4BRGA

Legionella pneumophila ntpdase1 crystal form ii (closed) in complex with mg gmppnp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
359
structure length
359
Chain Sequence
b'MDTNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 122
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brgA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brgA02
3SMPA 3ENOA 1BA1A 1NGGA 1JCFA 3IFRA 1SQKA 2W41A 4M7YA 3CHWA 4O5FA 4B1WB 3H3NO 4JD2B 3ZEUA 3R6MA 1ZXOA 5BRDA 1HJOA 2A5XA 5AQJA 3KZBA 3EKUA 4CZJA 4BVPA 4WQ4A 5BN9A 4BR0A 1NM1A 1CZAN 3LDPA 1NBWA 4A62A 4H0OA 5AQXA 5AR0A 2P9NB 2E8AA 3VF6A 4BROA 3EZWA 4BRKA 2BUPA 1NGBA 3ATVA 3D2EB 5TKYA 1QZ6A 4BGAA 2A3ZA 3ID8A 2P9IA 5EVZA 1YUWA 4JAXA 4QS8A 1NGAA 2F9WA 4A2AA 5KQ8A 1QHAA 3UB5A 4ISGA 3C7NB 2AA4A 1JCGA 1BU6O 3W3DA 1RFQA 3WXKA 5BPLA 1K8KA 3AY9A 3I33A 2E2NA 4H5NA 3WQTA 1JCEA 5BR9A 3RSEB 4H5TA 5AQMA 1DKGD 1Z6RA 1BO5O 1GLCG 2Q2RA 4FO0A 3UKUA 4GY2B 3EO3A 4AM6A 2ASOA 2QWNA 2ITMA 2GTDA 5LJVA 4HTLA 4E1JA 3R8EA 4CZIA 1X3NA 4QS9A 5AQYA 3HBTA 4BRMA 3W0LA 1HKGA 2GUPA 3VESA 1G99A 3M6GA 3O4WA 4J8FA 3VEXA 5FPDA 1GLBG 1LCUA 5BRHA 2CH6A 3EN9A 4FOEA 4BR9A 1GLJO 3L6QA 2CH5A 2FF3B 5AFUH 5B8HA 2QWPA 2AP1A 4B1YB 2QWOA 1E4FT 3CJAA 1H1VA 2V7ZA 5AQGA 5AQRA 3CQYA 1BG3A 4FWKA 3QFUA 4BVOA 1YVNA 2VYPA 2A6AA 2D0PA 2YHYA 3BF3A 3DAWA 3AAQA 5AQZA 3WEEA 3FZMA 3P4IA 1MDUB 2FF6A 3TU5A 3A5MC 2YCHA 3VEZA 3ZETB 3FR0A 1BWFO 4JHDB 2FSKA 2UYTA 3VPZA 2E20A 3VEOA 1C0FA 3CERA 3ZX3A 3C7NA 4DHYA 2I7NA 3ZX2A 3CJ9A 1BDGA 3BP8A 4CZGA 4FOIA 5ELZA 3RSEA 5AQUA 1P8ZA 4XH1A 4CBXA 5KQDA 1R59O 4BRFA 2H3GX 4FWMA 3LDLA 3QDKA 3JXUA 3M3ZA 2NLXA 3VETA 3D2FB 5AQNA 2IVNA 3F9MA 3O6WA 4WQ4C 3ATUA 2D0OA 3GE1A 3VGMA 2FSJA 3LDQA 4FWPA 1MWKA 4C23A 5KPZA 5E26A 2FLOA 1WUAA 4BRDA 4M7XA 2P9LA 4B9QA 4IWVA 4BRGA 5FPEA 4I6MB 2YJFA 4PKHA 1J6ZA 3LM2A 3C0BA 3MN6A 3VERA 2Q0UA 3JS6A 5AZIB 2I7PA 3A5LC 3VEWA 3L0QA 3WXLA 3WXJA 3SMSA 3GG4A 3ENHA 2Q97A 4FWLA 2KHOA 4K43A 3U9DA 5LJWA 2CGKA 2F9TA 4Y0WA 3MN5A 3ZX0A 5EOYA 4BRNA 3O1WA 3D7EO 3QB0A 5ADXA 2Q31A 3AAPA 5BRFA 4NB4A 3ULEA 4F9OA 3LL3A 3DXKB 4M63C 3O1BA 2P9KA 1HKBA 3HSCA 4H5WA 5AFUA 1KXPA 1NGHA 1NGDA 2P9PB 3CJ7A 1HKCA 5F2RA 4L3QA 2P9UB 5AQOA 3BF1A 3CIPA 4BRPA 2VWBA 1NGIA 2OANA 5FPNA 2QWRA 2P9SA 4B1XB 1T6CA 4K42A 3GDQA 5AZJA 3QICA 4BRIA 3DXMB 4PL8A 4FSVA 1U2VB 3M1FA 4FPAA 4WYBA 5ADXH 1YXQA 3MN7A 4JN4A 1TYQA 3HI0A 2QXLA 5EY4A 4BG9A 2CGLA 5AQTA 4A2BA 3HTVA 4FWRA 4PKIA 1YAGA 4EAHD 1DEJA 3I8BA 3MK6A 5AQHA 3VF2A 4NO7A 3B8AX 5CE3A 1ZBSA 2ZWHA 2ZF5O 4H03B 1NMDA 4ISEA 4JD2A 3FZLA 4BR5A 4AM7A 2Q0RA 4DCHA 1QQOA 2YHXA 4A61A 4K41A 4HWIA 4IJNA 2QWQA 4ISFA 1ATSA 3EL2A 3A5NC 3ZEUB 3IDHA 4CD1A 2FXUA 4IXCA 4XH4A 4CZEA 5JLFA 2P9NA 5LY3A 1TUUA 2V52B 3D2EA 1NGJA 4FWSA 4CBUA 2FSNA 5JICA 2HF3A 1SAZA 2E1YA 2Q1NA 1E4GT 3H3OB 3H45C 1Y64A 1T44A 3VGKA 2YI1A 4Z94A 4BC4A 3UKRB 2E1ZA 2P9IB 3DJCA 1SZ2A 3HZ6A 3MDQA 2IVOA 4RCHA 3GBTA 4WQ5A 2PBDA 2E2QA 3H1VX 2A42A 4MLHA 3SLCA 2V7YA 2GWKA 1K8KB 3H46O 4YDUA 5AQKA 2V51B 2W40A 3CETA 3AARA 2DPNA 3LM9A 1IJJA 3EKSA 4BRAA 3R9PA 2NRHA 2J4RA 4CZMA 1D4XA 4BQLA 2CGJA 4FWQA 2ZGYA 4H0YB 3FZFA 1HPMA 2PAVA 3BUZB 3G25A 4XEIA 3KHYA 2QWLA 3VEYA 1NWKA 1NGCA 4BR4A 4LC9B 1BOTO 5AQWA 4BR7A 4BG8A 2ASPA 3CJCA 5AQFA 5AQPA 5AQSA 3BEXA 3WT0A 1EQYA 4B1VA 1C0GA 4BC2A 1GLAG 4H5RA 2ASMA 4BRQA 4IO8A 2HF4A 1HLUA 2D4WA 3A5OC 2GELA 1XQSC 1HX1A 2E88A 2D1KA 4PKGA 3U9ZA 4CBWA 3QMLA 5AQQA 3ZETA 1DGKN 3VF4A 4BC5A 1MA9B 4CJ7A 4JHDA 3LDNA 4CI6A 1GLFO 1X9JA 5AQIA 3WEEB 2E2OA 3L4IA 1QZ5A 3FFKB 3HM8A 3CI5A 4MO4A 4EHUA 3UKRA 4DQ8A 5I9EB 1NLVA 4FWOA 1KAZA 2NZTA 4EIAA 2IVPA 1NGFA 3A8YA 1RDWX 3LDOA 3DWLA 3MMVA 1IG8A 3CJ1A 3CJBA 1T6DA 4BRHA 1Q18A 3D2FA 3MN9A 3J8AA 4EHTA 4FPBA 3GOIA 5AQLA 3SJHA 2A41A 3IUCA 5KPTA 2ZGZA 3H1QA 2VCPA 1U6ZA 2QM1A 4H0PA 3VEVA 1OKJA 4I6MA 5BREA 2A40A 4MLEA 1V4SA 1QQMA 1TUYA 3WQUA 4FWNA 1QQNA 3QFPA 3O80A 1GLEG 3A0IX 2QW9A 4H0TB 5AZIA 4RWTA 1HUXA 2P9LB 5F0XA 1MWMA 1X3MA 3UE5A 1XC3A 3VGLA 4JNEA 5AQVA 3VOVA 5BPMA 3H6EA 3FE1A 2BTFA 5KPRA 3QBXA 4EFHA 2GWJA 3GL1A 4CD3A 4QS7A 1NGEA 1KAYA 2IIRA 5JLHA 4XH5A 4BR2A 5BN8A 1GLLO 4CZLA 3FGUA 4IZ9A 5EXWA 3O08A 4CZFA 5F1XA 3FZHA 4WQ5C 4H0VB 4FL9A 3DXKA 4YDUC 2E2PA 1S22A 3MCPA 2HMPA 3FZKA 3IMXA 4B1UB 3O8MA 3U8XA 1XUPO 4RTFD 4IJAA 4GNIA 4BRCA 3OHRA 2P9PA 3QBWA 3ULEB 1BA0A 2P9UA 3O5BA 3KVGA 2HOEA 3U4LA 2P9KB 1V4TA 4CZKA 5JMVA 1KAXA 3CQXA 4O8KA 2EWSA 3SK3A 4BRLA 1Z05A 3WUHA 3FLCO 2YJEA 3DXMA 2QWMA 5EX5A 1ESVA 4BC3A 4BGBA 4DB3A 1U2VA 1WOQA 4BQZA 1ATNA 4H5VA 1BUPA 5E84A 3UKUB 2P9SB 1LOTB 4K25A 1S3XA 2YHWA 5AZJB 3TPQA 5BPNA 1RGIA 4PL7A 4BREA 4B1ZA 3VENA 5FPMA 4MO5A 3WXIA 4CZHA 3S41A 1ATRA 1TYQB 1GLDG 4H0XB 1ZC6A 2Q36A 4KBOA 2GEMA 2WUSA
chains in the Genus database with same CATH superfamily
1NGGA 3BGRA 3VQPA 1RDBA 3ZEUA 1JLGA 1ZXOA 2HHWA 4ELUA 3KZBA 1ZBUA 5KGWA 3EKUA 3LPUA 2WC9A 1QVFM 5SZTA 1NJXA 1VQ6N 1Q7YO 1TVRA 4A62A 4DR5K 4DS4A 1U47A 2QA4N 5JS1A 1TAUA 3E9OA 4BRKA 2YHAA 3NCIA 1NKBA 3D2EB 5AJ3K 3E01A 2P9IA 3CD6N 4KHUA 4CJSA 3KK2A 4JAXA 2F9WA 4A2AA 3CM5A 1SUQA 2UXBK 3VQ9A 1ZBFA 3C7NB 5DM7L 2YNGA 1BU6O 1RFQA 4EP5A 1K8KA 3P83D 1VSFA 3RSEB 4CHZA 3CCEN 2ZJQL 1TAQA 1I39A 3AO2A 3DYAA 1BO5O 1RTIA 1NKEA 4ELVA 5HP1A 1NK8A 3V1RA 4CZIA 5CHIA 4KHWA 2OCEA 4B08A 4Z0UA 4QS9A 4JKAA 4CGJA 4BRMA 4JK8A 3W0LA 3KLHA 1VQLN 2UUAK 3QEVA 5FPDA 4F4KA 1LCUA 2CH6A 3EN9A 4YOVA 3L6QA 3DLRA 2QWOA 1E4FT 1O13A 2E6MA 3CJAA 3AVAA 1H1VA 5KTQA 4IKFA 5AQRA 2XY8A 4FWKA 3QFUA 3ZSOA 4BVOA 1YVNA 3RR8A 1KVAA 1REVA 3QNOA 1RDUA 4LY7A 4CJ4A 4FLUA 3NVKA 2D0PA 1KLMA 1YT3A 4CEAA 4CERA 2UXDK 3P5JA 3BF3A 3DAWA 4B8CA 4U7BA 4B3TK 1MDUB 2FF6A 1RBSA 2VQFK 3CQ8A 1BWFO 1EX4A 1CZ9A 2UYTA 4YNQA 4HTUA 1NK4A 1C0FA 4DSIA 2HNYA 3ZX3A 2I7NA 2G8UA 3LDSA 1VQON 4FOIA 1T7PA 3VTHA 1P8ZA 3P1GA 5J2NA 1IBMK 3HPOA 4BDZA 3QLHA 4FLWA 3JXUA 3CYMA 3VETA 5I3UA 2P5OA 5AQNA 1BCOA 3F9MA 2QI2A 3DRSA 4FWPA 2FLOA 2KQ2A 3FFIA 2RKIA 4CJPA 1LW0A 2ZE2A 1SL2A 3C0BA 3VERA 4DSJA 1YTAA 4DTOA 3WXLA 4WE1A 3RWUA 1S6PA 1TKTA 2CGKA 4Y1DA 4CFAA 3SAGA 4Y0WA 3CG7A 1TK8A 5EOYA 4BRNA 3O1WA 3D7EO 3QB0A 2Q31A 3AAPA 3K59A 2X74A 3ULEA 4F9OA 4FM0A 2KFNA 2DFHA 1ASWA 3MWPA 1NKCA 5IT9O 5AFUA 4DTSA 4YOWA 3QEPA 3AA3A 4OX9K 2D0CA 2P9PB 3NAEA 1HKCA 4RW7A 4L3QA 5F2RA 4EP4A 3BF1A 1NGIA 4IOXA 5D3GA 3RRHA 2P9SA 4CEFA 2KKZA 3RMBA 1KVCA 3M1FA 2NRZA 1IKVA 4WYBA 3KD5E 1YXQA 4JN4A 4AHSA 3Q7CA 1RT2A 4DQSA 1SKWA 1N6QA 4FJLA 3V9UA 1C0UA 1SS6A 4KFBA 5KRSA 4E7JA 2NRRA 2CGLA 5AQTA 3K5MA 2YHBA 4PKIA 3NE6A 3RRGA 3B8AX 4IOAL 4JD2A 3NFAA 1I94K 3OYJA 4M3ZA 4AM7A 2Q0RA 3LPTA 1IKXA 5LMNK 5HROA 2HBLA 4HWIA 3OYBA 1RT4A 3QIOA 3M8RA 3U6FA 4AQYK 1ATSA 3ZEUB 1JXEA 3IDHA 2FXUA 4CK1A 3KJVA 3R1XA 5M1QA 3TAMA 4JKBA 1J54A 2IS3A 3DLGA 1TUUA 2PZSA 2E5LK 2V52B 1YJNN 2YKNA 5FROA 3NMUA 5FRMA 1HQUA 2HF3A 2Q1NA 4Q5VA 1XNQK 3MAQA 1E4GT 4O55A 3AA2A 2VGMA 1KC8O 2YI1A 4BC4A 2E6LA 1WSIA 2F96A 2P9IB 1TK0A 1QSYA 2DTUA 1QSSA 1SZ2A 3VA0A 2PYJA 1YHQN 2IVOA 3R3LA 4WQ5A 4DMNA 2PBDA 3OYFA 3AVJA 3PIPL 4ZTJA 2A42A 4J2BA 4FXDA 3VQDA 3DLEA 3QIPA 4JI5K 1K8KB 2W40A 3SI6A 5FDLA 1J9AA 3AARA 1QQCA 2DPNA 4FW1A 4EZ9A 3TANA 3E1YA 1N5YA 4CZMA 4B8AB 4BACA 2CGJA 3FZFA 4XEIA 1YIJN 1JXBA 5J2PA 4BR4A 3V9ZA 1BOTO 1KFDA 4BR7A 4BG8A 2ASPA 3CJCA 5AQSA 3WT0A 3DRPA 1KFSA 1KRPA 4PQUA 1CLQA 1GLAG 4IO8A 3PIOL 4GMJB 3A5OC 3HL8A 1WSJA 1XQSC 4R5PA 3CC7N 3CCUN 2E88A 2UUCK 4I9QA 3J80O 4CW7B 3ZETA 1JLQA 4OPHA 4BC5A 4LH5A 4HCCA 3LDNA 5AQIA 3HVTA 3L4IA 1VQ5N 2KZZA 1S1UA 3HM8A 4MO4A 4EHUA 4JK9A 4Z4FA 4DQ8A 4DUYK 2ETJA 1RT7A 3A8YA 3DWLA 1WNSA 3TSUA 1VSIA 2IC3A 3D2FA 2XY6A 3OYLA 2DFEA 4EHTA 1LV5A 3SQ1A 4IBNA 4YY3K 1E3MA 4I2QA 5KPTA 2VCPA 2QM1A 4IFYA 4MLEA 4LF8K 4FLTA 3D0PA 3O80A 1GLEG 3VTIA 1VSDA 5TKWA 3CPWM 5F0XA 3VA3A 1B92A 1X3MA 5BPMA 2YV0X 5AQVA 2ZD1A 1HNVA 2GWJA 3SCXA 