2ETJA

Crystal structure of ribonuclease hii (ec 3.1.26.4) (rnase hii) (tm0915) from thermotoga maritima at 1.74 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
221
structure length
211
Chain Sequence
MGIDELYKKEFGIVAGVDEAGRGCLAGPVVAAAVVLEKEIEAKRERLLDEIMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKPSFVLVDGKGIELSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRMYPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPVLELLTDDLLREFFEKGLISENRFERILNLLGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title Crystal structure of Ribonuclease HII (EC 3.1.26.4) (RNase HII) (tm0915) from THERMOTOGA MARITIMA at 1.74 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 68
structure length 211
sequence length 221
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2etjA00
3K5OA 3M8PA 3QEIA 2W42A 3TAQA 1D8YA 4CGDA 1KRPA 4F3OA 4CEBA 1UOCA 3ISNC 3TI0A 2XHBA 4KHUA 3L2QA 2VWJA 5C24A 3G10A 1TVRA 4B9LA 3ZSZA 2P5OA 3ZSQA 4B8CA 1WLJA 3QERA 1RTIA 5E41A 1HYSA 3NE6A 2FBTA 2B4JA 2WONA 5FDLA 1VSEA 1XWLA 4BDYA 2Z1HA 1LV5A 2IOCA 4JRPA 3P1GA 2ITGA 2WOMA 2Z1JA 3VQ7A 3K5LA 4FM0A 1X1PA 3CM5A 1IG9A 2HHSA 3PUFA 2RN2A 3MAQA 1T03A 1L5UA 2G8FA 4CGJA 4PQUA 3BGRA 4OPKA 3OJUA 2Y1IA 3DLKA 4LSLA 3NCIA 4CIEA 3I0SA 3V6DA 3AA5X 4E7JA 1KVCA 1KSPA 1HPZA 1TGOA 3KLFA 1U45A 3RWUA 1RTHA 1CZBA 1ITGA 1RBSA 3DLRA 3A2FA 5KRTA 4TSXA 4CEQA 4QCLA 4H8KA 4FVMA 1RBUA 1Q8IA 3ITHA 4HCBA 2HHUA 4RW4A 4CHQA 4ZTFA 4LY7A 3KJVA 3OYDA 3TANA 2E6MA 1ZBLA 1IKWA 1NKBA 4Z4GA 3RRGA 4KV8A 3RMDA 1VSKA 4DS4A 4DTXA 4I2QA 4I7FA 4GW6A 3L2WA 4O55A 2D0CA 2IGIA 3O4QA 4OPJA 3OY9A 1NJZA 3VQDA 3JYTA 2KFNA 4C8KA 3HSTB 1B9FA 1J5OA 4YNQA 3QEXA 4W5RA 3VQQA 4IG0A 4CJ5A 4F8RA 4FJKA 1L3VA 4HVJA 4J2DA 1Q9YA 4H4OA 1QSYA 3HM9A 3RMBA 1TAQA 4FLZA 4KI4A 1C0TA 1RT6A 4B9MA 4DSIA 3HPHA 4B9NA 1RNHA 2QKKA 1A5XA 1QQCA 3U6FA 3SUQA 3RMCA 1JLEA 4EZ6A 4KHQA 2X6NA 3VA3A 1BI4B 1VSJA 3DRSA 3MXIA 4CHPA 1XHXA 4OLBA 2EX3A 4CJQA 1EETA 2HNDA 3S9HA 4FLWA 4Z0UA 1X9MA 1VSDA 4M3YA 2DTUA 4DSEA 3AVIA 4DU1A 1A5VA 1YTAA 4CEZA 1B92A 1TK0A 3V1QA 4DTNA 4DSFA 4FYDA 4I9QA 4FW2A 4EZ9A 4CF2A 3SQ0A 1BQNA 3NAEA 4DF8A 1NK0A 3CQ8A 4M3WA 3O3FA 1KVBA 3CFOA 3V1OA 3V1RA 1GOBA 1EKEA 3MEDA 5T7BA 4YFUA 4AH9A 3KD5E 1EP4A 3L3VA 2OA8A 2ATQA 3KKSA 4CEAA 4IKFA 4NCBA 3SQ1A 5HRSA 1KFDA 4ICLA 2HHWA 3D0PA 1NK6A 4B08A 3RMAA 1S9GA 1YT3A 4E19A 3NGZA 4AHRA 3QNOA 4HUFA 4Z4CA 2AJQA 3ZSOA 3UIQA 4CJSA 2A1RA 4H4MA 3SI6A 1NJWA 4CJ4A 3T3FA 3PX4A 2JLEA 4Y1CA 1SL2A 3OYEA 3OYLA 4DTMA 5HRNA 3NH2A 2R7YA 4OKEA 4CJRA 4BE2A 1W9HA 3S3OA 3PY8A 3AVCA 4M3ZA 3CFPA 1IO2A 1HYVA 4CK1A 2ZE2A 3OYJA 4HUEA 4E7KA 3HXMA 1NK7A 1TK8A 1QSSA 4PUOA 3ASMA 1WAFA 4CHZA 3DRRA 1ASWA 4B9SA 3MXMA 4Y1DA 4KHYA 1GOAA 3KLEA 3KLGA 4CGHA 5KRSA 3BDPA 4HUGA 5JS1A 1XC9A 3RR7A 1ASUA 3TWHA 3RTVA 2OZMA 4CJKA 2FC0A 2VG7A 1JLAA 3ZT1A 1L3TA 4PWDA 4F2RA 3WNHA 3AO1A 4KHSA 4CK2A 3AVKA 1LW0A 1VSIA 3V81A 2DY4A 1ASVA 1X9SA 4FZXC 4CGIA 1NK4A 4F2SA 3ZT2A 1TV6A 2ZQBA 4CGFA 5HRPA 4HCCA 1TKDA 4FJNA 4M3TA 2YHBA 4LH5A 4GVMA 1NOYA 4O0IA 4C8NA 2XY7A 5HROA 3ULDA 1ZBIA 3G0ZA 2PY5A 2YKNA 2YNFA 3AVHA 3VQAA 4O5BA 5CY4A 5EU7A 5HBMA 3WNEA 4DG1A 4CCHA 2BDPA 2G8WA 1TK5A 1RDAA 3HVTA 4CJUA 2HNZA 3NGYA 4KREA 2FBXA 2ZD1A 1JLBA 4DTRA 2YNHA 3KKRA 3TR8A 3HO1A 3V9WA 4M45A 3FFIA 4DS5A 3B6OA 4FXDA 4CEEA 3VA0A 4LD0A 4ZHRA 3LP2A 1XHZA 3RR8A 2DFFA 1VRTA 3QEVA 4DFKA 2OPQA 1TL1A 1ZBFA 2VWKA 4CHYA 5J2MA 4FK0A 4BDPA 4FCYA 4CF0A 4FJ7A 3V9XA 2GUIA 2HVHA 3DMJA 3LPUA 3AVMA 1NK8A 1N6QA 4E0DA 3DOKA 3ZCMA 4FJ5A 2GV9A 1LWEA 1TKXA 1LWCA 3I0RA 3SJJA 2RPIA 4FJJA 4M3UA 2HB5A 2X74A 4DTPA 2GBZA 2OPRA 4XIUA 1U49A 3B6PA 3HP9A 4QAGA 4BWMA 1NK5A 4N41A 1W0HA 3DRPA 2DFHA 4FZYA 2G8IA 5DMRA 2F8TA 1KTQA 4UQGA 1S1XA 1SKSA 4EP4A 4CK3A 5SZTA 3AVBA 3NBPA 3D45A 1JL1A 2KTQA 4DLGA 3LP1A 3PO4A 4IFVA 1S9EA 3OYIA 3MECA 3OYKA 3LWLA 2Z1GA 4J2EA 4FJMA 3SYZA 3AVNA 3QIPA 4B9UA 1JXBA 2BGGA 4IFYA 1S1UA 3V9UA 3VQ9A 1HRHA 1WNSA 1JLQA 3OJSA 3LALA 3WNGA 3QEPA 4ELVA 3SUOA 3OYGA 5D3GA 1BISA 1VSLA 3ZSRA 2KZMA 4CFBA 5CZ1A 5CZ2A 4DTUA 1ZBHA 3SQ2A 2G8UA 1KVAA 4CECA 3L2VA 1U4BA 1RILA 3DI6A 5K14A 3OYNA 3KLHA 3S3MA 1QTMA 4DSLA 2YKMA 4C8MA 3NDKA 1N5YA 4DSJA 2KFZA 1CXQA 1S5JA 3NH0A 3IAYA 4E7HA 1RT4A 5J1EA 4W5TA 4DU3A 1T05A 3T1AA 4AHUA 4CJ3A 4CF9A 3TARA 3AVFA 1NOZA 4KTQA 2RKIA 4E1NA 3SNNA 1U04A 1LW2A 3LAKA 4I2PA 2HMIA 1CXUA 4FJLA 1YTUA 5CYMA 2P5GA 2YNIA 2B5JA 4K8XA 2YNGA 3AO5A 4B8AB 2G8KA 4F4KA 2HW3A 5HRRA 3KK1A 4LSNA 4GMJB 3AVJA 4KO0A 4AILC 2XY6A 2LSNA 4E3SA 4CJWA 1WSHA 1MU2A 4KAZA 2OZSA 3RRHA 3E01A 1VSMA 5JS2A 1KLNA 3VQ4A 1WN7A 3KLIA 4FK4A 1TKZA 3SZ2A 1CLQA 4KTZA 4N5SA 4NYNA 3DLEA 3HYFA 4DU4A 3O3GA 1C1BA 4CF8A 3KIOA 3EZ5A 1U48A 2XO7A 3T19A 1D9FA 4CGGA 3HPGA 3IRXA 1J54A 2QKBA 3PX0A 1I39A 2HVIA 5HP1A 3LP0A 3SCXA 1BCOA 3TAPA 1S6PA 4CEDA 4QOZB 4CFCA 5C25A 1FKPA 2FBYA 1S1WA 4KHNA 4NYFA 4CF1A 3M8QA 4W5OA 2O4IA 3NH1A 3V9ZA 4I9LA 4DQPA 4LH4A 2BANA 4E1MA 3LANA 5KTQA 3O4NA 3PV8A 1Q9XA 2E6LA 2B6AA 2XY5A 3HL8A 2PYLA 2KZZA 3QLHA 4W5NA 4DWIA 1I3AA 2IAJA 4G1QA 4ZTJA 3DM2A 3VQ6A 1NJXA 4C8OA 3HK2A 2HNYA 4FZZA 4N56A 3AA2A 4DQIA 1GOCA 3MXJA 3M8RA 3U3GA 4HHTA 1BIZA 4FJ9A 4IBNA 1EX4A 4Z4IA 3LPTA 3I8DA 1XI1A 5FRNA 1DTTA 1JL2A 3VQCA 2VG5A 2D5RA 4DFJA 3PX6A 1SKRA 2P51A 4FK2A 4B3OA 2OPSA 1UA1A 4KB1A 2OYQA 1JXEA 3LWMA 4FW1A 3SV3A 3H08A 1EXQA 3JSMA 4KHWA 1CZ9A 1KCFA 3L8BA 4KFBA 4CFDA 1O1WA 4AHSA 4DTSA 1VRUA 1SV5A 2Q3SA 4ID5A 1NKEA 1UWBA 2F96A 1FXXA 3K58A 1K6YA 3OYHA 4C8LA 1T8EA 1D5AA 4FJ8A 2NUBA 4CJVA 3OS0A 1JLCA 1S1VA 3QINA 1QSLA 3HPOA 3QIOA 5KGXA 1RBRA 3OYBA 3ZT0A 3LAMA 3NHGA 4CERA 4KTWA 4DQRA 3QO9A 1X9WA 4M3XA 2KW4A 1A5WA 4AHVA 3CYMA 4O44A 4FJHA 3OVNA 4OVLA 2F8SA 5KGWA 1RT7A 4RW7A 1WSEA 3SPZA 3DLHA 4KB0A 4CE9A 5SWMA 5DK5A 3HJFA 3P83D 3ZT4A 2XRIA 4DTJA 3OS1A 1YVUA 3NFAA 1IH7A 3NF9A 4IG3A 4M41A 1BIUA 3MEEA 5J2PA 3V4IA 4OGEA 2HHQA 3EY1A 4DSKA 3V9SA 4RW6A 1HQUA 1HMVA 1HQEA 1SUQA 4CHNA 3LZIA 4KPYA 5CYQA 3AA4A 4MFBA 4CEOA 2G8VA 1D9DA 4CJPA 3SUPA 1NJYA 4OKJA 2E4LA 1U47A 4OJRA 2YV0X 1KFSA 4K8ZA 2P1JA 4NCAA 3P5JA 1RBVA 3DYAA 2IDOA 3L3UA 5J2NA 4BDZA 2Y1JA 1UA0A 4BWJA 2HHTA 1C0UA 2XY8A 2KQ2A 3M8SA 1RT3A 4CEFA 1FK9A 2D0AA 2BE2A 1RDDA 4JS5A 4FLVA 4DTOA 2PZSA 2QK9A 1BGXT 4CJTA 3HP6A 4JRQA 4OKKA 4W5QA 4DLEA 2RF2A 1SKWA 3K5NA 4J2AA 2A1SA 4Q0BA 3VQBA 4FLYA 4F3TA 3NF6A 3LP3A 4RW9A 2D0BA 2FBVA 3HT3A 1FKOA 3ZSYA 1C1CA 3C94A 2I5JA 4BACA 3ZT3A 4AHCA 1UAXA 1Z25A 3QESA 4FJGA 4DMNA 1SL1A 3F73A 3KK2A 4O4GA 3ALYA 3SQ4A 1J53A 4AHTA 1JKHA 2OPPA 5I3UA 1L3SA 3AO2A 2G8HA 3DLGA 1RT5A 3HVRA 1HNVA 4JS4A 4OGCA 4FLUA 3AO4A 1IKVA 1ZYQA 2HHVA 5FROA 1KLMA 1REVA 1RDCA 3AO3A 2IC3A 3CG7A 3MEGA 3VQPA 3OYAA 4FLTA 4RG8A 4DFMA 3SUNA 5KI6A 4DF4A 3QEWA 2EHGA 3NF8A 4OLAA 1Z26A 4Z4HA 1BL3A 4E7IA 3DLBA 4CHOA 1T7PA 4R5PA 3VN5A 4FM1A 1C6VA 4CFAA 3KTQA 3EYZA 1VSHA 3AA3A 3TAGA 1DLOA 3WNFA 4PY5A 3C6TA 3SPYA 1HYZA 4DFPA 1JLFA 1RT2A 3AVAA 4M42A 1TAUA 3ZSWA 3L2UA 2QXFA 1NKCA 4Z4EA 1LAWA 4KRFA 3CM6A 4FLXA 1VSFA 3PO5A 4FJXA 3F9KA 1NK9A 1J9AA 2X78A 3IS9A 1RT1A 2IS3A 3TAEA 3OS2A 3OYMA 3L2RA 3K2PA 3C95A 3DOLA 4MQ3A 1RBTA 3K57A 4HTUA 2Z1IA 3CFRA 1QS4A 2X6SA 3VQ5A 4ID1A 5HLFA 1C0MA 1LWFA 2ETJA 2VG6A 2HHXA 3AVGA 4E89A 1RTJA 4PA1A 1WSGA 4JLHA 4Q5VA 4EP5A 3THVA 4O0JA 3OYCA 4ELUA 5FRMA 4J2BA 4B9VA 3QNNA 1RTDA 3VQ8A 3C6UA 4WE1A 3QETA 1S1TA 3TABA 4KKOA 4CIGA 3O3HA 3IG1A 1BHLA 1QE1A 1WAJA 4M3RA 2DFEA 4IDKA 3TAMA 3AVLA 1VK0A 1S6QA 4N47A 1TKTA 5C42A 4RW8A 3ZSVA 4DQQA 4FM2A 1IKXA 3LZJA 3U3YA 5I42A 3K59A 1BI4A 1QHTA 2YHAA 1G15A 3OYFA 1RCHA 1TL3A 1IKYA 1ZBUA 3NGIA 4E7LA 1SL0A 4KI6A 1Y97A 1R0AA 1JLGA 3S3NA 4Z4FA 4NCGA 3SV4A 1C1AA 3TAFA 1L3UA 1F21A 3KD1E 3KK3A 4CJLA 4FJIA 1DTQA 1RDBA 1BQMA 2O4GA 3ZSXA 4ELTA 3NF7A 4BE1A 4BE0A 1HJRA 1WSJA 4L8RB 3VQEA 1HNIA 1WSFA 4CESA 1LAVA 4CIFA 3LDSA 2PYJA 4CJFA 4N76A 3K5MA 5J2QA 4B9TA 1B9DA 1BCMA 2JGUA 3AV9A 4DQSA 4CJEA 1WSIA
chains in the Genus database with same CATH superfamily
