4BRGA

Legionella pneumophila ntpdase1 crystal form ii (closed) in complex with mg gmppnp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
359
structure length
359
Chain Sequence
MDTNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 122
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brgA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brgA02
2P9LB 3ZEUA 1NM1A 4BRLA 3L6QA 2P9IA 3UKUA 3FZLA 3SMSA 2P9PB 4FWRA 2P9KA 2ZGZA 4BROA 3A5MC 4A61A 4BRAA 3FZHA 4DCHA 4BQZA 1QZ6A 3A8YA 4CBWA 1QQNA 2P9UB 4NO7A 5AQPA 3KVGA 3WXIA 4FWPA 3IDHA 4ISEA 4BR2A 3DXMA 4H5VA 3LL3A 2ITMA 5EX5A 3O80A 1YUWA 4H5RA 3VEOA 4CZHA 3CQXA 3A5LC 1U6ZA 1YAGA 2FXUA 2GEMA 3D2EB 3U9ZA 4F9OA 3ENHA 3O4WA 2QXLA 2V52B 1G99A 3I8BA 3UB5A 5JICA 2H3GX 1NGFA 5AQKA 3JXUA 2FSKA 4WQ4C 2IVNA 3H6EA 1J6ZA 3UE5A 1BG3A 2E20A 2A5XA 5BRFA 4FOEA 2E1ZA 4FPBA 4EAHD 3R6MA 5F2RA 2YHXA 1NBWA 3HTVA 4JHDA 3M6GA 4BRGA 5JLHA 4H0YB 3EL2A 1C0FA 4PKGA 3ID8A 5KQ8A 3FGUA 5EY4A 4JAXA 1BO5O 1HUXA 3H3OB 3MCPA 4YDUA 3M3ZA 3LM2A 1ESVA 3FLCO 5EVZA 2BUPA 3O6WA 1C0GA 1T44A 4BRQA 4PKIA 5AQGA 2A3ZA 4FWQA 1IG8A 5FPDA 4XH1A 2CH6A 3D7EO 3TU5A 2D0PA 3FE1A 1XUPO 4CZEA 5CE3A 3GDQA 1GLLO 3WQTA 4QS9A 2P9SB 1NGDA 1NMDA 1IJJA 3CJ7A 1TYQB 2J4RA 4H0PA 5AQUA 3CIPA 3FZFA 4FWMA 3CQYA 1V4SA 2GWJA 2FLOA 2E2QA 2E1YA 4BGAA 4CZKA 5BREA 5KQDA 1E4GT 3LDOA 4K41A 4K25A 1GLAG 4CZMA 2FF6A 4I6MA 5AQRA 2P9IB 4B1VA 1BA0A 3WXJA 4BC5A 2NLXA 2ZWHA 2ZF5O 2WUSA 2QW9A 4WQ5A 4BRPA 3FFKB 1BA1A 5AFUA 2IIRA 1HKCA 1SQKA 2D4WA 1MDUB 2CH5A 1CZAN 3DAWA 3H1VX 3MN5A 3U8XA 3ENOA 5AQFA 3H3NO 1RDWX 2YJFA 5TKYA 2GELA 2QWMA 4H5TA 3R8EA 3VENA 4CBUA 1KAXA 1HLUA 3VPZA 1DGKN 2PAVA 5KPRA 5JLFA 3ATVA 1HX1A 5AQLA 3AAQA 5AFUH 3FZMA 5AQTA 5AQSA 4BG9A 3D2FB 3MK6A 1GLBG 3WEEB 4BQLA 4BVOA 3EO3A 1JCFA 5FPEA 4IXCA 3BF3A 4Y0WA 1RFQA 4IJAA 2DPNA 4BC4A 1HKGA 4QS7A 2Q0UA 1KAZA 3LM9A 4ISGA 5AQNA 4JHDB 3LDQA 3EN9A 2IVPA 4O8KA 3AARA 1LCUA 2F9WA 5AZIA 3U9DA 5E26A 3ZX0A 4NB4A 2Q36A 4HTLA 3WUHA 4FO0A 4BRMA 2E88A 1ZXOA 4BR5A 3L0QA 1KXPA 4DB3A 1U2VB 3BP8A 3CJBA 4A2BA 3H45C 1NWKA 3VF2A 4B1WB 1MWMA 2ASOA 2D1KA 2FSNA 3VERA 3C7NA 3ZX2A 4BRIA 2YHYA 4AM6A 3VOVA 4IJNA 5JMVA 3GOIA 4GY2B 3EKUA 3HI0A 3VEYA 1GLCG 3W0LA 2GUPA 4M63C 2FF3B 4RWTA 3GBTA 4CZIA 2Q31A 4BGBA 4IZ9A 4BVPA 2VYPA 2PBDA 4BRHA 3ZETA 3DXKA 3GL1A 1BUPA 5FPNA 1XC3A 1Q18A 4WQ4A 1NGIA 2HMPA 2P9NB 2P9LA 1JCGA 2NRHA 1HKBA 2YJEA 1K8KB 2ASMA 3UKRB 3VETA 3CJCA 1XQSC 2P9PA 5BRDA 4FWKA 4FSVA 1X3MA 4FWSA 3EZWA 4CZLA 1NGHA 2KHOA 4JD2A 3H1QA 4FWNA 4BR4A 5AZJA 4B1XB 5KPTA 2P9UA 4CD1A 1TUYA 2AP1A 3A0IX 2GTDA 2QWQA 3AY9A 4H03B 3HM8A 3A5OC 5AQYA 2ZGYA 1QZ5A 2OANA 2CGJA 1BDGA 4CD3A 1SZ2A 5AQXA 4K42A 4EHUA 4K43A 2QWOA 2IVOA 2E2NA 4H0OA 3IUCA 3ULEA 3ZEUB 3D2EA 3WQUA 1T6DA 5AQJA 4PKHA 4DHYA 4C23A 1TUUA 3UKUB 5BR9A 3SMPA 3SJHA 3GE1A 1ATSA 2P9KB 1ZBSA 2Q0RA 4HWIA 1DEJA 4BC3A 3QB0A 3GG4A 4QS8A 3VGLA 4AM7A 4BR7A 5BPMA 4GNIA 5I9EB 4FWLA 5F1XA 3CJAA 5BN8A 3EKSA 3VESA 1H1VA 4EIAA 2I7NA 4RTFD 4O5FA 3DXMB 4CZJA 5BPLA 1ATRA 3KZBA 2ASPA 4ISFA 2QWLA 2FSJA 2AA4A 4H5NA 4LC9B 1QHAA 4KBOA 4PL7A 3QFUA 3CETA 2W41A 5LJVA 3QFPA 3VF4A 3L4IA 1X9JA 2Q2RA 3LDLA 4BRFA 3H46O 2V7ZA 2HOEA 4A62A 4BREA 2UYTA 4FWOA 4EHTA 1DKGD 5AQQA 1LOTB 1S22A 3OHRA 4XH5A 2P9SA 4A2AA 4MLEA 1TYQA 4H0TB 3B8AX 5BPNA 3RSEA 3A5NC 5EOYA 4Z94A 4BRDA 3F9MA 5F0XA 3MDQA 1QQMA 3S41A 3QICA 1V4TA 1EQYA 3W3DA 3P4IA 3QBXA 2Q1NA 5BRHA 4JN4A 2I7PA 1YXQA 1X3NA 4FPAA 1BWFO 3VEXA 3DJCA 3J8AA 4JD2B 5AZJB 5AQWA 5AQMA 1WOQA 2VWBA 2A41A 3O08A 3CI5A 1R59O 1E4FT 1D4XA 3IFRA 5AQOA 4WYBA 3O1BA 4JNEA 1Z05A 5ADXA 3AAPA 3VEZA 3MMVA 5B8HA 2A6AA 4BR0A 4L3QA 1NGGA 3ULEB 2HF4A 3CJ9A 4B9QA 4PL8A 5FPMA 1YVNA 2V7YA 4I6MB 2VCPA 3HBTA 4BRKA 2E2OA 3D2FA 5AQIA 5BN9A 1HPMA 3WEEA 4RCHA 3HZ6A 5AQHA 3CJ1A 4H0XB 3BUZB 5ELZA 2D0OA 3CHWA 3QBWA 5AQZA 4M7YA 1ATNA 3CERA 4IO8A 3VGKA 2W40A 5ADXH 5E84A 3U4LA 1BOTO 1NGBA 2QWRA 3WXLA 5EXWA 1NLVA 1SAZA 4H5WA 4YDUC 3LDNA 4DQ8A 1MA9B 1GLEG 1GLFO 3C0BA 4FL9A 3IMXA 3LDPA 1QQOA 4BRNA 4H0VB 3QDKA 1GLDG 1NGCA 1Z6RA 3ATUA 4B1UB 4CZFA 1U2VA 3QMLA 3DWLA 3MN7A 1HJOA 2Q97A 4MO5A 5AR0A 4B1YB 4CZGA 2EWSA 3BF1A 3MN9A 2QWPA 3VEVA 3O1WA 1WUAA 4CJ7A 1NGAA 1S3XA 3MN6A 4EFHA 4BG8A 1BU6O 4E1JA 4XEIA 3TPQA 4MLHA 1RGIA 3O8MA 2YI1A 3FR0A 3RSEB 1NGEA 5LJWA 5AZIB 4WQ5C 5AQVA 3VGMA 4CI6A 4FOIA 3G25A 2P9NA 4CBXA 2YCHA 1K8KA 2YHWA 3UKRA 3ZX3A 4IWVA 3VF6A 2A40A 1ZC6A 2E8AA 2V51B 4BC2A 3JS6A 1KAYA 1Y64A 3C7NB 2NZTA 3FZKA 3R9PA 3VEWA 1P8ZA 2GWKA 2QWNA 4MO4A 2CGKA 4J8FA 3SK3A 2BTFA 1GLJO 4M7XA 3WXKA 1NGJA 1OKJA 3O5BA 5LY3A 2E2PA 4XH4A 2QM1A 3ZETB 3BEXA 2CGLA 3WT0A 4B1ZA 3M1FA 5KPZA 3DXKB 3I33A 2A42A 3SLCA 2F9TA 3HSCA 2HF3A 1MWKA 1JCEA 1T6CA 3KHYA 4BRCA 4BR9A
chains in the Genus database with same CATH superfamily
2P9LB 2RE2A 3ZSYA 2HHQA 3NF9A 1IO2A 4DTJA 1SUQA 2P9KA 4NYFA 2G8FA 4A61A 4BRAA 4DCHA 2ITGA 4IFVA 4J2AA 2BDPA 4BQZA 1N32K 2O8BB 1QZ6A 3A8YA 4CBWA 1I94K 2KZZA 4IDHA 3WXIA 2RKIA 1IBMK 2O4GA 1XHZA 4LF5K 3LL3A 3O80A 5HROA 3V1QA 4E7JA 4CIEA 2ETJA 3MXJA 4CJPA 3D2EB 4HVJA 1VQON 4CGJA 3PSIA 1C0MA 4N41A 4E7LA 4CHOA 3I8BA 3UB5A 2H3GX 3JXUA 4WQ4C 3H6EA 1J6ZA 3PX6A 2E20A 3BDPA 1DT9A 2X74A 3HXMA 2A5XA 3O3FA 2E1ZA 3R6MA 5F2RA 3K58A 3HTVA 3M6GA 3DLEA 4BRGA 1JJ2M 3EL2A 5I42A 4PKGA 4W5NA 5EY4A 3RRHA 3ASMA 4JAXA 3SAHA 3WNHA 3PLAA 3FLCO 1SL0A 3O6WA 1C0GA 4BRQA 4BWMA 5AQGA 1IG8A 2VGMA 1NK4A 2D0PA 2O8CA 1XUPO 2QA4N 4CECA 1X9SA 4DUYK 1RT1A 4R5PA 5C25A 1LAWA 1IJJA 1JLFA 3QETA 1TYQB 3CFPA 2WONA 4KO0A 3CIPA 3FZFA 3CPWM 3WXMB 1V4SA 2FLOA 5C12A 5BREA 3BGRA 4Z4EA 3SQ4A 4CGHA 4LF9K 3DRRA 1BA0A 4B1VA 3SUNA 4AHVA 4N76A 2HHVA 2DY4A 3F5TA 2NLXA 4E89A 3DRSA 2QW9A 3FFKB 1BA1A 1LW0A 5AFUA 2Q3SA 4YOTA 3L2WA 2PYJA 2OPSA 1T3VA 5AQFA 3PO4A 1REVA 2G8HA 1RDWX 3TAEA 1N34K 2GELA 1L3TA 5KRTA 3THWB 1RTJA 4B8CA 2PAVA 1QSYA 5JLFA 4I2PA 3T1AA 2ZD1A 3NH2A 5AQLA 3AAQA 4F2RA 5AFUH 5LL6Z 4B9TA 2P1JA 5AQSA 1RDCA 1GLBG 4C8NA 1O13A 4M45A 1L3UA 3N4QA 4IXCA 1D9FA 5H1SQ 3BF3A 4JI7K 1RFQA 4IJAA 5M1PA 2DPNA 4YFUA 4DTMA 3ZT4A 4QS7A 4KB1A 5AQNA 4DFJA 3TSPA 4O8KA 2IVPA 1J9AA 3EN9A 3AARA 1BL3A 4CGGA 1OH5A 1QSSA 4FJJA 4NB4A 1JXEA 4HTLA 4G9ZA 4FO0A 4U7BA 3HM9A 3RMDA 1ZXOA 4RW7A 4UY8O 3TR8A 1FXXA 1TK5A 3VF2A 1YTAA 1MWMA 3B6PA 3LPTA 3KKSA 3C7NA 4B9UA 4DQRA 5M1OA 4IJNA 3GOIA 3HI0A 3W0LA 2GUPA 4DTOA 1JL1A 2B5JA 1IBKK 3ZT2A 4BRHA 3O9RA 1NMNA 1Q9YA 4JS4A 3BZKA 5FPNA 3G4SN 4WQ4A 1OVQA 4FLVA 1VQ6N 1NGIA 2HBLA 4BWJA 2AJQA 5CZ1A 3VETA 1S1UA 3CJCA 1N8RO 1X9WA 3MAQA 1FK9A 4FWKA 2W6KA 1VSEA 3FFIA 4FLZA 4FSVA 4N47A 1RBRA 3EZWA 1QSLA 4EZ9A 3H1QA 4FWNA 5HLFA 4PQUA 2OTLN 4LF6K 1K9MO 2P9UA 3LPUA 3A0IX 3KKRA 4ILHA 3OYMA 3D45A 3A5OC 5GINA 5GIPA 2ZGYA 1QZ5A 4LFCK 3BY5A 3V9ZA 3KTQA 3AA2A 3OW2M 2CGJA 4GKKK 3ALYA 4IEIA 4K42A 4K43A 2QWOA 2IAJA 4CK3A 2E2NA 3ZEUB 3ZSVA 4PKHA 4B3MK 3UKUB 1U04A 3SUPA 3GE1A 1ATSA 4W5OA 2Q0RA 1DEJA 1BQNA 3K5OA 2HHWA 4IDKA 4GNIA 4OPHA 2HNZA 4FWLA 3V9UA 4KHWA 1RBTA 5BN8A 3EKSA 2O8EB 2WC9A 4EIAA 1H1VA 1BIUA 4F3OA 3E01A 4O5FA 5BPLA 2UUAK 1OH7A 1ATRA 3KZBA 1ASVA 2QWLA 4FYDA 4CJQA 4DS5A 4H5NA 4GKJK 4LC9B 1QHAA 4QAGA 4EP5A 4PL7A 3QFUA 5LJVA 3ULDA 3QFPA 2YNFA 3E1YA 2Q2RA 3LDLA 1RT6A 3JYTA 4LF4K 1BI4A 3E66A 4MFBA 3S9HA 4OGCA 4YHHK 1ASUA 3OYHA 4FWOA 4DFKA 4KTZA 4FW1A 3OHRA 4XH5A 4DU3A 2P5OA 4H0TB 3B8AX 1TKDA 5EOYA 3QESA 4CIFA 3OJSA 4FJNA 3F9MA 4KH5A 1KC8O 3RMAA 3ENBA 2EHGA 5A2QO 1JLCA 4MDBA 3P4IA 3QBXA 3E9LA 4CW7B 2Y1IA 4QCLA 4FPAA 3EZ5A 3VEXA 1JLBA 5AZJB 5AQMA 1WOQA 1VQMN 3H08A 1L3VA 1T05A 3PY8A 1RILA 3CI5A 1R59O 1ITGA 2HSTA 1EO1A 2KW4A 1KFSA 3LALA 4DTSA 1Z05A 5BR8K 4FJLA 3MMVA 5B8HA 4CJEA 2HF4A 2ZM6K 3KD1E 2QI2A 2V7YA 2VCPA 2OPRA 5BN9A 4WFNL 4NLBA 1XWLA 3VQ6A 3TARA 3CHWA 4B3TK 4F3TA 3CERA 4MQ3A 3SQ0A 5E84A 4E0DA 1BOTO 3MEDA 5AJ3K 1SAZA 4EP4A 4CIGA 4DR5K 1S1XA 