1JL2A

Crystal structure of tceo rnase h-a chimera combining the folding core from t. thermophilus rnase h and the remaining region of e. coli rnase h
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
150
structure length
150
Chain Sequence
KQVEIFTDGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELKAAIEGLKALKEPAEVDLYTDSHYLKKAFTEGWLEGWRKRGWRTAEGKPVKNRDLWEALLLAMAPHRVRFHFVKGHAGHPENERADELARAAAMNPTLEDTGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chimera of Ribonuclease HI, Ribonuclease H
publication title Contributions of folding cores to the thermostabilities of two ribonucleases H.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 42
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jl2A00
1SL1A 4BDPA 2VG5A 1YTUA 1RDDA 3QEPA 2QXFA 3AVIA 2YNFA 3K2PA 1RT2A 2OPSA 3QINA 3OJSA 3HVRA 4HHTA 4KHQA 2BDPA 3IAYA 2G8IA 1UA0A 4CIEA 4H4MA 3LDSA 4FJ8A 2F96A 3LZIA 5CYMA 3KD5E 2DTUA 3CFPA 3S3NA 4J2EA 3NBPA 3KK2A 3V9UA 2W42A 3OYMA 1C1BA 3S3MA 2IC3A 4CGJA 3TANA 1ITGA 3HPHA 1LW2A 3I0SA 4J2DA 4UQGA 4L8RB 2RF2A 2OZMA 4FM0A 1FKPA 4RW7A 1NJXA 4KV8A 3VQ9A 2EHGA 4M3UA 2VWJA 1TKDA 4RW9A 2OPRA 1TV6A 1S1VA 4JS5A 4CFAA 3OYHA 3SZ2A 1SKWA 4K8ZA 1KVAA 1ZBFA 1GOAA 1C1CA 3NF7A 1FXXA 4ID1A 1U4BA 1WN7A 3PY8A 1SV5A 4GVMA 3LWLA 3QEVA 4KB1A 1TL3A 3NF9A 3TARA 4CJTA 4YNQA 3HK2A 3UIQA 3DM2A 3HVTA 3ITHA 4CGDA 3TAFA 1D9DA 2G8UA 3HXMA 3I8DA 5FRMA 3OJUA 3VQ6A 1JL1A 3QLHA 1IKXA 4BACA 3NH2A 4OLBA 2HHVA 2HMIA 1UAXA 4B9SA 4CF8A 3AO3A 1RBTA 3M8SA 1T7PA 2PYLA 3B6OA 1RTJA 3KK1A 3SPZA 1KFSA 1RTIA 4CEQA 3OYEA 4KTZA 4BE1A 1U49A 3CM6A 4EZ9A 1L3TA 1T8EA 3AA2A 5J2NA 4CEFA 4DS4A 4DU4A 3AO4A 1NKBA 3QESA 3VQPA 4I9QA 4PA1A 2GBZA 1Q8IA 1RT4A 3PUFA 1VSKA 1QTMA 1KLNA 3NE6A 3QNOA 3AVNA 2BANA 3NH0A 1Y97A 3HL8A 2JGUA 1HYVA 4CJ3A 4HUEA 1XHXA 1HNIA 4CGFA 3VQ8A 3ZCMA 3NF8A 2HHTA 4CJKA 4H4OA 3KK3A 1QSLA 3V9SA 4KHNA 3LALA 1J53A 4RW6A 4FXDA 3M8QA 4FW2A 4N5SA 4DTMA 4QOZB 1BIZA 1DLOA 1IKYA 4Q5VA 2Z1GA 2IGIA 3QEXA 4W5QA 3H08A 4CHYA 4FJKA 1RBVA 4IFVA 4OJRA 1X9WA 3RMDA 3SUPA 4DMNA 4CK1A 1L5UA 1J5OA 1S1WA 4M41A 2XHBA 2KZMA 3V1RA 2XY7A 3G10A 3BDPA 4BWMA 3NGIA 1REVA 3RMBA 4MQ3A 3VQDA 4DF8A 4OPJA 4Y1DA 4KKOA 3F73A 1TL1A 4GW6A 4DTNA 4FJ7A 2FBVA 2KTQA 3EY1A 2Y1IA 3MXJA 1TVRA 3ZT1A 5KRTA 4DSFA 3RWUA 2A1SA 1QE1A 4FLUA 3PO5A 1JLBA 1A5WA 3P83D 4JRPA 3LP3A 3TAQA 4KHYA 1S6QA 1QS4A 1VSMA 4CEZA 4O44A 4KO0A 1NKEA 2YNIA 3S3OA 2RN2A 2B4JA 2B5JA 4IDKA 4B9VA 4M3ZA 4LSLA 5I42A 3OVNA 3THVA 4J2AA 3AVJA 4ELUA 3VA3A 1EX4A 2HNZA 1A5XA 1JLCA 4CE9A 3V9ZA 2ZE2A 4PY5A 4FJHA 3PX0A 4FJIA 4B9UA 3PX4A 3RR8A 1L3SA 4FK4A 1CXQA 1RCHA 1X1PA 3E01A 4NYNA 4F2RA 3K58A 4NCAA 3CM5A 4DSJA 3D0PA 2XO7A 3QEWA 1HYSA 3LZJA 1TAQA 3BGRA 1C1AA 2XRIA 1DTTA 1K6YA 1W0HA 4CJSA 4FLXA 3RRHA 3RMAA 3HJFA 3KLIA 4CIGA 4FYDA 2VWKA 4FCYA 3SCXA 1NJWA 5DMRA 3L2UA 3ZSVA 3P5JA 1DTQA 4CF1A 1ZBIA 4MFBA 3VQ7A 3L2QA 2D0AA 1RT5A 3RMCA 4LD0A 4E1NA 1KTQA 4HVJA 3KLGA 3SNNA 5HRSA 3NCIA 4C8MA 4XIUA 2Y1JA 4AHTA 1SL0A 4FM2A 3OY9A 4FLVA 2Z1HA 4CGIA 4DTOA 4KI6A 4GMJB 4KB0A 4QAGA 1JLAA 1KVBA 4CJ4A 5J2QA 1TAUA 3WNGA 3OS2A 2HHQA 1YT3A 1Q9XA 3ZSZA 3P1GA 1VRTA 1NK5A 1WSEA 1MU2A 3DI6A 2OYQA 3A2FA 1ZYQA 2KFNA 2X6NA 1A5VA 2G8WA 1J54A 3ZSWA 3TAPA 1LAWA 1WAFA 1WSGA 3U3GA 1HRHA 1N5YA 3QNNA 1B9FA 1BI4B 1S5JA 3DLHA 5T7BA 2AJQA 5K14A 3CFOA 1VSEA 1JKHA 1L3VA 1C0MA 4CJWA 3TABA 2E6LA 2HVHA 4DU1A 1LAVA 4Q0BA 3KLEA 3I0RA 3C6UA 3TAMA 4CERA 5SWMA 3O3GA 3U6FA 4CHNA 3DRSA 3TR8A 3TAGA 4DG1A 4ZHRA 4DFMA 3VQ4A 3K5LA 3SI6A 1S6PA 4CJVA 4Z4HA 3EYZA 3O3FA 3K5NA 4AH9A 1D5AA 1RDAA 3L3UA 4FZYA 1B92A 1C0UA 4IFYA 1IG9A 3ZT2A 1HMVA 3KLHA 4RW8A 1T05A 2RPIA 1HNVA 4CJPA 3SQ1A 4Y1CA 2KZZA 1NJZA 4W5RA 1HPZA 3OYNA 4FZZA 4LSNA 1TK5A 3KLFA 2XY6A 4FJGA 2D0CA 1TKZA 3DLGA 5CY4A 4N56A 5HRPA 1BI4A 3HSTB 4CEOA 4CK2A 3IS9A 1XWLA 3AVGA 2YKNA 1ASVA 3NGZA 1ZBLA 4DQPA 3KD1E 1WSFA 1YVUA 3VQCA 1QSSA 3ZSQA 1VSLA 1UOCA 1LV5A 2OA8A 4DSIA 4E7LA 3VQEA 4FJXA 4OKEA 4HCBA 4JS4A 1EP4A 1KSPA 4HUGA 4C8NA 4N47A 3AO5A 2QKBA 3L3VA 4CJEA 1X9MA 1NK4A 4M3XA 3SYZA 2P5GA 4N41A 4FK2A 3RTVA 4KREA 2HNYA 1JLGA 2HB5A 1KRPA 4DS5A 3T1AA 1Z26A 4CJ5A 3ULDA 3FFIA 3MEEA 1LW0A 4CEEA 3OYDA 3SUOA 4TSXA 3V4IA 4IKFA 4NYFA 4G1QA 4KTQA 4EP4A 1RILA 5CYQA 1RDCA 1TGOA 4EP5A 1Z25A 2YV0X 4CGGA 4HUFA 2FBXA 1WSJA 2IS3A 4BE0A 2QKKA 4JLHA 4DSLA 4DFJA 2GV9A 4FVMA 3V9WA 4Z4EA 3HO1A 2HVIA 1ASUA 2GUIA 5C42A 3K5MA 3TAEA 4B8AB 2HHXA 1VSJA 4FJLA 3KTQA 2I5JA 4K8XA 2IOCA 4C8KA 1SKRA 4FK0A 4OGEA 2WOMA 3VN5A 3M8RA 1RBUA 3CQ8A 2BE2A 3DLKA 1IO2A 1F21A 2YKMA 5HLFA 2DFHA 3K59A 1EXQA 2DFEA 3LAMA 3LANA 4KFBA 4CHOA 5HROA 3MXMA 3SPYA 5KGXA 3ZSXA 1R0AA 4E3SA 1S1UA 1NKCA 1WLJA 1RTDA 1D8YA 4DQIA 2HW3A 1BHLA 3U3YA 4B3OA 4CCHA 3ASMA 3SQ0A 1JLQA 4KHUA 1LWEA 4CEAA 1RBRA 3NGYA 5KTQA 3JSMA 1U47A 3KIOA 5EU7A 1SKSA 4ID5A 4PQUA 3QO9A 3ZSRA 1S9GA 1TKXA 3HYFA 2HHSA 5JS1A 4AHCA 1EETA 5KRSA 1BL3A 1BCMA 4R5PA 3ISNC 4BE2A 5FDLA 1UA1A 2OZSA 2ZQBA 3DRRA 4HCCA 5FRNA 3OYFA 2P1JA 4KHWA 3V81A 3C95A 4I2QA 2YHAA 1VSFA 1RT1A 1SL2A 3V1QA 4B9MA 1UWBA 4QCLA 3SUNA 3QETA 4J2BA 1CLQA 4LH4A 3M8PA 1EKEA 4I7FA 4DTRA 1C6VA 3ALYA 3QERA 2DFFA 4DLGA 4ELVA 2XY8A 2YHBA 3QIPA 4KTWA 3OYIA 3G0ZA 5KI6A 1IKVA 2IAJA 2G8FA 5FROA 3EZ5A 3HP6A 3LP2A 3NHGA 4OVLA 4BDZA 4OLAA 2PZSA 3V6DA 4CFCA 4F3TA 4E89A 2LSNA 3MEDA 2FBTA 4E19A 4AHUA 4Z4FA 5KGWA 1HQEA 1JXEA 2OPQA 4H8KA 4DU3A 2F8SA 2ATQA 2WONA 5HRNA 3ZT0A 3LP0A 2E6MA 4W5NA 3HPOA 3OYJA 4F3OA 5D3GA 3WNHA 1YTAA 3QEIA 3LP1A 1S9EA 4HTUA 3OYGA 4OPKA 1GOCA 3QIOA 1B9DA 1X9SA 1LWCA 2NUBA 2JLEA 4BDYA 4CESA 4DSKA 2D5RA 4AHSA 5HP1A 3ZSYA 1ASWA 2B6AA 4KRFA 1BISA 2IDOA 4I9LA 1RT7A 4O4GA 3O4QA 4EZ6A 3V1OA 3CFRA 1G15A 2VG7A 2E4LA 3LAKA 1WSIA 4Z0UA 3CYMA 4CECA 1VSIA 3L2WA 4E7KA 2D0BA 4DQRA 1QSYA 1FKOA 1KVCA 3AA4A 4DLEA 3SV3A 4FLWA 3AVFA 3C6TA 4Z4CA 3DOKA 3DYAA 4YFUA 1VRUA 3PO4A 1KLMA 1BGXT 1WAJA 1BCOA 4ICLA 4OKJA 3HP9A 4CJRA 3PV8A 2G8VA 3DLBA 5I3UA 4KI4A 3LPTA 3MECA 3OYAA 3TI0A 1HQUA 4E1MA 2P51A 1GOBA 4CJUA 3OS1A 3AVHA 4WE1A 4B8CA 4O0IA 1VSHA 4W5OA 1NJYA 2PYJA 1JLFA 1VK0A 4B9TA 1Q9YA 1J9AA 1W9HA 2XY5A 4DWIA 4AHRA 2KQ2A 1RBSA 4FLTA 4FW1A 3RR7A 4M45A 1XC9A 4FZXC 4M3WA 1RTHA 3NF6A 2R7YA 4FLZA 2FBYA 1BIUA 4IBNA 4IG3A 2Z1JA 3L2VA 4RW4A 4O0JA 1RT3A 4CJLA 1U48A 4E0DA 1S1TA 3T19A 3MXIA 3OYCA 3K5OA 2F8TA 1HJRA 5HBMA 5DK5A 3ZSOA 4CEBA 1TK8A 2HHWA 2EX3A 4CHQA 3SQ4A 4KAZA 4AILC 2X74A 3SV4A 1KCFA 3IRXA 4RG8A 3VQQA 3LWMA 3DLRA 1D9FA 4O55A 1WSHA 3CG7A 1IH7A 1NK8A 2DY4A 1U04A 4DTUA 3C94A 4CJFA 4B08A 4M3YA 2ITGA 2YNGA 4DQSA 4PUOA 1TKTA 3T3FA 4O5BA 1LWFA 4LH5A 4W5TA 3B6PA 1S1XA 4CHZA 3K57A 3VA0A 3V9XA 3S9HA 1NK9A 4PWDA 4CJQA 1RT6A 3AV9A 3NAEA 1C0TA 3AO1A 3AVKA 1JL2A 2O4IA 4E7IA 3ZT4A 4C8LA 2A1RA 3RRGA 4LY7A 1O1WA 4ELTA 4F2SA 1HYZA 1KFDA 2YNHA 2VG6A 4CF9A 4ZTJA 3HPGA 5JS2A 3OYLA 3AVCA 2OPPA 4IG0A 2RKIA 3AVBA 3L8BA 3DRPA 3O3HA 1T03A 3VQ5A 1NK7A 2ETJA 4NCGA 1ZBUA 4AHVA 4E7JA 1I3AA 4I2PA 4CF0A 4FLYA 4DFKA 4FJNA 3IG1A 1SUQA 3AVAA 4DTPA 3NDKA 4FJMA 4NCBA 1QQCA 3AO2A 2Q3SA 4FM1A 4ZTFA 3NH1A 3OS0A 4DTXA 3F9KA 4CHPA 5CZ1A 5SZTA 3D45A 2Z1IA 3MAQA 5J2MA 4M42A 2KFZA 1CXUA 3ZT3A 4FJJA 4DTSA 4OGCA 2FC0A 1N6QA 1NK0A 4CFDA 4C8OA 1RNHA 3JYTA 5HRRA 4F4KA 3L2RA 4E7HA 5C25A 1BQNA 4CGHA 4DQQA 4M3RA 5J2PA 3AA3A 3SUQA 3KKRA 4KPYA 3DOLA 1JLEA 4CEDA 3SJJA 1BQMA 4N76A 2PY5A 4F8RA 2QK9A 3DMJA 1NK6A 1L3UA 3WNEA 1NOYA 1FK9A 2P5OA 1XHZA 1CZBA 3HT3A 3LPUA 2ZD1A 1U45A 5J1EA 1RDBA 5C24A 3PX6A 1NOZA 4JRQA 4CIFA 3NFAA 4KHSA 3TWHA 2HNDA 1JXBA 2BGGA 3AVMA 4DSEA 3SQ2A 3DLEA 4B9LA 2O4GA 3HM9A 4B9NA 4Z4GA 3WNFA 3O4NA 4CFBA 5E41A 4OKKA 1WNSA 3OYBA 4FJ9A 4DFPA 2KW4A 2G8KA 4BWJA 3VQBA 4CF2A 3VQAA 1IKWA 2HHUA 4CK3A 4DTJA 1TK0A 3KKSA 2X78A 4FJ5A 1ZBHA 3MEGA 2G8HA 4M3TA 3OYKA 3AVLA 3KJVA 3AA5X 1QHTA 1XI1A 5CZ2A 4DF4A 1CZ9A 1I39A 4Z4IA 1VSDA 2X6SA
chains in the Genus database with same CATH superfamily