4CW7B 3K5OA 1D8YA 3KWGA 4CGDA 1KRPA 2QTDA 1GLDG 3L2QA 3SLCA 3G10A 4FWQA 1TVRA 3C65A 4CZFA 1RTIA 4O8KA 4YOXA 1DKGD 4FPAA 2Z1HA 1LV5A 3P1GA 4FM0A 3MAQA 2RN2A 1NMNA 4IFEA 4JHDA 4LSLA 1GLCG 3NCIA 3K0SA 1GLLO 5AZIA 1NNEA 4E7JA 1U45A 1BU6O 1CZBA 4K43A 4TSXA 2WC9A 5GINA 4H8KA 4FSVA 3ITHA 4HCBA 4GY2B 4CHQA 1EQYA 4GNIA 3KJVA 4PKIA 3OYDA 2UUAK 1IBMK 1IKWA 3ID6A 3L2WA 4O55A 3O4QA 4C1NI 4C8KA 1J5OA 3QEXA 3RSEB 1K8KB 3EL2A 3H45C 4HVJA 1L3VA 4DR4K 1Q9YA 3KVGA 1C0TA 3HPHA 1RNHA 3BUZB 4EZ6A 4KHQA 3DRSA 3GOIA 4CJQA 1EETA 2D4WA 2HNDA 3R8EA 3LM9A 4DU1A 4CEZA 4DSFA 2RE2A 4BQZA 1VQ6N 1QZ6A 3R6MA 4PKHA 3NAEA 2WBNA 1NK0A 1KVBA 3V1OA 4B3SK 4UY8O 3V1RA 2GX9A 1VQ4N 1EKEA 5LL6Z 1WB9A 1NWKA 3KKSA 4IKFA 4FVUA 3SQ1A 3O80A 4DUZK 1YT3A 5LY3A 3SI6A 2A41A 2JLEA 4Y1CA 2F9TA 2P9IB 3OYLA 4BRKA 2UYTA 2YJEA 3AVCA 4H03B 3VGLA 1HYVA 3OYJA 3CJCA 4LF8K 3HXMA 1NK7A 1TK8A 4PUOA 3S41A 1ASWA 1K9MO 5KRSA 1XC9A 1GLJO 3TWHA 3RTVA 3HTVA 4JEPA 4KHSA 3AVKA 2VWBA 3B8AX 1VSIA 1OVQA 4B1XB 4QS8A 4CGIA 4HCCA 3BF1A 3OHRA 1NOYA 4O0IA 3ID8A 2OANA 3VQAA 4LFCK 4CCHA 4O5BA 2BDPA 2G8WA 1TK5A 1RDAA 4KREA 3TR8A 3HO1A 3O1WA 4FWLA 1VQ8N 3THYB 3CJ1A 4OX9K 4ZHRA 3LP2A 4DFKA 4BDPA 3V9XA 2GUIA 2QWPA 4YOUA 4C1NK 4FJJA 1NGEA 2X74A 1NK5A 5C10A 5AZJA 2DFHA 4JI2K 5C0YA 4XH5A 4FOEA 2UXDK 1E4GT 3D45A 4IOAL 4LC9B 4J2EA 2BGGA 4JI7K 4GV3A 4BRPA 3DXKB 3VQ9A 4ELVA 1QHAA 2ZWHA 4CECA 4DR3K 1RILA 3DI6A 3MWPA 3OYNA 3KLHA 3S3MA 2NZTA 2W6LA 3VEOA 4E7HA 5J1EA 1LCUA 4W5TA 3BZCA 2O8DB 3TARA 3I8BA 2RKIA 1NGHA 2HF4A 3LAKA 1WUAA 4FJLA 1CXUA 3EEQA 1OVYA 3K9KA 2YNGA 4F4KA 2HHHK 2HW3A 5HRRA 4AILC 4KO0A 5AFUA 4E3SA 2QWMA 3ULEA 4CJWA 2OZSA 4MO4A 5AQVA 5M1PA 4YORA 1QQOA 3SZ2A 4B1VA 4KTZA 3MK6A 4NYNA 3DLEA 4CF8A 2XO7A 4CGGA 2GTDA 2QKBA 3SBGA 4QOZB 1BCOA 4H5NA 4CEDA 5F0XA 4KHNA 4NYFA 1VQPN 2O4IA 3HOTA 4DQPA 4RWTA 2BANA 4O5FA 2E6LA 5AQTA 5B8HA 2XY5A 2IAJA 4C8OA 2Q0RA 4WFNL 1Q18A 4A61A 4DQIA 1GOCA 3M8RA 4I6MB 3U3GA 4HHTA 5AQNA 1EX4A 4Z4IA 1DTTA 3TTFA 4DFJA 2D5RA 3P39A 4B3OA 2P51A 1HR0K 4FK2A 2OPSA 2OYQA 3FZMA 3SV3A 3H08A 5TKYA 1EXQA 1RGIA 3L8BA 1T44A 2F96A 2D0OA 3K58A 1GLEG 4C8LA 2YHWA 3T1YK 1JJ2M 1MDUB 1JLCA 1S1VA 4OPAA 5H1SQ 3VEVA 1QSLA 3QIOA 3LAMA 4FOIA 5AQFA 3SAGA 3OVNA 1VQNN 2F8SA 1RT7A 4RW7A 3P83D 5BPNA 4DTJA 5J2PA 1IH7A 4IG3A 3FZFA 2UXBK 2HBKA 1HQEA 3SJHA 3KK7A 4QS7A 2G8VA 4OKJA 4JK8A 4OJRA 4BR7A 3F5TA 4NCAA 1RBVA 1BA0A 4PKGA 3ZYYX 1U6ZA 3HZ6A 4H5WA 3P31A 3VGMA 2D0AA 1TUYA 2QK9A 4W5QA 3LDNA 2RF2A 3DWLA 2A1SA 4OPHA 4F3TA 3EKUA 3KHYA 4DV6K 2P9PB 2W6KA 3LP3A 3HT3A 1FKOA 3C94A 4BACA 3ZT3A 3F73A 3DLLL 1JKHA 1JCFA 1MA9B 3DLGA 3HVRA 2FSKA 1I94K 2HHVA 4CZGA 4DCHA 1RDCA 2E20A 3OYAA 3MEGA 4RG8A 4BRAA 3O8MA 4DF4A 3QEWA 3NF8A 4E7IA 3CI5A 4R5PA 1RDUA 3VN5A 4FM1A 1C6VA 3F9MA 4BGBA 3AA3A 1W97L 4PY5A 2Q2RA 3ZSWA 1VSFA 3HSCA 4JNEA 3F9KA 1J9AA 5DM7L 3IS9A 2O8CA 5DM6L 3M5RA 4WFAL 3C95A 4MQ3A 3K57A 2Z1IA 2X6SA 4ID1A 3UKRB 4IWVA 3AVGA 5AQHA 1RTJA 4Q5VA 4DB3A 3MX5A 4BRDA 3RSEA 4M63C 3T69A 3AGKA 4KKOA 4CIGA 1K8KA 2VGNA 1QE1A 4NLBA 4N47A 5C42A 4RW8A 4DQQA 2OTLN 5I42A 3QB0A 3R1XA 3RVCA 1RCHA 3CC7N 4NXNK 4DV4K 1KC8O 1R0AA 2W41A 3SV4A 1BOTO 3TAFA 4HTLA 4M7XA 1DTQA 3UKUB 1WSJA 2IIRA 4L8RB 1HNIA 1WSFA 3H1VX 4CESA 3LDSA 1EWQA 4N76A 1BCMA 3OBYA 4DQSA 1HKCA 3SK3A 3FE1A 2NNWA 3SMPA 4JKHA 3QEIA 3W0LA 1UOCA 3ISNC 2ITMA 1NGJA 3WXMB 2XHBA 2VWJA 5C24A 4JI1K 5FPDA 3ZSQA 3QERA 5E41A 2I7NA 2GELA 1HYSA 1HLUA 2FBTA 4WQ4A 3P4IA 2HF3A 2Z1JA 3VQ7A 3K5LA 1OH5A 1DT9A 2YX6A 1X1PA 4JI5K 1IG9A 2HHSA 1L5UA 2G8FA 1VQON 2O8BB 1HJOA 3CCSN 4CIEA 3V6DA 3AA5X 2FSJA 5JICA 1KSPA 1TGOA 3KLFA 2W40A 3CCJN 1RBSA 1RBUA 1ESVA 4RW4A 5AQIA 4ZTFA 3AAPA 3TANA 1ZBLA 2E6MA 4BGAA 4EHUA 3CMAN 3RRGA 3WQUA 3RMDA 3RWUA 4GW6A 3OY9A 2KFNA 5CHIA 4JKFA 3VQQA 4IG0A 4F8RA 4FJKA 2HSTA 3TSUA 1QSYA 3UB5A 4B9MA 4DSIA 4A2BA 1QQCA 3SUQA 1JLEA 2BH1A 3MXIA 1XHXA 3THYA 2EX3A 4BR0A 2E88A 4FWPA 1HKGA 4IXCA 2OTJN 4DSEA 3AVIA 1A5VA 4X65K 2QW9A 2WFBA 3V1QA 4FYDA 4JK7A 4JKCA 2P9KB 3ATUA 4CF2A 3QBXA 1VAZA 4DV7K 1GOBA 4YFUA 2ATQA 4NCBA 3O9QA 4ICLA 1NK6A 2A3ZA 4WQ5A 3N4QA 4DQ8A 4CJSA 4H4MA 3GL1A 3DXKA 2P9SB 2FF6A 2VCPA 4YY3K 5HRNA 2H3GX 4OKEA 3S3OA 4B9QA 3IMXA 4HUEA 2ZE2A 2UXCK 1DGKN 3ASMA 1WAFA 4CHZA 2O8DA 5AQGA 3MXMA 4KHYA 1GOAA 3KLEA 2BTFA 3M3ZA 4HUGA 4A5AA 4BR5A 4GKJK 2E2OA 3RR7A 4B3MK 5E26A 4PWDA 3IDHA 3AO1A 3FZKA 4CK2A 1LW0A 3GBTA 5AQOA 4F2SA 4CGFA 1TKDA 4M3TA 4GVMA 1VQ7N 3VGKA 5HROA 2XY7A 3ULDA 2A42A 3G0ZA 3VETA 3AVHA 4DG1A 4Z4CA 4AM7A 5C2FA 3NGYA 3WXKA 1KD1O 4DHYA 1JLBA 3V9WA 4FWRA 3VMFB 3B6OA 4DS5A 2VYPA 4CEEA 3VA0A 1XHZA 1VRTA 1RDWX 1TL1A 2VWKA 4A2AA 4CHYA 4FK0A 1SZ2A 3O9SA 2HVHA 2YCHA 3LPUA 1N6QA 3SJJA 1LWEA 1TKXA 5AQUA 4I6MA 2O8CB 4DTPA 2GBZA 4XIUA 3HP9A 2RHKA 2AP1A 2QWOA 1S1XA 3A8YA 3CQXA 1JL1A 1HX1A 3PSIA 3PO4A 4IFVA 2VQFK 2Z1GA 1VQ9N 4FJMA 3SYZA 3AVNA 4B9UA 3PLAA 3MX2A 3WQTA 1WNSA 3OJSA 3WNGA 5D3GA 3OYGA 1VSLA 3J7ZO 2KZMA 5CZ1A 4IO8A 5CZ2A 4DTUA 5GIPA 3L2VA 4A62A 4KTQA 5K14A 4KRFA 3QFPA 4DSLA 3NDKA 5F1XA 3H46O 3Q7BA 5IT9O 1CXQA 3NH0A 1RT4A 1T05A 4CJ3A 4FWOA 4LFBK 4BR9A 3SNNA 3D2EB 4I2PA 4BVPA 2P5GA 2B5JA 2YNIA 2GEMA 1P90A 3H3OB 2XY6A 3O08A 1WOQA 2LSNA 1WSHA 2ASMA 3E01A 1VSMA 4FK4A 4N5SA 4A59A 1C1BA 3T19A 1VHXA 1HNZK 2HVIA 1KQSM 1S6PA 5C25A 5BRHA 4CF1A 2Q36A 3NH1A 3V9ZA 3N4PA 3H1QA 4LH4A 1XNRK 2P9PA 3O4NA 4G9ZA 4BRCA 3I33A 2B6AA 2PYLA 2KZZA 5BR8K 1NU0A 3DM2A 3VQ6A 3Q7CA 2HNYA 3SAHA 3CCUN 1OH8A 1YHQN 3AA2A 2UU9K 3MXJA 2ZGZA 1QVFM 4ISEA 4F9OA 4IBNA 1MWKA 3W3DA 4BG9A 3LDLA 4DR2K 5FRNA 1JL2A 3PX6A 5KPRA 1JXEA 1XMOK 1OH7A 4KFBA 3TPQA 1VRUA 1SV5A 1Q82O 1NKEA 2Q1NA 3QICA 4BRFA 3OYHA 4FJ8A 2JWLA 4CERA 4KTWA 3QO9A 2KW4A 3LDQA 1A5WA 4AHVA 4O44A 5KGWA 2KKZA 3SBTA 5BRDA 3DLHA 4KB0A 4CE9A 4NB4A 5SWMA 2E8AA 3UKRA 3CCQN 4M41A 3NFAA 3CQYA 3NF9A 4O8UA 1BIUA 4AF1A 4BREA 3V4IA 5C15A 4LF6K 4DSKA 4R79A 3V9SA 4RW6A 4NO7A 1BUPA 5CYQA 2QWQA 3AA4A 4MFBA 4MDAA 4CJPA 1NJYA 1KFSA 4JD2B 3DYAA 3MMVA 5MLCQ 2Y1JA 1UA0A 1D4XA 2XY8A 3VEZA 4CEFA 1FK9A 4DTOA 4JS5A 3CPEA 4ISGA 1Q7YO 1BGXT 3HP6A 4PL8A 1SKWA 2CH5A 3K5NA 4J2AA 4GKKK 3BF3A 3UKUA 4RW9A 2FBVA 1Z6RA 5BN8A 5KPZA 4U67L 1Z25A 3QESA 4H5TA 4O4GA 1L3SA 5I3UA 2OPPA 2P9NB 3O6WA 1HNVA 4YOYA 4JS4A 2PAVA 2HOEA 5TKWA 2UUCK 3G71N 1NG9A 4A5BA 5JLFA 4K41A 3VQPA 2ZJQL 4BRNA 4OLAA 3H3NO 3WEEB 3TAGA 3C6TA 3T1HK 4FPBA 3SPYA 1JLFA 2F7TA 2O8BA 1IV0A 4KH6A 3G6EN 1NKCA 3PO5A 1NK9A 3T7ZA 1N32K 1S22A 1RT1A 3OS2A 2A5XA 4CZMA 3L2RA 5GAHP 4JI6K 3R3LA 3ZX2A 3CFRA 4HTUA 3VQ5A 1XQSC 5HLFA 4XH1A 1C0MA 4JKAA 4MDBA 1QVGM 2VG6A 4CBWA 2WTUA 3OYCA 4J2BA 1XNQK 3VQ8A 3C6UA 4WE1A 1S1TA 3O3HA 3IG1A 1BHLA 4CVNE 5LMNK 4IDKA 3TAMA 3AVLA 1YJWN 1TKTA 1OH6A 3ZSVA 5IWAK 4FM2A 1IKXA 1VQKN 1ILYA 2YHAA 3OYFA 1IKYA 4BRGA 2DPNA 3NGIA 1SL0A 4KI6A 4CZHA 4BC4A 2O8FB 4NCGA 4FWSA 1C1AA 4EHTA 2V7ZA 3A5NC 4H0TB 3ZSXA 2P9KA 1W7AA 3DXMB 3J8AA 1Z05A 2PYJA 4CJFA 5LJWA 3TTCA 4FWNA 2JGUA 1DEJA 1TYQB 4CJEA 4KH5A 2HBMA 4LF9K 3TI0A 2FXUA 2D0PA 3C0BA 4B9LA 3ZSZA 2P5OA 3DAWA 1WLJA 4B8CA 3VTHA 1NGFA 2P9SA 2WONA 5FDLA 1XWLA 4BDYA 1VQ5N 2E5LK 4JRPA 1S3XA 1NGCA 4EFHA 3CM5A 3PUFA 1T03A 3KZBA 3J7AP 5AQYA 4CGJA 1Q86O 3OJUA 1T6CA 3ATVA 3E1YA 1KVCA 4Y0WA 4JI0K 1HPZA 1RTHA 1XMQK 3U4LA 1ITGA 5KRTA 4CEQA 3CMEN 2ZGYA 3VESA 1QQNA 2HHUA 3AAQA 4J8FA 4KV8A 4DS4A 4DTXA 1XC3A 4I7FA 2D0CA 2IGIA 1NJZA 1NJIO 3VQDA 3JYTA 3HSTB 1B9FA 4W5RA 4CJ5A 5GAGP 2HBLA 4H4OA 3CF5L 1SQKA 1TAQA 3O9RA 4WQ5C 1YIJN 4B9NA 4BC3A 5AQSA 3RMCA 5AJ3K 3NVMA 3OTOK 2ZM6K 3VA3A 1JCEA 4CHPA 4OLBA 3S9HA 4FLWA 1X9MA 3EN9A 1NGAA 1VSDA 1YTAA 1TK0A 4DTNA 4WFBL 1O13A 2YI1A 5BR9A 4DF8A 3O3FA 3CJ7A 3PSFA 3G25A 4IZ9A 3MEDA 4RCHA 5T7BA 4AH9A 1EP4A 2VQEK 5HRSA 3DJCA 1IBKK 4BC2A 2A40A 2D1KA 2NRRA 3K9JA 5JMVA 1S9GA 4E19A 4IOCL 4AHRA 3QNOA 3UIQA 2A1RA 2PBDA 3CD6N 3VENA 3C7NB 3VF4A 3PX4A 3T3FA 4H0XB 1SL2A 4DTMA 1N8RO 3CHWA 4CJRA 5GAEP 3PY8A 1S72N 5ELZA 3GDQA 1HPMA 5AQQA 5KPTA 4B1YB 2QI2A 3CIPA 4ISFA 2QWRA 3VTIA 5FLXO 5BPLA 4CGHA 3HI0A 3BDPA 3D2EA 1ZC6A 1KAXA 3FLCO 2OZMA 3CCRN 4RTFD 2FC0A 4CJKA 2KHOA 1JLAA 1L3TA 1ATSA 3L4QA 1ASVA 4H0PA 2O8EA 5HRPA 4FJNA 2YHBA 3CJBA 3GG4A 4C8NA 1ZBIA 4H0OA 2PY5A 2YNFA 5EU7A 5HBMA 3WNEA 5CE3A 4CJUA 2HNZA 4DTRA 3FFIA 1YVNA 3QEVA 2OPQA 5HL7L 5J2MA 4WCEL 4CF0A 2QWNA 4FJ7A 3AVMA 1NK8A 4E0DA 3ZCMA 2GV9A 3A0IX 4JYAK 2RPIA 4CD3A 2HB5A 3CERA 2OPRA 4QAGA 4BWMA 4FO0A 5DMRA 4UQGA 1W2BM 2YHXA 3FZHA 4XH4A 4CK3A 4WYBA 3AVBA 4DV5K 2HMPA 3NBPA 3LP1A 3ZEUB 1OKJA 2WUSA 3LWLA 3QIPA 1JXBA 3A5LC 3BEXA 1HRHA 4DR1K 4CZLA 5EVZA 1J5EK 3QEPA 3SUOA 1BISA 1C0FA 2G8UA 3A5MC 1U4BA 4KAZA 2YKMA 3D2FB 2GWJA 4ILHA 3SAFA 4DSJA 4DV0K 2KFZA 3IAYA 4IJNA 4AHUA 4CF9A 3AVFA 1NOZA 2P9LB 1LW2A 3CJ9A 4XEIA 3ZETB 1YTUA 5GIOA 2HBJA 2G8KA 3AO5A 3OBWA 3AARA 1J6ZA 1BDGA 3M1FA 3PIOL 5ADXH 3RRHA 4JV5K 3WXIA 2JWKA 5I9EB 2ZJRL 5JS2A 1WN7A 3KLIA 4JD2A 4DR5K 1KAYA 4DU4A 3EZ5A 4FWMA 3HPGA 3IRXA 1J54A 1I39A 5HP1A 3LP0A 3SCXA 5M1OA 3TAPA 3MN7A 4CFCA 1FKPA 2CH6A 1FJGK 4I9LA 4LF4K 4E1MA 2YJFA 1H1VA 1Q9XA 4W5NA 3HL8A 5KQ8A 4DWIA 1I3AA 4G1QA 4ZTJA 4EIAA 1NJXA 3HK2A 3G4SN 4N56A 2P9NA 1R59O 4FJ9A 5AQZA 2V52B 4U7BA 1GLFO 3I8DA 1XI1A 1YUWA 2VG5A 1ZXOA 4KBOA 3L4IA 5JVGL 1UA1A 4BRHA 4KB1A 4FW1A 1ATNA 4DV1K 3JSMA 5AQPA 4KHWA 1KCFA 3E9OA 2UUBK 3WEEA 1O1WA 4AHSA 4CFDA 2ZF5O 1UWBA 1FXXA 4PL7A 1K6YA 1T8EA 1D5AA 3BP8A 4CJVA 3QINA 3TU5A 5KGXA 1NBWA 3NHGA 1X9WA 3A5OC 4M3XA 3CYMA 3E66A 3UE5A 1YXQA 1WSEA 3HJFA 2XRIA 1NGIA 3OS1A 4PQUA 1SAZA 4YOWA 3MEEA 4OGEA 3FR0A 3IFRA 3EY1A 1HQUA 4V19S 1HMVA 3LZIA 4AM6A 4KPYA 4CEOA 4YOVA 4JKGB 1NM1A 4YOTA 2E4LA 1U47A 3O5BA 4K8ZA 1IG8A 3P5JA 3EZWA 4BDZA 2HHTA 4BWJA 4CJ7A 5BPMA 4L3QA 2KQ2A 1U2VA 4IOXA 3M8SA 1RT3A 4GV6A 1G99A 2BE2A 4FLVA 1RDDA 2KLAA 4OKKA 2O8FA 1N34K 4Q0BA 4FLYA 5AQWA 4CI6A 3NF6A 3DXMA 1C1CA 2CGKA 4IO9L 4AHCA 1SL1A 2F8TA 3KK2A 4DKWA 1TYQA 2QWLA 1J53A 3SQ4A 5AQLA 2G8HA 1RT5A 3BZKA 4OGCA 3MN9A 3O1BA 3AO4A 1IKVA 1ZYQA 4WF9L 5FROA 1KLMA 4H5RA 1ATRA 3AO3A 3CG7A 4FLTA 5KI6A 3EE9A 4NXMK 2EHGA 4FL9A 5BN9A 3I56N 3D6RA 3EKSA 1BL3A 4Z4HA 3DLBA 4CHOA 