4BRGA

Legionella pneumophila ntpdase1 crystal form ii (closed) in complex with mg gmppnp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
359
structure length
359
Chain Sequence
MDTNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
total genus 122
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brgA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brgA02
4B1VA 1YAGA 1DGKN 1JCEA 1JCFA 4MLHA 3WXLA 2UYTA 1YUWA 3W3DA 2J4RA 3GBTA 1YXQA 3DXMB 3C0BA 3VEZA 1XC3A 2P9UA 1GLBG 3A8YA 3JS6A 5LY3A 5AQKA 4CZJA 5AQVA 4CZKA 3L0QA 5BN8A 3M6GA 4ISEA 4CBWA 3QB0A 2V52B 3VF6A 4BR7A 4CZFA 2CGLA 3QDKA 3VEYA 4FOEA 5ADXH 1WOQA 3IUCA 3HI0A 5FPNA 3VEOA 4H5WA 3U9DA 5E26A 1BG3A 3EKSA 4FWLA 2EWSA 2GWJA 3QBXA 4L3QA 4ISFA 2D0PA 3ENOA 4A2BA 3LDQA 3ZEUB 5AQUA 4EFHA 5KPRA 3S41A 2ZGZA 3GDQA 3DXKB 2ZWHA 4PKIA 1ZC6A 1QHAA 4BRAA 2NRHA 4FWMA 1QQNA 2CH6A 2CGJA 1Z6RA 3O4WA 4FOIA 1U6ZA 1NGFA 2P9KA 5AZIA 2YI1A 2AP1A 1E4FT 5BPNA 2QWLA 2QWOA 1T6CA 2P9IB 4M63C 3GOIA 4BR5A 1C0GA 1GLLO 1HKBA 3H1QA 2A3ZA 4H0PA 2FSNA 1XQSC 4Z94A 2P9LB 3JXUA 5AQRA 1SAZA 4DB3A 2PBDA 2QWRA 3VERA 5LJVA 4J8FA 3O8MA 5EXWA 3CQXA 3D2EA 1K8KB 3MDQA 4E1JA 3DAWA 4K41A 5AZJB 3RSEA 4H0YB 3FZFA 1ATSA 3HM8A 2ASMA 3FZLA 3H3OB 2QWQA 2E2PA 4QS8A 4Y0WA 3HTVA 1V4SA 3GL1A 3MMVA 4IO8A 3ZX2A 3WEEB 1HUXA 3ATUA 5BRHA 3HSCA 4H0TB 1XUPO 4PL7A 4FPBA 3FZHA 2Q2RA 3EN9A 2YCHA 2HOEA 3MN5A 4BRGA 4BC4A 5CE3A 3MK6A 5EVZA 1NGIA 2E1YA 5EY4A 2Q1NA 2W40A 2YJEA 3FZKA 3CI5A 5AQYA 2E88A 3CHWA 3CJ9A 5F0XA 2Q31A 2WUSA 3MCPA 3ZETB 4A2AA 2P9SA 1S22A 1JCGA 3A5NC 3EZWA 3O1WA 3C7NA 4BQLA 2HF3A 2A6AA 4EHUA 3A0IX 5FPEA 1MWMA 2FLOA 4O8KA 1GLEG 2HF4A 5E84A 3IDHA 1TUUA 4H5RA 2VCPA 5AQWA 4IZ9A 5BRFA 1BOTO 1HLUA 4RWTA 3WXKA 1U2VA 3R8EA 3D7EO 1T44A 5AQFA 4BG9A 1Y64A 1IJJA 4IWVA 4XEIA 2P9IA 3H1VX 5LJWA 3ULEA 3FZMA 4M7XA 2FF6A 3D2FB 4BR0A 5AQLA 1LCUA 3QBWA 2I7NA 1GLCG 1R59O 3WXIA 2BTFA 3TU5A 5KQDA 4JAXA 4BQZA 5AQZA 3MN9A 1Z05A 2V51B 1K8KA 3CJBA 4CI6A 4JHDA 2P9PB 5AZJA 1IG8A 3SLCA 1D4XA 3LM9A 5I9EB 5KQ8A 3R6MA 3CERA 4IXCA 3BF3A 4FWKA 4GNIA 3VEWA 3QFPA 1ZXOA 4HWIA 3ATVA 3R9PA 3VF2A 3WEEA 4BR4A 1EQYA 2GWKA 3WT0A 2Q0UA 3I33A 1X3NA 3I8BA 3ZX0A 3FFKB 1H1VA 4JN4A 3U9ZA 4CZEA 1NGEA 3HZ6A 1QQMA 5AQMA 1NGGA 4JD2A 3L4IA 4WQ5C 1BDGA 3F9MA 4H0XB 4FWQA 2ASOA 2A40A 3CETA 4QS7A 4K25A 3BF1A 2P9NA 4WQ5A 4BC5A 2FSKA 3A5OC 3AY9A 3U4LA 3UKRB 4NO7A 3EL2A 4QS9A 4B9QA 1G99A 1HKGA 2DPNA 3L6QA 4BRLA 1GLAG 1E4GT 5AQQA 3UB5A 5FPDA 4FWSA 4BROA 4FL9A 4CZGA 1HX1A 1WUAA 2E8AA 2Q36A 2VWBA 3LDPA 4A62A 4CZHA 1TYQA 4F9OA 3CJ7A 3VPZA 4MO4A 3WQUA 4BRPA 4CZLA 3DJCA 1Q18A 4BRHA 4HTLA 1NM1A 3BUZB 3OHRA 4B1ZA 5FPMA 2D0OA 3O6WA 3UKUB 4B1WB 2YHYA 2W41A 1HJOA 1KAXA 2GUPA 3J8AA 3VGMA 1RDWX 3DXMA 2A5XA 3BP8A 2GEMA 1HPMA 3SJHA 4BRKA 2P9PA 3A5LC 3O08A 4EAHD 4MLEA 2OANA 1RGIA 3FR0A 2BUPA 3ENHA 4BRDA 4WQ4C 3AARA 3FE1A 5BPMA 3IFRA 4KBOA 4BR9A 2P9UB 2A42A 2Q97A 1BUPA 4FWNA 4WQ4A 3H6EA 2E1ZA 4YDUC 1S3XA 4BG8A 3H45C 5AQJA 4B1UB 4BRFA 1BWFO 2V7YA 4YDUA 4B1YB 4XH1A 1MDUB 1MA9B 3ZEUA 4BGAA 5AFUA 5JICA 4XH4A 2YJFA 3DXKA 3LDOA 3LM2A 5ELZA 3U8XA 5JMVA 2I7PA 2D1KA 3UKRA 3WQTA 4WYBA 4H0OA 2ITMA 5KPTA 2NLXA 4C23A 1YVNA 1KAYA 5ADXA 1RFQA 4AM7A 3H3NO 4PKHA 1NMDA 1BA0A 2E2NA 1KAZA 5B8HA 1QZ6A 2GTDA 5AQIA 3KVGA 1HKCA 2FF3B 1NLVA 2P9LA 2P9KB 2YHXA 4AM6A 1GLFO 4H5VA 4GY2B 5AQOA 4M7YA 3WUHA 3VGLA 3LL3A 2IVNA 3MN6A 5AQTA 4PKGA 1MWKA 2CH5A 1KXPA 4BRNA 1BA1A 2GELA 4CBXA 4IJNA 3FGUA 3G25A 4FWRA 3D2EB 2YHWA 4H5NA 4I6MB 2E20A 3IMXA 4RCHA 3RSEB 3CIPA 5JLHA 1GLDG 4BRMA 5F1XA 4FWOA 1CZAN 5KPZA 5AFUH 1QQOA 3SMSA 2PAVA 3EKUA 1SQKA 2F9WA 2E2OA 4BR2A 2F9TA 1OKJA 3VF4A 4NB4A 1P8ZA 3QICA 4DQ8A 3O1BA 3ZETA 4CJ7A 3O80A 5AQSA 3SMPA 4XH5A 4K43A 2KHOA 2NZTA 3AAQA 5AQXA 5TKYA 3SK3A 3CJ1A 4ISGA 4CZMA 1DKGD 1SZ2A 3M1FA 3W0LA 2QXLA 3CQYA 3MN7A 4IJAA 2V7ZA 1ATRA 1NGHA 2P9SB 3C7NB 1X9JA 3GE1A 4FPAA 2VYPA 5AR0A 3GG4A 3FLCO 3M3ZA 1J6ZA 4BRCA 4O5FA 3KZBA 1NBWA 3ID8A 3D2FA 2QM1A 1NGDA 3BEXA 1ATNA 3EO3A 1U2VB 5BN9A 1BO5O 2E2QA 1NWKA 4A61A 3KHYA 4BVPA 5F2RA 4CD1A 1NGCA 5JLFA 2D4WA 3ULEB 4H5TA 3A5MC 2A41A 2Q0RA 4CZIA 3B8AX 3WXJA 5AQPA 3VEVA 4B1XB 4BREA 3CJAA 1C0FA 3TPQA 1V4TA 1ZBSA 2CGKA 2FSJA 4RTFD 2AA4A 4I6MA 2IIRA 3DWLA 4JHDB 5BRDA 3VOVA 1NGBA 1NGAA 5EX5A 4DCHA 5BR9A 3VEXA 4CBUA 3HBTA 3QMLA 1T6DA 4JNEA 2QW9A 4EIAA 4H0VB 2IVOA 4BVOA 4DHYA 3LDLA 5AQHA 5AQGA 1QZ5A 2H3GX 3VENA 3ZX3A 4FWPA 4PL8A 1BU6O 1NGJA 4BC2A 1LOTB 4FO0A 4JD2B 4EHTA 3UE5A 2ZF5O 1X3MA 3VESA 5BREA 4BRQA 3CJCA 1DEJA 3AAPA 3H46O 3VETA 2P9NB 4BRIA 3LDNA 5EOYA 2ZGYA 2HMPA 4K42A 2FXUA 2QWNA 3VGKA 2IVPA 4BC3A 5AQNA 3P4IA 4FSVA 4LC9B 5AZIB 2QWPA 4BGBA 2ASPA 2QWMA 3UKUA 5BPLA 3QFUA 3O5BA 1TUYA 1GLJO 1TYQB 4H03B 1ESVA 4CD3A 4MO5A
chains in the Genus database with same CATH superfamily
4FVMA 3ZT0A 4R79A 1JCEA 1BISA 1IG9A 4ELUA 3HVRA 1YXQA 2YV0X 5J2NA 4GW6A 4OJRA 4N56A 3KLEA 5LY3A 4DR4K 2G8IA 1Q81O 1G15A 4M41A 3TSQA 3M6GA 1TGOA 3V9ZA 2V52B 4DFMA 1BIZA 3QDKA 4FOEA 3DLLL 1WOQA 1E3MA 3L2QA 4GKJK 3QETA 3VEOA 1U4BA 1NKCA 4H5WA 3LZIA 3ENBA 1FW6A 4FVUA 4AHRA 1BG3A 2HNYA 3EKSA 1DTQA 1HNIA 2D0PA 4FM1A 3PIOL 1QE1A 3T1AA 3F73A 4V19S 3S3OA 2OPRA 3S41A 4JRQA 3C6UA 2ZWHA 1VRTA 4PKIA 4RW9A 4KHWA 3SUPA 1QQNA 2YKMA 3K9KA 4KH4A 3FFIA 5AZIA 3WNEA 1J54A 2RF2A 4M3TA 2P9IB 4M63C 3AVBA 3GOIA 3M8PA 4RW8A 1HKBA 4E3SA 2O8EB 2A3ZA 4H0PA 2FSNA 3G6EN 4CFDA 4OPKA 2YKNA 5C42A 5EXWA 4ID5A 3TSUA 1RDBA 3MDQA 1IH7A 2HB5A 5M1PA 4H0YB 3LP1A 3PY8A 3L4QA 1ATSA 4DLEA 4KH5A 3HM8A 1RDAA 2HHUA 2QA4N 5HOOA 4QS8A 3MMVA 4IO8A 5J1EA 4JI8K 4DF8A 4FW2A 2R7YA 1SL2A 4OKEA 1DTTA 4RW7A 2VQFK 1K9MO 4IFYA 4DR7K 3AVMA 4AF1A 2FBVA 4GV9A 1BIUA 2VG6A 4DU3A 4BE2A 4BC4A 5CE3A 1NGIA 4CERA 3QESA 3FZKA 5AQYA 4M3RA 5IWAK 4FJIA 1YI2N 5F0XA 1EP4A 4A2AA 3M8RA 3V81A 2HF3A 3TANA 4EHUA 4W5RA 4K0KK 5FPEA 4O8KA 3AVLA 5E84A 3IDHA 2A1RA 2VCPA 4CJVA 5BRFA 1BOTO 5C2DA 1T7PA 5AQFA 1VQ9N 3BZCA 4CF8A 4CF2A 1JLQA 3ULEA 3FZMA 4BR0A 3DLKA 3QBWA 3WXIA 2BTFA 5C15A 3TU5A 2YNIA 5KQDA 2NRZA 4BQZA 5AQZA 3HVTA 3MN9A 4CEDA 1S72N 3KD5E 4OX9K 4JHDA 2IAJA 1Q9XA 4CE9A 5I9EB 4IXCA 5AJ3K 4CIGA 1TL3A 4CGIA 3ATVA 4NYNA 3WEEA 3I33A 3ZX0A 3V1QA 4DUZK 3K5OA 3DLEA 4F2SA 1TKDA 3QINA 3SPZA 2OTLN 2VQEK 3NVKA 3DI6A 1NGGA 3SQ0A 1XMQK 1VQ6N 4CHZA 4FLZA 3PX4A 3HOSA 4AH9A 4H0XB 3SAHA 4J2DA 3SUQA 3LAMA 4WQ5A 1YIJN 3E01A 1HNWK 4BE1A 3A5OC 1JLEA 1WSFA 3V1OA 3EL2A 3DRRA 3CCQN 3THWA 1GLAG 5FPDA 1VHXA 2G8FA 4FL9A 1ZBIA 4RW4A 3NE6A 3J7ZO 4FZYA 4A62A 2OPPA 2G8WA 3OS2A 3WQUA 2KKZA 4CZLA 3EE9A 1EETA 4WE1A 4B1WB 4JKGA 1RDWX 4WF9L 1HPMA 3SJHA 3IRXA 4DTSA 3V9UA 4BRKA 2P9PA 3K5NA 3A5LC 5KGWA 4LY7A 2BUPA 3TAMA 3S3NA 2HSTA 3HP6A 3CCUN 4KBOA 4KTZA 2P9UB 5HRNA 1BUPA 3VQAA 3LZJA 2E1ZA 4LH4A 4I9QA 1SKWA 4KTQA 3TARA 1OH8A 4BY9C 1WSGA 2V7YA 1D5AA 2PY5A 2WC9A 1QSYA 4BWMA 1MA9B 2JWKA 4BGAA 3MEDA 2PZSA 4CJPA 5AFUA 4XH4A 4KHSA 3I56N 1N34K 1ASUA 3MECA 4H4OA 4FJNA 4AILC 3UKRA 1VQ4N 3CPEA 2ITMA 2HHVA 1S1VA 1HPZA 3ZT4A 1YVNA 3HJFA 1RFQA 4FLWA 4Q0BA 4FJ7A 1TKTA 4CF0A 3VQDA 5C12A 5AQIA 4K8ZA 4JKCA 2FF3B 1HJRA 3OJUA 3QEWA 2HBJA 3SZ2A 2X6SA 2NRVA 1KCFA 4ZTFA 4DWIA 4FM0A 4M7YA 3QEIA 4YOTA 1XNRK 1KXPA 4LSLA 4Z4IA 1BL3A 4F8RA 4H8KA 4FLYA 1KC8O 4PHTX 1QS4A 3NCIA 4RCHA 4KB1A 4LF4K 1GLDG 1KRPA 1WN7A 5D3GA 3LANA 3PUFA 4MQ3A 1K8AO 3DM2A 4KHQA 1VAZA 4JK9A 5CR4A 3HOTA 1SQKA 2Z1IA 1OKJA 3VF4A 2RKIA 4NB4A 3QICA 3OYKA 1X1PA 5HRPA 2NZTA 4FJHA 3AAQA 5AQXA 3TAFA 3KK1A 1N6QA 1M90O 4ISGA 2IGIA 1DKGD 4KH6A 5BR8K 1HRHA 3AGKA 4ID1A 3THXA 2V7ZA 1KD1O 4JS5A 4EZ6A 1X9JA 1SV5A 4FPAA 4CEEA 4OLBA 5GAEP 3GG4A 4BRCA 4O5FA 1RT4A 3KZBA 2GX9A 3ID8A 1UA1A 4A57A 1C1AA 1FKOA 1ATNA 3EO3A 4DR1K 2WBNA 2E2QA 1NWKA 3O9RA 4Y1DA 4CD1A 1TKZA 3QNNA 5JLFA 3G4SN 1VSMA 3T1HK 1KFDA 2A41A 1Q86O 4FCYA 4FZXC 3CXCM 1CZ9A 3VEVA 1C0FA 1V4TA 4ICLA 4IFVA 4IDHA 