5J2MA

Hiv-1 reverse transcriptase in complex with dna and efda-triphosphate, a translocation-defective rt inhibitor
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase p51 subunit
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/dna
total genus 166
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2mA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2mA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2mA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2mA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2mA05
3TR8A 4UQGA 5C24A 3PW7A 1JLFA 3SFUA 4DTRA 3NL0A 2IC3A 5F8NA 5F8GA 1IKVB 4KB0A 1JLAA 4KB7A 4CECA 2IS3A 4CE9A 3M9OB 1IO2A 1JLGB 1HPZA 3PW4A 1C1CA 4RNHA 3OVNA 3DM2B 1QSYA 2J6UA 4JS5A 2YHAA 3OS0A 2DFEA 3QEWA 1IM4A 5J2MB 3TABA 3OY9A 1WSEA 4G1QB 4E19A 2R8JA 2VG7A 2CJQA 3AVLA 3VQDA 4E7IA 1BQMA 1JLEA 1FKPA 2XO7A 2HHTA 4CEEA 2WHOA 2LSNA 2IBKA 1I6JA 2W9BB 4KAZA 3RMAA 2UVUA 3TAPA 3PJWA 4RU9A 4M3YA 4OPJA 4KHUA 4ZHRA 1S1XA 2FVSA 4O3PA 4ED0A 1RTDA 2AQ4A 4I2PB 1ZBHA 2UVVA 3WNGA 4DEZA 4DFPA 4CJFA 2B5JA 4Q8EA 1TKTB 4CHZA 1I39A 4DTMA 4CHNA 3DYAA 4FVMA 2P1JA 3HVRA 4ZP7A 5DLGA 4HVJA 2R8KA 2XCAA 1T05B 3ITHB 3OYKA 3DMJB 2RKIA 3SJJA 5KG0A 4FCYA 4I9LA 4H4OA 3QERA 5KG2A 2OPSB 4CF8A 1KFSA 5F8JA 3V4IA 3C6UA 3L2VA 2O4IA 1RT7B 3VQ5A 5KTQA 4LY7A 1KRPA 3PX4A 2IJFA 2YNGA 3DI6A 3GYNA 5SWMA 3KD5E 4JV0A 2IAJA 1RT5A 5L9XA 4HYKA 3OYNA 3MR5A 3AVKA 1TL1A 3RMCA 3MXJA 3NCIA 2FVPA 4FXDA 3QINA 4E1MA 4CF2A 3OYAA 3BJYA 3JYTA 1BGXT 3MEDB 4CEDA 4K4XA 2DFHA 5D3GB 3DLGA 4MH8A 4FM2A 4LH5A 4M94A 5KT6A 4F50A 1RTJA 2OPRB 4NLQA 2YNHB 3TQ1A 3DOKB 2ASJA 5HBMB 1RTHB 2W7PA 1TAUA 4O55A 3E51A 4Z4FA 2VG6A 4FZXC 1IKWB 3KK1A 2W8KA 1NJZA 4C8OA 3BSOA 4WZMA 3AVMA 4M95A 3NF7A 4F4KA 2A1RA 3PO5A 4FZZA 5KG3A 4WE1B 4Y1CA 4FLWA 2IM0A 3MEEB 3U6FA 2HNYA 1BISA 2G8FA 1ZYQA 2QK9A 5C24B 4M3UA 2XC9A 1JLFB 3F9KA 3SUNA 4E7JA 3KMSA 2ASLA 2IC3B 4GC6A 3V1OA 3HP9A 1JLAB 2BR0A 3BQ0A 3U3YA 4NLYA 1LWEA 5DK5A 1C1CB 4EEYA 1S1VA 3LZIA 3IN5A 5KFTA 1RBSA 3FSIA 3ICLA 2ZQBA 4B08A 1RDDA 4J2DA 3H59A 5JUMA 4QWBA 4GW6A 3AO1A 3KD1E 1C1BB 3T5KA 4CGGA 4FYDA 2VG7B 1NHUA 1KLMA 3UDLA 1VRTA 3H5SA 1SKRA 2HWIA 1JLEB 3OYGA 1FKPB 2FBVA 3NAEA 1S9EA 4OKJA 4CK2A 2HHVA 2JEGA 4DTJA 1ZBIA 3L3UA 1BCMA 4B8AB 1TKXA 2NUBA 3OHBA 1NK9A 3OLAA 3V81A 2W9CA 3OJUA 4TY8A 2KW4A 3SUPA 1S1XB 1NHVA 4QW8A 4Y1DA 4O4RA 5DMRA 5F8LA 4CHYA 3PR4A 3Q8RB 1QAIA 3CJ3A 4EBDA 4L8RB 4K4SA 1GOCA 4CJEA 4XPCA 1JLQA 1S6PA 4FS1A 2B5JB 4CK3A 1TKDA 2YHBA 2UVRA 4R0EA 1VSEA 1YT3A 1BL3A 3TAFA 3DYAB 4AHSA 3L3VA 5KFVA 1VSJA 3T5LA 3IRXA 4J9SA 4J9PA 4KPYA 4ECZA 4CJ4A 4H4OB 1QSSA 2OH2A 1YVFA 4YP3A 4KE5A 4AHCA 2ZD1A 3C6UB 1SH3A 3KHGA 4OLBA 3KLFA 4OKKA 5L1IA 2OA8A 1RDAA 1LWFA 4ZP8A 2G8WA 3BGRB 3VQAA 3K5LA 1JLCA 5FROA 3L2RA 1FK9A 1R0AA 5F9LA 1CZBA 2EHGA 3DI6B 4KFBA 2I5JB 1RT5B 2DY4A 1RDRA 3HSTB 3S3MA 4N56A 1UA1A 3RB3A 4FM1A 3RTVA 4DTNA 3TAMA 4U6PA 4O5BA 1TL1B 4CESA 4FLXA 4E0DA 1RBUA 1KSPA 2IMWP 1N56A 1LW2A 4MIBA 4E1NA 4LQ9A 4DL4A 1RBVA 4Z4CA 2XWYA 3JYTB 5DLFA 4DU1A 4FJNA 1T8EA 3N6MA 1C0MA 3TAEA 1YVUA 3RMBA 3B6PA 3DLGB 5EWGA 3SPZA 4KTQA 4M3XA 4KTWA 5C25A 1RTJB 1S0MA 3V6HA 5JS2A 4ZVGA 4IG0B 4FS2A 3A2FA 1HNIA 4ED8A 3IS9A 4IR1A 2VG6B 1T7PA 1SH0A 4I7FB 1LV5A 1HQUA 3MAQA 1GX5A 5KFKA 3NF8A 4C8KA 4CJ3A 3OL7A 4FM0A 4DFMA 2JC1A 5KGWA 2R2SA 4NYZA 3O3FA 3LDSA 1QE1B 1T03A 4CEOA 4FBUA 5J2QA 2ETJA 1QTMA 5HROB 3TARA 4FLVA 4ZPDA 4YR0A 3BQ2A 1JXEA 5KFJA 4ZP9A 2G8HA 5DG9A 5J2NA 4WXOA 1KHVA 3O4NA 3UPFA 3SQ4A 1LWEB 2XY7A 2PZSA 4K8XA 2QV6A 1VRUA 4RW9A 1S1VB 3KLGA 2C28A 1VK0A 2B4JA 4IFYA 2OZMA 3NBPA 3QZ7A 3ZT0A 4DSLA 3SNNA 1HARA 2IA6A 2XI3A 2V4RA 1KLMB 1VRTB 1RT6A 3H4DA 2QKKA 2YNFB 3OYBA 1A5VA 2PYJA 1S9EB 4ZPCA 1F21A 1RBTA 1HRHA 1GOAA 3KNAA 3SCXA 3T1AA 4J9RA 2WONA 1YTAA 4RG8A 3ZCMA 1TKXB 3PJXA 3EYZA 3V81B 2W9CB 4FZYA 4TY8B 3CYMA 4B9SA 3HVTA 1TL3A 4E3SA 4J9QA 1C2PA 1U49A 3DLHA 1REVA 3LP3A 2BANA 1JLQB 1S6PB 4TN2A 4TSXA 1S10A 1SH2A 3FQKA 3HPOA 4Z4IA 3PW5A 4OKEA 3CM6A 3IRXB 1HMVB 2QE5A 4O3SA 4F8RA 2B6AA 3CJ0A 3AV9A 2IM1A 5KFPA 5KFNA 5KFQA 4BDPA 1JKHA 3RBEA 4FJMA 3KLFB 5FDLA 4PUOA 3V1RA 3H5UA 4RW7A 3N6NA 3V9XA 3G6YA 4JRQA 4LSNA 3MEGB 2FJVA 2D5RA 1JLCB 4Q0BA 3I5BA 2KQ2A 1UWBB 4MFBB 4KFBB 5HP1B 4QAGA 3IG1B 4M3WA 3SV3A 1RYSA 3I8DA 3H98A 2F8SA 1TV6A 3OYEA 3KK3A 4O4GA 1B92A 3WNEA 2IM3A 2C2RA 4Q45A 3OYCA 3DOLB 4FLZA 1LW2B 4FJKA 2HHQA 3H40A 1RDBA 2Z1HA 1NOYA 3QIDA 4Y2CA 5C25B 2FJWA 4FK4A 1ZTWA 5EUHA 4DL7A 4YFUA 5KFFA 1UAXA 4NLPA 3VN5A 2HNDB 2ASDA 5F9NA 2CKWA 1HQUB 4DG1A 4ELTA 5EWFA 1SL2A 1KCFA 1X1PA 4NLWA 1TK0A 2XY6A 4JLHA 3PHEA 4DMNA 2F8TA 1FXXA 1DTTB 2OPQB 5J2QB 3MFHA 4AHTA 3JSMB 1QUVA 4CFDA 4IRKA 4GC7A 2YNIA 1XR6A 2X6NA 4CIFA 4NCGA 5J2NB 3AVNA 1XC9A 3NDKA 1Z26A 4XO0A 3SQ1A 3AA3A 4KO0A 1TVRA 1VRUB 4RW9B 3KLGB 2AJQA 4KI4A 4IFYB 1K1QA 3DLRA 3SI8A 4TQSA 3V6DA 2GUIA 4E7LA 4X2BA 2YKMA 3MXMA 1B9FA 2VWJA 4WYLA 4J9LA 2EX3A 1NKCA 3K5OA 5DG8A 2BE2A 3DLKA 4ECYA 1L5UA 1S4FA 5HRPA 3CWJA 3H2LA 3GV7B 2FJXA 3KK2A 3OHAA 1SV5A 4B9LA 3QEXA 4R5PB 3AVCA 1JL1A 4QOZB 1CLQA 5J2PB 3BDPA 5L1LA 1WSFA 