1BG3A 1T7PA 3U9DA 2O8EB 3U8XA 1VSHA 3L0QA 3THWB 1DLOA 3WNFA 5FPNA 4DFPA 4M42A 3AVAA 5A2QO 5JVHL 3CCLN 3ENOA 1LAWA 5BRFA 2X78A 1N36K 4DUYK 4EAHD 2IS3A 1WBBA 3DOLA 3IUCA 2QA4N 2NRWA 3LDPA 1QS4A 4CBUA 1RFQA 2E2NA 3O9TA 3THXB 4K0KK 4A57A 3THVA 4O0JA 3VEWA 1CZAN 5BREA 2OCEA 4FWKA 4DV2K 4KH4A 3QETA 4H5VA 3NMUA 4M3RA 2PFUA 3CC4N 1VK0A 1S6QA 5C12A 3K59A 1G15A 1TL3A 4HWIA 1ZBUA 3CCVN 1Y97A 1JLGA 3S3NA 4Z4FA 5AR0A 1TUUA 3KD1E 1L3UA 1F21A 3I55N 4FJIA 1BQMA 3QMLA 4ELTA 3OW2M 3NF7A 4BE0A 1HJRA 3VQEA 4CIFA 1V4TA 3LM2A 3K5MA 4B9TA 1B9DA 3AV9A 2E2QA 3M8PA 3CPWM 2W42A 3TAQA 4JAXA 4F3OA 4CEBA 3WXLA 1K73O 3VOVA 3L6QA 4X64K 3U9ZA 1FW6A 3C7NA 3NE6A 2B4JA 1X9JA 1VSEA 4KHPK 2IOCA 2ITGA 2WOMA 2I7PA 2ASPA 1YI2N 3F2KA 1XUPO 3HM8A 5FPEA 1M1KO 3BGRA 4OPKA 2Y1IA 2NRTA 3DLKA 4BROA 3TSPA 4YDUA 3I0SA 1Y64A 1NGDA 5EOYA 3EO3A 4JI3K 3DLRA 5AQXA 3A2FA 2VGMA 4QCLA 2NRVA 4FVMA 1Q8IA 4X66K 5HOOA 2IVNA 4LY7A 1NKBA 4Z4GA 4DR7K 1VSKA 4I2QA 1BO5O 4KHUA 4YHHK 4IEEA 4OPJA 4X62K 4YNQA 3VF2A 3E9LA 2P9UB 3M6GA 3MCAB 4J2DA 3HM9A 4Z94A 3RMBA 4FLZA 3CC2N 3GE1A 4KI4A 1NGBA 1RT6A 3HBTA 3LDOA 2J4RA 2QKKA 1A5XA 4BQLA 3U6FA 4OO1J 2X6NA 1BI4B 1VSJA 1E3MA 5LJVA 4Z0UA 4H0YB 4M3YA 2DTUA 1EWRA 4BRQA 2FSNA 1B92A 3ENBA 4CD1A 4I9QA 4FW2A 4EZ9A 3SQ0A 1BQNA 1NGGA 3CQ8A 4M3WA 3CFOA 3WT0A 3CJAA 3VERA 3KD5E 3L3VA 2OA8A 4CEAA 1KFDA 4C23A 2QXLA 5ADXA 2HHWA 3D0PA 4B08A 5JLHA 1X3MA 3ZEUA 4QS9A 5GADP 3NGZA 3RMAA 2NLXA 4HUFA 2AJQA 3ZSOA 4DR6K 3AY9A 1WBDA 4PHTX 1NJWA 4CJ4A 2YHYA 1N33K 4M7YA 3OYEA 2AA4A 3NH2A 1YAGA 2R7YA 3C6AA 4K42A 4BE2A 1W9HA 4CZIA 2A6AA 3D7EO 4M3ZA 3CFPA 1IO2A 4ILGB 4JHDB 3OA9A 3D2FA 4CK1A 1U2VB 4E7KA 4WQ4C 1QSSA 5AZIB 3BY5A 4IJAA 3MCPA 3DRRA 3FFKB 4B9SA 4Y1DA 3KLGA 2P9LA 5JS1A 1C0GA 3ZETA 1ASUA 1GLBG 1KAZA 2VG7A 1JCGA 3ZT1A 3ZLJA 3LL3A 3WNHA 4F2RA 1YITN 3V81A 2DY4A 1X9SA 4FZXC 1NK4A 3ZT2A 1TV6A 2ZQBA 4LH5A 4BY9C 5M1QA 3JXUA 2YKNA 5CY4A 3HVTA 4B3RK 2FBXA 2ZD1A 3QBWA 1GLAG 2CGLA 2YNHA 3KKRA 3O4WA 4M45A 3ZX3A 3VF6A 4FXDA 4JI4K 5AQJA 4LD0A 3RR8A 2DFFA 3SMSA 1ZBFA 4FCYA 3R9PA 3DMJA 5EX5A 3DOKA 4FJ5A 4M3UA 3I0RA 1LWCA 2CGJA 2ASOA 1U49A 3B6PA 4N41A 1HNWK 4LF5K 1W0HA 3DRPA 4FZYA 2G8IA 3KWIA 1KTQA 1SKSA 4EP4A 5SZTA 1BWFO 2KTQA 4DLGA 3HRGA 1S9EA 3OYIA 3MECA 3OYKA 4JK9A 4IFYA 4BR4A 1S1UA 3V9UA 2NRXA 1V4SA 1JLQA 3LALA 2QM1A 2E1YA 4IDHA 3ZSRA 4CFBA 1ZBHA 2EWSA 3SQ2A 1KVAA 3ENHA 1QTMA 1N5YA 4C8MA 4BRLA 3C6HA 3J81O 1S5JA 4DU3A 3T1AA 3CETA 2Q0UA 4E1NA 5EXWA 2E2PA 1BA1A 1U04A 4CBXA 2HMIA 5CYMA 4K8XA 1HKBA 4B8AB 3KK1A 4LSNA 4GMJB 3AVJA 1X3NA 3ZX0A 4B3TK 2FLOA 1EO1A 1MU2A 1KLNA 3VQ4A 4JKGA 1TKZA 2BUPA 1CLQA 3HYFA 3O3GA 3KIOA 1U48A 1D9FA 1QQMA 3PX0A 4B1ZA 4NLCA 2FBYA 2NRZA 1S1WA 3MN6A 3M8QA 4W5OA 4ILJA 4MLEA 2GUPA 3LANA 5KTQA 1NMDA 4BG8A 2IVPA 3PV8A 1IBLK 3QLHA 4IEIA 4FZZA 1HNXK 3MWTA 5E84A 1BIZA 3O9UA 4AQYK 5AZJB 3LPTA 3VQCA 1SKRA 2F9WA 3LWMA 5CR4A 1NLVA 4JKBA 4B1UB 4CZKA 1CZ9A 4DTSA 3JS6A 2Q3SA 3THWA 4ID5A 4B1WB 4MLHA 3IKMA 2NUBA 5KQDA 4K25A 3OS0A 3HPOA 1RBRA 3OYBA 3ZT0A 2QEXN 4DQRA 4BRMA 4FJHA 2GWKA 4OVLA 1E4FT 3SPZA 5DK5A 3MDQA 3ZT4A 1VQMN 1YVUA 3KTQA 3THXA 1ZBSA 4MO5A 2HHQA 4BVOA 1SUQA 4CHNA 1YJ9N 5F2RA 3ULEB 2ZJPL 1VQLN 2P9IA 1D9DA 1QZ5A 3SUPA 1T3VA 3TSQA 2YV0X 2FF3B 2P1JA 4LFAK 1YF5L 2IDOA 3H6EA 3L3UA 5AQRA 5J2NA 4DV3K 1C0UA 3VEYA 2V51B 2PZSA 3QFUA 3J80O 4CJTA 4JRQA 4DLEA 3VQBA 3WXJA 2Q31A 1YJNN 1KXPA 2D0BA 4LF7K 3ZSYA 2I5JA 1UAXA 4JI8K 4FJGA 5M1KA 4DMNA 3ALYA 5AQKA 4AHTA 4JN4A 3AO2A 4JKEA 3PIPL 5M1FA 4FLUA 5AQMA 2F4VK 5AFUH 5M1NA 2V7YA 1REVA 2IC3A 3SUNA 4DFMA 3TTDA 3MN5A 1SS6A 3FZLA 1Z26A 4CFAA 5C2DA 3EYZA 5LMUK 3CCMN 1HYZA 1RT2A 1TAUA 3L2UA 2QXFA 4Z4EA 3CM6A 4FLXA 4FJXA 2Q97A 4E1JA 3FGUA 3TAEA 3VPZA 3OYMA 1T6DA 5EY4A 3K2PA 5FPMA 1RBTA 3NVKA 4GV9A 3CCEN 3HOSA 1LWFA 2ETJA 2HHXA 1M90O 4E89A 4PA1A 1WSGA 4JLHA 4H0VB 4EP5A 2NRHA 4ELUA 5FRMA 4B9VA 1IJJA 3QNNA 1RTDA 3TABA 4BRIA 1LOTB 4JKDA 3QDKA 2P9UA 1WAJA 2DFEA 3VEXA 3LZJA 3U3YA 4GVEA 1HUXA 1BI4A 1QHTA 3P38A 1MWMA 2E1ZA 3E9PA 4E7LA 1Q81O 1P8ZA 3KK3A 4CJLA 1RDBA 3J7YP 1K8AO 2O4GA 4CZJA 4BC5A 4CZEA 3CXCM 4YDUC 1LAVA 3WUHA 3EE8A 4BR2A 5J2QA 3AGRA 3JAMO 2IVOA 4BE1A 1WSIA
chains in the Genus database with same CATH topology
3K5OA 3M8PA 3QEIA 2W42A 3TAQA 1D8YA 4CGDA 1KRPA 4F3OA 4CEBA 1UOCA 3ISNC 3TI0A 2XHBA 4KHUA 3L2QA 2VWJA 5C24A 3G10A 1TVRA 4B9LA 3ZSZA 2P5OA 3ZSQA 4B8CA 1WLJA 3QERA 1RTIA 5E41A 1HYSA 3NE6A 2FBTA 2B4JA 2WONA 5FDLA 1VSEA 1XWLA 4BDYA 2Z1HA 1LV5A 2IOCA 4JRPA 3P1GA 2ITGA 2WOMA 2Z1JA 3VQ7A 3K5LA 4FM0A 1X1PA 3CM5A 1IG9A 2HHSA 3PUFA 2RN2A 3MAQA 1T03A 1L5UA 2G8FA 4CGJA 4PQUA 3BGRA 4OPKA 3OJUA 2Y1IA 3DLKA 4LSLA 3NCIA 4CIEA 3I0SA 3V6DA 3AA5X 4E7JA 1KVCA 1KSPA 1HPZA 1TGOA 3KLFA 1U45A 3RWUA 1RTHA 1CZBA 1ITGA 1RBSA 3DLRA 3A2FA 5KRTA 4TSXA 4CEQA 4QCLA 4H8KA 4FVMA 1RBUA 1Q8IA 3ITHA 4HCBA 2HHUA 4RW4A 4CHQA 4ZTFA 4LY7A 3KJVA 3OYDA 3TANA 2E6MA 1ZBLA 1IKWA 1NKBA 4Z4GA 3RRGA 4KV8A 3RMDA 1VSKA 4DS4A 4DTXA 4I2QA 4I7FA 4GW6A 3L2WA 4O55A 2D0CA 2IGIA 3O4QA 4OPJA 3OY9A 1NJZA 3VQDA 3JYTA 2KFNA 4C8KA 3HSTB 1B9FA 1J5OA 4YNQA 3QEXA 4W5RA 3VQQA 4IG0A 4CJ5A 4F8RA 4FJKA 1L3VA 4HVJA 4J2DA 1Q9YA 4H4OA 1QSYA 3HM9A 3RMBA 1TAQA 4FLZA 4KI4A 1C0TA 1RT6A 4B9MA 4DSIA 3HPHA 4B9NA 1RNHA 2QKKA 1A5XA 1QQCA 3U6FA 3SUQA 3RMCA 1JLEA 4EZ6A 4KHQA 2X6NA 3VA3A 1BI4B 1VSJA 3DRSA 3MXIA 4CHPA 1XHXA 4OLBA 2EX3A 4CJQA 1EETA 2HNDA 3S9HA 4FLWA 4Z0UA 1X9MA 1VSDA 4M3YA 2DTUA 4DSEA 3AVIA 4DU1A 1A5VA 1YTAA 4CEZA 1B92A 1TK0A 3V1QA 4DTNA 4DSFA 4FYDA 4I9QA 4FW2A 4EZ9A 4CF2A 3SQ0A 1BQNA 3NAEA 4DF8A 1NK0A 3CQ8A 4M3WA 3O3FA 1KVBA 3CFOA 3V1OA 3V1RA 1GOBA 1EKEA 3MEDA 5T7BA 4YFUA 4AH9A 3KD5E 1EP4A 3L3VA 2OA8A 2ATQA 3KKSA 4CEAA 4IKFA 4NCBA 3SQ1A 5HRSA 1KFDA 4ICLA 2HHWA 3D0PA 1NK6A 4B08A 3RMAA 1S9GA 1YT3A 4E19A 3NGZA 4AHRA 3QNOA 4HUFA 4Z4CA 2AJQA 3ZSOA 3UIQA 4CJSA 2A1RA 4H4MA 3SI6A 1NJWA 4CJ4A 3T3FA 3PX4A 2JLEA 4Y1CA 1SL2A 3OYEA 3OYLA 4DTMA 5HRNA 3NH2A 2R7YA 4OKEA 4CJRA 4BE2A 1W9HA 3S3OA 3PY8A 3AVCA 4M3ZA 3CFPA 1IO2A 1HYVA 4CK1A 2ZE2A 3OYJA 4HUEA 4E7KA 3HXMA 1NK7A 1TK8A 1QSSA 4PUOA 3ASMA 1WAFA 4CHZA 3DRRA 1ASWA 4B9SA 3MXMA 4Y1DA 4KHYA 1GOAA 3KLEA 3KLGA 4CGHA 5KRSA 3BDPA 4HUGA 5JS1A 1XC9A 3RR7A 1ASUA 3TWHA 3RTVA 2OZMA 4CJKA 2FC0A 2VG7A 1JLAA 3ZT1A 1L3TA 4PWDA 4F2RA 3WNHA 3AO1A 4KHSA 4CK2A 3AVKA 1LW0A 1VSIA 3V81A 2DY4A 1ASVA 1X9SA 4FZXC 4CGIA 1NK4A 4F2SA 3ZT2A 1TV6A 2ZQBA 4CGFA 5HRPA 4HCCA 1TKDA 4FJNA 4M3TA 2YHBA 4LH5A 4GVMA 1NOYA 4O0IA 4C8NA 2XY7A 5HROA 3ULDA 1ZBIA 3G0ZA 2PY5A 2YKNA 2YNFA 3AVHA 3VQAA 4O5BA 5CY4A 5EU7A 5HBMA 3WNEA 4DG1A 4CCHA 2BDPA 2G8WA 1TK5A 1RDAA 3HVTA 4CJUA 2HNZA 3NGYA 4KREA 2FBXA 2ZD1A 1JLBA 4DTRA 2YNHA 3KKRA 3TR8A 3HO1A 3V9WA 4M45A 3FFIA 4DS5A 3B6OA 4FXDA 4CEEA 3VA0A 4LD0A 4ZHRA 3LP2A 1XHZA 3RR8A 2DFFA 1VRTA 3QEVA 4DFKA 2OPQA 1TL1A 1ZBFA 2VWKA 4CHYA 5J2MA 4FK0A 4BDPA 4FCYA 4CF0A 4FJ7A 3V9XA 2GUIA 2HVHA 3DMJA 3LPUA 3AVMA 1NK8A 1N6QA 4E0DA 3DOKA 3ZCMA 4FJ5A 2GV9A 1LWEA 1TKXA 1LWCA 3I0RA 3SJJA 2RPIA 4FJJA 4M3UA 2HB5A 2X74A 4DTPA 2GBZA 2OPRA 4XIUA 1U49A 3B6PA 3HP9A 4QAGA 4BWMA 1NK5A 4N41A 1W0HA 3DRPA 2DFHA 4FZYA 2G8IA 5DMRA 2F8TA 1KTQA 4UQGA 1S1XA 1SKSA 4EP4A 4CK3A 5SZTA 3AVBA 3NBPA 3D45A 1JL1A 2KTQA 4DLGA 3LP1A 3PO4A 4IFVA 1S9EA 3OYIA 3MECA 3OYKA 3LWLA 2Z1GA 4J2EA 4FJMA 3SYZA 3AVNA 3QIPA 4B9UA 1JXBA 2BGGA 4IFYA 1S1UA 3V9UA 3VQ9A 1HRHA 1WNSA 1JLQA 3OJSA 3LALA 3WNGA 3QEPA 4ELVA 3SUOA 3OYGA 5D3GA 1BISA 1VSLA 3ZSRA 2KZMA 4CFBA 5CZ1A 5CZ2A 4DTUA 1ZBHA 3SQ2A 2G8UA 1KVAA 4CECA 3L2VA 1U4BA 1RILA 3DI6A 5K14A 3OYNA 3KLHA 3S3MA 1QTMA 4DSLA 2YKMA 4C8MA 3NDKA 1N5YA 4DSJA 2KFZA 1CXQA 1S5JA 3NH0A 3IAYA 4E7HA 1RT4A 5J1EA 4W5TA 4DU3A 1T05A 3T1AA 4AHUA 4CJ3A 4CF9A 3TARA 3AVFA 1NOZA 4KTQA 2RKIA 4E1NA 3SNNA 1U04A 1LW2A 3LAKA 4I2PA 2HMIA 1CXUA 4FJLA 1YTUA 5CYMA 2P5GA 2YNIA 2B5JA 4K8XA 2YNGA 3AO5A 4B8AB 2G8KA 4F4KA 2HW3A 5HRRA 3KK1A 4LSNA 4GMJB 3AVJA 4KO0A 4AILC 2XY6A 2LSNA 4E3SA 4CJWA 1WSHA 1MU2A 4KAZA 2OZSA 3RRHA 3E01A 1VSMA 5JS2A 1KLNA 3VQ4A 1WN7A 3KLIA 4FK4A 1TKZA 3SZ2A 1CLQA 4KTZA 4N5SA 4NYNA 3DLEA 3HYFA 4DU4A 3O3GA 1C1BA 4CF8A 3KIOA 3EZ5A 1U48A 2XO7A 3T19A 1D9FA 4CGGA 3HPGA 3IRXA 1J54A 2QKBA 3PX0A 1I39A 2HVIA 5HP1A 3LP0A 3SCXA 1BCOA 3TAPA 1S6PA 4CEDA 4QOZB 4CFCA 5C25A 1FKPA 2FBYA 1S1WA 4KHNA 4NYFA 4CF1A 3M8QA 4W5OA 2O4IA 3NH1A 3V9ZA 4I9LA 4DQPA 4LH4A 2BANA 4E1MA 3LANA 5KTQA 3O4NA 3PV8A 1Q9XA 2E6LA 2B6AA 2XY5A 3HL8A 2PYLA 2KZZA 3QLHA 4W5NA 4DWIA 1I3AA 2IAJA 4G1QA 4ZTJA 3DM2A 3VQ6A 1NJXA 4C8OA 3HK2A 2HNYA 4FZZA 4N56A 3AA2A 4DQIA 1GOCA 3MXJA 3M8RA 3U3GA 4HHTA 1BIZA 4FJ9A 4IBNA 1EX4A 4Z4IA 3LPTA 3I8DA 1XI1A 5FRNA 1DTTA 1JL2A 3VQCA 2VG5A 2D5RA 4DFJA 3PX6A 1SKRA 2P51A 4FK2A 4B3OA 2OPSA 1UA1A 4KB1A 2OYQA 1JXEA 3LWMA 4FW1A 3SV3A 3H08A 1EXQA 3JSMA 4KHWA 1CZ9A 1KCFA 3L8BA 4KFBA 4CFDA 1O1WA 4AHSA 4DTSA 1VRUA 1SV5A 2Q3SA 4ID5A 1NKEA 1UWBA 2F96A 1FXXA 3K58A 1K6YA 3OYHA 4C8LA 1T8EA 1D5AA 4FJ8A 2NUBA 4CJVA 3OS0A 1JLCA 1S1VA 3QINA 1QSLA 3HPOA 3QIOA 5KGXA 1RBRA 3OYBA 3ZT0A 3LAMA 3NHGA 