5J2MA

Hiv-1 reverse transcriptase in complex with dna and efda-triphosphate, a translocation-defective rt inhibitor
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords HIV-1 reverse transcriptase p51 subunit
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
total genus 166
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2mA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2mA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2mA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2mA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2mA05
4NLWA 1TAQA 1DTTA 2IS3A 3GYNA 3MFIA 4CK2A 4CHOA 1YVFA 4QWDA 5DK5A 4IFVA 1BISA 1VSJA 1NKEA 1RT2B 5SZTA 1TK0A 4I2PA 3OYHA 3KLFB 3OL8A 5DG7A 3QIPB 4ICLB 1HMVB 1QAIA 3L2QA 4C8KA 4Q5VA 3TAMA 2E9ZA 4I2QB 3Q8PB 1MU2A 1U48A 4MIAA 3MAQA 1NK5A 1C1AA 3L3UA 4N56A 3T5LA 3I5AA 4FM0A 4Y2CA 2WRMA 1S1XA 4FJMA 1SV5B 4J2AA 5KTQA 3QO9B 4WFZA 3L2WA 4I7FA 5HROA 4UQGA 5CZ2A 5L1KA 4Y2AA 3H5UA 4ZPAA 2IC3A 4K4YA 2OPSB 3CJ4A 3V4IB 1RTJA 5KFLA 3DYAB 1B9FA 2JEFA 2QXFA 1RT6B 1RBSA 2X74A 4HKQA 3HVRA 1IKYA 1RT1B 3AVJA 3ZSYA 3OYJA 5KRSA 3N6LA 4EO8A 3TQ1A 2YHAA 3GV5B 1LWFA 4KHNA 1O1WA 1ZTWA 4J9LA 4I9QA 4NRTA 1N48A 2NUBA 2RF2B 1IM4A 2GIRA 3LWLA 1EXQA 3NF8A 5DG9A 4O44A 2O5DA 1KCFA 3DLKB 1X9WA 3DRRA 2HVHA 2HNDB 3K59A 5DGBA 3V9WA 4IH6A 2YV0X 3E51A 3LP0B 4DQSA 4IG3B 3QEWA 3KHRA 3CG7A 1BI4A 1A5VA 1X9SA 3GIJA 4Z4CA 2WTFA 4F2RA 3G86A 4GW6A 1KFSA 4CEEA 3TAEA 1W0HA 3IRXA 5KFGA 4KAZA 4JUZA 1TKTA 4PQUB 3NFAA 4FM1A 4R8UB 1TL1B 3PZPA 1C0UA 2YNHA 2FBYA 3SQ0A 4TQRA 1W9HA 1HYSB 3AVFA 3ZT0A 2O4IA 3H98A 2P5GA 2OZSA 4CCHA 1LW0A 3QYYA 3B6PA 3MEEB 3NDKA 3G6YA 4RW9B 1VRUB 3T19A 1JLAB 4MK8A 4MKAA 4DTRA 4O4RA 4NLDA 4CF8A 1FK9A 3AVLA 4FXDA 1HQUA 2ATQA 5KG2A 3S9HA 4DTUA 3QLHA 3MXIA 3AO3A 4ED2A 1FKPB 3MR3A 3DM2B 1C6VA 1S1UB 4AHTA 2KFNA 3BGRA 3QGGA 2P1JA 2RKIA 4QW9A 1SL1A 3KMQA 2GV9A 3CJ3A 3MFHA 3PO5A 1NKCA 2I5JB 1EX4A 3OYCA 5EWFA 4IKFA 4FJLA 4H4MA 2JLEA 4LSNB 4CESA 5L1LA 3DLGB 4Z4HA 2OPPB 4BWMA 4NLRA 3IS9A 3TARA 2IM2A 2P51A 1BCOA 2IDOA 4Z4GA 4Q0BB 1KVAA 3M9MB 4EYIB 2D0BA 4ZHRB 4AHVA 3K58A 3WNHA 4DL2A 2YNFB 4QOZB 3JYTB 4PWDB 4E3SA 2RDIA 3I8DA 3RB3A 2VA2A 5D3GA 4ZP7A 1KTQA 4PA1A 2D0AA 4OKJA 1TV6A 4RNMA 4QPXA 5K14B 2VG6B 3KLEB 4DQRA 5DG8A 3QEPA 3VN5A 4NLQA 1HRHA 1XR5A 3RMDA 4TY8B 5J2QA 1QHTA 5KFQA 2ASJA 1IKVA 4WE1A 4O3OA 3HM9A 3V9UA 1GOAA 3OLBA 4OJRA 5KFVA 3V9SA 1CXQA 1S0OA 3PR4A 4O3RA 4CHYA 3VQ8A 3KLIB 1JLQA 1S0MA 1JLCA 5I3UB 4Q43A 2HVIA 4CEAA 1ASUA 4F50A 4L8RB 1KFDA 3MEGB 3HKWA 2IBKA 2Z1HA 5HRNA 1TKXA 3DRSA 1XHZA 3HVTA 1ASWA 4CF1A 3V81B 1ZYQA 3ICLA 1NK9A 1IO2A 3C6TA 1WAJA 3P83D 1IKWB 4KI4A 3KD1E 4ID5B 4K4TA 1UOCA 2YKNA 5HRPA 1RDBA 2C22A 2DFHA 4E1NA 5KI6A 4KE5A 2KTQA 3AVNA 1S9EB 1VK0A 4ELVA 3ZSVA 3H08A 1IKXB 1HYZA 5KFDA 3I0RB 4HHTA 2FLLA 3OYMA 4ECZA 1D0EA 2V0NA 1VSIA 3M8QB 3CDWA 3SFGA 1X9MA 1ZBHA 5FRMA 1NK0A 3D0PA 1R0AA 2XHBA 3AVMA 4H4OB 3RBEA 3NBPA 1RTHA 1RTIB 4R5PB 4B3OB 4EO6A 4EP5A 4KRFA 5HBMA 1VSFA 4E89A 1C2PA 3DLRA 1N6QA 2R2SA 2RN2A 3PW2A 4GC6A 4MFBB 4EEYA 1NOZA 2HMIA 4CGIA 4NRUA 3OJSA 3O3FA 4RW8B 3TWHA 4DQPA 1DTQB 5KFHA 3VA0A 2DTUA 3RR7A 1T05A 4C8OA 4CJUA 1XR7A 1RT3A 3D28A 1Z25A 4TSXA 4KB0A 2VG7B 3PHEA 2UUWA 3TAPA 3KD5E 2BDPA 3FSIA 1X1PA 1LWEB 1IG9A 2ZQBA 3ZSOA 3CQ8A 2R2RA 2XCAA 2PYLA 1JLFB 2KZZA 3ZSRA 1EP4B 5CY4A 1YTUA 2EX3A 1LAVA 4QWAA 4ID1A 4CJ3A 2QKKA 4DSEA 3KIOA 1QAJA 3UIQA 3AVGA 1D9DA 1LW2B 1QE1A 3MR2A 2Z1GA 3C6UB 5DLGA 1WSIA 3ZSZA 5KGWA 2WK4A 4WXOA 3PR5B 4G1QB 3DLEB 4DL7A 1QUVA 3NAEA 4AH9A 3BREA 2OA8A 2JEIA 4IR9A 3M8SA 4IRKA 3WNGA 2R8HA 1C1CB 3ITHA 3CWJA 2B6AB 4AHCA 3OYBA 3LZIA 1NHUA 4AILC 1KLMA 5J2PA 1HNVB 5KT5A 1C0TB 4ZPBA 4DLGA 5J2MA 2R2UA 3ZCMA 1TL3B 2Y1IA 4KHSA 3P1GA 1S6QB 3GV7B 1L3TA 2UVRA 5KFCA 2EC0A 3KLVA 3OY9A 4NYNA 1S9FA 1WSHA 4RU9A 2AX0A 4Z4EA 3NGYA 4CFAA 3EZ5A 3MEDA 1S1VB 4TYBA 3L2RA 2D3UA 4IDKA 3S3MA 3KJVA 1XR6A 4FJ8A 2IAJA 2BQ3A 4MQ3A 1ZBIA 3EY1A 4I9LA 4YNQA 3HHKA 1NOYA 1S6PB 3OL6A 4RW6B 4HTUA 2X78A 3NF6A 1C1BA 4RW7A 5JS2A 2E6MA 4CHPA 4GC7A 3V6JA 1KHVA 4XPEA 3RRHA 1RBUA 3CDUA 4DWIA 2BE2B 2XRIA 3NAIA 1BQMA 3SZ2A 3QEVA 3FFIA 3V6HA 1JLEB 1RA7A 2KZMA 1LV5A 2HWIA 3EZUA 1RDAA 3I5BA 1WSGA 1VSMA 4FLZA 3UQSA 4E7KA 4B08A 2ASDA 1T03B 1S4FA 3LP2B 1RT2A 4DS5A 3KLFA 2R8KA 4FBTA 3SQ1A 3QIPA 3H5SA 3IG1B 1HMVA 4ICLA 3KLGB 3VQ9A 2BRLA 4I2QA 1J9AA 3AO4A 2G8WA 1L5UA 3M9NB 1FXXA 3OHBA 4J9KA 4CHNA 4DS4A 1S48A 3K5LA 3GIIA 4DU1A 1SV5A 3QO9A 1OS5A 1YTAA 2HW3A 4W5TA 5C25B 4BACA 2VWJA 2ILYA 3H2LA 2OPSA 3QIDA 1ZBUA 2OPRB 1S1TB 3RB0A 3V4IA 2BRKA 3DYAA 5KFWA 3QETA 1BCMA 4X2BA 1RT6A 2OH2A 3FQKA 4OGCA 4B8CA 4Z4IA 1L3UA 3N6MA 1RT1A 4R0EA 5KFEA 3NGDA 3MF5A 3PVXA 3CJ0A 4PUOB 4CFDA 3K2PA 5J2NB 4BDPA 3RAQA 2XO7A 3BR9A 3OYLA 3AA4A 4E7HA 1JLBB 2GIQA 3NL0A 1HQEB 2RF2A 4OLAA 3FDSA 4URQU 1XI1A 1T3NA 5KFBA 3DLKA 1RTDB 1L3VA 4J9OA 4FZXC 4HYKA 4Q44A 4ZP8A 3LP0A 1RBRA 4IG3A 2XY5A 2KFZA 5HP1B 4BDYA 2HHXA 2I1RA 3N6NA 3ZT3A 4RZRA 3RAXA 5EUHA 4YR0A 4DG1B 1U49A 5KFJA 3VQSA 4CHZA 2HNZB 4WYWA 4OPKA 4RW4B 3ZT4A 1N5YB 2V9WA 2ZD1B 4PQUA 4O3PA 5KFSA 