1JL2A

Crystal structure of tceo rnase h-a chimera combining the folding core from t. thermophilus rnase h and the remaining region of e. coli rnase h
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
150
structure length
150
Chain Sequence
KQVEIFTDGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELKAAIEGLKALKEPAEVDLYTDSHYLKKAFTEGWLEGWRKRGWRTAEGKPVKNRDLWEALLLAMAPHRVRFHFVKGHAGHPENERADELARAAAMNPTLEDTGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chimera of Ribonuclease HI, Ribonuclease H
publication title Contributions of folding cores to the thermostabilities of two ribonucleases H.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
total genus 42
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jl2A00
2PY5A 1UA1A 3NFAA 3RWUA 4XIUA 3K59A 4CIFA 2IDOA 4O55A 3HK2A 1BCMA 3KLGA 3MXMA 4Y1DA 1NKEA 3RRGA 4DSIA 3OYFA 1VSKA 2QXFA 1KSPA 3ZT3A 4KPYA 4DU1A 1ITGA 4O5BA 4Z0UA 5KTQA 3AVCA 1VSIA 1KVBA 2FBTA 3AVIA 1FKOA 1S1XA 4OVLA 4H4MA 2XY7A 2GBZA 1VSFA 3NGIA 1J54A 3C6TA 3NH0A 5FDLA 4KKOA 4M41A 3VA3A 4B9MA 4LY7A 4FW1A 4CJ3A 3OYAA 1LW2A 2XRIA 3IG1A 4AILC 1ASWA 1WSIA 5KRTA 1LV5A 4CFDA 2QKBA 4CESA 1JL2A 1KVCA 2P5OA 3K5MA 4RW7A 2W42A 4BE0A 4DSKA 1SV5A 2HHQA 1ZBUA 4CERA 1ASVA 1FXXA 4E7HA 4QOZB 1IH7A 4DWIA 1X9SA 2KZMA 3L2RA 4TSXA 4I7FA 3THVA 4K8ZA 3LDSA 1L3SA 4FZZA 5JS1A 4JRQA 3V81A 1BISA 3SUOA 1GOAA 1T8EA 2O4IA 1YTAA 1C0TA 3DLKA 1JLFA 3SUPA 4F3TA 3K5NA 5CYQA 1RT6A 4DF4A 4FJMA 3QINA 4KREA 3L2QA 4Z4HA 4KB0A 2HHTA 4LSNA 4PA1A 4B9TA 1ZBIA 4FJNA 1LWCA 3C95A 4I9LA 2OYQA 1S6QA 5KI6A 1HNIA 2Q3SA 4FW2A 4KO0A 4DSLA 3C6UA 4FZXC 3MEGA 4DU4A 2P51A 3MXJA 1RT7A 3VQ8A 1SL0A 3RRHA 3AA4A 4RW6A 4N56A 3OYLA 4CJSA 5SZTA 3K58A 1FKPA 1TKZA 3VQ7A 1QSSA 4KAZA 2OZMA 4M3RA 3VQ4A 3QEXA 4FK0A 4CF8A 3HPOA 1SL2A 4J2DA 1ASUA 4ID5A 3V9SA 4DTXA 4B9LA 4FLXA 1TKTA 4M3WA 2KFNA 4CGHA 3QIPA 4CF1A 3HT3A 1Z26A 3KK2A 4IG3A 1EKEA 3ZSRA 1UAXA 4OGCA 3CG7A 1CZ9A 1I3AA 4CHQA 2RKIA 3PX4A 3NGZA 2E4LA 4ZHRA 1T05A 5I3UA 1JXEA 2D0BA 1WLJA 1WSEA 3RMDA 1RT5A 1N5YA 4CFBA 4HUEA 4CCHA 1VSJA 1N6QA 2G8UA 4ICLA 5KGXA 4FLUA 4DTMA 5C25A 5J2PA 3S3NA 1W0HA 1TAUA 3U3GA 1L3UA 3NF6A 2XY5A 3M8RA 2DFEA 4YNQA 4NYNA 1BIUA 4BDPA 3ISNC 2GV9A 1S1VA 3SUQA 1U47A 1VK0A 1S1WA 4CIEA 3KLIA 3ZCMA 3DYAA 4E3SA 1R0AA 4BWJA 1KFDA 3OYMA 3QETA 4CEOA 2X6NA 4DQIA 1EXQA 2OZSA 3CYMA 3QIOA 5CZ1A 3OJUA 3QNNA 2AJQA 4FJIA 1XWLA 4DTSA 4Q5VA 1W9HA 4B08A 1IKYA 4DSFA 4CJLA 4E19A 3L8BA 3LPUA 3RTVA 2X74A 3LAMA 1BI4B 1S1TA 2HNZA 2OPSA 3KKRA 1LWEA 3HVRA 1KRPA 4BDYA 4OPKA 1WSFA 3SI6A 3VQBA 3OS1A 2OA8A 4JS5A 4CJFA 1EX4A 1HYZA 1XHXA 3V9ZA 3TAFA 2IAJA 3SNNA 1NK8A 3KLHA 4C8LA 4KRFA 1ZYQA 1U4BA 2IOCA 4EP4A 3DLGA 3OYDA 4PY5A 4JS4A 1C0UA 4FCYA 1B92A 3AVMA 3HPGA 4AHUA 1K6YA 2DY4A 4I2PA 4RG8A 1JLBA 1KTQA 2VG5A 4CEFA 4F2RA 1WAJA 1J5OA 1VSMA 4KTQA 2B5JA 4AH9A 2A1SA 1JLAA 1UWBA 4IKFA 1NK7A 4OKJA 4ZTFA 2KZZA 4UQGA 3AO2A 1VSDA 4DQRA 4OGEA 4LD0A 1WSGA 4BDZA 1RT4A 4CHNA 2LSNA 3RMBA 3NDKA 3T19A 1B9FA 3K5LA 1L5UA 1JKHA 5FRNA 2WOMA 3LAKA 4CJKA 4ZTJA 4KB1A 2PYLA 4DSEA 3HP6A 4R5PA 3DOLA 1TK8A 4M3YA 3P5JA 3AA5X 3VQAA 4CGFA 4CHPA 3V9WA 5FRMA 3PO4A 2HNDA 4JLHA 2YV0X 4E1NA 3JSMA 2RN2A 3OJSA 3SCXA 3WNFA 4Z4GA 1KLNA 1RTJA 2XHBA 4E89A 4O4GA 4FJ8A 2D5RA 1JLQA 3AVLA 3O3HA 4DFMA 1RDAA 3AO4A 4E7IA 4FJXA 1BQNA 4Z4FA 2ITGA 4CFCA 4CEQA 4HCCA 2QK9A 3DMJA 1NOZA 5HROA 3LPTA 1RDDA 3NH1A 3KIOA 4FM0A 1JLCA 3TANA 3B6PA 4CK1A 4E7LA 1ZBFA 3I8DA 5HRPA 2R7YA 2IGIA 1C0MA 5CYMA 3ASMA 3SQ0A 5HRNA 3DM2A 4M3TA 2IS3A 4B3OA 1BI4A 4CGDA 1J53A 3CFPA 3PV8A 4B8AB 1WSJA 3MECA 3F73A 3S3OA 5CZ2A 3HL8A 5T7BA 4FM2A 3VQQA 3FFIA 3L3UA 1QSYA 3AO3A 1GOCA 4BACA 1D8YA 1D9FA 1RDBA 1JLGA 4FJGA 4KI4A 1TVRA 4DTNA 3LANA 4IFVA 4IDKA 4LH4A 2YNGA 2FBXA 4CGIA 1NK5A 1SL1A 4CEBA 3NE6A 3CQ8A 2ZQBA 5HRRA 3TAGA 2G8KA 2BDPA 3V9UA 1RT1A 3G0ZA 2HHVA 5KRSA 1I39A 1S1UA 3NGYA 2JLEA 3K5OA 5KGWA 3O3FA 1TL1A 2X6SA 3PX6A 3S9HA 2XO7A 1RNHA 4PWDA 5J2NA 4Q0BA 1HJRA 4HTUA 3H08A 3EZ5A 3PY8A 3AVFA 2JGUA 3EY1A 1XC9A 1NJYA 3ITHA 4OPJA 2XY8A 4OKEA 4CJVA 5CY4A 4DTRA 1D5AA 1SUQA 3ZT2A 2B6AA 2ZE2A 3AV9A 4JRPA 4MFBA 1RT3A 1TK0A 3D45A 3VA0A 1CXUA 3UIQA 1HYSA 3AVJA 4DG1A 1X1PA 3SQ4A 1J9AA 3SQ2A 3JYTA 5J2MA 3TAEA 2OPRA 2O4GA 4OLBA 2F96A 2VG6A 1YT3A 1KLMA 1BL3A 2A1RA 4B9VA 4LH5A 3ZT1A 3AVHA 3KK1A 4B9NA 5C24A 3NF9A 3IRXA 3OYBA 4CJTA 3RMCA 1GOBA 3TAQA 1SKRA 4F8RA 1JL1A 3ULDA 4Z4EA 4DS4A 2KFZA 4CJ5A 2HMIA 4DQPA 3NBPA 4F2SA 1UOCA 1CLQA 4CF0A 3OYEA 3HM9A 1LAVA 2FBYA 3DOKA 2EX3A 1L3TA 4DSJA 4FK4A 3DI6A 4BE2A 3OYHA 5J1EA 3NAEA 4J2EA 4G1QA 4O44A 4W5NA 1RDCA 4CJRA 3SJJA 3V9XA 1QE1A 3AVAA 2G8WA 3MEDA 2G8IA 2HNYA 1RILA 4CEZA 4DFJA 4DTUA 4KHNA 4FJ9A 4KHSA 2KTQA 1XI1A 1VSEA 3KLFA 4ELTA 1BCOA 4OJRA 4WE1A 3KKSA 3O4QA 4CGGA 4CJ4A 3OYGA 4HUGA 2P5GA 1NK0A 1EETA 3O4NA 1G15A 3V1RA 3O3GA 1NJWA 1MU2A 3VQ6A 4B8CA 3L2WA 3DLHA 1VSLA 3M8PA 4DFPA 1QTMA 1U04A 5I42A 4NCGA 4CE9A 4M3UA 1U49A 2HHXA 4B9SA 3OVNA 3SPZA 1BIZA 2RPIA 4ELUA 3K57A 2YKMA 3QESA 4PQUA 1C1BA 3NCIA 4PUOA 1TL3A 3MAQA 1KVAA 3P1GA 3V6DA 4AHTA 3P83D 1NKBA 4DFKA 1KFSA 1A5WA 4FJ5A 3V1QA 4CF9A 2PYJA 1HQEA 1VSHA 4DLEA 4DU3A 4GMJB 5EU7A 4W5RA 2DTUA 1TAQA 1S9GA 1ZBHA 4FLTA 3QEIA 4CJWA 1Q9YA 2E6LA 3ZSQA 1X9MA 1QSLA 2G8HA 3IS9A 4N47A 3SV4A 3ZT0A 4KHWA 4FK2A 3RR7A 3BGRA 4Z4IA 3SV3A 3SZ2A 4DF8A 3TARA 3HPHA 5D3GA 3LZIA 2XY6A 2B4JA 3TAMA 4CHZA 1WSHA 3LZJA 3SYZA 3OYJA 1IKVA 3OYCA 3KD5E 4RW4A 3EYZA 4L8RB 3AO1A 5FROA 3TI0A 1C1AA 3DRRA 4KTZA 4W5QA 3ZT4A 4IBNA 1LWFA 4C8NA 4DTPA 4ELVA 4FJJA 3QEWA 2Y1IA 1WAFA 2P1JA 3T3FA 2HHWA 1DTTA 5J2QA 3HP9A 3LALA 3AVBA 3I0SA 2VWKA 2YNIA 4RW9A 3LWLA 4HUFA 2YKNA 4CK2A 4C8OA 4Y1CA 2E6MA 3AVGA 1SKWA 1C1CA 1HMVA 4YFUA 4F3OA 4NCBA 2D0CA 2Z1JA 4M3ZA 3ZSOA 3KK3A 1NOYA 4I9QA 2KQ2A 1NJXA 1S6PA 3I0RA 1VRTA 4E7KA 4DQSA 2I5JA 3OY9A 2EHGA 1L3VA 3QEVA 5HLFA 4NYFA 4ID1A 1RBRA 1S5JA 4DMNA 4FLYA 1IKXA 4KV8A 1U48A 4QCLA 3CM5A 1UA0A 4FYDA 1Y97A 1RBTA 3CFRA 1IO2A 1RBVA 3LP1A 4O0IA 4AHVA 3KLEA 1C6VA 4F4KA 4AHSA 4K8XA 3DLEA 3LP2A 3NF7A 3LWMA 1RTIA 5DK5A 1VRUA 4H8KA 2ZD1A 2FBVA 1DTQA 4DLGA 4W5TA 1NK9A 3SPYA 2YHAA 4CFAA 1XHZA 3HYFA 2Z1GA 2QKKA 2HHSA 1NK6A 3DLBA 1TV6A 3PUFA 4O0JA 1BHLA 1F21A 1EP4A 1FK9A 3NF8A 4M45A 3D0PA 1YTUA 2Z1HA 1Q8IA 1QS4A 4E7JA 2HW3A 2HB5A 1T7PA 4EZ6A 3LP3A 1NKCA 4CF2A 2WONA 4AHRA 4CJEA 3U3YA 3V4IA 3KD1E 2RF2A 3QLHA 3T1AA 3QERA 3BDPA 4FJ7A 1IKWA 3IAYA 2GUIA 4E1MA 1X9WA 4DTJA 3NHGA 4EZ9A 3MXIA 3AVNA 3E01A 4CEEA 2PZSA 3M8SA 1JLEA 1S9EA 1KCFA 2VWJA 2HVHA 4FLZA 3AVKA 3HSTB 3ZSYA 4CEAA 3KJVA 3QNOA 1D9DA 1RBUA 4IFYA 2IC3A 4H4OA 2FC0A 3V1OA 4FLWA 2KW4A 2G8FA 2BGGA 3G10A 1TKDA 2VG7A 1NK4A 5HBMA 3ALYA 4CECA 3DRSA 3QO9A 2OPQA 4CK3A 3VQPA 3ZSWA 3TAPA 4N5SA 1DLOA 2YNFA 4GW6A 2DFFA 4J2AA 1CXQA 1TKXA 3AA3A 4C8KA 3DRPA 3SUNA 4FXDA 4DTOA 2Z1IA 3KTQA 1HPZA 3ZSXA 3VN5A 4FJLA 3MEEA 2YHBA 3F9KA 4KHYA 2DFHA 3QEPA 4BWMA 3AO5A 3PO5A 1NJZA 1SKSA 1YVUA 4HCBA 4Z4CA 4CJUA 4NCAA 3M8QA 4M3XA 4CJQA 4BE1A 2BE2A 4KFBA 5HP1A 4LSLA 3B6OA 1CZBA 4CEDA 2HVIA 3OYKA 4OKKA 4HHTA 3TABA 4N76A 1QQCA 3VQ5A 1HNVA 2X78A 3RMAA 2BANA 3DLRA 1REVA 1RT2A 2ETJA 1O1WA 1Z25A 4HVJA 4EP5A 3OYIA 4B9UA 1B9DA 1TGOA 3RR8A 2ATQA 3HXMA 3A2FA 3C94A 4CGJA 2Y1JA 1LW0A 1RTHA 3HVTA 4J2BA 2F8TA 3WNEA 2HHUA 3K2PA 5HRSA 4QAGA 2F8SA 3ZSZA 4GVMA 4CHYA 2D0AA 3TR8A 1WNSA 3WNHA 3CM6A 3LP0A 4FM1A 3PX0A 1BGXT 4DQQA 1ZBLA 1RCHA 3VQ9A 3HJFA 4CJPA 2OPPA 1LAWA 5JS2A 5DMRA 3HO1A 2YNHA 3OS0A 2G8VA 3NH2A 4KTWA 3VQDA 4FZYA 1RBSA 2NUBA 4IG0A 4DS5A 3SQ1A 3WNGA 1TK5A 1A5XA 5SWMA 3CFOA 3L2VA 3OYNA 4KHQA 1BQMA 1HRHA 4AHCA 5K14A 4RW8A 1A5VA 1HQUA 4I2QA 4FVMA 5E41A 3L3VA 4N41A 4CIGA 4E0DA 1IG9A 1WN7A 4KHUA 3L2UA 3TWHA 5C42A 1U45A 3ZSVA 4C8MA 1Q9XA 4KI6A 1JXBA 1QHTA 4M42A 1HYVA 4FJHA 3VQEA 3OS2A 3S3MA 4W5OA 1RTDA 4FLVA 3AA2A 4MQ3A 4FJKA 4CHOA 3U6FA 3VQCA 1T03A 4OLAA
chains in the Genus database with same CATH superfamily
