5J2MA

Hiv-1 reverse transcriptase in complex with dna and efda-triphosphate, a translocation-defective rt inhibitor
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase p51 subunit
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/dna
total genus 166
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2mA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2mA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2mA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2mA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2mA05
3KD5E 3ZSVA 2OZSA 5CYQA 1TQLA 4OGCA 4ZPAA 3DOKB 4I7FB 4AHRA 4B9VA 3KJVB 1TAUA 3AO3A 4CF0A 3EY1A 4MFBB 4FJ8A 2HAIA 4DL6A 4NYZA 4DSLA 2HMIA 3CM6A 3AVNA 1WNEA 3H2LA 5KFWA 3K5LA 1VSFA 5FDLB 2R2RA 3LZJA 4E89A 3B6PA 2WONA 1RT6B 2YNIB 5DLFA 4J2AA 4IH5A 3MR6A 3VQCA 1SH2A 3O4NA 3OL7A 4OPKA 4CJUA 4O44B 3CM5A 1SV5A 1C0UB 3ZT1A 3MR5A 4Z4CA 2ATQA 2PYJA 3RWUA 4PA1A 2VG6A 1NJXA 1WSEA 4EBEA 2LSNA 3PZPA 1S0MA 1HQEB 5L9XA 2P5GA 3OYAA 4CERA 5KFNA 1NKEA 5KFGA 1UOCA 3ZCMA 4I2PA 4RW7A 1WSFA 1JLQA 3CJ0A 4E7HA 2UUWA 4DU3A 4AHUA 4FLYA 5HROA 2IAJA 3MECA 3CJ3A 3T3FA 1T05A 3DRRB 4R8UB 2FVQA 1S1WA 3O3FA 1JLEB 3MEDA 4AHSA 1HNIB 3F9KA 5KGXA 2QK9A 5J1EB 4FZZA 3KLIA 4ZHRA 4TYAA 3QEPA 2GC8A 2BQRA 1CZ9A 4K4UA 2BQ3A 3H40A 2OPRB 2KFZA 3G0ZA 4NLXA 2XHBA 4DFJA 1DTTA 1IKVA 4J9PA 4ZTJA 1IKWA 4TY8B 2IM2A 5J2NB 3EPIA 3QLHA 2C22A 3M9NB 4ZPDA 4QPXA 4KKOA 3BSCA 5DMRA 1KTQA 3QETA 3K59A 2RKIA 1RTHB 4C8NA 3KOAA 3V1OA 3ZSQA 2FBVA 2ETJA 4TXSA 4CK3A 2NUBA 4QAGA 3EYZA 4AHCA 1UA0A 4QWDA 4IFYA 4FJ9A 1NNDA 4YFUA 3WNFA 4HUEA 2HHSA 4CFBA 3MXJA 4CJ5A 5KT3A 1ZTTA 2J6SA 3CO9A 1WN7A 2BE2B 2YNFB 1RT3A 4ZP8A 4TSXA 5KFLA 1RA7A 2FBYA 1T94A 1JLFB 1S1XB 5EU7A 4FXDA 1S1VA 5KFVA 1YVUA 2VG5A 4MIBA 2IBKA 5I42A 2Y1IA 1BIZA 3D5MA 3PO5A 3OLAA 3E01B 2YNGB 3GILA 3SJJA 3OYFA 4LQ9A 1TV6A 4R5PB 4IG0A 1C1BB 1X1PA 3NCIA 3MFIA 4RU9A 3QEXA 2F8SA 1VRUA 3HJFA 1TAQA 3K2PA 4HHTA 1QSYA 1LWCA 4FJGA 4DTNA 4BDYA 4WXWA 1TL3B 2XCPA 1QS4A 5C24A 2A1SA 3G86A 2KFNA 2W8LA 3GV7B 4ID5A 3HL8A 4FBTA 4RW8B 3HVTB 2GUIA 1SL2A 2XC9A 1T8EA 4RUAA 1HYVA 1S1TB 4MK8A 5KG6A 1RT1A 1JKHB 4KHWA 1S1UA 3M8PA 4JUZA 3MTKA 3SQ4A 4W5RA 3IRXB 4QWCA 3AA2A 3DRPB 3UPFA 4Y34A 3TARA 3M8SA 5HRRA 4LH5A 1IKYA 4ECUA 2ASLA 3V9XA 1FK9B 3H5UA 1KFSA 4JRPA 1TKZB 3C6TB 4ECVA 2D5RA 1NK0A 3F73A 2WTFA 1NOZA 3PR4A 4ED7A 2X78A 4DQSA 3TAQA 4KRFA 2QV6A 4IQXA 4RW4B 5F8LA 5HBMA 4DF8A 3G6YA 1L5UA 4JV2A 1DLOB 2YNHA 4JV0A 4DTRA 1SKRA 4ECYA 4N56A 2FLPA 5DGAA 2OH2A 3DOLA 4O3SA 3ITHA 2F8EX 1REVB 3IAYA 2ZD1A 4DWIA 3DMJA 4IKAA 2XGPA 4JV1A 1TK5A 3IGVA 5DQGA 4B8CA 4KTWA 4IFVA 3DYAB 3IGNA 3RMDA 4PWDA 5DQHA 1RT7B 5L1KA 1N4LA 1RYRA 2XY6A 4NCAA 1VRTA 2D0AA 1QE1B 5I3UB 2KTQA 3RMBA 4NLOA 3QIPB 1FKOA 3AVBA 4RNNA 3AO4A 4J9SA 5CYQB 2IDOA 1RDBA 3FRZA 4DFKA 2ZKUA 4X2BA 4BE1A 1LWEA 1S0NA 3OYNA 3RB3A 1EP4B 1MMLA 4W5NA 3E51A 2HMIB 1CXQA 4DL7A 3PW7A 4CJFA 1S5JA 4IRDA 2X74A 3CDWA 2E6MA 2HHUA 4CGHA 2WONB 2HHQA 3ZSWA 3VQBA 2C2RA 4KBIA 3AVLA 1D9DA 3TAEA 2GIRA 3ULDA 5L1LA 3AVKA 4B3OA 3OYKA 1SV5B 4Q5VA 4FVMA 4OGEA 4DSIA 5F9LA 5JXSA 1ZYQA 1RNHA 3PJXA 1KVBA 2VA3A 1VK0A 2VG6B 3OHBA 5T7BA 4IR9A 2RPIA 2G8FA 2DFEA 1KFDA 4NLGA 3SV4A 3FDSA 3HXMA 3MR3A 3RR8A 4I2PB 5KT2A 4RW7B 4IH6A 3TVKA 1JLQB 1S10A 5HROB 2IAJB 3MECB 4O55A 1T05B 4RNOA 4J2BA 2BDPA 4CE9A 1S1WB 3SQ0A 3AVGA 3MEDB 2OZMA 1B9DA 3V6KA 4M3RA 4F50A 2ASDA 3M8QA 3GIKA 4DL3A 3KLIB 4ZHRB 2IJFA 1HPZA 4DQQA 1J5OA 1RTIA 2D3UA 3JYTA 3L8BA 3T5LA 1K1SA 4IDKA 1DTTB 1IKVB 3NGZA 3AA4A 1IKWB 2Z1GA 3K5OA 3QINA 1U45A 1TKTA 3V6HA 4O3RA 3QLHB 4URSA 4CHQA 4CHNA 3ZSYA 3VQDA 3O3HA 4KKOB 3DLRA 5CY4A 2RKIB 3CFRA 3M9OB 1NKBA 1S9GA 4IRCA 2ATLA 4KHUA 3UDLA 3PX6A 1RA6A 2V4RA 4J9NA 3QIDA 3KIOA 5FRNA 4IFYB 3RTVA 4MKBA 3KLGA 5HRPA 1LV5A 3GV5B 3U3GA 1Z4UA 1RT3B 2D7SA 3NH1A 4U7CA 1S4FA 4DLEA 4FM2A 4M42A 4ED3A 4DTSA 3LP0A 4Y1DA 4F8RA 5L1IA 4CJPA 1UWBA 1S1VB 2VG5B 2GV9A 4KHMA 4HUFA 3CDEA 2UVRA 4ZTFA 4RZRA 3PR5B 1TV6B 1J9AA 1GOCA 4CEFA 4KI4A 3MR2A 2XO7A 4IG0B 4CIFA 3KLVA 4CGJA 3I0SA 2JEGA 1D9FA 1KVCA 3KKRA 3L2WA 1ZBUA 3VN5A 1VRUB 3OYBA 3SUNA 1LWCB 3HP9A 3D45A 4FLTA 4DG1A 5C24B 1NKCA 4M3TA 4HYKA 3NDKA 3GIIA 2G8WA 4QW8A 5EWFA 2OPQA 4FK0A 3H4BA 4YNQA 3QYYA 2VWJA 4O5BA 1JIHA 1A5VA 2P51A 4F4KA 3N6NA 2W42A 2I1RA 1RT1B 1JLGA 3AVFA 1S1UB 3M8PB 5DLGA 4K4WA 3L3VA 4H54A 3HKWA 1RDCA 2WCXA 3Q8PB 1ASWA 2IM0A 4CGDA 3KHLA 3LALA 4O3NA 1Y97A 2KZMA 1KLNA 4M3UA 5F8NA 3HK2A 1IKYB 4LH4A 3RRGA 4JS5A 4KTZA 5J2PA 2CJQA 1WNSA 2RDIA 4F3OA 3PW4A 3OL8A 4BWJA 1BL3A 4QOZB 4BACA 5C25A 4ZP9A 4FJKA 4MQ3A 1VSMA 1A5WA 4TN2A 5HBMB 3T5KA 3H4DA 2WRMA 3DLHA 4O4RA 1L3VA 2BR0A 3H5XA 3FFIA 2YNHB 3HT3A 3BREA 3QGGA 3S3MA 1EKEA 3WNHA 3DI6A 2HHWA 1L3SA 3DOLB 1N48A 3QGHA 2G8KA 3ITHB 1JLCA 2ZD1B 5DG8A 3DMJB 5KFYA 3OJSA 4F2SA 1ASVA 4K50A 4CEDA 4N47A 3FSIA 3AO2A 4CEZA 3TI0A 4IFVB 2XGQA 1F21A 1NK5A 4LSNA 3KK3A 1ZETA 4CFDA 4PWDB 3KMSA 4CGFA 3EZ5A 2C2EA 5DK5A 2AX1A 4DU1A 5KFCA 3C95A 4XIUA 4KB1A 4CCHA 1VRTB 2W9BA 2E9ZA 3PW5A 4ECWA 1FKOB 4DL5A 2HNDA 1FXXA 3OHAA 3NGIA 2VG7A 3P5JA 2FVRA 5KTQA 3SUOA 