4R8UA 5F8MA 2BR0A 4CJQA 1TL1A 3G6XA 4DQQA 3T5JA 2IJFA 3DLHA 4U7CA 2XGQA 4F4XA 4XIUA 1HYSA 3K57A 2IA6A 3EYZA 4ED7A 3MEEA 4B8AB 4RW9A 1VRUA 2G8UA 1JLAA 2XGPA 1JKHB 3L8BA 2KW4A 3LP1B 1D9FA 1GOCA 1F21A 5JS1A 3VQCA 1LAWA 4K4VA 2Z1JA 1FKPA 1NJXA 1K1QA 5KFIA 3DM2A 1S1UA 3RR8A 2W9BB 5C42B 4KHMA 5KT3A 1WLJA 1RDRA 4KREA 2ETJA 4DTNA 4Y1DA 2XI3A 2I5JA 4ECRA 3M8RA 1WAFA 3LZJA 4LSNA 3DLGA 3V6DB 4N5SA 2R7YA 2BANA 2OPPA 3E01B 4RUCA 5KFOA 4DTXA 2VWKA 4Q0BA 4KHYA 4TN2A 5FDLB 5F9LA 4ZHRA 3G6VA 4DTMA 2YNFA 1ASVA 4EBEA 3JYTA 2R2TA 3M8PB 4PWDA 3DLBA 2QV6A 4CECA 3CIZA 3OL9A 3SV4A 4LH5A 1GX6A 1SL0A 5K14A 2VG6A 3KLEA 4FJGA 5T14A 5EWEA 3SUQA 1TK5A 3KKRA 4FJ5A 2IM0A 3CDEA 1EKEA 4TY8A 3PJXA 4KHWA 3V9ZA 2GC8A 4NYZA 3OYKA 4E7JA 4H54A 1VRTB 3Q8RB 4CHQA 3PW4A 5KFPA 3KK1B 2JGUA 2FC0A 3PUFA 3OHAA 2G8VA 2BGGA 5F8IA 3AVAA 4DFJA 3MXJA 3KLIA 3CVKA 1L3SA 2GUIA 5I3UA 2XY7A 4W5OA 2AGOA 2AJQA 4NLUA 4YP3A 1UA1A 4NCGB 1S1WB 3MEGA 4LD0A 4I7FB 4OL8A 4AHUA 1W25A 3RTVA 3KMSA 4TLRA 1S49A 3VQAA 3V81A 3CM6A 4QAGA 1Z26A 1WNEA 3LANA 1IKWA 4EYHB 4M41A 3OL7A 1DLOB 2XI2A 4ID5A 3QESA 2WHOA 2VG5A 2F8SA 1SH3A 3F9KA 2PZSA 3SI6A 4KTZA 2DPIA 4MK9A 3T5KA 4IRDA 1S9EA 3VQBA 1TKZB 4IRCA 4CJTA 1IKXA 3I0RA 4DFPA 3DRPB 3AVIA 1J54A 4RNHA 3LWMA 3T1AA 5JXSA 4FS2A 4NLVA 2G8FA 2R8IA 4ZPCA 4KBIA 3M8QA 1SH2A 1NHVA 1J5OB 1T94A 1HPZB 4BWJA 3F73A 4URSA 4H4OA 1RTIA 3I0SB 4R5PA 1S9GB 4B3OA 4K8XA 3KK3B 2OYQA 4DTOA 4DTJA 1Z4UA 2JC0A 4MFBA 3OYIA 4EZ6A 3Q8SB 1N4LA 4RW8A 4LQ9A 3LAKA 3NH1A 1HJRA 1DTQA 3NMAA 3QEXA 4K50A 1KSPA 2HHWA 4JS5A 3VA3A 3DOLA 4MH8A 4NZ0A 4DEZA 1LWCB 1TQLA 4U6PA 4E19A 5KFYA 3OYAA 2OPQB 1IH7A 1D1UA 1NK7A 3HO1A 1LWEA 3HVWA 2F8EX 1BIUA 4DL3A 1JLFA 1EP4A 5L1JA 4NLXA 1CLQA 3S3NA 3BGRB 5KFZA 4CF0A 3THVA 4FLYA 2FBTA 3NKYA 3RMBA 1JL2A 4IR1A 3VQ5A 1LW2A 4CJ5A 2W42A 4KV8B 2X6NA 4FLVA 3C6UA 1RNHA 3AVHA 3PV8A 4B9SA 3GV8B 3EPIA 3OS1A 4ZP9A 1NJYA 3OSNA 4G1QA 2E6LA 3OS0A 3DLEA 1JLGB 4W5NA 1JXLA 1KLNA 5T7BA 1WN7A 4IFYA 4KI6A 4FK4A 1C1CA 3H59A 4DSFA 2B6AA 2OZMA 3ULDA 4FLWA 4O3NA 4J9SA 1HNVA 4QWCA 4FJJA 4ZVHA 1C0TA 4KO0B 3KNAA 3TVKA 1BQNB 1TL3A 1S6QA 3K5NA 3M9OB 3KLHB 4K4ZA 1B9DA 3NE6A 4GMJB 1SKWA 2YNGB 5CYQB 1U04A 4BE0A 2IM1A 4CEOA 3O3GA 1A5WA 1T7PA 3CYMA 1S1VA 2C2EA 2J6UA 4CJKA 1RT5B 4LSLB 4M3UA 1S6PA 3UDLA 4CJLA 3DI6A 4RW6A 3RMAA 5KFUA 2P5OA 2W7OA 4Y34A 3OYGA 4ZMMA 4NLOA 3GIKA 3QNOA 1RDCA 2BE2A 4H8KA 4KHRA 4CEFA 5KG5A 1XHXA 3G0ZA 1JLEA 3SUOA 1B92A 3NCIA 4AHRA 3G10A 5I42B 4CE9A 4ED6A 4C8MA 4DSIA 4O3SA 2G8HA 1T03A 2YKMB 5FRNA 3LP2A 2ALZA 1ZETA 4YR3A 3AVKA 3O4QA 4FJ7A 3NGIA 4DU3A 3IG1A 3KLGA 3C95A 4WYLA 4ECWA 3KK2B 2XWYA 4OPJA 4JRPA 4DF8A 1SUQB 2B5JB 4K4XA 2F96A 2Y1JA 4ELTA 1UWBB 4FW2A 4XO0A 4CEDA 4CJ4A 1HARA 4DL4A 2HHSA 2HHTA 1ZTTA 1RBVA 4ECTA 1REVB 2FJXA 3DOKB 2XCPA 5C25A 4JRQA 3HJFA 4Y1CA 1TKDA 2OPRA 1S1TA 1G15A 1SKSA 5SWMA 4CIEA 3JSMB 4ECUA 3MR5A 4W5QA 1A5XA 5DQGA 3CFPA 4YR2A 1NJZA 4PUOA 3OLAA 5J1EB 4W5RA 3IAYA 5J2NA 4CGGA 1QQCA 3U3GA 4CJSA 4EZ9A 2D7SA 4DL5A 4CJVA 3OS2A 4FZYA 1BHLA 3L3VA 4ZTFA 3H4BA 1JLBA 1VSDA 4HUFA 1KRPA 2WONB 2V4QA 1HQEA 4K4WA 3AO5A 2FBXA 5KFMA 1I6JA 2RDJA 4GVMA 1RTDA 1S10A 1S5JA 4KTWA 3HPHA 4KSEB 4FLTA 1NNDA 2E9TA 2BQUA 4OKEA 4ECYA 4F4WA 4KAIA 2C28A 4MK7A 5HP1A 5JUMA 1TVRB 3HL8A 3H4DA 5C24B 1MMLA 4KKOB 5KFRA 4DG1A 3I5CA 2QKBA 2HNZA 4C8NA 4M94A 3OYFA 4FLXA 2D3ZA 4RW4A 1N5YA 3ZT2A 2F8TA 1EETB 2ZD1A 1CZBA 2QE5A 4JS4A 4O3QA 1SH0A 5CYMB 4AHSA 5KFKA 4EBDA 4KFBB 4Q8FA 1YVUA 2W9CB 4FVMA 3RRGA 1K6YA 5EWGA 1FKOB 1ITGA 1JKHA 4DF4A 1U4BA 3HXMA 4DTSA 1U09A 3SI8A 3TAFA 2JC1A 2W8LA 4E7LA 3LPTA 1KVCA 1WNSA 2CKWA 3LP1A 4ELUA 1ZBLA 1YT3A 4URGA 3SUPA 1TAUA 1D5AA 2WOMB 4B9LA 2W9BA 4Q8EA 5C42A 3QEIA 4O4GB 3SPZA 3DMJB 3QZ8A 5KG0A 4OVLA 4EP4A 4M3TA 3V6DA 3QIOA 3LDSA 2HNYB 3E01A 3L2VA 4K4SA 4YMEA 5FDLA 1C1BB 2HNDA 1Q9YA 3P5JA 4JLHA 5F8LA 3S3OA 1RT4B 4ED0A 3M8PA 3PX0A 1VSEA 4RNOA 4B9UA 4ZVGA 3MECB 2FVRA 3TAGA 4TXSA 2W9AA 2UVUA 2ZE2B 2A1RA 2FJWA 3TABA 5KFXA 2AWZA 2VA3A 5KG4A 4HUGA 4DFMA 4O0IA 1VRTA 3CM5A 2RPIA 3KK1A 4CF9A 3LP3A 2X6SA 4E0DA 4K4UA 2GBZA 2FVSA 3MTKA 3SV3A 4FLUA 3TANA 1Q8IA 3ZSQA 4CK3A 4N41A 4MKBA 1J53A 4NCGA 1S1WA 4NLYA 5C5JA 4IOBA 2C2DA 3K5MA 5FROA 5KRTA 3NH0A 3KOAA 3HP9A 4KHQA 4DTPA 4M3RA 3SUNA 1U45A 5HLFB 1TGOA 4FK0A 2B4JA 3L2UA 4IBNA 3SFUA 5KG1A 3GQCA 3HK2A 1DLOA 1VSKA 1RT7B 1D8YA 3KTQA 2DY4A 4CGFA 4MIBA 3CFOA 1HNIB 4CERA 2YNIB 4ECSA 2A1SA 2ATLA 3SNNA 1TKZA 4F4ZA 3BJYA 3BQ1A 2E4LA 3DRPA 4C8LA 5F8GA 3QGIA 4J9MA 3FRZA 4IG0B 3VQ4A 5KT7A 4ECVA 3ISNC 4CIGA 2AGPA 1J5OA 1DTTB 1HPZA 1SKRA 4FM2A 4NLPA 2AX1A 1RCHA 3OYEA 4IFVB 3ZSWA 4QWBA 3I0SA 1S9GA 1Y97A 4I2PB 2IJNA 3KK3A 1I3AA 4PY5A 3HSTB 3Q8QB 1JXBA 2FLPA 3TAMB 3VQQA 3TR8A 1MU2B 5KG3A 4FBUA 4FJNA 3AA5X 4NLTA 1NK4A 4N76A 3PX4A 5L1IA 4IQXA 4E1MA 3LALA 1S1XB 3CFRA 2AGQA 1QSYA 2ITGA 2HHVA 1JXEA 3PW0A 1LWCA 1T8EA 5HROB 3NF9A 2OPQA 3KHLA 2IC3B 3BSNA 5KT2A 4M45A 1RAJA 1WSFA 3TAQA 1RTJB 3VQEA 4DSJA 2J6TA 4Q45A 2ASLA 1IKYB 4WFYA 4JV2A 1RDDA 1SL2A 1I39A 4NLGA 4TQSA 4ECXA 4NCBA 3SJJA 1LWFB 3PJWA 4KV8A 4LQ3A 4CGDA 5KFFA 4ED8A 1QSSA 2B43A 5KG7A 3OJUA 