1JL2A

Crystal structure of tceo rnase h-a chimera combining the folding core from t. thermophilus rnase h and the remaining region of e. coli rnase h
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
150
structure length
150
Chain Sequence
KQVEIFTDGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELKAAIEGLKALKEPAEVDLYTDSHYLKKAFTEGWLEGWRKRGWRTAEGKPVKNRDLWEALLLAMAPHRVRFHFVKGHAGHPENERADELARAAAMNPTLEDTGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contributions of folding cores to the thermostabilities of two ribonucleases H.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
molecule keywords Chimera of Ribonuclease HI, Ribonuclease H
total genus 42
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jl2A00
1RDBA 3K5LA 3TAQA 4CIGA 3NF8A 4OPJA 4DFKA 2BDPA 3VQDA 2BANA 4FJIA 4HVJA 1IG9A 2OZMA 3O3GA 1YTUA 3RR8A 1IKYA 2R7YA 1UAXA 2HNYA 4NCAA 5KRTA 3TANA 4AHRA 5EU7A 1RT1A 1GOCA 1EETA 4DQPA 2WONA 1RT5A 4CJLA 1X9SA 2EX3A 3C95A 4DU1A 4DTXA 4DTPA 4J2DA 4KI6A 2HHQA 4M3XA 1F21A 2IC3A 3AVMA 1YT3A 3AA2A 4CEOA 5CYQA 3V81A 4NCBA 4CJQA 1R0AA 1BIUA 1RTHA 1RBUA 4KKOA 1U47A 3OYFA 1JLGA 3LPTA 3OS0A 4DLEA 1KLNA 4IFYA 3OS2A 4PUOA 4OJRA 3KKRA 4FXDA 3RWUA 4DTNA 3P83D 2OZSA 4FJMA 3TARA 1ZBUA 4B9LA 2PZSA 3AV9A 3M8SA 3TWHA 3DLRA 4QOZB 4E7KA 4FJ7A 2YHAA 2Q3SA 1S5JA 4Y1CA 4DTOA 2X74A 3QEIA 5HP1A 4FW1A 4KTQA 4CFBA 4AILC 1LWFA 4J2EA 2HVHA 2HHSA 2XY6A 3LAMA 4CJVA 2D0AA 4FJLA 4OGEA 5CYMA 4KB1A 4FJ8A 1BHLA 3HVTA 3EY1A 1JLBA 3WNFA 4OVLA 4FLYA 2Y1JA 2IDOA 3LALA 3M8PA 4GVMA 3BGRA 3VQ8A 4LY7A 3MEGA 5I3UA 4B9SA 2Z1GA 3V1RA 4E1NA 1C0UA 4B9MA 4DWIA 5C24A 3HYFA 3KTQA 4BE2A 2KFNA 2X6SA 1DTQA 4HUGA 4K8XA 4FYDA 2RPIA 1VSIA 3V1OA 3VQBA 1D5AA 5T7BA 4CEEA 2Y1IA 4BACA 1ASWA 1BQMA 4KFBA 5K14A 1ZBFA 3NGIA 4FJKA 4B3OA 4Z4IA 2I5JA 5HRSA 3P1GA 1IKVA 1HRHA 4Z4HA 4Q5VA 3AO2A 1BL3A 3LANA 3SUPA 1DTTA 2OPPA 4EZ9A 1HYVA 2ITGA 1TL1A 3OS1A 2KZMA 4CF2A 4RW9A 1J54A 3V1QA 3OYDA 1NJWA 4FK0A 4FW2A 3S3MA 2D0BA 1S1UA 3ZSWA 1C1BA 4MQ3A 3K58A 1RBSA 1TGOA 1BI4A 1NK8A 4C8MA 4NCGA 4BWJA 4CGGA 3I8DA 3PV8A 3DLBA 1VSDA 1SL1A 3UIQA 4HTUA 2IAJA 1ZYQA 2VG6A 3BDPA 4CF0A 4DSJA 4DU4A 1L3UA 1JXBA 3SPYA 1HNVA 3ULDA 3SZ2A 2HMIA 4RW6A 4HHTA 1T8EA 4FJ9A 3QESA 1NKBA 3QEVA 1RTIA 1GOAA 1JLEA 4CGDA 3HP9A 2YNHA 3QETA 3RMCA 3AA3A 4AH9A 4CECA 3SPZA 2OYQA 4FLTA 5HBMA 3F9KA 3PX6A 4B9UA 2ZD1A 4FK2A 3HJFA 3SQ0A 1LV5A 3HSTB 1NJYA 1WN7A 2KQ2A 2RF2A 4DSKA 4O0IA 3U3GA 4DS4A 3AVNA 1VRTA 2HHVA 4EP5A 1IKXA 1TVRA 4CJPA 3OYBA 3I0SA 3QIPA 5CZ2A 3QNNA 1TK8A 4HCBA 3RRGA 4BDZA 2EHGA 4CESA 4DQSA 4AHTA 3LP3A 3ZSOA 2GUIA 4Z0UA 5FROA 3KLFA 3SCXA 1X9MA 3VQ5A 5KGWA 3RMBA 4C8KA 3VQAA 1TK0A 3K2PA 3OYAA 3TAPA 1RTDA 5DMRA 3U3YA 4N5SA 4JRQA 3MEDA 4CFCA 4CERA 1BCMA 4KO0A 1IH7A 3C6TA 3OYMA 1U4BA 2HB5A 2PYJA 2OPSA 4DS5A 4CJ5A 4CJ3A 1C1AA 2FBVA 4FLXA 1SL0A 1TV6A 1QS4A 1YVUA 4CJEA 2DFEA 3NH1A 3L2VA 1WAJA 4OPKA 2OA8A 2ETJA 2P1JA 5FDLA 4CHOA 2RKIA 3L3VA 4TSXA 3RMDA 5CY4A 1GOBA 2VWJA 1D8YA 1WNSA 4DSFA 3MAQA 1ASVA 2QKBA 3HM9A 3NHGA 4O0JA 4KB0A 2ATQA 1VSJA 1LWEA 3LZJA 3DOLA 4CJWA 3ZT2A 1WSHA 4XIUA 4FM2A 4OLAA 3S9HA 1IKWA 4H4MA 4CF8A 1TKDA 3HO1A 2NUBA 1JLQA 3RR7A 1FKPA 1XHXA 3JYTA 4JS4A 1QSYA 3L3UA 4ZHRA 3OYHA 3S3NA 1KSPA 4QAGA 1Y97A 1C1CA 3PUFA 3F73A 2QKKA 1C0MA 1VSFA 2FBXA 3AVHA 4GW6A 4OKJA 4CGHA 3DYAA 3DRPA 5I42A 1NK0A 1HYZA 3EYZA 3PX0A 1I3AA 2E6MA 3MECA 3EZ5A 1KFSA 2G8VA 1HQEA 3VQ7A 1RILA 4CEZA 1RDAA 4W5QA 2W42A 5HRRA 4E19A 1RTJA 3LWMA 4F8RA 2LSNA 3O4QA 4J2AA 4CEBA 4IFVA 4F3OA 4DSEA 1TKZA 4O55A 4E3SA 3SYZA 1WSEA 3AVGA 1HPZA 3KJVA 4CGFA 2KFZA 3T19A 3HP6A 4E7LA 4M3TA 2YNIA 2GV9A 1T7PA 3V6DA 1DLOA 1NKCA 3V9UA 4M3RA 4KHYA 3NGYA 4FJNA 4KHUA 2FBTA 4I2PA 1QE1A 4N47A 1RT4A 3TR8A 4B9VA 3SQ4A 4Q0BA 1EP4A 3AO1A 2HVIA 2IS3A 1YTAA 2FBYA 3LPUA 3ZSVA 4JS5A 3CM6A 3T3FA 1NK9A 4UQGA 4F2RA 4E7JA 4M42A 1UA0A 5J1EA 2B5JA 4EP4A 2IOCA 3MXJA 5HRNA 3TI0A 3AVBA 3QLHA 4OKEA 1EX4A 1HYSA 3ZSRA 3PY8A 4B8CA 3NE6A 4DQQA 2JGUA 3KK1A 1CXQA 1KTQA 4CHPA 3HVRA 4HUEA 4CGJA 4N41A 4M3ZA 1VK0A 2X6NA 1MU2A 1J5OA 1TAQA 3LDSA 5J2QA 1A5XA 1SKSA 1JLFA 2ZE2A 4O4GA 3ZCMA 2VG5A 1QSSA 1TKXA 4H8KA 3LP2A 3QNOA 1NK7A 3SJJA 3O4NA 2FC0A 1Q8IA 4I7FA 4LD0A 2YHBA 3TAEA 4DTSA 1EXQA 1S9EA 1XWLA 3AO5A 3VQEA 4CEFA 3TAFA 4KV8A 2HNZA 3PX4A 3NBPA 4CJKA 1RT2A 1J53A 1LAWA 4C8OA 1WSGA 2ZQBA 1QSLA 3JSMA 1KLMA 1JL1A 1VSHA 1Z25A 4E1MA 3OYCA 3LZIA 1NK6A 2PY5A 1SKWA 1SV5A 2KZZA 4IG3A 3ALYA 4O5BA 4Y1DA 4DSLA 4O44A 3QEWA 2GBZA 3E01A 4LH5A 4CK3A 5KRSA 4CJ4A 3AVAA 5KGXA 2OPRA 3WNGA 2QXFA 1TL3A 4F3TA 4CEQA 1KFDA 1ZBHA 2YKNA 1I39A 1LWCA 3DLGA 4PA1A 4M3WA 4PY5A 3D45A 3VQQA 3B6OA 3LP1A 3ZSXA 4M41A 2WOMA 1Z26A 3QEPA 1NK5A 4KPYA 4RW8A 1D9FA 3KIOA 1X9WA 4BDPA 3HT3A 4LH4A 1ITGA 1NJXA 4FLWA 3VQ9A 4CIFA 3S3OA 4C8LA 4CJTA 3L2WA 2KTQA 3L2UA 4BE1A 2YKMA 5J2MA 5HLFA 3FFIA 3DLHA 2O4IA 3SQ1A 3KD1E 4EZ6A 1SUQA 3QINA 5SZTA 2G8UA 4C8NA 3M8RA 3LP0A 2HNDA 2P5OA 2QK9A 2D0CA 4DSIA 4I9QA 4CK2A 1CLQA 1W9HA 3K5OA 4DTMA 4DMNA 3IG1A 2XO7A 3O3FA 2YV0X 1S1XA 3NGZA 3KK3A 1T05A 4E0DA 2KW4A 4FVMA 5CZ1A 1JLCA 1QQCA 3L2QA 4JRPA 2IGIA 3G10A 1RT7A 1G15A 3H08A 1REVA 3ZSQA 3QERA 4DF8A 2AJQA 2DY4A 4W5NA 1C6VA 4AHVA 4PQUA 1S6PA 4M3YA 4IG0A 4JLHA 3K59A 2JLEA 1NKEA 3SNNA 3MXMA 2O4GA 3RRHA 4J2BA 3ASMA 4E89A 4FZYA 1A5WA 3NF7A 2HHWA 3DM2A 2P51A 4ZTJA 4BWMA 3P5JA 3ZT4A 4LSNA 1O1WA 1HNIA 3OY9A 1B9DA 4CJRA 2G8KA 1UA1A 4AHUA 3V4IA 2YNGA 1K6YA 4CEAA 5SWMA 3SUQA 3AVFA 1RBRA 3PO4A 4FK4A 3IAYA 2F8SA 3MEEA 1HQUA 3VQCA 4B08A 1BGXT 1U45A 1L3TA 2Z1JA 1FKOA 3NF9A 3CG7A 3SQ2A 4RW4A 3ZT3A 2HW3A 1QHTA 3ZSZA 1BIZA 2G8FA 1TAUA 2E6LA 4W5OA 2BE2A 4FM0A 3DRRA 1BISA 1KVAA 4H4OA 4LSLA 4DTJA 3THVA 4L8RB 1ZBIA 3NCIA 3WNHA 5HRPA 3CFPA 3SV4A 4CJFA 3KLIA 1T03A 3NF6A 1NJZA 2P5GA 4ZTFA 5J2NA 1B9FA 1BI4B 4OKKA 3AVIA 2DTUA 4GMJB 2RN2A 4BDYA 2F8TA 4QCLA 3NH0A 3KK2A 1A5VA 1RDCA 4DQRA 1NK4A 2G8WA 4KI4A 1S1VA 3M8QA 5DK5A 5HROA 4KREA 3DLEA 1NOYA 1U04A 4ICLA 4HCCA 1S9GA 4KHSA 1EKEA 3OJSA 3NH2A 3V9SA 1ASUA 1LW0A 1RCHA 4AHSA 3OYGA 1Q9XA 2PYLA 4FJ5A 2G8IA 1VSLA 5KTQA 3NAEA 1RNHA 1RDDA 4DFJA 4Z4FA 3QIOA 3MXIA 3TABA 1VSEA 1FK9A 4CJUA 3OYNA 3OYEA 3QEXA 5C25A 1TKTA 2XHBA 4B9NA 4DQIA 4AHCA 1VRUA 3RTVA 5KI6A 4PWDA 4CFAA 1L3VA 4I9LA 1KRPA 3VQPA 4E7IA 1D9DA 2Z1IA 4DFPA 5FRNA 3LAKA 1U48A 1KCFA 2G8HA 4FJXA 3TAMA 3AVKA 4W5RA 3OJUA 4ELTA 4Z4EA 2HHTA 1FXXA 2HHUA 3AVLA 4DLGA 1VSMA 1J9AA 4IKFA 1N6QA 3V9WA 4DG1A 4B9TA 4DF4A 1JKHA 2VWKA 2DFHA 3AA5X 4NYFA 1JLAA 1VSKA 5JS1A 3ITHA 3SI6A 3IS9A 1XHZA 3WNEA 4Z4GA 3V9ZA 4KRFA 1RT3A 4ELUA 3VQ4A 1CZBA 3HPGA 1NOZA 4FLZA 1UWBA 1N5YA 1W0HA 3CFOA 4FJHA 4CK1A 4DTUA 4NYNA 4FJJA 3DI6A 3KKSA 2E4LA 4IBNA 3RMAA 1RBTA 4YNQA 2B6AA 3HL8A 1KVBA 1RT6A 4CCHA 4KTZA 1U49A 1BCOA 1C0TA 3AVCA 5C42A 3OYIA 4FM1A 4W5TA 3V9XA 4CHZA 4RG8A 1ZBLA 3IRXA 4F2SA 3ZT0A 4M45A 3L2RA 3OYKA 4OLBA 4MFBA 4CHNA 1KVCA 4ID5A 4KAZA 3O3HA 3NFAA 4CIEA 4N56A 3LWLA 4I2QA 2A1SA 3ZT1A 3VA0A 3VA3A 4DTRA 4N76A 1WSIA 1L5UA 3T1AA 4YFUA 3KLHA 1CXUA 4M3UA 1LW2A 1XC9A 1CZ9A 4CHQA 3OYLA 4CHYA 2XY8A 1XI1A 1SKRA 3QO9A 3SV3A 1S1TA 3ZSYA 2VG7A 3AVJA 4R5PA 2XY7A 4KHQA 2F96A 4FZXC 4Z4CA 4KHWA 3HPHA 4B8AB 4E7HA 4G1QA 1SL2A 5J2PA 2B4JA 3VN5A 5FRMA 3CM5A 2YNFA 3K5NA 4CEDA 3DMJA 2XRIA 4DU3A 1BQNA 3K5MA 1QTMA 1WLJA 2OPQA 1TK5A 4FJGA 3DRSA 1B92A 4ID1A 3OYJA 1L3SA 4FLVA 4CGIA 5D3GA 1S6QA 3C94A 1WSFA 3HPOA 4CFDA 2BGGA 4DFMA 3I0RA 2A1RA 3B6PA 1RBVA 3HK2A 1HJRA 3OVNA 4FZZA 1S1WA 3DOKA 3CYMA 2HHXA 3SUNA 3L8BA 3A2FA 3D0PA 3K57A 3KD5E 2DFFA 2XY5A 4HUFA 1WAFA 4CJSA 3C6UA 4CF1A 1JXEA 4WE1A 4BE0A 4KTWA 1JL2A 1UOCA 3VQ6A 3TAGA 4CE9A 4K8ZA 3HXMA 1LAVA 4IDKA 4ELVA 3ISNC 3AO4A 3SUOA 3PO5A 4CF9A 3DLKA 3AO3A 3NDKA 4RW7A 5E41A 3CFRA 1IO2A 5JS2A 4F4KA 2X78A 4FLUA 3AA4A 1X1PA 1Q9YA 3KLEA 4FCYA 3KLGA 1HMVA 3CQ8A 4OGCA 4KHNA 1WSJA 3G0ZA 3U6FA 2D5RA 2Z1HA
chains in the Genus database with same CATH superfamily