4CERA 4KTWA 4DQRA 3QO9A 1X9WA 4M3XA 2KW4A 1A5WA 4AHVA 3CYMA 4O44A 4FJHA 3OVNA 4OVLA 2F8SA 5KGWA 1RT7A 4RW7A 1WSEA 3SPZA 3DLHA 4KB0A 4CE9A 5SWMA 5DK5A 3HJFA 3P83D 3ZT4A 2XRIA 4DTJA 3OS1A 1YVUA 3NFAA 1IH7A 3NF9A 4IG3A 4M41A 1BIUA 3MEEA 5J2PA 3V4IA 4OGEA 2HHQA 3EY1A 4DSKA 3V9SA 4RW6A 1HQUA 1HMVA 1HQEA 1SUQA 4CHNA 3LZIA 4KPYA 5CYQA 3AA4A 4MFBA 4CEOA 2G8VA 1D9DA 4CJPA 3SUPA 1NJYA 4OKJA 2E4LA 1U47A 4OJRA 2YV0X 1KFSA 4K8ZA 2P1JA 4NCAA 3P5JA 1RBVA 3DYAA 2IDOA 3L3UA 5J2NA 4BDZA 2Y1JA 1UA0A 4BWJA 2HHTA 1C0UA 2XY8A 2KQ2A 3M8SA 1RT3A 4CEFA 1FK9A 2D0AA 2BE2A 1RDDA 4JS5A 4FLVA 4DTOA 2PZSA 2QK9A 1BGXT 4CJTA 3HP6A 4JRQA 4OKKA 4W5QA 4DLEA 2RF2A 1SKWA 3K5NA 4J2AA 2A1SA 4Q0BA 3VQBA 4FLYA 4F3TA 3NF6A 3LP3A 4RW9A 2D0BA 2FBVA 3HT3A 1FKOA 3ZSYA 1C1CA 3C94A 2I5JA 4BACA 3ZT3A 4AHCA 1UAXA 1Z25A 3QESA 4FJGA 4DMNA 1SL1A 3F73A 3KK2A 4O4GA 3ALYA 3SQ4A 1J53A 4AHTA 1JKHA 2OPPA 5I3UA 1L3SA 3AO2A 2G8HA 3DLGA 1RT5A 3HVRA 1HNVA 4JS4A 4OGCA 4FLUA 3AO4A 1IKVA 1ZYQA 2HHVA 5FROA 1KLMA 1REVA 1RDCA 3AO3A 2IC3A 3CG7A 3MEGA 3VQPA 3OYAA 4FLTA 4RG8A 4DFMA 3SUNA 5KI6A 4DF4A 3QEWA 2EHGA 3NF8A 4OLAA 1Z26A 4Z4HA 1BL3A 4E7IA 3DLBA 4CHOA 1T7PA 4R5PA 3VN5A 4FM1A 1C6VA 4CFAA 3KTQA 3EYZA 1VSHA 3AA3A 3TAGA 1DLOA 3WNFA 4PY5A 3C6TA 3SPYA 1HYZA 4DFPA 1JLFA 1RT2A 3AVAA 4M42A 1TAUA 3ZSWA 3L2UA 2QXFA 1NKCA 4Z4EA 1LAWA 4KRFA 3CM6A 4FLXA 1VSFA 3PO5A 4FJXA 3F9KA 1NK9A 1J9AA 2X78A 3IS9A 1RT1A 2IS3A 3TAEA 3OS2A 3OYMA 3L2RA 3K2PA 3C95A 3DOLA 4MQ3A 1RBTA 3K57A 4HTUA 2Z1IA 3CFRA 1QS4A 2X6SA 3VQ5A 4ID1A 5HLFA 1C0MA 1LWFA 2ETJA 2VG6A 2HHXA 3AVGA 4E89A 1RTJA 4PA1A 1WSGA 4JLHA 4Q5VA 4EP5A 3THVA 4O0JA 3OYCA 4ELUA 5FRMA 4J2BA 4B9VA 3QNNA 1RTDA 3VQ8A 3C6UA 4WE1A 3QETA 1S1TA 3TABA 4KKOA 4CIGA 3O3HA 3IG1A 1BHLA 1QE1A 1WAJA 4M3RA 2DFEA 4IDKA 3TAMA 3AVLA 1VK0A 1S6QA 4N47A 1TKTA 5C42A 4RW8A 3ZSVA 4DQQA 4FM2A 1IKXA 3LZJA 3U3YA 5I42A 3K59A 1BI4A 1QHTA 2YHAA 1G15A 3OYFA 1RCHA 1TL3A 1IKYA 1ZBUA 3NGIA 4E7LA 1SL0A 4KI6A 1Y97A 1R0AA 1JLGA 3S3NA 4Z4FA 4NCGA 3SV4A 1C1AA 3TAFA 1L3UA 1F21A 3KD1E 3KK3A 4CJLA 4FJIA 1DTQA 1RDBA 1BQMA 2O4GA 3ZSXA 4ELTA 3NF7A 4BE1A 4BE0A 1HJRA 1WSJA 4L8RB 3VQEA 1HNIA 1WSFA 4CESA 1LAVA 4CIFA 3LDSA 2PYJA 4CJFA 4N76A 3K5MA 5J2QA 4B9TA 1B9DA 1BCMA 2JGUA 3AV9A 4DQSA 4CJEA 1WSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K5O A;  3M8P A;  3QEI A;  2W42 A;  3TAQ A;  1D8Y A;  4CGD A;  1KRP A;  4F3O A;  4CEB A;  1UOC A;  3ISN C;  3TI0 A;  2XHB A;  4KHU A;  3L2Q A;  2VWJ A;  5C24 A;  3G10 A;  1TVR A;  4B9L A;  3ZSZ A;  2P5O A;  3ZSQ A;  4B8C A;  1WLJ A;  3QER A;  1RTI A;  5E41 A;  1HYS A;  3NE6 A;  2FBT A;  2B4J A;  2WON A;  5FDL A;  1VSE A;  1XWL A;  4BDY A;  2Z1H A;  1LV5 A;  2IOC A;  4JRP A;  3P1G A;  2ITG A;  2WOM A;  2Z1J A;  3VQ7 A;  3K5L A;  4FM0 A;  1X1P A;  3CM5 A;  1IG9 A;  2HHS A;  3PUF A;  2RN2 A;  3MAQ A;  1T03 A;  1L5U A;  2G8F A;  4CGJ A;  4PQU A;  3BGR A;  4OPK A;  3OJU A;  2Y1I A;  3DLK A;  4LSL A;  3NCI A;  4CIE A;  3I0S A;  3V6D A;  3AA5 X;  4E7J A;  1KVC A;  1KSP A;  1HPZ A;  1TGO A;  3KLF A;  1U45 A;  3RWU A;  1RTH A;  1CZB A;  1ITG A;  1RBS A;  3DLR A;  3A2F A;  5KRT A;  4TSX A;  4CEQ A;  4QCL A;  4H8K A;  4FVM A;  1RBU A;  1Q8I A;  3ITH A;  4HCB A;  2HHU A;  4RW4 A;  4CHQ A;  4ZTF A;  4LY7 A;  3KJV A;  3OYD A;  3TAN A;  2E6M A;  1ZBL A;  1IKW A;  1NKB A;  4Z4G A;  3RRG A;  4KV8 A;  3RMD A;  1VSK A;  4DS4 A;  4DTX A;  4I2Q A;  4I7F A;  4GW6 A;  3L2W A;  4O55 A;  2D0C A;  2IGI A;  3O4Q A;  4OPJ A;  3OY9 A;  1NJZ A;  3VQD A;  3JYT A;  2KFN A;  4C8K A;  3HST B;  1B9F A;  1J5O A;  4YNQ A;  3QEX A;  4W5R A;  3VQQ A;  4IG0 A;  4CJ5 A;  4F8R A;  4FJK A;  1L3V A;  4HVJ A;  4J2D A;  1Q9Y A;  4H4O A;  1QSY A;  3HM9 A;  3RMB A;  1TAQ A;  4FLZ A;  4KI4 A;  1C0T A;  1RT6 A;  4B9M A;  4DSI A;  3HPH A;  4B9N A;  1RNH A;  2QKK A;  1A5X A;  1QQC A;  3U6F A;  3SUQ A;  3RMC A;  1JLE A;  4EZ6 A;  4KHQ A;  2X6N A;  3VA3 A;  1BI4 B;  1VSJ A;  3DRS A;  3MXI A;  4CHP A;  1XHX A;  4OLB A;  2EX3 A;  4CJQ A;  1EET A;  2HND A;  3S9H A;  4FLW A;  4Z0U A;  1X9M A;  1VSD A;  4M3Y A;  2DTU A;  4DSE A;  3AVI A;  4DU1 A;  1A5V A;  1YTA A;  4CEZ A;  1B92 A;  1TK0 A;  3V1Q A;  4DTN A;  4DSF A;  4FYD A;  4I9Q A;  4FW2 A;  4EZ9 A;  4CF2 A;  3SQ0 A;  1BQN A;  3NAE A;  4DF8 A;  1NK0 A;  3CQ8 A;  4M3W A;  3O3F A;  1KVB A;  3CFO A;  3V1O A;  3V1R A;  1GOB A;  1EKE A;  3MED A;  5T7B A;  4YFU A;  4AH9 A;  3KD5 E;  1EP4 A;  3L3V A;  2OA8 A;  2ATQ A;  3KKS A;  4CEA A;  4IKF A;  4NCB A;  3SQ1 A;  5HRS A;  1KFD A;  4ICL A;  2HHW A;  3D0P A;  1NK6 A;  4B08 A;  3RMA A;  1S9G A;  1YT3 A;  4E19 A;  3NGZ A;  4AHR A;  3QNO A;  4HUF A;  4Z4C A;  2AJQ A;  3ZSO A;  3UIQ A;  4CJS A;  2A1R A;  4H4M A;  3SI6 A;  1NJW A;  4CJ4 A;  3T3F A;  3PX4 A;  2JLE A;  4Y1C A;  1SL2 A;  3OYE A;  3OYL A;  4DTM A;  5HRN A;  3NH2 A;  2R7Y A;  4OKE A;  4CJR A;  4BE2 A;  1W9H A;  3S3O A;  3PY8 A;  3AVC A;  4M3Z A;  3CFP A;  1IO2 A;  1HYV A;  4CK1 A;  2ZE2 A;  3OYJ A;  4HUE A;  4E7K A;  3HXM A;  1NK7 A;  1TK8 A;  1QSS A;  4PUO A;  3ASM A;  1WAF A;  4CHZ A;  3DRR A;  1ASW A;  4B9S A;  3MXM A;  4Y1D A;  4KHY A;  1GOA A;  3KLE A;  3KLG A;  4CGH A;  5KRS A;  3BDP A;  4HUG A;  5JS1 A;  1XC9 A;  3RR7 A;  1ASU A;  3TWH A;  3RTV A;  2OZM A;  4CJK A;  2FC0 A;  2VG7 A;  1JLA A;  3ZT1 A;  1L3T A;  4PWD A;  4F2R A;  3WNH A;  3AO1 A;  4KHS A;  4CK2 A;  3AVK A;  1LW0 A;  1VSI A;  3V81 A;  2DY4 A;  1ASV A;  1X9S A;  4FZX C;  4CGI A;  1NK4 A;  4F2S A;  3ZT2 A;  1TV6 A;  2ZQB A;  4CGF A;  5HRP A;  4HCC A;  1TKD A;  4FJN A;  4M3T A;  2YHB A;  4LH5 A;  4GVM A;  1NOY A;  4O0I A;  4C8N A;  2XY7 A;  5HRO A;  3ULD A;  1ZBI A;  3G0Z A;  2PY5 A;  2YKN A;  2YNF A;  3AVH A;  3VQA A;  4O5B A;  5CY4 A;  5EU7 A;  5HBM A;  3WNE A;  4DG1 A;  4CCH A;  2BDP A;  2G8W A;  1TK5 A;  1RDA A;  3HVT A;  4CJU A;  2HNZ A;  3NGY A;  4KRE A;  2FBX A;  2ZD1 A;  1JLB A;  4DTR A;  2YNH A;  3KKR A;  3TR8 A;  3HO1 A;  3V9W A;  4M45 A;  3FFI A;  4DS5 A;  3B6O A;  4FXD A;  4CEE A;  3VA0 A;  4LD0 A;  4ZHR A;  3LP2 A;  1XHZ A;  3RR8 A;  2DFF A;  1VRT A;  3QEV A;  4DFK A;  2OPQ A;  1TL1 A;  1ZBF A;  2VWK A;  4CHY A;  5J2M A;  4FK0 A;  4BDP A;  4FCY A;  4CF0 A;  4FJ7 A;  3V9X A;  2GUI A;  2HVH A;  3DMJ A;  3LPU A;  3AVM A;  1NK8 A;  1N6Q A;  4E0D A;  3DOK A;  3ZCM A;  4FJ5 A;  2GV9 A;  1LWE A;  1TKX A;  1LWC A;  3I0R A;  3SJJ A;  2RPI A;  4FJJ A;  4M3U A;  2HB5 A;  2X74 A;  4DTP A;  2GBZ A;  2OPR A;  4XIU A;  1U49 A;  3B6P A;  3HP9 A;  4QAG A;  4BWM A;  1NK5 A;  4N41 A;  1W0H A;  3DRP A;  2DFH A;  4FZY A;  2G8I A;  5DMR A;  2F8T A;  1KTQ A;  4UQG A;  1S1X A;  1SKS A;  4EP4 A;  4CK3 A;  5SZT A;  3AVB A;  3NBP A;  3D45 A;  1JL1 A;  2KTQ A;  4DLG A;  3LP1 A;  3PO4 A;  4IFV A;  1S9E A;  3OYI A;  3MEC A;  3OYK A;  3LWL A;  2Z1G A;  4J2E A;  4FJM A;  3SYZ A;  3AVN A;  3QIP A;  4B9U A;  1JXB A;  2BGG A;  4IFY A;  1S1U A;  3V9U A;  3VQ9 A;  1HRH A;  1WNS A;  1JLQ A;  3OJS A;  3LAL A;  3WNG A;  3QEP A;  4ELV A;  3SUO A;  3OYG A;  5D3G A;  1BIS A;  1VSL A;  3ZSR A;  2KZM A;  4CFB A;  5CZ1 A;  5CZ2 A;  4DTU A;  1ZBH A;  3SQ2 A;  2G8U A;  1KVA A;  4CEC A;  3L2V A;  1U4B A;  1RIL A;  3DI6 A;  5K14 A;  3OYN A;  3KLH A;  3S3M A;  1QTM A;  4DSL A;  2YKM A;  4C8M A;  3NDK A;  1N5Y A;  4DSJ A;  2KFZ A;  1CXQ A;  1S5J A;  3NH0 A;  3IAY A;  4E7H A;  1RT4 A;  5J1E A;  4W5T A;  4DU3 A;  1T05 A;  3T1A A;  4AHU A;  4CJ3 A;  4CF9 A;  3TAR A;  3AVF A;  1NOZ A;  4KTQ A;  2RKI A;  4E1N A;  3SNN A;  1U04 A;  1LW2 A;  3LAK A;  4I2P A;  2HMI A;  1CXU A;  4FJL A;  1YTU A;  5CYM A;  2P5G A;  2YNI A;  2B5J A;  4K8X A;  2YNG A;  3AO5 A;  4B8A B;  2G8K A;  4F4K A;  2HW3 A;  5HRR A;  3KK1 A;  4LSN A;  4GMJ B;  3AVJ A;  4KO0 A;  4AIL C;  2XY6 A;  2LSN A;  4E3S A;  4CJW A;  1WSH A;  1MU2 A;  4KAZ A;  2OZS A;  3RRH A;  3E01 A;  1VSM A;  5JS2 A;  1KLN A;  3VQ4 A;  1WN7 A;  3KLI A;  4FK4 A;  1TKZ A;  3SZ2 A;  1CLQ A;  4KTZ A;  4N5S A;  4NYN A;  3DLE A;  3HYF A;  4DU4 A;  3O3G A;  1C1B A;  4CF8 A;  3KIO A;  3EZ5 A;  1U48 A;  2XO7 A;  3T19 A;  1D9F A;  4CGG A;  3HPG A;  3IRX A;  1J54 A;  2QKB A;  3PX0 A;  1I39 A;  2HVI A;  5HP1 A;  3LP0 A;  3SCX A;  1BCO A;  3TAP A;  1S6P A;  4CED A;  4QOZ B;  4CFC A;  5C25 A;  1FKP A;  2FBY A;  1S1W A;  4KHN A;  4NYF A;  4CF1 A;  3M8Q A;  4W5O A;  2O4I A;  3NH1 A;  3V9Z A;  4I9L A;  4DQP A;  4LH4 A;  2BAN A;  4E1M A;  3LAN A;  5KTQ A;  3O4N A;  3PV8 A;  1Q9X A;  2E6L A;  2B6A A;  2XY5 A;  3HL8 A;  2PYL A;  2KZZ A;  3QLH A;  4W5N A;  4DWI A;  1I3A A;  2IAJ A;  4G1Q A;  4ZTJ A;  3DM2 A;  3VQ6 A;  1NJX A;  4C8O A;  3HK2 A;  2HNY A;  4FZZ A;  4N56 A;  3AA2 A;  4DQI A;  1GOC A;  3MXJ A;  3M8R A;  3U3G A;  4HHT A;  1BIZ A;  4FJ9 A;  4IBN A;  1EX4 A;  4Z4I A;  3LPT A;  3I8D A;  1XI1 A;  5FRN A;  1DTT A;  1JL2 A;  3VQC A;  2VG5 A;  2D5R A;  4DFJ A;  3PX6 A;  1SKR A;  2P51 A;  4FK2 