5F8JA 3OYNA 4ZVFA 2BANB 4CJWA 1JLGA 4O44B 4FW1A 4FYDA 1CXUA 2FVPA 2R8JA 3AVCA 4KB7A 4Z4FA 3DRRB 1CSJA 4J2DA 2HWHA 3KHGA 5KGXA 4KO0A 4F4KA 3V9XA 2XY6A 4K8ZA 1BQNA 2FVCA 5EDWA 1S0NA 2YHBA 3AO2A 1BI4B 3KLHA 3AO1A 2PYJA 4IH5A 3SQ2A 4TY9A 2YNGA 2C2RA 5CYQA 3IRXB 2IM3A 3QNNA 3V1RA 2DFFA 1TKTB 2Q3SA 3BSCA 2HB5A 1C0UB 2YNHB 4ZPDA 1RT5A 3RB4A 2W8KA 1KVBA 4LSLA 4QWEA 4DFKA 4RUAA 2WCXA 3MXMA 3ZT1A 3SQ4A 3BSOA 2AU0A 4DMNA 2FVQA 4JV1A 2VG7A 1LW0B 4DSKA 3AA2A 2XC9A 4NCAA 3SPYA 5EU7A 2KQ2A 3NAHA 1FK9B 1RYRA 3ASMA 3FQLA 1HQUB 3QLHB 3NH2A 4CF2A 4FJIA 4KB1A 5I42A 4B9MA 2RKIB 4CFBA 3QINA 2BQRA 2YKMA 2XY8A 4KPYA 4CK1A 3BQ2A 3B6OA 3O3HA 4H4MB 2J6SA 4B9NA 2FBVA 5DGAA 2VG5B 4CJFA 4FK2A 1UA0A 4M3YA 3IS9B 3KK2A 1JX4A 4J9PA 1SUQA 4F3TA 2B5JA 4FJHA 1GX5A 5KG6A 1UWBA 3QGHA 3AA3A 4HVJA 5D3GB 4RNFA 1ZBFA 4B9VA 4OKKA 4NLSA 4J9QA 3PW7A 1TV6B 1RBTA 1REVA 2IGIA 4O0JA 3DOKA 3RWUA 1RILA 3HPOA 3ALYA 3IGNA 3AVBA 3IN5A 4BE2A 4FJXA 3T5HA 3JSMA 5J2QB 1IKVB 2W7PA 1GOBA 4WE1B 1JIHA 3LPUA 4CJPA 5DLFA 1BL3A 4EBCA 5J1EA 4BE1A 4LY7A 4J9NA 5F9NA 4DSLA 4QW8A 3GILA 4CGJA 3PW5A 1JLQB 3A2FA 2QK9A 1JLCB 2WONA 4WFXA 2R8GA 1K1SA 5F8NA 1N56A 5KFAA 5DQHA 3DOLB 3UR0A 2AQ4A 4HCBA 2D5RA 5KFNA 3C94A 5KT6A 1S97A 4DLEA 3CO9A 1TKXB 3D5MA 3DRSB 3HVTB 4J9RA 3MR6A 3H5YA 3VQ6A 4QCLA 3V6KA 5HRRA 1TVRA 3C6TB 3U3YA 2DFEA 5C24A 4KKOA 2CJQA 3KHHA 2YKNB 3DDKA 4BDZA 4DQIA 4ED3A 4WXWA 4JV0A 2D0CA 2IOCA 1NJWA 5KT4A 2IMWP 1EETA 4Z0UA 3BDPA 4M42A 3H5XA 2UVWA 5CYMA 1NKBA 4KFBA 3OVNA 2HHQA 4KTQA 3LAMA 4Y3CA 3BQ0A 2W9CA 1CZ9A 4J2BA 5L9XA 4IFYB 1FKOA 4M3ZA 1QTMA 4NYFA 2UUTA 3VQPA 4LH4A 1RA6A 3RB6A 1R0AB 3PO4A 3KKSA 3NBPB 4XPCA 1RTHB 4ZP6A 2ZKUA 5HBMB 4WZQA 4M95A 3HP6A 3ZSXA 3T3FA 1JL1A 3NGZA 2WOMA 3VQ7A 1N6QB 1QS4A 1VSHA 4CEBA 3VQDA 3IGVA 2G8KA 4O4GA 1BIZA 4ED1A 4DL6A 3DMJA 2HMIB 4F2SA 3K5OA 3O4NA 3CJ2A 2G8IA 2LSNA 2DPJA 1T05B 3CJ5A 3V1QA 2HNYA 1RT3B 2JEGA 3DI6B 1C0MA 1WSEA 3OSPA 1QSLA 5HRSA 1HYVA 4M3XA 3NHGA 1RT4A 4CEQA 4YQWA 4CFCA 4YFUA 5KFTA 2HAIA 1XWLA 4ZVEA 2FLNA 1WSJA 3PX6A 3SCXA 3PY8A 3BSAA 3MECA 1TP7A 4O55A 3U6FA 1Q9XA 1UAXA 4J2EA 4HCCA 4FJKA 1TK8A 2ZE2A 4IH7A 4E7IA 1QE1B 2JEJA 5F8HA 3HT3A 1XC9A 2Z1IA 2ILZA 5CZ1A 3UPFA 4O5BA 4WZMA 2WB4A 3OYDA 1VSLA 5DQIA 1NK6A 4TYAA 4CIFA 2V4RA 4ECQA 3ITHB 4DU4A 4CJRA 4CJEA 3TI0A 3QERA 4G3IA 3V1OA 1KLMB 3QZ7A 5J2PB 4IKAA 3WNFA 4RG8A 5J2MB 4CGHA 2D41A 4F4YA 1RYSA 1U47A 3GIMA 4FS1A 4FJ9A 4RNNA 5HLFA 3MEDB 4F8RA 2PY5A 3SYZA 4F3OA 4IDKB 1NK8A 3KJVB 1RT7A 2IAJB 3AV9A 4KHUA 4N47A 2HHUA 3ISND 1HNIA 3EPGA 5DMRA 2FJVA 4RW7B 3H40A 4HUEA 2YNIA 3WNEA 3RBDA 4B9TA 3HPGA 1BGXT 1KHWA 3D45A 5E41A 4OGEA 4OLBA 4M3WA 4CEZA 3HYFA 3HVAA 3RMCA 1BQMB 4FCYA 4FZZA 3FFIB 2E9RX 4IG0A 2EHGA 3NF7A 4ZTJA 2UVVA 2O4GA
chains in the Genus database with same CATH superfamily
1TAQA 4H5RA 3K9JA 3KHYA 1YVFA 4LF6K 1BISA 1FFSB 1TK0A 4MTPA 2XMAA 2VD3A 4YHHK 4Q5VA 3TAMA 3UE5A 3Q8PB 2WSCC 3MAQA 4NEYA 3T5LA 3C8YA 5AXKA 3PYFA 4JI1J 2UV8G 3QO9B 4C1NI 1EHWA 2QL9B 4ZPAA 2OPSB 4NI2B 1M5PC 3D2EB 2JFDA 1Z05A 5KFLA 2QXFA 4HKQA 1WHVA 1MWKA 1UVMA 1IKYA 4GKKF 3ZSYA 3OYJA 5KRSA 3TQ1A 2IHR1 2XSJB 4KHNA 2GMHA 4BC2A 1TL5A 1ZTWA 4J9LA 4I9QA 1N48A 2OELA 2GIRA 3LWLA 5HMYA 3NF8A 2C3MA 3B82A 3DLKB 3UW1A 1VJWA 2HG4A 2CPHA 2CWXA 3VAHA 3K59A 5DGBA 2YHWA 2YV0X 4DQSA 2F1FA 4DUZK 3O9QA 4RO0A 3FK4A 1ZOTA 4F2RA 1G6BA 3OTBA 3KG4A 3UNYA 4GW6A 3T7ZA 3CCMN 3U1LA 5IQ6A 4K0KK 1CQMA 4LF5F 2MLXA 3I55S 1TKTA 3NFAA 4JI2F 1ACMB 3PZPA 3NWRA 5F0WA 1J5EJ 4GKJF 3ZT0A 4DUYF 3H98A 1W2BR 4CCHA 3NDKA 4RW9B 3T19A 4DTRA 4MKAA 2OFHX 4LFAJ 2RQKA 4HWIA 1R59O 2R7QA 1EX8A 3AVLA 3BKTA 2ATQA 3S9HA 2EC2A 1FE0A 1NMNA 3MXIA 2DNOA 5LMNF 4ED2A 1M5SA 2WW4A 3W66A 1CS4B 3UDCA 3BB5A 3VEZA 3MD1A 1TYQB 2ZBIA 3FZ2A 2VGMA 3CJ3A 3PO5A 3IBFB 5EWFA 3H25A 1FJCA 4CESA 5L1LA 2GMLA 1HHQA 2XNQA 1WC6A 2OPPB 3ZZYA 3PNIA 2P51A 2K3KA 3QPIA 4GVBB 1M5OC 2MDAA 4QOZB 2P9IA 4HI1A 4LRAA 4OYBA 4PWDB 4E3SA 1FD2A 1TU0B 2OTLN 3AD9C 2V51B 1KTQA 4U67Q 1VHFA 1TV6A 3TUPA 2HBJA 2VG6B 5LOQA 5FPMA 1A9NB 1NPKA 2GQ2A 4WIQA 4Y00A 2NRZA 1VJQA 4JB8B 2IYGA 4LFBK 3PFOA 2LXIA 9RUBA 1NNEA 4NXNJ 2B56A 4OJRA 4DU8A 2VCPA 2E7XA 1U8WA 4CLYA 3PR4A 1HI0P 2M8HA 2OP5A 1JLQA 1JLCA 5I3UB 1S0VA 3DXKA 5ETNA 2LU1A 2WAQD 3MM9B 1MW7A 4F50A 1KFDA 1F9HA 3NOCA 2IBKA 2DJWA 2GGPA 4N8NA 2FQQB 1RWNB 1N33J 1ASWA 4OFZA 2AF6A 1HA1A 2DNRA 1ZYQA 3P5BP 2P6TA 3ICLA 1IO2A 1OKJA 2HGNA 4BR0A 3C6TA 2R7WA 3VALA 2YKNA 4NYOA 1BA0A 2E5LF 3ILOA 1QHAA 3N5FA 4K5RA 1PJ6A 2GO9A 1S9EB 3TZYA 4CYUB 3ZSVA 1YJTA 2CQIA 1FX4A 3HF5A 2M3DA 4HHTA 3I82A 2BXJA 4ECZA 1D0EA 1SJQA 5AQHA 3SFGA 1X9MA 3CERA 4IOCQ 1EARA 5FRMA 1VQ6S 3AVMA 5B0DA 1GMWD 5T41A 3NBPA 1RTHA 1RTIB 2VOOA 4H0VB 4ZLPA 5HBMA 4BRFA 2GX8A 2R2SA 5FJ4A 3G8TA 1B64A 4GC6A 4CGIA 2HMIA 4KRWA 1ATSA 4OI3A 3QJPA 2N4DA 3UKRA 4AM6A 4NMXA 1S22A 4C8OA 2KM8C 1XR7A 1OH8A 4JI5J 1HBNB 2VG7B 3WC0A 2UUWA 3PTWA 2NREA 2QO3A 3IFRA 1IBKJ 1LWEB 1IG9A 3Q89A 2LXUA 2KLAA 2ERRA 6FD1A 5THWA 1G4CA 5HANA 5AQXA 1Q7YO 4B1VA 4CNYA 1S6UA 1LAVA 1SC4B 2KRRA 4ID1A 3T69A 2QKKA 1BLUA 3UIQA 3EGVA 5D78A 2A5XA 2RS8A 1QE1A 3MR2A 3C6UB 