3MEEA

Hiv-1 reverse transcriptase in complex with tmc278
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords p66 Reverse transcriptase
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 155
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3meeA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3meeA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3meeA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3meeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3meeA05
3DLKA 2G8KA 4X2BA 1CSJA 3E51A 3SUNA 4TY8B 1XC9A 1OS5A 1SKWA 2QKKA 2G8WA 3C6TA 3BQ2A 4CIFA 5C25A 3GYNA 1VRTA 4KREA 4FLZA 2J6SA 3RAQA 5HRPA 1S97A 1Z25A 2FVSA 3QO9B 2OPRB 1RT3A 1SUQB 4RNMA 3HSTB 1JLCA 3NE6A 5KFBA 4EZ6A 1UWBA 3H4BA 4RW6A 3AO5A 3CDUA 5J1EA 3LP1B 2W9AA 1YVUA 2UVRA 1GOAA 4KI6A 4M94A 2F8EX 1XI1A 4K8ZA 5F8MA 3S9HA 2E4LA 4DTRA 1QAIA 2ILZA 3NAEA 5KRTA 1LWCB 5HRNA 4FM1A 3DLEB 4O3QA 1J5OA 1I6JA 1RTHB 3BQ1A 1NK9A 1RBTA 2FBTA 4HCCA 3B6OA 1SL0A 5HLFB 4Y1DA 2O5DA 3MEDB 3KD5E 3KLIA 4PQUA 2RN2A 4NZ0A 3DRSB 1NHVA 2Q3SA 1U49A 1QHTA 4QWAA 4FJ5A 5J2MA 3QIPB 5J2QB 3GILA 3OYHA 3FDSA 2YHBA 3GIKA 3PW0A 3PV8A 2YHAA 4B9NA 3FRZA 1RTJB 4ZVFA 1U47A 1T05A 4K4UA 1EETB 2FVPA 3G86A 1TVRB 5KFVA 2AWZA 2XGPA 3NF9A 1B92A 1T94A 3VQ6A 4URQU 1XHZA 3HJFA 3NH0A 4E89A 4WYWA 3QGGA 4ZVEA 1KFDA 2D5RA 4DU4A 2IJFA 1VSJA 3RRGA 1HNIA 4MQ3A 1WAJA 2BE2A 4R8UB 4WXWA 5EU7A 4FLWA 4DFMA 4F8RA 2V0NA 4DG1A 1J53A 3O3HA 2YNHB 3KLEA 3DLKB 2XO7A 5KFRA 3VQ9A 3C6TB 2KFNA 1U09A 5C25B 4CJUA 1VRTB 4QAGA 2WONA 4WFXA 4ZP6A 3ALYA 4ECWA 1RDBA 4KB7A 5KG7A 4U7CA 1N6QA 4LH4A 1RT3B 3IS9A 3P5JA 3HPOA 1UA1A 1JLCB 3AA3A 4EO8A 3H08A 3QIDA 1UWBB 4RW6B 3AA5X 1QQCA 4HTUA 5J1EB 2VWJA 3PW4A 1NJWA 1SH3A 2DFHA 2FVQA 3KMQA 1NK4A 3NKYA 3EYZA 4B9UA 4KB1A 5KFJA 3IG1A 1S0OA 4DL6A 2E9TA 2VWKA 3MXMA 3SI6A 4K8XA 4FJKA 3H59A 1J5OB 1YT3A 1KHWA 3L3VA 2WOMA 4Q8FA 3V6DA 1VSDA 2I5JA 4F4ZA 4ECYA 4CEDA 4FW1A 3KLIB 3KTQA 4PQUB 3QNOA 1TL3A 4DMNA 4DU3A 1X9WA 4IRKA 5J2MB 1GX6A 1I3AA 2WRMA 4B8CA 4B9SA 1IG9A 2P5OA 4AHTA 1T05B 1SV5A 3LPTA 3OS1A 1ZBLA 4NLPA 1BL3A 3Q8PB 3OL9A 3NMAA 1TK0A 2BQ3A 2IBKA 4OGEA 5KFFA 4NLYA 3SQ2A 1VK0A 4NRTA 1BCOA 4FZZA 3N6MA 2JEIA 4ID1A 3KLVA 3D28A 3QINA 4FLYA 3LANA 4KTWA 1L3VA 1HNIB 1VSMA 3MEEA 1JXEA 5L1LA 3AO4A 4QWEA 3CJ3A 2BE2B 5JS2A 1HNVA 3MR5A 2R8JA 4IDKA 4DG1B 4E1NA 3HK2A 3S3OA 3KLEB 1JX4A 5KT4A 1VSEA 2DPJA 4FJJA 1VSHA 2CJQA 2YKMA 2BRKA 1TAUA 2WONB 1S49A 3LZIA 1N6QB 1S1XA 3CM5A 2XY8A 5DGBA 3RTVA 3IS9B 3ZSQA 3PY8A 4CHQA 4DFKA 1I39A 1T7PA 2QV6A 2GIQA 5F8NA 1WSEA 1XR6A 3OSNA 3MTKA 2AGOA 4IR9A 4XPCA 3BSOA 4QWDA 1NOYA 3IG1B 4CF2A 3H5SA 4ECTA 4CF9A 4UQGA 4CJPA 2WOMB 1BGXT 3AVHA 5L1IA 4KO0A 3KJVA 4DL2A 3V6DB 1NK6A 4C8KA 2I5JB 3ZSWA 3U3YA 1FXXA 3SPZA 1UOCA 1TL3B 4IG3A 4U6PA 3QEPA 1SKSA 2AX0A 3GIMA 3K59A 3ZSOA 4NLRA 2W8LA 1L5UA 1RA7A 4CHYA 3C6UA 4KHNA 3SI8A 3VN5A 3TI0A 5F8HA 3LP3A 3TVKA 4NCAA 4JUZA 2P51A 4E7LA 3K5MA 3QEVA 1CZBA 4IR1A 1L3SA 3MFIA 4ED1A 1SV5B 1BQNA 1ASUA 3ULDA 4CEEA 1KVAA 4CIEA 3B6PA 4KRFA 3NGIA 1RBUA 2AU0A 4N56A 2G8HA 2ASDA 1LAVA 4CEQA 3DRPA 1EX4A 4Z0UA 2IM3A 1Q9YA 4NLUA 4KI4A 3TQ1A 3G6YA 4TQRA 3MEEB 2W9CA 4IG0A 4KFBA 1NJXA 1S10A 3L2QA 3T5LA 1ITGA 1U48A 4HKQA 3VQQA 1HNVB 3QZ7A 4IDKB 4EP4A 4IKFA 4DSIA 4ECXA 3P1GA 3SJJA 4ED8A 3SPYA 3BQ0A 4YMEA 4ED3A 3RBEA 3U3GA 3NHGA 4DFPA 2YKMB 3M9OB 2P5GA 4QCLA 1SH0A 2ALZA 4E7JA 1S9GA 3I0RA 4LSNA 3KMSA 2WHOA 4RNOA 3ZT4A 3SCXA 5KFCA 3LDSA 3SUQA 2ZKUA 5F9LA 3HXMA 1S1XB 5HROA 4IH6A 2BR0A 2VG6A 4YFUA 1ZBFA 2OPPA 3OL8A 4ECSA 3PW5A 2XRIA 3DI6A 3KKRA 3RMBA 1KFSA 4CGDA 4ELUA 4NLXA 4DF8A 2PYJA 4Q0BA 5KFZA 1JLEA 2WTFA 1S0NA 3CVKA 5KFKA 4KO0B 4AH9A 3KJVB 2HB5A 3TAFA 3PZPA 3RR8A 5J2NA 3GIJA 4JS4A 2Z1IA 4DWIA 4NLTA 4CJEA 4IG3B 1WLJA 4W5TA 4PY5A 3TANA 2ZQBA 4M3RA 4RW9A 4FJ7A 2XGQA 4TY9A 5L1KA 3M8RA 3C6UB 1WSJA 3D5MA 1KVCA 4KPYA 1S4FA 3N6NA 4GMJB 3AV9A 1FK9A 3CJ2A 3L3UA 3KHGA 4AHVA 1BQNB 1C1CA 4GC6A 2EHGA 4K50A 3MECA 4LD0A 4Q8EA 4DTJA 4NLOA 1MU2A 3CJ0A 4M95A 4OVLA 2W7PA 3O3FA 4KAZA 4PUOA 5KFTA 3DRPB 5F8LA 3MR6A 5C42A 4YR3A 2IMWP 3E01A 1IKXA 2W9CB 4MFBA 4IG0B 4KFBB 1RT4A 3QESA 4K4XA 4F2RA 2VA2A 3NCIA 3CG7A 2OA8A 2VG7A 4LQ9A 2IA6A 5DG9A 3AVCA 4ZPBA 1FKPA 2JEJA 3PR5B 3M8QA 5JUMA 1GOCA 4EBEA 3KK2A 3OYMA 2KZMA 1S9GB 3VQPA 4HYKA 4TSXA 3I0RB 4LSNB 4EBDA 3KLFA 4FJGA 1Z4UA 5HROB 5C5JA 5KT2A 2VG6B 1K6YA 2OPPB 4K4SA 1K1QA 5T14A 3OYKA 3DI6B 3KK3A 4J2AA 4C8NA 3C94A 4CJ3A 4NLQA 4OKEA 4CEFA 4FJ9A 5KFWA 3HO1A 2RF2A 2IM2A 4JLHA 1L3TA 4KKOA 3H40A 3VQAA 4Q0BB 4NYZA 1LW2A 3OS0A 3FFIA 2UUTA 4CCHA 4E3SA 5EWGA 3H5UA 3SQ1A 1JLEB 4MK9A 4DTXA 2EC0A 3KD1E 4TLRA 4E7IA 5CY4A 4DFJA 1KHVA 2JC1A 2E6MA 4W5QA 1JLGA 2RDIA 2OPQA 5L9XA 3QGHA 5J2NB 1D5AA 5DG8A 4CIGA 4RNHA 4F4YA 2HHSA 3Q8SB 2CKWA 1B9FA 2YKNA 4RW9B 5I42A 2ZD1A 3HT3A 3V6JA 1QUVA 4ZTFA 1FK9B 1QE1A 4CJLA 4QWBA 4IRDA 3DMJA 4RU9A 5KFNA 2W9BA 4O3OA 1C1CB 1RT5A 4KTQA 3ZSVA 3BDPA 3MECB 3AVIA 2HHWA 1MU2B 1RILA 1VSIA 3WNGA 5KFMA 4PUOB 4NYFA 5C42B 1S1VA 3E01B 1U04A 1IKXB 4FW2A 1RCHA 4DSEA 3CWJA 4MFBB 2E9RX 1RT4B 4CFBA 3T5HA 4FLXA 2NUBA 3T3FA 