2WONB 2OYQA 4TY9A 5J1EA 1EP4A 2D7SA 2DPJA 5KFGA 3G10A 3VQEA 1LW0B 3H5XA 3HVTB 5CZ1A 3AVHA 3H5YA 4HCBA 2UUTA 4O44B 1D5AA 3DRRA 1REVB 4CHOA 1L3SA 3DRSA 1SKWA 4C8MA 3OJSA 3FFIA 4Q5VA 3OL9A 1N6QB 2IDOA 3M9NB 5EU7A 1S6QA 1GX6A 4DWIA 4AILC 1LWCB 4RW6A 1ZTTA 5KG7A 3PV8A 3KLHA 2XY8A 2JC0A 3K2PA 1RT2A 2HWHA 2FC0A 1N5YB 1TAQA 1XR7A 3M8QA 2W42A 4HUGA 4ZVEA 4AHVA 1RTIA 2VG5A 3VQSA 1U04A 4K4VA 3ISND 5CY4A 5KG5A 3TANA 4M42A 3DLEB 3CFPA 4CCHA 3MFIA 2E9ZA 2HNZB 2AWZA 1JL2A 3PX6A 1S49A 4IG3A 3NMAA 1J5OA 2KFNA 1JLBA 3THVA 2WK4A 1L3TA 4LSNB 3M8SA 3NH1A 1NKEA 3OYDA 3F73A 4IKFA 3PW0A 4OGCA 4ID1A 4IFVB 1RT1B 4IH5A 5E41A 3L2UA 4Z4EA 4DLEA 3PO4A 3I0RA 3NGYA 3CJ2A 4LSLA 4N47A 4FK2A 3CO9A 3L2WA 3SQ2A 4F2RA 3LAKA 4O3QA 3HVWA 1S5JA 1S1UA 1IKYB 4KB1A 2O4GA 1HQEA 2F96A 3QGGA 2V4QA 2E9RX 4B3OA 3C6TA 4RNMA 1RDCA 3SZ2A 3DRPB 4JRPA 2IM2A 1BI4A 2D0AA 1HYSA 1JX4A 3WNHA 2X78A 3NH2A 4IBNA 4DG1B 3OYFA 3G86A 2Y1IA 3LP2A 1RBRA 3KLIA 1IG9A 4K8ZA 1RAJA 4KHYA 1BIZA 5CYQA 1HPZB 5C5JA 4WFYA 1W9HA 3RBDA 1RT3A 3SYZA 4KHMA 2AGPA 4PQUA 2KFZA 3T5JA 1GOBA 4AHUA 5KFMA 4TQRA 1S1WA 3VQ9A 1K6YA 4OLAA 3K57A 1ASVA 4W5NA 1NKBA 4QWDA 3AVFA 4NCGB 3LANA 1JIHA 4ID5A 1C0TA 1XR5A 4DSJA 4IR9A 1C0UA 5HLFA 4YR2A 3NF6A 1KVCA 1UOCA 1BQMB 1WSHA 3HK2A 4K4ZA 3MR2A 1RNHA 3HPHA 3AVJA 4LQ3A 4Z4GA 2OPPA 4ZP6A 3V9UA 4Y34A 2RPIA 3C94A 5KFDA 3CJ4A 4CF1A 4B9UA 1FKOA 4NYNA 3N6LA 4IRDA 3QLHA 3ZT4A 4NRTA 4NLTA 4ZHRB 4WXWA 4CFAA 3KK2B 4DL5A 1W0HA 1RTDB 1SV5B 5F8MA 4J2BA 2GIRA 4DTOA 4TYAA 4DQSA 1NK8A 1D8YA 4ICLA 4KHRA 1O1WA 1EP4B 2HMIA 5KFZA 1EETA 4YNQA 3IAYA 2IJNA 4B9MA 4KTZA 1NJXA 3QYYA 5KFAA 4BWJA 2RKIB 3DRRB 3HL8A 2G8IA 3DRSB 3K5MA 3FFIB 1TK8A 3OL8A 1KVBA 3RMDA 4ED2A 3KOAA 4CEAA 1U09A 1S6QB 1NJYA 1T94A 5FRMA 4JV2A 2RF2A 4RW6B 3V4IB 3TAQA 4URQU 4KKOA 2C2DA 3KLHB 1RILA 3BSNA 4ZPAA 1SL1A 4DQPA 4NLXA 3QGHA 1RT2B 2AX1A 4F4WA 3AO4A 3SUOA 1WSIA 3LALA 2QXFA 2YNGB 4IRCA 2FVQA 1RTIB 2VG5B 4O3OA 2IAJB 4XPEA 5KFIA 3B6OA 4Z4HA 1XI1A 3G6VA 1MU2A 3QESA 4J9NA 2FBTA 3QIPA 4U7CA 4IG3B 3L2QA 5K14A 1J5OB 4J2AA 2D3ZA 4TXSA 2BQUA 1CXQA 5HRSA 4Q8FA 3AVIA 4CJWA 1DLOA 1J9AA 4BE0A 1ZBUA 4DL6A 1CZ9A 1RA6A 1K1SA 3CDUA 4MK7A 1WLJA 3AO2A 4ECQA 5DGBA 1S9GA 3L8BA 1NK6A 3I0RB 4NLVA 2AGOA 4LSLB 4DQIA 4E7HA 4FJLA 4N5SA 4CJLA 3OSNA 1QHTA 3KK1B 4FW2A 2E6MA 3QNOA 4HCCA 4I2QA 3HT3A 5KFWA 4CGFA 1HQEB 4Y3CA 1X9WA 4F3OA 1N4LA 3HYFA 4KBIA 2Q3SA 5KG1A 3V6JA 1BI4B 1VSFA 1HYSB 4EO6A 3M8PA 5KFOA 3ZSRA 4M3RA 2HNYB 2GC8A 4AH9A 1NOZA 3SI6A 1SKSA 1G15A 1Q9XA 4Q44A 3MECA 4NLUA 3Q8PB 3LP2B 2QKBA 1IKVA 3V9SA 3D0PA 2AX0A 2IGIA 3MTKA 1S0NA 3NE6A 1JLGA 2ATLA 4C8LA 5CYQB 3VQ7A 2HVHA 1OS5A 4PQUB 3GQCA 4Y2AA 1S1WB 3MF5A 1VSHA 5J2MA 1ASUA 4DTSA 5SZTA 5T7BA 2GV9A 1XHXA 4K4WA 4JV1A 4XIUA 2EC0A 4ID5B 5I3UA 3ZT1A 1MMLA 2WTFA 1IH7A 4URGA 4NLRA 4HTUA 5HLFB 2Z1IA 4MK8A 4PWDA 4NLGA 3VQ8A 3BQ1A 5KFBA 2BRKA 4DL2A 4K50A 4KHQA 1S48A 1S9FA 2YV0X 3OS1A 4N76A 4W5QA 3OYHA 3LP0A 5F8HA 2W9BA 1VSDA 1W25A 4DSEA 1WSGA 3QNNA 1FKOB 2ZE2A 2GIQA 3QLHB 3KIOA 4PA1A 3RB6A 4CEQA 4KSEB 3CQ8A 2JGUA 3PW2A 4J9KA 1QQCA 4DQRA 4HHTA 4KV8A 4ECVA 2JEJA 4NCAA 3FRZA 2WRMA 4H4MA 4CF9A 2HVIA 4FBTA 2HMIB 2YKNA 2FBXA 3SFGA 5KFSA 3BSCA 4EZ9A 1T05A 4QWCA 3DMJA 2WOMA 4F4XA 1WSJA 3RR7A 5KFYA 1HYZA 4ZTFA 2OPSA 4HKQA 5KRTA 3Q8QB 3LPTA 4CGDA 1S0OA 4RW8A 1C6VA 4JUZA 1D9FA 2RF2B 2R8HA 1RT7A 2ZD1B 4KKOB 3LWLA 2HHSA 4CJUA 1ZETA 1LWFB 2XGPA 2P5GA 2HB5A 3S9HA 4IDKA 4DSFA 1FK9B 1R0AB 1U47A 2F8EX 2WCXA 3UQSA 4CERA 3HO1A 2J6TA 2P5OA 3KMQA 4M3TA 1MU2B 4E89A 3EPIA 4O3NA 3TAMB 1J53A 4DF8A 4TYBA 1NK7A 5EWEA 2OZSA 4TLRA 5L1JA 3TI0A 3PY8A 4DTXA 4OJRA 1DLOB 3SV4A 4BWMA 4KRFA 4DSKA 5KT7A 3UR0A 4IKAA 4ZTJA 2DTUA 4WZQA 4KHNA 1ZBFA 4OVLA 4B9NA 2BQ3A 1RTHA 4FJ9A 3PX0A 2FVCA 1HNIB 3IS9B 5KGXA 4OL8A 4K4YA 4I2QB 3M8RA 4MIAA 2UUWA 5DQIA 4ED1A 3VA3A 3NAIA 1WNEA 3AA4A 3GIKA 3OYIA 1X9MA 3ASMA 3NFAA 4FJHA 3QGIA 1T03B 2RN2A 3M8PB 5KFRA 4QPXA 5T14A 3VQ6A 1SUQA 2JLEA 4E7KA 3QIOA 3MECB 4ELUA 1LAVA 2O5DA 4NCBA 2UVWA 4J9MA 2R2RA 3VQBA 4FJ8A 4KI6A 3D45A 3D5MA 4W5OA 1EXQA 3PZPA 4O0IA 3NBPB 1QSLA 2W9AA 4EBCA 4ZVFA 4BDZA 4MK9A 1HYVA 4IQXA 1C1BA 4CEFA 4C8NA 4CJ5A 3HKWA 5I3UB 3GIJA 4PWDB 1RT6B 2D0BA 4LH4A 4CJQA 3RAXA 1Z4UA 3VA0A 3LP0B 5KG6A 2X74A 2XY5A 4FJGA 2PYLA 3ZT3A 4DS5A 2ZE2B 2I1RA 4MQ3A 1TL3B 3RR8A 1XHZA 4KV8B 4FLYA 4DS4A 2BANB 2VA3A 3HHKA 4H4MB 4ECSA 4FJ5A 3I5AA 5KFCA 3V9WA 3GILA 2JEIA 4CIGA 2YKNB 4BE2A 3ZSYA 5KRSA 3FDSA 3C95A 3O4QA 2WOMB 3V1QA 3RB0A 2B6AB 4DFKA 3U3GA 2PY5A 4IH6A 4CFBA 4RNOA 4RW8B 5CZ2A 1JKHB 1NK5A 5FDLB 1RT4A 4PUOB 4RZRA 4ZPBA 4RW7B 3E01A 1TGOA 3NF9A 3BGRA 4ZVHA 3EZUA 5DQHA 3BSAA 4IDKB 4Q0BB 4KHWA 2ATQA 1Q8IA 2I5JA 3HXMA 4N41A 3PUFA 1VSIA 1NK0A 1TV6B 1LAWA 3LWMA 3GIMA 3KK3B 4O4GB 5KFLA 1Y97A 5DQGA 2XCPA 1BQNA 4DU3A 4NZ0A 3OLBA 4NRUA 3MR3A 3DDKA 1S1TA 3CFRA 3LZJA 5DG7A 4RNFA 2JEFA 3NGZA 4RNNA 4EO8A 4M45A 4CEZA 4FLTA 4YQWA 3OSPA 4O3RA 3BREA 3KKRA 1HNVA 1CSJA 3CVKA 4IG0A 1VSLA 4FJ7A 4AHRA 1VSKA 2GBZA 2XHBA 5KFEA 4I7FA 3QO9A 4KAIA 1DTQA 1BIUA 4OPKA 4IH7A 1RA7A 5DGAA 2ILYA 4HUEA 4ECWA 2B43A 4CGJA 3NAHA 2XRIA 1QE1A 3ZSZA 