3MEEA

Hiv-1 reverse transcriptase in complex with tmc278
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
552
structure length
552
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords p66 Reverse transcriptase
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 155
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3meeA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3meeA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3meeA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3meeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3meeA05
1HNIA 3O3GA 1J5OA 4QOZB 3ITHB 1GOCA 3PX6A 1C2PA 4CJ5A 1RTIB 3IRXA 1FXXA 5KRSA 1U47A 4IFVA 3QERA 1KFDA 2OPPA 2OPQA 4KB0A 2R2UA 3MEDA 3LP2A 4F3TA 3QEVA 5CYMB 1MMLA 3ZSVA 4ZHRB 4Q8FA 4LSLA 3GYNA 3IGNA 1BI4A 4IFYA 3CJ3A 3ZT3A 4FZYA 4L8RB 1X9SA 1N48A 3OL6A 3LZIA 2D3ZA 4E7IA 4J9LA 2HHUA 1B92A 1ITGA 5C42B 1JL2A 4EEYA 4J2BA 4IRDA 3HVAA 3SUQA 3H5YA 1EETA 3RBDA 3SI6A 2VG5A 1RT2B 4WE1B 5HBMA 4Z4CA 3OS1A 4TY8A 4RU9A 1CXUA 4Z4IA 1S9EB 3VA3A 1IKVB 1QQCA 3NGZA 4F3OA 4CEOA 4B3OB 1KVAA 1RDRA 3V81B 2JC0A 3LZJA 4TY9A 2PY5A 1X1PA 2EX3A 3O4QA 4RZRA 3T5HA 3NH2A 4J9QA 1Y97A 5K14A 2BE2A 4J9MA 4RW6A 3KTQA 1Q9XA 4PQUA 3GIKA 5DGBA 1ZYQA 3H59A 4ICLA 5C24B 4KHUA 4CJLA 3OYJA 3MFIA 1LW2B 1HYSB 3QESA 4ELVA 3QO9B 4WXOA 4CJSA 1XWLA 1S0OA 5CYMA 2XCAA 3NCIA 3KD5E 1JKHB 3NF6A 5KFQA 1QAIA 2VA3A 4J2AA 3PO4A 3EPGA 5C42A 4KAIA 4ID5B 5J2MB 1K1QA 3JYTB 1DLOB 2AX1A 1BQMA 3PO5A 1D9DA 4OJRA 3KHLA 4Y2AA 3ZT4A 3ZSZA 1J54A 1TK8A 5L1KA 4CIFA 1RT2A 3HP9A 4WE1A 4M3UA 4AHUA 3DLKB 4CEQA 3KLEB 3SUNA 3O3FA 2EHGA 3PW2A 3L2UA 3HSTB 3OY9A 2YKMB 4EZ6A 5F8HA 3FSIA 4R5PB 5DMRA 3AVLA 1D5AA 4R8UB 3TAMB 3V81A 1SH3A 1A5VA 4E1MA 1A5XA 3ISNC 2UVUA 1RYSA 3ZT2A 4CGJA 4DTMA 4OKJA 4M3XA 3LP1B 4KHNA 3BR9A 4MFBB 4OVLA 4DU1A 3CM6A 1NJXA 1BQNB 3AA5X 5KFIA 3N6LA 2G8UA 3VQ7A 1HYSA 1NK6A 1J9AA 5L1LA 5SZTA 2DFEA 5KFFA 1JLAA 1RT4B 4FBTA 5KFRA 4ID1A 3G6YA 3LDSA 4FJ8A 2WHOA 1JKHA 1Q8IA 1S48A 3NGYA 3BDPA 4FM1A 3VQ9A 3V9WA 4I7FB 4FVMA 3KLHA 1GOAA 4EYIB 3TARA 4KB1A 5J2MA 1XR6A 2HAIA 5KFBA 3QLHA 4FJGA 3QIOA 2IAJA 3Q8QB 3TWHA 1ZBFA 3N6NA 1TQLA 3H4DA 4ED2A 3LWMA 4KTWA 3CFRA 4CHPA 2HVIA 3DLKA 1ASVA 3DYAA 1TP7A 2G8IA 4FK0A 1LWCA 3QGIA 2YKMA 3HL8A 4DTJA 2OPSB 3MAQA 1J53A 2B6AB 3I0RA 5F8JA 1I39A 4CESA 3D28A 1WAJA 1UA1A 4GMJB 2FBXA 4DU3A 3TANA 3LP1A 5KFZA 4M3TA 4K8ZA 1S1VB 1BL3A 2E6LA 3AVGA 1KCFA 2IM2A 3SV4A 3HPHA 1BQNA 4ZVFA 1W0HA 4OGEA 3ZSXA 2OZMA 1VSMA 2R2SA 3CWJA 1FKPA 1NK9A 2ZD1B 5DGAA 3VQSA 4H4OB 4NLQA 2R7YA 2YNFB 2EC0A 4E19A 1RT4A 1L3TA 1ZBHA 3V9XA 3UIQA 4MK8A 4O3PA 3KLGB 2HHTA 4CJTA 4KKOB 4Y3CA 4I7FA 1IKYB 1HJRA 4DFJA 5KFUA 2C2EA 3F9KA 2HHWA 1SKWA 5EDWA 3WNEA 3O3HA 4DTXA 5HROB 3QEXA 3L2QA 4HTUA 1VSEA 4BE1A 3HKWA 4EYHB 3IS9B 4XPCA 3RMBA 3AVCA 4WXWA 3FRZA 2VG7A 3QEWA 4K8XA 3SFGA 2BRLA 3UDLA 2O4IA 4CFDA 3LAMA 3PV8A 4KRFA 5T14A 4O44B 4ECQA 1S1XA 3SPYA 2OPSA 3P5JA 1IH7A 5HLFB 3PHEA 2C2RA 3VQ6A 3NDKA 2XY5A 3PW0A 4IR1A 4LQ3A 5DG9A 4FJLA 4B8AB 5F8IA 4NLVA 4GVMA 4J9KA 4RG8A 2P51A 4W5RA 1HARA 2X74A 4Z4HA 1NOYA 4I2PB 1U04A 1TL3B 2GIQA 4E3SA 1NKBA 1B9DA 1C0TB 4E7LA 3KMQA 3HPOA 1CLQA 2ZD1A 4WFZA 3ZSWA 4H4OA 2FLLA 2VWJA 1VSHA 2Q3SA 3RMCA 4CFBA 5JS2A 3EZ5A 3B6OA 5KFOA 2PZSA 1WAFA 4KHSA 5KFLA 3KLGA 4CJFA 3KD1E 4F4WA 4KAZA 1JLGB 4KKOA 3DLGA 4DQPA 4CJKA 3GIJA 1ZBUA 1IKYA 3CYMA 4BACA 3ZT1A 4W5NA 1VRTA 3QEIA 3SYZA 3QNOA 1RTDA 1LWEB 1DTQA 4F50A 2W9CB 5F9LA 3JSMA 2ASDA 5HROA 1NK5A 2PYJA 1JLQB 3RAQA 3DRPB 4FYDA 4NLGA 4FM2A 3TI0A 4YP3A 3CO9A 3F73A 4DFPA 4Y2CA 3RTVA 4CK3A 2Z1HA 4NLWA 3KOAA 3LP0B 4ECXA 2RPIA 1C1BB 4QWBA 2AX0A 2W8KA 2KFZA 2V0NA 1SH2A 4CF2A 4EO8A 4O44A 3M8PB 1YTAA 1EP4A 1RT1B 3RMDA 4RNHA 4H8KA 3K57A 5KG5A 4CEAA 3K5OA 4WFYA 4FJNA 4Q45A 3KJVA 4RNMA 1QS4A 4E0DA 1S9GA 4ZTJA 3CJ0A 3AO3A 4CGHA 1FKOB 1X9WA 4CJ3A 1L3VA 3I5CA 4MKAA 3H4BA 2KZMA 3NHGA 3MXMA 4Z4FA 4J9NA 2O4GA 4O3SA 1ZBLA 3GILA 4FS1A 4FLWA 4AHVA 1VK0A 1TL3A 4FK4A 3HVRA 1VSJA 4M45A 3VQ4A 1RCHA 2AJQA 3OYLA 2W7OA 1BGXT 1HRHA 4OGCA 3K2PA 4NLPA 3T3FA 1C0TA 1QSLA 2YNHB 2D0AA 2XY6A 5EWFA 4CGDA 3MF5A 3ZSRA 1U48A 3PY8A 1RT6A 4CJVA 4DQQA 3AVMA 4C8MA 1JLGA 3BSOA 4BWMA 5CY4A 4CEZA 4DTSA 1HYZA 2R2TA 1SV5B 5I3UA 1LWEA 1RDAA 2W9CA 3NF8A 2HNZA 1WSIA 1JLQA 3DRPA 3MECB 3MEEA 3OYDA 4IRKA 2FVCA 4FJIA 2IMWP 4DEZA 1C1BA 2DY4A 4CERA 2V4RA 5KFVA 4OLBA 4W5TA 3TR8A 1Z26A 5FRNA 3PX0A 2OYQA 3HXMA 3KLIB 4LQ9A 3AO2A 3QIPB 2GC8A 3RAXA 2QKBA 3PX4A 3CG7A 2HW3A 1FKOA 3MFHA 2HNYB 4FJHA 4DTPA 4CFAA 3NBPB 2V9WA 3I0SA 1T8EA 3T1AA 2GIRA 5KFXA 3NE6A 3CJ2A 1N6QB 4NRUA 1CZ9A 4PWDA 1EKEA 1IKXB 1T05B 5EWGA 3VQPA 1TKDA 1U09A 3CFOA 4KO0B 5KFHA 4E89A 3L3VA 1ZETA 1RT7B 2YNHA 2O5DA 4IKAA 4ZPCA 3HT3A 2YNGB 1HYVA 4DS5A 2X78A 4JV2A 3QINA 3ISND 3B6PA 4F8RA 4ZP7A 5J1EA 3RB0A 4MQ3A 3SPZA 2Y1IA 2KTQA 4EO6A 3NGDA 2DFFA 5HRRA 5KG2A 2I1RA 1L5UA 1SV5A 4IG0B 4RW9B 4WYLA 3M8QA 1S1WB 4WFXA 1L3SA 4DSFA 3H40A 1S0MA 3UPFA 4TQSA 4DLEA 2J6SA 3MECA 3BQ2A 1NJWA 4CECA 2RF2B 5KT4A 2JGUA 3I8DA 3S3MA 3DRSA 4QPXA 1HQEB 4PUOA 1D1UA 3OYNA 1C0UA 4I9LA 4U6PA 1S1UB 3KK3B 2YNIB 