2XHBA 4JKFA 1QQOA 3NCIA 4H0VB 1GLDG 1NGCA 3ATUA 4B1UB 1R0AA 4CZFA 1D5AA 3TAQA 3TANA 4MO5A 1RNHA 4HHTA 4CZGA 1M1KO 4QOZB 3CCMN 2ZE2A 2QWPA 4FJHA 1WUAA 4CJFA 2RHKA 3DOLA 3DOKA 1LWCA 4XEIA 3KWIA 3TPQA 1RGIA 2E4LA 4CHYA 5LJWA 2OPQA 3DI6A 5AZIB 3VGMA 1RDUA 4C8LA 2BGGA 1JXBA 3AO4A 1FKPA 2E8AA 4CJ4A 1YF5L 4JLHA 4BC2A 1Y64A 2NZTA 4C8MA 2GWKA 4MO4A 4E7HA 2CGKA 3HK2A 2Z1JA 3NFAA 4ID1A 4M7XA 4Q5VA 1U48A 1NGJA 4F2SA 5C2FA 3JAMO 3O5BA 3L8BA 3ZSZA 2E2PA 4E1NA 3QLHA 2D0AA 2QM1A 4O0JA 3ZETB 3BEXA 4E19A 3KLIA 3WT0A 3SLCA 1D8YA 3HSCA 2HF3A 1MWKA 4FZXC 1JCEA 2QK9A 2WTUA 1IKXA 4BRCA 1HR0K 3G0ZA 1W9HA 4BRLA 3L3UA 1C0TA 4FJMA 4CEZA 2P9IA 3FZLA 2P9PB 4FWRA 4IG3A 1U4BA 5HOOA 2ZGZA 3SV3A 1LWEA 4JYAK 4AQYK 3NHGA 4DQSA 1IKWA 1QE1A 4NO7A 4JRPA 3V9XA 1Z25A 1YIJN 4KTWA 3IDHA 4JS5A 4BR2A 3MWTA 3DXMA 2PFUA 3T3FA 4FVMA 5EX5A 3T7ZA 4ZHRA 4H5RA 4M3RA 3VEOA 3OYJA 5CHIA 3A5LC 2LSNA 2YV0X 4Z4HA 1U6ZA 4IOXA 1YAGA 4DMNA 3HO1A 1RCHA 1TAQA 3U9ZA 3HL8A 3NH0A 3NE6A 3NF8A 3SBGA 4A5BA 1G99A 5JICA 5AQKA 2FSKA 4KHSA 4H8KA 2IVNA 4DTNA 3OBWA 3UE5A 3DRPA 2G8VA 3NMUA 3K2PA 4FOEA 4CJKA 3J80O 5HRNA 1WSEA 1HMVA 4DF8A 5SZTA 1QQCA 4NCBA 5DK5A 4H0YB 3K9KA 2NUBA 3ID8A 4ELTA 2VWJA 4HTUA 4IOCL 3AVGA 1J5EK 1UWBA 4FJ8A 4CGFA 3H3OB 3HYFA 3QEXA 3M3ZA 1ESVA 2VQFK 4R79A 3AO5A 4NXMK 4PKIA 4FWQA 1S72N 3FE1A 5CE3A 1GLLO 3CCVN 3OVNA 4CHZA 3R1XA 3LZIA 3AGRA 3QERA 4DUZK 3THYB 5DMRA 2F8TA 1XC9A 4JI4K 3HOTA 5AQUA 4FWMA 3CQYA 1HQEA 3I8DA 3CCJN 4BGAA 4CZKA 5KGWA 5KQDA 1E4GT 3LDOA 4K25A 1TV6A 4I6MA 5AQRA 3OYFA 3SI6A 2IGIA 3WXJA 3O3HA 1TK0A 4BDZA 2OZMA 1HRHA 2ZWHA 2WUSA 2BH1A 1XI1A 1TL3A 4DSJA 4DV5K 1TAUA 3O9QA 5JVHL 1HKCA 1SQKA 2NRTA 2D4WA 5KTQA 3HPHA 3THVA 4JI1K 1KVAA 4FW2A 3MN5A 1VSLA 1N36K 2D5RA 2DTUA 4OPJA 3KJVA 5TKWA 3VENA 2VG7A 3THXA 4JV5K 2HBMA 3D0PA 1VSKA 3MX5A 3ATVA 1HX1A 4DR2K 4WCEL 1HYZA 4Y1DA 4LF7K 3WEEB 1XHXA 1JCFA 5M1QA 2IC3A 4Y0WA 4OO1J 1HNZK 3CM5A 4BC4A 1NJWA 1BQMA 5C24A 4FJIA 1I39A 1KAZA 4ICLA 4ISGA 4E1MA 3LDQA 1C6VA 5GIOA 3VQ5A 3C6AA 4DR1K 5E26A 3ZSQA 1HNWK 4BRMA 4CF0A 4HCBA 3ZSWA 4DU1A 4DB3A 1U2VB 3BP8A 3AA4A 4UQGA 1WB9A 2FSNA 2P51A 3U3GA 3L3VA 4CEAA 4AM6A 3SAFA 3E9PA 5C42A 3VOVA 1TKZA 5JMVA 1ZBLA 3C6TA 4CVNE 4CZIA 2Q31A 2VYPA 3PX4A 3TSQA 3NGYA 1NJZA 1T03A 1HYSA 3RMCA 1VQNN 3OY9A 3GL1A 1Q18A 4WF9L 3DLHA 1SKSA 2D0BA 4AH9A 2PY5A 2P9NB 2P9LA 1JCGA 3K9JA 4IBNA 1FW6A 1SL2A 3T1YK 3OYKA 2NNWA 4CJUA 4N5SA 4O5BA 4FWSA 2QKBA 2O8BA 4FXDA 2KHOA 1S5JA 5M1KA 4JD2A 5DM6L 3RMBA 4E7KA 3HSTB 3ZYYX 3KK2A 4B9VA 2AP1A 2IDOA 5HL7L 2UXBK 2GTDA 4DTXA 4V19S 2QWQA 4JK7A 4CJTA 2G8KA 4FLTA 3AVHA 1MU2A 4F4KA 1WSHA 3IUCA 3ULEA 1RTHA 3D2EA 3WQUA 4LH5A 4OKKA 1TUUA 4KKOA 4LH4A 3SMPA 3HOSA 2OZSA 3SJHA 5E41A 1BCOA 4ZTFA 3GG4A 4DV6K 3CJAA 3OYLA 4GV9A 4NXNK 2I7NA 2RPIA 3DLRA 4RTFD 4KH4A 3OYGA 2ASPA 4IOAL 4MDAA 3V1OA 2YX6A 5CYQA 5GADP 3K57A 4IFYA 3SV4A 1TL1A 2PYLA 3CCRN 3KK7A 3OYBA 3VF4A 1S9GA 3L4IA 5C2DA 4W5TA 4DR3K 1X9JA 4KHUA 3NBPA 4I7FA 3H46O 4O55A 2V7ZA 1IV0A 3SYZA 4KV8A 2A1RA 4YOWA 3J7AP 1KQSM 2UYTA 2HNDA 1S22A 4CEFA 4FM2A 4Z4GA 3V1RA 2FBYA 3KWGA 4MLEA 4CE9A 3OYAA 1NK9A 1TYQA 5BPNA 3RSEA 3A5NC 4Z94A 1KLMA 2DFEA 3WNEA 3MXMA 3S41A 3HT3A 4ID5A 1V4TA 1NOZA 1EQYA 3CFRA 4FCYA 3W3DA 3ZLJA 4FZZA 2Q1NA 1RT7A 5GAGP 2I7PA 3QIPA 1IG9A 1BWFO 3DJCA 3ZSXA 1A5XA 4AHUA 2VWBA 2A41A 4CHPA 3CC2N 1BCMA 4O44A 1D4XA 3KK1A 4BDPA 3KD5E 3O1BA 3VA3A 5ADXA 3QNNA 4B3RK 3THWA 3HP9A 1OH8A 4EZ6A 1YJWN 2W6LA 2O4IA 2A6AA 2KLAA 3WNFA 3V81A 3CJ9A 4PHTX 3VTHA 4B9QA 4ILJA 3RWUA 3U3YA 3AVJA 1N6QA 1KLNA 3AVFA 4M3XA 4RCHA 3HZ6A 4OGEA 4H4MA 3O9SA 4GVEA 3SUQA 1ATNA 1GOAA 3PX0A 1I3AA 5ADXH 2ZJRL 2QWRA 1K8AO 4JEPA 1NLVA 1C0UA 4H5WA 4YDUC 2BANA 4J2DA 3LP0A 1MA9B 1GLEG 3C0BA 4G1QA 4DQ8A 4CFAA 4BE2A 2F8SA 3KLFA 1RTIA 1Z6RA 4NYNA 3IG1A 5EU7A 3B6OA 3TAPA 3F9KA 4M3UA 1DTQA 3PIOL 4CFCA 3DWLA 4DS4A 3MN7A 1EP4A 2JLEA 2QKKA 4B1YB 4O0IA 4B3SK 1TKXA 4FM0A 4DQQA 4CJ7A 5MLCQ 4K8ZA 3G10A 3E9OA 2YI1A 3OTOK 1K73O 4RG8A 4E3SA 3SBTA 3ZT0A 3UIQA 4WQ5C 5AQVA 4LFBK 4PWDA 4JRQA 5CY4A 4KI6A 2YCHA 1YJNN 4OPAA 1ZC6A 4DLEA 2V51B 1VQKN 1S1WA 3JS6A 2HW3A 2X6NA 1T8EA 1JLQA 3AO2A 5CR4A 2HHUA 1CZ9A 1NJYA 3RVCA 3QNOA 2GBZA 1OKJA 2F4VK 3ZT1A 3PUFA 1NG9A 2Z1HA 3VQEA 4B1ZA 3K5MA 3M1FA 4E7IA 3DXKB 3O4QA 2A42A 4DF4A 1B92A 3SAGA 4ILGB 1ZBUA 3ZEUA 2FBXA 4YY3K 1NM1A 1SKRA 3SZ2A 3L6QA 1NOYA 3UKUA 4TSXA 4GVMA 2XY8A 3AVKA 4FLXA 1WBBA 1YI2N 2O8EA 4ISEA 4CFBA 3M8QA 1ZBFA 4JKCA 3AA3A 2ITMA 4DR4K 1RBVA 1YUWA 1U45A 4C8KA 3L2VA 2VG5A 2XY6A 5FLXO 5CYMA 1WAJA 2FXUA 2GEMA 5J2NA 3LWMA 1KVBA 4Y1CA 2KFZA 3O4WA 3LAKA 5T7BA 4DV2K 2V52B 2KTQA 1NGFA 4FK4A 4CEDA 1BG3A 1VQ8N 1NKCA 4YNQA 3MWPA 1OVYA 5BRFA 2YNGA 2WBNA 5FRNA 1ZBHA 4JHDA 4JKHA 3RR8A 5JLHA 4FLYA 1F21A 1C0FA 5KQ8A 3FGUA 2VGNA 4JKBA 1B9FA 1WSIA 4Z0UA 1BO5O 1HUXA 2HHSA 4YDUA 4J2EA 3NDKA 3C94A 2DFHA 4FK0A 4JKGA 2GV9A 4DR6K 4CJLA 3EE9A 1N33K 2A3ZA 4CF9A 1WSJA 3Q7CA 3TU5A 3WNGA 1D9DA 4CZEA 3K0SA 3WQTA 1P90A 4AILC 2P9SB 3VQ9A 1NGDA 1NMDA 4W5RA 4KAZA 3CJ7A 4H0PA 1UAXA 3J7YP 3U6FA 2QTDA 2GWJA 2E2QA 1NU0A 4K41A 4CFDA 5KGXA 2P9IB 3SNNA 3S3OA 4DSIA 1OH6A 4BC5A 3C95A 4WQ5A 3AVAA 4BRPA 4Q0BA 3CG7A 2UU9K 2IIRA 4LF8K 4LSNA 4YORA 4B08A 4CHNA 1CZAN 2JWLA 3DAWA 3U8XA 3ENOA 1LV5A 3VQAA 3T69A 2HBKA 3H3NO 5HRRA 1YTUA 2QWMA 1J53A 3R8EA 3VN5A 4CBUA 1HLUA 3VPZA 5KPRA 3L4QA 2OYQA 1VQ5N 4DSLA 3D2FB 3AVNA 4BQLA 3P39A 1XMOK 2P5GA 3EO3A 4DFPA 3C6HA 2G8UA 2NRZA 5FPEA 3G71N 1SV5A 3ZT3A 4DSEA 1EX4A 1HKGA 2XY5A 3CFOA 2HBJA 3AVMA 4O4GA 2F9WA 3M8PA 4I9LA 5AZIA 3NH1A 2VG6A 3TTCA 2Q36A 4K0KK 1UOCA 4CGIA 2YKNA 2FC0A 4O8UA 3OA9A 4A2BA 4JKAA 2DFFA 1CXQA 1Y97A 4B1WB 3VERA 2ASOA 1W2BM 4FM1A 1NK8A 4KFBA 1JLGA 4BRIA 3QEWA 3TAGA 3VEYA 2G8WA 1GLCG 2HHHK 4M63C 4RW6A 4GW6A 4RWTA 4IFEA 4BGBA 3CM6A 1Z26A 2PBDA 4CCHA 1XNRK 4DU4A 3ZETA 1ZBIA 1W7AA 3MECA 3AVIA 1UA1A 4LY7A 2RN2A 1HKBA 2G8IA 1K8KB 3UKRB 1RT3A 3IKMA 2P9PA 1KVCA 1RBSA 4B9NA 4ELUA 3VQ8A 4HUGA 4CEBA 4A5AA 4Z4IA 3DLLL 4B1XB 5KPTA 2B6AA 4CD1A 1TUYA 3CCEN 4FJGA 3S3NA 3NGIA 1TK8A 4H03B 3HM8A 4BE0A 5AQYA 2OANA 3THXB 2YNHA 1YHQN 2O8FB 2PZSA 5FRMA 3DM2A 1FJGK 2IVOA 2I5JA 3VQBA 4C23A 1QTMA 1QHTA 5BR9A 5JS1A 4IG0A 2P9KB 1ZBSA 1VK0A 3VGLA 1BISA 1S1TA 1VSJA 3LDSA 4DV0K 3ID6A 3LP2A 1IKVA 4AHSA 3VESA 5FDLA 3VMFB 3LP3A 2FSJA 4JI2K 3C65A 2AA4A 1WNSA 2ATQA 3CETA 2W41A 4JK9A 3M8RA 3TTDA 5HRPA 4OLAA 3AVCA 5FROA 3CXCM 4M42A 1C1BA 4FLUA 1X9MA 2E5LK 4IO9L 5KI6A 2W42A 4JKDA 1HYVA 1W0HA 3LP1A 1DKGD 4EHTA 1Q9XA 4FJ5A 1NKBA 3THYA 1Q8IA 4A2AA 2NRRA 2WOMA 4CK2A 1WSFA 1WSGA 3EEQA 1ASWA 1XNQK 1DLOA 4X62K 4RW9A 1RT4A 3MDQA 3QICA 4NLCA 5JVGL 4IKFA 1Q7YO 2XY7A 1JL2A 4N56A 1X3NA 2X78A 2E6LA 4JKEA 4DTRA 4JD2B 3J8AA 3RTVA 1O1WA 2NRVA 2O8CB 1VRTA 3S3MA 2O8DA 1E4FT 3QIOA 1K6YA 4GV3A 4FLWA 4WYBA 4HUEA 3VQQA 1QS4A 3K5LA 4DR7K 1B9DA 4L3QA 5I3UA 3ULEB 1EKEA 1VSDA 4PL8A 5FPMA 4BRKA 3I0SA 3WEEA 1VSHA 1VRUA 3MCAB 3Q7BA 5AQHA 4H0XB 2D0OA 4YOXA 3QBWA 1JLEA 2KFNA 4IO8A 3V9SA 3IAYA 4CF8A 3OYNA 1C1AA 3CPEA 3KK3A 1N5YA 1VSFA 4FL9A 4BRNA 3NGZA 3AO1A 3I56N 4NCGA 4DV1K 4X66K 4B9SA 4CJSA 1U2VA 3SUOA 3JSMA 4YOVA 3V6DA 4DWIA 4FK2A 3DLKA 4WFAL 2Q97A 3P5JA 1VQ4N 1VQ7N 4DTUA 3CMEN 2EWSA 3HPGA 3BF1A 3MN9A 1RDDA 1YITN 4I9QA 1S3XA 3MN6A 4EFHA 3VQDA 5JS2A 4BG8A 4E1JA 1SKWA 3O8MA 1EETA 1VSMA 3FR0A 3RSEB 1NGEA 3MEEA 4M3ZA 1VQLN 4CI6A 4DV4K 4FOIA 3G25A 2P9NA 2IS3A 3NVKA 3AA5X 2YHWA 4IWVA 2A40A 1J5OA 4OLBA 3SQ1A 1KAYA 3C7NB 3OYIA 3CF5L 1P8ZA 2QWNA 2RF2A 3QINA 3SK3A 2BTFA 2R7YA 4OX9K 1QVGM 3WXKA 4L8RB 4DV3K 3DMJA 1J54A 5LY3A 4KI4A 4Z4FA 2D0CA 4LD0A 5KPZA 3TTFA 1CXUA 2HMIA 1T6CA 4DSKA 4BR9A 1Q86O 3SMSA 1Q82O 1YT3A 2OPPA 4BROA 3A5MC 2Z1GA 1X1PA 3FZHA 4CGDA 4M3YA 4JI6K 1QQNA 2KKZA 3NVMA 2P9UB 5AQPA 3KVGA 4FWPA 3HP6A 5HBMA 5J1EA 1VQ9N 4H5VA 4BACA 3F73A 2OCEA 3TWHA 1EXQA 2Z1IA 1ILYA 4CZHA 3CQXA 4C1NK 1LAVA 