1N33K 1MWKA 4CIFA 1SS6A 4JNEA 3MXMA 3RRGA 2QXFA 3ZT3A 3KZBA 4EHTA 5KTQA 3GG4A 1S1XA 2XY7A 2D4WA 3NH0A 4M41A 3VA3A 1U6ZA 2BTFA 2OTJN 4FW1A 4CJ3A 2XRIA 2FF3B 5KPRA 1FXXA 1IH7A 5F1XA 3ID8A 1V4TA 3CXCM 4K8ZA 3LDSA 3SUOA 1BISA 1GOAA 4LF8K 1X9JA 1YTAA 2IVOA 4A2AA 1RT6A 4A2BA 3QINA 3FLCO 4JKFA 4K25A 1O13A 4JI8K 2OYQA 1HNWK 2Q3SA 2WC9A 5JLFA 3MEGA 1GLJO 3RRHA 1QHAA 3AA4A 1Z05A 3OYLA 3RVCA 1FKPA 1TKZA 4JKEA 4KAZA 4M3RA 1N8RO 4CF8A 1SL2A 4KHPK 3V9SA 4FLXA 4JYAK 4CF1A 1EKEA 1VQMN 3CG7A 5AQHA 2RKIA 2I7PA 3D2FB 2D0BA 1N5YA 1BU6O 2G8UA 4FLUA 5C25A 3U3GA 4B3TK 4M7YA 2O8CB 3M8RA 2VGMA 5AQPA 2GV9A 1S1VA 5GAHP 3KLIA 3VF2A 4E3SA 1IJJA 4ISGA 3MX5A 2OZSA 1VQ5N 5CZ1A 1GLBG 3ID6A 4DTSA 3MN7A 4MO4A 3VGKA 3CETA 3TU5A 3LPUA 2O8EA 3AAQA 1KRPA 4V19S 4BC3A 4JS5A 3V9ZA 1EX4A 4C8LA 3KLHA 5TKWA 1ZYQA 4FOIA 4EP4A 3OYDA 4JS4A 1HNZK 3HPGA 4AHUA 5AQMA 4B3MK 4LFBK 4F2RA 2HOEA 4AH9A 4JKDA 3FZKA 4UQGA 4DQRA 2HHHK 4LD0A 3NDKA 3D2FA 5FRNA 4IOXA 5AQQA 4R5PA 4FL9A 3SMSA 3J8AA 3CJCA 3VQAA 5FRMA 2YV0X 2QWMA 4H0OA 4Z4GA 2XHBA 1MA9B 3AVLA 3O3HA 4A61A 4E7IA 3A0IX 1BWFO 4CD3A 4CEQA 1OH6A 1NOZA 3MMVA 1ZBFA 5HRPA 2GTDA 5H1SQ 3I55N 3DM2A 1FW6A 4B3OA 3PV8A 2ZF5O 3F73A 1HLUA 2P9LA 5LMNK 4FM2A 3VQQA 1N36K 1D8YA 3AO3A 1GOCA 1D9FA 3EE9A 2QXLA 2A40A 3CC4N 2QK9A 2YNGA 2FBXA 1BDGA 5EX5A 3CQXA 3G0ZA 1G99A 2HHVA 4GV9A 1S1UA 2JLEA 3K5OA 4FWSA 5KGWA 2X6SA 4DV3K 3PX6A 3S9HA 1JCGA 4HTUA 3EZ5A 3G25A 3AVFA 2JGUA 3HZ6A 1XC9A 1YXQA 4O8KA 3C7NB 4JRPA 3SAFA 3WEEB 2JWLA 4MFBA 1TK0A 1CXUA 3THXA 1HYSA 4DG1A 1X1PA 4CZMA 1J9AA 2HF3A 4WFAL 2UU9K 3TAEA 2OPRA 2O4GA 3FGUA 4JI7K 1KLMA 4B9VA 5FPNA 2QA4N 3CIPA 1RGIA 3RMCA 3IRXA 4F8RA 2IVPA 4BRIA 4YOYA 4L3QA 4CJ5A 2HMIA 3HM9A 1ATSA 4FK4A 4BE2A 5J1EA 4O44A 4BG8A 1RDCA 4DV6K 3SJJA 1QE1A 3TSQA 2G8WA 2HNYA 1RILA 4CEZA 4FJ9A 4YOXA 3NVKA 4RCHA 3KLFA 4ELTA 3O9SA 3KKSA 1RDWX 1EETA 3FZHA 3VQ6A 4B8CA 5BRFA 4DR5K 1VSLA 4H0YB 2IVNA 4U7BA 5I42A 4NCGA 2HHXA 1U49A 1X3NA 4B9SA 1W7AA 3ATVA 4ELUA 4PQUA 2W41A 2NZTA 3OTOK 3NCIA 1YJNN 1KVAA 1TYQB 1NKBA 4DFKA 3QDKA 2NRRA 4CZLA 4DU3A 1GLDG 3AGKA 4QS8A 4FLTA 4DV0K 3ZSQA 3PSIA 3M6GA 3SV4A 3ZT0A 4FK2A 3LZIA 4CHZA 5AQWA 3KD5E 4L8RB 3I8BA 3AO1A 4CVNE 4IBNA 4C8NA 3G6EN 3O9TA 2QI2A 2HHWA 2VQEK 2A41A 5M1OA 3AVBA 2YNIA 4IJAA 4HUFA 3AVGA 1C1CA 5AQJA 4NO7A 4YFUA 1H1VA 4Y0WA 4BRAA 4F3OA 2Z1JA 4M3ZA 4I9QA 4AF1A 4EHUA 1L3VA 3THWB 3ZEUA 3AARA 4QCLA 4KV8A 2V7ZA 3M5RA 1NGIA 2D0OA 3K0SA 1Y97A 4FYDA 1IO2A 1HR0K 4KBOA 1C6VA 1EWRA 4IOCL 2QTDA 2YHXA 4K8XA 3DLEA 3NF7A 4JKAA 3J7YP 3LWMA 3U4LA 3A5LC 4DLGA 1NK9A 3GDQA 2D1KA 5EXWA 3HYFA 3DLBA 4O0JA 1FK9A 2FSNA 1QS4A 4PKGA 1VQ8N 5C0YA 3VEYA 1NKCA 4AHRA 1OVYA 4CJEA 3V4IA 2Q97A 2RF2A 3QLHA 5MLCQ 3QERA 1IKWA 2GUIA 3O9UA 5EVZA 4DTJA 4EZ9A 3M8SA 4FLZA 3AVKA 4CEAA 1WUAA 2IC3A 2KW4A 5E26A 3G10A 1NK4A 4CECA 3TAPA 3THWA 1WBDA 2DFFA 3AA3A 4C8KA 4FXDA 1K8KB 2GWKA 2Z1IA 3L6QA 1YI2N 3MWTA 1VQLN 2NRHA 3J81O 4HCBA 3CMEN 2E5LK 1QQOA 4LSLA 4CEDA 3OYKA 3VQ5A 3T1HK 1LCUA 1O1WA 4O5FA 1Z25A 3RR8A 3B8AX 2WBNA 1YUWA 5AQYA 4O8UA 2F8SA 1KXPA 2D0AA 3GE1A 3CM6A 4DB3A 1U2VB 3R6MA 3VERA 1ZBLA 3CCLN 3HJFA 1LAWA 2YNHA 3GOIA 3VQDA 1RBSA 4NB4A 3SQ1A 2GUPA 5SWMA 2QW9A 3CFOA 5C15A 2ZJRL 4AHCA 5AQNA 5K14A 4DV5K 1I94K 4JD2B 4N41A 5AQKA 3TTDA 1K8KA 4KI6A 3MCPA 1YJ9N 3UKUB 5AFUA 2VGNA 3O5BA 4EFHA 4PL8A 4HTLA 4OLAA 2PY5A 3QB0A 1UA1A 1WOQA 4BRMA 4XIUA 2IDOA 1T6CA 4O55A 3MCAB 2JWKA 4DSIA 4BRHA 4CZIA 3OYFA 5C10A 3MN9A 1ITGA 4KH6A 1YVNA 3IKMA 2FSJA 4Z0UA 4IWVA 5BREA 3AVIA 2FBTA 3Q7BA 4B1XB 1VQ4N 3IDHA 1FKOA 4OVLA 4K0KK 1VSFA 1NGGA 4YOWA 4U67L 4KKOA 4B9MA 3OYAA 3IG1A 5KRTA 4CFDA 1IBKK 1JL2A 1V4SA 1JJ2M 4BE0A 2UXDK 1BOTO 3A5NC 1NGDA 4I7FA 1L3SA 5FLXO 5BN9A 2O4IA 5AQRA 1FJGK 1C0TA 1JLFA 4H0XB 3TTCA 4PHTX 3K5NA 5CYQA 1WB9A 4KREA 3L2QA 4Z4HA 2Q0UA 4PA1A 3WXLA 1ZBIA 4FJNA 2A3ZA 3C95A 1S6QA 4DSLA 4KO0A 3C6UA 4FZXC 1RT7A 1SL0A 4RW6A 4N56A 3K58A 3VF6A 5BRDA 3L0QA 4DCHA 3BUZB 3HPOA 1R59O 1TKTA 4DR3K 4M3WA 2KFNA 3QIPA 2NNWA 3KK2A 1UAXA 1NMNA 4BRNA 3NGZA 3QICA 1WSEA 3MX2A 3DXMB 3RMDA 1N6QA 3VENA 1YAGA 5J2PA 3SJHA 3NF6A 3VEZA 4YNQA 4GNIA 1XQSC 4BDPA 2FSKA 3ISNC 4YOUA 1BA1A 1U47A 1VK0A 1S1WA 3PSFA 4CIEA 3VOVA 3H1QA 2H3GX 3OYMA 3QETA 4CEOA 3H1VX 3WQTA 1EXQA 3CYMA 3QIOA 3QNNA 5F0XA 1W9HA 1IKYA 4CJLA 3L8BA 4RWTA 3F5TA 2NRWA 1S1TA 4JI2K 2OPSA 3KKRA 4OPKA 1KAXA 3CC7N 2CGJA 3SI6A 1HYZA 1XHXA 2IAJA 5AQXA 4FOEA 1NMDA 3DLGA 4FCYA 1C0UA 3CI5A 1B92A 3F2KA 1Q18A 4CEFA 1KTQA 3OBYA 3CCRN 1VSMA 1J5OA 2B5JA 3ENHA 2A1SA 5BPLA 4OKJA 4ZTFA 2KZZA 5GAGP 3SAGA 2Q36A 1C0FA 2QWLA 4BRDA 4XH1A 4YDUC 4GV6A 2VYPA 3K5LA 3DXMA 4JI1K 2O8BB 4DSEA 1TK8A 4GV3A 3AA5X 4CGFA 3W0LA 4CHPA 2E20A 2HNDA 5GINA 4JLHA 2RN2A 4BR7A 3IMXA 4EAHD 3OJSA 3ZX3A 1RTJA 2D5RA 3D7EO 1MWMA 3BZCA 1VQ6N 2CH5A 3VGMA 3NH1A 3KIOA 1JLCA 3B6PA 4E7LA 2R7YA 2IGIA 1C0MA 4JHDB 3SQ0A 5HRNA 4M3TA 3CPEA 3K9KA 3CFPA 3MECA 3FFIA 3F9MA 4BQLA 1RDBA 4FJGA 2E88A 3LANA 4IFVA 4IDKA 3FFKB 3JAMO 1NK5A 4DR6K 2G8KA 2ZQBA 5HRRA 3TAGA 4IOAL 3LM9A 1RT1A 5M1QA 5KRSA 1I39A 2NRXA 2UXBK 1QZ5A 1TL1A 1NGFA 2XO7A 1RNHA 2D0PA 5EOYA 5J2NA 1HJRA 3PY8A 2KKZA 5IWAK 5BPNA 1K8AO 4CBWA 4A59A 4DUYK 4CJVA 1GLFO 1P8ZA 4DTRA 3O1BA 1D5AA 2O8BA 4X64K 1SUQA 3ZT2A 2B6AA 3AV9A 4WFBL 3D45A 4H5WA 3IFRA 3SQ2A 3JYTA 4OLBA 2VG6A 3ZLJA 1NU0A 1BL3A 3R8EA 4JK8A 4B9NA 3NF9A 3TAQA 3TSUA 4CJTA 1JL1A 3EZWA 4DS4A 4DQPA 4JKGB 4CW7B 4F2SA 1UOCA 4CF0A 3OYEA 3DOKA 3CF5L 4DSJA 3BY5A 4W5NA 4DR7K 3BEXA 3AGRA 3MEDA 2G8IA 4IZ9A 1ZBSA 4DTUA 4FWQA 1XI1A 1VSEA 3BF1A 2KLAA 4CZHA 5AZJB 4OJRA 5GIPA 4WE1A 4CJ4A 2CH6A 1NJWA 3L2WA 3DLHA 3FZMA 3M8PA 3WXKA 5KQDA 3AAPA 4IEIA 5LJVA 3IUCA 2RPIA 3K57A 2YKMA 4PUOA 3MAQA 3P1GA 1YHQN 1J6ZA 4XH5A 5BR8K 3EO3A 3CJ1A 1VSHA 5AQTA 4W5RA 3C6AA 3R1XA 1ZBHA 1S9GA 1X9MA 4BRPA 1QSLA 3IS9A 3RR7A 3SZ2A 1X3MA 2FLOA 4EIAA 4DF8A 3HPHA 2B4JA 3LZJA 5DM6L 3O4WA 3OYJA 2GWJA 5FROA 1C1AA 4W5QA 3PIPL 4FJJA 4DR4K 1Q81O 2Y1IA 2O8CA 1WBBA 1DTTA 3HP9A 2VWKA 3N4QA 5AQIA 2HBKA 1XMQK 2E6MA 4JI0K 3MN5A 4FWPA 1NOYA 1HUXA 4ISFA 3TPQA 3I0RA 5AZJA 2W6KA 1RBRA 4LFAK 2ZGYA 4IFEA 5GADP 1RBTA 3CFRA 1RBVA 3LP1A 4IO9L 5AQLA 4DQ8A 1NGEA 4O0IA 3J7AP 4DKWA 3ZYYX 4WCEL 2ASPA 3LP2A 3O8MA 1Q82O 5DK5A 1VRUA 2F9WA 2PBDA 4FWNA 2Z1GA 5TKYA 4KHWA 1TV6A 3NF8A 3O08A 5AQFA 1KQSM 4E7JA 2HW3A 5LY3A 4BRKA 3LP3A 3O9RA 3CCJN 3T1AA 4DR1K 3BDPA 1NGHA 4E1MA 2E2QA 1X9WA 3NHGA 3AVNA 3E01A 4CEEA 4BGBA 1JLEA 3HRGA 1RBUA 4IFYA 3V1OA 4H4OA 2FC0A 3HTVA 2YHYA 1TKDA 3ALYA 4BQZA 4NXMK 4JI6K 4GW6A 4B3RK 2QWRA 5DM7L 3QMLA 1EWQA 3ZSXA 4FJLA 3MEEA 2YHBA 3F9KA 2DFHA 1YVUA 4JKHA 1E4FT 3DWLA 3M8QA 4M3XA 4MO5A 4WYBA 2YHWA 1NWKA 5FPMA 4I6MB 4HHTA 3TABA 2QM1A 3JS6A 2X78A 1Q86O 4FPBA 2Q31A 5JICA 1QZ6A 3A2FA 1LW0A 3HVTA 3JXUA 2F8TA 2OCEA 3WNEA 3W3DA 3FR0A 4M63C 4UY8O 4DV1K 3C0BA 3TR8A 1WNSA 3LP0A 1N34K 2NRTA 1BGXT 3C7NA 3MK6A 1RCHA 3VQ9A 2E1YA 3WEEA 2OPPA 2NRVA 4H5RA 1YJWN 2VWBA 4KTWA 5AQSA 1IBMK 1BO5O 4YY3K 4DS5A 1A5XA 2F9TA 3UB5A 4RW8A 4FWLA 3EKUA 4CIGA 4E0DA 1IG9A 4KHUA 5E84A 3WQUA 1Q7YO 3ZETB 4FJHA 1TUYA 3LDLA 3AA2A 4FJKA 3U6FA 1M90O 3K59A 1QVFM 4E1JA 3LDNA 4I6MA 1Y64A 1NKEA 3M1FA 1VSKA 4CBUA 4PL7A 1KSPA 4AM7A 4KPYA 3VEWA 1KVBA 1BUPA 2GBZA 3FZFA 3NGIA 1KD1O 3A5MC 3C6TA 1E4GT 3KHYA 4FSVA 3SAHA 4R79A 3FZLA 1LW2A 1WSIA 1TYQA 3T69A 2E1ZA 4CESA 5C2FA 1KVCA 3K5MA 4YOVA 1ASVA 4E7HA 4QOZB 4DWIA 3U8XA 4BC4A 3VF4A 3THVA 4FZZA 4JRQA 1DEJA 5LL6Z 1D4XA 4DF4A 4FJMA 4JK7A 3P4IA 4KB0A 2HHTA 4LSNA 3H46O 4BR0A 4A57A 1HNIA 4FW2A 3ZETA 4FVUA 5KPTA 4CJSA 3VQ7A 4B1WB 5AR0A 5M1FA 4BROA 2PFUA 4H0PA 3HI0A 4CGHA 2GELA 4BRQA 2RHKA 4WQ5A 3ZSRA 2YX6A 4OGCA 1I3AA 3PX4A 2A6AA 1ATRA 1NGBA 4ZHRA 4J8FA 5I3UA 4IEEA 4CZJA 4CFBA 1VSJA 4ICLA 5KGXA 3S3NA 2AA4A 4H5TA 1VQPN 2XY5A 3MN6A 2DFEA 4JK9A 5M1PA 4NYNA 3SUQA 4BGAA 4K42A 4LF5K 1R0AA 4BWJA 1KFDA 3O6WA 3CJBA 3E9PA 3OJUA 1HKGA 2I7NA 4Q5VA 5ADXH 3E66A 4DSFA 4E19A 3P31A 2WTUA 2X74A 2GX9A 1BI4B 3LAMA 2HNZA 3HVRA 1LWEA 3KK7A 1WSFA 3VQBA 3OS1A 2OA8A 4CJFA 4KRFA 1NK8A 2UUCK 4JI3K 1U4BA 2IOCA 4NLCA 2V7YA 1K6YA 4JKBA 4I2PA 4LF9K 2VG5A 3ULEB 2V51B 1UWBA 2E8AA 1P90A 3AO2A 1VSDA 1WSGA 1RDUA 5JMVA 3UKRB 3VMFB 1RT4A 4JV5K 3A5OC 3CERA 1L5UA 1JKHA 3LAKA 4CJKA 4JEPA 1ZC6A 2PYLA 4M3YA 3P5JA 3NVMA 5AQOA 3PO4A 3ENBA 4E1NA 2UUAK 2DPNA 3T1YK 5BRHA 3QBXA 1KLNA 5AZIB 4E89A 1GLEG 4DFMA 4CFCA 4HCCA 5HROA 3LPTA 1U2VA 1GLCG 2WUSA 4CK1A 3I8DA 3CC2N 3BF3A 1QQMA 2IS3A 5CR4A 1BI4A 2P9PB 4CGDA 4B8AB 1WSJA 3L3UA 1C0GA 4BY9C 4BACA 1QVGM 1JLGA 1SAZA 4DTNA 4JD2A 4LH4A 4CGIA 5KQ8A 3CQ8A 3QBWA 4ISEA 3O3FA 2UXCK 3UKUA 4PKHA 1DKGD 3H08A 3VETA 2ZM6K 3UKRA 3EY1A 3SLCA 3ITHA 4OPJA 4OKEA 3BP8A 4WQ4A 2EWSA 2ZE2A 1RT3A 1T6DA 3UIQA 3SQ4A 3U9ZA 3O80A 5J2MA 4DV2K 2F96A 3VTIA 5AZIA 4LH5A 3ZT1A 4X65K 3KK1A 3OW2M 5C24A 3OYBA 1SKRA 4LFCK 3CMAN 3ULDA 4Z4EA 1W2BM 3ENOA 3DXKB 3EKSA 1CLQA 1NM1A 1L3TA 1KC8O 5AQVA 3OYHA 3NAEA 2CGLA 4G1QA 5AQZA 4X62K 3AVAA 4C1NI 4KHNA 4KHSA 1QQNA 1VQNN 3G71N 1NGAA 4CGGA 5A2QO 4NLBA 2P5GA 3D2EB 4X66K 1MU2A 4DFPA 1U04A 3L4QA 1T3VA 4BREA 4CE9A 3OVNA 1BIZA 1C1BA 4AHTA 3P83D 1A5WA 2GEMA 3V1QA 5LJWA 4DLEA 4GMJB 1ILYA 4YHHK 3QEIA 4CJWA 2G8HA 4XEIA 4BRLA 4N47A 1MDUB 1DGKN 3EE8A 1RFQA 3BGRA 4XH4A 3SV3A 1K73O 2FF6A 3TARA 2YJFA 3SYZA 4OPAA 3D6RA 3TI0A 1KAZA 2QWQA 4DR2K 3ZT4A 4DTPA 4ELVA 3DXKA 5J2QA 4GKJK 3LALA 3I0SA 2Q2RA 3LWLA 4B1VA 4CK2A 4C8OA 4DUZK 4Y1CA 1SKWA 4NCBA 2D0CA 3KK3A 5BPMA 1GLAG 3EL2A 2KQ2A 3G4SN 1NJXA 1S6PA 2NRZA 4QS9A 4E7KA 4A5BA 4DQSA 4IDHA 1NJIO 5HLFA 4YDUA 4ID1A 1S5JA 3D2EA 1U48A 3CM5A 4IO8A 5HL7L 1ZXOA 3KLEA 3UE5A 4F4KA 3J80O 3U9DA 1DTQA 3H3NO 3SPYA 1XHZA 3PUFA 2RE2A 1YTUA 1EP4A 1T44A 2BUPA 1Q8IA 5ADXA 2HBMA 2ITMA 4EZ6A 1NG9A 3T7ZA 4CF2A 3U3YA 1DT9A 3LM2A 4AM6A 1OH7A 2V52B 2O8EB 3KVGA 4H5NA 1S9EA 3R3LA 2HVHA 1IG8A 4IXCA 3ZSYA 3KJVA 3QNOA 4FLWA 2VG7A 5HBMA 3ATUA 3DRSA 3QO9A 4CK3A 3VQPA 1W97L 4ILHA 3PLAA 2YNFA 3S41A 2F4VK 1TKXA 4HWIA 3DRPA 4JHDA 4KHYA 1HPZA 3QEPA 4BWMA 3AO5A 3PO5A 1XC3A 1JCEA 1SKSA 3SMPA 2E2NA 4B1ZA 4CJUA 4CJQA 4BE1A 1OH5A 5HP1A 4JKCA 4LF6K 4OKKA 1HNVA 3I33A 3E9LA 4HVJA 4B9UA 1B9DA 1TGOA 2Q1NA 