1IBMK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1ibmK00
2UU9K 4LFCK 2VQFK 5LL6Z 1HNZK 4AQYK 1N32K 2ZM6K 4GKJK 2UXDK 4DV5K 4DV6K 1N36K 2UUAK 4DR7K 4JI5K 4B3MK 4X65K 4LF8K 4DV7K 1XMQK 4DR2K 5A2QO 4DUYK 4DUZK 2UXBK 1HNXK 1FJGK 4NXMK 4LF5K 4DV0K 4GKKK 4K0KK 2E5LK 4JI4K 4JI2K 5FLXO 4LF7K 4JV5K 4KHPK 4JI3K 5AJ3K 1XMOK 4X64K 4JI1K 4DV1K 4LFBK 4JI6K 2UUCK 4YHHK 1N34K 3JAMO 5LMNK 4JI7K 3J80O 1XNQK 2UXCK 4B3TK 1I94K 4X66K 5LMUK 4OX9K 4B3RK 1IBKK 1HR0K 1HNWK 4DR1K 4DR4K 3T1HK 4JI8K 4DR6K 4X62K 4JYAK 4CW7B 4DR5K 1IBMK 4NXNK 5IT9O 3OTOK 4CVNE 4JI0K 2HHHK 1XNRK 1IBLK 4LF9K 2VQEK 3J81O 4LFAK 4B3SK 4V19S 3J7AP 4DV2K 4YY3K 5IWAK 1N33K 3T1YK 5BR8K 4LF4K 3J7YP 2F4VK 4DR3K 1J5EK 4DV4K 2UUBK 4DV3K 4LF6K
chains in the Genus database with same CATH superfamily
1SKRA 4QS8A 5AQFA 4CECA 3G4SN 2OTJN 1JL1A 4E89A 4M3YA 1ITGA 4FWLA 5KPRA 2UXDK 4DR7K 1TGOA 2HNDA 1RT4A 2FLOA 3W0LA 1GLBG 4KO0A 4CEBA 1FKOA 2NRVA 2HHVA 3L2UA 4WQ5A 3PO4A 3TABA 1HNXK 4ID1A 1YT3A 1BOTO 1S1VA 3ZSOA 4B1WB 3SAFA 3SLCA 3ZT3A 1LAVA 4FLTA 1NMNA 5GINA 3UKRB 4LSNA 1XHZA 3OYDA 4FWPA 4BE0A 1BU6O 2G8WA 3PIOL 3ASMA 4JI1K 1ZYQA 3V1OA 3K5OA 4J8FA 4JI6K 1GLEG 3MEDA 1HQEA 4ELTA 2FBXA 1NU0A 3SQ2A 2OANA 4O4GA 4XH5A 3J80O 5KQ8A 3VQ6A 1KVCA 2A1SA 5AQUA 1P8ZA 2B6AA 2B4JA 4IZ9A 2HHTA 4FW1A 1KRPA 3OS0A 5LY3A 1T8EA 3SQ1A 2ASMA 1RT5A 1TL1A 4GW6A 5GAEP 3SK3A 3GBTA 4IOCL 3H3NO 1M90O 3S3NA 1QQOA 1C0TA 2V7YA 2IAJA 3ZSQA 1NJYA 3P31A 2GV9A 4KRFA 1J54A 3VGKA 4CZLA 1TVRA 1OH5A 4DWIA 1NGDA 3C95A 1NGBA 5HOOA 4KV8A 4KB0A 4RW8A 3BGRA 3LDSA 4DS4A 4E7IA 1VQNN 3NGYA 3NMUA 5ELZA 1CZ9A 1JKHA 4ILHA 3TSQA 5EY4A 3QEVA 3FLCO 3AA3A 4BY9C 3AVFA 4O44A 3C65A 1WNSA 3VN5A 4JRQA 3DXMA 4H0YB 1GLJO 2EX3A 4DV3K 1W0HA 5HL7L 3MXMA 1X3MA 3LDPA 1OVYA 3DRRA 4CIEA 4NYNA 1N5YA 2EHGA 1NKBA 1NGIA 3ZSYA 1S22A 3TI0A 2KLAA 4JRPA 3LANA 1CZAN 5AQXA 1BG3A 2O8BB 2QWLA 4DV6K 1EKEA 2O8EB 2KZZA 4DTRA 4LH4A 4FSVA 1NKCA 3QIPA 3MCAB 4LF8K 4CF8A 4NB4A 1NJXA 4R5PA 3OS2A 4RWTA 2CGKA 4JK7A 3DRSA 5EU7A 5CYMA 4DV0K 3E9PA 3O3GA 3RSEA 4E0DA 1TK0A 4DSJA 3BF3A 3QEPA 1C1CA 1NLVA 5AFUA 1VRTA 1K8AO 3E01A 1LV5A 1KLMA 1NWKA 1QQMA 1NK4A 2O8CA 4CZHA 3A5MC 3EE9A 3RWUA 3CCRN 3KKSA 2KKZA 3L0QA 2D0AA 3HL8A 4CK3A 1V4SA 1GOAA 3LPUA 3F73A 3FZLA 3QEIA 1IG8A 4CK1A 4GMJB 3F5TA 1YHQN 4Z4CA 1I94K 4F2RA 2PFUA 5JVGL 4DTXA 2XY8A 4YFUA 4BE2A 4BWMA 3AVIA 4FWRA 3VQQA 4I2PA 3EL2A 5J2QA 1IJJA 2O8DB 3AAQA 4IFEA 3FFKB 1NJIO 1KFDA 4X62K 3VERA 4Z0UA 3SQ0A 5J2NA 4BR7A 3QNOA 3K9JA 1NGFA 4ILJA 3TAPA 4O8KA 2ATQA 5EX5A 2I7NA 3WXKA 1SKSA 5BN8A 3BEXA 4HCCA 4HTUA 4DSIA 3HJFA 2P9LA 4CZEA 1OVQA 5AQSA 3KK1A 5AQPA 3KTQA 1QVFM 4NCBA 1WSEA 2P9UA 1BI4B 2WFBA 4OPHA 5EOYA 1LWEA 3HT3A 2W40A 4PHTX 2Q0RA 4ISFA 1KTQA 3LAMA 3DLKA 2R7YA 3DAWA 3R1XA 1EQYA 4CEAA 4FK2A 1BWFO 2BUPA 1SL1A 3H45C 3ENOA 2OZMA 3SI6A 3H1QA 1MDUB 3AA2A 2XY5A 1QS4A 3AO5A 3QFUA 4BWJA 3MMVA 2A6AA 2OCEA 3I33A 5LJWA 3SJHA 1YTAA 4DV7K 4BQLA 1JLQA 3IS9A 1T05A 3G25A 3HVTA 3LM9A 5AQKA 5AQGA 3NHGA 2ETJA 4DTUA 3DRPA 4E1NA 2Z1HA 3VEYA 3OA9A 1QZ5A 3O1BA 3WNFA 1ESVA 4DLGA 3VEWA 3DI6A 5F1XA 3OYCA 5J2PA 3VESA 3E9LA 2BTFA 1BGXT 3CPEA 5KGXA 3VQ5A 3IDHA 4BRIA 4E3SA 3VQBA 3SBGA 1DTTA 1VSFA 4X64K 5ADXA 4DSLA 3M8SA 1JL2A 4W5QA 1X9MA 3THWA 1DKGD 1Y97A 2QWQA 3AVAA 3JAMO 3OYNA 4YNQA 1NJWA 4PY5A 3NBPA 3CJBA 2P9KA 4FWNA 3MXIA 4RW9A 3V9XA 5AQLA 5E41A 1T3VA 4BG8A 1B92A 3SAHA 1L3TA 3QNNA 4FWKA 4JI8K 1VQ5N 4FWSA 3SUPA 1W2BM 4KREA 1IBMK 1QHAA 1W7AA 4WF9L 1P90A 3HP6A 1NK0A 3EYZA 4JN4A 1OKJA 3DLHA 4LF9K 3H1VX 4TSXA 1L3UA 4KHUA 4FWOA 1NGCA 2IIRA 4DV2K 3H6EA 4BRHA 3QDKA 4RCHA 4U7BA 2DY4A 1EXQA 3J8AA 3SUNA 4MO4A 1J5EK 5BPLA 4K43A 3ZX3A 4FJNA 2OTLN 4WYBA 1J53A 4QAGA 1XQSC 3DLGA 4H0VB 4CJ4A 5AZJA 1K8KB 2P5GA 1S3XA 5I9EB 2ZM6K 3VEZA 3CMAN 3PY8A 5DM7L 3KWIA 1YJNN 3AY9A 3HI0A 4H5NA 3DOLA 4J2EA 4H5TA 4DUZK 2QA4N 1DEJA 4W5RA 1NK9A 2HBLA 1E4GT 3SUQA 3ZT1A 1Q9YA 5AFUH 2ASOA 2E2OA 4PKIA 3H46O 5T7BA 4QS9A 4M3TA 1IH7A 3OVNA 3VF6A 3TANA 3A0IX 4HVJA 3KK7A 4OKKA 2NRWA 1O1WA 4OJRA 4B1XB 4RTFD 1WBDA 5DM6L 4YOUA 3ULEA 3OYAA 3V9WA 4GV6A 2D5RA 3R8EA 2Z1GA 4JKEA 1UWBA 4EHUA 3RMBA 4IOAL 1RBRA 1N8RO 4B9SA 4X66K 2OPSA 1JCEA 4UQGA 4OGEA 1SAZA 2FF6A 1CXUA 4B1VA 3O9SA 2QXLA 3C7NA 4I6MA 1IO2A 4K8ZA 1VRUA 4FJ7A 3GL1A 3LL3A 1KD1O 3UE5A 3SCXA 2YV0X 4FLYA 3KWGA 1L5UA 5C0YA 1KAYA 3BDPA 4F3TA 3S3MA 3L2VA 3J7AP 1HYSA 1ZBFA 2HNYA 4IOXA 5C2DA 1N33K 1Q86O 2HHUA 4FZXC 1KCFA 4A59A 3CERA 5AQVA 3O9QA 3SQ4A 4JLHA 2E6MA 4IEEA 4DSFA 3O8MA 4I7FA 4B8AB 4H0XB 4KI4A 4E1MA 4K42A 1QVGM 4CBXA 3OYEA 5C15A 1T7PA 4DV5K 4M3RA 1NK8A 2YNFA 1EO1A 5FRNA 2Q36A 2W6KA 2KHOA 5KGWA 2P9IB 2YX6A 1A5WA 4AM7A 2G8KA 4FK4A 2ITGA 2YI1A 1KVBA 2FBYA 3CQ8A 2PYJA 1VQ9N 1R59O 4GKKK 4IG3A 4M41A 4FL9A 3K5NA 3O9TA 3TU5A 4KHQA 2HF4A 2ZWHA 3J7ZO 4LF7K 1U6ZA 4CJUA 2E2PA 1BQNA 4OKJA 4JV5K 4BG9A 3MEEA 5ADXH 1HNIA 5BRFA 1HYVA 3DXMB 1ATRA 1SZ2A 1V4TA 1RDDA 3AO1A 