4DQIA 5KFOA 3KHRA 3K57A 1KLMA 3KNAA 1LWEB 4FW2A 2IM3A 5KFPA 1K6YA 1N6QA 1YTUA 4GC7A 3N6MA 1QSSA 4DTMA 5CZ2A 1XHZA 3G10A 4ECRA 5KGWA 4U6PA 5KRTA 1WSGA 1Q9YA 2G8UA 5KFMA 1IKXA 4ELUA 4EP4A 1SKWA 3PX4A 4I2QA 2FVPA 4OKKA 1CXUA 3HPHA 4CEOA 4KSEB 3VQ4A 5HLFA 2DFFA 4F2RA 4B3OB 3DRSA 3FQKA 1NJZA 3ZT2A 2W9AA 4KFBA 5F9NA 4ECSA 1KVAA 4F3TA 1HNVA 3OS1A 2KW4A 2IGIA 3QEVA 3DLEA 4DTPA 1WAFA 2C28A 3DLKA 4CJVA 3S3OA 4Q8FA 3NAHA 1HMVA 4NYFA 4DTOA 3V6DA 1ZBIA 2R8KA 1HPZB 4J2EA 2O4GA 1QQCA 1J5OB 1RTIB 4DS5A 1BCOA 4CHPA 3JYTB 4EBDA 3RBEA 2B5JA 4KB0A 4HKQA 1QAJA 1RDDA 3ASMA 5HRNA 5KG1A 1X9MA 3K5NA 4IDKB 3OL6A 3LAMA 1L3UA 4DFMA 2E6LA 1TKTB 1X9SA 1ZBFA 4K4TA 1RBRA 3G6VA 3NF7A 2R8HA 4KO0A 4E7LA 3GYNA 4FW1A 4H4OA 1N5YA 4Z0UA 3OYDA 2JEFA 2HHXA 1U04A 3KLEA 4PUOA 5KG2A 4Z4FA 3GQCA 5KFEA 2XRIA 1VSHA 5T14A 1ZBHA 4DTUA 4NLUA 4E1MA 4NCGA 2A1RA 3L3UA 5KFHA 3H98A 4EYIB 3UQSA 1S6QB 4YR0A 4O0JA 4Z4HA 5EDWA 4UQGA 1TL1A 3GIJA 4FS2A 3SQ1A 2UVUA 5C42A 3NFAA 4WXOA 4ECTA 5L1JA 1T3NA 2HNZA 1HYSA 3LP0B 1VSEA 1FKPA 3IG1A 3EZUA 4MK7A 4Z4EA 1QTMA 1UWBB 4FZYA 2R2UA 2XI2A 1VSJA 1WLJA 1C6VA 2FBTA 3RR7A 4WE1A 4BWMA 2DPJA 4C8MA 4EZ9A 2ITGA 2Y1JA 2WOMA 4F4YA 1NK9A 1ZTWA 4FJJA 3T5HA 4B9SA 2C2DA 1HARA 1XWLA 3ZSZA 3I0SB 1K1QA 4TYBA 4JRQA 3PW2A 3LZIA 1LWFA 3NAEA 3VQPA 4IOBA 3BQ2A 1U48A 4QCLA 4ELTA 5KFFA 4DSKA 3PJWA 4EP5A 5KT7A 4TQSA 2XI3A 4NLDA 4DG1B 2FVSA 5F8IA 4IKFA 4N76A 3JSMA 4PQUA 4FCYA 3I5CA 1LAVA 2JC0A 2QKBA 1NOYA 4OPJA 4TQRA 4NRUA 4OLAA 2OPQB 4ZVGA 5KFXA 3TAMA 5JUMA 4ID1A 3V9UA 2X6SA 3D0PA 3QIOA 5F8HA 3MAQA 4DMNA 1D1UA 4ED2A 3KK1A 3PW0A 4DQRA 1JLGB 4J9MA 1RCHA 3SQ2A 3I5AA 1RDAA 4L8RB 5SWMA 3HP6A 5EWEA 1XR7A 4NYNA 1RBTA 4EO8A 1HQEA 2BRKA 4ZVHA 1EETA 3A2FA 1RT4A 5KFKA 1U4BA 2HWHA 4WFZA 4G1QA 3IS9A 3AVAA 5KFQA 5J2PB 1JLEA 1ZBLA 1CLQA 1J53A 3MFHA 4KHQA 4IH7A 5C25B 2RF2A 4K8XA 3Q8QB 2F96A 2R2SA 3P1GA 3T1AA 4JLHA 3OSNA 2EC0A 4CJRA 5EUHA 3RBDA 1Q8IA 3FFIB 4ZP7A 4M41A 3CYMA 3NF9A 4NLPA 2HVHA 2HHVA 3KKSA 3DI6B 4GMJB 2AGQA 3RAXA 2IMWP 1JLCB 3BQ1A 5F8JA 5CZ1A 1NK4A 3QNNA 2AX0A 4O0IA 2W7OA 2QXFA 4TLRA 2I5JA 3PV8A 3BQ0A 3OYIA 1KSPA 2YKMA 3LPUA 4YR2A 4LSNB 3KK3B 2JC1A 4MIAA 4J9QA 2BQUA 4DTXA 4GW6A 1RBUA 3OVNA 4XPEA 2Z1JA 3QEIA 5KFZA 2HNYA 4HCBA 4CJQA 2FVCA 3V81A 3BR9A 4BDPA 3VQSA 4ECQA 4RNMA 2GBZA 4KI6A 4M3XA 2HNDB 3CFOA 1HRHA 2VG7B 2FJWA 1D8YA 4C8OA 3UR0A 4URQU 4AILC 3ICLA 4E3SA 3MF5A 1KLMB 1RTDA 4CGGA 4MK9A 4KPYA 4NLTA 2ZE2A 4BDZA 2G8IA 3OL9A 3DM2A 1XI1A 1N6QB 3QEWA 4DTJA 3SPYA 3O4QA 5CYMA 1D5AA 2Q3SA 3MEEA 3U6FA 2E4LA 2AQ4A 4FS1A 3H08A 1NK6A 4Q44A 1C2PA 5HP1A 1IKXB 3OYHA 3L2UA 4B9LA 4FM0A 4I2QB 5C5JA 4XPCA 3VQ7A 1RT2A 5HLFB 3V1QA 3OYGA 5KG0A 3WNGA 3DRSB 4CF8A 3CJ5A 3ZT0A 1GX6A 2DPIA 4E7JA 2AGPA 4W5TA 1LW2A 2HW3A 2UUTA 4KFBB 3QNOA 4FJIA 4MH8A 2ALZA 4NLVA 3NE6A 1HNVB 2QE5A 1BQMA 3TABA 4CJKA 2VWKA 5KG3A 3KD1E 5KRSA 3DLEB 4F4WA 4ED1A 3BJYA 3K5MA 2QKKA 3KHHA 3DLKB 3V1RA 5SZTA 3BSNA 2ILZA 1U49A 4K8ZA 3V6JA 4LD0A 1HMVB 4FJ7A 1SKSA 4C8KA 1UAXA 3LAKA 3V6DB 1CSJA 4OVLA 5I42B 1TKDA 3LP1A 1OS5A 2B5JB 5J2MA 4CESA 2BRLA 1N56A 4MKAA 5KFDA 4KAIA 4TY9A 5F8GA 3NMAA 2Z1IA 4E19A 3MXMA 3SFGA 4J9LA 4Y1CA 4KO0B 2D0CA 4E0DA 4H4OB 2FJXA 3NHGA 1N5YB 4RUCA 3NF6A 4J2DA 3MEGA 4Y3CA 1C0TA 3KLEB 4PUOB 2DY4A 1XR6A 3AVCA 3OS2A 2HWIA 4Q0BA 4ID5B 3BGRA 4DL2A 4JS4A 4LSLA 4NCGB 1NHVA 1SH0A 1HYZA 3NH2A 2R8IA 5J2QA 4M95A 5KG7A 2V9WA 1TL1B 3UIQA 3SCXA 3QO9A 1LW0A 4KHRA 3VQQA 5C42B 1S9EA 3ZSOA 5FRMA 1U47A 2HNZB 4FJXA 1HYSB 3LP2A 4FBUA 2WHOA 1SL1A 3SFUA 3OLBA 2W9CA 1RILA 4FLUA 1IO2A 1FKPB 3IG1B 1QUVA 3OSPA 4FK2A 2YV0X 2J6UA 4WE1B 2XY8A 4FLXA 2B6AA 2WOMB 1SL0A 4AHVA 4E7KA 4GVMA 1T7PA 4DSJA 5KI6A 1S48A 4W5OA 3SZ2A 2DTUA 2FC0A 4NRTA 1VSKA 3VQ6A 1LWFB 4RW9A 4EEYA 4AH9A 2RDJA 3V4IA 1RDRA 2IA6A 3GV8B 3VA0A 3TAPA 4N41A 4WZQA 4CEBA 3QGIA 1WAJA 1EP4A 1I3AA 1JL2A 5K14A 1S97A 3HYFA 3JSMB 4PQUB 2W7PA 1YT3A 4K4VA 1DTQA 3L2QA 4M3ZA 3KLFA 3TAMB 4CFAA 3K58A 1Z25A 4K4YA 1KRPA 4FJHA 3O3GA 3KK1B 4RNFA 4ZP6A 4B9NA 3AVIA 4Z4IA 3AVMA 1MU2A 1ITGA 3NL0A 3THVA 3VQ5A 4NLQA 3AVHA 1ASUA 5EWGA 5D3GA 4IG3A 4CHZA 4FLWA 3CFPA 4CJ4A 2IJNA 4FLZA 1RTJA 4FLVA 3H59A 1U09A 1EX4A 1EETB 4QW9A 1JXLA 1S6PA 1W25A 1RT4B 2XCAA 4G1QB 3IS9B 4H8KA 3LP3A 4FJLA 3V9WA 4Y2CA 2Z1HA 3CIZA 4WFXA 1KHVA 1XC9A 4PY5A 1TVRA 2RF2B 4O3PA 2ZQBA 4DL4A 2AGOA 1B9FA 2WB4A 5HRSA 4C8LA 1YTAA 4CEAA 1LAWA 1X9WA 2FBXA 3DLGA 2XWYA 2WK4A 4N5SA 1JLBA 3I0RA 2RN2A 3SPZA 3CG7A 4K4SA 1C1CA 3AA3A 4LY7A 3Q8RB 2YKNA 4OL8A 3PY8A 1EXQA 2O4IA 1JLAA 4I9LA 3TR8A 2I5JB 4NLRA 2OA8A 1T03A 4G3IA 3QERA 2P5OA 3KTQA 2YKMB 4YP3A 2YHAA 4CF1A 4Q45A 1RAJA 4KV8A 3HVRA 3SUQA 1TKXA 2R8JA 3DLBA 4HVJA 4AHTA 4Z4GA 3AV9A 3SYZA 3ZT3A 2AWZA 2HNYB 4B9TA 3V81B 4OJRA 5KFUA 2HHTA 4O4GA 4URGA 2XY7A 2PZSA 5JS2A 3M8QB 2D41A 3KK2A 4K4XA 1HQUA 4ICLA 4WYWA 2PYLA 3T19A 4H4MA 1RTDB 1BCMA 4CJEA 5KG4A 5DQIA 2ZE2B 4ELVA 4KAZA 3DM2B 1BQNA 2YHBA 4BE0A 2HVIA 1WSHA 2GIQA 5CYMB 4M3YA 3MEEB 1VSDA 4OKJA 4YR3A 1BI4A 3DDKA 3VQAA 4KHYA 4ZVFA 5HP1B 5KFTA 4EBCA 2OPSA 5KFSA 3HPGA 5DGBA 5KT6A 1O1WA 1SUQA 3GIMA 2IS3A 2IM1A 1NJWA 1RT2B 3C6UA 1JXEA 