4HUFA 2NRXA 3OS1A 4WFBL 4F9OA 3ENHA 5DM7L 2HVHA 3TI0A 2QXLA 1HQUA 4PY5A 2FBTA 3PSFA 3PIPL 4OKEA 5CZ2A 2JGUA 4CK1A 3HVRA 3CCSN 2HNYA 4U67L 4YOUA 4FPBA 4EAHD 2YHXA 1U47A 1M90O 1NBWA 4C8OA 5C10A 4B9LA 3CQ8A 2OTJN 2QEXN 4Z4CA 1ZYQA 2XRIA 3MCPA 3CC4N 3LM2A 5EVZA 1CZBA 4KHNA 2BUPA 1T44A 1BI4B 5FPDA 4KRFA 4XH1A 2CH6A 3D7EO 1C1CA 1TKTA 3V4IA 3GDQA 4DKWA 4PA1A 4QS9A 3O9UA 2J4RA 3RR7A 3VQ4A 4ELVA 3RRGA 4KB0A 3O4NA 2E1YA 2JWKA 4CZMA 4DQPA 1GLAG 2FF6A 3KLHA 4AF1A 3K5NA 1NK0A 5D3GA 4GV6A 2KZMA 3D6RA 2ZF5O 4XIUA 2E6MA 3OYDA 3DLGA 3DYAA 3M8SA 1UA0A 1QVFM 4OPKA 3SPZA 2EX3A 4DV7K 1KSPA 1MDUB 4BY9C 2CH5A 3H1VX 5LMNK 3DLBA 4H4OA 2HHTA 5GAHP 4JI5K 2YJFA 5TKYA 1W97L 4H5TA 3AVLA 1KAXA 4LSLA 3MEGA 3I55N 1DGKN 4ZTJA 4DG1A 5GAEP 2XO7A 1SS6A 3FZMA 3ISNC 1WLJA 5AQTA 2IOCA 4BG9A 5C0YA 1SL1A 3MK6A 3AV9A 2KQ2A 4BVOA 3L2RA 3T1HK 1VQPN 3NAEA 1BHLA 1G15A 4B3OA 5J2MA 2Q0UA 3CYMA 3P31A 3LM9A 4CESA 5SWMA 3OJUA 4JHDB 1LCUA 3U9DA 4JI0K 1NKEA 3ZX0A 2HHXA 3WUHA 1KCFA 2E88A 3CC7N 4BR5A 3L0QA 1KXPA 3VQPA 4B9MA 2UUCK 3BZCA 3HJFA 3CJBA 3ZSRA 3H45C 1NWKA 1IKYA 3IS9A 4A59A 2D1KA 4JKGB 2GUIA 3SQ2A 3ZX2A 3NF6A 3OS2A 3TAFA 2OA8A 2YHYA 4AHTA 4CEEA 3M5RA 4KHQA 4GY2B 3CCQN 4LFAK 3EKUA 3ZSOA 1WN7A 3AGKA 4DTPA 2FF3B 1YVUA 1NJIO 3GBTA 4RW8A 4BVPA 4IZ9A 4IEEA 3DXKA 3EY1A 1T7PA 1BUPA 1XC3A 3EE8A 3T19A 3O9TA 2HMPA 2YNIA 2NRHA 2YJEA 2ASMA 3QEPA 3EYZA 1XQSC 5LMUK 4DLGA 3TABA 3OS0A 4YOYA 5BRDA 3NF7A 3I0RA 1X3MA 4CZLA 5J2PA 1NGHA 3CCLN 5KRSA 4BR4A 5AZJA 1EWQA 4DSFA 3VQCA 2WFBA 1HPZA 2X6SA 3CCUN 3MXIA 3PO5A 3AY9A 3R3LA 4X64K 1HNIA 4FJ9A 1WAFA 4BE1A 1KRPA 3KIOA 4I2QA 1BDGA 4CD3A 1SZ2A 5AQXA 4KH6A 4EHUA 4NCAA 2UXDK 1TGOA 3HRGA 4H0OA 1KFDA 1T6DA 5AQJA 4CHQA 4OVLA 4DHYA 4DFMA 1XMQK 1LW2A 2F96A 1HNVA 4HWIA 4BC3A 3QB0A 4QS8A 3O3GA 4AM7A 4BR7A 5BPMA 4HCCA 3LZJA 2GX9A 1KD1O 2UXCK 1FKOA 1S9EA 5I9EB 5F1XA 4JK8A 4JI8K 4BDYA 3CD6N 3TAMA 3DXMB 4CJVA 4M3TA 4CZJA 4KTQA 4CEQA 1WBDA 4ISFA 4CERA 3AO3A 3P1GA 2HB5A 3V9WA 4AHRA 4KBOA 2ZQBA 4J2BA 4BRFA 1VAZA 1RTDA 2HOEA 4A62A 4BREA 5AQQA 2VQEK 3VTIA 1LOTB 3P38A 5M1FA 1A5VA 2VWKA 2BE2A 3ITHA 3LAMA 1RT5A 4FVUA 1Q81O 2P9SA 1JLAA 1YJ9N 4JI3K 2QXFA 2F7TA 4BRDA 4M41A 3L2QA 1VSIA 5F0XA 3QEIA 2ZJQL 1QQMA 3SJJA 1IH7A 1EWRA 3IRXA 3OBYA 3KLGA 5HP1A 5BRHA 3QO9A 4JN4A 4WE1A 1YXQA 4RW4A 3LANA 3A2FA 1KTQA 4OKJA 5AQWA 5C15A 1RDBA 3QEVA 3O08A 4CEOA 2NRWA 1S6PA 2Y1JA 3L2UA 1E3MA 3IFRA 5AQOA 4CJRA 1U49A 4JNEA 3AAPA 3VEZA 1S6QA 4BR0A 1GOCA 1NGGA 2YKMA 3MX2A 1NNEA 1TVRA 1YVNA 4I6MB 3N4PA 3HBTA 2E2OA 3D2FA 5AQIA 1HPMA 4FJXA 3CJ1A 5ELZA 3BUZB 4GMJB 3K59A 3CMAN 5AQZA 4PUOA 4M7YA 1NJXA 1VHXA 3PV8A 2B4JA 1LWFA 3VGKA 2W40A 3U4LA 1NGBA 3WXLA 5EXWA 3HVTA 3LDNA 1GLFO 2UUBK 4KHPK 2YHAA 3IMXA 1NK7A 3LDPA 4X65K 3QDKA 1IBLK 3OYCA 3VA0A 4KPYA 1HNXK 3F2KA 5IT9O 1A5WA 4FJKA 4CJWA 4CF2A 3ZCMA 5K14A 3QMLA 4B8AB 4DQIA 3G6EN 4FZYA 1HJOA 5AR0A 1HJRA 1BGXT 3AVBA 3SPYA 2YHBA 4CF1A 3J7ZO 3VEVA 5J2QA 3O1WA 1NGAA 1RDAA 3HPOA 2ZJPL 1BU6O 4F8RA 4MLHA 3J81O 1GOBA 1CLQA 3VQ7A 3LWLA 1L3SA 2A1SA 4KHYA 1RBUA 4CJ3A 4K8XA 2HVIA 4OJRA 3SCXA 4CBXA 4W5QA 1NK6A 3TSUA 4KREA 1K8KA 3UKRA 3ZX3A 3OYEA 3VF6A 3VEWA 3FZKA 3R9PA 2FBVA 3P83D 4J8FA 4A57A 4FJ7A 3KLEA 1BIZA 5HRSA 1GLJO 4M3WA 2O8DB 5IWAK 1JKHA 4CJ5A 4C1NI 5M1NA 1S1VA 4XH4A 2O8FA 2CGLA 1RT2A 1NK5A 1L5UA 3I33A 3C6UA 2F9TA 3KHYA 1DTTA 4AHCA
chains in the Genus database with same CATH topology
2P9LB 3ZEUA 1NM1A 4BRLA 1Q86O 2RE2A 3L6QA 2P9IA 3UKUA 3FZLA 3SMSA 1Q82O 2P9PB 4FWRA 2P9KA 5HOOA 2ZGZA 4BROA 3A5MC 4A61A 4BRAA 3FZHA 4DCHA 4BQZA 1QZ6A 3A8YA 4CBWA 1QQNA 2KKZA 3NVMA 2P9UB 4NO7A 4IDHA 5AQPA 3KVGA 3WXIA 1YIJN 4FWPA 1YI2N 3IDHA 4ISEA 3MWTA 4BR2A 1VQ9N 3DXMA 4H5VA 3LL3A 2PFUA 4JKCA 2ITMA 5EX5A 3O80A 1YUWA 3T7ZA 1ILYA 4H5RA 3VEOA 4CZHA 3CQXA 5CHIA 4C1NK 3A5LC 1U6ZA 2NRXA 4IOXA 1YAGA 2FXUA 2GEMA 3D2EB 3U9ZA 4WFBL 4F9OA 1VQON 3ENHA 3O4WA 5DM7L 2QXLA 3SBGA 2V52B 4A5BA 1G99A 3I8BA 3UB5A 5JICA 2H3GX 1NGFA 3PIPL 5AQKA 3JXUA 2FSKA 4WQ4C 1VQKN 2IVNA 3H6EA 1J6ZA 3OBWA 3UE5A 3CCSN 1BG3A 2E20A 1VQ8N 4U67L 1DT9A 3MWPA 3NMUA 1OVYA 2A5XA 5BRFA 4FOEA 4YOUA 2E1ZA 4FPBA 4EAHD 3R6MA 2WBNA 5F2RA 2YHXA 1M90O 1NBWA 3HTVA 4JHDA 3M6GA 4JKHA 4BRGA 5C10A 5JLHA 1JJ2M 4H0YB 3EL2A 3K9KA 1C0FA 4PKGA 3ID8A 5KQ8A 4IOCL 2QEXN 2OTJN 3FGUA 2VGNA 4JKBA 5EY4A 4JAXA 1BO5O 3SAHA 1HUXA 3H3OB 3MCPA 4YDUA 3CC4N 3M3ZA 3LM2A 1ESVA 3PLAA 4R79A 3FLCO 5EVZA 2BUPA 4JKGA 3O6WA 1C0GA 1T44A 4BRQA 3EE9A 4PKIA 5AQGA 2A3ZA 4FWQA 1IG8A 2VGMA 5FPDA 1S72N 3Q7CA 4XH1A 2CH6A 3D7EO 3TU5A 2D0PA 3FE1A 1XUPO 4CZEA 5CE3A 2QA4N 3GDQA 1GLLO 4DKWA 3CCVN 3WQTA 3R1XA 4QS9A 1P90A 3AGRA 3O9UA 2P9SB 1NGDA 1NMDA 1IJJA 1TYQB 2J4RA 3CJ7A 4H0PA 3HOTA 5AQUA 3CIPA 2QTDA 3FZFA 4FWMA 3CQYA 3CPWM 3CCJN 3WXMB 1V4SA 2GWJA 2FLOA 2E2QA 2E1YA 2JWKA 4BGAA 4CZKA 5BREA 5C12A 5KQDA 1E4GT 3LDOA 4K41A 4K25A 1GLAG 4CZMA 2FF6A 4I6MA 5AQRA 2P9IB 4B1VA 1BA0A 3WXJA 4AF1A 4GV6A 3F5TA 4BC5A 2NLXA 2ZWHA 3D6RA 2ZF5O 2WUSA 2BH1A 2QW9A 4WQ5A 3O9QA 3FFKB 4BRPA 1BA1A 1QVFM 5AFUA 5JVHL 2IIRA 1HKCA 1SQKA 2NRTA 2D4WA 4YOTA 1MDUB 4BY9C 4YORA 2CH5A 1CZAN 2JWLA 3DAWA 3H1VX 3MN5A 3U8XA 3ENOA 4B9QA 1T3VA 5AQFA 2HBKA 3H3NO 3T69A 5GAHP 1RDWX 2YJFA 5TKYA 2GELA 5TKWA 1W97L 2QWMA 4H5TA 3R8EA 3VENA 4CBUA 1KAXA 1HLUA 3VPZA 3I55N 1DGKN 2HBMA 2PAVA 5KPRA 5JLFA 3L4QA 3MX5A 5GAEP 3ATVA 1HX1A 5AQLA 3AAQA 1VQ5N 5AFUH 1SS6A 3FZMA 4WCEL 5AQTA 5C0YA 5AQSA 4BG9A 3D2FB 3MK6A 1GLBG 3WEEB 3P39A 4BQLA 4BVOA 3EO3A 1O13A 3C6HA 1JCFA 2NRZA 5FPEA 3G71N 3N4QA 4IXCA 1VQPN 5H1SQ 3BF3A 5M1QA 4Y0WA 1RFQA 4OO1J 4IJAA 5M1PA 2DPNA 4BC4A 1HKGA 4QS7A 2HBJA 2Q0UA 3P31A 1KAZA 3LM9A 4ISGA 5AQNA 4JHDB 3TSPA 3LDQA 2IVPA 3EN9A 3C6AA 4O8KA 3AARA 1LCUA 2F9WA 5AZIA 3U9DA 5GIOA 5E26A 3ZX0A 3TTCA 4NB4A 2Q36A 4HTLA 3WUHA 4G9ZA 4FO0A 4BRMA 4U7BA 2E88A 3CC7N 1ZXOA 4BR5A 3L0QA 1KXPA 4UY8O 4O8UA 1U2VB 3BP8A 3CJBA 3OA9A 4A2BA 4DB3A 4JKAA 3H45C 1NWKA 3VF2A 4A59A 4B1WB 1MWMA 2ASOA 2D1KA 2FSNA 3VERA 1W2BM 4JKGB 3C7NA 3ZX2A 4BRIA 2YHYA 4AM6A 3SAFA 3E9PA 5M1OA 3M5RA 4IJNA 3VOVA 5JMVA 3GOIA 4GY2B 3CCQN 3EKUA 3HI0A 3VEYA 1GLCG 3W0LA 2GUPA 3AGKA 4M63C 2FF3B 1NJIO 4RWTA 3GBTA 4IFEA 2Q31A 4BGBA 4IZ9A 4BVPA 4CZIA 2VYPA 2PBDA 3TSQA 4BRHA 3O9RA 3ZETA 4IEEA 1VQNN 3DXKA 3GL1A 1BUPA 5FPNA 1XC3A 1Q18A 3G4SN 4WQ4A 4WF9L 3EE8A 1VQ6N 1NGIA 3O9TA 2HMPA 2P9NB 2P9LA 2NRHA 1JCGA 2HBLA 3K9JA 1HKBA 2YJEA 1K8KB 2ASMA 3UKRB 3VETA 3IKMA 3CJCA 1XQSC 2P9PA 2NNWA 4YOYA 1N8RO 5BRDA 4FWKA 4FSVA 1X3MA 4FWSA 3EZWA 4CZLA 4A5AA 1NGHA 3CCLN 2KHOA 5M1KA 5DM6L 4JD2A 3H1QA 4FWNA 4BR4A 5AZJA 3DLLL 4B1XB 5KPTA 2OTLN 1K9MO 2P9UA 2WFBA 3ZYYX 4CD1A 1TUYA 3CCEN 2AP1A 3CCUN 3A0IX 5HL7L 4ILHA 2GTDA 2QWQA 3AY9A 4H03B 3HM8A 3R3LA 4JK7A 3A5OC 5GINA 5GIPA 5AQYA 2ZGYA 1QZ5A 2OANA 1YHQN 3OW2M 2CGJA 4IEIA 1BDGA 4CD3A 1SZ2A 5AQXA 4K42A 4KH6A 4K43A 4EHUA 2QWOA 2IVOA 3HRGA 2E2NA 4H0OA 3IUCA 3ULEA 3ZEUB 3D2EA 3WQUA 1T6DA 5AQJA 4PKHA 4DHYA 4C23A 1TUUA 3UKUB 5BR9A 3SMPA 3HOSA 3SJHA 3GE1A 1ATSA 2P9KB 1ZBSA 2Q0RA 4HWIA 1DEJA 4BC3A 3QB0A 3GG4A 4QS8A 3VGLA 4AM7A 4BR7A 5BPMA 2GX9A 1KD1O 3ID6A 4GNIA 5I9EB 4OPHA 4FWLA 5F1XA 4JK8A 3CJAA 4GV9A 5BN8A 3EKSA 2WC9A 3VESA 1H1VA 4EIAA 3CD6N 2I7NA 4RTFD 4O5FA 3DXMB 4KH4A 4CZJA 5BPLA 1ATRA 3KZBA 3VMFB 2ASPA 4IOAL 4ISFA 2QWLA 4MDAA 2YX6A 2FSJA 5GADP 3C65A 2AA4A 4H5NA 4LC9B 1QHAA 4KBOA 4PL7A 3QFUA 3CETA 2W41A 4JK9A 5LJVA 3CCRN 3KK7A 3QFPA 3TTDA 3VF4A 3L4IA 5C2DA 1X9JA 3CXCM 3E1YA 2Q2RA 3LDLA 4BRFA 1VAZA 3H46O 4IO9L 2V7ZA 3E66A 2HOEA 4YOWA 4JKDA 4A62A 1KQSM 4BREA 2UYTA 4FWOA 4EHTA 1DKGD 5AQQA 3VTIA 1LOTB 1S22A 3P38A 5M1FA 3OHRA 4XH5A 4FVUA 1Q81O 2P9SA 4A2AA 2NRRA 3KWGA 4MLEA 1YJ9N 1TYQA 4H0TB 3B8AX 5BPNA 3RSEA 3A5NC 5EOYA 4Z94A 2F7TA 4BRDA 3F9MA 4KH5A 1KC8O 5F0XA 3ENBA 3MDQA 2ZJQL 1QQMA 3S41A 3QICA 4NLCA 1V4TA 1EQYA 3OBYA 4MDBA 3W3DA 5JVGL 