1KFSA 2PYLA 1RT3B 4YMEA 1JLBB 2E9ZA 4LH4A 3H5UA 4FJKA 3QIPA 3WNHA 3SQ4A 2B4JA 3TAQA 2G8FA 4AHRA 3LPTA 2B43A 1TKZB 1HQUA 3QZ7A 4DSKA 3RWUA 4KI4A 2HNYA 2JEIA 4KFBA 1GOBA 2AU0A 3O4NA 3VA0A 1RDBA 1N5YB 3ITHA 4W5QA 3S9HA 4DL7A 1RTIA 1N6QA 5KFJA 3SFUA 1RTHB 2P5OA 2HB5A 1IKXA 4FCYA 4DSJA 4AILC 3OYKA 5JXSA 4KO0A 3BSCA 1RT7A 2XI2A 4MKBA 4CF1A 4K50A 4ZHRA 3DM2B 1TK0A 3BSAA 1KVBA 5C25B 4O3QA 4CIGA 4CF9A 1RBTA 3M8SA 1WSGA 4DTUA 4KV8B 2ALZA 3OJSA 1RYRA 4PY5A 2F8EX 4ECTA 3G0ZA 3MEGB 2IJNA 2NUBA 4NLXA 4IRCA 4CJUA 4DL2A 3MR3A 3KKRA 4NLSA 4NLYA 1S1WA 2Z1GA 3C95A 1S97A 4KPYA 3H5XA 3P1GA 2WOMB 2HHSA 5DQHA 4FJMA 1ASUA 4IH5A 4LY7A 3AV9A 3CDWA 4IOBA 1S9EA 3T5JA 1IKVA 2A1RA 2D0BA 2FLPA 4JV0A 3OLBA 5CZ2A 4ECZA 2YNIA 3VQ8A 5KFYA 2HHXA 1RT3A 4B3OA 3U3GA 4CFCA 3Q8SB 3BJYA 3QIDA 3OYCA 5KFTA 2G8HA 1S49A 1RBVA 2HMIB 1TKZA 2AWZA 3KLFB 2FBTA 2Y1JA 4XO0A 2YKNB 4DG1B 3LALA 5C24A 5J2PB 4URQU 1LW2A 2ILZA 5DLFA 4AHTA 3OYMA 1BCOA 3QO9A 2KW4A 1KSPA 5EUHA 1XHXA 4KHQA 3AVKA 1VSLA 3OYFA 3MR5A 3FDSA 1LWFB 4O3RA 3ZSQA 3DMJB 3PJXA 3HYFA 2AGOA 1KTQA 3DOKB 4ZVEA 2FBVA 3NL0A 4BDZA 1D0EA 4QAGA 4OPJA 2XRIA 1S10A 4KHRA 3E01B 2QKKA 1FK9B 2KZZA 5KT2A 4ID5A 1TKXB 3GIMA 3H08A 3JYTA 1DLOA 1DTTB 5J2QB 2F8TA 3L2WA 4AHCA 4DTRA 4O0IA 4QWDA 2OPRB 1KLMB 1ZTTA 1N4LA 1YVFA 3TAGA 3BQ1A 3D0PA 1RA7A 4GC7A 2YHAA 3DLRA 4H4MB 1TV6B 5KFSA 4KTZA 3KLEA 3K59A 2QE5A 3DI6B 2J6TA 4DQSA 4Y34A 4FLZA 4URSA 4FLYA 1RT5B 1TVRB 4M3WA 3T5KA 4R5PA 4HUGA 3TAEA 3H5SA 4DWIA 4Q44A 4R8UA 4DU4A 3WNGA 4CJQA 3TAMA 4FLVA 4YQWA 2D41A 4DMNA 2IGIA 1YVUA 3AVNA 4CJEA 2RKIB 4JLHA 4H54A 5KFWA 4G1QB 4MFBA 4DG1A 3VQEA 2R8GA 5J2PA 1B9FA 1S6PB 3HM9A 4BE0A 4M3YA 4K4SA 2XCPA 1KLNA 3ZSOA 5CYQB 3EZUA 1QE1B 4XPEA 4MK7A 1SUQB 5KT6A 4K4XA 2R8IA 3VQCA 4TN2A 3U3YA 4ECRA 3E51A 4DFMA 5F9NA 3PVXA 1LWFA 1NOZA 3AVAA 3LANA 2DPIA 2IC3B 4IG3B 3IG1B 4M95A 2D3UA 3K5MA 3V6KA 2B5JB 3E01A 3NF9A 1FK9A 4W5OA 1WSFA 1GX6A 5CZ1A 1DTTA 1C6VA 2FVQA 2D5RA 3ALYA 5T7BA 1A5WA 3Q8PB 1VRUB 4E7JA 1MU2B 1W9HA 3NKYA 3SNNA 2WCXA 2OPRA 3KNAA 3AA4A 4N41A 5F8MA 3AA3A 3FFIB 3QGGA 3Q8RB 3RB6A 3DRRB 4Q0BB 3HJFA 3DLBA 1Z25A 1TV6A 4M3RA 3A2FA 4MIAA 2BDPA 3DI6A 4CHNA 4G3IA 1RT5A 3OVNA 5L1JA 2VG6B 3AVFA 2B6AA 4OPKA 4UQGA 2JEJA 3DLHA 3PJWA 1K6YA 4CHOA 2VWKA 2UVRA 2WONB 1I6JA 1S1VA 1C1CB 3MXIA 3G86A 4MK9A 3KKSA 1TK5A 4Y1DA 3AVBA 4N5SA 3DOLB 4YR2A 5CYQA 4CEEA 1QE1A 5KG3A 5I42B 1IKWB 3K58A 2YNFA 4YFUA 3RRHA 4RUCA 4CJ4A 1XR7A 2W9BB 2E6MA 1TL1B 2GV9A 4RW4B 4AHSA 1NK0A 3SUPA 1NKCA 4CHQA 2HNDB 2J6UA 2OH2A 3GV8B 2D7SA 2W8LA 3KHRA 2FVPA 3I5BA 3QEPA 3M8RA 1IM4A 2I5JB 3M9MB 4NLTA 4Q43A 4Z0UA 4FLTA 4YR3A 4U7CA 4DF4A 5KG1A 1VRUA 4ZTFA 1XC9A 1NNDA 3OS2A 2R8KA 1RBRA 3IS9A 4EZ9A 3FFIA 4ZVGA 2XWYA 4Q0BA 4JS5A 3KMSA 4ECYA 2XO7A 4YNQA 2IM3A 4FJXA 1S6QB 4B9VA 1RBUA 1WLJA 1BIUA 2BRKA 3AVIA 4EP4A 3SQ0A 5KFAA 4CEDA 4FZXC 4B9UA 4HHTA 4NCBA 2CKWA 5HLFA 1QHTA 1LV5A 5DK5A 2ZE2B 3SUOA 4RNFA 4KBIA 2WRMA 5KFPA 4DL5A 3CIZA 1T7PA 4F2RA 4ZPAA 2BQRA 3ICLA 1LAVA 1I3AA 4I2PA 1EX4A 1R0AB 3NAHA 5FRMA 3EYZA 4EBDA 3DOLA 1S1TB 2RN2A 3CM5A 1F21A 2W9AA 4CE9A 2XGQA 3BSNA 2UVVA 1NJYA 2G8KA 1XI1A 1TAQA 5SWMA 1IKWA 4QCLA 2Z1JA 2UUWA 4ZPDA 3GQCA 5C5JA 2RDJA 1J5OB 2RDIA 4ZP8A 1TL1A 4B08A 3CJ4A 1RBSA 3BGRB 2R8JA 3IRXB 2HNDA 1W25A 2E9RX 4DQIA 2OPQB 3TAFA 4JS4A 3MEDB 1C0MA 1U49A 2ZKUA 4BDYA 1S9FA 1SH0A 4IDKB 2JEGA 4OKEA 2C2DA 5FROA 3C6UB 2GUIA 3S3NA 4ED6A 1RDDA 4LSLB 1BI4B 4IFYB 3OS0A 1U4BA 4K4TA 4DL6A 2FVSA 2Z1IA 1HMVB 4CJRA 1YTUA 3ZT0A 4GC6A 3LP0A 2FVRA 4NLOA 3G6VA 3M9OB 1VSKA 4NRTA 4CEBA 1NKEA 4TYBA 3S3OA 1JXBA 1JXEA 3PR4A 3OYEA 3M8PA 1RT1A 3PW4A 2W42A 1QTMA 5L1IA 4CJWA 4ZP6A 5KGWA 3QNNA 2AQ4A 4CJPA 5DQGA 3KHGA 4TY8B 3PW5A 4KHWA 5D3GB 3AO1A 4RUAA 5KG0A 2ASJA 1BHLA 4K4YA 4F4KA 3NH0A 3VN5A 4FK2A 3V9SA 1R0AA 3OYIA 4Y1CA 4DTNA 4EBCA 1QUVA 4C8LA 2YHBA 2ASLA 4Q5VA 2AGQA 2BE2B 3V6DB 4M3ZA 1WSJA 1CXQA 3QYYA 4NLDA 1UOCA 3VQDA 2WK4A 4J9SA 3IN5A 1WNSA 1X9MA 2XY7A 4N47A 4FBUA 3CFPA 4ICLB 2QK9A 3CJ5A 2DPJA 3BGRA 3AVHA 1VSFA 4Z4EA 4E7HA 4ZPBA 5DLGA 3RB3A 2IOCA 3OYGA 1RA6A 4IDKA 2D0CA 4FW1A 4ED1A 4Q8EA 3C6UA 3NGIA 3IAYA 1LW0B 3D45A 4BDPA 4C8NA 4ZVHA 4NCGB 4WYWA 1HMVA 3TVKA 2ZQBA 2BANB 1T03B 4JUZA 3PUFA 4FZZA 3SQ2A 1BQMB 2HHQA 3GV7B 4IR9A 1YT3A 4FLXA 3KLIA 2QV6A 1WN7A 3FQLA 3MXJA 1LAWA 4TSXA 4IH6A 2W7PA 3L8BA 4HUEA 5D3GA 1IG9A 4KB7A 5J2NB 2HWHA 1HNVB 3NFAA 1T3NA 3BREA 3NBPA 3G6XA 4FJ5A 2HWIA 1SKRA 2V4QA 2LSNA 1NK4A 5DQIA 3MR6A 4FM0A 1T05A 1S0NA 3V6DA 3MR2A 4J9OA 4F4XA 4JRPA 2OA8A 4KREA 1C1AA 3V1QA 3V9UA 1OS5A 3T19A 4WZMA 1ZTWA 1JIHA 2YNGA 1NJZA 5DG8A 4OL8A 3HK2A 5EU7A 2C28A 2BQUA 5L9XA 4C8OA 5JUMA 3LWLA 1JLAB 4IG0A 4RW9A 3LPUA 1KHVA 1QSSA 4N76A 3HO1A 4O4GB 1LW0A 1KHWA 4J2EA 4RNOA 1UA0A 3VQAA 3KIOA 4MIBA 5HRPA 4NCGA 4FXDA 3OYBA 3D5MA 2RF2A 4CCHA 3ZSYA 3TABA 3KHHA 2BANA 3KLHB 1T03A 4K4WA 4ED7A 1HQEA 3HHKA 4B9MA 4M94A 2WTFA 3QLHB 1S1UA 3KK3A 5KTQA 2IAJB 4KHYA 4DQRA 1NHUA 3HVTB 3RR7A 2XI3A 1JLBA 4KTQA 2FBYA 4CHZA 2BQ3A 4ED3A 3KK2B 1N56A 3OJUA 3DYAB 3K5NA 5J2NA 3CQ8A 1HNVA 4O4RA 3KLVA 2IS3A 4B9SA 1LWCB 1N5YA 4J2DA 3I0RB 1NHVA 3EY1A 