5J2MA

Hiv-1 reverse transcriptase in complex with dna and efda-triphosphate, a translocation-defective rt inhibitor
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/dna
molecule keywords HIV-1 reverse transcriptase p51 subunit
total genus 166
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2mA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2mA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2mA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2mA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2mA05
3QYYA 2JC1A 5HRSA 1JLBB 5I3UA 4NLWA 2OYQA 5KFNA 2BQ3A 2JGUA 4CJSA 1HPZA 4FJXA 5KFQA 4BWMA 3JSMA 4DFKA 3HM9A 3HPGA 5J1EA 1XR6A 4DTOA 3M9OB 2HNZB 4WE1A 4M42A 3KMQA 4CGDA 4FLXA 4DFPA 3DM2B 1ZETA 4CFAA 1N6QB 3TAGA 2W9CA 3BSAA 3UPFA 2D0AA 1S6PB 2YKMA 4Q8FA 4CHZA 2VWJA 3I5BA 3KLIA 2FJWA 4DSJA 3HK2A 5T7BA 4M3UA 2YNIA 3V6JA 3Q8SB 5F8IA 2O5DA 2FBTA 2R2TA 3TAEA 3JYTA 2DFFA 4CGFA 1VRTB 1UWBA 4WXOA 3QLHA 4U7CA 4CJRA 5J2MB 3DRPA 2Q3SA 2E9TA 2F8EX 3AVMA 1NK9A 3QNOA 2AJQA 4KI6A 1RTDA 4WYWA 4OPKA 2WB4A 5KT3A 3CFRA 1YTUA 3QIPB 5I3UB 4FLUA 2IAJB 4CCHA 2KFNA 3CO9A 5KFSA 2XI3A 3AO5A 4ELTA 4JUZA 1U48A 3SPZA 4CHNA 3LZIA 4NCGB 2Z1IA 4R0EA 1TV6A 1NJYA 3RR8A 4FK0A 1S1TB 3MEDA 2FVCA 3VQ5A 1XC9A 3WNHA 1VRUB 1X9WA 5KFIA 1T03A 3NF6A 3T5KA 1TQLA 4DL3A 4F3TA 5HBMA 4KB7A 3MTKA 3QEXA 3T3FA 3DRRB 3K5NA 1S6QB 2B5JB 2IM0A 3MXIA 1RBSA 1S9EA 3ZT1A 4JV1A 1SKRA 4Y2CA 3KLHA 3GIKA 3KLHB 2BQRA 4M94A 4E89A 3V81A 4J9QA 1K1QA 3ZT3A 1D8YA 1YT3A 3AVNA 4B9UA 1KLMB 1JIHA 4NRTA 4I7FB 1R0AB 5KG4A 1L3VA 1RDBA 2D7SA 4J9PA 4NLUA 4CFBA 4F2RA 2IM1A 3PJWA 5KFOA 4CJFA 2RPIA 3DOKA 3ITHA 3BREA 3OVNA 2ILYA 5CYMB 3KK1A 1JLCA 4DTMA 1JLAA 5KFDA 3C94A 3PJXA 4CFDA 2X6SA 4FM0A 4NLRA 1S1VB 3KKSA 1RAJA 3MECA 4CIEA 2IM3A 1JKHA 3NF7A 2AGPA 2YNIB 5HBMB 4OVLA 1RT2B 4ZVGA 4BE2A 4CJPA 4IDKA 1TKTA 4FJIA 1ZBIA 4FJ8A 1D9DA 1DTQB 2RDJA 4ECQA 4ZHRB 3HT3A 3ZT4A 3M8SA 3HL8A 4NYNA 4OLBA 2QXFA 4J2DA 4HHTA 4BDYA 4FW1A 1HQUB 1NHVA 4KFBB 4QW9A 4O5BA 4FJJA 3O4NA 3SQ0A 3QETA 3GQCA 3NFAA 3NCIA 4DG1B 4DL4A 5JUMA 2AGOA 3BR9A 5L1KA 1TGOA 1HYSB 1JLAB 1IKWA 3ZT0A 1ZBLA 1RTIB 3F9KA 3V81B 4F3OA 4F4KA 4ICLB 4RW9B 4LD0A 2UVUA 4IFYA 3MECB 1NK6A 5KFMA 3KLFA 4B08A 3OS1A 1UA0A 4AHUA 4EEYA 1C1BA 3QGIA 2IA6A 4RNFA 2HVIA 3C95A 2E6LA 3KJVA 5J2NA 3LPUA 1RT5A 3THVA 1NNDA 3Q8RB 1C1CA 3L8BA 4RNOA 1HYZA 3OL6A 2HVHA 3AVCA 3OYLA 1RT4B 1EX4A 3CJ5A 1TV6B 4DTUA 4IBNA 3D45A 3OYKA 4M45A 3AVLA 3KOAA 1W0HA 2W42A 4DF4A 2R8JA 3I0SB 4KAZA 4QWAA 1BCMA 3UQSA 5KFGA 5J2PA 5DGBA 4FS2A 2FVSA 5L1LA 1TL1B 3K5LA 4FM2A 2F96A 4ZVEA 4FBTA 1SV5B 3CDUA 2R2RA 4Q43A 2R2SA 3SUOA 4TY8B 3V1RA 1C0UB 4CEDA 3NH2A 3DMJB 2I5JA 1RT1A 5KT2A 4TQRA 2G8IA 3CFPA 3KLFB 4AHTA 3ICLA 3I5CA 4WZQA 3KMSA 1IKXB 4HYKA 1BI4A 2KQ2A 2Z1JA 3QGGA 3DLGA 2D41A 4J9NA 3BQ2A 1BIZA 1SH0A 2B6AB 1K6YA 3DLBA 2DPJA 4I2QA 4DU1A 4LSLA 4CEBA 4UQGA 3L3VA 3NMAA 4YFUA 2FLNA 2BANA 1I3AA 1KLNA 4BWJA 2HHUA 4DSIA 3BSOA 4KO0A 1HQEA 3QEVA 2ETJA 4NCBA 4IR1A 3BDPA 2VG7B 2AWZA 3RMAA 3PUFA 5KFUA 1VSHA 5HRNA 5KG5A 4FJMA 3IAYA 2BDPA 3ZCMA 5JS1A 4B8CA 3O3HA 5DG8A 3O4QA 3PV8A 5CYMA 4JRQA 3IN5A 1DTTB 3H4BA 1KTQA 3NE6A 3DRSA 4IOBA 2AQ4A 3QZ7A 2B4JA 1NK0A 3MEGA 4NLTA 4E7HA 2D3UA 4LQ3A 3AO3A 3RB4A 5KFFA 4ED8A 5D3GA 1RA7A 4MK9A 4Q45A 4FW2A 4KKOA 1GOCA 3TABA 4KHRA 5EUHA 4K4UA 2W9AA 3OYEA 1W9HA 3AVIA 3GIMA 4H54A 1C1AA 3K57A 1C6VA 2OH2A 1BQNA 1TL3A 3FQKA 3VA0A 3HVWA 1BQMA 1NJZA 2GV9A 3V9SA 2O4GA 3OHAA 1TKXB 5KFEA 2YNGA 2QV6A 1WSEA 2WCXA 2XHBA 3V6DA 2OPPB 4R8UB 1JLBA 2IAJA 4HUFA 4R5PB 1RCHA 4WYLA 5FRMA 3TANA 4QCLA 4H4MA 1C2PA 3ZT2A 1QSYA 5L9XA 2ITGA 3OYHA 2QKKA 3DYAA 3FRZA 3I5AA 3A2FA 3H5UA 3TVKA 3AVJA 1ASUA 5KG6A 4CJ4A 5DK5A 3KTQA 4E0DA 3MR3A 2R8IA 1WSJA 3V9ZA 3KLIB 2DY4A 3G86A 4TQSA 3G10A 3E51A 4KTWA 1N5YB 4CK1A 3QZ8A 3IG1B 3DLEB 3SZ2A 3K58A 2GC8A 1S9FA 3DOLA 3AVGA 4FYDA 4NYZA 4KPYA 2HNYA 1C1CB 3V6KA 3IRXB 3NBPA 1FXXA 4CHYA 4GC7A 5C25B 5I42A 2VWKA 3LP1B 4ZVFA 2BR0A 1A5WA 1RT1B 4QWEA 4RNNA 1X1PA 1TKXA 4DTSA 5C42A 1QSLA 3RAQA 4KFBA 4CGJA 3NDKA 4CIFA 4ED3A 5KFWA 3LP0A 2BE2A 3PO4A 4ZVHA 3LP2B 1DLOA 2W9BA 4CESA 3NGYA 4CFCA 3V9XA 4EO8A 1Q9YA 3WNEA 4M3YA 4YNQA 3KK1B 1L3SA 1FKPB 4F4YA 4G1QB 5CYQB 1VSLA 1KFSA 1JLEA 4CF2A 4MIBA 1U09A 4DU3A 4TYBA 5KG2A 1JX4A 3AO2A 1MU2A 2KFZA 3G6VA 4FBUA 2AGQA 1HNVA 5KG0A 3V6HA 4N41A 4RW8B 4PQUB 4EZ6A 1N5YA 2XCAA 5KI6A 5HP1A 4I9LA 3Q8PB 1S1UB 3OYJA 3CJ2A 2HNDB 4F4XA 2FBYA 4ECWA 4EBCA 2HWIA 2XO7A 4MFBB 4B3OA 3UDLA 1QSSA 4MK7A 3AO1A 4ECZA 5CZ1A 4ELUA 2GUIA 1HQUA 3FDSA 1ZBHA 3MAQA 3VQPA 4FJ9A 3NL0A 4RU9A 4ED0A 4EO6A 1TL1A 1J5OB 3G6XA 3DLEA 1A5VA 5KG1A 1J54A 4CF1A 3SI6A 2HHVA 1CZBA 4ECTA 1CZ9A 3OYNA 3P83D 3NHGA 4KHMA 2ATQA 4K8ZA 5KFJA 2R7YA 2XGQA 1HMVA 5F8NA 4IKFA 3CM5A 4IH6A 4GC6A 4MQ3A 1RT3A 4RW4B 1SL1A 4W5OA 5DLFA 4NYFA 3VQ8A 2P1JA 1D1UA 3TWHA 1RT6A 3V9UA 4O4GA 1RDDA 3OS2A 1RT7B 1L5UA 4C8LA 3EPGA 1JLFA 2OPQB 3HPHA 4DL7A 1QE1A 2AX0A 3LP3A 3VQQA 1TK8A 2VG7A 3L2QA 4JLHA 2FJXA 1IKYB 2V0NA 4E7JA 1JXBA 1VSIA 1T03B 2DPIA 2B43A 4EBDA 4AILC 2JLEA 3V4IA 3RR7A 3SQ2A 4OGEA 4CEFA 