3MEEA

Hiv-1 reverse transcriptase in complex with tmc278
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords p66 Reverse transcriptase
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 155
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3meeA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3meeA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3meeA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3meeA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3meeA05
3OS1A 3H2LA 1IKYB 1SH2A 3DMJA 4HUEA 3ICLA 3PHEA 3AVAA 1T8EA 1S0NA 3WNGA 1Y97A 3CVKA 4NLRA 4CJPA 1C1CA 1JX4A 1RT3B 3MFHA 4OVLA 3PO5A 3KHGA 1QAJA 3OLBA 2YV0X 3WNFA 4MFBA 4AHRA 4KB7A 3BDPA 2VA2A 3M8SA 5CYQA 3PW7A 1S97A 3D0PA 2FBYA 1RA6A 1KVBA 4MIBA 3QNOA 1C2PA 2AGOA 2Z1HA 4FLYA 2B4JA 5FDLA 4EO6A 1K1SA 4YQWA 4O0IA 5I42B 3OYGA 4IKAA 4B9LA 4C8OA 3BSNA 4Q43A 2ATQA 1KVAA 1SKSA 2B43A 3DRPB 3K59A 2EHGA 3LP2B 1IKYA 1T7PA 4DQQA 4AHCA 1S48A 2HNYB 4O3OA 1RTDA 5JXSA 4W5QA 2IAJB 1WLJA 1ZBUA 4Y1CA 4K8ZA 1RT3A 4AHVA 3DLEB 2RF2B 1XWLA 3RMAA 4GC6A 2PY5A 3GIJA 5KFBA 1TKDA 4OJRA 5HLFB 4FBUA 5CYMA 3G6XA 3QEVA 1TKZB 3AVBA 4CK3A 3Q8RB 4CGDA 2JEFA 2DFHA 5EUHA 3RB3A 4M3WA 2D5RA 3RWUA 2BGGA 1WSIA 4CJVA 4J9OA 3ZSVA 4Y3CA 1S9EB 3PW5A 4ED0A 5I42A 4F3OA 4ZP9A 1S1TB 3LP2A 5L1LA 4DTUA 1C6VA 3VQ7A 1IH7A 4ED8A 4ZTFA 1EP4B 2YHAA 3OJSA 2IAJA 4IFVB 3G86A 2XGQA 4O0JA 3DLEA 3LANA 4DFMA 4QPXA 1BIZA 2UUTA 1S5JA 2KZZA 5HLFA 1D9FA 1N48A 4B8AB 4IH6A 1RBVA 3RR8A 1WN7A 4DL2A 1JKHB 4CHQA 3SUQA 3PW0A 1S10A 2E9ZA 3O3FA 3QEWA 3TAPA 5KFCA 3CJ4A 3D5MA 4EP4A 1S9EA 1XI1A 4JUZA 2ASDA 4CHYA 3LPUA 1S1TA 5HRNA 2R2SA 1RYSA 3LP1A 4J2DA 2XY7A 2BANB 4FJLA 4W5TA 3QERA 4NLWA 3BSCA 4CCHA 1EP4A 4NLGA 1RNHA 3LZJA 5DK5A 3QO9B 3PVXA 2FBVA 2WTFA 3BGRB 3SV4A 4C8LA 3OHBA 2RDIA 3N6MA 1RBUA 1VSLA 1XR7A 3P5JA 3H4DA 1JKHA 4F4ZA 3NGYA 4ZPCA 3CJ5A 5CY4A 3TAQA 2V0NA 3DYAA 1KFDA 1C1BA 5KT6A 1S9GB 2J6SA 2P5OA 1J54A 4MKAA 3TAMB 3NGDA 1XHZA 4FJMA 4F4WA 5KFRA 3OYLA 3AVFA 1K6YA 3HPHA 3VQ8A 4LY7A 2KQ2A 3SPZA 3DOLA 2FJXA 4CEOA 2R8KA 3K2PA 2W9CB 5KFQA 3G10A 3QO9A 4RW8B 3MR3A 3SUOA 4B9NA 3BGRA 1QQCA 4KHQA 3HP6A 4CF0A 2AGQA 4ZPBA 3DLRA 3V81B 4NLUA 3ULDA 3NGIA 4YP3A 3RAQA 4CJQA 4RW4B 3TI0A 3VQBA 4N56A 1RAJA 4HUFA 2UUWA 3ZSYA 3IRXB 4FLVA 3SPYA 2AGPA 2PYJA 5HRSA 3OS2A 3S3MA 4DL4A 4IRKA 4WXOA 1S9GA 4DMNA 5L1KA 4ED7A 3I0SB 3TAMA 2FVPA 4ZMMA 3FQKA 2GBZA 3OYKA 3KIOA 4DSIA 1QS4A 3HP9A 3VQDA 1VRTB 3HXMA 4URQU 2OPRB 2G8VA 2WOMB 4PUOA 2B6AA 4RW8A 5SWMA 1RCHA 1JLFB 2ILYA 3JYTB 2D0AA 3WNHA 4PWDA 4B9SA 3V81A 1X1PA 3LDSA 3TWHA 3LP0A 1BI4B 2B5JB 1DTQB 2IMWP 4ED1A 1U47A 4RUCA 3VQ5A 1HJRA 4E19A 4FM2A 3QGGA 3IRXA 4OGEA 4KKOB 1HRHA 1TK0A 3OYEA 1D8YA 3THVA 3AVMA 3VN5A 3EPGA 3CFOA 3DRRB 4YR3A 3O3HA 3UPFA 1KHVA 5KFPA 4DTMA 4O44B 1VRTA 4NYNA 4FBTA 3FRZA 4FLTA 2OPRA 2WOMA 3O3GA 3NFAA 4CF1A 2W42A 4AH9A 3M8PB 2XY8A 5C42A 4RW9B 2JLEA 5KG3A 3SUPA 5J2MB 3PX6A 3PR5B 2HHWA 2C2DA 4J9KA 2G8HA 4JV2A 1TP7A 4EEYA 4FM1A 1RT6B 2RPIA 4KKOA 4C8NA 3KD1E 4I7FA 1K1QA 3QIOA 3ITHB 2HHUA 4ZHRA 4B08A 2FVQA 3NF7A 2D0BA 3NF9A 4DSKA 3IG1B 3MR5A 1IKXB 3DRRA 4TYBA 3NAIA 3AV9A 2RKIA 4M45A 5FRMA 4AHTA 4O44A 4WE1A 1WNEA 4F2RA 4XIUA 3MTKA 1RDRA 3QEIA 3NCIA 4OPJA 3M8PA 3HSTB 4DLGA 2ATLA 3V6DA 3Q8SB 4RW9A 1U4BA 4YNQA 1REVB 1S1WA 1WSEA 1KTQA 1RDAA 1S1VA 3E51A 3SFGA 5HP1B 4IG0B 4TN2A 3ZT4A 1RT6A 3NF6A 3OL9A 1L3SA 5KG4A 2V4QA 5J2QB 5KFOA 5C25B 1JXLA 4XO0A 3TAFA 3ITHA 4DQRA 1VK0A 2Z1JA 3T5JA 4IOBA 3EYZA 4BACA 3ISNC 3H5SA 1CZBA 3ZT1A 3IG1A 1IO2A 1IKXA 1YVFA 3S9HA 2HAIA 4CESA 4IR1A 4RUAA 4TSXA 1GOAA 4LH5A 1IG9A 4B9MA 3H08A 3LWLA 4ECQA 3TABA 3HJFA 2IS3A 3UDLA 1DLOB 5I3UB 4CERA 4TY9A 1FKOA 3SYZA 3VA3A 3KLEB 3I0RB 1RT2B 3U3YA 3K5OA 4QAGA 1NNDA 1REVA 4FLWA 1S9FA 1RBTA 2VA3A 1QTMA 1JLAB 5HP1A 3MEDA 4TXSA 4IG0A 3BQ0A 5F8HA 1I39A 3GIKA 3M9OB 4DFJA 1GX6A 4KHWA 1JLBB 5C25A 3OLAA 1BQNB 1N5YB 4M3ZA 1VSJA 4CJFA 3KKRA 4N41A 1NJZA 2P5GA 2E6MA 4QWBA 4DL6A 5J1EA 5F8MA 5KG7A 4KREA 2Y1JA 2YNHA 2D7SA 1VSKA 3SFUA 1MU2B 4DS5A 3S3OA 4URSA 3C6UA 1BGXT 1L3UA 5I3UA 3VQ4A 4CJKA 1NK6A 1UAXA 3I0RA 3K5NA 1RT2A 4RW6B 2IM1A 2I1RA 1HYSB 1TQLA 4AHUA 2G8FA 5KG6A 2IC3B 4Q45A 4J2EA 3QGHA 4OGCA 1JLAA 5HBMB 4E7JA 3O4NA 2JGUA 4ED6A 4CFDA 3KMSA 4O4GB 1JLBA 1BQNA 4ZVEA 4RNFA 3AVHA 4EZ9A 4K4XA 3KK2A 3OYMA 1BCMA 4PY5A 1HNVB 5DGBA 2DPJA 4DTSA 4G1QB 1U09A 4Y34A 4CHPA 3TAGA 3VQCA 5KFHA 1JLCB 4W5OA 4ZVFA 3OVNA 2HVHA 4EBCA 1A5VA 4QWCA 2E4LA 4KAZA 5KT3A 1S4FA 4RW6A 3F9KA 1RT5B 4IH5A 1T94A 4CGGA 5HBMA 4CIEA 3GQCA 4KE5A 4YMEA 4FK4A 4R0EA 4RW7A 4QWEA 1NK0A 4WYLA 4O4GA 3L2VA 3N6LA 5DLFA 2W9BB 1LWFB 4H54A 3MEGB 1X9SA 2XHBA 1ASUA 5KFLA 2IA6A 2AJQA 1HNVA 3UIQA 1N56A 2R2TA 1BHLA 3QIPB 3QLHA 3PW4A 4B9UA 1JL1A 3CQ8A 4G1QA 3HPGA 4Q5VA 3SZ2A 1QSSA 5DQHA 2AWZA 1NK7A 5L1IA 3LPTA 2HB5A 4QCLA 4FZZA 3HK2A 4J2BA 4IFYB 4Z0UA 1JXEA 1EXQA 5KFNA 1B9DA 4LSLA 3V9SA 1RT5A 2WHOA 4HTUA 4CJWA 4K4TA 2YKMB 2V4RA 5FROA 3NBPB 2AQ4A 3SUNA 1BIUA 3AVGA 1NK9A 4QOZB 2PZSA 5JUMA 1LWFA 4I9LA 1JLQB 3MEGA 4MK7A 4FS2A 3CFRA 4L8RB 3T5LA 4FM0A 2XI3A 4IQXA 3L8BA 1BQMB 