5J2MA

Hiv-1 reverse transcriptase in complex with dna and efda-triphosphate, a translocation-defective rt inhibitor
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/dna
molecule keywords HIV-1 reverse transcriptase p51 subunit
total genus 166
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2mA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2mA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2mA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2mA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2mA05
4EZ9A 3QESA 4Y1DA 4AHVA 4E7IA 3KKSA 1HYSA 3JSMB 3D28A 4ED0A 2BRLA 1XC9A 2PYLA 3SUQA 4CJFA 4RW8A 3KK1A 5J2NA 3CQ8A 4FLYA 1JLGA 1EP4B 2ZQBA 1VSIA 4KTWA 2W9CB 2ALZA 3CFRA 4J2DA 3RMBA 4Q0BB 4HUGA 1QSSA 4B08A 3QLHB 4FW1A 4C8OA 2W8KA 4WYWA 1TKXB 1W0HA 1YTUA 4CFDA 3KLHA 3TAGA 1RT2B 1RDAA 4E7JA 3FRZA 4J9SA 1NK4A 4ZVFA 2D7SA 1WSGA 3CG7A 3CFOA 4FZZA 4KV8B 3FQLA 1KVAA 4FZXC 2B6AB 3MEGA 3OJUA 4OPJA 3KHHA 4DQSA 3HVTB 1RT4A 1XR5A 1BIZA 2Z1JA 1S5JA 4CK2A 1SL1A 4LQ9A 2XY6A 4LD0A 5KRSA 3KIOA 3LAMA 1NOYA 3I8DA 3QYYA 3ZSXA 4FM1A 2XO7A 1U48A 4CEOA 5KFEA 4ZP7A 3L3UA 4DL7A 3ICLA 1MMLA 4R5PB 3AA5X 4TSXA 1KVCA 4BACA 1HNIA 1RTIB 4WE1B 3M8PA 2IJFA 4Y3CA 4CGIA 5CYQB 4JLHA 4CHYA 5C42A 2OPRA 4UQGA 5F8LA 1YVFA 4WZQA 3SCXA 5KG3A 3GYNA 3KK2A 1DTQB 3HVWA 3VA3A 2HNYA 1D9DA 3GQCA 4Q8FA 1KFSA 4CK1A 5I42A 2J6UA 4ZPCA 1HJRA 4CJPA 2BQRA 5KFAA 2ZD1B 3AVKA 4FJKA 4B8CA 3EPGA 3DLEA 2V0NA 3AVBA 2WOMB 4O44B 2YNHB 2BR0A 4DLEA 3AVNA 2JEIA 3Q8RB 1TK5A 1JLEA 1S48A 2RPIA 1RT6A 2VG6A 4ZHRB 3OYJA 3AVMA 1NJXA 2ZD1A 1TAQA 1LV5A 1S1VA 4J9NA 5KFOA 3EZ5A 4B9TA 2XHBA 1KSPA 1D0EA 2HMIA 1RT7B 2VG7A 3SQ4A 4BWJA 4N76A 1JLCA 1JLQB 3QNNA 1ZTWA 1JKHA 4IFVA 4CIGA 4AH9A 4QAGA 3CM6A 1IKWB 4DG1B 2V9WA 1EKEA 1W25A 1UA1A 1WN7A 4M3TA 4ECYA 2JC1A 4NLVA 1VSHA 1QQCA 2AJQA 4RNHA 2W7PA 3QEVA 3MECB 4K4TA 4CFCA 1Y97A 1FXXA 4B9LA 4IH5A 4H4OB 1HYSB 4B9VA 3RB3A 3H59A 3KLVA 4CGDA 1D8YA 4MKBA 2OPPB 2YKMB 1A5XA 3SZ2A 3HVRA 4F4KA 4M42A 3DOLB 1RT3A 4DL3A 5T7BA 2XY8A 3KLIA 2RN2A 4EBEA 3VQPA 3DLKB 3HL8A 1KVBA 1NK6A 4TLRA 1TAUA 4MK8A 2YNGA 4DTUA 4PUOA 1VSEA 2I5JA 4IG0B 3JYTA 4RW4A 3HVTA 2J6TA 4F3OA 4CF9A 2UUWA 2Q3SA 1RDCA 3AVHA 3MR2A 5KFRA 1C1BA 1T94A 5CYQA 1F21A 3PW7A 2YNIA 5DQGA 3KHRA 3TWHA 2UVRA 1TKZB 3K5MA 3NMAA 4FJJA 4MIBA 1XI1A 1S1VB 1DTTA 4B9SA 1MU2A 4HYKA 1SKRA 4IFYA 1QAJA 3C6TA 1XR7A 4PQUA 2A1SA 3CJ0A 4F4WA 2DFEA 4TN2A 2IM2A 4R5PA 2IS3A 1JX4A 4CHZA 2XC9A 4RUCA 3HPOA 4DWIA 4K4UA 3OYCA 4OGEA 2RKIB 2F8SA 3ITHB 4NLRA 3M8SA 1QHTA 4QOZB 4FJMA 4HTUA 4O4GA 5KFMA 3TAFA 4ECZA 4MK9A 4LSLA 1HMVA 2Z1HA 3VQ7A 3AVCA 2XI2A 1CXQA 3PW0A 1S0NA 4K4VA 5HRNA 3K2PA 2WCXA 4DL4A 3V9WA 5HLFB 2ASLA 4N47A 4NYFA 2ILYA 1IH7A 2G8IA 4KREA 4JS4A 3N6MA 3GILA 3JSMA 1LWEA 4ZHRA 1QS4A 1HYZA 4R8UB 2YNFA 2AQ4A 3IRXA 4FLZA 5KG7A 4I2QB 3QERA 1JLAB 4QCLA 1JLCB 3L2WA 3OYKA 3UQSA 5JUMA 3G6YA 2I1RA 3ZSWA 3HO1A 3BQ1A 4O4GB 4FLUA 1U45A 3NH0A 4CF2A 4IBNA 3KLFA 1Q8IA 5DG8A 4CFAA 2NUBA 3H5SA 4RW8B 1S1UA 4CJ3A 3EPIA 3U3GA 1S10A 3VQBA 4EO6A 2FBVA 4WE1A 2E9RX 1UA0A 1ZBLA 1NJZA 3RB6A 2OZSA 4KTQA 3HHKA 3THVA 1B92A 2GV9A 3MEGB 3PX6A 2AU0A 4EYIB 4FBUA 4IG0A 3JYTB 3NAIA 4J9LA 3PZPA 5CZ1A 4EP4A 4QWCA 3L2RA 5I42B 3PR4A 1BHLA 3KKRA 3N6LA 4DSEA 1S0OA 4ZP8A 1NJWA 1IKYA 2WK4A 1RDBA 1NKCA 3KLIB 3E51A 1X1PA 1LWCA 1JLAA 3TAPA 4NLWA 5J2MA 4IDKB 4GW6A 4ICLA 2O4IA 4E1NA 3U3YA 2X74A 4OVLA 3HP9A 2OPSA 4WFYA 2KZMA 3E01A 2KQ2A 2IOCA 5DGBA 1IM4A 4DLGA 1S6PB 2JC0A 5KFYA 3KMQA 2D0CA 3AVJA 4J9RA 4ELTA 3FFIA 3NBPB 5KFGA 1ZETA 4KRFA 1S0MA 4W5OA 2X6SA 4Q44A 3I5AA 3LZJA 2HNDA 1J5OA 1EP4A 2E9ZA 1T05B 1FK9A 4O0JA 3AO1A 3RBEA 1Q9YA 4Z4IA 4ZPDA 4E3SA 5F8NA 2B43A 4DF4A 4DTRA 4Y2AA 3KJVA 4ELUA 4DG1A 4H8KA 5KFPA 3OLAA 4KKOB 3FSIA 3NHGA 2IJNA 4FJGA 1HARA 3M8RA 4CJEA 2EHGA 4ECTA 4FBTA 3OYAA 4O5BA 3DLEB 2VG5B 5JS2A 4KSEB 2KZZA 5KFQA 1QTMA 1S1XB 3NAHA 2AGOA 4FCYA 3GV5B 3AO4A 2QV6A 4ZP9A 1IKVA 3NGYA 3LAKA 3RBDA 4URGA 3QNOA 1OS5A 2DPJA 4X2BA 1T8EA 3MTKA 4FLXA 1WAJA 2HB5A 4FJHA 1VRUA 4RZRA 2C2RA 4CEZA 2X6NA 3SNNA 2GIQA 3OHAA 3GV8B 2GUIA 1VSDA 2IAJB 3SPYA 3T5KA 1JLBB 4E89A 3RB0A 4DTSA 1WSIA 1WNEA 1UOCA 2WONA 4CEDA 3AA4A 3HJFA 5KFBA 4HUEA 5HBMA 3ISND 4TYAA 2D3ZA 2VWJA 1IKVB 5KFDA 4NLOA 4YR3A 1RTHB 3MF5A 2DTUA 1NK7A 4QW8A 2LSNA 1BL3A 4GMJB 3CWJA 4FJXA 4FYDA 1BGXT 3H08A 4PWDB 5KFWA 4AILC 5F8IA 3CJ4A 5F8MA 1HQUA 4KPYA 1C1BB 4PY5A 1S1UB 1B9DA 4H54A 4K4SA 1S1TA 1VSLA 1IKYB 4I7FA 4DSLA 4DU4A 3QGGA 5F8HA 2G8VA 5DLGA 3OLBA 4J9QA 5KFNA 4CK3A 5CYMB 3IG1B 1S1TB 4Z0UA 1RT3B 5FROA 3O3FA 3HPHA 3VQ6A 1RBVA 5KFIA 1RBTA 4CHQA 5J2PB 3MXIA 1RILA 1BCOA 1HPZA 2EC0A 1L3SA 5KGXA 3TAQA 2D41A 4LSNB 4RW7A 4TY8B 1RDDA 4GVMA 4H4MB 3AO2A 4WFXA 5I3UA 5J2PA 2XI3A 4JV1A 2R8GA 4IOBA 5SWMA 4QWEA 1Z4UA 2R8KA 2G8FA 4CHNA 1J54A 3SJJA 1EXQA 4C8NA 5FDLA 1RTDA 1L5UA 4FS1A 1LWEB 3KK1B 4RNMA 2AWZA 1RT7A 1VRTA 1FKPB 2BQUA 4N41A 3ZT1A 3FDSA 5C25B 2QKBA 3TVKA 4FJ9A 3FQKA 3V6KA 2OPQB 4G3IA 2O5DA 4AHUA 1NK8A 3CM5A 3BQ0A 1WSJA 3OYGA 4M3UA 1WSHA 2VA3A 3OL7A 4NCGA 3RR7A 1N5YA 1KCFA 1FK9B 4PA1A 3B6PA 3I0SB 5J2NB 