4FWRA 2QXFA 3W0LA 5F2RA 2O8EB 3OJSA 2O8CB 3VF4A 1QZ6A 2FF3B 2G8IA 4CIEA 3LDSA 2VQEK 2F96A 3FE1A 3LZIA 5CYMA 2DTUA 2QEXN 4J2EA 1C1BA 2IC3A 3TANA 2F4VK 4BQZA 1LW2A 1T6CA 4MO4A 3THXA 2NRVA 2OZMA 2P9NB 3VQ9A 4M3UA 1TKDA 4RW9A 1CZAN 1YF5L 2OPRA 3F2KA 3SZ2A 4ID1A 1GOAA 3PY8A 1WN7A 5C12A 3QEVA 4PL8A 4O8KA 4YNQA 3HVTA 3TAFA 3CPEA 5BPLA 5FRMA 1XUPO 3MCPA 3O9UA 1T7PA 2PYLA 3B6OA 1RTJA 1RTIA 2PAVA 4CEQA 5AQUA 4KTZA 3U4LA 4DV3K 3CM6A 5M1QA 5J2NA 4PA1A 1Q8IA 3PUFA 2RHKA 1QTMA 3CERA 2YI1A 3D2EA 5A2QO 1OH6A 1D4XA 4IO9L 5AQSA 1NMNA 3QDKA 4H4OA 1QQMA 1XMOK 3VF2A 2Z1GA 2IGIA 3L4IA 1VQ5N 1X9WA 1J5OA 1L5UA 4CK1A 1S1WA 2WFBA 1X9JA 5AQVA 4IJAA 2UYTA 3NGIA 5KQDA 2WC9A 4MQ3A 5AQWA 1XMQK 2NZTA 1TL1A 4GW6A 2A5XA 2Y1IA 4FLUA 1JLBA 4H0TB 3TAQA 4KHYA 1S6QA 4KO0A 3S3OA 2B5JA 3KWGA 4LSLA 5I42A 3C65A 5FPDA 3PX4A 3K58A 4NCAA 4JKGA 1U2VA 2XO7A 2CH6A 3EEQA 1K6YA 3O8MA 3KLIA 4CIGA 3SCXA 4BRDA 3L2QA 3I33A 1RT5A 2ASMA 4LD0A 3KLGA 1WUAA 3ZX2A 4AQYK 4C8MA 4XIUA 3ENBA 4ISEA 2FXUA 4FM2A 3OY9A 5BR8K 4KB0A 4QAGA 1JLAA 4B1VA 3WNGA 3OS2A 1Q9XA 3EE9A 3P1GA 1NK5A 1MU2A 1RDWX 1ZYQA 3TAPA 3DXKA 4YOWA 1N5YA 2O8DA 1BI4B 1S5JA 2QI2A 4BR5A 1Q7YO 3DXMA 3L0QA 4Q0BA 3C6UA 3TAMA 2Q0RA 3C7NB 1DKGD 5F0XA 4MDAA 4CZGA 4DFMA 3EYZA 4Z4HA 3K5NA 1X3MA 1RDAA 4H5VA 4IFEA 4NO7A 5AQYA 1IG9A 3ZT2A 4JYAK 1T05A 4JEPA 1NJZA 3OYNA 1HPZA 3CHWA 4LSNA 1TK5A 1H1VA 5LMUK 1K8KA 3KD1E 4DQPA 3NGZA 3AARA 1WSFA 1UOCA 1LV5A 4E7LA 4OKEA 4O8UA 5C0YA 4HCBA 3MN6A 4BRHA 3CD6N 2HBMA 3AO5A 5LL6Z 2QKBA 4IXCA 1WBBA 3L3VA 4F9OA 4KREA 3RTVA 5BRDA 2HB5A 3T1AA 1Z26A 1BA1A 1IBKK 3V4IA 4CGGA 4HUFA 3U8XA 3CJ1A 1WSJA 2JWKA 4JLHA 4DFJA 5EX5A 3CC4N 2QXLA 3LM2A 1IBMK 4FK0A 1XNRK 4OGEA 4JI6K 3CQ8A 1F21A 2W40A 3M1FA 4CHOA 5FPEA 3MXMA 3GG4A 1NKCA 4DQIA 1WLJA 1D8YA 1BHLA 4B3OA 1EWQA 3ASMA 1JLQA 5C10A 4DV0K 1QQNA 3NGYA 5EU7A 1T44A 1SKSA 4JKAA 4K0KK 3HYFA 5JS1A 4R5PA 3ISNC 4K25A 1YXQA 2VYPA 2CH5A 3V81A 3U9DA 2OTLN 1NGIA 3C95A 3O08A 1VSFA 3P4IA 1UWBA 2O8FB 1EKEA 1C6VA 4ELVA 3QIPA 4B3RK 3OYIA 3G0ZA 4QS7A 5KI6A 3HP6A 1VQKN 3KK7A 3CIPA 4CFCA 3ZETA 1JXEA 2OPQA 3BF3A 2ATQA 4W5NA 3LM9A 1YTAA 3QEIA 4CBWA 2NNWA 4OPKA 4A59A 3F5TA 2JLEA 4BDYA 5CE3A 2D5RA 1HJOA 5C2FA 5LJVA 1VQON 2IDOA 3V1OA 1G15A 2VG7A 3LAKA 2E5LK 4CECA 4E7KA 1HKCA 4DLEA 4FLWA 3AVFA 4Z4CA 4X65K 2ZJPL 1SZ2A 3VESA 1BCOA 4OKJA 4KI4A 4BRPA 5I3UA 4JI0K 3OYAA 3TI0A 1GOBA 3AVHA 4B8CA 3WQTA 5JLHA 1VSHA 1WBDA 3EN9A 1Q9YA 4KH5A 1W9HA 4UY8O 4DWIA 1T3VA 1U6ZA 4FW1A 3HSCA 1KAXA 4FLZA 4JK8A 5CR4A 2F7TA 1DT9A 3K9KA 2Z1JA 1RT3A 4QS8A 3LDOA 3J7AP 2A40A 5DK5A 2HHWA 2EX3A 3EL2A 4CHQA 2OCEA 2X74A 2YHWA 1KCFA 1KXPA 3IRXA 4RG8A 3DLRA 1D9FA 5AFUA 4JAXA 1YJNN 2VWBA 4DTUA 4GV6A 4CJFA 2Q36A 2ITGA 4DQSA 3T3FA 2E88A 4RCHA 3K57A 3V9XA 3O5BA 4CJQA 1RT6A 2HBKA 3AVKA 4BG9A 3ZT4A 4C8LA 3RRGA 2NRTA 5AQOA 4FWNA 2BTFA 2YNHA 3TSPA 3OTOK 5JS2A 3D6RA 3BEXA 3WEEA 3H1QA 3L8BA 3O3HA 1NOYA 1NLVA 4NCGA 3WXKA 2EWSA 1QQCA 4NCBA 2P9PA 4FM1A 1RDUA 2HOEA 2YJFA 5SZTA 3VEZA 3MAQA 1ILYA 4M42A 4B3MK 4G9ZA 1VQ9N 4FO0A 3CCVN 4K41A 4C8OA 2ZGYA 1KQSM 4CGHA 4FPAA 3QBWA 3I56N 4BQLA 4KPYA 1NGDA 1BQMA 1NGJA 1M90O 4F8RA 3WNEA 3FFKB 1XHZA 3EE8A 3PX6A 1NOZA 3TWHA 1JXBA 4DSEA 3MN9A 3DLEA 2O4GA 4Z4GA 4BRFA 3WNFA 3O4NA 1JCEA 3OYBA 4JKFA 2KW4A 4RTFD 4CVNE 4BWJA 4CW7B 4CK3A 2FSNA 1ZBHA 3THXB 1ATRA 2G8HA 3AVLA 3C0BA 3AA5X 1MWKA 1QHTA 3QNOA 4B1XB 4Z4IA 2X6SA 2VG5A 1RDDA 1YAGA 3QEPA 3AVIA 4KHQA 2OPSA 5ADXA 3NVMA 4FPBA 1UA0A 2BDPA 1WB9A 2UUBK 3GDQA 3SBTA 4JD2A 3S3NA 3NBPA 3KK2A 3V9UA 3OW2M 2P9LA 4CD3A 3VENA 2NRRA 4AF1A 4CGJA 4PL7A 4J2DA 4UQGA 3CMAN 4FM0A 2E1YA 1NGBA 2NLXA 4RW7A 1WOQA 1HKGA 2VWJA 4CI6A 4V19S 1TV6A 4JS5A 3OYHA 4K8ZA 1C1CA 5ELZA 3HO1A 1SV5A 3LWLA 1TL3A 4CJTA 3D2EB 3ITHA 1JCFA 4H5WA 3I8DA 3GL1A 3VQ6A 1JL1A 3LDPA 1VQMN 4LF7K 1YITN 3QLHA 4BACA 1KAYA 2HMIA 4B9SA 2WTUA 3SJHA 3SPZA 1MWMA 1KFSA 3R6MA 1V4SA 4BE1A 4A61A 4HWIA 4EZ9A 5BR9A 4CEFA 1X3NA 3PSFA 1MA9B 4I9QA 2D0OA 1VSKA 1Q81O 1KLNA 4BR7A 1Y97A 1HYVA 1S22A 4HUEA 1HNIA 4NXNK 3ZCMA 3NF8A 2VCPA 4CJKA 1QSLA 3R8EA 4RW6A 4BR2A 2QWMA 3QEXA 4IFVA 4OJRA 1IV0A 1HNZK 4M41A 2KZMA 5AQJA 2XY7A 3CQYA 1REVA 2GUPA 1QSSA 4DF8A 4WFAL 4DTNA 3GOIA 1TVRA 4JKGB 1U2VB 3ZT1A 3THYA 5KRTA 4CBXA 3ID8A 1QE1A 2A3ZA 1VSMA 3SLCA 1SAZA 4B9VA 1IG8A 1VQNN 3OVNA 3VA3A 1EX4A 1HR0K 3H6EA 4H0VB 2ZE2A 3V9ZA 4PY5A 4FJIA 4RWTA 3THWA 4FK4A 5LMNK 4H0PA 4NYNA 2AA4A 4DSJA 3P39A 1TAQA 3BGRA 1DTTA 1C0FA 1W0HA 5M1OA 3DXKB 3IKMA 4DR5K 3NVKA 1ESVA 2O8DB 1KD1O 2Q97A 3O9QA 4E1NA 2YCHA 3DXMB 4HVJA 3SNNA 2Y1JA 4FLVA 3KVGA 4DTOA 4GMJB 1VQ8N 1KVBA 5B8HA 3ZSZA 4EHTA 1VRTA 3DI6A 2OYQA 4YORA 5I9EB 5AR0A 1A5VA 2G8WA 5AZJA 2E2QA 3BP8A 1LAWA 4JKCA 3QNNA 1K8KB 3DLHA 3TPQA 4DU1A 1LAVA 3RSEA 5CHIA 4CHNA 3TR8A 4DG1A 3VQ4A 3K5LA 4JI2K 4CJVA 5AQHA 2HSTA 3L3UA 1C0UA 2YJEA 4DR6K 2RPIA 1HNVA 4MDBA 1VQLN 1OKJA 3BZCA 3KLFA 3J80O 5CY4A 4K43A 5HRPA 3HSTB 4CK2A 3IS9A 1XWLA 4CZEA 1ZBSA 4OPAA 5JMVA 3G71N 3A8YA 4DR1K 3OBWA 4DSIA 4FJXA 1T6DA 4WYBA 4HUGA 3ENHA 2HF4A 5KQ8A 1X9MA 1NK4A 3D2FA 4N41A 3CCJN 1JLGA 4DS5A 4IDHA 3MEEA 1LW0A 3ULEA 4TSXA 4AM6A 3CCMN 3SUOA 1VHXA 4NYFA 4G1QA 4BREA 4KTQA 1RILA 5CYQA 1RDCA 3J8AA 5TKWA 4DSLA 4Z4EA 4FVMA 3V9WA 1YJ9N 2HVIA 2GUIA 4BRLA 4B8AB 1KC8O 3KTQA 1N8RO 4NLCA 5GAHP 4C8KA 4B9QA 4XH4A 1KAZA 2O8BA 3M8RA 3VN5A 1RBUA 2YKMA 4NLBA 4CZFA 5HROA 4KH4A 1G99A 2HMPA 4E3SA 4JHDA 2UUCK 2F9TA 4CCHA 3SQ0A 3VGKA 1LWEA 4YDUC 2FSKA 4CEAA 4GKJK 3JSMA 4JNEA 2FLOA 1U47A 3HM8A 5AJ3K 3QO9A 3ZETB 1TUUA 1TKXA 2HHSA 5BN9A 1EETA 5KRSA 1BCMA 4BE2A 1UA1A 2OZSA 3CMEN 5FRNA 4KHWA 4IOAL 4IWVA 2ASOA 2HBJA 4R79A 3SUNA 1R59O 1CLQA 2CGKA 4BR4A 3QERA 3CETA 3ALYA 4BGAA 4DLGA 2YHBA 4DR4K 3PLAA 1IKVA 3SAHA 3LP2A 3NHGA 4OLAA 4BDZA 2QWLA 1RFQA 4E89A 1YTUA 5KGWA 2F8SA 1JJ2M 1P8ZA 4LFCK 5D3GA 2VGNA 3WNHA 3WXIA 1BOTO 4HTUA 4OPHA 1X9SA 1LWCA 1XNQK 2NUBA 3TTFA 4IOCL 5HP1A 2E2NA 1ASWA 2B6AA 3UKRA 1Q86O 4DU3A 1N34K 4Z0UA 1WSIA 4J8FA 1NGFA 3A5OC 4DB3A 3L2WA 2D0BA 4BR0A 3VGMA 4DQRA 1FKOA 1QSYA 4YFUA 4CJRA 3GE1A 3HZ6A 4JKEA 1E3MA 1V4TA 1HQUA 2VQFK 1NG9A 3WUHA 3S41A 4A2AA 4O0IA 1NJYA 1VK0A 4YOVA 5AQGA 1RBSA 2E2OA 2IIRA 4KBOA 3E9PA 4FWOA 3WXLA 5AQFA 2FBYA 4IBNA 4DKWA 5KPZA 1U48A 4JI4K 2RE2A 2IVPA 2D4WA 1S1TA 3OYCA 4BC4A 3O1BA 4CEBA 1TK8A 4FWKA 1HNWK 3G4SN 3VQQA 3WEEB 3LWMA 2HBLA 3QBXA 1WSHA 3PIOL 3CG7A 1IH7A 3ZX3A 2DY4A 3R3LA 3C94A 3HTVA 2P9PB 5BRFA 4O5BA 3T69A 4EAHD 3B6PA 1S1XA 4CHZA 5JICA 4W5TA 5AFUH 4JI3K 3NAEA 1JL2A 3O4WA 4LY7A 4LF8K 1QQOA 1ZC6A 4F2SA 1HYZA 2VG6A 4CF9A 4ZTJA 2QWRA 2OPPA 4FWSA 3DRPA 4EFHA 4E7JA 1ZBUA 3EKUA 4FJNA 1K9MO 4I2PA 4FLYA 3VTHA 4DTPA 4FJMA 2Q3SA 4ZTFA 3JXUA 3NH1A 3OS0A 4FVUA 3TSUA 4BC2A 3CJAA 2Z1IA 3D45A 3ZT3A 4FJJA 4DTSA 4OGCA 2KKZA 1N6QA 1NK0A 4CFDA 3JYTA 4F4KA 4DQQA 1SQKA 2V7ZA 1JLEA 4WCEL 2QK9A 1L3UA 1FK9A 3FZFA 3NMUA 1P90A 1U45A 3CJ9A 4M7XA 2P9UA 4CIFA 5HL7L 5BRHA 3P31A 5AQTA 4BRIA 1IJJA 2H3GX 3SQ2A 3HM9A 2YHXA 5E41A 1RGIA 4JD2B 3ENOA 3A5NC 2G8KA 2P9LB 1Z05A 5DM7L 5GIPA 4DTJA 1TK0A 4FJ5A 2E1ZA 2UU9K 5EY4A 1XC3A 3LDNA 2NRXA 1SS6A 4JI7K 5CZ2A 4DF4A 1MDUB 3O9RA 1NBWA 1YVNA 3HVRA 1RT2A 4CBUA 4HHTA 5GINA 3IAYA 4H4MA 3IFRA 3QFPA 4A5BA 4FWLA 3KD5E 1M1KO 4LF9K 1TUYA 5DM6L 1BDGA 3OYMA 1N32K 3S3MA 5ADXH 1ITGA 4CZJA 3IUCA 2GELA 3I0SA 4IJNA 4L8RB 3R1XA 4KV8A 1S1VA 1SKWA 1KVAA 1ZBFA 4KHNA 4GVMA 4KB1A 3TARA 3OA9A 4CGDA 2G8UA 5BN8A 1W97L 3DAWA 3HXMA 1ATSA 4A5AA 1E4GT 3OJUA 1IKXA 2GTDA 2HHVA 1UAXA 5AQLA 4CF8A 3JAMO 3AO3A 1GLDG 3FLCO 3KK1A 2P9KA 3K0SA 4A62A 3OYEA 1U49A 3MX2A 1T8EA 1YHQN 4DS4A 4DU4A 2A41A 1NKBA 1O13A 4ISFA 4C1NK 1RT4A 3O80A 4CJ3A 4C23A 1XHXA 1TYQA 3BY5A 3VQ8A 1ATNA 4GVEA 3ATVA 2HHTA 2I7PA 2QW9A 3CF5L 3THYB 4H0XB 4FW2A 4N5SA 4DTMA 4QOZB 1BIZA 1DLOA 4W5QA 3H08A 3ZEUA 4CHYA 4FJKA 3ZX0A 2YHYA 3N4PA 3KWIA 3SUPA 3FZKA 3G10A 3BDPA 3H45C 3EKSA 3VF6A 3IDHA 3THWB 3RMBA 3VQDA 4OPJA 4Y1DA 4KKOA 2NRWA 3F73A 3MMVA 2FBVA 4ILGB 2KTQA 5GAGP 3MXJA 3RWUA 3T1YK 2A1SA 1GLBG 4BRQA 5AQZA 3DWLA 4I6MA 4JRPA 3H3OB 3LP3A 1QS4A 1EQYA 1N36K 1NGCA 4O44A 3VMFB 1NKEA 2RN2A 1LOTB 2B4JA 4IDKA 4J2AA 2QM1A 2HNZA 4FWPA 3EZWA 3CJCA 1A5XA 1JLCA 3QB0A 4BVOA 4CE9A 4WFNL 3RR8A 4BROA 1L3SA 1CXQA 1X1PA 4JK7A 3CM5A 3D0PA 3QEWA 1HYSA 1GLFO 3HJFA 3RMAA 4BR9A 4LF6K 4WQ4A 2VWKA 4H5RA 5AZJB 5AQIA 3ZSVA 3L2UA 1ZBIA 3VQ7A 3MDQA 1KTQA 4CD1A 3CQXA 3RSEB 4CZHA 3NCIA 4Y0WA 4DV2K 4B1YB 1SL0A 2UXDK 4KI6A 5J2QA 4CJ4A 1TAUA 2GX9A 2QWQA 4LC9B 1DGKN 2ITMA 4IOXA 2KFNA 1J54A 1GLCG 1WAFA 3U3GA 1NJIO 1NM1A 1B9FA 1LCUA 4M7YA 3VEXA 5T7BA 2AJQA 1VSEA 3HOSA 3N4QA 1C0MA 4CJWA 3TABA 1VQ6N 3SK3A 3I0RA 3O3GA 2CGLA 3DRSA 3TAGA 5GADP 4ZHRA 3SMPA 5AQQA 5M1PA 3SMSA 1B92A 4IFYA 4DR3K 2UXBK 3D2FB 1Q82O 2OANA 3KLHA 4RW8A 2KZZA 3VGLA 4FZZA 3BF1A 3TTDA 3T7ZA 3ULEB 2XY6A 1TKZA 3DLGA 4CEOA 3PO4A 2HHUA 2YKNA 3AVGA 3FZHA 3F9MA 2OA8A 3MN5A 3VQEA 2W6KA 4NB4A 1EP4A 4C8NA 4N47A 3AY9A 5EOYA 2O8BB 4CJEA 4M3XA 5LY3A 4FK2A 5AQXA 2D0PA 3MK6A 3Q7CA 4JKHA 3QMLA 3O1WA 2ZGZA 3FFIA 3ZYYX 4CEEA 2Q0UA 4IKFA 4JHDB 2FBXA 2IS3A 3M3ZA 2ZWHA 4FWQA 5EVZA 3VETA 2QKKA 3TAEA 4GV3A 1Y64A 4K8XA 2DPNA 2ASPA 2WOMA 3DLKA 1OH7A 2F9WA 4YOYA 5TKYA 5HLFA 2DFHA 5IT9O 4KFBA 3H3NO 4CZMA 5KGXA 3SPYA 3ZSXA 1R0AA 1S1UA 2P9SA 2HW3A 1HNXK 2NRZA 3U3YA 3TU5A 4BC3A 1W7AA 1RBRA 3FGUA 3KZBA 1NGAA 3KIOA 4X64K 1BUPA 3IMXA 1EO1A 3LL3A 4ID5A 1S72N 3UKUA 4BRGA 3MX5A 1BL3A 5FDLA 1C0GA 1HLUA 2QWPA 3UB5A 4I2QA 2YHAA 1SL2A 4B9MA 4QCLA 2PFUA 3M8PA 4KTWA 3UKRB 2IAJA 2G8FA 5FROA 3EZ5A 3MN7A 4OVLA 1OVQA 2LSNA 4Z4FA 4AHUA 2IVOA 4H8KA 3OHRA 5HRNA 1BA0A 4MLHA 3VOVA 5BREA 3ZT0A 4DR7K 4F3OA 3LP1A 1S9EA 4PKHA 5FPNA 4K42A 1GOCA 4DSKA 2OTJN 5JLFA 4BRAA 1BG3A 4I9LA 4O4GA 3O4QA 1NWKA 4EZ6A 2E4LA 1VSIA 1KVCA 3SV3A 3C6TA 3DOKA 4GY2B 1VRUA 1KLMA 4ICLA 4NXMK 2G8VA 3DLBA 3PV8A 3LPTA 2P9IA 5AQPA 2P51A 4E1MA 4CJUA 3OS1A 2FSJA 2PYJA 1JLFA 1QVFM 4CZIA 4FLTA 3ZLJA 1IBLK 1NGEA 3O9SA 1XC9A 4M3WA 2R7YA 5JVGL 3FZMA 3L2VA 4E0DA 4OX9K 3T19A 3MXIA 1XQSC 4ILJA 3K5OA 2F8TA 5BPMA 5AZIA 3CI5A 4KAZA 3SQ4A 4AILC 4PKIA 3W3DA 4EHUA 3SAFA 1NNEA 4O55A 5C15A 4GKKK 4YOUA 1NK8A 4B3TK 1U04A 4B08A 1GLAG 4M3YA 1TKTA 