3ZT1A 4DMNA 1ZBHA 3DOLA 3J7AP 4I6MA 5C0YA 4PQUA 3DWLA 4J2AA 4J2BA 1NGBA 1S6QA 4DCHA 5BR9A 4JLHA 1Y97A 3VEXA 1W9HA 3OYFA 2OCEA 1Z25A 3HBTA 4FJMA 4NCGA 4DHYA 3LDLA 5AQHA 4X66K 1B92A 2Y1JA 4BACA 2DFHA 4PL8A 1LV5A 1HMVA 2KZMA 1WSIA 3PSFA 2ZF5O 4O55A 1I94K 5CZ1A 3BDPA 3VETA 4YOVA 1X9MA 2HMPA 2FXUA 4HCCA 3KK7A 3VGKA 2IVPA 1WAFA 4BC3A 3DLHA 5FROA 3G71N 2Z1GA 4DKWA 4LC9B 5AZIB 3L2RA 4OLAA 3SNNA 3M8QA 3ZSOA 2UUCK 1XHXA 4GV6A 1VSKA 1TYQB 5C2FA 1KVCA 2ATQA 4CD3A 4MO5A 4YY3K 2I5JA 4B1VA 1IV0A 1YAGA 3KK2A 4M3ZA 3NH1A 3ZLJA 1JCFA 3WXLA 2UYTA 4KFBA 4M3WA 5M1OA 4M3XA 4JI3K 3J7YP 3C6HA 2GV9A 2P9UA 3A8YA 3JS6A 4DQSA 4QCLA 3TABA 2O8FA 3SQ1A 4OKKA 2NNWA 2X78A 4CZKA 3A2FA 4B9MA 4CEQA 2P1JA 4CJFA 1I39A 4HUFA 1Q9YA 2CGLA 5ADXH 4IBNA 3HI0A 4DSJA 5FPNA 4BWJA 2OA8A 1M1KO 2ZJPL 2O8CB 3C95A 4OGEA 4DQPA 3T19A 4L3QA 2GWJA 3QBXA 1XHZA 3CCJN 4DFKA 4C8MA 3LDQA 4CK1A 4WCEL 4DTUA 3I55N 3GDQA 4NCAA 1LAVA 4MDBA 1ZC6A 4BRAA 1Z6RA 1U6ZA 3PO5A 1U47A 1W7AA 4WFBL 3S9HA 5LMUK 5FRNA 2QWOA 1T6CA 4C8LA 2NRWA 1F21A 2NRTA 1YVUA 5C25A 1C0GA 1GLLO 2KQ2A 5CYQA 4IEIA 3RVCA 3OYHA 3LDSA 1WLJA 3P83D 2P9LB 4Z94A 5AQRA 4F3TA 2HHXA 4DTPA 1UWBA 3VQ9A 4J8FA 4LFBK 2HHTA 4E1JA 3OS0A 4IKFA 4K41A 4DTOA 2X74A 1TAQA 3SAFA 3PSIA 3H3OB 2QWQA 2E2PA 1NNEA 1U49A 3WEEB 4KTWA 4RG8A 3V9XA 3NVMA 2ZJQL 4E7JA 3ZSZA 3K2PA 4DV4K 3TSPA 4A5BA 5BRHA 4H0TB 1XUPO 3LALA 2O8DB 5J2QA 3F2KA 4PL7A 3AVAA 2OPQA 2YCHA 1QHTA 1S1TA 4BDYA 3CCVN 4DUYK 3MK6A 2IS3A 2E1YA 3OYEA 5KGXA 3CI5A 3SPYA 3AO2A 1NK0A 3CHWA 4CJUA 3NH2A 4DTMA 4DF4A 3RMCA 3ZETB 3EZWA 3T7ZA 1JCGA 4I9LA 4FJ9A 2F8SA 1EX4A 4AHSA 4RW6A 1S9EA 3OBYA 2W42A 1GLEG 2HF4A 3HPHA 3KWIA 4H5RA 1HNXK 1IKXA 4IZ9A 4RWTA 3WXKA 1P90A 2NUBA 1WSJA 1LWFA 3D7EO 3EE8A 3H08A 4OVLA 4JS4A 2BE2A 1IJJA 3HYFA 4FLVA 4Z4GA 3I8DA 3EYZA 3U3GA 3J80O 4B9LA 3HPOA 1TK0A 4JKGB 1LCUA 3I0RA 2I7NA 3S3MA 1UA0A 4JAXA 2QEXN 1CLQA 1Z05A 4B9SA 1K8KA 1NK4A 2P9PB 1IG8A 3SLCA 2JGUA 1D4XA 3LM9A 5CHIA 3R6MA 1JLBA 4GNIA 3VEWA 1ZXOA 1JLFA 4BR4A 3WT0A 5I3UA 3NGYA 1X3NA 1A5XA 1ILYA 3AVCA 1H1VA 4JN4A 3K57A 4JK7A 5AQMA 3L4IA 5GIOA 1YJ9N 4E1MA 1N5YA 2ASOA 3CETA 3KD1E 1C0TA 5DM7L 4B3TK 4CJKA 3U4LA 3UKRB 4NO7A 3CCEN 3B6OA 1G99A 1HKGA 2DPNA 1E4GT 2LSNA 3UB5A 4DSIA 3ZSQA 4YOYA 2ZM6K 3OYCA 2E8AA 2E4LA 4N5SA 3C6AA 4CZHA 1WSHA 2QKKA 1TYQA 4M45A 3QERA 2GUIA 4BRPA 1T03A 3BUZB 3DRSA 3V4IA 3UKUB 3V6DA 3SYZA 2W41A 5JVGL 1KAXA 2GUPA 3SCXA 4IOXA 3AVGA 4ELTA 4BDPA 1U04A 3O08A 4DQRA 3DLBA 3NGIA 3FR0A 5FLXO 4QOZB 4WQ4C 5M1QA 1VQMN 3IFRA 2VG7A 4B9UA 1I3AA 2OZSA 3SI6A 3T3FA 4CJWA 4YDUC 1S3XA 4BG8A 1VQ8N 4FJLA 4CCHA 2O8CA 3MEGA 2F4VK 1IBKK 5IT9O 1MDUB 5HL7L 3OJSA 3OYJA 3CCRN 4YOWA 4I7FA 4CEZA 1C6VA 4XIUA 3VQPA 1SL0A 1BCOA 4CFAA 1XMOK 3LDOA 4C8KA 5JMVA 3L8BA 1XI1A 4KAZA 1FXXA 3WQTA 4WYBA 4H0OA 5KPTA 3N4PA 1RTDA 3THXB 5ADXA 3H3NO 1QVGM 2F96A 2O4GA 1NMDA 4K8XA 2E2NA 1HR0K 2GTDA 4FYDA 3KVGA 3AA2A 4CK2A 3E66A 5H1SQ 3QEPA 2P9LA 1RT5A 2P9KB 3ZSXA 4GY2B 3VGLA 1JL1A 2KTQA 1OH5A 2IVNA 3MN6A 4DTRA 5GINA 4DQQA 2HBKA 2GELA 1GOCA 1J9AA 4FK2A 3FGUA 3G25A 3R1XA 4FWRA 4PWDA 4MDAA 4I6MB 5HP1A 3RSEB 2O8DA 3CIPA 1L3UA 1NG9A 1LWEA 2XHBA 2FBTA 1CZAN 4CJQA 4B3MK 5KPZA 3O3GA 1QQOA 3SMSA 2PAVA 3JSMA 1LWCA 2F9TA 3LP2A 3VTIA 3ITHA 3UIQA 4DTNA 3HSTB 3ZETA 5AQSA 3SMPA 4KHUA 1VRUA 1VSJA 1ZBFA 3SK3A 3CJ1A 4CZMA 5CYMA 4L8RB 4NLBA 4B08A 3KTQA 4OO1J 3SQ4A 3LPTA 1HYVA 4IJAA 3ASMA 1NJWA 1ASVA 2P9SB 3U3YA 1RBTA 3GE1A 2VYPA 3EEQA 1NK5A 5AR0A 3KJVA 3CD6N 3FLCO 3M3ZA 1S6PA 4HUEA 4IOAL 2VWKA 1NBWA 3AVFA 2UUAK 3VA0A 3BEXA 1U2VB 1J53A 4DFPA 5GIPA 2O8BB 4JKHA 4E7KA 4FJGA 2Q0RA 2HVHA 3B8AX 3HRGA 4JI5K 3ZT2A 1ZBSA 2FSJA 4JKAA 3OYBA 2O8FB 3NF8A 5BRDA 4X64K 3KIOA 2QI2A 3VOVA 1NGAA 3RRHA 3NF6A 3TAQA 2ZD1A 4B9VA 3SUOA 4EIAA 1Z26A 4FXDA 1NKEA 4W5NA 5AQGA 2H3GX 2HBLA 2WTUA 4J2EA 1YTUA 4CF1A 3P38A 4JD2B 4IO9L 1TK8A 4EHTA 2XO7A 4CHQA 5C10A 3P39A 3BY5A 1DEJA 4I2PA 5KRTA 3MXIA 4BRIA 4CW7B 2ZGYA 3K0SA 1VQPN 4DR3K 1EKEA 4Z4CA 4FJKA 3NHGA 3UKUA 3HM9A 4WFNL 3VQ6A 1TK5A 4A5AA 3HL8A 4DSLA 3W3DA 3GBTA 1NK8A 3DXMB 4LD0A 4E1NA 4FM2A 4HUGA 3C0BA 3VEZA 1XC3A 4G9ZA 1XNQK 5HRSA 3ZSWA 3L0QA 5BN8A 1NK9A 4ISEA 4BE0A 4CBWA 3QB0A 3VF6A 4CZFA 4BR7A 1UOCA 2FBXA 3VEYA 2HHHK 1RT6A 4DU1A 1OH6A 1T05A 3U9DA 3CM5A 3OBWA 3ENOA 5AQUA 1VQ7N 5KPRA 3R3LA 4AHCA 3MCAB 3DRPA 4CJRA 5LL6Z 1LW2A 1RDDA 4PY5A 1QHAA 1HQUA 2NRHA 4FWMA 2YHAA 3ZCMA 2CGJA 4CJTA 1CZBA 4DV6K 1TL1A 4DR6K 2P9KA 5M1KA 1KVAA 3KLGA 2AP1A 4DR5K 3THVA 5BPNA 4B9TA 3VQEA 3PLAA 4KO0A 3F9KA 1BQMA 2KLAA 3SV4A 2GBZA 1XQSC 3HP9A 1SAZA 1DLOA 2PBDA 4AHTA 3O8MA 4KRFA 4Z4HA 1K8KB 2BGGA 2HHSA 3DAWA 3RSEA 3ZT3A 4PUOA 3DYAA 4UY8O 2VGMA 3FZFA 3Q7BA 1U48A 3TAEA 1K73O 2ASMA 2ITGA 1RNHA 3RTVA 1U45A 1N36K 3ATUA 3TTCA 1YJWN 3OYNA 3HSCA 2OPSA 4DS5A 3FZHA 3D0PA 2Q2RA 3EN9A 5I42A 2Z1HA 1KLMA 4BRGA 3DLGA 4F3OA 4F2RA 4JKEA 5EVZA 1D8YA 4GV3A 5EY4A 2Q1NA 2W40A 2YJEA 3VTHA 4B9NA 4JYAK 5LMNK 3CJ9A 4FLXA 4KV8A 1RT2A 3MX2A 1Q82O 4DTJA 2WUSA 2JWLA 2P9SA 2XY5A 3VQ4A 4BQLA 2NRRA 4CEAA 3A0IX 1O13A 3QNOA 4DFJA 2FLOA 3DMJA 4IEEA 2IOCA 1TUUA 3NF7A 4HHTA 4CHNA 5GADP 4FJ5A 4DG1A 1U2VA 2HHQA 4KB0A 2PYJA 4BG9A 1NJZA 1Y64A 4XEIA 3H1VX 1J5OA 2O8BA 4U7BA 3NGZA 1NJXA 1VSFA 2XRIA 4M7XA 4LSNA 1HQEA 2FF6A 3D2FB 3TR8A 2PYLA 1GLCG 1R59O 2G8UA 3QEVA 5CY4A 1VSLA 3VQ7A 4EP5A 3CC4N 4W5OA 2V51B 3CJBA 4CI6A 4CGGA 5AZJA 1REVA 2UUBK 5KQ8A 3CERA 3BF3A 4FWKA 3O9TA 4AHUA 1A5VA 3QFPA 4HWIA 5DMRA 2IDOA 1WAJA 2KFNA 2BANA 2GWKA 4LH5A 4CJSA 2Q0UA 4JI7K 3CMEN 4PA1A 4JKFA 3VQBA 4CZEA 5J2PA 1NGEA 4A59A 1L3SA 1QQMA 2RPIA 4JD2A 1BDGA 1ZBLA 4CJEA 3JYTA 1QTMA 2A40A 5JS1A 2RE2A 1BQNA 3BF1A 1N32K 2D0AA 3LWMA 4BC5A 3I0SA 2P51A 2FSKA 1JXEA 3OYAA 1BI4B 3JAMO 4CJLA 2BH1A 4CVNE 3ISNC 5AQQA 4C8OA 1KLNA 4BROA 1JLCA 4UQGA 1HX1A 2Q36A 1RBVA 2VWBA 3MXJA 4DSKA 3VPZA 1NK7A 4MO4A 1RTJA 3DJCA 1Q18A 4C1NK 4BRHA 3TAGA 2E6LA 1NM1A 3OHRA 4B1ZA 4HTUA 2DY4A 2D0OA 3O6WA 4QAGA 3LP0A 5KI6A 1XC9A 4OPJA 3RR7A 1HJOA 3VGMA 3J8AA 3OYMA 3DXMA 3SQ2A 2A5XA 4FK4A 1KSPA 4O0IA 4FLUA 1KTQA 3IKMA 2D0BA 4IOCL 3MX5A 3RMDA 4MLEA 1RGIA 2VGNA 4M3UA 1QQCA 4BRDA 3Q7CA 4KHPK 3QEXA 3VQ5A 5HROA 1TVRA 3AA3A 4M42A 4BR9A 2A42A 1VQNN 2Q97A 1NJIO 4FWNA 4WQ4A 5T7BA 3EY1A 3QIPA 5HLFA 4WFAL 5AQJA 4I2QA 4JRPA 3AO3A 1UAXA 4B1UB 1IKVA 3MWTA 3SV3A 4CECA 4YDUA 4B1YB 4N41A 4CJ5A 3CQ8A 4OPAA 1S1UA 2EX3A 3V9SA 3NDKA 2WFBA 3K9JA 3VQ8A 3LM2A 3ZSRA 4CHOA 2I7PA 4CIEA 2G8HA 4NCBA 2NLXA 4C23A 1KAYA 4AM7A 2HW3A 5MLCQ 4PKHA 1N33K 1KAZA 4B3OA 4DV7K 1QZ6A 4IFEA 2Q3SA 1NLVA 3PX6A 3PV8A 4AM6A 1GLFO 4M3YA 3IG1A 3PO4A 4JI4K 5HBMA 2IC3A 3LL3A 5AQTA 4PKGA 1MWKA 3OVNA 4BRNA 1LW0A 3SUNA 1BHLA 4KI6A 2QKBA 2VG5A 4IJNA 3D2EB 2YHWA 3HO1A 4B3SK 1WB9A 3D45A 3OYDA 3AA5X 4FWOA 2ETJA 4NLCA 3WNGA 4JI0K 3MEEA 5AFUH 3OTOK 3PX0A 3N4QA 2YHBA 2E2OA 1ITGA 1P8ZA 3WNFA 3O1BA 4JI1K 3O80A 4XH5A 1VSEA 4K43A 1IKYA 2E6MA 2KHOA 5TKYA 4FJ8A 1RDCA 2QXLA 3RRGA 3CQYA 3MN7A 4Y1CA 5JVHL 3L3VA 1NGHA 3C7NB 4E7LA 5EU7A 3CCMN 4G1QA 1IO2A 1W2BM 4YORA 2XY8A 4O4GA 3SJJA 4IDKA 1EWQA 1J6ZA 4B8CA 3P1GA 4H4MA 3CMAN 4IG0A 3D2FA 1NGDA 2BDPA 4ILJA 1BO5O 1C0MA 3KWGA 3KHYA 3E9OA 4BVPA 1N8RO 5F2RA 3ZYYX 3VN5A 4CGDA 4YOXA 4H5TA 3A5MC 4YFUA 4CZIA 5AQPA 4BREA 4B1XB 1O1WA 3J81O 1HNZK 3TPQA 2CGKA 4R5PA 2P5GA 3MAQA 1VSHA 3IS9A 3C6TA 5EX5A 1L3VA 3O3HA 3D6RA 4CK3A 1RBSA 1T3VA 3E1YA 3CF5L 3L3UA 3QMLA 1C0UA 3DOKA 1T6DA 4JNEA 3QO9A 3IAYA 4KI4A 3BZKA 2QW9A 4H0VB 4ILGB 4BVOA 4YOUA 5JS2A 4JEPA 1TKXA 5SZTA 4AHVA 4EZ9A 3ZX3A 1NGJA 4BC2A 1YJNN 4FO0A 3O4NA 3AA4A 1BI4A 4KKOA 4DS4A 3UE5A 4JK8A 3VESA 5BREA 4BRQA 3OW2M 3AAPA 1NJYA 3H46O 2P9NB 5EOYA 4DV2K 4DTXA 3HT3A 2QWNA 2DTUA 4KHNA 1FK9A 3CFPA 5AQNA 3E9PA 3TWHA 2FC0A 5HRRA 3NAEA 2QWMA 3NMUA 4CGHA 1YITN 3QFUA 1J5EK 2OZMA 1TUYA 1GLJO 1S9GA 1EWRA 4H03B 4OKJA 1KFSA 1X9WA 1DGKN 1C1CA 1WNSA 4Z4FA 1B9FA 4MLHA 