4LF5K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lf5K00
4JV5K 4B3RK 5IWAK 3J81O 4JI8K 4K0KK 2UUBK 4LFCK 1IBMK 4JI6K 2UU9K 4X62K 5FLXO 4DV3K 4V19S 3JAMO 4DR2K 1XNRK 4NXMK 3J80O 1XNQK 1FJGK 2HHHK 4B3SK 2UXBK 1N33K 4AQYK 4JI7K 4LF4K 4LF7K 1N34K 1HNZK 1HR0K 5AJ3K 5LMUK 4DUZK 5LL6Z 4B3TK 2E5LK 4DR1K 5LMNK 2F4VK 1IBKK 1J5EK 4LF8K 3T1HK 4DV6K 1XMQK 4CVNE 4X65K 4DR6K 3J7AP 3J7YP 4DR3K 5A2QO 1N32K 4JI4K 4LFBK 4DV0K 4OX9K 4DR7K 4GKJK 5BR8K 4DUYK 2UUAK 2UXDK 2ZM6K 4JI1K 4JI2K 4GKKK 4DV5K 4YHHK 4LF6K 4DR4K 4DV7K 1HNXK 4DV1K 1IBLK 3OTOK 4LF5K 4CW7B 4JI3K 2UXCK 4JI5K 1HNWK 4JYAK 4YY3K 1XMOK 4LF9K 5IT9O 4LFAK 4DV4K 4B3MK 4X66K 2VQFK 4KHPK 1I94K 3T1YK 4X64K 2UUCK 4DR5K 4NXNK 1N36K 2VQEK 4DV2K 4JI0K
chains in the Genus database with same CATH superfamily
4BY9C 4CJKA 1KVCA 1Q82O 2PY5A 3IAYA 1KXPA 4H8KA 3O3GA 1NK9A 1NGGA 3LDPA 5EVZA 4K0KK 3WXKA 4FJGA 4MLHA 4AHRA 2A3ZA 3V1OA 1X1PA 4FYDA 1WAJA 4BC4A 1J9AA 1VQMN 3MXJA 4IG3A 1NU0A 2D0PA 5ADXA 4NCAA 2HBKA 4YOTA 4CJFA 4CHYA 3DI6A 4M41A 4BQLA 3H1VX 4JK8A 3TPQA 3MCAB 5C15A 4DSIA 3C94A 4DS5A 5AQRA 2HBMA 4C8NA 4YORA 3ZX3A 3RSEB 3DLLL 4CJ3A 2IVOA 3K2PA 3P31A 3UB5A 5BRFA 4W5QA 3SUQA 3F9KA 3OS0A 3JSMA 1IKWA 1KAXA 3CF5L 1IG8A 2GUIA 4O4GA 3D2FB 3SYZA 2E2QA 3CQ8A 3J7AP 3V1RA 1VSLA 4OPHA 4OGEA 1WSIA 3NAEA 5C2FA 4FWLA 4KI4A 4CEOA 4LSLA 3RMDA 3MEGA 1GLFO 3P83D 1WSJA 4YHHK 1NJZA 5C12A 1FKPA 4IBNA 5AQTA 5AQLA 3O1WA 4DV7K 3KWGA 4FSVA 3SV3A 4B1WB 3HM8A 1BIZA 1VQKN 4PA1A 4BR0A 3SAGA 4WQ5C 1NKBA 3O80A 4AHTA 1I94K 3ZSXA 4RTFD 3SZ2A 4HWIA 1S6QA 3CMEN 3OY9A 4PWDA 4M45A 3FE1A 3OYAA 1RTDA 4OPKA 4DTXA 2QTDA 3VF4A 4DSEA 2VG7A 3CIPA 4KPYA 5AFUA 4KB1A 1W2BM 2UUBK 1KC8O 3E01A 4CGHA 2ZQBA 2UU9K 4RWTA 2FF6A 3QEIA 1BI4A 2VG5A 5DMRA 4ZHRA 4DV3K 4WFAL 1RT3A 4KI6A 3VESA 5M1OA 3CC2N 1TUUA 1WOQA 3LWLA 2O8DA 2P5OA 4CIEA 4PY5A 3VQQA 3S3OA 1FJGK 4G1QA 4CZKA 2HHHK 4CD3A 4YFUA 5H1SQ 4FXDA 3SQ2A 2BGGA 1C1BA 3ZYYX 1VQ7N 1U45A 3CI5A 3THWB 4NCGA 1BU6O 3OJUA 4FLWA 4A2BA 3NMUA 1B9FA 4JKDA 5ADXH 3R8EA 3HVTA 4OLBA 2YNIA 1D5AA 2GX9A 3DWLA 3U3GA 4OO1J 5M1QA 4WF9L 1XMQK 3QBWA 4WQ5A 3IMXA 4CF0A 1XHXA 2FBVA 3TSUA 4PHTX 4XH1A 4B8AB 4B8CA 3H08A 5I42A 1WBDA 3QEXA 4IOXA 2A41A 3BF3A 5M1PA 5EX5A 4DV1K 3LP2A 3MX5A 3HO1A 1DTTA 5J2PA 3MK6A 3J8AA 4H4MA 4ID5A 4BC5A 4DTPA 1NLVA 4L8RB 4C1NK 3LAMA 4CD1A 4IOCL 2E4LA 1A5XA 4KBOA 2OPQA 3G71N 3FZFA 3HVRA 2VQFK 5FDLA 4H5NA 4JKAA 1FKOA 4CECA 1TUYA 4CBUA 4KHQA 1LV5A 3SK3A 1IKXA 4LH4A 1VQ5N 5JMVA 2GBZA 4K43A 2P9SA 3RMAA 4E7JA 2QKKA 2OTJN 2D0OA 2DPNA 3PO4A 1B9DA 4RW9A 3WNHA 4O8UA 1HNIA 1EWQA 4GNIA 4V19S 3H3NO 3THVA 3MEEA 2ITMA 1GLDG 1ZBIA 2D0AA 1VK0A 1VSIA 3LWMA 5AFUH 2P9LA 2O8BB 1QHAA 5CYQA 5KRTA 1V4TA 4KH6A 4Z0UA 1NBWA 3IDHA 