3QEPA 1J5OA 4KAIA 4CEAA 3EZUA 3SQ4A 3KHGA 2J6TA 5C24A 3V1QA 3ZSOA 2B6AA 2HAIA 2YV0X 1VRUA 1J9AA 1NKCA 1S0NA 2BQUA 1NK4A 2OPSB 5DQIA 3L2WA 4ED2A 4W5QA 1D5AA 3QIPA 2VA3A 1GOBA 4B9LA 4XO0A 2V4QA 3MR5A 1TKZB 4MH8A 4B9NA 2ILZA 3IG1A 4Z0UA 4AH9A 1RT6B 4H8KA 3FQLA 3KLEA 1IKXA 4YQWA 4DTJA 4H4MB 1JL1A 1RTHA 3ISND 4HKQA 5HRPA 1QE1B 2YKNA 3DLGB 3PVXA 2ZQBA 1LV5A 2YKNB 1EP4A 4RW6B 2VG5A 3HVRA 1RA6A 4FJKA 3QIDA 4DSFA 1NHUA 4Y34A 1NOZA 3OL9A 1XHZA 3PR4A 4EBEA 1IKVB 1N56A 3TQ1A 4OLAA 3WNGA 1WSIA 3CFOA 4TYAA 3DM2A 5KT7A 3E01B 3RB0A 1LWFA 3M8QB 3O3GA 3ZSVA 4CJQA 5C42B 3RTVA 2G8UA 2HHXA 3H5YA 4Q8EA 4ZPAA 1HNIB 3V9WA 1LWCB 3IS9B 4R5PA 3S3MA 2W7PA 2IJFA 4J2EA 1XWLA 2FLPA 2HNZA 4IFVB 1S97A 2OPRB 3CJ0A 1YTAA 3MR6A 3AVHA 5KTQA 3O3FA 3PW4A 2Y1IA 4YP3A 3EYZA 3NGDA 5F8HA 1GOAA 4CGIA 4CJLA 1X9SA 4L8RB 1HJRA 1OS5A 5KFTA 5FRNA 4DS4A 4ED1A 3MEGB 3H98A 4RW9A 4DQSA 1EKEA 4Z4FA 4NCAA 2VA2A 1KVAA 4AHCA 4OKKA 3KLGB 5KT4A 1JLGA 4ECVA 2F8TA 3C6UA 2UUTA 4KHUA 2HWHA 3CDEA 1KFDA 5J1EB 1RDRA 4KTZA 4O3OA 3SNNA 1RBTA 2BANB 1YVUA 4IRKA 2GIQA 1U04A 3AVAA 2ZE2A 4O44B 4CJ5A 1BL3A 1ZTWA 4NLYA 3OYBA 3KK3A 3H40A 3TAMB 4DS5A 2ZD1A 4H4OB 3FSIA 2KW4A 1VSMA 4KHNA 3KHLA 4Q44A 4X2BA 1KSPA 2FLLA 2F8SA 4MIAA 3OJSA 4E7KA 2KZZA 1FK9B 1TVRA 2HHTA 3ISNC 5KFXA 1DLOB 4ED6A 1RBRA 5J2NB 3KD5E 4TY9A 1BI4B 3TR8A 4FJNA 2O4IA 4WE1B 2Z1HA 1FKOB 4B9VA 2RF2B 3PX6A 3AA4A 5F8LA 2R2UA 4DFMA 3AVKA 4K4SA 4RNMA 4CJKA 3M8RA 5F9NA 1S1TA 1B9DA 3S3OA 2IBKA 4M3ZA 4ZP6A 3T5LA 1CXUA 3NF9A 3SYZA 3M9NB 3SUPA 4N47A 4MKAA 4EZ9A 1IKVA 5KFRA 1NKBA 5HRRA 1Y97A 2RDIA 4GVMA 3K5MA 4HUEA 4CJUA 1SL0A 2KTQA 4CGHA 1RTJB 3VQDA 3DRPB 1RDCA 3OL8A 3LWLA 1T05A 3OLBA 4DSLA 4MFBA 3HKWA 2FVRA 4ICLA 4E19A 2AU0A 2I5JB 3PHEA 4QWCA 4OL8A 2DFEA 4PY5A 3DMJA 4DQPA 2YNGB 3B6OA 2R8HA 1KLMA 1R0AA 4O3SA 1Q9XA 1BGXT 3IGVA 2YNHA 3RRGA 5DQGA 4KHSA 4DF8A 3SQ1A 4Z4GA 1RNHA 3MXJA 2FC0A 4E7IA 4HCCA 1S9EB 3OJUA 2YHBA 1GX6A 1DTQA 4XIUA 1WAJA 4IG3A 4F4WA 5DLGA 3TAFA 3ZSWA 3K59A 2DTUA 4G1QA 5CYQA 3KIOA 3KLVA 3L2UA 2WOMB 4RW7A 3DLKA 2G8HA 5KFLA 4IFYB 1EXQA 3SFUA 1U47A 1LWEB 2PZSA 1RBVA 5J2PB 2XGPA 3KD1E 2B5JA 4NZ0A 1Q8IA 5HP1B 1TKDA 3AVBA 4M3RA 1I39A 1HYSA 3KK2B 1LWFB 4GW6A 1KCFA 4IRDA 2ZD1B 4H4OA 1SL2A 4HTUA 2C2EA 4BDZA 1KHVA 1G15A 2R8GA 3NGIA 2UVWA 4I7FA 2UVVA 1WSGA 3I8DA 1SKWA 3OHBA 4CK2A 4JV2A 4C8NA 4CEZA 4CEQA 4QW8A 1S10A 4CHPA 3SPYA 1EETB 1QHTA 4NLGA 4FLZA 3LWMA 4JS5A 4IH7A 3BSCA 3PX0A 1LAVA 4DQRA 1RYSA 5KFPA 4EYHB 2X74A 2BGGA 1WNSA 4KTQA 4FK2A 1BIUA 1N48A 1S1WB 3HP9A 2HB5A 4DQQA 3RAXA 3LANA 3RRHA 3IS9A 4ED7A 3T5JA 1TKTB 4CJVA 1QQCA 3OYFA 2WONB 2J6UA 3HVTB 4CJTA 3M8QA 3AO4A 4NLPA 2QE5A 3PW7A 4ELVA 2XWYA 4I2PB 5K14B 1LWCA 3ZSQA 1NJXA 3N6LA 3CYMA 4HVJA 4NLXA 1KRPA 3BGRB 1D0EA 1ASVA 3BGRA 3SV3A 4KKOB 4M95A 3C6UB 3GV7B 1U49A 1HPZB 2VG6B 4TLRA 4LH5A 4FS1A 1XI1A 5EWEA 4N76A 4EYIB 4DL6A 4J9SA 1S49A 4IH5A 4OKJA 3KNAA 5E41A 4NLQA 4KV8B 1SH2A 4K50A 3RWUA 1NOYA 5HROA 2PYLA 4O3QA 3VQSA 4OKEA 1NK8A 1HARA 4IRCA 4BACA 3RB6A 3SJJA 2XC9A 1VRTA 3LP2A 3SUQA 2E4LA 4YMEA 5F8JA 4XPEA 3KJVB 4PWDA 2YNFA 2D0BA 4O0IA 3BSNA 4DL5A 4ID1A 4IFVA 2IS3A 1HQEB 1J53A 4CJ3A 3GIJA 1QAIA 4MK8A 2E6MA 2YKMB 2KZMA 4CF0A 1Z25A 4W5TA 2QKBA 1C0TA 3BJYA 3Q8QB 2RN2A 3T19A 3VQCA 3V4IB 2HW3A 4AHSA 1D9FA 3VQBA 5DG9A 4EP5A 1VSDA 5FDLA 1WSHA 3ZSRA 4RUAA 4DL2A 4N56A 3UIQA 4FJHA 4ECRA 2D0CA 2EHGA 2GIRA 3L2RA 3ALYA 3CJ4A 3OYGA 4KHWA 4CJEA 4PA1A 1ITGA 1Z4UA 1HNVB 3H2LA 5HLFB 4F2SA 3QLHB 1TAQA 3ASMA 4O3PA 5J2MA 1JL2A 4K8XA 3M8PA 2WTFA 2BRKA 1S5JA 3HVTA 2RF2A 1UA1A 3CDWA 1RYRA 4QAGA 2R8KA 1IM4A 3IGNA 4C8MA 2P5OA 4ZTJA 2C28A 3HPOA 2W8LA 3H59A 4OPJA 1FK9A 1TVRB 1BISA 3P1GA 4KB0A 1S4FA 4OGCA 3MR2A 4PQUA 3SI8A 4ZPCA 5F9LA 1JLQB 3PW5A 3P5JA 2HNYB 2HNDA 1S6PA 1JLFB 4EP4A 1JLEB 1S1VA 4F4ZA 4K4TA 3C6TB 4PUOB 5J2QA 4DQIA 3HSTB 2E9RX 5JS2A 2WK4A 4URGA 2EX3A 1IKYA 4DTXA 4Q5VA 4ZTFA 1RT3B 3RBEA 3NF8A 2W7OA 3K2PA 1S48A 3QO9B 1SUQA 3NH0A 2PY5A 2XY7A 1VK0A 3ULDA 4MKBA 5FDLB 3OL7A 3OY9A 2OPRA 2ALZA 4FJGA 4LSNB 2IM2A 1VSFA 3PO5A 2WRMA 4Y3CA 3DI6B 4I2PA 4Y1DA 3DLHA 1MU2B 1NK7A 4G3IA 1KVBA 2YHAA 4J9LA 2PYJA 3DRRA 5KFHA 1LW2A 4KREA 3LAMA 4O4RA 3KHHA 4GMJB 4DTRA 4FLYA 3NH1A 1CLQA 4PWDB 4ECUA 1QUVA 1RILA 4WFXA 1CXQA 4O55A 2C2DA 3IRXA 3LP1A 2G8WA 1VSKA 4E1MA 3MEDB 4M3TA 1S9GA 2IC3A 1KHWA 3CJ3A 4DWIA 3SV4A 5CZ2A 1B9FA 4RW8A 4RZRA 5KT6A 1TKZA 4CJWA 3NAEA 3EPIA 3DOKB 2FJVA 4RNHA 3LAKA 2ASJA 4FLWA 2J6SA 3V1OA 1SH3A 3S9HA 3QERA 1I6JA 4TY8A 4FLTA 4Q0BA 2XY6A 4KHQA 3ZSZA 5K14A 3C6TA 1UAXA 4Y2AA 1T8EA 1LWEA 2G8FA 4WFYA 1X9MA 4QPXA 1S6QA 3MEEB 4DSEA 4AHRA 4URSA 4IDKB 4K4ZA 1A5XA 1FKPA 2Z1GA 4KBIA 1SV5A 1C0MA 4OJRA 5C25A 5I42B 3MFIA 4Z4IA 4B3OB 3I0RA 3HXMA 2ZKUA 2OA8A 1S1WA 4J9RA 3LDSA 4R8UA 3VA3A 2OPPA 1WN7A 3NGZA 4NLVA 4BE0A 4DTPA 1T3NA 5DMRA 3PZPA 2FVQA 4Z4EA 2RKIA 3TAPA 4ID5A 4TN2A 2HHSA 3UR0A 4Z4HA 4O3NA 4DU4A 2ZE2B 1RT4A 3CVKA 2IMWP 1T7PA 5KG7A 2XCPA 1RTIA 3KHRA 1S1XA 1U45A 5DGAA 2QK9A 1QAJA 4Y1CA 3MF5A 3M9MB 4PUOA 1C1BB 4DG1A 2WHOA 2AX1A 4B9MA 2V4RA 4M3XA 3DLRA 3AV9A 2XI2A 2JEFA 4O4GB 2X6NA 1XR7A 1Z26A 5KFVA 2GBZA 