3MEEA

Hiv-1 reverse transcriptase in complex with tmc278
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords p66 Reverse transcriptase
total genus 155
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3meeA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3meeA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3meeA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3meeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3meeA05
2VG6B 2G8HA 5I3UB 4FJIA 1L3SA 4B9VA 1BISA 3WNFA 3D5MA 5SWMA 3GV5B 4O44B 3QLHB 1RYRA 4O5BA 4K4WA 3DLKA 1LWFA 2CKWA 1LW0B 5KFNA 3DOKA 5CYMB 4PY5A 3CFRA 4KAZA 1QS4A 1HNVB 5T14A 2E9RX 4FVMA 1QQCA 1RT6A 4CGIA 3V9SA 1Z4UA 2FLLA 3IG1B 3AA5X 3WNHA 1D1UA 1NHVA 2X6NA 4OLAA 4DTUA 3NL0A 3MFIA 4EBDA 1RYSA 1C0UB 3L2RA 4W5QA 2JC1A 2EHGA 3RB6A 1C0MA 3HSTB 3KK3A 3VN5A 2RN2A 3S3OA 4ZMMA 1HMVB 1XR5A 2HNDA 4ECWA 4CHOA 1TKZB 5HRPA 4EZ6A 1S48A 3D45A 4E1NA 3M8QA 2VG5A 2AX0A 1BIZA 3TAMA 1DLOB 3C95A 3V1QA 3S3MA 5KT6A 5HLFB 1ZBLA 1IKVA 1EETA 4RNNA 3AVCA 4FJGA 3HP9A 1YT3A 3MXMA 1HRHA 3M8SA 3DRRB 1A5XA 3G6VA 1VSEA 1FKOB 3H4DA 2FJWA 1GOBA 3B6PA 3SJJA 4R0EA 1KFSA 1C0UA 3PUFA 1T03A 1B9DA 5L1KA 4AHCA 1EETB 3MR6A 2X78A 4EYIB 3ZSXA 4KB1A 3OJSA 3GQCA 1RTJB 3QGGA 4ZTJA 2LSNA 3K58A 5HP1B 5HROA 3P5JA 5KFXA 2FLPA 3OL6A 3V6KA 1R0AA 2IJNA 3RB4A 3OSNA 4FJ5A 3TVKA 4DTXA 1NK9A 4CJEA 4OPJA 4Y2CA 2J6TA 2WHOA 5DQIA 4ICLA 4J2AA 2IOCA 1NNDA 3IAYA 5I3UA 4RW6B 4HUEA 3BSCA 2HVIA 4F4WA 4CJUA 1SH3A 5F8JA 2AU0A 3SPZA 1LW2A 2DFFA 3V4IB 2VG7B 3TAPA 1Q9YA 1QHTA 4RW6A 3PJXA 3DOKB 1CSJA 3LPTA 1KLNA 5KFPA 3DI6A 5KFRA 1VK0A 4CFDA 3G6XA 1IKVB 4LD0A 4BDYA 3TQ1A 5DQHA 5HLFA 1S1XB 4IH6A 4IOBA 4WFYA 4CEEA 4RUCA 4B9NA 1JXEA 4ELTA 3ICLA 1G15A 4QAGA 3RBEA 4DQRA 1WN7A 2C2EA 1HMVA 4WYWA 1S0OA 4RNMA 2GUIA 2RPIA 4J9SA 5CZ2A 4DL2A 1ASUA 4IG0A 4DTPA 4DU4A 1S6QB 1S1UA 4M3UA 1WAJA 4BWMA 4MK7A 3KLVA 1NOYA 4MIAA 2XCPA 2OZMA 4HUGA 1N6QB 1NK0A 4CJQA 4N56A 3DYAA 5C5JA 3AVAA 5KT4A 4ID5B 1HARA 4CJRA 4I2QB 2IDOA 1VRTA 3LPUA 2OYQA 4IRKA 4BACA 5J2PB 4Y1DA 1BQMA 2V0NA 4NYNA 4Y2AA 4WFXA 4YR0A 1UA1A 2XHBA 3SPYA 2VG5B 2IGIA 4HHTA 4E7IA 4PA1A 1C1BB 2BDPA 3MEEA 4ELUA 3KK2A 2I5JA 4KE5A 3DLHA 2AJQA 3PW2A 4KHQA 5KG4A 5FDLB 3SQ0A 3NAIA 4XPEA 4DSEA 1S49A 3TI0A 1S1WB 3GIMA 3DRPB 4J9QA 3KOAA 2Z1HA 3RAXA 4TY9A 4DG1B 3LP1B 3ALYA 1D5AA 4PUOB 2GBZA 3BQ2A 4YQWA 4ICLB 5J2QB 4CJFA 3QYYA 3QGIA 3KLIA 5EWGA 3CJ2A 2D3UA 4WXOA 4OJRA 3TAGA 3VQBA 3T3FA 3F73A 4E1MA 4DL4A 3EY1A 1OS5A 4RUAA 4DWIA 3FQKA 3AVNA 3SI8A 2GIRA 4ECVA 4L8RB 4C8MA 1LWEB 2FJVA 3SV4A 1Q8IA 4JS4A 1QE1B 4CEAA 1SH2A 3RB0A 1GOAA 1ZTWA 1ZYQA 3O4NA 2XRIA 3ZSYA 3AA2A 2HHWA 4WZMA 2WRMA 3T5LA 3P1GA 1HQUA 5K14A 1K1SA 2YKMA 3T5JA 3DM2B 4KTWA 4OGEA 5KFTA 1RT4A 4J9OA 3LAMA 3I0SB 5I42B 4HKQA 3LP0A 1RNHA 2IC3A 1RTHA 3D0PA 3NF8A 4DL5A 5KFFA 3KHLA 1I6JA 3NHGA 2O4GA 4NCBA 3C6UB 3IG1A 3KJVB 3I5BA 1RTHB 1QUVA 3KK1B 4CHPA 2IM1A 3M8QB 1S1TB 3K57A 4JRPA 2W9CA 2YKNA 2P5OA 1IO2A 1QAJA 5KFQA 3MR5A 1KFDA 1IKYB 5CY4A 4Z0UA 4BE2A 5KG7A 4IFYA 5F9NA 4M45A 1K1QA 4U6PA 4OKKA 1L5UA 4B3OA 5KFYA 4HYKA 2E6MA 3Q8RB 3K5NA 3AVLA 3MEGB 3AVMA 2OPQB 2AGQA 1RT6B 4E89A 2CJQA 3NF9A 3ITHA 1JLQA 4FJ7A 3VQ5A 4N47A 3LDSA 1FK9B 2PZSA 5CYMA 5HBMB 1N56A 2UUTA 5KG2A 4CE9A 1IG9A 1RBTA 4UQGA 3QERA 1WSEA 4F2RA 2B6AB 4PWDB 1O1WA 5EWEA 3M9NB 4O3OA 3LP1A 1RCHA 3VQDA 1EKEA 3V4IA 1RT3B 3H5YA 4W5OA 5KFAA 4CF0A 4KV8A 4CIGA 1J53A 2VG6A 1N6QA 1S9FA 1DTQA 3VQ6A 3VQ9A 1Z26A 3MEGA 1J9AA 2ATLA 4JRQA 3DOLB 5KG5A 2HVHA 3UDLA 1GX5A 3QIPB 3KLGB 1RA7A 4ZPCA 5KFSA 1EXQA 3VA0A 3OYJA 3NGIA 4M3WA 3THVA 2UVWA 4PQUA 3O3GA 4M3ZA 4CJKA 1U45A 2DFEA 2R8GA 4I2QA 1RBRA 3G86A 2W9CB 3F9KA 5DQGA 5F8MA 3RMCA 1DTTA 3CO9A 3NFAA 3OYFA 3PW7A 4DLGA 3TABA 3C6UA 3CJ0A 3NAEA 5C42A 4QWCA 2IM2A 4CJ4A 4M3XA 3VQCA 5KT7A 4JV1A 3I0SA 4H4MB 5I42A 3CDUA 4LH4A 1RT4B 4FLUA 1RT7B 3MXIA 3HPGA 4CJ5A 3OYDA 4OLBA 3BREA 2ETJA 3QNNA 2BQRA 4ZP7A 2BRKA 1TAUA 1GX6A 3O4QA 3NF6A 4DQSA 4ZP8A 1W25A 4FK0A 1IKWB 1RTDB 1DLOA 3MAQA 3T5HA 2WOMA 1VRUA 3DMJB 1X9SA 1HYZA 4RW7B 5D3GA 2ATQA 2JEFA 3H08A 1TVRB 5HP1A 4OVLA 3ZSVA 3PZPA 4JV0A 3PW5A 4JLHA 2D0BA 3ZSZA 1JKHA 4RNOA 3QIDA 1RTIB 3ZT2A 4LQ9A 4MQ3A 4OKJA 4G3IA 3AA4A 2UVUA 3IRXA 4DTOA 2Z1GA 5KI6A 3SUNA 3H2LA 4PUOA 2ALZA 2XI3A 4NYFA 2XO7A 2BANA 3SQ2A 5JS2A 5FRNA 5KRSA 4C8KA 2HNZA 3NE6A 3V81B 4KREA 4DTSA 3BR9A 4C8LA 5KG6A 4AILC 1UWBA 4MKBA 4RW7A 1T05B 3DLKB 3VQEA 5KT3A 1D9DA 1C6VA 2WOMB 2X6SA 4DF4A 1NJWA 2JC0A 2UVRA 4GVMA 3NH1A 3O3HA 4F4XA 4ECQA 1TAQA 5KT5A 1T8EA 1TV6A 4QWDA 3N6MA 4CIFA 4KKOA 5KFWA 2R2UA 1QTMA 3M8PA 2IJFA 4CF8A 2IA6A 5DGAA 4GC7A 4K4XA 4CFAA 5L1IA 3BQ1A 4CJSA 2HHXA 5KTQA 3H40A 2FBVA 4HUFA 3OS0A 1RT2A 4ZPAA 4FBUA 4CGHA 2HHVA 3OS2A 4FLWA 3G6YA 3PHEA 3PX4A 1XI1A 3U3GA 1BQNA 3OHBA 3AVIA 1HYVA 3NBPB 2HMIB 4YR2A 3RB3A 1IM4A 1CLQA 2IMWP 3MEDB 3SCXA 3FDSA 2FBXA 2R7YA 1SH0A 3TAEA 2WCXA 1XWLA 3AVJA 2G8IA 3T5KA 3QZ8A 1TV6B 4Q8FA 1NK4A 1JLFB 4NCGB 1WSHA 1J5OA 1S6PA 3BGRA 4O4GA 4NRUA 1Q9XA 3FFIA 1SKWA 1XR7A 3LWLA 3SYZA 5JXSA 3QESA 2XCAA 4J2EA 3ISND 3PX0A 5J1EB 3UIQA 4DQPA 1KRPA 