3P4IA 3QBXA 2Q1NA 3E9LA 5BRHA 4JN4A 5GAGP 2I7PA 1Q7YO 1YXQA 1X3NA 4FPAA 4JKEA 1BWFO 3VEXA 3DJCA 3J8AA 4JD2B 5AZJB 5AQWA 5AQMA 1WOQA 2NRVA 2VWBA 5C15A 1VQMN 2A41A 3CC2N 3O08A 2NRWA 3CI5A 1R59O 1E4FT 1D4XA 2HSTA 4GV3A 1EO1A 3IFRA 5AQOA 4WYBA 3O1BA 4JNEA 1Z05A 5ADXA 3AAPA 1YJWN 3VEZA 3MMVA 5B8HA 2A6AA 2KLAA 4L3QA 1NGGA 4BR0A 3ULEB 2HF4A 3CJ9A 3MX2A 4PHTX 3VTHA 2QI2A 4PL8A 5FPMA 1YVNA 2V7YA 3N4PA 4I6MB 4ILJA 2VCPA 3HBTA 4BRKA 2E2OA 3D2FA 5AQIA 5BN9A 1HPMA 3WEEA 4WFNL 4RCHA 3HZ6A 3MCAB 3Q7BA 4NLBA 3CJ1A 4H0XB 3BUZB 5ELZA 5AQHA 2D0OA 4YOXA 3CHWA 3CMAN 3QBWA 5AQZA 4M7YA 3O9SA 4GVEA 1ATNA 3CERA 4IO8A 3VGKA 2W40A 5ADXH 5E84A 3U4LA 1BOTO 3CPEA 2ZJRL 1NGBA 2QWRA 3WXLA 1K8AO 4JEPA 5EXWA 1NLVA 1SAZA 4H5WA 4YDUC 3LDNA 4DQ8A 1MA9B 1GLEG 1GLFO 3C0BA 4FL9A 3IMXA 4JKFA 3LDPA 1QQOA 4BRNA 4H0VB 3QDKA 1GLDG 1NGCA 3I56N 1Z6RA 3ATUA 4B1UB 4CZFA 3F2KA 1U2VA 4YOVA 3QMLA 3PIOL 3DWLA 3MN7A 3G6EN 4WFAL 1HJOA 2Q97A 4MO5A 1VQ4N 5AR0A 4B1YB 1VQ7N 1M1KO 4CZGA 3CMEN 2EWSA 3BF1A 3MN9A 3CCMN 3J7ZO 2QWPA 3VEVA 3O1WA 1WUAA 4CJ7A 1YITN 2RHKA 1NGAA 1S3XA 3MN6A 4EFHA 5MLCQ 2ZJPL 4BG8A 1BU6O 4E1JA 4XEIA 3KWIA 4MLHA 3TPQA 1RGIA 3O8MA 3E9OA 2YI1A 3FR0A 1K73O 3RSEB 1NGEA 5LJWA 5AZIB 3SBTA 4WQ5C 5AQVA 1VQLN 3VGMA 4CI6A 4FOIA 3G25A 1RDUA 2P9NA 4CBXA 3NVKA 3TSUA 2YCHA 1YJNN 1K8KA 2YHWA 3UKRA 3ZX3A 4IWVA 3VF6A 2A40A 1ZC6A 2E8AA 4OPAA 1YF5L 2V51B 4BC2A 3JS6A 1KAYA 1Y64A 3C7NB 2NZTA 3FZKA 3R9PA 3VEWA 3CF5L 1P8ZA 2GWKA 2QWNA 4MO4A 2CGKA 4J8FA 4A57A 3SK3A 2BTFA 5CR4A 1GLJO 1QVGM 4M7XA 3WXKA 3RVCA 1NGJA 1OKJA 5C2FA 3O5BA 4C1NI 5M1NA 5LY3A 2E2PA 4XH4A 2QM1A 3ZETB 3BEXA 2CGLA 3WT0A 4B1ZA 3M1FA 3TTFA 5KPZA 3DXKB 3I33A 2A42A 3SLCA 2F9TA 3HSCA 2HF3A 1MWKA 1JCEA 3SAGA 4ILGB 1T6CA 3KHYA 4BRCA 4BR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9L B;  3ZEU A;  1NM1 A;  4BRL A;  3L6Q A;  2P9I A;  3UKU A;  3FZL A;  3SMS A;  2P9P B;  4FWR A;  2P9K A;  2ZGZ A;  4BRO A;  3A5M C;  4A61 A;  4BRA A;  3FZH A;  4DCH A;  4BQZ A;  1QZ6 A;  3A8Y A;  4CBW A;  1QQN A;  2P9U B;  4NO7 A;  5AQP A;  3KVG A;  3WXI A;  4FWP A;  3IDH A;  4ISE A;  4BR2 A;  3DXM A;  4H5V A;  3LL3 A;  2ITM A;  5EX5 A;  3O80 A;  1YUW A;  4H5R A;  3VEO A;  4CZH A;  3CQX A;  3A5L C;  1U6Z A;  1YAG A;  2FXU A;  2GEM A;  3D2E B;  3U9Z A;  4F9O A;  3ENH A;  3O4W A;  2QXL A;  2V52 B;  1G99 A;  3I8B A;  3UB5 A;  5JIC A;  2H3G X;  1NGF A;  5AQK A;  3JXU A;  2FSK A;  4WQ4 C;  2IVN A;  3H6E A;  1J6Z A;  3UE5 A;  1BG3 A;  2E20 A;  2A5X A;  5BRF A;  4FOE A;  2E1Z A;  4FPB A;  4EAH D;  3R6M A;  5F2R A;  2YHX A;  1NBW A;  3HTV A;  4JHD A;  3M6G A;  4BRG A;  5JLH A;  4H0Y B;  3EL2 A;  1C0F A;  4PKG A;  3ID8 A;  5KQ8 A;  3FGU A;  5EY4 A;  4JAX A;  1BO5 O;  1HUX A;  3H3O B;  3MCP A;  4YDU A;  3M3Z A;  3LM2 A;  1ESV A;  3FLC O;  5EVZ A;  2BUP A;  3O6W A;  1C0G A;  1T44 A;  4BRQ A;  4PKI A;  5AQG A;  2A3Z A;  4FWQ A;  1IG8 A;  5FPD A;  4XH1 A;  2CH6 A;  3D7E O;  3TU5 A;  2D0P A;  3FE1 A;  1XUP O;  4CZE A;  5CE3 A;  3GDQ A;  1GLL O;  3WQT A;  4QS9 A;  2P9S B;  1NGD A;  1NMD A;  1IJJ A;  3CJ7 A;  1TYQ B;  2J4R A;  4H0P A;  5AQU A;  3CIP A;  3FZF A;  4FWM A;  3CQY A;  1V4S A;  2GWJ A;  2FLO A;  2E2Q A;  2E1Y A;  4BGA A;  4CZK A;  5BRE A;  5KQD A;  1E4G T;  3LDO A;  4K41 A;  4K25 A;  1GLA G;  4CZM A;  2FF6 A;  4I6M A;  5AQR A;  2P9I B;  4B1V A;  1BA0 A;  3WXJ A;  4BC5 A;  2NLX A;  2ZWH A;  2ZF5 O;  2WUS A;  2QW9 A;  4WQ5 A;  4BRP A;  3FFK B;  1BA1 A;  5AFU A;  2IIR A;  1HKC A;  1SQK A;  2D4W A;  1MDU B;  2CH5 A;  1CZA N;  3DAW A;  3H1V X;  3MN5 A;  3U8X A;  3ENO A;  5AQF A;  3H3N O;  1RDW X;  2YJF A;  5TKY A;  2GEL A;  2QWM A;  4H5T A;  3R8E A;  3VEN A;  4CBU A;  1KAX A;  1HLU A;  3VPZ A;  1DGK N;  2PAV A;  5KPR A;  5JLF A;  3ATV A;  1HX1 A;  5AQL A;  3AAQ A;  5AFU H;  3FZM A;  5AQT A;  5AQS A;  4BG9 A;  3D2F B;  3MK6 A;  1GLB G;  3WEE B;  4BQL A;  4BVO A;  3EO3 A;  1JCF A;  5FPE A;  4IXC A;  3BF3 A;  4Y0W A;  1RFQ A;  4IJA A;  2DPN A;  4BC4 A;  1HKG A;  4QS7 A;  2Q0U A;  1KAZ A;  3LM9 A;  4ISG A;  5AQN A;  4JHD B;  3LDQ A;  3EN9 A;  2IVP A;  4O8K A;  3AAR A;  1LCU A;  2F9W A;  5AZI A;  3U9D A;  5E26 A;  3ZX0 A;  4NB4 A;  2Q36 A;  4HTL A;  3WUH A;  4FO0 A;  4BRM A;  2E88 A;  1ZXO A;  4BR5 A;  3L0Q A;  1KXP A;  4DB3 A;  1U2V B;  3BP8 A;  3CJB A;  4A2B A;  3H45 C;  1NWK A;  3VF2 A;  4B1W B;  1MWM A;  2ASO A;  2D1K A;  2FSN A;  3VER A;  3C7N A;  3ZX2 A;  4BRI A;  2YHY A;  4AM6 A;  3VOV A;  4IJN A;  5JMV A;  3GOI A;  4GY2 B;  3EKU A;  3HI0 A;  3VEY A;  1GLC G;  3W0L A;  2GUP A;  4M63 C;  2FF3 B;  4RWT A;  3GBT A;  4CZI A;  2Q31 A;  4BGB A;  4IZ9 A;  4BVP A;  2VYP A;  2PBD A;  4BRH A;  3ZET A;  3DXK A;  3GL1 A;  1BUP A;  5FPN A;  1XC3 A;  1Q18 A;  4WQ4 A;  1NGI A;  2HMP A;  2P9N B;  2P9L A;  1JCG A;  2NRH A;  1HKB A;  2YJE A;  1K8K B;  2ASM A;  3UKR B;  3VET A;  3CJC A;  1XQS C;  2P9P A;  5BRD A;  4FWK A;  4FSV A;  1X3M A;  4FWS A;  3EZW A;  4CZL A;  1NGH A;  2KHO A;  4JD2 A;  3H1Q A;  4FWN A;  4BR4 A;  5AZJ A;  4B1X B;  5KPT A;  2P9U A;  4CD1 A;  1TUY A;  2AP1 A;  3A0I X;  2GTD A;  2QWQ A;  3AY9 A;  4H03 B;  3HM8 A;  3A5O C;  5AQY A;  2ZGY A;  1QZ5 A;  2OAN A;  2CGJ A;  1BDG A;  4CD3 A;  1SZ2 A;  5AQX A;  4K42 A;  4EHU A;  4K43 A;  2QWO A;  2IVO A;  2E2N A;  4H0O A;  3IUC A;  3ULE A;  3ZEU B;  3D2E A;  3WQU A;  1T6D A;  5AQJ A;  4PKH A;  4DHY A;  4C23 A;  1TUU A;  3UKU B;  5BR9 A;  3SMP A;  3SJH A;  3GE1 A;  1ATS A;  2P9K B;  1ZBS A;  2Q0R A;  4HWI A;  1DEJ A;  4BC3 A;  3QB0 A;  3GG4 A;  4QS8 A;  3VGL A;  4AM7 A;  4BR7 A;  5BPM A;  4GNI A;  5I9E B;  4FWL A;  5F1X A;  3CJA A;  5BN8 A;  3EKS A;  3VES A;  1H1V A;  4EIA A;  2I7N A;  4RTF D;  4O5F A;  3DXM B;  4CZJ A;  5BPL A;  1ATR A;  3KZB A;  2ASP A;  4ISF A;  2QWL A;  2FSJ A;  2AA4 A;  4H5N A;  4LC9 B;  1QHA A;  4KBO A;  4PL7 A;  3QFU A;  3CET A;  2W41 A;  5LJV A;  3QFP A;  3VF4 A;  3L4I A;  1X9J A;  2Q2R A;  3LDL A;  4BRF A;  3H46 O;  2V7Z A;  2HOE A;  4A62 A;  4BRE A;  2UYT A;  4FWO A;  4EHT A;  1DKG D;  5AQQ A;  1LOT B;  1S22 A;  3OHR A;  4XH5 A;  2P9S A;  4A2A A;  4MLE A;  1TYQ A;  4H0T B;  3B8A X;  5BPN A;  3RSE A;  3A5N C;  5EOY A;  4Z94 A;  4BRD A;  3F9M A;  5F0X A;  3MDQ A;  1QQM A;  3S41 A;  3QIC A;  1V4T A;  1EQY A;  3W3D A;  3P4I A;  3QBX A;  2Q1N A;  5BRH A;  4JN4 A;  2I7P A;  1YXQ A;  1X3N A;  4FPA A;  1BWF O;  3VEX A;  3DJC A;  3J8A A;  4JD2 B;  5AZJ B;  5AQW A;  5AQM A;  1WOQ A;  2VWB A;  2A41 A;  3O08 A;  3CI5 A;  1R59 O;  1E4F T;  1D4X A;  3IFR A;  5AQO A;  4WYB A;  3O1B A;  4JNE A;  1Z05 A;  5ADX A;  3AAP A;  3VEZ A;  3MMV A;  5B8H A;  2A6A A;  4BR0 A;  4L3Q A;  1NGG A;  3ULE B;  2HF4 A;  3CJ9 A;  4B9Q A;  4PL8 A;  5FPM A;  1YVN A;  2V7Y A;  4I6M B;  2VCP A;  3HBT A;  4BRK A;  2E2O A;  3D2F A;  5AQI A;  5BN9 A;  1HPM A;  3WEE A;  4RCH A;  3HZ6 A;  5AQH A;  3CJ1 A;  4H0X B;  3BUZ B;  5ELZ A;  2D0O A;  3CHW A;  3QBW A;  5AQZ A;  4M7Y A;  1ATN A;  3CER A;  4IO8 A;  3VGK A;  2W40 A;  5ADX H;  5E84 A;  3U4L A;  1BOT O;  1NGB A;  2QWR A;  3WXL A;  5EXW A;  1NLV A;  1SAZ A;  4H5W A;  4YDU C;  3LDN A;  4DQ8 A;  1MA9 B;  1GLE G;  1GLF O;  3C0B A;  4FL9 A;  3IMX A;  3LDP A;  1QQO A;  4BRN A;  4H0V B;  3QDK A;  1GLD G;  1NGC A;  1Z6R A;  3ATU A;  4B1U B;  4CZF A;  1U2V A;  3QML A;  3DWL A;  3MN7 A;  1HJO A;  2Q97 A;  4MO5 A;  5AR0 A;  4B1Y B;  4CZG A;  2EWS A;  3BF1 A;  3MN9 A;  2QWP A;  3VEV A;  3O1W A;  1WUA A;  4CJ7 A;  1NGA A;  1S3X A;  3MN6 A;  4EFH A;  4BG8 A;  1BU6 O;  4E1J A;  4XEI A;  3TPQ A;  4MLH A;  1RGI A;  3O8M A;  2YI1 A;  3FR0 A;  3RSE B;  1NGE A;  5LJW A;  5AZI B;  4WQ5 C;  5AQV A;  3VGM A;  4CI6 A;  4FOI A;  3G25 A;  2P9N A;  4CBX A;  2YCH A;  1K8K A;  2YHW A;  3UKR A;  3ZX3 A;  4IWV A;  3VF6 A;  2A40 A;  1ZC6 A;  2E8A A;  2V51 B;  4BC2 A;  3JS6 A;  1KAY A;  1Y64 A;  3C7N B;  2NZT A;  3FZK A;  3R9P A;  3VEW A;  1P8Z A;  2GWK A;  2QWN A;  4MO4 A;  2CGK A;  4J8F A;  3SK3 A;  2BTF A;  1GLJ O;  4M7X A;  3WXK A;  1NGJ A;  1OKJ A;  3O5B A;  5LY3 A;  2E2P A;  4XH4 A;  2QM1 A;  3ZET B;  3BEX A;  2CGL A;  3WT0 A;  4B1Z A;  3M1F A;  5KPZ A;  3DXK B;  3I33 A;  2A42 A;  3SLC A;  2F9T A;  3HSC A;  2HF3 A;  1MWK A;  1JCE A;  1T6C A;  3KHY A;  4BRC A;  4BR9 A; 