1S6QB 4ECSA 4DF4A 3KOAA 3MXJA 3GYNA 3QIPA 1Q9YA 5E41A 2OZMA 2XWYA 4O3SA 3MR2A 4J9SA 3SCXA 3HO1A 5F8JA 1B9FA 3BSAA 2IJFA 4DU1A 4DTNA 4IFYA 2BDPA 2DPIA 1TL1B 2JC0A 4FK0A 2UVRA 1YVUA 3KLGB 1NJWA 4JS4A 1SKRA 4R5PB 3OSNA 3MR6A 2YKMA 3NBPA 2Z1IA 4JV0A 4U6PA 2CKWA 3GV7B 4RNNA 4ECUA 1JLQA 4BDPA 4CF2A 3ZSXA 1GOCA 1HQUB 1RDBA 4FLUA 1Z26A 1BQMA 5KFSA 1WAFA 2D41A 1S6QA 3DRPA 4NLQA 2BQUA 2Q3SA 4KHSA 3AVNA 2ALZA 4ECXA 3AA2A 4MK8A 2FLLA 1D9DA 1FK9B 2HNYA 4QW8A 5DG9A 2IOCA 3VQAA 3D45A 4DTXA 3PY8A 5KT4A 2VG7B 2RF2A 4EBEA 4NRTA 1TL1A 4YFUA 1KSPA 3KLGA 3MFIA 4EZ6A 1QSLA 2FVRA 4R5PA 1TKZA 4Z4FA 5KG2A 4W5NA 3IN5A 4DG1B 5DG8A 2WK4A 2ZQBA 4NRUA 4QWDA 4BDYA 2ZD1B 2FBXA 2W9AA 1HQUA 4I2QB 4O3RA 3TARA 3HT3A 4M3XA 2YKNB 5DLGA 4CJ3A 3RB6A 4FLZA 4RNOA 5KFZA 3AO5A 3LAKA 1FK9A 3UQSA 4NCGB 4BE1A 2EC0A 3OSPA 5KFYA 4IFVA 1FKPB 2VG7A 1KVCA 4OPKA 4NLPA 3IGNA 3AVLA 1C0MA 3O4QA 1EETB 4B9VA 2ZKUA 4ZTJA 1RTJB 4ICLB 3CM6A 3L3VA 3MAQA 4TQSA 2ZE2B 3QZ8A 1CLQA 2KW4A 2X6SA 2ZD1A 1OS5A 4CHNA 2A1SA 2Y1IA 4O55A 3OL8A 4NCAA 2YKNA 2G8WA 1QE1B 2FVSA 1U49A 3SJJA 1SKWA 2NUBA 2BANA 3M8RA 1TKTB 4NCGA 4CFAA 4IRDA 1WNSA 4U7CA 2RDJA 3CG7A 4DLEA 4GW6A 1TK8A 4FJXA 1FKPA 3OYHA 3G6VA 1CXUA 3GILA 4CECA 5KFFA 1RBSA 4ELTA 2RN2A 1EETA 4C8KA 3ZCMA 2BQ3A 3LWMA 3T3FA 4BE0A 4FCYA 1RTJA 1ITGA 1TK5A 3V9WA 4ICLA 2KTQA 2ZE2A 3BREA 3NH0A 4DU3A 3NDKA 3PZPA 2J6UA 1RTHB 3EY1A 1J5OB 3BJYA 4KTWA 1SH0A 3RB0A 3H59A 3RMDA 3P83D 5C5JA 2VG6B 2WCXA 5DQGA 4DQPA 1KLMB 3OYDA 1QE1A 3KNAA 3BR9A 4DL3A 1VSFA 2IGIA 1LWCB 2DFFA 3G0ZA 1T05B 1TKTA 4E7HA 2C2EA 2W9CA 4QWAA 5KRTA 1S0OA 3QESA 4HYKA 3V6HA 3KMQA 4OLAA 1BL3A 2BR0A 3DLGB 1NOZA 4RW4A 4FK2A 4LSNB 3B6OA 5KG1A 1C0UB 4Z4CA 3VA0A 2PYLA 2HNZB 1J5OA 1BISA 4CIFA 4PA1A 4MH8A 3I0SA 2X78A 4NLDA 3I5CA 2GUIA 2VG6A 4HVJA 1ZTTA 1KLMA 4CEEA 3OL7A 5KT2A 1J9AA 4CJ4A 1LWCA 2OPPB 2QKKA 3L2RA 1HARA 3C94A 4M3RA 2WRMA 2HWIA 5KFMA 5KT7A 2VG5B 5F8GA 1I6JA 1JLFA 1L5UA 3JYTA 2HHSA 3MXIA 1G15A 1QAIA 1BI4A 2B5JA 3EZ5A 3K57A 3DLGA 1DTQA 4NYFA 3C6TB 3MECB 3WNEA 3KLIB 3T19A 3CFPA 4LSNA 1TL3B 4CEZA 5T7BA 5F9NA 1C0UA 5J2PB 3OYFA 3K58A 1SV5B 1VSMA 3CJ3A 1VSEA 2W8KA 3F73A 2OPPA 1NOYA 2OPQB 1TKXB 4K4YA 4R8UB 4FXDA 1VRUB 3DM2B 5C24B 4AILC 3KLFB 4NLYA 1XR5A 4Y2AA 3HVWA 1JLEB 2VG5A 4HHTA 4E1MA 4KB0A 2WONB 4KPYA 1N6QB 2ITGA 4K4VA 5KFEA 1SUQB 1JL2A 3ZT2A 5J2MA 3PW2A 5KGWA 1HMVB 4FJ7A 4FJ9A 3OS0A 4JRPA 1RA7A 3ZSZA 3C6TA 3CJ0A 4KAIA 4FJGA 3NHGA 3CDWA 4DTJA 3KK3B 1JIHA 4EYHB 3SQ0A 5J2PA 2F96A 4DSJA 4Z4HA 1SV5A 4Y1DA 3U3GA 4DFKA 3NMAA 3LALA 4NYZA 4DS4A 2YNGB 4FVMA 4E89A 3IGVA 1SH3A 3E01B 2R8GA 3H4BA 5T14A 3AO3A 3RTVA 1TKXA 4QW9A 3RBDA 1VRUA 3QINA 3OYJA 3DM2A 5C24A 3OYNA 1NKBA 4TLRA 1W9HA 3V4IB 2QKBA 4J9MA 2XO7A 5JS2A 5KT5A 2DY4A 1LWEB 1S0MA 2WONA 1RTIB 2OPSB 4K50A 1N6QA 4CEQA 3HVAA 3BQ2A 1LV5A 3KHLA 4KI4A 5F8NA 2JEIA 1CZ9A 3TANA 4KSEB 4TY8B 2E9RX 4IRCA 3JSMB 2VWJA 3K5MA 3OY9A 2E9TA 4DFPA 2R8IA 4ZVHA 4BDZA 1HPZB 5J2QA 5D3GB 3L3UA 4ECRA 3KK1B 5K14B 4HKQA 4BWMA 5KG0A 3DI6B 4IH7A 3FSIA 1RBRA 1S1UB 4ELUA 1YTAA 2WB4A 2Z1GA 4N76A 4O3NA 1EX4A 4CEAA 4NCBA 3CYMA 3SQ1A 1TAQA 3HHKA 4PQUB 3G6YA 5CZ1A 4F50A 4B9TA 4F8RA 4CE9A 3V4IA 2HNDB 4ID1A 1HYVA 3QETA 1DLOA 3SNNA 1LWEA 1S1XB 2OPSA 3KLEA 4CJRA 1EKEA 1KFSA 3MEEB 3KLHB 1KCFA 1NK5A 4ZVGA 1LW0B 5DMRA 5KI6A 1S6PB 3JSMA 3HVRA 1CXQA 3BQ1A 5KFWA 3VQ6A 5F9LA 1HPZA 3UR0A 1NHVA 3OHAA 3KK1A 1N5YA 1VSDA 4DTRA 1NJXA 4I9QA 3ZSWA 4ED3A 3RMBA 3AA3A 4OKJA 1LW2B 4H4OB 2XY6A 1RT4B 2FJWA 2FVCA 5HROB 4FW2A 4CGIA 2HHVA 1L3TA 4E7LA 3T5KA 1MU2A 2ASLA 3OJUA 1KHWA 5HRRA 1RT1B 2HNDA 4IKFA 4N5SA 4FJIA 2W8LA 3CWJA 4KHRA 3HPOA 2IDOA 4FS1A 3MEEA 2VWKA 3NGZA 4E3SA 1U04A 1HYSA 1LAVA 2IC3A 2XY5A 1LW0A 4J9QA 1I3AA 5KFXA 3VQEA 1RYRA 1R0AB 3VQPA 4HCCA 5KFGA 4FJ8A 3KKSA 4EP5A 1A5WA 1C1CB 5KFVA 4CK1A 3VQQA 4MFBB 3CO9A 3NH2A 1TVRB 1N4LA 1LW2A 4O3PA 1RT4A 4OL8A 1L3VA 3M9NB 2OH2A 4CJ5A 4KHYA 5HROA 1YT3A 3ALYA 3TAEA 2BQRA 4M94A 4ECVA 4AHSA 3L2QA 4ZP6A 4F4XA 4FYDA 2IM2A 1JLCA 2IM3A 1Z4UA 2HMIB 4ED2A 3ASMA 4E1NA 4FJ5A 4BE2A 3ZT0A 1WSHA 1CSJA 4CGHA 4JRQA 3EZUA 3NL0A 2G8IA 1R0AA 1DTTB 1RTDB 5EDWA 1J53A 4J2AA 2W9BA 3I5AA 3H40A 1U48A 5KTQA 3RB4A 2J6TA 3DLKB 3M8QB 3NKYA 3V1OA 3FDSA 1HQEB 1QSYA 1TVRA 5KFTA 5CYMB 1Z25A 1FXXA 3HVTB 2C28A 1UWBB 4Q0BB 3V1QA 3QNNA 4JS5A 4KO0B 4G3IA 2R8HA 2R8JA 2W7PA 2XGPA 2YHBA 4M3TA 2HMIA 3OYCA 4DL7A 3AA5X 4Z4IA 4GMJB 5J2NB 3VQ9A 2QK9A 5KFIA 3FQLA 3SI8A 4ECZA 4K4SA 3LAMA 2QV6A 1DTTA 4CF9A 1C1AA 2HVIA 2X74A 1ZTWA 2FLNA 3I8DA 3DLKA 1NJYA 4DSLA 3M8QA 4B8CA 1HQEA 3OL6A 4CFBA 2V9WA 3HVTA 3QZ7A 1UWBA 4Q0BA 4KO0A 2HWHA 2FJVA 3CIZA 4HCBA 4LQ9A 5FRNA 4J9LA 4K4UA 3AVJA 4IG3B 2XCAA 4H8KA 5J2NA 4RU9A 4DTOA 1ZBIA 1WAJA 4KBIA 4O5BA 2R7YA 3LP1B 2YNIB 5EWFA 3TR8A 2JEGA 1ZBLA 4H4MB 4CEFA 3K5LA 3V9XA 2YNFB 2HHTA 3PX0A 4CJLA 4KI6A 4WXWA 3PJWA 4Y2CA 4NLSA 1UA0A 3OYBA 4ECWA 1WSJA 4M3YA 4FLXA 1B92A 4KB1A 2BE2B 3DYAB 2KFZA 4KFBB 1MMLA 4WZMA 2HHQA 1C1BB 2EX3A 1XHXA 4IG3A 3TVKA 3RRHA 4KTZA 1A5XA 5F8LA 1O1WA 2C22A 2YNIA 4WZQA 3DOLB 4C8MA 4CJTA 4WYWA 1ASWA 1IKVB 3MXMA 4DG1A 3V6JA 5DQIA 4H4MA 4Q8EA 