4CJSA 4KV8A 1CSJA 2E9TA 4KB1A 1Z25A 4CFBA 4HUFA 2AGQA 4HKQA 1SUQA 3IGNA 1JXLA 2ETJA 3V6DB 4FLWA 5CZ2A 5EDWA 1D9FA 4KAIA 4RU9A 4DMNA 4J9PA 3TQ1A 2HVIA 5KT7A 2JEGA 3NF7A 1SV5A 1KTQA 1S9EA 3S3OA 4Y2CA 4ED7A 4ELVA 2OZMA 4KHRA 3V81B 4M95A 1SL0A 3B6OA 4MK7A 4IH7A 1QUVA 3KHLA 1VRTB 1L3VA 1MU2B 4KHUA 1J53A 3E01B 5DGAA 1X9MA 4ZTJA 5SZTA 2ATQA 3RR8A 3M8QB 2YKNA 3I5CA 1BQNB 3BREA 3OYLA 2ATLA 3MEEB 3AVLA 3MFHA 1I3AA 4CF1A 3BSCA 1BCMA 4FK0A 4E0DA 2W9BA 3WNFA 3DI6B 1LWCB 5K14B 1REVA 1T05A 1N6QB 3V6DA 4CF8A 1RT5A 3V9ZA 3MEDB 4ZPBA 5KFKA 4G1QA 2D0AA 1RT4B 4ECQA 3GIMA 4WYLA 1X9WA 1TKDA 4BDYA 2WTFA 3DM2A 2XGQA 2IBKA 3IS9A 3MXMA 3H4BA 1VK0A 2B6AA 3BSAA 4ECXA 2I5JB 3ULDA 1C0UB 4O3PA 4FW2A 3D45A 2R8HA 4IR1A 2P5GA 4O3SA 4DU1A 3V6JA 2OH2A 3L2VA 5FRNA 4JV2A 3WNHA 5L9XA 3PW2A 3MXJA 3LANA 3OYNA 1NHVA 4YFUA 4FJIA 4ID5B 4RW6A 5HRRA 1NOZA 1SH2A 4RW9A 4NLPA 4OGCA 3UPFA 1LWFB 3KLGA 2W9CA 1G15A 2XGPA 1JLGB 1TQLA 1FKOA 3RRGA 1K1SA 2FJVA 1NK0A 2FBXA 3ZT4A 5KFSA 3SQ1A 2O4GA 2D0BA 2KTQA 4MQ3A 1K6YA 1BI4B 1RBUA 3V4IB 2C22A 3LP0A 3ZSQA 1SL2A 3SFGA 3VQ8A 5L1KA 2GIRA 3OYBA 2XY7A 4MFBA 4DFMA 2IAJA 5KFHA 4BE0A 1RYRA 3DLGB 2YNFB 4CEAA 4CJQA 1HRHA 2FVCA 1L3TA 2BRKA 4DQPA 4LH5A 4CGHA 5KTQA 2YV0X 3K5OA 1VSFA 3L8BA 4F4YA 4CCHA 4B9MA 4MFBB 2XCPA 1CZ9A 2WONB 4CEFA 3M9OB 3LP0B 1GOAA 2OPPA 2YKMA 1RAJA 3SV3A 4DFJA 4ECWA 1JLQA 3T5HA 2Y1IA 3T5LA 3AV9A 2FVPA 1C1AA 3PV8A 3ZSRA 4J2AA 3T1AA 3VQSA 3OYMA 4CJ4A 4ED8A 4J9KA 2ITGA 3HP6A 2RF2B 3TAEA 3OHBA 3LP2A 3SQ0A 3OS2A 4CJRA 4KO0A 4C8MA 3ASMA 3CIZA 3V81A 1UAXA 5EU7A 3CYMA 4RW4B 4QW9A 3AVGA 5F8GA 3NKYA 4O3QA 4RNOA 3NGDA 3H5XA 1YTAA 3IGVA 4FLVA 1TL3B 1D5AA 3KK3B 1BISA 5D3GA 4KHQA 4F2RA 3P83D 2VWKA 5C24A 1N4LA 5JS1A 1KHWA 1TGOA 3C95A 2BANB 2E4LA 4M3RA 2IDOA 2HW3A 3DOLA 5CY4A 4FJ8A 2G8UA 3TAMB 3QZ7A 1HQUB 3M8PB 3PR5B 3MFIA 4O3NA 2JGUA 3V4IA 3VQ9A 5DMRA 5EWEA 5DG7A 4DTNA 1ZYQA 4KHYA 4KFBB 2UVUA 1RA7A 5I3UB 3Q8SB 3LP1A 4RNNA 3VQEA 3DOKA 2RKIA 1C0TB 3BSNA 3NAEA 2FC0A 1J5OB 2BANA 1CXUA 4ZVGA 1HNVA 2FBTA 2AX1A 3ZT2A 3DM2B 1ZTTA 3U6FA 3CDEA 1CZBA 2FLPA 1C6VA 1JL1A 3G10A 1HNIB 4JRPA 4CJKA 2JLEA 3LALA 4K50A 3K5LA 3G6VA 2HHUA 1RTHA 4B8AB 1XWLA 3LPUA 2VG5A 3NF8A 1VSMA 4MH8A 3TI0A 4M3XA 1C1CA 3I0RA 1SV5B 4DTJA 1WSFA 4K8XA 4LY7A 4B9NA 1ASVA 1T03B 1R0AA 2FVQA 4Z4FA 3K5NA 4GC7A 2W7OA 2C2EA 4M94A 3L2QA 4MKAA 2ILZA 3DLKA 4DQRA 3VQ4A 4Q45A 1REVB 1N6QA 2YHAA 1HQEA 2HHWA 2IC3A 3DDKA 4I2PA 1KHVA 4TQRA 3DLGA 1RYSA 3LPTA 3SI8A 2B4JA 3AVAA 2P51A 2D5RA 3P1GA 5KFLA 3RMAA 2HWIA 4NCGB 3PUFA 4QWAA 1ASWA 4H4OA 1TK8A 3EZUA 3MAQA 1KFDA 2RF2A 4M3WA 4NYNA 3UR0A 1XHZA 3SI6A 4Q0BA 3DYAB 3KOAA 4FJ5A 1WSEA 5KG4A 1QE1B 3BGRB 3T5JA 4IRDA 1C1CB 3M9MB 1O1WA 5L1LA 1A5VA 1NKEA 1BIUA 3NF9A 5D3GB 5KT3A 4Q5VA 3DMJA 4CJTA 3DI6A 3H5UA 3NFAA 3NCIA 4DQQA 3QEXA 1ZBFA 4FJLA 3C6UB 4NLXA 5HROA 4FZYA 4O0IA 3IAYA 2JEFA 4EBDA 2XRIA 3QINA 4E7LA 1NNDA 4F2SA 2IC3B 4KHMA 3T19A 2HNZA 3A2FA 4ID1A 3SYZA 1FKOB 3PX4A 2A1RA 2Y1JA 4OPKA 3GIKA 1C0UA 5F9LA 4RW6B 3FFIB 1RTIA 4ZVHA 4EYHB 2KFNA 4DL5A 3ZT3A 1S6PA 4O44A 2FVSA 5KFXA 3HT3A 4JUZA 3ITHA 1C0MA 2PZSA 4FJ7A 4B9UA 3BSOA 1S9FA 2OYQA 4CJWA 1RTDB 2G8KA 2G8HA 1LW0A 4ZPAA 3VQ5A 1XR6A 1SKWA 2OPRB 1TKZA 3AA2A 3MR3A 1WLJA 2BQ3A 1U47A 2QK9A 3CO9A 3SFUA 4Z4GA 1S49A 4BWMA 2YNHA 3HM9A 1JIHA 1S1WB 4YNQA 5KI6A 3O3HA 3NGIA 2YNGB 3LZIA 4I9QA 2R2SA 5HBMB 1HQEB 5KG2A 1J9AA 2IGIA 2FLLA 5EWFA 4DSIA 4IG3A 1RT2A 2B5JB 4CJUA 1TL1B 2C28A 4DSJA 2YHBA 5L1IA 2V4RA 3V9XA 1ZBHA 4WXWA 4B3OA 3AVFA 4RW9B 3QO9A 3UIQA 2UUTA 3QGHA 1N48A 4IH6A 1WNSA 3C6UA 1S9EB 2F8EX 1BQNA 3QIPB 1U4BA 4IFVB 4I2PB 1FKPA 1LW0B 1ASUA 2WHOA 1JXBA 4IFYB 2R2UA 4Y34A 5KRTA 4OJRA 1TV6A 4CJLA 1VSJA 4NCBA 2HHQA 4EEYA 4W5QA 4TY9A 1JL2A 4NLDA 4HCCA 4W5RA 3G0ZA 3L3VA 5EUHA 3QIPA 4RUAA 4IDKA 4NLQA 3H5YA 2DFFA 2ZKUA 3KHGA 2R2RA 4CE9A 3ZCMA 3LP2B 5J2QA 4KB7A 5T14A 3H40A 4CECA 3AA3A 3HVAA 4XO0A 4CEQA 1ZBIA 2KW4A 5KGWA 2OA8A 2R8JA 3RRHA 4XPEA 3OY9A 2E6MA 3HXMA 1TKTA 3PW5A 1RT5B 4FK4A 4AHRA 3S9HA 4E19A 1IO2A 1RT6B 3MR5A 4U6PA 3V1QA 4DEZA 3O3GA 1TL3A 1X9SA 3M9NB 3SQ2A 4EZ6A 5C42B 3V9SA 3RB4A 3OS1A 3DLRA 2Z1GA 3F73A 4F8RA 2W42A 1KLMA 1W9HA 2R8IA 1IKXB 2ZE2A 3KTQA 3MEDA 3O4NA 4CGJA 4NLTA 5F8JA 4QWDA 4XPCA 5KT5A 4DU3A 4R8UA 3GV7B 3CJ5A 1A5WA 1C0TA 4KHWA 3QGIA 4ED1A 5KG1A 4KHNA 2VG6B 3SUOA 4TXSA 1WAFA 4FLTA 3K57A 4WFZA 5HP1B 1LAVA 4FVMA 3DRSB 4KKOA 2Z1IA 4DS4A 3T3FA 3OYIA 3Q8PB 3QO9B 4AHCA 3SV4A 3KLEA 3NDKA 3UDLA 1JKHB 3MECA 4FK2A 4LQ3A 1EETA 1HNVB 1TK0A 4OLAA 1VRUB 4G1QB 2XWYA 3HKWA 4IKAA 3Q8QB 3BQ2A 2HNDB 4YR0A 5JXSA 3IN5A 4K4WA 4EO8A 3KLGB 1RNHA 2IM0A 3OSNA 1LW2B 4BE1A 4J2EA 4Z4EA 3DRSA 2QXFA 4I2QA 4ECSA 4ED2A 2XCAA 3H2LA 4NRTA 5C5JA 5KFZA 3AO5A 4YMEA 3ZSZA 4R0EA 1SH3A 3PVXA 1U09A 4C8LA 1Z26A 2JEJA 4YP3A 2FBYA 3DLHA 2IA6A 2HVHA 3LDSA 4EBCA 3KD5E 4F4ZA 4OKKA 4DSKA 1JLBA 5HRPA 3OSPA 1SUQB 3CJ3A 2RDIA 1RDRA 2HHTA 3NH2A 3CJ2A 4IG3B 4CJ5A 4U7CA 1GOBA 4DTPA 4QWBA 3LWLA 4KI6A 1S9GA 1UWBB 3TR8A 3KD1E 3QLHA 3I0SA 1SH0A 2YNIB 2QE5A 4KFBA 3PHEA 3KMSA 2DFHA 2YKNB 3KNAA 1IG9A 4OLBA 3PJXA 3HSTB 4NLUA 1VSKA 3ZSVA 3OL8A 1HMVB 