2ETJA

Crystal structure of ribonuclease hii (ec 3.1.26.4) (rnase hii) (tm0915) from thermotoga maritima at 1.74 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
221
structure length
211
Chain Sequence
b'MGIDELYKKEFGIVAGVDEAGRGCLAGPVVAAAVVLEKEIEAKRERLLDEIMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKPSFVLVDGKGIELSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRMYPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPVLELLTDDLLREFFEKGLISENRFERILNLLGAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title Crystal structure of Ribonuclease HII (EC 3.1.26.4) (RNase HII) (tm0915) from THERMOTOGA MARITIMA at 1.74 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 68
structure length 211
sequence length 221
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2etjA00
3DLEA 4Z4GA 1BQMA 2HNDA 2G8FA 3DLBA 3KLEA 2A1RA 1DTQA 1SL1A 1VSMA 1KFSA 1CLQA 4B9TA 4CCHA 4JLHA 3HO1A 3QETA 1X9SA 4DSJA 4M3XA 4DS4A 4CIFA 2HHSA 3OYEA 1RT6A 2D5RA 2D0BA 3HVTA 4CJVA 4DSIA 1QQCA 4KPYA 1UA0A 2OPSA 3V1QA 1BI4A 3SQ4A 1ZBIA 3WNEA 3VQ7A 3O3GA 3AVFA 1XI1A 4BWJA 3NFAA 2VG5A 4LSLA 3OS0A 1HPZA 3E01A 1A5XA 3PX0A 4J2EA 3D0PA 5E41A 4C8KA 4NCBA 4K8XA 1NOYA 4KFBA 1FK9A 3NGZA 3V9UA 3NGYA 3ZT4A 1HYVA 3O4QA 1JL1A 2KFNA 5I42A 3NDKA 3HT3A 4AHRA 2YNIA 4KI6A 1ASUA 2IDOA 4E1NA 1RTIA 4DSEA 3QEXA 2QXFA 4FLYA 1JLBA 3NF7A 3AA4A 1NK8A 4RW7A 2HB5A 1U49A 3T19A 4QCLA 4FXDA 1VRTA 3DRSA 1J9AA 1VSFA 4DQRA 3L3UA 1XWLA 2YKMA 3L3VA 1HNIA 4CEEA 1WSEA 3F73A 3V6DA 1IH7A 1LAVA 1A5VA 5HRRA 2YV0X 4B08A 3K5MA 1R0AA 1RT5A 3SUOA 4CF0A 4M3TA 4KRFA 3K5OA 3KLGA 3OS1A 3SV3A 4F4KA 4KV8A 4AHSA 1BCOA 4CJWA 4FCYA 4KO0A 4CHYA 3SJJA 1XC9A 4CESA 4B8AB 4DTSA 4FJMA 3B6PA 3DMJA 2QKBA 3V1RA 4E19A 1WSFA 1U48A 1RNHA 2XRIA 3C95A 2FBTA 5HBMA 5KGXA 3V9SA 1QSLA 3O4NA 3RR7A 5HP1A 1RILA 1Q9XA 4E7HA 4DQQA 3LP1A 4C8OA 4YNQA 2NUBA 4CGIA 3MXMA 5FRNA 1LW0A 5C42A 3KLHA 1UAXA 4W5NA 2JLEA 3SQ1A 4CHOA 1EP4A 2G8UA 1ZBUA 1SKSA 3SV4A 4FZZA 1CZ9A 3NF9A 1G15A 1NKCA 3ZSRA 1NKEA 1QE1A 2DFFA 4FJKA 3K5NA 1T7PA 1QTMA 4CJSA 3I8DA 3TAFA 4ELTA 2F8TA 3MEDA 4JS4A 1C0TA 4FLXA 3TAGA 4J2DA 4DU3A 3M8QA 3ZSOA 3VQCA 3AVAA 1A5WA 3CYMA 3ISNC 2BE2A 4DTJA 2XY8A 3RMAA 2FC0A 3SUQA 2E4LA 4PY5A 4EZ9A 4ZTJA 4OKJA 4KAZA 4BDZA 3T1AA 4RW4A 3MEEA 1DTTA 3MXIA 1SL2A 4C8NA 4M45A 4CGJA 4H4MA 1RBRA 4N5SA 1NK0A 3KTQA 4B9SA 4DFKA 4DTXA 3PO4A 4FK4A 1ITGA 1HRHA 3DI6A 4O5BA 5KI6A 3WNHA 3P1GA 4O0IA 3NGIA 3M8SA 3DRPA 3G0ZA 3QEWA 2P1JA 1KVAA 4W5TA 4H4OA 1Z26A 2PY5A 4IFVA 3DOLA 1JLCA 3G10A 3TAEA 4RW8A 3AVKA 1ZBFA 4CEOA 1HYSA 3AVHA 4CIGA 4CFDA 4UQGA 3KD5E 1KCFA 4M41A 3VQEA 2HHTA 3MEGA 3K58A 1JLQA 1TK5A 3CFPA 3LP2A 4RW6A 5KTQA 4KREA 4QOZB 2RPIA 4JRQA 3VA0A 2YKNA 1RBVA 4I2PA 4DTUA 3AVNA 4CHPA 1NK4A 4NCGA 1LWEA 1N6QA 1S5JA 3VQ4A 4Z4FA 2XO7A 4BACA 4RW9A 5KRTA 4DF8A 1L3SA 1U04A 3RWUA 4M3YA 3OJSA 3K5LA 3RMCA 3CM5A 5D3GA 3P83D 3VN5A 1DLOA 1CXUA 4W5RA 1BQNA 4CEQA 2IGIA 1UOCA 2IC3A 4FLTA 4Z4HA 1L5UA 1BL3A 1NKBA 4ID5A 3TWHA 4KTQA 2I5JA 3HM9A 2X6SA 1CXQA 2ZE2A 3OYKA 1RTHA 3HXMA 2PYLA 1FKOA 4OGEA 3AVIA 4O4GA 4CK2A 3CG7A 4B9UA 5CY4A 3L2QA 3AVJA 3HP9A 1I3AA 2HNZA 4CK3A 3OYLA 4PWDA 3VQ8A 3ZSZA 1HNVA 1VK0A 3LAKA 3JYTA 1B9DA 3V9ZA 2BGGA 4AH9A 4EP4A 4L8RB 4LH4A 3VQPA 3L8BA 4MQ3A 3CFRA 1QS4A 1RCHA 1JL2A 3VA3A 2B5JA 3HL8A 1J5OA 4CJLA 4Z0UA 4CJKA 3AVLA 3L2RA 4B9MA 2HHXA 4OJRA 3AO3A 3AO5A 4E1MA 3HJFA 5I3UA 4FJ5A 4E0DA 1TL3A 3CM6A 5DMRA 4DS5A 3U3YA 4DTOA 1YTUA 2B6AA 3VQQA 4AHVA 3OYHA 4H8KA 1REVA 2Z1IA 1IKWA 1EXQA 5C25A 2G8WA 2Q3SA 3DLKA 3ZT2A 3HPGA 4CGFA 1KVCA 1JLGA 1WN7A 3DLHA 4HVJA 4N76A 1IKXA 1L3TA 2OZSA 4F2SA 1N5YA 4CJRA 2VG7A 4I7FA 4LSNA 3IRXA 2DFHA 2FBVA 4HTUA 3KK3A 3SPYA 5SWMA 4K8ZA 2HVHA 3SYZA 3MXJA 1WSIA 4F2RA 4DSFA 3AVGA 2WOMA 3VQDA 2EHGA 3HSTB 5JS2A 3TARA 4M3RA 1RDCA 4C8MA 4BE0A 1S9GA 1XHXA 4DSKA 2W42A 2OPPA 4CF8A 3KIOA 4DTRA 4DQPA 2DTUA 1RBTA 1JLFA 3IS9A 3QIPA 4RG8A 3V1OA 4N41A 4PQUA 4FM1A 1S1VA 3AV9A 2RF2A 3DRRA 2ATQA 5FDLA 1TGOA 3ALYA 3NF6A 4CHZA 4NYNA 1VSIA 1FXXA 1S6QA 2P51A 1W9HA 3CFOA 1ZBHA 3EZ5A 1ZBLA 1LWFA 4FZXC 4J2AA 1MU2A 3QIOA 4B9LA 4Z4EA 3AVCA 1QSYA 4GMJB 2PZSA 2DY4A 2P5GA 2FBXA 3LP3A 1ASVA 3NH0A 1K6YA 3NH1A 1FKPA 1BHLA 2G8HA 4KHUA 3ITHA 3AVMA 4IDKA 4FJIA 1TAUA 1JXEA 1SV5A 1S9EA 1RT3A 4I9LA 3QNNA 2ETJA 1KSPA 1LW2A 1VSLA 4O44A 3KKSA 3L2VA 4JS5A 2KTQA 1C0MA 4DF4A 3AVBA 1Y97A 5HLFA 3IAYA 1NK9A 1TAQA 1S1UA 3OS2A 3KLFA 1TKXA 1UWBA 1Q9YA 3O3HA 2Z1JA 2E6LA 3LAMA 1D5AA 4CERA 4AHTA 4DTMA 1TVRA 1D8YA 5FRMA 4AHCA 3LWMA 4DLGA 1T03A 3SPZA 2IOCA 4C8LA 4FJGA 3LALA 4CEZA 1VRUA 4ZTFA 2HVIA 4B9VA 3LZJA 3C94A 4OPJA 4F3OA 3DYAA 2XY7A 1SKRA 2XY6A 4LY7A 4BDYA 3TI0A 3VQ9A 3QEVA 5J2QA 1KFDA 1KVBA 3TAMA 3L2WA 1IG9A 2E6MA 4FZYA 4PUOA 4E7JA 3HVRA 1WAFA 3CQ8A 1IKVA 4HHTA 4F8RA 1D9FA 1RT2A 4DSLA 4PA1A 4OGCA 4OPKA 4FJ7A 2Y1JA 2HHUA 2FBYA 4B3OA 1RDAA 3NBPA 5HRNA 3EY1A 4GVMA 1S1XA 2OA8A 4AHUA 4CEFA 4CHNA 4QAGA 4KKOA 1F21A 3H08A 3OYIA 3F9KA 3ZSYA 4DFJA 4N56A 4KHYA 1GOBA 3NAEA 1D9DA 4E7LA 1J53A 1O1WA 3KD1E 3DLGA 4JRPA 1W0HA 3SCXA 1QHTA 1X9MA 3HK2A 2KZZA 2KZMA 3RRHA 4DTPA 4BWMA 1EX4A 3WNFA 1C1BA 4ELUA 2D0CA 2HNYA 3ZT3A 3QESA 3OYAA 1ASWA 2VG6A 3OVNA 3QO9A 4IBNA 4KTWA 2YHAA 4DMNA 3OYFA 4CGDA 4FLVA 2O4IA 3OYGA 2OPQA 3T3FA 2KW4A 4FJNA 2KQ2A 4CFCA 2X78A 1X1PA 4CF2A 4BE2A 2DFEA 1BI4B 1WSJA 4ICLA 3NHGA 1EKEA 1KLNA 4DQIA 1RTDA 3OJUA 2YNHA 1SUQA 3TAPA 4M3WA 2HHWA 4FLWA 1RT4A 3LZIA 1HYZA 3AA5X 5CYMA 4OKKA 2D0AA 2XHBA 1VSEA 3DLRA 4FJHA 4ID1A 1I39A 4Q5VA 4CFAA 3V81A 1NJXA 4CJQA 2XY5A 1HMVA 3P5JA 2X6NA 3RR8A 4N47A 2Z1GA 2A1SA 2KFZA 3AA3A 3KK2A 4Y1DA 3SI6A 2OYQA 2HW3A 3V9WA 1RTJA 1TV6A 3VQAA 1U4BA 4HUEA 1BGXT 1C1CA 2YNFA 4CHQA 3OYBA 1BCMA 4DTNA 1WSHA 2IS3A 4KTZA 4CGHA 3KK1A 4Z4CA 2VWKA 2YNGA 3OYJA 3PX6A 5C24A 3ULDA 5HRSA 4KHQA 4XIUA 2BANA 4CJ5A 3QEPA 4MFBA 1VSJA 2G8IA 5J1EA 4BDPA 4KB0A 1SL0A 1IO2A 4FW2A 1NK5A 3RMBA 3QLHA 3PX4A 1U47A 3SNNA 1U45A 2OZMA 1C0UA 4O55A 4J2BA 3JSMA 4CIEA 1NJYA 1LV5A 2ITGA 2P5OA 3SZ2A 2BDPA 3V4IA 2R7YA 3MECA 3NF8A 1WAJA 4FK0A 3AO4A 2OPRA 4CK1A 3OYCA 4HCCA 2VWJA 4CJUA 4DQSA 3ZSXA 1B9FA 4IG0A 1RT1A 3NE6A 4CFBA 2HMIA 4FM0A 3WNGA 4YFUA 1Z25A 1WNSA 2QKKA 4M42A 3C6UA 4I2QA 3M8PA 5J2MA 1XHZA 1YTAA 2PYJA 4TSXA 4IKFA 4OLAA 4FLZA 3OY9A 1LAWA 5KGWA 3ZSVA 4FJ8A 2GUIA 4LD0A 4CJFA 3PV8A 3ZT1A 3BGRA 3B6OA 2O4GA 3RRGA 1VSHA 3AO2A 4FJXA 4E7KA 3LDSA 1TL1A 3ZT0A 2ZQBA 5CZ1A 1JLEA 3D45A 4CJEA 4CJ4A 1B92A 2F96A 4CJPA 3VQ6A 1RT7A 5CZ2A 5DK5A 1GOAA 1NJZA 4Q0BA 3SUPA 5CYQA 4DG1A 4WE1A 2HHQA 5EU7A 1WLJA 4E7IA 1KTQA 3KLIA 4AILC 2YHBA 4CEDA 4CF9A 3RMDA 4BE1A 4FW1A 5J2PA 4I9QA 1JXBA 4Z4IA 1JKHA 3LPTA 2QK9A 3U3GA 1Q8IA 1VSDA 2Z1HA 2ZD1A 4R5PA 3U6FA 3SQ2A 1NOZA 2B4JA 1L3UA 2G8VA 4DFPA 4DWIA 4NCAA 3OYMA 1L3VA 4CF1A 1TKDA 3PUFA 4LH5A 4CE9A 5SZTA 3V9XA 3RTVA 2WONA 3O3FA 3TANA 3TABA 2HHVA 3HPHA 1LWCA 1HQUA 3S3NA 5K14A 3DOKA 3VQBA 4DU4A 4E89A 4CEAA 1HQEA 1NK6A 3UIQA 4W5QA 4HCBA 3K2PA 1RDDA 3QEIA 1CZBA 1KRPA 2X74A 3S9HA 3TAQA 3IG1A 1T05A 1BIUA 3LPUA 3KJVA 3C6TA 4DU1A 1SKWA 1QSSA 2G8KA 5KRSA 3BDPA 4FJJA 3EYZA 4W5OA 3NCIA 4FK2A 3M8RA 3K57A 3L2UA 1VSKA 4O0JA 2IAJA 3HP6A 4KB1A 3NH2A 3PY8A 3TR8A 4HUGA 3DM2A 4G1QA 1S1TA 4OVLA 4KHWA 4FJLA 3LANA 4CGGA 5HROA 4OKEA 3AA2A 4GW6A 3I0RA 1ZYQA 4FYDA 1BIZA 4IFYA 4KI4A 2GV9A 4NYFA 2RKIA 4EZ6A 3LP0A 4M3ZA 1TK0A 5FROA 1EETA 4IG3A 4FJ9A 4KHSA 4B9NA 5HRPA 3K59A 3ASMA 3SUNA 1S1WA 1TKZA 1KLMA 1RBUA 3VQ5A 3QNOA 1J54A 1X9WA 1C6VA 4HUFA 3MAQA 4CJ3A 5T7BA 1C1AA 3LWLA 4E3SA 1RDBA 1RBSA 4FLUA 3OYDA 3SQ0A 5J2NA 1T8EA 3QERA 1TK8A 3I0SA 2F8SA 3ZSWA 3HYFA 4ZHRA 1TKTA 3FFIA 4CEBA 1IKYA 1NJWA 3HPOA 2RN2A 1BISA 2Y1IA 1GOCA 1NK7A 4CECA 3THVA 3S3MA 3PO5A 4B8CA 4KHNA 3QINA 1WSGA 3S3OA 1UA1A 2JGUA 3ZCMA 4EP5A 1JLAA 1YT3A 1YVUA 4M3UA 3AO1A 4ELVA 3KKRA 4Y1CA 4OLBA 5JS1A 4DFMA 4FVMA 3ZSQA 4DLEA 2LSNA 4F3TA 1S6PA 2AJQA 2GBZA 4CJTA 4FM2A 3OYNA 3A2FA 2EX3A 1HJRA
chains in the Genus database with same CATH superfamily
