1JL2A

Crystal structure of tceo rnase h-a chimera combining the folding core from t. thermophilus rnase h and the remaining region of e. coli rnase h
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
150
structure length
150
Chain Sequence
KQVEIFTDGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELKAAIEGLKALKEPAEVDLYTDSHYLKKAFTEGWLEGWRKRGWRTAEGKPVKNRDLWEALLLAMAPHRVRFHFVKGHAGHPENERADELARAAAMNPTLEDTGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contributions of folding cores to the thermostabilities of two ribonucleases H.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
molecule keywords Chimera of Ribonuclease HI, Ribonuclease H
total genus 42
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jl2A00
3KTQA 3O3GA 1I3AA 5I3UA 1U49A 3PO4A 4KHQA 1L3SA 2QK9A 3AVCA 1FKOA 2YKMA 3L3UA 1NKEA 1RTHA 3JSMA 1VSEA 1KVBA 2BDPA 1XHXA 3AVHA 3E01A 4KFBA 4E3SA 3WNFA 5C25A 4FJ5A 4N56A 1IKXA 4RW9A 4EZ6A 2VWJA 4B9MA 3K2PA 2IC3A 3CFOA 4BWJA 3SJJA 3ZT0A 3KLIA 3LPUA 4O0JA 2OZSA 2YHAA 1EETA 4B9VA 4LSNA 3QEIA 1JLGA 4Z4CA 3OYJA 4C8MA 5SWMA 3TAEA 1WSFA 1CLQA 4CJRA 2DFHA 4BACA 2X74A 2YHBA 3HL8A 2G8WA 4B9SA 3K5LA 1RDDA 4Q5VA 3QEVA 4OVLA 2WOMA 4OGCA 4PQUA 1Y97A 4OKKA 3QETA 3IS9A 4GMJB 4FK4A 2HHQA 3OS2A 3O3FA 3VQ6A 3RWUA 3ZT4A 2A1SA 2YNHA 4O4GA 1X9WA 3HT3A 1FXXA 1TKTA 2Z1HA 4KTZA 5HRRA 3NGIA 4DFKA 4YNQA 1VSFA 3LP2A 3LP0A 3M8PA 3QNNA 2FC0A 1ZBUA 2KFZA 3SUOA 1BIUA 4KHYA 1RDAA 4OPKA 1G15A 4LD0A 1U48A 3EZ5A 3VQEA 2GV9A 3ZSZA 2P5GA 1BHLA 2F96A 5FRMA 1RT7A 1VRTA 4KI4A 1W0HA 4CEEA 3EYZA 1NKCA 2JLEA 2IGIA 4J2EA 1HRHA 3SNNA 2YKNA 4FM0A 1HPZA 5C24A 4LH5A 4DTPA 3PY8A 2KZMA 1X9SA 3K5NA 4E0DA 3ZSXA 3OY9A 2KTQA 3SV3A 3V9UA 3V9WA 1L3TA 2OA8A 1C1CA 4HHTA 3L2UA 2FBYA 1VSMA 4Z4FA 1UA1A 4Z4EA 4FJGA 5HRSA 2DY4A 4CK3A 4CJ5A 4JS5A 4R5PA 4CJEA 4OKJA 1U4BA 3F9KA 2HNYA 4CJLA 1KRPA 2DFFA 4FW2A 3HM9A 4CK2A 1CXUA 3DMJA 1HYVA 3SQ0A 2KQ2A 1O1WA 3RMAA 1NJWA 3TAPA 1SKSA 2HHSA 4NYFA 3LP1A 1LAWA 4NCAA 3G0ZA 4DSIA 2YNFA 1JL2A 1YT3A 1S9GA 5HBMA 3RMBA 4E7HA 3HVRA 4DSKA 1NOYA 1RBVA 1S1UA 1WAJA 3VA3A 3UIQA 5KGXA 2VG6A 4OJRA 3ZSVA 4BDYA 3TARA 4KHSA 3AO3A 1ITGA 3OYNA 4KAZA 2OPSA 4FZXC 1GOAA 4B8AB 4CCHA 1C0TA 4CHOA 3OYCA 3K58A 4QOZB 3AO2A 2RKIA 1JLFA 1QHTA 3LZJA 3C94A 4BE1A 1KFSA 1NKBA 4N41A 5J1EA 3KK3A 3KLEA 3C6TA 1U04A 3WNGA 4ID1A 1WSEA 5EU7A 3AA2A 3S3MA 2B4JA 1U45A 3MAQA 2D0AA 4DU1A 3DOKA 3OJSA 4CJPA 3K59A 2QXFA 2Q3SA 2R7YA 5CZ1A 1B9DA 4CJWA 4NCGA 3VQAA 3AVMA 4CGHA 4JS4A 4FLUA 1HQUA 5JS1A 3HXMA 4ELVA 3DLRA 3SUPA 4IBNA 4EP4A 4FLTA 3QESA 3KD1E 4CFAA 4DFMA 2XRIA 4YFUA 4Q0BA 4ZTJA 1VRUA 3AA4A 3KLFA 1NK8A 4CEBA 3T1AA 3P5JA 1WNSA 1RT2A 3KK1A 3U6FA 4E89A 4KTQA 4EP5A 2Z1GA 3HP9A 5HLFA 4Z4IA 1ZBLA 3NH2A 4DS4A 2GBZA 1RT1A 4KTWA 2HHVA 3HVTA 3KLGA 4JRQA 4ICLA 2F8TA 3OYMA 4FCYA 4KHWA 4M3YA 4DQSA 1RBTA 4CEOA 2XO7A 3ZT2A 1SL2A 2EX3A 1BQNA 3AVKA 3QIOA 3SQ1A 1F21A 1NJYA 4HTUA 4KV8A 4B9UA 1RT5A 1WSHA 1TL3A 5C42A 4BDPA 2DFEA 1C0UA 1NK5A 3G10A 4DU4A 4B9NA 2HMIA 2G8FA 1X9MA 4FJXA 3NBPA 1NOZA 4B3OA 4DG1A 3VQDA 1IG9A 4FLYA 2HHTA 4CF2A 2BE2A 3AVAA 3L2VA 3SPYA 3SV4A 4B9LA 1TV6A 3LAMA 4CGGA 3AA3A 1TKXA 3VQ5A 3V81A 1JLEA 2OYQA 3QNOA 4CGIA 4DFPA 2P5OA 2IDOA 5J2MA 3IAYA 4L8RB 5CYQA 3OYDA 4W5QA 3DI6A 3LP3A 4HVJA 3A2FA 1NK7A 1TK8A 1K6YA 4LSLA 1RTJA 4G1QA 3VQ7A 1SL1A 4CGJA 3VQ4A 1QQCA 4ELTA 1KTQA 2LSNA 4AHRA 4B08A 5T7BA 3L2QA 4HUGA 4FM1A 3QINA 2O4GA 3NH1A 4I2QA 4Z4GA 3DLEA 1RBUA 5HP1A 4CJVA 3KKSA 2D0BA 4QAGA 4J2DA 4DTNA 5DK5A 3RTVA 4FJ8A 1VSJA 1RCHA 2HHXA 3OYLA 4AH9A 3S3OA 5HROA 3H08A 3KKRA 5FDLA 1VSLA 3L2RA 4F8RA 1D5AA 3HPHA 1XC9A 1ASUA 3NF8A 1JLAA 1SV5A 3MXJA 3I0RA 4I9LA 5J2PA 1NK6A 3ALYA 3NH0A 3K5MA 1RT4A 2D5RA 1S5JA 2ITGA 4DTUA 3TANA 3SCXA 1ASVA 4CHYA 3AVGA 3DRRA 3TR8A 4F3TA 4XIUA 1D9DA 1EX4A 3V1QA 4E7IA 4Y1DA 2PYJA 4FXDA 2X6NA 4FLZA 2HHWA 4HUFA 3QLHA 2W42A 4M41A 5I42A 3S3NA 4JLHA 4DF8A 4M3ZA 2P51A 2QKKA 3TAQA 2HNDA 1BGXT 1BCOA 4FLWA 3RRGA 3V6DA 1LWCA 2XHBA 4DFJA 2IOCA 2NUBA 4K8ZA 3I8DA 4DSJA 4I9QA 3HJFA 1EXQA 4FVMA 2PZSA 1IKWA 1B9FA 1TGOA 1LW0A 2OPRA 3NCIA 3RR7A 4DU3A 1B92A 1YTUA 2ATQA 3OS0A 3PO5A 3K5OA 3FFIA 4FJLA 4CIGA 4KHNA 4KB1A 1IKVA 1KLMA 4DLGA 1FK9A 3OJUA 3M8SA 1A5XA 2A1RA 3NFAA 4IG0A 3ZT3A 3C95A 1JXEA 1I39A 1RT6A 4GVMA 1N5YA 4FK2A 1VK0A 1HNVA 1NK4A 1HYSA 1TAQA 1EKEA 3SQ2A 1VSIA 3DRPA 5DMRA 4N5SA 3OYBA 3M8RA 3LWMA 2BANA 1FKPA 3DYAA 3TABA 4CGDA 1L3UA 2D0CA 3S9HA 1TKZA 2G8UA 1S1XA 3IRXA 3LANA 1KFDA 3ISNC 4AHSA 1JLCA 3V4IA 4FW1A 1T03A 2IS3A 4PUOA 2O4IA 4HCBA 4CHPA 3L8BA 3WNEA 1VSHA 3NF9A 4CF0A 4F2RA 4OLAA 1J9AA 4M3XA 4ELUA 1RDCA 3IG1A 3T19A 3CYMA 2WONA 3V1RA 2X6SA 3LAKA 3AVBA 1TL1A 4BE0A 3B6OA 1QTMA 4I7FA 4CJQA 3TAFA 2E6LA 3TI0A 1JL1A 1S6QA 1N6QA 4DTOA 3QO9A 2Z1JA 3VQ9A 4Z4HA 2E6MA 3QERA 4IFYA 3L2WA 2VG5A 5CZ2A 1IO2A 3NGYA 4W5NA 1QE1A 4H4OA 1BIZA 4CF1A 4CJUA 3KLHA 5J2NA 2HHUA 3BDPA 1ZBIA 2PY5A 3PX6A 2I5JA 3OYIA 3PX4A 5J2QA 4NYNA 3SQ4A 4OKEA 3PV8A 2B6AA 2FBVA 4CEZA 3AVLA 3K57A 1ZYQA 4IKFA 4KRFA 5K14A 3QIPA 1MU2A 4NCBA 2YNIA 1T05A 1WSJA 3CM6A 4FJ9A 3O4NA 4M3TA 3SI6A 1L5UA 4CIEA 4F3OA 5KGWA 3VQPA 2IAJA 4DMNA 3TWHA 3AA5X 1JLBA 3V9XA 2KFNA 3DRSA 3CG7A 4DTXA 3HSTB 3MXMA 4EZ9A 3I0SA 3MXIA 3ULDA 1TK5A 3MECA 3MEDA 4CERA 3DM2A 3DLHA 1LW2A 1S1WA 4FZYA 5CY4A 4F2SA 4KB0A 4CF8A 1BI4B 4DSFA 3L3VA 3OYKA 4CFDA 4J2AA 1BL3A 4RW4A 1L3VA 1RILA 4OLBA 5KRSA 3HP6A 4FJIA 3DLKA 3MEEA 4CHZA 5KTQA 1RNHA 3SYZA 2G8VA 4C8KA 3B6PA 4RW8A 1BCMA 1WLJA 2VWKA 1IKYA 4CEAA 3QEWA 1UA0A 4J2BA 3C6UA 5KI6A 3VQQA 1JLQA 1TVRA 4UQGA 4K8XA 4Z0UA 4PWDA 3HK2A 2GUIA 4KI6A 1LWFA 1GOCA 2G8HA 1UOCA 3NE6A 1Q9XA 1C6VA 5JS2A 4CIFA 5FRNA 3NHGA 2ZD1A 3LALA 1RBRA 2RF2A 1BISA 1WN7A 4IG3A 4MQ3A 1HQEA 3DOLA 4H8KA 4CEFA 3OYFA 3SPZA 1NJZA 3HO1A 4CE9A 4FJMA 4O5BA 4M3RA 1D8YA 2ZQBA 3AVFA 4B9TA 4CFBA 3LDSA 4KREA 4LY7A 4LH4A 4FK0A 3VQ8A 1HNIA 5HRPA 3T3FA 1KLNA 4FZZA 1QSSA 4AHVA 3KD5E 3QEPA 4N76A 2QKBA 1RTIA 3ZSRA 4E7LA 4OGEA 3NF6A 3WNHA 4DS5A 4AILC 3KK2A 3PX0A 2HW3A 1S9EA 3QEXA 4M42A 3P83D 4M45A 1T8EA 4FYDA 3HPGA 1Z25A 3ZT1A 3ZSWA 2JGUA 4CHNA 4CJ3A 4RW7A 2HVIA 1TKDA 4DSLA 4FJ7A 4O0IA 3DLBA 4N47A 4CJTA 2FBTA 4WE1A 2FBXA 4E7JA 4E1NA 4E1MA 3OYHA 3M8QA 2P1JA 5CYMA 2ZE2A 1U47A 3RRHA 4QCLA 3RMDA 4CECA 3AO5A 1ZBHA 3KIOA 1LWEA 1RBSA 3TAGA 1VSDA 1CXQA 4F4KA 3ASMA 1YVUA 4B8CA 4BE2A 4DQPA 3D45A 3NGZA 4RW6A 4ZHRA 3CFPA 1LV5A 2X78A 1IH7A 3ZSYA 3VA0A 2G8IA 1RTDA 4O55A 4OPJA 3OVNA 3CQ8A 2KW4A 1SKWA 1DTTA 1QSYA 3ITHA 3HYFA 3PUFA 4BDZA 1EP4A 3AVIA 4FM2A 4DQRA 1R0AA 1KVCA 1HMVA 4BWMA 4ID5A 3ZCMA 4AHCA 4CJFA 4CHQA 5HRNA 1T7PA 1J5OA 4M3WA 1WSGA 3JYTA 4DSEA 1JKHA 2HB5A 1A5WA 4I2PA 3EY1A 3V9ZA 3AO4A 4ZTFA 4M3UA 3TAMA 5E41A 2ETJA 3LPTA 3SUNA 3ZSQA 1S1VA 2BGGA 1Q9YA 3OYGA 2OZMA 2OPPA 4KO0A 4CK1A 5SZTA 3V9SA 4DTRA 3OYAA 3AVJA 4PY5A 4C8OA 4AHTA 3AVNA 3BGRA 3NAEA 3LZIA 4DQQA 1ASWA 1CZ9A 3CM5A 4AHUA 2B5JA 3RMCA 3NF7A 1UWBA 1C1AA 3LWLA 3THVA 4CF9A 4O44A 2RN2A 4FLXA 1X1PA 1XWLA 4CFCA 3CFRA 2Y1IA 1KSPA 1GOBA 3O3HA 3VN5A 1VSKA 1XHZA 1DLOA 1SUQA 4FJNA 2E4LA 1REVA 1WSIA 1DTQA 2HNZA 3NDKA 1ZBFA 2OPQA 2YNGA 2F8SA 2HVHA 1HJRA 2Z1IA 4W5OA 5KRTA 2PYLA 1J54A 1Z26A 4CJ4A 3MEGA 4MFBA 1YTAA 3O4QA 4KKOA 3U3YA 5FROA 2XY7A 4GW6A 1NK0A 4DWIA 3SUQA 4DTMA 2EHGA 4W5RA 3F73A 4C8LA 1SL0A 1JXBA 1RDBA 1CZBA 4RG8A 1C1BA 2RPIA 2AJQA 1SKRA 2XY8A 1W9HA 1Q8IA 1C0MA 4PA1A 4W5TA 4HCCA 2Y1JA 4FJHA 3AO1A 4FJKA 4DLEA 4CGFA 4KPYA 3V1OA 4KHUA 3SZ2A 1S1TA 3VQBA 3VQCA 4C8NA 5D3GA 3ZSOA 4E19A 4IFVA 1QSLA 3RR8A 1KCFA 3OYEA 3U3GA 4HUEA 1HYZA 1TK0A 2VG7A 4IDKA 1RT3A 4DTSA 3P1GA 1NJXA 4DQIA 4CJKA 1WAFA 1KVAA 4CEDA 4CJSA 3DLGA 3KJVA 2DTUA 3D0PA 3OS1A 3HPOA 1XI1A 4DF4A 1BQMA 4H4MA 1J53A 1A5VA 1S6PA 4DTJA 4TSXA 4Y1CA 4JRPA 4CEQA 2KZZA 3AV9A 4CESA 2XY5A 2XY6A 1NK9A 1LAVA 2G8KA 1BI4A 1QS4A 1UAXA 4FLVA 1D9FA 2YV0X 4FJJA 1TAUA 4E7KA
chains in the Genus database with same CATH superfamily
