1JL2A

Crystal structure of tceo rnase h-a chimera combining the folding core from t. thermophilus rnase h and the remaining region of e. coli rnase h
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
150
structure length
150
Chain Sequence
b'KQVEIFTDGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELKAAIEGLKALKEPAEVDLYTDSHYLKKAFTEGWLEGWRKRGWRTAEGKPVKNRDLWEALLLAMAPHRVRFHFVKGHAGHPENERADELARAAAMNPTLEDTGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chimera of Ribonuclease HI, Ribonuclease H
publication title Contributions of folding cores to the thermostabilities of two ribonucleases H.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
total genus 42
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jl2A00
4DU4A 4I9QA 1F21A 3NF6A 1EETA 1Z26A 1JLFA 1WSIA 4E7LA 1CLQA 3VQBA 3OYLA 3QEVA 4DLGA 3LP3A 3LWMA 1UOCA 2LSNA 1QSSA 5SZTA 3EZ5A 3PX4A 4FJJA 4FYDA 3AVCA 5K14A 3IG1A 3OYFA 4KREA 4CJUA 2P5OA 4LSNA 4CJKA 1WNSA 1JXBA 3HYFA 3SCXA 1SUQA 4FVMA 4OJRA 2XHBA 3I0SA 1NJZA 3VQ9A 4N5SA 2VWJA 4E7HA 4NYNA 3C6UA 4C8NA 1ZBFA 2WOMA 1NKCA 4KB1A 1WSGA 2HHWA 3AVLA 4Q0BA 4H8KA 1RBRA 3VA3A 4CF9A 2X6SA 1GOBA 1RCHA 4CF8A 3V4IA 1U49A 1FKOA 4F2SA 3T19A 3V6DA 2B4JA 4M45A 3QEXA 1X1PA 1QTMA 2HHQA 1LWFA 4CJFA 1SKWA 4NCBA 4M3UA 2HHVA 1VSDA 3AVBA 1W0HA 1ZYQA 2R7YA 4N41A 3ZSZA 3NDKA 3SZ2A 5CY4A 2Z1GA 3ISNC 4FJMA 3AA5X 3F9KA 3DLEA 1HJRA 3AO4A 1S5JA 4KV8A 3U6FA 1R0AA 4E19A 4KHUA 3HXMA 1S1WA 4CGDA 5FRMA 2VWKA 4F4KA 3ZCMA 1B9FA 2FBYA 3M8PA 1QE1A 1J5OA 1U04A 4M3WA 4O0IA 5FRNA 1RDDA 3V9ZA 4DFMA 4CHQA 1SKSA 1ITGA 4CEZA 3TABA 3TAQA 4DFKA 3RMDA 3TARA 3S3MA 2GUIA 4W5TA 4FLTA 1IG9A 2KTQA 4FLXA 4GVMA 3ZSYA 3NH2A 1S1UA 2YNIA 4AH9A 3PUFA 3VQ4A 3G10A 1JLAA 3ZSWA 1TKXA 3K5MA 3V9XA 3RR8A 2HVHA 4CGHA 2HNDA 1LWCA 1U48A 2G8HA 4JS5A 4CF1A 5CZ2A 3ZT0A 2HB5A 4RG8A 1U4BA 1JLCA 1IKXA 1KCFA 4CJPA 3O3FA 3MXMA 1RBTA 3NAEA 2XY6A 3OYNA 4DQSA 5CYQA 1L5UA 3AVAA 4PUOA 2G8WA 4LH5A 1TV6A 3AO1A 4CHOA 1ZBUA 5JS1A 3VQDA 4DG1A 4Z4FA 4B8CA 5KRTA 1T05A 3OYAA 2PY5A 3NE6A 2E6LA 5HRSA 3CYMA 4I2PA 1TKDA 1C1CA 3KJVA 2YHBA 1VSIA 4FJ5A 3OYJA 3TWHA 3DMJA 3QNOA 1Z25A 2IDOA 3U3GA 3ZSQA 4Q5VA 3B6PA 1RDBA 3KTQA 1RT4A 4ICLA 4OGCA 3TI0A 4F3TA 1JXEA 3LPUA 3SV4A 4NYFA 4DFPA 2OYQA 4CERA 1WSEA 1FKPA 1YT3A 3O4NA 1NK8A 1CZBA 1J54A 3QO9A 4OKKA 5I3UA 2OPRA 3LANA 3OS1A 1WSJA 1L3UA 2FBVA 4HCBA 1YTUA 3QEIA 1D9FA 4AHVA 4M3YA 4FZXC 1A5VA 4O5BA 3WNEA 3RRGA 3NGIA 3KLFA 4FJXA 3QEPA 3HK2A 4PWDA 3BGRA 2RF2A 1ASWA 1TAQA 3B6OA 2F8TA 2OA8A 1JL1A 3KK1A 5HRPA 2ITGA 1L3TA 4B9NA 1CZ9A 1SL2A 3VN5A 2VG7A 2Z1IA 5KRSA 3O4QA 4CHZA 3RR7A 2HNYA 3UIQA 2IC3A 3K5NA 4CJEA 4FXDA 1RT6A 3VQPA 4G1QA 2KZMA 4RW9A 4CEBA 4EP5A 2ZD1A 4OKJA 1VSHA 4RW6A 1REVA 3SQ0A 4DTUA 1S6QA 3ZT1A 4M42A 2F8SA 2DY4A 2YKNA 4Z4CA 4O0JA 4EZ9A 1VSFA 4CJLA 1LAVA 2HNZA 1B92A 1C0MA 3AA2A 3OYCA 1KSPA 1HYZA 3LDSA 4KTZA 3H08A 2QK9A 4QAGA 3OYEA 4JRPA 2QXFA 4OPJA 3HVRA 4NCAA 3P5JA 1Y97A 4CE9A 1SL0A 3HO1A 3L2VA 1KLNA 1KFSA 1XHXA 3VQ5A 4AHUA 1KRPA 4FLVA 3P1GA 4OLBA 1J53A 4KTWA 3L2QA 1KLMA 3RMBA 4KHQA 3OS2A 2P5GA 3KD1E 1A5WA 4FM2A 4CCHA 4CJWA 1BISA 1UA1A 3OY9A 1IKYA 1WLJA 2PZSA 4DSLA 3QETA 3CFOA 3C6TA 4FJHA 4K8XA 3LAKA 5FROA 2JLEA 4HUFA 1TL1A 1RBUA 3M8SA 1J9AA 4OLAA 4OGEA 1BCOA 4CF2A 3L8BA 1QHTA 1DTQA 2A1RA 3S3OA 1LWEA 3TR8A 1HQUA 3SUQA 3OYBA 3K5OA 3KKSA 4RW4A 4OVLA 4DQQA 1GOCA 3QINA 5DMRA 4FM1A 1RT7A 4DTJA 3AVIA 1HMVA 4BDYA 3RRHA 2ETJA 3L2RA 3AA3A 3L3UA 2KW4A 3WNFA 4F3OA 2FBXA 3NGZA 3KLEA 2KFNA 2KFZA 1KTQA 4HUGA 1RTDA 1HPZA 2QKBA 3AO3A 4FK4A 5T7BA 4FJ8A 1EKEA 4LY7A 3MAQA 4OKEA 1TK0A 4DQPA 3K57A 2YNHA 4DSJA 2OPQA 1L3VA 1HYSA 4TSXA 1IKWA 1BHLA 3V1QA 2HHUA 4DSIA 3L2WA 4CGFA 2XRIA 3KLGA 4E7KA 3CG7A 1HNVA 1KFDA 4CEDA 4W5RA 3DM2A 3DLGA 4HVJA 3V9UA 2YNFA 1L3SA 2VG5A 4CIGA 2BDPA 1MU2A 3AA4A 4CFDA 4FJ9A 4M3XA 4DU3A 4IKFA 1CXQA 3ZT3A 3OS0A 3QEWA 2G8FA 4CEFA 4CK2A 4Z4EA 3AV9A 2D0CA 3HP6A 2HHTA 4KI4A 2JGUA 2QKKA 4B9UA 2PYLA 4JS4A 1K6YA 3IS9A 1BI4A 4CFBA 1BCMA 1RNHA 4C8LA 5CZ1A 1TK8A 4CJTA 1VSLA 2OZMA 3MEDA 4B08A 2YHAA 3A2FA 4WE1A 1QQCA 1JLBA 3I0RA 4H4OA 2AJQA 1RILA 1DLOA 1YVUA 4FW2A 2HHSA 1XC9A 1RBSA 1IO2A 4IDKA 3K5LA 1NK9A 4FLYA 3DLHA 1DTTA 3E01A 3VQ7A 1RT5A 4DSFA 1NJXA 4DQRA 4N76A 3M8RA 4HHTA 3LAMA 2XO7A 3DLBA 1S1XA 4HUEA 3T3FA 4FK0A 3P83D 4CJSA 3NH1A 3HPHA 5HLFA 3ZSOA 1KVCA 4CJ5A 2X78A 5FDLA 2OPPA 1X9MA 4IG3A 3BDPA 3VQ8A 1S9EA 1B9DA 2D0BA 2EHGA 4BWMA 1JL2A 2ZQBA 4AHCA 1SV5A 3OYGA 1C6VA 4ZTJA 2WONA 4DTNA 1D8YA 4FJGA 4ID5A 5E41A 4OPKA 4YFUA 3CFRA 1BQMA 1D5AA 4CJ4A 4E1NA 1W9HA 4DSEA 1RDAA 3ASMA 3LP2A 3KKRA 4F2RA 1S9GA 2ZE2A 4FLWA 2XY7A 4O44A 1NK0A 1CXUA 2B5JA 3AVFA 1LV5A 4DWIA 3VQAA 4BE0A 3V81A 4CF0A 3OJUA 1IH7A 4KKOA 3SQ4A 1RTHA 3M8QA 4DTRA 1N6QA 1VRTA 4DTXA 1ZBHA 4CIFA 4ZTFA 3T1AA 5KTQA 3OYMA 4RW7A 3DLRA 1Q8IA 2F96A 1GOAA 3JSMA 3NFAA 1ZBLA 4EP4A 4FM0A 1HYVA 3TAEA 3ZSXA 4KI6A 3DRSA 1UWBA 4M41A 3LPTA 1RT2A 4CGGA 1N5YA 1QSLA 4FK2A 3LP1A 4IBNA 1EX4A 1C1AA 4BE1A 4E7IA 5I42A 4DQIA 2GBZA 1S1TA 4UQGA 4DF4A 3HJFA 2HHXA 2E6MA 4AHSA 3SQ1A 4CK3A 4FW1A 4CJVA 1BGXT 3HM9A 4DU1A 4BDZA 2HW3A 4K8ZA 3RTVA 4KAZA 4NCGA 3O3HA 1KVBA 3CFPA 2I5JA 3DLKA 4O55A 3NHGA 3D45A 2P51A 3LZIA 2KQ2A 4FJKA 3CM6A 3ZSVA 1SKRA 4DS5A 4B9SA 1T8EA 4FJ7A 1T03A 3TAMA 4LH4A 5HRNA 1EP4A 3WNHA 4CEAA 3MEGA 1YTAA 2O4GA 4KHYA 4CGIA 2Z1HA 3THVA 4HCCA 4CK1A 4I2QA 3RWUA 3WNGA 1NK7A 1S6PA 3V9WA 4I7FA 4Z4GA 3VQCA 4C8OA 4W5OA 4FZYA 4ZHRA 3ULDA 1TGOA 1XI1A 4AILC 3PY8A 3HT3A 4CJQA 3VQQA 5DK5A 1NKBA 1C0TA 3IAYA 5SWMA 1LW0A 2D5RA 4R5PA 4KPYA 2G8VA 1D9DA 4ELUA 2ATQA 5J2NA 1RT3A 1EXQA 3PO4A 1TAUA 2IAJA 3LZJA 3I8DA 5J2PA 1HRHA 2A1SA 4BACA 3SPYA 2DFHA 4E0DA 3LP0A 2B6AA 1TVRA 3QERA 2DFEA 4Z4HA 4JRQA 4DTSA 3O3GA 1G15A 5HBMA 3SV3A 5J2QA 3PX6A 4L8RB 5C25A 1RTIA 1S1VA 3EY1A 2X6NA 4Y1CA 4CHYA 3EYZA 3AVNA 5D3GA 3AVGA 3JYTA 3OJSA 2X74A 3MEEA 4IG0A 4B9TA 5CYMA 4BDPA 1XHZA 4YNQA 4E3SA 5KI6A 4PQUA 3QIPA 5C24A 3TAPA 2NUBA 4GW6A 5EU7A 3VA0A 5HROA 4F8RA 3AVMA 4Z4IA 2FC0A 3ZSRA 3SUPA 4E1MA 1VSMA 1XWLA 2Y1JA 3DI6A 4CFAA 4QCLA 1JLGA 3KK2A 1RBVA 3DOLA 4BWJA 4PY5A 2VG6A 3SUNA 3V9SA 3L2UA 3LALA 2W42A 4KHSA 2YV0X 3CM5A 1WSHA 4FLUA 4BE2A 4HTUA 4N47A 3AO5A 1C1BA 1TKTA 4CHPA 3CQ8A 3SI6A 4LSLA 4FZZA 1O1WA 1BIUA 4B9VA 4J2EA 1KVAA 1VSEA 4C8MA 2GV9A 3QIOA 2Y1IA 2HVIA 4KFBA 4Y1DA 4DTOA 4ELVA 4CGJA 3HVTA 3RMCA 2KZZA 3V1OA 4KO0A 4B8AB 1X9SA 1LAWA 1BL3A 1JKHA 3RMAA 4CJ3A 3AVHA 3NF9A 4CEQA 2E4LA 4CJRA 4MQ3A 1QSYA 4B9MA 4DFJA 3FFIA 4EZ6A 3OYDA 1JLQA 2RPIA 2IGIA 3DYAA 5HP1A 4O4GA 1NJYA 2BGGA 1RT1A 4J2DA 1BIZA 2YKMA 3NGYA 2IS3A 3ALYA 3NF8A 4IFYA 5JS2A 1ASUA 4DF8A 3S9HA 3TANA 4B9LA 4KB0A 4GMJB 3NCIA 3AO2A 4AHTA 3U3YA 1NKEA 1NOYA 3V1RA 4B3OA 4E89A 4DTMA 3KIOA 3DOKA 3DRPA 4KTQA 3HPOA 3S3NA 4DSKA 4PA1A 3MXJA 3SYZA 1VRUA 4J2BA 1IKVA 2EX3A 3F73A 4KHNA 2G8KA 3ITHA 1T7PA 3KD5E 4E7JA 1ASVA 1RTJA 3VQEA 4DMNA 4DTPA 3QESA 1A5XA 3PO5A 1Q9XA 1VSKA 3HP9A 4ID1A 5KGXA 1NK6A 3SUOA 3KK3A 2OZSA 1HQEA 5J1EA 3LWLA 1SL1A 2RN2A 1C0UA 1VK0A 1TKZA 3HL8A 3NH0A 3D0PA 1QS4A 4JLHA 2XY8A 3C94A 3K2PA 4CHNA 4FJLA 4CFCA 2Z1JA 5C42A 2P1JA 3SNNA 1FK9A 1FXXA 1RDCA 3AVJA 4N56A 4MFBA 3QNNA 1NK4A 1ZBIA 2RKIA 3QLHA 1WSFA 3K59A 2G8UA 2Q3SA 3IRXA 3NF7A 2HMIA 2FBTA 4LD0A 3MXIA 2DFFA 1HNIA 3SQ2A 3PV8A 4J2AA 2PYJA 2DTUA 1TL3A 4CEOA 4CEEA 4ELTA 3G0ZA 4H4MA 1NK5A 2BANA 4I9LA 4M3TA 3K58A 2D0AA 4CECA 4DLEA 3L3VA 4RW8A 4CESA 1TK5A 1NOZA 3AVKA 4W5QA 4FJNA 4QOZB 5HRRA 3NBPA 1I39A 4CIEA 4FCYA 1U45A 3SPZA 1VSJA 1LW2A 1WN7A 3DRRA 4Z0UA 5KGWA 4XIUA 1I3AA 3KLHA 4FLZA 3TAGA 4FJIA 4W5NA 4M3RA 3ZT2A 1U47A 1JLEA 1UA0A 2G8IA 3OYIA 4M3ZA 2XY5A 1BQNA 3C95A 3OYHA 1Q9YA 1NJWA 2OPSA 3HPGA 5J2MA 3PX0A 1WAJA 3VQ6A 2YNGA 4DS4A 1BI4B 3HSTB 2BE2A 1UAXA 1WAFA 3KLIA 3OVNA 4IFVA 3ZT4A 3TAFA 3SJJA 4C8KA 2IOCA 4KRFA 2O4IA 3MECA 3OYKA 4KHWA 4AHRA 1X9WA
chains in the Genus database with same CATH superfamily