4J9RA 5L1JA 4F4YA 4DTPA 4LH4A 2F8SA 3ZT3A 2YNFA 4F4KA 1T3NA 5KFJA 4IBNA 4LD0A 3CM5A 4I2QA 2R2RA 1LAWA 5CZ2A 4JLHA 2OA8A 1ZBHA 3HL8A 3L2WA 2BE2A 3V9UA 4RZRA 1SL0A 4KFBA 4XPCA 2FC0A 1S49A 4Q44A 3V9ZA 2R2UA 3TQ1A 4X2BA 1RT7B 1JXBA 2F8TA 2AX1A 1KRPA 1IKVA 4J9NA 3QEPA 2GC8A 1W25A 4PUOB 5HRPA 2B6AB 2UVVA 1NHUA 4WFYA 2IM0A 4PWDB 3QEXA 2O5DA 4RNMA 3LP0B 3T5HA 1YTUA 2HHXA 4EO8A 5KGXA 4N47A 3SI6A 3QIDA 1Q8IA 4FJJA 4JV1A 4ZPAA 4IR9A 3ISND 4DSFA 2IBKA 1SL1A 3A2FA 3CDUA 1VSHA 3AO2A 3H98A 4WFXA 2XC9A 1RT7A 4TQRA 2QE5A 2KFNA 5KFAA 2W7OA 2A1RA 4B3OB 3C95A 3SQ2A 3SQ4A 4CIGA 1GX5A 4F3TA 1W0HA 1WSFA 4NZ0A 1RTHA 1ZYQA 3IAYA 4DSEA 4M42A 4E0DA 1SL2A 4FW1A 5C42B 4KRFA 1D0EA 4W5RA 2OZSA 4DEZA 3RAXA 3LZIA 2XCPA 4J9PA 3NAEA 2XI2A 4CJSA 3KTQA 3PR4A 1HYZA 4ELVA 1T05A 4KHNA 2OYQA 3SV3A 2DFEA 4YR2A 3T1AA 4I7FB 3IS9B 2E6LA 3DDKA 4ZHRB 5KG5A 1ASVA 4DU4A 4ZPDA 4CEBA 1JLGB 2GIQA 3EPIA 4ZP7A 3LP3A 2D3UA 2XRIA 4M95A 2RKIB 4KV8B 5F8IA 3KHHA 1U45A 2G8KA 4WE1B 4B3OA 4NLXA 1TAUA 5EWEA 2HNZA 3H5UA 3RR7A 2UVWA 3V6DB 1X9WA 3DRSB 3GIIA 3AO4A 4CHZA 1S1WB 3AO1A 4FJNA 4XPEA 4CGJA 1S1VB 2X6NA 3D28A 1NKCA 4KHMA 3GV5B 4M3UA 3IS9A 2ETJA 1NKEA 4HUGA 4I2PB 4GC7A 1JLGA 5DGAA 2P1JA 5KFDA 3PO4A 4CGFA 4KV8A 3NH1A 2UVUA 1TV6B 5KRSA 3MECA 3KLIA 2D0CA 4CK2A 1TL3A 2I5JB 1FKOB 4DF8A 1UA1A 4FZXC 4M41A 4Z4GA 3DRSA 3GV8B 2AU0A 1VSIA 4DWIA 4OLBA 1IM4A 2F8EX 3MEDB 5KFUA 4GVMA 2IJNA 2OPQA 3MF5A 4CJUA 4R8UA 3NF8A 2LSNA 3KLFA 1JLEA 4FJKA 3KD5E 4I2PA 4CHOA 4ID5B 3PJXA 3RBEA 3B6PA 1SUQA 4WFZA 4FJHA 5J1EB 1HMVA 4TYAA 2GV9A 1Q9XA 1TV6A 4UQGA 2YNHB 3GIMA 5DG7A 4E7IA 4K4WA 3BSOA 4DQSA 3KK3A 2BRKA 1BCOA 3C6UB 2I5JA 2FLPA 1IKWB 4ECYA 4LQ3A 1T03B 4CF8A 4YR0A 2YNGA 3PUFA 5SZTA 2CJQA 4EYIB 2JEJA 3E01A 4DL5A 2D3ZA 1HNIB 4NLOA 2C2RA 3AVIA 3PX4A 4Z4EA 5EU7A 4K8XA 4URGA 1QHTA 2GIRA 3KK2B 1RTIA 4ID5A 1D5AA 3S3NA 2KZMA 2ILZA 3RRGA 3ZSQA 1NK8A 1QUVA 4OKKA 3HKWA 3AA4A 4FZYA 4TY8A 3H5XA 3Q8QB 3DLBA 3V1RA 2DTUA 4MIAA 3H5YA 5D3GA 1IKWA 3OYIA 5K14A 3DOKB 5EWGA 4MKBA 3DI6A 1T03A 2O4IA 3NE6A 3HYFA 5L9XA 4DQIA 3Q8PB 3FFIB 3CJ2A 1S1UA 1F21A 2P51A 2HW3A 1RDDA 4RG8A 4IDKB 3PV8A 3KLVA 3ZSOA 4PQUA 3AVKA 3HM9A 4RW7B 1C0TB 1HNIA 3I5BA 2QXFA 4ZP8A 3KHRA 3CDEA 4CEDA 4K4ZA 3QYYA 4O4RA 1S1XA 5KFKA 3KJVB 4NLTA 1X9MA 3U6FA 4OKEA 4MQ3A 3KLHA 2FBTA 4E7KA 4EBDA 1RDCA 3QLHB 4RNHA 3DMJB 3OYAA 1S6PA 1TGOA 2ASJA 1ZETA 3VQSA 3N6NA 3RMCA 3M9MB 3DOKA 1UOCA 4NLVA 1GOBA 4F2SA 1D1UA 1XC9A 3FFIA 2AX0A 4CFCA 4LSLB 3DLHA 3NAHA 4H4OA 5CYQB 2JC1A 1ZBFA 4IDKA 1NK4A 2G8UA 4BWJA 1WSGA 4KHUA 1XR6A 4Q8FA 1KLNA 1C0TA 3L2UA 3AVCA 4KTQA 4O3QA 1RT1A 2BRLA 3ZSRA 5JS1A 3V6KA 1RILA 4CJEA 5FDLB 4ECTA 2O4GA 3QGIA 3P1GA 3KJVA 4MK9A
chains in the Genus database with same CATH superfamily
3EGVA 3H2LA 1IKYB 3A0IX 3TTFA 1WTBA 1SB6A 3R5AA 4U7UD 3AVAA 3V4MA 3HOTA 1NAQA 4CRJA 1G99A 1M1GA 1JX4A 3MFHA 1YIJS 1NU4A 1MNEA 4YHHK 3RU0A 2MQMA 5CYQA 3F44A 3CCEN 1OY8A 1Y7PA 1C2PA 1N8RT 4E98A 4ZPVR 4WFAL 5FLXU 3M6GA 2BX6A 3W1YC 5I42B 1NB2A 4BVOA 4WKYA 1SKSA 1Q79A 2B43A 3DRPB 2I2YA 1AA1B 3DOMB 3ATVA 6FDRA 1T7PA 1RB0A 1S72N 4X62K 4JD2B 1S48A 4KR0B 3VF0B 3TO8A 4BY9C 5JXSA 1Q82T 2IAJB 4IOCQ 3MDQA 2GJIA 2DGWA 1RWKB 1XWLA 4OHZA 3RMAA 3GIJA 5KFBA 1EKSA 3IXQA 3QEVA 1TKZB 3AVBA 4CK3A 2DXDA 1YJNN 1SIZA 4CGDA 2DRAA 3GJRB 4M3WA 2DGQA 3PCOB 4TU7A 2BGGA 3NS5A 3W0LA 3ZSVA 4Y3CA 3ENAA 4ZVSB 4ZP9A 4X4NA 1BWFO 4OHYA 3LP2A 4DX7A 1RWNB 5L1LA 1QQNA 3G6EN 4DTUA 1C6VA 5BRDA 3CJCA 1X4FA 1S5ZA 1IG8A 5ETLA 2C42A 4FF1A 3MN7A 3OJSA 1Y0HA 5B0BA 4IFVB 2F4VF 3BZKA 3GCWP 3LANA 2W41A 1BIZA 2QZ8A 1Q53A 2H5JB 3H46O 2HBJA 4LT6A 1D9FA 1N48A 3QDKA 1WN7A 1WC1A 2HURA 3HI0A 1YIJN 3M6UA 4RUHA 3SUQA 4WF9Q 4UF4A 4ZN1A 2OEMA 1J5EJ 5KFCA 5FPDA 1S9EA 5LOQA 1K44A 3BKUA 1FDAA 3T6JA 5HRNA 3R7BB 1VLOA 3AAWB 4AT1B 3O1WA 2VFVA 3HMJG 1VQ9S 3K5PA 2BANB 1FXDA 3RSEB 2BE7D 1GLLO 4CZFA 3LZJA 2RNEA 5F0XA 4PG8A 3HFZB 3PVXA 3SV4A 3KVGA 4C8LA 2Y3YA 3N6MA 5LMUJ 2LLZA 2X1FA 4UOGA 1APSA 5B08A 4JI8J 2V0NA 5KPTA 4U7UK 2RJZA 3SQOP 1SAZA 4BRPA 3TAMB 1DZ5A 4FJMA 1OKJA 4F4WA 1UVIA 1K6YA 1F9FA 2EXUA 4ES1A 4B02A 1YZ7A 2HRYA 4YN3B 2FJXA 2IVYA 3MCSA 3PKMA 2W9CB 3G10A 3G8SA 3SBTA 2O8FB 3BGRA 2IRXA 1FWKA 1QQCA 2QLFB 3O5BA 4ZPBA 2JFKA 1RHJB 4DR1J 2BABA 1UJ6A 4FYXB 3NGIA 4YP3A 2VQEJ 3TI0A 1VQ5N 1CPZA 4BRLA 1SIWB 3IRXB 2PYJA 3OS2A 4OPAA 4NYPA 1S9GA 2JH3A 2MTLA 4ED7A 5CHIA 1HW9A 3BM7A 3I0SB 3JTOA 4RPFA 2XMVA 3KIOA 3EWGA 3HP9A 2WTUA 1H3DA 2QWPA 1VRTB 2IA0A 1LCUA 2OPRB 4QYZJ 1OYEA 2B6AA 2V50A 5DJBA 1BD6A 1JLFB 3AA9A 3FKBA 2ILYA 3JYTB 3GPAA 4KT0C 4B9SA 3LDSA 3TWHA 4HT7A 2ZBPA 1BI4B 3TX8A 4DV4J 2IMWP 4LF7F 2FUG9 3VQ5A 1HJRA 2G2OA 3G82B 5TKWA 3QGGA 2EK6A 5EY4A 1RWXB 4MIWA 4KKOB 1HRHA 4PWWA 1U1QA 4FWRA 1V4TA 3HLUA 3UPFA 4DTMA 1PSDA 1R3NA 4NYNA 4FBTA 4FLTA 2F7TA 3O3GA 3ET6A 4CF1A 2ZJRL 5IFMA 3WDOA 2W42A 4AH9A 2B9WA 2XMMA 2JLEA 1YVNA 2Q6CA 1X60A 2RVJA 2C2DA 5CXTA 4J9KA 2YQ1A 1VQ4S 1Y3KA 3N79A 3GTYX 2HHUA 4NO7A 3J80O 4ZHRA 3GFXA 4Y2IA 4M5LA 4B08A 2FVQA 3T41A 3MX5A 4DSKA 4M5DB 3DRRA 4ETZA 3HSCA 4M5MA 2RH3A 1HNZJ 1RABB 2E7XA 3NCIA 4EWTA 3ZZRA 4DV3J 3BYPA 