2OPSB 1I39A 2AX0A 4KI4A 2FVRA 2R2TA 4FXDA 2BGGA 1JLFB 4CJVA 1S6QB 1YVUA 2XY5A 3KK3A 2P1JA 4ID5A 3HPGA 4QPXA 3DLBA 5J2QB 3RMCA 4DQIA 1K1QA 3EYZA 1KRPA 3KLEB 1DLOA 3OYHA 5J1EB 3SUPA 4CHPA 3NE6A 5E41A 5KG6A 3HYFA 3PY8A 4HCBA 2PY5A 1RA6A 4NCAA 3P5JA 3RTVA 1DTTB 5J2MB 5KFVA 3QZ8A 3VQQA 3AO3A 4Z4CA 4H4MA 4NLGA 4CESA 4ICLB 3TANA 2KFZA 5KT6A 4JRQA 4DTOA 3CDWA 4XIUA 3V9UA 3VN5A 3S3MA 3BDPA 3L2UA 3D0PA 4I9LA 1NK9A 4M3ZA 3G6XA 1LW2A 1TV6B 1N56A 1L3UA 1DTQA 3RMDA 2HMIB 2UVVA 2GBZA 1TVRA 3QEWA 4LSNA 4DSFA 1LAWA 2J6SA 4AHTA 2WB4A 3LP1B 4OKJA 1JLEB 1GX6A 4JV0A 2G8WA 4B3OB 3RAXA 1C2PA 2CJQA 2GC8A 3PX0A 3I0RB 4F4XA 2OPQA 4O3OA 1RT1B 5EWGA 3KJVB 3KLFB 4NYZA 4TYBA 2EX3A 3I5BA 4K4YA 5KG5A 3QIDA 1YT3A 4CIFA 2X78A 5HLFA 3GIIA 4RNFA 3OYDA 3KLHB 5FDLB 2FJWA 1S1WA 3BJYA 1QSYA 2HAIA 4F50A 2W9BB 4C8KA 4URSA 4E1MA 4DL2A 3OVNA 3RAQA 4PWDA 3IRXB 3C6TB 4M41A 1TKTB 5DK5A 4OKEA 4DS5A 3QEIA 1TL1A 3SUNA 4KAZA 3BR9A 2RDJA 4BDZA 4K8ZA 4M3YA 4ZP6A 3NH1A 3NL0A 4IQXA 1CLQA 4YQWA 4CIEA 2R7YA 2E6LA 4JS5A 1RT1A 5J1EA 4CEEA 5CYMA 4ZVEA 3ZSYA 4YR2A 1D1UA 3V6HA 4FM2A 2WOMA 4J2BA 3CDUA 4OL8A 2BDPA 3MR6A 4Q8EA 1JLFA 2F96A 4WXOA 2ASJA 4IR9A 2HNZB 4BE2A 4TQSA 3WNEA 4URQU 2DY4A 1RBSA 3CFPA 2W9AA 1SKSA 3PW4A 3KK2B 4NZ0A 1EX4A 4LH4A 3D5MA 3GIJA 1ITGA 3HK2A 3V1OA 1S97A 4W5TA 2V4QA 2FJXA 3C94A 3N6NA 4FM0A 4IKFA 1S6QA 1GOCA 3LWMA 2VG7B 3H4DA 4ED3A 5KFUA 4J9MA 3VQAA 3WNGA 2BE2A 2B5JA 4DL6A 3DOKB 1HPZB 5DQHA 1XHXA 1I6JA 3IS9B 5L1JA 2C2DA 3DRRA 4J9OA 1RBRA 5DG9A 4IRCA 4M45A 3NBPA 4KE5A 3TARA 1T03A 1HYVA 3VQDA 3OYFA 3TAMA 4ZMMA 2DPIA 3O4QA 1U49A 3DRPB 4FS2A 3VA0A 2HNYB 3H98A 5DQIA 4CEBA 1N5YB 1JXEA 4DTXA 3OYEA 3OS0A 4KB0A 1T7PA 3ALYA 2WRMA 4NLYA 3G86A 4ED6A 3PO4A 1R0AB 4W5NA 2HWHA 1TP7A 3ZSOA 3S3NA 3ISNC 1QSLA 2AGPA 5C25A 2PYJA 4PUOB 5DLFA 4AHSA 5F9NA 2HHSA 4DFKA 1TVRB 1S9GB 1UWBA 2ASDA 3QETA 4GC6A 1LWFA 1BQMB 4Q43A 1RCHA 3PO5A 2W8LA 5KFFA 4ECVA 1TKXA 1NKBA 1IKXA 2ZE2B 4ECRA 3NF6A 1Q9XA 1IKWA 5KFTA 4CF0A 4N5SA 1ZBUA 3IG1A 5KT4A 3K59A 1BI4A 1BQMA 1RTJA 2VA2A 4KTZA 3BGRA 2CKWA 4MIAA 1T3NA 4CHOA 5KG0A 3TABA 4RG8A 2HHXA 3DYAA 4FJNA 5KFJA 1U04A 4O4RA 2BE2B 1QE1A 3OL6A 2IM3A 5KFCA 4DFPA 1RTJB 4L8RB 4K4XA 3EY1A 5HRSA 5HROB 3OL9A 2P5OA 3MEEA 4LSLB 4KO0B 4E7HA 3OJSA 1NJYA 1KLNA 4KHSA 3M8QA 4K4ZA 1NHUA 5C24B 2IMWP 4O55A 3VQCA 2UVWA 2HHVA 1EETB 2F8TA 4N56A 4CGFA 4ZTFA 4F3TA 4KBIA 5KT2A 3AVIA 4HVJA 4I7FB 4E7KA 4DTMA 1S1XA 4Y1CA 2QKKA 5K14A 4EP5A 4DF8A 2D3UA 5HP1A 3ZT0A 3K58A 3SPZA 4ECUA 3QIOA 4BDPA 3V1RA 3DMJB 4PQUB 3CVKA 4NRUA 4IRKA 3RWUA 4O3RA 4RW7B 4TY8A 3LP3A 3DRRB 4HHTA 4NLSA 3QEPA 1QAIA 4WZMA 3F9KA 1S4FA 3NGZA 4CGGA 4Z4HA 5FRMA 3DRPA 1KLMB 2IM1A 1DLOB 1NK5A 4CERA 3PJWA 1GX5A 1B9FA 2FLNA
chains in the Genus database with same CATH superfamily
3QESA 4AHVA 5GAGP 4B1YB 3OV7A 1HPMA 4CNZA 5EGYA 4C7QA 1HHTP 3D28A 4DR6J 3FMBA 2MLZA 5RUBA 1XC9A 1C0GA 5L8RC 5J2NA 1UFWA 3CQ8A 4FLYA 1JLGA 3CETA 4U7UK 4GO7X 4J2DA 3CFRA 4TKTA 3AY0A 4Q0BB 1DHMA 2QA1A 3THXB 4PWUA 1QSSA 3SCJE 3AFGA 4NOHA 4B3MF 1XK8A 1G1XA 1W0HA 1YTUA 3TAGA 3L4BC 2MYFA 4QIEA 3PLAA 1F3VA 3THPA 1JJ2R 2V34A 3CC4S 2AJFE 3AAPA 3CG7A 1U1NA 3CFOA 1UAWA 4YDDB 3OJUA 4XH5A 2LVWA 2IMOA 3KHHA 3UB5A 1YI2S 1FD2A 4NI2A 4BLGA 1B0TA 3PRBA 1SC1B 4P73A 1SL1A 4QIWD 4KJIA 2XY6A 4H5RA 2ZHBA 4DV7K 4OHVA 3LGHA 4B1WB 2A6OA 4ZCMA 1MMLA 3VZHA 4TU7A 1KVCA 1PG5B 1HNIA 3Q7CA 3CGIA 2ROEA 4WE1B 2E1AA 4CGIA 3U1MA 5C42A 2W01A 2DRAA 3VTHA 3VTIA 3SCXA 3GYNA 3O44A 1DTQB 4X66K 2DGUA 2HNYA 4JI5F 1KFSA 3Q8YA 1P9QC 4CK1A 4HT5A 1HJRA 2BQRA 2VGMA 2ZD1B 3J81U 1HNZJ 2JFKA 2V0NA 2CNOB 3QSYB 2YNHB 1XUPO 3Q8RB 1TK5A 3BGFA 4B1XB 1U2CA 1NJXA 4V19X 3AVMA 2ZD1A 1TAQA 1LV5A 1IJJA 4OPAA 1S1VA 4J9NA 5AXMA 3GR1A 3EZ5A 2XHBA 3NMRA 2LLZA 1D0EA 1S5ZA 1RT7B 5EHHA 3SQ4A 4F67A 4N76A 2XEXA 4OFZA 2PFFB 2YQ0A 3UN3A 2ZH5A 3I9V9 4D3GA 4M1KA 1KTVA 3BH6B 4AH9A 1ZA1B 4ILLA 2AYMA 4KYZA 3AHPA 4QAGA 3CM6A 1NB2A 1UVLA 4EHUA 4NMXA 1EKEA 2BA9A 3M7VA 3IRWP 2O67A 2LU2A 3MM6A 4ECYA 3P6YC 2JC1A 1GMWD 4NLVA 1VSHA 3HOTA 2AJQA 5AQMA 3MECB 3FE1A 3J7YU 4CFCA 2MB0B 1UWAA 3FZ2A 4B9LA 1X5OA 4IH5A 4EHTA 1HYSB 4B9VA 3RB3A 5IT9Y 3IM8A 1UVMA 4U9RA 4DUTA 5TKWA 1RT3A 5A0YB 1YJNN 2G0JA 2XY8A 3DLKB 2C2ZB 2N82B 1KVBA 4MK8A 4PUOA 5IWAF 4NXNF 4BR9A 4F3OA 3HVTA 2J6TA 1FA0A 5B7WA 1VQYA 2NRWA 5KFRA 2Q43A 1C1BA 1RWVB 5E5NA 2OP5A 1I94F 4KR0B 2UVRA 4MIBA 4UY8O 5AQJA 1XI1A 3D54A 4YOWA 4DV2J 1MU2A 1SKRA 3C6TA 4USVA 4PQUA 2PSZA 1EKRA 4K4UA 1VQNN 4NXNJ 4C2MA 2F8SA 5KQ8A 3LW5C 4QOZB 2O8CA 3KFWX 3DWLA 1HMVA 4G1IA 4CO2A 2XI2A 5HI7A 1CXQA 4KQZA 3RRKA 5HRNA 4LF8J 5AQVA 3K2PA 4X4TA 4DL4A 3N5FA 1IH7A 4QQBA 1WG4A 3H7HB 1Q53A 3JSMA 3NWGA 1F1BB 3AARA 2FPHX 1NJIT 2JL9A 2HOEA 3H1VX 4BR0A 1X4BA 2KN4A 2C3UA 2DNKA 4FPRA 3EICA 1WC3A 3QERA 4QCLA 4KH0B 1NEEA 1JLCB 3UQSA 4ZOSA 1BWVA 3G6YA 2HBMA 4JI0F 2HLUA 5M2PA 3G8TA 2E5HA 3C14B 5DG8A 2CJAA 2NUBA 1U2RA 3J7AN 4RW8B 3KHYA 4F0HA 3C6HA 3VQBA 2FBVA 2E9RX 4CZJA 1C0FA 3RB6A 2AP6A 1S7IA 5M2RA 4IEIA 3UVJA 2VICA 5D77A 1UZDA 4DPYA 4YUDA 3IBFB 3GONA 4FBUA 4IG0A 3JYTB 3NAIA 3R27A 3PZPA 5I42B 3PR4A 3G71S 4HACA 3QFPA 