2HBKA 1GLLO 2E4LA 2O8CA 4IZ9A 5EXWA 4LFCK 3O08A 2OTLN 4BE0A 4E7HA 3ZT1A 4CJLA 3HPHA 3HXMA 4E19A 4V19S 3DXKA 1TK5A 3AO5A 5CY4A 2A1RA 4WF9L 1NOZA 4DG1A 3IMXA 2P51A 3FZKA 4ZHRA 2Z1GA 4CGGA 1XUPO 4O0IA 4GNIA 3BZKA 3AA5X 4M45A 5I42A 4CJEA 3ULEB 1BA0A 3MEGA 4GKKK 2HOEA 4FVUA 4O44A 1LWEA 5JMVA 4CIGA 2HHQA 3CQXA 4RG8A 3FLCO 2QWMA 5EX5A 1ESVA 4BC3A 1U2VA 1WOQA 5C24A 3OS1A 4BQZA 1ATNA 3OYKA 4FLZA 4Z4CA 2P9SB 1LOTB 1HYZA 1UWBA 3TPQA 4E89A 3WNFA 4KTQA 3VENA 4C1NI 1KSPA 1WN7A 1IKYA 4CE9A 1RBRA 1VQPN 3L2UA 3PUFA 4BDPA 2GEMA 2E2PA 3TSQA 1NJIO 3SMPA 3M5RA 3H08A 4CJUA 1JCFA 4B1WB 2QKKA 4JD2B 3ZCMA 1K8AO 3OYHA 1HJOA 1NJYA 1Q86O 4BVPA 5BN9A 4BR0A 3RTVA 3AO3A 4RW9A 1OH8A 1NM1A 4CJWA 4PY5A 1LWFA 3VF6A 2KLAA 3ATVA 4DR1K 4BGAA 1HJRA 5EVZA 3EEQA 1YUWA 3KLIA 2AJQA 1VQ8N 3SUNA 1N33K 5KQ8A 3JSMA 4JS5A 1QHAA 4FJJA 5C2DA 3CFPA 1EXQA 1WBBA 2AA4A 3WXKA 3HT3A 5BR9A 3WQTA 4H5TA 1S6QA 3C94A 3HK2A 4CHYA 3OYMA 1Z6RA 1JL2A 3UKUA 4JKGA 3EO3A 3CM6A 4AM6A 2B5JA 2GTDA 4HTLA 4IO9L 4DSLA 1QTMA 3R8EA 1X3NA 1KCFA 2Z1IA 5DMRA 5GADP 3VESA 4KHPK 3F2KA 4KH5A 4B9NA 4KPYA 4J8FA 3BY5A 4FVMA 5BRHA 3O3GA 3HM9A 1U45A 2G8FA 4IFVA 2CH5A 3MXMA 2QWPA 3HRGA 4NLCA 4B1YB 3SUPA 3MX2A 2QK9A 3T7ZA 3AV9A 4DQRA 2V7ZA 4LF5K 3T3FA 1VSKA 2VYPA 2A6AA 1SKRA 2HMIA 4NXMK 2NRTA 5JVGL 2GBZA 4LSLA 1WSEA 3AAQA 4FJHA 3WEEA 2W6KA 3FZMA 4CF9A 3TU5A 3QEWA 1EO1A 3ZETB 3AO1A 1DLOA 2HBMA 4LF9K 2KW4A 4N76A 4A5AA 4ZTFA 3HYFA 1N8RO 3VPZA 4MFBA 4NCGA 3CERA 4M41A 3ZX2A 1ASVA 1BDGA 4IEEA 4M3WA 1EWQA 4JKHA 1TKZA 2RE2A 4XH1A 5H1SQ 1BQNA 3QDKA 3OJSA 3OBYA 3MEEA 3LP0A 4FJIA 3D2FB 4HUGA 2IVNA 3TSPA 3DLBA 5KPZA 3VGMA 2FSJA 3LDQA 2XY7A 1MWKA 1S9GA 5E26A 4B9QA 1VQ9N 2JLEA 4IOCL 4BRGA 5FPEA 2ATQA 3AA4A 3V81A 3K2PA 3T69A 1J6ZA 2BH1A 1ZBLA 3HP6A 4Q0BA 1W97L 5CYQA 4C1NK 2I7PA 1TL1A 3VEWA 3WXJA 3V9SA 3AVLA 2R7YA 3ENHA 1XI1A 2Q97A 2KHOA 3MN5A 3AVMA 5DM6L 2O8CB 2FBTA 4JI8K 4QAGA 3PX4A 4DTXA 2FBYA 5BRFA 4DLEA 4OVLA 5GAEP 3LL3A 3DXKB 2P9KA 3O9SA 3L2VA 2VGNA 4FJKA 3KIOA 3M8PA 5KI6A 2HHSA 3CJ7A 3VMFB 2OANA 3ZSVA 2BDPA 4B1XB 1T6CA 5AZJA 3OYGA 3QICA 5C2FA 4CVNE 4M42A 4YOUA 3LALA 4CHPA 1EWRA 1U2VB 5M1OA 3IS9A 4W5TA 3PX0A 3TABA 1J5EK 2OPQA 1X9WA 4A2BA 1OH7A 4NCBA 4DFMA 4EAHD 2RN2A 2HHVA 1RDAA 3ZT0A 3MK6A 5AQHA 3VF2A 4NO7A 4TSXA 2ZF5O 4H03B 1NMDA 3FZLA 4IG0A 4G9ZA 1NK7A 4CEQA 4BR5A 4DCHA 1QQOA 2YHXA 3RVCA 2ZQBA 4LFAK 4ISFA 3V1QA 4KHQA 4HCBA 1NG9A 1IG9A 1RT5A 1FKOA 4IXCA 4XH4A 4CZEA 4GW6A 5JLFA 4ID5A 1A5WA 4FK4A 2NRXA 3TTDA 5C25A 4HHTA 2HB5A 1SAZA 4EZ6A 1Y64A 1VRTA 1GOBA 3K5OA 3C6TA 4Z94A 3SQ4A 4DTPA 4GV9A 1BISA 2E2QA 4FM2A 3O9QA 2IDOA 2NNWA 4FZXC 4DR6K 5AQKA 3PV8A 3CETA 1TV6A 3LM9A 1IJJA 5LL6Z 1VSJA 4HUEA 3SAHA 4FJXA 4CK3A 4JKGB 2JWLA 4BQLA 1A5VA 4B9VA 2ZM6K 3NH1A 3NF6A 4B3OA 4AHRA 1HPMA 2PAVA 5HOOA 4E7KA 4KHSA 2P1JA 3DOLA 3MX5A 3G10A 1BIZA 2PYLA 3K9KA 1NWKA 4LC9B 1T8EA 5AQPA 3ZYYX 3HO1A 2PFUA 3E9LA 4H5RA 3VQAA 4BRQA 1L3UA 2HF4A 2D4WA 1TL3A 3P39A 3TTCA 4OGEA 3QMLA 5AQQA 1M1KO 3VF4A 2EHGA 2OZSA 1LW2A 4CJ7A 4JHDA 4CI6A 1GLFO 2RHKA 3WEEB 3KLEA 1L3TA 4O8UA 3UKRA 5I9EB 1NLVA 4FM1A 2IVPA 4E7IA 3LDOA 1C6VA 1YVUA 1X9SA 1RDDA 5HRPA 4FCYA 1BCMA 3OYDA 4DSEA 1U04A 3MXJA 4ILGB 3SZ2A 3AGKA 5J2QA 3NH2A 1DT9A 4JI6K 3L4QA 1TKXA 3DLLL 1UOCA 4JRQA 1YI2N 4BWJA 1VSMA 1KTQA 3OA9A 5GIOA 3ID6A 2Z1HA 4B3SK 1S72N 3PO4A 4I6MA 5BREA 4DKWA 3SPZA 1V4SA 4BE2A 4FW2A 3WQUA 4F8RA 4B9SA 3QFPA 3NF8A 3A0IX 4CJQA 4CJKA 3THVA 2F7TA 2WBNA 1MWMA 1Q9XA 3N4PA 3H6EA 4IDHA 2BTFA 5KPRA 4DV5K 2OPRA 3GL1A 4CD3A 3ENBA 4QS7A 1KAYA 4XH5A 2I5JA 4DFPA 3B6OA 4W5RA 1OH5A 1QS4A 4WQ5C 3LP3A 1XHZA 3AVFA 1Z25A 3JAMO 3D45A 2UU9K 2RPIA 1HR0K 1IKWA 1BL3A 1S22A 3VQCA 3MCPA 4B1UB 3DM2A 5CZ1A 5MLCQ 3OS2A 4AHTA 3PX6A 3S3OA 1L5UA 3ZSXA 3CPEA 4OPKA 3LP1A 1OVQA 1NK6A 3O5BA 4JI3K 2P9KB 3SNNA 4NLBA 1V4TA 4DQPA 4KTWA 4UQGA 4CZKA 3NBPA 1KAXA 1W7AA 2XO7A 2EWSA 1NMNA 1N34K 2YJEA 3L2WA 1S1VA 2O8BA 3OVNA 4H5VA 1BUPA 1W0HA 4DQQA 2X6NA 1S3XA 5AZJB 3NF7A 3SPYA 1RGIA 4JI2K 5C42A 3HOTA 3VQEA 4BE1A 5FPMA 4CZHA 4U67L 3VQ5A 3MEDA 1ZC6A 4JI0K 4KBOA 2JGUA 2WUSA 5E41A 3ENOA 1BA1A 3PSIA 4IDKA 1QSLA 3IFRA 3QINA 5HLFA 2W41A 1UA0A 3CHWA 4DTJA 4DV1K 3HP9A 3C6HA 1WBDA 5BRDA 5AQJA 2A5XA 1LAWA 4QOZB 3CC2N 4PWDA 4CZJA 4H8KA 4ELTA 4WQ4A 4DV6K 1SV5A 4CK2A 4CJ5A 3LDPA 1CZAN 1NBWA 2O8FA 1KVBA 4H0OA 1B9DA 4BROA 3EZWA 4E0DA 2BUPA 5TKYA 1QZ6A 2A3ZA 1WB9A 1VQMN 4JI7K 3ID8A 3CXCM 4DV2K 3HOSA 4FK2A 3UB5A 4ISGA 5HL7L 1JCGA 2VG6A 3I33A 4CEEA 2E2NA 3LAMA 3RR7A 4C8OA 5AQMA 1YTUA 1DKGD 1RT6A 4J2AA 3LANA 1P90A 1Z26A 3ZSWA 3TI0A 2VG7A 4N56A 5IWAK 2Q2RA 2XHBA 4GY2B 1M90O 3LWMA 1WSGA 1K73O 4LD0A 2QWNA 4PUOA 3SQ2A 1VSHA 5M1PA 4CJ3A 1IBLK 4BY9C 3ZSYA 4I2PA 5GAGP 1HKGA 4YORA 2GUPA 3CF5L 1G99A 1ILYA 3M6GA 3O4WA 4MQ3A 3VEXA 4DF8A 3QERA 3OYNA 4B3MK 1JLEA 2ITGA 1I3AA 2QKBA 3D6RA 3ULDA 4DV3K 2G8WA 1ASUA 2OYQA 3I8DA 3CCQN 4DV0K 4JRPA 2F8TA 5C15A 5SWMA 4DFJA 3CQYA 2RF2A 1BG3A 4FZYA 4JYAK 2HHXA 3TWHA 1NK5A 2O8DA 4C8NA 4C8MA 3VQBA 1UA1A 4YFUA 1T05A 5FLXO 4OLBA 3P4IA 3A5MC 3MXIA 4O5BA 3FR0A 3EY1A 2Y1JA 1HNZK 4F2SA 1GOCA 4JHDB 4CGFA 3ALYA 2E20A 3VEOA 2WFBA 4DU4A 2YNIA 4GV6A 3C7NA 4KI6A 3CJ9A 3QEXA 1N36K 4JI4K 3RSEA 3O3HA 4DLGA 5KQDA 1R59O 4BRFA 3QEIA 3HVRA 4B3RK 4G1QA 3THYA 3LDLA 3ZT3A 5T7BA 3CFOA 4RW4A 3O6WA 1XHXA 3ATUA 3SUQA 1IH7A 1CXUA 4E7LA 2P9LA 3K0SA 4I6MB 1VRUA 2YJFA 4PKHA 3LM2A 1U4BA 4YOTA 2Q0UA 3JS6A 4XIUA 3OS0A 1D9FA 3A5LC 4NCAA 4DQIA 4CEOA 4FLVA 3SMSA 3GG4A 4RW8A 5LJWA 4DU3A 4CEBA 4CHNA 1JKHA 4CGIA 5GINA 5GIPA 4GV3A 2B6AA 4R79A 4AHUA 5JVHL 3KWGA 3SQ0A 4FZZA 1D8YA 3KLFA 3SBTA 4LF4K 1NGHA 3THWA 5KGXA 4BRPA 1B9FA 3HSTB 3L2RA 4H4MA 1Q81O 4WFNL 2HVHA 3J81O 3GDQA 1YJ9N 4PL8A 3NHGA 4FSVA 2O8BB 4OGCA 1TYQA 3HI0A 2QXLA 4ILHA 3OYEA 2OZMA 1O1WA 3HTVA 4CJFA 4FJ5A 1YAGA 4CF1A 1DEJA 3I8BA 1FXXA 1WSFA 4KKOA 1ZBSA 2ZWHA 4ID1A 5KRTA 2BE2A 4UY8O 2PY5A 4KH6A 4W5OA 3DI6A 4E3SA 4M3RA 3OW2M 4KTZA 1RT1A 3AVBA 4OKKA 3J7AP 4K41A 2QWQA 1QHTA 1CZBA 4KV8A 3EL2A 3A5NC 3Q7BA 1SL0A 4CIFA 4CD1A 5BR8K 3WNEA 1OVYA 2O4IA 3LP2A 2P9NA 1K9MO 4CCHA 1DTQA 4WFAL 3OTOK 3LWLA 4CBUA 5JICA 3T1HK 2O8FB 2G8KA 3H3OB 3QESA 3H45C 3KKSA 3IG1A 4LF6K 4A5BA 1T44A 3OYIA 4JKDA 2E1ZA 2IOCA 3DJCA 4AHVA 3DLHA 3AVIA 3MDQA 2QEXN 3HJFA 1D9DA 3GBTA 4O4GA 1JL1A 1WLJA 3SLCA 4JS4A 3K5NA 2V7YA 3H46O 4YDUA 2V51B 3TR8A 1HYSA 3G6EN 4B9TA 4BRAA 4K8XA 3R9PA 2NRHA 2J4RA 4CECA 2UXCK 3M8SA 3ITHA 3QO9A 4OKJA 4C8LA 3AVCA 3F73A 1U49A 3HPGA 2OA8A 3KKRA 3G25A 1FK9A 4M3UA 2QWLA 2W42A 3VEYA 1RTDA 3F9KA 4FJNA 3O9UA 4FJ8A 2BGGA 1HMVA 5AQWA 1GOAA 2GX9A 3SAFA 2KFZA 4B1VA 3IKMA 4BC2A 3MECA 4Z4HA 4KRFA 3NGYA 1S9EA 1J5OA 1HLUA 3NGIA 1XNRK 1KD1O 3CCMN 3SV3A 4JI1K 1RCHA 4PKGA 4CBWA 1HNXK 2O8DB 3P38A 2HNZA 1JLAA 2A1SA 4AHCA 2WONA 2KZMA 1QZ5A 4X62K 4EIAA 1KLNA 3ZLJA 1Y97A 3MMVA 2D0AA 3F5TA 1IG8A 1IBKK 2KTQA 3ISNC 4CFCA 3V4IA 1T6DA 4N47A 2HHUA 1Q9YA 1TKDA 3U3GA 4FPBA 4M3YA 2D0BA 3SJHA 3THYB 1EKEA 2A41A 2FBXA 2X6SA 4CEDA 3C6AA 4MDAA 3TTFA 3K58A 4H0PA 3CCLN 4N5SA 2A40A 3SJJA 1QQMA 1RDCA 1QQNA 3SBGA 4KREA 1G15A 2IGIA 2VWJA 1RNHA 2VG5A 5AZIA 4RWTA 2DY4A 2P9LB 1D5AA 3UE5A 5HRRA 4J2DA 1L3SA 4BR2A 5BN8A 1NJWA 3DMJA 4DWIA 4WCEL 5F1XA 3ZT2A 3OJUA 2UUBK 4JKFA 4FL9A 1CXQA 4A59A 1R0AA 1TGOA 4O0JA 4W5NA 2HMPA 3NVMA 3O8MA 4RTFD 4BRCA 3I55N 3OHRA 4FLYA 3QBWA 2NRVA 2P9UA 3EE8A 4I9LA 3U3YA 3LAKA 3OY9A 3ZSQA 2WOMA 2GUIA 1ZYQA 4BRLA 1Z05A 3WUHA 3DXMA 3THWB 4LSNA 1NJZA 5E84A 3UKUB 4F3OA 5J2MA 2YHWA 5BPNA 3G71N 1HQEA 4PL7A 4BREA 4B1ZA 3C6UA 5GAHP 4IG3A 3DLKA 4MO5A 3WXIA 1X9MA 1EP4A 5C12A 1ATRA 4DFKA 1TYQB 4K0KK 1GLDG 4PHTX 3CCJN 3TARA 3PLAA 2FC0A 2Z1JA 3L3UA 4KHNA 2O8EA 4QCLA 4DV4K 3O3FA 3CMEN 3V1OA 1FW6A 1XC9A 2HNDA 4M7YA 3EZ5A 1SQKA 4O5FA 3H3NO 1NK9A 3O4NA 3R6MA 4KH4A 4IEIA 1DTTA 3SUOA 4OJRA 2NRWA 1EETA 2HBJA 4B9UA 5AQXA 5DK5A 4KHYA 5AR0A 2P9NB 