4BRGA

Legionella pneumophila ntpdase1 crystal form ii (closed) in complex with mg gmppnp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
359
structure length
359
Chain Sequence
MDTNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 122
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brgA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brgA02
3HTVA 4BC4A 3QB0A 3EL2A 4A61A 3CERA 3IDHA 5LY3A 5AQSA 1GLFO 1KAZA 3C0BA 1WOQA 1NGEA 3S41A 4XH4A 1MWMA 3LDLA 1Z6RA 3D2EB 4WQ4C 2W40A 5FPNA 2Q0RA 4E1JA 4EHTA 3VOVA 1C0FA 1X9JA 5EVZA 4QS8A 4CJ7A 3D2FA 4FWMA 3LM2A 1NGAA 2PAVA 3GG4A 2DPNA 4DB3A 1NGDA 3H45C 2HF3A 4BVPA 4BRAA 4QS7A 3C7NB 3H1QA 2NZTA 3L6QA 5AZIB 4BGAA 2D0PA 2GWKA 4BQLA 4IZ9A 1GLAG 3WUHA 4Z94A 3ULEA 3FFKB 4B1WB 2GWJA 1ATRA 1T6DA 3BUZB 4MO4A 3O08A 3ENHA 3CQXA 3LL3A 4K42A 5F0XA 3SLCA 4BRQA 3M6GA 4JNEA 3VENA 5TKYA 3ZETB 2GUPA 4BRNA 1BUPA 2Q2RA 4BRGA 1TUYA 4RTFD 4BR7A 4BC5A 2QWPA 5E26A 4H5RA 3H46O 4BRHA 5F1XA 3CQYA 3GE1A 1GLCG 3L0QA 3UKRB 3DAWA 1JCGA 1GLEG 2ASOA 1BG3A 2QWMA 2E2PA 1QZ6A 3QICA 1TYQB 4XEIA 4B1XB 4B1VA 4O5FA 5BRFA 3AARA 3O6WA 4BG8A 1QQNA 5AQYA 5AQFA 2P9KA 3VEXA 4WQ4A 1JCFA 2A42A 3A5MC 3AAQA 1G99A 1MA9B 2P9UA 3FE1A 4I6MA 4C23A 5AZJB 1RFQA 3O1WA 3O80A 3A0IX 3VF4A 3CJ1A 2A5XA 5FPMA 2YHWA 3FR0A 3LDQA 4BRPA 1GLBG 4CBWA 4FL9A 2P9IA 4MLEA 3ZX2A 3FZLA 3U9ZA 1T44A 3WXIA 2P9NB 1WUAA 2CH6A 3MN7A 4KBOA 4BC2A 4IXCA 2UYTA 2H3GX 4WQ5A 1JCEA 3KZBA 3A8YA 1Z05A 3EKUA 1SAZA 1ZBSA 1RGIA 2V7YA 3D2EA 4L3QA 5CE3A 5AQPA 5KQ8A 2QM1A 3KHYA 3EKSA 3VETA 2FXUA 4PKHA 2YHYA 1NGHA 4O8KA 3QFPA 3ZX0A 4FPAA 1X3MA 4CBXA 5F2RA 2Q97A 3SJHA 3U4LA 4NO7A 3R8EA 2P9SB 4H5VA 4FOIA 5AQKA 3C7NA 5AZIA 4BRCA 3CETA 2A41A 3MN6A 5KQDA 3AAPA 2CGKA 2ASMA 2F9WA 1NMDA 1NWKA 2CGJA 3DWLA 2EWSA 2D0OA 2ZGZA 1K8KB 2V7ZA 1YUWA 4XH1A 2E2OA 3FZMA 1Q18A 4IJAA 4GNIA 1NGBA 4QS9A 2BTFA 4BRKA 4CD3A 3MCPA 1IG8A 4LC9B 3W3DA 5BN8A 1BO5O 5AQGA 3F9MA 4ISFA 3DXMB 3ZETA 2E88A 4H0VB 4CBUA 1KAXA 3I8BA 3BP8A 3ATVA 4CZLA 4FWSA 4F9OA 2ZGYA 5AQRA 4DQ8A 1KAYA 2E1ZA 3VF6A 2FSKA 5BRDA 4CZEA 2P9LB 3UKRA 2WUSA 4A2BA 5BPMA 1X3NA 5BPNA 4WQ5C 4B1UB 1R59O 3R9PA 3RSEB 4NB4A 3VF2A 4B1ZA 2AP1A 4RWTA 1TYQA 5JMVA 5AFUH 3LM9A 2YCHA 2P9PB 3DJCA 1LOTB 2D1KA 1MDUB 4BREA 3CJ9A 4M63C 5B8HA 3HSCA 2PBDA 2ZWHA 3UKUA 1NGFA 2A40A 3KVGA 2E1YA 1XQSC 4CD1A 2I7PA 2QWOA 4HWIA 1U2VB 5AZJA 3IUCA 4MO5A 1YXQA 4M7YA 4IWVA 3U8XA 4PL7A 4K41A 4RCHA 3WXKA 3WQTA 1DKGD 3LDNA 4FWNA 2ASPA 4JHDA 3GBTA 2QWLA 3GDQA 5AQNA 3VEVA 2QWRA 3SMSA 1HKCA 4CZMA 5AQOA 5AR0A 3QBWA 4FWLA 3VEWA 1BDGA 2I7NA 3EO3A 5FPEA 3FLCO 1DEJA 4BQZA 4CZJA 2CGLA 3VESA 4H5NA 3ZEUB 1BA0A 3HM8A 2QWNA 2GEMA 3VEOA 3CIPA 3BF1A 4PL8A 2E2NA 1C0GA 3B8AX 1HUXA 3IMXA 3OHRA 5AQUA 2E8AA 1J6ZA 4B9QA 3JS6A 2P9SA 1ZXOA 1YVNA 1GLDG 2VWBA 1OKJA 3O1BA 1E4FT 4Y0WA 3A5NC 5AQLA 3VEYA 5AFUA 5JLFA 1NGJA 1BA1A 2KHOA 3SK3A 3EZWA 4IO8A 4FOEA 2J4RA 3VGMA 1H1VA 4H0YB 2V51B 4BR9A 3MK6A 1K8KA 4H5WA 1LCUA 1Y64A 2AA4A 2E20A 2F9TA 1ATSA 3QMLA 2ITMA 2FSNA 2QWQA 4ISGA 2IVPA 3DXMA 3HBTA 5BR9A 2NRHA 2YHXA 3O8MA 1BOTO 5ADXH 3MDQA 2IVOA 3GOIA 3QDKA 1ZC6A 3J8AA 3BEXA 3FGUA 4BC3A 5KPRA 3H3OB 3HI0A 4FSVA 2P9KB 4HTLA 3RSEA 4BRDA 2HMPA 3WEEB 5BRHA 3WXJA 3I33A 4BR5A 5KPTA 4BR2A 5BREA 3W0LA 3MN9A 2FF6A 4H5TA 1QQOA 3A5LC 2Q31A 3WQUA 4M7XA 3GL1A 3DXKB 4J8FA 4CZKA 2P9IB 4JN4A 4K25A 1U2VA 4BRFA 1CZAN 3VGLA 1GLJO 4JD2B 5AQMA 1YAGA 1HKGA 5AQZA 3L4IA 3G25A 3QBXA 1KXPA 2GTDA 3H1VX 4FPBA 4GY2B 5EX5A 4DHYA 3LDPA 5BPLA 3FZKA 3ID8A 1HLUA 2CH5A 5AQXA 3R6MA 2YJEA 2QW9A 4BRMA 2Q1NA 1XC3A 5I9EB 2HF4A 2NLXA 4A2AA 2A6AA 3P4IA 5AQTA 3JXUA 4XH5A 5EY4A 3ZEUA 4H0TB 5LJVA 5ADXA 2V52B 1IJJA 3ZX3A 1HX1A 4CZIA 1ATNA 4H03B 4IJNA 3U9DA 1NM1A 3VPZA 5FPDA 5AQQA 4EHUA 4BRIA 3ATUA 4AM7A 4H0OA 3CJBA 2D4WA 2IIRA 2YI1A 1DGKN 5ELZA 3MN5A 3FZFA 4FWRA 5E84A 1HPMA 4FWOA 4H0PA 4PKIA 3BF3A 4CZGA 1QQMA 2P9NA 2QXLA 3AY9A 1EQYA 4JAXA 5AQJA 5AQHA 4YDUA 1MWKA 1XUPO 2FLOA 2W41A 3CJ7A 4BROA 3D2FB 3D7EO 2ZF5O 5KPZA 1GLLO 1V4TA 3CI5A 3ENOA 5JLHA 3M3ZA 1NGCA 3MMVA 2GELA 4EIAA 1NLVA 5EXWA 1QZ5A 5AQWA 3WXLA 3O4WA 3TU5A 5LJWA 1NBWA 3QFUA 3ULEB 4FWPA 3CJCA 3H3NO 1P8ZA 2VCPA 3VERA 3UE5A 4FO0A 4FWQA 5BN9A 3EN9A 3A5OC 3VEZA 3CJAA 2A3ZA 2VYPA 5EOYA 3UKUB 1BWFO 3O5BA 3WEEA 5AQVA 2IVNA 1E4GT 3TPQA 2BUPA 4BR4A 4FWKA 1SZ2A 3UB5A 1NGIA 4CZFA 1T6CA 1HJOA 3M1FA 1NGGA 4PKGA 2FSJA 2Q0UA 1RDWX 4JHDB 5AQIA 4EAHD 4MLHA 3DXKA 2YJFA 1ESVA 4BVOA 4EFHA 4B1YB 4A62A 2Q36A 3IFRA 1BU6O 1V4SA 4JD2A 4H0XB 2E2QA 4WYBA 3SMPA 4DCHA 1HKBA 3CHWA 4AM6A 2OANA 1S3XA 4CZHA 2P9LA 3H6EA 4ISEA 3LDOA 4YDUC 5JICA 1D4XA 4BR0A 1QHAA 2HOEA 1TUUA 3FZHA 1SQKA 1S22A 4CI6A 4BRLA 1U6ZA 3HZ6A 2P9UB 3VGKA 2P9PA 4BGBA 3WT0A 2FF3B 4I6MB 4K43A 4BG9A
chains in the Genus database with same CATH superfamily
3QB0A 3TR8A 4FVUA 2EX3A 4ZTJA 3A2FA 1C1CA 1WOQA 4I9LA 5J1EA 4M3WA 4DQPA 4E19A 5M1FA 1MWMA 5C42A 4FLUA 3LP1A 3D2EB 4CK2A 2HHTA 5FPNA 3BY5A 4DSJA 4ELVA 4E1JA 4EHTA 1IV0A 3VOVA 3ZT2A 4DUYK 3TTCA 1K73O 4LFCK 4QS8A 1CXUA 4C1NI 4DR6K 3LWMA 3TAGA 4LF6K 3H45C 4B3MK 3NAEA 3TAEA 4LFBK 3OYNA 4Z4EA 3EZ5A 3VA3A 3C7NB 2NZTA 4DSIA 4JKBA 4BQLA 1WSJA 3SQ4A 1GLAG 2X6SA 4Z94A 3L3VA 4CHNA 1EX4A 4E89A 4OLBA 3ZSOA 1UA1A 3O08A 4GVMA 3TI0A 2PFUA 4DWIA 3L4QA 1XC9A 5C10A 1Q8IA 4JNEA 1L3TA 3VENA 2O8EB 2UUBK 2Q2RA 5E41A 4JKGA 4BC5A 4NXNK 3F5TA 1M1KO 4CF8A 3H46O 4DS4A 4Q5VA 5JS2A 3PO5A 2QWMA 4KHYA 1HRHA 3OA9A 1TYQB 3IRXA 3JAMO 4B1VA 3RMDA 3C95A 5BRFA 2E6LA 3WNFA 1QQNA 5AQYA 2ZJQL 3LAKA 1ZBUA 2P9KA 2A42A 4B9MA 4LF4K 3A5MC 3AAQA 3CD6N 3KLFA 4X65K 4JYAK 1NKCA 1VAZA 2NRZA 2VQEK 5FPMA 4JI2K 3FR0A 1BQNA 1S72N 5HLFA 2VQFK 2JGUA 4JKCA 4KBOA 5LL6Z 4IXCA 1HYSA 1JCEA 2DTUA 4B9TA 5I42A 4FK4A 3EKUA 1ZBSA 2V7YA 3D2EA 5CE3A 3S3MA 3OS2A 3NF6A 4DQRA 1NJXA 3DOKA 2ITGA 2OTLN 3AGRA 3SJHA 4H5VA 3C7NA 4IBNA 4CFDA 5KQDA 3CYMA 2CGKA 3D6RA 5A2QO 1NKEA 4DV1K 3LDSA 2CGJA 3KLHA 5GAGP 2D0OA 2ZGZA 3VQ4A 3VQ5A 4C8LA 3LZIA 1NK0A 1YUWA 1VHXA 4XH1A 4NXMK 3RWUA 4DTXA 1WSHA 4GNIA 2D5RA 3O9QA 2KZMA 5BN8A 4DR7K 5AQGA 3F9MA 3VMFB 4AQYK 1I94K 3VQ8A 3I8BA 3G0ZA 3VQ7A 4W5RA 1RNHA 1WNSA 3HPOA 4KKOA 3VA0A 1ILYA 2E1ZA 2FSKA 2KQ2A 3KK3A 3OW2M 1X3NA 1XMOK 4WQ5C 4IG0A 4NB4A 4U67L 1MU2A 4B8CA 4KHWA 3NH0A 1TYQA 3QETA 4OPJA 2YCHA 1N33K 1W0HA 2HNZA 3LP3A 1MDUB 3CJ9A 4M63C 3TWHA 3N4PA 4OPKA 3NF8A 1JJ2M 1NGFA 4NCGA 3KVGA 4DFMA 1YI2N 3E9OA 3SQ1A 1XQSC 4NYNA 1JLEA 4M3ZA 1ZBLA 2RPIA 4IOXA 4AILC 1UOCA 3LDNA 4KREA 4YOXA 3T1HK 1TKDA 4CJFA 3VEVA 3HK2A 4CJEA 2KW4A 2A1SA 4DV3K 3K5LA 3MEGA 1BDGA 4H8KA 1DEJA 3PX6A 1KD1O 3QO9A 4CHOA 1OVYA 3VQCA 1Q9YA 4JI7K 2B5JA 3B8AX 4FK0A 3I0RA 3JS6A 1SL0A 5M1NA 1OKJA 5AFUA 3A5NC 1I3AA 1NGJA 3EZWA 4IO8A 2UUAK 2GBZA 2J4RA 4JI4K 2NRWA 3CPEA 2V51B 3UIQA 1LCUA 1BISA 1Y64A 4BDYA 3AVCA 2GUIA 5TKWA 2E20A 4E7LA 1N34K 1VQLN 4LH4A 3L2RA 1Q9XA 2QWQA 4JEPA 3ZT0A 1TGOA 1I39A 5ADXH 5BR9A 1BOTO 3QDKA 2KFZA 5HRNA 3J8AA 4YY3K 3BEXA 4BWJA 3FGUA 1NU0A 5KPRA 3M5RA 2YNFA 4DQIA 2XY8A 3RR7A 4EP5A 3WXJA 3C94A 2ETJA 3IG1A 1T03A 4DUZK 1X9MA 3CCVN 3V9UA 5BREA 5BR8K 4DTUA 2ZQBA 4CJTA 1B9FA 4M7XA 1VQ4N 4LF8K 5AJ3K 4K25A 2HW3A 1GLJO 4M3TA 5AQMA 4KHQA 1ZBHA 3L4IA 3SBTA 4GY2B 4DHYA 3LDPA 4OGEA 4CHPA 4IG3A 2ZJPL 2CH5A 3ZSZA 4BRMA 4FCYA 1XC3A 3ZYYX 2IS3A 2LSNA 2NLXA 2YKMA 2I5JA 4XH5A 2DFHA 3ZT4A 4H0TB 4CJ3A 1NNEA 1IJJA 3ZX3A 3M8RA 3E9PA 3MWTA 1E3MA 1RBRA 2YHBA 4CVNE 5FPDA 1VSIA 3SV4A 4E7HA 2B4JA 2D4WA 3CMEN 1RILA 3KWIA 5ELZA 3MN5A 1YVUA 3VQBA 1CZBA 4FWRA 3CXCM 1TKXA 1C0MA 4RW9A 4FWOA 4H0PA 4DQSA 4CZGA 1BL3A 3AA5X 3D45A 4CGIA 1RTHA 2W41A 3HRGA 3D7EO 3T69A 3CI5A 4HCCA 3ENOA 2OCEA 1RT7A 4CCHA 3MMVA 1RDBA 1KFSA 2GELA 2UXCK 5EXWA 3KD1E 5AQWA 2ZE2A 3O4WA 4DR3K 1TKZA 2OZSA 4MDBA 1DT9A 3CJCA 1P8ZA 3DLBA 1TAQA 2VCPA 3VERA 3UE5A 4FO0A 2G8UA 1WSIA 3VEZA 2OPQA 4X62K 1HR0K 2IGIA 3R3LA 4KTWA 1UA0A 