1NK7A 2ASPA 5HROA 2AP1A 3GDQA 4UQGA 1C0FA 4YOUA 5KGXA 1NKCA 3T7ZA 1RTJA 3BEXA 3KVGA 3VQEA 1ILYA 3VQCA 4OPAA 1W7AA 4E1JA 1UWBA 4FW1A 3TAPA 2HVIA 3CPWM 3R3LA 3QBXA 4DR3K 4WE1A 2XO7A 1QVGM 1QZ5A 3L2UA 1TVRA 4GKJK 3SI6A 4PKIA 4HHTA 3O08A 3L0QA 1JLGA 1BCMA 2Q0UA 3WUHA 4XH5A 4FJ8A 3V1QA 2Q0RA 3WXJA 4W5RA 4DLEA 3CFPA 3VQBA 1SKWA 1IBLK 2ZGZA 5FROA 3IUCA 3MN5A 2HHSA 4CZEA 3S3NA 3K57A 3VA0A 4LFAK 4DTNA 1VQNN 4FPAA 1X9WA 4A62A 3AA2A 1WBBA 1CLQA 3E66A 4DQSA 1NJYA 5JVHL 4KH5A 2GEMA 4F2SA 3UE5A 3L2RA 4H0XB 4BVOA 4YOWA 1BIUA 4ILGB 4DQIA 4FOIA 4AHCA 4BG9A 5EU7A 3SJHA 1SL1A 2PAVA 3NGIA 4B9MA 4H5VA 2ITGA 4AILC 4DSJA 4BRNA 4QS9A 2QWMA 1TK0A 2YI1A 1SV5A 4FJNA 1T6CA 1ZBFA 4JS4A 3AVHA 3C6HA 5AZIA 5FPMA 3CC4N 1Q86O 2KFNA 2A5XA 2WONA 1VRUA 4YDUA 5BN8A 4KRFA 3ID8A 4BDZA 1QHTA 3OYMA 4N47A 1V4SA 1KVBA 4JEPA 4IZ9A 3J80O 3CCQN 1LAVA 3OYBA 3MN7A 1RT2A 3EO3A 2X74A 3C7NB 3L3UA 3MN9A 3ZSVA 5HOOA 1VQ6N 4CE9A 4FVMA 1N34K 4KTWA 4DB3A 4DUZK 5F2RA 3I8BA 5BPNA 3NVKA 5LMNK 3KKRA 1XWLA 2X6NA 3D2EB 1HQUA 1J6ZA 1TYQA 1YT3A 4DU1A 4DQ8A 1CZ9A 3SQ1A 3WNEA 4FPBA 1DGKN 3K59A 4QS7A 2NRTA 4FWMA 3TAMA 5BPMA 4DR7K 1NM1A 2GELA 4EZ9A 4DTRA 3O6WA 4WCEL 4IOAL 2GWKA 4J2AA 1VSEA 1E4FT 2HSTA 4JK9A 1S1VA 3CC7N 3A5MC 3NGYA 1QSSA 1BWFO 1WN7A 4ELUA 1ZBHA 2AA4A 3V9WA 4EIAA 3MWPA 2WC9A 4CGJA 2UXCK 1NGDA 1RDWX 3QINA 3IRXA 4R5PA 3CJ7A 5KI6A 1T8EA 3T1YK 1TL3A 4X64K 3CM5A 4OGCA 2F9WA 4E19A 3UKUB 3D6RA 1K9MO 3THYB 4F4KA 1VSKA 5CZ1A 4YOXA 1NJXA 2PZSA 1DEJA 2HHQA 1X9JA 4JV5K 1YTUA 1BO5O 4OKEA 1TGOA 1QVFM 2HMPA 4QAGA 4BACA 4JI8K 3ULEB 1IKYA 4KHWA 4Z4IA 1NWKA 5KQDA 2WTUA 2Q36A 4EZ6A 2Y1IA 3SBGA 3HXMA 3ZSRA 4GVEA 5ELZA 4MQ3A 4IJAA 1BL3A 4FK4A 2ATQA 4B9VA 3A5NC 3A0IX 5FRMA 1XNQK 5I9EB 1L3UA 4OJRA 3HBTA 3ENOA 3RSEA 3KJVA 4AM7A 2KHOA 4CJLA 2RE2A 1KVAA 3DRRA 2OZMA 2Z1HA 4B3TK 3D2FA 4CJVA 5F0XA 1YUWA 4DR1K 3BGRA 3SBTA 3SCXA 2F4VK 2EHGA 3EE8A 2Q1NA 2OPRA 2VWBA 4FM0A 2YKMA 3OYNA 2G8IA 3LZIA 5AQXA 5GAHP 3UIQA 2E1YA 3MXIA 4PQUA 1U49A 3R1XA 1TKZA 1WB9A 3U4LA 1EO1A 4YOVA 3OJSA 3FR0A 3PV8A 2E2OA 2P9UB 5HRRA 5M1FA 2IAJA 5E26A 4U7BA 2XY5A 3OYFA 2KW4A 2YHXA 4C8LA 1BQMA 1D4XA 3M8SA 5AQPA 2G8HA 1S1TA 4JI3K 4ISEA 4HCCA 1B92A 1A5VA 1YF5L 4O5BA 5CZ2A 4KHPK 2NRRA 1U6ZA 4KTZA 5TKYA 1IH7A 3M8PA 4NLBA 4XEIA 1VQPN 1VQLN 1VSMA 4JI0K 3LAKA 1N6QA 4UY8O 4Q0BA 5AQVA 2BDPA 3TAGA 3OS1A 4EP5A 1SUQA 3ZT0A 3S9HA 3EY1A 1D9FA 4LFCK 4GV3A 1U4BA 2A40A 3OW2M 1SQKA 3EZ5A 4BDPA 5JICA 4DSKA 4IFEA 2Q2RA 1RT7A 1D8YA 1HJOA 1IG9A 4JKFA 1LCUA 2QWQA 4J2EA 1C1AA 2W40A 4QCLA 1YVUA 3I0SA 1YJNN 4JD2B 2OCEA 4DU4A 4BG8A 3THWA 4DSFA 1QSLA 2E8AA 1SKSA 3QIPA 3OYIA 3ZSOA 2HNDA 3VENA 3AVMA 5HRSA 1X3NA 4CHQA 3KK3A 3ZT4A 2HNYA 4HCBA 2BUPA 1EWRA 3DLBA 4FLUA 4CGGA 