1JLCB 1QAJA 5KT7A 2DFHA 2OZSA 4I9QA 1RTHA 4B9LA 1JLFB 3I5AA 4HUFA 4CGIA 3SJJA 3ASMA 4DF8A 4ZMMA 3N6MA 2XY8A 1NK8A 4KHMA 4HVJA 3DM2A 4FS2A 4LSNB 3AVJA 4B8CA 5C25A 2UVWA 2CJQA 3L2RA 4GW6A 3CVKA 4KV8A 1FKPB 3DLEB 2E4LA 3V1OA 2X6NA 3BQ0A 3MEGA 3SV3A 2AGPA 4ED0A 1RILA 2ILYA 2FJVA 2JEFA 5KI6A 1QSYA 3UR0A 5F8GA 4O4GA 3CDEA 1RDCA 1K1SA 2BGGA 4K4VA 2QXFA 1U45A 3HPGA 3GIIA 3OYHA 3H98A 2E9TA 2WOMA 5KFMA 4O3OA 4TQRA 4ED8A 4NCAA 3OL7A 3DDKA 2XGPA 3OSPA 2FJWA 2F8SA 3HVTA 4N56A 1D9FA 4HKQA 4HYKA 3WNFA 4E7KA 3KK2A 3TQ1A 2VG7B 4KSEB 2HMIA 1JX4A 3KLFA 3AO4A 3NMAA 3V1RA 4F4YA 2YKNA 2G8WA 1S1XB 4KI6A 2IJFA 5FDLB 4ECWA 1ZBIA 5KG4A 4IBNA 1JLCA 2FC0A 4HCCA 5KG7A 3IGVA 1JLFA 4ELUA 4TXSA 5KFNA 1HPZB 3PZPA 3H2LA 4WZQA 2DTUA 3RRGA 5HP1B 2A1SA 1S4FA 4NZ0A 3GV5B 4LSNA 2ATQA 3DMJA 4RW8B 3SCXA 4O55A 1BISA 4K4ZA 3DOKA 4DS4A 4DL3A 1JXLA 1JLEB 3DLEA 4DL4A 4XIUA 3NH1A 1UWBB 1REVB 3AO5A 3EPIA 1SL2A 4CGFA 2IA6A 1TKXA 1TGOA 3QETA 4CIEA 3THVA 4IQXA 5J2QA 2F96A 3LP3A 4IH7A 4NYZA 1S5JA 1KLMA 1UAXA 3DLGB 3KK1B 4J9PA 3V9ZA 3PW7A 1VRTB 4H4MA 4EP5A 1RTDB 1DTQB 3U6FA 4X2BA 3VQBA 3JSMB 3RMAA 4M41A 4NYFA 5KFGA 2YV0X 1TVRA 1ASWA 2XHBA 3L3UA 4O3NA 3C94A 4FJ9A 2JLEA 3QZ8A 2X6SA 1BIZA 4FJ7A 4CHYA 4K4UA 5KFDA 4IKFA 2WB4A 2C22A 3VQ5A 2RKIA 4ECSA 4AH9A 5KG6A 3RR8A 4G1QA 1BCMA 4TLRA 3RB4A 1EP4B 2VA2A 3SQ1A 5FDLA 4LD0A 2BR0A 4ECVA 1S6PA 3RBEA 3KJVB 3V6HA 4KE5A 4LH5A 5KRTA 1S9GB 4B9TA 5HRSA 2R2RA 4ELTA 1HPZA 1SUQA 3PR5B 4F4ZA 3NAIA 5EWEA 5HP1A 1WSHA 4B9NA 1TKTB 4RW8A 4QWCA 4OKKA 1XHZA 5E41A 2IC3A 1G15A 4IG3A 4O0JA 3IG1A 1JLEA 4M42A 3V4IB 1UWBA 1REVA 2B5JA 1VSIA 1KRPA 4OLAA 2P1JA 3ZCMA 4CF8A 3ULDA 3OHAA 1JL1A 3L2VA 2HHVA 4C8KA 4DSLA 1RT6B 4NLUA 1MU2A 1VSDA 4QWAA 1SKSA 4ZP9A 1O1WA 3KK1A 4CF0A 3LAKA 4F2SA 3UQSA 3DRRA 3FQKA 5I3UB 1T94A 1XR5A 4BWJA 4CK2A 2IDOA 4BE2A 2HNZB 4HCBA 3OLAA 3T5LA 2ITGA 2VG6A 1L3UA 3MEEB 5KFKA 3NAEA 4PA1A 2FJXA 5KGXA 4TYAA 4I2QB 3VQQA 5F8NA 3QGHA 3MTKA 4R0EA 5KT5A 2WONA 3OHBA 1CZBA 3OYAA 4EBEA 1Q9YA 2IM1A 4O5BA 2KQ2A 2FLNA 2R8HA 3C6TB 1C1CA 3NF7A 4FLUA 3CDUA 1RTJB 4YR0A 5KFCA 4RW7B 3HP6A 4FJJA 5KFEA 1RAJA 2IM0A 5I42A 4MH8A 2ATLA 1HNIB 3I0SB 4JV1A 2W9BA 4E1NA 5KT3A 3SI8A 4RW4A 1TKTA 3OL8A 3V6JA 3HVWA 2HVHA 4PWDB 4IFVB 1KVCA 2OPPB 3OSNA 4Z4GA 2I5JA 3V4IA 3LP2B 3TAPA 2IBKA 1TAUA 1WNEA 4FW2A 4DFKA 1NK7A 1D8YA 2G8VA 2ETJA 1Z4UA 5J1EB 3AA2A 2XC9A 5F8LA 3M8QB 4NLRA 1S6QA 4DSIA 4URGA 5JS1A 4DSEA 1EETB 1IO2A 4DTOA 2KFNA 2VG5B 3OL9A 5HBMB 4I2QA 1SL0A 3G10A 3P83D 4JRQA 4QWEA 2P5GA 5DG7A 3DRSB 2ZE2A 4CEFA 4CGGA 4PUOB 5HRNA 1C0UB 3SZ2A 2UUTA 1WSEA 3M9NB 1SL1A 4QW9A 2GBZA 4RNNA 3C6TA 1GX5A 4DLGA 4ECUA 3K5LA 4CK1A 1EXQA 1RTJA 1RNHA 1S1TA 4RW7A 5K14B 4QW8A 1CSJA 2JC1A 4RW6B 1HQUB 4J9RA 4NYNA 4KFBB 4PQUB
chains in the Genus database with same CATH superfamily
4HEA9 3ITHB 1F0XA 2GEMA 2Y8WA 3R6GB 1FXXA 3LPYA 1U47A 5KRSA 3A1YG 1H7XA 5BRFA 4YOXA 2R2UA 3D4JA 5HJYA 3QEVA 2P9UB 1LCUA 4X65J 1BI4A 1WBBA 2BJ3A 1YKWA 3KVGA 2XHCA 4FZYA 3OL6A 4DV2F 2I6WA 3CC2S 3VAHA 1B92A 5C42B 1JL2A 4JKHA 1WSRA 2UXDF 1REGX 2A6AA 2ZDOA 2HRUA 4A8QA 3ZYYX 3H2VE 3H5YA 2H1YA 4NA3A 3ZX0A 4WE1B 2GV1A 5HJXA 4RU9A 1CXUA 1ZM4A 2RNEA 2KM8C 3TEHB 4H0TB 4F3OA 2LQBA 4B3OB 2CJXB 1KVAA 3SDEA 1RDRA 2JC0A 2PY5A 1QVFM 4OI4A 1UVNA 4RZRA 3T5HA 2HLTA 5IWAF 3O9QA 4LF7K 3G8SA 4YHHJ 5K14A 4J9MA 2OGUA 2E5IA 2MYFA 1VQKS 5CCLA 4CJLA 3MFIA 2P9IB 3LUYA 4JI7F 2EG1A 4H4KA 3QO9B 2VFUA 4PKIA 1N33K 2DNQA 2GQCA 4JKGA 1OY6A 2XZWA 3MURP 2L9DA 4AL6A 1RP5A 3WHIA 1VQ8S 1ROFA 2HSEB 1AZSB 4LF9K 2VA3A 2FYXA 3PO4A 3H45C 5C42A 1HBMB 3T6JA 1VQ9N 1RHQB 1K1QA 4TNOA 3PO5A 2D0PA 4OJRA 2DH8A 5KOWA 2FC8A 3I4HX 1TK8A 4CIFA 3HP9A 4WE1A 1YZ7A 4KHPF 3AAQA 4AHUA 1NGGA 2XYGB 2W1BA 4A2AA 2FHKA 3SUNA 1X5TA 2QLXA 4BY9C 5AQHA 1T3OA 1Z2ZA 4CDIA 5DMRA 4I6MA 2LVWA 3AVLA 3PCOB 2KH9A 3DXMB 4ZVQB 1SH3A 4E1MA 1A5XA 1RYSA 2MKSA 4CGJA 4W90B 4DTMA 1JXVA 1PYOB 4LRAA 4A8OA 3BBFA 3OTOJ 2QWPA 3GU0A 2CGJA 3DOMA 3W8GA 4NZ7A 3VQ7A 1NK6A 4EHUA 3EGZA 5L1LA 1U1RA 3PEHA 3ZXWA 1RBOB 5B0FA 1QAXA 1V6HA 3OV7A 3G6YA 3QJPA 3IP0A 4C11A 4UY85 1A7GE 4YY3K 1S48A 1PILA 1EWQA 2RS8A 2XZTB 2IYGA 5LMUK 2P9NB 1AZSA 2E7XA 5FLXY 3KLHA 2ZGZA 3TUIC 4KB1A 4OZLA 2HAIA 5KFBA 3QLHA 3KYLA 5CYJA 4B1UB 3QIOA 2IAJA 3THWB 3GYGA 3CD6S 3I9ZA 3MUVP 2HYIB 4LIRA 3LDOA 4P75A 3OTEA 1WKJA 1OKJA 3LGNA 2HVIA 3CD7A 2XS2A 1ASVA 3DYAA 3ZTSA 3OFEA 4FK0A 1Q82O 5M1QA 4ZCKA 4DV7J 4FPBA 3SSSA 4HHJA 2OPSB 3I0RA 1I39A 4CESA 1H6KX 2VDHA 4FZVA 3N79A 2EI5A 5G4DA 4EUVA 2QL5B 2E2QA 5G0RB 3TANA 5KFZA 1S1VB 2O8FB 2EFGA 1BL3A 2E6LA 1J5EK 4AYBD 3AVGA 2IVYA 1NCLA 1W0HA 4ZVFA 3JTNA 1H2VZ 4BRCA 1VSMA 2W4CA 3CWJA 4LF8F 1FKPA 4ILRA 4QOTA 5DGAA 1Q8LA 3U9ZA 3G25A 3VQSA 3O80A 2R7YA 1SC4B 2YNFB 1HKCA 2DGWA 3F44A 4E19A 4OPHA 2RMLA 4KJIA 2RH3A 3M4XA 4JOUA 4AM6A 3MR7A 1WUUA 4HTIA 3MN5A 4BRNA 1SKWA 2H51B 3WNEA 2UUAK 1HNWJ 3O3HA 4X65F 4C8YA 3C2PA 1B0TA 5HROB 4OMFG 1DQ8A 2Q43A 4OLOA 3N0VA 4WKYA 5TKWA 4BE1A 4J37A 3IS9B 2WVBA 4XPCA 3RMBA 3MTJA 1YBUA 2O8EA 2HLUA 1LOUA 5DM6Q 1CC7A 4BROA 4CW7B 3PIPL 2X1FA 1HWIA 4O44B 5K8NA 4ECQA 1S1XA 3O2IA 2QJ3A 3MWPA 4BGAA 