;  4CJK A;  1WSH A;  1KVC A;  3C6H A;  5BR9 A;  5F2R A;  1CZB A;  4IG3 A;  4NLC A;  3D2E A;  3PX4 A;  1BCO A;  4WF9 L;  5A2Q O;  2FBY A;  1XMQ K;  5DK5 A;  4FJK A;  2GEL A;  1C1C A;  2YHY A;  3NH0 A;  1YJW N;  5AZJ B;  1R59 O;  4A59 A;  1N5Y A;  1IBM K;  4FLX A;  1VSH A;  1S9G A;  3LAM A;  5KPT A;  3AAP A;  5AQR A;  3J7Y P;  1ASW A;  4G1Q A;  3VA3 A;  2A6A A;  3HL8 A;  1VQ4 N;  4M3W A;  3EN9 A;  3LDP A;  1RTH A;  1IKV A;  1X9S A;  3DOL A;  3MN5 A;  3QBW A;  1RBR A;  4AHT A;  4DR3 K;  3OS1 A;  3OW2 M;  4F3T A;  4H03 B;  3CCQ N;  5JVG L;  3V1Q A;  4QS7 A;  2O8D B;  1JL1 A;  3P5J A;  5GAH P;  3CME N;  4WYB A;  3O3H A;  3ULE A;  3T1Y K;  4EHT A;  2OA8 A;  2X74 A;  1ZBS A;  5J2N A;  3ZX3 A;  3I0R A;  1MWM A;  1BCM A;  4BC3 A;  4FJX A;  3VEY A;  4O4G A;  3VPZ A;  1NMD A;  1HNX K;  1C1A A;  4DSJ A;  3SZ2 A;  3RR8 A;  3CFO A;  2ITG A;  4KHU A;  1C0F A;  4IOC L;  1VSJ A;  4ZTJ A;  4RW9 A;  1HRH A;  3I55 N;  3VQB A;  3WEE A;  4LSN A;  4DWI A;  5E41 A;  2NLX A;  4NO7 A;  3CHW A;  5HRP A;  4KHW A;  3T3F A;  3E66 A;  3RMB A;  4CJR A;  4BRQ A;  4AHR A;  1SL0 A;  3THY B;  2IAJ A;  4BRG A;  1W0H A;  2KQ2 A;  4CJL A;  2BH1 A;  2D0O A;  3TTF A;  3LAN A;  3S3N A;  3CYM A;  5J2P A;  4BG8 A;  1VQM N;  4BWM A;  1KAY A;  2RE2 A;  1RIL A;  4OPA A;  4HWI A;  1HNW K;  3RVC A;  2Q1N A;  4CEE A;  4CJT A; 
#chains in the Genus database with same CATH homology
 4DS4 A;  4O5B A;  3U3G A;  2Q3S A;  2VG6 A;  4KI6 A;  3ZSR A;  1VSI A;  1UAX A;  3LPU A;  3NF6 A;  1BQN A;  2BAN A;  2YNH A;  4CIG A;  3OYC A;  4KKO A;  3CFR A;  5CYM A;  3KKS A;  1S1W A;  4DLG A;  1NK8 A;  4E0D A;  1D5A A;  1RDC A;  3L3V A;  3LP0 A;  4I2Q A;  1YT3 A;  1JXB A;  3OYA A;  4YFU A;  1REV A;  3DRP A;  4HHT A;  1NK7 A;  3ZT2 A;  2KFZ A;  2WOM A;  4FJ8 A;  4E1M A;  3ZSY A;  1S1V A;  4XIU A;  1RT5 A;  3RR7 A;  4DSF A;  1JLG A;  1GOB A;  1NOZ A;  4W5T A;  4E7J A;  1LWE A;  3V1R A;  3NAE A;  5HLF A;  4FZX C;  1SL2 A;  4R5P A;  4CCH A;  4CEO A;  3OY9 A;  3NHG A;  3B6O A;  4CF0 A;  1RTJ A;  1QSS A;  1D9F A;  1KRP A;  3VQC A;  1Z26 A;  2GV9 A;  2B4J A;  4DTS A;  3AVJ A;  3CFP A;  4DQR A;  3LP1 A;  3MXM A;  4LD0 A;  3THV A;  3AVA A;  2XHB A;  3C95 A;  4CK3 A;  1X1P A;  4C8O A;  3C6U A;  2IC3 A;  5CZ2 A;  2BE2 A;  5J1E A;  2YNF A;  3SUO A;  2Z1H A;  3ITH A;  3OYH A;  4OLB A;  4HCC A;  4W5R A;  3KK3 