3TAMA 4CJ4A 3EZUA 3MEGA 5CZ2A 4OJRA 2VG7B 2DFFA 1T03A 2AX1A 4WFYA 3MF5A 4N5SA 1FKPB 3NAHA 3NDKA 3M8QB 1XWLA 3KK2B 3K58A 3QNNA 1T3NA 4F4WA 4BDYA 1Q9XA 4Q5VA 3KOAA 5DG7A 4KHYA 4CEBA 3KLFB 2IDOA 1RT7A 3LP0A 2J6UA 3ZT1A 4J9RA 4FVMA 3HPGA 4WZQA 2DTUA 4O3RA 2IAJA 1SH2A 3ITHA 4ELVA 4ECUA 4QWCA 1REVA 3NH1A 3L8BA 4N47A 3KHRA 3KK3B 3CYMA 3OHAA 4HUEA 3BGRA 1DTQA 1TKDA 2RF2B 1D1UA 4KKOB 3OYFA 4CJKA 5FROA 1KLMA 3TAPA 1LW2B 3FFIB 2KZZA 3PHEA 3QETA 3IN5A 1IKVA 1JLFA 1JLGB 4M45A 1RT2A 3QGIA 4I2PA 2OPQB 4M3XA 1HARA 4KE5A 4KBIA 1RT1A 1JXLA 4PWDA 2YKNB 4O55A 3QEWA 1W0HA 3IAYA 5I42B 2GC8A 2ZD1B 4DL4A 2UVWA 1NNDA 1QAJA 4Y3CA 3A2FA 1JXBA 4FBUA 1QE1B 3U6FA 4DQSA 1DTTA 4O44A 3DMJB 2W9BB 4Y2CA 1RDCA 4C8OA 3KHLA 1G15A 5SWMA 3AVAA 1RT6A 4AHRA 1RT5B 3OL6A 3I8DA 4JRPA 1HMVA 3MAQA 2C2EA 3SZ2A 3O3GA 5CZ1A 3V1RA 1S6PA 4KHRA 4W5NA 4IFVA 2Z1JA 5EUHA 3ZT2A 4E19A 2VG5A 4BE1A 2XCAA 1S1VB 2IS3A 4CHNA 2V9WA 4IH7A 1D9FA 4CJTA 1HQUA 3DLRA 3RMAA 2C2RA 2JGUA 3KKSA 4RW8A 3ZCMA 2DPIA 4DS5A 3TAMB 4Y1CA 3MEGB 2IGIA 4NLSA 3G10A 1T03B 1T8EA 4BE2A 5KFYA 1D0EA 4ZP7A 4MIBA 3SQ0A 2B4JA 4JS5A 4CERA 2OZMA 5KG4A 3QIOA 3PJWA 4CK2A 2EX3A 1W9HA 4OL8A 3ZT3A 1BQMA 1RT7B 3CFRA 4NYNA 3LP0B 3DOLA 3V6HA 4NLDA 1CLQA 1JIHA 2IAJB 3UQSA 3SUOA 3ITHB 5DGAA 2FLLA 3BSCA 4YP3A 1REVB 3H2LA 2QK9A 2OH2A 3BGRB 1DTQB 1Y97A 3OYCA 4J9MA 2GBZA 1GX5A 1WAFA 3VQ8A 2ASLA 2D3UA 1KLMB 4J9PA 2R2TA 2D0AA 4K4YA 2IC3A 3THVA 3NAIA 3WNHA 5HBMA 5KFAA 4MK8A 1WSHA 1IKVB 1JLFB 1N5YA 3VQ5A 1RT2B 4I2PB 2Y1IA 1UAXA 1SL1A 1N56A 3CDEA 3QLHA 1RT1B 4H4MA 4PWDB 1WSIA 3K2PA 3GV5B 5KGWA 4CK3A 4NCGA 3H5XA 3JSMA 4CHZA 3AVBA 4O5BA 1RTDA 5CYMA 4RW4A 3ASMA 3QEIA 3PX0A 4O3SA 4CK1A 1DTTB 4O44B 4CF8A 4OPKA 4O4RA 3RMDA 4O4GA 1N48A 3S3MA 3N6LA 4EBCA 1RT6B 1NJYA 1QTMA 4WXOA 4I9LA 3T5JA 1HMVB 3EPIA 4K4WA 2HHVA 1KVBA 4L8RB 3LZJA 1S6PB 2XI3A 4IFVB 2VG5B 1L3UA 4ZMMA 5C24A 5KG3A 3GIIA 3KHHA 1S1UA 1HQUB 1YTAA 2JEGA 4YR0A 3TAGA 3TABA 4RW8B 3OYDA 2R8GA 3NGZA 3UIQA 3CJ5A 4TYBA 2FJVA 4ID5A 2HHQA 4FJHA 1TAQA 3WNFA 3BR9A 2YNFA 2YNGA 3OYEA 3AVKA 3RB4A 5KG0A 1BQMB 3DOLB 3LALA 4Z4IA 3OYGA 1C0TA 4FXDA 4HCBA 1ASVA 3H98A 1BHLA 5DQHA 1TK8A 4JV0A 3PJXA 4NLGA 5F9NA 3ZSXA 5KG5A 1KRPA 4CEZA 4B3OA 4I7FA 4DTNA 3RR7A 3KLGA 5KT5A 3G6XA 3PO4A 1LWFA 3OYJA 4IOBA 5HRSA 3D0PA 1LWEA 3V9XA 2IJNA 2IC3B 1JL1A 5HBMB 1EXQA 3Q8QB 3OSPA 1XR5A 1N5YB 4H8KA 3HP6A 3T5KA 1TV6A 1CXQA 4BDPA 4EZ9A 4RZRA 2OYQA 1KSPA 3V81A 4M3WA 2ZE2A 2J6TA 3QLHB 3IGVA 4H4MB 3IRXA 1VSFA 2R2UA 2PY5A 4KHWA 4OPJA 4CJSA 4LSLA 3RMCA 5KFQA 4NCGB 3JSMB 4URSA 4DL3A 1RTDB 5CYMB 4RW4B 3UDLA 1TKZA 3SNNA 4AHCA 4ED7A 2D0CA 4O4GB 4J2DA 4J9QA 1ZBUA 4M3YA 4LQ3A 4G3IA 4M42A 3SQ4A 5EDWA 1KCFA 3HP9A 4ECQA 5HP1A 1ZYQA 3FQKA 3OYNA 4FM0A 2FBVA 1NKEA 2A1SA 1NKCA 3OHBA 2HWIA 5C24B 1XHXA 1S1UB 4EYIB 4CJQA 3NH2A 3SUPA 5DK5A 4ECZA 3PX4A 2B6AA 1D9DA 5KFUA 4BWMA 2C28A 4WZMA 4JV1A 3VQCA 4DSLA 2ASJA 1BIZA 2Z1GA 1WSFA 3AVNA 4ID5B 4CJ5A 4FLUA 2RPIA 2BANA 1ZTWA 2X78A 4C8LA 2YNFB 4ZP8A 2KTQA 2X6SA 4AHUA 3V9ZA 2YNGB 4KHMA 3DOKA 3DRRA 4I2QA 2HHTA 4CEAA 1HJRA 1HQEA 2W8KA 4KSEB 4IKAA 5KG2A 4B08A 4CGJA 1NOZA 1C0TB 4ZVHA 3O4NA 4AILC 4GC7A 2WCXA 2G8VA 4DTMA 3OLBA 4CGGA 3FSIA 3ICLA 2V4RA 1HYZA 1HYVA 1JLBA 3T1AA 1JLAA 2R8HA 3F73A 2LSNA 4ZTJA 3HVTA 4KHSA 3VA3A 4B3OB 4I7FB 4BDZA 4B9VA 2FJXA 4TYAA 3KLGB 3KNAA 4JRQA 1LWFB 3RAXA 1LWEB 4G1QA 3M9NB 3HVRA 4IQXA 5E41A 4J9KA 5DLGA 1BCMA 3GV8B 5CYQA 2ITGA 3NF6A 1TV6B 3MXJA 2W7OA 1TKXA 1RDDA 4KHQA 3V81B 3JYTA 1RBRA 3V9WA 1W25A 3DM2A 2ZE2B 3IRXB 4B9MA 4CJFA 3I0SA 2GUIA 1U4BA 4QPXA 4LSLB 5KFOA 4URGA 3QYYA 2UUWA 3HKWA 3ISND 1TKZB 2DFEA 1S6QA 2RKIA 2FLPA 2XI2A 1S48A 4KTZA 4ZP9A 1ZBHA 1ZBIA 3LAKA 4DLEA 4NLWA 4IBNA 3RRHA 4Z4GA 2HVHA 3SV4A 3KK1A 4TN2A 4H4OA 3PO5A 4MKAA 3EPGA 3L2UA 5HP1B 3VQ7A 2DY4A 4F2SA 3VA0A 3L2WA 5KFXA 3RBDA 4Q44A 3NGDA 3CM6A 2IM1A 3AVGA 2AGQA 4FBTA 4CHOA 5SZTA 1X9SA 4J9NA 5DQIA 2FBXA 2XY7A 2B6AB 4O3PA 2F96A 3KIOA 2OZSA 2AJQA 1HPZA 1WSGA 2FBYA 4DU1A 3PUFA 2BANB 4JV2A 2E6LA 3OYLA 2R8IA 2X6NA 4Z4FA 3CJ4A 3DOKB 3DRRB 4I2QB 1HQEB 3K5NA 4RNFA 2HMIA 3MFHA 2QKBA 4PA1A 1ASWA 2PYLA 1SL2A 3PR4A 3LP2A 3SFUA 1LAWA 5EWEA 1HRHA 4DQQA 3QERA 1J54A 1S1WA 1S5JA 4B9TA 4F4XA 1JLBB 2FLNA 4FK2A 1JLAB 5FRMA 5KFIA 4K4VA 4DL5A 4CF0A 1B9DA 4CE9A 3M8PA 3HVTB 1R0AA 5KT7A 1VSLA 1HYSA 2YV0X 1QSYA 4Y2AA 1RTIA 3G0ZA 5L1JA 3EZ5A 2B43A 3AVJA 3OYAA 4G1QB 2JC0A 5KI6A 4J9OA 4BE0A 4J2BA 3OY9A 3BJYA 2W42A 3HM9A 2O4GA 5CYQB 1NK7A 4KB0A 1TKXB 4GW6A 1IH7A 2IOCA 3JYTB 5EWFA 4Z4EA 1BISA 3DM2B 4J9SA 4CFAA 5DQGA 3VQEA 3OLAA 2R2RA 2R7YA 4CGFA 1TL1A 4O3NA 3I0SB 2XY5A 5F8JA 2D3ZA 5KT6A 1C1BA 4M3UA 4KAIA 3TARA 4DTSA 1S6QB 1X1PA 3TAEA 2RKIB 1QSSA 4EP5A 4CFCA 4ELTA 4N76A 3DDKA 3TR8A 1S1TA 4FJIA 1A5WA 4CGIA 3GV7B 5DMRA 3KK1B 4H4OB 2HNDA 3OS2A 1A5VA 3VQSA 1TKTA 3Q8RB 3ZSRA 3OJSA 3BSNA 4QW9A 5J2PA 5T7BA 3HL8A 5K14A 5JXSA 3CIZA 1CXUA 4Z4CA 4FK4A 1RDRA 5KFSA 4MH8A 1X9MA 4ZPCA 4F50A 5DLFA 2XCPA 1HPZB 1IKYA 3SFGA 1RNHA 3AA2A 3DLHA 4CHPA 1RYRA 2HHUA 5KFEA 4ZHRA 4WE1A 1BIUA 5I3UA 2HHXA 3ZSZA 3NL0A 4DF4A 4K4ZA 1LW0A 4YQWA 2FVCA 3VQ4A 3RB0A 