#chains in the Genus database with same CATH topology
 2P9L B;  2RE2 A;  3ZSY A;  2HHQ A;  3NF9 A;  1IO2 A;  4DTJ A;  1SUQ A;  2P9K A;  4NYF A;  2G8F A;  4A61 A;  4BRA A;  4DCH A;  2ITG A;  4IFV A;  4J2A A;  2BDP A;  4BQZ A;  1N32 K;  2O8B B;  1QZ6 A;  3A8Y A;  4CBW A;  1I94 K;  2KZZ A;  4IDH A;  3WXI A;  2RKI A;  1IBM K;  2O4G A;  1XHZ A;  4LF5 K;  3LL3 A;  3O80 A;  5HRO A;  3V1Q A;  4E7J A;  4CIE A;  2ETJ A;  3MXJ A;  4CJP A;  3D2E B;  4HVJ A;  1VQO N;  4CGJ A;  3PSI A;  1C0M A;  4N41 A;  4E7L A;  4CHO A;  3I8B A;  3UB5 A;  2H3G X;  3JXU A;  4WQ4 C;  3H6E A;  1J6Z A;  3PX6 A;  2E20 A;  3BDP A;  1DT9 A;  2X74 A;  3HXM A;  2A5X A;  3O3F A;  2E1Z A;  3R6M A;  5F2R A;  3K58 A;  3HTV A;  3M6G A;  3DLE A;  4BRG A;  1JJ2 M;  3EL2 A;  5I42 A;  4PKG A;  4W5N A;  5EY4 A;  3RRH A;  3ASM A;  4JAX A;  3SAH A;  3WNH A;  3PLA A;  3FLC O;  1SL0 A;  3O6W A;  1C0G A;  4BRQ A;  4BWM A;  5AQG A;  1IG8 A;  2VGM A;  1NK4 A;  2D0P A;  2O8C A;  1XUP O;  2QA4 N;  4CEC A;  1X9S A;  4DUY K;  1RT1 A;  4R5P A;  5C25 A;  1LAW A;  1IJJ A;  1JLF A;  3QET A;  1TYQ B;  3CFP A;  2WON A;  4KO0 A;  3CIP A;  3FZF A;  3CPW M;  3WXM B;  1V4S A;  2FLO A;  5C12 A;  5BRE A;  3BGR A;  4Z4E A;  3SQ4 A;  4CGH A;  4LF9 K;  3DRR A;  1BA0 A;  4B1V A;  3SUN A;  4AHV A;  4N76 A;  2HHV A;  2DY4 A;  3F5T A;  2NLX A;  4E89 A;  3DRS A;  2QW9 A;  3FFK B;  1BA1 A;  1LW0 A;  5AFU A;  2Q3S A;  4YOT A;  3L2W A;  2PYJ A;  2OPS A;  1T3V A;  5AQF A;  3PO4 A;  1REV A;  2G8H A;  1RDW X;  3TAE A;  1N34 K;  2GEL A;  1L3T A;  5KRT A;  3THW B;  1RTJ A;  4B8C A;  2PAV A;  1QSY A;  5JLF A;  4I2P A;  3T1A A;  2ZD1 A;  3NH2 A;  5AQL A;  3AAQ A;  4F2R A;  5AFU H;  5LL6 Z;  4B9T A;  2P1J A;  5AQS A;  1RDC A;  1GLB G;  4C8N A;  1O13 A;  4M45 A;  1L3U A;  3N4Q A;  4IXC A;  1D9F A;  5H1S Q;  3BF3 A;  4JI7 K;  1RFQ A;  4IJA A;  5M1P A;  2DPN A;  4YFU A;  4DTM A;  3ZT4 A;  4QS7 A;  4KB1 A;  5AQN A;  4DFJ A;  3TSP A;  4O8K A;  2IVP A;  1J9A A;  3EN9 A;  3AAR A;  1BL3 A;  4CGG A;  1OH5 A;  1QSS A;  4FJJ A;  4NB4 A;  1JXE A;  4HTL A;  4G9Z A;  4FO0 A;  4U7B A;  3HM9 A;  3RMD A;  1ZXO A;  4RW7 A;  4UY8 O;  3TR8 A;  1FXX A;  1TK5 A;  3VF2 A;  1YTA A;  1MWM A;  3B6P A;  3LPT A;  3KKS A;  3C7N A;  4B9U A;  4DQR A;  5M1O A;  4IJN A;  3GOI A;  3HI0 A;  3W0L A;  2GUP A;  4DTO A;  1JL1 A;  2B5J A;  1IBK K;  3ZT2 A;  4BRH A;  3O9R A;  1NMN A;  1Q9Y A;  4JS4 A;  3BZK A;  5FPN A;  3G4S N;  4WQ4 A;  1OVQ A;  4FLV A;  1VQ6 N;  1NGI A;  2HBL A;  4BWJ A;  2AJQ A;  5CZ1 A;  3VET A;  1S1U A;  3CJC A;  1N8R O;  1X9W A;  3MAQ A;  1FK9 A;  4FWK A;  2W6K A;  1VSE A;  3FFI A;  4FLZ A;  4FSV A;  4N47 A;  1RBR A;  3EZW A;  1QSL A;  4EZ9 A;  3H1Q A;  4FWN A;  5HLF A;  4PQU A;  2OTL N;  4LF6 K;  1K9M O;  2P9U A;  3LPU A;  3A0I X;  3KKR A;  4ILH A;  3OYM A;  3D45 A;  3A5O C;  5GIN A;  5GIP A;  2ZGY A;  1QZ5 A;  4LFC K;  3BY5 A;  3V9Z A;  3KTQ A;  3AA2 A;  3OW2 M;  2CGJ A;  4GKK K;  3ALY A;  4IEI A;  4K42 A;  4K43 A;  2QWO A;  2IAJ A;  4CK3 A;  2E2N A;  3ZEU B;  3ZSV A;  4PKH A;  4B3M K;  3UKU B;  1U04 A;  3SUP A;  3GE1 A;  1ATS A;  4W5O A;  2Q0R A;  1DEJ A;  1BQN A;  3K5O A;  2HHW A;  4IDK A;  4GNI A;  4OPH A;  2HNZ A;  4FWL A;  3V9U A;  4KHW A;  1RBT A;  5BN8 A;  3EKS A;  2O8E B;  2WC9 A;  4EIA A;  1H1V A;  1BIU A;  4F3O A;  3E01 A;  4O5F A;  5BPL A;  2UUA K;  1OH7 A;  1ATR A;  3KZB A;  1ASV A;  2QWL A;  4FYD A;  4CJQ A;  4DS5 A;  4H5N A;  4GKJ K;  4LC9 B;  1QHA A;  4QAG A;  4EP5 A;  4PL7 A;  3QFU A;  5LJV A;  3ULD A;  3QFP A;  2YNF A;  3E1Y A;  2Q2R A;  3LDL A;  1RT6 A;  3JYT A;  4LF4 K;  1BI4 A;  3E66 A;  4MFB A;  3S9H A;  4OGC A;  4YHH K;  1ASU A;  3OYH A;  4FWO A;  4DFK A;  4KTZ A;  4FW1 A;  3OHR A;  4XH5 A;  4DU3 A;  2P5O A;  4H0T B;  3B8A X;  1TKD A;  5EOY A;  3QES A;  4CIF A;  3OJS A;  4FJN A;  3F9M A;  4KH5 A;  1KC8 O;  3RMA A;  3ENB A;  2EHG A;  5A2Q O;  1JLC A;  4MDB A;  3P4I A;  3QBX A;  3E9L A;  4CW7 B;  2Y1I A;  4QCL A;  4FPA A;  3EZ5 A;  3VEX A;  1JLB A;  5AZJ B;  5AQM A;  1WOQ A;  1VQM N;  3H08 A;  1L3V A;  1T05 A;  3PY8 A;  1RIL A;  3CI5 A;  1R59 O;  1ITG A;  2HST A;  1EO1 A;  2KW4 A;  1KFS A;  3LAL A;  4DTS A;  1Z05 A;  5BR8 K;  4FJL A;  3MMV A;  5B8H A;  4CJE A;  2HF4 A;  2ZM6 K;  3KD1 E;  2QI2 A;  2V7Y A;  2VCP A;  2OPR A;  5BN9 A;  4WFN L;  4NLB A;  1XWL A;  3VQ6 A;  3TAR A;  3CHW A;  4B3T K;  4F3T A;  3CER A;  4MQ3 A;  3SQ0 A;  5E84 A;  4E0D A;  1BOT O;  3MED A;  5AJ3 K;  1SAZ A;  4EP4 A;  4CIG A;  4DR5 K;  1S1X A;  2XHB A;  4JKF A;  1QQO A;  3NCI A;  4H0V B;  1GLD G;  1NGC A;  3ATU A;  4B1U B;  1R0A A;  4CZF A;  1D5A A;  3TAQ A;  3TAN A;  4MO5 A;  1RNH A;  4HHT A;  4CZG A;  1M1K O;  4QOZ B;  3CCM N;  2ZE2 A;  2QWP A;  4FJH A;  1WUA A;  4CJF A;  2RHK A;  3DOL A;  3DOK A;  1LWC A;  4XEI A;  3KWI A;  3TPQ A;  1RGI A;  2E4L A;  4CHY A;  5LJW A;  2OPQ A;  3DI6 A;  5AZI B;  3VGM A;  1RDU A;  4C8L A;  2BGG A;  1JXB A;  3AO4 A;  1FKP A;  2E8A A;  4CJ4 A;  1YF5 L;  4JLH A;  4BC2 A;  1Y64 A;  2NZT A;  4C8M A;  2GWK A;  4MO4 A;  4E7H A;  2CGK A;  3HK2 A;  2Z1J A;  3NFA A;  4ID1 A;  4M7X A;  4Q5V A;  1U48 A;  1NGJ A;  4F2S A;  5C2F A;  3JAM O;  3O5B A;  3L8B A;  3ZSZ A;  2E2P A;  4E1N A;  3QLH A;  2D0A A;  2QM1 A;  4O0J A;  3ZET B;  3BEX A;  4E19 A;  3KLI A;  3WT0 A;  3SLC A;  1D8Y A;  3HSC A;  2HF3 A;  1MWK A;  4FZX C;  1JCE A;  2QK9 A;  2WTU A;  1IKX A;  4BRC A;  1HR0 K;  3G0Z A;  1W9H A;  4BRL A;  3L3U A;  1C0T A;  4FJM A;  4CEZ A;  2P9I A;  3FZL A;  2P9P B;  4FWR A;  4IG3 A;  1U4B A;  5HOO A;  2ZGZ A;  3SV3 A;  1LWE A;  4JYA K;  4AQY K;  3NHG A;  4DQS A;  1IKW A;  1QE1 A;  4NO7 A;  4JRP A;  3V9X A;  1Z25 A;  1YIJ N;  4KTW A;  3IDH A;  4JS5 A;  4BR2 A;  3MWT A;  3DXM A;  2PFU A;  3T3F A;  4FVM A;  5EX5 A;  3T7Z A;  4ZHR A;  4H5R A;  4M3R A;  3VEO A;  3OYJ A;  5CHI A;  3A5L C;  2LSN A;  2YV0 X;  4Z4H A;  1U6Z A;  4IOX A;  1YAG A;  4DMN A;  3HO1 A;  1RCH A;  1TAQ A;  3U9Z A;  3HL8 A;  3NH0 A;  3NE6 A;  3NF8 A;  3SBG A;  4A5B A;  1G99 A;  5JIC A;  5AQK A;  2FSK A;  4KHS A;  4H8K A;  2IVN A;  4DTN A;  3OBW A;  3UE5 A;  3DRP A;  2G8V A;  3NMU A;  3K2P A;  4FOE A;  4CJK A;  3J80 O;  5HRN A;  1WSE A;  1HMV A;  4DF8 A;  5SZT A;  1QQC A;  4NCB A;  5DK5 A;  4H0Y B;  3K9K A;  2NUB A;  3ID8 A;  4ELT A;  2VWJ A;  4HTU A;  4IOC L;  3AVG A;  1J5E K;  1UWB A;  4FJ8 A;  4CGF A;  3H3O B;  3HYF A;  3QEX A;  3M3Z A;  1ESV A;  2VQF K;  4R79 A;  3AO5 A;  4NXM K;  4PKI A;  4FWQ A;  1S72 N;  3FE1 A;  5CE3 A;  1GLL O;  3CCV N;  3OVN A;  4CHZ A;  3R1X A;  3LZI A;  3AGR A;  3QER A;  4DUZ K;  3THY B;  5DMR A;  2F8T A;  1XC9 A;  4JI4 K;  3HOT A;  5AQU A;  4FWM A;  3CQY A;  1HQE A;  3I8D A;  3CCJ N;  4BGA A;  4CZK A;  5KGW A;  5KQD A;  1E4G T;  3LDO A;  4K25 A;  1TV6 A;  4I6M A;  5AQR A;  3OYF A;  3SI6 A;  2IGI A;  3WXJ A;  3O3H A;  1TK0 A;  4BDZ A;  2OZM A;  1HRH A;  2ZWH A;  2WUS A;  2BH1 A;  1XI1 A;  1TL3 A;  4DSJ A;  4DV5 K;  1TAU A;  3O9Q A;  5JVH L;  1HKC A;  1SQK A;  2NRT A;  2D4W A;  5KTQ A;  3HPH A;  3THV A;  4JI1 K;  1KVA A;  4FW2 A;  3MN5 A;  1VSL A;  1N36 K;  2D5R A;  2DTU A;  4OPJ A;  3KJV A;  5TKW A;  3VEN A;  2VG7 A;  3THX