4BE1A 3GILA 1HYVA 2BRLA 3H5XA 3ZSYA 1HMVB 4NLDA 1HNIA 4RG8A 4FZYA 4FJ7A 1RT2A 2A1RA 1WAFA 3L2VA 2OZMA 4CEEA 4NLOA 3DRSB 2EC0A 4CE9A 3CM6A 4KE5A 4CF8A 1IH7A 1C0UA 1ASWA 3QNNA 1N4LA 3H08A 3LPTA 3FFIA 4XPCA 4CGGA 4WXWA 4CECA 5L1IA 5FROA 5D3GB 1RBUA 3OSNA 3VN5A 3QINA 3QESA 1QTMA 1ZBUA 3GYNA 3LALA 4LH4A 2OZSA 3U3YA 4HUGA 3U3GA 3N6NA 3L3UA 2HMIA 1BQMB 3T1AA 3PY8A 3VQAA 4KRFA 4IG0B 5SZTA 4IG0A 2HHQA 4ECXA 3RBDA 3CQ8A 4QWDA 3PW0A 1MMLA 2BE2B 1ZYQA 2C22A 2RKIB 3VQ6A 4K4WA 4U6PA 4IG3B 3SFGA 3KKRA 4IR9A 5F8MA 3E01A 4QOZB 3OYDA 4FJ5A 4ZPBA 4CERA 3WNFA 2JEJA 3MFHA 4QWBA 4F50A 3DLKB 3S3NA 5HROB 3FFIB 3I0SA 4CK3A 5SWMA 4LSLB 5KRTA 2XRIA 3T5HA 4RW4A 2ASLA 3VQ9A 5KGXA 1TK5A 1SUQB 1UWBB 4O44A 4NRUA 1EETA 3RMDA 4W5RA 4KI4A 1RT7A 3DOLB 3KK2A 4J9KA 1RTHB 2WONA 3LZJA 4FCYA 5JXSA 1WLJA 3G0ZA 4FZZA 5EWGA 5J2QB 3CWJA 3NAHA 3NAIA 4E3SA 3K5OA 2G8VA 4RW6A 3VQ4A 1QS4A 4KB1A 1RDAA 4AHVA 3ZSXA 3LP0B 1WNEA 5KGWA 4B8AB 4M3WA 4ZP7A 3PR5B 4CHOA 3AA3A 2VG6A 2LSNA 4DMNA 2JC0A 1LW2B 3CIZA 5CY4A 3TI0A 3RMBA 1NK5A 3TAQA 5C24B 3D0PA 4Z4CA 2G8KA 3TAMA 1BQNB 1TL3B 4E7LA 3PX4A 4FJLA 2FBVA 1LW0B 3QEWA 3OYMA 3DI6A 1IG9A 2NUBA 2XY8A 3H4DA 3HP6A 1WSFA 5KFYA 1TAUA 4BDPA 4RUCA 1JXEA 4YR2A 4CHQA 1JXLA 3M8PB 5F8GA 4KSEB 4I9QA 3QO9A 3SCXA 2CJQA 1KVCA 3KK3B 3OYIA 2OPQA 4N5SA 5DQHA 1B92A 1SKSA 4KHYA 1REVA 1CSJA 4FXDA 3GV8B 2HMIB 1BCOA 1S1XB 4DLGA 5KRSA 2D3ZA 3OS0A 4C8OA 1YVFA 2UUWA 2VG5B 4URQU 3KLGA 1C0TB 3VQ7A 1JKHB 3N6MA 2W9BB 2FBXA 2HHWA 2JEIA 5DG7A 3MXMA 2JEGA 3QEIA 4ID5B 5KG3A 5KFKA 4YR3A 4DEZA 1S0OA 1O1WA 4HCBA 4J9OA 1FKOA 3OYCA 4K4VA 1JLCB 4DFJA 2FVPA 3TARA 2ATLA 4TXSA 3D28A 4ZPDA 1LW0A 4O0JA 4TSXA 4LY7A 3OLAA 2OPSA 3QIOA 1L3UA 4DTNA 3V6DB 2YNHB 4FM1A 3H5SA 3HHKA 5L1JA 4C8KA 4ECYA 4J9MA 3VQEA 3CG7A 1XHXA 5EWFA 3GV5B 1T05B 4ZHRA 4DSKA 3NBPB 3B6PA 4K4YA 1N6QA 3BQ0A 3I0RB 2IOCA 3U6FA 3HO1A 1RTDB 1TK0A 4Q0BB 4WFZA 4JRPA 1XR5A 5KFAA 1GX5A 2IJNA 2WOMA 3AA2A 4ZP8A 2P51A 4FK4A 5T14A 1K1SA 2W8KA 1UOCA 4LQ9A 2E9ZA 3AA5X 3ITHB 5KFBA 4FLVA 3JYTB 2ASDA 5HLFA 1BHLA 2XY5A 2P5GA 1W25A 3SUNA 3BQ1A 1S1UA 1RTJA 1ZTTA 2C2RA 3KLEB 1IO2A 3DYAB 1IKWB 4K4XA 4FVMA 4FZXC 4B9TA 1HRHA 4W5NA 1REVB 5C5JA 3EZ5A 1ZBFA 1NKEA 2IC3B 3G6YA 3NKYA 2X78A 3D5MA 5KFZA 2UVRA 1LAWA 2I1RA 3JSMB 1T94A 2V9WA 4CIGA 2YNFB 2DFHA 4WZMA 3HYFA 4IQXA 3GIIA 3RB3A 3QGHA 3OSPA 2W9CB 1S0MA 4IKAA 1DTTA 3PW2A 4J2AA 4ZMMA 1VSEA 4DLEA 4RW7B 4LSNA 2CKWA 5KT5A 4F8RA 4JS4A 4KV8A 3EY1A 4M41A 4I2QB 4ZP9A 3RMCA 3DDKA 1JLGB 1VSJA 3AVFA 1L3TA 4NLSA 4CEOA 5EU7A 2D5RA 3HJFA 2Y1JA 3MEEA 4JV0A 2A1SA 2IGIA 5EDWA 1TP7A 3F73A 1U4BA 4B9SA 1JLQA 1NJWA 4NCGA 3HVAA 1RT5B 5KFCA 4J2BA 4ECSA 1F21A 4KO0B 4CF9A 4E1NA 4YR0A 2IDOA 1S9GB 3OYAA 1EP4B 4O3RA
chains in the Genus database with same CATH superfamily
2I0XA 3QYYA 1ILYA 3CJKB 2NRRA 1JLBB 4NLWA 2XSFA 2OYQA 3BO3A 1XMQF 2DNOA 4PG7A 1HPZA 4BHQA 1BWFO 4BWMA 2NLXA 3HPGA 5AQIA 5J1EA 1XR6A 3KMQA 2CGJA 5AZIB 4MLHA 1ZZFA 1N6QB 2W9CA 5GIPA 2AA4A 2AYGA 2XLJA 2YTCA 4LIWA 1O51A 1S4EA 3TNVA 2VWJA 1P8ZA 3I5BA 3DLJA 2CZ4A 2A2DA 4WP8A 3J80Y 4JKGA 1KQKA 3VAIA 5F8IA 2R2TA 1WC1A 4CLUA 3R5BA 4CJRA 1X0PA 1VRTB 2OELA 2Q3SA 2PIIA 4CTAA 2F8EX 1CC8A 1NDPA 2VDHA 4EI2A 1NK9A 2DXEA 2AJQA 4KI6A 4WYWA 4OPKA 1URNA 2KFNA 1GQEA 2DR5A 1FDBA 4B1YB 2CA9A 3SPZA 4IWVA 2MQOA 3WXLA 2WSFC 4FK0A 1XC9A 4OJHA 4DL3A 3T41A 3ILJA 2GMJA 4KB7A 4OLPA 2MPUA 2OJ3A 3DRRB 2B9EA 3ETOA 4YY3J 3I56N 2MGZB 2HVDA 2R7VA 3LDPA 1RBSA 3THPA 3ZT1A 4JV1A 2NYIA 3GDQA 3BGUA 3KLHB 2ASMA 1EARA 2P9IB 3W9JA 1YT3A 4CZIA 4FYYB 5AQZA 1JIHA 2N7CA 4AXIA 2Y8YA 1ATNA 5KG4A 1RDBA 4CJFA 4X66K 3CCRN 2GNKA 1OWXA 4JI6F 4B3RK 4OZ1A 5CYMB 1JLCA 4MO4A 3C94A 2E5GA 2LXFA 2VQFJ 4NLRA 1RAJA 3AXMA 2IM3A 2EKYA 1JKHA 2HVZA 4CZGA 1NRKA 2CUYA 4LF9F 1A9NB 2WVDA 1RT2B 3TUJC 4IDKA 4RX6A 2UXCJ 3HT0A 1ZBIA 2ZNYA 1U6BA 5HK4A 1DTQB 2RDJA 4EHUA 4ECQA 3IDHA 4ZHRB 4CRJA 1Y7PA 3HSGA 1M5SA 4OLBA 3D2EB 3MPYA 4QU6A 1WC3A 1NHVA 3TA2A 4QW9A 3K2YA 3CC7S 1K8KB 2JLGA 3O4NA 3LGHA 4ZLNA 5GAEP 2F7VA 2Q0RA 4QYRA 3BZCA 5CYJA 1X9JA 5JUMA 4ZIWA 3BR9A 2OCEA 1M90T 2CQIA 2E1RA 3WQPA 1HYSB 1JLAB 3VF6A 4V19X 1IKWA 1RTIB 3F9KA 5CH7B 2VC1A 1OYEA 4B08A 3OS1A 3QAEA 1C1BA 1T95A 2ZKTA 2HVIA 3TA1A 2XMVA 4BRKA 1HBOB 3KJVA 3D6RA 5JVHQ 2XBPA 1NNDA 3HZGA 3L8BA 2KKHA 3D67A 2MLYA 4I6YA 3OVSA 4DI6A 1EX4A 2NXNA 4NMLA 3K17A 4DTUA 3C14B 3D45A 4QIWD 2ZGZA 5A8RA 4B3TF 4BRMA 4WFAL 1MROB 1WEXA 1JJ2M 1BCMA 1JMTA 2P2CB 4FS2A 2V7ZA 2UXBK 4L3NA 1TL1B 2E5IA 1KD1O 2MTLA 4FM2A 1KQSR 5FLXY 5M1KA 4DR3J 2KJVA 3OTCA 2QL5B 3KDOA 2FZKB 4DCOB 3V1RA 3HZEA 4N8OA 1FDDA 4YB1P 4H5RA 2YKQA 1VC0A 2J4RA 3CC2N 2AKWB 3KLFB 3V4MA 1FDAA 3CCQS 3ICLA 1HKAA 4X64K 5HL7L 3I5CA 2ZJRL 1Z2LA 2ZITA 3FZ2A 1S72S 3QT8A 1IKXB 2M7SA 3MPDA 3THXB 2NREA 2NSBA 3VWSA 4BRHA 1HBNB 1AT1B 1HBMA 2Z1JA 3QGGA 3MM8B 4FSVA 1NPPA 1E4FT 2VGMA 2QN6B 4RWTA 1K6YA 1FRJA 2DPJA 4H5TA 4CO2A 3FBCA 4NMXA 1UWAA 4UQGA 3DLLQ 1MWQA 4BR4A 2NUHA 3ET6B 1VMBA 1I3AA 2ZWPA 1KLNA 4M63C 5M1PA 3BZQA 4BWJA 2HHUA 3MOJB 1F2HA 3KWGA 3QBXA 1HQEA 2I2YA 2AEJA 2ETJA 4NCBA 4DB3A 4IR1A 2RE1A 4DV6F 1VSHA 5HRNA 4RL1A 3ZCMA 