2HMIB 1TK5A 3K57A 4Y34A 3LP2B 1RBVA 2G8FA 1S1WB 1S0MA 4HVJA 1KTQA 3CFOA 3I5BA 2R8KA 4E1MA 2XY6A 3C95A 5FRNA 3M8PB 4OKJA 4DTPA 1R0AB 1EKEA 3TWHA 1HYSB 1RTIB 4MKBA 4CFDA 1XR7A 4CESA 4DSFA 1WNSA 2ATLA 3NF7A 3V9SA 1C6VA 3HHKA 3KLHA 2IM0A 3VQBA 5F8IA 2QE5A 5KFDA 1Z26A 2G8UA 4AHSA 3V4IA 4F3OA 5KRSA 4IFYA 3RWUA 1F21A 2XC9A 3M8SA 4FZYA 1C1AA 1VSKA 4NRUA 5KFPA 1TL1B 1JL2A 3CO9A 1YVFA 1RA6A 4J9LA 1C1BB 4F3TA 4RUAA 3NGYA 1NJZA 1ZETA 4FJXA 4O0JA 3MR2A 4F4KA 1DLOA 1S1TB 2YNIA 2X74A 1MMLA 4IRCA 1JKHA 1O1WA 4I9QA 4FJLA 2QXFA 4GVMA 4QOZB 3V1OA 3DYAA 4ED2A 2HNDB 3MR3A 3CDWA 1LV5A 3NF8A 4CJVA 1GOBA 1TKTB 1NKBA 3RB6A 4NCBA 1NK5A 1QSLA 4DSJA 1NHUA 3OJUA 3UR0A 5J2PB 4CEOA 3L2VA 5K14B 4WFZA 4OKKA 4E7HA 2D0BA 4OLAA 4XIUA 1SKRA 4FK0A 2B5JA 2FC0A 1IKYB 2FJWA 3SV3A 3P83D 3M9MB 3LPUA 4ZHRB 4WE1B 2D41A 2GV9A 3D45A 3LWMA 1QS4A 5I3UB 1A5XA 4RW7A 2JLEA 3MXIA 2C22A 1LW0B 3OYBA 3PX6A 3HYFA 4DQIA 1JLQA 3RB3A 3H5YA 3DLGA 3PVXA 4RG8A 1EP4A 4FJMA 4CGHA 5KFGA 3H4DA 3UPFA 2HNYA 4YR2A 1N4LA 1C2PA 1FKOA 4FCYA 1BI4A 3HVAA 4HUFA 2UVVA 4ED6A 1WNEA 5D3GA 4B8AB 3NBPA 2VA3A 1J9AA 4RUCA 4LH5A 4E7KA 2I1RA 4XPEA 2RDJA 3WNEA 2HWHA 1YTUA 1S9EA 1UA0A 2HNZA 3F9KA 4HHTA 3KLHB 1RAJA 4ECRA 4ED0A 3AO2A 1RBSA 2FVRA 2WK4A 2OPSA 4C8MA 2E9ZA 3GQCA 4Q45A 3V4IB 2KW4A 3OVNA 2C2DA 4IFYB 2V4QA 3EY1A 4DEZA 3L2RA 3ZSYA 4FZXC 4FLVA 3IGNA 2ETJA 4DLGA 2Z1HA 1TGOA 3I5CA 4FS1A 1TQLA 1VRUA 4ICLA 3K5OA 3SYZA 1DLOB 2YNIB 1IKWA 4H54A 1JKHB 4O0IA 4DQPA 4E0DA 2D7SA 3PW2A 4RNNA 3DYAB 4KV8A 3I5AA 4DTUA 4M3ZA 4KHUA 5KFLA 4EO6A 4DQRA 4WYLA 4DTOA 2BRLA 3DLBA 4ZVGA 2Y1JA 2HAIA 5FDLA 4W5RA 2BQRA 4R5PA 1NK0A 2R2SA 5KG6A 4BACA 1U45A 4EEYA 2GIRA 2B5JB 1C0UA 3OL7A 4DL7A 1IM4A 1IO2A 4TY8A 2XHBA 4FJNA 2BGGA 2KQ2A 3CFPA 3CQ8A 3V6KA 5KGXA 2O4IA 4RW7B 4CJRA 5KTQA 4EYHB 2ATQA 1JLQB 3QO9A 2OPRA 3DLGB 1SUQA 2JEFA 4M41A 1EP4B 5KG1A 4W5OA 4FJ8A 3K5LA 1WN7A 1KLNA 2HNYB 4IH5A 4LY7A 4TXSA 3LWLA 3TAQA 1FKOB 3LP1A 1BI4B 5D3GB 3NBPB 2AQ4A 1Q8IA 1K1SA 3S3NA 4CF1A 5JS1A 3T19A 4Z4HA 3V9UA 4YNQA 1D8YA 1LWCA 2P1JA 3DLEA 4K4TA 4FS2A 1S9EB 2BDPA 3V1QA 1RTHA 3OYIA 2HNZB 3AVMA 3AO3A 4N41A 5HLFA 3BREA 2OPSB 5KT3A 1RDAA 4OGCA 3ZT0A 1ZTTA 2F8TA 3MEDA 1S9FA 4B9LA 4M3TA 4QW8A 3FQLA 3DRSA 3AO1A 4MIAA 2PZSA 3QEXA 4CECA 3LAMA 3VQDA 4NLVA 3QIPA 3HVWA 4ECVA 2KFZA 5J2QA 3BSAA 4HUGA 3AVLA 2ILYA 4FYDA 1TP7A 3AVFA 1RTJA 4CJWA 1VRUB 2WB4A 4ICLB 2BQUA 3NFAA 1C0MA 1EETA 2A1RA 3G6VA 1TVRA 1IKWB 4XO0A 1CZ9A 1RYSA 2G8IA 3O4QA 4KV8B 5F8GA 2AGPA 4DS4A 3QZ8A 4FLTA 4TQSA 4Q43A 4ZPDA 4BWJA 2F8SA 5KFHA 3ISNC 4FM2A 4DSKA 4R8UA 5HRRA 5FDLB 4MK7A 3PW7A 1NK8A 4R5PB 4OLBA 4ZPAA 3AA4A 4R0EA 2HW3A 3HPHA 2YNHA 4J2EA 1C0UB 2HVIA 2UVUA 2XWYA
chains in the Genus database with same CATH superfamily
4X2BA 3SBTA 3SUNA 1XC9A 3G8QA 1FJ7A 2QKKA 5HQMA 1M5SA 4FWLA 4B1ZA 3I9ZA 1CJVB 3RAQA 4B1XB 4FYXB 4RNMA 3NE6A 2DXEA 5B0GA 3CDUA 3ZO7A 3ILOA 4NA3A 1YVUA 1GOAA 5LL6Z 4FVCA 4KI6A 4M94A 2YH0A 2D74B 2VFUA 1XI1A 4K8ZA 3N28A 4BR4A 3W8GA 4JI7K 1QAIA 2N3OA 3BN7A 3NAEA 1YX2A 5HRNA 4FM1A 2GQCA 1RTHB 1C0FA 2B4UA 5HMYA 4HCCA 3GWCA 2AYGA 2CNLB 2FB0A 4F25A 2I9SA 2O67A 2QLJB 1SCJB 2OLWA 4NZ0A 2Q3SA 1YITS 4LMZA 1QHTA 4EMDA 2BJ9A 1CQMA 1PAUB 5J2QB 3KUEA 1OQ3A 1RHUB 2QXLA 4FDFA 2YHAA 4JI7J 1HBNB 5CAAA 1HJOA 3CC7N 2UUAF 3OUYB 1HI0P 5HJYA 2XGPA 2GVDA 5GAHP 1B99A 1XHZA 2GAGC 4ZIWA 4E89A 5IQ6A 2M52A 2MGZB 1CJKA 1KC8T 1NGGA 4YB7A 5A8KB 1SIWB 2JLGA 4LR8A 2HGLA 5M1QA 3Q8UA 2RE2A 2BVZA 4JI0J 1EWRA 2YJFA 4FWRA 4R8UB 1RBOB 1FVQA 5ETRA 3G6ES 1LOUA 4DG1A 1J53A 3PHTA 5CE3A 3MM8A 4JD2B 3O3HA 3KLEA 3DLKB 4WCEQ 4ES1A 2YBVA 2V68A 1MWQA 1FWKA 2KFNA 4DUYF 4RO0A 1VRTB 3W2WA 2RIJA 4QAGA 2XS5A 2CUYA 4ZP6A 3ALYA 4ECWA 5E5NA 4KB7A 4U7CA 2GMLA 4LH4A 1G2EA 3AA3A 3IBFB 3HFZB 1VQON 3FGVA 4DV2K 5DO2A 3FSYA 2VWJA 1E4GT 2UXCF 3KMQA 3GZ7A 4JI4J 2AW0A 2PAVA 4B9UA 4PG5A 3IG1A 3JSRA 3DFEA 3ZTPA 2O1PA 2F4VK 3FK4A 1S7IA 3MX2A 3H59A 1B0TA 3EO3A 2UUCK 1N5TA 2BH1A 4F4ZA 4LRCA 2P9SB 4DUTA 5KPZA 2KXFA 3KLIB 5LL6d 2V7ZA 1FD2A 3EXYA 3QJPA 3QNOA 5HN0A 4PXCA 1X9WA 2WRMA 3CJRA 5AQYA 4QJVA 2VPYB 4AHTA 3SCKE 4BRDA 1T05B 1RLCL 2LP4A 1ZBLA 4Y2MA 1BL3A 5EN1A 2JNJA 5ADXA 2IBKA 1LCUA 4OGEA 2NRZA 3BN4A 5KFFA 2H54B 4NLYA 1VK0A 4NRTA 4FZZA 5LMUF 3IMQJ 2WSCC 4ID1A 4KR0B 5E33A 4KTWA 2J0WA 3AO4A 2DY9A 2BE2B 2H4WB 3VGMA 2CGJA 2R8JA 1IBMF 3BF3A 4E1NA 3HK2A 1QQOA 3O5BA 3S3OA 4P9SA 4Y28C 3VQTA 4FJJA 3I31A 4O23A 4B3MK 2YKMA 1XERA 3WXJA 1YIJS 1NEEA 2WONB 5IOLA 1HW8A 3LZIA 2APOA 2G0JA 1N6QB 4DV7K 2I38A 3T41A 1QUPA 3O9UA 3U27A 3D2FA 4K0KF 3R2CJ 5LSOA 4CLKA 3OSNA 2J9CA 2AGOA 2FHMA 4M7XA 2MKSA 2B7BB 3W61A 3VF2A 2G4BA 4B3MJ 2P6SA 4C8ZA 1WEZA 1X4GA 4BRMA 1VQ8S 2WOMB 5L1IA 4KO0A 3JTOA 3V6DB 4C8KA 3T69A 4WP8A 4OYAA 4ES3A 1NBEB 4GO7X 1VHIA 2RSQA 2K8GA 5ETVA 3QEPA 1SKSA 3GIMA 3D1HA 7FDRA 2YWGA 5FIIA 2RQCA 1SV5B 3HTVA 1CLFA 5FPNA 3ULDA 3S41A 4X64K 2KRBA 2CJ9A 2DNOA 1RI7A 1HNWK 5B0AA 2G8HA 4FWPA 3J7ZT 1SBRA 1EX4A 2IM3A 2AF6A 2XNQA 2DD8S 1S10A 3DXKB 4CRJA 4HKQA 1CC8A 1HNVB 4IDKB 2WVBA 2A40A 1UW9A 4ECXA 3P1GA 3SJJA 4KRWA 3BKUA 2BJ8A 2ROEA 2P5GA 2I6WA 1T3VA 2O8EA 