1F3VA 1WSIA 3ZSZA 1BC6A 1O5JA 3C15A 3THYB 3L6QA 3SQGA 3BREA 2NXUA 3QSYB 2KL8A 3WNGA 1EJ7L 2QXLA 2B6AB 4AHCA 4BRKA 3P39A 4JKHA 1NHUA 1KLMA 5J2PA 2BACA 1C0TB 2AEMA 4ZPBA 4DLGA 5J2MA 2CQ0A 3O2IA 3PDNA 2UVRA 1ZAXA 3GJRB 2QA2A 2DNMA 2JLGA 1NPPA 1S9FA 2EVZA 1WSHA 5IT0A 2W2MP 2KXHA 4A4JA 1KQFB 2Z30B 1XNQJ 3VZHA 2V9KA 2RHKA 4H0OA 1HW9A 2HK3A 4IDKA 3MX2A 4FJ8A 2BQ3A 1IV0A 1ZBIA 3EY1A 4YNQA 4H0PA 1NOYA 4LF4F 4I0WA 4RW6B 3SCKE 4HTUA 2X78A 4AYBD 1C1BA 2HF3A 3CCJN 4A2BA 2W2QP 2LVWA 1XMOJ 3V6JA 3ZTQA 2XMVA 4HACA 1RBUA 1YI2S 4OYIA 2XRIA 5BPLA 3BBBA 3MM6B 4EAHD 2C3YA 3EZUA 1H72C 4LC9B 1DY3A 2E88A 4KGMA 1W2IA 5HJYA 1VSMA 2ZH1A 4FLZA 1SBRA 1Z6RA 1S7HA 4IO8A 4ZVUB 1S4FA 3LP2B 4YOXA 1RT2A 2R8KA 3AJDA 4FBTA 2H3EB 4FNHA 3QIPA 4BRPA 3I9ZA 4DV1K 2BRLA 1YJNN 2GO8A 2G8WA 1FXXA 2V52B 2B8QA 2XHCA 4CHNA 4YY3K 3I87A 5B0AA 3VEVA 3H3NO 1SV5A 3CB4A 1R8AA 4JK8A 2J9DE 3EXCX 4X62J 1YIJN 4W5TA 1VQMS 5C25B 2ZNZA 4BACA 2XWXA 3H2LA 3WQPA 2YY3A 3LTOA 2MQQA 5CZXA 3OR2B 2CPFA 3DYAA 2ZWHA 4F0MA 4IOXA 3QETA 4C11A 4DR1J 4X2BA 5M1FA 4DR7J 2A41A 4QOTA 3FQKA 4OGCA 2M2BA 3OBIA 4B8CA 4Z4IA 3N6MA 4R0EA 5KFEA 1U6FA 4BDPA 3B6BA 2XO7A 3BR9A 4E7HA 4ZN3A 4OPHA 3NL0A 2DPNA 4OLAA 2R7OA 3MI7X 2MKHA 5EXWA 1XI1A 4OLOA 4DR6J 4ES1A 1YJ9S 1L3VA 3H45C 3A5NC 1F5BA 1FWPA 2Y0BB 4Q44A 5HAOA 3NMRA 1RBRA 4IG3A 2XY5A 4LREA 1HBUB 1U0SA 2X1AA 4QYRA 2J0SD 5D4OA 4RLEA 3MURP 4OPKA 2DNZA 4RW4B 3ZT4A 4DJBA 2V9WA 2M52A 4CJQA 3ENWA 3G6XA 1OY9A 2YWKA 4MT1A 3DLHA 2XGQA 3I31A 2H3GX 2H51B 3HDSA 4M5IA 3WX4A 3J7YP 4DV0K 3U1MA 5GIPA 2G8UA 4ID8A 1Y64A 2XGPA 5AXMA 3TW0A 4UY8O 1QVGM 5HOOA 1D9FA 2UXDJ 1LAWA 1FKPA 4X4QA 2C2NA 1NJXA 3PIOQ 3DM2A 1Q82O 3RR8A 2PSZA 2UXBK 2V8HA 4KHMA 5HQLA 5KT3A 5E3RA 1WLJA 2LQBA 3MMJA 1HJOA 5LL6d 3LM9A 4Y1DA 4ECRA 1XNRF 3CHWA 3H2UB 3DLGA 4UOCA 1NGAA 3OTOF 1UP1A 3SSRA 4Q0BA 5LY3A 2CPZA 3CJCA 2P9UA 2YNFA 1ASVA 3FCVA 3QRRA 3TTCA 4CECA 1R8PA 2ADBA 2CYYA 4YDUC 1GX6A 5K14A 4FNIA 4FJGA 3FEXB 2E29A 3PKMA 4IFEA 4FJ5A 2L41A 4RUHA 3QJJA 3M3ZA 3VCDA 3DGPB 4TY8A 1G99A 1QVGR 1OSCA 4HTJA 1RAFB 4DN9A 1HHSA 4PG7A 4A62A 2YCHA 3Q8RB 3JS9A 4I6MA 3S8SA 4NXMK 3J81U 3CEDA 2G8VA 2VL1A 4GV3A 1L3SA 2UUBJ 5C2DA 4B02A 2EBGA 5D0HA 2AW0A 1NM1A 4HI2A 5IZHA 1UA1A 4NCGB 3NGKA 4LD0A 3AAPA 1VQ6N 1W25A 3KMSA 4KT0C 3CM6A 2HEKA 3LANA 5AFUA 3E9LA 2PO4A 4JI0J 5ETKA 2HS4A 4I6YA 3T1YJ 2HQCA 4AL6A 4CZFA 3AA8A 4ZVOB 2F8SA 5C2GA 3VAIA 4BRLA 4CI6A 2JJ4D 3VQBA 2F9DA 3TJAA 1TKZB 3KJFB 5I9EB 2NYIA 5H9EK 1J54A 4CDIA 5JXSA 1F5AA 2R8IA 2UUCF 3IWXA 2PD1A 4ZPCA 4KBIA 1HBMA 2FLOA 3M8QA 4I67A 1SH2A 3CULA 1YAGA 1PKUA 1BA1A 1HPZB 1Q78A 4FYWB 3MMBB 3T9NA 4R5PA 4B3OA 1S9GB 4NPOA 5BYRA 5IS2A 4DB3A 4B17A 1RWUA 4ZVSB 3KK3B 2JL9A 4FO0A 4JI3F 3M1VA 3MAAB 3TTDA 1HJRA 3QEXA 5AJ3J 2ZJPL 2E2PA 4PQAA 4FZVA 2CQPA 4MH8A 2UU9F 1LWCB 3J8AA 2DBBA 2EEYA 2NR0A 3OYAA 2DNNA 2QFIA 5AQMA 2EFQA 2IY5B 3HO1A 3BUZB 1VBKA 4OZ5A 5I3QA 3LF0A 1EP4A 2ZWPA 5AFUH 2FHJA 3AB2B 4IR1A 1LW2A 4CJ5A 4KV8B 4FLVA 1RNHA 3PV8A 1T44A 3GV8B 4L6V3 2HQFA 1B0VA 1PYSB 2HIYA 3BO3A 1NJYA 1HWKA 2OTJS 1HBOB 1YTYA 3JXUA 1NHKL 1KLNA 5T7BA 1WN7A 3RAMA 4IFYA 5LL6Z 2MZTA 4FK4A 1HX1A 4CZKA 3ULDA 4QWCA 3KWMA 2WSEC 3K5NA 4XAKA 3MPVA 1SKWA 1BE4A 2E1MC 3GE9A 2YWWA 1X4AA 5CYQB 2DCUB 4DX5A 1QTNB 2D69A 2C2EA 4DOZA 1ZM4A 2VASA 1S6PA 3O9UA 3UDLA 3UKUB 2X7IA 1UZDA 2QYCA 3IKMA 3MMAA 4JI1F 4OI2A 3MM7B 3WDOA 2P5OA 1NXIA 2H65B 3GFZA 1NSPA 4AXJA 2JFKA 3OYGA 4ZMMA 4NLOA 3QNOA 1VQMN 3JAMU 2BE2A 4CZJA 3BP8A 2JNJA 2V7YA 5A6PA 3SUOA 4GMKA 3G10A 5I42B 2HRTA 4WFNQ 4CLZA 4MYTA 2R7XA 5JMNA 1VBXA 2GWJA 2ZM6K 2ALZA 4YR3A 2LQ9A 3TNVA 3NGIA 4DU3A 1LEOA 3HSJA 3KK2B 2XWYA 2EFPA 2B5JB 1NWKA 2Y1JA 4ELTA 4OHYA 2B0GA 3DHWC 2KO1A 4PG6A 1YJ9N 2ATCB 1UWBB 4CEDA 2O3DA 1T6CA 4CJ4A 2HHTA 1REVB 2K7KA 2APOA 2XCPA 5AE1A 3EGZA 4WF9Q 4Y1CA 5AQIA 2OPRA 1FRLA 1NG9A 3R6MA 2AD9A 2A10A 3BGFA 2W2OP 5D4LA 1A5XA 3ID8A 3QT8A 5DQGA 3PRDA 3PFEA 4WWSA 4PUOA 3OLAA 3IAYA 3SXLA 1QQCA 4B1UB 3U3GA 2HFOA 1VQ7N 3C16B 4FZYA 4I6WA 1DQ9A 3THPA 3H4BA 2FY8A 1JLBA 1VSDA 1I3OB 2Z8QA 2WONB 4XDCA 1HQEA 4K4WA 2QT7A 1M1GA 1DAXA 4JNEA 4LFAF 2XQCA 3G6ES 4KTWA 4KSEB 3ENAA 2H5IB 1KAYA 2MY8A 2M9KA 4QR0A 3THTA 3HL8A 3MMCA 5C24B 1WG5A 1MMLA 5KFRA 3SEOA 4FKXA 1Q53A 3I5CA 2G0CA 4M94A 4CTAA 2D3ZA 1MLAA 1N5YA 2AJ1A 1FTCA 1J27A 4PG8A 1CZBA 3CPWM 2QE5A 4CNZA 4V19J 4O3QA 3IXQA 1FE4A 3W7BA 5KFKA 3CJKA 4EBDA 3OVSA 4Q8FA 5JVGL 4FYVB 2MKIA 1YVUA 3HOSA 5J1NA 5K9FA 2IVYA 5EWGA 3UCGA 1FXRA 1VLYA 1YRXA 3L7UA 3MDFA 4DF4A 4YB6A 2MGZA 4O5FA 4E7LA 3MN5A 3LPTA 2CKWA 4ELUA 1YT3A 2ZH9A 4URGA 1JNZB 3SUPA 4ILRA 4DZDA 2A18A 3O5TB 2WOMB 4HH0A 1REGX 5C42A 4HH1A 4TKTA 4O4GB 1R0BG 2VBYA 2VQEJ 4NXNF 2O8DB 2CDQA 2ADCA 4EP4A 1OQ6A 1B4SA 4EUVA 5FDLA 1C1BB 4HVZA 2HNDA 3FKBA 3CPWR 3S41A 3VEWA 3VGKA 3M8PA 1RBLA 5HL7Q 4UY8T 4H4KA 4FWRA 5AQJA 5HATA 4RNOA 4B9UA 2J4RA 3G2XA 1C0GA 3AXMA 3MM5A 3TABA 3TYTA 2ACYA 2AWZA 3NGUA 1IR0A 3S7RA 3HHNB 2PE8A 1XC3A 4DV3J 1VRTA 4I64A 5KQ8A 4FL9A 4Y2IA 2X6SA 2HSTA 1DT9A 5A0YB 5H1SQ 2E7WA 2FY1A 2FB0A 1Y3KA 1J53A 3HSCA 4IOBA 3K5MA 5FROA 1P9QC 2K7JA 1F5CA 3HP9A 2Q0RA 4X65J 2NQPA 