4CGHA 3LP1A 3Q8SB 3KKSA 2BGGA 3NKYA 5HROA 3ZT2A 1JXLA 1SUQB 2RDJA 3SQ0A 3TWHA 2DPIA 4J2EA 4WFZA 3VQPA 4QW9A 3T5HA 2YNIB 5KT3A 3VQQA 2HHXA 3AVGA 2HAIA 1KVAA 2FBYA 4WFXA 3HP6A 4CF0A 4ED6A 4KO0B 1TVRB 1KFDA 4ECUA 4NLDA 1B9DA 2VWKA 5KG4A 3V6DB 2YKMB 2HHWA 3FQLA 3T3FA 4RW4A 4CJVA 4FK0A 3QEVA 4CHPA 2ALZA 4DSIA 1VSMA 2C22A 1C1AA 3CIZA 4R8UA 2BE2B 3DLKB 5KT5A 3AO3A 3O3GA 3TVKA 2YNFA 3NGDA 3H4BA 4F4YA 1EX4A 4I9QA 4WYWA 2FVRA 2BRLA 3V9ZA 4QWAA 1U4BA 5HRRA 5J1EB 1KLNA 2E4LA 3P5JA 1S97A 3CG7A 4EZ6A 4H8KA 4YMEA 3QEIA 2D3UA 2E9TA 5KI6A 3PR5B 4HUFA 3CM5A 4J9OA 2ITGA 4DU4A 3KLEA 3K58A 3OYLA 5F8IA 1J54A 4CJKA 4ECXA 4B9VA 4IOBA 1NNDA 1HMVA 3GV8B 3OYMA 3VQCA 3O3HA 3UIQA 3M8QB 4EBEA 1BHLA 1WNSA 5C42A 3P83D 4RUAA 1ITGA 3P1GA 1A5XA 3LAMA 4CIEA 2HHUA 3QZ8A 3AVBA 2AGQA 3AA2A 2J6SA 3ZSXA 2BQRA 1RT4B 1D0EA 3KTQA 1JLBB 1TKZA 4DF4A 3E01B 2BDPA 5HRNA 3KHLA 3MEGA 5CYMA 1UWBA 4MFBA 5JS1A 4F3TA 5HP1A 3IG1A 4W5TA 4JS4A 4DQQA 4QWEA 1WAFA 4EP4A 1KHWA 4FLUA 1ASWA 3RRGA 3MXIA 2E6LA 4NLSA 3OS2A 1TQLA 1L3UA 2Z1GA 5KFUA 3KJVA 2D41A 1BCOA 3RRHA 3VQ4A 2R8GA 3RAQA 3DLBA 3DOLA 4W5RA 1U48A 1NJWA 4ED3A 3MR6A 2D0CA 1BQNB 3AO5A 1KTQA 3HJFA 3ZSOA 2R2UA 1S1TB 4OGEA 2DFFA 1S1UB 3T19A 2W7OA 4FJXA 1IKXA 2G8KA 3K5NA 5I42A 2V9WA 1QS4A 3EPGA 4O0JA 5KT4A 3D28A 1A5WA 1HNVB 4DTPA 2P51A 2R2TA 1SL0A 4B3OB 3C6TB 4LD0A 1HJRA 3IGNA 2X6SA 4RUCA 3I0SA 2WB4A 4FJJA 4GVMA 4BE1A 2HNDA 2V0NA 4CJRA 3QO9B 1DTQB 4FW1A 3RB4A 1RYRA 2FLPA 3KLIB 3NH0A 1WAJA 3CDWA 2HW3A 5KT2A 3LP1B 3AA5X 4Q43A 3M9MB 1DTTA 4ED7A 4BDYA 2OPQA 1CXUA 1RT3B 1T3NA 3DM2A 5L1KA 3JSMA 3PVXA 1XWLA 3LPUA 3KLVA 2Z1JA 4CEBA 2ZKUA 4G3IA 4FJIA 3ALYA 4CK1A 2R7YA 1D9DA 4G1QA 3I5CA 3S3NA 1C0TB 5KFHA 1JXBA 1C0UB 4URSA 3CDEA 2W8LA 1TP7A 2AU0A 3IGVA 3HPGA 3GIIA 3G6XA 3ISNC 4B8CA 5JXSA 2OPPB 3KHHA 3SUQA 4RW4B 1TK5A 4NLOA 3HM9A 4KHSA 4PY5A 4R8UB 3ULDA 4NYFA 4CJSA 4I2PA 3OYJA 4R5PA 3ZSVA 4DL3A 2IOCA 5J2PA 2Y1JA 3ZSWA 1TKTA 1N48A 4ICLB 2ILZA 3BR9A 3GV5B 2KTQA 1EETB 3K59A 4DLGA 1LW0A 3QEPA 4ELVA 3SPYA 1EKEA 3NGIA 5KFXA 3V6KA 3ITHA 4O44A 2R8IA 4QCLA 4EYHB 2XI2A 2RDIA 3KHRA 4ECTA 4CGIA 3KLEB 4EYIB 2VA2A 4DFJA 1N6QA 2G8VA 5EDWA 3HVAA 4GMJB 4K4UA 1LWCA 4BACA 3WNFA 4EP5A 3ZSQA 1N5YA 1X9SA 1RCHA 5C42B 1U45A 1YTUA 3DLEA 1NK4A 1I3AA 4KREA 2HNZA 4MKBA 1UA0A 1WN7A 4CJPA 3QIPB 3CFOA 5K14B 4ECRA 1TKZB 2FLLA 4MKAA 3G0ZA 4CHQA 5CYMB 1Q9YA 1QAJA 4M41A 4Z0UA 3MEDA 4F2SA 1L3VA 2A1SA 1D1UA 2FLNA 5D3GA 4IFVA 3AVAA 3RWUA 1RT1A 2G8UA 4B9TA 3TAGA 3OL6A 2OPRA 1S9GB 3KJVB 2YNHA 3DOKA 4CJTA 3CJ5A 5HBMA 3QETA 4ZMMA 4YR3A 3H08A 2KZMA 2C2EA 1IKWA 4K4TA 3EY1A 4H54A 1IKYA 1IKXB 4M3ZA 1ZBLA 3S3OA 5I42B 3NHGA 1Z25A 3EZ5A 3DRPA 4WE1A 2XGQA 5FRNA 3I0SB 4F4ZA 4CFCA 3MEEA 2KZZA 4DTUA
chains in the Genus database with same CATH superfamily
4PKGA 3TR8A 3UVJB 2HIYA 5C24A 1S6UA 3DOMA 4BR9A 1IKVB 4ZVPB 2AYEA 4KB0A 1JLAA 4KB7A 3IR6B 2EK6A 1HPZA 3PW4A 1C1CA 2WZ1A 3OVNA 4JS5A 1KOOA 2YHAA 3QEWA 3MD3A 3OY9A 1AFJA 1X9JA 1ZOTA 4RJVA 1A0OB 4A59A 1EARA 2XMAA 2F8MA 3AVLA 4DV6F 2A10A 1BQMA 1JLEA 2GW8A 4OLPA 4HEA9 2LSNA 4LF2A 3NXZA 3PJWA 2EKNA 4JI4J 4M3YA 3IFRA 1OY9A 4CZKA 5EX0A 5C7PA 2CJKA 1NB7A 4KHUA 3MOJB 3DKDA 4ZHRA 1BLUA 2FVSA 4QPTA 1UFWA 1RTDA 2DKOB 3C16B 3IRWP 4BR7A 4OHYA 3WNGA 5HL7L 3CPWR 1EKRA 1TKTB 2EBGA 4CHNA 2DNHA 2GNKA 3DYAA 1N36J 4LMZA 2AT1B 3HVRA 3R6LB 4ZP7A 1EIYB 3GU0A 1UP1A 4QIEA 4KBOA 4ISGA 3J7AN 3DMJB 1OMSA 1ZPVA 2X7IA 3D1HA 3FVYA 1LNQA 1N36K 4CF8A 3CPWM 2VBZA 4OJGA 2V8PA 3VQ5A 1WUAA 3HFKA 5KTQA 2WVDA 4LF4K 2X1FA 1N88A 5AQZA 1SQGA 2IJFA 2YNGA 2GMJA 2W40A 1RT5A 3R6MA 2E5LK 3B4DA 4HYKA 3OYNA 3MR5A 4CD3A 2J0QD 3C8YA 4WJBA 1F5AA 1U7LA 3HFZB 3WDOA 4CF2A 3TJAA 4WU3A 1BGXT 1IBLK 1LQ9A 3EVWA 3THWA 2J7UA 3I55S 4ZVQB 3A3PB 3KJFB 2OPRB 4NLQA 2HVDA 3ETOA 2YNHB 2C3YA 3VHQA 1M0SA 2W7PA 3QJJA 3QFWA 2GO9A 4X4TA 1RWNB 5CH7B 4QS7A 3KK1A 4BRAA 2R7OA 5M2PA 1NGCA 2H48B 3CEDA 4F4KA 1FDNA 2BM0A 2HHHJ 2F9JA 3PO5A 1Q82T 4Y1CA 1NGEA 4FLWA 3FSYA 2VD3A 3VOVA 4FWSA 4AM6A 1ZYQA 3I82A 1YI2S 4Y2IA 2ASLA 3IP0A 4GC6A 4DUYJ 2BOPA 3UD4P 3CETA 2DT9A 3BQ0A 3U3YA 3CCWA 2Z30B 1EQ0A 2QLJB 4DPXA 5F3TA 1D4XA 3J81j 5H1SV 2VQFK 1X31C 1RDDA 3SCJE 5HAOA 1PAEX 4E2FB 3AO1A 3KD1E 1C1BB 4PL7A 3H5SA 4KIAA 5D0HA 1ZZNA 4H03B 2H4WB 3U1MA 2BJ1A 1S9EA 3J7ZO 1IR1A 2HHVA 4G9ZA 1YWXA 4DTJA 3L3UA 1TKXA 3OHBA 3K0JA 2KW4A 4Z37A 3FZBA 5F8LA 1N5QA 3Q8RB 3CJ3A 4K4SA 1MWKA 2UXBJ 1JLQA 1S6PA 2WBRA 2MKCA 2B5JB 4NXMF 1TKDA 2HRYA 1P90A 1VSEA 3TAFA 2OGUA 4AHSA 1R0BG 2DY1A 4Y00A 2VDHA 5IT9U 2YHWA 3JQMA 5D0RA 3T5LA 1M1HA 3BEGB 3AJ2A 1GH8A 4CJ4A 2L08A 4DX6A 1YVFA 4YP3A 3MMCA 1QUPA 1XQIA 3PEJA 2ZD1A 3C6UB 4LFBJ 2O67A 2EFQA 1ATSA 1NPRA 5FROA 3L2RA 1CZBA 1V3RA 4P75A 3FGVA 4USWA 4BGAA 1JJ4A 4P7TA 4DTNA 4LFBK 2XQCA 3TAMA 4O5BA 1TL1B 3TUPA 3U27A 4E0DA 4NLBA 1KSPA 2E1CA 3S7RA 1U0HA 5BRFA 2C3OA 1LW2A 2E1PA 1RBVA 3JYTB 5DLFA 4FJNA 1T8EA 3N6MA 1J5EF 4WCEL 2WB1D 5CD4H 4M3XA 3RUBL 1ATRA 1RTJB 1S0MA 3Q22A 4MLEA 3V6HA 2PD1A 5JS2A 2P9IA 3CCQS 2XLKA 2P9KA 4IG0B 5IC4B 3A2FA 1HNIA 2VPXB 2VBXA 1LXJA 1MNEA 4IR1A 2VG6B 1NRKA 4DUZK 4A8FA 1GX5A 2GVDA 3SQGB 