4OPJA 4DFKA 3J7YP 3VQDA 1NMDA 5GINA 4FJIA 2OZMA 3QMLA 4JI2K 3M5RA 2R7YA 1UAXA 3OBYA 4RCHA 1C0GA 4JEPA 3KVGA 5EU7A 2WONA 2GELA 3E9LA 1N33K 3LM9A 3AVMA 3AA2A 4NCBA 1R0AA 1BIUA 1J5EK 1JLGA 3EZWA 4DLEA 1KLNA 2OTLN 4PUOA 4NLCA 3KKRA 4DTNA 3P83D 2OZSA 3DXMA 5H1SQ 4QOZB 4DTOA 4FW1A 1V4SA 2XY6A 2WTUA 4IO9L 3I56N 4FJLA 4OGEA 4BGBA 1VQON 3EY1A 1JLBA 2Y1JA 2IDOA 3LALA 3D7EO 3HTVA 1YHQN 3BGRA 4LY7A 3MEGA 2PFUA 1N32K 1DTQA 2CH5A 4K8XA 1KAYA 1GLBG 4CEEA 5GAHP 4Z4IA 2I5JA 1HRHA 1IJJA 4Z4HA 3GL1A 3SUPA 3LANA 3JAMO 1HYVA 2KZMA 3I8BA 4MO5A 4WQ5A 3WQUA 3CXCM 1J54A 3V1QA 3OYDA 4I6MA 4FW2A 4FK0A 2D0BA 1V4TA 4CGGA 4H5WA 4H5NA 4HTUA 1ZYQA 4CF0A 4LF9K 2HMIA 4FJ9A 4IJAA 1RTIA 1HPMA 4WYBA 5GIPA 3BUZB 3QETA 3RMCA 3HJFA 4FLTA 3F9KA 4FK2A 1LV5A 1JJ2M 3IKMA 1NJYA 3UKRB 4DS4A 3AVNA 4BRGA 2NLXA 2HHVA 4CJPA 1FJGK 2QWRA 3OYBA 1MWKA 5CZ2A 1DGKN 2EHGA 4CESA 1NGGA 4BDZA 3ZSOA 3RMBA 2NRXA 1TK0A 3KZBA 2NRRA 3HM8A 5DMRA 5AQLA 4JRQA 3MEDA 4O8KA 4CERA 2EWSA 1IH7A 4KO0A 3P38A 3H1VX 3OYMA 2PYJA 3E9PA 1C1AA 1SL0A 1YVUA 4OPKA 2ETJA 3AGKA 3VEWA 5GIOA 5FDLA 4CHOA 2RKIA 2QWNA 3RMDA 4JKDA 2GUPA 5C0YA 1D8YA 3LM2A 4CVNE 5FPMA 3L4IA 4OLAA 4WF9L 3S9HA 1K8AO 2OCEA 2RE2A 3F2KA 4CF8A 1NWKA 5GAGP 3C65A 1W7AA 1FKPA 3GDQA 4QAGA 4YDUC 3VEOA 2HHHK 4GW6A 1VSFA 4OKJA 2ZGYA 4CD1A 4CZFA 1XNQK 3GE1A 5M1PA 1I3AA 1KFSA 3VQ7A 3C7NA 1RTJA 5GADP 3O4QA 4MDAA 1QVGM 4DCHA 4IFVA 4X65K 4DSEA 1IV0A 4IEEA 1N36K 3SYZA 4GY2B 1ZBSA 4E7LA 3H46O 1JCFA 3D2EA 4DR1K 4X62K 4KHYA 1QE1A 1Q82O 2HBKA 3CQXA 3ZSVA 3LPUA 3RVCA 4UQGA 4E7JA 3J8AA 5J1EA 4IJNA 2B5JA 5AQGA 3TI0A 3AVBA 3QLHA 4FVUA 5LL6Z 5FPEA 4CHPA 5A2QO 1IBKK 1MU2A 5EY4A 3LDSA 1TKXA 4H8KA 2E88A 1T44A 1VQ5N 3TAEA 4KH4A 5KPRA 4DTSA 3ZEUB 3AO5A 3TAFA 3FR0A 1M1KO 3NBPA 1WSGA 2CGKA 3LZIA 4ISGA 1SKWA 1SV5A 2HBMA 4KBOA 2GBZA 4EAHD 2V7YA 2GWKA 1XC3A 2OPRA 2QXFA 1TL3A 4F3TA 3VETA 3AGRA 2CH6A 4CEQA 1KFDA 1ZBHA 2YKNA 3VGLA 1I39A 1QQNA 2HOEA 3DLGA 4PY5A 1QHAA 3VQQA 3ZSXA 3QEPA 1NK5A 4H0PA 5ELZA 3KIOA 5AR0A 1ZC6A 3W0LA 2Q0UA 1HNZK 4BC2A 1OH8A 1SUQA 4EZ6A 4OX9K 3LP0A 3SMPA 5E84A 3FFKB 4DSIA 4I9QA 3AARA 5C12A 2D1KA 4QS9A 2XO7A 4CJ7A 3PIOL 4E0DA 1BO5O 2KW4A 4FVMA 2A40A 2IGIA 4R79A 1G15A 1REVA 3QERA 4W5NA 3EKSA 4FWNA 1C6VA 4M3YA 2QI2A 2JLEA 3F5TA 4GVEA 1NKEA 3ASMA 4E89A 4U7BA 2W6LA 2HHWA 2P51A 4ZTJA 4LSNA 1HNIA 3J7AP 4C1NK 2O8BA 3C7NB 5AQFA 3O9RA 3PO4A 3MEEA 1HQUA 3VQCA 5JLHA 4JI5K 2Z1JA 3ZX3A 3NF9A 5C15A 2HW3A 1T6DA 4WFBL 2FSKA 2YI1A 3ZSZA 1KVAA 4LSLA 4BC5A 5IT9O 2P5GA 1MA9B 1T6CA 1SQKA 4ILHA 4BDYA 2O8EB 1A5VA 4KI4A 4KREA 2F9TA 1NOYA 2VQFK 1S9GA 4KHSA 3AAQA 3NH2A 1E4FT 4NB4A 1ASUA 2CGLA 3TU5A 3OYGA 4FWKA 1Q9XA 2PYLA 4FJ5A 4PL7A 4BG9A 4DFJA 4O8UA 3CERA 5LMUK 4DB3A 3QFPA 4C23A 2XHBA 4BRKA 4DQIA 1NBWA 1VRUA 3RTVA 3WEEB 1KRPA 1D9DA 1U48A 4RWTA 4FJXA 3TAMA 3AVKA 3J7ZO 4Z4EA 2HHUA 2E5LK 4DLGA 2HBLA 1N6QA 1NNEA 4DG1A 2DFHA 3IS9A 5F1XA 1XHZA 4ELUA 3MCAB 3VQ4A 1CZBA 3HPGA 4FLZA 1EWRA 4H5RA 4CBXA 1W0HA 1N5YA 4FJHA 3DI6A 4OO1J 4CZGA 3KKSA 2AP1A 4YHHK 1TUUA 2ZJPL 4YNQA 4DHYA 2VYPA 4CCHA 5BPMA 4B3TK 4YOWA 5AQTA 1BCOA 1C0TA 3AVCA 5C42A 3OYIA 4W5TA 1ZBLA 4M45A 3OYKA 4OLBA 5C2FA 4JHDB 4CHNA 4ID5A 2P9IA 3LWLA 1X3NA 4N56A 4DTRA 3VA3A 3WQTA 3T1AA 1CZ9A 3QBXA 3C6HA 5DM6L 3QO9A 3SV3A 4FZXC 4Z4CA 5AQKA 4LF8K 3HPHA 4B8AB 2H3GX 4E7HA 2ZJQL 1SL2A 5AQHA 5J2PA 3JXUA 1OKJA 3K5NA 1K73O 4WFAL 2JWKA 3K5MA 1QTMA 1TK5A 1B92A 3OYJA 2P9SA 4BRCA 4DV4K 5D3GA 1S6QA 2KLAA 1Y64A 2BGGA 2A1RA 4A2AA 3B6PA 2F4VK 3OVNA 4FZZA 3DOKA 2HHXA 4IEIA 4B1YB 2O8BB 4YOYA 3Q7CA 3HXMA 4ELVA 2BTFA 3O9SA 1LOTB 3DLKA 5E41A 4X66K 1D4XA 1RFQA 2X78A 3ENOA 1HMVA 3FE1A 2Q31A 5C2DA 1U6ZA 1WSJA 3G0ZA 3AAPA 4LFAK 3K5LA 4GV6A 3P31A 4CIGA 3NF8A 2BDPA 4BC3A 3O3GA 3RR8A 4B3MK 1VQPN 2HNYA 4NCAA 3ZLJA 2YHWA 4AHRA 3TTDA 1RT1A 1GOCA 4DQPA 1RT5A 4DV6K 3C95A 4EIAA 4DTPA 4J2DA 2Q1NA 1F21A 4BRAA 1YT3A 3V81A 1K9MO 1RTHA 4DQ8A 3OS0A 4FXDA 3RWUA 4K42A 2GX9A 3THXB 2PZSA 3M8SA 4E7KA 1SS6A 2Q3SA 4Y1CA 2X74A 3QEIA 4CFBA 4J2EA 2HHSA 4F9OA 1OVQA 3LAMA 5KPTA 4EFHA 3HVTA 4BR9A 4FLYA 2DPNA 4GVMA 4B9SA 2Z1GA 4B9MA 1XNRK 2WBNA 3HYFA 1YXQA 1IG8A 1KXPA 3KTQA 4BE2A 2KFNA 1BDGA 2D4WA 3V1OA 5CR4A 4BACA 1ASWA 1BQMA 4JHDA 1ZBFA 4FO0A 4FJKA 2ZM6K 5HRSA 3P1GA 2P9PA 1EQYA 3H45C 3FZKA 3OS1A 1QQOA 4AM7A 1N34K 3VEZA 4X64K 5F0XA 1C1BA 3T1YK 3TPQA 1YUWA 1RBSA 1TGOA 1NK8A 3T69A 4NCGA 3PV8A 2IAJA 2NRWA 2Q0RA 3VGMA 4DU4A 1L3UA 1BA1A 1HNVA 3ULDA 1T8EA 2FF6A 1Z05A 3CCJN 3QEVA 2P9SB 3CJCA 4NXMK 1JLEA 1QZ5A 4CGDA 3HP9A 2YNHA 3A5LC 5HBMA 4B9UA 3GOIA 1VQ8N 1VQ7N 1CZAN 2YHXA 5BN9A 4BRMA 4JI3K 3CHWA 4JI4K 1JCEA 3LP3A 4FWRA 3I55N 2VGMA 4JI6K 3VQ5A 4FWSA 3VQAA 2HMPA 3TAPA 1C0FA 4N5SA 4CFCA 2QM1A 1U4BA 2HB5A 3CPWM 4DS5A 4CJ5A 1QS4A 2OA8A 2DFEA 3L2VA 2P1JA 2WC9A 1JCGA 1GLCG 2VWJA 3ATUA 1WNSA 3VPZA 4BR7A 4DV7K 2QKBA 2P9UA 3HM9A 4O0JA 3GBTA 1LWEA 3DOLA 1S22A 3OW2M 4H4MA 2E1YA 1JLQA 2NUBA 1XHXA 4WCEL 3RR7A 3JYTA 1QSYA 3N4QA 1KSPA 3OYHA 4FWLA 3S3NA 1VQLN 3VF2A 4JI8K 1C0MA 1NGJA 4CGHA 4DUZK 1NJIO 4BR2A 4BR0A 2E20A 5AQZA 1HYZA 3EYZA 2E6MA 3MECA 1RILA 3SBGA 4W5QA 4E19A 4F8RA 3LWMA 3O6WA 3PLAA 4CEBA 1VQ9N 3G6EN 1TKZA 4LF4K 1ATRA 1HPZA 3CCLN 3HP6A 3VEVA 4M3TA 2GEMA 2NZTA 1NKCA 3DAWA 3MDQA 4M3RA 2FBTA 4I2PA 4Q0BA 3AO1A 1Q7YO 5BRFA 3GG4A 5HOOA 1NK9A 2A41A 3T3FA 2VGNA 1O13A 4F2RA 4M42A 5HRNA 5AQRA 3IMXA 4OKEA 1HYSA 3PY8A 3NE6A 4DQQA 2JGUA 4BC4A 3KK1A 4H03B 3HVRA 4N41A 1VK0A 4AF1A 3E1YA 2ZE2A 3MK6A 1QSSA 4DV2K 3G4SN 4H5TA 3WT0A 1WUAA 2HF3A 5AQPA 1Q8IA 4I7FA 3MWPA 1NMNA 4LD0A 1EXQA 1XWLA 2HNZA 3WXIA 4CJKA 1HNXK 1T3VA 2D0PA 1RT2A 3VTIA 3AY9A 2O8CA 2ZQBA 4IDHA 3JSMA 1JL1A 1VSHA 1Z25A 4E1MA 1HNWK 1W97L 4O5BA 4O44A 1S3XA 4A57A 4CK3A 5KRSA 3AVAA 1LWCA 3B6OA 1BA0A 1WBDA 4M41A 2WOMA 4KPYA 4RW8A 1Q81O 1D9FA 3OBWA 3HT3A 4LH4A 4CIFA 3S3OA 4C8LA 3L2WA 3O9QA 3R1XA 4BE1A 2YKMA 4B1WB 3HSCA 5J2MA 3FFIA 3SQ1A 4QS8A 4C8NA 2QK9A 5F2RA 3DXMB 4HTLA 4YOVA 4DR4K 3IG1A 2HBJA 1T05A 2E2OA 3A0IX 4FPBA 1RT7A 3ZSQA 2DY4A 4A59A 4PQUA 4IG0A 3K59A 3SBTA 3H1QA 3BZKA 2CGJA 1NGIA 3NF7A 3DM2A 3P5JA 4BREA 4WQ4A 1B9DA 2ZWHA 3UKUB 4AHUA 1G99A 3AVFA 3IAYA 4B08A 1BGXT 1U45A 1L3TA 2KHOA 3CG7A 5TKWA 1QHTA 1BIZA 5BN8A 4W5OA 2BE2A 4H4OA 4DTJA 3THVA 1VQNN 1ZBIA 3NCIA 5HRPA 4CJFA 1KAZA 3KLIA 5KQ8A 1VQ6N 3O9TA 1VAZA 3TTFA 3AVIA 4GMJB 4H0VB 3SAFA 4DQRA 3U9ZA 4B1UB 5HROA 3ENHA 3MN9A 1U04A 4ICLA 4JD2A 3OJSA 4FWMA 4AHSA 1QVFM 3NAEA 4Z4FA 3MXIA 3TABA 1QZ6A 1FK9A 3QICA 1HLUA 5AQJA 3ZETA 5C25A 2FLOA 4BR4A 4I9LA 3KHYA 1L3VA 2NRHA 4ILGB 2Z1IA 4DFPA 5FRNA 1NGFA 3R3LA 3LDPA 1FXXA 3O08A 3N4PA 1VSMA 3V9WA 2O8CB 2ASMA 2VWKA 4FL9A 3AA5X 4GV9A 4NYFA 4BRLA 3MWTA 1ESVA 2ZJRL 1NOZA 3CFOA 4DV5K 5IWAK 2HSTA 3RMAA 2O8DB 4B3SK 1RBTA 3HL8A 1X3MA 4BVPA 2QWQA 1U49A 4FM1A 3IRXA 1YJ9N 3L2RA 4CD3A 4MFBA 1SAZA 2YHYA 4KAZA 4JKBA 3FZLA 3ZT1A 1HKBA 1WSIA 4YFUA 4CHQA 4CHYA 1XI1A 4FPAA 1S1TA 4B3RK 2P9LA 4R5PA 2XY7A 4KHQA 2VWBA 3VN5A 3CI5A 5E26A 4NXNK 5BR8K 1Z6RA 3THWA 1WLJA 4K25A 4FLVA 4EHUA 2YJEA 3BZCA 3EN9A 3CPEA 1WSFA 4IWVA 4JI0K 1QQMA 3CYMA 3SMSA 3A2FA 3D0PA 2DFFA 2XY5A 4UY8O 1EO1A 4K0KK 2I7NA 1JXEA 4WE1A 3CMAN 4KTWA 4CE9A 5BRDA 2RHKA 3EL2A 3PO5A 4XH1A 5AQOA 4CF9A 5BR9A 4RW7A 3LL3A 3HBTA 5KQDA 3AA4A 3L6QA 1BOTO 5BPNA 3CQ8A 4KHNA 4M7YA 1RDBA 3TAQA 1WOQA 3WXJA 3THYB 2BANA 4HVJA 1YTUA 2P9KA 1IKYA 3BF1A 3HI0A 3TANA 4FOEA 3A5NC 2V51B 2EX3A 4KI6A 2YJFA 4JKGB 4M3XA 2IC3A 3D2FA 2NRVA 5CYQA 5FPNA 4KKOA 1RBUA 4JKCA 3OYFA 1NGHA 1YJWN 3O80A 2YCHA 4FJMA 2UU9K 3TARA 4NLBA 1NGBA 4JYAK 3CC4N 3AV9A 3TWHA 3DLRA 4FJ7A 2YHAA 1S5JA 5HP1A 4KTQA 3CQYA 2HVHA 4CJVA 4G9ZA 2D0AA 3CJBA 3O8MA 5CYMA 4A2BA 3T7ZA 4OPHA 3V1RA 2QWLA 1C0UA 2E1ZA 4O5FA 2X6SA 5I9EB 4FYDA 3VQBA 5T7BA 1ATSA 2Y1IA 4BGAA 3QBWA 3NGIA 1KQSM 5M1QA 3AO2A 1BL3A 1TL1A 2ASOA 3M1FA 4CF2A 4B9QA 1MWMA 4ISEA 3ZSWA 4FSVA 5AQIA 4MQ3A 2F7TA 1BI4A 4C8MA 4BWJA 3DLBA 5M1KA 3UIQA 3BDPA 4DSJA 2FSJA 3SPYA 3SZ2A 4RW6A 3THWB 1NKBA 4K43A 1FW6A 1NGAA 2E2NA 5C10A 4E1JA 1P8ZA 2OYQA 3AA3A 4AH9A 4CECA 3J80O 3PX6A 2ZD1A 3SQ0A 3HSTB 2O8EA 5CHIA 4BRFA 4EP5A 4IXCA 4JKFA 3I0SA 4OPAA 4HCBA 3RRGA 1H1VA 2GTDA 4AHTA 3FZFA 3KLFA 4Z0UA 4JK7A 4BY9C 5KGWA 4H0TB 3HOTA 3K2PA 3OYAA 3VF6A 3VERA 4CZHA 4GKJK 4KH5A 5M1OA 3MCPA 2IVPA 1BCMA 4JK9A 3TTCA 2FBVA 3WEEA 4FLXA 1TV6A 1WAJA 3HOSA 4FOIA 3A5MC 4TSXA 1GOBA 1TYQA 3MN5A 3NHGA 4KB0A 4L3QA 4PKGA 4CJWA 3ZT2A 4XIUA 1IKWA 1TKDA 3HO1A 4JS4A 3L3UA 4ZHRA 2FXUA 4IZ9A 5JLFA 1Y97A 4CBUA 3PUFA 3ENBA 1K8KA 2QKKA 4JNEA 3LDLA 3DYAA 5CE3A 3DRPA 2G8VA 3O9UA 1YJNN 4CZIA 1RDAA 3FZMA 4M63C 2LSNA 3LDOA 2VQEK 1OH7A 1BWFO 4F3OA 2P9IB 3MN6A 4E3SA 1WSEA 2KFZA 4CGFA 4WQ5C 3T19A 2YNIA 2FSNA 2GV9A 1T7PA 4FJNA 4KHUA 4YOUA 4B9VA 1RT4A 1GLAG 2UXCK 1EP4A 1YTAA 2FBYA 3CM6A 4PKIA 4BVOA 3VOVA 4YOXA 1CXQA 2W6KA 3CCRN 4HUEA 4BQLA 5JICA 5JMVA 4M3ZA 1TAQA 2V52B 4JK8A 4MO4A 5AFUH 3ZCMA 1OH5A 3LP2A 1U2VB 3QNOA 3QDKA 3CC7N 3SJJA 2FC0A 4LF5K 2P9NB 1IBMK 4DV3K 1S9EA 4CEFA 1TUYA 4KV8A 3PX4A 1NK6A 1KLMA 3OYCA 4BRNA 2GWJA 2KZZA 4IG3A 3ALYA 3H6EA 4DSLA 4DR6K 2PAVA 4LH5A 4CJ4A 3WNGA 3CCUN 4XEIA 4PA1A 4M3WA 3D45A 3NVKA 4A5AA 3H3NO 1Z26A 4BDPA 3MX2A 1ITGA 1NJXA 4FLWA 4BRIA 4CJTA 2KTQA 3L2UA 3DLHA 2O4IA 3KD1E 5SZTA 2G8UA 3M8RA 2HNDA 5ADXA 2D0CA 1TYQB 4CK2A 3THXA 3FGUA 3K5OA 4DTMA 4DMNA 3O3FA 2YV0X 1S1XA 3KK3A 3O4WA 1JLCA 3L2QA 4JRPA 3H08A 1NU0A 4AHVA 2FF3B 3SNNA 3MXMA 2O4GA 4J2BA 1HJOA 4FZYA 2QW9A 1J6ZA 2W41A 3VEXA 4JN4A 1O1WA 1GLEG 3OY9A 4CJRA 1UA1A 4DR5K 4CZLA 3L0QA 2KKZA 4FK4A 2F8SA 5BPLA 3ZT3A 2G8FA 2E2PA 1TAUA 3K9JA 4GV3A 4ISFA 4L8RB 3CFPA 2A6AA 1T03A 1HKGA 3CCVN 3DLLL 4ZTFA 3SAHA 1B9FA 4FWQA 2V7ZA 5HL7L 2DTUA 4LC9B 2RN2A 2F8TA 3NH0A 3UKRA 3D6RA 1HR0K 1NLVA 3F9MA 1WB9A 4HCCA 4WFNL 1E3MA 3V9SA 2Q36A 2G8IA 3K9KA 5KTQA 3KK7A 1RDDA 3QIOA 3L4QA 1VSEA 1RGIA 3OYEA 3QEXA 5BRHA 4IOXA 3CJ9A 4CFAA 2UXBK 1KAXA 4E7IA 1Q18A 1KCFA 2G8HA 3CIPA 2UUAK 5MLCQ 3OJUA 1NGDA 5EX5A 3SJHA 5AQMA 3T1HK 1VQKN 1J9AA 3CJAA 4DF4A 5DM7L 1JLAA 3VGKA 3BY5A 5JS1A 3WNEA 4Z4GA 1XQSC 4KRFA 1UWBA 3EE8A 4YY3K 4CK1A 1IBLK 4NYNA 4FJJA 3NMUA 1W2BM 4DR7K 2E4LA 3JS6A 4IBNA 5M1FA 2B6AA 1NGEA 