4M8LA 4M3RA 4AL5A 3PLAA 2HBMA 5KG1A 3MM8A 1OY6A 2ZNYA 4E8UA 1B3TA 1TTHB 1DLOA 3BN7A 4M5JA 2DY4A 1XMQK 4A46A 5CXTA 1HNIB 1FWKA 4Y0FA 3VTHA 4GO7X 1Y00A 3BF1A 4JI5F 3BQ1A 2E4LA 5AQTA 3DRPA 5DO2A 1OYDA 1IBKF 5F8GA 5BPMA 3R6GB 1WF2A 3QGIA 4CBWA 5JICA 4OZLA 1T02A 3A8EA 3VQ4A 1NPRA 5DETA 4LJMA 1WOSA 3CF5L 2VPZB 4IFVB 5B08A 1LNQA 2XMJA 1R89A 1X3NA 4PY5A 3HSTB 4FYXB 2JVRA 1MU2B 2V6AA 3MPDA 3KWGA 3AA5X 2DGTA 1XQIA 4E1MA 3H1VX 3K9KA 3LALA 1GH8A 2ITGA 2HHVA 4O23A 5IOLA 4GNIA 2HF4A 5HROB 3BH6B 2HLUA 2OPQA 3KHLA 1FRMA 1OSDA 1RAAB 3W60A 4GKKK 3BSNA 4DPXA 5KT2A 1HNZK 1CG2A 5D4NA 1U2VB 1VGYA 2E5GA 3M30A 2K8GA 4X64J 4BRNA 1I39A 4KQZA 3D67A 3GJTB 4NCBA 2QLWA 2ZZTA 4M5HA 3W1YC 1LWFB 3U7JA 3I56N 3GOIA 3T6BA 5KFFA 4LF7F 1QSSA 3R27A 5F8JA 4RBTA 4ZVFA 3LM2A 2DR6A 4IO9L 4CJWA 1JLGA 4O44B 4P52A 1ICEB 5DZ7A 2VJVA 4J90A 2FVPA 2VKRA 4KB7A 4Z4FA 5ELZA 2OMOA 4G65A 1CSJA 2KKHA 3KHGA 5KGXA 4JKAA 4KO0A 4LF5K 5EDWA 3AO2A 1S0NA 3IWLA 1NDCA 4JI2K 3UVJA 4XH1A 2YNGA 3FZLA 3IRXB 4GKJK 4DUYK 2DFFA 2OCEA 4H5TA 2COLA 3O1LA 4ZPDA 2W8KA 1YWXA 4LSLA 3OTEA 3MXMA 1X4EA 2J9CA 3A3PB 4DMNA 1KAXA 3ZZZA 5LMNK 4M5DB 3AA2A 2ROPA 1VQ9S 1Z1ZA 2MPUA 2N4CA 3SPYA 2F9WA 1FVSA 1RYRA 1LCUA 3FQLA 1HQUB 5AQNA 2FC8A 3FZBA 3NH2A 2KKZA 4ED4A 4DR1F 4DV6J 4DPUA 3R1XA 3QNWB 3FEZA 4BRAA 1EQ0A 2YKMA 4DV4J 2XY8A 4RTFD 4H4MB 2J6SA 4OYXA 3BGUA 3R5AA 3CCQN 2P9SB 3IS9B 2LDYA 4J9PA 4F3TA 2J9EA 2NZ4A 2KI2A 5BYQA 2VC0A 5KG6A 2P5VA 3VENA 1IBMJ 4CO3A 3QGHA 1P27B 4QIEA 4PHTX 1CVJA 3T9ZA 2IGIA 1F3FA 3DOKA 4M63C 3HPOA 3ALYA 3IGNA 4LFCJ 3M6UA 4WFBQ 3AVBA 3M32B 2VBZA 3JSMA 5J2QB 4KIAA 4WE1B 2W4CA 2KT3A 5ETRA 2ZH8A 3BO2A 5CZVA 1S6OA 3VVUA 3ZTRA 5BPNA 4DV2J 4DSLA 5AQOA 3W62A 4JEPA 3PW5A 3EZWA 2QK9A 2XMKA 2R8GA 1T6DA 5KFAA 2B51A 4DR2J 1QQMA 3C94A 1S97A 3ET6B 2ZBRA 3D5MA 3DRSB 3HHDA 3HVTB 4J9RA 2E5LK 1RB0A 4QCLA 3MR7A 2KT2A 1VQ5S 3GB0A 3DDKA 4ED3A 2RQCA 4JV0A 3SK3A 4Z0UA 4CRJA 1UPMB 3ULHA 4QPTA 3P38A 1RGIA 4KFBA 3Q83A 4ZLNA 4KTQA 4Y3CA 3BQ0A 4KH0B 4K2XA 2ALYB 2LEBA 3FBBA 5L9XA 3J7AP 4IFYB 1EWQA 1FKOA 3CPEA 4NYFA 2P9GA 3RB6A 2H54B 2HFNA 3NS7B 3W8GA 3ZZUA 1WEYA 4XPCA 4WZQA 3NGZA 3BPDA 3VQ7A 1N6QB 4H0TB 1VSHA 4HR2A 3SCIE 4CH0S 2ZJQQ 3P4IA 3SAGA 4DL6A 4MKVA 4LR7A 4F2SA 3O4NA 3BEGB 3V1QA 5IM0A 1T9VA 2HNYA 1FXLA 2B4OA 1C0MA 1WSEA 2Q79A 2XULA 1W97L 1RWKB 5CABA 3Q7CA 1RT4A 4BRCA 4CFCA 1XWLA 2HAIA 2FLNA 3PX6A 4K2JA 2M4MA 3IBCB 3MECA 4O55A 1Q9XA 4M5NA 2CGKA 1OO0B 4HCCA 4FJKA 1TK8A 2ZOGA 1OYEA 4EGLA 4JI0F 4RJVA 4IH7A 4E7IA 4A61A 5F8HA 3HT3A 3PG9A 3CIPA 1GEHA 4LRBA 4KPCA 4W92B 5KAKA 4JHDA 3GONA 5DQIA 3CJQA 2PMHA 4A8XA 2V4RA 2P9KB 4ECQA 2AEJA 5BR9A 3ITHB 3ETOA 4XK8C 4CJRA 1IBLJ 3TI0A 4G3IA 1IM6A 3QZ7A 1UVJA 4CZIA 1UVKA 4GVEA 4FVCA 2NRRA 4FYYB 4LF4K 2HZAA 2LQJA 5HLFA 4PRFA 4CZCA 4JD2B 4IOAL 3TRGA 4KYZA 2DXEA 3EKUA 3CCVN 4FVUA 2LCWA 2RQ4A 2IAJB 2BM1A 4JKCA 2EBEA 4EU0A 3ISND 1UPPA 4JN4A 3O8MA 1YSJA 3CCUN 4OZ1A 5AJ3F 4HDHA 4J91A 2B4UA 3DAWA 2OD6A 3ZEUB 4CEZA 4FZZA 3LGMA 4WQ5C 1JK9B 2EHGA 1ULRA 5E84A 3VAFA 3NF7A 3MUMP 3VEXA 3UI3A 1S59A 4F36A 3LDQA 3MFIA 4CHOA 2YPYA 4QWDA 3W5YA 2CQGA 3POTB 4I2PA 3UNGC 3OL8A 2NS1B 4ICLB 1HMVB 1Q4RA 4ITSA 2MB0B 4YOVA 5LMUJ 4MIAA 1Q79A 1NK5A 1FJGJ 3L7OA 1ZZFA 4USWA 4JKGB 2Y9HA 3I5AA 1GT8A 4FM0A 3HKZD 3O1BA 2V68A 2D4WA 3HI9A 4J2AA 4WFZA 3L2WA 2P9LA 4I7FA 2F4VJ 2EI5A 5L1KA 4N8OA 2IC3A 5HQ8A 2HGLA 3V4IB 1RBSA 1AZSB 1RT1B 3AVJA 3SJHA 3D2FA 4A5BA 2R7VA 4KGXB 2YHAA 5ETLA 5AQKA 4M1KA 4BQZA 2F8HA 3ZX2A 1R43A 4NRTA 3FRYA 3NVMA 4WYBA 1IM4A 2NPIA 1EXQA 1HHTP 1U24A 5DG9A 1EQMA 4OHVA 2K1RB 5B7WA 2PC6A 1KCFA 1N32K 3TA0A 3TP2A 1FRXA 2HNDB 1UFWA 3OQ2A 4IH6A 3E51A 1RAGB 3G71S 1A5VA 4CLLA 2MYFA 3O08A 3TAEA 2FHKA 2W2NP 5GMEA 4JUZA 1T0TV 1K73T 3EKSA 3D9BA 5LJWA 1VQYA 2MQPA 3G96A 2YNHA 4DN0A 4PXBA 5AQQA 3W2VA 2P5GA 2OZSA 1LW0A 3MEEB 3THXB 2GVDB 3G6YA 1VRUB 2GWKA 2NNWA 2V7ZA 4NLDA 4QR2A 2QTWA 4CF8A 1UJ4A 5KPZA 5E26A 3K8VA 3KNGA 4DTUA 3QLHA 2LMIA 4DR5J 4BR4A 3PACA 4HLBA 1B0TA 4LF9J 1S1UB 4QS7A 4AHTA 2KFNA 3BGRA 2P1JA 2WTUA 2RKIA 5IV3A 2CNLB 1SL1A 4UUXA 3OTOK 3F44A 1R3NA 1X5OA 1NGCA 3EM1A 4FJLA 4OI0A 3U02A 5F2RA 3FZMA 4LSNB 1BU6O 2RD5C 4Z4HA 2MXYA 4NLRA 1TFWA 3CMEN 5BRDA 4AQYK 4YHHJ 1BCOA 3M9MB 4ZHRB 4PG4A 3CCSS 2CADA 1QAYA 3PKYA 2VA2A 5D3GA 4ZP7A 3CD6N 3SLCA 4Q2MA 3JSRA 3KUEA 5DG8A 3QEPA 4NLQA 1HRHA 4I69A 2BMBA 1QHTA 3VAKA 1IKVA 3TVZA 2ASJA 3ZETA 4O3OA 5A8WA 3U1NA 3KUGA 5KFVA 3SSSA 1CULB 5A76A 2PBDA 4YOTA 3S6EA 4MYUA 4O3RA 4CHYA 2RQMA 3UD4P 1NB2A 2CUYA 4L8RB 3MEGB 3A5LC 1U0HA 5HRNA 3A12A 1TKXA 1XHZA 4F3MA 4Z2XA 2WZ1A 1OVQA 1WAJA 4DUZJ 2PDAA 1IKWB 3EGWB 1RWWB 2VQEF 2B9YA 1DZ5A 2C2MB 2C22A 2DFHA 1X0PA 4E1NA 3UN5A 2NLWA 2JSXA 1AA1B 4K0KJ 2VB6A 3AVNA 4LR8A 2UUCK 2QWLA 2V8DA 3A8KA 3GJSB 1IKXB 1HYZA 3HCXA 3ZX3A 3ATVA 5I3PA 4CO4A 3CC4N 3C7NA 3MXHP 1VSIA 5DM6Q 1RWOB 3GYXB 1NK0A 3D0PA 1GLJO 5IFMA 4LRCA 4JV5K 1AROP 4H4OB 3V4MA 4EO6A 4EP5A 3IMXA 3DHXA 1YHQS 4E89A 1C2PA 2N3OA 5FIIA 2YKQA 1N54B 3MCAB 4QR1A 3PW2A 3BZKA 2IMOA 4MFBB 3GTYX 1TMJA 5JLFA 2UU9K 4EEYA 4NRUA 4DCJB 3O3FA 4RW8B 2CZVC 3TWHA 2U1AA 3T1HF 3VA0A 2AZ1A 3CC2S 3RSEA 