2HNDA 2G8FA 2A1RA 1DTQA 4UY8O 1VSMA 3QETA 3MWTA 4CIFA 3A5NC 1RT6A 1P90A 3AARA 5GAHP 4KPYA 3V1QA 3SQ4A 3ENHA 3SBGA 3O3GA 4BWJA 5LMUK 1MWKA 3E01A 5AQWA 4LFBK 3D0PA 5E41A 3SMPA 4A5AA 2KFNA 3ZT4A 5IWAK 3O4QA 3HT3A 5AZIB 4DSEA 3NF7A 3AA4A 2QWQA 3BF3A 1HNIA 1WSEA 1IH7A 1LAVA 4GV3A 2YV0X 3CCUN 4CF0A 4M3TA 4AHSA 1BCOA 4CJWA 4CESA 4JKCA 1M90O 4WCEL 4E19A 1WSFA 4IOXA 1RNHA 2XRIA 2HVIA 1QSLA 5JLHA 1Q9XA 2YI1A 3LP1A 4DB3A 4CHOA 2G8UA 3M5RA 4O8UA 3VERA 4FZZA 1CZ9A 3L6QA 3NF9A 5A2QO 4B3SK 3ZSRA 4BQZA 2OTLN 3TAFA 4CZKA 3MEDA 1C0TA 5AQTA 3O1WA 3MCPA 3O80A 3ZSOA 1A5WA 3CYMA 4JNEA 3VMFB 3TPQA 3LL3A 3VEVA 4KAZA 5JICA 4CGJA 3KTQA 4DTXA 1HUXA 1NM1A 1ITGA 1HRHA 3EKSA 5KI6A 3NGIA 3M8SA 4A2AA 3G0ZA 3QEWA 2P1JA 1KVAA 3G10A 3TAEA 3RSEB 1QQOA 3SK3A 2QW9A 3AVKA 1FW6A 1HYSA 3AVHA 3I33A 2YHXA 4DQ8A 2Q97A 3VQEA 5GAGP 5KPZA 1C0GA 3K58A 1JLQA 1TK5A 4RW6A 5KTQA 3VA0A 1OVQA 3VPZA 1WB9A 1N6QA 4BACA 4RW9A 3A8YA 5KRTA 5CHIA 2GEMA 3J7YP 3VN5A 1W97L 2A40A 3JAMO 4FLTA 5MLCQ 2I7PA 1NKBA 4ID5A 4KTQA 2X6SA 5M1FA 3OYKA 3CCSN 3AVIA 3CG7A 3TU5A 3AVJA 4BGBA 4PWDA 3VQ8A 3ZEUA 1VK0A 1ATSA 3MN9A 3SMSA 1Q81O 2D4WA 3CFRA 4EFHA 4BY9C 3LM9A 4H5WA 4Z0UA 4CJKA 1YITN 1KAZA 1NGIA 4DTOA 2B6AA 5BRHA 3VQQA 1JCEA 2Q3SA 4CGFA 2VGNA 3VGKA 3DLHA 2UXBK 4QS8A 3LM2A 1BA0A 3EE9A 4BROA 2OZSA 4F2SA 4I7FA 3CC7N 4H0TB 4BR4A 3IDHA 5SWMA 4EAHD 2BTFA 4XH4A 4F2RA 3VQDA 2WOMA 2EHGA 3H45C 1XC3A 5JS2A 1RDCA 4BE0A 3THXB 4CF8A 1RDUA 3QIPA 4RG8A 4PQUA 1S1VA 3DRRA 4BC2A 2ATQA 5FDLA 5FPMA 1TGOA 1HJOA 3ALYA 4JKDA 3VENA 3THYB 1YJWN 1W9HA 3T7ZA 1ZBHA 3MN5A 1ZBLA 4IWVA 4B9LA 1GLFO 2E8AA 4IO8A 3THWB 4CD1A 5KQ8A 2PZSA 4GMJB 3LP3A 1ASVA 3NH0A 1K6YA 3T69A 2J4RA 3ITHA 3TTDA 5AQOA 3QNNA 5F0XA 2KTQA 3KKSA 4JS5A 4PKIA 3IAYA 4DV3K 3FZKA 1D8YA 4DTMA 4FOEA 1TVRA 5AQSA 4KBOA 4DLGA 1HPMA 2KKZA 1ZC6A 4F3OA 3ENBA 4OPJA 3AAPA 1QZ5A 1SKRA 2GUPA 2XY6A 4LY7A 3NMUA 2W41A 3TI0A 2UYTA 3TTCA 1IG9A 4E7JA 4WQ5C 3PSFA 4BRGA 4WFAL 2FBYA 4B3OA 3C65A 3EY1A 1S1XA 3E9LA 2OA8A 4AHUA 4QAGA 1SQKA 3OYIA 4DFJA 3C7NB 1D9DA 3KD1E 4JRPA 1W0HA 3WXJA 1QHTA 3SCXA 1EX4A 4JKHA 1K9MO 1H1VA 2D0CA 2HNYA 3QESA 1VHXA 2VG6A 3I8BA 4KTWA 3QO9A 4FLVA 3J8AA 3T3FA 4CFCA 5KPRA 4H0OA 4BC5A 4BE2A 4BG8A 5M1KA 1BI4B 3NHGA 3CIPA 3OJUA 1TYQB 2P9IB 3ZX2A 1RT4A 5CYMA 4I6MA 3FZMA 3DLRA 5BREA 3DLLL 1I39A 3K9JA 3V81A 4CJQA 2XY5A 1HMVA 1WBBA 4PKGA 2A1SA 4Y1DA 3VQAA 4FWPA 3OYBA 2IS3A 3PX6A 2IIRA 3O9SA 5C24A 1I94K 3QEPA 4KB0A 2OTJN 3QLHA 3SNNA 2P9PB 1XUPO 1C0UA 4O55A 5EY4A 2ITGA 1LV5A 2CGJA 3V4IA 2R7YA 3NF8A 4DUYK 1WAJA 4FK0A 4IEIA 1GLBG 3OYCA 1QZ6A 5AQHA 3ZSXA 4JI1K 2QKKA 4M42A 3ZETA 1YTAA 2NRWA 3HOSA 2HOEA 4DUZK 1WUAA 4IKFA 4JKBA 3ZSVA 4LF9K 2D0PA 1J6ZA 3BGRA 2O4GA 3AO2A 4GY2B 3O08A 1TL1A 3OW2M 3UE5A 4BRFA 1BWFO 4JK9A 3ULEA 1RT7A 2O8DA 1GOAA 2IVOA 3SUPA 4XH1A 2KHOA 4E7IA 4CEDA 1JXBA 2QK9A 4R5PA 1GLLO 2Z1HA 2Q2RA 4NCAA 3H3NO 4ILGB 1JCGA 1M1KO 1TKDA 3C6AA 4LH5A 4CE9A 2HHVA 5LMNK 4YOVA 5K14A 3VQBA 4CEAA 1HQEA 3H3OB 3K2PA 1RDDA 2O8FA 2V7YA 2UU9K 4KHPK 5AQUA 4IOCL 4BR2A 3DXKA 3SAFA 3NCIA 1K8KA 3WXKA 3ATUA 4IO9L 3CI5A 1MWMA 2I7NA 4G1QA 1EWQA 3RVCA 2CH5A 1ZYQA 2GV9A 4NYFA 4EZ6A 1TUUA 4BREA 1IBMK 1NGGA 4DR4K 4IG3A 3CMAN 4H0XB 4HTLA 2QA4N 3SUNA 1KLMA 3VQ5A 2P9SA 1IG8A 1X9WA 4HUFA 4WFBL 1RDBA 2E88A 4BRHA 4ZHRA 1TKTA 3FFIA 5CE3A 2WC9A 3A5OC 1NK7A 3VOVA 3THVA 1QQNA 3QINA 1UA1A 1MA9B 1X9JA 3ZCMA 1YVUA 1G99A 3AO1A 3D2EA 4DLEA 5E84A 2YHYA 2AJQA 3AGKA 4KH4A 3LDOA 5EVZA 2EX3A 1U6ZA 2VYPA 4A62A 4BRCA 3DLBA 3Q7BA 2P9LA 4JLHA 3U4LA 4DSJA 4DS4A 2D5RA 2D0BA 3HVTA 2FF6A 2ZJPL 5AQZA 1ZBIA 4ILHA 3EKUA 3WNEA 2P9NA 3OS0A 3O9QA 5JVHL 1A5XA 2QWLA 4J2EA 4NCBA 3CJ9A 5LL6Z 4LF5K 3V9UA 3NGYA 2BUPA 1ASUA 2IDOA 2HHHK 1RTIA 4BRQA 3QEXA 2QXFA 3DJCA 2HB5A 4QCLA 1S22A 3DRSA 1W7AA 1HKCA 1VSFA 2NRVA 4DQRA 2QWOA 3L3VA 2WFBA 4FWLA 2O8EA 3WEEA 4B08A 3TTFA 3M3ZA 4KRFA 3K5OA 4KV8A 3R6MA 4FCYA 4KO0A 4CHYA 1VAZA 4DTSA 3HBTA 3B6PA 4FO0A 3C95A 3V9SA 2FBTA 4FWMA 5HBMA 3RR7A 3O4NA 5AQNA 3P31A 1K73O 4WQ5A 3FZFA 1EP4A 1NWKA 1SKSA 3SV4A 4DR7K 1G15A 1NKCA 1NKEA 1QE1A 3K5NA 1SZ2A 4ELTA 3VEOA 3J80O 1WBDA 4YOYA 5AQYA 4DU3A 3VQCA 3BP8A 1KAYA 3PIOL 1BU6O 3U9ZA 4OKJA 4RW4A 3MEEA 1SL2A 2IVPA 3O9RA 1NK0A 1RBRA 4DFKA 2HSTA 1NGCA 4O0IA 3WNHA 4WF9L 4Y0WA 5EOYA 3IUCA 2RE2A 3UKRA 2PY5A 4GV9A 2D0OA 5HL7L 4CEOA 4CIGA 2GTDA 4CFDA 1E3MA 2P9UB 2HHTA 1BA1A 3LP2A 3AAQA 5E26A 4I2PA 4MDAA 3SAHA 3VQ4A 4NB4A 4U67L 4CVNE 3OJSA 4BC4A 3CHWA 4DR5K 3P83D 1DLOA 1CXUA 4CEQA 2IGIA 2IC3A 2HMPA 4Z4HA 4YOXA 1IJJA 1L5UA 2VGMA 3TWHA 3BUZB 1RTHA 5CY4A 3L2QA 4CK3A 1I3AA 4O5FA 4Z94A 1HNVA 3JYTA 4JI6K 4CZLA 3KWGA 4EP4A 4CZEA 4MQ3A 5ADXA 3T1HK 3HL8A 1J5OA 2QWPA 3DXMB 2ZJRL 4B9MA 3G71N 4OJRA 1NNEA 1O13A 4JAXA 3HJFA 5I3UA 4E0DA 1TL3A 3KVGA 1QQMA 5LY3A 1V4SA 3GE1A 3OYHA 1REVA 2G8WA 1IKWA 3UB5A 1HKBA 2YX6A 3HPGA 2UXDK 3P39A 1JLGA 1WN7A 2NNWA 4DV6K 3EN9A 3VEZA 2VG7A 2ZF5O 2FBVA 3IKMA 4K25A 3MXJA 4BRIA 3CC4N 3HSTB 4B1ZA 3TARA 4M3RA 1S9GA 1XHXA 2W42A 2DTUA 2ZJQL 4IOAL 2PFUA 3IS9A 3V1OA 1KQSM 2Q31A 4CHZA 3NF6A 5I9EB 4WFNL 4NYNA 1KD1O 1FXXA 3CFOA 2DY4A 4FWOA 1X3MA 2FBXA 4BVOA 4G9ZA 4GV6A 2O8CB 1BDGA 1BHLA 1FKPA 2QEXN 1NGBA 3AVMA 4IDKA 4FJIA 1JXEA 4YOWA 2ETJA 1GLEG 1LW2A 1VSLA 4O44A 3L2VA 5AQLA 1HJRA 4DR6K 3O5BA 1OKJA 1NK9A 4AM7A 1TKXA 2H3GX 2E6LA 2YJEA 1D5AA 4B1XB 4AHTA 3LWMA 4CJ7A 4M7YA 4AM6A 4FJGA 4CEZA 1VRUA 1BG3A 2E2PA 1VQON 5M1PA 5J2QA 1KVBA 3L2WA 2E6MA 4PUOA 3CQ8A 1NU0A 4PA1A 4OPKA 2UUBK 2HHUA 2Y1JA 4YHHK 4XEIA 3NBPA 4AF1A 4H5TA 3OBYA 4WQ4C 3IFRA 1N33K 4EIAA 3IMXA 5JMVA 1HNWK 4H03B 1GOBA 3NAEA 1J53A 4BRMA 3DLGA 3HK2A 4IJAA 2IVNA 2KZMA 3HZ6A 4KH6A 4C23A 1ESVA 3OYFA 2HBLA 4K43A 4CGDA 4CZMA 3MWPA 2ASOA 4FJNA 1X1PA 3D6RA 4CF2A 2DFEA 1Q7YO 3CC2N 3CCRN 4ISGA 1E4GT 1SUQA 3R3LA 5EX5A 4IZ9A 1YAGA 1VSEA 2NRHA 3O9TA 4A5BA 5BPLA 1T6DA 4ID1A 1NJXA 4NXNK 2Z1GA 2EWSA 4YY3K 1TV6A 1U4BA 4HUEA 4CHQA 3UKUA 3OYJA 2PAVA 4X66K 2BANA 4MFBA 2G8IA 5J1EA 4FW2A 3CCVN 2OZMA 3PX4A 4IXCA 1U45A 4FOIA 2FLOA 3GL1A 4J2BA 1Y64A 3JSMA 2BDPA 1VQ8N 4CZIA 4CK1A 4HCCA 2VWJA 4IG0A 3CMEN 1RT1A 3NE6A 4CFBA 4FM0A 1WNSA 3J7ZO 4I2QA 1XHZA 3PSIA 3CPEA 3A5MC 1ATNA 1NMDA 4JYAK 4FJ8A 3CJAA 3PV8A 4FJXA 1VSHA 3LDSA 3ID6A 3WXLA 1JLEA 4CJ4A 4CJEA 2F96A 3QMLA 5CZ2A 1VQ7N 2ZGZA 1NJZA 4XH5A 4Q0BA 5GINA 4M7XA 5EU7A 1WLJA 1KTQA 3KLIA 3RMDA 4DV0K 5J2PA 1JKHA 3LPTA 3U6FA 3G4SN 3J7AP 2B4JA 4DFPA 4DWIA 4CF1A 3PUFA 3TANA 1V4TA 2WONA 4PHTX 1HQUA 2QM1A 1FJGK 2FSKA 3DOKA 3EO3A 4DU4A 1OH5A 2Q1NA 1NK6A 5AQGA 4ILJA 3QEIA 1KRPA 3TAQA 5B8HA 4DU1A 1QSSA 3BDPA 1BUPA 4W5OA 4FK2A 4CW7B 3CERA 3M8RA 3K57A 1SAZA 4MLEA 2HBKA 3DM2A 1S1TA 4KHWA 2NRTA 4FJLA 4CGGA 4GW6A 3O6WA 3B8AX 5AQFA 4DCHA 4FJ9A 4BRLA 3E9OA 3ZEUB 4BRNA 5H1SQ 1RBUA 3KWIA 1NGAA 1C6VA 4E3SA 2OANA 4CJ3A 3CJ7A 3LWLA 4FLUA 3MMVA 3QERA 1TK8A 4CEBA 5BR9A 3HPOA 4JD2A 1BISA 2QWNA 4CECA 4NXMK 3FZHA 4JKAA 1T6CA 1JLAA 3L4QA 2F9TA 4Y1CA 2QTDA 5JS1A 4DFMA 1RDWX 2LSNA 4DHYA 4F3TA 4JI2K 4BR5A 3A2FA 4Z4GA 1RGIA 3TSPA 1BQMA 2ITMA 1KFSA 5LJVA 5AJ3K 4B9TA 4CCHA 1X9SA 2O8BA 4M3XA 2NRRA 3OYEA 4CJVA 4DSIA 3R9PA 1OH6A 3EEQA 2PBDA 1UA0A 2OPSA 4BVPA 3G25A 3NFAA 1X3NA 4GKJK 4LSLA 3VTIA 3KZBA 3JS6A 3PX0A 4C8KA 4K8XA 3NGZA 2VQFK 1JL1A 4JI3K 2YNIA 4E1NA 4M63C 4FLYA 1WOQA 1JLBA 4PL7A 4RW7A 1U49A 3VGLA 4LC9B 1VRTA 1N34K 1J9AA 1GLAG 5AQVA 4CEEA 3F73A 3U8XA 2QXLA 1A5VA 5C15A 1NJIO 1R0AA 3SUOA 4OPHA 3WXMB 3LDNA 3OS1A 3KLGA 4F4KA 3SBTA 3Q7CA 1XC9A 4B8AB 3BF1A 4FJMA 4A61A 3SAGA 2QKBA 1U48A 2E2QA 3S41A 1RILA 2WTUA 4YNQA 5FRNA 4CGIA 5IT9O 5C42A 3KLHA 1UAXA 1CZAN 1NBWA 3HOTA 3QFUA 1KXPA 4JV5K 1EO1A 2HBMA 1NGEA 4WQ4A 2F8TA 4JS4A 3TAGA 4J2DA 2BE2A 2FC0A 3FGUA 1E4FT 3SUQA 2E4LA 2V51B 4ZTJA 4EZ9A 1HLUA 4BDZA 3T1AA 2AP1A 1DTTA 3MXIA 1QVFM 4C8NA 4B9SA 1T44A 4FK4A 3DI6A 4H5VA 3QBWA 3DRPA 3FR0A 1S72N 4H4OA 4IFVA 3DOLA 1JLCA 4I6MB 4RW8A 4NLBA 1ZBFA 4JHDA 3E1YA 3H46O 3KD5E 1KCFA 4YDUC 3VF2A 3MEGA 3CFPA 5M1NA 5BN9A 4QOZB 4JRQA 2YKNA 4FWQA 4CHPA 2P9KA 1NK4A 1S5JA 1U2VA 4Z4FA 2XO7A 3H1QA 4DF8A 4IDHA 3I56N 4V19S 4M3YA 2GELA 1NGFA 4A57A 5D3GA 4OPAA 4W5RA 3C6HA 3ENOA 3G6EN 2VWBA 1HNXK 2PYLA 1CXQA 2ZE2A 3GG4A 3HXMA 1FKOA 4OGEA 1OVYA 4WYBA 4B9UA 4JKGA 3HP9A 5BRDA 4L8RB 2JWLA 3VQPA 3L8BA 3ZETB 1QS4A 1JL2A 2B5JA 3D2FA 2NLXA 4CJLA 3L2RA 5AZJA 3AO3A 1K8AO 3AO5A 4E1MA 4BG9A 5FPDA 2D1KA 5DMRA 4DS5A 2F9WA 4IFEA 3SJHA 4AHVA 4H8KA 5C25A 3DLKA 3ULEB 2O8DB 3P4IA 3MCAB 3WQUA 1IKXA 1L3TA 1N5YA 5FPNA 3IRXA 4HTUA 4K8ZA 2CGLA 2HVHA 1YF5L 3H6EA 4J8FA 1Q82O 5DM7L 2OPPA 3HM8A 3KIOA 3ZX0A 4DTRA 2HBJA 4DQPA 4FSVA 2O8FB 2F4VK 3AV9A 2RF2A 1DEJA 1BOTO 5TKWA 3A5LC 2FXUA 4X64K 4YOUA 1VSIA 1S6QA 3A0IX 3MDQA 3DXKB 3EZ5A 1LWFA 4FZXC 1MU2A 1K8KB 4DV7K 3N4QA 1QSYA 3VTHA 2P5GA 1IBKK 5AZIA 3CCJN 2G8HA 1RT3A 4I9LA 1KSPA 3AVBA 1Y97A 5HLFA 3OS2A 3KLFA 4BRPA 3O3HA 1N8RO 2Z1JA 3LAMA 5AQIA 3TSQA 1N32K 5FRMA 4CBWA 1VQ5N 1T3VA 3H1VX 3SPZA 4C8LA 3LALA 1EQYA 4B9VA 2P9SB 3LZJA 5DM6L 3ZYYX 1BO5O 4FWSA 4IJNA 4BDYA 3VQ9A 3QEVA 3TAMA 4JKFA 4FZYA 3HVRA 1WAFA 4F8RA 3FLCO 2P9KB 4OGCA 4FJ7A 4EHUA 3D2EB 3W0LA 4OO1J 3F9KA 3ZSYA 4MDBA 4N56A 2UUCK 4E7LA 5CR4A 3VF4A 3EZWA 2UXCK 2KZZA 4CZFA 2UUAK 3RRHA 4DTPA 3HI0A 3DWLA 3ID8A 5ADXH 2P9LB 3ZT3A 3OYAA 1ASWA 4IBNA 2HHXA 1TAUA 5GIPA 2O4IA 2OPQA 2KW4A 2X78A 4R79A 1QHAA 1WSJA 4DQIA 1RTDA 5GAEP 1HKGA 2P9NB 2YNHA 3TAPA 4M3WA 4MLHA 5AZJB 2JWKA 4FLWA 4FWRA 2E1ZA 3RSEA 1VQMN 4FJHA 1YVNA 4Q5VA 4LF4K 3EL2A 2X6NA 3RR8A 3VEWA 1VQKN 2KFZA 2RHKA 3KK2A 2OYQA 4BRAA 1RTJA 4YOTA 4YORA 1VQ6N 1BGXT 2YCHA 2YNFA 3CETA 1YJNN 1WSHA 5C12A 4H0PA 3O4WA 2VWKA 3MN6A 2O8EB 4KHQA 3WEEB 1ATRA 1VSJA 2WBNA 4JKEA 3DAWA 5AQJA 2Q36A 3WXIA 1NK5A 3U9DA 4DV5K 1NJYA 3QICA 4GVEA 1XMOK 2OPRA 4CJUA 5AFUA 3P38A 1B9FA 3L4IA 1YHQN 4JI0K 2HMIA 3WNGA 2W6LA 2AA4A 3C6UA 4LF6K 3M8PA 3WT0A 4GNIA 2PYJA 2GX9A 2HF3A 4OLAA 4FLZA 4CZGA 3WUHA 3C0BA 5KGWA 4HWIA 3F2KA 4LD0A 4KHUA 3KHYA 4E7KA 1NGHA 3D45A 5DK5A 3CJ1A 5CYQA 4DG1A 2YHBA 4CF9A 4BE1A 3O8MA 4I9QA 5AR0A 3U3GA 1VSDA 2ZD1A 2G8VA 1IV0A 3SQ2A 3HTVA 3UKRB 1L3VA 2YJFA 4B1WB 4RCHA 