2MKSA 4RO0A 1KOOA 1HBOB 1SJ4P 1U2FA 2DHAA 3KLIB 2P9GA 4R25A 3HKZD 3S1TA 4LFBJ 3D3BJ 3CJTA 2HIYA 2ZJPQ 4LJMA 4NLWA 1GXLA 2NLWA 3OFGA 4U67L 4CTAA 4ICLA 3MM5B 5E7OB 3U3YA 2DYAA 2X74A 3GG4A 4OVLA 3HP9A 1NJIO 1FRIA 3E01A 1RHJB 4RKUC 4JI3F 5DGBA 1SAZA 4ED5A 3DHXA 3KMQA 2D0CA 4JKCA 1XNQJ 5BPNA 3FFIA 2WVFA 5KFGA 4HVZA 1GLAG 3MPDA 3WIVA 1RFQA 4W5OA 3HHLC 4DN0A 2OTJS 1SVDA 4P52A 1J5OA 1HLWA 3AO1A 2BJDA 1Q9YA 5HVGA 2HFOA 4E3SA 4DTRA 1NZ8A 5KFPA 2F63A 2IJNA 5I3QA 3P96A 3DLEB 2VG5B 4KSEB 2ZWHA 1S1XB 1OMSA 3CD0A 1S6OA 3UCGA 1IKVA 3IC1A 3EL2A 5IZHA 1VIOA 1OS5A 2EFOA 4X2BA 1J6ZA 2WTUA 1IUJA 1WAJA 2HB5A 2XWXA 4FJHA 4RZRA 2KKZA 3ILIA 2C2RA 5EOYA 3ET6A 1R8HA 5IC4B 1IBLF 2GIQA 1XIQA 5B0GA 3CSKA 3SPYA 1FWKA 2WONA 3P5TL 4C0BA 2O8DB 4HUEA 3LPEA 3Q8VA 5KFDA 1JCFA 3M4XA 4JI2J 3HX9A 2CWXA 3CT9A 1JJ2M 2LSNA 1BL3A 3CWJA 4FYDA 3OUYB 5A76A 5KOWA 2QXLA 4ZK7M 2HBZB 4ZN3A 3CJ4A 2V8VA 3P4IA 2VGNA 1YBUA 4AUKA 2GX8A 3R8YA 1S1UB 3N28A 4OYAA 4H54A 1VSLA 4RWWA 2VOOA 3VPZA 1IKYB 4I7FA 4DSLA 2P9NB 2FGCA 1Y3KA 2ZBPA 2G8VA 4J9QA 2DHGA 1HUXA 2WBRA 3HI0A 4FWLA 1AT1B 4CK3A 4DL0C 5CYMB 4LBHA 3IG1B 1RAOA 3BB5A 1UVJA 1RBTA 2YH0A 2P9PA 1UETA 4BREA 1TMJA 5J1PA 5KGXA 4YDUC 1F2HA 3IBWA 1MROB 4C1NI 1VQKN 1AUDA 4NX9A 1PCAA 4PZVA 1VYAA 3UI3A 2VBXA 4WFXA 4F4AA 1O13A 3D6RA 4GVEA 2HF3A 1R59O 1VQNS 1B70B 3Q22A 4DR5J 1NGCA 5AJ3F 3NVMA 3WQTA 3H0PA 4OHXA 1MWMA 1XNRJ 3CPWR 2VOPA 1WC0A 1RTDA 3VGVA 2W24A 1L5UA 2HK3A 1LWEB 1KAYA 5LMNF 3VGSA 3MM6B 2OMLA 3X3UA 3D0GE 4WU2A 4BR5A 1FX2A 3FDSA 5C2DA 4CI0B 1FFSB 2RILA 3A8YA 1S72N 4G3IA 4HTLA 1VGYA 4KC5A 2O5DA 2BJ7A 4AHUA 3H45C 3OYGA 1WSHA 1VJWA 3ZTSA 1T6DA 1ZM9A 1S77D 3EXCX 3HFVA 3O80A 5J2NB 3ZZPA 2UXDF 2I7NA 4HUFA 2F4VK 2XNRA 3WEEB 3IGNA 1JXLA 3V6DB 2IYGA 3CIMA 1D9FA 3BP8A 4J9PA 3TQ1A 4ZDNA 5CXTA 2HVIA 3HCXA 4JP8A 4WK3A 3NF7A 2P6SA 3L0QA 1I94K 4ZJQA 3H1QA 2J9DE 3D2EB 3HD1A 1S9EA 1VQ4S 4Y2CA 2OZMA 3V81B 4LUBA 4B1ZA 2BUPA 4MK7A 3MUMP 1FHTA 1L3VA 4WFAQ 3EE9A 3GYXB 4WPAA 1MMDA 2PE8A 4BC9A 3I5CA 1HA1A 3MEEB 3ZNUA 1NGHA 3J7YP 3W65A 2PD1A 2B51A 4WTOB 3M1VA 2DTJA 4DU8A 4EAHD 4JKBA 3VESA 2VB6A 3PEJA 3MDQA 5K14B 2QWNA 1T05A 3V6DA 1VISA 3R3LA 3D6MB 5LSRA 3TZZA 2H3GX 2U2FA 3CCES 4P71A 1H0HB 3CC7S 3ZZUA 5I4MA 5KFKA 4G1QA 2D0AA 4ECQA 5DS7A 1CEZA 3GIMA 1K9MO 1FNMA 4BDYA 2B4OA 3DM2A 2GUPA 2XGQA 2IBKA 3IS9A 4B17A 2B6AA 3BSAA 4B02A 2M8HA 3A5NC 2Y1LB 4H0OA 1C0UB 1Y0HA 2U1AA 4KGXB 4FW2A 1UJ5A 2YPYA 5HMXA 1RHMB 3W5YA 2CJBA 3E3XA 4O3SA 3FLCO 1VHFA 5DDPC 3EO3A 3WNHA 5AXNA 5AXLA 3PW2A 2G2YA 3AB2B 2NSBA 4CQ1A 1HBNB 4J5OA 1TUUA 5G0RB 4YB1P 2B4PA 4LFAJ 4IOXA 2CQ4A 3UPFA 4NPOA 2GA7A 4BRIA 3MN7A 4K0KJ 2FBXA 3D7SB 4JI8K 2GJIA 5KFSA 2ZC4A 3IR5B 5CA5A 1RHUB 4K5SA 3OVAA 3LP0A 3KUEA 1WDTA 1SL2A 2XY7A 1XMOF 2PN6A 5KFHA 3DLGB 3VV2B 5CZVA 2P8IA 2E29A 2N7CA 1DJ0A 4LH5A 4CNYA 3L7PA 3LOUA 3C16B 3NRBA 2ZH9A 5KTQA 4U8VA 1RAHB 4A47A 3OTOJ 1PJ7A 3L8BA 2XCPA 1KC8T 4X62K 3OFEA 3ZC4A 2J0QD 3PCOB 1RAJA 4ID8A 4FWSA 3CJ9A 4FOIA 2Y1IA 3FBFA 3T5LA 4I6WA 3T9ZA 1QM9A 2UUCK 3OR2A 1B7YB 2QLBB 4J2AA 3FBEA 4ZLPA 3OYMA 5DRKA 4CJ4A 3KJQB 5AQZA 1NDPA 3HP6A 2RE2A 3TAEA 3TX8A 3SQ0A 1K73T 4JI4J 4WJBA 2M70A 3ASMA 4RW4B 4QW9A 3I6PA 5F8GA 4X4PA 3H5XA 3VERA 1UTAA 2NREA 3CC2N 3CCJN 3KK3B 2J8AA 1EQYA 3HHLB 5JS1A 1KHWA 2E4LA 3AGKA 3DOLA 5DETA 2KI2A 3NEKA 1VQ6S 5HL7L 2G8UA 3ZX3A 2O8FB 3A1YG 3V4IA 3VEOA 3JSRA 5EWEA 4A8KA 5D78A 4HLBA 4QU6A 3Q8SB 1UKUA 3DOKA 3SSSA 1C0TB 3BSNA 1WBDA 2O8BB 5E26A 3G96A 4BBYA 1EWQA 2BANA 2N3OA 2HBKA 3QT8A 2XMKA 2ASOA 4BVOA 1YBTA 3SDEA 3BH7B 2H9ZA 3ADAC 3MOZA 4FWNA 5IV3A 3NOCA 1CZBA 2FLPA 3OFFA 2WC9A 1WG5A 4NWBA 1JL1A 3RYLA 2ZNYA 4CO5A 2Y9HA 2YBVA 1RAEB 3MMBA 2JLEA 3LALA 4K50A 2CPJA 3EXYA 1RTHA 2KHCA 4BRQA 1UJ4A 1XWLA 4WBFA 3LPUA 3JQMA 2VG5A 1VSMA 4MH8A 3I0RA 1SV5B 4DTJA 1WSFA 4BRAA 3DDNA 4ZLNA 4L76A 5ITHA 2FVQA 2W7OA 1UW4A 4D3HA 4NA1A 2XHCA 3FEZA 1U1OA 1REVB 1BUXA 4WKRA 4M5GA 1KHVA 2EI5A 2BOAA 3LPTA 1RKJA 3SI8A 2B4JA 1UMJA 3CHWA 2D5RA 5KFLA 2NZTA 4NCGB 2P9EA 4X4UA 1QAXA 1ASWA 2VQEK 3MAQA 2V4JB 2WUSA 4NYNA 3UR0A 5CR4A 3SI6A 4Q0BA 3DYAB 4ILMA 1IR1A 5LXRA 1ELOA 4IO1A 1QE1B 4YS2A 4I6AA 1LFPA 2A1BA 1IBMK 2IIHA 2ZWPA 2E7VA 3G82B 5D3GB 2MZSA 2HAFA 1X4EA 4LIWA 3HTVA 3H5UA 4DQQA 1FFGB 3UKRB 3QEXA 1XN9A 2CWKA 1VOMA 4NLXA 2ZZNA 3PM9A 1ZH5A 2D4WA 3IAYA 2JEFA 4DV7F 2XRIA 4H4KC 4F2SA 5ETSA 1XEZA 2R42A 1FKOB 2RHSB 3U27A 4I6MB 1FFWB 1IJEB 2Y1JA 4OPKA 3IAM9 2ZM6J 5BYSA 4NXNK 3CCWA 3FFIB 4ZVHA 1KS2A 1S6PA 1K0TA 3N5BA 1RZMA 2FVSA 1VHXA 5KFXA 1PJ6A 3QWUA 3ITHA 4FJ7A 2MDAA 2OYQA 5F1XA 2G8KA 2G8HA 1LW0A 1XR6A 4PL8A 1R6VA 5E84A 2PO4A 2H51B 3LGNA 3MR3A 4Y00A 3PRDA 2NRHA 5B0FA 1DQ8A 1RUSA 4MYTA 1EWRA 4L3KA 1RBLA 5KI6A 2MMYA 4C8ZA 4LFBF 1N88A 4FPAA 4FWOA 3JTNA 1HI0P 5TKYA 4X65F 5KG2A 4QYZJ 4DSIA 5EWFA 1X5PA 4IG3A 1RT2A 4BRKA 2RQKA 2V4RA 2VYPA 3QFUA 3PYDA 5HN0A 2Q0UA 1N48A 3TQEA 3NVKA 3C6UA 2R7XA 2F8EX 2A2CA 2XO6A 3M8ZA 1HNXK 1E3MA 1T3OA 1LW0B 3HBTA 2J7WA 1JXBA 2WHOA 2ZGYA 4OJRA 1XNQF 4CJLA 1RJJA 2W2PP 2HHQA 4EEYA 4W5QA 4F02A 1JL2A 4NLDA 2DNRA 2V8GA 1S6UA 3VALA 1CPZA 4DR3K 5I9EB 4RUAA 3C7NB 1PYOB 