3KLHA 4B8AB 3AVJA 3RMCA 3TANA 3U3YA 1I6JA 4BE2A 1TP7A 1S9GB 2E9TA 3RB0A 4HTUA 3V9ZA 4ED8A 4FM1A 4CJWA 2E9RX 4CF9A 1LW2B 5F8MA 2IC3A 4FK4A 4WZMA 3T5JA 1SH3A 2X6NA 2OPPA 3LANA 1BQMB 1RYSA 3AO1A 3KLGB 3PX0A 1RT5A 1IG9A 4FJNA 1TK8A 4RW6A 2FLLA 3VA3A 4Q8EA 1RBVA 1WSJA 4M94A 3VQEA 1B92A 1RBSA 1NHUA 4YMEA 2PY5A 3HHKA 4NLWA 5KFRA 1IH7A 3PVXA 1JL1A 3LP1B 2DFHA 2R8GA 3ISNC 3N6LA 3NBPA 5J2MB 5KFJA 1R0AA 2BANA 4F4XA 4KTQA 4ED0A 3TAFA 2XY5A 5KT5A 3RB6A 3OYMA 5KFBA 5E41A 3DOKA 4I7FA 4DSFA 3ISND 3KJVA 3MEGB 1KCFA 4HUGA 4MFBA 2BGGA 2OYQA 2EHGA 1C0TB 3PO4A 1YVFA 4Q0BB 2R2TA 2V4QA 4KB7A 4QWEA 3BGRB 5FDLA 3CDUA 1VSLA 4LSLB 3H5YA 3VQ8A 1Q9XA 3SUPA 5J2QB 1RT6A 3HVAA 2YNIA 2JGUA 3RRHA 4M3WA 3TWHA 1S0OA 3M9MB 4O3OA 4NLYA 2FLNA 3SV3A 3QO9B 1LW0B 4O44A 3D28A 1TK0A 4B9MA 2B43A 1S9EB 1C0UA 1W0HA 3OYLA 1D0EA 5DG7A 1KHWA 4E1NA 3RAQA 3LP2B 4NZ0A 2W9CB 2HB5A 1GX5A 3OYEA 1XR5A 2CKWA 2ASJA 4DLGA 2UVWA 4M45A 3QZ7A 2B6AB 3ZSRA 2FJVA 4DU4A 3DRRA 4CK2A 4R8UA 5JS1A 2ILYA 3WNEA 1HNIA 1IM4A 5J1EA 4NLSA 1QAIA 4DF4A 4RW9B 4ZMMA 2JEIA 3V4IB 4CF2A 2O5DA 3CVKA 3FQLA 4ZPBA 3ZT4A 4QWBA 5FROA 3CQ8A 3I8DA 2EX3A 2JLEA 2OPRA 4CEEA 2G8HA 1W9HA 3HVWA 4TY8A 1NK8A 5K14B 4F4ZA 5J2NA 3EPGA 4FZXC 1UA1A 1DTQB 1JX4A 3AO5A 3KLFB 5DG9A 4YQWA 3HM9A 4J9KA 3M8RA 3S3NA 5KG5A 4J9OA 2KQ2A 2D0BA 1RTHA 1TGOA 2IOCA 4DEZA 3Q8SB 4CIGA 1MU2B 2W8KA 1C1AA 2W9BB 5D3GB 4IG3B 4KREA 4CGIA 4FJ5A 4CEQA 1G15A 4K4ZA 1QHTA 4IBNA 3ALYA 4EYHB 1HJRA 1GOAA 3ZSXA 4DSEA 3HPOA 3PHEA 1RTJB 4ZPCA 2VA2A 4E7IA 3OY9A 4DS4A 3CWJA 4CK1A 4WYLA 1S6PB 3BDPA 3S9HA 2BE2A 2YNFA 2F8TA 2JEJA 3C94A 1S49A 4ED6A 4FJMA 3QZ8A 1TVRB 3OYCA 1JLFA 1S1XA 3KHGA 3TQ1A 2J6TA 4IR1A 3CJ2A 5KFIA 3HSTB 3HO1A 4CHOA 4FYDA 3DLGB 3E01A 2YNGA 1JLBB 3I0RB 3LPTA 4R5PA 4CIEA 3NKYA 4CJLA 1C1CB 1C1BA 4KE5A 3RB4A 1BGXT 1BIUA 2YKNB 1JLAB 4CFCA 3CJ4A 4HCCA 1XHXA 3L2RA 1T03B 1JXBA 1Z26A 1NJYA 1J54A 2KZZA 3PUFA 3NAIA 1TL3A 3NF8A 3SNNA 4KV8B 1C0MA 1TKXB 4DQPA 4W5QA 4KHNA 3NGDA 4Y2AA 3OYJA 4CJ3A 3LWMA 4RW8A 4RNHA 3HVTA 4R0EA 3IN5A 4RG8A 4O4GB 3NH0A 1S1TA 1S6QA 3KK2B 1HQUB 4ICLB 2R7YA 4OKEA 1BHLA 1JKHA 2D3ZA 4ZVEA 4H4MB 1QSLA 3OJUA 3SI6A 4NCBA 4CJSA 4XO0A 2G8VA 1S9FA 1BQNB 3NGYA 3VQ9A 4ECZA 3AA5X 3IRXA 4CHYA 3B6OA 1BI4B 4WFYA 5KFAA 5KT4A 3DRPA 2OPSB 1A5XA 4QWAA 4I9QA 4KHSA 1SUQB 1FK9A 2V0NA 3RMAA 1TKZA 3C6TA 3BSAA 3H5SA 4Q43A 3C6UB 4J9RA 3KLHB 2UVVA 1CZBA 4GC6A 3L2VA 3QESA 3I5BA 3TAGA 4EO6A 1L3TA 1NK7A 4B08A 4RW4A 2AU0A 3V9SA 1GOBA 3KMQA 2IC3B 4CJTA 2B4JA 1WSIA 1I39A 1DLOA 3OS0A 2OPPB 4CECA 1RT5B 4DFPA 3P83D 3G6XA 1REVA 4RW6B 1BISA 3LWLA 1VSIA 3SI8A 2P1JA 3LDSA 3DYAA 4IRKA 4ECXA 4EZ6A 4B9UA 1RT7A 4OLBA 2AJQA 3NBPB 1QE1A 3MXIA 5I3UA 1R0AB 2BANB 4LQ3A 3QIPA 3BSOA 4O3QA
chains in the Genus database with same CATH superfamily
3KD5E 4DR4K 4H03B 2OZSA 1TQLA 2P2CB 2RRNA 2DR8A 2VFUA 2FJDB 3VGKA 4I7FB 1OYDA 2HS4A 1HW9A 2ZVSA 1U7LA 3ZTQA 4BREA 2DR5A 4DL6A 4BG9A 4WCEL 3G9CA 5M2PA 4DSLA 2HMIA 3CM6A 2QN6B 3HHLA 3CJKB 3H2LA 2PFDA 4BR2A 1SJRA 1VSFA 5FDLB 1Q8BA 4NXMF 2HQIA 5D78A 1Z05A 1RT6B 2YNIB 4IH5A 5SUHA 3K0SA 2BH1A 4DR3K 3HSJA 3ATVA 3O4NA 1T44A 1C0UB 2YWWA 3ZT1A 2ATQA 2PYJA 3E9OA 1BWFO 5F2RA 3O44A 2RHQB 2MKSA 3D9BA 3QRQA 1S0MA 1HQEB 5KFNA 4L3QA 1ACMB 2ZJPQ 1CG2A 5MAOA 4RW7A 2B9WA 4JI7F 1WSFA 4J8FA 1WC1A 1UKUA 4DU3A 1YBAA 4WFNQ 4NA2A 4AHUA 2IAJA 5BYQA 5HQLA 2FVQA 1NSKL 5CHCB 1S1WA 1XJWB 3VOVA 4AHSA 5ADXH 2RVJA 1FTCA 2DT9A 3NGTA 2ASPA 5FJ4A 2P9KA 2JHEA 4FZZA 4JB8B 5H9EJ 3QEPA 1CJTA 2KYZA 2BQRA 1CZ9A 3M8WA 2KFZA 4NLXA 1ZZNA 1IKVA 5B0DA 4J9PA 1IKWA 3OBIA 3ENAA 3EPIA 4RWXA 1DQ8A 4H0OA 1IJJA 2E66A 4ZPDA 5LXYA 1YF5L 4KKOA 3HTVA 3AY9A 5DMRA 4USTA 2VGMA 3KOAA 3ZLJA 4B3SJ 3TP2A 4TXSA 2UUBK 4DR6F 2ERRA 3CCEN 4OX6A 4QWDA 3O1BA 1B99A 4IFYA 4PG7A 1BC6A 3OVBA 3WNFA 2RNEA 5LMNK 3MXJA 5LJ5Y 4CJ5A 1ZTTA 2J6SA 3CO9A 1LOTB 4TSXA 4WJBA 2D4WA 2ZJQL 4OZ5A 1PJ7A 4X4SA 1OH8A 1WF2A 4NB4A 2HG4A 1JLFB 4JYAF 2KHOA 1KS2A 5KFVA 3KUHA 2Y1IA 5AQVA 3PIPQ 2YVSA 3D5MA 1P1LA 2DNRA 3E01B 4IOAQ 3GILA 3J80O 1CJKA 1UL3A 1N36J 4IG0A 4QIWD 3MFIA 3L4QA 2O01C 2BM0A 3AD7C 3MD1A 1ATNA 1VHIA 3K2PA 2XMTA 4FYXB 2O67A 3KJFB 4OLPA 4BDYA 2LU1A 4WXWA 4DPWA 1QLNA 2XCPA 5C24A 2GTDA 3G86A 2KFNA 3VAJA 4ID5A 2E1PA 1NO8A 4BCAA 3KHYA 4HHUA 2QSWA 1N34F 1SL2A 2C1EB 1UFKA 4L3NA 1S1TB 1JK9B 4MK8A 5JMVA 1RT1A 4KHWA 5FPMA 4CW7B 3M8PA 4G65A 2YI1A 3MTKA 3CPWR 4A8KA 2NUHA 4W5RA 3C14B 3IRXB 1VISA 1FDAA 1KOHA 2N4CA 4HTJA 3QT6A 4ECUA 1I94K 1FESA 3RYLA 1O8BA 1YZ7A 2D5RA 5AE3A 2WTFA 1W7WA 3AJ2A 2E1RA 1NPRA 2GX9A 3D0IE 3TA2A 4IQXA 3WXLA 1Z6RA 1BWVA 4I56A 3CD0A 4Z2XA 5HBMA 4DF8A 5AQJA 2P9PA 4FYWB 2YNHA 4I4BA 3NNAA 3BUZB 2O8CA 4BRPA 2Z57B 8AT1B 4O3SA 3ITHA 1JJ2R 4JKAA 2J0WA 2MJNA 3DLJA 4JI3J 4PZVA 3KYLA 2AT1B 1XEZA 4K41A 4JV1A 1FWKA 3LA0A 1RADB 4JHDA 4B8CA 3MMBA 3A0IX 2G2YA 2LQ9A 3IGNA 3DFEA 2MKCA 4MYTA 4YHHJ 2R3VA 5DQHA 3BKTA 3V5RA 3P31A 1RYRA 4HHJA 2PSZA 3GU0A 4NCAA 4IOCL 5I3UB 3U1LA 4NLOA 1FKOA 2OFGX 4M5NA 1V3SA 3AVBA 4ISEA 3QT5A 1FRLA 4HTIA 4DFKA 3VAKA 2G9OA 2H4WB 4HH0A 2ZKUA 2ZH2A 3DU5A 2R7VA 4RX6A 1GLEG 1XMQJ 4XAKA 4UQTA 1MMLA 