5SZTA 4DR3K 3O3FA 3RTVA 3TABA 1JCFA 3THXA 3HPHA 3S3NA 2ZWHA 5GADP 3UIQA 4HCBA 4YDUA 5F1XA 1GLCG 2X74A 3THYA 2A41A 1T05A 1BIUA 3LPUA 3KJVA 3C6TA 1SKWA 5KRSA 3EYZA 3THWA 1DT9A 3L2UA 1VSKA 4O0JA 2IAJA 5KPTA 4BQLA 3TR8A 2FSJA 2F7TA 4OVLA 5HROA 4OKEA 3I0RA 4BR9A 2A6AA 1BIZA 4KI4A 3GBTA 2A3ZA 2RKIA 3LP0A 5EXWA 1TK0A 5FROA 3K59A 3ASMA 4FVUA 1S1WA 1TKZA 1J54A 5T7BA 1C1AA 3SQ0A 1RBSA 2DPNA 3OYDA 1S3XA 3HYFA 4LF7K 1GOCA 3PIPL 1GLJO 1MDUB 3S3MA 3PO5A 4DV2K 1ZXOA 2JGUA 3M1FA 1DKGD 4OLBA 3MX5A 1DGKN 3LDQA 3CQYA 3ZSQA 3BZKA 1S6PA 1NG9A 2GBZA 4CJTA 3C7NA 1VQ9N 3OYNA 4DKWA 1KC8O 3DLEA 3VEXA 3KLEA 5AQKA 1SL1A 1CLQA 3HO1A 2HHSA 4BR0A 1QQCA 1BI4A 3MN7A 3VQ7A 1XI1A 3AVFA 1HNZK 4PL8A 2VG5A 1TYQA 4IEEA 1HPZA 2P9IA 4FL9A 1LOTB 2E2NA 1XNRK 1NOYA 3E66A 1FK9A 4KFBA 1YI2N 1HYVA 5I42A 3NDKA 4AHRA 4KI6A 4B1UB 1NK8A 4JI7K 3T19A 4FXDA 4KH5A 4OX9K 3L3UA 1XWLA 2V52B 2A5XA 2YKMA 3V6DA 3ATVA 5HRRA 5AQXA 4BC3A 4DV4K 3K5MA 1P8ZA 1RT5A 4BGAA 4LF8K 4ISFA 3SV3A 1NMNA 3HRGA 1YIJN 3SJJA 2P9PA 2GWKA 3DMJA 3NVMA 4MO5A 4X65K 1VQLN 3V1RA 5KGXA 5HP1A 3CXCM 4E7HA 4DQQA 5ELZA 4C8OA 2NUBA 3MXMA 2Q0RA 1LW0A 4W5NA 2JLEA 3SQ1A 3BEXA 1ZBUA 5FLXO 4K42A 3E9PA 2DFFA 4FJKA 1T7PA 1QTMA 4CJSA 3I8DA 2CGKA 4FLXA 2ASPA 5C2FA 4JI8K 3M8QA 3AVAA 1IBLK 3OTOK 3ISNC 3JXUA 3CCMN 1GLDG 3T1YK 4JN4A 4DTJA 2XY8A 4CZJA 3RMAA 4PY5A 1RFQA 4MO4A 4NLCA 4M45A 4H4MA 4N5SA 3PO4A 4RWTA 4O5BA 3P1GA 4RTFD 4PKHA 4W5TA 1Z26A 3CCQN 1YUWA 1SS6A 4CBXA 3GOIA 4UQGA 4M41A 4B3MK 2NZTA 5LJWA 4KREA 4B3TK 2RPIA 3QBXA 3F5TA 1RBVA 4DTUA 2BH1A 3AVNA 3UKUB 1VQ4N 4NCGA 1LWEA 3K0SA 1ZBSA 1L3SA 3CJBA 1U04A 3RWUA 3K5LA 3RMCA 3CM5A 1BQNA 1XNQK 1UOCA 5AQQA 1BL3A 1EWRA 4X62K 4FWNA 4H0VB 2I5JA 3HM9A 3VESA 4O4GA 4CK2A 3CJCA 3OYLA 2HNZA 4JI5K 3ZSZA 3LAKA 3V9ZA 1B9DA 2BGGA 3GDQA 3WQTA 4AH9A 5HOOA 4LH4A 3OA9A 2V7ZA 3FZLA 1RCHA 1C0FA 3HSCA 3VA3A 2KLAA 3FFKB 3QB0A 4B1VA 3AVLA 4LFCK 5AQRA 4FJ5A 3W3DA 2FSNA 4JI4K 2E1YA 4NO7A 3U3YA 1YTUA 1NGDA 1YJ9N 2Z1IA 1EXQA 2NRXA 1ILYA 3ZT2A 2W6KA 1KVCA 4K0KK 1Q86O 3ZLJA 2NRZA 4HVJA 3D7EO 4N76A 3FE1A 1VQPN 3R1XA 4CJRA 2OCEA 4LSNA 2DFHA 3KK3A 3SPYA 3SYZA 1WSIA 1Z05A 4DSFA 3AVGA 3K9KA 4C8MA 4DSKA 1RBTA 1JLFA 4N41A 4FM1A 4AQYK 3EE8A 2P51A 1LCUA 2YHWA 4J2AA 3QIOA 4Z4EA 3AVCA 5BPMA 1HX1A 2QWRA 3NH1A 1SV5A 1S9EA 3NVKA 4FPAA 1C0MA 4DF4A 1HR0K 3CF5L 4B9QA 4JK8A 5TKYA 1TAQA 1S1UA 5M1QA 1UWBA 1Q9YA 4DR2K 4CERA 4QS9A 4AHCA 1T03A 2IOCA 3QDKA 4ZTFA 3C94A 3DYAA 1Q18A 2XY7A 1QVGM 1KFDA 2ZM6K 4A2BA 4JD2B 3QFPA 1IKVA 4HHTA 1D9FA 5BR8K 1RT2A 4DSLA 3M6GA 4H0YB 5BN8A 4C1NK 2Q0UA 4B1YB 1RDAA 2W40A 2VQEK 5HRNA 1KAXA 4GVMA 5AQPA 4CEFA 4CHNA 4DV1K 4KKOA 3J81O 1F21A 3H08A 3O9UA 3R8EA 4U7BA 1JJ2M 4KHYA 5C2DA 1O1WA 1X9MA 4BWMA 3WNFA 3BY5A 1C1BA 4L3QA 1J5EK 4ELUA 2E5LK 3VEYA 3LDPA 3OVNA 2O8BB 4BR7A 2YHAA 4DMNA 3MX2A 3OYGA 3TSUA 2KQ2A 3L0QA 1KLNA 4ICLA 1EKEA 4FPBA 3MK6A 4O8KA 2HHWA 2ASMA 3LZIA 1HYZA 3AA5X 4OKKA 2D0AA 2XHBA 4F9OA 4QS7A 4E1JA 4CD3A 3AY9A 4CFAA 1NLVA 2P9UA 3P5JA 4N47A 5JVGL 3AA3A 2HW3A 3SI6A 3V9WA 3CQXA 1C1CA 3N4PA 1BCMA 4DTNA 4KTZA 4CGHA 3KK1A 4Z4CA 2YNGA 4K41A 2A42A 3KK7A 2QWMA 3ULDA 5HRSA 4C1NI 4XIUA 4CJ5A 4BDPA 1XMQK 1SL0A 1IO2A 3RMBA 1U47A 4LFAK 4CIEA 2P5OA 3F9MA 3SZ2A 3MECA 3VETA 3AO4A 4A59A 4DQSA 3ZX3A 4YFUA 1Z25A 5J2MA 3OHRA 4TSXA 4EHTA 1N36K 3DXMA 3OBWA 1W2BM 3OY9A 1OH7A 1LAWA 5KQDA 2GUIA 4CJFA 3ZT1A 3B6OA 3RRGA 4H5RA 1Z6RA 3ZT0A 2ZQBA 3I55N 5CZ1A 1B92A 4CJPA 3VQ6A 3VF6A 4WE1A 3SLCA 2HHQA 4AILC 2VCPA 4Z4IA 4ISEA 4FW1A 4CBUA 5BRFA 5M1OA 1Q8IA 5C10A 1L3UA 1VQNN 3VGMA 1NOZA 4GKKK 4B3RK 3OYMA 1TUYA 5FPEA 3V9XA 2E2OA 1LWCA 1OH8A 4JHDB 4E89A 3O1BA 4W5QA 1CZBA 3S9HA 5GIOA 4CI6A 3IG1A 2GWJA 3CD6N 2E20A 5JLFA 4FJJA 2G8KA 4H5NA 1U2VB 3CCLN 4FWKA 4JK7A 3HP6A 4KB1A 3NH2A 3PLAA 3PY8A 2O8CA 4HUGA 3LANA 2FF3B 2QI2A 3AA2A 3AGRA 4FYDA 4IFYA 4M3ZA 1NGJA 5AQMA 4JKGB 4DR1K 1EETA 4KHSA 4B9NA 5HRPA 3CPWM 3QNOA 3CCEN 3MAQA 2HF4A 1T8EA 5J2NA 3BZCA 3D2FB 2F8SA 3I0SA 2CH6A 3ZSWA 1D4XA 1IKYA 3LDLA 1NJWA 2RN2A 5BPNA 2Y1IA 2WUSA 4JEPA 4B8CA 4KHNA 2ZGYA 1WSGA 3S3OA 4EP5A 4M3UA 1YT3A 4ELVA 3KKRA 4BRDA 4CZHA 1XQSC 1YXQA 1R59O 4FVMA 5C0YA 4FM2A 5AFUH 5F2RA 4BRKA 3CM6A
chains in the Genus database with same CATH topology
3DLEA 4Z4GA 1BQMA 2HNDA 2G8FA 3DLBA 3KLEA 2A1RA 1DTQA 1SL1A 1VSMA 1KFSA 1CLQA 4B9TA 4CCHA 4JLHA 3HO1A 3QETA 1X9SA 4DSJA 4M3XA 4DS4A 4CIFA 2HHSA 3OYEA 1RT6A 2D5RA 2D0BA 3HVTA 4CJVA 4DSIA 1QQCA 4KPYA 1UA0A 2OPSA 3V1QA 1BI4A 3SQ4A 1ZBIA 3WNEA 3VQ7A 3O3GA 3AVFA 1XI1A 4BWJA 3NFAA 2VG5A 4LSLA 3OS0A 1HPZA 3E01A 1A5XA 3PX0A 4J2EA 3D0PA 5E41A 4C8KA 4NCBA 4K8XA 1NOYA 4KFBA 1FK9A 3NGZA 3V9UA 3NGYA 3ZT4A 1HYVA 3O4QA 1JL1A 2KFNA 5I42A 3NDKA 3HT3A 4AHRA 2YNIA 4KI6A 1ASUA 2IDOA 4E1NA 1RTIA 4DSEA 3QEXA 2QXFA 4FLYA 1JLBA 3NF7A 3AA4A 1NK8A 4RW7A 2HB5A 1U49A 3T19A 4QCLA 4FXDA 1VRTA 3DRSA 1J9AA 1VSFA 4DQRA 3L3UA 1XWLA 2YKMA 3L3VA 1HNIA 4CEEA 1WSEA 3F73A 3V6DA 1IH7A 1LAVA 1A5VA 5HRRA 2YV0X 4B08A 3K5MA 1R0AA 1RT5A 3SUOA 4CF0A 4M3TA 4KRFA 3K5OA 3KLGA 3OS1A 3SV3A 4F4KA 4KV8A 4AHSA 1BCOA 4CJWA 4FCYA 4KO0A 4CHYA 3SJJA 1XC9A 4CESA 4B8AB 4DTSA 4FJMA 3B6PA 3DMJA 2QKBA 3V1RA 4E19A 1WSFA 1U48A 1RNHA 2XRIA 3C95A 2FBTA 5HBMA 5KGXA 3V9SA 1QSLA 3O4NA 3RR7A 5HP1A 1RILA 1Q9XA 4E7HA 4DQQA 3LP1A 4C8OA 4YNQA 2NUBA 4CGIA 3MXMA 5FRNA 1LW0A 5C42A 3KLHA 1UAXA 4W5NA 2JLEA 3SQ1A 4CHOA 1EP4A 2G8UA 1ZBUA 1SKSA 3SV4A 4FZZA 1CZ9A 3NF9A 1G15A 1NKCA 3ZSRA 1NKEA 1QE1A 2DFFA 4FJKA 3K5NA 1T7PA 1QTMA 4CJSA 3I8DA 3TAFA 4ELTA 2F8TA 3MEDA 4JS4A 1C0TA 4FLXA 3TAGA 4J2DA 4DU3A 3M8QA 3ZSOA 3VQCA 3AVAA 1A5WA 3CYMA 3ISNC 2BE2A 4DTJA 2XY8A 3RMAA 2FC0A 3SUQA 2E4LA 4PY5A 4EZ9A 4ZTJA 4OKJA 4KAZA 4BDZA 3T1AA 4RW4A 3MEEA 1DTTA 3MXIA 1SL2A 4C8NA 4M45A 4CGJA 4H4MA 1RBRA 4N5SA 1NK0A 3KTQA 4B9SA 4DFKA 4DTXA 3PO4A 4FK4A 1ITGA 1HRHA 3DI6A 4O5BA 5KI6A 3WNHA 3P1GA 4O0IA 3NGIA 3M8SA 3DRPA 3G0ZA 3QEWA 2P1JA 1KVAA 4W5TA 4H4OA 1Z26A 2PY5A 4IFVA 3DOLA 1JLCA 3G10A 3TAEA 4RW8A 3AVKA 1ZBFA 4CEOA 1HYSA 3AVHA 4CIGA 4CFDA 4UQGA 3KD5E 1KCFA 4M41A 3VQEA 2HHTA 3MEGA 3K58A 1JLQA 1TK5A 3CFPA 3LP2A 4RW6A 5KTQA 4KREA 4QOZB 2RPIA 4JRQA 3VA0A 2YKNA 1RBVA 4I2PA 4DTUA 3AVNA 4CHPA 1NK4A 4NCGA 1LWEA 1N6QA 1S5JA 3VQ4A 4Z4FA 2XO7A 4BACA 4RW9A 5KRTA 4DF8A 1L3SA 1U04A 3RWUA 4M3YA 3OJSA 3K5LA 3RMCA 3CM5A 5D3GA 3P83D 3VN5A 1DLOA 1CXUA 4W5RA 1BQNA 4CEQA 2IGIA 1UOCA 2IC3A 4FLTA 4Z4HA 1L5UA 1BL3A 1NKBA 4ID5A 3TWHA 4KTQA 2I5JA 3HM9A 2X6SA 1CXQA 2ZE2A 3OYKA 1RTHA 3HXMA 2PYLA 1FKOA 4OGEA 3AVIA 4O4GA 4CK2A 3CG7A 4B9UA 5CY4A 3L2QA 3AVJA 3HP9A 1I3AA 2HNZA 4CK3A 3OYLA 4PWDA 3VQ8A 3ZSZA 1HNVA 1VK0A 3LAKA 3JYTA 1B9DA 3V9ZA 2BGGA 4AH9A 4EP4A 4L8RB 4LH4A 3VQPA 3L8BA 4MQ3A 3CFRA 1QS4A 1RCHA 1JL2A 3VA3A 2B5JA 3HL8A 1J5OA 4CJLA 4Z0UA 4CJKA 3AVLA 3L2RA 4B9MA 2HHXA 4OJRA 3AO3A 3AO5A 4E1MA 3HJFA 5I3UA 4FJ5A 4E0DA 1TL3A 3CM6A 5DMRA 4DS5A 3U3YA 4DTOA 1YTUA 2B6AA 3VQQA 4AHVA 3OYHA 4H8KA 1REVA 2Z1IA 1IKWA 1EXQA 5C25A 2G8WA 2Q3SA 3DLKA 3ZT2A 3HPGA 4CGFA 1KVCA 1JLGA 1WN7A 3DLHA 4HVJA 4N76A 1IKXA 1L3TA 2OZSA 4F2SA 1N5YA 4CJRA 2VG7A 4I7FA 4LSNA 3IRXA 2DFHA 2FBVA 4HTUA 3KK3A 3SPYA 5SWMA 4K8ZA 2HVHA 3SYZA 3MXJA 1WSIA 4F2RA 4DSFA 3AVGA 2WOMA 3VQDA 2EHGA 3HSTB 5JS2A 3TARA 4M3RA 1RDCA 4C8MA 4BE0A 1S9GA 1XHXA 4DSKA 2W42A 2OPPA 4CF8A 3KIOA 4DTRA 4DQPA 2DTUA 1RBTA 1JLFA 3IS9A 3QIPA 4RG8A 3V1OA 4N41A 4PQUA 4FM1A 1S1VA 3AV9A 2RF2A 3DRRA 2ATQA 5FDLA 1TGOA 3ALYA 3NF6A 4CHZA 4NYNA 1VSIA 1FXXA 1S6QA 2P51A 1W9HA 3CFOA 1ZBHA 3EZ5A 1ZBLA 1LWFA 4FZXC 4J2AA 1MU2A 3QIOA 4B9LA 4Z4EA 3AVCA 1QSYA 4GMJB 2PZSA 2DY4A 2P5GA 2FBXA 3LP3A 1ASVA 3NH0A 1K6YA 3NH1A 1FKPA 1BHLA 2G8HA 4KHUA 3ITHA 3AVMA 4IDKA 4FJIA 1TAUA 1JXEA 1SV5A 1S9EA 1RT3A 4I9LA 3QNNA 2ETJA 1KSPA 1LW2A 1VSLA 4O44A 3KKSA 3L2VA 4JS5A 2KTQA 1C0MA 4DF4A 3AVBA 1Y97A 5HLFA 3IAYA 1NK9A 1TAQA 1S1UA 3OS2A 3KLFA 1TKXA 1UWBA 1Q9YA 3O3HA 2Z1JA 2E6LA 3LAMA 1D5AA 4CERA 4AHTA 4DTMA 1TVRA 1D8YA 5FRMA 4AHCA 3LWMA 4DLGA 1T03A 3SPZA 2IOCA 4C8LA 4FJGA 3LALA 4CEZA 1VRUA 4ZTFA 2HVIA 4B9VA 3LZJA 3C94A 4OPJA 4F3OA 3DYAA 2XY7A 1SKRA 2XY6A 4LY7A 4BDYA 3TI0A 3VQ9A 3QEVA 5J2QA 1KFDA 1KVBA 3TAMA 3L2WA 1IG9A 2E6MA 4FZYA 4PUOA 4E7JA 3HVRA 1WAFA 3CQ8A 1IKVA 4HHTA 4F8RA 1D9FA 1RT2A 4DSLA 4PA1A 4OGCA 4OPKA 4FJ7A 2Y1JA 2HHUA 2FBYA 4B3OA 1RDAA 3NBPA 5HRNA 3EY1A 4GVMA 1S1XA 2OA8A 4AHUA 4CEFA 4CHNA 4QAGA 4KKOA 1F21A 3H08A 3OYIA 3F9KA 3ZSYA 4DFJA 4N56A 4KHYA 1GOBA 3NAEA 1D9DA 4E7LA 1J53A 1O1WA 3KD1E 3DLGA 4JRPA 1W0HA 3SCXA 1QHTA 1X9MA 3HK2A 2KZZA 2KZMA 3RRHA 4DTPA 4BWMA 1EX4A 3WNFA 1C1BA 4ELUA 2D0CA 2HNYA 3ZT3A 3QESA 3OYAA 1ASWA 2VG6A 3OVNA 3QO9A 4IBNA 4KTWA 2YHAA 4DMNA 3OYFA 4CGDA 4FLVA 2O4IA 3OYGA 2OPQA 3T3FA 2KW4A 4FJNA 2KQ2A 4CFCA 2X78A 1X1PA 4CF2A 4BE2A 2DFEA 1BI4B 1WSJA 4ICLA 3NHGA 1EKEA 1KLNA 4DQIA 1RTDA 3OJUA 2YNHA 1SUQA 3TAPA 4M3WA 2HHWA 4FLWA 1RT4A 3LZIA 1HYZA 3AA5X 5CYMA 4OKKA 2D0AA 2XHBA 1VSEA 3DLRA 4FJHA 4ID1A 1I39A 4Q5VA 4CFAA 3V81A 1NJXA 4CJQA 2XY5A 1HMVA 3P5JA 2X6NA 3RR8A 4N47A 2Z1GA 2A1SA 2KFZA 3AA3A 3KK2A 4Y1DA 