2B6AA 1QAIA 4PWDA 3AVHA 1T94A 4AHTA 2XWYA 2ZKUA 2RF2B 5KG0A 4NYZA 4M42A 3DLGB 1FK9A 5KFCA 2V9WA 4NCAA 5KFHA 1JXBA 5HROB 2BE2B 5F8GA 3RRGA 2BGGA 3G0ZA 1KVCA 1VSLA 4CK1A 5C25A 4MKAA 1REVA 3A2FA 3VQ8A 4EBCA 5CYQA 2B43A 4MK8A 1C0TA 4Q44A 1MMLA 3TWHA 1ASWA 3HO1A 1T03B 1U4BA 1YVFA 3MTKA 1HYSB 1SV5B 4ZVFA 2F8EX 1D9FA 1EX4A 3HHKA 2IAJA 3WNGA 4DTNA 3CVKA 5FRMA 4DFJA 3LANA 3KLFB 2OPRA 4J9RA 3V6HA 4KI6A 1Z25A 3AO3A 1XHZA 3KIOA 3QNOA 3I8DA 3DRRA 2KW4A 1BIUA 4J9PA 1S97A 1YTAA 4FJJA 2O5DA 4LQ3A 4IG3B 3GIIA 3HVTB 4RW4B 4E0DA 3L2VA 5KFDA 4B9SA 4ZP9A 4TYBA 4DSFA 1B92A 4K4SA 1IH7A 4NLOA 2KFNA 1WNSA 3PV8A 4NZ0A 4ECYA 1TKZA 3EZUA 4ED1A 3EYZA 1TKXB 4MFBA 2YNHA 3TAQA 3LP3A 2VA2A 3PW0A 4DLEA 1WNEA 1WAFA 3PR4A 2KFZA 4I9LA 3LP2A 3CYMA 4H4OB 4WYLA 4ED2A 3HVAA 5KG3A 4B9LA 4KHUA 4CFCA 3MECB 1S9EA 2B5JB 4DU1A 3CFPA 4FM1A 4K4ZA 4K4VA 3OL8A 1JLEA 4IH5A 3OYKA 3TR8A 3RMBA 4E7JA 1KLMA 5EU7A 4CESA 1JLBA 2OH2A 4GW6A 4M41A 3BQ0A 3IGNA 5DLFA 2XGQA 3FQLA 2VWKA 2IBKA 2R2SA 3MXJA 1KHWA 3K5MA 3KLIB 2E6LA 3IS9B 5KFKA 2ZQBA 3T19A 4GMJB 1VSDA 3OYIA 4C8NA 1JLGB 4TY8B 2DFHA 4R8UB 3OYBA 5HRSA 4Z4FA 2G8WA 2HNYA 2FVRA 3M9OB 3NGZA 3QZ7A 4I7FB 1ZBHA 3SZ2A 2WONB 2HHQA 1TK0A 4IFVB 2OPSB 1KLMB 5C24B 4NLTA 2W9BB 3ITHB 3MEEB 2XGPA 2Z1JA 5HRNA 3DRSA 3CDWA 4I7FA 4DFKA 1RA6A 3MECA 2D5RA 2R8JA 2FBYA 4HCBA 5JS1A 2HWIA 4W5RA 4QW8A 5KFBA 1TKTB 4DQQA 1U04A 1MU2A 4AHUA 3CM5A 4BE0A 2V4QA 4J9LA 1NJXA 1RAJA 3MEDA 4FJ9A 4NRTA 1SL1A 3GV7B 2I1RA 3PJWA 3TAFA 4KFBB 4WE1A 1BQNB 2XY8A 4N5SA 2C28A 3CIZA 3NDKA 3V9UA 4KHNA 4NLDA 4KHRA 2VWJA 4G1QB 2FJXA 3SFGA 4K4YA 1YTUA 3L8BA 4EO8A 3QEPA 3C94A 3SUPA 2W7OA 3OYGA 4ZTFA 1LV5A 4LSLB 2FC0A 1S4FA 4M94A 2W9BA 2QV6A 3ZSOA 1U09A 1S1XA 1RBVA 1KCFA 1HQEA 4WXWA 1EP4A 2HHUA 4R8UA 2E9TA 3QEIA 1RBUA 5L1JA 1C1CA 5J2NA 4FZZA 3HVTA 4IG3A 4DS5A 4DL7A 4TQRA 1S5JA 4CHQA 1C2PA 2YNGA 2OA8A 2OPRB 4ZVHA 4FK2A 5DLGA 3OLBA 1HPZA 2BANB 1JLEB 1X9WA 5DGBA 3GIKA 4DL3A 3MF5A 4CJVA 3M8RA 1NOZA 2YNGB 2HWHA 1S0MA 3VQ4A 4NLPA 2RKIB 3ASMA 1WSFA 2KTQA 2R2RA 4URSA 3KHRA 1BCMA 2NUBA 1SKSA 3CJ4A 4FLXA 3PW4A 4Y1CA 4O0JA 2G8KA 4IDKB 2BE2A 3L3VA 1SUQB 3SI6A 1UA0A 5FDLA 4KO0B 4J2DA 4Q43A 2PY5A 4M3TA 3JSMB 4F3TA 3PO4A 1VSKA 5DK5A 3I0RA 1NJYA 2W8KA 1VRUB 4CERA 4RG8A 4KB0A 1CXUA 3NCIA 1IKWA 4OL8A 3GILA 3KMQA 1VSIA 1XHXA 1TKDA 4E19A 4DQIA 2R8HA 4M3YA 4F4ZA 1XR6A 1JXLA 4O4GB 1S6PB 4IR9A 3BSAA 1U47A 4XO0A 1C1CB 4O3NA 4N41A 2UVVA 1SV5A 3TAMB 2C22A 1S6QA 3AA3A 4CEDA 2YNIB 5DMRA 4IG0B 4LH5A 3QEVA 4YNQA 3KLEA 3Q8PB 1SL0A 1NK5A 1NHUA 2W8LA 5J2MA 4IQXA 3OLAA 3GIJA 5KFLA 2WB4A 2G8VA 3O3FA 4E7HA 3HPHA 3CDEA 3RR7A 3L3UA 5KFVA 3ZT4A 2AGOA 4O55A 3KLHB 3MR2A 4NLUA 4O3RA 4BDZA 4FLVA 4DSIA 3H5UA 1RT1B 1RDAA 4CHYA 1HPZB 3E51A 1NKCA 5KRTA 4LSNB 3RMAA 2PYJA 2OPSA 4RW9A 1TL1A 1TL3A 3GYNA 3LWMA 3ISNC 2VG7A 2O4IA 2BRLA 4F3OA 4BDPA 1DTQB 5KG1A 1LWFB 4ZPBA 3HYFA 3SFUA 1NKEA 5DG8A 1RT1A 4E3SA 4TY8A 5J2NB 3UQSA 1TKTA 4DFPA 4URQU 4KKOB 2W9AA 3KHGA 3AO2A 2DPIA 3QIOA 2EX3A 3N6NA 2JGUA 4CGGA 2C2DA 3V6JA 2G8UA 3KLEB 1UWBB 1NK7A 5C24A 1TVRA 1FKPB 3VQQA 4ZVEA 4HVJA 3OSPA 2OPQA 3NBPA 3V81A 2HMIA 5DG7A 4LSNA 2HNYB 4KI4A 3Q8QB 2HAIA 4W5NA 2A1SA 2AGPA 3KLHA 1ZBIA 2C2RA 2AQ4A 4RU9A 3IRXB 2YHBA 2FVSA 4W5TA 2B4JA 4KHWA 2G8FA 4H8KA 4FJ8A 4B9UA 2QE5A 2J6SA 1ZTTA 3L2UA 4Z4HA 4E7KA 3HT3A 3VQSA 1JLCB 4TN2A 1C1AA 4I2PA 2XI2A 3NGYA 3CJ5A 1UOCA 5EUHA 1HQEB 3C6TA 4FM2A 2EC0A 3CM6A 3HXMA 1SUQA 4TLRA 2JLEA 3QGHA 1DTTB 2J6UA 3DLEB 1ZBUA 3CFOA 5F8HA 3DRSB 1QSYA 4O0IA 4ECUA 2BQUA 4LSLA 2W7PA 4U7CA 2ZD1A 4RNFA 1HNIA 1TP7A 2V4RA 3DLEA 4KSEB 4WFZA 2ZE2B 4DU3A 2RKIA 2IAJB 2WTFA 1W0HA 1S10A 4OKEA 4F8RA 2HW3A 4CJTA 1RT5A 1WSGA 1RT7A 5CZ1A 1KTQA 3NH0A 1NKBA 4H4MA 3CQ8A 2QK9A 4IKFA 4R5PB 4XIUA 4HTUA 4EO6A 3Q8SB 3NH2A 4KPYA 4KB7A 4ECZA 3H4BA 1KSPA 2R8KA 3U6FA 4IDKA 4DTJA 4KV8B 4ED7A 4AHSA 4KHYA 4CGDA 5DG9A 4R5PA 3HP6A 2ILZA 2VA3A 1VSJA 1NJZA 3T1AA 1KHVA 2WK4A 4ZHRB 2FVCA 3PX6A 4Y34A 4CF9A 1X9MA 1F21A 4B9MA 4IRCA 5EDWA 4YR3A 4Q8EA 3RAQA 4J9NA 4CEZA 4CEFA 3FFIB 2Y1JA 4FS2A 3PO5A 1U49A 3DRPA 4CHNA 3AVGA 2ASLA 4B8CA 1JLFA 1SKRA 3OL7A 5F9LA 4F4YA 4B3OB 2D41A 4O3PA 2YNFA 4FS1A 4QOZB 4WZQA 4CEBA 3IS9A 3OJUA 3V6DA 4TSXA 3OYCA 3V1OA 4QWEA 4M3RA 2YKNB 2ZE2A 1JLBB 1N5YB 3HL8A 5E41A 5SZTA 4QWBA 4KTQA 2ZD1B 1S0NA 1Y97A 3KKRA 3N6LA 3OY9A 4DFMA 1N4LA 4ECRA 3VQ7A 3OS1A 3C6TB 5KFMA 4ECTA 3RRHA 1L3VA 1HJRA 2KZMA 4FJNA 1RT2B 3ZSRA 4YFUA 3QIPA 4MH8A 2XY7A 1CXQA 2W42A 4BE1A 4I2PB 4EEYA 3DM2A 2DY4A 1REVB 3KD1E 3S3NA 1JL2A 1HQUB 4JS5A 4CF2A 4Z4CA 4IBNA 1RDDA 1JLAB 4FLTA 3HKWA 2E9ZA 4B9TA 2R2TA 1JLGA 3IN5A 2ASJA 1FXXA 4BWJA 4FW1A 3KJVA 4NLVA 3WNEA 3LAKA 1JX4A 4CK2A 4IR1A 4Y3CA 2IC3B 4RZRA 1ZETA 4CCHA 1D0EA 5KFIA 4DSJA 4MK9A 1WSJA 2XY5A 2KQ2A 3H59A 4RNHA 4DSLA 1TL3B 4OPKA 4K8XA 3D28A 1JLQB 4KBIA 2JEGA 3ULDA 1I3AA 3K5LA 4IFVA 5K14B 3K2PA 4FXDA 3MFHA 1J5OB 4KHSA 4NCGA 4DTMA 1K6YA 5F8IA 3OHAA 3V9ZA 3BDPA 1LWCA 4NLRA 1UAXA 3OYNA 4Q0BB 1VSMA 3LZJA 4TQSA 4Z4IA 2FBTA 1IKYA 3VQPA 1W9HA 3DDKA 3PY8A 5EWFA 4QW9A 2AWZA 1ZBFA 3TARA 4CJ3A 2D0CA 3MR3A 2XY6A 4TXSA 1TL1B 5F8NA 4DMNA 