2E8AA 1NGBA 4DTUA 4HVJA 3CCSN 1YJWN 5HBMA 2IAJA 1S5JA 3JYTA 5M1KA 1T3VA 3AVNA 4CJTA 4QS8A 1NGAA 1VK0A 4CHOA 2DFFA 1YITN 4LF7K 1Q8IA 3E66A 3W3DA 3AGRA 5BPLA 3KWIA 3RMDA 1NOYA 3AY9A 4H5NA 1JCEA 1C1AA 3G4SN 3P31A 3I56N 5HRSA 2FBVA 3VQ7A 1BIUA 4X64K 1GLCG 4FO0A 4PA1A 3KLGA 3O4QA 3C65A 2ASOA 1C1CA 2ITMA 5LJVA 2ZJRL 4E1JA 3NDKA 2O4GA 4JV5K 5AQYA 3HBTA 4DTRA 3K57A 4DTNA 4FLXA 1GLBG 2WTUA 4FOEA 4BR9A 4FJGA 1GLJO 4DR2K 2FF3B 5AFUH 1QVGM 2P5GA 5B8HA 2AP1A 1HYVA 3RMCA 4W5QA 3AO4A 5EU7A 4YHHK 4NYNA 5AQGA 1NK0A 2G8VA 1RBUA 1RILA 1S1XA 2YKMA 1HPZA 4X65K 2YHYA 3AVKA 1HNIA 1NNEA 5AQZA 1OH6A 3B6PA 2YCHA 2LSNA 3WNHA 3VEZA 5FRNA 2B4JA 3AVGA 4F3TA 3M8QA 1BQMA 1F21A 2FSKA 1FJGK 1VQNN 4DHYA 1BI4A 4JLHA 3TAGA 1WAJA 3BP8A 4CZGA 2HVIA 5ELZA 5AQUA 5CR4A 4CBXA 4Y1CA 2H3GX 4FWMA 1C0MA 4J2EA 3M3ZA 2NLXA 4JKEA 4WQ4C 3CC4N 3EE9A 2D0OA 4C23A 3GE1A 1U48A 1ZBIA 3KTQA 2QXFA 4KAZA 3UIQA 1WUAA 3BZCA 4BDYA 4BRDA 4M7XA 4HUFA 4B9MA 4F2RA 4IWVA 2Y1IA 2GV9A 3VQQA 3MN6A 1JLFA 1LAVA 1KQSM 5AZIB 3L8BA 2NUBA 3L0QA 4OPAA 3THXA 3OYCA 4IFEA 3CCRN 3ZSRA 3PO5A 4FWLA 4K43A 3U9DA 4KB1A 2F9TA 1IV0A 3ZX0A 4CJRA 1BHLA 1N32K 5ADXA 3AVHA 2D5RA 2Q3SA 1XMQK 3V9XA 4NB4A 1XMOK 5M1FA 4M63C 4CEZA 3O1BA 1HKBA 3HSCA 1ITGA 1NU0A 3CFRA 3DOKA 4H5WA 5CYMA 2F8SA 1W2BM 2OPPA 1KXPA 2HW3A 4CGDA 1NGDA 2P9UB 5AQOA 3CIPA 5M1NA 2VWBA 1VQ4N 5FPNA 3OBWA 1K6YA 2QWRA 4K42A 2BANA 2HSTA 1SL1A 4BRIA 3SYZA 3DXMB 4FPAA 4RW6A 5ADXH 3MN7A 3O9RA 3KK1A 4OO1J 2W6LA 4E1NA 5EY4A 4BG9A 4DUZK 4GKJK 4JEPA 4FWRA 3VQ4A 2G8IA 1C1BA 4KI4A 5J1EA 5CE3A 4H4OA 4ISEA 3PSFA 3WXMB 3KK3A 5CZ2A 2O8EB 4A61A 3ASMA 4DV7K 4JKCA 4IJNA 1VSLA 3MWTA 4GVMA 4B9LA 5C10A 4LH4A 5K14A 4CGHA 3T1AA 3NH0A 5LY3A 2XRIA 4BWMA 1T03A 4E1MA 3D2EA 1FKPA 1NGJA 4FWSA 4CF2A 3T1YK 2FSNA 2E1YA 4C8KA 1WSHA 4FJ7A 4YOXA 3MCAB 3VGKA 2EX3A 3UKRB 1WAFA 3HZ6A 3A2FA 4RCHA 3H1VX 3K9JA 1X1PA 4MLHA 2GWKA 4WFBL 4ICLA 3EKSA 3I0RA 4M3XA 3DRRA 2JWKA 1JLCA 1SKSA 1D4XA 3VQ8A 2G8HA 4FWQA 4H0YB 2ZGYA 3V9WA 5A2QO 4OLAA 4N41A 3BUZB 4CFBA 3KK7A 3KHYA 3S3MA 3QETA 4YOYA 3TAFA 3I0SA 1NGCA 2HHTA 3K5LA 3J7YP 1HNWK 5AQFA 3BEXA 4ILJA 1EQYA 1C0GA 4CESA 1UAXA 3VN5A 3C95A 2ASMA 3TAPA 3IAYA 1VSEA 2GELA 4CF0A 2ZJPL 1JJ2M 4M3TA 3TAQA 1HX1A 1BGXT 2D1KA 3U9ZA 4DSFA 1DGKN 2X78A 4CJVA 2YX6A 4CF8A 1XWLA 4OPJA 3TAEA 4DS5A 3V6DA 1QE1A 1X9JA 3RMAA 2E2OA 4DSKA 3QNNA 4FJMA 3FFKB 1LWCA 3CI5A 4DTMA 1IO2A 4FWOA 1KAZA 2NZTA 1NGFA 2XY5A 1RDWX 4DF4A 4GVEA 5LMUK 1ZBHA 5C0YA 4Z4IA 4DR4K 1MU2A 3CJ1A 1S1TA 3CJBA 1BI4B 4BRHA 1Q18A 4L8RB 4I7FA 3MN9A 2VWKA 4CHQA 3J8AA 4FJ9A 3GOIA 4K8ZA 5AQLA 1YF5L 3EYZA 3CCVN 1VHXA 3IUCA 2ZGZA 4OKEA 3ZT4A 3BDPA 2OTJN 3H1QA 3KD1E 1U6ZA 3VEVA 3L3VA 1OKJA 3N4QA 3SV4A 1VQ7N 1Q82O 3S9HA 1TUYA 4FWNA 1C0TA 3IRXA 2QW9A 4H0TB 2YNHA 3LZJA 1HUXA 1W9HA 1XC3A 3VGLA 4JNEA 3VOVA 3CMAN 3FE1A 3S3NA 3QBXA 4EFHA 1S1WA 1NGEA 2IIRA 3NF9A 5JLHA 4CZLA 3FGUA 3OYAA 4KO0A 3THXB 4CZFA 3FZHA 1JLBA 1A5XA 3E9PA 4H0VB 2F4VK 1RTJA 2YNFA 1RTHA 4YDUC 4FYDA 1RBTA 3ZSZA 4MDBA 3LZIA 3U8XA 4AH9A 4IJAA 2VQEK 4JK7A 2P9PA 3L2QA 4NYFA 1J53A 3KVGA 3U4LA 5JS2A 1HRHA 4FK0A 1VQKN 1RT3A 4CIEA 3PY8A 4Z4EA 4O8KA 2OPSA 2HHHK 2QTDA 3SK3A 4NXNK 3J7ZO 4CFDA 4DB3A 1L3VA 4BGBA 4DU1A 3WNGA 3O9TA 1RBVA 4DR3K 3T19A 4DR7K 4AILC 5HRNA 4AF1A 4K25A 3NGZA 4LFBK 4X66K 4KB0A 3S41A 4Z4GA 3VQ6A 4H0XB 2Q36A 3G0ZA 4A57A 1MA9B 1VAZA
chains in the Genus database with same CATH topology
3SMPA 3M5RA 3ENOA 1BA1A 3CMEN 1NGGA 1JCFA 3IFRA 1SQKA 2W41A 4M7YA 3CHWA 4O5FA 4B1WB 3H3NO 4JD2B 3ZEUA 1K8AO 3R6MA 3C6HA 1ZXOA 4KH4A 4IEIA 5BRDA 1HJOA 2A5XA 5AQJA 3KZBA 3CC2N 3EKUA 4CZJA 1Q86O 4BVPA 4WQ4A 2WC9A 5BN9A 4BR0A 1QVFM 1VQ6N 1NM1A 1CZAN 3LDPA 1Q7YO 2NRWA 1NBWA 2HBJA 4H0OA 4A62A 5AQXA 2QA4N 5AR0A 2P9NB 2E8AA 3E9OA 3VF6A 3EZWA 4BROA 4BRKA 2BUPA 2KLAA 1NGBA 3ATVA 3D2EB 5TKYA 1QZ6A 4BGAA 2A3ZA 1VQMN 3ID8A 3CCSN 2P9IA 5EVZA 3CXCM 1YUWA 1YJWN 3CD6N 1VQ8N 3HOSA 4JAXA 5M1KA 1T3VA 4QS8A 1NGAA 2F9WA 4A2AA 5KQ8A 1YITN 1QHAA 3UB5A 5C2DA 4ISGA 3C7NB 3E66A 5DM7L 2AA4A 5HL7L 1JCGA 1BU6O 3W3DA 1RFQA 3AGRA 3KWIA 3WXKA 5BPLA 1K8KA 3AY9A 3I33A 2E2NA 4H5NA 3WQTA 1JCEA 5BR9A 3RSEB 4H5TA 5AQMA 1DKGD 3CCEN 2ZJQL 3G4SN 3P31A 3I56N 1P90A 1Z6RA 1BO5O 1GLCG 2Q2RA 4FO0A 3UKUA 4GY2B 4JKGA 3EO3A 1M90O 3C65A 1K73O 4AM6A 2ASOA 2QWNA 2ITMA 2GTDA 5LJVA 4HTLA 2ZJRL 4IO9L 4E1JA 5M1PA 3R8EA 4CZIA 5CHIA 1X3NA 4QS9A 4JKAA 5AQYA 3HBTA 4BRMA 4BY9C 4JK8A 3W0LA 5GAGP 5GADP 1VQLN 1HKGA 4YORA 2GUPA 3VESA 1G99A 3F2KA 4KH5A 3CF5L 1ILYA 3M6GA 3O4WA 4J8FA 3VEXA 5FPDA 1GLBG 1LCUA 5BRHA 2CH6A 3EN9A 4FOEA 4BR9A 4YOVA 1GLJO 3L6QA 2CH5A 3D6RA 2FF3B 5AFUH 1QVGM 5B8HA 2QWPA 3HRGA 4NLCA 2AP1A 4B1YB 2QWOA 1E4FT 3MX2A 1O13A 3CCQN 3CJAA 3T7ZA 1H1VA 2V7ZA 5AQGA 5AQRA 5C15A 3CQYA 1BG3A 4FWKA 3QFUA 4BVOA 1YVNA 2VYPA 2A6AA 1RDUA 3NVKA 2D0PA 2NRTA 5JVGL 2YHYA 3BF3A 3DAWA 3AAQA 5AQZA 3WEEA 3FZMA 4U7BA 3P4IA 1MDUB 2FF6A 3TU5A 3A5MC 2YCHA 3VEZA 1EO1A 3ZETB 3FR0A 1BWFO 2HBMA 4A5AA 4JHDB 2FSKA 1N8RO 2UYTA 3VPZA 2E20A 3VEOA 2WFBA 1C0FA 1VQNN 3CERA 3ZX3A 4GV6A 3C7NA 4DHYA 2I7NA 3ZX2A 3CJ9A 1BDGA 4IEEA 1VQON 3BP8A 4CZGA 4FOIA 4JKHA 5ELZA 3RSEA 1NJIO 5AQUA 2RE2A 1P8ZA 4XH1A 5CR4A 3VTHA 1R59O 4CBXA 5KQDA 5H1SQ 4BRFA 2H3GX 4FWMA 3LDLA 3QDKA 3JXUA 3M3ZA 3OBYA 2NLXA 3VETA 3D2FB 4JKEA 5AQNA 2IVNA 3TSPA 3F9MA 3O6WA 2QI2A 4WQ4C 3CC4N 3EE9A 3ATUA 2D0OA 3GE1A 3VGMA 2FSJA 3LDQA 4FWPA 1MWKA 4C23A 5KPZA 5E26A 2FLOA 1WUAA 4BRDA 4M7XA 2P9LA 4B9QA 1VQ9N 4IOCL 4IWVA 4BRGA 5FPEA 4I6MB 2YJFA 4PKHA 1J6ZA 3LM2A 3T69A 3C0BA 3MN6A 4YOTA 3VERA 2Q0UA 3JS6A 2BH1A 1KQSM 5AZIB 1W97L 4C1NK 2I7PA 3A5LC 3VEWA 3L0QA 3WXLA 4OPAA 3WXJA 3SMSA 3GG4A 3ENHA 4IFEA 2Q97A 3CCRN 4FWLA 2KHOA 4K43A 3U9DA 5LJWA 2CGKA 3SAGA 2F9TA 4Y0WA 3MN5A 3ZX0A 5DM6L 5EOYA 4BRNA 3O1WA 3D7EO 3QB0A 5ADXA 2Q31A 3AAPA 5BRFA 5GINA 4NB4A 5GIPA 5M1FA 4GV3A 3ULEA 5GAEP 4F9OA 3LL3A 3DXKB 4M63C 4R79A 3O1BA 3MWPA 2P9KA 3O9SA 1HKBA 5JVHL 3HSCA 3KWGA 2VGNA 4H5WA 5AFUA 4YOWA 1W2BM 3SBTA 1KXPA 1NGHA 1NGDA 2P9PB 3CJ7A 1HKCA 5F2RA 4L3QA 2P9UB 3VMFB 5AQOA 3BF1A 3CIPA 5M1NA 4BRPA 2VWBA 1NGIA 2OANA 1Q81O 1VQ4N 4IOXA 5FPNA 4WFNL 3OBWA 2QWRA 2P9SA 4B1XB 1T6CA 4K42A 3GDQA 5AZJA 2HSTA 3QICA 5C2FA 1YJ9N 4BRIA 2KKZA 4YOUA 3DXMB 4PL8A 4FSVA 1U2VB 3M1FA 2NRZA 4FPAA 4WYBA 5M1OA 1YXQA 3MN7A 3O9RA 3Q7CA 4JN4A 5ADXH 1TYQA 4OO1J 3HI0A 2QXLA 4ILHA 1SS6A 5EY4A 4BG9A 2NRRA 2CGLA 5AQTA 4JEPA 3HTVA 4FWRA 4A2BA 4PKIA 1YAGA 4EAHD 1DEJA 3I8BA 3MK6A 5AQHA 3VF2A 4NO7A 3B8AX 5CE3A 4IOAL 1ZBSA 2ZWHA 2ZF5O 4H03B 1NMDA 4ISEA 4JD2A 4UY8O 4KH6A 3FZLA 4G9ZA 3WXMB 4BR5A 4AM7A 2Q0RA 3OW2M 4DCHA 1QQOA 2YHXA 4A61A 4JKCA 3RVCA 4K41A 2HBLA 4HWIA 4IJNA 2QWQA 4ISFA 1ATSA 3EL2A 3A5NC 3MWTA 3Q7BA 3ZEUB 3IDHA 5C10A 4CD1A 2FXUA 1OVYA 3R1XA 5M1QA 4IXCA 4XH4A 4CZEA 5JLFA 2P9NA 4JKBA 5LY3A 1TUUA 1K9MO 2V52B 3D2EA 4WFAL 1YJNN 2NRXA 3TTDA 1NGJA 4FWSA 4CBUA 3NMUA 2FSNA 5JICA 2HF3A 1SAZA 2E1YA 2Q1NA 1E4GT 3H3OB 3H45C 1Y64A 2VGMA 4YOXA 1KC8O 4A5BA 1T44A 3MCAB 3VGKA 2YI1A 4Z94A 4BC4A 3UKRB 4JKDA 2E1ZA 2P9IB 3DJCA 1SZ2A 3HZ6A 3MDQA 1YHQN 2QEXN 2IVOA 4RCHA 3R3LA 3GBTA 4GV9A 4WQ5A 2PBDA 2E2QA 3H1VX 3PIPL 3K9JA 2A42A 4MLHA 3SLCA 3O9QA 2NNWA 2V7YA 2GWKA 1K8KB 3H46O 4YDUA 5AQKA 2V51B 2W40A 3CETA 4WFBL 3G6EN 3AARA 2DPNA 3LM9A 1IJJA 3EKSA 4BRAA 3R9PA 3SAHA 2NRHA 2J4RA 3E1YA 2JWKA 4JKGB 2JWLA 1D4XA 4CZMA 4BQLA 2CGJA 4FWQA 2ZGYA 4H0YB 3FZFA 1HPMA 2PAVA 3BUZB 5HOOA 3G25A 3KK7A 4XEIA 3MX5A 1YIJN 3KHYA 2QWLA 3VEYA 3K9KA 4YOYA 3O9UA 1NWKA 1NGCA 4BR4A 4LC9B 1BOTO 5AQWA 4BR7A 2GX9A 4BG8A 2ASPA 3CJCA 3SAFA 5AQFA 5AQPA 5AQSA 3BEXA 4ILJA 1EQYA 3WT0A 1C0GA 2PFUA 3E9LA 3IKMA 3ZYYX 4B1VA 4BC2A 1GLAG 4H5RA 2ASMA 4BRQA 4IO8A 3PIOL 2HF4A 1HLUA 2D4WA 3A5OC 2GELA 2ZJPL 1XQSC 1KD1O 1JJ2M 3CC7N 3P39A 3CCUN 3CCMN 1HX1A 2E88A 3TTCA 2D1KA 4PKGA 3U9ZA 4CBWA 3QMLA 5AQQA 3ZETA 1M1KO 