1TYQB 4CW7B 1EETA 1ZBSA 1Z26A 2VYPA 1WSIA 3CQXA 4JKGB 3CC2N 3OYLA 2O8BB 3LP3A 3FZLA 1YIJN 4DR1K 4FWPA 4PKGA 3VMFB 4KREA 4CJUA 2P5OA 3HYFA 3SCXA 1DKGD 2XHBA 3LDNA 2P9KB 4N5SA 3R6MA 1ZBFA 2YJEA 2WOMA 4BGAA 4X66K 4H8KA 3VA3A 4M63C 1GLDG 2VWBA 3V6DA 4JK8A 1NGJA 4CJFA 3QICA 4IEEA 2UXDK 2RHKA 3AA5X 3OHRA 5M1KA 4CD1A 1R0AA 3HXMA 1S22A 3VEOA 3H1VX 2D0PA 2QW9A 1GLAG 3C7NB 4CHQA 3O9UA 5EXWA 4CEZA 3CCQN 2ZGZA 4LFBK 2E2QA 4FLXA 3PUFA 3VQ4A 3G10A 1IV0A 3TU5A 4CGHA 5HOOA 2G8HA 4JS5A 2P9IB 3O3FA 1RBTA 2XY6A 3OYNA 4PUOA 4HTLA 4BRCA 5AZJA 4Z4FA 4B8CA 3MN7A 2PY5A 3NE6A 1HNWK 1HPMA 1HKBA 1VSIA 4IEIA 4BG9A 3QNOA 4A5AA 3ZSQA 4BG8A 4Q5VA 4R79A 4BRHA 3DXKA 1FJGK 3EE8A 3LDQA 4WQ5A 3LPUA 3SV4A 4JHDA 1XMOK 5C12A 4LFAK 3ENBA 5GAGP 2W41A 5AQFA 4AHVA 4X64K 2AA4A 3FR0A 3C65A 4PKHA 3NGIA 3KLFA 1U2VB 4PWDA 1NGIA 3BGRA 3WQTA 2Q2RA 3KK1A 2ASMA 5AQWA 1RT6A 3SAGA 3O5BA 4G1QA 4B3SK 4FXDA 3P38A 2KZMA 4RW9A 4NLBA 1IBMK 1BWFO 5KPTA 1REVA 3SQ0A 4DTUA 3ZT1A 3CMEN 3VPZA 4CJLA 3OYCA 1KSPA 3I33A 3LDSA 4IJNA 3OYEA 3P5JA 1XHXA 3GG4A 4AHUA 2O8CA 3G71N 4FPAA 1KRPA 4FLVA 4OLBA 4KTWA 4KHQA 1KLMA 3HOTA 2P5GA 1BISA 1IKYA 5F1XA 1IBLK 4H0YB 2JWKA 1TL1A 3AAQA 1VQPN 4BY9C 1QHTA 1HQUA 3SUQA 3OYBA 3O9QA 4YOUA 4OVLA 1Q86O 5FPDA 4DTJA 3WT0A 4BDYA 3AA3A 4F3OA 2WC9A 2FBXA 3O9TA 4FWMA 1RTDA 4FK4A 4A57A 1EKEA 4FWLA 2GX9A 4DQPA 2OPQA 3CC4N 1HYSA 4TSXA 1IKWA 4BR2A 1N36K 2XRIA 1YVNA 3O6WA 3DM2A 4BC4A 3V9UA 1L3SA 1W97L 4CIGA 2BDPA 5FPEA 1MU2A 2P9LA 3AA4A 4IOXA 2UXBK 2E1YA 4ISEA 1C0FA 5FPMA 4BQLA 3AV9A 4IJAA 4YDUC 2BH1A 4B9UA 4JS4A 3IS9A 1Q7YO 1RNHA 1TK8A 1VSLA 1JCEA 2YHAA 4WE1A 1K9MO 4H0OA 5AQLA 3I0RA 4DV4K 2KKZA 4H4OA 3R9PA 4FW2A 1XC9A 3VQ7A 4DSFA 4DQRA 1RGIA 1CZAN 2P9NA 3NH1A 3HPHA 3ZSOA 4CJ5A 4U67L 1Q81O 2D0BA 2EHGA 4AHCA 3HBTA 2WONA 4FJGA 4ID5A 5E41A 4YFUA 3ZEUA 1D5AA 4PL7A 3ZETA 4JK9A 2XY7A 4CI6A 1W2BM 3V81A 4CF0A 2I7NA 4JKFA 2CGLA 1WOQA 4A2AA 3OYMA 4RW7A 1YXQA 4KI6A 3R8EA 3ZSXA 4EIAA 2O8DB 1QSLA 3LP1A 5I42A 1S1TA 2A6AA 4AQYK 1OKJA 4B3TK 1XC3A 4CJVA 4DU1A 4BDZA 2HW3A 4K8ZA 2NLXA 4WFNL 2QWQA 4NCGA 2Q31A 3RTVA 1KD1O 4FJKA 4DS5A 4B9SA 2P9LB 1XNRK 4DV6K 2FLOA 3T7ZA 2UUCK 4CEAA 4CGIA 4CK1A 1NK7A 5F0XA 1BO5O 2E8AA 4JKAA 2Q97A 4FZYA 5AQNA 4ZHRA 3HT3A 4CJQA 5DK5A 1C0TA 3AY9A 2G8VA 1VQ6N 1QQOA 3UKRB 1RT3A 1EXQA 2NRHA 4BACA 4E0DA 3VEYA 5TKYA 4O8KA 3KWIA 4JRQA 1LOTB 2QM1A 3ID6A 3PX6A 5J2QA 4L8RB 1RTIA 4FVUA 3CQYA 3SMSA 3THXB 4YNQA 4O5FA 3ZETB 1VQ4N 5BREA 5EU7A 5HROA 5JVHL 3SUPA 4E1MA 1VSMA 4CFAA 3CCLN 3THYA 4BR5A 4PY5A 4KHSA 4IFEA 3L2UA 2YV0X 4BE2A 3THWB 3P31A 2Q1NA 5AQMA 5JMVA 1TKTA 3QB0A 3SI6A 1VAZA 4LSLA 3VGMA 2W6KA 4J2EA 2NRZA 1WB9A 4C8MA 3AAPA 2HVIA 4ELVA 4DTOA 2KZZA 2FXUA 4KO0A 4B8AB 1BL3A 3WXLA 4CJ3A 4EZ6A 1X3NA 4A59A 2NRXA 5HP1A 2RPIA 1NJYA 4LF5K 4J2DA 4DF8A 4NO7A 2ZF5O 5AQPA 4GMJB 3AO2A 4WFAL 4AHTA 3MK6A 3HTVA 3J7YP 4B3OA 4JKEA 4X65K 1BDGA 4FWOA 3FZFA 4KTQA 4DR4K 3MXJA 3SYZA 4J2BA 2EX3A 4DV1K 3A8YA 5FLXO 4KHNA 5BPLA 3KD5E 5KPZA 5CHIA 4WYBA 1VSKA 2QTDA 5KGXA 3H46O 1HQEA 4DB3A 5J1EA 1C0UA 4ILGB 1QS4A 3D2FB 1RDCA 4N56A 1VQMN 4MFBA 1MWKA 4DR6K 5AJ3K 1NWKA 1BG3A 3NF7A 5JVGL 3MXIA 3OBWA 2DFFA 3PV8A 3SMPA 5AQSA 4H4MA 1NK5A 2BANA 3L3VA 2VGNA 1T3VA 4CESA 2QWRA 4J8FA 3NBPA 1I39A 4CIEA 1VSJA 1WN7A 3DRRA 2FSKA 3PIOL 1X3MA 4AM6A 3BP8A 1U47A 2G8IA 2XY5A 2H3GX 3C95A 4JAXA 4DHYA 5KQDA 4LC9B 5J2MA 3PX0A 1WAJA 4B9QA 1DGKN 3OVNA 2BE2A 1WAFA 4IFVA 4UY8O 1HNZK 3VGLA 3OYKA 4KHWA 3VGKA 1F21A 3NF6A 1JLFA 5AZIB 1EWQA 2P9PB 4DQ8A 4IZ9A 3LWMA 1UOCA 4IO8A 2LSNA 1QSSA 3CD6N 2BTFA 4A62A 1N32K 5K14A 3I0SA 3W3DA 2GELA 3B8AX 3OA9A 3CMAN 2VWJA 3QMLA 4BRQA 2QWMA 4DR3K 3C6UA 1NKCA 4KB1A 2IVOA 3U4LA 3AVLA 4ISGA 3ATUA 4Q0BA 1RBRA 4CF9A 3H1QA 1RCHA 4CF8A 3T19A 1QTMA 2B4JA 3QEXA 1X1PA 4N41A 1GLCG 3DLEA 4DV5K 1YUWA 1S5JA 4GV3A 5LMUK 4CGDA 5FRMA 1B9FA 2FBYA 3M8PA 4JI3K 1IJJA 1ITGA 3LDPA 4H5WA 3SAFA 4DFKA 3TARA 2KTQA 5M1QA 4FLTA 1IG9A 1HNXK 2JWLA 3ZSYA 4BRKA 2UXCK 1QZ6A 3ZSWA 3K5MA 2HMPA 3CCMN 5MLCQ 1LWCA 4NB4A 3ZT0A 1IKXA 4NCAA 5CYQA 4LH5A 4CHOA 1ZBUA 4JI8K 2OCEA 2NNWA 2IVNA 4AM7A 5M1OA 4I2PA 4DV0K 3DMJA 3DJCA 2IDOA 2YHYA 1J6ZA 1RDBA 5AQRA 3KTQA 4F3TA 1K73O 4CZKA 3KHYA 4BRNA 1FKPA 3O4NA 4BRPA 2OPRA 1L3UA 2FBVA 1YTUA 2A41A 4IXCA 3DXMA 3OTOK 3ENHA 1A5VA 3R3LA 4FZXC 4FJXA 3QEPA 3HK2A 5E26A 1MDUB 2RF2A 5B8HA 4WCEL 1TAQA 2OA8A 1CZ9A 4JK7A 2Z1IA 3E66A 5KRSA 1WBDA 1M1KO 3RR7A 2P9UB 3VTIA 2IC3A 2ZD1A 3A0IX 3H3OB 2F8SA 1S6QA 3PIPL 2DY4A 3C6HA 1OH5A 4JN4A 3VENA 4IOAL 2HNZA 3AA2A 4JI5K 1N34K 4KTZA 3H08A 4KH6A 4B1VA 4BVPA 2YJFA 1VQ5N 3L2VA 1KLNA 3O8MA 1J53A 3EEQA 4FM2A 4CCHA 2CGKA 1UA1A 4DSLA 1WLJA 3M5RA 3EKUA 4FJHA 5AQZA 4MLEA 4OLAA 3L8BA 3DAWA 1DTQA 1YAGA 4FWKA 3K5OA 5FPNA 3TSQA 4DQQA 3MX2A 3L2RA 2VQFK 2KW4A 3WNFA 1KTQA 2QXLA 1HPZA 2QKBA 3AO3A 5T7BA 2RE2A 3MMVA 1VQ9N 4K41A 2O8FA 3VEXA 2YHWA 1GLJO 3CJBA 4DSJA 2V52B 3V1QA 2HHUA 4DSIA 4CGFA 2UU9K 3CG7A 1HNVA 2DPNA 2YNFA 4A2BA 2HF4A 4FJ9A 4MDAA 2O8EB 5JLFA 2HBKA 3TSPA 4YOVA 1K6YA 3CPWM 5CZ1A 4FO0A 3MEDA 4YOYA 4BGBA 3HZ6A 3G4SN 5AFUA 1SS6A 1DLOA 1IO2A 4IDKA 3N4QA 1DTTA 1Q82O 3E9OA 5EX5A 3D6RA 4B1ZA 4HHTA 3VEWA 4JKHA 3DLBA 4YOTA 3T3FA 3P83D 4CJSA 3IUCA 5DM7L 1KVCA 5FDLA 1IG8A 4NXMK 3TPQA 3VQ8A 3G6EN 4ZTJA 4DTNA 2ASPA 2F4VK 4E1NA 1W9HA 4OO1J 1RDAA 4BROA 3KKRA 4F2RA 2ZE2A 4ILHA 1CXUA 3H6EA 3AVFA 4H0XB 3OJUA 4GVEA 3SQ4A 4K43A 3M8QA 3GL1A 4MO5A 3TTCA 1VRTA 4CIFA 4ZTFA 5KTQA 1X9JA 1GOAA 1ZBLA 4EP4A 4FM0A 3DRSA 1RT2A 4CGGA 1EX4A 5GADP 4E7IA 4DF4A 4GV9A 1FW6A 4AHSA 3I8BA 4CJ7A 3SQ1A 3HM9A 3VEVA 3DLKA 3D45A 2P51A 3LZIA 2KQ2A 1DT9A 5C10A 2FSNA 3FZMA 1RDWX 1T03A 3TAMA 1EP4A 4GNIA 3I55N 2UUBK 4KHYA 1XUPO 4I2QA 3MN5A 4FL9A 1YJ9N 2D1KA 2VGMA 1S6PA 4CZMA 4Z4GA 1ZC6A 4C8OA 2FF3B 4LF8K 1XI1A 1G99A 3ZYYX 3IKMA 3LM9A 5AZJB 3WEEA 1LW0A 1TUUA 4R5PA 5AQVA 5I9EB 2ATQA 1QHAA 1Z05A 5J2PA 3I8DA 1ZXOA 1QQMA 3SLCA 3SPYA 2IVPA 2DFHA 5BN9A 2B6AA 3AGKA 2DFEA 3J8AA 3QBXA 2F7TA 5HBMA 3SBTA 3DXKB 5C0YA 4AF1A 2PAVA 1Q18A 3MWPA 3EYZA 3AVNA 5D3GA 3ULEA 3OJSA 2X74A 4IG0A 4JHDB 4F9OA 5KI6A 2NRRA 4PQUA 1MWMA 5C24A 4BQZA 1NGHA 4Z4IA 3AVMA 3CJ9A 2FSJA 4MLHA 3C0BA 3BY5A 1KAYA 2HBMA 2ITMA 3DOLA 3V9SA 3LALA 3CERA 5ADXA 3GDQA 4HTUA 4Z94A 4N47A 1C1BA 3P4IA 4B9VA 3E1YA 1KVAA 2GV9A 4B1UB 3QIOA 3CJAA 2Y1IA 4FSVA 5M1NA 3PSFA 4CGJA 4JI2K 3JXUA 4WF9L 1X9SA 1LAWA 3NF9A 4CJRA 2E4LA 3FFIA 4JKDA 3OYDA 2BGGA 1XQSC 3NGYA 1SAZA 5JS2A 5AQTA 5BRFA 3E9LA 2O8CB 2CH5A 2GWKA 2VQEK 5JICA 1NOYA 4KHPK 3V1RA 4E89A 3KIOA 3S3NA 3MN6A 3E9PA 2G8KA 2V7ZA 3GOIA 1ASVA 3PO5A 4DTPA 1A5XA 1NU0A 4ID1A 5AQHA 4OX9K 5LJVA 3SUOA 1NGCA 3VF6A 3LWLA 3ZX0A 2RN2A 1TKZA 2XY8A 4E1JA 2OANA 3K2PA 4CFCA 4H5TA 2P1JA 1FXXA 4K42A 3FZKA 3QLHA 1WSFA 3K59A 2WBNA 3OW2M 1N8RO 2FBTA 5AQGA 3SQ2A 2PFUA 2PYJA 4J2AA 3AARA 4CEEA 1H1VA 4YHHK 3K58A 3ULEB 4FWSA 1TK5A 1NOZA 1HUXA 4W5QA 4FJNA 3MWTA 4JNEA 1YF5L 2ZM6K 4FLZA 3SPZA 2E20A 3TAGA 1I3AA 2UYTA 4MO4A 3OYIA 1BQNA 3O1BA 4DV3K 1BU6O 4H5RA 1Q9YA 2OPSA 4CZFA 4BRDA 3Q7BA 3VQ6A 3SJJA 2O4IA 4H0PA 3MX5A 4I9QA 4BREA 4CBWA 3QEVA 2VCPA 4GV6A 2J4RA 5C2DA 2P9NB 3AVCA 2E88A 3L0QA 4LSNA 4CJKA 1SUQA 4FVMA 4OJRA 4O8UA 5IT9O 2HOEA 3CETA 4C8NA 1QVGM 3ZEUB 3CCEN 3NMUA 1WSGA 2A5XA 2HHWA 4FOEA 1NM1A 3W0LA 1NGAA 2X6SA 2HHHK 1FKOA 4JD2A 1LWFA 1SKWA 3HI0A 4M3UA 2GEMA 2HHVA 1VSDA 3AVBA 2R7YA 2V51B 3SZ2A 5CY4A 2Z1GA 3F9KA 3AO4A 3EL2A 4KV8A 3U6FA 2VWKA 5KQ8A 4F4KA 1J5OA 1U04A 4M3WA 4O0IA 5FRNA 4CZGA 1SKSA 3TAQA 3S3MA 4JYAK 2GUIA 2OTJN 4GVMA 4OPHA 1S1UA 2YNIA 4AH9A 1JLAA 3RR8A 2HNDA 1U48A 5CZ2A 4RG8A 4BR0A 1E4GT 2PBDA 4CJPA 3AVAA 1HLUA 1NMNA 1TV6A 1NBWA 3AO1A 3FLCO 1NNEA 3VQDA 2KLAA 5JS1A 5KRTA 1T05A 3OYAA 4CZEA 2E6LA 5HRSA 1SQKA 1TKDA 3J80O 1C1CA 2YHBA 3GBTA 3OYJA 3TWHA 1Z25A 3U3GA 1NG9A 1HR0K 3ZLJA 3QFPA 2HF3A 1ATSA 5AR0A 4EHTA 1RT4A 4ICLA 4OGCA 4WQ4C 3TI0A 2Q0RA 4JI4K 4H03B 1WBBA 4DFPA 3CCSN 4DR5K 4CERA 1WSEA 1YT3A 4U7BA 2QWPA 1J54A 5I3UA 5AQJA 1BOTO 3LANA 3OS1A 1WSJA 4HCBA 3A5OC 3QEIA 3PSIA 3WNEA 5GAHP 4FPBA 3IFRA 3B6OA 4B9NA 1JL1A 5HRPA 2ITGA 1SL2A 3VN5A 4JI6K 4WFBL 2VG7A 4CHZA 3KVGA 2E5LK 3K5NA 3THYB 4CJEA 3VQPA 3LDLA 3T1HK 4CEBA 1Z6RA 4OKJA 2I7PA 2AP1A 3CJ7A 2YX6A 5AQXA 4O0JA 4EZ9A 1B92A 1C0MA 2QK9A 1HYZA 5BRDA 4QAGA 3KZBA 4FOIA 1S3XA 1Y97A 3VETA 1V4SA 1RFQA 3LDOA 3L2QA 3FE1A 3KD1E 3EN9A 3SAHA 3OY9A 3VTHA 4B1WB 2IIRA 3C6TA 3LAKA 4HUFA 1RBUA 1J9AA 4OGEA 4I6MA 4KH5A 3QDKA 1LWEA 3TR8A 2NRVA 3KKSA 4RW4A 4FWNA 5AFUH 4FM1A 1RT7A 4LF4K 1HMVA 3CPEA 3SK3A 2ETJA 3L3UA 4B1XB 3NGZA 3KLEA 2KFNA 2KFZA 4HUGA 5KPRA 2NRTA 4FJ8A 3MAQA 4OKEA 1TK0A 1L3VA 3CI5A 1BHLA 3L2WA 3MCAB 4W5RA 3DLGA 3TSUA 3F9MA 2VG5A 4CFDA 4DU3A 1T44A 4IKFA 5AQIA 1CXQA 3OS0A 2G8FA 4CEFA 4Z4EA 2D0CA 1QVFM 3M3ZA 3HP6A 4KI4A 2JGUA 2QKKA 1NGFA 4BRLA 1OH7A 1BI4A 3O9SA 2HSTA 3I56N 3A2FA 1TYQA 4BRMA 4NLCA 3T69A 2AJQA 1YVUA 3DLHA 1VHXA 2O8BA 1RT5A 1NJXA 4N76A 3LAMA 2YCHA 5DM6L 2X78A 1K8KA 2OPPA 2A42A 4IG3A 2P9KA 4YDUA 3OYGA 2E1ZA 1SV5A 3K0SA 1D8YA 3CFRA 3J81O 3PLAA 3ASMA 3EO3A 3LP2A 3C6AA 4IOCL 2B5JA 1LV5A 4DWIA 4I6MB 4BE0A 1RTHA 4CBXA 5AQYA 1N6QA 3T1AA 3DLRA 1Q8IA 2F96A 4C23A 3JAMO 3JSMA 3BF1A 3NFAA 5C2FA 3FGUA 3O80A 3F2KA 4BRIA 3TAEA 4M41A 1KXPA 4FK2A 1N5YA 4B3MK 4DQIA 4BE1A 1C1AA 4A61A 3C7NA 5BPNA 4YOXA 1Y64A 5AQQA 1ATRA 4JEPA 4CK3A 4FW1A 1BGXT 3L6QA 4KAZA 3O3HA 2NZTA 1KVBA 3CFPA 2I5JA 3NHGA 4O55A 2HBLA 1HKGA 4BR7A 1SZ2A 3CM6A 3ZSVA 5GAEP 2P9IA 4FWRA 1T8EA 1NMDA 4BRAA 4LH4A 5HRNA 1T6DA 1YTAA 2Z1HA 4EAHD 3WNGA 4BR4A 2A40A 3UB5A 2Q0UA 3V9WA 4QS9A 3A5LC 4EHUA 3VQCA 4W5OA 1I94K 3ULDA 1TGOA 4AILC 3PY8A 3VQQA 5BRHA 1N33K 2D5RA 3QFUA 5LMNK 4ELUA 5J2NA 2A3ZA 3PO4A 2IAJA 1HRHA 2A1SA 3CHWA 4LF6K 2WFBA 1ATNA 3LP0A 5AQOA 4KBOA 3ENOA 1K8KB 1E3MA 1OVQA 5AQKA 1DEJA 3M1FA 3SV3A 1GLBG 5C25A 1S1VA 3EY1A 3HM8A 4CHYA 1U2VA 3AVGA 1GLLO 4B9TA 3IDHA 5CYMA 4BDPA 4E3SA 3NVMA 4GW6A 3U9ZA 3DXMB 3VA0A 1YITN 2FC0A 2Y1JA 3DI6A 1P8ZA 1RBVA 3EE9A 4BWJA 4QS8A 4A5BA 3CM5A 4FLUA 2F9TA 4CHPA 4FZZA 2QEXN 1O1WA 1BIUA 3VOVA 4CZIA 1VSEA 4YY3K 3RMCA 3EKSA 4RCHA 3V1OA 3DLLL 3RSEA 1T6CA 3AVHA 4MQ3A 1QSYA 3VERA 3DYAA 4Y0WA 1RT1A 