1LWFA 4LH5A 3SAGA 1BU6O 1NK9A 3AV9A 3AO1A 5E84A 4E7IA 2A1RA 4LFBK 4BRMA 1O1WA 3HRGA 2ZJRL 4EIAA 3OYLA 2CGJA 4IG0A 1VQ4N 3AVBA 1T03A 3VEWA 4DFKA 2Q1NA 3AVAA 3J81O 3AO2A 3F9KA 4CHPA 5J2MA 2P9UB 2KFZA 4XH1A 1CXUA 4H0OA 4JK9A 5IWAK 5JVHL 1YI2N 1RNHA 3PSIA 3CPWM 3L2RA 4E7HA 5C25A 1BQNA 5J2PA 3O6WA 2YX6A 1YUWA 3DOLA 4CEDA 3SJJA 2PY5A 1NK6A 3PIPL 3VEVA 1FJGK 3CCQN 5J1EA 1RDBA 5C24A 5M1NA 4IZ9A 4BRCA 4JRQA 3NFAA 2A6AA 1VQPN 4KHSA 4DQ8A 2HNDA 2BGGA 5KPTA 2E8AA 1WNSA 4WQ4C 3D7EO 4DFPA 1I94K 3VQBA 4CF2A 3G25A 1W2BM 3MEGA 4YY3K 4DHYA 4M3TA 4JI8K 3KJVA 1XI1A 1CZ9A 3FR0A 3M6GA 1VSDA 1SL1A 3K2PA 2YNFA 3QINA 3I55N 4YOXA 4FJ8A 3CFPA 2KLAA 2W42A 3HPHA 5GAEP 2P9KB 3I8BA 2RF2A 4DUYK 4E1JA 1FKPA 3WXJA 4OO1J 1NJXA 2EHGA 2GWKA 4CFAA 4DV6K 3NF7A 4DCHA 2O8EA 1FXXA 1U4BA 2O8CA 4ILHA 3NF9A 5C2DA 3HK2A 3O9TA 3UIQA 3DM2A 5EXWA 3AAQA 2JWLA 1D9DA 1S3XA 3WT0A 1TYQB 1VQ7N 3ID6A 1QVGM 3J7YP 3NH2A 4OLBA 2KHOA 2W6LA 1RBTA 4WFBL 3M8SA 3T1HK 5MLCQ 3UE5A 3SBGA 2P9NA 1L3TA 3ZEUB 3AA2A 4CZKA 3AO4A 3FZLA 3QESA 3VQPA 2GBZA 3CCEN 3NE6A 3AVNA 2BANA 3C6AA 3NH0A 3HL8A 2JGUA 2ZM6K 4CGFA 2E2PA 2UUAK 2QWOA 3AGRA 3KK3A 3V9SA 3LALA 1J53A 4FXDA 3M8QA 3HBTA 1NGGA 4Q5VA 1IKYA 4I6MB 4JKBA 4X66K 1RBVA 3DJCA 3RMDA 1E4FT 4DMNA 3CCLN 2XHBA 3V1RA 4BGBA 4BWMA 3RVCA 4BDPA 4FJ7A 5AQRA 4O5FA 1NGHA 3EY1A 3CCUN 4DSFA 1ZXOA 3PO5A 1N33K 1A5WA 3P83D 4CEZA 2E20A 5FPMA 2YNIA 4XEIA 4JKDA 4M3ZA 1J6ZA 3THVA 3AVJA 2WBNA 4ELUA 1VAZA 4MLEA 2ZF5O 3PX0A 4FJHA 4B9UA 3CXCM 1RCHA 4LF4K 4FWMA 3E01A 4WQ5A 4F2RA 3LZJA 1C1AA 2XRIA 4CJSA 3RRHA 4FLXA 1OH8A 4FYDA 4FCYA 1NJWA 5DMRA 3VTIA 3EO3A 3P5JA 1DTQA 4CF1A 3G6EN 4MFBA 1NMDA 2NRHA 2IVNA 2D0AA 3RMCA 1Z6RA 5HRSA 3K9JA 5M1KA 4AHTA 3QFUA 3VEOA 4HTLA 2Z1HA 4CGIA 2V7YA 2UXCK 2HHQA 4ISGA 1YT3A 3HOTA 2BUPA 2I7NA 1WSEA 3A2FA 4BVPA 2X6NA 3ZSWA 4IEIA 1WSGA 1HRHA 2V51B 4DV4K 1QHAA 5K14A 3CFOA 1JKHA 1L3VA 2HVHA 2E6LA 3KLEA 4CERA 5SWMA 3U6FA 2GWJA 5M1FA 3SI6A 1S6PA 3M5RA 3O3FA 4B3SK 4AH9A 1D5AA 4FZYA 4IO8A 1HMVA 3TTCA 4CJPA 3SQ1A 1K73O 4Y1CA 4W5RA 1OH5A 4FJGA 2D0CA 4N56A 1BI4A 1ZBLA 1ASVA 1YVUA 3VQCA 1BO5O 1YIJN 2Q2RA 3ZSQA 1VSLA 3C7NA 4JS4A 1KSPA 4B1ZA 4WF9L 3SYZA 2P5GA 4JI5K 1GLLO 4B1WB 2HNYA 3LDLA 1KRPA 4M63C 3ULDA 4CJ5A 1HUXA 4C1NI 3OYDA 2P9SB 4KHPK 4EP4A 4EP5A 1TGOA 1Z25A 2YV0X 2Q31A 4BE0A 2GV9A 1ASUA 5C42A 3K5MA 2HHXA 1VSJA 4PKGA 4FJLA 2I5JA 2IOCA 1SKRA 3CC7N 3UKUB 3L6QA 2BE2A 1IO2A 3GBTA 3K59A 1EXQA 2DFEA 3LAMA 3LANA 4GV9A 1RTDA 3JS6A 3AGKA 4MO5A 5E26A 5AQMA 4KHUA 2VGMA 1OVYA 4U7BA 5AQNA 5KTQA 2PBDA 3AAPA 4AM7A 4YDUA 4PQUA 3ZSRA 1S9GA 1FW6A 4AHCA 1EWRA 4BG8A 2ZQBA 3DRRA 4HCCA 4DV7K 3OYFA 2P1JA 3TSQA 4DUZK 1RT1A 3V1QA 5HOOA 2AP1A 3QETA 4J2BA 3CC2N 4LH4A 1Q18A 4I7FA 4DTRA 5FLXO 2DFFA 2XY8A 5F1XA 3MWTA 3MWPA 2PZSA 3V6DA 3HI0A 4F3TA 4BRNA 2D1KA 3MEDA 2FBTA 4CZLA 4E19A 2HF3A 1HQEA 3B8AX 2WONA 5BPNA 3Q7BA 1K8AO 3LP0A 2E6MA 3HPOA 3OYJA 2A42A 2GEMA 3CJBA 3L4QA 4DV1K 3OYGA 3QIOA 2P9IB 1B9DA 1QZ5A 2O8FA 4FSVA 3U9ZA 4A2BA 4CESA 3VERA 4AHSA 3ZSYA 4BY9C 4KRFA 4PHTX 3KHYA 1BISA 4L3QA 3C6HA 4YHHK 4H5TA 1RT7A 3CFRA 3CYMA 4DR2K 1HPMA 4JI1K 3AA4A 3MCAB 4DV5K 2BH1A 3DYAA 4JV5K 1BGXT 1WAJA 3VPZA 4FOIA 1BWFO 3HP9A 1GLEG 5AZIB 3MECA 2J4RA 3QICA 4LFAK 4WE1A 4W5OA 5AQKA 4B9TA 1J9AA 4U67L 4BRKA 2XY5A 4AHRA 3E1YA 2ZJQL 3RR7A 4M45A 1JCGA 5KPRA 4FZXC 1RTHA 3NF6A 4H5NA 1BIUA 4IG3A 4RW4A 3OBYA 4O0JA 4CJLA 1HKBA 1HJRA 5HBMA 3ZSOA 1YJWN 2QTDA 3SV4A 3H1VX 4BC5A 3WXMB 2QA4N 2V52B 4QS9A 4XH5A 3CJ7A 2YNGA 4PUOA 3LDQA 3CCSN 1NU0A 3S9HA 3VA0A 4PWDA 1C0TA 2O4IA 2HHHK 3A5LC 4ELTA 2W41A 3E9OA 3DLLL 1KFDA 4FOEA 3HPGA 4H0YB 3AVCA 2RKIA 4YOTA 1HX1A 4IEEA 3VQ5A 1NK7A 2ETJA 3E9LA 4AHVA 1I3AA 3E66A 4CF0A 3J7ZO 3IG1A 1SUQA 3NDKA 3P38A 4JN4A 4DTXA 3A0IX 5CZ1A 2QWNA 3A5MC 3ATUA 4H03B 2FC0A 4Z94A 5HRRA 3VEYA 4M3RA 1GLJO 5GIOA 3AA3A 3SUQA 3WQUA 1J5EK 3KKRA 4KH6A 3R9PA 5LJWA 3BUZB 4N76A 3DMJA 5H1SQ 2P5OA 1CZBA 3HT3A 3LPUA 2ZD1A 4CJ7A 4WQ5C 2WUSA 4LF5K 3AVMA 4B9LA 4B9NA 4CFBA 2FF6A 4GNIA 4OKKA 4X62K 4FJ9A 4FL9A 3H46O 4B1UB 3CCRN 3VQAA 1IKWA 3KKSA 2X78A 4A57A 3OYKA 3BZKA 1I39A 1DEJA 2KQ2A
chains in the Genus database with same CATH topology
1SL1A 4BDPA 2VG5A 1YTUA 1RDDA 3QEPA 2QXFA 3AVIA 2YNFA 3K2PA 1RT2A 2OPSA 3QINA 3OJSA 3HVRA 4HHTA 4KHQA 2BDPA 3IAYA 2G8IA 1UA0A 4CIEA 4H4MA 3LDSA 4FJ8A 2F96A 3LZIA 5CYMA 3KD5E 2DTUA 3CFPA 3S3NA 4J2EA 3NBPA 3KK2A 3V9UA 2W42A 3OYMA 1C1BA 3S3MA 2IC3A 4CGJA 3TANA 1ITGA 3HPHA 1LW2A 3I0SA 4J2DA 4UQGA 4L8RB 2RF2A 2OZMA 4FM0A 1FKPA 4RW7A 1NJXA 4KV8A 3VQ9A 2EHGA 4M3UA 2VWJA 1TKDA 4RW9A 2OPRA 1TV6A 1S1VA 4JS5A 4CFAA 3OYHA 3SZ2A 1SKWA 4K8ZA 1KVAA 1ZBFA 1GOAA 1C1CA 3NF7A 1FXXA 4ID1A 1U4BA 1WN7A 3PY8A 1SV5A 4GVMA 3LWLA 3QEVA 4KB1A 1TL3A 3NF9A 3TARA 4CJTA 4YNQA 3HK2A 3UIQA 3DM2A 3HVTA 3ITHA 4CGDA 3TAFA 1D9DA 2G8UA 3HXMA 3I8DA 5FRMA 3OJUA 3VQ6A 1JL1A 3QLHA 1IKXA 4BACA 3NH2A 4OLBA 2HHVA 2HMIA 1UAXA 4B9SA 4CF8A 3AO3A 1RBTA 3M8SA 1T7PA 2PYLA 3B6OA 1RTJA 3KK1A 3SPZA 1KFSA 1RTIA 4CEQA 3OYEA 4KTZA 4BE1A 1U49A 3CM6A 4EZ9A 1L3TA 1T8EA 3AA2A 5J2NA 4CEFA 4DS4A 4DU4A 3AO4A 1NKBA 3QESA 3VQPA 4I9QA 4PA1A 2GBZA 1Q8IA 1RT4A 3PUFA 1VSKA 1QTMA 1KLNA 3NE6A 3QNOA 3AVNA 2BANA 3NH0A 1Y97A 3HL8A 2JGUA 1HYVA 4CJ3A 4HUEA 1XHXA 1HNIA 4CGFA 3VQ8A 3ZCMA 3NF8A 2HHTA 4CJKA 4H4OA 3KK3A 1QSLA 3V9SA 4KHNA 3LALA 1J53A 4RW6A 4FXDA 3M8QA 4FW2A 4N5SA 4DTMA 4QOZB 1BIZA 1DLOA 1IKYA 4Q5VA 2Z1GA 2IGIA 3QEXA 4W5QA 3H08A 4CHYA 4FJKA 1RBVA 4IFVA 4OJRA 1X9WA 3RMDA 3SUPA 4DMNA 4CK1A 1L5UA 1J5OA 1S1WA 4M41A 2XHBA 2KZMA 3V1RA 2XY7A 3G10A 3BDPA 4BWMA 3NGIA 1REVA 3RMBA 4MQ3A 3VQDA 4DF8A 4OPJA 4Y1DA 4KKOA 3F73A 1TL1A 4GW6A 4DTNA 4FJ7A 2FBVA 2KTQA 3EY1A 2Y1IA 3MXJA 1TVRA 3ZT1A 5KRTA 4DSFA 3RWUA 2A1SA 1QE1A 4FLUA 3PO5A 1JLBA 1A5WA 3P83D 4JRPA 3LP3A 3TAQA 4KHYA 1S6QA 1QS4A 1VSMA 4CEZA 4O44A 4KO0A 1NKEA 2YNIA 3S3OA 2RN2A 2B4JA 2B5JA 4IDKA 4B9VA 4M3ZA 4LSLA 5I42A 3OVNA 3THVA 4J2AA 3AVJA 4ELUA 3VA3A 1EX4A 2HNZA 1A5XA 1JLCA 4CE9A 3V9ZA 2ZE2A 4PY5A 4FJHA 3PX0A 4FJIA 4B9UA 3PX4A 3RR8A 1L3SA 4FK4A 1CXQA 1RCHA 1X1PA 3E01A 4NYNA 4F2RA 3K58A 4NCAA 3CM5A 4DSJA 3D0PA 2XO7A 3QEWA 1HYSA 3LZJA 1TAQA 3BGRA 1C1AA 2XRIA 1DTTA 1K6YA 1W0HA 4CJSA 4FLXA 3RRHA 3RMAA 3HJFA 3KLIA 4CIGA 4FYDA 2VWKA 4FCYA 3SCXA 1NJWA 5DMRA 3L2UA 3ZSVA 3P5JA 1DTQA 4CF1A 1ZBIA 4MFBA 3VQ7A 3L2QA 2D0AA 1RT5A 3RMCA 4LD0A 4E1NA 1KTQA 4HVJA 3KLGA 3SNNA 5HRSA 3NCIA 4C8MA 4XIUA 2Y1JA 4AHTA 1SL0A 4FM2A 3OY9A 4FLVA 2Z1HA 4CGIA 4DTOA 4KI6A 4GMJB 4KB0A 4QAGA 1JLAA 1KVBA 4CJ4A 5J2QA 1TAUA 3WNGA 3OS2A 2HHQA 1YT3A 1Q9XA 3ZSZA 3P1GA 1VRTA 1NK5A 1WSEA 1MU2A 3DI6A 2OYQA 3A2FA 1ZYQA 2KFNA 2X6NA 1A5VA 2G8WA 1J54A 3ZSWA 3TAPA 1LAWA 1WAFA 1WSGA 3U3GA 1HRHA 1N5YA 3QNNA 1B9FA 1BI4B 1S5JA 3DLHA 5T7BA 2AJQA 5K14A 3CFOA 1VSEA 1JKHA 1L3VA 1C0MA 4CJWA 3TABA 2E6LA 2HVHA 4DU1A 1LAVA 4Q0BA 3KLEA 3I0RA 3C6UA 3TAMA 4CERA 5SWMA 3O3GA 3U6FA 4CHNA 3DRSA 3TR8A 3TAGA 4DG1A 4ZHRA 4DFMA 3VQ4A 3K5LA 3SI6A 1S6PA 4CJVA 4Z4HA 3EYZA 3O3FA 3K5NA 4AH9A 1D5AA 1RDAA 3L3UA 4FZYA 1B92A 1C0UA 4IFYA 1IG9A 3ZT2A 1HMVA 3KLHA 4RW8A 1T05A 2RPIA 1HNVA 4CJPA 3SQ1A 4Y1CA 2KZZA 1NJZA 4W5RA 1HPZA 3OYNA 4FZZA 4LSNA 1TK5A 3KLFA 2XY6A 4FJGA 2D0CA 1TKZA 3DLGA 5CY4A 4N56A 5HRPA 1BI4A 3HSTB 4CEOA 4CK2A 3IS9A 1XWLA 3AVGA 2YKNA 1ASVA 3NGZA 1ZBLA 4DQPA 3KD1E 1WSFA 1YVUA 3VQCA 1QSSA 3ZSQA 1VSLA 1UOCA 1LV5A 2OA8A 4DSIA 4E7LA 3VQEA 4FJXA 4OKEA 4HCBA 4JS4A 1EP4A 1KSPA 4HUGA 4C8NA 4N47A 3AO5A 2QKBA 3L3VA 4CJEA 1X9MA 1NK4A 4M3XA 3SYZA 2P5GA 4N41A 4FK2A 3RTVA 4KREA 2HNYA 1JLGA 2HB5A 1KRPA 4DS5A 3T1AA 1Z26A 4CJ5A 3ULDA 3FFIA 3MEEA 1LW0A 4CEEA 3OYDA 3SUOA 4TSXA 3V4IA 4IKFA 4NYFA 4G1QA 4KTQA 4EP4A 1RILA 5CYQA 1RDCA 1TGOA 4EP5A 1Z25A 2YV0X 4CGGA 4HUFA 2FBXA 1WSJA 2IS3A 4BE0A 2QKKA 4JLHA 4DSLA 4DFJA 2GV9A 4FVMA 3V9WA 4Z4EA 3HO1A 2HVIA 1ASUA 2GUIA 5C42A 3K5MA 3TAEA 4B8AB 2HHXA 1VSJA 4FJLA 3KTQA 2I5JA 4K8XA 2IOCA 4C8KA 1SKRA 4FK0A 4OGEA 2WOMA 3VN5A 3M8RA 1RBUA 3CQ8A 2BE2A 3DLKA 1IO2A 1F21A 2YKMA 5HLFA 2DFHA 3K59A 1EXQA 2DFEA 3LAMA 3LANA 4KFBA 4CHOA 5HROA 3MXMA 3SPYA 5KGXA 3ZSXA 1R0AA 4E3SA 1S1UA 1NKCA 1WLJA 1RTDA 1D8YA 4DQIA 2HW3A 1BHLA 3U3YA 4B3OA 4CCHA 3ASMA 3SQ0A 1JLQA 4KHUA 1LWEA 4CEAA 1RBRA 3NGYA 5KTQA 3JSMA 1U47A 3KIOA 5EU7A 1SKSA 4ID5A 4PQUA 3QO9A 3ZSRA 1S9GA 1TKXA 3HYFA 2HHSA 5JS1A 4AHCA 1EETA 5KRSA 1BL3A 1BCMA 4R5PA 3ISNC 4BE2A 5FDLA 1UA1A 2OZSA 2ZQBA 3DRRA 4HCCA 5FRNA 3OYFA 2P1JA 4KHWA 3V81A 3C95A 4I2QA 2YHAA 1VSFA 1RT1A 1SL2A 3V1QA 4B9MA 1UWBA 4QCLA 3SUNA 3QETA 4J2BA 1CLQA 4LH4A 3M8PA 1EKEA 4I7FA 4DTRA 1C6VA 3ALYA 3QERA 2DFFA 4DLGA 4ELVA 2XY8A 2YHBA 3QIPA 4KTWA 3OYIA 3G0ZA 5KI6A 1IKVA 2IAJA 2G8FA 5FROA 3EZ5A 3HP6A 3LP2A 3NHGA 4OVLA 4BDZA 4OLAA 2PZSA 3V6DA 4CFCA 4F3TA 4E89A 2LSNA 3MEDA 2FBTA 4E19A 4AHUA 4Z4FA 5KGWA 1HQEA 1JXEA 2OPQA 4H8KA 4DU3A 2F8SA 2ATQA 2WONA 5HRNA 3ZT0A 3LP0A 2E6MA 4W5NA 3HPOA 3OYJA 4F3OA 5D3GA 3WNHA 1YTAA 3QEIA 3LP1A 1S9EA 4HTUA 3OYGA 4OPKA 1GOCA 3QIOA 1B9DA 1X9SA 1LWCA 2NUBA 2JLEA 4BDYA 4CESA 4DSKA 2D5RA 