2YJFA 4B9MA 2P5OA 2Y1IA 1HMVA 1BO5O 3L2WA 4B9UA 4XEIA 1RT2A 5FPEA 3CD6N 5CR4A 1TL3A 1UAXA 3ID6A 1WLJA 4MDBA 1GLCG 1U49A 4BC2A 3DLRA 3EZWA 2KTQA 3WQTA 3AA4A 3D2FA 2P9PA 1RDAA 4CVNE 1C0GA 4B1YB 3TARA 1IV0A 4FJGA 3KVGA 2A42A 3QIOA 1NMDA 3HYFA 1VSDA 4JHDA 2OA8A 2O8FA 4C8MA 5FROA 2QWRA 3OYJA 4CFCA 4DFPA 3CF5L 4JKHA 3V1RA 3MWPA 1UA1A 3OYMA 1LCUA 3ZYYX 4M42A 3QMLA 4N76A 4FZZA 3J7YP 5M1PA 5M1FA 3AVNA 4LC9B 3QEWA 4YDUA 1VQ4N 4YOYA 4Q0BA 4BVPA 2UU9K 3S41A 4OLAA 3NGIA 4L8RB 1RBSA 2X6NA 2E2QA 4MO5A 1LW2A 4AQYK 4CE9A 5HROA 4NLBA 1TUYA 1KC8O 1RT3A 2HMIA 3CC4N 2HHXA 4CJSA 4L3QA 3L4IA 3I8DA 4KH4A 3HBTA 4FYDA 2I7PA 5B8HA 4DR2K 2QWPA 4ID5A 3PUFA 2YNIA 2NRRA 1KAXA 5HLFA 3TTDA 5C12A 3JSMA 4AHRA 2NLXA 2YHYA 3LALA 4CI6A 4DTSA 3VQPA 2HF3A 4JD2A 5AQTA 1RDCA 5KPZA 4PL8A 1Q7YO 1OH8A 4WFBL 3D0PA 1RDUA 5AQHA 4AF1A 2P9UB 4CF9A 4IJNA 4AM6A 3HOTA 4DV1K 3D6RA 4BRMA 3ZSRA 4BR4A 1Q81O 3OJSA 4M7XA 4FOEA 1OH6A 2E20A 1W97L 4CD1A 3DXKB 4CJQA 1BDGA 4FJXA 3FZKA 4FJLA 1HLUA 4FWMA 3TWHA 3WNGA 2D4WA 4M3UA 5LMUK 5GIPA 3MDQA 4FLVA 4E1JA 1HR0K 4B9QA 3BUZB 5HP1A 3DM2A 3P4IA 4BE1A 3ATVA 5FPMA 5C42A 4DKWA 1TYQA 3F2KA 3HXMA 3KLHA 2VG5A 2YHXA 3L4QA 1BIZA 4KB1A 2E88A 4CJPA 1J6ZA 3OYFA 2QW9A 3VA0A 3Q7BA 4O0JA 4W5TA 1U2VA 5AZIB 4FO0A 4CEOA 3AO2A 4XIUA 4A62A 4G9ZA 4YY3K 3CQYA 1YF5L 3CCVN 2A41A 4OVLA 4M63C 2D0OA 3OYHA 3IUCA 2ZJPL 3THYA 3THWB 3T1AA 3KIOA 4BR9A 1NK5A 3M5RA 4LFCK 4FJKA 4C8KA 5EXWA 2P9KB 3U3GA 4NO7A 4BRQA 1C0FA 1T44A 2OPQA 2UYTA 3AVCA 4GKJK 4DQSA 1BUPA 2ZQBA 3PX4A 2HBKA 3K9KA 4AHTA 4EIAA 3G0ZA 4OPKA 3VENA 2CGJA 3RMDA 2Q0UA 1YVUA 3U3YA 1KXPA 2BANA 3T7ZA 3EN9A 3AVKA 5EVZA 3V9SA 1Q18A 4KH6A 2GBZA 1T03A 4JI4K 3A5OC 1QQNA 1RTJA 1VAZA 1VSKA 2P9SB 3CCMN 4NCGA 3ENHA 1JLEA 1JLFA 4B9LA 3CJ1A 2FSJA 3HOSA 1RDBA 4OPAA 3EKUA 4RW7A 2GELA 3RTVA 4NYFA 5AR0A 1N34K 4FM2A 3SAGA 1I3AA 5AZJB 3VQDA 3VGMA 3SJJA 3ZT0A 2Q2RA 1HNWK 5AQIA 4J2DA 3LM2A 4DR4K 4A5BA 3T1HK 4C8NA 3IKMA 3RR7A 3CXCM 2VGMA 2YHBA 4CW7B 4Y1DA 5E26A 3TAQA 5IT9O 5MLCQ 3EY1A 3CC7N 4JKDA 1XNRK 4KTWA 1C1BA 2J4RA 3AVBA 3UKUA 2D0CA 3WQUA 4Y1CA 1RBUA 3N4PA 4KTQA 2E1YA 5BREA 3ZT4A 3VQ9A 3LPTA 3WT0A 3ZT2A 3NVMA 3UB5A 3NF8A 5IWAK 1HKBA 1WSHA 3NFAA 3QLHA 1Q82O 3VQEA 3T1YK 3AVGA 5JS1A 3ZX2A 3ULEB 1NM1A 4B9TA 4BRGA 2UUBK 4MDAA 4CHPA 2KFZA 1WSFA 3ZEUA 5HRRA 1HKGA 4E7HA 3CJ9A 3K5LA 1VQON 4I9LA 4WE1A 2AJQA 1ZBIA 1BCMA 1JLGA 2IOCA 5TKYA 2BE2A 1N32K 1DT9A 4CEZA 3MECA 3SMPA 1KLNA 4KTZA 4B3MK 3C7NB 2HMPA 4Q5VA 1QTMA 4FJIA 1X3NA 5DMRA 3F9MA 3VETA 4DTPA 4KHNA 1Z25A 4ISEA 2HVHA 1YUWA 2V7ZA 4NXMK 3T3FA 5C25A 4CZMA 3QFPA 3G6EN 4WQ5C 4CIGA 1HPZA 4I2QA 1YJWN 1NG9A 1ILYA 4JI3K 3QICA 1RDWX 4LFBK 3C0BA 2XRIA 4LH5A 3LWLA 1E3MA 2OPPA 1I39A 2UUCK 4O5BA 2Q97A 3KLFA 3JYTA 1JJ2M 1YIJN 4FLXA 4JI7K 3NDKA 4B9VA 1DGKN 4WFNL 4F3OA 3I55N 3E1YA 3K59A 3UKRA 4CGFA 4CGDA 3R3LA 5AQJA 3VF2A 1W9HA 2XO7A 2IGIA 3P38A 1S5JA 1E4FT 2X6SA 3AVLA 5D3GA 2YHAA 4KHYA 4JYAK 2FBTA 3NF7A 1G99A 2YNHA 4A61A 1JXEA 4GV3A 4CERA 1SV5A 2P1JA 2IS3A 1C0UA 3RRGA 4RG8A 3VF4A 4PKGA 3VQAA 4QCLA 4FJHA 3V81A 3KKRA 2WBNA 3WXJA 3OS1A 2QWMA 1VSJA 1HNZK 1JXBA 1RBTA 3O4QA 4MQ3A 3M3ZA 1NKEA 3EKSA 2QWNA 4Y0WA 4WQ4A 2UUAK 2CGLA 5SZTA 1SQKA 3LDNA 4CGHA 5GIOA 3OHRA 1LAWA 1F21A 1XMQK 3ZETB 3O5BA 3PV8A 3CCLN 1KQSM 5FPNA 5GAGP 2KQ2A 3BP8A 3GG4A 3PLAA 2O4GA 5CE3A 2O8BA 3EO3A 3T19A 1RT6A 3V9ZA 4ZTFA 5BPMA 3TAEA 4FZYA 4N41A 4KFBA 1YXQA 3QBXA 5CZ1A 4CJRA 3HVRA 5FDLA 3WXLA 3KJVA 2E6LA 1SL2A 5M1QA 4BC3A 4M3XA 1C6VA 2W6LA 1NGAA 4BDPA 5E84A 1XNQK 1ZXOA 5KPTA 2Q3SA 4CJVA 1HRHA 4HUFA 4DQPA 2XY7A 3VEOA 4Z94A 4F9OA 3TSPA 2GWJA 3VQ4A 4I9QA 4HTLA 1EX4A 1SUQA 4OKEA 1NNEA 4FPAA 4M3WA 3KD5E 3SV3A 3HPGA 4CHOA 3LP2A 2GEMA 1NOYA 4GNIA 3AAPA 4KH5A 4KHSA 2HHWA 1D5AA 1ATSA 1RGIA 3AVMA 5FPDA 4JD2B 3CPWM 1TKDA 2PZSA 5F0XA 4LFAK 3O4WA 4IO8A 4KKOA 4LD0A 3OYBA 3L2RA 2WTUA 2QI2A 3FZFA 4FPBA 2DTUA 2O8DA 4IFVA 2O4IA 2ASPA 1IKXA 3WNHA 4FCYA 4CHNA 5BN9A 2F4VK 4DR3K 2JGUA 4BRKA 3VTIA 3K58A 5K14A 5KRTA 2XY6A 1ASUA 1TK5A 4CEEA 4DLEA 4BR2A 4BACA 2W41A 3OY9A 3THXA 2YCHA 4MLEA 3VOVA 4M7YA 3MN6A 1BA0A 2VG6A 1GLFO 1NOZA 1HX1A 1VSHA 1LW0A 1JLBA 1TYQB 3CQXA 1HNVA 3LDOA 4DUYK 3V4IA 3K57A 3OBYA 4QOZB 2UXBK 1S9EA 5CY4A 2BGGA 1DTQA 4B1ZA 3O3HA 2XHBA 4Z4IA 1VQLN 2IC3A 4AH9A 2E5LK 4AHCA 3I56N 1YTUA 4AHSA 3M1FA 4W5OA 4KHPK 4DFJA 3RVCA 2QKKA 1D9FA 2G8HA 3SZ2A 3GE1A 3AARA 1WUAA 1YVNA 3ZSXA 3THYB 2H3GX 3MXJA 4DTMA 3CFPA 3WUHA 3FFIA 4CF1A 4A2AA 3IG1A 3TPQA 4H5RA 3TTFA 1YI2N 1KSPA 2V52B 1A5VA 3B8AX 2HNZA 4FJMA 4JK9A 1FKPA 4IKFA 4RW4A 5KRSA 3ENBA 3KD1E 1JCGA 4CJ7A 3LZJA 1LWCA 3L2QA 4DFKA 4NXNK 3M8PA 5AQMA 1ZBSA 4BRLA 1M1KO 3IMXA 3PX6A 2HW3A 3OJUA 1HPMA 1Z05A 5HRPA 4K8XA 4ELVA 3HPOA 4CJLA 4JKGA 4IDKA 3VQCA 5BR8K 3ZLJA 5C10A 3LWMA 4OO1J 3A8YA 2RKIA 5HBMA 3VGLA 1ZBHA 3FZMA 3MN7A 4KHWA 3RSEB 2ZGYA 2RPIA 1VHXA 4O0IA 3C6AA 3H3OB 1BIUA 3KK2A 2AP1A 3BZKA 2O8CB 3MCPA 2G8VA 4CF2A 