4JRQA 3O5BA 4RW7A 3HP9A 2IVNA 4DLGA 4GVEA 4BR4A 3HSTB 3PSIA 3VTHA 4FJGA 2IOCA 1NGGA 4PKGA 4CHZA 3CQ8A 5FLXO 4Z4IA 4JHDB 2PZSA 5HBMA 2FBTA 3KJVA 3DOLA 3P1GA 4KRFA 1IBKK 5DMRA 4B9NA 1V4SA 4UY8O 4H0XB 2E2QA 1HKBA 3CHWA 3PIPL 4YOUA 5I3UA 1FK9A 2W42A 1ASWA 1SKRA 2P9LA 4C8MA 4JV5K 3H6EA 2E4LA 4YDUC 4FZZA 1W7AA 3AA4A 2HOEA 3CMAN 1BCOA 3S3OA 3U3YA 4CI6A 1QHTA 3P39A 4IFEA 3SV3A 2P9UB 3VGKA 3WNGA 4I6MB 1YITN 4FLTA 4BG9A 3OVNA 2VG6A 1RDCA 3SQ2A 3BGRA 1QQCA 4KB1A 1JLFA 3EL2A 4A61A 1KAZA 5J2QA 3OBWA 4DFJA 1EXQA 3C0BA 2G8VA 1Q81O 1BHLA 3J7AP 4XH4A 2KTQA 3LDLA 3V1QA 1QTMA 3THVA 2NRXA 4WQ4C 2W40A 4PHTX 4DMNA 1JL2A 3F9KA 2Q0RA 4I2PA 3I8DA 2RHKA 1C0FA 1X9JA 5EVZA 4AF1A 4FWMA 4CF1A 3LM2A 3ZSQA 4NYFA 1NGAA 1KVBA 4CGHA 3WNEA 1LWEA 1S1UA 1NGDA 3IAYA 3HYFA 4JKHA 3VQ9A 2NUBA 4QS7A 4FJNA 4M3UA 1SL1A 4CW7B 4WF9L 5AZIB 4CJKA 4WFBL 3K58A 4M42A 3OYDA 4BGAA 4W5NA 4E1NA 1NG9A 2VWKA 1EO1A 4B9VA 1BIUA 1ATRA 3BUZB 3KLIA 4LFAK 1QS4A 3ENHA 4KV8A 3MCAB 4BRQA 2PYLA 1C0UA 4CK1A 2HVHA 4X64K 1S1TA 4FJ9A 4CJSA 4F3OA 1BUPA 4BRGA 5GIOA 4RTFD 4AH9A 4JI5K 5E26A 4H5RA 4FJIA 2E6MA 3THWA 1RBVA 1D5AA 4BRHA 4F4KA 3GE1A 3BZKA 3ID6A 1GLEG 1B9DA 3THYB 2E2PA 1VRTA 1QZ6A 3KWGA 3DLHA 4H4OA 4B1XB 3OYKA 3AARA 3ALYA 2UUCK 3DYAA 4A5BA 2F7TA 4C8NA 5AQFA 3VEXA 4KHUA 4WQ4A 1NOZA 3HVRA 3BZCA 1MA9B 2P9UA 1NMNA 4I6MA 3AA2A 1JLGA 4K0KK 3O80A 3A0IX 4IEIA 3CFRA 4BRPA 1X9SA 3IKMA 4FL9A 2P9IA 4MLEA 1WUAA 3MN7A 4BC2A 2H3GX 3MWPA 2QI2A 1GOCA 4FJXA 2WONA 3SPYA 1IKXA 4ELTA 3CC7N 4FLZA 1RGIA 4L3QA 4W5TA 1VQPN 5KQ8A 4B3SK 3O4QA 1RCHA 3VETA 4OPHA 1U49A 1NGHA 3H08A 2Q97A 3L2VA 4NO7A 2P9SB 1WB9A 3NHGA 1T05A 1TL1A 4FYDA 5AZIA 2ASMA 1NMDA 4CEFA 4DU3A 1TAUA 2OA8A 4DKWA 4E3SA 4YFUA 4CJPA 1NGBA 1GOAA 2BTFA 4QOZB 1IG8A 1NJYA 1BO5O 4JI1K 3DXMB 4H0VB 4CBUA 2VGNA 3D0PA 2OTJN 3BP8A 3ATVA 4CZLA 4F9OA 2ZGYA 4Z4HA 1VRUA 4CFAA 4DQ8A 1KAYA 5BRDA 5FRMA 4ID5A 3MECA 5BPNA 2PY5A 1LW0A 2HNDA 3R9PA 2R7YA 1WSEA 1TKTA 4RWTA 2Z1JA 3SI6A 1XNQK 5AFUH 3LM9A 2P9PB 1LOTB 1WBBA 3AO2A 3UKUA 2HHSA 4DR4K 4HUGA 4CJ5A 1NOYA 3PSFA 2F4VK 4CD1A 3SAGA 3LP0A 1BQMA 1G15A 1YXQA 1DTQA 3DLGA 2QTDA 4RCHA 3WXKA 2D0BA 1DKGD 2FBXA 4U7BA 4J2DA 4N56A 4M45A 1TVRA 5CZ1A 4BACA 5AQNA 3VQEA 2F8TA 2QWRA 3SMSA 1HKCA 1M90O 4IFYA 4E7IA 3SAHA 4IFVA 4CE9A 5FPEA 4CZJA 2CGLA 3VESA 4DG1A 1BA0A 3AVBA 2XRIA 1QSYA 2GEMA 3CIPA 3BF1A 4N41A 4JI8K 4PL8A 2E2NA 3Q7CA 2D0AA 4JKDA 4B9QA 2O8FB 2P9SA 1LWCA 2HHVA 1GLDG 3OY9A 4TSXA 5AQLA 5JLFA 4ZHRA 1BA1A 3SK3A 3L2QA 1WSFA 4G1QA 3K5MA 2Q3SA 1H1VA 5IT9O 4HTUA 1ASUA 1JL1A 3MK6A 5C0YA 4H5WA 3CPWM 3ZSYA 1ATSA 3HT3A 3RRGA 4N5SA 2FSNA 1LV5A 3CCUN 3J7YP 1QVFM 3DXMA 3E9LA 4JS4A 3CCRN 3U6FA 4V19S 2NRHA 3O8MA 1FKPA 4NLCA 4X66K 3O3FA 5KGXA 3TSQA 3KKSA 4BE2A 3L8BA 3C6HA 1A5VA 1YJWN 1UAXA 3EE8A 1KLNA 3H3OB 3HI0A 5HRSA 2B6AA 4LY7A 3V81A 5BRHA 3WEEB 2O8DB 4CIEA 2F96A 3SPZA 3HJFA 4ICLA 2O8CB 5CZ2A 2YKNA 4R79A 3OYIA 2HMIA 4KHSA 2Q31A 3WQUA 2O8EA 4CJ4A 3GL1A 4OPAA 4J8FA 3PIOL 4CZKA 1XHXA 3CCMN 4DQQA 3SYZA 3J81O 3TSUA 2G8WA 1YJ9N 1KQSM 5AQZA 1WLJA 1KXPA 2GTDA 1XI1A 4FPBA 5BPLA 3ID8A 5AQXA 4WCEL 3R6MA 4W5OA 4JRPA 4DV5K 4BE1A 4IOAL 2Q1NA 1VSEA 4AHCA 1BCMA 3SAFA 1JXEA 2W6KA 3AVGA 4A2AA 3NF9A 4FLXA 4FW2A 1L3VA 2V52B 1T3VA 2P5OA 1HX1A 3O9UA 2P5GA 2QA4N 1U4BA 4H03B 3AVAA 3LANA 3U9DA 1NM1A 3VPZA 1S5JA 4GMJB 4EHUA 4M3XA 4WFNL 4DU1A 4OGCA 2X78A 5K14A 1DGKN 4JKAA 4O55A 4Q0BA 1ZYQA 3RR8A 2QXLA 3AY9A 1TK0A 5AQJA 1VSDA 1XUPO 1VK0A 3MEEA 5J2PA 1V4TA 3NMUA 3KLGA 1WBDA 3M3ZA 1SKSA 3VTIA 4CEAA 3T1YK 1NLVA 1EETA 3WNHA 2WOMA 1NK5A 1NJWA 3V1RA 3OYAA 1C1BA 1SUQA 3ULEB 3QESA 1A5WA 3H3NO 4OJRA 3AVKA 3QLHA 4FWQA 5FDLA 5BN9A 3PX4A 3SUQA 4DR1K 5LMNK 1J9AA 5EOYA 3WEEA 3TPQA 4Y1CA 3LPTA 1ZBFA 2BUPA 1TV6A 3LALA 1NGIA 1T6CA 3M1FA 1LAVA 2EHGA 3NF7A 3OYMA 2FSJA 1RDWX 4E7KA 2F8SA 1XMQK 5AQIA 3K5NA 2YJFA 4CHQA 1ESVA 4EFHA 4B1YB 5GAHP 4A62A 1TK8A 4CEBA 4G9ZA 3TARA 1VQON 3DRPA 4RG8A 3EEQA 1Q7YO 3DLRA 4AHUA 1W2BM 3G10A 3FZHA 1SQKA 5C2DA 4FM0A 2VG5A 3HZ6A 3AVIA 4K43A 1S1XA 2VWJA 3HTVA 2XY7A 4F3TA 3QNNA 4IOCL 1D9DA 5AQSA 4DR2K 1GLFO 2GX9A 5KI6A 1VSKA 3QEXA 4B3TK 4NCAA 3ZCMA 5SWMA 3S41A 5DK5A 1Z6RA 1Y97A 2FBYA 3TAMA 1EP4A 2DFFA 3EE9A 4HHTA 4HUFA 2YHAA 4DF8A 1RT2A 5JS1A 1IG9A 4MDAA 4DSEA 3GG4A 1HYZA 2HF3A 3SJJA 4UQGA 4BRAA 3MXIA 2QXFA 3K9KA 3H1QA 2D0PA 4JK7A 3DLKA 1D8YA 3WUHA 2Z1HA 2QK9A 3MX2A 3ULEA 4FJ7A 3FFKB 3CFPA 1J53A 3CQXA 4JK8A 3V6DA 1TL3A 5F0XA 1REVA 3M6GA 4CJRA 5M1OA 4ID1A 5TKYA 3ZETB 2GUPA 1NK9A 4BRNA 4BR7A 1VSLA 2E5LK 4W5QA 4WE1A 2G8FA 1RBUA 4O0IA 1RTJA 4DTJA 1KFDA 1CXQA 3CQYA 1Z25A 3UKRB 1JCGA 2ASOA 4J2BA 4JI0K 1BG3A 1KTQA 4JLHA 3K0SA 4JI6K 3P31A 4DV2K 4KTZA 4XEIA 2JLEA 4DV4K 4KB0A 4GV6A 3AO4A 3O6WA 4BG8A 1KVAA 2QEXN 4FJ8A 4C8KA 1JCFA 2Y1JA 2HHHK 1G99A 5C12A 4GV9A 3C65A 3KK1A 1SKWA 1RFQA 5CY4A 2ZM6K 2A5XA 2VGMA 1VQKN 4CBWA 3LDQA 1GLBG 4CGGA 3ZX2A 1NKBA 2VG7A 3FZLA 3U9ZA 3OYHA 3MEDA 1T44A 3WXIA 2P9NB 2RF2A 1WAJA 3I55N 1B92A 1W9HA 1K8AO 2OPPA 5HRRA 1Z05A 4DF4A 1NJZA 3QIOA 3TABA 1YF5L 4JKEA 4JI3K 3EKSA 1U45A 2FXUA 1BI4B 4LSLA 4PKHA 4O8KA 1JLBA 1X3MA 2P51A 3ULDA 3RRHA 3THXB 3U4LA 4HVJA 3MAQA 4YOTA 4BRCA 1BIZA 2A41A 3OS1A 2WTUA 5HP1A 2G8KA 2IAJA 3NCIA 4J2EA 2NRTA 1YIJN 3EY1A 4IJAA 3NGIA 3PUFA 1EWQA 4BRKA 3O4NA 3MCPA 4CD3A 4LC9B 3W3DA 4AHSA 2DFEA 3O9RA 1JLQA 4ISFA 2AJQA 3ZETA 4M3RA 4DV0K 3M8QA 3IS9A 4FJHA 4FWSA 5JVGL 1S1VA 4KTQA 2Y1IA 5M1KA 4CZEA 3UKRA 4A2BA 2WUSA 5BPMA 3QEVA 1K9MO 3RTVA 1C6VA 3RSEB 3VF2A 4IDKA 1TK5A 1CZ9A 2AP1A 2XY6A 1HMVA 2D1KA 2JWKA 5D3GA 1NK7A 3CFOA 5GAEP 4Z4FA 1XNRK 4LSNA 3OJUA 4E7JA 2E1YA 1QSSA 2QWOA 5HRPA 4JS5A 1U2VB 3IUCA 1VSJA 3PY8A 5GIPA 3U8XA 1WN7A 4K41A 3NGZA 4FWNA 2BE2A 2A1RA 1VQ6N 2ASPA 4FM2A 5MLCQ 2BDPA 4JHDA 3GBTA 2WFBA 3GDQA 4DTOA 1OH5A 4CZMA 5AQOA 4FZYA 5AR0A 3QBWA 1OH6A 3EO3A 3FLCO 4CGFA 2Z1IA 4H5NA 3OYEA 4B9LA 2OPRA 3VEOA 1BI4A 5C24A 2RKIA 3AVMA 1O13A 4CK3A 3ITHA 3O9SA 1VQ9N 1HQUA 4NLBA 1C0GA 1HUXA 3KLEA 3C6AA 2O4GA 2E8AA 1J6ZA 3THXA 1IBLK 4DV6K 3DRRA 1YVNA 1E4FT 1P90A 2NRVA 2KHOA 3VGMA 2HBKA 3CCLN 2FBVA 1NK6A 3QINA 2XY5A 3AA3A 4PUOA 1YHQN 2AA4A 3VQPA 1WSGA 4JKGB 2ITMA 1FJGK 4N76A 2IVPA 5HL7L 3QEPA 3MDQA 4CECA 1Q82O 2ZJRL 3GOIA 1ZC6A 1RT4A 2BANA 3K2PA 4M3YA 3OBYA 4FSVA 4OLAA 2P9KB 4HTLA 3RSEA 4BRDA 2HMPA 4LH5A 4BR5A 5KPTA 4GV3A 1IKYA 3BDPA 1VQ8N 1U48A 4YORA 3W0LA 3MN9A 2ZD1A 3P5JA 2FF6A 4H5TA 1QQOA 1L5UA 3TANA 3NVMA 4ILHA 3DXKB 1U2VA 1CZAN 1YT3A 3G71N 1YAGA 4QAGA 4B3OA 3T3FA 5C25A 4DTNA 3H1VX 5EX5A 2JWLA 3DM2A 3HOTA 4LF7K 1HLUA 1WAFA 3CF5L 4FJJA 4O5BA 4FLYA 4FW1A 3THYA 4ILGB 4CESA 3R1XA 1EKEA 4DSKA 4BY9C 1JLCA 3FFIA 3NDKA 4DTMA 2P1JA 1S6QA 3CCSN 3PV8A 3RVCA 2QKBA 1XWLA 2DY4A 1ATNA 4IJNA 3LP2A 5AQQA 3ATUA 3KIOA 3OYBA 4KFBA 3OYJA 4H0OA 3OS0A 3NE6A 3FZFA 4A57A 4GKKK 1HPMA 4PKIA 3LAMA 1IKVA 3BF3A 1QQMA 2X74A 3HOSA 4PY5A 1MWKA 2FLOA 3CJ7A 4FM1A 4YNQA 3D2FB 2ZF5O 5KPZA 4Y1DA 4KH4A 3OYFA 1N32K 5JLHA 1CLQA 3G6EN 2HHUA 1UWBA 3LPUA 4OKKA 4CF0A 3TU5A 3RMBA 5LJWA 1NBWA 3QFUA 4CGJA 1OH8A 5H1SQ 3CJAA 2KKZA 2VYPA 5KTQA 2HVIA 4DU4A 4BDPA 4RW8A 4CZFA 3VN5A 1Z26A 1JKHA 3ZSVA 3OYLA 4DTSA 1DLOA 4CJUA 5KRTA 1NK4A 4MLHA 3DXKA 1QVGM 4OX9K 2YNGA 4BVOA 3L3UA 5EU7A 2Q36A 4O4GA 3IFRA 1BU6O 4WYBA 3SMPA 5DM7L 4AM6A 3I0SA 4DFKA 2OANA 3O3GA 2O8BB 1VQ7N 3ISNC 3AVLA 4CZHA 4HUEA 3HM9A 5JICA 4BR0A 1QHAA 4CF2A 1TUUA 2HBMA 4MQ3A 4CFBA 2P9PA 4BGBA 2OZMA 4CF9A 5GADP 4BC4A 3RMCA 1T7PA 3CERA 3IDHA 4CEOA 5LY3A 4YOVA 3S3NA 4KAZA 4IDHA 3VQQA 4GKJK 3C6UA 1NGEA 4I9QA 1S1WA 1HNIA 2YV0X 3J7ZO 4K8XA 3DRSA 3CCEN 3AVNA 1JLAA 2OYQA 1FKOA 3QIPA 3HVTA 4CJ7A 3D2FA 1N36K 2PAVA 3AVJA 3NBPA 2DPNA 4DB3A 2UXBK 4LF9K 4BVPA 1RBTA 1RT1A 3QNOA 1GOBA 3SUPA 3L6QA 3K5OA 2GWKA 4IZ9A 3HL8A 1L3SA 2QKKA 3ZSRA 4YOWA 2O8FA 4B1WB 2GWJA 2KFNA 4KHPK 1T6DA 4FLWA 4KHNA 1O1WA 3TTFA 1FW6A 2YNIA 4MO4A 3LL3A 