4FXVA 4E7JA 3K9JA 2MB0B 3WIVA 3BPSP 3ZT4A 3SCXA 3SUQA 2H5JB 1WOSA 3JXUA 1S1XB 4QIWD 1F3FA 1V3SA 2OPPA 2AKWB 2JLFA 1FTRA 4FYVB 7AT1B 2QFIA 3KKRA 5F3ZA 3M2UA 2G1DA 1DFDA 1JCGA 4DF8A 1WEYA 4BHQA 1WOOA 4DPYA 1JLEA 4F0HA 5ETPA 5KFKA 3TAFA 4JI5K 1EQMA 3QSYB 3S1TA 3PZPA 3RR8A 4C1NI 4I1TA 4JS4A 1X5TA 3R5AA 4NPOA 3MN7A 2ZOMA 2OKQA 2XM3A 4ILGB 4MLHA 4W5TA 2ZQBA 4TY9A 1KS2A 3C6UB 3M7VA 3JB9k 1M5PC 3D5MA 1OVYA 1WG4A 1KVCA 3GR0A 4FSVA 1FK9A 3CJ2A 1VC5A 5AZIB 1URNA 3GCWP 4I69A 1BQNB 1C1CA 4NO7A 4ETZA 2QM1A 4DTJA 4B17A 1XTZA 1MU2A 3CJ0A 4JI5J 2W7PA 4DR6K 4KAZA 4FF3A 2OI2A 3MCOA 1N0UA 3IUCA 5C42A 4A8FA 2DT9A 3AA9A 4PG4A 2W9CB 1F60B 4OZ0A 2F3JA 5AE1A 3D54A 4F2RA 5GAEI 3CXCR 3SLCA 1BE4A 1OY8A 2UU9K 2ZZMA 1E6YB 3EDQB 3CG7A 3H7HB 1L3KA 1CG2A 1FKPA 2JEJA 3FSXA 4ATNA 1BOTO 3VQPA 3G82A 3AOBA 4LSNB 3O6QA 5EX5A 4EBDA 4AYBD 3KLFA 8ATCB 3E3XA 1Z4UA 3IP0A 5C5JA 3ID8A 2VG6B 1K6YA 5E3CA 4K4SA 4LBIA 2UXDK 2UU9J 3ZFVA 3TSPA 1W7WA 3BKFA 4C8NA 1FFSB 1Q7YO 5D15A 5KAKA 2V8GA 2IM2A 3TX0A 1MNEA 4P2MA 5M2PA 3H40A 4GKKJ 1U24A 4NYZA 3FFIA 2FF3B 5EWGA 4D3GA 4DQ8A 2E6MA 4W5QA 2V63A 3LGNA 1KDNA 3HSGA 5L9XA 4IYQA 1YHQN 5J2NB 1D5AA 4CIGA 1R59O 2F40A 2Q0RA 3D2EA 4K25A 2CKWA 4KH0B 1EQYA 3TRGA 2NRTA 5I42A 2GX8A 2ZD1A 1N33K 3V6JA 2DR6A 4MO4A 1EWQA 4ZTFA 2XMTA 2VJUA 2DNHA 2JRSA 4WF9Q 4RU9A 3QRQA 4UOFA 1TL7A 4KTQA 3ZSVA 1S0VA 4WQ4C 2Z2ZA 4U7BA 4IOCL 4PUOB 4YY3K 1MLAA 3OBWA 1SS6A 4KJIA 1N33J 3DLLL 1SC4B 5AQOA 1RT4B 4CFBA 5LSLA 4FLXA 4OFZA 2CPJA 4OHYA 4CJ4A 1HW9A 1EARA 3N0VA 4ILRA 3VALA 1Q8BA 2BW7A 4ILMA 5DDRC 1WG5A 1T3NA 3HHNB 4F4WA 3NCQA 4Q5VA 3CF5L 5DG7A 4CEBA 1T9YA 3JAMU 3D4JA 3LP0A 3TQEA 3ETMA 3ZT1A 3IXQA 3LL3A 4ZVRB 2YH1A 2DTUA 4O3RA 1JK9B 1SH2A 3WQTA 2J76E 5AE3A 3BS9A 1REVA 3L8BA 2L9NA 4N47A 3CYMA 1YF5L 5AZJB 3UFCX 5LY3A 3KJNB 4DJBA 1V6HA 2GGPB 1D1UA 3M2VA 4CBWA 3BYPA 4O8UA 4CJKA 1KLMA 1LW2B 4H0XB 3Q23A 2QA2A 2DGSA 5DJBA 4DBQA 4E98A 3BBBA 3MMAA 4PZVA 2OPQB 2P9GA 2EXUA 2ZEJA 4CZJA 1HARA 4KE5A 4JI7F 1VQKS 5ETKA 2QG9B 3FR0A 1IQZA 3J7YI 3IAYA 4FOEA 1QAJA 1MDUB 3OW2R 3D2WA 3U6FA 1X4CA 4DQSA 4O44A 2W9BB 4Y2CA 4C8OA 3CERA 1RT5B 2KFYA 4JKHA 1IN0A 1AZSA 5A6PA 1K8KA 1HMVA 4QIVA 3DN9A 3JTPA 4A8YA 4EUVA 3V1RA 3O3GA 2HFZA 1FKAF 3N5BA 1S6PA 3TA0A 4IFVA 3QFPA 3O1BA 4WKRA 3P38A 2KL8A 3GONA 2AT1B 1BU6O 1RBAA 3DGVA 3ZT2A 2R7TA 2VG5A 4IH7A 1SXLA 3O6WA 1LXNA 2PA3A 2AEMA 1CULA 2E5JA 1D9FA 2OEJA 1HQUA 3DXMA 4CZGA 5M1OA 2DR9A 3N9UC 2DPIA 2KJVA 3MEGB 3TO8A 2FGOA 1OH6A 1F5AA 2GJIA 1T03B 1T8EA 1DZ5A 3HBTA 4CERA 2C2MB 2QEXN 2Q6BA 4CT8A 4NYNA 1ZPVA 3O1LA 2IAJB 1H6KX 3UQSA 3SUOA 3ITHB 4CZFA 3A4TA 1XNQJ 2RS8A 1FE0A 2WVCA 4M5HA 3BSCA 4YP3A 3FUYA 1JJ2M 4BQZA 3H2LA 2QK9A 2BE9B 1DTQB 5H1SV 4DZDA 2GBZA 2N3LA 2D3UA 3KHYA 2R9LA 3HHLA 3BB5A 2R2TA 4UUWA 4DV2F 4K4YA 1JCFA 1PCAA 3C7NB 1IKVB 1N5YA 1RT2B 2Y1IA 3H2VE 5A8RB 1UAXA 1HNZJ 3U1MA 2ZHAA 2KVIA 3JSBA 2OFHX 2F4VF 4I67A 1CS4A 3MZIA 4QPTA 4ZCLA 2UUCF 3SK3A 3K2PA 4NCGA 4O5BA 5CYMA 3X1LB 2E2NA 1SC3B 1V4SA 2P9IA 2BV3A 3HSDA 3OXFA 1VIXA 3S3MA 4EBCA 4FPAA 2DGOA 5ETOA 1I94K 4C23A 4C11B 3BO2A 2HHVA 2F1FA 4LVOP 4DXLA 5BPLA 2NRXA 2XI3A 3VVUA 1ATRA 2PEHA 4MTPA 5HVFA 4ER8A 5KG3A 3AB2B 3KHHA 1GLBG 5AQFA 1YTAA 1N0VC 2B51A 2PDAA 4IOCQ 3NGZA 3UIQA 2KVQE 1YJNS 3D3BJ 4ID5A 4MYUA 3CD6N 3WNFA 2QW9A 3DLLQ 2O01C 2BM1A 3POTB 2YNGA 1M1HA 3OYEA 3R9PA 1WC6A 4H0VB 3MN6A 1TMMA 4DV5J 3LALA 3GJTB 3LPEA 4B3MF 1C0TA 4QS8A 3W66A 4H5TA 2A6MA 2RU9A 4DR1J 2WFBA 2YCHA 5DQHA 4NLGA 2LMIA 4CEZA 3GDQA 1X0PA 4DTNA 3MMCA 2ZNZA 3CF5Q 4RWWA 4DV7F 3RR7A 3KLGA 2MZSA 3PO4A 1LWFA 2HRYA 4YOTA 3OYJA 4RLEA 2IJNA 1JL1A 1FRKA 4LC9B 1HR0K 2HIYA 3MXHP 2DNRA 1HD0A 3Q8QB 4CQ1A 1BD6A 2WW4A 1NZ8A 4CDIA 1XMQK 3ATVA 4M3WA 2ZE2A 2J6TA 3CE8A 2C2KB 2EBGA 1P6TA 2FYXA 5I3PA 2HGMA 4LSLA 4BC5A 1TKZA 3E9PA 3EKUA 4RU2A 3VAGA 2O66A 2CQPA 1HR0J 4J9QA 3TU5A 1ZBUA 1QZ6A 3SAFA 4M42A 1KCFA 4ITSA 3HP9A 4ECQA 1XMQJ 3QWUA 1ZYQA 3FQKA 4AT1B 5FPDA 2MHEA 2EKYA 1JJ4A 3WC0A 3CIPA 4X64F 1GMVA 5C24B 4ZVOB 4YORA 3P3DA 1XHXA 1HNWF 3SUPA 4OHZA 3K0SA 4OHWA 4BWMA 3VAMA 4DSLA 1BIZA 2Z1GA 3QAUA 4CJ5A 2RPIA 1HQ2A 1EAYC 1PYTA 2CNOB 1T6DA 2X6SA 2J5AA 4KHMA 1LEOA 2ZJRL 5JVGQ 4IKAA 4BG9A 1RWMB 3MCSA 1TZ0A 3EVOA 1TUWA 1LK5A 3SMPA 1TL5A 2VKZG 2RB7A 2G8VA 3FSIA 3H25A 1HYZA 5AQLA 4X4VA 5LM7E 1K44A 3ZTSA 2LA4A 4JV5K 1RTZA 5BRDA 4JRQA 1BHNA 3CMES 3BUZB 4IQXA 1C4AA 3AODA 2NREA 1BCMA 3NF6A 4PABA 2GNKA 1K0VA 2P2CB 4C8YA 1OKJA 5SUHA 3V81B 3V9WA 5FPEA 5BPNA 1YLXA 5L9NA 4CLFA 4NEYA 2GUIA 1U4BA 3A1YG 3UCGA 4JI5F 3HKWA 4FF2A 4JV5J 5D0HA 2R7QA 1S6QA 1GMWA 2XI2A 3J81O 1RKJA 2HVHA 2NPFA 4TN2A 3PO5A 3VQ7A 3R2DJ 3PIPQ 5KFXA 4M5DB 4Q44A 4CLSA 1F5BA 4X4UA 2J7KA 2RJZA 4DR6F 4PKGA 4YUDA 2FBXA 2B6AB 4O3PA 4Z7YA 2NZCA 3VVTA 1Y64A 1RP5A 3ENHA 4JV2A 2BUPA 1NDLA 4FYWB 1V3ZA 2UU9F 3R3TA 2E1AA 1OYDA 3DOKB 1HQEB 1OH8A 1U6FA 2HMIA 3MFHA 8RUCA 3O9QA 1IJJA 1S1WA 2J0SD 2H3EB 2YWEA 1VBZA 3UKUA 2FDNA 2IRXA 5KFIA 3CJCA 3E9LA 1Q5YA 1RCXB 5KT7A 1PYSB 2YV0X 1NXIA 3G0ZA 2GAHC 4LF6J 4DDFA 2WVEA 4LRDA 3OYAA 2DIUA 2JC0A 2UXDF 4J2BA 4MO5A 1ATSA 2O4GA 5GAHU 4KB0A 3UKRA 1Q81T 3UNYA 