1JL2A

Crystal structure of tceo rnase h-a chimera combining the folding core from t. thermophilus rnase h and the remaining region of e. coli rnase h
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
150
structure length
150
Chain Sequence
KQVEIFTDGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELKAAIEGLKALKEPAEVDLYTDSHYLKKAFTEGWLEGWRKRGWRTAEGKPVKNRDLWEALLLAMAPHRVRFHFVKGHAGHPENERADELARAAAMNPTLEDTGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chimera of Ribonuclease HI, Ribonuclease H
publication title Contributions of folding cores to the thermostabilities of two ribonucleases H.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
total genus 42
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jl2A00
3V9XA 1RDDA 4OLBA 4RW8A 4IG3A 3LWLA 4B3OA 3AVMA 1MU2A 1REVA 5HLFA 1N5YA 3RMDA 3NAEA 2KZMA 4CHNA 3M8RA 2B5JA 1F21A 4FW2A 4KRFA 3VQEA 4TSXA 4KHUA 2I5JA 3K5NA 1RTDA 2D0AA 4BE1A 2HHUA 2VG5A 3WNEA 4QCLA 1VRUA 4OJRA 3SI6A 4YFUA 3I0RA 2O4GA 3G0ZA 4E3SA 2W42A 1HQUA 3FFIA 4CGHA 3KLFA 4CHYA 4FLTA 4M3UA 2DFHA 3QLHA 1T03A 3SV3A 4E89A 1BIUA 4CIGA 1JLFA 4FYDA 3EY1A 1RT4A 3V9ZA 2BDPA 2KZZA 4KHQA 4DQRA 3OS0A 2PYJA 1RBRA 1KSPA 3TAQA 1WSIA 3M8QA 4ZTJA 1C0TA 1NK8A 4CF9A 1RTJA 1RNHA 4CE9A 3NGZA 3NGIA 1U47A 1VK0A 2GUIA 2JLEA 3TAGA 1RBUA 2BGGA 4CEEA 4AHCA 4B9UA 4C8NA 1EP4A 3V4IA 1SKSA 3VQCA 4CF0A 3OYMA 4AHSA 4DU3A 4LSNA 3WNHA 3QESA 1CZ9A 3ZT4A 4E7JA 1Q9YA 1WAFA 3VQDA 4EP4A 3ALYA 3RRHA 2P1JA 1RDAA 3NF6A 1DTTA 1X9MA 1TK0A 3AVGA 1QHTA 3OYCA 4BACA 3KKRA 4CEAA 3AVCA 3VA0A 3RMAA 4J2DA 1EETA 3RMCA 4CJ5A 5JS1A 4HUEA 2HMIA 2RN2A 3L3UA 3LDSA 3P5JA 3ZT0A 3BGRA 4CJRA 1HNIA 2DY4A 2GBZA 4DS4A 4DSIA 2D0BA 2Y1JA 3TAPA 3KTQA 4KPYA 3OYNA 2IGIA 1BQNA 3TAEA 5CZ2A 2Q3SA 2VWKA 4M3ZA 3QERA 2RKIA 4CHPA 3ASMA 4NYNA 4E1MA 1ZBIA 4KB1A 2QKBA 1YT3A 5SWMA 3F9KA 3VQ6A 1TL1A 2YNFA 1ZBLA 4J2AA 2A1SA 4FXDA 4RW9A 1JLCA 3B6PA 4B08A 4CJVA 4H4OA 4CJQA 3LP1A 3HPOA 4C8MA 4Q0BA 4DQIA 1NK4A 5CY4A 3I0SA 4UQGA 1QSYA 4DMNA 1BHLA 1IKWA 1A5XA 2ITGA 1BCOA 2WOMA 3MEDA 2XY5A 4FK2A 2HVIA 1RTHA 2OA8A 1NKBA 1WSGA 4KKOA 4F3TA 4ZHRA 3PX0A 1UA0A 2E6MA 3HVTA 4Y1CA 4DTNA 4CJKA 4FVMA 1LV5A 4Z4FA 1WN7A 3ISNC 3DRSA 3M8PA 4CJUA 2YHBA 3MXIA 2XY8A 1U04A 3RMBA 5EU7A 2IDOA 4QAGA 1JLGA 1VSDA 3QIPA 5FDLA 4HCCA 4JS5A 4FJ9A 1J5OA 3EYZA 2B4JA 1C1BA 3CFOA 3OYLA 4OGEA 1GOCA 4I9LA 5T7BA 4NCGA 4RG8A 2YNHA 4CEFA 4KO0A 3PO4A 2F8TA 3AO4A 2DTUA 4FJ8A 4Q5VA 2YKMA 1U48A 1X9WA 4OPKA 3KLIA 4R5PA 3NH1A 1CXQA 2IS3A 3OYKA 3L3VA 1S1XA 3AVIA 4I2QA 3K58A 4FK0A 3SUOA 3AVBA 1IH7A 2Z1IA 4ICLA 3KLHA 3V6DA 1IO2A 3OY9A 3M8SA 4J2EA 1IKVA 3LP0A 2G8HA 5D3GA 1RT5A 3P83D 4EP5A 3DMJA 3NDKA 3CFPA 3TR8A 4KREA 1FKPA 3SV4A 4KI6A 3OJUA 1JXEA 1NOZA 1ZBUA 4DWIA 3KK2A 3EZ5A 5HBMA 4C8KA 5KRSA 3HVRA 4CK2A 3K59A 1J54A 3KKSA 3LWMA 3NFAA 3MAQA 4DFPA 2Z1JA 1R0AA 4FJJA 2QXFA 4M41A 2XRIA 3T1AA 2HHWA 3K5OA 4O0JA 1WAJA 1WSJA 1VRTA 3AVKA 3OYBA 4JLHA 3VQ5A 4BE2A 3S3MA 3ITHA 2NUBA 2HNYA 3SQ4A 3SUQA 3PX4A 4CCHA 3SPYA 4OKKA 1ASWA 1IKYA 4DF4A 1D9DA 3LZJA 4DTXA 3KK3A 4BDYA 4FM2A 2FBYA 2OZSA 2FBTA 3V1OA 3V1QA 4DTPA 3TABA 1QSSA 3BDPA 4B9NA 4H8KA 4HHTA 1U45A 3V9UA 3MEEA 1XI1A 3C6UA 1C0MA 1LWEA 1TV6A 3CQ8A 2ZD1A 2BANA 2HHQA 4KTZA 4CJEA 3QEXA 3DLKA 1X1PA 4FLWA 1SL0A 1XWLA 4B9VA 5DMRA 3VQPA 1JKHA 1DTQA 4IFVA 4DTJA 4FLUA 4CF8A 1HYZA 2G8IA 3CG7A 1L5UA 4B9MA 4O44A 4DLEA 1RCHA 2P5OA 4DSKA 4Z4CA 4NCBA 3AO2A 1FKOA 5SZTA 4IDKA 3DYAA 3QEWA 4MFBA 3S3NA 3AO1A 3NHGA 1TK8A 2KFZA 3PV8A 1JLAA 4N41A 3ZSQA 3O3GA 3U3GA 3OYFA 1BGXT 1KTQA 1UWBA 3LPTA 4CJ3A 1NOYA 4DFKA 1QTMA 4DTOA 3SQ2A 4DTRA 2QK9A 3AA3A 3ULDA 4FM1A 4FJNA 1KFDA 4KHSA 3WNFA 5C25A 5KGXA 3HM9A 4KHNA 4CGIA 2XHBA 1D5AA 4CHOA 1FK9A 1KRPA 4PA1A 3SPZA 3RWUA 3D0PA 4KAZA 1BI4A 1NK7A 3OJSA 4EZ9A 1WSFA 4L8RB 2HNDA 1O1WA 3DOKA 4KHWA 3SZ2A 4XIUA 4FLVA 1VSJA 1YTAA 4CHQA 4JRQA 4FJLA 4EZ6A 1I39A 1A5WA 3VQ8A 3AA4A 1RBVA 3MXJA 3L2QA 4JRPA 3K5MA 1EKEA 4HUFA 5CZ1A 2KFNA 4HCBA 4KFBA 1LWCA 3O4QA 1S9EA 2Z1HA 4KB0A 3DRRA 4F2SA 2HVHA 1JL2A 4O5BA 4RW7A 4ELTA 4YNQA 4ZTFA 1NJWA 5J2QA 5C24A 4FLZA 4Z0UA 3CM6A 4DSFA 1L3SA 3OS2A 1BQMA 1WSHA 3SNNA 4OKEA 2IC3A 4FLYA 1Q9XA 3HO1A 4ID5A 3VN5A 3HL8A 5FROA 1NJZA 3HP6A 4OVLA 3K2PA 3NGYA 4MQ3A 5CYMA 3TAMA 4CJ4A 4HUGA 3QINA 1NK0A 1RT6A 4DSLA 1HYSA 4W5QA 2HB5A 4O0IA 1HPZA 1HMVA 3MECA 3E01A 4OPJA 4AILC 2X78A 2G8UA 1S1WA 2KTQA 1TAQA 3LPUA 2FC0A 1VSEA 4IKFA 3L8BA 4KTQA 3ZCMA 2BE2A 3LP2A 4AHTA 1ITGA 4BE0A 4G1QA 2G8KA 1S1UA 1CXUA 3SQ1A 1YVUA 1SKWA 1EX4A 3ZSOA 4W5OA 4CJTA 3QNNA 5HROA 2XY6A 1BISA 2OPPA 1QQCA 1JL1A 1ASVA 4KI4A 1XHZA 4K8ZA 1RDCA 1BL3A 2FBXA 3TANA 2G8FA 3PO5A 3NF9A 3KD5E 4N47A 4E7IA 3KD1E 4AHRA 1VSLA 4M3XA 2HHTA 4IG0A 4CESA 4FJGA 3SQ0A 4N56A 2E6LA 1T7PA 1L3VA 2DFEA 3ZSXA 2XY7A 1QS4A 1W9HA 4CEDA 1HJRA 1IG9A 2IAJA 3IS9A 1RT7A 2KW4A 2OZMA 5KGWA 1S1VA 4DFJA 3T19A 3SYZA 1N6QA 3K5LA 1HQEA 4PY5A 1SV5A 3DI6A 3OYJA 1KVCA 3O3FA 3H08A 5JS2A 4FM0A 1JXBA 1D8YA 3NF8A 4CGFA 4FJ7A 3AA5X 4ID1A 4CECA 3OYIA 2ZQBA 5J2MA 3VQ9A 3ZSYA 1B92A 3NBPA 2IOCA 3PUFA 1C1CA 4DG1A 3I8DA 3L2VA 1BI4B 2YHAA 1SKRA 3NF7A 1UA1A 5HRPA 1C6VA 4W5TA 3HK2A 4CEQA 1KCFA 2F96A 4M45A 1ZYQA 4NCAA 2WONA 3VQBA 3KIOA 4DQQA 1B9DA 3OYAA 3SCXA 2P51A 3PY8A 4ELUA 1KVAA 3AVHA 3LAKA 1RTIA 1Z25A 5KTQA 4DU4A 3KK1A 3RRGA 3QEVA 5HRSA 4B9TA 3ZT3A 2PYLA 1WNSA 2DFFA 2EX3A 3L2UA 3DLRA 4C8LA 3ZSZA 1JLEA 4CFDA 1VSMA 3HXMA 4E7KA 3ZSWA 4CJSA 4M3WA 2D0CA 5KI6A 1CZBA 4DTSA 4CJFA 1TAUA 3K57A 1C1AA 3DM2A 1T05A 3RR8A 4DSJA 5C42A 4E7LA 3B6OA 3AV9A 4BWMA 4M3RA 2YNGA 3VA3A 2Y1IA 4KHYA 1ZBHA 3OYDA 1RT2A 3CM5A 3V9WA 4I9QA 3PX6A 2RF2A 1LAVA 3AVFA 4E0DA 4FZXC 4LD0A 1U4BA 4E19A 3TI0A 1XHXA 4CGJA 4IBNA 4LH5A 2LSNA 2AJQA 4CIFA 3AVNA 3F73A 2ETJA 4F2RA 1TVRA 3C95A 3U3YA 1W0HA 1HRHA 1KVBA 3CYMA 4C8OA 1K6YA 1BCMA 4F4KA 3L2RA 2HNZA 2JGUA 1Z26A 4CIEA 4CJPA 3SJJA 1WSEA 4Z4IA 4N76A 4M3TA 3QO9A 3LZIA 4FJXA 3AVAA 4O4GA 5J1EA 4B9LA 1HYVA 1G15A 2YNIA 4GW6A 3JYTA 2X74A 4CJLA 4E1NA 1JLBA 4CFCA 3ZSVA 4BDPA 4ELVA 4DFMA 4I2PA 3OYHA 3TWHA 3HP9A 4WE1A 1BIZA 5HRRA 3THVA 2A1RA 1TKXA 3AO5A 4LH4A 4BDZA 1L3UA 4F8RA 3U6FA 4DQPA 1VSKA 3OVNA 3V81A 4B8CA 4I7FA 1LW0A 1VSFA 3ZT2A 2P5GA 4JS4A 1HNVA 1LWFA 1Q8IA 1S5JA 4CERA 5J2NA 1NJYA 1A5VA 2YV0X 4FZZA 3DLHA 4FJMA 4W5RA 2HW3A 3IG1A 1TK5A 1NKEA 4H4MA 4Z4HA 1B9FA 2YKNA 1RT3A 4LY7A 3OS1A 4DTUA 1L3TA 3LP3A 4DS5A 4KV8A 3AVJA 3C94A 4PWDA 2PY5A 1TGOA 1TKZA 2ATQA 4QOZB 1SUQA 2G8WA 2E4LA 2HHXA 1VSIA 3V1RA 4J2BA 5FRNA 3MXMA 4CF1A 1DLOA 1TKDA 4CFAA 3QEPA 2ZE2A 1Y97A 4CEOA 2OYQA 1EXQA 3VQ4A 3LANA 1CLQA 1LW2A 4FCYA 4PQUA 5KRTA 2OPRA 1NK9A 2B6AA 3ZT1A 2EHGA 1TL3A 3WNGA 3TARA 3S9HA 4CGGA 3S3OA 3RTVA 3QEIA 1I3AA 1VSHA 4FJKA 2FBVA 3DLBA 4OGCA 2RPIA 5DK5A 4M42A 3CFRA 4DU1A 1LAWA 4Z4EA 4FK4A 2HHVA 3NCIA 4NYFA 3VQAA 5HRNA 5K14A 3OYEA 1NKCA 1SL2A 2GV9A 4OLAA 3DOLA 1GOAA 3IRXA 4HVJA 4GMJB 2OPSA 2R7YA 3V9SA 4CK1A 3MEGA 4DQSA 5I42A 2PZSA 4W5NA 1D9FA 3VQQA 5HP1A 3HJFA 3HSTB 5CYQA 1S6QA 4B8AB 1T8EA 3SUNA 1KLMA 4KTWA 2O4IA 1S9GA 2KQ2A 1KLNA 4DLGA 3O4NA 1S6PA 3KLEA 1JLQA 3A2FA 3AO3A 3HYFA 3C6TA 1GOBA 1UOCA 3DLGA 1C0UA 3LALA 3ZSRA 3OYGA 3KLGA 1KFSA 1QSLA 1TKTA 2D5RA 2G8VA 4FJ5A 4GVMA 4FJIA 3HT3A 3QETA 1XC9A 4BWJA 4CJWA 1NK6A 2X6NA 3VQ7A 1FXXA 4B9SA 2HHSA 3LAMA 3HPGA 4IFYA 4RW4A 2VWJA 5FRMA 4PUOA 4CF2A 4E7HA 2Z1GA 1SL1A 4Z4GA 4HTUA 3NH2A 1RILA 1ASUA 3G10A 3RR7A 3SUPA 1RDBA 4OKJA 4FZYA 3DRPA 4FJHA 3O3HA 2X6SA 4FLXA 1YTUA 4K8XA 3UIQA 4CEZA 3D45A 1RT1A 4F3OA 4N5SA 3NH0A 3QNOA 4CFBA 2F8SA 5E41A 1RBSA 1QE1A 3QIOA 1J9AA 4CGDA 2OPQA 5I3UA 4AH9A 1NJXA 3TAFA 4AHVA 4CEBA 1IKXA 3KJVA 3T3FA 3JSMA 1S1TA 4DSEA 4CHZA 4DTMA 1ZBFA 1NK5A 4M3YA 1WLJA 2VG6A 4FW1A 4AHUA 1J53A 2VG7A 3AA2A 3P1GA 2XO7A 4LSLA 2QKKA 3HPHA 4CK3A 3NE6A 1X9SA 1U49A 1UAXA 4DF8A 1RBTA 4O55A 3AVLA 3L2WA 3DLEA 5J2PA 4RW6A 3IAYA 4Y1DA
chains in the Genus database with same CATH superfamily