2ATQA 4CGJA 3C94A 3THYB 1S3XA 3K2PA 5HRSA 5CHIA 4NXNK 1XNQK 1IV0A 4QAGA 1S22A 3VESA 3A8YA 3WNHA 4FM1A 5BN8A 3CCMN 4DQQA 3N4PA 4CJPA 5JS2A 3HO1A 5DMRA 2HSTA 3NH2A 3WXJA 1HKBA 4FZYA 4IG0A 1YITN 2P9LB 3WNGA 3L2VA 4KHQA 1BQMA 1HRHA 2P9UB 4OPHA 4B1YB 1HQUA 4I2QA 1OKJA 5E41A 4BRGA 3J7ZO 4CZEA 5C42A 3H45C 4JKGA 3WUHA 3ZSVA 2A42A 1U45A 1Q9XA 1JXBA 1QHTA 4M42A 1HYVA 1TUUA 3OS2A 2A5XA 4J2AA 3VQCA 4B1UB 1T03A 4B9QA 3NFAA 3RWUA 3HK2A 1BCMA 3KLGA 2WFBA 5BR9A 4BRCA 4Y1DA 3HOTA 4FO0A 3GBTA 3ZX0A 1IBLK 3THXB 4DU1A 4MLHA 4O5BA 3AVCA 1VSIA 4G9ZA 4LF7K 3VGLA 4H4MA 4BC5A 1J54A 3THYA 5FDLA 4C1NK 2UYTA 4LY7A 4KH5A 4DV7K 4AILC 2QKBA 3FE1A 1ASWA 3VTHA 1LV5A 2O8FB 2P5OA 2YJEA 4RW7A 2W42A 1KAYA 4DSKA 1SV5A 2HHQA 4GVEA 1ZBUA 4CERA 3WT0A 4FWRA 1X9SA 4GKKK 3OA9A 2KZMA 3L2RA 4TSXA 4OO1J 5JS1A 2P9SB 5LMUK 3V81A 1T8EA 2YI1A 3QFUA 5C2DA 3DLKA 4KH4A 2P9UA 3SUPA 1NGJA 4F3TA 1VQON 4CI6A 3GL1A 2HMPA 3C65A 2O8DB 4B9TA 3LDPA 1LWCA 3BZKA 4I9LA 5KI6A 4DU4A 2P51A 3MXJA 3VQ8A 5FPDA 2Q0RA 5AFUH 5SZTA 1QSSA 2OZMA 3VQ4A 3QEXA 4FK0A 3H3OB 4MDBA 4J2DA 1ASUA 4ID5A 3QFPA 4DTXA 4B9LA 4CD1A 1SZ2A 3HT3A 1Z26A 4IG3A 3VEOA 3PIOL 4RTFD 1M1KO 4ILJA 1CZ9A 4CHQA 2E4LA 2J4RA 1T05A 1JXEA 1WLJA 1HX1A 1RT5A 4HUEA 4CCHA 1HKCA 4DTMA 1W0HA 1TAUA 1XUPO 1L3UA 1XMOK 2O8FA 2P9KB 4BR5A 1BIUA 5FPEA 3ZCMA 4QS7A 3DYAA 2P9SA 1HNXK 2X6NA 4DQIA 5GAEP 5HOOA 2AJQA 5IT9O 4FJIA 1XWLA 3ZEUB 4B08A 3E1YA 3RTVA 2O8DA 3I56N 5JVHL 4BDYA 3TAFA 3SNNA 4A62A 1HJOA 3AY9A 4BRFA 4PY5A 4CZKA 2QEXN 1N32K 3AVMA 3LDOA 4LF4K 2DY4A 3EEQA 3H6EA 4RG8A 1JLBA 1HPMA 4C23A 4KTQA 1WAJA 5AQUA 1JLAA 2UUBK 4IKFA 1NK7A 3CCUN 4OGEA 5JVGL 4BDZA 2FXUA 3VEVA 4CHNA 2LSNA 2CGKA 3RMBA 1EQYA 1BG3A 3KWGA 3T19A 1B9FA 2OANA 2WOMA 4ZTJA 4KB1A 4PKIA 3HP6A 3DOLA 3E9OA 4FWKA 3V9WA 2BH1A 2P9KA 1OH8A 3JSMA 3SCXA 3O1WA 3WNFA 5EY4A 4O4GA 4FJ8A 1JLQA 3HBTA 3O9QA 1RDAA 3AO4A 4FJXA 1BQNA 4Z4FA 2ITGA 4H0VB 4BG9A 3DMJA 1RDDA 3CCVN 4FM0A 4H0TB 4Z94A 3TANA 3DLLL 2W40A 4LC9B 5CYMA 3ASMA 5JLHA 1J53A 3CPWM 1NNEA 3S3OA 5CZ2A 4YOTA 3HL8A 5T7BA 1QSYA 4KI4A 3HSCA 1TVRA 1GLLO 1JCFA 1SL1A 3OBWA 4CEBA 3NE6A 4CZFA 2BDPA 1SQKA 3SBTA 3V9UA 3NGYA 3HM8A 2QWNA 3TSPA 4BVPA 4B3SK 4H03B 3OHRA 4PWDA 4Q0BA 3CQYA 4AQYK 1NJYA 5B8HA 2XY8A 5CY4A 4WQ5C 3VA0A 3KWIA 3AVJA 1ATNA 2P9IB 1YT3A 2A1RA 1VAZA 3AVHA 3LL3A 4DV4K 3SBGA 1GOBA 2ZWHA 4YORA 1EO1A 3RSEB 2KFZA 3NBPA 1LAVA 2FBYA 2EX3A 3DI6A 4J2EA 3VEXA 3P38A 4CJRA 3V9XA 5ELZA 5I9EB 4DFJA 3CJ7A 2KTQA 4CZGA 1BCOA 3ZX2A 3OYGA 3O4QA 4HUGA 1NK0A 3O4NA 1G15A 3V1RA 3O3GA 4IJNA 3K9JA 1QTMA 2IIRA 3SK3A 4M3UA 1XNRK 3SPZA 2YCHA 3QESA 1LOTB 1TL3A 1KFSA 3V6DA 4BR2A 1OVQA 4FJ5A 1VQ9N 4A5AA 4CF9A 5AQGA 1HQEA 2PYJA 5EU7A 2DTUA 1TAQA 1Q9YA 2E6LA 4MDAA 2P9IA 4Z4IA 5D3GA 2XY6A 3TAMA 1WSHA 1IKVA 3OYCA 4RW4A 3EYZA 2ASMA 4KTZA 3DRRA 1Z6RA 4OX9K 1LWFA 3RSEA 5M1KA 3QEWA 3WXMB 1WAFA 2P1JA 3T3FA 5AJ3K 4RW9A 2YKNA 1HMVA 2E2PA 3ZSOA 1VRTA 5CE3A 2I5JA 3OY9A 2EHGA 2NLXA 3QEVA 4NYFA 4DMNA 4FLYA 1IKXA 1UA0A 3M3ZA 4AHVA 4H5VA 4DHYA 4K43A 3CCEN 4CJ7A 3CCQN 2ASOA 4AHSA 4JI5K 4BC2A 2PAVA 1RTIA 3CHWA 4H8KA 2QWPA 2ZD1A 3C6HA 1ESVA 2FBVA 3ULEA 2ZJQL 4W5TA 2QKKA 2YHAA 4CFAA 4ILGB 2HHSA 1NK6A 2QWOA 5KPZA 1BHLA 1F21A 4M45A 3D0PA 4WQ4C 2HBLA 2Z1HA 2HB5A 1T7PA 2WONA 3KD1E 2ZGZA 4CBXA 4FJ7A 3MWPA 3IAYA 1VHXA 3LDQA 3R9PA 3MXIA 2PZSA 1NGCA 2HF4A 1KCFA 2VWJA 3NMUA 3HSTB 1J5EK 1D9DA 2G8FA 2BGGA 3CJ9A 2ZJPL 2AP1A 1BA0A 2OPQA 3ZSWA 2P9NB 4N5SA 1E3MA 1DLOA 1CXQA 4JAXA 3SUNA 4DTOA 4JN4A 3KTQA 3VN5A 2P9PA 1NJZA 4FWOA 4Z4CA 4NCAA 3WXIA 1YF5L 2BE2A 4KFBA 1VQ7N 4BR4A 3B6OA 1CZBA 5C12A 2HVIA 2OTLN 4N76A 1QQCA 4M7XA 3TTFA 3CCSN 3RMAA 2BANA 4BVOA 2HBJA 1NLVA 1YIJN 1S72N 3DLRA 1REVA 3VPZA 1RT2A 3L4IA 2ETJA 4EP5A 3OYIA 3CD6N 3HXMA 4F9OA 2Y1JA 1RTHA 4J2BA 3P39A 3DAWA 2HHUA 2F7TA 4WFNL 2KHOA 3Q7CA 3CJAA 3ZSZA 4GVMA 4CHYA 5M1NA 4WF9L 2VCPA 3PX0A 1K9MO 4FWMA 4FPAA 4BR9A 2E2OA 3OS0A 2G8VA 4MLEA 3DJCA 4GY2B 2NUBA 1TK5A 3OYNA 1CZAN 3EN9A 4JI4K 3HOSA 1A5VA 2VQFK 4FVMA 5GIOA 1VQKN 2P9NA 3L3VA 1WN7A 3L2UA 3TWHA 1NBWA 5F2RA 4C8MA 2W6LA 3VQEA 3S3MA 4W5OA 4K41A 1RTDA 4FLVA 3MDQA 4MQ3A 4CHOA
chains in the Genus database with same CATH topology
2PY5A 1UA1A 3NFAA 3RWUA 4XIUA 3K59A 4CIFA 2IDOA 4O55A 3HK2A 1BCMA 3KLGA 3MXMA 4Y1DA 1NKEA 3RRGA 4DSIA 3OYFA 1VSKA 2QXFA 1KSPA 3ZT3A 4KPYA 4DU1A 1ITGA 4O5BA 4Z0UA 5KTQA 3AVCA 1VSIA 1KVBA 2FBTA 3AVIA 1FKOA 1S1XA 4OVLA 4H4MA 2XY7A 2GBZA 1VSFA 3NGIA 1J54A 3C6TA 3NH0A 5FDLA 4KKOA 4M41A 3VA3A 4B9MA 4LY7A 4FW1A 4CJ3A 3OYAA 1LW2A 2XRIA 3IG1A 4AILC 1ASWA 1WSIA 5KRTA 1LV5A 4CFDA 2QKBA 4CESA 1JL2A 1KVCA 2P5OA 3K5MA 4RW7A 2W42A 4BE0A 4DSKA 1SV5A 2HHQA 1ZBUA 4CERA 1ASVA 1FXXA 4E7HA 4QOZB 1IH7A 4DWIA 1X9SA 2KZMA 3L2RA 4TSXA 4I7FA 3THVA 4K8ZA 3LDSA 1L3SA 4FZZA 5JS1A 4JRQA 3V81A 1BISA 3SUOA 1GOAA 1T8EA 2O4IA 1YTAA 1C0TA 3DLKA 1JLFA 3SUPA 4F3TA 3K5NA 5CYQA 1RT6A 4DF4A 4FJMA 3QINA 4KREA 3L2QA 4Z4HA 4KB0A 2HHTA 4LSNA 4PA1A 4B9TA 1ZBIA 4FJNA 1LWCA 3C95A 4I9LA 2OYQA 1S6QA 5KI6A 1HNIA 2Q3SA 4FW2A 4KO0A 4DSLA 3C6UA 4FZXC 3MEGA 4DU4A 2P51A 3MXJA 1RT7A 3VQ8A 1SL0A 3RRHA 3AA4A 4RW6A 4N56A 3OYLA 4CJSA 5SZTA 3K58A 1FKPA 1TKZA 3VQ7A 1QSSA 4KAZA 2OZMA 4M3RA 3VQ4A 3QEXA 4FK0A 4CF8A 3HPOA 1SL2A 4J2DA 1ASUA 4ID5A 3V9SA 4DTXA 4B9LA 4FLXA 1TKTA 4M3WA 2KFNA 4CGHA 3QIPA 4CF1A 3HT3A 1Z26A 3KK2A 4IG3A 1EKEA 3ZSRA 1UAXA 4OGCA 3CG7A 1CZ9A 1I3AA 4CHQA 2RKIA 3PX4A 3NGZA 2E4LA 4ZHRA 1T05A 5I3UA 1JXEA 2D0BA 1WLJA 1WSEA 3RMDA 1RT5A 1N5YA 4CFBA 4HUEA 4CCHA 1VSJA 1N6QA 2G8UA 4ICLA 5KGXA 4FLUA 4DTMA 5C25A 5J2PA 3S3NA 1W0HA 1TAUA 3U3GA 1L3UA 3NF6A 2XY5A 3M8RA 2DFEA 4YNQA 4NYNA 1BIUA 4BDPA 3ISNC 2GV9A 1S1VA 3SUQA 1U47A 1VK0A 1S1WA 4CIEA 3KLIA 3ZCMA 3DYAA 4E3SA 1R0AA 4BWJA 1KFDA 3OYMA 3QETA 4CEOA 2X6NA 4DQIA 1EXQA 2OZSA 3CYMA 3QIOA 5CZ1A 3OJUA 3QNNA 2AJQA 4FJIA 1XWLA 4DTSA 4Q5VA 1W9HA 4B08A 1IKYA 4DSFA 4CJLA 4E19A 3L8BA 3LPUA 3RTVA 2X74A 3LAMA 1BI4B 1S1TA 2HNZA 2OPSA 3KKRA 1LWEA 3HVRA 1KRPA 4BDYA 4OPKA 1WSFA 3SI6A 3VQBA 3OS1A 2OA8A 4JS5A 4CJFA 1EX4A 1HYZA 1XHXA 3V9ZA 3TAFA 2IAJA 3SNNA 1NK8A 3KLHA 4C8LA 4KRFA 1ZYQA 1U4BA 2IOCA 4EP4A 3DLGA 3OYDA 4PY5A 4JS4A 1C0UA 4FCYA 1B92A 3AVMA 3HPGA 4AHUA 1K6YA 2DY4A 4I2PA 4RG8A 1JLBA 1KTQA 2VG5A 4CEFA 4F2RA 1WAJA 1J5OA 1VSMA 4KTQA 2B5JA 4AH9A 2A1SA 1JLAA 1UWBA 4IKFA 1NK7A 4OKJA 4ZTFA 2KZZA 4UQGA 3AO2A 1VSDA 4DQRA 4OGEA 4LD0A 1WSGA 4BDZA 1RT4A 4CHNA 2LSNA 3RMBA 3NDKA 3T19A 1B9FA 3K5LA 1L5UA 1JKHA 5FRNA 2WOMA 3LAKA 4CJKA 4ZTJA 4KB1A 2PYLA 4DSEA 3HP6A 4R5PA 3DOLA 1TK8A 4M3YA 3P5JA 3AA5X 3VQAA 4CGFA 4CHPA 3V9WA 5FRMA 3PO4A 2HNDA 4JLHA 2YV0X 4E1NA 3JSMA 2RN2A 3OJSA 3SCXA 3WNFA 4Z4GA 1KLNA 1RTJA 2XHBA 4E89A 4O4GA 4FJ8A 2D5RA 1JLQA 3AVLA 3O3HA 4DFMA 1RDAA 3AO4A 4E7IA 4FJXA 1BQNA 4Z4FA 2ITGA 4CFCA 4CEQA 4HCCA 2QK9A 3DMJA 1NOZA 5HROA 3LPTA 1RDDA 3NH1A 3KIOA 4FM0A 1JLCA 3TANA 3B6PA 4CK1A 4E7LA 1ZBFA 3I8DA 5HRPA 2R7YA 2IGIA 1C0MA 5CYMA 3ASMA 3SQ0A 5HRNA 3DM2A 4M3TA 2IS3A 4B3OA 1BI4A 4CGDA 1J53A 3CFPA 3PV8A 4B8AB 1WSJA 3MECA 3F73A 3S3OA 5CZ2A 3HL8A 5T7BA 4FM2A 3VQQA 3FFIA 3L3UA 1QSYA 3AO3A 1GOCA 4BACA 1D8YA 1D9FA 1RDBA 1JLGA 4FJGA 4KI4A 1TVRA 4DTNA 3LANA 4IFVA 4IDKA 4LH4A 2YNGA 2FBXA 4CGIA 1NK5A 1SL1A 4CEBA 3NE6A 3CQ8A 2ZQBA 5HRRA 3TAGA 2G8KA 2BDPA 3V9UA 1RT1A 3G0ZA 2HHVA 5KRSA 1I39A 1S1UA 3NGYA 2JLEA 3K5OA 5KGWA 3O3FA 1TL1A 2X6SA 3PX6A 3S9HA 2XO7A 1RNHA 4PWDA 5J2NA 4Q0BA 1HJRA 4HTUA 3H08A 3EZ5A 3PY8A 3AVFA 2JGUA 3EY1A 1XC9A 1NJYA 3ITHA 4OPJA 2XY8A 4OKEA 4CJVA 5CY4A 4DTRA 1D5AA 1SUQA 3ZT2A 2B6AA 2ZE2A 3AV9A 4JRPA 4MFBA 1RT3A 1TK0A 3D45A 3VA0A 1CXUA 3UIQA 1HYSA 3AVJA 4DG1A 1X1PA 3SQ4A 1J9AA 3SQ2A 3JYTA 5J2MA 3TAEA 2OPRA 2O4GA 4OLBA 2F96A 2VG6A 1YT3A 1KLMA 1BL3A 2A1RA 4B9VA 4LH5A 3ZT1A 3AVHA 3KK1A 4B9NA 5C24A 3NF9A 3IRXA 3OYBA 4CJTA 3RMCA 1GOBA 3TAQA 1SKRA 4F8RA 1JL1A 3ULDA 4Z4EA 4DS4A 2KFZA 4CJ5A 2HMIA 4DQPA 3NBPA 4F2SA 1UOCA 1CLQA 4CF0A 3OYEA 3HM9A 1LAVA 2FBYA 3DOKA 2EX3A 1L3TA 4DSJA 4FK4A 3DI6A 4BE2A 3OYHA 5J1EA 3NAEA 4J2EA 4G1QA 4O44A 4W5NA 1RDCA 4CJRA 3SJJA 3V9XA 1QE1A 3AVAA 2G8WA 3MEDA 2G8IA 2HNYA 1RILA 4CEZA 4DFJA 4DTUA 4KHNA 4FJ9A 4KHSA 2KTQA 1XI1A 1VSEA 3KLFA 4ELTA 1BCOA 4OJRA 4WE1A 3KKSA 3O4QA 4CGGA 4CJ4A 3OYGA 4HUGA 2P5GA 1NK0A 1EETA 3O4NA 1G15A 3V1RA 3O3GA 1NJWA 1MU2A 3VQ6A 4B8CA 3L2WA 3DLHA 1VSLA 3M8PA 4DFPA 1QTMA 1U04A 5I42A 4NCGA 4CE9A 4M3UA 1U49A 2HHXA 4B9SA 3OVNA 3SPZA 1BIZA 2RPIA 4ELUA 3K57A 2YKMA 3QESA 4PQUA 1C1BA 3NCIA 4PUOA 1TL3A 3MAQA 1KVAA 3P1GA 3V6DA 4AHTA 3P83D 1NKBA 4DFKA 1KFSA 1A5WA 4FJ5A 3V1QA 4CF9A 2PYJA 1HQEA 1VSHA 4DLEA 4DU3A 4GMJB 5EU7A 4W5RA 2DTUA 1TAQA 1S9GA 1ZBHA 4FLTA 3QEIA 4CJWA 1Q9YA 2E6LA 3ZSQA 1X9MA 1QSLA 2G8HA 3IS9A 4N47A 3SV4A 3ZT0A 4KHWA 4FK2A 3RR7A 3BGRA 4Z4IA 3SV3A 3SZ2A 4DF8A 3TARA 3HPHA 5D3GA 3LZIA 2XY6A 2B4JA 3TAMA 4CHZA 1WSHA 3LZJA 3SYZA 3OYJA 1IKVA 3OYCA 3KD5E 4RW4A 3EYZA 4L8RB 3AO1A 5FROA 3TI0A 1C1AA 3DRRA 4KTZA 4W5QA 3ZT4A 4IBNA 1LWFA 4C8NA 4DTPA 4ELVA 4FJJA 3QEWA 2Y1IA 1WAFA 2P1JA 3T3FA 2HHWA 1DTTA 5J2QA 