3CETA 5EOYA 4H0YB 1GLJO 2UXDK 1ILYA 5EXWA 1NGCA 4BRQA 4C1NI 3O3HA 4CIEA 3TSPA 3CCSN 1XUPO 4N76A 3KLHA 4HWIA 4M3UA 1LW2A 1XC9A 1YF5L 2VG7A 3BF3A 3D2EB 2F96A 5TKYA 4G1QA 4EHTA 2B4JA 3WXKA 2O8FA 4DV0K 3FLCO 5FRMA 2YNFA 4CEDA 3DMJA 2F9WA 2XRIA 4FJGA 3DRSA 3A8YA 2D0OA 4CGIA 1X9JA 3QB0A 3P4IA 4NO7A 4CFDA 4JKAA 1RBVA 3ATVA 1HJRA 2OTJN 1S1WA 3CJ1A 5FLXO 3L8BA 4A62A 3KD5E 3O1WA 2E8AA 1WAFA 3C6UA 4CF1A 4BE0A 3CCMN 1UOCA 3VQ6A 3PSIA 4K8ZA 3LDNA 4IDKA 3ZEUA 3AO4A 3SUOA 1DT9A 1GLDG 3ID6A 3CFRA 4F4KA 4FLUA 3PSFA 1BUPA 1X1PA 3BP8A 1Q9YA 1KD1O 5BREA 1ZXOA 3P39A 4AILC 4XH4A 2E2QA 3H3OB 1IG9A 4LFCK 5AZIA 1BG3A 4CZMA 1DKGD 2BH1A 5KRTA 3LDQA 4XH5A 3VTHA 1EETA 3WXLA 4CJLA 1X9SA 4DU1A 4DTXA 4BR5A 2HHQA 4CEOA 4CJQA 3EE9A 4J8FA 1U47A 3LPTA 3I33A 4IFYA 3OS2A 4OJRA 1WBBA 3RSEB 5LY3A 1ZBUA 2ITMA 4B9LA 4PL8A 4B1XB 3VMFB 3CD6N 1LWFA 2BUPA 5KPZA 2Q2RA 4KB1A 4FJ8A 1BHLA 4H0OA 4K41A 3WNFA 4OVLA 3M8PA 3VQ8A 5I3UA 4E1NA 4KHPK 1GLLO 4DWIA 3DXKA 5C24A 3OA9A 4HUGA 2QTDA 1VSIA 2RPIA 1D5AA 2AA4A 4LF6K 4KFBA 1XMOK 5K14A 4B3OA 1IKVA 1P90A 4IO8A 4CZKA 4Q5VA 1DTTA 2OPPA 1HKCA 4EZ9A 2ITGA 4RW9A 1NJWA 1YAGA 3MN7A 1GLFO 3S3MA 3UKUA 1S1UA 3K58A 3MX5A 3I8DA 4DUYK 1VSDA 1SL1A 2A3ZA 2VG6A 2O8FB 1JXBA 3HZ6A 4HHTA 3QESA 4YOTA 1GOAA 3SPZA 2UUCK 3VF4A 4KH6A 3ZX0A 1WN7A 2KQ2A 1M90O 2RF2A 4DSKA 4WQ4C 4O0IA 3U3GA 4MLHA 1VRTA 4RTFD 1IKXA 1TVRA 3QIPA 1TK8A 3QNNA 4JD2B 1NM1A 4DQSA 3SCXA 2GUIA 5FROA 2A42A 1X9MA 4C8KA 5AQVA 1RTDA 2QA4N 3U3YA 3ZETB 1RDUA 1ATNA 1EWQA 3C6TA 3S41A 2OPSA 4CJ3A 2NRZA 4CJEA 3NH1A 3PIPL 2WFBA 3G71N 3L3VA 5CY4A 1SZ2A 4AM6A 4DSFA 3MAQA 1ASVA 2ATQA 1VSJA 5AQXA 3LZJA 3KWIA 1WSHA 5AZIB 4FM2A 3A5OC 3NVMA 4GNIA 3VESA 1C1CA 2UUBK 4JI1K 3F73A 5AQNA 2FBXA 2IVNA 5LMNK 3AVHA 2O8DA 5I42A 1NK0A 4M7XA 3C0BA 4H5VA 3PX0A 2AJQA 3EZ5A 1HQEA 4CEZA 2W42A 3RSEA 5HRRA 1N8RO 3O5BA 4J2AA 4IFEA 4A5BA 3EEQA 4O55A 2ASPA 2OANA 2QWOA 3AVGA 3KJVA 4PHTX 4BRDA 3V6DA 1DLOA 5AQUA 3ZX2A 3OTOK 2P9LB 3R6MA 3V9UA 3NGYA 4N47A 3TR8A 2JWLA 3SQ4A 2HVIA 2IS3A 3DXKB 5LJWA 4JS5A 4FWPA 1UA0A 3M3ZA 3M6GA 4EP4A 2IOCA 3MXJA 3CCQN 1EX4A 1R59O 3ZSRA 1OH6A 4B8CA 3UB5A 5FPDA 1KTQA 4CGJA 4B1VA 2X6NA 1J5OA 3WXMB 3CC2N 5J2QA 1SKSA 1A5XA 2QEXN 1JLFA 4U67L 4O4GA 2VG5A 4LF7K 4CZJA 1NK7A 1KC8O 3O4NA 2HF4A 2YHBA 4JKHA 1RDWX 3VQEA 4IOCL 1J53A 1LAWA 4C8OA 4DR2K 1QSLA 3CF5L 2PY5A 5GAEP 2W40A 4Y1DA 5AJ3K 4YORA 3QEWA 5ADXH 3E01A 5JVHL 5KGXA 3THYA 3Q7BA 2NNWA 2P9KB 3LP1A 1VQ4N 4BQZA 4AQYK 1X9WA 3VQ9A 4JKGA 2A5XA 3D2FB 3E9OA 5HLFA 4JKEA 3QINA 5AQYA 2P5OA 3IDHA 1CLQA 1HUXA 1W9HA 3R8EA 3TSUA 3NGZA 1I94K 4YDUA 5CZ1A 1QQCA 3G10A 3U4LA 4Z94A 4DF8A 3CMEN 2QXLA 2PBDA 1S6PA 4FWOA 4JLHA 5AZJA 3ZYYX 3RRHA 1A5WA 2P9PB 4BWMA 4JI7K 3ZT4A 4CBWA 3ULEB 4JV5K 2I7PA 4CW7B 3J81O 2ZF5O 2G8KA 5LJVA 3V4IA 2YNGA 1K6YA 2IVOA 3HRGA 3VEYA 4CEAA 1RBRA 5SWMA 3SUQA 3IFRA 1YI2N 1FKOA 3IUCA 3SQ2A 4RW4A 3SK3A 2E6LA 4FM0A 3DRRA 1BISA 4A61A 3MMVA 3WNHA 3SV4A 3WUHA 3NF6A 1NJZA 5J2NA 1BI4B 4OKKA 1XMQK 2QWPA 4QCLA 3E66A 4CI6A 5AQWA 1RDCA 3KK2A 4DR3K 1NK4A 2G8WA 5EVZA 1S1VA 3M8QA 5DK5A 3EO3A 1MDUB 3C6AA 3DLEA 3W3DA 1EKEA 4ILJA 1LW0A 1RCHA 1VSLA 3VENA 1RNHA 4BROA 2VCPA 3U9DA 3SAGA 3KWGA 4IOAL 4CJUA 3OYNA 3TSQA 4DKWA 1TKTA 4B9NA 4AHCA 1YIJN 5KI6A 4PWDA 3VQPA 3LAKA 3K0SA 1DEJA 4W5RA 4ELTA 4BRPA 2HHTA 2P9UB 3AVLA 4IKFA 3BEXA 4B9TA 3R9PA 5JVGL 1JKHA 1VSKA 3B8AX 1YITN 3ITHA 3SI6A 4Y0WA 3V9ZA 1RT3A 1S72N 3SLCA 4DTUA 3FZHA 4BG8A 1LCUA 5AQSA 1KVBA 1RT6A 4KTZA 2NRTA 4DV1K 3V9XA 4CHZA 4RG8A 4F2SA 3ZT0A 4BRHA 2Q97A 1KVCA 4CZEA 3ID8A 3NFAA 1K8KB 5AQQA 4I2QA 2A1SA 3VA0A 1OVYA 1L5UA 3DJCA 1CXUA 3OYLA 4QS7A 2YX6A 3UE5A 2XY8A 1SKRA 4I6MB 3ZSYA 4MLEA 3AVJA 4LFBK 4MDBA 1VQMN 1NG9A 4KHWA 3G25A 2WUSA 3CM5A 5B8HA 4DU3A 1BQNA 1HX1A 2OPQA 1Q86O 4ID1A 1L3SA 5AZJB 2IIRA 5AFUA 4V19S 3C94A 1BU6O 4B1ZA 2QWMA 3HPOA 4DFMA 3I0RA 2UYTA 3HK2A 1YVNA 3ULEA 2ZGZA 3SUNA 3CCEN 4JAXA 3K57A 3OHRA 3O1BA 4HUFA 4CJSA 1VHXA 5M1NA 4H0XB 4PKHA 1JL2A 3TAGA 1LAVA 3ISNC 3DWLA 3AO3A 3CJ7A 3NDKA 1IO2A 2J4RA 5JS2A 4GKKK 1U2VA 3EKUA 3KLEA 4FCYA 3KLGA 1E4GT 3U8XA 3QFUA 4OGCA 2P9NA 3U6FA 2D5RA 2Z1HA
chains in the Genus database with same CATH topology
1RDBA 3K5LA 3TAQA 4CIGA 3NF8A 4OPJA 4DFKA 2BDPA 3VQDA 2BANA 4FJIA 4HVJA 1IG9A 2OZMA 3O3GA 1YTUA 3RR8A 1IKYA 2R7YA 1UAXA 2HNYA 4NCAA 5KRTA 3TANA 4AHRA 5EU7A 1RT1A 1GOCA 1EETA 4DQPA 2WONA 1RT5A 4CJLA 1X9SA 2EX3A 3C95A 4DU1A 4DTXA 4DTPA 4J2DA 4KI6A 2HHQA 4M3XA 1F21A 2IC3A 3AVMA 1YT3A 3AA2A 4CEOA 5CYQA 3V81A 4NCBA 4CJQA 1R0AA 1BIUA 1RTHA 1RBUA 4KKOA 1U47A 3OYFA 1JLGA 3LPTA 3OS0A 4DLEA 1KLNA 4IFYA 3OS2A 4PUOA 4OJRA 3KKRA 4FXDA 3RWUA 4DTNA 3P83D 2OZSA 4FJMA 3TARA 1ZBUA 4B9LA 2PZSA 3AV9A 3M8SA 3TWHA 3DLRA 4QOZB 4E7KA 4FJ7A 2YHAA 2Q3SA 1S5JA 4Y1CA 4DTOA 2X74A 3QEIA 5HP1A 4FW1A 4KTQA 4CFBA 4AILC 1LWFA 4J2EA 2HVHA 2HHSA 2XY6A 3LAMA 4CJVA 2D0AA 4FJLA 4OGEA 5CYMA 4KB1A 4FJ8A 1BHLA 3HVTA 3EY1A 1JLBA 3WNFA 4OVLA 4FLYA 2Y1JA 2IDOA 3LALA 3M8PA 4GVMA 3BGRA 3VQ8A 4LY7A 3MEGA 5I3UA 4B9SA 2Z1GA 3V1RA 4E1NA 1C0UA 4B9MA 4DWIA 5C24A 3HYFA 3KTQA 4BE2A 2KFNA 2X6SA 1DTQA 4HUGA 4K8XA 4FYDA 2RPIA 1VSIA 3V1OA 3VQBA 1D5AA 5T7BA 4CEEA 2Y1IA 4BACA 1ASWA 1BQMA 4KFBA 5K14A 1ZBFA 3NGIA 4FJKA 4B3OA 4Z4IA 2I5JA 5HRSA 3P1GA 1IKVA 1HRHA 4Z4HA 4Q5VA 3AO2A 1BL3A 3LANA 3SUPA 1DTTA 2OPPA 4EZ9A 1HYVA 2ITGA 1TL1A 3OS1A 2KZMA 4CF2A 4RW9A 1J54A 3V1QA 3OYDA 1NJWA 4FK0A 4FW2A 3S3MA 2D0BA 1S1UA 3ZSWA 1C1BA 4MQ3A 3K58A 1RBSA 1TGOA 1BI4A 1NK8A 4C8MA 4NCGA 4BWJA 4CGGA 3I8DA 3PV8A 3DLBA 1VSDA 1SL1A 3UIQA 4HTUA 2IAJA 1ZYQA 2VG6A 3BDPA 4CF0A 4DSJA 4DU4A 1L3UA 1JXBA 3SPYA 1HNVA 3ULDA 3SZ2A 2HMIA 4RW6A 4HHTA 1T8EA 4FJ9A 3QESA 1NKBA 3QEVA 1RTIA 1GOAA 1JLEA 4CGDA 3HP9A 2YNHA 3QETA 3RMCA 3AA3A 4AH9A 4CECA 3SPZA 2OYQA 4FLTA 5HBMA 3F9KA 3PX6A 4B9UA 2ZD1A 4FK2A 3HJFA 3SQ0A 1LV5A 3HSTB 1NJYA 1WN7A 2KQ2A 2RF2A 4DSKA 4O0IA 3U3GA 4DS4A 3AVNA 1VRTA 2HHVA 4EP5A 1IKXA 1TVRA 4CJPA 3OYBA 3I0SA 3QIPA 5CZ2A 3QNNA 1TK8A 4HCBA 3RRGA 4BDZA 2EHGA 4CESA 4DQSA 4AHTA 3LP3A 3ZSOA 2GUIA 4Z0UA 5FROA 3KLFA 3SCXA 1X9MA 3VQ5A 5KGWA 3RMBA 4C8KA 3VQAA 1TK0A 3K2PA 3OYAA 3TAPA 1RTDA 5DMRA 3U3YA 4N5SA 4JRQA 3MEDA 4CFCA 4CERA 1BCMA 4KO0A 1IH7A 3C6TA 3OYMA 1U4BA 2HB5A 2PYJA 2OPSA 4DS5A 4CJ5A 4CJ3A 1C1AA 2FBVA 4FLXA 1SL0A 1TV6A 1QS4A 1YVUA 4CJEA 2DFEA 3NH1A 3L2VA 1WAJA 4OPKA 2OA8A 2ETJA 2P1JA 5FDLA 4CHOA 2RKIA 3L3VA 4TSXA 3RMDA 5CY4A 1GOBA 2VWJA 1D8YA 1WNSA 4DSFA 3MAQA 1ASVA 2QKBA 3HM9A 3NHGA 4O0JA 4KB0A 2ATQA 1VSJA 1LWEA 3LZJA 3DOLA 4CJWA 3ZT2A 1WSHA 4XIUA 4FM2A 4OLAA 3S9HA 1IKWA 4H4MA 4CF8A 1TKDA 3HO1A 2NUBA 1JLQA 3RR7A 1FKPA 1XHXA 3JYTA 4JS4A 1QSYA 3L3UA 4ZHRA 3OYHA 3S3NA 1KSPA 4QAGA 1Y97A 1C1CA 3PUFA 3F73A 2QKKA 1C0MA 1VSFA 2FBXA 3AVHA 4GW6A 4OKJA 4CGHA 3DYAA 3DRPA 5I42A 1NK0A 1HYZA 3EYZA 3PX0A 1I3AA 2E6MA 3MECA 3EZ5A 1KFSA 2G8VA 1HQEA 3VQ7A 1RILA 4CEZA 1RDAA 4W5QA 2W42A 5HRRA 4E19A 1RTJA 3LWMA 4F8RA 2LSNA 3O4QA 4J2AA 4CEBA 4IFVA 4F3OA 4DSEA 1TKZA 4O55A 4E3SA 3SYZA 1WSEA 3AVGA 1HPZA 3KJVA 4CGFA 2KFZA 3T19A 3HP6A 4E7LA 4M3TA 2YNIA 2GV9A 1T7PA 3V6DA 1DLOA 1NKCA 3V9UA 4M3RA 4KHYA 3NGYA 4FJNA 4KHUA 2FBTA 4I2PA 1QE1A 4N47A 1RT4A 3TR8A 4B9VA 3SQ4A 4Q0BA 1EP4A 3AO1A 2HVIA 2IS3A 1YTAA 2FBYA 3LPUA 3ZSVA 4JS5A 3CM6A 3T3FA 1NK9A 4UQGA 4F2RA 4E7JA 4M42A 1UA0A 5J1EA 2B5JA 4EP4A 2IOCA 3MXJA 5HRNA 3TI0A 3AVBA 3QLHA 4OKEA 1EX4A 1HYSA 3ZSRA 3PY8A 4B8CA 3NE6A 4DQQA 2JGUA 3KK1A 1CXQA 1KTQA 4CHPA 3HVRA 4HUEA 4CGJA 4N41A 4M3ZA 1VK0A 2X6NA 1MU2A 1J5OA 1TAQA 3LDSA 5J2QA 1A5XA 1SKSA 1JLFA 2ZE2A 4O4GA 3ZCMA 2VG5A 1QSSA 1TKXA 4H8KA 3LP2A 3QNOA 1NK7A 3SJJA 3O4NA 2FC0A 1Q8IA 4I7FA 4LD0A 2YHBA 3TAEA 4DTSA 1EXQA 1S9EA 1XWLA 3AO5A 3VQEA 4CEFA 3TAFA 4KV8A 2HNZA 3PX4A 3NBPA 4CJKA 1RT2A 1J53A 1LAWA 4C8OA 1WSGA 2ZQBA 1QSLA 3JSMA 1KLMA 1JL1A 1VSHA 1Z25A 4E1MA 3OYCA 3LZIA 1NK6A 2PY5A 1SKWA 1SV5A 2KZZA 4IG3A 3ALYA 4O5BA 4Y1DA 4DSLA 4O44A 3QEWA 2GBZA 3E01A 4LH5A 4CK3A 5KRSA 4CJ4A 3AVAA 5KGXA 2OPRA 3WNGA 2QXFA 1TL3A 4F3TA 4CEQA 1KFDA 1ZBHA 2YKNA 1I39A 1LWCA 3DLGA 4PA1A 4M3WA 4PY5A 3D45A 3VQQA 3B6OA 3LP1A 3ZSXA 4M41A 2WOMA 1Z26A 3QEPA 1NK5A 4KPYA 4RW8A 1D9FA 3KIOA 1X9WA 4BDPA 3HT3A 4LH4A 1ITGA 1NJXA 4FLWA 3VQ9A 4CIFA 3S3OA 4C8LA 4CJTA 3L2WA 2KTQA 3L2UA 4BE1A 2YKMA 5J2MA 5HLFA 3FFIA 3DLHA 2O4IA 3SQ1A 3KD1E 4EZ6A 1SUQA 3QINA 5SZTA 2G8UA 4C8NA 3M8RA 3LP0A 2HNDA 2P5OA 2QK9A 2D0CA 4DSIA 4I9QA 4CK2A 1CLQA 1W9HA 3K5OA 4DTMA 4DMNA 3IG1A 2XO7A 3O3FA 2YV0X 1S1XA 3NGZA 3KK3A 1T05A 4E0DA 2KW4A 4FVMA 5CZ1A 1JLCA 1QQCA 3L2QA 4JRPA 2IGIA 3G10A 1RT7A 1G15A 3H08A 1REVA 3ZSQA 3QERA 4DF8A 2AJQA 2DY4A 4W5NA 1C6VA 4AHVA 4PQUA 1S6PA 4M3YA 4IG0A 4JLHA 3K59A 2JLEA 1NKEA 3SNNA 3MXMA 2O4GA 3RRHA 4J2BA 3ASMA 4E89A 4FZYA 1A5WA 3NF7A 2HHWA 3DM2A 2P51A 4ZTJA 4BWMA 3P5JA 3ZT4A 4LSNA 1O1WA 1HNIA 3OY9A 1B9DA 4CJRA 2G8KA 1UA1A 4AHUA 3V4IA 2YNGA 1K6YA 4CEAA 5SWMA 3SUQA 3AVFA 1RBRA 3PO4A 4FK4A 3IAYA 2F8SA 3MEEA 1HQUA 3VQCA 4B08A 1BGXT 1U45A 1L3TA 2Z1JA 1FKOA 3NF9A 3CG7A 3SQ2A 4RW4A 3ZT3A 2HW3A 