2G8WA 2YKMA 2IS3A 3ALYA 1ASUA 2E2PA 3TANA 3NCIA 1NKEA 2P9SA 1JCFA 3DOKA 3DRPA 4H5NA 3O4WA 3VEZA 3HPOA 1M90O 3BZKA 3GE1A 1VRUA 2KHOA 4DV2K 3ITHA 4E7JA 2D0OA 1RTJA 3VQEA 3QESA 3T1YK 1MA9B 1O13A 3HP9A 1NK6A 3MN9A 3CC7N 4BC2A 3KK3A 1SL1A 1VK0A 3HL8A 5AQUA 3NH0A 4JLHA 4CHNA 2Z1JA 5C42A 1FK9A 1ZBIA 3MDQA 2RKIA 2E2NA 2G8UA 2EWSA 2Q3SA 3IRXA 4LD0A 1HNIA 2O8FB 2DTUA 4CEOA 3BUZB 3NVKA 4DLEA 4RW8A 5HRRA 3KLHA 1LW2A 4XIUA 4W5NA 3ZT2A 4WQ4A 5EY4A 1J5EK 4BRGA 4NXNK 4M3ZA 4PKIA 3OYHA 5CE3A 1NJWA 4LFCK 4JKBA 4C8KA 3TAFA 2F9WA 3MECA 3CCRN 1X9WA 3SJHA 4DU4A 3A5MC 4E7LA 1CLQA 3VQBA 3DWLA 4DLGA 3RSEB 4BC5A 5SZTA 3EZ5A 3PX4A 4FJJA 4FYDA 3IG1A 3OYFA 1WNSA 1JXBA 4CVNE 2UUAK 1NJZA 3VQ9A 4E7HA 4NYNA 4K0KK 2P9SB 2D4WA 1GOBA 1U49A 3V4IA 4F2SA 4M45A 2HHQA 4XH5A 4NCBA 1YJWN 1ZYQA 2O8DA 1W0HA 4HWIA 3IMXA 5JLHA 3ZSZA 3NDKA 1VQ8N 4FJMA 3ISNC 3LL3A 1HJRA 5LJWA 4E19A 4KHUA 3KWGA 1S1WA 4IWVA 4MDBA 3ZCMA 1QE1A 5BR8K 2E2OA 4BRFA 4DUYK 1RDDA 3V9ZA 4DFMA 3TABA 3RMDA 4W5TA 4BR9A 3NH2A 1E4FT 1TKXA 3RVCA 3V9XA 2HVHA 3J7AP 4ILJA 4CF1A 2HB5A 1U4BA 1JLCA 1KCFA 3MXMA 1Q9XA 3NAEA 1L5UA 4DQSA 1VQLN 3M6GA 4M7XA 4DG1A 3UE5A 1P90A 1QZ5A 3UKRA 3CYMA 1XMQK 3KJVA 3H45C 4ISFA 4FJ5A 2WTUA 4G9ZA 3WEEB 4JI7K 3U9DA 3B6PA 2QWOA 1JXEA 2QA4N 4NYFA 2OYQA 3S41A 5IWAK 1NK8A 3EZWA 1CZBA 4OKKA 3QO9A 3VF4A 3THXA 1R59O 3CCJN 1D9FA 1OH6A 4M3YA 4O5BA 1KAZA 3ZX3A 3RRGA 1NGBA 4CZLA 4BVOA 2BUPA 1S72N 4CD3A 1ASWA 2F8TA 3KK7A 3HRGA 1L3TA 3THWA 5E84A 3O4QA 2HNYA 3UIQA 1YJNN 4EP5A 3D7EO 4C1NI 1VSHA 4RW6A 4DUZK 4M42A 2YKNA 4Z4CA 2ZJRL 1VSFA 2WUSA 1LAVA 4BC3A 4JRPA 2QXFA 4OPJA 3HVRA 3CF5L 3BZCA 1SL0A 4CE9A 3HO1A 5EVZA 1KFSA 1U6ZA 3VQ5A 3ATVA 3LM2A 3P1GA 3RMBA 5H1SQ 4H0TB 3OS2A 1A5WA 4CJWA 4JI0K 2PZSA 3QETA 3CFOA 4K8XA 5FROA 2JLEA 3M8SA 1BCOA 4CF2A 2YHXA 2A1RA 3S3OA 1BA1A 1GOCA 3QINA 5DMRA 1K8AO 5GINA 3AVIA 3RRHA 1LCUA 3D2FA 3R1XA 5LL6Z 3HSCA 1ILYA 5LY3A 4X62K 4H5VA 4L3QA 2QWNA 4LY7A 3TTDA 2FF6A 4JKCA 5ELZA 3K57A 2YNHA 4PHTX 4B3RK 3KLGA 4E7KA 1KFDA 4CEDA 3N4PA 3K9KA 4HVJA 3CCVN 3Q7CA 4M3XA 3J7ZO 4PL8A 3ZT3A 4CBUA 4LF7K 3QEWA 4CK2A 1VQKN 2HHTA 4WQ5C 2PYLA 3G25A 4IDHA 2GWJA 1TUYA 4CFBA 1BCMA 1GLFO 1BUPA 2QWLA 4C8LA 3CIPA 4CJTA 2OZMA 3U8XA 4B08A 3P39A 1QQCA 1JLBA 5AZIA 1RILA 3QBWA 2HHSA 2P9PA 1RBSA 3K5LA 1NK9A 4FLYA 3E01A 3M8RA 2XO7A 1XNQK 1S1XA 1JCGA 4HUEA 4FK0A 1OVYA 5HLFA 4OPAA 3WQUA 3O08A 1X9MA 3BDPA 1S9EA 1B9DA 4BWMA 1JL2A 2ZQBA 1C6VA 4OPKA 3CJCA 1BQMA 4CJ4A 3WXJA 4DSEA 1YI2N 1S9GA 4FLWA 3CJ1A 4O44A 3SBGA 3CCUN 1NK0A 3VQAA 2W40A 1IH7A 3L4QA 3F5TA 4KKOA 4DTRA 4DTXA 1ZBHA 3WUHA 1OH8A 1QQNA 4RTFD 5TKWA 4YORA 2HBJA 3ID8A 4JD2B 1HYVA 1UWBA 3LPTA 4IBNA 3HJFA 4JV5K 2GBZA 4UQGA 2HHXA 2E6MA 1KQSM 3UKUA 5EOYA 1VQNN 1YHQN 1KAXA 5GIPA 4XH1A 1D4XA 1JJ2M 5CR4A 2CH6A 1SKRA 4FJ7A 3WNHA 5HL7L 3MEGA 2O4GA 2GTDA 3FZHA 3O9RA 3THVA 3H3NO 4HCCA 3RWUA 1VQ7N 4DR2K 3MCPA 4I7FA 2ZJQL 3D2EA 3VESA 1NJIO 1NKBA 3IAYA 1EWRA 5SWMA 4EFHA 4KPYA 1D9DA 1TAUA 3LZJA 2ZWHA 4DKWA 4GKJK 1TVRA 3QERA 4B1YB 1V4TA 1HJOA 4Z4HA 4DTSA 3O3GA 1G15A 2X6NA 4Y1CA 5BPMA 1NGDA 3JYTA 3MEEA 5C15A 1XHZA 3JS6A 4H0VB 3QIPA 5BN8A 3OBYA 1HKCA 3ZX2A 3TAPA 4RWTA 2NUBA 4F8RA 4V19S 3ZSRA 3FFKB 1NGGA 2P9UA 1XWLA 4QCLA 1JLGA 3KK2A 5A2QO 1C0GA 2VG6A 3SUNA 4XEIA 3TTFA 1HX1A 2W42A 1EQYA 4DV7K 3O1WA 1WSHA 3BEXA 4JI1K 3AO5A 3CQ8A 4GY2B 1NLVA 3AGRA 4JKGA 3HOSA 4KFBA 4Y1DA 3UKUB 3HVTA 1KC8O 1JKHA 3RMAA 4CEQA 1WUAA 4B9MA 4DFJA 3A5NC 4YOWA 2NRWA 1JLQA 2IGIA 4O4GA 1EO1A 1RDUA 1BIZA 4IFYA 3NF8A 3S9HA 3BF3A 4B9LA 4KB0A 2W6LA 3WXKA 2Q36A 3U3YA 3WXIA 5M1FA 4DTMA 1NGEA 4DSKA 4PA1A 1IKVA 3F73A 1T7PA 2OTLN 3D2EB 4DMNA 1GLEG 4XH4A 4FWQA 2OZSA 1IBKK 3D0PA 3L4IA 3C94A 4FJLA 2YI1A 1W7AA 3SNNA 1NK4A 2CGJA 3AVJA 3K9JA 1VQON 3QNNA 4M7YA 4QS7A 2HMIA 2ASOA 1TL3A 4M3TA 4ELTA 3G0ZA 2O8EA 4I9LA 2D0AA 4CECA 5GIOA 2ZGYA 3VF2A 3AVKA 2QI2A 4QOZB 5M1PA 4FCYA 1U45A 5BR9A 4LF9K 2ZJPL 4FJIA 4Z0UA 5KGWA 4CZHA 3CXCM 4DCHA 4M3RA 4K25A 1JLEA 4IO9L 1UA0A 2V7YA 4KH4A 5F2RA 4C1NK 4DR7K 3HPGA 3WXMB 4CZJA 1ESVA 4GKKK 2GUPA 1BA0A 2YNGA 5ADXH 1BI4B 3HSTB 3ZT4A 1UAXA 4DS4A 3KLIA 4KRFA 2IOCA 4AHRA
chains in the Genus database with same CATH topology
4DU4A 4I9QA 1F21A 3NF6A 1EETA 1Z26A 1JLFA 1WSIA 4E7LA 1CLQA 3VQBA 3OYLA 3QEVA 4DLGA 3LP3A 3LWMA 1UOCA 2LSNA 1QSSA 5SZTA 3EZ5A 3PX4A 4FJJA 4FYDA 3AVCA 5K14A 3IG1A 3OYFA 4KREA 4CJUA 2P5OA 4LSNA 4CJKA 1WNSA 1JXBA 3HYFA 3SCXA 1SUQA 4FVMA 4OJRA 2XHBA 3I0SA 1NJZA 3VQ9A 4N5SA 2VWJA 4E7HA 4NYNA 3C6UA 4C8NA 1ZBFA 2WOMA 1NKCA 4KB1A 1WSGA 2HHWA 3AVLA 4Q0BA 4H8KA 1RBRA 3VA3A 4CF9A 2X6SA 1GOBA 1RCHA 4CF8A 3V4IA 1U49A 1FKOA 4F2SA 3T19A 3V6DA 2B4JA 4M45A 3QEXA 1X1PA 1QTMA 2HHQA 1LWFA 4CJFA 1SKWA 4NCBA 4M3UA 2HHVA 1VSDA 3AVBA 1W0HA 1ZYQA 2R7YA 4N41A 3ZSZA 3NDKA 3SZ2A 5CY4A 2Z1GA 3ISNC 4FJMA 3AA5X 3F9KA 3DLEA 1HJRA 3AO4A 1S5JA 4KV8A 3U6FA 1R0AA 4E19A 4KHUA 3HXMA 1S1WA 4CGDA 5FRMA 2VWKA 4F4KA 3ZCMA 1B9FA 2FBYA 3M8PA 1QE1A 1J5OA 1U04A 4M3WA 4O0IA 5FRNA 1RDDA 3V9ZA 4DFMA 4CHQA 1SKSA 1ITGA 4CEZA 3TABA 3TAQA 4DFKA 3RMDA 3TARA 3S3MA 2GUIA 4W5TA 4FLTA 1IG9A 2KTQA 4FLXA 4GVMA 3ZSYA 3NH2A 1S1UA 2YNIA 4AH9A 3PUFA 3VQ4A 3G10A 1JLAA 3ZSWA 1TKXA 3K5MA 3V9XA 3RR8A 2HVHA 4CGHA 2HNDA 1LWCA 1U48A 2G8HA 4JS5A 4CF1A 5CZ2A 3ZT0A 2HB5A 4RG8A 1U4BA 1JLCA 1IKXA 1KCFA 4CJPA 3O3FA 3MXMA 1RBTA 3NAEA 2XY6A 3OYNA 4DQSA 5CYQA 1L5UA 3AVAA 4PUOA 2G8WA 4LH5A 1TV6A 3AO1A 4CHOA 1ZBUA 5JS1A 3VQDA 4DG1A 4Z4FA 4B8CA 5KRTA 1T05A 3OYAA 2PY5A 3NE6A 2E6LA 5HRSA 3CYMA 4I2PA 1TKDA 1C1CA 3KJVA 2YHBA 1VSIA 4FJ5A 3OYJA 3TWHA 3DMJA 3QNOA 1Z25A 2IDOA 3U3GA 3ZSQA 4Q5VA 3B6PA 1RDBA 3KTQA 1RT4A 4ICLA 4OGCA 3TI0A 4F3TA 1JXEA 3LPUA 3SV4A 4NYFA 4DFPA 2OYQA 4CERA 1WSEA 1FKPA 1YT3A 3O4NA 1NK8A 1CZBA 1J54A 3QO9A 4OKKA 5I3UA 2OPRA 3LANA 3OS1A 1WSJA 1L3UA 2FBVA 4HCBA 1YTUA 3QEIA 1D9FA 4AHVA 4M3YA 4FZXC 1A5VA 4O5BA 3WNEA 3RRGA 3NGIA 3KLFA 4FJXA 3QEPA 3HK2A 4PWDA 3BGRA 2RF2A 1ASWA 1TAQA 3B6OA 2F8TA 2OA8A 1JL1A 3KK1A 5HRPA 2ITGA 1L3TA 4B9NA 1CZ9A 1SL2A 3VN5A 2VG7A 2Z1IA 5KRSA 3O4QA 4CHZA 3RR7A 2HNYA 3UIQA 2IC3A 3K5NA 4CJEA 4FXDA 1RT6A 3VQPA 4G1QA 2KZMA 4RW9A 4CEBA 4EP5A 2ZD1A 4OKJA 1VSHA 4RW6A 1REVA 3SQ0A 4DTUA 1S6QA 3ZT1A 4M42A 2F8SA 2DY4A 2YKNA 4Z4CA 4O0JA 4EZ9A 1VSFA 4CJLA 1LAVA 2HNZA 1B92A 1C0MA 3AA2A 3OYCA 1KSPA 1HYZA 3LDSA 4KTZA 3H08A 2QK9A 4QAGA 3OYEA 4JRPA 2QXFA 4OPJA 3HVRA 4NCAA 3P5JA 1Y97A 4CE9A 1SL0A 3HO1A 3L2VA 1KLNA 1KFSA 1XHXA 3VQ5A 4AHUA 1KRPA 4FLVA 3P1GA 4OLBA 1J53A 4KTWA 3L2QA 1KLMA 3RMBA 4KHQA 3OS2A 2P5GA 3KD1E 1A5WA 4FM2A 4CCHA 4CJWA 1BISA 1UA1A 3OY9A 1IKYA 1WLJA 2PZSA 4DSLA 3QETA 3CFOA 3C6TA 4FJHA 4K8XA 3LAKA 5FROA 2JLEA 4HUFA 1TL1A 1RBUA 3M8SA 1J9AA 4OLAA 4OGEA 1BCOA 4CF2A 3L8BA 1QHTA 1DTQA 2A1RA 3S3OA 1LWEA 3TR8A 1HQUA 3SUQA 3OYBA 3K5OA 3KKSA 4RW4A 4OVLA 4DQQA 1GOCA 3QINA 5DMRA 4FM1A 1RT7A 4DTJA 3AVIA 1HMVA 4BDYA 3RRHA 2ETJA 3L2RA 3AA3A 3L3UA 2KW4A 3WNFA 4F3OA 2FBXA 3NGZA 3KLEA 2KFNA 2KFZA 1KTQA 4HUGA 1RTDA 1HPZA 2QKBA 3AO3A 4FK4A 5T7BA 4FJ8A 1EKEA 4LY7A 3MAQA 4OKEA 1TK0A 4DQPA 3K57A 2YNHA 4DSJA 2OPQA 1L3VA 1HYSA 4TSXA 1IKWA 1BHLA 3V1QA 2HHUA 4DSIA 3L2WA 4CGFA 2XRIA 3KLGA 4E7KA 3CG7A 1HNVA 1KFDA 4CEDA 4W5RA 3DM2A 3DLGA 4HVJA 3V9UA 2YNFA 1L3SA 2VG5A 4CIGA 2BDPA 1MU2A 3AA4A 4CFDA 4FJ9A 4M3XA 4DU3A 4IKFA 1CXQA 3ZT3A 3OS0A 3QEWA 2G8FA 4CEFA 4CK2A 4Z4EA 3AV9A 2D0CA 3HP6A 2HHTA 4KI4A 2JGUA 2QKKA 4B9UA 2PYLA 4JS4A 1K6YA 3IS9A 1BI4A 4CFBA 1BCMA 1RNHA 4C8LA 5CZ1A 1TK8A 4CJTA 1VSLA 2OZMA 3MEDA 4B08A 2YHAA 3A2FA 4WE1A 1QQCA 1JLBA 3I0RA 4H4OA 2AJQA 1RILA 1DLOA 1YVUA 4FW2A 2HHSA 1XC9A 1RBSA 1IO2A 4IDKA 3K5LA 1NK9A 4FLYA 3DLHA 1DTTA 3E01A 3VQ7A 1RT5A 4DSFA 1NJXA 4DQRA 4N76A 3M8RA 4HHTA 3LAMA 2XO7A 3DLBA 1S1XA 4HUEA 3T3FA 4FK0A 3P83D 4CJSA 3NH1A 3HPHA 5HLFA 3ZSOA 1KVCA 4CJ5A 2X78A 5FDLA 2OPPA 1X9MA 4IG3A 3BDPA 3VQ8A 1S9EA 1B9DA 2D0BA 2EHGA 4BWMA 1JL2A 2ZQBA 4AHCA 1SV5A 3OYGA 1C6VA 4ZTJA 2WONA 4DTNA 1D8YA 4FJGA 4ID5A 5E41A 4OPKA 4YFUA 3CFRA 1BQMA 1D5AA 4CJ4A 4E1NA 1W9HA 4DSEA 1RDAA 3ASMA 3LP2A 3KKRA 4F2RA 1S9GA 2ZE2A 4FLWA 2XY7A 4O44A 1NK0A 1CXUA 2B5JA 3AVFA 1LV5A 4DWIA 3VQAA 4BE0A 3V81A 4CF0A 3OJUA 1IH7A 4KKOA 3SQ4A 1RTHA 3M8QA 4DTRA 1N6QA 1VRTA 4DTXA 1ZBHA 4CIFA 4ZTFA 3T1AA 5KTQA 3OYMA 4RW7A 3DLRA 1Q8IA 2F96A 1GOAA 3JSMA 3NFAA 1ZBLA 4EP4A 4FM0A 1HYVA 3TAEA 3ZSXA 4KI6A 3DRSA 1UWBA 4M41A 3LPTA 1RT2A 4CGGA 1N5YA 1QSLA 4FK2A 3LP1A 4IBNA 1EX4A 1C1AA 4BE1A 4E7IA 5I42A 4DQIA 2GBZA 1S1TA 4UQGA 4DF4A 3HJFA 2HHXA 2E6MA 4AHSA 3SQ1A 4CK3A 4FW1A 4CJVA 1BGXT 3HM9A 4DU1A 4BDZA 2HW3A 4K8ZA 3RTVA 4KAZA 4NCGA 3O3HA 1KVBA 3CFPA 2I5JA 3DLKA 4O55A 3NHGA 3D45A 2P51A 3LZIA 2KQ2A 4FJKA 3CM6A 3ZSVA 1SKRA 4DS5A 4B9SA 1T8EA 4FJ7A 1T03A 3TAMA 4LH4A 5HRNA 1EP4A 3WNHA 4CEAA 3MEGA 1YTAA 2O4GA 4KHYA 4CGIA 2Z1HA 3THVA 4HCCA 4CK1A 4I2QA 3RWUA 3WNGA 1NK7A 1S6PA 3V9WA 4I7FA 4Z4GA 3VQCA 4C8OA 4W5OA 4FZYA 4ZHRA 3ULDA 1TGOA 1XI1A 4AILC 3PY8A 3HT3A 4CJQA 3VQQA 5DK5A 1NKBA 1C0TA 3IAYA 5SWMA 1LW0A 2D5RA 4R5PA 4KPYA 2G8VA 1D9DA 4ELUA 2ATQA 