5IM0B 4FM0A 1VQKS 3MM8A 4BRMA 5KPZA 3R5GA 2R2SA 4NYZA 3LDSA 1QE1B 4CEOA 1U25A 2FYXA 3P5TL 2RE2A 1IM6A 5J2QA 5AQUA 4YR0A 4B1XB 3CCQN 1IV0A 2KHCA 3JAMO 1JXEA 4M5HA 4ZP9A 3BY5A 5DG9A 2CDRB 1KC8T 4WXOA 1QTNB 3TTFA 4DV6J 4K8XA 3FZLA 1S1VB 3KLGA 2R7UA 1VQKN 1E4GT 1VK0A 4BRCA 2OZMA 3BH7B 3QZ7A 4I67A 2QMUB 2CQ1A 2ZH4A 1C4AA 5D4PA 2IA6A 1RWKB 4DV2F 1E6VB 4DV6K 3G87A 1RP5A 4CH7A 4UT4A 3DHWC 1KLMB 4QQBA 2HK2A 2D1KA 2QKKA 2YNFB 2ZVIA 3OYBA 2MKKA 2ZWHA 1F21A 1HRHA 5MLCQ 3LUYA 3T1AA 2WONA 3R5AA 3A13A 4Q2MA 2ZOFA 4RG8A 3CPEA 3TQEA 1MROA 2X51A 1FJ7A 4YDXA 2W9CB 4FZYA 3AAPA 4TY8B 4B9SA 3HVTA 4E3SA 3WQTA 2BACA 4HTJA 1X4EA 2MGZA 1U49A 3MMAA 2BANA 3O8WA 1JCGA 2IRUA 2GHWA 2CZ4A 2HQCA 3CCTA 1FRKA 1WOPA 1DHMA 3J80U 2YX6A 1M5KC 1VJWA 7FD1A 4JBCA 2A2CA 2ZC4A 3JTPA 3CJ0A 4WP8A 5DO2A 3VGMA 5KFPA 5LMNF 2P9PB 3R1XA 5KFNA 1HW8A 4JP8A 1S6OA 3KLFB 3SCIE 2VHGA 3H5UA 4C48A 2MY8A 3P39A 2D5RA 4MFBB 1NDKA 5B0AA 3EE9A 3R8EA 3CJQA 3H2UB 4F04B 4JHDA 3WBZA 4BRIA 4KFBB 3G82A 4M3WA 3ZTSA 2F8SA 1TV6A 2Z56B 2ZZNA 3D67A 5AQYA 2DEIA 4H5NA 4YOXA 1N33F 2ZOMA 1VQSA 4OJHA 3DOLB 3LH2S 2XS5A 5A8RA 4C98A 4FJKA 2HQGA 2BABA 3H40A 2HBZB 2W2MP 2Z1HA 3OD2A 2BKPA 4Y2CA 5C25B 2OFGX 4JI1F 2FJWA 2RHKA 3VENA 1ZTWA 4YFUA 5HQ8A 1UAXA 4MIWA 2N7YA 2ERRA 2CKWA 5KQ8A 3L4BC 4UW2A 1SL2A 3DXMB 1KCFA 2AHOB 5I3QA 3IKMA 1KQGB 4NLWA 3U02A 2XY6A 3PHEA 1WC1A 1DTTB 1SI9A 2A6MA 3HZ6A 2R7XA 2MQLA 3L6QA 1FE4A 1TL4A 2YNIA 1FT8A 4ATNA 4U9RA 4LFAJ 2MHNA 2F4VF 4CIFA 4NCGA 2GCFA 5J2NB 1WACA 2KT2A 1Q8BA 4AL6A 1FDBA 1RSCA 3J7YP 4IFYB 1VHFA 1KVJA 3DLRA 3UD5A 2HBRB 4PZVA 3SI8A 3FLCO 3H90A 2JWLA 1RI7A 3WT0A 3MXMA 2VWJA 3HTVA 1J27A 2V67A 3K0SA 1FRIA 1OQ3A 4ES2A 5DG8A 2KKHA 1BDGA 3DLKA 4ECYA 3TTCA 2HSTA 1L5UA 4CBWA 1O51A 1BA1A 1S4FA 2DGOA 3H2LA 3GV7B 3EN9A 2FJXA 3KK2A 4B9LA 4R5PB 3CCUS 3AVCA 3DLJA 1LFWA 1CLQA 3BDPA 5DZ7A 1WSFA 2ZDPA 4QIGA 2OYQA 3VAGA 4A8QA 3CMAN 4RTFD 3NG8A 1RHRB 5KFGA 1LW0B 3H5XA 5CZ1A 3AVHA 3SMSA 4KGZB 2DGUA 2UUTA 1KONA 4HCBA 1WI6A 3ZTRA 2DNRA 4NXMK 4K59A 4UOCA 3T9NA 2IDOA 1GX6A 4TLQA 3GOIA 1LWCB 1ZTTA 5BXIA 3PV8A 1IQTA 4Y0FA 2CRLA 3FZKA 4DUTA 4J8FA 3FZMA 2HGMA 1V3SA 1RT2A 2FC0A 4M5DB 1H74A 2BYCA 4WIIA 1RTIA 2VG5A 1U04A 2LEBA 4RX6A 4B3SF 2QLXA 1FDAA 2NRXA 1FX2A 3PX6A 1VQ5N 3NMAA 4IG3A 3A0IX 2WK4A 1M5VC 3NH1A 2L9NA 2W24A 3PW0A 3CT9A 3EWGA 4KJIA 3EKSA 2BA9A 4B1UB 3R3TA 3HSGA 1AZSA 4IH5A 1EWQA 3WC2A 5E41A 2KHOA 3L2UA 4KGMA 4OI0A 3H42A 4L76A 4DKWA 2IBOA 4N47A 4OYIA 4FK2A 3CO9A 3HVWA 3NS6A 1J5EK 2R42A 1YJTA 3MCAB 2V4QA 3TSUA 4B3OA 3MX2A 2IM2A 1BI4A 2V4JA 4ZLJA 3D0IE 1X4HA 2B9EA 3FEXB 1K44A 1G2EA 2VPYB 4P71A 1KN6A 4IBNA 2RQCA 3OYFA 3DOMB 2PFUA 4WFBQ 4F3QA 2KVIA 4MTPA 2NYIA 1RAJA 2E44A 3SSSA 4BR4A 3SDEA 5B09A 1HPZB 1VLOA 3KDNA 5C5JA 4KHMA 1YITS 2HS4A 3JAMY 4BQZA 3RBZA 2W25A 3T5JA 5KFMA 4TQRA 4RO0A 3OVSA 3K57A 1NKBA 3K8WA 4QWDA 3AVFA 4DV2J 1EX8A 1C0TA 4DSJA 2KRBA 4IR9A 1M5HA 4C23A 4V19X 3RGIA 1BQMB 3HK2A 2Y1LB 4X62J 1PCAA 4LQ3A 3SAFA 4B3MF 4DV2K 2FQQB 1NUEA 4GNIA 4Y34A 3UFCX 1YITN 2DBBA 3M6UA 3EZOA 5BPNA 3CJ4A 4IRDA 1HKGA 4A2BA 3R5DA 4ZHRB 4PCQA 2XNQA 1RTDB 1TFWA 4DTOA 3BDEA 2K7JA 3MUTP 4PHTX 1D8YA 4KHRA 2H3GX 5KFZA 1EETA 4GKKJ 1HPMA 3CHWA 1RAEB 3MM5A 1QM9A 2CGJA 4HR2A 5C2CA 5EGYA 3T1YJ 3N28A 4BWJA 2JVRA 3IM9A 5ETSA 2G8IA 3IFEA 3DRSB 3OL8A 4F7VA 3RMDA 4YHHF 2YQ1A 1NJYA 1T94A 2ZF5O 2B51A 3TAQA 2NXEA 3WZ0A 4WTYA 3DC2A 2AKWB 3GIRA 3FSXA 4NLXA 1BWVA 2QA4G 2AX1A 2B4VA 2ZHAA 3SUOA 3X1LB 1WSIA 5EOYA 2YNGB 2FVQA 2F40A 4O3OA 4U95A 2COLA 2Z2YB 2RVJA 4Z4HA 4PWUA 4B1VA 3QESA 3A5NC 2FSJA 2FBTA 1J5OB 2CPFA 1IN0A 5HRSA 2HS0A 2DR5A 1F60B 3CDBA 4Q8FA 2KLAA 5AT1B 2FTRA 2CAJA 4PPZA 3LGMA 3THWB 3HBTA 3JTOA 1K1SA 1N33K 4MK7A 4ECQA 5DGBA 1F3FA 4KRWA 3KUEA 2C2KB 3CJKB 4M63C 2R7QA 4RUHA 2AGOA 3QWUA 4N5SA 2OEJA 3OSNA 2YPYA 2OSRA 5ETTA 3KK1B 1RAHB 2QL7B 3I6PA 4HCCA 4CGFA 4Y3CA 4JI1K 4OV6A 3F56A 1WG1A 2XMUA 2Q3SA 5KG1A 1VSFA 1HYSB 3HD2A 3M8PA 2F5GA 5HVGA 4ZLLA 4ZCIA 2GC8A 1SKSA 1G15A 1SJFA 2YWEA 2BE9B 3LP2B 3V9SA 3VGUA 3KG4A 2YX7A 2HSEB 1N8RT 3NCPA 3MTKA 3PSFA 2RQKA 2W7AA 2H54B 1ZH5A 5ADXH 3K8VA 2EFVA 1S1WB 4PXCA 4USKA 1Y9OA 2F4VK 2IRXA 4NA1A 2V94A 2LA4A 1XNQF 4ID5B 1AB8A 5I3UA 3ZT1A 4HTUA 2Z1IA 4ZPVR 5AQSA 5KFBA 1RLDA 2AP1A 4DL2A 4K50A 4KHQA 2MQQA 2E5IA 2VFUA 2J9DA 2ZEJA 3ISZA 4W5QA 2FPHX 3LP0A 5F8HA 5M1NA 3QNNA 5CYJA 4WQ5A 3X3UA 2ZE2A 2B56A 2GIQA 4PA1A 4FSVA 4CEQA 3T1HF 4J9KA 4HHTA 4ECVA 5C2FA 1K73T 4NCAA 1Y10A 5F3ZA 3FK4A 4S0MA 4LSZB 3KWIA 2HVIA 2YKAA 2A18A 1VISA 3D6MB 4FWNA 1T05A 4MMOA 1WWHA 2MJNA 1I5OB 4GMKA 4AXJA 1WUUA 3CCJS 2OD6A 4FO0A 2RS8A 3TNVA 1FRMA 4FVCA 1NSPA 3MMCB 4OZNA 4CGDA 2PMHA 2VWBA 4CZHA 1OH6A 1RT7A 2ZD1B 1X5SA 3MCNA 2EW9A 1V9OA 5ITHA 5H9EK 1MA9B 2VODA 4CLPA 4B3SK 1MU2B 3TAMB 2K8GA 4QU6A 3CCJN 2HBJA 1U0HB 1M90T 3NP5A 1XMQJ 4TLRA 2HGNA 2YJEA 3SV4A 1N0UA 4KRFA 5KT7A 3RSEA 1Y5LB 4IKAA 4QS9A 2DTUA 4OVLA 2G2OA 2P9IB 2HK3A 4FJ9A 5JVHQ 5CCLA 1DARA 1HNIB 5CA5A 5KGXA 4P2FA 4OL8A 5IWAF 3VF2A 2A6OA 4TKTA 4OZLA 2UUWA 2IHR1 1BXNA 3CIPA 3AA4A 2Z58B 3MGJA 3MM8B 2IYGA 4A2AA 3CGIA 1I94F 1X9MA 4DN0A 4HVZA 2D3O1 3NFAA 