4PR6A 2HMIB 1FO1A 3HHLB 4DL7A 2VBZA 4CJFA 4IRDA 4F36A 4F9OA 5AQOA 4CGHA 1IBKK 1KAZA 4WK3A 2C2RA 2M2BA 1H1VA 2CH6A 3MUVP 3OYKA 5AFUH 4L6V3 1EQMA 2LLZA 1NDLA 1KVBA 2VA3A 3HF5A 2X1BA 1FD2A 2ZOFA 2G8FA 2YCHA 2C2OB 1GLAG 4DUYJ 3RR8A 2FF3B 4RW7B 2B4OA 4KT0C 4CZLA 3JQKA 1S10A 5GAHI 3TA1A 2IAJB 1JCFA 4J2BA 3H1QA 4BR5A 1S1WB 4MTPA 2OZMA 1B9DA 1FJGK 4BRCA 2LXUA 5KPZA 3IA0A 2JX2A 2XHWA 1CJTB 1RTIA 2DR7A 3F2KA 3JYTA 3L8BA 4ES2A 4BG8A 4CIOA 1K1SA 3L6QA 1IKVB 1HJOA 3NGZA 3AA4A 1IKWB 3K5OA 3GJSB 1V9OA 3V6HA 4URSA 3PDNA 5AFUA 4JKGA 4PKIA 3O3HA 3QJJA 4KKOB 4USWA 4Z37A 3W9HA 2XMJA 2Q1NA 2B4PA 4CLFA 1HPMA 5IQQA 2ATLA 2VQFF 4KHUA 2VKRA 3L0QA 3UDLA 3PX6A 5H1SQ 1FD8A 4CT8A 2AEFA 4J9NA 3CMEN 2GFFA 4IFYB 2I9SA 2Z4PA 3TX8A 4WCEQ 4N8OA 1D4XA 3KLGA 5HRPA 3WDOA 3HZEA 1QVFR 4ED3A 1B70B 2NXEA 4F8RA 3TR5A 2HGLA 4CJPA 3HFVA 2JLGA 2GV9A 3WX4A 1LK7A 4LFBJ 1XMOK 4GKKK 1FVQA 4HUFA 2BABA 4ZTFA 2E29A 2MZSA 3PR5B 1CJKB 1GOCA 2Y0BB 4LRCA 5HOOA 2PBDA 2XO7A 4DV7F 4IG0B 4CIFA 1EAYC 5AE1A 2EPIA 4DDFA 3I31A 1KVIA 1N88A 2GMHA 5CQGA 4KH6A 3VTIA 1QUPA 3AH6A 1ULRA 5C24B 2J9CA 1NKCA 3RU0A 1R7IA 2UUCF 4JI6F 2UXDK 1Y3KA 2MEWA 2G8WA 4QW8A 2OPQA 1YBTA 4YNQA 1JIHA 1A5VA 1VQPN 1ZAXA 1RT1B 3AB2B 3VETA 2MY8A 4TKTA 1VQ9S 2K8GA 3M8PB 3RJMB 3IUCA 1HKBA 1RGVA 4H54A 3HKWA 2WCXA 1HD0A 5FD1A 4O3NA 2VZ9A 2W7AA 4IOXA 5LM7E 2PA8D 3MX5A 2Y3YA 3UKUA 4KTZA 2IYIA 2Q1LA 1WNSA 3OL8A 4BWJA 4BACA 4QYRA 4ZP9A 2KLAA 3HZGA 1MW7A 1VSMA 1A5WA 2JWKA 3FCHA 4MDBA 5HBMB 2WRMA 4LBHA 4O4RA 1YK9A 5AXNA 2P9PB 2BR0A 3WIUA 2ZJQQ 4DR4J 3FFIA 1IV0A 2YNHB 5BRDA 3HT3A 3G6EN 3BREA 2XMAA 1TR0A 2O8CB 1QZ5A 3WNHA 3UD3P 2OTJN 1N48A 5AQWA 3ITHB 3SJHA 3R3TA 3PRDA 5K8NA 4CEDA 4K50A 4N47A 3OA9A 2F4FA 2CQBA 4JHDB 1WC0A 3TI0A 3MMBB 1ZETA 1OIAA 3KMSA 3W61A 2I38A 2F8HA 3MN9A 1EB0A 3C95A 4XIUA 3IBCB 4CCHA 1RXOB 1HUXA 2W9BA 4WK1A 4PXEA 1FKOB 1FXXA 4DR3J 3OHAA 1V3ZA 3NGIA 3J7YP 4CDIA 4Y28C 2ZWOA 4DQIA 4W98A 1LFPA 4CLSA 2DRDA 4IXCA 4FW2A 2IM3A 5BREA 3CCRS 2OEKA 1KAXA 4GC7A 1VQ5S 1QSSA 3R5DA 3D1OA 4OX9F 4B3MF 4U6PA 3JS6A 3CB4A 3TSPA 1PC5A 2KKHA 4DV3F 1CJUA 4EP4A 3ZTOA 4WQ4C 4OZLA 3MCPA 3VEYA 3VEZA 3HPHA 3CMQA 1RTZA 5HLFA 2V69A 3FZFA 4Y2KA 1H38A 1T9WA 1NJZA 4QYZK 1JCGA 1X5PA 4KHPF 4KFBA 3H8YA 5F9NA 1KD1T 3CCUN 4HI1A 1VLYA 3LGMA 3OS1A 4RL1A 4CQ1A 4GVLA 4H0PA 2A2DA 5C12A 1Y3JA 1W7AA 2FZKB 4CJVA 3S3OA 1S5ZA 4Q8FA 2H65B 3IDHA 1FDNA 3BGOP 1ZH5A 4DTOA 2R8KA 1RTIB 3JYTB 3RBEA 2B5JA 1RDDA 5LMNJ 3OL6A 5LJVA 4A8OA 5GIPA 1QY7A 1X9SA 1HNXF 4KC5A 5DDRC 1RBRA 4IOCQ 4JKGB 4QIEA 3HSZA 1Q79A 2BW7A 1UW9A 4B02A 1TYQA 1HI8A 4OI3A 3VPZA 5KG2A 4DN9A 3ZO7A 5A76A 4Z4FA 4RJVA 4FWQA 1VSHA 3OHRA 4DTUA 2GNKA 4NCGA 4OHWA 2KDOA 5F0XA 1RFQA 3MMVA 1A9NB 2UVUA 1E6VA 3ZEUA 4PXCA 5AT1B 3VAGA 2HNZA 2CDQA 4L76A 2K3KA 4OPHA 1APSA 4I6YA 4AL5A 1FKPA 4OYPA 5ETLA 5A2QO 3GCWP 1UPMB 2L48A 4V1Ak 4BGBA 2D0OA 4WE1A 3MPVA 4BWMA 2G1DA 1U1PA 4YB5A 1UMJA 3CCQS 1NK9A 1ZTWA 3I6PA 2CAJA 3CCSS 3R8EA 3WXMB 1RI7A 2IRYA 4P72A 4BC4A 2C2DA 2VOOA 4JRQA 3LZIA 2UV8G 5CH7B 4UY8T 4QCLA 4ELTA 1H2VZ 5KFFA 4PYAA 4EP5A 4TQSA 2XI3A 4WQ5A 2GWKA 3IBFB 4IKFA 1I94J 1F1BB 4N76A 1KQSM 3JSMA 4PQUA 3E1YA 3TTDA 1BOTO 3I5CA 1LAVA 2HFNA 4WP3A 2QKBA 2VF3A 4OPJA 2QT7A 2OPQB 1FE0A 4ID1A 3V9UA 3VQTA 4A47A 5F8HA 3MAQA 2AZ1A 4ED2A 3FFKB 2OFHX 3PW0A 3G4SS 4J9MA 2KXNB 3TSQA 2HQGA 5B0GA 3FMBA 4GKJK 1BG3A 2H54B 5KQ8A 3AAWB 1XR7A 1V6HA 4NYNA 4DV5F 1RBTA 1XK8A 4ZVHA 1EETA 3JTOA 4QZVB 3BO3A 3HD2A 3UKUB 2MXYA 5KAKA 5KFQA 1ZBLA 4LFCF 4OX8A 4IH7A 1RLDA 2VPYB 2R2SA 2ZWPA 3T1AA 3OSNA 1OQ3A 4K8RA 2CYYA 1Q8IA 1AUSL 1K8AO 3FFIB 3SSQA 3WC2A 2RQMA 3NF9A 4NLPA 4U7BA 3KKSA 3RBZA 3RAXA 4PPZA 1P6TA 4AUKA 3BQ1A 5F8JA 1NK4A 4JI8K 3H2UB 2IPOB 1YZ6A 3POTA 3OYIA 2GX8A 4FYYB 3D67A 2ZOMA 3VCDA 1NDCA 4JKBA 3QEIA 2RS8A 2QWNA 2DHGA 2HNYA 4BDPA 3V81A 1FJCA 1IBKJ 2LEPA 4RNMA 2GJFA 5EXWA 4IO9L 2A0FB 3K0JA 4DPTA 3UR0A 3M3ZA 4C23A 1FVSA 1M0SA 4KQZA 3H6EA 4E3SA 4D3HA 2DY1A 4NLTA 2H9ZA 2FB0A 4XDDA 4LF8F 3SPYA 3O4QA 1D5AA 4LREA 4WIQA 3MEEA 3H08A 1R8AA 5LJWA 5K8PA 4Q44A 1C2PA 5HP1A 3OYHA 3GOIA 1CJUB 2B7BB 2O8FA 4FF3A 5GAGI 1FJGJ 2LQBA 1RT2A 2QWPA 3TUZC 3KNGA 4YB1P 5HLFB 1EQYA 4IO8A 3CJ5A 4CLYA 1GX6A 2LDYA 2QWOA 2W4PA 3H25A 4JK7A 3THTA 2UUTA 4PG5A 4KFBB 5K8MA 3F41A 4NLVA 2QLJB 2ZM6F 1BQMA 4P6QA 2VWKA 3KWIA 1TUGB 3VGTA 1U1MA 3KD1E 5KRSA 4DCOB 4DR7F 2DNHA 2VOPA 4J91A 4F0KA 4ES3A 3V1RA 5IZHA 5SZTA 1U49A 4JI0F 1SKSA 4ETXA 1CSJA 2B5JB 3O5TB 2CNNB 5K8OA 1VQ6N 2BRLA 2UU9K 1NGFA 5JVGL 1T02A 3W7BA 2M8HA 4M7XA 3DJCA 4KAIA 2Z1IA 1J27A 3MXMA 1OH7A 2XLKA 4Y1CA 2J9EA 3QFPA 2BVZA 1S7IA 2E2PA 1TYQB 2F3JA 2JNJA 5HVHA 2DY4A 5HQ8A 2CNLB 1XMOJ 4GKKJ 2GZOA 4BC2A 1UETA 2HQCA 4LRFA 4JS4A 5D0RA 3EN9A 4LSLA 5FLXU 2ZH7A 4NCGB 5L46A 5J2QA 3DRXA 5D0HA 4OJHA 1CPZA 2IJRA 4PPDA 1VQSA 4JKCA 1E6VB 3QO9A 3VQQA 3EJMA 3ZEUB 2HNZB 1EKSA 1YJWN 4C8ZA 2FDNA 3SFUA 4DHVA 2W9CA 4EGLA 4FLUA 1FKPB 5AE2A 2YV0X 2UXDJ 4WU3A 2DCUB 4WE1B 2XY8A 2Z2MA 3MM6A 3JS9A 2B6AA 2JL9A 3PFOA 3J7ZO 1T7PA 5KI6A 1S48A 1X4HA 5AQKA 2AF6A 2FC0A 3VQ6A 4ANEA 3EEQA 1NGAA 3CERA 4AH9A 3V4IA 2RE2A 1FRJA 2MSSA 4CEBA 3VWSA 