3HP9A 3LALA 3AVBA 3I0SA 2VWKA 2YNIA 4RW9A 3LWLA 4HUFA 2YKNA 4CK2A 4C8OA 4Y1CA 2E6MA 3AVGA 1SKWA 1C1CA 1HMVA 4YFUA 4F3OA 4NCBA 2D0CA 2Z1JA 4M3ZA 3ZSOA 3KK3A 1NOYA 4I9QA 2KQ2A 1NJXA 1S6PA 3I0RA 1VRTA 4E7KA 4DQSA 2I5JA 3OY9A 2EHGA 1L3VA 3QEVA 5HLFA 4NYFA 4ID1A 1RBRA 1S5JA 4DMNA 4FLYA 1IKXA 4KV8A 1U48A 4QCLA 3CM5A 1UA0A 4FYDA 1Y97A 1RBTA 3CFRA 1IO2A 1RBVA 3LP1A 4O0IA 4AHVA 3KLEA 1C6VA 4F4KA 4AHSA 4K8XA 3DLEA 3LP2A 3NF7A 3LWMA 1RTIA 5DK5A 1VRUA 4H8KA 2ZD1A 2FBVA 1DTQA 4DLGA 4W5TA 1NK9A 3SPYA 2YHAA 4CFAA 1XHZA 3HYFA 2Z1GA 2QKKA 2HHSA 1NK6A 3DLBA 1TV6A 3PUFA 4O0JA 1BHLA 1F21A 1EP4A 1FK9A 3NF8A 4M45A 3D0PA 1YTUA 2Z1HA 1Q8IA 1QS4A 4E7JA 2HW3A 2HB5A 1T7PA 4EZ6A 3LP3A 1NKCA 4CF2A 2WONA 4AHRA 4CJEA 3U3YA 3V4IA 3KD1E 2RF2A 3QLHA 3T1AA 3QERA 3BDPA 4FJ7A 1IKWA 3IAYA 2GUIA 4E1MA 1X9WA 4DTJA 3NHGA 4EZ9A 3MXIA 3AVNA 3E01A 4CEEA 2PZSA 3M8SA 1JLEA 1S9EA 1KCFA 2VWJA 2HVHA 4FLZA 3AVKA 3HSTB 3ZSYA 4CEAA 3KJVA 3QNOA 1D9DA 1RBUA 4IFYA 2IC3A 4H4OA 2FC0A 3V1OA 4FLWA 2KW4A 2G8FA 2BGGA 3G10A 1TKDA 2VG7A 1NK4A 5HBMA 3ALYA 4CECA 3DRSA 3QO9A 2OPQA 4CK3A 3VQPA 3ZSWA 3TAPA 4N5SA 1DLOA 2YNFA 4GW6A 2DFFA 4J2AA 1CXQA 1TKXA 3AA3A 4C8KA 3DRPA 3SUNA 4FXDA 4DTOA 2Z1IA 3KTQA 1HPZA 3ZSXA 3VN5A 4FJLA 3MEEA 2YHBA 3F9KA 4KHYA 2DFHA 3QEPA 4BWMA 3AO5A 3PO5A 1NJZA 1SKSA 1YVUA 4HCBA 4Z4CA 4CJUA 4NCAA 3M8QA 4M3XA 4CJQA 4BE1A 2BE2A 4KFBA 5HP1A 4LSLA 3B6OA 1CZBA 4CEDA 2HVIA 3OYKA 4OKKA 4HHTA 3TABA 4N76A 1QQCA 3VQ5A 1HNVA 2X78A 3RMAA 2BANA 3DLRA 1REVA 1RT2A 2ETJA 1O1WA 1Z25A 4HVJA 4EP5A 3OYIA 4B9UA 1B9DA 1TGOA 3RR8A 2ATQA 3HXMA 3A2FA 3C94A 4CGJA 2Y1JA 1LW0A 1RTHA 3HVTA 4J2BA 2F8TA 3WNEA 2HHUA 3K2PA 5HRSA 4QAGA 2F8SA 3ZSZA 4GVMA 4CHYA 2D0AA 3TR8A 1WNSA 3WNHA 3CM6A 3LP0A 4FM1A 3PX0A 1BGXT 4DQQA 1ZBLA 1RCHA 3VQ9A 3HJFA 4CJPA 2OPPA 1LAWA 5JS2A 5DMRA 3HO1A 2YNHA 3OS0A 2G8VA 3NH2A 4KTWA 3VQDA 4FZYA 1RBSA 2NUBA 4IG0A 4DS5A 3SQ1A 3WNGA 1TK5A 1A5XA 5SWMA 3CFOA 3L2VA 3OYNA 4KHQA 1BQMA 1HRHA 4AHCA 5K14A 4RW8A 1A5VA 1HQUA 4I2QA 4FVMA 5E41A 3L3VA 4N41A 4CIGA 4E0DA 1IG9A 1WN7A 4KHUA 3L2UA 3TWHA 5C42A 1U45A 3ZSVA 4C8MA 1Q9XA 4KI6A 1JXBA 1QHTA 4M42A 1HYVA 4FJHA 3VQEA 3OS2A 3S3MA 4W5OA 1RTDA 4FLVA 3AA2A 4MQ3A 4FJKA 4CHOA 3U6FA 3VQCA 1T03A 4OLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PY5 A;  1UA1 A;  3NFA A;  3RWU A;  4XIU A;  3K59 A;  4CIF A;  2IDO A;  4O55 A;  3HK2 A;  1BCM A;  3KLG A;  3MXM A;  4Y1D A;  1NKE A;  3RRG A;  4DSI A;  3OYF A;  1VSK A;  2QXF A;  1KSP A;  3ZT3 A;  4KPY A;  4DU1 A;  1ITG A;  4O5B A;  4Z0U A;  5KTQ A;  3AVC A;  1VSI A;  1KVB A;  2FBT A;  3AVI A;  1FKO A;  1S1X A;  4OVL A;  4H4M A;  2XY7 A;  2GBZ A;  1VSF A;  3NGI A;  1J54 A;  3C6T A;  3NH0 A;  5FDL A;  4KKO A;  4M41 A;  3VA3 A;  4B9M A;  4LY7 A;  4FW1 A;  4CJ3 A;  3OYA A;  1LW2 A;  2XRI A;  3IG1 A;  4AIL C;  1ASW A;  1WSI A;  5KRT A;  1LV5 A;  4CFD A;  2QKB A;  4CES A;  1JL2 A;  1KVC A;  2P5O A;  3K5M A;  4RW7 A;  2W42 A;  4BE0 A;  4DSK A;  1SV5 A;  2HHQ A;  1ZBU A;  4CER A;  1ASV A;  1FXX A;  4E7H A;  4QOZ B;  1IH7 A;  4DWI A;  1X9S A;  2KZM A;  3L2R A;  4TSX A;  4I7F A;  3THV A;  4K8Z A;  3LDS A;  1L3S A;  4FZZ A;  5JS1 A;  4JRQ A;  3V81 A;  1BIS A;  3SUO A;  1GOA A;  1T8E A;  2O4I A;  1YTA A;  1C0T A;  3DLK A;  1JLF A;  3SUP A;  4F3T A;  3K5N A;  5CYQ A;  1RT6 A;  4DF4 A;  4FJM A;  3QIN A;  4KRE A;  3L2Q A;  4Z4H A;  4KB0 A;  2HHT A;  4LSN A;  4PA1 A;  4B9T A;  1ZBI A;  4FJN A;  1LWC A;  3C95 A;  4I9L A;  2OYQ A;  1S6Q A;  5KI6 A;  1HNI A;  2Q3S A;  4FW2 A;  4KO0 A;  4DSL A;  3C6U A;  4FZX C;  3MEG A;  4DU4 A;  2P51 A;  3MXJ A;  1RT7 A;  3VQ8 A;  1SL0 A;  3RRH A;  3AA4 A;  4RW6 A;  4N56 A;  3OYL A;  4CJS A;  5SZT A;  3K58 A;  1FKP A;  1TKZ A;  3VQ7 A;  1QSS A;  4KAZ A;  2OZM A;  4M3R A;  3VQ4 A;  3QEX A;  4FK0 A;  4CF8 A;  3HPO A;  1SL2 A;  4J2D A;  1ASU A;  4ID5 A;  3V9S A;  4DTX A;  4B9L A;  4FLX A;  1TKT A;  4M3W A;  2KFN A;  4CGH A;  3QIP A;  4CF1 A;  3HT3 A;  1Z26 A;  3KK2 A;  4IG3 A;  1EKE A;  3ZSR A;  1UAX A;  4OGC A;  3CG7 A;  1CZ9 A;  1I3A A;  4CHQ A;  2RKI A;  3PX4 A;  3NGZ A;  2E4L A;  4ZHR A;  1T05 A;  5I3U A;  1JXE A;  2D0B A;  1WLJ A;  1WSE A;  3RMD A;  1RT5 A;  1N5Y A;  4CFB A;  4HUE A;  4CCH A;  1VSJ A;  1N6Q A;  2G8U A;  4ICL A;  5KGX A;  4FLU A;  4DTM A;  5C25 A;  5J2P A;  3S3N A;  1W0H A;  1TAU A;  3U3G A;  1L3U A;  3NF6 A;  2XY5 A;  3M8R A;  2DFE A;  4YNQ A;  4NYN A;  1BIU A;  4BDP A;  3ISN C;  2GV9 A;  1S1V A;  3SUQ A;  1U47 A;  1VK0 A;  1S1W A;  4CIE A;  3KLI A;  3ZCM A;  3DYA A;  4E3S A;  1R0A A;  4BWJ A;  1KFD A;  3OYM A;  3QET A;  4CEO A;  2X6N A;  4DQI A;  1EXQ A;  2OZS A;  3CYM A;  3QIO A;  5CZ1 A;  3OJU A;  3QNN A;  2AJQ A;  4FJI A;  1XWL A;  4DTS A;  4Q5V A;  1W9H A;  4B08 A;  1IKY A;  4DSF A;  4CJL A;  4E19 A;  3L8B A;  3LPU A;  3RTV A;  2X74 A;  3LAM A;  1BI4 B;  1S1T A;  2HNZ A;  2OPS A;  3KKR A;  1LWE A;  3HVR A;  1KRP A;  4BDY A;  4OPK A;  1WSF A;  3SI6 A;  3VQB A;  3OS1 A;  2OA8 A;  4JS5 A;  4CJF A;  1EX4 A;  1HYZ A;  1XHX A;  3V9Z A;  3TAF A;  2IAJ A;  3SNN A;  1NK8 A;  3KLH A;  4C8L A;  4KRF A;  1ZYQ A;  1U4B A;  2IOC A;  4EP4 A;  3DLG A;  3OYD A;  4PY5 A;  4JS4 A;  1C0U A;  4FCY A;  1B92 A;  3AVM A;  3HPG A;  4AHU A;  1K6Y A;  2DY4 A;  4I2P A;  4RG8 A;  1JLB A;  1KTQ A;  2VG5 A;  4CEF A;  4F2R A;  1WAJ A;  1J5O A;  1VSM A;  4KTQ A;  2B5J A;  4AH9 A;  2A1S A;  1JLA A;  1UWB A;  4IKF A;  1NK7 A;  4OKJ A;  4ZTF A;  2KZZ A;  4UQG A;  3AO2 A;  1VSD A;  4DQR A;  4OGE A;  4LD0 A;  1WSG A;  4BDZ A;  1RT4 A;  4CHN A;  2LSN A;  3RMB A;  3NDK A;  3T19 A;  1B9F A;  3K5L A;  1L5U A;  1JKH A;  5FRN A;  2WOM A;  3LAK A;  4CJK A;  4ZTJ A;  4KB1 A;  2PYL A;  4DSE A;  3HP6 A;  4R5P A;  3DOL A;  1TK8 A;  4M3Y A;  3P5J A;  3AA5 X;  3VQA A;  4CGF A;  4CHP A;  3V9W A;  5FRM A;  3PO4 A;  2HND A;  4JLH A;  2YV0 X;  4E1N A;  3JSM A;  2RN2 A;  3OJS A;  3SCX A;  3WNF A;  4Z4G A;  1KLN A;  1RTJ A;  2XHB A;  4E89 A;  4O4G A;  4FJ8 A;  2D5R A;  1JLQ A;  3AVL A;  3O3H A;  4DFM A;  1RDA A;  3AO4 A;  4E7I A;  4FJX A;  1BQN A;  4Z4F A;  2ITG A;  4CFC A;  4CEQ A;  4HCC A;  2QK9 A;  3DMJ A;  1NOZ A;  5HRO A;  3LPT A;  1RDD A;  3NH1 A;  3KIO A;  4FM0 A;  1JLC A;  3TAN A;  3B6P A;  4CK1 A;  4E7L A;  1ZBF A;  3I8D A;  5HRP A;  2R7Y A;  2IGI A;  1C0M A;  5CYM A;  3ASM A;  3SQ0 A;  5HRN A;  3DM2 A;  4M3T A;  2IS3 A;  4B3O A;  1BI4 A;  4CGD A;  1J53 A;  3CFP A;  3PV8 A;  4B8A B;  1WSJ A;  3MEC A;  3F73 A;  3S3O A;  5CZ2 A;  3HL8 A;  5T7B A;  4FM2 A;  3VQQ A;  3FFI A;  3L3U A;  1QSY A;  3AO3 A;  1GOC A;  4BAC A;  1D8Y A;  1D9F A;  1RDB A;  1JLG A;  4FJG A;  4KI4 A;  1TVR A;  4DTN A;  3LAN A;  4IFV A;  4IDK A;  4LH4 A;  2YNG A;  2FBX A;  4CGI A;  1NK5 A;  1SL1 A;  4CEB A;  3NE6 A;  3CQ8 A;  2ZQB A;  5HRR A;  3TAG A;  2G8K A;  2BDP A;  3V9U A;  1RT1 A;  3G0Z A;  2HHV A;  5KRS A;  1I39 A;  1S1U A;  3NGY A;  2JLE A;  3K5O A;  5KGW A;  3O3F A;  1TL1 A;  2X6S A;  3PX6 A;  3S9H A;  2XO7 A;  1RNH A;  4PWD A;  5J2N A;  4Q0B A;  1HJR A;  4HTU A;  3H08 A;  3EZ5 A;  3PY8 A;  3AVF A;  2JGU A;  3EY1 A;  1XC9 A;  1NJY A;  3ITH A;  4OPJ A;  2XY8 A;  4OKE A;  4CJV A;  5CY4 A;  4DTR A;  1D5A A;  1SUQ A;  3ZT2 A;  2B6A A;  2ZE2 A;  3AV9 A;  4JRP A;  4MFB A;  1RT3 A;  1TK0 A;  3D45 A;  3VA0 A;  1CXU A;  3UIQ A;  1HYS A;  3AVJ A;  4DG1 A;  1X1P A;  3SQ4 A;  1J9A A;  3SQ2 A;  3JYT A;  5J2M A;  3TAE A;  2OPR A;  2O4G A;  4OLB A;  2F96 A;  2VG6 A;  1YT3 A;  1KLM A;  1BL3 A;  2A1R A;  4B9V A;  4LH5 A;  3ZT1 A;  3AVH A;  3KK1 A;  4B9N A;  5C24 A;  3NF9 A;  3IRX A;  3OYB A;  4CJT A;  3RMC A;  1GOB A;  3TAQ A;  1SKR A;  4F8R A;  1JL1 A;  3ULD A;  4Z4E A;  4DS4 A;  2KFZ A;  4CJ5 A;  2HMI A;  4DQP A;  3NBP A;  4F2S A;  1UOC A;  1CLQ A;  4CF0 A;  3OYE A;  3HM9 A;  1LAV A;  2FBY A;  3DOK A;  2EX3 A;  1L3T A;  4DSJ A;  4FK4 A;  3DI6 A;  4BE2 A;  3OYH A;  5J1E A;  3NAE A;  4J2E A;  4G1Q A;  4O44 A;  4W5N A;  1RDC A;  4CJR A;  3SJJ A;  3V9X A;  1QE1 A;  3AVA A;  2G8W A;  3MED A;  2G8I A;  2HNY A;  1RIL A;  4CEZ A;  4DFJ A;  4DTU A;  4KHN A;  4FJ9 A;  4KHS A;  2KTQ A;  1XI1 A;  1VSE A;  3KLF A;  4ELT A;  1BCO A;  4OJR A;  4WE1 A;  3KKS A;  3O4Q A;  4CGG A;  4CJ4 A;  3OYG A;  4HUG A;  2P5G A;  1NK0 A;  1EET A;  3O4N A;  1G15 A;  3V1R A;  3O3G A;  1NJW A;  1MU2 A;  3VQ6 A;  4B8C A;  3L2W A;  3DLH A;  1VSL A;  3M8P A;  4DFP A;  1QTM A;  1U04 A;  5I42 A;  4NCG A;  4CE9 A;  4M3U A;  1U49 A;  2HHX A;  4B9S A;  3OVN A;  3SPZ A;  1BIZ A;  2RPI A;  4ELU A;  3K57 A;  2YKM A;  3QES A;  4PQU A;  1C1B A;  3NCI A;  4PUO A;  1TL3 A;  3MAQ A;  1KVA A;  3P1G A;  3V6D A;  4AHT A;  3P83 D;  1NKB A;  4DFK A;  1KFS A;  1A5W A;  4FJ5 A;  3V1Q A;  4CF9 A;  2PYJ A;  1HQE A;  1VSH A;  4DLE A;  4DU3 A;  4GMJ B;  5EU7 A;  4W5R A;  2DTU A;  1TAQ A;  1S9G A;  1ZBH A;  4FLT A;  3QEI A;  4CJW A;  1Q9Y A;  2E6L A;  3ZSQ A;  1X9M A;  