2OPSA 4JI1K 2NXNA 1N5VA 3M1VA 4RPFA 2BMBA 2CGKA 1IH7A 5HLFB 3PHEA 3VQ6A 3G82A 1EKSA 2XY5A 3C6AA 3WIVA 3WQTA 2CG4A 3ILOA 3ILIA 4J9KA 4IWVA 2QI2A 4D3HA 2YJFA 4CRJA 1HARA 4Z4HA 4H4KC 2UU9J 2GIQA 1WDTA 4E3SA 1CLQA 4YHHF 4WFZA 2VWJA 3MUMP 1ATRA 3RMCA 5JS2A 3NY0A 2OSQA 2YKPA 1R89A 2FJEB 4KHSA 1X8DA 3THTA 4CJFA 4JI8J 3CYMA 2UUBJ 2AEJA 3FE1A 2HQGA 3SYZA 1LWEB 2GWJA 3M8YA 4X66J 5F9LA 3IDHA 5HROA 1NK5A 3RAQA 3DRPB 4NLGA 3CO9A 1FERA 4QZVB 1NO8A 1NH7A 3O6WA 3S41A 4NLWA 3MCOA 4ECXA 2RPIA 3U1NA 2CYYA 5D4PA 3PIOL 1X31C 2CAJA 2XSJA 2AX0A 2W8KA 4OYIA 3HHLC 4H5NA 3A8YA 1V3SA 4O44A 5GADU 4FF2A 1DRZA 2ZUAA 4CLTA 3H6EA 3K57A 4RUHA 5ETMA 1K8KB 4WFYA 4FJNA 3MMVA 4ED4A 3KJVA 1RWNB 2POKA 2I9SA 3GFHA 2P9CA 4A62A 1NB7A 4CGHA 4DPYA 3QBCA 1FKOB 3I5CA 4N8NA 3H4BA 3MXMA 4J9NA 1UZHA 4O3SA 1P1TA 3OHRA 2V51B 3CPWM 4FK4A 4M45A 3VQ4A 4X4TA 2W7OA 4OGCA 3N4WA 3T3FA 2CADA 1KQSM 3M8WA 3SCJE 2JWKA 4PQAA 2HS3A 5T41A 3OTOF 3BDEA 4CGDA 3ETMA 3PY8A 1ZBSA 4JI6J 3WXKA 3PYGA 5KPZA 1Z05A 2F7VA 3RVCA 3DWLA 1QUPA 4P2MA 4CH7A 1LWEA 2RUGA 2V94A 2B51A 3DRPA 5CD4A 4HWIA 2FVCA 1PJ5A 1K73T 4YORA 2IMWP 2AEFA 3PLAA 4DV0J 4C1NI 3ENAA 5KFVA 4OLBA 4W5TA 1MN7A 3TR8A 4BG9A 2KHOA 5AQJA 1S79A 4LQ9A 1H7WA 1K8KA 2YQ0A 3QWPA 1SS6A 2QKBA 5FIIA 5BPMA 2KB2A 1FKOA 4YDUA 4LBIA 1RWOB 3NBPB 2V9WA 3I0SA 4DV7F 3VAGA 1N54B 2F4FA 4NRUA 4PEOA 2E20A 1KP6A 1YLXA 4PWDA 1X4CA 5EWGA 2J7WA 1XQIA 1WC3A 1TKDA 1EIYB 3L3VA 1UVLA 1ZETA 2X7IA 3CSKA 2UV8G 1VQNS 2OHDA 5E3AA 4PG8A 1HYVA 2DNOA 4YOEA 3VERA 3QINA 4BG8A 3SPZA 2KTQA 2DFFA 5HRRA 4OV6A 2NREA 2VU5A 3CC7N 1VK3A 1S1WB 2N3OA 2LEBA 3THYB 1CQNA 5ETQA 3UPFA 3CEDA 2J6SA 1NJWA 5KT4A 2HG4A 2JGUA 1HNWF 2CQ0A 3DRSA 1OH7A 3MMAA 1D1UA 2V52B 1C0UA 1Y5IB 2Z4PA 3K17A 3SIPB 1S1UB 3PKMA 4NPOA 1KFSA 1M1HA 1F6TA 1VQMN 4L76A 1H73A 1LWXA 1G99A 3O4WA 2VDIA 2YXLA 2B4JA 4RCHA 1Q79A 4KR0B 4U7UD 3MEKA 4DUZJ 4KI4A 3CCZA 1GOBA 3D2FA 2NPFA 4JV5J 4CIOA 1NUEA 3TPQA 3E3XA 3BS9A 4OLPA 4FCYA 2L9NA 4DSJA 2E8AA 4LFBK 2RHQB 4ZITA 2XLKA 5SUHA 4ANCA 1O51A 1KAZA 2ZVIA 3FUYA 1MMDA 1YUWA 4ZHRA 3VQTA 3JB9k 3DM2B 3BSAA 2UU9F 4UUWA 1IBMK 3LH2S 2DRBA 3TOQA 1R7IA 4KV8B 1K0VA 1N34K 1GLFO 4F0HA 3G0ZA 3VAIA 4EU0A 3MEGB 1FRMA 3EZWA 4NLXA 1QQNA 3TSQA 4CJUA 3MWTA 4NLSA 3PXGa 3NP5A 4NLYA 1S1WA 5AQYA 3THYA 3PNIA 3W60A 3L9ZA 2OFGX 3CW2C 4UOGA 3OFHA 3H5XA 3P1GA 2UUBF 4Y6IA 5DQHA 3TX0A 3MI7X 4LY7A 4X66F 4A48A 1BE4A 4DR2F 3OQ2A 4BREA 3HFVA 4X4OA 2N7CA 2E1AA 1CJKB 1YI2S 5KFTA 1S49A 2BM1A 2EPIA 1LKZA 1R0BG 2E2PA 3D54A 2QW9A 1S22A 5LL6Z 2ZH1A 3LALA 2Z2MA 1PBUA 4EIAA 4X62F 4JK8A 2GO8A 3CUNA 1BCOA 2GAGC 2GCFA 3WT0A 3TX8A 1PAUB 5AJ3K 5CHIA 5M2PA 2VUGA 4O3RA 3DMJB 5C2DA 3JS9A 3I82A 3HYFA 2M7SA 1BQXA 3US5A 2GVZA 1D0EA 2C42A 2Y9HA 5GAHP 2KZZA 2VFSA 4DX5A 4ID5A 4FOEA 3GIMA 4UZBA 3JYTA 3OFGA 1DTTB 3L4IA 2EWHA 4JI6F 2G13A 4AHCA 4BR2A 3EDRB 4O0IA 2OPRB 2Q3PA 4FVCA 4LR7A 4Y2MA 1X4FA 1YVFA 1RA7A 4GC7A 2YHAA 4B1WB 1EO1A 3ZNJ1 1UW4A 5KFSA 4KTZA 3W2VB 4HI2A 4ANDA 4JI5K 3DI6B 1JCFA 4Y34A 4FLZA 4KPCA 1RT5B 1IBLK 2OIHA 1FDAA 1BUXA 4R5PA 4AL7A 2GMLA 1WC4A 5B0BA 3DU6A 4K5RA 5DDRC 4DV0F 4YQWA 3MK6A 4DMNA 4LF6J 4LF4J 2DNPA 4CJEA 2RKIB 4E1JA 1ZPVA 1SJRA 5HSPA 1B99A 5C12A 4G1QB 4MFBA 5KOXA 3VQEA 3MCAB 3FBEA 4HT7A 2C3YA 3LDNA 1DARA 3VEYA 4K4SA 5DDPC 5CYQB 2XMJA 3TR5A 4XPEA 3SJHA 1SUQB 4Z2XA 2R8IA 4TN2A 1TUYA 4PABA 2YQ1A 2NLWA 3IG1B 2P6SA 2JX2A 2BKOA 3O8MA 2RILA 2Y3YA 4PL7A 5EX3A 1DTTA 4L75A 2KKHA 1FRKA 4X4UA 1K9MO 3SNNA 4UT4A 2WCXA 2OPRA 5F0WA 1HBUB 1VJWA 2EFQA 2DB1A 3KDNA 2RDDA 1Z25A 4GO5X 3MN7A 4MIAA 3UN2A 4PAAA 3W2VA 2BDPA 3HF5A 3DI6A 1NHKL 4GKKJ 1A9NB 1LOTB 1B7FA 1RT5A 2EFNA 1R8HA 2CG8A 3NGSA 2A2DA 1EKRA 2UV8A 1Q86O 2H54B 3PACA 5HI7A 2UVRA 3R3LA 2WONB 1OJ4A 2GHPA 4OZNA 1RWMB 2HBKA 5BR9A 3DRYA 3K8WA 3KKSA 1TK5A 3OUYB 1E4FT 2WTUA 4OJHA 5CYQA 4M5NA 1FCAA 4DUZF 3RRHA 1ZS6A 4AHSA 4JV5F 3D7EO 2HNDB 4DB3A 3OR2A 1TU0B 2HURA 3I5BA 3AFGA 3L7OA 1IM4A 4KYZA 3IR5B 2XZDB 4Z0UA 4U7CA 3CD6N 2DNNA 2D3OR 1XC9A 3OS2A 2R8KA 1RBRA 2Z0GA 1HBUA 2MDAA 4CBXA 3MM8A 2RHKA 4FJXA 3HZEA 3MGJA 4IYQA 3EGNA 1QHTA 2IVMA 4B3RJ 4L3KA 2OTJS 4RNFA 3H8YA 1X4AA 2ZZTA 4DV3K 1LAVA 2NRWA 3NAHA 3OUYA 3UN3A 4B9QA 3CM5A 3B6BA 2XGQA 2G8KA 2WVFA 2Z1JA 5CA5A 2UUWA 4ZPDA 3GQCA 1VBZA 4NEYA 4ZP8A 1RBSA 3IRXB 5JLFA 2HNDA 1K73O 3HT0A 3R1XA 2VGNA 1P8ZA 3O9UA 3MEDB 1U49A 4IDKB 2BKPA 1GXUA 4IXCA 4F9OA 1B70B 2HBYB 4FNHA 1Z1ZA 1U4BA 4DR7F 4P6QA 4DL6A 1BOTO 4CJRA 3ZT0A 4GC6A 4W92B 1VSKA 4NRTA 4BVPA 1UEKA 1F3VA 4OYWA 3J7YI 1XNRK 2F8MA 3UI3A 3OYEA 3BP8A 1RT1A 3OBYA 2KXNB 1QTMA 2FF6A 5L1IA 2P9SB 5KGWA 5DQGA 5AXKA 3AO1A 1PSDA 5KG0A 1OVYA 2YHWA 2OEMA 2HOEA 3SQGA 2C3OA 3V9SA 4FK2A 1VLYA 2XMAA 2VZ9A 1R8AA 3FLCO 1WKKA 2HHHJ 4EBCA 4LF6F 4BLGA 4LF4F 3UDVA 1HHTP 4Q5VA 2AGQA 4BC2A 3FMBA 1YVNA 1UOCA 4J9SA 3IN5A 1WNSA 3MX2A 4OZ3A 1BY9A 2DPJA 2DNLA 2XMTA 3HHDA 1E6VA 3VEVA 5EHHA 1VSFA 4FXVA 2BKNA 2R9LA 3M2UA 4DZ6A 3NNCA 2IOCA 3M8ZA 1RA6A 4IDKA 2E1PA 2D0CA 1NM2A 2RHSB 3NGIA 3IAYA 4XTTA 1LW0B 2OEKA 2LMIA 1F1BB 4DR5J 4ZVHA 5DM6L 1XMQJ 1URRA 1SPBP 2E5LJ 3AXKA 2R7VA 1NGIA 2ZITA 2GX8A 1OH5A 4DR3K 5A6WA 1BQMB 2CJYB 