3OYAA 4RW9B 4J2BA 4QWAA 1L3TA 5F8LA 3SUOA 1RTJA 3KK1A 5L9XA 3SNNA 4URGA 3PVXA 3NKYA 5J2PA 1RT5B 3QEWA 4AHRA 4KRFA 2D7SA 3NF7A 4ID5A 4F2SA 1S9GA 3OYHA 3FRZA 4NLWA 1HNIB 4CJPA 3SUQA 4FK4A 4KHMA 5J2MB 1L3UA 4K50A 1FKOA 4MFBB 4EBEA 1TQLA 3ZSWA 2OPPA 2BQ3A 3L2WA 4FJKA 5D3GB 1S1VB 3I0RB 3G10A 2YNIA 3RTVA 3EPGA 5KGXA 5HRRA 1C1BA 4O3QA 3VQAA 3P83D 4ED6A 2IM0A 4DSKA 4KO0A 1ASVA 2DPJA 2YHAA 4ED8A 5C25B 1BQMB 4Q45A 1T7PA 4OGCA 4FYDA 2QKBA 1WSIA 4IRDA 1RBSA 3AO1A 2HNDB 1RDBA 4ED3A 3AO4A 3PR5B 3LZIA 3QEXA 3EPIA 3AVBA 3HK2A 4KTZA 2RF2A 1N48A 4K4UA 1BHLA 4N76A 4RW8A 3KD5E 4Z4EA 5J1EA 1VSHA 3DLRA 4B08A 3JSMA 1FKPA 2GIQA 1RTIA 4XPCA 2HB5A 4TYAA 4M95A 3BJYA 1RT3A 3IGVA 4EYHB 1I39A 1IKXB 3H98A 4FJHA 3M8PB 4Q0BA 2YV0X 3KMSA 3QETA 5JUMA 4AHVA 4EZ9A 4ZP6A 4ID1A 3UPFA 1SL2A 4CGJA 1TK8A 4J9MA 3QLHA 4O44A 4IH7A 3AVFA 3KLGA 2IS3A 4Z4GA 4QPXA 5KFGA 2IM3A 2R8IA 2JEIA 3ZT3A 3DI6B 2ASDA 1XC9A 4NLQA 3NMAA 4IKAA 4CK3A 1X1PA 4FW2A 4FZYA 2D0AA 1IKXA 2DTUA 1LW2B 2KZZA 3EZ5A 2GV9A 4NLYA 4FCYA 4K4TA 3BGRB 3BSOA 3K59A 1NK6A 2D3ZA 3H5XA 4MIBA 1JIHA 5T7BA 4IFYB 4WE1B 1T3NA 1S1UB 4DS4A 3KNAA 4CECA 4RW8B 2AX1A 4I9QA 2UUWA 1JLAA 5C42B 4CGFA 4Q5VA 1KVAA 1GOCA 4ECSA 2A1RA 4DF8A 5HBMA 4KAIA 5KFZA 4GC6A 4B8AB 4FJLA 4CHZA 3KTQA 3KKSA 2XC9A 4F4KA 4NLGA 3CWJA 4K8ZA 4G1QA 3B6OA 4H4OA 4FLYA 3HM9A 3VA3A 1U48A 2PYLA 1TGOA 4H54A 2HHTA 1S1VA 2Q3SA 1N5YA 5FROA 2YNHB 2OPPB 1TKXA 4CIEA 3KK3B 4FLZA 4YMEA 3JYTA 3V6DB 3OVNA 1YVUA 4EP5A 3RWUA 2F96A 1RILA 1S1TA 3OYLA 3HVRA 1MU2B 1S9GB 4FJXA 2FVQA 1CZBA 4F50A 4O4RA 4JUZA 2OZSA 3SQ1A 4NLXA 2QXFA 4FJMA 4O3SA 1J54A 4ELVA 4J9KA 2X74A 3AV9A 3SV3A 4CJLA 4DTRA 3OYEA 1JKHB 2F8TA 3HVWA 3KHHA 1T05A 3SQ4A 1R0AB 3V9WA 3L2QA 3FSIA 1LW0A 5KT2A 1CZ9A 1QSSA 3NAHA 2BR0A 1LAVA 1HYSA 4NLSA 2HNZB 1S9EB 2B5JA 4ZHRA 2Z1IA 1RTDA 4DG1A 3U3YA 1C0TB 1VSFA 3LP2B 3OYMA 2F8SA 4QCLA 1TK5A 1QE1A 5L1LA 1LWCB 3H5SA 2E4LA 4ED0A 1LWEA 4ECXA 3I5CA 1NK8A 1WLJA 5KFOA 4CJWA 3QO9B 2QKKA 2ITGA 3BSNA 2GC8A 2ILYA 2JEJA 3ZCMA 1A5VA 1RDCA 4C8OA 3UR0A 4CF1A 2I5JB 4YP3A 1D8YA 1BL3A 2FVPA 3ZT0A 4X2BA 1BCOA 2P51A 5KFJA 1EP4B 2HHSA 4RW4A 5J2QA 3DMJA 3S9HA 1VRTB 1BI4B 3LP0B 2P1JA 5KFEA 3AO5A 3JYTB 2RDJA 2YKMB 4ZPDA 3V1RA 3AVKA 3KK2B 2RDIA 1LAWA 3V9XA 3ZT1A 4DL6A 4DEZA 3RBDA 3RMDA 4KFBA 2P5GA 4CEQA 3ZSQA 5CYQB 5KFUA 1JLCA 3TANA 3E01B 3DOLA 3LALA 1RDRA 4LY7A 4E7LA 3CG7A 3M9MB 1QSLA 1BGXT 3K5OA 1JL1A 4CFBA 3DYAB 4EP4A 1HNVA 4FM0A 3DLGA 3CJ3A 4FBTA 1BI4A 3KLFA 3I5AA 4FZXC 4PQUB 3NGDA 3HJFA 3E01A 5KGWA 4HCCA 4JV2A 1KVBA 2Y1IA 1ITGA 3QINA 2YNFB 4CEOA 3HPOA 4AH9A 2FLNA 1A5WA 3RR8A 3DLBA 3OL9A 1B9FA 4ZVGA 3QO9A 1S1WA 2WONA 3GV8B
chains in the Genus database with same CATH superfamily
2G8HA 1RDUA 5I3UB 2GEMA 4OJHA 2VPWB 4AXJA 3R7NB 3GV5B 4DR6J 1I1GA 4DX6A 3DDIA 1FA0A 3MI7X 1LWFA 5CYMB 4B3MK 3VZHA 1HNVB 5T14A 2QFIA 2HIQA 2VFUA 2E9RX 4G6VB 1QQCA 1M1GA 3B82A 4ERDA 2KHCA 2UP1A 3NL0A 4PCQA 4FSVA 4FPBA 1F2HA 1C0UB 2GHWA 2M88A 2EHGA 3THYB 4B9QA 5FPNA 4BR2A 4NA1A 2VOOA 3HLUA 1ZAWA 1Q8BA 4PG5A 3PIPQ 5A0YA 1BOTO 2Z0GA 3BGFA 2BKPA 2MZ1A 1Q0NA 5A8RB 4MDAA 2ZWHA 3M8QA 3QFUA 3I31A 4JI1J 3S3MA 1IBLF 5HLFB 3THPA 1YVNA 2ZM6F 5IFMA 2EG1A 1KAYA 5GINA 4FJGA 4WYBA 4ZN3A 3M8SA 1CVJA 5EN1A 2Z30B 3R8EA 3H4DA 3CCLN 2FJWA 3MXHP 5HVHA 1HKAA 1RBOB 3UVJB 4H0XB 1RHMB 3SJJA 4CZEA 4R0EA 4H5VA 5F3TA 1U0HA 2DNYA 3FVYA 3OFFA 3HI0A 1X4FA 5JLHA 2X78A 4CZCA 4OX9K 2H5IB 1FVQA 3ENAA 4OYOA 1RTJB 4ZTJA 2FGOA 3ZC4A 2DPNA 5D77A 5HP1B 3CHWA 4KGKA 3U9ZA 3R2CJ 3AA8A 1R0AA 2CPFA 3OSNA 1VK8A 3TVKA 4DTXA 2L9NA 1T3VA 2WHOA 2M52A 5LJ3Y 4JI3K 4C1NI 4HDHA 3SCKE 4HVZA 3RZAA 1KXPA 3IAYA 1U2VA 3G25A 2B9YA 2HVIA 2F4VK 3GZ7A 4U7UD 5A2QU 3ZTRA 3MMAB 2HFSA 4OYMA 3LOUA 4ES3A 1QHTA 4RW6A 3PJXA 4W4MA 2GJIA 5A8WB 2J7WA 1KLNA 3LPTA 2PMWA 3D1HA 5BR8K 3AJ2A 4BDYA 5HLFA 4IH6A 3M1VA 3NCQA 3HJVA 1FESA 4DL0C 1G15A 3DAWA 2KFYA 3AGRA 2OHDA 3W3DA 4OYIA 3B78A 1XQIA 4WYWA 1NXIA 2GUIA 5LSLA 4DL2A 2F9TA 4IG0A 1Q8LA 2ZHBA 1ZPVA 2CPZA 1SZ2A 4DTPA 3NCPA 4IFEA 2W41A 4JK7A 3OBYA 1S6QB 4DHYA 2VFSA 4M3UA 3ZTPA 1MW7A 4RX6A 2F4VF 2XCPA 1NSQA 1N6QB 4E98A 2LQ9A 4DCOB 1NK0A 4DMZA 2RE2A 4CJQA 1FNOA 4DV6J 4LFCJ 1FRJA 3J7YP 2OYQA 4IRKA 2VFRA 2XMMA 4GKKF 4BACA 5J2PB 3CI5A 4UF4A 1E3MA 4X4TA 5BR8F 4WTYA 2Y8WA 4WFXA 2YWKA 2IGIA 4KE5A 3DLHA 2DYAA 4KHQA 1QM9A 4DCJB 3WXLA 4XPEA 2UXDK 1OY9A 1NPRA 2BJ9A 3RUBL 2FIUA 4TY9A 3FEZA 4LF8K 2ZBPA 4DG1B 1D5AA 3NEKA 4CJFA 5J2QB 1FFSB 3O9TA 1VBXA 3EGZA 1XBWA 1TZ0A 3LQVA 3CJ2A 3KJFB 2QSWA 2D3UA 3VV2B 4WXOA 3IFEA 5HL7L 3MM8B 3F73A 3OTOF 4E1MA 3EY1A 1UEUA 1OS5A 1HNXK 2OEMA 2J7UA 3FNNA 1LWEB 3I33A 4W92B 3SV4A 3BO4A 3RB0A 2J9DE 2HRTA 3O4NA 4NI2B 2XRIA 1RAEB 4K2XA 2AD9A 2F5GA 2IDEA 3ZZOA 3P1GA 4FYWB 2NRWA 2BUPA 1UW4A 2K7KA 1LNQA 4OGEA 3GR1A 3HSDA 2K1RB 4JD2A 5DZ6A 5DJBA 4A8MP 3D0PA 2KG0A 3WC0A 2ITMA 5KFFA 3MHYA 3PSFA 3OTOJ 2FSJA 1GLEG 1VQLS 3CPWR 3ID8A 1RTHB 1QUVA 4WWSA 1FNXH 3UR3C 3D4JA 3PTWA 1S1TB 3AARA 4JRPA 2YKNA 1RXOB 2Y0SD 1YITS 3E2EA 1QAJA 5KFQA 3PYGA 1KFDA 4DR1F 4Z0UA 1MLAA 2DXFA 2VDHA 3D9BA 5GMDA 2HQGA 1K1QA 3TOQA 4U6PA 1RHRB 