1IBMK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1ibmK00
4JI3K 2UXCK 4JI1K 4DV0K 2ZM6K 2VQEK 3J81O 1HNWK 4LF7K 4DR7K 3JAMO 5IT9O 2HHHK 1HNXK 4DR1K 2UU9K 2UUBK 4X62K 4JI5K 3J7AP 4YY3K 4B3SK 4GKJK 4CVNE 2UUAK 5BR8K 4YHHK 5A2QO 4JV5K 1N36K 4LF8K 5IWAK 3T1YK 2E5LK 4JI2K 4KHPK 4LFBK 1N33K 4OX9K 4DV5K 4DV1K 1I94K 1J5EK 4X66K 2VQFK 1XMQK 4NXNK 2UXBK 4DV7K 1FJGK 3OTOK 4LF6K 4V19S 4DV3K 4LF9K 4JI0K 5FLXO 1XNQK 5LMUK 3J7YP 4LFCK 2UXDK 4JI6K 4DV4K 4GKKK 5AJ3K 4JI8K 4DUZK 4B3RK 1XMOK 4B3TK 4X64K 4NXMK 3T1HK 4X65K 4DR3K 1IBKK 4DR6K 1HR0K 4LFAK 1N32K 4DV2K 1IBLK 3J80O 4DUYK 4DR5K 1XNRK 4DR2K 4B3MK 4JI4K 2F4VK 4K0KK 4CW7B 4LF4K 2UUCK 5LMNK 4LF5K 4JI7K 5LL6Z 1HNZK 4DV6K 4AQYK 4DR4K 4JYAK 1N34K 1IBMK
chains in the Genus database with same CATH superfamily
1WBDA 1W97L 1NK4A 5T7BA 4QAGA 1OH8A 3DXKA 3D7EO 3MMVA 3BGRA 4FO0A 3BDPA 3H1VX 4HWIA 5M1QA 2O8FB 2VWKA 4IDHA 4JKFA 4E1MA 5DM7L 3VF2A 4FJ7A 4CBXA 4CD1A 1J6ZA 3CCJN 3HTVA 5J1EA 2UUBK 1JXBA 1O1WA 3Q7BA 3MK6A 1TKDA 1D8YA 1UWBA 1A5XA 4HCBA 3QETA 1NGHA 3VETA 1C6VA 4FVMA 2X74A 3C6UA 3SYZA 3EY1A 2OCEA 4H0VB 4PKGA 4O8UA 3ZT0A 4DTOA 1BIZA 1NGJA 4DSIA 4CEBA 1CZ9A 5KPTA 1LWFA 3CJBA 4YOYA 2JWLA 5KPRA 3SAHA 1U45A 1VSHA 1UAXA 1NGGA 3HO1A 1U04A 4Y1CA 1FJGK 1BCMA 3VQEA 3DRRA 5AQOA 3CIPA 4NYFA 5M1PA 2F96A 3ID8A 4KFBA 1NLVA 2J4RA 5C12A 4Q5VA 4CEQA 3EEQA 3O9RA 3IG1A 4GKKK 2P5GA 3WEEA 4DUZK 2D0PA 4N56A 2GBZA 4FWSA 4FW1A 3T1AA 1S6QA 4A61A 1TK8A 3NF8A 2P9SA 4JD2A 3CQ8A 1Q86O 3O4WA 3L4IA 3QO9A 4L8RB 4NCAA 1Q18A 3RMAA 1WNSA 1BOTO 3L2UA 1WLJA 3LPTA 1SZ2A 1U48A 3ZSVA 5E84A 1E4GT 2QWLA 2YV0X 3PSFA 4Z4GA 3M5RA 4GVMA 3A8YA 3UKUB 4WYBA 4AHRA 1HNVA 4CHNA 2O8DA 2IVOA 2P51A 1KAYA 4BVOA 4AHUA 1A5VA 4CZMA 1VSLA 5AQNA 4KBOA 3ZYYX 4IJNA 4DF4A 4M3UA 2JWKA 4C23A 3O9TA 1C1AA 4JN4A 3QLHA 1GLEG 2Z1GA 5BRDA 3SUPA 4IFVA 3T3FA 1LOTB 3ID6A 4YY3K 3R8EA 4DLGA 2ASPA 1YIJN 4CK2A 1JLBA 4H03B 2I5JA 1WSGA 4W5QA 4WQ5A 1TKTA 4BR9A 2E5LK 1S9GA 3VTHA 3EYZA 3GG4A 1MWMA 1NJXA 1VQMN 2KFZA 3HM9A 4FPAA 3OYGA 2QWNA 3BP8A 3WUHA 4JEPA 1C0GA 4FJLA 2QWPA 2VQFK 1XMQK 5CR4A 1VSJA 5BPNA 1J9AA 3OTOK 4MQ3A 3U3YA 5HP1A 3MXIA 4Q0BA 2HVIA 2P9PA 4M63C 3LM9A 4DV3K 3RRGA 3QNOA 2WFBA 2FBVA 3D45A 4O8KA 3G25A 2P9UB 1P8ZA 3O5BA 1TUYA 3SAFA 2HW3A 1XMOK 3T7ZA 1C0TA 2KHOA 5F2RA 3AVHA 5I9EB 2VWJA 1ZBLA 2X6SA 4LFAK 1IKVA 4FWNA 1N32K 2IS3A 4UQGA 3J8AA 2XY8A 4FK2A 4CJKA 2GV9A 1D4XA 4EZ6A 1HNIA 4BRPA 1RCHA 3IS9A 1REVA 1NKCA 1RT6A 1IJJA 2Z1JA 2DY4A 3BEXA 2EX3A 1YVNA 3TTCA 3VQ4A 2P9IA 2E20A 4CJWA 3ZSWA 1T3VA 1C0UA 4YFUA 4B3OA 4YDUC 3L4QA 2OZMA 5AQVA 1TV6A 1EO1A 3C7NA 2PFUA 1YJ9N 1DLOA 3VQ9A 1YI2N 2HNZA 4CEZA 3PUFA 1VQ6N 2IOCA 4DQPA 1ATNA 2P9SB 4Z94A 3RWUA 4N47A 3JAMO 2FSKA 3B6OA 1HLUA 1QSLA 1HRHA 1Q7YO 3QESA 1JKHA 1GLDG 3E1YA 3OYBA 2D0AA 4AHCA 2P9KA 1M1KO 5AFUA 3K57A 5KQDA 2O8EA 4DCHA 4OPHA 3CQYA 4FJIA 1R59O 1MU2A 1SUQA 2E1ZA 1TAUA 1J53A 2WUSA 1VQ9N 4IEEA 1NK9A 3SJHA 3TARA 1KLNA 1S1XA 4HVJA 3AA4A 4KAZA 2QWMA 3LZJA 4KI4A 5EY4A 5KQ8A 3AGRA 4JK7A 4DSLA 5BPMA 4CHYA 3FFIA 1QVGM 1XNQK 3FFKB 2UXDK 4NCBA 3VOVA 4GV6A 1B9DA 4RW8A 4LSLA 4BREA 4F2SA 4QS9A 3CCMN 1Q9XA 2AP1A 3V1OA 3KLHA 4CIGA 4GV9A 1IO2A 1JLCA 3ATUA 3WNFA 2ZJRL 4E7KA 3HPHA 1YITN 1IBLK 5FDLA 3SNNA 2P1JA 1VQ7N 1RDUA 3L6QA 2BUPA 4JKDA 3RMCA 5CY4A 3ZSXA 5AQUA 2ZQBA 1DKGD 2IIRA 2UUCK 1L3SA 2P9PB 4BROA 4B1WB 5LL6Z 1HPMA 3CCQN 1Z05A 1EP4A 4FM1A 3JYTA 4H5TA 3CD6N 1NGBA 4EHUA 3THWA 2WC9A 4BRHA 3G4SN 1VSIA 2UXCK 1ZC6A 3TAGA 4N76A 2YI1A 4BRLA 3F5TA 1HNWK 4CESA 1U49A 4W5RA 4FLWA 1RDAA 3LP1A 2VYPA 2UU9K 4FJJA 1SL0A 2IGIA 3RMBA 1X9MA 4DU1A 1IG8A 3HSTB 3VGMA 4DS4A 4PKHA 2HHQA 5A2QO 5SZTA 3VQ8A 2P9IB 4CHZA 2QA4N 3OYFA 4LF8K 3CERA 5IWAK 4CHQA 1T6DA 2FLOA 3C7NB 3D2EB 3SUOA 1EWQA 4DV1K 1NKEA 1I94K 3K9JA 5AZIA 3KLFA 5K14A 3DRPA 4GW6A 3SI6A 1ZBUA 4FLXA 4LF6K 4OPAA 5AQLA 1RDDA 2YHYA 4IG0A 4KHYA 4Z4EA 4AHVA 1FK9A 3HVTA 1D9DA 3IAYA 3V4IA 5C2FA 1VQ8N 3CMEN 3ATVA 1HPZA 3PO4A 3H1QA 4JI8K 2IVPA 1X9SA 2HHXA 3S9HA 1LWCA 2V52B 1YAGA 2GEMA 4Z0UA 1GLAG 3HP6A 3O6WA 3RR8A 1SAZA 3AY9A 2OTJN 4DR5K 4F8RA 3TI0A 1XI1A 2I7PA 3B8AX 3NCIA 2F4VK 2O4IA 4CW7B 1BQNA 5HRPA 2VGMA 4B8CA 3ZEUB 4AH9A 4WFBL 3SLCA 3CFRA 4BWJA 4BR0A 1BGXT 3CXCM 5AQJA 4YNQA 2O8FA 5FRNA 4CBWA 3KJVA 5CHIA 3QNNA 3O3HA 2HNYA 1BU6O 3M8SA 2KLAA 3QBWA 4CGFA 4KH5A 2Q2RA 2QW9A 1QSSA 3ZT4A 2YJFA 4F2RA 1DT9A 3O9SA 4EP4A 3V9XA 4HCCA 4OPJA 4OO1J 4M3TA 4NYNA 3QEXA 3V9SA 3J7AP 2YHBA 3A5LC 3A5NC 1RT7A 3DLEA 3NF6A 2UUAK 1K8KA 5AQHA 5EX5A 1B9FA 3FLCO 4PWDA 4CF1A 4CJEA 4O0JA 1Y97A 3AARA 1KC8O 4CJ4A 2QM1A 1FKOA 3DRSA 4DV5K 3UE5A 5KTQA 3THWB 1E3MA 1FXXA 4NXNK 2IAJA 3T69A 2YHWA 4PY5A 4G9ZA 5HROA 4IXCA 3DI6A 2O8CA 1D9FA 3JS6A 3S3MA 1TL1A 2XY5A 5ADXH 4JAXA 2BANA 2OANA 5GAEP 4B1VA 1S1TA 3CYMA 4OPKA 3ENHA 2D0BA 2VG7A 5C42A 4AM7A 4JS5A 4FW2A 4DF8A 5H1SQ 3TAQA 3O9QA 1CZAN 3G10A 4B3TK 4K8XA 3CCEN 4CEAA 4ISGA 2YNIA 4KPYA 4DR6K 