4JI7F 4JOUA 2XSFA 4CJUA 1DARA 4XH4A 3Q0AA 1RT3A 3O1WA 3NGRA 1HWIA 1RKIA 1Z25A 4TSXA 4C23A 2EK6A 4KB0A 2IRUA 3C6AA 2W4DA 5CAAA 2ZUAA 3TAPA 2HRYA 3EICA 3CI5A 3FSIA 1X1PA 4KY3A 3CQ8A 2VFTA 1JCGA 3N28A 4X65F 1JLFB 1O51A 1BO5O 2KZZA 3ZSRA 2A3JA 5CY4A 1GQEA 1ZM3A 1WWHA 1AW0A 4CZHA 4QWAA 1RE1B 2FHMA 2L9DA 3P96A 3QMQA 4ZIVA 5DLGA 3CJRA 3L3CA 2G1DA 1LWXA 4EIAA 3DOMA 4G1QB 1H2UX 1VS3A 4OX8A 2M0GB 4DV5J 4LFBJ 1QUVA 2OEMA 3NAEA 4AH9A 2NRVA 2GUPA 1EO1A 3KWIA 2CQ3A 4QIWD 5D0RA 3AOCA 5KT5A 2FD2A 3HHLB 2R2UA 3ZCMA 1TL3B 2Y1IA 3P1GA 1S6QB 3GV7B 2QMXA 3THWB 3OVBA 3D1OA 5KFCA 2EC0A 5GADI 5E3AA 3UE2A 2R4FA 5KOWA 1F9EB 4G9ZA 1VQNS 1NO8A 4RU9A 2AX0A 2RHQB 2AYMA 4PYAA 1S1VB 3ULEB 3L2RA 1RLDA 1JJ2R 3KJVA 4X4TA 4HDGA 3EJMA 5B0EA 4CLSA 1VLOA 1RADB 1FJEB 1AT1B 2ZH4A 4GC7A 1XJWB 4Q7AA 4YS2A 1Q5YA 3OTDA 4C3LA 2DGQA 4NA1A 3CDUA 2P9CA 2BJ3A 5T7LB 1Q0NA 3AD7C 4HTLA 3SZ2A 3QEVA 2BKOA 3FFIA 2QLBB 4QU7A 4ZA1A 1UMJA 4WFAQ 1RDAA 2ZJRQ 4BRHA 1WSGA 1X60A 3F41A 4X64F 2QSFA 1D8ZA 2GA7A 2CJKA 4PWWA 3SQ1A 3H5SA 5GIOA 3RGIA 3KLGB 5HVFA 1J9AA 1L5UA 3M9NB 3OHBA 1LK7A 4J9KA 4DS4A 1S48A 3K5LA 1CJUB 1WJ9A 5EGYA 4I56A 3QO9A 1FJ7A 1OS5A 1M5KC 2HW3A 4IJAA 2KDOA 5H9FK 3QIDA 2OPSA 4NI2A 2HFSA 4FSVA 1JJCB 1S1TB 3D2EA 2BRKA 4BHQA 2I0XA 4DBQA 3HZ6A 4OHWA 1SQGA 5TKWA 3Q23A 3KG1A 2O8BB 1E6VB 2X1FA 2M5YA 5K8MA 3CJ0A 4P2SA 3WQUA 4USJC 3K2PA 2FF6A 4ED5A 2XSJA 1SCJB 3G4SS 3W8PA 2OHDA 1VQPS 1ZZNA 4TU9A 1Z2LA 4URQU 4IDHA 2L3MA 4UY85 5ETVA 2LQ5A 3I4PA 3DLKA 2KHDA 1HIYA 5IC4B 4BREA 5CH7B 2O8EB 4CLTA 4C1NK 5HP1B 3FNNA 1PCAA 3ZT3A 1CC8A 3RAXA 4B3MJ 1FKAF 4OQJA 5GAEU 4DV4F 5DZ6A 4CHZA 1T9UA 4OYZA 1X4BA 1UJ5A 3TSPA 2GHVC 4C3MA 2ZD1B 5BJRA 2D9OA 3T5JA 2IJFA 2ZZMA 2OMLA 1NZAA 4DHYA 3K57A 2QMUB 2NUUG 1V4TA 1IBMF 2HHHK 4ED7A 3A5OC 5RUBA 5AQPA 4RW9A 1JKHB 3L8BA 4ZVPB 2KW4A 5LXRA 3LP1B 4CT9A 4K4VA 4NXNK 3GP9A 5KFIA 1FHTA 1DFDA 1CS4A 2W9BB 1WACA 3DU6A 1TYQA 2CGJA 1X9JA 3M8RA 4KHPK 3LZJA 5IQQA 3CJSA 2MJUA 2OPPA 3E01B 4USHA 4NL5A 4OO1J 4PZVA 4GVBA 3OUYB 2DB1A 4DTMA 5D6GA 4EBEA 4IJNA 2AZ3A 4PWDA 2JZ5A 5ETOA 4YY3J 1ESVA 2AYEA 3CIZA 3CC7N 3MUVP 1NU4A 1BXNA 4OJGA 2VG6A 4OPAA 2H48B 5E3QA 3ENBA 2DEJA 5EWEA 2NXEA 4RU2A 1EKEA 4KH1B 4JI4J 3OXFA 3V9ZA 4E7JA 3PEHA 4B1YB 1KXPA 4UTGA 3KK1B 1Z2ZA 2JGUA 3N0VA 7FD1A 5E5NA 4UF4A 5F8IA 3AVAA 4DFJA 1RJJA 2LKZA 3CVKA 2GUIA 5I3UA 4W5OA 3W2WA 3R2DJ 2AGOA 1WEXA 3MM9A 4I7FB 4FWSA 2YKAA 1WI8A 1H7XA 4AHUA 3L4QA 2RDDA 3FVYA 3AAQA 4QAGA 1DKGD 1Z26A 4PCQA 2V2VA 3NMUA 3AOBA 4LR9A 4EYHB 4U7BA 5BRHA 2ZDPA 2XZTB 2XI2A 3QESA 2VG5A 4OV6A 2JVOA 4JI5K 1K0VA 4BVOA 1FT8A 2PZSA 1YBTA 5B0BA 4MK9A 3WC2A 4IRDA 3EMTA 1S9EA 4CYUA 3Q22A 3VF2A 4YOWA 4CZEA 3AB4B 1HR0F 3AVIA 4RNHA 3LWMA 2QRRA 3PSFA 1FDDA 3VAMA 2G8FA 3G8SA 4PXEA 4ZKAA 3F73A 4BROA 4YDDB 2G2ZA 2VH7A 1WF1A 4R0JA 1IQZA 2RUSA 1UWAA 1TUUA 1RTIA 2A1BA 4K8XA 3WT0A 1RU1A 4DTOA 1E3MA 1Z4UA 2ZBQA 4BG9A 1WSRA 3ZLJA 4QS8A 2UXBJ 3Q8SB 4RX6A 4AM7A 1FCAA 4NWBA 3N5BA 2F7VA 4LQ9A 2NZCA 3MWBA 2HHWA 3WIVA 3NEKA 5E2QA 3DOLA 3GU0A 2QWQA 1IBLF 1XQSC 1HBNA 3GFXA 2E2NA 1T11A 3H42A 2QGFB 3WX8A 1MNEA 4TVAB 1LWEA 3OBYA 1KQKA 4JI6K 2ZOMA 2F8EX 1VQNN 4DL3A 4B1ZA 2RRAA 2HBYB 5LJ5Y 2J9DA 4LF7K 3BGRB 1WEZA 2FTRA 4CF0A 3THVA 4FLYA 2FBTA 2KT5A 2X1BA 1V5VA 1JL2A 3VQ5A 4B9SA 3C6UA 1RWPB 3AVHA 3CCMS 3OS1A 1F60B 3OSNA 8RUCA 2E6LA 3THYA 4W5NA 1JXLA 2IVNA 4I4BA 2HOEA 4NXMJ 2B6AA 2OZMA 4EHTA 4FLWA 3LQVA 4O3NA 3IFEA 4FJJA 1C0TA 1F1BB 4DV7J 1BQNB 1P90A 4L3NA 3M9OB 3KLHB 1XMBA 1VQKN 3RYLA 1BG3A 4N77A 4GMJB 2LXFA 4HHJA 3K8WA 4LF1A 3WIUA 4F26A 3CJ8A 1G3OA 3O3GA 2WVDA 1A5WA 1JCEA 2D9PA 2GCFA 2J6UA 2UP1A 1RCXB 1FJGF 2P2CB 3DJCA 4F04B 4B3SJ 3B4DA 4CJLA 1OJ4A 4RW6A 3K0JA 2MLZA 3RMAA 4BRDA 2G1HA 3HHLC 2VBWA 2MZSA 1RDCA 2C3UA 3PIPL 4H8KA 1GFWB 4CEFA 3MM6A 4L76A 2FZGB 4A8OA 3O3LA 2OTLS 1S7IA 5GADU 1QM9A 4O3SA 2WW8A 2G8HA 2XYPB 4C6AA 3LP2A 2X1GA 3QBXA 1ZETA 1Y5IB 1U1MA 2B4PA 2Y8YA 2SXLA 2RU9A 3G4SN 3Q8YA 2DR8A 2ZHBA 4WYLA 4ECWA 2E5HA 2A42A 5GAEP 4HEA9 3MGJA 3U8XA 4FW2A 2LP4A 2YQ0A 3W3DA 2V4JB 4DL4A 1RBVA 2F7TA 2FJXA 1VHXA 4DQ8A 1MN9A 3G25A 4U7UD 5C25A 1QQOA 3HJFA 4IWVA 1S5ZA 2AJ4A 3CT9A 4DPTA 2ZH6A 3OR2A 1SKSA 2FXUA 4MIWA 1URNA 3OR1B 2VGNA 3HZGA 4PAAA 4ISFA 2QWMA 4G1IA 3VEYA 3CFPA 3OFFA 4YR2A 1NJZA 4AF1A 1GLDG 1SI9A 2IRXA 4CI0B 5E0OA 2YHXA 3AARA 4CJVA 3OS2A 2GAGC 3L3VA 2MJNA 2GV1A 2MSSA 1KRPA 4HUFA 3TO8A 2R7RA 1NLKL 2MZRA 1VK8A 1S5JA 3TJ8A 2N7CA 1H74A 5JJBA 1JXVA 3CMQA 4CO0A 4OKEA 4ECYA 4F4WA 4KAIA 2C28A 2ZFHA 1F9FA 1TVRB 2KG1A 1HBUA 2MLYA 4KKOB 3M6VA 3QBWA 3T41A 2QKBA 5HVHA 4FP9A 2LECA 3OVAA 4RW4A 2YPZA 2VDIA 3D1HA 2A2CA 2QZ8A 1CBKA 4JS4A 4KH6A 4YHHF 1YJWN 5HJXA 3HHEA 2RH3A 1P8GA 3WXIA 2P9EA 2W9CB 1I94J 3UO0A 1ITGA 2CQ4A 1WG4A 3M8WA 3HD1A 2CH6A 1PAEX 3MWTA 5GAGP 2RIJA 1ZBLA 2XHWA 5EN1A 1ATNA 1TAUA 1D5AA 4ZOSA 2AP6A 1U1NA 2C2OB 2DNLA 2FJAB 2EW9A 2YQ3A 1EKSA 3SPZA 3CJAA 4OVLA 3P4UB 2ZM6J 4HL9A 4M3TA 1HLUA 1DGKN 3QIOA 3L2VA 4K4SA 1WC0A 4YMEA 4W4MA 3P5JA 3KUHA 4ED0A 3CIMA 4WCEQ 3PX0A 3U9DA 4C97A 2RT3A 3QSIA 1SKUB 1BOTO 3U4LA 4JI0K 3PYDA 3D6FB 2EPIA 2V94A 4ZVGA 3DLLQ 2FVRA 2V8VA 2WB1D 