5L39A 2MB0B 3U9ZA 5E33A 1VQON 3HI9A 4MDAA 2XQCA 2P9NA 5IWAK 5K14A 1S97A 5AQFA 3JSMB 4PQUB 4ANCA 3AAQA 2VD3A 3KDNA 3U7JA 1YT3A 1LKZA 3F9MA 3C6HA 3N0VA 5ETRA 3K89A 1VAZA 1WKKA 3FMWA 5LMUK 4ZP6A 1Q4RA 3AVIA 3MHYA 1FE4A 3WBZA 3P4IA 1ITGA 3NL0A 3VQ5A 3FZ2A 3Q0AA 3QDKA 5D3GA 4IG3A 4E1JA 4DV1F 1R43A 3BS9A 4MO4A 2YH1A 1FWLA 2O1PA 3AJ1A 4FLVA 3N5BA 1QVGR 1U09A 1BE4A 2DK2A 2VQEF 1EX4A 1EETB 4JI5F 4QW9A 1JXLA 2XCAA 2QYCA 3W8GA 1PYTA 3LP3A 3Q2SC 4B1UB 1TVRA 5B0FA 5THWA 2PD1A 2M5YA 1GNKA 1OQ6A 4C8LA 1YTAA 4CEAA 1DARA 3QICA 2WK4A 2V8DA 4LF1A 1HNWF 4MLHA 3SPZA 1N36F 3CJBA 3AA3A 1RAEB 3Q8RB 4FWNA 4MLEA 1EXQA 3VAIA 5HVGA 5ETOA 2OA8A 3POTB 2YHAA 4CF1A 3CIMA 2NYHA 4FVUA 4KV8A 1FDDA 1OY6A 2R8JA 3DLBA 4HVJA 2K06A 3C66A 2IVNA 4AHTA 3OTOK 2V4JA 4Z7CA 2HNYB 3V81B 1KONA 2J7KA 4O4GA 2FY1A 2XY7A 3ZZTA 3BF1A 4QYZJ 2PYLA 1M5OC 1T9VA 3ZNUA 3P4UB 3D1HA 3W9IA 1BCMA 5KG4A 2MTLA 2MQNA 2VIHA 4DUZK 2YHBA 2GIQA 3MEEB 1VSDA 4OKJA 1BI4A 4XH5A 3VQAA 2KG1A 5HP1B 2OPSA 3VGSA 2E5LK 4BRMA 2O8FB 4OYBA 1KP6A 4KGXB 5AQRA 4QR1A 1P8ZA 1NJWA 3R2CJ 1RT2B 1JXEA 4LVOP 3RMCA 3TANA 3U3YA 1I6JA 4BE2A 1XNQF 1NGBA 1TP7A 1S9GB 1S6UA 4HTUA 4ED8A 2EFOA 4Z94A 4FM1A 4HVZA 4CF9A 2QA4S 2UXCK 4BRNA 4FF2A 1NJIT 3T5JA 1SH3A 3S8SA 5BR8K 1BQMB 1WG4A 3T1HK 3FCWA 9RUBA 3PX0A 1WKLA 2DH9A 3K8VA 1RCXB 3M05A 2E5HA 1BA1A 3UN5A 4RW6A 2VFSA 1F9FA 3AT1B 2F9DA 3LQVA 4PKDB 3S6EA 2E1CA 1WSJA 2R7SA 2HIQA 1WJ9A 3HHKA 2G0CA 1CEZA 5DRKA 1YI2N 5KFRA 3BF3A 3O4WA 2DFHA 3ISNC 5KFJA 2DEIA 3GPAA 1SIWB 2F4VJ 3B6BA 3G71S 3OYMA 5KFBA 4DHYA 2FHJD 3DOKA 4KY3A 1ZS6A 3VF6A 3DXKA 1IQTA 3ISND 3KJVA 3WUHA 4USJC 4MFBA 2BGGA 1CULA 1S99A 4IO9Q 2O3DA 1YVFA 3VF0B 1RISA 5LJ3Y 4B1XB 4QWEA 1HR0F 1SVDA 4LSLB 1Q9XA 5J1NA 5J2QB 2VUGA 4NLYA 3VGLA 4MKYA 3QO9B 2PAVA 2OJ3A 1MN9A 4B9MA 4X4NA 1KN6A 1DY3A 1D0EA 2UZAA 2W9CB 4NWBA 3AAPA 5HMZA 1GX5A 3OYEA 2WZ1A 4DLGA 1UTAA 3MM6B 3MN6A 2RB7A 2B6AB 2ROGA 3VENA 4R8UA 3BPSP 5JS1A 3OR1A 4QJVA 2MSTA 1PKUA 4NLSA 2Z58B 2L9WA 3MAAA 1U2CA 2MQLA 3V4IB 4GKJJ 3J7ZT 3JB9k 3FQLA 4ZPBA 5FROA 4FWMA 3CQ8A 3I8DA 2JLEA 4NA1A 4CEEA 2NSCA 3G8QA 1W9HA 2P9NB 4YDDB 1NK8A 5K14B 1NEEA 5J2NA 1HQ2A 2QLXA 4EI2A 1MMNA 2KXFA 4YQWA 4OQJA 1VHXA 2NRHA 2U1AA 3M8RA 1O5JA 5JVGQ 3CETA 5GVQA 1SJFA 4J9OA 1RTHA 2IOCA 4Y00A 4ZN3A 3Q8SB 5E3CA 4LF4K 4B1WB 5D3GB 4IG3B 1DQAA 5FLXY 3MUMP 3ZYYX 4K4ZA 1QHTA 4DSEA 1WC4A 3UFCX 5AQLA 1RDWX 3HSCA 4FPBA 2HBQB 4JI8J 3SBTA 4I0WA 2R7OA 4OYMA 1F5BA 2OSQA 1HHTP 2I8EA 2YNFA 2F8TA 2EWSA 2OTLN 1SJQA 1S12A 2XBPA 2R7RA 3CD6S 4C48A 3QZ8A 2ZBPA 1TVRB 3OYCA 4AFFA 4FWKA 4H5VA 3J81j 2W40A 5KPTA 2ZBIA 4CH0S 1XNRF 3HSTB 2CUYA 1VBKA 3PHTA 2YNGA 3GFHA 4AQYF 2QIFA 1M1KO 3O1WA 1OSCA 4NLBA 3NKYA 1Q7LB 1U1NA 3RB4A 3BN7A 1WF0A 2AV5A 3TYTA 3CE8A 1Q0NA 1WOPA 4K42A 4HCCA 4FWPA 3I96A 1NJYA 1RK8A 3PUFA 4P2MA 4UUWA 2GHWA 4KV8B 4DQPA 3NGDA 1WSVA 2MKIA 4Y2AA 2RQ4A 2V4JB 3OYJA 1GTEA 2CVIA 3ENVA 4RNHA 4LF5F 3NMRA 2QO3A 2ZJRL 4ZVPB 1SI9A 3IN5A 4O4GB 1UPPA 3MWBA 4BBYA 1MWMA 2F7TA 1Y4ZB 3SI6A 4NCBA 4LF7K 4XO0A 2G8VA 2Q6CA 2CGLA 4ECZA 1IBLK 4J9UE 5ITHA 3V2UC 1BI4B 3NS7B 4WFYA 1IWGA 2OPSB 2VJVA 5CZXA 1IBMF 2VGNA 1TKZA 3C6TA 3BSAA 4J9RA 4GY2B 3BEXA 1BUPA 1VCTA 4RW4A 1ICEB 4CO3A 2CZ4A 4CJTA 3QWPA 2UU9J 2B4JA 2AW0A 3W66A 4ATNA 1DAXA 3SBGA 4CECA 1REVA 4RW6B 1BISA 2R4FA 1LCUA 3UDCA 1VSIA 4E2FB 1AB8A 2W25A 3ZC4A 1N33F 1RT7A 3OTCA 4OJ3A 2AJQA 2IA0A 3KKFA 2XZWA 4O3QA 3TJ9A 3BM7A 5CYQA 4NOHA 1EX8A 5DS7A 1CQMA 4H4KA 1SC6A 2HPUA 3DOKB 1Q81T 3DXKB 5D0GA 3NGUA 4OFZA 3MWPA 2HZVA 4B9VA 1V5IB 3KJVB 4AL7A 4CF0A 4MFBB 1CULB 5D8HB 3E66A 4KJIA 3MM8A 4X62K 2VDIA 3EXCX 3LDOA 3K5LA 3TZXA 4LRDA 1Y5IB 4IEEA 2XZTB 2WONA 3CHWA 4BROA 3CNQP 4A4JA 4J5OA 3HD1A 1SH2A 4TU7A 4OPKA 5AZIA 2H1YA 3GE9A 3T1YK 3ENOA 4HR2A 1IJFB 2CQ0A 3ZZUA 1VQLN 2FGCA 3TUIC 4PA1A 2JDJA 2HRYA 2VG6A 3ZX3A 5ETKA 4EBEA 5IWAJ 4TNOA 2P5GA 4CERA 1NKEA 3I9ZA 1S4EA 2HBJA 4I2PA 2BJ1A 2COLA 3D54A 4E7HA 2ZH5A 4FO0A 3T3FA 4R8UB 1RHKB 4WBFA 1JLEB 1M5VC 1AROP 3OR1B 4YOYA 5LMUJ 2YPYA 4ISFA 3MAAB 2RILA 3CDAA 3O9RA 3KLIA 2NRVA 4ZHRA 5GAHP 2JJ4D 5CCMA 2VV5A 2YKPA 2C3OA 1E4FT 4JV5K 2HHHK 2BQ3A 5HJXA 3H40A 3G0ZA 4ZDNA 4ZTJA 3AFGA 1WHVA 2BEFA 5J2NB 1I3OB 4WFBL 3QLHA 2XMUA 2ZWHA 4BRHA 4HHHA 1HBOA 4X4TA 4QPXA 3BSCA 1FXRA 2HSTA 1RTHB 1BY9A 3OV7A 4C8NA 3V1OA 2FBVA 1HD1A 2HURA 3K9KA 3THXA 4CK3A 4C4WA 1RWUA 2Q2RA 4FF1A 1S22A 4AHCA 1UA0A 4FJ9A 2RIJA 2WW4A 2EFPA 4CFBA 2ASOA 5BJRA 3G82A 1WN7A 4BRQA 2JVRA 2YNFB 4ZP8A 5KFLA 1U1QA 4O23A 2FBYA 2CPIA 5EU7A 4RR5A 3OTOJ 4CZGA 3OVAA 2VG5A 4MIBA 1YJTA 1K73T 2IBKA 3I56S 3R6GB 5I42A 3W60A 3FBCA 3FJ2A 2ZH4A 3OLAA 2YNGB 4DV2K 2DHXA 3OYFA 1S72S 1TV6A 1M1GA 2YWGA 4USKA 1BUXA 3R1XA 1Q8LA 1KDNA 3NCIA 4GRSA 1HWIA 2AYEA 5HATA 3CO0P 3N4WA 4B9QA 2F8SA 4DUZJ 1TAQA 1QSYA 1HI0P 4C1NI 4X64F 5HI7A 4B1ZA 3ZTPA 2E5LJ 1VQ7S 4NMXA 2YQ1A 1HIYA 1CS4B 2GAHC 5GAEI 3A12A 1M90T 3UB5A 1IJEB 1NB2A 2ACMA 4KBOA 2FXUA 2UXCJ 1BDGA 3MAHA 4WPAA 4U8YA 1DGKN 3SQ4A 5BR8J 3T1HJ 1NBWA 1RAAB 3AXKA 2DTJA 2LP4A 2C3UA 2BOAA 2YTCA 1IKYA 1AZSA 1JXVA 2GVZA 5H1SV 2NS1B 3CJSA 3PIOL 1TKZB 3C6TB 3MPYA 3DU6A 4ECVA 3F73A 1TUVA 