A;  4B3O A;  2OPS A;  1UA1 A;  4KB1 A;  2OYQ A;  1JXE A;  3LWM A;  4FW1 A;  3SV3 A;  3H08 A;  1EXQ A;  3JSM A;  4KHW A;  1CZ9 A;  1KCF A;  3L8B A;  4KFB A;  4CFD A;  1O1W A;  4AHS A;  4DTS A;  1VRU A;  1SV5 A;  2Q3S A;  4ID5 A;  1NKE A;  1UWB A;  2F96 A;  1FXX A;  3K58 A;  1K6Y A;  3OYH A;  4C8L A;  1T8E A;  1D5A A;  4FJ8 A;  2NUB A;  4CJV A;  3OS0 A;  1JLC A;  1S1V A;  3QIN A;  1QSL A;  3HPO A;  3QIO A;  5KGX A;  1RBR A;  3OYB A;  3ZT0 A;  3LAM A;  3NHG A;  4CER A;  4KTW A;  4DQR A;  3QO9 A;  1X9W A;  4M3X A;  2KW4 A;  1A5W A;  4AHV A;  3CYM A;  4O44 A;  4FJH A;  3OVN A;  4OVL A;  2F8S A;  5KGW A;  1RT7 A;  4RW7 A;  1WSE A;  3SPZ A;  3DLH A;  4KB0 A;  4CE9 A;  5SWM A;  5DK5 A;  3HJF A;  3P83 D;  3ZT4 A;  2XRI A;  4DTJ A;  3OS1 A;  1YVU A;  3NFA A;  1IH7 A;  3NF9 A;  4IG3 A;  4M41 A;  1BIU A;  3MEE A;  5J2P A;  3V4I A;  4OGE A;  2HHQ A;  3EY1 A;  4DSK A;  3V9S A;  4RW6 A;  1HQU A;  1HMV A;  1HQE A;  1SUQ A;  4CHN A;  3LZI A;  4KPY A;  5CYQ A;  3AA4 A;  4MFB A;  4CEO A;  2G8V A;  1D9D A;  4CJP A;  3SUP A;  1NJY A;  4OKJ A;  2E4L A;  1U47 A;  4OJR A;  2YV0 X;  1KFS A;  4K8Z A;  2P1J A;  4NCA A;  3P5J A;  1RBV A;  3DYA A;  2IDO A;  3L3U A;  5J2N A;  4BDZ A;  2Y1J A;  1UA0 A;  4BWJ A;  2HHT A;  1C0U A;  2XY8 A;  2KQ2 A;  3M8S A;  1RT3 A;  4CEF A;  1FK9 A;  2D0A A;  2BE2 A;  1RDD A;  4JS5 A;  4FLV A;  4DTO A;  2PZS A;  2QK9 A;  1BGX T;  4CJT A;  3HP6 A;  4JRQ A;  4OKK A;  4W5Q A;  4DLE A;  2RF2 A;  1SKW A;  3K5N A;  4J2A A;  2A1S A;  4Q0B A;  3VQB A;  4FLY A;  4F3T A;  3NF6 A;  3LP3 A;  4RW9 A;  2D0B A;  2FBV A;  3HT3 A;  1FKO A;  3ZSY A;  1C1C A;  3C94 A;  2I5J A;  4BAC A;  3ZT3 A;  4AHC A;  1UAX A;  1Z25 A;  3QES A;  4FJG A;  4DMN A;  1SL1 A;  3F73 A;  3KK2 A;  4O4G A;  3ALY A;  3SQ4 A;  1J53 A;  4AHT A;  1JKH A;  2OPP A;  5I3U A;  1L3S A;  3AO2 A;  2G8H A;  3DLG A;  1RT5 A;  3HVR A;  1HNV A;  4JS4 A;  4OGC A;  4FLU A;  3AO4 A;  1IKV A;  1ZYQ A;  2HHV A;  5FRO A;  1KLM A;  1REV A;  1RDC A;  3AO3 A;  2IC3 A;  3CG7 A;  3MEG A;  3VQP A;  3OYA A;  4FLT A;  4RG8 A;  4DFM A;  3SUN A;  5KI6 A;  4DF4 A;  3QEW A;  2EHG A;  3NF8 A;  4OLA A;  1Z26 A;  4Z4H A;  1BL3 A;  4E7I A;  3DLB A;  4CHO A;  1T7P A;  4R5P A;  3VN5 A;  4FM1 A;  1C6V A;  4CFA A;  3KTQ A;  3EYZ A;  1VSH A;  3AA3 A;  3TAG A;  1DLO A;  3WNF A;  4PY5 A;  3C6T A;  3SPY A;  1HYZ A;  4DFP A;  1JLF A;  1RT2 A;  3AVA A;  4M42 A;  1TAU A;  3ZSW A;  3L2U A;  2QXF A;  1NKC A;  4Z4E A;  1LAW A;  4KRF A;  3CM6 A;  4FLX A;  1VSF A;  3PO5 A;  4FJX A;  3F9K A;  1NK9 A;  1J9A A;  2X78 A;  3IS9 A;  1RT1 A;  2IS3 A;  3TAE A;  3OS2 A;  3OYM A;  3L2R A;  3K2P A;  3C95 A;  3DOL A;  4MQ3 A;  1RBT A;  3K57 A;  4HTU A;  2Z1I A;  3CFR A;  1QS4 A;  2X6S A;  3VQ5 A;  4ID1 A;  5HLF A;  1C0M A;  1LWF A;  2ETJ A;  2VG6 A;  2HHX A;  3AVG A;  4E89 A;  1RTJ A;  4PA1 A;  1WSG A;  4JLH A;  4Q5V A;  4EP5 A;  3THV A;  4O0J A;  3OYC A;  4ELU A;  5FRM A;  4J2B A;  4B9V A;  3QNN A;  1RTD A;  3VQ8 A;  3C6U A;  4WE1 A;  3QET A;  1S1T A;  3TAB A;  4KKO A;  4CIG A;  3O3H A;  3IG1 A;  1BHL A;  1QE1 A;  1WAJ A;  4M3R A;  2DFE A;  4IDK A;  3TAM A;  3AVL A;  1VK0 A;  1S6Q A;  4N47 A;  1TKT A;  5C42 A;  4RW8 A;  3ZSV A;  4DQQ A;  4FM2 A;  1IKX A;  3LZJ A;  3U3Y A;  5I42 A;  3K59 A;  1BI4 A;  1QHT A;  2YHA A;  1G15 A;  3OYF A;  1RCH A;  1TL3 A;  1IKY A;  1ZBU A;  3NGI A;  4E7L A;  1SL0 A;  4KI6 A;  1Y97 A;  1R0A A;  1JLG A;  3S3N A;  4Z4F A;  4NCG A;  3SV4 A;  1C1A A;  3TAF A;  1L3U A;  1F21 A;  3KD1 E;  3KK3 A;  4CJL A;  4FJI A;  1DTQ A;  1RDB A;  1BQM A;  2O4G A;  3ZSX A;  4ELT A;  3NF7 A;  4BE1 A;  4BE0 A;  1HJR A;  1WSJ A;  4L8R B;  3VQE A;  1HNI A;  1WSF A;  4CES A;  1LAV A;  4CIF A;  3LDS A;  2PYJ A;  4CJF A;  4N76 A;  3K5M A;  5J2Q A;  4B9T A;  1B9D A;  1BCM A;  2JGU A;  3AV9 A;  4DQS A;  4CJE A;  1WSI A; 
#chains in the Genus database with same CATH topology
 4CW7 B;  3K5O A;  1D8Y A;  3KWG A;  4CGD A;  1KRP A;  2QTD A;  1GLD G;  3L2Q A;  3SLC A;  3G10 A;  4FWQ A;  1TVR A;  3C65 A;  4CZF A;  1RTI A;  4O8K A;  4YOX A;  1DKG D;  4FPA A;  2Z1H A;  1LV5 A;  3P1G A;  4FM0 A;  3MAQ A;  2RN2 A;  1NMN A;  4IFE A;  4JHD A;  4LSL A;  1GLC G;  3NCI A;  3K0S A;  1GLL O;  5AZI A;  1NNE A;  4E7J A;  1U45 A;  1BU6 O;  1CZB A;  4K43 A;  4TSX A;  2WC9 A;  5GIN A;  4H8K A;  4FSV A;  3ITH A;  4HCB A;  4GY2 B;  4CHQ A;  1EQY A;  4GNI A;  3KJV A;  4PKI A;  3OYD A;  2UUA K;  1IBM K;  1IKW A;  3ID6 A;  3L2W A;  4O55 A;  3O4Q A;  4C1N I;  4C8K A;  1J5O A;  3QEX A;  3RSE B;  1K8K B;  3EL2 A;  3H45 C;  4HVJ A;  1L3V A;  4DR4 K;  1Q9Y A;  3KVG A;  1C0T A;  3HPH A;  1RNH A;  3BUZ B;  4EZ6 A;  4KHQ A;  3DRS A;  3GOI A;  4CJQ A;  1EET A;  2D4W A;  2HND A;  3R8E A;  3LM9 A;  4DU1 A;  4CEZ A;  4DSF A;  2RE2 A;  4BQZ A;  1VQ6 N;  1QZ6 A;  3R6M A;  4PKH A;  3NAE A;  2WBN A;  1NK0 A;  1KVB A;  3V1O A;  4B3S K;  4UY8 O;  3V1R A;  2GX9 A;  1VQ4 N;  1EKE A;  5LL6 Z;  1WB9 A;  1NWK A;  3KKS A;  4IKF A;  4FVU A;  3SQ1 A;  3O80 A;  4DUZ K;  1YT3 A;  5LY3 A;  3SI6 A;  2A41 A;  2JLE A;  4Y1C A;  2F9T A;  2P9I B;  3OYL A;  4BRK A;  2UYT A;  2YJE A;  3AVC A;  4H03 B;  3VGL A;  1HYV A;  3OYJ A;  3CJC A;  4LF8 K;  3HXM A;  1NK7 A;  1TK8 A;  4PUO A;  3S41 A;  1ASW A;  1K9M O;  5KRS A;  1XC9 A;  1GLJ O;  3TWH A;  3RTV A;  3HTV A;  4JEP A;  4KHS A;  3AVK A;  2VWB A;  3B8A X;  1VSI A;  1OVQ A;  4B1X B;  4QS8 A;  4CGI A;  4HCC A;  3BF1 A;  3OHR A;  1NOY A;  4O0I A;  3ID8 A;  2OAN A;  3VQA A;  4LFC K;  4CCH A;  4O5B A;  2BDP A;  2G8W A;  1TK5 A;  1RDA A;  4KRE A;  3TR8 A;  3HO1 A;  3O1W A;  4FWL A;  1VQ8 N;  3THY B;  3CJ1 A;  4OX9 K;  4ZHR A;  3LP2 A;  4DFK A;  4BDP A;  3V9X A;  2GUI A;  2QWP A;  4YOU A;  4C1N K;  4FJJ A;  1NGE A;  2X74 A;  1NK5 A;  5C10 A;  5AZJ A;  2DFH A;  4JI2 K;  5C0Y A;  4XH5 A;  4FOE A;  2UXD K;  1E4G T;  3D45 A;  4IOA L;  4LC9 B;  4J2E A;  2BGG A;  4JI7 K;  4GV3 A;  4BRP A;  3DXK B;  3VQ9 A;  4ELV A;  1QHA A;  2ZWH A;  4CEC A;  4DR3 K;  1RIL A;  3DI6 A;  3MWP A;  3OYN A;  3KLH A;  3S3M A;  2NZT A;  2W6L A;  3VEO A;  4E7H A;  5J1E A;  1LCU A;  4W5T A;  3BZC A;  2O8D B;  3TAR A;  3I8B A;  2RKI A;  1NGH A;  2HF4 A;  3LAK A;  1WUA A;  4FJL A;  1CXU A;  3EEQ A;  1OVY A;  3K9K A;  2YNG A;  4F4K A;  2HHH K;  2HW3 A;  5HRR A;  4AIL C;  4KO0 A;  5AFU A;  4E3S A;  2QWM A;  3ULE A;  4CJW A;  2OZS A;  4MO4 A;  5AQV A;  5M1P A;  4YOR A;  1QQO A;  3SZ2 A;  4B1V A;  4KTZ A;  3MK6 A;  4NYN A;  3DLE A;  4CF8 A;  2XO7 A;  4CGG A;  2GTD A;  2QKB A;  3SBG A;  4QOZ B;  1BCO A;  4H5N A;  4CED A;  5F0X A;  4KHN A;  4NYF A;  1VQP N;  2O4I A;  3HOT A;  4DQP A;  4RWT A;  2BAN A;  4O5F A;  2E6L A;  5AQT A;  5B8H A;  2XY5 A;  2IAJ A;  4C8O A;  2Q0R A;  4WFN L;  1Q18 A;  4A61 A;  4DQI A;  1GOC A;  3M8R A;  4I6M B;  3U3G A;  4HHT A;  5AQN A;  1EX4 A;  4Z4I A;  1DTT A;  3TTF A;  4DFJ A;  2D5R A;  3P39 A;  4B3O A;  2P51 A;  1HR0 K;  4FK2 A;  2OPS A;  2OYQ A;  3FZM A;  3SV3 A;  3H08 A;  5TKY A;  1EXQ A;  1RGI A;  3L8B A;  1T44 A;  2F96 A;  2D0O A;  3K58 A;  1GLE G;  4C8L A;  2YHW A;  3T1Y K;  1JJ2 M;  1MDU B;  1JLC A;  1S1V A;  4OPA A;  5H1S Q;  3VEV A;  1QSL A;  3QIO A;  3LAM A;  4FOI A;  5AQF A;  3SAG A;  3OVN A;  1VQN N;  2F8S A;  1RT7 A;  4RW7 A;  3P83 D;  5BPN A;  4DTJ A;  5J2P A;  1IH7 A;  4IG3 A;  3FZF A;  2UXB K;  2HBK A;  1HQE A;  3SJH A;  3KK7 A;  4QS7 A;  2G8V A;  4OKJ A;  4JK8 A;  4OJR A;  4BR7 A;  3F5T A;  4NCA A;  1RBV A;  1BA0 A;  4PKG A;  3ZYY X;  1U6Z A;  3HZ6 A;  4H5W A;  3P31 A;  3VGM A;  2D0A A;  1TUY A;  2QK9 A;  4W5Q A;  3LDN A;  2RF2 A;  3DWL A;  2A1S A;  4OPH A;  4F3T A;  3EKU A;  3KHY A;  4DV6 K;  2P9P B;  2W6K A;  3LP3 A;  3HT3 A;  1FKO A;  3C94 A;  4BAC A;  3ZT3 A;  3F73 A;  3DLL L;  1JKH A;  1JCF A;  1MA9 B;  3DLG A;  3HVR A;  2FSK A;  1I94 K;  2HHV A;  4CZG A;  4DCH A;  1RDC A;  2E20 A;  3OYA A;  3MEG A;  4RG8 A;  4BRA A;  3O8M A;  4DF4 A;  3QEW A;  3NF8 A;  4E7I A;  3CI5 A;  4R5P A;  1RDU A;  3VN5 A;  4FM1 A;  1C6V A;  3F9M A;  4BGB A;  3AA3 A;  1W97 L;  4PY5 A;  2Q2R A;  3ZSW A;  1VSF A;  3HSC A;  4JNE A;  3F9K A;  1J9A A;  5DM7 L;  3IS9 A;  2O8C A;  5DM6 L;  3M5R A;  4WFA L;  3C95 A;  4MQ3 A;  3K57 A;  2Z1I A;  2X6S A;  4ID1 A;  3UKR B;  4IWV A;  3AVG A;  5AQH A;  1RTJ A;  4Q5V A;  4DB3 A;  3MX5 A;  4BRD A;  3RSE A;  4M63 C;  3T69 A;  3AGK A;  4KKO A;  4CIG A;  1K8K A;  2VGN A;  1QE1 A;  4NLB A;  4N47 A;  5C42 A;  4RW8 A;  4DQQ A;  2OTL N;  5I42 A;  3QB0 A;  3R1X A;  3RVC A;  1RCH A;  3CC7 N;  4NXN K;  4DV4 K;  1KC8 O;  1R0A A;  2W41 A;  3SV4 A;  1BOT O;  3TAF A;  4HTL A;  4M7X A;  1DTQ A;  3UKU B;  1WSJ A;  2IIR A;  4L8R B;  1HNI A;  1WSF A;  3H1V X;  4CES A;  3LDS A;  1EWQ A;  4N76 A;  1BCM A;  3OBY A;  4DQS A;  1HKC A;  3SK3 A;  3FE1 A;  2NNW A;  3SMP A;  4JKH A;  3QEI A;  3W0L A;  1UOC A;  3ISN C;  2ITM