A;  4WE1 A;  1D8Y A;  1UA1 A;  3C94 A;  4RW6 A;  1NKC A;  4B9N A;  3IRX A;  4DF8 A;  1CZ9 A;  5FRO A;  3ZSZ A;  4CFA A;  1HYV A;  2BDP A;  3PO4 A;  4HCB A;  1S6Q A;  1TKX A;  4CHP A;  1J5O A;  2HHU A;  2KTQ A;  3C6T A;  1EP4 A;  1RT7 A;  2QKK A;  1X9W A;  3S3O A;  1KFD A;  2D0C A;  4KTZ A;  4MFB A;  4DFJ A;  3V4I A;  4KHS A;  3HO1 A;  1HNV A;  2A1R A;  4KO0 A;  4CGH A;  4JS4 A;  2Y1J A;  3SNN A;  1L3S A;  2HHS A;  1HYZ A;  3OYF A;  4FVM A;  3PY8 A;  1N6Q A;  4FW1 A;  1K6Y A;  1CXQ A;  3VN5 A;  4I7F A;  1XHZ A;  4BWJ A;  4M42 A;  1EX4 A;  2D0B A;  2WON A;  3T1A A;  4KAZ A;  4QAG A;  3DMJ A;  3AA3 A;  3P83 D;  3V6D A;  1A5X A;  1WSF A;  4FLV A;  3DLB A;  4Z4I A;  1ITG A;  3OYL A;  2HB5 A;  3NGZ A;  1J53 A;  1VK0 A;  3H08 A;  2FC0 A;  4IG0 A;  4DTP A;  1RBV A;  3M8R A;  2IGI A;  2HHX A;  3QEX A;  4Z0U A;  3AA5 X;  4AHS A;  1ZYQ A;  3VQ9 A;  3DLK A;  5I42 A;  2O4I A;  3MEE A;  2FBT A;  3AA2 A;  4Z4H A;  3QEI A;  4F2R A;  3NBP A;  1NK4 A;  2KZM A;  3DOK A;  4DU3 A;  1JLQ A;  3L2Q A;  4B8A B;  3K5O A;  5SWM A;  3FFI A;  1S1T A;  2YKM A;  3VQ5 A;  4BE1 A;  4DQI A;  3DLE A;  4ZHR A;  3SQ2 A;  1FK9 A;  4Q0B A;  4ICL A;  5CYQ A;  3TAR A;  4K8Z A;  1J54 A;  4OJR A;  2RF2 A;  4CER A;  1BI4 A;  1XI1 A;  1XC9 A;  3NFA A;  3HK2 A;  3WNF A;  4CGI A;  4DF4 A;  1X9M A;  3PV8 A;  2XY5 A;  3K5N A;  4CHN A;  2GBZ A;  4B08 A;  3MEC A;  3NGY A;  3JYT A;  1YTA A;  3KLI A;  3NF9 A;  4IDK A;  1CXU A;  3L2W A;  3LAL A;  4GMJ B;  2FBX A;  1R0A A;  2DFE A;  3EY1 A;  2IS3 A;  2E6M A;  4AH9 A;  4CJE A;  1Q9X A;  4DSI A;  2ZQB A;  2G8U A;  3OYE A;  3QIO A;  2DFF A;  1IKX A;  4FK0 A;  4LH4 A;  3NH1 A;  3WNG A;  1ASV A;  4E19 A;  3AVL A;  4HUG A;  3QLH A;  3UIQ A;  3DLG A;  2Y1I A;  2PY5 A;  3AO4 A;  3AV9 A;  1QSL A;  1FXX A;  3OYI A;  3NGI A;  1SKW A;  3QNN A;  2RN2 A;  5FRM A;  4E7K A;  1ASU A;  5C24 A;  3L2U A;  4C8M A;  2ETJ A;  4O44 A;  1RT2 A;  3DYA A;  4AHC A;  3MAQ A;  3SV3 A;  3SUP A;  4N41 A;  3TAB A;  2QK9 A;  2KFN A;  4CGF A;  4LSL A;  3KIO A;  3T19 A;  5KRT A;  3IS9 A;  3KTQ A;  3OYB A;  3TAG A;  4K8X A;  4CJQ A;  1RBT A;  4MQ3 A;  4J2D A;  3TR8 A;  4AIL C;  1NK0 A;  1HJR A;  1WSI A;  3U3Y A;  3BGR A;  4DTM A;  3DLR A;  4QCL A;  3S3M A;  3OYM A;  1GOC A;  1BGX T;  2P1J A;  3HT3 A;  1B92 A;  3SI6 A;  4FJL A;  3NE6 A;  4PQU A;  4W5N A;  2IDO A;  4DSE