3KTQA 1MWKA 1K9MO 5I3UA 3KWGA 4KHQA 3AVCA 1GLEG 1RTHA 3JSMA 4RW9A 3EL2A 1RDWX 3VTIA 4B9MA 3K2PA 2IC3A 3ZT0A 3KLIA 1KAYA 3DXKB 3LPUA 4L3QA 5C12A 2UUAK 4B9VA 1JLGA 3DLLL 3O5BA 1BA0A 2X74A 2YHBA 2G8WA 5BRFA 4Q5VA 4PQUA 3O3FA 3RWUA 4IFEA 4YY3K 4K42A 5JICA 2ZM6K 3NGIA 5AQXA 2QA4N 1U48A 2UXBK 4EHUA 4JKBA 5BRHA 2F96A 4KBOA 2O8BA 2IVNA 3H3NO 3O9QA 2ASOA 3VF4A 4DTPA 3PY8A 1X9SA 3K5NA 1L3TA 2OA8A 4JI8K 3CQYA 4Z4FA 4Z4EA 4FJGA 4A57A 5TKYA 1IBKK 4PL7A 1U4BA 2DY4A 4CJEA 4H0YB 5EX5A 3A5NC 5EY4A 1T6DA 1CXUA 1NK9A 3MDQA 5FPNA 2KQ2A 3RMAA 1WUAA 2HHSA 4NYFA 3LP1A 1VQ8N 3G0ZA 1S9GA 4GV6A 4E7HA 4WQ5A 2EWSA 4IDHA 1WAJA 3CI5A 4OJRA 4HWIA 2QWLA 4I6MA 4XH1A 3AO2A 1QHTA 3LZJA 1KFSA 2W6LA 4H0VB 1NKBA 5J1EA 2UXCK 2NLXA 2Q97A 5C10A 4NLBA 5EU7A 3AA2A 5AQHA 4X64K 1B9DA 3E1YA 3N4PA 3HXMA 2P9LA 4EP4A 4ISGA 4DFMA 4AF1A 4WFBL 4CEBA 1WB9A 3P5JA 1WNSA 1RT2A 4CZJA 2O8CA 3HP9A 4NB4A 5HLFA 4GKKK 4KTWA 1NGJA 3KLGA 4MDAA 4FCYA 3VEWA 4CEOA 4BRDA 3SQ1A 1U2VB 5TKWA 4BDPA 3EZWA 1NK5A 3G10A 4FWOA 3J7AP 4EFHA 4FJXA 4B3OA 3VQDA 1O13A 4GKJK 2BE2A 1ZBSA 3C0BA 3AA3A 1GLBG 4JK9A 3FZFA 2P9UB 2OYQA 4JK7A 1G99A 3WEEB 2J4RA 4H0TB 2HMPA 4FWNA 1TK8A 2FXUA 1LOTB 4C23A 3VQ7A 2LSNA 5T7BA 4OPAA 4H5NA 3QINA 2YHYA 3TSQA 4PKHA 3CPWM 3DLEA 4CJVA 3KKSA 3PSFA 5ADXH 3RTVA 1VSJA 3OYLA 4AH9A 3NVKA 3H08A 1T3VA 1VSLA 3EKSA 3HPHA 4BC4A 1NLVA 1SS6A 3G6EN 2O8DB 3OW2M 4DR5K 4F3TA 3V1QA 2HHWA 4HUFA 3QLHA 3TSPA 4M41A 4BR2A 5I42A 2P51A 4JI6K 4JKHA 2JWLA 1BCOA 3CF5L 3RRGA 2ZJPL 2XHBA 1XMQK 3I8DA 3CJAA 1YXQA 4FVMA 1IKWA 1B9FA 2I7PA 1TGOA 2F4VK 1LW0A 4IO9L 3NCIA 3RR7A 1B92A 1NGIA 5GIOA 3SAHA 4FJLA 4KHNA 5BN8A 3U9ZA 4IG0A 2OTLN 2QI2A 2WC9A 1I39A 1RT6A 4JD2B 4FK2A 1NK4A 2NRWA 1HNXK 2PBDA 1YVNA 3ZX3A 3OYBA 2FF3B 4B3SK 3LWMA 2BANA 4QS7A 2UUCK 3THXA 3E9LA 3ISNC 2NRXA 2IS3A 4KHPK 1W2BM 3L8BA 4CF0A 4F2RA 3BF1A 1J9AA 4ELUA 1RDCA 3CYMA 4BY9C 3V1RA 1DT9A 2X6SA 5M1FA 2ASMA 3B6OA 4I7FA 1N6QA 2HF4A 3TAFA 1S6QA 1NU0A 2QEXN 4YORA 3QO9A 1E4FT 3UKRB 2E6MA 3VEOA 4JYAK 3NGYA 3H3OB 1NGHA 3IDHA 2HHUA 5EOYA 4M7YA 3OYIA 2Q36A 4NYNA 3SQ4A 2E1YA 4OKEA 3PV8A 1ZYQA 1TUUA 3NMUA 4DV7K 5K14A 1WSJA 1YI2N 4FJ9A 3EKUA 2RHKA 1GLAG 3VEVA 3TWHA 3SBGA 1JLBA 3V9XA 3CG7A 4CZKA 4FWPA 5GINA 4EZ9A 3MEDA 4KH4A 4U67L 4FZYA 1BI4B 4J2AA 2HF3A 1BL3A 4OLBA 3HP6A 3J80O 3SYZA 1UA0A 2QWQA 4UQGA 2GUIA 2YJEA 3ID8A 1LWFA 4JAXA 3NE6A 1Q9XA 3MX5A 3R1XA 1NJZA 1HQEA 3FR0A 4JV5K 2P9IA 4CEFA 4O5BA 3CCQN 2O8EA 4O5FA 4JKGB 4PHTX 1NGAA 4B1WB 3ENHA 5KPRA 1KLNA 1QSSA 4AHVA 3QICA 4CJ7A 3WQTA 2QXLA 3T7ZA 1SAZA 5AJ3K 5IWAK 4M45A 1T8EA 3HPGA 1Z25A 3ZSWA 2JGUA 4CJ3A 3ATUA 2HVIA 3SAGA 4YOYA 4CJTA 3EE9A 2FBTA 4JD2A 1VQKN 4WFNL 4QCLA 1QZ5A 3RMDA 1BUPA 3VF6A 1ZBHA 3KIOA 1CXQA 3GE1A 3ASMA 4B8CA 4BE2A 2QWNA 3CCUN 1NM1A 3NGZA 4ZHRA 1QQNA 1LV5A 4BRGA 1P90A 3TSUA 1RDUA 3OVNA 1S22A 1DTTA 4BDZA 4CW7B 3AVIA 3VGLA 4AHCA 1JCFA 5F0XA 5JLFA 2WFBA 2VCPA 3TAMA 4DKWA 3SMSA 4JHDA 5AQZA 2OZMA 4KO0A 3O9TA 3V9SA 1VQMN 4C8OA 3ZYYX 4BGAA 3NAEA 2ZF5O 3WEEA 3LZIA 2B5JA 4PKGA 1N32K 1UWBA 2D0PA 3LWLA 4CF9A 5AZJA 5AQNA 3O3HA 2D4WA 3VENA 3IMXA 3F5TA 1NWKA 4NO7A 5HOOA 2YNGA 3CHWA 3O08A 4KKOA 4K41A 4DWIA 3KZBA 4GV9A 3BP8A 5C0YA 4W5RA 1XQSC 1JXBA 1GLLO 2RPIA 2AJQA 3BEXA 1SKRA 1W9HA 4PA1A 1C0MA 4DHYA 1OH6A 3MWPA 4HCCA 4EAHD 3CCEN 4FJHA 4B3MK 4KHUA 4H5RA 2VQEK 3VQBA 3KVGA 4E19A 4IJAA 3K9KA 3RR8A 1NGFA 3U3GA 1TK0A 2VG7A 1NJXA 1VQ4N 3QFPA 1KVAA 4CJSA 4PL8A 2DTUA 2NRTA 3FLCO 4TSXA 2DPNA 4Y1CA 3A5MC 3CQXA 3VERA 3O8MA 4IOCL 4FLVA 4E7JA 1Q81O 4E7KA 1U49A 1L3SA 2QK9A 1FKOA 3HSCA 3RSEA 2BDPA 3E01A 1NGEA 1N8RO 4FJ5A 4BGBA 1IKXA 4EZ6A 2VWJA 3CFOA 1HPMA 5M1QA 2E8AA 4O0JA 5GAEP 5BR8K 2E2QA 1YHQN 3OYJA 5SWMA 1WSFA 2DFHA 4BACA 2YHWA 3RSEB 2WOMA 4FK4A 3IS9A 3N4QA 3VQ6A 3L4QA 4O4GA 1X9WA 1FXXA 2YJFA 1TKTA 4K0KK 2Z1HA 4DFKA 4WYBA 4KHYA 5ELZA 4LD0A 2GV9A 1BHLA 1Q18A 1RT7A 3P38A 3FE1A 2VYPA 1NKCA 2JLEA 2IGIA 4JKAA 1ATRA 4LH5A 3SLCA 3ZSXA 3OY9A 4B1XB 4HHTA 1I94K 3L2UA 2V7ZA 3H6EA 1Q7YO 4OKJA 1NGDA 2HNYA 2CH5A 1BG3A 1NGBA 1BOTO 5ADXA 3THYA 3HM9A 3AY9A 3TAPA 3M1FA 4NCAA 3DXKA 4DSKA 1FJGK 1RBVA 1S1UA 3IFRA 1JCGA 2VG6A 4G9ZA 4BVPA 1GOAA 1C0TA 3OYCA 3C94A 5AQGA 3C6TA 3C7NA 1U04A 3WNGA 4ID1A 1YIJN 3L0QA 1U45A 2D0AA 4IEEA 3DOKA 2QXFA 5FPEA 3TTDA 2R7YA 4EIAA 4NCGA 4JS4A 3AVMA 4MDBA 4LF6K 3DLRA 5BN9A 4FLTA 4CFAA 4Q0BA 5AQMA 3T1AA 3P39A 3KK1A 4E89A 4KTQA 4Z4IA 3NH2A 2GBZA 2HHVA 2BTFA 3HVTA 3Q7BA 1RFQA 3CXCM 3OYMA 2E88A 4KHWA 1RBTA 4NLCA 1U2VA 4LF9K 1BQNA 1F21A 1NJYA 3AAQA 4YOVA 4KV8A 4B9UA 2FSKA 3ZLJA 2HBJA 2P9SA 4CZFA 1RT5A 4GVEA 1TUYA 4DV0K 5BR9A 1IBMK 2DFEA 1HJOA 1YAGA 4DU4A 2HMIA 4AM6A 4DG1A 4ISFA 3MWTA 4FLYA 3SPYA 3AVAA 3TU5A 3LAMA 1KQSM 2GX9A 3VQ5A 3V81A 4BR0A 3QNOA 4PKIA 4A2AA 4A59A 3IAYA 5CYQA 3OYDA 4W5QA 3A2FA 3FZLA 2CH6A 4LSLA 4RTFD 1SL1A 2H3GX 3M5RA 5AZIA 2OTJN 3AAPA 2OCEA 4B08A 4FM1A 4AHRA 4Z4GA 3L2QA 4HUGA 3WXMB 5HP1A 4QAGA 2D0BA 4DTNA 5DK5A 4B3TK 1U6ZA 4IOAL 2Q0RA 5BRDA 5HROA 1NG9A 3MN9A 4YOXA 1XC9A 1ASUA 5AQUA 1SV5A 4DV2K 3I0RA 1H1VA 4DB3A 1GLCG 1LCUA 3K5MA 1HNWK 3ENOA 3ULEB 2ITGA 1MA9B 3TANA 1ASVA 3TR8A 1WBDA 1XNRK 4XIUA 1EX4A 2PYJA 4FXDA 3S3NA 4WF9L 3BF3A 1IBLK 1LWCA 4K8ZA 4DSJA 2PZSA 3A5OC 3M3ZA 3S41A 1YTUA 2ATQA 3OS0A 3UB5A 3K5OA 5LL6Z 3MK6A 4CIGA 3HZ6A 4KB1A 1IKVA 2A1RA 1A5XA 3NFAA 3ZT3A 1BDGA 1JXEA 2QWPA 3OBWA 4YOWA 1HYSA 1YF5L 5LJVA 3DRPA 3SQ2A 3M8RA 3DYAA 3TABA 3O4WA 3S9HA 4BRMA 1TKZA 2G8UA 2W40A 1KFDA 3V4IA 4GNIA 2O4IA 4NXMK 3WNEA 1VSHA 3VPZA 4M3XA 1NGGA 1W97L 3IG1A 4BG8A 3H1QA 3LAKA 2ITMA 5LY3A 1IV0A 2E6LA 4JN4A 2GEMA 3VMFB 4DTOA 2Z1JA 4Z4HA 4IFYA 3L2WA 1GLDG 3ULEA 1BIZA 2KHOA 5J2NA 1MWMA 2I5JA 3PX4A 1V4TA 1VHXA 3UKUB 2V51B 4BR5A 4CEZA 1WOQA 4KRFA 3QIPA 4NCBA 1V4SA 2NRRA 2YNIA 3CM6A 3LM2A 3CJBA 3O4NA 4M3TA 3SI6A 3SBTA 3ATVA 4MO5A 1L5UA 4F3OA 1X3NA 2W6KA 3VQPA 3AA5X 3EE8A 2ZWHA 3CC2N 3MXMA 2KFNA 3MXIA 3DLHA 3DM2A 1S1WA 1NBWA 3HRGA 5CY4A 4F2SA 4DSFA 4CFDA 1L3VA 1M90O 3C7NB 2O8EB 3MEEA 4CHZA 5KTQA 1BCMA 4CBWA 3VQQA 2Q1NA 1TVRA 4Z0UA 1K8KA 2G8HA 4ISEA 1UOCA 2VQFK 3CETA 3MCPA 1VQPN 1BISA 3FFKB 4CE9A 4FJMA 1D8YA 4RCHA 4QS8A 4EHTA 3VOVA 1NMNA 2IVPA 4BQZA 4CFBA 3LDSA 4LY7A 4LH4A 4FK0A 1HNIA 5HRPA 4N76A 4FWKA 2QKBA 2YI1A 2NRHA 1RTIA 3ZSRA 2P9KA 3H1VX 4AILC 4DS5A 3KK2A 3CMAN 3T1HK 1CZAN 3E9PA 4CHNA 5AQKA 3VEYA 4FJ7A 4O0IA 2AA4A 5F1XA 4FWQA 4N47A 4WE1A 4E1NA 2P1JA 4A62A 5CYMA 1U47A 3DXMB 5GADP 3C6AA 1HR0K 1LWEA 1RBSA 1VSDA 1YVUA 1X9JA 4DQPA 3HTVA 5FLXO 4RW6A 3CFPA 3JAMO 3J8AA 4BRPA 3ZSYA 3FGUA 2I7NA 3VA0A 1CLQA 4O55A 3EO3A 2KW4A 1QSYA 3ITHA 3PUFA 1R0AA 4FM2A 1Z05A 1HMVA 3CJ7A 4ID5A 4CJFA 5HRNA 5BREA 1J5OA 3ZEUB 1WSGA 3V9ZA 3EY1A 2A3ZA 3AO4A 4M3UA 2ETJA 3LPTA 4A5BA 2E2PA 3SUNA 4B1VA 1S1VA 5AZIB 4CI6A 2OPPA 4JKDA 5SZTA 4DTRA 3AVJA 3L6QA 4PY5A 2O8CB 4AHTA 3OA9A 3CM5A 1OVQA 3LDOA 3WT0A 4FLXA 3DWLA 1BU6O 1XHZA 1SUQA 3MN7A 4FJNA 2E4LA 1REVA 1DTQA 4BR4A 1HKBA 1HJRA 4W5OA 2FF6A 5KRTA 1J54A 3MEGA 1YTAA 3O4QA 2NRZA 5H1SQ 2XY7A 3SK3A 3ZETA 4DR4K 4DTMA 3F73A 4C8LA 1VQNN 1SL0A 4BC5A 1RDBA 3DXMA 1C1BA 2QM1A 1EWQA 3K0SA 1Q8IA 4W5TA 1QZ6A 2E2NA 4KPYA 4CGFA 1DKGD 2O8DA 3ZSOA 5AQFA 3AGRA 4YDUA 4BRCA 3OYEA 3D6RA 1ESVA 4IWVA 3QBWA 4DQIA 4CJKA 4LF5K 3DLGA 3D0PA 4DF4A 3MMVA 4OPHA 3G4SN 1A5VA 1S6PA 4AM7A 4CESA 2XY5A 1D4XA 1QS4A 5C15A 1TAUA 4X65K 3O3GA 3PO4A 5KQ8A 3L3UA 2QWMA 2VGMA 1OKJA 2P9UA 4ILJA 1XHXA 4E3SA 3WNFA 5C25A 4DR6K 4H5WA 4JKEA 4CZMA 2YHAA 4LSNA 3QEIA 3TAEA 4YOUA 4CJRA 4B9SA 4OGCA 1Y97A 2YX6A 3QETA 2HHQA 4GMJB 2GUPA 3HT3A 4KTZA 4JI3K 3QNNA 4YNQA 1VSFA 3LP0A 3M8PA 2KFZA 3SUOA 1RDAA 4OPKA 1G15A 1SZ2A 2Q2RA 3VQEA 3ZSZA 5FRMA 4KI4A 5JMVA 4CEEA 4J2EA 1HRHA 3HOTA 3JS6A 3CCMN 2GWKA 1HPZA 4FSVA 2A40A 2KZMA 3SV3A 3V9WA 2FSNA 1C1CA 3D2EA 2FBYA 1VSMA 5HRSA 4CK3A 1NGCA 2A6AA 3F9KA 1EQYA 4DCHA 2DFFA 4FW2A 1BWFO 3DMJA 3SQ0A 1SKSA 4JI7K 3M6GA 3O6WA 4C1NI 4AQYK 2YNFA 4DR2K 1JL2A 4LFBK 1YT3A 3HVRA 1NOYA 3VA3A 5KGXA 4RWTA 4BDYA 2KLAA 3R8EA 3TARA 4KHSA 3AO3A 1Z6RA 1RGIA 4CHOA 3K58A 4QOZB 2RKIA 4O8UA 1JLFA 4BE1A 5AQTA 4M63C 3PIPL 3E66A 4N41A 3EN9A 3KLEA 5M1PA 1QVFM 5E84A 1WSEA 4YOTA 4DU1A 3OJSA 5AQVA 3WQUA 1J5EK 1MDUB 3VQAA 4CGHA 4BRKA 1HQUA 5JS1A 5AQIA 4FL9A 3QBXA 4LC9B 4IBNA 3QESA 3KD1E 4H5VA 2F9TA 4YFUA 4V19S 2O8FB 3AA4A 5AFUH 1HKCA 2Z1GA 3CCJN 1ZBLA 3CCVN 4DS4A 1RT1A 4ICLA 2F8TA 1YITN 4M3YA 5IT9O 1YJNN 2PAVA 4BC2A 4YHHK 1SL2A 2EX3A 4FPAA 2HBKA 3AVKA 3U4LA 1HX1A 2P9IB 2E2OA 4UY8O 4FWMA 1WSHA 3W0LA 1C0UA 3HOSA 3VEZA 3NBPA 3WUHA 3I56N 1IG9A 2HHTA 4CF2A 3L2VA 1T6CA 1TV6A 2AP1A 2NNWA 4CGGA 4WCEL 3IUCA 5GAGP 4CGIA 4DUZK 4DFPA 2IDOA 4L8RB 3DI6A 3LP3A 3NVMA 2F7TA 1K6YA 2QWRA 1ATSA 1KC8O 1HLUA 1RTJA 4CGJA 1QQCA 4ELTA 1KTQA 4BG9A 1XMOK 2UUBK 1S72N 4J2DA 2ZGYA 1RCHA 3GDQA 4K43A 2HHXA 3LDLA 3KKRA 2HSTA 5FDLA 4BC3A 4B1UB 4BR9A 1D5AA 3GG4A 3NF8A 1JLAA 4I9LA 5J2PA 3ALYA 2JWKA 1RT4A 2D5RA 3WXIA 3L4IA 4DTUA 5M1NA 3DRRA 1GLFO 1D9DA 5HL7L 4E7IA 4Y1DA 2KKZA 4C1NK 4JLHA 4DF8A 3TAQA 2HNDA 4FLWA 3MCAB 4XEIA 3V6DA 3QB0A 2UU9K 3PLAA 4DFJA 2NRVA 3W3DA 3CMEN 5AR0A 1EXQA 3I33A 3J7ZO 2OPRA 1DEJA 4DQ8A 1QVGM 1FK9A 3I8BA 2D1KA 3C95A 2P9PA 4GVMA 2P9LB 1VK0A 1VSIA 5DMRA 3A5LC 5GIPA 3MX2A 3WXLA 4CGDA 4F9OA 4AHSA 3IRXA 1T03A 1JLCA 4PUOA 2A42A 3WXKA 4CHPA 2E5LK 1IG8A 2VGNA 4OLAA 2CGKA 5JVGL 2E1ZA 2WONA 1TL1A 4BE0A 1JCEA 3UKUA 1QTMA 4CJQA 3TI0A 1EO1A 3GBTA 5EVZA 4W5NA 1QE1A 4DV5K 4CF1A 3R3LA 3KLHA 3BDPA 5J2QA 3FZKA 2B6AA 3AVLA 3K57A 4IKFA 2HHHK 3B8AX 2FLOA 2QTDA 3Q7CA 5GAHP 4OX9K 4DMNA 1VQ5N 3I0SA 3ULDA 3MECA 1LW2A 3UE5A 1QHAA 4KB0A 4CF8A 3L3VA 3VEXA 4RW4A 1RILA 4FJIA 3DLKA 4CZEA 1RNHA 2G8VA 3B6PA 4RW8A 1WLJA 5EXWA 3QEWA 4J2BA 5KI6A 1JLQA 4K8XA 3F2KA 4JKCA 4KI6A 2FSJA 1C6VA 4CIFA 4H03B 2ZD1A 3LALA 1RBRA 1WN7A 4MQ3A 3DOLA 4H8KA 5BPLA 3HO1A 3LM9A 5BPNA 3QMLA 4FVUA 1QQMA 2ZQBA 3UKRA 4B9TA 4DV4K 4FZZA 3THXB 3KD5E 4J8FA 4FWRA 5AQYA 4E7LA 3U9DA 3NF6A 3CCRN 3PX0A 5F2RA 1GLJO 3LDPA 4FYDA 3VGKA 1WBBA 3AGKA 4DSLA 4CD1A 3BZKA 4O8KA 3DLBA 2FBXA 4CZHA 2A41A 5AQJA 3M8QA 4JKFA 2ZE2A 3RRHA 5FPMA 4B9QA 2GTDA 3TAGA 4F4KA 3LDNA 1X3MA 1NJIO 1KD1O 3D45A 4QS9A 4JI0K 4U7BA 