3FCHA 3J8AA 4NMXA 2CQPA 3MXJA 4TSXA 2MZSA 2P9SA 2W2PP 1IBCB 1IG9A 5GIOA 1NMEB 4ISFA 2HWIA 2V4QA 2F40A 2LXUA 1NK4A 1KAXA 1E6YA 3CQXA 5FPNA 3DLLL 3IBCB 1DT9A 2V6AA 4JRPA 2OA8A 4R25A 3V1QA 4DR1K 2FB0A 3V9UA 3T19A 4WZMA 1EB0A 1ZTWA 1JIHA 1RQ0A 2KT5A 2HFZA 5C0YA 2LQ8A 2FSKA 3E9OA 2C28A 4FWRA 4C8OA 3LWLA 2FLOA 1JLAB 3GJQB 1CZAN 4IG0A 4RW9A 1KHVA 4AQYJ 2O8DB 3PKYA 2JLFA 4O4GB 3HO1A 1LW0A 1RXOB 1KHWA 4J2EA 2PGCA 3C0BA 1NEEA 3OYBA 3SSQA 4K4WA 3QNWB 3A3OB 4UF4A 1CBKA 3AJ1A 4ED7A 2K7JA 1JJCB 2WTFA 2ASOA 3R5BA 4KHYA 2OANA 3HVTB 3RR7A 1IBKJ 2XI3A 1IG8A 4C98A 4CHZA 2BQ3A 1KBRA 3OTCA 3EKUA 3EN9A 7FDRA 1N56A 2RVJA 1XMOJ 4CT9A 3GLJA 1VQ5S 1LWCB 3WC2A 4FWNA 1W2BM 4J2DA 4I9QA 2DFHA 1RTHA 1JLFB 3GG0A 4B3RF 2ASYA 4HUFA 4CGIA 3ASMA 1AA1B 2DGOA 3CCEN 3GR0A 2Q1NA 5JICA 1K47A 2QIFA 4LVOP 1NK8A 2XY8A 3AJ2A 5D4LA 5B0AA 4HVJA 4BRLA 4LSNB 3AVJA 1IM6A 1TFYA 5C25A 1GK8A 2FD2A 5C2CA 3DLEB 1AT1B 3DHWC 2R7RA 2AZ1A 2MKCA 2YH1A 4MIWA 5KI6A 1QSYA 4H5WA 5F8GA 4O4GA 3G9CA 4A59A 3HX9A 4RTFD 3GIIA 5LXYA 4ZCMA 2K8GA 1SC6A 2NSCA 1VOMA 1HKBA 2OP5A 1HNZJ 1FE0A 1YJNS 2ZJQQ 2F8HA 2PN6A 4X4QA 1WI6A 1QQMA 4JI2K 3I6PA 4LBPA 3OL7A 4M1KA 1HNXJ 3A8IA 4QIEA 4CO1A 4P72A 3HVTA 4U96A 4NZ6A 1D9FA 4HKQA 2E1ZA 2VG7B 2BYCA 2VQFJ 2DT9A 3U9DA 4H0VB 2FXUA 3NMAA 4EAHD 1N32K 5FDLB 4ECWA 1FWKA 4PZVA 3M6UA 2FC0A 4ELUA 1JLFA 2CNLB 4TXSA 3QT7A 4USWA 3PYFA 2XNQA 5KFNA 1HR0K 3VOVA 1HI0P 4JI3J 1YF5L 2C2KB 5IC4B 5HP1B 2A1SA 3N01A 3TTDA 4LSNA 2KYZA 1WJ9A 4O55A 2HHHF 1Q7LB 3VGUA 1T6DA 3DLEA 2ZBIA 4AXJA 4XIUA 3CCVS 1KQKA 1REVB 1V5IB 3L95X 1TKXA 5GADI 4IQXA 1RACB 5EX0A 4FWQA 2FQQB 4JK7A 4B1VA 3V9ZA 1TL4A 2IYIA 1XUPO 3VQBA 2BBEA 4DR5F 1TVRA 2CQBA 3GE1A 1YI2N 2F5GA 1W7AA 3LPEA 1XMQF 4DV6K 1ESVA 3QZ8A 3MX5A 4FJ7A 2E5LF 3SMZA 2MSSA 4I68A 4IKFA 3KNGA 3AQPA 2C22A 3VQ5A 3NGRA 5KG6A 4X4PA 4GV3A 2A3ZA 3RB4A 2VA2A 3BO3A 4L73A 3F2KA 5FDLA 2F4VK 3PRDA 3IRWP 1S6PA 4ECVA 2EFPA 4NYOA 3L4BC 5GVQA 3V6HA 4LH5A 3EE8A 1YX2A 5E3CA 4JI0J 2EKYA 4P74A 2DNYA 3CT9A 1H74A 2OUGA 2FHMA 3FZLA 5HMXA 5HP1A 1RHJB 2V2KA 2V4JA 5F0UA 1VQOS 5LM7E 1TKTB 5CZVA 4X4VA 4DV2K 4OKKA 4X4RA 1S6UA 1G15A 2OMOA 2V8GA 1GFWB 3ZZUA 2UXDK 1REVA 1KRPA 3D3CJ 4CF8A 2PEHA 3ULDA 1YRUA 1JL1A 2ADBA 1LFWA 3IWLA 5AQZA 1RT6B 2NXJA 4NLUA 1MU2A 3Q83A 3QSYB 1SKSA 3WX8A 1O1WA 2BOPA 2DR6A 4FN5A 2RRNA 2LXFA 1NDKA 3DRRA 2DGVA 3FQKA 4P7VA 4PR6A 5GMEA 4AQYF 4BWJA 2LEAA 2HNZB 3O1LA 4IDHA 3T5LA 3VWSA 2XLIA 3VGMA 4AFFA 5KGXA 4TYAA 1RAAB 4I2QB 3AXMA 2ASPA 1R8CA 3R2DJ 5IWAK 4MLEA 4R0EA 5H9EJ 3PHTA 4P71A 4EBEA 2EBEA 4DCPB 4JD2A 1IBKF 2FUG9 4NMLA 1C1CA 5ETTA 3H1VX 4ZPVR 4JP8A 1H0HB 3NCPA 1HJOA 3D0HE 3J81O 4A8XA 5JJBA 4RW7B 1XMOF 1RAJA 1PGZA 4MH8A 2QMXA 4WPAA 2ATLA 2PI5A 3BO4A 2XM3A 4JV1A 2W9BA 4I6WA 1LNQA 5KT3A 3SI8A 3NGTA 1QLNA 2DJWA 3CCJS 1TKTA 1HWUA 1FA0A 2QEXS 3AOAA 3QT6A 4IFVB 2LQ5A 1KVCA 2OPPB 2JWLA 1SIZA 3OSNA 2Z8QA 4QU7A 4ZS6A 3BZQA 1TAUA 2M2BA 2MLYA 2CNOB 4L72B 4A47A 4TKTA 4USUA 4DCJB 2DPNA 3TWZA 5BPNA 2CNNB 4KHPK 2UUCJ 2DKOB 4MAKA 5E0OA 2OEJA 2RU3A 4F0KA 3O6QA 4NLRA 4LR8A 4C2MA 2B4VA 2L9WA 4DTOA 4ZIVA 2VG5B 4I2QA 2N82B 4YN3B 2HQ3A 1HNZF 2P5GA 1IWAA 4Q2LA 3FRYA 3UE5A 5HRNA 2OTLS 3SZ2A 1HNXF 1RJJA 4JHDA 2GBZA 1D9AA 1QTNB 4ECUA 3K7RA 1R59O 1RNHA 2KU7A 2AJ4A 4RW7A 2VQFF 2M52A 5HANA 4L3NA 1CSJA 3T69A 2AJFE 2P6TA 1J6ZA 3P38A 2BJ1A 2VKZG 4KFBB 3PM9A 1J5OA 2IPOB 2DRDA 5K5MA 5AZJA 5F41A 4WF9Q 4JBCA 2Q97A 4DPXA 2VPWB 4IFVA 3H3NO 4IEIA 4UQTA 2OPPA 3DGPB 4M5IA 2LP4A 4JI3F 4CO4A 1JK9B 1MMLA 4WIQA 2L41A 1CJVB 1RDUA 3CTRA 4LSLA 3IGNA 4IFYA 3CJ3A 5U47A 1DEJA 4L8RB 1N48A 4KGXB 2HHUA 2WBNA 3S1TA 1SXLA 2M0GB 3SUQA 3FCVA 3VVTA 3RBDA 3SI6A 4ERDA 3TVYA 2VG5A 3KHYA 5LL6d 2DNHA 4DV1K 5C2FA 4YOYA 4DBQA 2OTJN 4Z4CA 3OS1A 7AT1B 4Z4IA 5BJRA 1S9EB 3O8WA 4FF3A 1IKVB 2VIHA 1OYDA 2LYVA 2DXFA 3RUBL 3CJ1A 3HRGA 2KYXA 3C15A 1RAIB 3KKFA 3V81B 2QLFB 4O5FA 1XIQA 1X1PA 3IO1A 1HBOB 4J9QA 1Y97A 4KH5A 2BE2A 4G65A 2PA3A 1Q9XA 5DGBA 1U0SA 4ICLA 5F0XA 5C24B 1SAZA 3GSDA 2X1GA 2M8DB 4WU2A 3GDQA 2E44A 5GAEU 1LW2B 2Z2YB 2W4PA 2AYBA 1XMBA 3NVMA 4ELVA 4WXOA 4CJSA 3F56A 2ZBCA 2XCAA 3KD5E 4WKRA 3TTFA 3V5RA 2KJVA 3QRRA 3WQUA 3E66A 5KFQA 2YCHA 1QAIA 2GGPB 2IJRA 2G2ZA 4KAIA 2BVZA 1JJ2M 5J2MB 1B4SA 2AX1A 1D9DA 3RBZA 1GQEA 3HZ6A 3KHLA 4MKVA 4CI0B 5DZ6A 5L1KA 4M3UA 3LW5C 5IV3A 4HTJA 4OI2A 1B0PA 5F8HA 4RBUA 2OKQA 4DZDA 3HJVA 1D5AA 3QFUA 4BBYA 3TAMB 3V81A 3TEGA 4YHHK 4ZCIA 3IFRA 2RRAA 1QVGR 3NWGA 4B3SJ 1HBOA 3T7ZA 4K8RA 4M3XA 4HACA 4NXMJ 3CM6A 1UEVA 2ZVSA 4LF5J 1VK8A 5KFIA 2AYMA 4TVAB 5AQQA 4OHZA 2MZTA 2AD9A 1NMNA 1SCJB 2FHOB 1J9AA 1UETA 5SZTA 3CIMA 3O08A 3MD1A 5KQDA 2JFDA 1WOQA 3G87A 4BRPA 5B0DA 4FBTA 3LDLA 2A41A 3LDSA 2WHOA 2J5AA 2F9TA 4FM1A 2O8BA 2VPYB 1DQAA 3V9WA 2G2OA 1NU0A 4ZLJA 4ZVTB 2K1RB 5HQMA 4EYIB 3VGTA 3VESA 5J2MA 1D4XA 1XR6A 2M8HA 2ZH6A 4FJGA 3Q8QB 1APSA 1NZ8A 2UYTA 2MZJA 2ERRA 4KTWA 4CM0A 1EHWA 1J27A 4P9SA 1TP7A 4ZDNA 1XBWA 3QGIA 3HL8A 3UFCX 4RLEA 2B6AB 1YJVA 1RBAA 1WAJA 1FTRA 4Y0FA 3VEWA 3UCGA 2FBXA 1F9EB 4HI1A 5HMYA 1FNXH 4HVZA 2V50A 3OTOK 2KI2A 5FJ4A 1BMQB 5D77A 3B78A 2P9KA 2QLJB 5A8RB 3C7NB 1WEYA 