4OKKA 5DS7A 2VZ9A 1L5UA 2AEFA 5KFYA 2UUCF 4HYKA 1FKAF 2E6MA 3VEZA 1OO0B 1OIAA 3AVMA 3TA0A 2CJQA 3ITHA 1JLQA 3GTYX 4PYDA 2ZH8A 3LDSA 3GP9A 1MN9A 2PZSA 1SC3B 3GG4A 3C16A 1S76D 1RBTA 4UQGA 1CJVB 2QWNA 5LT5A 3BZCA 4K41A 5L8RC 1HI0P 4WTOB 5EWEA 3M9NB 3NY0A 4YY3K 4GV6A 4O3OA 2DT9A 4JI0F 4W5OA 5KFAA 3ETOA 3DXMB 4V19S 3VQ9A 3MEGA 4LF6K 1WHXA 2V9KA 1YBUA 1UAWA 5KG5A 3UDLA 1GX5A 1HLWA 3BB5A 3QIPB 4LF5K 3TSQA 3MOJB 3EVWA 3NGIA 3MM6A 4M3WA 3OT9A 2GJFA 1ULRA 4PQUA 4M3ZA 3H42A 2DFEA 3G86A 5AE2A 2W9CB 1RABB 1WJ9A 4DUYJ 1Q81T 5CA5A 1R8PA 1CC7A 1AB8A 2ZF5O 2Q2RA 2VBZA 3B54A 3BN4A 2A6OA 3WBZA 4QYZK 4CJ4A 4M3XA 2E1YA 3CDUA 4H4MB 2HGMA 4FLUA 5GAEI 2VQEK 1WG5A 3OYDA 5LSOA 4OLBA 2YWGA 4ETXA 1XNRK 2ETJA 1R3NA 2ZH9A 1REGX 2COLA 3HOSA 2BRKA 1TAUA 1GX6A 2ZKTA 5HOOA 3NF6A 1W25A 3ENBA 1RQ0A 4YDUA 3J81U 1PBUA 1LKZA 1RTDB 1Y4ZB 1HW9A 2WOMA 3DGVA 4ILMA 1GAOA 3D2EA 3UCZP 3VF2A 5ETKA 1G1XA 1IBLJ 3PZPA 3P4UB 4JV0A 5E2QA 1OH8A 2E1CA 2D0BA 1Q4RA 4M5JA 3QIDA 3QWUA 4FKYA 3ZT2A 4OKJA 3DXSX 3DGPA 1V5IB 1RU2A 3IRXA 1LWXA 1P9YA 3M6XA 3VENA 1B4SA 2CG4A 2QYCA 3C46A 3ZX0A 2BANA 4AYBD 1MWKA 3JTPA 2YWEA 1RWWB 1N33J 4C8KA 3L4IA 2E2NA 3EKUA 3AAWB 3BR9A 1KKHA 5KG6A 5GIOA 1NPKA 1K9MO 3MMVA 4A2BA 1Q7YT 2VJVA 5IT4A 4MAKA 3MM9A 1B0VA 1D9DA 1C6VA 2WOMB 1FEHA 4DF4A 1Y00A 3IUCA 4BRQA 4DV6F 4B3MJ 4CIFA 5KFWA 3MX5A 4IO1A 3M8PA 4CF8A 1WOQA 4K4XA 2M8DB 3CC7S 2XULA 3H40A 2FBVA 4HUFA 4WCEL 4O5FA 4FBUA 4CZJA 1N0VC 3OQ2A 2FC8A 2HHVA 1WBBA 3BPDA 1T6CA 2J7KA 2CNKB 1BQNA 1KR4A 2CQ1A 3MZIA 1HYVA 5JICA 1W7AA 4USMA 1RHQB 3W2WB 1PJ7A 1EKSA 1RADB 4H0OA 1SH0A 3TAEA 2FGCA 3R1LA 3CCTA 3N01A 4Q8FA 5U47A 2B8PA 2UUBK 2E29A 1JLFB 1NGFA 4ZVOB 2JH3A 2OGUA 4K7QA 3BGRA 4O4GA 1WI8A 4DV1F 2R9LA 3D67A 1HHTP 1GLDG 3PKMA 4OHVA 3FFIA 2BW2A 3NS7B 4J2EA 5HJXA 3BKUA 3UIQA 4J90A 1O13A 4WU3A 1U2RA 3AVHA 4QQBA 3W63A 1T94A 4AHTA 2YX6A 2ZKUA 2RF2B 2GMLA 2ADCA 3K9KA 3LM9A 4DX8H 3B8AX 2O66A 3OR2B 4O8UA 2BE2B 4FYVB 5AQFA 3QFHA 3H90A 3G0ZA 5AQLA 2W2PP 4CK1A 5C25A 3CULA 4RBVA 4TU8A 2B43A 3WQPA 4DR3K 2CQCA 1FRLA 4Q44A 1M90T 2GVZB 4UY8O 2CYYA 1YVFA 1W7WA 5IT9O 3DCAA 4ZVFA 2Q43A 3UNGC 2IAJA 1JCFA 3LANA 1W26A 2OPRA 2DTJA 2YBVA 2ZBCA 2HOEA 3DRRA 4KGXB 3TYTA 2NREA 3VALA 1VQOS 3KWMA 3PIOQ 1XMOK 4XH4A 2X1FA 1R6YA 4IG3B 1HKCA 3GIIA 3L2VA 1HHQA 5KFDA 4TYBA 4DR7J 3BYRA 4U7UK 1M5SA 1ITPA 5C15A 4UZBA 3G82A 2HAFA 3PV8A 4O8KA 4ECYA 4ED1A 2G1DA 3M32B 4WPAA 1TKXB 4F7VA 3SLCA 3TAQA 4DLEA 3GSIA 2NR0A 4AQYJ 3PW0A 1XNQJ 4HH0A 4H4OB 4ED2A 2QT7A 1GH8A 4DU1A 4FM1A 4K4ZA 3QWPA 2BKNA 4K4VA 3OL8A 1CPZA 1JLEA 2FUG9 3BR8A 2NRZA 1JLBA 2OH2A 3CCJS 1HI1A 1FO1A 3VAGA 3G96A 2E6LA 4LUBA 3J7A1 4DV1K 4A57A 4AL7A 1SJFA 2GFFA 2GO8A 2CIMA 3PRDA 4TY8B 3QICA 4FXWA 5HRSA 1TUWA 2UXDJ 2HNYA 2FVRA 4ZIVA 3NGZA 3QZ7A 4FWKA 5GAEP 3I4HX 2JVOA 3BV8A 4RWXA 1KLMB 3TTCA 5C24B 4NLTA 2W9BB 2DNZA 4WP8A 4B3SF 3IO1A 3D6HB 2XGPA 2Z1JA 5HRNA 3CPWM 1EO1A 1ZM9A 4I7FA 1KD1O 3MECA 3VVTA 5CCMA 1WHWA 4W5RA 5LMUK 1YBTA 4QW8A 1LK5A 1U04A 3M1FA 2GV1A 5AQRA 2GUPA 3MMBB 3MEDA 4OX8A 2MQ8A 4FJ9A 2HVEA 4KPCA 3P39A 1SL1A 5IC4B 4UOCA 2NXCA 3CC4N 3THTA 4WE1A 3NDKA 1WSRA 4FWRA 5F0UA 3TX0A 2VWJA 3C14A 3HSJA 2D74B 4EO8A 3PG9A 2ZWPA 3DOMB 1S4FA 1V4TA 5AQKA 2XYPB 4NXMF 1HNXJ 3E3XA 2FD2A 4PKIA 2ABYA 2JDJA 1RHUB 3OV7A 1HQEA 3PEHA 2NPFA 1NDPA 2E8AA 1RBUA 4TU7A 1ZA1B 2QXLA 4X4NA 5J2NA 5FPDA 4FZZA 4HT7A 3UD4P 1DRZA 4DZ6A 4DS5A 1S5JA 1RE1B 1O5JA 1SJ3P 2BJ3A 2AZ3A 2IRYA 2NZCA 3AB4B 1C2PA 4M8LA 2YNGA 2OA8A 2RS2A 2DD8S 4FK2A 3OLBA 5CZXA 2XS7A 1S4EA 3SCIE 3M8RA 4CJVA 4N77A 1NOZA 2PA8D 2YNGB 2HWHA 1ZAVA 1BXNA 3ASMA 1WSFA 1QVGM 1RLDA 3U9DA 5IWAF 1MROA 2NUBA 3CJ4A 2FDNA 3PW4A 4FLXA 3EGVA 4Y1CA 2XSFA 4RUBA 4I67A 1FJCA 1C0GA 3L3VA 3SI6A 5FDLA 4KO0B 4ALZA 4BC3A 2E7VA 3PO4A 3M2UB 4CERA 1YJ9N 3HM8A 2CQGA 3OTCA 3OBIA 1CXUA 2H51B 3C15A 1SJQA 2N7YA 2CH6A 4A46A 1XHXA 5HQLA 2KI2A 2O8DB 4E19A 2R8HA 4J91A 1XR6A 1JXLA 1S6PB 4IR9A 3MEKA 3SMZA 1SCJB 1N88A 2C22A 3AA3A 1OQ3A 2V50A 4CEDA 4DN9A 7AT1B 5DMRA 3TW0A 3PDNA 3CCZA 4EU0A 2LQ5A 3Q8PB 4JI5K 3LPEA 2MMYA 4CLLA 2QN6B 4IQXA 4Z7CA 2WVBA 4E7HA 4M63A 3CD7A 2P9LB 2RAQA 4OV1A 2PBDA 3HPHA 3RR7A 2KDOA 5KFVA 2AGOA 4DSIA 1RT1B 2M5YA 4FZVA 1NKCA 3RMAA 4RW9A 2K8GA 2DHGA 1TL3A 2P8IA 3LWMA 2O4IA 5BXIA 1YKWA 1LWFB 4ZPBA 3HYFA 3WEEA 4ZLNA 4TY8A 2ASYA 2EG2A 3O9UA 4JI2K 4AE5A 2KKHA 4DR5F 1IV0A 2EX3A 3KZBA 1KC8O 2JGUA 2FJBB 1J6ZA 1JJCB 3K8VA 3J80O 4PXEA 2C2DA 1EIYB 4DV4J 3ZETB 3UN5A 2HK3A 2VU5A 2MQPA 3NBPA 2HMIA 1P1TA 3SDEB 3OUYA 4KI4A 5M1KA 2Q1LA 2HAIA 4KH5A 4GO7X 2H54B 1I5OB 3KLHA 2C2RA 3VEXA 4NEZA 3N4WA 4FWOA 4FWNA 1MWMA 2B4JA 1FWPA 1VR6A 3UE2A 4TN2A 2K7JA 2PC6A 2HFZA 4BROA 2B4UA 4LF8J 4U67L 2RUSA 3C6TA 1W2IA 1KWMA 2JLEA 2DCUB 1ZBUA 3CFOA 5F8HA 2A5XA 4ECUA 2W7PA 3EVOA 4JK8A 2HGNA 8ATCB 3KDNA 4KSEB 1RWUA 2RKIA 2IAJB 2WTFA 1W0HA 1S10A 2HW3A 1URRA 3K0JA 1KTQA 2BM1A 3CJBA 4CNYA 3L4QA 4C3LA 4IKFA 4XIUA 1M5PC 3CUNA 3VETA 3ID6A 3CCRN 5IOLA 2F3JA 3UW1A 3OR2A 1Q7YO 5HK4A 1S12A 2OLWA 4AHSA 2QLXA 4BR9A 3JS9A 4CGDA 4BRHA 1QUPA 4QR2A 3GFHA 3HP6A 2UYTA 5M1OA 2NCKL 1HI8A 1X4DA 3RVCA 4Y34A 4DR3J 