1RDDA 4IG3A 3U8XA 4IOCL 4B3OA 1MU2A 3J7YP 5JLFA 4KRFA 2I5JA 2GELA 4BE1A 2E2OA 3I0RA 1QHAA 3FFIA 4CGHA 1LCUA 4BRGA 4CHYA 1HKCA 4BRFA 1JLFA 4KH6A 2A41A 3V9ZA 5AQFA 1SZ2A 1P8ZA 1VQ4N 3Q7BA 3M5RA 1KSPA 3M8QA 4ZTJA 1NK8A 1RNHA 3NGZA 3ENOA 1VK0A 2JLEA 3CCQN 1XNRK 1JCEA 4B9UA 4C8NA 3HOSA 1SKSA 3VQCA 3WNHA 4A5AA 3NF6A 4DR4K 3A5MC 4AM7A 3KKRA 4CEAA 3AVCA 3ZETB 4MO4A 2O8EB 1QVGM 1NLVA 5BRFA 4CJRA 1HNIA 4FSVA 4DSIA 2D0BA 4KPYA 3OYNA 4BQLA 1BQNA 3U9ZA 5CZ2A 1HUXA 2Q3SA 2RKIA 2E1ZA 3WXKA 3ASMA 4NYNA 4E1MA 1NGEA 3F9KA 5M1FA 1N36K 3H6EA 2A1SA 4J2AA 4RW9A 1JLCA 2IVNA 2ZJPL 1RGIA 2CGLA 3LP1A 3H1VX 5AQSA 4H5VA 2P9SA 4DV6K 1NK4A 3KWIA 3D6RA 5LL6Z 1QSYA 4C1NI 3VGKA 4JHDB 4DMNA 1IKWA 2HVIA 2RE2A 4LFCK 2NLXA 4DUZK 3DLLL 3ZX3A 2XY8A 5EU7A 4HCCA 1JLGA 4FJ9A 2KHOA 2BH1A 4PKHA 5TKYA 4JI5K 3CJCA 1DGKN 4RG8A 3L0QA 5M1PA 4DV3K 4L3QA 1X9WA 3ID8A 3NH1A 4JD2A 2IS3A 4JKDA 3THXA 1S1XA 3SUOA 1IH7A 3V6DA 3I55N 4J2EA 1IKVA 3P83D 3CFPA 3DMJA 1C0FA 4BG9A 1JXEA 1NOZA 1SS6A 3EZ5A 1ESVA 4DB3A 5KRSA 4DUYK 4NO7A 3LWMA 3EEQA 3O9UA 2Z1JA 4DFPA 1HR0K 2QXFA 2XRIA 2HHWA 3K5OA 2O8CB 4O0JA 3S3MA 2NUBA 3O1BA 1IJJA 3SUQA 5AR0A 4DF4A 4BVOA 4JI7K 1OH6A 3KK3A 4BDYA 2FBYA 2OZSA 2FBTA 3V1OA 4DTPA 3QBWA 5EX5A 3MEEA 4B3SK 2ZJRL 3VF2A 4IOXA 1Q7YO 1HJOA 4BRIA 2BANA 2HHQA 3CMEN 3QEXA 4JEPA 1RDWX 1IG8A 3SJHA 2A5XA 1XWLA 5DMRA 1XMQK 1DTQA 5AQKA 1HYZA 1RCHA 4DSKA 1FKOA 4HTLA 4XH5A 4JI6K 3AO1A 3TSUA 1JLAA 3ZSQA 3O3GA 3M3ZA 1NGFA 1BGXT 2JWLA 1UWBA 1NOYA 2E8AA 4DFKA 3SQ2A 2Q1NA 2QK9A 1X9JA 1KFDA 4KHSA 4KHNA 4CHOA 3AGRA 3RVCA 3JXUA 4KAZA 1BI4A 1NK7A 3OJSA 2YCHA 1WSFA 4EZ9A 1MDUB 4YOXA 4L8RB 1O1WA 4MLEA 4C23A 5GAEP 4CHQA 1YTAA 1Q81O 5BR9A 4OPHA 3AA4A 3MXJA 5AFUA 3K5MA 2YX6A 3VEYA 2KFNA 1LWCA 3VEOA 1S9EA 1K9MO 1JL2A 3F2KA 4O5BA 3EKUA 2H3GX 5C24A 4FLZA 4V19S 3MX5A 3OS2A 1WSHA 4FLYA 1QQOA 3HP6A 4OVLA 5CYMA 5AQJA 1M1KO 1RT6A 4W5QA 2HB5A 1HPZA 5IT9O 3MECA 4OPJA 4AILC 3THYA 2X78A 1JJ2M 1S1WA 1TAQA 2P9NA 2FC0A 3VGMA 3AY9A 1S1UA 3SQ1A 1YVUA 1EX4A 2VQEK 4MDBA 1BA1A 5HROA 3HTVA 3VPZA 3MWTA 5AQOA 2QWNA 4K8ZA 1RDCA 2FBXA 4GNIA 4A57A 1YJWN 2G8FA 3PO5A 4GKKK 2HHTA 4AHRA 3EO3A 4IG0A 3WUHA 1T7PA 2E6LA 2O8BA 1KC8O 3UKUB 3S41A 3SAHA 3T19A 3K5LA 4JKBA 1SV5A 3H08A 4BR5A 5JS2A 4FM0A 3NF8A 2FSNA 3AA5X 4A2AA 4CECA 1QZ5A 2ZQBA 2VCPA 1NU0A 4H03B 3L2VA 4PKGA 1Q18A 4UY8O 1C6VA 3CPWM 4NCAA 3KIOA 1KVAA 3KK1A 2ASMA 5HRSA 2YHWA 3FZLA 1HKBA 2EX3A 4C8LA 3DLRA 1YXQA 4FPBA 4CZHA 1WUAA 3CC4N 4DSJA 1HNWK 5C42A 4EAHD 1NM1A 2YNGA 4XEIA 1RT2A 3QMLA 3CM5A 4CVNE 4I9QA 3AVFA 4E0DA 4LD0A 1Y64A 3TI0A 4CGJA 4BGAA 4IBNA 4LH5A 2AJQA 4CIFA 2GWKA 3U3YA 2P9UB 4OO1J 1X3MA 4WFAL 4PL8A 1K6YA 1BCMA 3F9MA 4CJPA 4Z4IA 4WQ5C 3CI5A 3CJBA 3LZIA 3AVAA 1HYVA 2X74A 1I94K 4BDPA 4DFMA 4LF4K 3OYHA 3CIPA 4WE1A 4BRMA 1GLAG 4DQPA 1VSKA 3LDQA 1VQKN 4O5FA 4KHYA 1Q8IA 5J2NA 1A5VA 3DLHA 4W5RA 2O8DB 1DKGD 3CCJN 3IFRA 4DTUA 4CBWA 5BPMA 3AVJA 3C94A 5KPZA 1TKZA 3SAGA 2V7ZA 1ZBSA 2HHXA 3V1RA 4G9ZA 1DLOA 4CFAA 2ZE2A 1Y97A 1EXQA 3ULEB 1LW2A 4A2BA 2OPRA 1NK9A 1QZ6A 2QW9A 4AM6A 1VSHA 3QEIA 4FJKA 1NGBA 2RPIA 1BUPA 3C7NB 4M42A 4DU1A 2Q97A 3CF5L 4NYFA 5HRNA 4B9QA 1NKCA 3UE5A 1SL2A 3PLAA 3AGKA 1GOAA 4PHTX 5I42A 4W5NA 5BN8A 2D1KA 1D9FA 4KTWA 1W97L 3E66A 1S6PA 1T3VA 1JLQA 3HYFA 3LALA 3JAMO 4BR9A 4DR6K 3HSCA 1IBKK 5ADXH 5AQRA 4B1UB 4GV9A 1FXXA 5EVZA 3LAMA 3HPGA 3EE8A 3CCRN 3NH2A 4LF5K 3O3HA 2QWMA 5I9EB 2V7YA 3ID6A 4F3OA 4N5SA 3QNOA 3CCLN 2F8SA 4O8UA 1J9AA 5I3UA 3R8EA 4AHVA 3T3FA 5KQDA 5AJ3K 3JSMA 5EY4A 1ZBFA 2VG6A 4AHUA 2JWKA 3BF3A 3ATVA 1X9SA 1UAXA 4Y0WA 4MO5A 3TU5A 4O55A 3AVLA 4DHYA 1TYQA 3V9XA 4JI3K 1VQ8N 2VGMA 5HLFA 1N5YA 4JHDA 2B5JA 3HZ6A 1RFQA 2D0AA 4DKWA 3WNEA 4QCLA 2QM1A 3SI6A 5BRHA 3G0ZA 1GLDG 2E2NA 3KLFA 2DFHA 3QLHA 1BIUA 3LDNA 1RT4A 3BP8A 3LL3A 2BDPA 4KHQA 2PYJA 1RBRA 3PIOL 3HOTA 1RTJA 5AQHA 3NGIA 4CEEA 4AHCA 1EP4A 4BRNA 4DU3A 2GWJA 4LSNA 3TTCA 5KPRA 1CZ9A 4E7JA 1Q9YA 2UXDK 1WAFA 1VQMN 3ALYA 3RRHA 4BVPA 1DTTA 3M1FA 4B3RK 1X9MA 2FSKA 3NVKA 3DXKA 1TK0A 4BACA 3UKRB 4YOWA 3WXIA 1EETA 1G99A 2HMIA 3P5JA 4IFEA 4DS4A 3UB5A 2O8CA 4IWVA 4M3ZA 4K0KK 1CZAN 4CHPA 2F9TA 1TL1A 2YNFA 5CE3A 3CCMN 4HWIA 2J4RA 4CJVA 3DWLA 4C8MA 5CY4A 3I0SA 4H5TA 2NRXA 1BHLA 1A5XA 5AQQA 2WOMA 4FK2A 1EWQA 1RTHA 4B1ZA 4KKOA 3PX0A 3CCEN 4DTNA 4WYBA 1LV5A 1WN7A 3DRSA 4CJUA 1U04A 3RMBA 1ZBIA 3EN9A 1VSDA 1J5OA 3EYZA 2B4JA 1C1BA 2EWSA 4OGEA 1DT9A 2YNHA 4CEFA 4YY3K 4KO0A 2DTUA 3AO4A 1NGDA 5AQXA 2YKMA 5JLHA 5ELZA 4CZIA 4OPKA 1U48A 3AVIA 4I2QA 4FK0A 4M63C 1E4FT 3AVBA 4CW7B 5C12A 1NGCA 3OY9A 2G8HA 3NDKA 4KREA 2CH5A 1ZXOA 1ATSA 5BREA 3KK2A 1NGAA 2NRVA 4C8KA 5EOYA 3K59A 1J54A 3KKSA 5GIOA 3VF6A 2ZM6K 1R0AA 3WXLA 4M7XA 3CC7N 3AVKA 3OYBA 3VQ5A 2O8FA 2HNYA 3P39A 4CCHA 1VQON 3ZEUB 1IKYA 2AP1A 5AQNA 3LZJA 4DTXA 4FM2A 1K8AO 3BDPA 1QSSA 4B9NA 4HHTA 3H46O 3V9UA 5M1OA 1LWEA 3L6QA 3CQ8A 4KTZA 4FWQA 5AQYA 1TUUA 3DLKA 4FLWA 2UUBK 3BZKA 2NRRA 1JKHA 3NVMA 4IFVA 2YJEA 1WOQA 4YDUA 5FLXO 4FLUA 5F2RA 4DTJA 4CBUA 1L5UA 4MDAA 4DLEA 4Z4CA 4NCBA 5C2FA 3DYAA 4JAXA 1KQSM 3MCPA 2KFZA 3PV8A 4N41A 4J8FA 4QS7A 3LPTA 2OA8A 1XQSC 4DTOA 4DTRA 1WBBA 3AA3A 4FJNA 2F8TA 5KGXA 3NMUA 1N33K 1QVFM 3O4WA 4RTFD 1KRPA 3SPZA 1X3NA 5MLCQ 3CMAN 3DAWA 4GV6A 4KHWA 3SZ2A 1K73O 4FWMA 3QB0A 4CZGA 4GVEA 3H3NO 4JRPA 1EKEA 2V52B 2E2QA 5CZ1A 4BRQA 4CJ7A 2Z1HA 2NRTA 4F2SA 2HVHA 4CZJA 4AF1A 1NJWA 5J2QA 4PKIA 3SNNA 4OKEA 4CD1A 5FROA 1XMOK 1NMNA 3TAMA 2QWLA 2CH6A 3QINA 1HYSA 2XY6A 1HMVA 2KTQA 2G8UA 2VYPA 3OTOK 4IKFA 4KTQA 4AHTA 4G1QA 4H0XB 1CXUA 1SKWA 1W2BM 3ZSOA 1U2VB 3QNNA 2UXCK 4I6MB 1H1VA 1NNEA 1QQCA 1NGHA 4F9OA 1ASVA 4FWSA 3KD5E 4N47A 4M3XA 1XC3A 4CESA 5ADXA 2DFEA 3ZYYX 2XY7A 5LY3A 3CJ7A 2Q36A 4DV5K 1IG9A 3IS9A 4WQ4C 4U7BA 5KGWA 3D2FB 3SYZA 3O3FA 3OYIA 1IBMK 4YOTA 5J2MA 3VQ9A 3ZSYA 1B92A 3PUFA 5DM7L 2UYTA 3NF7A 4BR7A 4EHUA 4YOUA 5HRPA 3VEWA 3VQBA 3SCXA 3OYAA 3HRGA 2W6KA 3QEVA 3ZT3A 4LF6K 2PYLA 2DFFA 3L2UA 3ZSZA 1JLEA 4CFDA 2D0OA 3HXMA 4E7KA 4CJSA 2D4WA 5AZJB 3CCUN 3DM2A 1T05A 3RR8A 3C7NA 4BWMA 3VA3A 2Y1IA 4M3RA 5M1QA 3OYDA 3DXMA 4X64K 1LAVA 4IXCA 3MCAB 3IUCA 3WXMB 3FE1A 3AVNA 3WEEB 4FOIA 2ETJA 4F2RA 3C95A 1RDUA 1K8KA 1KVBA 3CYMA 4C8OA 4C1NK 2JGUA 1Z26A 4CIEA 2QTDA 4ISEA 4M3TA 4RCHA 4FJXA 4O4GA 4B9LA 4GW6A 3JYTA 3SK3A 3MDQA 4X66K 2Q2RA 1BIZA 5HRRA 4BDZA 4F8RA 4X65K 4I7FA 2E88A 4JS4A 1HNVA 1S5JA 2PFUA 4CERA 4FZZA 2UU9K 4CZKA 1V4SA 2HW3A 3BZCA 1NKEA 4H4MA 3CHWA 1B9FA 1VAZA 1RT3A 3LP3A 3CPEA 2P9KB 5CR4A 5LJVA 4JYAK 4PWDA 2PY5A 4QOZB 2G8WA 2F9WA 3QBXA 4J2BA 5FRNA 3MXMA 2HBLA 3CQYA 4IJAA 4AQYK 2HMPA 5KRTA 1VQ6N 3S9HA 3WXJA 3OW2M 3RTVA 1I3AA 3RSEB 5C2DA 4Z4EA 1N8RO 3NCIA 1IBLK 4IEIA 3VENA 3OYEA 4JN4A 2GV9A 3CQXA 3P31A 4DV1K 1EWRA 2W40A 3V9SA 5GAHP 1R59O 5HP1A 3HJFA 3O80A 2YI1A 4IEEA 1KLMA 1S9GA 2P9IA 1KLNA 4DLGA 3KLEA 4KH4A 4Y1CA 3AO3A 3OA9A 1UOCA 3OYGA 3FR0A 1QSLA 4FJ5A 2G8VA 4GVMA 3QETA 4BWJA 4CJWA 3VQ7A 2HHSA 4RW4A 2VWJA 3D7EO 2Z1GA 1GLJO 4FPAA 4HTUA 4E1JA 3G10A 1ASUA 2NRWA 4FVUA 5GAGP 2UUAK 4FZYA 3DRPA 4K8XA 1ATNA 3UIQA 1JCFA 1EO1A 5E41A 1VQ9N 4WCEL 1QE1A 4X62K 1KAYA 4CGDA 2IVOA 3KZBA 1NJXA 4NB4A 5JVGL 3TAFA 5IWAK 5A2QO 3KJVA 1N32K 4K41A 4CD3A 4DSEA 4CHZA 4M3YA 3D2EB 4LSLA 2QKKA 3HPHA 2OTJN 4DF8A 3TTDA 1RBTA 3SAFA 3I8BA 1S72N 4IJNA 4BR0A 4B3MK 3MN6A 3LWLA 2QI2A 3RMDA 3NAEA 2KZMA 4CHNA 1F21A 4FW2A 1RTDA 2HHUA 3A5LC 5E26A 4NLCA 4OJRA 2O4GA 4E3SA 4M3UA 3O9QA 1IV0A 1T03A 3SV3A 4A5BA 4CIGA 4E89A 4DV2K 4FYDA 1VQ5N 5AZIB 4FWOA 3IMXA 1C0TA 1U47A 5LMNK 1DEJA 3TAGA 1RBUA 4KH5A 3V4IA 4CF0A 3OYMA 3QESA 3ZT4A 4JKAA 4EP4A 1VHXA 3DJCA 4B1YB 1D4XA 4YOYA 4JD2B 4BQZA 1GLCG 5BN9A 3VA0A 4J2DA 3RMCA 5JS1A 4HUEA 2RN2A 3LDSA 3ZT0A 2GBZA 3TAPA 3KTQA 2IGIA 4WFNL 4DV7K 3VOVA 4KB1A 3VQ6A 1ZBLA 4FXDA 4H5WA 1LOTB 3B6PA 4B08A 4H4OA 3G6EN 3OBWA 4OPAA 4Q0BA 5B8HA 4DQIA 1VQNN 4UQGA 4FOEA 2ITGA 1BCOA 3VMFB 2XY5A 1NKBA 1WSGA 4GV3A 4F3TA 5FPEA 2CGKA 1UA0A 2Q0UA 3KK7A 4CJKA 4FVMA 3J80O 3ISNC 1KD1O 3M8PA 2YHBA 1FJGK 5FDLA 4JS5A 3P4IA 3BEXA 5HOOA 4NCGA 3FGUA 2VGNA 4Q5VA 4LFAK 4R5PA 1CXQA 3MN7A 3L3VA 3ZETA 2A42A 4JV5K 3ENBA 3K58A 4CZFA 2O8EA 4ICLA 1GLEG 3G71N 3M8SA 3LDLA 1RT5A 2YHXA 1FKPA 4KI6A 3OJUA 3O1WA 4DWIA 4NLBA 4GY2B 3JS6A 3O9TA 5HBMA 4BRHA 4CK2A 1O13A 3ZLJA 4A59A 4M41A 3T1AA 4BE2A 4JLHA 3QDKA 1SAZA 2P9LB 3PX4A 4OKKA 4Z94A 1ASWA 3LDPA 4H0YB 3V1QA 3TABA 5C15A 1M90O 1U2VA 1XI1A 5FPMA 4CJEA 3THYB 1X1PA 1ZC6A 2QWOA 1SL0A 4B9VA 3TSPA 1HNZK 2WFBA 4CF8A 1MWKA 2G8IA 3CG7A 5F0XA 4IDKA 1E3MA 3E9PA 3T7ZA 1TK8A 3NHGA 3GL1A 3D2FA 3QFPA 4IDHA 5BRDA 3GG4A 3U3GA 4U67L 1KTQA 1QTMA 4FM1A 2UUCK 3L4IA 3WNFA 3HM9A 5TKWA 4CGIA 3M6GA 2QXLA 2XHBA 4FWRA 1FK9A 4PA1A 3RWUA 4WFBL 3D0PA 1HPMA 5BR8K 4RWTA 2HNDA 4DV4K 3OBYA 4XIUA 4FLVA 1VSJA 5GINA 4JRQA 4FJLA 3C65A 1I39A 1OH5A 1A5WA 3VQ8A 1RBVA 1BG3A 4KFBA 4EIAA 2HBKA 4ISFA 1VQLN 4BR2A 4DSFA 1BQMA 1MA9B 2FF6A 1SQKA 3HL8A 2A6AA 4HUGA 4MQ3A 2HHHK 1NK0A 4CJ4A 4BC3A 4GKJK 4O0IA 3IKMA 5GIPA 4H0VB 3IDHA 3LP2A 1ITGA 4BE0A 5BPNA 2G8KA 3WEEA 2ZJQL 2GUPA 4KBOA 4W5OA 1W7AA 4CJTA 3BY5A 1QQNA 1EQYA 4FWNA 4KI4A 3KD1E 4E7IA 1VSLA 3U9DA 4FJGA 4BC5A 3K0SA 4N56A 3SQ0A 2V51B 5AQPA 1QS4A 1HJRA 3H45C 1T6DA 2KW4A 2OZMA 4DFJA 1HNXK 1HQEA 1KVCA 1JXBA 4FJ7A 4QS8A 5CHIA 2IOCA 4DG1A 1C1CA 2YHAA 3SMPA 4YOVA 3SLCA 1UA1A 4W5TA 3HK2A 4CEQA 3J7AP 2GEMA 4DQQA 1B9DA 3O6WA 3PY8A 4ELUA 3AVHA 2DPNA 3RRGA 5KTQA 4JKFA 3HM8A 3CC2N 1WNSA 3GE1A 5KPTA 1VSMA 4JKGB 2Q31A 3ZSWA 1FW6A 3E9LA 4XH4A 3RSEA 1TAUA 4DTSA 4QS9A 3AV9A 1ZBHA 3PX6A 1YI2N 2RF2A 4DQ8A 2IVPA 4BRPA 1N34K 1U4BA 1VQPN 3J8AA 5AQWA 2Q0RA 4YORA 3VF4A 4BG8A 4F4KA 3UKUA 2HNZA 3VESA 3LM2A 4JK7A 1OKJA 4DR2K 1WSEA 3KVGA 3SBTA 3C0BA 4CJLA 4E1NA 1KAXA 2W6LA 4I2PA 1S22A 3TWHA 3THVA 3E9OA 5JVHL 1TKXA 1L3UA 3U6FA 3V81A 1LW0A 3ZT2A 5DM6L 2YV0X 1YAGA 3THWB 5F1XA 4LY7A 2YKNA 1NG9A 4JI1K 1TGOA 2PAVA 4BGBA 1SUQA 5JICA 1HLUA 3CJAA 3WQUA 1OH8A 4CF1A 3PIPL 1TKDA 3D2EA 4CBXA 2WUSA 4H0TB 4CEOA 2OYQA 1CLQA 2QWRA 3TTFA 3VEZA 2B6AA 3I56N 3WNGA 4CGGA 3S3OA 4H0PA 2FBVA 1KXPA 4OGCA 2P9UA 1HKGA 1LAWA 5C0YA 4BC2A 4B1XB 3VQAA 1YHQN 3TSQA 4OLAA 4HVJA 3IRXA 2R7YA 