1QSL A;  2G8H A;  3IS9 A;  4N47 A;  3SV4 A;  3ZT0 A;  4KHW A;  4FK2 A;  3RR7 A;  3BGR A;  4Z4I A;  3SV3 A;  3SZ2 A;  4DF8 A;  3TAR A;  3HPH A;  5D3G A;  3LZI A;  2XY6 A;  2B4J A;  3TAM A;  4CHZ A;  1WSH A;  3LZJ A;  3SYZ A;  3OYJ A;  1IKV A;  3OYC A;  3KD5 E;  4RW4 A;  3EYZ A;  4L8R B;  3AO1 A;  5FRO A;  3TI0 A;  1C1A A;  3DRR A;  4KTZ A;  4W5Q A;  3ZT4 A;  4IBN A;  1LWF A;  4C8N A;  4DTP A;  4ELV A;  4FJJ A;  3QEW A;  2Y1I A;  1WAF A;  2P1J A;  3T3F A;  2HHW A;  1DTT A;  5J2Q A;  3HP9 A;  3LAL A;  3AVB A;  3I0S A;  2VWK A;  2YNI A;  4RW9 A;  3LWL A;  4HUF A;  2YKN A;  4CK2 A;  4C8O A;  4Y1C A;  2E6M A;  3AVG A;  1SKW A;  1C1C A;  1HMV A;  4YFU A;  4F3O A;  4NCB A;  2D0C A;  2Z1J A;  4M3Z A;  3ZSO A;  3KK3 A;  1NOY A;  4I9Q A;  2KQ2 A;  1NJX A;  1S6P A;  3I0R A;  1VRT A;  4E7K A;  4DQS A;  2I5J A;  3OY9 A;  2EHG A;  1L3V A;  3QEV A;  5HLF A;  4NYF A;  4ID1 A;  1RBR A;  1S5J A;  4DMN A;  4FLY A;  1IKX A;  4KV8 A;  1U48 A;  4QCL A;  3CM5 A;  1UA0 A;  4FYD A;  1Y97 A;  1RBT A;  3CFR A;  1IO2 A;  1RBV A;  3LP1 A;  4O0I A;  4AHV A;  3KLE A;  1C6V A;  4F4K A;  4AHS A;  4K8X A;  3DLE A;  3LP2 A;  3NF7 A;  3LWM A;  1RTI A;  5DK5 A;  1VRU A;  4H8K A;  2ZD1 A;  2FBV A;  1DTQ A;  4DLG A;  4W5T A;  1NK9 A;  3SPY A;  2YHA A;  4CFA A;  1XHZ A;  3HYF A;  2Z1G A;  2QKK A;  2HHS A;  1NK6 A;  3DLB A;  1TV6 A;  3PUF A;  4O0J A;  1BHL A;  1F21 A;  1EP4 A;  1FK9 A;  3NF8 A;  4M45 A;  3D0P A;  1YTU A;  2Z1H A;  1Q8I A;  1QS4 A;  4E7J A;  2HW3 A;  2HB5 A;  1T7P A;  4EZ6 A;  3LP3 A;  1NKC A;  4CF2 A;  2WON A;  4AHR A;  4CJE A;  3U3Y A;  3V4I A;  3KD1 E;  2RF2 A;  3QLH A;  3T1A A;  3QER A;  3BDP A;  4FJ7 A;  1IKW A;  3IAY A;  2GUI A;  4E1M A;  1X9W A;  4DTJ A;  3NHG A;  4EZ9 A;  3MXI A;  3AVN A;  3E01 A;  4CEE A;  2PZS A;  3M8S A;  1JLE A;  1S9E A;  1KCF A;  2VWJ A;  2HVH A;  4FLZ A;  3AVK A;  3HST B;  3ZSY A;  4CEA A;  3KJV A;  3QNO A;  1D9D A;  1RBU A;  4IFY A;  2IC3 A;  4H4O A;  2FC0 A;  3V1O A;  4FLW A;  2KW4 A;  2G8F A;  2BGG A;  3G10 A;  1TKD A;  2VG7 A;  1NK4 A;  5HBM A;  3ALY A;  4CEC A;  3DRS A;  3QO9 A;  2OPQ A;  4CK3 A;  3VQP A;  3ZSW A;  3TAP A;  4N5S A;  1DLO A;  2YNF A;  4GW6 A;  2DFF A;  4J2A A;  1CXQ A;  1TKX A;  3AA3 A;  4C8K A;  3DRP A;  3SUN A;  4FXD A;  4DTO A;  2Z1I A;  3KTQ A;  1HPZ A;  3ZSX A;  3VN5 A;  4FJL A;  3MEE A;  2YHB A;  3F9K A;  4KHY A;  2DFH A;  3QEP A;  4BWM A;  3AO5 A;  3PO5 A;  1NJZ A;  1SKS A;  1YVU A;  4HCB A;  4Z4C A;  4CJU A;  4NCA A;  3M8Q A;  4M3X A;  4CJQ A;  4BE1 A;  2BE2 A;  4KFB A;  5HP1 A;  4LSL A;  3B6O A;  1CZB A;  4CED A;  2HVI A;  3OYK A;  4OKK A;  4HHT A;  3TAB A;  4N76 A;  1QQC A;  3VQ5 A;  1HNV A;  2X78 A;  3RMA A;  2BAN A;  3DLR A;  1REV A;  1RT2 A;  2ETJ A;  1O1W A;  1Z25 A;  4HVJ A;  4EP5 A;  3OYI A;  4B9U A;  1B9D A;  1TGO A;  3RR8 A;  2ATQ A;  3HXM A;  3A2F A;  3C94 A;  4CGJ A;  2Y1J A;  1LW0 A;  1RTH A;  3HVT A;  4J2B A;  2F8T A;  3WNE A;  2HHU A;  3K2P A;  5HRS A;  4QAG A;  2F8S A;  3ZSZ A;  4GVM A;  4CHY A;  2D0A A;  3TR8 A;  1WNS A;  3WNH A;  3CM6 A;  3LP0 A;  4FM1 A;  3PX0 A;  1BGX T;  4DQQ A;  1ZBL A;  1RCH A;  3VQ9 A;  3HJF A;  4CJP A;  2OPP A;  1LAW A;  5JS2 A;  5DMR A;  3HO1 A;  2YNH A;  3OS0 A;  2G8V A;  3NH2 A;  4KTW A;  3VQD A;  4FZY A;  1RBS A;  2NUB A;  4IG0 A;  4DS5 A;  3SQ1 A;  3WNG A;  1TK5 A;  1A5X A;  5SWM A;  3CFO A;  3L2V A;  3OYN A;  4KHQ A;  1BQM A;  1HRH A;  4AHC A;  5K14 A;  4RW8 A;  1A5V A;  1HQU A;  4I2Q A;  4FVM A;  5E41 A;  3L3V A;  4N41 A;  4CIG A;  4E0D A;  1IG9 A;  1WN7 A;  4KHU A;  3L2U A;  3TWH A;  5C42 A;  1U45 A;  3ZSV A;  4C8M A;  1Q9X A;  4KI6 A;  1JXB A;  1QHT A;  4M42 A;  1HYV A;  4FJH A;  3VQE A;  3OS2 A;  3S3M A;  4W5O A;  1RTD A;  4FLV A;  3AA2 A;  4MQ3 A;  4FJK A;  4CHO A;  3U6F A;  3VQC A;  1T03 A;  4OLA A; 
#chains in the Genus database with same CATH topology
 1N33 K;  1MWK A;  4CIF A;  1SS6 A;  4JNE A;  3MXM A;  3RRG A;  2QXF A;  3ZT3 A;  3KZB A;  4EHT A;  5KTQ A;  3GG4 A;  1S1X A;  2XY7 A;  2D4W A;  3NH0 A;  4M41 A;  3VA3 A;  1U6Z A;  2BTF A;  2OTJ N;  4FW1 A;  4CJ3 A;  2XRI A;  2FF3 B;  5KPR A;  1FXX A;  1IH7 A;  5F1X A;  3ID8 A;  1V4T A;  3CXC M;  4K8Z A;  3LDS A;  3SUO A;  1BIS A;  1GOA A;  4LF8 K;  1X9J A;  1YTA A;  2IVO A;  4A2A A;  1RT6 A;  4A2B A;  3QIN A;  3FLC O;  4JKF A;  4K25 A;  1O13 A;  4JI8 K;  2OYQ A;  1HNW K;  2Q3S A;  2WC9 A;  5JLF A;  3MEG A;  1GLJ O;  3RRH A;  1QHA A;  3AA4 A;  1Z05 A;  3OYL A;  3RVC A;  1FKP A;  1TKZ A;  4JKE A;  4KAZ A;  4M3R A;  1N8R O;  4CF8 A;  1SL2 A;  4KHP K;  3V9S A;  4FLX A;  4JYA K;  4CF1 A;  1EKE A;  1VQM N;  3CG7 A;  5AQH A;  2RKI A;  2I7P A;  3D2F B;  2D0B A;  1N5Y A;  1BU6 O;  2G8U A;  4FLU A;  5C25 A;  3U3G A;  4B3T K;  4M7Y A;  2O8C B;  3M8R A;  2VGM A;  5AQP A;  2GV9 A;  1S1V A;  5GAH P;  3KLI A;  3VF2 A;  4E3S A;  1IJJ A;  4ISG A;  3MX5 A;  2OZS A;  1VQ5 N;  5CZ1 A;  1GLB G;  3ID6 A;  4DTS A;  3MN7 A;  4MO4 A;  3VGK A;  3CET A;  3TU5 A;  3LPU A;  2O8E A;  3AAQ A;  1KRP A;  4V19 S;  4BC3 A;  4JS5 A;  3V9Z A;  1EX4 A;  4C8L A;  3KLH A;  5TKW A;  1ZYQ A;  4FOI A;  4EP4 A;  3OYD A;  4JS4 A;  1HNZ K;  3HPG A;  4AHU A;  5AQM A;  4B3M K;  4LFB K;  4F2R A;  2HOE A;  4AH9 A;  4JKD A;  3FZK A;  4UQG A;  4DQR A;  2HHH K;  4LD0 A;  3NDK A;  3D2F A;  5FRN A;  4IOX A;  5AQQ A;  4R5P A;  4FL9 A;  3SMS A;  3J8A A;  3CJC A;  3VQA A;  5FRM A;  2YV0 X;  2QWM A;  4H0O A;  4Z4G A;  2XHB A;  1MA9 B;  3AVL A;  3O3H A;  4A61 A;  4E7I A;  3A0I X;  1BWF O;  4CD3 A;  4CEQ A;  1OH6 A;  1NOZ A;  3MMV A;  1ZBF A;  5HRP A;  2GTD A;  5H1S Q;  3I55 N;  3DM2 A;  1FW6 A;  4B3O A;  3PV8 A;  2ZF5 O;  3F73 A;  1HLU A;  2P9L A;  5LMN K;  4FM2 A;  3VQQ A;  1N36 K;  1D8Y A;  3AO3 A;  1GOC A;  1D9F A;  3EE9 A;  2QXL A;  2A40 A;  3CC4 N;  2QK9 A;  2YNG A;  2FBX A;  1BDG A;  5EX5 A;  3CQX A;  3G0Z A;  1G99 A;  2HHV A;  4GV9 A;  1S1U A;  2JLE A;  3K5O A;  4FWS A;  5KGW A;  2X6S A;  4DV3 K;  3PX6 A;  3S9H A;  1JCG A;  4HTU A;  3EZ5 A;  3G25 A;  3AVF A;  2JGU A;  3HZ6 A;  1XC9 A;  1YXQ A;  4O8K A;  3C7N B;  4JRP A;  3SAF A;  3WEE B;  2JWL A;  4MFB A;  1TK0 A;  1CXU A;  3THX A;  1HYS A;  4DG1 A;  1X1P A;  4CZM A;  1J9A A;  2HF3 A;  4WFA L;  2UU9 K;  3TAE A;  2OPR A;  2O4G A;  3FGU A;  4JI7 K;  1KLM A;  4B9V A;  5FPN A;  2QA4 N;  3CIP A;  1RGI A;  3RMC A;  3IRX A;  4F8R A;  2IVP A;  4BRI A;  4YOY A;  4L3Q A;  4CJ5 A;  2HMI A;  3HM9 A;  1ATS A;  4FK4 A;  4BE2 A;  5J1E A;  4O44 A;  4BG8 A;  1RDC A;  4DV6 K;  3SJJ A;  1QE1 A;  3TSQ A;  2G8W A;  2HNY A;  1RIL A;  4CEZ A;  4FJ9 A;  4YOX A;  3NVK A;  4RCH A;  3KLF A;  4ELT A;  3O9S A;  3KKS A;  1RDW X;  1EET A;  3FZH A;  3VQ6 A;  4B8C A;  5BRF A;  4DR5 K;  1VSL A;  4H0Y B;  2IVN A;  4U7B A;  5I42 A;  4NCG A;  2HHX A;  1U49 A;  1X3N A;  4B9S A;  1W7A A;  3ATV A;  4ELU A;  4PQU A;  2W41 A;  2NZT A;  3OTO K;  3NCI A;  1YJN N;  1KVA A;  1TYQ B;  1NKB A;  4DFK A;  3QDK A;  2NRR A;  4CZL A;  4DU3 A;  1GLD G;  3AGK A;  4QS8 A;  4FLT A;  4DV0 K;  3ZSQ A;  3PSI A;  3M6G A;  3SV4 A;  3ZT0 A;  4FK2 A;  3LZI A;  4CHZ A;  5AQW A;  3KD5 E;  4L8R B;  3I8B A;  3AO1 A;  4CVN E;  4IBN A;  4C8N A;  3G6E N;  3O9T A;  2QI2 A;  2HHW A;  2VQE K;  2A41 A;  5M1O A;  3AVB A;  2YNI A;  4IJA A;  4HUF A;  3AVG A;  1C1C A;  5AQJ A;  4NO7 A;  4YFU A;  1H1V A;  4Y0W A;  4BRA A;  4F3O A;  2Z1J A;  4M3Z A;  4I9Q A;  4AF1 A;  4EHU A;  1L3V A;  3THW B;  3ZEU A;  3AAR A;  4QCL A;  4KV8 A;  2V7Z A;  3M5R A;  1NGI A;  2D0O A;  3K0S A;  1Y97 A;  4FYD A;  1IO2 A;  1HR0 K;  4KBO A;  1C6V A;  1EWR A;  4IOC L;  2QTD A;  2YHX A;  4K8X A;  3DLE A;  3NF7 A;  4JKA A;  3J7Y P;  3LWM A;  3U4L A;  3A5L C;  4DLG A;  1NK9 A;  3GDQ A;  2D1K A;  5EXW A;  3HYF A;  3DLB A;  4O0J A;  1FK9 A;  2FSN A;  1QS4 A;  4PKG A;  1VQ8 N;  5C0Y A;  3VEY A;  1NKC A;  4AHR A;  1OVY A;  4CJE A;  3V4I A;  2Q97 A;  2RF2 A;  3QLH A;  5MLC Q;  3QER A;  1IKW A;  2GUI A;  3O9U A;  5EVZ A;  4DTJ A;  4EZ9 A;  3M8S A;  4FLZ A;  3AVK A;  4CEA A;  1WUA A;  2IC3 A;  2KW4 A;  5E26 A;  3G10 A;  1NK4 A;  4CEC A;  3TAP A;  3THW A;  1WBD A;  2DFF A;  3AA3 A;  4C8K A;  4FXD A;  1K8K B;  2GWK A;  2Z1I A;  3L6Q A;  1YI2 N;  3MWT A;  1VQL N;  2NRH A;  3J81 O;  4HCB A;  3CME N;  2E5L K;  1QQO A;  4LSL A;  4CED A;  3OYK A;  3VQ5 A;  3T1H K;  1LCU A;  1O1W A;  4O5F A;  1Z25 A;  3RR8 A;  3B8A X;  2WBN A;  1YUW A;  5AQY A;  4O8U A;  2F8S A;  1KXP A;  2D0A A;  3GE1 A;  3CM6 A;  4DB3 A;  1U2V B;  3R6M A;  3VER A;  1ZBL A;  3CCL N;  3HJF A;  1LAW A;  2YNH A;  3GOI A;  3VQD A;  1RBS A;  4NB4 A;  3SQ1 A;  2GUP A;  5SWM A;  2QW9 A;  3CFO A;  5C15 A;  2ZJR L;  4AHC A;  5AQN A;  5K14 A;  4DV5 K;  1I94 K;  4JD2 B;  4N41 A;  5AQK A;  3TTD A;  1K8K A;  4KI6 A;  3MCP A;  1YJ9 N;  3UKU B;  5AFU A;  2VGN A;  3O5B A;  4EFH A;  4PL8 A;  4HTL A;  4OLA A;  2PY5 A;  