1YSJA 3GDQA 2EBEA 4WFBL 5T14A 3VQ6A 3B6BA 3CD7A 2WC9A 3QIOA 1RWVB 2PFFB 3PIOL 2DNNA 3FZFA 4L3QA 2IFXA 4J9MA 2ZWPA 1IJJA 3VQTA 1FDDA 3M2VA 4FJ8A 3CXCR 4BG8A 4XEIA 4EBCA 3KJNB 3QQCD 4CO2A 3A8KA 4I6YA 3IBWA 1RADB 4C97A 4C8NA 4X64J 2A0FB 3QJLA 3OTDA 5FLXO 2RSQA 4BR5A 2LCWA 3OW2R 1Q79A 3RAXA 1LK7A 4B3MK 4DR2F 4ILLA 1U8WA 2NPIA 4G6VB 1RGVA 2PYLA 5B0EA 1R8HA 3UB5A 2X1AA 4DS5A 2I1RA 3CCMS 4YDDB 2MGZB 1CJTB 3BP8A 4A5BA 3GJSB 3MMAB 2RQ4A 2W2PP 2BANB 4DV4F 3P4UB 1QQOA 3THXB 4FOIA 2P9LB 3N5BA 2R7TA 1ZBTA 1NGAA 3A1YG 3V9WA 2YKNB 2WVEA 3C95A 3ILOA 4K5RA 4CLFA 4CLUA 2HZCA 2UXCF 1ZAXA 2D0OA 2QMWA 3U3GA 4YHHK 3CCMN 4RNOA 3CSKA 2H5JB 5IV3A 1F0XA 3GL1A 4TU9A 2ZBIA 3E01A 2FJDB 3BGRA 3D9BA 3BSAA 4IDKB 2ASOA 1HA1A 2DNOA 3G82B 4KR0B 1WOQA 4WPAA 4DR6F 4TVAB 2ZNYA 1VS3A 3NWRA 1TV6B 3LWMA 3GIMA 3SQOP 2I8EA 2E1MC 4FOEA 3TZYA 5DQGA 1DRZA 2AEJA 3CQXA 3CUNA 2B9YA 2OANA 2XEXA 2MQPA 2ZFHA 4NRUA 2DEJA 2JEFA 4LBHA 3PEHA 4M45A 1R89A 2BW2A 2Q79A 2RU3A 4YQWA 1PO6A 2YXLA 3EGWB 4J7CA 2NNWA 5AQGA 3M1FA 2YWFA 4FJ7A 3D1QA 4OI4A 3TZWA 1HR0F 2KB2A 3L9ZA 2XHBA 4I7FA 3QO9A 3HM8A 1DTQA 3CTRA 4IH7A 4C0BA 2JJ4D 2HFUA 1UMJA 1M5OC 3QSIA 4HUEA 4A8WA 3PXGa 2XRIA 4ZLPA 1UVKA 3Q23A 1J6ZA 2BGGA 3NKYA 5HROA 1FW6A 2DPIA 2NPFA 3C15A 3T5HA 2YNIB 5KT3A 1BY9A 2HHXA 3AVGA 2ZUGA 4L3NA 4KC5A 1RCXB 3E2EA 3HZEA 2HAIA 1XNQJ 4LVNP 4CYUB 2ZHBA 1KVAA 1OWXA 3GG4A 3HP6A 3OA9A 4X4VA 3F5TA 1KFDA 4NLDA 2VWKA 3THYA 2KH9A 5KG4A 3H7HB 3VF4A 1XNQK 4FPBA 4RW4A 3QEVA 2ALZA 2EI5A 2JWKA 1AUSL 1F5BA 4CZLA 3DLKB 1IBKJ 2GX8A 3US5A 4I9QA 1H98A 3AY0A 3AOCA 5LMUF 3QRPA 4F02A 1A7GE 4IOCQ 1S97A 3CG7A 3QEIA 2PGCA 1XNRJ 2C3PA 5CHIA 3FZHA 1W2BR 2QN6B 1VQLS 4I68A 3FRYA 2NRZA 4RWTA 5LJ3Y 3A12A 1J54A 1RU2A 3TYTA 2NZTA 4H0OA 1HMVA 3GV8B 2PEBA 3OYMA 4O8UA 3M8ZA 1T3OA 4QR2A 1WNSA 4OHWA 1VDHA 4PEOA 4H4KA 5LSLA 1X0PA 5AR0A 3QZ8A 3AVBA 3AA2A 5BYQA 2J6SA 1VQLN 2O8BA 1RDUA 1RT4B 3HRGA 4DF4A 3D6HB 3MCOA 1HL6A 1UWBA 2G2YA 4XDCA 1X4CA 5JS1A 2RD5C 4F3TA 2WTUA 4DQQA 2X3DA 4YB5A 2JOQA 1GMUA 4CTAA 1KD1O 2PIIA 3OS2A 2MKHA 5KFUA 3RRHA 3BEXA 3RAQA 1RWPB 2RQMA 3ZZZA 3IMQJ 1KTQA 3ZSOA 2R2UA 2DFFA 4FJXA 5JVHL 1U1QA 2ZBQA 2HBLA 1GLFO 3LTOA 3W5XA 5I42A 5KT4A 4JNEA 1OKJA 1HNVB 1SBRA 4B3OB 1S57A 2BXJA 4RUCA 2VOOA 1KQSR 2V4JB 2EK1A 5EN1A 1RAIB 2J76E 4B3RF 1TL7A 2I38A 4BVPA 1I94K 3RB4A 4QZVB 3ATVA 1WAJA 2HW3A 1VYAA 3VWSA 4Q43A 4ED7A 1T3NA 1YG0A 5L1KA 3PVXA 1XWLA 2Z1JA 3MXHP 3W7BA 1HW9A 2ZKUA 3VEZA 2G2ZA 4CK1A 3I5CA 5E33A 1C0TB 1LK5A 2OAUA 4OHVA 5CZVA 4ALZA 3ZZPA 1TP7A 3MI7X 3Q8VA 1OH7A 5IQQA 4B8CA 3ZETA 3D0GE 3DXBA 5AQOA 4BC5A 3SUQA 4A46A 4F9OA 5FLXY 4PY5A 3ULDA 1S72S 2DO0A 2EWSA 3I9ZA 2YTCA 3MAAA 3DDNA 4DV5F 4I2PA 3OYJA 1CJVA 5JLHA 4DR2K 2E7VA 2BUPA 4FXVA 3T69A 5J2PA 1UVNA 1S22A 1Q16B 2NLWA 1N48A 2MKYA 3WXMB 4EUVA 3R8YA 5E84A 3GV5B 4B9QA 1EETB 3Q89A 1HD1A 2MTLA 3QEPA 1U1NA 1EKEA 1QJHA 3ITHA 4OPAA 4O44A 4MT1A 4NASA 2R8IA 2DJWA 4QCLA 4DV4K 1T9XA 3LDQA 1HWKA 2MSTA 2XI2A 3KHRA 4ECTA 2DTJA 1MW7A 2VA2A 4YUDA 3TPQA 4W4MA 1NPKA 1KDNA 3ULHA 4GMJB 4K4UA 3JB9k 2ACMA 2OEKA 1FNMA 3D2FA 3PIPQ 5F0WA 2UXCK 2DGWA 4IO1A 3M7VA 3EICA 1RCHA 5DM7Q 5C42B 5AQWA 4F26A 2NRHA 3R5BA 2D4WA 2WW4A 4XH4A 1NK4A 1I3AA 4KREA 4IXCA 2K1RA 4MKBA 2AA4A 2KDOA 1ZM3A 3CFOA 3R2DJ 3THTA 3VALA 7AT1B 4BS2A 5KPTA 3MMBA 4MKAA 4PG8A 1WDTA 1Q9YA 2M9KA 3VEWA 4Z0UA 2BOAA 4DR6K 4F2SA 4IFVA 4ZIWA 3RWUA 2G8UA 1YZ7A 2RU9A 5HBMA 1FTRA 2DGVA 4ZMMA 1Q7YT 1O13A 2KZMA 3H08A 2ZH5A 3DXKB 4K4TA 2JL9A 4CI0B 4OYAA 3AB4B 6FDRA 1IKXB 4JKGA 3P38A 3O6WA 2G13A 2ZJRL 5F0UA 3DRPA 4WE1A 2XGQA 2GAGC 5DS7A 3WX4A 3I0SB 5FRNA 3A8IA 1CJKA 4UQGA 3SSQA 1UW9A 4A8KA 2IC3A 4CZJA 1PBAA 3FJ2A 4OI6A 2LXFA 5IXUA 2VFVA 1NBEB 1P9QC 2ZZMA 2IS3A 3M9OB 2PEHA 3C66A 2XG8A 1VAZA 1QSYA 2J6UA 2V8HA 2DFEA 5F2RA 3MOZA 1IM4A 2QZ8A 4FWQA 5DM6L 1EO1A 1YTYA 3K7RA 3B82A 1KVKA 4NI2A 2VG7A 3ULEA 4KH6A 2HQDA 4E7IA 3KUGA 1VQYA 5IT9O 3NVKA 2XO7A 2MY7A 5AFUA 2ZJQQ 2IBKA 3R6GB 4ZVSB 2Q6CA 3R7BB 4BRNA 4KAZA 4M5IA 5IZHA 1WG4A 2PO4A 5KQDA 5H1SQ 1S1XA 4O3PA 2CIMA 3QICA 2AQ4A 5LMUK 2FJAB 4IOCL 4DEZA 4L74A 4CJFA 4H0YB 3CJSA 2MJUA 5J1PA 3UKRA 2P8IA 4AM7A 4PG5A 4OYBA 4AQYF 1T05B 4I1TA 4H4OA 5L8RC 5KG2A 3K89A 1C0GA 1RBLA 4FP9A 1KFSA 3V4IA 3L2VA 1RT7B 4CH0S 1HBUB 4DHYA 1S76D 3M1VB 1KRPA 4LY7A 4P10A 3PX4A 1JJ2R 3J7A1 2E2OA 1YJUA 3GYNA 5SWMA 1K8AO 4F0MA 3FGUA 4JV0A 1URNA 5HN0A 3EM1A 3AVKA 4DHVA 1N5TA 3MXJA 3HDSA 4RPFA 2FVPA 2YQ3A 4K0KF 2M5YA 3BJYA 1FJGF 5BR8J 4K4XA 1HUXA 3OTOF 5D3GB 5B8HA 2Q0RA 3F44A 4LH5A 5KT6A 5C15A 5LOQA 4ZVUB 2ZH7A 3DOKB 1HIYA 1TUYA 2YHXA 4O55A 3E51A 1Y4ZB 1QAYA 2W8KA 1HNWF 3AVMA 4M95A 4TU8A 2YWWA 5GIOA 3AGRA 1B7YB 3VAIA 2MZJA 1HWLA 1SB6A 5KG3A 2JFDA 3DU5A 2IM0A 3VCDA 4ZITA 1BISA 2G8FA 3W61A 2X3GA 4B3RK 4M3UA 1C0FA 1JLFB 4ZVTB 5E26A 3LQVA 5IFMA 3KMSA 3V1OA 1E6YB 4ZJQA 4DX8H 3DRYA 1G6BA 4ED4A 5DK5A 5AXMA 4WFAQ 4NO7A 5ETRA 3LZIA 3ICLA 2YX1A 4J2DA 4WKYA 5JUMA 2V7YA 2CQ2A 4L3KA 3W9HA 3CJAA 3T5KA 3ET6B 4CGGA 4X66F 1SQKA 4C2MA 3I8BA 3QBWA 1VRTA 5KOXA 2HWIA 3J80O 4FWLA 1ELOA 1FKPB 4A62A 3P45B 3CJ7A 4DV5J 4LIWA 4KHPJ 4CK2A 4DB3A 2DRDA 2JEGA 1BCMA 