5J2MA

Hiv-1 reverse transcriptase in complex with dna and efda-triphosphate, a translocation-defective rt inhibitor
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
558
structure length
558
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase p51 subunit
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/dna
total genus 166
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2mA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2mA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2mA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2mA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2mA05
2IGIA 4AHTA 1RBVA 2JGUA 4NLQA 1J9AA 4O44A 4ED3A 3NCIA 4WFXA 1L3SA 3JSMB 3CJ5A 2AJQA 3OL8A 1G15A 3TAEA 1J54A 1KLMB 2R2TA 3DLEA 4Y3CA 3ULDA 2BANB 3LP2B 1IKXB 3BSNA 3KLHB 4KE5A 3QESA 1S48A 5HBMB 4CHZA 3BR9A 3NE6A 5C25B 2IM1A 3IGNA 5KT3A 4RUCA 3AVJA 3BSOA 2HHVA 3DMJB 4K4VA 3MEEA 1FKOB 2DPIA 4CEOA 3CFPA 3MF5A 4AHCA 1BQMA 1C1BA 3GIIA 3V9WA 1K1SA 4ZTFA 3HVRA 3RMDA 3NBPB 2DFHA 2IAJA 3AV9A 1RTHA 3KK1B 1NHUA 3SUOA 4FZZA 1KHWA 1A5XA 1REVB 2X74A 2W9BA 2W9CA 1S10A 1NK6A 5J2PB 3T3FA 4DTNA 4NLTA 2B43A 2G8UA 4M94A 1SL2A 4I2PB 1KVBA 3M8PA 3V4IA 3NGDA 4DLEA 1NK9A 4RNOA 3V9XA 4GW6A 4FLUA 1GOBA 3DRPB 2D7SA 1FKPB 5DG8A 3GILA 3RB6A 4J9KA 1KRPA 4N76A 1VSKA 1RNHA 4H4MA 3V6DA 4QWAA 4OPJA 4O0IA 4CGIA 3K2PA 2W9AA 1XHZA 2KTQA 1BCOA 3KMSA 4RW4B 4Y1CA 1U45A 4O3RA 4Y2AA 1FK9A 4DTUA 1I3AA 2X6SA 3D0PA 3QIDA 2E6MA 4MK8A 4CEQA 2RKIB 3NH1A 1F21A 3P1GA 3D28A 4CEDA 4IH6A 3HL8A 3NAIA 3KHLA 1MU2B 4PUOA 3WNFA 2VG7B 2B6AA 1TKTB 4YQWA 4OJRA 2B5JA 2WRMA 4FJGA 4ED8A 3TAMB 3KLEA 1GOAA 1LWEA 3T1AA 4CJ4A 4J9QA 1RBTA 4CF0A 1RBRA 5CYMB 1T8EA 4F4KA 1S1XB 4OLBA 5C24B 3NGIA 4CCHA 3MXJA 4F2RA 1BIZA 1NOZA 2P5OA 1HMVB 3M9OB 1CZBA 4BE2A 3BGRB 1DLOA 1WN7A 1S1WB 4W5RA 3K58A 3BQ2A 3T5KA 1WSJA 3JYTB 4EP5A 3SV3A 3VQPA 3AVAA 4O0JA 1QS4A 1JLFA 2BQRA 1S9EA 1EX4A 2FBYA 5HLFB 3ZSZA 2V0NA 1QE1A 1QSYA 5F8LA 4CEAA 3CWJA 3I0SA 3TANA 4FJ7A 3CG7A 1RTDA 3L2VA 4AILC 3F9KA 2IC3B 2KW4A 4DL5A 1U49A 4I2QA 2D5RA 4CEZA 5DG7A 1KSPA 4KKOB 4QOZB 3RBDA 4RNHA 3LAKA 3IRXB 4K8XA 1HYSB 4WXWA 4CE9A 5KFLA 4ECSA 3HT3A 1RTJA 2HAIA 5K14B 1C2PA 3VQ7A 5KFHA 5KFJA 2LSNA 3PX6A 4EBEA 3ITHB 2WK4A 3QLHB 3OYJA 4KAZA 3SFGA 2RDIA 4FK2A 4KHUA 5DLGA 4CF2A 3L8BA 5I42B 3V1QA 5HRPA 4CF1A 4TY9A 3PO5A 1D0EA 2OPRA 3AVBA 5EWFA 4J9LA 2DPJA 1ASWA 3C6UB 5FRNA 4BWJA 4ECQA 4DQIA 4O3OA 4Q43A 5F9NA 3RB4A 3QEVA 4ZP7A 5CYQA 3OSPA 3HVTA 3DDKA 5J2QB 3EPGA 3NF9A 2E6LA 1S1UB 1UWBB 4FJ9A 5KTQA 2FVQA 1S1TA 3L2RA 3MEGB 4HUFA 4RU9A 2YKMA 1S5JA 2ZE2A 4C8NA 4HKQA 3SNNA 3IG1A 2JC1A 4GMJB 1S6PB 2YKNA 4O3SA 2ASLA 3QYYA 2XHBA 4ZP9A 1TVRB 3PW5A 1HNVA 3KOAA 3AO4A 3NHGA 1JLQB 1KVAA 1RT7B 4KO0A 4QPXA 4TY8A 2XC9A 4FW2A 1HRHA 4DQPA 1L5UA 4KHQA 4CERA 4AH9A 3AA5X 2D3UA 4ECWA 2Z1GA 4QW8A 2RDJA 5DQIA 4B9LA 2XY5A 3KJVA 5DLFA 4KB1A 3NMAA 4NLRA 2E9TA 2YNIA 4OGCA 1VSHA 3TAPA 4DG1A 4CK1A 5KFAA 4CHQA 4LH4A 4ICLA 3NH2A 2Z1HA 2IA6A 3PX0A 1LAWA 3LPTA 2WONB 3ZT2A 1RYSA 3QZ7A 1XC9A 4IDKB 2XI2A 2HVIA 1DTTA 4NZ0A 4ECXA 4CFDA 3FDSA 3BDPA 4CEEA 4NLWA 3CJ3A 1J5OA 3C6TB 4XO0A 1T7PA 3V81B 4EZ6A 2QK9A 4NYFA 4FJHA 4JV2A 4F4YA 5KGWA 4E1NA 3NGYA 4Q0BA 4KAIA 4LSLA 5C5JA 4W5OA 3L2QA 3VQ6A 4CGDA 4B9VA 3AVGA 5HRSA 4G1QA 3KK3A 4KI4A 1RT1B 3QIOA 5DGAA 1WNSA 3PUFA 3QO9A 1IKVB 1BI4B 2WCXA 4MKAA 1LW2A 1D9FA 1D1UA 3RWUA 5KG0A 4HUEA 4WE1B 3SUQA 4KB7A 5I3UB 3SI6A 2ASDA 2HNYB 4NLSA 3ZT1A 2HHTA 2R8JA 4RW6B 4HYKA 3N6LA 1EETB 5CZ1A 4CGHA 4IH5A 2W42A 2E9ZA 2FC0A 3L3VA 4ID1A 1RT6A 3DOLB 4OPKA 4K4SA 1C1AA 4FS1A 3VQCA 3DM2A 3S3NA 1QSLA 2F8SA 4K4UA 2KZZA 4E1MA 4FM0A 2YNGA 4C8LA 2OYQA 3C94A 4FLWA 4CK3A 3DLKA 1JLAA 3H5UA 4O44B 1EXQA 3HPOA 5FDLA 1U04A 3AVCA 4RZRA 5J2MA 3IN5A 3SV4A 3KTQA 4RW9A 3DLEB 3SQ2A 3S3MA 3NAEA 2VWJA 4IRCA 4E89A 1SH0A 3QINA 3VQ4A 5KFRA 3MEEB 4ELTA 4B8AB 5CY4A 3ZT3A 4IR1A 1BQMB 1TL1A 1RBUA 2A1RA 1Y97A 3D45A 5KFKA 3ZT4A 4FYDA 1CXUA 2G8FA 4R5PA 4Z4GA 2IAJB 1RTHB 3Q8SB 3BQ1A 2DTUA 2ZD1A 4E7IA 3OS1A 2W9BB 2R8GA 2W9CB 3H5XA 1KFDA 4DU3A 1WSEA 2FLPA 4DF8A 2HHQA 4F4XA 5KG6A 2OH2A 3AO2A 3M8PB 3V4IB 5L1JA 5KFXA 4URQU 1LWFA 5KG2A 5E41A 3LP1A 4TQRA 4TYBA 3O3FA 3EY1A 3HO1A 4Y2CA 4KI6A 1RYRA 4H4MB 1SH3A 1IKYA 4ZP8A 1UOCA 3V6DB 3MTKA 3HSTB 1U4BA 3H2LA 3NAHA 4K4WA 4TLRA 3OYNA 5KFSA 4L8RB 1N4LA 1D5AA 3I5CA 3ISNC 4FJMA 3TR8A 3ZSRA 1FK9B 4EYHB 2C22A 3V9SA 4TXSA 1B9DA 3CDEA 4JRPA 5DQGA 3NF6A 4FZXC 4IH7A 2EHGA 3FSIA 2B6AB 3AVHA 3OJUA 3OLBA 2B5JB 3GIKA 3AO1A 4LSNA 1IG9A 2FJXA 3PHEA 3KLEB 1U09A 2KZMA 1LWEB 3CJ2A 1RDCA 2HNDA 3PW2A 3KKRA 3M9NB 4NLVA 3OYAA 4M3WA 5J1EA 3OS2A 1GX6A 2C28A 3UQSA 2C2EA 3K5LA 1Z4UA 1N56A 3VQEA 2CKWA 5F9LA 2AGQA 3OL7A 4RNNA 1DLOB 3DLGA 4CESA 4R0EA 3M9MB 4CIEA 1N6QA 1TK5A 3V1OA 3BSAA 1I6JA 3HHKA 5HP1A 4FLTA 1JLFB 1C0TA 2GIRA 3RB3A 2HB5A 1MMLA 1S9EB 2R2RA 3DYAA 2UUTA 4E3SA 1JLCA 2BQUA 2BGGA 3THVA 3AVIA 3KLGA 3DRSA 2A1SA 1TGOA 1QE1B 1KVCA 1NK4A 3HP9A 3OYMA 5DQHA 4Z0UA 3E51A 3I0SB 3ZSWA 4E7KA 2J6TA 1RTDB 2JLEA 4B9NA 3RR8A 1HQUA 1U47A 2KQ2A 4CHPA 1J53A 4I2QB 2HHUA 4CHNA 2BE2A 2J6SA 