4CO5A 3B82A 2VH7A 4I56A 2CWKA 1F3FA 4KHPF 1RCOB 4K0KK 1U8WA 3P6YC 3IN5A 3DRSA 2AQ4A 2B4JA 1TFYA 4JI8J 4JI5F 1JCEA 4DPXA 4NLTA 4LQ3A 3JB9k 3P49B 4BC5A 3I4PA 2B56A 4WP3A 5D3GA 4FW2A 1IBLJ 3TABA 4K4UA 2W9AA 4OHZA 1W9HA 4LFCJ 4OZ0A 2J7KA 1FRLA 3K57A 1C6VA 2OH2A 1NAQA 1GLJO 3FQKA 1G4CA 4EFHA 2KM8B 4JI4F 1WF1A 3CJ8A 1NJZA 3V9SA 2O4GA 2DXFA 2CQ2A 1TKXB 5KFEA 4PWUA 2YNGA 2QV6A 3VZHA 1RWWB 2AYMA 1QM9A 1QQMA 4R8UB 4YB5A 4FWKA 2QA4G 4HUFA 2E2NA 1VQ7S 4WYLA 3D54A 4M1KA 4QCLA 3MI7X 3O9QA 1VQPN 2ITGA 4LIRA 1U1OA 3DYAA 2VDIA 3A2FA 2VBZA 2HZVA 3ZETB 1IBLF 2M52A 4E0DA 1IBKK 3V9ZA 2DY4A 3G86A 2E2OA 1N5YB 2J9CA 1BMQB 1U1QA 3VEXA 4JI5J 2BMBA 3K58A 2R7WA 3AVGA 4FYDA 4NYZA 2ALYB 2DJWA 2HNYA 1T9VA 1AYEA 5C25B 4OHVA 3LP1B 4ZVFA 2YX4A 4QWEA 4KFBA 3WIUA 3HHLD 3M6XA 5THWA 4CGJA 5AXKA 4JI7F 4CIFA 3CSKA 4ED3A 2BE2A 1QUPA 3OR1B 4CESA 2DGWA 4LF5K 3V9XA 2V2ZA 1LFWA 2DGXA 4HACA 2UUBF 2V5HG 3WNEA 4YNQA 2F4VJ 2RD5C 4LRAA 1VQLS 2H51B 2PAVA 2DGOA 2I8EA 4CF2A 4MIBA 1U09A 4DU3A 5KG2A 2LFVA 1F9EB 1JX4A 3ZNJ1 4FBUA 4ISFA 2C3MA 2KHCA 5KG0A 3V6HA 3N4WA 4FNIA 4PQUB 3GPAA 4EZ6A 1N5YA 1YJWN 4LRDA 4I9LA 4H4KC 1PCAA 1VBZA 3PM9A 2D0OA 3THWB 3NS7B 2FBYA 4EBCA 3LQVA 2EG2A 4QR1A 1UW4A 3CEDA 3PRBA 3IFRA 4ELUA 4UY8T 3TRGA 4YOEA 2PBDA 1Y4ZB 3BKTA 4ED0A 1UZHA 2EK6A 1WKLA 5IV3A 3DLEA 5KG1A 4CF1A 4LBIA 2F65A 2HHVA 4ECTA 5FJ4A 2HFOA 4KHMA 2ATQA 2VL1A 4K8ZA 5KFJA 2R7YA 1Z1ZA 3CCLN 1HMVA 4CM2A 3KUHA 2HQIA 4IKFA 1YRUA 3M30A 2A2CA 2XZTB 2FJDB 2MKCA 4W5OA 4OPHA 1SJRA 4NYFA 2P1JA 1RT6A 4WQ5C 3HHLA 3GG0A 3OS2A 4WTOB 4C8LA 1HNWJ 3R9LA 4DL7A 4JB8B 3CCSS 1Y3JA 3LP3A 4FWOA 1Q8BA 3H7HB 3RVCA 3BPDA 1PBAA 1RISA 3AJDA 4XDDA 4EBDA 4AILC 4ZN3A 2CQ1A 3RR7A 3N4PA 2VKZG 1XK8A 3WC2A 3FEYB 3EZUA 3WT0A 3LDNA 1YRTA 3KHGA 1ZC6A 4KHPJ 3CCES 4ANDA 3G71S 2OUGA 2NXJA 1VRUA 1J9AA 3CF5L 1U7LA 3KJFB 2OPSB 5DQIA 3SXLA 3S8SA 1B7FA 3B8AX 4LJMA 2CIMA 3QIPA 1IVZA 2RDDA 5AQNA 2HK2A 1MN9A 1TKZB 4E2FB 1VQPS 1RT6B 4DTJA 1IKXA 5BR8J 2A42A 3MMAA 3Q86A 1G7CB 3WDOA 2Z2LA 3CPWR 4YOVA 1VI7A 2OSQA 1VBKA 3QT5A 5C2GA 2ZQBA 4DX6A 1EP4A 5HOOA 1Q1KA 2HRTA 1RA6A 4FJKA 4LF9J 4JYAF 4JI2J 1J5EK 3UO0A 1N56A 4H0XB 4ZLPA 3TQ1A 4OLAA 2CJXB 3CFOA 3ET6A 4DV0K 2ZBRA 5F1XA 3NGRA 5AR0A 3RB0A 1IJJA 5MLCQ 4J91A 3M8QB 3O3GA 2YY3A 4C11B 2JWNA 2HHXA 1W97L 2WW4A 2LQ8A 1HKCA 2NXCA 4WCEQ 2KL8A 1YIJN 1YG0A 2FSJA 4DR7K 3CJ0A 2CPZA 4L3QA 4NXNJ 3MR6A 2M9KA 1YTAA 3RW7A 3NGDA 1S0VA 4DS4A 5C12A 4RW9A 1M5VC 4AHCA 4LR9A 2I7NA 1YJUA 4ECVA 5TKWA 2F8TA 2R7RA 2V68A 3C6UA 2O8DB 4KHUA 3VEVA 4WFBL 6AT1B 1URRA 4DV6K 2A41A 4IRKA 2GIQA 1U04A 3AVAA 4CJ5A 1BL3A 3CXCM 3OYBA 1H72C 4H4OB 4M5KA 4H0TB 4KHNA 1K0TA 4Q44A 4X2BA 1N5VA 4MIAA 3VGVA 3P5BP 1KVKA 2QLFB 3J7AP 4U95A 3NMRA 2V9KA 1NBEB 4QYZK 5KFXA 3NRBA 2J9EA 5GAHU 2ZEJA 4IJNA 5LM7E 1RBRA 4RTFD 5FLXO 4WE1B 1H6KX 3AA4A 1JB0C 4DFMA 4RNMA 3CJBA 1S1TA 3EGNA 4ZP6A 5B0CA 3T5LA 4LFAK 2QX0A 3F44A 3M9NB 4MKAA 4X64F 1NKBA 5HRRA 2RDIA 4HUEA 3DOMA 1PJ7A 3VQDA 2OD6A 2EEYA 1FRKA 1CQNA 2FLOA 4DV1J 3OLBA 4MFBA 2FF3B 5HVHA 4OL8A 4PY5A 1H2TZ 3C6HA 2YNGB 3X3UA 1XMQJ 1BGXT 3D0GE 3OTOF 3RRGA 3DU5A 4Z2XA 3M6VA 4HCCA 2YHBA 1FE4A 4XIUA 1WAJA 2DHHA 4IG3A 4AF1A 2WBRA 3K59A 4YHHK 2DTUA 5CYQA 2RQCA 2QTDA 5IS2A 3DLKA 2Q3PA 4KGVB 1VS3A 4EK2A 3DAWA 2L9DA 3W5YA 3JQJA 2RHKA 1F5BA 2B5JA 1TKDA 4L6V3 2KHOA 1OH6A 1HBOA 4R25A 1FCAA 5ETQA 3KK2B 1KCFA 4DCHA 3CC2S 1D09B 1YZ6A 4PG8A 1B0TA 4PL8A 2AEFA 4KGZB 2ZJRQ 2V8PA 3H20A 3N0VA 1G15A 1FESA 2HQ3A 4ZA1A 3CMES 2ZHAA 1SQEA 1CEZA 1R6YA 1FNMA 1VQON 4CEQA 3SPYA 1VQSA 4YDUA 5AFUA 3ATVA 4G1IA 4NLGA 1S3XA 4RBVA 3LWMA 2G1DA 1V4SA 3VTHA 1LAVA 3JSYA 2UUCF 3A4TA 4EYHB 4K7QA 1RE1B 4OYWA 1M5KC 2X74A 5FPNA 2A3JA 2BGGA 1N48A 1S1WB 4X4TA 5GAHP 4LF6J 2CZVC 2DR9A 1XNQF 5KQ8A 2PEBA 3T5JA 3GR1A 1JJ2R 3ZTRA 3IO1A 4LF5F 3SCIE 2WONB 2J6UA 1OQ3A 5AE1A 4CJTA 3AO4A 4G6VB 4KC5A 1T9UA 2UV8G 4ELVA 4OX9J 2MSSA 2YWHA 3OR2A 2DR7A 3ZSQA 3N6LA 3SCKE 3MDFA 1LNQA 4M95A 3GV7B 1GK8A 4ATNA 1XI1A 4N76A 4EYIB 4J9SA 2F8MA 3ZEUB 1XNRF 2D69A 4PYAA 2XS2A 4NLQA 3HOTA 2Q79A 3U7JA 5HROA 1MW7A 5D4OA 2K1RB 5I3QA 3KG0A 2XO6A 2HSTA 1EQ0A 1S6OA 3GOIA 2IYGA 3LP2A 3EGVA 1S57A 1T11A 4DL5A 4DV7J 3EX7B 3GIJA 4MK8A 2KZMA 2VYPA 4CF0A 2KU7A 3Q8QB 1D3WA 2YKAA 3T19A 3VQCA 2QFIA 1KBRA 4AHSA 2C2NA 1KQGB 4ERDA 1EQMA 1F9HA 5DDOC 4EP5A 1X0FA 2X1BA 5FDLA 3NS5A 5CR4A 3ZSRA 4I6MB 3PYDA 4RR5A 2QL9B 4N56A 3UIQA 5CAAA 4CZFA 1IBKJ 2GIRA 3ALYA 3SAFA 7AT1B 1GLEG 2V8VA 4DDFA 2XTJP 2H3GX 3UN2A 4IOCL 3B4DA 2ZH7A 4ZCLA 2ASPA 1HNVB 1WG5A 3H2LA 3C8YA 1PJ6A 4C3LA 4F2SA 4M5NA 5J2MA 1JL2A 1RHRB 1S72N 4KHPK 2VPZB 4LRCA 4B1ZA 3J7ZO 4UZBA 1CULB 1Q86T 2RF2A 4C1NI 3K8VA 3C14A 2BX6A 1FRHA 2JDJA 3CCWA 3L7PA 3E2EA 2W8LA 2B8QA 4AD6A 3A8EA 2K3IA 3O9RA 4KB0A 3HKZD 4A8OA 1VQYA 2DGUA 3E8OA 3E3XA 4E98A 4FF3A 3OTEA 1M1GA 4DR4F 5C2DA 5F9LA 4DOZA 1LWXA 2XMKA 1HX1A 2HNYB 2HNDA 3LTOA 4EP4A 2QA4N 3TVYA 4HEA9 4F4ZA 4PUOB 2EFOA 5JLFA 2WK4A 4ZIVA 1BY9A 1GTEA 1IKYA 1T9TA 4Q5VA 4ETXA 2GEMA 2FHJA 1SUQA 1R8AA 2XY7A 3ULDA 2FY8A 3OL7A 3SJHA 2OPRA 3E9PA 2ALZA 3PIOL 2MEWA 5IC6B 4WKYA 4FJGA 4USJC 4RJVA 3ZTQA 2VGNA 