3SI6A 2OYQA 2HW3A 3V9WA 1RTJA 1TV6A 3VQAA 1U4BA 4HUEA 1BGXT 1C1CA 2YNFA 4CHQA 3OYBA 1BCMA 4DTNA 1WSHA 2IS3A 4KTZA 4CGHA 3KK1A 4Z4CA 2VWKA 2YNGA 3OYJA 3PX6A 5C24A 3ULDA 5HRSA 4KHQA 4XIUA 2BANA 4CJ5A 3QEPA 4MFBA 1VSJA 2G8IA 5J1EA 4BDPA 4KB0A 1SL0A 1IO2A 4FW2A 1NK5A 3RMBA 3QLHA 3PX4A 1U47A 3SNNA 1U45A 2OZMA 1C0UA 4O55A 4J2BA 3JSMA 4CIEA 1NJYA 1LV5A 2ITGA 2P5OA 3SZ2A 2BDPA 3V4IA 2R7YA 3MECA 3NF8A 1WAJA 4FK0A 3AO4A 2OPRA 4CK1A 3OYCA 4HCCA 2VWJA 4CJUA 4DQSA 3ZSXA 1B9FA 4IG0A 1RT1A 3NE6A 4CFBA 2HMIA 4FM0A 3WNGA 4YFUA 1Z25A 1WNSA 2QKKA 4M42A 3C6UA 4I2QA 3M8PA 5J2MA 1XHZA 1YTAA 2PYJA 4TSXA 4IKFA 4OLAA 4FLZA 3OY9A 1LAWA 5KGWA 3ZSVA 4FJ8A 2GUIA 4LD0A 4CJFA 3PV8A 3ZT1A 3BGRA 3B6OA 2O4GA 3RRGA 1VSHA 3AO2A 4FJXA 4E7KA 3LDSA 1TL1A 3ZT0A 2ZQBA 5CZ1A 1JLEA 3D45A 4CJEA 4CJ4A 1B92A 2F96A 4CJPA 3VQ6A 1RT7A 5CZ2A 5DK5A 1GOAA 1NJZA 4Q0BA 3SUPA 5CYQA 4DG1A 4WE1A 2HHQA 5EU7A 1WLJA 4E7IA 1KTQA 3KLIA 4AILC 2YHBA 4CEDA 4CF9A 3RMDA 4BE1A 4FW1A 5J2PA 4I9QA 1JXBA 4Z4IA 1JKHA 3LPTA 2QK9A 3U3GA 1Q8IA 1VSDA 2Z1HA 2ZD1A 4R5PA 3U6FA 3SQ2A 1NOZA 2B4JA 1L3UA 2G8VA 4DFPA 4DWIA 4NCAA 3OYMA 1L3VA 4CF1A 1TKDA 3PUFA 4LH5A 4CE9A 5SZTA 3V9XA 3RTVA 2WONA 3O3FA 3TANA 3TABA 2HHVA 3HPHA 1LWCA 1HQUA 3S3NA 5K14A 3DOKA 3VQBA 4DU4A 4E89A 4CEAA 1HQEA 1NK6A 3UIQA 4W5QA 4HCBA 3K2PA 1RDDA 3QEIA 1CZBA 1KRPA 2X74A 3S9HA 3TAQA 3IG1A 1T05A 1BIUA 3LPUA 3KJVA 3C6TA 4DU1A 1SKWA 1QSSA 2G8KA 5KRSA 3BDPA 4FJJA 3EYZA 4W5OA 3NCIA 4FK2A 3M8RA 3K57A 3L2UA 1VSKA 4O0JA 2IAJA 3HP6A 4KB1A 3NH2A 3PY8A 3TR8A 4HUGA 3DM2A 4G1QA 1S1TA 4OVLA 4KHWA 4FJLA 3LANA 4CGGA 5HROA 4OKEA 3AA2A 4GW6A 3I0RA 1ZYQA 4FYDA 1BIZA 4IFYA 4KI4A 2GV9A 4NYFA 2RKIA 4EZ6A 3LP0A 4M3ZA 1TK0A 5FROA 1EETA 4IG3A 4FJ9A 4KHSA 4B9NA 5HRPA 3K59A 3ASMA 3SUNA 1S1WA 1TKZA 1KLMA 1RBUA 3VQ5A 3QNOA 1J54A 1X9WA 1C6VA 4HUFA 3MAQA 4CJ3A 5T7BA 1C1AA 3LWLA 4E3SA 1RDBA 1RBSA 4FLUA 3OYDA 3SQ0A 5J2NA 1T8EA 3QERA 1TK8A 3I0SA 2F8SA 3ZSWA 3HYFA 4ZHRA 1TKTA 3FFIA 4CEBA 1IKYA 1NJWA 3HPOA 2RN2A 1BISA 2Y1IA 1GOCA 1NK7A 4CECA 3THVA 3S3MA 3PO5A 4B8CA 4KHNA 3QINA 1WSGA 3S3OA 1UA1A 2JGUA 3ZCMA 4EP5A 1JLAA 1YT3A 1YVUA 4M3UA 3AO1A 4ELVA 3KKRA 4Y1CA 4OLBA 5JS1A 4DFMA 4FVMA 3ZSQA 4DLEA 2LSNA 4F3TA 1S6PA 2AJQA 2GBZA 4CJTA 4FM2A 3OYNA 3A2FA 2EX3A 1HJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLE A;  4Z4G A;  1BQM A;  2HND A;  2G8F A;  3DLB A;  3KLE A;  2A1R A;  1DTQ A;  1SL1 A;  1VSM A;  1KFS A;  1CLQ A;  4B9T A;  4CCH A;  4JLH A;  3HO1 A;  3QET A;  1X9S A;  4DSJ A;  4M3X A;  4DS4 A;  4CIF A;  2HHS A;  3OYE A;  1RT6 A;  2D5R A;  2D0B A;  3HVT A;  4CJV A;  4DSI A;  1QQC A;  4KPY A;  1UA0 A;  2OPS A;  3V1Q A;  1BI4 A;  3SQ4 A;  1ZBI A;  3WNE A;  3VQ7 A;  3O3G A;  3AVF A;  1XI1 A;  4BWJ A;  3NFA A;  2VG5 A;  4LSL A;  3OS0 A;  1HPZ A;  3E01 A;  1A5X A;  3PX0 A;  4J2E A;  3D0P A;  5E41 A;  4C8K A;  4NCB A;  4K8X A;  1NOY A;  4KFB A;  1FK9 A;  3NGZ A;  3V9U A;  3NGY A;  3ZT4 A;  1HYV A;  3O4Q A;  1JL1 A;  2KFN A;  5I42 A;  3NDK A;  3HT3 A;  4AHR A;  2YNI A;  4KI6 A;  1ASU A;  2IDO A;  4E1N A;  1RTI A;  4DSE A;  3QEX A;  2QXF A;  4FLY A;  1JLB A;  3NF7 A;  3AA4 A;  1NK8 A;  4RW7 A;  2HB5 A;  1U49 A;  3T19 A;  4QCL A;  4FXD A;  1VRT A;  3DRS A;  1J9A A;  1VSF A;  4DQR A;  3L3U A;  1XWL A;  2YKM A;  3L3V A;  1HNI A;  4CEE A;  1WSE A;  3F73 A;  3V6D A;  1IH7 A;  1LAV A;  1A5V A;  5HRR A;  2YV0 X;  4B08 A;  3K5M A;  1R0A A;  1RT5 A;  3SUO A;  4CF0 A;  4M3T A;  4KRF A;  3K5O A;  3KLG A;  3OS1 A;  3SV3 A;  4F4K A;  4KV8 A;  4AHS A;  1BCO A;  4CJW A;  4FCY A;  4KO0 A;  4CHY A;  3SJJ A;  1XC9 A;  4CES A;  4B8A B;  4DTS A;  4FJM A;  3B6P A;  3DMJ A;  2QKB A;  3V1R A;  4E19 A;  1WSF A;  1U48 A;  1RNH A;  2XRI A;  3C95 A;  2FBT A;  5HBM A;  5KGX A;  3V9S A;  1QSL A;  3O4N A;  3RR7 A;  5HP1 A;  1RIL A;  1Q9X A;  4E7H A;  4DQQ A;  3LP1 A;  4C8O A;  4YNQ A;  2NUB A;  4CGI A;  3MXM A;  5FRN A;  1LW0 A;  5C42 A;  3KLH A;  1UAX A;  4W5N A;  2JLE A;  3SQ1 A;  4CHO A;  1EP4 A;  2G8U A;  1ZBU A;  1SKS A;  3SV4 A;  4FZZ A;  1CZ9 A;  3NF9 A;  1G15 A;  1NKC A;  3ZSR A;  1NKE A;  1QE1 A;  2DFF A;  4FJK A;  3K5N A;  1T7P A;  1QTM A;  4CJS A;  3I8D A;  3TAF A;  4ELT A;  2F8T A;  3MED A;  4JS4 A;  1C0T A;  4FLX A;  3TAG A;  4J2D A;  4DU3 A;  3M8Q A;  3ZSO A;  3VQC A;  3AVA A;  1A5W A;  3CYM A;  3ISN C;  2BE2 A;  4DTJ A;  2XY8 A;  3RMA A;  2FC0 A;  3SUQ A;  2E4L A;  4PY5 A;  4EZ9 A;  4ZTJ A;  4OKJ A;  4KAZ A;  4BDZ A;  3T1A A;  4RW4 A;  3MEE A;  1DTT A;  3MXI A;  1SL2 A;  4C8N A;  4M45 A;  4CGJ A;  4H4M A;  1RBR A;  4N5S A;  1NK0 A;  3KTQ A;  4B9S A;  4DFK A;  4DTX A;  3PO4 A;  4FK4 A;  1ITG A;  1HRH A;  3DI6 A;  4O5B A;  5KI6 A;  3WNH A;  3P1G A;  4O0I A;  3NGI A;  3M8S A;  3DRP A;  3G0Z A;  3QEW A;  2P1J A;  1KVA A;  4W5T A;  4H4O A;  1Z26 A;  2PY5 A;  4IFV A;  3DOL A;  1JLC A;  3G10 A;  3TAE A;  4RW8 A;  3AVK A;  1ZBF A;  4CEO A;  1HYS A;  3AVH A;  4CIG A;  4CFD A;  4UQG A;  3KD5 E;  1KCF A;  4M41 A;  3VQE A;  2HHT A;  3MEG A;  3K58 A;  1JLQ A;  1TK5 A;  3CFP A;  3LP2 A;  4RW6 A;  5KTQ A;  4KRE A;  4QOZ B;  2RPI A;  4JRQ A;  3VA0 A;  2YKN A;  1RBV A;  4I2P A;  4DTU A;  3AVN A;  4CHP A;  1NK4 A;  4NCG A;  1LWE A;  1N6Q A;  1S5J A;  3VQ4 A;  4Z4F A;  2XO7 A;  4BAC A;  4RW9 A;  5KRT A;  4DF8 A;  1L3S A;  1U04 A;  3RWU A;  4M3Y A;  3OJS A;  3K5L A;  3RMC A;  3CM5 A;  5D3G A;  3P83 D;  3VN5 A;  1DLO A;  1CXU A;  4W5R A;  1BQN A;  4CEQ A;  2IGI A;  1UOC A;  2IC3 A;  4FLT A;  4Z4H A;  1L5U A;  1BL3 A;  1NKB A;  4ID5 A;  3TWH A;  4KTQ A;  2I5J A;  3HM9 A;  2X6S A;  1CXQ A;  2ZE2 A;  3OYK A;  1RTH A;  3HXM A;  2PYL A;  1FKO A;  4OGE A;  3AVI A;  4O4G A;  4CK2 A;  3CG7 A;  4B9U A;  5CY4 A;  3L2Q A;  3AVJ A;  3HP9 A;  1I3A A;  2HNZ A;  4CK3 A;  3OYL A;  4PWD A;  3VQ8 A;  3ZSZ A;  1HNV A;  1VK0 A;  3LAK A;  3JYT A;  1B9D A;  3V9Z A;  2BGG A;  4AH9 A;  4EP4 A;  4L8R B;  4LH4 A;  3VQP A;  3L8B A;  4MQ3 A;  3CFR A;  1QS4 A;  1RCH A;  1JL2 A;  3VA3 A;  2B5J A;  3HL8 A;  1J5O A;  4CJL A;  4Z0U A;  4CJK A;  3AVL A;  3L2R A;  4B9M A;  2HHX A;  4OJR A;  3AO3 A;  3AO5 A;  4E1M A;  3HJF A;  5I3U A;  4FJ5 A;  4E0D A;  1TL3 A;  3CM6 A;  5DMR A;  4DS5 A;  3U3Y A;  4DTO A;  1YTU A;  2B6A A;  3VQQ A;  4AHV A;  3OYH A;  4H8K A;  1REV A;  2Z1I A;  1IKW A;  1EXQ A;  5C25 A;  2G8W A;  2Q3S A;  3DLK A;  3ZT2 A;  3HPG A;  4CGF A;  1KVC A;  1JLG A;  1WN7 A;  3DLH A;  4HVJ A;  4N76 A;  1IKX A;  1L3T A;  2OZS A;  4F2S A;  1N5Y A;  4CJR A;  2VG7 A;  4I7F A;  4LSN A;  3IRX A;  2DFH A;  2FBV A;  4HTU A;  3KK3 A;  3SPY A;  5SWM A;  4K8Z A;  2HVH A;  3SYZ A;  3MXJ A;  1WSI A;  4F2R A;  4DSF A;  3AVG A;  2WOM A;  3VQD A;  2EHG A;  3HST B;  5JS2 A;  3TAR A;  4M3R A;  1RDC A;  4C8M A;  4BE0 A;  1S9G A;  1XHX A;  4DSK A;  2W42 A;  2OPP A;  4CF8 A;  3KIO A;  4DTR A;  4DQP A;  2DTU A;  1RBT A;  1JLF A;  3IS9 A;  3QIP A;  4RG8 A;  3V1O A;  4N41 A;  4PQU A;  4FM1 A;  1S1V A;  3AV9 A;  2RF2 A;  3DRR A;  2ATQ A;  5FDL A;  1TGO A;  3ALY A;  3NF6 A;  4CHZ A;  4NYN A;  1VSI A;  1FXX A;  1S6Q A;  2P51 A;  1W9H A;  3CFO A;  1ZBH A;  3EZ5 A;  1ZBL A;  1LWF A;  4FZX C;  4J2A A;  1MU2 A;  3QIO A;  4B9L A;  4Z4E A;  3AVC A;  1QSY A;  4GMJ B;  2PZS A;  2DY4 A;  2P5G A;  2FBX A;  3LP3 A;  1ASV A;  3NH0 A;  1K6Y A;  3NH1 A;  1FKP A;  1BHL A;  2G8H A;  4KHU A;  3ITH A;  3AVM A;  4IDK A;  4FJI A;  1TAU A;  1JXE A;  1SV5 A;  1S9E A;  1RT3 A;  4I9L A;  3QNN A;  2ETJ A;  1KSP A;  1LW2 A;  1VSL A;  4O44 A;  3KKS A;  3L2V A;  4JS5 A;  2KTQ A;  1C0M A;  4DF4 A;  3AVB A;  1Y97 A;  5HLF A;  3IAY A;  1NK9 A;  1TAQ A;  1S1U A;  3OS2 A;  3KLF A;  1TKX A;  1UWB A;  1Q9Y A;  3O3H A;  2Z1J A;  2E6L A;  3LAM A;  1D5A A;  4CER A;  4AHT A;  4DTM A;  1TVR A;  1D8Y A;  5FRM A;  4AHC A;  3LWM A;  4DLG A;  1T03 A;  3SPZ A;  2IOC A;  4C8L A;  4FJG A;  3LAL A;  4CEZ A;  1VRU A;  4ZTF A;  2HVI A;  4B9V A;  3LZJ A;  3C94 A;  4OPJ A;  4F3O A;  3DYA A;  2XY7 A;  1SKR A;  2XY6 A;  4LY7 A;  4BDY A;  3TI0 A;  3VQ9 A;  3QEV A;  5J2Q A;  1KFD A;  1KVB A;  3TAM A;  3L2W A;  1IG9 A;  2E6M A;  4FZY A;  4PUO A;  4E7J A;  3HVR A;  1WAF A;  3CQ8 A;  1IKV A;  4HHT A;  4F8R A;  1D9F A;  1RT2 A;  4DSL A;  4PA1 A;  4OGC A;  4OPK A;  4FJ7 A;  2Y1J A;  2HHU A;  2FBY A;  4B3O A;  1RDA A;  3NBP A;  5HRN A;  3EY1 A;  4GVM A;  1S1X A;  2OA8 A;  4AHU A;  4CEF A;  4CHN A;  4QAG A;  4KKO A;  1F21 A;  3H08 A;  3OYI A;  3F9K A;  3ZSY A;  4DFJ A;  4N56 A;  4KHY A;  1GOB A;  3NAE A;  1D9D A;  4E7L A;  1J53 A;  1O1W A;  3KD1 E;  3DLG A;  4JRP A;  1W0H A;  3SCX A;  1QHT A;  1X9M A;  3HK2 A;  2KZZ A;  2KZM A;  3RRH A;  4DTP A;  4BWM A;  1EX4 A;  3WNF A;  1C1B A;  4ELU A;  2D0C A;  2HNY A;  3ZT3 A;  3QES A;  3OYA A;  1ASW A;  2VG6 A;  3OVN A;  3QO9 A;  4IBN A;  4KTW A;  2YHA A;  4DMN A;  3OYF A;  4CGD A;  4FLV A;  2O4I A;  3OYG A;  2OPQ A;  3T3F A;  2KW4 A;  4FJN A;  2KQ2 