1NK9A 1EZZB 3HSZA 4EHTA 3Q83A 3V81A 3OJUA 2Y8YA 4DV5K 1TR0A 3OR1B 1NHVA 4OHXA 2E2NA 1RJJA 4A61A 5DMRA 3O9TA 5GMEA 1GOCA 4FS1A 2BJ7A 2UVRA 1YT3A 1BL3A 3ZO7A 3CD6S 1QDUB 2ZM6J 4C6AA 2CFXA 5KFVA 2G9OA 5JLFA 2JHEA 3IRXA 2O1PA 2UU9J 2VUGA 2UUAJ 1TELA 4J9PA 3C7NB 4JI2J 2WVFA 1QSSA 4ANEA 3PIPL 2ZM6K 2YKOA 4KE5A 3AQOA 4OLBA 1SH3A 3CCEN 4OKKA 5DM7L 4A8XA 2UXDF 3MPVA 2OA8A 1LWFA 1P27B 3BGRB 3K5LA 4DV7J 4CD1A 1R0AA 5F9LA 3QDKA 3CD6N 3DI6B 3ZX0A 3HSTB 2VFTA 3S3MA 4N56A 4LF5J 1UA1A 4UOGA 1WBDA 3EVMA 3RTVA 2QEXN 2B4OA 4CESA 2V50A 3KWGA 4FLXA 2LLZA 4E1NA 2MYFA 4MIBA 4Z4CA 4BY9C 3TAEA 3RMBA 3DLGB 5EWGA 1OYEA 4FNHA 2ITMA 3TOQA 4KTWA 3OFHA 4QR1A 4CM2A 3KG0A 1RAGB 3CJCA 1B4SA 4FS2A 4ED8A 4WQ4C 1WD6A 2FD2A 1SH0A 4I7FB 2LYVA 5LJWA 1QZ5A 3IAS9 1HQUA 2GGPA 5KFKA 1DQ8A 2XNRA 2ZUAA 5EX3A 4C8KA 3OL7A 4DFMA 3DAWA 1UEKA 4FXWA 3B78A 2H51B 1QTMA 1NGIA 5HROB 2GFFA 4U7BA 2ADCA 1RABB 1T9VA 3C15B 4OIXA 1WEZA 3ILJA 4JYAF 2V8VA 2JDJA 4EFHA 2JZ5A 1KHVA 2LQ8A 2V2VA 3SQ4A 1LWEB 1QD1A 2QXLA 3OFFA 1VRUA 4RW9A 1MDUB 3O9UA 2F65A 4DSLA 3SNNA 1HARA 2QSFA 4XH1A 1NDLA 4BLGA 2ZJQL 5IT9Y 2V4RA 4DV1F 3ZEUA 5E3PA 1RT6A 1CS4B 3RU0A 3R27A 1GOAA 1BUXA 3L4QA 1DZ5A 2CQ0A 2QLBB 1N34F 1HKBA 3I4HX 4BC3A 2CQ3A 4Z94A 5LJ5Y 1TL3A 1QLNA 1C2PA 2G4BA 1W2IA 2M0GB 5HANA 3DLHA 3PRDA 2XMWA 3LP3A 2O8DA 4EK2A 4KH0B 4JV5F 3FQKA 3HPOA 4C7QA 4AQYK 1M1KT 4QS8A 4Z7CA 3HFVA 4FWPA 4OKEA 3CM6A 4OYZA 1HMVB 2QE5A 3JQJA 2V7ZA 4A8YA 4F8RA 4ZLNA 1P1LA 2IM1A 2ZVSA 3V5RA 2H9ZA 4BDPA 3C14B 1JKHA 3RBEA 4FJMA 2O8BB 2I9SA 3V1RA 3N6NA 3G6YA 4HT5A 1MG7A 4LSNA 2FJVA 1IWGA 2E2PA 1JLCB 4A5AA 3I5BA 2KQ2A 1UWBB 4KGKA 3UDEA 3K9JA 1NZ8A 4JI5F 3H46O 3OTOJ 2BE7D 4DV0J 1KQFB 1Q86O 4Y65A 4Q45A 4K0KK 4FLZA 3GR0A 1NO8A 4PKIA 2NRTA 5AXKA 1FJGK 2RHSB 2HHQA 4HI1A 2J9CA 3OTOK 3E1YA 4DV0K 2D74B 2GUPA 1IR0A 5GVQA 3RYLA 3VVUA 1WG5A 3ZTQA 1TUUA 4FK4A 4RCHA 4ID8A 3FMWA 4ZVRB 1HNWK 5F9NA 2KRRA 4FF4A 4NZ7A 4DG1A 2BVZA 1TL7B 3J81U 4YY3J 5GAHU 2J0WA 4P6QA 1DKGD 4CWBA 3VAMA 3ENOA 2HZAA 2MQ8A 1EB0A 3CCVS 4DMNA 4NX9A 2CPHA 4NE9C 2W6LA 3KUHA 1W7WA 4Y28C 2LQJA 1RB0A 5AQTA 5HMXA 4LRFA 3IR5B 2X6NA 3NS5A 3AVNA 5AQKA 2NXJA 2VASA 4X66J 4AF1A 4CZCA 2FHJD 3CJRA 3AA3A 1GT8A 1VC0A 4KO0A 3D0HE 4B3TF 4BRGA 1WF0A 3AJ1A 3MUMP 3OBWA 3W64A 3CCVN 2GUIA 2LP4A 4X2BA 4E7LA 1H38A 2ZKTA 2ZJPQ 4X66K 4WYLA 1HNZF 2EX3A 2NR0A 1NKCA 3ADAC 2VF3A 3J80Y 1HHSA 2BE2A 2E8AA 4JI6F 4DR3F 5HRPA 3CWJA 2QWPA 3OHAA 1SV5A 2ZOGA 3QEXA 4YOTA 2DIVA 5J2PB 4CT9A 4P72A 1SJ1A 2YWGA 1E3MA 4E1JA 2WSCC 4RLEA 4O44B 1D5AA 3DRRA 2BUNA 1REVB 5GIPA 5E3CA 1L3SA 1FXLA 4C8MA 3GFZA 5HO4A 2D9PA 4JN4A 2RS2A 1R31A 3M9NB 3GSIA 2HWTA 4DWIA 3NNHA 2B4UA 3ZZYA 1Q5YA 1W26A 4AILC 5KG7A 3BYRA 2QW9A 2YKPA 1SC4B 2DNKA 3W66A 3D2FB 4DR4F 3OBYA 3IAM9 4H0XB 2HF4A 2HWHA 3P49B 4X84A 2W42A 4HUGA 1IBMJ 1FTCA 3VQSA 4OI1A 4ZN3A 1KBRA 4OYXA 3ISND 1WI8A 3BF4A 2UUBJ 2FJEB 2UXDK 2AWZA 1JL2A 2DGSA 1Y11A 3MM9B 1JLBA 2KFNA 4HWIA 3THVA 4UZCA 1UEVA 4M7YA 1ZBSA 2VIHA 1AXQA 4RL1A 3OYDA 2VBWA 1ZM9A 3PYEA 4ID1A 4IFVB 4NA3A 2XSJA 4IUFA 4NXNF 3I0RA 2MZRA 3NGYA 3CJ2A 4LSLA 4LF6J 2XO6A 3SQ2A 4F2RA 1IXKA 2GTDA 4O3QA 1R0CB 1S5JA 4WP9A 1S1UA 4JI7F 2KFYA 1NAQA 3UDCA 3O5TB 4HDHA 4JKGB 1HQEA 4ETZA 3N01A 2F96A 5AJ3F 3BGOP 1ICEB 3DHXA 2E9RX 3J7AP 3C6TA 4RNMA 3VESA 3SZ2A 3DRPB 1VQ9S 4JRPA 2D0AA 4LF1A 3UD3P 1JX4A 2RRNA 3VERA 3MMJA 4AD6A 4CDIA 4HTIA 2X78A 3G86A 3D3CJ 1X5OA 4X65F 4RUBA 2J0SD 3KLIA 2B7CB 3GBTA 4K8ZA 2NZ4A 2O01C 1Q81T 1VQNS 4YB6A 1BIZA 3TX0A 3U4LA 1W9HA 3M6WA 3R5CA 3H20A 1FRHA 2QYCA 2AGPA 2L9WA 2E7WA 1P8GA 4DU7A 2KFZA 4J90A 1RXOB 4FNIA 1VQMS 1K6YA 4KPCA 1ASVA 2MKSA 5F1XA 4BC7A 4CIOA 3LANA 1Q95G 2ZGYA 4YB1P 1XR5A 3KG1A 4NEYA 1C0UA 5HLFA 4FYYB 4YR2A 1QZ6A 4A57A 3MR2A 4I6WA 2Y9HA 1U2RA 2IVOA 2OPPA 1X4GA 3H1QA 5HI7A 4J5OA 4ZP6A 1KAXA 2RPIA 2DR9A 5AE1A 4DV1K 1N34J 1D3WA 4U7UK 1FKOA 3P96A 4CLYA 4K25A 3QLHA 2DO4A 4NRTA 4NLTA 4LIRA 3GTYX 4TYAA 4DQSA 1AFIA 1FD2A 3UNGC 4ICLA 4JI4F 1ZXOA 2Z0GA 1N34K 1EP4B 4YNQA 1GXLA 3EKUA 4DOZA 4IFEA 4B9MA 4ZS6A 3T6JA 4KTZA 1FCAA 2LMIA 2ZH8A 2B9WA 3FFIB 1TK8A 4JV5K 1KVBA 2W41A 4CEAA 2CNKB 3OR2A 1S6QB 4GY2B 1N36F 2Y0BB 3NRBA 2CPEA 4RW6B 3V4IB 2OD4A 1WB9A 1HI0P 4KKOA 2C2DA 3AY9A 3KLHB 3EGVA 3M2RA 3KWMA 3UR3C 1R59O 4F4WA 4AL7A 3LF0A 3IO1A 4XPEA 1S7HA 5KFIA 4E8UA 3B6OA 5B08A 1XI1A 1U8SA 2MQNA 4LREA 3SJHA 3E9OA 4J9NA 1RK8A 1EHWA 3BBFA 4J2AA 1UEUA 1HHTP 3WC0A 4BREA 1UWAA 3JSBA 2Q97A 3VMFB 1ZBUA 4DL6A 1RA6A 3CDUA 1WLJA 3TX8A 1S9GA 2FZCB 3EVOA 3HOTA 3G8QA 4DZ6A 4DQIA 4FJLA 3OBIA 3EGNA 3BO4A 1QHTA 5F0XA 3QNOA 4I2QA 2DNLA 3PCOB 2CPIA 4F3OA 4ZKAA 3V6JA 2CNLB 4ISEA 3DLLQ 3D2EA 3CJ1A 1RACB 3BGUA 4AH9A 1Y0HA 3ENAA 4ZVOB 3DNCA 3MECA 3Q8PB 2HHHF 1H7WA 2UUCJ 3D0PA 5G4DA 4BRDA 2E88A 1JLGA 2E5JA 5CYQB 2HVHA 2ZBRA 4PQUB 4ILHA 5IC6B 3MF5A 4DUYF 1VSHA 3FEYB 2PBDA 5SZTA 5T7BA 1XHXA 3NGTA 4K4WA 4FF2A 4NLCA 4JV1A 3R9LA 3WEEA 1GMWA 2GHVC 1HNZJ 1MMLA 1N5VA 2WTFA 4URGA 4NLRA 2RJZA 4B3TK 4NLGA 4JI6J 3BQ1A 3VZIA 2ZJPL 1RWUA 2BRKA 1PAUB 1QVFR 2OELA 1OPIA 4NL5A 4HHUA 4N76A 4MYTA 3OYHA 1HNZK 4DSEA 2YWKA 1WSGA 1BO5O 3FKBA 1R6VA 4B1YB 