2L9WA 4CJ7A 2PFFB 5F0UA 2W9AA 4DUZF 2KXNB 4LSZB 2A1RA 3FGUA 4QIVA 4X4NA 3DGPA 1IG8A 3CCES 1GXUA 2KHCA 2KB2A 4L72B 3NCQA 4L75A 1RCOB 4HUGA 4O0IA 1ELOA 2POKA 4K0KF 4QIFA 1MROB 4OX6A 4PEOA 5MLCV 3HM8A 3SV3A 4K4UA 4FLUA 3PJ9A 1KEKA 2EG2A 4Y2MA 4QBUA 1UEVA 4JI8J 2JLFA 2BABA 3W5XA 3CCJS 3NY0A 4NCGA 2C2DA 2DGXA 3NH0A 4H5NA 2KVIA 3LDPA 4KHQA 1GXLA 1U45A 4FK0A 4FPBA 2DGOA 2BKNA 3L2UA 4YUDA 3SFUA 2P6SA 3FMWA 3HK2A 3V5RA 2F63A 1RT7B 2PMWA 1FXDA 4MIBA 3CFOA 3M05A 1W2BM 1OH7A 4CERA 2W40A 3H7HB 2YNIB 1YG0A 2KH9A 3QBCA 4JP8A 4ZITA 2A1SA 1Y5NB 2ATLA 3SNNA 1TKZA 1NDPA 3BGLA 1YJNS 3BJYA 2NRHA 3BKUA 4MMOA 1WDTA 1HNWJ 4J9MA 2Q1LA 2E1RA 2E2OA 5FPNA 2DKOB 3QMLA 3TSUA 3F5TA 4CIGA 2AGPA 3LO3A 2ZH7A 1DTTB 1YIJS 3VWSA 1HPZA 1SKRA 4Q2LA 2C2ZB 3GL1A 3MMBA 1OMSA 3OYEA 3PHTA 4WK3A 3ZSWA 4B3TK 3KVGA 1S9GA 3LDNA 4OLPA 2MQ8A 2QA4N 2IJNA 3KK3A 1I3AA 2BJ9A 3Q8QB 1VDHA 4K5SA 4DR4J 3UFCX 3VAGA 1PBUA 2CG4A 2NXCA 5G4DA 2YH1A 5F3TA 2QLFB 3MAAA 1CJVB 1X4GA 4DV5F 2AV5A 4N76A 2DH8A 1VQLN 1RWMB 3U27A 1S1XB 3QAEA 1KP6A 4C3KA 3PW0A 1LWCA 1WELA 3RBZA 3CNQP 1JCFA 3W9HA 2G2YA 4M45A 2LEPA 1QD1A 3RJMB 4IZ9A 1RTJB 2DEIA 3VQEA 3VF6A 2J6TA 3PEJA 3VPZA 4Q45A 1UEUA 4S0MA 4JV2A 3RG6A 1H2VZ 5F3ZA 3VTIA 1NBEB 2DGUA 4HT5A 4OIXA 4P74A 4NASA 4KV8A 1U2FA 5K20B 2F9TA 4CGDA 2FHJD 1FNMA 4X4OA 4ED8A 2P9NB 2B43A 3OJUA 3GE1A 4X66F 2FJEB 2DHXA 4U67L 1HBOA 4LBHA 4FW1A 1YKWA 2D3OR 1GTHA 4DR3J 1S3XA 1RGVA 3DRRB 2ROEA 5A8RB 4J2DA 1RLCL 2GZOA 3TZWA 1NMDA 2CQDA 2UYTA 3V9XA 2XY6A 4K8ZA 5L8RC 1BI4B 3AO1A 4IH5A 3D3BJ 3QWUA 4TY9A 2XYGB 5CYQA 3MCSA 1YRTA 3VGTA 5A8KB 2Q3SA 2HB5A 1C0UB 2J8AA 1HLWA 2O8CB 2H5EA 3CQXA 3ZT1A 3SQ4A 3BSOA 4FPAA 3UKUA 3D0GE 4WU3A 2FVQA 3MM7A 2EFGA 1CEZA 5EU7A 2V8PA 3NAHA 1FK9B 3CGIA 4OYAA 3W2WB 2AEFA 1NJIO 1EZZB 4AD6A 3SBMA 5I42A 4B1WB 3N4WA 2GVZB 1WKKA 4JYAF 2BQRA 1SAZA 4QU6A 2E7VA 4M63A 2BA9A 5KOXA 3C0BA 1U6BA 1ROFA 5DGAA 2PGCA 2VG5B 1MMDA 1UA0A 2FDNA 3KK2A 3C6HA 2HQGA 2B5JA 2BUNA 3ZO7A 4IOCL 1Q7LB 4Z7CA 4FXWA 1O8BA 1UWBA 3SAHA 4WTYA 1W7WA 4OKKA 5AXLA 3WHIA 3PW7A 2CPJA 1U7LA 1REVA 1NZ8A 3RWUA 1QJHA 1Q16B 3NNAA 1RILA 3IDHA 4CD3A 2MSTA 1Q86O 2CQBA 4GKKJ 4FJXA 3IN5A 1HNZJ 4B3MF 4CT8A 3M6XA 3O6QA 1Q18A 3DXMB 1GOBA 2MHEA 1FF2A 3LPUA 5TKYA 1GMUA 2N3LA 5E3CA 4EBCA 3TQEA 1I51B 4MDBA 2V8GA 2FZKB 5JVHQ 4BBYA 5F9NA 3C16A 3GILA 3CQYA 2KRBA 2BOAA 3A2FA 2WONA 4F25A 4WFXA 5DQHA 2LU2A 3DOLB 3EN9A 4TU8A 2AQ4A 3KG0A 2D5RA 2WVFA 3F56A 4EWTA 1RUSA 2LFVA 3PYGA 3C14B 3MR6A 5DRKA 3H5YA 3VQ6A 3V6KA 5HRRA 2IVOA 1F2HA 5C24A 4ES2A 4LF5J 3O80A 3I96A 3KHHA 4JI2J 3WQTA 4BDZA 4WKRA 4WXWA 2D0CA 2GNKA 5KT4A 2H4YB 2I9SA 4UOGA 1KKHA 2FZCB 5AE3A 3OVNA 4O0NA 3J7A1 1YGYA 4YY3F 4M3ZA 1QTMA 4YOYA 4QYZK 2IVMA 3TA2A 3VQPA 1OQ3A 3WUHA 1R0AB 3GSIA 4EHUA 3HOTA 1DQ8A 3PO4A 4P72A 3KKSA 4ZP6A 4CH7A 3ZFVA 3ZSXA 1WC3A 4JI4F 2WOMA 2NSCA 3J80Y 3T1HK 3CCEN 1QZ5A 2QMWA 3O4WA 4CEBA 4JI7K 2G8KA 4O4GA 1BIZA 4ED1A 2O8DA 3CJ2A 4X84A 5CD4H 3PRVA 3P31A 5IT9Y 3GG0A 1T05B 2CRLA 2VWBA 2QLXA 1YZ7A 4X65K 1RHJB 5HRSA 4M5KA 1HYVA 4M3XA 3ZZ0A 4I6AA 3HBTA 2C3OA 1WSJA 3B78A 3SBGA 3BSAA 5HMXA 4PKGA 4J2EA 2FHOB 2Z0GA 3H1QA 2VU5A 1XC9A 2Z2LA 5K8PA 3UPFA 4O5BA 1S77D 1KDNA 2GHWA 1M5HA 3E8OA 2P9PB 1FA0A 1U1KA 2IRYA 4YOUA 5EX0A 1Y7PA 3M2RB 3O8WA 3H8YA 1BUXA 3DWLA 5A0YA 4AXIA 1NB7A 1UEKA 2QYGA 4BC3A 3WNFA 4J9UE 4RCHA 2D41A 4F4YA 4DU7A 1TUGB 4FS1A 2KJVA 4XEIA 3FBFA 2YI1A 2EK1A 2Z2MA 4Y65A 3ZZOA 2QTDA 1PBAA 3MEDB 2E5LJ 3R5BA 4F8RA 4QQBA 4WQ5A 3AOAA 1KQGB 3R5DA 1D9AA 1VISA 1NK8A 4N47A 4A8WA 1FTRA 1HNIA 1FERA 2BJ7A 3A8JA 1RBOB 2FJVA 4RW7B 3H40A 4HUEA 1DEJA 4GY2B 3RBDA 3M5RA 3E9OA 3D45A 3CCLN 4BY9C 4OLBA 3HYFA 3HVAA 5AT1B 1BQMB 4ZJLA 4OX9J 4FCYA 5M2RA 2E9RX 1UZHA 4F7VA 4KR0B 3GR0A 4FKYA 4NLWA 4J37A 2YVSA 1KOOA 3VR1A 4BC7A 3GYNA 3K17A 4CK2A 2QWOA 2DT9A 1NGDA 4IFVA 2EG1A 1NKEA 1VSJA 5SZTA 1G2EA 3OYHA 3KLFB 5DG7A 4TNOA 1K8AO 2WSFC 1QAIA 3L2QA 4C8KA 3OA9A 4BC9A 2E9ZA 4I2QB 1MU2A 2CQ1A 3JSBA 1C1AA 3FJ2A 1TELA 4N56A 1HWUA 3L3UA 1GXTA 1HKAA 3E66A 4N7TA 1VQ7S 2WRMA 3MD3A 4EK2A 4ISEA 4NXMF 2UXCF 1NGBA 5KTQA 2LDIA 3M8ZA 4QZVB 3PIOL 5HROA 5CZ2A 4L73A 4Y2AA 3H5UA 4U96A 4DV7F 4K4YA 4EFAC 5M2UA 4MDAA 1FX2A 1S99A 1NGIA 1U2VA 1B9FA 2JEFA 2PIIA 1RT6B 2X74A 2VQFJ 3ATUA 4K8RA 2H9ZA 3V2UC 3N6LA 3N4QA 1LWFA 4WIIA 4B3SF 2EFVA 2RF2B 3H6EA 1VC5A 1GLEG 3WXKA 4O44A 2O5DA 4V1Ak 2D1KA 1A0OB 5DM7Q 2HVHA 2W7AA 1TL4A 3WBZA 4DV4K 4HTIA 3LP0B 1ZAVA 2DITA 3QEWA 3KHRA 2E8AA 5E7OB 1X9SA 4UZCA 4BG8A 4C0OC 2N7YA 1LXNA 5C0YA 3DFEA 3IRXA 1CJKB 5C15A 5KFGA 1FVQA 3JXOA 4LF4J 4PQUB 4FM1A 1T95A 4R8UB 2HFVA 1F0XA 3O44A 1TL1B 3AQPA 2FBYA 3SQ0A 1HYSB 2O4IA 1TL7B 4OI4A 4A8QA 3QYYA 4LRDA 4M5DA 3HLUA 4IYQA 3AAWB 1H73A 1JLAB 3IM9A 4O4RA 1SQFA 4FXDA 1HQUA 1NU0A 8AT1B 5KG2A 3NLCA 5LSLA 3OW2R 2CJBA 1C6VA 4OHZA 3NG8A 1U26A 3BBFA 3QT7A 5JLHA 3OFGA 3UD3P 2BX6A 1QDUB 3AJ2A 4QW9A 3ZTPA 1PJ5A 3J7AN 3MFHA 1NKCA 4DCPB 1VQ8S 2Q31A 2I5JB 3OYCA 4IKFA 1EIYB 4H4MA 2JLEA 2YTCA 1SQKA 3ENHA 2RJZA 2CJAA 2P9SA 3IS9A 2ABYA 5EHHA 3QWPA 1JJHA 3K58A 4AHVA 4DL2A 3JYTB 4LF8J 2R7UA 4OJ3A 2RDIA 3I8DA 1N5QA 3RB3A 5BR8F 2MZ1A 