1U48A 3K5NA 5C42A 1JLBA 4DQRA 1KQSM 1HKBA 2G8KA 3SPZA 1X9MA 5E41A 4L3QA 3HTVA 5AQGA 1BA1A 3WEEB 3LPTA 3E9LA 4HVJA 1Q9XA 5E84A 5HLFA 4K25A 4KHUA 4JHDB 4AF1A 4FJIA 2PFUA 2FLOA 2F9TA 1SL0A 4CFCA 4B9SA 1O1WA 1K73O 4E7IA 3THXB 1YXQA 3DXKB 4B9UA 4DV5K 1GLAG 4Z94A 1NMDA 4DR4K 5HL7L 1WLJA 2QI2A 1LAWA 1I39A 5C2DA 3I33A 1M90O 2HBLA 1JLAA 2CH6A 3LDOA 4JYAK 4BRHA 5HP1A 1XMOK 1QQOA 2ASOA 4FK2A 3O4WA 4EFHA 2RPIA 1HKGA 4IG0A 2VG6A 3ZT3A 5GADP 4DR2K 3I8DA 2Q31A 3NFAA 4FO0A 1RBRA 1G15A 3HT3A 4IO9L 4BR9A 2HHTA 4N76A 3ZT2A 3VF6A 5EXWA 2X6SA 1TK8A 1FW6A 3AVNA 3M8RA 3DLGA 2O8BA 2F96A 3N4PA 3T69A 2EX3A 4KHSA 2W6LA 4K41A 4R79A 3VEYA 5CHIA 3LM9A 3TI0A 1OH5A 2UYTA 4N5SA 4B3SK 4ICLA 3VQ6A 3FZHA 4U67L 2NRHA 4E7HA 2UXBK 4IFYA 1RDCA 5AQOA 1VSHA 1HR0K 4KAZA 5LMUK 1NK8A 3TAQA 4CK1A 2YHAA 4RW6A 3QETA 1EP4A 1IBKK 4KHNA 1MWMA 4BGAA 2OYQA 3H3OB 1ZBUA 3SPYA 4CJ4A 2W42A 1NJWA 5A2QO 1N32K 4JI4K 3PIOL 4GW6A 1S22A 1LW0A 3TAEA 4B1XB 4CJEA 3ITHA 2KZMA 3LZJA 3CM6A 1K8AO 3EEQA 2UXDK 2AJQA 3SQ0A 4JI1K 4K8XA 4GKKK 3KK1A 4GVMA 1HNVA 4PL7A 4A57A 4KB0A 4LY7A 3K58A 1RFQA 1E4GT 3LALA 1LOTB 2HHUA 3CJCA 2QWLA 4KHYA 4DF8A 2JWLA 3TTFA 2O8EB 3VQ8A 1RDAA 1Q9YA 5FRNA 5BREA 4MDAA 4BREA 3DXMB 4YOYA 3DRSA 4FWRA 1J5OA 5JVGL 4B9QA 4WYBA 4RW8A 3W0LA 1NGJA 3OVNA 1DT9A 3VGMA 3S41A 3EZWA 4B1ZA 4FJLA 3LP1A 3FLCO 3IFRA 2NRWA 3AGKA 3QLHA 4DCHA 2P51A 3NDKA 1M1KO 2VWJA 4B9NA 4Z4EA 3AVFA 1DTQA 2FSKA 2P5GA 1KTQA 2Z1IA 4HTLA 4ISFA 1WSGA 4BRCA 3SAHA 3E1YA 2YX6A 3EL2A 3U8XA 2QA4N 4IDHA 4KKOA 3PSFA 4J2BA 1RGIA 4EAHD 3C7NA 1YI2N 3U3YA 2BTFA 1C6VA 3DLKA 1RNHA 3WXIA 4CHNA 1LWFA 2B6AA 4JRPA 1YVNA 4CFDA 3TTDA 3CG7A 3ZSYA 5JS2A 1XC3A 1NK6A 4JKGB 3KTQA 1KLMA 5KRSA 3WQTA 4LF4K 4C1NI 4FZXC 4FW2A 4KTQA 2D5RA 4PL8A 1HNZK 3D2EA 1JLCA 2FSJA 1HPZA 4CBXA 3ENBA 1S3XA 2YHYA 3QDKA 4RCHA 4JRQA 1NGHA 1BGXT 4LSNA 2QWNA 2ZJQL 1W9HA 4CIFA 2FBTA 4CFBA 1WSHA 4DG1A 1O13A 5AQWA 3AVBA 3JXUA 2GTDA 3N4QA 3AAPA 2OZSA 4DUYK 4JLHA 3ZETB 1TAQA 4B9LA 1SZ2A 4JS5A 4M3UA 1NGAA 3DOLA 3W3DA 4BC2A 4K42A 3U9ZA 5KTQA 4YDUC 1HNXK 3CQXA 5DK5A 3ZLJA 4ILJA 5FPDA 3V9SA 3UKUA 5IT9O 3TARA 3DLEA 1VQ9N 3THYA 2H3GX 5AQNA 5KPRA 1XHZA 2CGKA 1TKTA 3KLGA 3P1GA 2GUPA 1OH7A 3VQ9A 3V9UA 3U6FA 3A5LC 1R0AA 1NGIA 5AQFA 5CE3A 3BUZB 4Z4HA 3L3VA 1OVYA 4DQQA 3AVCA 1CXQA 3VEVA 4W5OA 3ULEA 4MO5A 1A5WA 3KWIA 4H0PA 4CK2A 5EY4A 3DMJA 3K5MA 4YNQA 2V7YA 3OYEA 3NF6A 1YITN 1TV6A 3QFPA 4CJUA 4MFBA 3OBYA 3CETA 3GOIA 3CFRA 3FZMA 3VEWA 2E2PA 1F21A 3AO1A 2WUSA 2NNWA 4FM1A 1ATNA 2A6AA 1WSEA 1Q81O 3A8YA 4PUOA 3QFUA 1NG9A 4FK0A 3HL8A 3NF7A 1KRPA 5JS1A 3ALYA 5GAEP 1HPMA 3VQAA 3NCIA 4AQYK 1JKHA 4BDYA 2J4RA 2A42A 3HOTA 3CCEN 1S1XA 2HMIA 3L2QA 2E5LK 5DM7L 4WQ4A 1GLJO 1LWCA 3VQ5A 3M5RA 4Y0WA 4Z4FA 