1J6ZA 3G25A 1RTDA 3HYFA 4DQRA 3D7EO 3VTHA 3H45C 3QDKA 2PFUA 3ZCMA 5KPTA 1N33K 3JYTA 1R59O 4I2PA 1A5WA 4B3RK 4K25A 5MLCQ 3ZSQA 1YJ9N 4FOIA 2YCHA 2WBNA 2BGGA 3CJCA 4MLHA 3OYGA 4CK1A 2V7YA 3F9MA 3AVNA 3BGRA 1ASWA 3CPEA 1CZ9A 1C1AA 4O44A 2RN2A 1XWLA 3FZMA 3D2FB 2Y1IA 2HOEA 2WTUA 1XUPO 5CR4A 1VSKA 1DLOA 1ZC6A 4BVOA 1VAZA 1P8ZA 2OANA 3KK7A 5DM6L 2Z1IA 5LMNK 3BY5A 2ZGZA 2PYLA 4CJ4A 4MFBA 4KH5A 3U3YA 2CGLA 3SUQA 2EHGA 1BA1A 4FWLA 1CZBA 4RG8A 2XY8A 3AO1A 4DLEA 3SZ2A 1S1TA 5AQPA 5M1OA 3VQCA 4DUYK 4IFVA 1QSLA 4BRHA 1S3XA 4HUEA 1RT3A 3P1GA 3C65A 5E26A 4DR1K 1WAFA 4CEDA 1NNEA 3KJVA 1XI1A 4JNEA 4JRPA 3I55N 4CEQA 3THWA 3O1BA 2KZZA 2G8KA 2CGJA 3A0IX 2W41A 1BI4A 4BRAA 1UAXA 2HBLA 4JKGA 2YV0X 4IEIA 4Y0WA 1I3AA 3HBTA 3CJ1A 1VQ6N 3FZHA 2V52B 2YKMA 5DM7L 5AQLA 1NKEA 1VSEA 1KVBA 3CCLN 3AVHA 4KFBA 4N56A 5B8HA 2YHXA 4BWJA 3SJJA 2OZSA 1EETA 1C0FA 4H0OA 4Z4CA 4C8MA 3HL8A 3K5LA 1RDDA 3QEVA 3JXUA 4OVLA 1VQON 4OKKA 3RVCA 3OS2A 3ZT4A 2A1SA 2YNHA 5HRRA 4IXCA 3LP2A 4I6MB 2FC0A 1ZBUA 4WQ4A 4LF4K 3R6MA 4BRFA 4CBXA 1BIUA 4CBUA 3THWB 3EZ5A 2P5GA 4LFAK 4R79A 1VRTA 3D2EB 1W0HA 3EYZA 3SNNA 2YKNA 4BRNA 4FM0A 3LDQA 1YJWN 1TYQA 4E0DA 2KTQA 3V9UA 4CVNE 4GV3A 3TPQA 3GOIA 1UA1A 2IIRA 4CJ5A 4JS5A 4R5PA 3K9JA 4CJLA 1KRPA 4CK2A 1NJWA 1HYVA 1O1WA 2WUSA 1K8AO 2BUPA 1LAWA 5AQWA 4DSIA 5HBMA 3RMBA 1KAXA 4LFCK 3SAFA 3UIQA 3ZSVA 1ITGA 3OYNA 4KAZA 2OPSA 4FZXC 4B8AB 4CCHA 1DGKN 4CZGA 1N34K 3KK3A 5AZJB 1Y64A 1W7AA 3VF2A 3S3MA 1ILYA 2B4JA 3MAQA 3KHYA 3K59A 4CJPA 4FOEA 2Q3SA 3CD6N 1N36K 5CZ1A 4CJWA 4FLUA 4IO8A 4ELVA 3HM8A 3SUPA 1TYQB 2XRIA 4ZTJA 1VRUA 3KLFA 1BO5O 1NK8A 3ZX0A 4Z94A 3C6HA 3U6FA 4JI4K 4EP5A 4H0PA 3GL1A 2ZJQL 1QQOA 4A2BA 4JRQA 1KXPA 4X66K 3SMPA 4DV1K 4DQSA 2XO7A 3ZT2A 4MO4A 5JVHL 1HUXA 4JEPA 3QIOA 2P9NA 4HTUA 3EEQA 5C2FA 3O1WA 3HI0A 1TL3A 5LMUK 3CC4N 5C42A 3O9RA 4B9NA 3TTCA 2G8FA 1X9MA 3CC7N 1NOZA 5I9EB 4B9LA 3SV4A 4IZ9A 1TKXA 4GY2B 3J7YP 1JLEA 4CZLA 2P5OA 2F9WA 5J2MA 1NK7A 4HVJA 3VESA 4CD3A 4B1ZA 2HBMA 4G1QA 1VQLN 3VQ4A 4FPBA 3LL3A 3ID6A 4WFAL 2O4GA 3NH1A 4I2QA 3H46O 1RBUA 4BROA 3A8YA 4FJ8A 4BREA 3S3OA 3ZEUA 5M1KA 3L2RA 4F8RA 2Q31A 4CZIA 3MXJA 1NK6A 3NH0A 4X62K 3VETA 4OO1J 1S5JA 3SCXA 1Q82O 1KAZA 3AVGA 4A61A 4CHYA 1FW6A 4NXNK 2X6NA 4FLZA 1OH7A 2W42A 4M3ZA 2QKKA 4FO0A 1BGXT 3PSIA 2IOCA 2NUBA 1HNZK 4I9QA 3HJFA 3THYB 1JJ2M 4DU3A 3PO5A 3FFIA 2GWJA 4IOXA 5AFUA 1KLMA 4DLGA 3OJUA 3M8SA 3U8XA 1N5YA 1HNVA 1TAQA 1EKEA 4N5SA 3CJ9A 1FKPA 1L3UA 2D0CA 2E20A 1S1XA 3LANA 4FW1A 4HCBA 3NF9A 4BQLA 5KQDA 3T19A 3WXJA 3DJCA 3AVBA 3P4IA 1YUWA 5BPMA 5LJWA 1JL1A 4XH5A 3VQ9A 4B1YB 3QERA 2VG5A 5CZ2A 1IO2A 3KWIA 4H4OA 4DV3K 1ATNA 4CJUA 4DR3K 1ZBIA 4E1JA 2PY5A 3PX6A 4ILGB 4H5TA 4ILHA 3CERA 2FBVA 2RE2A 2O8BB 3P31A 1MU2A 1T05A 4LF7K 5AQQA 2QW9A 3T69A 1Q86O 2IVOA 4CIEA 2P9PB 5KGWA 2IAJA 1C0GA 3DRSA 4DTXA 3HSTB 5AQSA 1TK5A 4CERA 1XNQK 4XH4A 2NZTA 3OYKA 4JHDB 5KRSA 1M1KO 4DV6K 4C8KA 3G71N 2VWKA 1IKYA 4CEAA 1XC3A 3C6UA 3OTOK 4JK8A 4PWDA 3HK2A 1GOCA 5JS2A 5FRNA 3NHGA 3J81O 2RF2A 3MN6A 4IG3A 3OYFA 3SPZA 1OVYA 4M3RA 1VQ7N 3AVFA 1IJJA 4KREA 3VQ8A 3ZETB 3T3FA 3QEPA 4IJNA 4KH6A 4OGEA 2D0OA 3WNHA 3CIPA 2HW3A 1S9EA 3QEXA 4M42A 3P83D 2GELA 3ZT1A 4RW7A 1SQKA 1TKDA 4LF8K 3BUZB 2ZJRL 4E1MA 3OYHA 2Q0UA 4JI1K 2UYTA 2A5XA 5A2QO 4CECA 3AO5A 3ZX2A 5KPZA 3AARA 4A5AA 2X78A 1IH7A 3O80A 5CHIA 2G8IA 4OPJA 3CQ8A 1SKWA 1EWRA 3OHRA 3QFUA 1EP4A 3BZCA 1KVCA 4BR7A 1E3MA 4BWMA 4CHQA 1T7PA 5C2DA 4M3WA 1VQ9N 4DSEA 4YDUC 1JKHA 2HB5A 1K73O 4ZTFA 1OH5A 5E41A 4JI5K 3T1YK 4HTLA 4BRQA 5AQOA 4BRLA 2O8FA 3DAWA 1T44A 1Q9YA 2BH1A 3OYAA 1ZXOA 3IKMA 3SJHA 4DQQA 4H0XB 4AHUA 4BRIA 2VWBA 3RMCA 5JLHA 3NF7A 3THVA 3O9UA 1X1PA 3MN5A 4CFCA 3CFRA 1KSPA 1GOBA 5CE3A 3VN5A 3OBYA 3E9OA 4FWSA 1OH8A 2HNZA 1WSIA 3ENBA 3NDKA 1ZBFA 3O9SA 2OPQA 2F8SA 2HVHA 3R9PA 1Z26A 2P9KB 5FPDA 2P9NB 4MLEA 4DR7K 5FROA 4GW6A 1NK0A 3TTFA 1E4GT 4WQ5C 3VGMA 2ASPA 4WQ4C 2Y1JA 4FJKA 3V1OA 4M7XA 3PIOL 1NMDA 1HKGA 4C8NA 5D3GA 3CCSN 1KCFA 1K8KB 1HYZA 4IDKA 4DTSA 2P9SB 5AQRA 4JI2K 3D2FA 3OS1A 3HPOA 1BQMA 4H4MA 1J53A 4DTJA 3AV9A 2XY6A 1LAVA 2QWOA 2UXDK 1D9FA 5C24A 4FJJA
chains in the Genus database with same CATH topology
3KTQA 3O3GA 1I3AA 5I3UA 1U49A 3PO4A 4KHQA 1L3SA 2QK9A 3AVCA 1FKOA 2YKMA 3L3UA 1NKEA 1RTHA 3JSMA 1VSEA 1KVBA 2BDPA 1XHXA 3AVHA 3E01A 4KFBA 4E3SA 3WNFA 5C25A 4FJ5A 4N56A 1IKXA 4RW9A 4EZ6A 2VWJA 4B9MA 3K2PA 2IC3A 3CFOA 4BWJA 3SJJA 3ZT0A 3KLIA 3LPUA 4O0JA 2OZSA 2YHAA 1EETA 4B9VA 4LSNA 3QEIA 1JLGA 4Z4CA 3OYJA 4C8MA 5SWMA 3TAEA 1WSFA 1CLQA 4CJRA 2DFHA 4BACA 2X74A 2YHBA 3HL8A 2G8WA 4B9SA 3K5LA 1RDDA 4Q5VA 3QEVA 4OVLA 2WOMA 4OGCA 4PQUA 1Y97A 4OKKA 3QETA 3IS9A 4GMJB 4FK4A 2HHQA 3OS2A 3O3FA 3VQ6A 3RWUA 3ZT4A 2A1SA 2YNHA 4O4GA 1X9WA 3HT3A 1FXXA 1TKTA 2Z1HA 4KTZA 5HRRA 3NGIA 4DFKA 4YNQA 1VSFA 3LP2A 3LP0A 3M8PA 3QNNA 2FC0A 1ZBUA 2KFZA 3SUOA 1BIUA 4KHYA 1RDAA 4OPKA 1G15A 4LD0A 1U48A 3EZ5A 3VQEA 2GV9A 3ZSZA 2P5GA 1BHLA 2F96A 5FRMA 1RT7A 1VRTA 4KI4A 1W0HA 4CEEA 3EYZA 1NKCA 2JLEA 2IGIA 4J2EA 1HRHA 3SNNA 2YKNA 4FM0A 1HPZA 5C24A 4LH5A 4DTPA 3PY8A 2KZMA 1X9SA 3K5NA 4E0DA 3ZSXA 3OY9A 2KTQA 3SV3A 3V9UA 3V9WA 1L3TA 2OA8A 1C1CA 4HHTA 3L2UA 2FBYA 1VSMA 4Z4FA 1UA1A 4Z4EA 4FJGA 5HRSA 2DY4A 4CK3A 4CJ5A 4JS5A 4R5PA 4CJEA 4OKJA 1U4BA 3F9KA 2HNYA 4CJLA 1KRPA 2DFFA 4FW2A 3HM9A 4CK2A 1CXUA 3DMJA 1HYVA 3SQ0A 2KQ2A 1O1WA 3RMAA 1NJWA 3TAPA 1SKSA 2HHSA 4NYFA 3LP1A 1LAWA 4NCAA 3G0ZA 4DSIA 2YNFA 1JL2A 1YT3A 1S9GA 5HBMA 3RMBA 4E7HA 3HVRA 4DSKA 1NOYA 1RBVA 1S1UA 1WAJA 3VA3A 3UIQA 5KGXA 2VG6A 4OJRA 3ZSVA 4BDYA 3TARA 4KHSA 3AO3A 1ITGA 3OYNA 4KAZA 2OPSA 4FZXC 1GOAA 4B8AB 4CCHA 1C0TA 4CHOA 3OYCA 3K58A 4QOZB 3AO2A 2RKIA 1JLFA 1QHTA 3LZJA 3C94A 4BE1A 1KFSA 1NKBA 4N41A 5J1EA 3KK3A 3KLEA 3C6TA 1U04A 3WNGA 4ID1A 1WSEA 5EU7A 3AA2A 3S3MA 2B4JA 1U45A 3MAQA 2D0AA 4DU1A 3DOKA 3OJSA 4CJPA 3K59A 2QXFA 2Q3SA 2R7YA 5CZ1A 1B9DA 4CJWA 4NCGA 3VQAA 3AVMA 4CGHA 4JS4A 4FLUA 1HQUA 5JS1A 3HXMA 4ELVA 3DLRA 3SUPA 4IBNA 4EP4A 4FLTA 3QESA 3KD1E 4CFAA 4DFMA 2XRIA 4YFUA 4Q0BA 4ZTJA 1VRUA 3AA4A 3KLFA 1NK8A 4CEBA 3T1AA 3P5JA 1WNSA 1RT2A 3KK1A 3U6FA 4E89A 4KTQA 4EP5A 2Z1GA 3HP9A 5HLFA 4Z4IA 1ZBLA 3NH2A 4DS4A 2GBZA 1RT1A 4KTWA 2HHVA 3HVTA 3KLGA 4JRQA 4ICLA 2F8TA 3OYMA 4FCYA 4KHWA 4M3YA 4DQSA 1RBTA 4CEOA 2XO7A 3ZT2A 1SL2A 2EX3A 1BQNA 3AVKA 3QIOA 3SQ1A 1F21A 1NJYA 4HTUA 4KV8A 4B9UA 1RT5A 1WSHA 1TL3A 5C42A 4BDPA 2DFEA 1C0UA 1NK5A 3G10A 4DU4A 4B9NA 2HMIA 2G8FA 1X9MA 4FJXA 3NBPA 1NOZA 4B3OA 4DG1A 3VQDA 1IG9A 4FLYA 2HHTA 4CF2A 2BE2A 3AVAA 3L2VA 3SPYA 3SV4A 4B9LA 1TV6A 3LAMA 4CGGA 3AA3A 1TKXA 3VQ5A 3V81A 1JLEA 2OYQA 3QNOA 4CGIA 4DFPA 2P5OA 2IDOA 5J2MA 3IAYA 4L8RB 5CYQA 3OYDA 4W5QA 3DI6A 3LP3A 4HVJA 3A2FA 1NK7A 1TK8A 1K6YA 4LSLA 1RTJA 4G1QA 3VQ7A 1SL1A 4CGJA 3VQ4A 1QQCA 4ELTA 1KTQA 2LSNA 4AHRA 4B08A 5T7BA 3L2QA 4HUGA 4FM1A 3QINA 2O4GA 3NH1A 4I2QA 4Z4GA 3DLEA 1RBUA 5HP1A 4CJVA 3KKSA 2D0BA 4QAGA 4J2DA 4DTNA 5DK5A 3RTVA 4FJ8A 1VSJA 1RCHA 2HHXA 3OYLA 4AH9A 3S3OA 5HROA 3H08A 3KKRA 5FDLA 1VSLA 3L2RA 4F8RA 1D5AA 3HPHA 1XC9A 1ASUA 3NF8A 1JLAA 1SV5A 3MXJA 3I0RA 4I9LA 5J2PA 1NK6A 3ALYA 3NH0A 3K5MA 1RT4A 2D5RA 1S5JA 2ITGA 4DTUA 3TANA 3SCXA 1ASVA 4CHYA 3AVGA 3DRRA 3TR8A 4F3TA 4XIUA 1D9DA 1EX4A 3V1QA 4E7IA 4Y1DA 2PYJA 4FXDA 2X6NA 4FLZA 2HHWA 4HUFA 3QLHA 2W42A 4M41A 5I42A 3S3NA 4JLHA 4DF8A 4M3ZA 2P51A 2QKKA 3TAQA 2HNDA 1BGXT 1BCOA 4FLWA 3RRGA 3V6DA 1LWCA 2XHBA 4DFJA 2IOCA 2NUBA 4K8ZA 3I8DA 4DSJA 4I9QA 3HJFA 1EXQA 4FVMA 2PZSA 1IKWA 1B9FA 1TGOA 1LW0A 2OPRA 3NCIA 3RR7A 4DU3A 1B92A 1YTUA 2ATQA 3OS0A 3PO5A 3K5OA 3FFIA 4FJLA 4CIGA 4KHNA 4KB1A 1IKVA 1KLMA 4DLGA 1FK9A 3OJUA 3M8SA 1A5XA 2A1RA 3NFAA 4IG0A 3ZT3A 3C95A 1JXEA 1I39A 1RT6A 4GVMA 1N5YA 4FK2A 1VK0A 1HNVA 1NK4A 1HYSA 1TAQA 1EKEA 3SQ2A 1VSIA 3DRPA 5DMRA 4N5SA 3OYBA 3M8RA 3LWMA 2BANA 1FKPA 3DYAA 3TABA 4CGDA 1L3UA 2D0CA 3S9HA 1TKZA 2G8UA 1S1XA 3IRXA 3LANA 1KFDA 3ISNC 4AHSA 1JLCA 3V4IA 4FW1A 1T03A 2IS3A 4PUOA 2O4IA 4HCBA 4CHPA 3L8BA 3WNEA 1VSHA 3NF9A 4CF0A 4F2RA 4OLAA 1J9AA 4M3XA 4ELUA 1RDCA 3IG1A 3T19A 3CYMA 2WONA 3V1RA 2X6SA 3LAKA 3AVBA 1TL1A 4BE0A 3B6OA 1QTMA 4I7FA 4CJQA 3TAFA 2E6LA 3TI0A 1JL1A 1S6QA 1N6QA 4DTOA 3QO9A 2Z1JA 3VQ9A 4Z4HA 2E6MA 3QERA 4IFYA 3L2WA 2VG5A 5CZ2A 1IO2A 3NGYA 4W5NA 1QE1A 4H4OA 1BIZA 4CF1A 4CJUA 3KLHA 5J2NA 2HHUA 3BDPA 1ZBIA 2PY5A 3PX6A 2I5JA 3OYIA 3PX4A 5J2QA 4NYNA 3SQ4A 4OKEA 3PV8A 2B6AA 2FBVA 4CEZA 3AVLA 3K57A 1ZYQA 4IKFA 4KRFA 5K14A 3QIPA 1MU2A 4NCBA 2YNIA 1T05A 1WSJA 3CM6A 4FJ9A 3O4NA 4M3TA 3SI6A 1L5UA 4CIEA 4F3OA 5KGWA 3VQPA 2IAJA 4DMNA 3TWHA 3AA5X 1JLBA 3V9XA 2KFNA 3DRSA 3CG7A 4DTXA 3HSTB 3MXMA 4EZ9A 3I0SA 3MXIA 3ULDA 1TK5A 3MECA 3MEDA 4CERA 3DM2A 3DLHA 1LW2A 1S1WA 4FZYA 5CY4A 4F2SA 4KB0A 4CF8A 1BI4B 4DSFA 3L3VA 3OYKA 4CFDA 4J2AA 1BL3A 4RW4A 1L3VA 1RILA 4OLBA 5KRSA 3HP6A 4FJIA 3DLKA 3MEEA 4CHZA 5KTQA 1RNHA 3SYZA 2G8VA 4C8KA 3B6PA 4RW8A 1BCMA 1WLJA 2VWKA 1IKYA 4CEAA 3QEWA 1UA0A 4J2BA 3C6UA 5KI6A 3VQQA 1JLQA 1TVRA 4UQGA 4K8XA 4Z0UA 4PWDA 3HK2A 2GUIA 