5J2NA 1RT3A 1EXQA 3PO4A 1TAUA 2IAJA 3LZJA 3I8DA 5J2PA 1HRHA 2A1SA 4BACA 3SPYA 2DFHA 4E0DA 3LP0A 2B6AA 1TVRA 3QERA 2DFEA 4Z4HA 4JRQA 4DTSA 3O3GA 1G15A 5HBMA 3SV3A 5J2QA 3PX6A 4L8RB 5C25A 1RTIA 1S1VA 3EY1A 2X6NA 4Y1CA 4CHYA 3EYZA 3AVNA 5D3GA 3AVGA 3JYTA 3OJSA 2X74A 3MEEA 4IG0A 4B9TA 5CYMA 4BDPA 1XHZA 4YNQA 4E3SA 5KI6A 4PQUA 3QIPA 5C24A 3TAPA 2NUBA 4GW6A 5EU7A 3VA0A 5HROA 4F8RA 3AVMA 4Z4IA 2FC0A 3ZSRA 3SUPA 4E1MA 1VSMA 1XWLA 2Y1JA 3DI6A 4CFAA 4QCLA 1JLGA 3KK2A 1RBVA 3DOLA 4BWJA 4PY5A 2VG6A 3SUNA 3V9SA 3L2UA 3LALA 2W42A 4KHSA 2YV0X 3CM5A 1WSHA 4FLUA 4BE2A 4HTUA 4N47A 3AO5A 1C1BA 1TKTA 4CHPA 3CQ8A 3SI6A 4LSLA 4FZZA 1O1WA 1BIUA 4B9VA 4J2EA 1KVAA 1VSEA 4C8MA 2GV9A 3QIOA 2Y1IA 2HVIA 4KFBA 4Y1DA 4DTOA 4ELVA 4CGJA 3HVTA 3RMCA 2KZZA 3V1OA 4KO0A 4B8AB 1X9SA 1LAWA 1BL3A 1JKHA 3RMAA 4CJ3A 3AVHA 3NF9A 4CEQA 2E4LA 4CJRA 4MQ3A 1QSYA 4B9MA 4DFJA 3FFIA 4EZ6A 3OYDA 1JLQA 2RPIA 2IGIA 3DYAA 5HP1A 4O4GA 1NJYA 2BGGA 1RT1A 4J2DA 1BIZA 2YKMA 3NGYA 2IS3A 3ALYA 3NF8A 4IFYA 5JS2A 1ASUA 4DF8A 3S9HA 3TANA 4B9LA 4KB0A 4GMJB 3NCIA 3AO2A 4AHTA 3U3YA 1NKEA 1NOYA 3V1RA 4B3OA 4E89A 4DTMA 3KIOA 3DOKA 3DRPA 4KTQA 3HPOA 3S3NA 4DSKA 4PA1A 3MXJA 3SYZA 1VRUA 4J2BA 1IKVA 2EX3A 3F73A 4KHNA 2G8KA 3ITHA 1T7PA 3KD5E 4E7JA 1ASVA 1RTJA 3VQEA 4DMNA 4DTPA 3QESA 1A5XA 3PO5A 1Q9XA 1VSKA 3HP9A 4ID1A 5KGXA 1NK6A 3SUOA 3KK3A 2OZSA 1HQEA 5J1EA 3LWLA 1SL1A 2RN2A 1C0UA 1VK0A 1TKZA 3HL8A 3NH0A 3D0PA 1QS4A 4JLHA 2XY8A 3C94A 3K2PA 4CHNA 4FJLA 4CFCA 2Z1JA 5C42A 2P1JA 3SNNA 1FK9A 1FXXA 1RDCA 3AVJA 4N56A 4MFBA 3QNNA 1NK4A 1ZBIA 2RKIA 3QLHA 1WSFA 3K59A 2G8UA 2Q3SA 3IRXA 3NF7A 2HMIA 2FBTA 4LD0A 3MXIA 2DFFA 1HNIA 3SQ2A 3PV8A 4J2AA 2PYJA 2DTUA 1TL3A 4CEOA 4CEEA 4ELTA 3G0ZA 4H4MA 1NK5A 2BANA 4I9LA 4M3TA 3K58A 2D0AA 4CECA 4DLEA 3L3VA 4RW8A 4CESA 1TK5A 1NOZA 3AVKA 4W5QA 4FJNA 4QOZB 5HRRA 3NBPA 1I39A 4CIEA 4FCYA 1U45A 3SPZA 1VSJA 1LW2A 1WN7A 3DRRA 4Z0UA 5KGWA 4XIUA 1I3AA 3KLHA 4FLZA 3TAGA 4FJIA 4W5NA 4M3RA 3ZT2A 1U47A 1JLEA 1UA0A 2G8IA 3OYIA 4M3ZA 2XY5A 1BQNA 3C95A 3OYHA 1Q9YA 1NJWA 2OPSA 3HPGA 5J2MA 3PX0A 1WAJA 3VQ6A 2YNGA 4DS4A 1BI4B 3HSTB 2BE2A 1UAXA 1WAFA 3KLIA 3OVNA 4IFVA 3ZT4A 3TAFA 3SJJA 4C8KA 2IOCA 4KRFA 2O4IA 3MECA 3OYKA 4KHWA 4AHRA 1X9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DU4 A;  4I9Q A;  1F21 A;  3NF6 A;  1EET A;  1Z26 A;  1JLF A;  1WSI A;  4E7L A;  1CLQ A;  3VQB A;  3OYL A;  3QEV A;  4DLG A;  3LP3 A;  3LWM A;  1UOC A;  2LSN A;  1QSS A;  5SZT A;  3EZ5 A;  3PX4 A;  4FJJ A;  4FYD A;  3AVC A;  5K14 A;  3IG1 A;  3OYF A;  4KRE A;  4CJU A;  2P5O A;  4LSN A;  4CJK A;  1WNS A;  1JXB A;  3HYF A;  3SCX A;  1SUQ A;  4FVM A;  4OJR A;  2XHB A;  3I0S A;  1NJZ A;  3VQ9 A;  4N5S A;  2VWJ A;  4E7H A;  4NYN A;  3C6U A;  4C8N A;  1ZBF A;  2WOM A;  1NKC A;  4KB1 A;  1WSG A;  2HHW A;  3AVL A;  4Q0B A;  4H8K A;  1RBR A;  3VA3 A;  4CF9 A;  2X6S A;  1GOB A;  1RCH A;  4CF8 A;  3V4I A;  1U49 A;  1FKO A;  4F2S A;  3T19 A;  3V6D A;  2B4J A;  4M45 A;  3QEX A;  1X1P A;  1QTM A;  2HHQ A;  1LWF A;  4CJF A;  1SKW A;  4NCB A;  4M3U A;  2HHV A;  1VSD A;  3AVB A;  1W0H A;  1ZYQ A;  2R7Y A;  4N41 A;  3ZSZ A;  3NDK A;  3SZ2 A;  5CY4 A;  2Z1G A;  3ISN C;  4FJM A;  3AA5 X;  3F9K A;  3DLE A;  1HJR A;  3AO4 A;  1S5J A;  4KV8 A;  3U6F A;  1R0A A;  4E19 A;  4KHU A;  3HXM A;  1S1W A;  4CGD A;  5FRM A;  2VWK A;  4F4K A;  3ZCM A;  1B9F A;  2FBY A;  3M8P A;  1QE1 A;  1J5O A;  1U04 A;  4M3W A;  4O0I A;  5FRN A;  1RDD A;  3V9Z A;  4DFM A;  4CHQ A;  1SKS A;  1ITG A;  4CEZ A;  3TAB A;  3TAQ A;  4DFK A;  3RMD A;  3TAR A;  3S3M A;  2GUI A;  4W5T A;  4FLT A;  1IG9 A;  2KTQ A;  4FLX A;  4GVM A;  3ZSY A;  3NH2 A;  1S1U A;  2YNI A;  4AH9 A;  3PUF A;  3VQ4 A;  3G10 A;  1JLA A;  3ZSW A;  1TKX A;  3K5M A;  3V9X A;  3RR8 A;  2HVH A;  4CGH A;  2HND A;  1LWC A;  1U48 A;  2G8H A;  4JS5 A;  4CF1 A;  5CZ2 A;  3ZT0 A;  2HB5 A;  4RG8 A;  1U4B A;  1JLC A;  1IKX A;  1KCF A;  4CJP A;  3O3F A;  3MXM A;  1RBT A;  3NAE A;  2XY6 A;  3OYN A;  4DQS A;  5CYQ A;  1L5U A;  3AVA A;  4PUO A;  2G8W A;  4LH5 A;  1TV6 A;  3AO1 A;  4CHO A;  1ZBU A;  5JS1 A;  3VQD A;  4DG1 A;  4Z4F A;  4B8C A;  5KRT A;  1T05 A;  3OYA A;  2PY5 A;  3NE6 A;  2E6L A;  5HRS A;  3CYM A;  4I2P A;  1TKD A;  1C1C A;  3KJV A;  2YHB A;  1VSI A;  4FJ5 A;  3OYJ A;  3TWH A;  3DMJ A;  3QNO A;  1Z25 A;  2IDO A;  3U3G A;  3ZSQ A;  4Q5V A;  3B6P A;  1RDB A;  3KTQ A;  1RT4 A;  4ICL A;  4OGC A;  3TI0 A;  4F3T A;  1JXE A;  3LPU A;  3SV4 A;  4NYF A;  4DFP A;  2OYQ A;  4CER A;  1WSE A;  1FKP A;  1YT3 A;  3O4N A;  1NK8 A;  1CZB A;  1J54 A;  3QO9 A;  4OKK A;  5I3U A;  2OPR A;  3LAN A;  3OS1 A;  1WSJ A;  1L3U A;  2FBV A;  4HCB A;  1YTU A;  3QEI A;  1D9F A;  4AHV A;  4M3Y A;  4FZX C;  1A5V A;  4O5B A;  3WNE A;  3RRG A;  3NGI A;  3KLF A;  4FJX A;  3QEP A;  3HK2 A;  4PWD A;  3BGR A;  2RF2 A;  1ASW A;  1TAQ A;  3B6O A;  2F8T A;  2OA8 A;  1JL1 A;  3KK1 A;  5HRP A;  2ITG A;  1L3T A;  4B9N A;  1CZ9 A;  1SL2 A;  3VN5 A;  2VG7 A;  2Z1I A;  5KRS A;  3O4Q A;  4CHZ A;  3RR7 A;  2HNY A;  3UIQ A;  2IC3 A;  3K5N A;  4CJE A;  4FXD A;  1RT6 A;  3VQP A;  4G1Q A;  2KZM A;  4RW9 A;  4CEB A;  4EP5 A;  2ZD1 A;  4OKJ A;  1VSH A;  4RW6 A;  1REV A;  3SQ0 A;  4DTU A;  1S6Q A;  3ZT1 A;  4M42 A;  2F8S A;  2DY4 A;  2YKN A;  4Z4C A;  4O0J A;  4EZ9 A;  1VSF A;  4CJL A;  1LAV A;  2HNZ A;  1B92 A;  1C0M A;  3AA2 A;  3OYC A;  1KSP A;  1HYZ A;  3LDS A;  4KTZ A;  3H08 A;  2QK9 A;  4QAG A;  3OYE A;  4JRP A;  2QXF A;  4OPJ A;  3HVR A;  4NCA A;  3P5J A;  1Y97 A;  4CE9 A;  1SL0 A;  3HO1 A;  3L2V A;  1KLN A;  1KFS A;  1XHX A;  3VQ5 A;  4AHU A;  1KRP A;  4FLV A;  3P1G A;  4OLB A;  1J53 A;  4KTW A;  3L2Q A;  1KLM A;  3RMB A;  4KHQ A;  3OS2 A;  2P5G A;  3KD1 E;  1A5W A;  4FM2 A;  4CCH A;  4CJW A;  1BIS A;  1UA1 A;  3OY9 A;  1IKY A;  1WLJ A;  2PZS A;  4DSL A;  3QET A;  3CFO A;  3C6T A;  4FJH A;  4K8X A;  3LAK A;  5FRO A;  2JLE A;  4HUF A;  1TL1 A;  1RBU A;  3M8S A;  1J9A A;  4OLA A;  4OGE A;  1BCO A;  4CF2 A;  3L8B A;  1QHT A;  1DTQ A;  2A1R A;  3S3O A;  1LWE A;  3TR8 A;  1HQU A;  3SUQ A;  3OYB A;  3K5O A;  3KKS A;  4RW4 A;  4OVL A;  4DQQ A;  1GOC A;  3QIN A;  5DMR A;  4FM1 A;  1RT7 A;  4DTJ A;  3AVI A;  1HMV A;  4BDY A;  3RRH A;  2ETJ A;  3L2R A;  3AA3 A;  3L3U A;  2KW4 A;  3WNF A;  4F3O A;  2FBX A;  3NGZ A;  3KLE A;  2KFN A;  2KFZ A;  1KTQ A;  4HUG A;  1RTD A;  1HPZ A;  2QKB A;  3AO3 A;  4FK4 A;  5T7B A;  4FJ8 A;  1EKE A;  4LY7 A;  3MAQ A;  4OKE A;  1TK0 A;  4DQP A;  3K57 A;  2YNH A;  4DSJ A;  2OPQ A;  1L3V A;  1HYS A;  4TSX A;  1IKW A;  1BHL A;  3V1Q A;  2HHU A;  4DSI A;  3L2W A;  4CGF A;  2XRI A;  3KLG A;  4E7K A;  3CG7 A;  1HNV A;  1KFD A;  4CED A;  4W5R A;  3DM2 A;  3DLG A;  4HVJ A;  3V9U A;  2YNF A;  1L3S A;  2VG5 A;  4CIG A;  2BDP A;  1MU2 A;  3AA4 A;  4CFD A;  4FJ9 A;  4M3X A;  4DU3 A;  4IKF A;  1CXQ A;  3ZT3 A;  3OS0 A;  3QEW A;  2G8F A;  4CEF A;  4CK2 A;  4Z4E A;  3AV9 A;  2D0C A;  3HP6 A;  2HHT A;  4KI4 A;  2JGU A;  2QKK A;  4B9U A;  2PYL A;  4JS4 A;  1K6Y A;  3IS9 A;  1BI4 A;  4CFB A;  1BCM A;  1RNH A;  4C8L A;  5CZ1 A;  1TK8 A;  4CJT A;  1VSL A;  2OZM A;  3MED A;  4B08 A;  2YHA A;  3A2F A;  4WE1 A;  1QQC A;  1JLB A;  3I0R A;  4H4O A;  2AJQ A;  1RIL A;  1DLO A;  1YVU A;  4FW2 A;  2HHS A;  1XC9 A;  1RBS A;  1IO2 A;  4IDK A;  3K5L A;  1NK9 A;  4FLY A;  3DLH A;  1DTT A;  3E01 A;  3VQ7 A;  1RT5 A;  4DSF A;  1NJX A;  4DQR A;  4N76 A;  3M8R A;  4HHT A;  3LAM A;  2XO7 A;  3DLB A;  1S1X A;  4HUE A;  3T3F A;  4FK0 A;  3P83 D;  4CJS A;  3NH1 A;  3HPH A;  5HLF A;  3ZSO A;  1KVC A;  4CJ5 A;  2X78 A;  5FDL A;  2OPP A;  1X9M A;  4IG3 A;  3BDP A;  3VQ8 A;  1S9E A;  1B9D A;  2D0B A;  2EHG A;  4BWM A;  1JL2 A;  2ZQB A;  4AHC A;  1SV5 A;  3OYG A;  1C6V A;  4ZTJ A;  2WON A;  4DTN A;  1D8Y A;  4FJG A;  4ID5 A;  5E41 A;  4OPK A;  4YFU A;  3CFR A;  1BQM A;  1D5A A;  4CJ4 A;  4E1N A;  1W9H A;  4DSE A;  1RDA A;  3ASM A;  3LP2 A;  3KKR A;  4F2R A;  1S9G A;  2ZE2 A;  4FLW A;  2XY7 A;  4O44 A;  1NK0 A;  1CXU A;  2B5J A;  3AVF A;  1LV5 A;  4DWI A;  3VQA A;  4BE0 A;  3V81 A;  4CF0 A;  3OJU A;  1IH7 A;  4KKO A;  3SQ4 A;  1RTH A;  3M8Q A;  4DTR A;  1N6Q A;  1VRT A;  4DTX A;  1ZBH A;  4CIF A;  4ZTF A;  3T1A A;  5KTQ A;  3OYM A;  4RW7 A;  3DLR A;  1Q8I A;  2F96 A;  1GOA A;  3JSM A;  3NFA A;  1ZBL A;  4EP4 A;  4FM0 A;  1HYV A;  3TAE A;  3ZSX A;  4KI6 A;  3DRS A;  1UWB A;  4M41 A;  3LPT A;  1RT2 A;  4CGG A;  1N5Y A;  1QSL A;  4FK2 A;  3LP1 A;  4IBN A;  1EX4 A;  1C1A A;  4BE1 A;  4E7I A;  5I42 A;  4DQI A;  2GBZ A;  1S1T A;  4UQG A;  4DF4 A;  3HJF A;  2HHX A;  2E6M A;  4AHS A;  3SQ1 A;  4CK3 A;  4FW1 A;  4CJV A;  1BGX T;  3HM9 A;  4DU1 A;  4BDZ A;  2HW3 A;  4K8Z A;  3RTV A;  4KAZ A;  4NCG A;  3O3H A;  1KVB A;  3CFP A;  2I5J A;  3DLK A;  4O55 A;  3NHG A;  3D45 A;  2P51 A;  3LZI A;  2KQ2 A;  4FJK A;  3CM6 A;  3ZSV A;  1SKR A;  