4AHSA 5HP1A 3ZSYA 1ASWA 2B6AA 4KRFA 1BISA 2IDOA 4I9LA 1RT7A 4O4GA 3O4QA 4EZ6A 3V1OA 3CFRA 1G15A 2VG7A 2E4LA 3LAKA 1WSIA 4Z0UA 3CYMA 4CECA 1VSIA 3L2WA 4E7KA 2D0BA 4DQRA 1QSYA 1FKOA 1KVCA 3AA4A 4DLEA 3SV3A 4FLWA 3AVFA 3C6TA 4Z4CA 3DOKA 3DYAA 4YFUA 1VRUA 3PO4A 1KLMA 1BGXT 1WAJA 1BCOA 4ICLA 4OKJA 3HP9A 4CJRA 3PV8A 2G8VA 3DLBA 5I3UA 4KI4A 3LPTA 3MECA 3OYAA 3TI0A 1HQUA 4E1MA 2P51A 1GOBA 4CJUA 3OS1A 3AVHA 4WE1A 4B8CA 4O0IA 1VSHA 4W5OA 1NJYA 2PYJA 1JLFA 1VK0A 4B9TA 1Q9YA 1J9AA 1W9HA 2XY5A 4DWIA 4AHRA 2KQ2A 1RBSA 4FLTA 4FW1A 3RR7A 4M45A 1XC9A 4FZXC 4M3WA 1RTHA 3NF6A 2R7YA 4FLZA 2FBYA 1BIUA 4IBNA 4IG3A 2Z1JA 3L2VA 4RW4A 4O0JA 1RT3A 4CJLA 1U48A 4E0DA 1S1TA 3T19A 3MXIA 3OYCA 3K5OA 2F8TA 1HJRA 5HBMA 5DK5A 3ZSOA 4CEBA 1TK8A 2HHWA 2EX3A 4CHQA 3SQ4A 4KAZA 4AILC 2X74A 3SV4A 1KCFA 3IRXA 4RG8A 3VQQA 3LWMA 3DLRA 1D9FA 4O55A 1WSHA 3CG7A 1IH7A 1NK8A 2DY4A 1U04A 4DTUA 3C94A 4CJFA 4B08A 4M3YA 2ITGA 2YNGA 4DQSA 4PUOA 1TKTA 3T3FA 4O5BA 1LWFA 4LH5A 4W5TA 3B6PA 1S1XA 4CHZA 3K57A 3VA0A 3V9XA 3S9HA 1NK9A 4PWDA 4CJQA 1RT6A 3AV9A 3NAEA 1C0TA 3AO1A 3AVKA 1JL2A 2O4IA 4E7IA 3ZT4A 4C8LA 2A1RA 3RRGA 4LY7A 1O1WA 4ELTA 4F2SA 1HYZA 1KFDA 2YNHA 2VG6A 4CF9A 4ZTJA 3HPGA 5JS2A 3OYLA 3AVCA 2OPPA 4IG0A 2RKIA 3AVBA 3L8BA 3DRPA 3O3HA 1T03A 3VQ5A 1NK7A 2ETJA 4NCGA 1ZBUA 4AHVA 4E7JA 1I3AA 4I2PA 4CF0A 4FLYA 4DFKA 4FJNA 3IG1A 1SUQA 3AVAA 4DTPA 3NDKA 4FJMA 4NCBA 1QQCA 3AO2A 2Q3SA 4FM1A 4ZTFA 3NH1A 3OS0A 4DTXA 3F9KA 4CHPA 5CZ1A 5SZTA 3D45A 2Z1IA 3MAQA 5J2MA 4M42A 2KFZA 1CXUA 3ZT3A 4FJJA 4DTSA 4OGCA 2FC0A 1N6QA 1NK0A 4CFDA 4C8OA 1RNHA 3JYTA 5HRRA 4F4KA 3L2RA 4E7HA 5C25A 1BQNA 4CGHA 4DQQA 4M3RA 5J2PA 3AA3A 3SUQA 3KKRA 4KPYA 3DOLA 1JLEA 4CEDA 3SJJA 1BQMA 4N76A 2PY5A 4F8RA 2QK9A 3DMJA 1NK6A 1L3UA 3WNEA 1NOYA 1FK9A 2P5OA 1XHZA 1CZBA 3HT3A 3LPUA 2ZD1A 1U45A 5J1EA 1RDBA 5C24A 3PX6A 1NOZA 4JRQA 4CIFA 3NFAA 4KHSA 3TWHA 2HNDA 1JXBA 2BGGA 3AVMA 4DSEA 3SQ2A 3DLEA 4B9LA 2O4GA 3HM9A 4B9NA 4Z4GA 3WNFA 3O4NA 4CFBA 5E41A 4OKKA 1WNSA 3OYBA 4FJ9A 4DFPA 2KW4A 2G8KA 4BWJA 3VQBA 4CF2A 3VQAA 1IKWA 2HHUA 4CK3A 4DTJA 1TK0A 3KKSA 2X78A 4FJ5A 1ZBHA 3MEGA 2G8HA 4M3TA 3OYKA 3AVLA 3KJVA 3AA5X 1QHTA 1XI1A 5CZ2A 4DF4A 1CZ9A 1I39A 4Z4IA 1VSDA 2X6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SL1 A;  4BDP A;  2VG5 A;  1YTU A;  1RDD A;  3QEP A;  2QXF A;  3AVI A;  2YNF A;  3K2P A;  1RT2 A;  2OPS A;  3QIN A;  3OJS A;  3HVR A;  4HHT A;  4KHQ A;  2BDP A;  3IAY A;  2G8I A;  1UA0 A;  4CIE A;  4H4M A;  3LDS A;  4FJ8 A;  2F96 A;  3LZI A;  5CYM A;  3KD5 E;  2DTU A;  3CFP A;  3S3N A;  4J2E A;  3NBP A;  3KK2 A;  3V9U A;  2W42 A;  3OYM A;  1C1B A;  3S3M A;  2IC3 A;  4CGJ A;  3TAN A;  1ITG A;  3HPH A;  1LW2 A;  3I0S A;  4J2D A;  4UQG A;  4L8R B;  2RF2 A;  2OZM A;  4FM0 A;  1FKP A;  4RW7 A;  1NJX A;  4KV8 A;  3VQ9 A;  2EHG A;  4M3U A;  2VWJ A;  1TKD A;  4RW9 A;  2OPR A;  1TV6 A;  1S1V A;  4JS5 A;  4CFA A;  3OYH A;  3SZ2 A;  1SKW A;  4K8Z A;  1KVA A;  1ZBF A;  1GOA A;  1C1C A;  3NF7 A;  1FXX A;  4ID1 A;  1U4B A;  1WN7 A;  3PY8 A;  1SV5 A;  4GVM A;  3LWL A;  3QEV A;  4KB1 A;  1TL3 A;  3NF9 A;  3TAR A;  4CJT A;  4YNQ A;  3HK2 A;  3UIQ A;  3DM2 A;  3HVT A;  3ITH A;  4CGD A;  3TAF A;  1D9D A;  2G8U A;  3HXM A;  3I8D A;  5FRM A;  3OJU A;  3VQ6 A;  1JL1 A;  3QLH A;  1IKX A;  4BAC A;  3NH2 A;  4OLB A;  2HHV A;  2HMI A;  1UAX A;  4B9S A;  4CF8 A;  3AO3 A;  1RBT A;  3M8S A;  1T7P A;  2PYL A;  3B6O A;  1RTJ A;  3KK1 A;  3SPZ A;  1KFS A;  1RTI A;  4CEQ A;  3OYE A;  4KTZ A;  4BE1 A;  1U49 A;  3CM6 A;  4EZ9 A;  1L3T A;  1T8E A;  3AA2 A;  5J2N A;  4CEF A;  4DS4 A;  4DU4 A;  3AO4 A;  1NKB A;  3QES A;  3VQP A;  4I9Q A;  4PA1 A;  2GBZ A;  1Q8I A;  1RT4 A;  3PUF A;  1VSK A;  1QTM A;  1KLN A;  3NE6 A;  3QNO A;  3AVN A;  2BAN A;  3NH0 A;  1Y97 A;  3HL8 A;  2JGU A;  1HYV A;  4CJ3 A;  4HUE A;  1XHX A;  1HNI A;  4CGF A;  3VQ8 A;  3ZCM A;  3NF8 A;  2HHT A;  4CJK A;  4H4O A;  3KK3 A;  1QSL A;  3V9S A;  4KHN A;  3LAL A;  1J53 A;  4RW6 A;  4FXD A;  3M8Q A;  4FW2 A;  4N5S A;  4DTM A;  4QOZ B;  1BIZ A;  1DLO A;  1IKY A;  4Q5V A;  2Z1G A;  2IGI A;  3QEX A;  4W5Q A;  3H08 A;  4CHY A;  4FJK A;  1RBV A;  4IFV A;  4OJR A;  1X9W A;  3RMD A;  3SUP A;  4DMN A;  4CK1 A;  1L5U A;  1J5O A;  1S1W A;  4M41 A;  2XHB A;  2KZM A;  3V1R A;  2XY7 A;  3G10 A;  3BDP A;  4BWM A;  3NGI A;  1REV A;  3RMB A;  4MQ3 A;  3VQD A;  4DF8 A;  4OPJ A;  4Y1D A;  4KKO A;  3F73 A;  1TL1 A;  4GW6 A;  4DTN A;  4FJ7 A;  2FBV A;  2KTQ A;  3EY1 A;  2Y1I A;  3MXJ A;  1TVR A;  3ZT1 A;  5KRT A;  4DSF A;  3RWU A;  2A1S A;  1QE1 A;  4FLU A;  3PO5 A;  1JLB A;  1A5W A;  3P83 D;  4JRP A;  3LP3 A;  3TAQ A;  4KHY A;  1S6Q A;  1QS4 A;  1VSM A;  4CEZ A;  4O44 A;  4KO0 A;  1NKE A;  2YNI A;  3S3O A;  2RN2 A;  2B4J A;  2B5J A;  4IDK A;  4B9V A;  4M3Z A;  4LSL A;  5I42 A;  3OVN A;  3THV A;  4J2A A;  3AVJ A;  4ELU A;  3VA3 A;  1EX4 A;  2HNZ A;  1A5X A;  1JLC A;  4CE9 A;  3V9Z A;  2ZE2 A;  4PY5 A;  4FJH A;  3PX0 A;  4FJI A;  4B9U A;  3PX4 A;  3RR8 A;  1L3S A;  4FK4 A;  1CXQ A;  1RCH A;  1X1P A;  3E01 A;  4NYN A;  4F2R A;  3K58 A;  4NCA A;  3CM5 A;  4DSJ A;  3D0P A;  2XO7 A;  3QEW A;  1HYS A;  3LZJ A;  1TAQ A;  3BGR A;  1C1A A;  2XRI A;  1DTT A;  1K6Y A;  1W0H A;  4CJS A;  4FLX A;  3RRH A;  3RMA A;  3HJF A;  3KLI A;  4CIG A;  4FYD A;  2VWK A;  4FCY A;  3SCX A;  1NJW A;  5DMR A;  3L2U A;  3ZSV A;  3P5J A;  1DTQ A;  4CF1 A;  1ZBI A;  4MFB A;  3VQ7 A;  3L2Q A;  2D0A A;  1RT5 A;  3RMC A;  4LD0 A;  4E1N A;  1KTQ A;  4HVJ A;  3KLG A;  3SNN A;  5HRS A;  3NCI A;  4C8M A;  4XIU A;  2Y1J A;  4AHT A;  1SL0 A;  4FM2 A;  3OY9 A;  4FLV A;  2Z1H A;  4CGI A;  4DTO A;  4KI6 A;  4GMJ B;  4KB0 A;  4QAG A;  1JLA A;  1KVB A;  4CJ4 A;  5J2Q A;  1TAU A;  3WNG A;  3OS2 A;  2HHQ A;  1YT3 A;  1Q9X A;  3ZSZ A;  3P1G A;  1VRT A;  1NK5 A;  1WSE A;  1MU2 A;  3DI6 A;  2OYQ A;  3A2F A;  1ZYQ A;  2KFN A;  2X6N A;  1A5V A;  2G8W A;  1J54 A;  3ZSW A;  3TAP A;  1LAW A;  1WAF A;  1WSG A;  3U3G A;  1HRH A;  1N5Y A;  3QNN A;  1B9F A;  1BI4 B;  1S5J A;  3DLH A;  5T7B A;  2AJQ A;  5K14 A;  3CFO A;  1VSE A;  1JKH A;  1L3V A;  1C0M A;  4CJW A;  3TAB A;  2E6L A;  2HVH A;  4DU1 A;  1LAV A;  4Q0B A;  3KLE A;  3I0R A;  3C6U A;  3TAM A;  4CER A;  5SWM A;  3O3G A;  3U6F A;  4CHN A;  3DRS A;  3TR8 A;  3TAG A;  4DG1 A;  4ZHR A;  4DFM A;  3VQ4 A;  3K5L A;  3SI6 A;  1S6P A;  4CJV A;  4Z4H A;  3EYZ A;  3O3F A;  3K5N A;  4AH9 A;  1D5A A;  1RDA A;  3L3U A;  4FZY A;  1B92 A;  1C0U A;  4IFY A;  1IG9 A;  3ZT2 A;  1HMV A;  3KLH A;  4RW8 A;  1T05 A;  2RPI A;  1HNV A;  4CJP A;  3SQ1 A;  4Y1C A;  2KZZ A;  1NJZ A;  4W5R A;  1HPZ A;  3OYN A;  4FZZ A;  4LSN A;  1TK5 A;  3KLF A;  2XY6 A;  4FJG A;  2D0C A;  1TKZ A;  3DLG A;  5CY4 A;  4N56 A;  5HRP A;  1BI4 A;  3HST B;  4CEO A;  4CK2 A;  3IS9 A;  1XWL A;  3AVG A;  2YKN A;  1ASV A;  3NGZ A;  1ZBL A;  4DQP A;  3KD1 E;  1WSF A;  1YVU A;  3VQC A;  1QSS A;  3ZSQ A;  1VSL A;  1UOC A;  1LV5 A;  2OA8 A;  4DSI A;  4E7L A;  3VQE A;  4FJX A;  4OKE A;  4HCB A;  4JS4 A;  1EP4 A;  1KSP A;  4HUG A;  4C8N A;  4N47 A;  3AO5 A;  2QKB A;  3L3V A;  4CJE A;  1X9M A;  1NK4 A;  4M3X A;  3SYZ A;  2P5G A;  4N41 A;  4FK2 A;  3RTV A;  4KRE A;  2HNY A;  1JLG A;  2HB5 A;  1KRP A;  4DS5 A;  3T1A A;  1Z26 A;  4CJ5 A;  3ULD A;  3FFI A;  3MEE A;  1LW0 A;  4CEE A;  3OYD A;  3SUO A;  4TSX A;  3V4I A;  4IKF A;  4NYF A;  4G1Q A;  4KTQ A;  4EP4 A;  1RIL A;  5CYQ A;  1RDC A;  1TGO A;  4EP5 A;  1Z25 A;  2YV0 X;  4CGG A;  4HUF A;  2FBX A;  1WSJ A;  2IS3 A;  4BE0 A;  2QKK A;  4JLH A;  4DSL A;  4DFJ A;  2GV9 A;  4FVM A;  3V9W A;  4Z4E A;  3HO1 A;  2HVI A;  1ASU A;  2GUI A;  5C42 A;  3K5M A;  3TAE A;  4B8A B;  2HHX A;  1VSJ A;  4FJL A;  3KTQ A;  2I5J A;  4K8X A;  2IOC A;  4C8K A;  1SKR A;  4FK0 A;  4OGE A;  2WOM A;  3VN5 A;  3M8R A;  1RBU A;  3CQ8 A;  2BE2 A;  3DLK A;  1IO2 A;  1F21 A;  2YKM A;  5HLF A;  2DFH A;  3K59 A;  1EXQ A;  2DFE A;  3LAM A;  3LAN A;  4KFB A;  4CHO A;  5HRO A;  3MXM A;  3SPY A;  5KGX A;  3ZSX A;  1R0A A;  4E3S A;  1S1U A;  1NKC A;  1WLJ A;  1RTD A;  1D8Y A;  4DQI A;  2HW3 A;  1BHL A;  3U3Y A;  4B3O A;  4CCH A;  3ASM A;  3SQ0 A;  1JLQ A;  4KHU A;  1LWE A;  4CEA A;  1RBR A;  3NGY A;  5KTQ A;  3JSM A;  1U47 A;  3KIO A;  5EU7 A;  1SKS A;  4ID5 A;  4PQU A;  3QO9 A;  3ZSR A;  1S9G A;  1TKX A;  3HYF A;  2HHS A;  5JS1 A;  4AHC A;  1EET A;  5KRS A;  1BL3 A;  1BCM A;  4R5P A;  3ISN C;  4BE2 A;  5FDL A;  1UA1 A;  2OZS A;  2ZQB A;  3DRR A;  4HCC A;  5FRN A;  3OYF A;  2P1J A;  4KHW A;  3V81 A;  3C95 A;  4I2Q A;  2YHA A;  1VSF A;  1RT1 A;  1SL2 A;  3V1Q A;  4B9M A;  1UWB A;  4QCL A;  3SUN A;  3QET A;  4J2B A;  1CLQ A;  4LH4 A;  3M8P A;  1EKE A;  4I7F A;  4DTR A;  1C6V A;  3ALY A;  3QER A;  2DFF A;  4DLG A;  4ELV A;  2XY8 A;  2YHB A;  3QIP A;  4KTW A;  3OYI A;  3G0Z A;  5KI6 A;  1IKV A;  2IAJ A;  2G8F A;  5FRO