1F3FA 3ZO7A 4CD1A 3KHGA 1WI6A 1Q82O 3W3DA 3D1QA 5E3QA 3IWNC 2WVCA 3A3NB 3HSJA 4CECA 1CC7A 4G9ZA 4XO0A 2GO8A 2KW4A 3LDLA 5KGWA 3RRHA 1U02A 3TJAA 2E6MA 5FPEA 3HXMA 3PW5A 3D6TB 2F8HA 3NWRA 1WTBA 1NBWA 3LM9A 3V1QA 4NYOA 3SQ2A 5C42B 4JI3K 3DLRA 2Z1GA 3C0BA 3N4WA 2W42A 1KLMA 2FZCB 2R8IA 1SC3B 4OJHA 3G8SA 3O4NA 4NLTA 1RCXB 5F8JA 2RU9A 1C4CA 2NUHA 4F3QA 1A5WA 4QIGA 1BD6A 1BA1A 4OHWA 4WTYA 2Y8WA 4J8FA 5HP1B 4FVMA 3ETOA 4DS4A 3QO9B 3J80O 3OBWA 2B0GA 5AQNA 4AHCA 3KLEA 1QZ5A 3MECA 4FK2A 4ZS6A 1NHKL 1N36K 1DY3A 4G1QB 2XWYA 4PKGA 3HKWA 4IKAA 3B4MA 3BQ2A 1XMOK 3G2XA 3TUZC 4HWIA 4LF5J 4ENOA 2BJEA 1VQLS 2XCAA 1Q95G 5AE1A 2E1YA 3I4PA 2NXEA 3CCVS 3GYGA 4M5JA 4N8OA 3AO5A 5FLXU 4YMEA 2CUYA 3EE8A 4KH1B 3HZ6A 2X1AA 4DKWA 4YB6A 3BDEA 5HSPA 5IT4A 2PA8D 5HAOA 2RVJA 2YWGA 1FCAA 2DO4A 2IVYA 2HVHA 3LDSA 1Q78A 3KD5E 1WD6A 4MYUA 5U47A 4F4ZA 1WHWA 1B64A 4JI2K 4DSKA 5A8KB 4DCPB 1N5QA 1MLAA 4NA3A 3BY5A 4JNEA 5HRPA 3CJ3A 5T7LA 5ADZA 1NB7A 2RDIA 2VASA 4C3LA 3CJ2A 3W60A 4ISFA 4KPCA 1FJGF 1LXJA 4C0HA 5KAKA 4JI1J 4YOUA 2VF3A 3KDOA 1B7FA 3TA2A 1CULA 4LSZB 4FKYA 1SH0A 3DXKA 4CJ7A 4OI6A 4KFBA 4U95A 3KMSA 4JYAK 4ZPWR 3M6GA 3QB0A 3PJXA 1XMQJ 4OYBA 4PPDA 3HSTB 3GBTA 1IXKA 3DNCA 4JI4K 1NGDA 1HMVB 1CULB 3BKFA 2OPSB 2CRLA 4FXDA 2QA4S 3LL3A 1MNEA 3TX0A 1S6QB 2XY5A 2ZEJA 3KK3A 2CVIA 2QM1A 3DLBA 3NNCA 4E98A 2E5LJ 2J0XA 1K1QA 3KLEB 4DPTA 1TUYA 1DLOA 3OYHA 5J1EB 2BKPA 3KNGA 3CMQA 1JCGA 3OHRA 2XYGB 5KG6A 1GLDG 3FJ2A 5BJRA 3PY8A 4KGZB 2OD4A 4X62F 1OY6A 4N8NA 1RA6A 1T9YA 2E5LK 3VQTA 3QZ8A 3TOQA 4H4MA 4NLGA 4LR7A 4W92B 3U4LA 4ICLB 2R7VA 2Z57B 4XIUA 4DUZK 4LF7J 3VN5A 2ASYA 1WC6A 8RUCA 3L2UA 4I9LA 3QMQA 1U1QA 4M3ZA 2XMWA 2P9LB 1VK3A 1JQGA 2G2ZA 3W1YC 2HMIB 3RMDA 3TRGA 4ATNA 1TVRA 4WCEQ 4DSFA 3N4QA 4AHTA 4GKJF 2WB4A 4HT7A 4UF4A 2RS2A 1JLEB 4JV0A 4B3OB 3RAXA 2CJQA 2GC8A 1CJUB 2GVZA 3GSIA 4OYOA 3PX0A 4YDXA 3I0RB 3BKUA 2OPQA 2J9CA 4FVUA 2YQ1A 1FW6A 4NYZA 4DOZA 4DV0J 3NNHA 3VAKA 1KD1T 2W6KA 3CF5L 3U9ZA 2J76E 2GJFA 3OYDA 3KLHB 4PEOA 5FDLB 2FJWA 1RDWX 5BR8J 2FSKA 1S1WA 4WP9A 3BJYA 4F50A 4A8FA 4C8KA 4L74A 4E1MA 2JJ4D 3GZ7A 3RAQA 3U1NA 5AQQA 1R43A 1AYEA 2CJ9A 4LRCA 3IRXB 4JKHA 4M41A 1X4FA 4OKEA 3SUNA 4PXDA 3W63A 4BRFA 4K8ZA 3SBGA 3C3LA 3MMAB 2QRRA 4ZP6A 2CZ9A 3T7ZA 4CIEA 2R7YA 1VQ8S 4JS5A 1RWKB 4FYVB 5J1EA 4EI2A 5CYMA 4ZVEA 2CGKA 3UW1A 4BRLA 1D1UA 3V6HA 4FM2A 3DDIA 1OQ3A 3MR6A 3IR7B 2ZOMA 2HNZB 1KC8O 3CERA 3O8WA 2AT1B 3CFPA 1BOTO 1Q7LB 4FF2A 3IFRA 4UOHA 4PL7A 1HNWF 2CZ4A 3WHIA 4LH4A 3KUHA 3D5MA 1S97A 2HGNA 1UVIA 3P5BP 4B3RJ 2UXDJ 4FYWB 3N6NA 3C94A 4FM0A 3WXLA 2VG7B 3CNQP 4CZFA 1NSAA 4B3MJ 4ED3A 1VFJA 2B5JA 2FY1A 2V2KA 5HK4A 1RBRA 1E6YA 3VETA 5GIOA 2GVDB 1HNXF 4KE5A 3TARA 1LQ9A 4WFNQ 1T03A 4YB5A 2P5VA 3GMGA 3TAMA 4ZMMA 4OYIA 1WDDA 3KKFA 3CXCM 2GMJA 4FS2A 5DQIA 4CEBA 2CVEA 3MWBA 3TEGA 1A9NB 4KB0A 2OLWA 1CQNA 4NLYA 1F5AA 4WU3A 1V3ZA 4W5NA 1TP7A 5A8RA 1K8KA 2E7WA 2BMBA 2BJ1A 3KYLA 1QSLA 2O8EA 4AHSA 2FJAB 3O08A 2F65A 4CWBA 3DFEA 3TZYA 1SPBP 4J9VA 4GC6A 4YB7A 1BQMB 3W2WB 3PO5A 5KFFA 4ECVA 1YJ9N 4ZLJA 1NKBA 1H98A 1VQ9N 4GV3A 2B7BB 2K1RB 1PIEA 1IKXA 2ZE2B 3MN5A 3NF6A 3EVMA 4JB8B 1IKWA 2C3MA 3K59A 1BI4A 4BGAA 1BQMA 1RTJA 2VA2A 1M1KO 1WG1A 1HIYA 4MIAA 5KG0A 4FJNA 1U04A 4O4RA 3GTYX 2N3LA 2ZVSA 1W97L 3OL6A 4DFPA 2E88A 4WFAL 1RTJB 1YJWS 1WJ9A 3O2IA 3GPAA 2V51B 3R5CA 3OTCA 4P74A 1NHUA 2DXDA 3CTRA 5L39A 2IMWP 2IRYA 3BPSP 3W3SA 3MM8B 3Q24A 1SJ1A 1FXLA 2NRTA 3DXBA 2F8TA 4ZTFA 2CADA 2ZM6K 2K7KA 1DBDA 3AXMA 4Y1CA 1K9MT 2MEWA 5K14A 3C66A 4DF8A 1FEEA 3ZT0A 1M1KT 4PG7A 3SPZA 1U8WA 3BN4A 4TNOA 3G8QA 4PQUB 2HG4A 3CVKA 4WP8A 2UXCK 3DRRB 2O01C 3F9KA 1S4FA 2UV8G 3NGZA 3VGLA 4LFCK 1HW9A 5DM6L 1KLMB 1YJTA 1NK5A 4CERA 1GX5A 2F9DA 3R1LA 4LMZA 3KKSA 2A6MA 3HHDA 2BRLA 4O8UA 2NXJA 1ZPWX 4PG6A 3S8SA 4V19J 3SIPB 2Z2ZA 1NH8A 3SEOA 2GGPA 1X60A 4OX9J 1JJ4A 5M1QA 3W2VB 4IDHA 1LK5A 4BRGA 4DUYF 1I3OB 5AR0A 2OTJN 3Q7BA 4CFDA 3MOJB 4H03B 4BR7A 4DV0K 2W2QP 1OVQA 4E7JA 3FRZA 3SCKE 4C48A 2CIMA 1WSGA 1W2BM 1SS6A 1KVAA 1TTHB 3KVGA 2B6AB 3MEGA 1YHQS 1KOHA 1OY9A 5JLHA 1FNXH 4PG5A 3H20A 4DQSA 3ZX0A 1G6BA 4EGLA 2ASMA 2XB2D 1RT4A 2QFIA 1S5JA 2PMHA 3TSUA 1X4GA 3R7BB 4LQ9A 1RP5A 5KRSA 3KIOA 3QYYA 2XZDB 3SQOP 3AY9A 2UUAK 2IVFB 5KFEA 4ZP7A 3L3UA 3MMJA 3ICLA 3DXSX 4C98A 3SSQA 2E1ZA 3UWTA 2ITMA 2AYEA 4F7VA 1PSDA 3AA9A 5CYQB 1H3DA 4MTPA 2IDLA 2IJRA 3V5RA 3F44A 4UQGA 9ATCB 5KG3A 4FZVA 5LXYA 4FDFA 3KK2A 2UXCJ 1DT9A 2HZCA 3ZTRA 4Q8FA 3VAGA 3D2WA 2J6UA 2KT2A 3H25A 1KEKA 4CJPA 2AEJA 2B4VA 3ZXWA 4B8CA 2NUUG 3FNNA 3MMVA 4CO1A 2WOMB 5K20B 4O44B 4DLEA 2JEIA 4XDCA 4U67Q 4W90B 3UD3P 5E3PA 1JLEA 2GAHC 1RT6A 4PXEA 2VG6A 4MLEA 3OYJA 2ZH6A 2DH8A 3BEGB 2YWKA 4G1PA 1S22A 4EFAC 4JYAJ 1VQ7N 1JLCA 2FC8A 4DDFA 1OH8A 4PCQA 1ZTWA 1JKHA 4IFVA 3C46A 4BY9C 4CIGA 2F8MA 1S3XA 3DGPB 3MCMA 3JSYA 3PIPQ 3ZTPA 1W25A 1HKGA 4UOCA 2ZH2A 1UA1A 4M3TA 3QAEA 2LECA 1NPPA 1Q1KA 3LO3A 1QQCA 3EVWA 1T9UA 2VU5A 1S7HA 3R3TA 4M5DB 4BC7A 1NUEA 4K4TA 1FXXA 2F5GA 3CI5A 1YJVA 4H4OB 2HEKA 1NWKA 3R97A 3KLVA 1VQ8N 4LF6K 3SZ2A 3HVRA 4F4KA 3CCRN 3DOLB 4DL3A 5T7BA 3PYFA 3KLIA 2RN2A 2HSTA 3HL8A 