4KI6A 1LWFA 1GOCA 2G8HA 1UOCA 3NE6A 1Q9XA 1C6VA 5JS2A 4CIFA 5FRNA 3NHGA 2ZD1A 3LALA 1RBRA 2RF2A 1BISA 1WN7A 4IG3A 4MQ3A 1HQEA 3DOLA 4H8KA 4CEFA 3OYFA 3SPZA 1NJZA 3HO1A 4CE9A 4FJMA 4O5BA 4M3RA 1D8YA 2ZQBA 3AVFA 4B9TA 4CFBA 3LDSA 4KREA 4LY7A 4LH4A 4FK0A 3VQ8A 1HNIA 5HRPA 3T3FA 1KLNA 4FZZA 1QSSA 4AHVA 3KD5E 3QEPA 4N76A 2QKBA 1RTIA 3ZSRA 4E7LA 4OGEA 3NF6A 3WNHA 4DS5A 4AILC 3KK2A 3PX0A 2HW3A 1S9EA 3QEXA 4M42A 3P83D 4M45A 1T8EA 4FYDA 3HPGA 1Z25A 3ZT1A 3ZSWA 2JGUA 4CHNA 4CJ3A 4RW7A 2HVIA 1TKDA 4DSLA 4FJ7A 4O0IA 3DLBA 4N47A 4CJTA 2FBTA 4WE1A 2FBXA 4E7JA 4E1NA 4E1MA 3OYHA 3M8QA 2P1JA 5CYMA 2ZE2A 1U47A 3RRHA 4QCLA 3RMDA 4CECA 3AO5A 1ZBHA 3KIOA 1LWEA 1RBSA 3TAGA 1VSDA 1CXQA 4F4KA 3ASMA 1YVUA 4B8CA 4BE2A 4DQPA 3D45A 3NGZA 4RW6A 4ZHRA 3CFPA 1LV5A 2X78A 1IH7A 3ZSYA 3VA0A 2G8IA 1RTDA 4O55A 4OPJA 3OVNA 3CQ8A 2KW4A 1SKWA 1DTTA 1QSYA 3ITHA 3HYFA 3PUFA 4BDZA 1EP4A 3AVIA 4FM2A 4DQRA 1R0AA 1KVCA 1HMVA 4BWMA 4ID5A 3ZCMA 4AHCA 4CJFA 4CHQA 5HRNA 1T7PA 1J5OA 4M3WA 1WSGA 3JYTA 4DSEA 1JKHA 2HB5A 1A5WA 4I2PA 3EY1A 3V9ZA 3AO4A 4ZTFA 4M3UA 3TAMA 5E41A 2ETJA 3LPTA 3SUNA 3ZSQA 1S1VA 2BGGA 1Q9YA 3OYGA 2OZMA 2OPPA 4KO0A 4CK1A 5SZTA 3V9SA 4DTRA 3OYAA 3AVJA 4PY5A 4C8OA 4AHTA 3AVNA 3BGRA 3NAEA 3LZIA 4DQQA 1ASWA 1CZ9A 3CM5A 4AHUA 2B5JA 3RMCA 3NF7A 1UWBA 1C1AA 3LWLA 3THVA 4CF9A 4O44A 2RN2A 4FLXA 1X1PA 1XWLA 4CFCA 3CFRA 2Y1IA 1KSPA 1GOBA 3O3HA 3VN5A 1VSKA 1XHZA 1DLOA 1SUQA 4FJNA 2E4LA 1REVA 1WSIA 1DTQA 2HNZA 3NDKA 1ZBFA 2OPQA 2YNGA 2F8SA 2HVHA 1HJRA 2Z1IA 4W5OA 5KRTA 2PYLA 1J54A 1Z26A 4CJ4A 3MEGA 4MFBA 1YTAA 3O4QA 4KKOA 3U3YA 5FROA 2XY7A 4GW6A 1NK0A 4DWIA 3SUQA 4DTMA 2EHGA 4W5RA 3F73A 4C8LA 1SL0A 1JXBA 1RDBA 1CZBA 4RG8A 1C1BA 2RPIA 2AJQA 1SKRA 2XY8A 1W9HA 1Q8IA 1C0MA 4PA1A 4W5TA 4HCCA 2Y1JA 4FJHA 3AO1A 4FJKA 4DLEA 4CGFA 4KPYA 3V1OA 4KHUA 3SZ2A 1S1TA 3VQBA 3VQCA 4C8NA 5D3GA 3ZSOA 4E19A 4IFVA 1QSLA 3RR8A 1KCFA 3OYEA 3U3GA 4HUEA 1HYZA 1TK0A 2VG7A 4IDKA 1RT3A 4DTSA 3P1GA 1NJXA 4DQIA 4CJKA 1WAFA 1KVAA 4CEDA 4CJSA 3DLGA 3KJVA 2DTUA 3D0PA 3OS1A 3HPOA 1XI1A 4DF4A 1BQMA 4H4MA 1J53A 1A5VA 1S6PA 4DTJA 4TSXA 4Y1CA 4JRPA 4CEQA 2KZZA 3AV9A 4CESA 2XY5A 2XY6A 1NK9A 1LAVA 2G8KA 1BI4A 1QS4A 1UAXA 4FLVA 1D9FA 2YV0X 4FJJA 1TAUA 4E7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KTQ A;  3O3G A;  1I3A A;  5I3U A;  1U49 A;  3PO4 A;  4KHQ A;  1L3S A;  2QK9 A;  3AVC A;  1FKO A;  2YKM A;  3L3U A;  1NKE A;  1RTH A;  3JSM A;  1VSE A;  1KVB A;  2BDP A;  1XHX A;  3AVH A;  3E01 A;  4KFB A;  4E3S A;  3WNF A;  5C25 A;  4FJ5 A;  4N56 A;  1IKX A;  4RW9 A;  4EZ6 A;  2VWJ A;  4B9M A;  3K2P A;  2IC3 A;  3CFO A;  4BWJ A;  3SJJ A;  3ZT0 A;  3KLI A;  3LPU A;  4O0J A;  2OZS A;  2YHA A;  1EET A;  4B9V A;  4LSN A;  3QEI A;  1JLG A;  4Z4C A;  3OYJ A;  4C8M A;  5SWM A;  3TAE A;  1WSF A;  1CLQ A;  4CJR A;  2DFH A;  4BAC A;  2X74 A;  2YHB A;  3HL8 A;  2G8W A;  4B9S A;  3K5L A;  1RDD A;  4Q5V A;  3QEV A;  4OVL A;  2WOM A;  4OGC A;  4PQU A;  1Y97 A;  4OKK A;  3QET A;  3IS9 A;  4GMJ B;  4FK4 A;  2HHQ A;  3OS2 A;  3O3F A;  3VQ6 A;  3RWU A;  3ZT4 A;  2A1S A;  2YNH A;  4O4G A;  1X9W A;  3HT3 A;  1FXX A;  1TKT A;  2Z1H A;  4KTZ A;  5HRR A;  3NGI A;  4DFK A;  4YNQ A;  1VSF A;  3LP2 A;  3LP0 A;  3M8P A;  3QNN A;  2FC0 A;  1ZBU A;  2KFZ A;  3SUO A;  1BIU A;  4KHY A;  1RDA A;  4OPK A;  1G15 A;  4LD0 A;  1U48 A;  3EZ5 A;  3VQE A;  2GV9 A;  3ZSZ A;  2P5G A;  1BHL A;  2F96 A;  5FRM A;  1RT7 A;  1VRT A;  4KI4 A;  1W0H A;  4CEE A;  3EYZ A;  1NKC A;  2JLE A;  2IGI A;  4J2E A;  1HRH A;  3SNN A;  2YKN A;  4FM0 A;  1HPZ A;  5C24 A;  4LH5 A;  4DTP A;  3PY8 A;  2KZM A;  1X9S A;  3K5N A;  4E0D A;  3ZSX A;  3OY9 A;  2KTQ A;  3SV3 A;  3V9U A;  3V9W A;  1L3T A;  2OA8 A;  1C1C A;  4HHT A;  3L2U A;  2FBY A;  1VSM A;  4Z4F A;  1UA1 A;  4Z4E A;  4FJG A;  5HRS A;  2DY4 A;  4CK3 A;  4CJ5 A;  4JS5 A;  4R5P A;  4CJE A;  4OKJ A;  1U4B A;  3F9K A;  2HNY A;  4CJL A;  1KRP A;  2DFF A;  4FW2 A;  3HM9 A;  4CK2 A;  1CXU A;  3DMJ A;  1HYV A;  3SQ0 A;  2KQ2 A;  1O1W A;  3RMA A;  1NJW A;  3TAP A;  1SKS A;  2HHS A;  4NYF A;  3LP1 A;  1LAW A;  4NCA A;  3G0Z A;  4DSI A;  2YNF A;  1JL2 A;  1YT3 A;  1S9G A;  5HBM A;  3RMB A;  4E7H A;  3HVR A;  4DSK A;  1NOY A;  1RBV A;  1S1U A;  1WAJ A;  3VA3 A;  3UIQ A;  5KGX A;  2VG6 A;  4OJR A;  3ZSV A;  4BDY A;  3TAR A;  4KHS A;  3AO3 A;  1ITG A;  3OYN A;  4KAZ A;  2OPS A;  4FZX C;  1GOA A;  4B8A B;  4CCH A;  1C0T A;  4CHO A;  3OYC A;  3K58 A;  4QOZ B;  3AO2 A;  2RKI A;  1JLF A;  1QHT A;  3LZJ A;  3C94 A;  4BE1 A;  1KFS A;  1NKB A;  4N41 A;  5J1E A;  3KK3 A;  3KLE A;  3C6T A;  1U04 A;  3WNG A;  4ID1 A;  1WSE A;  5EU7 A;  3AA2 A;  3S3M A;  2B4J A;  1U45 A;  3MAQ A;  2D0A A;  4DU1 A;  3DOK A;  3OJS A;  4CJP A;  3K59 A;  2QXF A;  2Q3S A;  2R7Y A;  5CZ1 A;  1B9D A;  4CJW A;  4NCG A;  3VQA A;  3AVM A;  4CGH A;  4JS4 A;  4FLU A;  1HQU A;  5JS1 A;  3HXM A;  4ELV A;  3DLR A;  3SUP A;  4IBN A;  4EP4 A;  4FLT A;  3QES A;  3KD1 E;  4CFA A;  4DFM A;  2XRI A;  4YFU A;  4Q0B A;  4ZTJ A;  1VRU A;  3AA4 A;  3KLF A;  1NK8 A;  4CEB A;  3T1A A;  3P5J A;  1WNS A;  1RT2 A;  3KK1 A;  3U6F A;  4E89 A;  4KTQ A;  4EP5 A;  2Z1G A;  3HP9 A;  5HLF A;  4Z4I A;  1ZBL A;  3NH2 A;  4DS4 A;  2GBZ A;  1RT1 A;  4KTW A;  2HHV A;  3HVT A;  3KLG A;  4JRQ A;  4ICL A;  2F8T A;  3OYM A;  4FCY A;  4KHW A;  4M3Y A;  4DQS A;  1RBT A;  4CEO A;  2XO7 A;  3ZT2 A;  1SL2 A;  2EX3 A;  1BQN A;  3AVK A;  3QIO A;  3SQ1 A;  1F21 A;  1NJY A;  4HTU A;  4KV8 A;  4B9U A;  1RT5 A;  1WSH A;  1TL3 A;  5C42 A;  4BDP A;  2DFE A;  1C0U A;  1NK5 A;  3G10 A;  4DU4 A;  4B9N A;  2HMI A;  2G8F A;  1X9M A;  4FJX A;  3NBP A;  1NOZ A;  4B3O A;  4DG1 A;  3VQD A;  1IG9 A;  4FLY A;  2HHT A;  4CF2 A;  2BE2 A;  3AVA A;  3L2V A;  3SPY A;  3SV4 A;  4B9L A;  1TV6 A;  3LAM A;  4CGG A;  3AA3 A;  1TKX A;  3VQ5 A;  3V81 A;  1JLE A;  2OYQ A;  3QNO A;  4CGI A;  4DFP A;  2P5O A;  2IDO A;  5J2M A;  3IAY A;  4L8R B;  5CYQ A;  3OYD A;  4W5Q A;  3DI6 A;  3LP3 A;  4HVJ A;  3A2F A;  1NK7 A;  1TK8 A;  1K6Y A;  4LSL A;  1RTJ A;  4G1Q A;  3VQ7 A;  1SL1 A;  4CGJ A;  3VQ4 A;  1QQC A;  4ELT A;  1KTQ A;  2LSN A;  4AHR A;  4B08 A;  5T7B A;  3L2Q A;  4HUG A;  4FM1 A;  3QIN A;  2O4G A;  3NH1 A;  4I2Q A;  4Z4G A;  3DLE A;  1RBU A;  5HP1 A;  4CJV A;  3KKS A;  2D0B A;  4QAG A;  4J2D A;  4DTN A;  5DK5 A;  3RTV A;  4FJ8 A;  1VSJ A;  1RCH A;  2HHX A;  3OYL A;  4AH9 A;  3S3O A;  5HRO A;  3H08 A;  3KKR A;  5FDL A;  1VSL A;  3L2R A;  4F8R A;  1D5A A;  3HPH A;  1XC9 A;  1ASU A;  3NF8 A;  1JLA A;  1SV5 A;  3MXJ A;  3I0R A;  4I9L A;  5J2P A;  1NK6 A;  3ALY A;  3NH0 A;  3K5M A;  1RT4 A;  2D5R A;  1S5J A;  2ITG A;  4DTU A;  3TAN A;  3SCX A;  1ASV A;  4CHY A;  3AVG A;  3DRR A;  3TR8 A;  4F3T A;  4XIU A;  1D9D A;  1EX4 A;  3V1Q A;  4E7I A;  4Y1D A;  2PYJ A;  4FXD A;  2X6N A;  4FLZ A;  2HHW A;  4HUF A;  3QLH A;  2W42 A;  4M41 A;  5I42 A;  3S3N A;  4JLH A;  4DF8 A;  4M3Z A;  2P51 A;  2QKK A;  3TAQ A;  2HND A;  1BGX T;  1BCO A;  4FLW A;  3RRG A;  3V6D A;  1LWC A;  2XHB A;  4DFJ A;  2IOC A;  2NUB A;  4K8Z A;  3I8D A;  4DSJ A;  4I9Q A;  3HJF A;  1EXQ A;  4FVM A;  2PZS A;  1IKW A;  1B9F A;  1TGO A;  1LW0 A;  2OPR A;  3NCI A;  3RR7 A;  4DU3 A;  1B92 A;  1YTU A;  2ATQ A;  3OS0 A;  3PO5 A;  3K5O A;  3FFI A;  4FJL A;  4CIG A;  4KHN A;  4KB1 A;  1IKV A;  1KLM A;  4DLG A;  1FK9 A;  3OJU A;  3M8S A;  1A5X A;  2A1R A;  3NFA A;  4IG0 A;  3ZT3 A;  3C95 A;  1JXE A;  1I39 A;  1RT6 A;  4GVM A;  1N5Y A;  4FK2 A;  1VK0 A;  1HNV A;  1NK4 A;  1HYS A;  1TAQ A;  1EKE A;  3SQ2 A;  1VSI A;  3DRP A;  5DMR A;  4N5S A;  3OYB A;  3M8R A;  3LWM A;  2BAN A;  1FKP A;  3DYA A;  3TAB A;  4CGD A;  1L3U A;  2D0C A;  3S9H A;  1TKZ A;  2G8U A;  1S1X A;  3IRX A;  3LAN A;  1KFD A;  3ISN C;  4AHS A;  1JLC A;  3V4I A;  4FW1 A;  1T03 A;  2IS3 A;  4PUO A;  2O4I A;  4HCB A;  4CHP A;  3L8B A;  3WNE A;  1VSH A;  3NF9 A;  4CF0 A;  4F2R A;  4OLA A;  1J9A A;  4M3X A;  4ELU A;  1RDC A;  3IG1 A;  3T19 A;  3CYM A;  2WON A;  3V1R A;  2X6S A;  3LAK A;  3AVB A;  1TL1 A;  4BE0 A;  3B6O A;  1QTM A;  4I7F A;  4CJQ A;  3TAF A;  2E6L A;  3TI0 A;  1JL1 A;  1S6Q A;  1N6Q A;  4DTO A;  3QO9 A;  2Z1J A;  3VQ9 A;  4Z4H A;  2E6M A;  3QER A;  4IFY A;  3L2W A;  2VG5 A;  5CZ2 A;  1IO2 A;  3NGY A;  4W5N A;  1QE1 A;  4H4O A;  1BIZ A;  4CF1 A;  4CJU A;  3KLH A;  5J2N A;  2HHU A;  3BDP A;  1ZBI A;  2PY5 A;  3PX6 A;  2I5J A;  3OYI A;  3PX4 A;  5J2Q A;  4NYN A;  3SQ4 A;  4OKE A;  3PV8 A;  2B6A A;  2FBV A;  4CEZ A;  3AVL A;  3K57 A;  1ZYQ A;  4IKF A;  4KRF A;  5K14 A;  3QIP A;  1MU2 A;  4NCB A;  2YNI A;  1T05 A;  1WSJ A;  3CM6 A;  4FJ9 A;  3O4N A;  4M3T A;  3SI6 A;  1L5U A;  4CIE A;  4F3O A;  5KGW A;  3VQP A;  2IAJ A;  4DMN A;  3TWH A;  3AA5 X;  1JLB A;  3V9X A;  2KFN A;  3DRS A;  3CG7 A;  4DTX A;  3HST B;  3MXM A;  4EZ9 A;  3I0S A;  3MXI A;  3ULD A;  1TK5 A;  3MEC A;  