1QHTA 3ZSZA 1BIZA 2G8FA 1TAUA 2E6LA 4W5OA 2BE2A 4FM0A 3DRRA 1BISA 1KVAA 4H4OA 4LSLA 4DTJA 3THVA 4L8RB 1ZBIA 3NCIA 3WNHA 5HRPA 3CFPA 3SV4A 4CJFA 3KLIA 1T03A 3NF6A 1NJZA 2P5GA 4ZTFA 5J2NA 1B9FA 1BI4B 4OKKA 3AVIA 2DTUA 4GMJB 2RN2A 4BDYA 2F8TA 4QCLA 3NH0A 3KK2A 1A5VA 1RDCA 4DQRA 1NK4A 2G8WA 4KI4A 1S1VA 3M8QA 5DK5A 5HROA 4KREA 3DLEA 1NOYA 1U04A 4ICLA 4HCCA 1S9GA 4KHSA 1EKEA 3OJSA 3NH2A 3V9SA 1ASUA 1LW0A 1RCHA 4AHSA 3OYGA 1Q9XA 2PYLA 4FJ5A 2G8IA 1VSLA 5KTQA 3NAEA 1RNHA 1RDDA 4DFJA 4Z4FA 3QIOA 3MXIA 3TABA 1VSEA 1FK9A 4CJUA 3OYNA 3OYEA 3QEXA 5C25A 1TKTA 2XHBA 4B9NA 4DQIA 4AHCA 1VRUA 3RTVA 5KI6A 4PWDA 4CFAA 1L3VA 4I9LA 1KRPA 3VQPA 4E7IA 1D9DA 2Z1IA 4DFPA 5FRNA 3LAKA 1U48A 1KCFA 2G8HA 4FJXA 3TAMA 3AVKA 4W5RA 3OJUA 4ELTA 4Z4EA 2HHTA 1FXXA 2HHUA 3AVLA 4DLGA 1VSMA 1J9AA 4IKFA 1N6QA 3V9WA 4DG1A 4B9TA 4DF4A 1JKHA 2VWKA 2DFHA 3AA5X 4NYFA 1JLAA 1VSKA 5JS1A 3ITHA 3SI6A 3IS9A 1XHZA 3WNEA 4Z4GA 3V9ZA 4KRFA 1RT3A 4ELUA 3VQ4A 1CZBA 3HPGA 1NOZA 4FLZA 1UWBA 1N5YA 1W0HA 3CFOA 4FJHA 4CK1A 4DTUA 4NYNA 4FJJA 3DI6A 3KKSA 2E4LA 4IBNA 3RMAA 1RBTA 4YNQA 2B6AA 3HL8A 1KVBA 1RT6A 4CCHA 4KTZA 1U49A 1BCOA 1C0TA 3AVCA 5C42A 3OYIA 4FM1A 4W5TA 3V9XA 4CHZA 4RG8A 1ZBLA 3IRXA 4F2SA 3ZT0A 4M45A 3L2RA 3OYKA 4OLBA 4MFBA 4CHNA 1KVCA 4ID5A 4KAZA 3O3HA 3NFAA 4CIEA 4N56A 3LWLA 4I2QA 2A1SA 3ZT1A 3VA0A 3VA3A 4DTRA 4N76A 1WSIA 1L5UA 3T1AA 4YFUA 3KLHA 1CXUA 4M3UA 1LW2A 1XC9A 1CZ9A 4CHQA 3OYLA 4CHYA 2XY8A 1XI1A 1SKRA 3QO9A 3SV3A 1S1TA 3ZSYA 2VG7A 3AVJA 4R5PA 2XY7A 4KHQA 2F96A 4FZXC 4Z4CA 4KHWA 3HPHA 4B8AB 4E7HA 4G1QA 1SL2A 5J2PA 2B4JA 3VN5A 5FRMA 3CM5A 2YNFA 3K5NA 4CEDA 3DMJA 2XRIA 4DU3A 1BQNA 3K5MA 1QTMA 1WLJA 2OPQA 1TK5A 4FJGA 3DRSA 1B92A 4ID1A 3OYJA 1L3SA 4FLVA 4CGIA 5D3GA 1S6QA 3C94A 1WSFA 3HPOA 4CFDA 2BGGA 4DFMA 3I0RA 2A1RA 3B6PA 1RBVA 3HK2A 1HJRA 3OVNA 4FZZA 1S1WA 3DOKA 3CYMA 2HHXA 3SUNA 3L8BA 3A2FA 3D0PA 3K57A 3KD5E 2DFFA 2XY5A 4HUFA 1WAFA 4CJSA 3C6UA 4CF1A 1JXEA 4WE1A 4BE0A 4KTWA 1JL2A 1UOCA 3VQ6A 3TAGA 4CE9A 4K8ZA 3HXMA 1LAVA 4IDKA 4ELVA 3ISNC 3AO4A 3SUOA 3PO5A 4CF9A 3DLKA 3AO3A 3NDKA 4RW7A 5E41A 3CFRA 1IO2A 5JS2A 4F4KA 2X78A 4FLUA 3AA4A 1X1PA 1Q9YA 3KLEA 4FCYA 3KLGA 1HMVA 3CQ8A 4OGCA 4KHNA 1WSJA 3G0ZA 3U6FA 2D5RA 2Z1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RDB A;  3K5L A;  3TAQ A;  4CIG A;  3NF8 A;  4OPJ A;  4DFK A;  2BDP A;  3VQD A;  2BAN A;  4FJI A;  4HVJ A;  1IG9 A;  2OZM A;  3O3G A;  1YTU A;  3RR8 A;  1IKY A;  2R7Y A;  1UAX A;  2HNY A;  4NCA A;  5KRT A;  3TAN A;  4AHR A;  5EU7 A;  1RT1 A;  1GOC A;  1EET A;  4DQP A;  2WON A;  1RT5 A;  4CJL A;  1X9S A;  2EX3 A;  3C95 A;  4DU1 A;  4DTX A;  4DTP A;  4J2D A;  4KI6 A;  2HHQ A;  4M3X A;  1F21 A;  2IC3 A;  3AVM A;  1YT3 A;  3AA2 A;  4CEO A;  5CYQ A;  3V81 A;  4NCB A;  4CJQ A;  1R0A A;  1BIU A;  1RTH A;  1RBU A;  4KKO A;  1U47 A;  3OYF A;  1JLG A;  3LPT A;  3OS0 A;  4DLE A;  1KLN A;  4IFY A;  3OS2 A;  4PUO A;  4OJR A;  3KKR A;  4FXD A;  3RWU A;  4DTN A;  3P83 D;  2OZS A;  4FJM A;  3TAR A;  1ZBU A;  4B9L A;  2PZS A;  3AV9 A;  3M8S A;  3TWH A;  3DLR A;  4QOZ B;  4E7K A;  4FJ7 A;  2YHA A;  2Q3S A;  1S5J A;  4Y1C A;  4DTO A;  2X74 A;  3QEI A;  5HP1 A;  4FW1 A;  4KTQ A;  4CFB A;  4AIL C;  1LWF A;  4J2E A;  2HVH A;  2HHS A;  2XY6 A;  3LAM A;  4CJV A;  2D0A A;  4FJL A;  4OGE A;  5CYM A;  4KB1 A;  4FJ8 A;  1BHL A;  3HVT A;  3EY1 A;  1JLB A;  3WNF A;  4OVL A;  4FLY A;  2Y1J A;  2IDO A;  3LAL A;  3M8P A;  4GVM A;  3BGR A;  3VQ8 A;  4LY7 A;  3MEG A;  5I3U A;  4B9S A;  2Z1G A;  3V1R A;  4E1N A;  1C0U A;  4B9M A;  4DWI A;  5C24 A;  3HYF A;  3KTQ A;  4BE2 A;  2KFN A;  2X6S A;  1DTQ A;  4HUG A;  4K8X A;  4FYD A;  2RPI A;  1VSI A;  3V1O A;  3VQB A;  1D5A A;  5T7B A;  4CEE A;  2Y1I A;  4BAC A;  1ASW A;  1BQM A;  4KFB A;  5K14 A;  1ZBF A;  3NGI A;  4FJK A;  4B3O A;  4Z4I A;  2I5J A;  5HRS A;  3P1G A;  1IKV A;  1HRH A;  4Z4H A;  4Q5V A;  3AO2 A;  1BL3 A;  3LAN A;  3SUP A;  1DTT A;  2OPP A;  4EZ9 A;  1HYV A;  2ITG A;  1TL1 A;  3OS1 A;  2KZM A;  4CF2 A;  4RW9 A;  1J54 A;  3V1Q A;  3OYD A;  1NJW A;  4FK0 A;  4FW2 A;  3S3M A;  2D0B A;  1S1U A;  3ZSW A;  1C1B A;  4MQ3 A;  3K58 A;  1RBS A;  1TGO A;  1BI4 A;  1NK8 A;  4C8M A;  4NCG A;  4BWJ A;  4CGG A;  3I8D A;  3PV8 A;  3DLB A;  1VSD A;  1SL1 A;  3UIQ A;  4HTU A;  2IAJ A;  1ZYQ A;  2VG6 A;  3BDP A;  4CF0 A;  4DSJ A;  4DU4 A;  1L3U A;  1JXB A;  3SPY A;  1HNV A;  3ULD A;  3SZ2 A;  2HMI A;  4RW6 A;  4HHT A;  1T8E A;  4FJ9 A;  3QES A;  1NKB A;  3QEV A;  1RTI A;  1GOA A;  1JLE A;  4CGD A;  3HP9 A;  2YNH A;  3QET A;  3RMC A;  3AA3 A;  4AH9 A;  4CEC A;  3SPZ A;  2OYQ A;  4FLT A;  5HBM A;  3F9K A;  3PX6 A;  4B9U A;  2ZD1 A;  4FK2 A;  3HJF A;  3SQ0 A;  1LV5 A;  3HST B;  1NJY A;  1WN7 A;  2KQ2 A;  2RF2 A;  4DSK A;  4O0I A;  3U3G A;  4DS4 A;  3AVN A;  1VRT A;  2HHV A;  4EP5 A;  1IKX A;  1TVR A;  4CJP A;  3OYB A;  3I0S A;  3QIP A;  5CZ2 A;  3QNN A;  1TK8 A;  4HCB A;  3RRG A;  4BDZ A;  2EHG A;  4CES A;  4DQS A;  4AHT A;  3LP3 A;  3ZSO A;  2GUI A;  4Z0U A;  5FRO A;  3KLF A;  3SCX A;  1X9M A;  3VQ5 A;  5KGW A;  3RMB A;  4C8K A;  3VQA A;  1TK0 A;  3K2P A;  3OYA A;  3TAP A;  1RTD A;  5DMR A;  3U3Y A;  4N5S A;  4JRQ A;  3MED A;  4CFC A;  4CER A;  1BCM A;  4KO0 A;  1IH7 A;  3C6T A;  3OYM A;  1U4B A;  2HB5 A;  2PYJ A;  2OPS A;  4DS5 A;  4CJ5 A;  4CJ3 A;  1C1A A;  2FBV A;  4FLX A;  1SL0 A;  1TV6 A;  1QS4 A;  1YVU A;  4CJE A;  2DFE A;  3NH1 A;  3L2V A;  1WAJ A;  4OPK A;  2OA8 A;  2ETJ A;  2P1J A;  5FDL A;  4CHO A;  2RKI A;  3L3V A;  4TSX A;  3RMD A;  5CY4 A;  1GOB A;  2VWJ A;  1D8Y A;  1WNS A;  4DSF A;  3MAQ A;  1ASV A;  2QKB A;  3HM9 A;  3NHG A;  4O0J A;  4KB0 A;  2ATQ A;  1VSJ A;  1LWE A;  3LZJ A;  3DOL A;  4CJW A;  3ZT2 A;  1WSH A;  4XIU A;  4FM2 A;  4OLA A;  3S9H A;  1IKW A;  4H4M A;  4CF8 A;  1TKD A;  3HO1 A;  2NUB A;  1JLQ A;  3RR7 A;  1FKP A;  1XHX A;  3JYT A;  4JS4 A;  1QSY A;  3L3U A;  4ZHR A;  3OYH A;  3S3N A;  1KSP A;  4QAG A;  1Y97 A;  1C1C A;  3PUF A;  3F73 A;  2QKK A;  1C0M A;  1VSF A;  2FBX A;  3AVH A;  4GW6 A;  4OKJ A;  4CGH A;  3DYA A;  3DRP A;  5I42 A;  1NK0 A;  1HYZ A;  3EYZ A;  3PX0 A;  1I3A A;  2E6M A;  3MEC A;  3EZ5 A;  1KFS A;  2G8V A;  1HQE A;  3VQ7 A;  1RIL A;  4CEZ A;  1RDA A;  4W5Q A;  2W42 A;  5HRR A;  4E19 A;  1RTJ A;  3LWM A;  4F8R A;  2LSN A;  3O4Q A;  4J2A A;  4CEB A;  4IFV A;  4F3O A;  4DSE A;  1TKZ A;  4O55 A;  4E3S A;  3SYZ A;  1WSE A;  3AVG A;  1HPZ A;  3KJV A;  4CGF A;  2KFZ A;  3T19 A;  3HP6 A;  4E7L A;  4M3T A;  2YNI A;  2GV9 A;  1T7P A;  3V6D A;  1DLO A;  1NKC A;  3V9U A;  4M3R A;  4KHY A;  3NGY A;  4FJN A;  4KHU A;  2FBT A;  4I2P A;  1QE1 A;  4N47 A;  1RT4 A;  3TR8 A;  4B9V A;  3SQ4 A;  4Q0B A;  1EP4 A;  3AO1 A;  2HVI A;  2IS3 A;  1YTA A;  2FBY A;  3LPU A;  3ZSV A;  4JS5 A;  3CM6 A;  3T3F A;  1NK9 A;  4UQG A;  4F2R A;  4E7J A;  4M42 A;  1UA0 A;  5J1E A;  2B5J A;  4EP4 A;  2IOC A;  3MXJ A;  5HRN A;  3TI0 A;  3AVB A;  3QLH A;  4OKE A;  1EX4 A;  1HYS A;  3ZSR A;  3PY8 A;  4B8C A;  3NE6 A;  4DQQ A;  2JGU A;  3KK1 A;  1CXQ A;  1KTQ A;  4CHP A;  3HVR A;  4HUE A;  4CGJ A;  4N41 A;  4M3Z A;  1VK0 A;  2X6N A;  1MU2 A;  1J5O A;  1TAQ A;  3LDS A;  5J2Q A;  1A5X A;  1SKS A;  1JLF A;  2ZE2 A;  4O4G A;  3ZCM A;  2VG5 A;  1QSS A;  1TKX A;  4H8K A;  3LP2 A;  3QNO A;  1NK7 A;  3SJJ A;  3O4N A;  2FC0 A;  1Q8I A;  4I7F A;  4LD0 A;  2YHB A;  3TAE A;  4DTS A;  1EXQ A;  1S9E A;  1XWL A;  3AO5 A;  3VQE A;  4CEF A;  3TAF A;  4KV8 A;  2HNZ A;  3PX4 A;  3NBP A;  4CJK A;  1RT2 A;  1J53 A;  1LAW A;  4C8O A;  1WSG A;  2ZQB A;  1QSL A;  3JSM A;  1KLM A;  1JL1 A;  1VSH A;  1Z25 A;  4E1M A;  3OYC A;  3LZI A;  1NK6 A;  2PY5 A;  1SKW A;  1SV5 A;  2KZZ A;  4IG3 A;  3ALY A;  4O5B A;  4Y1D A;  4DSL A;  4O44 A;  3QEW A;  2GBZ A;  3E01 A;  4LH5 A;  4CK3 A;  5KRS A;  4CJ4 A;  3AVA A;  5KGX A;  2OPR A;  3WNG A;  2QXF A;  1TL3 A;  4F3T A;  4CEQ A;  1KFD A;  1ZBH A;  2YKN A;  1I39 A;  1LWC A;  3DLG A;  4PA1 A;  4M3W A;  4PY5 A;  3D45 A;  3VQQ A;  3B6O A;  3LP1 A;  3ZSX A;  4M41 A;  2WOM A;  1Z26 A;  3QEP A;  1NK5 A;  4KPY A;  4RW8 A;  1D9F A;  3KIO A;  1X9W A;  4BDP A;  3HT3 A;  4LH4 A;  1ITG A;  1NJX A;  4FLW A;  3VQ9 A;  4CIF A;  3S3O A;  4C8L A;  4CJT A;  3L2W A;  2KTQ A;  3L2U A;  4BE1 A;  2YKM A;  5J2M A;  5HLF A;  3FFI A;  3DLH A;  2O4I A;  3SQ1 A;  3KD1 E;  4EZ6 A;  1SUQ A;  3QIN A;  5SZT A;  2G8U A;  4C8N A;  3M8R A;  3LP0 A;  2HND A;  2P5O A;  2QK9 A;  2D0C A;  4DSI A;  4I9Q A;  4CK2 A;  1CLQ A;  1W9H A;  3K5O A;  4DTM A;  4DMN A;  3IG1 A;  2XO7 A;  3O3F A;  2YV0 X;  1S1X A;  3NGZ A;  3KK3 A;  1T05 A;  4E0D A;  2KW4 A;  4FVM A;  5CZ1 A;  1JLC A;  1QQC A;  3L2Q A;  4JRP A;  2IGI A;  3G10 A;  1RT7 A;  1G15 A;  3H08 A;  1REV A;  3ZSQ A;  3QER A;  4DF8 A;  2AJQ A;  2DY4 A;  4W5N A;  1C6V A;  4AHV A;  4PQU A;  1S6P A;  4M3Y A;  4IG0 A;  4JLH A;  3K59 A;  2JLE A;  