A;  1NGJ A;  3WXM B;  2XHB A;  2VWJ A;  5C24 A;  4JI1 K;  5FPD A;  3ZSQ A;  3QER A;  5E41 A;  2I7N A;  2GEL A;  1HYS A;  1HLU A;  2FBT A;  4WQ4 A;  3P4I A;  2HF3 A;  2Z1J A;  3VQ7 A;  3K5L A;  1OH5 A;  1DT9 A;  2YX6 A;  1X1P A;  4JI5 K;  1IG9 A;  2HHS A;  1L5U A;  2G8F A;  1VQO N;  2O8B B;  1HJO A;  3CCS N;  4CIE A;  3V6D A;  3AA5 X;  2FSJ A;  5JIC A;  1KSP A;  1TGO A;  3KLF A;  2W40 A;  3CCJ N;  1RBS A;  1RBU A;  1ESV A;  4RW4 A;  5AQI A;  4ZTF A;  3AAP A;  3TAN A;  1ZBL A;  2E6M A;  4BGA A;  4EHU A;  3CMA N;  3RRG A;  3WQU A;  3RMD A;  3RWU A;  4GW6 A;  3OY9 A;  2KFN A;  5CHI A;  4JKF A;  3VQQ A;  4IG0 A;  4F8R A;  4FJK A;  2HST A;  3TSU A;  1QSY A;  3UB5 A;  4B9M A;  4DSI A;  4A2B A;  1QQC A;  3SUQ A;  1JLE A;  2BH1 A;  3MXI A;  1XHX A;  3THY A;  2EX3 A;  4BR0 A;  2E88 A;  4FWP A;  1HKG A;  4IXC A;  2OTJ N;  4DSE A;  3AVI A;  1A5V A;  4X65 K;  2QW9 A;  2WFB A;  3V1Q A;  4FYD A;  4JK7 A;  4JKC A;  2P9K B;  3ATU A;  4CF2 A;  3QBX A;  1VAZ A;  4DV7 K;  1GOB A;  4YFU A;  2ATQ A;  4NCB A;  3O9Q A;  4ICL A;  1NK6 A;  2A3Z A;  4WQ5 A;  3N4Q A;  4DQ8 A;  4CJS A;  4H4M A;  3GL1 A;  3DXK A;  2P9S B;  2FF6 A;  2VCP A;  4YY3 K;  5HRN A;  2H3G X;  4OKE A;  3S3O A;  4B9Q A;  3IMX A;  4HUE A;  2ZE2 A;  2UXC K;  1DGK N;  3ASM A;  1WAF A;  4CHZ A;  2O8D A;  5AQG A;  3MXM A;  4KHY A;  1GOA A;  3KLE A;  2BTF A;  3M3Z A;  4HUG A;  4A5A A;  4BR5 A;  4GKJ K;  2E2O A;  3RR7 A;  4B3M K;  5E26 A;  4PWD A;  3IDH A;  3AO1 A;  3FZK A;  4CK2 A;  1LW0 A;  3GBT A;  5AQO A;  4F2S A;  4CGF A;  1TKD A;  4M3T A;  4GVM A;  1VQ7 N;  3VGK A;  5HRO A;  2XY7 A;  3ULD A;  2A42 A;  3G0Z A;  3VET A;  3AVH A;  4DG1 A;  4Z4C A;  4AM7 A;  5C2F A;  3NGY A;  3WXK A;  1KD1 O;  4DHY A;  1JLB A;  3V9W A;  4FWR A;  3VMF B;  3B6O A;  4DS5 A;  2VYP A;  4CEE A;  3VA0 A;  1XHZ A;  1VRT A;  1RDW X;  1TL1 A;  2VWK A;  4A2A A;  4CHY A;  4FK0 A;  1SZ2 A;  3O9S A;  2HVH A;  2YCH A;  3LPU A;  1N6Q A;  3SJJ A;  1LWE A;  1TKX A;  5AQU A;  4I6M A;  2O8C B;  4DTP A;  2GBZ A;  4XIU A;  3HP9 A;  2RHK A;  2AP1 A;  2QWO A;  1S1X A;  3A8Y A;  3CQX A;  1JL1 A;  1HX1 A;  3PSI A;  3PO4 A;  4IFV A;  2VQF K;  2Z1G A;  1VQ9 N;  4FJM A;  3SYZ A;  3AVN A;  4B9U A;  3PLA A;  3MX2 A;  3WQT A;  1WNS A;  3OJS A;  3WNG A;  5D3G A;  3OYG A;  1VSL A;  3J7Z O;  2KZM A;  5CZ1 A;  4IO8 A;  5CZ2 A;  4DTU A;  5GIP A;  3L2V A;  4A62 A;  4KTQ A;  5K14 A;  4KRF A;  3QFP A;  4DSL A;  3NDK A;  5F1X A;  3H46 O;  3Q7B A;  5IT9 O;  1CXQ A;  3NH0 A;  1RT4 A;  1T05 A;  4CJ3 A;  4FWO A;  4LFB K;  4BR9 A;  3SNN A;  3D2E B;  4I2P A;  4BVP A;  2P5G A;  2B5J A;  2YNI A;  2GEM A;  1P90 A;  3H3O B;  2XY6 A;  3O08 A;  1WOQ A;  2LSN A;  1WSH A;  2ASM A;  3E01 A;  1VSM A;  4FK4 A;  4N5S A;  4A59 A;  1C1B A;  3T19 A;  1VHX A;  1HNZ K;  2HVI A;  1KQS M;  1S6P A;  5C25 A;  5BRH A;  4CF1 A;  2Q36 A;  3NH1 A;  3V9Z A;  3N4P A;  3H1Q A;  4LH4 A;  1XNR K;  2P9P A;  3O4N A;  4G9Z A;  4BRC A;  3I33 A;  2B6A A;  2PYL A;  2KZZ A;  5BR8 K;  1NU0 A;  3DM2 A;  3VQ6 A;  3Q7C A;  2HNY A;  3SAH A;  3CCU N;  1OH8 A;  1YHQ N;  3AA2 A;  2UU9 K;  3MXJ A;  2ZGZ A;  1QVF M;  4ISE A;  4F9O A;  4IBN A;  1MWK A;  3W3D A;  4BG9 A;  3LDL A;  4DR2 K;  5FRN A;  1JL2 A;  3PX6 A;  5KPR A;  1JXE A;  1XMO K;  1OH7 A;  4KFB A;  3TPQ A;  1VRU A;  1SV5 A;  1Q82 O;  1NKE A;  2Q1N A;  3QIC A;  4BRF A;  3OYH A;  4FJ8 A;  2JWL A;  4CER A;  4KTW A;  3QO9 A;  2KW4 A;  3LDQ A;  1A5W A;  4AHV A;  4O44 A;  5KGW A;  2KKZ A;  3SBT A;  5BRD A;  3DLH A;  4KB0 A;  4CE9 A;  4NB4 A;  5SWM A;  2E8A A;  3UKR A;  3CCQ N;  4M41 A;  3NFA A;  3CQY A;  3NF9 A;  4O8U A;  1BIU A;  4AF1 A;  4BRE A;  3V4I A;  5C15 A;  4LF6 K;  4DSK A;  4R79 A;  3V9S A;  4RW6 A;  4NO7 A;  1BUP A;  5CYQ A;  2QWQ A;  3AA4 A;  4MFB A;  4MDA A;  4CJP A;  1NJY A;  1KFS A;  4JD2 B;  3DYA A;  3MMV A;  5MLC Q;  2Y1J A;  1UA0 A;  1D4X A;  2XY8 A;  3VEZ A;  4CEF A;  1FK9 A;  4DTO A;  4JS5 A;  3CPE A;  4ISG A;  1Q7Y O;  1BGX T;  3HP6 A;  4PL8 A;  1SKW A;  2CH5 A;  3K5N A;  4J2A A;  4GKK K;  3BF3 A;  3UKU A;  4RW9 A;  2FBV A;  1Z6R A;  5BN8 A;  5KPZ A;  4U67 L;  1Z25 A;  3QES A;  4H5T A;  4O4G A;  1L3S A;  5I3U A;  2OPP A;  2P9N B;  3O6W A;  1HNV A;  4YOY A;  4JS4 A;  2PAV A;  2HOE A;  5TKW A;  2UUC K;  3G71 N;  1NG9 A;  4A5B A;  5JLF A;  4K41 A;  3VQP A;  2ZJQ L;  4BRN A;  4OLA A;  3H3N O;  3WEE B;  3TAG A;  3C6T A;  3T1H K;  4FPB A;  3SPY A;  1JLF A;  2F7T A;  2O8B A;  1IV0 A;  4KH6 A;  3G6E N;  1NKC A;  3PO5 A;  1NK9 A;  3T7Z A;  1N32 K;  1S22 A;  1RT1 A;  3OS2 A;  2A5X A;  4CZM A;  3L2R A;  5GAH P;  4JI6 K;  3R3L A;  3ZX2 A;  3CFR A;  4HTU A;  3VQ5 A;  1XQS C;  5HLF A;  4XH1 A;  1C0M A;  4JKA A;  4MDB A;  1QVG M;  2VG6 A;  4CBW A;  2WTU A;  3OYC A;  4J2B A;  1XNQ K;  3VQ8 A;  3C6U A;  4WE1 A;  1S1T A;  3O3H A;  3IG1 A;  1BHL A;  4CVN E;  5LMN K;  4IDK A;  3TAM A;  3AVL A;  1YJW N;  1TKT A;  1OH6 A;  3ZSV A;  5IWA K;  4FM2 A;  1IKX A;  1VQK N;  1ILY A;  2YHA A;  3OYF A;  1IKY A;  4BRG A;  2DPN A;  3NGI A;  1SL0 A;  4KI6 A;  4CZH A;  4BC4 A;  2O8F B;  4NCG A;  4FWS A;  1C1A A;  4EHT A;  2V7Z A;  3A5N C;  4H0T B;  3ZSX A;  2P9K A;  1W7A A;  3DXM B;  3J8A A;  1Z05 A;  2PYJ A;  4CJF A;  5LJW A;  3TTC A;  4FWN A;  2JGU A;  1DEJ A;  1TYQ B;  4CJE A;  4KH5 A;  2HBM A;  4LF9 K;  3TI0 A;  2FXU A;  2D0P A;  3C0B A;  4B9L A;  3ZSZ A;  2P5O A;  3DAW A;  1WLJ A;  4B8C A;  3VTH A;  1NGF A;  2P9S A;  2WON A;  5FDL A;  1XWL A;  4BDY A;  1VQ5 N;  2E5L K;  4JRP A;  1S3X A;  1NGC A;  4EFH A;  3CM5 A;  3PUF A;  1T03 A;  3KZB A;  3J7A P;  5AQY A;  4CGJ A;  1Q86 O;  3OJU A;  1T6C A;  3ATV A;  3E1Y A;  1KVC A;  4Y0W A;  4JI0 K;  1HPZ A;  1RTH A;  1XMQ K;  3U4L A;  1ITG A;  5KRT A;  4CEQ A;  3CME N;  2ZGY A;  3VES A;  1QQN A;  2HHU A;  3AAQ A;  4J8F A;  4KV8 A;  4DS4 A;  4DTX A;  1XC3 A;  4I7F A;  2D0C A;  2IGI A;  1NJZ A;  1NJI O;  3VQD A;  3JYT A;  3HST B;  1B9F A;  4W5R A;  4CJ5 A;  5GAG P;  2HBL A;  4H4O A;  3CF5 L;  1SQK A;  1TAQ A;  3O9R A;  4WQ5 C;  1YIJ N;  4B9N A;  4BC3 A;  5AQS A;  3RMC A;  5AJ3 K;  3NVM A;  3OTO K;  2ZM6 K;  3VA3 A;  1JCE A;  4CHP A;  4OLB A;  3S9H A;  4FLW A;  1X9M A;  3EN9 A;  1NGA A;  1VSD A;  1YTA A;  1TK0 A;  4DTN A;  4WFB L;  1O13 A;  2YI1 A;  5BR9 A;  4DF8 A;  3O3F A;  3CJ7 A;  3PSF A;  3G25 A;  4IZ9 A;  3MED A;  4RCH A;  5T7B A;  4AH9 A;  1EP4 A;  2VQE K;  5HRS A;  3DJC A;  1IBK K;  4BC2 A;  2A40 A;  2D1K A;  2NRR A;  3K9J A;  5JMV A;  1S9G A;  4E19 A;  4IOC L;  4AHR A;  3QNO A;  3UIQ A;  2A1R A;  2PBD A;  3CD6 N;  3VEN A;  3C7N B;  3VF4 A;  3PX4 A;  3T3F A;  4H0X B;  1SL2 A;  4DTM A;  1N8R O;  3CHW A;  4CJR A;  5GAE P;  3PY8 A;  1S72 N;  5ELZ A;  3GDQ A;  1HPM A;  5AQQ A;  5KPT A;  4B1Y B;  2QI2 A;  3CIP A;  4ISF A;  2QWR A;  3VTI A;  5FLX O;  5BPL A;  4CGH A;  3HI0 A;  3BDP A;  3D2E A;  1ZC6 A;  1KAX A;  3FLC O;  2OZM A;  3CCR N;  4RTF D;  2FC0 A;  4CJK A;  2KHO A;  1JLA A;  1L3T A;  1ATS A;  3L4Q A;  1ASV A;  4H0P A;  2O8E A;  5HRP A;  4FJN A;  2YHB A;  3CJB A;  3GG4 A;  4C8N A;  1ZBI A;  4H0O A;  2PY5 A;  2YNF A;  5EU7 A;  5HBM A;  3WNE A;  5CE3 A;  4CJU A;  2HNZ A;  4DTR A;  3FFI A;  1YVN A;  3QEV A;  2OPQ A;  5HL7 L;  5J2M A;  4WCE L;  4CF0 A;  2QWN A;  4FJ7 A;  3AVM A;  1NK8 A;  4E0D A;  3ZCM A;  2GV9 A;  3A0I X;  4JYA K;  2RPI A;  4CD3 A;  2HB5 A;  3CER A;  2OPR A;  4QAG A;  4BWM A;  4FO0 A;  5DMR A;  4UQG A;  1W2B M;  2YHX A;  3FZH A;  4XH4 A;  4CK3 A;  4WYB A;  3AVB A;  4DV5 K;  2HMP A;  3NBP A;  3LP1 A;  3ZEU B;  1OKJ A;  2WUS A;  3LWL A;  3QIP A;  1JXB A;  3A5L C;  3BEX A;  1HRH A;  4DR1 K;  4CZL A;  5EVZ A;  1J5E K;  3QEP A;  3SUO A;  1BIS A;  1C0F A;  2G8U A;  3A5M C;  1U4B A;  4KAZ A;  2YKM A;  3D2F B;  2GWJ A;  4ILH A;  3SAF A;  4DSJ A;  4DV0 K;  2KFZ A;  3IAY A;  4IJN A;  4AHU A;  4CF9 A;  3AVF A;  1NOZ A;  2P9L B;  1LW2 A;  3CJ9 A;  4XEI A;  3ZET B;  1YTU A;  5GIO A;  2HBJ A;  2G8K A;  3AO5 A;  3OBW A;  3AAR A;  1J6Z A;  1BDG A;  3M1F A;  3PIO L;  5ADX H;  3RRH A;  4JV5 K;  3WXI A;  2JWK A;  5I9E B;  2ZJR L;  5JS2 A;  1WN7 A;  3KLI A;  4JD2 A;  4DR5 K;  1KAY A;  4DU4 A;  3EZ5 A;  4FWM A;  3HPG A;  3IRX A;  1J54 A;  1I39 A;  5HP1 A;  3LP0 A;  3SCX A;  5M1O A;  3TAP A;  3MN7 A;  4CFC A;  1FKP A;  2CH6 A;  1FJG K;  4I9L A;  4LF4 K;  4E1M A;  2YJF A;  1H1V A;  1Q9X A;  4W5N A;  3HL8 A;  5KQ8 A;  4DWI A;  1I3A A;  4G1Q A;  4ZTJ A;  4EIA A;  1NJX A;  3HK2 A;  3G4S N;  4N56 A;  2P9N A;  1R59 O;  4FJ9 A;  5AQZ A;  2V52 B;  4U7B A;  1GLF O;  3I8D A;  1XI1 A;  1YUW A;  2VG5 A;  1ZXO A;  4KBO A;  3L4I A;  5JVG L;  1UA1 A;  4BRH A;  4KB1 A;  4FW1 A;  1ATN A;  4DV1 K;  3JSM A;  5AQP A;  4KHW A;  1KCF A;  3E9O A;  2UUB K;  3WEE A;  1O1W A;  4AHS A;  4CFD A;  2ZF5 O;  1UWB A;  1FXX A;  4PL7 A;  1K6Y A;  1T8E A;  1D5A A;  3BP8 A;  4CJV A;  3QIN A;  3TU5 A;  5KGX A;  