4OPHA 1DGKN 3VF4A 4BC5A 2YX6A 1MA9B 3P38A 4CJ7A 4JHDA 3LDNA 4CI6A 1GLFO 1X9JA 2RHKA 5AQIA 3WEEB 2E2OA 3L4IA 1VQ5N 4O8UA 1QZ5A 3FFKB 3HM8A 3CI5A 4MO4A 4EHUA 4JK9A 3UKRA 4DQ8A 5I9EB 1NLVA 4FWOA 1KAZA 2NZTA 4EIAA 2IVPA 1NGFA 3A8YA 1RDWX 3LDOA 3DWLA 3MMVA 4GVEA 5C0YA 3F5TA 1IG8A 3CJ1A 3TSUA 3CJBA 1T6DA 4BRHA 1Q18A 3D2FA 4ILGB 3MN9A 3AGKA 1DT9A 3J8AA 4EHTA 4FPBA 3GOIA 3L4QA 3DLLL 5AQLA 3SJHA 1YF5L 3CCVN 1YI2N 2A41A 3IUCA 5KPTA 2ZGZA 3OA9A 2OTJN 3C6AA 3ID6A 3H1QA 2VCPA 4MDAA 1U6ZA 2QM1A 4H0PA 3N4QA 1OKJA 3TTFA 4I6MA 3VEVA 5BREA 1S72N 2A40A 4DKWA 1VQ7N 3CCLN 1Q82O 4MLEA 1V4SA 1QQMA 1TUYA 3WQUA 4FWNA 1QQNA 3QFPA 3O80A 1GLEG 3A0IX 3SBGA 2QW9A 4H0TB 5AZIA 3VTIA 4RWTA 1HUXA 2F7TA 5TKWA 3CPWM 2P9LB 5F0XA 2WBNA 1MWMA 1X3MA 3UE5A 1XC3A 3VGLA 4JNEA 5AQVA 3VOVA 5BPMA 3CMAN 3N4PA 3H6EA 4IDHA 3FE1A 2BTFA 5KPRA 3QBXA 4EFHA 2GWJA 3GL1A 4CD3A 3ENBA 4QS7A 2HBKA 1NGEA 1KAYA 2IIRA 5JLHA 4XH5A 4BR2A 5BN8A 1GLLO 4CZLA 3FGUA 4IZ9A 5EXWA 3O08A 4CZFA 2OTLN 4WCEL 5F1XA 3FZHA 4WQ5C 3E9PA 4H0VB 4JKFA 4FL9A 4A59A 3DXKA 4YDUC 2E2PA 1S22A 4WF9L 3MCPA 2HMPA 3FZKA 3IMXA 4B1UB 3NVMA 5MLCQ 4MDBA 3O8MA 3U8XA 1XUPO 4RTFD 4IJAA 4GNIA 3CPEA 4JK7A 4BRCA 3I55N 3OHRA 2P9PA 3QBWA 2NRVA 1BA0A 2P9UA 3EE8A 3O5BA 3KVGA 3ULEB 2HOEA 3U4LA 2P9KB 4NLBA 4FVUA 1V4TA 1VQKN 4CZKA 5JMVA 1KAXA 3CQXA 4O8KA 2EWSA 2QTDA 3SK3A 4BRLA 1Z05A 3WUHA 3J7ZO 3FLCO 2YJEA 3DXMA 2QWMA 5EX5A 1ESVA 4BC3A 4BGBA 4DB3A 1U2VA 1WOQA 4BQZA 1ATNA 4H5VA 1BUPA 5E84A 3O9TA 3UKUB 2P9SB 1LOTB 4AF1A 4K25A 1S3XA 2YHWA 5AZJB 3TPQA 5BPNA 3G71N 1RGIA 4PL7A 4BREA 4B1ZA 3VENA 4C1NI 5GAHP 3HOTA 5FPMA 4MO5A 3WXIA 4CZHA 3S41A 1ATRA 4U67L 5C12A 5GIOA 1TYQB 1GLDG 4PHTX 1VQPN 3CCJN 4H0XB 1ZC6A 2Q36A 3PLAA 4KBOA 4A57A 2GEMA 1VAZA 2WUSA 3TSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SMP A;  3ENO A;  1BA1 A;  1NGG A;  1JCF A;  3IFR A;  1SQK A;  2W41 A;  4M7Y A;  3CHW A;  4O5F A;  4B1W B;  3H3N O;  4JD2 B;  3ZEU A;  3R6M A;  1ZXO A;  5BRD A;  1HJO A;  2A5X A;  5AQJ A;  3KZB A;  3EKU A;  4CZJ A;  4BVP A;  4WQ4 A;  5BN9 A;  4BR0 A;  1NM1 A;  1CZA N;  3LDP A;  1NBW A;  4A62 A;  4H0O A;  5AQX A;  5AR0 A;  2P9N B;  2E8A A;  3VF6 A;  4BRO A;  3EZW A;  4BRK A;  2BUP A;  1NGB A;  3ATV A;  3D2E B;  5TKY A;  1QZ6 A;  4BGA A;  2A3Z A;  3ID8 A;  2P9I A;  5EVZ A;  1YUW A;  4JAX A;  4QS8 A;  1NGA A;  2F9W A;  4A2A A;  5KQ8 A;  1QHA A;  3UB5 A;  4ISG A;  3C7N B;  2AA4 A;  1JCG A;  1BU6 O;  3W3D A;  1RFQ A;  3WXK A;  5BPL A;  1K8K A;  3AY9 A;  3I33 A;  2E2N A;  4H5N A;  3WQT A;  1JCE A;  5BR9 A;  3RSE B;  4H5T A;  5AQM A;  1DKG D;  1Z6R A;  1BO5 O;  1GLC G;  2Q2R A;  4FO0 A;  3UKU A;  4GY2 B;  3EO3 A;  4AM6 A;  2ASO A;  2QWN A;  2ITM A;  2GTD A;  5LJV A;  4HTL A;  4E1J A;  3R8E A;  4CZI A;  1X3N A;  4QS9 A;  5AQY A;  3HBT A;  4BRM A;  3W0L A;  1HKG A;  2GUP A;  3VES A;  1G99 A;  3M6G A;  3O4W A;  4J8F A;  3VEX A;  5FPD A;  1GLB G;  1LCU A;  5BRH A;  2CH6 A;  3EN9 A;  4FOE A;  4BR9 A;  1GLJ O;  3L6Q A;  2CH5 A;  2FF3 B;  5AFU H;  5B8H A;  2QWP A;  2AP1 A;  4B1Y B;  2QWO A;  1E4F T;  3CJA A;  1H1V A;  2V7Z A;  5AQG A;  5AQR A;  3CQY A;  1BG3 A;  4FWK A;  3QFU A;  4BVO A;  1YVN A;  2VYP A;  2A6A A;  2D0P A;  2YHY A;  3BF3 A;  3DAW A;  3AAQ A;  5AQZ A;  3WEE A;  3FZM A;  3P4I A;  1MDU B;  2FF6 A;  3TU5 A;  3A5M C;  2YCH A;  3VEZ A;  3ZET B;  3FR0 A;  1BWF O;  4JHD B;  2FSK A;  2UYT A;  3VPZ A;  2E20 A;  3VEO A;  1C0F A;  3CER A;  3ZX3 A;  3C7N A;  4DHY A;  2I7N A;  3ZX2 A;  3CJ9 A;  1BDG A;  3BP8 A;  4CZG A;  4FOI A;  5ELZ A;  3RSE A;  5AQU A;  1P8Z A;  4XH1 A;  4CBX A;  5KQD A;  1R59 O;  4BRF A;  2H3G X;  4FWM A;  3LDL A;  3QDK A;  3JXU A;  3M3Z A;  2NLX A;  3VET A;  3D2F B;  5AQN A;  2IVN A;  3F9M A;  3O6W A;  4WQ4 C;  3ATU A;  2D0O A;  3GE1 A;  3VGM A;  2FSJ A;  3LDQ A;  4FWP A;  1MWK A;  4C23 A;  5KPZ A;  5E26 A;  2FLO A;  1WUA A;  4BRD A;  4M7X A;  2P9L A;  4B9Q A;  4IWV A;  4BRG A;  5FPE A;  4I6M B;  2YJF A;  4PKH A;  1J6Z A;  3LM2 A;  3C0B A;  3MN6 A;  3VER A;  2Q0U A;  3JS6 A;  5AZI B;  2I7P A;  3A5L C;  3VEW A;  3L0Q A;  3WXL A;  3WXJ A;  3SMS A;  3GG4 A;  3ENH A;  2Q97 A;  4FWL A;  2KHO A;  4K43 A;  3U9D A;  5LJW A;  2CGK A;  2F9T A;  4Y0W A;  3MN5 A;  3ZX0 A;  5EOY A;  4BRN A;  3O1W A;  3D7E O;  3QB0 A;  5ADX A;  2Q31 A;  3AAP A;  5BRF A;  4NB4 A;  3ULE A;  4F9O A;  3LL3 A;  3DXK B;  4M63 C;  3O1B A;  2P9K A;  1HKB A;  3HSC A;  4H5W A;  5AFU A;  1KXP A;  1NGH A;  1NGD A;  2P9P B;  3CJ7 A;  1HKC A;  5F2R A;  4L3Q A;  2P9U B;  5AQO A;  3BF1 A;  3CIP A;  4BRP A;  2VWB A;  1NGI A;  2OAN A;  5FPN A;  2QWR A;  2P9S A;  4B1X B;  1T6C A;  4K42 A;  3GDQ A;  5AZJ A;  3QIC A;  4BRI A;  3DXM B;  4PL8 A;  4FSV A;  1U2V B;  3M1F A;  4FPA A;  4WYB A;  5ADX H;  1YXQ A;  3MN7 A;  4JN4 A;  1TYQ A;  3HI0 A;  2QXL A;  5EY4 A;  4BG9 A;  2CGL A;  5AQT A;  4A2B A;  3HTV A;  4FWR A;  4PKI A;  1YAG A;  4EAH D;  1DEJ A;  3I8B A;  3MK6 A;  5AQH A;  3VF2 A;  4NO7 A;  3B8A X;  5CE3 A;  1ZBS A;  2ZWH A;  2ZF5 O;  4H03 B;  1NMD A;  4ISE A;  4JD2 A;  3FZL A;  4BR5 A;  4AM7 A;  2Q0R A;  4DCH A;  1QQO A;  2YHX A;  4A61 A;  4K41 A;  4HWI A;  4IJN A;  2QWQ A;  4ISF A;  1ATS A;  3EL2 A;  3A5N C;  3ZEU B;  3IDH A;  4CD1 A;  2FXU A;  4IXC A;  4XH4 A;  4CZE A;  5JLF A;  2P9N A;  5LY3 A;  1TUU A;  2V52 B;  3D2E A;  1NGJ A;  4FWS A;  4CBU A;  2FSN A;  5JIC A;  2HF3 A;  1SAZ A;  2E1Y A;  2Q1N A;  1E4G T;  3H3O B;  3H45 C;  1Y64 A;  1T44 A;  3VGK A;  2YI1 A;  4Z94 A;  4BC4 A;  3UKR B;  2E1Z A;  2P9I B;  3DJC A;  1SZ2 A;  3HZ6 A;  3MDQ A;  2IVO A;  4RCH A;  3GBT A;  4WQ5 A;  2PBD A;  2E2Q A;  3H1V X;  2A42 A;  4MLH A;  3SLC A;  2V7Y A;  2GWK A;  1K8K B;  3H46 O;  4YDU A;  5AQK A;  2V51 B;  2W40 A;  3CET A;  3AAR A;  2DPN A;  3LM9 A;  1IJJ A;  3EKS A;  4BRA A;  3R9P A;  2NRH A;  2J4R A;  4CZM A;  1D4X A;  4BQL A;  2CGJ A;  4FWQ A;  2ZGY A;  4H0Y B;  3FZF A;  1HPM A;  2PAV A;  3BUZ B;  3G25 A;  4XEI A;  3KHY A;  2QWL A;  3VEY A;  1NWK A;  1NGC A;  4BR4 A;  4LC9 B;  1BOT O;  5AQW A;  4BR7 A;  4BG8 A;  2ASP A;  3CJC A;  5AQF A;  5AQP A;  5AQS A;  3BEX A;  3WT0 A;  1EQY A;  4B1V A;  1C0G A;  4BC2 A;  1GLA G;  4H5R A;  2ASM A;  4BRQ A;  4IO8 A;  2HF4 A;  1HLU A;  2D4W A;  3A5O C;  2GEL A;  1XQS C;  1HX1 A;  2E88 A;  2D1K A;  4PKG A;  3U9Z A;  4CBW A;  3QML A;  5AQQ A;  3ZET A;  1DGK N;  3VF4 A;  4BC5 A;  1MA9 B;  4CJ7 A;  4JHD A;  3LDN A;  4CI6 A;  1GLF O;  1X9J A;  5AQI A;  3WEE B;  2E2O A;  3L4I A;  1QZ5 A;  3FFK B;  3HM8 A;  3CI5 A;  4MO4 A;  4EHU A;  3UKR A;  4DQ8 A;  5I9E B;  1NLV A;  4FWO A;  1KAZ A;  2NZT A;  4EIA A;  2IVP A;  1NGF A;  3A8Y A;  1RDW X;  3LDO A;  3DWL A;  3MMV A;  1IG8 A;  3CJ1 A;  3CJB A;  1T6D A;  4BRH A;  1Q18 A;  3D2F A;  3MN9 A;  3J8A A;  4EHT A;  4FPB A;  3GOI A;  5AQL A;  3SJH A;  2A41 A;  3IUC A;  5KPT A;  2ZGZ A;  3H1Q A;  2VCP A;  1U6Z A;  2QM1 A;  4H0P A;  3VEV A;  1OKJ A;  4I6M A;  5BRE A;  2A40 A;  4MLE A;  1V4S A;  1QQM A;  1TUY A;  3WQU A;  4FWN A;  1QQN A;  3QFP A;  3O80 A;  1GLE G;  3A0I X;  2QW9 A;  4H0T B;  5AZI A;  4RWT A;  1HUX A;  2P9L B;  5F0X A;  1MWM A;  1X3M A;  3UE5 A;  1XC3 A;  3VGL A;  4JNE A;  5AQV A;  3VOV A;  5BPM A;  3H6E A;  3FE1 A;  2BTF A;  5KPR A;  3QBX A;  4EFH A;  2GWJ A;  3GL1 A;  4CD3 A;  4QS7 A;  1NGE A;  1KAY A;  2IIR A;  5JLH A;  4XH5 A;  4BR2 A;  5BN8 A;  1GLL O;  4CZL A;  3FGU A;  4IZ9 A;  5EXW A;  3O08 A;  4CZF A;  5F1X A;  3FZH A;  4WQ5 C;  4H0V B;  4FL9 A;  3DXK A;  4YDU C;  2E2P A;  1S22 A;  3MCP A;  2HMP A;  3FZK A;  3IMX A;  4B1U B;  3O8M A;  3U8X A;  1XUP O;  4RTF D;  4IJA A;  4GNI A;  4BRC A;  3OHR A;  2P9P A;  3QBW A;  3ULE B;  1BA0 A;  2P9U A;  3O5B A;  3KVG A;  2HOE A;  3U4L A;  2P9K B;  1V4T A;  4CZK A;  5JMV A;  1KAX A;  3CQX A;  4O8K A;  2EWS A;  3SK3 A;  4BRL A;  1Z05 A;  3WUH A;  3FLC O;  2YJE A;  3DXM A;  2QWM A;  5EX5 A;  1ESV A;  4BC3 A;  4BGB A;  4DB3 A;  1U2V A;  1WOQ A;  4BQZ A;  1ATN A;  4H5V A;  1BUP A;  5E84 A;  3UKU B;  2P9S B;  1LOT B;  4K25 A;  1S3X A;  2YHW A;  5AZJ B;  3TPQ A;  5BPN A;  1RGI A;  4PL7 A;  4BRE A;  4B1Z A;  3VEN A;  5FPM A;  4MO5 A;  3WXI A;  4CZH A;  3S41 A;  1ATR A;  1TYQ B;  1GLD G;  4H0X B;  1ZC6 A;  2Q36 A;  4KBO A;  2GEM A;  2WUS A; 