4K42A 3E66A 4LD0A 3SLCA 3JSMA 3AO3A 1RT3A 3B6PA 1ZBIA 5J2MA 4M41A 4DLEA 1IKWA 2RE2A 2HNYA 1TUYA 2QWPA 3SNNA 4FJ5A 3U3GA 4QCLA 4KO0A 5F1XA 4CJVA 1GLCG 3L0QA 3DAWA 3RMAA 1HNVA 3KK7A 4A5AA 1VSHA 2RN2A 4DTPA 3T19A 3QICA 2GV9A 3QERA 2O8BA 4PQUA 3VQAA 4O5FA 4DTRA 2O4IA 5CYMA 1HJRA 4Z4CA 1OH7A 1N6QA 3F73A 1ASVA 3CC4N 3G4SN 3V9XA 5C2FA 2O8DA 4O44A 2KLAA 3CC2N 5SZTA 1EWRA 3NFAA 1T8EA 3CM5A 3FE1A 4C23A 1HNXK 5AZJB 5J2NA 2O8CA 3O1WA 1VQMN 3VF4A 2UXDK 3E1YA 3OJSA 2XHBA 3CJ1A 2UU9K 2YHWA 3AV9A 4N47A 3MXMA 2OPSA 2CH6A 3ZT3A 3NH2A 2UYTA 1KCFA 3ASMA 1QSLA 2ATQA 4WQ5A 5M1QA 3KZBA 3A8YA 1SAZA 4JK9A 4I2QA 5AQPA 3V9WA 5HOOA 3OYCA 2QM1A 3KHYA 4PWDA 4B3RK 3AVFA 2YHYA 4AHRA 4B08A 3NGYA 2X6NA 3QFPA 3ZX0A 4HCBA 4Z0UA 4FPAA 3DLLL 4CBXA 5F2RA 4H4MA 3R8EA 3TTDA 4FOIA 5AQKA 3K57A 3CCJN 4FJMA 3CETA 3Q7BA 3MN6A 3AAPA 3QEWA 1C1AA 2F9WA 2IC3A 4RW6A 1YTUA 5T7BA 1NWKA 4CEZA 1RTDA 3DWLA 2EWSA 2HHXA 2WC9A 1K8KB 1RTIA 4OKEA 2V7ZA 1DTTA 4IKFA 2E2OA 1VSFA 3FZMA 1Q18A 1VQNN 1BGXT 2HHQA 4QS9A 1RDUA 4CIGA 4F8RA 4B8AB 3QEIA 4KI6A 3LZJA 2E88A 4AHVA 4EP4A 3NH1A 3C6TA 1K6YA 1KAXA 3LWLA 3E01A 5HROA 3B6OA 4L8RB 2YX6A 3N4QA 1J5OA 5AQRA 1HNWK 3VF6A 1IO2A 4KPYA 3VQ6A 4NCBA 2P9LB 5JVHL 2HBJA 4B1UB 1R59O 4ILJA 4B1ZA 1VQ5N 1SL2A 4CIFA 5JMVA 1SS6A 3DJCA 4CJLA 4OVLA 3ENBA 4BREA 5B8HA 3HSCA 2PBDA 2ZWHA 3CG7A 1YJNN 3DI6A 2A40A 4MFBA 2BH1A 2I7PA 4HWIA 5FRNA 5AZJA 4MO5A 4M7YA 4IWVA 4IEEA 4PL7A 3I56N 3WQTA 4CEDA 2D0CA 3AGKA 3AO1A 2QWLA 3T7ZA 4CEEA 1D9FA 4FJKA 1RBSA 4FWLA 3VEWA 2I7NA 1J5EK 1IH7A 2KZZA 4BQZA 3ZEUB 4CEQA 3MXJA 1X9WA 3HM8A 2QWNA 1S6PA 3TSPA 3VQDA 3WXMB 1IBMK 1LW2A 3HXMA 3EYZA 4E1MA 5CHIA 4DSLA 4R5PA 3M8SA 4CJQA 2HB5A 3S9HA 3IMXA 3OHRA 4CJWA 5AQUA 5IWAK 1N5YA 1LWFA 1ZXOA 4F2RA 2VWBA 1RDAA 3O1BA 4Y0WA 3VEYA 4FLVA 4YHHK 3HPHA 4FOEA 1ITGA 3L2UA 4H0YB 4PA1A 3PO4A 1HYVA 4BR9A 3O9TA 3M8PA 3PLAA 1JXBA 1K8KA 3PX0A 1R0AA 1XHZA 5KRSA 1X1PA 1F21A 4Z4GA 4I7FA 2F9TA 3QMLA 3SUNA 4B9SA 3ZSXA 3P38A 4E0DA 3CCQN 2Z1GA 2WBNA 3THWB 4KI4A 4ISGA 4CFCA 3DMJA 4ELUA 4BWMA 3HBTA 5CR4A 5CYQA 3SBGA 2YHXA 2IVOA 4RW4A 3OTOK 2XO7A 5KGWA 4BC3A 3V9ZA 3JYTA 4XIUA 1U04A 3I33A 2HSTA 1HNZK 1LAWA 4BR2A 3K59A 3V9SA 4FJLA 4CHYA 3A5LC 3O3HA 4IO9L 4EZ9A 2P9IB 4JN4A 3V4IA 3AVHA 3ZSWA 4BRFA 4DFPA 3VGLA 3V1OA 4JD2B 4LF5K 1HKGA 3G25A 1RDDA 3QBXA 4CGDA 1RT6A 4BE0A 1FXXA 1HQEA 1QE1A 3AO5A 5LMUK 3ZLJA 1L3UA 3FZKA 3KD5E 2YJEA 2QW9A 1N8RO 3L2WA 5I9EB 2HF4A 4KH6A 3J80O 2A6AA 3P4IA 5AQTA 3JXUA 1RT5A 1SV5A 5EY4A 3ZEUA 5LJVA 5ADXA 1HPZA 4CERA 4CZIA 2BGGA 1Q86O 4BRIA 4AM7A 3TAFA 1S9GA 3KTQA 3CJBA 2IIRA 1W97L 2FC0A 2YI1A 3ZT1A 1NJIO 5E84A 3SUOA 4BDZA 1KC8O 2P9NA 3HO1A 2HHWA 2G8HA 2G8IA 1EQYA 4JAXA 4WFAL 5AQHA 4YDUA 4FZXC 3SZ2A 4BROA 1KVCA 1KLMA 1GLLO 3F2KA 4DS5A 4EZ6A 4FK2A 4DSFA 1NGCA 4YOYA 3OYGA 4EIAA 2IDOA 4OO1J 1QZ5A 4KH5A 4F2SA 3WXLA 4ZTFA 5GINA 1OVQA 3HPGA 3TAPA 3DLEA 3KKRA 3P83D 4FWPA 4DV7K 4K8ZA 4GW6A 3EN9A 3A5OC 4A59A 3KK2A 4J2AA 2A3ZA 4O8UA 1KRPA 3UKUB 1BWFO 3T1AA 5AQVA 1E4GT 4C8OA 3K9JA 1C0TA 3SCXA 1VSMA 4FWKA 1SZ2A 5FROA 3UB5A 1HJOA 2PYJA 1KSPA 5C15A 4O0JA 1A5XA 2Q0UA 1J54A 1YTAA 4EAHD 4FVMA 1NK8A 3TAQA 2NRRA 1U47A 4DCHA 3CM6A 4JD2A 5M1PA 1S3XA 3HP6A 3NVKA 4FXDA 4ISEA 3LDOA 1D4XA 1S9EA 4AHTA 4DR5K 2W6LA 2HBLA 3MX5A 3SQ0A 4JKFA 1S22A 2YNHA 4BRLA 1U6ZA 4OKJA 3WT0A 2FF3B 2NNWA 4B9UA 5DM6L 4C1NK
chains in the Genus database with same CATH topology
3HTVA 4BC4A 3QB0A 3EL2A 4A61A 3CERA 3IDHA 4IOCL 5LY3A 5AQSA 4YOVA 4FVUA 1GLFO 1KAZA 2GX9A 3OBWA 3C0BA 1WOQA 4IDHA 1Q81O 1NGEA 3S41A 4XH4A 3J7ZO 5M1FA 1MWMA 3LDLA 1Z6RA 2NRXA 3D2EB 4WQ4C 2W40A 3CCEN 3EE9A 5FPNA 4PHTX 2Q0RA 4E1JA 4EHTA 3VOVA 2RHKA 1C0FA 1X9JA 5EVZA 4AF1A 3TTCA 1K73O 4QS8A 4CJ7A 3D2FA 4FWMA 3LM2A 4C1NI 1NGAA 4MDAA 2PAVA 3GG4A 2DPNA 4DB3A 1NGDA 3H45C 2HF3A 4BVPA 4JKHA 4BRAA 4QS7A 3K9KA 3C7NB 3H1QA 4WF9L 2NZTA 3L6QA 5AZIB 4WFBL 4JKBA 4BGAA 2D0PA 2GWKA 4JK7A 4BQLA 4IZ9A 1GLAG 3WUHA 4Z94A 4YOWA 3MX2A 3ULEA 3FFKB 4B1WB 1EO1A 2GWJA 1ATRA 1T6DA 3TTFA 3BUZB 4MO4A 3O08A 3ENHA 3CQXA 3LL3A 4JK8A 4K42A 2PFUA 3E66A 3MCAB 5F0XA 3SLCA 4BRQA 3M6GA 3L4QA 5M1OA 5C10A 4JNEA 3VENA 5TKYA 3ZETB 2GUPA 4BRNA 1BUPA 2Q2RA 4BRGA 2RE2A 5GIOA 1TUYA 4RTFD 4BR7A 4JKGA 4BC5A 3F5TA 1M1KO 2QWPA 5E26A 4H5RA 3H46O 4BRHA 5F1XA 3CQYA 3GE1A 1GLCG 3L0QA 3UKRB 3DAWA 1JCGA 1GLEG 2ASOA 3ID6A 3KK7A 1BG3A 2QWMA 2E2PA 4A5AA 1QZ6A 3KWGA 3P31A 3QICA 3OA9A 1TYQB 4XEIA 4B1XB 4B1VA 4O5FA 5BRFA 4GV6A 3AARA 3O6WA 4BG8A 1QQNA 5AQYA 2QEXN 4A5BA 2F7TA 2ZJQL 5AQFA 2P9KA 3VEXA 4WQ4A 1JCFA 3G4SN 3CC4N 5C2FA 2A42A 2KLAA 3A5MC 3AAQA 3CD6N 1G99A 1MA9B 2P9UA 3CC2N 5C12A 3FE1A 4I6MA 4C23A 1VAZA 4GV9A 5AZJB 3C65A 1RFQA 3O1WA 1VQMN 2NRZA 3O80A 3A0IX 3VF4A 4IEIA 3E1YA 3CJ1A 2A5XA 2VGMA 1VQKN 5FPMA 2YHWA 3FR0A 3LDQA 4BRPA 1GLBG 3IKMA 4CBWA 4FL9A 2P9IA 4MLEA 3ZX2A 3FZLA 3U9ZA 1S72N 1T44A 3WXIA 2P9NB 1WUAA 2CH6A 3MN7A 4JKCA 4KBOA 4BC2A 4IXCA 2UYTA 2H3GX 3I55N 3MWPA 2QI2A 4WQ5A 5M1QA 1JCEA 3KZBA 3A8YA 1K8AO 1Z05A 3EKUA 3CC7N 1SAZA 1ZBSA 1RGIA 2V7YA 3D2EA 1YF5L 4JK9A 4L3QA 5CE3A 5AQPA 5HOOA 1VQPN 4JKEA 2QM1A 3KHYA 5KQ8A 3EKSA 3VETA 4OPHA 2FXUA 4PKHA 2YHYA 1NGHA 4O8KA 3QFPA 3ZX0A 2OTLN 4FPAA 1X3MA 3DLLL 4CBXA 5F2RA 2Q97A 3AGRA 3SJHA 3U4LA 4NO7A 3R8EA 2P9SB 4H5VA 3TTDA 4FOIA 5AQKA 3C7NA 4YOTA 3CCJN 5AZIA 4BRCA 3CETA 3Q7BA 2A41A 3MN6A 5KQDA 3AAPA 2CGKA 2ASMA 3D6RA 2F9WA 1NMDA 1NWKA 2CGJA 5GAGP 3DWLA 2EWSA 2D0OA 2ZGZA 2NRTA 2WC9A 1K8KB 2V7ZA 1YUWA 4XH1A 4DKWA 2E2OA 1YIJN 3FZMA 1Q18A 1VQNN 4IJAA 4GNIA 1NGBA 4QS9A 1RDUA 2BTFA 4BRKA 3O9QA 3MCPA 1IG8A 4CD3A 4LC9B 3W3DA 5BN8A 1BO5O 5AQGA 3F9MA 3VMFB 3O9RA 4ISFA 3DXMB 3ZETA 4UY8O 2E88A 4H0VB 4CBUA 2VGNA 1KAXA 3I8BA 2OTJN 3BP8A 3ATVA 4CZLA 4FWSA 4F9OA 2YX6A 3N4QA 5JVGL 2ZGYA 1ILYA 5AQRA 4DQ8A 1KAYA 2E1ZA 3VF6A 2FSKA 5BRDA 5M1KA 4CZEA 2P9LB 3UKRA 2WUSA 4A2BA 5BPMA 5JVHL 3OW2M 1X3NA 2HBJA 4WQ5C 5BPNA 4B1UB 1K9MO 1R59O 3R9PA 3RSEB 4NB4A 3VF2A 4U67L 4ILJA 4B1ZA 2AP1A 1VQ5N 4RWTA 1TYQA 5JMVA 5AFUH 3LM9A 1SS6A 2YCHA 2P9PB 3DJCA 1LOTB 2D1KA 2JWKA 1MDUB 3ENBA 3CJ9A 4M63C 4BREA 5B8HA 3N4PA 3HSCA 2PBDA 2ZWHA 3UKUA 1JJ2M 1YJNN 1NGFA 5GAEP 2A40A 3KVGA 2E1YA 1YI2N 3E9OA 2BH1A 1XQSC 4CD1A 2I7PA 2QWOA 4HWIA 3SAGA 1U2VB 5AZJA 3IUCA 4MO5A 1YXQA 4M7YA 4IWVA 4IEEA 3U8XA 2QTDA 4K41A 4IOXA 4RCHA 3WQTA 1DKGD 3WXKA 3LDNA 4FWNA 4U7BA 3I56N 1VQ6N 2ASPA 4YOXA 5MLCQ 4JHDA 3GBTA 3AGKA 2QWLA 2WFBA 3GDQA 5AQNA 3VEVA 2QWRA 3SMSA 3T7ZA 1HKCA 4CZMA 5AQOA 1M90O 5AR0A 3QBWA 4FWLA 3SAHA 3VEWA 1BDGA 2I7NA 3EO3A 5FPEA 3FLCO 1DEJA 4BQZA 4CZJA 2CGLA 3VESA 1KD1O 4H5NA 3ZEUB 1BA0A 3HM8A 2QWNA 3TSPA 2GEMA 3VEOA 3WXMB 3CIPA 3BF1A 1OVYA 5CHIA 4PL8A 1O13A 2E2NA 3O9SA 1VQ9N 3Q7CA 4NLBA 1C0GA 3B8AX 1HUXA 3IMXA 3C6AA 3OHRA 4JKDA 5AQUA 2E8AA 1J6ZA 4B9QA 3JS6A 2P9SA 1ZXOA 5M1NA 1YVNA 1GLDG 2VWBA 1OKJA 3O1BA 1E4FT 4Y0WA 3A5NC 5AQLA 3VEYA 5AFUA 1P90A 1NGJA 2NRVA 1BA1A 5JLFA 2KHOA 3SK3A 3EZWA 4IO8A 4FOEA 2J4RA 3VGMA 2HBKA 3CCLN 1H1VA 4H0YB 2NRWA 3CPEA 2V51B 4BR9A 3O9TA 3PLAA 3MK6A 5C0YA 1K8KA 4H5WA 1LCUA 1Y64A 5TKWA 3CPWM 2AA4A 1YHQN 2E20A 2F9TA 4JKGB 1ATSA 3QMLA 2ITMA 2FSNA 1VQLN 3P38A 3CCQN 3CCUN 2WBNA 2QWQA 4ISGA 2IVPA 1QVFM 3DXMA 3E9LA 3HBTA 5CR4A 4JEPA 5HL7L 3CCRN 3SBGA 5BR9A 2NRHA 2YHXA 3O8MA 1BOTO 5ADXH 3MDQA 4NLCA 1Q82O 2ZJRL 2IVOA 3GOIA 3QDKA 1ZC6A 3J8AA 3TSQA 3BEXA 3C6HA 3FGUA 1YJWN 3EE8A 4BC3A 5KPRA 3H3OB 3HI0A 3OBYA 3M5RA 4FSVA 2P9KB 4HTLA 3RSEA 4BRDA 2HMPA 3WEEB 5BRHA 3WXJA 3I33A 2HSTA 4BR5A 5KPTA 4GV3A 4G9ZA 4BR2A 3CCVN 5BREA 1VQ8N 4YORA 3W0LA 3MN9A 2FF6A 4H5TA 4R79A 1QQOA 5GIPA 3A5LC 2Q31A 3WQUA 3NVMA 4M7XA 4IO9L 4ILHA 1VQ4N 3GL1A 4OPAA 3DXKB 4J8FA 4CZKA 2P9IB 4JN4A 3PIOL 3CCMN 4K25A 1U2VA 4BRFA 1CZAN 3VGLA 1GLJO 3TSUA 4JD2B 3G71N 5AQMA 1YJ9N 1YAGA 1KQSM 1HKGA 5AQZA 3L4IA 3G25A 3QBXA 1KXPA 3SBTA 2GTDA 3H1VX 4FPBA 