2IIRA 3M8PA 4X64J 4ZCLA 4A57A 2CADA 2KYXA 3NMUA 3WC2A 4Q2LA 1U4BA 3FMBA 1WSEA 4LF7K 3E51A 5HP1B 4TN2A 1F9EB 4QR0A 4AFFA 1B0TA 3NF6A 1IBKF 5KG4A 4KRWA 3V5RA 3ITHA 1R6VA 4U7BA 3H5SA 3ZT1A 1IO2A 1IKXA 1YVFA 2GHVC 1VJQA 1O51A 3H2VE 5DM6Q 3L6QA 2J8AA 3TABA 4OYIA 3GFZA 2KVQE 1FKOA 4TY9A 2RU9A 1LXJA 2G1HA 3KLEB 3U3YA 2QLJB 4WKRA 5F0UA 3K5OA 1UMJA 1H7XA 3D6FB 2PMWA 4IG0A 5F8HA 1I39A 3GIKA 4DFJA 3OVAA 4JI1K 2KJWA 1GX6A 3VAIA 4B1WB 3OLAA 2XMJA 2H48B 1VSJA 1B99A 4N41A 1VQ4N 5DO2A 3GB0A 4QWBA 5J1EA 5F8MA 4KREA 2D7SA 1F9HA 2HGLA 1VBZA 4F0KA 4LRFA 1PBUA 5ETTA 1E6YA 1L3UA 5I3UA 1XNRJ 4UZBA 3O9SA 3VQ4A 4CJKA 4AHUA 2CQ0A 3C6HA 5KG6A 4Q45A 4IYQA 2M5YA 2HQIA 3O4NA 2JGUA 2AJFE 1IBKK 2DHSA 2RD5C 4O4GB 2F8HA 5GINA 3GU0A 2W01A 5ETQA 4ZVEA 4HHUA 2BE9B 5AQVA 2MHNA 1UEKA 2FIUA 3UWTA 3JQMA 4DTSA 1NMDA 4OZ2A 2I0XA 3R5DA 3VQCA 5KFHA 1JLCB 2WBMA 3WEEA 2F65A 4EBCA 5AQUA 3CPWM 4KAZA 5F0WA 1S7HA 5K8PA 2GQCA 3ATUA 4WU2A 3BO4A 3TTDA 1T94A 4CGGA 5HBMA 4Z7CA 3MPUB 4YMEA 4R0EA 3QBCA 4LF8F 3L2VA 3N6LA 1UTAA 3HZGA 1X9SA 1JQGA 4AM7A 4YY3K 1KAYA 1ASUA 3LGMA 4LF9F 2IA6A 1E4GT 2GA7A 3EICA 3QLHA 1P9YA 3GG0A 2C2KB 3ADAC 5DQHA 1NK7A 5L1IA 2D69A 4QCLA 3VGLA 5A6PA 5KFNA 2V4JB 2GMLA 3I32A 4LSLA 1RT5A 4WQ5C 2YKMB 3IMXA 3NBPB 3SUNA 3AVGA 4C7QA 2LU1A 5CH7B 1IM6A 1LWFA 4C0OC 4MK7A 4FS2A 2Q0RA 4PXEA 2DGTA 5C2DA 1FE0A 1NDLA 1Q4RA 3M30B 4DF4A 3KOAA 3K89A 4DV1J 5E41A 2Q6BA 3QATA 3I4PA 2XWYA 4O3SA 3BBCA 4J9SA 2XB2D 1B9FA 4Q2MA 4RJVA 2HFUA 2B7BB 1XN9A 2BDPA 2DPIA 3KWGA 2JC0A 4FK0A 2MSSA 4JS4A 3OSNA 2UUBF 1AW0A 1GNKA 5C0YA 3CJ7A 1HUXA 3VCDA 1DY3A 2RQ4A 4LF8K 2Z1IA 4U6PA 3O4WA 4RNNA 4BDPA 2UU9F 1U8SA 4LF9K 5MAOA 1QQOA 4JAXA 2BJ8A 5T7LB 2VOPA 2VYPA 1BQMA 4ZPWR 1YI2S 1NSAA 3D4JA 4YOVA 3DRPA 4XDDA 1NU0A 1ZZNA 2Q3SA 4JKBA 4KHSA 3TA0A 4X66J 4JD2A 3AA2A 1D9DA 3M05A 4QW8A 1WELA 2CPEA 2RHQB 4DTXA 3D68A 2WVBA 1K9MO 1M5VC 3VERA 4EBEA 3JB9k 1TL1A 4P10A 4OI0A 2DHHA 3E3XA 3MCAB 4PRFA 1TKZA 4H5NA 4RX6A 3IN5A 2WK4A 1BXNA 3TRGA 3AOCA 2NR0A 4ANDA 2VQFF 2E8AA 3E66A 4QWDA 2MSTA 3D6HB 2GAHC 2HLUA 2Z4PA 4BDYA 2ZD1B 1N32K 4C11B 4FNIA 5DLGA 4DU7A 2HFSA 3L7UA 2QXLA 1OVYA 3TPQA 1RHUB 3UQSA 3D66A 3RJMB 2AD9A 2EC0A 3NGSA 4IFVA 1FKPB 2VG7A 3O6WA 4OPKA 4NLPA 3AVLA 5ELZA 3DGVA 3M6WA 2VH7A 4MMOA 2YWFA 2ASPA 3R5JB 4DX8H 3L3VA 2UU9K 4TQSA 3QZ8A 3HFKA 2X6SA 2AJ0A 2LECA 4YDDB 2G8WA 3R5CA 2CFXA 1JJCB 5D4NA 2NUBA 2BANA 4NCGA 1YI2N 3RSEA 1IWAA 3CERA 2LXFA 4H5RA 1HKCA 4RBTA 1OH5A 2NXNA 2XSJA 1K8AO 4KJIA 1HBMB 4X4VA 1NH7A 2RN2A 1EETA 3K17A 3KJQB 4W4MA 2BJEA 2CIMA 4C8KA 3ZX0A 2JRSA 1WUAA 3OXFA 3LWMA 3T3FA 2VQFK 4FCYA 4A8MP 4N77A 1XEZA 4OZ5A 3NDKA 4CQ1A 1RTHB 2J9CA 3CO0P 1NGEA 2W1BA 1PAUB 4P2SA 2QSWA 5E3RA 3BR9A 1YKWA 1VQ8N 1HWUA 1SJQA 2FSKA 5B0EA 3QT8A 3PEJA 1T05B 4OLOA 2W9CA 2K7JA 4UZCA 3Q22A 3TP2A 2E1PA 4J9UE 4AXJA 3QESA 2FC8A 2EFVA 2XHWA 2CJAA 3V6HA 4PKDB 1BL3A 1F2HA 3D2FB 1J2VA 4P73A 3I56S 3QJJA 2J0QD 3W61A 4LSNB 2HNZB 3EO3A 4CIFA 1ZBSA 4MH8A 3I0SA 2X78A 5HQMA 2VG6A 1KLMA 2A0FB 4CEEA 1J9AA 3VEWA 3UN2A 2O3DA 2VBZA 1KQGB 2QKKA 2UUCJ 3JS9A 3L2RA 9RUBA 1I51B 5A76A 2BOPA 4FXVA 4F04B 4M3RA 2HWIA 3TA1A 2R9LA 3CXCM 2ASOA 3ZZPA 2V63A 3VWSA 5KT7A 2VG5B 5F8GA 1I6JA 1JLFA 2LEAA 2AW0A 1FWPA 1NDCA 5K9FA 3JYTA 2HHSA 4ZDNA 2E1AA 3DCAA 2VC1A 5D78A 3NGTA 1BI4A 3DLGA 3C6TB 1SJ3P 3OA9A 4U8YA 3ZETA 3KLIB 2DH9A 3CFPA 3ZTRA 1TL3B 2YVSA 2GEMA 1C0UA 1PKUA 1HNXF 3OYFA 2JLFA 1SV5B 1NMNA 2HS0A 3MHYA 3CJ3A 1M5PC 1VSEA 1KQSM 3F73A 4DR4J 3C65A 4X4TA 2OPQB 1TKXB 2X7IA 4NLYA 1XR5A 1JLEB 3AOAA 3THYB 1B7YB 1VC5A 2MKJA 4NOHA 5KFEA 1SUQB 3ZT2A 5AXNA 1QDUB 4TU8A 2E7WA 3OS0A 1AFIA 4UT4A 3EVWA 2FY1A 1R7IA 1RAOA 2ZUAA 4DSJA 4I6WA 4BREA 1H72C 5H9EK 3I56N 3LALA 3D6MB 3CCVS 4M5DA 4ZIWA 2YNGB 4E89A 3IGVA 1FJGJ 2ZH7A 2ZM6F 3UD5A 3E01B 4M63A 5T14A 2CH5A 3AO3A 1WKLA 3OYJA 5C24A 1T02A 1W9HA 3V4IB 5KT5A 4D3HA 3M2UB 4K0KJ 4WIQA 2QA4G 1LWEB 2WONA 3QFWA 1RTIB 3CCTA 1N6QA 3IP0A 2KB2A 3HVAA 5AQHA 3AB4B 4OI1A 1LV5A 1R31A 1S0VA 4KI4A 2DGOA 3N5BA 4YDXA 3MR7A 2E9RX 3DGPA 1S12A 3CQXA 4IRCA 2VWJA 5C7PA 4DFPA 1HNXK 2DVIA 5BJRA 3KG1A 4HKQA 4BWMA 1RFQA 5KG0A 1RBRA 1F6TA 3CCSS 2VV5A 5LJ3Y 2Z1GA 1U2CA 4N76A 2KKZA 4NCBA 3O1LA 4U67Q 1KC8T 4OX9J 1NGIA 1HYVA 2QGFB 2QX0A 4QPTA 4RR5A 3KLEA 1KFSA 1EKEA 4I6YA 3HSZA 2UXDF 4DX6A 3G8QA 3LDNA 5KFWA 1V5VA 3VQ6A 1PG5B 1VC0A 2XULA 4NXNF 3H20A 2VFTA 4LFBF 3ZSWA 2WAQD 3TX0A 2NRVA 2A5XA 3H3NO 1WSVA 1GQEA 2AT1B 4H4OB 1RT4B 2ZH2A 3IRWP 5AQLA 2FVCA 3NXZA 5ADXA 4FW2A 2VD3A 5LMNF 4RBUA 2HHVA 1ZC6A 3CCVN 2YWGA 2X1GA 4CM2A 3EKSA 5HRRA 2HBZB 1Q1KA 3CWJA 1GAOA 3MEEA 2HG4A 2XHCA 4E3SA 3VGUA 1LAVA 5AE1A 3GR1A 3ENQA 4Q7AA 4J9QA 4P6QA 3MUVP 4F25A 3VQEA 5U47A 3QJLA 2J7KA 3KKSA 1LFWA 5B0GA 2Q43A 3T1YF 2IRYA 4A2AA 2XBPA 2YHXA 3VQQA 3OTDA 4MFBB 3P38A 3GR0A 1NGAA 3BEXA 4DR2F 1LXNA 1L3VA 2OH2A 1S4EA 4DV2F 1YT3A 3ALYA 4ECVA 3CCSN 4ZP6A 4F4XA 5CD4H 1JLCA 3OD2A 1N5SA 1XNQK 5KOWA 3KWIA 4AXIA 3MAAA 1YRUA 3QRPA 4LVNP 3ASMA 4O8KA 2QFJA 2UXDK 5E7OB 1WSHA 1NNEA 4AQYJ 1D4XA 3BGLA 2EWHA 4CGHA 4JRQA 1ESVA 4LIRA 3AAPA 3SSRA 4CVNE 2LEPA 4J2AA 3OBYA 3H40A 4LFBK 4NPOA 