1RTIA 4WFYA 4Q8EA 4IG3A 3T5JA 4M42A 1JLGA 3KHRA 3DLBA 4EZ9A 2VG5A 5HRRA 3T19A 4FM1A 4EP4A 1RTJB 4F4WA 4M3YA 5JS2A 3SUPA 2WTFA 4CGGA 4CJRA 1SL0A 4IFYA 3KHGA 2AWZA 3MXIA 4IKFA 4MH8A 1VK0A 4CHYA 1TKXA 4PQUA 3PZPA 1LAVA 3UIQA 4IG0A 4JLHA 4EO6A 4F3TA 5FROA 4LD0A 3RR7A 3OY9A 4I7FA 2HMIA 1RA6A 1TK8A 3OJSA 1FXXA 3CQ8A 5CYQB 3K5MA 3HVTB 5FRMA 2G8WA 2IJFA 5KRSA 3RAXA 2Q3SA 3VQBA 3EYZA 2OPPA 1BISA 1ASUA 1WAJA 2C2DA 4CJSA 3KMQA 3IGVA 1S1TB 4Z4EA 2AX1A 4ECRA 2OA8A 2D0BA 1RDBA 4W5NA 5KFDA 2YKMB 4NCGA 2ZE2B 4QAGA 2ATQA 4DL4A 3IG1B 4KFBA 4YR2A 1WLJA 3CFRA 2HHWA 2YKNB 4W5TA 4ZP6A 3PW4A 4DFPA 4NLUA 4NLXA 3WNEA 1X9MA 1HNVB 2RN2A 3FFIA 2QKKA 5KT4A 4CJFA 1T03A 4KO0B 3PY8A 4TY8B 3KLFA 3F73A 1KFSA 1JXEA 3LWLA 5KFNA 3RAQA 3NL0A 2ATLA 1YVFA 2KFNA 4J2EA 1YTAA 1VRUA 1RAJA 4CK2A 1ZTTA 4H4OA 2IOCA 3SPYA 4DSIA 4J9MA 3KJVB 2G8VA 4ED0A 3L3UA 2YNIB 4ED2A 1KCFA 5EWGA 4ZHRA 2R2SA 4DG1B 1N5YA 4IFVA 4J9OA 2I1RA 2JEJA 3MEDA 5KG7A 3CM5A 4RW7A 5KG5A 3LP0A 4O4GA 5KGXA 4DF4A 1GOCA 3WNGA 3BJYA 4CIGA 4RNMA 4YFUA 1DTTB 2QV6A 4CJEA 3Q8QB 1VRTA 3I5BA 1C0MA 3VN5A 1J5OB 5KFTA 3TAFA 1I39A 5F8IA 3IS9A 2VG6A 3I8DA 4NCAA 3RRHA 4DQRA 1IM4A 3B6OA 3HYFA 4ZTJA 3VQ5A 4URSA 1ITGA 1HARA 2HNZA 4Q0BB 4F4ZA 4EEYA 4KB0A 4FJIA 1B92A 4LSLB 2IM3A 1BQNA 2XY8A 5KG1A 4CF9A 4G1QB 3KK3B 4CEFA 1R0AA 3H4DA 2R8HA 4EYIB 2PZSA 1S0OA 4FJNA 4Z4HA 4BE0A 4EBCA 1TKZA 5L9XA 2JEGA 4JV0A 3TVKA 1RA7A 1RCHA 4KTWA 3QO9B 3QNNA 4OL8A 1LW2B 4Q45A 3OSNA 2KFZA 2I5JA 4FBTA 4DS4A 4CJVA 3LP3A 5EUHA 1NJXA 3TAQA 3CO9A 4BWMA 4E7HA 4EBDA 2ALZA 4RW8A 4IRKA 3FRZA 4CJ3A 2ITGA 4KHRA 1L3UA 3PO4A 4FLVA 1XHXA 5HROA 4IRDA 4OKKA 1O1WA 1HNIA 4ECYA 2UVRA 3MXMA 4K4YA 1KTQA 3PR5B 3WNHA 4OKJA 1TAUA 1TKDA 4ED6A 1S1VA 1RT6B 5J2NA 2P1JA 1JLEA 3AO3A 2FVSA 3SZ2A 2G8KA 3DM2B 4BE1A 4NYNA 4KHWA 4OGEA 3H4BA 2BDPA 4F2SA 3NH0A 1XI1A 1WSFA 4DFMA 2YNGB 1W0HA 1S9GA 3H5YA 1Q9XA 4B3OA 1T3NA 3DLKB 1QAIA 4NCBA 3OYKA 1SL1A 1JLAB 2W7OA 3QIPA 3EZUA 4ZPAA 1WSIA 5FDLB 3HK2A 4IBNA 4BACA 3KLIA 1LWCA 3ZSOA 5J2MB 2AGPA 4RW9B 1ZBFA 3H08A 4AHUA 1WNEA 2W8KA 1S4FA 4TSXA 3KNAA 4HUGA 4TQSA 3U6FA 2Z1JA 3CJ4A 4KV8A 1TL1B 5L1KA 1NK0A 4HTUA 4ECVA 3CDWA 1UWBA 4R5PB 2PY5A 4G3IA 3NGZA 4FK4A 4J9SA 3UPFA 4ELVA 1CSJA 2ZD1B 3DLHA 1QAJA 1U48A 2FBXA 2HHXA 4F3OA 1W25A 4KBIA 1RT4A 5KG3A 3SQ1A 4O55A 4KSEB 1LWFB 1Q9YA 1VSDA 4HCCA 1ZBIA 4JS5A 1S0NA 4FW1A 3LP1B 1ZYQA 2IM2A 1JX4A 5EU7A 3AO5A 1HQEA 3M8SA 1SV5A 1X9WA 3QERA 4NLYA 1RILA 4M3TA 3CM6A 4FM2A 1IKYB 3I0RA 5C42A 2GC8A 3BSCA 4CJ5A 4AHSA 5D3GA 3QZ8A 4ED7A 2DFEA 3GIMA 3G86A 2BRKA 3VQQA 4YR3A 4XPEA 4NLDA 2XWYA 3ZT0A 2X6NA 3LPUA 3L2UA 3OVNA 2IDOA 2QKBA 3VQ8A 4Z4CA 1A5VA 4MFBA 3CFOA 1JKHA 3NF8A 4CJTA 4J2DA 3OYCA 2BQ3A 4LY7A 1T94A 1S6QA 2J6UA 2NUBA 3OYHA 1VSFA 4LSNB 1TK0A 4DSEA 1TV6A 4DEZA 3GIJA 3QGHA 3ZSVA 4U7CA 2HNDB 2YNFA 4E19A 1EP4A 3KD5E 1WSGA 4URGA 1TP7A 2IM0A 4I9LA 1C1CA 3SI8A 2WOMA 1C1BB 3DRRA 5DGBA 2XY6A 3MECA 3CDUA 5HRNA 3VQ9A 1RDAA 3I5AA 1SUQA 4ID5A 3HVAA 4N56A 3DLGB 4CJQA 3RBEA 4IOBA 2HWHA 2HW3A 3DLRA 2YV0X 1JXLA 2QE5A 3G6YA 1N6QB 4MK9A 3SPZA 4E0DA 4Z4IA 3SUNA 3ISND 1HPZA 2C2RA 4WYWA 4K4TA 4M3XA 4RUAA 1BCMA 5HP1B 1IH7A 1C0TB 4YNQA 2OPSA 4NLPA 2FVRA 5KFPA 3DYAB 3AVLA 2ILZA 4FJ8A 4DWIA 1JLCB 3K57A 3KLGB 3DRSB 4DL3A 1DTQA 3GQCA 4H54A 1XR7A 3LWMA 3K5NA 3OYBA 4DU1A 1HQUB 2D0AA 3EZ5A 4CJWA 4KREA 4CJLA 3LZJA 3TARA 3G10A 3DI6A 2BE2B 1RTIB 4IG3B 5KFIA 4UQGA 2XI3A 1JLGB 2VG5B 3PVXA 4F50A 4AHRA 2Z1IA 4PUOB 4GC7A 2OPQA 2R8IA 3U3YA 4CEBA 1RT5A 1RT2A 4IFYB 4FS2A 5EWEA 1S9FA 5L1LA 1RT3A 5KFMA 3MR2A 5KFWA 1TL3A 1TKXB 4PQUB 2VWKA 4R8UA 3M8QA 4IG0B 2UUWA 3D5MA 3SQ0A 2YNHA 4B9SA 4O3PA 4I7FB 1S49A 1C0UA 2HMIB 4LQ3A 4QWBA 4QWDA 5T7BA 3OHBA 3QETA 3TABA 2FBTA 4QWCA 4Y1DA 1Z26A 2OPPB 4PWDA 2DY4A 3MFHA 1NKEA 2FVPA 2B4JA 3PR4A 2ETJA 4E7JA 2GUIA 2V9WA 3U3GA 1ZBUA 3GYNA 1VSEA 3LDSA 2Y1JA 2RF2A 1NKBA 4BDZA 3L2WA 4EO8A 4U6PA 4NCGB 3TI0A 4CFAA 3E01A 4KFBB 5KG4A 3AVNA 3G0ZA 1GX5A 2EX3A 1QTMA 3KIOA 4KHMA 4FJKA 4B08A 3K59A 2UVVA 1D8YA 2PYJA 1YT3A 3FFIB 1NJYA 2AU0A 4KHSA 2GBZA 3AVFA 5JS1A 3KK2A 1T03B 3IAYA 4YR0A 3KLFB 4WYLA 3OS0A 3P83D 1N48A 3ZSXA 3LALA 1JL1A 1T05A 1IO2A 4WXOA 1VRUB 3OHAA 1JLBA 4XPCA 4WZMA 2P51A 3T5LA 4DTPA 5DK5A 1LW0A 4H4OB 4O5BA 2V4RA 3AVKA 5EDWA 2CJQA 3N6MA 3CIZA 4DTJA 1BL3A 5KFEA 4ZHRB 4JUZA 1N5YB 4IFVB 1IKWA 3DOKA 3H59A 3PJXA 5KRTA 3MEDB 4FJ5A 4RW7B 3AA3A 2HWIA 4M3RA 4N47A 5SZTA 4BDYA 3LP0B 2OPRB 4O4GB 3S3OA 3V9ZA 2FLLA 4C8MA 4RNFA 1NKCA 3HM9A 3NDKA 4X2BA 4M41A 4FVMA 3JSMA 4CGJA 4HHTA 1VRTB 4DQSA 4FCYA 3GV7B 1KLMA 2D41A 2BANA 3LP2A 5KFOA 3AVMA 1IKXA 2R2UA 3OYIA 3KLHA 5HBMA 3IS9B 3O4QA 2VG6B 3HVWA 3OYGA 5F8MA 5C25A 4ZVFA 1NK8A 1SKWA 3ZSQA 3DMJA 2XCPA 1FKOA 4Q44A 2HNZB 1K6YA 1ZBLA 1BQNB 3N6NA 1NK5A 4ZVGA 4LH5A 3RMAA 1R0AB 3NBPA 5JUMA 3KK1A 5KT5A 3BREA 4IQXA 4FJLA 4OVLA 4PY5A 1TKZB 1REVA 3TWHA 2AQ4A 1HYZA 2EC0A 3RMCA 1QSSA 1ZTWA 5J2PA 3OYFA 2P5GA 3G6VA 3V6KA 2I5JB 1UA0A 2JEIA 4I2PA 4OKEA 3DRPA 3B6PA 1FKPA 1XR6A 1S0MA 3PJWA 4RW8B 4NRUA 4NLGA 2IBKA 5HROB 3SFUA 3GV8B 4J2AA 3S9HA 4M45A 1HNIB 2X78A 4KTQA 1RDRA 2R8KA 3TAGA 4RW4A 1S1VB 5J2NB 1JLEB 