4GY2B 2JWLA 5EX5A 3LDPA 4DHYA 5BPLA 3HOTA 3FZKA 3ID8A 1HLUA 2CH5A 5AQXA 3R6MA 2YJEA 4WCEL 2ZJPL 3CF5L 2QW9A 1N8RO 4BRMA 4IOAL 2Q1NA 1XC3A 4ILGB 3ZYYX 3R1XA 5I9EB 3SAFA 2HF4A 2NLXA 4KH6A 4A2AA 2A6AA 3P4IA 5AQTA 3JXUA 4BY9C 4XH5A 5EY4A 3ZEUA 4H0TB 5LJVA 5ADXA 2V52B 3CCSN 1T3VA 1IJJA 3ZX3A 1HX1A 3O9UA 3RVCA 3E9PA 4CZIA 3MWTA 2QA4N 1ATNA 4H03B 4IJNA 3U9DA 1Q86O 1NM1A 3VPZA 5FPDA 5AQQA 4EHUA 4BRIA 4WFNL 3ATUA 4AM7A 4H0OA 3CJBA 2D4WA 1W97L 2IIRA 3CMEN 2YI1A 1DGKN 3KWIA 4JKAA 3MN5A 5ELZA 3FZFA 1NJIO 4A57A 4FWRA 5E84A 3CXCM 1HPMA 4FWOA 4H0PA 4PKIA 1KC8O 3BF3A 4CZGA 1QQMA 2P9NA 2QXLA 3AY9A 3HOSA 1EQYA 4JAXA 5AQJA 5AQHA 4YDUA 4WFAL 1MWKA 1XUPO 2FLOA 2W41A 3CJ7A 4BROA 3HRGA 3D2FB 3D7EO 2ZF5O 5KPZA 1GLLO 1V4TA 3CI5A 3F2KA 4KH4A 3T69A 3ENOA 5JLHA 3NMUA 3M3ZA 1NGCA 3MMVA 4YOYA 3G6EN 3VTIA 2GELA 4EIAA 1NLVA 5EXWA 4OO1J 1QZ5A 4KH5A 5AQWA 3WXLA 3O4WA 3TU5A 5LJWA 5GINA 1NBWA 3QFUA 4MDBA 4FWPA 1DT9A 3CJCA 3H3NO 3ULEB 1P8ZA 2VCPA 3VERA 3UE5A 4FO0A 4FWQA 5BN9A 5H1SQ 3EN9A 3A5OC 4A59A 3VEZA 3CJAA 2A3ZA 2KKZA 4O8UA 3R3LA 2VYPA 5EOYA 3UKUB 1BWFO 3O5BA 3WEEA 5AQVA 2IVNA 1E4GT 3TPQA 3K9JA 2BUPA 4GVEA 4BR4A 4FWKA 1SZ2A 3UB5A 1NGIA 4CZFA 1T6CA 3VTHA 1HJOA 3M1FA 1NGGA 5C15A 4PKGA 2FSJA 2Q0UA 1RDWX 4JHDB 5AQIA 4EAHD 4MLHA 3DXKA 1QVGM 2YJFA 1ESVA 4BVOA 4EFHA 4B1YB 5GAHP 4A62A 2Q36A 2NRRA 3IFRA 1BU6O 1V4SA 4JD2A 4H0XB 2E2QA 4WYBA 5M1PA 3SMPA 1HKBA 3CHWA 4DCHA 5DM7L 4AM6A 3PIPL 2OANA 1VQON 1S3XA 4YOUA 3NVKA 1VQ7N 4CZHA 1Q7YO 2P9LA 3H6EA 4ISEA 3LDOA 4YDUC 5JICA 1D4XA 4BR0A 1W2BM 1QHAA 2HOEA 1TUUA 4PL7A 3CMAN 2HBLA 3FZHA 1SQKA 3MX5A 5C2DA 2HBMA 1S22A 4JKFA 3P39A 1U6ZA 4IFEA 3HZ6A 4BRLA 2P9UB 4CI6A 3VGKA 2P9PA 4BGBA 3WT0A 2FF3B 4I6MB 1YITN 2NNWA 4K43A 5DM6L 5GADP 4BG9A 4C1NK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HTV A;  4BC4 A;  3QB0 A;  3EL2 A;  4A61 A;  3CER A;  3IDH A;  5LY3 A;  5AQS A;  1GLF O;  1KAZ A;  3C0B A;  1WOQ A;  1NGE A;  3S41 A;  4XH4 A;  1MWM A;  3LDL A;  1Z6R A;  3D2E B;  4WQ4 C;  2W40 A;  5FPN A;  2Q0R A;  4E1J A;  4EHT A;  3VOV A;  1C0F A;  1X9J A;  5EVZ A;  4QS8 A;  4CJ7 A;  3D2F A;  4FWM A;  3LM2 A;  1NGA A;  2PAV A;  3GG4 A;  2DPN A;  4DB3 A;  1NGD A;  3H45 C;  2HF3 A;  4BVP A;  4BRA A;  4QS7 A;  3C7N B;  3H1Q A;  2NZT A;  3L6Q A;  5AZI B;  4BGA A;  2D0P A;  2GWK A;  4BQL A;  4IZ9 A;  1GLA G;  3WUH A;  4Z94 A;  3ULE A;  3FFK B;  4B1W B;  2GWJ A;  1ATR A;  1T6D A;  3BUZ B;  4MO4 A;  3O08 A;  3ENH A;  3CQX A;  3LL3 A;  4K42 A;  5F0X A;  3SLC A;  4BRQ A;  3M6G A;  4JNE A;  3VEN A;  5TKY A;  3ZET B;  2GUP A;  4BRN A;  1BUP A;  2Q2R A;  4BRG A;  1TUY A;  4RTF D;  4BR7 A;  4BC5 A;  2QWP A;  5E26 A;  4H5R A;  3H46 O;  4BRH A;  5F1X A;  3CQY A;  3GE1 A;  1GLC G;  3L0Q A;  3UKR B;  3DAW A;  1JCG A;  1GLE G;  2ASO A;  1BG3 A;  2QWM A;  2E2P A;  1QZ6 A;  3QIC A;  1TYQ B;  4XEI A;  4B1X B;  4B1V A;  4O5F A;  5BRF A;  3AAR A;  3O6W A;  4BG8 A;  1QQN A;  5AQY A;  5AQF A;  2P9K A;  3VEX A;  4WQ4 A;  1JCF A;  2A42 A;  3A5M C;  3AAQ A;  1G99 A;  1MA9 B;  2P9U A;  3FE1 A;  4I6M A;  4C23 A;  5AZJ B;  1RFQ A;  3O1W A;  3O80 A;  3A0I X;  3VF4 A;  3CJ1 A;  2A5X A;  5FPM A;  2YHW A;  3FR0 A;  3LDQ A;  4BRP A;  1GLB G;  4CBW A;  4FL9 A;  2P9I A;  4MLE A;  3ZX2 A;  3FZL A;  3U9Z A;  1T44 A;  3WXI A;  2P9N B;  1WUA A;  2CH6 A;  3MN7 A;  4KBO A;  4BC2 A;  4IXC A;  2UYT A;  2H3G X;  4WQ5 A;  1JCE A;  3KZB A;  3A8Y A;  1Z05 A;  3EKU A;  1SAZ A;  1ZBS A;  1RGI A;  2V7Y A;  3D2E A;  4L3Q A;  5CE3 A;  5AQP A;  5KQ8 A;  2QM1 A;  3KHY A;  3EKS A;  3VET A;  2FXU A;  4PKH A;  2YHY A;  1NGH A;  4O8K A;  3QFP A;  3ZX0 A;  4FPA A;  1X3M A;  4CBX A;  5F2R A;  2Q97 A;  3SJH A;  3U4L A;  4NO7 A;  3R8E A;  2P9S B;  4H5V A;  4FOI A;  5AQK A;  3C7N A;  5AZI A;  4BRC A;  3CET A;  2A41 A;  3MN6 A;  5KQD A;  3AAP A;  2CGK A;  2ASM A;  2F9W A;  1NMD A;  1NWK A;  2CGJ A;  3DWL A;  2EWS A;  2D0O A;  2ZGZ A;  1K8K B;  2V7Z A;  1YUW A;  4XH1 A;  2E2O A;  3FZM A;  1Q18 A;  4IJA A;  4GNI A;  1NGB A;  4QS9 A;  2BTF A;  4BRK A;  4CD3 A;  3MCP A;  1IG8 A;  4LC9 B;  3W3D A;  5BN8 A;  1BO5 O;  5AQG A;  3F9M A;  4ISF A;  3DXM B;  3ZET A;  2E88 A;  4H0V B;  4CBU A;  1KAX A;  3I8B A;  3BP8 A;  3ATV A;  4CZL A;  4FWS A;  4F9O A;  2ZGY A;  5AQR A;  4DQ8 A;  1KAY A;  2E1Z A;  3VF6 A;  2FSK A;  5BRD A;  4CZE A;  2P9L B;  3UKR A;  2WUS A;  4A2B A;  5BPM A;  1X3N A;  5BPN A;  4WQ5 C;  4B1U B;  1R59 O;  3R9P A;  3RSE B;  4NB4 A;  3VF2 A;  4B1Z A;  2AP1 A;  4RWT A;  1TYQ A;  5JMV A;  5AFU H;  3LM9 A;  2YCH A;  2P9P B;  3DJC A;  1LOT B;  2D1K A;  1MDU B;  4BRE A;  3CJ9 A;  4M63 C;  5B8H A;  3HSC A;  2PBD A;  2ZWH A;  3UKU A;  1NGF A;  2A40 A;  3KVG A;  2E1Y A;  1XQS C;  4CD1 A;  2I7P A;  2QWO A;  4HWI A;  1U2V B;  5AZJ A;  3IUC A;  4MO5 A;  1YXQ A;  4M7Y A;  4IWV A;  3U8X A;  4PL7 A;  4K41 A;  4RCH A;  3WXK A;  3WQT A;  1DKG D;  3LDN A;  4FWN A;  2ASP A;  4JHD A;  3GBT A;  2QWL A;  3GDQ A;  5AQN A;  3VEV A;  2QWR A;  3SMS A;  1HKC A;  4CZM A;  5AQO A;  5AR0 A;  3QBW A;  4FWL A;  3VEW A;  1BDG A;  2I7N A;  3EO3 A;  5FPE A;  3FLC O;  1DEJ A;  4BQZ A;  4CZJ A;  2CGL A;  3VES A;  4H5N A;  3ZEU B;  1BA0 A;  3HM8 A;  2QWN A;  2GEM A;  3VEO A;  3CIP A;  3BF1 A;  4PL8 A;  2E2N A;  1C0G A;  3B8A X;  1HUX A;  3IMX A;  3OHR A;  5AQU A;  2E8A A;  1J6Z A;  4B9Q A;  3JS6 A;  2P9S A;  1ZXO A;  1YVN A;  1GLD G;  2VWB A;  1OKJ A;  3O1B A;  1E4F T;  4Y0W A;  3A5N C;  5AQL A;  3VEY A;  5AFU A;  5JLF A;  1NGJ A;  1BA1 A;  2KHO A;  3SK3 A;  3EZW A;  4IO8 A;  4FOE A;  2J4R A;  3VGM A;  1H1V A;  4H0Y B;  2V51 B;  4BR9 A;  3MK6 A;  1K8K A;  4H5W A;  1LCU A;  1Y64 A;  2AA4 A;  2E20 A;  2F9T A;  1ATS A;  3QML A;  2ITM A;  2FSN A;  2QWQ A;  4ISG A;  2IVP A;  3DXM A;  3HBT A;  5BR9 A;  2NRH A;  2YHX A;  3O8M A;  1BOT O;  5ADX H;  3MDQ A;  2IVO A;  3GOI A;  3QDK A;  1ZC6 A;  3J8A A;  3BEX A;  3FGU A;  4BC3 A;  5KPR A;  3H3O B;  3HI0 A;  4FSV A;  2P9K B;  4HTL A;  3RSE A;  4BRD A;  2HMP A;  3WEE B;  5BRH A;  3WXJ A;  3I33 A;  4BR5 A;  5KPT A;  4BR2 A;  5BRE A;  3W0L A;  3MN9 A;  2FF6 A;  4H5T A;  1QQO A;  3A5L C;  2Q31 A;  3WQU A;  4M7X A;  3GL1 A;  3DXK B;  4J8F A;  4CZK A;  2P9I B;  4JN4 A;  4K25 A;  1U2V A;  4BRF A;  1CZA N;  3VGL A;  1GLJ O;  4JD2 B;  5AQM A;  1YAG A;  1HKG A;  5AQZ A;  3L4I A;  3G25 A;  3QBX A;  1KXP A;  2GTD A;  3H1V X;  4FPB A;  4GY2 B;  5EX5 A;  4DHY A;  3LDP A;  5BPL A;  3FZK A;  3ID8 A;  1HLU A;  2CH5 A;  5AQX A;  3R6M A;  2YJE A;  2QW9 A;  4BRM A;  2Q1N A;  1XC3 A;  5I9E B;  2HF4 A;  2NLX A;  4A2A A;  2A6A A;  3P4I A;  5AQT A;  3JXU A;  4XH5 A;  5EY4 A;  3ZEU A;  4H0T B;  5LJV A;  5ADX A;  2V52 B;  1IJJ A;  3ZX3 A;  1HX1 A;  4CZI A;  1ATN A;  4H03 B;  4IJN A;  3U9D A;  1NM1 A;  3VPZ A;  5FPD A;  5AQQ A;  4EHU A;  4BRI A;  3ATU A;  4AM7 A;  4H0O A;  3CJB A;  2D4W A;  2IIR A;  2YI1 A;  1DGK N;  5ELZ A;  3MN5 A;  3FZF A;  4FWR A;  5E84 A;  1HPM A;  4FWO A;  4H0P A;  4PKI A;  3BF3 A;  4CZG A;  1QQM A;  2P9N A;  2QXL A;  3AY9 A;  1EQY A;  4JAX A;  5AQJ A;  5AQH A;  4YDU A;  1MWK A;  1XUP O;  2FLO A;  2W41 A;  3CJ7 A;  4BRO A;  3D2F B;  3D7E O;  2ZF5 O;  5KPZ A;  1GLL O;  1V4T A;  3CI5 A;  3ENO A;  5JLH A;  3M3Z A;  1NGC A;  3MMV A;  2GEL A;  4EIA A;  1NLV A;  5EXW A;  1QZ5 A;  5AQW A;  3WXL A;  3O4W A;  3TU5 A;  5LJW A;  1NBW A;  3QFU A;  3ULE B;  4FWP A;  3CJC A;  3H3N O;  1P8Z A;  2VCP A;  3VER A;  3UE5 A;  4FO0 A;  4FWQ A;  5BN9 A;  3EN9 A;  3A5O C;  3VEZ A;  3CJA A;  2A3Z A;  2VYP A;  5EOY A;  3UKU B;  1BWF O;  3O5B A;  3WEE A;  5AQV A;  2IVN A;  1E4G T;  3TPQ A;  2BUP A;  4BR4 A;  4FWK A;  1SZ2 A;  3UB5 A;  1NGI A;  4CZF A;  1T6C A;  1HJO A;  3M1F A;  1NGG A;  4PKG A;  2FSJ A;  2Q0U A;  1RDW X;  4JHD B;  5AQI A;  4EAH D;  4MLH A;  3DXK A;  2YJF A;  1ESV A;  4BVO A;  4EFH A;  4B1Y B;  4A62 A;  2Q36 A;  3IFR A;  1BU6 O;  1V4S A;  4JD2 A;  4H0X B;  2E2Q A;  4WYB A;  3SMP A;  4DCH A;  1HKB A;  3CHW A;  4AM6 A;  2OAN A;  1S3X A;  4CZH A;  2P9L A;  3H6E A;  4ISE A;  3LDO A;  4YDU C;  5JIC A;  1D4X A;  4BR0 A;  1QHA A;  2HOE A;  1TUU A;  3FZH A;  1SQK A;  1S22 A;  4CI6 A;  4BRL A;  1U6Z A;  3HZ6 A;  2P9U B;  3VGK A;  2P9P A;  4BGB A;  3WT0 A;  2FF3 B;  4I6M B;  4K43 A;  4BG9 A; 