3MED A;  4CER A;  3DM2 A;  3DLH A;  1LW2 A;  1S1W A;  4FZY A;  5CY4 A;  4F2S A;  4KB0 A;  4CF8 A;  1BI4 B;  4DSF A;  3L3V A;  3OYK A;  4CFD A;  4J2A A;  1BL3 A;  4RW4 A;  1L3V A;  1RIL A;  4OLB A;  5KRS A;  3HP6 A;  4FJI A;  3DLK A;  3MEE A;  4CHZ A;  5KTQ A;  1RNH A;  3SYZ A;  2G8V A;  4C8K A;  3B6P A;  4RW8 A;  1BCM A;  1WLJ A;  2VWK A;  1IKY A;  4CEA A;  3QEW A;  1UA0 A;  4J2B A;  3C6U A;  5KI6 A;  3VQQ A;  1JLQ A;  1TVR A;  4UQG A;  4K8X A;  4Z0U A;  4PWD A;  3HK2 A;  2GUI A;  4KI6 A;  1LWF A;  1GOC A;  2G8H A;  1UOC A;  3NE6 A;  1Q9X A;  1C6V A;  5JS2 A;  4CIF A;  5FRN A;  3NHG A;  2ZD1 A;  3LAL A;  1RBR A;  2RF2 A;  1BIS A;  1WN7 A;  4IG3 A;  4MQ3 A;  1HQE A;  3DOL A;  4H8K A;  4CEF A;  3OYF A;  3SPZ A;  1NJZ A;  3HO1 A;  4CE9 A;  4FJM A;  4O5B A;  4M3R A;  1D8Y A;  2ZQB A;  3AVF A;  4B9T A;  4CFB A;  3LDS A;  4KRE A;  4LY7 A;  4LH4 A;  4FK0 A;  3VQ8 A;  1HNI A;  5HRP A;  3T3F A;  1KLN A;  4FZZ A;  1QSS A;  4AHV A;  3KD5 E;  3QEP A;  4N76 A;  2QKB A;  1RTI A;  3ZSR A;  4E7L A;  4OGE A;  3NF6 A;  3WNH A;  4DS5 A;  4AIL C;  3KK2 A;  3PX0 A;  2HW3 A;  1S9E A;  3QEX A;  4M42 A;  3P83 D;  4M45 A;  1T8E A;  4FYD A;  3HPG A;  1Z25 A;  3ZT1 A;  3ZSW A;  2JGU A;  4CHN A;  4CJ3 A;  4RW7 A;  2HVI A;  1TKD A;  4DSL A;  4FJ7 A;  4O0I A;  3DLB A;  4N47 A;  4CJT A;  2FBT A;  4WE1 A;  2FBX A;  4E7J A;  4E1N A;  4E1M A;  3OYH A;  3M8Q A;  2P1J A;  5CYM A;  2ZE2 A;  1U47 A;  3RRH A;  4QCL A;  3RMD A;  4CEC A;  3AO5 A;  1ZBH A;  3KIO A;  1LWE A;  1RBS A;  3TAG A;  1VSD A;  1CXQ A;  4F4K A;  3ASM A;  1YVU A;  4B8C A;  4BE2 A;  4DQP A;  3D45 A;  3NGZ A;  4RW6 A;  4ZHR A;  3CFP A;  1LV5 A;  2X78 A;  1IH7 A;  3ZSY A;  3VA0 A;  2G8I A;  1RTD A;  4O55 A;  4OPJ A;  3OVN A;  3CQ8 A;  2KW4 A;  1SKW A;  1DTT A;  1QSY A;  3ITH A;  3HYF A;  3PUF A;  4BDZ A;  1EP4 A;  3AVI A;  4FM2 A;  4DQR A;  1R0A A;  1KVC A;  1HMV A;  4BWM A;  4ID5 A;  3ZCM A;  4AHC A;  4CJF A;  4CHQ A;  5HRN A;  1T7P A;  1J5O A;  4M3W A;  1WSG A;  3JYT A;  4DSE A;  1JKH A;  2HB5 A;  1A5W A;  4I2P A;  3EY1 A;  3V9Z A;  3AO4 A;  4ZTF A;  4M3U A;  3TAM A;  5E41 A;  2ETJ A;  3LPT A;  3SUN A;  3ZSQ A;  1S1V A;  2BGG A;  1Q9Y A;  3OYG A;  2OZM A;  2OPP A;  4KO0 A;  4CK1 A;  5SZT A;  3V9S A;  4DTR A;  3OYA A;  3AVJ A;  4PY5 A;  4C8O A;  4AHT A;  3AVN A;  3BGR A;  3NAE A;  3LZI A;  4DQQ A;  1ASW A;  1CZ9 A;  3CM5 A;  4AHU A;  2B5J A;  3RMC A;  3NF7 A;  1UWB A;  1C1A A;  3LWL A;  3THV A;  4CF9 A;  4O44 A;  2RN2 A;  4FLX A;  1X1P A;  1XWL A;  4CFC A;  3CFR A;  2Y1I A;  1KSP A;  1GOB A;  3O3H A;  3VN5 A;  1VSK A;  1XHZ A;  1DLO A;  1SUQ A;  4FJN A;  2E4L A;  1REV A;  1WSI A;  1DTQ A;  2HNZ A;  3NDK A;  1ZBF A;  2OPQ A;  2YNG A;  2F8S A;  2HVH A;  1HJR A;  2Z1I A;  4W5O A;  5KRT A;  2PYL A;  1J54 A;  1Z26 A;  4CJ4 A;  3MEG A;  4MFB A;  1YTA A;  3O4Q A;  4KKO A;  3U3Y A;  5FRO A;  2XY7 A;  4GW6 A;  1NK0 A;  4DWI A;  3SUQ A;  4DTM A;  2EHG A;  4W5R A;  3F73 A;  4C8L A;  1SL0 A;  1JXB A;  1RDB A;  1CZB A;  4RG8 A;  1C1B A;  2RPI A;  2AJQ A;  1SKR A;  2XY8 A;  1W9H A;  1Q8I A;  1C0M A;  4PA1 A;  4W5T A;  4HCC A;  2Y1J A;  4FJH A;  3AO1 A;  4FJK A;  4DLE A;  4CGF A;  4KPY A;  3V1O A;  4KHU A;  3SZ2 A;  1S1T A;  3VQB A;  3VQC A;  4C8N A;  5D3G A;  3ZSO A;  4E19 A;  4IFV A;  1QSL A;  3RR8 A;  1KCF A;  3OYE A;  3U3G A;  4HUE A;  1HYZ A;  1TK0 A;  2VG7 A;  4IDK A;  1RT3 A;  4DTS A;  3P1G A;  1NJX A;  4DQI A;  4CJK A;  1WAF A;  1KVA A;  4CED A;  4CJS A;  3DLG A;  3KJV A;  2DTU A;  3D0P A;  3OS1 A;  3HPO A;  1XI1 A;  4DF4 A;  1BQM A;  4H4M A;  1J53 A;  1A5V A;  1S6P A;  4DTJ A;  4TSX A;  4Y1C A;  4JRP A;  4CEQ A;  2KZZ A;  3AV9 A;  4CES A;  2XY5 A;  2XY6 A;  1NK9 A;  1LAV A;  2G8K A;  1BI4 A;  1QS4 A;  1UAX A;  4FLV A;  1D9F A;  2YV0 X;  4FJJ A;  1TAU A;  4E7K A; 
#chains in the Genus database with same CATH topology
 3KTQ A;  1MWK A;  1K9M O;  5I3U A;  3KWG A;  4KHQ A;  3AVC A;  1GLE G;  1RTH A;  3JSM A;  4RW9 A;  3EL2 A;  1RDW X;  3VTI A;  4B9M A;  3K2P A;  2IC3 A;  3ZT0 A;  3KLI A;  1KAY A;  3DXK B;  3LPU A;  4L3Q A;  5C12 A;  2UUA K;  4B9V A;  1JLG A;  3DLL L;  3O5B A;  1BA0 A;  2X74 A;  2YHB A;  2G8W A;  5BRF A;  4Q5V A;  4PQU A;  3O3F A;  3RWU A;  4IFE A;  4YY3 K;  4K42 A;  5JIC A;  2ZM6 K;  3NGI A;  5AQX A;  2QA4 N;  1U48 A;  2UXB K;  4EHU A;  4JKB A;  5BRH A;  2F96 A;  4KBO A;  2O8B A;  2IVN A;  3H3N O;  3O9Q A;  2ASO A;  3VF4 A;  4DTP A;  3PY8 A;  1X9S A;  3K5N A;  1L3T A;  2OA8 A;  4JI8 K;  3CQY A;  4Z4F A;  4Z4E A;  4FJG A;  4A57 A;  5TKY A;  1IBK K;  4PL7 A;  1U4B A;  2DY4 A;  4CJE A;  4H0Y B;  5EX5 A;  3A5N C;  5EY4 A;  1T6D A;  1CXU A;  1NK9 A;  3MDQ A;  5FPN A;  2KQ2 A;  3RMA A;  1WUA A;  2HHS A;  4NYF A;  3LP1 A;  1VQ8 N;  3G0Z A;  1S9G A;  4GV6 A;  4E7H A;  4WQ5 A;  2EWS A;  4IDH A;  1WAJ A;  3CI5 A;  4OJR A;  4HWI A;  2QWL A;  4I6M A;  4XH1 A;  3AO2 A;  1QHT A;  3LZJ A;  1KFS A;  2W6L A;  4H0V B;  1NKB A;  5J1E A;  2UXC K;  2NLX A;  2Q97 A;  5C10 A;  4NLB A;  5EU7 A;  3AA2 A;  5AQH A;  4X64 K;  1B9D A;  3E1Y A;  3N4P A;  3HXM A;  2P9L A;  4EP4 A;  4ISG A;  4DFM A;  4AF1 A;  4WFB L;  4CEB A;  1WB9 A;  3P5J A;  1WNS A;  1RT2 A;  4CZJ A;  2O8C A;  3HP9 A;  4NB4 A;  5HLF A;  4GKK K;  4KTW A;  1NGJ A;  3KLG A;  4MDA A;  4FCY A;  3VEW A;  4CEO A;  4BRD A;  3SQ1 A;  1U2V B;  5TKW A;  4BDP A;  3EZW A;  1NK5 A;  3G10 A;  4FWO A;  3J7A P;  4EFH A;  4FJX A;  4B3O A;  3VQD A;  1O13 A;  4GKJ K;  2BE2 A;  1ZBS A;  3C0B A;  3AA3 A;  1GLB G;  4JK9 A;  3FZF A;  2P9U B;  2OYQ A;  4JK7 A;  1G99 A;  3WEE B;  2J4R A;  4H0T B;  2HMP A;  4FWN A;  1TK8 A;  2FXU A;  1LOT B;  4C23 A;  3VQ7 A;  2LSN A;  5T7B A;  4OPA A;  4H5N A;  3QIN A;  2YHY A;  3TSQ A;  4PKH A;  3CPW M;  3DLE A;  4CJV A;  3KKS A;  3PSF A;  5ADX H;  3RTV A;  1VSJ A;  3OYL A;  4AH9 A;  3NVK A;  3H08 A;  1T3V A;  1VSL A;  3EKS A;  3HPH A;  4BC4 A;  1NLV A;  1SS6 A;  3G6E N;  2O8D B;  3OW2 M;  4DR5 K;  4F3T A;  3V1Q A;  2HHW A;  4HUF A;  3QLH A;  3TSP A;  4M41 A;  4BR2 A;  5I42 A;  2P51 A;  4JI6 K;  4JKH A;  2JWL A;  1BCO A;  3CF5 L;  3RRG A;  2ZJP L;  2XHB A;  1XMQ K;  3I8D A;  3CJA A;  1YXQ A;  4FVM A;  1IKW A;  1B9F A;  2I7P A;  1TGO A;  2F4V K;  1LW0 A;  4IO9 L;  3NCI A;  3RR7 A;  1B92 A;  1NGI A;  5GIO A;  3SAH A;  4FJL A;  4KHN A;  5BN8 A;  3U9Z A;  4IG0 A;  2OTL N;  2QI2 A;  2WC9 A;  1I39 A;  1RT6 A;  4JD2 B;  4FK2 A;  1NK4 A;  2NRW A;  1HNX K;  2PBD A;  1YVN A;  3ZX3 A;  3OYB A;  2FF3 B;  4B3S K;  3LWM A;  2BAN A;  4QS7 A;  2UUC K;  3THX A;  3E9L A;  3ISN C;  2NRX A;  2IS3 A;  4KHP K;  1W2B M;  3L8B A;  4CF0 A;  4F2R A;  3BF1 A;  1J9A A;  4ELU A;  1RDC A;  3CYM A;  4BY9 C;  3V1R A;  1DT9 A;  2X6S A;  5M1F A;  2ASM A;  3B6O A;  4I7F A;  1N6Q A;  2HF4 A;  3TAF A;  1S6Q A;  1NU0 A;  2QEX N;  4YOR A;  3QO9 A;  1E4F T;  3UKR B;  2E6M A;  3VEO A;  4JYA K;  3NGY A;  3H3O B;  1NGH A;  3IDH A;  2HHU A;  5EOY A;  4M7Y A;  3OYI A;  2Q36 A;  4NYN A;  3SQ4 A;  2E1Y A;  4OKE A;  3PV8 A;  1ZYQ A;  1TUU A;  3NMU A;  4DV7 K;  5K14 A;  1WSJ A;  1YI2 N;  4FJ9 A;  3EKU A;  2RHK A;  1GLA G;  3VEV A;  3TWH A;  3SBG A;  1JLB A;  3V9X A;  3CG7 A;  4CZK A;  4FWP A;  5GIN A;  4EZ9 A;  3MED A;  4KH4 A;  4U67 L;  4FZY A;  1BI4 B;  4J2A A;  2HF3 A;  1BL3 A;  4OLB A;  3HP6 A;  3J80 O;  3SYZ A;  1UA0 A;  2QWQ A;  4UQG A;  2GUI A;  2YJE A;  3ID8 A;  1LWF A;  4JAX A;  3NE6 A;  1Q9X A;  3MX5 A;  3R1X A;  1NJZ A;  1HQE A;  3FR0 A;  4JV5 K;  2P9I A;  4CEF A;  4O5B A;  3CCQ N;  2O8E A;  4O5F A;  4JKG B;  4PHT X;  1NGA A;  4B1W B;  3ENH A;  5KPR A;  1KLN A;  1QSS A;  4AHV A;  3QIC A;  4CJ7 A;  3WQT A;  2QXL A;  3T7Z A;  1SAZ A;  5AJ3 K;  5IWA K;  4M45 A;  1T8E A;  3HPG A;  1Z25 A;  3ZSW A;  2JGU A;  4CJ3 A;  3ATU A;  2HVI A;  3SAG A;  4YOY A;  4CJT A;  3EE9 A;  2FBT A;  4JD2 A;  1VQK N;  4WFN L;  4QCL A;  1QZ5 A;  3RMD A;  1BUP A;  3VF6 A;  1ZBH A;  3KIO A;  1CXQ A;  3GE1 A;  3ASM A;  4B8C A;  4BE2 A;  2QWN A;  3CCU N;  1NM1 A;  3NGZ A;  4ZHR A;  1QQN A;  1LV5 A;  4BRG A;  1P90 A;  3TSU A;  1RDU A;  3OVN A;  1S22 A;  1DTT A;  4BDZ A;  4CW7 B;  3AVI A;  3VGL A;  4AHC A;  1JCF A;  5F0X A;  5JLF A;  2WFB A;  2VCP A;  3TAM A;  4DKW A;  3SMS A;  4JHD A;  5AQZ A;  2OZM A;  4KO0 A;  3O9T A;  3V9S A;  1VQM N;  4C8O A;  3ZYY X;  4BGA A;  3NAE A;  2ZF5 O;  3WEE A;  3LZI A;  2B5J A;  4PKG A;  1N32 K;  1UWB A;  2D0P A;  3LWL A;  4CF9 A;  5AZJ A;  5AQN A;  3O3H A;  2D4W A;  3VEN A;  3IMX A;  3F5T A;  1NWK A;  4NO7 A;  5HOO A;  2YNG A;  3CHW A;  3O08 A;  4KKO A;  4K41 A;  4DWI A;  3KZB A;  4GV9 A;  3BP8 A;  5C0Y A;  4W5R A;  1XQS C;  1JXB A;  1GLL O;  2RPI A;  2AJQ A;  3BEX A;  1SKR A;  1W9H A;  4PA1 A;  1C0M A;  4DHY A;  1OH6 A;  3MWP A;  4HCC A;  4EAH D;  3CCE N;  4FJH A;  4B3M K;  4KHU A;  4H5R A;  2VQE K;  3VQB A;  3KVG A;  4E19 A;  4IJA A;  