3ITHA 4M45A 3SMSA 3E9OA 4ILGB 3F9KA 3ALYA 3I8BA 5JS2A 1Q9XA 4JEPA 3VQ8A 3ZSWA 4H5VA 2ZE2A 4F8RA 3H08A 2HBMA 1IKWA 4IO9L 5SWMA 2FSNA 2GUPA 4BQZA 4KAZA 2P9NA 3D2EA 1NBWA 3OYLA 2E2NA 2NRXA 3ZEUB 4ELUA 3RR8A 3AO4A 3QO9A 4FJ9A 4U67L 2Q1NA 4CEDA 4B3TK 3IAYA 4JKFA 3GDQA 3LDLA 2P9LB 4Z4EA 1IKYA 1S6QA 2HVIA 4FJ5A 4EAHD 4Z4GA 3B6OA 2X74A 1HYZA 5I3UA 4ZTJA 3ZX0A 3KHYA 1GLLO 3U4LA 3CJAA 3MN5A 1D9DA 1RTIA 4JKBA 4EZ9A 3NH0A 3NGZA 5FRMA 2FXUA 5DK5A 1X1PA 3KK3A 2ZJRL 3HSTB 3O6WA 2BDPA 2NRZA 3QBWA 5CYQA 1WSGA 2G8UA 4B8CA 5I42A 3VEVA 4BRAA 1Z26A 3DLEA 4DV4K 3MAQA 3NF6A 3AVHA 4Z4FA 1IKVA 5HRNA 2VQFK 5LL6Z 3FE1A 1JLAA 4XH4A 3A2FA 4G1QA 2F9WA 2ZD1A 3CC2N 1EETA 1J5OA 2DPNA 4PL7A 2OPRA 3O80A 1TKZA 3K2PA 2WOMA 1L3SA 1ZC6A 2B5JA 4CBWA 5M1NA 4FJ8A 4JI5K 3DLLL 4EZ6A 4X65K 4CFDA 4JAXA 4BC5A 4O8UA 3HP9A 4CZGA 1SKWA 3WXIA 4A5AA 1QQCA 2RF2A 3B6PA 1EWRA 1EP4A 2VGNA 1YAGA 3O3FA 1BHLA 1ASVA 4JI2K 1VQKN 5FLXO 2A1RA 3CM6A 3CHWA 5AQYA 5KTQA 1XC9A 2P9IA 4DQIA 5LJVA 4HHTA 4CJ3A 4C8OA 3ATUA 2ZF5O 2Q31A 3SYZA 1L3VA 1WSIA 5JMVA 1BA1A 2WUSA 3O4NA 2D0BA 4DHYA 2ZJQL 1REVA 3NE6A 2JLEA 4ICLA 4OX9K 2YKMA 4IEIA 1IBKK 1TK8A 2HB5A 1KVAA 1S1UA 1WBBA 3I0RA 4HUEA 3VQ7A 1JCFA 4CF0A 1QSLA 3MX2A 1NK6A 4IJAA 2FF3B 4EHTA 3V6DA 4OGCA 2QEXN 3KLGA 1UOCA 4CJKA 3DWLA 3I0SA 5CZ2A 3NH1A 3TTCA 4CESA 1FXXA 2P51A 3O08A 4YOTA 3L3VA 1WSJA 1EWQA 1NGHA 2GUIA 2Y1JA 1XI1A 2QTDA 1SS6A 2VWBA 3T69A 4DU1A 3WEEA 4CCHA 1VQ6N 4FM0A 3PIPL 3O1WA 3CJ7A 1MWMA 4FJJA 3M8RA 4C8LA 4IDHA 3RMCA 3HM8A 3SPYA 1VSMA 4YDUC 3U9DA 3BY5A 2WONA 1DLOA 4BR5A 4C23A 1MWKA 4FW2A 3CFRA 4CJTA 3THVA 2E1ZA 3SNNA 5BPNA 4E19A 3WXMB 2VG7A 3U6FA 4GV9A 3QB0A 4DS5A 5AQRA 4ZHRA 4CZIA 2I5JA 3HTVA 1MU2A 4CJWA 3KZBA 2NRTA 3TAFA 2HSTA 4JNEA 3EE8A 1VQPN 1TKTA 4GVEA 1A5XA 4I6MB 3AGRA 3KLEA 4H0PA 1X9JA 4OLBA 4CGJA 2A40A 2FC0A 3OBWA 3THXB 4IFYA 4DMNA 2HBJA 2OZSA 2JWKA 4YOXA 3CMEN 5F2RA 4IG0A 2KW4A 3HZ6A 5TKWA 3LDQA 2VYPA 1BL3A 2F9TA 2NNWA 5AQQA 5H1SQ 2D0PA 4IBNA 2CH5A 3K5MA 1KFSA 2IVOA 4BDYA 4DR5K 3CM5A 1S6PA 1WB9A 3C94A 1K6YA 3S3OA 4BGBA 3CG7A 4LY7A 3DXKA 1TV6A 2VWJA 2QK9A 3D45A 2YHWA 3L8BA 4ISGA 1R0AA 4F4KA 4CZFA 4DU4A 4H5WA 1MA9B 4DCHA 3OYKA 1S9GA 1T6DA 1Q8IA 3EZ5A 5CHIA 2QM1A 3P1GA 1X9SA 2A3ZA 3HRGA 2F96A 1QZ6A 1RTHA 3TAMA 4A57A 3U8XA 4FM1A 3QERA 3IRXA 4CHYA 3M6GA 2QWOA 3VMFB 4BREA 4CBUA 3LZIA 1HJOA 5AZIA 2VCPA 3TSUA 3CCJN 4R79A 4HUGA 4FK0A 3CCUN 1VSLA 4CJ5A 5AQWA 5AQOA 4DTOA 4O55A 3RMAA 1QSSA 3BZCA 5GAHP 1NK7A 3CCQN 1U4BA 1K73O 4E7KA 1RTDA 4PKHA 1ZBUA 1FJGK 1RFQA 3CFOA 1S72N 1T6CA 5JVHL 4JK8A 4K0KK 3MK6A 4MLHA 1TAUA 4EP4A 2W42A 4CFBA 4W5NA 5J2MA 3V1QA 2Z1IA 4JKGB 3AVJA 5AJ3K 4CZJA 1BQMA 3DYAA 4PA1A 2QXFA 4JKCA 5M1KA 3OYIA 2GX9A 2IVNA 3O9RA 4CHZA 3D2FB 3NF9A 2NUBA 2P9PB 1WOQA 4FLWA 4FVUA 4KI6A 4YHHK 1TAQA 3P5JA 3FGUA 4BVOA 1RILA 1G15A 1OH7A 1C1AA 2GTDA 1U48A 2KZMA 2UXCK 1O13A 4JHDB 4FVMA 2O8FB 5BRHA 2F8TA 2RHKA 4B1UB 1FK9A 4AHUA 2P9SA 4B3RK 2E8AA 1HJRA 3L6QA 2O8EA 2YNGA 5BRDA 3PO5A 4YORA 1XUPO 4BDZA 1VSEA 1N6QA 3G10A 3R9PA 4PWDA 3DJCA 2V51B 3P39A 4M3ZA 3IFRA 2HHSA 1ZBLA 3OTOK 4YOWA 4BR0A 4JI0K 2HHHK 1K9MO 3MN9A 2PY5A 1IBLK 3D7EO 5KI6A 5BR9A 2DFHA 1NJZA 3FZHA 1SL0A 4V19S 4N56A 4DTJA 4B9NA 1UA0A 1KAZA 3M8QA 3K0SA 4IWVA 4AILC 4B08A 3WNEA 4BC4A 3R6MA 2P9NB 3D2EB 1BISA 1VQ8N 4LF6K 4MFBA 2A5XA 4WFAL 4J2AA 2YJEA 3SPZA 4DB3A 3SV4A 3CYMA 1QSYA 3RRHA 4NCAA 2BH1A 4RW6A 1WN7A 3Q7CA 4CJEA 5C2FA 3LP3A 3CCEN 2KFNA 3JS6A 1VK0A 1JLCA 4BRNA 1C0MA 4CEFA 4UY8O 4JS4A 1BCOA 1CXQA 2X78A 3HM9A 4FWQA 2PYLA 4BRDA 3NAEA 4NLCA 3A5NC 4DQRA 2YKNA 1HUXA 2CH6A 2Z1JA 3ISNC 4CGGA 1H1VA 5JLFA 1U04A 4H4MA 1IG9A 5GADP 4LF5K 2DFEA 4PQUA 5AQNA 1D8YA 3CI5A 4J2BA 4A2BA 2HOEA 1RCHA 4E7JA 5JLHA 2QKBA 1HKCA 3MEGA 1XHXA 4WCEL 1NGEA 4DQQA 2DFFA 1BI4A 1VSIA 1RNHA 2VWKA 1RBVA 3C6TA 4CFAA 4YOVA 4DSEA 1LWFA 4H0OA 4CHQA 1U2VB 3P83D 3ZCMA 1VQ7N 4H4OA 1U45A 2ZGZA 4DR1K 1GOCA 3EEQA 4DR6K 4KBOA 1QHTA 4CJFA 2HHQA 3PSIA 1XC3A 4JKAA 2LSNA 2PAVA 4N5SA 3VTHA 3NVKA 4IXCA 3ULDA 1S1XA 3NCIA 4DQ8A 2PBDA 3QEXA 3S9HA 2VQEK 3J81O 4B3SK 5M1OA 3HSCA 2E4LA 2G8IA 3VA3A 4DF4A 3PX0A 1HQUA 1YJ9N 5HRSA 2F7TA 3HK2A 1RT1A 2NZTA 4JS5A 1J9AA 3C6UA 3ZSVA 1XMOK 1NGJA 1CLQA 1U47A 3DMJA 3KLIA 3VPZA 4E7LA 1CZBA 1Z6RA 1RT7A 1Y64A 2FSKA 4DTNA 2RE2A 1XWLA 5C24A 3AV9A 2RN2A 4DFMA 4BROA 1S1TA 1N36K 3DOKA 5J1EA 1WAJA 2EWSA 4EP5A 3BF1A 3AA5X 3SBTA 1X9WA 3AGKA 2OYQA 4DU3A 2D1KA 5A2QO 3JXUA 4AHVA 3W3DA 3NH2A 4WQ4C 3QINA 3MX5A 4KPYA 3TAGA 4CD3A 4PUOA 3OW2M 2NRHA 4CZKA 4BRFA 4BRPA 1GOBA 1LOTB 3ZSZA 4FOIA 2ITMA 2IVPA 1ATNA 4CK2A 3O9UA 4OPJA 4BRCA 5JICA 1VQMN 4DSKA 4C1NI 3G71N 3CJCA 1NGGA 2G8FA 1FW6A 3SUOA 3LP1A 4DF8A 3ZETA 2IDOA 3LP0A 4F2SA 3WEEB 4EFHA 4HCBA 4H0TB 3QETA 3PSFA 3CETA 4B3OA 2FBVA 5LMNK 3UKUB 4HWIA 4GVMA 5KQDA 2F8SA 1K8KA 3ID8A 1B9DA 2GWKA 2JWLA 4Z4HA 1GLAG 4H8KA 1YITN 4FXDA 3UIQA 4O5FA 3GOIA 4N47A 3U9ZA 1GLDG 3QESA 4FLZA 3L3UA 3CIPA 1TKXA 3HPHA 2AA4A 4LSLA 4K41A 3A5LC 4C1NK 3CCSN 3OYGA 4H03B 4DG1A 1D4XA 5AQZA 3AO3A 4CEQA 4K25A 3FR0A 3V9UA 1S1WA 4QS7A 3HO1A 4GY2B 1ASWA 3VEXA 4CIFA 3N4QA 3LAKA 3DLBA 4FLUA 1QE1A 3C6HA 2WC9A 4CGIA 4LF4K 3TR8A 3E66A 3MWTA 1B9FA 1TUUA 4XH1A 1WAFA 4BGAA