4M7YA 3VTIA 3DM2A 1S9EA 3NGZA 4MLEA 2V7ZA 3EN9A 2I7NA 2P9UA 4AHUA 3CYMA 1CXUA 3O9RA 1MA9B 4FLTA 3A5OC 3BZKA 1HYZA 4DFPA 4GMJB 3P38A 4RG8A 3O9UA 2IS3A 4E7LA 4B1VA 1VAZA 2W41A 3WQUA 3M1FA 4DKWA 3RTVA 2YHWA 1VRTA 4ZTFA 3H1QA 3P39A 5AQMA 3AVKA 5HRNA 3FZLA 4FWPA 4FJ9A 2E2NA 3G25A 4CFAA 1S1WA 2FC0A 1ASVA 3VTHA 4H0TB 2IDOA 4ID1A 1N36K 1QSYA 4KV8A 4NLCA 4A59A 1HMVA 3AO3A 1QS4A 4DTMA 4B3RK 1LW2A 4CGDA 3G6EN 4OLAA 2WFBA 4IWVA 4JI6K 3IS9A 4FL9A 4JAXA 4NO7A 3FFKB 3L2VA 4JD2A 2F7TA 1T03A 1VSFA 1RDBA 4NXMK 3EYZA 2I5JA 4B1YB 4A5AA 4BR5A 1EQYA 1HKCA 5SZTA 5CYMA 5MLCQ 4CGFA 1GLLO 3WNGA 4Z4CA 2P9IB 4O0IA 2VGNA 3WEEA 4IEIA 4DWIA 1L5UA 1HLUA 3SNNA 4OVLA 3ZSWA 2O8CB 1YAGA 1NMNA 4JHDA 4CF9A 3PIPL 1S1UA 4NYFA 4BR7A 4DR6K 4H5WA 3IKMA 4B08A 2R7YA 2CH5A 3HPHA 3PSIA 1QQNA 4A2AA 3QNNA 3O9TA 3VN5A 3THXA 4IKFA 3DXKA 4AH9A 2DFEA 5BR8K 4TSXA 1BG3A 3SJJA 2RKIA 1OKJA 2QK9A 3BF1A 3QB0A 3BDPA 2O4GA 3BZCA 3CERA 3ATVA 1SKRA 3LL3A 5DM6L 3JS6A 3AA5X 1I3AA 3HYFA 3KD5E 3OA9A 2HBJA 2P9PB 4E7KA 1NNEA 5AQSA 2YNFA 2KTQA 2NRZA 3CJAA 1HNWK 2YCHA 4O0JA 5BRDA 3OYKA 2YV0X 1S72N 4H0OA 4FWSA 3LP0A 4B3MK 4PKHA 2HW3A 3HSCA 3AA3A 4DFJA 2V52B 3CCRN 3HP6A 1UA1A 4CESA 1Z6RA 1EX4A 2BE2A 4NXNK 1Y64A 3AAQA 1JCGA 4FLXA 3VQPA 2A1RA 5IWAK 1QQMA 3GBTA 3VQDA 1RT5A 2HVHA 4CF1A 3CCLN 4IJNA 2DFHA 3L8BA 2YJEA 4C8MA 2HHXA 4M63C 1C0MA 2OPPA 3CFOA 4CERA 1SS6A 2D0CA 1WNSA 4CZLA 4FJMA 3PX4A 3V9ZA 2JWKA 4M42A 2JGUA 4BWMA 4WFNL 1OH6A 2KZZA 4FJ7A 4FJHA 1BISA 2PYJA 4M7XA 3J7ZO 4H0VB 1Y97A 3VQ4A 3DRPA 3RWUA 5FPNA 1UOCA 2P9NB 4BRAA 3MMVA 3H45C 3ZEUB 1GLEG 3H6EA 3KLHA 3E9OA 3TWHA 4CVNE 3SUNA 3EKUA 1K8KB 4DTJA 2DFFA 3GE1A 1KD1O 3TSPA 5CR4A 3V81A 3AV9A 3QICA 3HSTB 4B1UB 2O8FB 1N5YA 2HOEA 4H4OA 2V51B 1NK5A 3PY8A 3FFIA 3M6GA 3VA3A 2GV9A 5SWMA 3RR8A 2NUBA 1X9SA 4H0YB 3C95A 4CF8A 1QE1A 3WXMB 3HZ6A 3CD6N 2O8EA 4CF2A 3NH0A 1ATRA 1HJRA 4CJSA 4DHYA 4LF5K 2HF3A 3L4QA 1NOZA 3DXMA 4CW7B 3TABA 1NOYA 4DLGA 1IKVA 4YY3K 3HI0A 3M3ZA 4C8KA 2P9KB 1IO2A 4OKKA 1ATSA 2IC3A 2OA8A 3HRGA 3LDSA 4M3XA 3MDQA 1NKEA 1C1CA 1S9GA 1Q8IA 4JKBA 1RTHA 4IDKA 4DSLA 5C24A 3KLFA 4EHUA 3K0SA 5AZJB 1RBUA 4DS4A 4F3OA 3LM2A 2BH1A 3TR8A 4CGIA 2HHVA 3C6AA 4FVUA 4GV6A 5B8HA 2XY7A 4E1MA 4WFBL 1X3MA 3JAMO 5J1EA 1BQNA 4CZMA 4N56A 1XNRK 4F8RA 4NCBA 1KLNA 1KFDA 4A5BA 3K5OA 4JKGA 2WOMA 4W5TA 1RBTA 2IVPA 4JKEA 3ISNC 4DTUA 3ULDA 4FWQA 3OS2A 5LY3A 1MDUB 3F2KA 4IXCA 4CEAA 5M1NA 4MDBA 1NGCA 1FXXA 2E6LA 3JYTA 1ASWA 4O5FA 4LF7K 3P5JA 3QMLA 3I55N 3CJ1A 1NK0A 4I6MB 2G8FA 3KZBA 1P90A 2E88A 4KO0A 1VSJA 3WXLA 3G0ZA 3QO9A 3QESA 3MX2A 3HP9A 1J5EK 4LF8K 4DV6K 4E3SA 2NRVA 3Q7BA 4BRDA 2HB5A 2YHBA 3T3FA 4AM6A 1RBSA 3HM9A 3ZETA 3ZSZA 3QEVA 3AVJA 5J2NA 4CHPA 5T7BA 3TU5A 3HOSA 4BRPA 3SMSA 