#chains in the Genus database with same CATH topology
 3QB0 A;  3TR8 A;  4FVU A;  2EX3 A;  4ZTJ A;  3A2F A;  1C1C A;  1WOQ A;  4I9L A;  5J1E A;  4M3W A;  4DQP A;  4E19 A;  5M1F A;  1MWM A;  5C42 A;  4FLU A;  3LP1 A;  3D2E B;  4CK2 A;  2HHT A;  5FPN A;  3BY5 A;  4DSJ A;  4ELV A;  4E1J A;  4EHT A;  1IV0 A;  3VOV A;  3ZT2 A;  4DUY K;  3TTC A;  1K73 O;  4LFC K;  4QS8 A;  1CXU A;  4C1N I;  4DR6 K;  3LWM A;  3TAG A;  4LF6 K;  3H45 C;  4B3M K;  3NAE A;  3TAE A;  4LFB K;  3OYN A;  4Z4E A;  3EZ5 A;  3VA3 A;  3C7N B;  2NZT A;  4DSI A;  4JKB A;  4BQL A;  1WSJ A;  3SQ4 A;  1GLA G;  2X6S A;  4Z94 A;  3L3V A;  4CHN A;  1EX4 A;  4E89 A;  4OLB A;  3ZSO A;  1UA1 A;  3O08 A;  4GVM A;  3TI0 A;  2PFU A;  4DWI A;  3L4Q A;  1XC9 A;  5C10 A;  1Q8I A;  4JNE A;  1L3T A;  3VEN A;  2O8E B;  2UUB K;  2Q2R A;  5E41 A;  4JKG A;  4BC5 A;  4NXN K;  3F5T A;  1M1K O;  4CF8 A;  3H46 O;  4DS4 A;  4Q5V A;  5JS2 A;  3PO5 A;  2QWM A;  4KHY A;  1HRH A;  3OA9 A;  1TYQ B;  3IRX A;  3JAM O;  4B1V A;  3RMD A;  3C95 A;  5BRF A;  2E6L A;  3WNF A;  1QQN A;  5AQY A;  2ZJQ L;  3LAK A;  1ZBU A;  2P9K A;  2A42 A;  4B9M A;  4LF4 K;  3A5M C;  3AAQ A;  3CD6 N;  3KLF A;  4X65 K;  4JYA K;  1NKC A;  1VAZ A;  2NRZ A;  2VQE K;  5FPM A;  4JI2 K;  3FR0 A;  1BQN A;  1S72 N;  5HLF A;  2VQF K;  2JGU A;  4JKC A;  4KBO A;  5LL6 Z;  4IXC A;  1HYS A;  1JCE A;  2DTU A;  4B9T A;  5I42 A;  4FK4 A;  3EKU A;  1ZBS A;  2V7Y A;  3D2E A;  5CE3 A;  3S3M A;  3OS2 A;  3NF6 A;  4DQR A;  1NJX A;  3DOK A;  2ITG A;  2OTL N;  3AGR A;  3SJH A;  4H5V A;  3C7N A;  4IBN A;  4CFD A;  5KQD A;  3CYM A;  2CGK A;  3D6R A;  5A2Q O;  1NKE A;  4DV1 K;  3LDS A;  2CGJ A;  3KLH A;  5GAG P;  2D0O A;  2ZGZ A;  3VQ4 A;  3VQ5 A;  4C8L A;  3LZI A;  1NK0 A;  1YUW A;  1VHX A;  4XH1 A;  4NXM K;  3RWU A;  4DTX A;  1WSH A;  4GNI A;  2D5R A;  3O9Q A;  2KZM A;  5BN8 A;  4DR7 K;  5AQG A;  3F9M A;  3VMF B;  4AQY K;  1I94 K;  3VQ8 A;  3I8B A;  3G0Z A;  3VQ7 A;  4W5R A;  1RNH A;  1WNS A;  3HPO A;  4KKO A;  3VA0 A;  1ILY A;  2E1Z A;  2FSK A;  2KQ2 A;  3KK3 A;  3OW2 M;  1X3N A;  1XMO K;  4WQ5 C;  4IG0 A;  4NB4 A;  4U67 L;  1MU2 A;  4B8C A;  4KHW A;  3NH0 A;  1TYQ A;  3QET A;  4OPJ A;  2YCH A;  1N33 K;  1W0H A;  2HNZ A;  3LP3 A;  1MDU B;  3CJ9 A;  4M63 C;  3TWH A;  3N4P A;  4OPK A;  3NF8 A;  1JJ2 M;  1NGF A;  4NCG A;  3KVG A;  4DFM A;  1YI2 N;  3E9O A;  3SQ1 A;  1XQS C;  4NYN A;  1JLE A;  4M3Z A;  1ZBL A;  2RPI A;  4IOX A;  4AIL C;  1UOC A;  3LDN A;  4KRE A;  4YOX A;  3T1H K;  1TKD A;  4CJF A;  3VEV A;  3HK2 A;  4CJE A;  2KW4 A;  2A1S A;  4DV3 K;  3K5L A;  3MEG A;  1BDG A;  4H8K A;  1DEJ A;  3PX6 A;  1KD1 O;  3QO9 A;  4CHO A;  1OVY A;  3VQC A;  1Q9Y A;  4JI7 K;  2B5J A;  3B8A X;  4FK0 A;  3I0R A;  3JS6 A;  1SL0 A;  5M1N A;  1OKJ A;  5AFU A;  3A5N C;  1I3A A;  1NGJ A;  3EZW A;  4IO8 A;  2UUA K;  2GBZ A;  2J4R A;  4JI4 K;  2NRW A;  3CPE A;  2V51 B;  3UIQ A;  1LCU A;  1BIS A;  1Y64 A;  4BDY A;  3AVC A;  2GUI A;  5TKW A;  2E20 A;  4E7L A;  1N34 K;  1VQL N;  4LH4 A;  3L2R A;  1Q9X A;  2QWQ A;  4JEP A;  3ZT0 A;  1TGO A;  1I39 A;  5ADX H;  5BR9 A;  1BOT O;  3QDK A;  2KFZ A;  5HRN A;  3J8A A;  4YY3 K;  3BEX A;  4BWJ A;  3FGU A;  1NU0 A;  5KPR A;  3M5R A;  2YNF A;  4DQI A;  2XY8 A;  3RR7 A;  4EP5 A;  3WXJ A;  3C94 A;  2ETJ A;  3IG1 A;  1T03 A;  4DUZ K;  1X9M A;  3CCV N;  3V9U A;  5BRE A;  5BR8 K;  4DTU A;  2ZQB A;  4CJT A;  1B9F A;  4M7X A;  1VQ4 N;  4LF8 K;  5AJ3 K;  4K25 A;  2HW3 A;  1GLJ O;  4M3T A;  5AQM A;  4KHQ A;  1ZBH A;  3L4I A;  3SBT A;  4GY2 B;  4DHY A;  3LDP A;  4OGE A;  4CHP A;  4IG3 A;  2ZJP L;  2CH5 A;  3ZSZ A;  4BRM A;  4FCY A;  1XC3 A;  3ZYY X;  2IS3 A;  2LSN A;  2NLX A;  2YKM A;  2I5J A;  4XH5 A;  2DFH A;  3ZT4 A;  4H0T B;  4CJ3 A;  1NNE A;  1IJJ A;  3ZX3 A;  3M8R A;  3E9P A;  3MWT A;  1E3M A;  1RBR A;  2YHB A;  4CVN E;  5FPD A;  1VSI A;  3SV4 A;  4E7H A;  2B4J A;  2D4W A;  3CME N;  1RIL A;  3KWI A;  5ELZ A;  3MN5 A;  1YVU A;  3VQB A;  1CZB A;  4FWR A;  3CXC M;  1TKX A;  1C0M A;  4RW9 A;  4FWO A;  4H0P A;  4DQS A;  4CZG A;  1BL3 A;  3AA5 X;  3D45 A;  4CGI A;  1RTH A;  2W41 A;  3HRG A;  3D7E O;  3T69 A;  3CI5 A;  4HCC A;  3ENO A;  2OCE A;  1RT7 A;  4CCH A;  3MMV A;  1RDB A;  1KFS A;  2GEL A;  2UXC K;  5EXW A;  3KD1 E;  5AQW A;  2ZE2 A;  3O4W A;  4DR3 K;  1TKZ A;  2OZS A;  4MDB A;  1DT9 A;  3CJC A;  1P8Z A;  3DLB A;  1TAQ A;  2VCP A;  3VER A;  3UE5 A;  4FO0 A;  2G8U A;  1WSI A;  3VEZ A;  2OPQ A;  4X62 K;  1HR0 K;  2IGI A;  3R3L A;  4KTW A;  1UA0 A;  4JRQ A;  3O5B A;  4RW7 A;  3HP9 A;  2IVN A;  4DLG A;  4GVE A;  4BR4 A;  3HST B;  3PSI A;  3VTH A;  4FJG A;  2IOC A;  1NGG A;  4PKG A;  4CHZ A;  3CQ8 A;  5FLX O;  4Z4I A;  4JHD B;  2PZS A;  5HBM A;  2FBT A;  3KJV A;  3DOL A;  3P1G A;  4KRF A;  1IBK K;  5DMR A;  4B9N A;  1V4S A;  4UY8 O;  4H0X B;  2E2Q A;  1HKB A;  3CHW A;  3PIP L;  4YOU A;  5I3U A;  1FK9 A;  2W42 A;  1ASW A;  1SKR A;  2P9L A;  4C8M A;  4JV5 K;  3H6E A;  2E4L A;  4YDU C;  4FZZ A;  1W7A A;  3AA4 A;  2HOE A;  3CMA N;  1BCO A;  3S3O A;  3U3Y A;  4CI6 A;  1QHT A;  3P39 A;  4IFE A;  3SV3 A;  2P9U B;  3VGK A;  3WNG A;  4I6M B;  1YIT N;  4FLT A;  4BG9 A;  3OVN A;  2VG6 A;  1RDC A;  3SQ2 A;  3BGR A;  1QQC A;  4KB1 A;  1JLF A;  3EL2 A;  4A61 A;  1KAZ A;  5J2Q A;  3OBW A;  4DFJ A;  1EXQ A;  3C0B A;  2G8V A;  1Q81 O;  1BHL A;  3J7A P;  4XH4 A;  2KTQ A;  3LDL A;  3V1Q A;  1QTM A;  3THV A;  2NRX A;  4WQ4 C;  2W40 A;  4PHT X;  4DMN A;  1JL2 A;  3F9K A;  2Q0R A;  4I2P A;  3I8D A;  2RHK A;  1C0F A;  1X9J A;  5EVZ A;  4AF1 A;  4FWM A;  4CF1 A;  3LM2 A;  3ZSQ A;  4NYF A;  1NGA A;  1KVB A;  4CGH A;  3WNE A;  1LWE A;  1S1U A;  1NGD A;  3IAY A;  3HYF A;  4JKH A;  3VQ9 A;  2NUB A;  4QS7 A;  4FJN A;  4M3U A;  1SL1 A;  4CW7 B;  4WF9 L;  5AZI B;  4CJK A;  4WFB L;  3K58 A;  4M42 A;  3OYD A;  4BGA A;  4W5N A;  4E1N A;  1NG9 A;  2VWK A;  1EO1 A;  4B9V A;  1BIU A;  1ATR A;  3BUZ B;  3KLI A;  4LFA K;  1QS4 A;  3ENH A;  4KV8 A;  3MCA B;  4BRQ A;  2PYL A;  1C0U A;  4CK1 A;  2HVH A;  4X64 K;  1S1T A;  4FJ9 A;  4CJS A;  4F3O A;  1BUP A;  4BRG A;  5GIO A;  4RTF D;  4AH9 A;  4JI5 K;  5E26 A;  4H5R A;  4FJI A;  2E6M A;  3THW A;  1RBV A;  1D5A A;  4BRH A;  4F4K A;  3GE1 A;  3BZK A;  3ID6 A;  1GLE G;  1B9D A;  3THY B;  2E2P A;  1VRT A;  1QZ6 A;  3KWG A;  3DLH A;  4H4O A;  4B1X B;  3OYK A;  3AAR A;  3ALY A;  2UUC K;  3DYA A;  4A5B A;  2F7T A;  4C8N A;  5AQF A;  3VEX A;  4KHU A;  4WQ4 A;  1NOZ A;  3HVR A;  3BZC A;  1MA9 B;  2P9U A;  1NMN A;  4I6M A;  3AA2 A;  1JLG A;  4K0K K;  3O80 A;  3A0I X;  4IEI A;  3CFR A;  4BRP A;  1X9S A;  3IKM A;  4FL9 A;  2P9I A;  4MLE A;  1WUA A;  3MN7 A;  4BC2 A;  2H3G X;  3MWP A;  2QI2 A;  1GOC A;  4FJX A;  2WON A;  3SPY A;  1IKX A;  4ELT A;  3CC7 N;  4FLZ A;  1RGI A;  4L3Q A;  4W5T A;  1VQP N;  5KQ8 A;  4B3S K;  3O4Q A;  1RCH A;  3VET A;  4OPH A;  1U49 A;  1NGH A;  3H08 A;  2Q97 A;  3L2V A;  4NO7 A;  2P9S B;  1WB9 A;  3NHG A;  1T05 A;  1TL1 A;  4FYD A;  5AZI A;  2ASM A;  1NMD A;  4CEF A;  4DU3 A;  1TAU A;  2OA8 A;  4DKW A;  4E3S A;  4YFU A;  4CJP A;  1NGB A;  1GOA A;  2BTF A;  4QOZ B;  1IG8 A;  1NJY A;  1BO5 O;  4JI1 K;  3DXM