1NOZA 4OYZA 4DV6F 4ED7A 3A8YA 4DQSA 3TAQA 2E1ZA 2FPHX 4RW4B 4AT1B 1P8GA 2XS2A 3A8KA 2V9KA 2ZGZA 2QG9B 3BYRA 5B09A 3B4DA 1Q5VA 5A8RA 3DOLA 3FEZA 2WUSA 1F9EB 1REVB 4OO1J 2ZD1A 4R0JA 4DZDA 4IKAA 2KN4A 3W63A 3IGVA 5DQGA 2V94A 4HH1A 4QPTA 1WB9A 3L9ZA 4PWDA 1RT7B 2ZC4A 4LF9F 1RU2A 2ZZTA 4F02A 3ENQA 3UKRA 2EEYA 4DQ8A 4RNNA 5JJBA 2QWQA 5CYQB 1N32F 1RDBA 3ILIA 2RU3A 4ZLNA 3RB3A 3IM8A 3MM8B 4W5NA 2AKWB 2VHGA 2RHKA 3VVTA 4WIIA 2MPUA 2U2FA 2FLOA 2X74A 2FHJA 2WONB 4FSVA 1YITN 3IMQJ 4KBIA 4BHQA 3Q23A 5GAGU 1RBAA 3ULDA 2MQPA 3AVKA 4B3OA 4JI1F 5AZIB 3UD4P 4Q5VA 4FVMA 4OGEA 2JWNA 3Q83A 2VG6B 4LUBA 3C19A 2QJ3A 4IR9A 3D2EA 1KFDA 3HXMA 1T9UA 4I2PB 3TVKA 4DX5A 3SMPA 3J81U 3OFGA 2BDPA 4CE9A 3SQ0A 2GMJA 3V6KA 4M3RA 4OHYA 3M8QA 4LFAK 4LF4J 2VODA 4DL3A 3KLIB 4ZHRB 2IJFA 1G99A 3MR7A 1VQ8N 5K9FA 2D3UA 3C3LA 1GTHA 4JP8A 3T5LA 2MYFA 3ID6A 2RH3A 4IDKA 2MGZA 1V5VA 3FEXB 1U45A 2DEJA 3BBFA 2UXBF 2J9DA 3QLHB 1P27B 5DJBA 2CJXB 4CLKA 3DKDA 3ZSYA 1EQ0A 4NE9C 3VQDA 1HBOB 2Z2LA 4C0BA 4U9RA 5CY4A 1SXLA 3CFRA 3K8WA 2XWXA 2ROEA 2XHCA 4IRCA 2V8GA 3THXB 2HSEB 5AXKA 3QIDA 5FRNA 3TSUA 3R9LA 1SQFA 2QXLA 3IFEA 2CJ9A 4MKBA 1UWAA 3G82B 3GV5B 3U3GA 4K0KK 2D7SA 4C9DA 2BXJA 5AQIA 4DLEA 4FM2A 3HHLC 3L4BC 2G4BA 1OO0B 2X1GA 4Y1DA 2OCEA 5L1IA 2BKOA 3UNGC 2VG5B 3KJQB 4A46A 1SIZA 2YXLA 2J76E 4LC9B 5BRHA 2QFJA 2ZDOA 4A5BA 2UVRA 1WDDA 3BBBA 2OANA 2R9LA 1TV6B 3U27A 1J9AA 4JI2F 4L73A 4KI4A 4NLCA 1SBRA 4LF7J 1KVCA 3L2WA 1ZBUA 3AQOA 1RWXB 3UR3C 1DJ0A 4QS7A 3SUNA 1IBLJ 4NL5A 3D45A 2MZ1A 1S76D 4FLTA 4DG1A 3R3LA 4M3TA 4HYKA 3NDKA 3GIIA 4DMZA 3M6UA 2OEJA 5LT5A 5DO2A 1UVKA 4YY3K 2HS0A 1PBAA 1AXQA 2IVMA 3DDIA 2DD8S 1G1XA 3I82A 3AVFA 4WFBQ 2QLWA 1ZC6A 4K4WA 4JI4K 1RDCA 5AQYA 2YKAA 2MQ8A 2R42A 4CGDA 1AFIA 3LALA 4JNEA 3FGUA 1Y97A 3PM9A 3QSYB 2FHOB 1RKJA 1S0VA 1IKYB 1AZSB 1GMVA 2GVZB 2Q97A 5G4DA 4JS5A 2AYGA 1GXLA 3I55S 2CJQA 4F25A 4F3OA 2QEXN 3THPA 3JXUA 3B8HA 4MQ3A 3HFZB 4B3TK 4TN2A 5AQZA 4RBVA 3FZLA 2IMOA 2YJFA 4V19X 2IVYA 3CCVN 2HHWA 5A8RB 3DOLB 2B51A 2ZD1B 2KJVA 7FD1A 4ED4A 1UW4A 3FSIA 2PMHA 4NXNF 3EL2A 3A8EA 1X0PA 4X62J 2NZCA 3X3UA 1F21A 4LSNA 3KK3A 3FE1A 4CFDA 4PWDB 4CGFA 2Q31A 3ELHA 5DK5A 5KFCA 4AXJA 4X65F 4KB1A 3IFRA 3O3LA 4G1PA 1R8PA 2HVDA 3CJRA 2E9ZA 4NXMK 1IXKA 4ECWA 4DL5A 3CT9A 2AYMA 1HLWA 3UKRB 4LF6F 5C2CA 4ZITA 3GONA 3F44A 1KVKA 2NR0A 2DNLA 3SUOA 1IR2A 4NASA 5AQNA 3T1YJ 2D1KA 4HTLA 3QATA 3K57A 2QMUB 1KLMA 1VQKS 4QOTA 1RQ0A 2F9WA 5KFPA 1K6YA 1H2TZ 2J8AA 3N6MA 4CZEA 1WUAA 2D0PA 5CZ2A 3OQ2A 3J80U 1IN0A 3G10A 4ECRA 2DH7A 3SSSA 3WQTA 1NDKA 4M63A 4ELUA 4JI7K 3VVUA 5K20B 3ENWA 2YY3A 1FRHA 1CXUA 3KG0A 4CEOA 2Z30B 3SLCA 1X4EA 2DFFA 1HW8A 4B3OB 3HBTA 4YEAA 2CPYA 2XO6A 2L08A 3P5TL 4USVA 4JV5J 2HHHJ 1ZAVA 1WI8A 2W9AA 4C6AA 2E1AA 4F0HA 3D2EB 1HNVA 3OTEA 3C65A 3QEVA 4ZLLA 1N8RT 3MPWA 4IYQA 2QTDA 1X5TA 3DLKA 4F3MA 2B56A 4NYFA 3V6DA 2G13A 2WTUA 1WEZA 2N4DA 1BCOA 3CF5L 4KB0A 1Y0HA 4DR6K 1QAJA 3ASMA 2GVDA 1TL4A 4IDKB 1NB7A 2MGZB 4PABA 4C11A 5IQ6A 4DFMA 2F4VF 2HZCA 4K4TA 3E8OA 2BW2A 3NF7A 1O0PA 1R8BA 5F41A 4E7LA 4ZPTR 4FW1A 7AT1B 3WT0A 1U04A 5CYJA 3IXQA 4JYAK 3GG0A 5E3AA 3TRGA 1LEOA 2W2NP 3JTPA 2GW8A 2Z2YB 4NLUA 4DV2J 4E1MA 4CRJA 1OVYA 1V4TA 1HHQA 1X4FA 4Z4HA 1G4CA 3BBCA 5EDWA 2AIRB 1TL1A 1MG7A 4HI2A 1N5QA 2LECA 4KGMA 3NLCA 3VAFA 4I67A 5L1JA 1VQ4S 1T3NA 5FPEA 1HYSA 3QT8A 4ZOSA 3MMJA 3RSEA 3VF4A 3LPEA 2DPJA 4EZ9A 3J81Y 4OLOA 2NNWA 5G0RA 3DGPA 3J7Z5 3T5HA 1N34K 2CRLA 1HARA 1XWLA 2HFVA 1VI7A 5B0BA 1WG5A 4TYBA 4DR5F 2V2QA 1UJ6A 2M88A 1UEVA 2VYPA 4H0XB 3HLUA 4B1YB 2JVOA 1FA0A 3O8MA 4NLDA 5TKYA 2Z8QA 4DG1B 1ZPVA 1QZ6A 5D4OA 4ITSA 3GMGA 3QMLA 2JC0A 5A6WA 1PBUA 1Y00A 4TQRA 4OLAA 2DNOA 5JUMA 3RG6A 4X4PA 2X6SA 2IFXA 4EU0A 4DMNA 1D1UA 1IG8A 3KK1A 2GV1A 1WHYA 5RUBA 1BLUA 1RCHA 4OZ3A 3SQ2A 3I5AA 3OTBA 1RDAA 1FRIA 5SWMA 4FF4A 4X66F 5EWEA 5E5NA 1HQEA 3FCVA 5IS2A 3GJTB 3CJ8A 2HK3A 4AXIA 2CJKA 3BDEA 1U4BA 1AW0A 4WFZA 4G1QA 2G0IA 2ZH6A 2QX0A 3NCRA 3AVAA 3Q24A 4ETZA 1URNA 5GADP 3D6HB 1CLQA 3R9PA 4M5HA 4A8MP 2ZKTA 2F96A 1U0SA 3CC2N 2BMBA 4ZVUB 3P1GA 4JLHA 1I1GA 2A5XA 3GDQA 4EIAA 2CPXA 5EUHA 5T41A 1YKWA 2RU9A 2QA2A 4ZP7A 3PRBA 1YRUA 3GG4A 4GMJB 2IMWP 4DR2F 3QNNA 3MMAA 1NXIA 4O0IA 4TLRA 3CI5A 1P90A 3BPDA 4QS9A 4LSNB 3KK3B 2BQUA 2UYTA 5I9EB 2BUPA 1RBUA 2IDLA 4WP8A 4HCBA 4CJQA 1YIJS 1YJ9S 3VQSA 4ECQA 2WBRA 1KXPA 4M3XA 3AQPA 4ED5A 3B54A 1D8YA 4C8OA 5AQMA 5B7WA 2A3JA 3CJ9A 2XS7A 4BVOA 3SCKE 3ICLA 4YDUA 1KLMB 4CH1A 4NPOA 4HLBA 1HKAA 4ZKAA 3VHQA 3DM2A 3QEWA 5JICA 2QWLA 4A62A 2Q3SA 3W5YA 2ZUGA 2KL8A 2AJ4A 3W9JA 3L2UA 2I7PA 1LXJA 2HGMA 4XPCA 3J7A1 1EJ7L 1U1LA 4LFAJ 3V1QA 3VEOA 3MI7X 3WNGA 4YOXA 4CF8A 2DIUA 3T6BA 3ZT0A 2RQCA 4UF4A 4MKVA 3EWGA 2QL9B 2DPIA 1WEYA 2M52A 1VC5A 2IRXA 2HW3A 1WKJA 3FK4A 2UU9F 1YWXA 4MH8A 2ALZA 3NE6A 3J7AN 1HNVB 1B4SA 3TABA 2B3TB 1MROA 2VH7A 1UVNA 2CNOB 4ED1A 2GA7A 2QKKA 3KHHA 1WBDA 3K9JA 3DLKB 5EX0A 1JQGA 2ILZA 3SAFA 4LRAA 1PC4A 2IBOA 3D7SB 3V6DB 4BQLA 3LP1A 1KQSR 2VQFK 3KK7A 2VWBA 3WXJA 2Y8YA 2J0QD 4CESA 3PLAA 2GVDB 1XBWA 4W92B 3I32A 5A0YA 5DDOC 3S7RA 5KFDA 4C11B 2JRSA 3M32A 4J9LA 4K0KJ 4FKXA 