A;  4CFC A;  2X78 A;  1X1P A;  4CF2 A;  4BE2 A;  2DFE A;  1BI4 B;  1WSJ A;  4ICL A;  3NHG A;  1EKE A;  1KLN A;  4DQI A;  1RTD A;  3OJU A;  2YNH A;  1SUQ A;  3TAP A;  4M3W A;  2HHW A;  4FLW A;  1RT4 A;  3LZI A;  1HYZ A;  3AA5 X;  5CYM A;  4OKK A;  2D0A A;  2XHB A;  1VSE A;  3DLR A;  4FJH A;  4ID1 A;  1I39 A;  4Q5V A;  4CFA A;  3V81 A;  1NJX A;  4CJQ A;  2XY5 A;  1HMV A;  3P5J A;  2X6N A;  3RR8 A;  4N47 A;  2Z1G A;  2A1S A;  2KFZ A;  3AA3 A;  3KK2 A;  4Y1D A;  3SI6 A;  2OYQ A;  2HW3 A;  3V9W A;  1RTJ A;  1TV6 A;  3VQA A;  1U4B A;  4HUE A;  1BGX T;  1C1C A;  2YNF A;  4CHQ A;  3OYB A;  1BCM A;  4DTN A;  1WSH A;  2IS3 A;  4KTZ A;  4CGH A;  3KK1 A;  4Z4C A;  2VWK A;  2YNG A;  3OYJ A;  3PX6 A;  5C24 A;  3ULD A;  5HRS A;  4KHQ A;  4XIU A;  2BAN A;  4CJ5 A;  3QEP A;  4MFB A;  1VSJ A;  2G8I A;  5J1E A;  4BDP A;  4KB0 A;  1SL0 A;  1IO2 A;  4FW2 A;  1NK5 A;  3RMB A;  3QLH A;  3PX4 A;  1U47 A;  3SNN A;  1U45 A;  2OZM A;  1C0U A;  4O55 A;  4J2B A;  3JSM A;  4CIE A;  1NJY A;  1LV5 A;  2ITG A;  2P5O A;  3SZ2 A;  2BDP A;  3V4I A;  2R7Y A;  3MEC A;  3NF8 A;  1WAJ A;  4FK0 A;  3AO4 A;  2OPR A;  4CK1 A;  3OYC A;  4HCC A;  2VWJ A;  4CJU A;  4DQS A;  3ZSX A;  1B9F A;  4IG0 A;  1RT1 A;  3NE6 A;  4CFB A;  2HMI A;  4FM0 A;  3WNG A;  4YFU A;  1Z25 A;  1WNS A;  2QKK A;  4M42 A;  3C6U A;  4I2Q A;  3M8P A;  5J2M A;  1XHZ A;  1YTA A;  2PYJ A;  4TSX A;  4IKF A;  4OLA A;  4FLZ A;  3OY9 A;  1LAW A;  5KGW A;  3ZSV A;  4FJ8 A;  2GUI A;  4LD0 A;  4CJF A;  3PV8 A;  3ZT1 A;  3BGR A;  3B6O A;  2O4G A;  3RRG A;  1VSH A;  3AO2 A;  4FJX A;  4E7K A;  3LDS A;  1TL1 A;  3ZT0 A;  2ZQB A;  5CZ1 A;  1JLE A;  3D45 A;  4CJE A;  4CJ4 A;  1B92 A;  2F96 A;  4CJP A;  3VQ6 A;  1RT7 A;  5CZ2 A;  5DK5 A;  1GOA A;  1NJZ A;  4Q0B A;  3SUP A;  5CYQ A;  4DG1 A;  4WE1 A;  2HHQ A;  5EU7 A;  1WLJ A;  4E7I A;  1KTQ A;  3KLI A;  4AIL C;  2YHB A;  4CED A;  4CF9 A;  3RMD A;  4BE1 A;  4FW1 A;  5J2P A;  4I9Q A;  1JXB A;  4Z4I A;  1JKH A;  3LPT A;  2QK9 A;  3U3G A;  1Q8I A;  1VSD A;  2Z1H A;  2ZD1 A;  4R5P A;  3U6F A;  3SQ2 A;  1NOZ A;  2B4J A;  1L3U A;  2G8V A;  4DFP A;  4DWI A;  4NCA A;  3OYM A;  1L3V A;  4CF1 A;  1TKD A;  3PUF A;  4LH5 A;  4CE9 A;  5SZT A;  3V9X A;  3RTV A;  2WON A;  3O3F A;  3TAN A;  3TAB A;  2HHV A;  3HPH A;  1LWC A;  1HQU A;  3S3N A;  5K14 A;  3DOK A;  3VQB A;  4DU4 A;  4E89 A;  4CEA A;  1HQE A;  1NK6 A;  3UIQ A;  4W5Q A;  4HCB A;  3K2P A;  1RDD A;  3QEI A;  1CZB A;  1KRP A;  2X74 A;  3S9H A;  3TAQ A;  3IG1 A;  1T05 A;  1BIU A;  3LPU A;  3KJV A;  3C6T A;  4DU1 A;  1SKW A;  1QSS A;  2G8K A;  5KRS A;  3BDP A;  4FJJ A;  3EYZ A;  4W5O A;  3NCI A;  4FK2 A;  3M8R A;  3K57 A;  3L2U A;  1VSK A;  4O0J A;  2IAJ A;  3HP6 A;  4KB1 A;  3NH2 A;  3PY8 A;  3TR8 A;  4HUG A;  3DM2 A;  4G1Q A;  1S1T A;  4OVL A;  4KHW A;  4FJL A;  3LAN A;  4CGG A;  5HRO A;  4OKE A;  3AA2 A;  4GW6 A;  3I0R A;  1ZYQ A;  4FYD A;  1BIZ A;  4IFY A;  4KI4 A;  2GV9 A;  4NYF A;  2RKI A;  4EZ6 A;  3LP0 A;  4M3Z A;  1TK0 A;  5FRO A;  1EET A;  4IG3 A;  4FJ9 A;  4KHS A;  4B9N A;  5HRP A;  3K59 A;  3ASM A;  3SUN A;  1S1W A;  1TKZ A;  1KLM A;  1RBU A;  3VQ5 A;  3QNO A;  1J54 A;  1X9W A;  1C6V A;  4HUF A;  3MAQ A;  4CJ3 A;  5T7B A;  1C1A A;  3LWL A;  4E3S A;  1RDB A;  1RBS A;  4FLU A;  3OYD A;  3SQ0 A;  5J2N A;  1T8E A;  3QER A;  1TK8 A;  3I0S A;  2F8S A;  3ZSW A;  3HYF A;  4ZHR A;  1TKT A;  3FFI A;  4CEB A;  1IKY A;  1NJW A;  3HPO A;  2RN2 A;  1BIS A;  2Y1I A;  1GOC A;  1NK7 A;  4CEC A;  3THV A;  3S3M A;  3PO5 A;  4B8C A;  4KHN A;  3QIN A;  1WSG A;  3S3O A;  1UA1 A;  2JGU A;  3ZCM A;  4EP5 A;  1JLA A;  1YT3 A;  1YVU A;  4M3U A;  3AO1 A;  4ELV A;  3KKR A;  4Y1C A;  4OLB A;  5JS1 A;  4DFM A;  4FVM A;  3ZSQ A;  4DLE A;  2LSN A;  4F3T A;  1S6P A;  2AJQ A;  2GBZ A;  4CJT A;  4FM2 A;  3OYN A;  3A2F A;  2EX3 A;  1HJR A; 
#chains in the Genus database with same CATH topology
 2HND A;  2G8F A;  2A1R A;  1DTQ A;  4UY8 O;  1VSM A;  3QET A;  3MWT A;  4CIF A;  3A5N C;  1RT6 A;  1P90 A;  3AAR A;  5GAH P;  4KPY A;  3V1Q A;  3SQ4 A;  3ENH A;  3SBG A;  3O3G A;  4BWJ A;  5LMU K;  1MWK A;  3E01 A;  5AQW A;  4LFB K;  3D0P A;  5E41 A;  3SMP A;  4A5A A;  2KFN A;  3ZT4 A;  5IWA K;  3O4Q A;  3HT3 A;  5AZI B;  4DSE A;  3NF7 A;  3AA4 A;  2QWQ A;  3BF3 A;  1HNI A;  1WSE A;  1IH7 A;  1LAV A;  4GV3 A;  2YV0 X;  3CCU N;  4CF0 A;  4M3T A;  4AHS A;  1BCO A;  4CJW A;  4CES A;  4JKC A;  1M90 O;  4WCE L;  4E19 A;  1WSF A;  4IOX A;  1RNH A;  2XRI A;  2HVI A;  1QSL A;  5JLH A;  1Q9X A;  2YI1 A;  3LP1 A;  4DB3 A;  4CHO A;  2G8U A;  3M5R A;  4O8U A;  3VER A;  4FZZ A;  1CZ9 A;  3L6Q A;  3NF9 A;  5A2Q O;  4B3S K;  3ZSR A;  4BQZ A;  2OTL N;  3TAF A;  4CZK A;  3MED A;  1C0T A;  5AQT A;  3O1W A;  3MCP A;  3O80 A;  3ZSO A;  1A5W A;  3CYM A;  4JNE A;  3VMF B;  3TPQ A;  3LL3 A;  3VEV A;  4KAZ A;  5JIC A;  4CGJ A;  3KTQ A;  4DTX A;  1HUX A;  1NM1 A;  1ITG A;  1HRH A;  3EKS A;  5KI6 A;  3NGI A;  3M8S A;  4A2A A;  3G0Z A;  3QEW A;  2P1J A;  1KVA A;  3G10 A;  3TAE A;  3RSE B;  1QQO A;  3SK3 A;  2QW9 A;  3AVK A;  1FW6 A;  1HYS A;  3AVH A;  3I33 A;  2YHX A;  4DQ8 A;  2Q97 A;  3VQE A;  5GAG P;  5KPZ A;  1C0G A;  3K58 A;  1JLQ A;  1TK5 A;  4RW6 A;  5KTQ A;  3VA0 A;  1OVQ A;  3VPZ A;  1WB9 A;  1N6Q A;  4BAC A;  4RW9 A;  3A8Y A;  5KRT A;  5CHI A;  2GEM A;  3J7Y P;  3VN5 A;  1W97 L;  2A40 A;  3JAM O;  4FLT A;  5MLC Q;  2I7P A;  1NKB A;  4ID5 A;  4KTQ A;  2X6S A;  5M1F A;  3OYK A;  3CCS N;  3AVI A;  3CG7 A;  3TU5 A;  3AVJ A;  4BGB A;  4PWD A;  3VQ8 A;  3ZEU A;  1VK0 A;  1ATS A;  3MN9 A;  3SMS A;  1Q81 O;  2D4W A;  3CFR A;  4EFH A;  4BY9 C;  3LM9 A;  4H5W A;  4Z0U A;  4CJK A;  1YIT N;  1KAZ A;  1NGI A;  4DTO A;  2B6A A;  5BRH A;  3VQQ A;  1JCE A;  2Q3S A;  4CGF A;  2VGN A;  3VGK A;  3DLH A;  2UXB K;  4QS8 A;  3LM2 A;  1BA0 A;  3EE9 A;  4BRO A;  2OZS A;  4F2S A;  4I7F A;  3CC7 N;  4H0T B;  4BR4 A;  3IDH A;  5SWM A;  4EAH D;  2BTF A;  4XH4 A;  4F2R A;  3VQD A;  2WOM A;  2EHG A;  3H45 C;  1XC3 A;  5JS2 A;  1RDC A;  4BE0 A;  3THX B;  4CF8 A;  1RDU A;  3QIP A;  4RG8 A;  4PQU A;  1S1V A;  3DRR A;  4BC2 A;  2ATQ A;  5FDL A;  5FPM A;  1TGO A;  1HJO A;  3ALY A;  4JKD A;  3VEN A;  3THY B;  1YJW N;  1W9H A;  3T7Z A;  1ZBH A;  3MN5 A;  1ZBL A;  4IWV A;  4B9L A;  1GLF O;  2E8A A;  4IO8 A;  3THW B;  4CD1 A;  5KQ8 A;  2PZS A;  4GMJ B;  3LP3 A;  1ASV A;  3NH0 A;  1K6Y A;  3T69 A;  2J4R A;  3ITH A;  3TTD A;  5AQO A;  3QNN A;  5F0X A;  2KTQ A;  3KKS A;  4JS5 A;  4PKI A;  3IAY A;  4DV3 K;  3FZK A;  1D8Y A;  4DTM A;  4FOE A;  1TVR A;  5AQS A;  4KBO A;  4DLG A;  1HPM A;  2KKZ A;  1ZC6 A;  4F3O A;  3ENB A;  4OPJ A;  3AAP A;  1QZ5 A;  1SKR A;  2GUP A;  2XY6 A;  4LY7 A;  3NMU A;  2W41 A;  3TI0 A;  2UYT A;  3TTC A;  1IG9 A;  4E7J A;  4WQ5 C;  3PSF A;  4BRG A;  4WFA L;  2FBY A;  4B3O A;  3C65 A;  3EY1 A;  1S1X A;  3E9L A;  2OA8 A;  4AHU A;  4QAG A;  1SQK A;  3OYI A;  4DFJ A;  3C7N B;  1D9D A;  3KD1 E;  4JRP A;  1W0H A;  3WXJ A;  1QHT A;  3SCX A;  1EX4 A;  4JKH A;  1K9M O;  1H1V A;  2D0C A;  2HNY A;  3QES A;  1VHX A;  2VG6 A;  3I8B A;  4KTW A;  3QO9 A;  4FLV A;  3J8A A;  3T3F A;  4CFC A;  5KPR A;  4H0O A;  4BC5 A;  4BE2 A;  4BG8 A;  5M1K A;  1BI4 B;  3NHG A;  3CIP A;  3OJU A;  1TYQ B;  2P9I B;  3ZX2 A;  1RT4 A;  5CYM A;  4I6M A;  3FZM A;  3DLR A;  5BRE A;  3DLL L;  1I39 A;  3K9J A;  3V81 A;  4CJQ A;  2XY5 A;  1HMV A;  1WBB A;  4PKG A;  2A1S A;  4Y1D A;  3VQA A;  4FWP A;  3OYB A;  2IS3 A;  3PX6 A;  2IIR A;  3O9S A;  5C24 A;  1I94 K;  3QEP A;  4KB0 A;  2OTJ N;  3QLH A;  3SNN A;  2P9P B;  1XUP O;  1C0U A;  4O55 A;  5EY4 A;  2ITG A;  1LV5 A;  2CGJ A;  3V4I A;  2R7Y A;  3NF8 A;  4DUY K;  1WAJ A;  4FK0 A;  4IEI A;  1GLB G;  3OYC A;  1QZ6 A;  5AQH A;  3ZSX A;  4JI1 K;  2QKK A;  4M42 A;  3ZET A;  1YTA A;  2NRW A;  3HOS A;  2HOE A;  4DUZ K;  1WUA A;  4IKF A;  4JKB A;  3ZSV A;  4LF9 K;  2D0P A;  1J6Z A;  3BGR A;  2O4G A;  3AO2 A;  4GY2 B;  3O08 A;  1TL1 A;  3OW2 M;  3UE5 A;  4BRF A;  1BWF O;  4JK9 A;  3ULE A;  1RT7 A;  2O8D A;  1GOA A;  2IVO A;  3SUP A;  4XH1 A;  2KHO A;  4E7I A;  4CED A;  1JXB A;  2QK9 A;  4R5P A;  1GLL O;  2Z1H A;  2Q2R A;  4NCA A;  3H3N O;  4ILG B;  1JCG A;  1M1K O;  1TKD A;  3C6A A;  4LH5 A;  4CE9 A;  2HHV A;  5LMN K;  4YOV A;  5K14 A;  3VQB A;  4CEA A;  1HQE A;  3H3O B;  3K2P A;  1RDD A;  2O8F A;  2V7Y A;  2UU9 K;  4KHP K;  5AQU A;  4IOC L;  4BR2 A;  3DXK A;  3SAF A;  3NCI A;  1K8K A;  3WXK A;  3ATU A;  4IO9 L;  3CI5 A;  1MWM A;  2I7N A;  4G1Q A;  1EWQ A;  3RVC A;  2CH5 A;  1ZYQ A;  2GV9 A;  4NYF A;  4EZ6 A;  1TUU A;  4BRE A;  1IBM K;  1NGG A;  4DR4 K;  4IG3 A;  3CMA N;  4H0X B;  4HTL A;  2QA4 N;  3SUN A;  1KLM A;  3VQ5 A;  2P9S A;  1IG8 A;  1X9W A;  4HUF A;  4WFB L;  1RDB A;  2E88 A;  4BRH A;  4ZHR A;  1TKT A;  3FFI A;  5CE3 A;  2WC9 A;  3A5O C;  1NK7 A;  