1NKE A;  3SNN A;  3MXM A;  2O4G A;  3RRH A;  4J2B A;  3ASM A;  4E89 A;  4FZY A;  1A5W A;  3NF7 A;  2HHW A;  3DM2 A;  2P51 A;  4ZTJ A;  4BWM A;  3P5J A;  3ZT4 A;  4LSN A;  1O1W A;  1HNI A;  3OY9 A;  1B9D A;  4CJR A;  2G8K A;  1UA1 A;  4AHU A;  3V4I A;  2YNG A;  1K6Y A;  4CEA A;  5SWM A;  3SUQ A;  3AVF A;  1RBR A;  3PO4 A;  4FK4 A;  3IAY A;  2F8S A;  3MEE A;  1HQU A;  3VQC A;  4B08 A;  1BGX T;  1U45 A;  1L3T A;  2Z1J A;  1FKO A;  3NF9 A;  3CG7 A;  3SQ2 A;  4RW4 A;  3ZT3 A;  2HW3 A;  1QHT A;  3ZSZ A;  1BIZ A;  2G8F A;  1TAU A;  2E6L A;  4W5O A;  2BE2 A;  4FM0 A;  3DRR A;  1BIS A;  1KVA A;  4H4O A;  4LSL A;  4DTJ A;  3THV A;  4L8R B;  1ZBI A;  3NCI A;  3WNH A;  5HRP A;  3CFP A;  3SV4 A;  4CJF A;  3KLI A;  1T03 A;  3NF6 A;  1NJZ A;  2P5G A;  4ZTF A;  5J2N A;  1B9F A;  1BI4 B;  4OKK A;  3AVI A;  2DTU A;  4GMJ B;  2RN2 A;  4BDY A;  2F8T A;  4QCL A;  3NH0 A;  3KK2 A;  1A5V A;  1RDC A;  4DQR A;  1NK4 A;  2G8W A;  4KI4 A;  1S1V A;  3M8Q A;  5DK5 A;  5HRO A;  4KRE A;  3DLE A;  1NOY A;  1U04 A;  4ICL A;  4HCC A;  1S9G A;  4KHS A;  1EKE A;  3OJS A;  3NH2 A;  3V9S A;  1ASU A;  1LW0 A;  1RCH A;  4AHS A;  3OYG A;  1Q9X A;  2PYL A;  4FJ5 A;  2G8I A;  1VSL A;  5KTQ A;  3NAE A;  1RNH A;  1RDD A;  4DFJ A;  4Z4F A;  3QIO A;  3MXI A;  3TAB A;  1VSE A;  1FK9 A;  4CJU A;  3OYN A;  3OYE A;  3QEX A;  5C25 A;  1TKT A;  2XHB A;  4B9N A;  4DQI A;  4AHC A;  1VRU A;  3RTV A;  5KI6 A;  4PWD A;  4CFA A;  1L3V A;  4I9L A;  1KRP A;  3VQP A;  4E7I A;  1D9D A;  2Z1I A;  4DFP A;  5FRN A;  3LAK A;  1U48 A;  1KCF A;  2G8H A;  4FJX A;  3TAM A;  3AVK A;  4W5R A;  3OJU A;  4ELT A;  4Z4E A;  2HHT A;  1FXX A;  2HHU A;  3AVL A;  4DLG A;  1VSM A;  1J9A A;  4IKF A;  1N6Q A;  3V9W A;  4DG1 A;  4B9T A;  4DF4 A;  1JKH A;  2VWK A;  2DFH A;  3AA5 X;  4NYF A;  1JLA A;  1VSK A;  5JS1 A;  3ITH A;  3SI6 A;  3IS9 A;  1XHZ A;  3WNE A;  4Z4G A;  3V9Z A;  4KRF A;  1RT3 A;  4ELU A;  3VQ4 A;  1CZB A;  3HPG A;  1NOZ A;  4FLZ A;  1UWB A;  1N5Y A;  1W0H A;  3CFO A;  4FJH A;  4CK1 A;  4DTU A;  4NYN A;  4FJJ A;  3DI6 A;  3KKS A;  2E4L A;  4IBN A;  3RMA A;  1RBT A;  4YNQ A;  2B6A A;  3HL8 A;  1KVB A;  1RT6 A;  4CCH A;  4KTZ A;  1U49 A;  1BCO A;  1C0T A;  3AVC A;  5C42 A;  3OYI A;  4FM1 A;  4W5T A;  3V9X A;  4CHZ A;  4RG8 A;  1ZBL A;  3IRX A;  4F2S A;  3ZT0 A;  4M45 A;  3L2R A;  3OYK A;  4OLB A;  4MFB A;  4CHN A;  1KVC A;  4ID5 A;  4KAZ A;  3O3H A;  3NFA A;  4CIE A;  4N56 A;  3LWL A;  4I2Q A;  2A1S A;  3ZT1 A;  3VA0 A;  3VA3 A;  4DTR A;  4N76 A;  1WSI A;  1L5U A;  3T1A A;  4YFU A;  3KLH A;  1CXU A;  4M3U A;  1LW2 A;  1XC9 A;  1CZ9 A;  4CHQ A;  3OYL A;  4CHY A;  2XY8 A;  1XI1 A;  1SKR A;  3QO9 A;  3SV3 A;  1S1T A;  3ZSY A;  2VG7 A;  3AVJ A;  4R5P A;  2XY7 A;  4KHQ A;  2F96 A;  4FZX C;  4Z4C A;  4KHW A;  3HPH A;  4B8A B;  4E7H A;  4G1Q A;  1SL2 A;  5J2P A;  2B4J A;  3VN5 A;  5FRM A;  3CM5 A;  2YNF A;  3K5N A;  4CED A;  3DMJ A;  2XRI A;  4DU3 A;  1BQN A;  3K5M A;  1QTM A;  1WLJ A;  2OPQ A;  1TK5 A;  4FJG A;  3DRS A;  1B92 A;  4ID1 A;  3OYJ A;  1L3S A;  4FLV A;  4CGI A;  5D3G A;  1S6Q A;  3C94 A;  1WSF A;  3HPO A;  4CFD A;  2BGG A;  4DFM A;  3I0R A;  2A1R A;  3B6P A;  1RBV A;  3HK2 A;  1HJR A;  3OVN A;  4FZZ A;  1S1W A;  3DOK A;  3CYM A;  2HHX A;  3SUN A;  3L8B A;  3A2F A;  3D0P A;  3K57 A;  3KD5 E;  2DFF A;  2XY5 A;  4HUF A;  1WAF A;  4CJS A;  3C6U A;  4CF1 A;  1JXE A;  4WE1 A;  4BE0 A;  4KTW A;  1JL2 A;  1UOC A;  3VQ6 A;  3TAG A;  4CE9 A;  4K8Z A;  3HXM A;  1LAV A;  4IDK A;  4ELV A;  3ISN C;  3AO4 A;  3SUO A;  3PO5 A;  4CF9 A;  3DLK A;  3AO3 A;  3NDK A;  4RW7 A;  5E41 A;  3CFR A;  1IO2 A;  5JS2 A;  4F4K A;  2X78 A;  4FLU A;  3AA4 A;  1X1P A;  1Q9Y A;  3KLE A;  4FCY A;  3KLG A;  1HMV A;  3CQ8 A;  4OGC A;  4KHN A;  1WSJ A;  3G0Z A;  3U6F A;  2D5R A;  2Z1H A; 
#chains in the Genus database with same CATH topology
 4OPJ A;  4DFK A;  3J7Y P;  3VQD A;  1NMD A;  5GIN A;  4FJI A;  2OZM A;  3QML A;  4JI2 K;  3M5R A;  2R7Y A;  1UAX A;  3OBY A;  4RCH A;  1C0G A;  4JEP A;  3KVG A;  5EU7 A;  2WON A;  2GEL A;  3E9L A;  1N33 K;  3LM9 A;  3AVM A;  3AA2 A;  4NCB A;  1R0A A;  1BIU A;  1J5E K;  1JLG A;  3EZW A;  4DLE A;  1KLN A;  2OTL N;  4PUO A;  4NLC A;  3KKR A;  4DTN A;  3P83 D;  2OZS A;  3DXM A;  5H1S Q;  4QOZ B;  4DTO A;  4FW1 A;  1V4S A;  2XY6 A;  2WTU A;  4IO9 L;  3I56 N;  4FJL A;  4OGE A;  4BGB A;  1VQO N;  3EY1 A;  1JLB A;  2Y1J A;  2IDO A;  3LAL A;  3D7E O;  3HTV A;  1YHQ N;  3BGR A;  4LY7 A;  3MEG A;  2PFU A;  1N32 K;  1DTQ A;  2CH5 A;  4K8X A;  1KAY A;  1GLB G;  4CEE A;  5GAH P;  4Z4I A;  2I5J A;  1HRH A;  1IJJ A;  4Z4H A;  3GL1 A;  3SUP A;  3LAN A;  3JAM O;  1HYV A;  2KZM A;  3I8B A;  4MO5 A;  4WQ5 A;  3WQU A;  3CXC M;  1J54 A;  3V1Q A;  3OYD A;  4I6M A;  4FW2 A;  4FK0 A;  2D0B A;  1V4T A;  4CGG A;  4H5W A;  4H5N A;  4HTU A;  1ZYQ A;  4CF0 A;  4LF9 K;  2HMI A;  4FJ9 A;  4IJA A;  1RTI A;  1HPM A;  4WYB A;  5GIP A;  3BUZ B;  3QET A;  3RMC A;  3HJF A;  4FLT A;  3F9K A;  4FK2 A;  1LV5 A;  1JJ2 M;  3IKM A;  1NJY A;  3UKR B;  4DS4 A;  3AVN A;  4BRG A;  2NLX A;  2HHV A;  4CJP A;  1FJG K;  2QWR A;  3OYB A;  1MWK A;  5CZ2 A;  1DGK N;  2EHG A;  4CES A;  1NGG A;  4BDZ A;  3ZSO A;  3RMB A;  2NRX A;  1TK0 A;  3KZB A;  2NRR A;  3HM8 A;  5DMR A;  5AQL A;  4JRQ A;  3MED A;  4O8K A;  4CER A;  2EWS A;  1IH7 A;  4KO0 A;  3P38 A;  3H1V X;  3OYM A;  2PYJ A;  3E9P A;  1C1A A;  1SL0 A;  1YVU A;  4OPK A;  2ETJ A;  3AGK A;  3VEW A;  5GIO A;  5FDL A;  4CHO A;  2RKI A;  2QWN A;  3RMD A;  4JKD A;  2GUP A;  5C0Y A;  1D8Y A;  3LM2 A;  4CVN E;  5FPM A;  3L4I A;  4OLA A;  4WF9 L;  3S9H A;  1K8A O;  2OCE A;  2RE2 A;  3F2K A;  4CF8 A;  1NWK A;  5GAG P;  3C65 A;  1W7A A;  1FKP A;  3GDQ A;  4QAG A;  4YDU C;  3VEO A;  2HHH K;  4GW6 A;  1VSF A;  4OKJ A;  2ZGY A;  4CD1 A;  4CZF A;  1XNQ K;  3GE1 A;  5M1P A;  1I3A A;  1KFS A;  3VQ7 A;  3C7N A;  1RTJ A;  5GAD P;  3O4Q A;  4MDA A;  1QVG M;  4DCH A;  4IFV A;  4X65 K;  4DSE A;  1IV0 A;  4IEE A;  1N36 K;  3SYZ A;  4GY2 B;  1ZBS A;  4E7L A;  3H46 O;  1JCF A;  3D2E A;  4DR1 K;  4X62 K;  4KHY A;  1QE1 A;  1Q82 O;  2HBK A;  3CQX A;  3ZSV A;  3LPU A;  3RVC A;  4UQG A;  4E7J A;  3J8A A;  5J1E A;  4IJN A;  2B5J A;  5AQG A;  3TI0 A;  3AVB A;  3QLH A;  4FVU A;  5LL6 Z;  5FPE A;  4CHP A;  5A2Q O;  1IBK K;  1MU2 A;  5EY4 A;  3LDS A;  1TKX A;  4H8K A;  2E88 A;  1T44 A;  1VQ5 N;  3TAE A;  4KH4 A;  5KPR A;  4DTS A;  3ZEU B;  3AO5 A;  3TAF A;  3FR0 A;  1M1K O;  3NBP A;  1WSG A;  2CGK A;  3LZI A;  4ISG A;  1SKW A;  1SV5 A;  2HBM A;  4KBO A;  2GBZ A;  4EAH D;  2V7Y A;  2GWK A;  1XC3 A;  2OPR A;  2QXF A;  1TL3 A;  4F3T A;  3VET A;  3AGR A;  2CH6 A;  4CEQ A;  1KFD A;  1ZBH A;  2YKN A;  3VGL A;  1I39 A;  1QQN A;  2HOE A;  3DLG A;  4PY5 A;  1QHA A;  3VQQ A;  3ZSX A;  3QEP A;  1NK5 A;  4H0P A;  5ELZ A;  3KIO A;  5AR0 A;  1ZC6 A;  3W0L A;  2Q0U A;  1HNZ K;  4BC2 A;  1OH8 A;  1SUQ A;  4EZ6 A;  4OX9 K;  3LP0 A;  3SMP A;  5E84 A;  3FFK B;  4DSI A;  4I9Q A;  3AAR A;  5C12 A;  2D1K A;  4QS9 A;  2XO7 A;  4CJ7 A;  3PIO L;  4E0D A;  1BO5 O;  2KW4 A;  4FVM A;  2A40 A;  2IGI A;  4R79 A;  1G15 A;  1REV A;  3QER A;  4W5N A;  3EKS A;  4FWN A;  1C6V A;  4M3Y A;  2QI2 A;  2JLE A;  3F5T A;  4GVE A;  1NKE A;  3ASM A;  4E89 A;  4U7B A;  2W6L A;  2HHW A;  2P51 A;  4ZTJ A;  4LSN A;  1HNI A;  3J7A P;  4C1N K;  2O8B A;  3C7N B;  5AQF A;  3O9R A;  3PO4 A;  3MEE A;  1HQU A;  3VQC A;  5JLH A;  4JI5 K;  2Z1J A;  3ZX3 A;  3NF9 A;  5C15 A;  2HW3 A;  1T6D A;  4WFB L;  2FSK A;  2YI1 A;  3ZSZ A;  1KVA A;  4LSL A;  4BC5 A;  5IT9 O;  2P5G A;  1MA9 B;  1T6C A;  1SQK A;  4ILH A;  4BDY A;  2O8E B;  1A5V A;  4KI4 A;  4KRE A;  2F9T A;  1NOY A;  2VQF K;  1S9G A;  4KHS A;  3AAQ A;  3NH2 A;  1E4F T;  4NB4 A;  1ASU A;  2CGL A;  3TU5 A;  3OYG A;  4FWK A;  1Q9X A;  2PYL A;  4FJ5 A;  4PL7 A;  4BG9 A;  4DFJ A;  4O8U A;  3CER A;  5LMU K;  4DB3 A;  3QFP A;  4C23 A;  2XHB A;  4BRK A;  4DQI A;  1NBW A;  1VRU A;  3RTV A;  3WEE B;  1KRP A;  1D9D A;  1U48 A;  4RWT A;  4FJX A;  3TAM A;  3AVK A;  3J7Z O;  4Z4E A;  2HHU A;  2E5L K;  4DLG A;  2HBL A;  1N6Q A;  1NNE A;  4DG1 A;  2DFH A;  3IS9 A;  5F1X A;  1XHZ A;  4ELU A;  3MCA B;  3VQ4 A;  1CZB A;  3HPG A;  4FLZ A;  1EWR A;  4H5R A;  4CBX A;  1W0H A;  1N5Y A;  4FJH A;  3DI6 A;  4OO1 J;  4CZG A;  3KKS A;  2AP1 A;  4YHH K;  1TUU A;  2ZJP L;  4YNQ A;  4DHY A;  2VYP A;  4CCH A;  5BPM A;  4B3T K;  4YOW A;  5AQT A;  1BCO A;  1C0T A;  3AVC A;  5C42 A;  3OYI A;  4W5T A;  1ZBL A;  4M45 A;  3OYK A;  4OLB A;  5C2F A;  4JHD B;  4CHN A;  4ID5 A;  2P9I A;  3LWL A;  1X3N A;  4N56 A;  4DTR A;  3VA3 A;  3WQT A;  3T1A A;  1CZ9 A;  3QBX A;  3C6H A;  5DM6 L;  3QO9 A;  3SV3 A;  4FZX C;  4Z4C A;  5AQK A;  4LF8 K;  3HPH A;  4B8A B;  2H3G X;  4E7H A;  2ZJQ L;  1SL2 A;  5AQH A;  5J2P A;  3JXU A;  1OKJ A;  