A;  4UQG A;  3EZ5 A;  1RT3 A;  3HP9 A;  3V9X A;  3SUQ A;  1EET A;  1C1B A;  3TAF A;  3O4N A;  3HVR A;  4FK4 A;  5KTQ A;  1WN7 A;  3QEV A;  4OPJ A;  4CK2 A;  2NUB A;  1IG9 A;  1W9H A;  2B5J A;  2A1S A;  3ZT3 A;  3RWU A;  4CJF A;  3O3F A;  3F73 A;  1VRU A;  1IKW A;  4C8N A;  2OZM A;  3PUF A;  4FLT A;  4C8K A;  3D45 A;  4KHY A;  5HRN A;  1RDD A;  3MEG A;  4HVJ A;  4E7I A;  3LDS A;  3SV4 A;  4DTN A;  2XO7 A;  2Z1G A;  1NK6 A;  2G8I A;  2P5O A;  3VQP A;  2F8T A;  4FW2 A;  3K5M A;  4DTJ A;  3SQ4 A;  3VQ7 A;  5HRO A;  1QS4 A;  3ISN C;  4CFD A;  4CJ3 A;  4C8L A;  1JLF A;  2E6L A;  3AVM A;  4N56 A;  3AVN A;  1RBS A;  4NCG A;  1T03 A;  1TK8 A;  1TKT A;  1KCF A;  3RRG A;  1VSF A;  1KVB A;  1QE1 A;  1QTM A;  3P1G A;  4CJV A;  3TI0 A;  4DG1 A;  5D3G A;  1LW2 A;  4DTO A;  2E4L A;  1BHL A;  4NYF A;  3KLG A;  4F3O A;  3MXJ A;  3QES A;  1LW0 A;  4FYD A;  4H4M A;  4O0J A;  4FLU A;  4KHN A;  1S1U A;  3ALY A;  3ZSQ A;  4B9U A;  1JKH A;  1RT4 A;  3DI6 A;  1S5J A;  1RTD A;  1U48 A;  3V9W A;  4E7L A;  1DTT A;  1VSK A;  1KSP A;  3IAY A;  1VSE A;  4EP4 A;  1D9D A;  3QEP A;  2DY4 A;  5HBM A;  1GOA A;  4FJ9 A;  1ZBI A;  2OYQ A;  3LAK A;  3VQD A;  3VQQ A;  4Y1D A;  1SUQ A;  1SL1 A;  1L3T A;  2KZZ A;  3ZSX A;  3HJF A;  4M3X A;  2OPS A;  4CJU A;  4CJP A;  4OKE A;  3AA4 A;  2F8S A;  3OVN A;  3QIP A;  4DQQ A;  3AVC A;  1ZBH A;  5SZT A;  4RW7 A;  1TVR A;  4KB0 A;  2HW3 A;  3RRH A;  4DFK A;  4Q5V A;  4FZY A;  4KHQ A;  3AVB A;  3AO1 A;  3NH2 A;  3AVG A;  1JLA A;  3A2F A;  4CHQ A;  1DTQ A;  3VQE A;  4CIF A;  1WSG A;  3AO3 A;  3L3U A;  4O55 A;  4N5S A;  1IKY A;  1RDB A;  5JS2 A;  3VQ6 A;  3LWM A;  4BDZ A;  4PWD A;  1C0T A;  1BIU A;  4OVL A;  3EYZ A;  4CGD A;  4L8R B;  4KI4 A;  3OJS A;  4CHY A;  5I3U A;  3AVK A;  4BE0 A;  1T05 A;  3NCI A;  3U6F A;  1VSL A;  4BDP A;  3VQ8 A;  2B6A A;  1WNS A;  2QXF A;  3QEW A;  3DLH A;  3KKR A;  4FCY A;  4ELU A;  4RG8 A;  4CEC A;  2GUI A;  3KLE A;  4BAC A;  3ULD A;  3RMC A;  1NK9 A;  2PZS A;  4I9Q A;  2VWK A;  1NJY A;  5KI6 A;  1T7P A;  3F9K A;  4CK1 A;  3KD1 E;  4EZ6 A;  1LWF A;  2LSN A;  4ID5 A;  4H8K A;  3OYG A;  2JLE A;  2W42 A;  1LAV A;  2OPR A;  2FBV A;  3NF8 A;  4DFP A;  1TAQ A;  1TL3 A;  2IOC A;  3KK1 A;  1U4B A;  5J2Q A;  3DM2 A;  2Z1J A;  3HPH A;  4IFV A;  3HM9 A;  1SKR A;  1FKP A;  3KK2 A;  2OPP A;  4I9L A;  1JLC A;  1L3U