3DLKB 5HAOA 5H9FJ 1NLKL 1G3OA 3FDSA 5CYMB 3SAFA 2M7SA 1Z25A 1UWBB 3HHLB 4JS5A 4AL7A 4KO0B 2W7PA 2J7UA 2YHBA 2NCKL 2HMIA 3OYCA 4DL7A 1SC6A 3CIMA 4Z4IA 2VODA 3DU6A 2ABYA 4JYAF 2HHHJ 2DNLA 3VQ9A 4ECZA 1WWHA 3AGKA 5C2GA 4K4SA 1DTTA 2M52A 1SQFA 4LMZA 4B1VA 1C1AA 3T1YK 2FHJA 3CF5Q 2D1CA 3EE3A 1FDNA 2DT9A 1NJYA 4DSLA 3M8QA 3UI3A 1YZ6A 4DPYA 3HVTA 3M30A 4Q0BA 5E3CA 4DV2K 1HKBA 3ULEB 2FJVA 1ZOTA 2KU7A 1N34F 5BN9A 3M3ZA 4GY2B 3HFVA 3CCMS 1Q81T 5FRNA 4GKJF 3JAMU 3A5MC 3FGVA 4H0OA 2DHAA 4F02A 3W5YA 2QFIA 4O23A 4RU9A 4YOTA 3LP1B 2YNIB 3AQOA 2WVEA 3K2YA 2JEGA 1ZBLA 4H4MB 4CEFA 3GOIA 2HHTA 2D1KA 1MWZA 2CH6A 4QIWD 1WI8A 1NBWA 2FJBB 1HW8A 4Y2CA 1LOTB 1CS4A 2QL7B 4A5BA 2AZ1A 4FYVB 1WSJA 3RG6A 1WG1A 1GLDG 3DYAB 4OZJA 1GEHA 4IOAL 2HHQA 3MWBA 4ILJA 4NMXA 4CZEA 3RRHA 1AZSB 4JYAK 3GDQA 3ENBA 3FLCO 1GXLA 5IT9U 4F3MA 4KTZA 2BJ9A 4WWSA 5F8LA 1NPPA 2GX9A 2M88A 4CTAA 2DCUB 3MTJA 2XMWA 1KD1T 1FF2A 1AROP 1ASWA 1IKVB 4C4WA 3MXMA 4ZJQA 5DQIA 5L1JA 1B3TA 4LH4A 2ZKTA 2QMWA 2YNFA 5KFJA 3BH7B 2LQ8A 3SLCA 4C11A 2UXCF 2R2RA 1ZM2A 2Q3PA 3E9OA 4IEIA 1X9JA 3QGPA 4JLHA 3U1NA 4FSVA 1N34K 1K0VA 1H7WA 4GKJK 2X51A 2W7AA 4RZRA 4XPCA 1V9OA 3V9ZA 2XG8A 5DDPC 3K8WA 1UCNA 2DXEA 1U2VB 3BN4A 3CCMN 1BUPA 1JXBA 3VF2A 4JI6K 2F8TA 4YOXA 1X4HA 5BREA 2GC8A 2FJEB 1K8KB 3H3OB 3QPIA 4ILGB 3ONQA 2DD8S 2O5DA 1H73A 3TJ8A 3P6YC 3B8HA 5KGXA 4N47A 2HZCA 4HHJA 3RRKA 5BR8F 1FFSB 3D0IE 2ZBCA 1UVLA 3CDUA 2I7PA 1WG5A 2F4FA 1YBTA 5KFAA 4HTJA 3OBIA 1YF5L 2A2DA 4B3OB 1C4AA 4GV6A 2E5LJ 1GX5A 4CT9A 4CH7A 3D0GE 2UXCK 1RTHA 4E0DA 4JK9A 1NGBA 5C42B 3VZHA 4KRFA 1D0EA 3TEGA 4W5RA 4CZLA 4J9PA 3H6EA 2PC6A 3TZYA 4CJSA 3FCWA 1U02A 4OLPA 2LDIA 2OLWA 1T05A 4YR2A 4I7FB 2MQ8A 2E6LA 1RTZA 1VQOS 3UNGC 4FPRA 5AT1B 3SSQA 3EPIA 2XRIA 2CNOB 2RKIB 1R8HA 5F8IA 3KHHA 4JKCA 4WE1B 3MD1A 2AJ2A 2HMPA 5GAGU 3MWTA 1RGVA 5EWEA 2R7TA 2HNZA 2KRRA 1HI8A 1JJ2M 1RBAA 3RR7A 1EX8A 2PSZA 3DRSB 1TUGB 4CHZA 3AO1A 2JWNA 4CGJA 3D28A 3R5GA 1RSCA 3GV5B 4JI4K 1G4CA 5BR8K 2RDDA 3N01A 3J7Z5 3PRBA 3PNIA 2RE1A 3I8BA 2ETJA 3FZBA 4A8YA 1NKEA 2H54B 4HUGA 2GW8A 4GC7A 1JLGA 2P1JA 5IOLA 3PO4A 3P31A 1QJHA 5H1SQ 3KLIA 3MMAB 4PXDA 1TL3A 4NB4A 2I5JB 1U25A 5D15A 3C0BA 1BMQB 4Z4GA 2YPZA 4OI3A 2X3GA 4OLBA 3HULA 2F8EX 3MEDB 2IJNA 2OPQA 8AT1B 1E6VB 1WHWA 1B4SA 1JLEA 1U8WA 3MMVA 3KD5E 2POKA 3WX8A 3RBEA 1SUQA 4WFZA 1KBRA 1TV6A 2YNHB 3K0SA 1VQON 4ZVUB 4E7IA 4L73A 2BRKA 1BCOA 3P45B 2Y0BB 2FLPA 4ECYA 3OVSA 4DPXA 1T03B 4DZ6A 3IO1A 4CF8A 4YR0A 2YNGA 2OSQA 4EYIB 2JEJA 3OW2R 3R9LA 3E01A 2LXUA 1UETA 4IJAA 2YX7A 4NL5A 3PX4A 4Z4EA 4K8XA 2XO6A 4J90A 3M2UA 2GIRA 2PAVA 1KQFB 2HS3A 3FVYA 1WKJA 2ZBQA 1RTIA 2KJVA 3B6BA 2D0PA 3TTCA 4ID5A 2Q1NA 3JTNA 3ZSQA 3KUEA 4OYMA 3NWGA 1QUVA 4OKKA 3KDNA 3HKWA 2KXFA 4FZYA 2DITA 4WIIA 3Q8QB 4HT5A 4CZGA 2V6AA 3V1RA 2OTJS 2F8MA 2KL8A 4MIAA 3IWNC 5KQDA 1IUJA 3H5YA 1IKWA 3OYIA 3FSXA 5HVHA 2O4IA 3FFIB 1VGYA 5GMEA 2HW3A 4QYRA 3RW6A 4IDKB 4ZJLA 5BRHA 2ITMA 3AVKA 3IWLA 3I5BA 2P9PA 2QXFA 4BS2A 2KO1A 3QYYA 2CNNB 4O4RA 5KFKA 3KJVB 5CABA 3ZYYX 4MQ3A 2P9UB 1X5OA 2YWEA 1GFWB 3WC0A 4RNHA 2DGSA 1TUUA 4CM0A 1N8RO 2ASJA 1YQHA 3VQSA 2JJ4D 3L4QA 2C3PA 3MPYA 1RKIA 4FN5A 2QM1A 3OXLA 3MI7X 4PABA 5IWAJ 4F2SA 1XC9A 2AX0A 3DLHA 2DY1A 4H4OA 2J5AA 1R8PA 4C1NK 3J8AA 2G8UA 4BWJA 4RO0A 3FBBA 1XR6A 4PAAA 1WSRA 4JEPA 5M1QA 3G96A 1KLNA 3UB5A 2XMKA 3L2UA 1Q82O 4BQLA 4OV1A 1RILA 4CJEA 1Y5IB 1SXLA 4LF6J 2PN6A 2OHDA 5B09A 5G4DA 2NYHA 2RRAA 1SH2A 2D9PA 3DMJA 3VF4A 3ICLA 3PHEA 1T8EA 1S0NA 4BCAA 1Y97A 3WNGA 2HFVA 4PXCA 1JK9B 3I87A 1X7VA 2PBDA 1HBOB 2VJUA 4IOXA 4EFAC 2ZOGA 2YV0X 3P3DA 1VBYA 1J5EF 3WNFA 1RQ0A 2OTJN 4MFBA 3BDPA 2MZJA 1PJ5A 3GE9A 1N5QA 1S97A 3D0PA 3FUYA 4OFZA 2H65B 2FBYA 1RA6A 2DR7A 1K73T 2QWMA 4MIBA 1ZAWA 4JNEA 2F1FA 3G25A 1O5JA 2PO4A 2AGOA 1W2BR 3FEXB 5D6GA 1NGJA 3PJ9A 4EO6A 1K1SA 4KHPJ 3C14B 4B9LA 3ILLA 5EX3A 3CCJS 2WB1D 3K59A 2EHGA 4DQQA 3M8ZA 1H74A 5LMUF 4N8OA 3UN5A 4DMZA 1RT3A 4M5JA 5KOXA 4AHVA 4JI8F 2AP6A 2PY5A 9ATCB 2AV5A 5HLFB 1T6DA 5CYMA 4JI2J 2JEFA 5KQ8A 5SUHA 5GVQA 1U0HA 2L9NA 1DAXA 4DL0C 3U4LA 4QS7A 1RAAB 3EN9A 2V5HG 2CGLA 4ZITA 4F3OA 3PM9A 5JVGQ 5CR4A 1WD6A 2MYFA 1VFJA 1YRTA 1FRLA 2O01C 1YGYA 1U1PA 1IH7A 5AXLA 3K8VA 3FFKB 3ZLJA 4DR1F 2DBBA 3TJAA 4BRAA 2VQEF 2E1YA 3DLEA 4KH5A 1P27B 1J5EK 4DFMA 1S5JA 3OR1A 2KZZA 2MMYA 2WSEC 2YWKA 4IH6A 3UN3A 2CJXB 2ZF5O 3RR8A 2FB0A 1EB0A 1JKHB 3AARA 2E9ZA 2NZ4A 1Q0NA 4OI2A 4CLKA 1DQAA 3US5A 2Q36A 3LPUA 1S1TA 1GLJO 1P90A 2A42A 4BRFA 2R2SA 3MM8B 3W62A 2CJKA 3LP1A 2YXLA 3DC2A 2KXHA 2XY7A 5LMUK 3M5RA 3NY0A 4FJLA 1C4CA 5E3PA 3CCJN 3BSCA 1EP4A 5F3TA 4TNOA 2EBGA 1CEZA 4JI8K 4DV4F 3QO9B 1H6KX 2PFFB 2WTFA 3FMWA 4FKYA 3B4DA 1VSLA 5E26A 3P5JA 3H4DA 4F4ZA 3MM6B 4KGXB 3CJ5A 3DYAA 2ZDPA 1EARA 4NZ7A 2HHPA 3MK6A 2J6SA 4DUYK 1AZSA 2NRXA 2P9LA 2KLAA 1SBRA 3AVFA 3CIPA 2AYEA 3VQ8A 1QLNA 3EGZA 4CEOA 4DR1K 5BN8A 4V19J 1TZ0A 3F0NA 3MR3A 4B9NA 5D0HA 3HP6A 2Q2RA 4CF0A 4IFEA 3ZX2A 2AMCB 1NZ8A 3DLRA 5D0RA 1RHKB 3ULDA 3NVMA 4CJQA 2E20A 3IBFB 2H51B 4HUFA 4WQ5A 1HNZF 5ETSA 2ALYB 2AGPA 5HRSA 4ENOA 4WFNL 3S3MA 4DL4A 1WBBA 1YBAA 4WXOA 4QYZK 