2LCWA 4F7VA 2KH9A 1RU1A 3WEEA 2D0CA 2DHSA 3ULHA 3NHGA 3A3OB 3NF6A 4J2DA 4LVNP 5M2UA 3MN5A 1C0TA 3IR7B 3J80Y 2EC2A 2LEBA 1XR6A 3AVCA 3OS2A 3UI3A 2ROPA 3RAMA 2L9DA 1NHVA 3NH2A 1G3OA 5KG7A 1DEJA 5E84A 4ZLJA 2V9WA 4ER8A 1TL1B 2QRRA 4DV7K 3UIQA 3OFHA 4KHRA 1LW0A 4F67A 3FZBA 1C0FA 1UCNA 3JSRA 5EY4A 2A18A 2BJ9A 1HYSB 2C3PA 3RSEB 5AXMA 1LOUA 1IO2A 1FFWB 3NGRA 4FK2A 1N5TA 4WFAL 2J6UA 4X4QA 3W65A 5HQMA 1GLFO 3N4QA 4JKEA 4FLXA 2UUCK 4JI6K 4YY3J 1WWHA 2BOPA 5BXIA 5G0RB 3DGPB 4DSJA 1FXDA 3SZ2A 3A5NC 1VSKA 2V8HA 2XZDB 2GQQA 5CE3A 3GV8B 3I8BA 1EIYB 2DGUA 4I1TA 3TAPA 3OW2M 4WZQA 3QGIA 5E3RA 1WG1A 1YJRA 2VKZG 2CDRB 3MEKA 1AUDA 2W7PA 1NM1A 4QU6A 1MWYA 2A3ZA 2LXIA 2FC9A 2LVWA 3L2QA 1NCLA 2RUSA 1Z25A 4K4YA 2G0JA 1IQZA 2UUAF 3G87A 4JN4A 4RLEA 1VQNS 3KK1B 1SC1B 4B9NA 2PI4A 4B3TJ 4CD1A 3AVMA 4BRKA 2PN6A 4NLQA 2CQCA 3ILJA 1X5OA 4ZCKA 4CJ4A 3PYFA 1RTJA 1QM9A 2Q66A 3CCMN 1GXTA 3RW6A 5IC4B 3AD9C 1RE1B 4OIXA 4KRWA 1W25A 3P8BB 4G1QB 1PYOB 1KVJA 2PFFB 4K7QA 4FJLA 3V9WA 4R79A 2DO0A 4Y2CA 1FX2A 2Z1HA 3TW0A 1XC9A 2NXCA 3ZZ0A 3UCUP 2AJ1A 1Q16B 3JAMO 1U26A 4DL4A 2ZQBA 2AGOA 2WB4A 4NXMJ 3HMJG 1LAWA 1VIOA 1HNZF 2FBXA 3I0RA 1X60A 2OELA 2AZ3A 4OL8A 2O4IA 5LL6Z 3MMAB 4I9LA 5IT9O 4QIVA 1VJQA 2FZGB 1K8KA 4G3IA 3GBTA 1TTHB 3Q86A 5ETQA 4CO2A 4CZCA 1OY9A 5GINA 2HIYA 4JI7J 4OX9K 4W90B 4B3MK 4Z4GA 2W01A 3AV9A 1H73A 3EO3A 4CZMA 4DV3K 2HS3A 3IM9A 4B9TA 4KGVB 1NGGA 4OYAA 5C2GA 5EGYA 2XNRA 4DOZA 2D41A 3QQCD 1HQUA 2L9NA 4ICLA 5ADXA 5GAEU 2Z0GA 3T19A 4H4MA 1VOMA 4WQ5C 3O9QA 4A48A 1JNRB 2QI2A 3DM2B 4BE0A 1WSHA 3ZXWA 4KHPK 4YR3A 3DDKA 1RAGB 2RUGA 5KFSA 4CNZA 4OI0A 1R27B 4FL9A 2EFGA 2V7YA 3EE9A 3DXBA 1SCJB 3VESA 3FBEA 3V9ZA 3SXLA 4DR6J 1XMBA 3PKMA 4CZFA 3QBXA 1R8CA 3SAHA 4WZMA 4CLPA 4FPIA 2OPPA 3FZMA 1UVIA 2J4RA 2NLXA 1MROB 4OHXA 2MQOA 1TK8A 1S77D 1HNXK 4CBWA 1R0BG 3Q89A 4LRBA 3VA3A 4Q8EA 4YB7A 3VQEA 1XERA 3QMQA 1NHUA 4JYAJ 2CVEA 3RUBL 4UW2A 4NLWA 4A8SA 1IH7A 1JL1A 3LP1B 1Q86T 2CH5A 3N6LA 4M5IA 1ZZFA 1YHQN 3OXFA 2V6AA 5A0YB 4FN5A 2H4YB 2J0SD 1U2FA 1HWJA 4N77A 3M32B 1CVJA 1U6FA 3WEEB 4DSFA 3BV8A 4I64A 5L8RC 3QFUA 3LM2A 1Y5NB 2OYQA 1C0TB 2RQKA 2LQJA 4B3RF 2FTRA 3PYDA 4YOVA 5D4LA 3PTWA 4CBUA 2LA6A 4BC5A 1N34J 3M6VA 4DPUA 4O8KA 5GMDA 2F65A 1M5HA 2DGVA 4NZ6A 2FLNA 4UOGA 3LGHA 1LW0B 2Z2ZA 2B43A 2QFIA 1KC8T 2KVQE 5DG7A 3MGJA 1X3MA 1GEHA 4E1NA 4L3KA 3FNNA 2WAQD 4YOEA 1NHKL 1XR5A 2UVWA 5ETPA 4DPYA 3A3PB 3QZ7A 2YBVA 1VQYA 2FJVA 4PYDA 1RBLA 2AD9A 2VFVA 4FXVA 3B8AX 3WNEA 1WBBA 1HNIA 4K43A 4DV4F 5J1EA 4OZJA 3TEGA 4DF4A 1MMDA 4USMA 2PDAA 3CVKA 3QSIA 4QWBA 3ZZZA 4RBTA 2OPRA 3D3BJ 2XM3A 1R8HA 4TY8A 3UNYA 4I6AA 4WKYA 1VMBA 4DV5K 4V19S 1HX1A 1UA1A 3H42A 3AO5A 5DG9A 4ZK7M 2IRUA 1D3WA 3CTRA 3ZTSA 1PIEA 1KD1O 2KM8B 4LFCK 1VQMN 1WUUA 4CIGA 3EVMA 5BPMA 2NRTA 1VLOA 1ZXOA 4CGIA 4DX7A 4CEQA 3ZTRA 3R5JB 4EYHB 1HJRA 2GQCA 2ZBCA 1JJHA 1RTJB 3E2EA 3UVJA 3ET6A 1Q5YA 3OY9A 1PSDA 2EBGA 2VJUA 3CMAN 4CK1A 5E2QA 3CCES 2AEMA 2BE2A 2JEJA 2CPDA 3HM8A 1VHFA 4DR1F 3C94A 4H0YB 4ED6A 3U1MA 2A41A 1P9YA 1S1XA 2J6TA 4IR1A 3CJ2A 4O8UA 3C2PA 1UZHA 2MJUA 1FXLA 2WBNA 2NREA 2HBZB 2PA3A 2UP1A 3TVYA 2QMWA 4FYDA 3I0RB 5AJ3F 3LPTA 4R5PA 1C1BA 4WFAQ 1ELOA 1BGXT 4U8VA 2W41A 4MMOA 3BZQA 3TQEA 3L2RA 1GAOA 1K8KB 2W4DA 1Z26A 1YDLA 3O1LA 2IY5B 3VR1A 1J54A 1ZM2A 2W2OP 4LF8K 1TL3A 1QD1A 3CCJN 3SNNA 1IWAA 5H9FK 2FSJA 4W5QA 4WTOB 2HQFA 3EDQB 1TL5A 4RW8A 4R0EA 3O5BA 3NH0A 3O8WA 1WI6A 2HAFA 1HQUB 4ICLB 4A8XA 3MCSA 4H4MB 2O8EA 4ES1A 3NGYA 3VQ9A 2OGUA 5IV4A 3B6OA 2Q43A 5KFAA 3LF0A 2ZM6K 2HBMA 2QA1A 2GHVC 1X4DA 4QWAA 3O9UA 3VGUA 2XB2D 4KHSA 1FK9A 3RMAA 1U8SA 4UY8O 4DR7K 3AOBA 4NO7A 3WC0A 6FDRA 1CZBA 4C8YA 4GC6A 4JI0K 3IWNC 3I5BA 3E3XA 4EO6A 2VQFJ 2L3MA 3V9SA 4AM7A 4IEIA 1Q82O 1R3NA 3ULEB 1RHJB 1M5KC 1WSIA 1DKGD 1I39A 2OPPB 1SPBP 2ZNYA 4LF2A 3PSIA 3LM9A 4C3MA 2V51B 4CO1A 4DFPA 5KQDA 1GQEA 2PT0A 3EZWA 4NX9A 3NG8A 3G25A 3CC7N 1F3VA 1CJVA 2N7YA 3DYAA 1GH8A 4IRKA 4RTFD 5B0AA 1O13A 3R6LB 1ZM3A 5JMNA 4RCHA 1HWLA 1QAXA 4LMZA 1SS6A 3QIPA 1RAIB 3ZSVA 4DV7J 1Y9OA 4OGCA 3AY0A 5U47A 5LL6d 5A2QY 4ZPAA 2GGPA 3E9LA 4AHRA 3BGFA 1N0VC 4FWRA 1B7FA 3AO3A 3UE5A 3EY1A 3RVCA 4XK8C 5HO4A 3QBCA 1GLLO 1U1RA 3UD5A 2UUCJ 4JI6J 4IQMA 4CZKA 2XYPB 3A3NB 4P10A 3LZJA 1QTNB 4E89A 3B6PA 2P9IA 3GCXP 5DLFA 3MR6A 2WVCA 3OL7A 3M30A 4FWSA 4CJUA 2E8AA 8ATCB 3CM5A 1SV5A 2RMLA 1W2BM 2ATCB 3MR5A 2F5GA 2CFXA 5C2FA 4Z4CA 4L75A 3RWUA 1NJXA 4YOTA 2LSNA 3KG1A 4OHZA 1NAQA 3VF2A 2MLYA 3SQOP 2QZ8A 1UOCA 3ZCMA 2UUWA 1A0OB 5HROA 3MECA 1J6ZA 5M1OA 3N01A 3MEDA 1HNIB 1CZAN 5KGXA 3QGPA 2QK9A 5J1EB 1EKRA 2DJWA 4JOUA 3FR0A 4A61A 4K4UA 2DCLA 3DWLA 1T0TV 1RAHB 2Z56B 1GLBG 2OPRB 3LDNA 4DV1K 1AA1B 3CXCM 2XHBA 1DTTA 2CJBA 1FI4A 1LFWA 4TY8B 2O8DA 3TNVA 1WSRA 2VQEK 4JI5K 1WC5A 2C22A 5I3PA 3M9NB 2F40A 3BYPA 2AP6A 2W6KA 4F04B 3QETA 2RKIA 3MTJA 3TA0A 2E2QA 4UOFA 2MLZA 1BWEA 2BKNA 1H3DA 4HDGA 2VICA 3UVJB 3ET6B 4YFUA 1HNWK 4HUEA 2HHSA 1N36K 3D6MB 2QYGA 4XDCA 5KT3A 3X1LB 2BE7D 2BE2B 3CMES 1HWUA 4KH0B 1RT3A 1RA7A 4N8NA 2FF6A 2RHSB 1S1XB 4OX9J 4FXDA 4B3MJ 5M1FA 1S1VA 3CGIA 1YVUA 2UUBJ 2VCPA 4DV3J 1AYEA 1S79A 