1NK9A 3VF6A 4NLQA 5BN8A 3VTIA 3C14B 2EC0A 3MM7B 5E3PA 3V9XA 1F5BA 3M32B 4O3PA 2CQ3A 1XN9A 4Y3CA 3FEXB 4ZJLA 1HJRA 3LDPA 3VPZA 3EVMA 5KFUA 3WDOA 4GVBA 2K1RA 2A42A 2RRBA 1NM1A 1Q7YT 2L3MA 4HHHA 1WC6A 4B02A 2Q0UA 2HVEA 4QYZK 2ZBQA 3FRZA 2C2ZB 3KUEA 2BRLA 1FJ7A 3LAMA 3PV8A 3I4PA 2Q2RA 4DV4K 3CCLS 2N4DA 2B7CB 2GJIA 4CO5A 4X84A 4FYVB 3P96A 2EC2A 3F0NA 2FZKB 1BA1A 2X74A 4OZJA 5A8RA 1NKBA 2GTDA 4MO4A 2E1YA 4JK9A 1ZA2B 4ISEA 2HHPA 3IXQA 2JL9A 1Q5VA 1RI7A 1M1KO 3C14A 2PSZA 3KK7A 3JSYA 5JVHQ 3B6OA 1QQOA 3M32A 3KD1E 4JEPA 2E5HA 4KAZA 4DQPA 2HBJA 3GIJA 3UKUA 4CJKA 1YJNN 1UMJA 1HNWK 1RTDA 5DZ7A 5AT1B 2W9CB 3JSMA 2ASDA 4C3LA 1X7VA 3A5LC 4FYDA 3SBGA 4ZLPA 4FM2A 3OXFA 1FJCA 1RAFB 4C8ZA 4CK3A 4Y0WA 2AIRB 3T1HJ 5EXWA 3DNCA 3LP0B 5TKYA 4M7XA 1VQ7S 3OW2R 1X5SA 2V0NA 3NS5A 4CF2A 4EO8A 1YTAA 1EP4A 1F9HA 3UN5A 3OPKA 2EK1A 2XSFA 1WF1A 4OI1A 2HZCA 4WIIA 2DY9A 3CJ0A 2HGLA 2CVIA 3R2CJ 2BA9A 3SK3A 3VAKA 1L3VA 1Q5YA 2FC9A 2KZMA 5D6GA 1ZBLA 3GILA 2J0WA 2XULA 4F0MA 3UO0A 1JNRB 3WEEB 2DHGA 4KH6A 3EGVA 3WZ0A 4USIA 4NXMF 1S12A 2XY6A 4LF5F 4JI8K 4PWWA 2UUBK 4FYWB 3AD8C 3BSOA 2FTRA 5CY4A 3VETA 4CEZA 4DTSA 1GAOA 4B3MF 4FWLA 2R2TA 1SV5B 5I3UA 5L8RC 1RDAA 2W9CA 1FWLA 1FRIA 1M5VC 1OVQA 3DXBA 3MECB 3P45B 3SCKE 4CYUB 1ZH5A 5T7LB 4A5BA 4JI4K 2HGNA 2MLZA 2ZH3A 1I51B 1MDUB 4PG5A 5B09A 3TJAA 2M9KA 5IC6B 1Z26A 1RHKB 1HKGA 5FRNA 3PX0A 3K9KA 4YOTA 5AFUH 5AQUA 5BRHA 2DY1A 1ILYA 3PX4A 3CG7A 2A6MA 1VQON 2FY8A 2HNYB 4DTPA 2ZNYA 3W66A 5KFXA 3NE6A 1FFGB 3J81j 1GTHA 3M6GA 2JWNA 1N6QB 4K41A 3FBCA 1CZ9A 3TJ8A 8ATCB 3A8JA 1FI4A 4ZJQA 1IKXB 2J0SD 5GIPA 4I4BA 4NL5A 4BC3A 2MKJA 1N33J 1SKUB 4CLUA 3IM9A 2YNGB 3MUTP 4JI6K 4DS5A 4C4WA 2X78A 1FJEB 4F8RA 4ZP7A 1UAWA 3RB0A 2V2VA 3W61A 4EO6A 1T44A 3FCWA 1VGYA 5KG2A 4LFCJ 2I1RA 4EK2A 2XHWA 1SV5A 2DGUA 3KJNB 4WYLA 3M8QA 4KBOA 5A76A 4YB1P 2DIUA 2XQCA 2MY8A 4A5AA 4ZVPB 2QA1A 4BR0A 3T1YJ 4UUXA 4DLEA 3MECA 4W98A 1U24A 2RIJA 5AZIA 1RUSA 4A8SA 4AXIA 1LXNA 4PUOA 4QBUA 1FFWB 4U6PA 3KK3B 2VJVA 2YNIB 5IFMA 5E3QA 2PYLA 3C16B 2GAHC 4YMEA 3QRQA 4B17A 1JLBB 4F67A 2E9ZA 1U6BA 4DR6J 3R7NB 5LJWA 3SQ4A 2CH6A 4OI0A 2B43A 3LQVA 1HQUA 3VENA 2HNYA 3CCJN 2NXUA 4ZKAA 2NUUG 3L4QA 1R6VA 3DN9A 1Q53A 3S9HA 1RTIA 1N6QA 5KFJA 3SFUA 2P5OA 4NI2B 2YBVA 1ITPA 2V8DA 1IKXA 1FX2A 5J1NA 3BSCA 1Q4RA 1UWAA 3P8BB 4MKBA 2I7NA 4L3QA 1TK0A 1MA9B 3IMXA 4DR4J 1VQLS 1WSGA 2Z58B 2ALZA 3LL3A 4RO0A 2IJNA 4J90A 3ZETB 3KKRA 2Z1GA 1T9UA 1S97A 1AFIA 1TL5A 2X3GA 1RB0A 2B8PA 4HLBA 2WOMB 4FJMA 1ASUA 1MWZA 4IO8A 2OTLN 5M1KA 3GOIA 5AR0A 4IOBA 4M5DA 2FLPA 4JV0A 5FD1A 3JS6A 4XEIA 2YNIA 2CDRB 2PO4A 3VQ8A 3BH6B 4FSVA 3J7A1 2FSNA 3C16A 1AB8A 2Q66A 3U3GA 1YGYA 1WUAA 3BJYA 2G8HA 4DUZK 1RBVA 4K7QA 2EWSA 2AWZA 3KLFB 2FBTA 4ILHA 1YRXA 2YKNB 4JV5K 4P73A 4DG1B 1OSCA 1PBAA 3CCUS 2VB6A 4NLCA 3SMSA 1NPKA 4NI2A 2ILZA 1U0HA 4EI2A 1KSPA 2KW4A 1MNEA 3J81U 5EUHA 1XHXA 1Y5NB 2BUPA 3T41A 3UCUP 3ZSQA 3PJXA 2CZ9A 3C65A 6FDRA 1FTCA 1U1PA 3ZTPA 3VZIA 3E01B 2QKKA 4BQLA 5IT9O 1DLOA 1P8GA 1F9FA 5J2QB 3PSIA 4C0BA 2F8TA 1KR4A 3D1QA 2I7PA 1KLMB 1ZTTA 4KC5A 1N4LA 3BGUA 3ULEB 2WFBA 4H4MB 1LFPA 2ZHOA 3KLEA 2QE5A 2J6TA 4DQSA 2K3KA 3ZC4A 5AQWA 2MGZB 4M3WA 3T5KA 3WBZA 2OI2A 1HBNB 4DWIA 4Q44A 4R8UA 4DU4A 2AKWB 4QS9A 4PYAA 2D41A 2RD5C 2IGIA 1YVUA 5D0RA 3AVNA 3BF3A 3M3ZA 4LMZA 2HZAA 3KWGA 2JDJA 1RWVB 5KFWA 2IVPA 5BYRA 1N8RO 4DG1A 2R8GA 2KM8B 1B9FA 1KNZA 2V68A 1OQ3A 2GJFA 1MSWD 1KLNA 2NSBA 2Z2LA 3ZSOA 5A8WB 1XERA 1QE1B 3HHLD 1RHUB 1Q82T 4ECRA 3E51A 3HSDA 5F9NA 3PVXA 4JKCA 4ZJOA 1NOZA 3AVAA 1GEHA 3LANA 4DQ8A 1YHQS 4M95A 3NGUA 1BXNA 3V6KA 1N33F 2B5JB 3E01A 2EEYA 1WSFA 1GX6A 5CZ1A 1ATNA 3ALYA 1UEUA 1A5WA 1HHSA 1VRUB 3ET6B 1WG1A 2J0QD 2QN6B 5ETLA 3BPDA 5F8MA 3AA3A 3Q8RB 4LF9F 4Q0BB 2DEIA 3DLBA 3A2FA 3X1LB 2FF3B 2F63A 5AQPA 1NGEA 4G3IA 4BC5A 3T1YF 5L1JA 3QBXA 1HBNA 4OPKA 4GV9A 4LF6K 1YSJA 1K6YA 3MAAA 1RAHB 3MM6A 3HULA 1FHTA 4IEEA 1I6JA 1WD6A 1VQ4N 3VMFB 1HQ2A 1WTFA 4DR6F 4N5SA 4CZIA 3LM9A 3R1HA 3HKZD 1S7HA 1NBWA 4CEEA 1QE1A 5I42B 1IKWB 2C1EB 1QVFR 1NJIT 4J9VA 2CPIA 2GV9A 1TL1B 4RW4B 1WORA 3L6QA 5LJ5Y 2P9LA 4AUKA 4YB6A 2OH2A 4RWTA 1SJ1A 2D7SA 2FVPA 4A57A 1U8WA 3M8RA 2I5JB 4FLTA 1JB0C 2VV5A 4CLFA 4DF4A 3VCDA 4DR4F 4NYPA 1VRUA 3CB4A 3ET6A 4CLLA 3BY5A 2CPFA 1RADB 1NNDA 1X4BA 4H5TA 3G4SS 1KTVA 2KG0A 2XWYA 4Q0BA 3MPWA 4GKKK 4JS5A 4ETXA 1QHAA 8AT1B 4YNQA 2B3TB 4B9VA 5GAGU 4JNEA 4GRSA 1AXQA 2ZUGA 2QZ8A 5AQMA 3NCRA 3SBTA 2BRKA 4EP4A 4CTAB 3SQ0A 2CH5A 4BCAA 4CEDA 1H2TZ 4FZXC 4B9UA 4HHTA 3HSZA 3P49B 3R7BB 2W2OP 4PG6A 4KBIA 2WRMA 4G1IA 2V8PA 2HBRB 2A0FB 4F2RA 4ZPAA 3QICA 2BOAA 3QAEA 5JLHA 3V2UC 1I3AA 4I2PA 2W2MP 5LSRA 1S1TB 1VQMS 1NJYA 2ROEA 1XI1A 1TAQA 5ETVA 2ZH4A 4QJVA 1IKWA 3MCMA 1WF2A 2RDIA 1GLCG 1TL1A 1V4TA 4PXEA 4OI6A 2QSFA 1KDNA 4WFNQ 5HK4A 1O5JA 1SH0A 1U02A 5EX5A 5H9FK 2E88A 5HMZA 2C2DA 4BR4A 5FROA 5CCMA 3S3NA 3G6ES 3L7UA 1RDDA 1BI4B 1TUVA 4IQMA 4K4TA 1UVIA 2FVSA 4QYRA 1HMVB 4CD3A 1YTUA 4YDXA 3M9OB 4AD6A 4TYBA 1KQGB 3BF4A 2Q1LA 2NRHA 2YWKA 1RABB 3CCLN 4OX6A 3M8PA 3KUGA 5GAEI 4CTAA 2CPJA 2W6KA 4B3RK 4CJWA 4ZP6A 2AQ4A 2ADCA 4CJPA 3KHGA 1KS2A 3PW5A 