1NK0A 1HJRA 3LWMA 4DQQA 4CBUA 2YKNA 4KTWA 4IKFA 2HHVA 3AO3A 3SQ2A 3MX5A 1ITGA 5AZIB 1V4TA 1YXQA 3FZHA 3GL1A 4F3OA 4KB0A 1LW0A 4IO8A 4YOTA 4MO5A 3PIOL 3FR0A 3ZT1A 1ESVA 2E4LA 4A5BA 4BRMA 3MEDA 5LMNK 2PBDA 3DWLA 3EE9A 4JKAA 1YTAA 1RBSA 1LWEA 4CFAA 2E8AA 4ILHA 3ZSQA 4OVLA 4ILGB 4BE1A 4C8KA 2A41A 1OVYA 4CFCA 3KK1A 3H45C 4XIUA 4ICLA 3ZSRA 5AQSA 4ZTJA 4B9QA 4B9VA 1LAWA 1GLCG 3LP3A 3S3OA 3L2RA 5FRMA 2A1SA 1U2VB 3C0BA 4FJ9A 3U3GA 4FK0A 4BRNA 4BRAA 3HJFA 5HOOA 3P31A 2NLXA 3CJCA 4DB3A 2AJQA 3LPUA 5AZJA 2R7YA 2YJEA 4CF9A 3C65A 3QMLA 5BR8K 4I2QA 3CJ7A 4BE0A 4R5PA 3G71N 4KKOA 3C94A 1SKWA 3ZSYA 4FZXC 1NKBA 3QB0A 2DFEA 4CJQA 1BI4A 4FWMA 3DMJA 3AO5A 4BDYA 3PLAA 1HUXA 2P9UA 4WE1A 3NE6A 1VQ4N 3C6TA 3LM2A 3LDSA 4FWKA 5GAGP 3RTVA 4LF9K 1SL1A 2G8IA 4NCGA 2PAVA 1NOYA 2BH1A 4JI6K 1NG9A 4BRQA 4K25A 4XH1A 4FJGA 1K8KB 2F7TA 3AO2A 4HHTA 4DR3K 4ID5A 3K59A 3ENOA 4FLTA 3HSCA 4DTMA 1VQPN 3WT0A 1Q9YA 4M7YA 4B9MA 3SV3A 1QZ5A 2HHWA 3KK7A 3VQCA 1ZYQA 3P4IA 1SKRA 3S41A 3Q7CA 2V7ZA 4DFPA 1NOZA 1TL3A 4LF4K 1HQEA 1H1VA 2ASMA 2O8CB 1UA0A 3DLRA 4JI7K 1VHXA 2E6MA 4OJRA 3NFAA 1QHTA 3NF9A 4E19A 2A3ZA 4CJLA 1BWFO 1BIUA 2VCPA 3KLIA 2NRXA 3V1RA 1VSEA 1S5JA 1JXEA 3AVLA 4DSEA 2FXUA 1KVCA 1OH6A 2VG5A 4BACA 3JSMA 4B9SA 2VQEK 1DEJA 1JLFA 4QCLA 3OYJA 4K8ZA 3L3VA 1NM1A 3TTDA 2NRRA 2HHHK 3KHYA 3AA2A 4FWOA 3LDQA 4B08A 2ASOA 4CVNE 4HTUA 1RTDA 3V9UA 5HBMA 4AHTA 3QFUA 2B6AA 3SMPA 4FJXA 4BDPA 4EHTA 2F8TA 5BN9A 1N33K 1TUUA 3MXJA 1NGCA 5C10A 1NGFA 3SQ0A 2BE2A 3KKSA 3WNHA 3I55N 3R3LA 4X66K 3F9MA 3FZMA 3LALA 3AVFA 4A2AA 2PYLA 3HRGA 4CI6A 4EAHD 2Y1IA 4DWIA 4AHSA 1HQUA 5FLXO 5LY3A 3K5NA 1GLLO 3VQDA 2X78A 4BGAA 4H0PA 4FCYA 3P83D 5AZJB 3VQBA 2V51B 2YHAA 3F2KA 3OS1A 1M90O 4A5AA 1CXUA 3H3OB 3E66A 5HRSA 4JKHA 3T1HK 1TKXA 2RE2A 3O4NA 3VQ7A 4R79A 3LP0A 3GDQA 3A0IX 1QZ6A 2DFHA 3J80O 1BA1A 1BI4B 3CM5A 1SKSA 3EZWA 4DMNA 4FM2A 5KRSA 2HF4A 1JJ2M 1XWLA 1C1BA 3E01A 3AO1A 3QEWA 4UY8O 4DU3A 4C8NA 2PZSA 3SK3A 2Q0UA 4JKGA 1NGAA 5SWMA 2ZF5O 5FROA 3OYNA 3VEXA 5AQYA 4GVEA 3VN5A 4CZGA 1MWKA 4M3ZA 3FZFA 4CZIA 4JI1K 3VA3A 2GWKA 4J2AA 4CHPA 1K9MO 3DJCA 4DTSA 2WBNA 3OHRA 2YX6A 3NMUA 4JKEA 1E4FT 1S22A 2RN2A 1KFDA 2CGJA 4M3XA 3MCAB 4G1QA 4DTJA 3PX4A 2XHBA 4IBNA 4F3TA 3TABA 3D2EA 1BQMA 1TAQA 4Z4CA 1QQMA 3M8QA 1RTHA 4E1NA 3U4LA 4JV5K 2DFFA 1JL2A 1N36K 4DTRA 1RDBA 3O08A 3NH2A 4FM0A 4FJ8A 4GY2B 3HL8A 3UKRA 3ULEA 4LD0A 2HHSA 1XQSC 4OX9K 3LDNA 3MX2A 3O4QA 3CCUN 4RW7A 1VQNN 1J5EK 3OVNA 4ELTA 3MN9A 3U6FA 3C95A 1IH7A 3LL3A 4O0IA 2HVHA 4PUOA 4ELUA 3U8XA 4KHNA 3RSEB 3FGUA 4MDBA 2QKBA 5AQWA 2DPNA 3UIQA 5I42A 3AVIA 2ZE2A 4QS7A 3CJ1A 2FSJA 5M1OA 4WQ4A 1YJWN 2FSNA 4ISEA 2NNWA 4CFDA 4FWPA 3ULDA 1XUPO 2OZSA 4BC3A 3ZEUA 2HBMA 1YVUA 3O1BA 1T7PA 4ILJA 1NJIO 4J8FA 2P9NA 1N8RO 3NAEA 3DLHA 3THYB 4FYDA 3K9KA 3AVBA 5M1FA 3VENA 1KSPA 4CK3A 3AA3A 4CJPA 4DFJA 2WTUA 3TSPA 4MDAA 1IKYA 3OBWA 3HOTA 5LJWA 1C0MA 4Z4FA 1NJWA 3F9KA 3K2PA 4PA1A 1X3NA 1VSFA 5BPLA 3VEOA 5JLHA 4J2EA 3M6GA 1EKEA 5LJVA 3SBTA 3VEWA 3ZX3A 2OA8A 3TPQA 1TGOA 1KVAA 4IEIA 3O3FA 4CEFA 2NRHA 2HNDA 4H4OA 3NGZA 3AO4A 3THVA 3ZSOA 2OTLN 5FPDA 4LF7K 3MN6A 3N4PA 5C25A 4B1XB 3OYMA 1Z25A 3CC4N 1EXQA 5KGXA 1RT5A 3CQXA 4BQLA 3UB5A 4LC9B 1D5AA 4E7IA 3OYDA 1L3VA 3MDQA 5BN8A 1RDCA 4B9LA 2D0CA 1VK0A 2E2OA 3IFRA 5CE3A 4E7HA 3AAQA 2ZJQL 4KHSA 3V6DA 4IFEA 3CCVN 3HXMA 4JKGB 3QINA 1RBVA 3VF4A 5TKWA 1B92A 5F1XA 1K73O 1RGIA 4M42A 3ALYA 1GOAA 5CZ2A 2A42A 4L3QA 2QKKA 1T03A 1S6PA 1C1CA 1NNEA 3IRXA 2NRVA 3VTIA 3AVAA 4BQZA 3CETA 5AR0A 3E9PA 1I3AA 3ZETB 4FJ5A 4LFCK 5MLCQ 3J7YP 3GOIA 1X1PA 4O4GA 4IOCL 4DTNA 3OYLA 3PX0A 3LDLA 3QFPA 4FWRA 4B3RK 3R1XA 2LSNA 4DSFA 2BDPA 1SV5A 3QERA 4CIEA 4DSKA 4FLVA 4CEOA 3V81A 4FJHA 3KIOA 1BISA 3UKRB 3ULEB 4Z4IA 5GIPA 1WBBA 1OVQA 3I0RA 4WF9L 4FJMA 3IDHA 4CF0A 1S72N 2KZMA 4FLZA 4M41A 3GBTA 4M3YA 4C8LA 1Z26A 5DM6L 1WOQA 3G6EN 4DS5A 1XC9A 4QOZB 4DSJA 3LANA 5AQMA 1NK6A 3HPGA 4RTFD 1UOCA 4AF1A 4FLUA 1EX4A 1ASWA 1U2VA 1HYZA 4DR4K 1XC3A 2HOEA 2F8SA 1F21A 3WNGA 1WN7A 4CGJA 5AFUH 4WQ5C 3A5MC 5DK5A 4FK4A 1YHQN 4CJ7A 5I3UA 4FVUA 2VGNA 1KD1O 4FL9A 4CD3A 1NU0A 4YOWA 4CGGA 3OY9A 1NBWA 2F9WA 5HRRA 1WSFA 2P9NB 3QICA 1KXPA 3NDKA 1T6CA 3WXIA 4BRDA 4H8KA 4PQUA 2OPPA 5AQTA 3H46O 3K5MA 5D3GA 4KHPK 5CYMA 3SAGA 3FZLA 3BF3A 3VQQA 3HM8A 4B1ZA 1VQLN 1WB9A 3WQTA 4DV7K 4BC2A 4KTQA 3I56N 4H0XB 1ZBFA 1L5UA 3AAPA 4O55A 3WNEA 4I9LA 3LAMA 4TSXA 3VGLA 1QQCA 2W6LA 2UYTA 4BRKA 4BR5A 3TAFA 1KAZA 1S1UA 3NVMA 4DV4K 3DAWA 3EKUA 4IO9L 1NGIA 2E2QA 1YT3A 4FJNA 3WXLA 1XHZA 3I33A 1VSKA 2Z1IA 4MO4A 2G8UA 3QBXA 4CJVA 2H3GX 5E26A 2GUIA 4CECA 4DFMA 3DLGA 4FOIA 5M1NA 2FF3B 4BGBA 2EHGA 2WONA 5M1KA 1RILA 1XNRK 3CHWA 1RBRA 3BF1A 4H0TB 5B8HA 4BRIA 1WSHA 3TSUA 1VQ5N 5J2QA 3QIPA 1ZXOA 4BY9C 3ENBA 3VPZA 2XRIA 3ZLJA 4BR7A 1HJOA 5AQKA 2YNFA 4JK8A 3SUQA 4M3WA 5CYQA 2KKZA 1VQKN 2E2PA 4JI3K 3P1GA 4Z4HA 2P5OA 3CM6A 2FBTA 3AVNA 2ZM6K 5AQIA 3VGKA 