1WHYA 1NWKA 3PO5A 2WRMA 4Y3CA 5LMUK 4I2PA 4OHXA 2Y8WA 4BQLA 1VJWA 4S0MA 4JI0F 4J9LA 4DUZK 1WOQA 4KREA 4NXNK 3M2RB 3KHHA 4DTRA 4LFBJ 3GMGA 1YJ9N 2B9WA 1QUVA 2DISA 2RB7A 4OV1A 1UVKA 3LP1A 5AQUA 1VSKA 1U2RA 4E1MA 4MTPA 4YS2A 4ISEA 1QVFM 1H7WA 4OV6A 2XSJA 4IO9L 4LMZA 4FKYA 2QEXS 3SDEA 2XLIA 3IP0A 5HQ8A 3MM5A 1TKZA 2L3MA 2LEBA 3DOKB 4JHDB 4ES2A 3LAKA 1TZ0A 2ASJA 4FLWA 5E0OA 4X66J 2P9UB 1QVGR 3QB0A 2ACYA 3QERA 2D74B 1X5PA 2XY6A 3MEKA 2Q1LA 1UAXA 3HBTA 2LLZA 1LWEA 3J7ZT 2G8FA 3V2UC 3WEEB 2B4VA 5BN9A 1HWIA 3OBWA 3MEEB 4ZLLA 3CETA 2WVCA 4AHRA 4URSA 4K4ZA 3M2VB 3M1VA 1FO1A 2FDNA 1FKPA 3GL1A 2VQEK 3WQTA 4DUYF 4B3OB 3I0RA 3UE5A 3QRRA 3UCZP 4PCQA 1S1WA 4J9RA 3CCVN 3FSXA 2HLUA 8AT1B 3CC4N 1GLBG 1T3NA 5DMRA 1QLNA 3PZPA 2FVQA 1K8AT 4K43A 3TAPA 4JI8F 2V94A 2HHSA 3BO4A 2RU3A 2M8HA 4O3NA 4DU4A 1RT4A 1RHKB 4F0HA 3VV2B 3IUCA 1QJHA 2B3TB 2P5VA 1U45A 4TNOA 4C4WA 1VJQA 1UW9A 2WW8A 4PUOA 4JD2B 2R4FA 2V8GA 3R8EA 2H9ZA 4L74A 3MMJA 4B3MF 2AX1A 2P9NA 2V4RA 2CNOB 2JEFA 2K7JA 1P9QC 4O4GB 2MKIA 4TKTA 3O4WA 1XR7A 1CQMA 2KXFA 4MAKA 1HYVA 1VQ5S 5GMDA 3Q8VA 2RUGA 3ZSYA 4JV5J 1RBOB 2P9KA 1IN0A 3SSQA 5JVHL 4ILGB 2M2BA 1WAFA 4OYXA 1GT8A 2EXUA 4CVNE 2HHHK 2J0WA 2XMJA 4M5IA 2VQFF 3I9ZA 2PMHA 4U67Q 1W2BR 1N5TA 2ZC4A 4DV5F 2HBQB 5FROA 4OJGA 4BRGA 3OSNA 4BVPA 3VN5A 4CIOA 1VLOA 4L73A 3NGKA 3ONQA 1VBYA 1R3NA 1ICEB 1U1LA 4LH4A 3OVAA 2OZSA 2AV5A 3BB5A 1AFJA 3QFUA 4HUGA 5DETA 2YWEA 3UWTA 2L48A 3W8PA 1GLLO 3HX9A 1M1KT 2YQ3A 4GMKA 1PYOB 1VQ8N 2AJ4A 5SZTA 1SJ3P 4ECXA 2FJAB 4QWDA 3MCOA 2BE2B 5LMUF 2QLWA 1U24A 2C22A 2D0PA 2DXDA 3VQ6A 4K4WA 4Y28C 1KONA 4U6PA 4BBYA 5JMNA 2NCKL 3ZEUA 3E01A 2J0QD 3ULHA 3R6MA 4FXWA 4CERA 4CT8A 2ZZMA 4F50A 3DLKB 2KT2A 4CH0S 5HROB 2W2MP 4CK3A 4LRFA 1NSQA 5KRTA 2XRIA 3T5HA 3CD7A 4JN4A 3FCVA 2ASLA 3VQ9A 3C6AA 3CCMN 1QY7A 5GAGP 2DK2A 5JVGL 1EETA 3GCWP 1RTHB 5JXSA 4MIWA 3FBFA 5A2QY 3RSEA 4DN9A 4UUWA 3CWJA 3KZBA 3PDNA 1Y9OA 1QS4A 4KB1A 5EY4A 5ETSA 4AHVA 2D9OA 1FDNA 2RMLA 1VHFA 4BG9A 3DKDA 3PR5B 1U26A 4BGBA 3VEYA 5CY4A 4DX7A 1NK5A 1UFWA 2BUNA 1PBUA 4Z4CA 3TAMA 1TL3B 2ZM6K 2IBOA 3WXJA 2VODA 5GADU 2DH9A 3SBGA 1KOOA 4PRFA 3H4DA 3J7AN 5F2RA 5KFYA 1TAUA 2ZBQA 3TVZA 1IR2A 4BDPA 2V51B 2KLAA 2CJKA 3GP9A 4F26A 2B0GA 1I5OB 4FN5A 2BM0A 2WVEA 3SCXA 2CJQA 4L75A 1HNZF 3KK3B 1ULRA 2HOEA 3OYIA 1UVMA 2CPIA 3VTIA 4N5SA 3O1WA 4OZ2A 1B92A 5AQMA 4KHYA 1REVA 3RJMB 2E7VA 1K73O 3H2UB 4DLGA 4ED4A 1PGZA 5KRSA 4C8OA 3R6LB 1HR0J 3KLGA 4DCJB 4GVEA 4CZKA 2O8BA 2JEIA 2RQ4A 4ZJOA 2JEGA 2ASOA 3QEIA 2R7QA 5KG3A 5KFKA 1IR1A 4YR3A 4DEZA 1JXVA 2DITA 2JSXA 1O1WA 2IVFB 2WTUA 2ZH5A 3MMCA 1KQSM 3AXKA 4OO1J 3D68A 5AQFA 4TXSA 2EFPA 2JL9A 3MD3A 4TSXA 4LVNP 4WP9A 1VQNN 3QIOA 3HSCA 2EFQA 4FM1A 4C8KA 2E5JA 4X4OA 2R7SA 4J9MA 4DV5J 3CG7A 2YQ0A 4USWA 5EWFA 2VFVA 4K5RA 1T05B 4ZHRA 4FF2A 5M1QA 4ISGA 2L9WA 3I0RB 4DV2J 3HO1A 1RTDB 1WF0A 4WFZA 5KFAA 2KJWA 3AA2A 4ZP8A 1B64A 4OQJA 3OTOJ 1K1SA 1MLAA 2UXCK 2E9ZA 4KJIA 3ITHB 4DR5J 4JI7K 2ASDA 3T69A 1KR4A 2C2RA 3KLEB 1IKWB 3UI3A 1WKJA 1U1MA 5GAHI 2DNRA 5E3RA 1KEKA 4CO1A 2I38A 4X64J 3D2FA 5B7WA 3MM5B 2UVRA 1LAWA 2UUCK 3MN9A 1UETA 2DFHA 2RIJA 1RGIA 3HYFA 2HLTA 4IQXA 2AEMA 3GIIA 2D1CA 3QGHA 4FKXA 4IKAA 3HHEA 3HTVA 1DTTA 3PW2A 2ERRA 4U8VA 1N33F 2NPFA 4PG5A 2BYCA 4RW7B 1R31A 2MKHA 3CIPA 4DR1K 2BOAA 5D0HA 4M41A 4ZP9A 3RMCA 3K89A 5LMNK 3HJFA 3MEEA 1SCJB 4M5JA 4FPBA 5IXUA 3J81U 1U4BA 3UVJB 2MQNA 5AXLA 3HVAA 1RT5B 1ZBSA 3O6QA 5KFCA 2GTDA 4CTAB 2YVSA 4YR0A 2IDOA 1S9GB 1S59A 4RUBA 3CXCR 2GX8A 2CPHA 2AF6A 1DJ0A 5KFNA 2BQ3A 2JGUA 4OZ5A 4CH1A 4HTIA 1D9AA 1CVJA 2VASA 3LM9A 4WE1A 4BRAA 4CGDA 1YTYA 2GVZA 2OMLA 1KAYA 4DFPA 4DR5K 2MSTA 1ZETA 4F25A 4CFAA 4G9ZA 4LREA 3OFEA 3BSAA 1RWUA 2YKMA 3ZTSA 5CCLA 3LF0A 5DZ6A 2DRDA 3C2PA 1XERA 3ZO7A 1B3TA 2GQ2A 3UN3A 3HK2A 4WIQA 3I32A 4DV0F 3G2XA 3JYTA 4OI0A 4U7CA 1UWBA 5J2MB 1Q95G 1BC6A 2E1PA 1CJTA 1TTHB 4JYAK 2OIHA 2BKOA 3L4QA 4NL5A 1RTDA 1HBUB 5M1NA 2XSJB 2GWJA 5KT3A 1TL7A 1YTUA 3QIPB 2DNKA 3NGTA 2M88A 1R27B 3RZAA 3CO9A 4USUA 5KFSA 2XI3A 3SQGB 1U48A 3MMAB 4I6WA 4CHNA 3L9ZA 5E3PA 4NCGB 2Z1IA 3L4BC 3CJRA 2O1PA 1SQFA 3JXUA 2P8IA 1SC6A 2M70A 3WNHA 3ENQA 1VRUB 3ENAA 3MN7A 4F3TA 1N5QA 2N82B 3EDQB 1WORA 2K3KA 4ID8A 5KPZA 5F0UA 3PSIA 3KLHA 5AXMA 5DJBA 4DUYK 1XIQA 3QSIA 3ETMA 4HTJA 4E89A 4Z7YA 1NXIA 4PPDA 3ZT3A 2HS4A 3D4JA 4GY2B 3AVNA 2F7TA 1FWPA 1KLMB 3VETA 4NRTA 4CZLA 2OGUA 3O8MA 3MM9B 4J9PA 4NLUA 3PJWA 1CPZA 3OUYB 2RPIA 3DOKA 3P3DA 5AQXA 3B6BA 3CCTA 2RT3A 3TA0A 2GJFA 4OIXA 4EUVA 3KK1A 4DTMA 3EJMA 1JLAA 1A0OB 4DV3K 4X65F 1HIYA 3PJXA 4FM0A 2ROPA 2BJ8A 1U1NA 3KKSA 1S1VB 2GVDB 1ZPWX 3EE8A 4UOFA 3DDIA 3U1MA 2D3OR 1GTHA 5AFUH 2OAUA 1IM6A 2HBJA 3DN9A 3F9MA 1N8RT 3BGOP 2BVZA 3DNCA 3H1QA 8ATCB 3MM6B 2QLJB 4FWMA 2YJFA 1D9DA 5CXTA 3HT3A 2SXLA 2GVZB 2JWLA 3DWLA 5BR8F 1KDNA 3P4UB 3QFWA 5JVGQ 5IT9O 4WBFA 4FWQA 3CGIA 4DUZF 1T3OA 1RACB 1YITS 3NFAA 4DG1B 1WHXA 2AGOA 3MM7B 1NGDA 2B7BB 2VPYB 1ZH5A 4WFAQ 1TUVA 3DHXA 3HULA 4BR5A 1LXNA 3ZT0A 3PTWA 4F3OA 1OVQA 4F4KA 3ILOA 4A8QA 4IFYA 1PSDA 1QHAA 3KLFA 1NJIT 2A6OA 1UA0A 5HAOA 4PHTX 4UOHA 4RNFA 2O01C 1FEHA 3C95A 