1YUWA 4N76A 2J4RA 2B6AA 4CJ4A 3TTDA 4JV5K 1CXUA 4O0JA 1SKRA 3MXMA 3HPGA 4TSXA 2KZZA 3AVIA 1GLBG 5AQKA 3G10A 3M5RA 4CZJA 2KFZA 1D9DA 5AQVA 3L2UA 2UXDK 2HHWA 1VSIA 2QK9A 1RILA 3NF9A 4OPHA 1ZYQA 2X6NA 4JI2K 3IUCA 4DLGA 3AVNA 1FKPA 2EHGA 3T69A 1HYSA 5E26A 2YNHA 2W6KA 4FWLA 2EWSA 3TAPA 4ISFA 1OVYA 4A2BA 3ZEUB 3THYB 1VQ5N 4EFHA 3KKSA 2UXCK 3AGRA 4CEOA 2ZGZA 1RT1A 3DXKB 4DSEA 3CC2N 1Q7YO 1GOBA 1WBBA 1OH7A 2CH6A 4FOIA 3O4WA 4CEFA 3RMBA 3OS1A 1NGFA 1YHQN 2P5OA 3SBGA 2YI1A 3AO1A 4NXNK 1YTAA 1E4FT 5M1FA 1K6YA 2QWLA 2ZQBA 1RDUA 4KHYA 4BR5A 3H1QA 4CFCA 3KLHA 3JXUA 4DB3A 1OVQA 4DQIA 2QWRA 3VERA 5LJVA 3L2WA 4DV1K 4E7IA 1LAWA 3ID6A 3CQXA 3D2EA 1S1XA 2WONA 5AZJB 3QLHA 3FZLA 4Y0WA 2YX6A 4O8UA 3HTVA 1V4SA 3O4QA 3GL1A 3ZX2A 3C94A 1HUXA 1RTHA 3TTFA 4JI6K 1Q8IA 3P5JA 3KLIA 4FPBA 1WSEA 5E41A 3OA9A 2HOEA 3MN5A 3SAGA 3CFOA 3CM6A 2AJQA 3VA3A 2E88A 1SL1A 1JXBA 3VQQA 5M1NA 1HYZA 1RBUA 2Q31A 2QXFA 3MCPA 1L3TA 1S22A 3A5NC 3O1WA 3C7NA 1S5JA 2OYQA 1A5WA 2YNGA 2A6AA 4LF9K 1L5UA 1KVBA 1TAUA 4KPYA 1MWMA 3LPUA 4DU4A 3B6PA 1KQSM 4FJXA 5AQWA 1HLUA 4DV3K 3R8EA 1T44A 4B8AB 1W0HA 3KKRA 4IWVA 1TV6A 2P9IA 2WOMA 5LJWA 4BDZA 2O8EA 3VQCA 3K58A 2D5RA 5AQLA 4NYFA 1RT3A 3K59A 3P31A 4E19A 1EO1A 2Y1IA 5DK5A 3NFAA 4IG3A 1BGXT 4DV5K 3LWLA 1JL2A 3R9PA 3VF2A 1NOYA 1EQYA 3I8BA 4LF5K 3FFKB 2DFFA 3U9ZA 5GAGP 4C8NA 3O9QA 3OYGA 3HZ6A 5C24A 3CCSN 4GVEA 3MWPA 4WQ5C 4CEBA 2HMIA 3F9MA 4W5QA 4FWQA 1RT7A 3RMAA 1BCMA 1ASWA 4FW1A 4QS7A 4K25A 2P9NA 1SKSA 3AY9A 1S1WA 3VMFB 5FRMA 5J2MA 4QS9A 4B9QA 1YF5L 2UXBK 3L6QA 4BRLA 2XY7A 4OGCA 3CPWM 4FWSA 4NXMK 2XY6A 3DLRA 2PFUA 4CZGA 1WUAA 3LDPA 3EZ5A 4F9OA 1ZBUA 3CJ7A 4N47A 4DSFA 2G8KA 4ZHRA 2UU9K 3K5LA 4HTLA 5FPMA 4LFAK 1NK6A 2YHYA 1QVFM 3BGRA 3K5MA 4X62K 1GOAA 1T8EA 3BP8A 2GEMA 1X9SA 3AVHA 2O4IA 2OTJN 4C1NI 1JJ2M 3OY9A 1HNVA 2B5JA 4EAHD 2OANA 3CFRA 4JKDA 3ENHA 4ZTJA 3AARA 3FE1A 5BPMA 3KLFA 3AO5A 4GVMA 4CF9A 3OYIA 5DM6L 1JLAA 2ZJRL 3H6EA 4MFBA 3H45C 3LAKA 5GAHP 4E0DA 4BRFA 1BWFO 2B4JA 4XH1A 3ZEUA 3THYA 3RWUA 3KK3A 5JICA 4FK0A 2YJFA 3SBTA 3DXKA 5ELZA 3U8XA 4CHYA 4GKKK 3AVKA 2D1KA 2YNFA 3LP3A 1XWLA 4E7HA 1IBMK 1CXQA 1BA0A 1QSSA 5B8HA 4B3RK 4HCBA 1HKCA 1R0AA 1W97L 4HVJA 3V1RA 3CG7A 2YHXA 3WXMB 4H5VA 1NOZA 3ZSYA 1RTIA 1NU0A 5AQOA 4EP4A 3WUHA 1VQKN 5A2QO 4Q5VA 1JKHA 2CH5A 1BA1A 3O9UA 3U6FA 4FLTA 2NRXA 4FJJA 4CBXA 1VQLN 3F5TA 4H5NA 1MU2A 2E20A 3IMXA 3M8SA 4ILHA 3L2VA 1IKWA 5JLHA 4BRMA 5F1XA 3PIPL 4FZZA 2KW4A 3V9WA 2HNZA 3G0ZA 3EKUA 2RHKA 2F9WA 4BR2A 4CFBA 4YHHK 2DFEA 5TKWA 4DQ8A 4CJ7A 3NH0A 1SZ2A 3M1FA 3W0LA 4DR2K 1NKBA 2JLEA 1RCHA 3WNHA 1RBRA 4O5BA 1ATRA 1C1BA 4CJ3A 4CGJA 1D9FA 3ULDA 3AO4A 1YT3A 4CIFA 2QM1A 5BN9A 3QIOA 3C65A 4YNQA 2A1SA 3TI0A 4A61A 4CGFA 4ELVA 4Z0UA 4U67L 4AQYK 1NGCA 1JLGA 2D4WA 3ULEB 5FDLA 3WXJA 3CJAA 2RN2A 4JKBA 4CHPA 1IBLK 4RTFD 2AA4A 2IIRA 4JHDB 4KREA 1VQON 1FJGK 3HK2A 4DV0K 2F8TA 4E89A 4F4KA 2HVIA 4CBUA 3AVJA 4X65K 2VWJA 1NMNA 1B9DA 3O9SA 2IVOA 1SUQA 4GMJB 1QZ5A 3VENA 3CC7N 4FWPA 4Z4EA 1BU6O 5K14A 5KRSA 1SS6A 1LOTB 4W5TA 1EXQA 4LFCK 1VK0A 2F7TA 4O44A 3AV9A 4LF8K 3RR8A 1X3MA 3CYMA 3CJCA 2ZE2A 3OYLA 3LDNA 3NBPA 4K42A 3E9LA 5SWMA 4CESA 4LF7K 3P4IA 4FSVA 1WBDA 1DT9A 3ZSVA 3THWB 2G8VA 2QWPA 4BGBA 2ASPA 5CZ2A 1QSLA 2Z1JA 5BPLA 2FBYA 5KTQA 4LF6K 3O5BA 2W6LA 2E5LK 2D0CA 1ESVA 2HNDA 3T1YK 2HBMA 3O3FA 1VSDA 3ALYA 2QTDA 3HXMA 3CCLN
chains in the Genus database with same CATH topology
4B1VA 1YAGA 1DGKN 4R79A 1JCEA 1JCFA 4MLHA 3WXLA 2UYTA 1YUWA 3W3DA 5M1OA 2J4RA 3GBTA 3TTDA 1YXQA 3DXMB 3C0BA 3C6HA 1XC3A 3VEZA 4G9ZA 2P9UA 1GLBG 3A8YA 3JS6A 5LY3A 5AQKA 2NNWA 3M5RA 4CZJA 1Q81O 5AQVA 4CZKA 3L0QA 5BN8A 3TSQA 3M6GA 4ISEA 4CBWA 3QB0A 2V52B 3VF6A 4BR7A 4CZFA 4OPHA 2CGLA 3QDKA 3VEYA 4FOEA 3DLLL 5ADXH 1WOQA 3IUCA 3HI0A 5FPNA 3VEOA 3T69A 1M1KO 4H5WA 2ZJPL 3ENBA 3U9DA 5E26A 4FVUA 1BG3A 3EKSA 4FWLA 2EWSA 2GWJA 3QBXA 4L3QA 4ISFA 2D0PA 3CCJN 1OVYA 3OBWA 3ENOA 4A2BA 3LDQA 3ZEUB 3PIOL 5AQUA 4WCEL 4EFHA 1VQ5N 1VQ7N 3I55N 5KPRA 3AGRA 3R3LA 3S41A 2ZGZA 3GDQA 3MCAB 3DXKB 2ZWHA 4PKIA 3CC2N 4MDBA 1Q7YO 1ZC6A 1QHAA 4BRAA 2NRHA 4FWMA 1QQNA 2CH6A 2CGJA 1Z6RA 3K9KA 3O4WA 4FOIA 5HOOA 1U6ZA 1NGFA 2P9KA 4KH4A 5M1KA 1YHQN 3SBGA 5AZIA 2YI1A 2AP1A 1E4FT 4WFBL 5M1FA 5BPNA 2QWLA 2QWOA 1RDUA 1T6CA 2NRWA 2P9IB 2NRTA 4M63C 3GOIA 4BR5A 3PLAA 1C0GA 1GLLO 1HKBA 3H1QA 2KLAA 2A3ZA 4H0PA 2FSNA 4IEIA 1XQSC 3RVCA 3G6EN 4Z94A 2P9LB 3JXUA 5AQRA 1SAZA 4DB3A 2PBDA 2QWRA 3VERA 5LJVA 4J8FA 3O8MA 5EXWA 3ID6A 3CQXA 3D2EA 3TSUA 1K8KB 3MDQA 4E1JA 5M1PA 3DAWA 4K41A 5AZJB 3RSEA 4H0YB 4UY8O 2VGMA 3L4QA 3FZFA 3Q7BA 1ATSA 4KH5A 3SAFA 3HM8A 1K73O 2ASMA 3FZLA 2QA4N 3H3OB 2QWQA 2E2PA 2YX6A 4O8UA 3HTVA 1V4SA 4QS8A 3GL1A 3MMVA 4IO8A 3ZX2A 3WEEB 1HUXA 3NVMA 2ZJQL 3ATUA 3TTFA 3TTCA 1YJWN 3TSPA 4A5BA 5BRHA 3HSCA 4H0TB 1XUPO 1K9MO 3F2KA 4PL7A 4FPBA 3FZHA 2Q2RA 2YCHA 3EN9A 3OA9A 2HOEA 4AF1A 4GV9A 3MN5A 3CCVN 4BRGA 3SAGA 4BC4A 4JKEA 3MK6A 5EVZA 1NGIA 2E1YA 5CE3A 5EY4A 4GV3A 2Q1NA 2W40A 2YJEA 3FZKA 3CI5A 5AQYA 2E88A 3VTHA 3CHWA 1YI2N 3CJ9A 1Q82O 3MX2A 5F0XA 5M1NA 2Q31A 2WUSA 3MCPA 2JWLA 3ZETB 4A2AA 2P9SA 1S22A 1JCGA 3A5NC 3EZWA 3O1WA 3T7ZA 3C7NA 4BQLA 2HF3A 2NRRA 2A6AA 4EHUA 3A0IX 5FPEA 1O13A 1MWMA 2FLOA 3OBYA 4IEEA 4O8KA 1GLEG 2HF4A 5E84A 3IDHA 1KQSM 3KWIA 1TUUA 4H5RA 2VCPA 5AQWA 4IZ9A 5C2DA 5BRFA 1BOTO 1HLUA 5GADP 4RWTA 3WXKA 1U2VA 1P90A 3R8EA 3D7EO 1T44A 3EE8A 5AQFA 4BG9A 1VQ9N 1Y64A 1IJJA 4IWVA 4XEIA 2P9IA 3H1VX 5LJWA 4U7BA 3ULEA 3FZMA 4M7XA 2FF6A 3D2FB 4JKGB 5AQLA 4BR0A 1LCUA 3QBWA 2I7NA 1GLCG 1R59O 3WXIA 2BTFA 5C15A 3TU5A 5KQDA 4JAXA 2QEXN 2NRZA 4BQZA 3CC4N 5AQZA 3MN9A 1S72N 1Z05A 2V51B 1K8KA 3CJBA 3P31A 4JHDA 2P9PB 4CI6A 5AZJA 1IG8A 3SLCA 1EO1A 1D4XA 3LM9A 5I9EB 5KQ8A 5CHIA 3R6MA 3CERA 4IXCA 3BF3A 4FWKA 3O9TA 4GNIA 3VEWA 3QFPA 1ZXOA 4HWIA 3ATVA 3R9PA 3VF2A 3WEEA 4BR4A 1EQYA 2GWKA 3WT0A 2Q0UA 3I33A 1X3NA 3I8BA 3ZX0A 3CMEN 3FFKB 1ILYA 4JKFA 2OTLN 1H1VA 4JN4A 3U9ZA 4CZEA 5GAGP 3O9QA 4JK7A 1NGEA 3HZ6A 4A59A 3NVKA 1QQMA 5AQMA 1NGGA 4JD2A 3CCSN 1VQ6N 3L4IA 4GVEA 3MWPA 4WQ5C 5GIOA 1YJ9N 1BDGA 3F9MA 3HOSA 4H0XB 4FWQA 2ASOA 3SAHA 2A40A 2RE2A 3CETA 4QS7A 4K25A 3BF1A 2P9NA 4WQ5A 1YIJN 5DM7L 4BC5A 2FSKA 3A5OC 3AY9A 3U4LA 3UKRB 4NO7A 3VMFB 3EL2A 3CCEN 4QS9A 4B9QA 1G99A 1HKGA 1YF5L 2DPNA 3L6QA 3CCQN 4BRLA 2BH1A 1GLAG 1E4GT 5AQQA 3UB5A 5FPDA 3CPWM 4FWSA 4BROA 4YOYA 4FL9A 2PFUA 4CZGA 1HX1A 1WUAA 2E8AA 2Q36A 2VWBA 3C6AA 3LDPA 4A62A 4CZHA 3J7ZO 1TYQA 4Y0WA 4F9OA 3CJ7A 3VPZA 4MO4A 3WQUA 4BRPA 2KKZA 4CZLA 3DJCA 1Q18A 4C1NK 4BRHA 4HTLA 1NM1A 3BUZB 3OHRA 4B1ZA 3EE9A 5FPMA 2D0OA 3O6WA 3UKUB 4B1WB 2YHYA 2W41A 5JVGL 1HJOA 1KAXA 2GUPA 3J8AA 3VGMA 1QVFM 4JKGA 4IOXA 1RDWX 3DXMA 2A5XA 3BP8A 4WF9L 2GEMA 1HPMA 3SJHA 2OTJN 4BRKA 2P9PA 3IKMA 4C1NI 4IOCL 3A5LC 3MX5A 3O08A 1JJ2M 4EAHD 4MLEA 2OANA 1RGIA 4JKDA 2VGNA 2BUPA 3FR0A 3ENHA 4BRDA 4WQ4C 5M1QA 3AARA 2HSTA 3FE1A 3Q7CA 3IFRA 5BPMA 1VQMN 3CCUN 4KBOA 4BR9A 2P9UB 2A42A 1VQNN 2Q97A 1BUPA 5DM6L 1NJIO 4FWNA 2ZJRL 4WQ4A 3H6EA 2E1ZA 4YDUC 1S3XA 4BG8A 1VQ8N 3H45C 5GAHP 4WFAL 4BY9C 5AQJA 4B1UB 4BRFA 1BWFO 2V7YA 3MWTA 2WC9A 4YDUA 4B1YB 4XH1A 1MDUB 5HL7L 1MA9B 3ZEUA 2JWKA 3CCRN 4BGAA 4YOWA 4OPAA 5AFUA 5JICA 2WFBA 3K9JA 4XH4A 2YJFA 3SBTA 3I56N 3DXKA 3LDOA 3LM2A 5ELZA 3U8XA 5JMVA 2I7PA 2D1KA 3UKRA 3WQTA 1VQ4N 4WYBA 3CPEA 4H0OA 3N4PA 2NLXA 2ITMA 4C23A 5KPTA 1YVNA 1KAYA 5ADXA 1RFQA 4AM7A 3H3NO 1QVGM 5MLCQ 4PKHA 1NMDA 1BA0A 2E2NA 1KAZA 5B8HA 1QZ6A 2GTDA 4IFEA 5C12A 5AQIA 3KVGA 1HKCA 2FF3B 3E66A 4JKCA 5H1SQ 1NLVA 1W97L 2HBJA 2P9LA 2P9KB 3WXMB 2YHXA 4AM6A 2NRVA 1GLFO 4H5VA 4GY2B 5AQOA 4M7YA 3WUHA 3VGLA 1VQKN 3LL3A 2IVNA 3MN6A 5AQTA 4YOTA 4PKGA 1MWKA 2CH5A 1KXPA 4BRNA 1BA1A 3O9UA 5GINA 2NRXA 2HBKA 2GELA 4CBXA 4PHTX 1KC8O 1VQLN 4IJNA 3FGUA 3G25A 3F5TA 3R1XA 4FWRA 3D2EB 2YHWA 4H5NA 4I6MB 4MDAA 2E20A 