3K9K A;  3RR8 A;  1NGF A;  3U3G A;  1TK0 A;  2VG7 A;  1NJX A;  1VQ4 N;  3QFP A;  1KVA A;  4CJS A;  4PL8 A;  2DTU A;  2NRT A;  3FLC O;  4TSX A;  2DPN A;  4Y1C A;  3A5M C;  3CQX A;  3VER A;  3O8M A;  4IOC L;  4FLV A;  4E7J A;  1Q81 O;  4E7K A;  1U49 A;  1L3S A;  2QK9 A;  1FKO A;  3HSC A;  3RSE A;  2BDP A;  3E01 A;  1NGE A;  1N8R O;  4FJ5 A;  4BGB A;  1IKX A;  4EZ6 A;  2VWJ A;  3CFO A;  1HPM A;  5M1Q A;  2E8A A;  4O0J A;  5GAE P;  5BR8 K;  2E2Q A;  1YHQ N;  3OYJ A;  5SWM A;  1WSF A;  2DFH A;  4BAC A;  2YHW A;  3RSE B;  2WOM A;  4FK4 A;  3IS9 A;  3N4Q A;  3VQ6 A;  3L4Q A;  4O4G A;  1X9W A;  1FXX A;  2YJF A;  1TKT A;  4K0K K;  2Z1H A;  4DFK A;  4WYB A;  4KHY A;  5ELZ A;  4LD0 A;  2GV9 A;  1BHL A;  1Q18 A;  1RT7 A;  3P38 A;  3FE1 A;  2VYP A;  1NKC A;  2JLE A;  2IGI A;  4JKA A;  1ATR A;  4LH5 A;  3SLC A;  3ZSX A;  3OY9 A;  4B1X B;  4HHT A;  1I94 K;  3L2U A;  2V7Z A;  3H6E A;  1Q7Y O;  4OKJ A;  1NGD A;  2HNY A;  2CH5 A;  1BG3 A;  1NGB A;  1BOT O;  5ADX A;  3THY A;  3HM9 A;  3AY9 A;  3TAP A;  3M1F A;  4NCA A;  3DXK A;  4DSK A;  1FJG K;  1RBV A;  1S1U A;  3IFR A;  1JCG A;  2VG6 A;  4G9Z A;  4BVP A;  1GOA A;  1C0T A;  3OYC A;  3C94 A;  5AQG A;  3C6T A;  3C7N A;  1U04 A;  3WNG A;  4ID1 A;  1YIJ N;  3L0Q A;  1U45 A;  2D0A A;  4IEE A;  3DOK A;  2QXF A;  5FPE A;  3TTD A;  2R7Y A;  4EIA A;  4NCG A;  4JS4 A;  3AVM A;  4MDB A;  4LF6 K;  3DLR A;  5BN9 A;  4FLT A;  4CFA A;  4Q0B A;  5AQM A;  3T1A A;  3P39 A;  3KK1 A;  4E89 A;  4KTQ A;  4Z4I A;  3NH2 A;  2GBZ A;  2HHV A;  2BTF A;  3HVT A;  3Q7B A;  1RFQ A;  3CXC M;  3OYM A;  2E88 A;  4KHW A;  1RBT A;  4NLC A;  1U2V A;  4LF9 K;  1BQN A;  1F21 A;  1NJY A;  3AAQ A;  4YOV A;  4KV8 A;  4B9U A;  2FSK A;  3ZLJ A;  2HBJ A;  2P9S A;  4CZF A;  1RT5 A;  4GVE A;  1TUY A;  4DV0 K;  5BR9 A;  1IBM K;  2DFE A;  1HJO A;  1YAG A;  4DU4 A;  2HMI A;  4AM6 A;  4DG1 A;  4ISF A;  3MWT A;  4FLY A;  3SPY A;  3AVA A;  3TU5 A;  3LAM A;  1KQS M;  2GX9 A;  3VQ5 A;  3V81 A;  4BR0 A;  3QNO A;  4PKI A;  4A2A A;  4A59 A;  3IAY A;  5CYQ A;  3OYD A;  4W5Q A;  3A2F A;  3FZL A;  2CH6 A;  4LSL A;  4RTF D;  1SL1 A;  2H3G X;  3M5R A;  5AZI A;  2OTJ N;  3AAP A;  2OCE A;  4B08 A;  4FM1 A;  4AHR A;  4Z4G A;  3L2Q A;  4HUG A;  3WXM B;  5HP1 A;  4QAG A;  2D0B A;  4DTN A;  5DK5 A;  4B3T K;  1U6Z A;  4IOA L;  2Q0R A;  5BRD A;  5HRO A;  1NG9 A;  3MN9 A;  4YOX A;  1XC9 A;  1ASU A;  5AQU A;  1SV5 A;  4DV2 K;  3I0R A;  1H1V A;  4DB3 A;  1GLC G;  1LCU A;  3K5M A;  1HNW K;  3ENO A;  3ULE B;  2ITG A;  1MA9 B;  3TAN A;  1ASV A;  3TR8 A;  1WBD A;  1XNR K;  4XIU A;  1EX4 A;  2PYJ A;  4FXD A;  3S3N A;  4WF9 L;  3BF3 A;  1IBL K;  1LWC A;  4K8Z A;  4DSJ A;  2PZS A;  3A5O C;  3M3Z A;  3S41 A;  1YTU A;  2ATQ A;  3OS0 A;  3UB5 A;  3K5O A;  5LL6 Z;  3MK6 A;  4CIG A;  3HZ6 A;  4KB1 A;  1IKV A;  2A1R A;  1A5X A;  3NFA A;  3ZT3 A;  1BDG A;  1JXE A;  2QWP A;  3OBW A;  4YOW A;  1HYS A;  1YF5 L;  5LJV A;  3DRP A;  3SQ2 A;  3M8R A;  3DYA A;  3TAB A;  3O4W A;  3S9H A;  4BRM A;  1TKZ A;  2G8U A;  2W40 A;  1KFD A;  3V4I A;  4GNI A;  2O4I A;  4NXM K;  3WNE A;  1VSH A;  3VPZ A;  4M3X A;  1NGG A;  1W97 L;  3IG1 A;  4BG8 A;  3H1Q A;  3LAK A;  2ITM A;  5LY3 A;  1IV0 A;  2E6L A;  4JN4 A;  2GEM A;  3VMF B;  4DTO A;  2Z1J A;  4Z4H A;  4IFY A;  3L2W A;  1GLD G;  3ULE A;  1BIZ A;  2KHO A;  5J2N A;  1MWM A;  2I5J A;  3PX4 A;  1V4T A;  1VHX A;  3UKU B;  2V51 B;  4BR5 A;  4CEZ A;  1WOQ A;  4KRF A;  3QIP A;  4NCB A;  1V4S A;  2NRR A;  2YNI A;  3CM6 A;  3LM2 A;  3CJB A;  3O4N A;  4M3T A;  3SI6 A;  3SBT A;  3ATV A;  4MO5 A;  1L5U A;  4F3O A;  1X3N A;  2W6K A;  3VQP A;  3AA5 X;  3EE8 A;  2ZWH A;  3CC2 N;  3MXM A;  2KFN A;  3MXI A;  3DLH A;  3DM2 A;  1S1W A;  1NBW A;  3HRG A;  5CY4 A;  4F2S A;  4DSF A;  4CFD A;  1L3V A;  1M90 O;  3C7N B;  2O8E B;  3MEE A;  4CHZ A;  5KTQ A;  1BCM A;  4CBW A;  3VQQ A;  2Q1N A;  1TVR A;  4Z0U A;  1K8K A;  2G8H A;  4ISE A;  1UOC A;  2VQF K;  3CET A;  3MCP A;  1VQP N;  1BIS A;  3FFK B;  4CE9 A;  4FJM A;  1D8Y A;  4RCH A;  4QS8 A;  4EHT A;  3VOV A;  1NMN A;  2IVP A;  4BQZ A;  4CFB A;  3LDS A;  4LY7 A;  4LH4 A;  4FK0 A;  1HNI A;  5HRP A;  4N76 A;  4FWK A;  2QKB A;  2YI1 A;  2NRH A;  1RTI A;  3ZSR A;  2P9K A;  3H1V X;  4AIL C;  4DS5 A;  3KK2 A;  3CMA N;  3T1H K;  1CZA N;  3E9P A;  4CHN A;  5AQK A;  3VEY A;  4FJ7 A;  4O0I A;  2AA4 A;  5F1X A;  4FWQ A;  4N47 A;  4WE1 A;  4E1N A;  2P1J A;  4A62 A;  5CYM A;  1U47 A;  3DXM B;  5GAD P;  3C6A A;  1HR0 K;  1LWE A;  1RBS A;  1VSD A;  1YVU A;  1X9J A;  4DQP A;  3HTV A;  5FLX O;  4RW6 A;  3CFP A;  3JAM O;  3J8A A;  4BRP A;  3ZSY A;  3FGU A;  2I7N A;  3VA0 A;  1CLQ A;  4O55 A;  3EO3 A;  2KW4 A;  1QSY A;  3ITH A;  3PUF A;  1R0A A;  4FM2 A;  1Z05 A;  1HMV A;  3CJ7 A;  4ID5 A;  4CJF A;  5HRN A;  5BRE A;  1J5O A;  3ZEU B;  1WSG A;  3V9Z A;  3EY1 A;  2A3Z A;  3AO4 A;  4M3U A;  2ETJ A;  3LPT A;  4A5B A;  2E2P A;  3SUN A;  4B1V A;  1S1V A;  5AZI B;  4CI6 A;  2OPP A;  4JKD A;  5SZT A;  4DTR A;  3AVJ A;  3L6Q A;  4PY5 A;  2O8C B;  4AHT A;  3OA9 A;  3CM5 A;  1OVQ A;  3LDO A;  3WT0 A;  4FLX A;  3DWL A;  1BU6 O;  1XHZ A;  1SUQ A;  3MN7 A;  4FJN A;  2E4L A;  1REV A;  1DTQ A;  4BR4 A;  1HKB A;  1HJR A;  4W5O A;  2FF6 A;  5KRT A;  1J54 A;  3MEG A;  1YTA A;  3O4Q A;  2NRZ A;  5H1S Q;  2XY7 A;  3SK3 A;  3ZET A;  4DR4 K;  4DTM A;  3F73 A;  4C8L A;  1VQN N;  1SL0 A;  4BC5 A;  1RDB A;  3DXM A;  1C1B A;  2QM1 A;  1EWQ A;  3K0S A;  1Q8I A;  4W5T A;  1QZ6 A;  2E2N A;  4KPY A;  4CGF A;  1DKG D;  2O8D A;  3ZSO A;  5AQF A;  3AGR A;  4YDU A;  4BRC A;  3OYE A;  3D6R A;  1ESV A;  4IWV A;  3QBW A;  4DQI A;  4CJK A;  4LF5 K;  3DLG A;  3D0P A;  4DF4 A;  3MMV A;  4OPH A;  3G4S N;  1A5V A;  1S6P A;  4AM7 A;  4CES A;  2XY5 A;  1D4X A;  1QS4 A;  5C15 A;  1TAU A;  4X65 K;  3O3G A;  3PO4 A;  5KQ8 A;  3L3U A;  2QWM A;  2VGM A;  1OKJ A;  2P9U A;  4ILJ A;  1XHX A;  4E3S A;  3WNF A;  5C25 A;  4DR6 K;  4H5W A;  4JKE A;  4CZM A;  2YHA A;  4LSN A;  3QEI A;  3TAE A;  4YOU A;  4CJR A;  4B9S A;  4OGC A;  1Y97 A;  2YX6 A;  3QET A;  2HHQ A;  4GMJ B;  2GUP A;  3HT3 A;  4KTZ A;  4JI3 K;  3QNN A;  4YNQ A;  1VSF A;  3LP0 A;  3M8P A;  2KFZ A;  3SUO A;  1RDA A;  4OPK A;  1G15 A;  1SZ2 A;  2Q2R A;  3VQE A;  3ZSZ A;  5FRM A;  4KI4 A;  5JMV A;  4CEE A;  4J2E A;  1HRH A;  3HOT A;  3JS6 A;  3CCM N;  2GWK A;  1HPZ A;  4FSV A;  2A40 A;  2KZM A;  3SV3 A;  3V9W A;  2FSN A;  1C1C A;  3D2E A;  2FBY A;  1VSM A;  5HRS A;  4CK3 A;  1NGC A;  2A6A A;  3F9K A;  1EQY A;  4DCH A;  2DFF A;  4FW2 A;  1BWF O;  3DMJ A;  3SQ0 A;  1SKS A;  4JI7 K;  3M6G A;  3O6W A;  4C1N I;  4AQY K;  2YNF A;  4DR2 K;  1JL2 A;  4LFB K;  1YT3 A;  3HVR A;  1NOY A;  3VA3 A;  5KGX A;  4RWT A;  4BDY A;  2KLA A;  3R8E A;  3TAR A;  4KHS A;  3AO3 A;  1Z6R A;  1RGI A;  4CHO A;  3K58 A;  4QOZ B;  2RKI A;  4O8U A;  1JLF A;  4BE1 A;  5AQT A;  4M63 C;  3PIP L;  3E66 A;  4N41 A;  3EN9 A;  3KLE A;  5M1P A;  1QVF M;  5E84 A;  1WSE A;  4YOT A;  4DU1 A;  3OJS A;  5AQV A;  3WQU A;  1J5E K;  1MDU B;  3VQA A;  4CGH A;  4BRK A;  1HQU A;  5JS1 A;  5AQI A;  4FL9 A;  3QBX A;  4LC9 B;  4IBN A;  3QES A;  3KD1 E;  4H5V A;  2F9T A;  4YFU A;  4V19 S;  2O8F B;  3AA4 A;  5AFU H;  1HKC A;  2Z1G A;  3CCJ N;  1ZBL A;  3CCV N;  4DS4 A;  1RT1 A;  4ICL A;  2F8T A;  1YIT N;  4M3Y A;  5IT9 O;  1YJN N;  2PAV A;  4BC2 A;  4YHH K;  1SL2 A;  2EX3 A;  4FPA A;  2HBK A;  3AVK A;  3U4L A;  1HX1 A;  2P9I B;  2E2O A;  4UY8 O;  4FWM A;  1WSH A;  3W0L A;  1C0U A;  3HOS A;  3VEZ A;  3NBP A;  3WUH A;  3I56 N;  1IG9 A;  2HHT A;  4CF2 A;  3L2V A;  1T6C A;  1TV6 A;  2AP1 A;  2NNW A;  4CGG A;  4WCE L;  3IUC A;  5GAG P;  4CGI A;  4DUZ K;  4DFP A;  2IDO A;  4L8R B;  3DI6 A;  3LP3 A;  3NVM A;  2F7T A;  1K6Y A;  2QWR A;  1ATS A;  1KC8 O;  1HLU A;  1RTJ A;  4CGJ A;  1QQC A;  4ELT A;  1KTQ A;  4BG9 A;  1XMO K;  2UUB K;  1S72 N;  4J2D A;  2ZGY A;  1RCH A;  3GDQ A;  4K43 A;  2HHX A;  3LDL A;  3KKR A;  2HST A;  5FDL A;  4BC3 A;  4B1U B;  4BR9 A;  1D5A A;  3GG4 A;  3NF8 A;  1JLA A;  4I9L A;  5J2P A;  3ALY A;  2JWK A;  1RT4 A;  2D5R A;  3WXI A;  3L4I A;  4DTU A;  5M1N A;  3DRR A;  1GLF O;  1D9D A;  5HL7 L;  4E7I A;  4Y1D A;  2KKZ A;  4C1N K;  4JLH A;  4DF8 A;  3TAQ A;  2HND A;  4FLW A;  3MCA B;  4XEI A;  3V6D A;  3QB0 A;  2UU9 K;  3PLA A;  4DFJ A;  2NRV A;  3W3D A;  3CME N;  5AR0 A;  1EXQ A;  3I33 A;  3J7Z O;  2OPR A;  1DEJ A;  4DQ8 A;  1QVG M;  1FK9 A;  3I8B A;  2D1K A;  3C95 A;  2P9P A;  4GVM A;  2P9L B;  1VK0 A;  1VSI A;  5DMR A;  3A5L C;  5GIP A;  3MX2 A;  3WXL A;  4CGD A;  4F9O A;  4AHS A;  3IRX A;  1T03 A;  1JLC A;  4PUO A;  2A42 A;  3WXK A;  4CHP A;  2E5L K;  1IG8 A;  2VGN A;  4OLA A;  2CGK A;  5JVG L;  2E1Z A;  2WON A;  1TL1 A;  4BE0 A;  1JCE A;  3UKU A;  1QTM A;  4CJQ A;  3TI0 A;  1EO1 A;  3GBT A;  5EVZ A;  4W5N A;  1QE1 A;  4DV5 K;  