1TKXB 4GW6A 4EFHA 4JI6J 4XK8C 1VQ7S 5IC4B 5EWFA 3MM5A 4AL7A 1BISA 3DM2B 4JI8K 3DGPA 3TTCA 2ZJPQ 3HFKA 3EGZA 2R7YA 1R8CA 3I0SB 5B0FA 2XY5A 1YBTA 2FXUA 1C1BA 2XHWA 3GBTA 3M8ZA 1VCTA 3G71S 1N8RT 4CLUA 3I87A 4KY3A 4ELTA 1UPMB 2AYEA 1S1TA 1DBDA 1A5WA 4CGIA 3PTWA 3LDOA 1N33F 4LREA 1TKTA 2AMCB 5LT5A 3ZSRA 2YQ1A 3ENOA 2I7NA 4M5KA 1FXDA 4QW9A 5J2PA 2B8PA 2KG0A 5T7BA 3J7ZO 3HL8A 5JXSA 5HAOA 4Z4CA 4FK4A 4MH8A 4YY3F 3P49B 1DJ0A 4X62J 4B3TK 1HPZB 3SFGA 2J0QD 4B3SK 3PCOB 4WE1A 1RHJB 2HHXA 3NL0A 2GHPA 3TJ9A 1LW0A 3OA9A 2EWSA 4IWVA 2RS2A 3RB0A 5GAEP 4ERDA 2QRRA 1F3VA 4LF5K 3LP2B 3SSRA 3EICA 3HSJA 1S0MA 4HVJA 3AJDA 2HURA 2LLZA 3C95A 3D7EO 5FRNA 1NSAA 3C16A 3M8PB 4OKJA 1VQSA 5B0BA 4MKBA 3DXBA 1R43A 1WNSA 2ATLA 3NF7A 3V9SA 2W2PP 2D3OR 2DNNA 4X4NA 1EKSA 2NS1B 3KLHA 1CJUA 3HHLC 3F2KA 3VQBA 3MURP 3HHLD 1RABB 3BP8A 2HBRB 4LF5J 3AAQA 3CCRN 2C2NA 2GX9A 1QVGR 2MJNA 1TL1B 2C1EB 1WEXA 4H5VA 4HHHA 1RA6A 3IDHA 4RUAA 3O4WA 1BC6A 2L48A 1NDCA 4F4KA 2KO1A 4DX8H 2AZ3A 2X74A 4BR2A 3ZZTA 4QOZB 4NE9C 2NXJA 1WHXA 2HRUA 2GWJA 3ZTRA 3QSIA 2EVZA 2V34A 1UFLA 2OHDA 4NMLA 4FZVA 3W0LA 4CEOA 5IV4A 5K14B 4H5NA 4GKJK 3CJQA 3AHPA 1K73O 4OLAA 5H9FJ 4BRIA 5LJ5Y 1SC1B 2QYCA 2B5JA 1HBUA 2FC0A 4U7UK 3G4SN 4PYDA 3SV3A 3PEHA 2XLKA 3P83D 3M9MB 1QS4A 2P9LA 1DRZA 1VQ9N 2M9KA 1XNQF 1IBLK 3BY5A 4X4PA 4P52A 2GVZA 3PX6A 3OYBA 2HWTA 1GXTA 4DQIA 3PVXA 2JHEA 2NXNA 1EP4A 3AXMA 1RACB 4PL8A 3UPFA 1WF1A 2H3GX 4YR2A 3EDRB 3CCVS 1FKOA 3OR1A 4FCYA 4HUFA 2UVVA 4ED6A 5D3GA 3T1HK 3CCMS 2LQJA 3GG4A 1F2GA 2VC0A 2RDJA 4X84A 2HWHA 1YTUA 1HX1A 3MTJA 2ZKTA 2HNZA 1C0GA 4ED0A 4OYXA 4AF1A 1OIAA 1RBSA 1FRXA 4PXBA 4C8MA 1HWLA 4BRNA 3V4IB 1KN6A 3L0QA 2LDYA 2MTLA 4DR3K 1KVJA 3BF1A 3TUZC 5A2QU 1WD6A 4FLVA 4WIIA 2B9XA 2M4MA 5RUBA 4DLGA 1WOQA 1TGOA 2FJEB 2ZNYA 2YX4A 4DPOA 2VPWB 2BOPA 3W5YA 1QZ5A 4O0IA 5HQLA 4LIRA 4DCOB 2P9KB 1G99A 1X5PA 4U8YA 4RNNA 3DYAB 3ZX0A 3J7YP 4JKEA 4LF8J 4KHUA 2QMWA 4DQRA 2X3DA 3GL1A 1OMSA 4DR3J 3EL2A 2F4FA 4ZVGA 1I94F 4OX7A 3WQPA 1BUPA 2ZWOA 1UJ4A 3AJ1A 3FBCA 1RKIA 4R5PA 3A12A 4YB6A 4ZVUB 1NK0A 4BACA 2GIRA 2CJBA 3K0JA 3OL7A 2ZZNA 1HKBA 1FRJA 1IO2A 1G3OA 4TY8A 2G0CA 2XHBA 2CPZA 2KQ2A 1LOTB 3CFPA 3V6KA 2O4IA 2CGLA 1F2HA 4CJRA 3MOJB 4IUFA 3RG6A 3H2UB 3UR3C 3DLGB 5BYSA 2BYCA 1X3NA 2CPDA 3HRGA 3K5LA 3FEZA 4GRSA 2JH3A 1IWGA 1B7YB 3NBPB 3GU0A 1Q8IA 4CM2A 4LF1A 1M1GA 3KWGA 1K1SA 1KP6A 3S3NA 3G8SA 2EFOA 5GMDA 3P31A 4Z4HA 2FTRA 3V9UA 3AD7C 2P1JA 3DLEA 4C9DA 2Z2LA 4PQAA 3OYIA 4JAXA 2BABA 3M32A 4N41A 3BREA 2OPSB 5KT3A 1RDAA 3ZT0A 2R42A 2MKIA 3ADAC 3I82A 1HUXA 1RAAB 2PZSA 1H3DA 3VQDA 4M5LA 3HVWA 1ILYA 1HR0F 2YX7A 3BSAA 3AVLA 4FYDA 1PJ7A 2HK2A 1YGYA 3AVFA 2QO3A 5IXUA 4HACB 3VHQA 1XMQF 3MMBB 4CJWA 1VRUB 4GY2B 1S99A 1H72C 3OQ2A 1WUAA 3G6VA 4WJBA 2NCKL 5AJ3K 1IKWB 1FNMA 2ZDPA 3FZ2A 1RDUA 2G8IA 1N54B 1GMWD 2QWOA 2AGPA 4A61A 4DS4A 4XH4A 2KI2A 2E88A 3PFEA 2HS4A 5CH7B 4DV0K 1ZAVA 3EMTA 2DB1A 4USWA 4ZPDA 4BWJA 1NG9A 2CQ1A 2KHCA 3MDFA 4BRQA 4FM2A 2MQOA 3CMQA 3CO0P 2VCPA 3WC2A 4MK7A 3QBXA 5EXWA 2MKHA 4OLBA 4NLBA 3HPHA 3RUBL 2UVUA 4AFFA 2XWYA 2G8KA 1ULRA 3E51A 4IO9Q 1SKWA 3N4WA 4CIFA 5C25A 3UCZP 3GYNA 1AB8A 3NG8A 4U8VA 2F9TA 3MMJA 4PPZA 1SUQB 1GXLA 1U1KA 3HSTB 3ENWA 1WHWA 5KFBA 2QFJA 4EZ6A 1UWBA 4RW6A 2QT7A 4YB1P 3FCHA 3CQXA 3AO5A 2N7CA 4B1VA 4E2FB 3OTDA 5J1EA 3BH7B 3CCLS 3MK6A 4NYPA 2UUBK 2GHWA 3LP1B 4NLCA 2UVRA 4JN4A 3K17A 1NGIA 2PMZD 1HWJA 2XMMA 2VONA 2E4LA 4DTRA 4X4QA 3M05A 4HR2A 4NI2A 1SJ4P 1LQ9A 1LWCB 4M5GA 4O3QA 2UXBJ 1I6JA 3BQ1A 3PRDA 1NK9A 1ICEB 2W4PA 1RBTA 4O0NA 3B6OA 4Y1DA 3JQKA 2O5DA 3MEDB 4GNIA 2R7SA 4JV5F 4PQUA 4ZVTB 1XMOK 1WTBA 1YKWA 1E6VA 4FJ5A 5J2MA 3M30B 4ZPTR 1AXQA 1JNZB 3K8WA 3GILA 3OYHA 1RDWX 3ZNJ1 3GIKA 1N5QA 1EIYB 2ZM6K 4UT4A 3FRZA 4ZVFA 1U47A 1B70B 4K4UA 5ELZA 1EETB 2NZ4A 1GQEA 1FNOA 2QIFA 2LU2A 4XDCA 5CZVA 3BGLA 2F5GA 1HKAA 3LM2A 4ZVEA 4ZA1A 1KFDA 2D5RA 1XMOJ 3OTOK 4ZDNA 3RRGA 4OO1J 2BMBA 3D1QA 2VQEK 4GV3A 4I68A 2BJ7A 3PACA 4DFMA 4F8RA 5T7LB 4OIXA 2UV8G 3UB5A 2V0NA 1NO8A 4WIQA 2YNHB 1W97L 4BCAA 2HVDA 4QYRA 5KFRA 5GMKa 3WUHA 2P6TA 2ZOFA 2IYGA 2CQGA 2M5YA 3W2VA 3TJ8A 3OTOJ 4DCHA 3NS7B 5HVGA 3P5JA 1VQPS 2JWKA 3US5A 4EO8A 3H08A 3QIDA 4ANDA 3J80Y 2PEBA 4LFAJ 4BRFA 4HTUA 1Q53A 1YG0A 3PW4A 1ELOA 5B8HA 1SH3A 3HZEA 3D0HE 1TELA 3FNNA 4DI6A 3NKYA 3EYZA 1U1RA 1S0OA 2W4DA 4DL6A 5F2RA 2E9TA 3H46O 2VD3A 4FJKA 3B54A 1YT3A 4Y00A 1Z2LA 2LQ5A 1UFKA 2I5JA 4ECYA 2E5LJ 4CEDA 5A6WA 1TL3A 4DMNA 1R7IA 3ULEA 4DU3A 4OZ3A 5AQUA 4IRKA 1HIYA 2CWKA 1I3AA 1ZZFA 4B8CA 2HBZB 4B9SA 1WC4A 3MN9A 3WHIA 2MXYA 4DKWA 1VAZA 4NOHA 1XQSC 4OHVA 3LPTA 3L4QA 1Q7LB 4JI8F 4OJ3A 3NMAA 3A3NB 1TK0A 2GVDB 3ZNUA 1Y9OA 3W63A 3N6MA 1CJKB 5B09A 1Y10A 4A46A 1IWAA 3KLVA 1JXEA 2FC9A 3CJ3A 2RT3A 3TTFA 1FD8A 2VHGA 3K7RA 2VQFK 4DG1B 2WBMA 4MMOA 1X4EA 3MM8B 3CC7S 3KLEB 1VSEA 4KGVB 4CWBA 2CJQA 3THXA 4H5WA 4AL5A 2GWKA 3EM1A 1YUWA 4PG8A 3W2WB 3P6YC 4MYTA 1IR1A 1N5SA 3VEXA 4B3TF 2VKRA 1WACA 4B3SF 1UEUA 3ZSQA 3PY8A 1DGKN 2AHOB 3DKDA 2QV6A 2X1AA 1JJHA 5F8NA 2RRNA 3MTKA 5AQKA 4YOUA 5JMVA 4XPCA 5ETLA 1U2FA 2XS2A 3MCNA 5C10A 2V51B 4LF5F 2IRUA 