3L3UA 1T44A 1VQON 3OYEA 1BHLA 4WQ4C 4Y1DA 3N4QA 1JLAA 4MLHA 3VEZA 1QQNA 1Q8IA 4I6MB 1VRTA 4H5VA 4BWMA 4OGCA 4AILC 4W5TA 4B3SK 4RWTA 2OPSA 3TSQA 1ASUA 1QVFM 4JLHA 5BRHA 1TK5A 3DLBA 3QDKA 1S1WA 1O13A 4DQIA 5BRFA 1GLJO 4HTLA 5AQRA 1ATSA 4H5RA 3T1YK 4W5OA 1WSEA 3CC7N 3SCXA 4DG1A 1RBTA 2ITMA 2GX9A 3K5LA 3LAKA 3SPYA 4J2DA 1VRUA 2GTDA 4OLAA 3PO5A 4H4MA 4V19S 1DTQA 4RW4A 3MWPA 4JI0K 4EIAA 3NBPA 1BUPA 5AQZA 3MAQA 2O4GA 4CZHA 1ZBSA 2FBXA 3SZ2A 2GWJA 3NH0A 4CJUA 4DKWA 1RDWX 3HBTA 3L2WA 3CPEA 3CCSN 3ZT3A 3EO3A 3QEIA 1I39A 2NRZA 4DLEA 3HVRA 2E88A 4H5WA 4C1NK 3VQPA 3MCPA 3NGIA 3KD1E 2KQ2A 3TAMA 4PHTX 1JCGA 4JNEA 4BRFA 4RW9A 2RKIA 1WSJA 1A5WA 5JS1A 3CG7A 1HX1A 1U47A 3AVJA 4C8MA 4NLBA 2IDOA 2OPRA 4NLCA 1QHAA 4XH5A 2ATQA 2W40A 3KKRA 1GLBG 4DV6K 3DOKA 4A57A 3KVGA 4FZYA 5C2DA 3ZX0A 3HZ6A 2YKMA 4CJRA 2E1YA 1J54A 3KD5E 1NMNA 1JLEA 3C6HA 3NF7A 4DV0K 1G99A 4IFYA 2X6NA 2D4WA 2QWOA 4KO0A 1GOCA 3OS0A 1NK7A 2G8FA 3VA0A 4MLEA 3BZCA 3ZSZA 4CGHA 1HNXK 4KHUA 3QEVA 4KRFA 4KH4A 3MXMA 3G0ZA 4HUEA 5AQPA 1N6QA 4X62K 1RT3A 3KK3A 4N41A 1FW6A 3I8DA 1KCFA 1HYSA 3HOSA 4N5SA 1QE1A 4NB4A 4B1UB 3IMXA 2HBJA 3C6AA 2KFNA 1QTMA 1HKBA 1EETA 4JI2K 3RR7A 2KW4A 4OKEA 3E9LA 3D6RA 4NO7A 4MFBA 2UXBK 3RSEA 3LDPA 4FZZA 3FE1A 3OW2M 3AGKA 3I8BA 1RTJA 5GAHP 3CMAN 4CCHA 4BRCA 5CZ1A 1NJZA 2D0OA 3CFOA 3WQUA 2HBKA 3O8MA 5C15A 4O44A 2XO7A 1Z6RA 1SL2A 4YORA 2YCHA 3LZIA 3SUNA 5HLFA 1LV5A 5AQFA 4JKCA 4FWQA 3SJJA 3EL2A 1OH5A 2KTQA 5FPMA 3DM2A 1QQOA 3TAPA 3THYA 3H6EA 3LWLA 1Y64A 1ZBIA 4J2BA 4A59A 4CERA 3BZKA 1G15A 2HMIA 3VEVA 3SQ4A 1QSYA 2PY5A 3ZCMA 4U7BA 5AQXA 3TAEA 1X9JA 1X9WA 2YNHA 4OGEA 4JRPA 2HHUA 4CF8A 4M45A 3TU5A 4U67L 3V9WA 5GIOA 4XEIA 4OLBA 4LY7A 1RBUA 4CJSA 1Q82O 4OKJA 4LSNA 1NK8A 4CZKA 2ETJA 2G8WA 1BDGA 5JICA 3OJSA 4CZLA 1CZBA 3MWTA 3VERA 4PL7A 4BE2A 1KRPA 5E41A 3V1QA 3DXKB 4ZTFA 1J5OA 5HL7L 3OS2A 1OKJA 3HK2A 2Y1JA 3TANA 1RT4A 3R6MA 1KQSM 2HSTA 3D0PA 3HP9A 1X3MA 2RF2A 3MN7A 2XY6A 4C8OA 4I9QA 5JS2A 5F0XA 2HMPA 4BVPA 4CJFA 1GOBA 2ITGA 4E89A 1HKGA 4BR4A 3OYIA 1LAVA 1RNHA 3ZETA 2ZGZA 4AM6A 1S1VA 4KV8A 1BO5O 3NGYA 4O5FA 3A2FA 3HT3A 2RPIA 2VWBA 1RT1A 3HI0A 4H0OA 2YHXA 4F4KA 3ISNC 4E7LA 5LMUK 4CZJA 5GADP 2Z1HA 2FF6A 4DU4A 4E7JA 3THXA 2JLEA 4OKKA 2GELA 2Q31A 3A5OC 1JLGA 3BY5A 1TVRA 3CCRN 5EU7A 2B4JA 2CGLA 4JKBA 3WEEB 1TK0A 2FBYA 4IWVA 4KH6A 2I7NA 4E1JA 5KPZA 1Q81O 2DTUA 4JD2B 2E6LA 3KTQA 3OBYA 1W9HA 4CE9A 1JCFA 1T05A 2G8KA 2QWRA 1K8AO 1HNZK 4CEDA 5J2MA 3R9PA 3K5OA 3JXUA 3DLLL 1CXQA 3P38A 4AQYK 3AVGA 5JMVA 2G8VA 5EOYA 3KLEA 4HUGA 1IBMK 1SS6A 3W3DA 1S3XA 3M8RA 4CFBA 1JLQA 4ZHRA 2G8HA 3WXJA 2Q36A 3K58A 2NUBA 1N5YA 2P9LA 1LCUA 2O8DB 3ZT2A 3OYAA 3TWHA 3DXMA 5JVHL 4CGDA 4DR1K 2AA4A 4CGIA 2O8BA 4GKJK 4I7FA 1P90A 2W6KA 3RMDA 4KTZA 1JCEA 4YOVA 3MEEA 3CJAA 3MECA 4C1NI 5FPEA 4BC5A 5JVGL 2QXLA 3OYKA 3KWIA 5C24A 4IG3A 1HKCA 3RVCA 3VMFB 5AQGA 1U6ZA 4WFNL 4BG9A 3IUCA 1W2BM 3MN5A 2QK9A 3SV4A 3P39A 3IKMA 3SBGA 3VEYA 3AVCA 1UA1A 3CCLN 1WSIA 2NZTA 2A6AA 1T8EA 1L3UA 4E3SA 3QIOA 2A1RA 1KLMA 1RFQA 1KAXA 5J2NA 5EVZA 1HMVA 4K42A 3WXMB 4X65K 5J2PA 4W5NA 5ADXA 3NHGA 3OA9A 1EQYA 3U9DA 2CH6A 4FJKA 3NVKA 5HRNA 3CPWM 2D1KA 3CI5A 4DUYK 2Q0RA 1C0FA 2VG6A 3LP2A 1FKPA 3L8BA 3CF5L 1KTQA 3H08A 3KLGA 4BDZA 1CLQA 3W0LA 4FXDA 1DTTA 4JHDA 2ZGYA 1ILYA 3AVMA 4B8AB 2HB5A 4JYAK 5JLFA 4CJ3A 3L2QA 3BUZB 3O1WA 3WXKA 4M7XA 3AV9A 4I6MA 3THXB 3PX6A 3D2FA 4WFAL 3J81O 3OJUA 5IT9O 2JGUA 1EWRA 4YOUA 1TKZA 4B9TA 1MA9B 3PV8A 1S9EA 2CH5A 3NH1A 1L3TA 1QS4A 4M3RA 4FPBA 3TTFA 3HPOA 2KZZA 1HYVA 1BA0A 4F9OA 5AQQA 5C0YA 2D5RA 3M3ZA 3DYAA 4CK1A 1WAJA 1YUWA 2P9KB 3ASMA 4DFKA 4CHOA 4KHQA 1SQKA 2ZWHA 5KRTA 2O8EB 1NWKA 3OYHA 5ELZA 1BCOA 1BL3A 2E2NA 4LH4A 4A2BA 4O5BA 2Q3SA 3EZ5A 3M8PA 3SQ1A 2QEXN 2ZD1A 2P9LB 5TKYA 2EWSA 4DTUA 2CGKA 3DXMB 4FLYA 2O8BB 1TYQA 5AJ3K 3DLKA 4K43A 5BR9A 3OYCA 4HUFA 2B5JA 4KB1A 4CJTA 3EKSA 4NXMK 1NGEA 4B9NA 2QWQA 4RG8A 4H5NA 3QEPA 3CC2N 1YF5L 1IKWA 4BC4A 4Y0WA 1VSDA 4FSVA 3B6PA 2IC3A 1VSMA 4DTXA 4EZ9A 2XY7A 2QXFA 5GINA 1ASVA 1NMDA 4B1YB 3T19A 5BREA 4JI4K 4K0KK 1WAFA 3H3NO 5DMRA 4LF5K 1WUAA 1IG9A 2Q1NA 1KVBA 1XHXA 3KK2A 2W42A 3MEGA 3CJ9A 1GLFO 3DOLA 3KZBA 4BG8A 2F9TA 1KFSA 3J7ZO 1N34K 3VESA 2BTFA 3KWGA 4BRGA 4B9UA 1R0AA 1NK5A 4GMJB 3VF6A 4YOXA 3CFPA 3L2VA 4XH4A 2HBLA 4DR7K 5FPNA 4H0YB 4DQ8A 1DGKN 2FC0A 4ELVA 3M1FA 2NRWA 3GE1A 4FOEA 4KI6A 1IKXA 4JI5K 3O80A 3VQ6A 3F73A 2OPQA 4A62A 1MDUB 3RRHA 1YTUA 4JK9A 4YHHK 4IDKA 4KHWA 1U4BA 4KREA 4LH5A 2GUPA 4IJAA 4LFBK 3P5JA 4JHDB 2V7YA 2QI2A 4DQSA 1OH7A 1VAZA 3E9OA 4IOAL 1BG3A 2QTDA 3U9ZA 3HYFA 3ITHA 2HF3A 4ID1A 4GV3A 2NRTA 1RT2A 2ZJPL 2A40A 1W7AA 1NGDA 4PL8A 3D2FB 4E0DA 4YDUA 3ZX2A 3PIPL 4CJ5A 1LW2A 3VQAA 2YNGA 1V4SA 4CIFA 2A5XA 3O3GA 3S3NA 4FWLA 4DTPA 3TR8A 2RHKA 3UKUA 2W41A 2BGGA 1JL1A 3SPZA 4IZ9A 4CF2A 3EE8A 3FZKA 5EXWA 4EP5A 3LDOA 3V9ZA 4X64K 4DHYA 1RTIA 3EN9A 1IBKK 4IOXA 4I2PA 1K6YA 3VQ5A 1IV0A 1HR0K 4WCEL 4DV2K 4ISFA 3I0SA 4RW6A 3L0QA 5KI6A 4CZEA 3AVKA 4JRQA 4CZFA 3K0SA 4K41A 3SMSA 2OYQA 1ZBHA 4DR2K 4B3MK 1W0HA 1YJNN 1NJYA 4CEEA 2PYJA 4BR2A 4QS8A 3AA5X 2Q97A 3PY8A 2WOMA 4GNIA 2IVNA 1ATRA 3PSIA 4DQRA 4EFHA 4PKIA 2HHTA 1TYQB 4RCHA 4JS4A 5KGWA 3O9UA