1TYQB 4ILGB 4CK1A 3MEGA 4DQSA 4LF9K 3VQQA 5FPDA 3HSTB 1S6QA 3SUNA 5AZIA 3MWPA 3O4NA 3A2FA 5BPLA 3C6TA 1GOBA 3DLGA 1C0UA 1NMDA 3HI0A 2NZTA 3FFKB 5AQLA 1TKTA 5M1NA 3J81O 4FJIA 1XC9A 3BUZB 1NK6A 2X6NA 2O8DA 4B9SA 4IFYA 4IZ9A 2PBDA 4PUOA 3O9RA 3FZKA 1WB9A 1SL1A 4Z4GA 1RILA 3RR7A 3SUPA 3VERA 4OKJA 4FJHA 2ASPA 2ASOA 2X6SA 1YTUA 5M1KA 4CEZA 1RT1A 4BR4A 4DCHA 3QIOA 3ULEA 1Q82O 3CJ9A 2OTLN 3VEXA 4BREA 4CEBA 1IKXA 2YJFA 4JKCA 1S1TA 4H0OA 3DXKB 1WLJA 3MXIA 4FW1A 2VG7A 3P1GA 3AA2A 4BY9C 4CK3A 1U49A 4M7YA 4BROA 2WC9A 3DLEA 3L2WA 5J2PA 4NXMK 4WQ5A 4OLBA 4RW8A 2HOEA 3AVMA 1REVA 3B8AX 5C10A 3W0LA 3M8RA 4JNEA 4ISGA 3VQEA 4TSXA 4KHUA 3PSIA 3K5NA 4BRCA 4EHTA 4K42A 2VG5A 1VRUA 4YFUA 1J6ZA 2P9PB 2W42A 1HQUA 4FLTA 3GDQA 4BRLA 3EY1A 1MWMA 3T1HK 4JK8A 2KZZA 3C6HA 4DQRA 3OS0A 3TAQA 1WSIA 3H3OB 4CF9A 4OX9K 4CE9A 2F4VK 2GUIA 2BGGA 1C0GA 4WF9L 2GTDA 4YDUC 4AHSA 5EXWA 3VQDA 1YITN 4ILHA 3EL2A 2P1JA 3VETA 1P90A 1RDAA 2HBMA 3AVGA 1QHTA 2ZGZA 3N4PA 3OYCA 3RMAA 3VTIA 1YIJN 4CJ5A 3L3UA 2NNWA 3BGRA 2DY4A 2Y1JA 3TAEA 1T44A 4FWPA 2VWKA 3LDOA 1GLBG 3QERA 4K25A 2P9LA 2QKBA 1YT3A 5SWMA 3P38A 3FZFA 3T1YK 1V4TA 4BC4A 3SMSA 4CJQA 3HPOA 3R6MA 2BTFA 2O8FB 3G25A 4DV0K 2OCEA 1BWFO 3WT0A 3MEDA 4K43A 5FPNA 4ZHRA 2GX9A 2E6MA 3HVTA 4Z4FA 4MLHA 3KWGA 3EZWA 1GLFO 4DR5K 2IDOA 4QAGA 3QIPA 3CFOA 3OYLA 2W41A 4LFBK 1GOCA 1XUPO 4I9LA 5T7BA 3PO4A 4FJ8A 3C6AA 3KLIA 4DR3K 3UKRA 3OYKA 3N4QA 2QWQA 2WBNA 4FWLA 2Z1IA 4FO0A 3KLHA 2RHKA 1VQ7N 1IO2A 2FF3B 3A5NC 3LP0A 5D3GA 4JKHA 4KHPK 2E1YA 4EP5A 3TR8A 4IO9L 3SV4A 3CJ1A 3MN5A 4PL7A 2VQFK 3W3DA 1ZBUA 2HF3A 3HVRA 3MMVA 3TPQA 3VGLA 3NFAA 3MAQA 4FJJA 4JKEA 3VTHA 1WAJA 1WSJA 1VRTA 4NXNK 3ITHA 3SQ4A 1NGJA 2NRZA 3SPYA 3J7ZO 1D9DA 3AAPA 4CZMA 4LC9B 4H8KA 1U45A 3C6UA 4LF7K 1C0MA 1TUYA 1TV6A 2ZD1A 3R1XA 1BO5O 1U6ZA 2P9SB 3OHRA 3VQPA 3VEVA 1E4GT 2CGJA 3PSFA 4B9MA 4O44A 1YJNN 2P5OA 3AO2A 5SZTA 3QEWA 4MFBA 3S3NA 1GLLO 2I7NA 3K9KA 3OYFA 1Q86O 1WBDA 1BU6O 4CJ3A 3GBTA 3ULDA 5C25A 2HSTA 3MX2A 1D5AA 1YJ9N 3AARA 4O8KA 3I33A 2F7TA 4A62A 3DOKA 3THXB 2E5LK 3A0IX 4ILJA 1YF5L 5AQMA 2ZF5O 1S3XA 1NGIA 4EZ6A 2D0PA 3K9JA 3L2QA 4HUFA 3E1YA 4HCBA 3O4QA 3FZMA 4KB0A 3DRRA 4JKGA 4JK9A 4RW7A 4ELTA 4YNQA 4ZTFA 3ZEUA 4Z0UA 3CM6A 1L3SA 2ZWHA 5AQGA 1NWKA 5LJWA 2IC3A 1Q9XA 3HO1A 4ID5A 3VN5A 1NJZA 3K2PA 3NGYA 4DSLA 3E01A 1BA0A 4R79A 3LPUA 1VSEA 3L8BA 3ZCMA 2BE2A 4H5NA 2A40A 4BRDA 4JI8K 3BF1A 3CERA 3CXCM 2QA4N 1BISA 2OPPA 3DXMB 1JL1A 1OVQA 1XHZA 1BL3A 3R9PA 3TANA 3NF9A 3O5BA 2OANA 1L3VA 1K8KB 3ZSXA 3MK6A 1JCGA 1W9HA 4CEDA 2IAJA 1RT7A 2A3ZA 1OVYA 3QICA 3R3LA 1S1VA 3Q7CA 3F5TA 1N6QA 1YUWA 3ENHA 4PY5A 3DI6A 3OYJA 4B3TK 1D8YA 3QFUA 4CGFA 2WTUA 3FLCO 4ID1A 3THWA 1Z05A 1J5EK 4FWKA 5H1SQ 2BUPA 3NBPA 3I8DA 1SKRA 3ATUA 1BI4B 2IIRA 1ZYQA 1KCFA 2F96A 4M45A 3O08A 2WONA 2FSJA 2P51A 3LAKA 2KKZA 1RTIA 1Z25A 4DU4A 4B9TA 3CETA 1HX1A 2I7PA 2QEXN 3O9SA 2AA4A 4M3WA 2D0CA 5KI6A 4BRKA 1CZBA 4CJFA 3K57A 1C1AA 2NRHA 4E7LA 3B6OA 3V9WA 3T69A 4I6MA 4CI6A 2YHYA 3FZHA 4FZXC 2P9NB 3MN9A 4E19A 1XHXA 4YHHK 4XH1A 2LSNA 1NGGA 3F73A 5GADP 1TVRA 1W0HA 1HRHA 4IOAL 5KQ8A 3CCSN 3L2RA 1OH7A 5AQVA 1T6CA 3SJJA 3U4LA 5AQUA 4N76A 3QO9A 5HL7L 3GOIA 5J1EA 2YNIA 1G15A 3SBGA 4JI0K 1JLBA 4CFCA 3ZSVA 4ELVA 2O8BB 2P9IB 3ZX2A 3HP9A 2A1RA 3AO5A 4LH4A 2ZGYA 2E2PA 3OVNA 1NJIO 4B8CA 2P5GA 1VSFA 3LM9A 3A8YA 1LWFA 2HBJA 1NJYA 3CD6N 4FJMA 1QQMA 3WQTA 4B1VA 3IG1A 4BRAA 1TK5A 4Z4HA 3OS1A 4JI4K 2FXUA 5AQTA 1BDGA 1L3TA 4DR1K 4DS5A 4KV8A 2ATQA 2ITMA 5AQIA 5AZJA 2E4LA 1VSIA 5AFUH 3QEPA 3EE9A 3VQ4A 3LANA 4FCYA 4PQUA 2HF4A 4DR7K 3ZT1A 2EHGA 1TL3A 3TARA 3ZX0A 3L4QA 3DLBA 4A61A 2VWBA 5DK5A 3CFRA 4FK4A 2HHVA 3HBTA 5K14A 4WQ4A 3KHYA 3DOLA 3EKSA 2P9PA 2KLAA 2OPSA 4GMJB 2PZSA 1XNQK 5CYQA 4B8AB 1T8EA 2O4IA 1Z6RA 2KQ2A 1ILYA 4LF8K 4IO8A 3ZSRA 3KLGA 1KFSA 2D5RA 3HT3A 2FLOA 5FRMA 5E84A 4CF2A 3H1QA 4E7HA 1KAZA 4CZEA 5LMUK 2P9KA 4FL9A 1RDBA 4CZLA 4FLXA 1ATRA 2E20A 3D45A 3NH0A 4CFBA 2QWPA 1RBSA 3AAQA 2UXBK 1YVNA 2OPQA 4AH9A 5AQZA 5JMVA 3CCVN 4DTMA 1NK5A 3G4SN 1J53A 1NBWA 2XO7A 4B1WB 1BOTO 3NE6A 4JI2K 3O8MA 4EFHA 4H5RA 3IAYA 4RW6A 4Y1DA 3A5OC
chains in the Genus database with same CATH topology
3V9XA 1RDDA 4OLBA 4RW8A 4IG3A 3LWLA 4B3OA 3AVMA 1MU2A 1REVA 5HLFA 1N5YA 3RMDA 3NAEA 2KZMA 4CHNA 3M8RA 2B5JA 1F21A 4FW2A 4KRFA 3VQEA 4TSXA 4KHUA 2I5JA 3K5NA 1RTDA 2D0AA 4BE1A 2HHUA 2VG5A 3WNEA 4QCLA 1VRUA 4OJRA 3SI6A 4YFUA 3I0RA 2O4GA 3G0ZA 4E3SA 2W42A 1HQUA 3FFIA 4CGHA 3KLFA 4CHYA 4FLTA 4M3UA 2DFHA 3QLHA 1T03A 3SV3A 4E89A 1BIUA 4CIGA 1JLFA 4FYDA 3EY1A 1RT4A 3V9ZA 2BDPA 2KZZA 4KHQA 4DQRA 3OS0A 2PYJA 1RBRA 1KSPA 3TAQA 1WSIA 3M8QA 4ZTJA 1C0TA 1NK8A 4CF9A 1RTJA 1RNHA 4CE9A 3NGZA 3NGIA 1U47A 1VK0A 2GUIA 2JLEA 3TAGA 1RBUA 2BGGA 4CEEA 4AHCA 4B9UA 4C8NA 1EP4A 3V4IA 1SKSA 3VQCA 4CF0A 3OYMA 4AHSA 4DU3A 4LSNA 3WNHA 3QESA 1CZ9A 3ZT4A 4E7JA 1Q9YA 1WAFA 3VQDA 4EP4A 3ALYA 3RRHA 2P1JA 1RDAA 3NF6A 1DTTA 1X9MA 1TK0A 3AVGA 1QHTA 3OYCA 4BACA 3KKRA 4CEAA 3AVCA 3VA0A 3RMAA 4J2DA 1EETA 3RMCA 4CJ5A 5JS1A 4HUEA 2HMIA 2RN2A 3L3UA 3LDSA 3P5JA 3ZT0A 3BGRA 4CJRA 1HNIA 2DY4A 2GBZA 4DS4A 4DSIA 2D0BA 2Y1JA 3TAPA 3KTQA 4KPYA 3OYNA 2IGIA 1BQNA 3TAEA 5CZ2A 2Q3SA 2VWKA 4M3ZA 3QERA 2RKIA 4CHPA 3ASMA 4NYNA 4E1MA 1ZBIA 4KB1A 2QKBA 1YT3A 5SWMA 3F9KA 3VQ6A 1TL1A 2YNFA 1ZBLA 4J2AA 2A1SA 4FXDA 4RW9A 1JLCA 3B6PA 4B08A 4CJVA 4H4OA 4CJQA 3LP1A 3HPOA 4C8MA 4Q0BA 4DQIA 1NK4A 5CY4A 3I0SA 4UQGA 1QSYA 4DMNA 1BHLA 1IKWA 1A5XA 2ITGA 1BCOA 2WOMA 3MEDA 2XY5A 4FK2A 2HVIA 1RTHA 2OA8A 1NKBA 1WSGA 4KKOA 4F3TA 4ZHRA 3PX0A 1UA0A 2E6MA 3HVTA 4Y1CA 4DTNA 4CJKA 4FVMA 1LV5A 4Z4FA 1WN7A 3ISNC 3DRSA 3M8PA 4CJUA 2YHBA 3MXIA 2XY8A 1U04A 3RMBA 5EU7A 2IDOA 4QAGA 1JLGA 1VSDA 3QIPA 5FDLA 4HCCA 4JS5A 4FJ9A 1J5OA 3EYZA 2B4JA 1C1BA 3CFOA 3OYLA 4OGEA 1GOCA 4I9LA 5T7BA 4NCGA 4RG8A 2YNHA 4CEFA 4KO0A 3PO4A 2F8TA 3AO4A 2DTUA 4FJ8A 4Q5VA 2YKMA 1U48A 1X9WA 4OPKA 3KLIA 4R5PA 3NH1A 1CXQA 2IS3A 3OYKA 3L3VA 1S1XA 3AVIA 4I2QA 3K58A 4FK0A 3SUOA 3AVBA 1IH7A 2Z1IA 4ICLA 3KLHA 3V6DA 1IO2A 3OY9A 3M8SA 4J2EA 1IKVA 3LP0A 2G8HA 5D3GA 1RT5A 3P83D 4EP5A 3DMJA 3NDKA 3CFPA 3TR8A 4KREA 1FKPA 3SV4A 4KI6A 3OJUA 1JXEA 1NOZA 1ZBUA 4DWIA 3KK2A 3EZ5A 5HBMA 4C8KA 5KRSA 3HVRA 4CK2A 3K59A 1J54A 3KKSA 3LWMA 3NFAA 3MAQA 4DFPA 2Z1JA 1R0AA 4FJJA 2QXFA 4M41A 2XRIA 3T1AA 2HHWA 3K5OA 4O0JA 1WAJA 1WSJA 1VRTA 3AVKA 3OYBA 4JLHA 3VQ5A 4BE2A 3S3MA 3ITHA 2NUBA 2HNYA 3SQ4A 3SUQA 3PX4A 4CCHA 3SPYA 4OKKA 1ASWA 1IKYA 4DF4A 1D9DA 3LZJA 4DTXA 3KK3A 4BDYA 4FM2A 2FBYA 2OZSA 2FBTA 3V1OA 3V1QA 4DTPA 3TABA 1QSSA 3BDPA 4B9NA 4H8KA 4HHTA 1U45A 3V9UA 3MEEA 1XI1A 3C6UA 1C0MA 1LWEA 1TV6A 3CQ8A 2ZD1A 2BANA 2HHQA 4KTZA 4CJEA 3QEXA 3DLKA 1X1PA 4FLWA 1SL0A 1XWLA 4B9VA 5DMRA 3VQPA 1JKHA 1DTQA 4IFVA 4DTJA 4FLUA 4CF8A 1HYZA 2G8IA 3CG7A 1L5UA 4B9MA 4O44A 4DLEA 1RCHA 2P5OA 4DSKA 4Z4CA 4NCBA 3AO2A 1FKOA 5SZTA 4IDKA 3DYAA 3QEWA 4MFBA 3S3NA 3AO1A 3NHGA 1TK8A 2KFZA 3PV8A 1JLAA 4N41A 3ZSQA 3O3GA 3U3GA 3OYFA 1BGXT 1KTQA 1UWBA 3LPTA 4CJ3A 1NOYA 4DFKA 1QTMA 4DTOA 3SQ2A 4DTRA 2QK9A 3AA3A 3ULDA 4FM1A 4FJNA 1KFDA 4KHSA 3WNFA 5C25A 5KGXA 3HM9A 4KHNA 4CGIA 2XHBA 1D5AA 4CHOA 1FK9A 1KRPA 4PA1A 3SPZA 3RWUA 3D0PA 4KAZA 1BI4A 1NK7A 3OJSA 4EZ9A 1WSFA 4L8RB 2HNDA 1O1WA 3DOKA 4KHWA 3SZ2A 4XIUA 4FLVA 1VSJA 1YTAA 4CHQA 4JRQA 4FJLA 4EZ6A 1I39A 1A5WA 3VQ8A 3AA4A 1RBVA 3MXJA 3L2QA 4JRPA 3K5MA 1EKEA 4HUFA 5CZ1A 2KFNA 4HCBA 4KFBA 1LWCA 3O4QA 1S9EA 2Z1HA 4KB0A 3DRRA 4F2SA 2HVHA 1JL2A 4O5BA 4RW7A 4ELTA 4YNQA 4ZTFA 1NJWA 5J2QA 5C24A 4FLZA 4Z0UA 3CM6A 4DSFA 1L3SA 3OS2A 1BQMA 1WSHA 3SNNA 4OKEA 2IC3A 4FLYA 1Q9XA 3HO1A 4ID5A 3VN5A 3HL8A 5FROA 1NJZA 3HP6A 4OVLA 3K2PA 3NGYA 4MQ3A 5CYMA 3TAMA 4CJ4A 4HUGA 3QINA 1NK0A 1RT6A 4DSLA 1HYSA 4W5QA 2HB5A 4O0IA 1HPZA 1HMVA 3MECA 3E01A 4OPJA 4AILC 2X78A 2G8UA 1S1WA 2KTQA 1TAQA 3LPUA 2FC0A 1VSEA 4IKFA 3L8BA 4KTQA 3ZCMA 2BE2A 3LP2A 4AHTA 1ITGA 4BE0A 4G1QA 2G8KA 1S1UA 1CXUA 3SQ1A 1YVUA 1SKWA 1EX4A 3ZSOA 4W5OA 4CJTA 3QNNA 5HROA 2XY6A 1BISA 2OPPA 1QQCA 1JL1A 1ASVA 4KI4A 1XHZA 4K8ZA 1RDCA 1BL3A 2FBXA 3TANA 2G8FA 3PO5A 3NF9A 3KD5E 4N47A 4E7IA 3KD1E 4AHRA 1VSLA 4M3XA 2HHTA 4IG0A 4CESA 4FJGA 3SQ0A 4N56A 2E6LA 1T7PA 1L3VA 2DFEA 3ZSXA 2XY7A 1QS4A 1W9HA 4CEDA 1HJRA 1IG9A 2IAJA 3IS9A 1RT7A 2KW4A 2OZMA 5KGWA 1S1VA 4DFJA 3T19A 3SYZA 1N6QA 3K5LA 1HQEA 4PY5A 1SV5A 3DI6A 3OYJA 1KVCA 3O3FA 3H08A 5JS2A 4FM0A 1JXBA 1D8YA 3NF8A 4CGFA 4FJ7A 3AA5X 4ID1A 4CECA 3OYIA 2ZQBA 5J2MA 3VQ9A 3ZSYA 1B92A 3NBPA 2IOCA 3PUFA 1C1CA 4DG1A 3I8DA 3L2VA 1BI4B 2YHAA 1SKRA 3NF7A 1UA1A 5HRPA 1C6VA 4W5TA 3HK2A 4CEQA 1KCFA 2F96A 4M45A 1ZYQA 4NCAA 2WONA 3VQBA 3KIOA 4DQQA 1B9DA 3OYAA 3SCXA 2P51A 3PY8A 4ELUA 1KVAA 3AVHA 3LAKA 1RTIA 1Z25A 5KTQA 4DU4A 3KK1A 3RRGA 3QEVA 5HRSA 4B9TA 3ZT3A 2PYLA 1WNSA 2DFFA 2EX3A 3L2UA 3DLRA 4C8LA 3ZSZA 1JLEA 4CFDA 1VSMA 3HXMA 4E7KA 3ZSWA 4CJSA 4M3WA 2D0CA 5KI6A 1CZBA 4DTSA 4CJFA 1TAUA 3K57A 1C1AA 3DM2A 1T05A 3RR8A 4DSJA 5C42A 4E7LA 3B6OA 3AV9A 4BWMA 4M3RA 2YNGA 3VA3A 2Y1IA 4KHYA 1ZBHA 3OYDA 