3QB0 A;  1UA1 A;  1WOQ A;  4BRM A;  4XIU A;  2IDO A;  1T6C A;  4O55 A;  3MCA B;  2JWK A;  4DSI A;  4BRH A;  4CZI A;  3OYF A;  5C10 A;  3MN9 A;  1ITG A;  4KH6 A;  1YVN A;  3IKM A;  2FSJ A;  4Z0U A;  4IWV A;  5BRE A;  3AVI A;  2FBT A;  3Q7B A;  4B1X B;  1VQ4 N;  3IDH A;  1FKO A;  4OVL A;  4K0K K;  1VSF A;  1NGG A;  4YOW A;  4U67 L;  4KKO A;  4B9M A;  3OYA A;  3IG1 A;  5KRT A;  4CFD A;  1IBK K;  1JL2 A;  1V4S A;  1JJ2 M;  4BE0 A;  2UXD K;  1BOT O;  3A5N C;  1NGD A;  4I7F A;  1L3S A;  5FLX O;  5BN9 A;  2O4I A;  5AQR A;  1FJG K;  1C0T A;  1JLF A;  4H0X B;  3TTC A;  4PHT X;  3K5N A;  5CYQ A;  1WB9 A;  4KRE A;  3L2Q A;  4Z4H A;  2Q0U A;  4PA1 A;  3WXL A;  1ZBI A;  4FJN A;  2A3Z A;  3C95 A;  1S6Q A;  4DSL A;  4KO0 A;  3C6U A;  4FZX C;  1RT7 A;  1SL0 A;  4RW6 A;  4N56 A;  3K58 A;  3VF6 A;  5BRD A;  3L0Q A;  4DCH A;  3BUZ B;  3HPO A;  1R59 O;  1TKT A;  4DR3 K;  4M3W A;  2KFN A;  3QIP A;  2NNW A;  3KK2 A;  1UAX A;  1NMN A;  4BRN A;  3NGZ A;  3QIC A;  1WSE A;  3MX2 A;  3DXM B;  3RMD A;  1N6Q A;  3VEN A;  1YAG A;  5J2P A;  3SJH A;  3NF6 A;  3VEZ A;  4YNQ A;  4GNI A;  1XQS C;  4BDP A;  2FSK A;  3ISN C;  4YOU A;  1BA1 A;  1U47 A;  1VK0 A;  1S1W A;  3PSF A;  4CIE A;  3VOV A;  3H1Q A;  2H3G X;  3OYM A;  3QET A;  4CEO A;  3H1V X;  3WQT A;  1EXQ A;  3CYM A;  3QIO A;  3QNN A;  5F0X A;  1W9H A;  1IKY A;  4CJL A;  3L8B A;  4RWT A;  3F5T A;  2NRW A;  1S1T A;  4JI2 K;  2OPS A;  3KKR A;  4OPK A;  1KAX A;  3CC7 N;  2CGJ A;  3SI6 A;  1HYZ A;  1XHX A;  2IAJ A;  5AQX A;  4FOE A;  1NMD A;  3DLG A;  4FCY A;  1C0U A;  3CI5 A;  1B92 A;  3F2K A;  1Q18 A;  4CEF A;  1KTQ A;  3OBY A;  3CCR N;  1VSM A;  1J5O A;  2B5J A;  3ENH A;  2A1S A;  5BPL A;  4OKJ A;  4ZTF A;  2KZZ A;  5GAG P;  3SAG A;  2Q36 A;  1C0F A;  2QWL A;  4BRD A;  4XH1 A;  4YDU C;  4GV6 A;  2VYP A;  3K5L A;  3DXM A;  4JI1 K;  2O8B B;  4DSE A;  1TK8 A;  4GV3 A;  3AA5 X;  4CGF A;  3W0L A;  4CHP A;  2E20 A;  2HND A;  5GIN A;  4JLH A;  2RN2 A;  4BR7 A;  3IMX A;  4EAH D;  3OJS A;  3ZX3 A;  1RTJ A;  2D5R A;  3D7E O;  1MWM A;  3BZC A;  1VQ6 N;  2CH5 A;  3VGM A;  3NH1 A;  3KIO A;  1JLC A;  3B6P A;  4E7L A;  2R7Y A;  2IGI A;  1C0M A;  4JHD B;  3SQ0 A;  5HRN A;  4M3T A;  3CPE A;  3K9K A;  3CFP A;  3MEC A;  3FFI A;  3F9M A;  4BQL A;  1RDB A;  4FJG A;  2E88 A;  3LAN A;  4IFV A;  4IDK A;  3FFK B;  3JAM O;  1NK5 A;  4DR6 K;  2G8K A;  2ZQB A;  5HRR A;  3TAG A;  4IOA L;  3LM9 A;  1RT1 A;  5M1Q A;  5KRS A;  1I39 A;  2NRX A;  2UXB K;  1QZ5 A;  1TL1 A;  1NGF A;  2XO7 A;  1RNH A;  2D0P A;  5EOY A;  5J2N A;  1HJR A;  3PY8 A;  2KKZ A;  5IWA K;  5BPN A;  1K8A O;  4CBW A;  4A59 A;  4DUY K;  4CJV A;  1GLF O;  1P8Z A;  4DTR A;  3O1B A;  1D5A A;  2O8B A;  4X64 K;  1SUQ A;  3ZT2 A;  2B6A A;  3AV9 A;  4WFB L;  3D45 A;  4H5W A;  3IFR A;  3SQ2 A;  3JYT A;  4OLB A;  2VG6 A;  3ZLJ A;  1NU0 A;  1BL3 A;  3R8E A;  4JK8 A;  4B9N A;  3NF9 A;  3TAQ A;  3TSU A;  4CJT A;  1JL1 A;  3EZW A;  4DS4 A;  4DQP A;  4JKG B;  4CW7 B;  4F2S A;  1UOC A;  4CF0 A;  3OYE A;  3DOK A;  3CF5 L;  4DSJ A;  3BY5 A;  4W5N A;  4DR7 K;  3BEX A;  3AGR A;  3MED A;  2G8I A;  4IZ9 A;  1ZBS A;  4DTU A;  4FWQ A;  1XI1 A;  1VSE A;  3BF1 A;  2KLA A;  4CZH A;  5AZJ B;  4OJR A;  5GIP A;  4WE1 A;  4CJ4 A;  2CH6 A;  1NJW A;  3L2W A;  3DLH A;  3FZM A;  3M8P A;  3WXK A;  5KQD A;  3AAP A;  4IEI A;  5LJV A;  3IUC A;  2RPI A;  3K57 A;  2YKM A;  4PUO A;  3MAQ A;  3P1G A;  1YHQ N;  1J6Z A;  4XH5 A;  5BR8 K;  3EO3 A;  3CJ1 A;  1VSH A;  5AQT A;  4W5R A;  3C6A A;  3R1X A;  1ZBH A;  1S9G A;  1X9M A;  4BRP A;  1QSL A;  3IS9 A;  3RR7 A;  3SZ2 A;  1X3M A;  2FLO A;  4EIA A;  4DF8 A;  3HPH A;  2B4J A;  3LZJ A;  5DM6 L;  3O4W A;  3OYJ A;  2GWJ A;  5FRO A;  1C1A A;  4W5Q A;  3PIP L;  4FJJ A;  4DR4 K;  1Q81 O;  2Y1I A;  2O8C A;  1WBB A;  1DTT A;  3HP9 A;  2VWK A;  3N4Q A;  5AQI A;  2HBK A;  1XMQ K;  2E6M A;  4JI0 K;  3MN5 A;  4FWP A;  1NOY A;  1HUX A;  4ISF A;  3TPQ A;  3I0R A;  5AZJ A;  2W6K A;  1RBR A;  4LFA K;  2ZGY A;  4IFE A;  5GAD P;  1RBT A;  3CFR A;  1RBV A;  3LP1 A;  4IO9 L;  5AQL A;  4DQ8 A;  1NGE A;  4O0I A;  3J7A P;  4DKW A;  3ZYY X;  4WCE L;  2ASP A;  3LP2 A;  3O8M A;  1Q82 O;  5DK5 A;  1VRU A;  2F9W A;  2PBD A;  4FWN A;  2Z1G A;  5TKY A;  4KHW A;  1TV6 A;  3NF8 A;  3O08 A;  5AQF A;  1KQS M;  4E7J A;  2HW3 A;  5LY3 A;  4BRK A;  3LP3 A;  3O9R A;  3CCJ N;  3T1A A;  4DR1 K;  3BDP A;  1NGH A;  4E1M A;  2E2Q A;  1X9W A;  3NHG A;  3AVN A;  3E01 A;  4CEE A;  4BGB A;  1JLE A;  3HRG A;  1RBU A;  4IFY A;  3V1O A;  4H4O A;  2FC0 A;  3HTV A;  2YHY A;  1TKD A;  3ALY A;  4BQZ A;  4NXM K;  4JI6 K;  4GW6 A;  4B3R K;  2QWR A;  5DM7 L;  3QML A;  1EWQ A;  3ZSX A;  4FJL A;  3MEE A;  2YHB A;  3F9K A;  2DFH A;  1YVU A;  4JKH A;  1E4F T;  3DWL A;  3M8Q A;  4M3X A;  4MO5 A;  4WYB A;  2YHW A;  1NWK A;  5FPM A;  4I6M B;  4HHT A;  3TAB A;  2QM1 A;  3JS6 A;  2X78 A;  1Q86 O;  4FPB A;  2Q31 A;  5JIC A;  1QZ6 A;  3A2F A;  1LW0 A;  3HVT A;  3JXU A;  2F8T A;  2OCE A;  3WNE A;  3W3D A;  3FR0 A;  4M63 C;  4UY8 O;  4DV1 K;  3C0B A;  3TR8 A;  1WNS A;  3LP0 A;  1N34 K;  2NRT A;  1BGX T;  3C7N A;  3MK6 A;  1RCH A;  3VQ9 A;  2E1Y A;  3WEE A;  2OPP A;  2NRV A;  4H5R A;  1YJW N;  2VWB A;  4KTW A;  5AQS A;  1IBM K;  1BO5 O;  4YY3 K;  4DS5 A;  1A5X A;  2F9T A;  3UB5 A;  4RW8 A;  4FWL A;  3EKU A;  4CIG A;  4E0D A;  1IG9 A;  4KHU A;  5E84 A;  3WQU A;  1Q7Y O;  3ZET B;  4FJH A;  1TUY A;  3LDL A;  3AA2 A;  4FJK A;  3U6F A;  1M90 O;  3K59 A;  1QVF M;  4E1J A;  3LDN A;  4I6M A;  1Y64 A;  1NKE A;  3M1F A;  1VSK A;  4CBU A;  4PL7 A;  1KSP A;  4AM7 A;  4KPY A;  3VEW A;  1KVB A;  1BUP A;  2GBZ A;  3FZF A;  3NGI A;  1KD1 O;  3A5M C;  3C6T A;  1E4G T;  3KHY A;  4FSV A;  3SAH A;  4R79 A;  3FZL A;  1LW2 A;  1WSI A;  1TYQ A;  3T69 A;  2E1Z A;  4CES A;  5C2F A;  1KVC A;  3K5M A;  4YOV A;  1ASV A;  4E7H A;  4QOZ B;  4DWI A;  3U8X A;  4BC4 A;  3VF4 A;  3THV A;  4FZZ A;  4JRQ A;  1DEJ A;  5LL6 Z;  1D4X A;  4DF4 A;  4FJM A;  4JK7 A;  3P4I A;  4KB0 A;  2HHT A;  4LSN A;  3H46 O;  4BR0 A;  4A57 A;  1HNI A;  4FW2 A;  3ZET A;  4FVU A;  5KPT A;  4CJS A;  3VQ7 A;  4B1W B;  5AR0 A;  5M1F A;  4BRO A;  2PFU A;  4H0P A;  3HI0 A;  4CGH A;  2GEL A;  4BRQ A;  2RHK A;  4WQ5 A;  3ZSR A;  2YX6 A;  4OGC A;  1I3A A;  3PX4 A;  2A6A A;  1ATR A;  1NGB A;  4ZHR A;  4J8F A;  5I3U A;  4IEE A;  4CZJ A;  4CFB A;  1VSJ A;  4ICL A;  5KGX A;  3S3N A;  2AA4 A;  4H5T A;  1VQP N;  2XY5 A;  3MN6 A;  2DFE A;  4JK9 A;  5M1P A;  4NYN A;  3SUQ A;  4BGA A;  4K42 A;  4LF5 K;  1R0A A;  4BWJ A;  1KFD A;  3O6W A;  3CJB A;  3E9P A;  3OJU A;  1HKG A;  2I7N A;  4Q5V A;  5ADX H;  3E66 A;  4DSF A;  4E19 A;  3P31 A;  2WTU A;  2X74 A;  2GX9 A;  1BI4 B;  3LAM A;  2HNZ A;  3HVR A;  1LWE A;  3KK7 A;  1WSF A;  3VQB A;  3OS1 A;  2OA8 A;  4CJF A;  4KRF A;  1NK8 A;  2UUC K;  4JI3 K;  1U4B A;  2IOC A;  4NLC A;  2V7Y A;  1K6Y A;  4JKB A;  4I2P A;  4LF9 K;  2VG5 A;  3ULE B;  2V51 B;  1UWB A;  2E8A A;  1P90 A;  3AO2 A;  1VSD A;  1WSG A;  1RDU A;  5JMV A;  3UKR B;  3VMF B;  1RT4 A;  4JV5 K;  3A5O C;  3CER A;  1L5U A;  1JKH A;  3LAK A;  4CJK A;  4JEP A;  1ZC6 A;  2PYL A;  4M3Y A;  3P5J A;  3NVM A;  5AQO A;  3PO4 A;  3ENB A;  4E1N A;  2UUA K;  2DPN A;  3T1Y K;  5BRH A;  3QBX A;  1KLN A;  5AZI B;  4E89 A;  1GLE G;  4DFM A;  4CFC A;  4HCC A;  5HRO A;  3LPT A;  1U2V A;  1GLC G;  2WUS A;  4CK1 A;  3I8D A;  3CC2 N;  3BF3 A;  1QQM A;  2IS3 A;  5CR4 A;  1BI4 A;  2P9P B;  4CGD A;  4B8A B;  1WSJ A;  3L3U A;  1C0G A;  4BY9 C;  4BAC A;  1QVG M;  1JLG A;  1SAZ A;  4DTN A;  4JD2 A;  4LH4 A;  4CGI A;  5KQ8 A;  3CQ8 A;  3QBW A;  4ISE A;  3O3F A;  2UXC K;  3UKU A;  4PKH A;  1DKG D;  3H08 A;  3VET A;  2ZM6 K;  3UKR A;  3EY1 A;  3SLC A;  3ITH A;  4OPJ A;  4OKE A;  3BP8 A;  4WQ4 A;  2EWS A;  2ZE2 A;  1RT3 A;  1T6D A;  3UIQ A;  3SQ4 A;  3U9Z A;  3O80 A;  5J2M A;  4DV2 K;  2F96 A;  3VTI A;  5AZI A;  4LH5 A;  3ZT1 A;  4X65 K;  3KK1 A;  3OW2 M;  5C24 A;  3OYB A;  1SKR A;  4LFC K;  3CMA N;  3ULD A;  4Z4E A;  1W2B M;  3ENO A;  3DXK B;  3EKS A;  1CLQ A;  1NM1 A;  1L3T A;  1KC8 O;  5AQV A;  3OYH A;  3NAE A;  2CGL A;  4G1Q A;  5AQZ A;  4X62 K;  3AVA A;  4C1N I;  4KHN A;  4KHS A;  1QQN A;  1VQN N;  3G71 N;  1NGA A;  4CGG A;  5A2Q O;  4NLB A;  2P5G A;  3D2E B;  4X66 K;  1MU2 A;  4DFP A;  1U04 A;  3L4Q A;  1T3V A;  4BRE A;  4CE9 A;  3OVN A;  1BIZ A;  1C1B A;  4AHT A;  3P83 D;  1A5W A;  2GEM A;  3V1Q A;  5LJW A;  4DLE A;  4GMJ B;  1ILY A;  4YHH K;  3QEI A;  4CJW A;  2G8H A;  4XEI A;  4BRL A;  4N47 A;  1MDU B;  1DGK N;  3EE8 A;  1RFQ A;  3BGR A;  4XH4 A;  3SV3 A;  1K73 O;  2FF6 A;  3TAR A;  2YJF A;  3SYZ A;  4OPA A;  3D6R A;  3TI0 A;  1KAZ A;  2QWQ A;  4DR2 K;  3ZT4 A;  4DTP A;  4ELV A;  3DXK A;  5J2Q A;  4GKJ K;  3LAL A;  3I0S A;  2Q2R A;  3LWL A;  4B1V A;  4CK2 A;  4C8O A;  4DUZ K;  4Y1C A;  