A;  1JXE A;  2YNI A;  1L3V A;  1VRT A;  5KRS A;  1BL3 A;  1VSD A;  1U49 A;  4KTQ A;  1S1X A;  4IBN A;  4RW4 A;  2ATQ A;  1LV5 A;  3SJJ A;  1UWB A;  4CEB A;  3IG1 A;  5JS1 A;  4E7H A;  1KVA A;  2G8F A;  1YTU A;  3V1O A;  3G10 A;  3LPT A;  5T7B A;  1SV5 A;  2R7Y A;  3V81 A;  5J2M A;  3L2R A;  2F96 A;  4CF2 A;  4DSK A;  2PYL A;  2I5J A;  1TK0 A;  3M8P A;  4F2S A;  4M3Y A;  3LZI A;  4NCB A;  1RTI A;  4Z4C A;  1RBU A;  1ZBU A;  3MED A;  4YNQ A;  4DTR A;  3LWL A;  4DLE A;  3TAE A;  4CGG A;  3SUN A;  1B9D A;  1S9E A;  3SPZ A;  4CEQ A;  2HND A;  1VSM A;  3VQA A;  1O1W A;  4CFB A;  1Y97 A;  2YHA A;  4CEZ A;  1QSY A;  2EX3 A;  1F21 A;  1RCH A;  3HST B;  1NKB A;  4W5Q A;  1UOC A;  2HHV A;  4FM2 A;  4M3T A;  3AVI A;  5FDL A;  1NJW A;  1CLQ A;  3LZJ A;  4HUE A;  1BIS A;  4KFB A;  3SYZ A;  1TGO A;  2VG7 A;  4CF8 A;  3K59 A;  1Z25 A;  1RNH A;  4J2B A;  3QNO A;  3B6P A;  3LP3 A;  4Z4E A;  3L8B A;  3KJV A;  4CF1 A;  5HRR A;  4OKJ A;  1BI4 B;  4ELT A;  4NCA A;  3CQ8 A;  4HTU A;  1IH7 A;  1TAU A;  2PYJ A;  1QHT A;  1ZBL A;  2G8V A;  3G0Z A;  3D0P A;  3QER A;  3SQ0 A;  4TSX A;  2ZD1 A;  2VG5 A;  1NKE A;  4B9T A;  4OKK A;  4FLZ A;  3KLF A;  2HHQ A;  3AVH A;  3M8Q A;  4HUF A;  1TKD A;  4ZTF A;  2X78 A;  4F8R A;  1J9A A;  3PX0 A;  5HP1 A;  4CEA A;  4CFC A;  3RMA A;  2P51 A;  1A5V A;  1A5W A;  1S6P A;  4FJI A;  3L2V A;  1JL2 A;  4FJN A;  4CIE A;  4EP5 A;  1T8E A;  1YVU A;  3SCX A;  2BGG A;  4KV8 A;  4B9S A;  3CM5 A;  4FJ5 A;  4CJ5 A;  5KGX A;  4OLA A;  2YNG A;  4M45 A;  4BE2 A;  4E3S A;  2DTU A;  1XWL A;  1HQE A;  2HNY A;  2G8W A;  4DMN A;  3TAP A;  3OYK A;  2XRI A;  3V9S A;  1FKO A;  3K2P A;  3OYN A;  3KLH A;  4M3U A;  1BQM A;  4CEF A;  3OS2 A;  2HHW A;  1XHX A;  4CED A;  3VQ4 A;  1DLO A;  4B9M A;  4CHZ A;  1WSJ A;  2OPQ A;  4CJK A;  5EU7 A;  4Z4G A;  1WSE A;  1KVC A;  1WSH A;  1TKZ A;  4CJ4 A;  4E89 A;  1C6V A;  4ELV A;  2YKN A;  3WNH A;  3ZSO A;  4M3Z A;  3O4Q A;  1CZB A;  4IG3 A;  1HQU A;  4FM0 A;  3PX4 A;  4J2A A;  4AHV A;  3DRR A;  4DQP A;  1BCO A;  1EKE A;  2RKI A;  2FBY A;  4LY7 A;  4IFY A;  2G8H A;  3PO5 A;  5DK5 A;  4DU1 A;  4FJK A;  2G8K A;  4DU4 A;  1C1C A;  3NH0 A;  1KTQ A;  4JLH A;  4M3R A;  1HNI A;  4W5O A;  3OJU A;  4QOZ B;  3HP6 A;  1N5Y A;  3AVF A;  4FLX A;  3V9U A;  3K5L A;  1VSH A;  3PX6 A;  4CJS A;  4OPK A;  1S9G A;  4CJW A;  1G15 