2FVCA 4ICLB 3QEIA 4Y34A 2RKIA 4ECZA 2D0CA 4XIUA 1NJZA 4DMNA 3MR6A 1S9GB 1VSLA 3QEWA 1MU2A 4B3OB 2ILYA 2VG7A 1TKTA 3UDLA 1CXQA 3QIPB 1RBSA 4DLGA 4ZPCA 4LQ9A 3TAMA 4J9NA 2XCAA 3KLIB 2O5DA 5KFUA 3CYMA 1LWCB 3C95A 3QGGA 5CYMA 3MAQA 5KT7A 3SQ4A 5KT6A 4NYZA 1S1XA 2FLNA 4BDPA 3PW7A 2XGQA 2AGOA 5C24A 2AX0A 3KLVA 5L1IA 2IMWP 1ZBHA 4DL2A 2QXFA 4K4ZA 1HMVA 3OYLA 3OLAA 3HP6A 4KV8B 3BGRA 4I9QA 1S1WA 3MR5A 2ZQBA 4DSFA 1KHVA 4DTRA 2BR0A 5CZ2A 2OZSA 3H40A 4DFJA 3JYTA 2V4QA 4B8CA 4F8RA 1EKEA 3PX4A 3V6HA 3ASMA 4DL6A 2FJWA 1JIHA 2XRIA 1RT4B 1L3TA 5HLFA 4JV1A 5KFCA 1S97A 1TQLA 3TQ1A 4GVMA 4PA1A 3VA0A 2UVUA 4QW9A 1HQEB 1SV5B 4DSLA 3NKYA 3QNOA 2IC3A 4IR9A 3I0RB 4DFKA 5C42B 3OL6A 5KT2A 4CGFA 5D3GB 3H98A 1NOYA 2FJVA 4KKOA 5KFQA 4H8KA 4CFCA 3AA4A 4B9UA 3M8RA 2DFFA 3IRXA 1HYSA 4WZQA 2VA3A 5K14A 1OS5A 4TN2A 4NRTA 4CJPA 2E4LA 4MFBB 1JKHB 2UVWA 1RDDA 3LANA 1NJWA 2F96A 4WFZA 3Q8PB 4DSJA 3ITHA 4N5SA 3QLHA 2W8LA 4K4XA 5JXSA 4MIBA 1S6QB 3NF7A 4HVJA 1QUVA 5I42A 1L3VA 3HXMA 3VA3A 1JXBA 5KI6A 1TV6B 3C6UA 2JC0A 2IJNA 1QHTA 4QCLA 3P5JA 3SYZA 2HHSA 4J9RA 3SCXA 2YNFB 2GIQA 1EP4B 1ASVA 3EPIA 3PW0A 3ALYA 4CFBA 2R7YA 1C1CB 2ZKUA 3MR3A 5J2QA 1K1QA 3SJJA 2WOMB 4IKAA 4ZPBA 3DRRB 3CJ0A 1B9FA 3A2FA 3HPHA 1XR5A 1YVUA 1S1UA 3MECB 4MQ3A 3RRGA 4E7LA 4CHOA 1SUQB 4ID5B 4DS5A 4KHYA 3QEXA 5SWMA 1UAXA 5F8JA 3MEGA 4JS4A 2XGPA 4N41A 4J2BA 3H5SA 2OZMA 3LZIA 4FZYA 4KPYA 1QQCA 3O4NA 1ZETA 2ASJA 1HPZB 4M3UA 1S6PA 1LV5A 1YTUA 2FBVA 4FXDA 1TVRA 2OPSB 3MFIA 1NNDA 4GC6A 1VSMA 3V9UA 1JLQA 1SKRA 4J9PA 2PYLA 1DTQB 1RT7A 4Q8FA 4KHNA 4DQQA 5F8HA 4MIAA 4M3ZA 4MK7A 1VSJA 3KD1E 3KHHA 3OYEA 4ZVEA 3O3GA 4FLXA 4CJKA 4FJXA 3RTVA 3DI6B 4JRQA 1HJRA 2BRLA 4DTXA 4ELUA 2Y1IA 4ZMMA 3ZSYA 2VA2A 4CECA 2G8HA 3KKSA 1BIUA 5KFYA 3HPGA 4CIFA 4Z4FA 1BHLA 1UA1A 4C8OA 1NK7A 1SH2A 2OPQB 5KFZA 3HJFA 4K8ZA 1RT5B 4DSKA 1X1PA 1RT2B 2WONA 3CVKA 4O4RA 4YP3A 4FLYA 1CLQA 1W9HA 4IDKA 2IS3A 1RT3B 3GV5B 5F8NA 3OYDA 3Q8RB 5KFBA 5T14A 4NLOA 2YHBA 1D9DA 1TL3B 3HKWA 3QEPA 4ECTA 2XY7A 3LAMA 4R8UB 1Z25A 3M8QB 4CJUA 4DTSA 2YNHB 2F8EX 4FK0A 3C6TA 5J1EB 3V81A 5DMRA 1C0UB 4DL7A 2D3ZA 5KFGA 1X9SA 2YHAA 4K50A 2WHOA 3PV8A 3NFAA 4O3NA 3OL9A 3QGIA 1JL2A 4ZPDA 4TYAA 4AHVA 2JEFA 1Q8IA 4PWDB 5KFFA 3ZCMA 4B9MA 1BGXT 1C6VA 5KFVA 4KRFA 5F8GA 1RT1A 4MKBA 4O3QA 1HYVA 4FJJA 3T5HA 2GV9A 4DTOA 2RF2B 4M95A 1TAQA 1NHVA 2O4IA 4DU4A 1VSIA 3FQKA 4ZVHA 5DG9A 1IKVA 2E9RX 3RMBA 1BI4A 2RPIA 2G8IA 3E01B 3VQDA 3ICLA 4ED1A 4CF8A 4WE1A 2O4GA 3K5OA 1WAFA 4QWEA 4RG8A 5I3UA 4FLZA 3UR0A 4DTMA 1KLNA 4C8KA 3KK2B 1XWLA 4OLAA 2HNYA 3FQLA 1T05B 4RW6A 4W5QA 3VQSA 1EETA 4HCBA 1JLBB 1SKSA 1A5WA 3O3HA 1LW0B 3V6JA 3V1RA 2XO7A 3AA2A 3DOLA 3G6XA 1CZ9A 4Q5VA 2WB4A 2HVHA 3BQ0A 3VQAA 1WSHA 4YMEA 4ECUA 2W7PA 4B9TA 1IKWB 3DOKB 4FBUA 4KTZA 3RB0A 2F8TA
chains in the Genus database with same CATH superfamily
2BVZA 2HQ3A 4B3RF 1RBVA 5LSLA 4ED3A 3NCIA 1L3SA 4BRLA 3W60A 1J54A 1NPRA 1LKZA 3LP2B 1R43A 3BSNA 3VEYA 4LFAJ 1S48A 2NUUG 3EVOA 2IM1A 3IGNA 4Z37A 5KT3A 3MK6A 4NWBA 1GLDG 3GCXP 2DPIA 2X51A 4WIIA 3CFPA 2BOPA 3BYPA 1BQMA 3UI3A 5EVZA 2HVZA 3V9WA 4ZTFA 2DCUB 2IAJA 3U27A 2HF4A 5G0RA 4FZZA 1MWZA 1WG5A 1GLEG 2P9SB 4DTNA 4J8FA 4I6YA 4GKJF 2KI2A 1NB7A 2MSTA 3M8PA 3V4IA 3E3XA 4RNOA 3RBZA 4NASA 4NXMK 3ELHA 3DRPB 5DG8A 3LGNA 4MMOA 4WTOB 1KRPA 1RNHA 2HYIB 2P9PA 3T7ZA 3V6DA 2H3EB 2HIYA 4QWAA 1YKWA 2Q1LA 3QJLA 5K8OA 5AQKA 2QWNA 5BJRA 3UD4P 2E8AA 2KTQA 4BR2A 3KMSA 4DR2F 4Y2AA 1UMJA 1FK9A 2GMLA 2X6SA 2F63A 3M3ZA 1UJ4A 2DRDA 3QIDA 4JB8B 2KM8C 4FWMA 1F21A 1WUUA 3D28A 4FXWA 3MN7A 3KHLA 4OO1J 1MU2B 4PUOA 5DRKA 2X1GA 3SQGA 3P31A 4LRDA 3KLEA 1GOAA 3CCES 2VUGA 1RBTA 1NSAA 2UUCJ 4U95A 1T44A 3THXA 4OLBA 1B3TA 4KH6A 3LL3A 5E3AA 5C24B 4GO7X 4CCHA 3Q8VA 1BIZA 5GAGI 2V4JB 1IBLK 2W2MP 4J91A 1Q16B 3HFVA 3R8EA 3P5TL 1CZBA 5T7LA 2DGVA 2Z57B 5A0YB 4CBWA 2V2KA 3JYTB 4EP5A 4WFBL 1AFJA 1LK7A 4O0JA 4WP8A 4ZIVA 2YQ3A 3VENA 2FBYA 3TA1A 2HRUA 1B7FA 1QSYA 3TANA 3EL2A 4AILC 3F9KA 4LF8F 4H0YB 2FIUA 2Z58B 1QUPA 4PZVA 3TUIC 4DL5A 2O3DA 1FNOA 1KSPA 1NZ8A 4QOZB 2FHOB 1XMQF 3H45C 4RNHA 3IRXB 1UFKA 4O8KA 2HAIA 3J80Y 1Z6RA 1CS4A 5KFJA 3JQKA 4A8YA 4BRAA 3QRPA 2X3DA 3OQ2A 3QLHB 3FSXA 4E8UA 3L8BA 4FVCA 4CNYA 4TY9A 3PO5A 4PL8A 2QEXS 3AVBA 2YJFA 1ASWA 5FRNA 4JI6K 4CNZA 5GINA 3PKYA 2AJ0A 3JS6A 4ZP7A 3AH6A 4OLOA 1NGBA 2CZVC 4WJBA 4F9OA 1SVDA 2DNNA 2E7WA 3BPSP 3HVTA 2P9KB 3DDKA 2CJ9A 2YCHA 4LR9A 3MUMP 3EPGA 3PLAA 3VGKA 3PKMA 4DR6F 3L4BC 2DITA 4FJ9A 5KTQA 2A18A 2FVQA 4PABA 3DGPA 1S1TA 2LYVA 3OHRA 1XUPO 2AZ3A 2V5HG 4F36A 4HUFA 4YDDB 3C66A 2G2YA 4ZLJA 1CJVB 2YKNA 4FWNA 2DEJA 2ASLA 2M3DA 3QYYA 3EKSA 3Q22A 1SI9A 1HNVA 2GIFA 4QR0A 3PEJA 3TRGA 3QNWB 1M1KT 1F9HA 5I9EB 1HLUA 3N4QA 4DQPA 2HLTA 2VOPA 4AFFA 4U67L 3VF2A 2Z1GA 4QW8A 4DCJB 5DQIA 4ZCMA 1FEHA 4B9LA 3DHWC 5M1KA 4DR5J 2YNIA 1U2RA 1T6DA 1U24A 4OGCA 4JV5K 1N0UA 1VSHA 3Q23A 1OQ3A 2JLFA 5KFAA 2RU3A 2IA6A 3LPTA 1FRXA 3N0VA 1HR0F 3POTA 1WC4A 3O1WA 4IDKB 2D0PA 3KJFB 3R8YA 1ZS6A 3BBBA 1RLCL 2FD2A 3IC1A 4ECXA 4CFDA 2D1KA 4GKKK 3HZ6A 1J5OA 5E2QA 3UDCA 3C6TB 4LF4K 1YLXA 1KNZA 2RUGA 3ZETA 2QK9A 3QT7A 1XEZA 4FJHA 3ATUA 3ZZUA 4IYQA 5LL6d 2O8BA 2M9KA 3NGYA 2IVOA 4KAIA 2HZVA 2A5XA 4M5DB 1T0TV 2UV8A 2N3LA 4G1QA 1FVSA 2E1PA 5IT4A 5EX5A 5DGAA 1WNSA 4UZCA 3VGVA 2ADBA 4MJKA 3PIOL 1CLFA 2XZDB 4ZCKA 4MKAA 4L73A 4X4QA 1LW2A 1D9FA 5DM6L 3KHYA 5KG0A 3HULA 3SUQA 2V2VA 4K41A 1OQ6A 2DK2A 4LVNP 3C14B 4Y2MA 3ADAC 2IVMA 2HHTA 2BJDA 4JHDA 3ZT1A 4RW6B 3UN3A 4CGHA 4IH5A 3HSJA 4X4SA 2E9ZA 3ZTOA 1R0BG 4ID1A 3QB0A 1RT6A 4K4SA 4FS1A 1KQSR 2HBKA 2F5GA 3DM2A 1QSLA 4K4UA 2KZZA 1Z2LA 4OHYA 5MLCV 4FLWA 4YOEA 3O3LA 5ETSA 1Q82O 4C3LA 3OVSA 1T9XA 3AD9C 1ZBSA 4O44B 5AQLA 2LA4A 3WT0A 3K2YA 1X4EA 3QBXA 3I87A 4RZRA 5J2MA 1ZM9A 1Y00A 4CVNE 3DLEB 2HS4A 2VWJA 1IWGA 3HHEA 2D74B 3DRXA 2UXCF 1HW8A 2YWHA 5D0EA 1VQ9S 5A8KA 3FVYA 3H7HB 5CY4A 4KJIA 1WJ9A 1UJ5A 5KFKA 3ZT4A 4R5PA 1BOTO 5FLXO 5JLHA 2CQHA 4WPAA 2FZKB 2JJ4D 1W2BR 2W9CB 2ATCB 3G4SN 5D6GA 4PG7A 1HI0P 1YIJN 3AO2A 1CJKA 1GMWD 2ZH5A 5KPRA 3MUVP 1RAFB 2KXHA 1FXDA 1BWVA 3O3FA 2PT0A 3EY1A 2GMJA 4TKTA 4H4MB 1IKYA 5IQ6A 4ZP8A 3ET6A 3VAKA 3HSTB 3FK4A 3BB5A 2UU9J 4BRHA 1OVQA 4TLRA 4ATNA 4BC3A 4F4AA 3QRRA 1A6LA 1U2FA 1H2UX 4KGXB 4LRFA 5MAOA 1MN7A 3I5CA 5GAGU 3TR8A 5HK4A 3TNVA 2C22A 2ZOGA 2V94A 2ZOFA 4FZXC 1E4FT 2EHGA 3FSIA 3MCSA 3OLBA 2F7TA 3AO1A 4FL9A 2CPYA 1V6HA 1LWEB 1X0FA 1MWQA 5EX0A 1JJ2R 4PRFA 2ACYA 1URNA 1D4XA 2LECA 5AR0A 2H5JB 1UZDA 5J1EA 2BACA 4USIA 4BQZA 1FE0A 3UW1A 2ZBIA 1GX6A 2DNHA 3H90A 5IOLA 3J80O 1PIEA 5ETKA 3OL7A 2O8FB 3W2WA 1U26A 1DLOB 4DUZJ 3U9DA 2FJAB 1Q8BA 2R7QA 2K7JA 3M9MB 4FSVA 4CIEA 2YWGA 4IO9L 2IYGA 4WFBQ 1UW9A 3V1OA 3GMGA 3M6XA 2W4CA 4H5WA 3FLCO 1JLFB 1C0TA 3VVTA 2R2RA 1HWLA 4DV6F 2CQ3A 2UUTA 5BRDA 2JNJA 1EWQA 1TGOA 1QE1B 2W7AA 3MCOA 3CSKA 2DNMA 3I0SB 1HNXF 4E7KA 4EK2A 3NRBA 2J6TA 3QJJA 5KQDA 4DV1K 3NGRA 4B9NA 1U47A 2E88A 3J7ZT 1SS6A 4CHNA 3EJMA 2J6SA 1UEKA 2BJ7A 5FPDA 3T5JA 4M42A 3DLBA 4EZ9A 4ILHA 3QMLA 5HRRA 2K1RB 4FM1A 4AXIA 4LF5F 5JS2A 5FPNA 4R25A 4DB3A 1EQ0A 3ENVA 4CGGA 4CJRA 2HG4A 2ASOA 4CT9A 1VK3A 4IFYA 3KHGA 3B8HA 4L3KA 3G96A 2PEHA 3BF4A 3UFCX 4WP9A 4YHHF 4DHVA 1YX2A 4JLHA 4EO6A 1RWXB 1NPKA 2HBYB 3OTBA 3NXZA 4B3MJ 4WQ4C 2J9DE 1RA6A 5LMNF 1FXXA 3HZGA 3CQ8A 3VPZA 2BJ9A 3UKRA 4DV3F 4AYBD 5CCLA 2OSQA 3GCWP 3K9JA 5F0WA 4P2SA 1WAJA 2RIJA 2C2DA 4CJSA 4NYOA 3W5YA 5BPLA 2Z2LA 2D0BA 1X3MA 2YKMB 4X4TA 4QAGA 5B0AA 3JXOA 1MROA 4U7UK 1WI8A 3X1LB 4KQZA 1GXTA 2V7ZA 5C2GA 1HNWF 3M32B 5K20B 5B7WA 4X65F 2RN2A 1FF2A 1FT8A 3FFIA 4O23A 1R89A 4Q7AA 1HNZF 4TY8B 3LWLA 2BJ1A 3RAQA 1HBOB 1YVFA 2HZAA 4X84A 4U67Q 4J2EA 1VRUA 4LFCJ 3KXDA 1NGEA 3DJCA 3SPYA 4DV7F 1BWEA 1GQEA 5L39A 3D6TB 5AXKA 2Q0RA 5D4LA 1QVFM 1HBNA 4ED2A 1UZHA 2CJXB 4NL5A 5D77A 5EWGA 4ZHRA 2R2SA 3UWTA 3HHNB 3MEDA 4G6VB 5KG7A 5IM0A 1LFWA 2QLXA 1PJ7A 4NLCA 2ALYB 2GTDA 2V8GA 2ZEJA 2Q3PA 5CCMA 4CIGA 3BR8A 4CJEA 1HD0A 4KGMA 1NDPA 1S76D 5E33A 2ZJRL 3HHDA 3VN5A 1I39A 3PXGa 1YZ7A 2YBVA 2VG6A 3I8DA 1ILYA 3RRHA 3FBFA 3FCVA 3EGZA 3HYFA 2ABYA 4F67A 4ZTJA 3VQ5A 1ZPWX 4LF6J 1HARA 4Q0BB 3CCTA 3SEOA 4F4ZA 5FJ4A 5ETLA 1FXLA 1BQNA 1RWOB 2HWTA 5KG1A 3MEKA 3KK3B 2ZDOA 3G8QA 2KRRA 4OX9F 1S0OA 5D78A 5AQWA 4QYZJ 3MPDA 1TKZA 2JEGA 3PIOQ 2NUHA 3QNNA 3M4XA 2Z4PA 4C0BA 4MDBA 3OSNA 5A6WA 4FBTA 2DEIA 3KUGA 3O80A 4CJVA 1UAWA 1NJXA 1WC6A 4BWMA 4EBDA 1RKIA 2B9WA 1OYEA 3VAHA 1UPPA 1A7GE 3Q86A 2ITGA 4B1UB 3FZFA 3MAAB 1WI6A 4I68A 2QLBB 4G1PA 2ZZMA 3ZZ0A 3A8IA 4OKKA 1EARA 4MDAA 4EMDA 1GLJO 2P9UB 1M5PC 2O8EA 3PR5B 3NGTA 3S1TA 3ZEUA 4MYUA 3CCQN 4ETXA 5J2NA 3R5JB 2F8MA 2FVSA 4BE1A 4V1Ak 1WSFA 4DCHA 1Q9XA 4B3OA 3KG1A 4PXBA 3BEXA 3DLKB 3UDEA 1QAIA 1DJ0A 1SL1A 2W7OA 2AJ1A 4ZPAA 4Z94A 3GONA 4QIGA 1VQPS 4IBNA 4YN3B 1ZC6A 1LWCA 2NXNA 1T11A 3EVWA 3H08A 4FOEA 3HMJG 2JFKA 5LSRA 3SJHA 2KHCA 2XLIA 4PR6A 2W8KA 4DN0A 2OFHX 1UW4A 5M1NA 5M2RA 4LBHA 4TQSA 3CJ4A 5L1KA 4FWOA 4DZ6A 1NK0A 4DDFA 3FZHA 4ZVOB 2MJNA 4FK4A 1H74A 1H38A 3VGSA 2CXEA 1MW7A 1XJWB 2FBXA 1F3VA 1K9MO 4CO3A 1FJGF 4KBIA 1RT4A 3B54A 4QR1A 3I8BA 3SQ1A 4O55A 4KSEB 1LWFB 3H0PA 4JS5A 4DV5J 5IT9Y 5EU7A 1HQEA 2G2ZA 1X9WA 2GA7A 4DX5A 3QAUA 4USVA 2NXUA 3T1HF 5C42A 3LPYA 4CJ5A 2H4YB 4ED7A 5E3RA 3GIMA 1CEZA 2BRKA 1NAQA 4RBVA 3VQQA 4YB1P 2XSFA 4NLDA 3ZT0A 2XWYA 2F9TA 1U6FA 4MTPA 2BM0A 1YHQS 1ZAWA 2IDOA 4I64A 2HBZB 2B4PA 1JKHA 3NF8A 2J8SA 1Q0NA 1T94A 3F41A 4RJVA 3WEEB 1S6QA 1KS2A 2J6UA 1VSFA 2NRRA 1WEYA 4OYZA 1WF2A 1T9VA 2Q36A 4NI2A 4Z7CA 3QGHA 1DZ5A 1F3FA 2PFUA 2Z2YB 4P2FA 1PO6A 3V4MA 2V2ZA 4ILRA 3KD5E 1WSGA 4BRIA 1FFWB 2CQ2A 2CGJA 5LMUK 2UXDK 3M05A 4B3RJ 1MWKA 4JI0F 3MECA 3A3OB 1RDAA 3I5AA 1SUQA 3FFKB 4ID5A 4K2JA 1SIWB 3ONQA 5GVQA 4IO9Q 3FZ2A 5EOYA 3SPZA 2RS8A 1VC0A 1FRKA 2VFSA 1BA0A 3R7NB 2YI1A 5HP1B 1UVKA 4C23A 2OPSA 3I6PA 1HWUA 4NLPA 3DYAB 2H51B 1JLCB 1RAGB 3J7YI 3LDQA 3DRSB 2B0GA 5A76A 3P45B 4FPIA 2W40A 3K5NA 1VC5A 5GMKa 1CQNA 3NY0A 4KREA 2RB7A 2E7XA 4GKJJ 3WHIA 4K0KF 3G10A 4DV2F 3T1YF 2CQCA 3PVXA 4L3NA 2HBLA 1Q53A 3BEGB 4PUOB 2N4DA 2R8IA 2LCWA 4CEBA 1RT5A 1RT2A 2HMPA 1IWAA 1WG4A 3O2IA 1S9FA 5KFMA 5JVHL 2KYZA 2AD9A 1TL3A 2ZVSA 4R8UA 4LC9B 4IG0B 2UUWA 2YNHA 1Z1ZA 4X4PA 2BW7A 1R8HA 2KXFA 2HMIB 4N77A 4QWBA 4QWDA 5T7BA 2M5YA 1T95A 4HACB 4ZVRB 1NU4A 3LA0A 