A;  3EZ5 A;  3HP6 A;  3LP2 A;  3NHG A;  4OVL A;  4BDZ A;  4OLA A;  2PZS A;  3V6D A;  4CFC A;  4F3T A;  4E89 A;  2LSN A;  3MED A;  2FBT A;  4E19 A;  4AHU A;  4Z4F A;  5KGW A;  1HQE A;  1JXE A;  2OPQ A;  4H8K A;  4DU3 A;  2F8S A;  2ATQ A;  2WON A;  5HRN A;  3ZT0 A;  3LP0 A;  2E6M A;  4W5N A;  3HPO A;  3OYJ A;  4F3O A;  5D3G A;  3WNH A;  1YTA A;  3QEI A;  3LP1 A;  1S9E A;  4HTU A;  3OYG A;  4OPK A;  1GOC A;  3QIO A;  1B9D A;  1X9S A;  1LWC A;  2NUB A;  2JLE A;  4BDY A;  4CES A;  4DSK A;  2D5R A;  4AHS A;  5HP1 A;  3ZSY A;  1ASW A;  2B6A A;  4KRF A;  1BIS A;  2IDO A;  4I9L A;  1RT7 A;  4O4G A;  3O4Q A;  4EZ6 A;  3V1O A;  3CFR A;  1G15 A;  2VG7 A;  2E4L A;  3LAK A;  1WSI A;  4Z0U A;  3CYM A;  4CEC A;  1VSI A;  3L2W A;  4E7K A;  2D0B A;  4DQR A;  1QSY A;  1FKO A;  1KVC A;  3AA4 A;  4DLE A;  3SV3 A;  4FLW A;  3AVF A;  3C6T A;  4Z4C A;  3DOK A;  3DYA A;  4YFU A;  1VRU A;  3PO4 A;  1KLM A;  1BGX T;  1WAJ A;  1BCO A;  4ICL A;  4OKJ A;  3HP9 A;  4CJR A;  3PV8 A;  2G8V A;  3DLB A;  5I3U A;  4KI4 A;  3LPT A;  3MEC A;  3OYA A;  3TI0 A;  1HQU A;  4E1M A;  2P51 A;  1GOB A;  4CJU A;  3OS1 A;  3AVH A;  4WE1 A;  4B8C A;  4O0I A;  1VSH A;  4W5O A;  1NJY A;  2PYJ A;  1JLF A;  1VK0 A;  4B9T A;  1Q9Y A;  1J9A A;  1W9H A;  2XY5 A;  4DWI A;  4AHR A;  2KQ2 A;  1RBS A;  4FLT A;  4FW1 A;  3RR7 A;  4M45 A;  1XC9 A;  4FZX C;  4M3W A;  1RTH A;  3NF6 A;  2R7Y A;  4FLZ A;  2FBY A;  1BIU A;  4IBN A;  4IG3 A;  2Z1J A;  3L2V A;  4RW4 A;  4O0J A;  1RT3 A;  4CJL A;  1U48 A;  4E0D A;  1S1T A;  3T19 A;  3MXI A;  3OYC A;  3K5O A;  2F8T A;  1HJR A;  5HBM A;  5DK5 A;  3ZSO A;  4CEB A;  1TK8 A;  2HHW A;  2EX3 A;  4CHQ A;  3SQ4 A;  4KAZ A;  4AIL C;  2X74 A;  3SV4 A;  1KCF A;  3IRX A;  4RG8 A;  3VQQ A;  3LWM A;  3DLR A;  1D9F A;  4O55 A;  1WSH A;  3CG7 A;  1IH7 A;  1NK8 A;  2DY4 A;  1U04 A;  4DTU A;  3C94 A;  4CJF A;  4B08 A;  4M3Y A;  2ITG A;  2YNG A;  4DQS A;  4PUO A;  1TKT A;  3T3F A;  4O5B A;  1LWF A;  4LH5 A;  4W5T A;  3B6P A;  1S1X A;  4CHZ A;  3K57 A;  3VA0 A;  3V9X A;  3S9H A;  1NK9 A;  4PWD A;  4CJQ A;  1RT6 A;  3AV9 A;  3NAE A;  1C0T A;  3AO1 A;  3AVK A;  1JL2 A;  2O4I A;  4E7I A;  3ZT4 A;  4C8L A;  2A1R A;  3RRG A;  4LY7 A;  1O1W A;  4ELT A;  4F2S A;  1HYZ A;  1KFD A;  2YNH A;  2VG6 A;  4CF9 A;  4ZTJ A;  3HPG A;  5JS2 A;  3OYL A;  3AVC A;  2OPP A;  4IG0 A;  2RKI A;  3AVB A;  3L8B A;  3DRP A;  3O3H A;  1T03 A;  3VQ5 A;  1NK7 A;  2ETJ A;  4NCG A;  1ZBU A;  4AHV A;  4E7J A;  1I3A A;  4I2P A;  4CF0 A;  4FLY A;  4DFK A;  4FJN A;  3IG1 A;  1SUQ A;  3AVA A;  4DTP A;  3NDK A;  4FJM A;  4NCB A;  1QQC A;  3AO2 A;  2Q3S A;  4FM1 A;  4ZTF A;  3NH1 A;  3OS0 A;  4DTX A;  3F9K A;  4CHP A;  5CZ1 A;  5SZT A;  3D45 A;  2Z1I A;  3MAQ A;  5J2M A;  4M42 A;  2KFZ A;  1CXU A;  3ZT3 A;  4FJJ A;  4DTS A;  4OGC A;  2FC0 A;  1N6Q A;  1NK0 A;  4CFD A;  4C8O A;  1RNH A;  3JYT A;  5HRR A;  4F4K A;  3L2R A;  4E7H A;  5C25 A;  1BQN A;  4CGH A;  4DQQ A;  4M3R A;  5J2P A;  3AA3 A;  3SUQ A;  3KKR A;  4KPY A;  3DOL A;  1JLE A;  4CED A;  3SJJ A;  1BQM A;  4N76 A;  2PY5 A;  4F8R A;  2QK9 A;  3DMJ A;  1NK6 A;  1L3U A;  3WNE A;  1NOY A;  1FK9 A;  2P5O A;  1XHZ A;  1CZB A;  3HT3 A;  3LPU A;  2ZD1 A;  1U45 A;  5J1E A;  1RDB A;  5C24 A;  3PX6 A;  1NOZ A;  4JRQ A;  4CIF A;  3NFA A;  4KHS A;  3TWH A;  2HND A;  1JXB A;  2BGG A;  3AVM A;  4DSE A;  3SQ2 A;  3DLE A;  4B9L A;  2O4G A;  3HM9 A;  4B9N A;  4Z4G A;  3WNF A;  3O4N A;  4CFB A;  5E41 A;  4OKK A;  1WNS A;  3OYB A;  4FJ9 A;  4DFP A;  2KW4 A;  2G8K A;  4BWJ A;  3VQB A;  4CF2 A;  3VQA A;  1IKW A;  2HHU A;  4CK3 A;  4DTJ A;  1TK0 A;  3KKS A;  2X78 A;  4FJ5 A;  1ZBH A;  3MEG A;  2G8H A;  4M3T A;  3OYK A;  3AVL A;  3KJV A;  3AA5 X;  1QHT A;  1XI1 A;  5CZ2 A;  4DF4 A;  1CZ9 A;  1I39 A;  4Z4I A;  1VSD A;  2X6S A; 
#chains in the Genus database with same CATH topology
 4FWR A;  2QXF A;  3W0L A;  5F2R A;  2O8E B;  3OJS A;  2O8C B;  3VF4 A;  1QZ6 A;  2FF3 B;  2G8I A;  4CIE A;  3LDS A;  2VQE K;  2F96 A;  3FE1 A;  3LZI A;  5CYM A;  2DTU A;  2QEX N;  4J2E A;  1C1B A;  2IC3 A;  3TAN A;  2F4V K;  4BQZ A;  1LW2 A;  1T6C A;  4MO4 A;  3THX A;  2NRV A;  2OZM A;  2P9N B;  3VQ9 A;  4M3U A;  1TKD A;  4RW9 A;  1CZA N;  1YF5 L;  2OPR A;  3F2K A;  3SZ2 A;  4ID1 A;  1GOA A;  3PY8 A;  1WN7 A;  5C12 A;  3QEV A;  4PL8 A;  4O8K A;  4YNQ A;  3HVT A;  3TAF A;  3CPE A;  5BPL A;  5FRM A;  1XUP O;  3MCP A;  3O9U A;  1T7P A;  2PYL A;  3B6O A;  1RTJ A;  1RTI A;  2PAV A;  4CEQ A;  5AQU A;  4KTZ A;  3U4L A;  4DV3 K;  3CM6 A;  5M1Q A;  5J2N A;  4PA1 A;  1Q8I A;  3PUF A;  2RHK A;  1QTM A;  3CER A;  2YI1 A;  3D2E A;  5A2Q O;  1OH6 A;  1D4X A;  4IO9 L;  5AQS A;  1NMN A;  3QDK A;  4H4O A;  1QQM A;  1XMO K;  3VF2 A;  2Z1G A;  2IGI A;  3L4I A;  1VQ5 N;  1X9W A;  1J5O A;  1L5U A;  4CK1 A;  1S1W A;  2WFB A;  1X9J A;  5AQV A;  4IJA A;  2UYT A;  3NGI A;  5KQD A;  2WC9 A;  4MQ3 A;  5AQW A;  1XMQ K;  2NZT A;  1TL1 A;  4GW6 A;  2A5X A;  2Y1I A;  4FLU A;  1JLB A;  4H0T B;  3TAQ A;  4KHY A;  1S6Q A;  4KO0 A;  3S3O A;  2B5J A;  3KWG A;  4LSL A;  5I42 A;  3C65 A;  5FPD A;  3PX4 A;  3K58 A;  4NCA A;  4JKG A;  1U2V A;  2XO7 A;  2CH6 A;  3EEQ A;  1K6Y A;  3O8M A;  3KLI A;  4CIG A;  3SCX A;  4BRD A;  3L2Q A;  3I33 A;  1RT5 A;  2ASM A;  4LD0 A;  3KLG A;  1WUA A;  3ZX2 A;  4AQY K;  4C8M A;  4XIU A;  3ENB A;  4ISE A;  2FXU A;  4FM2 A;  3OY9 A;  5BR8 K;  4KB0 A;  4QAG A;  1JLA A;  4B1V A;  3WNG A;  3OS2 A;  1Q9X A;  3EE9 A;  3P1G A;  1NK5 A;  1MU2 A;  1RDW X;  1ZYQ A;  3TAP A;  3DXK A;  4YOW A;  1N5Y A;  2O8D A;  1BI4 B;  1S5J A;  2QI2 A;  4BR5 A;  1Q7Y O;  3DXM A;  3L0Q A;  4Q0B A;  3C6U A;  3TAM A;  2Q0R A;  3C7N B;  1DKG D;  5F0X A;  4MDA A;  4CZG A;  4DFM A;  3EYZ A;  4Z4H A;  3K5N A;  1X3M A;  1RDA A;  4H5V A;  4IFE A;  4NO7 A;  5AQY A;  1IG9 A;  3ZT2 A;  4JYA K;  1T05 A;  4JEP A;  1NJZ A;  3OYN A;  1HPZ A;  3CHW A;  4LSN A;  1TK5 A;  1H1V A;  5LMU K;  1K8K A;  3KD1 E;  4DQP A;  3NGZ A;  3AAR A;  1WSF A;  1UOC A;  1LV5 A;  4E7L A;  4OKE A;  4O8U A;  5C0Y A;  4HCB A;  3MN6 A;  4BRH A;  3CD6 N;  2HBM A;  3AO5 A;  5LL6 Z;  2QKB A;  4IXC A;  1WBB A;  3L3V A;  4F9O A;  4KRE A;  3RTV A;  5BRD A;  2HB5 A;  3T1A A;  1Z26 A;  1BA1 A;  1IBK K;  3V4I A;  4CGG A;  4HUF A;  3U8X A;  3CJ1 A;  1WSJ A;  2JWK A;  4JLH A;  4DFJ A;  5EX5 A;  3CC4 N;  2QXL A;  3LM2 A;  1IBM K;  4FK0 A;  1XNR K;  4OGE A;  4JI6 K;  3CQ8 A;  1F21 A;  2W40 A;  3M1F A;  4CHO A;  5FPE A;  3MXM A;  3GG4 A;  1NKC A;  4DQI A;  1WLJ A;  1D8Y A;  1BHL A;  4B3O A;  1EWQ A;  3ASM A;  1JLQ A;  5C10 A;  4DV0 K;  1QQN A;  3NGY A;  5EU7 A;  1T44 A;  1SKS A;  4JKA A;  4K0K K;  3HYF A;  5JS1 A;  4R5P A;  3ISN C;  4K25 A;  1YXQ A;  2VYP A;  2CH5 A;  3V81 A;  3U9D A;  2OTL N;  1NGI A;  3C95 A;  3O08 A;  1VSF A;  3P4I A;  1UWB A;  2O8F B;  1EKE A;  1C6V A;  4ELV A;  3QIP A;  4B3R K;  3OYI A;  3G0Z A;  4QS7 A;  5KI6 A;  3HP6 A;  1VQK N;  3KK7 A;  3CIP A;  4CFC A;  3ZET A;  1JXE A;  2OPQ A;  3BF3 A;  2ATQ A;  4W5N A;  3LM9 A;  1YTA A;  3QEI A;  4CBW A;  2NNW A;  4OPK A;  4A59 A;  3F5T A;  2JLE A;  4BDY A;  5CE3 A;  2D5R A;  1HJO A;  5C2F A;  5LJV A;  1VQO N;  2IDO A;  3V1O A;  1G15 A;  2VG7 A;  3LAK A;  2E5L K;  4CEC A;  4E7K A;  1HKC A;  4DLE A;  4FLW A;  3AVF A;  4Z4C A;  4X65 K;  2ZJP L;  1SZ2 A;  3VES A;  1BCO A;  4OKJ A;  4KI4 A;  4BRP A;  5I3U A;  4JI0 K;  3OYA A;  3TI0 A;  1GOB A;  3AVH A;  4B8C A;  3WQT A;  5JLH A;  1VSH A;  1WBD A;  3EN9 A;  1Q9Y A;  4KH5 A;  1W9H A;  4UY8 O;  4DWI A;  1T3V A;  1U6Z A;  4FW1 A;  3HSC A;  1KAX A;  4FLZ A;  4JK8 A;  5CR4 A;  2F7T A;  1DT9 A;  3K9K A;  2Z1J A;  1RT3 A;  4QS8 A;  3LDO A;  3J7A P;  2A40 A;  5DK5 A;  2HHW A;  2EX3 A;  3EL2 A;  4CHQ A;  2OCE A;  2X74 A;  2YHW A;  1KCF A;  1KXP A;  3IRX A;  4RG8 A;  3DLR A;  1D9F A;  5AFU A;  4JAX A;  1YJN N;  2VWB A;  4DTU A;  4GV6 A;  4CJF A;  2Q36 A;  2ITG A;  4DQS A;  3T3F A;  2E88 A;  4RCH A;  3K57 A;  3V9X A;  3O5B A;  4CJQ A;  1RT6 A;  2HBK A;  3AVK A;  4BG9 A;  3ZT4 A;  4C8L A;  3RRG A;  2NRT A;  5AQO A;  4FWN A;  2BTF A;  2YNH A;  3TSP A;  3OTO K;  5JS2 A;  3D6R A;  3BEX A;  3WEE A;  3H1Q A;  3L8B A;  3O3H A;  1NOY A;  1NLV A;  4NCG A;  3WXK A;  2EWS A;  1QQC A;  4NCB A;  2P9P A;  4FM1 A;  1RDU A;  2HOE A;  2YJF A;  5SZT A;  3VEZ A;  3MAQ A;  1ILY A;  4M42 A;  4B3M K;  4G9Z A;  1VQ9 N;  4FO0 A;  3CCV N;  4K41 A;  4C8O A;  2ZGY A;  1KQS M;  4CGH A;  4FPA A;  3QBW A;  3I56 N;  4BQL A;  4KPY A;  1NGD A;  1BQM A;  1NGJ A;  1M90 O;  4F8R A;  3WNE A;  3FFK B;  1XHZ A;  3EE8 A;  3PX6 A;  1NOZ A;  3TWH A;  1JXB A;  4DSE A;  3MN9 A;  3DLE A;  2O4G A;  4Z4G A;  4BRF A;  3WNF A;  3O4N A;  1JCE A;  3OYB A;  4JKF A;  2KW4 A;  4RTF D;  4CVN E;  4BWJ A;  4CW7 B;  4CK3 A;  2FSN A;  1ZBH A;  3THX B;  1ATR A;  2G8H A;  3AVL A;  3C0B A;  3AA5 X;  1MWK