1BIZA 2MKYA 2QLFB 2LQ8A 5C2DA 2FYXA 4ZJQA 3M1FA 4R5PB 2HRUA 1TMJA 2E2NA 4J37A 1C1BB 1SC4B 2GELA 2HBKA 3H90A 3HJFA 4A2AA 6FD1A 4KHPJ 1KWMA 1T6DA 1X7VA 4FJGA 4DTNA 3VZIA 1TL3B 2A1SA 2DNNA 3GG1A 4Y0FA 1HBMA 2DGQA 4P71A 3GE1A 3HL8A 4FBTA 4RW8B 3NRBA 3O9TA 1U0HA 1NPPA 2XC9A 3AGKA 1HYVA 5KG6A 1B3TA 1XNQK 4BR4A 5ETTA 1S1UA 4U96A 2O8EB 3DCAA 2WFBA 1ATRA 2H48B 1VQPS 3FZHA 1NG9A 3DHWC 3PRVA 3AA2A 3TARA 5HRRA 1HNXJ 3D4JA 1FK9B 2HWTA 4JRPA 1U6ZA 2BM1A 4Y2IA 1NGCA 2X78A 1DFDA 2ZUAA 4KRFA 4LT6A 4DV0F 3JSYA 2KI2A 2GQ2A 2L41A 1L5UA 2YPZA 4DTRA 2I2YA 2BKPA 3MM7B 4ECYA 4N56A 1Q82T 2OH2A 2P6TA 3IAYA 2RRBA 2JWLA 5IV3A 3SMZA 2XGPA 5IM0A 3G6ES 1TK5A 1CJVB 4H5WA 3BZCA 3DYAB 4GVBA 2OTJS 1U2RA 3QNWB 3RMDA 5L1KA 1N4LA 2M3DA 2XY6A 4IJAA 4Z7YA 1HR0K 4HWIA 2KTQA 4CYUA 3QIPB 1URRA 3CJAA 3AO4A 2NZ4A 4DPXA 4X4VA 2B0GA 1CC7A 3FRZA 3MZIA 2GGPB 1LWEA 3THWA 4YDXA 1J2VA 1EP4B 1CXQA 1ZBSA 2D9PA 5GMEA 2E6MA 3R8YA 2HHUA 3NMUA 2P9IB 2HBRB 2HHQA 4K59A 1J5EF 3VQBA 3MM5A 2E44A 4FDFA 4CO0A 1D9DA 3TAEA 3M30B 3KJNB 1OVQA 1SV5B 3TUJC 1GLDG 3MOJB 1G6BA 2NRXA 2N7CA 3PJXA 3BB5A 3OHBA 2RPIA 2IDEA 4DV5J 3FDSA 2RE1A 4ZIWA 4PAAA 3MR3A 4Y65A 3LW5C 1FEHA 2R7UA 3P39A 5HROB 3MECB 3EMTA 4RNOA 3CCUS 1FJ7A 2CQPA 1CLFA 3AVGA 4F3QA 3MEDB 3MWTA 3G8TA 4F50A 4LFCJ 1ATSA 2XTJP 1J5OA 3IR5B 1JMTA 1M5PC 2K3IA 1DTTB 4DN0A 1BXNA 2O8DB 2IVOA 1OPIA 2M0GB 4K2XA 1TKTA 4O3RA 2HLTA 4CHNA 2Y1LB 2DGSA 4A5AA 1WELA 3FC9A 1PJ6A 5EN1A 2RKIB 5AQQA 2YWFA 1NJIO 3M9OB 3RGIA 1S9GA 1YUWA 2CADA 2MHEA 3N4PA 1IBCB 3FBBA 4RU2A 1RA6A 2V4RA 2D9OA 1XNRK 2VBYA 3KIOA 4H4KC 4P9SA 3CIPA 3R5CA 4AQYK 5D0EA 2B8QA 1LV5A 2O8BA 2ZEJA 1Z4UA 1RT3B 3NH1A 1S4FA 4M42A 4DTSA 3LP0A 4YORA 4LF8J 5H9FJ 5F3TA 2PEHA 1NSAA 2K7JA 1UWBA 1L3KA 1S1VB 3KXDA 2QL7B 1IR0A 2OIHA 3C46A 2WVBA 1RAFB 3CULA 1NGHA 4RZRA 2ZFHA 4LF5K 3ZFVA 4CEFA 2JZ5A 4JKFA 3KLVA 4CGJA 3I0SA 2JEGA 1D9FA 3MK6A 1HLUA 3PSFA 1VS3A 3HX9A 3OYBA 3B4MA 4OI2A 3WHIA 1MWQA 4OYWA 3W64A 2M8DB 3NWGA 2LMIA 2NPFA 5FPDA 2ZM6J 2A6AA 2BYCA 3W5ZA 4DX6A 3IWXA 1HBMB 4DR7J 4DPOA 2DVIA 5EWFA 2XLJA 1IBMK 4FK0A 3H4BA 2VWJA 1U0HB 4RBUA 1S7HA 3U02A 4JI0J 4O5BA 3DHXA 3SBMA 2EVZA 4F4KA 3N6NA 3KUEA 1LNQA 1NPKA 4B3TF 1IM6A 3IBWA 1S1UB 5DLGA 2E20A 3BP8A 2CA9A 3L3VA 2BA9A 1R31A 3Q8PB 1ASWA 3KHLA 1KLNA 4M3UA 5F8NA 4CT9A 3HK2A 4G9ZA 1UFWA 3P45B 2ZVIA 3HT0A 4FP9A 5J2PA 2RAQA 1NLVA 2RDIA 1F2HA 1H6KX 2AJ2A 4QOZB 3EVWA 5C25A 4KR0B 8RUCA 1N33K 2M70A 4DU8A 1JB0C 3H4DA 2HFSA 2M7SA 1L3VA 3H5XA 2G1HA 4L74A 5EHHA 4CNYA 2XMKA 3DI6A 1L3SA 3MCAB 3QGHA 1U25A 3QJLA 2WVFA 4F2SA 1R6VA 5IM0B 3AO2A 4CEZA 2BV3A 4GVBB 2V8VA 5EX3A 5C0YA 3CJQA 3EZ5A 2G2OA 2AX1A 3W1YC 2V50A 4B3SF 5M2RA 4EFHA 3BKFA 4CYUB 2HNDA 1C4CA 2VG7A 1KOOA 2FVRA 4OZ1A 5L9NA 5KTQA 2OMLA 3H45C 3KG4A 3KHRA 2LA4A 1LWEB 3THWB 2V67A 4IO1A 4OX7A 2VASA 1FDBA 3QAEA 1WC3A 1N6QA 5BYRA 4DTMA 4MIWA 2E2OA 5KGWA 3R1HA 1VRQC 2P8IA 4PXDA 1E6YA 2VB6A 1XTZA 3WXKA 1SKWA 2XSFA 1WOQA 2DNPA 3MM5B 3VQ4A 3I87A 1Q7YT 3FVYA 3OPKA 2ZOGA 1MSWD 4DV1J 3CPEA 1Z2ZA 2P9GA 4ECSA 1NGEA 1KVAA 5F1XA 5CHIA 2H5IB 4F3TA 1WOSA 2KB2A 3CD7A 2YHXA 1U2VA 2VQEJ 4JI5J 3S41A 3T9NA 1LK5A 4BS2A 2M9KA 3CJCA 1WAFA 5HANA 2RDDA 2C28A 2CXEA 4HEA9 3S01A 2DH8A 3NAHA 1SZ2A 3H46O 3HHEA 4J2EA 3M2VA 1J5OB 4CHPA 4EBDA 3U1NA 4HKQA 4QQBA 5HRNA 1F9HA 2MLXA 4FVCA 1X9MA 1O6XA 1HNWJ 2XS5A 2B9YA 3LAMA 2LFVA 1L3UA 3T7ZA 1NH7A 3AXMA 1IR1A 1TKTB 2P9SA 2DKOB 3ZZPA 1XQSC 2DIVA 3GYNA 1VQ6S 4H4OA 2JEFA 4ILHA 2CWKA 3KLEA 2DGXA 4PUOA 3SQGA 3W5XA 3TTCA 5KFEA 2XRIA 4NEYA 3SMSA 3CSKA 1RZMA 3IMXA 1T9YA 3N79A 2BZ2A 5T14A 1ZBHA 5AQTA 1PAUB 4P74A 2V34A 3L3UA 4ZLPA 1KQKA 1U1OA 1S6QB 3VAHA 2ASMA 4Q2MA 3GIJA 2E1YA 3SQ1A 3MXHP 1PJ5A 2N82B 3NFAA 2O8BB 3M7VA 4ECTA 4JI3F 3LP0B 5IOLA 1VSEA 3BY5A 4QS8A 3OFEA 1T95A 4OI6A 2CWXA 3IG1A 2RD5C 1D9AA 3MCOA 1UWBB 4FZYA 2R2UA 2JFDA 4YHHF 1CC8A 1VSJA 3P49B 4X64K 1WLJA 3L7UA 2FBTA 3RR7A 4C8MA 2ITGA 1YJUA 1YJWS 4F4YA 4WKRA 4MYUA 1RACB 4FJJA 1Q81O 3C7NA 1XNQJ 3NCQA 2R7TA 1HA1A 3I0SB 1K1QA 3NAEA 1K9MO 1U48A 1GT8A 2V7ZA 1SB6A 1XMQF 4GO5X 2BJ7A 4DSKA 4NMLA 1I51B 2CPFA 1H98A 2FVSA 5F8IA 2ZITA 2LDIA 4FCYA 4M5GA 1NOYA 1VQ9N 4FNHA 1NSQA 2E5IA 4NRUA 2ABYA 4ZVGA 5KFXA 1VQOS 3TAMA 3FEYB 4J9VA 3D0PA 3QIOA 5T7LA 2WC9A 4DV6K 3M8YA 2J8SA 2IHR1 4DQRA 3P5BP 5LSLA 3J7YU 5DM7L 4I6MA 1B0VA 4L8RB 2K7KA 2HBLA 3GYGA 2LKZA 3GP9A 2EI5A 3SSRA 3ILLA 4JBCA 4CZHA 4DCPB 4DUYF 1SJ4P 2CPZA 5KFKA 2HWHA 4QR0A 3N5FA 2BACA 2ZC3A 3DXSX 5J2PB 3T41A 1JLEA 3MFHA 4ILRA 3GL1A 5C25B 2RF2A 4K8XA 2OUGA 1HR0J 2IVFB 4LF9K 4CJRA 1K44A 2MQMA 3LUYA 2DXFA 4W4MA 4FNIA 3BO4A 4M1KA 2XMWA 5MLCQ 4OHVA 3DI6B 1N32K 1T11A 5CR4A 2AJFE 5CZ1A 2W7OA 2QXFA 2I5JA 1T9TA 4CH7A 3PV8A 5E3PA 3BQ0A 3LPUA 1LQ9A 2CQHA 4NEZA 2JC1A 4MIAA 2HQDA 4ZJOA 4ILLA 4J9QA 1GLCG 3OVNA 4QR2A 4XPEA 5JLHA 3NGKA 3ID8A 5HJYA 2QW9A 2FVCA 3BR9A 4FPRA 4CO5A 4KI6A 2HNDB 5CZVA 1UVMA 3CFOA 1HRHA 2VG7B 4HT5A 4H5NA 3CCRN 3HDSA 4URQU 4OI1A 4WYBA 1VQ5N 2P9KB 3PG9A 2DNQA 3MF5A 4JI1K 2D74B 1RTDA 1N0UA 4MK9A 4KPYA 1NDPA 2ZE2A 1K73O 4BDZA 3OL9A 1N6QB 4DTJA 3ZX2A 5CYMA 5CXTA 1S6OA 2AQ4A 4FS1A 1NK6A 4M5JA 1E6YB