4KHWA 4LJMA 2H5EA 2XNRA 2W25A 2XMKA 3VN5A 1NG9A 4OYAA 2WB1D 1YTYA 3ZFVA 4JI1F 5IT4A 3H7HB 3OYIA 4DTNA 4C8LA 1QUVA 1RSCA 1E3MA 2M88A 2RQ4A 4NO7A 3ZZOA 2G1DA 1MWMA 1F60B 3P3DA 1X0FA 4LFBJ 4N47A 1SZ2A 3CJ5A 5CR4A 2VFRA 3ATUA 2ZHBA 2NS1B 1RE1B 3TO8A 1IBMJ 2DR9A 2YX4A 5LJVA 2XLJA 3VGLA 4ZPBA 4WK1A 3RB3A 3AA9A 1N34J 5L38A 4JKGB 4KH4A 2OFHX 4ILJA 4ZVUB 2JRSA 3UB5A 4H03B 1GTEA 4BDPA 4N8OA 4C8NA 2ZJPQ 1V3ZA 2HZVA 1VQ7N 4YS2A 1HMVA 4U9RA 1RU2A 1FRJA 1EQMA 3GFYA 4USMA 5J1PA 2E1RA 3C19A 3W65A 2R7TA 5DJBA 2CUYA 5RUBA 3UNYA 3KLIA 2QV6A 1WN7A 2NXEA 3FQLA 1LAWA 1EJ7L 5H1SV 2W7PA 2NZTA 1HL6A 3RU0A 2IVFB 3FBFA 1F2HA 3BREA 4U7BA 3G6XA 4FJ5A 2QA4S 1CEZA 4I6MB 2FZCB 3HHLB 4AL5A 2ACYA 8RUCA 3CDAA 5C2GA 3QWUA 1VS3A 2XS5A 4FM0A 4ES1A 1T05A 1S0NA 4J9OA 5JVHL 2FDNA 2W2NP 4KREA 2J9DE 1KXPA 3J7YU 1NMDA 2HK2A 5AJ3J 5DG8A 2GO9A 3DOMB 1Q81T 4OQJA 3DHXA 3BV8A 3HK2A 4QQBA 3UCZP 1AFJA 3UVJA 5EU7A 1N0UA 4C23A 3BF1A 4AE5A 3RYLA 4P10A 3O3LA 4YB7A 5JUMA 1P6TA 1FXDA 4DR5K 4C11B 3EVOA 1WSVA 4EHTA 5IQQA 1UA0A 3VQAA 1XMQK 4F3MA 2HQFA 5HRPA 1EQ0A 4FXDA 2E5LK 4K2XA 2RF2A 2E2OA 2VF3A 3EE3A 3KLHB 2E66A 1RHRB 4JKDA 3POTB 1HQEA 2VBZA 3DAWA 3QLHB 3S8SA 4TU8A 5KTQA 2ZJRQ 2IAJB 5AQIA 3ZZTA 1L3KA 4DQRA 5ADZA 5M1PA 2QTWA 4J5OA 1VC5A 3CO0P 4HT5A 3OJUA 3DYAB 1KQFB 3TZZA 3CQ8A 4O4RA 3PTWA 2DBBA 1U2VB 3KLVA 1Z6RA 2GA7A 1RKIA 3DDNA 3VAMA 1N5YA 2RQMA 4XDDA 3M6VA 1NSPA 3HHLA 3I0RB 3VR1A 1QAJA 4MTPA 4DCOB 3TUZC 3U4LA 3D3BJ 2GELA 1R0CB 4KGKA 1FJGJ 4ZMMA 3G96A 4KHMA 4FS2A 3KG4A 1DHMA 1VLOA 4CWBA 1S6OA 2CJQA 5D0GA 1XC3A 1SJ4P 4GW6A 3MMBA 1FKPB 1XTZA 2GNKA 2PMHA 3BQ0A 3CPWR 3T6BA 5HL7Q 5A2QO 2U1AA 3P4IA 2JEFA 5E2QA 1KQSR 1FW6A 2CVEA 2CFXA 1RDCA 2BGGA 2GVDB 4K4VA 2QXFA 4B3TJ 2D4WA 2V63A 3CCRS 3VHQA 5BREA 2QT7A 1CS4A 2J9CA 2G2YA 1YJTA 3POTA 3QJJA 4DOZA 3P39A 1S72S 1IBKK 3OSPA 4ID8A 3FZ2A 3HSJA 2F8SA 3W1YC 3KJQB 1QDUB 1XMOK 3WNFA 2O8EB 4KSEB 3D67A 2HMIA 1X4EA 5FLXO 1U2VA 2G8WA 2VBWA 3MMCA 1S1XB 3QT5A 4IBNA 3AB4B 3M1VB 3TSPA 2QFIA 1R3NA 5L9NA 3G82B 4WFAQ 4NASA 3I8BA 4K25A 2KRRA 3VV2B 3CXCM 3K0SA 2VC1A 1QM9A 4GVLA 3EJMA 2DIVA 2BABA 1S4FA 3IR7B 1K8AO 2ZWPA 4HH0A 1VQLN 4P2XA 2BV3A 2ATQA 4RW8B 1QJHA 3SCXA 3DOKA 1JXLA 1JLEB 3FVYA 1KWMA 1YRTA 1Q8KA 4LFBF 3IKMA 4L74A 4FNIA 1TGOA 3QETA 3HOSA 5FPDA 1DZ5A 3TNVA 3A3NB 2E5GA 1KC8T 2GVDA 1IBMF 2NRTA 1OMSA 1KVJA 1UAXA 3EO3A 1CPZA 1M5SA 1HNZK 2D1KA 3AD7C 1NU4A 1H2UX 4CLZA 1N34F 4EP5A 4MJKA 3FEZA 1HNXK 1S57A 2QM1A 4NYFA 3FZHA 5IT0A 2YV0X 3H90A 1ASWA 3NOGA 4O3NA 4FJ9A 2X6SA 2VQFK 3IBFB 3OXGA 4C3KA 4CHYA 5KFDA 2VH7A 2XSJB 1NJIO 4ECSA 3CCUN 2G0CA 1YBAA 3QJLA 2PFDA 2JZ5A 4TLRA 3SQ1A 4LD0A 3RBEA 1K9MT 3KJVB 4WCEQ 5BYQA 2B8QA 3NNAA 4JI3K 4V19J 1NGDA 4Z7YA 2R2RA 1UFWA 4ELTA 4PKDB 2KRBA 4F4ZA 2PEBA 3BKUA 4JKAA 1Q8BA 3MPUB 3OBWA 2LCWA 4NOHA 1B64A 5JMNA 2PFUA 4RW8A 1UVKA 3BGOP 4QWCA 4LF2A 2HBQB 2QWLA 2CJBA 1UVMA 2IC3A 2AZ3A 4IG3A 1JLEA 2PMWA 2MQQA 3GWCA 3J7AP 1Q86T 2LLZA 3V4IB 1TYQB 1R8PA 2P1JA 4F3QA 5LMNJ 5AJ3F 1XNQJ 2R4FA 2HHVA 1XEZA 2AEMA 1VSDA 4ZP9A 4CF0A 1G3OA 4LRFA 3UQSA 3TJ9A 2ACMA 2IDOA 4BE2A 3MOZA 4HCBA 4DR2J 2N4CA 3Q86A 2ITGA 2VG6A 1L3UA 4A2BA 3O44A 1WG4A 3NAEA 4PA1A 2FJXA 4PRFA 3CJ7A 3VQQA 5FPEA 5KT5A 4J91A 3ZEUA 4ZN1A 2EKNA 4CZFA 2CXEA 3OYAA 1NSKL 1Q9YA 2IM1A 4U7UK 1PIEA 2IDLA 3IAS9 2YWGA 4HH1A 2LECA 2KQ2A 4EFHA 3WXIA 1N36J 4OJGA 2AHOB 2UP1A 4X62J 4JI0K 3VVUA 3BZKA 5KFCA 4FJJA 1Y3JA 5KFEA 3UE2A 3HM8A 4RR5A 4ENOA 1WF0A 3I0SB 4E1NA 5GADP 2FY1A 1YHQN 2R42A 3DKDA 2B9YA 1X4HA 2APOA 2CPXA 3OL8A 2ROPA 1M5KC 4PWDB 1NGFA 1FJGF 3LOUA 4P2FA 1TL7A 4Z4GA 3V4IA 2YX1A 3LP2B 1TYQA 3TAPA 2IBKA 1ATSA 3CJQA 2E5JA 5F1XA 3PRVA 2DNKA 1G2EA 4QR0A 4CBWA 3BEXA 3HSCA 1D8YA 2V69A 1T0TV 4CBUA 5I3PA 3L0QA 2NRVA 4MKYA 4QS7A 1EZZB 5EGYA 1S6QA 1IJEB 4DSIA 5JS1A 4S0MA 1CJUA 3EMTA 5IT9U 4B3TF 4YB5A 4BRHA 3OL9A 2HVZA 1SL0A 5H9EK 4ZLLA 2CPHA 2IIHA 4QWEA 5IM0A 2M70A 3DRSB 2ZE2A 4CEFA 4CGGA 2XYHB 3MMAB 1NRKA 1C0UB 3AY9A 2UUTA 1WSEA 3P5TL 4LVNP 4RNNA 3A4TA 3E2EA 1WB9A 3HFKA 1GX5A 1BUPA 3K5LA 4CK1A 1EXQA 5CABA 2VBYA 1FNMA 4RW6B 2B4UA 3D2FB 1UCNA 3O3GA 4QOZB 4DR1J 3PX6A 1C2PA 4CJ5A 1IVZA 1BHNA 3C46A 2E1CA 1VHFA 4FL9A 4DU7A 3K9JA 3WC0A 3O9TA 4OZ5A 2OPQA 4KB0A 5BRDA 1T9YA 3LP2A 4F3TA 3MCNA 2NQPA 5CYMB 4PHTX 4GV6A 2DNZA 3U1MA 4ZHRB 5ETOA 4Q8FA 3KUHA 3GYNA 3CCES 2MJNA 3G4SN 2UUCK 1X9SA 4KGMA 1LK5A 4DN0A 4NLBA 4E7IA 2V34A 3BO2A 3GYXB 4EEYA 3TYTA 3IC1A 2SXLA 1T3VA 1SC1B 1CVJA 3BB5A 2MHEA 2M4MA 2VD3A 3U8XA 1FRLA 3FFKB 2HFSA 2E29A 1RCOB 4TY8A 2GS8A 1FDBA 2J9DA 4I64A 3CCQS 4DMZA 2QWRA 3QSIA 1QQCA 3NGZA 3SSRA 5H1SQ 2HQIA 1Q81O 4WFBL 4ER8A 4CEOA 1HLUA 1O8BA 3PIPQ 3AGKA 3D9BA 3LZJA 2EX3A 1H72C 3O4QA 4M5MA 3NH2A 4OYMA 4LBHA 1YIJS 4RW6A 2A2CA 1ZYQA 1M5PC 3H59A 4DV3F 3I55S 2ZKTA 3OXLA 2AP1A 4CJ7A 4G6VB 1HW9A 2NPIA 1OH6A 3CCMS 1S0OA 3G6EN 4IO9L 5CYMA 3NCIA 2DNGA 1JKHB 3SAGA 2ZOFA 1U26A 2J4RA 1CG2A 5DM7L 2GVZB 1NPRA 4J2AA 1XJWB 4OYBA 3UR3C 3EPGA 1YITN 3RG6A 4ID5B 5LMNF 1XNQF 2PDAA 3JYTB 4U95A 2CQCA 3EWGA 1FDNA 3BGLA 4Y2AA 2QGFB 1EWRA 3Q2TC 2KHDA 2LQ9A 4HR2A 2QWMA 2WVCA 1VC6A 3O3FA 3BBBA 1NB2A 2EHGA 1TR0A 