4FJ5A 2PBDA 2KFZA 3SLCA 4JI2K 3CMAN 1WAFA 1W0HA 4RW7A 1U2VB 5AQKA 5BR9A 1E3MA 2B4JA 4O55A 3MXMA 4DF4A 5J2MA 4ILHA 3MWTA 3OYGA 3C65A 4IO8A 5K14A 1VQ4N 3EKSA 1VHXA 3QIOA 3VQ7A 1T7PA 2FXUA 1P8ZA 3HPGA 2VYPA 1Q7YO 4CCHA 4DU3A 3M8QA 3OBWA 2DY4A 2QM1A 2YKNA 5AQZA 4CEBA 4ZTJA 2UUCK 5HRPA 1YIJN 3UKRB 3I56N 3KD1E 3AARA 4FOEA 1GOAA 1XQSC 4I9QA 4AHSA 5LJVA 1RT6A 4BQZA 5AQUA 1RT1A 1BA0A 4QS8A 3RMCA 1D9DA 3AO4A 1KSPA 4C8OA 1EETA 1S5JA 4BRKA 5C10A 5GINA 1JL2A 3R6MA 3TANA 3HJFA 2Q3SA 5AQQA 4DMNA 3PX0A 3CHWA 4BRIA 3SUOA 5AQHA 2QWRA 5EOYA 2RN2A 1C0GA 3QEWA 3D0PA 1T6DA 4CJQA 1J53A 3VETA 1RCHA 1C0TA 4HUGA 5HBMA 2GWJA 3R9PA 2VCPA 1Z05A 3VOVA 1L3SA 1N33K 5KGWA 4M3RA 3O9SA 1Z26A 4C23A 3QEPA 3MCPA 5AJ3K 3OYCA 3AA4A 3F9MA 2KLAA 1HX1A 3KIOA 4CEZA 1HRHA 2F8TA 4CZGA 3ENHA 5JLHA 4BVPA 1BDGA 3DOKA 1C0UA 4BRFA 3SUPA 3NVMA 1S6PA 4BRMA 3D45A 2Q97A 3J7YP 3CJBA 4CJRA 4LFBK 3ASMA 5KQ8A 1QQCA 1JJ2M 1DLOA 2CGJA 3B8AX 1ZC6A 4CHOA 3TAFA 3V4IA 1FK9A 3KHYA 4LF6K 3A2FA 2A1SA 4JNEA 5AR0A 2WBNA 5BPLA 2IOCA 1ESVA 3CXCM 1CZAN 2O4IA 3P4IA 4FZZA 3OTOK 3H46O 4DFMA 2FBYA 2BANA 3VGKA 2P1JA 4EP4A 5CY4A 4O44A 3BY5A 4FWOA 2ZWHA 3O4QA 4XH4A 5JLFA 4Y1CA 3L4IA 4EHTA 4X66K 2OANA 3ZX0A 1OVQA 2IIRA 2DTUA 1U04A 2ZF5O 3QNOA 2HNZA 3O3HA 4CJ7A 1NGEA 3O9QA 4BRLA 2E6MA 2YJFA 4DR5K 4CZHA 4CEDA 1W97L 2CGLA 1HUXA 5FPEA 4FJJA 3WNFA 4WQ4C 4CJ5A 1QTMA 4LC9B 4CZJA 4CEQA 3MN6A 4FJXA 3SAFA 3F73A 3MECA 1BOTO 1T05A 2QXLA 4ELTA 3VERA 2HF4A 3MEDA 2IVNA 3AGRA 1JXBA 3C6TA 1T44A 4BE0A 3AVIA 3BP8A 4FM2A 3GL1A 5KPZA 3VEZA 4LD0A 1BI4B 4Q5VA 4CJWA 3OYLA 2ZGYA 3ZCMA 2P9IA 2O8DB 4KREA 2VGMA 1MWKA 4JI7K 1JXEA 4W5NA 1K6YA 2NRXA 3DJCA 3VF2A 3DYAA 3B6OA 2O8CA 5LL6Z 4F2RA 2I7PA 1ITGA 4JKHA 5D3GA 2G8WA 3RVCA 3T1HK 3T1AA 4H5RA 4FWKA 4B3OA 2NLXA 3I0RA 4BROA 4OX9K 4LH5A 1QZ6A 4BC3A 3HPOA 1JLFA 1YHQN 1VQ8N 1JLEA 5GIOA 1RDUA 4CHZA 4AHVA 1CZBA 1IV0A 3ZSQA 1GLBG 2P9PA 3LP3A 5AQIA 3L2WA 1REVA 3PUFA 2KKZA 4CIGA 4IFVA 1XC9A 1ZBSA 3QERA 2FSNA 3LDNA 1T3VA 4HTUA 4JI5K 3KLIA 2ZE2A 3OYDA 1ZBLA 1Z25A 1YJ9N 1TL1A 4F9OA 2QWPA 1GOCA 2ZD1A 2QKBA 3LPUA 4CZIA 3DLRA 4QOZB 2D4WA 3D7EO 4FZYA 1UA0A 3CQYA 3FGUA 4FWNA 5BN9A 4J8FA 5GAGP 4Z4GA 2EWSA 3LANA 3PO5A 3L6QA 5TKWA 1KCFA 2RHKA 4B9TA 3VEOA 3J81O 2P9SB 2KQ2A 3O1BA 5J2QA 1U47A 3ID6A 4Y1DA 4X62K 5FLXO 4I2PA 1OH8A 4MO4A 1BHLA 2NZTA 3ZX2A 3G10A 3U9DA 5C25A 5BRHA 3FZKA 2P9LB 3TSQA 3VGLA 2W6KA 4I7FA 2P9NA 4HUFA 3ATUA 1LWEA 3Q7CA 3ZEUA 2FBXA 4FJKA 1Q18A 1RDDA 4J2DA 4OKJA 1R59O 4FCYA 3C0BA 1K8KA 5F1XA 4M3TA 2FF3B 3G4SN 1TK5A 2ZJRL 1DKGD 3LDLA 3NBPA 1RILA 4DQPA 4BRGA 4CZFA 3NF9A 3CCVN 1TKXA 4FLYA 1NGBA 4F3TA 2O8FA 1VSDA 2OPSA 3AVGA 3CCSN 5M1KA 3E9PA 3C6UA 3VMFB 4ISGA 3AO2A 3CCUN 3S3MA 5LJWA 3NHGA 1HQEA 