2PFUA 3IG1B 4CF2A 4ECTA 4CJPA 3AVHA 2KKZA 4ENOA 2IMOA 4DL2A 4PR6A 3SPZA 3D6MB 4IG3A 4QIEA 2DISA 1VQOS 5AQHA 4PKIA 3VN5A 2PA8D 2P51A 3D6FB 3K5MA 3I9V9 1CZBA 3MFIA 1FESA 2NR0A 5DS7A 4CEEA 4J90A 5BR9A 2IVPA 3GYXB 4KRFA 1QDUB 1RBUA 2AU0A 1EQ0A 5KQDA 4NWBA 1LAVA 4DHYA 3VETA 4JHDA 1U0SA 4NLUA 4KI4A 1O13A 3D67A 4TQRA 4HTLA 3WEEA 4KFBA 1NJXA 2FZKB 3L2QA 3CQYA 4L75A 2XQCA 4CLPA 1FEEA 4IKFA 1T9WA 4D3HA 4EHTA 4ED3A 1H7XA 3RBEA 3U3GA 4DFPA 2KXHA 2YKMB 1R0BG 2LQBA 4QCLA 1SH0A 2VFTA 4GKJF 1U7LA 2H4YB 1S9GA 4J37A 3KMSA 4K7QA 5KFCA 2EK1A 3N5FA 5F9LA 4QS7A 3IC1A 5HROA 2C2ZB 4UQTA 3CJ7A 4ECSA 1FJGJ 2XRIA 1PBAA 1GMUA 3DI6A 3CJSA 4ZJLA 3BEXA 3D2FB 2IY5B 1IBLF 4P71A 2DR8A 1G7CB 2VODA 3DAWA 4ELUA 1HWIA 3CDBA 2QZ8A 2CVEA 3DDNA 4X65K 2XZDB 1S0NA 2W7AA 3CVKA 1RXOB 4A62A 2ZH9A 4KO0B 4AH9A 3T1HF 4XTTA 3J8AA 4A59A 1G6BA 4DWIA 3KG1A 4PY5A 4FP9A 3TANA 4M3RA 1Q81O 4RW9A 2FHOB 5L1KA 2CFXA 2BW2A 2ASOA 3CCQN 4KPYA 1S4FA 3N6NA 3AV9A 4LF8F 1HKGA 5HJXA 3J81Y 4USTA 5JVHQ 3MAAA 3KHGA 3IO1A 4DR3F 1B64A 4BRLA 3UE2A 4GC6A 3R5GA 5ETMA 4K50A 1N8RO 4CD1A 1FWLA 3MECA 4LD0A 4DOZA 4Q8EA 4NLOA 2DNYA 3W3DA 4M95A 4LF7K 1KXPA 2PI4A 3EGWB 1M1KT 4KHPK 4A4JA 1QY7A 5H9EK 3E01A 1S7HA 3O80A 2RU3A 1IKXA 1VRQC 5JMNA 5K8NA 4MFBA 3QESA 1VS3A 3VAIA 3QB0A 1DARA 3L95X 3CD7A 2NSBA 4KGXB 2UV8A 5DZ7A 2VG7A 4LQ9A 2IA6A 2Y1LB 4ZPBA 2ZOGA 2VZ9A 4X4TA 3R1HA 3FBEA 1GOCA 4EBEA 3KK2A 2O8EB 3BBCA 2KZMA 2D1CA 5D4OA 4OX9J 1BWEA 2VWBA 4U67L 4FJGA 4LFBK 3H20A 3M6WA 5H9EJ 2OPPB 4LJMA 4JNEA 1R31A 4FNIA 2VBXA 5MAOA 3U8XA 3KK3A 1FWPA 2E5IA 3M2UB 4NLQA 3PYGA 4CEFA 3NVMA 1A7GE 4JLHA 4IXCA 5AQPA 2W01A 1JLEB 1K9MT 4TLRA 1GTHA 1SJRA 5CY4A 4DFJA 1KHVA 1WI8A 1GXUA 1JLGA 1S77D 3RVCA 1X7VA 1PIEA 3U1LA 1MA9B 4F4YA 2CQ4A 1B9FA 4KGMA 2XSJA 2UUAJ 1W2BM 2NRVA 3NEKA 2HFNA 2XZWA 1MSWD 4RX6A 1QUVA 5EX0A 4BREA 1FK9B 3HMJG 1OH7A 3D3CJ 3DMJA 1KAZA 5KFNA 3KUGA 1I5OB 1C1CB 4ZK7M 3BDPA 4JKBA 1MU2B 2LCWA 3M6XA 4HEA9 3MI7X 4NYFA 1T6CA 1VC6A 1S79A 3ZZ0A 3QT8A 2H9ZA 5C42B 2V2QA 3PKYA 5AJ3F 2HQFA 4FW2A 3DLJA 4DSEA 2D3O1 2E9RX 1M5HA 4BRPA 4DUYJ 1FTCA 2W6KA 4BR9A 2DR5A 2X1BA 3EZUA 4QU6A 4DV0F 3OFGA 2HSTA 3AGKA 2DFFA 1R6VA 1FKPB 3WZ0A 3NDKA 1XWLA 4Q2LA 2XSFA 3QBCA 1WUUA 3THWA 3G82B 1Q9XA 2IDEA 3MN5A 4DR7K 2B9YA 3KLFB 2NSCA 1RT7A 2KM8C 2CRLA 2YX1A 1UKUA 3HPGA 3GTYX 3HI9A 2ZGZA 4QWCA 3HF5A 1ZH5A 5AFUH 3TOQA 3KHRA 4WFNL 3BGRA 1O8BA 1RU2A 3SQOP 2NXUA 3S01A 5CABA 1NRKA 3FZMA 3JTNA 2G2OA 2ROPA 3OYFA 3OVBA 5FROA 2KU7A 3FFIB 1O6XA 2CNKB 2KZZA 2EFNA 1VGYA 2UUBF 4HDGA 5I4MA 4TU9A 3IN5A 4I2PA 4AQYK 4M3XA 3FKBA 5TKYA 1HWKA 2XMWA 4KBIA 3VGVA 3D2EB 1RT1A 1YJWN 3QEWA 4O55A 3NS6A 1W0HA 3VTHA 5I42B 5CD4H 2ZD1B 4RUHA 3FCVA 1CJTA 1NMNA 2N7YA 3QT5A 1VISA 3ZZYA 3M3ZA 4V19S 1DTTA 2YJEA 1XMOF 1S5ZA 1TL7B 5SWMA 1G15A 3AVAA 3I8DA 4JRPA 4W92B 2DO4A 2C2EA 1NUEA 3D66A 4RKUC 2XG8A 5CZ1A 6AT1B 2QL7B 1F9FA 2ZM6F 3CJAA 4W5NA 5M1PA 1YHQS 4C2MA 1IBMJ 4DX6A 2DHHA 1CZAN 4E19A 4CH1A 5GAEU 2W6LA 2R7UA 4CJTA 3AAWB 2JGUA 2IA0A 4RW8A 2WTUA 2CG4A 2Q6CA 3OTOF 2IIRA 4Y1CA 3W9HA 1PYOB 2VQEF 2ZGYA 1FDBA 1BQXA 4ZP7A 4MIBA 4NB4A 3C19A 3SQ0A 4IO1A 4K0KJ 5KG4A 3QIOA 1RWNB 2EX3A 3T6BA 1W9HA 4USKA 2JWLA 1BQMA 3CUNA 5DM7L 3LP0B 4DN9A 3T1YK 1JIHA 1Q86T 1U0HA 3DRXA 1NGEA 2PFFB 3IAM9 1IR0A 4K41A 1REVB 3CCTA 4CZHA 1HHQA 2OH2A 5K5MA 3ZZUA 3A8KA 4YS2A 1Y97A 3Q2TC 2BTFA 1B0VA 4U67Q 2ASYA 3M2VB 5AQXA 1GX5A 4P2XA 1WAFA 5GAGI 1SJ1A 2NYHA 1KLMB 3M8WA 2CZ9A 1IR2A 1NSPA 1U8SA 1VJQA 3VGTA 2D0AA 4M7YA 5HBMA 2HBMA 2W2OP 3MMAB 4AM7A 4EGLA 3VQ5A 3FCWA 3DHXA 2WW8A 2UP1A 1SL1A 1WHYA 2DIVA 5I3QA 3CDEA 3QLHA 4H4MA 3B4MA 1W26A 1CVJA 2RNEA 4CTAA 3ET6A 4CK3A 4M5JA 1GFWB 1RTDA 3PX0A 3QEIA 1ZM3A 4CZCA 1MMNA 3E1YA 4HI2A 4O44B 1YJTA 2BKOA 4O4GA 4CNYA 3BO3A 2ITMA 1K8KB 1AZSB 3VPZA 3T5JA 4RPFA 1HMVB 3EPIA 4K4WA 4USIA 4OI2A 1KVBA 4AE5A 3ATUA 5AQGA 1S6PB 4ZCMA 4IFVB 3J81j 4Q2MA 2IRYA 1H98A 3A5LC 2VG5B 4BGBA 2HQIA 1L3UA 1JNRB 3R1XA 2YQ3A 4LR7A 1S1UA 3MMVA 1CULB 1HQUB 3DXMB 2V94A 2ZF5O 2JEGA 1V5IB 4IEEA 3OYDA 1BLUA 2OELA 3P5TL 2HAFA 3CJ5A 4V1Ak 3W1YC 2HHQA 4IJAA 1MG7A 1ATNA 1TAQA 2NNWA 2KYZA 2L3MA 4LUBA 4KH6A 2VQFF 3AVKA 5C15A 1YJVA 3TVYA 3RSEA 1UEVA 3OTBA 2HK3A 1VQLN 4OYZA 3MM9A 3CT9A 4EU0A 3OYGA 4AM6A 1NPKA 4HCBA 2A3ZA 3A5NC 2CJXB 2IVFB 1RISA 2DRAA 1ASVA 1KNZA 1TK8A 4JV0A 3ZSXA 5KG5A 1KRPA 1U6BA 3C8YA 4I7FA 3SBMA 4H4KC 4OJHA 5KT5A 3G6XA 3R3LA 7FD1A 2O8DA 3HHLB 4KC5A 5HRSA 3V9XA 2HKEA 4ES2A 3CSKA 4XH5A 1MWKA 2LECA 4H0YB 3VF4A 4CZKA 1XR5A 1N5YB 2QEXS 1TV6A 1CXQA 5F0WA 5CR4A 2OYQA 1KSPA 4WCEL 2AEFA 3VEYA 2R7XA 1JJCB 3IRXA 1CS4B 3MD3A 3NGUA 4KHWA 4A8QA 4CJSA 4NCGB 4B02A 4DL3A 3WQUA 1S72N 5CYMB 4AHCA 3QNWB 2D0CA 2EPIA 2JZ5A 2P9IB 1N32K 2XTJP 4J2DA 2CPHA 2ZH2A 2PC6A 3NWRA 4LQ3A 4G3IA 1WELA 5EDWA 1K8AT 3U9ZA 5AXLA 5AQVA 3MX5A 5D6GA 1WTFA 3QFHA 4G1IA 5EGYA 4JKDA 4PCQA 5G4DA 2MHNA 4FM0A 1NKEA 2A1SA 3HD2A 4BG8A 1F9HA 1Y7PA 2WAQD 3I6PA 4EYIB 1AW0A 4CO0A 3NH2A 4F26A 4XDDA 3FFKB 4ECZA 3PX4A 4WZMA 3MPVA 3VQCA 2ASJA 1WSFA 3EE9A 4ID5B 5ADXH 1NDKA 5LSRA 1R27B 1FJGF 4DU8A 3G9CA 1KVIA 4C8LA 2KTQA 3JSYA 2YNGB 3DRRA 4I2QA 1HJRA 