3IMXA 4RCHA 4ILHA 3RSEB 3CIPA 5JLHA 1GLDG 4BRMA 5F1XA 3PIPL 4FWOA 1CZAN 4NLCA 1K8AO 5KPZA 5AFUH 3N4QA 1VAZA 1QQOA 3SMSA 2PAVA 3EKUA 4JK9A 5CR4A 2RHKA 1SQKA 2F9WA 2E2OA 4BR2A 3HOTA 2F9TA 3VTIA 1OKJA 3VF4A 4NB4A 1P8ZA 3QICA 5TKWA 3O1BA 3ZETA 4CJ7A 3O80A 5AQSA 3SMPA 4XH5A 4DQ8A 4K43A 2KHOA 2NZTA 3AAQA 5AQXA 5TKYA 3SK3A 1M90O 3CJ1A 4ISGA 4CZMA 1DKGD 1SZ2A 4KH6A 4NLBA 3M1FA 3CXCM 3W0LA 4OO1J 2QXLA 3AGKA 3CQYA 3MN7A 4IJAA 2V7ZA 1ATRA 5JVHL 1KD1O 1NGHA 2P9SB 3C7NB 3CCMN 1X9JA 3GE1A 4FPAA 2VYPA 1W2BM 4YORA 5AR0A 5GAEP 3GG4A 3FLCO 3CD6N 3M3ZA 1J6ZA 4BRCA 4IOAL 4O5FA 3KZBA 2GX9A 1NBWA 3ID8A 3CMAN 3D2FA 2QM1A 4A57A 1NGDA 3BEXA 1ATNA 3EO3A 1U2VB 5BN9A 4ILJA 3C65A 2WBNA 1BO5O 2E2QA 1NWKA 3KWGA 3KHYA 4A61A 3E9OA 4BVPA 3O9RA 1N8RO 5F2RA 4CD1A 4U67L 1NGCA 5JLFA 5GIPA 4JKHA 3ZYYX 3G4SN 2D4WA 3ULEB 4YOXA 4H5TA 3A5MC 2A41A 2Q0RA 1Q86O 4CZIA 3B8AX 3WXJA 5AQPA 3VEVA 4B1XB 3HRGA 3CJAA 4BREA 1C0FA 3TPQA 1V4TA 1ZBSA 2CGKA 2FSJA 4IDHA 4JKAA 4JKBA 4RTFD 2AA4A 4I6MA 5C0YA 2IIRA 3DWLA 4JHDB 5BRDA 2QI2A 1NGBA 1NGAA 5EX5A 3VOVA 4DCHA 1VQON 3D6RA 5BR9A 3VEXA 1T3VA 3E1YA 3CF5L 4CBUA 3HBTA 3QMLA 1T6DA 4JNEA 2QW9A 4EIAA 3O9SA 4H0VB 2IVOA 4ILGB 4YOUA 4BVOA 4JEPA 3LDLA 4DHYA 5AQHA 5AQGA 1QZ5A 2H3GX 2HBLA 3VENA 3ZX3A 3CC7N 4FWPA 4PL8A 1BU6O 1NGJA 1SS6A 4BC2A 1YJNN 1LOTB 3P38A 4FO0A 4JD2B 4IO9L 4EHTA 2F7TA 3UE5A 2ZF5O 4JK8A 1X3MA 3VESA 5C10A 3P39A 5BREA 4BRQA 3OW2M 3CJCA 1DEJA 3AAPA 3H46O 3VETA 4YOVA 2P9NB 4BRIA 3LDNA 5EOYA 2ZGYA 2HMPA 4K42A 2FXUA 1VQPN 3KK7A 2QWNA 3E9LA 3VGKA 2IVPA 4BC3A 5AQNA 3P4IA 4FSVA 3G71N 1DT9A 4DKWA 3E9PA 4LC9B 5AZIB 2QWPA 4BGBA 2ASPA 2QWMA 3UKUA 3NMUA 5BPLA 1YITN 3QFUA 3O5BA 4GV6A 4WFNL 1TUYA 1GLJO 1TYQB 4H03B 1ESVA 5C2FA 2HBMA 4A5AA 2QTDA 4CD3A 4MO5A 3CCLN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B1V A;  1YAG A;  1DGK N;  1JCE A;  1JCF A;  4MLH A;  3WXL A;  2UYT A;  1YUW A;  3W3D A;  2J4R A;  3GBT A;  1YXQ A;  3DXM B;  3C0B A;  3VEZ A;  1XC3 A;  2P9U A;  1GLB G;  3A8Y A;  3JS6 A;  5LY3 A;  5AQK A;  4CZJ A;  5AQV A;  4CZK A;  3L0Q A;  5BN8 A;  3M6G A;  4ISE A;  4CBW A;  3QB0 A;  2V52 B;  3VF6 A;  4BR7 A;  4CZF A;  2CGL A;  3QDK A;  3VEY A;  4FOE A;  5ADX H;  1WOQ A;  3IUC A;  3HI0 A;  5FPN A;  3VEO A;  4H5W A;  3U9D A;  5E26 A;  1BG3 A;  3EKS A;  4FWL A;  2EWS A;  2GWJ A;  3QBX A;  4L3Q A;  4ISF A;  2D0P A;  3ENO A;  4A2B A;  3LDQ A;  3ZEU B;  5AQU A;  4EFH A;  5KPR A;  3S41 A;  2ZGZ A;  3GDQ A;  3DXK B;  2ZWH A;  4PKI A;  1ZC6 A;  1QHA A;  4BRA A;  2NRH A;  4FWM A;  1QQN A;  2CH6 A;  2CGJ A;  1Z6R A;  3O4W A;  4FOI A;  1U6Z A;  1NGF A;  2P9K A;  5AZI A;  2YI1 A;  2AP1 A;  1E4F T;  5BPN A;  2QWL A;  2QWO A;  1T6C A;  2P9I B;  4M63 C;  3GOI A;  4BR5 A;  1C0G A;  1GLL O;  1HKB A;  3H1Q A;  2A3Z A;  4H0P A;  2FSN A;  1XQS C;  4Z94 A;  2P9L B;  3JXU A;  5AQR A;  1SAZ A;  4DB3 A;  2PBD A;  2QWR A;  3VER A;  5LJV A;  4J8F A;  3O8M A;  5EXW A;  3CQX A;  3D2E A;  1K8K B;  3MDQ A;  4E1J A;  3DAW A;  4K41 A;  5AZJ B;  3RSE A;  4H0Y B;  3FZF A;  1ATS A;  3HM8 A;  2ASM A;  3FZL A;  3H3O B;  2QWQ A;  2E2P A;  4QS8 A;  4Y0W A;  3HTV A;  1V4S A;  3GL1 A;  3MMV A;  4IO8 A;  3ZX2 A;  3WEE B;  1HUX A;  3ATU A;  5BRH A;  3HSC A;  4H0T B;  1XUP O;  4PL7 A;  4FPB A;  3FZH A;  2Q2R A;  3EN9 A;  2YCH A;  2HOE A;  3MN5 A;  4BRG A;  4BC4 A;  5CE3 A;  3MK6 A;  5EVZ A;  1NGI A;  2E1Y A;  5EY4 A;  2Q1N A;  2W40 A;  2YJE A;  3FZK A;  3CI5 A;  5AQY A;  2E88 A;  3CHW A;  3CJ9 A;  5F0X A;  2Q31 A;  2WUS A;  3MCP A;  3ZET B;  4A2A A;  2P9S A;  1S22 A;  1JCG A;  3A5N C;  3EZW A;  3O1W A;  3C7N A;  4BQL A;  2HF3 A;  2A6A A;  4EHU A;  3A0I X;  5FPE A;  1MWM A;  2FLO A;  4O8K A;  1GLE G;  2HF4 A;  5E84 A;  3IDH A;  1TUU A;  4H5R A;  2VCP A;  5AQW A;  4IZ9 A;  5BRF A;  1BOT O;  1HLU A;  4RWT A;  3WXK A;  1U2V A;  3R8E A;  3D7E O;  1T44 A;  5AQF A;  4BG9 A;  1Y64 A;  1IJJ A;  4IWV A;  4XEI A;  2P9I A;  3H1V X;  5LJW A;  3ULE A;  3FZM A;  4M7X A;  2FF6 A;  3D2F B;  4BR0 A;  5AQL A;  1LCU A;  3QBW A;  2I7N A;  1GLC G;  1R59 O;  3WXI A;  2BTF A;  3TU5 A;  5KQD A;  4JAX A;  4BQZ A;  5AQZ A;  3MN9 A;  1Z05 A;  2V51 B;  1K8K A;  3CJB A;  4CI6 A;  4JHD A;  2P9P B;  5AZJ A;  1IG8 A;  3SLC A;  1D4X A;  3LM9 A;  5I9E B;  5KQ8 A;  3R6M A;  3CER A;  4IXC A;  3BF3 A;  4FWK A;  4GNI A;  3VEW A;  3QFP A;  1ZXO A;  4HWI A;  3ATV A;  3R9P A;  3VF2 A;  3WEE A;  4BR4 A;  1EQY A;  2GWK A;  3WT0 A;  2Q0U A;  3I33 A;  1X3N A;  3I8B A;  3ZX0 A;  3FFK B;  1H1V A;  4JN4 A;  3U9Z A;  4CZE A;  1NGE A;  3HZ6 A;  1QQM A;  5AQM A;  1NGG A;  4JD2 A;  3L4I A;  4WQ5 C;  1BDG A;  3F9M A;  4H0X B;  4FWQ A;  2ASO A;  2A40 A;  3CET A;  4QS7 A;  4K25 A;  3BF1 A;  2P9N A;  4WQ5 A;  4BC5 A;  2FSK A;  3A5O C;  3AY9 A;  3U4L A;  3UKR B;  4NO7 A;  3EL2 A;  4QS9 A;  4B9Q A;  1G99 A;  1HKG A;  2DPN A;  3L6Q A;  4BRL A;  1GLA G;  1E4G T;  5AQQ A;  3UB5 A;  5FPD A;  4FWS A;  4BRO A;  4FL9 A;  4CZG A;  1HX1 A;  1WUA A;  2E8A A;  2Q36 A;  2VWB A;  3LDP A;  4A62 A;  4CZH A;  1TYQ A;  4F9O A;  3CJ7 A;  3VPZ A;  4MO4 A;  3WQU A;  4BRP A;  4CZL A;  3DJC A;  1Q18 A;  4BRH A;  4HTL A;  1NM1 A;  3BUZ B;  3OHR A;  4B1Z A;  5FPM A;  2D0O A;  3O6W A;  3UKU B;  4B1W B;  2YHY A;  2W41 A;  1HJO A;  1KAX A;  2GUP A;  3J8A A;  3VGM A;  1RDW X;  3DXM A;  2A5X A;  3BP8 A;  2GEM A;  1HPM A;  3SJH A;  4BRK A;  2P9P A;  3A5L C;  3O08 A;  4EAH D;  4MLE A;  2OAN A;  1RGI A;  3FR0 A;  2BUP A;  3ENH A;  4BRD A;  4WQ4 C;  3AAR A;  3FE1 A;  5BPM A;  3IFR A;  4KBO A;  4BR9 A;  2P9U B;  2A42 A;  2Q97 A;  1BUP A;  4FWN A;  4WQ4 A;  3H6E A;  2E1Z A;  4YDU C;  1S3X A;  4BG8 A;  3H45 C;  5AQJ A;  4B1U B;  4BRF A;  1BWF O;  2V7Y A;  4YDU A;  4B1Y B;  4XH1 A;  1MDU B;  1MA9 B;  3ZEU A;  4BGA A;  5AFU A;  5JIC A;  4XH4 A;  2YJF A;  3DXK A;  3LDO A;  3LM2 A;  5ELZ A;  3U8X A;  5JMV A;  2I7P A;  2D1K A;  3UKR A;  3WQT A;  4WYB A;  4H0O A;  2ITM A;  5KPT A;  2NLX A;  4C23 A;  1YVN A;  1KAY A;  5ADX A;  1RFQ A;  4AM7 A;  3H3N O;  4PKH A;  1NMD A;  1BA0 A;  2E2N A;  1KAZ A;  5B8H A;  1QZ6 A;  2GTD A;  5AQI A;  3KVG A;  1HKC A;  2FF3 B;  1NLV A;  2P9L A;  2P9K B;  2YHX A;  4AM6 A;  1GLF O;  4H5V A;  4GY2 B;  5AQO A;  4M7Y A;  3WUH A;  3VGL A;  3LL3 A;  2IVN A;  3MN6 A;  5AQT A;  4PKG A;  1MWK A;  2CH5 A;  1KXP A;  4BRN A;  1BA1 A;  2GEL A;  4CBX A;  4IJN A;  3FGU A;  3G25 A;  4FWR A;  3D2E B;  2YHW A;  4H5N A;  4I6M B;  2E20 A;  3IMX A;  4RCH A;  3RSE B;  3CIP A;  5JLH A;  1GLD G;  4BRM A;  5F1X A;  4FWO A;  1CZA N;  5KPZ A;  5AFU H;  1QQO A;  3SMS A;  2PAV A;  3EKU A;  1SQK A;  2F9W A;  2E2O A;  4BR2 A;  2F9T A;  1OKJ A;  3VF4 A;  4NB4 A;  1P8Z A;  3QIC A;  4DQ8 A;  3O1B A;  3ZET A;  4CJ7 A;  3O80 A;  5AQS A;  3SMP A;  4XH5 A;  4K43 A;  2KHO A;  2NZT A;  3AAQ A;  5AQX A;  5TKY A;  3SK3 A;  3CJ1 A;  4ISG A;  4CZM A;  1DKG D;  1SZ2 A;  3M1F A;  3W0L A;  2QXL A;  3CQY A;  3MN7 A;  4IJA A;  2V7Z A;  1ATR A;  1NGH A;  2P9S B;  3C7N B;  1X9J A;  3GE1 A;  4FPA A;  2VYP A;  5AR0 A;  3GG4 A;  3FLC O;  3M3Z A;  1J6Z A;  4BRC A;  4O5F A;  3KZB A;  1NBW A;  3ID8 A;  3D2F A;  2QM1 A;  1NGD A;  3BEX A;  1ATN A;  3EO3 A;  1U2V B;  5BN9 A;  1BO5 O;  2E2Q A;  1NWK A;  4A61 A;  3KHY A;  4BVP A;  5F2R A;  4CD1 A;  1NGC A;  5JLF A;  2D4W A;  3ULE B;  4H5T A;  3A5M C;  2A41 A;  2Q0R A;  4CZI A;  3B8A X;  3WXJ A;  5AQP A;  3VEV A;  4B1X B;  4BRE A;  3CJA A;  1C0F A;  3TPQ A;  1V4T A;  1ZBS A;  2CGK A;  2FSJ A;  4RTF D;  2AA4 A;  4I6M A;  2IIR A;  3DWL A;  4JHD B;  5BRD A;  3VOV A;  1NGB A;  1NGA A;  5EX5 A;  4DCH A;  5BR9 A;  3VEX A;  4CBU A;  3HBT A;  3QML A;  1T6D A;  4JNE A;  2QW9 A;  4EIA A;  4H0V B;  2IVO A;  4BVO A;  4DHY A;  3LDL A;  5AQH A;  5AQG A;  1QZ5 A;  2H3G X;  3VEN A;  3ZX3 A;  4FWP A;  4PL8 A;  1BU6 O;  1NGJ A;  4BC2 A;  1LOT B;  4FO0 A;  4JD2 B;  4EHT A;  3UE5 A;  2ZF5 O;  1X3M A;  3VES A;  5BRE A;  4BRQ A;  3CJC A;  1DEJ A;  3AAP A;  3H46 O;  3VET A;  2P9N B;  4BRI A;  3LDN A;  5EOY A;  2ZGY A;  2HMP A;  4K42 A;  2FXU A;  2QWN A;  3VGK A;  2IVP A;  4BC3 A;  5AQN A;  3P4I A;  4FSV A;  4LC9 B;  5AZI B;  2QWP A;  4BGB A;  2ASP A;  2QWM A;  3UKU A;  5BPL A;  3QFU A;  3O5B A;  1TUY A;  1GLJ O;  1TYQ B;  4H03 B;  1ESV A;  4CD3 A;  4MO5 A; 