3L2UA 4EZ6A 3HSTB 3OY9A 4R5PB 2CZVC 2Q6CA 3ISNC 2UVUA 1RLDA 1VBYA 4OKJA 1OH8A 3PFEA 3BR9A 4MFBB 2PIIA 3I9V9 1N36F 3MCSA 4WFNL 1VCTA 3N6LA 2G8UA 1NGCA 1HD1A 4OHYA 5AQRA 4JYAJ 3ZZPA 1FNOA 1Y00A 3G8QA 3F5TA 5KFRA 3B4DA 1Q8IA 1JKHA 4BRDA 3ID8A 1ZOTA 3BDPA 4DR7J 2O01C 4CZGA 3VQ9A 4KH0B 4I7FB 4FVMA 3K89A 2CQGA 3E1YA 3WXMB 1PAEX 5IS2A 2P9PB 4DPOA 3TARA 4KIAA 5ADXA 5JVGL 2E7VA 4F25A 1VQYA 3CCTA 3TWHA 7FD1A 1BO5O 5B8HA 1TQLA 3LWMA 3H4DA 3CFRA 3R9PA 4CHPA 3B8AX 2G8IA 1Q95G 2QA4N 2XMMA 1YQHA 1PJ7A 3M6XA 1U25A 4XAKA 5F8JA 2F4VJ 4B3SK 3NNHA 3GZ7A 1UA1A 2X1BA 3GJTB 4JKFA 4DU3A 4M3TA 4NXMK 4C3MA 1KCFA 2QX0A 3BR8A 2IM2A 3M2RA 1KC8O 3SV4A 4OGEA 3CDBA 2HK3A 3ZSXA 2R2SA 4N7TA 2ZD1B 3WXLA 2ZWHA 3R8YA 5GAGI 1NDLA 4DR1F 1ZBHA 3TSUA 5CD4H 3UIQA 5B0GA 3KLGB 3OR2B 4I7FA 1YK9A 5AQGA 4DFJA 5HQ8A 3F9KA 3MM9B 4I67A 5EDWA 2P9PA 4Z94A 4K0KK 1Q78A 3TZXA 2MQMA 4BS2A 4CVNE 3EXCX 3L2QA 1NPPA 5LT5A 4OYZA 4H5RA 2GMHA 1JWWA 3R6MA 2F9DA 2WAQD 4K8XA 3MM8B 3SFGA 9RUBA 1PG5B 4CFDA 4FO0A 2Z2ZA 5B0EA 4KRFA 2HMPA 5BR8J 3J7ZT 2NCKL 3SPYA 2V8HA 4ALZA 4AT1B 4K59A 3NDKA 5M1OA 2RT3A 1X5PA 3MPDA 4LQ3A 5DG9A 3B82A 5F8IA 2W01A 4NLVA 4GVMA 3QFHA 2P51A 4W5RA 1NOYA 4ILMA 1U04A 3MDQA 4P52A 5IZHA 4JN4A 3WQPA 1C0TB 4E7LA 3HPOA 1I3OB 2ZD1A 5D0HA 4OFZA 2ZOGA 4LT6A 4ATNA 3AA8A 2RE2A 2FLLA 2VOOA 2PI4A 4MDAA 4LIWA 4CFBA 1DY3A 2MLXA 4DPUA 1IJJA 3EZ5A 3DXSX 3CCRN 3EL2A 5KFOA 2FJDB 2PZSA 1WAFA 3KLGA 2WUSA 2EBGA 2QMWA 4F4WA 2QYGA 3DLGA 1QAYA 5ELZA 3CMEN 3HI9A 3NS7B 2V7ZA 3ZT1A 3BEGB 1VJQA 3MM9A 4HHUA 1VRTA 1TUUA 3QEIA 2K2PA 4F4AA 2ZJRL 3QNOA 3ADAC 1S72N 1DTQA 4QIFA 4QIWD 3ENOA 1ACMB 4IJNA 3TI0A 9ATCB 3D6HB 2DR7A 4U67Q 1O13A 4Y2CA 2Z1HA 2J9EA 3KOAA 1C1BB 1FESA 4QWBA 4FOIA 2N7YA 1SH2A 2NRZA 1QY7A 3RGIA 1R31A 4JI2F 1RT1B 4DU8A 3RMDA 4RNHA 4H8KA 5KG5A 4CEAA 5M2RA 3K5OA 2VOPA 2EW9A 3THPA 2MEWA 1S9GA 4ZTJA 2DK2A 1U7LA 4CJ3A 3G8TA 4MKAA 1P1LA 4Z4FA 4QU6A 3SQGB 1QD1A 2O4GA 3TTCA 2ZF5O 5ETPA 1MMNA 1AROP 3FZBA 4AHVA 1FD2A 1N32F 1OQ6A 2CQHA 2HWTA 1VSJA 2AJQA 2UXCJ 3KZBA 4I1TA 3A0IX 3K2PA 2COLA 3OR1B 1C0TA 3U02A 1QSLA 4WP9A 3MN9A 1DGKN 3CHWA 2K7KA 2PC6A 2D0AA 2HRYA 3DCAA 2IY5B 2MJUA 5THWA 1X0PA 1U48A 3SAHA 3ZSRA 1EARA 2D9PA 1E6VB 3CULA 4C8MA 3AVMA 4R79A 3M2UB 2DTJA 4JYAF 4BWMA 3NG8A 4GKJK 3N9UC 2EVZA 2HGMA 2X3DA 3NF8A 1WSIA 5LY3A 1ULRA 4CO0A 1LXJA 3T9ZA 2BM0A 4H0PA 2ZH9A 4FP9A 5A2QU 5AE1A 3MEEA 3P4UB 3T1HK 3AB2B 5IV4A 2XYPB 3NRBA 2ZGYA 4FJIA 3JTPA 4DEZA 1C1BA 2E1MC 4CERA 3M30A 2O67A 1Z2LA 2NRRA 5AQSA 4WFAL 4DX6A 3VF4A 3AO2A 2GC8A 3CJAA 1PCAA 3MFHA 3R9LA 4FJHA 2B56A 4CFAA 2J0XA 3T1AA 2AV5A 5FLXU 2F4VF 4F04B 3WX4A 1E6YB 3JQJA 4EFAC 1EKEA 4O0NA 3OR1A 4DV5K 1U09A 3R5CA 4KO0B 5KFHA 4E89A 5ADXH 1KOOA 4CNZA 3BYRA 1RT7B 3HT3A 2NZ4A 3HBTA 2BJDA 3ID6A 1VRQC 5J1EA 2WSEC 1DKGD 2Y1IA 1Y5LB 3NGDA 3W9JA 3PFOA 4CLPA 3TUPA 3VGSA 3UW1A 3ZX3A 1L5UA 4IG0B 4RW9B 2JSXA 4H0XB 5HVFA 4DSFA 1S0MA 4TQSA 4DI6A 1FVQA 2MQOA 2IIRA 1RLCL 4OO1J 1P27B 3EICA 3I8DA 3S3MA 4YOWA 3S7RA 1Y11A 2CWXA 4OX9K 4WCEL 1RT3B 1CLFA 3THXA 4LH4A 4OHXA 4DPWA 1DFDA 3H5UA 1P9QC 4FJKA 2CQ2A 4AHRA 3LPTA 1TKZB 1ZA1B 1FEEA 5BR8F 1NXIA 2GHWA 2AU0A 3O4NA 2ALYB 3VA0A 5F3TA 2W41A 2P9EA 3ITHA 1ZZFA 1RTHB 2Q0RA 1LK7A 3OTDA 4XH5A 3OYKA 4EMDA 5JXSA 4KO0A 3QGPA 1RT7A 2XI2A 3VAJA 2P9UA 5C25B 4LR9A 3G71S 4CIGA 1RBTA 3M8SA 2Y8YA 4DTUA 1KAYA 3OJSA 4PY5A 4LFCK 1X9JA 3S01A 1BWFO 2P5VA 2NUBA 2HQCA 3LM2A 3JTOA 4IRCA 4BRIA 4DL2A 3T1YK 1KVIA 2KG1A 3N5BA 2PFFB 2HHSA 4TU7A 3AV9A 2QL9B 3T5JA 2F3JA 2A1RA 3OLBA 5KFYA 2HHXA 4ZN3A 1RT3A 2D1CA 4B3OA 4J7CA 4DR6K 5BN9A 3QIDA 3I56S 5A2QY 1G6BA 4C1NK 3UD5A 3W0LA 1TKZA 2Y1JA 4XO0A 1URNA 4CQ1A 1VQSA 4OZ2A 5J2PB 5CXTA 4FWKA 3QBWA 2P9IA 2DGSA 2VASA 2KL8A 3OYMA 5DLFA 4AHTA 2YH0A 3QO9A 4ZVSB 3R5JB 4DDFA 3Q2SC 1IXKA 1GMVA 4KHQA 3OYFA 3RW6A 1YZ6A 4DR4K 5I4MA 4LRCA 2ZM6J 4LFAK 2AGOA 2NXCA 2UXCF 1KTQA 1AUSL 2FBVA 4K2JA 2W7AA 4BDZA 3LDQA 4OPJA 2XRIA 3Q23A 4KHRA 2WVEA 1FK9B 1W7WA 3B54A 5KT2A 1HBMA 1WACA 4FWOA 1TKXB 1V4SA 3OBIA 3L2WA 3GBTA 1W97L 2GZOA 4RX6A 1MROB 3TAGA 4A61A 3BQ1A 4NXNJ 3CCQN 3B8HA 4M5KA 1TV6B 3K59A 4QYZJ 3TUJC 1GMWD 3ULHA 1ZAVA 2H48B 1TVRB 2P2CB 3EUNA 4HUGA 3TAEA 3H5SA 3DXMA 3WNGA 1YIJN 4DV1F 4CJQA 1BD6A 4DV4J 2VYPA 1YXQA 1IV0A 1TTHB 3SBMA 1U2CA 4JB8B 3SAFA 3H46O 5LJ3Y 2AYGA 3I55N 4H54A 5J2PA 1S6PB 2GFFA 1RWWB 1KD1T 1RAOA 2BTFA 4M3YA 2GHVC 3CCMN 1HWJA 5BXIA 1S76D 3TZYA 2XCPA 4LSZB 2CJKA 3EZUA 4MK7A 3OVAA 1PC4A 4J9UE 4BGBA 1D3WA 3VQCA 2V4JB 1IN0A 1RISA 4Y00A 3U3YA 2HIYA 4DFMA 1KKHA 1VR6A 3MN6A 2YKAA 1KONA 3CI5A 3R8EA 3CERA 2DGTA 4FF1A 1FT8A 2D3UA 2P9NA 3CQYA 3O5TB 3K5MA 3NF9A 1FK9A 1O6XA 4W5OA 2ZWOA 2D5RA 3C8YA 2FVQA 1C6VA 5T7BA 5AXMA 1CQMA 3J7ZO 1IWGA 3Q8PB 3THWA 4E7JA 1MU2B 1W9HA 1IR2A 1NZAA 3KNAA 1MROA 3QGGA 1S4EA 3RB6A 3DRRB 3HJFA 1TV6A 1VIOA 4CHNA 1G1XA 3OVNA 2DCUB 3AVFA 4C9DA 2D74B 4UQGA 3ZX2A 2JEJA 3FZFA 3PJ9A 3DLHA 3PJWA 5G0RA 4BVOA 2NUHA 2O8CB 2WBRA 2Q6BA 1S1VA 2O8FA 3FEYB 2ZZMA 4FPIA 1Y64A 3MCPA 3D0IE 4K5SA 4JD2B 1C1CB 2C3MA 3G86A 4MK9A 4Y1DA 2CPYA 3DOLB 1HFEL 1WELA 4YR2A 3CJTA 4OPAA 5KG3A 2WBMA 3MOJB 2VQEJ 1VBKA 3K58A