4IRCA 5EDWA 1IVZA 4YR3A 1YGYA 4M5HA 3EGWB 5K20B 3FFIB 3UI3A 4ZCMA 2D9OA 4I6MB 3DRPA 4ES1A 3EZWA 2MYFA 1CC8A 1DT9A 2CPYA 2F9JA 3H1QA 4B8CA 1JLFA 1WDTA 2BYCA 4F4YA 4B3OB 3MAAA 2D41A 2OSRA 4F0HA 1A7GE 1KBRA 5FJ4A 2XNRA 2V4JA 3LDOA 4WZQA 2DCLA 2NYIA 1WC6A 2AT1B 2BOAA 5IS2A 4CJ7A 2ASPA 1R43A 3SSQA 3V6DA 3IR6B 3B4MA 3CEDA 2ZJPL 2AJ0A 1UMJA 3VHQA 4M3RA 2DHHA 3TUZC 2OFGX 1R8HA 3HL8A 1J5EJ 4QWBA 2GVDA 5GAEU 1Y97A 4MO4A 2VIHA 3I4PA 2R7TA 2PSZA 5B0BA 1N4LA 3VQ7A 3IM9A 3MWTA 3ELHA 1PJ6A 1K8KA 5KFMA 2QMXA 1L3VA 4HWIA 2KZMA 2NRVA 2AYBA 1Q78A 3BGLA 4I2PB 4EEYA 4OI0A 2DY4A 1REVB 3KD1E 1HQUB 2IVPA 1Q81O 2B9WA 2AA4A 1X4CA 2GX8A 2N4CA 3J8AA 3R5AA 2GWJA 1JLAB 1AUSL 5K8PA 3HKWA 4B9TA 3IN5A 2V94A 1K8AT 3JAMU 2ASJA 1FXXA 4BRIA 4LBPA 1HX1A 3QFWA 2OP5A 1J5EF 2Y9HA 3RBZA 1IBMF 2KYZA 3QBCA 1JJ4A 4KIAA 5ADXA 4RZRA 2WAQD 5KFIA 3D6TB 1WSJA 2QLBB 2YKAA 5M2UA 2OKQA 1TL3B 4OPKA 4K8XA 3VEVA 4I64A 3ULDA 1I3AA 4IFVA 1V5VA 3NCRA 4WK3A 4FXDA 3FLCO 3K2PA 3NP5A 4G1IA 4NCGA 1K6YA 9RUBA 3W2VB 3HHLB 3PACA 4NLRA 1U26A 1UAXA 1XMBA 4Q0BB 1VSMA 3MGJA 3M05A 2V8DA 2FBTA 3IM8A 4DV6K 3O44A 2V2QA 1IKYA 2DVIA 1GLFO 3VQPA 2DEJA 2J9EA 2K3IA 4QW9A 3HHNB 2AWZA 4CJ3A 2V7ZA 3MR3A 4TXSA 1TL1B 5ETLA 4DMNA 4QWAA 2F40A 5F8LA 1U1QA 1YK9A 3VAJA 4A8SA 1KAXA 3J7Z5 1NLKL 2VKZG 4IEIA 1P90A 1XMQF 3NKYA 1DZ5A 4DR4F 2G9OA 1S9GA 3OYHA 4NLWA 2J76E 2NNWA 4CJPA 1QY7A 5J2MB 1ZC6A 1FDDA 1WF1A 4EBEA 1YJWN 2OPPA 1X3MA 4PG7A 3L2WA 5D3GB 3G10A 3MPDA 2I6WA 3WC2A 4DUYF 2FHKA 2IM0A 4KO0A 2AYGA 4CO2A 4Q45A 1NGAA 3PRBA 4MTPA 4D3HA 2ATCB 3I6PA 3L95X 3BO2A 4P6QA 1RBSA 3AO1A 5C10A 1U1MA 1XMQJ 1RDBA 1IR2A 2R3VA 4K0KJ 2VC0A 2MKJA 2ZVSA 2QTDA 4C0BA 1BWFO 3WXJA 2X51A 1U1LA 3GJRB 1W97L 4S0MA 3G9CA 5J1EA 1RBLA 1FI4A 3CCUN 4RLEA 2UUAJ 1QQOA 1PCAA 3O1LA 2E5HA 3OTBA 2LDYA 1ESVA 4XPCA 5B0EA 4ZIWA 3BJYA 3IGVA 4F0KA 1FTCA 1GQEA 4CZGA 2EK6A 2YV0X 3BP8A 4P52A 2O8CA 4QIVA 5JVHL 2UUBJ 3QETA 3TJAA 1OKJA 3O1BA 4ZP6A 1TK8A 4CGJA 4O44A 3GYGA 3M30A 1JWWA 5KFGA 2IM3A 1YRUA 4WBFA 1XC9A 5HI7A 1PIEA 2FHJD 3NMAA 5AQXA 4A8XA 4CK3A 4FZYA 2HBJA 4PEOA 4YOYA 2KJVA 4NLYA 2O8BA 4K4TA 4C9DA 2D3ZA 1X0FA 3QNWB 5IZHA 1QAXA 1A9NB 4WE1B 1T3NA 4DS4A 4IJNA 4OZ3A 1U1OA 4CECA 4RW8B 1RCXB 4I9QA 5C42B 4CGFA 3FFKB 2M2BA 3MN6A 4DF8A 2GIFA 5HBMA 4RWWA 4HL9A 4G1PA 2XMUA 4FJLA 2R7OA 3QSIA 4ZLLA 4F4KA 1DQAA 3U27A 2WW4A 3CDBA 3VA3A 4B02A 4UW2A 1GTEA 2LXFA 1S1VA 3K8WA 2ZC4A 1FRHA 4OQJA 1N5YA 1N8RO 2YNHB 2RQCA 1PILA 1MWZA 5F0XA 1OVQA 1YVUA 3RWUA 2XMWA 4AM7A 3BUZB 2UU9F 1VRQC 1U25A 5D4NA 4NLXA 1UFLA 1GNKA 1XUPO 3VGMA 4CLUA 4IZ9A 4QIFA 1H2VZ 3VGLA 1QTNB 3D1QA 4CO4A 5LM7E 1VBYA 2VH7A 3OYEA 1FF2A 3U1NA 3KHHA 3P6YC 2HSEB 3Q86A 3SQGA 1X4AA 4X66K 3L2QA 1LW0A 2DNOA 1CZ9A 2B3TB 2LEAA 1QSSA 3NAHA 4LREA 2V52B 1WEZA 4NLSA 2ZGZA 3IA0A 4C0HA 5F3ZA 3F5TA 1ZPWX 4DG1A 3FCHA 1WTBA 1TK5A 1QE1A 1LWCB 2WUSA 4ECXA 2V6AA 2QKKA 2IA0A 1F6TA 1D09B 2ILYA 5G0RB 1A5VA 1RDCA 3UR0A 1D8YA 3ZT0A 4DPUA 3BF1A 4X2BA 1NM1A 1E6VA 2BJEA 3VWSA 1BCOA 4E1JA 1EP4B 1KDNA 3MOZA 2HHSA 4UOGA 3DMJA 4JI0K 4ZVQB 1OVYA 4WU2A 1IBKF 2ZDPA 2KHOA 4ZPDA 4LF5F 4JI8K 4LFBK 4JI6J 3AVKA 2P9SA 3H25A 1NGIA 2VICA 2E2OA 1U02A 1K73O 4CEQA 3ZSQA 2G0CA 5AZJB 1QVGR 3LALA 4RJVA 2ZBQA 4LY7A 4E7LA 3CG7A 4CLYA 4ILJA 1QSLA 3MCMA 3M1VB 3RU0A 1NDLA 1BI4A 4OHYA 4JV2A 1S5ZA 1SJ1A 1CJUB 3QINA 1VQ4N 3HPOA 2ZBRA 1YG0A 4AH9A 2FLNA 1X4BA 3W9HA 2MTLA 1WD6A 3PJ9A 1B9FA 3QO9A 1S1WA 4ZJOA 2WONA 1X8DA 2VG6B 2J0SD 3Q2TC 3QRRA 1O0PA 1JJHA 1L3SA 4B9VA 1BISA 4Q7AA 3D5MA 3RRKA 1ICEB 3BH7B 2MEWA 3QLHB 3NGKA 4DBQA 4O5BA 4ANDA 4K4WA 3FBFA 4P7TA 3D2FB 2E7XA 5KFNA 4USTA 2RU9A 2JZ5A 2DIVA 1HBNB 1RT6A 4DR2F 4DV7K 4CGIA 2EI5A 3EGNA 3HSCA 3ZZTA 4OLAA 4YOTA 4JOUA 1J27A 3DJCA 4YUDA 4P10A 2JC1A 5D6GA 4TU9A 1Y9OA 3RB6A 4H0VB 1BDGA 3HSTB 3KK3A 3VN5A 3S3OA 1HMVB 1TYQB 1U8SA 3TNVA 3A0IX 2V69A 4CHOA 1U1NA 1TKZB 4EZ6A 1S48A 3A3OB 4E1NA 3TZYA 2GGPB 1BIZA 4MYUA 1DLOB 3BYPA 4CD1A 4XH1A 3V1QA 5KT6A 3IWXA 2HBLA 1EETA 4KR0B 3AVCA 3HP9A 1MWYA 3IDHA 3MXMA 3DC2A 1HRHA 3GPAA 3HD1A 1BWVA 1VSEA 1FKOB 5H9EK 3FGVA 2DEIA 3OR1B 2P9IB 3CJCA 1C0UA 3U1LA 1IUJA 3PUFA 1T03A 2W6LA 1B9DA 4AHCA 1OH5A 5A6PA 4YDXA 2IY5B 5JVGQ 3ZSXA 2QC3A 3GQCA 4LR7A 4DPWA 3KNGA 4USKA 3QB0A 3P5JA 5KFXA 2FLPA 4ZK7M 3D7SB 2RQKA 3HFZB 3HDSA 4L74A 4FJ5A 4ZS6A 2WSCC 4OPJA 2J6TA 3G2XA 4U7BA 2NRXA 3CCQN 2K3KA 2LCWA 5I3UA 4HUEA 4CYUB 3CPEA 3ZO7A 1CS4B 3CJKA 1Y11A 1MMNA 2HEKA 3IC1A 3VGSA 2OEJA 3DRYA 4QBUA 3SPZA 4QR0A 1WTFA 3R5CA 4KH6A 3DOKB 2JWNA 1WOSA 5KFRA 1S72S 4GVBB 1JCGA 4JYAJ 1IKVB 4LD0A 1BC6A 3WIUA 5DQHA 4ZA1A 3BDEA 2KO1A 4WFYA 3MURP 2EEYA 4RUCA 1WBDA 5E5NA 4HDGA 1SIZA 4ELTA 3ICLA 2PEBA 5GAGP 3U1MA 4EMDA 1N34F 4OX6A 2C2EA 2KLAA 1S0OA 4DV3J 5CZ2A 1HBMA 1ASUA 3CJ9A 2HBZB 2K06A 4CLPA 1YZ7A 3BM7A 4CIOA 3WXMB 3B8HA 1YRXA 1NGCA 1S1UA 2VV5A 3GBTA 4LBHA 1NOYA 5JLFA 2OZMA 4HUGA 4USHA 1BUXA 4LFBF 1AZSB 2CVEA 3THWB 4N56A 4IO9L 1FWKA 3DYAA 5AQGA 5B0AA 4ID5B 4A48A 1VRTA 3LPUA 2YX1A 5AT1B 3D0GE 1M90O 4NYNA 2Q1NA 4W90B 2BJ8A 1UA1A 2VG5B 4HHTA 4PA1A 3C16B 2BDPA 1XC3A 3LF0A 4ELUA 3PIPL 2VBXA 3A8YA 3PW2A 4M5KA 