3K5N A;  1K73 O;  4WFA L;  2JWK A;  3K5M A;  1QTM A;  1TK5 A;  1B92 A;  3OYJ A;  2P9S A;  4BRC A;  4DV4 K;  5D3G A;  1S6Q A;  2KLA A;  1Y64 A;  2BGG A;  2A1R A;  4A2A A;  3B6P A;  2F4V K;  3OVN A;  4FZZ A;  3DOK A;  2HHX A;  4IEI A;  4B1Y B;  2O8B B;  4YOY A;  3Q7C A;  3HXM A;  4ELV A;  2BTF A;  3O9S A;  1LOT B;  3DLK A;  5E41 A;  4X66 K;  1D4X A;  1RFQ A;  2X78 A;  3ENO A;  1HMV A;  3FE1 A;  2Q31 A;  5C2D A;  1U6Z A;  1WSJ A;  3G0Z A;  3AAP A;  4LFA K;  3K5L A;  4GV6 A;  3P31 A;  4CIG A;  3NF8 A;  2BDP A;  4BC3 A;  3O3G A;  3RR8 A;  4B3M K;  1VQP N;  2HNY A;  4NCA A;  3ZLJ A;  2YHW A;  4AHR A;  3TTD A;  1RT1 A;  1GOC A;  4DQP A;  1RT5 A;  4DV6 K;  3C95 A;  4EIA A;  4DTP A;  4J2D A;  2Q1N A;  1F21 A;  4BRA A;  1YT3 A;  3V81 A;  1K9M O;  1RTH A;  4DQ8 A;  3OS0 A;  4FXD A;  3RWU A;  4K42 A;  2GX9 A;  3THX B;  2PZS A;  3M8S A;  4E7K A;  1SS6 A;  2Q3S A;  4Y1C A;  2X74 A;  3QEI A;  4CFB A;  4J2E A;  2HHS A;  4F9O A;  1OVQ A;  3LAM A;  5KPT A;  4EFH A;  3HVT A;  4BR9 A;  4FLY A;  2DPN A;  4GVM A;  4B9S A;  2Z1G A;  4B9M A;  1XNR K;  2WBN A;  3HYF A;  1YXQ A;  1IG8 A;  1KXP A;  3KTQ A;  4BE2 A;  2KFN A;  1BDG A;  2D4W A;  3V1O A;  5CR4 A;  4BAC A;  1ASW A;  1BQM A;  4JHD A;  1ZBF A;  4FO0 A;  4FJK A;  2ZM6 K;  5HRS A;  3P1G A;  2P9P A;  1EQY A;  3H45 C;  3FZK A;  3OS1 A;  1QQO A;  4AM7 A;  1N34 K;  3VEZ A;  4X64 K;  5F0X A;  1C1B A;  3T1Y K;  3TPQ A;  1YUW A;  1RBS A;  1TGO A;  1NK8 A;  3T69 A;  4NCG A;  3PV8 A;  2IAJ A;  2NRW A;  2Q0R A;  3VGM A;  4DU4 A;  1L3U A;  1BA1 A;  1HNV A;  3ULD A;  1T8E A;  2FF6 A;  1Z05 A;  3CCJ N;  3QEV A;  2P9S B;  3CJC A;  4NXM K;  1JLE A;  1QZ5 A;  4CGD A;  3HP9 A;  2YNH A;  3A5L C;  5HBM A;  4B9U A;  3GOI A;  1VQ8 N;  1VQ7 N;  1CZA N;  2YHX A;  5BN9 A;  4BRM A;  4JI3 K;  3CHW A;  4JI4 K;  1JCE A;  3LP3 A;  4FWR A;  3I55 N;  2VGM A;  4JI6 K;  3VQ5 A;  4FWS A;  3VQA A;  2HMP A;  3TAP A;  1C0F A;  4N5S A;  4CFC A;  2QM1 A;  1U4B A;  2HB5 A;  3CPW M;  4DS5 A;  4CJ5 A;  1QS4 A;  2OA8 A;  2DFE A;  3L2V A;  2P1J A;  2WC9 A;  1JCG A;  1GLC G;  2VWJ A;  3ATU A;  1WNS A;  3VPZ A;  4BR7 A;  4DV7 K;  2QKB A;  2P9U A;  3HM9 A;  4O0J A;  3GBT A;  1LWE A;  3DOL A;  1S22 A;  3OW2 M;  4H4M A;  2E1Y A;  1JLQ A;  2NUB A;  1XHX A;  4WCE L;  3RR7 A;  3JYT A;  1QSY A;  3N4Q A;  1KSP A;  3OYH A;  4FWL A;  3S3N A;  1VQL N;  3VF2 A;  4JI8 K;  1C0M A;  1NGJ A;  4CGH A;  4DUZ K;  1NJI O;  4BR2 A;  4BR0 A;  2E20 A;  5AQZ A;  1HYZ A;  3EYZ A;  2E6M A;  3MEC A;  1RIL A;  3SBG A;  4W5Q A;  4E19 A;  4F8R A;  3LWM A;  3O6W A;  3PLA A;  4CEB A;  1VQ9 N;  3G6E N;  1TKZ A;  4LF4 K;  1ATR A;  1HPZ A;  3CCL N;  3HP6 A;  3VEV A;  4M3T A;  2GEM A;  2NZT A;  1NKC A;  3DAW A;  3MDQ A;  4M3R A;  2FBT A;  4I2P A;  4Q0B A;  3AO1 A;  1Q7Y O;  5BRF A;  3GG4 A;  5HOO A;  1NK9 A;  2A41 A;  3T3F A;  2VGN A;  1O13 A;  4F2R A;  4M42 A;  5HRN A;  5AQR A;  3IMX A;  4OKE A;  1HYS A;  3PY8 A;  3NE6 A;  4DQQ A;  2JGU A;  4BC4 A;  3KK1 A;  4H03 B;  3HVR A;  4N41 A;  1VK0 A;  4AF1 A;  3E1Y A;  2ZE2 A;  3MK6 A;  1QSS A;  4DV2 K;  3G4S N;  4H5T A;  3WT0 A;  1WUA A;  2HF3 A;  5AQP A;  1Q8I A;  4I7F A;  3MWP A;  1NMN A;  4LD0 A;  1EXQ A;  1XWL A;  2HNZ A;  3WXI A;  4CJK A;  1HNX K;  1T3V A;  2D0P A;  1RT2 A;  3VTI A;  3AY9 A;  2O8C A;  2ZQB A;  4IDH A;  3JSM A;  1JL1 A;  1VSH A;  1Z25 A;  4E1M A;  1HNW K;  1W97 L;  4O5B A;  4O44 A;  1S3X A;  4A57 A;  4CK3 A;  5KRS A;  3AVA A;  1LWC A;  3B6O A;  1BA0 A;  1WBD A;  4M41 A;  2WOM A;  4KPY A;  4RW8 A;  1Q81 O;  1D9F A;  3OBW A;  3HT3 A;  4LH4 A;  4CIF A;  3S3O A;  4C8L A;  3L2W A;  3O9Q A;  3R1X A;  4BE1 A;  2YKM A;  4B1W B;  3HSC A;  5J2M A;  3FFI A;  3SQ1 A;  4QS8 A;  4C8N A;  2QK9 A;  5F2R A;  3DXM B;  4HTL A;  4YOV A;  4DR4 K;  3IG1 A;  2HBJ A;  1T05 A;  2E2O A;  3A0I X;  4FPB A;  1RT7 A;  3ZSQ A;  2DY4 A;  4A59 A;  4PQU A;  4IG0 A;  3K59 A;  3SBT A;  3H1Q A;  3BZK A;  2CGJ A;  1NGI A;  3NF7 A;  3DM2 A;  3P5J A;  4BRE A;  4WQ4 A;  1B9D A;  2ZWH A;  3UKU B;  4AHU A;  1G99 A;  3AVF A;  3IAY A;  4B08 A;  1BGX T;  1U45 A;  1L3T A;  2KHO A;  3CG7 A;  5TKW A;  1QHT A;  1BIZ A;  5BN8 A;  4W5O A;  2BE2 A;  4H4O A;  4DTJ A;  3THV A;  1VQN N;  1ZBI A;  3NCI A;  5HRP A;  4CJF A;  1KAZ A;  3KLI A;  5KQ8 A;  1VQ6 N;  3O9T A;  1VAZ A;  3TTF A;  3AVI A;  4GMJ B;  4H0V B;  3SAF A;  4DQR A;  3U9Z A;  4B1U B;  5HRO A;  3ENH A;  3MN9 A;  1U04 A;  4ICL A;  4JD2 A;  3OJS A;  4FWM A;  4AHS A;  1QVF M;  3NAE A;  4Z4F A;  3MXI A;  3TAB A;  1QZ6 A;  1FK9 A;  3QIC A;  1HLU A;  5AQJ A;  3ZET A;  5C25 A;  2FLO A;  4BR4 A;  4I9L A;  3KHY A;  1L3V A;  2NRH A;  4ILG B;  2Z1I A;  4DFP A;  5FRN A;  1NGF A;  3R3L A;  3LDP A;  1FXX A;  3O08 A;  3N4P A;  1VSM A;  3V9W A;  2O8C B;  2ASM A;  2VWK A;  4FL9 A;  3AA5 X;  4GV9 A;  4NYF A;  4BRL A;  3MWT A;  1ESV A;  2ZJR L;  1NOZ A;  3CFO A;  4DV5 K;  5IWA K;  2HST A;  3RMA A;  2O8D B;  4B3S K;  1RBT A;  3HL8 A;  1X3M A;  4BVP A;  2QWQ A;  1U49 A;  4FM1 A;  3IRX A;  1YJ9 N;  3L2R A;  4CD3 A;  4MFB A;  1SAZ A;  2YHY A;  4KAZ A;  4JKB A;  3FZL A;  3ZT1 A;  1HKB A;  1WSI A;  4YFU A;  4CHQ A;  4CHY A;  1XI1 A;  4FPA A;  1S1T A;  4B3R K;  2P9L A;  4R5P A;  2XY7 A;  4KHQ A;  2VWB A;  3VN5 A;  3CI5 A;  5E26 A;  4NXN K;  5BR8 K;  1Z6R A;  3THW A;  1WLJ A;  4K25 A;  4FLV A;  4EHU A;  2YJE A;  3BZC A;  3EN9 A;  3CPE A;  1WSF A;  4IWV A;  4JI0 K;  1QQM A;  3CYM A;  3SMS A;  3A2F A;  3D0P A;  2DFF A;  2XY5 A;  4UY8 O;  1EO1 A;  4K0K K;  2I7N A;  1JXE A;  4WE1 A;  3CMA N;  4KTW A;  4CE9 A;  5BRD A;  2RHK A;  3EL2 A;  3PO5 A;  4XH1 A;  5AQO A;  4CF9 A;  5BR9 A;  4RW7 A;  3LL3 A;  3HBT A;  5KQD A;  3AA4 A;  3L6Q A;  1BOT O;  5BPN A;  3CQ8 A;  4KHN A;  4M7Y A;  1RDB A;  3TAQ A;  1WOQ A;  3WXJ A;  3THY B;  2BAN A;  4HVJ A;  1YTU A;  2P9K A;  1IKY A;  3BF1 A;  3HI0 A;  3TAN A;  4FOE A;  3A5N C;  2V51 B;  2EX3 A;  4KI6 A;  2YJF A;  4JKG B;  4M3X A;  2IC3 A;  3D2F A;  2NRV A;  5CYQ A;  5FPN A;  4KKO A;  1RBU A;  4JKC A;  3OYF A;  1NGH A;  1YJW N;  3O80 A;  2YCH A;  4FJM A;  2UU9 K;  3TAR A;  4NLB A;  1NGB A;  4JYA K;  3CC4 N;  3AV9 A;  3TWH A;  3DLR A;  4FJ7 A;  2YHA A;  1S5J A;  5HP1 A;  4KTQ A;  3CQY A;  2HVH A;  4CJV A;  4G9Z A;  2D0A A;  3CJB A;  3O8M A;  5CYM A;  4A2B A;  3T7Z A;  4OPH A;  3V1R A;  2QWL A;  1C0U A;  2E1Z A;  4O5F A;  2X6S A;  5I9E B;  4FYD A;  3VQB A;  5T7B A;  1ATS A;  2Y1I A;  4BGA A;  3QBW A;  3NGI A;  1KQS M;  5M1Q A;  3AO2 A;  1BL3 A;  1TL1 A;  2ASO A;  3M1F A;  4CF2 A;  4B9Q A;  1MWM A;  4ISE A;  3ZSW A;  4FSV A;  5AQI A;  4MQ3 A;  2F7T A;  1BI4 A;  4C8M A;  4BWJ A;  3DLB A;  5M1K A;  3UIQ A;  3BDP A;  4DSJ A;  2FSJ A;  3SPY A;  3SZ2 A;  4RW6 A;  3THW B;  1NKB A;  4K43 A;  1FW6 A;  1NGA A;  2E2N A;  5C10 A;  4E1J A;  1P8Z A;  2OYQ A;  3AA3 A;  4AH9 A;  4CEC A;  3J80 O;  3PX6 A;  2ZD1 A;  3SQ0 A;  3HST B;  2O8E A;  5CHI A;  4BRF A;  4EP5 A;  4IXC A;  4JKF A;  3I0S A;  4OPA A;  4HCB A;  3RRG A;  1H1V A;  2GTD A;  4AHT A;  3FZF A;  3KLF A;  4Z0U A;  4JK7 A;  4BY9 C;  5KGW A;  4H0T B;  3HOT A;  3K2P A;  3OYA A;  3VF6 A;  3VER A;  4CZH A;  4GKJ K;  4KH5 A;  5M1O A;  3MCP A;  2IVP A;  1BCM A;  4JK9 A;  3TTC A;  2FBV A;  3WEE A;  4FLX A;  1TV6 A;  1WAJ A;  3HOS A;  4FOI A;  3A5M C;  4TSX A;  1GOB A;  1TYQ A;  3MN5 A;  3NHG A;  4KB0 A;  4L3Q A;  4PKG A;  4CJW A;  3ZT2 A;  4XIU A;  1IKW A;  1TKD A;  3HO1 A;  4JS4 A;  3L3U A;  4ZHR A;  2FXU A;  4IZ9 A;  5JLF A;  1Y97 A;  4CBU A;  3PUF A;  3ENB A;  1K8K A;  2QKK A;  4JNE A;  3LDL A;  3DYA A;  5CE3 A;  3DRP A;  2G8V A;  3O9U A;  1YJN N;  4CZI A;  1RDA A;  3FZM A;  4M63 C;  2LSN A;  3LDO A;  2VQE K;  1OH7 A;  1BWF O;  4F3O A;  2P9I B;  3MN6 A;  4E3S A;  1WSE A;  2KFZ A;  4CGF A;  4WQ5 C;  3T19 A;  2YNI A;  2FSN A;  2GV9 A;  1T7P A;  4FJN A;  4KHU A;  4YOU A;  4B9V A;  1RT4 A;  1GLA G;  2UXC K;  1EP4 A;  1YTA A;  2FBY A;  3CM6 A;  4PKI A;  4BVO A;  3VOV A;  4YOX A;  1CXQ A;  2W6K A;  3CCR N;  4HUE A;  4BQL A;  5JIC A;  5JMV A;  4M3Z A;  1TAQ A;  2V52 B;  4JK8 A;  4MO4 A;  5AFU H;  3ZCM A;  1OH5 A;  3LP2 A;  1U2V B;  3QNO A;  3QDK A;  3CC7 N;  3SJJ A;  2FC0 A;  4LF5 K;  2P9N B;  1IBM K;  4DV3 K;  1S9E A;  4CEF A;  1TUY A;  4KV8 A;  3PX4 A;  1NK6 A;  1KLM A;  3OYC A;  4BRN A;  2GWJ A;  2KZZ A;  4IG3 A;  3ALY A;  3H6E A;  4DSL A;  4DR6 K;  2PAV A;  4LH5 A;  4CJ4 A;  3WNG A;  3CCU N;  4XEI A;  4PA1 A;  4M3W A;  3D45 A;  3NVK A;  4A5A A;  3H3N O;  1Z26 A;  4BDP A;  3MX2 A;  1ITG A;  1NJX A;  4FLW A;  4BRI A;  4CJT A;  2KTQ A;  3L2U A;  3DLH A;  2O4I A;  3KD1 E;  5SZT A;  2G8U A;  3M8R A;  2HND A;  5ADX A;  2D0C A;  1TYQ B;  4CK2 A;  3THX A;  3FGU A;  3K5O A;  4DTM A;  4DMN A;  3O3F A;  2YV0 X;  1S1X A;  3KK3 A;  3O4W A;  1JLC A;  3L2Q A;  4JRP A;  3H08 A;  1NU0 A;  4AHV A;  2FF3 B;  3SNN A;  3MXM A;  2O4G A;  4J2B A;  