5DS7A 4KIAA 2FVPA 2E7VA 4CLTA 2R4FA 3FQKA 3SQGA 2GBZA 3OYKA 3GWCA 1QS4A 4LF5J 3CCLS 4DV3F 3VQDA 1JJ2R 2VICA 1YAGA 4X64F 2FSNA 1JXVA 2YBVA 1NEEA 3F5TA 2ZZNA 1S99A 3NCPA 5AXKA 2CZ9A 1ZS6A 4DV4K 1S22A 4RW8A 5SWMA 2DNYA 2BZ2A 1YJUA 1VQ6S 3NNAA 3V81A 3O3LA 2V2KA 2DNZA 5LSLA 1HBNB 1DTQB 5AZIA 4RUCA 3B8AX 3H1VX 5JICA 3I9ZA 1FDBA 1Y11A 2NPIA 2IVNA 4ZLJA 1TK0A 3OYEA 1PGZA 1Y64A 3QT5A 3THVA 3D9BA 3AVMA 1RBLA 4B3MJ 4YR3A 2IVMA 1KHVA 5KFPA 4ZCIA 3CQYA 4O44B 5IT9O 4FWKA 3FRZA 3VOVA 2PI4A 2WOMA 3O9RA 4LSZB 2CZVC 1FRXA 4CDIA 5C42A 5KG3A 1S6OA 3ZZOA 2OD6A 4JK8A 3TSQA 3VTIA 2HHWA 4MLEA 2G8HA 4EEYA 1RT6B 4I7FA 1K1QA 3QIOA 1PYOB 3NF7A 4DV3K 4UTGA 4X64K 4TYBA 3AV9A 1XNRF 2RKIA 4DQ8A 1UL3A 4WE1A 1WNEA 4XIUA 4Y2KA 2A41A 3CCLN 5E0OA 5EHHA 2E2QA 2BUNA 4OPJA 1OH8A 3Q8SB 4RW9A 4FWMA 4WQ4C 1HX1A 2CRLA 3IBCB 4JK7A 1RDAA 4DR7J 1VQ6N 3ZT4A 4ILRA 1L3SA 2V4QA 5C25B 3TAFA 3FC9A 2V2VA 3CJQA 2M9KA 1RWWB 1OSCA 4XAKA 2C3MA 1WOQA 3IG1A 2HAIA 1Q86T 4U8VA 4FWPA 4RUAA 1BLUA 2BV3A 1NSQA 2BW7A 3ZTPA 4JKDA 2VPYB 2XSFA 4LH5A 1FD2A 4B9MA 4I56A 1NSKL 2IS3A 5LXRA 3UDLA 4ZJOA 3VA3A 3H45C 3PLAA 3I0RB 1RT2B 4QAGA 1REVA 4DPUA 1ZA1B 2AJ4A 1QTMA 1OWXA 3MEDA 3ILIA 4H0VB 2HQFA 3M9OB 4LBHA 5ETKA 1E6VA 3IMQJ 4LC9B 4DKWA 4KHWA 3EEQA 1N5YB 4DN9A 2DNMA 2P5GA 2F7VA 3HM8A 1XNRK 3QWUA 2YNHA 3RAMA 2GGPB 1CULB 3R8YA 3I33A 1MU2B 1LKZA 4UUWA 3WXMB 1KR4A 1CJKA 4M7XA 1NK6A 4BBYA 2CPJA 2YH1A 1HYSB 3WZ0A 2C2NA 2IC3B 4GNIA 4OGCA 4NZ6A 1JLAA 2ASYA 4ED6A 4CFDA 4DV1F 4MYTA 2W2PP 3POTA 1JLBA 1UW4A 1BQNA 2VFRA 4KH0B 1B64A 4K4XA 3R97A 3CD5A 4PY5A 5DM7L 3HT0A 1GH8A 2DPJA 4BGAA 5IQQA 2JZ5A 3GYXB 4Y34A 4TVAB 4CHPA 3HKZD 1X5PA 2ZWOA 5E3AA 3T7ZA 3OTEA 5GAHP 4QWCA 2A3ZA 1PBAA 1HWIA 2ADBA 5KT3A 1S4FA 4RW6A 1E3MA 5B0CA 2CQ3A 2ZWPA 3M32B 3TUJC 2G4BA 4WFNQ 2JWLA 1NG9A 4WK3A 4KE5A 4X65J 1NK0A 2YHWA 3BGUA 4FOIA 4H54A 4X66F 3MEGB 3EJMA 1HNVA 2AJQA 4HDHA 4FZVA 3J81O 2P9UA 2ZUGA 1BHLA 3TZZA 3MM5B 2YWWA 1JL1A 3CQ8A 4G1QA 4DV6J 3IR7B 1ELOA 3D2EB 2LEBA 4H0PA 3IR6B 1RU2A 2ZJQQ 1RISA 3HK2A 4J2BA 1X5TA 2DTJA 5AQZA 1HD0A 2WHOA 1HNWJ 4HTUA 4L74A 2HPUA 4CJWA 4K4TA 4CZIA 1ZPVA 2AKWB 4O8UA 1U1MA 5M2PA 1NK9A 3TVYA 1BG3A 5E33A 1BA0A 2UYTA 4RLEA 1JLQB 3MXHP 1RU1A 4Z37A 3KJFB 2K1RA 3L8BA 1BE4A 2AA4A 4FPBA 1S6QB 2L41A 3GYNA 3QIPA 3MR2A 1RWMB 3HO1A 5F8JA 5BYQA 1RACB 2RS2A 1PAEX 3L7OA 3MPDA 4DTNA 2G1DA 4IFYA 4M5KA 4P52A 4C2MA 4C23A 3KLGB 2V8PA 3LPYA 3MUTP 3VEXA 1SJ4P 2CKWA 3GFHA 1ZM4A 4X66K 1SZ2A 1HI0P 2M4MA 4EK2A 1GOCA 2BJ1A 4G65A 1Z26A 1S59A 2HQCA 2JVOA 1H0HB 2XTJP 3M1VB 4USHA 2ERRA 2DK2A 4LRCA 2W24A 4Y65A 3PY8A 3J7ZT 4ES3A 3SJHA 2O66A 2W4CA 4NRTA 3IKMA 4YFUA 4EZ6A 2MKCA 2FVRA 4R5PA 4V1Ak 5KG2A 3SBGA 5CQGA 2MPUA 1G6BA 2HGMA 4CLLA 2ASMA 1FT8A 2FBXA 2AIRB 2YPYA 2HRUA 1RCXB 1HQUA 4LRAA 2MEWA 4X4RA 3PSFA 4M3XA 2YKNB 4P74A 2P6SA 4FLZA 3AO5A 1RZMA 3ZX3A 1FK9A 2ROGA 3ZZUA 1NLVA 2Q97A 3EVOA 1ZH5A 4YOEA 1KVCA 4YB7A 3IGNA 3NMRA 3LDQA 2PA3A 3EX7B 1UEUA 3SIPB 2C3YA 2Y1RI 3CM6A 3IAM9 2ZE2B 2UUCF 1MROB 4XH1A 3RBXA 1FX4A 4O55A 2OTLS 2BEFA 4NCAA 1N54B 3JTPA 3T1HK 2F9WA 4CBXA 1WC3A 2FVSA 1U49A 1SKWA 1T3VA 3IBWA 2O8BA 2JOQA 3M1FA 1TKTB 1QVFM 3CT9A 2IDEA 1WNSA 4DLEA 3OYHA 3G6VA 2E2NA 2CJBA 1CXUA 3GILA 5T41A 2YKPA 2XZDB 4Z94A 3FZMA 4ELTA 1H98A 1BWVA 2HKEA 4MLHA 3ZCMA 5HQLA 1RTJA 2YX6A 3V9WA 4ICLA 2KTQA 2YKOA 5DM7Q 3N28A 2D3OR 3UVJA 3CJ9A 2V8HA 3MWPA 1SH0A 4EUVA 3P83D 1JMTA 3MEKA 5C5JA 4DUZJ 1YDLA 1QE1A 4K59A 1VSFA 2IGIA 2UP1A 2WUSA 4I69A 1FW6A 4E7HA 1WUUA 3MDFA 5GIOA 3HJVA 4F36A 4QWAA 1T9TA 1CZAN 1UPPA 2OMOA 4KC5A 2NNWA 4HR2A 2VPZB 4OLAA 4A8FA 3MMJA 4ISEA 1V3SA 3HHLD 2G9OA 4YEAA 1NOZA 1TL7B 4FK2A 5GMKa 1EIYB 1FJGF 1OH6A 3B6OA 4Z4CA 3VA0A 5IT4A 4B3RJ 1J5OA 3QAUA 3I5CA 2IBOA 1UEVA 4K0KF 4OZ3A 4CJ4A 1LWCA 2OPPB 3W2VA 2PGCA 1REGX 2OTLN 4MTPA 1CJVB 1VBKA 4RBVA 1QVGM 1X3MA 1UJ5A 2QRRA 1L5UA 1KONA 2MQNA 4UY85 1NSPA 3MXIA 4JI0K 1G15A 1NM1A 3KJNB 3K57A 1DTQA 2CWKA 2MZ1A 4OJHA 3T19A 5T7BA 1N33K 2H4YB 3CC7S 5J2PB 6AT1B 2O8DB 4BRIA 3K58A 1PC5A 3QAEA 4OZ1A 4IOCL 4OX9F 2W8KA 1RI7A 3DXSX 1NOYA 2EG1A 4XEIA 4K4YA 4PPDA 4A62A 1VRUB 1V3ZA 3KLFB 1BQXA 3O9QA 2Z0GA 4HHTA 4E1MA 2N7CA 4CZMA 4KPYA 2ITGA 2YCHA 3MMBB 3K9JA 1A0OB 2CQHA 4FJ7A 4B3SK 2E2PA 1F5BA 4JRPA 2K3KA 3C16A 1KC8O 1FJGK 4P2FA 3NHGA 3A8IA 3SQ0A 5TKYA 2F96A 1NUEA 1RHRB 4Y1DA 1H2VZ 4DFKA 3W8GA 4K0KK 2K2PA 3A5NC 2R8GA 3OQ2A 3RTVA 3QINA 3DM2A 2KKHA 4WF9L 2XO7A 2OIHA 2DY4A 1S0MA 4K50A 2A3JA 2BMBA 3BS9A 4GVLA 1QZ5A 1N0UA 5F8NA 2JEIA 2LA6A 4KSEB 4BRMA 4PEOA 1FNXH 3IM8A 3JSMB 3K5MA 4GVBB 3OY9A 1F60B 1HPZB 3L3UA 4ECRA 5K14B 1UAWA 3D3CJ 1R59O 4ELUA 3CC7N 2NXJA 2ZVSA 4CEAA 2HZVA 4OJ1A 1S77D 2QL9B 1TAQA 3ILJA 3SQ1A 4JI1J 4PQUB 3G6YA 5CZ1A 3J7YI 4B9TA 1A9NB 4CE9A 3NVKA 4AQYF 3BKTA 1DQ8A 2HSTA 2OPSA 3EE8A 4CJRA 2E1ZA 3KLHB 3CCUS 5L38A 5FJ4A 4ZVGA 1LW0B 2QEXS 2FHKA 5KI6A 3THWA 3HVRA 4IDHA 5B7WA 1CXQA 2V2QA 1VYAA 3UR0A 4UOCA 2V68A 1NHVA 3OHAA 3KK1A 1N5YA 2HFNA 1CLFA 1MMNA 4I9QA 1YLXA 2ZEJA 4QIGA 3J81Y 3F2KA 5HROB 2QLXA 4NX9A 2MJUA 3T5KA 1MU2A 2HHHF 1A7GE 2MB0B 1KHWA 2HNDA 4IKFA 1PJ7A 4N5SA 2W8LA 2E1RA 1YJ9S 