A;  1QHT A;  3QNO A;  4B1X B;  4Z4I A;  2X6S A;  2VG5 A;  1RDD A;  1YAG A;  3QEP A;  3AVI A;  4KHQ A;  2OPS A;  5ADX A;  3NVM A;  4FPB A;  1UA0 A;  2BDP A;  1WB9 A;  2UUB K;  3GDQ A;  3SBT A;  4JD2 A;  3S3N A;  3NBP A;  3KK2 A;  3V9U A;  3OW2 M;  2P9L A;  4CD3 A;  3VEN A;  2NRR A;  4AF1 A;  4CGJ A;  4PL7 A;  4J2D A;  4UQG A;  3CMA N;  4FM0 A;  2E1Y A;  1NGB A;  2NLX A;  4RW7 A;  1WOQ A;  1HKG A;  2VWJ A;  4CI6 A;  4V19 S;  1TV6 A;  4JS5 A;  3OYH A;  4K8Z A;  1C1C A;  5ELZ A;  3HO1 A;  1SV5 A;  3LWL A;  1TL3 A;  4CJT A;  3D2E B;  3ITH A;  1JCF A;  4H5W A;  3I8D A;  3GL1 A;  3VQ6 A;  1JL1 A;  3LDP A;  1VQM N;  4LF7 K;  1YIT N;  3QLH A;  4BAC A;  1KAY A;  2HMI A;  4B9S A;  2WTU A;  3SJH A;  3SPZ A;  1MWM A;  1KFS A;  3R6M A;  1V4S A;  4BE1 A;  4A61 A;  4HWI A;  4EZ9 A;  5BR9 A;  4CEF A;  1X3N A;  3PSF A;  1MA9 B;  4I9Q A;  2D0O A;  1VSK A;  1Q81 O;  1KLN A;  4BR7 A;  1Y97 A;  1HYV A;  1S22 A;  4HUE A;  1HNI A;  4NXN K;  3ZCM A;  3NF8 A;  2VCP A;  4CJK A;  1QSL A;  3R8E A;  4RW6 A;  4BR2 A;  2QWM A;  3QEX A;  4IFV A;  4OJR A;  1IV0 A;  1HNZ K;  4M41 A;  2KZM A;  5AQJ A;  2XY7 A;  3CQY A;  1REV A;  2GUP A;  1QSS A;  4DF8 A;  4WFA L;  4DTN A;  3GOI A;  1TVR A;  4JKG B;  1U2V B;  3ZT1 A;  3THY A;  5KRT A;  4CBX A;  3ID8 A;  1QE1 A;  2A3Z A;  1VSM A;  3SLC A;  1SAZ A;  4B9V A;  1IG8 A;  1VQN N;  3OVN A;  3VA3 A;  1EX4 A;  1HR0 K;  3H6E A;  4H0V B;  2ZE2 A;  3V9Z A;  4PY5 A;  4FJI A;  4RWT A;  3THW A;  4FK4 A;  5LMN K;  4H0P A;  4NYN A;  2AA4 A;  4DSJ A;  3P39 A;  1TAQ A;  3BGR A;  1DTT A;  1C0F A;  1W0H A;  5M1O A;  3DXK B;  3IKM A;  4DR5 K;  3NVK A;  1ESV A;  2O8D B;  1KD1 O;  2Q97 A;  3O9Q A;  4E1N A;  2YCH A;  3DXM B;  4HVJ A;  3SNN A;  2Y1J A;  4FLV A;  3KVG A;  4DTO A;  4GMJ B;  1VQ8 N;  1KVB A;  5B8H A;  3ZSZ A;  4EHT A;  1VRT A;  3DI6 A;  2OYQ A;  4YOR A;  5I9E B;  5AR0 A;  1A5V A;  2G8W A;  5AZJ A;  2E2Q A;  3BP8 A;  1LAW A;  4JKC A;  3QNN A;  1K8K B;  3DLH A;  3TPQ A;  4DU1 A;  1LAV A;  3RSE A;  5CHI A;  4CHN A;  3TR8 A;  4DG1 A;  3VQ4 A;  3K5L A;  4JI2 K;  4CJV A;  5AQH A;  2HST A;  3L3U A;  1C0U A;  2YJE A;  4DR6 K;  2RPI A;  1HNV A;  4MDB A;  1VQL N;  1OKJ A;  3BZC A;  3KLF A;  3J80 O;  5CY4 A;  4K43 A;  5HRP A;  3HST B;  4CK2 A;  3IS9 A;  1XWL A;  4CZE A;  1ZBS A;  4OPA A;  5JMV A;  3G71 N;  3A8Y A;  4DR1 K;  3OBW A;  4DSI A;  4FJX A;  1T6D A;  4WYB A;  4HUG A;  3ENH A;  2HF4 A;  5KQ8 A;  1X9M A;  1NK4 A;  3D2F A;  4N41 A;  3CCJ N;  1JLG A;  4DS5 A;  4IDH A;  3MEE A;  1LW0 A;  3ULE A;  4TSX A;  4AM6 A;  3CCM N;  3SUO A;  1VHX A;  4NYF A;  4G1Q A;  4BRE A;  4KTQ A;  1RIL A;  5CYQ A;  1RDC A;  3J8A A;  5TKW A;  4DSL A;  4Z4E A;  4FVM A;  3V9W A;  1YJ9 N;  2HVI A;  2GUI A;  4BRL A;  4B8A B;  1KC8 O;  3KTQ A;  1N8R O;  4NLC A;  5GAH P;  4C8K A;  4B9Q A;  4XH4 A;  1KAZ A;  2O8B A;  3M8R A;  3VN5 A;  1RBU A;  2YKM A;  4NLB A;  4CZF A;  5HRO A;  4KH4 A;  1G99 A;  2HMP A;  4E3S A;  4JHD A;  2UUC K;  2F9T A;  4CCH A;  3SQ0 A;  3VGK A;  1LWE A;  4YDU C;  2FSK A;  4CEA A;  4GKJ K;  3JSM A;  4JNE A;  2FLO A;  1U47 A;  3HM8 A;  5AJ3 K;  3QO9 A;  3ZET B;  1TUU A;  1TKX A;  2HHS A;  5BN9 A;  1EET A;  5KRS A;  1BCM A;  4BE2 A;  1UA1 A;  2OZS A;  3CME N;  5FRN A;  4KHW A;  4IOA L;  4IWV A;  2ASO A;  2HBJ A;  4R79 A;  3SUN A;  1R59 O;  1CLQ A;  2CGK A;  4BR4 A;  3QER A;  3CET A;  3ALY A;  4BGA A;  4DLG A;  2YHB A;  4DR4 K;  3PLA A;  1IKV A;  3SAH A;  3LP2 A;  3NHG A;  4OLA A;  4BDZ A;  2QWL A;  1RFQ A;  4E89 A;  1YTU A;  5KGW A;  2F8S A;  1JJ2 M;  1P8Z A;  4LFC K;  5D3G A;  2VGN A;  3WNH A;  3WXI A;  1BOT O;  4HTU A;  4OPH A;  1X9S A;  1LWC A;  1XNQ K;  2NUB A;  3TTF A;  4IOC L;  5HP1 A;  2E2N A;  1ASW A;  2B6A A;  3UKR A;  1Q86 O;  4DU3 A;  1N34 K;  4Z0U A;  1WSI A;  4J8F A;  1NGF A;  3A5O C;  4DB3 A;  3L2W A;  2D0B A;  4BR0 A;  3VGM A;  4DQR A;  1FKO A;  1QSY A;  4YFU A;  4CJR A;  3GE1 A;  3HZ6 A;  4JKE A;  1E3M A;  1V4T A;  1HQU A;  2VQF K;  1NG9 A;  3WUH A;  3S41 A;  4A2A A;  4O0I A;  1NJY A;  1VK0 A;  4YOV A;  5AQG A;  1RBS A;  2E2O A;  2IIR A;  4KBO A;  3E9P A;  4FWO A;  3WXL A;  5AQF A;  2FBY A;  4IBN A;  4DKW A;  5KPZ A;  1U48 A;  4JI4 K;  2RE2 A;  2IVP A;  2D4W A;  1S1T A;  3OYC A;  4BC4 A;  3O1B A;  4CEB A;  1TK8 A;  4FWK A;  1HNW K;  3G4S N;  3VQQ A;  3WEE B;  3LWM A;  2HBL A;  3QBX A;  1WSH A;  3PIO L;  3CG7 A;  1IH7 A;  3ZX3 A;  2DY4 A;  3R3L A;  3C94 A;  3HTV A;  2P9P B;  5BRF A;  4O5B A;  3T69 A;  4EAH D;  3B6P A;  1S1X A;  4CHZ A;  5JIC A;  4W5T A;  5AFU H;  4JI3 K;  3NAE A;  1JL2 A;  3O4W A;  4LY7 A;  4LF8 K;  1QQO A;  1ZC6 A;  4F2S A;  1HYZ A;  2VG6 A;  4CF9 A;  4ZTJ A;  2QWR A;  2OPP A;  4FWS A;  3DRP A;  4EFH A;  4E7J A;  1ZBU A;  3EKU A;  4FJN A;  1K9M O;  4I2P A;  4FLY A;  3VTH A;  4DTP A;  4FJM A;  2Q3S A;  4ZTF A;  3JXU A;  3NH1 A;  3OS0 A;  4FVU A;  3TSU A;  4BC2 A;  3CJA A;  2Z1I A;  3D45 A;  3ZT3 A;  4FJJ A;  4DTS A;  4OGC A;  2KKZ A;  1N6Q A;  1NK0 A;  4CFD A;  3JYT A;  4F4K A;  4DQQ A;  1SQK A;  2V7Z A;  1JLE A;  4WCE L;  2QK9 A;  1L3U A;  1FK9 A;  3FZF A;  3NMU A;  1P90 A;  1U45 A;  3CJ9 A;  4M7X A;  2P9U A;  4CIF A;  5HL7 L;  5BRH A;  3P31 A;  5AQT A;  4BRI A;  1IJJ A;  2H3G X;  3SQ2 A;  3HM9 A;  2YHX A;  5E41 A;  1RGI A;  4JD2 B;  3ENO A;  3A5N C;  2G8K A;  2P9L B;  1Z05 A;  5DM7 L;  5GIP A;  4DTJ A;  1TK0 A;  4FJ5 A;  2E1Z A;  2UU9 K;  5EY4 A;  1XC3 A;  3LDN A;  2NRX A;  1SS6 A;  4JI7 K;  5CZ2 A;  4DF4 A;  1MDU B;  3O9R A;  1NBW A;  1YVN A;  3HVR A;  1RT2 A;  4CBU A;  4HHT A;  5GIN A;  3IAY A;  4H4M A;  3IFR A;  3QFP A;  4A5B A;  4FWL A;  3KD5 E;  1M1K O;  4LF9 K;  1TUY A;  5DM6 L;  1BDG A;  3OYM A;  1N32 K;  3S3M A;  5ADX H;  1ITG A;  4CZJ A;  3IUC A;  2GEL A;  3I0S A;  4IJN A;  4L8R B;  3R1X A;  4KV8 A;  1S1V A;  1SKW A;  1KVA A;  1ZBF A;  4KHN A;  4GVM A;  4KB1 A;  3TAR A;  3OA9 A;  4CGD A;  2G8U A;  5BN8 A;  1W97 L;  3DAW A;  3HXM A;  1ATS A;  4A5A A;  1E4G T;  3OJU A;  1IKX A;  2GTD A;  2HHV A;  1UAX A;  5AQL A;  4CF8 A;  3JAM O;  3AO3 A;  1GLD G;  3FLC O;  3KK1 A;  2P9K A;  3K0S A;  4A62 A;  3OYE A;  1U49 A;  3MX2 A;  1T8E A;  1YHQ N;  4DS4 A;  4DU4 A;  2A41 A;  1NKB A;  1O13 A;  4ISF A;  4C1N K;  1RT4 A;  3O80 A;  4CJ3 A;  4C23 A;  1XHX A;  1TYQ A;  3BY5 A;  3VQ8 A;  1ATN A;  4GVE A;  3ATV A;  2HHT A;  2I7P A;  2QW9 A;  3CF5 L;  3THY B;  4H0X B;  4FW2 A;  4N5S A;  4DTM A;  4QOZ B;  1BIZ A;  1DLO A;  4W5Q A;  3H08 A;  3ZEU A;  4CHY A;  4FJK A;  3ZX0 A;  2YHY A;  3N4P A;  3KWI A;  3SUP A;  3FZK A;  3G10 A;  3BDP A;  3H45 C;  3EKS A;  3VF6 A;  3IDH A;  3THW B;  3RMB A;  3VQD A;  4OPJ A;  4Y1D A;  4KKO A;  2NRW A;  3F73 A;  3MMV A;  2FBV A;  4ILG B;  2KTQ A;  5GAG P;  3MXJ A;  3RWU A;  3T1Y K;  2A1S A;  1GLB G;  4BRQ A;  5AQZ A;  3DWL A;  4I6M A;  4JRP A;  3H3O B;  3LP3 A;  1QS4 A;  1EQY A;  1N36 K;  1NGC A;  4O44 A;  3VMF B;  1NKE A;  2RN2 A;  1LOT B;  2B4J A;  4IDK A;  4J2A A;  2QM1 A;  2HNZ A;  4FWP A;  3EZW A;  3CJC A;  1A5X A;  1JLC A;  3QB0 A;  4BVO A;  4CE9 A;  4WFN L;  3RR8 A;  4BRO A;  1L3S A;  1CXQ A;  1X1P A;  4JK7 A;  3CM5 A;  3D0P A;  3QEW A;  1HYS A;  1GLF O;  3HJF A;  3RMA A;  4BR9 A;  4LF6 K;  4WQ4 A;  2VWK A;  4H5R A;  5AZJ B;  5AQI A;  3ZSV A;  3L2U A;  1ZBI A;  3VQ7 A;  3MDQ A;  1KTQ A;  4CD1 A;  3CQX A;  3RSE B;  4CZH A;  3NCI A;  4Y0W A;  4DV2 K;  4B1Y B;  1SL0 A;  2UXD K;  4KI6 A;  5J2Q A;  4CJ4 A;  1TAU A;  2GX9 A;  2QWQ A;  4LC9 B;  1DGK N;  2ITM A;  4IOX A;  2KFN A;  1J54 A;  1GLC G;  1WAF A;  3U3G A;  1NJI O;  1NM1 A;  1B9F A;  1LCU A;  4M7Y A;  3VEX A;  5T7B A;  2AJQ A;  1VSE A;  3HOS A;  3N4Q A;  1C0M A;  4CJW A;  3TAB A;  1VQ6 N;  3SK3 A;  3I0R A;  3O3G A;  2CGL A;  3DRS A;  3TAG A;  5GAD P;  4ZHR A;  3SMP A;  5AQQ A;  5M1P A;  3SMS A;  1B92 A;  4IFY A;  4DR3 K;  2UXB K;  3D2F B;  1Q82 O;  2OAN A;  3KLH A;  4RW8 A;  2KZZ A;  3VGL A;  4FZZ A;  3BF1 A;  3TTD A;  3T7Z A;  3ULE B;  2XY6 A;  1TKZ A;  3DLG A;  4CEO A;  3PO4 A;  2HHU A;  2YKN A;  3AVG A;  3FZH A;  3F9M A;  2OA8 A;  3MN5 A;  3VQE A;  2W6K A;  4NB4 A;  1EP4 A;  4C8N A;  4N47 A;  3AY9 A;  5EOY A;  2O8B B;  4CJE A;  4M3X A;  5LY3 A;  4FK2 A;  5AQX A;  2D0P A;  3MK6 A;  3Q7C A;  4JKH A;  3QML A;  3O1W A;  2ZGZ A;  3FFI A;  3ZYY X;  4CEE A;  2Q0U A;  4IKF A;  4JHD B;  2FBX A;  2IS3 A;  3M3Z A;  2ZWH A;  4FWQ A;  5EVZ A;  3VET A;  2QKK A;  3TAE A;  4GV3 A;  1Y64 A;  4K8X A;  2DPN A;  2ASP A;  2WOM A;  3DLK A;  1OH7 A;  2F9W A;  4YOY A;  5TKY A;  5HLF A;  2DFH A;  5IT9 O;  4KFB A;  3H3N O;  4CZM A;  5KGX A;  3SPY A;  3ZSX A;  1R0A A;  1S1U A;  2P9S A;  2HW3 A;  1HNX K;  2NRZ A;  3U3Y A;  3TU5 A;  4BC3 A;  1W7A A;  1RBR A;  3FGU A;  3KZB A;  1NGA A;  3KIO A;  4X64 K;  1BUP A;  3IMX A;  1EO1 A;  3LL3 A;  4ID5 A;  1S72 N;  3UKU A;  4BRG A;  3MX5 A;  1BL3 A;  5FDL A;  1C0G A;  