4DS5 A;  4B9S A;  1T8E A;  4FJ7 A;  1T03 A;  3TAM A;  4LH4 A;  5HRN A;  1EP4 A;  3WNH A;  4CEA A;  3MEG A;  1YTA A;  2O4G A;  4KHY A;  4CGI A;  2Z1H A;  3THV A;  4HCC A;  4CK1 A;  4I2Q A;  3RWU A;  3WNG A;  1NK7 A;  1S6P A;  3V9W A;  4I7F A;  4Z4G A;  3VQC A;  4C8O A;  4W5O A;  4FZY A;  4ZHR A;  3ULD A;  1TGO A;  1XI1 A;  4AIL C;  3PY8 A;  3HT3 A;  4CJQ A;  3VQQ A;  5DK5 A;  1NKB A;  1C0T A;  3IAY A;  5SWM A;  1LW0 A;  2D5R A;  4R5P A;  4KPY A;  2G8V A;  1D9D A;  4ELU A;  2ATQ A;  5J2N A;  1RT3 A;  1EXQ A;  3PO4 A;  1TAU A;  2IAJ A;  3LZJ A;  3I8D A;  5J2P A;  1HRH A;  2A1S A;  4BAC A;  3SPY A;  2DFH A;  4E0D A;  3LP0 A;  2B6A A;  1TVR A;  3QER A;  2DFE A;  4Z4H A;  4JRQ A;  4DTS A;  3O3G A;  1G15 A;  5HBM A;  3SV3 A;  5J2Q A;  3PX6 A;  4L8R B;  5C25 A;  1RTI A;  1S1V A;  3EY1 A;  2X6N A;  4Y1C A;  4CHY A;  3EYZ A;  3AVN A;  5D3G A;  3AVG A;  3JYT A;  3OJS A;  2X74 A;  3MEE A;  4IG0 A;  4B9T A;  5CYM A;  4BDP A;  1XHZ A;  4YNQ A;  4E3S A;  5KI6 A;  4PQU A;  3QIP A;  5C24 A;  3TAP A;  2NUB A;  4GW6 A;  5EU7 A;  3VA0 A;  5HRO A;  4F8R A;  3AVM A;  4Z4I A;  2FC0 A;  3ZSR A;  3SUP A;  4E1M A;  1VSM A;  1XWL A;  2Y1J A;  3DI6 A;  4CFA A;  4QCL A;  1JLG A;  3KK2 A;  1RBV A;  3DOL A;  4BWJ A;  4PY5 A;  2VG6 A;  3SUN A;  3V9S A;  3L2U A;  3LAL A;  2W42 A;  4KHS A;  2YV0 X;  3CM5 A;  1WSH A;  4FLU A;  4BE2 A;  4HTU A;  4N47 A;  3AO5 A;  1C1B A;  1TKT A;  4CHP A;  3CQ8 A;  3SI6 A;  4LSL A;  4FZZ A;  1O1W A;  1BIU A;  4B9V A;  4J2E A;  1KVA A;  1VSE A;  4C8M A;  2GV9 A;  3QIO A;  2Y1I A;  2HVI A;  4KFB A;  4Y1D A;  4DTO A;  4ELV A;  4CGJ A;  3HVT A;  3RMC A;  2KZZ A;  3V1O A;  4KO0 A;  4B8A B;  1X9S A;  1LAW A;  1BL3 A;  1JKH A;  3RMA A;  4CJ3 A;  3AVH A;  3NF9 A;  4CEQ A;  2E4L A;  4CJR A;  4MQ3 A;  1QSY A;  4B9M A;  4DFJ A;  3FFI A;  4EZ6 A;  3OYD A;  1JLQ A;  2RPI A;  2IGI A;  3DYA A;  5HP1 A;  4O4G A;  1NJY A;  2BGG A;  1RT1 A;  4J2D A;  1BIZ A;  2YKM A;  3NGY A;  2IS3 A;  3ALY A;  3NF8 A;  4IFY A;  5JS2 A;  1ASU A;  4DF8 A;  3S9H A;  3TAN A;  4B9L A;  4KB0 A;  4GMJ B;  3NCI A;  3AO2 A;  4AHT A;  3U3Y A;  1NKE A;  1NOY A;  3V1R A;  4B3O A;  4E89 A;  4DTM A;  3KIO A;  3DOK A;  3DRP A;  4KTQ A;  3HPO A;  3S3N A;  4DSK A;  4PA1 A;  3MXJ A;  3SYZ A;  1VRU A;  4J2B A;  1IKV A;  2EX3 A;  3F73 A;  4KHN A;  2G8K A;  3ITH A;  1T7P A;  3KD5 E;  4E7J A;  1ASV A;  1RTJ A;  3VQE A;  4DMN A;  4DTP A;  3QES A;  1A5X A;  3PO5 A;  1Q9X A;  1VSK A;  3HP9 A;  4ID1 A;  5KGX A;  1NK6 A;  3SUO A;  3KK3 A;  2OZS A;  1HQE A;  5J1E A;  3LWL A;  1SL1 A;  2RN2 A;  1C0U A;  1VK0 A;  1TKZ A;  3HL8 A;  3NH0 A;  3D0P A;  1QS4 A;  4JLH A;  2XY8 A;  3C94 A;  3K2P A;  4CHN A;  4FJL A;  4CFC A;  2Z1J A;  5C42 A;  2P1J A;  3SNN A;  1FK9 A;  1FXX A;  1RDC A;  3AVJ A;  4N56 A;  4MFB A;  3QNN A;  1NK4 A;  1ZBI A;  2RKI A;  3QLH A;  1WSF A;  3K59 A;  2G8U A;  2Q3S A;  3IRX A;  3NF7 A;  2HMI A;  2FBT A;  4LD0 A;  3MXI A;  2DFF A;  1HNI A;  3SQ2 A;  3PV8 A;  4J2A A;  2PYJ A;  2DTU A;  1TL3 A;  4CEO A;  4CEE A;  4ELT A;  3G0Z A;  4H4M A;  1NK5 A;  2BAN A;  4I9L A;  4M3T A;  3K58 A;  2D0A A;  4CEC A;  4DLE A;  3L3V A;  4RW8 A;  4CES A;  1TK5 A;  1NOZ A;  3AVK A;  4W5Q A;  4FJN A;  4QOZ B;  5HRR A;  3NBP A;  1I39 A;  4CIE A;  4FCY A;  1U45 A;  3SPZ A;  1VSJ A;  1LW2 A;  1WN7 A;  3DRR A;  4Z0U A;  5KGW A;  4XIU A;  1I3A A;  3KLH A;  4FLZ A;  3TAG A;  4FJI A;  4W5N A;  4M3R A;  3ZT2 A;  1U47 A;  1JLE A;  1UA0 A;  2G8I A;  3OYI A;  4M3Z A;  2XY5 A;  1BQN A;  3C95 A;  3OYH A;  1Q9Y A;  1NJW A;  2OPS A;  3HPG A;  5J2M A;  3PX0 A;  1WAJ A;  3VQ6 A;  2YNG A;  4DS4 A;  1BI4 B;  3HST B;  2BE2 A;  1UAX A;  1WAF A;  3KLI A;  3OVN A;  4IFV A;  3ZT4 A;  3TAF A;  3SJJ A;  4C8K A;  2IOC A;  4KRF A;  2O4I A;  3MEC A;  3OYK A;  4KHW A;  4AHR A;  1X9W A; 
#chains in the Genus database with same CATH topology
 1TYQ B;  4CW7 B;  1EET A;  1ZBS A;  1Z26 A;  2VYP A;  1WSI A;  3CQX A;  4JKG B;  3CC2 N;  3OYL A;  2O8B B;  3LP3 A;  3FZL A;  1YIJ N;  4DR1 K;  4FWP A;  4PKG A;  3VMF B;  4KRE A;  4CJU A;  2P5O A;  3HYF A;  3SCX A;  1DKG D;  2XHB A;  3LDN A;  2P9K B;  4N5S A;  3R6M A;  1ZBF A;  2YJE A;  2WOM A;  4BGA A;  4X66 K;  4H8K A;  3VA3 A;  4M63 C;  1GLD G;  2VWB A;  3V6D A;  4JK8 A;  1NGJ A;  4CJF A;  3QIC A;  4IEE A;  2UXD K;  2RHK A;  3AA5 X;  3OHR A;  5M1K A;  4CD1 A;  1R0A A;  3HXM A;  1S22 A;  3VEO A;  3H1V X;  2D0P A;  2QW9 A;  1GLA G;  3C7N B;  4CHQ A;  3O9U A;  5EXW A;  4CEZ A;  3CCQ N;  2ZGZ A;  4LFB K;  2E2Q A;  4FLX A;  3PUF A;  3VQ4 A;  3G10 A;  1IV0 A;  3TU5 A;  4CGH A;  5HOO A;  2G8H A;  4JS5 A;  2P9I B;  3O3F A;  1RBT A;  2XY6 A;  3OYN A;  4PUO A;  4HTL A;  4BRC A;  5AZJ A;  4Z4F A;  4B8C A;  3MN7 A;  2PY5 A;  3NE6 A;  1HNW K;  1HPM A;  1HKB A;  1VSI A;  4IEI A;  4BG9 A;  3QNO A;  4A5A A;  3ZSQ A;  4BG8 A;  4Q5V A;  4R79 A;  4BRH A;  3DXK A;  1FJG K;  3EE8 A;  3LDQ A;  4WQ5 A;  3LPU A;  3SV4 A;  4JHD A;  1XMO K;  5C12 A;  4LFA K;  3ENB A;  5GAG P;  2W41 A;  5AQF A;  4AHV A;  4X64 K;  2AA4 A;  3FR0 A;  3C65 A;  4PKH A;  3NGI A;  3KLF A;  1U2V B;  4PWD A;  1NGI A;  3BGR A;  3WQT A;  2Q2R A;  3KK1 A;  2ASM A;  5AQW A;  1RT6 A;  3SAG A;  3O5B A;  4G1Q A;  4B3S K;  4FXD A;  3P38 A;  2KZM A;  4RW9 A;  4NLB A;  1IBM K;  1BWF O;  5KPT A;  1REV A;  3SQ0 A;  4DTU A;  3ZT1 A;  3CME N;  3VPZ A;  4CJL A;  3OYC A;  1KSP A;  3I33 A;  3LDS A;  4IJN A;  3OYE A;  3P5J A;  1XHX A;  3GG4 A;  4AHU A;  2O8C A;  3G71 N;  4FPA A;  1KRP A;  4FLV A;  4OLB A;  4KTW A;  4KHQ A;  1KLM A;  3HOT A;  2P5G A;  1BIS A;  1IKY A;  5F1X A;  1IBL K;  4H0Y B;  2JWK A;  1TL1 A;  3AAQ A;  1VQP N;  4BY9 C;  1QHT A;  1HQU A;  3SUQ A;  3OYB A;  3O9Q A;  4YOU A;  4OVL A;  1Q86 O;  5FPD A;  4DTJ A;  3WT0 A;  4BDY A;  3AA3 A;  4F3O A;  2WC9 A;  2FBX A;  3O9T A;  4FWM A;  1RTD A;  4FK4 A;  4A57 A;  1EKE A;  4FWL A;  2GX9 A;  4DQP A;  2OPQ A;  3CC4 N;  1HYS A;  4TSX A;  1IKW A;  4BR2 A;  1N36 K;  2XRI A;  1YVN A;  3O6W A;  3DM2 A;  4BC4 A;  3V9U A;  1L3S A;  1W97 L;  4CIG A;  2BDP A;  5FPE A;  1MU2 A;  2P9L A;  3AA4 A;  4IOX A;  2UXB K;  2E1Y A;  4ISE A;  1C0F A;  5FPM A;  4BQL A;  3AV9 A;  4IJA A;  4YDU C;  2BH1 A;  4B9U A;  4JS4 A;  3IS9 A;  1Q7Y O;  1RNH A;  1TK8 A;  1VSL A;  1JCE A;  2YHA A;  4WE1 A;  1K9M O;  4H0O A;  5AQL A;  3I0R A;  4DV4 K;  2KKZ A;  4H4O A;  3R9P A;  4FW2 A;  1XC9 A;  3VQ7 A;  4DSF A;  4DQR A;  1RGI A;  1CZA N;  2P9N A;  3NH1 A;  3HPH A;  3ZSO A;  4CJ5 A;  4U67 L;  1Q81 O;  2D0B A;  2EHG A;  4AHC A;  3HBT A;  2WON A;  4FJG A;  4ID5 A;  5E41 A;  4YFU A;  3ZEU A;  1D5A A;  4PL7 A;  3ZET A;  4JK9 A;  2XY7 A;  4CI6 A;  1W2B M;  3V81 A;  4CF0 A;  2I7N A;  4JKF A;  2CGL A;  1WOQ A;  4A2A A;  3OYM A;  4RW7 A;  1YXQ A;  4KI6 A;  3R8E A;  3ZSX A;  4EIA A;  2O8D B;  1QSL A;  3LP1 A;  5I42 A;  1S1T A;  2A6A A;  4AQY K;  1OKJ A;  4B3T K;  1XC3 A;  4CJV A;  4DU1 A;  4BDZ A;  2HW3 A;  4K8Z A;  2NLX A;  4WFN L;  2QWQ A;  4NCG A;  2Q31 A;  3RTV A;  1KD1 O;  4FJK A;  4DS5 A;  4B9S A;  2P9L B;  1XNR K;  4DV6 K;  2FLO A;  3T7Z A;  2UUC K;  4CEA A;  4CGI A;  4CK1 A;  1NK7 A;  5F0X A;  1BO5 O;  2E8A A;  4JKA A;  2Q97 A;  4FZY A;  5AQN A;  4ZHR A;  3HT3 A;  4CJQ A;  5DK5 A;  1C0T A;  3AY9 A;  2G8V A;  1VQ6 N;  1QQO A;  3UKR B;  1RT3 A;  1EXQ A;  2NRH A;  4BAC A;  4E0D A;  3VEY A;  5TKY A;  4O8K A;  3KWI A;  4JRQ A;  1LOT B;  2QM1 A;  3ID6 A;  3PX6 A;  5J2Q A;  4L8R B;  1RTI A;  4FVU A;  3CQY A;  3SMS A;  3THX B;  4YNQ A;  4O5F A;  3ZET B;  1VQ4 N;  5BRE A;  5EU7 A;  5HRO A;  5JVH L;  3SUP A;  4E1M A;  1VSM A;  4CFA A;  3CCL N;  3THY A;  4BR5 A;  4PY5 A;  4KHS A;  4IFE A;  3L2U A;  2YV0 X;  4BE2 A;  3THW B;  3P31 A;  2Q1N A;  5AQM A;  5JMV A;  1TKT A;  3QB0 A;  3SI6 A;  1VAZ A;  4LSL A;  3VGM A;  2W6K A;  4J2E A;  2NRZ A;  1WB9 A;  4C8M A;  3AAP A;  2HVI A;  4ELV A;  4DTO A;  2KZZ A;  2FXU A;  4KO0 A;  4B8A B;  1BL3 A;  3WXL A;  4CJ3 A;  4EZ6 A;  1X3N A;  4A59 A;  2NRX A;  5HP1 A;  2RPI A;  1NJY A;  4LF5 K;  4J2D A;  4DF8 A;  4NO7 A;  2ZF5 O;  5AQP A;  4GMJ B;  3AO2 A;  4WFA L;  4AHT A;  3MK6 A;  3HTV A;  3J7Y P;  4B3O A;  4JKE A;  4X65 K;  1BDG A;  4FWO A;  3FZF A;  4KTQ A;  4DR4 K;  3MXJ A;  3SYZ A;  4J2B A;  2EX3 A;  4DV1 K;  3A8Y A;  5FLX O;  4KHN A;  5BPL A;  3KD5 E;  5KPZ A;  5CHI A;  4WYB A;  1VSK A;  2QTD A;  5KGX A;  3H46 O;  1HQE A;  4DB3 A;  5J1E A;  1C0U A;  4ILG B;  1QS4 A;  3D2F B;  1RDC A;  4N56 A;  1VQM N;  4MFB A;  1MWK A;  4DR6 K;  5AJ3 K;  1NWK A;  1BG3 A;  3NF7 A;  5JVG L;  3MXI A;  3OBW A;  2DFF A;  3PV8 A;  3SMP A;  5AQS A;  4H4M A;  1NK5 A;  2BAN A;  3L3V A;  2VGN A;  1T3V A;  4CES A;  2QWR A;  4J8F A;  3NBP A;  1I39 A;  4CIE A;  1VSJ A;  1WN7 A;  3DRR A;  2FSK A;  3PIO L;  1X3M A;  4AM6 A;  3BP8 A;  1U47 A;  2G8I A;  2XY5 A;  2H3G X;  3C95 A;  4JAX A;  4DHY A;  