1NBW A;  3NHG A;  1X9W A;  3A5O C;  4M3X A;  3CYM A;  3E66 A;  3UE5 A;  1YXQ A;  1WSE A;  3HJF A;  2XRI A;  1NGI A;  3OS1 A;  4PQU A;  1SAZ A;  4YOW A;  3MEE A;  4OGE A;  3FR0 A;  3IFR A;  3EY1 A;  1HQU A;  4V19 S;  1HMV A;  3LZI A;  4AM6 A;  4KPY A;  4CEO A;  4YOV A;  4JKG B;  1NM1 A;  4YOT A;  2E4L A;  1U47 A;  3O5B A;  4K8Z A;  1IG8 A;  3P5J A;  3EZW A;  4BDZ A;  2HHT A;  4BWJ A;  4CJ7 A;  5BPM A;  4L3Q A;  2KQ2 A;  1U2V A;  4IOX A;  3M8S A;  1RT3 A;  4GV6 A;  1G99 A;  2BE2 A;  4FLV A;  1RDD A;  2KLA A;  4OKK A;  2O8F A;  1N34 K;  4Q0B A;  4FLY A;  5AQW A;  4CI6 A;  3NF6 A;  3DXM A;  1C1C A;  2CGK A;  4IO9 L;  4AHC A;  1SL1 A;  2F8T A;  3KK2 A;  4DKW A;  1TYQ A;  2QWL A;  1J53 A;  3SQ4 A;  5AQL A;  2G8H A;  1RT5 A;  3BZK A;  4OGC A;  3MN9 A;  3O1B A;  3AO4 A;  1IKV A;  1ZYQ A;  4WF9 L;  5FRO A;  1KLM A;  4H5R A;  1ATR A;  3AO3 A;  3CG7 A;  4FLT A;  5KI6 A;  3EE9 A;  4NXM K;  2EHG A;  4FL9 A;  5BN9 A;  3I56 N;  3D6R A;  3EKS A;  1BL3 A;  4Z4H A;  3DLB A;  4CHO A;  1BG3 A;  1T7P A;  3U9D A;  2O8E B;  3U8X A;  1VSH A;  3L0Q A;  3THW B;  1DLO A;  3WNF A;  5FPN A;  4DFP A;  4M42 A;  3AVA A;  5A2Q O;  5JVH L;  3CCL N;  3ENO A;  1LAW A;  5BRF A;  2X78 A;  1N36 K;  4DUY K;  4EAH D;  2IS3 A;  1WBB A;  3DOL A;  3IUC A;  2QA4 N;  2NRW A;  3LDP A;  1QS4 A;  4CBU A;  1RFQ A;  2E2N A;  3O9T A;  3THX B;  4K0K K;  4A57 A;  3THV A;  4O0J A;  3VEW A;  1CZA N;  5BRE A;  2OCE A;  4FWK A;  4DV2 K;  4KH4 A;  3QET A;  4H5V A;  3NMU A;  4M3R A;  2PFU A;  3CC4 N;  1VK0 A;  1S6Q A;  5C12 A;  3K59 A;  1G15 A;  1TL3 A;  4HWI A;  1ZBU A;  3CCV N;  1Y97 A;  1JLG A;  3S3N A;  4Z4F A;  5AR0 A;  1TUU A;  3KD1 E;  1L3U A;  1F21 A;  3I55 N;  4FJI A;  1BQM A;  3QML A;  4ELT A;  3OW2 M;  3NF7 A;  4BE0 A;  1HJR A;  3VQE A;  4CIF A;  1V4T A;  3LM2 A;  3K5M A;  4B9T A;  1B9D A;  3AV9 A;  2E2Q A;  3M8P A;  3CPW M;  2W42 A;  3TAQ A;  4JAX A;  4F3O A;  4CEB A;  3WXL A;  1K73 O;  3VOV A;  3L6Q A;  4X64 K;  3U9Z A;  1FW6 A;  3C7N A;  3NE6 A;  2B4J A;  1X9J A;  1VSE A;  4KHP K;  2IOC A;  2ITG A;  2WOM A;  2I7P A;  2ASP A;  1YI2 N;  3F2K A;  1XUP O;  3HM8 A;  5FPE A;  1M1K O;  3BGR A;  4OPK A;  2Y1I A;  2NRT A;  3DLK A;  4BRO A;  3TSP A;  4YDU A;  3I0S A;  1Y64 A;  1NGD A;  5EOY A;  3EO3 A;  4JI3 K;  3DLR A;  5AQX A;  3A2F A;  2VGM A;  4QCL A;  2NRV A;  4FVM A;  1Q8I A;  4X66 K;  5HOO A;  2IVN A;  4LY7 A;  1NKB A;  4Z4G A;  4DR7 K;  1VSK A;  4I2Q A;  1BO5 O;  4KHU A;  4YHH K;  4IEE A;  4OPJ A;  4X62 K;  4YNQ A;  3VF2 A;  3E9L A;  2P9U B;  3M6G A;  3MCA B;  4J2D A;  3HM9 A;  4Z94 A;  3RMB A;  4FLZ A;  3CC2 N;  3GE1 A;  4KI4 A;  1NGB A;  1RT6 A;  3HBT A;  3LDO A;  2J4R A;  2QKK A;  1A5X A;  4BQL A;  3U6F A;  4OO1 J;  2X6N A;  1BI4 B;  1VSJ A;  1E3M A;  5LJV A;  4Z0U A;  4H0Y B;  4M3Y A;  2DTU A;  1EWR A;  4BRQ A;  2FSN A;  1B92 A;  3ENB A;  4CD1 A;  4I9Q A;  4FW2 A;  4EZ9 A;  3SQ0 A;  1BQN A;  1NGG A;  3CQ8 A;  4M3W A;  3CFO A;  3WT0 A;  3CJA A;  3VER A;  3KD5 E;  3L3V A;  2OA8 A;  4CEA A;  1KFD A;  4C23 A;  2QXL A;  5ADX A;  2HHW A;  3D0P A;  4B08 A;  5JLH A;  1X3M A;  3ZEU A;  4QS9 A;  5GAD P;  3NGZ A;  3RMA A;  2NLX A;  4HUF A;  2AJQ A;  3ZSO A;  4DR6 K;  3AY9 A;  1WBD A;  4PHT X;  1NJW A;  4CJ4 A;  2YHY A;  1N33 K;  4M7Y A;  3OYE A;  2AA4 A;  3NH2 A;  1YAG A;  2R7Y A;  3C6A A;  4K42 A;  4BE2 A;  1W9H A;  4CZI A;  2A6A A;  3D7E O;  4M3Z A;  3CFP A;  1IO2 A;  4ILG B;  4JHD B;  3OA9 A;  3D2F A;  4CK1 A;  1U2V B;  4E7K A;  4WQ4 C;  1QSS A;  5AZI B;  3BY5 A;  4IJA A;  3MCP A;  3DRR A;  3FFK B;  4B9S A;  4Y1D A;  3KLG A;  2P9L A;  5JS1 A;  1C0G A;  3ZET A;  1ASU A;  1GLB G;  1KAZ A;  2VG7 A;  1JCG A;  3ZT1 A;  3ZLJ A;  3LL3 A;  3WNH A;  4F2R A;  1YIT N;  3V81 A;  2DY4 A;  1X9S A;  4FZX C;  1NK4 A;  3ZT2 A;  1TV6 A;  2ZQB A;  4LH5 A;  4BY9 C;  5M1Q A;  3JXU A;  2YKN A;  5CY4 A;  3HVT A;  4B3R K;  2FBX A;  2ZD1 A;  3QBW A;  1GLA G;  2CGL A;  2YNH A;  3KKR A;  3O4W A;  4M45 A;  3ZX3 A;  3VF6 A;  4FXD A;  4JI4 K;  5AQJ A;  4LD0 A;  3RR8 A;  2DFF A;  3SMS A;  1ZBF A;  4FCY A;  3R9P A;  3DMJ A;  5EX5 A;  3DOK A;  4FJ5 A;  4M3U A;  3I0R A;  1LWC A;  2CGJ A;  2ASO A;  1U49 A;  3B6P A;  4N41 A;  1HNW K;  4LF5 K;  1W0H A;  3DRP A;  4FZY A;  2G8I A;  3KWI A;  1KTQ A;  1SKS A;  4EP4 A;  5SZT A;  1BWF O;  2KTQ A;  4DLG A;  3HRG A;  1S9E A;  3OYI A;  3MEC A;  3OYK A;  4JK9 A;  4IFY A;  4BR4 A;  1S1U A;  3V9U A;  2NRX A;  1V4S A;  1JLQ A;  3LAL A;  2QM1 A;  2E1Y A;  4IDH A;  3ZSR A;  4CFB A;  1ZBH A;  2EWS A;  3SQ2 A;  1KVA A;  3ENH A;  1QTM A;  1N5Y A;  4C8M A;  4BRL A;  3C6H A;  3J81 O;  1S5J A;  4DU3 A;  3T1A A;  3CET A;  2Q0U A;  4E1N A;  5EXW A;  2E2P A;  1BA1 A;  1U04 A;  4CBX A;  2HMI A;  5CYM A;  4K8X A;  1HKB A;  4B8A B;  3KK1 A;  4LSN A;  4GMJ B;  3AVJ A;  1X3N A;  3ZX0 A;  4B3T K;  2FLO A;  1EO1 A;  1MU2 A;  1KLN A;  3VQ4 A;  4JKG A;  1TKZ A;  2BUP A;  1CLQ A;  3HYF A;  3O3G A;  3KIO A;  1U48 A;  1D9F A;  1QQM A;  3PX0 A;  4B1Z A;  4NLC A;  2FBY A;  2NRZ A;  1S1W A;  3MN6 A;  3M8Q A;  4W5O A;  4ILJ A;  4MLE A;  2GUP A;  3LAN A;  5KTQ A;  1NMD A;  4BG8 A;  2IVP A;  3PV8 A;  1IBL K;  3QLH A;  4IEI A;  4FZZ A;  1HNX K;  3MWT A;  5E84 A;  1BIZ A;  3O9U A;  4AQY K;  5AZJ B;  3LPT A;  3VQC A;  1SKR A;  2F9W A;  3LWM A;  5CR4 A;  1NLV A;  4JKB A;  4B1U B;  4CZK A;  1CZ9 A;  4DTS A;  3JS6 A;  2Q3S A;  3THW A;  4ID5 A;  4B1W B;  4MLH A;  3IKM A;  2NUB A;  5KQD A;  4K25 A;  3OS0 A;  3HPO A;  1RBR A;  3OYB A;  3ZT0 A;  2QEX N;  4DQR A;  4BRM A;  4FJH A;  2GWK A;  4OVL A;  1E4F T;  3SPZ A;  5DK5 A;  3MDQ A;  3ZT4 A;  1VQM N;  1YVU A;  3KTQ A;  3THX A;  1ZBS A;  4MO5 A;  2HHQ A;  4BVO A;  1SUQ A;  4CHN A;  1YJ9 N;  5F2R A;  3ULE B;  2ZJP L;  1VQL N;  2P9I A;  1D9D A;  1QZ5 A;  3SUP A;  1T3V A;  3TSQ A;  2YV0 X;  2FF3 B;  2P1J A;  4LFA K;  1YF5 L;  2IDO A;  3H6E A;  3L3U A;  5AQR A;  5J2N A;  4DV3 K;  1C0U A;  3VEY A;  2V51 B;  2PZS A;  3QFU A;  3J80 O;  4CJT A;  4JRQ A;  4DLE A;  3VQB A;  3WXJ A;  2Q31 A;  1YJN N;  1KXP A;  2D0B A;  4LF7 K;  3ZSY A;  2I5J A;  1UAX A;  4JI8 K;  4FJG A;  5M1K A;  4DMN A;  3ALY A;  5AQK A;  4AHT A;  4JN4 A;  3AO2 A;  4JKE A;  3PIP L;  5M1F A;  4FLU A;  5AQM A;  2F4V K;  5AFU H;  5M1N A;  2V7Y A;  1REV A;  2IC3 A;  3SUN A;  4DFM A;  3TTD A;  3MN5 A;  1SS6 A;  3FZL A;  1Z26 A;  4CFA A;  5C2D A;  3EYZ A;  5LMU K;  3CCM N;  1HYZ A;  1RT2 A;  1TAU A;  3L2U A;  2QXF A;  4Z4E A;  3CM6 A;  4FLX A;  4FJX A;  2Q97 A;  4E1J A;  3FGU A;  3TAE A;  3VPZ A;  3OYM A;  1T6D A;  5EY4 A;  3K2P A;  5FPM A;  1RBT A;  3NVK A;  4GV9 A;  3CCE N;  3HOS A;  1LWF A;  2ETJ A;  2HHX A;  1M90 O;  4E89 A;  4PA1 A;  1WSG A;  4JLH A;  4H0V B;  4EP5 A;  2NRH A;  4ELU A;  5FRM A;  4B9V A;  1IJJ A;  3QNN A;  1RTD A;  3TAB A;  4BRI A;  1LOT B;  4JKD A;  3QDK A;  2P9U A;  1WAJ A;  2DFE A;  3VEX A;  3LZJ A;  3U3Y A;  4GVE A;  1HUX A;  1BI4 A;  1QHT A;  3P38 A;  1MWM A;  2E1Z A;  3E9P A;  4E7L A;  1Q81 O;  1P8Z A;  3KK3 A;  4CJL A;  1RDB A;  3J7Y P;  1K8A O;  2O4G A;  4CZJ A;  4BC5 A;  4CZE A;  3CXC M;  4YDU C;  1LAV A;  3WUH A;  3EE8 A;  4BR2 A;  5J2Q A;  3AGR A;  3JAM O;  2IVO A;  4BE1 A;  1WSI A; 
#chains in the Genus database with same CATH homology
 3K5O A;  3M8P A;  3QEI A;  2W42 A;  3TAQ A;  1D8Y A;  4CGD A;  1KRP A;  4F3O A;  4CEB A;  1UOC A;  3ISN C;  3TI0 A;  2XHB A;  4KHU A;  3L2Q A;  2VWJ A;  5C24 A;  3G10 A;  1TVR A;  4B9L A;  3ZSZ A;  2P5O A;  3ZSQ A;  4B8C A;  1WLJ A;  3QER A;  1RTI A;  5E41 A;  1HYS A;  3NE6 A;  2FBT A;  2B4J A;  2WON A;  5FDL A;  1VSE A;  1XWL A;  4BDY A;  2Z1H A;  1LV5 A;  2IOC A;  4JRP A;  3P1G A;  2ITG A;  2WOM A;  2Z1J A;  3VQ7 A;  3K5L A;  4FM0 A;  1X1P A;  3CM5 A;  1IG9 A;  2HHS A;  3PUF A;  2RN2 A;  3MAQ A;  1T03 A;  1L5U A;  2G8F A;  4CGJ A;  4PQU A;  3BGR A;  4OPK A;  3OJU A;  2Y1I A;  3DLK A;  4LSL A;  3NCI A;  4CIE A;  3I0S A;  3V6D A;  3AA5 X;  4E7J A;  1KVC A;  1KSP A;  1HPZ A;  1TGO A;  3KLF A;  1U45 A;  3RWU A;  1RTH A;  1CZB A;  1ITG A;  1RBS A;  3DLR A;  3A2F A;  5KRT A;  4TSX A;  4CEQ A;  4QCL A;  4H8K A;  4FVM A;  1RBU A;  1Q8I A;  3ITH A;  4HCB A;  2HHU A;  4RW4 A;  4CHQ A;  4ZTF A;  4LY7 A;  3KJV A;  3OYD A;  3TAN A;  2E6M A;  1ZBL A;  1IKW A;  1NKB A;  4Z4G A;  3RRG A;  4KV8 A;  3RMD A;  1VSK A;  4DS4 A;  4DTX A;  4I2Q A;  4I7F A;  4GW6 A;  3L2W A;  4O55 A;  2D0C A;  2IGI A;  3O4Q A;  4OPJ A;  3OY9 A;  1NJZ A;  3VQD A;  3JYT A;  2KFN A;  4C8K A;  3HST B;  1B9F A;  1J5O A;  4YNQ A;  3QEX A;  4W5R A;  3VQQ A;  4IG0 A;  4CJ5 A;  4F8R A;  4FJK A;  1L3V A;  4HVJ A;  4J2D A;  1Q9Y A;  4H4O A;  1QSY A;  3HM9 A;  3RMB A;  1TAQ A;  4FLZ A;  4KI4 A;  1C0T A;  1RT6 A;  4B9M A;  4DSI A;  3HPH A;  4B9N A;  1RNH A;  2QKK A;  1A5X A;  1QQC A;  3U6F A;  3SUQ A;  3RMC A;  1JLE A;  4EZ6 A;  4KHQ A;  2X6N A;  3VA3 A;  1BI4 