1HJO A;  4FZY A;  2QW9 A;  1J6Z A;  2W41 A;  3VEX A;  4JN4 A;  1O1W A;  1GLE G;  3OY9 A;  4CJR A;  1UA1 A;  4DR5 K;  4CZL A;  3L0Q A;  2KKZ A;  4FK4 A;  2F8S A;  5BPL A;  3ZT3 A;  2G8F A;  2E2P A;  1TAU A;  3K9J A;  4GV3 A;  4ISF A;  4L8R B;  3CFP A;  2A6A A;  1T03 A;  1HKG A;  3CCV N;  3DLL L;  4ZTF A;  3SAH A;  1B9F A;  4FWQ A;  2V7Z A;  5HL7 L;  2DTU A;  4LC9 B;  2RN2 A;  2F8T A;  3NH0 A;  3UKR A;  3D6R A;  1HR0 K;  1NLV A;  3F9M A;  1WB9 A;  4HCC A;  4WFN L;  1E3M A;  3V9S A;  2Q36 A;  2G8I A;  3K9K A;  5KTQ A;  3KK7 A;  1RDD A;  3QIO A;  3L4Q A;  1VSE A;  1RGI A;  3OYE A;  3QEX A;  5BRH A;  4IOX A;  3CJ9 A;  4CFA A;  2UXB K;  1KAX A;  4E7I A;  1Q18 A;  1KCF A;  2G8H A;  3CIP A;  2UUA K;  5MLC Q;  3OJU A;  1NGD A;  5EX5 A;  3SJH A;  5AQM A;  3T1H K;  1VQK N;  1J9A A;  3CJA A;  4DF4 A;  5DM7 L;  1JLA A;  3VGK A;  3BY5 A;  5JS1 A;  3WNE A;  4Z4G A;  1XQS C;  4KRF A;  1UWB A;  3EE8 A;  4YY3 K;  4CK1 A;  1IBL K;  4NYN A;  4FJJ A;  3NMU A;  1W2B M;  4DR7 K;  2E4L A;  3JS6 A;  4IBN A;  5M1F A;  2B6A A;  1NGE A;  3CET A;  5EOY A;  4H0Y B;  1GLJ O;  2UXD K;  1ILY A;  5EXW A;  1NGC A;  4BRQ A;  4C1N I;  3O3H A;  4CIE A;  3TSP A;  3CCS N;  1XUP O;  4N76 A;  3KLH A;  4HWI A;  4M3U A;  1LW2 A;  1XC9 A;  1YF5 L;  2VG7 A;  3BF3 A;  3D2E B;  2F96 A;  5TKY A;  4G1Q A;  4EHT A;  2B4J A;  3WXK A;  2O8F A;  4DV0 K;  3FLC O;  5FRM A;  2YNF A;  4CED A;  3DMJ A;  2F9W A;  2XRI A;  4FJG A;  3DRS A;  3A8Y A;  2D0O A;  4CGI A;  1X9J A;  3QB0 A;  3P4I A;  4NO7 A;  4CFD A;  4JKA A;  1RBV A;  3ATV A;  1HJR A;  2OTJ N;  1S1W A;  3CJ1 A;  5FLX O;  3L8B A;  4A62 A;  3KD5 E;  3O1W A;  2E8A A;  1WAF A;  3C6U A;  4CF1 A;  4BE0 A;  3CCM N;  1UOC A;  3VQ6 A;  3PSI A;  4K8Z A;  3LDN A;  4IDK A;  3ZEU A;  3AO4 A;  3SUO A;  1DT9 A;  1GLD G;  3ID6 A;  3CFR A;  4F4K A;  4FLU A;  3PSF A;  1BUP A;  1X1P A;  3BP8 A;  1Q9Y A;  1KD1 O;  5BRE A;  1ZXO A;  3P39 A;  4AIL C;  4XH4 A;  2E2Q A;  3H3O B;  1IG9 A;  4LFC K;  5AZI A;  1BG3 A;  4CZM A;  1DKG D;  2BH1 A;  5KRT A;  3LDQ A;  4XH5 A;  3VTH A;  1EET A;  3WXL A;  4CJL A;  1X9S A;  4DU1 A;  4DTX A;  4BR5 A;  2HHQ A;  4CEO A;  4CJQ A;  3EE9 A;  4J8F A;  1U47 A;  3LPT A;  3I33 A;  4IFY A;  3OS2 A;  4OJR A;  1WBB A;  3RSE B;  5LY3 A;  1ZBU A;  2ITM A;  4B9L A;  4PL8 A;  4B1X B;  3VMF B;  3CD6 N;  1LWF A;  2BUP A;  5KPZ A;  2Q2R A;  4KB1 A;  4FJ8 A;  1BHL A;  4H0O A;  4K41 A;  3WNF A;  4OVL A;  3M8P A;  3VQ8 A;  5I3U A;  4E1N A;  4KHP K;  1GLL O;  4DWI A;  3DXK A;  5C24 A;  3OA9 A;  4HUG A;  2QTD A;  1VSI A;  2RPI A;  1D5A A;  2AA4 A;  4LF6 K;  4KFB A;  1XMO K;  5K14 A;  4B3O A;  1IKV A;  1P90 A;  4IO8 A;  4CZK A;  4Q5V A;  1DTT A;  2OPP A;  1HKC A;  4EZ9 A;  2ITG A;  4RW9 A;  1NJW A;  1YAG A;  3MN7 A;  1GLF O;  3S3M A;  3UKU A;  1S1U A;  3K58 A;  3MX5 A;  3I8D A;  4DUY K;  1VSD A;  1SL1 A;  2A3Z A;  2VG6 A;  2O8F B;  1JXB A;  3HZ6 A;  4HHT A;  3QES A;  4YOT A;  1GOA A;  3SPZ A;  2UUC K;  3VF4 A;  4KH6 A;  3ZX0 A;  1WN7 A;  2KQ2 A;  1M90 O;  2RF2 A;  4DSK A;  4WQ4 C;  4O0I A;  3U3G A;  4MLH A;  1VRT A;  4RTF D;  1IKX A;  1TVR A;  3QIP A;  1TK8 A;  3QNN A;  4JD2 B;  1NM1 A;  4DQS A;  3SCX A;  2GUI A;  5FRO A;  2A42 A;  1X9M A;  4C8K A;  5AQV A;  1RTD A;  2QA4 N;  3U3Y A;  3ZET B;  1RDU A;  1ATN A;  1EWQ A;  3C6T A;  3S41 A;  2OPS A;  4CJ3 A;  2NRZ A;  4CJE A;  3NH1 A;  3PIP L;  2WFB A;  3G71 N;  3L3V A;  5CY4 A;  1SZ2 A;  4AM6 A;  4DSF A;  3MAQ A;  1ASV A;  2ATQ A;  1VSJ A;  5AQX A;  3LZJ A;  3KWI A;  1WSH A;  5AZI B;  4FM2 A;  3A5O C;  3NVM A;  4GNI A;  3VES A;  1C1C A;  2UUB K;  4JI1 K;  3F73 A;  5AQN A;  2FBX A;  2IVN A;  5LMN K;  3AVH A;  2O8D A;  5I42 A;  1NK0 A;  4M7X A;  3C0B A;  4H5V A;  3PX0 A;  2AJQ A;  3EZ5 A;  1HQE A;  4CEZ A;  2W42 A;  3RSE A;  5HRR A;  1N8R O;  3O5B A;  4J2A A;  4IFE A;  4A5B A;  3EEQ A;  4O55 A;  2ASP A;  2OAN A;  2QWO A;  3AVG A;  3KJV A;  4PHT X;  4BRD A;  3V6D A;  1DLO A;  5AQU A;  3ZX2 A;  3OTO K;  2P9L B;  3R6M A;  3V9U A;  3NGY A;  4N47 A;  3TR8 A;  2JWL A;  3SQ4 A;  2HVI A;  2IS3 A;  3DXK B;  5LJW A;  4JS5 A;  4FWP A;  1UA0 A;  3M3Z A;  3M6G A;  4EP4 A;  2IOC A;  3MXJ A;  3CCQ N;  1EX4 A;  1R59 O;  3ZSR A;  1OH6 A;  4B8C A;  3UB5 A;  5FPD A;  1KTQ A;  4CGJ A;  4B1V A;  2X6N A;  1J5O A;  3WXM B;  3CC2 N;  5J2Q A;  1SKS A;  1A5X A;  2QEX N;  1JLF A;  4U67 L;  4O4G A;  2VG5 A;  4LF7 K;  4CZJ A;  1NK7 A;  1KC8 O;  3O4N A;  2HF4 A;  2YHB A;  4JKH A;  1RDW X;  3VQE A;  4IOC L;  1J53 A;  1LAW A;  4C8O A;  4DR2 K;  1QSL A;  3CF5 L;  2PY5 A;  5GAE P;  2W40 A;  4Y1D A;  5AJ3 K;  4YOR A;  3QEW A;  5ADX H;  3E01 A;  5JVH L;  5KGX A;  3THY A;  3Q7B A;  2NNW A;  2P9K B;  3LP1 A;  1VQ4 N;  4BQZ A;  4AQY K;  1X9W A;  3VQ9 A;  4JKG A;  2A5X A;  3D2F B;  3E9O A;  5HLF A;  4JKE A;  3QIN A;  5AQY A;  2P5O A;  3IDH A;  1CLQ A;  1HUX A;  1W9H A;  3R8E A;  3TSU A;  3NGZ A;  1I94 K;  4YDU A;  5CZ1 A;  1QQC A;  3G10 A;  3U4L A;  4Z94 A;  4DF8 A;  3CME N;  2QXL A;  2PBD A;  1S6P A;  4FWO A;  4JLH A;  5AZJ A;  3ZYY X;  3RRH A;  1A5W A;  2P9P B;  4BWM A;  4JI7 K;  3ZT4 A;  4CBW A;  3ULE B;  4JV5 K;  2I7P A;  4CW7 B;  3J81 O;  2ZF5 O;  2G8K A;  5LJV A;  3V4I A;  2YNG A;  1K6Y A;  2IVO A;  3HRG A;  3VEY A;  4CEA A;  1RBR A;  5SWM A;  3SUQ A;  3IFR A;  1YI2 N;  1FKO A;  3IUC A;  3SQ2 A;  4RW4 A;  3SK3 A;  2E6L A;  4FM0 A;  3DRR A;  1BIS A;  4A61 A;  3MMV A;  3WNH A;  3SV4 A;  3WUH A;  3NF6 A;  1NJZ A;  5J2N A;  1BI4 B;  4OKK A;  1XMQ K;  2QWP A;  4QCL A;  3E66 A;  4CI6 A;  5AQW A;  1RDC A;  3KK2 A;  4DR3 K;  1NK4 A;  2G8W A;  5EVZ A;  1S1V A;  3M8Q A;  5DK5 A;  3EO3 A;  1MDU B;  3C6A A;  3DLE A;  3W3D A;  1EKE A;  4ILJ A;  1LW0 A;  1RCH A;  1VSL A;  3VEN A;  1RNH A;  4BRO A;  2VCP A;  3U9D A;  3SAG A;  3KWG A;  4IOA L;  4CJU A;  3OYN A;  3TSQ A;  4DKW A;  1TKT A;  4B9N A;  4AHC A;  1YIJ N;  5KI6 A;  4PWD A;  3VQP A;  3LAK A;  3K0S A;  1DEJ A;  4W5R A;  4ELT A;  4BRP A;  2HHT A;  2P9U B;  3AVL A;  4IKF A;  3BEX A;  4B9T A;  3R9P A;  5JVG L;  1JKH A;  1VSK A;  3B8A X;  1YIT N;  3ITH A;  3SI6 A;  4Y0W A;  3V9Z A;  1RT3 A;  1S72 N;  3SLC A;  4DTU A;  3FZH A;  4BG8 A;  1LCU A;  5AQS A;  1KVB A;  1RT6 A;  4KTZ A;  2NRT A;  4DV1 K;  3V9X A;  4CHZ A;  4RG8 A;  4F2S A;  3ZT0 A;  4BRH A;  2Q97 A;  1KVC A;  4CZE A;  3ID8 A;  3NFA A;  1K8K B;  5AQQ A;  4I2Q A;  2A1S A;  3VA0 A;  1OVY A;  1L5U A;  3DJC A;  1CXU A;  3OYL A;  4QS7 A;  2YX6 A;  3UE5 A;  2XY8 A;  1SKR A;  4I6M B;  3ZSY A;  4MLE A;  3AVJ A;  4LFB K;  4MDB A;  1VQM N;  1NG9 A;  4KHW A;  3G25 A;  2WUS A;  3CM5 A;  5B8H A;  4DU3 A;  1BQN A;  1HX1 A;  2OPQ A;  1Q86 O;  4ID1 A;  1L3S A;  5AZJ B;  2IIR A;  5AFU A;  4V19 S;  3C94 A;  1BU6 O;  4B1Z A;  2QWM A;  3HPO A;  4DFM A;  3I0R A;  2UYT A;  3HK2 A;  1YVN A;  3ULE A;  2ZGZ A;  3SUN A;  3CCE N;  4JAX A;  3K57 A;  3OHR A;  3O1B A;  4HUF A;  4CJS A;  1VHX A;  5M1N A;  4H0X B;  4PKH A;  1JL2 A;  3TAG A;  1LAV A;  3ISN C;  3DWL A;  3AO3 A;  3CJ7 A;  3NDK A;  1IO2 A;  2J4R A;  5JS2 A;  4GKK K;  1U2V A;  3EKU A;  3KLE A;  4FCY A;  3KLG A;  1E4G T;  3U8X A;  3QFU A;  4OGC A;  2P9N A;  3U6F A;  2D5R A;  2Z1H A; 
#chains in the Genus database with same CATH homology
 1RDB A;  3K5L A;  3TAQ A;  4CIG A;  3NF8 A;  4OPJ A;  4DFK A;  2BDP A;  3VQD A;  2BAN A;  4FJI A;  4HVJ A;  1IG9 A;  2OZM A;  3O3G A;  1YTU A;  3RR8 A;  1IKY A;  2R7Y A;  1UAX A;  2HNY A;  4NCA A;  5KRT A;  3TAN A;  4AHR A;  5EU7 A;  1RT1 A;  1GOC A;  1EET A;  4DQP A;  2WON A;  1RT5 A;  4CJL A;  1X9S A;  2EX3 A;  3C95 A;  4DU1 A;  4DTX A;  4DTP A;  4J2D A;  4KI6 A;  2HHQ A;  4M3X A;  1F21 A;  2IC3 A;  3AVM A;  1YT3 A;  3AA2 A;  4CEO A;  5CYQ A;  3V81 A;  4NCB A;  4CJQ A;  1R0A A;  1BIU A;  1RTH A;  1RBU A;  4KKO A;  1U47 A;  3OYF A;  1JLG A;  3LPT A;  3OS0 A;  4DLE A;  1KLN A;  4IFY A;  3OS2 A;  4PUO A;  4OJR A;  3KKR A;  4FXD A;  3RWU A;  4DTN A;  3P83 D;  2OZS A;  4FJM A;  3TAR A;  1ZBU A;  4B9L A;  2PZS A;  3AV9 A;  3M8S A;  3TWH A;  3DLR A;  4QOZ B;  4E7K A;  4FJ7 A;  2YHA A;  2Q3S A;  1S5J A;  4Y1C A;  4DTO A;  2X74 A;  3QEI A;  5HP1 A;  4FW1 A;  4KTQ A;  4CFB A;  4AIL C;  1LWF A;  4J2E A;  2HVH A;  2HHS A;  2XY6 A;  3LAM A;  4CJV A;  2D0A A;  4FJL A;  4OGE A;  5CYM A;  4KB1 A;  4FJ8 A;  1BHL A;  3HVT A;  3EY1 A;  1JLB A;  3WNF A;  4OVL A;  4FLY A;  2Y1J A;  2IDO A;  3LAL A;  3M8P A;  4GVM A;  3BGR A;  3VQ8 A;  4LY7 A;  3MEG A;  5I3U A;  4B9S A;  2Z1G A;  3V1R A;  4E1N A;  1C0U A;  4B9M A;  4DWI A;  5C24 A;  3HYF A;  3KTQ A;  4BE2 A;  2KFN A;  2X6S A;  1DTQ A;  4HUG A;  4K8X A;  4FYD A;  2RPI A;  1VSI A;  3V1O A;  3VQB A;  1D5A A;  5T7B A;  4CEE A;  2Y1I A;  4BAC A;  1ASW A;  1BQM A;  4KFB A;  5K14 A;  1ZBF A;  3NGI A;  4FJK A;  4B3O A;  4Z4I A;  2I5J A;  5HRS A;  3P1G A;  1IKV A;  1HRH A;  4Z4H A;  4Q5V A;  3AO2 