4O8KA 1KAZA 4OKJA 1Q8BA 1PG5B 3HHLD 3NGSA 3KLEB 5K8OA 1NJIT 3EXYA 5L39A 4DQRA 1S4EA 4USTA 5CCMA 3VN5A 4JK9A 3RMDA 3M32A 5J2QA 5KFQA 5LM7E 2J76E 1U1QA 4WE1A 1J6ZA 2AJ2A 3HM9A 3V9SA 3GSDA 3UCUP 3LL3A 3R1LA 5M1PA 2D74B 3WXMB 1K8KB 5FPDA 1CXQA 3FCHA 3L95X 1WOQA 4BR7A 3MUTP 4HT7A 3VQ8A 3KLIB 1S0MA 4MLEA 3ELHA 4Q43A 1I94F 2HVIA 4CEAA 1GTEA 2V5HG 1ASUA 3JS6A 4MJKA 2BVZA 3NCRA 3ET6A 2Z1HA 4MKYA 4B3RF 1N32J 1HFEL 1RWXB 2NUHA 3DRSA 3HVTA 2K3IA 3V81B 1Q1KA 1PSDA 1Q86T 3J7YI 1NK9A 2NRTA 5IWAF 3PCOB 2YHYA 4UW2A 2RUGA 1NM2A 1LFWA 4B9QA 2HS0A 3IWNC 2EXUA 3KD1E 2E66A 4ID5B 2MQOA 1UOCA 6AT1B 5HRPA 1RDBA 5AZIB 2DHHA 2PA3A 1HR0K 2DGSA 5LXYA 1V6HA 2GAHC 2KTQA 2GIFA 5KFDA 3I0RB 2DISA 2HLTA 5HSPA 3OYMA 3KDOA 1D3WA 5AQYA 2V0NA 1R6VA 2GJ2A 2WFBA 3AGKA 2A0FB 4FWMA 4NLBA 4GV6A 2IJRA 3CDWA 1ZBHA 3Q7BA 3M8YA 2XHBA 1U6ZA 3MCOA 4YB1P 1R27B 3A8IA 2U2FA 2IVFB 2BJ8A 1N6QA 3RRKA 2RN2A 1IBLK 1NOZA 2NYHA 4CVNE 3OJSA 3TZZA 4DQPA 3VF4A 1DTQB 2RSQA 5KFHA 2DIUA 2DTUA 5GVQA 2XEXA 3I56S 5HMWA 3D28A 4JI8F 3IR7B 3H3OB 4PWUA 4AQYJ 3KD5E 2BDPA 1Y4ZB 4WFNL 1HNXJ 1M90O 1WOOA 2GQCA 3SQOP 3FLCO 2XCAA 3IMQJ 1RHKB 1YTUA 4P73A 4CJ3A 4AL7A 2CNNB 1QAJA 4KGKA 3KIOA 4ENOA 2R42A 1LKZA 3QJLA 1V4SA 2A2DA 3K5PA 2Z1GA 1VMBA 3R5JB 1O0PA 5GINA 4J5OA 3PR5B 4USVA 4P71A 2HFUA 3DLEB 2VFRA 2UUAK 4OYOA 2Q2RA 3M8SA 2P9KA 4OV1A 2R8HA 4WF9L 1C1CB 3ITHA 1HQ2A 2JRSA 3DU5A 3CWJA 4CBUA 1HNWF 2BEFA 3OYBA 3LZIA 1RWVB 5D8HB 1HNVB 1IJFB 1L3TA 2Q43A 2IBOA 3OY9A 4NYNA 1DQAA 4Y6IA 2Q97A 1FJGK 1CQNA 5D0GA 4Z4EA 3NGYA 2BYCA 4JD2A 1GAOA 7AT1B 4DR4F 2D3UA 3S3MA 2XLJA 2IAJA 4I9LA 3HHKA 2RRNA 2KFYA 3OL6A 4ERDA 3NF6A 1CC7A 3A5MC 5JS2A 1J5EF 3CW2C 4ZS6A 3CCQS 4XPEA 4F3QA 2UUCJ 1QUPA 2EKNA 1SC1B 3HMJG 5M1NA 3ZEUA 3NAIA 1JLEB 2I2YA 1E6YB 2HWIA 3KZBA 1NDLA 2ZEJA 3SSQA 1MA9B 3UQSA 3CMAN 2F5GA 3KYLA 4E7KA 1T03B 3POTA 4DS5A 3VGMA 4JV5J 2XS7A 3LPYA 1U8SA 2J0QD 1P8ZA 3IG1B 1HMVA 4ICLA 3VQ9A 5DJBA 1UVNA 4YEAA 4JKGA 4RR5A 4B1XB 2XZDB 3MOJB 1S79A 5L46A 4ILJA 4DR3F 4E98A 1RAOA 3GIIA 2WUSA 4NE9C 1FD8A 1YTAA 3AA9A 4CH1A 2ZZNA 3MCPA 2VWJA 3P45B 1RHUB 3RB0A 1H0HB 4CWBA 1NGHA 3V4IA 3W61A 2DH7A 2QEXN 3MOZA 1N52B 3R6LB 4QS9A 1AZSA 1L3UA 1RT1A 4ZLLA 3NGDA 3N4PA 2EKYA 3TX8A 1K8AT 2O8FB 3MK6A 5J2NB 3RAQA 3VGVA 3AA4A 1RTZA 4F0HA 2FPHX 1RQ0A 1GMVA 2GIQA 5HL7L 4CZLA 3FDSA 3OD2A 1UVIA 2XNRA 1T3NA 2K1RA 5KFBA 1RTDB 2FSJA 1YZ6A 2DHAA 4NOHA 1JNRB 1KWMA 4FZXC 3R7NB 4HYKA 4ZP8A 5CR4A 1NSQA 1HL6A 2KFZA 1OH6A 2HHXA 1CJTB 2I1RA 3N6NA 4RZRA 1N33F 5EUHA 4K42A 4DG1B 1U49A 3LA0A 4BGAA 4USIA 5CQGA 2A6AA 2HNZB 1VQ8N 5AZJB 1A7GE 1N34K 5KFSA 5F8MA 3MX5A 2HK2A 1N36J 3HT0A 1OVYA 4DQQA 4F4XA 2VKZG 1AFIA 3M2VB 3K0SA 2IA6A 1LOUA 1RHMB 4KGZB 3CCRS 2YQ1A 3MEEA 3THXA 2GVDA 2HURA 4B8AB 1VRUA 3LPEA 3C19A 2PAVA 4IXCA 1AYEA 1SIWB 3RVCA 3TA1A 1DHMA 1A6LA 4NO7A 1F21A 3VQCA 4RUBA 1FRJA 3JQKA 1HNZF 1S1UA 9ATCB 1NBWA 5I4MA 4KREA 1GNKA 2ETJA 2XI3A 4R25A 4C2MA 4LSNA 3ZZPA 3V6DB 3J80O 2R7YA 3IBWA 2BANA 2CVIA 4WBFA 5KFOA 4DTXA 4NX9A 2VWKA 3JQJA 1Y5LB 2Y3YA 4ZHRA 3BYPA 5IT9O 2W2PP 2R2TA 5K5MA 2QV6A 3SV4A 3OL9A 4LH5A 2PEBA 2C42A 3NRBA 5T14A 3K89A 2L9NA 3TUJC 2G9OA 5H9FJ 2IM0A 3CDEA 4OZ2A 3PJXA 2GC8A 2CNOB 4NYZA 2G2OA 2YH0A 2KYXA 1WF0A 5AE2A 1KVKA 3TU5A 4CHQA 1VQON 1N8RO 1CULA 3CCVS 2MQMA 2CH5A 1WG1A 3OHAA 3NCPA 3CCUS 2XY7A 3J7ZO 1HWJA 4YP3A 3I33A 1S1WB 3MEGA 1VIOA 4ZVTB 4OL8A 2AYGA 2HZVA 4TLRA 1S49A 3CDAA 2LA6A 3SAFA 2YWFA 4OZJA 4WK1A 4PXDA 4ILHA 1WNEA 2QSWA 2K06A 1NH8A 1GLCG 1IKWA 4M41A 1XNQF 3VGLA 3M2UB 4KTZA 2DPIA 3T5KA 1X4HA 1K73O 3FCWA 3F9MA 3RUBL 1FWLA 4CM0A 1IKXA 5A2QY 4CJTA 3KJNB 2C1EB 1XMOF 2WC9A 3CTRA 1ZBTA 4NLVA 4CM2A 2HHHJ 2QLJB 1J5OB 1SZ2A 1T94A 4BWJA 2ZH5A 4FWKA 4URSA 3B54A 3I4HX 2BE9B 4H4OA 3I0SB 2MKJA 3J7YU 4DV5K 4P2FA 4CLPA 5FLXY 2OYQA 1P1TA 3RW7A 4MFBA 5BRFA 1HPMA 2G13A 3FUYA 3WEEB 3NOGA 4RW8A 3LAKA 1HI1A 2F40A 3MWPA 3NMAA 4K50A 3IRWP 2GJIA 4JS5A 4RWXA 4KHPJ 3VA3A 2OLWA 3IA0A 2A6MA 2RAQA 4DEZA 1NLVA 1S72S 1TQLA 4U6PA 4E19A 5KFYA 5AQLA 2DD8S 2OEJA 3R3LA 3GDQA 4CO1A 2VYPA 3C66A 1D1UA 5IC6B 2OEKA 4X62F 3GYGA 1EAYC 1VAZA 1JLFA 3QRQA 4AE5A 4NLXA 1GLAG 3S3NA 5KFZA 4DR7F 4X66K 3QFPA 5M2PA 2VHGA 3NKYA 3CJ1A 3RMBA 2W42A 3FBCA 2X6NA 4A8SA 2QX0A 3CD0A 4ILLA 4G1QA 4OMFG 1BQXA 3NP5A 4P9SA 1MSWD 2JOQA 4KI6A 3VMFB 1OWXA 3OFHA 3H59A 4DSFA 4OX9F 4DR6F 4WFBL 1M90T 4J9SA 4ZVHA 2QFJA 2A3ZA 3KNAA 3HHLA 1TL3A 4L3QA 1S6QA 3THWA 1B9DA 3NE6A 1FFGB 2W4PA 2LA4A 1U04A 4BE0A 1T7PA 4NB4A 1S1VA 2RE1A 3ULEA 4DX7A 3D0IE 1EWRA 1RT5B 3AGRA 4L3KA 2OD4A 4UT4A 5KFUA 3LDOA 2W7OA 4K41A 3DXBA 3CMES 1VR6A 4JYAK 1OPIA 5T7LA 2I38A 4KHRA 5KG5A 3G0ZA 4I68A 1B92A 3NCIA 3N79A 1TUYA 4AHRA 2KHOA 2VQFF 3CD6S 4C8MA 2UXDF 1YUWA 2NXNA 2IFXA 3DDIA 5FRNA 4MLHA 5AQFA 1YF5L 1IVZA 1IWAA 3UR3C 3O4QA 1WUAA 3KLGA 1WUUA 3R8YA 2HYIB 1BWFO 3L0QA 4JRPA 1SUQB 3L7PA 2F96A 2Z58B 1HUXA 1M1KO 2QM1A 2NPFA 1CJUA 4V19X 2HHSA 4B3MK 4H03B 2CGLA 3MCMA 2ZJQL 2J5AA 3BM7A 1S1TA 4YORA 2J8SA 5SWMA 2VPWB 2ZVIA 2RHSB 4ECUA 1NSAA 2O8BA 3VZIA 1E6VA 4JI6J 3BS9A 2UZAA 4W5RA 5J1EB 2NXJA 3MZIA 4LF7J 4CGGA 2BW7A 3IUCA 4CJSA 1X4CA 2D7SA 5B09A