1GLBG 2MQOA 1N34F 4TLRA 1TAUA 3UN5A 4DTUA 1VSEA 2I5JA 4RW4A 4CF9A 4EK2A 4ETZA 3NGUA 3AVHA 1QUPA 2OGUA 5SUHA 5CYQA 3RW6A 4EU0A 3PW7A 1XNRF 3KHRA 1WOQA 2E20A 1IM6A 2P9IA 4JV5F 5EXWA 3AB4B 2QLFB 4K5RA 3M32B 3M3ZA 4LR8A 1DTTA 4HYKA 4IFYA 4JI7J 4RLEA 1HL6A 1RAIB 2EFVA 1X4AA 3MAHA 4JN4A 3J80U 3VAHA 5LMUK 5AXKA 4JV5K 2FYXA 2MZRA 2J7UA 4R5PA 2IS3A 4CHZA 1NXIA 3CO0P 4RUCA 2V63A 3HHLA 3A13A 3ITHB 4AQYF 2VQEJ 1QHTA 1VQKS 4HTUA 4O4GA 5GAHU 1VQLN 3K0JA 1S4EA 1P6TA 4MK9A 2J9DA 3O1WA 4LSLA 3N0VA 2Z1HA 3DAWA 1MA9B 3VQ7A 3AVCA 2GV1A 5A8WA 3PW0A 1S0NA 4K4VA 5A8RB 1RI7A 3NCRA 3G4SN 2YPZA 1DAXA 4N47A 4NYFA 4WYBA 3QFHA 4HI1A 5M1OA 4ANEA 4E8UA 3N6MA 1T9WA 2B9WA 3C14A 2XLJA 3GILA 1LK7A 5EX3A 1LWEA 5GMEA 3N4PA 4NLCA 5C0YA 2YNFA 4Y2MA 3IRXA 4W98A 3PKMA 5CE3A 4FLZA 4MKYA 4LT6A 1JLAB 3QAUA 3G82A 3OYKA 4RBUA 3IP0A 2JWKA 2I1RA 3ZSWA 2VKZG 4O4GB 4M7YA 4FLUA 1U45A 4IBNA 5H1SQ 4CFAA 3IAS9 2KL8A 2UXBK 1S1UA 4DZDA 3K9JA 4OI3A 1OJ4A 2LQBA 3U3GA 5A2QU 4UY8T 1W2IA 1RWOB 2BV3A 4XAKA 1SIZA 4L6V3 3THVA 4X4SA 1SC4B 2MJUA 3K9KA 3D1OA 1WOSA 2MPUA 1VIXA 3N6LA 4DSEA 1S0OA 2D1CA 3M2RB 4ZP8A 2E5IA 4AFFA 1NJWA 2WK4A 2PFUA 1LWCA 1JLAA 1OYDA 5AQGA 2NS1B 3OVBA 3UKUA 4DZ6A 4E1NA 1DQAA 2KZMA 4LF6J 2A18A 3IWXA 3BR8A 2IOCA 4DLGA 4CBWA 5DDQC 1S6PB 2JC0A 1YAGA 3GFYA 5KFYA 4DCJB 2XTJP 4GVLA 3D7EO 4ISEA 1ZETA 4KRFA 3BZKA 5LJ3Y 3GFZA 1HNWJ 2HNDA 4UUWA 3RBXA 2E9ZA 1FK9A 4A46A 2E1MC 3W8GA 4O0JA 1QAYA 2D1KA 3JQJA 4ZPDA 1K8KB 3J7ZO 1IWGA 4H8KA 1MWKA 1V4SA 1HARA 1ZM4A 2PAVA 4FYYB 2F4VF 4CJEA 1EZZB 4ECTA 2E2PA 5D4NA 3OYAA 2UXDK 4O5BA 1PC4A 2KZZA 3TVZA 3UDCA 5KFQA 3NAHA 2MHNA 5CCMA 2UUCF 4FCYA 1NMNA 3B8HA 2QV6A 4ZP9A 3QNOA 4H5NA 3HLUA 2DPJA 2NRZA 2BE9B 1VC6A 2QSFA 3R2DJ 3FKBA 3BO4A 4JKEA 2V8DA 2X6NA 3OHAA 4IQMA 4FF3A 2GUIA 1VSDA 2IAJB 4B9QA 3T5KA 4E89A 2GTDA 1WNEA 3CJQA 1M5KC 5LMNK 4CEDA 3BGLA 3AA4A 2AA4A 3UD5A 2VWJA 5AQRA 1J2VA 3MF5A 4JKGB 1APSA 2IFXA 2DNYA 2DNPA 2DTUA 3RUBL 1NK7A 2F9TA 3M1VB 2OSRA 2HVZA 1W2BR 4FJXA 4OZ0A 1LKZA 4NI2B 4KPYA 4P6QA 4PY5A 2VFVA 3QJJA 5LMUJ 4GKJJ 4Z94A 1SJQA 5F0UA 3TUPA 2DKOB 5E33A 2HBRB 3OLBA 1TL5A 3W9JA 4KH6A 3VR1A 5CAAA 1RT3B 5A0YA 4H0TB 2RRAA 2PA3A 4A2BA 4U8YA 1ZZNA 1T6CA 4CHQA 1YTYA 4DR4F 1HBUB 1RILA 1AZSA 2GWKA 3QJLA 1L3SA 3A5MC 3AOCA 5FLXY 1YUWA 3NCPA 4Y0WA 3AO2A 2DNQA 5I3UA 4Q7AA 4DR4K 1Y5IB 3JS9A 2XI3A 4JV1A 4IOBA 4QWEA 5AFUA 3J8AA 2HQCA 3M8WA 2GO9A 1RSCA 1WC1A 4A8QA 4DR7J 1P90A 4NYPA 4A5BA 3SJJA 4OMFG 5KPTA 3FZHA 4FS1A 5THWA 4ANDA 2HBJA 4RNMA 1U6BA 1RT7A 4PYDA 1BG3A 1VRTA 1Z6RA 1RLCL 1QQNA 1FX4A 1V5IB 3F2KA 3ZT1A 5KQDA 4NO7A 2Q6BA 1N34J 5C25B 1H6KX 3TVKA 4ED4A 1CG2A 4TU9A 2CNLB 2R7QA 4M3UA 4AD6A 4X4RA 3R5BA 4ZN1A 4DR1F 4ZITA 4A8SA 3OTEA 3B6PA 1NGBA 4YHHJ 2B3TB 2FGOA 1CSJA 1R6YA 4GKKF 4Q2MA 4CFBA 4DB3A 3ULHA 3N79A 3EM1A 2OFHX 1SUQA 3H42A 4OI1A 4OHZA 2M52A 2ETJA 5CZ2A 1DZ5A 1PYTA 4C1NK 4DMNA 2F4FA 5F0WA 2NXNA 4DV3K 1SV5A 1KTQA 4C3MA 2N4CA 4ELVA 3S3OA 1MWQA 4KHRA 2HQIA 2RRNA 1FTRA 3WC0A 3KHLA 1V5VA 4HEA9 1VRTB 2GHPA 1MU2B 2NSCA 4KHUA 5DGAA 3D3CJ 1K8AT 2BW7A 4Y65A 4LF6F 2IDEA 4YORA 3M8QB 2DITA 3TYTA 2EK1A 2YHYA 2ATLA 1WSVA 3AVLA 1S12A 3BSCA 5DDRC 4E0DA 3CCSS 4LF5F 3L09A 1N6QB 2KM8C 2QIFA 4CIOA 4GNIA 1RT5A 4DPWA 3JXUA 3RGIA 3DXKB 1FE0A 1HWJA 2YWWA 1X9WA 2MGZA 5HQLA 2ZC3A 4ZVTB 4DCOB 2P9SA 1VLOA 2HFSA 2WTFA 2EK6A 3OXGA 5M2UA 3MXMA 4ECXA 2I5JB 4O3PA 4BRNA 3MWTA 2XQCA 5MLCQ 4DU7A 2P5GA 4DU1A 1VQ4N 3V6JA 2OH2A 1FDBA 4JV2A 3LANA 2WW8A 1NHVA 5D4OA 4YFUA 4ID5B 2YKOA 4RW9A 4NLPA 3KLGA 2WBMA 4KRWA 1G15A 4GVBA 1D3WA 1WTFA 3EN9A 4P2FA 3SQ1A 1BLUA 2D0BA 3CE8A 4OLPA 1RBUA 3V4IB 1Q5VA 2XYHB 4Z7YA 1F9FA 4BE0A 1E4FT 1RYRA 1VQ6N 1YI2N 2YNFB 4N77A 1HRHA 1MG7A 1L3TA 4DQPA 1VDHA 3D1HA 4CGHA 3CJ7A 2YV0X 5K8OA 3K5OA 4ZA1A 1VSFA 4CCHA 4B9MA 3IKMA 3B4DA 1CZ9A 2WONB 4PPZA 1GOAA 4IFEA 2GVZB 1Q18A 3THYB 5LMNJ 4DFJA 1GQEA 1JLQA 2FVPA 5ETNA 1DARA 2HQGA 3ZSRA 4IOCL 3L3CA 3VQSA 3UKUB 4ED8A 3LPYA 3QWPA 3MM7A 3RBZA 1FJEB 1HKBA 4C11B 3LP2A 3OS2A 2MGZB 4CJRA 4RWTA 3CIZA 1F9EB 1UAXA 1EB0A 2EKYA 4O3QA 2DD8S 1KNZA 4DI6A 1LOTB 2C2NA 2CPDA 1D5AA 2MTLA 1P8ZA 5D3GA 3AQOA 2R7UA 3P45B 4F2RA 2XG8A 2VWKA 3PACA 2BANB 2DVIA 4FJ8A 2AJ0A 3TAMB 5A8WB 3QZ7A 3M8PB 5E2QA 3AQPA 3CJRA 1MW7A 4OJ3A 2JGUA 2UYTA 3KG0A 5HVFA 1FTCA 1FRLA 2I9SA 2YX7A 2E44A 4DTNA 1ZYQA 1FO1A 3TP2A 1Z2ZA 2UVUA 4X64K 3AH6A 5JVHQ 3VF4A 3A12A 3NAEA 3AT1B 1HFEL 2FC0A 1J5OB 2YKPA 4ZVGA 3TTDA 3UDEA 4OZJA 2O8EB 1HNVA 3PFOA 3PKYA 3W8PA 1NPRA 4DV7J 1X3MA 3CDEA 2W25A 3ENAA 3ULEB 1C6VA 3A8EA 3G10A 3W2WA 4JRPA 4CJKA 3GJSB 2IVOA 1RXOB 3G6VA 3ENBA 1Z2LA 3G4SS 3Q0AA 5B0AA 3NF8A 3TI0A 1C1CA 1HWIA 2E2NA 4LY7A 2BACA 1T03B 1QY7A 1R0AA 3CEDA 2V50A 4GC7A 1U1PA 3JTPA 3CW2C 2FDNA 4MKAA 3MX5A 4DQRA 1V3RA 3VQ4A 4JKDA 2BW2A 2XLIA 1HQEA 3J81Y 2UXBJ 2HHWA 3DDKA 4TQRA 4R0JA 1FEHA 3LGMA 1RYSA 4CH7A 3ATUA 3RW7A 3P1GA 1SQFA 4QWAA 2YKQA 2VFRA 2XZWA 2ZUGA 3EZUA 2RF2A 3Q86A 3VAJA 4B3RK 1XHZA 1WUAA 5CD4A 4USUA 3CCTA 2H1YA 4DQ8A 5KG4A 2CDRB 1C1CB 4LF7K 2P9NA 3CD7A 2OTLN 3M9MB 1O1WA 1OH7A 2Q0RA 1SQGA 1R89A 2PMWA 4JK9A 4YOVA 1NKEA 3ZETB 1FF2A 4JK8A 5AQUA 2ROPA 