1DEJA 3MXHP 5H9FK 1MWYA 3Q8UA 3GG4A 2WFBA 2GJIA 4LF7F 1HYZA 2HVHA 3AVCA 2UUBJ 1RT4B 4P7TA 2J8AA 4UZCA 2E66A 1N5SA 3IR6B 2GMLA 5ADZA 4CLKA 2P9PB 3H45C 3P31A 1D4XA 5AQTA 5I3PA 4B3RF 3KOAA 1W0HA 2QI2A 1DQ8A 1N32K 4QWAA 1E6YB 5CQGA 2XHWA 1J2VA 4LT6A 5KQDA 2F96A 4ZVEA 4FBTA 5CZVA 1SV5B 4CEDA 3NH2A 1E6VB 1RT1A 5KT2A 4CZHA 2G8IA 5ETRA 3NWRA 3HD1A 2XEXA 3O5BA 3MM9A 3SCLE 1XMBA 3HI0A 2DHGA 2YWWA 1X31C 3W62A 5GAEI 3S01A 4J9UE 4NO7A 1VGYA 1OQ6A 3VVTA 3VEZA 3EICA 2KHDA 1YJ7A 4AXJA 1BIZA 1SH0A 3FUYA 2B6AB 4NA3A 3S1TA 3DLBA 3CULA 4JI0J 4DU1A 4CEBA 2FQQB 1SC1B 5K8NA 1LOUA 3TSQA 3CPWM 1GEHA 4DJBA 2QMWA 3L7UA 4YFUA 2OLWA 2FLNA 3TUPA 2CGLA 1I94F 1QZ6A 3BSOA 3NOCA 3TUZC 3C3LA 2GV1A 2DCLA 4A8YA 3QEVA 1GXUA 4OX6A 3BDPA 1NM2A 1YI2S 3RMAA 4IQMA 5H1SQ 2ZH8A 2GHPA 4FJMA 2DHXA 3D6HB 2K06A 2CDRB 4BG8A 3CCMS 2QC3A 1IXKA 3PV8A 3CHWA 1NZ8A 2P9UA 1DTTB 3NE6A 2OHDA 1RKJA 2XYHB 3LH2S 4RCHA 2JZ5A 3AD9C 3MEGA 3B54A 2D3UA 3AO3A 1R0BG 4MK9A 5A8RB 1QQOA 4KHRA 4BR0A 3CW2C 3EXCX 2Q6CA 3AVIA 3GIMA 1ZPVA 1HNWF 4H54A 5GAEU 1C1AA 2HBMA 2MZQA 4H0YB 1HD0A 3HLUA 2LU2A 1HI0P 1NHKL 1TL3A 1UPPA 2O8FA 3F2KA 4EAHD 1ESVA 2WC9A 4Y2KA 2WVFA 1RAGB 5AQRA 2P9PA 4P2MA 3HOSA 1RWVB 1KKHA 1JLBA 3AD7C 2H5EA 1Q81T 3ZTPA 1VQMN 2C42A 1V5VA 3TANA 1C2PA 4R79A 3OYHA 5FIIA 4L76A 3FRZA 3TW0A 3MAAB 5CZXA 3MN5A 3HM8A 4B3SJ 4X4SA 4CJ4A 1RI7A 2KXHA 3RUBL 3KTQA 2ZJQL 3MR3A 2R8IA 1EJ7L 3OVBA 2G2YA 4B9QA 4WPAA 3DXKA 4KTWA 2J9DE 2FHOB 1MWMA 3DLEB 3SZ2A 4OJ3A 2J76E 2GC8A 1N32J 1CJTB 4KPYA 2YHWA 3GG1A 4PYDA 1FXXA 1C1CB 3IRXB 3CD0A 1MMDA 2Q97A 5I42A 5GMEA 2R42A 5ETPA 4X62J 1X1PA 5C42A 3RAQA 5DM6Q 1UJ5A 2ROGA 2ABYA 5KFWA 4IUFA 3N5FA 2EWSA 2FGOA 4ZVHA 4CWBA 3BBCA 3AB2B 3ZLJA 3HHLB 4PKDB 3VEWA 4EO8A 2DPNA 2ZGYA 4M3YA 1V9OA 2A1BA 3KK1B 3C7NA 2HHHF 2MQMA 2E29A 5CYQB 3EZOA 1KFSA 3NY0A 4TYBA 4JI7J 5L38A 1HNVA 3NGSA 2DNZA 1X4GA 1AZSB 4Y6IA 1YK9A 4QR2A 3TSPA 2HNDB 4F4XA 4ECWA 1GMWD 4LR8A 2FD2A 4ECZA 5CZ1A 3DC2A 3CT9A 2QL7B 1G2EA 4BCAA 4F4AA 1NEEA 2PC6A 1JQGA 3VF2A 3SBMA 1PAEX 2HIYA 2DTJA 3VQPA 5BRDA 3EKUA 3JS9A 5DM7Q 3GU0A 2XULA 2CH5A 1A5VA 1J54A 3GFZA 2HBZB 2Z57B 3NHGA 2DHAA 5L9NA 2QWMA 3WZ0A 2PDAA 4AE5A 2XGQA 2HZAA 4BC7A 5F8NA 3FBBA 4B3TJ 2PA3A 4IH6A 3DJCA 4GC6A 2FF6A 1RT3A 1K73T 1SL1A 2J7WA 3TWHA 1D1UA 1Q53A 4JI6K 2NS1B 4FF4A 4BC2A 3PRDA 4OI2A 3GR0A 1L5UA 2HQDA 2OPQB 2NUUG 1H73A 1QE1A 1Q8LA 2AX0A 4C0OC 1HA1A 3A5MC 2CNLB 4ZKAA 2VG7A 3BZKA 3L2QA 3R7SB 2FJXA 1K8KA 5CCMA 1T03B 1AUDA 4J7CA 2DPIA 1H74A 1WDDA 3V4IA 5M1OA 2F4FA 4OGEA 4CEFA 3MM7A 4FOEA 1J5OA 2GS8A 4KAIA 3C16B 5IC4B 1T02A 1U02A 2PFDA 2CQHA 2FB0A 4BRQA 1DHMA 3U1LA 3V1QA 3ZSOA 3O2IA 1WG4A 2W7AA 1X5SA 3N4QA 3UKRB 2RHSB 2B6AA 3QBWA 2HAIA 4K42A 1NKCA 1NDLA 2G0JA 1H2UX 1D5AA 4CO0A 3CMAN 1GOBA 1BLUA 3DHWC 3QPIA 2U1AA 4NXMF 2KN4A 1AZSA 4BVOA 4H4MB 3OTBA 1JL1A 4GKKJ 1JJ4A 1VOMA 2DY9A 1QE1B 2ZH4A 3CDBA 2YKNB 3D3BJ 4DN0A 1HHTP 1KD1T 1NCLA 4DR7J 3CJ9A 1NOZA 3OL9A 1IKVB 1AROP 1NGJA 3VPZA 3WNGA 4OX8A 3UVJA 2OTLS 2BJ9A 2RRNA 3PHTA 5KT7A 1DURA 4A48A 3CPEA 1E6VA 2IDLA 4HR2A 4C11A 4YOTA 3GJSB 3D1OA 3RTVA 2ZUAA 3AQOA 4Q8EA 3QWUA 5GADP 2JOQA 3V9WA 1LWCB 3IS9B 4R5PA 1CZAN 3S3MA 4WK1A 1KQFB 1XWLA 1UCNA 3Q7BA 2FLPA 3DGVA 3H42A 3NVMA 4GKKF 2HNZA 2PT0A 5KTQA 3PW4A 3EYZA 1X9SA 4TVAB 5F8HA 3AB4B 3PYGA 3JSBA 1HJRA 2IVMA 5KFTA 5FRNA 1RUSA 4ED1A 3MEGB 2VA2A 2FSKA 2X51A 4PXEA 3O9UA 4OKKA 3G25A 1VYAA 5KT4A 2XNQA 3X1LB 1HJOA 2HWHA 3CDEA 2VC0A 1KFDA 3P8BB 1O8BA 4C0BA 1RDRA 1OSDA 3PXGa 3A5NC 3T1YJ 3SNNA 4O44B 1ZTWA 2B4OA 4LF7J 2ZD1A 3FSIA 3VGLA 1VSMA 1ROFA 4W90B 2F8SA 5AZJA 5BXIA 1O5JA 3OJSA 4WU2A 4CO4A 1TVRA 2HHTA 3ISNC 4F02A 3OA9A 1DLOB 2NXEA 1VIOA 3RG6A 3KD5E 4FJNA 2O4IA 2Z1HA 1YI2N 3M1FA 1RDUA 1T6CA 4A5AA 4FWLA 4K4SA 1HUXA 4CJKA 4AFFA 3GFHA 2M5YA 2IBKA 2EWHA 3K9JA 1HNXK 3SUPA 4QS7A 1IKVA 2IRUA 1AFIA 4GVMA 1YJ9S 1SL0A 2KTQA 4CJUA 3G6ES 5FPEA 4CGHA 2A6MA 5EHHA 2GAGC 3IA0A 1RQ0A 2WSCC 3DRPB 2C1EB 1RDCA 3OL8A 3AT1B 2CJAA 4A62A 1RP5A 1Y5NB 3PKMA 2DNGA 3PHEA 4PG6A 2YKPA 5EXWA 4FYVB 3B6OA 4LFCF 1Q9XA 3R9PA 2YNHA 4KHSA 2DNLA 4Z4GA 3MXJA 2FC0A 1R7IA 1XQIA 3I33A 1S9EB 2HGMA 1DTQA 4X65J 3ZX3A 1ATSA 5DLGA 3TAFA 3DRXA 3ZSWA 2YH0A 4G1QA 2CPJA 4HT5A 5HJYA 3QJLA 2WOMB 2Z0GA 5E7OB 2V63A 2G8HA 3U1NA 4IFYB 1FKAF 4NPOA 3SFUA 1LWEB 3OHRA 2JNJA 3KD1E 5HP1B 3AVBA 4M3RA 1HYSA 2Y0BB 3M2VA 3KDNA 4H4OA 3D7EO 5SUHA 1FNOA 1GNKA 1DZ5A 3R1LA 4BDZA 2E5LF 3NGIA 2UVWA 4I7FA 1PC5A 4HHHA 1ATRA 4BR2A 2B4PA 2E20A 3OHBA 1U2VA 1R8HA 3QFHA 3W7BA 2JRSA 4CEZA 4EGLA 1SVDA 5D4PA 1S10A 4CHPA 1IBLK 1TYQA 2OTLN 3MDQA 2HBRB 3CMEN 2PO4A 4IH7A 3BSCA 3FLCO 4C8ZA 1ZXOA 2VONA 2ZWHA 5KFPA 2DNPA 2MY7A 5A2QU 4F7VA 1IQZA 1WNSA 2CQPA 3HP9A 5B0AA 2HB5A 4DQQA 3RAXA 1Q16B 3AARA 3CERA 1NG9A 5F3ZA 4CYUA 5GVQA 2F9JA 1TKTB 4CJVA 4U9RA 5BR8K 2UXDK 1UP1A 4P10A 3FFKB 2CWXA 5D78A 2G9OA 2IVNA 1Z6RA 3JAMO 4EU0A 4NA2A 2HYIB 3QBCA 2QE5A 5ITHA 2XWYA 4JI2F 4B3MJ 2X1AA 3GBTA 3R1XA 1RWNB 3UD3P 5EN1A 1D0EA 2QIFA 4KKOB 4LH5A 4FS1A 1RB0A 2DRAA 2E2PA 3MCPA 2IYIA 4KY3A 4IH5A 4I6MA 3ATUA 1YLXA 5E41A 2E1CA 3MMVA 3NCRA 4IXCA 5KAKA 4NXMJ 4K50A 4O3QA 2IY5B 