#chains in the Genus database with same CATH topology
 4FVM A;  3ZT0 A;  4R79 A;  1JCE A;  1BIS A;  1IG9 A;  4ELU A;  3HVR A;  1YXQ A;  2YV0 X;  5J2N A;  4GW6 A;  4OJR A;  4N56 A;  3KLE A;  5LY3 A;  4DR4 K;  2G8I A;  1Q81 O;  1G15 A;  4M41 A;  3TSQ A;  3M6G A;  1TGO A;  3V9Z A;  2V52 B;  4DFM A;  1BIZ A;  3QDK A;  4FOE A;  3DLL L;  1WOQ A;  1E3M A;  3L2Q A;  4GKJ K;  3QET A;  3VEO A;  1U4B A;  1NKC A;  4H5W A;  3LZI A;  3ENB A;  1FW6 A;  4FVU A;  4AHR A;  1BG3 A;  2HNY A;  3EKS A;  1DTQ A;  1HNI A;  2D0P A;  4FM1 A;  3PIO L;  1QE1 A;  3T1A A;  3F73 A;  4V19 S;  3S3O A;  2OPR A;  3S41 A;  4JRQ A;  3C6U A;  2ZWH A;  1VRT A;  4PKI A;  4RW9 A;  4KHW A;  3SUP A;  1QQN A;  2YKM A;  3K9K A;  4KH4 A;  3FFI A;  5AZI A;  3WNE A;  1J54 A;  2RF2 A;  4M3T A;  2P9I B;  4M63 C;  3AVB A;  3GOI A;  3M8P A;  4RW8 A;  1HKB A;  4E3S A;  2O8E B;  2A3Z A;  4H0P A;  2FSN A;  3G6E N;  4CFD A;  4OPK A;  2YKN A;  5C42 A;  5EXW A;  4ID5 A;  3TSU A;  1RDB A;  3MDQ A;  1IH7 A;  2HB5 A;  5M1P A;  4H0Y B;  3LP1 A;  3PY8 A;  3L4Q A;  1ATS A;  4DLE A;  4KH5 A;  3HM8 A;  1RDA A;  2HHU A;  2QA4 N;  5HOO A;  4QS8 A;  3MMV A;  4IO8 A;  5J1E A;  4JI8 K;  4DF8 A;  4FW2 A;  2R7Y A;  1SL2 A;  4OKE A;  1DTT A;  4RW7 A;  2VQF K;  1K9M O;  4IFY A;  4DR7 K;  3AVM A;  4AF1 A;  2FBV A;  4GV9 A;  1BIU A;  2VG6 A;  4DU3 A;  4BE2 A;  4BC4 A;  5CE3 A;  1NGI A;  4CER A;  3QES A;  3FZK A;  5AQY A;  4M3R A;  5IWA K;  4FJI A;  1YI2 N;  5F0X A;  1EP4 A;  4A2A A;  3M8R A;  3V81 A;  2HF3 A;  3TAN A;  4EHU A;  4W5R A;  4K0K K;  5FPE A;  4O8K A;  3AVL A;  5E84 A;  3IDH A;  2A1R A;  2VCP A;  4CJV A;  5BRF A;  1BOT O;  5C2D A;  1T7P A;  5AQF A;  1VQ9 N;  3BZC A;  4CF8 A;  4CF2 A;  1JLQ A;  3ULE A;  3FZM A;  4BR0 A;  3DLK A;  3QBW A;  3WXI A;  2BTF A;  5C15 A;  3TU5 A;  2YNI A;  5KQD A;  2NRZ A;  4BQZ A;  5AQZ A;  3HVT A;  3MN9 A;  4CED A;  1S72 N;  3KD5 E;  4OX9 K;  4JHD A;  2IAJ A;  1Q9X A;  4CE9 A;  5I9E B;  4IXC A;  5AJ3 K;  4CIG A;  1TL3 A;  4CGI A;  3ATV A;  4NYN A;  3WEE A;  3I33 A;  3ZX0 A;  3V1Q A;  4DUZ K;  3K5O A;  3DLE A;  4F2S A;  1TKD A;  3QIN A;  3SPZ A;  2OTL N;  2VQE K;  3NVK A;  3DI6 A;  1NGG A;  3SQ0 A;  1XMQ K;  1VQ6 N;  4CHZ A;  4FLZ A;  3PX4 A;  3HOS A;  4AH9 A;  4H0X B;  3SAH A;  4J2D A;  3SUQ A;  3LAM A;  4WQ5 A;  1YIJ N;  3E01 A;  1HNW K;  4BE1 A;  3A5O C;  1JLE A;  1WSF A;  3V1O A;  3EL2 A;  3DRR A;  3CCQ N;  3THW A;  1GLA G;  5FPD A;  1VHX A;  2G8F A;  4FL9 A;  1ZBI A;  4RW4 A;  3NE6 A;  3J7Z O;  4FZY A;  4A62 A;  2OPP A;  2G8W A;  3OS2 A;  3WQU A;  2KKZ A;  4CZL A;  3EE9 A;  1EET A;  4WE1 A;  4B1W B;  4JKG A;  1RDW X;  4WF9 L;  1HPM A;  3SJH A;  3IRX A;  4DTS A;  3V9U A;  4BRK A;  2P9P A;  3K5N A;  3A5L C;  5KGW A;  4LY7 A;  2BUP A;  3TAM A;  3S3N A;  2HST A;  3HP6 A;  3CCU N;  4KBO A;  4KTZ A;  2P9U B;  5HRN A;  1BUP A;  3VQA A;  3LZJ A;  2E1Z A;  4LH4 A;  4I9Q A;  1SKW A;  4KTQ A;  3TAR A;  1OH8 A;  4BY9 C;  1WSG A;  2V7Y A;  1D5A A;  2PY5 A;  2WC9 A;  1QSY A;  4BWM A;  1MA9 B;  2JWK A;  4BGA A;  3MED A;  2PZS A;  4CJP A;  5AFU A;  4XH4 A;  4KHS A;  3I56 N;  1N34 K;  1ASU A;  3MEC A;  4H4O A;  4FJN A;  4AIL C;  3UKR A;  1VQ4 N;  3CPE A;  2ITM A;  2HHV A;  1S1V A;  1HPZ A;  3ZT4 A;  1YVN A;  3HJF A;  1RFQ A;  4FLW A;  4Q0B A;  4FJ7 A;  1TKT A;  4CF0 A;  3VQD A;  5C12 A;  5AQI A;  4K8Z A;  4JKC A;  2FF3 B;  1HJR A;  3OJU A;  3QEW A;  2HBJ A;  3SZ2 A;  2X6S A;  2NRV A;  1KCF A;  4ZTF A;  4DWI A;  4FM0 A;  4M7Y A;  3QEI A;  4YOT A;  1XNR K;  1KXP A;  4LSL A;  4Z4I A;  1BL3 A;  4F8R A;  4H8K A;  4FLY A;  1KC8 O;  4PHT X;  1QS4 A;  3NCI A;  4RCH A;  4KB1 A;  4LF4 K;  1GLD G;  1KRP A;  1WN7 A;  5D3G A;  3LAN A;  3PUF A;  4MQ3 A;  1K8A O;  3DM2 A;  4KHQ A;  1VAZ A;  4JK9 A;  5CR4 A;  3HOT A;  1SQK A;  2Z1I A;  1OKJ A;  3VF4 A;  2RKI A;  4NB4 A;  3QIC A;  3OYK A;  1X1P A;  5HRP A;  2NZT A;  4FJH A;  3AAQ A;  5AQX A;  3TAF A;  3KK1 A;  1N6Q A;  1M90 O;  4ISG A;  2IGI A;  1DKG D;  4KH6 A;  5BR8 K;  1HRH A;  3AGK A;  4ID1 A;  3THX A;  2V7Z A;  1KD1 O;  4JS5 A;  4EZ6 A;  1X9J A;  1SV5 A;  4FPA A;  4CEE A;  4OLB A;  5GAE P;  3GG4 A;  4BRC A;  4O5F A;  1RT4 A;  3KZB A;  2GX9 A;  3ID8 A;  1UA1 A;  4A57 A;  1C1A A;  1FKO A;  1ATN A;  3EO3 A;  4DR1 K;  2WBN A;  2E2Q A;  1NWK A;  3O9R A;  4Y1D A;  4CD1 A;  1TKZ A;  3QNN A;  5JLF A;  3G4S N;  1VSM A;  3T1H K;  1KFD A;  2A41 A;  1Q86 O;  4FCY A;  4FZX C;  3CXC M;  1CZ9 A;  3VEV A;  1C0F A;  1V4T A;  4ICL A;  4IFV A;  4IDH A;  3ZT1 A;  4DMN A;  1ZBH A;  3DOL A;  3J7A P;  4I6M A;  5C0Y A;  4PQU A;  3DWL A;  4J2A A;  4J2B A;  1NGB A;  1S6Q A;  4DCH A;  5BR9 A;  4JLH A;  1Y97 A;  3VEX A;  1W9H A;  3OYF A;  2OCE A;  1Z25 A;  3HBT A;  4FJM A;  4NCG A;  4DHY A;  3LDL A;  5AQH A;  4X66 K;  1B92 A;  2Y1J A;  4BAC A;  2DFH A;  4PL8 A;  1LV5 A;  1HMV A;  2KZM A;  1WSI A;  3PSF A;  2ZF5 O;  4O55 A;  1I94 K;  5CZ1 A;  3BDP A;  3VET A;  4YOV A;  1X9M A;  2HMP A;  2FXU A;  4HCC A;  3KK7 A;  3VGK A;  2IVP A;  1WAF A;  4BC3 A;  3DLH A;  5FRO A;  3G71 N;  2Z1G A;  4DKW A;  4LC9 B;  5AZI B;  3L2R A;  4OLA A;  3SNN A;  3M8Q A;  3ZSO A;  2UUC K;  1XHX A;  4GV6 A;  1VSK A;  1TYQ B;  5C2F A;  1KVC A;  2ATQ A;  4CD3 A;  4MO5 A;  4YY3 K;  2I5J A;  4B1V A;  1IV0 A;  1YAG A;  3KK2 A;  4M3Z A;  3NH1 A;  3ZLJ A;  1JCF A;  3WXL A;  2UYT A;  4KFB A;  4M3W A;  5M1O A;  4M3X A;  4JI3 K;  3J7Y P;  3C6H A;  2GV9 A;  2P9U A;  3A8Y A;  3JS6 A;  4DQS A;  4QCL A;  3TAB A;  2O8F A;  3SQ1 A;  4OKK A;  2NNW A;  2X78 A;  4CZK A;  3A2F A;  4B9M A;  4CEQ A;  2P1J A;  4CJF A;  1I39 A;  4HUF A;  1Q9Y A;  2CGL A;  5ADX H;  4IBN A;  3HI0 A;  4DSJ A;  5FPN A;  4BWJ A;  2OA8 A;  1M1K O;  2ZJP L;  2O8C B;  3C95 A;  4OGE A;  4DQP A;  3T19 A;  4L3Q A;  2GWJ A;  3QBX A;  1XHZ A;  3CCJ N;  4DFK A;  4C8M A;  3LDQ A;  4CK1 A;  4WCE L;  4DTU A;  3I55 N;  3GDQ A;  4NCA A;  1LAV A;  4MDB A;  1ZC6 A;  4BRA A;  1Z6R A;  1U6Z A;  3PO5 A;  1U47 A;  1W7A A;  4WFB L;  3S9H A;  5LMU K;  5FRN A;  2QWO A;  1T6C A;  4C8L A;  2NRW A;  1F21 A;  2NRT A;  1YVU A;  5C25 A;  1C0G A;  1GLL O;  2KQ2 A;  5CYQ A;  4IEI A;  3RVC A;  3OYH A;  3LDS A;  1WLJ A;  3P83 D;  2P9L B;  4Z94 A;  5AQR A;  4F3T A;  2HHX A;  4DTP A;  1UWB A;  3VQ9 A;  4J8F A;  4LFB K;  2HHT A;  4E1J A;  3OS0 A;  4IKF A;  4K41 A;  4DTO A;  2X74 A;  1TAQ A;  3SAF A;  3PSI A;  3H3O B;  2QWQ A;  2E2P A;  1NNE A;  1U49 A;  3WEE B;  4KTW A;  4RG8 A;  3V9X A;  3NVM A;  2ZJQ L;  4E7J A;  3ZSZ A;  3K2P A;  4DV4 K;  3TSP A;  4A5B A;  5BRH A;  4H0T B;  1XUP O;  3LAL A;  2O8D B;  5J2Q A;  3F2K A;  4PL7 A;  3AVA A;  2OPQ A;  2YCH A;  1QHT A;  1S1T A;  4BDY A;  3CCV N;  4DUY K;  3MK6 A;  2IS3 A;  2E1Y A;  3OYE A;  5KGX A;  3CI5 A;  3SPY A;  3AO2 A;  1NK0 A;  3CHW A;  4CJU A;  3NH2 A;  4DTM A;  4DF4 A;  3RMC A;  3ZET B;  3EZW A;  3T7Z A;  1JCG A;  4I9L A;  4FJ9 A;  2F8S A;  1EX4 A;  4AHS A;  4RW6 A;  1S9E A;  3OBY A;  2W42 A;  1GLE G;  2HF4 A;  3HPH A;  3KWI A;  4H5R A;  1HNX K;  1IKX A;  4IZ9 A;  4RWT A;  3WXK A;  1P90 A;  2NUB A;  1WSJ A;  1LWF A;  3D7E O;  3EE8 A;  3H08 A;  4OVL A;  4JS4 A;  2BE2 A;  1IJJ A;  3HYF A;  4FLV A;  4Z4G A;  