3VOV A;  3THV A;  1QQN A;  3QIN A;  1UA1 A;  1MA9 B;  1X9J A;  3ZCM A;  1YVU A;  1G99 A;  3AO1 A;  3D2E A;  4DLE A;  5E84 A;  2YHY A;  2AJQ A;  3AGK A;  4KH4 A;  3LDO A;  5EVZ A;  2EX3 A;  1U6Z A;  2VYP A;  4A62 A;  4BRC A;  3DLB A;  3Q7B A;  2P9L A;  4JLH A;  3U4L A;  4DSJ A;  4DS4 A;  2D5R A;  2D0B A;  3HVT A;  2FF6 A;  2ZJP L;  5AQZ A;  1ZBI A;  4ILH A;  3EKU A;  3WNE A;  2P9N A;  3OS0 A;  3O9Q A;  5JVH L;  1A5X A;  2QWL A;  4J2E A;  4NCB A;  3CJ9 A;  5LL6 Z;  4LF5 K;  3V9U A;  3NGY A;  2BUP A;  1ASU A;  2IDO A;  2HHH K;  1RTI A;  4BRQ A;  3QEX A;  2QXF A;  3DJC A;  2HB5 A;  4QCL A;  1S22 A;  3DRS A;  1W7A A;  1HKC A;  1VSF A;  2NRV A;  4DQR A;  2QWO A;  3L3V A;  2WFB A;  4FWL A;  2O8E A;  3WEE A;  4B08 A;  3TTF A;  3M3Z A;  4KRF A;  3K5O A;  4KV8 A;  3R6M A;  4FCY A;  4KO0 A;  4CHY A;  1VAZ A;  4DTS A;  3HBT A;  3B6P A;  4FO0 A;  3C95 A;  3V9S A;  2FBT A;  4FWM A;  5HBM A;  3RR7 A;  3O4N A;  5AQN A;  3P31 A;  1K73 O;  4WQ5 A;  3FZF A;  1EP4 A;  1NWK A;  1SKS A;  3SV4 A;  4DR7 K;  1G15 A;  1NKC A;  1NKE A;  1QE1 A;  3K5N A;  1SZ2 A;  4ELT A;  3VEO A;  3J80 O;  1WBD A;  4YOY A;  5AQY A;  4DU3 A;  3VQC A;  3BP8 A;  1KAY A;  3PIO L;  1BU6 O;  3U9Z A;  4OKJ A;  4RW4 A;  3MEE A;  1SL2 A;  2IVP A;  3O9R A;  1NK0 A;  1RBR A;  4DFK A;  2HST A;  1NGC A;  4O0I A;  3WNH A;  4WF9 L;  4Y0W A;  5EOY A;  3IUC A;  2RE2 A;  3UKR A;  2PY5 A;  4GV9 A;  2D0O A;  5HL7 L;  4CEO A;  4CIG A;  2GTD A;  4CFD A;  1E3M A;  2P9U B;  2HHT A;  1BA1 A;  3LP2 A;  3AAQ A;  5E26 A;  4I2P A;  4MDA A;  3SAH A;  3VQ4 A;  4NB4 A;  4U67 L;  4CVN E;  3OJS A;  4BC4 A;  3CHW A;  4DR5 K;  3P83 D;  1DLO A;  1CXU A;  4CEQ A;  2IGI A;  2IC3 A;  2HMP A;  4Z4H A;  4YOX A;  1IJJ A;  1L5U A;  2VGM A;  3TWH A;  3BUZ B;  1RTH A;  5CY4 A;  3L2Q A;  4CK3 A;  1I3A A;  4O5F A;  4Z94 A;  1HNV A;  3JYT A;  4JI6 K;  4CZL A;  3KWG A;  4EP4 A;  4CZE A;  4MQ3 A;  5ADX A;  3T1H K;  3HL8 A;  1J5O A;  2QWP A;  3DXM B;  2ZJR L;  4B9M A;  3G71 N;  4OJR A;  1NNE A;  1O13 A;  4JAX A;  3HJF A;  5I3U A;  4E0D A;  1TL3 A;  3KVG A;  1QQM A;  5LY3 A;  1V4S A;  3GE1 A;  3OYH A;  1REV A;  2G8W A;  1IKW A;  3UB5 A;  1HKB A;  2YX6 A;  3HPG A;  2UXD K;  3P39 A;  1JLG A;  1WN7 A;  2NNW A;  4DV6 K;  3EN9 A;  3VEZ A;  2VG7 A;  2ZF5 O;  2FBV A;  3IKM A;  4K25 A;  3MXJ A;  4BRI A;  3CC4 N;  3HST B;  4B1Z A;  3TAR A;  4M3R A;  1S9G A;  1XHX A;  2W42 A;  2DTU A;  2ZJQ L;  4IOA L;  2PFU A;  3IS9 A;  3V1O A;  1KQS M;  2Q31 A;  4CHZ A;  3NF6 A;  5I9E B;  4WFN L;  4NYN A;  1KD1 O;  1FXX A;  3CFO A;  2DY4 A;  4FWO A;  1X3M A;  2FBX A;  4BVO A;  4G9Z A;  4GV6 A;  2O8C B;  1BDG A;  1BHL A;  1FKP A;  2QEX N;  1NGB A;  3AVM A;  4IDK A;  4FJI A;  1JXE A;  4YOW A;  2ETJ A;  1GLE G;  1LW2 A;  1VSL A;  4O44 A;  3L2V A;  5AQL A;  1HJR A;  4DR6 K;  3O5B A;  1OKJ A;  1NK9 A;  4AM7 A;  1TKX A;  2H3G X;  2E6L A;  2YJE A;  1D5A A;  4B1X B;  4AHT A;  3LWM A;  4CJ7 A;  4M7Y A;  4AM6 A;  4FJG A;  4CEZ A;  1VRU A;  1BG3 A;  2E2P A;  1VQO N;  5M1P A;  5J2Q A;  1KVB A;  3L2W A;  2E6M A;  4PUO A;  3CQ8 A;  1NU0 A;  4PA1 A;  4OPK A;  2UUB K;  2HHU A;  2Y1J A;  4YHH K;  4XEI A;  3NBP A;  4AF1 A;  4H5T A;  3OBY A;  4WQ4 C;  3IFR A;  1N33 K;  4EIA A;  3IMX A;  5JMV A;  1HNW K;  4H03 B;  1GOB A;  3NAE A;  1J53 A;  4BRM A;  3DLG A;  3HK2 A;  4IJA A;  2IVN A;  2KZM A;  3HZ6 A;  4KH6 A;  4C23 A;  1ESV A;  3OYF A;  2HBL A;  4K43 A;  4CGD A;  4CZM A;  3MWP A;  2ASO A;  4FJN A;  1X1P A;  3D6R A;  4CF2 A;  2DFE A;  1Q7Y O;  3CC2 N;  3CCR N;  4ISG A;  1E4G T;  1SUQ A;  3R3L A;  5EX5 A;  4IZ9 A;  1YAG A;  1VSE A;  2NRH A;  3O9T A;  4A5B A;  5BPL A;  1T6D A;  4ID1 A;  1NJX A;  4NXN K;  2Z1G A;  2EWS A;  4YY3 K;  1TV6 A;  1U4B A;  4HUE A;  4CHQ A;  3UKU A;  3OYJ A;  2PAV A;  4X66 K;  2BAN A;  4MFB A;  2G8I A;  5J1E A;  4FW2 A;  3CCV N;  2OZM A;  3PX4 A;  4IXC A;  1U45 A;  4FOI A;  2FLO A;  3GL1 A;  4J2B A;  1Y64 A;  3JSM A;  2BDP A;  1VQ8 N;  4CZI A;  4CK1 A;  4HCC A;  2VWJ A;  4IG0 A;  3CME N;  1RT1 A;  3NE6 A;  4CFB A;  4FM0 A;  1WNS A;  3J7Z O;  4I2Q A;  1XHZ A;  3PSI A;  3CPE A;  3A5M C;  1ATN A;  1NMD A;  4JYA K;  4FJ8 A;  3CJA A;  3PV8 A;  4FJX A;  1VSH A;  3LDS A;  3ID6 A;  3WXL A;  1JLE A;  4CJ4 A;  4CJE A;  2F96 A;  3QML A;  5CZ2 A;  1VQ7 N;  2ZGZ A;  1NJZ A;  4XH5 A;  4Q0B A;  5GIN A;  4M7X A;  5EU7 A;  1WLJ A;  1KTQ A;  3KLI A;  3RMD A;  4DV0 K;  5J2P A;  1JKH A;  3LPT A;  3U6F A;  3G4S N;  3J7A P;  2B4J A;  4DFP A;  4DWI A;  4CF1 A;  3PUF A;  3TAN A;  1V4T A;  2WON A;  4PHT X;  1HQU A;  2QM1 A;  1FJG K;  2FSK A;  3DOK A;  3EO3 A;  4DU4 A;  1OH5 A;  2Q1N A;  1NK6 A;  5AQG A;  4ILJ A;  3QEI A;  1KRP A;  3TAQ A;  5B8H A;  4DU1 A;  1QSS A;  3BDP A;  1BUP A;  4W5O A;  4FK2 A;  4CW7 B;  3CER A;  3M8R A;  3K57 A;  1SAZ A;  4MLE A;  2HBK A;  3DM2 A;  1S1T A;  4KHW A;  2NRT A;  4FJL A;  4CGG A;  4GW6 A;  3O6W A;  3B8A X;  5AQF A;  4DCH A;  4FJ9 A;  4BRL A;  3E9O A;  3ZEU B;  4BRN A;  5H1S Q;  1RBU A;  3KWI A;  1NGA A;  1C6V A;  4E3S A;  2OAN A;  4CJ3 A;  3CJ7 A;  3LWL A;  4FLU A;  3MMV A;  3QER A;  1TK8 A;  4CEB A;  5BR9 A;  3HPO A;  4JD2 A;  1BIS A;  2QWN A;  4CEC A;  4NXM K;  3FZH A;  4JKA A;  1T6C A;  1JLA A;  3L4Q A;  2F9T A;  4Y1C A;  2QTD A;  5JS1 A;  4DFM A;  1RDW X;  2LSN A;  4DHY A;  4F3T A;  4JI2 K;  4BR5 A;  3A2F A;  4Z4G A;  1RGI A;  3TSP A;  1BQM A;  2ITM A;  1KFS A;  5LJV A;  5AJ3 K;  4B9T A;  4CCH A;  1X9S A;  2O8B A;  4M3X A;  2NRR A;  3OYE A;  4CJV A;  4DSI A;  3R9P A;  1OH6 A;  3EEQ A;  2PBD A;  1UA0 A;  2OPS A;  4BVP A;  3G25 A;  3NFA A;  1X3N A;  4GKJ K;  4LSL A;  3VTI A;  3KZB A;  3JS6 A;  3PX0 A;  4C8K A;  4K8X A;  3NGZ A;  2VQF K;  1JL1 A;  4JI3 K;  2YNI A;  4E1N A;  4M63 C;  4FLY A;  1WOQ A;  1JLB A;  4PL7 A;  4RW7 A;  1U49 A;  3VGL A;  4LC9 B;  1VRT A;  1N34 K;  1J9A A;  1GLA G;  5AQV A;  4CEE A;  3F73 A;  3U8X A;  2QXL A;  1A5V A;  5C15 A;  1NJI O;  1R0A A;  3SUO A;  4OPH A;  3WXM B;  3LDN A;  3OS1 A;  3KLG A;  4F4K A;  3SBT A;  3Q7C A;  1XC9 A;  4B8A B;  3BF1 A;  4FJM A;  4A61 A;  3SAG A;  2QKB A;  1U48 A;  2E2Q A;  3S41 A;  1RIL A;  2WTU A;  4YNQ A;  5FRN A;  4CGI A;  5IT9 O;  5C42 A;  3KLH A;  1UAX A;  1CZA N;  1NBW A;  3HOT A;  3QFU A;  1KXP A;  4JV5 K;  1EO1 A;  2HBM A;  1NGE A;  4WQ4 A;  2F8T A;  4JS4 A;  3TAG A;  4J2D A;  2BE2 A;  2FC0 A;  3FGU A;  1E4F T;  3SUQ A;  2E4L A;  2V51 B;  4ZTJ A;  4EZ9 A;  1HLU A;  4BDZ A;  3T1A A;  2AP1 A;  1DTT A;  3MXI A;  1QVF M;  4C8N A;  4B9S A;  1T44 A;  4FK4 A;  3DI6 A;  4H5V A;  3QBW A;  3DRP A;  3FR0 A;  1S72 N;  4H4O A;  4IFV A;  3DOL A;  1JLC A;  4I6M B;  4RW8 A;  4NLB A;  1ZBF A;  4JHD A;  3E1Y A;  3H46 O;  3KD5 E;  1KCF A;  4YDU C;  3VF2 A;  3MEG A;  3CFP A;  5M1N A;  5BN9 A;  4QOZ B;  4JRQ A;  2YKN A;  4FWQ A;  4CHP A;  2P9K A;  1NK4 A;  1S5J A;  1U2V A;  4Z4F A;  2XO7 A;  3H1Q A;  4DF8 A;  4IDH A;  3I56 N;  4V19 S;  4M3Y A;  2GEL A;  1NGF A;  4A57 A;  5D3G A;  4OPA A;  4W5R A;  3C6H A;  3ENO A;  3G6E N;  2VWB A;  1HNX K;  2PYL A;  1CXQ A;  2ZE2 A;  3GG4 A;  3HXM A;  1FKO A;  4OGE A;  1OVY A;  4WYB A;  4B9U A;  4JKG A;  3HP9 A;  5BRD A;  4L8R B;  2JWL A;  3VQP A;  3L8B A;  3ZET B;  1QS4 A;  1JL2 A;  2B5J A;  3D2F A;  2NLX A;  4CJL A;  3L2R A;  5AZJ A;  3AO3 A;  1K8A O;  3AO5 A;  4E1M A;  4BG9 A;  5FPD A;  2D1K A;  5DMR A;  4DS5 A;  2F9W A;  4IFE A;  3SJH A;  4AHV A;  4H8K A;  5C25 A;  3DLK A;  3ULE B;  2O8D B;  3P4I A;  3MCA B;  3WQU A;  1IKX A;  1L3T A;  1N5Y A;  5FPN A;  3IRX A;  4HTU A;  4K8Z A;  2CGL A;  2HVH A;  1YF5 L;  3H6E A;  4J8F A;  1Q82 O;  5DM7 L;  2OPP A;  3HM8 A;  3KIO A;  3ZX0 A;  4DTR A;  2HBJ A;  4DQP A;  4FSV A;  2O8F B;  2F4V K;  3AV9 A;  2RF2 A;  1DEJ A;  1BOT O;  5TKW A;  3A5L C;  2FXU A;  4X64 K;  4YOU A;  1VSI A;  1S6Q A;  3A0I X;  3MDQ A;  3DXK B;  3EZ5 A;  1LWF A;  4FZX C;  1MU2 A;  1K8K B;  4DV7 K;  3N4Q A;  1QSY A;  3VTH A;  2P5G A;  1IBK K;  5AZI A;  3CCJ N;  2G8H A;  1RT3 A;  4I9L A;  1KSP A;  3AVB A;  1Y97 A;  5HLF A;  3OS2 A;  3KLF A;  4BRP A;  3O3H A;  1N8R O;  2Z1J A;  3LAM A;  5AQI A;  3TSQ A;  1N32 K;  5FRM A;  4CBW A;  1VQ5 N;  1T3V A;  3H1V X;  3SPZ A;  4C8L A;  3LAL A;  1EQY A;  4B9V A;  2P9S B;  3LZJ A;  5DM6 L;  3ZYY X;  1BO5 O;  4FWS A;  4IJN A;  4BDY A;  3VQ9 A;  3QEV A;  3TAM A;  4JKF A;  4FZY A;  3HVR A;  1WAF A;  4F8R A;  3FLC O;  2P9K B;  4OGC A;  4FJ7 A;  4EHU A;  3D2E B;  3W0L A;  4OO1 J;  3F9K A;  3ZSY A;  4MDB A;  4N56 A;  2UUC K;  4E7L A;  5CR4 A;  3VF4 A;  3EZW A;  2UXC K;  2KZZ A;  4CZF A;  2UUA K;  3RRH A;  4DTP A;  3HI0 A;  3DWL A;  3ID8 A;  5ADX H;  2P9L B;  3ZT3 A;  3OYA A;  1ASW A;  4IBN A;  2HHX A;  1TAU A;  5GIP A;  2O4I A;  2OPQ A;  2KW4 A;  2X78 A;  4R79 A;  1QHA A;  1WSJ A;  4DQI A;  1RTD A;  5GAE P;  1HKG A;  2P9N B;  2YNH A;  3TAP A;  4M3W A;  4MLH A;  5AZJ B;  2JWK A;  