#chains in the Genus database with same CATH topology
 1NGG A;  3BGR A;  3VQP A;  1RDB A;  3ZEU A;  1JLG A;  1ZXO A;  2HHW A;  4ELU A;  3KZB A;  1ZBU A;  5KGW A;  3EKU A;  3LPU A;  2WC9 A;  1QVF M;  5SZT A;  1NJX A;  1VQ6 N;  1Q7Y O;  1TVR A;  4A62 A;  4DR5 K;  4DS4 A;  1U47 A;  2QA4 N;  5JS1 A;  1TAU A;  3E9O A;  4BRK A;  2YHA A;  3NCI A;  1NKB A;  3D2E B;  5AJ3 K;  3E01 A;  2P9I A;  3CD6 N;  4KHU A;  4CJS A;  3KK2 A;  4JAX A;  2F9W A;  4A2A A;  3CM5 A;  1SUQ A;  2UXB K;  3VQ9 A;  1ZBF A;  3C7N B;  5DM7 L;  2YNG A;  1BU6 O;  1RFQ A;  4EP5 A;  1K8K A;  3P83 D;  1VSF A;  3RSE B;  4CHZ A;  3CCE N;  2ZJQ L;  1TAQ A;  1I39 A;  3AO2 A;  3DYA A;  1BO5 O;  1RTI A;  1NKE A;  4ELV A;  5HP1 A;  1NK8 A;  3V1R A;  4CZI A;  5CHI A;  4KHW A;  2OCE A;  4B08 A;  4Z0U A;  4QS9 A;  4JKA A;  4CGJ A;  4BRM A;  4JK8 A;  3W0L A;  3KLH A;  1VQL N;  2UUA K;  3QEV A;  5FPD A;  4F4K A;  1LCU A;  2CH6 A;  3EN9 A;  4YOV A;  3L6Q A;  3DLR A;  2QWO A;  1E4F T;  1O13 A;  2E6M A;  3CJA A;  3AVA A;  1H1V A;  5KTQ A;  4IKF A;  5AQR A;  2XY8 A;  4FWK A;  3QFU A;  3ZSO A;  4BVO A;  1YVN A;  3RR8 A;  1KVA A;  1REV A;  3QNO A;  1RDU A;  4LY7 A;  4CJ4 A;  4FLU A;  3NVK A;  2D0P A;  1KLM A;  1YT3 A;  4CEA A;  4CER A;  2UXD K;  3P5J A;  3BF3 A;  3DAW A;  4B8C A;  4U7B A;  4B3T K;  1MDU B;  2FF6 A;  1RBS A;  2VQF K;  3CQ8 A;  1BWF O;  1EX4 A;  1CZ9 A;  2UYT A;  4YNQ A;  4HTU A;  1NK4 A;  1C0F A;  4DSI A;  2HNY A;  3ZX3 A;  2I7N A;  2G8U A;  3LDS A;  1VQO N;  4FOI A;  1T7P A;  3VTH A;  1P8Z A;  3P1G A;  5J2N A;  1IBM K;  3HPO A;  4BDZ A;  3QLH A;  4FLW A;  3JXU A;  3CYM A;  3VET A;  5I3U A;  2P5O A;  5AQN A;  1BCO A;  3F9M A;  2QI2 A;  3DRS A;  4FWP A;  2FLO A;  2KQ2 A;  3FFI A;  2RKI A;  4CJP A;  1LW0 A;  2ZE2 A;  1SL2 A;  3C0B A;  3VER A;  4DSJ A;  1YTA A;  4DTO A;  3WXL A;  4WE1 A;  3RWU A;  1S6P A;  1TKT A;  2CGK A;  4Y1D A;  4CFA A;  3SAG A;  4Y0W A;  3CG7 A;  1TK8 A;  5EOY A;  4BRN A;  3O1W A;  3D7E O;  3QB0 A;  2Q31 A;  3AAP A;  3K59 A;  2X74 A;  3ULE A;  4F9O A;  4FM0 A;  2KFN A;  2DFH A;  1ASW A;  3MWP A;  1NKC A;  5IT9 O;  5AFU A;  4DTS A;  4YOW A;  3QEP A;  3AA3 A;  4OX9 K;  2D0C A;  2P9P B;  3NAE A;  1HKC A;  4RW7 A;  4L3Q A;  5F2R A;  4EP4 A;  3BF1 A;  1NGI A;  4IOX A;  5D3G A;  3RRH A;  2P9S A;  4CEF A;  2KKZ A;  3RMB A;  1KVC A;  3M1F A;  2NRZ A;  1IKV A;  4WYB A;  3KD5 E;  1YXQ A;  4JN4 A;  4AHS A;  3Q7C A;  1RT2 A;  4DQS A;  1SKW A;  1N6Q A;  4FJL A;  3V9U A;  1C0U A;  1SS6 A;  4KFB A;  5KRS A;  4E7J A;  2NRR A;  2CGL A;  5AQT A;  3K5M A;  2YHB A;  4PKI A;  3NE6 A;  3RRG A;  3B8A X;  4IOA L;  4JD2 A;  3NFA A;  1I94 K;  3OYJ A;  4M3Z A;  4AM7 A;  2Q0R A;  3LPT A;  1IKX A;  5LMN K;  5HRO A;  2HBL A;  4HWI A;  3OYB A;  1RT4 A;  3QIO A;  3M8R A;  3U6F A;  4AQY K;  1ATS A;  3ZEU B;  1JXE A;  3IDH A;  2FXU A;  4CK1 A;  3KJV A;  3R1X A;  5M1Q A;  3TAM A;  4JKB A;  1J54 A;  2IS3 A;  3DLG A;  1TUU A;  2PZS A;  2E5L K;  2V52 B;  1YJN N;  2YKN A;  5FRO A;  3NMU A;  5FRM A;  1HQU A;  2HF3 A;  2Q1N A;  4Q5V A;  1XNQ K;  3MAQ A;  1E4G T;  4O55 A;  3AA2 A;  2VGM A;  1KC8 O;  2YI1 A;  4BC4 A;  2E6L A;  1WSI A;  2F96 A;  2P9I B;  1TK0 A;  1QSY A;  2DTU A;  1QSS A;  1SZ2 A;  3VA0 A;  2PYJ A;  1YHQ N;  2IVO A;  3R3L A;  4WQ5 A;  4DMN A;  2PBD A;  3OYF A;  3AVJ A;  3PIP L;  4ZTJ A;  2A42 A;  4J2B A;  4FXD A;  3VQD A;  3DLE A;  3QIP A;  4JI5 K;  1K8K B;  2W40 A;  3SI6 A;  5FDL A;  1J9A A;  3AAR A;  1QQC A;  2DPN A;  4FW1 A;  4EZ9 A;  3TAN A;  3E1Y A;  1N5Y A;  4CZM A;  4B8A B;  4BAC A;  2CGJ A;  3FZF A;  4XEI A;  1YIJ N;  1JXB A;  5J2P A;  4BR4 A;  3V9Z A;  1BOT O;  1KFD A;  4BR7 A;  4BG8 A;  2ASP A;  3CJC A;  5AQS A;  3WT0 A;  3DRP A;  1KFS A;  1KRP A;  4PQU A;  1CLQ A;  1GLA G;  4IO8 A;  3PIO L;  4GMJ B;  3A5O C;  3HL8 A;  1WSJ A;  1XQS C;  4R5P A;  3CC7 N;  3CCU N;  2E88 A;  2UUC K;  4I9Q A;  3J80 O;  4CW7 B;  3ZET A;  1JLQ A;  4OPH A;  4BC5 A;  4LH5 A;  4HCC A;  3LDN A;  5AQI A;  3HVT A;  3L4I A;  1VQ5 N;  2KZZ A;  1S1U A;  3HM8 A;  4MO4 A;  4EHU A;  4JK9 A;  4Z4F A;  4DQ8 A;  4DUY K;  2ETJ A;  1RT7 A;  3A8Y A;  3DWL A;  1WNS A;  3TSU A;  1VSI A;  2IC3 A;  3D2F A;  2XY6 A;  3OYL A;  2DFE A;  4EHT A;  1LV5 A;  3SQ1 A;  4IBN A;  4YY3 K;  1E3M A;  4I2Q A;  5KPT A;  2VCP A;  2QM1 A;  4IFY A;  4MLE A;  4LF8 K;  4FLT A;  3D0P A;  3O80 A;  1GLE G;  3VTI A;  1VSD A;  5TKW A;  3CPW M;  5F0X A;  3VA3 A;  1B92 A;  1X3M A;  5BPM A;  2YV0 X;  5AQV A;  2ZD1 A;  1HNV A;  2GWJ A;  3SCX A;  2HBK A;  1GLL O;  2E4L A;  2O8C A;  4IZ9 A;  5EXW A;  4LFC K;  3O08 A;  2OTL N;  4BE0 A;  4E7H A;  3ZT1 A;  4CJL A;  3HPH A;  3HXM A;  4E19 A;  4V19 S;  3DXK A;  1TK5 A;  3AO5 A;  5CY4 A;  2A1R A;  4WF9 L;  1NOZ A;  4DG1 A;  3IMX A;  2P51 A;  3FZK A;  4ZHR A;  2Z1G A;  4CGG A;  1XUP O;  4O0I A;  4GNI A;  3BZK A;  3AA5 X;  4M45 A;  5I42 A;  4CJE A;  3ULE B;  1BA0 A;  3MEG A;  4GKK K;  2HOE A;  4FVU A;  4O44 A;  1LWE A;  5JMV A;  4CIG A;  2HHQ A;  3CQX A;  4RG8 A;  3FLC O;  2QWM A;  5EX5 A;  1ESV A;  4BC3 A;  1U2V A;  1WOQ A;  5C24 A;  3OS1 A;  4BQZ A;  1ATN A;  3OYK A;  4FLZ A;  4Z4C A;  2P9S B;  1LOT B;  1HYZ A;  1UWB A;  3TPQ A;  4E89 A;  3WNF A;  4KTQ A;  3VEN A;  4C1N I;  1KSP A;  1WN7 A;  1IKY A;  4CE9 A;  1RBR A;  1VQP N;  3L2U A;  3PUF A;  4BDP A;  2GEM A;  2E2P A;  3TSQ A;  1NJI O;  3SMP A;  3M5R A;  3H08 A;  4CJU A;  1JCF A;  4B1W B;  2QKK A;  4JD2 B;  3ZCM A;  1K8A O;  3OYH A;  1HJO A;  1NJY A;  1Q86 O;  4BVP A;  5BN9 A;  4BR0 A;  3RTV A;  3AO3 A;  4RW9 A;  1OH8 A;  1NM1 A;  4CJW A;  4PY5 A;  1LWF A;  3VF6 A;  2KLA A;  3ATV A;  4DR1 K;  4BGA A;  1HJR A;  5EVZ A;  3EEQ A;  1YUW A;  3KLI A;  2AJQ A;  1VQ8 N;  3SUN A;  1N33 K;  5KQ8 A;  3JSM A;  4JS5 A;  1QHA A;  4FJJ A;  5C2D A;  3CFP A;  1EXQ A;  1WBB A;  2AA4 A;  3WXK A;  3HT3 A;  5BR9 A;  3WQT A;  4H5T A;  1S6Q A;  3C94 A;  3HK2 A;  4CHY A;  3OYM A;  1Z6R A;  1JL2 A;  3UKU A;  4JKG A;  3EO3 A;  3CM6 A;  4AM6 A;  2B5J A;  2GTD A;  4HTL A;  4IO9 L;  4DSL A;  1QTM A;  3R8E A;  1X3N A;  1KCF A;  2Z1I A;  5DMR A;  5GAD P;  3VES A;  4KHP K;  3F2K A;  4KH5 A;  4B9N A;  4KPY A;  4J8F A;  3BY5 A;  4FVM A;  5BRH A;  3O3G A;  3HM9 A;  1U45 A;  2G8F A;  4IFV A;  2CH5 A;  3MXM A;  2QWP A;  3HRG A;  4NLC A;  4B1Y B;  3SUP A;  3MX2 A;  2QK9 A;  3T7Z A;  3AV9 A;  4DQR A;  2V7Z A;  4LF5 K;  3T3F A;  1VSK A;  2VYP A;  2A6A A;  1SKR A;  2HMI A;  4NXM K;  2NRT A;  5JVG L;  2GBZ A;  4LSL A;  1WSE A;  3AAQ A;  4FJH A;  3WEE A;  2W6K A;  3FZM A;  4CF9 A;  3TU5 A;  3QEW A;  1EO1 A;  3ZET B;  3AO1 A;  1DLO A;  2HBM A;  4LF9 K;  2KW4 A;  4N76 A;  4A5A A;  4ZTF A;  3HYF A;  1N8R O;  3VPZ A;  4MFB A;  4NCG A;  3CER A;  4M41 A;  3ZX2 A;  1ASV A;  1BDG A;  4IEE A;  4M3W A;  1EWQ A;  4JKH A;  1TKZ A;  2RE2 A;  4XH1 A;  5H1S Q;  1BQN A;  3QDK A;  3OJS A;  3OBY A;  3MEE A;  3LP0 A;  4FJI A;  3D2F B;  4HUG A;  2IVN A;  3TSP A;  3DLB A;  5KPZ A;  3VGM A;  2FSJ A;  3LDQ A;  2XY7 A;  1MWK A;  1S9G A;  5E26 A;  4B9Q A;  1VQ9 N;  2JLE A;  4IOC L;  4BRG A;  5FPE A;  2ATQ A;  3AA4 A;  3V81 A;  3K2P A;  3T69 A;  1J6Z A;  2BH1 A;  1ZBL A;  3HP6 A;  4Q0B A;  1W97 L;  