1HLU A;  2QWP A;  3UB5 A;  4I2Q A;  2YHA A;  1SL2 A;  4B9M A;  4QCL A;  2PFU A;  3M8P A;  4KTW A;  3UKR B;  2IAJ A;  2G8F A;  5FRO A;  3EZ5 A;  3MN7 A;  4OVL A;  1OVQ A;  2LSN A;  4Z4F A;  4AHU A;  2IVO A;  4H8K A;  3OHR A;  5HRN A;  1BA0 A;  4MLH A;  3VOV A;  5BRE A;  3ZT0 A;  4DR7 K;  4F3O A;  3LP1 A;  1S9E A;  4PKH A;  5FPN A;  4K42 A;  1GOC A;  4DSK A;  2OTJ N;  5JLF A;  4BRA A;  1BG3 A;  4I9L A;  4O4G A;  3O4Q A;  1NWK A;  4EZ6 A;  2E4L A;  1VSI A;  1KVC A;  3SV3 A;  3C6T A;  3DOK A;  4GY2 B;  1VRU A;  1KLM A;  4ICL A;  4NXM K;  2G8V A;  3DLB A;  3PV8 A;  3LPT A;  2P9I A;  5AQP A;  2P51 A;  4E1M A;  4CJU A;  3OS1 A;  2FSJ A;  2PYJ A;  1JLF A;  1QVF M;  4CZI A;  4FLT A;  3ZLJ A;  1IBL K;  1NGE A;  3O9S A;  1XC9 A;  4M3W A;  2R7Y A;  5JVG L;  3FZM A;  3L2V A;  4E0D A;  4OX9 K;  3T19 A;  3MXI A;  1XQS C;  4ILJ A;  3K5O A;  2F8T A;  5BPM A;  5AZI A;  3CI5 A;  4KAZ A;  3SQ4 A;  4AIL C;  4PKI A;  3W3D A;  4EHU A;  3SAF A;  1NNE A;  4O55 A;  5C15 A;  4GKK K;  4YOU A;  1NK8 A;  4B3T K;  1U04 A;  4B08 A;  1GLA G;  4M3Y A;  1TKT A;  1LWF A;  4LH5 A;  3SAG A;  1BU6 O;  1NK9 A;  3AV9 A;  3AO1 A;  5E84 A;  4E7I A;  2A1R A;  4LFB K;  4BRM A;  1O1W A;  3HRG A;  2ZJR L;  4EIA A;  3OYL A;  2CGJ A;  4IG0 A;  1VQ4 N;  3AVB A;  1T03 A;  3VEW A;  4DFK A;  2Q1N A;  3AVA A;  3J81 O;  3AO2 A;  3F9K A;  4CHP A;  5J2M A;  2P9U B;  2KFZ A;  4XH1 A;  1CXU A;  4H0O A;  4JK9 A;  5IWA K;  5JVH L;  1YI2 N;  1RNH A;  3PSI A;  3CPW M;  3L2R A;  4E7H A;  5C25 A;  1BQN A;  5J2P A;  3O6W A;  2YX6 A;  1YUW A;  3DOL A;  4CED A;  3SJJ A;  2PY5 A;  1NK6 A;  3PIP L;  3VEV A;  1FJG K;  3CCQ N;  5J1E A;  1RDB A;  5C24 A;  5M1N A;  4IZ9 A;  4BRC A;  4JRQ A;  3NFA A;  2A6A A;  1VQP N;  4KHS A;  4DQ8 A;  2HND A;  2BGG A;  5KPT A;  2E8A A;  1WNS A;  4WQ4 C;  3D7E O;  4DFP A;  1I94 K;  3VQB A;  4CF2 A;  3G25 A;  1W2B M;  3MEG A;  4YY3 K;  4DHY A;  4M3T A;  4JI8 K;  3KJV A;  1XI1 A;  1CZ9 A;  3FR0 A;  3M6G A;  1VSD A;  1SL1 A;  3K2P A;  2YNF A;  3QIN A;  3I55 N;  4YOX A;  4FJ8 A;  3CFP A;  2KLA A;  2W42 A;  3HPH A;  5GAE P;  2P9K B;  3I8B A;  2RF2 A;  4DUY K;  4E1J A;  1FKP A;  3WXJ A;  4OO1 J;  1NJX A;  2EHG A;  2GWK A;  4CFA A;  4DV6 K;  3NF7 A;  4DCH A;  2O8E A;  1FXX A;  1U4B A;  2O8C A;  4ILH A;  3NF9 A;  5C2D A;  3HK2 A;  3O9T A;  3UIQ A;  3DM2 A;  5EXW A;  3AAQ A;  2JWL A;  1D9D A;  1S3X A;  3WT0 A;  1TYQ B;  1VQ7 N;  3ID6 A;  1QVG M;  3J7Y P;  3NH2 A;  4OLB A;  2KHO A;  2W6L A;  1RBT A;  4WFB L;  3M8S A;  3T1H K;  5MLC Q;  3UE5 A;  3SBG A;  2P9N A;  1L3T A;  3ZEU B;  3AA2 A;  4CZK A;  3AO4 A;  3FZL A;  3QES A;  3VQP A;  2GBZ A;  3CCE N;  3NE6 A;  3AVN A;  2BAN A;  3C6A A;  3NH0 A;  3HL8 A;  2JGU A;  2ZM6 K;  4CGF A;  2E2P A;  2UUA K;  2QWO A;  3AGR A;  3KK3 A;  3V9S A;  3LAL A;  1J53 A;  4FXD A;  3M8Q A;  3HBT A;  1NGG A;  4Q5V A;  1IKY A;  4I6M B;  4JKB A;  4X66 K;  1RBV A;  3DJC A;  3RMD A;  1E4F T;  4DMN A;  3CCL N;  2XHB A;  3V1R A;  4BGB A;  4BWM A;  3RVC A;  4BDP A;  4FJ7 A;  5AQR A;  4O5F A;  1NGH A;  3EY1 A;  3CCU N;  4DSF A;  1ZXO A;  3PO5 A;  1N33 K;  1A5W A;  3P83 D;  4CEZ A;  2E20 A;  5FPM A;  2YNI A;  4XEI A;  4JKD A;  4M3Z A;  1J6Z A;  3THV A;  3AVJ A;  2WBN A;  4ELU A;  1VAZ A;  4MLE A;  2ZF5 O;  3PX0 A;  4FJH A;  4B9U A;  3CXC M;  1RCH A;  4LF4 K;  4FWM A;  3E01 A;  4WQ5 A;  4F2R A;  3LZJ A;  1C1A A;  2XRI A;  4CJS A;  3RRH A;  4FLX A;  1OH8 A;  4FYD A;  4FCY A;  1NJW A;  5DMR A;  3VTI A;  3EO3 A;  3P5J A;  1DTQ A;  4CF1 A;  3G6E N;  4MFB A;  1NMD A;  2NRH A;  2IVN A;  2D0A A;  3RMC A;  1Z6R A;  5HRS A;  3K9J A;  5M1K A;  4AHT A;  3QFU A;  3VEO A;  4HTL A;  2Z1H A;  4CGI A;  2V7Y A;  2UXC K;  2HHQ A;  4ISG A;  1YT3 A;  3HOT A;  2BUP A;  2I7N A;  1WSE A;  3A2F A;  4BVP A;  2X6N A;  3ZSW A;  4IEI A;  1WSG A;  1HRH A;  2V51 B;  4DV4 K;  1QHA A;  5K14 A;  3CFO A;  1JKH A;  1L3V A;  2HVH A;  2E6L A;  3KLE A;  4CER A;  5SWM A;  3U6F A;  2GWJ A;  5M1F A;  3SI6 A;  1S6P A;  3M5R A;  3O3F A;  4B3S K;  4AH9 A;  1D5A A;  4FZY A;  4IO8 A;  1HMV A;  3TTC A;  4CJP A;  3SQ1 A;  1K73 O;  4Y1C A;  4W5R A;  1OH5 A;  4FJG A;  2D0C A;  4N56 A;  1BI4 A;  1ZBL A;  1ASV A;  1YVU A;  3VQC A;  1BO5 O;  1YIJ N;  2Q2R A;  3ZSQ A;  1VSL A;  3C7N A;  4JS4 A;  1KSP A;  4B1Z A;  4WF9 L;  3SYZ A;  2P5G A;  4JI5 K;  1GLL O;  4B1W B;  2HNY A;  3LDL A;  1KRP A;  4M63 C;  3ULD A;  4CJ5 A;  1HUX A;  4C1N I;  3OYD A;  2P9S B;  4KHP K;  4EP4 A;  4EP5 A;  1TGO A;  1Z25 A;  2YV0 X;  2Q31 A;  4BE0 A;  2GV9 A;  1ASU A;  5C42 A;  3K5M A;  2HHX A;  1VSJ A;  4PKG A;  4FJL A;  2I5J A;  2IOC A;  1SKR A;  3CC7 N;  3UKU B;  3L6Q A;  2BE2 A;  1IO2 A;  3GBT A;  3K59 A;  1EXQ A;  2DFE A;  3LAM A;  3LAN A;  4GV9 A;  1RTD A;  3JS6 A;  3AGK A;  4MO5 A;  5E26 A;  5AQM A;  4KHU A;  2VGM A;  1OVY A;  4U7B A;  5AQN A;  5KTQ A;  2PBD A;  3AAP A;  4AM7 A;  4YDU A;  4PQU A;  3ZSR A;  1S9G A;  1FW6 A;  4AHC A;  1EWR A;  4BG8 A;  2ZQB A;  3DRR A;  4HCC A;  4DV7 K;  3OYF A;  2P1J A;  3TSQ A;  4DUZ K;  1RT1 A;  3V1Q A;  5HOO A;  2AP1 A;  3QET A;  4J2B A;  3CC2 N;  4LH4 A;  1Q18 A;  4I7F A;  4DTR A;  5FLX O;  2DFF A;  2XY8 A;  5F1X A;  3MWT A;  3MWP A;  2PZS A;  3V6D A;  3HI0 A;  4F3T A;  4BRN A;  2D1K A;  3MED A;  2FBT A;  4CZL A;  4E19 A;  2HF3 A;  1HQE A;  3B8A X;  2WON A;  5BPN A;  3Q7B A;  1K8A O;  3LP0 A;  2E6M A;  3HPO A;  3OYJ A;  2A42 A;  2GEM A;  3CJB A;  3L4Q A;  4DV1 K;  3OYG A;  3QIO A;  2P9I B;  1B9D A;  1QZ5 A;  2O8F A;  4FSV A;  3U9Z A;  4A2B A;  4CES A;  3VER A;  4AHS A;  3ZSY A;  4BY9 C;  4KRF A;  4PHT X;  3KHY A;  1BIS A;  4L3Q A;  3C6H A;  4YHH K;  4H5T A;  1RT7 A;  3CFR A;  3CYM A;  4DR2 K;  1HPM A;  4JI1 K;  3AA4 A;  3MCA B;  4DV5 K;  2BH1 A;  3DYA A;  4JV5 K;  1BGX T;  1WAJ A;  3VPZ A;  4FOI A;  1BWF O;  3HP9 A;  1GLE G;  5AZI B;  3MEC A;  2J4R A;  3QIC A;  4LFA K;  4WE1 A;  4W5O A;  5AQK A;  4B9T A;  1J9A A;  4U67 L;  4BRK A;  2XY5 A;  4AHR A;  3E1Y A;  2ZJQ L;  3RR7 A;  4M45 A;  1JCG A;  5KPR A;  4FZX C;  1RTH A;  3NF6 A;  4H5N A;  1BIU A;  4IG3 A;  4RW4 A;  3OBY A;  4O0J A;  4CJL A;  1HKB A;  1HJR A;  5HBM A;  3ZSO A;  1YJW N;  2QTD A;  3SV4 A;  3H1V X;  4BC5 A;  3WXM B;  2QA4 N;  2V52 B;  4QS9 A;  4XH5 A;  3CJ7 A;  2YNG A;  4PUO A;  3LDQ A;  3CCS N;  1NU0 A;  3S9H A;  3VA0 A;  4PWD A;  1C0T A;  2O4I A;  2HHH K;  3A5L C;  4ELT A;  2W41 A;  3E9O A;  3DLL L;  1KFD A;  4FOE A;  3HPG A;  4H0Y B;  3AVC A;  2RKI A;  4YOT A;  1HX1 A;  4IEE A;  3VQ5 A;  1NK7 A;  2ETJ A;  3E9L A;  4AHV A;  1I3A A;  3E66 A;  4CF0 A;  3J7Z O;  3IG1 A;  1SUQ A;  3NDK A;  3P38 A;  4JN4 A;  4DTX A;  3A0I X;  5CZ1 A;  2QWN A;  3A5M C;  3ATU A;  4H03 B;  2FC0 A;  4Z94 A;  5HRR A;  3VEY A;  4M3R A;  1GLJ O;  5GIO A;  3AA3 A;  3SUQ A;  3WQU A;  1J5E K;  3KKR A;  4KH6 A;  3R9P A;  5LJW A;  3BUZ B;  4N76 A;  3DMJ A;  5H1S Q;  2P5O A;  1CZB A;  3HT3 A;  3LPU A;  2ZD1 A;  4CJ7 A;  4WQ5 C;  2WUS A;  4LF5 K;  3AVM A;  4B9L A;  4B9N A;  4CFB A;  2FF6 A;  4GNI A;  4OKK A;  4X62 K;  4FJ9 A;  4FL9 A;  3H46 O;  4B1U B;  3CCR N;  3VQA A;  1IKW A;  3KKS A;  2X78 A;  4A57 A;  3OYK A;  3BZK A;  1I39 A;  1DEJ A;  2KQ2 A; 
#chains in the Genus database with same CATH homology
 1SL1 A;  4BDP A;  2VG5 A;  1YTU A;  1RDD A;  3QEP A;  2QXF A;  3AVI A;  2YNF A;  3K2P A;  1RT2 A;  2OPS A;  3QIN A;  3OJS A;  3HVR A;  4HHT A;  4KHQ A;  2BDP A;  3IAY A;  2G8I A;  1UA0 A;  4CIE A;  4H4M A;  3LDS A;  4FJ8 A;  2F96 A;  3LZI A;  5CYM A;  3KD5 E;  2DTU A;  3CFP A;  3S3N A;  4J2E A;  3NBP A;  3KK2 A;  3V9U A;  2W42 A;  3OYM A;  1C1B A;  3S3M A;  2IC3 A;  4CGJ A;  3TAN A;  1ITG A;  3HPH A;  1LW2 A;  3I0S A;  4J2D A;  4UQG A;  4L8R B;  2RF2 A;  2OZM A;  4FM0 A;  1FKP A;  4RW7 A;  1NJX A;  4KV8 A;  3VQ9 A;  2EHG A;  4M3U A;  2VWJ A;  1TKD A;  4RW9 A;  2OPR A;  1TV6 A;  1S1V A;  4JS5 A;  4CFA A;  3OYH A;  3SZ2 A;  1SKW A;  4K8Z A;  1KVA A;  1ZBF A;  1GOA A;  1C1C A;  3NF7 A;  1FXX A;  4ID1 A;  1U4B A;  1WN7 A;  3PY8 A;  1SV5 A;  4GVM A;  3LWL A;  3QEV A;  4KB1 A;  1TL3 A;  3NF9 A;  3TAR A;  4CJT A;  4YNQ A;  3HK2 A;  3UIQ A;  3DM2 A;  3HVT A;  3ITH A;  4CGD A;  3TAF A;  1D9D A;  2G8U A;  3HXM A;  3I8D A;  5FRM A;  3OJU A;  3VQ6 A;  1JL1 A;  3QLH A;  1IKX A;  4BAC A;  3NH2 A;  4OLB A;  2HHV A;  2HMI A;  1UAX A;  4B9S A;  4CF8 A;  3AO3 A;  1RBT A;  3M8S A;  1T7P A;  2PYL A;  3B6O A;  1RTJ A;  3KK1 A;  3SPZ A;  1KFS A;  1RTI A;  4CEQ A;  3OYE A;  4KTZ A;  4BE1 A;  1U49 A;  3CM6 A;  4EZ9 A;  1L3T A;  1T8E A;  3AA2 A;  5J2N A;  4CEF A;  4DS4 A;  4DU4 A;  3AO4 A;  1NKB A;  3QES A;  3VQP A;  4I9Q A;  4PA1 A;  2GBZ A;  1Q8I A;  1RT4 A;  3PUF A;  1VSK A;  1QTM A;  1KLN A;  3NE6 A;  3QNO A;  3AVN A;  2BAN A;  3NH0 A;  1Y97 A;  3HL8 A;  2JGU A;  1HYV A;  4CJ3 A;  4HUE A;  1XHX A;  1HNI A;  4CGF A;  3VQ8 A;  3ZCM A;  3NF8 A;  