1NCLA 4N8NA 5AXNA 4B08A 4CGJA 1NOZA 3A8IA 3L7OA 3PYFA 1C0TB 3PEJA 1PILA 4AILC 5F41A 2A6OA 2RQMA 4BRAA 3ICLA 2BX6A 4KPCA 3L3CA 3UVJA 1X0FA 4UUXA 2WUSA 1JLAA 4UTGA 3F73A 1CEZA 2LSNA 3HVTA 3VTIA 3MMCB 2GFFA 4M1KA 3KLGB 1LWFB 3RAXA 3CD6S 3M9NB 3HVRA 4B3RK 5E41A 3EE8A 2WBRA 4JOUA 2ITGA 2V5HG 1RDDA 3MCMA 3R5DA 1V5VA 1SAZA 3VZHA 1EJ7L 2ZE2B 4X65F 2FUG9 3IFEA 3B78A 4CJFA 2DY1A 4LSLB 4G1PA 2BA9A 1NPRA 2UUWA 1YQHA 2ASPA 1TKZB 4FPBA 2RKIA 2FLPA 1S48A 4KTZA 4ZP9A 1ZBHA 3EVWA 1KWMA 3CD5A 4IDHA 1UVMA 1A9NB 2ZBRA 4BRCA 4Z4GA 1AUDA 3LH2S 1CQNA 1OY9A 1QQMA 4ZN3A 2K2PA 1VQMN 1WSRA 3DWLA 1GLEG 1KD1T 4FBTA 1NBWA 3OBYA 4LF7F 3MUMP 1X9SA 4J9NA 1UZDA 5C2CA 4OX9F 4CZMA 4ZLNA 2F96A 3KIOA 4KHPF 3VGUA 4CI6A 5CQGA 3W9JA 4WK3A 5BN8A 2E6LA 3OYLA 4K5SA 1FFGB 2CQCA 4A47A 3R7NB 1NWKA 3CCSN 2J4RA 4CI0B 4RNFA 3C14A 1F1BB 3JS9A 4CZLA 5EWEA 3QERA 1U2CA 1J54A 1FA0A 1S5JA 4F4XA 3CC4N 3FZHA 4FK2A 4UOCA 3WXMB 4LFBF 5FRMA 2W25A 1B9DA 2VDIA 3ILLA 2K06A 1VSLA 1T0TV 1HYSA 2F8HA 5FLXU 1RAOA 1RTIA 4Y2AA 5IWAK 4F0KA 3ETOA 5L1JA 2MZJA 3TZWA 3GLJA 4WQ4A 2Z30B 3FZKA 4BE0A 2P9CA 1VQ6N 1BWVA 4Y2IA 2GJFA 3CJ9A 3FEYB 2E8AA 2OEMA 4PPDA 5A8WA 4ZPWR 2NLWA 1K47A 2IHR1 1HPMA 2A18A 1N5VA 3OLAA 2ZJQQ 5KPRA 3QMLA 3ZX2A 4L3QA 4CJ7A 4M3UA 3M4XA 2RH3A 3TNVA 2K3KA 2H48B 2BBEA 3TARA 4DTSA 1S6QB 1X1PA 4WFBL 4EP5A 2MQQA 3TR8A 2KDOA 3ZEUA 4FJIA 1NLVA 2CWXA 3B4DA 3EVMA 1YZ7A 2VC1A 3WX4A 1FI4A 5DMRA 2HNDA 2RAQA 3OS2A 1A5VA 1SZ2A 4F4AA 3VQSA 1WG1A 2MYFA 1YWXA 1IUJA 3OJSA 1R0CB 3Q8VA 1MROA 4ZLJA 2QJ3A 3HZGA 2VASA 3AD8C 5HANA 3ZTQA 3UW1A 3AJ2A 4LRFA 1RDRA 1X9MA 4F50A 5A0YA 5DLFA 2B4PA 2ROGA 3AA2A 3DLHA 3HCXA 5KFEA 4ZHRA 2YWFA 1KTVA 2EKNA 4H0TB 1GLDG 5A2QO 2M88A 3AH6A 4K4ZA 3ULHA 3VQ4A 2HMIB 2RUGA 3MWBA 2XO6A 4BS2A 2VDHA 1MWZA 4FWSA 1XMBA 4CLTA 2FSKA 4DV6K 1S1WB 4BROA 3I5BA 2R8KA 4DV2J 4E1MA 3UKUB 2DGTA 4DPWA 4ETXA 2DRDA 4DR7F 4ZJQA 2YKPA 3IA0A 4LSZB 1F5CA 3MGJA 1WORA 1W7AA 4DSFA 2YPYA 2NXCA 1TFYA 2F4VJ 4PRFA 2IM0A 2ATCB 2HG4A 2UUCJ 3S6EA 2QE5A 2V8HA 5KFDA 2G8UA 1X4HA 3UKRB 4F3OA 5KRSA 3Q89A 1RZMA 4IFYA 3MM5B 4DV6J 2XC9A 3DGPB 1C1AA 1BY9A 2ZBQA 1NHKL 1BUXA 2VJVA 1JL2A 4JBCA 3LDQA 1U2VA 4BR7A 1C1BB 3DOMA 4AQYF 1ESVA 2Q97A 4F3TA 3NGYA 1NJZA 1ZETA 1DLOA 1S1TB 4CT9A 1P90A 4FJLA 4GVMA 5ETTA 4Y0WA 3MR3A 3TEHB 3H1QA 3KVGA 4CJVA 1TKTB 1U1MA 2J7WA 3GJRB 1QSLA 2DYAA 3ENAA 3UDCA 2E1CA 4HDHA 1NHUA 3OJUA 3UR0A 5DDPC 5J2PB 2KT5A 3EUNA 1M1KO 1UJ5A 1Q18A 1NM1A 4OKKA 4E7HA 3C0BA 2D0BA 4RCHA 5E84A 2VICA 4LBHA 4FK0A 4KIAA 2HF3A 4B1YB 4P2FA 4USVA 2H65B 3LPUA 4WE1B 2GV9A 1U1NA 3LWMA 1OJ4A 3L4BC 4RW7A 2JLEA 2NLXA 2C22A 2E7WA 2KYXA 3TYTA 3OFEA 1LW0B 2DNGA 2LQ8A 5AQIA 1WC0A 3RB3A 3H5YA 1JJ2R 4WF9L 4LF2A 2VPZB 3H4DA 4DV7J 2W4CA 1WBDA 2HNYA 2LA6A 1C2PA 1CBKA 3HVAA 4LBPA 2OP5A 4K8RA 4LF4K 3C16B 1BMQB 1VFJA 3T1YF 4ZCIA 4XPEA 4M5NA 2ACYA 3TUIC 3M6UA 1UVKA 2MLZA 1UA0A 2HYIB 3KLHB 1CJUB 4M63A 3CJKA 2E9ZA 1JXVA 2LXUA 2V4QA 3ZYYX 4ED4A 2V4JA 4CVNE 2CQBA 3FMBA 1IQTA 3N4PA 1X5SA 3F44A 4FPRA 2ETJA 2WBNA 2Z1HA 1ZM4A 3E2EA 4CO3A 1ZAWA 2CH6A 3SYZA 4WKYA 4X4SA 5JICA 2D7SA 4X64J 1NGBA 4Y6IA 3QJLA 3GYGA 3TEGA 1HNWJ 3IFRA 4WYLA 2DEJA 2F63A 3OT9A 5HOOA 4Q7AA 3CCRS 2W40A 1QD1A 4WFBQ 4HH0A 3VR1A 5FDLA 3HD1A 1U26A 4W5RA 1MWYA 2O8CA 2Y0SD 1WSVA 2B5JB 5DRKA 1HBUB 2AJ4A 1IM4A 4DPTA 4FJNA 4WWSA 3L7PA 3CQ8A 2MY7A 2P9LB 5KGXA 4QR0A 2QTWA 2GVZB 3R6MA 3QO9A 3NS5A 5IT9U 2OPRA 4M41A 1EP4B 5L38A 1UMJA 3BDEA 4LY7A 4TXSA 2UYTA 5IS2A 1FKOB 3OR1B 3T9NA 1IBKK 4FWMA 2MPUA 1LNQA 2DCUB 5D3GB 3CW2C 2AQ4A 2RVJA 4HT5A 1IXKA 2AYMA 3T19A 3G4SS 2HLTA 2QLFB 1TUYA 3D6HB 4PWWA 3GE1A 1VQ9S 2FIUA 2HNZB 3SSSA 2HBYB 4FN5A 3I4PA 2EI5A 5HLFA 1EB0A 3GCXP 2F8TA 3ZTOA 4B9LA 4QW8A 1NZAA 1ZC6A 3ENBA 2P5VA 2Y3YA 3FQLA 3TZZA 3DRSA 1XNRK 3QIPA 4ECVA 2KFZA 1WI6A 5GAGP 5CHIA 3Q83A 2CVIA 4YDXA 1RTJA 1HLWA 2I8EA 3NFAA 2ZWHA 4PXEA 1TVRA 2A1RA 2CJKA 4RBTA 1I3OB 1S6UA 2HS0A 4XO0A 5D8HB 1RYSA 4OMFG 3C15A 3NXZA 3O4QA 3HOSA 5F8GA 4DR6J 2AYBA 3AXKA 4OYIA 4FLTA 4A5BA 4TQSA 5EVZA 2HOEA 1N32F 1RQ0A 1IV0A 2F8SA 2P9EA 3BZQA 3ISNC 2CQHA 2PN6A 3IRWP 1WWHA 1NK8A 4R5PB 4ZPAA 3LDPA 2V8DA 5EY4A 4DCPB 2HW3A 4GVEA 4J2EA 4TNOA 1HNXK 1CSJA 4TY8B 2DH7A 2GZOA 3C6TA 2ADCA 2ADBA 3R97A 3CMAN 4KREA 2PIIA 2J6SA 1JQGA 4WP9A 5ETSA 3AB4B 1Z25A 2FVSA 2FD2A 1T9VA 1WKKA 2HPUA 1RT3A 1S22A 1JLCA 1SQEA 3RRKA 2COLA 1Q86O 1M5KC 2UXDJ 2ZH1A 3C46A 2V2KA 1HBOA 3BKTA 1FO1A 1T95A 3AFGA 3EWGA 3GFZA 3H90A 3DLEB 4C98A 1J5OA 3MWPA 1WOPA 2J9DE 3M32B 2FBTA 1SL0A 1PJ6A 3KD5E 3CPWM 2RN2A 3CC2N 4DR5K 1NHVA 2F9JA 4P74A 4B3RF 1FXLA 1SQFA 4YOYA 3G25A 1FEHA 1U1PA 2C3YA 3QRPA 3FDSA 6FD1A 2BOAA 4B9NA 2Q79A 1DAXA 4K2XA 2FVPA 3BR8A 3E8OA 2AWZA 2CQDA 3NF9A 1T94A 4A48A 3VQ6A 4URQU 1ITPA 4DV4K 4LF9K 2FZGB 3QGGA 1FNXH 2MKYA 2GMHA 4YY3J 2VFVA 1VSJA 1HNIA 2YVSA 3P45B 2ZBIA 4ANEA 2AEJA 3O3LA 1XK8A 5LMUK 5A76A 4FLWA 4WXWA 1X4FA 3OXLA 5BJRA 1A0OB 2V9KA 2OSRA 3VMFB 4UF4A 3RAMA 5U47A 1UVIA 1QHAA 3WT0A 4DV4J 4LF9J 1U09A 5C25B 2MKKA 3CCEN 1QAYA 3D7SB 4WFXA 5KG7A 3VENA 1YJ7A 3IS9A 3V4MA 1GLJO 1UWBB 3M6GA 4RW6B 4OPHA 1RWXB 2C3UA 4K59A 1QQCA 5J1EB 