3O8MA 3OYJA 3NE6A 1H1VA 1SL2A 5C0YA 3AO5A 3AY9A 2XY6A 1G99A 1NGFA 3AVLA 4NYNA 3VPZA 3CCJN 3PX6A 3SMPA 2P9KA 1MU2A 4RW4A 1XI1A 4O8KA 3SQ4A 1HYVA 2XRIA 4LF9K 1UAXA 1SAZA 4DV4K 3TTCA 1XUPO 3O3FA 2XHBA 1EXQA 1JL1A 1J54A 2D0BA 2VWKA 1ZYQA 5AZJA 2HHWA 1RTIA 1ZXOA 3AVAA 2ETJA 1BUPA 4DFKA 3RRGA 4BR4A 1IJJA 3F5TA 4DV2K 1RBVA 3RMBA 4BE1A 3RRHA 2G8UA 4K8ZA 2D1KA 1YTAA 1BCOA 3CJ9A 4I9LA 2Z1JA 2YNGA 2B5JA 4BWJA 1IBMK 4FLZA 4XIUA 1NJIO 3NH2A 4ELVA 4IEEA 2OTLN 3RR7A 5AZIB 4M3WA 3O5BA 4OPJA 1JCEA 2LSNA 4M3ZA 1HYSA 1RT4A 4FLVA 4GY2B 3DAWA 2QWOA 3MAQA 2F8SA 2ZJPL 2QW9A 2IGIA 4CEFA 1YJWN 4I6MA 3KLEA 4BE2A 3KK7A 3NF8A 3OYHA 4BR2A 5AQYA 3DLHA 4H03B 3WT0A 5KPTA 3OHRA 4N41A 3CPEA 4CK3A 3CCMN 3K9JA 1EKEA 3KKSA 4X65K 3NH1A 4CJTA 4CI6A 3ZT1A 5AQJA 4H5TA 1KFSA 4CBWA 3GG4A 3V6DA 4JKCA 1KAZA 3SV4A 2QXFA 3KK2A 5I3UA 2G8VA 1TYQB 4E0DA 4DV0K 3O4NA 3LDQA 2Z1GA 1L3TA 4M3YA 1NK4A 1GOBA 4E89A 2JLEA 3PLAA 2Y1JA 4G9ZA 5GIPA 1U2VA 4I2QA 4BRQA 2UUAK 1TAUA 4KH4A 3HK2A 4CJPA 4BGBA 4DTOA 2ZM6K 3K9KA 2E20A 4E1NA 4CEEA 1TKDA 1ASUA 1WUAA 4DTSA 2XY8A 4A61A 1N8RO 4NB4A 2QEXN 4GV9A 1GLCG 2E1ZA 3UKRA 2YNHA 1WSFA 3T19A 2ASMA 2RF2A 1JLQA 3V9XA 1VQON 3IG1A 4JN4A 4HUEA 1L3VA 4KFBA 1JCFA 4JK7A 2X78A 3K5LA 3EE9A 3B6PA 2PYLA 1KAYA 2VQEK 4PKGA 3VEXA
chains in the Genus database with same CATH topology
4JV5K 4B3RK 5IWAK 3J81O 4JI8K 4K0KK 2UUBK 4LFCK 1IBMK 4JI6K 2UU9K 4X62K 5FLXO 4DV3K 4V19S 3JAMO 4DR2K 1XNRK 4NXMK 3J80O 1XNQK 1FJGK 2HHHK 4B3SK 2UXBK 1N33K 4AQYK 4JI7K 4LF4K 4LF7K 1N34K 1HNZK 1HR0K 5AJ3K 5LMUK 4DUZK 5LL6Z 4B3TK 2E5LK 4DR1K 5LMNK 2F4VK 1IBKK 1J5EK 4LF8K 3T1HK 4DV6K 1XMQK 4CVNE 4X65K 4DR6K 3J7AP 3J7YP 4DR3K 5A2QO 1N32K 4JI4K 4LFBK 4DV0K 4OX9K 4DR7K 4GKJK 5BR8K 4DUYK 2UUAK 2UXDK 2ZM6K 4JI1K 4JI2K 4GKKK 4DV5K 4YHHK 4LF6K 4DR4K 4DV7K 1HNXK 4DV1K 1IBLK 3OTOK 4LF5K 4CW7B 4JI3K 2UXCK 4JI5K 1HNWK 4JYAK 4YY3K 1XMOK 4LF9K 5IT9O 4LFAK 4DV4K 4B3MK 4X66K 2VQFK 4KHPK 1I94K 3T1YK 4X64K 2UUCK 4DR5K 4NXNK 1N36K 2VQEK 4DV2K 4JI0K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 K;  4B3R K;  5IWA K;  3J81 O;  4JI8 K;  4K0K K;  2UUB K;  4LFC K;  1IBM K;  4JI6 K;  2UU9 K;  4X62 K;  5FLX O;  4DV3 K;  4V19 S;  3JAM O;  4DR2 K;  1XNR K;  4NXM K;  3J80 O;  1XNQ K;  1FJG K;  2HHH K;  4B3S K;  2UXB K;  1N33 K;  4AQY K;  4JI7 K;  4LF4 K;  4LF7 K;  1N34 K;  1HNZ K;  1HR0 K;  5AJ3 K;  5LMU K;  4DUZ K;  5LL6 Z;  4B3T K;  2E5L K;  4DR1 K;  5LMN K;  2F4V K;  1IBK K;  1J5E K;  4LF8 K;  3T1H K;  4DV6 K;  1XMQ K;  4CVN E;  4X65 K;  4DR6 K;  3J7A P;  3J7Y P;  4DR3 K;  5A2Q O;  1N32 K;  4JI4 K;  4LFB K;  4DV0 K;  4OX9 K;  4DR7 K;  4GKJ K;  5BR8 K;  4DUY K;  2UUA K;  2UXD K;  2ZM6 K;  4JI1 K;  4JI2 K;  4GKK K;  4DV5 K;  4YHH K;  4LF6 K;  4DR4 K;  4DV7 K;  1HNX K;  4DV1 K;  1IBL K;  3OTO K;  4LF5 K;  4CW7 B;  4JI3 K;  2UXC K;  4JI5 K;  1HNW K;  4JYA K;  4YY3 K;  1XMO K;  4LF9 K;  5IT9 O;  4LFA K;  4DV4 K;  4B3M K;  4X66 K;  2VQF K;  4KHP K;  1I94 K;  3T1Y K;  4X64 K;  2UUC K;  4DR5 K;  4NXN K;  1N36 K;  2VQE K;  4DV2 K;  4JI0 K; 