chains in the Genus database with same CATH topology
4JI3K 2UXCK 4JI1K 4DV0K 2ZM6K 2VQEK 3J81O 1HNWK 4LF7K 4DR7K 3JAMO 5IT9O 2HHHK 1HNXK 4DR1K 2UU9K 2UUBK 4X62K 4JI5K 3J7AP 4YY3K 4B3SK 4GKJK 4CVNE 2UUAK 5BR8K 4YHHK 5A2QO 4JV5K 1N36K 4LF8K 5IWAK 3T1YK 2E5LK 4JI2K 4KHPK 4LFBK 1N33K 4OX9K 4DV5K 4DV1K 1I94K 1J5EK 4X66K 2VQFK 1XMQK 4NXNK 2UXBK 4DV7K 1FJGK 3OTOK 4LF6K 4V19S 4DV3K 4LF9K 4JI0K 5FLXO 1XNQK 5LMUK 3J7YP 4LFCK 2UXDK 4JI6K 4DV4K 4GKKK 5AJ3K 4JI8K 4DUZK 4B3RK 1XMOK 4B3TK 4X64K 4NXMK 3T1HK 4X65K 4DR3K 1IBKK 4DR6K 1HR0K 4LFAK 1N32K 4DV2K 1IBLK 3J80O 4DUYK 4DR5K 1XNRK 4DR2K 4B3MK 4JI4K 2F4VK 4K0KK 4CW7B 4LF4K 2UUCK 5LMNK 4LF5K 4JI7K 5LL6Z 1HNZK 4DV6K 4AQYK 4DR4K 4JYAK 1N34K 1IBMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 K;  2UXC K;  4JI1 K;  4DV0 K;  2ZM6 K;  2VQE K;  3J81 O;  1HNW K;  4LF7 K;  4DR7 K;  3JAM O;  5IT9 O;  2HHH K;  1HNX K;  4DR1 K;  2UU9 K;  2UUB K;  4X62 K;  4JI5 K;  3J7A P;  4YY3 K;  4B3S K;  4GKJ K;  4CVN E;  2UUA K;  5BR8 K;  4YHH K;  5A2Q O;  4JV5 K;  1N36 K;  4LF8 K;  5IWA K;  3T1Y K;  2E5L K;  4JI2 K;  4KHP K;  4LFB K;  1N33 K;  4OX9 K;  4DV5 K;  4DV1 K;  1I94 K;  1J5E K;  4X66 K;  2VQF K;  1XMQ K;  4NXN K;  2UXB K;  4DV7 K;  1FJG K;  3OTO K;  4LF6 K;  4V19 S;  4DV3 K;  4LF9 K;  4JI0 K;  5FLX O;  1XNQ K;  5LMU K;  3J7Y P;  4LFC K;  2UXD K;  4JI6 K;  4DV4 K;  4GKK K;  5AJ3 K;  4JI8 K;  4DUZ K;  4B3R K;  1XMO K;  4B3T K;  4X64 K;  4NXM K;  3T1H K;  4X65 K;  4DR3 K;  1IBK K;  4DR6 K;  1HR0 K;  4LFA K;  1N32 K;  4DV2 K;  1IBL K;  3J80 O;  4DUY K;  4DR5 K;  1XNR K;  4DR2 K;  4B3M K;  4JI4 K;  2F4V K;  4K0K K;  4CW7 B;  4LF4 K;  2UUC K;  5LMN K;  4LF5 K;  4JI7 K;  5LL6 Z;  1HNZ K;  4DV6 K;  4AQY K;  4DR4 K;  4JYA K;  1N34 K;  1IBM K; 
#chains in the Genus database with same CATH topology
 1WBD A;  1W97 L;  1NK4 A;  5T7B A;  4QAG A;  1OH8 A;  3DXK A;  3D7E O;  3MMV A;  3BGR A;  4FO0 A;  3BDP A;  3H1V X;  4HWI A;  5M1Q A;  2O8F B;  2VWK A;  4IDH A;  4JKF A;  4E1M A;  5DM7 L;  3VF2 A;  4FJ7 A;  4CBX A;  4CD1 A;  1J6Z A;  3CCJ N;  3HTV A;  5J1E A;  2UUB K;  1JXB A;  1O1W A;  3Q7B A;  3MK6 A;  1TKD A;  1D8Y A;  1UWB A;  1A5X A;  4HCB A;  3QET A;  1NGH A;  3VET A;  1C6V A;  4FVM A;  2X74 A;  3C6U A;  3SYZ A;  3EY1 A;  2OCE A;  4H0V B;  4PKG A;  4O8U A;  3ZT0 A;  4DTO A;  1BIZ A;  1NGJ A;  4DSI A;  4CEB A;  1CZ9 A;  5KPT A;  1LWF A;  3CJB A;  4YOY A;  2JWL A;  5KPR A;  3SAH A;  1U45 A;  1VSH A;  1UAX A;  1NGG A;  3HO1 A;  1U04 A;  4Y1C A;  1FJG K;  1BCM A;  3VQE A;  3DRR A;  5AQO A;  3CIP A;  4NYF A;  5M1P A;  2F96 A;  3ID8 A;  4KFB A;  1NLV A;  2J4R A;  5C12 A;  4Q5V A;  4CEQ A;  3EEQ A;  3O9R A;  3IG1 A;  4GKK K;  2P5G A;  3WEE A;  4DUZ K;  2D0P A;  4N56 A;  2GBZ A;  4FWS A;  4FW1 A;  3T1A A;  1S6Q A;  4A61 A;  1TK8 A;  3NF8 A;  2P9S A;  4JD2 A;  3CQ8 A;  1Q86 O;  3O4W A;  3L4I A;  3QO9 A;  4L8R B;  4NCA A;  1Q18 A;  3RMA A;  1WNS A;  1BOT O;  3L2U A;  1WLJ A;  3LPT A;  1SZ2 A;  1U48 A;  3ZSV A;  5E84 A;  1E4G T;  2QWL A;  2YV0 X;  3PSF A;  4Z4G A;  3M5R A;  4GVM A;  3A8Y A;  3UKU B;  4WYB A;  4AHR A;  1HNV A;  4CHN A;  2O8D A;  2IVO A;  2P51 A;  1KAY A;  4BVO A;  4AHU A;  1A5V A;  4CZM A;  1VSL A;  5AQN A;  4KBO A;  3ZYY X;  4IJN A;  4DF4 A;  4M3U A;  2JWK A;  4C23 A;  3O9T A;  1C1A A;  4JN4 A;  3QLH A;  1GLE G;  2Z1G A;  5BRD A;  3SUP A;  4IFV A;  3T3F A;  1LOT B;  3ID6 A;  4YY3 K;  3R8E A;  4DLG A;  2ASP A;  1YIJ N;  4CK2 A;  1JLB A;  4H03 B;  2I5J A;  1WSG A;  4W5Q A;  4WQ5 A;  1TKT A;  4BR9 A;  2E5L K;  1S9G A;  3VTH A;  3EYZ A;  3GG4 A;  1MWM A;  1NJX A;  1VQM N;  2KFZ A;  3HM9 A;  4FPA A;  3OYG A;  2QWN A;  3BP8 A;  3WUH A;  4JEP A;  1C0G A;  4FJL A;  2QWP A;  2VQF K;  1XMQ K;  5CR4 A;  1VSJ A;  5BPN A;  1J9A A;  3OTO K;  4MQ3 A;  3U3Y A;  5HP1 A;  3MXI A;  4Q0B A;  2HVI A;  2P9P A;  4M63 C;  3LM9 A;  4DV3 K;  3RRG A;  3QNO A;  2WFB A;  2FBV A;  3D45 A;  4O8K A;  3G25 A;  2P9U B;  1P8Z A;  3O5B A;  1TUY A;  3SAF A;  2HW3 A;  1XMO K;  3T7Z A;  1C0T A;  2KHO A;  5F2R A;  3AVH A;  5I9E B;  2VWJ A;  1ZBL A;  2X6S A;  4LFA K;  1IKV A;  4FWN A;  1N32 K;  2IS3 A;  4UQG A;  3J8A A;  2XY8 A;  4FK2 A;  4CJK A;  2GV9 A;  1D4X A;  4EZ6 A;  1HNI A;  4BRP A;  1RCH A;  3IS9 A;  1REV A;  1NKC A;  1RT6 A;  1IJJ A;  2Z1J A;  2DY4 A;  3BEX A;  2EX3 A;  1YVN A;  3TTC A;  3VQ4 A;  2P9I A;  2E20 A;  4CJW A;  3ZSW A;  1T3V A;  1C0U A;  4YFU A;  4B3O A;  4YDU C;  3L4Q A;  2OZM A;  5AQV A;  1TV6 A;  1EO1 A;  3C7N A;  2PFU A;  1YJ9 N;  1DLO A;  3VQ9 A;  1YI2 N;  2HNZ A;  4CEZ A;  3PUF A;  1VQ6 N;  2IOC A;  4DQP A;  1ATN A;  2P9S B;  4Z94 A;  3RWU A;  4N47 A;  3JAM O;  2FSK A;  3B6O A;  1HLU A;  1QSL A;  1HRH A;  1Q7Y O;  3QES A;  1JKH A;  1GLD G;  3E1Y A;  3OYB A;  2D0A A;  4AHC A;  2P9K A;  1M1K O;  5AFU A;  3K57 A;  5KQD A;  2O8E A;  4DCH A;  4OPH A;  3CQY A;  4FJI A;  1R59 O;  1MU2 A;  1SUQ A;  2E1Z A;  1TAU A;  1J53 A;  2WUS A;  1VQ9 N;  4IEE A;  1NK9 A;  3SJH A;  3TAR A;  1KLN A;  1S1X A;  4HVJ A;  3AA4 A;  4KAZ A;  2QWM A;  3LZJ A;  4KI4 A;  5EY4 A;  5KQ8 A;  3AGR A;  4JK7 A;  4DSL A;  5BPM A;  4CHY A;  3FFI A;  1QVG M;  1XNQ K;  3FFK B;  2UXD K;  4NCB A;  3VOV A;  4GV6 A;  1B9D A;  4RW8 A;  4LSL A;  4BRE A;  4F2S A;  4QS9 A;  3CCM N;  1Q9X A;  2AP1 A;  3V1O A;  3KLH A;  4CIG A;  4GV9 A;  1IO2 A;  1JLC A;  3ATU A;  3WNF A;  2ZJR L;  4E7K A;  3HPH A;  1YIT N;  1IBL K;  5FDL A;  3SNN A;  2P1J A;  1VQ7 N;  1RDU A;  3L6Q A;  2BUP A;  4JKD A;  3RMC A;  5CY4 A;  3ZSX A;  5AQU A;  2ZQB A;  1DKG D;  2IIR A;  2UUC K;  1L3S A;  2P9P B;  4BRO A;  4B1W B;  5LL6 Z;  1HPM A;  3CCQ N;  1Z05 A;  1EP4 A;  4FM1 A;  3JYT A;  4H5T A;  3CD6 N;  1NGB A;  4EHU A;  3THW A;  2WC9 A;  4BRH A;  3G4S N;  1VSI A;  2UXC K;  1ZC6 A;  3TAG A;  4N76 A;  2YI1 A;  4BRL A;  3F5T A;  1HNW K;  4CES A;  1U49 A;  4W5R A;  4FLW A;  1RDA A;  3LP1 A;  2VYP A;  2UU9 K;  4FJJ A;  1SL0 A;  2IGI A;  3RMB A;  1X9M A;  4DU1 A;  1IG8 A;  3HST B;  3VGM A;  4DS4 A;  4PKH A;  2HHQ A;  5A2Q O;  5SZT A;  3VQ8 A;  2P9I B;  4CHZ A;  2QA4 N;  3OYF A;  4LF8 K;  3CER A;  5IWA K;  4CHQ A;  1T6D A;  2FLO A;  3C7N B;  3D2E B;  3SUO A;  1EWQ A;  4DV1 K;  1NKE A;  1I94 K;  3K9J A;  5AZI A;  3KLF A;  5K14 A;  3DRP A;  4GW6 A;  3SI6 A;  1ZBU A;  4FLX A;  4LF6 K;  4OPA A;  5AQL A;  1RDD A;  2YHY A;  4IG0 A;  4KHY A;  4Z4E A;  4AHV A;  1FK9 A;  3HVT A;  1D9D A;  3IAY A;  3V4I A;  5C2F A;  1VQ8 N;  3CME N;  3ATV A;  1HPZ A;  3PO4 A;  3H1Q A;  4JI8 K;  2IVP A;  1X9S A;  2HHX A;  3S9H A;  1LWC A;  2V52 B;  1YAG A;  2GEM A;  4Z0U A;  1GLA G;  3HP6 A;  3O6W A;  3RR8 A;  1SAZ A;  3AY9 A;  2OTJ N;  4DR5 K;  4F8R A;  3TI0 A;  1XI1 A;  2I7P A;  3B8A X;  3NCI A;  2F4V K;  2O4I A;  4CW7 B;  1BQN A;  5HRP A;  2VGM A;  4B8C A;  3ZEU B;  4AH9 A;  4WFB L;  3SLC A;  3CFR A;  4BWJ A;  4BR0 A;  1BGX T;  3CXC M;  5AQJ A;  4YNQ A;  2O8F A;  5FRN A;  4CBW A;  3KJV A;  5CHI A;  3QNN A;  3O3H A;  2HNY A;  1BU6 O;  3M8S A;  2KLA A;  3QBW A;  4CGF A;  4KH5 A;  2Q2R A;  2QW9 A;  1QSS A;  3ZT4 A;  2YJF A;  4F2R A;  1DT9 A;  3O9S A;  4EP4 A;  3V9X A;  4HCC A;  4OPJ A;  4OO1 J;  4M3T A;  4NYN A;  3QEX A;  3V9S A;  3J7A P;  2YHB A;  3A5L C;  3A5N C;  1RT7 A;  3DLE A;  3NF6 A;  2UUA K;  1K8K A;  5AQH A;  5EX5 A;  1B9F A;  3FLC O;  4PWD A;  4CF1 A;  4CJE A;  4O0J A;  1Y97 A;  3AAR A;  1KC8 O;  4CJ4 A;  2QM1 A;  1FKO A;  3DRS A;  4DV5 K;  3UE5 A;  5KTQ A;  3THW B;  1E3M A;  1FXX A;  4NXN K;  2IAJ A;  3T69 A;  2YHW A;  4PY5 A;  4G9Z A;  5HRO A;  4IXC A;  3DI6 A;  2O8C A;  1D9F A;  3JS6 A;  3S3M A;  1TL1 A;  2XY5 A;  5ADX H;  4JAX A;  2BAN A;  2OAN A;  5GAE P;  4B1V A;  1S1T A;  3CYM A;  4OPK A;  3ENH A;  2D0B A;  2VG7 A;  5C42 A;  4AM7 A;  4JS5 A;  4FW2 A;  4DF8 A;  5H1S Q;  3TAQ A;  3O9Q A;  1CZA N;  3G10 A;  4B3T K;  4K8X A;  3CCE N;  4CEA A;  4ISG A;  2YNI A;  4KPY A;  4DR6 K;  1NK0 A;  1HJR A;  3LWM A;  4DQQ A;  4CBU A;  2YKN A;  4KTW A;  4IKF A;  2HHV A;  3AO3 A;  3SQ2 A;  3MX5 A;  1ITG A;  5AZI B;  1V4T A;  1YXQ A;  3FZH A;  3GL1 A;  4F3O A;  4KB0 A;  1LW0 A;  4IO8 A;  4YOT A;  4MO5 A;  3PIO L;  3FR0 A;  3ZT1 A;  1ESV A;  2E4L A;  4A5B A;  4BRM A;  3MED A;  5LMN K;  2PBD A;  3DWL A;  3EE9 A;  4JKA A;  1YTA A;  1RBS A;  1LWE A;  4CFA A;  2E8A A;  4ILH A;  3ZSQ A;  4OVL A;  4ILG B;  4BE1 A;  4C8K A;  2A41 A;  1OVY A;  4CFC A;  3KK1 A;  3H45 C;  4XIU A;  4ICL A;  3ZSR A;  5AQS A;  4ZTJ A;  4B9Q A;  4B9V A;  1LAW A;  1GLC G;  3LP3 A;  3S3O A;  3L2R A;  5FRM A;  2A1S A;  1U2V B;  3C0B A;  4FJ9 A;  3U3G A;  4FK0 A;  4BRN A;  4BRA A;  3HJF A;  5HOO A;  3P31 A;  2NLX A;  3CJC A;  4DB3 A;  2AJQ A;  3LPU A;  5AZJ A;  2R7Y A;  2YJE A;  4CF9 A;  3C65 A;  3QML A;  5BR8 K;  4I2Q A;  3CJ7 A;  4BE0 A;  4R5P A;  3G71 N;  4KKO A;  3C94 A;  1SKW A;  3ZSY A;  4FZX C;  1NKB A;  3QB0 A;  2DFE A;  4CJQ A;  1BI4 A;  4FWM A;  3DMJ A;  3AO5 A;  4BDY A;  3PLA A;  1HUX A;  2P9U A;  4WE1 A;  3NE6 A;  1VQ4 N;  3C6T A;  3LM2 A;  3LDS A;  4FWK A;  5GAG P;  3RTV A;  4LF9 K;  1SL1 A;  2G8I A;  4NCG A;  2PAV A;  1NOY A;  2BH1 A;  4JI6 K;  1NG9 A;  4BRQ A;  4K25 A;  4XH1 A;  4FJG A;  1K8K B;  2F7T A;  3AO2 A;  4HHT A;  4DR3 K;  4ID5 A;  3K59 A;  3ENO A;  4FLT A;  3HSC A;  4DTM A;  1VQP N;  3WT0 A;  1Q9Y A;  4M7Y A;  4B9M A;  3SV3 A;  1QZ5 A;  2HHW A;  3KK7 A;  3VQC A;  1ZYQ A;  3P4I A;  1SKR A;  3S41 A;  3Q7C A;  2V7Z A;  4DFP