1OPZA 2KKZA 1TL7B 4W98A 3JAMO 3EX7B 2JJ4D 1KONA 4F4AA 2BMBA 3DDNA 3LP1B 4Y2KA 4C4WA 1B64A 2GBZA 3BQ2A 2YPZA 2D3O1 3QYYA 3QGIA 2RMLA 4G65A 3SCLE 2AHOB 4OJRA 3FBCA 2KH9A 4X4RA 1OH7A 3VQBA 3T3FA 2DGTA 2ZJPQ 3AVNA 4M5NA 2GIRA 1RAGB 3AQPA 4L8RB 1H2UX 4C8MA 4B1WB 4DV4F 1NMDA 1Q8IA 4H5WA 2DNKA 1GOAA 2NSCA 2HBYB 5BPMA 3ZSYA 4OO1J 3VAFA 3W2VA 2CPHA 3FZBA 4WZMA 2A0FB 2YKMA 1EWRA 1C0FA 3I55N 4N8NA 4Z2XA 3I0SB 5I42B 3BY5A 5LJVA 2QI2A 4Y28C 3M5RA 1UJ5A 4GKJK 1LEOA 2CQIA 1ZZNA 3I5BA 4BCAA 2JLGA 3NNAA 2IM1A 2R7WA 2ZOFA 2XSJB 3IBCB 1Q82O 2N82B 1FW6A 4LBIA 3MR5A 2KHDA 5CY4A 4BE2A 1MDUB 4AXIA 1IBKJ 3CCVS 4M45A 2C3YA 1PAUB 2QMWA 3JQJA 2BJ7A 3IFRA 3Q8RB 2DJWA 3GWCA 3KUGA 5HL7Q 3OBWA 4NPOA 1N8RT 1RT6B 3KUHA 3VQ5A 4N47A 1YIJN 3GE9A 1MSWD 1FXRA 1WUUA 2X1GA 5KG2A 1IG9A 1S3XA 3ULEB 3QERA 2DNHA 4PWDB 4U96A 1UPMB 3HF5A 1UVNA 2FF3B 2A10A 1DURA 1RCHA 3TA1A 3V4IA 1I51B 1RT3B 4JI0J 3VOVA 3MD3A 4HHUA 4CIGA 4BRFA 1J53A 2VG6A 1N6QA 1S9FA 1DTQA 1V3SA 3VQ6A 3A3PB 3ET6B 1Z26A 4X66F 3K5PA 1VBKA 4JRQA 5E0OA 2HLTA 7FD1A 1R8CA 4NXNJ 3F41A 4DU8A 2BVZA 3KLGB 2ZNYA 1KD1T 4ZPCA 2PIIA 5KFSA 3VA0A 3AA9A 2CPEA 2UVWA 4C8ZA 1HWUA 3O3GA 2CFXA 2DGOA 3WUHA 2R8GA 4I2QA 2NXUA 3F9KA 3WX8A 5F8MA 3EO3A 5AJ3J 3RMCA 3NFAA 4DLGA 3C6UA 3F9MA 3P3DA 3NAEA 4GNIA 2FTRA 3GFXA 4MKYA 5KT7A 4UUXA 3BH6B 1RT4B 4BR4A 2P9SB 5J1NA 3QQCD 1TUGB 4LF7K 4UZCA 2BQRA 4ZP7A 5T7LA 4ZKAA 1F5AA 4ZPTR 3O4QA 4GKJF 4DQSA 4ZP8A 4FK0A 5IM0A 1IKWB 2NXNA 4YEAA 2I7PA 3PM9A 2XZDB 3BPSP 1VRUA 3DMJB 2E5LK 3O9QA 2GA7A 2JEFA 2VC1A 3AOBA 1LFWA 5HP1A 4X4PA 5DM7Q 3PW5A 4JLHA 1VQ6S 5DM6Q 4X66J 1JKHA 3ZSZA 1GMVA 1I94J 2YWWA 1R7IA 4NLBA 5KI6A 3H2LA 4PUOA 4P74A 3W9JA 1FCAA 2ALZA 2XI3A 2I8EA 1VHIA 4P72A 4FYXB 4DR5J 3SQ2A 5DRKA 5JS2A 2ROGA 2CQ2A 5FRNA 2LU2A 1FJGK 3NE6A 3SDEA 1T9WA 2YQ0A 4KT0C 4DTSA 2VFVA 3I82A 2P9CA 4X64F 2B56A 2IYIA 3Q8YA 4HHJA 3ZZPA 1NJWA 2UVRA 1TFWA 2POKA 3GONA 4GVMA 4DV2J 3NH1A 3VF6A 2HHHF 3HFKA 2J5AA 1NJIT 2J0XA 1T8EA 4QWDA 2QEXN 2IA6A 1FDBA 5DGAA 4F26A 1JNRB 3N28A 5A0YB 2LU1A 4NA2A 4CJSA 4FVCA 5DM7L 1Q8KA 3CGIA 1M5KC 3CJ7A 1RT2A 1YAGA 1NU4A 5BRDA 1GT8A 2MQLA 1F5CA 3EJMA 5B0GA 4B3TK 4A8OA 1XI1A 2B4VA 4MLHA 3U3GA 3O9RA 1XNRJ 1TTHB 4B3RF 2P9PA 3OHBA 3AH6A 2VJUA 3AVIA 1ROFA 1Z1ZA 1IM6A 1IM4A 3J7AP 2IMWP 5D8HB 2DGVA 2FBXA 1XWLA 4P7VA 3AVJA 1K8AO 4KY3A 3GCXP 3G4SN 4EUVA 4BRMA 3J80U 3GFZA 3ZTQA 1S6PA 5AQUA 3FZ2A 1VISA 3MPUB 1Q9XA 2XQCA 1XR7A 3LH2S 2QWMA 2XCAA 3PX0A 2GELA 2XO6A 4Y6IA 2DGWA 1WI6A 3OFGA 2C3OA 1QAIA 1NDCA 3QDKA 2FB0A 1LCUA 2WFBA 3CT9A 4B3SJ 5KG0A 4NYZA 2ASOA 3GFYA 1FK9A 3MWBA 2ZFHA 5KFHA 3J81j 1AFIA 1BA0A 5HROB 2XMJA 2OMOA 2BGGA 4YY3J 3VESA 1UPPA 2AEMA 4MKAA 2NQPA 1FNMA 4MK8A 4IO8A 5HO4A 1C0TA 1IBKK 1MMLA 3TWHA 3HO1A 1RWVB 1FFGB 1DQ9A 2P9GA 4Y0FA 3R9PA 2E1RA 2Z2ZA 2P9NB 1SV5B 1EX4A 2WVEA 1K47A 2PEHA 4H5TA 3SAGA 5FRMA 4DFJA 2CGKA 3LTOA 4FKXA 1VS3A 5RUBA 5T7LB 3AO3A 1XHZA 4RBUA 1S72N 1YTAA 4FJJA 2DNQA 2O5DA 4HLBA 4LF7J 4LQ3A 5LMUJ 1YSJA 4E0DA 5AXLA 1CZAN 1U2FA 2L3MA 1S59A 1YF5L 3EVMA 1WOOA 2XMTA 3PXGa 5AFUA 1HHSA 4P75A 3CF5Q 2JOQA 4YDUC 3GSDA 3CMES 3EYZA 2A41A 3LP3A 1LXJA 2DH9A 4QIEA 2O3DA 4M5DA 3TUIC 2O8FA 1S22A 4X64J 4I9LA 4WQ4C 4I4BA 5K8OA 4LVNP 1M1KT 3TR8A 3AD8C 3UCGA 4F25A 4ZPWR 4IOCL 1RU1A 1RGVA 4CESA 1B7YB 2YKQA 3IGNA 5DLFA 2XGQA 3FQLA 2VWKA 1NSPA 3DHWC 3IS9B 5KFKA 1OWXA 2ZQBA 3T19A 3FGUA 4GMJB 1VSDA 3GE1A 4JB8B 2X7IA 4DV7F 4DR2K 3O6WA 4Z4FA 2NRTA 3O80A 4I7FB 3SZ2A 1UETA 4PZVA 1TK0A 3UKUB 4IFVB 2HBRB 4M5LA 2OPSB 2BX6A 3P5BP 5HQMA 1B0PA 3D1OA 6FDRA 1T9TA 4DFKA 4XDDA 2C2OB 2QYGA 2K2PA 4MT1A 2FBYA 1PYTA 2QSFA 3RG6A 5JS1A 2HWIA 4BVPA 1TKTB 4DQQA 3OTOK 1YWXA 3FZKA 4BE0A 2DR7A 2CADA 4BR0A 1RAJA 3D6MB 1XIQA 3TSPA 4DR1J 1P8ZA 1K0VA 3TAFA 2KB2A 3CIZA 1OSCA 2VQFK 1N54B 4NLDA 2UXBK 4P9SA 3SFGA 4K4YA 3EN9A 2YHXA 1LOTB 3WXKA 3L8BA 3C94A 4EFHA 3VTIA 3SUPA 2W7OA 3OYGA 2Q31A 2Q66A 1VQ4S 1GEHA 1U6BA 2DR9A 1RWKB 2KU7A 3DXKB 4CBWA 3NS6A 3BBBA 3HHEA 2BABA 1YI2N 1HBUA 4FNIA 2E9TA 1KAZA 2YJFA 1BLUA 4ZCLA 4CH0S 5L1JA 1Q79A 5GVQA 3LGNA 4IG3A 2PE8A 4IEEA 2PGCA 1RUSA 2YVSA 2OTLS 1PG5B 2OJ3A 5C2FA 4JNEA 8RUCA 1R0CB 2OPRB 4OX9J 4ZVHA 4A8YA 2VPZB 1BWEA 4YB6A 5DLGA 1HPZA 1BO5O 1X9WA 1Q5VA 5DGBA 3GIKA 3OVBA 3MF5A 3QMLA 1UVJA 3ZZYA 1VQ9N 1WKJA 1PGZA 4I69A 1M0SA 3BN7A 5HAOA 2KTQA 2R2RA 1F0XA 2JRSA 3CD0A 3ZX2A 5E33A 1BCMA 4JI7K 1NAQA 4A8FA 4O0JA 3TZZA 1RP5A 2FY1A 4CDIA 2BE2A 1SUQB 4AQYK 5CE3A 2XLKA 5TKWA 2BZ2A 4JN4A 2ZH3A 2MQNA 4JI1K 1NUEA 3ZEUB 5HMWA 3ENVA 4HT5A 4M5GA 4RG8A 2F7VA 3T6BA 4UUWA 3VR1A 1E6YA 1FD8A 3QSYB 1VSIA 1FVSA 2CQBA 3WDOA 3SBGA 5ELZA 4DR4J 2OTJS 3JQMA 4O4GB 3D54A 3GOIA 1DQ8A 1U47A 4DV1J 4N41A 3KG0A 1SV5A 2R7QA 2WSFC 2CDQA 2ACMA 2YNIB 3AHPA 4H5RA 4KHPF 1LQ9A 3QEVA 1FFWB 4GVEA 4YNQA 1NK5A 4DV3K 2L08A 2D0OA 3GIJA 3CJ8A 5AFUH 3CDEA 3L3UA 4O55A 3KLHB 4H03B 4NLUA 4FLVA 2CVIA 4DB3A 4YY3F 3D6RA 1RDAA 2UUCJ 4FPRA 2C1EB 4CHYA 4GVBA 5KRTA 4F9OA 1OPIA 1SIWB 3MPWA 3D7EO 3GYNA 4FOIA 1Q86T 3J81O 2ZZNA 5IT0A 2BRLA 4F3OA 3SFUA 1NKEA 5DG8A 3RGIA 3PEJA 1TKTA 3J7YU 2JWLA 4CW7B 2HQFA 3NNHA 2KVIA 3JSBA 4U95A 