4FLW A;  4FWR A;  2E1Z A;  3RSE A;  1VQM N;  4FJH A;  1YVN A;  4Q5V A;  4LF4 K;  3EL2 A;  2X6N A;  3RR8 A;  3VEW A;  1VQK N;  2KFZ A;  2RHK A;  3KK2 A;  2OYQ A;  4BRA A;  1RTJ A;  4YOT A;  4YOR A;  1VQ6 N;  1BGX T;  2YCH A;  2YNF A;  3CET A;  1YJN N;  1WSH A;  5C12 A;  4H0P A;  3O4W A;  2VWK A;  3MN6 A;  2O8E B;  4KHQ A;  3WEE B;  1ATR A;  1VSJ A;  2WBN A;  4JKE A;  3DAW A;  5AQJ A;  2Q36 A;  3WXI A;  1NK5 A;  3U9D A;  4DV5 K;  1NJY A;  3QIC A;  4GVE A;  1XMO K;  2OPR A;  4CJU A;  5AFU A;  3P38 A;  1B9F A;  3L4I A;  1YHQ N;  4JI0 K;  2HMI A;  3WNG A;  2W6L A;  2AA4 A;  3C6U A;  4LF6 K;  3M8P A;  3WT0 A;  4GNI A;  2PYJ A;  2GX9 A;  2HF3 A;  4OLA A;  4FLZ A;  4CZG A;  3WUH A;  3C0B A;  5KGW A;  4HWI A;  3F2K A;  4LD0 A;  4KHU A;  3KHY A;  4E7K A;  1NGH A;  3D45 A;  5DK5 A;  3CJ1 A;  5CYQ A;  4DG1 A;  2YHB A;  4CF9 A;  4BE1 A;  3O8M A;  4I9Q A;  5AR0 A;  3U3G A;  1VSD A;  2ZD1 A;  2G8V A;  1IV0 A;  3SQ2 A;  3HTV A;  3UKR B;  1L3V A;  2YJF A;  4B1W B;  4RCH A;  5SZT A;  4DR3 K;  3O3F A;  3RTV A;  3TAB A;  1JCF A;  3THX A;  3HPH A;  3S3N A;  2ZWH A;  5GAD P;  3UIQ A;  4HCB A;  4YDU A;  5F1X A;  1GLC G;  2X74 A;  3THY A;  2A41 A;  1T05 A;  1BIU A;  3LPU A;  3KJV A;  3C6T A;  1SKW A;  5KRS A;  3EYZ A;  3THW A;  1DT9 A;  3L2U A;  1VSK A;  4O0J A;  2IAJ A;  5KPT A;  4BQL A;  3TR8 A;  2FSJ A;  2F7T A;  4OVL A;  5HRO A;  4OKE A;  3I0R A;  4BR9 A;  2A6A A;  1BIZ A;  4KI4 A;  3GBT A;  2A3Z A;  2RKI A;  3LP0 A;  5EXW A;  1TK0 A;  5FRO A;  3K59 A;  3ASM A;  4FVU A;  1S1W A;  1TKZ A;  1J54 A;  5T7B A;  1C1A A;  3SQ0 A;  1RBS A;  2DPN A;  3OYD A;  1S3X A;  3HYF A;  4LF7 K;  1GOC A;  3PIP L;  1GLJ O;  1MDU B;  3S3M A;  3PO5 A;  4DV2 K;  1ZXO A;  2JGU A;  3M1F A;  1DKG D;  4OLB A;  3MX5 A;  1DGK N;  3LDQ A;  3CQY A;  3ZSQ A;  3BZK A;  1S6P A;  1NG9 A;  2GBZ A;  4CJT A;  3C7N A;  1VQ9 N;  3OYN A;  4DKW A;  1KC8 O;  3DLE A;  3VEX A;  3KLE A;  5AQK A;  1SL1 A;  1CLQ A;  3HO1 A;  2HHS A;  4BR0 A;  1QQC A;  1BI4 A;  3MN7 A;  3VQ7 A;  1XI1 A;  3AVF A;  1HNZ K;  4PL8 A;  2VG5 A;  1TYQ A;  4IEE A;  1HPZ A;  2P9I A;  4FL9 A;  1LOT B;  2E2N A;  1XNR K;  1NOY A;  3E66 A;  1FK9 A;  4KFB A;  1YI2 N;  1HYV A;  5I42 A;  3NDK A;  4AHR A;  4KI6 A;  4B1U B;  1NK8 A;  4JI7 K;  3T19 A;  4FXD A;  4KH5 A;  4OX9 K;  3L3U A;  1XWL A;  2V52 B;  2A5X A;  2YKM A;  3V6D A;  3ATV A;  5HRR A;  5AQX A;  4BC3 A;  4DV4 K;  3K5M A;  1P8Z A;  1RT5 A;  4BGA A;  4LF8 K;  4ISF A;  3SV3 A;  1NMN A;  3HRG A;  1YIJ N;  3SJJ A;  2P9P A;  2GWK A;  3DMJ A;  3NVM A;  4MO5 A;  4X65 K;  1VQL N;  3V1R A;  5KGX A;  5HP1 A;  3CXC M;  4E7H A;  4DQQ A;  5ELZ A;  4C8O A;  2NUB A;  3MXM A;  2Q0R A;  1LW0 A;  4W5N A;  2JLE A;  3SQ1 A;  3BEX A;  1ZBU A;  5FLX O;  4K42 A;  3E9P A;  2DFF A;  4FJK A;  1T7P A;  1QTM A;  4CJS A;  3I8D A;  2CGK A;  4FLX A;  2ASP A;  5C2F A;  4JI8 K;  3M8Q A;  3AVA A;  1IBL K;  3OTO K;  3ISN C;  3JXU A;  3CCM N;  1GLD G;  3T1Y K;  4JN4 A;  4DTJ A;  2XY8 A;  4CZJ A;  3RMA A;  4PY5 A;  1RFQ A;  4MO4 A;  4NLC A;  4M45 A;  4H4M A;  4N5S A;  3PO4 A;  4RWT A;  4O5B A;  3P1G A;  4RTF D;  4PKH A;  4W5T A;  1Z26 A;  3CCQ N;  1YUW A;  1SS6 A;  4CBX A;  3GOI A;  4UQG A;  4M41 A;  4B3M K;  2NZT A;  5LJW A;  4KRE A;  4B3T K;  2RPI A;  3QBX A;  3F5T A;  1RBV A;  4DTU A;  2BH1 A;  3AVN A;  3UKU B;  1VQ4 N;  4NCG A;  1LWE A;  3K0S A;  1ZBS A;  1L3S A;  3CJB A;  1U04 A;  3RWU A;  3K5L A;  3RMC A;  3CM5 A;  1BQN A;  1XNQ K;  1UOC A;  5AQQ A;  1BL3 A;  1EWR A;  4X62 K;  4FWN A;  4H0V B;  2I5J A;  3HM9 A;  3VES A;  4O4G A;  4CK2 A;  3CJC A;  3OYL A;  2HNZ A;  4JI5 K;  3ZSZ A;  3LAK A;  3V9Z A;  1B9D A;  2BGG A;  3GDQ A;  3WQT A;  4AH9 A;  5HOO A;  4LH4 A;  3OA9 A;  2V7Z A;  3FZL A;  1RCH A;  1C0F A;  3HSC A;  3VA3 A;  2KLA A;  3FFK B;  3QB0 A;  4B1V A;  3AVL A;  4LFC K;  5AQR A;  4FJ5 A;  3W3D A;  2FSN A;  4JI4 K;  2E1Y A;  4NO7 A;  3U3Y A;  1YTU A;  1NGD A;  1YJ9 N;  2Z1I A;  1EXQ A;  2NRX A;  1ILY A;  3ZT2 A;  2W6K A;  1KVC A;  4K0K K;  1Q86 O;  3ZLJ A;  2NRZ A;  4HVJ A;  3D7E O;  4N76 A;  3FE1 A;  1VQP N;  3R1X A;  4CJR A;  2OCE A;  4LSN A;  2DFH A;  3KK3 A;  3SPY A;  3SYZ A;  1WSI A;  1Z05 A;  4DSF A;  3AVG A;  3K9K A;  4C8M A;  4DSK A;  1RBT A;  1JLF A;  4N41 A;  4FM1 A;  4AQY K;  3EE8 A;  2P51 A;  1LCU A;  2YHW A;  4J2A A;  3QIO A;  4Z4E A;  3AVC A;  5BPM A;  1HX1 A;  2QWR A;  3NH1 A;  1SV5 A;  1S9E A;  3NVK A;  4FPA A;  1C0M A;  4DF4 A;  1HR0 K;  3CF5 L;  4B9Q A;  4JK8 A;  5TKY A;  1TAQ A;  1S1U A;  5M1Q A;  1UWB A;  1Q9Y A;  4DR2 K;  4CER A;  4QS9 A;  4AHC A;  1T03 A;  2IOC A;  3QDK A;  4ZTF A;  3C94 A;  3DYA A;  1Q18 A;  2XY7 A;  1QVG M;  1KFD A;  2ZM6 K;  4A2B A;  4JD2 B;  3QFP A;  1IKV A;  4HHT A;  1D9F A;  5BR8 K;  1RT2 A;  4DSL A;  3M6G A;  4H0Y B;  5BN8 A;  4C1N K;  2Q0U A;  4B1Y B;  1RDA A;  2W40 A;  2VQE K;  5HRN A;  1KAX A;  4GVM A;  5AQP A;  4CEF A;  4CHN A;  4DV1 K;  4KKO A;  3J81 O;  1F21 A;  3H08 A;  3O9U A;  3R8E A;  4U7B A;  1JJ2 M;  4KHY A;  5C2D A;  1O1W A;  1X9M A;  4BWM A;  3WNF A;  3BY5 A;  1C1B A;  4L3Q A;  1J5E K;  4ELU A;  2E5L K;  3VEY A;  3LDP A;  3OVN A;  2O8B B;  4BR7 A;  2YHA A;  4DMN A;  3MX2 A;  3OYG A;  3TSU A;  2KQ2 A;  3L0Q A;  1KLN A;  4ICL A;  1EKE A;  4FPB A;  3MK6 A;  4O8K A;  2HHW A;  2ASM A;  3LZI A;  1HYZ A;  3AA5 X;  4OKK A;  2D0A A;  2XHB A;  4F9O A;  4QS7 A;  4E1J A;  4CD3 A;  3AY9 A;  4CFA A;  1NLV A;  2P9U A;  3P5J A;  4N47 A;  5JVG L;  3AA3 A;  2HW3 A;  3SI6 A;  3V9W A;  3CQX A;  1C1C A;  3N4P A;  1BCM A;  4DTN A;  4KTZ A;  4CGH A;  3KK1 A;  4Z4C A;  2YNG A;  4K41 A;  2A42 A;  3KK7 A;  2QWM A;  3ULD A;  5HRS A;  4C1N I;  4XIU A;  4CJ5 A;  4BDP A;  1XMQ K;  1SL0 A;  1IO2 A;  3RMB A;  1U47 A;  4LFA K;  4CIE A;  2P5O A;  3F9M A;  3SZ2 A;  3MEC A;  3VET A;  3AO4 A;  4A59 A;  4DQS A;  3ZX3 A;  4YFU A;  1Z25 A;  5J2M A;  3OHR A;  4TSX A;  4EHT A;  1N36 K;  3DXM A;  3OBW A;  1W2B M;  3OY9 A;  1OH7 A;  1LAW A;  5KQD A;  2GUI A;  4CJF A;  3ZT1 A;  3B6O A;  3RRG A;  4H5R A;  1Z6R A;  3ZT0 A;  2ZQB A;  3I55 N;  5CZ1 A;  1B92 A;  4CJP A;  3VQ6 A;  3VF6 A;  4WE1 A;  3SLC A;  2HHQ A;  4AIL C;  2VCP A;  4Z4I A;  4ISE A;  4FW1 A;  4CBU A;  5BRF A;  5M1O A;  1Q8I A;  5C10 A;  1L3U A;  1VQN N;  3VGM A;  1NOZ A;  4GKK K;  4B3R K;  3OYM A;  1TUY A;  5FPE A;  3V9X A;  2E2O A;  1LWC A;  1OH8 A;  4JHD B;  4E89 A;  3O1B A;  4W5Q A;  1CZB A;  3S9H A;  5GIO A;  4CI6 A;  3IG1 A;  2GWJ A;  3CD6 N;  2E20 A;  5JLF A;  4FJJ A;  2G8K A;  4H5N A;  1U2V B;  3CCL N;  4FWK A;  4JK7 A;  3HP6 A;  4KB1 A;  3NH2 A;  3PLA A;  3PY8 A;  2O8C A;  4HUG A;  3LAN A;  2FF3 B;  2QI2 A;  3AA2 A;  3AGR A;  4FYD A;  4IFY A;  4M3Z A;  1NGJ A;  5AQM A;  4JKG B;  4DR1 K;  1EET A;  4KHS A;  4B9N A;  5HRP A;  3CPW M;  3QNO A;  3CCE N;  3MAQ A;  2HF4 A;  1T8E A;  5J2N A;  3BZC A;  3D2F B;  2F8S A;  3I0S A;  2CH6 A;  3ZSW A;  1D4X A;  1IKY A;  3LDL A;  1NJW A;  2RN2 A;  5BPN A;  2Y1I A;  2WUS A;  4JEP A;  4B8C A;  4KHN A;  2ZGY A;  1WSG A;  3S3O A;  4EP5 A;  4M3U A;  1YT3 A;  4ELV A;  3KKR A;  4BRD A;  4CZH A;  1XQS C;  1YXQ A;  1R59 O;  4FVM A;  5C0Y A;  4FM2 A;  5AFU H;  5F2R A;  4BRK A;  3CM6 A; 
#chains in the Genus database with same CATH homology
 3DLE A;  4Z4G A;  1BQM A;  2HND A;  2G8F A;  3DLB A;  3KLE A;  2A1R A;  1DTQ A;  1SL1 A;  1VSM A;  1KFS A;  1CLQ A;  4B9T A;  4CCH A;  4JLH A;  3HO1 A;  3QET A;  1X9S A;  4DSJ A;  4M3X A;  4DS4 A;  4CIF A;  2HHS A;  3OYE A;  1RT6 A;  2D5R A;  2D0B A;  3HVT A;  4CJV A;  4DSI A;  1QQC A;  4KPY A;  1UA0 A;  2OPS A;  3V1Q A;  1BI4 A;  3SQ4 A;  1ZBI A;  3WNE A;  3VQ7 A;  3O3G A;  3AVF A;  1XI1 A;  4BWJ A;  3NFA A;  2VG5 A;  4LSL A;  3OS0 A;  1HPZ A;  3E01 A;  1A5X A;  3PX0 A;  4J2E A;  3D0P A;  5E41 A;  4C8K A;  4NCB A;  4K8X A;  1NOY A;  4KFB A;  1FK9 A;  3NGZ A;  3V9U A;  3NGY A;  3ZT4 A;  1HYV A;  3O4Q A;  1JL1 A;  2KFN A;  5I42 A;  3NDK A;  3HT3 A;  4AHR A;  2YNI A;  4KI6 A;  1ASU A;  2IDO A;  4E1N A;  1RTI A;  4DSE A;  3QEX A;  2QXF A;  4FLY A;  1JLB A;  3NF7 A;  3AA4 A;  1NK8 A;  4RW7 A;  2HB5 A;  1U49 A;  3T19 A;  4QCL A;  4FXD A;  1VRT A;  3DRS A;  1J9A A;  1VSF A;  4DQR A;  3L3U A;  1XWL A;  2YKM A;  3L3V A;  1HNI A;  4CEE A;  1WSE A;  3F73 A;  3V6D A;  1IH7 A;  1LAV A;  1A5V A;  5HRR A;  2YV0 X;  4B08 A;  3K5M A;  1R0A A;  1RT5 A;  3SUO A;  4CF0 A;  4M3T A;  4KRF A;  3K5O A;  3KLG A;  3OS1 A;  3SV3 A;  4F4K A;  4KV8 A;  4AHS A;  1BCO A;  4CJW A;  4FCY A;  4KO0 A;  4CHY A;  3SJJ A;  1XC9 A;  4CES A;  4B8A B;  4DTS A;  4FJM A;  3B6P A;  3DMJ A;  2QKB A;  3V1R A;  4E19 A;  1WSF A;  1U48 A;  1RNH A;  2XRI A;  3C95 A;  2FBT A;  5HBM A;  5KGX A;  3V9S A;  1QSL A;  3O4N A;  3RR7 A;  5HP1 A;  1RIL A;  1Q9X A;  4E7H A;  4DQQ A;  3LP1 A;  4C8O A;  4YNQ A;  2NUB A;  4CGI A;  3MXM A;  5FRN A;  1LW0 A;  5C42 A;  3KLH