A;  4JV5 K;  2HBM A;  3D0P A;  1VSK A;  3MX5 A;  3ATV A;  1HX1 A;  4DR2 K;  4WCE L;  1HYZ A;  4Y1D A;  4LF7 K;  3WEE B;  1XHX A;  1JCF A;  5M1Q A;  2IC3 A;  4Y0W A;  4OO1 J;  1HNZ K;  3CM5 A;  4BC4 A;  1NJW A;  1BQM A;  5C24 A;  4FJI A;  1I39 A;  1KAZ A;  4ICL A;  4ISG A;  4E1M A;  3LDQ A;  1C6V A;  5GIO A;  3VQ5 A;  3C6A A;  4DR1 K;  5E26 A;  3ZSQ A;  1HNW K;  4BRM A;  4CF0 A;  4HCB A;  3ZSW A;  4DU1 A;  4DB3 A;  1U2V B;  3BP8 A;  3AA4 A;  4UQG A;  1WB9 A;  2FSN A;  2P51 A;  3U3G A;  3L3V A;  4CEA A;  4AM6 A;  3SAF A;  3E9P A;  5C42 A;  3VOV A;  1TKZ A;  5JMV A;  1ZBL A;  3C6T A;  4CVN E;  4CZI A;  2Q31 A;  2VYP A;  3PX4 A;  3TSQ A;  3NGY A;  1NJZ A;  1T03 A;  1HYS A;  3RMC A;  1VQN N;  3OY9 A;  3GL1 A;  1Q18 A;  4WF9 L;  3DLH A;  1SKS A;  2D0B A;  4AH9 A;  2PY5 A;  2P9N B;  2P9L A;  1JCG A;  3K9J A;  4IBN A;  1FW6 A;  1SL2 A;  3T1Y K;  3OYK A;  2NNW A;  4CJU A;  4N5S A;  4O5B A;  4FWS A;  2QKB A;  2O8B A;  4FXD A;  2KHO A;  1S5J A;  5M1K A;  4JD2 A;  5DM6 L;  3RMB A;  4E7K A;  3HST B;  3ZYY X;  3KK2 A;  4B9V A;  2AP1 A;  2IDO A;  5HL7 L;  2UXB K;  2GTD A;  4DTX A;  4V19 S;  2QWQ A;  4JK7 A;  4CJT A;  2G8K A;  4FLT A;  3AVH A;  1MU2 A;  4F4K A;  1WSH A;  3IUC A;  3ULE A;  1RTH A;  3D2E A;  3WQU A;  4LH5 A;  4OKK A;  1TUU A;  4KKO A;  4LH4 A;  3SMP A;  3HOS A;  2OZS A;  3SJH A;  5E41 A;  1BCO A;  4ZTF A;  3GG4 A;  4DV6 K;  3CJA A;  3OYL A;  4GV9 A;  4NXN K;  2I7N A;  2RPI A;  3DLR A;  4RTF D;  4KH4 A;  3OYG A;  2ASP A;  4IOA L;  4MDA A;  3V1O A;  2YX6 A;  5CYQ A;  5GAD P;  3K57 A;  4IFY A;  3SV4 A;  1TL1 A;  2PYL A;  3CCR N;  3KK7 A;  3OYB A;  3VF4 A;  1S9G A;  3L4I A;  5C2D A;  4W5T A;  4DR3 K;  1X9J A;  4KHU A;  3NBP A;  4I7F A;  3H46 O;  4O55 A;  2V7Z A;  1IV0 A;  3SYZ A;  4KV8 A;  2A1R A;  4YOW A;  3J7A P;  1KQS M;  2UYT A;  2HND A;  1S22 A;  4CEF A;  4FM2 A;  4Z4G A;  3V1R A;  2FBY A;  3KWG A;  4MLE A;  4CE9 A;  3OYA A;  1NK9 A;  1TYQ A;  5BPN A;  3RSE A;  3A5N C;  4Z94 A;  1KLM A;  2DFE A;  3WNE A;  3MXM A;  3S41 A;  3HT3 A;  4ID5 A;  1V4T A;  1NOZ A;  1EQY A;  3CFR A;  4FCY A;  3W3D A;  3ZLJ A;  4FZZ A;  2Q1N A;  1RT7 A;  5GAG P;  2I7P A;  3QIP A;  1IG9 A;  1BWF O;  3DJC A;  3ZSX A;  1A5X A;  4AHU A;  2VWB A;  2A41 A;  4CHP A;  3CC2 N;  1BCM A;  4O44 A;  1D4X A;  3KK1 A;  4BDP A;  3KD5 E;  3O1B A;  3VA3 A;  5ADX A;  3QNN A;  4B3R K;  3THW A;  3HP9 A;  1OH8 A;  4EZ6 A;  1YJW N;  2W6L A;  2O4I A;  2A6A A;  2KLA A;  3WNF A;  3V81 A;  3CJ9 A;  4PHT X;  3VTH A;  4B9Q A;  4ILJ A;  3RWU A;  3U3Y A;  3AVJ A;  1N6Q A;  1KLN A;  3AVF A;  4M3X A;  4RCH A;  3HZ6 A;  4OGE A;  4H4M A;  3O9S A;  4GVE A;  3SUQ A;  1ATN A;  1GOA A;  3PX0 A;  1I3A A;  5ADX H;  2ZJR L;  2QWR A;  1K8A O;  4JEP A;  1NLV A;  1C0U A;  4H5W A;  4YDU C;  2BAN A;  4J2D A;  3LP0 A;  1MA9 B;  1GLE G;  3C0B A;  4G1Q A;  4DQ8 A;  4CFA A;  4BE2 A;  2F8S A;  3KLF A;  1RTI A;  1Z6R A;  4NYN A;  3IG1 A;  5EU7 A;  3B6O A;  3TAP A;  3F9K A;  4M3U A;  1DTQ A;  3PIO L;  4CFC A;  3DWL A;  4DS4 A;  3MN7 A;  1EP4 A;  2JLE A;  2QKK A;  4B1Y B;  4O0I A;  4B3S K;  1TKX A;  4FM0 A;  4DQQ A;  4CJ7 A;  5MLC Q;  4K8Z A;  3G10 A;  3E9O A;  2YI1 A;  3OTO K;  1K73 O;  4RG8 A;  4E3S A;  3SBT A;  3ZT0 A;  3UIQ A;  4WQ5 C;  5AQV A;  4LFB K;  4PWD A;  4JRQ A;  5CY4 A;  4KI6 A;  2YCH A;  1YJN N;  4OPA A;  1ZC6 A;  4DLE A;  2V51 B;  1VQK N;  1S1W A;  3JS6 A;  2HW3 A;  2X6N A;  1T8E A;  1JLQ A;  3AO2 A;  5CR4 A;  2HHU A;  1CZ9 A;  1NJY A;  3RVC A;  3QNO A;  2GBZ A;  1OKJ A;  2F4V K;  3ZT1 A;  3PUF A;  1NG9 A;  2Z1H A;  3VQE A;  4B1Z A;  3K5M A;  3M1F A;  4E7I A;  3DXK B;  3O4Q A;  2A42 A;  4DF4 A;  1B92 A;  3SAG A;  4ILG B;  1ZBU A;  3ZEU A;  2FBX A;  4YY3 K;  1NM1 A;  1SKR A;  3SZ2 A;  3L6Q A;  1NOY A;  3UKU A;  4TSX A;  4GVM A;  2XY8 A;  3AVK A;  4FLX A;  1WBB A;  1YI2 N;  2O8E A;  4ISE A;  4CFB A;  3M8Q A;  1ZBF A;  4JKC A;  3AA3 A;  2ITM A;  4DR4 K;  1RBV A;  1YUW A;  1U45 A;  4C8K A;  3L2V A;  2VG5 A;  2XY6 A;  5FLX O;  5CYM A;  1WAJ A;  2FXU A;  2GEM A;  5J2N A;  3LWM A;  1KVB A;  4Y1C A;  2KFZ A;  3O4W A;  3LAK A;  5T7B A;  4DV2 K;  2V52 B;  2KTQ A;  1NGF A;  4FK4 A;  4CED A;  1BG3 A;  1VQ8 N;  1NKC A;  4YNQ A;  3MWP A;  1OVY A;  5BRF A;  2YNG A;  2WBN A;  5FRN A;  1ZBH A;  4JHD A;  4JKH A;  3RR8 A;  5JLH A;  4FLY A;  1F21 A;  1C0F A;  5KQ8 A;  3FGU A;  2VGN A;  4JKB A;  1B9F A;  1WSI A;  4Z0U A;  1BO5 O;  1HUX A;  2HHS A;  4YDU A;  4J2E A;  3NDK A;  3C94 A;  2DFH A;  4FK0 A;  4JKG A;  2GV9 A;  4DR6 K;  4CJL A;  3EE9 A;  1N33 K;  2A3Z A;  4CF9 A;  1WSJ A;  3Q7C A;  3TU5 A;  3WNG A;  1D9D A;  4CZE A;  3K0S A;  3WQT A;  1P90 A;  4AIL C;  2P9S B;  3VQ9 A;  1NGD A;  1NMD A;  4W5R A;  4KAZ A;  3CJ7 A;  4H0P A;  1UAX A;  3J7Y P;  3U6F A;  2QTD A;  2GWJ A;  2E2Q A;  1NU0 A;  4K41 A;  4CFD A;  5KGX A;  2P9I B;  3SNN A;  3S3O A;  4DSI A;  1OH6 A;  4BC5 A;  3C95 A;  4WQ5 A;  3AVA A;  4BRP A;  4Q0B A;  3CG7 A;  2UU9 K;  2IIR A;  4LF8 K;  4LSN A;  4YOR A;  4B08 A;  4CHN A;  1CZA N;  2JWL A;  3DAW A;  3U8X A;  3ENO A;  1LV5 A;  3VQA A;  3T69 A;  2HBK A;  3H3N O;  5HRR A;  1YTU A;  2QWM A;  1J53 A;  3R8E A;  3VN5 A;  4CBU A;  1HLU A;  3VPZ A;  5KPR A;  3L4Q A;  2OYQ A;  1VQ5 N;  4DSL A;  3D2F B;  3AVN A;  4BQL A;  3P39 A;  1XMO K;  2P5G A;  3EO3 A;  4DFP A;  3C6H A;  2G8U A;  2NRZ A;  5FPE A;  3G71 N;  1SV5 A;  3ZT3 A;  4DSE A;  1EX4 A;  1HKG A;  2XY5 A;  3CFO A;  2HBJ A;  3AVM A;  4O4G A;  2F9W A;  3M8P A;  4I9L A;  5AZI A;  3NH1 A;  2VG6 A;  3TTC A;  2Q36 A;  4K0K K;  1UOC A;  4CGI A;  2YKN A;  2FC0 A;  4O8U A;  3OA9 A;  4A2B A;  4JKA A;  2DFF A;  1CXQ A;  1Y97 A;  4B1W B;  3VER A;  2ASO A;  1W2B M;  4FM1 A;  1NK8 A;  4KFB A;  1JLG A;  4BRI A;  3QEW A;  3TAG A;  3VEY A;  2G8W A;  1GLC G;  2HHH K;  4M63 C;  4RW6 A;  4GW6 A;  4RWT A;  4IFE A;  4BGB A;  3CM6 A;  1Z26 A;  2PBD A;  4CCH A;  1XNR K;  4DU4 A;  3ZET A;  1ZBI A;  1W7A A;  3MEC A;  3AVI A;  1UA1 A;  4LY7 A;  2RN2 A;  1HKB A;  2G8I A;  1K8K B;  3UKR B;  1RT3 A;  3IKM A;  2P9P A;  1KVC A;  1RBS A;  4B9N A;  4ELU A;  3VQ8 A;  4HUG A;  4CEB A;  4A5A A;  4Z4I A;  3DLL L;  4B1X B;  5KPT A;  2B6A A;  4CD1 A;  1TUY A;  3CCE N;  4FJG A;  3S3N A;  3NGI A;  1TK8 A;  4H03 B;  3HM8 A;  4BE0 A;  5AQY A;  2OAN A;  3THX B;  2YNH A;  1YHQ N;  2O8F B;  2PZS A;  5FRM A;  3DM2 A;  1FJG K;  2IVO A;  2I5J A;  3VQB A;  4C23 A;  1QTM A;  1QHT A;  5BR9 A;  5JS1 A;  4IG0 A;  2P9K B;  1ZBS A;  1VK0 A;  3VGL A;  1BIS A;  1S1T A;  1VSJ A;  3LDS A;  4DV0 K;  3ID6 A;  3LP2 A;  1IKV A;  4AHS A;  3VES A;  5FDL A;  3VMF B;  3LP3 A;  2FSJ A;  4JI2 K;  3C65 A;  2AA4 A;  1WNS A;  2ATQ A;  3CET A;  2W41 A;  4JK9 A;  3M8R A;  3TTD A;  5HRP A;  4OLA A;  3AVC A;  5FRO A;  3CXC M;  4M42 A;  1C1B A;  4FLU A;  1X9M A;  2E5L K;  4IO9 L;  5KI6 A;  2W42 A;  4JKD A;  1HYV A;  1W0H A;  3LP1 A;  1DKG D;  4EHT A;  1Q9X A;  4FJ5 A;  1NKB A;  3THY A;  1Q8I A;  4A2A A;  2NRR A;  2WOM A;  4CK2 A;  1WSF A;  1WSG A;  3EEQ A;  1ASW A;  1XNQ K;  1DLO A;  4X62 K;  4RW9 A;  1RT4 A;  3MDQ A;  3QIC A;  4NLC A;  5JVG L;  4IKF A;  1Q7Y O;  2XY7 A;  1JL2 A;  4N56 A;  1X3N A;  2X78 A;  2E6L A;  4JKE A;  4DTR A;  4JD2 B;  3J8A A;  3RTV A;  1O1W A;  2NRV A;  2O8C B;  1VRT A;  3S3M A;  2O8D A;  1E4F T;  3QIO A;  1K6Y A;  4GV3 A;  4FLW A;  4WYB A;  4HUE A;  3VQQ A;  1QS4 A;  3K5L A;  4DR7 K;  1B9D A;  4L3Q A;  5I3U A;  3ULE B;  1EKE A;  1VSD A;  4PL8 A;  5FPM A;  4BRK A;  3I0S A;  3WEE A;  1VSH A;  1VRU A;  3MCA B;  3Q7B A;  5AQH A;  4H0X B;  2D0O A;  4YOX A;  3QBW A;  1JLE A;  2KFN A;  4IO8 A;  3V9S A;  3IAY A;  4CF8 A;  3OYN A;  1C1A A;  3CPE A;  3KK3 A;  1N5Y A;  1VSF A;  4FL9 A;  4BRN