B;  1VSJ A;  3DRS A;  3MXI A;  4CHP A;  1XHX A;  4OLB A;  2EX3 A;  4CJQ A;  1EET A;  2HND A;  3S9H A;  4FLW A;  4Z0U A;  1X9M A;  1VSD A;  4M3Y A;  2DTU A;  4DSE A;  3AVI A;  4DU1 A;  1A5V A;  1YTA A;  4CEZ A;  1B92 A;  1TK0 A;  3V1Q A;  4DTN A;  4DSF A;  4FYD A;  4I9Q A;  4FW2 A;  4EZ9 A;  4CF2 A;  3SQ0 A;  1BQN A;  3NAE A;  4DF8 A;  1NK0 A;  3CQ8 A;  4M3W A;  3O3F A;  1KVB A;  3CFO A;  3V1O A;  3V1R A;  1GOB A;  1EKE A;  3MED A;  5T7B A;  4YFU A;  4AH9 A;  3KD5 E;  1EP4 A;  3L3V A;  2OA8 A;  2ATQ A;  3KKS A;  4CEA A;  4IKF A;  4NCB A;  3SQ1 A;  5HRS A;  1KFD A;  4ICL A;  2HHW A;  3D0P A;  1NK6 A;  4B08 A;  3RMA A;  1S9G A;  1YT3 A;  4E19 A;  3NGZ A;  4AHR A;  3QNO A;  4HUF A;  4Z4C A;  2AJQ A;  3ZSO A;  3UIQ A;  4CJS A;  2A1R A;  4H4M A;  3SI6 A;  1NJW A;  4CJ4 A;  3T3F A;  3PX4 A;  2JLE A;  4Y1C A;  1SL2 A;  3OYE A;  3OYL A;  4DTM A;  5HRN A;  3NH2 A;  2R7Y A;  4OKE A;  4CJR A;  4BE2 A;  1W9H A;  3S3O A;  3PY8 A;  3AVC A;  4M3Z A;  3CFP A;  1IO2 A;  1HYV A;  4CK1 A;  2ZE2 A;  3OYJ A;  4HUE A;  4E7K A;  3HXM A;  1NK7 A;  1TK8 A;  1QSS A;  4PUO A;  3ASM A;  1WAF A;  4CHZ A;  3DRR A;  1ASW A;  4B9S A;  3MXM A;  4Y1D A;  4KHY A;  1GOA A;  3KLE A;  3KLG A;  4CGH A;  5KRS A;  3BDP A;  4HUG A;  5JS1 A;  1XC9 A;  3RR7 A;  1ASU A;  3TWH A;  3RTV A;  2OZM A;  4CJK A;  2FC0 A;  2VG7 A;  1JLA A;  3ZT1 A;  1L3T A;  4PWD A;  4F2R A;  3WNH A;  3AO1 A;  4KHS A;  4CK2 A;  3AVK A;  1LW0 A;  1VSI A;  3V81 A;  2DY4 A;  1ASV A;  1X9S A;  4FZX C;  4CGI A;  1NK4 A;  4F2S A;  3ZT2 A;  1TV6 A;  2ZQB A;  4CGF A;  5HRP A;  4HCC A;  1TKD A;  4FJN A;  4M3T A;  2YHB A;  4LH5 A;  4GVM A;  1NOY A;  4O0I A;  4C8N A;  2XY7 A;  5HRO A;  3ULD A;  1ZBI A;  3G0Z A;  2PY5 A;  2YKN A;  2YNF A;  3AVH A;  3VQA A;  4O5B A;  5CY4 A;  5EU7 A;  5HBM A;  3WNE A;  4DG1 A;  4CCH A;  2BDP A;  2G8W A;  1TK5 A;  1RDA A;  3HVT A;  4CJU A;  2HNZ A;  3NGY A;  4KRE A;  2FBX A;  2ZD1 A;  1JLB A;  4DTR A;  2YNH A;  3KKR A;  3TR8 A;  3HO1 A;  3V9W A;  4M45 A;  3FFI A;  4DS5 A;  3B6O A;  4FXD A;  4CEE A;  3VA0 A;  4LD0 A;  4ZHR A;  3LP2 A;  1XHZ A;  3RR8 A;  2DFF A;  1VRT A;  3QEV A;  4DFK A;  2OPQ A;  1TL1 A;  1ZBF A;  2VWK A;  4CHY A;  5J2M A;  4FK0 A;  4BDP A;  4FCY A;  4CF0 A;  4FJ7 A;  3V9X A;  2GUI A;  2HVH A;  3DMJ A;  3LPU A;  3AVM A;  1NK8 A;  1N6Q A;  4E0D A;  3DOK A;  3ZCM A;  4FJ5 A;  2GV9 A;  1LWE A;  1TKX A;  1LWC A;  3I0R A;  3SJJ A;  2RPI A;  4FJJ A;  4M3U A;  2HB5 A;  2X74 A;  4DTP A;  2GBZ A;  2OPR A;  4XIU A;  1U49 A;  3B6P A;  3HP9 A;  4QAG A;  4BWM A;  1NK5 A;  4N41 A;  1W0H A;  3DRP A;  2DFH A;  4FZY A;  2G8I A;  5DMR A;  2F8T A;  1KTQ A;  4UQG A;  1S1X A;  1SKS A;  4EP4 A;  4CK3 A;  5SZT A;  3AVB A;  3NBP A;  3D45 A;  1JL1 A;  2KTQ A;  4DLG A;  3LP1 A;  3PO4 A;  4IFV A;  1S9E A;  3OYI A;  3MEC A;  3OYK A;  3LWL A;  2Z1G A;  4J2E A;  4FJM A;  3SYZ A;  3AVN A;  3QIP A;  4B9U A;  1JXB A;  2BGG A;  4IFY A;  1S1U A;  3V9U A;  3VQ9 A;  1HRH A;  1WNS A;  1JLQ A;  3OJS A;  3LAL A;  3WNG A;  3QEP A;  4ELV A;  3SUO A;  3OYG A;  5D3G A;  1BIS A;  1VSL A;  3ZSR A;  2KZM A;  4CFB A;  5CZ1 A;  5CZ2 A;  4DTU A;  1ZBH A;  3SQ2 A;  2G8U A;  1KVA A;  4CEC A;  3L2V A;  1U4B A;  1RIL A;  3DI6 A;  5K14 A;  3OYN A;  3KLH A;  3S3M A;  1QTM A;  4DSL A;  2YKM A;  4C8M A;  3NDK A;  1N5Y A;  4DSJ A;  2KFZ A;  1CXQ A;  1S5J A;  3NH0 A;  3IAY A;  4E7H A;  1RT4 A;  5J1E A;  4W5T A;  4DU3 A;  1T05 A;  3T1A A;  4AHU A;  4CJ3 A;  4CF9 A;  3TAR A;  3AVF A;  1NOZ A;  4KTQ A;  2RKI A;  4E1N A;  3SNN A;  1U04 A;  1LW2 A;  3LAK A;  4I2P A;  2HMI A;  1CXU A;  4FJL A;  1YTU A;  5CYM A;  2P5G A;  2YNI A;  2B5J A;  4K8X A;  2YNG A;  3AO5 A;  4B8A B;  2G8K A;  4F4K A;  2HW3 A;  5HRR A;  3KK1 A;  4LSN A;  4GMJ B;  3AVJ A;  4KO0 A;  4AIL C;  2XY6 A;  2LSN A;  4E3S A;  4CJW A;  1WSH A;  1MU2 A;  4KAZ A;  2OZS A;  3RRH A;  3E01 A;  1VSM A;  5JS2 A;  1KLN A;  3VQ4 A;  1WN7 A;  3KLI A;  4FK4 A;  1TKZ A;  3SZ2 A;  1CLQ A;  4KTZ A;  4N5S A;  4NYN A;  3DLE A;  3HYF A;  4DU4 A;  3O3G A;  1C1B A;  4CF8 A;  3KIO A;  3EZ5 A;  1U48 A;  2XO7 A;  3T19 A;  1D9F A;  4CGG A;  3HPG A;  3IRX A;  1J54 A;  2QKB A;  3PX0 A;  1I39 A;  2HVI A;  5HP1 A;  3LP0 A;  3SCX A;  1BCO A;  3TAP A;  1S6P A;  4CED A;  4QOZ B;  4CFC A;  5C25 A;  1FKP A;  2FBY A;  1S1W A;  4KHN A;  4NYF A;  4CF1 A;  3M8Q A;  4W5O A;  2O4I A;  3NH1 A;  3V9Z A;  4I9L A;  4DQP A;  4LH4 A;  2BAN A;  4E1M A;  3LAN A;  5KTQ A;  3O4N A;  3PV8 A;  1Q9X A;  2E6L A;  2B6A A;  2XY5 A;  3HL8 A;  2PYL A;  2KZZ A;  3QLH A;  4W5N A;  4DWI A;  1I3A A;  2IAJ A;  4G1Q A;  4ZTJ A;  3DM2 A;  3VQ6 A;  1NJX A;  4C8O A;  3HK2 A;  2HNY A;  4FZZ A;  4N56 A;  3AA2 A;  4DQI A;  1GOC A;  3MXJ A;  3M8R A;  3U3G A;  4HHT A;  1BIZ A;  4FJ9 A;  4IBN A;  1EX4 A;  4Z4I A;  3LPT A;  3I8D A;  1XI1 A;  5FRN A;  1DTT A;  1JL2 A;  3VQC A;  2VG5 A;  2D5R A;  4DFJ A;  3PX6 A;  1SKR A;  2P51 A;  4FK2 A;  4B3O A;  2OPS A;  1UA1 A;  4KB1 A;  2OYQ A;  1JXE A;  3LWM A;  4FW1 A;  3SV3 A;  3H08 A;  1EXQ A;  3JSM A;  4KHW A;  1CZ9 A;  1KCF A;  3L8B A;  4KFB A;  4CFD A;  1O1W A;  4AHS A;  4DTS A;  1VRU A;  1SV5 A;  2Q3S A;  4ID5 A;  1NKE A;  1UWB A;  2F96 A;  1FXX A;  3K58 A;  1K6Y A;  3OYH A;  4C8L A;  1T8E A;  1D5A A;  4FJ8 A;  2NUB A;  4CJV A;  3OS0 A;  1JLC A;  1S1V A;  3QIN A;  1QSL A;  3HPO A;  3QIO A;  5KGX A;  1RBR A;  3OYB A;  3ZT0 A;  3LAM A;  3NHG A;  4CER A;  4KTW A;  4DQR A;  3QO9 A;  1X9W A;  4M3X A;  2KW4 A;  1A5W A;  4AHV A;  3CYM A;  4O44 A;  4FJH A;  3OVN A;  4OVL A;  2F8S A;  5KGW A;  1RT7 A;  4RW7 A;  1WSE A;  3SPZ A;  3DLH A;  4KB0 A;  4CE9 A;  5SWM A;  5DK5 A;  3HJF A;  3P83 D;  3ZT4 A;  2XRI A;  4DTJ A;  3OS1 A;  1YVU A;  3NFA A;  1IH7 A;  3NF9 A;  4IG3 A;  4M41 A;  1BIU A;  3MEE A;  5J2P A;  3V4I A;  4OGE A;  2HHQ A;  3EY1 A;  4DSK A;  3V9S A;  4RW6 A;  1HQU A;  1HMV A;  1HQE A;  1SUQ A;  4CHN A;  3LZI A;  4KPY A;  5CYQ A;  3AA4 A;  4MFB A;  4CEO A;  2G8V A;  1D9D A;  4CJP A;  3SUP A;  1NJY A;  4OKJ A;  2E4L A;  1U47 A;  4OJR A;  2YV0 X;  1KFS A;  4K8Z A;  2P1J A;  4NCA A;  3P5J A;  1RBV A;  3DYA A;  2IDO A;  3L3U A;  5J2N A;  4BDZ A;  2Y1J A;  1UA0 A;  4BWJ A;  2HHT A;  1C0U A;  2XY8 A;  2KQ2 A;  3M8S A;  1RT3 A;  4CEF A;  1FK9 A;  2D0A A;  2BE2 A;  1RDD A;  4JS5 A;  4FLV A;  4DTO A;  2PZS A;  2QK9 A;  1BGX T;  4CJT A;  3HP6 A;  4JRQ A;  4OKK A;  4W5Q A;  4DLE A;  2RF2 A;  1SKW A;  3K5N A;  4J2A A;  2A1S A;  4Q0B A;  3VQB A;  4FLY A;  4F3T A;  3NF6 A;  3LP3 A;  4RW9 A;  2D0B A;  2FBV A;  3HT3 A;  1FKO A;  3ZSY A;  1C1C A;  3C94 A;  2I5J A;  4BAC A;  3ZT3 A;  4AHC A;  1UAX A;  1Z25 A;  3QES A;  4FJG A;  4DMN A;  1SL1 A;  3F73 A;  3KK2 A;  4O4G A;  3ALY A;  3SQ4 A;  1J53 A;  4AHT A;  1JKH A;  2OPP A;  5I3U A;  1L3S A;  3AO2 A;  2G8H A;  3DLG A;  1RT5 A;  3HVR A;  1HNV A;  4JS4 A;  4OGC A;  4FLU A;  3AO4 A;  1IKV A;  1ZYQ A;  2HHV A;  5FRO A;  1KLM A;  1REV A;  1RDC A;  3AO3 A;  2IC3 A;  3CG7 A;  3MEG A;  3VQP A;  3OYA A;  4FLT A;  4RG8 A;  4DFM A;  3SUN A;  5KI6 A;  4DF4 A;  3QEW A;  2EHG A;  3NF8 A;  4OLA A;  1Z26 A;  4Z4H A;  1BL3 A;  4E7I A;  3DLB A;  4CHO A;  1T7P A;  4R5P A;  3VN5 A;  4FM1 A;  1C6V A;  4CFA A;  3KTQ A;  3EYZ A;  1VSH A;  3AA3 A;  3TAG A;  1DLO A;  3WNF A;  4PY5 A;  3C6T A;  3SPY A;  1HYZ A;  4DFP A;  1JLF A;  1RT2 A;  3AVA A;  4M42 A;  1TAU A;  3ZSW A;  3L2U A;  2QXF A;  1NKC A;  4Z4E A;  1LAW A;  4KRF A;  3CM6 A;  4FLX A;  1VSF A;  3PO5 A;  4FJX A;  3F9K A;  1NK9 A;  1J9A A;  2X78 A;  3IS9 A;  1RT1 A;  2IS3 A;  3TAE A;  3OS2 A;  3OYM A;  3L2R A;  3K2P A;  3C95 A;  3DOL A;  4MQ3 A;  1RBT A;  3K57 A;  4HTU A;  2Z1I A;  3CFR A;  1QS4 A;  2X6S A;  3VQ5 A;  4ID1 A;  5HLF A;  1C0M A;  1LWF A;  2ETJ A;  2VG6 A;  2HHX A;  3AVG A;  4E89 A;  1RTJ A;  4PA1 A;  1WSG A;  4JLH A;  4Q5V A;  4EP5 A;  3THV A;  4O0J A;  3OYC A;  4ELU A;  5FRM A;  4J2B A;  4B9V A;  3QNN A;  1RTD A;  3VQ8 A;  3C6U A;  4WE1 A;  3QET A;  1S1T A;  3TAB A;  4KKO A;  4CIG A;  3O3H A;  3IG1 A;  1BHL A;  1QE1 A;  1WAJ A;  4M3R A;  2DFE A;  4IDK A;  3TAM A;  3AVL A;  1VK0 A;  1S6Q A;  4N47 A;  1TKT A;  5C42 A;  4RW8 A;  3ZSV A;  4DQQ A;  4FM2 A;  1IKX A;  3LZJ A;  3U3Y A;  5I42 A;  3K59 A;  1BI4 A;  1QHT A;  2YHA A;  1G15 A;  3OYF A;  1RCH A;  1TL3 A;  1IKY A;  1ZBU A;  3NGI A;  4E7L A;  1SL0 A;  4KI6 A;  1Y97 A;  1R0A A;  1JLG A;  3S3N A;  4Z4F A;  4NCG A;  3SV4 A;  1C1A A;  3TAF A;  1L3U A;  1F21 A;  3KD1 E;  3KK3 A;  4CJL A;  4FJI A;  1DTQ A;  1RDB A;  1BQM A;  2O4G A;  3ZSX A;  4ELT A;  3NF7 A;  4BE1 A;  4BE0 A;  1HJR A;  1WSJ A;  4L8R B;  3VQE A;  1HNI A;  1WSF A;  4CES A;  1LAV A;  4CIF A;  3LDS A;  2PYJ A;  4CJF A;  4N76 A;  3K5M A;  5J2Q A;  4B9T A;  1B9D A;  1BCM A;  2JGU A;  3AV9 A;  4DQS A;  4CJE A;  1WSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...