4A59A 4A61A 5E2QA 1NPRA 2J0XA 2OJ3A 1HYSA 3OT9A 4IO9Q 3P49B 2IC3A 1ZAXA 3C3LA 3DXKB 3UKRB 4CO0A 1I3AA 1R0AB 5EVZA 2W2NP 4GRSA 4JKEA 4FYYB 5KFVA 3NH2A 2V52B 5EGYA 1LW2A 4CBWA 4CJ7A 4H0XB 4OL8A 3M9NB 2GWJA 1FDDA 3HZEA 4M94A 2DNRA 4AQYK 3L2QA 4YY3J 2VZ9A 3ILOA 3S1TA 1R89A 2IM3A 3EDQB 4QQBA 3U1LA 3E2EA 1Z4UA 4KGZB 1P8ZA 4ED2A 4HVZA 4K2JA 2GVZB 4BE2A 2KHDA 2MXYA 1DRZA 3ZT0A 5H9FK 3N4QA 4LVOP 3P4UB 1Q81O 2G8IA 2CPDA 3RVCA 5DZ7A 1RTDB 2YX4A 1J53A 3CCUN 2QEXN 4ZVRB 1OQ3A 1NB7A 3OFHA 4GO5X 2BKNA 3V1OA 4FWNA 1VMBA 2MZTA 1HQEB 1QSYA 1TVRA 3A3NB 1FXXA 2C28A 3QNNA 1X31C 3CUNA 1WORA 2ZVIA 2HHHK 3M8YA 5B0DA 1XJWB 2DR5A 1VQMS 3D2EA 3ZO7A 1IR1A 2XGPA 2GZOA 4M3TA 3MMCB 1Q8LA 4HTLA 3QMQA 4UQTA 5J2NB 3A3PB 3SI8A 1YJ9N 3LAMA 2QV6A 1PYTA 2Z2MA 2ZHAA 5GAGI 3CJTA 3WHIA 4HTIA 4TKTA 5EOYA 4N8NA 1X4CA 5HANA 2KRBA 1KD1O 3KG4A 4O0NA 2ROPA 3I96A 4K8RA 2H5EA 2CJ9A 4M5NA 4LQ9A 4CIOA 1PILA 4J9LA 3EUNA 4PL8A 4K4UA 3GSDA 4USUA 4IG3B 2CQPA 5KPZA 1F2GA 2KT5A 2WSCC 3HX9A 1VS3A 5C10A 3RUBL 2OANA 4RWTA 3CI5A 1Q8BA 2Z2YB 3P8BB 1VQYA 3J7YP 3V9XA 5DM6L 4CJLA 2YJEA 4KI6A 3PRDA 1VQ5S 1QVFR 2GV1A 2MGZB 3VVTA 2WC9A 2CVIA 1MWKA 4LRDA 2Y8YA 2NUHA 3D54A 4C1NI 2BE2B 4CH0S 2NREA 1DHMA 4AL6A 4KFBB 1N32J 2KFZA 4JKGB 3UO0A 1NH8A 1C1BB 5DDQC 2P9SA 1T95A 1QZ6A 1BUXA 2PFDA 2E5LF 2E66A 2JDJA 1VQMN 5AQYA 1BOTO 2C22A 3B78A 3DOLB 4CJTA 3Q23A 4Q8EA 4J9RA 4F4YA 1HHTP 3T6BA 4F4KA 1MW7A 5E3QA 3FZFA 1LNQA 4LD0A 3W9JA 1LAWA 4DOZA 4BLGA 1KKHA 2H5IB 3UKUB 4CWBA 3KUHA 3L7PA 3EGWB 3QFHA 4OIXA 4DPTA 2M0GB 3V9UA 5M2RA 5AJ3J 3QFPA 4JV5J 3TQ1A 2JLGA 3R7SB 3TZWA 2DR6A 3BF1A 1RT7B 3HF5A 3BF4A 2WFBA 2N4CA 3K0JA 5AFUH 3MN5A 1KRPA 2WBNA 3MCMA 2DGUA 3HTVA 4MO5A 4BC9A 4PUOB 5HRPA 2F4VK 2K3IA 4A8WA 2UVVA 1MROA 4WFYA 2IM0A 4LR9A 3LTOA 5K8MA 4RNMA 4CLFA 2OEKA 3LP0B 1M90T 3BY5A 3W65A 4QU6A 3TNVA 2HAFA 1IV0A 4FJJA 2B7CB 3ISND 3RBZA 3G8TA 1JB0C 2J9DA 5JVHQ 1I1GA 3HHNB 3LA0A 2VB6A 1SL1A 4BR0A 2E5LK 3OTOJ 3L9ZA 2EKNA 4L3NA 3I82A 4RWWA 4ANEA 2BVZA 5D4OA 2W7OA 3TYTA 3D7EO 4OYAA 2A1RA 3SQ2A 3HD1A 4CIGA 1RHQB 3VTHA 2XZTB 2EK1A 5IM0A 4NWBA 1AXQA 4M42A 1SL2A 2BJ7A 3CEDA 2OZSA 3M2RB 3UE5A 3LZIA 1SQGA 2OSRA 3KTQA 4WPAA 1VQKS 1HYZA 4KHNA 2L08A 3IS9B 1N0VC 4OX6A 3DDKA 3N5FA 4ZPDA 2GIQA 3SCJE 4IO1A 4M95A 4W98A 5HQ8A 1FWLA 4CO5A 4OYZA 3ZEUB 5FD1A 1TL7A 1BA1A 2E1MC 2GTDA 1QY7A 2ZH1A 2M8HA 1X4DA 1FERA 3H5UA 1YJWS 3V6DB 4BRKA 2HIQA 2B0GA 3GIIA 3O9TA 1S1WB 4XPEA 2OELA 1S1VB 3FR0A 4M3UA 5AQPA 4AM6A 3J7AP 4A48A 2FJDB 1X4AA 5KFDA 2RRNA 5A2QO 5HVFA 4KV8A 2VJVA 3CCZA 2FC9A 4OV6A 4ERDA 1Z05A 5KRSA 4NA2A 4OYPA 4LF1A 3LF0A 1H2UX 2NRWA 2PIIA 2GX8A 4H03B 1NJIO 1YJVA 5AQOA 1FTRA 4EMDA 1GLCG 1VSIA 3MM7B 2CPHA 5KFUA 4GVMA 2P9IA 2LP4A 3TQEA 2LSNA 5LJ5Y 4ISFA 2IPOB 3KLFA 4CH1A 4IZ9A 1S57A 2BW2A 3CMES 4X4UA 5DZ6A 4OZLA 2X3DA 2GELA 1VQKN 4I2PA 4CHOA 3PJXA 4DB3A 2QN6B 4P2XA 2QWNA 4PXBA 2GV9A 3FRYA 5IWAF 1Q9XA 3MCNA 2EFNA 5E5NA 3G2XA 5DG7A 3D7SB 3Q89A 3DLLL 4CO3A 3WXIA 3L09A 3PXGa 3HHLC 2W2MP 4XH4A 3PUFA 2VU5A 5SZTA 4P9SA 2CJQA 2W25A 1YJWN 4LF6F 2DRDA 2Z2LA 2YKQA 4UUXA 4E8UA 3VZIA 2D3ZA 1VR6A 4WP3A 1S3XA 1KN6A 5EU7A 2VGNA 3DXMB 1QHTA 2ACYA 2YQ3A 3KK2B 5HMWA 4I4BA 3KHYA 2B4OA 2KZMA 4EHUA 2ILZA 3RRGA 3CDAA 3IFRA 3KG0A 2ZZTA 4MT1A 4KGKA 2CNKB 3QNWB 4V19S 4A8QA 5K14A 3DN9A 1FEHA 5EWGA 3NE6A 5L9XA 4DQIA 3SSSA 3DRYA 4KHPF 3PV8A 2H4WB 3CD0A 3KLVA 2CYYA 4L6V3 4PQUA 1I5OB 4RW7B 2O8CB 1C0TB 1HNIA 1WHVA 3PYFA 2E5JA 4CYUB 5A8KB 4XH5A 5A8WA 3SK3A 1HBUB 4CEDA 3DU5A 2OUGA 3U6FA 1N36J 4USVA 3KLHA 2NRZA 5IWAK 3CMEN 2CQBA 4AD6A 1K73O 1IR2A 2XMUA 5AQNA 3OYAA 2J7WA 4L76A 2P9NA 4JI2F 1YG0A 1U1RA 1YBUA 2OKQA 3DOKA 5H1SV 2W6LA 1UOCA 2KM8B 3BH6B 1D1UA 3C15A 2I38A 4CFCA 1AYEA 2YH0A 5CYQB 4TU9A 4LF6K 4DJBA 2LYVA 1LEOA 3R6LB 4Q8FA 2Q0UA 4KTQA 1FNMA 2BRLA 5AQWA 5JS1A 3S7RA 4YOYA 4N7TA 3NCQA 3P1GA 3LQVA 4FL9A 4MK9A 4FKXA 3FCHA 3DXKA 3PYEA 3UKRA 4HUEA 3QSYB 4NMLA 1GLAG 4BRDA 1XNQJ 4NLRA 3ZTQA 3L4BC 1B7FA 4KH4A 4OVLA 4OX7A 1KAZA 1RBOB 1QAJA 1HR0J 5MLCQ 2VA2A 4KHPK 2CPXA 2PEBA 2HF4A 3H42A 3PW7A 3NRBA 2AEJA 4I6MA 1Q18A 4DUTA 4WQ4A 4CI0B 3VENA 2G13A 2HK3A 3CGIA 3TVZA 2Z1HA 2V7ZA 5FDLA 3THPA 2ZITA 4YQWA 1HWKA 4IKAA 4C8OA 3BSNA 4Q43A 3HHDA 2RE2A 2GVZA 3LP2B 4WJBA 1IKYA 1NDPA 2WVDA 2ZHOA 4O3OA 4ZLPA 1OYDA 2DCLA 4JI2K 1RTDA 2RUGA 3GCXP 1WLJA 5A6WA 4Y1CA 2RF2B 4FF2A 4GC6A 2E29A 4OJRA 2JX2A 4FBUA 3L3CA 3G6XA 4UY8T 3Q8RB 3VEYA 3Q8UA 5EUHA 3RB3A 2B9XA 3JQKA 2COLA 2H3EB 4J9OA 2ZH4A 2JSXA 1S9EB 3PW5A 4HH0A 1TU0B 5I42A 3MMCA 4ED0A 3NGUA 3AXKA 2CA9A 3DOMA 4GV9A 2UZAA 3B82A 4L75A 4ED8A 4A5AA 2YHAA 4RUBA 2IAJA 2VUGA 4JI3J 4EU0A 2IMOA 2UUTA 3AJDA 5C12A 4B8AB 3G71S 4EIAA 4LF5F 3O3FA 2KXNB 3QEWA 3CJ4A 4LFAJ 4EP4A 2ZC3A 3DWLA 1VQ8S 1SC3B 3C66A 3QRRA 4B17A 2V51B 2E88A 3DLLQ 3W60A 4W5TA 3QERA 4Z7YA 3ID8A 4CCHA 4NLGA 3GE1A 2YTCA 4KPCA 1XMOJ 3MOJB 4U67L 2CQ4A 3BGRB 3OHBA 5K8OA 1MMDA 1RBUA 2UUBK 2RILA 1LQ9A 1M1HA 1XR7A 2FPHX 4NEZA 3SXLA 3U9DA 4B1YB 2BBEA 3NGYA 4ZPCA 3MM9B 5CY4A 4B3MF 3TAQA 2P9EA 4JKGA 1C1BA 5KT6A 1S9GB 4WYBA 1J54A 4MKAA 5EX0A 3NGDA 3QJPA 3BBBA 1DKGD 5KFRA 4NXMJ 3HPHA 2KQ2A 