1CULA 4DUZK 4B3MF 3H8YA 3N6NA 2D9PA 4JK9A 1NGHA 1U1RA 3OVAA 1NLVA 5AR0A 2G8UA 3KLEB 4I6AA 1TVRA 3E9PA 3S01A 4ZVEA 5E3PA 3OSPA 5DM6L 2OPQA 4I68A 1A0OB 3Q8QB 4OYZA 3TEGA 1UTAA 1X31C 4ZVPB 4JKCA 2A1SA 3UCUP 1ZA2B 2EBGA 2AGPA 1ZBIA 2P6SA 4JKDA 2VCPA 1G3OA 2ZH1A 3IRXB 2YHBA 5CABA 4W5TA 4KHWA 3G87A 4FJ8A 1HNWJ 4H8KA 4B9UA 2J6SA 4I6WA 2MSTA 4OJ3A 2HHHJ 2BKOA 1UFWA 1JLCB 2E1PA 4BRAA 5ETMA 1Y64A 3CJ5A 4LIRA 3QT8A 4RR5A 4DX5A 1ZH5A 5E3QA 2RRBA 4QPTA 2CXEA 3F2KA 1DTTB 3DLEB 2VDIA 3DRSB 1QSYA 4YOUA 1W2BR 2BQUA 1VCTA 3OXGA 4RNFA 1TP7A 1RAOA 2ZE2B 4F8RA 4JKEA 4OKEA 2GMJA 2R7VA 1UVIA 4FPAA 4LFBJ 1NKBA 5GADI 4H4MA 2XLJA 1HQ2A 1HUXA 3CCSN 3SBTA 4KGMA 4R5PB 4HTUA 4NMLA 3Q8SB 4HTJA 1EWQA 4KB7A 4ECZA 3H4BA 3QAEA 2EFOA 4KV8B 2AP6A 4IYQA 5D4LA 5AQMA 3H20A 5KOWA 3VCDA 3S8SA 4KHYA 2ILZA 2VA3A 1NJZA 1P27B 4NWBA 3CERA 2BV3A 4CF9A 1U7LA 1NEEA 1UEVA 3R5BA 3N79A 1NH7A 4NZ6A 2G1HA 3RAQA 2XZTB 3OXFA 3AVGA 2X1AA 2GNKA 3TX8A 1XJWB 4B3SK 5AQHA 3N4QA 5M2RA 4O3PA 5E3AA 2BACA 2D0PA 1T3OA 2BOPA 2EFNA 4CEBA 3IS9A 1SJ4P 2DY9A 4X65F 3OJUA 4TSXA 3G4SS 3UDCA 4L3QA 4JHDA 2ZE2A 1VQMN 5E41A 1WACA 3N6LA 1MNEA 1U6FA 2Q6BA 3CJTA 3W64A 1WEXA 3G8SA 2QLFB 3RRHA 2RQMA 1HJRA 3MM7A 1K73T 4FJNA 2P9KB 4A5BA 3TP2A 4KGZB 3JB9k 2XY7A 3S7RA 2W42A 4BE1A 1YJNN 3DM2A 1SPBP 4Z4CA 4WIIA 3MMBA 2ZH7A 4PR6A 1VHXA 1RDDA 4FLTA 1JLGA 1IJFB 2RRNA 2PFFB 3IXQA 4ANEA 1GLBG 1QQNA 3W66A 5A8KA 1EQ0A 2IDLA 3LAKA 4EI2A 4LF9K 1YJRA 1ZETA 5CQGA 1KQGB 4DSJA 3GYXB 2XY5A 2KQ2A 2LEPA 3NS5A 4Y00A 5LMNK 4KBIA 1WG1A 4JKBA 2UUAK 2YWHA 1J5OB 5L38A 2E1AA 4YHHK 3HI9A 3OHAA 1LWCA 3W7BA 4DV0K 3EL2A 2VUGA 4Z4IA 1H0HB 5A2QY 1LOUA 3DU5A 2KXFA 3PY8A 1F3VA 1RLCL 3TUPA 3NGTA 2D0CA 2XY6A 2MJUA 5AQYA 1HWJA 2AW0A 4GY2B 3Q24A 3LDLA 1KP6A 4IJAA 5AZIB 3PVXA 4I56A 9ATCB 1HIYA 1K9MT 4F2SA 2IVMA 4NXNF 4FWPA 2JWKA 2IHR1 3W62A 3MCPA 1ZBSA 3SUQA 2EWSA 3E1YA 1YI2S 4FK4A 1L3UA 5M2PA 2E88A 1VIXA 4B3RK 1TQLA 3CC4S 2EKNA 1NGDA 1S1VB 2YNIA 4AFFA 4ZCKA 5KGXA 4DDFA 3VQAA 5HVFA 3WIVA 5C7PA 3WQUA 2AYEA 2FHJA 1V6HA 4K2JA 4OGCA 1RAAB 4FYDA 2QKBA 3GDQA 3OTDA 1WSIA 2DNGA 2HNDB 1P8GA 3U02A 3M6WA 3PR5B 2UU9J 1X5SA 3HK2A 4KTZA 5B7WA 1JK9B 4JV5J 1O6XA 2V51B 1BHLA 4N76A 4RW8A 3ZEUA 3MN7A 1FWLA 4P73A 3WXIA 3CCRS 1AT1B 1RTIA 2HB5A 3ZX3A 3M3ZA 2J4RA 1C4AA 2F7TA 2FPHX 3H98A 4FJHA 4A8KA 3QPIA 5T41A 4EZ9A 2ZEJA 3UPFA 1SL2A 2I9SA 1QAYA 4IH7A 2KM8C 3AVFA 3KLGA 2IS3A 3TO8A 2AKWB 2LP4A 5H9EJ 2O8EB 5GMEA 4FYYB 4JV5F 3N5FA 3MPVA 4ED5A 2KZZA 2GV9A 2XHWA 4NYOA 1B99A 4DI6A 3ZTSA 3BGRB 4JI4K 1IWGA 1DKGD 1XMQK 4QS9A 4GMKA 1HR0K 2MGZA 4NXMK 1S1UB 3QATA 3F44A 3AJ1A 1ZS6A 2DH8A 2R7RA 4Q5VA 1KVAA 4ECSA 5AQPA 4DUTA 1WWHA 1VQ9S 4H5NA 4KAIA 5KFZA 4GC6A 3W5XA 3HX9A 5BRFA 4B1XB 4M1KA 5F1XA 5FD1A 3CWJA 1XNQK 3HM9A 1U48A 3NGUA 2MLYA 3L9ZA 2HBKA 2CWXA 3BGOP 2OPPB 1K44A 3N9UC 2QZ8A 3FMWA 3UVJA 4YMEA 3JYTA 3OVNA 2HPUA 4PG8A 1NJIO 2JNJA 1S9GB 4DN0A 4FJXA 4CYUA 2H48B 4F50A 2OZSA 2B51A 2V63A 1APSA 4FJMA 3WX4A 3I9V9 4ER8A 4ELVA 4J9KA 4CI0B 2LLZA 4CJLA 3OW2M 3HVWA 3W60A 4H0YB 3FSIA 5KT2A 4K25A 1YJUA 2BR0A 1LAVA 1HYSA 3IAM9 3G6EN 2XB2D 4ZHRA 1T44A 3FR0A 3THYA 4ED4A 4YN3B 1DJ0A 4QR1A 1VSFA 3LP2B 3UFCX 4AQYF 2Q0RA 2MQMA 3H5SA 2E4LA 3TZXA 1RCOB 2E7WA 4OI1A 2DGQA 5KFOA 4CJWA 2ITGA 2EW9A 3BSNA 4C8OA 1H7XA 2YWFA 3A12A 2FVPA 2XS5A 3MCOA 2P51A 4OHZA 1KQKA 1OSDA 2E5IA 4A47A 3P49B 3ULEA 3S9HA 4BC7A 1QVFM 3LP0B 4IO9Q 5C2GA 1HNZF 2N3LA 4LF9F 3JYTB 2A40A 5BYRA 3F56A 2RDJA 1URNA 5CHIA 4HHHA 1H98A 4DV7J 4F3MA 5GMKa 3ZFVA 2VGNA 3EXYA 4CWBA 3D3CJ 3V9XA 3ZT1A 1SB6A 1SBRA 5KFUA 3E01B 3DOLA 2FZKB 1RDRA 4JKGB 1U8WA 2MZTA 3OFHA 2ZOGA 1BGXT 1TMMA 3LDQA 5L39A 3DYAB 2DNMA 4EP4A 2RVJA 2UV8G 2EFPA 3DLGA 3CJ3A 3ATUA 3MX2A 3I5AA 2KL8A 4JEPA 1S99A 1QD1A 4FZXC 4PQUB 2B7BB 5AQQA 5FLXU 2CUYA 1ITGA 4UT4A 2H5EA 4BS2A 2AEJA 3H2UB 1XMOF 3M2VB 4NA3A 3EDQB 3FE1A 3DLBA 4K5SA 4GO5X 2A3JA 3WQTA 4J7CA 3GV8B 3TTDA 2RHQB 4BC9A 4B3TJ 4FJIA 1NU0A 1HA1A 2HRUA 4FWQA 2LQBA 3WNFA 4MKVA 1J2VA 4WFAL 2KT2A 1FX2A 3H6EA 3MN5A 1RYRA 4BC5A 2FZCB 3DLKA 4X84A 2CKWA 2H3EB 2HBMA 2RQ4A 1R89A 3DOKA 4PY5A 4TNOA 4C1NK 4ZVUB 1NGJA 4KAZA 1T9VA 1SKUB 4FVMA 4JP8A 2OI2A 3KWGA 2DHXA 3V9SA 1Z4UA 3IG1B 3AA5X 1NZAA 1NHVA 1BQXA 3FZMA 4DTUA 3MFIA 4EBDA 5AZJA 1RYSA 2GW8A 4JI8F 3VPZA 3L2RA 3JTOA 2O8FB 2QA4N 3NWGA 1UZDA 4XEIA 2RN2A 4ZMMA 5MLCV 3P8BB 1XR5A 2HNDA 3W1YC 4ECWA 4IOAQ 1PC4A 1TELA 4NASA 5HRPA 3EE9A 5IQ6A 2VG5A 3IAS9 2AX0A 3TAMA 1BHNA 4B1VA 1NH8A 3P5TL 3IR7B 2I7NA 2D1CA 1AXQA 1IBMJ 3A8EA 2JSXA 1M5VC 1YT3A 2IBOA 3WT0A 4YB1P 4LR9A 2F8MA 1NGBA 1F2GA 2P9IA 3G6VA 4KYZA 2FC9A 1GOBA 5G0RA 1DY3A 3ONQA 1N34K 3HT0A 3B6PA 2QLWA 3MCAB 1KFSA 2LDIA 2RUGA 1QQMA 5L1KA 1GXUA 1EETB 2VGMA 3MR6A 3OXLA 4EYIB 1F9FA 5GADU 3QGGA 2CJXB 2ZJQL 2HS3A 4DXLA 3RSEB 1O51A 3LW5C 2GWKA 2RB7A 3K58A 5HROA 2OD4A 2MXYA 4JI4F 3OL6A 4PG4A 2J0WA 3V6KA 3RB4A 3L3CA 4CTAB 4CJEA 2U2FA 3MMCA 1VQON 1KC8T 4ZVTB 3I9ZA 2ZHOA 3VVUA 3AXKA 1VK3A 3BSCA 4P2MA 2Z2LA 4BREA 1N32K 4CJUA 2Q3PA 1RAHB 5F8JA 3EEQA 3WEEB 3P38A 2AU0A 2MB0B 2DFFA 3TAPA 1Q9YA 3CE8A 1CSJA 3GR0A 5LMNF 1YIJS 3D2FA 3AD7C 1YITN 