4OKEA 1FF2A 3PEJA 2CJ9A 4IRCA 4BACA 4OYOA 1VRTA 2C3PA 2Z56B 3SUQA 1WG1A 2E4LA 4YMEA 2P9LA 5F8JA 4K2JA 2J0XA 3FGVA 4PWDA 1U25A 3MCSA 2W40A 4IFVA 2IS3A 3H2VE 1HQEB 4ILJA 1QAIA 2E6MA 2GX9A 2GIFA 3GONA 1Z25A 5LMUJ 1AW0A 4W5TA 3EGZA 4LFAF 2RN2A 4AT1B 4J5OA 3V4IB 3E9LA 3IBWA 1N33J 3D66A 1N54B 2BE7D 4MDAA 1ZBTA 3HZ6A 2O3DA 4DL2A 4FJHA 4ECRA 3L2RA 2ZJQQ 4RO0A 3FCWA 4LF1A 2XZWA 1NNEA 4PA1A 1Z4UA 3WBZA 1KVIA 2C3UA 3M30B 4CYUB 3R8YA 2I9SA 5HLFB 4XAKA 3PLAA 1TAQA 4O3PA 3MN6A 4DPTA 4K8XA 1RJJA 4PABA 3C15A 3VERA 1HKBA 3H90A 4USMA 4NLBA 4EIAA 3UDVA 1RYRA 5A8WB 4QAGA 2R8KA 1IM4A 3F0NA 4HDGA 4GVBB 4OYMA 3IGNA 4C8MA 1B70B 2FC8A 3UE2A 2P5OA 1TVRB 1BISA 1C0GA 3D2WA 2OD4A 3P1GA 3D7SB 4B3TK 2QWPA 4OGCA 3MR2A 3BGLA 3SI8A 1UFLA 2RJZA 4CO3A 1M5PC 4DV5K 1WWHA 3H6EA 3T1YK 1JLFB 1Q82O 1RCXB 2EKNA 4K4TA 4DQIA 2MB0B 1EO1A 2E9RX 4RBUA 2LECA 3R97A 4H4KA 2EX3A 2OEMA 3ENHA 1RT3B 3NF8A 2YKOA 1GLFO 1S48A 1YF5L 1VIXA 2NRXA 1HI1A 5FPMA 3NH0A 4LF6K 1ZM9A 3BN4A 3OY9A 5A8WA 2H65B 3VMFB 4DZDA 3AHPA 3D3CJ 5AQGA 2EFVA 1X4EA 1VSFA 4TU7A 3VF4A 3BN7A 1E3MA 4C2MA 1KVBA 2GELA 2AZ1A 1PG5B 1RFQA 5KFHA 4DU7A 2Y0SD 4GKJF 4M5LA 4PWDB 3E9OA 2Q6BA 4Y2IA 1CXQA 3T1HF 2DGQA 2QA4S 1S9GA 1KHWA 2ZUGA 3CJ3A 1HBUA 2KM8C 5AQYA 1GFWB 2CAJA 2GJ2A 1PO6A 1B9FA 4JV5F 2M0GB 2W6LA 5KT6A 2CQCA 5IFMA 2L9NA 3CCUN 5C2FA 1ELOA 1S76D 2QTWA 2HZCA 2KVIA 1N0VC 2NRHA 1BG3A 3GLJA 2F9DA 4ZVOB 1FWKA 3TTCA 1SH3A 4U7BA 1I6JA 3QFPA 3IRWP 2DO0A 2H54B 3C46A 4BC3A 2G2OA 4A8XA 2NRZA 3ZSZA 5K14A 3NG8A 4Y2AA 1G99A 5IQ6A 4KH6A 2VU5A 1X3MA 4DSEA 1RWKB 2ZOFA 2YX7A 1BHNA 3T1HJ 3SSRA 1YBUA 1A5XA 2YX1A 2ACMA 2ZHBA 1C0MA 1RAAB 3HF5A 4Z4IA 3CC4S 1LQ9A 3HXMA 1FX2A 4I68A 3I8BA 4P9SA 2OA8A 1SS6A 1TU0B 3Q8YA 4HI2A 1BA1A 5E84A 3IKMA 4BE0A 4CP5A 3Q2SC 3ULEB 1IR0A 4ID5A 3UR0A 4Z4HA 2PN6A 2ZE2B 3CVKA 2IMWP 3HHLC 5MAOA 5KG7A 3KHRA 4ILMA 1S1XA 1N8RO 5DGAA 1K0VA 2FJBB 2Z2MA 4CH7A 2V69A 5CD4H 4OYBA 1TUWA 4DG1A 1WEYA 4B9MA 5BYRA 1X4AA 2GMHA 3MM6A 2F5GA 4TU9A 3OW2M 2O8FB 1RBAA 4EHTA 4BE1A 4WIIA 3D2FB 4RG8A 5AQWA 1RT2A 2OEKA 1GH8A 3DCAA 2ZM6F 4H0VB 2R7UA 4CNZA 1P90A 3K5PA 2UXBJ 4QIEA 2YI1A 3D1QA 3WC0A 3QGPA 3R7NB 1WUUA 3DRSB 4ZS6A 3CMQA 5LOQA 1MWKA 3CM6A 3AQPA 1C0UA 3FGUA 1N4LA 3MD1A 3H08A 3FFIA 4WXWA 1RHJB 4CECA 3S6EA 5L1IA 4A47A 4JEPA 4A2AA 3VAFA 4CQ1A 3CCEN 3QINA 2YPZA 1QTMA 1ZBUA 2MZJA 3LALA 2ADCA 2EI5A 3U3GA 3N6NA 2GGPA 1BQMB 3T1AA 2WBNA 4A2BA 4CLYA 4KRFA 1CLFA 3M7VA 3VZIA 4IG0A 4FVCA 3ZZZA 3GB0A 2CNNB 2D1KA 2N3OA 2ZHOA 4NYOA 3LPYA 4CDIA 4NX9A 1F9FA 5DM6L 3BM7A 4DV3J 3SAGA 2M4MA 2VWBA 4AL5A 2EC2A 3GJRB 2HS0A 1P9YA 4FJ5A 4ZPBA 3BS9A 2QWRA 2JEJA 4QWBA 4WWSA 4DU8A 6FDRA 1HD1A 3S3NA 3FFIB 4Z7CA 4KR0B 4JK8A 3AJ1A 1SIWB 3MMBB 5L46A 3H3OB 2P9LB 5I4MA 2V2VA 4A8KA 2BM1A 4FO0A 3L3CA 4NRUA 5D0EA 3RMDA 1SJ1A 3LZJA 3ADAC 4FCYA 4DV2K 4OZ3A 1YUWA 3S7RA 5BRFA 3ZZ0A 4AL6A 4M8LA 4NXMK 1NB7A 4Y65A 5ETLA 1XEZA 1RDAA 3ZSXA 1EIYB 2HHPA 3NGUA 3EMTA 1VQKS 4ZP7A 3AA3A 2LSNA 4DMNA 4ENOA 3UW1A 1WI8A 3TI0A 3TAQA 2VQFK 5C24B 3D0PA 2G8KA 1BQNB 3S41A 3MHYA 1LW0B 4MLEA 4IEIA 4X4NA 2NUBA 1LK7A 4DPWA 5F3TA 4RUCA 4YR2A 4CHQA 2QA1A 4I9QA 3CJCA 4YOYA 1KVCA 2HMPA 2CVEA 1YHQS 2OPQA 3QT7A 5T41A 4DR6F 1CSJA 2V6AA 3A8YA 5HMWA 2DEIA 3GYGA 1BCOA 1G6BA 3OS0A 1VK3A 4URQU 1CJUA 2MZRA 4GO7X 3ILLA 3K7RA 3A3PB 2HHWA 3BBBA 3MXMA 2GHVC 2W2OP 1TYQB 4DHYA 5C10A 1XNQK 3NP5A 1S0OA 3IAS9 2R3VA 5HN0A 1BOTO 2ZFHA 1FKOA 3OYCA 5LL6Z 2BZ2A 1JLCB 4YDDB 1VQ5N 3TARA 2HFZA 4F36A 2RE2A 5E33A 2ATLA 3D28A 1LW0A 4I69A 3U02A 1SQGA 4LY7A 3OLAA 4LUBA 2OPSA 2M3DA 4JOUA 5F0WA 2YNHB 2R9LA 2IIHA 3HHKA 5H9EJ 4H03B 3AOCA 4ECYA 4I1TA 4PG4A 4PKGA 3OQ2A 3VQEA 4ZCKA 4BC4A 3GV5B 2VQEF 2LKZA 3W5ZA 1Q78A 3B6PA 2Q2RA 2IOCA 4LF5J 3U6FA 1KWMA 1TK0A 3RSEB 4Q0BB 1XR5A 1GX5A 4FK4A 5T14A 1FFGB 4LF6F 3OPKA 2OFHX 1X4BA 1NGIA 3L09A 1APSA 1MMNA 2UU9J 2P5GA 1W25A 3B8HA 2XYGB 1Q7LB 4YDUC 2IMOA 2PFFB 3UNYA 1TR0A 3DYAB 2QT7A 1J5EJ 3PIPL 1WSRA 1OH8A 2CPDA 3Q83A 4LBHA 1ZBFA 1NKEA 2MDAA 1DQAA 4X65K 2B8PA 4DX5A 2X78A 2DNMA 4PKHA 3D5MA 4WU3A 4JNEA 2FY1A 3SDEB 3JSMB 4CIGA 2P9GA 3MWTA 3TSUA 4WZMA 3WUHA 3RB3A 2E1YA 2YWKA 4OI6A 3OSPA 4ZMMA 2X1FA 3GTYX 4DLEA 4I0WA 3T6BA 4LSNA 2CKWA 5GAGI 4F8RA 4J90A 4E1JA 1HFEL 4I2QB 1YXQA 2JH3A 3M32A 3DDKA 1VSJA 4JI1J 2U2FA 3CJAA 3OD2A 3DDNA 4JV0A 3RRKA 1JK9B 4F0KA 5D0GA 4B9SA 5IWAJ 2DBBA 4NCGA 2Q36A 5HANA 4J2BA 1ACMB 4ECSA 1F21A 3EE9A 3R5JB 1K8AO 3Q7CA 4LF8K 1SC4B 2FZCB 2JC1A 5HRSA 5DZ7A 2G13A 5C7PA 4OZJA 2HBYB 4CJSA 4FJXA 5KFQA 2HQGA 4IDHA 3JSMA 1X5OA 3SIPB 2W4CA 2A18A 3M9OB 3EN9A 4M42A 4FLXA 3DM2B 1VQ8S 3M8ZA 4JK9A 1S6PB 4Q8FA 4CHZA 5E3AA 2GQQA 3ZTOA 1PC4A 1YDLA 4U96A 3KLIA 2FJWA 3EGWB 4DSJA 5IT9Y 3CJTA 1XMOF 3V6JA 2FBTA 1BDGA 3LA0A 3VGMA 3C16A 3WX4A 3N5BA 4OX9K 1IBCB 1IJEB 3DRPA 1YJWS 3FBEA 3U9ZA 2E9TA 1EX8A 3AVMA 4PL7A 3QNWB 2CXEA 3FR0A 1R43A 4A8FA 5FD1A 3I55N 4DR5F 3CFRA 2EFGA 2DCUB 1YKWA 5I3UB 2AZ3A 4DR7F 2RRBA 2GO8A 4UY85 3M6UA 2HGLA 4FWPA 4GO5X 2ZVSA 1Q79A 3AO5A 2PEHA 3ZX2A 2LDYA 4JUZA 2W25A 3LZIA 4WK3A 4R0JA 2ATCB 1TV6A 2A5XA 3TZZA 1NJYA 3G8SA 2RAQA 4C9DA 1S1TB 3MEDA 2W4PA 1I51B 3O80A 