3TABA 2N7YA 2W1BA 1E4GT 2KB2A 2QEXN 4PAAA 1Z26A 1RGIA 2FHJA 3FBEA 3MFHA 2Q66A 1XBWA 1TFWA 2V9WA 4OZ0A 3GYNA 3LDSA 2HBRB 2ZVIA 3L2WA 4PKHA 4BRPA 2OHDA 4WP3A 3E01A 2QWPA 4KFBB 5A2QU 1U0SA 5BR8K 5GIPA 2HQCA 4LF7F 2EX3A 1QTMA 2UVVA 3BP8A 2PYJA 1MA9B 4DHYA 4NMXA 1RAHB 3TJ8A 2X7IA 4YR0A 2ZUGA 3KLFB 3CMAS 3OS0A 1N48A 3AA8A 1SXLA 1QVGR 1N33F 2V51B 4C11A 2FY1A 3MX5A 2Q31A 4YEAA 3OHAA 1JLBA 2P51A 2R7XA 2XYGB 4HDGA 4O5BA 2MLXA 3VTHA 4G1IA 3N6MA 3W61A 2QMWA 3CJQA 1SKUB 1F5CA 3OFGA 4X4RA 4FVUA 1N5YB 3M30B 1IKWA 2VBZA 1EIYB 4YOWA 2HKEA 4RW7B 1O5JA 3AA3A 2HWIA 4OZJA 1TYQB 3V9ZA 2FLLA 2A3ZA 3WC0A 4RNFA 3HM9A 3NDKA 2IY5B 4OIXA 3VETA 1XMQJ 4B3MK 1VRTB 1H2TZ 3THYB 3GTYX 2ZJRQ 2P5VA 1QAXA 5KFOA 3K0SA 2KDOA 3IS9B 2XYHB 3JSRA 4ZVFA 5A8WA 3U4LA 1IBCB 1FKOA 1H3DA 4Q44A 5BRFA 3U9ZA 1ZBLA 2J5AA 4ZVGA 3C16A 5JUMA 3KK1A 4UZBA 4OVLA 2QTDA 5CA5A 3LW5C 1REVA 3AQOA 2SXLA 1QSSA 4F26A 4NXMF 1S4EA 3G6VA 4DJBA 5THWA 5AZJA 4UOFA 3IFRA 2GFFA 3RBXA 4DR6J 4HI1A 1NMDA 1DFDA 5FIIA 3B6PA 1FKPA 4ZJQA 1G4CA 1NBWA 4DPUA 3A8JA 4JI1K 4L76A 4NRUA 4NLGA 3HHLA 5HROB 3GV8B 4UOGA 1SQFA 4EGLA 3BZKA 1WDTA 3S9HA 1HNIB 3A5MC 3PIPL 1IR1A 5KPTA 2OMOA 2QIFA 1KC8O 3PHTA 5AQNA 4Y34A 3PRDA 2FUG9 1NJZA 4JYAF 1S9GB 3QEWA 1RLDA 1S6UA 2DJWA 2ILYA 4H5NA 1WDDA 1CXQA 3MD3A 1VHFA 3DKDA 5IT9O 4C1NI 1F5BA 3R9LA 3KLIB 3CYMA 3SBTA 4DR4F 4NEYA 2HHPA 4J9UE 3A0IX 3QGGA 3MAQA 5KT7A 1IBLF 2H1YA 3OXGA 4YB5A 4LF6K 1HR0J 2AGOA 4CZKA 4FKYA 1CJUB 5L1IA 2CQIA 1WEXA 5DZ6A 2L9WA 2QXFA 5KOWA 2GZOA 3DOMB 3HP6A 4QYZK 1FCAA 4JEPA 4BREA 2ZQBA 2UXBF 2BR0A 3V2UC 3H40A 3SBGA 3G25A 2LFVA 3FEYB 4OI2A 4BR7A 4F8RA 1VQ9N 2HRYA 3PX4A 3P3DA 3V6HA 5AFUA 4MAKA 1QJHA 2YHWA 5CABA 1WHVA 1S97A 1NDKA 4PHTX 4GVMA 1WG1A 4GV6A 2AJ2A 2UVUA 2PC6A 1BG3A 2RUSA 1SV5B 2M70A 5JVGQ 1IJFB 4DFKA 3TU5A 5D3GB 2R7UA 2FJVA 1HA1A 4B17A 4H8KA 2NYIA 3M8RA 2ZH6A 2AA4A 2QA4S 1RQ0A 4NRTA 4DR3K 3FCWA 2L9DA 2E4LA 4NA1A 3HSDA 1NJWA 3N4PA 3Q8PB 4CH7A 3W65A 4K4XA 3F0NA 5JXSA 4JI6F 5I42A 1L3VA 1Y11A 1ITPA 5AJ3F 1JXBA 2MQMA 5KI6A 3C6UA 1QHTA 1RAOA 1TUGB 1X4CA 2HHSA 2HGMA 4J9RA 4FPRA 3J7YU 4ZK7M 1ASVA 1VS3A 3EPIA 2MKHA 4OZ1A 2R7YA 1C1CB 3OTDA 5J2QA 5IXUA 1KOHA 4IKAA 3DRRB 2YX6A 1XR5A 5RUBA 1S1UA 4K2XA 2OCEA 1NGAA 5F8JA 3VGUA 2KN4A 2WZ1A 3IFEA 3CCMN 2FQQB 4CP5A 1QQCA 1HPZB 4KH5A 2UXCJ 2XEXA 1CZAN 5GMEA 4Y2KA 4DV5K 2FBVA 3MFIA 4U7BA 2A42A 1NNDA 4GC6A 1AA1B 3C7NB 1PYTA 1SKRA 2PA8D 4KHNA 3RU0A 4EFHA 5F8HA 4M3ZA 1VSJA 5ADXA 3KHHA 4P10A 3A5OC 4CJKA 3BF1A 1VMBA 2VQEK 3ZTPA 3U1MA 4DTXA 2VDIA 4GVLA 2Y1IA 4ELUA 3ZSYA 4CECA 2G8HA 4A2BA 4Z4FA 5B08A 3QFUA 1SH2A 4F0KA 1VQ7S 4K8ZA 4B1YB 1D9AA 5JVHQ 3A3NB 3OYDA 1BC6A 2LU2A 5T14A 2YHBA 3D9BA 3O1BA 3GYXB 1YQHA 4BC4A 4ECTA 2UYTA 3OR1B 3AQPA 5J1EB 3G71S 3B8AX 4B3RK 3SSSA 1IBKJ 4K50A 3CERA 5J1PA 1JNZB 4A48A 4PWDB 5E5NA 5KFFA 3T5HA 2RF2B 1U2VA 2RQ4A 2MSSA 4DU4A 3FQKA 4ZVHA 5DG9A 1RHMB 2RPIA 2G8IA 3R97A 3ICLA 2D1CA 4ED1A 1V3SA 4WE1A 4CTAA 2C1EB 3K5OA 1WAFA 3BGOP 3UR0A 1M90T 3MHYA 2B8PA 4FYWB 3GG1A 4JKFA 1I1GA 3KK2B 3VF4A 4RO0A 4GKJK 1Y0HA 2P9IA 5LJ3Y 4W5QA 1EETA 4HCBA 2XQCA 4LRBA 2HVHA 3CC7S 3VQAA 1HNXJ 2JWKA 2W7PA 2EWSA 2DVIA 4NXNF 3ILLA 4LIWA 3SMPA 4H0VB 2JGUA 4DR2K 1J9AA 1S72S 4YOTA 4A57A 2QGFB 3OL8A 1G15A 2HURA 1HIYA 4Y3CA 1DY3A 3ULDA 4KE5A 1JXVA 5HBMB 2BKNA 2XS5A 2CNKB 1LOTB 1VR6A 4RUCA 3BSOA 2HHVA 3AVJA 3DMJB 2QC3A 4CEOA 3MF5A 3HD2A 1I94F 2RVJA 1RBLA 4DPXA 1WEZA 4YHHJ 2GQ2A 1X4BA 3OFHA 1RTHA 3SUOA 1BWFO 3MMBA 2X74A 5LMNJ 4PG5A 4ZVPB 3EMTA 2W9BA 4K5SA 3R1XA 3RZAA 5J2PB 2E2OA 4NLTA 2C3MA 2YWKA 5M2UA 4I2PB 1KVBA 4YY3F 2LQJA 5K8NA 1U6BA 1NO8A 2NXJA 4GW6A 1GOBA 3RB6A 1I51B 4N76A 4ISGA 2EKNA 2KU7A 1KD1T 2M88A 4B3SF 2F40A 4ANDA 3CCRS 4WQ5A 3O9SA 2O01C 3K2PA 2W9AA 1CG2A 4J9VA 1W7WA 5DO2A 4X65J 4Y1CA 4O3RA 1UVJA 4DTUA 4RKUC 1I3AA 4LF8K 2YPZA 2F3JA 3DN9A 2E6MA 1IXKA 2RKIB 5L8RC 3P8BB 3NH1A 4CEDA 3L7PA 3NAIA 4LFAF 1XMQK 3WNFA 2VG7B 2B6AA 4M5GA 4OJRA 4JI5J 2E5HA 1RWNB 5AQJA 1M1KO 2O8DB 3TAMB 2VQFF 3CJCA 2JVRA 4LBPA 3T1AA 4J9QA 5CYMB 3ULHA 1HWJA 3A13A 3CC2N 4CYUB 4ZJOA 2FJEB 2DNKA 1VQMS 2CPJA 2JH3A 3D2FB 1BD6A 3NGIA 5BPNA 3MXJA 4F2RA 4BRKA 4A47A 2NRXA 3N4WA 3G87A 1HMVB 2M0GB 4A5AA 3J81j 3BGRB 1S1WB 1OPZA 3BQ2A 4NA2A 2XMMA 4GO5X 1Z05A 3EZWA 3CCUS 3SV3A 4N7TA 2WB1D 3CCJN 4DR6K 3AVAA 1C0FA 1QS4A 4EHTA 3QWUA 3EVMA 1S9EA 2QYCA 2I2YA 5HLFB 2BV3A 3QT6A 2V0NA 2XMUA 2ZJPQ 3VZIA 4OX9J 4FJ7A 3CG7A 1RTDA 3ZX2A 1ACMB 5BYRA 2IC3B 2QA1A 1FW6A 1QQNA 2J7KA 2R7OA 2RE2A 3U8XA 5M1PA 1U49A 2MHEA 4I2QA 4ZJLA 2D5RA 1ZM4A 1G6BA 1U1PA 1YI2S 4P6QA 2NRZA 4ES1A 2KG0A 3KJNB 4AF1A 4KKOB 2DKOB 3SDEB 4H0XB 1HYSB 3BH6B 4WXWA 2PIIA 5KFLA 3CC4N 2XHCA 4ECSA 3QPIA 5K14B 1C2PA 2LSNA 2UUCF 3PX6A 4U9RA 1FX2A 3IR5B 3ITHB 3OYJA 4JBCA 2RDIA 1PC4A 4KHUA 3AOCA 5BXIA 3V1QA 4E98A 2OPRA 3CCLS 3BZCA 5EWFA 2GAGC 1OKJA 1U1OA 4BWJA 3PFOA 1HR0K 1OSDA 4BHQA 4M8LA 2XO6A 3VTIA 3TUPA 1X4HA 4F3MA 3TX0A 4JKDA 5CYQA 4CLZA 3OSPA 2BA9A 2ZHAA 4IZ9A 3KWMA 2L9NA 1VDHA 4DI6A 2F8HA 1BE4A 1K0VA 2XSJA 2H65B 3PCOB 4G9ZA 2MGZA 2ZE2A 3O9UA 4HKQA 1Q79A 2KG1A 3ZTRA 4HR2A 3FEZA 1Q8KA 2B4UA 2Y0SD 2ZDPA 1GFWB 4JP8A 