3I8D A;  3EYZ A;  3U3G A;  3J80 O;  4B9L A;  3HPO A;  1TK0 A;  4JKG B;  1LCU A;  3I0R A;  2I7N A;  3S3M A;  1UA0 A;  4JAX A;  2QEX N;  1CLQ A;  1Z05 A;  4B9S A;  1K8K A;  1NK4 A;  2P9P B;  1IG8 A;  3SLC A;  2JGU A;  1D4X A;  3LM9 A;  5CHI A;  3R6M A;  1JLB A;  4GNI A;  3VEW A;  1ZXO A;  1JLF A;  4BR4 A;  3WT0 A;  5I3U A;  3NGY A;  1X3N A;  1A5X A;  1ILY A;  3AVC A;  1H1V A;  4JN4 A;  3K57 A;  4JK7 A;  5AQM A;  3L4I A;  5GIO A;  1YJ9 N;  4E1M A;  1N5Y A;  2ASO A;  3CET A;  3KD1 E;  1C0T A;  5DM7 L;  4B3T K;  4CJK A;  3U4L A;  3UKR B;  4NO7 A;  3CCE N;  3B6O A;  1G99 A;  1HKG A;  2DPN A;  1E4G T;  2LSN A;  3UB5 A;  4DSI A;  3ZSQ A;  4YOY A;  2ZM6 K;  3OYC A;  2E8A A;  2E4L A;  4N5S A;  3C6A A;  4CZH A;  1WSH A;  2QKK A;  1TYQ A;  4M45 A;  3QER A;  2GUI A;  4BRP A;  1T03 A;  3BUZ B;  3DRS A;  3V4I A;  3UKU B;  3V6D A;  3SYZ A;  2W41 A;  5JVG L;  1KAX A;  2GUP A;  3SCX A;  4IOX A;  3AVG A;  4ELT A;  4BDP A;  1U04 A;  3O08 A;  4DQR A;  3DLB A;  3NGI A;  3FR0 A;  5FLX O;  4QOZ B;  4WQ4 C;  5M1Q A;  1VQM N;  3IFR A;  2VG7 A;  4B9U A;  1I3A A;  2OZS A;  3SI6 A;  3T3F A;  4CJW A;  4YDU C;  1S3X A;  4BG8 A;  1VQ8 N;  4FJL A;  4CCH A;  2O8C A;  3MEG A;  2F4V K;  1IBK K;  5IT9 O;  1MDU B;  5HL7 L;  3OJS A;  3OYJ A;  3CCR N;  4YOW A;  4I7F A;  4CEZ A;  1C6V A;  4XIU A;  3VQP A;  1SL0 A;  1BCO A;  4CFA A;  1XMO K;  3LDO A;  4C8K A;  5JMV A;  3L8B A;  1XI1 A;  4KAZ A;  1FXX A;  3WQT A;  4WYB A;  4H0O A;  5KPT A;  3N4P A;  1RTD A;  3THX B;  5ADX A;  3H3N O;  1QVG M;  2F96 A;  2O4G A;  1NMD A;  4K8X A;  2E2N A;  1HR0 K;  2GTD A;  4FYD A;  3KVG A;  3AA2 A;  4CK2 A;  3E66 A;  5H1S Q;  3QEP A;  2P9L A;  1RT5 A;  2P9K B;  3ZSX A;  4GY2 B;  3VGL A;  1JL1 A;  2KTQ A;  1OH5 A;  2IVN A;  3MN6 A;  4DTR A;  5GIN A;  4DQQ A;  2HBK A;  2GEL A;  1GOC A;  1J9A A;  4FK2 A;  3FGU A;  3G25 A;  3R1X A;  4FWR A;  4PWD A;  4MDA A;  4I6M B;  5HP1 A;  3RSE B;  2O8D A;  3CIP A;  1L3U A;  1NG9 A;  1LWE A;  2XHB A;  2FBT A;  1CZA N;  4CJQ A;  4B3M K;  5KPZ A;  3O3G A;  1QQO A;  3SMS A;  2PAV A;  3JSM A;  1LWC A;  2F9T A;  3LP2 A;  3VTI A;  3ITH A;  3UIQ A;  4DTN A;  3HST B;  3ZET A;  5AQS A;  3SMP A;  4KHU A;  1VRU A;  1VSJ A;  1ZBF A;  3SK3 A;  3CJ1 A;  4CZM A;  5CYM A;  4L8R B;  4NLB A;  4B08 A;  3KTQ A;  4OO1 J;  3SQ4 A;  3LPT A;  1HYV A;  4IJA A;  3ASM A;  1NJW A;  1ASV A;  2P9S B;  3U3Y A;  1RBT A;  3GE1 A;  2VYP A;  3EEQ A;  1NK5 A;  5AR0 A;  3KJV A;  3CD6 N;  3FLC O;  3M3Z A;  1S6P A;  4HUE A;  4IOA L;  2VWK A;  1NBW A;  3AVF A;  2UUA K;  3VA0 A;  3BEX A;  1U2V B;  1J53 A;  4DFP A;  5GIP A;  2O8B B;  4JKH A;  4E7K A;  4FJG A;  2Q0R A;  2HVH A;  3B8A X;  3HRG A;  4JI5 K;  3ZT2 A;  1ZBS A;  2FSJ A;  4JKA A;  3OYB A;  2O8F B;  3NF8 A;  5BRD A;  4X64 K;  3KIO A;  2QI2 A;  3VOV A;  1NGA A;  3RRH A;  3NF6 A;  3TAQ A;  2ZD1 A;  4B9V A;  3SUO A;  4EIA A;  1Z26 A;  4FXD A;  1NKE A;  4W5N A;  5AQG A;  2H3G X;  2HBL A;  2WTU A;  4J2E A;  1YTU A;  4CF1 A;  3P38 A;  4JD2 B;  4IO9 L;  1TK8 A;  4EHT A;  2XO7 A;  4CHQ A;  5C10 A;  3P39 A;  3BY5 A;  1DEJ A;  4I2P A;  5KRT A;  3MXI A;  4BRI A;  4CW7 B;  2ZGY A;  3K0S A;  1VQP N;  4DR3 K;  1EKE A;  4Z4C A;  4FJK A;  3NHG A;  3UKU A;  3HM9 A;  4WFN L;  3VQ6 A;  1TK5 A;  4A5A A;  3HL8 A;  4DSL A;  3W3D A;  3GBT A;  1NK8 A;  3DXM B;  4LD0 A;  4E1N A;  4FM2 A;  4HUG A;  3C0B A;  3VEZ A;  1XC3 A;  4G9Z A;  1XNQ K;  5HRS A;  3ZSW A;  3L0Q A;  5BN8 A;  1NK9 A;  4ISE A;  4BE0 A;  4CBW A;  3QB0 A;  3VF6 A;  4CZF A;  4BR7 A;  1UOC A;  2FBX A;  3VEY A;  2HHH K;  1RT6 A;  4DU1 A;  1OH6 A;  1T05 A;  3U9D A;  3CM5 A;  3OBW A;  3ENO A;  5AQU A;  1VQ7 N;  5KPR A;  3R3L A;  4AHC A;  3MCA B;  3DRP A;  4CJR A;  5LL6 Z;  1LW2 A;  1RDD A;  4PY5 A;  1QHA A;  1HQU A;  2NRH A;  4FWM A;  2YHA A;  3ZCM A;  2CGJ A;  4CJT A;  1CZB A;  4DV6 K;  1TL1 A;  4DR6 K;  2P9K A;  5M1K A;  1KVA A;  3KLG A;  2AP1 A;  4DR5 K;  3THV A;  5BPN A;  4B9T A;  3VQE A;  3PLA A;  4KO0 A;  3F9K A;  1BQM A;  2KLA A;  3SV4 A;  2GBZ A;  1XQS C;  3HP9 A;  1SAZ A;  1DLO A;  2PBD A;  4AHT A;  3O8M A;  4KRF A;  4Z4H A;  1K8K B;  2BGG A;  2HHS A;  3DAW A;  3RSE A;  3ZT3 A;  4PUO A;  3DYA A;  4UY8 O;  2VGM A;  3FZF A;  3Q7B A;  1U48 A;  3TAE A;  1K73 O;  2ASM A;  2ITG A;  1RNH A;  3RTV A;  1U45 A;  1N36 K;  3ATU A;  3TTC A;  1YJW N;  3OYN A;  3HSC A;  2OPS A;  4DS5 A;  3FZH A;  3D0P A;  2Q2R A;  3EN9 A;  5I42 A;  2Z1H A;  1KLM A;  4BRG A;  3DLG A;  4F3O A;  4F2R A;  4JKE A;  5EVZ A;  1D8Y A;  4GV3 A;  5EY4 A;  2Q1N A;  2W40 A;  2YJE A;  3VTH A;  4B9N A;  4JYA K;  5LMN K;  3CJ9 A;  4FLX A;  4KV8 A;  1RT2 A;  3MX2 A;  1Q82 O;  4DTJ A;  2WUS A;  2JWL A;  2P9S A;  2XY5 A;  3VQ4 A;  4BQL A;  2NRR A;  4CEA A;  3A0I X;  1O13 A;  3QNO A;  4DFJ A;  2FLO A;  3DMJ A;  4IEE A;  2IOC A;  1TUU A;  3NF7 A;  4HHT A;  4CHN A;  5GAD P;  4FJ5 A;  4DG1 A;  1U2V A;  2HHQ A;  4KB0 A;  2PYJ A;  4BG9 A;  1NJZ A;  1Y64 A;  4XEI A;  3H1V X;  1J5O A;  2O8B A;  4U7B A;  3NGZ A;  1NJX A;  1VSF A;  2XRI A;  4M7X A;  4LSN A;  1HQE A;  2FF6 A;  3D2F B;  3TR8 A;  2PYL A;  1GLC G;  1R59 O;  2G8U A;  3QEV A;  5CY4 A;  1VSL A;  3VQ7 A;  4EP5 A;  3CC4 N;  4W5O A;  2V51 B;  3CJB A;  4CI6 A;  4CGG A;  5AZJ A;  1REV A;  2UUB K;  5KQ8 A;  3CER A;  3BF3 A;  4FWK A;  3O9T A;  4AHU A;  1A5V A;  3QFP A;  4HWI A;  5DMR A;  2IDO A;  1WAJ A;  2KFN A;  2BAN A;  2GWK A;  4LH5 A;  4CJS A;  2Q0U A;  4JI7 K;  3CME N;  4PA1 A;  4JKF A;  3VQB A;  4CZE A;  5J2P A;  1NGE A;  4A59 A;  1L3S A;  1QQM A;  2RPI A;  4JD2 A;  1BDG A;  1ZBL A;  4CJE A;  3JYT A;  1QTM A;  2A40 A;  5JS1 A;  2RE2 A;  1BQN A;  3BF1 A;  1N32 K;  2D0A A;  3LWM A;  4BC5 A;  3I0S A;  2P51 A;  2FSK A;  1JXE A;  3OYA A;  1BI4 B;  3JAM O;  4CJL A;  2BH1 A;  4CVN E;  3ISN C;  5AQQ A;  4C8O A;  1KLN A;  4BRO A;  1JLC A;  4UQG A;  1HX1 A;  2Q36 A;  1RBV A;  2VWB A;  3MXJ A;  4DSK A;  3VPZ A;  1NK7 A;  4MO4 A;  1RTJ A;  3DJC A;  1Q18 A;  4C1N K;  4BRH A;  3TAG A;  2E6L A;  1NM1 A;  3OHR A;  4B1Z A;  4HTU A;  2DY4 A;  2D0O A;  3O6W A;  4QAG A;  3LP0 A;  5KI6 A;  1XC9 A;  4OPJ A;  3RR7 A;  1HJO A;  3VGM A;  3J8A A;  3OYM A;  3DXM A;  3SQ2 A;  2A5X A;  4FK4 A;  1KSP A;  4O0I A;  4FLU A;  1KTQ A;  3IKM A;  2D0B A;  4IOC L;  3MX5 A;  3RMD A;  4MLE A;  1RGI A;  2VGN A;  4M3U A;  1QQC A;  4BRD A;  3Q7C A;  4KHP K;  3QEX A;  3VQ5 A;  5HRO A;  1TVR A;  3AA3 A;  4M42 A;  4BR9 A;  2A42 A;  1VQN N;  2Q97 A;  1NJI O;  4FWN A;  4WQ4 A;  5T7B A;  3EY1 A;  3QIP A;  5HLF A;  4WFA L;  5AQJ A;  4I2Q A;  4JRP A;  3AO3 A;  1UAX A;  4B1U B;  1IKV A;  3MWT A;  3SV3 A;  4CEC A;  4YDU A;  4B1Y B;  4N41 A;  4CJ5 A;  3CQ8 A;  4OPA A;  1S1U A;  2EX3 A;  3V9S A;  3NDK A;  2WFB A;  3K9J A;  3VQ8 A;  3LM2 A;  3ZSR A;  4CHO A;  2I7P A;  4CIE A;  2G8H A;  4NCB A;  2NLX A;  4C23 A;  1KAY A;  4AM7 A;  2HW3 A;  5MLC Q;  4PKH A;  1N33 K;  1KAZ A;  4B3O A;  4DV7 K;  1QZ6 A;  4IFE A;  2Q3S A;  1NLV A;  3PX6 A;  3PV8 A;  4AM6 A;  1GLF O;  4M3Y A;  3IG1 A;  3PO4 A;  4JI4 K;  5HBM A;  2IC3 A;  3LL3 A;  5AQT A;  4PKG A;  1MWK A;  3OVN A;  4BRN A;  1LW0 A;  3SUN A;  1BHL A;  4KI6 A;  2QKB A;  2VG5 A;  4IJN A;  3D2E B;  2YHW A;  3HO1 A;  4B3S K;  1WB9 A;  3D45 A;  3OYD A;  3AA5 X;  4FWO A;  2ETJ A;  4NLC A;  3WNG A;  4JI0 K;  3MEE A;  5AFU H;  3OTO K;  3PX0 A;  3N4Q A;  2YHB A;  2E2O A;  1ITG A;  1P8Z A;  3WNF A;  3O1B A;  4JI1 K;  3O80 A;  4XH5 A;  1VSE A;  4K43 A;  1IKY A;  2E6M A;  2KHO A;  5TKY A;  4FJ8 A;  1RDC A;  2QXL A;  3RRG A;  3CQY A;  3MN7 A;  4Y1C A;  5JVH L;  3L3V A;  1NGH A;  3C7N B;  4E7L A;  5EU7 A;  3CCM N;  4G1Q A;  1IO2 A;  1W2B M;  4YOR A;  2XY8 A;  4O4G A;  3SJJ A;  4IDK A;  1EWQ A;  1J6Z