5A6WA 1N34J 3MUTP 2LEAA 1X9WA 5HBMA 3QEXA 5C15A 3K5NA 2RVJA 2RUSA 3ENOA 2B5JB 2IM0A 1QVGM 2XMMA 4Y2CA 2BJEA 3GIKA 4X62K 2BQRA 4M94A 4DR1F 4J9QA 3HCXA 4HHUA 4Q7AA 1NM1A 1D8YA 4GVBA 4B9UA 5EVZA 1HQ2A 5K20B 4I7FB 1R0AB 4EWTA 2X3GA 5IZHA 1L3VA 1S77D 2D7SA 4CFBA 4F2RA 2IM1A 5B0FA 5KFOA 2Z2YB 2V8DA 3OVNA 3J7YI 5G4DA 4FNHA 4DMZA 3WQUA 2XS7A 5AE2A 8RUCA 5D77A 1YIJS 5KFDA 3CCVS 4CFDA 2X6SA 3AH6A 2Q31A 2QLXA 4P2SA 1WI6A 2FHKA 5HBMB 4OVLA 1FHTA 1Y10A 4BE2A 4CJPA 2GZOA 4IJAA 4FJIA 4FJ8A 3QSYB 4Z94A 1GLAG 1NGFA 4BROA 3BKUA 3ZT4A 3HL8A 4NB4A 2F8HA 2QFJA 4CJ7A 1S79A 4CLTA 4BDYA 4FW1A 3QRPA 1QVFR 4KFBB 2B7CB 4O5BA 1ITPA 1S6UA 1FJGF 1W2BM 5HQLA 3QETA 2NR0A 4LFAJ 2P9SA 2W2NP 3VAGA 1YITN 3V81B 2KG0A 2DGTA 2UYTA 4RW9B 4LD0A 2UVUA 2KI2A 5KFMA 4XK8C 4AHUA 4EEYA 1UVJA 3QGIA 3KNGA 5LSOA 1TFWA 3BF1A 2BUPA 1Q5YA 5J2NA 3LPUA 3Q8RB 2E1MC 4YEAA 3OL6A 1Q7YT 2VOPA 5MLCV 1TV6B 1DFDA 3D0IE 4IBNA 3OYKA 1JNRB 3RGIA 1RWXB 2R8JA 3I0SB 3QJPA 4KAZA 1VQOS 4HT7A 3UQSA 5J2PA 2FVSA 5L1LA 1T44A 2UP1A 3RYLA 3K5LA 2QA2A 2B9YA 4AQYK 2B9XA 4MO5A 4MYUA 3CDUA 4Q43A 2R2SA 4TY8B 1C0UB 3DMJB 4N77A 4TQRA 4USVA 2LP4A 4AHTA 2MXYA 2C2ZB 3P45B 3CTRA 4OHWA 2KQ2A 4CM0A 3DLGA 3SCJE 2D41A 3SSSA 4KIAA 4B3SK 1GXTA 3R6GB 3FMBA 4WJBA 4I2QA 2H4YB 4LSLA 4I64A 4K41A 3F56A 4WCEL 1CJVB 3L3VA 3IBCB 1CJKB 1IBKF 4CZEA 4ZN1A 2VFSA 4M7XA 2FGCA 4KO0A 1VQ4N 1RLDA 2GGPB 3G96A 2CQGA 2MQLA 5K8MA 3H46O 2AWZA 2N4CA 3PUFA 5KFUA 2Q1NA 3R5DA 3MMBA 3IAYA 2BDPA 2NYHA 4NE9C 5JS1A 3H1VX 4B8CA 2MKSA 3MUVP 2KYZA 3J80U 3TOQA 2EFNA 3O4QA 5CYMA 3J81j 4BRCA 2IA0A 1Q5VA 4DV1K 1HNXF 2GO9A 3ENVA 1QAXA 1ZA1B 4E7HA 2KT5A 4ZVTB 1AXQA 3HMJG 3BUZB 3TTFA 4HL9A 5KFFA 4ED8A 4B1VA 1RA7A 3CD6S 4KKOA 3MCMA 1Q4RA 3OYEA 3NMUA 1BQNA 1SJ4P 3I6PA 3A8KA 2GFFA 1BQMA 3E66A 2KRRA 3KG1A 1VC6A 2GV9A 3EM1A 4GV6A 2XB2D 4XH1A 4P7VA 3IR7B 2AJ2A 2WCXA 1WSEA 3V6DA 5LL6d 1Z2ZA 5AQVA 2E1ZA 2UXDJ 2KYXA 4LF2A 5FRMA 2D3O1 3ZT2A 1QSYA 4B17A 1WOSA 3H5UA 3TUIC 1YBAA 5ADXA 3TVKA 1ASUA 5LMNF 3BYPA 5DK5A 3HHDA 4TQSA 3G10A 4CK1A 2BXJA 4JKFA 3QZ8A 3TJ8A 3IG1B 4N8NA 1S9FA 2HEKA 3Q22A 3V6KA 4CHYA 3NBPA 2MHNA 2VWKA 4F04B 3Q0AA 1RT1B 1OIAA 1QSLA 2WZ1A 4K25A 4DTSA 5AQPA 3BP8A 3NDKA 4N7TA 3KFWX 4M63A 2A6AA 3PO4A 4C23A 1SPBP 4JI8K 3LP2B 1DLOA 2BKPA 2RNEA 3NGYA 4CFCA 1TELA 3J81O 2AP6A 4B02A 3O08A 4ZOSA 1BUXA 1WELA 3R1HA 2LA6A 4CLPA 1NDCA 1L3SA 1FKPB 1FVQA 1NPKA 4F4YA 1PILA 1OVYA 4G1QB 1U2CA 2QW9A 5HVFA 1T9YA 1JLEA 5RUBA 3OXFA 1RU1A 3G6VA 4NI2A 3BO2A 4N41A 4RW8B 2XCAA 2JFKA 3POTB 5HP1A 3GJTB 3CI5A 1Y64A 3CJ2A 2NRTA 2F9TA 4M5HA 3QRQA 2KH9A 2HWIA 4MFBB 4B3OA 1QSSA 3AO1A 5JLHA 3GCXP 4XH5A 3OFGA 3JTPA 1PYTA 4JKAA 4J9VA 1VFJA 3MAQA 2NQPA 3SMPA 3FEXB 2FUG9 4EO6A 4ZJLA 4CLSA 1J5OB 4C97A 1B7YB 1XUPO 3SI6A 1CZBA 1VDHA 3CCSN 2EVZA 3W0LA 4GRSA 3CQYA 2DH7A 1YGYA 1N88A 4GNIA 1H1VA 4KYZA 5IWAK 3DOMB 1UTAA 5DLFA 2EW9A 2E5LJ 3POTA 3THXA 5BREA 1HR0K 4MMOA 4O4GA 1YJNS 3PJ9A 2G4BA 3ID8A 3I31A 4BY9C 1T9WA 3VQQA 5EGYA 4JLHA 1S99A 1IKYB 2V0NA 1NGGA 4OI3A 3M32B 4E7JA 1NH7A 4BRNA 3G8QA 3HJVA 1GAOA 2ZH6A 4YY3K 3LPEA 3C0BA 4CEAA 2GA7A 5BYQA 3HSJA 4DV7F 1YVNA 2J6TA 5C24A 3ZZRA 1X4FA 5E2QA 2JVRA 3UKRA 1U1PA 2VJVA 4BRFA 2CADA 1SQKA 2YV0X 4GKJK 1S0NA 2BQUA 2VIHA 1KXPA 4B9LA 1UFKA 3AA9A 2RS2A 1N34F 3G82B 4XO0A 2V4QA 2Z2ZA 3HFZB 2ILZA 3DLLL 2MJUA 4Z0UA 4AH9A 1U0HB 4HDHA 3I96A 4YQWA 4LF4K 5B09A 4B1XB 1WOPA 1RTHA 3ISND 4HKQA 2CQ4A 5HRPA 3CC7N 2YKNA 3DLGB 1VQ9N 3D1HA 3FE1A 4O0NA 3CJ7A 1BU6O 3U4LA 4NEYA 4DSFA 1NHUA 4Y34A 3TP2A 3PR4A 4EBEA 4ED5A 3P4IA 2RILA 2HRUA 2QYGA 1WSIA 4TYAA 2LQ9A 3E01B 3W60A 3U8XA 2O8EA 4PPZA 5J1PA 1LWFA 4USHA 4J37A 4DV4K 2NZ4A 3W63A 2LVWA 3ZSVA 4OX7A 1N36K 3H5YA 2ZVIA 1HLWA 1HNIB 1HKGA 4QIVA 1W7AA 1RHQB 2LQ5A 2IJFA 2WSEC 4J2EA 4Y0FA 2Q0UA 5ETTA 4FDFA 2OFGX 4IFVB 5AXNA 5IOLA 4CBUA 1Y5IB 2PGCA 3O3FA 2Y1IA 4YP3A 2YBVA 1DGKN 3TU5A 3FEZA 4CGIA 4L8RB 1DAXA 1OS5A 2NZTA 3ZETA 1FXLA 4DQSA 4Z4FA 1CJUB 3NWGA 1V6HA 2LQBA 5KPRA 3KLGB 1PJ5A 4B3RJ 2UUTA 5M2RA 3G9CA 4JI5K 4CW7B 5J1EB 4ER8A 2VZ9A 4O3OA 1RBTA 1YVUA 4NLYA 3KK3A 3H40A 3TAMB 2KFYA 3DGPA 2HQCA 4A46A 4IO1A 2KT3A 4BGAA 4BREA 3A1YG 3SQOP 3BYRA 3FNNA 1FK9B 5AJ3J 3IXQA 4JK7A 4DZ6A 1B0VA 3QQCD 2DIVA 4RWWA 5J2NB 4TY9A 1BI4B 3A5LC 3PG9A 4B9VA 2RF2B 2CPXA 5EX3A 2R2UA 3SMZA 3AVKA 3J7Z5 2VBXA 3I55S 7FDRA 3MOZA 3S3OA 1OY6A 5B0EA 1DARA 5CHIA 4LF7K 2HBLA 1CXUA 3PRVA 4N47A 4JYAJ 1RWOB 4EZ9A 1SXLA 5KFRA 3CUNA 2XMUA 3K5MA 5HMZA 2ZH3A 1DKGD 4DSLA 3LWLA 1T05A 4LR7A 3VCDA 2FVRA 3KUGA 1HBNA 2I5JB 3VGTA 3DMJA 1RSCA 1R0AA 1U1KA 4FWNA 3IGVA 4A59A 3BR8A 4DF8A 3SQ1A 2HFNA 4E7IA 3EUNA 2MMYA 3L6QA 2F1FA 3OJUA 4DPYA 1GX6A 3BEGB 4P2XA 3FMWA 1W7WA 4F4WA 2W41A 4LBPA 2ROEA 1RAFB 1VK8A 4RW7A 4MJKA 5KFLA 3VAKA 3MCAB 4IFEA 1U47A 1WTFA 1WKKA 3VAHA 2PZSA 4JKEA 5J2PB 5K9FA 1G3OA 4P52A 2AYEA 4LSZB 1F6TA 1Q8IA 4NZ0A 3DXKB 4UT4A 4DBQA 1O13A 4W4MA 3NCQA 2KRBA 2F4VF 4GW6A 1KTVA 4IRDA 2ZD1B 4XEIA 1SL2A 1W2IA 4HTUA 4Y0WA 2RS8A 3G8TA 1NDKA 2OSRA 5AQJA 2C2OB 1KHVA 4BR7A 5M1FA 4JKHA 3GE9A 1SKWA 1ZA2B 4CK2A 4DR2J 1NU0A 4AM6A 1MSWD 4C8NA 4WQ4A 4QW8A 2P9SB 1EETB 2ADBA 4FLZA