5KQD A;  4LC9 B;  5J2M A;  3PX0 A;  1WAJ A;  4B9Q A;  1DGK N;  3OVN A;  2BE2 A;  1WAF A;  4IFV A;  4UY8 O;  1HNZ K;  3VGL A;  3OYK A;  4KHW A;  3VGK A;  1F21 A;  3NF6 A;  1JLF A;  5AZI B;  1EWQ A;  2P9P B;  4DQ8 A;  4IZ9 A;  3LWM A;  1UOC A;  4IO8 A;  2LSN A;  1QSS A;  3CD6 N;  2BTF A;  4A62 A;  1N32 K;  5K14 A;  3I0S A;  3W3D A;  2GEL A;  3B8A X;  3OA9 A;  3CMA N;  2VWJ A;  3QML A;  4BRQ A;  2QWM A;  4DR3 K;  3C6U A;  1NKC A;  4KB1 A;  2IVO A;  3U4L A;  3AVL A;  4ISG A;  3ATU A;  4Q0B A;  1RBR A;  4CF9 A;  3H1Q A;  1RCH A;  4CF8 A;  3T19 A;  1QTM A;  2B4J A;  3QEX A;  1X1P A;  4N41 A;  1GLC G;  3DLE A;  4DV5 K;  1YUW A;  1S5J A;  4GV3 A;  5LMU K;  4CGD A;  5FRM A;  1B9F A;  2FBY A;  3M8P A;  4JI3 K;  1IJJ A;  1ITG A;  3LDP A;  4H5W A;  3SAF A;  4DFK A;  3TAR A;  2KTQ A;  5M1Q A;  4FLT A;  1IG9 A;  1HNX K;  2JWL A;  3ZSY A;  4BRK A;  2UXC K;  1QZ6 A;  3ZSW A;  3K5M A;  2HMP A;  3CCM N;  5MLC Q;  1LWC A;  4NB4 A;  3ZT0 A;  1IKX A;  4NCA A;  5CYQ A;  4LH5 A;  4CHO A;  1ZBU A;  4JI8 K;  2OCE A;  2NNW A;  2IVN A;  4AM7 A;  5M1O A;  4I2P A;  4DV0 K;  3DMJ A;  3DJC A;  2IDO A;  2YHY A;  1J6Z A;  1RDB A;  5AQR A;  3KTQ A;  4F3T A;  1K73 O;  4CZK A;  3KHY A;  4BRN A;  1FKP A;  3O4N A;  4BRP A;  2OPR A;  1L3U A;  2FBV A;  1YTU A;  2A41 A;  4IXC A;  3DXM A;  3OTO K;  3ENH A;  1A5V A;  3R3L A;  4FZX C;  4FJX A;  3QEP A;  3HK2 A;  5E26 A;  1MDU B;  2RF2 A;  5B8H A;  4WCE L;  1TAQ A;  2OA8 A;  1CZ9 A;  4JK7 A;  2Z1I A;  3E66 A;  5KRS A;  1WBD A;  1M1K O;  3RR7 A;  2P9U B;  3VTI A;  2IC3 A;  2ZD1 A;  3A0I X;  3H3O B;  2F8S A;  1S6Q A;  3PIP L;  2DY4 A;  3C6H A;  1OH5 A;  4JN4 A;  3VEN A;  4IOA L;  2HNZ A;  3AA2 A;  4JI5 K;  1N34 K;  4KTZ A;  3H08 A;  4KH6 A;  4B1V A;  4BVP A;  2YJF A;  1VQ5 N;  3L2V A;  1KLN A;  3O8M A;  1J53 A;  3EEQ A;  4FM2 A;  4CCH A;  2CGK A;  1UA1 A;  4DSL A;  1WLJ A;  3M5R A;  3EKU A;  4FJH A;  5AQZ A;  4MLE A;  4OLA A;  3L8B A;  3DAW A;  1DTQ A;  1YAG A;  4FWK A;  3K5O A;  5FPN A;  3TSQ A;  4DQQ A;  3MX2 A;  3L2R A;  2VQF K;  2KW4 A;  3WNF A;  1KTQ A;  2QXL A;  1HPZ A;  2QKB A;  3AO3 A;  5T7B A;  2RE2 A;  3MMV A;  1VQ9 N;  4K41 A;  2O8F A;  3VEX A;  2YHW A;  1GLJ O;  3CJB A;  4DSJ A;  2V52 B;  3V1Q A;  2HHU A;  4DSI A;  4CGF A;  2UU9 K;  3CG7 A;  1HNV A;  2DPN A;  2YNF A;  4A2B A;  2HF4 A;  4FJ9 A;  4MDA A;  2O8E B;  5JLF A;  2HBK A;  3TSP A;  4YOV A;  1K6Y A;  3CPW M;  5CZ1 A;  4FO0 A;  3MED A;  4YOY A;  4BGB A;  3HZ6 A;  3G4S N;  5AFU A;  1SS6 A;  1DLO A;  1IO2 A;  4IDK A;  3N4Q A;  1DTT A;  1Q82 O;  3E9O A;  5EX5 A;  3D6R A;  4B1Z A;  4HHT A;  3VEW A;  4JKH A;  3DLB A;  4YOT A;  3T3F A;  3P83 D;  4CJS A;  3IUC A;  5DM7 L;  1KVC A;  5FDL A;  1IG8 A;  4NXM K;  3TPQ A;  3VQ8 A;  3G6E N;  4ZTJ A;  4DTN A;  2ASP A;  2F4V K;  4E1N A;  1W9H A;  4OO1 J;  1RDA A;  4BRO A;  3KKR A;  4F2R A;  2ZE2 A;  4ILH A;  1CXU A;  3H6E A;  3AVF A;  4H0X B;  3OJU A;  4GVE A;  3SQ4 A;  4K43 A;  3M8Q A;  3GL1 A;  4MO5 A;  3TTC A;  1VRT A;  4CIF A;  4ZTF A;  5KTQ A;  1X9J A;  1GOA A;  1ZBL A;  4EP4 A;  4FM0 A;  3DRS A;  1RT2 A;  4CGG A;  1EX4 A;  5GAD P;  4E7I A;  4DF4 A;  4GV9 A;  1FW6 A;  4AHS A;  3I8B A;  4CJ7 A;  3SQ1 A;  3HM9 A;  3VEV A;  3DLK A;  3D45 A;  2P51 A;  3LZI A;  2KQ2 A;  1DT9 A;  5C10 A;  2FSN A;  3FZM A;  1RDW X;  1T03 A;  3TAM A;  1EP4 A;  4GNI A;  3I55 N;  2UUB K;  4KHY A;  1XUP O;  4I2Q A;  3MN5 A;  4FL9 A;  1YJ9 N;  2D1K A;  2VGM A;  1S6P A;  4CZM A;  4Z4G A;  1ZC6 A;  4C8O A;  2FF3 B;  4LF8 K;  1XI1 A;  1G99 A;  3ZYY X;  3IKM A;  3LM9 A;  5AZJ B;  3WEE A;  1LW0 A;  1TUU A;  4R5P A;  5AQV A;  5I9E B;  2ATQ A;  1QHA A;  1Z05 A;  5J2P A;  3I8D A;  1ZXO A;  1QQM A;  3SLC A;  3SPY A;  2IVP A;  2DFH A;  5BN9 A;  2B6A A;  3AGK A;  2DFE A;  3J8A A;  3QBX A;  2F7T A;  5HBM A;  3SBT A;  3DXK B;  5C0Y A;  4AF1 A;  2PAV A;  1Q18 A;  3MWP A;  3EYZ A;  3AVN A;  5D3G A;  3ULE A;  3OJS A;  2X74 A;  4IG0 A;  4JHD B;  4F9O A;  5KI6 A;  2NRR A;  4PQU A;  1MWM A;  5C24 A;  4BQZ A;  1NGH A;  4Z4I A;  3AVM A;  3CJ9 A;  2FSJ A;  4MLH A;  3C0B A;  3BY5 A;  1KAY A;  2HBM A;  2ITM A;  3DOL A;  3V9S A;  3LAL A;  3CER A;  5ADX A;  3GDQ A;  4HTU A;  4Z94 A;  4N47 A;  1C1B A;  3P4I A;  4B9V A;  3E1Y A;  1KVA A;  2GV9 A;  4B1U B;  3QIO A;  3CJA A;  2Y1I A;  4FSV A;  5M1N A;  3PSF A;  4CGJ A;  4JI2 K;  3JXU A;  4WF9 L;  1X9S A;  1LAW A;  3NF9 A;  4CJR A;  2E4L A;  3FFI A;  4JKD A;  3OYD A;  2BGG A;  1XQS C;  3NGY A;  1SAZ A;  5JS2 A;  5AQT A;  5BRF A;  3E9L A;  2O8C B;  2CH5 A;  2GWK A;  2VQE K;  5JIC A;  1NOY A;  4KHP K;  3V1R A;  4E89 A;  3KIO A;  3S3N A;  3MN6 A;  3E9P A;  2G8K A;  2V7Z A;  3GOI A;  1ASV A;  3PO5 A;  4DTP A;  1A5X A;  1NU0 A;  4ID1 A;  5AQH A;  4OX9 K;  5LJV A;  3SUO A;  1NGC A;  3VF6 A;  3LWL A;  3ZX0 A;  2RN2 A;  1TKZ A;  2XY8 A;  4E1J A;  2OAN A;  3K2P A;  4CFC A;  4H5T A;  2P1J A;  1FXX A;  4K42 A;  3FZK A;  3QLH A;  1WSF A;  3K59 A;  2WBN A;  3OW2 M;  1N8R O;  2FBT A;  5AQG A;  3SQ2 A;  2PFU A;  2PYJ A;  4J2A A;  3AAR A;  4CEE A;  1H1V A;  4YHH K;  3K58 A;  3ULE B;  4FWS A;  1TK5 A;  1NOZ A;  1HUX A;  4W5Q A;  4FJN A;  3MWT A;  4JNE A;  1YF5 L;  2ZM6 K;  4FLZ A;  3SPZ A;  2E20 A;  3TAG A;  1I3A A;  2UYT A;  4MO4 A;  3OYI A;  1BQN A;  3O1B A;  4DV3 K;  1BU6 O;  4H5R A;  1Q9Y A;  2OPS A;  4CZF A;  4BRD A;  3Q7B A;  3VQ6 A;  3SJJ A;  2O4I A;  4H0P A;  3MX5 A;  4I9Q A;  4BRE A;  4CBW A;  3QEV A;  2VCP A;  4GV6 A;  2J4R A;  5C2D A;  2P9N B;  3AVC A;  2E88 A;  3L0Q A;  4LSN A;  4CJK A;  1SUQ A;  4FVM A;  4OJR A;  4O8U A;  5IT9 O;  2HOE A;  3CET A;  4C8N A;  1QVG M;  3ZEU B;  3CCE N;  3NMU A;  1WSG A;  2A5X A;  2HHW A;  4FOE A;  1NM1 A;  3W0L A;  1NGA A;  2X6S A;  2HHH K;  1FKO A;  4JD2 A;  1LWF A;  1SKW A;  3HI0 A;  4M3U A;  2GEM A;  2HHV A;  1VSD A;  3AVB A;  2R7Y A;  2V51 B;  3SZ2 A;  5CY4 A;  2Z1G A;  3F9K A;  3AO4 A;  3EL2 A;  4KV8 A;  3U6F A;  2VWK A;  5KQ8 A;  4F4K A;  1J5O A;  1U04 A;  4M3W A;  4O0I A;  5FRN A;  4CZG A;  1SKS A;  3TAQ A;  3S3M A;  4JYA K;  2GUI A;  2OTJ N;  4GVM A;  4OPH A;  1S1U A;  2YNI A;  4AH9 A;  1JLA A;  3RR8 A;  2HND A;  1U48 A;  5CZ2 A;  4RG8 A;  4BR0 A;  1E4G T;  2PBD A;  4CJP A;  3AVA A;  1HLU A;  1NMN A;  1TV6 A;  1NBW A;  3AO1 A;  3FLC O;  1NNE A;  3VQD A;  2KLA A;  5JS1 A;  5KRT A;  1T05 A;  3OYA A;  4CZE A;  2E6L A;  5HRS A;  1SQK A;  1TKD A;  3J80 O;  1C1C A;  2YHB A;  3GBT A;  3OYJ A;  3TWH A;  1Z25 A;  3U3G A;  1NG9 A;  1HR0 K;  3ZLJ A;  3QFP A;  2HF3 A;  1ATS A;  5AR0 A;  4EHT A;  1RT4 A;  4ICL A;  4OGC A;  4WQ4 C;  3TI0 A;  2Q0R A;  4JI4 K;  4H03 B;  1WBB A;  4DFP A;  3CCS N;  4DR5 K;  4CER A;  1WSE A;  1YT3 A;  4U7B A;  2QWP A;  1J54 A;  5I3U A;  5AQJ A;  1BOT O;  3LAN A;  3OS1 A;  1WSJ A;  4HCB A;  3A5O C;  3QEI A;  3PSI A;  3WNE A;  5GAH P;  4FPB A;  3IFR A;  3B6O A;  4B9N A;  1JL1 A;  5HRP A;  2ITG A;  1SL2 A;  3VN5 A;  4JI6 K;  4WFB L;  2VG7 A;  4CHZ A;  3KVG A;  2E5L K;  3K5N A;  3THY B;  4CJE A;  3VQP A;  3LDL A;  3T1H K;  4CEB A;  1Z6R A;  4OKJ A;  2I7P A;  2AP1 A;  3CJ7 A;  2YX6 A;  5AQX A;  4O0J A;  4EZ9 A;  1B92 A;  1C0M A;  2QK9 A;  1HYZ A;  5BRD A;  4QAG A;  3KZB A;  4FOI A;  1S3X A;  1Y97 A;  3VET A;  1V4S A;  1RFQ A;  3LDO A;  3L2Q A;  3FE1 A;  3KD1 E;  3EN9 A;  3SAH A;  3OY9 A;  3VTH A;  4B1W B;  2IIR A;  3C6T A;  3LAK A;  4HUF A;  1RBU A;  1J9A A;  4OGE A;  4I6M A;  4KH5 A;  3QDK A;  1LWE A;  3TR8 A;  2NRV A;  3KKS A;  4RW4 A;  4FWN A;  5AFU H;  4FM1 A;  1RT7 A;  4LF4 K;  1HMV A;  3CPE A;  3SK3 A;  2ETJ A;  3L3U A;  4B1X B;  3NGZ A;  3KLE A;  2KFN A;  2KFZ A;  4HUG A;  5KPR A;  2NRT A;  4FJ8 A;  3MAQ A;  4OKE A;  1TK0 A;  1L3V A;  3CI5 A;  1BHL A;  3L2W A;  3MCA B;  4W5R A;  3DLG A;  3TSU A;  3F9M A;  2VG5 A;  4CFD A;  4DU3 A;  1T44 A;  4IKF A;  5AQI A;  1CXQ A;  3OS0 A;  2G8F A;  4CEF A;  4Z4E A;  2D0C A;  1QVF M;  3M3Z A;  3HP6 A;  4KI4 A;  2JGU A;  2QKK A;  1NGF A;  4BRL A;  1OH7 A;  1BI4 A;  3O9S A;  2HST A;  3I56 N;  3A2F A;  1TYQ A;  4BRM A;  4NLC A;  3T69 A;  2AJQ A;  1YVU A;  3DLH A;  1VHX A;  2O8B A;  1RT5 A;  1NJX A;  4N76 A;  3LAM A;  2YCH A;  5DM6 L;  2X78 A;  1K8K A;  2OPP A;  2A42 A;  4IG3 A;  2P9K A;  4YDU A;  3OYG A;  2E1Z A;  1SV5 A;  3K0S A;  1D8Y A;  3CFR A;  3J81 O;  3PLA A;  3ASM A;  3EO3 A;  3LP2 A;  3C6A A;  4IOC L;  2B5J A;  1LV5 A;  4DWI A;  4I6M B;  4BE0 A;  1RTH A;  4CBX A;  5AQY A;  1N6Q A;  3T1A A;  3DLR A;  1Q8I A;  2F96 A;  4C23 A;  3JAM O;  3JSM A;  3BF1 A;  3NFA A;  5C2F A;  3FGU A;  3O80 A;  3F2K A;  4BRI A;  3TAE A;  4M41 A;  1KXP A;  4FK2 A;  1N5Y A;  4B3M K;  4DQI A;  4BE1 A;  1C1A A;  4A61 A;  3C7N A;  5BPN A;  4YOX A;  1Y64 A;  5AQQ A;  1ATR A;  4JEP A;  4CK3 A;  4FW1 A;  1BGX T;  3L6Q A;  4KAZ A;  3O3H A;  2NZT A;  1KVB A;  3CFP A;  2I5J A;  3NHG A;  4O55 A;  2HBL A;  1HKG A;  4BR7 