A;  1NOZ A;  1TL3 A;  4LF4 K;  1HQE A;  1H1V A;  2ASM A;  2O8C B;  1UA0 A;  3DLR A;  4JI7 K;  1VHX A;  2E6M A;  4OJR A;  3NFA A;  1QHT A;  3NF9 A;  4E19 A;  2A3Z A;  4CJL A;  1BWF O;  1BIU A;  2VCP A;  3KLI A;  2NRX A;  3V1R A;  1VSE A;  1S5J A;  1JXE A;  3AVL A;  4DSE A;  2FXU A;  1KVC A;  1OH6 A;  2VG5 A;  4BAC A;  3JSM A;  4B9S A;  2VQE K;  1DEJ A;  1JLF A;  4QCL A;  3OYJ A;  4K8Z A;  3L3V A;  1NM1 A;  3TTD A;  2NRR A;  2HHH K;  3KHY A;  3AA2 A;  4FWO A;  3LDQ A;  4B08 A;  2ASO A;  4CVN E;  4HTU A;  1RTD A;  3V9U A;  5HBM A;  4AHT A;  3QFU A;  2B6A A;  3SMP A;  4FJX A;  4BDP A;  4EHT A;  2F8T A;  5BN9 A;  1N33 K;  1TUU A;  3MXJ A;  1NGC A;  5C10 A;  1NGF A;  3SQ0 A;  2BE2 A;  3KKS A;  3WNH A;  3I55 N;  3R3L A;  4X66 K;  3F9M A;  3FZM A;  3LAL A;  3AVF A;  4A2A A;  2PYL A;  3HRG A;  4CI6 A;  4EAH D;  2Y1I A;  4DWI A;  4AHS A;  1HQU A;  5FLX O;  5LY3 A;  3K5N A;  1GLL O;  3VQD A;  2X78 A;  4BGA A;  4H0P A;  4FCY A;  3P83 D;  5AZJ B;  3VQB A;  2V51 B;  2YHA A;  3F2K A;  3OS1 A;  1M90 O;  4A5A A;  1CXU A;  3H3O B;  3E66 A;  5HRS A;  4JKH A;  3T1H K;  1TKX A;  2RE2 A;  3O4N A;  3VQ7 A;  4R79 A;  3LP0 A;  3GDQ A;  3A0I X;  1QZ6 A;  2DFH A;  3J80 O;  1BA1 A;  1BI4 B;  3CM5 A;  1SKS A;  3EZW A;  4DMN A;  4FM2 A;  5KRS A;  2HF4 A;  1JJ2 M;  1XWL A;  1C1B A;  3E01 A;  3AO1 A;  3QEW A;  4UY8 O;  4DU3 A;  4C8N A;  2PZS A;  3SK3 A;  2Q0U A;  4JKG A;  1NGA A;  5SWM A;  2ZF5 O;  5FRO A;  3OYN A;  3VEX A;  5AQY A;  4GVE A;  3VN5 A;  4CZG A;  1MWK A;  4M3Z A;  3FZF A;  4CZI A;  4JI1 K;  3VA3 A;  2GWK A;  4J2A A;  4CHP A;  1K9M O;  3DJC A;  4DTS A;  2WBN A;  3OHR A;  2YX6 A;  3NMU A;  4JKE A;  1E4F T;  1S22 A;  2RN2 A;  1KFD A;  2CGJ A;  4M3X A;  3MCA B;  4G1Q A;  4DTJ A;  3PX4 A;  2XHB A;  4IBN A;  4F3T A;  3TAB A;  3D2E A;  1BQM A;  1TAQ A;  4Z4C A;  1QQM A;  3M8Q A;  1RTH A;  4E1N A;  3U4L A;  4JV5 K;  2DFF A;  1JL2 A;  1N36 K;  4DTR A;  1RDB A;  3O08 A;  3NH2 A;  4FM0 A;  4FJ8 A;  4GY2 B;  3HL8 A;  3UKR A;  3ULE A;  4LD0 A;  2HHS A;  1XQS C;  4OX9 K;  3LDN A;  3MX2 A;  3O4Q A;  3CCU N;  4RW7 A;  1VQN N;  1J5E K;  3OVN A;  4ELT A;  3MN9 A;  3U6F A;  3C95 A;  1IH7 A;  3LL3 A;  4O0I A;  2HVH A;  4PUO A;  4ELU A;  3U8X A;  4KHN A;  3RSE B;  3FGU A;  4MDB A;  2QKB A;  5AQW A;  2DPN A;  3UIQ A;  5I42 A;  3AVI A;  2ZE2 A;  4QS7 A;  3CJ1 A;  2FSJ A;  5M1O A;  4WQ4 A;  1YJW N;  2FSN A;  4ISE A;  2NNW A;  4CFD A;  4FWP A;  3ULD A;  1XUP O;  2OZS A;  4BC3 A;  3ZEU A;  2HBM A;  1YVU A;  3O1B A;  1T7P A;  4ILJ A;  1NJI O;  4J8F A;  2P9N A;  1N8R O;  3NAE A;  3DLH A;  3THY B;  4FYD A;  3K9K A;  3AVB A;  5M1F A;  3VEN A;  1KSP A;  4CK3 A;  3AA3 A;  4CJP A;  4DFJ A;  2WTU A;  3TSP A;  4MDA A;  1IKY A;  3OBW A;  3HOT A;  5LJW A;  1C0M A;  4Z4F A;  1NJW A;  3F9K A;  3K2P A;  4PA1 A;  1X3N A;  1VSF A;  5BPL A;  3VEO A;  5JLH A;  4J2E A;  3M6G A;  1EKE A;  5LJV A;  3SBT A;  3VEW A;  3ZX3 A;  2OA8 A;  3TPQ A;  1TGO A;  1KVA A;  4IEI A;  3O3F A;  4CEF A;  2NRH A;  2HND A;  4H4O A;  3NGZ A;  3AO4 A;  3THV A;  3ZSO A;  2OTL N;  5FPD A;  4LF7 K;  3MN6 A;  3N4P A;  5C25 A;  4B1X B;  3OYM A;  1Z25 A;  3CC4 N;  1EXQ A;  5KGX A;  1RT5 A;  3CQX A;  4BQL A;  3UB5 A;  4LC9 B;  1D5A A;  4E7I A;  3OYD A;  1L3V A;  3MDQ A;  5BN8 A;  1RDC A;  4B9L A;  2D0C A;  1VK0 A;  2E2O A;  3IFR A;  5CE3 A;  4E7H A;  3AAQ A;  2ZJQ L;  4KHS A;  3V6D A;  4IFE A;  3CCV N;  3HXM A;  4JKG B;  3QIN A;  1RBV A;  3VF4 A;  5TKW A;  1B92 A;  5F1X A;  1K73 O;  1RGI A;  4M42 A;  3ALY A;  1GOA A;  5CZ2 A;  2A42 A;  4L3Q A;  2QKK A;  1T03 A;  1S6P A;  1C1C A;  1NNE A;  3IRX A;  2NRV A;  3VTI A;  3AVA A;  4BQZ A;  3CET A;  5AR0 A;  3E9P A;  1I3A A;  3ZET B;  4FJ5 A;  4LFC K;  5MLC Q;  3J7Y P;  3GOI A;  1X1P A;  4O4G A;  4IOC L;  4DTN A;  3OYL A;  3PX0 A;  3LDL A;  3QFP A;  4FWR A;  4B3R K;  3R1X A;  2LSN A;  4DSF A;  2BDP A;  1SV5 A;  3QER A;  4CIE A;  4DSK A;  4FLV A;  4CEO A;  3V81 A;  4FJH A;  3KIO A;  1BIS A;  3UKR B;  3ULE B;  4Z4I A;  5GIP A;  1WBB A;  1OVQ A;  3I0R A;  4WF9 L;  4FJM A;  3IDH A;  4CF0 A;  1S72 N;  2KZM A;  4FLZ A;  4M41 A;  3GBT A;  4M3Y A;  4C8L A;  1Z26 A;  5DM6 L;  1WOQ A;  3G6E N;  4DS5 A;  1XC9 A;  4QOZ B;  4DSJ A;  3LAN A;  5AQM A;  1NK6 A;  3HPG A;  4RTF D;  1UOC A;  4AF1 A;  4FLU A;  1EX4 A;  1ASW A;  1U2V A;  1HYZ A;  4DR4 K;  1XC3 A;  2HOE A;  2F8S A;  1F21 A;  3WNG A;  1WN7 A;  4CGJ A;  5AFU H;  4WQ5 C;  3A5M C;  5DK5 A;  4FK4 A;  1YHQ N;  4CJ7 A;  5I3U A;  4FVU A;  2VGN A;  1KD1 O;  4FL9 A;  4CD3 A;  1NU0 A;  4YOW A;  4CGG A;  3OY9 A;  1NBW A;  2F9W A;  5HRR A;  1WSF A;  2P9N B;  3QIC A;  1KXP A;  3NDK A;  1T6C A;  3WXI A;  4BRD A;  4H8K A;  4PQU A;  2OPP A;  5AQT A;  3H46 O;  3K5M A;  5D3G A;  4KHP K;  5CYM A;  3SAG A;  3FZL A;  3BF3 A;  3VQQ A;  3HM8 A;  4B1Z A;  