A;  4B8C A;  3P1G A;  4H4M A;  3CMA N;  4IG0 A;  3D2F A;  1NGD A;  2BDP A;  4ILJ A;  1BO5 O;  1C0M A;  3KWG A;  3KHY A;  3E9O A;  4BVP A;  1N8R O;  5F2R A;  3ZYY X;  3VN5 A;  4CGD A;  4YOX A;  4H5T A;  3A5M C;  4YFU A;  4CZI A;  5AQP A;  4BRE A;  4B1X B;  1O1W A;  3J81 O;  1HNZ K;  3TPQ A;  2CGK A;  4R5P A;  2P5G A;  3MAQ A;  1VSH A;  3IS9 A;  3C6T A;  5EX5 A;  1L3V A;  3O3H A;  3D6R A;  4CK3 A;  1RBS A;  1T3V A;  3E1Y A;  3CF5 L;  3L3U A;  3QML A;  1C0U A;  3DOK A;  1T6D A;  4JNE A;  3QO9 A;  3IAY A;  4KI4 A;  3BZK A;  2QW9 A;  4H0V B;  4ILG B;  4BVO A;  4YOU A;  5JS2 A;  4JEP A;  1TKX A;  5SZT A;  4AHV A;  4EZ9 A;  3ZX3 A;  1NGJ A;  4BC2 A;  1YJN N;  4FO0 A;  3O4N A;  3AA4 A;  1BI4 A;  4KKO A;  4DS4 A;  3UE5 A;  4JK8 A;  3VES A;  5BRE A;  4BRQ A;  3OW2 M;  3AAP A;  1NJY A;  3H46 O;  2P9N B;  5EOY A;  4DV2 K;  4DTX A;  3HT3 A;  2QWN A;  2DTU A;  4KHN A;  1FK9 A;  3CFP A;  5AQN A;  3E9P A;  3TWH A;  2FC0 A;  5HRR A;  3NAE A;  2QWM A;  3NMU A;  4CGH A;  1YIT N;  3QFU A;  1J5E K;  2OZM A;  1TUY A;  1GLJ O;  1S9G A;  1EWR A;  4H03 B;  4OKJ A;  1KFS A;  1X9W A;  1DGK N;  1C1C A;  1WNS A;  4Z4F A;  1B9F A;  4MLH A;  1YUW A;  4N76 A;  2J4R A;  2B6A A;  4CJ4 A;  3TTD A;  4JV5 K;  1CXU A;  4O0J A;  1SKR A;  3MXM A;  3HPG A;  4TSX A;  2KZZ A;  3AVI A;  1GLB G;  5AQK A;  3G10 A;  3M5R A;  4CZJ A;  2KFZ A;  1D9D A;  5AQV A;  3L2U A;  2UXD K;  2HHW A;  1VSI A;  2QK9 A;  1RIL A;  3NF9 A;  4OPH A;  1ZYQ A;  2X6N A;  4JI2 K;  3IUC A;  4DLG A;  3AVN A;  1FKP A;  2EHG A;  3T69 A;  1HYS A;  5E26 A;  2YNH A;  2W6K A;  4FWL A;  2EWS A;  3TAP A;  4ISF A;  1OVY A;  4A2B A;  3ZEU B;  3THY B;  1VQ5 N;  4EFH A;  3KKS A;  2UXC K;  3AGR A;  4CEO A;  2ZGZ A;  1RT1 A;  3DXK B;  4DSE A;  3CC2 N;  1Q7Y O;  1GOB A;  1WBB A;  1OH7 A;  2CH6 A;  4FOI A;  3O4W A;  4CEF A;  3RMB A;  3OS1 A;  1NGF A;  1YHQ N;  2P5O A;  3SBG A;  2YI1 A;  3AO1 A;  4NXN K;  1YTA A;  1E4F T;  5M1F A;  1K6Y A;  2QWL A;  2ZQB A;  1RDU A;  4KHY A;  4BR5 A;  3H1Q A;  4CFC A;  3KLH A;  3JXU A;  4DB3 A;  1OVQ A;  4DQI A;  2QWR A;  3VER A;  5LJV A;  3L2W A;  4DV1 K;  4E7I A;  1LAW A;  3ID6 A;  3CQX A;  3D2E A;  1S1X A;  2WON A;  5AZJ B;  3QLH A;  3FZL A;  4Y0W A;  2YX6 A;  4O8U A;  3HTV A;  1V4S A;  3O4Q A;  3GL1 A;  3ZX2 A;  3C94 A;  1HUX A;  1RTH A;  3TTF A;  4JI6 K;  1Q8I A;  3P5J A;  3KLI A;  4FPB A;  1WSE A;  5E41 A;  3OA9 A;  2HOE A;  3MN5 A;  3SAG A;  3CFO A;  3CM6 A;  2AJQ A;  3VA3 A;  2E88 A;  1SL1 A;  1JXB A;  3VQQ A;  5M1N A;  1HYZ A;  1RBU A;  2Q31 A;  2QXF A;  3MCP A;  1L3T A;  1S22 A;  3A5N C;  3O1W A;  3C7N A;  1S5J A;  2OYQ A;  1A5W A;  2YNG A;  2A6A A;  4LF9 K;  1L5U A;  1KVB A;  1TAU A;  4KPY A;  1MWM A;  3LPU A;  4DU4 A;  3B6P A;  1KQS M;  4FJX A;  5AQW A;  1HLU A;  4DV3 K;  3R8E A;  1T44 A;  4B8A B;  1W0H A;  3KKR A;  4IWV A;  1TV6 A;  2P9I A;  2WOM A;  5LJW A;  4BDZ A;  2O8E A;  3VQC A;  3K58 A;  2D5R A;  5AQL A;  4NYF A;  1RT3 A;  3K59 A;  3P31 A;  4E19 A;  1EO1 A;  2Y1I A;  5DK5 A;  3NFA A;  4IG3 A;  1BGX T;  4DV5 K;  3LWL A;  1JL2 A;  3R9P A;  3VF2 A;  1NOY A;  1EQY A;  3I8B A;  4LF5 K;  3FFK B;  2DFF A;  3U9Z A;  5GAG P;  4C8N A;  3O9Q A;  3OYG A;  3HZ6 A;  5C24 A;  3CCS N;  4GVE A;  3MWP A;  4WQ5 C;  4CEB A;  2HMI A;  3F9M A;  4W5Q A;  4FWQ A;  1RT7 A;  3RMA A;  1BCM A;  1ASW A;  4FW1 A;  4QS7 A;  4K25 A;  2P9N A;  1SKS A;  3AY9 A;  1S1W A;  3VMF B;  5FRM A;  5J2M A;  4QS9 A;  4B9Q A;  1YF5 L;  2UXB K;  3L6Q A;  4BRL A;  2XY7 A;  4OGC A;  3CPW M;  4FWS A;  4NXM K;  2XY6 A;  3DLR A;  2PFU A;  4CZG A;  1WUA A;  3LDP A;  3EZ5 A;  4F9O A;  1ZBU A;  3CJ7 A;  4N47 A;  4DSF A;  2G8K A;  4ZHR A;  2UU9 K;  3K5L A;  4HTL A;  5FPM A;  4LFA K;  1NK6 A;  2YHY A;  1QVF M;  3BGR A;  3K5M A;  4X62 K;  1GOA A;  1T8E A;  3BP8 A;  2GEM A;  1X9S A;  3AVH A;  2O4I A;  2OTJ N;  4C1N I;  1JJ2 M;  3OY9 A;  1HNV A;  2B5J A;  4EAH D;  2OAN A;  3CFR A;  4JKD A;  3ENH A;  4ZTJ A;  3AAR A;  3FE1 A;  5BPM A;  3KLF A;  3AO5 A;  4GVM A;  4CF9 A;  3OYI A;  5DM6 L;  1JLA A;  2ZJR L;  3H6E A;  4MFB A;  3H45 C;  3LAK A;  5GAH P;  4E0D A;  4BRF A;  1BWF O;  2B4J A;  4XH1 A;  3ZEU A;  3THY A;  3RWU A;  3KK3 A;  5JIC A;  4FK0 A;  2YJF A;  3SBT A;  3DXK A;  5ELZ A;  3U8X A;  4CHY A;  4GKK K;  3AVK A;  2D1K A;  2YNF A;  3LP3 A;  1XWL A;  4E7H A;  1IBM K;  1CXQ A;  1BA0 A;  1QSS A;  5B8H A;  4B3R K;  4HCB A;  1HKC A;  1R0A A;  1W97 L;  4HVJ A;  3V1R A;  3CG7 A;  2YHX A;  3WXM B;  4H5V A;  1NOZ A;  3ZSY A;  1RTI A;  1NU0 A;  5AQO A;  4EP4 A;  3WUH A;  1VQK N;  5A2Q O;  4Q5V A;  1JKH A;  2CH5 A;  1BA1 A;  3O9U A;  3U6F A;  4FLT A;  2NRX A;  4FJJ A;  4CBX A;  1VQL N;  3F5T A;  4H5N A;  1MU2 A;  2E20 A;  3IMX A;  3M8S A;  4ILH A;  3L2V A;  1IKW A;  5JLH A;  4BRM A;  5F1X A;  3PIP L;  4FZZ A;  2KW4 A;  3V9W A;  2HNZ A;  3G0Z A;  3EKU A;  2RHK A;  2F9W A;  4BR2 A;  4CFB A;  4YHH K;  2DFE A;  5TKW A;  4DQ8 A;  4CJ7 A;  3NH0 A;  1SZ2 A;  3M1F A;  3W0L A;  4DR2 K;  1NKB A;  2JLE A;  1RCH A;  3WNH A;  1RBR A;  4O5B A;  1ATR A;  1C1B A;  4CJ3 A;  4CGJ A;  1D9F A;  3ULD A;  3AO4 A;  1YT3 A;  4CIF A;  2QM1 A;  5BN9 A;  3QIO A;  3C65 A;  4YNQ A;  2A1S A;  3TI0 A;  4A61 A;  4CGF A;  4ELV A;  4Z0U A;  4U67 L;  4AQY K;  1NGC A;  1JLG A;  2D4W A;  3ULE B;  5FDL A;  3WXJ A;  3CJA A;  2RN2 A;  4JKB A;  4CHP A;  1IBL K;  4RTF D;  2AA4 A;  2IIR A;  4JHD B;  4KRE A;  1VQO N;  1FJG K;  3HK2 A;  4DV0 K;  2F8T A;  4E89 A;  4F4K A;  2HVI A;  4CBU A;  3AVJ A;  4X65 K;  2VWJ A;  1NMN A;  1B9D A;  3O9S A;  2IVO A;  1SUQ A;  4GMJ B;  1QZ5 A;  3VEN A;  3CC7 N;  4FWP A;  4Z4E A;  1BU6 O;  5K14 A;  5KRS A;  1SS6 A;  1LOT B;  4W5T A;  1EXQ A;  4LFC K;  1VK0 A;  2F7T A;  4O44 A;  3AV9 A;  4LF8 K;  3RR8 A;  1X3M A;  3CYM A;  3CJC A;  2ZE2 A;  3OYL A;  3LDN A;  3NBP A;  4K42 A;  3E9L A;  5SWM A;  4CES A;  4LF7 K;  3P4I A;  4FSV A;  1WBD A;  1DT9 A;  3ZSV A;  3THW B;  2G8V A;  2QWP A;  4BGB A;  2ASP A;  5CZ2 A;  1QSL A;  2Z1J A;  5BPL A;  2FBY A;  5KTQ A;  4LF6 K;  3O5B A;  2W6L A;  2E5L K;  2D0C A;  1ESV A;  2HND A;  3T1Y K;  2HBM A;  3O3F A;  1VSD A;  3ALY A;  2QTD A;  3HXM A;  3CCL N; 
#chains in the Genus database with same CATH homology
 4B1V A;  1YAG A;  1DGK N;  4R79 A;  1JCE A;  1JCF A;  4MLH A;  3WXL A;  2UYT A;  1YUW A;  3W3D A;  5M1O A;  2J4R A;  3GBT A;  3TTD A;  1YXQ A;  3DXM B;  3C0B A;  3C6H A;  1XC3 A;  3VEZ A;  4G9Z A;  2P9U A;  1GLB G;  3A8Y A;  3JS6 A;  5LY3 A;  5AQK A;  2NNW A;  3M5R A;  4CZJ A;  1Q81 O;  5AQV A;  4CZK A;  3L0Q A;  5BN8 A;  3TSQ A;  3M6G A;  4ISE A;  4CBW A;  3QB0 A;  2V52 B;  3VF6 A;  4BR7 A;  4CZF A;  4OPH A;  2CGL A;  3QDK A;  3VEY A;  4FOE A;  3DLL L;  5ADX H;  1WOQ A;  3IUC A;  3HI0 A;  5FPN A;  3VEO A;  3T69 A;  1M1K O;  4H5W A;  2ZJP L;  3ENB A;  3U9D A;  5E26 A;  4FVU A;  1BG3 A;  3EKS A;  4FWL A;  2EWS A;  2GWJ A;  3QBX A;  4L3Q A;  4ISF A;  2D0P A;  3CCJ N;  1OVY A;  3OBW A;  3ENO A;  4A2B A;  3LDQ A;  3ZEU B;  3PIO L;  5AQU A;  4WCE L;  4EFH A;  1VQ5 N;  1VQ7 N;  3I55 N;  5KPR A;  3AGR A;  3R3L A;  3S41 A;  2ZGZ A;  3GDQ A;  3MCA B;  3DXK B;  2ZWH A;  4PKI A;  3CC2 N;  4MDB A;  1Q7Y O;  1ZC6 A;  1QHA A;  4BRA A;  2NRH A;  4FWM A;  1QQN A;  2CH6 A;  2CGJ A;  1Z6R A;  3K9K A;  3O4W A;  4FOI A;  5HOO A;  1U6Z A;  1NGF A;  2P9K A;  4KH4 A;  5M1K A;  1YHQ N;  3SBG A;  5AZI A;  2YI1 A;  2AP1 A;  1E4F T;  4WFB L;  5M1F A;  5BPN A;  2QWL A;  2QWO A;  1RDU A;  1T6C A;  2NRW A;  2P9I B;  2NRT A;  4M63 C;  3GOI A;  4BR5 A;  3PLA A;  1C0G A;  1GLL O;  1HKB A;  3H1Q A;  2KLA A;  2A3Z A;  4H0P A;  2FSN A;  4IEI A;  1XQS C;  3RVC A;  3G6E N;  4Z94 A;  2P9L B;  3JXU A;  5AQR A;  1SAZ A;  4DB3 