3PW5A 2R7SA 3ULEA 4PQAA 1S6OA 2F9WA 2DIUA 3M8WA 3VEXA 3NHGA 3PYFA 5TKWA 4KO0A 4FW2A 2PD1A 4ES3A 2E1AA 3AA5X 4JKBA 2J9EA 2EFGA 2YQ1A 2D3UA 4ECWA 4ZITA 4RBTA 2DY1A 2OTJN 3U1LA 4NLRA 1LXJA 3OXLA 3FSYA 4HL9A 4CK1A 4CHQA 5LJVA 3PX0A 4B3TJ 4WCEQ 1J5EF 3NCRA 2AEFA 3BBCA 1P27B 2WVEA 2WONB 2Q97A 1Q18A 2XS7A 1XC9A 2XI2A 3W5ZA 1MWMA 2HVIA 1DTTA 1XMBA 1M5VC 2EK6A 5M1QA 3HTVA 3LM9A 1ROFA 4YB7A 4O8UA 4UT4A 1T7PA 3C46A 4RPFA 2IVFB 2FSNA 3A5LC 2BMBA 2A10A 4Z7YA 4E1NA 3R7SB 1U1LA 2CVEA 5C5JA 4W5OA 3WXJA 4CGDA 1E6YA 4A2AA 3AVGA 4KI4A 5AQGA 3QIOA 1Q81O 3PUFA 2KT3A 2UXCK 1OH8A 2AMCB 3CCWA 2IVYA 2BUNA 2IDEA 1IKVB 2DGWA 1AUSL 1BI4B 2RDDA 3MM6B 3RWUA 1SAZA 1HWIA 4M5JA 4ILJA 1SC6A 2VKRA 5I3UB 4BCAA 2CNNB 4DR5F 2GW8A 4GVBA 1ZA2B 2OTLN 1GMWA 1AXQA 1SC4B 2KYXA 2HNYB 2NREA 4NLSA 1NM2A 2R8JA 3N6LA 2CADA 3BN7A 3AY9A 2IMOA 5AZIB 3P38A 1RABB 3L3VA 1XQIA 1NH8A 4C8ZA 4OPKA 3WQUA 1KP6A 2V2QA 4DXLA 4E1MA 2YNGA 3EGWB 4L74A 2OYQA 3C94A 3TUJC 2WSEC 3IDHA 1H2VZ 5E26A 3DNCA 4K0KJ 3SSRA 1GLLO 5FDLA 4JI4J 5F0UA 1FEEA 4JAXA 3IN5A 3SV4A 3KTQA 2R4FA 2VGNA 1IBKK 3SQ2A 5IWAJ 2G0IA 3HKZD 2X1BA 3WIVA 3QINA 4AL5A 3MEEB 4ELTA 2RHKA 4B8AB 3ZT3A 2AW0A 3LGMA 4IR1A 5F3ZA 2GQCA 1TL1A 2DNRA 1KQKA 1Y97A 3D45A 4ZN3A 5KPZA 1CXUA 1EHWA 3GE1A 1XC3A 3D54A 2XMAA 3K17A 2FC8A 1AZSA 4E7IA 2BABA 2R8GA 4CO1A 4JI2F 1XNQJ 1TUUA 1WSEA 4DF8A 4OHXA 2DISA 2OH2A 5L1JA 3R6LB 3NNCA 3F9MA 2PEBA 3AD8C 5E41A 2C2NA 1HHTP 3TSUA 1U8WA 2W4DA 4TQRA 2C2KB 3HO1A 4JK8A 2YH0A 1KN6A 1RZMA 4BVOA 4UF4A 4KI6A 3BZQA 1J27A 2LEAA 4DMZA 3GG0A 1U4BA 4DV6K 4LF7J 2RU9A 1YRTA 4EUVA 1YJTA 3OYNA 1TR0A 5C12A 2AF6A 2MHNA 3Q89A 2C2OB 1JJ4A 2HBJA 4IEEA 3ISNC 1HNXK 3ZSRA 4EYHB 1VBZA 1B9DA 5BREA 4JRPA 1VJWA 1XMOJ 3LDNA 2W2OP 1N33J 4WQ4A 2EVZA 3AVHA 3CD6N 1HHQA 2B5JB 1IG9A 4OYWA 3ZNJ1 3PHEA 3ZLJA 4LF1A 4LF5K 5FLXU 3G9CA 4OHVA 5L9NA 3CJ8A 3TSQA 3PW2A 3GSIA 2EG1A 4NLVA 4YDXA 3JAMY 2NSBA 2WBNA 5F41A 1PILA 3OS2A 3C19A 1WKJA 5A8RB 3CIMA 5HATA 2E1RA 4YHHK 4X66J 1NSPA 5D0HA 2CKWA 5F9LA 4AM7A 3D7SB 2AGQA 4QQBA 3T41A 4ZVQB 2KT5A 4H5TA 1NU0A 5LMNK 4CESA 3T6JA 1TK5A 2ROEA 1U1KA 4DV3K 4ZS6A 1HQ2A 1O13A 4FWLA 3PEHA 4CZIA 2Y9HA 1Q7YT 1HFEL 4WWSA 4BC5A 2HB5A 1MMLA 1M5OC 2UU9F 2BQUA 5AE2A 3KLGA 1RHQB 2HQDA 5B0DA 3HP9A 1HBMA 2Q79A 1HQUA 4OJ1A 5B0CA 1HNWK 2KQ2A 4XDDA 1J53A 2HHUA 4X65K 1REGX 2ZBRA 3DXBA 2BE2A 5E3PA 1R8PA 1RTIA 4IG3A 1HNZK 2NLWA 2B4OA 4EP4A 1RTJB 5BYSA 4M3YA 4ED4A 1BUPA 2WTFA 4JI5K 1SL0A 3FBBA 4DV7K 3J80U 4CQ1A 2BE9B 1NH7A 5HJYA 2VZ9A 4A8QA 4C6AA 3PZPA 2AJ4A 3M1VA 4M1KA 2FF6A 1LAVA 3TR5A 4DCOB 1KAZA 4I7FA 1IV0A 1OYDA 3R2CJ 4DUZF 4K25A 1TK8A 2NRTA 2MY8A 3C3LA 3QMQA 2Q3SA 3EYZA 2OPPA 1LWXA 3MCAB 4DX7A 4LFBJ 4ZCIA 2Z30B 3KMQA 2FJBB 3G4SS 3MMAA 1NMNA 4ECRA 1R59O 1YIJS 1RDBA 1JB0C 3W2VB 3RSEA 5AQHA 2ATQA 3HDSA 4ISFA 4DL4A 3IG1B 3Q8YA 3P49B 5HI7A 2WTUA 3CFRA 4W5TA 3QAEA 4DOZA 3ZZZA 3AA9A 2ASMA 4DFPA 2VPZB 4NLUA 2IDLA 4OX9K 4JD2B 1N5SA 2NLXA 3TJ9A 2P9NB 2K2PA 2UXBJ 4BG8A 5KT4A 2QRRA 3IRWP 3F73A 3LOUA 4OI3A 2V67A 1T9YA 1YTAA 2M8DB 1ZTTA 2EK1A 3MM5A 4H4OA 4FWRA 4IJAA 4DSIA 3ILIA 4J9MA 4DUYJ 3KJVB 1VIOA 2G8VA 4NOHA 4WK3A 1M5SA 3QSYB 2EKYA 4DG1B 4FNHA 4J9OA 3DWLA 2J9DA 4WK1A 4B3MF 2YWWA 3LP0A 2CJAA 2ZBCA 4O4GA 3D66A 5DS7A 2OSRA 4OHZA 4PL7A 4RNMA 1WF1A 4OYOA 2ROGA 2VC1A 4GRSA 5DM7L 3FRYA 3C0BA 3GYGA 3I5BA 4OHWA 3R1HA 5F8IA 4NCAA 1IM4A 2WC9A 3MMCA 1HI1A 3VF0B 4QZVB 2MKSA 3DFEA 1ITGA 2HNZA 4EEYA 5HMYA 4FJIA 2W2NP 2YWFA 4LSLB 2IM3A 2F4VF 4K5RA 2NR0A 4P9SA 2CPEA 1PAEX 4CF9A 2DHAA 4CEFA 1U0HB 1R0AA 3H4DA 2R8HA 2BZ2A 2V6AA 4C8YA 1Y3JA 4JV0A 3QO9B 2EEYA 1N32F 2WSFC 2KFZA 2I5JA 1SIZA 4DS4A 1IR2A 1YVNA 4OZ2A 4AD6A 2ZHBA 3AAWB 1HBUB 5EUHA 1V4TA 5E3QA 4LFCF 4BR0A 4RW8A 3G82A 3BF3A 1WC0A 4A46A 1L3UA 5CE3A 4X4VA 1VK8A 5D4NA 2UUAJ 4PWWA 1FJGK 1O1WA 3MXMA 4K4YA 2EFOA 5AXNA 3WNHA 3P5BP 1JLEA 3ETMA 3DC2A 3SZ2A 1P90A 3CTRA 2BE7D 1DRZA 4RWXA 2FYXA 4W98A 3T1HK 2ZNYA 4KHWA 2MZJA 1W0HA 1H98A 1X5OA 2GGPA 1T3NA 1T3OA 4RLEA 1JLAB 4D3GA 5F0XA 3QIPA 4P7TA 2OFGX 1WSIA 3H2UB 4V19J 4PG6A 2CH5A 4U96A 1UFWA 2PDAA 3HK2A 1BLUA 1PYOB 2ZNZA 2AGPA 5D4PA 4RW9B 2OLWA 3CJKA 1ZBFA 5GAHI 4OPHA 4AHUA 1FNXH 4L6V3 3R5GA 4OYXA 2V7YA 1S72N 4TSXA 3QBWA 3IA0A 1TL7B 3CCZA 4KV8A 5CD4A 2HVEA 4RUHA 4A8WA 3SCIE 1FKAF 2I7NA 4HTUA 1UWBA 1U7LA 2XHWA 4LREA 4JI0K 2Y8WA 1CSJA 1RHKB 2ZD1B 4LUBA 2COLA 3OTOF 5LT5A 3IKMA 1BHNA 2R7RA 2VFTA 5H9EK 1QZ5A 3JAMO 1R8AA 1ZBIA 2RQCA 1S0NA 2JVOA 3LP1B 3FMWA 1VQNN 2XTJP 1X4GA 5EHHA 2DNLA 1JX4A 4OYPA 4M3TA 4FM2A 3BYRA 3JQMA 2GC8A 4AHSA 4QIVA 3G86A 2YXLA 4XPEA 3NEKA 2ZH8A 3LPUA 3CE8A 2GX8A 3L2UA 2QKBA 3VQ8A 4FN5A 3TPQA 3CFOA 3KVGA 4CJTA 2PMWA 1T9UA 2BQ3A 4K0KK 4DV2K 4LY7A 2NQPA 1K8KA 3T1YK 2GAHC 2NUBA 4BGBA 4NX9A 3KK7A 4CZGA 3EDRB 4LSNB 2WVBA 4JKCA 1TK0A 2YY3A 2HFSA 1TV6A 3KUHA 3MD1A 1HPMA 4CM0A 2D4WA 2HNDB 1VLOA 3UKUA 2YNFA 3MURP 1TP7A 4NXNJ 2IHR1 2RHSB 3HF5A 5HRNA 1W2BM 1VBKA 2JWLA 1GLFO 2Q6CA 3HVAA 4N56A 3DLGB 3MMBB 1IQTA 4CJQA 3DLRA 2YV0X 4DV5F 4E0DA 1N6QB 1FRIA 1X4AA 2C2RA 4WYWA 4K4TA 2CVIA 1TUWA 4RUAA 2BUPA 1BCMA 2VFUA 4YNQA 3OFFA 1P8GA 4WFNL 3CW2C 3AVLA 2QMXA 