A;  3NGZ A;  3AO1 A;  3I56 N;  4NCG A;  4DV1 K;  4X66 K;  4B9S A;  4CJS A;  1U2V A;  3SUO A;  3JSM A;  4YOV A;  3V6D A;  4DWI A;  4FK2 A;  3DLK A;  4WFA L;  2Q97 A;  3P5J A;  1VQ4 N;  1VQ7 N;  4DTU A;  3CME N;  2EWS A;  3HPG A;  3BF1 A;  3MN9 A;  1RDD A;  1YIT N;  4I9Q A;  1S3X A;  3MN6 A;  4EFH A;  3VQD A;  5JS2 A;  4BG8 A;  4E1J A;  1SKW A;  3O8M A;  1EET A;  1VSM A;  3FR0 A;  3RSE B;  1NGE A;  3MEE A;  4M3Z A;  1VQL N;  4CI6 A;  4DV4 K;  4FOI A;  3G25 A;  2P9N A;  2IS3 A;  3NVK A;  3AA5 X;  2YHW A;  4IWV A;  2A40 A;  1J5O A;  4OLB A;  3SQ1 A;  1KAY A;  3C7N B;  3OYI A;  3CF5 L;  1P8Z A;  2QWN A;  2RF2 A;  3QIN A;  3SK3 A;  2BTF A;  2R7Y A;  4OX9 K;  1QVG M;  3WXK A;  4L8R B;  4DV3 K;  3DMJ A;  1J54 A;  5LY3 A;  4KI4 A;  4Z4F A;  2D0C A;  4LD0 A;  5KPZ A;  3TTF A;  1CXU A;  2HMI A;  1T6C A;  4DSK A;  4BR9 A;  1Q86 O;  3SMS A;  1Q82 O;  1YT3 A;  2OPP A;  4BRO A;  3A5M C;  2Z1G A;  1X1P A;  3FZH A;  4CGD A;  4M3Y A;  4JI6 K;  1QQN A;  2KKZ A;  3NVM A;  2P9U B;  5AQP A;  3KVG A;  4FWP A;  3HP6 A;  5HBM A;  5J1E A;  1VQ9 N;  4H5V A;  4BAC A;  3F73 A;  2OCE A;  3TWH A;  1EXQ A;  2Z1I A;  1ILY A;  4CZH A;  3CQX A;  4C1N K;  1LAV A;  4HUF A;  2NRX A;  3OS1 A;  4WFB L;  4F9O A;  3ENH A;  5DM7 L;  2HVH A;  3TI0 A;  2QXL A;  1HQU A;  4PY5 A;  2FBT A;  3PSF A;  3PIP L;  4OKE A;  5CZ2 A;  2JGU A;  4CK1 A;  3HVR A;  3CCS N;  2HNY A;  4U67 L;  4YOU A;  4FPB A;  4EAH D;  2YHX A;  1U47 A;  1M90 O;  1NBW A;  4C8O A;  5C10 A;  4B9L A;  3CQ8 A;  2OTJ N;  2QEX N;  4Z4C A;  1ZYQ A;  2XRI A;  3MCP A;  3CC4 N;  3LM2 A;  5EVZ A;  1CZB A;  4KHN A;  2BUP A;  1T44 A;  1BI4 B;  5FPD A;  4KRF A;  4XH1 A;  2CH6 A;  3D7E O;  1C1C A;  1TKT A;  3V4I A;  3GDQ A;  4DKW A;  4PA1 A;  4QS9 A;  3O9U A;  2J4R A;  3RR7 A;  3VQ4 A;  4ELV A;  3RRG A;  4KB0 A;  3O4N A;  2E1Y A;  2JWK A;  4CZM A;  4DQP A;  1GLA G;  2FF6 A;  3KLH A;  4AF1 A;  3K5N A;  1NK0 A;  5D3G A;  4GV6 A;  2KZM A;  3D6R A;  2ZF5 O;  4XIU A;  2E6M A;  3OYD A;  3DLG A;  3DYA A;  3M8S A;  1UA0 A;  1QVF M;  4OPK A;  3SPZ A;  2EX3 A;  4DV7 K;  1KSP A;  1MDU B;  4BY9 C;  2CH5 A;  3H1V X;  5LMN K;  3DLB A;  4H4O A;  2HHT A;  5GAH P;  4JI5 K;  2YJF A;  5TKY A;  1W97 L;  4H5T A;  3AVL A;  1KAX A;  4LSL A;  3MEG A;  3I55 N;  1DGK N;  4ZTJ A;  4DG1 A;  5GAE P;  2XO7 A;  1SS6 A;  3FZM A;  3ISN C;  1WLJ A;  5AQT A;  2IOC A;  4BG9 A;  5C0Y A;  1SL1 A;  3MK6 A;  3AV9 A;  2KQ2 A;  4BVO A;  3L2R A;  3T1H K;  1VQP N;  3NAE A;  1BHL A;  1G15 A;  4B3O A;  5J2M A;  2Q0U A;  3CYM A;  3P31 A;  3LM9 A;  4CES A;  5SWM A;  3OJU A;  4JHD B;  1LCU A;  3U9D A;  4JI0 K;  1NKE A;  3ZX0 A;  2HHX A;  3WUH A;  1KCF A;  2E88 A;  3CC7 N;  4BR5 A;  3L0Q A;  1KXP A;  3VQP A;  4B9M A;  2UUC K;  3BZC A;  3HJF A;  3CJB A;  3ZSR A;  3H45 C;  1NWK A;  1IKY A;  3IS9 A;  4A59 A;  2D1K A;  4JKG B;  2GUI A;  3SQ2 A;  3ZX2 A;  3NF6 A;  3OS2 A;  3TAF A;  2OA8 A;  2YHY A;  4AHT A;  4CEE A;  3M5R A;  4KHQ A;  4GY2 B;  3CCQ N;  4LFA K;  3EKU A;  3ZSO A;  1WN7 A;  3AGK A;  4DTP A;  2FF3 B;  1YVU A;  1NJI O;  3GBT A;  4RW8 A;  4BVP A;  4IZ9 A;  4IEE A;  3DXK A;  3EY1 A;  1T7P A;  1BUP A;  1XC3 A;  3EE8 A;  3T19 A;  3O9T A;  2HMP A;  2YNI A;  2NRH A;  2YJE A;  2ASM A;  3QEP A;  3EYZ A;  1XQS C;  5LMU K;  4DLG A;  3TAB A;  3OS0 A;  4YOY A;  5BRD A;  3NF7 A;  3I0R A;  1X3M A;  4CZL A;  5J2P A;  1NGH A;  3CCL N;  5KRS A;  4BR4 A;  5AZJ A;  1EWQ A;  4DSF A;  3VQC A;  2WFB A;  1HPZ A;  2X6S A;  3CCU N;  3MXI A;  3PO5 A;  3AY9 A;  3R3L A;  4X64 K;  1HNI A;  4FJ9 A;  1WAF A;  4BE1 A;  1KRP A;  3KIO A;  4I2Q A;  1BDG A;  4CD3 A;  1SZ2 A;  5AQX A;  4KH6 A;  4EHU A;  4NCA A;  2UXD K;  1TGO A;  3HRG A;  4H0O A;  1KFD A;  1T6D A;  5AQJ A;  4CHQ A;  4OVL A;  4DHY A;  4DFM A;  1XMQ K;  1LW2 A;  2F96 A;  1HNV A;  4HWI A;  4BC3 A;  3QB0 A;  4QS8 A;  3O3G A;  4AM7 A;  4BR7 A;  5BPM A;  4HCC A;  3LZJ A;  2GX9 A;  1KD1 O;  2UXC K;  1FKO A;  1S9E A;  5I9E B;  5F1X A;  4JK8 A;  4JI8 K;  4BDY A;  3CD6 N;  3TAM A;  3DXM B;  4CJV A;  4M3T A;  4CZJ A;  4KTQ A;  4CEQ A;  1WBD A;  4ISF A;  4CER A;  3AO3 A;  3P1G A;  2HB5 A;  3V9W A;  4AHR A;  4KBO A;  2ZQB A;  4J2B A;  4BRF A;  1VAZ A;  1RTD A;  2HOE A;  4A62 A;  4BRE A;  5AQQ A;  2VQE K;  3VTI A;  1LOT B;  3P38 A;  5M1F A;  1A5V A;  2VWK A;  2BE2 A;  3ITH A;  3LAM A;  1RT5 A;  4FVU A;  1Q81 O;  2P9S A;  1JLA A;  1YJ9 N;  4JI3 K;  2QXF A;  2F7T A;  4BRD A;  4M41 A;  3L2Q A;  1VSI A;  5F0X A;  3QEI A;  2ZJQ L;  1QQM A;  3SJJ A;  1IH7 A;  1EWR A;  3IRX A;  3OBY A;  3KLG A;  5HP1 A;  5BRH A;  3QO9 A;  4JN4 A;  4WE1 A;  1YXQ A;  4RW4 A;  3LAN A;  3A2F A;  1KTQ A;  4OKJ A;  5AQW A;  5C15 A;  1RDB A;  3QEV A;  3O08 A;  4CEO A;  2NRW A;  1S6P A;  2Y1J A;  3L2U A;  1E3M A;  3IFR A;  5AQO A;  4CJR A;  1U49 A;  4JNE A;  3AAP A;  3VEZ A;  1S6Q A;  4BR0 A;  1GOC A;  1NGG A;  2YKM A;  3MX2 A;  1NNE A;  1TVR A;  1YVN A;  4I6M B;  3N4P A;  3HBT A;  2E2O A;  3D2F A;  5AQI A;  1HPM A;  4FJX A;  3CJ1 A;  5ELZ A;  3BUZ B;  4GMJ B;  3K59 A;  3CMA N;  5AQZ A;  4PUO A;  4M7Y A;  1NJX A;  1VHX A;  3PV8 A;  2B4J A;  1LWF A;  3VGK A;  2W40 A;  3U4L A;  1NGB A;  3WXL A;  5EXW A;  3HVT A;  3LDN A;  1GLF O;  2UUB K;  4KHP K;  2YHA A;  3IMX A;  1NK7 A;  3LDP A;  4X65 K;  3QDK A;  1IBL K;  3OYC A;  3VA0 A;  4KPY A;  1HNX K;  3F2K A;  5IT9 O;  1A5W A;  4FJK A;  4CJW A;  4CF2 A;  3ZCM A;  5K14 A;  3QML A;  4B8A B;  4DQI A;  3G6E N;  4FZY A;  1HJO A;  5AR0 A;  1HJR A;  1BGX T;  3AVB A;  3SPY A;  2YHB A;  4CF1 A;  3J7Z O;  3VEV A;  5J2Q A;  3O1W A;  1NGA A;  1RDA A;  3HPO A;  2ZJP L;  1BU6 O;  4F8R A;  4MLH A;  3J81 O;  1GOB A;  1CLQ A;  3VQ7 A;  3LWL A;  1L3S A;  2A1S A;  4KHY A;  1RBU A;  4CJ3 A;  4K8X A;  2HVI A;  4OJR A;  3SCX A;  4CBX A;  4W5Q A;  1NK6 A;  3TSU A;  4KRE A;  1K8K A;  3UKR A;  3ZX3 A;  3OYE A;  3VF6 A;  3VEW A;  3FZK A;  3R9P A;  2FBV A;  3P83 D;  4J8F A;  4A57 A;  4FJ7 A;  3KLE A;  1BIZ A;  5HRS A;  1GLJ O;  4M3W A;  2O8D B;  5IWA K;  1JKH A;  4CJ5 A;  4C1N I;  5M1N A;  1S1V A;  4XH4 A;  2O8F A;  2CGL A;  1RT2 A;  1NK5 A;  1L5U A;  3I33 A;  3C6U A;  2F9T A;  3KHY A;  1DTT A;  4AHC A; 
#chains in the Genus database with same CATH homology
 2P9L B;  3ZEU A;  1NM1 A;  4BRL A;  1Q86 O;  2RE2 A;  3L6Q A;  2P9I A;  3UKU A;  3FZL A;  3SMS A;  1Q82 O;  2P9P B;  4FWR A;  2P9K A;  5HOO A;  2ZGZ A;  4BRO A;  3A5M C;  4A61 A;  4BRA A;  3FZH A;  4DCH A;  4BQZ A;  1QZ6 A;  3A8Y A;  4CBW A;  1QQN A;  2KKZ A;  3NVM A;  2P9U B;  4NO7 A;  4IDH A;  5AQP A;  3KVG A;  3WXI A;  1YIJ N;  4FWP A;  1YI2 N;  3IDH A;  4ISE A;  3MWT A;  4BR2 A;  1VQ9 N;  3DXM A;  4H5V A;  3LL3 A;  2PFU A;  4JKC A;  2ITM A;  5EX5 A;  3O80 A;  1YUW A;  3T7Z A;  1ILY A;  4H5R A;  3VEO A;  4CZH A;  3CQX A;  5CHI A;  4C1N K;  3A5L C;  1U6Z A;  2NRX A;  4IOX A;  1YAG A;  2FXU A;  2GEM A;  3D2E B;  3U9Z A;  4WFB L;  4F9O A;  1VQO N;  3ENH A;  3O4W A;  5DM7 L;  2QXL A;  3SBG A;  2V52 B;  4A5B A;  1G99 A;  3I8B A;  3UB5 A;  5JIC A;  2H3G X;  1NGF A;  3PIP L;  5AQK A;  3JXU A;  2FSK A;  4WQ4 C;  1VQK N;  2IVN A;  3H6E A;  1J6Z A;  3OBW A;  3UE5 A;  3CCS N;  1BG3 A;  2E20 A;  1VQ8 N;  4U67 L;  1DT9 A;  3MWP A;  3NMU A;  1OVY A;  2A5X A;  5BRF A;  4FOE A;  4YOU A;  2E1Z A;  4FPB A;  4EAH D;  3R6M A;  2WBN A;  5F2R A;  2YHX A;  1M90 O;  1NBW A;  3HTV A;  4JHD A;  3M6G A;  4JKH A;  4BRG A;  5C10 A;  5JLH A;  1JJ2 M;  4H0Y B;  3EL2 A;  3K9K A;  1C0F A;  4PKG A;  3ID8 A;  5KQ8 A;  4IOC L;  2QEX N;  2OTJ N;  3FGU A;  2VGN A;  4JKB A;  5EY4 A;  4JAX A;  1BO5 O;  3SAH A;  1HUX A;  3H3O B;  3MCP A;  4YDU A;  3CC4 N;  3M3Z A;  3LM2 A;  1ESV A;  3PLA A;  4R79 A;  3FLC O;  5EVZ A;  2BUP