5CYQ A;  4C1N K;  2I7P A;  1TL1 A;  3VEW A;  3WXJ A;  3V9S A;  3AVL A;  2R7Y A;  3ENH A;  1XI1 A;  2Q97 A;  2KHO A;  3MN5 A;  3AVM A;  5DM6 L;  2O8C B;  2FBT A;  4JI8 K;  4QAG A;  3PX4 A;  4DTX A;  2FBY A;  5BRF A;  4DLE A;  4OVL A;  5GAE P;  3LL3 A;  3DXK B;  2P9K A;  3O9S A;  3L2V A;  2VGN A;  4FJK A;  3KIO A;  3M8P A;  5KI6 A;  2HHS A;  3CJ7 A;  3VMF B;  2OAN A;  3ZSV A;  2BDP A;  4B1X B;  1T6C A;  5AZJ A;  3OYG A;  3QIC A;  5C2F A;  4CVN E;  4M42 A;  4YOU A;  3LAL A;  4CHP A;  1EWR A;  1U2V B;  5M1O A;  3IS9 A;  4W5T A;  3PX0 A;  3TAB A;  1J5E K;  2OPQ A;  1X9W A;  4A2B A;  1OH7 A;  4NCB A;  4DFM A;  4EAH D;  2RN2 A;  2HHV A;  1RDA A;  3ZT0 A;  3MK6 A;  5AQH A;  3VF2 A;  4NO7 A;  4TSX A;  2ZF5 O;  4H03 B;  1NMD A;  3FZL A;  4IG0 A;  4G9Z A;  1NK7 A;  4CEQ A;  4BR5 A;  4DCH A;  1QQO A;  2YHX A;  3RVC A;  2ZQB A;  4LFA K;  4ISF A;  3V1Q A;  4KHQ A;  4HCB A;  1NG9 A;  1IG9 A;  1RT5 A;  1FKO A;  4IXC A;  4XH4 A;  4CZE A;  4GW6 A;  5JLF A;  4ID5 A;  1A5W A;  4FK4 A;  2NRX A;  3TTD A;  5C25 A;  4HHT A;  2HB5 A;  1SAZ A;  4EZ6 A;  1Y64 A;  1VRT A;  1GOB A;  3K5O A;  3C6T A;  4Z94 A;  3SQ4 A;  4DTP A;  4GV9 A;  1BIS A;  2E2Q A;  4FM2 A;  3O9Q A;  2IDO A;  2NNW A;  4FZX C;  4DR6 K;  5AQK A;  3PV8 A;  3CET A;  1TV6 A;  3LM9 A;  1IJJ A;  5LL6 Z;  1VSJ A;  4HUE A;  3SAH A;  4FJX A;  4CK3 A;  4JKG B;  2JWL A;  4BQL A;  1A5V A;  4B9V A;  2ZM6 K;  3NH1 A;  3NF6 A;  4B3O A;  4AHR A;  1HPM A;  2PAV A;  5HOO A;  4E7K A;  4KHS A;  2P1J A;  3DOL A;  3MX5 A;  3G10 A;  1BIZ A;  2PYL A;  3K9K A;  1NWK A;  4LC9 B;  1T8E A;  5AQP A;  3ZYY X;  3HO1 A;  2PFU A;  3E9L A;  4H5R A;  3VQA A;  4BRQ A;  1L3U A;  2HF4 A;  2D4W A;  1TL3 A;  3P39 A;  3TTC A;  4OGE A;  3QML A;  5AQQ A;  1M1K O;  3VF4 A;  2EHG A;  2OZS A;  1LW2 A;  4CJ7 A;  4JHD A;  4CI6 A;  1GLF O;  2RHK A;  3WEE B;  3KLE A;  1L3T A;  4O8U A;  3UKR A;  5I9E B;  1NLV A;  4FM1 A;  2IVP A;  4E7I A;  3LDO A;  1C6V A;  1YVU A;  1X9S A;  1RDD A;  5HRP A;  4FCY A;  1BCM A;  3OYD A;  4DSE A;  1U04 A;  3MXJ A;  4ILG B;  3SZ2 A;  3AGK A;  5J2Q A;  3NH2 A;  1DT9 A;  4JI6 K;  3L4Q A;  1TKX A;  3DLL L;  1UOC A;  4JRQ A;  1YI2 N;  4BWJ A;  1VSM A;  1KTQ A;  3OA9 A;  5GIO A;  3ID6 A;  2Z1H A;  4B3S K;  1S72 N;  3PO4 A;  4I6M A;  5BRE A;  4DKW A;  3SPZ A;  1V4S A;  4BE2 A;  4FW2 A;  3WQU A;  4F8R A;  4B9S A;  3QFP A;  3NF8 A;  3A0I X;  4CJQ A;  4CJK A;  3THV A;  2F7T A;  2WBN A;  1MWM A;  1Q9X A;  3N4P A;  3H6E A;  4IDH A;  2BTF A;  5KPR A;  4DV5 K;  2OPR A;  3GL1 A;  4CD3 A;  3ENB A;  4QS7 A;  1KAY A;  4XH5 A;  2I5J A;  4DFP A;  3B6O A;  4W5R A;  1OH5 A;  1QS4 A;  4WQ5 C;  3LP3 A;  1XHZ A;  3AVF A;  1Z25 A;  3JAM O;  3D45 A;  2UU9 K;  2RPI A;  1HR0 K;  1IKW A;  1BL3 A;  1S22 A;  3VQC A;  3MCP A;  4B1U B;  3DM2 A;  5CZ1 A;  5MLC Q;  3OS2 A;  4AHT A;  3PX6 A;  3S3O A;  1L5U A;  3ZSX A;  3CPE A;  4OPK A;  3LP1 A;  1OVQ A;  1NK6 A;  3O5B A;  4JI3 K;  2P9K B;  3SNN A;  4NLB A;  1V4T A;  4DQP A;  4KTW A;  4UQG A;  4CZK A;  3NBP A;  1KAX A;  1W7A A;  2XO7 A;  2EWS A;  1NMN A;  1N34 K;  2YJE A;  3L2W A;  1S1V A;  2O8B A;  3OVN A;  4H5V A;  1BUP A;  1W0H A;  4DQQ A;  2X6N A;  1S3X A;  5AZJ B;  3NF7 A;  3SPY A;  1RGI A;  4JI2 K;  5C42 A;  3HOT A;  3VQE A;  4BE1 A;  5FPM A;  4CZH A;  4U67 L;  3VQ5 A;  3MED A;  1ZC6 A;  4JI0 K;  4KBO A;  2JGU A;  2WUS A;  5E41 A;  3ENO A;  1BA1 A;  3PSI A;  4IDK A;  1QSL A;  3IFR A;  3QIN A;  5HLF A;  2W41 A;  1UA0 A;  3CHW A;  4DTJ A;  4DV1 K;  3HP9 A;  3C6H A;  1WBD A;  5BRD A;  5AQJ A;  2A5X A;  1LAW A;  4QOZ B;  3CC2 N;  4PWD A;  4CZJ A;  4H8K A;  4ELT A;  4WQ4 A;  4DV6 K;  1SV5 A;  4CK2 A;  4CJ5 A;  3LDP A;  1CZA N;  1NBW A;  2O8F A;  1KVB A;  4H0O A;  1B9D A;  4BRO A;  3EZW A;  4E0D A;  2BUP A;  5TKY A;  1QZ6 A;  2A3Z A;  1WB9 A;  1VQM N;  4JI7 K;  3ID8 A;  3CXC M;  4DV2 K;  3HOS A;  4FK2 A;  3UB5 A;  4ISG A;  5HL7 L;  1JCG A;  2VG6 A;  3I33 A;  4CEE A;  2E2N A;  3LAM A;  3RR7 A;  4C8O A;  5AQM A;  1YTU A;  1DKG D;  1RT6 A;  4J2A A;  3LAN A;  1P90 A;  1Z26 A;  3ZSW A;  3TI0 A;  2VG7 A;  4N56 A;  5IWA K;  2Q2R A;  2XHB A;  4GY2 B;  1M90 O;  3LWM A;  1WSG A;  1K73 O;  4LD0 A;  2QWN A;  4PUO A;  3SQ2 A;  1VSH A;  5M1P A;  4CJ3 A;  1IBL K;  4BY9 C;  3ZSY A;  4I2P A;  5GAG P;  1HKG A;  4YOR A;  2GUP A;  3CF5 L;  1G99 A;  1ILY A;  3M6G A;  3O4W A;  4MQ3 A;  3VEX A;  4DF8 A;  3QER A;  3OYN A;  4B3M K;  1JLE A;  2ITG A;  1I3A A;  2QKB A;  3D6R A;  3ULD A;  4DV3 K;  2G8W A;  1ASU A;  2OYQ A;  3I8D A;  3CCQ N;  4DV0 K;  4JRP A;  2F8T A;  5C15 A;  5SWM A;  4DFJ A;  3CQY A;  2RF2 A;  1BG3 A;  4FZY A;  4JYA K;  2HHX A;  3TWH A;  1NK5 A;  2O8D A;  4C8N A;  4C8M A;  3VQB A;  1UA1 A;  4YFU A;  1T05 A;  5FLX O;  4OLB A;  3P4I A;  3A5M C;  3MXI A;  4O5B A;  3FR0 A;  3EY1 A;  2Y1J A;  1HNZ K;  4F2S A;  1GOC A;  4JHD B;  4CGF A;  3ALY A;  2E20 A;  3VEO A;  2WFB A;  4DU4 A;  2YNI A;  4GV6 A;  3C7N A;  4KI6 A;  3CJ9 A;  3QEX A;  1N36 K;  4JI4 K;  3RSE A;  3O3H A;  4DLG A;  5KQD A;  1R59 O;  4BRF A;  3QEI A;  3HVR A;  4B3R K;  4G1Q A;  3THY A;  3LDL A;  3ZT3 A;  5T7B A;  3CFO A;  4RW4 A;  3O6W A;  1XHX A;  3ATU A;  3SUQ A;  1IH7 A;  1CXU A;  4E7L A;  2P9L A;  3K0S A;  4I6M B;  1VRU A;  2YJF A;  4PKH A;  3LM2 A;  1U4B A;  4YOT A;  2Q0U A;  3JS6 A;  4XIU A;  3OS0 A;  1D9F A;  3A5L C;  4NCA A;  4DQI A;  4CEO A;  4FLV A;  3SMS A;  3GG4 A;  4RW8 A;  5LJW A;  4DU3 A;  4CEB A;  4CHN A;  1JKH A;  4CGI A;  5GIN A;  5GIP A;  4GV3 A;  2B6A A;  4R79 A;  4AHU A;  5JVH L;  3KWG A;  3SQ0 A;  4FZZ A;  1D8Y A;  3KLF A;  3SBT A;  4LF4 K;  1NGH A;  3THW A;  5KGX A;  4BRP A;  1B9F A;  3HST B;  3L2R A;  4H4M A;  1Q81 O;  4WFN L;  2HVH A;  3J81 O;  3GDQ A;  1YJ9 N;  4PL8 A;  3NHG A;  4FSV A;  2O8B B;  4OGC A;  1TYQ A;  3HI0 A;  2QXL A;  4ILH A;  3OYE A;  2OZM A;  1O1W A;  3HTV A;  4CJF A;  4FJ5 A;  1YAG A;  4CF1 A;  1DEJ A;  3I8B A;  1FXX A;  1WSF A;  4KKO A;  1ZBS A;  2ZWH A;  4ID1 A;  5KRT A;  2BE2 A;  4UY8 O;  2PY5 A;  4KH6 A;  4W5O A;  3DI6 A;  4E3S A;  4M3R A;  3OW2 M;  4KTZ A;  1RT1 A;  3AVB A;  4OKK A;  3J7A P;  4K41 A;  2QWQ A;  1QHT A;  1CZB A;  4KV8 A;  3EL2 A;  3A5N C;  3Q7B A;  1SL0 A;  4CIF A;  4CD1 A;  5BR8 K;  3WNE A;  1OVY A;  2O4I A;  3LP2 A;  2P9N A;  1K9M O;  4CCH A;  1DTQ A;  4WFA L;  3OTO K;  3LWL A;  4CBU A;  5JIC A;  3T1H K;  2O8F B;  2G8K A;  3H3O B;  3QES A;  3H45 C;  3KKS A;  3IG1 A;  4LF6 K;  4A5B A;  1T44 A;  3OYI A;  4JKD A;  2E1Z A;  2IOC A;  3DJC A;  4AHV A;  3DLH A;  3AVI A;  3MDQ A;  2QEX N;  3HJF A;  1D9D A;  3GBT A;  4O4G A;  1JL1 A;  1WLJ A;  3SLC A;  4JS4 A;  3K5N A;  2V7Y A;  3H46 O;  4YDU A;  2V51 B;  3TR8 A;  1HYS A;  3G6E N;  4B9T A;  4BRA A;  4K8X A;  3R9P A;  2NRH A;  2J4R A;  4CEC A;  2UXC K;  3M8S A;  3ITH A;  3QO9 A;  4OKJ A;  4C8L A;  3AVC A;  3F73 A;  1U49 A;  3HPG A;  2OA8 A;  3KKR A;  3G25 A;  1FK9 A;  4M3U A;  2QWL A;  2W42 A;  3VEY A;  1RTD A;  3F9K A;  4FJN A;  3O9U A;  4FJ8 A;  2BGG A;  1HMV A;  5AQW A;  1GOA A;  2GX9 A;  3SAF A;  2KFZ A;  4B1V A;  3IKM A;  4BC2 A;  3MEC A;  4Z4H A;  4KRF A;  3NGY A;  1S9E A;  1J5O A;  1HLU A;  3NGI A;  1XNR K;  1KD1 O;  3CCM N;  3SV3 A;  4JI1 K;  1RCH A;  4PKG A;  4CBW A;  1HNX K;  2O8D B;  3P38 A;  2HNZ A;  1JLA A;  2A1S A;  4AHC A;  2WON A;  2KZM A;  1QZ5 A;  4X62 K;  4EIA A;  1KLN A;  3ZLJ A;  1Y97 A;  3MMV A;  2D0A A;  3F5T A;  1IG8 A;  1IBK K;  2KTQ A;  3ISN C;  4CFC A;  3V4I A;  1T6D A;  4N47 A;  2HHU A;  1Q9Y A;  1TKD A;  3U3G A;  4FPB A;  4M3Y A;  2D0B A;  3SJH A;  3THY B;  1EKE A;  2A41 A;  2FBX A;  2X6S A;  4CED A;  3C6A A;  4MDA A;  3TTF A;  3K58 A;  4H0P A;  3CCL N;  4N5S A;  2A40 A;  3SJJ A;  1QQM A;  1RDC