1RT2A 3CM5A 3V9WA 4I9QA 3PX6A 2RF2A 1LAVA 3AVFA 4E0DA 4FZXC 4LD0A 1U4BA 4E19A 3TI0A 1XHXA 4CGJA 4IBNA 4LH5A 2LSNA 2AJQA 4CIFA 3AVNA 3F73A 2ETJA 4F2RA 1TVRA 3C95A 3U3YA 1W0HA 1HRHA 1KVBA 3CYMA 4C8OA 1K6YA 1BCMA 4F4KA 3L2RA 2HNZA 2JGUA 1Z26A 4CIEA 4CJPA 3SJJA 1WSEA 4Z4IA 4N76A 4M3TA 3QO9A 3LZIA 4FJXA 3AVAA 4O4GA 5J1EA 4B9LA 1HYVA 1G15A 2YNIA 4GW6A 3JYTA 2X74A 4CJLA 4E1NA 1JLBA 4CFCA 3ZSVA 4BDPA 4ELVA 4DFMA 4I2PA 3OYHA 3TWHA 3HP9A 4WE1A 1BIZA 5HRRA 3THVA 2A1RA 1TKXA 3AO5A 4LH4A 4BDZA 1L3UA 4F8RA 3U6FA 4DQPA 1VSKA 3OVNA 3V81A 4B8CA 4I7FA 1LW0A 1VSFA 3ZT2A 2P5GA 4JS4A 1HNVA 1LWFA 1Q8IA 1S5JA 4CERA 5J2NA 1NJYA 1A5VA 2YV0X 4FZZA 3DLHA 4FJMA 4W5RA 2HW3A 3IG1A 1TK5A 1NKEA 4H4MA 4Z4HA 1B9FA 2YKNA 1RT3A 4LY7A 3OS1A 4DTUA 1L3TA 3LP3A 4DS5A 4KV8A 3AVJA 3C94A 4PWDA 2PY5A 1TGOA 1TKZA 2ATQA 4QOZB 1SUQA 2G8WA 2E4LA 2HHXA 1VSIA 3V1RA 4J2BA 5FRNA 3MXMA 4CF1A 1DLOA 1TKDA 4CFAA 3QEPA 2ZE2A 1Y97A 4CEOA 2OYQA 1EXQA 3VQ4A 3LANA 1CLQA 1LW2A 4FCYA 4PQUA 5KRTA 2OPRA 1NK9A 2B6AA 3ZT1A 2EHGA 1TL3A 3WNGA 3TARA 3S9HA 4CGGA 3S3OA 3RTVA 3QEIA 1I3AA 1VSHA 4FJKA 2FBVA 3DLBA 4OGCA 2RPIA 5DK5A 4M42A 3CFRA 4DU1A 1LAWA 4Z4EA 4FK4A 2HHVA 3NCIA 4NYFA 3VQAA 5HRNA 5K14A 3OYEA 1NKCA 1SL2A 2GV9A 4OLAA 3DOLA 1GOAA 3IRXA 4HVJA 4GMJB 2OPSA 2R7YA 3V9SA 4CK1A 3MEGA 4DQSA 5I42A 2PZSA 4W5NA 1D9FA 3VQQA 5HP1A 3HJFA 3HSTB 5CYQA 1S6QA 4B8AB 1T8EA 3SUNA 1KLMA 4KTWA 2O4IA 1S9GA 2KQ2A 1KLNA 4DLGA 3O4NA 1S6PA 3KLEA 1JLQA 3A2FA 3AO3A 3HYFA 3C6TA 1GOBA 1UOCA 3DLGA 1C0UA 3LALA 3ZSRA 3OYGA 3KLGA 1KFSA 1QSLA 1TKTA 2D5RA 2G8VA 4FJ5A 4GVMA 4FJIA 3HT3A 3QETA 1XC9A 4BWJA 4CJWA 1NK6A 2X6NA 3VQ7A 1FXXA 4B9SA 2HHSA 3LAMA 3HPGA 4IFYA 4RW4A 2VWJA 5FRMA 4PUOA 4CF2A 4E7HA 2Z1GA 1SL1A 4Z4GA 4HTUA 3NH2A 1RILA 1ASUA 3G10A 3RR7A 3SUPA 1RDBA 4OKJA 4FZYA 3DRPA 4FJHA 3O3HA 2X6SA 4FLXA 1YTUA 4K8XA 3UIQA 4CEZA 3D45A 1RT1A 4F3OA 4N5SA 3NH0A 3QNOA 4CFBA 2F8SA 5E41A 1RBSA 1QE1A 3QIOA 1J9AA 4CGDA 2OPQA 5I3UA 4AH9A 1NJXA 3TAFA 4AHVA 4CEBA 1IKXA 3KJVA 3T3FA 3JSMA 1S1TA 4DSEA 4CHZA 4DTMA 1ZBFA 1NK5A 4M3YA 1WLJA 2VG6A 4FW1A 4AHUA 1J53A 2VG7A 3AA2A 3P1GA 2XO7A 4LSLA 2QKKA 3HPHA 4CK3A 3NE6A 1X9SA 1U49A 1UAXA 4DF8A 1RBTA 4O55A 3AVLA 3L2WA 3DLEA 5J2PA 4RW6A 3IAYA 4Y1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V9X A;  1RDD A;  4OLB A;  4RW8 A;  4IG3 A;  3LWL A;  4B3O A;  3AVM A;  1MU2 A;  1REV A;  5HLF A;  1N5Y A;  3RMD A;  3NAE A;  2KZM A;  4CHN A;  3M8R A;  2B5J A;  1F21 A;  4FW2 A;  4KRF A;  3VQE A;  4TSX A;  4KHU A;  2I5J A;  3K5N A;  1RTD A;  2D0A A;  4BE1 A;  2HHU A;  2VG5 A;  3WNE A;  4QCL A;  1VRU A;  4OJR A;  3SI6 A;  4YFU A;  3I0R A;  2O4G A;  3G0Z A;  4E3S A;  2W42 A;  1HQU A;  3FFI A;  4CGH A;  3KLF A;  4CHY A;  4FLT A;  4M3U A;  2DFH A;  3QLH A;  1T03 A;  3SV3 A;  4E89 A;  1BIU A;  4CIG A;  1JLF A;  4FYD A;  3EY1 A;  1RT4 A;  3V9Z A;  2BDP A;  2KZZ A;  4KHQ A;  4DQR A;  3OS0 A;  2PYJ A;  1RBR A;  1KSP A;  3TAQ A;  1WSI A;  3M8Q A;  4ZTJ A;  1C0T A;  1NK8 A;  4CF9 A;  1RTJ A;  1RNH A;  4CE9 A;  3NGZ A;  3NGI A;  1U47 A;  1VK0 A;  2GUI A;  2JLE A;  3TAG A;  1RBU A;  2BGG A;  4CEE A;  4AHC A;  4B9U A;  4C8N A;  1EP4 A;  3V4I A;  1SKS A;  3VQC A;  4CF0 A;  3OYM A;  4AHS A;  4DU3 A;  4LSN A;  3WNH A;  3QES A;  1CZ9 A;  3ZT4 A;  4E7J A;  1Q9Y A;  1WAF A;  3VQD A;  4EP4 A;  3ALY A;  3RRH A;  2P1J A;  1RDA A;  3NF6 A;  1DTT A;  1X9M A;  1TK0 A;  3AVG A;  1QHT A;  3OYC A;  4BAC A;  3KKR A;  4CEA A;  3AVC A;  3VA0 A;  3RMA A;  4J2D A;  1EET A;  3RMC A;  4CJ5 A;  5JS1 A;  4HUE A;  2HMI A;  2RN2 A;  3L3U A;  3LDS A;  3P5J A;  3ZT0 A;  3BGR A;  4CJR A;  1HNI A;  2DY4 A;  2GBZ A;  4DS4 A;  4DSI A;  2D0B A;  2Y1J A;  3TAP A;  3KTQ A;  4KPY A;  3OYN A;  2IGI A;  1BQN A;  3TAE A;  5CZ2 A;  2Q3S A;  2VWK A;  4M3Z A;  3QER A;  2RKI A;  4CHP A;  3ASM A;  4NYN A;  4E1M A;  1ZBI A;  4KB1 A;  2QKB A;  1YT3 A;  5SWM A;  3F9K A;  3VQ6 A;  1TL1 A;  2YNF A;  1ZBL A;  4J2A A;  2A1S A;  4FXD A;  4RW9 A;  1JLC A;  3B6P A;  4B08 A;  4CJV A;  4H4O A;  4CJQ A;  3LP1 A;  3HPO A;  4C8M A;  4Q0B A;  4DQI A;  1NK4 A;  5CY4 A;  3I0S A;  4UQG A;  1QSY A;  4DMN A;  1BHL A;  1IKW A;  1A5X A;  2ITG A;  1BCO A;  2WOM A;  3MED A;  2XY5 A;  4FK2 A;  2HVI A;  1RTH A;  2OA8 A;  1NKB A;  1WSG A;  4KKO A;  4F3T A;  4ZHR A;  3PX0 A;  1UA0 A;  2E6M A;  3HVT A;  4Y1C A;  4DTN A;  4CJK A;  4FVM A;  1LV5 A;  4Z4F A;  1WN7 A;  3ISN C;  3DRS A;  3M8P A;  4CJU A;  2YHB A;  3MXI A;  2XY8 A;  1U04 A;  3RMB A;  5EU7 A;  2IDO A;  4QAG A;  1JLG A;  1VSD A;  3QIP A;  5FDL A;  4HCC A;  4JS5 A;  4FJ9 A;  1J5O A;  3EYZ A;  2B4J A;  1C1B A;  3CFO A;  3OYL A;  4OGE A;  1GOC A;  4I9L A;  5T7B A;  4NCG A;  4RG8 A;  2YNH A;  4CEF A;  4KO0 A;  3PO4 A;  2F8T A;  3AO4 A;  2DTU A;  4FJ8 A;  4Q5V A;  2YKM A;  1U48 A;  1X9W A;  4OPK A;  3KLI A;  4R5P A;  3NH1 A;  1CXQ A;  2IS3 A;  3OYK A;  3L3V A;  1S1X A;  3AVI A;  4I2Q A;  3K58 A;  4FK0 A;  3SUO A;  3AVB A;  1IH7 A;  2Z1I A;  4ICL A;  3KLH A;  3V6D A;  1IO2 A;  3OY9 A;  3M8S A;  4J2E A;  1IKV A;  3LP0 A;  2G8H A;  5D3G A;  1RT5 A;  3P83 D;  4EP5 A;  3DMJ A;  3NDK A;  3CFP A;  3TR8 A;  4KRE A;  1FKP A;  3SV4 A;  4KI6 A;  3OJU A;  1JXE A;  1NOZ A;  1ZBU A;  4DWI A;  3KK2 A;  3EZ5 A;  5HBM A;  4C8K A;  5KRS A;  3HVR A;  4CK2 A;  3K59 A;  1J54 A;  3KKS A;  3LWM A;  3NFA A;  3MAQ A;  4DFP A;  2Z1J A;  1R0A A;  4FJJ A;  2QXF A;  4M41 A;  2XRI A;  3T1A A;  2HHW A;  3K5O A;  4O0J A;  1WAJ A;  1WSJ A;  1VRT A;  3AVK A;  3OYB A;  4JLH A;  3VQ5 A;  4BE2 A;  3S3M A;  3ITH A;  2NUB A;  2HNY A;  3SQ4 A;  3SUQ A;  3PX4 A;  4CCH A;  3SPY A;  4OKK A;  1ASW A;  1IKY A;  4DF4 A;  1D9D A;  3LZJ A;  4DTX A;  3KK3 A;  4BDY A;  4FM2 A;  2FBY A;  2OZS A;  2FBT A;  3V1O A;  3V1Q A;  4DTP A;  3TAB A;  1QSS A;  3BDP A;  4B9N A;  4H8K A;  4HHT A;  1U45 A;  3V9U A;  3MEE A;  1XI1 A;  3C6U A;  1C0M A;  1LWE A;  1TV6 A;  3CQ8 A;  2ZD1 A;  2BAN A;  2HHQ A;  4KTZ A;  4CJE A;  3QEX A;  3DLK A;  1X1P A;  4FLW A;  1SL0 A;  1XWL A;  4B9V A;  5DMR A;  3VQP A;  1JKH A;  1DTQ A;  4IFV A;  4DTJ A;  4FLU A;  4CF8 A;  1HYZ A;  2G8I A;  3CG7 A;  1L5U A;  4B9M A;  4O44 A;  4DLE A;  1RCH A;  2P5O A;  4DSK A;  4Z4C A;  4NCB A;  3AO2 A;  1FKO A;  5SZT A;  4IDK A;  3DYA A;  3QEW A;  4MFB A;  3S3N A;  3AO1 A;  3NHG A;  1TK8 A;  2KFZ A;  3PV8 A;  1JLA A;  4N41 A;  3ZSQ A;  3O3G A;  3U3G A;  3OYF A;  1BGX T;  1KTQ A;  1UWB A;  3LPT A;  4CJ3 A;  1NOY A;  4DFK A;  1QTM A;  4DTO A;  3SQ2 A;  4DTR A;  2QK9 A;  3AA3 A;  3ULD A;  4FM1 A;  4FJN A;  1KFD A;  4KHS A;  3WNF A;  5C25 A;  5KGX A;  3HM9 A;  4KHN A;  4CGI A;  2XHB A;  1D5A A;  4CHO A;  1FK9 A;  1KRP A;  4PA1 A;  3SPZ A;  3RWU A;  3D0P A;  4KAZ A;  1BI4 A;  1NK7 A;  3OJS A;  4EZ9 A;  1WSF A;  4L8R B;  2HND A;  1O1W A;  3DOK A;  4KHW A;  3SZ2 A;  4XIU A;  4FLV A;  1VSJ A;  1YTA A;  4CHQ A;  4JRQ A;  4FJL A;  4EZ6 A;  1I39 A;  1A5W A;  3VQ8 A;  3AA4 A;  1RBV A;  3MXJ A;  3L2Q A;  4JRP A;  3K5M A;  1EKE A;  4HUF A;  5CZ1 A;  2KFN A;  4HCB A;  4KFB A;  1LWC A;  3O4Q A;  1S9E A;  2Z1H A;  4KB0 A;  3DRR A;  4F2S A;  2HVH A;  1JL2 A;  4O5B A;  4RW7 A;  4ELT A;  4YNQ A;  4ZTF A;  1NJW A;  5J2Q A;  5C24 A;  4FLZ A;  4Z0U A;  3CM6 A;  4DSF A;  1L3S A;  3OS2 A;  1BQM A;  1WSH A;  3SNN A;  4OKE A;  2IC3 A;  4FLY A;  1Q9X A;  3HO1 A;  4ID5 A;  3VN5 A;  3HL8 A;  5FRO A;  1NJZ A;  3HP6 A;  4OVL A;  3K2P A;  3NGY A;  4MQ3 A;  5CYM A;  3TAM A;  4CJ4 A;  4HUG A;  3QIN A;  1NK0 A;  1RT6 A;  4DSL A;  1HYS A;  4W5Q A;  2HB5 A;  4O0I A;  1HPZ A;  1HMV A;  3MEC A;  3E01 A;  4OPJ A;  4AIL C;  2X78 A;  2G8U A;  1S1W A;  2KTQ A;  1TAQ A;  3LPU A;  2FC0 A;  1VSE A;  4IKF A;  3L8B A;  4KTQ A;  3ZCM A;  2BE2 A;  3LP2 A;  4AHT A;  1ITG A;  4BE0 A;  4G1Q A;  2G8K A;  1S1U A;  1CXU A;  3SQ1 A;  1YVU A;  1SKW A;  1EX4 A;  3ZSO A;  4W5O A;  4CJT A;  3QNN A;  5HRO A;  2XY6 A;  1BIS A;  2OPP A;  1QQC A;  1JL1 A;  1ASV A;  4KI4 A;  1XHZ A;  4K8Z A;  1RDC A;  1BL3 A;  2FBX A;  3TAN A;  2G8F A;  3PO5 A;  3NF9 A;  3KD5 E;  4N47 A;  4E7I A;  3KD1 E;  4AHR A;  1VSL A;  4M3X A;  2HHT A;  4IG0 A;  4CES A;  4FJG A;  3SQ0 A;  4N56 A;  2E6L A;  1T7P A;  1L3V A;  2DFE A;  3ZSX A;  2XY7 A;  1QS4 A;  1W9H A;  4CED A;  1HJR A;  1IG9 A;  2IAJ A;  3IS9 A;  1RT7 A;  2KW4 A;  2OZM A;  5KGW A;  1S1V A;  4DFJ A;  3T19 A;  3SYZ A;  1N6Q A;  3K5L A;  1HQE A;  4PY5 A;  1SV5 A;  3DI6 A;  3OYJ A;  1KVC A;  3O3F A;  3H08 A;  5JS2 A;  4FM0 A;  1JXB A;  1D8Y A;  3NF8 A;  4CGF A;  4FJ7 A;  3AA5 X;  4ID1 A;  4CEC A;  3OYI A;  2ZQB A;  5J2M A;  3VQ9 A;  3ZSY A;  1B92 A;  3NBP A;  2IOC A;  3PUF A;  1C1C A;  4DG1 A;  3I8D A;  3L2V A;  1BI4 B;  2YHA A;  1SKR A;  3NF7 A;  1UA1 A;  5HRP A;  1C6V A;  4W5T A;  3HK2 A;  4CEQ A;  1KCF A;  2F96 A;  4M45 A;  1ZYQ A;  4NCA A;  2WON A;  3VQB A;  3KIO A;  4DQQ A;  1B9D A;  3OYA A;  3SCX A;  2P51 A;  3PY8 A;  