4JI6K 3BBBA 4DR3K 2H65B 4NEZA 3L7PA 3WUHA 3KIOA 3RB6A 4KSEB 3CQ8A 2JGUA 4DQRA 1QQCA 4ES3A 1SAZA 2JEJA 1PJ6A 2XYGB 3MM7A 2QWNA 1QVFM 3I87A 1GTEA 3A3OB 2HMIB 4MKVA 3KVGA 4CBUA 1FRXA 3LA0A 4DR4J 2DCLA 4QWCA 3JSYA 2WOMA 5ETNA 1WSJA 3RR7A 2UXBF 1HYZA 4ZTFA 4HKQA 2GELA 3SXLA 3Q8QB 2OFHX 3C6HA 1C6VA 1S7IA 1D9FA 2RF2B 3LWLA 4DR4K 1T9YA 3IDHA 4CJUA 1U02A 2BJ8A 2YKQA 1LWFB 2GJIA 3MAHA 1RAFB 2HB5A 1R0AB 1U47A 2WCXA 1YIJS 3HO1A 1GLCG 2CVEA 4C1NK 3KMQA 4M3TA 2KM8C 1YHQS 2MQMA 1VGYA 5LSOA 3W3DA 3O8MA 1EQMA 4DF8A 4NXNJ 3OUYA 4TYBA 1NK7A 1FD8A 4CQ1A 3TUZC 4QR0A 2V34A 5L38A 2JRSA 1DLOB 4M5LA 4JI7J 2MMYA 2F63A 3J8AA 2MDAA 3B8AX 2GVZA 1TMJA 4U8VA 4BRLA 1HBOA 2F7VA 4NXNK 1JJCB 3P8BB 2V51B 1RTHA 1Y00A 3W62A 3PX0A 1YHQN 4JKBA 4JI7K 1VK3A 4K4YA 2GGPB 5AJ3K 4MIAA 2QO3A 2ACYA 4ED1A 3NAIA 2QC3A 2MZSA 3VGLA 4N7TA 2LEPA 3QMLA 3MWBA 3ASMA 4BROA 1ROFA 3QGIA 1X60A 1FVQA 2RN2A 1MWQA 3ONQA 4KH5A 1SUQA 4GKJJ 4Z7YA 2JLEA 3PKMA 4FWOA 1Q82O 4OZJA 5B0FA 4D3HA 4X65K 2AJ2A 5LL6d 5GAHI 3HHNB 1U6BA 1LAVA 2O5DA 1AA1B 2UVWA 2ATCB 3VQBA 2X1BA 1FNXH 3D5MA 3JSRA 4W5OA 1K8KA 1EXQA 1QSLA 2W9AA 4BDZA 2O8EA 4RR5A 1HYVA 4IQXA 1RHUB 3K5PA 4P74A 3BPSP 4USIA 2H5EA 2B8PA 2P6TA 2AJ0A 3GSDA 3ZEUB 4PWDB 2V2KA 3BGFA 1RT6B 4HACA 3BZQA 4CJQA 3NGSA 4WP3A 2HLUA 4OJ1A 3TUIC 1S4EA 4DBQA 1U1LA 1S59A 2X74A 2XY5A 3FR0A 4FJGA 3CC7S 3ZNUA 1R6YA 1NJIT 4DCJB 1TL3B 1XHZA 3MMVA 2XTJP 4KV8B 4FLYA 1V6HA 4WYBA 3HHKA 4JI4K 2O8DB 3DXSX 4BHQA 3ZZTA 4H4MB 4RWXA 5KFCA 4GV6A 3GILA 4P73A 4DR1J 3W3SA 4I56A 1SQEA 2HGLA 4FPAA 2QWRA 3O4QA 2CPZA 4YOWA 3CC7N 4DFKA 1GLLO 2DRAA 1ZA2B 4RW8B 2UZAA 2VPZB 2B3TB 5CZ2A 4I69A 1JKHB 5A6PA 4YEAA 1I1GA 4RZRA 4ZPBA 2A42A 3EZUA 5DQHA 1G1XA 1QAXA 1OPZA 4KHWA 2ATQA 4M5GA 2VQEJ 2KM8B 3D2WA 1Q8IA 2I5JA 4ZPWR 4DPOA 1VSIA 1NK0A 2Y0SD 3VTHA 2XYPB 2FGCA 5KFLA 3N0VA 4X4SA 1KNZA 2E20A 3QBXA 4E98A 4UQTA 2XCPA 2DGQA 4NMXA 1RWMB 4DU3A 5GMDA 1QY7A 2BJ9A 1GNKA 1PC5A 3OLBA 1S1TA 2NYHA 5DG7A 1Z1ZA 3NGZA 4JKEA 3BKTA 4EO8A 4CEZA 2XMVA 1KP6A 4FLTA 3OSPA 2KL8A 3BREA 2QL9B 3BKFA 3EL2A 4DCHA 3FBCA 2HFVA 4QYRA 2P9NA 3JQKA 1YAGA 2G0JA 5BN9A 1BIUA 4OPKA 3M8WA 1RA7A 4K43A 2YX4A 3DLLL 2VICA 2QJ3A 2ROPA 2ILYA 2HHPA 1HBMA 1VOMA 3ZSZA 4CGHA 3LP1A 1Y3KA 3FBBA 2GEMA 5DJBA 2VCPA 2DH7A 4PXBA 4WFZA 2HHHK 4QW9A 4GVBA 4ZOSA 1U2VB 2CUYA 3EXYA 2L3MA 2VC0A 3AGKA 2FBYA 2OHDA 2UP1A 5B0DA 4KO0B 1NZAA 4DUYK 5BRDA 1R43A 2J8SA 3Q7BA 2D0PA 4I6MA 4H0TB 5A0YB 4LFAF 2MEWA 4ANDA 1IQZA 1KC8O 5JICA 2AJ4A 3FQLA 4CJVA 4FK0A 4TU7A 2C22A 1C1AA 3CIZA 4R8UA 3AAWB 1LOUA 2BE2B 2D1CA 3TVKA 3W8GA 3UE5A 2C2OB 3NGDA 1K9MT 3S01A 4F4YA 3WQUA 4K7QA 1NBWA 1XUPO 4H8KA 4YMEA 2FXUA 2D3UA 2C1EB 5KI6A 3TA2A 3AFGA 5ETVA 1F9EB 2FF6A 3HHDA 1BWEA 3KLEA 3K58A 4MLHA 3IM8A 5F8IA 4FKYA 4F0KA 4ECXA 5CE3A 4B9VA 2UYTA 4ILMA 2NRVA 1HKCA 1NNDA 3SSRA 2UXBK 4J9UE 3O3HA 4EBEA 3HSDA 3AA8A 3RG6A 3AH6A 4ZDNA 1ITGA 1A5XA 4FZVA 4EFAC 2HHUA 1WF2A 2RIJA 1IBCB 1JLBB 2K7KA 5T7LB 4WIQA 3EUNA 3KHLA 3MEGA 5CYMA 5HP1A 2F9DA 3IG1A 1GEHA 5FJ4A 1WAFA 2HAFA 3ENQA 4FLUA 3RRGA 3MXIA 2FZGB 2Z1GA 3KJVA 3F0NA 3EE3A 2R8GA 3DLBA 1U48A 1PJ5A 4ED3A 3MR6A 1Y5NB 5D4OA 2D0CA 1BQNB 3QT7A 3AO5A 3PRVA 4OGEA 1S1UB 2KI2A 1VQPS 1GK8A 2DHAA 4H5WA 3ID6A 1SL0A 2XBPA 2CQIA 3C6TB 4LD0A 3T7ZA 3GJQB 4IJNA 1SQFA 2WB4A 1GLDG 2HNDA 2OEMA 3UVJA 2QI2A 1NXIA 3TRGA 2FSKA 4JEPA 1FERA 2MZQA 9RUBA 3OT9A 3KLIB 3CDWA 1Q0NA 5KT2A 3LPYA 3AA5X 1JJHA 4BDYA 1VQPN 1CXUA 1T95A 3VEXA 4NPOA 4OX7A 1YKWA 3JSMA 2QFJA 1XIQA 2ZBCA 4G3IA 1YBAA 3PKYA 3S3NA 1C0UB 2HURA 3CDEA 3PTWA 1G3OA 2UV8G 3IGVA 3GIIA 3SCKE 1VJQA 3K2YA 5GADU 5GADP 3ISNC 1ZS6A 5JXSA 2OPPB 3KHHA 1RGIA 1IR2A 3HM9A 2P9SB 3HULA 3SBMA 2JSXA 5IT4A 1S0VA 3IMXA 3NNCA 4OYWA 4X62F 5KPRA 4QOTA 4DL3A 2FHKA 5HOOA 4I64A 1PC4A 1TKTA 4ICLB 2ILZA 4EHUA 3BF1A 2KTQA 2CPYA 4DXLA 3P4IA 3TU5A 4ELVA 3V6KA 2CJYB 2IJRA 3F41A 3H0PA 2FUG9 4LF9J 3RW6A 1N6QA 5CHCB 3GJTB 3OR2B 4GKKF 1WKKA 4CLKA 3WNFA 4BACA 2LVWA 3TA0A 1NGJA 2RNEA 4EP5A 4OQJA 3T1YF 2RRBA 2N4DA 4FKXA 5DZ6A 1U45A 2DNPA 1NDPA 5AXLA 1H72C 3DDIA 4ECRA 1TKZB 4C3MA 4PXEA 4F36A 3GFHA 1L3VA 2A1SA 1D1UA 2FLNA 2VGMA 1TU0B 2OPRA 3I4PA 1S9GB 2YNHA 4CJTA 3LOUA 3CJ5A 1Z6RA 4HDGA 3H3NO 2L9DA 4K2JA 2C2EA 3LL3A 1FE0A 3EY1A 4H54A 3GJRB 1H2TZ 1IKYA 2LQ5A 1H1VA 4M3ZA 3HMJG 5HVFA 2GJFA 8ATCB 1MMDA 4OX6A 4DR7J 1C4CA 2KZZA 4DTUA 2CQDA 1ESVA 2IVNA 3PW7A 2LU1A 4DTRA 3S6EA 3AD7C 5F8GA 1XMOJ 4M5KA 5EX5A 4CE9A 4PYAA 4LF7J 1JLGB 1IO2A 4Y6IA 3H25A 2WUSA 4RNHA 2U1AA 4U96A 3DM2B 3CNQP 3C19A 4WWSA 3OS0A 5BN8A 3TABA 5EY4A 3DFEA 4G1QB 4E19A 5HMWA 4DR5J 2CJQA 3VGTA 4OV1A 3LPEA 3VQDA 4RBVA 3CMAS 2JFKA 1HQ2A 2V9KA 1FWLA 4LFAK 2DY9A 2HHTA 3GYXB 3SEOA 3D1OA 1I6JA 1F9FA 2VBYA 2UVUA 3TAPA 1WORA 3E8OA 4OPJA 2CQHA 2GQ2A 3WIUA 2KT3A 2G1DA 1RBOB 2Z2LA 1YRTA 3GG0A 3OTCA 1WBBA 1X4BA 2UVVA 4DFPA 2B5JA 4CHZA 4CZIA 1I39A 4DTMA 4HTLA 4FVMA 1V4SA 2QWLA 1DAXA 4AXIA 3FNNA 1AUDA 4MDBA 4HVJA 2R8KA 3OYKA 2RKIA 5KG0A 1VQ5S 1UFLA 1TYQA 1VQ7S 4I9LA 3QERA 1ULRA 2F8HA 1AW0A 3C6UA 3BR8A 2O4IA 2CDQA 2PA3A 3WXLA 2I6WA 4JD2B 5GINA 2J8AA 2NSBA 4OPHA 2O8FA 1EQYA 1YK9A 3KD5E 1OSCA 1RFQA 