B;  4H0V B;  4CBU A;  2VGN A;  3D0P A;  2OTJ N;  3BP8 A;  3ATV A;  4CZL A;  4F9O A;  2ZGY A;  4Z4H A;  1VRU A;  4CFA A;  4DQ8 A;  1KAY A;  5BRD A;  5FRM A;  4ID5 A;  3MEC A;  5BPN A;  2PY5 A;  1LW0 A;  2HND A;  3R9P A;  2R7Y A;  1WSE A;  1TKT A;  4RWT A;  2Z1J A;  3SI6 A;  1XNQ K;  5AFU H;  3LM9 A;  2P9P B;  1LOT B;  1WBB A;  3AO2 A;  3UKU A;  2HHS A;  4DR4 K;  4HUG A;  4CJ5 A;  1NOY A;  3PSF A;  2F4V K;  4CD1 A;  3SAG A;  3LP0 A;  1BQM A;  1G15 A;  1YXQ A;  1DTQ A;  3DLG A;  2QTD A;  4RCH A;  3WXK A;  2D0B A;  1DKG D;  2FBX A;  4U7B A;  4J2D A;  4N56 A;  4M45 A;  1TVR A;  5CZ1 A;  4BAC A;  5AQN A;  3VQE A;  2F8T A;  2QWR A;  3SMS A;  1HKC A;  1M90 O;  4IFY A;  4E7I A;  3SAH A;  4IFV A;  4CE9 A;  5FPE A;  4CZJ A;  2CGL A;  3VES A;  4DG1 A;  1BA0 A;  3AVB A;  2XRI A;  1QSY A;  2GEM A;  3CIP A;  3BF1 A;  4N41 A;  4JI8 K;  4PL8 A;  2E2N A;  3Q7C A;  2D0A A;  4JKD A;  4B9Q A;  2O8F B;  2P9S A;  1LWC A;  2HHV A;  1GLD G;  3OY9 A;  4TSX A;  5AQL A;  5JLF A;  4ZHR A;  1BA1 A;  3SK3 A;  3L2Q A;  1WSF A;  4G1Q A;  3K5M A;  2Q3S A;  1H1V A;  5IT9 O;  4HTU A;  1ASU A;  1JL1 A;  3MK6 A;  5C0Y A;  4H5W A;  3CPW M;  3ZSY A;  1ATS A;  3HT3 A;  3RRG A;  4N5S A;  2FSN A;  1LV5 A;  3CCU N;  3J7Y P;  1QVF M;  3DXM A;  3E9L A;  4JS4 A;  3CCR N;  3U6F A;  4V19 S;  2NRH A;  3O8M A;  1FKP A;  4NLC A;  4X66 K;  3O3F A;  5KGX A;  3TSQ A;  3KKS A;  4BE2 A;  3L8B A;  3C6H A;  1A5V A;  1YJW N;  1UAX A;  3EE8 A;  1KLN A;  3H3O B;  3HI0 A;  5HRS A;  2B6A A;  4LY7 A;  3V81 A;  5BRH A;  3WEE B;  2O8D B;  4CIE A;  2F96 A;  3SPZ A;  3HJF A;  4ICL A;  2O8C B;  5CZ2 A;  2YKN A;  4R79 A;  3OYI A;  2HMI A;  4KHS A;  2Q31 A;  3WQU A;  2O8E A;  4CJ4 A;  3GL1 A;  4OPA A;  4J8F A;  3PIO L;  4CZK A;  1XHX A;  3CCM N;  4DQQ A;  3SYZ A;  3J81 O;  3TSU A;  2G8W A;  1YJ9 N;  1KQS M;  5AQZ A;  1WLJ A;  1KXP A;  2GTD A;  1XI1 A;  4FPB A;  5BPL A;  3ID8 A;  5AQX A;  4WCE L;  3R6M A;  4W5O A;  4JRP A;  4DV5 K;  4BE1 A;  4IOA L;  2Q1N A;  1VSE A;  4AHC A;  1BCM A;  3SAF A;  1JXE A;  2W6K A;  3AVG A;  4A2A A;  3NF9 A;  4FLX A;  4FW2 A;  1L3V A;  2V52 B;  1T3V A;  2P5O A;  1HX1 A;  3O9U A;  2P5G A;  2QA4 N;  1U4B A;  4H03 B;  3AVA A;  3LAN A;  3U9D A;  1NM1 A;  3VPZ A;  1S5J A;  4GMJ B;  4EHU A;  4M3X A;  4WFN L;  4DU1 A;  4OGC A;  2X78 A;  5K14 A;  1DGK N;  4JKA A;  4O55 A;  4Q0B A;  1ZYQ A;  3RR8 A;  2QXL A;  3AY9 A;  1TK0 A;  5AQJ A;  1VSD A;  1XUP O;  1VK0 A;  3MEE A;  5J2P A;  1V4T A;  3NMU A;  3KLG A;  1WBD A;  3M3Z A;  1SKS A;  3VTI A;  4CEA A;  3T1Y K;  1NLV A;  1EET A;  3WNH A;  2WOM A;  1NK5 A;  1NJW A;  3V1R A;  3OYA A;  1C1B A;  1SUQ A;  3ULE B;  3QES A;  1A5W A;  3H3N O;  4OJR A;  3AVK A;  3QLH A;  4FWQ A;  5FDL A;  5BN9 A;  3PX4 A;  3SUQ A;  4DR1 K;  5LMN K;  1J9A A;  5EOY A;  3WEE A;  3TPQ A;  4Y1C A;  3LPT A;  1ZBF A;  2BUP A;  1TV6 A;  3LAL A;  1NGI A;  1T6C A;  3M1F A;  1LAV A;  2EHG A;  3NF7 A;  3OYM A;  2FSJ A;  1RDW X;  4E7K A;  2F8S A;  1XMQ K;  5AQI A;  3K5N A;  2YJF A;  4CHQ A;  1ESV A;  4EFH A;  4B1Y B;  5GAH P;  4A62 A;  1TK8 A;  4CEB A;  4G9Z A;  3TAR A;  1VQO N;  3DRP A;  4RG8 A;  3EEQ A;  1Q7Y O;  3DLR A;  4AHU A;  1W2B M;  3G10 A;  3FZH A;  1SQK A;  5C2D A;  4FM0 A;  2VG5 A;  3HZ6 A;  3AVI A;  4K43 A;  1S1X A;  2VWJ A;  3HTV A;  2XY7 A;  4F3T A;  3QNN A;  4IOC L;  1D9D A;  5AQS A;  4DR2 K;  1GLF O;  2GX9 A;  5KI6 A;  1VSK A;  3QEX A;  4B3T K;  4NCA A;  3ZCM A;  5SWM A;  3S41 A;  5DK5 A;  1Z6R A;  1Y97 A;  2FBY A;  3TAM A;  1EP4 A;  2DFF A;  3EE9 A;  4HHT A;  4HUF A;  2YHA A;  4DF8 A;  1RT2 A;  5JS1 A;  1IG9 A;  4MDA A;  4DSE A;  3GG4 A;  1HYZ A;  2HF3 A;  3SJJ A;  4UQG A;  4BRA A;  3MXI A;  2QXF A;  3K9K A;  3H1Q A;  2D0P A;  4JK7 A;  3DLK A;  1D8Y A;  3WUH A;  2Z1H A;  2QK9 A;  3MX2 A;  3ULE A;  4FJ7 A;  3FFK B;  3CFP A;  1J53 A;  3CQX A;  4JK8 A;  3V6D A;  1TL3 A;  5F0X A;  1REV A;  3M6G A;  4CJR A;  5M1O A;  4ID1 A;  5TKY A;  3ZET B;  2GUP A;  1NK9 A;  4BRN A;  4BR7 A;  1VSL A;  2E5L K;  4W5Q A;  4WE1 A;  2G8F A;  1RBU A;  4O0I A;  1RTJ A;  4DTJ A;  1KFD A;  1CXQ A;  3CQY A;  1Z25 A;  3UKR B;  1JCG A;  2ASO A;  4J2B A;  4JI0 K;  1BG3 A;  1KTQ A;  4JLH A;  3K0S A;  4JI6 K;  3P31 A;  4DV2 K;  4KTZ A;  4XEI A;  2JLE A;  4DV4 K;  4KB0 A;  4GV6 A;  3AO4 A;  3O6W A;  4BG8 A;  1KVA A;  2QEX N;  4FJ8 A;  4C8K A;  1JCF A;  2Y1J A;  2HHH K;  1G99 A;  5C12 A;  4GV9 A;  3C65 A;  3KK1 A;  1SKW A;  1RFQ A;  5CY4 A;  2ZM6 K;  2A5X A;  2VGM A;  1VQK N;  4CBW A;  3LDQ A;  1GLB G;  4CGG A;  3ZX2 A;  1NKB A;  2VG7 A;  3FZL A;  3U9Z A;  3OYH A;  3MED A;  1T44 A;  3WXI A;  2P9N B;  2RF2 A;  1WAJ A;  3I55 N;  1B92 A;  1W9H A;  1K8A O;  2OPP A;  5HRR A;  1Z05 A;  4DF4 A;  1NJZ A;  3QIO A;  3TAB A;  1YF5 L;  4JKE A;  4JI3 K;  3EKS A;  1U45 A;  2FXU A;  1BI4 B;  4LSL A;  4PKH A;  4O8K A;  1JLB A;  1X3M A;  2P51 A;  3ULD A;  3RRH A;  3THX B;  3U4L A;  4HVJ A;  3MAQ A;  4YOT A;  4BRC A;  1BIZ A;  2A41 A;  3OS1 A;  2WTU A;  5HP1 A;  2G8K A;  2IAJ A;  3NCI A;  4J2E A;  2NRT A;  1YIJ N;  3EY1 A;  4IJA A;  3NGI A;  3PUF A;  1EWQ A;  4BRK A;  3O4N A;  3MCP A;  4CD3 A;  4LC9 B;  3W3D A;  4AHS A;  2DFE A;  3O9R A;  1JLQ A;  4ISF A;  2AJQ A;  3ZET A;  4M3R A;  4DV0 K;  3M8Q A;  3IS9 A;  4FJH A;  4FWS A;  5JVG L;  1S1V A;  4KTQ A;  2Y1I A;  5M1K A;  4CZE A;  3UKR A;  4A2B A;  2WUS A;  5BPM A;  3QEV A;  1K9M O;  3RTV A;  1C6V A;  3RSE B;  3VF2 A;  4IDK A;  1TK5 A;  1CZ9 A;  2AP1 A;  2XY6 A;  1HMV A;  2D1K A;  2JWK A;  5D3G A;  1NK7 A;  3CFO A;  5GAE P;  4Z4F A;  1XNR K;  4LSN A;  3OJU A;  4E7J A;  2E1Y A;  1QSS A;  2QWO A;  5HRP A;  4JS5 A;  1U2V B;  3IUC A;  1VSJ A;  3PY8 A;  5GIP A;  3U8X A;  1WN7 A;  4K41 A;  3NGZ A;  4FWN A;  2BE2 A;  2A1R A;  1VQ6 N;  2ASP A;  4FM2 A;  5MLC Q;  2BDP A;  4JHD A;  3GBT A;  2WFB A;  3GDQ A;  4DTO A;  1OH5 A;  4CZM A;  5AQO A;  4FZY A;  5AR0 A;  3QBW A;  1OH6 A;  3EO3 A;  3FLC O;  4CGF A;  2Z1I A;  4H5N A;  3OYE A;  4B9L A;  2OPR A;  3VEO A;  1BI4 A;  5C24 A;  2RKI A;  3AVM A;  1O13 A;  4CK3 A;  3ITH A;  3O9S A;  1VQ9 N;  1HQU A;  4NLB A;  1C0G A;  1HUX A;  3KLE A;  3C6A A;  2O4G A;  2E8A A;  1J6Z A;  3THX A;  1IBL K;  4DV6 K;  3DRR A;  1YVN A;  1E4F T;  1P90 A;  2NRV A;  2KHO A;  3VGM A;  2HBK A;  3CCL N;  2FBV A;  1NK6 A;  3QIN A;  2XY5 A;  3AA3 A;  4PUO A;  1YHQ N;  2AA4 A;  3VQP A;  1WSG A;  4JKG B;  2ITM A;  1FJG K;  4N76 A;  2IVP A;  5HL7 L;  3QEP A;  3MDQ A;  4CEC A;  1Q82 O;  2ZJR L;  3GOI A;  1ZC6 A;  1RT4 A;  2BAN A;  3K2P A;  4M3Y A;  3OBY A;  4FSV A;  4OLA A;  2P9K B;  4HTL A;  3RSE A;  4BRD A;  2HMP A;  4LH5 A;  4BR5 A;  5KPT A;  4GV3 A;  1IKY A;  3BDP A;  1VQ8 N;  1U48 A;  4YOR A;  3W0L A;  3MN9 A;  2ZD1 A;  3P5J A;  2FF6 A;  4H5T A;  1QQO A;  1L5U A;  3TAN A;  3NVM A;  4ILH A;  3DXK B;  1U2V A;  1CZA N;  1YT3 A;  3G71 N;  1YAG A;  4QAG A;  4B3O A;  3T3F A;  5C25 A;  4DTN A;  3H1V X;  5EX5 A;  2JWL A;  3DM2 A;  3HOT A;  4LF7 K;  1HLU A;  1WAF A;  3CF5 L;  4FJJ A;  4O5B A;  4FLY A;  4FW1 A;  3THY A;  4ILG B;  4CES A;  3R1X A;  1EKE A;  4DSK A;  4BY9 C;  1JLC A;  3FFI A;  3NDK A;  4DTM A;  2P1J A;  1S6Q A;  3CCS N;  3PV8 A;  3RVC A;  2QKB A;  1XWL A;  2DY4 A;  1ATN A;  4IJN A;  3LP2 A;  5AQQ A;  3ATU A;  3KIO A;  3OYB A;  4KFB A;  3OYJ A;  4H0O A;  3OS0 A;  3NE6 A;  3FZF A;  4A57 A;  4GKK K;  1HPM A;  4PKI A;  3LAM A;  1IKV A;  3BF3 A;  1QQM A;  2X74 A;  3HOS A;  4PY5 A;  1MWK A;  2FLO A;  3CJ7 A;  4FM1 A;  4YNQ A;  3D2F B;  2ZF5 O;  5KPZ A;  4Y1D A;  4KH4 A;  3OYF A;  1N32 K;  5JLH A;  1CLQ A;  3G6E N;  2HHU A;  1UWB A;  3LPU A;  4OKK A;  4CF0 A;  3TU5 A;  3RMB A;  5LJW A;  1NBW A;  3QFU A;  4CGJ A;  1OH8 A;  5H1S