2ILZA 4CO2A 3DAWA 2AYGA 3WX4A 3CCUN 2DR8A 2HSTA 1EQYA 1CJTB 3IXQA 1N36J 1XR7A 3I96A 4LF7K 1UTAA 2LQ9A 5KQ8A 4DU1A 2HFZA 2IRUA 2VDHA 2RD5C 2OIHA 4CM2A 2P9LA 4CH1A 4CJLA 3LZJA 2FSJA 3CF5L 5CR4A 2FC9A 4YY3J 1BY9A 1V3ZA 4UQGA 1ATRA 5AQMA 1JLGB 1I3OB 2VG5B 4F50A 1N33K 4M5MA 1HHSA 5KAKA 2Z1IA 4GC7A 2OPQA 3U3YA 4ZIWA 4HTIA 1YI2N 1TL5A 1G7CB 3R27A 4K8RA 2C3OA 2KVQE 1RT3A 5L1LA 3MR2A 5GAEP 1TKXB 4PQUB 1QHAA 3M8QA 4YOUA 3BUZB 3PSIA 3SQ0A 3T69A 4B9SA 3JSYA 1MDUB 3W66A 1EQMA 2HF3A 3M2RA 3JB9k 5DDRC 1C0UA 4X66K 4NEZA 2P9EA 4X4OA 3OHBA 2R7VA 3QETA 1W7AA 4QWCA 3CCLN 2VPWB 4F04B 2PMHA 4OQJA 3I32A 2VQFJ 2XG8A 2Q1NA 1VSEA 5D0GA 1WELA 4NCGB 2Q0UA 4CFAA 1QY7A 5HL7Q 5IT0A 1YBUA 1DQAA 4DN9A 4IOCL 3E9LA 1Q82T 2LXIA 2XZTB 2GEMA 3MM9A 4KHMA 4FJKA 4PKGA 5K8PA 4A8MP 1ZH5A 1YT3A 3CJSA 4AT1B 1NJYA 2GBZA 5JS1A 1T03B 3IAYA 3SLCA 2MYFA 3Q24A 4WYLA 4MIWA 3S8SA 3NS5A 4HT7A 2IRYA 3ZSXA 1T05A 5ITHA 3JTOA 4A8XA 5LM7E 4DTPA 3IWLA 1YF5L 3M2VA 4DKWA 3D6RA 1YDLA 2CJQA 4WTYA 4DL0C 2YX7A 3GJQB 1BL3A 5KFEA 3PG9A 4P2XA 2EPIA 4YDUC 4IFVB 3HD1A 4CZHA 4N47A 3TSPA 1FJCA 2OPRB 4C8MA 4J37A 4X2BA 3NWRA 4FVMA 3ENWA 4CGJA 3PRVA 4HHTA 4DQSA 4UQTA 3W9HA 2D41A 2QZ8A 2DHHA 4JYAK 3LP2A 2ZH4A 2KHDA 5B09A 3L09A 3J7AP 2MZQA 1VOMA 4GY2B 5F8MA 5F1XA 3HCXA 3CDAA 4DR4K 2RRBA 3ZYYX 3N6NA 1HI8A 1PCAA 2DPNA 5GADU 2H5EA 1NSQA 1NG9A 3GL1A 4DV0F 1X31C 3SAHA 3HFKA 2RT3A 4FXVA 2P9SA 3OYFA 2YKQA 5AQUA 2JEIA 1MLAA 4AQYJ 1KBRA 2UXBK 3NOCA 3THTA 2G0CA 3DRPA 2G1HA 1XR6A 2CNOB 2B9XA 1S0MA 3PJWA 1KTVA 2A3JA 4J2AA 4N8NA 4M45A 3D6HB 2R8KA 3F56A 5AQVA 3TAGA 3AOBA 1LOUA 1S1VB 3IBWA 2EWHA 3CJ7A 3QEIA 3M7VA 1RB0A 3THPA 2O66A 4OMFG 1IBMF 3WQPA 1MU2A 1PJ6A 4WQ5C 2FGCA 1YK9A 1UETA 1V9OA 2C2MB 2DO4A 2Z56B 1S59A 3OD2A 2VBXA 3ZFVA 2XCAA 1K47A 1FX4A 1VQKN 3C95A 3DDIA 3BDEA 3TOQA 5D8HB 3SQ4A 2PO4A 4BDPA 2GELA 1J5EJ 3UN5A 3FNNA 3QGPA 3PW7A 5C24A 4QIFA 2AX0A 3KLVA 5AJ3K 2DXDA 1ZBHA 2V4JA 2EW9A 1UFLA 3OLAA 3OYLA 3UVJB 5A0YA 1KHVA 3QDKA 1XNRJ 1GLAG 1VJQA 1P6TA 4DFJA 3JYTA 2JDJA 1EKEA 3MCMA 3ZZPA 1NUEA 3OUYB 3QRQA 3ASMA 1SQEA 4DL6A 2E7VA 2XRIA 5KFCA 1TQLA 3WXIA 2UUAK 3VA0A 1IG8A 5B0GA 1KQFB 2FSKA 3D68A 2B56A 3SSQA 3RG6A 2M52A 8AT1B 4IR9A 4NZ7A 3I0RB 4ENOA 2V8VA 3ZTQA 5KT2A 5IT9U 2FLOA 4FF2A 2R3VA 2MKJA 5KFQA 4B9UA 1RK8A 3IRXA 2E5LJ 3NVKA 4RWWA 1VQ6N 2Q43A 1ATSA 2YVSA 3R6MA 2POKA 2MQPA 2E1CA 4CJPA 4MFBB 1RDDA 1NGCA 4WFZA 4DSJA 4N5SA 3QLHA 1M90O 4NB4A 1IJEB 4HVJA 3VA3A 3NCQA 1NEEA 1WSRA 1NCLA 5D0RA 4X64F 3P5JA 1M5HA 4WKRA 3W9JA 1WOPA 2LDYA 3SCXA 2ZC3A 1WD6A 5DDQC 1EP4B 3PW0A 2ZJQL 2K06A 3D0GE 4Y28C 2P9KA 4RUBA 5LXRA 1UVIA 2ZKUA 4ZLNA 2WOMB 3A2FA 3FR0A 4ZPWR 4MQ3A 2IVPA 2HOEA 3QJPA 3QEXA 2HEKA 2ZGYA 3MTJA 2ZH3A 4JS4A 4N41A 3H5SA 3TZZA 3D3CJ 4OZLA 2D3OR 1CJVA 1LXNA 2ASJA 2CWXA 5AXLA 1X0PA 3GWCA 1FRLA 3N9UC 4WFNQ 3BBFA 5LSOA 2W2QP 3UE2A 1DTQB 4PXDA 3CETA 4CO5A 3J81Y 3OYEA 4C97A 4JI2J 1FJEB 1P1TA 4JI3J 3DI6B 4JRQA 4CD1A 3I31A 2HAFA 1VISA 2AT1B 3OTCA 3EN9A 2F65A 5KFYA 3HPGA 1Y7PA 4A59A 2IBOA 1UA1A 4C8OA 1NK7A 3F44A 3HJFA 4W92B 3FZMA 1GXUA 1NGIA 2O67A 1X1PA 1LEOA 1W9HA 4IDKA 2IS3A 3Q8RB 4KGKA 9RUBA 4IEIA 1FWLA 1X7VA 2XY7A 4M5KA 3NOGA 1AB8A 4Z2XA 3C6TA 4NXNK 4KRWA 4BY9C 3EKUA 4J7CA 2EC2A 2D3ZA 5KFGA 2YHAA 2WHOA 5HVFA 3PV8A 3NFAA 4M63A 3OL9A 4OYMA 2ADCA 3QGIA 3ZNUA 1JL2A 1XK8A 4AHVA 5B0FA 4M5DA 1AYEA 2O1PA 2R7TA 2XMJA 3I9V9 5KFVA 1RAIB 5CZVA 5F8GA 4KRFA 1ZPVA 2GS8A 1HYVA 2GV9A 3IR7B 5H9FJ 4QS9A 1GMVA 2E9RX 4BRCA 3UCGA 2LEPA 2H54B 1I94K 1LFPA 2V69A 4IOCQ 4CF8A 2AV5A 3DXKB 1TL4A 4QWEA 4RG8A 2YX4A 3W63A 1HL6A 3C14A 1KLNA 2H5IB 2W4PA 3WIUA 1TFYA 3QT8A 2VH7A 4YY3K 2BX6A 2GVDB 4HEA9 4RW6A 4ZPVR 4YUDA 1JNRB 3VQSA 2EBGA 1RDUA 1SKSA 1A5WA 3O3HA 1WUAA 1LW0B 3V6JA 1YJWN 3V1RA 2XO7A 3AA2A 4IFEA 3G6XA 4CD3A 3MWBA 1CZ9A 1FD2A 4B3SK 2WB4A 2M7SA 4DV4J 5ELZA 1WSHA 3I56N 4OYAA 3M2UB 4TVAB 3DOKB 4FBUA 1FDAA 2CQPA 1ZBTA 5GADP 4CLKA 5ADZA 2ZBPA 2IGIA 4AHTA 1IBKF 2V9KA 4O44A 3QFPA 1XN9A 1K9MT 3JSMB 2QLJB 3CJ5A 2AJQA 3IWXA 1KLMB 2R2TA 3DLEA 2BANB 3C15B 1IKXB 4LFAK 3KLHB 3QESA 3VAJA 4ANCA 1W2IA 3I4HX 4CHZA 3BR9A 1IJJA 5C25B 1SBRA 2VQFK 4K4VA 3CCMS 2QL7B 2EFVA 4AHCA 2AZ1A 3DDNA 1FWPA 2BXJA 2QL9B 1IN0A 3PYGA 1KDNA 2XWXA 1IVZA 1X9JA 3HVRA 3NBPB 2VC0A 2DFHA 3H3NO 1NHUA 2GVZB 1A5XA 2BKOA 2OANA 2QSFA 1S3XA 4OV1A 3SMZA 2W9CA 4LRCA 1S10A 4LBIA 2G8UA 2NPIA 4DUTA 3NGDA 1NK9A 3DXMB 1QVGM 3VEWA 3V9XA 4FLUA 4R79A 2D7SA 1X8DA 3GILA 4J9KA 4ETZA 3TP2A 3LDLA 2N3OA 4PPZA 1D3WA 4H4MA 1S0VA 4OPJA 5IC6B 4CGIA 2RQMA 1CULA 1SJ3P 2JWNA 1XHZA 1ZA1B 1BCOA 2MEWA 4RW4B 3CD7A 3L4IA 1S99A 3VR1A 2Q2RA 4MK8A 5CZXA 1OY6A 3ENOA 3P1GA 3FZKA 5ETTA 3T9NA 1TKTB 3FEXB 4NMLA 3J7AN 1K44A 4ED8A 2Q6BA 4USKA 1H1VA 3D0IE 2JL9A 5DDPC 2HPUA 3AOAA 3L3CA 3VALA 5M1OA 2FHJD 1LWEA 4R0JA 5ETPA 2UUCK 1RBRA 5IFMA 1T8EA 4F4KA 2VPXB 3T6BA 1S1XB 3W0LA 3TVYA 5DDOC 2DNGA 1YJUA 3DU5A 1NOZA 2P5OA 1UVNA 2QM1A 2QWLA 3M9OB 2O8FA 1DLOA 1WN7A 4W5RA 4KBOA 3D2EB 5CXTA 1WSJA 4DQ8A 3THWB 3CJTA 3TZYA 2C3YA 4DX8H 4OPAA 2D3O1 4BBYA 4C4WA 1JLFA 4BQLA 2BQRA 2VU5A 8RUCA 2F4VJ 2LP4A 4PYAA 1QE1A 4A62A 1GLBG 1PKUA 4CEAA 3CWJA 3I0SA 