A;  4JKG A;  3O6W A;  1C0G A;  1T44 A;  4BRQ A;  3EE9 A;  4PKI A;  5AQG A;  2A3Z A;  4FWQ A;  1IG8 A;  2VGM A;  5FPD A;  1S72 N;  3Q7C A;  4XH1 A;  2CH6 A;  3D7E O;  3TU5 A;  2D0P A;  3FE1 A;  1XUP O;  4CZE A;  5CE3 A;  2QA4 N;  3GDQ A;  1GLL O;  4DKW A;  3CCV N;  3WQT A;  3R1X A;  4QS9 A;  1P90 A;  3AGR A;  3O9U A;  2P9S B;  1NGD A;  1NMD A;  1IJJ A;  1TYQ B;  2J4R A;  3CJ7 A;  4H0P A;  3HOT A;  5AQU A;  3CIP A;  2QTD A;  3FZF A;  4FWM A;  3CQY A;  3CPW M;  3CCJ N;  3WXM B;  1V4S A;  2GWJ A;  2FLO A;  2E2Q A;  2E1Y A;  2JWK A;  4BGA A;  4CZK A;  5BRE A;  5C12 A;  5KQD A;  1E4G T;  3LDO A;  4K41 A;  4K25 A;  1GLA G;  4CZM A;  2FF6 A;  4I6M A;  5AQR A;  2P9I B;  4B1V A;  1BA0 A;  3WXJ A;  4AF1 A;  4GV6 A;  3F5T A;  4BC5 A;  2NLX A;  2ZWH A;  3D6R A;  2ZF5 O;  2WUS A;  2BH1 A;  2QW9 A;  4WQ5 A;  3O9Q A;  3FFK B;  4BRP A;  1BA1 A;  1QVF M;  5AFU A;  5JVH L;  2IIR A;  1HKC A;  1SQK A;  2NRT A;  2D4W A;  4YOT A;  1MDU B;  4BY9 C;  4YOR A;  2CH5 A;  1CZA N;  2JWL A;  3DAW A;  3H1V X;  3MN5 A;  3U8X A;  3ENO A;  4B9Q A;  1T3V A;  5AQF A;  2HBK A;  3H3N O;  3T69 A;  5GAH P;  1RDW X;  2YJF A;  5TKY A;  2GEL A;  5TKW A;  1W97 L;  2QWM A;  4H5T A;  3R8E A;  3VEN A;  4CBU A;  1KAX A;  1HLU A;  3VPZ A;  3I55 N;  1DGK N;  2HBM A;  2PAV A;  5KPR A;  5JLF A;  3L4Q A;  3MX5 A;  5GAE P;  3ATV A;  1HX1 A;  5AQL A;  3AAQ A;  1VQ5 N;  5AFU H;  1SS6 A;  3FZM A;  4WCE L;  5AQT A;  5C0Y A;  5AQS A;  4BG9 A;  3D2F B;  3MK6 A;  1GLB G;  3WEE B;  3P39 A;  4BQL A;  4BVO A;  3EO3 A;  1O13 A;  3C6H A;  1JCF A;  2NRZ A;  5FPE A;  3G71 N;  3N4Q A;  4IXC A;  1VQP N;  5H1S Q;  3BF3 A;  5M1Q A;  4Y0W A;  1RFQ A;  4OO1 J;  4IJA A;  5M1P A;  2DPN A;  4BC4 A;  1HKG A;  4QS7 A;  2HBJ A;  2Q0U A;  3P31 A;  1KAZ A;  3LM9 A;  4ISG A;  5AQN A;  4JHD B;  3TSP A;  3LDQ A;  2IVP A;  3EN9 A;  3C6A A;  4O8K A;  3AAR A;  1LCU A;  2F9W A;  5AZI A;  3U9D A;  5GIO A;  5E26 A;  3ZX0 A;  3TTC A;  4NB4 A;  2Q36 A;  4HTL A;  3WUH A;  4G9Z A;  4FO0 A;  4BRM A;  4U7B A;  2E88 A;  3CC7 N;  1ZXO A;  4BR5 A;  3L0Q A;  1KXP A;  4UY8 O;  4O8U A;  1U2V B;  3BP8 A;  3CJB A;  3OA9 A;  4A2B A;  4DB3 A;  4JKA A;  3H45 C;  1NWK A;  3VF2 A;  4A59 A;  4B1W B;  1MWM A;  2ASO A;  2D1K A;  2FSN A;  3VER A;  1W2B M;  4JKG B;  3C7N A;  3ZX2 A;  4BRI A;  2YHY A;  4AM6 A;  3SAF A;  3E9P A;  5M1O A;  3M5R A;  4IJN A;  3VOV A;  5JMV A;  3GOI A;  4GY2 B;  3CCQ N;  3EKU A;  3HI0 A;  3VEY A;  1GLC G;  3W0L A;  2GUP A;  3AGK A;  4M63 C;  2FF3 B;  1NJI O;  4RWT A;  3GBT A;  4IFE A;  2Q31 A;  4BGB A;  4IZ9 A;  4BVP A;  4CZI A;  2VYP A;  2PBD A;  3TSQ A;  4BRH A;  3O9R A;  3ZET A;  4IEE A;  1VQN N;  3DXK A;  3GL1 A;  1BUP A;  5FPN A;  1XC3 A;  1Q18 A;  3G4S N;  4WQ4 A;  4WF9 L;  3EE8 A;  1VQ6 N;  1NGI A;  3O9T A;  2HMP A;  2P9N B;  2P9L A;  2NRH A;  1JCG A;  2HBL A;  3K9J A;  1HKB A;  2YJE A;  1K8K B;  2ASM A;  3UKR B;  3VET A;  3IKM A;  3CJC A;  1XQS C;  2P9P A;  2NNW A;  4YOY A;  1N8R O;  5BRD A;  4FWK A;  4FSV A;  1X3M A;  4FWS A;  3EZW A;  4CZL A;  4A5A A;  1NGH A;  3CCL N;  2KHO A;  5M1K A;  5DM6 L;  4JD2 A;  3H1Q A;  4FWN A;  4BR4 A;  5AZJ A;  3DLL L;  4B1X B;  5KPT A;  2OTL N;  1K9M O;  2P9U A;  2WFB A;  3ZYY X;  4CD1 A;  1TUY A;  3CCE N;  2AP1 A;  3CCU N;  3A0I X;  5HL7 L;  4ILH A;  2GTD A;  2QWQ A;  3AY9 A;  4H03 B;  3HM8 A;  3R3L A;  4JK7 A;  3A5O C;  5GIN A;  5GIP A;  5AQY A;  2ZGY A;  1QZ5 A;  2OAN A;  1YHQ N;  3OW2 M;  2CGJ A;  4IEI A;  1BDG A;  4CD3 A;  1SZ2 A;  5AQX A;  4K42 A;  4KH6 A;  4K43 A;  4EHU A;  2QWO A;  2IVO A;  3HRG A;  2E2N A;  4H0O A;  3IUC A;  3ULE A;  3ZEU B;  3D2E A;  3WQU A;  1T6D A;  5AQJ A;  4PKH A;  4DHY A;  4C23 A;  1TUU A;  3UKU B;  5BR9 A;  3SMP A;  3HOS A;  3SJH A;  3GE1 A;  1ATS A;  2P9K B;  1ZBS A;  2Q0R A;  4HWI A;  1DEJ A;  4BC3 A;  3QB0 A;  3GG4 A;  4QS8 A;  3VGL A;  4AM7 A;  4BR7 A;  5BPM A;  2GX9 A;  1KD1 O;  3ID6 A;  4GNI A;  5I9E B;  4OPH A;  4FWL A;  5F1X A;  4JK8 A;  3CJA A;  4GV9 A;  5BN8 A;  3EKS A;  2WC9 A;  3VES A;  1H1V A;  4EIA A;  3CD6 N;  2I7N A;  4RTF D;  4O5F A;  3DXM B;  4KH4 A;  4CZJ A;  5BPL A;  1ATR A;  3KZB A;  3VMF B;  2ASP A;  4IOA L;  4ISF A;  2QWL A;  4MDA A;  2YX6 A;  2FSJ A;  5GAD P;  3C65 A;  2AA4 A;  4H5N A;  4LC9 B;  1QHA A;  4KBO A;  4PL7 A;  3QFU A;  3CET A;  2W41 A;  4JK9 A;  5LJV A;  3CCR N;  3KK7 A;  3QFP A;  3TTD A;  3VF4 A;  3L4I A;  5C2D A;  1X9J A;  3CXC M;  3E1Y A;  2Q2R A;  3LDL A;  4BRF A;  1VAZ A;  3H46 O;  4IO9 L;  2V7Z A;  3E66 A;  2HOE A;  4YOW A;  4JKD A;  4A62 A;  1KQS M;  4BRE A;  2UYT A;  4FWO A;  4EHT A;  1DKG D;  5AQQ A;  3VTI A;  1LOT B;  1S22 A;  3P38 A;  5M1F A;  3OHR A;  4XH5 A;  4FVU A;  1Q81 O;  2P9S A;  4A2A A;  2NRR A;  3KWG A;  4MLE A;  1YJ9 N;  1TYQ A;  4H0T B;  3B8A X;  5BPN A;  3RSE A;  3A5N C;  5EOY A;  4Z94 A;  2F7T A;  4BRD A;  3F9M A;  4KH5 A;  1KC8 O;  5F0X A;  3ENB A;  3MDQ A;  2ZJQ L;  1QQM A;  3S41 A;  3QIC A;  4NLC A;  1V4T A;  1EQY A;  3OBY A;  4MDB A;  3W3D A;  5JVG L;  3P4I A;  3QBX A;  2Q1N A;  3E9L A;  5BRH A;  4JN4 A;  5GAG P;  2I7P A;  1Q7Y O;  1YXQ A;  1X3N A;  4FPA A;  4JKE A;  1BWF O;  3VEX A;  3DJC A;  3J8A A;  4JD2 B;  5AZJ B;  5AQW A;  5AQM A;  1WOQ A;  2NRV A;  2VWB A;  5C15 A;  1VQM N;  2A41 A;  3CC2 N;  3O08 A;  2NRW A;  3CI5 A;  1R59 O;  1E4F T;  1D4X A;  2HST A;  4GV3 A;  1EO1 A;  3IFR A;  5AQO A;  4WYB A;  3O1B A;  4JNE A;  1Z05 A;  5ADX A;  3AAP A;  1YJW N;  3VEZ A;  3MMV A;  5B8H A;  2A6A A;  2KLA A;  4L3Q A;  1NGG A;  4BR0 A;  3ULE B;  2HF4 A;  3CJ9 A;  3MX2 A;  4PHT X;  3VTH A;  2QI2 A;  4PL8 A;  5FPM A;  1YVN A;  2V7Y A;  3N4P A;  4I6M B;  4ILJ A;  2VCP A;  3HBT A;  4BRK A;  2E2O A;  3D2F A;  5AQI A;  5BN9 A;  1HPM A;  3WEE A;  4WFN L;  4RCH A;  3HZ6 A;  3MCA B;  3Q7B A;  4NLB A;  3CJ1 A;  4H0X B;  3BUZ B;  5ELZ A;  5AQH A;  2D0O A;  4YOX A;  3CHW A;  3CMA N;  3QBW A;  5AQZ A;  4M7Y A;  3O9S A;  4GVE A;  1ATN A;  3CER A;  4IO8 A;  3VGK A;  2W40 A;  5ADX H;  5E84 A;  3U4L A;  1BOT O;  3CPE A;  2ZJR L;  1NGB A;  2QWR A;  3WXL A;  1K8A O;  4JEP A;  5EXW A;  1NLV A;  1SAZ A;  4H5W A;  4YDU C;  3LDN A;  4DQ8 A;  1MA9 B;  1GLE G;  1GLF O;  3C0B A;  4FL9 A;  3IMX A;  4JKF A;  3LDP A;  1QQO A;  4BRN A;  4H0V B;  3QDK A;  1GLD G;  1NGC A;  3I56 N;  1Z6R A;  3ATU A;  4B1U B;  4CZF A;  3F2K A;  1U2V A;  4YOV A;  3QML A;  3PIO L;  3DWL A;  3MN7 A;  3G6E N;  4WFA L;  1HJO A;  2Q97 A;  4MO5 A;  1VQ4 N;  5AR0 A;  4B1Y B;  1VQ7 N;  1M1K O;  4CZG A;  3CME N;  2EWS A;  3BF1 A;  3MN9 A;  3CCM N;  3J7Z O;  2QWP A;  3VEV A;  3O1W A;  1WUA A;  4CJ7 A;  1YIT N;  2RHK A;  1NGA A;  1S3X A;  3MN6 A;  4EFH A;  5MLC Q;  2ZJP L;  4BG8 A;  1BU6 O;  4E1J A;  4XEI A;  3KWI A;  4MLH A;  3TPQ A;  1RGI A;  3O8M A;  3E9O A;  2YI1 A;  3FR0 A;  1K73 O;  3RSE B;  1NGE A;  5LJW A;  5AZI B;  3SBT A;  4WQ5 C;  5AQV A;  1VQL N;  3VGM A;  4CI6 A;  4FOI A;  3G25 A;  1RDU A;  2P9N A;  4CBX A;  3NVK A;  3TSU A;  2YCH A;  1YJN N;  1K8K A;  2YHW A;  3UKR A;  3ZX3 A;  4IWV A;  3VF6 A;  2A40 A;  1ZC6 A;  2E8A A;  4OPA A;  1YF5 L;  2V51 B;  4BC2 A;  3JS6 A;  1KAY A;  1Y64 A;  3C7N B;  2NZT A;  3FZK A;  3R9P A;  3VEW A;  3CF5 L;  1P8Z A;  2GWK A;  2QWN A;  4MO4 A;  2CGK A;  4J8F A;  4A57 A;  3SK3 A;  2BTF A;  5CR4 A;  1GLJ O;  1QVG M;  4M7X A;  3WXK A;  3RVC A;  1NGJ A;  1OKJ A;  5C2F A;  3O5B A;  4C1N I;  5M1N A;  5LY3 A;  2E2P A;  4XH4 A;  2QM1 A;  3ZET B;  3BEX A;  2CGL A;  3WT0 A;  4B1Z A;  3M1F A;  3TTF A;  5KPZ A;  3DXK B;  3I33 A;  2A42 A;  3SLC A;  2F9T A;  3HSC A;  2HF3 A;  1MWK A;  1JCE A;  3SAG A;  4ILG B;  1T6C A;  3KHY A;  4BRC A;  4BR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...