2VC1A 2B7CB 2MQPA 2VQFF 3VEXA 1ZBFA 3C6UB 4FZYA 2FSJA 1YDLA 1Q16B 4E7LA 2J7KA 2X3DA 1NNDA 4FN5A 3T19A 2QTWA 2J0SD 3QRPA 1ITPA 2E2OA 3PX4A 2ZBQA 1FXRA 3EVOA 3WZ0A 3GIKA 1C0UA 5F9LA 4RW6B 4K0KF 1HD1A 2HF4A 3ULEA 2DR5A 2H65B 4DL5A 5LOQA 2H3EB 4O44A 2Q1LA 4BRPA 5GMDA 2PZSA 4B9UA 4YOTA 4JAXA 3PG9A 1YIJN 1RTDB 3EGVA 4ZPAA 5CD4H 2QL9B 3VGTA 1TKZA 2E1PA 5JMNA 1WLJA 1U47A 1AZSB 5D15A 1ZAXA 4CLWA 1FWPA 2EG2A 3CO9A 3SAGA 3HSGA 3TA1A 3J7ZT 4GV9A 2YNHA 3HM9A 4PG4A 4YOEA 1TMMA 2N7YA 3LZIA 2IYIA 4I9QA 2DNHA 1E6VA 2R2SA 5HBMB 1HQEB 4ILHA 1J9AA 2IGIA 4CJUA 2ADBA 1TYQB 2YHBA 2BH1A 1ZBHA 5T7LB 1HW8A 3QO9A 2R7OA 1D8ZA 4DV0F 2DISA 3QGHA 1S9EB 3CCEN 1U4BA 1F2GA 4IFVB 4I2PB 2R2UA 4Y34A 1XTZA 2I8EA 1TV6A 4NCBA 3GE9A 2V2VA 3G0ZA 1YXQA 5A8KA 4IDKA 5JVGQ 4DV6K 2EC2A 2V9KA 1NSPA 1Y64A 1DQ9A 2E1RA 4KB7A 3ZX2A 3AA3A 1ZBIA 4PKDB 5JICA 3E66A 3OY9A 2PBDA 3GFHA 5GAHI 4FK4A 3A4TA 1SKUB 3DJCA 4E19A 1A0OB 1IO2A 3J80Y 1RT6B 4CBXA 1JXVA 3M9NB 3RSEA 4WCEL 3V9SA 3OS1A 3F73A 1IQTA 4LFAF 1W9HA 2A0FB 3E9LA 4WIQA 2W4PA 4CGJA 5F3TA 5L38A 5ETPA 4QWDA 4XPCA 2VH7A 4DU3A 1RISA 3GV7B 1VQPS 2KVQE 2POKA 3QGIA 5D8HB 3US5A 3FMWA 1RTZA 3D67A 4WQ4C 4DR4J 1VQPN 3EWGA 1WAFA 1UFKA 4PWWA 1HHSA 3K57A 4ILGB 3IWLA 4CTAB 4X66J 2Z1IA 4KKOA 9RUBA 2OTLS 3T3FA 3OYIA 2HHPA 1QQOA 1U2VB 3VF0B 2YJFA 3VEYA 2JH3A 2W2OP 3UDLA 4A2AA 3PIOL 3ILJA 3C16A 1VRUB 2HQFA 2F1FA 4YR0A 3MMCB 5JXSA 4K4WA 3TTFA 2DY9A 4EO8A 2CJKA 2UUAJ 3KLGB 2IM0A 4QS7A 3BYPA 1LW2B 1FDNA 1VC0A 2UU9F 4J2EA 1TL4A 4ED2A 1Q5YA 5AQKA 1O8BA 4HHHA 2WFBA 2P9KA 3O8MA 5KFZA 4H0YB 3F0NA 4DHYA 1NZAA 2PDAA 2I38A 3MR7A 4GMKA 5M1FA 3K2YA 5BR9A 3G6ES 4DUZJ 2ZJRL 4EBCA 2RB7A 1Q8BA 5K8MA 4J9UE 1IBKJ 3H8YA 4GY2B 1YG0A 1JLBA 3OSPA 4NASA 3OPKA 2CFXA 3PNIA 2EFGA 3KXDA 2UUCJ 3W9IA 4LRFA 4WWSA 4CJ5A 4U7CA 1GOBA 4DTPA 4RBVA 4KI6A 3MX2A 3TPQA 4LRBA 4DR3J 3KD1E 2VD3A 1Q79A 3CCMN 2QE5A 4U96A 2HS0A 3TWZA 3KNAA 1IBMJ 1OY8A 2DRBA 2C2MB 5G4DA 5BPMA 1UPMB 2F40A 4FO0A 3ZSVA 4NXMK 1I39A 1LFWA 2AX0A 4AE5A 1IBCB 3W64A 2M4MA 1JLFB 5E3RA 2P1JA 4ID5A 3KK7A 4DXLA 4QPXA 4USIA 5J2QB 3RMCA 3EYZA 1IR2A 4QU7A 3ZTOA 4CHPA 3HYFA 2EKNA 5JJBA 4B3SK 2PY5A 3WXIA 1ULRA 3MCSA 2DPNA 4CRJA 1DTTB 2BABA 3ENHA 3W62A 2F9WA 5KFVA 5KPRA 3VQQA 4Z4CA 2P9PB 2B8QA 4DR2K 1Q86O 5HATA 2KFZA 5KT6A 2XMUA 3M6VA 2GWJA 2V94A 3S3MA 3CB4A 1U1LA 5GAHP 2RHQB 1YBAA 4LFCF 2XBPA 2QLXA 4PXBA 1HKAA 3S6EA 3G6XA 2ALYB 2DR6A 5FD1A 2GBZA 2UVVA 5M1NA 1KQGB 4DR5K 4IOAL 1R27B 3O1LA 1X3NA 3QEWA 4LSNA 4QIVA 3CD6N 5IM0B 7FDRA 3A8JA 4I1TA 4RPFA 4GO5X 2NYIA 1YLXA 2GHVC 3EDQB 3VVTA 4LFAK 1N32K 2VC0A 1RT1B 4USTA 1KQFB 5HMZA 1SJ3P 1F0XA 3KJNB 3I5BA 3GU0A 2NRXA 2EW9A 4K4YA 5KG5A 1RU1A 3QIDA 2D69A 4CBUA 3KZBA 3BZCA 5A2QY 3QT6A 3EGNA 3KWIA 4I4BA 5HLFA 3LA0A 5AQYA 3GIIA 4M63C 2QFJA 2MY7A 4RNFA 1IBMF 5EX0A 2RQMA 2B9YA 3T1HF 1QSYA 8ATCB 3T1HJ 1IN0A 3OVNA 4DR3F 2UUBJ 3P49B 1QJHA 4E2FB 6FD1A 2C3OA 1TKTB 5H9FJ 4DV6F 2VPYB 3QEIA 4M5LA 4ZPVR 3UN2A 2RDJA 4BDZA 4ZIWA 2QMUB 3GOIA 2XS5A 1N33J 4BG9A 2KLAA 2C2KB 2E6LA 1RT1A 4DUZF 3CCJS 4CEEA 5LL6d 3EUNA 3ZSYA 4YR2A 2CPXA 4X64J 4J2BA 4B3SJ 3I96A 1F6TA 4WXOA 1BUPA 2ASJA 4IR9A 3WNEA 2DY4A 1RBSA 3GCWP 3C6AA 2W9AA 2C3PA 4CO0A 3PW4A 4NZ0A 2BBEA 1EX4A 1RE1B 2K1RA 3GIJA 2QEXN 3SXLA 4BRDA 4O23A 4W5TA 2CA9A 3PYEA 2V4QA 2CQ0A 1M90T 4LF8F 1IBKF 3H4DA 1CS4B 4ZJLA 1S57A 2J5AA 4JV5J 3VQAA 5LJVA 3QBWA 3C2PA 4A62A 4DL6A 1X7VA 2BVZA 4YY3J 1XHXA 1MWZA 3IS9B 1O51A 4CO4A 1PGZA 1Y5LB 1T95A 4IRCA 1FESA 1I51B 1YZ6A 3IA0A 1RWMB 3ID6A 3OYFA 1JNZB 4GRSA 3A8IA 1NAQA 2M7SA 1UJ6A 2HNYB 2K3KA 3H98A 2BM1A 1YF5L 4DTXA 1IBKK 2D3O1 2KYXA 3OYEA 3FC9A 2O8DA 5GAEP 4FPIA 1RAAB 2KG1A 2CGJA 1R0AB 4G65A 2HWHA 4F0KA 3KUGA 4HL9A 3GDQA 1VS3A 1YRUA 3CJ1A 2H4WB 5H9FK 1NDCA 4QBUA 5C25A 1VLYA 4WFNL 5EY4A 4CD3A 4PUOB 4V19S 2EFNA 3WX4A 1S9GB 1UWBA 1LWFA 2CGLA 5HJXA 2GQQA 5BR8K 3VOVA 1CBKA 4C97A 2NR0A 1PAEX 4PHTX 1VQ5S 4JEPA 1KQSR 1BA0A 1Q9XA 1NGFA 4Z7CA 3D2FB 4CF0A 4N5SA 3IG1A 1N8RT 3FVYA 4KTZA 4H5TA 3TABA 4YDUA 4KHPF 2BE2B 2EBGA 2PI5A 2JLGA 2IM3A 4L8RB 3VGKA 3A3PB 4I0WA 3LDPA 1NMDA 3ZLJA 1ZBTA 3MEEA 4K25A 4KO0B 3S01A 2LEAA 1NJYA 1R3NA 3NS7B 3M8QA 3FGUA 4K4ZA 2RQ4A 4NE9C 4P9SA 4F36A 5C24B 5CHCB 3QGPA 2DY1A 4O55A 3VQCA 1ACMB 3TZWA 3NGSA 3BV8A 2UXCF 2NYHA 2P9IB 4CGFA 2W6LA 3PEHA 2DH7A 4KBIA 3AVIA 3NGKA 2PEBA 4HVJA 4E7KA 2VDHA 1OSDA 2D3UA 5HP1A 4CLLA 4FKXA 3G25A 4PR6A 4ECUA 3FGVA 4NEYA 2A3JA 3DMJB 1BXNA 5C7PA 3U8XA 2RNEA 3RWUA 2D0PA 2JZ5A 2X1FA 4NLSA 4DCHA 1QAIA 3JSBA 3NGTA 1H2UX 1RLDA 1P27B 4DX5A 3LQVA 1PILA 2Z4PA 1MMNA 3CPEA 1DLOB 3QQCD 3PJWA 5H9EK 3SAHA 2FLNA 3D0IE 4E7IA 5D0GA 1XMQK 1HYSA 2WW4A 2AIRB 4CZCA 4FWRA 1BWFO 4NEZA 3SUQA 4RW8A 2V52B 4A8WA 1EP4B 1OKJA 2Z2YB 1BWEA 2D74B 4KTWA 2ALZA 3EX7B 2MKHA 2BYCA 1WKJA 1VQON 4B08A 3I56N 1RACB 4FW1A 4UTGA 5C12A 1HNWK 3KLHA 1RDAA 1FRHA 4LBPA 3W7BA 2EG1A 2AV5A 1NK4A 2D7SA 5CABA 3MEKA 1FVSA 5D0EA 3PJ9A 4FZZA 1NG9A 4ETXA 3EKSA 3FQLA 4FSVA 1KXPA 3CCMS 4RR5A 4NXMF 4OPJA 3CMEN 4RJVA 1O0PA 2YHXA 3UVJB 2R3VA 1S99A 5GMKa 3OA9A 3HVTB 1XR5A 3Q83A 3MCAB 2W41A 1RDUA 2NZCA 1GLJO 3LAMA 3ZSXA 5AZIB 3VF2A 