1SKW A;  4NCB A;  2D0C A;  3KK3 A;  5BPM A;  1GLA G;  3EL2 A;  2KQ2 A;  3G4S N;  1NJX A;  1S6P A;  2NRZ A;  4QS9 A;  4E7K A;  4A5B A;  4DQS A;  4IDH A;  1NJI O;  5HLF A;  4YDU A;  4ID1 A;  1S5J A;  3D2E A;  1U48 A;  3CM5 A;  4IO8 A;  5HL7 L;  1ZXO A;  3KLE A;  3UE5 A;  4F4K A;  3J80 O;  3U9D A;  1DTQ A;  3H3N O;  3SPY A;  1XHZ A;  3PUF A;  2RE2 A;  1YTU A;  1EP4 A;  1T44 A;  2BUP A;  1Q8I A;  5ADX A;  2HBM A;  2ITM A;  4EZ6 A;  1NG9 A;  3T7Z A;  4CF2 A;  3U3Y A;  1DT9 A;  3LM2 A;  4AM6 A;  1OH7 A;  2V52 B;  2O8E B;  3KVG A;  4H5N A;  1S9E A;  3R3L A;  2HVH A;  1IG8 A;  4IXC A;  3ZSY A;  3KJV A;  3QNO A;  4FLW A;  2VG7 A;  5HBM A;  3ATU A;  3DRS A;  3QO9 A;  4CK3 A;  3VQP A;  1W97 L;  4ILH A;  3PLA A;  2YNF A;  3S41 A;  2F4V K;  1TKX A;  4HWI A;  3DRP A;  4JHD A;  4KHY A;  1HPZ A;  3QEP A;  4BWM A;  3AO5 A;  3PO5 A;  1XC3 A;  1JCE A;  1SKS A;  3SMP A;  2E2N A;  4B1Z A;  4CJU A;  4CJQ A;  4BE1 A;  1OH5 A;  5HP1 A;  4JKC A;  4LF6 K;  4OKK A;  1HNV A;  3I33 A;  3E9L A;  4HVJ A;  4B9U A;  1B9D A;  1TGO A;  2Q1N A;  2ATQ A;  4CGJ A;  3C94 A;  3THY B;  1S3X A;  3K2P A;  5HRS A;  5CHI A;  4NXN K;  1XNQ K;  1IV0 A;  4QAG A;  1S22 A;  3VES A;  3A8Y A;  3WNH A;  4FM1 A;  5BN8 A;  3CCM N;  4DQQ A;  3N4P A;  4CJP A;  5JS2 A;  3HO1 A;  5DMR A;  2HST A;  3NH2 A;  3WXJ A;  1HKB A;  4FZY A;  4IG0 A;  1YIT N;  2P9L B;  3WNG A;  3L2V A;  4KHQ A;  1BQM A;  1HRH A;  2P9U B;  4OPH A;  4B1Y B;  1HQU A;  4I2Q A;  1OKJ A;  5E41 A;  4BRG A;  3J7Z O;  4CZE A;  5C42 A;  3H45 C;  4JKG A;  3WUH A;  3ZSV A;  2A42 A;  1U45 A;  1Q9X A;  1JXB A;  1QHT A;  4M42 A;  1HYV A;  1TUU A;  3OS2 A;  2A5X A;  4J2A A;  3VQC A;  4B1U B;  1T03 A;  4B9Q A;  3NFA A;  3RWU A;  3HK2 A;  1BCM A;  3KLG A;  2WFB A;  5BR9 A;  4BRC A;  4Y1D A;  3HOT A;  4FO0 A;  3GBT A;  3ZX0 A;  1IBL K;  3THX B;  4DU1 A;  4MLH A;  4O5B A;  3AVC A;  1VSI A;  4G9Z A;  4LF7 K;  3VGL A;  4H4M A;  4BC5 A;  1J54 A;  3THY A;  5FDL A;  4C1N K;  2UYT A;  4LY7 A;  4KH5 A;  4DV7 K;  4AIL C;  2QKB A;  3FE1 A;  1ASW A;  3VTH A;  1LV5 A;  2O8F B;  2P5O A;  2YJE A;  4RW7 A;  2W42 A;  1KAY A;  4DSK A;  1SV5 A;  2HHQ A;  4GVE A;  1ZBU A;  4CER A;  3WT0 A;  4FWR A;  1X9S A;  4GKK K;  3OA9 A;  2KZM A;  3L2R A;  4TSX A;  4OO1 J;  5JS1 A;  2P9S B;  5LMU K;  3V81 A;  1T8E A;  2YI1 A;  3QFU A;  5C2D A;  3DLK A;  4KH4 A;  2P9U A;  3SUP A;  1NGJ A;  4F3T A;  1VQO N;  4CI6 A;  3GL1 A;  2HMP A;  3C65 A;  2O8D B;  4B9T A;  3LDP A;  1LWC A;  3BZK A;  4I9L A;  5KI6 A;  4DU4 A;  2P51 A;  3MXJ A;  3VQ8 A;  5FPD A;  2Q0R A;  5AFU H;  5SZT A;  1QSS A;  2OZM A;  3VQ4 A;  3QEX A;  4FK0 A;  3H3O B;  4MDB A;  4J2D A;  1ASU A;  4ID5 A;  3QFP A;  4DTX A;  4B9L A;  4CD1 A;  1SZ2 A;  3HT3 A;  1Z26 A;  4IG3 A;  3VEO A;  3PIO L;  4RTF D;  1M1K O;  4ILJ A;  1CZ9 A;  4CHQ A;  2E4L A;  2J4R A;  1T05 A;  1JXE A;  1WLJ A;  1HX1 A;  1RT5 A;  4HUE A;  4CCH A;  1HKC A;  4DTM A;  1W0H A;  1TAU A;  1XUP O;  1L3U A;  1XMO K;  2O8F A;  2P9K B;  4BR5 A;  1BIU A;  5FPE A;  3ZCM A;  4QS7 A;  3DYA A;  2P9S A;  1HNX K;  2X6N A;  4DQI A;  5GAE P;  5HOO A;  2AJQ A;  5IT9 O;  4FJI A;  1XWL A;  3ZEU B;  4B08 A;  3E1Y A;  3RTV A;  2O8D A;  3I56 N;  5JVH L;  4BDY A;  3TAF A;  3SNN A;  4A62 A;  1HJO A;  3AY9 A;  4BRF A;  4PY5 A;  4CZK A;  2QEX N;  1N32 K;  3AVM A;  3LDO A;  4LF4 K;  2DY4 A;  3EEQ A;  3H6E A;  4RG8 A;  1JLB A;  1HPM A;  4C23 A;  4KTQ A;  1WAJ A;  5AQU A;  1JLA A;  2UUB K;  4IKF A;  1NK7 A;  3CCU N;  4OGE A;  5JVG L;  4BDZ A;  2FXU A;  3VEV A;  4CHN A;  2LSN A;  2CGK A;  3RMB A;  1EQY A;  1BG3 A;  3KWG A;  3T19 A;  1B9F A;  2OAN A;  2WOM A;  4ZTJ A;  4KB1 A;  4PKI A;  3HP6 A;  3DOL A;  3E9O A;  4FWK A;  3V9W A;  2BH1 A;  2P9K A;  1OH8 A;  3JSM A;  3SCX A;  3O1W A;  3WNF A;  5EY4 A;  4O4G A;  4FJ8 A;  1JLQ A;  3HBT A;  3O9Q A;  1RDA A;  3AO4 A;  4FJX A;  1BQN A;  4Z4F A;  2ITG A;  4H0V B;  4BG9 A;  3DMJ A;  1RDD A;  3CCV N;  4FM0 A;  4H0T B;  4Z94 A;  3TAN A;  3DLL L;  2W40 A;  4LC9 B;  5CYM A;  3ASM A;  5JLH A;  1J53 A;  3CPW M;  1NNE A;  3S3O A;  5CZ2 A;  4YOT A;  3HL8 A;  5T7B A;  1QSY A;  4KI4 A;  3HSC A;  1TVR A;  1GLL O;  1JCF A;  1SL1 A;  3OBW A;  4CEB A;  3NE6 A;  4CZF A;  2BDP A;  1SQK A;  3SBT A;  3V9U A;  3NGY A;  3HM8 A;  2QWN A;  3TSP A;  4BVP A;  4B3S K;  4H03 B;  3OHR A;  4PWD A;  4Q0B A;  3CQY A;  4AQY K;  1NJY A;  5B8H A;  2XY8 A;  5CY4 A;  4WQ5 C;  3VA0 A;  3KWI A;  3AVJ A;  1ATN A;  2P9I B;  1YT3 A;  2A1R A;  1VAZ A;  3AVH A;  3LL3 A;  4DV4 K;  3SBG A;  1GOB A;  2ZWH A;  4YOR A;  1EO1 A;  3RSE B;  2KFZ A;  3NBP A;  1LAV A;  2FBY A;  2EX3 A;  3DI6 A;  4J2E A;  3VEX A;  3P38 A;  4CJR A;  3V9X A;  5ELZ A;  5I9E B;  4DFJ A;  3CJ7 A;  2KTQ A;  4CZG A;  1BCO A;  3ZX2 A;  3OYG A;  3O4Q A;  4HUG A;  1NK0 A;  3O4N A;  1G15 A;  3V1R A;  3O3G A;  4IJN A;  3K9J A;  1QTM A;  2IIR A;  3SK3 A;  4M3U A;  1XNR K;  3SPZ A;  2YCH A;  3QES A;  1LOT B;  1TL3 A;  1KFS A;  3V6D A;  4BR2 A;  1OVQ A;  4FJ5 A;  1VQ9 N;  4A5A A;  4CF9 A;  5AQG A;  1HQE A;  2PYJ A;  5EU7 A;  2DTU A;  1TAQ A;  1Q9Y A;  2E6L A;  4MDA A;  2P9I A;  4Z4I A;  5D3G A;  2XY6 A;  3TAM A;  1WSH A;  1IKV A;  3OYC A;  4RW4 A;  3EYZ A;  2ASM A;  4KTZ A;  3DRR A;  1Z6R A;  4OX9 K;  1LWF A;  3RSE A;  5M1K A;  3QEW A;  3WXM B;  1WAF A;  2P1J A;  3T3F A;  5AJ3 K;  4RW9 A;  2YKN A;  1HMV A;  2E2P A;  3ZSO A;  1VRT A;  5CE3 A;  2I5J A;  3OY9 A;  2EHG A;  2NLX A;  3QEV A;  4NYF A;  4DMN A;  4FLY A;  1IKX A;  1UA0 A;  3M3Z A;  4AHV A;  4H5V A;  4DHY A;  4K43 A;  3CCE N;  4CJ7 A;  3CCQ N;  2ASO A;  4AHS A;  4JI5 K;  4BC2 A;  2PAV A;  1RTI A;  3CHW A;  4H8K A;  2QWP A;  2ZD1 A;  3C6H A;  1ESV A;  2FBV A;  3ULE A;  2ZJQ L;  4W5T A;  2QKK A;  2YHA A;  4CFA A;  4ILG B;  2HHS A;  1NK6 A;  2QWO A;  5KPZ A;  1BHL A;  1F21 A;  4M45 A;  3D0P A;  4WQ4 C;  2HBL A;  2Z1H A;  2HB5 A;  1T7P A;  2WON A;  3KD1 E;  2ZGZ A;  4CBX A;  4FJ7 A;  3MWP A;  3IAY A;  1VHX A;  3LDQ A;  3R9P A;  3MXI A;  2PZS A;  1NGC A;  2HF4 A;  1KCF A;  2VWJ A;  3NMU A;  3HST B;  1J5E K;  1D9D A;  2G8F A;  2BGG A;  3CJ9 A;  2ZJP L;  2AP1 A;  1BA0 A;  2OPQ A;  3ZSW A;  2P9N B;  4N5S A;  1E3M A;  1DLO A;  1CXQ A;  4JAX A;  3SUN A;  4DTO A;  4JN4 A;  3KTQ A;  3VN5 A;  2P9P A;  1NJZ A;  4FWO A;  4Z4C A;  4NCA A;  3WXI A;  1YF5 L;  2BE2 A;  4KFB A;  1VQ7 N;  4BR4 A;  3B6O A;  1CZB A;  5C12 A;  2HVI A;  2OTL N;  4N76 A;  1QQC A;  4M7X A;  3TTF A;  3CCS N;  3RMA A;  2BAN A;  4BVO A;  2HBJ A;  1NLV A;  1YIJ N;  1S72 N;  3DLR A;  1REV A;  3VPZ A;  1RT2 A;  3L4I A;  2ETJ A;  4EP5 A;  3OYI A;  3CD6 N;  3HXM A;  4F9O A;  2Y1J A;  1RTH A;  4J2B A;  3P39 A;  3DAW A;  2HHU A;  2F7T A;  4WFN L;  2KHO A;  3Q7C A;  3CJA A;  3ZSZ A;  4GVM A;  4CHY A;  5M1N A;  4WF9 L;  2VCP A;  3PX0 A;  1K9M O;  4FWM A;  4FPA A;  4BR9 A;  2E2O A;  3OS0 A;  2G8V A;  4MLE A;  3DJC A;  4GY2 B;  2NUB A;  1TK5 A;  3OYN A;  1CZA N;  3EN9 A;  4JI4 K;  3HOS A;  1A5V A;  2VQF K;  4FVM A;  5GIO A;  1VQK N;  2P9N A;  3L3V A;  1WN7 A;  3L2U A;  3TWH A;  1NBW A;  5F2R A;  4C8M A;  2W6L A;  3VQE A;  3S3M A;  4W5O A;  4K41 A;  1RTD A;  4FLV A;  3MDQ A;  4MQ3 A;  4CHO A; 
#chains in the Genus database with same CATH homology
 2PY5 A;  1UA1 A;  3NFA A;  3RWU A;  4XIU A;  3K59 A;  4CIF A;  2IDO A;  4O55 A;  3HK2 A;  1BCM A;  3KLG A;  3MXM A;  4Y1D A;  1NKE A;  3RRG A;  4DSI A;  3OYF A;  1VSK A;  2QXF A;  1KSP A;  3ZT3 A;  4KPY A;  4DU1 A;  1ITG A;  4O5B A;  4Z0U A;  5KTQ A;  3AVC A;  1VSI A;  1KVB A;  2FBT A;  3AVI A;  1FKO A;  1S1X A;  4OVL A;  4H4M A;  2XY7 A;  2GBZ A;  1VSF A;  3NGI A;  1J54 A;  3C6T A;  3NH0 A;  5FDL A;  4KKO A;  4M41 A;  3VA3 A;  4B9M A;  4LY7 A;  4FW1 A;  4CJ3 A;  3OYA A;  1LW2 A;  2XRI A;  3IG1 A;  4AIL C;  1ASW A;  1WSI A;  5KRT A;  1LV5 A;  4CFD A;  2QKB A;  4CES A;  1JL2 A;  1KVC A;  2P5O A;  3K5M A;  4RW7 A;  2W42 A;  4BE0 A;  4DSK A;  1SV5 A;  2HHQ A;  1ZBU A;  4CER A;  1ASV A;  1FXX A;  4E7H A;  4QOZ B;  1IH7 A;  4DWI A;  1X9S A;  2KZM A;  3L2R A;  4TSX A;  4I7F A;  3THV A;  4K8Z A;  3LDS A;  1L3S A;  4FZZ A;  5JS1 A;  4JRQ A;  3V81 A;  1BIS A;  3SUO A;  1GOA A;  1T8E A;  2O4I A;  1YTA A;  1C0T A;  3DLK A;  1JLF A;  3SUP A;  4F3T A;  3K5N A;  5CYQ A;  1RT6 A;  4DF4 A;  4FJM A;  3QIN A;  4KRE A;  3L2Q A;  4Z4H A;  4KB0 A;  2HHT A;  4LSN A;  4PA1 A;  4B9T A;  1ZBI A;  4FJN A;  1LWC A;  3C95 A;  4I9L A;  2OYQ A;  1S6Q A;  5KI6 A;  1HNI A;  2Q3S A;  4FW2 A;  4KO0 A;  4DSL A;  3C6U A;  4FZX C;  3MEG A;  4DU4 A;  2P51 A;  3MXJ A;  1RT7 A;  3VQ8 A;  1SL0 A;  3RRH A;  3AA4 A;  4RW6 A;  4N56 A;  3OYL A;  4CJS A;  5SZT A;  3K58 A;  1FKP A;  1TKZ A;  3VQ7 A;  1QSS A;  4KAZ A;  2OZM A;  4M3R A;  3VQ4 A;  3QEX A;  4FK0 A;  4CF8 A;  3HPO A;  1SL2 A;  4J2D A;  1ASU A;  4ID5 A;  3V9S A;  4DTX A;  4B9L A;  4FLX A;  1TKT A;  4M3W