A;  1SZ2 A;  3CM6 A;  3ZSV A;  5GAE P;  2P9I A;  4FWR A;  1T8E A;  1NMD A;  4BRA A;  4LH4 A;  5HRN A;  1T6D A;  1YTA A;  2Z1H A;  4EAH D;  3WNG A;  4BR4 A;  2A40 A;  3UB5 A;  2Q0U A;  3V9W A;  4QS9 A;  3A5L C;  4EHU A;  3VQC A;  4W5O A;  1I94 K;  3ULD A;  1TGO A;  4AIL C;  3PY8 A;  3VQQ A;  5BRH A;  1N33 K;  2D5R A;  3QFU A;  5LMN K;  4ELU A;  5J2N A;  2A3Z A;  3PO4 A;  2IAJ A;  1HRH A;  2A1S A;  3CHW A;  4LF6 K;  2WFB A;  1ATN A;  3LP0 A;  5AQO A;  4KBO A;  3ENO A;  1K8K B;  1E3M A;  1OVQ A;  5AQK A;  1DEJ A;  3M1F A;  3SV3 A;  1GLB G;  5C25 A;  1S1V A;  3EY1 A;  3HM8 A;  4CHY A;  1U2V A;  3AVG A;  1GLL O;  4B9T A;  3IDH A;  5CYM A;  4BDP A;  4E3S A;  3NVM A;  4GW6 A;  3U9Z A;  3DXM B;  3VA0 A;  1YIT N;  2FC0 A;  2Y1J A;  3DI6 A;  1P8Z A;  1RBV A;  3EE9 A;  4BWJ A;  4QS8 A;  4A5B A;  3CM5 A;  4FLU A;  2F9T A;  4CHP A;  4FZZ A;  2QEX N;  1O1W A;  1BIU A;  3VOV A;  4CZI A;  1VSE A;  4YY3 K;  3RMC A;  3EKS A;  4RCH A;  3V1O A;  3DLL L;  3RSE A;  1T6C A;  3AVH A;  4MQ3 A;  1QSY A;  3VER A;  3DYA A;  4Y0W A;  1RT1 A;  2G8W A;  2YKM A;  2IS3 A;  3ALY A;  1ASU A;  2E2P A;  3TAN A;  3NCI A;  1NKE A;  2P9S A;  1JCF A;  3DOK A;  3DRP A;  4H5N A;  3O4W A;  3VEZ A;  3HPO A;  1M90 O;  3BZK A;  3GE1 A;  1VRU A;  2KHO A;  4DV2 K;  3ITH A;  4E7J A;  2D0O A;  1RTJ A;  3VQE A;  3QES A;  3T1Y K;  1MA9 B;  1O13 A;  3HP9 A;  1NK6 A;  3MN9 A;  3CC7 N;  4BC2 A;  3KK3 A;  1SL1 A;  1VK0 A;  3HL8 A;  5AQU A;  3NH0 A;  4JLH A;  4CHN A;  2Z1J A;  5C42 A;  1FK9 A;  1ZBI A;  3MDQ A;  2RKI A;  2E2N A;  2G8U A;  2EWS A;  2Q3S A;  3IRX A;  4LD0 A;  1HNI A;  2O8F B;  2DTU A;  4CEO A;  3BUZ B;  3NVK A;  4DLE A;  4RW8 A;  5HRR A;  3KLH A;  1LW2 A;  4XIU A;  4W5N A;  3ZT2 A;  4WQ4 A;  5EY4 A;  1J5E K;  4BRG A;  4NXN K;  4M3Z A;  4PKI A;  3OYH A;  5CE3 A;  1NJW A;  4LFC K;  4JKB A;  4C8K A;  3TAF A;  2F9W A;  3MEC A;  3CCR N;  1X9W A;  3SJH A;  4DU4 A;  3A5M C;  4E7L A;  1CLQ A;  3VQB A;  3DWL A;  4DLG A;  3RSE B;  4BC5 A;  5SZT A;  3EZ5 A;  3PX4 A;  4FJJ A;  4FYD A;  3IG1 A;  3OYF A;  1WNS A;  1JXB A;  4CVN E;  2UUA K;  1NJZ A;  3VQ9 A;  4E7H A;  4NYN A;  4K0K K;  2P9S B;  2D4W A;  1GOB A;  1U49 A;  3V4I A;  4F2S A;  4M45 A;  2HHQ A;  4XH5 A;  4NCB A;  1YJW N;  1ZYQ A;  2O8D A;  1W0H A;  4HWI A;  3IMX A;  5JLH A;  3ZSZ A;  3NDK A;  1VQ8 N;  4FJM A;  3ISN C;  3LL3 A;  1HJR A;  5LJW A;  4E19 A;  4KHU A;  3KWG A;  1S1W A;  4IWV A;  4MDB A;  3ZCM A;  1QE1 A;  5BR8 K;  2E2O A;  4BRF A;  4DUY K;  1RDD A;  3V9Z A;  4DFM A;  3TAB A;  3RMD A;  4W5T A;  4BR9 A;  3NH2 A;  1E4F T;  1TKX A;  3RVC A;  3V9X A;  2HVH A;  3J7A P;  4ILJ A;  4CF1 A;  2HB5 A;  1U4B A;  1JLC A;  1KCF A;  3MXM A;  1Q9X A;  3NAE A;  1L5U A;  4DQS A;  1VQL N;  3M6G A;  4M7X A;  4DG1 A;  3UE5 A;  1P90 A;  1QZ5 A;  3UKR A;  3CYM A;  1XMQ K;  3KJV A;  3H45 C;  4ISF A;  4FJ5 A;  2WTU A;  4G9Z A;  3WEE B;  4JI7 K;  3U9D A;  3B6P A;  2QWO A;  1JXE A;  2QA4 N;  4NYF A;  2OYQ A;  3S41 A;  5IWA K;  1NK8 A;  3EZW A;  1CZB A;  4OKK A;  3QO9 A;  3VF4 A;  3THX A;  1R59 O;  3CCJ N;  1D9F A;  1OH6 A;  4M3Y A;  4O5B A;  1KAZ A;  3ZX3 A;  3RRG A;  1NGB A;  4CZL A;  4BVO A;  2BUP A;  1S72 N;  4CD3 A;  1ASW A;  2F8T A;  3KK7 A;  3HRG A;  1L3T A;  3THW A;  5E84 A;  3O4Q A;  2HNY A;  3UIQ A;  1YJN N;  4EP5 A;  3D7E O;  4C1N I;  1VSH A;  4RW6 A;  4DUZ K;  4M42 A;  2YKN A;  4Z4C A;  2ZJR L;  1VSF A;  2WUS A;  1LAV A;  4BC3 A;  4JRP A;  2QXF A;  4OPJ A;  3HVR A;  3CF5 L;  3BZC A;  1SL0 A;  4CE9 A;  3HO1 A;  5EVZ A;  1KFS A;  1U6Z A;  3VQ5 A;  3ATV A;  3LM2 A;  3P1G A;  3RMB A;  5H1S Q;  4H0T B;  3OS2 A;  1A5W A;  4CJW A;  4JI0 K;  2PZS A;  3QET A;  3CFO A;  4K8X A;  5FRO A;  2JLE A;  3M8S A;  1BCO A;  4CF2 A;  2YHX A;  2A1R A;  3S3O A;  1BA1 A;  1GOC A;  3QIN A;  5DMR A;  1K8A O;  5GIN A;  3AVI A;  3RRH A;  1LCU A;  3D2F A;  3R1X A;  5LL6 Z;  3HSC A;  1ILY A;  5LY3 A;  4X62 K;  4H5V A;  4L3Q A;  2QWN A;  4LY7 A;  3TTD A;  2FF6 A;  4JKC A;  5ELZ A;  3K57 A;  2YNH A;  4PHT X;  4B3R K;  3KLG A;  4E7K A;  1KFD A;  4CED A;  3N4P A;  3K9K A;  4HVJ A;  3CCV N;  3Q7C A;  4M3X A;  3J7Z O;  4PL8 A;  3ZT3 A;  4CBU A;  4LF7 K;  3QEW A;  4CK2 A;  1VQK N;  2HHT A;  4WQ5 C;  2PYL A;  3G25 A;  4IDH A;  2GWJ A;  1TUY A;  4CFB A;  1BCM A;  1GLF O;  1BUP A;  2QWL A;  4C8L A;  3CIP A;  4CJT A;  2OZM A;  3U8X A;  4B08 A;  3P39 A;  1QQC A;  1JLB A;  5AZI A;  1RIL A;  3QBW A;  2HHS A;  2P9P A;  1RBS A;  3K5L A;  1NK9 A;  4FLY A;  3E01 A;  3M8R A;  2XO7 A;  1XNQ K;  1S1X A;  1JCG A;  4HUE A;  4FK0 A;  1OVY A;  5HLF A;  4OPA A;  3WQU A;  3O08 A;  1X9M A;  3BDP A;  1S9E A;  1B9D A;  4BWM A;  1JL2 A;  2ZQB A;  1C6V A;  4OPK A;  3CJC A;  1BQM A;  4CJ4 A;  3WXJ A;  4DSE A;  1YI2 N;  1S9G A;  4FLW A;  3CJ1 A;  4O44 A;  3SBG A;  3CCU N;  1NK0 A;  3VQA A;  2W40 A;  1IH7 A;  3L4Q A;  3F5T A;  4KKO A;  4DTR A;  4DTX A;  1ZBH A;  3WUH A;  1OH8 A;  1QQN A;  4RTF D;  5TKW A;  4YOR A;  2HBJ A;  3ID8 A;  4JD2 B;  1HYV A;  1UWB A;  3LPT A;  4IBN A;  3HJF A;  4JV5 K;  2GBZ A;  4UQG A;  2HHX A;  2E6M A;  1KQS M;  3UKU A;  5EOY A;  1VQN N;  1YHQ N;  1KAX A;  5GIP A;  4XH1 A;  1D4X A;  1JJ2 M;  5CR4 A;  2CH6 A;  1SKR A;  4FJ7 A;  3WNH A;  5HL7 L;  3MEG A;  2O4G A;  2GTD A;  3FZH A;  3O9R A;  3THV A;  3H3N O;  4HCC A;  3RWU A;  1VQ7 N;  4DR2 K;  3MCP A;  4I7F A;  2ZJQ L;  3D2E A;  3VES A;  1NJI O;  1NKB A;  3IAY A;  1EWR A;  5SWM A;  4EFH A;  4KPY A;  1D9D A;  1TAU A;  3LZJ A;  2ZWH A;  4DKW A;  4GKJ K;  1TVR A;  3QER A;  4B1Y B;  1V4T A;  1HJO A;  4Z4H A;  4DTS A;  3O3G A;  1G15 A;  2X6N A;  4Y1C A;  5BPM A;  1NGD A;  3JYT A;  3MEE A;  5C15 A;  1XHZ A;  3JS6 A;  4H0V B;  3QIP A;  5BN8 A;  3OBY A;  1HKC A;  3ZX2 A;  3TAP A;  4RWT A;  2NUB A;  4F8R A;  4V19 S;  3ZSR A;  3FFK B;  1NGG A;  2P9U A;  1XWL A;  4QCL A;  1JLG A;  3KK2 A;  5A2Q O;  1C0G A;  2VG6 A;  3SUN A;  4XEI A;  3TTF A;  1HX1 A;  2W42 A;  1EQY A;  4DV7 K;  3O1W A;  1WSH A;  3BEX A;  4JI1 K;  3AO5 A;  3CQ8 A;  4GY2 B;  1NLV A;  3AGR A;  4JKG A;  3HOS A;  4KFB A;  4Y1D A;  3UKU B;  3HVT A;  1KC8 O;  1JKH A;  3RMA A;  4CEQ A;  1WUA A;  4B9M A;  4DFJ A;  3A5N C;  4YOW A;  2NRW A;  1JLQ A;  2IGI A;  4O4G A;  1EO1 A;  1RDU A;  1BIZ A;  4IFY A;  3NF8 A;  3S9H A;  3BF3 A;  4B9L A;  4KB0 A;  2W6L A;  3WXK A;  2Q36 A;  3U3Y A;  3WXI A;  5M1F A;  4DTM A;  1NGE A;  4DSK A;  4PA1 A;  1IKV A;  3F73 A;  1T7P A;  2OTL N;  3D2E B;  4DMN A;  1GLE G;  4XH4 A;  4FWQ A;  2OZS A;  1IBK K;  3D0P A;  3L4I A;  3C94 A;  4FJL A;  2YI1 A;  1W7A A;  3SNN A;  1NK4 A;  2CGJ A;  3AVJ A;  3K9J A;  1VQO N;  3QNN A;  4M7Y A;  4QS7 A;  2HMI A;  2ASO A;  1TL3 A;  4M3T A;  4ELT A;  3G0Z A;  2O8E A;  4I9L A;  2D0A A;  4CEC A;  5GIO A;  2ZGY A;  3VF2 A;  3AVK A;  2QI2 A;  4QOZ B;  5M1P A;  4FCY A;  1U45 A;  5BR9 A;  4LF9 K;  2ZJP L;  4FJI A;  4Z0U A;  5KGW A;  4CZH A;  3CXC M;  4DCH A;  4M3R A;  4K25 A;  1JLE A;  4IO9 L;  1UA0 A;  2V7Y A;  4KH4 A;  5F2R A;  4C1N K;  4DR7 K;  3HPG A;  3WXM B;  4CZJ A;  1ESV A;  4GKK K;  2GUP A;  1BA0 A;  2YNG A;  5ADX H;  1BI4 B;  3HST B;  3ZT4 A;  1UAX A;  4DS4 A;  3KLI A;  4KRF A;  2IOC A;  4AHR A; 
#chains in the Genus database with same CATH homology
 4DU4 A;  4I9Q A;  1F21 A;  3NF6 A;  1EET A;  1Z26 A;  1JLF A;  1WSI A;  4E7L A;  1CLQ A;  3VQB A;  3OYL A;  3QEV A;  4DLG A;  3LP3 A;  3LWM A;  1UOC A;  2LSN A;  1QSS A;  5SZT A;  3EZ5 A;  3PX4 A;  4FJJ A;  4FYD A;  3AVC A;  5K14 A;  3IG1 A;  3OYF A;  4KRE A;  4CJU A;  2P5O A;  4LSN A;  4CJK A;  1WNS A;  1JXB A;  3HYF A;  3SCX A;  1SUQ A;  4FVM A;  4OJR A;  2XHB A;  3I0S A;  1NJZ A;  3VQ9 A;  4N5S A;  2VWJ A;  4E7H A;  4NYN A;  3C6U A;  4C8N A;  1ZBF A;  2WOM A;  1NKC A;  4KB1 A;  1WSG A;  2HHW A;  3AVL A;  4Q0B A;  4H8K A;  1RBR A;  3VA3 A;  4CF9 A;  2X6S A;  1GOB A;  1RCH A;  4CF8 A;  3V4I A;  1U49 A;  1FKO A;  4F2S A;  3T19 A;  3V6D A;  2B4J A;  4M45 A;  3QEX A;  1X1P A;  1QTM A;  2HHQ A;  1LWF A;  4CJF A;  1SKW A;  4NCB A;  4M3U A;  2HHV A;  1VSD A;  3AVB A;  1W0H A;  1ZYQ A;  2R7Y A;  4N41 A;  3ZSZ A;  3NDK A;  3SZ2 A;  5CY4 A;  2Z1G A;  3ISN C;  4FJM A;  3AA5 X;  3F9K A;  3DLE A;  1HJR A;  3AO4 A;  1S5J A;  4KV8 A;  3U6F A;  1R0A A;  4E19 A;  4KHU A;  3HXM A;  1S1W A;  4CGD A;  5FRM A;  2VWK A;  4F4K A;  3ZCM A;  1B9F A;  2FBY A;  3M8P A;  1QE1 A;  1J5O A;  1U04 A;  4M3W A;  4O0I A;  5FRN A;  1RDD A;  3V9Z A;  4DFM A;  4CHQ A;  1SKS A;  1ITG A;  4CEZ A;  3TAB A;  3TAQ A;  4DFK A;  3RMD A;  3TAR A;  3S3M A;  2GUI A;  4W5T A;  4FLT A;  1IG9 A;  2KTQ A;  4FLX A;  4GVM A;  3ZSY A;  3NH2 A;  1S1U A;  2YNI A;  4AH9 A;  3PUF A;  3VQ4 A;  3G10 A;  1JLA A;  3ZSW A;  1TKX A;  3K5M A;  3V9X A;  3RR8 A;  2HVH A;  4CGH A;  2HND A;  1LWC A;  1U48 A;  2G8H A;  4JS5 A;  4CF1 A;  5CZ2 A;  3ZT0 A;  2HB5 A;  4RG8 A;  1U4B A;  1JLC