A;  2PBD A;  2QWR A;  3VER A;  5LJV A;  4J8F A;  3O8M A;  5EXW A;  3ID6 A;  3CQX A;  3D2E A;  3TSU A;  1K8K B;  3MDQ A;  4E1J A;  5M1P A;  3DAW A;  4K41 A;  5AZJ B;  3RSE A;  4H0Y B;  4UY8 O;  2VGM A;  3L4Q A;  3FZF A;  3Q7B A;  1ATS A;  4KH5 A;  3SAF A;  3HM8 A;  1K73 O;  2ASM A;  3FZL A;  2QA4 N;  3H3O B;  2QWQ A;  2E2P A;  2YX6 A;  4O8U A;  3HTV A;  1V4S A;  4QS8 A;  3GL1 A;  3MMV A;  4IO8 A;  3ZX2 A;  3WEE B;  1HUX A;  3NVM A;  2ZJQ L;  3ATU A;  3TTF A;  3TTC A;  1YJW N;  3TSP A;  4A5B A;  5BRH A;  3HSC A;  4H0T B;  1XUP O;  1K9M O;  3F2K A;  4PL7 A;  4FPB A;  3FZH A;  2Q2R A;  2YCH A;  3EN9 A;  3OA9 A;  2HOE A;  4AF1 A;  4GV9 A;  3MN5 A;  3CCV N;  4BRG A;  3SAG A;  4BC4 A;  4JKE A;  3MK6 A;  5EVZ A;  1NGI A;  2E1Y A;  5CE3 A;  5EY4 A;  4GV3 A;  2Q1N A;  2W40 A;  2YJE A;  3FZK A;  3CI5 A;  5AQY A;  2E88 A;  3VTH A;  3CHW A;  1YI2 N;  3CJ9 A;  1Q82 O;  3MX2 A;  5F0X A;  5M1N A;  2Q31 A;  2WUS A;  3MCP A;  2JWL A;  3ZET B;  4A2A A;  2P9S A;  1S22 A;  1JCG A;  3A5N C;  3EZW A;  3O1W A;  3T7Z A;  3C7N A;  4BQL A;  2HF3 A;  2NRR A;  2A6A A;  4EHU A;  3A0I X;  5FPE A;  1O13 A;  1MWM A;  2FLO A;  3OBY A;  4IEE A;  4O8K A;  1GLE G;  2HF4 A;  5E84 A;  3IDH A;  1KQS M;  3KWI A;  1TUU A;  4H5R A;  2VCP A;  5AQW A;  4IZ9 A;  5C2D A;  5BRF A;  1BOT O;  1HLU A;  5GAD P;  4RWT A;  3WXK A;  1U2V A;  1P90 A;  3R8E A;  3D7E O;  1T44 A;  3EE8 A;  5AQF A;  4BG9 A;  1VQ9 N;  1Y64 A;  1IJJ A;  4IWV A;  4XEI A;  2P9I A;  3H1V X;  5LJW A;  4U7B A;  3ULE A;  3FZM A;  4M7X A;  2FF6 A;  3D2F B;  4JKG B;  5AQL A;  4BR0 A;  1LCU A;  3QBW A;  2I7N A;  1GLC G;  1R59 O;  3WXI A;  2BTF A;  5C15 A;  3TU5 A;  5KQD A;  4JAX A;  2QEX N;  2NRZ A;  4BQZ A;  3CC4 N;  5AQZ A;  3MN9 A;  1S72 N;  1Z05 A;  2V51 B;  1K8K A;  3CJB A;  3P31 A;  4JHD A;  2P9P B;  4CI6 A;  5AZJ A;  1IG8 A;  3SLC A;  1EO1 A;  1D4X A;  3LM9 A;  5I9E B;  5KQ8 A;  5CHI A;  3R6M A;  3CER A;  4IXC A;  3BF3 A;  4FWK A;  3O9T A;  4GNI A;  3VEW A;  3QFP A;  1ZXO A;  4HWI A;  3ATV A;  3R9P A;  3VF2 A;  3WEE A;  4BR4 A;  1EQY A;  2GWK A;  3WT0 A;  2Q0U A;  3I33 A;  1X3N A;  3I8B A;  3ZX0 A;  3CME N;  3FFK B;  1ILY A;  4JKF A;  2OTL N;  1H1V A;  4JN4 A;  3U9Z A;  4CZE A;  5GAG P;  3O9Q A;  4JK7 A;  1NGE A;  3HZ6 A;  4A59 A;  3NVK A;  1QQM A;  5AQM A;  1NGG A;  4JD2 A;  3CCS N;  1VQ6 N;  3L4I A;  4GVE A;  3MWP A;  4WQ5 C;  5GIO A;  1YJ9 N;  1BDG A;  3F9M A;  3HOS A;  4H0X B;  4FWQ A;  2ASO A;  3SAH A;  2A40 A;  2RE2 A;  3CET A;  4QS7 A;  4K25 A;  3BF1 A;  2P9N A;  4WQ5 A;  1YIJ N;  5DM7 L;  4BC5 A;  2FSK A;  3A5O C;  3AY9 A;  3U4L A;  3UKR B;  4NO7 A;  3VMF B;  3EL2 A;  3CCE N;  4QS9 A;  4B9Q A;  1G99 A;  1HKG A;  1YF5 L;  2DPN A;  3L6Q A;  3CCQ N;  4BRL A;  2BH1 A;  1GLA G;  1E4G T;  5AQQ A;  3UB5 A;  5FPD A;  3CPW M;  4FWS A;  4BRO A;  4YOY A;  4FL9 A;  2PFU A;  4CZG A;  1HX1 A;  1WUA A;  2E8A A;  2Q36 A;  2VWB A;  3C6A A;  3LDP A;  4A62 A;  4CZH A;  3J7Z O;  1TYQ A;  4Y0W A;  4F9O A;  3CJ7 A;  3VPZ A;  4MO4 A;  3WQU A;  4BRP A;  2KKZ A;  4CZL A;  3DJC A;  1Q18 A;  4C1N K;  4BRH A;  4HTL A;  1NM1 A;  3BUZ B;  3OHR A;  4B1Z A;  3EE9 A;  5FPM A;  2D0O A;  3O6W A;  3UKU B;  4B1W B;  2YHY A;  2W41 A;  5JVG L;  1HJO A;  1KAX A;  2GUP A;  3J8A A;  3VGM A;  1QVF M;  4JKG A;  4IOX A;  1RDW X;  3DXM A;  2A5X A;  3BP8 A;  4WF9 L;  2GEM A;  1HPM A;  3SJH A;  2OTJ N;  4BRK A;  2P9P A;  3IKM A;  4C1N I;  4IOC L;  3A5L C;  3MX5 A;  3O08 A;  1JJ2 M;  4EAH D;  4MLE A;  2OAN A;  1RGI A;  4JKD A;  2VGN A;  2BUP A;  3FR0 A;  3ENH A;  4BRD A;  4WQ4 C;  5M1Q A;  3AAR A;  2HST A;  3FE1 A;  3Q7C A;  3IFR A;  5BPM A;  1VQM N;  3CCU N;  4KBO A;  4BR9 A;  2P9U B;  2A42 A;  1VQN N;  2Q97 A;  1BUP A;  5DM6 L;  1NJI O;  4FWN A;  2ZJR L;  4WQ4 A;  3H6E A;  2E1Z A;  4YDU C;  1S3X A;  4BG8 A;  1VQ8 N;  3H45 C;  5GAH P;  4WFA L;  4BY9 C;  5AQJ A;  4B1U B;  4BRF A;  1BWF O;  2V7Y A;  3MWT A;  2WC9 A;  4YDU A;  4B1Y B;  4XH1 A;  1MDU B;  5HL7 L;  1MA9 B;  3ZEU A;  2JWK A;  3CCR N;  4BGA A;  4YOW A;  4OPA A;  5AFU A;  5JIC A;  2WFB A;  3K9J A;  4XH4 A;  2YJF A;  3SBT A;  3I56 N;  3DXK A;  3LDO A;  3LM2 A;  5ELZ A;  3U8X A;  5JMV A;  2I7P A;  2D1K A;  3UKR A;  3WQT A;  1VQ4 N;  4WYB A;  3CPE A;  4H0O A;  3N4P A;  2NLX A;  2ITM A;  4C23 A;  5KPT A;  1YVN A;  1KAY A;  5ADX A;  1RFQ A;  4AM7 A;  3H3N O;  1QVG M;  5MLC Q;  4PKH A;  1NMD A;  1BA0 A;  2E2N A;  1KAZ A;  5B8H A;  1QZ6 A;  2GTD A;  4IFE A;  5C12 A;  5AQI A;  3KVG A;  1HKC A;  2FF3 B;  3E66 A;  4JKC A;  5H1S Q;  1NLV A;  1W97 L;  2HBJ A;  2P9L A;  2P9K B;  3WXM B;  2YHX A;  4AM6 A;  2NRV A;  1GLF O;  4H5V A;  4GY2 B;  5AQO A;  4M7Y A;  3WUH A;  3VGL A;  1VQK N;  3LL3 A;  2IVN A;  3MN6 A;  5AQT A;  4YOT A;  4PKG A;  1MWK A;  2CH5 A;  1KXP A;  4BRN A;  1BA1 A;  3O9U A;  5GIN A;  2NRX A;  2HBK A;  2GEL A;  4CBX A;  4PHT X;  1KC8 O;  1VQL N;  4IJN A;  3FGU A;  3G25 A;  3F5T A;  3R1X A;  4FWR A;  3D2E B;  2YHW A;  4H5N A;  4I6M B;  4MDA A;  2E20 A;  3IMX A;  4RCH A;  4ILH A;  3RSE B;  3CIP A;  5JLH A;  1GLD G;  4BRM A;  5F1X A;  3PIP L;  4FWO A;  1CZA N;  4NLC A;  1K8A O;  5KPZ A;  5AFU H;  3N4Q A;  1VAZ A;  1QQO A;  3SMS A;  2PAV A;  3EKU A;  4JK9 A;  5CR4 A;  2RHK A;  1SQK A;  2F9W A;  2E2O A;  4BR2 A;  3HOT A;  2F9T A;  3VTI A;  1OKJ A;  3VF4 A;  4NB4 A;  1P8Z A;  3QIC A;  5TKW A;  3O1B A;  3ZET A;  4CJ7 A;  3O80 A;  5AQS A;  3SMP A;  4XH5 A;  4DQ8 A;  4K43 A;  2KHO A;  2NZT A;  3AAQ A;  5AQX A;  5TKY A;  3SK3 A;  1M90 O;  3CJ1 A;  4ISG A;  4CZM A;  1DKG D;  1SZ2 A;  4KH6 A;  4NLB A;  3M1F A;  3CXC M;  3W0L A;  4OO1 J;  2QXL A;  3AGK A;  3CQY A;  3MN7 A;  4IJA A;  2V7Z A;  1ATR A;  5JVH L;  1KD1 O;  1NGH A;  2P9S B;  3C7N B;  3CCM N;  1X9J A;  3GE1 A;  4FPA A;  2VYP A;  1W2B M;  4YOR A;  5AR0 A;  5GAE P;  3GG4 A;  3FLC O;  3CD6 N;  3M3Z A;  1J6Z A;  4BRC A;  4IOA L;  4O5F A;  3KZB A;  2GX9 A;  1NBW A;  3ID8 A;  3CMA N;  3D2F A;  2QM1 A;  4A57 A;  1NGD A;  3BEX A;  1ATN A;  3EO3 A;  1U2V B;  5BN9 A;  4ILJ A;  3C65 A;  2WBN A;  1BO5 O;  2E2Q A;  1NWK A;  3KWG A;  3KHY A;  4A61 A;  3E9O A;  4BVP A;  3O9R A;  1N8R O;  5F2R A;  4CD1 A;  4U67 L;  1NGC A;  5JLF A;  5GIP A;  4JKH A;  3ZYY X;  3G4S N;  2D4W A;  3ULE B;  4YOX A;  4H5T A;  3A5M C;  2A41 A;  2Q0R A;  1Q86 O;  4CZI A;  3B8A X;  3WXJ A;  5AQP A;  3VEV A;  4B1X B;  3HRG A;  3CJA A;  4BRE A;  1C0F A;  3TPQ A;  1V4T A;  1ZBS A;  2CGK A;  2FSJ A;  4IDH A;  4JKA A;  4JKB A;  4RTF D;  2AA4 A;  4I6M A;  5C0Y A;  2IIR A;  3DWL A;  4JHD B;  5BRD A;  2QI2 A;  1NGB A;  1NGA A;  5EX5 A;  3VOV A;  4DCH A;  1VQO N;  3D6R A;  5BR9 A;  3VEX A;  1T3V A;  3E1Y A;  3CF5 L;  4CBU A;  3HBT A;  3QML A;  1T6D A;  4JNE A;  2QW9 A;  4EIA A;  3O9S A;  4H0V B;  2IVO A;  4ILG B;  4YOU A;  4BVO A;  4JEP A;  3LDL A;  4DHY A;  5AQH A;  5AQG A;  1QZ5 A;  2H3G X;  2HBL A;  3VEN A;  3ZX3 A;  3CC7 N;  4FWP A;  4PL8 A;  1BU6 O;  1NGJ A;  1SS6 A;  4BC2 A;  1YJN N;  1LOT B;  3P38 A;  4FO0 A;  4JD2 B;  4IO9 L;  4EHT A;  2F7T A;  3UE5 A;  2ZF5 O;  4JK8 A;  1X3M A;  3VES A;  5C10 A;  3P39 A;  5BRE A;  4BRQ A;  3OW2 M;  3CJC A;  1DEJ A;  3AAP A;  3H46 O;  3VET A;  4YOV A;  2P9N B;  4BRI A;  3LDN A;  5EOY A;  2ZGY A;  2HMP A;  4K42 A;  2FXU A;  1VQP N;  3KK7 A;  2QWN A;  3E9L A;  3VGK A;  2IVP A;  4BC3 A;  5AQN A;  3P4I A;  4FSV A;  3G71 N;  1DT9 A;  4DKW A;  3E9P A;  4LC9 B;  5AZI B;  2QWP A;  4BGB A;  2ASP A;  2QWM A;  3UKU A;  3NMU A;  5BPL A;  1YIT N;  3QFU A;  3O5B A;  4GV6 A;  4WFN L;  1TUY A;  1GLJ O;  1TYQ B;  4H03 B;  1ESV A;  5C2F A;  2HBM A;  4A5A A;  2QTD A;  4CD3 A;  4MO5 A;  3CCL N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...