chains in the Genus database with same CATH topology
2UU9K 4LFCK 2VQFK 5LL6Z 1HNZK 4AQYK 1N32K 2ZM6K 4GKJK 2UXDK 4DV5K 4DV6K 1N36K 2UUAK 4DR7K 4JI5K 4B3MK 4X65K 4LF8K 4DV7K 1XMQK 4DR2K 5A2QO 4DUYK 4DUZK 2UXBK 1HNXK 1FJGK 4NXMK 4LF5K 4DV0K 4GKKK 4K0KK 2E5LK 4JI4K 4JI2K 5FLXO 4LF7K 4JV5K 4KHPK 4JI3K 5AJ3K 1XMOK 4X64K 4JI1K 4DV1K 4LFBK 4JI6K 2UUCK 4YHHK 1N34K 3JAMO 5LMNK 4JI7K 3J80O 1XNQK 2UXCK 4B3TK 1I94K 4X66K 5LMUK 4OX9K 4B3RK 1IBKK 1HR0K 1HNWK 4DR1K 4DR4K 3T1HK 4JI8K 4DR6K 4X62K 4JYAK 4CW7B 4DR5K 1IBMK 4NXNK 5IT9O 3OTOK 4CVNE 4JI0K 2HHHK 1XNRK 1IBLK 4LF9K 2VQEK 3J81O 4LFAK 4B3SK 4V19S 3J7AP 4DV2K 4YY3K 5IWAK 1N33K 3T1YK 5BR8K 4LF4K 3J7YP 2F4VK 4DR3K 1J5EK 4DV4K 2UUBK 4DV3K 4LF6K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 K;  4LFC K;  2VQF K;  5LL6 Z;  1HNZ K;  4AQY K;  1N32 K;  2ZM6 K;  4GKJ K;  2UXD K;  4DV5 K;  4DV6 K;  1N36 K;  2UUA K;  4DR7 K;  4JI5 K;  4B3M K;  4X65 K;  4LF8 K;  4DV7 K;  1XMQ K;  4DR2 K;  5A2Q O;  4DUY K;  4DUZ K;  2UXB K;  1HNX K;  1FJG K;  4NXM K;  4LF5 K;  4DV0 K;  4GKK K;  4K0K K;  2E5L K;  4JI4 K;  4JI2 K;  5FLX O;  4LF7 K;  4JV5 K;  4KHP K;  4JI3 K;  5AJ3 K;  1XMO K;  4X64 K;  4JI1 K;  4DV1 K;  4LFB K;  4JI6 K;  2UUC K;  4YHH K;  1N34 K;  3JAM O;  5LMN K;  4JI7 K;  3J80 O;  1XNQ K;  2UXC K;  4B3T K;  1I94 K;  4X66 K;  5LMU K;  4OX9 K;  4B3R K;  1IBK K;  1HR0 K;  1HNW K;  4DR1 K;  4DR4 K;  3T1H K;  4JI8 K;  4DR6 K;  4X62 K;  4JYA K;  4CW7 B;  4DR5 K;  1IBM K;  4NXN K;  5IT9 O;  3OTO K;  4CVN E;  4JI0 K;  2HHH K;  1XNR K;  1IBL K;  4LF9 K;  2VQE K;  3J81 O;  4LFA K;  4B3S K;  4V19 S;  3J7A P;  4DV2 K;  4YY3 K;  5IWA K;  1N33 K;  3T1Y K;  5BR8 K;  4LF4 K;  3J7Y P;  2F4V K;  4DR3 K;  1J5E K;  4DV4 K;  2UUB K;  4DV3 K;  4LF6 K; 
#chains in the Genus database with same CATH topology
 1SKR A;  4QS8 A;  5AQF A;  4CEC A;  3G4S N;  2OTJ N;  1JL1 A;  4E89 A;  4M3Y A;  1ITG A;  4FWL A;  5KPR A;  2UXD K;  4DR7 K;  1TGO A;  2HND A;  1RT4 A;  2FLO A;  3W0L A;  1GLB G;  4KO0 A;  4CEB A;  1FKO A;  2NRV A;  2HHV A;  3L2U A;  4WQ5 A;  3PO4 A;  3TAB A;  1HNX K;  4ID1 A;  1YT3 A;  1BOT O;  1S1V A;  3ZSO A;  4B1W B;  3SAF A;  3SLC A;  3ZT3 A;  1LAV A;  4FLT A;  1NMN A;  5GIN A;  3UKR B;  4LSN A;  1XHZ A;  3OYD A;  4FWP A;  4BE0 A;  1BU6 O;  2G8W A;  3PIO L;  3ASM A;  4JI1 K;  1ZYQ A;  3V1O A;  3K5O A;  4J8F A;  4JI6 K;  1GLE G;  3MED A;  1HQE A;  4ELT A;  2FBX A;  1NU0 A;  3SQ2 A;  2OAN A;  4O4G A;  4XH5 A;  3J80 O;  5KQ8 A;  3VQ6 A;  1KVC A;  2A1S A;  5AQU A;  1P8Z A;  2B6A A;  2B4J A;  4IZ9 A;  2HHT A;  4FW1 A;  1KRP A;  3OS0 A;  5LY3 A;  1T8E A;  3SQ1 A;  2ASM A;  1RT5 A;  1TL1 A;  4GW6 A;  5GAE P;  3SK3 A;  3GBT A;  4IOC L;  3H3N O;  1M90 O;  3S3N A;  1QQO A;  1C0T A;  2V7Y A;  2IAJ A;  3ZSQ A;  1NJY A;  3P31 A;  2GV9 A;  4KRF A;  1J54 A;  3VGK A;  4CZL A;  1TVR A;  1OH5 A;  4DWI A;  1NGD A;  3C95 A;  1NGB A;  5HOO A;  4KV8 A;  4KB0 A;  4RW8 A;  3BGR A;  3LDS A;  4DS4 A;  4E7I A;  1VQN N;  3NGY A;  3NMU A;  5ELZ A;  1CZ9 A;  1JKH A;  4ILH A;  3TSQ A;  5EY4 A;  3QEV A;  3FLC O;  3AA3 A;  4BY9 C;  3AVF A;  4O44 A;  3C65 A;  1WNS A;  3VN5 A;  4JRQ A;  3DXM A;  4H0Y B;  1GLJ O;  2EX3 A;  4DV3 K;  1W0H A;  5HL7 L;  3MXM A;  1X3M A;  3LDP A;  1OVY A;  3DRR A;  4CIE A;  4NYN A;  1N5Y A;  2EHG A;  1NKB A;  1NGI A;  3ZSY A;  1S22 A;  3TI0 A;  2KLA A;  4JRP A;  3LAN A;  1CZA N;  5AQX A;  1BG3 A;  2O8B B;  2QWL A;  4DV6 K;  1EKE A;  2O8E B;  2KZZ A;  4DTR A;  4LH4 A;  4FSV A;  1NKC A;  3QIP A;  3MCA B;  4LF8 K;  4CF8 A;  4NB4 A;  1NJX A;  4R5P A;  3OS2 A;  4RWT A;  2CGK A;  4JK7 A;  3DRS A;  5EU7 A;  5CYM A;  4DV0 K;  3E9P A;  3O3G A;  3RSE A;  4E0D A;  1TK0 A;  4DSJ A;  3BF3 A;  3QEP A;  1C1C A;  1NLV A;  5AFU A;  1VRT A;  1K8A O;  3E01 A;  1LV5 A;  1KLM A;  1NWK A;  1QQM A;  1NK4 A;  2O8C A;  4CZH A;  3A5M C;  3EE9 A;  3RWU A;  3CCR N;  3KKS A;  2KKZ A;  3L0Q A;  2D0A A;  3HL8 A;  4CK3 A;  1V4S A;  1GOA A;  3LPU A;  3F73 A;  3FZL A;  3QEI A;  1IG8 A;  4CK1 A;  4GMJ B;  3F5T A;  1YHQ N;  4Z4C A;  1I94 K;  4F2R A;  2PFU A;  5JVG L;  4DTX A;  2XY8 A;  4YFU A;  4BE2 A;  4BWM A;  3AVI A;  4FWR A;  3VQQ A;  4I2P A;  3EL2 A;  5J2Q A;  1IJJ A;  2O8D B;  3AAQ A;  4IFE A;  3FFK B;  1NJI O;  1KFD A;  4X62 K;  3VER A;  4Z0U A;  3SQ0 A;  5J2N A;  4BR7 A;  3QNO A;  3K9J A;  1NGF A;  4ILJ A;  3TAP A;  4O8K A;  2ATQ A;  5EX5 A;  2I7N A;  3WXK A;  1SKS A;  5BN8 A;  3BEX A;  4HCC A;  4HTU A;  4DSI A;  3HJF A;  2P9L A;  4CZE A;  1OVQ A;  5AQS A;  3KK1 A;  5AQP A;  3KTQ A;  1QVF M;  4NCB