1S0VA 3SBMA 3V5RA 4OYXA 5A8KB 1S1XB 4IOBA 4LF1A 2P9LA 5IM0B 4CEEA 1H74A 2M4MA 4B9NA 1JXEA 3CCVN 3TQEA 4DR7K 1WN7A 5AQIA 2RPIA 2HRYA 5ETQA 4J9SA 4JAXA 4DR4K 2E5LF 4NYPA 3MDFA 2FZGB 1Y0HA 4ZVSB 1CJUA 4DU4A 2M0GB 3K7RA 3TRGA 2Z2MA 4BWMA 4MK7A 2MZQA 3KLVA 4MIAA 4OI4A 3VGUA 3R8YA 2XEXA 3C6HA 2MKHA 5AQTA 1EQMA 5BPLA 5KT4A 1HARA 2PI4A 4I2QB 2G4BA 5AQWA 4Y1DA 4F67A 3MMCB 4Y2AA 4O23A 3AOAA 2GGPA 4YR0A 2XHBA 3SPYA 5IT9U 1XTZA 1C1BB 2GX9A 3MEEA 1BD6A 4FN5A 4OYBA 3RW7A 2I5JA 1HWKA 2AJQA 4FWLA 3I87A 1L3KA 1FEEA 5KG4A 5FDLB 2C2KB 1JB0C 2M70A 3SQ0A 2LFVA 1S49A 1BU6O 3GIMA 1WHVA 3ZXWA 3MMAA 3MD1A 6FD1A 3KOAA 1MROB 2LKZA 2CJ9A 3ILJA 1AFJA 2Z1HA 4BC2A 5DETA 1NZ8A 3ALYA 4PUOB 3VERA 4LF9J 5HATA 1M1KO 3E9OA 3KLIA 2PA3A 5EXWA 4XAKA 4WP3A 4I6YA 3L7OA 5KOXA 4DV2K 2QX0A 3R9LA 4FO0A 3TAGA 1GXLA 3I8BA 2RSQA 4RUAA 4DWIA 3FQKA 4OX9F 2MKKA 1M5HA 3Q89A 2FJVA 2F63A 1DARA 1T0TV 4PWUA 1QE1B 3R7BB 2ZZMA 2PMHA 1ZTWA 3AOCA 5M1NA 2VF3A 2VYPA 1EHWA 2WRMA 2HZCA 5BR8J 5K14A 1K1SA 5EX0A 3T5JA 3DM2B 3QBXA 5KFTA 2PFUA 1RT4A 4J9OA 3LAMA 3C65A 1HNXF 2DKOB 1MG7A 3LP0A 1VI7A 1RNHA 2IC3A 3NF8A 2ZJRQ 2EK1A 3KHLA 3VEWA 4A8WA 4PL8A 3C6UB 3IG1A 2ZH5A 5CD4H 4DV5F 3M8QB 3SSSA 3K57A 3SEOA 4M63C 2OELA 2X3GA 2Z8QA 1IO2A 1IKYB 4U67Q 1UFKA 2ZNZA 5G4DA 2DR6A 4IWVA 4IFYA 5F9NA 4FNHA 2KRRA 2QL5B 4ISGA 4ISFA 4CBUA 3HHLA 3K5NA 3AVLA 3O1WA 2OPQB 2AGQA 3CNQP 3A1YG 4E89A 3T1YF 3NF9A 1T11A 1WDDA 3PLAA 2B4PA 5CYMA 5HBMB 5A76A 1N56A 5AQSA 2UUTA 4CE9A 3O9SA 1VHFA 2NUHA 4C0OC 3TR5A 2B6AB 2NZTA 4QIGA 1O1WA 2VB6A 2DGSA 3O6QA 1T02A 4RTFD 3A3NB 4EAHD 3LP1A 1EKEA 2LECA 4XK8C 4PYAA 3D0HE 3H5YA 2MQQA 1D3WA 4KV8A 4DV2F 1VOMA 3T6JA 1J9AA 4J5OA 2ATLA 3DOLB 1S7HA 2HVHA 4RKUC 5BR9A 1RA7A 3UB5A 2GS8A 4CTAA 3CD5A 2W7AA 3TTFA 2EXUA 2GCFA 3CJSA 4ISEA 2O8CB 4AT1B 4LIWA 1BA1A 2M3DA 5DQGA 1F60B 1DTTA 3OYFA 1UZHA 2JHEA 5J1PA 4RCHA 4QOTA 1HNZJ 4OZ0A 3JSRA 4JV1A 3HHLC 3H1VX 4MDBA 3I0SA 5I42A 5ETRA 3UD5A 1HBMB 1T9XA 3MXIA 4CJ5A 5CD4A 4DV5K 3BREA 3QNNA 4KC5A 1NM2A 1E6YB 4ILGB 4NL5A 4FPIA 2HLUA 2JL9A 4OX7A 2OEKA 3MAQA 1SI9A 1X9SA 1HYZA 4RW7B 1S6OA 5D3GA 2ATQA 5AQNA 1RZMA 2XTJP 4X4QA 3H08A 1TVRB 3ZSVA 2DXEA 3J81Y 2MDAA 3SXLA 3OTEA 3HHLD 1RTIB 4LQ9A 3J7ZT 4JV5K 4G3IA 2VONA 4NE9C 4JKHA 4WP9A 3DNCA 4USIA 4DTOA 2C42A 1VQ5N 1CBKA 3DLJA 2W1BA 2AJ2A 2YX7A 5KRSA 3CF5L 4DV5J 1TFYA 2RIJA 5BN8A 3FZLA 4L3NA 1V3RA 3LDNA 4AF1A 4CH1A 1UWBA 4RW7A 4DHVA 1VAZA 3DLKB 3VQEA 3VF0B 2HHHK 2EBEA 2X6SA 2WVFA 3O3HA 4F4XA 2UXBF 4ECQA 5KT5A 1WC0A 3N6MA 4KKOA 4CLKA 2R2UA 2IJFA 5AJ3K 5E84A 4EHTA 4WFNL 4GC7A 1HKBA 5L1IA 2IIHA 3BQ1A 2QWRA 5KTQA 2DY1A 4Q2MA 1OJ4A 4X4UA 5JMNA 2L41A 4OHXA 4ZVRB 3VZIA 4CM2A 4OI2A 3LGMA 2CJAA 3G6YA 2MGZB 3B4DA 3PHEA 3O8WA 1IR1A 1VMBA 4E8UA 3I56S 4HACB 3PRVA 5BYQA 2CGLA 3NBPB 2HMIB 3OUYB 5CR4A 1CLQA 2MKSA 5I4MA 4AL6A 2DNNA 4QYZJ 5M1PA 3SCXA 3WHIA 3FDSA 3NRBA 2R7YA 2WCXA 3LA0A 1FDAA 2C2ZB 2GQCA 2G8IA 3QZ8A 3FKBA 4H0PA 5ETSA 2YCHA 2UXCF 5D4PA 4LRBA 5IV3A 3EMTA 1H72C 1J5OA 5F2RA 1MWQA 3H7HB 2WTUA 3LWLA 3SYZA 3QESA 4IUFA 2MLZA 2JVRA 2OMLA 1KRPA 2B6AA 2A2CA 1VIOA 3UO0A 2XWYA 2LMIA 4BQLA 2DRAA 1Y5NB 3ILIA 2V9WA 4NCAA 4ITSA 3MAAB 3W9IA 1JXBA 3DGPB 3NGSA 3IWNC 5F8GA 2KVQE 3RRGA 2V2ZA 3VGKA 1KVCA 1VSLA 3A2FA 1WKKA 5BPNA 3VQ8A 4EBCA 3O3LA 5CYQA 3ATVA 1N33K 4JKAA 1HBUB 1T03B 3MTKA 1HYSB 4CNZA 1WOPA 4HI2A 2KT3A 4BC4A 1D9FA 3HHKA 3WNGA 2QWPA 4X4SA 2ZGYA 3AY9A 4I0WA 4J9RA 3QMQA 1JJ2M 4M5DB 2EFQA 2QRRA 3KIOA 4J9PA 1S97A 4HTLA 1FHTA 2YHWA 2E66A 2VBYA 2J9CA 1UP1A 3HVTB 4RW4B 4DUYK 4B9SA 3VMFB 1QHAA 4ZP9A 3ZNJ1 3FCVA 1B92A 1IH7A 1S57A 4ID8A 2KFNA 3D66A 1CJTB 4USWA 2EWHA 4QIWD 2W4DA 1TKZA 1FD2A 1G7CB 4L75A 3IR5B 4MFBA 3CXCR 2W2MP 2VA2A 2OFHX 4M7XA 1WNEA 2DNLA 2R4FA 2BA9A 1WAFA 2ACYA 1RWMB 5IXUA 4WYLA 4YOWA 3HVAA 3AXMA 5KG3A 4KHUA 1RFQA 1KQSR 3L7UA 1S9EA 2B5JB 4M7YA 4XH5A 1YJVA 1HJOA 3CQXA 4IH5A 4WFAQ 5HJYA 2GVDB 2FJDB 3RMBA 4E7JA 4CBXA 3HFVA 4GW6A 5FPMA 2GTDA 3K89A 2J9DA 3PFEA 5EHHA 5DDPC 3UKUA 5EY4A 3DN9A 2R2SA 1DFDA 3K5MA 3TJ9A 3KLIB 5E3CA 1YRTA 2YKPA 3OYIA 1TUYA 3HKZD 2AV5A 2A3ZA 4C8NA 1JLGB 4X65K 4ZN1A 2V8VA 4LVOP 4JI2F 5GAHP 3M9OB 2WONB 4BGBA 2O8EA 3PYFA 7FDRA 1EKRA 3ITHB 4Z7YA 3SQGB 4DR1K 3MEEB 2GHVC 3DRSA 2EKYA 4WF9L 1BMQB 4P2FA 4CD3A 3PKYA 4P71A 2HFUA 2R8JA 1N34J 5D15A 3KJNB 5KFBA 1CJKA 1JJ2R 2QFJA 4AHUA 3CM5A 3CIMA 1NJXA 4J9LA 4JHDB 3RBXA 3IMQJ 5E7OB 3CCMN 3GV7B 4K0KF 5AE3A 3PJWA 5B08A 2DH7A 2HQ3A 1RAIB 3B6BA 1N32F 2KXNB 4N5SA 2XY8A 3R6GB 2C28A 2HWTA 3V9UA 4L76A 4KHRA 3KG1A 2FJXA 1YTUA 1EARA 3HHDA 2ALYB 4ZTFA 3EKSA 2UUBF 1LV5A 4DR5K 4M94A 2W9BA 2QV6A 1YUWA 4IOXA 3ZSOA 1VQ8N 4JI8J 1U09A 1F5BA 3OW2R 4BRPA 1S1XA 2CDRB 3ILLA 2A2DA 2Y1RI 4BRCA 2E5LJ 3CCMS 2DGUA 3FMBA 3NOCA 2CPDA 1EP4A 2B9XA 1VYAA 2HHUA 1SXLA 3O2IA 1P9QC 3Q0AA 1E6VB 1FJEB 3NNCA 1V9OA 2DHSA 4YB5A 1TUUA 3T69A 2XWXA 2DO0A 3HMJG 4DKWA 4DL7A 2NRRA 3W5YA 4C98A 4QU6A 1JXVA 4LF4J 1DAXA 4LRCA 4A4JA 2W6KA 2I38A 4L72B 5ETTA 4BRDA 5AZIA 1JLEB 3SK3A 5H1SV 4DL3A 1HNWK 3MM5A 4NOHA 2XMVA 2V5HG 2V8PA 2VKRA 3DKDA 2HZVA 3CD6S 4ILRA 4URSA 1SKSA 3RSEA 1PYOB 1NHKL 2EC2A