A;  3LAM A;  4KRE A;  1HYS A;  1LAW A;  1HMV A;  2XY7 A;  1U47 A;  1ASW A;  4N76 A;  4G1Q A;  4BDY A;  3O3G A;  1I3A A;  3V9Z A;  3HL8 A;  3VA3 A;  4M3W A;  3OYJ A;  1U04 A;  4DTU A;  4KTW A;  4JS5 A;  4KB1 A;  4Y1C A;  1TV6 A;  1RTH A;  2HMI A;  4KPY A;  2AJQ A;  1IKV A;  1ZBF A;  3ZCM A;  4KRF A;  3ASM A;  1X9S A;  3DOL A;  3HYF A;  5KGW A;  5CZ1 A;  1KLN A;  1RBR A;  4CE9 A;  4FM1 A;  1WAF A;  4FJJ A;  3HXM A;  5DMR A;  4FLY A;  2RPI A;  4AHT A;  3OS1 A;  3DRS A;  3ZT4 A;  5K14 A;  3ZT1 A;  4F3T A;  5C25 A;  5FRN A;  4FJM A;  5CY4 A;  1RDA A;  4M41 A;  1MU2 A;  4RW8 A;  4B3O A;  3V1Q A;  3S9H A;  1Q9Y A;  2X6N A;  4PA1 A;  2KW4 A;  3KD5 E;  4FJ7 A;  1BIZ A;  1JL1 A;  3P5J A;  3MXI A;  1EXQ A;  3O3H A;  2Z1I A;  3NF7 A;  2X74 A;  2OA8 A;  5J2N A;  4CGJ A;  3HVT A;  1QQC A;  3I0R A;  3TAQ A;  3RMD A;  1BCM A;  4CES A;  1KFS A;  4JRQ A;  4FJX A;  4O4G A;  1C1A A;  4B9V A;  3E01 A;  3SZ2 A;  3RR8 A;  4DSJ A;  4B8C A;  3CFO A;  2ITG A;  4LH5 A;  4GVM A;  3TAN A;  4KHU A;  1RT1 A;  2P5G A;  3AO2 A;  1VSJ A;  3ZSW A;  4ZTJ A;  4RW9 A;  3JSM A;  2XY6 A;  4OGE A;  3HPO A;  4Z4F A;  2X6S A;  3M8S A;  4FXD A;  4DTX A;  2D5R A;  4F4K A;  1HRH A;  1TL1 A;  2XY8 A;  3VQB A;  3ZT0 A;  1NJX A;  1WAJ A;  4LSN A;  3K57 A;  4DWI A;  4N47 A;  4FK2 A;  1B9F A;  5E41 A;  2JGU A;  2DFH A;  3QO9 A;  4ID1 A;  4FJH A;  3OYD A;  2D0A A;  5HRP A;  1NJZ A;  4KHW A;  4FLW A;  1RT6 A;  2OZS A;  1KLM A;  1C0M A;  3LP2 A;  4OGC A;  3T3F A;  4CHO A;  3OS0 A;  4FJG A;  3SPY A;  4FZZ A;  2HVI A;  2ZE2 A;  3RMB A;  4DS5 A;  2O4G A;  4CJR A;  2EHG A;  5HRS A;  1UA0 A;  4IKF A;  3NDK A;  3CG7 A;  1L5U A;  4AHR A;  1SL0 A;  3AO5 A;  2IAJ A;  3QIN A;  3K58 A;  2QKB A;  1W0H A;  1HPZ A;  1Q8I A;  2KQ2 A;  2HHT A;  4I2P A;  4CJL A;  3CM6 A;  3VA0 A;  4DFM A;  1WLJ A;  1IO2 A;  1NK5 A;  1JLB A;  3I0S A;  4O0I A;  2HNZ A;  1SKS A;  2HVH A;  1U45 A;  2YV0 X;  3LAN A;  3RTV A;  3S3N A;  2YHB A;  3CYM A;  5J2P A;  3SQ1 A;  4PUO A;  4BWM A;  3WNE A;  2VWJ A;  4DQS A;  1NOY A;  1LWC A;  3BDP A;  4J2E A;  4E1N A;  5C42 A;  1I39 A;  4H4O A;  4AHU A;  3I8D A;  1RIL A;  1JLE A;  3HPG A;  4GW6 A;  4CF9 A;  4EZ9 A;  3QET A;  3TAM A;  4PY5 A;  4JRP A;  1TK5 A;  4NYN A;  4DSL A;  3TWH A;  4CEE A;  3ZSV A;  4CJT A;  4B9L A;  1C0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...