A;  1QQN A;  3SBG A;  4KRE A;  1G15 A;  2IGI A;  2VWJ A;  1RNH A;  2VG5 A;  5AZI A;  4RWT A;  2DY4 A;  2P9L B;  1D5A A;  3UE5 A;  5HRR A;  4J2D A;  1L3S A;  4BR2 A;  5BN8 A;  1NJW A;  3DMJ A;  4DWI A;  4WCE L;  5F1X A;  3ZT2 A;  3OJU A;  2UUB K;  4JKF A;  4FL9 A;  1CXQ A;  4A59 A;  1R0A A;  1TGO A;  4O0J A;  4W5N A;  2HMP A;  3NVM A;  3O8M A;  4RTF D;  4BRC A;  3I55 N;  3OHR A;  4FLY A;  3QBW A;  2NRV A;  2P9U A;  3EE8 A;  4I9L A;  3U3Y A;  3LAK A;  3OY9 A;  3ZSQ A;  2WOM A;  2GUI A;  1ZYQ A;  4BRL A;  1Z05 A;  3WUH A;  3DXM A;  3THW B;  4LSN A;  1NJZ A;  5E84 A;  3UKU B;  4F3O A;  5J2M A;  2YHW A;  5BPN A;  3G71 N;  1HQE A;  4PL7 A;  4BRE A;  4B1Z A;  3C6U A;  5GAH P;  4IG3 A;  3DLK A;  4MO5 A;  3WXI A;  1X9M A;  1EP4 A;  5C12 A;  1ATR A;  4DFK A;  1TYQ B;  4K0K K;  1GLD G;  4PHT X;  3CCJ N;  3TAR A;  3PLA A;  2FC0 A;  2Z1J A;  3L3U A;  4KHN A;  2O8E A;  4QCL A;  4DV4 K;  3O3F A;  3CME N;  3V1O A;  1FW6 A;  1XC9 A;  2HND A;  4M7Y A;  3EZ5 A;  1SQK A;  4O5F A;  3H3N O;  1NK9 A;  3O4N A;  3R6M A;  4KH4 A;  4IEI A;  1DTT A;  3SUO A;  4OJR A;  2NRW A;  1EET A;  2HBJ A;  4B9U A;  5AQX A;  5DK5 A;  4KHY A;  5AR0 A;  2P9N B;  2E8A A;  1NGB A;  4DTU A;  4HVJ A;  3CCS N;  1YJW N;  5HBM A;  2IAJ A;  1S5J A;  3JYT A;  5M1K A;  1T3V A;  3AVN A;  4CJT A;  4QS8 A;  1NGA A;  1VK0 A;  4CHO A;  2DFF A;  1YIT N;  4LF7 K;  1Q8I A;  3E66 A;  3W3D A;  3AGR A;  5BPL A;  3KWI A;  3RMD A;  1NOY A;  3AY9 A;  4H5N A;  1JCE A;  1C1A A;  3G4S N;  3P31 A;  3I56 N;  5HRS A;  2FBV A;  3VQ7 A;  1BIU A;  4X64 K;  1GLC G;  4FO0 A;  4PA1 A;  3KLG A;  3O4Q A;  3C65 A;  2ASO A;  1C1C A;  2ITM A;  5LJV A;  2ZJR L;  4E1J A;  3NDK A;  2O4G A;  4JV5 K;  5AQY A;  3HBT A;  4DTR A;  3K57 A;  4DTN A;  4FLX A;  1GLB G;  2WTU A;  4FOE A;  4BR9 A;  4FJG A;  1GLJ O;  4DR2 K;  2FF3 B;  5AFU H;  1QVG M;  2P5G A;  5B8H A;  2AP1 A;  1HYV A;  3RMC A;  4W5Q A;  3AO4 A;  5EU7 A;  4YHH K;  4NYN A;  5AQG A;  1NK0 A;  2G8V A;  1RBU A;  1RIL A;  1S1X A;  2YKM A;  1HPZ A;  4X65 K;  2YHY A;  3AVK A;  1HNI A;  1NNE A;  5AQZ A;  1OH6 A;  3B6P A;  2YCH A;  2LSN A;  3WNH A;  3VEZ A;  5FRN A;  2B4J A;  3AVG A;  4F3T A;  3M8Q A;  1BQM A;  1F21 A;  2FSK A;  1FJG K;  1VQN N;  4DHY A;  1BI4 A;  4JLH A;  3TAG A;  1WAJ A;  3BP8 A;  4CZG A;  2HVI A;  5ELZ A;  5AQU A;  5CR4 A;  4CBX A;  4Y1C A;  2H3G X;  4FWM A;  1C0M A;  4J2E A;  3M3Z A;  2NLX A;  4JKE A;  4WQ4 C;  3CC4 N;  3EE9 A;  2D0O A;  4C23 A;  3GE1 A;  1U48 A;  1ZBI A;  3KTQ A;  2QXF A;  4KAZ A;  3UIQ A;  1WUA A;  3BZC A;  4BDY A;  4BRD A;  4M7X A;  4HUF A;  4B9M A;  4F2R A;  4IWV A;  2Y1I A;  2GV9 A;  3VQQ A;  3MN6 A;  1JLF A;  1LAV A;  1KQS M;  5AZI B;  3L8B A;  2NUB A;  3L0Q A;  4OPA A;  3THX A;  3OYC A;  4IFE A;  3CCR N;  3ZSR A;  3PO5 A;  4FWL A;  4K43 A;  3U9D A;  4KB1 A;  2F9T A;  1IV0 A;  3ZX0 A;  4CJR A;  1BHL A;  1N32 K;  5ADX A;  3AVH A;  2D5R A;  2Q3S A;  1XMQ K;  3V9X A;  4NB4 A;  1XMO K;  5M1F A;  4M63 C;  4CEZ A;  3O1B A;  1HKB A;  3HSC A;  1ITG A;  1NU0 A;  3CFR A;  3DOK A;  4H5W A;  5CYM A;  2F8S A;  1W2B M;  2OPP A;  1KXP A;  2HW3 A;  4CGD A;  1NGD A;  2P9U B;  5AQO A;  3CIP A;  5M1N A;  2VWB A;  1VQ4 N;  5FPN A;  3OBW A;  1K6Y A;  2QWR A;  4K42 A;  2BAN A;  2HST A;  1SL1 A;  4BRI A;  3SYZ A;  3DXM B;  4FPA A;  4RW6 A;  5ADX H;  3MN7 A;  3O9R A;  3KK1 A;  4OO1 J;  2W6L A;  4E1N A;  5EY4 A;  4BG9 A;  4DUZ K;  4GKJ K;  4JEP A;  4FWR A;  3VQ4 A;  2G8I A;  1C1B A;  4KI4 A;  5J1E A;  5CE3 A;  4H4O A;  4ISE A;  3PSF A;  3WXM B;  3KK3 A;  5CZ2 A;  2O8E B;  4A61 A;  3ASM A;  4DV7 K;  4JKC A;  4IJN A;  1VSL A;  3MWT A;  4GVM A;  4B9L A;  5C10 A;  4LH4 A;  5K14 A;  4CGH A;  3T1A A;  3NH0 A;  5LY3 A;  2XRI A;  4BWM A;  1T03 A;  4E1M A;  3D2E A;  1FKP A;  1NGJ A;  4FWS A;  4CF2 A;  3T1Y K;  2FSN A;  2E1Y A;  4C8K A;  1WSH A;  4FJ7 A;  4YOX A;  3MCA B;  3VGK A;  2EX3 A;  3UKR B;  1WAF A;  3HZ6 A;  3A2F A;  4RCH A;  3H1V X;  3K9J A;  1X1P A;  4MLH A;  2GWK A;  4WFB L;  4ICL A;  3EKS A;  3I0R A;  4M3X A;  3DRR A;  2JWK A;  1JLC A;  1SKS A;  1D4X A;  3VQ8 A;  2G8H A;  4FWQ A;  4H0Y B;  2ZGY A;  3V9W A;  5A2Q O;  4OLA A;  4N41 A;  3BUZ B;  4CFB A;  3KK7 A;  3KHY A;  3S3M A;  3QET A;  4YOY A;  3TAF A;  3I0S A;  1NGC A;  2HHT A;  3K5L A;  3J7Y P;  1HNW K;  5AQF A;  3BEX A;  4ILJ A;  1EQY A;  1C0G A;  4CES A;  1UAX A;  3VN5 A;  3C95 A;  2ASM A;  3TAP A;  3IAY A;  1VSE A;  2GEL A;  4CF0 A;  2ZJP L;  1JJ2 M;  4M3T A;  3TAQ A;  1HX1 A;  1BGX T;  2D1K A;  3U9Z A;  4DSF A;  1DGK N;  2X78 A;  4CJV A;  2YX6 A;  4CF8 A;  1XWL A;  4OPJ A;  3TAE A;  4DS5 A;  3V6D A;  1QE1 A;  1X9J A;  3RMA A;  2E2O A;  4DSK A;  3QNN A;  4FJM A;  3FFK B;  1LWC A;  3CI5 A;  4DTM A;  1IO2 A;  4FWO A;  1KAZ A;  2NZT A;  1NGF A;  2XY5 A;  1RDW X;  4DF4 A;  4GVE A;  5LMU K;  1ZBH A;  5C0Y A;  4Z4I A;  4DR4 K;  1MU2 A;  3CJ1 A;  1S1T A;  3CJB A;  1BI4 B;  4BRH A;  1Q18 A;  4L8R B;  4I7F A;  3MN9 A;  2VWK A;  4CHQ A;  3J8A A;  4FJ9 A;  3GOI A;  4K8Z A;  5AQL A;  1YF5 L;  3EYZ A;  3CCV N;  1VHX A;  3IUC A;  2ZGZ A;  4OKE A;  3ZT4 A;  3BDP A;  2OTJ N;  3H1Q A;  3KD1 E;  1U6Z A;  3VEV A;  3L3V A;  1OKJ A;  3N4Q A;  3SV4 A;  1VQ7 N;  1Q82 O;  3S9H A;  1TUY A;  4FWN A;  1C0T A;  3IRX A;  2QW9 A;  4H0T B;  2YNH A;  3LZJ A;  1HUX A;  1W9H A;  1XC3 A;  3VGL A;  4JNE A;  3VOV A;  3CMA N;  3FE1 A;  3S3N A;  3QBX A;  4EFH A;  1S1W A;  1NGE A;  2IIR A;  3NF9 A;  5JLH A;  4CZL A;  3FGU A;  3OYA A;  4KO0 A;  3THX B;  4CZF A;  3FZH A;  1JLB A;  1A5X A;  3E9P A;  4H0V B;  2F4V K;  1RTJ A;  2YNF A;  1RTH A;  4YDU C;  4FYD A;  1RBT A;  3ZSZ A;  4MDB A;  3LZI A;  3U8X A;  4AH9 A;  4IJA A;  2VQE K;  4JK7 A;  2P9P A;  3L2Q A;  4NYF A;  1J53 A;  3KVG A;  3U4L A;  5JS2 A;  1HRH A;  4FK0 A;  1VQK N;  1RT3 A;  4CIE A;  3PY8 A;  4Z4E A;  4O8K A;  2OPS A;  2HHH K;  2QTD A;  3SK3 A;  4NXN K;  3J7Z O;  4CFD A;  4DB3 A;  1L3V A;  4BGB A;  4DU1 A;  3WNG A;  3O9T A;  1RBV A;  4DR3 K;  3T19 A;  4DR7 K;  4AIL C;  5HRN A;  4AF1 A;  4K25 A;  3NGZ A;  4LFB K;  4X66 K;  4KB0 A;  3S41 A;  4Z4G A;  3VQ6 A;  4H0X B;  2Q36 A;  3G0Z A;  4A57 A;  1MA9 B;  1VAZ A; 
#chains in the Genus database with same CATH homology
 3SMP A;  3M5R A;  3ENO A;  1BA1 A;  3CME N;  1NGG A;  1JCF A;  3IFR A;  1SQK A;  2W41 A;  4M7Y A;  3CHW A;  4O5F A;  4B1W B;  3H3N O;  4JD2 B;  3ZEU A;  1K8A O;  3R6M A;  3C6H A;  1ZXO A;  4KH4 A;  4IEI A;  5BRD A;  1HJO A;  2A5X A;  5AQJ A;  3KZB A;  3CC2 N;  3EKU A;  4CZJ A;  1Q86 O;  4BVP A;  4WQ4 A;  2WC9 A;  5BN9 A;  4BR0 A;  1QVF M;  1VQ6 N;  1NM1 A;  1CZA N;  3LDP A;  1Q7Y O;  2NRW A;  1NBW A;  2HBJ A;  4H0O A;  4A62 A;  5AQX A;  2QA4 N;  5AR0 A;  2P9N B;  2E8A A;  3E9O A;  3VF6 A;  3EZW A;  4BRO A;  4BRK A;  2BUP A;  2KLA A;  1NGB A;  3ATV A;  3D2E B;  5TKY A;  1QZ6 A;  4BGA A;  2A3Z A;  1VQM N;  3ID8 A;  3CCS N;  2P9I A;  5EVZ A;  3CXC M;  1YUW A;  1YJW N;  3CD6 N;  1VQ8 N;  3HOS A;  4JAX A;  5M1K A;  1T3V A;  4QS8 A;  1NGA A;  2F9W A;  4A2A A;  5KQ8 A;  1YIT N;  1QHA A;  3UB5 A;  5C2D A;  4ISG A;  3C7N B;  3E66 A;  5DM7 L;  2AA4 A;  5HL7 L;  1JCG A;  1BU6 O;  3W3D A;  1RFQ A;  3AGR A;  3KWI A;  3WXK A;  5BPL A;  1K8K A;  3AY9 A;  3I33 A;  2E2N A;  4H5N A;  3WQT A;  1JCE A;  5BR9 A;  3RSE B;  4H5T A;  5AQM A;  1DKG D;  3CCE N;  2ZJQ L;  3G4S N;  3P31 A;  3I56 N;  1P90 A;  1Z6R A;  1BO5 O;  1GLC G;  2Q2R A;  4FO0 A;  3UKU A;  4GY2 B;  4JKG A;  3EO3 A;  1M90 O;  3C65 A;  1K73 O;  4AM6 A;  2ASO A;  2QWN A;  2ITM A;  2GTD A;  5LJV A;  4HTL A;  2ZJR L;  4IO9 L;  4E1J A;  5M1P A;  3R8E A;  4CZI A;  5CHI A;  1X3N A;  4QS9 A;  4JKA A;  5AQY A;  3HBT A;  4BRM A;  4BY9 C;  4JK8 A;  3W0L