#chains in the Genus database with same CATH topology
 4BY9 C;  4CJK A;  1KVC A;  1Q82 O;  2PY5 A;  3IAY A;  1KXP A;  4H8K A;  3O3G A;  1NK9 A;  1NGG A;  3LDP A;  5EVZ A;  4K0K K;  3WXK A;  4FJG A;  4MLH A;  4AHR A;  2A3Z A;  3V1O A;  1X1P A;  4FYD A;  1WAJ A;  4BC4 A;  1J9A A;  1VQM N;  3MXJ A;  4IG3 A;  1NU0 A;  2D0P A;  5ADX A;  4NCA A;  2HBK A;  4YOT A;  4CJF A;  4CHY A;  3DI6 A;  4M41 A;  4BQL A;  3H1V X;  4JK8 A;  3TPQ A;  3MCA B;  5C15 A;  4DSI A;  3C94 A;  4DS5 A;  5AQR A;  2HBM A;  4C8N A;  4YOR A;  3ZX3 A;  3RSE B;  3DLL L;  4CJ3 A;  2IVO A;  3K2P A;  3P31 A;  3UB5 A;  5BRF A;  4W5Q A;  3SUQ A;  3F9K A;  3OS0 A;  3JSM A;  1IKW A;  1KAX A;  3CF5 L;  1IG8 A;  2GUI A;  4O4G A;  3D2F B;  3SYZ A;  2E2Q A;  3CQ8 A;  3J7A P;  3V1R A;  1VSL A;  4OPH A;  4OGE A;  1WSI A;  3NAE A;  5C2F A;  4FWL A;  4KI4 A;  4CEO A;  4LSL A;  3RMD A;  3MEG A;  1GLF O;  3P83 D;  1WSJ A;  4YHH K;  1NJZ A;  5C12 A;  1FKP A;  4IBN A;  5AQT A;  5AQL A;  3O1W A;  4DV7 K;  3KWG A;  4FSV A;  3SV3 A;  4B1W B;  3HM8 A;  1BIZ A;  1VQK N;  4PA1 A;  4BR0 A;  3SAG A;  4WQ5 C;  1NKB A;  3O80 A;  4AHT A;  1I94 K;  3ZSX A;  4RTF D;  3SZ2 A;  4HWI A;  1S6Q A;  3CME N;  3OY9 A;  4PWD A;  4M45 A;  3FE1 A;  3OYA A;  1RTD A;  4OPK A;  4DTX A;  2QTD A;  3VF4 A;  4DSE A;  2VG7 A;  3CIP A;  4KPY A;  5AFU A;  4KB1 A;  1W2B M;  2UUB K;  1KC8 O;  3E01 A;  4CGH A;  2ZQB A;  2UU9 K;  4RWT A;  2FF6 A;  3QEI A;  1BI4 A;  2VG5 A;  5DMR A;  4ZHR A;  4DV3 K;  4WFA L;  1RT3 A;  4KI6 A;  3VES A;  5M1O A;  3CC2 N;  1TUU A;  1WOQ A;  3LWL A;  2O8D A;  2P5O A;  4CIE A;  4PY5 A;  3VQQ A;  3S3O A;  1FJG K;  4G1Q A;  4CZK A;  2HHH K;  4CD3 A;  4YFU A;  5H1S Q;  4FXD A;  3SQ2 A;  2BGG A;  1C1B A;  3ZYY X;  1VQ7 N;  1U45 A;  3CI5 A;  3THW B;  4NCG A;  1BU6 O;  3OJU A;  4FLW A;  4A2B A;  3NMU A;  1B9F A;  4JKD A;  5ADX H;  3R8E A;  3HVT A;  4OLB A;  2YNI A;  1D5A A;  2GX9 A;  3DWL A;  3U3G A;  4OO1 J;  5M1Q A;  4WF9 L;  1XMQ K;  3QBW A;  4WQ5 A;  3IMX A;  4CF0 A;  1XHX A;  2FBV A;  3TSU A;  4PHT X;  4XH1 A;  4B8A B;  4B8C A;  3H08 A;  5I42 A;  1WBD A;  3QEX A;  4IOX A;  2A41 A;  3BF3 A;  5M1P A;  5EX5 A;  4DV1 K;  3LP2 A;  3MX5 A;  3HO1 A;  1DTT A;  5J2P A;  3MK6 A;  3J8A A;  4H4M A;  4ID5 A;  4BC5 A;  4DTP A;  1NLV A;  4L8R B;  4C1N K;  3LAM A;  4CD1 A;  4IOC L;  2E4L A;  1A5X