3THWB 1U48A 3UNGC 4WKYA 1RAFB 4R5PB 2G13A 3HJVA 2F3JA 1RTIB 1A6LA 2L08A 5DZ6A 1BO5O 3M8PA 1FT8A 2C1EB 4Y3CA 2OSQA 2Q3PA 2G2OA 4JLHA 4CHYA 2OPRA 1YVFA 4WZQA 3EMTA 3HVWA 2OFGX 3VA3A 1D9DA 2NRRA 5JVGL 5I42A 4ZPCA 2Q1NA 4IOCQ 1RB0A 4HDHA 3AVKA 2ROGA 4FJKA 3VCDA 1SB6A 3EPGA 3FZMA 3DLEA 1TELA 3AVBA 1ZM3A 1WHXA 3E8OA 2VBZA 4X4VA 3G71N 3AAWB 2BR0A 1RBOB 5IQQA 1P1LA 2RPIA 3AJ2A 2D9OA 2J8SA 3CC7N 3QBXA 1WC5A 1ZOTA 4I6YA 5B08A 3IR6B 4B9TA 2P6TA 1OSCA 1L3KA 2HMIA 6AT1B 4JI6F 3FCWA 1ZXOA 4BWJA 4OPHA 2VQFJ 1BDGA 1JLQB 3QNNA 1TFYA 3O6QA 1HX1A 1I1GA 4CLYA 4ZLLA 3EGWB 4K0KK 3M6XA 3L4QA 4M5MA 4UW2A 2XSFA 2ZNZA 3JXOA 1WN7A 4O8KA 4OQJA 2KXNB 3UFCX 1XJWB 4RNHA 1GH8A 2W7PA 2HPUA 3ZEUA 2CQPA 1YJ9S 2WVBA 3DLLL 3NG8A 4NZ7A 2IRUA 4NLBA 2AEFA 1FXDA 1HWUA 2MKCA 3PIOQ 4MKBA 3CCUN 2MSSA 1N0UA 1SQKA 2NXUA 5AZIA 3GIRA 3MM5A 2YNGA 3EJMA 4OYPA 3CCLS 4IG0B 3JYTA 4BCAA 3P31A 4JI7K 2UUWA 2Q3SA 5DM6Q 2PGCA 4CZGA 1WEXA 1T94A 1ILYA 3ZTQA 1REGX 1F21A 3MPYA 2J0WA 5JMVA 1KVIA 5DQGA 1Q81T 2B8PA 3TWHA 1Q4RA 4M7XA 4OO1J 1H7WA 3K5MA 1CJVB 4DR5F 3NMAA 4JI7F 2DEJA 1IVZA 3HSCA 2HRUA 2QEXS 4BG8A 4BHQA 2W7AA 3LDQA 4OYXA 1RCOB 1QAJA 4Z37A 3MHYA 2A5XA 3SMSA 4EFHA 3CJSA 4X4OA 2VHGA 2A1SA 3CJ0A 4LVOP 2AZ3A 3QT7A 3MPVA 3VAIA 5GAGI 2DNGA 2XC9A 4CLZA 3OYCA 4OGEA 2GQ2A 4NLRA 3M8SA 4B3SF 4FJMA 5BPLA 5KFMA 1CS4A 4ECZA 2MKKA 1Y3JA 3Q2SC 2FD2A 2ZVIA 3THXA 2LMIA 2L9DA 1TL7B 3KDNA 3GWCA 3NP5A 2KKHA 3TVYA 2EEYA 1YIJS 2WCXA 5HLFB 2KHOA 2EWHA 2ILYA 2N4DA 2G8IA 3I55N 4OZ1A 4XDDA 2YJEA 4ZHRA 2ABYA 1HYZA 1QS4A 3TSPA 4R8UB 5D6GA 5LM7E 2XHWA 3M05A 2BKNA 3O4WA 5KG7A 4I2QB 3KG1A 1XNRK 3G9CA 4F25A 5JUMA 1G2EA 5AQSA 3R1HA 3HO1A 3BQ1A 3BF3A 3NH0A 2MQMA 2IRXA 3H5SA 1ESVA 2HLTA 2Z8QA 1WELA 4CJ3A 3EPIA 2L9WA 1S10A 4ZPTR 3D66A 4WE1A 2VFUA 3WXKA 4KTQA 1LXNA 3ELHA 3HHKA 2GMLA 5MAOA 4CP5A 3FZKA 3MEGB 3PX6A 4EYIB 5DM7L 4J9LA 4ZVUB 4ZVOB 3DXMA 4EP4A 4QWCA 1BHLA 4ZVRB 4DV1K 5ADXA 1B3TA 1UVNA 1IKYA 1NKCA 3BZQA 3UO0A 3J7A1 2HGLA 1RADB 1GXUA 2V7ZA 1NNEA 1X0FA 3E1YA 1HNXJ 4IDKB 1N54B 1M5HA 3H6EA 3GL1A 2O4IA 2DNLA 1NH7A 5ETVA 3F56A 2MKIA 4WFYA 4LRAA 1N5TA 2K7JA 4PXCA 3VAFA 4OV6A 4LF5K 2VONA 2HHHJ 3BEXA 3AVJA 2FHJA 1CC8A 5FJ4A 2AJ2A 3NBPB 2M5YA 3IMXA 2VZ9A 2MLXA 1S0MA 4FOEA 4C3KA 1B99A 2X6SA 3I5AA 1T05B 2HFUA 4DR7F 1T44A 4Z4IA 2QWRA 4BC5A 2B43A 2G0IA 1ZM2A 4DG1A 1W7WA 3OLAA 3FSIA 4DV4J 2WZ1A 1NLVA 3NS6A 3M8RA 1VBKA 2EHGA 2VDIA 4FBTA 4KGMA 5JS2A 3K7RA 4B3MK 1I94J 3BS9A 3AO4A 3LAKA 2O8CB 2FJDB 4URGA 3MTKA 4WF9L 3C15B 4AL7A 5HO4A 1VRUA 2A3ZA 4FP9A 4OYWA 4CEZA 4DBQA 3SNNA 4LF4J 3GV8B 4KBOA 2OCEA 3BPDA 3RB0A 1QLNA 2PIIA 4BS2A 3W61A 1O5JA 3DGVA 1N5SA 1S59A 4Y6IA 3C15A 1BE4A 2M0GB 3HJFA 5HBMA 3ISND 2D3ZA 3TA0A 1XNQK 4NLOA 4YR3A 2JX2A 2MZJA 3M30A 2YH1A 2CPIA 1RKIA 2VQFK 1N34K 2FF6A 4GMJB 2XM3A 3Q89A 5E3CA 1BGXT 1RWUA 2LFVA 3H08A 4PWDB 4AILC 2P9CA 2ZZMA 4EMDA 5F8IA 2QSWA 4CW7B 3SQGA 5F8MA 2F7TA 1HQUA 2ZH8A 1C1BB 2LEPA 3JS6A 2ZJRQ 1CLFA 1B9DA 1S1TA 2CG8A 4M8LA 3MD3A 4DU4A 4TU8A 5AQTA 5F8HA 1VBZA 4RU2A 1AUSL 2MQNA 1LWXA 2GZOA 3MUTP 5C10A 1S1TB 2YY3A 3O3FA 3HPHA 4K8RA 1V6HA 4C11A 1NCLA 2OD6A 3MXIA 1N32J 1HPZA 2EC0A 1PC5A 4JI6K 1KQSM 4K41A 3CJCA 3FFKB 5HQMA 4RW7A 4TY8B 4GVMA 4H4MB 3FCHA 5HVHA 1T02A 1X5SA 3CJBA 4N7TA 2G1HA 2R8GA 2M8DB 3VENA 5SWMA 2R8KA 2VJVA 3QFWA 4LC9B 4B3TJ 3AOAA 1J54A 5IT9O 1KVKA 1KONA 1EXQA 4C8NA 5FDLA 1IBLJ 3KK1B 1S79A 2RE1A 4A4JA 2OI2A 2BQUA 3I8BA 4N41A 2QX0A 1X5TA 4R79A 2QKBA 2P9KB 3FQKA 2OPQB 3GP9A 1XMQF 3D0HE 3BQ0A 2HZAA 2DT9A 2DR8A 4QPTA 4JYAF 3L7UA 3R5GA 2DGTA 3RR7A 1KCFA 3TJ9A 4BR4A 4FWQA 2E9TA 2AGQA 4HKQA 3BM7A 3B82A 3M2VB 3BO3A 4FLWA 2LEBA 4CI6A 4KAIA 4RU9A 1H2VZ 1JMTA 2OIHA 3ZZRA 2J4RA 4Q2LA 5KT7A 4PKIA 2WVDA 3NS5A 1IBLK 3WXJA 4CZHA 4ED7A 1CJKB 1G3OA 1YSJA 3ZZ0A 4M95A 1G4CA 2DR7A 2FHKA 1SL0A 3M2VA 1JJHA 4IH7A 4JI5J 4X84A 4BRHA 3PDNA 2G0CA 1J53A 3GG0A 3E01B 1X9MA 5SZTA 3DHWC 2AJ4A 3EKUA 1F60B 4CF1A 4JI8J 1U0SA 1QVFM 2QWOA 3BBFA 3ZEUB 3DI6B 4DV6J 2HK2A 1ZC6A 3E9PA 2CQ1A 1LWCB 3H3OB 2FXUA 3W0LA 1REVA 3PIPL 3CJAA 1Q7YT 4ZPBA 3LDNA 1Y4ZB 2IVNA 4DX7A 4WYLA 3VVUA 1TKDA 3T9NA 2EFQA 3QT5A 3R6MA 1KQKA 4EIAA 2SXLA 3D6HB 3ULDA 7AT1B 4FPBA 1Y10A 3T1HK 3SMPA 4GVBB 2HFVA 5AT1B 1FJCA 3L2VA 2BZ2A 5L9XA 4AL6A 3J81j 3TNVA 2CPFA 1ZAVA 4E1JA 4FJIA 2GEMA 4RW6A 2XSJB 1NOZA 3SBTA 1SH2A 2KG0A 1GMUA 4UZBA 2MZTA 2W9CA 4K2JA 3A5LC 1JLGB 3O6WA 1TQLA 1FKOA 4AQYK 3ZT4A 2OKQA 1YJNS 5FPDA 1K6YA 4GKJK 4DN9A 1BI4B 2C22A 3ZSQA 5IS2A 3SFGA 3DU6A 3BBCA 3VQ8A 3FEYB 5L1KA 2GIRA 3OYBA 3THYA 4MFBA 4DFMA 2BJ9A 2ZH1A 4CEAA 2NCKL 4CJQA 2FVCA 4JI3J 2LQ5A 1QDUB 1M1GA 2HZVA 3M2RA 4ZIVA 1R8AA 2YWHA 5A6WA 4MFBB 4CEFA 4IZ9A 2VQEF 4DR2F 3M9OB 2VFTA 2CYYA 1M0SA 3SV3A 2RUSA 5ETMA 1M5VC 3CCZA 4JKGA 5EX5A 1HJOA 3AV9A 1C1AA 3PV8A 4BVPA 4J9KA 2ITGA 1FNOA 5K5MA 1LCUA 2A41A 2RF2B 1H1VA 4DR1J 1KAZA 3WIUA 2V8HA 3V81A 2HFZA 3NKYA 4RNOA 5ETKA 3IO1A 3P8BB 3IGVA 1GEHA 2GJ2A 4FLVA 1TL3B 4JI8F 1TFWA 3FSYA 3OR1B 4KHQA 4H4KA 3Q23A 3P83D 3IDHA 5C24A 4NB4A 3C95A 1RWXB 4BC4A 3CCQS 5CY4A 2HKEA 3OTBA 3PR5B 1IWAA 3MFIA 3P4UB 4DV1F 4B3TF 3QSIA 5DG7A 4KHYA 2KRBA