A;  5GAG P;  5GAD P;  1VQL N;  1HKG A;  4YOR A;  2GUP A;  3VES A;  1G99 A;  3F2K A;  4KH5 A;  3CF5 L;  1ILY A;  3M6G A;  3O4W A;  4J8F A;  3VEX A;  5FPD A;  1GLB G;  1LCU A;  5BRH A;  2CH6 A;  3EN9 A;  4FOE A;  4BR9 A;  4YOV A;  1GLJ O;  3L6Q A;  2CH5 A;  3D6R A;  2FF3 B;  5AFU H;  1QVG M;  5B8H A;  2QWP A;  3HRG A;  4NLC A;  2AP1 A;  4B1Y B;  2QWO A;  1E4F T;  3MX2 A;  1O13 A;  3CCQ N;  3CJA A;  3T7Z A;  1H1V A;  2V7Z A;  5AQG A;  5AQR A;  5C15 A;  3CQY A;  1BG3 A;  4FWK A;  3QFU A;  4BVO A;  1YVN A;  2VYP A;  2A6A A;  1RDU A;  3NVK A;  2D0P A;  2NRT A;  5JVG L;  2YHY A;  3BF3 A;  3DAW A;  3AAQ A;  5AQZ A;  3WEE A;  3FZM A;  4U7B A;  3P4I A;  1MDU B;  2FF6 A;  3TU5 A;  3A5M C;  2YCH A;  3VEZ A;  1EO1 A;  3ZET B;  3FR0 A;  1BWF O;  2HBM A;  4A5A A;  4JHD B;  2FSK A;  1N8R O;  2UYT A;  3VPZ A;  2E20 A;  3VEO A;  2WFB A;  1C0F A;  1VQN N;  3CER A;  3ZX3 A;  4GV6 A;  3C7N A;  4DHY A;  2I7N A;  3ZX2 A;  3CJ9 A;  1BDG A;  4IEE A;  1VQO N;  3BP8 A;  4CZG A;  4FOI A;  4JKH A;  5ELZ A;  3RSE A;  1NJI O;  5AQU A;  2RE2 A;  1P8Z A;  4XH1 A;  5CR4 A;  3VTH A;  1R59 O;  4CBX A;  5KQD A;  5H1S Q;  4BRF A;  2H3G X;  4FWM A;  3LDL A;  3QDK A;  3JXU A;  3M3Z A;  3OBY A;  2NLX A;  3VET A;  3D2F B;  4JKE A;  5AQN A;  2IVN A;  3TSP A;  3F9M A;  3O6W A;  2QI2 A;  4WQ4 C;  3CC4 N;  3EE9 A;  3ATU A;  2D0O A;  3GE1 A;  3VGM A;  2FSJ A;  3LDQ A;  4FWP A;  1MWK A;  4C23 A;  5KPZ A;  5E26 A;  2FLO A;  1WUA A;  4BRD A;  4M7X A;  2P9L A;  4B9Q A;  1VQ9 N;  4IOC L;  4IWV A;  4BRG A;  5FPE A;  4I6M B;  2YJF A;  4PKH A;  1J6Z A;  3LM2 A;  3T69 A;  3C0B A;  3MN6 A;  4YOT A;  3VER A;  2Q0U A;  3JS6 A;  2BH1 A;  1KQS M;  5AZI B;  1W97 L;  4C1N K;  2I7P A;  3A5L C;  3VEW A;  3L0Q A;  3WXL A;  4OPA A;  3WXJ A;  3SMS A;  3GG4 A;  3ENH A;  4IFE A;  2Q97 A;  3CCR N;  4FWL A;  2KHO A;  4K43 A;  3U9D A;  5LJW A;  2CGK A;  3SAG A;  2F9T A;  4Y0W A;  3MN5 A;  3ZX0 A;  5DM6 L;  5EOY A;  4BRN A;  3O1W A;  3D7E O;  3QB0 A;  5ADX A;  2Q31 A;  3AAP A;  5BRF A;  5GIN A;  4NB4 A;  5GIP A;  5M1F A;  4GV3 A;  3ULE A;  5GAE P;  4F9O A;  3LL3 A;  3DXK B;  4M63 C;  4R79 A;  3O1B A;  3MWP A;  2P9K A;  3O9S A;  1HKB A;  5JVH L;  3HSC A;  3KWG A;  2VGN A;  4H5W A;  5AFU A;  4YOW A;  1W2B M;  3SBT A;  1KXP A;  1NGH A;  1NGD A;  2P9P B;  3CJ7 A;  1HKC A;  5F2R A;  4L3Q A;  2P9U B;  3VMF B;  5AQO A;  3BF1 A;  3CIP A;  5M1N A;  4BRP A;  2VWB A;  1NGI A;  2OAN A;  1Q81 O;  1VQ4 N;  4IOX A;  5FPN A;  4WFN L;  3OBW A;  2QWR A;  2P9S A;  4B1X B;  1T6C A;  4K42 A;  3GDQ A;  5AZJ A;  2HST A;  3QIC A;  5C2F A;  1YJ9 N;  4BRI A;  2KKZ A;  4YOU A;  3DXM B;  4PL8 A;  4FSV A;  1U2V B;  3M1F A;  2NRZ A;  4FPA A;  4WYB A;  5M1O A;  1YXQ A;  3MN7 A;  3O9R A;  3Q7C A;  4JN4 A;  5ADX H;  1TYQ A;  4OO1 J;  3HI0 A;  2QXL A;  4ILH A;  1SS6 A;  5EY4 A;  4BG9 A;  2NRR A;  2CGL A;  5AQT A;  4JEP A;  3HTV A;  4FWR A;  4A2B A;  4PKI A;  1YAG A;  4EAH D;  1DEJ A;  3I8B A;  3MK6 A;  5AQH A;  3VF2 A;  4NO7 A;  3B8A X;  5CE3 A;  4IOA L;  1ZBS A;  2ZWH A;  2ZF5 O;  4H03 B;  1NMD A;  4ISE A;  4JD2 A;  4UY8 O;  4KH6 A;  3FZL A;  4G9Z A;  3WXM B;  4BR5 A;  4AM7 A;  2Q0R A;  3OW2 M;  4DCH A;  1QQO A;  2YHX A;  4A61 A;  4JKC A;  3RVC A;  4K41 A;  2HBL A;  4HWI A;  4IJN A;  2QWQ A;  4ISF A;  1ATS A;  3EL2 A;  3A5N C;  3MWT A;  3Q7B A;  3ZEU B;  3IDH A;  5C10 A;  4CD1 A;  2FXU A;  1OVY A;  3R1X A;  5M1Q A;  4IXC A;  4XH4 A;  4CZE A;  5JLF A;  2P9N A;  4JKB A;  5LY3 A;  1TUU A;  1K9M O;  2V52 B;  3D2E A;  4WFA L;  1YJN N;  2NRX A;  3TTD A;  1NGJ A;  4FWS A;  4CBU A;  3NMU A;  2FSN A;  5JIC A;  2HF3 A;  1SAZ A;  2E1Y A;  2Q1N A;  1E4G T;  3H3O B;  3H45 C;  1Y64 A;  2VGM A;  4YOX A;  1KC8 O;  4A5B A;  1T44 A;  3MCA B;  3VGK A;  2YI1 A;  4Z94 A;  4BC4 A;  3UKR B;  4JKD A;  2E1Z A;  2P9I B;  3DJC A;  1SZ2 A;  3HZ6 A;  3MDQ A;  1YHQ N;  2QEX N;  2IVO A;  4RCH A;  3R3L A;  3GBT A;  4GV9 A;  4WQ5 A;  2PBD A;  2E2Q A;  3H1V X;  3PIP L;  3K9J A;  2A42 A;  4MLH A;  3SLC A;  3O9Q A;  2NNW A;  2V7Y A;  2GWK A;  1K8K B;  3H46 O;  4YDU A;  5AQK A;  2V51 B;  2W40 A;  3CET A;  4WFB L;  3G6E N;  3AAR A;  2DPN A;  3LM9 A;  1IJJ A;  3EKS A;  4BRA A;  3R9P A;  3SAH A;  2NRH A;  2J4R A;  3E1Y A;  2JWK A;  4JKG B;  2JWL A;  1D4X A;  4CZM A;  4BQL A;  2CGJ A;  4FWQ A;  2ZGY A;  4H0Y B;  3FZF A;  1HPM A;  2PAV A;  3BUZ B;  5HOO A;  3G25 A;  3KK7 A;  4XEI A;  3MX5 A;  1YIJ N;  3KHY A;  2QWL A;  3VEY A;  3K9K A;  4YOY A;  3O9U A;  1NWK A;  1NGC A;  4BR4 A;  4LC9 B;  1BOT O;  5AQW A;  4BR7 A;  2GX9 A;  4BG8 A;  2ASP A;  3CJC A;  3SAF A;  5AQF A;  5AQP A;  5AQS A;  3BEX A;  4ILJ A;  1EQY A;  3WT0 A;  1C0G A;  2PFU A;  3E9L A;  3IKM A;  3ZYY X;  4B1V A;  4BC2 A;  1GLA G;  4H5R A;  2ASM A;  4BRQ A;  4IO8 A;  3PIO L;  2HF4 A;  1HLU A;  2D4W A;  3A5O C;  2GEL A;  2ZJP L;  1XQS C;  1KD1 O;  1JJ2 M;  3CC7 N;  3P39 A;  3CCU N;  3CCM N;  1HX1 A;  2E88 A;  3TTC A;  2D1K A;  4PKG A;  3U9Z A;  4CBW A;  3QML A;  5AQQ A;  3ZET A;  1M1K O;  4OPH A;  1DGK N;  3VF4 A;  4BC5 A;  2YX6 A;  1MA9 B;  3P38 A;  4CJ7 A;  4JHD A;  3LDN A;  4CI6 A;  1GLF O;  1X9J A;  2RHK A;  5AQI A;  3WEE B;  2E2O A;  3L4I A;  1VQ5 N;  4O8U A;  1QZ5 A;  3FFK B;  3HM8 A;  3CI5 A;  4MO4 A;  4EHU A;  4JK9 A;  3UKR A;  4DQ8 A;  5I9E B;  1NLV A;  4FWO A;  1KAZ A;  2NZT A;  4EIA A;  2IVP A;  1NGF A;  3A8Y A;  1RDW X;  3LDO A;  3DWL A;  3MMV A;  4GVE A;  5C0Y A;  3F5T A;  1IG8 A;  3CJ1 A;  3TSU A;  3CJB A;  1T6D A;  4BRH A;  1Q18 A;  3D2F A;  4ILG B;  3MN9 A;  3AGK A;  1DT9 A;  3J8A A;  4EHT A;  4FPB A;  3GOI A;  3L4Q A;  3DLL L;  5AQL A;  3SJH A;  1YF5 L;  3CCV N;  1YI2 N;  2A41 A;  3IUC A;  5KPT A;  2ZGZ A;  3OA9 A;  2OTJ N;  3C6A A;  3ID6 A;  3H1Q A;  2VCP A;  4MDA A;  1U6Z A;  2QM1 A;  4H0P A;  3N4Q A;  1OKJ A;  3TTF A;  4I6M A;  3VEV A;  5BRE A;  1S72 N;  2A40 A;  4DKW A;  1VQ7 N;  3CCL N;  1Q82 O;  4MLE A;  1V4S A;  1QQM A;  1TUY A;  3WQU A;  4FWN A;  1QQN A;  3QFP A;  3O80 A;  1GLE G;  3A0I X;  3SBG A;  2QW9 A;  4H0T B;  5AZI A;  3VTI A;  4RWT A;  1HUX A;  2F7T A;  5TKW A;  3CPW M;  2P9L B;  5F0X A;  2WBN A;  1MWM A;  1X3M A;  3UE5 A;  1XC3 A;  3VGL A;  4JNE A;  5AQV A;  3VOV A;  5BPM A;  3CMA N;  3N4P A;  3H6E A;  4IDH A;  3FE1 A;  2BTF A;  5KPR A;  3QBX A;  4EFH A;  2GWJ A;  3GL1 A;  4CD3 A;  3ENB A;  4QS7 A;  2HBK A;  1NGE A;  1KAY A;  2IIR A;  5JLH A;  4XH5 A;  4BR2 A;  5BN8 A;  1GLL O;  4CZL A;  3FGU A;  4IZ9 A;  5EXW A;  3O08 A;  4CZF A;  2OTL N;  4WCE L;  5F1X A;  3FZH A;  4WQ5 C;  3E9P A;  4H0V B;  4JKF A;  4FL9 A;  4A59 A;  3DXK A;  4YDU C;  2E2P A;  1S22 A;  4WF9 L;  3MCP A;  2HMP A;  3FZK A;  3IMX A;  4B1U B;  3NVM A;  5MLC Q;  4MDB A;  3O8M A;  3U8X A;  1XUP O;  4RTF D;  4IJA A;  4GNI A;  3CPE A;  4JK7 A;  4BRC A;  3I55 N;  3OHR A;  2P9P A;  3QBW A;  2NRV A;  1BA0 A;  2P9U A;  3EE8 A;  3O5B A;  3KVG A;  3ULE B;  2HOE A;  3U4L A;  2P9K B;  4NLB A;  4FVU A;  1V4T A;  1VQK N;  4CZK A;  5JMV A;  1KAX A;  3CQX A;  4O8K A;  2EWS A;  2QTD A;  3SK3 A;  4BRL A;  1Z05 A;  3WUH A;  3J7Z O;  3FLC O;  2YJE A;  3DXM A;  2QWM A;  5EX5 A;  1ESV A;  4BC3 A;  4BGB A;  4DB3 A;  1U2V A;  1WOQ A;  4BQZ A;  1ATN A;  4H5V A;  1BUP A;  5E84 A;  3O9T A;  3UKU B;  2P9S B;  1LOT B;  4AF1 A;  4K25 A;  1S3X A;  2YHW A;  5AZJ B;  3TPQ A;  5BPN A;  3G71 N;  1RGI A;  4PL7 A;  4BRE A;  4B1Z A;  3VEN A;  4C1N I;  5GAH P;  3HOT A;  5FPM A;  4MO5 A;  3WXI A;  4CZH A;  3S41 A;  1ATR A;  4U67 L;  5C12 A;  5GIO A;  1TYQ B;  1GLD G;  4PHT X;  1VQP N;  3CCJ N;  4H0X B;  1ZC6 A;  2Q36 A;  3PLA A;  4KBO A;  4A57 A;  2GEM A;  1VAZ A;  2WUS A;  3TSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...