1I5OB 4USHA 3FMBA 4XEIA 4XH5A 2KW4A 1N32J 3G8SA 4PCQA 3NGKA 4OI1A 3QFHA 5ETOA 3RBDA 2MLZA 3LAKA 4JI5F 4K8XA 1A9NB 1FTCA 5E3CA 2K1RA 4H5VA 2CRLA 1VHIA 5KFHA 4EBEA 2XS2A 2WK4A 3EICA 2W41A 4KAZA 4FK2A 5HRPA 3NS7B 4J9LA 2DPJA 3QQCD 3J81O 4ECQA 1J5EK 4B1XB 1LNQA 4I6MA 4O3OA 2ROPA 3QSIA 2GV1A 2ZJQQ 2VWBA 3MN6A 2XYPB 3H3OB 3FCHA 3MDQA 2E6LA 3EGVA 1UWBB 3OR2B 1DQ8A 3MEGB 3EWGA 3X3UA 4QS8A 3A12A 2YKMA 1YRXA 2XZWA 4C8NA 4E1JA 2JC1A 2A6MA 3LGHA 4GMJB 1S6PB 1FDBA 3BGLA 1WSVA 2XHBA 3M32A 2A2CA 1TVRB 5DM6Q 2ZM6F 2WAQD 3R5CA 4BRGA 3IAS9 3CJAA 3AO4A 2XMVA 3ETOA 1JLQB 1KVAA 2V8PA 3HT0A 3QT5A 4BG9A 1RT7B 4TY8A 3TVZA 2VJVA 1L5UA 4CERA 1HBOA 3OTOJ 3CI5A 2QYGA 2RDJA 1VQOS 2HQGA 1VI7A 2ACMA 5DLFA 1F2GA 3L6QA 4DR5K 2E9TA 4WU3A 1F5AA 3NH2A 2FHKA 3D6FB 1HLWA 3ZT2A 1RYSA 3QZ7A 1T9WA 3ZC4A 3CC2S 3PFEA 4I1TA 1SJ4P 4NZ0A 4LMZA 4IWVA 4BRQA 4CEEA 4LF9J 4NLWA 5AQYA 1N8RO 2XNRA 4GKKJ 1NJIO 3DRYA 4LF4J 3V81B 4EZ6A 3BO2A 3IUCA 2O8CB 2HQIA 3TW0A 4NYFA 4JV2A 4F4YA 1ZZFA 4Q0BA 2XMTA 3VQ6A 4JK7A 3CCJS 4FPBA 4B9VA 3CQYA 3KK3A 3MPYA 1RT1B 4H0TB 4M5IA 3VESA 1KC8T 2MB0B 1U1NA 2WCXA 3M1FA 3IP0A 5GAGP 4JKEA 2GJIA 3AJDA 3MM8B 3TEHB 1J6ZA 4A8SA 1OSCA 1N5QA 3MM7B 3KG0A 3SI6A 5BYQA 2OKQA 4CBUA 2ASDA 4JI2K 3HFZB 2VCPA 3MAAA 1R8BA 5KOXA 3CC4S 2UUBF 4HYKA 4B3TF 2P9UA 3LQVA 2W42A 3B4MA 2FC0A 1N0VC 3DOLB 1U1RA 3RUBL 1EWRA 3VQCA 1QQOA 4FM0A 1K8AO 1GMUA 3I82A 4AL6A 3ZTSA 1APSA 5JMNA 5C10A 1B70B 1GLCG 4CK3A 2WFBA 3GP9A 3DLKA 2J7WA 2RQKA 3SK3A 2CPXA 3H5UA 3DGVA 3VHQA 3BV8A 2P9CA 1U04A 3CIPA 3HBTA 2OELA 2E1YA 2E1MC 2BOAA 2J0SD 3NAEA 2LVWA 2PE8A 1VQ8N 4IRCA 4E89A 4PEOA 1RP5A 3VQ4A 1RBAA 3R5AA 2E20A 1Q78A 1BQMB 1JCFA 1RBUA 2A1RA 2H48B 5H9FK 3AARA 4FYDA 2G8FA 1XERA 2WW8A 2IAJB 4FWKA 5G0RB 1WTBA 2DTUA 4MT1A 4Y65A 3H5XA 1KFDA 3A4TA 2XB2D 2FLPA 2HHQA 4F4XA 1DEJA 3M8PB 3V4IB 4KC5A 2CJYB 5KFXA 4URQU 1SQGA 1LWFA 3GBTA 3UD5A 2FZGB 2V68A 3EDQB 3EE9A 2EXUA 4Y2CA 2E5JA 3CXCR 2P9PB 2OTJS 2CYYA 3BPDA 5G4DA 4FWPA 4GVEA 1RE1B 1Y4ZB 3V6DB 2UZAA 2Z0GA 1UOCA 2ITMA 1YJNN 4WU2A 2GJFA 2UU9K 3NAHA 2RE1A 4IJNA 4Y00A 4L8RB 2JOQA 3GDQA 1D5AA 5HQMA 1KXPA 2BKPA 3RW6A 1FK9B 3GR1A 4TXSA 4JI4F 3CDEA 2EBEA 3D6MB 1ULRA 4IH7A 3CJ1A 3MN5A 2U1AA 2HSEB 3WEEA 5IWAF 4P2MA 4ZPTR 3SQGB 3BS9A 3GIKA 3AB2B 2FJXA 4F7VA 3KLEB 2KZMA 3OBWA 5HO4A 2XMWA 3CJ2A 3D4JA 3BY5A 5AFUH 1RDCA 1RUSA 3ID8A 2LLZA 3KKRA 1GH8A 4LR7A 5JJBA 3D1HA 5AE3A 3THXB 4M3WA 2VHGA 3ENAA 2Z2MA 2DGXA 3K0JA 3UQSA 1Z4UA 4NLBA 3VQEA 2DD8S 3DU6A 1XNQF 5HQ8A 3VEVA 5T7LB 2MTLA 3G2XA 4DUZK 3R3TA 1Q86T 4ZN1A 5AXMA 4DPYA 3MOZA 1JJHA 5F2RA 3BSAA 2IRXA 5SUHA 1I6JA 4KH0B 5HP1A 3RB3A 2OTLS 2QO3A 4I4BA 3DYAA 5AQPA 1JLCA 1SJ1A 4Y0WA 2BGGA 3THVA 2HFUA 3DRSA 1NK4A 3OYMA 2DH8A 5DQHA 4DV0J 5HVGA 3SAGA 4ERDA 4DV1J 2JLEA 4YB6A 3RR8A 1Q5VA 2NRHA 4CHPA 3NWGA 1XMOF 5HMWA 4TU8A 4CDIA 3PNIA 3B4DA 3MZIA 3M5RA 5CH7B 2E2PA 4WFYA 4Q8EA 3KHRA 1FJ7A 1CS4B 5FLXY 3H46O 3CQXA 1O6XA 3FZLA 2A1BA 1RWVB 2CQ4A 3L7OA 3MXIA 4IKFA 4MH8A 5E7OB 4JOUA 1VQLN 4X66F 1GTEA 4IG0A 2B9YA 1H73A 4F3TA 3RR7A 2MQLA 2DXFA 4OX6A 2HMIA 3MI7X 3OJSA 3PYEA 3EGNA 3K5MA 1IBMJ 4HACA 3HVTB 5FRMA 2HQFA 2G8WA 4AUKA 4UW2A 1RHRB 1N52B 3BH7B 1BISA 5ADXH 2RILA 3E9OA 2GJ2A 5C7PA 2MZTA 3DGPB 3S6EA 3IGVA 1S1TB 3ZZRA 3CCSN 4Z4EA 2AX1A 1YBAA 2IA0A 2YHYA 4W5NA 5KFDA 1FD8A 2VONA 3H20A 4KFBA 3P96A 2J76E 1WLJA 2F4VK 2HHWA 2YKNB 2YKAA 2DY9A 3PW4A 2NZTA 1HNVB 4OLPA 5JLFA 2OEMA 2XM3A 3R5DA 1N32K 3KLFA 1KFSA 2ERRA 1TMMA 4I6AA 1PSDA 5KFNA 3C65A 3NL0A 2ATLA 1JCEA 3TTDA 2Z2ZA 1RAJA 4LFCK 4IOXA 3MAHA 1BUXA 2A0FB 1RADB 3O6WA 4UUWA 4KH1B 2YNIB 1RHUB 3CD6S 4CO0A 1KCFA 1N5YA 3K8WA 3M30A 2NZCA 2JEJA 1N34F 3CM5A 4RW7A 2DNOA 2GO8A 3POTB 1HWKA 5KGXA 1TYQA 4DF4A 2HLUA 2MZRA 2VGMA 3WNGA 3E9PA 4YFUA 3M6WA 4OI4A 3IBCB 1NPPA 3Q8QB 1B0VA 1VRTA 1T6CA 3THYA 1AUDA 2A41A 2PGCA 4CWBA 1C0MA 2FB0A 1J5OB 5KFTA 4LFBF 3W62A 2P2CB 5ETRA 4PXEA 3IS9A 3FJ2A 4DQRA 2E66A 3WBZA 3ZETB 1NNEA 4ZLLA 3BN4A 3LM2A 2O8BB 4URSA 4KB0A 4IO1A 5B0BA 3D0HE 4F0HA 2DGUA 4BR4A 1BU6O 4G1QB 2M4MA 4X64J 2XMKA 2J0QD 1CBKA 4Z4HA 5L9XA 2AEJA 2D69A 3TVKA 2OEKA 1RA7A 2PFDA 3AFGA 1RCHA 4KTWA 4OL8A 5IV4A 1LW2B 4PG4A 3CJBA 5M2PA 2GMHA 1S22A 3KNGA 3L7UA 4IUFA 5EGYA 3IBFB 3CO9A 1RKJA 3RYLA 4K59A 2GHVC 2CIMA 4DUYF 2ALZA 4CIOA 4IRKA 3OTOK 4CJ3A 1OY8A 3ILOA 4E2FB 1IM6A 1XHXA 5HROA 3O5BA 4JHDB 1OPIA 1HNIA 3ENBA 2UVRA 2P6SA 1KTQA 4A8FA 1U6ZA 4ZLPA 1TAUA 4ED6A 1RT6B 4RU2A 3AO3A 1SCJB 3DM2B 1VBYA 4NYNA 2KJWA 2AYEA 3H4BA 1VQ4N 3NH0A 4KY3A 1XI1A 3E2EA 1NWKA 1S9GA 3H5YA 4HTLA 4QJVA 2B4VA 5HAOA 2CWKA 2N7CA 2H9ZA 3DXSX 3QWPA 2VODA 3EZUA 3WX8A 4LF9K 3PDNA 2BTFA 4M5LA 1SJRA 1F9EB 2BJ8A 2YKPA 3R2DJ 4BACA 3KLIA 3ZSOA 5J2MB 1F6TA 4IQMA 3FUYA 1JCGA 5AE1A 3CPEA 1BA1A 5AQTA 1CJUA 4TNOA 1YJ9N 1Y5IB 5A8KB 1S4FA 1K73O 2NRWA 1NDCA 3GU0A 4HUGA 2GNKA 5HVHA 1ZM2A 3U6FA 3DOMA 2EFQA 1YITN 3UN2A 6AT1B 4R5PB 3VVUA 3NGZA 2IIHA 3UPFA 4ELVA 3C8YA 3MOJB 3UR3C 1U48A 4JK9A 3W64A 3MMVA 2UUAF 3S7RA 2FTRA 3TA0A 2NXEA 1CJKB 5KG3A 1VSDA 2CQ1A 2HZCA 1ZYQA 2IM2A 1FFSB 3MGJA 2I7PA 3M8SA 2NCKL 1SV5A 1NZAA 2HK3A 4NLYA 1RILA 3CM6A 2DT9A 1IKYB 1KVKA 4P74A