A;  1WSE A;  2P9U A;  1BI4 B;  2WFB A;  4OPH A;  5EOY A;  1LWE A;  3HT3 A;  2W40 A;  4PHT X;  2Q0R A;  4ISF A;  1KTQ A;  3LAM A;  3DLK A;  2R7Y A;  3DAW A;  3R1X A;  1EQY A;  4CEA A;  4FK2 A;  1BWF O;  2BUP A;  1SL1 A;  3H45 C;  3ENO A;  2OZM A;  3SI6 A;  3H1Q A;  1MDU B;  3AA2 A;  2XY5 A;  1QS4 A;  3AO5 A;  3QFU A;  4BWJ A;  3MMV A;  2A6A A;  2OCE A;  3I33 A;  5LJW A;  3SJH A;  1YTA A;  4DV7 K;  4BQL A;  1JLQ A;  3IS9 A;  1T05 A;  3G25 A;  3HVT A;  3LM9 A;  5AQK A;  5AQG A;  3NHG A;  2ETJ A;  4DTU A;  3DRP A;  4E1N A;  2Z1H A;  3VEY A;  3OA9 A;  1QZ5 A;  3O1B A;  3WNF A;  1ESV A;  4DLG A;  3VEW A;  3DI6 A;  5F1X A;  3OYC A;  5J2P A;  3VES A;  3E9L A;  2BTF A;  1BGX T;  3CPE A;  5KGX A;  3VQ5 A;  3IDH A;  4BRI A;  4E3S A;  3VQB A;  3SBG A;  1DTT A;  1VSF A;  4X64 K;  5ADX A;  4DSL A;  3M8S A;  1JL2 A;  4W5Q A;  1X9M A;  3THW A;  1DKG D;  1Y97 A;  2QWQ A;  3AVA A;  3JAM O;  3OYN A;  4YNQ A;  1NJW A;  4PY5 A;  3NBP A;  3CJB A;  2P9K A;  4FWN A;  3MXI A;  4RW9 A;  3V9X A;  5AQL A;  5E41 A;  1T3V A;  4BG8 A;  1B92 A;  3SAH A;  1L3T A;  3QNN A;  4FWK A;  4JI8 K;  1VQ5 N;  4FWS A;  3SUP A;  1W2B M;  4KRE A;  1IBM K;  1QHA A;  1W7A A;  4WF9 L;  1P90 A;  3HP6 A;  1NK0 A;  3EYZ A;  4JN4 A;  1OKJ A;  3DLH A;  4LF9 K;  3H1V X;  4TSX A;  1L3U A;  4KHU A;  4FWO A;  1NGC A;  2IIR A;  4DV2 K;  3H6E A;  4BRH A;  3QDK A;  4RCH A;  4U7B A;  2DY4 A;  1EXQ A;  3J8A A;  3SUN A;  4MO4 A;  1J5E K;  5BPL A;  4K43 A;  3ZX3 A;  4FJN A;  2OTL N;  4WYB A;  1J53 A;  4QAG A;  1XQS C;  3DLG A;  4H0V B;  4CJ4 A;  5AZJ A;  1K8K B;  2P5G A;  1S3X A;  5I9E B;  2ZM6 K;  3VEZ A;  3CMA N;  3PY8 A;  5DM7 L;  3KWI A;  1YJN N;  3AY9 A;  3HI0 A;  4H5N A;  3DOL A;  4J2E A;  4H5T A;  4DUZ K;  2QA4 N;  1DEJ A;  4W5R A;  1NK9 A;  2HBL A;  1E4G T;  3SUQ A;  3ZT1 A;  1Q9Y A;  5AFU H;  2ASO A;  2E2O A;  4PKI A;  3H46 O;  5T7B A;  4QS9 A;  4M3T A;  1IH7 A;  3OVN A;  3VF6 A;  3TAN A;  3A0I X;  4HVJ A;  3KK7 A;  4OKK A;  2NRW A;  1O1W A;  4OJR A;  4B1X B;  4RTF D;  1WBD A;  5DM6 L;  4YOU A;  3ULE A;  3OYA A;  3V9W A;  4GV6 A;  2D5R A;  3R8E A;  2Z1G A;  4JKE A;  1UWB A;  4EHU A;  3RMB A;  4IOA L;  1RBR A;  1N8R O;  4B9S A;  4X66 K;  2OPS A;  1JCE A;  4UQG A;  4OGE A;  1SAZ A;  2FF6 A;  1CXU A;  4B1V A;  3O9S A;  2QXL A;  3C7N A;  4I6M A;  1IO2 A;  4K8Z A;  1VRU A;  4FJ7 A;  3GL1 A;  3LL3 A;  1KD1 O;  3UE5 A;  3SCX A;  2YV0 X;  4FLY A;  3KWG A;  1L5U A;  5C0Y A;  1KAY A;  3BDP A;  4F3T A;  3S3M A;  3L2V A;  3J7A P;  1HYS A;  1ZBF A;  2HNY A;  4IOX A;  5C2D A;  1N33 K;  1Q86 O;  2HHU A;  4FZX C;  1KCF A;  4A59 A;  3CER A;  5AQV A;  3O9Q A;  3SQ4 A;  4JLH A;  2E6M A;  4IEE A;  4DSF A;  3O8M A;  4I7F A;  4B8A B;  4H0X B;  4KI4 A;  4E1M A;  4K42 A;  1QVG M;  4CBX A;  3OYE A;  5C15 A;  1T7P A;  4DV5 K;  4M3R A;  1NK8 A;  2YNF A;  1EO1 A;  5FRN A;  2Q36 A;  2W6K A;  2KHO A;  5KGW A;  2P9I B;  2YX6 A;  1A5W A;  4AM7 A;  2G8K A;  4FK4 A;  2ITG A;  2YI1 A;  1KVB A;  2FBY A;  3CQ8 A;  2PYJ A;  1VQ9 N;  1R59 O;  4GKK K;  4IG3 A;  4M41 A;  4FL9 A;  3K5N A;  3O9T A;  3TU5 A;  4KHQ A;  2HF4 A;  2ZWH A;  3J7Z O;  4LF7 K;  1U6Z A;  4CJU A;  2E2P A;  1BQN A;  4OKJ A;  4JV5 K;  4BG9 A;  3MEE A;  5ADX H;  1HNI A;  5BRF A;  1HYV A;  3DXM B;  1ATR A;  1SZ2 A;  1V4T A;  1RDD A;  3AO1 A;  2YJF A;  4B9M A;  2P5O A;  2Y1I A;  1HMV A;  1BO5 O;  3L2W A;  4B9U A;  4XEI A;  1RT2 A;  5FPE A;  3CD6 N;  5CR4 A;  1TL3 A;  1UAX A;  3ID6 A;  1WLJ A;  4MDB A;  1GLC G;  1U49 A;  4BC2 A;  3DLR A;  3EZW A;  2KTQ A;  3WQT A;  3AA4 A;  3D2F A;  2P9P A;  1RDA A;  4CVN E;  1C0G A;  4B1Y B;  3TAR A;  1IV0 A;  4FJG A;  3KVG A;  2A42 A;  3QIO A;  1NMD A;  3HYF A;  1VSD A;  4JHD A;  2OA8 A;  2O8F A;  4C8M A;  5FRO A;  2QWR A;  3OYJ A;  4CFC A;  4DFP A;  3CF5 L;  4JKH A;  3V1R A;  3MWP A;  1UA1 A;  3OYM A;  1LCU A;  3ZYY X;  4M42 A;  3QML A;  4N76 A;  4FZZ A;  3J7Y P;  5M1P A;  5M1F A;  3AVN A;  4LC9 B;  3QEW A;  4YDU A;  1VQ4 N;  4YOY A;  4Q0B A;  4BVP A;  2UU9 K;  3S41 A;  4OLA A;  3NGI A;  4L8R B;  1RBS A;  2X6N A;  2E2Q A;  4MO5 A;  1LW2 A;  4AQY K;  4CE9 A;  5HRO A;  4NLB A;  1TUY A;  1KC8 O;  1RT3 A;  2HMI A;  3CC4 N;  2HHX A;  4CJS A;  4L3Q A;  3L4I A;  3I8D A;  4KH4 A;  3HBT A;  4FYD A;  2I7P A;  5B8H A;  4DR2 K;  2QWP A;  4ID5 A;  3PUF A;  2YNI A;  2NRR A;  1KAX A;  5HLF A;  3TTD A;  5C12 A;  3JSM A;  4AHR A;  2NLX A;  2YHY A;  3LAL A;  4CI6 A;  4DTS A;  3VQP A;  2HF3 A;  4JD2 A;  5AQT A;  1RDC A;  5KPZ A;  4PL8 A;  1Q7Y O;  1OH8 A;  4WFB L;  3D0P A;  1RDU A;  5AQH A;  4AF1 A;  2P9U B;  4CF9 A;  4IJN A;  4AM6 A;  3HOT A;  4DV1 K;  3D6R A;  4BRM A;  3ZSR A;  4BR4 A;  1Q81 O;  3OJS A;  4M7X A;  4FOE A;  1OH6 A;  2E20 A;  1W97 L;  4CD1 A;  3DXK B;  4CJQ A;  1BDG A;  4FJX A;  3FZK A;  4FJL A;  1HLU A;  4FWM A;  3TWH A;  3WNG