A;  2KFN A;  4CGH A;  3QIP A;  4CF1 A;  3HT3 A;  1Z26 A;  3KK2 A;  4IG3 A;  1EKE A;  3ZSR A;  1UAX A;  4OGC A;  3CG7 A;  1CZ9 A;  1I3A A;  4CHQ A;  2RKI A;  3PX4 A;  3NGZ A;  2E4L A;  4ZHR A;  1T05 A;  5I3U A;  1JXE A;  2D0B A;  1WLJ A;  1WSE A;  3RMD A;  1RT5 A;  1N5Y A;  4CFB A;  4HUE A;  4CCH A;  1VSJ A;  1N6Q A;  2G8U A;  4ICL A;  5KGX A;  4FLU A;  4DTM A;  5C25 A;  5J2P A;  3S3N A;  1W0H A;  1TAU A;  3U3G A;  1L3U A;  3NF6 A;  2XY5 A;  3M8R A;  2DFE A;  4YNQ A;  4NYN A;  1BIU A;  4BDP A;  3ISN C;  2GV9 A;  1S1V A;  3SUQ A;  1U47 A;  1VK0 A;  1S1W A;  4CIE A;  3KLI A;  3ZCM A;  3DYA A;  4E3S A;  1R0A A;  4BWJ A;  1KFD A;  3OYM A;  3QET A;  4CEO A;  2X6N A;  4DQI A;  1EXQ A;  2OZS A;  3CYM A;  3QIO A;  5CZ1 A;  3OJU A;  3QNN A;  2AJQ A;  4FJI A;  1XWL A;  4DTS A;  4Q5V A;  1W9H A;  4B08 A;  1IKY A;  4DSF A;  4CJL A;  4E19 A;  3L8B A;  3LPU A;  3RTV A;  2X74 A;  3LAM A;  1BI4 B;  1S1T A;  2HNZ A;  2OPS A;  3KKR A;  1LWE A;  3HVR A;  1KRP A;  4BDY A;  4OPK A;  1WSF A;  3SI6 A;  3VQB A;  3OS1 A;  2OA8 A;  4JS5 A;  4CJF A;  1EX4 A;  1HYZ A;  1XHX A;  3V9Z A;  3TAF A;  2IAJ A;  3SNN A;  1NK8 A;  3KLH A;  4C8L A;  4KRF A;  1ZYQ A;  1U4B A;  2IOC A;  4EP4 A;  3DLG A;  3OYD A;  4PY5 A;  4JS4 A;  1C0U A;  4FCY A;  1B92 A;  3AVM A;  3HPG A;  4AHU A;  1K6Y A;  2DY4 A;  4I2P A;  4RG8 A;  1JLB A;  1KTQ A;  2VG5 A;  4CEF A;  4F2R A;  1WAJ A;  1J5O A;  1VSM A;  4KTQ A;  2B5J A;  4AH9 A;  2A1S A;  1JLA A;  1UWB A;  4IKF A;  1NK7 A;  4OKJ A;  4ZTF A;  2KZZ A;  4UQG A;  3AO2 A;  1VSD A;  4DQR A;  4OGE A;  4LD0 A;  1WSG A;  4BDZ A;  1RT4 A;  4CHN A;  2LSN A;  3RMB A;  3NDK A;  3T19 A;  1B9F A;  3K5L A;  1L5U A;  1JKH A;  5FRN A;  2WOM A;  3LAK A;  4CJK A;  4ZTJ A;  4KB1 A;  2PYL A;  4DSE A;  3HP6 A;  4R5P A;  3DOL A;  1TK8 A;  4M3Y A;  3P5J A;  3AA5 X;  3VQA A;  4CGF A;  4CHP A;  3V9W A;  5FRM A;  3PO4 A;  2HND A;  4JLH A;  2YV0 X;  4E1N A;  3JSM A;  2RN2 A;  3OJS A;  3SCX A;  3WNF A;  4Z4G A;  1KLN A;  1RTJ A;  2XHB A;  4E89 A;  4O4G A;  4FJ8 A;  2D5R A;  1JLQ A;  3AVL A;  3O3H A;  4DFM A;  1RDA A;  3AO4 A;  4E7I A;  4FJX A;  1BQN A;  4Z4F A;  2ITG A;  4CFC A;  4CEQ A;  4HCC A;  2QK9 A;  3DMJ A;  1NOZ A;  5HRO A;  3LPT A;  1RDD A;  3NH1 A;  3KIO A;  4FM0 A;  1JLC A;  3TAN A;  3B6P A;  4CK1 A;  4E7L A;  1ZBF A;  3I8D A;  5HRP A;  2R7Y A;  2IGI A;  1C0M A;  5CYM A;  3ASM A;  3SQ0 A;  5HRN A;  3DM2 A;  4M3T A;  2IS3 A;  4B3O A;  1BI4 A;  4CGD A;  1J53 A;  3CFP A;  3PV8 A;  4B8A B;  1WSJ A;  3MEC A;  3F73 A;  3S3O A;  5CZ2 A;  3HL8 A;  5T7B A;  4FM2 A;  3VQQ A;  3FFI A;  3L3U A;  1QSY A;  3AO3 A;  1GOC A;  4BAC A;  1D8Y A;  1D9F A;  1RDB A;  1JLG A;  4FJG A;  4KI4 A;  1TVR A;  4DTN A;  3LAN A;  4IFV A;  4IDK A;  4LH4 A;  2YNG A;  2FBX A;  4CGI A;  1NK5 A;  1SL1 A;  4CEB A;  3NE6 A;  3CQ8 A;  2ZQB A;  5HRR A;  3TAG A;  2G8K A;  2BDP A;  3V9U A;  1RT1 A;  3G0Z A;  2HHV A;  5KRS A;  1I39 A;  1S1U A;  3NGY A;  2JLE A;  3K5O A;  5KGW A;  3O3F A;  1TL1 A;  2X6S A;  3PX6 A;  3S9H A;  2XO7 A;  1RNH A;  4PWD A;  5J2N A;  4Q0B A;  1HJR A;  4HTU A;  3H08 A;  3EZ5 A;  3PY8 A;  3AVF A;  2JGU A;  3EY1 A;  1XC9 A;  1NJY A;  3ITH A;  4OPJ A;  2XY8 A;  4OKE A;  4CJV A;  5CY4 A;  4DTR A;  1D5A A;  1SUQ A;  3ZT2 A;  2B6A A;  2ZE2 A;  3AV9 A;  4JRP A;  4MFB A;  1RT3 A;  1TK0 A;  3D45 A;  3VA0 A;  1CXU A;  3UIQ A;  1HYS A;  3AVJ A;  4DG1 A;  1X1P A;  3SQ4 A;  1J9A A;  3SQ2 A;  3JYT A;  5J2M A;  3TAE A;  2OPR A;  2O4G A;  4OLB A;  2F96 A;  2VG6 A;  1YT3 A;  1KLM A;  1BL3 A;  2A1R A;  4B9V A;  4LH5 A;  3ZT1 A;  3AVH A;  3KK1 A;  4B9N A;  5C24 A;  3NF9 A;  3IRX A;  3OYB A;  4CJT A;  3RMC A;  1GOB A;  3TAQ A;  1SKR A;  4F8R A;  1JL1 A;  3ULD A;  4Z4E A;  4DS4 A;  2KFZ A;  4CJ5 A;  2HMI A;  4DQP A;  3NBP A;  4F2S A;  1UOC A;  1CLQ A;  4CF0 A;  3OYE A;  3HM9 A;  1LAV A;  2FBY A;  3DOK A;  2EX3 A;  1L3T A;  4DSJ A;  4FK4 A;  3DI6 A;  4BE2 A;  3OYH A;  5J1E A;  3NAE A;  4J2E A;  4G1Q A;  4O44 A;  4W5N A;  1RDC A;  4CJR A;  3SJJ A;  3V9X A;  1QE1 A;  3AVA A;  2G8W A;  3MED A;  2G8I A;  2HNY A;  1RIL A;  4CEZ A;  4DFJ A;  4DTU A;  4KHN A;  4FJ9 A;  4KHS A;  2KTQ A;  1XI1 A;  1VSE A;  3KLF A;  4ELT A;  1BCO A;  4OJR A;  4WE1 A;  3KKS A;  3O4Q A;  4CGG A;  4CJ4 A;  3OYG A;  4HUG A;  2P5G A;  1NK0 A;  1EET A;  3O4N A;  1G15 A;  3V1R A;  3O3G A;  1NJW A;  1MU2 A;  3VQ6 A;  4B8C A;  3L2W A;  3DLH A;  1VSL A;  3M8P A;  4DFP A;  1QTM A;  1U04 A;  5I42 A;  4NCG A;  4CE9 A;  4M3U A;  1U49 A;  2HHX A;  4B9S A;  3OVN A;  3SPZ A;  1BIZ A;  2RPI A;  4ELU A;  3K57 A;  2YKM A;  3QES A;  4PQU A;  1C1B A;  3NCI A;  4PUO A;  1TL3 A;  3MAQ A;  1KVA A;  3P1G A;  3V6D A;  4AHT A;  3P83 D;  1NKB A;  4DFK A;  1KFS A;  1A5W A;  4FJ5 A;  3V1Q A;  4CF9 A;  2PYJ A;  1HQE A;  1VSH A;  4DLE A;  4DU3 A;  4GMJ B;  5EU7 A;  4W5R A;  2DTU A;  1TAQ A;  1S9G A;  1ZBH A;  4FLT A;  3QEI A;  4CJW A;  1Q9Y A;  2E6L A;  3ZSQ A;  1X9M A;  1QSL A;  2G8H A;  3IS9 A;  4N47 A;  3SV4 A;  3ZT0 A;  4KHW A;  4FK2 A;  3RR7 A;  3BGR A;  4Z4I A;  3SV3 A;  3SZ2 A;  4DF8 A;  3TAR A;  3HPH A;  5D3G A;  3LZI A;  2XY6 A;  2B4J A;  3TAM A;  4CHZ A;  1WSH A;  3LZJ A;  3SYZ A;  3OYJ A;  1IKV A;  3OYC A;  3KD5 E;  4RW4 A;  3EYZ A;  4L8R B;  3AO1 A;  5FRO A;  3TI0 A;  1C1A A;  3DRR A;  4KTZ A;  4W5Q A;  3ZT4 A;  4IBN A;  1LWF A;  4C8N A;  4DTP A;  4ELV A;  4FJJ A;  3QEW A;  2Y1I A;  1WAF A;  2P1J A;  3T3F A;  2HHW A;  1DTT A;  5J2Q A;  3HP9 A;  3LAL A;  3AVB A;  3I0S A;  2VWK A;  2YNI A;  4RW9 A;  3LWL A;  4HUF A;  2YKN A;  4CK2 A;  4C8O A;  4Y1C A;  2E6M A;  3AVG A;  1SKW A;  1C1C A;  1HMV A;  4YFU A;  4F3O A;  4NCB A;  2D0C A;  2Z1J A;  4M3Z A;  3ZSO A;  3KK3 A;  1NOY A;  4I9Q A;  2KQ2 A;  1NJX A;  1S6P A;  3I0R A;  1VRT A;  4E7K A;  4DQS A;  2I5J A;  3OY9 A;  2EHG A;  1L3V A;  3QEV A;  5HLF A;  4NYF A;  4ID1 A;  1RBR A;  1S5J A;  4DMN A;  4FLY A;  1IKX A;  4KV8 A;  1U48 A;  4QCL A;  3CM5 A;  1UA0 A;  4FYD A;  1Y97 A;  1RBT A;  3CFR A;  1IO2 A;  1RBV A;  3LP1 A;  4O0I A;  4AHV A;  3KLE A;  1C6V A;  4F4K A;  4AHS A;  4K8X A;  3DLE A;  3LP2 A;  3NF7 A;  3LWM A;  1RTI A;  5DK5 A;  1VRU A;  4H8K A;  2ZD1 A;  2FBV A;  1DTQ A;  4DLG A;  4W5T A;  1NK9 A;  3SPY A;  2YHA A;  4CFA A;  1XHZ A;  3HYF A;  2Z1G A;  2QKK A;  2HHS A;  1NK6 A;  3DLB A;  1TV6 A;  3PUF A;  4O0J A;  1BHL A;  1F21 A;  1EP4 A;  1FK9 A;  3NF8 A;  4M45 A;  3D0P A;  1YTU A;  2Z1H A;  1Q8I A;  1QS4 A;  4E7J A;  2HW3 A;  2HB5 A;  1T7P A;  4EZ6 A;  3LP3 A;  1NKC A;  4CF2 A;  2WON A;  4AHR A;  4CJE A;  3U3Y A;  3V4I A;  3KD1 E;  2RF2 A;  3QLH A;  3T1A A;  3QER A;  3BDP A;  4FJ7 A;  1IKW A;  3IAY A;  2GUI A;  4E1M A;  1X9W A;  4DTJ A;  3NHG A;  4EZ9 A;  3MXI A;  3AVN A;  3E01 A;  4CEE A;  2PZS A;  3M8S A;  1JLE A;  1S9E A;  1KCF A;  2VWJ A;  2HVH A;  4FLZ A;  3AVK A;  3HST B;  3ZSY A;  4CEA A;  3KJV A;  3QNO A;  1D9D A;  1RBU A;  4IFY A;  2IC3 A;  4H4O A;  2FC0 A;  3V1O A;  4FLW A;  2KW4 A;  2G8F A;  2BGG A;  3G10 A;  1TKD A;  2VG7 A;  1NK4 A;  5HBM A;  3ALY A;  4CEC A;  3DRS A;  3QO9 A;  2OPQ A;  4CK3 A;  3VQP A;  3ZSW A;  3TAP A;  4N5S A;  1DLO A;  2YNF A;  4GW6 A;  2DFF A;  4J2A A;  1CXQ A;  1TKX A;  3AA3 A;  4C8K A;  3DRP A;  3SUN A;  4FXD A;  4DTO A;  2Z1I A;  3KTQ A;  1HPZ A;  3ZSX A;  3VN5 A;  4FJL A;  3MEE A;  2YHB A;  3F9K A;  4KHY A;  2DFH A;  3QEP A;  4BWM A;  3AO5 A;  3PO5 A;  1NJZ A;  1SKS A;  1YVU A;  4HCB A;  4Z4C A;  4CJU A;  4NCA A;  3M8Q A;  4M3X A;  4CJQ A;  4BE1 A;  2BE2 A;  4KFB A;  5HP1 A;  4LSL A;  3B6O A;  1CZB A;  4CED A;  2HVI A;  3OYK A;  4OKK A;  4HHT A;  3TAB A;  4N76 A;  1QQC A;  3VQ5 A;  1HNV A;  2X78 A;  3RMA A;  2BAN A;  3DLR A;  1REV A;  1RT2 A;  2ETJ A;  1O1W A;  1Z25 A;  4HVJ A;  4EP5 A;  3OYI A;  4B9U A;  1B9D A;  1TGO A;  3RR8 A;  2ATQ A;  3HXM A;  3A2F A;  3C94 A;  4CGJ A;  2Y1J A;  1LW0 A;  1RTH A;  3HVT A;  4J2B A;  2F8T A;  3WNE A;  2HHU A;  3K2P A;  5HRS A;  4QAG A;  2F8S A;  3ZSZ A;  4GVM A;  4CHY A;  2D0A A;  3TR8 A;  1WNS A;  3WNH A;  3CM6 A;  3LP0 A;  4FM1 A;  3PX0 A;  1BGX T;  4DQQ A;  1ZBL A;  1RCH A;  3VQ9 A;  3HJF A;  4CJP A;  2OPP A;  1LAW A;  5JS2 A;  5DMR A;  3HO1 A;  2YNH A;  3OS0 A;  2G8V A;  3NH2 A;  4KTW A;  3VQD A;  4FZY A;  1RBS A;  2NUB A;  4IG0 A;  4DS5 A;  3SQ1 A;  3WNG A;  1TK5 A;  1A5X A;  5SWM A;  3CFO A;  3L2V A;  3OYN A;  4KHQ A;  1BQM A;  1HRH A;  4AHC A;  5K14 A;  4RW8 A;  1A5V A;  1HQU A;  4I2Q A;  4FVM A;  5E41 A;  3L3V A;  4N41 A;  4CIG A;  4E0D A;  1IG9 A;  1WN7 A;  4KHU A;  3L2U A;  3TWH A;  5C42 A;  1U45 A;  3ZSV A;  4C8M A;  1Q9X A;  4KI6 A;  1JXB A;  1QHT A;  4M42 A;  1HYV A;  4FJH A;  3VQE A;  3OS2 A;  3S3M A;  4W5O A;  1RTD A;  4FLV A;  3AA2 A;  4MQ3 A;  4FJK A;  4CHO A;  3U6F A;  3VQC A;  1T03 A;  4OLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...