4ELU A;  1KVA A;  3AVH A;  3LAK A;  1RTI A;  1Z25 A;  5KTQ A;  4DU4 A;  3KK1 A;  3RRG A;  3QEV A;  5HRS A;  4B9T A;  3ZT3 A;  2PYL A;  1WNS A;  2DFF A;  2EX3 A;  3L2U A;  3DLR A;  4C8L A;  3ZSZ A;  1JLE A;  4CFD A;  1VSM A;  3HXM A;  4E7K A;  3ZSW A;  4CJS A;  4M3W A;  2D0C A;  5KI6 A;  1CZB A;  4DTS A;  4CJF A;  1TAU A;  3K57 A;  1C1A A;  3DM2 A;  1T05 A;  3RR8 A;  4DSJ A;  5C42 A;  4E7L A;  3B6O A;  3AV9 A;  4BWM A;  4M3R A;  2YNG A;  3VA3 A;  2Y1I A;  4KHY A;  1ZBH A;  3OYD A;  1RT2 A;  3CM5 A;  3V9W A;  4I9Q A;  3PX6 A;  2RF2 A;  1LAV A;  3AVF A;  4E0D A;  4FZX C;  4LD0 A;  1U4B A;  4E19 A;  3TI0 A;  1XHX A;  4CGJ A;  4IBN A;  4LH5 A;  2LSN A;  2AJQ A;  4CIF A;  3AVN A;  3F73 A;  2ETJ A;  4F2R A;  1TVR A;  3C95 A;  3U3Y A;  1W0H A;  1HRH A;  1KVB A;  3CYM A;  4C8O A;  1K6Y A;  1BCM A;  4F4K A;  3L2R A;  2HNZ A;  2JGU A;  1Z26 A;  4CIE A;  4CJP A;  3SJJ A;  1WSE A;  4Z4I A;  4N76 A;  4M3T A;  3QO9 A;  3LZI A;  4FJX A;  3AVA A;  4O4G A;  5J1E A;  4B9L A;  1HYV A;  1G15 A;  2YNI A;  4GW6 A;  3JYT A;  2X74 A;  4CJL A;  4E1N A;  1JLB A;  4CFC A;  3ZSV A;  4BDP A;  4ELV A;  4DFM A;  4I2P A;  3OYH A;  3TWH A;  3HP9 A;  4WE1 A;  1BIZ A;  5HRR A;  3THV A;  2A1R A;  1TKX A;  3AO5 A;  4LH4 A;  4BDZ A;  1L3U A;  4F8R A;  3U6F A;  4DQP A;  1VSK A;  3OVN A;  3V81 A;  4B8C A;  4I7F A;  1LW0 A;  1VSF A;  3ZT2 A;  2P5G A;  4JS4 A;  1HNV A;  1LWF A;  1Q8I A;  1S5J A;  4CER A;  5J2N A;  1NJY A;  1A5V A;  2YV0 X;  4FZZ A;  3DLH A;  4FJM A;  4W5R A;  2HW3 A;  3IG1 A;  1TK5 A;  1NKE A;  4H4M A;  4Z4H A;  1B9F A;  2YKN A;  1RT3 A;  4LY7 A;  3OS1 A;  4DTU A;  1L3T A;  3LP3 A;  4DS5 A;  4KV8 A;  3AVJ A;  3C94 A;  4PWD A;  2PY5 A;  1TGO A;  1TKZ A;  2ATQ A;  4QOZ B;  1SUQ A;  2G8W A;  2E4L A;  2HHX A;  1VSI A;  3V1R A;  4J2B A;  5FRN A;  3MXM A;  4CF1 A;  1DLO A;  1TKD A;  4CFA A;  3QEP A;  2ZE2 A;  1Y97 A;  4CEO A;  2OYQ A;  1EXQ A;  3VQ4 A;  3LAN A;  1CLQ A;  1LW2 A;  4FCY A;  4PQU A;  5KRT A;  2OPR A;  1NK9 A;  2B6A A;  3ZT1 A;  2EHG A;  1TL3 A;  3WNG A;  3TAR A;  3S9H A;  4CGG A;  3S3O A;  3RTV A;  3QEI A;  1I3A A;  1VSH A;  4FJK A;  2FBV A;  3DLB A;  4OGC A;  2RPI A;  5DK5 A;  4M42 A;  3CFR A;  4DU1 A;  1LAW A;  4Z4E A;  4FK4 A;  2HHV A;  3NCI A;  4NYF A;  3VQA A;  5HRN A;  5K14 A;  3OYE A;  1NKC A;  1SL2 A;  2GV9 A;  4OLA A;  3DOL A;  1GOA A;  3IRX A;  4HVJ A;  4GMJ B;  2OPS A;  2R7Y A;  3V9S A;  4CK1 A;  3MEG A;  4DQS A;  5I42 A;  2PZS A;  4W5N A;  1D9F A;  3VQQ A;  5HP1 A;  3HJF A;  3HST B;  5CYQ A;  1S6Q A;  4B8A B;  1T8E A;  3SUN A;  1KLM A;  4KTW A;  2O4I A;  1S9G A;  2KQ2 A;  1KLN A;  4DLG A;  3O4N A;  1S6P A;  3KLE A;  1JLQ A;  3A2F A;  3AO3 A;  3HYF A;  3C6T A;  1GOB A;  1UOC A;  3DLG A;  1C0U A;  3LAL A;  3ZSR A;  3OYG A;  3KLG A;  1KFS A;  1QSL A;  1TKT A;  2D5R A;  2G8V A;  4FJ5 A;  4GVM A;  4FJI A;  3HT3 A;  3QET A;  1XC9 A;  4BWJ A;  4CJW A;  1NK6 A;  2X6N A;  3VQ7 A;  1FXX A;  4B9S A;  2HHS A;  3LAM A;  3HPG A;  4IFY A;  4RW4 A;  2VWJ A;  5FRM A;  4PUO A;  4CF2 A;  4E7H A;  2Z1G A;  1SL1 A;  4Z4G A;  4HTU A;  3NH2 A;  1RIL A;  1ASU A;  3G10 A;  3RR7 A;  3SUP A;  1RDB A;  4OKJ A;  4FZY A;  3DRP A;  4FJH A;  3O3H A;  2X6S A;  4FLX A;  1YTU A;  4K8X A;  3UIQ A;  4CEZ A;  3D45 A;  1RT1 A;  4F3O A;  4N5S A;  3NH0 A;  3QNO A;  4CFB A;  2F8S A;  5E41 A;  1RBS A;  1QE1 A;  3QIO A;  1J9A A;  4CGD A;  2OPQ A;  5I3U A;  4AH9 A;  1NJX A;  3TAF A;  4AHV A;  4CEB A;  1IKX A;  3KJV A;  3T3F A;  3JSM A;  1S1T A;  4DSE A;  4CHZ A;  4DTM A;  1ZBF A;  1NK5 A;  4M3Y A;  1WLJ A;  2VG6 A;  4FW1 A;  4AHU A;  1J53 A;  2VG7 A;  3AA2 A;  3P1G A;  2XO7 A;  4LSL A;  2QKK A;  3HPH A;  4CK3 A;  3NE6 A;  1X9S A;  1U49 A;  1UAX A;  4DF8 A;  1RBT A;  4O55 A;  3AVL A;  3L2W A;  3DLE A;  5J2P A;  4RW6 A;  3IAY A;  4Y1D A; 
#chains in the Genus database with same CATH topology
 1RDD A;  4IG3 A;  3U8X A;  4IOC L;  4B3O A;  1MU2 A;  3J7Y P;  5JLF A;  4KRF A;  2I5J A;  2GEL A;  4BE1 A;  2E2O A;  3I0R A;  1QHA A;  3FFI A;  4CGH A;  1LCU A;  4BRG A;  4CHY A;  1HKC A;  4BRF A;  1JLF A;  4KH6 A;  2A41 A;  3V9Z A;  5AQF A;  1SZ2 A;  1P8Z A;  1VQ4 N;  3Q7B A;  3M5R A;  1KSP A;  3M8Q A;  4ZTJ A;  1NK8 A;  1RNH A;  3NGZ A;  3ENO A;  1VK0 A;  2JLE A;  3CCQ N;  1XNR K;  1JCE A;  4B9U A;  4C8N A;  3HOS A;  1SKS A;  3VQC A;  3WNH A;  4A5A A;  3NF6 A;  4DR4 K;  3A5M C;  4AM7 A;  3KKR A;  4CEA A;  3AVC A;  3ZET B;  4MO4 A;  2O8E B;  1QVG M;  1NLV A;  5BRF A;  4CJR A;  1HNI A;  4FSV A;  4DSI A;  2D0B A;  4KPY A;  3OYN A;  4BQL A;  1BQN A;  3U9Z A;  5CZ2 A;  1HUX A;  2Q3S A;  2RKI A;  2E1Z A;  3WXK A;  3ASM A;  4NYN A;  4E1M A;  1NGE A;  3F9K A;  5M1F A;  1N36 K;  3H6E A;  2A1S A;  4J2A A;  4RW9 A;  1JLC A;  2IVN A;  2ZJP L;  1RGI A;  2CGL A;  3LP1 A;  3H1V X;  5AQS A;  4H5V A;  2P9S A;  4DV6 K;  1NK4 A;  3KWI A;  3D6R A;  5LL6 Z;  1QSY A;  4C1N I;  3VGK A;  4JHD B;  4DMN A;  1IKW A;  2HVI A;  2RE2 A;  4LFC K;  2NLX A;  4DUZ K;  3DLL L;  3ZX3 A;  2XY8 A;  5EU7 A;  4HCC A;  1JLG A;  4FJ9 A;  2KHO A;  2BH1 A;  4PKH A;  5TKY A;  4JI5 K;  3CJC A;  1DGK N;  4RG8 A;  3L0Q A;  5M1P A;  4DV3 K;  4L3Q A;  1X9W A;  3ID8 A;  3NH1 A;  4JD2 A;  2IS3 A;  4JKD A;  3THX A;  1S1X A;  3SUO A;  1IH7 A;  3V6D A;  3I55 N;  4J2E A;  1IKV A;  3P83 D;  3CFP A;  3DMJ A;  1C0F A;  4BG9 A;  1JXE A;  1NOZ A;  1SS6 A;  3EZ5 A;  1ESV A;  4DB3 A;  5KRS A;  4DUY K;  4NO7 A;  3LWM A;  3EEQ A;  3O9U A;  2Z1J A;  4DFP A;  1HR0 K;  2QXF A;  2XRI A;  2HHW A;  3K5O A;  2O8C B;  4O0J A;  3S3M A;  2NUB A;  3O1B A;  1IJJ A;  3SUQ A;  5AR0 A;  4DF4 A;  4BVO A;  4JI7 K;  1OH6 A;  3KK3 A;  4BDY A;  2FBY A;  2OZS A;  2FBT A;  3V1O A;  4DTP A;  3QBW A;  5EX5 A;  3MEE A;  4B3S K;  2ZJR L;  3VF2 A;  4IOX A;  1Q7Y O;  1HJO A;  4BRI A;  2BAN A;  2HHQ A;  3CME N;  3QEX A;  4JEP A;  1RDW X;  1IG8 A;  3SJH A;  2A5X A;  1XWL A;  5DMR A;  1XMQ K;  1DTQ A;  5AQK A;  1HYZ A;  1RCH A;  4DSK A;  1FKO A;  4HTL A;  4XH5 A;  4JI6 K;  3AO1 A;  3TSU A;  1JLA A;  3ZSQ A;  3O3G A;  3M3Z A;  1NGF A;  1BGX T;  2JWL A;  1UWB A;  1NOY A;  2E8A A;  4DFK A;  3SQ2 A;  2Q1N A;  2QK9 A;  1X9J A;  1KFD A;  4KHS A;  4KHN A;  4CHO A;  3AGR A;  3RVC A;  3JXU A;  4KAZ A;  1BI4 A;  1NK7 A;  3OJS A;  2YCH A;  1WSF A;  4EZ9 A;  1MDU B;  4YOX A;  4L8R B;  1O1W A;  4MLE A;  4C23 A;  5GAE P;  4CHQ A;  1YTA A;  1Q81 O;  5BR9 A;  4OPH A;  3AA4 A;  3MXJ A;  5AFU A;  3K5M A;  2YX6 A;  3VEY A;  2KFN A;  1LWC A;  3VEO A;  1S9E A;  1K9M O;  1JL2 A;  3F2K A;  4O5B A;  3EKU A;  2H3G X;  5C24 A;  4FLZ A;  4V19 S;  3MX5 A;  3OS2 A;  1WSH A;  4FLY A;  1QQO A;  3HP6 A;  4OVL A;  5CYM A;  5AQJ A;  1M1K O;  1RT6 A;  4W5Q A;  2HB5 A;  1HPZ A;  5IT9 O;  3MEC A;  4OPJ A;  4AIL C;  3THY A;  2X78 A;  1JJ2 M;  1S1W A;  1TAQ A;  2P9N A;  2FC0 A;  3VGM A;  3AY9 A;  1S1U A;  3SQ1 A;  1YVU A;  1EX4 A;  2VQE K;  4MDB A;  1BA1 A;  5HRO A;  3HTV A;  3VPZ A;  3MWT A;  5AQO A;  2QWN A;  4K8Z A;  1RDC A;  2FBX A;  4GNI A;  4A57 A;  1YJW N;  2G8F A;  3PO5 A;  4GKK K;  2HHT A;  4AHR A;  3EO3 A;  4IG0 A;  3WUH A;  1T7P A;  2E6L A;  2O8B A;  1KC8 O;  3UKU B;  3S41 A;  3SAH A;  3T19 A;  3K5L A;  4JKB A;  1SV5 A;  3H08 A;  4BR5 A;  5JS2 A;  4FM0 A;  3NF8 A;  2FSN A;  3AA5 X;  4A2A A;  4CEC A;  1QZ5 A;  2ZQB A;  2VCP A;  1NU0 A;  4H03 B;  3L2V A;  4PKG A;  1Q18 A;  4UY8 O;  1C6V A;  3CPW M;  4NCA A;  3KIO A;  1KVA A;  3KK1 A;  2ASM A;  5HRS A;  2YHW A;  3FZL A;  1HKB A;  2EX3 A;  4C8L A;  3DLR A;  1YXQ A;  4FPB A;  4CZH A;  1WUA A;  3CC4 N;  4DSJ A;  1HNW K;  5C42 A;  4EAH D;  1NM1 A;  2YNG A;  4XEI A;  1RT2 A;  3QML A;  3CM5 A;  4CVN E;  4I9Q A;  3AVF A;  4E0D A;  4LD0 A;  1Y64 A;  3TI0 A;  4CGJ A;  4BGA A;  4IBN A;  4LH5 A;  2AJQ A;  4CIF A;  2GWK A;  3U3Y A;  2P9U B;  4OO1 J;  1X3M A;  4WFA L;  4PL8 A;  1K6Y A;  1BCM A;  3F9M A;  4CJP A;  4Z4I A;  4WQ5 C;  3CI5 A;  3CJB A;  3LZI A;  3AVA A;  1HYV A;  2X74 A;  1I94 K;  4BDP A;  4DFM A;  4LF4 K;  3OYH A;  3CIP A;  4WE1 A;  4BRM A;  1GLA G;  4DQP A;  1VSK A;  3LDQ A;  1VQK N;  4O5F A;  4KHY A;  1Q8I A;  5J2N A;  1A5V A;  3DLH A;  4W5R A;  2O8D B;  1DKG D;  3CCJ N;  3IFR A;  4DTU A;  4CBW A;  5BPM A;  3AVJ A;  3C94 A;  5KPZ A;  1TKZ A;  3SAG A;  2V7Z A;  1ZBS A;  2HHX A;  3V1R A;  4G9Z A;  1DLO A;  4CFA A;  2ZE2 A;  1Y97 A;  1EXQ A;  3ULE B;  1LW2 A;  4A2B A;  2OPR A;  1NK9 A;  1QZ6 A;  2QW9 A;  4AM6 A;  1VSH A;  3QEI A;  4FJK A;  1NGB A;  2RPI A;  1BUP A;  3C7N B;  4M42 A;  4DU1 A;  2Q97 A;  3CF5 L;  4NYF A;  5HRN A;  4B9Q A;  1NKC A;  3UE5 A;  1SL2 A;  3PLA A;  3AGK A;  1GOA A;  4PHT X;  5I42 A;  4W5N A;  5BN8 A;  2D1K A;  1D9F A;  4KTW A;  1W97 L;  3E66 A;  1S6P A;  1T3V A;  1JLQ A;  3HYF A;  3LAL A;  3JAM O;  4BR9 A;  4DR6 K;  3HSC A;  1IBK K;  5ADX H;  5AQR A;  4B1U B;  4GV9 A;  1FXX A;  5EVZ A;  3LAM A;  