A;  1BL3 A;  3LAN A;  3SUP A;  1DTT A;  2OPP A;  4EZ9 A;  1HYV A;  2ITG A;  1TL1 A;  3OS1 A;  2KZM A;  4CF2 A;  4RW9 A;  1J54 A;  3V1Q A;  3OYD A;  1NJW A;  4FK0 A;  4FW2 A;  3S3M A;  2D0B A;  1S1U A;  3ZSW A;  1C1B A;  4MQ3 A;  3K58 A;  1RBS A;  1TGO A;  1BI4 A;  1NK8 A;  4C8M A;  4NCG A;  4BWJ A;  4CGG A;  3I8D A;  3PV8 A;  3DLB A;  1VSD A;  1SL1 A;  3UIQ A;  4HTU A;  2IAJ A;  1ZYQ A;  2VG6 A;  3BDP A;  4CF0 A;  4DSJ A;  4DU4 A;  1L3U A;  1JXB A;  3SPY A;  1HNV A;  3ULD A;  3SZ2 A;  2HMI A;  4RW6 A;  4HHT A;  1T8E A;  4FJ9 A;  3QES A;  1NKB A;  3QEV A;  1RTI A;  1GOA A;  1JLE A;  4CGD A;  3HP9 A;  2YNH A;  3QET A;  3RMC A;  3AA3 A;  4AH9 A;  4CEC A;  3SPZ A;  2OYQ A;  4FLT A;  5HBM A;  3F9K A;  3PX6 A;  4B9U A;  2ZD1 A;  4FK2 A;  3HJF A;  3SQ0 A;  1LV5 A;  3HST B;  1NJY A;  1WN7 A;  2KQ2 A;  2RF2 A;  4DSK A;  4O0I A;  3U3G A;  4DS4 A;  3AVN A;  1VRT A;  2HHV A;  4EP5 A;  1IKX A;  1TVR A;  4CJP A;  3OYB A;  3I0S A;  3QIP A;  5CZ2 A;  3QNN A;  1TK8 A;  4HCB A;  3RRG A;  4BDZ A;  2EHG A;  4CES A;  4DQS A;  4AHT A;  3LP3 A;  3ZSO A;  2GUI A;  4Z0U A;  5FRO A;  3KLF A;  3SCX A;  1X9M A;  3VQ5 A;  5KGW A;  3RMB A;  4C8K A;  3VQA A;  1TK0 A;  3K2P A;  3OYA A;  3TAP A;  1RTD A;  5DMR A;  3U3Y A;  4N5S A;  4JRQ A;  3MED A;  4CFC A;  4CER A;  1BCM A;  4KO0 A;  1IH7 A;  3C6T A;  3OYM A;  1U4B A;  2HB5 A;  2PYJ A;  2OPS A;  4DS5 A;  4CJ5 A;  4CJ3 A;  1C1A A;  2FBV A;  4FLX A;  1SL0 A;  1TV6 A;  1QS4 A;  1YVU A;  4CJE A;  2DFE A;  3NH1 A;  3L2V A;  1WAJ A;  4OPK A;  2OA8 A;  2ETJ A;  2P1J A;  5FDL A;  4CHO A;  2RKI A;  3L3V A;  4TSX A;  3RMD A;  5CY4 A;  1GOB A;  2VWJ A;  1D8Y A;  1WNS A;  4DSF A;  3MAQ A;  1ASV A;  2QKB A;  3HM9 A;  3NHG A;  4O0J A;  4KB0 A;  2ATQ A;  1VSJ A;  1LWE A;  3LZJ A;  3DOL A;  4CJW A;  3ZT2 A;  1WSH A;  4XIU A;  4FM2 A;  4OLA A;  3S9H A;  1IKW A;  4H4M A;  4CF8 A;  1TKD A;  3HO1 A;  2NUB A;  1JLQ A;  3RR7 A;  1FKP A;  1XHX A;  3JYT A;  4JS4 A;  1QSY A;  3L3U A;  4ZHR A;  3OYH A;  3S3N A;  1KSP A;  4QAG A;  1Y97 A;  1C1C A;  3PUF A;  3F73 A;  2QKK A;  1C0M A;  1VSF A;  2FBX A;  3AVH A;  4GW6 A;  4OKJ A;  4CGH A;  3DYA A;  3DRP A;  5I42 A;  1NK0 A;  1HYZ A;  3EYZ A;  3PX0 A;  1I3A A;  2E6M A;  3MEC A;  3EZ5 A;  1KFS A;  2G8V A;  1HQE A;  3VQ7 A;  1RIL A;  4CEZ A;  1RDA A;  4W5Q A;  2W42 A;  5HRR A;  4E19 A;  1RTJ A;  3LWM A;  4F8R A;  2LSN A;  3O4Q A;  4J2A A;  4CEB A;  4IFV A;  4F3O A;  4DSE A;  1TKZ A;  4O55 A;  4E3S A;  3SYZ A;  1WSE A;  3AVG A;  1HPZ A;  3KJV A;  4CGF A;  2KFZ A;  3T19 A;  3HP6 A;  4E7L A;  4M3T A;  2YNI A;  2GV9 A;  1T7P A;  3V6D A;  1DLO A;  1NKC A;  3V9U A;  4M3R A;  4KHY A;  3NGY A;  4FJN A;  4KHU A;  2FBT A;  4I2P A;  1QE1 A;  4N47 A;  1RT4 A;  3TR8 A;  4B9V A;  3SQ4 A;  4Q0B A;  1EP4 A;  3AO1 A;  2HVI A;  2IS3 A;  1YTA A;  2FBY A;  3LPU A;  3ZSV A;  4JS5 A;  3CM6 A;  3T3F A;  1NK9 A;  4UQG A;  4F2R A;  4E7J A;  4M42 A;  1UA0 A;  5J1E A;  2B5J A;  4EP4 A;  2IOC A;  3MXJ A;  5HRN A;  3TI0 A;  3AVB A;  3QLH A;  4OKE A;  1EX4 A;  1HYS A;  3ZSR A;  3PY8 A;  4B8C A;  3NE6 A;  4DQQ A;  2JGU A;  3KK1 A;  1CXQ A;  1KTQ A;  4CHP A;  3HVR A;  4HUE A;  4CGJ A;  4N41 A;  4M3Z A;  1VK0 A;  2X6N A;  1MU2 A;  1J5O A;  1TAQ A;  3LDS A;  5J2Q A;  1A5X A;  1SKS A;  1JLF A;  2ZE2 A;  4O4G A;  3ZCM A;  2VG5 A;  1QSS A;  1TKX A;  4H8K A;  3LP2 A;  3QNO A;  1NK7 A;  3SJJ A;  3O4N A;  2FC0 A;  1Q8I A;  4I7F A;  4LD0 A;  2YHB A;  3TAE A;  4DTS A;  1EXQ A;  1S9E A;  1XWL A;  3AO5 A;  3VQE A;  4CEF A;  3TAF A;  4KV8 A;  2HNZ A;  3PX4 A;  3NBP A;  4CJK A;  1RT2 A;  1J53 A;  1LAW A;  4C8O A;  1WSG A;  2ZQB A;  1QSL A;  3JSM A;  1KLM A;  1JL1 A;  1VSH A;  1Z25 A;  4E1M A;  3OYC A;  3LZI A;  1NK6 A;  2PY5 A;  1SKW A;  1SV5 A;  2KZZ A;  4IG3 A;  3ALY A;  4O5B A;  4Y1D A;  4DSL A;  4O44 A;  3QEW A;  2GBZ A;  3E01 A;  4LH5 A;  4CK3 A;  5KRS A;  4CJ4 A;  3AVA A;  5KGX A;  2OPR A;  3WNG A;  2QXF A;  1TL3 A;  4F3T A;  4CEQ A;  1KFD A;  1ZBH A;  2YKN A;  1I39 A;  1LWC A;  3DLG A;  4PA1 A;  4M3W A;  4PY5 A;  3D45 A;  3VQQ A;  3B6O A;  3LP1 A;  3ZSX A;  4M41 A;  2WOM A;  1Z26 A;  3QEP A;  1NK5 A;  4KPY A;  4RW8 A;  1D9F A;  3KIO A;  1X9W A;  4BDP A;  3HT3 A;  4LH4 A;  1ITG A;  1NJX A;  4FLW A;  3VQ9 A;  4CIF A;  3S3O A;  4C8L A;  4CJT A;  3L2W A;  2KTQ A;  3L2U A;  4BE1 A;  2YKM A;  5J2M A;  5HLF A;  3FFI A;  3DLH A;  2O4I A;  3SQ1 A;  3KD1 E;  4EZ6 A;  1SUQ A;  3QIN A;  5SZT A;  2G8U A;  4C8N A;  3M8R A;  3LP0 A;  2HND A;  2P5O A;  2QK9 A;  2D0C A;  4DSI A;  4I9Q A;  4CK2 A;  1CLQ A;  1W9H A;  3K5O A;  4DTM A;  4DMN A;  3IG1 A;  2XO7 A;  3O3F A;  2YV0 X;  1S1X A;  3NGZ A;  3KK3 A;  1T05 A;  4E0D A;  2KW4 A;  4FVM A;  5CZ1 A;  1JLC A;  1QQC A;  3L2Q A;  4JRP A;  2IGI A;  3G10 A;  1RT7 A;  1G15 A;  3H08 A;  1REV A;  3ZSQ A;  3QER A;  4DF8 A;  2AJQ A;  2DY4 A;  4W5N A;  1C6V A;  4AHV A;  4PQU A;  1S6P A;  4M3Y A;  4IG0 A;  4JLH A;  3K59 A;  2JLE A;  1NKE A;  3SNN A;  3MXM A;  2O4G A;  3RRH A;  4J2B A;  3ASM A;  4E89 A;  4FZY A;  1A5W A;  3NF7 A;  2HHW A;  3DM2 A;  2P51 A;  4ZTJ A;  4BWM A;  3P5J A;  3ZT4 A;  4LSN A;  1O1W A;  1HNI A;  3OY9 A;  1B9D A;  4CJR A;  2G8K A;  1UA1 A;  4AHU A;  3V4I A;  2YNG A;  1K6Y A;  4CEA A;  5SWM A;  3SUQ A;  3AVF A;  1RBR A;  3PO4 A;  4FK4 A;  3IAY A;  2F8S A;  3MEE A;  1HQU A;  3VQC A;  4B08 A;  1BGX T;  1U45 A;  1L3T A;  2Z1J A;  1FKO A;  3NF9 A;  3CG7 A;  3SQ2 A;  4RW4 A;  3ZT3 A;  2HW3 A;  1QHT A;  3ZSZ A;  1BIZ A;  2G8F A;  1TAU A;  2E6L A;  4W5O A;  2BE2 A;  4FM0 A;  3DRR A;  1BIS A;  1KVA A;  4H4O A;  4LSL A;  4DTJ A;  3THV A;  4L8R B;  1ZBI A;  3NCI A;  3WNH A;  5HRP A;  3CFP A;  3SV4 A;  4CJF A;  3KLI A;  1T03 A;  3NF6 A;  1NJZ A;  2P5G A;  4ZTF A;  5J2N A;  1B9F A;  1BI4 B;  4OKK A;  3AVI A;  2DTU A;  4GMJ B;  2RN2 A;  4BDY A;  2F8T A;  4QCL A;  3NH0 A;  3KK2 A;  1A5V A;  1RDC A;  4DQR A;  1NK4 A;  2G8W A;  4KI4 A;  1S1V A;  3M8Q A;  5DK5 A;  5HRO A;  4KRE A;  3DLE A;  1NOY A;  1U04 A;  4ICL A;  4HCC A;  1S9G A;  4KHS A;  1EKE A;  3OJS A;  3NH2 A;  3V9S A;  1ASU A;  1LW0 A;  1RCH A;  4AHS A;  3OYG A;  1Q9X A;  2PYL A;  4FJ5 A;  2G8I A;  1VSL A;  5KTQ A;  3NAE A;  1RNH A;  1RDD A;  4DFJ A;  4Z4F A;  3QIO A;  3MXI A;  3TAB A;  1VSE A;  1FK9 A;  4CJU A;  3OYN A;  3OYE A;  3QEX A;  5C25 A;  1TKT A;  2XHB A;  4B9N A;  4DQI A;  4AHC A;  1VRU A;  3RTV A;  5KI6 A;  4PWD A;  4CFA A;  1L3V A;  4I9L A;  1KRP A;  3VQP A;  4E7I A;  1D9D A;  2Z1I A;  4DFP A;  5FRN A;  3LAK A;  1U48 A;  1KCF A;  2G8H A;  4FJX A;  3TAM A;  3AVK A;  4W5R A;  3OJU A;  4ELT A;  4Z4E A;  2HHT A;  1FXX A;  2HHU A;  3AVL A;  4DLG A;  1VSM A;  1J9A A;  4IKF A;  1N6Q A;  3V9W A;  4DG1 A;  4B9T A;  4DF4 A;  1JKH A;  2VWK A;  2DFH A;  3AA5 X;  4NYF A;  1JLA A;  1VSK A;  5JS1 A;  3ITH A;  3SI6 A;  3IS9 A;  1XHZ A;  3WNE A;  4Z4G A;  3V9Z A;  4KRF A;  1RT3 A;  4ELU A;  3VQ4 A;  1CZB A;  3HPG A;  1NOZ A;  4FLZ A;  1UWB A;  1N5Y A;  1W0H A;  3CFO A;  4FJH A;  4CK1 A;  4DTU A;  4NYN A;  4FJJ A;  3DI6 A;  3KKS A;  2E4L A;  4IBN A;  3RMA A;  1RBT A;  4YNQ A;  2B6A A;  3HL8 A;  1KVB A;  1RT6 A;  4CCH A;  4KTZ A;  1U49 A;  1BCO A;  1C0T A;  3AVC A;  5C42 A;  3OYI A;  4FM1 A;  4W5T A;  3V9X A;  4CHZ A;  4RG8 A;  1ZBL A;  3IRX A;  4F2S A;  3ZT0 A;  4M45 A;  3L2R A;  3OYK A;  4OLB A;  4MFB A;  4CHN A;  1KVC A;  4ID5 A;  4KAZ A;  3O3H A;  3NFA A;  4CIE A;  4N56 A;  3LWL A;  4I2Q A;  2A1S A;  3ZT1 A;  3VA0 A;  3VA3 A;  4DTR A;  4N76 A;  1WSI A;  1L5U A;  3T1A A;  4YFU A;  3KLH A;  1CXU A;  4M3U A;  1LW2 A;  1XC9 A;  1CZ9 A;  4CHQ A;  3OYL A;  4CHY A;  2XY8 A;  1XI1 A;  1SKR A;  3QO9 A;  3SV3 A;  1S1T A;  3ZSY A;  2VG7 A;  3AVJ A;  4R5P A;  2XY7 A;  4KHQ A;  2F96 A;  4FZX C;  4Z4C A;  4KHW A;  3HPH A;  4B8A B;  4E7H A;  4G1Q A;  1SL2 A;  5J2P A;  2B4J A;  3VN5 A;  5FRM A;  3CM5 A;  2YNF A;  3K5N A;  4CED A;  3DMJ A;  2XRI A;  4DU3 A;  1BQN A;  3K5M A;  1QTM A;  1WLJ A;  2OPQ A;  1TK5 A;  4FJG A;  3DRS A;  1B92 A;  4ID1 A;  3OYJ A;  1L3S A;  4FLV A;  4CGI A;  5D3G A;  1S6Q A;  3C94 A;  1WSF A;  3HPO A;  4CFD A;  2BGG A;  4DFM A;  3I0R A;  2A1R A;  3B6P A;  1RBV A;  3HK2 A;  1HJR A;  3OVN A;  4FZZ A;  1S1W A;  3DOK A;  3CYM A;  2HHX A;  3SUN A;  3L8B A;  3A2F A;  3D0P A;  3K57 A;  3KD5 E;  2DFF A;  2XY5 A;  4HUF A;  1WAF A;  4CJS A;  3C6U A;  4CF1 A;  1JXE A;  4WE1 A;  4BE0 A;  4KTW A;  1JL2 A;  1UOC A;  3VQ6 A;  3TAG A;  4CE9 A;  4K8Z A;  3HXM A;  1LAV A;  4IDK A;  4ELV A;  3ISN C;  3AO4 A;  3SUO A;  3PO5 A;  4CF9 A;  3DLK A;  3AO3 A;  3NDK A;  4RW7 A;  5E41 A;  3CFR A;  1IO2 A;  5JS2 A;  4F4K A;  2X78 A;  4FLU A;  3AA4 A;  1X1P A;  1Q9Y A;  3KLE A;  4FCY A;  3KLG A;  1HMV A;  3CQ8 A;  4OGC A;  4KHN A;  1WSJ A;  3G0Z A;  3U6F A;  2D5R A;  2Z1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...