1VQL N;  1WB9 A;  3WQT A;  4DV7 K;  4BC2 A;  4KTQ A;  3I56 N;  4H0X B;  1ZBF A;  1L5U A;  3AAP A;  4O55 A;  3WNE A;  4I9L A;  3LAM A;  4TSX A;  3VGL A;  1QQC A;  2W6L A;  2UYT A;  4BRK A;  4BR5 A;  3TAF A;  1KAZ A;  1S1U A;  3NVM A;  4DV4 K;  3DAW A;  3EKU A;  4IO9 L;  1NGI A;  2E2Q A;  1YT3 A;  4FJN A;  3WXL A;  1XHZ A;  3I33 A;  1VSK A;  2Z1I A;  4MO4 A;  2G8U A;  3QBX A;  4CJV A;  2H3G X;  5E26 A;  2GUI A;  4CEC A;  4DFM A;  3DLG A;  4FOI A;  5M1N A;  2FF3 B;  4BGB A;  2EHG A;  2WON A;  5M1K A;  1RIL A;  1XNR K;  3CHW A;  1RBR A;  3BF1 A;  4H0T B;  5B8H A;  4BRI A;  1WSH A;  3TSU A;  1VQ5 N;  5J2Q A;  3QIP A;  1ZXO A;  4BY9 C;  3ENB A;  3VPZ A;  2XRI A;  3ZLJ A;  4BR7 A;  1HJO A;  5AQK A;  2YNF A;  4JK8 A;  3SUQ A;  4M3W A;  5CYQ A;  2KKZ A;  1VQK N;  2E2P A;  4JI3 K;  3P1G A;  4Z4H A;  2P5O A;  3CM6 A;  2FBT A;  3AVN A;  2ZM6 K;  5AQI A;  3VGK A;  3L3U A;  1T44 A;  1VQO N;  3OYE A;  1BHL A;  4WQ4 C;  4Y1D A;  3N4Q A;  1JLA A;  4MLH A;  3VEZ A;  1QQN A;  1Q8I A;  4I6M B;  1VRT A;  4H5V A;  4BWM A;  4OGC A;  4AIL C;  4W5T A;  4B3S K;  4RWT A;  2OPS A;  3TSQ A;  1ASU A;  1QVF M;  4JLH A;  5BRH A;  1TK5 A;  3DLB A;  3QDK A;  1S1W A;  1O13 A;  4DQI A;  5BRF A;  1GLJ O;  4HTL A;  5AQR A;  1ATS A;  4H5R A;  3T1Y K;  4W5O A;  1WSE A;  3CC7 N;  3SCX A;  4DG1 A;  1RBT A;  2ITM A;  2GX9 A;  3K5L A;  3LAK A;  3SPY A;  4J2D A;  1VRU A;  2GTD A;  4OLA A;  3PO5 A;  4H4M A;  4V19 S;  1DTQ A;  4RW4 A;  3MWP A;  4JI0 K;  4EIA A;  3NBP A;  1BUP A;  5AQZ A;  3MAQ A;  2O4G A;  4CZH A;  1ZBS A;  2FBX A;  3SZ2 A;  2GWJ A;  3NH0 A;  4CJU A;  4DKW A;  1RDW X;  3HBT A;  3L2W A;  3CPE A;  3CCS N;  3ZT3 A;  3EO3 A;  3QEI A;  1I39 A;  2NRZ A;  4DLE A;  3HVR A;  2E88 A;  4H5W A;  4C1N K;  3VQP A;  3MCP A;  3NGI A;  3KD1 E;  2KQ2 A;  3TAM A;  4PHT X;  1JCG A;  4JNE A;  4BRF A;  4RW9 A;  2RKI A;  1WSJ A;  1A5W A;  5JS1 A;  3CG7 A;  1HX1 A;  1U47 A;  3AVJ A;  4C8M A;  4NLB A;  2IDO A;  2OPR A;  4NLC A;  1QHA A;  4XH5 A;  2ATQ A;  2W40 A;  3KKR A;  1GLB G;  4DV6 K;  3DOK A;  4A57 A;  3KVG A;  4FZY A;  5C2D A;  3ZX0 A;  3HZ6 A;  2YKM A;  4CJR A;  2E1Y A;  1J54 A;  3KD5 E;  1NMN A;  1JLE A;  3C6H A;  3NF7 A;  4DV0 K;  1G99 A;  4IFY A;  2X6N A;  2D4W A;  2QWO A;  4KO0 A;  1GOC A;  3OS0 A;  1NK7 A;  2G8F A;  3VA0 A;  4MLE A;  3BZC A;  3ZSZ A;  4CGH A;  1HNX K;  4KHU A;  3QEV A;  4KRF A;  4KH4 A;  3MXM A;  3G0Z A;  4HUE A;  5AQP A;  1N6Q A;  4X62 K;  1RT3 A;  3KK3 A;  4N41 A;  1FW6 A;  3I8D A;  1KCF A;  1HYS A;  3HOS A;  4N5S A;  1QE1 A;  4NB4 A;  4B1U B;  3IMX A;  2HBJ A;  3C6A A;  2KFN A;  1QTM A;  1HKB A;  1EET A;  4JI2 K;  3RR7 A;  2KW4 A;  4OKE A;  3E9L A;  3D6R A;  4NO7 A;  4MFB A;  2UXB K;  3RSE A;  3LDP A;  4FZZ A;  3FE1 A;  3OW2 M;  3AGK A;  3I8B A;  1RTJ A;  5GAH P;  3CMA N;  4CCH A;  4BRC A;  5CZ1 A;  1NJZ A;  2D0O A;  3CFO A;  3WQU A;  2HBK A;  3O8M A;  5C15 A;  4O44 A;  2XO7 A;  1Z6R A;  1SL2 A;  4YOR A;  2YCH A;  3LZI A;  3SUN A;  5HLF A;  1LV5 A;  5AQF A;  4JKC A;  4FWQ A;  3SJJ A;  3EL2 A;  1OH5 A;  2KTQ A;  5FPM A;  3DM2 A;  1QQO A;  3TAP A;  3THY A;  3H6E A;  3LWL A;  1Y64 A;  1ZBI A;  4J2B A;  4A59 A;  4CER A;  3BZK A;  1G15 A;  2HMI A;  3VEV A;  3SQ4 A;  1QSY A;  2PY5 A;  3ZCM A;  4U7B A;  5AQX A;  3TAE A;  1X9J A;  1X9W A;  2YNH A;  4OGE A;  4JRP A;  2HHU A;  4CF8 A;  4M45 A;  3TU5 A;  4U67 L;  3V9W A;  5GIO A;  4XEI A;  4OLB A;  4LY7 A;  1RBU A;  4CJS A;  1Q82 O;  4OKJ A;  4LSN A;  1NK8 A;  4CZK A;  2ETJ A;  2G8W A;  1BDG A;  5JIC A;  3OJS A;  4CZL A;  1CZB A;  3MWT A;  3VER A;  4PL7 A;  4BE2 A;  1KRP A;  5E41 A;  3V1Q A;  3DXK B;  4ZTF A;  1J5O A;  5HL7 L;  3OS2 A;  1OKJ A;  3HK2 A;  2Y1J A;  3TAN A;  1RT4 A;  3R6M A;  1KQS M;  2HST A;  3D0P A;  3HP9 A;  1X3M A;  2RF2 A;  3MN7 A;  2XY6 A;  4C8O A;  4I9Q A;  5JS2 A;  5F0X A;  2HMP A;  4BVP A;  4CJF A;  1GOB A;  2ITG A;  4E89 A;  1HKG A;  4BR4 A;  3OYI A;  1LAV A;  1RNH A;  3ZET A;  2ZGZ A;  4AM6 A;  1S1V A;  4KV8 A;  1BO5 O;  3NGY A;  4O5F A;  3A2F A;  3HT3 A;  2RPI A;  2VWB A;  1RT1 A;  3HI0 A;  4H0O A;  2YHX A;  4F4K A;  3ISN C;  4E7L A;  5LMU K;  4CZJ A;  5GAD P;  2Z1H A;  2FF6 A;  4DU4 A;  4E7J A;  3THX A;  2JLE A;  4OKK A;  2GEL A;  2Q31 A;  3A5O C;  1JLG A;  3BY5 A;  1TVR A;  3CCR N;  5EU7 A;  2B4J A;  2CGL A;  4JKB A;  3WEE B;  1TK0 A;  2FBY A;  4IWV A;  4KH6 A;  2I7N A;  4E1J A;  5KPZ A;  1Q81 O;  2DTU A;  4JD2 B;  2E6L A;  3KTQ A;  3OBY A;  1W9H A;  4CE9 A;  1JCF A;  1T05 A;  2G8K A;  2QWR A;  1K8A O;  1HNZ K;  4CED A;  5J2M A;  3R9P A;  3K5O A;  3JXU A;  3DLL L;  1CXQ A;  3P38 A;  4AQY K;  3AVG A;  5JMV A;  2G8V A;  5EOY A;  3KLE A;  4HUG A;  1IBM K;  1SS6 A;  3W3D A;  1S3X A;  3M8R A;  4CFB A;  1JLQ A;  4ZHR A;  2G8H A;  3WXJ A;  2Q36 A;  3K58 A;  2NUB A;  1N5Y A;  2P9L A;  1LCU A;  