3HPG A;  3EE8 A;  3CCR N;  3NH2 A;  4LF5 K;  3O3H A;  2QWM A;  5I9E B;  2V7Y A;  3ID6 A;  4F3O A;  4N5S A;  3QNO A;  3CCL N;  2F8S A;  4O8U A;  1J9A A;  5I3U A;  3R8E A;  4AHV A;  3T3F A;  5KQD A;  5AJ3 K;  3JSM A;  5EY4 A;  1ZBF A;  2VG6 A;  4AHU A;  2JWK A;  3BF3 A;  3ATV A;  1X9S A;  1UAX A;  4Y0W A;  4MO5 A;  3TU5 A;  4O55 A;  3AVL A;  4DHY A;  1TYQ A;  3V9X A;  4JI3 K;  1VQ8 N;  2VGM A;  5HLF A;  1N5Y A;  4JHD A;  2B5J A;  3HZ6 A;  1RFQ A;  2D0A A;  4DKW A;  3WNE A;  4QCL A;  2QM1 A;  3SI6 A;  5BRH A;  3G0Z A;  1GLD G;  2E2N A;  3KLF A;  2DFH A;  3QLH A;  1BIU A;  3LDN A;  1RT4 A;  3BP8 A;  3LL3 A;  2BDP A;  4KHQ A;  2PYJ A;  1RBR A;  3PIO L;  3HOT A;  1RTJ A;  5AQH A;  3NGI A;  4CEE A;  4AHC A;  1EP4 A;  4BRN A;  4DU3 A;  2GWJ A;  4LSN A;  3TTC A;  5KPR A;  1CZ9 A;  4E7J A;  1Q9Y A;  2UXD K;  1WAF A;  1VQM N;  3ALY A;  3RRH A;  4BVP A;  1DTT A;  3M1F A;  4B3R K;  1X9M A;  2FSK A;  3NVK A;  3DXK A;  1TK0 A;  4BAC A;  3UKR B;  4YOW A;  3WXI A;  1EET A;  1G99 A;  2HMI A;  3P5J A;  4IFE A;  4DS4 A;  3UB5 A;  2O8C A;  4IWV A;  4M3Z A;  4K0K K;  1CZA N;  4CHP A;  2F9T A;  1TL1 A;  2YNF A;  5CE3 A;  3CCM N;  4HWI A;  2J4R A;  4CJV A;  3DWL A;  4C8M A;  5CY4 A;  3I0S A;  4H5T A;  2NRX A;  1BHL A;  1A5X A;  5AQQ A;  2WOM A;  4FK2 A;  1EWQ A;  1RTH A;  4B1Z A;  4KKO A;  3PX0 A;  3CCE N;  4DTN A;  4WYB A;  1LV5 A;  1WN7 A;  3DRS A;  4CJU A;  1U04 A;  3RMB A;  1ZBI A;  3EN9 A;  1VSD A;  1J5O A;  3EYZ A;  2B4J A;  1C1B A;  2EWS A;  4OGE A;  1DT9 A;  2YNH A;  4CEF A;  4YY3 K;  4KO0 A;  2DTU A;  3AO4 A;  1NGD A;  5AQX A;  2YKM A;  5JLH A;  5ELZ A;  4CZI A;  4OPK A;  1U48 A;  3AVI A;  4I2Q A;  4FK0 A;  4M63 C;  1E4F T;  3AVB A;  4CW7 B;  5C12 A;  1NGC A;  3OY9 A;  2G8H A;  3NDK A;  4KRE A;  2CH5 A;  1ZXO A;  1ATS A;  5BRE A;  3KK2 A;  1NGA A;  2NRV A;  4C8K A;  5EOY A;  3K59 A;  1J54 A;  3KKS A;  5GIO A;  3VF6 A;  2ZM6 K;  1R0A A;  3WXL A;  4M7X A;  3CC7 N;  3AVK A;  3OYB A;  3VQ5 A;  2O8F A;  2HNY A;  3P39 A;  4CCH A;  1VQO N;  3ZEU B;  1IKY A;  2AP1 A;  5AQN A;  3LZJ A;  4DTX A;  4FM2 A;  1K8A O;  3BDP A;  1QSS A;  4B9N A;  4HHT A;  3H46 O;  3V9U A;  5M1O A;  1LWE A;  3L6Q A;  3CQ8 A;  4KTZ A;  4FWQ A;  5AQY A;  1TUU A;  3DLK A;  4FLW A;  2UUB K;  3BZK A;  2NRR A;  1JKH A;  3NVM A;  4IFV A;  2YJE A;  1WOQ A;  4YDU A;  5FLX O;  4FLU A;  5F2R A;  4DTJ A;  4CBU A;  1L5U A;  4MDA A;  4DLE A;  4Z4C A;  4NCB A;  5C2F A;  3DYA A;  4JAX A;  1KQS M;  3MCP A;  2KFZ A;  3PV8 A;  4N41 A;  4J8F A;  4QS7 A;  3LPT A;  2OA8 A;  1XQS C;  4DTO A;  4DTR A;  1WBB A;  3AA3 A;  4FJN A;  2F8T A;  5KGX A;  3NMU A;  1N33 K;  1QVF M;  3O4W A;  4RTF D;  1KRP A;  3SPZ A;  1X3N A;  5MLC Q;  3CMA N;  3DAW A;  4GV6 A;  4KHW A;  3SZ2 A;  1K73 O;  4FWM A;  3QB0 A;  4CZG A;  4GVE A;  3H3N O;  4JRP A;  1EKE A;  2V52 B;  2E2Q A;  5CZ1 A;  4BRQ A;  4CJ7 A;  2Z1H A;  2NRT A;  4F2S A;  2HVH A;  4CZJ A;  4AF1 A;  1NJW A;  5J2Q A;  4PKI A;  3SNN A;  4OKE A;  4CD1 A;  5FRO A;  1XMO K;  1NMN A;  3TAM A;  2QWL A;  2CH6 A;  3QIN A;  1HYS A;  2XY6 A;  1HMV A;  2KTQ A;  2G8U A;  2VYP A;  3OTO K;  4IKF A;  4KTQ A;  4AHT A;  4G1Q A;  4H0X B;  1CXU A;  1SKW A;  1W2B M;  3ZSO A;  1U2V B;  3QNN A;  2UXC K;  4I6M B;  1H1V A;  1NNE A;  1QQC A;  1NGH A;  4F9O A;  1ASV A;  4FWS A;  3KD5 E;  4N47 A;  4M3X A;  1XC3 A;  4CES A;  5ADX A;  2DFE A;  3ZYY X;  2XY7 A;  5LY3 A;  3CJ7 A;  2Q36 A;  4DV5 K;  1IG9 A;  3IS9 A;  4WQ4 C;  4U7B A;  5KGW A;  3D2F B;  3SYZ A;  3O3F A;  3OYI A;  1IBM K;  4YOT A;  5J2M A;  3VQ9 A;  3ZSY A;  1B92 A;  3PUF A;  5DM7 L;  2UYT A;  3NF7 A;  4BR7 A;  4EHU A;  4YOU A;  5HRP A;  3VEW A;  3VQB A;  3SCX A;  3OYA A;  3HRG A;  2W6K A;  3QEV A;  3ZT3 A;  4LF6 K;  2PYL A;  2DFF A;  3L2U A;  3ZSZ A;  1JLE A;  4CFD A;  2D0O A;  3HXM A;  4E7K A;  4CJS A;  2D4W A;  5AZJ B;  3CCU N;  3DM2 A;  1T05 A;  3RR8 A;  3C7N A;  4BWM A;  3VA3 A;  2Y1I A;  4M3R A;  5M1Q A;  3OYD A;  3DXM A;  4X64 K;  1LAV A;  4IXC A;  3MCA B;  3IUC A;  3WXM B;  3FE1 A;  3AVN A;  3WEE B;  4FOI A;  2ETJ A;  4F2R A;  3C95 A;  1RDU A;  1K8K A;  1KVB A;  3CYM A;  4C8O A;  4C1N K;  2JGU A;  1Z26 A;  4CIE A;  2QTD A;  4ISE A;  4M3T A;  4RCH A;  4FJX A;  4O4G A;  4B9L A;  4GW6 A;  3JYT A;  3SK3 A;  3MDQ A;  4X66 K;  2Q2R A;  1BIZ A;  5HRR A;  4BDZ A;  4F8R A;  4X65 K;  4I7F A;  2E88 A;  4JS4 A;  1HNV A;  1S5J A;  2PFU A;  4CER A;  4FZZ A;  2UU9 K;  4CZK A;  1V4S A;  2HW3 A;  3BZC A;  1NKE A;  4H4M A;  3CHW A;  1B9F A;  1VAZ A;  1RT3 A;  3LP3 A;  3CPE A;  2P9K B;  5CR4 A;  5LJV A;  4JYA K;  4PWD A;  2PY5 A;  4QOZ B;  2G8W A;  2F9W A;  3QBX A;  4J2B A;  5FRN A;  3MXM A;  2HBL A;  3CQY A;  4IJA A;  4AQY K;  2HMP A;  5KRT A;  1VQ6 N;  3S9H A;  3WXJ A;  3OW2 M;  3RTV A;  1I3A A;  3RSE B;  5C2D A;  4Z4E A;  1N8R O;  3NCI A;  1IBL K;  4IEI A;  3VEN A;  3OYE A;  4JN4 A;  2GV9 A;  3CQX A;  3P31 A;  4DV1 K;  1EWR A;  2W40 A;  3V9S A;  5GAH P;  1R59 O;  5HP1 A;  3HJF A;  3O80 A;  2YI1 A;  4IEE A;  1KLM A;  1S9G A;  2P9I A;  1KLN A;  4DLG A;  3KLE A;  4KH4 A;  4Y1C A;  3AO3 A;  3OA9 A;  1UOC A;  3OYG A;  3FR0 A;  1QSL A;  4FJ5 A;  2G8V A;  4GVM A;  3QET A;  4BWJ A;  4CJW A;  3VQ7 A;  2HHS A;  4RW4 A;  2VWJ A;  3D7E O;  2Z1G A;  1GLJ O;  4FPA A;  4HTU A;  4E1J A;  3G10 A;  1ASU A;  2NRW A;  4FVU A;  5GAG P;  2UUA K;  4FZY A;  3DRP A;  4K8X A;  1ATN A;  3UIQ A;  1JCF A;  1EO1 A;  5E41 A;  1VQ9 N;  4WCE L;  1QE1 A;  4X62 K;  1KAY A;  4CGD A;  2IVO A;  3KZB A;  1NJX A;  4NB4 A;  5JVG L;  3TAF A;  5IWA K;  5A2Q O;  3KJV A;  1N32 K;  4K41 A;  4CD3 A;  4DSE A;  4CHZ A;  4M3Y A;  3D2E B;  4LSL A;  2QKK A;  3HPH A;  2OTJ N;  4DF8 A;  3TTD A;  1RBT A;  3SAF A;  3I8B A;  1S72 N;  4IJN A;  4BR0 A;  4B3M K;  3MN6 A;  3LWL A;  2QI2 A;  3RMD A;  3NAE A;  2KZM A;  4CHN A;  1F21 A;  4FW2 A;  1RTD A;  2HHU A;  3A5L C;  5E26 A;  4NLC A;  4OJR A;  2O4G A;  4E3S A;  4M3U A;  3O9Q A;  1IV0 A;  1T03 A;  3SV3 A;  4A5B A;  4CIG A;  4E89 A;  4DV2 K;  4FYD A;  1VQ5 N;  5AZI B;  4FWO A;  3IMX A;  1C0T A;  1U47 A;  5LMN K;  1DEJ A;  3TAG A;  1RBU A;  4KH5 A;  3V4I A;  4CF0 A;  3OYM A;  3QES A;  3ZT4 A;  4JKA A;  4EP4 A;  1VHX A;  3DJC A;  4B1Y B;  1D4X A;  4YOY A;  4JD2 B;  4BQZ A;  1GLC G;  5BN9 A;  3VA0 A;  4J2D A;  3RMC A;  5JS1 A;  4HUE A;  2RN2 A;  3LDS A;  3ZT0 A;  2GBZ A;  3TAP A;  3KTQ A;  2IGI A;  4WFN L;  4DV7 K;  3VOV A;  4KB1 A;  3VQ6 A;  1ZBL A;  4FXD A;  4H5W A;  1LOT B;  3B6P A;  4B08 A;  4H4O A;  3G6E N;  3OBW A;  4OPA A;  4Q0B A;  5B8H A;  4DQI A;  1VQN N;  4UQG A;  4FOE A;  2ITG A;  1BCO A;  3VMF B;  2XY5 A;  1NKB A;  1WSG A;  4GV3 A;  4F3T A;  5FPE A;  2CGK A;  1UA0 A;  2Q0U A;  3KK7 A;  4CJK A;  4FVM A;  3J80 O;  3ISN C;  1KD1 O;  3M8P A;  2YHB A;  1FJG K;  5FDL A;  4JS5 A;  3P4I A;  3BEX A;  5HOO A;  4NCG A;  3FGU A;  2VGN A;  4Q5V A;  4LFA K;  4R5P A;  1CXQ A;  3MN7 A;  3L3V A;  3ZET A;  2A42 A;  4JV5 K;  3ENB A;  3K58 A;  4CZF A;  2O8E A;  4ICL A;  1GLE G;  3G71 N;  3M8S A;  3LDL A;  1RT5 A;  2YHX A;  1FKP A;  4KI6 A;  3OJU A;  3O1W A;  4DWI A;  4NLB A;  4GY2 B;  3JS6 A;  3O9T A;  5HBM A;  4BRH A;  4CK2 A;  1O13 A;  3ZLJ A;  4A59 A;  4M41 A;  3T1A A;  4BE2 A;  4JLH A;  3QDK A;  1SAZ A;  2P9L B;  3PX4 A;  4OKK A;  4Z94 A;  1ASW A;  3LDP A;  4H0Y B;  3V1Q A;  3TAB A;  5C15 A;  1M90 O;  1U2V A;  1XI1 A;  5FPM A;  4CJE A;  3THY B;  1X1P A;  1ZC6 A;  2QWO A;  1SL0 A;  4B9V A;  3TSP A;  1HNZ K;  2WFB A;  4CF8 A;  1MWK A;  2G8I A;  3CG7 A;  5F0X A;  4IDK A;  1E3M A;  3E9P A;  3T7Z A;  1TK8 A;  3NHG A;  3GL1 A;  3D2F A;  3QFP A;  4IDH A;  5BRD A;  3GG4 A;  3U3G A;  4U67 L;  1KTQ A;  1QTM A;  4FM1 A;  2UUC K;  3L4I A;  3WNF A;  3HM9 A;  5TKW A;  4CGI A;  3M6G A;  2QXL A;  2XHB A;  4FWR A;  1FK9 A;  4PA1 A;  3RWU A;  4WFB L;  3D0P A;  1HPM A;  5BR8 K;  4RWT A;  2HND A;  4DV4 K;  3OBY A;  4XIU A;  4FLV A;  1VSJ A;  5GIN A;  4JRQ A;  4FJL A;  3C65 A;  1I39 A;  1OH5 A;  1A5W A;  3VQ8 A;  1RBV A;  1BG3 A;  4KFB A;  4EIA A;  2HBK A;  4ISF A;  1VQL N;  4BR2 A;  4DSF A;  1BQM A;  1MA9 B;  2FF6 A;  1SQK A;  3HL8 A;  2A6A A;  4HUG A;  4MQ3 A;  2HHH K;  1NK0 A;  4CJ4 A;  4BC3 A;  4GKJ K;  4O0I A;  3IKM A;  5GIP A;  4H0V B;  3IDH A;  3LP2 A;  1ITG A;  4BE0 A;  5BPN A;  2G8K A;  3WEE A;  2ZJQ L;  2GUP A;  4KBO A;  4W5O A;  1W7A A;  4CJT A;  3BY5 A;  1QQN A;  1EQY A;  4FWN A;  4KI4 A;  3KD1 E;  4E7I A;  1VSL A;  3U9D A;  4FJG A;  4BC5 A;  3K0S A;  4N56 A;  3SQ0 A;  2V51 B;  5AQP A;  1QS4 A;  1HJR A;  3H45 C;  1T6D A;  2KW4 A;  2OZM A;  4DFJ A;  1HNX K;  1HQE A;  1KVC A;  1JXB A;  4FJ7 A;  4QS8 A;  5CHI A;  2IOC A;  4DG1 A;  1C1C A;  2YHA A;  3SMP A;  4YOV A;  3SLC A;  1UA1 A;  4W5T A;  3HK2 A;  4CEQ A;  3J7A P;  2GEM A;  4DQQ A;  1B9D A;  3O6W A;  3PY8 A;  4ELU A;  3AVH A;  2DPN A;  3RRG A;  5KTQ A;  4JKF A;  3HM8 A;  3CC2 N;  1WNS A;  3GE1 A;  5KPT A;  1VSM A;  4JKG B;  2Q31 A;  3ZSW A;  1FW6 A;  3E9L A;  4XH4 A;  3RSE A;  1TAU A;  4DTS A;  4QS9 A;  3AV9 A;  1ZBH A;  3PX6 A;  1YI2 N;  2RF2 A;  4DQ8 A;  2IVP A;  4BRP A;  1N34 K;  1U4B A;  1VQP N;  3J8A A;  5AQW A;  2Q0R A;  4YOR A;  3VF4 A;  4BG8 A;  4F4K A;  3UKU A;  2HNZ A;  3VES A;  3LM2 A;  4JK7 A;  1OKJ A;  4DR2 K;  1WSE A;  3KVG A;  3SBT A;  3C0B A;  4CJL A;  4E1N A;  1KAX A;  2W6L A;  4I2P A;  1S22 A;  3TWH A;  3THV A;  3E9O A;  5JVH L;  1TKX A;  1L3U A;  3U6F A;  3V81 A;  1LW0 A;  3ZT2 A;  5DM6 L;  2YV0 X;  1YAG A;  3THW B;  5F1X A;  4LY7 A;  2YKN A;  1NG9 A;  4JI1 K;  1TGO A;  2PAV A;  4BGB A;  1SUQ A;  5JIC A;  1HLU A;  3CJA A;  3WQU A;  1OH8 A;  4CF1 A;  3PIP L;  1TKD A;  3D2E A;  4CBX A;  2WUS A;  4H0T B;  4CEO A;  2OYQ A;  1CLQ A;  2QWR A;  3TTF A;  3VEZ A;  2B6A A;  3I56 N;  3WNG A;  4CGG A;  3S3O A;  4H0P A;  2FBV A;  1KXP A;  4OGC A;  2P9U A;  1HKG A;  1LAW A;  5C0Y A;  4BC2 A;  4B1X B;  3VQA A;  1YHQ N;  3TSQ A;  4OLA A;  4HVJ A;  3IRX A;  2R7Y A;  1TYQ B;  4ILG B;  4CK1 A;  3MEG A;  4DQS A;  4LF9 K;  3VQQ A;  5FPD A;  3HST B;  1S6Q A;  3SUN A;  5AZI A;  3MWP A;  3O4N A;  3A2F A;  5BPL A;  3C6T A;  1GOB A;  3DLG A;  1C0U A;  1NMD A;  3HI0 A;  2NZT A;  3FFK B;  5AQL A;  1TKT A;  5M1N A;  3J81 O;  4FJI A;  1XC9 A;  3BUZ B;  1NK6 A;  2X6N A;  2O8D A;  4B9S A;  4IFY A;  4IZ9 A;  2PBD A;  4PUO A;  3O9R A;  3FZK A;  1WB9 A;  1SL1 A;  4Z4G A;  1RIL A;  3RR7 A;  3SUP A;  3VER A;  4OKJ A;  4FJH A;  2ASP A;  2ASO A;  2X6S A;  1YTU A;  5M1K A;  4CEZ A;  1RT1 A;  4BR4 A;  4DCH A;  3QIO A;  3ULE A;  1Q82 O;  3CJ9 A;  2OTL N;  3VEX A;  4BRE A;  4CEB A;  1IKX A;  2YJF A;  4JKC A;  1S1T A;  4H0O A;  3DXK B;  1WLJ A;  3MXI A;  4FW1 A;  2VG7 A;  3P1G A;  3AA2 A;  4BY9 C;  4CK3 A;  1U49 A;  4M7Y A;  4BRO A;  2WC9 A;  3DLE A;  3L2W A;  5J2P A;  4NXM K;  4WQ5 A;  4OLB A;  4RW8 A;  2HOE A;  3AVM A;  1REV A;  3B8A X;  5C10 A;  3W0L A;  3M8R A;  4JNE A;  4ISG A;  3VQE A;  4TSX A;  4KHU A;  3PSI A;  3K5N A;  4BRC A;  4EHT A;  4K42 A;  2VG5 A;  1VRU A;  4YFU A;  1J6Z A;  2P9P B;  2W42 A;  1HQU A;  4FLT A;  3GDQ A;  4BRL A;  3EY1 A;  1MWM A;  3T1H K;  4JK8 A;  2KZZ A;  3C6H A;  4DQR A;  3OS0 A;  3TAQ A;  1WSI A;  3H3O B;  4CF9 A;  4OX9 K;  4CE9 A;  2F4V K;  2GUI A;  2BGG A;  1C0G A;  4WF9 L;  2GTD A;  4YDU C;  4AHS A;  5EXW A;  3VQD A;  1YIT N;  4ILH A;  3EL2 A;  2P1J A;  3VET A;  1P90 A;  1RDA A;  2HBM A;  3AVG A;  1QHT A;  2ZGZ A;  3N4P A;  3OYC A;  3RMA A;  3VTI A;  1YIJ N;  4CJ5 A;  3L3U A;  2NNW A;  3BGR A;  2DY4 A;  2Y1J A;  3TAE A;  1T44 A;  4FWP A;  2VWK A;  3LDO A;  1GLB G;  3QER A;  4K25 A;  2P9L A;  2QKB A;  1YT3 A;  5SWM A;  3P38 A;  3FZF A;  3T1Y K;  1V4T A;  4BC4 A;  3SMS A;  4CJQ A;  3HPO A;  3R6M A;  2BTF A;  2O8F B;  3G25 A;  4DV0 K;  2OCE A;  1BWF O;  3WT0 A;  3MED A;  4K43 A;  5FPN A;  4ZHR A;  2GX9 A;  2E6M A;  3HVT A;  4Z4F A;  4MLH A;  3KWG A;  3EZW A;  1GLF O;  4DR5 K;  2IDO A;  4QAG A;  3QIP A;  3CFO A;  3OYL A;  2W41 A;  4LFB K;  1GOC A;  1XUP O;  4I9L A;  5T7B A;  3PO4 A;  4FJ8 A;  3C6A A;  3KLI A;  4DR3 K;  3UKR A;  3OYK A;  3N4Q A;  2QWQ A;  2WBN A;  4FWL A;  2Z1I A;  4FO0 A;  3KLH A;  2RHK A;  1VQ7 N;  1IO2 A;  2FF3 B;  3A5N C;  3LP0 A;  5D3G A;  4JKH A;  4KHP K;  2E1Y A;  4EP5 A;  3TR8 A;  4IO9 L;  3SV4 A;  3CJ1 A;  3MN5 A;  4PL7 A;  2VQF K;  3W3D A;  1ZBU A;  2HF3 A;  3HVR A;  3MMV A;  3TPQ A;  3VGL A;  3NFA A;  3MAQ A;  4FJJ A;  4JKE A;  3VTH A;  1WAJ A;  1WSJ A;  1VRT A;  4NXN K;  3ITH A;  3SQ4 A;  1NGJ A;  2NRZ A;  3SPY A;  3J7Z O;  1D9D A;  3AAP A;  4CZM A;  4LC9 B;  4H8K A;  1U45 A;  3C6U A;  4LF7 K;  1C0M A;  1TUY A;  1TV6 A;  2ZD1 A;  3R1X A;  1BO5 O;  1U6Z A;  2P9S B;  3OHR A;  3VQP A;  3VEV A;  1E4G T;  2CGJ A;  3PSF A;  4B9M A;  4O44 A;  1YJN N;  2P5O A;  3AO2 A;  5SZT A;  3QEW A;  4MFB A;  3S3N A;  1GLL O;  2I7N A;  3K9K A;  3OYF A;  1Q86 O;  1WBD A;  1BU6 O;  4CJ3 A;  3GBT A;  3ULD A;  5C25 A;  2HST A;  3MX2 A;  1D5A A;  1YJ9 N;  3AAR A;  4O8K A;  3I33 A;  2F7T A;  4A62 A;  3DOK A;  3THX B;  2E5L K;  3A0I X;  4ILJ A;  1YF5 L;  5AQM A;  2ZF5 O;  1S3X A;  1NGI A;  4EZ6 A;  2D0P A;  3K9J A;  3L2Q A;  4HUF A;  3E1Y A;  4HCB A;  3O4Q A;  3FZM A;  4KB0 A;  3DRR A;  4JKG A;  4JK9 A;  4RW7 A;  4ELT A;  4YNQ A;  4ZTF A;  3ZEU A;  4Z0U A;  3CM6 A;  1L3S A;  2ZWH A;  5AQG A;  1NWK A;  5LJW A;  2IC3 A;  1Q9X A;  3HO1 A;  4ID5 A;  3VN5 A;  1NJZ A;  3K2P A;  3NGY A;  4DSL A;  3E01 A;  1BA0 A;  4R79 A;  3LPU A;  1VSE A;  3L8B A;  3ZCM A;  2BE2 A;  4H5N A;  2A40 A;  4BRD A;  4JI8 K;  3BF1 A;  3CER A;  3CXC M;  2QA4 N;  1BIS A;  2OPP A;  3DXM B;  1JL1 A;  1OVQ A;  1XHZ A;  1BL3 A;  3R9P A;  3TAN A;  3NF9 A;  3O5B A;  2OAN A;  1L3V A;  1K8K B;  3ZSX A;  3MK6 A;  1JCG A;  1W9H A;  4CED A;  2IAJ A;  1RT7 A;  2A3Z A;  1OVY A;  3QIC A;  3R3L A;  1S1V A;  3Q7C A;  3F5T A;  1N6Q A;  1YUW A;  3ENH A;  4PY5 A;  3DI6 A;  3OYJ A;  4B3T K;  1D8Y A;  3QFU A;  4CGF A;  2WTU A;  3FLC O;  4ID1 A;  3THW A;  1Z05 A;  1J5E K;  4FWK A;  5H1S Q;  2BUP A;  3NBP A;  3I8D A;  1SKR A;  3ATU A;  1BI4 B;  2IIR A;  1ZYQ A;  1KCF A;  2F96 A;  4M45 A;  3O08 A;  2WON A;  2FSJ A;  2P51 A;  3LAK A;  2KKZ A;  1RTI A;  1Z25 A;  4DU4 A;  4B9T A;  3CET A;  1HX1 A;  2I7P A;  2QEX N;  3O9S A;  2AA4 A;  4M3W A;  2D0C A;  5KI6 A;  4BRK A;  1CZB A;  4CJF A;  3K57 A;  1C1A A;  2NRH A;  4E7L A;  3B6O A;  3V9W A;  3T69 A;  4I6M A;  4CI6 A;  2YHY A;  3FZH A;  4FZX C;  2P9N B;  3MN9 A;  4E19 A;  1XHX A;  4YHH K;  4XH1 A;  2LSN A;  1NGG A;  3F73 A;  5GAD P;  1TVR A;  1W0H A;  1HRH A;  4IOA L;  5KQ8 A;  3CCS N;  3L2R A;  1OH7 A;  5AQV A;  1T6C A;  3SJJ A;  3U4L A;  5AQU A;  4N76 A;  3QO9 A;  5HL7 L;  3GOI A;  5J1E A;  2YNI A;  1G15 A;  3SBG A;  4JI0 K;  1JLB A;  4CFC A;  3ZSV A;  4ELV A;  2O8B B;  2P9I B;  3ZX2 A;  3HP9 A;  2A1R A;  3AO5 A;  4LH4 A;  2ZGY A;  2E2P A;  3OVN A;  1NJI O;  4B8C A;  2P5G A;  1VSF A;  3LM9 A;  3A8Y A;  1LWF A;  2HBJ A;  1NJY A;  3CD6 N;  4FJM A;  1QQM A;  3WQT A;  4B1V A;  3IG1 A;  4BRA A;  1TK5 A;  4Z4H A;  3OS1 A;  4JI4 K;  2FXU A;  5AQT A;  1BDG A;  1L3T A;  4DR1 K;  4DS5 A;  4KV8 A;  2ATQ A;  2ITM A;  5AQI A;  5AZJ A;  2E4L A;  1VSI A;  5AFU H;  3QEP A;  3EE9 A;  3VQ4 A;  3LAN A;  4FCY A;  4PQU A;  2HF4 A;  4DR7 K;  3ZT1 A;  2EHG A;  1TL3 A;  3TAR A;  3ZX0 A;  3L4Q A;  3DLB A;  4A61 A;  2VWB A;  5DK5 A;  3CFR A;  4FK4 A;  2HHV A;  3HBT A;  5K14 A;  4WQ4 A;  3KHY A;  3DOL A;  3EKS A;  2P9P A;  2KLA A;  2OPS A;  4GMJ B;  2PZS A;  1XNQ K;  5CYQ A;  4B8A B;  1T8E A;  2O4I A;  1Z6R A;  2KQ2 A;  1ILY A;  4LF8 K;  4IO8 A;  3ZSR A;  3KLG A;  1KFS A;  2D5R A;  3HT3 A;  2FLO A;  5FRM A;  5E84 A;  4CF2 A;  3H1Q A;  4E7H A;  1KAZ A;  4CZE A;  5LMU K;  2P9K A;  4FL9 A;  1RDB A;  4CZL A;  4FLX A;  1ATR A;  2E20 A;  3D45 A;  3NH0 A;  4CFB A;  2QWP A;  1RBS A;  3AAQ A;  2UXB K;  1YVN A;  2OPQ A;  4AH9 A;  5AQZ A;  5JMV A;  3CCV N;  4DTM A;  1NK5 A;  3G4S N;  1J53 A;  1NBW A;  2XO7 A;  4B1W B;  1BOT O;  3NE6 A;  4JI2 K;  3O8M A;  4EFH A;  4H5R A;  3IAY A;  4RW6 A;  4Y1D A;  3A5O C; 
#chains in the Genus database with same CATH homology
 3V9X A;  1RDD A;  4OLB A;  4RW8 A;  4IG3 A;  3LWL A;  4B3O A;  3AVM A;  1MU2 A;  1REV A;  5HLF A;  1N5Y A;  3RMD A;  3NAE A;  2KZM A;  4CHN A;  3M8R A;  2B5J A;  1F21 A;  4FW2 A;  4KRF A;  3VQE A;  4TSX A;  4KHU A;  2I5J A;  3K5N A;  1RTD A;  2D0A A;  4BE1 A;  2HHU A;  2VG5 A;  3WNE A;  4QCL A;  1VRU A;  4OJR A;  3SI6 A;  4YFU A;  3I0R A;  2O4G A;  3G0Z A;  4E3S A;  2W42 A;  1HQU A;  3FFI A;  4CGH A;  3KLF A;  4CHY A;  4FLT A;  4M3U A;  2DFH A;  3QLH A;  1T03 A;  3SV3 A;  4E89 A;  1BIU A;  4CIG A;  1JLF A;  4FYD A;  3EY1 A;  1RT4 A;  3V9Z A;  2BDP A;  2KZZ A;  4KHQ A;  4DQR A;  3OS0 A;  2PYJ A;  1RBR A;  1KSP A;  3TAQ A;  1WSI A;  3M8Q A;  4ZTJ A;  1C0T A;  1NK8 A;  4CF9 A;  1RTJ A;  1RNH A;  4CE9 A;  3NGZ A;  3NGI A;  1U47 A;  1VK0 A;  2GUI A;  2JLE A;  3TAG A;  1RBU A;  2BGG A;  4CEE A;  4AHC A;  4B9U A;  4C8N A;  1EP4 A;  3V4I A;  1SKS A;  3VQC A;  4CF0 A;  3OYM A;  4AHS A;  4DU3 A;  4LSN A;  3WNH A;  3QES A;  1CZ9 A;  3ZT4 A;  4E7J A;  1Q9Y A;  1WAF A;  3VQD A;  4EP4 A;  3ALY A;  3RRH A;  2P1J A;  1RDA A;  3NF6 A;  1DTT A;  1X9M A;  1TK0 A;  3AVG A;  1QHT A;  3OYC A;  4BAC A;  3KKR A;  4CEA A;  3AVC A;  3VA0 A;  3RMA A;  4J2D A;  1EET A;  3RMC A;  4CJ5 A;  5JS1 A;  4HUE A;  2HMI A;  2RN2 A;  3L3U A;  3LDS A;  3P5J A;  3ZT0 A;  3BGR A;  4CJR A;  1HNI A;  2DY4 A;  2GBZ A;  4DS4 A;  4DSI A;  2D0B A;  2Y1J A;  3TAP A;  3KTQ A;  4KPY A;  3OYN A;  2IGI A;  1BQN A;  3TAE A;  5CZ2 A;  2Q3S A;  2VWK A;  4M3Z A;  3QER A;  2RKI A;  4CHP A;  3ASM A;  4NYN A;  4E1M A;  1ZBI A;  4KB1 A;  2QKB A;  1YT3 A;  5SWM A;  3F9K A;  3VQ6 