Q;  3CJA A;  2KKZ A;  2VYP A;  5KTQ A;  2HVI A;  4DU4 A;  4BDP A;  4RW8 A;  4CZF A;  3VN5 A;  1Z26 A;  1JKH A;  3ZSV A;  3OYL A;  4DTS A;  1DLO A;  4CJU A;  5KRT A;  1NK4 A;  4MLH A;  3DXK A;  1QVG M;  4OX9 K;  2YNG A;  4BVO A;  3L3U A;  5EU7 A;  2Q36 A;  4O4G A;  3IFR A;  1BU6 O;  4WYB A;  3SMP A;  5DM7 L;  4AM6 A;  3I0S A;  4DFK A;  2OAN A;  3O3G A;  2O8B B;  1VQ7 N;  3ISN C;  3AVL A;  4CZH A;  4HUE A;  3HM9 A;  5JIC A;  4BR0 A;  1QHA A;  4CF2 A;  1TUU A;  2HBM A;  4MQ3 A;  4CFB A;  2P9P A;  4BGB A;  2OZM A;  4CF9 A;  5GAD P;  4BC4 A;  3RMC A;  1T7P A;  3CER A;  3IDH A;  4CEO A;  5LY3 A;  4YOV A;  3S3N A;  4KAZ A;  4IDH A;  3VQQ A;  4GKJ K;  3C6U A;  1NGE A;  4I9Q A;  1S1W A;  1HNI A;  2YV0 X;  3J7Z O;  4K8X A;  3DRS A;  3CCE N;  3AVN A;  1JLA A;  2OYQ A;  1FKO A;  3QIP A;  3HVT A;  4CJ7 A;  3D2F A;  1N36 K;  2PAV A;  3AVJ A;  3NBP A;  2DPN A;  4DB3 A;  2UXB K;  4LF9 K;  4BVP A;  1RBT A;  1RT1 A;  3QNO A;  1GOB A;  3SUP A;  3L6Q A;  3K5O A;  2GWK A;  4IZ9 A;  3HL8 A;  1L3S A;  2QKK A;  3ZSR A;  4YOW A;  2O8F A;  4B1W B;  2GWJ A;  2KFN A;  4KHP K;  1T6D A;  4FLW A;  4KHN A;  1O1W A;  3TTF A;  1FW6 A;  2YNI A;  4MO4 A;  3LL3 A;  4K42 A;  3E66 A;  4LD0 A;  3SLC A;  3JSM A;  3AO3 A;  1RT3 A;  3B6P A;  1ZBI A;  5J2M A;  4M41 A;  4DLE A;  1IKW A;  2RE2 A;  2HNY A;  1TUY A;  2QWP A;  3SNN A;  4FJ5 A;  3U3G A;  4QCL A;  4KO0 A;  5F1X A;  4CJV A;  1GLC G;  3L0Q A;  3DAW A;  3RMA A;  1HNV A;  3KK7 A;  4A5A A;  1VSH A;  2RN2 A;  4DTP A;  3T19 A;  3QIC A;  2GV9 A;  3QER A;  2O8B A;  4PQU A;  3VQA A;  4O5F A;  4DTR A;  2O4I A;  5CYM A;  1HJR A;  4Z4C A;  1OH7 A;  1N6Q A;  3F73 A;  1ASV A;  3CC4 N;  3G4S N;  3V9X A;  5C2F A;  2O8D A;  4O44 A;  2KLA A;  3CC2 N;  5SZT A;  1EWR A;  3NFA A;  1T8E A;  3CM5 A;  3FE1 A;  4C23 A;  1HNX K;  5AZJ B;  5J2N A;  2O8C A;  3O1W A;  1VQM N;  3VF4 A;  2UXD K;  3E1Y A;  3OJS A;  2XHB A;  3CJ1 A;  2UU9 K;  2YHW A;  3AV9 A;  4N47 A;  3MXM A;  2OPS A;  2CH6 A;  3ZT3 A;  3NH2 A;  2UYT A;  1KCF A;  3ASM A;  1QSL A;  2ATQ A;  4WQ5 A;  5M1Q A;  3KZB A;  3A8Y A;  1SAZ A;  4JK9 A;  4I2Q A;  5AQP A;  3V9W A;  5HOO A;  3OYC A;  2QM1 A;  3KHY A;  4PWD A;  4B3R K;  3AVF A;  2YHY A;  4AHR A;  4B08 A;  3NGY A;  2X6N A;  3QFP A;  3ZX0 A;  4HCB A;  4Z0U A;  4FPA A;  3DLL L;  4CBX A;  5F2R A;  4H4M A;  3R8E A;  3TTD A;  4FOI A;  5AQK A;  3K57 A;  3CCJ N;  4FJM A;  3CET A;  3Q7B A;  3MN6 A;  3AAP A;  3QEW A;  1C1A A;  2F9W A;  2IC3 A;  4RW6 A;  1YTU A;  5T7B A;  1NWK A;  4CEZ A;  1RTD A;  3DWL A;  2EWS A;  2HHX A;  2WC9 A;  1K8K B;  1RTI A;  4OKE A;  2V7Z A;  1DTT A;  4IKF A;  2E2O A;  1VSF A;  3FZM A;  1Q18 A;  1VQN N;  1BGX T;  2HHQ A;  4QS9 A;  1RDU A;  4CIG A;  4F8R A;  4B8A B;  3QEI A;  4KI6 A;  3LZJ A;  2E88 A;  4AHV A;  4EP4 A;  3NH1 A;  3C6T A;  1K6Y A;  1KAX A;  3LWL A;  3E01 A;  5HRO A;  3B6O A;  4L8R B;  2YX6 A;  3N4Q A;  1J5O A;  5AQR A;  1HNW K;  3VF6 A;  1IO2 A;  4KPY A;  3VQ6 A;  4NCB A;  2P9L B;  5JVH L;  2HBJ A;  4B1U B;  1R59 O;  4ILJ A;  4B1Z A;  1VQ5 N;  1SL2 A;  4CIF A;  5JMV A;  1SS6 A;  3DJC A;  4CJL A;  4OVL A;  3ENB A;  4BRE A;  5B8H A;  3HSC A;  2PBD A;  2ZWH A;  3CG7 A;  1YJN N;  3DI6 A;  2A40 A;  4MFB A;  2BH1 A;  2I7P A;  4HWI A;  5FRN A;  5AZJ A;  4MO5 A;  4M7Y A;  4IWV A;  4IEE A;  4PL7 A;  3I56 N;  3WQT A;  4CED A;  2D0C A;  3AGK A;  3AO1 A;  2QWL A;  3T7Z A;  4CEE A;  1D9F A;  4FJK A;  1RBS A;  4FWL A;  3VEW A;  2I7N A;  1J5E K;  1IH7 A;  2KZZ A;  4BQZ A;  3ZEU B;  4CEQ A;  3MXJ A;  1X9W A;  3HM8 A;  2QWN A;  1S6P A;  3TSP A;  3VQD A;  3WXM B;  1IBM K;  1LW2 A;  3HXM A;  3EYZ A;  4E1M A;  5CHI A;  4DSL A;  4R5P A;  3M8S A;  4CJQ A;  2HB5 A;  3S9H A;  3IMX A;  3OHR A;  4CJW A;  5AQU A;  5IWA K;  1N5Y A;  1LWF A;  1ZXO A;  4F2R A;  2VWB A;  1RDA A;  3O1B A;  4Y0W A;  3VEY A;  4FLV A;  4YHH K;  3HPH A;  4FOE A;  1ITG A;  3L2U A;  4H0Y B;  4PA1 A;  3PO4 A;  1HYV A;  4BR9 A;  3O9T A;  3M8P A;  3PLA A;  1JXB A;  1K8K A;  3PX0 A;  1R0A A;  1XHZ A;  5KRS A;  1X1P A;  1F21 A;  4Z4G A;  4I7F A;  2F9T A;  3QML A;  3SUN A;  4B9S A;  3ZSX A;  3P38 A;  4E0D A;  3CCQ N;  2Z1G A;  2WBN A;  3THW B;  4KI4 A;  4ISG A;  4CFC A;  3DMJ A;  4ELU A;  4BWM A;  3HBT A;  5CR4 A;  5CYQ A;  3SBG A;  2YHX A;  2IVO A;  4RW4 A;  3OTO K;  2XO7 A;  5KGW A;  4BC3 A;  3V9Z A;  3JYT A;  4XIU A;  1U04 A;  3I33 A;  2HST A;  1HNZ K;  1LAW A;  4BR2 A;  3K59 A;  3V9S A;  4FJL A;  4CHY A;  3A5L C;  3O3H A;  4IO9 L;  4EZ9 A;  2P9I B;  4JN4 A;  3V4I A;  3AVH A;  3ZSW A;  4BRF A;  4DFP A;  3VGL A;  3V1O A;  4JD2 B;  4LF5 K;  1HKG A;  3G25 A;  1RDD A;  3QBX A;  4CGD A;  1RT6 A;  4BE0 A;  1FXX A;  1HQE A;  1QE1 A;  3AO5 A;  5LMU K;  3ZLJ A;  1L3U A;  3FZK A;  3KD5 E;  2YJE A;  2QW9 A;  1N8R O;  3L2W A;  5I9E B;  2HF4 A;  4KH6 A;  3J80 O;  2A6A A;  3P4I A;  5AQT A;  3JXU A;  1RT5 A;  1SV5 A;  5EY4 A;  3ZEU A;  5LJV A;  5ADX A;  1HPZ A;  4CER A;  4CZI A;  2BGG A;  1Q86 O;  4BRI A;  4AM7 A;  3TAF A;  1S9G A;  3KTQ A;  3CJB A;  2IIR A;  1W97 L;  2FC0 A;  2YI1 A;  3ZT1 A;  1NJI O;  5E84 A;  3SUO A;  4BDZ A;  1KC8 O;  2P9N A;  3HO1 A;  2HHW A;  2G8H A;  2G8I A;  1EQY A;  4JAX A;  4WFA L;  5AQH A;  4YDU A;  4FZX C;  3SZ2 A;  4BRO A;  1KVC A;  1KLM A;  1GLL O;  3F2K A;  4DS5 A;  4EZ6 A;  4FK2 A;  4DSF A;  1NGC A;  4YOY A;  3OYG A;  4EIA A;  2IDO A;  4OO1 J;  1QZ5 A;  4KH5 A;  4F2S A;  3WXL A;  4ZTF A;  5GIN A;  1OVQ A;  3HPG A;  3TAP A;  3DLE A;  3KKR A;  3P83 D;  4FWP A;  4DV7 K;  4K8Z A;  4GW6 A;  3EN9 A;  3A5O C;  4A59 A;  3KK2 A;  4J2A A;  2A3Z A;  4O8U A;  1KRP A;  3UKU B;  1BWF O;  3T1A A;  5AQV A;  1E4G T;  4C8O A;  3K9J A;  1C0T A;  3SCX A;  1VSM A;  4FWK A;  1SZ2 A;  5FRO A;  3UB5 A;  1HJO A;  2PYJ A;  1KSP A;  5C15 A;  4O0J A;  1A5X A;  2Q0U A;  1J54 A;  1YTA A;  4EAH D;  4FVM A;  1NK8 A;  3TAQ A;  2NRR A;  1U47 A;  4DCH A;  3CM6 A;  4JD2 A;  5M1P A;  1S3X A;  3HP6 A;  3NVK A;  4FXD A;  4ISE A;  3LDO A;  1D4X A;  1S9E A;  4AHT A;  4DR5 K;  2W6L A;  2HBL A;  3MX5 A;  3SQ0 A;  4JKF A;  1S22 A;  2YNH A;  4BRL A;  1U6Z A;  4OKJ A;  3WT0 A;  2FF3 B;  2NNW A;  4B9U A;  5DM6 L;  4C1N K; 
#chains in the Genus database with same CATH homology
 3HTV A;  4BC4 A;  3QB0 A;  3EL2 A;  4A61 A;  3CER A;  3IDH A;  4IOC L;  5LY3 A;  5AQS A;  4YOV A;  4FVU A;  1GLF O;  1KAZ A;  2GX9 A;  3OBW A;  3C0B A;  1WOQ A;  4IDH A;  1Q81 O;  1NGE A;  3S41 A;  4XH4 A;  3J7Z O;  5M1F A;  1MWM A;  3LDL A;  1Z6R A;  2NRX A;  3D2E B;  4WQ4 C;  2W40 A;  3CCE N;  3EE9 A;  5FPN A;  4PHT X;  2Q0R A;  4E1J A;  4EHT A;  3VOV A;  2RHK A;  1C0F A;  1X9J A;  5EVZ A;  4AF1 A;  3TTC A;  1K73 O;  4QS8 A;  4CJ7 A;  3D2F A;  4FWM A;  3LM2 A;  4C1N I;  1NGA A;  4MDA A;  2PAV A;  3GG4 A;  2DPN A;  4DB3 A;  1NGD A;  3H45 C;  2HF3 A;  4BVP A;  4JKH A;  4BRA A;  4QS7 A;  3K9K A;  3C7N B;  3H1Q A;  4WF9 L;  2NZT A;  3L6Q A;  5AZI B;  4WFB L;  4JKB A;  4BGA A;  2D0P A;  2GWK A;  4JK7 A;  4BQL A;  4IZ9 A;  1GLA G;  3WUH A;  4Z94 A;  4YOW A;  3MX2 A;  3ULE A;  3FFK B;  4B1W B;  1EO1 A;  2GWJ A;  1ATR A;  1T6D A;  3TTF A;  3BUZ B;  4MO4 A;  3O08 A;  3ENH A;  3CQX A;  3LL3 A;  4JK8 A;  4K42 A;  2PFU A;  3E66 A;  3MCA B;  5F0X A;  3SLC A;  4BRQ A;  3M6G A;  3L4Q A;  5M1O A;  5C10 A;  4JNE A;  3VEN A;  5TKY A;  3ZET B;  2GUP A;  4BRN A;  1BUP A;  2Q2R A;  4BRG A;  2RE2 A;  5GIO A;  1TUY A;  4RTF D;  4BR7 A;  4JKG A;  4BC5 A;  3F5T A;  1M1K O;  2QWP A;  5E26 A;  4H5R A;  3H46 O;  4BRH A;  5F1X A;  3CQY A;  3GE1 A;  1GLC G;  3L0Q A;  3UKR B;  3DAW A;  1JCG A;  1GLE G;  2ASO A;  3ID6 A;  3KK7 A;  1BG3 A;  2QWM A;  2E2P A;  4A5A A;  1QZ6 A;  3KWG A;  3P31 A;  3QIC A;  3OA9 A;  1TYQ B;  4XEI A;  4B1X B;  4B1V A;  4O5F A;  5BRF A;  4GV6 A;  3AAR A;  3O6W A;  4BG8 A;  1QQN A;  5AQY A;  2QEX N;  4A5B A;  2F7T A;  2ZJQ L;  5AQF A;  2P9K A;  3VEX A;  4WQ4 A;  1JCF A;  3G4S N;  3CC4 N;  5C2F A;  2A42 A;  2KLA A;  3A5M C;  3AAQ A;  3CD6 N;  1G99 A;  1MA9 B;  2P9U A;  3CC2 N;  5C12 A;  3FE1 A;  4I6M A;  4C23 A;  1VAZ A;  4GV9 A;  5AZJ B;  3C65 A;  1RFQ A;  3O1W A;  1VQM N;  2NRZ A;  3O80 A;  3A0I X;  3VF4 A;  4IEI A;  3E1Y A;  3CJ1 A;  2A5X A;  2VGM A;  1VQK N;  5FPM A;  2YHW A;  3FR0 A;  3LDQ A;  4BRP A;  1GLB G;  3IKM A;  4CBW A;  4FL9 A;  2P9I A;  4MLE A;  3ZX2 A;  3FZL A;  3U9Z A;  1S72 N;  1T44 A;  3WXI A;  2P9N B;  1WUA A;  2CH6 A;  3MN7 A;  4JKC A;  4KBO A;  4BC2 A;  4IXC A;  2UYT A;  2H3G X;  3I55 N;  3MWP A;  2QI2 A;  4WQ5 A;  5M1Q A;  1JCE A;  3KZB A;  3A8Y A;  1K8A O;  1Z05 A;  3EKU A;  3CC7 N;  1SAZ A;  1ZBS A;  1RGI A;  2V7Y A;  3D2E A;  1YF5 L;  4JK9 A;  4L3Q A;  5CE3 A;  5AQP A;  5HOO A;  1VQP N;  4JKE A;  2QM1 A;  3KHY A;  5KQ8 A;  3EKS A;  3VET A;  4OPH A;  2FXU A;  4PKH A;  2YHY A;  1NGH A;  4O8K A;  3QFP A;  3ZX0 A;  2OTL N;  4FPA A;  1X3M A;  3DLL L;  4CBX A;  5F2R A;  2Q97 A;  3AGR A;  3SJH A;  3U4L A;  4NO7 A;  3R8E A;  2P9S B;  4H5V A;  3TTD A;  4FOI A;  5AQK A;  3C7N A;  4YOT A;  3CCJ N;  5AZI A;  4BRC A;  3CET A;  3Q7B A;  2A41 A;  3MN6 A;  5KQD A;  3AAP A;  2CGK A;  2ASM A;  3D6R A;  2F9W A;  1NMD A;  1NWK A;  2CGJ A;  5GAG P;  3DWL A;  2EWS A;  2D0O A;  2ZGZ A;  2NRT A;  2WC9 A;  1K8K B;  2V7Z A;  1YUW A;  4XH1 A;  4DKW A;  2E2O A;  1YIJ N;  3FZM A;  1Q18 A;  1VQN N;  4IJA A;  4GNI A;  1NGB A;  4QS9 A;  1RDU A;  2BTF A;  4BRK A;  3O9Q A;  3MCP A;  1IG8 A;  4CD3 A;  4LC9 B;  3W3D A;  5BN8 A;  1BO5 O;  5AQG A;  3F9M A;  3VMF B;  3O9R A;  4ISF A;  3DXM B;  3ZET A;  4UY8 O;  2E88 A;  4H0V B;  4CBU A;  2VGN A;  1KAX A;  3I8B A;  2OTJ N;  3BP8 A;  3ATV A;  4CZL A;  4FWS A;  4F9O A;  2YX6 A;  3N4Q A;  5JVG L;  2ZGY A;  1ILY A;  5AQR A;  4DQ8 A;  1KAY A;  2E1Z A;  3VF6 A;  2FSK A;  5BRD A;  5M1K A;  4CZE A;  2P9L B;  3UKR A;  2WUS A;  4A2B A;  5BPM A;  5JVH L;  3OW2 M;  1X3N A;  2HBJ A;  4WQ5 C;  5BPN A;  4B1U B;  1K9M O;  1R59 O;  3R9P A;  3RSE B;  4NB4 A;  3VF2 A;  4U67 L;  4ILJ A;  4B1Z A;  2AP1 A;  1VQ5 N;  4RWT A;  1TYQ A;  5JMV A;  5AFU H;  3LM9 A;  1SS6 A;  2YCH A;  2P9P B;  3DJC A;  1LOT B;  2D1K A;  2JWK A;  1MDU B;  3ENB A;  3CJ9 A;  4M63 C;  4BRE A;  5B8H A;  3N4P A;  3HSC A;  2PBD A;  2ZWH A;  3UKU A;  1JJ2 M;  1YJN N;  1NGF A;  5GAE P;  2A40 A;  3KVG A;  2E1Y A;  1YI2 N;  3E9O A;  2BH1 A;  1XQS C;  4CD1 A;  2I7P A;  2QWO A;  4HWI A;  3SAG A;  1U2V B;  5AZJ A;  3IUC A;  4MO5 A;  1YXQ A;  4M7Y A;  4IWV A;  4IEE A;  3U8X A;  2QTD A;  4K41 A;  4IOX A;  4RCH A;  3WQT A;  1DKG D;  3WXK A;  3LDN A;  4FWN A;  4U7B A;  3I56 N;  1VQ6 N;  2ASP A;  4YOX A;  5MLC Q;  4JHD A;  3GBT A;  3AGK A;  2QWL A;  2WFB A;  3GDQ A;  5AQN A;  3VEV A;  2QWR A;  3SMS A;  3T7Z A;  1HKC A;  4CZM A;  5AQO A;  1M90 O;  5AR0 A;  3QBW A;  4FWL A;  3SAH A;  3VEW A;  1BDG A;  2I7N A;  3EO3 A;  5FPE A;  3FLC O;  1DEJ A;  4BQZ A;  4CZJ A;  2CGL A;  3VES A;  1KD1 O;  4H5N A;  3ZEU B;  1BA0 A;  3HM8 A;  2QWN A;  3TSP A;  2GEM A;  3VEO A;  3WXM B;  3CIP A;  3BF1 A;  1OVY A;  5CHI A;  4PL8 A;  1O13 A;  2E2N A;  3O9S A;  1VQ9 N;  3Q7C A;  4NLB A;  1C0G A;  3B8A X;  1HUX A;  3IMX A;  3C6A A;  3OHR A;  4JKD A;  5AQU A;  2E8A A;  1J6Z A;  4B9Q A;  3JS6 A;  2P9S A;  1ZXO A;  5M1N A;  1YVN A;  1GLD G;  2VWB A;  1OKJ A;  3O1B A;  1E4F T;  4Y0W A;  3A5N C;  5AQL A;  3VEY A;  5AFU A;  1P90 A;  1NGJ A;  2NRV A;  1BA1 A;  5JLF A;  2KHO A;  3SK3 A;  3EZW A;  4IO8 A;  4FOE A;  2J4R A;  3VGM A;  2HBK A;  3CCL N;  1H1V A;  4H0Y B;  2NRW A;  3CPE A;  2V51 B;  4BR9 A;  3O9T A;  3PLA A;  3MK6 A;  5C0Y A;  1K8K A;  4H5W A;  1LCU A;  1Y64 A;  5TKW A;  3CPW M;  2AA4 A;  1YHQ N;  2E20 A;  2F9T A;  4JKG B;  1ATS A;  3QML A;  2ITM A;  2FSN A;  1VQL N;  3P38 A;  3CCQ N;  3CCU N;  2WBN A;  2QWQ A;  4ISG A;  2IVP A;  1QVF M;  3DXM A;  3E9L A;  3HBT A;  5CR4 A;  4JEP A;  5HL7 L;  3CCR N;  3SBG A;  5BR9 A;  2NRH A;  2YHX A;  3O8M A;  1BOT O;  5ADX H;  3MDQ A;  4NLC A;  1Q82 O;  2ZJR L;  2IVO A;  3GOI A;  3QDK A;  1ZC6 A;  3J8A A;  3TSQ A;  3BEX A;  3C6H A;  3FGU A;  1YJW N;  3EE8 A;  4BC3 A;  5KPR A;  3H3O B;  3HI0 A;  3OBY A;  3M5R A;  4FSV A;  2P9K B;  4HTL A;  3RSE A;  4BRD A;  2HMP A;  3WEE B;  5BRH A;  3WXJ A;  3I33 A;  2HST A;  4BR5 A;  5KPT A;  4GV3 A;  4G9Z A;  4BR2 A;  3CCV N;  5BRE A;  1VQ8 N;  4YOR A;  3W0L A;  3MN9 A;  2FF6 A;  4H5T A;  4R79 A;  1QQO A;  5GIP A;  3A5L C;  2Q31 A;  3WQU A;  3NVM A;  4M7X A;  4IO9 L;  4ILH A;  1VQ4 N;  3GL1 A;  4OPA A;  3DXK B;  4J8F A;  4CZK A;  2P9I B;  4JN4 A;  3PIO L;  3CCM N;  4K25 A;  1U2V A;  4BRF A;  1CZA N;  3VGL A;  1GLJ O;  3TSU A;  4JD2 B;  3G71 N;  5AQM A;  1YJ9 N;  1YAG A;  1KQS M;  1HKG A;  5AQZ A;  3L4I A;  3G25 A;  3QBX A;  1KXP A;  3SBT A;  2GTD A;  3H1V X;  4FPB A;  4GY2 B;  2JWL A;  5EX5 A;  3LDP A;  4DHY A;  5BPL A;  3HOT A;  3FZK A;  3ID8 A;  1HLU A;  2CH5 A;  5AQX A;  3R6M A;  2YJE A;  4WCE L;  2ZJP L;  3CF5 L;  2QW9 A;  1N8R O;  4BRM A;  4IOA L;  2Q1N A;  1XC3 A;  4ILG B;  3ZYY X;  3R1X A;  5I9E B;  3SAF A;  2HF4 A;  2NLX A;  4KH6 A;  4A2A A;  2A6A A;  3P4I A;  5AQT A;  3JXU A;  4BY9 C;  4XH5 A;  5EY4 A;  3ZEU A;  4H0T B;  5LJV A;  5ADX A;  2V52 B;  3CCS N;  1T3V A;  1IJJ A;  3ZX3 A;  1HX1 A;  3O9U A;  3RVC A;  3E9P A;  4CZI A;  3MWT A;  2QA4 N;  1ATN A;  4H03 B;  4IJN A;  3U9D A;  1Q86 O;  1NM1 A;  3VPZ A;  5FPD A;  5AQQ A;  4EHU A;  4BRI A;  4WFN L;  3ATU A;  4AM7 A;  4H0O A;  3CJB A;  2D4W A;  1W97 L;  2IIR A;  3CME N;  2YI1 A;  1DGK N;  3KWI A;  4JKA A;  3MN5 A;  5ELZ A;  3FZF A;  1NJI O;  4A57 A;  4FWR A;  5E84 A;  3CXC M;  1HPM A;  4FWO A;  4H0P A;  4PKI A;  1KC8 O;  3BF3 A;  4CZG A;  1QQM A;  2P9N A;  2QXL A;  3AY9 A;  3HOS A;  1EQY A;  4JAX A;  5AQJ A;  5AQH A;  4YDU A;  4WFA L;  1MWK A;  1XUP O;  2FLO A;  2W41 A;  3CJ7 A;  4BRO A;  3HRG A;  3D2F B;  3D7E O;  2ZF5 O;  5KPZ A;  1GLL O;  1V4T A;  3CI5 A;  3F2K A;  4KH4 A;  3T69 A;  3ENO A;  5JLH A;  3NMU A;  3M3Z A;  1NGC A;  3MMV A;  4YOY A;  3G6E N;  3VTI A;  2GEL A;  4EIA A;  1NLV A;  5EXW A;  4OO1 J;  1QZ5 A;  4KH5 A;  5AQW A;  3WXL A;  3O4W A;  3TU5 A;  5LJW A;  5GIN A;  1NBW A;  3QFU A;  4MDB A;  4FWP A;  1DT9 A;  3CJC A;  3H3N O;  3ULE B;  1P8Z A;  2VCP A;  3VER A;  3UE5 A;  4FO0 A;  4FWQ A;  5BN9 A;  5H1S Q;  3EN9 A;  3A5O C;  4A59 A;  3VEZ A;  3CJA A;  2A3Z A;  2KKZ A;  4O8U A;  3R3L A;  2VYP A;  5EOY A;  3UKU B;  1BWF O;  3O5B A;  3WEE A;  5AQV A;  2IVN A;  1E4G T;  3TPQ A;  3K9J A;  2BUP A;  4GVE A;  4BR4 A;  4FWK A;  1SZ2 A;  3UB5 A;  1NGI A;  4CZF A;  1T6C A;  3VTH A;  1HJO A;  3M1F A;  1NGG A;  5C15 A;  4PKG A;  2FSJ A;  2Q0U A;  1RDW X;  4JHD B;  5AQI A;  4EAH D;  4MLH A;  3DXK A;  1QVG M;  2YJF A;  1ESV A;  4BVO A;  4EFH A;  4B1Y B;  5GAH P;  4A62 A;  2Q36 A;  2NRR A;  3IFR A;  1BU6 O;  1V4S A;  4JD2 A;  4H0X B;  2E2Q A;  4WYB A;  5M1P A;  3SMP A;  1HKB A;  3CHW A;  4DCH A;  5DM7 L;  4AM6 A;  3PIP L;  2OAN A;  1VQO N;  1S3X A;  4YOU A;  3NVK A;  1VQ7 N;  4CZH A;  1Q7Y O;  2P9L A;  3H6E A;  4ISE A;  3LDO A;  4YDU C;  5JIC A;  1D4X A;  4BR0 A;  1W2B M;  1QHA A;  2HOE A;  1TUU A;  4PL7 A;  3CMA N;  2HBL A;  3FZH A;  1SQK A;  3MX5 A;  5C2D A;  2HBM A;  1S22 A;  4JKF A;  3P39 A;  1U6Z A;  4IFE A;  3HZ6 A;  4BRL A;  2P9U B;  4CI6 A;  3VGK A;  2P9P A;  4BGB A;  3WT0 A;  2FF3 B;  4I6M B;  1YIT N;  2NNW A;  4K43 A;  5DM6 L;  5GAD P;  4BG9 A;  4C1N K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...