2O8D B;  3ZT2 A;  3OYA A;  3TWH A;  3DXM A;  5JVH L;  4CGD A;  4DR1 K;  2AA4 A;  4CGI A;  2O8B A;  4GKJ K;  4I7F A;  1P90 A;  2W6K A;  3RMD A;  4KTZ A;  1JCE A;  4YOV A;  3MEE A;  3CJA A;  3MEC A;  4C1N I;  5FPE A;  4BC5 A;  5JVG L;  2QXL A;  3OYK A;  3KWI A;  5C24 A;  4IG3 A;  1HKC A;  3RVC A;  3VMF B;  5AQG A;  1U6Z A;  4WFN L;  4BG9 A;  3IUC A;  1W2B M;  3MN5 A;  2QK9 A;  3SV4 A;  3P39 A;  3IKM A;  3SBG A;  3VEY A;  3AVC A;  1UA1 A;  3CCL N;  1WSI A;  2NZT A;  2A6A A;  1T8E A;  1L3U A;  4E3S A;  3QIO A;  2A1R A;  1KLM A;  1RFQ A;  1KAX A;  5J2N A;  5EVZ A;  1HMV A;  4K42 A;  3WXM B;  4X65 K;  5J2P A;  4W5N A;  5ADX A;  3NHG A;  3OA9 A;  1EQY A;  3U9D A;  2CH6 A;  4FJK A;  3NVK A;  5HRN A;  3CPW M;  2D1K A;  3CI5 A;  4DUY K;  2Q0R A;  1C0F A;  2VG6 A;  3LP2 A;  1FKP A;  3L8B A;  3CF5 L;  1KTQ A;  3H08 A;  3KLG A;  4BDZ A;  1CLQ A;  3W0L A;  4FXD A;  1DTT A;  4JHD A;  2ZGY A;  1ILY A;  3AVM A;  4B8A B;  2HB5 A;  4JYA K;  5JLF A;  4CJ3 A;  3L2Q A;  3BUZ B;  3O1W A;  3WXK A;  4M7X A;  3AV9 A;  4I6M A;  3THX B;  3PX6 A;  3D2F A;  4WFA L;  3J81 O;  3OJU A;  5IT9 O;  2JGU A;  1EWR A;  4YOU A;  1TKZ A;  4B9T A;  1MA9 B;  3PV8 A;  1S9E A;  2CH5 A;  3NH1 A;  1L3T A;  1QS4 A;  4M3R A;  4FPB A;  3TTF A;  3HPO A;  2KZZ A;  1HYV A;  1BA0 A;  4F9O A;  5AQQ A;  5C0Y A;  2D5R A;  3M3Z A;  3DYA A;  4CK1 A;  1WAJ A;  1YUW A;  2P9K B;  3ASM A;  4DFK A;  4CHO A;  4KHQ A;  1SQK A;  2ZWH A;  5KRT A;  2O8E B;  1NWK A;  3OYH A;  5ELZ A;  1BCO A;  1BL3 A;  2E2N A;  4LH4 A;  4A2B A;  4O5B A;  2Q3S A;  3EZ5 A;  3M8P A;  3SQ1 A;  2QEX N;  2ZD1 A;  2P9L B;  5TKY A;  2EWS A;  4DTU A;  2CGK A;  3DXM B;  4FLY A;  2O8B B;  1TYQ A;  5AJ3 K;  3DLK A;  4K43 A;  5BR9 A;  3OYC A;  4HUF A;  2B5J A;  4KB1 A;  4CJT A;  3EKS A;  4NXM K;  1NGE A;  4B9N A;  2QWQ A;  4RG8 A;  4H5N A;  3QEP A;  3CC2 N;  1YF5 L;  1IKW A;  4BC4 A;  4Y0W A;  1VSD A;  4FSV A;  3B6P A;  2IC3 A;  1VSM A;  4DTX A;  4EZ9 A;  2XY7 A;  2QXF A;  5GIN A;  1ASV A;  1NMD A;  4B1Y B;  3T19 A;  5BRE A;  4JI4 K;  4K0K K;  1WAF A;  3H3N O;  5DMR A;  4LF5 K;  1WUA A;  1IG9 A;  2Q1N A;  1KVB A;  1XHX A;  3KK2 A;  2W42 A;  3MEG A;  3CJ9 A;  1GLF O;  3DOL A;  3KZB A;  4BG8 A;  2F9T A;  1KFS A;  3J7Z O;  1N34 K;  3VES A;  2BTF A;  3KWG A;  4BRG A;  4B9U A;  1R0A A;  1NK5 A;  4GMJ B;  3VF6 A;  4YOX A;  3CFP A;  3L2V A;  4XH4 A;  2HBL A;  4DR7 K;  5FPN A;  4H0Y B;  4DQ8 A;  1DGK N;  2FC0 A;  4ELV A;  3M1F A;  2NRW A;  3GE1 A;  4FOE A;  4KI6 A;  1IKX A;  4JI5 K;  3O80 A;  3VQ6 A;  3F73 A;  2OPQ A;  4A62 A;  1MDU B;  3RRH A;  1YTU A;  4JK9 A;  4YHH K;  4IDK A;  4KHW A;  1U4B A;  4KRE A;  4LH5 A;  2GUP A;  4IJA A;  4LFB K;  3P5J A;  4JHD B;  2V7Y A;  2QI2 A;  4DQS A;  1OH7 A;  1VAZ A;  3E9O A;  4IOA L;  1BG3 A;  2QTD A;  3U9Z A;  3HYF A;  3ITH A;  2HF3 A;  4ID1 A;  4GV3 A;  2NRT A;  1RT2 A;  2ZJP L;  2A40 A;  1W7A A;  1NGD A;  4PL8 A;  3D2F B;  4E0D A;  4YDU A;  3ZX2 A;  3PIP L;  4CJ5 A;  1LW2 A;  3VQA A;  2YNG A;  1V4S A;  4CIF A;  2A5X A;  3O3G A;  3S3N A;  4FWL A;  4DTP A;  3TR8 A;  2RHK A;  3UKU A;  2W41 A;  2BGG A;  1JL1 A;  3SPZ A;  4IZ9 A;  4CF2 A;  3EE8 A;  3FZK A;  5EXW A;  4EP5 A;  3LDO A;  3V9Z A;  4X64 K;  4DHY A;  1RTI A;  3EN9 A;  1IBK K;  4IOX A;  4I2P A;  1K6Y A;  3VQ5 A;  1IV0 A;  1HR0 K;  4WCE L;  4DV2 K;  4ISF A;  3I0S A;  4RW6 A;  3L0Q A;  5KI6 A;  4CZE A;  3AVK A;  4JRQ A;  4CZF A;  3K0S A;  4K41 A;  3SMS A;  2OYQ A;  1ZBH A;  4DR2 K;  4B3M K;  1W0H A;  1YJN N;  1NJY A;  4CEE A;  2PYJ A;  4BR2 A;  4QS8 A;  3AA5 X;  2Q97 A;  3PY8 A;  2WOM A;  4GNI A;  2IVN A;  1ATR A;  3PSI A;  4DQR A;  4EFH A;  4PKI A;  2HHT A;  1TYQ B;  4RCH A;  4JS4 A;  5KGW A;  3O9U A; 
#chains in the Genus database with same CATH homology
 4JI3 K;  2UXC K;  4JI1 K;  4DV0 K;  2ZM6 K;  2VQE K;  3J81 O;  1HNW K;  4LF7 K;  4DR7 K;  3JAM O;  5IT9 O;  2HHH K;  1HNX K;  4DR1 K;  2UU9 K;  2UUB K;  4X62 K;  4JI5 K;  3J7A P;  4YY3 K;  4B3S K;  4GKJ K;  4CVN E;  2UUA K;  5BR8 K;  4YHH K;  5A2Q O;  4JV5 K;  1N36 K;  4LF8 K;  5IWA K;  3T1Y K;  2E5L K;  4JI2 K;  4KHP K;  4LFB K;  1N33 K;  4OX9 K;  4DV5 K;  4DV1 K;  1I94 K;  1J5E K;  4X66 K;  2VQF K;  1XMQ K;  4NXN K;  2UXB K;  4DV7 K;  1FJG K;  3OTO K;  4LF6 K;  4V19 S;  4DV3 K;  4LF9 K;  4JI0 K;  5FLX O;  1XNQ K;  5LMU K;  3J7Y P;  4LFC K;  2UXD K;  4JI6 K;  4DV4 K;  4GKK K;  5AJ3 K;  4JI8 K;  4DUZ K;  4B3R K;  1XMO K;  4B3T K;  4X64 K;  4NXM K;  3T1H K;  4X65 K;  4DR3 K;  1IBK K;  4DR6 K;  1HR0 K;  4LFA K;  1N32 K;  4DV2 K;  1IBL K;  3J80 O;  4DUY K;  4DR5 K;  1XNR K;  4DR2 K;  4B3M K;  4JI4 K;  2F4V K;  4K0K K;  4CW7 B;  4LF4 K;  2UUC K;  5LMN K;  4LF5 K;  4JI7 K;  5LL6 Z;  1HNZ K;  4DV6 K;  4AQY K;  4DR4 K;  4JYA K;  1N34 K;  1IBM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...