4CF1 A;  3R3L A;  3KLH A;  3BDP A;  5J2Q A;  3FZK A;  2B6A A;  3AVL A;  3K57 A;  4IKF A;  2HHH K;  3B8A X;  2FLO A;  2QTD A;  3Q7C A;  5GAH P;  4OX9 K;  4DMN A;  1VQ5 N;  3I0S A;  3ULD A;  3MEC A;  1LW2 A;  3UE5 A;  1QHA A;  4KB0 A;  4CF8 A;  3L3V A;  3VEX A;  4RW4 A;  1RIL A;  4FJI A;  3DLK A;  4CZE A;  1RNH A;  2G8V A;  3B6P A;  4RW8 A;  1WLJ A;  5EXW A;  3QEW A;  4J2B A;  5KI6 A;  1JLQ A;  4K8X A;  3F2K A;  4JKC A;  4KI6 A;  2FSJ A;  1C6V A;  4CIF A;  4H03 B;  2ZD1 A;  3LAL A;  1RBR A;  1WN7 A;  4MQ3 A;  3DOL A;  4H8K A;  5BPL A;  3HO1 A;  3LM9 A;  5BPN A;  3QML A;  4FVU A;  1QQM A;  2ZQB A;  3UKR A;  4B9T A;  4DV4 K;  4FZZ A;  3THX B;  3KD5 E;  4J8F A;  4FWR A;  5AQY A;  4E7L A;  3U9D A;  3NF6 A;  3CCR N;  3PX0 A;  5F2R A;  1GLJ O;  3LDP A;  4FYD A;  3VGK A;  1WBB A;  3AGK A;  4DSL A;  4CD1 A;  3BZK A;  4O8K A;  3DLB A;  2FBX A;  4CZH A;  2A41 A;  5AQJ A;  3M8Q A;  4JKF A;  2ZE2 A;  3RRH A;  5FPM A;  4B9Q A;  2GTD A;  3TAG A;  4F4K A;  3LDN A;  1X3M A;  1NJI O;  1KD1 O;  3D45 A;  4QS9 A;  4JI0 K;  4U7B A;  1J6Z A;  3G25 A;  1RTD A;  3HYF A;  4DQR A;  3D7E O;  3VTH A;  3H45 C;  3QDK A;  2PFU A;  3ZCM A;  5KPT A;  1N33 K;  3JYT A;  1R59 O;  4I2P A;  1A5W A;  4B3R K;  4K25 A;  5MLC Q;  3ZSQ A;  1YJ9 N;  4FOI A;  2YCH A;  2WBN A;  2BGG A;  3CJC A;  4MLH A;  3OYG A;  4CK1 A;  2V7Y A;  3F9M A;  3AVN A;  3BGR A;  1ASW A;  3CPE A;  1CZ9 A;  1C1A A;  4O44 A;  2RN2 A;  1XWL A;  3FZM A;  3D2F B;  2Y1I A;  2HOE A;  2WTU A;  1XUP O;  5CR4 A;  1VSK A;  1DLO A;  1ZC6 A;  4BVO A;  1VAZ A;  1P8Z A;  2OAN A;  3KK7 A;  5DM6 L;  2Z1I A;  5LMN K;  3BY5 A;  2ZGZ A;  2PYL A;  4CJ4 A;  4MFB A;  4KH5 A;  3U3Y A;  2CGL A;  3SUQ A;  2EHG A;  1BA1 A;  4FWL A;  1CZB A;  4RG8 A;  2XY8 A;  3AO1 A;  4DLE A;  3SZ2 A;  1S1T A;  5AQP A;  5M1O A;  3VQC A;  4DUY K;  4IFV A;  1QSL A;  4BRH A;  1S3X A;  4HUE A;  1RT3 A;  3P1G A;  3C65 A;  5E26 A;  4DR1 K;  1WAF A;  4CED A;  1NNE A;  3KJV A;  1XI1 A;  4JNE A;  4JRP A;  3I55 N;  4CEQ A;  3THW A;  3O1B A;  2KZZ A;  2G8K A;  2CGJ A;  3A0I X;  2W41 A;  1BI4 A;  4BRA A;  1UAX A;  2HBL A;  4JKG A;  2YV0 X;  4IEI A;  4Y0W A;  1I3A A;  3HBT A;  3CJ1 A;  1VQ6 N;  3FZH A;  2V52 B;  2YKM A;  5DM7 L;  5AQL A;  1NKE A;  1VSE A;  1KVB A;  3CCL N;  3AVH A;  4KFB A;  4N56 A;  5B8H A;  2YHX A;  4BWJ A;  3SJJ A;  2OZS A;  1EET A;  1C0F A;  4H0O A;  4Z4C A;  4C8M A;  3HL8 A;  3K5L A;  1RDD A;  3QEV A;  3JXU A;  4OVL A;  1VQO N;  4OKK A;  3RVC A;  3OS2 A;  3ZT4 A;  2A1S A;  2YNH A;  5HRR A;  4IXC A;  3LP2 A;  4I6M B;  2FC0 A;  1ZBU A;  4WQ4 A;  4LF4 K;  3R6M A;  4BRF A;  4CBX A;  1BIU A;  4CBU A;  3THW B;  3EZ5 A;  2P5G A;  4LFA K;  4R79 A;  1VRT A;  3D2E B;  1W0H A;  3EYZ A;  3SNN A;  2YKN A;  4BRN A;  4FM0 A;  3LDQ A;  1YJW N;  1TYQ A;  4E0D A;  2KTQ A;  3V9U A;  4CVN E;  4GV3 A;  3TPQ A;  3GOI A;  1UA1 A;  2IIR A;  4CJ5 A;  4JS5 A;  4R5P A;  3K9J A;  4CJL A;  1KRP A;  4CK2 A;  1NJW A;  1HYV A;  1O1W A;  2WUS A;  1K8A O;  2BUP A;  1LAW A;  5AQW A;  4DSI A;  5HBM A;  3RMB A;  1KAX A;  4LFC K;  3SAF A;  3UIQ A;  3ZSV A;  1ITG A;  3OYN A;  4KAZ A;  2OPS A;  4FZX C;  4B8A B;  4CCH A;  1DGK N;  4CZG A;  1N34 K;  3KK3 A;  5AZJ B;  1Y64 A;  1W7A A;  3VF2 A;  3S3M A;  1ILY A;  2B4J A;  3MAQ A;  3KHY A;  3K59 A;  4CJP A;  4FOE A;  2Q3S A;  3CD6 N;  1N36 K;  5CZ1 A;  4CJW A;  4FLU A;  4IO8 A;  4ELV A;  3HM8 A;  3SUP A;  1TYQ B;  2XRI A;  4ZTJ A;  1VRU A;  3KLF A;  1BO5 O;  1NK8 A;  3ZX0 A;  4Z94 A;  3C6H A;  3U6F A;  4JI4 K;  4EP5 A;  4H0P A;  3GL1 A;  2ZJQ L;  1QQO A;  4A2B A;  4JRQ A;  1KXP A;  4X66 K;  3SMP A;  4DV1 K;  4DQS A;  2XO7 A;  3ZT2 A;  4MO4 A;  5JVH L;  1HUX A;  4JEP A;  3QIO A;  2P9N A;  4HTU A;  3EEQ A;  5C2F A;  3O1W A;  3HI0 A;  1TL3 A;  5LMU K;  3CC4 N;  5C42 A;  3O9R A;  4B9N A;  3TTC A;  2G8F A;  1X9M A;  3CC7 N;  1NOZ A;  5I9E B;  4B9L A;  3SV4 A;  4IZ9 A;  1TKX A;  4GY2 B;  3J7Y P;  1JLE A;  4CZL A;  2P5O A;  2F9W A;  5J2M A;  1NK7 A;  4HVJ A;  3VES A;  4CD3 A;  4B1Z A;  2HBM A;  4G1Q A;  1VQL N;  3VQ4 A;  4FPB A;  3LL3 A;  3ID6 A;  4WFA L;  2O4G A;  3NH1 A;  4I2Q A;  3H46 O;  1RBU A;  4BRO A;  3A8Y A;  4FJ8 A;  4BRE A;  3S3O A;  3ZEU A;  5M1K A;  3L2R A;  4F8R A;  2Q31 A;  4CZI A;  3MXJ A;  1NK6 A;  3NH0 A;  4X62 K;  3VET A;  4OO1 J;  1S5J A;  3SCX A;  1Q82 O;  1KAZ A;  3AVG A;  4A61 A;  4CHY A;  1FW6 A;  4NXN K;  2X6N A;  4FLZ A;  1OH7 A;  2W42 A;  4M3Z A;  2QKK A;  4FO0 A;  1BGX T;  3PSI A;  2IOC A;  2NUB A;  1HNZ K;  4I9Q A;  3HJF A;  3THY B;  1JJ2 M;  4DU3 A;  3PO5 A;  3FFI A;  2GWJ A;  4IOX A;  5AFU A;  1KLM A;  4DLG A;  3OJU A;  3M8S A;  3U8X A;  1N5Y A;  1HNV A;  1TAQ A;  1EKE A;  4N5S A;  3CJ9 A;  1FKP A;  1L3U A;  2D0C A;  2E20 A;  1S1X A;  3LAN A;  4FW1 A;  4HCB A;  3NF9 A;  4BQL A;  5KQD A;  3T19 A;  3WXJ A;  3DJC A;  3AVB A;  3P4I A;  1YUW A;  5BPM A;  5LJW A;  1JL1 A;  4XH5 A;  3VQ9 A;  4B1Y B;  3QER A;  2VG5 A;  5CZ2 A;  1IO2 A;  3KWI A;  4H4O A;  4DV3 K;  1ATN A;  4CJU A;  4DR3 K;  1ZBI A;  4E1J A;  2PY5 A;  3PX6 A;  4ILG B;  4H5T A;  4ILH A;  3CER A;  2FBV A;  2RE2 A;  2O8B B;  3P31 A;  1MU2 A;  1T05 A;  4LF7 K;  5AQQ A;  2QW9 A;  3T69 A;  1Q86 O;  2IVO A;  4CIE A;  2P9P B;  5KGW A;  2IAJ A;  1C0G A;  3DRS A;  4DTX A;  3HST B;  5AQS A;  1TK5 A;  4CER A;  1XNQ K;  4XH4 A;  2NZT A;  3OYK A;  4JHD B;  5KRS A;  1M1K O;  4DV6 K;  4C8K A;  3G71 N;  2VWK A;  1IKY A;  4CEA A;  1XC3 A;  3C6U A;  3OTO K;  4JK8 A;  4PWD A;  3HK2 A;  1GOC A;  5JS2 A;  5FRN A;  3NHG A;  3J81 O;  2RF2 A;  3MN6 A;  4IG3 A;  3OYF A;  3SPZ A;  1OVY A;  4M3R A;  1VQ7 N;  3AVF A;  1IJJ A;  4KRE A;  3VQ8 A;  3ZET B;  3T3F A;  3QEP A;  4IJN A;  4KH6 A;  4OGE A;  2D0O A;  3WNH A;  3CIP A;  2HW3 A;  1S9E A;  3QEX A;  4M42 A;  3P83 D;  2GEL A;  3ZT1 A;  4RW7 A;  1SQK A;  1TKD A;  4LF8 K;  3BUZ B;  2ZJR L;  4E1M A;  3OYH A;  2Q0U A;  4JI1 K;  2UYT A;  2A5X A;  5A2Q O;  4CEC A;  3AO5 A;  3ZX2 A;  5KPZ A;  3AAR A;  4A5A A;  2X78 A;  1IH7 A;  3O80 A;  5CHI A;  2G8I A;  4OPJ A;  3CQ8 A;  1SKW A;  1EWR A;  3OHR A;  3QFU A;  1EP4 A;  3BZC A;  1KVC A;  4BR7 A;  1E3M A;  4BWM A;  4CHQ A;  1T7P A;  5C2D A;  4M3W A;  1VQ9 N;  4DSE A;  4YDU C;  1JKH A;  2HB5 A;  1K73 O;  4ZTF A;  1OH5 A;  5E41 A;  4JI5 K;  3T1Y K;  4HTL A;  4BRQ A;  5AQO A;  4BRL A;  2O8F A;  3DAW A;  1T44 A;  1Q9Y A;  2BH1 A;  3OYA A;  1ZXO A;  3IKM A;  3SJH A;  4DQQ A;  4H0X B;  4AHU A;  4BRI A;  2VWB A;  3RMC A;  5JLH A;  3NF7 A;  3THV A;  3O9U A;  1X1P A;  3MN5 A;  4CFC A;  3CFR A;  1KSP A;  1GOB A;  5CE3 A;  3VN5 A;  3OBY A;  3E9O A;  4FWS A;  1OH8 A;  2HNZ A;  1WSI A;  3ENB A;  3NDK A;  1ZBF A;  3O9S A;  2OPQ A;  2F8S A;  2HVH A;  3R9P A;  1Z26 A;  2P9K B;  5FPD A;  2P9N B;  4MLE A;  4DR7 K;  5FRO A;  4GW6 A;  1NK0 A;  3TTF A;  1E4G T;  4WQ5 C;  3VGM A;  2ASP A;  4WQ4 C;  2Y1J A;  4FJK A;  3V1O A;  4M7X A;  3PIO L;  1NMD A;  1HKG A;  4C8N A;  5D3G A;  3CCS N;  1KCF A;  1K8K B;  1HYZ A;  4IDK A;  4DTS A;  2P9S B;  5AQR A;  4JI2 K;  3D2F A;  3OS1 A;  3HPO A;  1BQM A;  4H4M A;  1J53 A;  4DTJ A;  3AV9 A;  2XY6 A;  1LAV A;  2QWO A;  2UXD K;  1D9F A;  5C24 A;  4FJJ A; 
#chains in the Genus database with same CATH homology
 3KTQ A;  3O3G A;  1I3A A;  5I3U A;  1U49 A;  3PO4 A;  4KHQ A;  1L3S A;  2QK9 A;  3AVC A;  1FKO A;  2YKM A;  3L3U A;  1NKE A;  1RTH A;  3JSM A;  1VSE A;  1KVB A;  2BDP A;  1XHX A;  3AVH A;  3E01 A;  4KFB A;  4E3S A;  3WNF A;  5C25 A;  4FJ5 A;  4N56 A;  1IKX A;  4RW9 A;  4EZ6 A;  2VWJ A;  4B9M A;  3K2P A;  2IC3 A;  3CFO A;  4BWJ A;  3SJJ A;  3ZT0 A;  3KLI A;  3LPU A;  4O0J A;  2OZS A;  2YHA A;  1EET A;  4B9V A;  4LSN A;  3QEI A;  1JLG A;  4Z4C A;  3OYJ A;  4C8M A;  5SWM A;  3TAE A;  1WSF A;  1CLQ A;  4CJR A;  2DFH A;  4BAC A;  2X74 A;  2YHB A;  3HL8 A;  2G8W A;  4B9S A;  3K5L A;  1RDD A;  4Q5V A;  3QEV A;  4OVL A;  2WOM A;  4OGC A;  4PQU A;  1Y97 A;  4OKK A;  3QET A;  3IS9 A;  4GMJ B;  4FK4 A;  2HHQ A;  3OS2 A;  3O3F A;  3VQ6 A;  3RWU A;  3ZT4 A;  2A1S A;  2YNH A;  4O4G A;  1X9W A;  3HT3 A;  1FXX A;  1TKT A;  2Z1H A;  4KTZ A;  5HRR A;  3NGI A;  4DFK A;  4YNQ A;  1VSF A;  3LP2 A;  3LP0 A;  3M8P A;  3QNN A;  2FC0 A;  1ZBU A;  2KFZ A;  3SUO A;  1BIU A;  4KHY A;  1RDA A;  4OPK A;  1G15 A;  4LD0 A;  1U48 A;  3EZ5 A;  3VQE A;  2GV9 A;  3ZSZ A;  2P5G A;  1BHL A;  2F96 A;  5FRM A;  1RT7 A;  1VRT A;  4KI4 A;  1W0H A;  4CEE A;  3EYZ A;  1NKC A;  2JLE A;  2IGI A;  4J2E A;  1HRH A;  3SNN A;  2YKN A;  4FM0 A;  1HPZ A;  5C24 A;  4LH5 A;  4DTP A;  3PY8 A;  2KZM A;  1X9S A;  3K5N A;  4E0D A;  3ZSX A;  3OY9 A;  2KTQ A;  3SV3 A;  3V9U A;  3V9W A;  1L3T A;  2OA8 A;  1C1C A;  4HHT A;  3L2U A;  2FBY A;  1VSM A;  4Z4F A;  1UA1 A;  4Z4E A;  4FJG A;  5HRS A;  2DY4 A;  4CK3 A;  4CJ5 A;  4JS5 A;  4R5P A;  4CJE A;  4OKJ A;  1U4B A;  3F9K A;  2HNY