A;  2D4W A;  4M3U A;  5LMU K;  5GIP A;  3MDQ A;  4FLV A;  4E1J A;  1HR0 K;  4B9Q A;  3BUZ B;  5HP1 A;  3DM2 A;  3P4I A;  4BE1 A;  3ATV A;  5FPM A;  5C42 A;  4DKW A;  1TYQ A;  3F2K A;  3HXM A;  3KLH A;  2VG5 A;  2YHX A;  3L4Q A;  1BIZ A;  4KB1 A;  2E88 A;  4CJP A;  1J6Z A;  3OYF A;  2QW9 A;  3VA0 A;  3Q7B A;  4O0J A;  4W5T A;  1U2V A;  5AZI B;  4FO0 A;  4CEO A;  3AO2 A;  4XIU A;  4A62 A;  4G9Z A;  4YY3 K;  3CQY A;  1YF5 L;  3CCV N;  2A41 A;  4OVL A;  4M63 C;  2D0O A;  3OYH A;  3IUC A;  2ZJP L;  3THY A;  3THW B;  3T1A A;  3KIO A;  4BR9 A;  1NK5 A;  3M5R A;  4LFC K;  4FJK A;  4C8K A;  5EXW A;  2P9K B;  3U3G A;  4NO7 A;  4BRQ A;  1C0F A;  1T44 A;  2OPQ A;  2UYT A;  3AVC A;  4GKJ K;  4DQS A;  1BUP A;  2ZQB A;  3PX4 A;  2HBK A;  3K9K A;  4AHT A;  4EIA A;  3G0Z A;  4OPK A;  3VEN A;  2CGJ A;  3RMD A;  2Q0U A;  1YVU A;  3U3Y A;  1KXP A;  2BAN A;  3T7Z A;  3EN9 A;  3AVK A;  5EVZ A;  3V9S A;  1Q18 A;  4KH6 A;  2GBZ A;  1T03 A;  4JI4 K;  3A5O C;  1QQN A;  1RTJ A;  1VAZ A;  1VSK A;  2P9S B;  3CCM N;  4NCG A;  3ENH A;  1JLE A;  1JLF A;  4B9L A;  3CJ1 A;  2FSJ A;  3HOS A;  1RDB A;  4OPA A;  3EKU A;  4RW7 A;  2GEL A;  3RTV A;  4NYF A;  5AR0 A;  1N34 K;  4FM2 A;  3SAG A;  1I3A A;  5AZJ B;  3VQD A;  3VGM A;  3SJJ A;  3ZT0 A;  2Q2R A;  1HNW K;  5AQI A;  4J2D A;  3LM2 A;  4DR4 K;  4A5B A;  3T1H K;  4C8N A;  3IKM A;  3RR7 A;  3CXC M;  2VGM A;  2YHB A;  4CW7 B;  4Y1D A;  5E26 A;  3TAQ A;  5IT9 O;  5MLC Q;  3EY1 A;  3CC7 N;  4JKD A;  1XNR K;  4KTW A;  1C1B A;  2J4R A;  3AVB A;  3UKU A;  2D0C A;  3WQU A;  4Y1C A;  1RBU A;  3N4P A;  4KTQ A;  2E1Y A;  5BRE A;  3ZT4 A;  3VQ9 A;  3LPT A;  3WT0 A;  3ZT2 A;  3NVM A;  3UB5 A;  3NF8 A;  5IWA K;  1HKB A;  1WSH A;  3NFA A;  3QLH A;  1Q82 O;  3VQE A;  3T1Y K;  3AVG A;  5JS1 A;  3ZX2 A;  3ULE B;  1NM1 A;  4B9T A;  4BRG A;  2UUB K;  4MDA A;  4CHP A;  2KFZ A;  1WSF A;  3ZEU A;  5HRR A;  1HKG A;  4E7H A;  3CJ9 A;  3K5L A;  1VQO N;  4I9L A;  4WE1 A;  2AJQ A;  1ZBI A;  1BCM A;  1JLG A;  2IOC A;  5TKY A;  2BE2 A;  1N32 K;  1DT9 A;  4CEZ A;  3MEC A;  3SMP A;  1KLN A;  4KTZ A;  4B3M K;  3C7N B;  2HMP A;  4Q5V A;  1QTM A;  4FJI A;  1X3N A;  5DMR A;  3F9M A;  3VET A;  4DTP A;  4KHN A;  1Z25 A;  4ISE A;  2HVH A;  1YUW A;  2V7Z A;  4NXM K;  3T3F A;  5C25 A;  4CZM A;  3QFP A;  3G6E N;  4WQ5 C;  4CIG A;  1HPZ A;  4I2Q A;  1YJW N;  1NG9 A;  1ILY A;  4JI3 K;  3QIC A;  1RDW X;  4LFB K;  3C0B A;  2XRI A;  4LH5 A;  3LWL A;  1E3M A;  2OPP A;  1I39 A;  2UUC K;  4O5B A;  2Q97 A;  3KLF A;  3JYT A;  1JJ2 M;  1YIJ N;  4FLX A;  4JI7 K;  3NDK A;  4B9V A;  1DGK N;  4WFN L;  4F3O A;  3I55 N;  3E1Y A;  3K59 A;  3UKR A;  4CGF A;  4CGD A;  3R3L A;  5AQJ A;  3VF2 A;  1W9H A;  2XO7 A;  2IGI A;  3P38 A;  1S5J A;  1E4F T;  2X6S A;  3AVL A;  5D3G A;  2YHA A;  4KHY A;  4JYA K;  2FBT A;  3NF7 A;  1G99 A;  2YNH A;  4A61 A;  1JXE A;  4GV3 A;  4CER A;  1SV5 A;  2P1J A;  2IS3 A;  1C0U A;  3RRG A;  4RG8 A;  3VF4 A;  4PKG A;  3VQA A;  4QCL A;  4FJH A;  3V81 A;  3KKR A;  2WBN A;  3WXJ A;  3OS1 A;  2QWM A;  1VSJ A;  1HNZ K;  1JXB A;  1RBT A;  3O4Q A;  4MQ3 A;  3M3Z A;  1NKE A;  3EKS A;  2QWN A;  4Y0W A;  4WQ4 A;  2UUA K;  2CGL A;  5SZT A;  1SQK A;  3LDN A;  4CGH A;  5GIO A;  3OHR A;  1LAW A;  1F21 A;  1XMQ K;  3ZET B;  3O5B A;  3PV8 A;  3CCL N;  1KQS M;  5FPN A;  5GAG P;  2KQ2 A;  3BP8 A;  3GG4 A;  3PLA A;  2O4G A;  5CE3 A;  2O8B A;  3EO3 A;  3T19 A;  1RT6 A;  3V9Z A;  4ZTF A;  5BPM A;  3TAE A;  4FZY A;  4N41 A;  4KFB A;  1YXQ A;  3QBX A;  5CZ1 A;  4CJR A;  3HVR A;  5FDL A;  3WXL A;  3KJV A;  2E6L A;  1SL2 A;  5M1Q A;  4BC3 A;  4M3X A;  1C6V A;  2W6L A;  1NGA A;  4BDP A;  5E84 A;  1XNQ K;  1ZXO A;  5KPT A;  2Q3S A;  4CJV A;  1HRH A;  4HUF A;  4DQP A;  2XY7 A;  3VEO A;  4Z94 A;  4F9O A;  3TSP A;  2GWJ A;  3VQ4 A;  4I9Q A;  4HTL A;  1EX4 A;  1SUQ A;  4OKE A;  1NNE A;  4FPA A;  4M3W A;  3KD5 E;  3SV3 A;  3HPG A;  4CHO A;  3LP2 A;  2GEM A;  1NOY A;  4GNI A;  3AAP A;  4KH5 A;  4KHS A;  2HHW A;  1D5A A;  1ATS A;  1RGI A;  3AVM A;  5FPD A;  4JD2 B;  3CPW M;  1TKD A;  2PZS A;  5F0X A;  4LFA K;  3O4W A;  4IO8 A;  4KKO A;  4LD0 A;  3OYB A;  3L2R A;  2WTU A;  2QI2 A;  3FZF A;  4FPB A;  2DTU A;  2O8D A;  4IFV A;  2O4I A;  2ASP A;  1IKX A;  3WNH A;  4FCY A;  4CHN A;  5BN9 A;  2F4V K;  4DR3 K;  2JGU A;  4BRK A;  3VTI A;  3K58 A;  5K14 A;  5KRT A;  2XY6 A;  1ASU A;  1TK5 A;  4CEE A;  4DLE A;  4BR2 A;  4BAC A;  2W41 A;  3OY9 A;  3THX A;  2YCH A;  4MLE A;  3VOV A;  4M7Y A;  3MN6 A;  1BA0 A;  2VG6 A;  1GLF O;  1NOZ A;  1HX1 A;  1VSH A;  1LW0 A;  1JLB A;  1TYQ B;  3CQX A;  1HNV A;  3LDO A;  4DUY K;  3V4I A;  3K57 A;  3OBY A;  4QOZ B;  2UXB K;  1S9E A;  5CY4 A;  2BGG A;  1DTQ A;  4B1Z A;  3O3H A;  2XHB A;  4Z4I A;  1VQL N;  2IC3 A;  4AH9 A;  2E5L K;  4AHC A;  3I56 N;  1YTU A;  