A;  1IKX A;  1KCF A;  4CJP A;  3O3F A;  3MXM A;  1RBT A;  3NAE A;  2XY6 A;  3OYN A;  4DQS A;  5CYQ A;  1L5U A;  3AVA A;  4PUO A;  2G8W A;  4LH5 A;  1TV6 A;  3AO1 A;  4CHO A;  1ZBU A;  5JS1 A;  3VQD A;  4DG1 A;  4Z4F A;  4B8C A;  5KRT A;  1T05 A;  3OYA A;  2PY5 A;  3NE6 A;  2E6L A;  5HRS A;  3CYM A;  4I2P A;  1TKD A;  1C1C A;  3KJV A;  2YHB A;  1VSI A;  4FJ5 A;  3OYJ A;  3TWH A;  3DMJ A;  3QNO A;  1Z25 A;  2IDO A;  3U3G A;  3ZSQ A;  4Q5V A;  3B6P A;  1RDB A;  3KTQ A;  1RT4 A;  4ICL A;  4OGC A;  3TI0 A;  4F3T A;  1JXE A;  3LPU A;  3SV4 A;  4NYF A;  4DFP A;  2OYQ A;  4CER A;  1WSE A;  1FKP A;  1YT3 A;  3O4N A;  1NK8 A;  1CZB A;  1J54 A;  3QO9 A;  4OKK A;  5I3U A;  2OPR A;  3LAN A;  3OS1 A;  1WSJ A;  1L3U A;  2FBV A;  4HCB A;  1YTU A;  3QEI A;  1D9F A;  4AHV A;  4M3Y A;  4FZX C;  1A5V A;  4O5B A;  3WNE A;  3RRG A;  3NGI A;  3KLF A;  4FJX A;  3QEP A;  3HK2 A;  4PWD A;  3BGR A;  2RF2 A;  1ASW A;  1TAQ A;  3B6O A;  2F8T A;  2OA8 A;  1JL1 A;  3KK1 A;  5HRP A;  2ITG A;  1L3T A;  4B9N A;  1CZ9 A;  1SL2 A;  3VN5 A;  2VG7 A;  2Z1I A;  5KRS A;  3O4Q A;  4CHZ A;  3RR7 A;  2HNY A;  3UIQ A;  2IC3 A;  3K5N A;  4CJE A;  4FXD A;  1RT6 A;  3VQP A;  4G1Q A;  2KZM A;  4RW9 A;  4CEB A;  4EP5 A;  2ZD1 A;  4OKJ A;  1VSH A;  4RW6 A;  1REV A;  3SQ0 A;  4DTU A;  1S6Q A;  3ZT1 A;  4M42 A;  2F8S A;  2DY4 A;  2YKN A;  4Z4C A;  4O0J A;  4EZ9 A;  1VSF A;  4CJL A;  1LAV A;  2HNZ A;  1B92 A;  1C0M A;  3AA2 A;  3OYC A;  1KSP A;  1HYZ A;  3LDS A;  4KTZ A;  3H08 A;  2QK9 A;  4QAG A;  3OYE A;  4JRP A;  2QXF A;  4OPJ A;  3HVR A;  4NCA A;  3P5J A;  1Y97 A;  4CE9 A;  1SL0 A;  3HO1 A;  3L2V A;  1KLN A;  1KFS A;  1XHX A;  3VQ5 A;  4AHU A;  1KRP A;  4FLV A;  3P1G A;  4OLB A;  1J53 A;  4KTW A;  3L2Q A;  1KLM A;  3RMB A;  4KHQ A;  3OS2 A;  2P5G A;  3KD1 E;  1A5W A;  4FM2 A;  4CCH A;  4CJW A;  1BIS A;  1UA1 A;  3OY9 A;  1IKY A;  1WLJ A;  2PZS A;  4DSL A;  3QET A;  3CFO A;  3C6T A;  4FJH A;  4K8X A;  3LAK A;  5FRO A;  2JLE A;  4HUF A;  1TL1 A;  1RBU A;  3M8S A;  1J9A A;  4OLA A;  4OGE A;  1BCO A;  4CF2 A;  3L8B A;  1QHT A;  1DTQ A;  2A1R A;  3S3O A;  1LWE A;  3TR8 A;  1HQU A;  3SUQ A;  3OYB A;  3K5O A;  3KKS A;  4RW4 A;  4OVL A;  4DQQ A;  1GOC A;  3QIN A;  5DMR A;  4FM1 A;  1RT7 A;  4DTJ A;  3AVI A;  1HMV A;  4BDY A;  3RRH A;  2ETJ A;  3L2R A;  3AA3 A;  3L3U A;  2KW4 A;  3WNF A;  4F3O A;  2FBX A;  3NGZ A;  3KLE A;  2KFN A;  2KFZ A;  1KTQ A;  4HUG A;  1RTD A;  1HPZ A;  2QKB A;  3AO3 A;  4FK4 A;  5T7B A;  4FJ8 A;  1EKE A;  4LY7 A;  3MAQ A;  4OKE A;  1TK0 A;  4DQP A;  3K57 A;  2YNH A;  4DSJ A;  2OPQ A;  1L3V A;  1HYS A;  4TSX A;  1IKW A;  1BHL A;  3V1Q A;  2HHU A;  4DSI A;  3L2W A;  4CGF A;  2XRI A;  3KLG A;  4E7K A;  3CG7 A;  1HNV A;  1KFD A;  4CED A;  4W5R A;  3DM2 A;  3DLG A;  4HVJ A;  3V9U A;  2YNF A;  1L3S A;  2VG5 A;  4CIG A;  2BDP A;  1MU2 A;  3AA4 A;  4CFD A;  4FJ9 A;  4M3X A;  4DU3 A;  4IKF A;  1CXQ A;  3ZT3 A;  3OS0 A;  3QEW A;  2G8F A;  4CEF A;  4CK2 A;  4Z4E A;  3AV9 A;  2D0C A;  3HP6 A;  2HHT A;  4KI4 A;  2JGU A;  2QKK A;  4B9U A;  2PYL A;  4JS4 A;  1K6Y A;  3IS9 A;  1BI4 A;  4CFB A;  1BCM A;  1RNH A;  4C8L A;  5CZ1 A;  1TK8 A;  4CJT A;  1VSL A;  2OZM A;  3MED A;  4B08 A;  2YHA A;  3A2F A;  4WE1 A;  1QQC A;  1JLB A;  3I0R A;  4H4O A;  2AJQ A;  1RIL A;  1DLO A;  1YVU A;  4FW2 A;  2HHS A;  1XC9 A;  1RBS A;  1IO2 A;  4IDK A;  3K5L A;  1NK9 A;  4FLY A;  3DLH A;  1DTT A;  3E01 A;  3VQ7 A;  1RT5 A;  4DSF A;  1NJX A;  4DQR A;  4N76 A;  3M8R A;  4HHT A;  3LAM A;  2XO7 A;  3DLB A;  1S1X A;  4HUE A;  3T3F A;  4FK0 A;  3P83 D;  4CJS A;  3NH1 A;  3HPH A;  5HLF A;  3ZSO A;  1KVC A;  4CJ5 A;  2X78 A;  5FDL A;  2OPP A;  1X9M A;  4IG3 A;  3BDP A;  3VQ8 A;  1S9E A;  1B9D A;  2D0B A;  2EHG A;  4BWM A;  1JL2 A;  2ZQB A;  4AHC A;  1SV5 A;  3OYG A;  1C6V A;  4ZTJ A;  2WON A;  4DTN A;  1D8Y A;  4FJG A;  4ID5 A;  5E41 A;  4OPK A;  4YFU A;  3CFR A;  1BQM A;  1D5A A;  4CJ4 A;  4E1N A;  1W9H A;  4DSE A;  1RDA A;  3ASM A;  3LP2 A;  3KKR A;  4F2R A;  1S9G A;  2ZE2 A;  4FLW A;  2XY7 A;  4O44 A;  1NK0 A;  1CXU A;  2B5J A;  3AVF A;  1LV5 A;  4DWI A;  3VQA A;  4BE0 A;  3V81 A;  4CF0 A;  3OJU A;  1IH7 A;  4KKO A;  3SQ4 A;  1RTH A;  3M8Q A;  4DTR A;  1N6Q A;  1VRT A;  4DTX A;  1ZBH A;  4CIF A;  4ZTF A;  3T1A A;  5KTQ A;  3OYM A;  4RW7 A;  3DLR A;  1Q8I A;  2F96 A;  1GOA A;  3JSM A;  3NFA A;  1ZBL A;  4EP4 A;  4FM0 A;  1HYV A;  3TAE A;  3ZSX A;  4KI6 A;  3DRS A;  1UWB A;  4M41 A;  3LPT A;  1RT2 A;  4CGG A;  1N5Y A;  1QSL A;  4FK2 A;  3LP1 A;  4IBN A;  1EX4 A;  1C1A A;  4BE1 A;  4E7I A;  5I42 A;  4DQI A;  2GBZ A;  1S1T A;  4UQG A;  4DF4 A;  3HJF A;  2HHX A;  2E6M A;  4AHS A;  3SQ1 A;  4CK3 A;  4FW1 A;  4CJV A;  1BGX T;  3HM9 A;  4DU1 A;  4BDZ A;  2HW3 A;  4K8Z A;  3RTV A;  4KAZ A;  4NCG A;  3O3H A;  1KVB A;  3CFP A;  2I5J A;  3DLK A;  4O55 A;  3NHG A;  3D45 A;  2P51 A;  3LZI A;  2KQ2 A;  4FJK A;  3CM6 A;  3ZSV A;  1SKR A;  4DS5 A;  4B9S A;  1T8E A;  4FJ7 A;  1T03 A;  3TAM A;  4LH4 A;  5HRN A;  1EP4 A;  3WNH A;  4CEA A;  3MEG A;  1YTA A;  2O4G A;  4KHY A;  4CGI A;  2Z1H A;  3THV A;  4HCC A;  4CK1 A;  4I2Q A;  3RWU A;  3WNG A;  1NK7 A;  1S6P A;  3V9W A;  4I7F A;  4Z4G A;  3VQC A;  4C8O A;  4W5O A;  4FZY A;  4ZHR A;  3ULD A;  1TGO A;  1XI1 A;  4AIL C;  3PY8 A;  3HT3 A;  4CJQ A;  3VQQ A;  5DK5 A;  1NKB A;  1C0T A;  3IAY A;  5SWM A;  1LW0 A;  2D5R A;  4R5P A;  4KPY A;  2G8V A;  1D9D A;  4ELU A;  2ATQ A;  5J2N A;  1RT3 A;  1EXQ A;  3PO4 A;  1TAU A;  2IAJ A;  3LZJ A;  3I8D A;  5J2P A;  1HRH A;  2A1S A;  4BAC A;  3SPY A;  2DFH A;  4E0D A;  3LP0 A;  2B6A A;  1TVR A;  3QER A;  2DFE A;  4Z4H A;  4JRQ A;  4DTS A;  3O3G A;  1G15 A;  5HBM A;  3SV3 A;  5J2Q A;  3PX6 A;  4L8R B;  5C25 A;  1RTI A;  1S1V A;  3EY1 A;  2X6N A;  4Y1C A;  4CHY A;  3EYZ A;  3AVN A;  5D3G A;  3AVG A;  3JYT A;  3OJS A;  2X74 A;  3MEE A;  4IG0 A;  4B9T A;  5CYM A;  4BDP A;  1XHZ A;  4YNQ A;  4E3S A;  5KI6 A;  4PQU A;  3QIP A;  5C24 A;  3TAP A;  2NUB A;  4GW6 A;  5EU7 A;  3VA0 A;  5HRO A;  4F8R A;  3AVM A;  4Z4I A;  2FC0 A;  3ZSR A;  3SUP A;  4E1M A;  1VSM A;  1XWL A;  2Y1J A;  3DI6 A;  4CFA A;  4QCL A;  1JLG A;  3KK2 A;  1RBV A;  3DOL A;  4BWJ A;  4PY5 A;  2VG6 A;  3SUN A;  3V9S A;  3L2U A;  3LAL A;  2W42 A;  4KHS A;  2YV0 X;  3CM5 A;  1WSH A;  4FLU A;  4BE2 A;  4HTU A;  4N47 A;  3AO5 A;  1C1B A;  1TKT A;  4CHP A;  3CQ8 A;  3SI6 A;  4LSL A;  4FZZ A;  1O1W A;  1BIU A;  4B9V A;  4J2E A;  1KVA A;  1VSE A;  4C8M A;  2GV9 A;  3QIO A;  2Y1I A;  2HVI A;  4KFB A;  4Y1D A;  4DTO A;  4ELV A;  4CGJ A;  3HVT A;  3RMC A;  2KZZ A;  3V1O A;  4KO0 A;  4B8A B;  1X9S A;  1LAW A;  1BL3 A;  1JKH A;  3RMA A;  4CJ3 A;  3AVH A;  3NF9 A;  4CEQ A;  2E4L A;  4CJR A;  4MQ3 A;  1QSY A;  4B9M A;  4DFJ A;  3FFI A;  4EZ6 A;  3OYD A;  1JLQ A;  2RPI A;  2IGI A;  3DYA A;  5HP1 A;  4O4G A;  1NJY A;  2BGG A;  1RT1 A;  4J2D A;  1BIZ A;  2YKM A;  3NGY A;  2IS3 A;  3ALY A;  3NF8 A;  4IFY A;  5JS2 A;  1ASU A;  4DF8 A;  3S9H A;  3TAN A;  4B9L A;  4KB0 A;  4GMJ B;  3NCI A;  3AO2 A;  4AHT A;  3U3Y A;  1NKE A;  1NOY A;  3V1R A;  4B3O A;  4E89 A;  4DTM A;  3KIO A;  3DOK A;  3DRP A;  4KTQ A;  3HPO A;  3S3N A;  4DSK A;  4PA1 A;  3MXJ A;  3SYZ A;  1VRU A;  4J2B A;  1IKV A;  2EX3 A;  3F73 A;  4KHN A;  2G8K A;  3ITH A;  1T7P A;  3KD5 E;  4E7J A;  1ASV A;  1RTJ A;  3VQE A;  4DMN A;  4DTP A;  3QES A;  1A5X A;  3PO5 A;  1Q9X A;  1VSK A;  3HP9 A;  4ID1 A;  5KGX A;  1NK6 A;  3SUO A;  3KK3 A;  2OZS A;  1HQE A;  5J1E A;  3LWL A;  1SL1 A;  2RN2 A;  1C0U A;  1VK0 A;  1TKZ A;  3HL8 A;  3NH0 A;  3D0P A;  1QS4 A;  4JLH A;  2XY8 A;  3C94 A;  3K2P A;  4CHN A;  4FJL A;  4CFC A;  2Z1J A;  5C42 A;  2P1J A;  3SNN A;  1FK9 A;  1FXX A;  1RDC A;  3AVJ A;  4N56 A;  4MFB A;  3QNN A;  1NK4 A;  1ZBI A;  2RKI A;  3QLH A;  1WSF A;  3K59 A;  2G8U A;  2Q3S A;  3IRX A;  3NF7 A;  2HMI A;  2FBT A;  4LD0 A;  3MXI A;  2DFF A;  1HNI A;  3SQ2 A;  3PV8 A;  4J2A A;  2PYJ A;  2DTU A;  1TL3 A;  4CEO A;  4CEE A;  4ELT A;  3G0Z A;  4H4M A;  1NK5 A;  2BAN A;  4I9L A;  4M3T A;  3K58 A;  2D0A A;  4CEC A;  4DLE A;  3L3V A;  4RW8 A;  4CES A;  1TK5 A;  1NOZ A;  3AVK A;  4W5Q A;  4FJN A;  4QOZ B;  5HRR A;  3NBP A;  1I39 A;  4CIE A;  4FCY A;  1U45 A;  3SPZ A;  1VSJ A;  1LW2 A;  1WN7 A;  3DRR A;  4Z0U A;  5KGW A;  4XIU A;  1I3A A;  3KLH A;  4FLZ A;  3TAG A;  4FJI A;  4W5N A;  4M3R A;  3ZT2 A;  1U47 A;  1JLE A;  1UA0 A;  2G8I A;  3OYI A;  4M3Z A;  2XY5 A;  1BQN A;  3C95 A;  3OYH A;  1Q9Y A;  1NJW A;  2OPS A;  3HPG A;  5J2M A;  3PX0 A;  1WAJ A;  3VQ6 A;  2YNG A;  4DS4 A;  1BI4 B;  3HST B;  2BE2 A;  1UAX A;  1WAF A;  3KLI A;  3OVN A;  4IFV A;  3ZT4 A;  3TAF A;  3SJJ A;  4C8K A;  2IOC A;  4KRF A;  2O4I A;  3MEC A;  3OYK A;  4KHW A;  4AHR A;  1X9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...