4IJNA 3SPZA 3DOLA 1O13A 5CD4A 1CG2A 4Z2XA 2RUSA 4GV3A 3EL2A 3MAHA 1OJ4A 3SUOA 3CE8A 4KHQA 1R43A 2GCFA 1D9AA 3SDEB 4JI6J 3W63A 4NLUA 2HQDA 5LJVA 2FHOB 3RAQA 3KK7A 4LF5K 3VQBA 3JXUA 5KAKA 1RAJA 1WOSA 3AD8C 2GQ2A 1IJFB 3G71N 4FLVA 3VEOA 5AR0A 2MKHA 4IRKA 4H4KC 1LOUA 4NEYA 5L1KA 3TAMA 4ZMMA 4ZN3A 4LREA 2OGUA 3DLJA 4DSIA 3O9UA 4CNYA 2MQQA 3VAHA 1HKGA 1C0FA 1M5OC 3HXMA 1VOMA 1YHQS 4URQU 1ZBTA 3KUGA 2G8VA 3QT7A 5IT0A 4PUOA 5BPMA 1RCHA 1HPMA 4X4OA 4DR7F 2O8FA 1CC7A 1VHXA 1X1PA 2GVDB 1K0TA 3LP0A 2RQCA 2RS8A 3AFGA 2B5JB 1EHWA 3HZ6A 4JHDB 4B3MK 2P9GA 3IRXA 1I94J 1D8YA 5FIIA 4K5SA 4F0MA 1W26A 3VN5A 3EPGA 3CFOA 4K25A 5J1NA 2XZWA 2FXUA 3DRRB 3CJ1A 3O3HA 2EFGA 5AQFA 5A2QY 1VRTA 1RAFB 4ZIVA 3CHWA 2OPRA 1PC4A 1RK8A 4DCPB 4LFCJ 3M8PB 2JL9A 2XY8A 1Q86O 3SMPA 3FZKA 1RGIA 1TR0A 3PX6A 2WVCA 1VK3A 5D0EA 3TW0A 1PO6A 3UE2A 3G82A 3S6EA 4FM1A 4JI5J 1EWRA 2FQQB 4BVPA 2C3OA 4KKOA 4C8NA 3ITHB 1QAYA 2D0BA 3FZHA 3CF5L 2GNKA 2I7NA 3MR5A 1IKXB 2UUAF 4J91A 3NAIA 4HHHA 1WDDA 4M45A 3KXDA 4JI4J 3L95X 4AHTA 3ZEUA 1RDRA 2QMXA 3QBXA 1K47A 2ADCA 4DR7K 3MD3A 1VRQC 1YHQN 3VETA 4OHXA 1MDUB 2ATLA 4Y0FA 3V6DA 2VPWB 4LIWA 1S1WA 1KTQA 2CWXA 1U7LA 3HBTA 1S1VA 4IG0B 2VPXB 4P71A 4IUFA 1WC6A 5B0FA 3OL9A 5J2QB 1JXLA 1UVKA 1VK0A 1RP5A 1UPMB 4IOBA 4R25A 4BACA 3ISNC 4J37A 1CZBA 2MLYA 3D1HA 4ZVPB 4IR1A 4C3KA 4QIFA 1GOAA 3AB2B 1RAEB 1S7IA 1IG9A 1ILYA 4F0HA 3H08A 1QHAA 4ECQA 3NP5A 4R79A 3D3BJ 1DLOB 5I3UB 4CERA 4X65F 3UNYA 3GBTA 4BR9A 1SQKA 3C19A 1NNDA 1VLYA 4CZCA 4FLWA 1Y10A 1RBTA 1OH7A 5HP1A 3B4MA 4TXSA 3BQ0A 1U24A 3D0HE 3GP9A 5BPLA 1W7AA 4DV6F 4L72B 2MJNA 4M3ZA 3ZC4A 2R3VA 2CAJA 3BN7A 4CJFA 1RXOB 3KKRA 5J1PA 4BC7A 2UUAK 2E5GA 3HHEA 2E6MA 3UCZP 3CPWR 3BR8A 1YJTA 4C6AA 2E44A 2FTRA 1QAXA 4DPOA 2B9EA 5LT5A 1VSKA 4EAHD 4QS9A 1WOOA 1LFPA 4DS5A 1HNWF 3FE1A 2ZJPQ 2W6KA 3WEEB 1BGXT 2MKSA 1SC4B 3K5NA 1XIQA 3CDBA 1TQLA 3R5BA 3QGHA 1R8CA 5CCMA 5HBMB 2E1CA 2BUPA 2FF3B 4ZVOB 1FJCA 5GAEU 4EZ9A 3A1YG 3KK2A 2M2BA 3AQPA 1O6XA 4USIA 5AQMA 5EN1A 1T44A 2ZM6K 3T9NA 3CJ8A 2H9ZA 3AODA 3EZOA 2XWXA 1U09A 3GONA 3TAGA 1SS6A 4KGMA 4ZVFA 1GLFO 2HVHA 2R7SA 4X65K 1A5VA 2E4LA 1CC8A 2IVFB 1HL6A 1WTFA 4PG6A 2BM1A 3BPSP 1RT5B 3SBMA 1JCGA 4CIEA 4FK4A 4RW7A 1KAXA 4WYLA 4CYUA 4ZK7M 4DR6J 4O4GA 5A8KA 1TMMA 5DLFA 4DV6K 1LWFB 1NM2A 1HBUA 2XHBA 3OR2B 4NLCA 2J76E 2CQ2A 3UIQA 2RSQA 1N56A 2XS5A 4Y28C 5I4MA 4ZLNA 1YK9A 1HNWK 5LSOA 3SZ2A 1HKAA 4LUBA 1G1XA 2YI1A 2AWZA 4P7VA 2HB5A 2BYCA 2Q31A 3HSGA 4Z0UA 1EXQA 1B9DA 3U8XA 3SEOA 1F3VA 4C0HA 2V4RA 1OO0B 5FROA 3FBFA 3ZZ0A 1BIUA 4NXNK 1IQZA 1TYQB 3J7ZO 4QOZB 5JUMA 1VQPS 2EG2A 2ZNYA 4L8RB 4FM0A 4O5FA 2XI3A 2HGNA 4IQXA 1BQMB 4YORA 4ECSA 3DAWA 2F9DA 3MXJA 5LMNK 2QTDA 1GMWD 3PSIA 3FZLA 2OZMA 3SCXA 5HVGA 1X0FA 3BSAA 1KXPA 3CJBA 2C2MB 2MQPA 1FXRA 2QLBB 1TL1B 2V4JA 1SKRA 4DCOB 3ZFVA 2ZGYA 1CVJA 2YKMA 2DIUA 3NBPA 2VKRA 3Q86A 2EEYA 3GV7B 1Q7YT 4CF2A 2OFHX 1UVNA 3ZSXA 2CPZA 2V8VA 5AE2A 4PWUA 4DR2K 5KFSA 2D41A 4CLUA 3LM9A 3IM9A 3CULA 4NLQA 2BQUA 3AVNA 2ALZA 4ECXA 4L3QA 2IOCA 1EQYA 4DR3J 1RWUA 2J9EA 1MG7A 1XBWA 2VG7B 2RF2A 3S8SA 4WP9A 1QSLA 3I55S 3NWRA 4Z4FA 5HJYA 4W5NA 3WQTA 1LK5A 1KP6A 3PIPL 3VAKA 3QFUA 4DUZF 2ZQBA 4NRUA 2B8PA 2VHGA 3TA2A 5I9EB 4O3RA 4I2QB 2UV8A 1AB8A 5T7LA 3TARA 5LSRA 2HEKA 3U7JA 2QI2A 4G1IA 4RL1A 1T9YA 1FX2A 1GTEA 5HOOA 3AOBA 3O1BA 5HL7L 1VQPN 2BH1A 3RB6A 4RNOA 4IO8A 5KFZA 3LAKA 2VOOA 4NCGB 2HVDA 3OSPA 2NUUG 3N0VA 3LGHA 1NGGA 2XSJB 1C0MA 3PYGA 1UFWA 1EETB 4B3RF 2ZKUA 2HBLA 4JP8A 3WX4A 3MAQA 3GMGA 2NRTA 2ZD1A 1OS5A 4RTFD 4CHNA 2A1SA 3FEYB 2LU2A 3MZIA 2GO8A 1SQEA 3OL8A 5ITHA 4HWIA 4M5GA 2IVOA 1OY6A 3SJJA 2V67A 2G0IA 1ZAVA 4DUYJ 1WC0A 3AAQA 1CJTB 3CG7A 4GW6A 4FJXA 1FKPA 2DNQA 2R7WA 2R7OA 2I8EA 4DUZK 3MM9A 3P4IA 1ITGA 3I55N 3BREA 3NH0A 3MOZA 4RU2A 3PZPA 2J6UA 3EY1A 1VJWA 3KYLA 5DDRC 1FVQA 3CXCR 3BJYA 3ZTSA 3RMDA 2VG6B 4DQPA 1KLMB 5I3PA 4DL3A 5F1XA 1KOOA 2ZBIA 4G9ZA 2KDOA 3G0ZA 3VGVA 2C2EA 1TUYA 4FPIA 3EM1A 1VK8A 4IEEA 1VQ9N 1S0OA 3SDEA 4HYKA 1WHXA 1HBMA 5GADI 4M8LA 3PRVA 4ZLLA 2CDQA 4B3RK 3SCIE 4FPAA 3KMQA 1EJ7L 2OCEA 2BR0A 3DLGB 2F5GA 3ULHA 2FF6A 3ZETB 1KQSR 1FKAF 5KG1A 4B3TJ 1C0UB 2G2ZA 3GZ7A 1FHTA 4PA1A 3C2PA 4B1XB 1FVSA 1GLEG 1MWMA 4NLDA 2HFOA 3J81j 4Y0WA 1NHKL 4JBCA 2D4WA 2A6AA 1RAHB 1DFDA 3C94A 2ZHBA 1RJJA 1W7WA 5FPMA 3PG9A 3LL3A 2Z30B 1X5SA 4CZKA 2GVDA 2F40A 1N52B 3NNHA 3EZ5A 2B5JA 1WF0A 3D2FA 1ULRA 1SJFA 2OD4A 4JHDA 3WNEA 3NGKA 4WFAQ 4LSNA 3BUZB 4CEZA 5F9NA 1YSJA 3GJQB 2W4DA 3E1YA 4JI1F 3N9UC 4H0YB 4OO1J 2QWOA 1NGFA 5IZHA 4USTA 1UFLA 1SKUB 1FCAA 4R8UB 1RE1B 5C24B 3BZCA 1KDNA 5L9NA 3A5OC 4ETXA 2CQ1A 1KVKA 3HVWA 2VG5A 4F26A 2JVRA 2WONB 4RCHA 3F56A 1OY9A 1R8AA 1N6QB 4K4VA 2MKIA 2J0SD 4KYZA 3DNCA 3ENVA 1JCEA 3HI9A 2VBXA 5KGWA 4FJ9A 5JVGL 2LA4A 1FEEA 3ZSZA 3C6TA 3CJ0A 3DGPB 6FD1A 2VWBA 1JIHA 1VISA 4DR5J 3WIUA 1SV5A 2FGCA 3NMAA 4KBOA 3D6TB 3C6AA 4DS4A 4FVMA 3ZNJ1 2P2CB 5LM7E 1SH3A 1HLUA 4M5HA 3H4BA 1TKXA 3RBDA 3OYNA 3J81U 2WW8A 4J9MA 3THXB 5JS2A 4KH1B 3THYA 4A8SA 4CEQA 4RKUC 3PIPQ 3BQ2A 5M1NA 1YITS 4LR8A 3TANA 1CZ9A 4J9VA 4TY8B 2Y8WA 1CJUB 1VQLS 2E9TA 1FRMA