4AHS A;  3M1F A;  4W5O A;  4KHP K;  4DFJ A;  3RVC A;  2QKK A;  1D9F A;  2G8H A;  3SZ2 A;  3GE1 A;  3AAR A;  1WUA A;  1YVN A;  3ZSX A;  3THY B;  2H3G X;  3MXJ A;  4DTM A;  3CFP A;  3WUH A;  3FFI A;  4CF1 A;  4A2A A;  3IG1 A;  3TPQ A;  4H5R A;  3TTF A;  1YI2 N;  1KSP A;  2V52 B;  1A5V A;  3B8A X;  2HNZ A;  4FJM A;  4JK9 A;  1FKP A;  4IKF A;  4RW4 A;  5KRS A;  3ENB A;  3KD1 E;  1JCG A;  4CJ7 A;  3LZJ A;  1LWC A;  3L2Q A;  4DFK A;  4NXN K;  3M8P A;  5AQM A;  1ZBS A;  4BRL A;  1M1K O;  3IMX A;  3PX6 A;  2HW3 A;  3OJU A;  1HPM A;  1Z05 A;  5HRP A;  4K8X A;  4ELV A;  3HPO A;  4CJL A;  4JKG A;  4IDK A;  3VQC A;  5BR8 K;  3ZLJ A;  5C10 A;  3LWM A;  4OO1 J;  3A8Y A;  2RKI A;  5HBM A;  3VGL A;  1ZBH A;  3FZM A;  3MN7 A;  4KHW A;  3RSE B;  2ZGY A;  2RPI A;  1VHX A;  4O0I A;  3C6A A;  3H3O B;  1BIU A;  3KK2 A;  2AP1 A;  3BZK A;  2O8C B;  3MCP A;  2G8V A;  4CF2 A;  3ITH A;  4M45 A;  3SMS A;  3E9O A;  4ILG B;  3F9K A;  3ALY A;  3I8B A;  5JS2 A;  1Q9X A;  4JEP A;  3VQ8 A;  3ZSW A;  4H5V A;  2ZE2 A;  4F8R A;  3H08 A;  2HBM A;  1IKW A;  4IO9 L;  5SWM A;  2FSN A;  2GUP A;  4BQZ A;  4KAZ A;  2P9N A;  3D2E A;  1NBW A;  3OYL A;  2E2N A;  2NRX A;  3ZEU B;  4ELU A;  3RR8 A;  3AO4 A;  3QO9 A;  4FJ9 A;  4U67 L;  2Q1N A;  4CED A;  4B3T K;  3IAY A;  4JKF A;  3GDQ A;  3LDL A;  2P9L B;  4Z4E A;  1IKY A;  1S6Q A;  2HVI A;  4FJ5 A;  4EAH D;  4Z4G A;  3B6O A;  2X74 A;  1HYZ A;  5I3U A;  4ZTJ A;  3ZX0 A;  3KHY A;  1GLL O;  3U4L A;  3CJA A;  3MN5 A;  1D9D A;  1RTI A;  4JKB A;  4EZ9 A;  3NH0 A;  3NGZ A;  5FRM A;  2FXU A;  5DK5 A;  1X1P A;  3KK3 A;  2ZJR L;  3HST B;  3O6W A;  2BDP A;  2NRZ A;  3QBW A;  5CYQ A;  1WSG A;  2G8U A;  4B8C A;  5I42 A;  3VEV A;  4BRA A;  1Z26 A;  3DLE A;  4DV4 K;  3MAQ A;  3NF6 A;  3AVH A;  4Z4F A;  1IKV A;  5HRN A;  2VQF K;  5LL6 Z;  3FE1 A;  1JLA A;  4XH4 A;  3A2F A;  4G1Q A;  2F9W A;  2ZD1 A;  3CC2 N;  1EET A;  1J5O A;  2DPN A;  4PL7 A;  2OPR A;  3O80 A;  1TKZ A;  3K2P A;  2WOM A;  1L3S A;  1ZC6 A;  2B5J A;  4CBW A;  5M1N A;  4FJ8 A;  4JI5 K;  3DLL L;  4EZ6 A;  4X65 K;  4CFD A;  4JAX A;  4BC5 A;  4O8U A;  3HP9 A;  4CZG A;  1SKW A;  3WXI A;  4A5A A;  1QQC A;  2RF2 A;  3B6P A;  1EWR A;  1EP4 A;  2VGN A;  1YAG A;  3O3F A;  1BHL A;  1ASV A;  4JI2 K;  1VQK N;  5FLX O;  2A1R A;  3CM6 A;  3CHW A;  5AQY A;  5KTQ A;  1XC9 A;  2P9I A;  4DQI A;  5LJV A;  4HHT A;  4CJ3 A;  4C8O A;  3ATU A;  2ZF5 O;  2Q31 A;  3SYZ A;  1L3V A;  1WSI A;  5JMV A;  1BA1 A;  2WUS A;  3O4N A;  2D0B A;  4DHY A;  2ZJQ L;  1REV A;  3NE6 A;  2JLE A;  4ICL A;  4OX9 K;  2YKM A;  4IEI A;  1IBK K;  1TK8 A;  2HB5 A;  1KVA A;  1S1U A;  1WBB A;  3I0R A;  4HUE A;  3VQ7 A;  1JCF A;  4CF0 A;  1QSL A;  3MX2 A;  1NK6 A;  4IJA A;  2FF3 B;  4EHT A;  3V6D A;  4OGC A;  2QEX N;  3KLG A;  1UOC A;  4CJK A;  3DWL A;  3I0S A;  5CZ2 A;  3NH1 A;  3TTC A;  4CES A;  1FXX A;  2P51 A;  3O08 A;  4YOT A;  3L3V A;  1WSJ A;  1EWQ A;  1NGH A;  2GUI A;  2Y1J A;  1XI1 A;  2QTD A;  1SS6 A;  2VWB A;  3T69 A;  4DU1 A;  3WEE A;  4CCH A;  1VQ6 N;  4FM0 A;  3PIP L;  3O1W A;  3CJ7 A;  1MWM A;  4FJJ A;  3M8R A;  4C8L A;  4IDH A;  3RMC A;  3HM8 A;  3SPY A;  1VSM A;  4YDU C;  3U9D A;  3BY5 A;  2WON A;  1DLO A;  4BR5 A;  4C23 A;  1MWK A;  4FW2 A;  3CFR A;  4CJT A;  3THV A;  2E1Z A;  3SNN A;  5BPN A;  4E19 A;  3WXM B;  2VG7 A;  3U6F A;  4GV9 A;  3QB0 A;  4DS5 A;  5AQR A;  4ZHR A;  4CZI A;  2I5J A;  3HTV A;  1MU2 A;  4CJW A;  3KZB A;  2NRT A;  3TAF A;  2HST A;  4JNE A;  3EE8 A;  1VQP N;  1TKT A;  4GVE A;  1A5X A;  4I6M B;  3AGR A;  3KLE A;  4H0P A;  1X9J A;  4OLB A;  4CGJ A;  2A40 A;  2FC0 A;  3OBW A;  3THX B;  4IFY A;  4DMN A;  2HBJ A;  2OZS A;  2JWK A;  4YOX A;  3CME N;  5F2R A;  4IG0 A;  2KW4 A;  3HZ6 A;  5TKW A;  3LDQ A;  2VYP A;  1BL3 A;  2F9T A;  2NNW A;  5AQQ A;  5H1S Q;  2D0P A;  4IBN A;  2CH5 A;  3K5M A;  1KFS A;  2IVO A;  4BDY A;  4DR5 K;  3CM5 A;  1S6P A;  1WB9 A;  3C94 A;  1K6Y A;  3S3O A;  4BGB A;  3CG7 A;  4LY7 A;  3DXK A;  1TV6 A;  2VWJ A;  2QK9 A;  3D45 A;  2YHW A;  3L8B A;  4ISG A;  1R0A A;  4F4K A;  4CZF A;  4DU4 A;  4H5W A;  1MA9 B;  4DCH A;  3OYK A;  1S9G A;  1T6D A;  1Q8I A;  3EZ5 A;  5CHI A;  2QM1 A;  3P1G A;  1X9S A;  2A3Z A;  3HRG A;  2F96 A;  1QZ6 A;  1RTH A;  3TAM A;  4A57 A;  3U8X A;  4FM1 A;  3QER A;  3IRX A;  4CHY A;  3M6G A;  2QWO A;  3VMF B;  4BRE A;  4CBU A;  3LZI A;  1HJO A;  5AZI A;  2VCP A;  3TSU A;  3CCJ N;  4R79 A;  4HUG A;  4FK0 A;  3CCU N;  1VSL A;  4CJ5 A;  5AQW A;  5AQO A;  4DTO A;  4O55 A;  3RMA A;  1QSS A;  3BZC A;  5GAH P;  1NK7 A;  3CCQ N;  1U4B A;  1K73 O;  4E7K A;  1RTD A;  4PKH A;  1ZBU A;  1FJG K;  1RFQ A;  3CFO A;  1S72 N;  1T6C A;  5JVH L;  4JK8 A;  4K0K K;  3MK6 A;  4MLH A;  1TAU A;  4EP4 A;  2W42 A;  4CFB A;  4W5N A;  5J2M A;  3V1Q A;  2Z1I A;  4JKG B;  3AVJ A;  5AJ3 K;  