2FVQA 4F3QA 3O1WA 1KBRA 2E5GA 4NI2B 5KFJA 2DNKA 4BLGA 2LVWA 4RTFD 2DKOB 3A8YA 3GPAA 3MXMA 4K8XA 4PAAA 3EKSA 4Q8FA 1VSDA 1HHSA 4OJ1A 4A2AA 2JFDA 4FW1A 2Z0GA 5IWAF 3J81U 4PQUB 1UEKA 5AQTA 2JWNA 3IBCB 3L6QA 4WQ5C 1E6VB 3VF0B 5E3RA 5G0RA 5J2MB 1GX6A 3HKZD 4Y0FA 2MMYA 4KH4A 1N36K 5D4LA 3CD0A 2XBPA 4BRHA 9RUBA 5JVGL 5BN9A 1KQSM 3OS1A 1KR4A 3PG9A 4RUBA 4YOXA 4RWTA 4P73A 2XLJA 1BCOA 5JLHA 2JEIA 4A8SA 2OTLN 1K8AO 2ZH3A 4FLYA 5K9FA 3MEEA 1C4CA 2P9PA 1N36J 4QWEA 4EHUA 2DH9A 4PYAA 3BGFA 2AP1A 2VBZA 5JS2A 5B7WA 1X8DA 4X66K 4JI3K 4R0JA 1EHWA 4JKCA 3J80O 5KT4A 2N4DA 3VAKA 3KUHA 3FMWA 2KM8B 1P9YA 2BRKA 1TAUA 1S49A 3W2VB 1VK8A 2QL5B 2CA9A 3CM5A 2XY8A 1U25A 5DGBA 2LXFA 2RD5C 4DFKA 1T7PA 2GIQA 4X66J 4JI3J 2NQPA 2U1AA 3PIPL 2DRBA 3SQGA 1NOYA 3UE5A 2H1YA 3H5SA 4CF9A 4DV6F 2VBYA 1HL6A 2HVZA 2M8HA 3KJVA 2I5JB 2MQ8A 3ZSWA 1M90T 1H73A 2Z4PA 1FXXA 3LOUA 1UOCA 4ZCKA 1TL3B 4M63C 4U6PA 3ULEB 1ZBTA 2AX0A 3K59A 5LJ3Y 4WPAA 2W8LA 1L5UA 2H5IB 4JKGA 4KHNA 3QQCD 4C0BA 3TI0A 5BRFA 5F1XA 3LP3A 4JUZA 4E7LA 1OSCA 4IR1A 1GK8A 4ED1A 2WZ1A 3D6RA 1PGZA 2DHAA 3L4IA 1MN7A 1NH7A 1I94J 2EW9A 3QJJA 4CIEA 3VERA 3VGKA 3R8EA 3NGIA 4TLQA 2ASDA 4CEQA 3DRPA 1VQ4N 4DU7A 3B8HA 1Q9YA 3RJMB 1NPPA 4IG0A 4N7TA 3IM8A 3NOCA 2LKZA 4V19J 1ITGA 2FJDB 4H0PA 3QZ7A 1R8AA 4EP4A 1KD1O 1Y0HA 3DJCA 1DT9A 2RRBA 3PYEA 1DQ8A 4ISEA 4ED8A 3THXB 3SPYA 2FY1A 3CIMA 2ZJPL 2OMLA 3I0RA 4PG6A 2ZC3A 3GR1A 4RNOA 3LDSA 2KLAA 2ZKUA 3BEGB 3HXMA 1YAGA 1H0HB 4IH6A 2BR0A 4YFUA 2HLUA 1ZBFA 3OL8A 4WK1A 3CCUN 3M1VA 4NL5A 1RBLA 1Z1ZA 1KFSA 3TWZA 1O0PA 4NLXA 5AQWA 4MDAA 4Q0BA 2KH9A 4A8WA 5KFZA 4USMA 4JK7A 4JYAK 2FC8A 4LF4F 2HB5A 9ATCB 2Z1IA 4NLTA 3R27A 4IG3B 4NMXA 3L9ZA 5IFMA 3W5ZA 1PAEX 1YDLA 3HULA 2XEXA 5GMEA 1KC8O 1U02A 1T9UA 2EBEA 4G6VB 2M8DB 3L3UA 2BXJA 4LVNP 4MDBA 3CPEA 2A10A 5AQJA 3TPQA 4OVLA 5C2GA 3CCJN 4O5FA 5KFTA 4IJNA 4YDUA 5F8LA 3MR6A 5C7PA 4JHDB 1S3XA 4YR3A 3GSDA 3WEEB 4KFBB 1SPBP 5AXKA 2GS8A 4PEOA 2VA2A 4DHVA 3F5TA 2OA8A 4CLWA 2PSZA 3GFXA 5C2DA 4YN3B 1P8ZA 1LWXA 3PR5B 3M8QA 2HQDA 2F9DA 1EKRA 3IWLA 2LFVA 1KQFB 3G2XA 2P9NA 3OYMA 1S9GB 3MPUB 4ALZA 4GMKA 5HROB 3EE3A 3QWPA 2XMUA 5KT2A 2E1PA 4L73A 3MPWA 1FF2A 4OJGA 3OYKA 3DI6B 1M5VC 3VEVA 2OUGA 4J2AA 4G65A 1PBUA 4CJ3A 1TMJA 4FJ9A 1OWXA 5KFWA 2RF2A 3MM6A 3R1LA 1L3TA 4KKOA 3HHEA 4OV6A 4OI4A 3SQ1A 3HZ6A 3KD1E 3ENQA 1IBKF 3UWTA 2QWNA 2RDIA 2QA4G 2GTDA 5HL7L 2R3VA 5DG8A 3OBIA 2ZH6A 4RNHA 3O08A 4JEPA 1NU0A 3EZOA 3A5OC 2YKNA 4RW9B 5F3TA 3PYDA 4YDDB 3HT3A 3HOTA 5HI7A 2XB2D 3RW6A 4IEIA 2PD1A 2HBLA 2MSSA 1QE1A 2MDAA 4ZVQB 2MZ1A 4CJLA 3E9OA 3MAAB 2N4CA 1XNRF 2L41A 4O3OA 1RGIA 3BH6B 4UY85 4WU3A 3MECB 1A6LA 2VV5A 2HHWA 2LEPA 2CDRB 1RILA 1VSIA 3C6AA 3WNGA 4PKDB 4ZIVA 5KFMA 2DHSA 2VOOA 1OQ6A 2L08A 1Y5LB 5F0UA 1S1VA 3E01B 1O5JA 4K5RA 1IKXB 3RZAA 3SEOA 1U04A 4JI0K 3CWJA 4MFBB 3BZCA 2ZWPA 3T5HA 4CM0A 2NUBA 3CCQS 1V4TA 2IIHA 3TAMA 2Q1LA 4OJRA 2VG7B 4XAKA 2HQ3A 2AX1A 2DJWA 5A2QY 4CLZA 4N5SA 3ZETA 3Q0AA 3JS6A 3GP9A 4P75A 3KK2B 3K58A 3QNNA 3QAEA 1YI2N 3PSIA 4BDYA 5LMNK 3HHDA 3UN2A 3KOAA 2IDOA 1J6ZA 2J6UA 4B1WB 3ZLJA 1HNXF 4J9RA 3L09A 2CIMA 1Q5VA 1PC4A 4WZQA 2H5EA 3TZYA 3NH1A 2AJ0A 3KK3B 3OHAA 3TA1A 1NJIT 4HUEA 4JI4K 4JI2K 3NGTA 4K43A 3W8PA 2E66A 1YSJA 2GW8A 5AQQA 2VF3A 1Z05A 3ZZPA 5LMNJ 1Q82T 1UTAA 5CZXA 3O9RA 4GV6A 1JLFA 1JLGB 3CNQP 1N88A 3QGIA 1OPZA 2NZTA 2Z2MA 1JXLA 4PWDA 2XSJB 1RAFB 2GC8A 4K2JA 3V5RA 4DL4A 4JI8J 2NRRA 2FSJA 4QQBA 1HLUA 2OAUA 3A2FA 4DR4K 3MDQA 4JI2J 2ERRA 2OIHA 1OO0B 1W2IA 3DMJB 1WF2A 4DR5F 1LK7A 4ZLPA 1RT6A 4AHRA 3OL6A 3SMSA 4QS9A 3MAQA 3LA0A 4A8OA 3SZ2A 4LIWA 4KHRA 3Q7BA 2Q36A 5EUHA 1RAGB 3W3SA 1KKHA 4DR4J 4X4OA 4DV4F 4LF9F 2ZUAA 4DB3A 3DLRA 2C2RA 3TA2A 1YJUA 3IAS9 3KKSA 3ZCMA 2LEBA 2Y0BB 3FE1A 4EIAA 2F65A 3G10A 3LW5C 3A0IX 4J91A 4B3TJ 2G1HA 2YHXA 4B3SJ 4C3KA 1FXRA 4BE2A 1D0EA 1T02A 2OTJN 3THWB 2B4JA 1FDAA 2IPOB 2YWWA 3O9SA 4CK2A 4OLOA 4KH5A 4HH1A 1RT7B 4KBOA 3DOLA 3N4QA 3V6HA 4DUZK 2E7XA 4NLDA 1GLCG 5DGAA 2FLLA 1T9XA 3WXIA 2OSQA 2QI2A 2MZTA 3BGUA 2ZH8A 3BGRB 1PO6A 2V52B 3NWGA 2RILA 2QC3A 3OYCA 4J9MA 2ASLA 3THPA 4J9PA 2FZCB 5CYJA 2Y8YA 3R6LB 2IC3A 4NX9A 3OV7A 3NAIA 3WNHA 1UETA 2O8FA 1NLKL 5KFAA 4MK8A 1WSHA 4I2PB 4DUZJ 1YRXA 1RT1B 4IO9L 2FJAB 1WSIA 1RWPB 5K8OA 4F0MA 4GV9A 1CJTB 2K1RA 3JSMA 3MM7A 4A5AA 2RE1A 4RW4A 3ASMA 4CK1A 1DTTB 4OPKA 4O4RA 2EK6A 5HL7Q 1N48A 3N6LA 3I55N 1NJYA 2A0FB 1F9EB 3PSFA 2C3OA 1N36F 3HM8A 5C2FA 2POKA 4L8RB 4HL9A 3LZJA 4RR5A 4E1JA 5AR0A 2W1BA 1ACMB 1NM2A 4ZMMA 1YJWS 3UO0A 4UZBA 2OD6A 4L3KA 4GKJJ 3TAGA 3TABA 4RW8B 3TTDA 1OSDA 4OZNA 2V50A 4TYBA 4BC7A 2QWRA 4OX6A 2YNFA 1SKUB 1IBLJ 4X66F 3RB4A 4JI3F 3HDSA 1NGCA 1BQMB 4YEAA 3EEQA 1U0HB 2MQPA 1OH5A 1NGFA 3ILIA 1MWMA 1BHLA 4H0OA 1K0TA 5GADI 2A41A 1VBXA 3KZBA 5BYQA 3KG4A 4CH7A 3SDEA 4B3OA 3T1HJ 4P2SA 5MLCV 2PMWA 4ZJOA 2XYPB 4IOBA 3D0PA 1LWEA 1ZXOA 2LU1A 3AY0A 5HBMB 3OSPA 3VAHA 3RBXA 2M0GB 1QVFM 3HP6A 3T5KA 3MR7A 2Q3PA 4BDPA 4EZ9A 2W2QP 3BV8A 4LFCK 4RZRA 3PNIA 4I64A 3BF4A 3QLHB 3IGVA 4H4MB 1HBMA 1VSFA 4UW2A 2R2UA 4MIWA 4CTAB 3ET6B 5KFQA 3VAJA 1RTDB 1VI7A 5DZ6A 4ED7A 4O4GB 3PKMA