2HHT A;  4CJK A;  4H4O A;  3KK3 A;  1QSL A;  3V9S A;  4KHN A;  3LAL A;  1J53 A;  4RW6 A;  4FXD A;  3M8Q A;  4FW2 A;  4N5S A;  4DTM A;  4QOZ B;  1BIZ A;  1DLO A;  1IKY A;  4Q5V A;  2Z1G A;  2IGI A;  3QEX A;  4W5Q A;  3H08 A;  4CHY A;  4FJK A;  1RBV A;  4IFV A;  4OJR A;  1X9W A;  3RMD A;  3SUP A;  4DMN A;  4CK1 A;  1L5U A;  1J5O A;  1S1W A;  4M41 A;  2XHB A;  2KZM A;  3V1R A;  2XY7 A;  3G10 A;  3BDP A;  4BWM A;  3NGI A;  1REV A;  3RMB A;  4MQ3 A;  3VQD A;  4DF8 A;  4OPJ A;  4Y1D A;  4KKO A;  3F73 A;  1TL1 A;  4GW6 A;  4DTN A;  4FJ7 A;  2FBV A;  2KTQ A;  3EY1 A;  2Y1I A;  3MXJ A;  1TVR A;  3ZT1 A;  5KRT A;  4DSF A;  3RWU A;  2A1S A;  1QE1 A;  4FLU A;  3PO5 A;  1JLB A;  1A5W A;  3P83 D;  4JRP A;  3LP3 A;  3TAQ A;  4KHY A;  1S6Q A;  1QS4 A;  1VSM A;  4CEZ A;  4O44 A;  4KO0 A;  1NKE A;  2YNI A;  3S3O A;  2RN2 A;  2B4J A;  2B5J A;  4IDK A;  4B9V A;  4M3Z A;  4LSL A;  5I42 A;  3OVN A;  3THV A;  4J2A A;  3AVJ A;  4ELU A;  3VA3 A;  1EX4 A;  2HNZ A;  1A5X A;  1JLC A;  4CE9 A;  3V9Z A;  2ZE2 A;  4PY5 A;  4FJH A;  3PX0 A;  4FJI A;  4B9U A;  3PX4 A;  3RR8 A;  1L3S A;  4FK4 A;  1CXQ A;  1RCH A;  1X1P A;  3E01 A;  4NYN A;  4F2R A;  3K58 A;  4NCA A;  3CM5 A;  4DSJ A;  3D0P A;  2XO7 A;  3QEW A;  1HYS A;  3LZJ A;  1TAQ A;  3BGR A;  1C1A A;  2XRI A;  1DTT A;  1K6Y A;  1W0H A;  4CJS A;  4FLX A;  3RRH A;  3RMA A;  3HJF A;  3KLI A;  4CIG A;  4FYD A;  2VWK A;  4FCY A;  3SCX A;  1NJW A;  5DMR A;  3L2U A;  3ZSV A;  3P5J A;  1DTQ A;  4CF1 A;  1ZBI A;  4MFB A;  3VQ7 A;  3L2Q A;  2D0A A;  1RT5 A;  3RMC A;  4LD0 A;  4E1N A;  1KTQ A;  4HVJ A;  3KLG A;  3SNN A;  5HRS A;  3NCI A;  4C8M A;  4XIU A;  2Y1J A;  4AHT A;  1SL0 A;  4FM2 A;  3OY9 A;  4FLV A;  2Z1H A;  4CGI A;  4DTO A;  4KI6 A;  4GMJ B;  4KB0 A;  4QAG A;  1JLA A;  1KVB A;  4CJ4 A;  5J2Q A;  1TAU A;  3WNG A;  3OS2 A;  2HHQ A;  1YT3 A;  1Q9X A;  3ZSZ A;  3P1G A;  1VRT A;  1NK5 A;  1WSE A;  1MU2 A;  3DI6 A;  2OYQ A;  3A2F A;  1ZYQ A;  2KFN A;  2X6N A;  1A5V A;  2G8W A;  1J54 A;  3ZSW A;  3TAP A;  1LAW A;  1WAF A;  1WSG A;  3U3G A;  1HRH A;  1N5Y A;  3QNN A;  1B9F A;  1BI4 B;  1S5J A;  3DLH A;  5T7B A;  2AJQ A;  5K14 A;  3CFO A;  1VSE A;  1JKH A;  1L3V A;  1C0M A;  4CJW A;  3TAB A;  2E6L A;  2HVH A;  4DU1 A;  1LAV A;  4Q0B A;  3KLE A;  3I0R A;  3C6U A;  3TAM A;  4CER A;  5SWM A;  3O3G A;  3U6F A;  4CHN A;  3DRS A;  3TR8 A;  3TAG A;  4DG1 A;  4ZHR A;  4DFM A;  3VQ4 A;  3K5L A;  3SI6 A;  1S6P A;  4CJV A;  4Z4H A;  3EYZ A;  3O3F A;  3K5N A;  4AH9 A;  1D5A A;  1RDA A;  3L3U A;  4FZY A;  1B92 A;  1C0U A;  4IFY A;  1IG9 A;  3ZT2 A;  1HMV A;  3KLH A;  4RW8 A;  1T05 A;  2RPI A;  1HNV A;  4CJP A;  3SQ1 A;  4Y1C A;  2KZZ A;  1NJZ A;  4W5R A;  1HPZ A;  3OYN A;  4FZZ A;  4LSN A;  1TK5 A;  3KLF A;  2XY6 A;  4FJG A;  2D0C A;  1TKZ A;  3DLG A;  5CY4 A;  4N56 A;  5HRP A;  1BI4 A;  3HST B;  4CEO A;  4CK2 A;  3IS9 A;  1XWL A;  3AVG A;  2YKN A;  1ASV A;  3NGZ A;  1ZBL A;  4DQP A;  3KD1 E;  1WSF A;  1YVU A;  3VQC A;  1QSS A;  3ZSQ A;  1VSL A;  1UOC A;  1LV5 A;  2OA8 A;  4DSI A;  4E7L A;  3VQE A;  4FJX A;  4OKE A;  4HCB A;  4JS4 A;  1EP4 A;  1KSP A;  4HUG A;  4C8N A;  4N47 A;  3AO5 A;  2QKB A;  3L3V A;  4CJE A;  1X9M A;  1NK4 A;  4M3X A;  3SYZ A;  2P5G A;  4N41 A;  4FK2 A;  3RTV A;  4KRE A;  2HNY A;  1JLG A;  2HB5 A;  1KRP A;  4DS5 A;  3T1A A;  1Z26 A;  4CJ5 A;  3ULD A;  3FFI A;  3MEE A;  1LW0 A;  4CEE A;  3OYD A;  3SUO A;  4TSX A;  3V4I A;  4IKF A;  4NYF A;  4G1Q A;  4KTQ A;  4EP4 A;  1RIL A;  5CYQ A;  1RDC A;  1TGO A;  4EP5 A;  1Z25 A;  2YV0 X;  4CGG A;  4HUF A;  2FBX A;  1WSJ A;  2IS3 A;  4BE0 A;  2QKK A;  4JLH A;  4DSL A;  4DFJ A;  2GV9 A;  4FVM A;  3V9W A;  4Z4E A;  3HO1 A;  2HVI A;  1ASU A;  2GUI A;  5C42 A;  3K5M A;  3TAE A;  4B8A B;  2HHX A;  1VSJ A;  4FJL A;  3KTQ A;  2I5J A;  4K8X A;  2IOC A;  4C8K A;  1SKR A;  4FK0 A;  4OGE A;  2WOM A;  3VN5 A;  3M8R A;  1RBU A;  3CQ8 A;  2BE2 A;  3DLK A;  1IO2 A;  1F21 A;  2YKM A;  5HLF A;  2DFH A;  3K59 A;  1EXQ A;  2DFE A;  3LAM A;  3LAN A;  4KFB A;  4CHO A;  5HRO A;  3MXM A;  3SPY A;  5KGX A;  3ZSX A;  1R0A A;  4E3S A;  1S1U A;  1NKC A;  1WLJ A;  1RTD A;  1D8Y A;  4DQI A;  2HW3 A;  1BHL A;  3U3Y A;  4B3O A;  4CCH A;  3ASM A;  3SQ0 A;  1JLQ A;  4KHU A;  1LWE A;  4CEA A;  1RBR A;  3NGY A;  5KTQ A;  3JSM A;  1U47 A;  3KIO A;  5EU7 A;  1SKS A;  4ID5 A;  4PQU A;  3QO9 A;  3ZSR A;  1S9G A;  1TKX A;  3HYF A;  2HHS A;  5JS1 A;  4AHC A;  1EET A;  5KRS A;  1BL3 A;  1BCM A;  4R5P A;  3ISN C;  4BE2 A;  5FDL A;  1UA1 A;  2OZS A;  2ZQB A;  3DRR A;  4HCC A;  5FRN A;  3OYF A;  2P1J A;  4KHW A;  3V81 A;  3C95 A;  4I2Q A;  2YHA A;  1VSF A;  1RT1 A;  1SL2 A;  3V1Q A;  4B9M A;  1UWB A;  4QCL A;  3SUN A;  3QET A;  4J2B A;  1CLQ A;  4LH4 A;  3M8P A;  1EKE A;  4I7F A;  4DTR A;  1C6V A;  3ALY A;  3QER A;  2DFF A;  4DLG A;  4ELV A;  2XY8 A;  2YHB A;  3QIP A;  4KTW A;  3OYI A;  3G0Z A;  5KI6 A;  1IKV A;  2IAJ A;  2G8F A;  5FRO A;  3EZ5 A;  3HP6 A;  3LP2 A;  3NHG A;  4OVL A;  4BDZ A;  4OLA A;  2PZS A;  3V6D A;  4CFC A;  4F3T A;  4E89 A;  2LSN A;  3MED A;  2FBT A;  4E19 A;  4AHU A;  4Z4F A;  5KGW A;  1HQE A;  1JXE A;  2OPQ A;  4H8K A;  4DU3 A;  2F8S A;  2ATQ A;  2WON A;  5HRN A;  3ZT0 A;  3LP0 A;  2E6M A;  4W5N A;  3HPO A;  3OYJ A;  4F3O A;  5D3G A;  3WNH A;  1YTA A;  3QEI A;  3LP1 A;  1S9E A;  4HTU A;  3OYG A;  4OPK A;  1GOC A;  3QIO A;  1B9D A;  1X9S A;  1LWC A;  2NUB A;  2JLE A;  4BDY A;  4CES A;  4DSK A;  2D5R A;  4AHS A;  5HP1 A;  3ZSY A;  1ASW A;  2B6A A;  4KRF A;  1BIS A;  2IDO A;  4I9L A;  1RT7 A;  4O4G A;  3O4Q A;  4EZ6 A;  3V1O A;  3CFR A;  1G15 A;  2VG7 A;  2E4L A;  3LAK A;  1WSI A;  4Z0U A;  3CYM A;  4CEC A;  1VSI A;  3L2W A;  4E7K A;  2D0B A;  4DQR A;  1QSY A;  1FKO A;  1KVC A;  3AA4 A;  4DLE A;  3SV3 A;  4FLW A;  3AVF A;  3C6T A;  4Z4C A;  3DOK A;  3DYA A;  4YFU A;  1VRU A;  3PO4 A;  1KLM A;  1BGX T;  1WAJ A;  1BCO A;  4ICL A;  4OKJ A;  3HP9 A;  4CJR A;  3PV8 A;  2G8V A;  3DLB A;  5I3U A;  4KI4 A;  3LPT A;  3MEC A;  3OYA A;  3TI0 A;  1HQU A;  4E1M A;  2P51 A;  1GOB A;  4CJU A;  3OS1 A;  3AVH A;  4WE1 A;  4B8C A;  4O0I A;  1VSH A;  4W5O A;  1NJY A;  2PYJ A;  1JLF A;  1VK0 A;  4B9T A;  1Q9Y A;  1J9A A;  1W9H A;  2XY5 A;  4DWI A;  4AHR A;  2KQ2 A;  1RBS A;  4FLT A;  4FW1 A;  3RR7 A;  4M45 A;  1XC9 A;  4FZX C;  4M3W A;  1RTH A;  3NF6 A;  2R7Y A;  4FLZ A;  2FBY A;  1BIU A;  4IBN A;  4IG3 A;  2Z1J A;  3L2V A;  4RW4 A;  4O0J A;  1RT3 A;  4CJL A;  1U48 A;  4E0D A;  1S1T A;  3T19 A;  3MXI A;  3OYC A;  3K5O A;  2F8T A;  1HJR A;  5HBM A;  5DK5 A;  3ZSO A;  4CEB A;  1TK8 A;  2HHW A;  2EX3 A;  4CHQ A;  3SQ4 A;  4KAZ A;  4AIL C;  2X74 A;  3SV4 A;  1KCF A;  3IRX A;  4RG8 A;  3VQQ A;  3LWM A;  3DLR A;  1D9F A;  4O55 A;  1WSH A;  3CG7 A;  1IH7 A;  1NK8 A;  2DY4 A;  1U04 A;  4DTU A;  3C94 A;  4CJF A;  4B08 A;  4M3Y A;  2ITG A;  2YNG A;  4DQS A;  4PUO A;  1TKT A;  3T3F A;  4O5B A;  1LWF A;  4LH5 A;  4W5T A;  3B6P A;  1S1X A;  4CHZ A;  3K57 A;  3VA0 A;  3V9X A;  3S9H A;  1NK9 A;  4PWD A;  4CJQ A;  1RT6 A;  3AV9 A;  3NAE A;  1C0T A;  3AO1 A;  3AVK A;  1JL2 A;  2O4I A;  4E7I A;  3ZT4 A;  4C8L A;  2A1R A;  3RRG A;  4LY7 A;  1O1W A;  4ELT A;  4F2S A;  1HYZ A;  1KFD A;  2YNH A;  2VG6 A;  4CF9 A;  4ZTJ A;  3HPG A;  5JS2 A;  3OYL A;  3AVC A;  2OPP A;  4IG0 A;  2RKI A;  3AVB A;  3L8B A;  3DRP A;  3O3H A;  1T03 A;  3VQ5 A;  1NK7 A;  2ETJ A;  4NCG A;  1ZBU A;  4AHV A;  4E7J A;  1I3A A;  4I2P A;  4CF0 A;  4FLY A;  4DFK A;  4FJN A;  3IG1 A;  1SUQ A;  3AVA A;  4DTP A;  3NDK A;  4FJM A;  4NCB A;  1QQC A;  3AO2 A;  2Q3S A;  4FM1 A;  4ZTF A;  3NH1 A;  3OS0 A;  4DTX A;  3F9K A;  4CHP A;  5CZ1 A;  5SZT A;  3D45 A;  2Z1I A;  3MAQ A;  5J2M A;  4M42 A;  2KFZ A;  1CXU A;  3ZT3 A;  4FJJ A;  4DTS A;  4OGC A;  2FC0 A;  1N6Q A;  1NK0 A;  4CFD A;  4C8O A;  1RNH A;  3JYT A;  5HRR A;  4F4K A;  3L2R A;  4E7H A;  5C25 A;  1BQN A;  4CGH A;  4DQQ A;  4M3R A;  5J2P A;  3AA3 A;  3SUQ A;  3KKR A;  4KPY A;  3DOL A;  1JLE A;  4CED A;  3SJJ A;  1BQM A;  4N76 A;  2PY5 A;  4F8R A;  2QK9 A;  3DMJ A;  1NK6 A;  1L3U A;  3WNE A;  1NOY A;  1FK9 A;  2P5O A;  1XHZ A;  1CZB A;  3HT3 A;  3LPU A;  2ZD1 A;  1U45 A;  5J1E A;  1RDB A;  5C24 A;  3PX6 A;  1NOZ A;  4JRQ A;  4CIF A;  3NFA A;  4KHS A;  3TWH A;  2HND A;  1JXB A;  2BGG A;  3AVM A;  4DSE A;  3SQ2 A;  3DLE A;  4B9L A;  2O4G A;  3HM9 A;  4B9N A;  4Z4G A;  3WNF A;  3O4N A;  4CFB A;  5E41 A;  4OKK A;  1WNS A;  3OYB A;  4FJ9 A;  4DFP A;  2KW4 A;  2G8K A;  4BWJ A;  3VQB A;  4CF2 A;  3VQA A;  1IKW A;  2HHU A;  4CK3 A;  4DTJ A;  1TK0 A;  3KKS A;  2X78 A;  4FJ5 A;  1ZBH A;  3MEG A;  2G8H A;  4M3T A;  3OYK A;  3AVL A;  3KJV A;  3AA5 X;  1QHT A;  1XI1 A;  5CZ2 A;  4DF4 A;  1CZ9 A;  1I39 A;  4Z4I A;  1VSD A;  2X6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...