A;  1TL1 A;  2YNF A;  1ZBL A;  4J2A A;  2A1S A;  4FXD A;  4RW9 A;  1JLC A;  3B6P A;  4B08 A;  4CJV A;  4H4O A;  4CJQ A;  3LP1 A;  3HPO A;  4C8M A;  4Q0B A;  4DQI A;  1NK4 A;  5CY4 A;  3I0S A;  4UQG A;  1QSY A;  4DMN A;  1BHL A;  1IKW A;  1A5X A;  2ITG A;  1BCO A;  2WOM A;  3MED A;  2XY5 A;  4FK2 A;  2HVI A;  1RTH A;  2OA8 A;  1NKB A;  1WSG A;  4KKO A;  4F3T A;  4ZHR A;  3PX0 A;  1UA0 A;  2E6M A;  3HVT A;  4Y1C A;  4DTN A;  4CJK A;  4FVM A;  1LV5 A;  4Z4F A;  1WN7 A;  3ISN C;  3DRS A;  3M8P A;  4CJU A;  2YHB A;  3MXI A;  2XY8 A;  1U04 A;  3RMB A;  5EU7 A;  2IDO A;  4QAG A;  1JLG A;  1VSD A;  3QIP A;  5FDL A;  4HCC A;  4JS5 A;  4FJ9 A;  1J5O A;  3EYZ A;  2B4J A;  1C1B A;  3CFO A;  3OYL A;  4OGE A;  1GOC A;  4I9L A;  5T7B A;  4NCG A;  4RG8 A;  2YNH A;  4CEF A;  4KO0 A;  3PO4 A;  2F8T A;  3AO4 A;  2DTU A;  4FJ8 A;  4Q5V A;  2YKM A;  1U48 A;  1X9W A;  4OPK A;  3KLI A;  4R5P A;  3NH1 A;  1CXQ A;  2IS3 A;  3OYK A;  3L3V A;  1S1X A;  3AVI A;  4I2Q A;  3K58 A;  4FK0 A;  3SUO A;  3AVB A;  1IH7 A;  2Z1I A;  4ICL A;  3KLH A;  3V6D A;  1IO2 A;  3OY9 A;  3M8S A;  4J2E A;  1IKV A;  3LP0 A;  2G8H A;  5D3G A;  1RT5 A;  3P83 D;  4EP5 A;  3DMJ A;  3NDK A;  3CFP A;  3TR8 A;  4KRE A;  1FKP A;  3SV4 A;  4KI6 A;  3OJU A;  1JXE A;  1NOZ A;  1ZBU A;  4DWI A;  3KK2 A;  3EZ5 A;  5HBM A;  4C8K A;  5KRS A;  3HVR A;  4CK2 A;  3K59 A;  1J54 A;  3KKS A;  3LWM A;  3NFA A;  3MAQ A;  4DFP A;  2Z1J A;  1R0A A;  4FJJ A;  2QXF A;  4M41 A;  2XRI A;  3T1A A;  2HHW A;  3K5O A;  4O0J A;  1WAJ A;  1WSJ A;  1VRT A;  3AVK A;  3OYB A;  4JLH A;  3VQ5 A;  4BE2 A;  3S3M A;  3ITH A;  2NUB A;  2HNY A;  3SQ4 A;  3SUQ A;  3PX4 A;  4CCH A;  3SPY A;  4OKK A;  1ASW A;  1IKY A;  4DF4 A;  1D9D A;  3LZJ A;  4DTX A;  3KK3 A;  4BDY A;  4FM2 A;  2FBY A;  2OZS A;  2FBT A;  3V1O A;  3V1Q A;  4DTP A;  3TAB A;  1QSS A;  3BDP A;  4B9N A;  4H8K A;  4HHT A;  1U45 A;  3V9U A;  3MEE A;  1XI1 A;  3C6U A;  1C0M A;  1LWE A;  1TV6 A;  3CQ8 A;  2ZD1 A;  2BAN A;  2HHQ A;  4KTZ A;  4CJE A;  3QEX A;  3DLK A;  1X1P A;  4FLW A;  1SL0 A;  1XWL A;  4B9V A;  5DMR A;  3VQP A;  1JKH A;  1DTQ A;  4IFV A;  4DTJ A;  4FLU A;  4CF8 A;  1HYZ A;  2G8I A;  3CG7 A;  1L5U A;  4B9M A;  4O44 A;  4DLE A;  1RCH A;  2P5O A;  4DSK A;  4Z4C A;  4NCB A;  3AO2 A;  1FKO A;  5SZT A;  4IDK A;  3DYA A;  3QEW A;  4MFB A;  3S3N A;  3AO1 A;  3NHG A;  1TK8 A;  2KFZ A;  3PV8 A;  1JLA A;  4N41 A;  3ZSQ A;  3O3G A;  3U3G A;  3OYF A;  1BGX T;  1KTQ A;  1UWB A;  3LPT A;  4CJ3 A;  1NOY A;  4DFK A;  1QTM A;  4DTO A;  3SQ2 A;  4DTR A;  2QK9 A;  3AA3 A;  3ULD A;  4FM1 A;  4FJN A;  1KFD A;  4KHS A;  3WNF A;  5C25 A;  5KGX A;  3HM9 A;  4KHN A;  4CGI A;  2XHB A;  1D5A A;  4CHO A;  1FK9 A;  1KRP A;  4PA1 A;  3SPZ A;  3RWU A;  3D0P A;  4KAZ A;  1BI4 A;  1NK7 A;  3OJS A;  4EZ9 A;  1WSF A;  4L8R B;  2HND A;  1O1W A;  3DOK A;  4KHW A;  3SZ2 A;  4XIU A;  4FLV A;  1VSJ A;  1YTA A;  4CHQ A;  4JRQ A;  4FJL A;  4EZ6 A;  1I39 A;  1A5W A;  3VQ8 A;  3AA4 A;  1RBV A;  3MXJ A;  3L2Q A;  4JRP A;  3K5M A;  1EKE A;  4HUF A;  5CZ1 A;  2KFN A;  4HCB A;  4KFB A;  1LWC A;  3O4Q A;  1S9E A;  2Z1H A;  4KB0 A;  3DRR A;  4F2S A;  2HVH A;  1JL2 A;  4O5B A;  4RW7 A;  4ELT A;  4YNQ A;  4ZTF A;  1NJW A;  5J2Q A;  5C24 A;  4FLZ A;  4Z0U A;  3CM6 A;  4DSF A;  1L3S A;  3OS2 A;  1BQM A;  1WSH A;  3SNN A;  4OKE A;  2IC3 A;  4FLY A;  1Q9X A;  3HO1 A;  4ID5 A;  3VN5 A;  3HL8 A;  5FRO A;  1NJZ A;  3HP6 A;  4OVL A;  3K2P A;  3NGY A;  4MQ3 A;  5CYM A;  3TAM A;  4CJ4 A;  4HUG A;  3QIN A;  1NK0 A;  1RT6 A;  4DSL A;  1HYS A;  4W5Q A;  2HB5 A;  4O0I A;  1HPZ A;  1HMV A;  3MEC A;  3E01 A;  4OPJ A;  4AIL C;  2X78 A;  2G8U A;  1S1W A;  2KTQ A;  1TAQ A;  3LPU A;  2FC0 A;  1VSE A;  4IKF A;  3L8B A;  4KTQ A;  3ZCM A;  2BE2 A;  3LP2 A;  4AHT A;  1ITG A;  4BE0 A;  4G1Q A;  2G8K A;  1S1U A;  1CXU A;  3SQ1 A;  1YVU A;  1SKW A;  1EX4 A;  3ZSO A;  4W5O A;  4CJT A;  3QNN A;  5HRO A;  2XY6 A;  1BIS A;  2OPP A;  1QQC A;  1JL1 A;  1ASV A;  4KI4 A;  1XHZ A;  4K8Z A;  1RDC A;  1BL3 A;  2FBX A;  3TAN A;  2G8F A;  3PO5 A;  3NF9 A;  3KD5 E;  4N47 A;  4E7I A;  3KD1 E;  4AHR A;  1VSL A;  4M3X A;  2HHT A;  4IG0 A;  4CES A;  4FJG A;  3SQ0 A;  4N56 A;  2E6L A;  1T7P A;  1L3V A;  2DFE A;  3ZSX A;  2XY7 A;  1QS4 A;  1W9H A;  4CED A;  1HJR A;  1IG9 A;  2IAJ A;  3IS9 A;  1RT7 A;  2KW4 A;  2OZM A;  5KGW A;  1S1V A;  4DFJ A;  3T19 A;  3SYZ A;  1N6Q A;  3K5L A;  1HQE A;  4PY5 A;  1SV5 A;  3DI6 A;  3OYJ A;  1KVC A;  3O3F A;  3H08 A;  5JS2 A;  4FM0 A;  1JXB A;  1D8Y A;  3NF8 A;  4CGF A;  4FJ7 A;  3AA5 X;  4ID1 A;  4CEC A;  3OYI A;  2ZQB A;  5J2M A;  3VQ9 A;  3ZSY A;  1B92 A;  3NBP A;  2IOC A;  3PUF A;  1C1C A;  4DG1 A;  3I8D A;  3L2V A;  1BI4 B;  2YHA A;  1SKR A;  3NF7 A;  1UA1 A;  5HRP A;  1C6V A;  4W5T A;  3HK2 A;  4CEQ A;  1KCF A;  2F96 A;  4M45 A;  1ZYQ A;  4NCA A;  2WON A;  3VQB A;  3KIO A;  4DQQ A;  1B9D A;  3OYA A;  3SCX A;  2P51 A;  3PY8 A;  4ELU A;  1KVA A;  3AVH A;  3LAK A;  1RTI A;  1Z25 A;  5KTQ A;  4DU4 A;  3KK1 A;  3RRG A;  3QEV A;  5HRS A;  4B9T A;  3ZT3 A;  2PYL A;  1WNS A;  2DFF A;  2EX3 A;  3L2U A;  3DLR A;  4C8L A;  3ZSZ A;  1JLE A;  4CFD A;  1VSM A;  3HXM A;  4E7K A;  3ZSW A;  4CJS A;  4M3W A;  2D0C A;  5KI6 A;  1CZB A;  4DTS A;  4CJF A;  1TAU A;  3K57 A;  1C1A A;  3DM2 A;  1T05 A;  3RR8 A;  4DSJ A;  5C42 A;  4E7L A;  3B6O A;  3AV9 A;  4BWM A;  4M3R A;  2YNG A;  3VA3 A;  2Y1I A;  4KHY A;  1ZBH A;  3OYD A;  1RT2 A;  3CM5 A;  3V9W A;  4I9Q A;  3PX6 A;  2RF2 A;  1LAV A;  3AVF A;  4E0D A;  4FZX C;  4LD0 A;  1U4B A;  4E19 A;  3TI0 A;  1XHX A;  4CGJ A;  4IBN A;  4LH5 A;  2LSN A;  2AJQ A;  4CIF A;  3AVN A;  3F73 A;  2ETJ A;  4F2R A;  1TVR A;  3C95 A;  3U3Y A;  1W0H A;  1HRH A;  1KVB A;  3CYM A;  4C8O A;  1K6Y A;  1BCM A;  4F4K A;  3L2R A;  2HNZ A;  2JGU A;  1Z26 A;  4CIE A;  4CJP A;  3SJJ A;  1WSE A;  4Z4I A;  4N76 A;  4M3T A;  3QO9 A;  3LZI A;  4FJX A;  3AVA A;  4O4G A;  5J1E A;  4B9L A;  1HYV A;  1G15 A;  2YNI A;  4GW6 A;  3JYT A;  2X74 A;  4CJL A;  4E1N A;  1JLB A;  4CFC A;  3ZSV A;  4BDP A;  4ELV A;  4DFM A;  4I2P A;  3OYH A;  3TWH A;  3HP9 A;  4WE1 A;  1BIZ A;  5HRR A;  3THV A;  2A1R A;  1TKX A;  3AO5 A;  4LH4 A;  4BDZ A;  1L3U A;  4F8R A;  3U6F A;  4DQP A;  1VSK A;  3OVN A;  3V81 A;  4B8C A;  4I7F A;  1LW0 A;  1VSF A;  3ZT2 A;  2P5G A;  4JS4 A;  1HNV A;  1LWF A;  1Q8I A;  1S5J A;  4CER A;  5J2N A;  1NJY A;  1A5V A;  2YV0 X;  4FZZ A;  3DLH A;  4FJM A;  4W5R A;  2HW3 A;  3IG1 A;  1TK5 A;  1NKE A;  4H4M A;  4Z4H A;  1B9F A;  2YKN A;  1RT3 A;  4LY7 A;  3OS1 A;  4DTU A;  1L3T A;  3LP3 A;  4DS5 A;  4KV8 A;  3AVJ A;  3C94 A;  4PWD A;  2PY5 A;  1TGO A;  1TKZ A;  2ATQ A;  4QOZ B;  1SUQ A;  2G8W A;  2E4L A;  2HHX A;  1VSI A;  3V1R A;  4J2B A;  5FRN A;  3MXM A;  4CF1 A;  1DLO A;  1TKD A;  4CFA A;  3QEP A;  2ZE2 A;  1Y97 A;  4CEO A;  2OYQ A;  1EXQ A;  3VQ4 A;  3LAN A;  1CLQ A;  1LW2 A;  4FCY A;  4PQU A;  5KRT A;  2OPR A;  1NK9 A;  2B6A A;  3ZT1 A;  2EHG A;  1TL3 A;  3WNG A;  3TAR A;  3S9H A;  4CGG A;  3S3O A;  3RTV A;  3QEI A;  1I3A A;  1VSH A;  4FJK A;  2FBV A;  3DLB A;  4OGC A;  2RPI A;  5DK5 A;  4M42 A;  3CFR A;  4DU1 A;  1LAW A;  4Z4E A;  4FK4 A;  2HHV A;  3NCI A;  4NYF A;  3VQA A;  5HRN A;  5K14 A;  3OYE A;  1NKC A;  1SL2 A;  2GV9 A;  4OLA A;  3DOL A;  1GOA A;  3IRX A;  4HVJ A;  4GMJ B;  2OPS A;  2R7Y A;  3V9S A;  4CK1 A;  3MEG A;  4DQS A;  5I42 A;  2PZS A;  4W5N A;  1D9F A;  3VQQ A;  5HP1 A;  3HJF A;  3HST B;  5CYQ A;  1S6Q A;  4B8A B;  1T8E A;  3SUN A;  1KLM A;  4KTW A;  2O4I A;  1S9G A;  2KQ2 A;  1KLN A;  4DLG A;  3O4N A;  1S6P A;  3KLE A;  1JLQ A;  3A2F A;  3AO3 A;  3HYF A;  3C6T A;  1GOB A;  1UOC A;  3DLG A;  1C0U A;  3LAL A;  3ZSR A;  3OYG A;  3KLG A;  1KFS A;  1QSL A;  1TKT A;  2D5R A;  2G8V A;  4FJ5 A;  4GVM A;  4FJI A;  3HT3 A;  3QET A;  1XC9 A;  4BWJ A;  4CJW A;  1NK6 A;  2X6N A;  3VQ7 A;  1FXX A;  4B9S A;  2HHS A;  3LAM A;  3HPG A;  4IFY A;  4RW4 A;  2VWJ A;  5FRM A;  4PUO A;  4CF2 A;  4E7H A;  2Z1G A;  1SL1 A;  4Z4G A;  4HTU A;  3NH2 A;  1RIL A;  1ASU A;  3G10 A;  3RR7 A;  3SUP A;  1RDB A;  4OKJ A;  4FZY A;  3DRP A;  4FJH A;  3O3H A;  2X6S A;  4FLX A;  1YTU A;  4K8X A;  3UIQ A;  4CEZ A;  3D45 A;  1RT1 A;  4F3O A;  4N5S A;  3NH0 A;  3QNO A;  4CFB A;  2F8S A;  5E41 A;  1RBS A;  1QE1 A;  3QIO A;  1J9A A;  4CGD A;  2OPQ A;  5I3U A;  4AH9 A;  1NJX A;  3TAF A;  4AHV A;  4CEB A;  1IKX A;  3KJV A;  3T3F A;  3JSM A;  1S1T A;  4DSE A;  4CHZ A;  4DTM A;  1ZBF A;  1NK5 A;  4M3Y A;  1WLJ A;  2VG6 A;  4FW1 A;  4AHU A;  1J53 A;  2VG7 A;  3AA2 A;  3P1G A;  2XO7 A;  4LSL A;  2QKK A;  3HPH A;  4CK3 A;  3NE6 A;  1X9S A;  1U49 A;  1UAX A;  4DF8 A;  1RBT A;  4O55 A;  3AVL A;  3L2W A;  3DLE A;  5J2P A;  4RW6 A;  3IAY A;  4Y1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...