4CZJ A;  1BQM A;  3DYA A;  4PA1 A;  2QXF A;  4JKC A;  5M1K A;  3OYI A;  2GX9 A;  2IVN A;  3O9R A;  4CHZ A;  3D2F B;  3NF9 A;  2NUB A;  2P9P B;  1WOQ A;  4FLW A;  4FVU A;  4KI6 A;  4YHH K;  1TAQ A;  3P5J A;  3FGU A;  4BVO A;  1RIL A;  1G15 A;  1OH7 A;  1C1A A;  2GTD A;  1U48 A;  2KZM A;  2UXC K;  1O13 A;  4JHD B;  4FVM A;  2O8F B;  5BRH A;  2F8T A;  2RHK A;  4B1U B;  1FK9 A;  4AHU A;  2P9S A;  4B3R K;  2E8A A;  1HJR A;  3L6Q A;  2O8E A;  2YNG A;  5BRD A;  3PO5 A;  4YOR A;  1XUP O;  4BDZ A;  1VSE A;  1N6Q A;  3G10 A;  3R9P A;  4PWD A;  3DJC A;  2V51 B;  3P39 A;  4M3Z A;  3IFR A;  2HHS A;  1ZBL A;  3OTO K;  4YOW A;  4BR0 A;  4JI0 K;  2HHH K;  1K9M O;  3MN9 A;  2PY5 A;  1IBL K;  3D7E O;  5KI6 A;  5BR9 A;  2DFH A;  1NJZ A;  3FZH A;  1SL0 A;  4V19 S;  4N56 A;  4DTJ A;  4B9N A;  1UA0 A;  1KAZ A;  3M8Q A;  3K0S A;  4IWV A;  4AIL C;  4B08 A;  3WNE A;  4BC4 A;  3R6M A;  2P9N B;  3D2E B;  1BIS A;  1VQ8 N;  4LF6 K;  4MFB A;  2A5X A;  4WFA L;  4J2A A;  2YJE A;  3SPZ A;  4DB3 A;  3SV4 A;  3CYM A;  1QSY A;  3RRH A;  4NCA A;  2BH1 A;  4RW6 A;  1WN7 A;  3Q7C A;  4CJE A;  5C2F A;  3LP3 A;  3CCE N;  2KFN A;  3JS6 A;  1VK0 A;  1JLC A;  4BRN A;  1C0M A;  4CEF A;  4UY8 O;  4JS4 A;  1BCO A;  1CXQ A;  2X78 A;  3HM9 A;  4FWQ A;  2PYL A;  4BRD A;  3NAE A;  4NLC A;  3A5N C;  4DQR A;  2YKN A;  1HUX A;  2CH6 A;  2Z1J A;  3ISN C;  4CGG A;  1H1V A;  5JLF A;  1U04 A;  4H4M A;  1IG9 A;  5GAD P;  4LF5 K;  2DFE A;  4PQU A;  5AQN A;  1D8Y A;  3CI5 A;  4J2B A;  4A2B A;  2HOE A;  1RCH A;  4E7J A;  5JLH A;  2QKB A;  1HKC A;  3MEG A;  1XHX A;  4WCE L;  1NGE A;  4DQQ A;  2DFF A;  1BI4 A;  1VSI A;  1RNH A;  2VWK A;  1RBV A;  3C6T A;  4CFA A;  4YOV A;  4DSE A;  1LWF A;  4H0O A;  4CHQ A;  1U2V B;  3P83 D;  3ZCM A;  1VQ7 N;  4H4O A;  1U45 A;  2ZGZ A;  4DR1 K;  1GOC A;  3EEQ A;  4DR6 K;  4KBO A;  1QHT A;  4CJF A;  2HHQ A;  3PSI A;  1XC3 A;  4JKA A;  2LSN A;  2PAV A;  4N5S A;  3VTH A;  3NVK A;  4IXC A;  3ULD A;  1S1X A;  3NCI A;  4DQ8 A;  2PBD A;  3QEX A;  3S9H A;  2VQE K;  3J81 O;  4B3S K;  5M1O A;  3HSC A;  2E4L A;  2G8I A;  3VA3 A;  4DF4 A;  3PX0 A;  1HQU A;  1YJ9 N;  5HRS A;  2F7T A;  3HK2 A;  1RT1 A;  2NZT A;  4JS5 A;  1J9A A;  3C6U A;  3ZSV A;  1XMO K;  1NGJ A;  1CLQ A;  1U47 A;  3DMJ A;  3KLI A;  3VPZ A;  4E7L A;  1CZB A;  1Z6R A;  1RT7 A;  1Y64 A;  2FSK A;  4DTN A;  2RE2 A;  1XWL A;  5C24 A;  3AV9 A;  2RN2 A;  4DFM A;  4BRO A;  1S1T A;  1N36 K;  3DOK A;  5J1E A;  1WAJ A;  2EWS A;  4EP5 A;  3BF1 A;  3AA5 X;  3SBT A;  1X9W A;  3AGK A;  2OYQ A;  4DU3 A;  2D1K A;  5A2Q O;  3JXU A;  4AHV A;  3W3D A;  3NH2 A;  4WQ4 C;  3QIN A;  3MX5 A;  4KPY A;  3TAG A;  4CD3 A;  4PUO A;  3OW2 M;  2NRH A;  4CZK A;  4BRF A;  4BRP A;  1GOB A;  1LOT B;  3ZSZ A;  4FOI A;  2ITM A;  2IVP A;  1ATN A;  4CK2 A;  3O9U A;  4OPJ A;  4BRC A;  5JIC A;  1VQM N;  4DSK A;  4C1N I;  3G71 N;  3CJC A;  1NGG A;  2G8F A;  1FW6 A;  3SUO A;  3LP1 A;  4DF8 A;  3ZET A;  2IDO A;  3LP0 A;  4F2S A;  3WEE B;  4EFH A;  4HCB A;  4H0T B;  3QET A;  3PSF A;  3CET A;  4B3O A;  2FBV A;  5LMN K;  3UKU B;  4HWI A;  4GVM A;  5KQD A;  2F8S A;  1K8K A;  3ID8 A;  1B9D A;  2GWK A;  2JWL A;  4Z4H A;  1GLA G;  4H8K A;  1YIT N;  4FXD A;  3UIQ A;  4O5F A;  3GOI A;  4N47 A;  3U9Z A;  1GLD G;  3QES A;  4FLZ A;  3L3U A;  3CIP A;  1TKX A;  3HPH A;  2AA4 A;  4LSL A;  4K41 A;  3A5L C;  4C1N K;  3CCS N;  3OYG A;  4H03 B;  4DG1 A;  1D4X A;  5AQZ A;  3AO3 A;  4CEQ A;  4K25 A;  3FR0 A;  3V9U A;  1S1W A;  4QS7 A;  3HO1 A;  4GY2 B;  1ASW A;  3VEX A;  4CIF A;  3N4Q A;  3LAK A;  3DLB A;  4FLU A;  1QE1 A;  3C6H A;  2WC9 A;  4CGI A;  4LF4 K;  3TR8 A;  3E66 A;  3MWT A;  1B9F A;  1TUU A;  4XH1 A;  1WAF A;  4BGA A; 
#chains in the Genus database with same CATH homology
 2UU9 K;  4LFC K;  2VQF K;  5LL6 Z;  1HNZ K;  4AQY K;  1N32 K;  2ZM6 K;  4GKJ K;  2UXD K;  4DV5 K;  4DV6 K;  1N36 K;  2UUA K;  4DR7 K;  4JI5 K;  4B3M K;  4X65 K;  4LF8 K;  4DV7 K;  1XMQ K;  4DR2 K;  5A2Q O;  4DUY K;  4DUZ K;  2UXB K;  1HNX K;  1FJG K;  4NXM K;  4LF5 K;  4DV0 K;  4GKK K;  4K0K K;  2E5L K;  4JI4 K;  4JI2 K;  5FLX O;  4LF7 K;  4JV5 K;  4KHP K;  4JI3 K;  5AJ3 K;  1XMO K;  4X64 K;  4JI1 K;  4DV1 K;  4LFB K;  4JI6 K;  2UUC K;  4YHH K;  1N34 K;  3JAM O;  5LMN K;  4JI7 K;  3J80 O;  1XNQ K;  2UXC K;  4B3T K;  1I94 K;  4X66 K;  5LMU K;  4OX9 K;  4B3R K;  1IBK K;  1HR0 K;  1HNW K;  4DR1 K;  4DR4 K;  3T1H K;  4JI8 K;  4DR6 K;  4X62 K;  4JYA K;  4CW7 B;  4DR5 K;  1IBM K;  4NXN K;  5IT9 O;  3OTO K;  4CVN E;  4JI0 K;  2HHH K;  1XNR K;  1IBL K;  4LF9 K;  2VQE K;  3J81 O;  4LFA K;  4B3S K;  4V19 S;  3J7A P;  4DV2 K;  4YY3 K;  5IWA K;  1N33 K;  3T1Y K;  5BR8 K;  4LF4 K;  3J7Y P;  2F4V K;  4DR3 K;  1J5E K;  4DV4 K;  2UUB K;  4DV3 K;  4LF6 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...