A;  1UAX A;  4W5N A;  2JLE A;  3SQ1 A;  4CHO A;  1EP4 A;  2G8U A;  1ZBU A;  1SKS A;  3SV4 A;  4FZZ A;  1CZ9 A;  3NF9 A;  1G15 A;  1NKC A;  3ZSR A;  1NKE A;  1QE1 A;  2DFF A;  4FJK A;  3K5N A;  1T7P A;  1QTM A;  4CJS A;  3I8D A;  3TAF A;  4ELT A;  2F8T A;  3MED A;  4JS4 A;  1C0T A;  4FLX A;  3TAG A;  4J2D A;  4DU3 A;  3M8Q A;  3ZSO A;  3VQC A;  3AVA A;  1A5W A;  3CYM A;  3ISN C;  2BE2 A;  4DTJ A;  2XY8 A;  3RMA A;  2FC0 A;  3SUQ A;  2E4L A;  4PY5 A;  4EZ9 A;  4ZTJ A;  4OKJ A;  4KAZ A;  4BDZ A;  3T1A A;  4RW4 A;  3MEE A;  1DTT A;  3MXI A;  1SL2 A;  4C8N A;  4M45 A;  4CGJ A;  4H4M A;  1RBR A;  4N5S A;  1NK0 A;  3KTQ A;  4B9S A;  4DFK A;  4DTX A;  3PO4 A;  4FK4 A;  1ITG A;  1HRH A;  3DI6 A;  4O5B A;  5KI6 A;  3WNH A;  3P1G A;  4O0I A;  3NGI A;  3M8S A;  3DRP A;  3G0Z A;  3QEW A;  2P1J A;  1KVA A;  4W5T A;  4H4O A;  1Z26 A;  2PY5 A;  4IFV A;  3DOL A;  1JLC A;  3G10 A;  3TAE A;  4RW8 A;  3AVK A;  1ZBF A;  4CEO A;  1HYS A;  3AVH A;  4CIG A;  4CFD A;  4UQG A;  3KD5 E;  1KCF A;  4M41 A;  3VQE A;  2HHT A;  3MEG A;  3K58 A;  1JLQ A;  1TK5 A;  3CFP A;  3LP2 A;  4RW6 A;  5KTQ A;  4KRE A;  4QOZ B;  2RPI A;  4JRQ A;  3VA0 A;  2YKN A;  1RBV A;  4I2P A;  4DTU A;  3AVN A;  4CHP A;  1NK4 A;  4NCG A;  1LWE A;  1N6Q A;  1S5J A;  3VQ4 A;  4Z4F A;  2XO7 A;  4BAC A;  4RW9 A;  5KRT A;  4DF8 A;  1L3S A;  1U04 A;  3RWU A;  4M3Y A;  3OJS A;  3K5L A;  3RMC A;  3CM5 A;  5D3G A;  3P83 D;  3VN5 A;  1DLO A;  1CXU A;  4W5R A;  1BQN A;  4CEQ A;  2IGI A;  1UOC A;  2IC3 A;  4FLT A;  4Z4H A;  1L5U A;  1BL3 A;  1NKB A;  4ID5 A;  3TWH A;  4KTQ A;  2I5J A;  3HM9 A;  2X6S A;  1CXQ A;  2ZE2 A;  3OYK A;  1RTH A;  3HXM A;  2PYL A;  1FKO A;  4OGE A;  3AVI A;  4O4G A;  4CK2 A;  3CG7 A;  4B9U A;  5CY4 A;  3L2Q A;  3AVJ A;  3HP9 A;  1I3A A;  2HNZ A;  4CK3 A;  3OYL A;  4PWD A;  3VQ8 A;  3ZSZ A;  1HNV A;  1VK0 A;  3LAK A;  3JYT A;  1B9D A;  3V9Z A;  2BGG A;  4AH9 A;  4EP4 A;  4L8R B;  4LH4 A;  3VQP A;  3L8B A;  4MQ3 A;  3CFR A;  1QS4 A;  1RCH A;  1JL2 A;  3VA3 A;  2B5J A;  3HL8 A;  1J5O A;  4CJL A;  4Z0U A;  4CJK A;  3AVL A;  3L2R A;  4B9M A;  2HHX A;  4OJR A;  3AO3 A;  3AO5 A;  4E1M A;  3HJF A;  5I3U A;  4FJ5 A;  4E0D A;  1TL3 A;  3CM6 A;  5DMR A;  4DS5 A;  3U3Y A;  4DTO A;  1YTU A;  2B6A A;  3VQQ A;  4AHV A;  3OYH A;  4H8K A;  1REV A;  2Z1I A;  1IKW A;  1EXQ A;  5C25 A;  2G8W A;  2Q3S A;  3DLK A;  3ZT2 A;  3HPG A;  4CGF A;  1KVC A;  1JLG A;  1WN7 A;  3DLH A;  4HVJ A;  4N76 A;  1IKX A;  1L3T A;  2OZS A;  4F2S A;  1N5Y A;  4CJR A;  2VG7 A;  4I7F A;  4LSN A;  3IRX A;  2DFH A;  2FBV A;  4HTU A;  3KK3 A;  3SPY A;  5SWM A;  4K8Z A;  2HVH A;  3SYZ A;  3MXJ A;  1WSI A;  4F2R A;  4DSF A;  3AVG A;  2WOM A;  3VQD A;  2EHG A;  3HST B;  5JS2 A;  3TAR A;  4M3R A;  1RDC A;  4C8M A;  4BE0 A;  1S9G A;  1XHX A;  4DSK A;  2W42 A;  2OPP A;  4CF8 A;  3KIO A;  4DTR A;  4DQP A;  2DTU A;  1RBT A;  1JLF A;  3IS9 A;  3QIP A;  4RG8 A;  3V1O A;  4N41 A;  4PQU A;  4FM1 A;  1S1V A;  3AV9 A;  2RF2 A;  3DRR A;  2ATQ A;  5FDL A;  1TGO A;  3ALY A;  3NF6 A;  4CHZ A;  4NYN A;  1VSI A;  1FXX A;  1S6Q A;  2P51 A;  1W9H A;  3CFO A;  1ZBH A;  3EZ5 A;  1ZBL A;  1LWF A;  4FZX C;  4J2A A;  1MU2 A;  3QIO A;  4B9L A;  4Z4E A;  3AVC A;  1QSY A;  4GMJ B;  2PZS A;  2DY4 A;  2P5G A;  2FBX A;  3LP3 A;  1ASV A;  3NH0 A;  1K6Y A;  3NH1 A;  1FKP A;  1BHL A;  2G8H A;  4KHU A;  3ITH A;  3AVM A;  4IDK A;  4FJI A;  1TAU A;  1JXE A;  1SV5 A;  1S9E A;  1RT3 A;  4I9L A;  3QNN A;  2ETJ A;  1KSP A;  1LW2 A;  1VSL A;  4O44 A;  3KKS A;  3L2V A;  4JS5 A;  2KTQ A;  1C0M A;  4DF4 A;  3AVB A;  1Y97 A;  5HLF A;  3IAY A;  1NK9 A;  1TAQ A;  1S1U A;  3OS2 A;  3KLF A;  1TKX A;  1UWB A;  1Q9Y A;  3O3H A;  2Z1J A;  2E6L A;  3LAM A;  1D5A A;  4CER A;  4AHT A;  4DTM A;  1TVR A;  1D8Y A;  5FRM A;  4AHC A;  3LWM A;  4DLG A;  1T03 A;  3SPZ A;  2IOC A;  4C8L A;  4FJG A;  3LAL A;  4CEZ A;  1VRU A;  4ZTF A;  2HVI A;  4B9V A;  3LZJ A;  3C94 A;  4OPJ A;  4F3O A;  3DYA A;  2XY7 A;  1SKR A;  2XY6 A;  4LY7 A;  4BDY A;  3TI0 A;  3VQ9 A;  3QEV A;  5J2Q A;  1KFD A;  1KVB A;  3TAM A;  3L2W A;  1IG9 A;  2E6M A;  4FZY A;  4PUO A;  4E7J A;  3HVR A;  1WAF A;  3CQ8 A;  1IKV A;  4HHT A;  4F8R A;  1D9F A;  1RT2 A;  4DSL A;  4PA1 A;  4OGC A;  4OPK A;  4FJ7 A;  2Y1J A;  2HHU A;  2FBY A;  4B3O A;  1RDA A;  3NBP A;  5HRN A;  3EY1 A;  4GVM A;  1S1X A;  2OA8 A;  4AHU A;  4CEF A;  4CHN A;  4QAG A;  4KKO A;  1F21 A;  3H08 A;  3OYI A;  3F9K A;  3ZSY A;  4DFJ A;  4N56 A;  4KHY A;  1GOB A;  3NAE A;  1D9D A;  4E7L A;  1J53 A;  1O1W A;  3KD1 E;  3DLG A;  4JRP A;  1W0H A;  3SCX A;  1QHT A;  1X9M A;  3HK2 A;  2KZZ A;  2KZM A;  3RRH A;  4DTP A;  4BWM A;  1EX4 A;  3WNF A;  1C1B A;  4ELU A;  2D0C A;  2HNY A;  3ZT3 A;  3QES A;  3OYA A;  1ASW A;  2VG6 A;  3OVN A;  3QO9 A;  4IBN A;  4KTW A;  2YHA A;  4DMN A;  3OYF A;  4CGD A;  4FLV A;  2O4I A;  3OYG A;  2OPQ A;  3T3F A;  2KW4 A;  4FJN A;  2KQ2 A;  4CFC A;  2X78 A;  1X1P A;  4CF2 A;  4BE2 A;  2DFE A;  1BI4 B;  1WSJ A;  4ICL A;  3NHG A;  1EKE A;  1KLN A;  4DQI A;  1RTD A;  3OJU A;  2YNH A;  1SUQ A;  3TAP A;  4M3W A;  2HHW A;  4FLW A;  1RT4 A;  3LZI A;  1HYZ A;  3AA5 X;  5CYM A;  4OKK A;  2D0A A;  2XHB A;  1VSE A;  3DLR A;  4FJH A;  4ID1 A;  1I39 A;  4Q5V A;  4CFA A;  3V81 A;  1NJX A;  4CJQ A;  2XY5 A;  1HMV A;  3P5J A;  2X6N A;  3RR8 A;  4N47 A;  2Z1G A;  2A1S A;  2KFZ A;  3AA3 A;  3KK2 A;  4Y1D A;  3SI6 A;  2OYQ A;  2HW3 A;  3V9W A;  1RTJ A;  1TV6 A;  3VQA A;  1U4B A;  4HUE A;  1BGX T;  1C1C A;  2YNF A;  4CHQ A;  3OYB A;  1BCM A;  4DTN A;  1WSH A;  2IS3 A;  4KTZ A;  4CGH A;  3KK1 A;  4Z4C A;  2VWK A;  2YNG A;  3OYJ A;  3PX6 A;  5C24 A;  3ULD A;  5HRS A;  4KHQ A;  4XIU A;  2BAN A;  4CJ5 A;  3QEP A;  4MFB A;  1VSJ A;  2G8I A;  5J1E A;  4BDP A;  4KB0 A;  1SL0 A;  1IO2 A;  4FW2 A;  1NK5 A;  3RMB A;  3QLH A;  3PX4 A;  1U47 A;  3SNN A;  1U45 A;  2OZM A;  1C0U A;  4O55 A;  4J2B A;  3JSM A;  4CIE A;  1NJY A;  1LV5 A;  2ITG A;  2P5O A;  3SZ2 A;  2BDP A;  3V4I A;  2R7Y A;  3MEC A;  3NF8 A;  1WAJ A;  4FK0 A;  3AO4 A;  2OPR A;  4CK1 A;  3OYC A;  4HCC A;  2VWJ A;  4CJU A;  4DQS A;  3ZSX A;  1B9F A;  4IG0 A;  1RT1 A;  3NE6 A;  4CFB A;  2HMI A;  4FM0 A;  3WNG A;  4YFU A;  1Z25 A;  1WNS A;  2QKK A;  4M42 A;  3C6U A;  4I2Q A;  3M8P A;  5J2M A;  1XHZ A;  1YTA A;  2PYJ A;  4TSX A;  4IKF A;  4OLA A;  4FLZ A;  3OY9 A;  1LAW A;  5KGW A;  3ZSV A;  4FJ8 A;  2GUI A;  4LD0 A;  4CJF A;  3PV8 A;  3ZT1 A;  3BGR A;  3B6O A;  2O4G A;  3RRG A;  1VSH A;  3AO2 A;  4FJX A;  4E7K A;  3LDS A;  1TL1 A;  3ZT0 A;  2ZQB A;  5CZ1 A;  1JLE A;  3D45 A;  4CJE A;  4CJ4 A;  1B92 A;  2F96 A;  4CJP A;  3VQ6 A;  1RT7 A;  5CZ2 A;  5DK5 A;  1GOA A;  1NJZ A;  4Q0B A;  3SUP A;  5CYQ A;  4DG1 A;  4WE1 A;  2HHQ A;  5EU7 A;  1WLJ A;  4E7I A;  1KTQ A;  3KLI A;  4AIL C;  2YHB A;  4CED A;  4CF9 A;  3RMD A;  4BE1 A;  4FW1 A;  5J2P A;  4I9Q A;  1JXB A;  4Z4I A;  1JKH A;  3LPT A;  2QK9 A;  3U3G A;  1Q8I A;  1VSD A;  2Z1H A;  2ZD1 A;  4R5P A;  3U6F A;  3SQ2 A;  1NOZ A;  2B4J A;  1L3U A;  2G8V A;  4DFP A;  4DWI A;  4NCA A;  3OYM A;  1L3V A;  4CF1 A;  1TKD A;  3PUF A;  4LH5 A;  4CE9 A;  5SZT A;  3V9X A;  3RTV A;  2WON A;  3O3F A;  3TAN A;  3TAB A;  2HHV A;  3HPH A;  1LWC A;  1HQU A;  3S3N A;  5K14 A;  3DOK A;  3VQB A;  4DU4 A;  4E89 A;  4CEA A;  1HQE A;  1NK6 A;  3UIQ A;  4W5Q A;  4HCB A;  3K2P A;  1RDD A;  3QEI A;  1CZB A;  1KRP A;  2X74 A;  3S9H A;  3TAQ A;  3IG1 A;  1T05 A;  1BIU A;  3LPU A;  3KJV A;  3C6T A;  4DU1 A;  1SKW A;  1QSS A;  2G8K A;  5KRS A;  3BDP A;  4FJJ A;  3EYZ A;  4W5O A;  3NCI A;  4FK2 A;  3M8R A;  3K57 A;  3L2U A;  1VSK A;  4O0J A;  2IAJ A;  3HP6 A;  4KB1 A;  3NH2 A;  3PY8 A;  3TR8 A;  4HUG A;  3DM2 A;  4G1Q A;  1S1T A;  4OVL A;  4KHW A;  4FJL A;  3LAN A;  4CGG A;  5HRO A;  4OKE A;  3AA2 A;  4GW6 A;  3I0R A;  1ZYQ A;  4FYD A;  1BIZ A;  4IFY A;  4KI4 A;  2GV9 A;  4NYF A;  2RKI A;  4EZ6 A;  3LP0 A;  4M3Z A;  1TK0 A;  5FRO A;  1EET A;  4IG3 A;  4FJ9 A;  4KHS A;  4B9N A;  5HRP A;  3K59 A;  3ASM A;  3SUN A;  1S1W A;  1TKZ A;  1KLM A;  1RBU A;  3VQ5 A;  3QNO A;  1J54 A;  1X9W A;  1C6V A;  4HUF A;  3MAQ A;  4CJ3 A;  5T7B A;  1C1A A;  3LWL A;  4E3S A;  1RDB A;  1RBS A;  4FLU A;  3OYD A;  3SQ0 A;  5J2N A;  1T8E A;  3QER A;  1TK8 A;  3I0S A;  2F8S A;  3ZSW A;  3HYF A;  4ZHR A;  1TKT A;  3FFI A;  4CEB A;  1IKY A;  1NJW A;  3HPO A;  2RN2 A;  1BIS A;  2Y1I A;  1GOC A;  1NK7 A;  4CEC A;  3THV A;  3S3M A;  3PO5 A;  4B8C A;  4KHN A;  3QIN A;  1WSG A;  3S3O A;  1UA1 A;  2JGU A;  3ZCM A;  4EP5 A;  1JLA A;  1YT3 A;  1YVU A;  4M3U A;  3AO1 A;  4ELV A;  3KKR A;  4Y1C A;  4OLB A;  5JS1 A;  4DFM A;  4FVM A;  3ZSQ A;  4DLE A;  2LSN A;  4F3T A;  1S6P A;  2AJQ A;  2GBZ A;  4CJT A;  4FM2 A;  3OYN A;  3A2F A;  2EX3 A;  1HJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...