2LQ9A 1TL1A 1GLEG 4RKUC 4JKCA 3ZTOA 1VQ7N 1Q7LB 3NCIA 2D3OR 4E1MA 1FX4A 3G2XA 4PABA 1T9WA 3OUYB 4JK9A 2AEMA 2M8HA 3VF0B 4ZCKA 5ETOA 3JYTA 1LFPA 3MEDB 4M1KA 4CEDA 1HLWA 2DFHA 4FM2A 1F2HA 2AD9A 2FC9A 2GVZB 3KYLA 3P31A 3BYPA 4C4WA 1RTJA 3TQ1A 1RU1A 2DK2A 1RTHB 1XMQF 1FEHA 2DRBA 4WFNQ 2ADBA 4Z4FA 2KKZA 2NSCA 4A4JA 2VG6A 4CO3A 4UUWA 1IKWB 1NJZA 2AIRB 4WZMA 4C8YA 1WEXA 4TNOA 3NF7A 4NA2A 4FZZA 1HHQA 2QA2A 3OPKA 2D69A 3MEEB 3L7OA 2HNYA 4BCAA 2PSZA 5C24B 2RH3A 3F9KA 4E7JA 3R7NB 4X4UA 2EEYA 3LM9A 2ROGA 1RBAA 1R8CA 3ZZ0A 1JLAB 2DGXA 3OXFA 3D3BJ 2EFPA 1C1CB 4QU7A 3U8XA 3PIOQ 1XTZA 5IV4A 1S1VA 5AZJA 2E66A 1K8KB 5D0GA 1RBSA 3FSIA 5K9FA 2EPIA 3AXMA 5FIIA 2QWQA 2ZQBA 1N8RO 4B08A 3H59A 1Q8KA 4AL5A 1W97L 4GW6A 3E3XA 3L4IA 3HKZD 1XEZA 1NHUA 3TTDA 1KLMA 1SKRA 3MCPA 1JLEB 4CO5A 2BTFA 4GVEA 4UOHA 3NAEA 5AE2A 4OKJA 2FY8A 1Q18A 4NYPA 4Y2KA 2HVEA 2K3IA 2NUBA 4X64F 1RE1B 4NZ6A 2E2QA 2W9CA 1N54B 4TY8A 4X62K 3SUPA 4DCOB 4O4RA 4CHYA 2F9TA 1QAIA 5GAGU 2MKIA 1PSDA 4XPCA 1NEEA 2E5GA 3MK6A 2YHBA 8RUCA 2BJEA 3DYAB 3L3VA 5FD1A 1VSJA 1K73O 3UN2A 2XM3A 3POTA 3DCAA 4ECZA 2K06A 3T9ZA 4FL9A 3QBCA 2CYYA 2YH1A 1KQKA 3EX7B 1G99A 1T3VA 2OH2A 1DEJA 2P9PA 1DQ9A 4GKKK 3WHIA 4AHCA 3KHGA 3KLFA 3T1YK 1SIWB 3GR1A 1RDAA 4ZP8A 2G8WA 3VQAA 3FEZA 2EHGA 3HOSA 3NOGA 4KFBA 2I5JB 1RT5B 4YN3B 4OX9J 2C2NA 1RDRA 1VR6A 4CW7B 4U6PA 4CM0A 3QFUA 3PRBA 3CDAA 5E5NA 3J81O 3BV8A 5AQJA 1OYDA 1N56A 5U47A 2XWYA 1DGKN 4DU1A 2MSSA 2RDDA 5BRHA 3C46A 5CD4A 1C0MA 3B6PA 2LFVA 4KTQA 2E1RA 5C25A 3IC1A 1M90O 4ZVGA 4AT1B 2P9NB 1CVJA 4EIAA 3PLAA 1HJOA 1JNZB 1T7PA 4RBUA 3MR7A 3PSIA 3G4SS 5HJXA 3NF8A 3DXMA 5AQXA 2Q66A 4CJ3A 1KWMA 4FYWB 1HBMB 1S79A 2PMWA 4KY3A 1SJRA 2NXNA 1RISA 1BQXA 2ETJA 5LM7E 1NSKL 3TARA 1RZMA 3BQ2A 4GVBB 5B0BA 3VZHA 3M6XA 2G8HA 1A6LA 5J2NA 4OI3A 3G4SN 1SCJB 3IWNC 3O4NA 3UPFA 3MDQA 2XY7A 2PZSA 1GMVA 1R8AA 1X4FA 5AQLA 2C28A 5AQMA 4IFYA 3NBPA 3ZT0A 2IDLA 5H9FJ 4DPTA 3CCSN 4P52A 1WOSA 1RKJA 1Y5IB 3BO3A 1FF2A 2CZVC 2AJ1A 1FNOA 3VVTA 4NWBA 1JK9B 2PYJA 5GADI 1S9EB 3QSYB 1RBTA 3KNAA 4J9RA 4N8NA 1YTAA 4IEIA 1OH8A 4F3MA 4YOUA 5ETKA 1TKXB 1MLAA 1IBKF 5IS2A 4JK7A 4NYOA 2NQPA 4PXDA 1AROP 4UY8T 1JLQB 1S6PB 3M8YA 1HFEL 1RLCL 4TN2A 2OIHA 4ANCA 3R1HA 4FDFA 1SH2A 3PW5A 2QA1A 3QAUA 3HJVA 5M2UA 1XNRF 1UW4A 5GAEU 5GAEP 3SMPA 2FZKB 4O3SA 2GX9A 4YOYA 3AV9A 1HBNA 2LQBA 1MMNA 2NREA 4JKFA 2DNZA 1CQMA 1VMBA 3D68A 1LKZA 3CO0P 5FDLA 4PUOA 4RW7A 3V9XA 1NMNA 3QNWB 2A6AA 4JRQA 3MEGB 4KGVB 4BC2A 4OHZA 4Q0BA 3H2VE 3WXIA 4QJVA 5HP1B 4QAGA 5JVGL 3IG1B 2ZDOA 4PKHA 3EDRB 3I8DA 3H98A 3GONA 3OYEA 2ROEA 4DMZA 4ETXA 3A8YA 3LDOA 4O4GA 3WNEA 4JKHA 2ZH1A 1NSAA 5GMKa 1UJ5A 5JMNA 1LW2B 2PDAA 3D6TB 4OYMA 1TUVA 2IRYA 3PYDA 3HHLD 3AD8C 1RDBA 5K8MA 1NOYA 4WFNL 4NB4A 1K47A 2XLIA 4L73A 3IXQA 3AXKA 1B3TA 1XMQK 1XERA 4DL7A 2P9KB 3HI9A 4NLPA 3OTBA 2HNDB 2M4MA 1FWKA 2ASDA 2OTLN 2WW8A 4C0HA 5B0CA 4CZGA 2GVDB 3A4TA 4O23A 3M2UA 3M4XA 1X1PA 4LR8A 1PG5B 2BJDA 1TK0A 4LR9A 1F3VA 1S99A 1QVGR 4XK8C 1ZA1B 2Y8WA 3UNYA 4JLHA 1FXXA 1F9HA 2VYPA 5J2QB 1WOOA 4AHTA 2GS8A 4K42A 3JSMB 1QUVA 4GC7A 1Y3JA 1XR6A 3CCRS 4BC9A 3A8JA 5DETA 3O2IA 4N77A 5LL6Z 2M2BA 4C11A 2QTWA 5K20B 3N5FA 1Z26A 1QVGM 2QYGA 3KLGB 1NU4A 2AJQA 4FWKA 4KI4A 2C2MB 1K1QA 5MAOA 4ENOA 2EFNA 1GAOA 4TQSA 3AA9A 3HF5A 2YKMA 1XC3A 1B9FA 2Q6BA 4J9LA 3W65A 3H8YA 3K5OA 3TJ8A 1WC0A 3KZBA 3CCRN 3CD0A 4A8SA 3M3ZA 4LR7A 2VJVA 1JL1A 2RUGA 4QOZB 1H3DA 1RDWX 2WONB 4X64K 4TY9A 1MROB 3PYFA 2WSEC 2H3EB 3ELHA 3G10A 3VQEA 4X4QA 3HVTB 2AYGA 1FFGB 2LXUA 1WC6A 4LF4J 4CHOA 2DH8A 2RRAA 3DRSA 3OJSA 3I32A 4DPYA 4Q5VA 4H5VA 4V19S 4DL0C 3BPDA 1N6QB 2E5LJ 5D6GA 5A2QU 1GXTA 2XY8A 2JC0A 2B9XA 2ASPA 2GHPA 3M8QA 4UUXA 4JI3J 1IBLJ 4K4VA 3MWTA 3CW2C 5KG5A 3TANA 3CFPA 1BHNA 3MFIA 2E9ZA 3P6YC 2J7WA 1J5OA 3PYGA 1L3TA 1NMEB 5HQLA 1SJ3P 1SJQA 3M8SA 4JI3K 4JHDB 4IKFA 3FC9A 4OGCA 2EFGA 2W6KA 1Y7PA 4ZA1A 3J81Y 3U9ZA 4Z4EA 4DLEA 1YBUA 3CJKA 1GLJO 1OH5A 4ILJA 5A8RB 5LT5A 3HI0A 5BPMA 2HKEA 2O66A 2BEFA 1IWAA 1IKYB 4BG9A 1YLXA 3CJ8A 3QGGA 2CJ9A 4X4NA 3W8PA 1RDCA 3ZNJ1 3I55N 1HYSA 5AQRA 1BOTO 5TKYA 4CT8A 3T6BA 1CZAN 2PI4A 2ZJRQ 2GQQA 2Y1IA 3EJMA 3LP2A 2VQFJ 1IG9A 2ZNZA 3FBFA 4K8RA 3GE9A 3SYZA 1GOBA 1FXDA 1S1WA 2VH7A 4FVUA 4JOUA 3QAEA 2RILA 3VQ9A 4OLAA 3LGHA 5M1QA 4EU0A 1N52B 2HMPA 4I4BA 5E2QA 4NCGB 1JIHA 1RTZA 4ID5A 1YI2N 5L46A 4L75A 2D9OA 4PG4A 5DM6Q 4ZCMA 1WSHA 1SC1B 2MZTA 4K4ZA 3OVAA 1RNHA 3HPHA 1NDCA 3AVJA 2C2ZB 3TVYA 4BRPA 2R9LA 4Z4GA 3QRQA 5BR9A 3C94A 1D09B 2Y3YA 3CB4A 4LFCJ 4NYNA 2YCHA 3ZT4A 3KDOA 3O6QA 3CD5A 2DHHA 3KK2B 1W0HA 2GIRA 3AOAA 3GP9A 4C3LA 2ZBPA 4LFCK 1IBKK 5A8KA 4H0PA 1QQMA 2IJNA 2AW0A 3HHLA 1NJXA 3G71S 1U1KA 1VCTA 5GAGI 2RKIB 3HL8A 2CADA 1TYQB 3K5MA 2OI2A 4ED2A 3KOAA 1SC6A 1U09A 1X3NA 4PR6A 2O8CA 2JLFA 1XNRK 1RILA 3KXDA 3BSNA 4WF9Q 5CR4A 4DQPA 3QGHA 1RT2B 2BKOA 3UCGA 3W0LA 2O8FB 2A2DA 3AO4A 1FHTA 3LALA 2QXFA 2RB7A 4BGBA 2IMOA 1IG8A 3BF3A 1RTIB 2VG5B 3BZKA 2FJBB 3G71N 3G6VA 1MU2A 1U6FA 2W2NP 3AB2B 3SLCA 4IG3B 3L2QA 2D3ZA 2CPXA 4CLWA 4TXSA 2VPWB 2QMXA 3FCWA 4EI2A 2AV5A 4PKDB 3M5RA 1J9AA 4BE0A 4AYBD 4DUZJ 2RHQB 2WAQD