A;  4CJL A;  1KRP A;  2DFF A;  4FW2 A;  3HM9 A;  4CK2 A;  1CXU A;  3DMJ A;  1HYV A;  3SQ0 A;  2KQ2 A;  1O1W A;  3RMA A;  1NJW A;  3TAP A;  1SKS A;  2HHS A;  4NYF A;  3LP1 A;  1LAW A;  4NCA A;  3G0Z A;  4DSI A;  2YNF A;  1JL2 A;  1YT3 A;  1S9G A;  5HBM A;  3RMB A;  4E7H A;  3HVR A;  4DSK A;  1NOY A;  1RBV A;  1S1U A;  1WAJ A;  3VA3 A;  3UIQ A;  5KGX A;  2VG6 A;  4OJR A;  3ZSV A;  4BDY A;  3TAR A;  4KHS A;  3AO3 A;  1ITG A;  3OYN A;  4KAZ A;  2OPS A;  4FZX C;  1GOA A;  4B8A B;  4CCH A;  1C0T A;  4CHO A;  3OYC A;  3K58 A;  4QOZ B;  3AO2 A;  2RKI A;  1JLF A;  1QHT A;  3LZJ A;  3C94 A;  4BE1 A;  1KFS A;  1NKB A;  4N41 A;  5J1E A;  3KK3 A;  3KLE A;  3C6T A;  1U04 A;  3WNG A;  4ID1 A;  1WSE A;  5EU7 A;  3AA2 A;  3S3M A;  2B4J A;  1U45 A;  3MAQ A;  2D0A A;  4DU1 A;  3DOK A;  3OJS A;  4CJP A;  3K59 A;  2QXF A;  2Q3S A;  2R7Y A;  5CZ1 A;  1B9D A;  4CJW A;  4NCG A;  3VQA A;  3AVM A;  4CGH A;  4JS4 A;  4FLU A;  1HQU A;  5JS1 A;  3HXM A;  4ELV A;  3DLR A;  3SUP A;  4IBN A;  4EP4 A;  4FLT A;  3QES A;  3KD1 E;  4CFA A;  4DFM A;  2XRI A;  4YFU A;  4Q0B A;  4ZTJ A;  1VRU A;  3AA4 A;  3KLF A;  1NK8 A;  4CEB A;  3T1A A;  3P5J A;  1WNS A;  1RT2 A;  3KK1 A;  3U6F A;  4E89 A;  4KTQ A;  4EP5 A;  2Z1G A;  3HP9 A;  5HLF A;  4Z4I A;  1ZBL A;  3NH2 A;  4DS4 A;  2GBZ A;  1RT1 A;  4KTW A;  2HHV A;  3HVT A;  3KLG A;  4JRQ A;  4ICL A;  2F8T A;  3OYM A;  4FCY A;  4KHW A;  4M3Y A;  4DQS A;  1RBT A;  4CEO A;  2XO7 A;  3ZT2 A;  1SL2 A;  2EX3 A;  1BQN A;  3AVK A;  3QIO A;  3SQ1 A;  1F21 A;  1NJY A;  4HTU A;  4KV8 A;  4B9U A;  1RT5 A;  1WSH A;  1TL3 A;  5C42 A;  4BDP A;  2DFE A;  1C0U A;  1NK5 A;  3G10 A;  4DU4 A;  4B9N A;  2HMI A;  2G8F A;  1X9M A;  4FJX A;  3NBP A;  1NOZ A;  4B3O A;  4DG1 A;  3VQD A;  1IG9 A;  4FLY A;  2HHT A;  4CF2 A;  2BE2 A;  3AVA A;  3L2V A;  3SPY A;  3SV4 A;  4B9L A;  1TV6 A;  3LAM A;  4CGG A;  3AA3 A;  1TKX A;  3VQ5 A;  3V81 A;  1JLE A;  2OYQ A;  3QNO A;  4CGI A;  4DFP A;  2P5O A;  2IDO A;  5J2M A;  3IAY A;  4L8R B;  5CYQ A;  3OYD A;  4W5Q A;  3DI6 A;  3LP3 A;  4HVJ A;  3A2F A;  1NK7 A;  1TK8 A;  1K6Y A;  4LSL A;  1RTJ A;  4G1Q A;  3VQ7 A;  1SL1 A;  4CGJ A;  3VQ4 A;  1QQC A;  4ELT A;  1KTQ A;  2LSN A;  4AHR A;  4B08 A;  5T7B A;  3L2Q A;  4HUG A;  4FM1 A;  3QIN A;  2O4G A;  3NH1 A;  4I2Q A;  4Z4G A;  3DLE A;  1RBU A;  5HP1 A;  4CJV A;  3KKS A;  2D0B A;  4QAG A;  4J2D A;  4DTN A;  5DK5 A;  3RTV A;  4FJ8 A;  1VSJ A;  1RCH A;  2HHX A;  3OYL A;  4AH9 A;  3S3O A;  5HRO A;  3H08 A;  3KKR A;  5FDL A;  1VSL A;  3L2R A;  4F8R A;  1D5A A;  3HPH A;  1XC9 A;  1ASU A;  3NF8 A;  1JLA A;  1SV5 A;  3MXJ A;  3I0R A;  4I9L A;  5J2P A;  1NK6 A;  3ALY A;  3NH0 A;  3K5M A;  1RT4 A;  2D5R A;  1S5J A;  2ITG A;  4DTU A;  3TAN A;  3SCX A;  1ASV A;  4CHY A;  3AVG A;  3DRR A;  3TR8 A;  4F3T A;  4XIU A;  1D9D A;  1EX4 A;  3V1Q A;  4E7I A;  4Y1D A;  2PYJ A;  4FXD A;  2X6N A;  4FLZ A;  2HHW A;  4HUF A;  3QLH A;  2W42 A;  4M41 A;  5I42 A;  3S3N A;  4JLH A;  4DF8 A;  4M3Z A;  2P51 A;  2QKK A;  3TAQ A;  2HND A;  1BGX T;  1BCO A;  4FLW A;  3RRG A;  3V6D A;  1LWC A;  2XHB A;  4DFJ A;  2IOC A;  2NUB A;  4K8Z A;  3I8D A;  4DSJ A;  4I9Q A;  3HJF A;  1EXQ A;  4FVM A;  2PZS A;  1IKW A;  1B9F A;  1TGO A;  1LW0 A;  2OPR A;  3NCI A;  3RR7 A;  4DU3 A;  1B92 A;  1YTU A;  2ATQ A;  3OS0 A;  3PO5 A;  3K5O A;  3FFI A;  4FJL A;  4CIG A;  4KHN A;  4KB1 A;  1IKV A;  1KLM A;  4DLG A;  1FK9 A;  3OJU A;  3M8S A;  1A5X A;  2A1R A;  3NFA A;  4IG0 A;  3ZT3 A;  3C95 A;  1JXE A;  1I39 A;  1RT6 A;  4GVM A;  1N5Y A;  4FK2 A;  1VK0 A;  1HNV A;  1NK4 A;  1HYS A;  1TAQ A;  1EKE A;  3SQ2 A;  1VSI A;  3DRP A;  5DMR A;  4N5S A;  3OYB A;  3M8R A;  3LWM A;  2BAN A;  1FKP A;  3DYA A;  3TAB A;  4CGD A;  1L3U A;  2D0C A;  3S9H A;  1TKZ A;  2G8U A;  1S1X A;  3IRX A;  3LAN A;  1KFD A;  3ISN C;  4AHS A;  1JLC A;  3V4I A;  4FW1 A;  1T03 A;  2IS3 A;  4PUO A;  2O4I A;  4HCB A;  4CHP A;  3L8B A;  3WNE A;  1VSH A;  3NF9 A;  4CF0 A;  4F2R A;  4OLA A;  1J9A A;  4M3X A;  4ELU A;  1RDC A;  3IG1 A;  3T19 A;  3CYM A;  2WON A;  3V1R A;  2X6S A;  3LAK A;  3AVB A;  1TL1 A;  4BE0 A;  3B6O A;  1QTM A;  4I7F A;  4CJQ A;  3TAF A;  2E6L A;  3TI0 A;  1JL1 A;  1S6Q A;  1N6Q A;  4DTO A;  3QO9 A;  2Z1J A;  3VQ9 A;  4Z4H A;  2E6M A;  3QER A;  4IFY A;  3L2W A;  2VG5 A;  5CZ2 A;  1IO2 A;  3NGY A;  4W5N A;  1QE1 A;  4H4O A;  1BIZ A;  4CF1 A;  4CJU A;  3KLH A;  5J2N A;  2HHU A;  3BDP A;  1ZBI A;  2PY5 A;  3PX6 A;  2I5J A;  3OYI A;  3PX4 A;  5J2Q A;  4NYN A;  3SQ4 A;  4OKE A;  3PV8 A;  2B6A A;  2FBV A;  4CEZ A;  3AVL A;  3K57 A;  1ZYQ A;  4IKF A;  4KRF A;  5K14 A;  3QIP A;  1MU2 A;  4NCB A;  2YNI A;  1T05 A;  1WSJ A;  3CM6 A;  4FJ9 A;  3O4N A;  4M3T A;  3SI6 A;  1L5U A;  4CIE A;  4F3O A;  5KGW A;  3VQP A;  2IAJ A;  4DMN A;  3TWH A;  3AA5 X;  1JLB A;  3V9X A;  2KFN A;  3DRS A;  3CG7 A;  4DTX A;  3HST B;  3MXM A;  4EZ9 A;  3I0S A;  3MXI A;  3ULD A;  1TK5 A;  3MEC A;  3MED A;  4CER A;  3DM2 A;  3DLH A;  1LW2 A;  1S1W A;  4FZY A;  5CY4 A;  4F2S A;  4KB0 A;  4CF8 A;  1BI4 B;  4DSF A;  3L3V A;  3OYK A;  4CFD A;  4J2A A;  1BL3 A;  4RW4 A;  1L3V A;  1RIL A;  4OLB A;  5KRS A;  3HP6 A;  4FJI A;  3DLK A;  3MEE A;  4CHZ A;  5KTQ A;  1RNH A;  3SYZ A;  2G8V A;  4C8K A;  3B6P A;  4RW8 A;  1BCM A;  1WLJ A;  2VWK A;  1IKY A;  4CEA A;  3QEW A;  1UA0 A;  4J2B A;  3C6U A;  5KI6 A;  3VQQ A;  1JLQ A;  1TVR A;  4UQG A;  4K8X A;  4Z0U A;  4PWD A;  3HK2 A;  2GUI A;  4KI6 A;  1LWF A;  1GOC A;  2G8H A;  1UOC A;  3NE6 A;  1Q9X A;  1C6V A;  5JS2 A;  4CIF A;  5FRN A;  3NHG A;  2ZD1 A;  3LAL A;  1RBR A;  2RF2 A;  1BIS A;  1WN7 A;  4IG3 A;  4MQ3 A;  1HQE A;  3DOL A;  4H8K A;  4CEF A;  3OYF A;  3SPZ A;  1NJZ A;  3HO1 A;  4CE9 A;  4FJM A;  4O5B A;  4M3R A;  1D8Y A;  2ZQB A;  3AVF A;  4B9T A;  4CFB A;  3LDS A;  4KRE A;  4LY7 A;  4LH4 A;  4FK0 A;  3VQ8 A;  1HNI A;  5HRP A;  3T3F A;  1KLN A;  4FZZ A;  1QSS A;  4AHV A;  3KD5 E;  3QEP A;  4N76 A;  2QKB A;  1RTI A;  3ZSR A;  4E7L A;  4OGE A;  3NF6 A;  3WNH A;  4DS5 A;  4AIL C;  3KK2 A;  3PX0 A;  2HW3 A;  1S9E A;  3QEX A;  4M42 A;  3P83 D;  4M45 A;  1T8E A;  4FYD A;  3HPG A;  1Z25 A;  3ZT1 A;  3ZSW A;  2JGU A;  4CHN A;  4CJ3 A;  4RW7 A;  2HVI A;  1TKD A;  4DSL A;  4FJ7 A;  4O0I A;  3DLB A;  4N47 A;  4CJT A;  2FBT A;  4WE1 A;  2FBX A;  4E7J A;  4E1N A;  4E1M A;  3OYH A;  3M8Q A;  2P1J A;  5CYM A;  2ZE2 A;  1U47 A;  3RRH A;  4QCL A;  3RMD A;  4CEC A;  3AO5 A;  1ZBH A;  3KIO A;  1LWE A;  1RBS A;  3TAG A;  1VSD A;  1CXQ A;  4F4K A;  3ASM A;  1YVU A;  4B8C A;  4BE2 A;  4DQP A;  3D45 A;  3NGZ A;  4RW6 A;  4ZHR A;  3CFP A;  1LV5 A;  2X78 A;  1IH7 A;  3ZSY A;  3VA0 A;  2G8I A;  1RTD A;  4O55 A;  4OPJ A;  3OVN A;  3CQ8 A;  2KW4 A;  1SKW A;  1DTT A;  1QSY A;  3ITH A;  3HYF A;  3PUF A;  4BDZ A;  1EP4 A;  3AVI A;  4FM2 A;  4DQR A;  1R0A A;  1KVC A;  1HMV A;  4BWM A;  4ID5 A;  3ZCM A;  4AHC A;  4CJF A;  4CHQ A;  5HRN A;  1T7P A;  1J5O A;  4M3W A;  1WSG A;  3JYT A;  4DSE A;  1JKH A;  2HB5 A;  1A5W A;  4I2P A;  3EY1 A;  3V9Z A;  3AO4 A;  4ZTF A;  4M3U A;  3TAM A;  5E41 A;  2ETJ A;  3LPT A;  3SUN A;  3ZSQ A;  1S1V A;  2BGG A;  1Q9Y A;  3OYG A;  2OZM A;  2OPP A;  4KO0 A;  4CK1 A;  5SZT A;  3V9S A;  4DTR A;  3OYA A;  3AVJ A;  4PY5 A;  4C8O A;  4AHT A;  3AVN A;  3BGR A;  3NAE A;  3LZI A;  4DQQ A;  1ASW A;  1CZ9 A;  3CM5 A;  4AHU A;  2B5J A;  3RMC A;  3NF7 A;  1UWB A;  1C1A A;  3LWL A;  3THV A;  4CF9 A;  4O44 A;  2RN2 A;  4FLX A;  1X1P A;  1XWL A;  4CFC A;  3CFR A;  2Y1I A;  1KSP A;  1GOB A;  3O3H A;  3VN5 A;  1VSK A;  1XHZ A;  1DLO A;  1SUQ A;  4FJN A;  2E4L A;  1REV A;  1WSI A;  1DTQ A;  2HNZ A;  3NDK A;  1ZBF A;  2OPQ A;  2YNG A;  2F8S A;  2HVH A;  1HJR A;  2Z1I A;  4W5O A;  5KRT A;  2PYL A;  1J54 A;  1Z26 A;  4CJ4 A;  3MEG A;  4MFB A;  1YTA A;  3O4Q A;  4KKO A;  3U3Y A;  5FRO A;  2XY7 A;  4GW6 A;  1NK0 A;  4DWI A;  3SUQ A;  4DTM A;  2EHG A;  4W5R A;  3F73 A;  4C8L A;  1SL0 A;  1JXB A;  1RDB A;  1CZB A;  4RG8 A;  1C1B A;  2RPI A;  2AJQ A;  1SKR A;  2XY8 A;  1W9H A;  1Q8I A;  1C0M A;  4PA1 A;  4W5T A;  4HCC A;  2Y1J A;  4FJH A;  3AO1 A;  4FJK A;  4DLE A;  4CGF A;  4KPY A;  3V1O A;  4KHU A;  3SZ2 A;  1S1T A;  3VQB A;  3VQC A;  4C8N A;  5D3G A;  3ZSO A;  4E19 A;  4IFV A;  1QSL A;  3RR8 A;  1KCF A;  3OYE A;  3U3G A;  4HUE A;  1HYZ A;  1TK0 A;  2VG7 A;  4IDK A;  1RT3 A;  4DTS A;  3P1G A;  1NJX A;  4DQI A;  4CJK A;  1WAF A;  1KVA A;  4CED A;  4CJS A;  3DLG A;  3KJV A;  2DTU A;  3D0P A;  3OS1 A;  3HPO A;  1XI1 A;  4DF4 A;  1BQM A;  4H4M A;  1J53 A;  1A5V A;  1S6P A;  4DTJ A;  4TSX A;  4Y1C A;  4JRP A;  4CEQ A;  2KZZ A;  3AV9 A;  4CES A;  2XY5 A;  2XY6 A;  1NK9 A;  1LAV A;  2G8K A;  1BI4 A;  1QS4 A;  1UAX A;  4FLV A;  1D9F A;  2YV0 X;  4FJJ A;  1TAU A;  4E7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...