A;  4KBO A;  2OPQ A;  3G71 N;  3FZF A;  3HVR A;  2VQF K;  5FDL A;  4H5N A;  4JKA A;  1FKO A;  4CEC A;  1TUY A;  4CBU A;  4KHQ A;  1LV5 A;  3SK3 A;  1IKX A;  4LH4 A;  1VQ5 N;  5JMV A;  2GBZ A;  4K43 A;  2P9S A;  3RMA A;  4E7J A;  2QKK A;  2OTJ N;  2D0O A;  2DPN A;  3PO4 A;  1B9D A;  4RW9 A;  3WNH A;  4O8U A;  1HNI A;  1EWQ A;  4GNI A;  4V19 S;  3H3N O;  3THV A;  3MEE A;  2ITM A;  1GLD G;  1ZBI A;  2D0A A;  1VK0 A;  1VSI A;  3LWM A;  5AFU H;  2P9L A;  2O8B B;  1QHA A;  5CYQ A;  5KRT A;  1V4T A;  4KH6 A;  4Z0U A;  1NBW A;  3IDH A;  1NK7 A;  2ASP A;  5HRO A;  2AP1 A;  3GDQ A;  4UQG A;  1C0F A;  4YOU A;  5KGX A;  1NKC A;  3T7Z A;  1RTJ A;  3BEX A;  3KVG A;  3VQE A;  1ILY A;  3VQC A;  4OPA A;  1W7A A;  4E1J A;  1UWB A;  4FW1 A;  3TAP A;  2HVI A;  3CPW M;  3R3L A;  3QBX A;  4DR3 K;  4WE1 A;  2XO7 A;  1QVG M;  1QZ5 A;  3L2U A;  1TVR A;  4GKJ K;  3SI6 A;  4PKI A;  4HHT A;  3O08 A;  3L0Q A;  1JLG A;  1BCM A;  2Q0U A;  3WUH A;  4XH5 A;  4FJ8 A;  3V1Q A;  2Q0R A;  3WXJ A;  4W5R A;  4DLE A;  3CFP A;  3VQB A;  1SKW A;  1IBL K;  2ZGZ A;  5FRO A;  3IUC A;  3MN5 A;  2HHS A;  4CZE A;  3S3N A;  3K57 A;  3VA0 A;  4LFA K;  4DTN A;  1VQN N;  4FPA A;  1X9W A;  4A62 A;  3AA2 A;  1WBB A;  1CLQ A;  3E66 A;  4DQS A;  1NJY A;  5JVH L;  4KH5 A;  2GEM A;  4F2S A;  3UE5 A;  3L2R A;  4H0X B;  4BVO A;  4YOW A;  1BIU A;  4ILG B;  4DQI A;  4FOI A;  4AHC A;  4BG9 A;  5EU7 A;  3SJH A;  1SL1 A;  2PAV A;  3NGI A;  4B9M A;  4H5V A;  2ITG A;  4AIL C;  4DSJ A;  4BRN A;  4QS9 A;  2QWM A;  1TK0 A;  2YI1 A;  1SV5 A;  4FJN A;  1T6C A;  1ZBF A;  4JS4 A;  3AVH A;  3C6H A;  5AZI A;  5FPM A;  3CC4 N;  1Q86 O;  2KFN A;  2A5X A;  2WON A;  1VRU A;  4YDU A;  5BN8 A;  4KRF A;  3ID8 A;  4BDZ A;  1QHT A;  3OYM A;  4N47 A;  1V4S A;  1KVB A;  4JEP A;  4IZ9 A;  3J80 O;  3CCQ N;  1LAV A;  3OYB A;  3MN7 A;  1RT2 A;  3EO3 A;  2X74 A;  3C7N B;  3L3U A;  3MN9 A;  3ZSV A;  5HOO A;  1VQ6 N;  4CE9 A;  4FVM A;  1N34 K;  4KTW A;  4DB3 A;  4DUZ K;  5F2R A;  3I8B A;  5BPN A;  3NVK A;  5LMN K;  3KKR A;  1XWL A;  2X6N A;  3D2E B;  1HQU A;  1J6Z A;  1TYQ A;  1YT3 A;  4DU1 A;  4DQ8 A;  1CZ9 A;  3SQ1 A;  3WNE A;  4FPB A;  1DGK N;  3K59 A;  4QS7 A;  2NRT A;  4FWM A;  3TAM A;  5BPM A;  4DR7 K;  1NM1 A;  2GEL A;  4EZ9 A;  4DTR A;  3O6W A;  4WCE L;  4IOA L;  2GWK A;  4J2A A;  1VSE A;  1E4F T;  2HST A;  4JK9 A;  1S1V A;  3CC7 N;  3A5M C;  3NGY A;  1QSS A;  1BWF O;  1WN7 A;  4ELU A;  1ZBH A;  2AA4 A;  3V9W A;  4EIA A;  3MWP A;  2WC9 A;  4CGJ A;  2UXC K;  1NGD A;  1RDW X;  3QIN A;  3IRX A;  4R5P A;  3CJ7 A;  5KI6 A;  1T8E A;  3T1Y K;  1TL3 A;  4X64 K;  3CM5 A;  4OGC A;  2F9W A;  4E19 A;  3UKU B;  3D6R A;  1K9M O;  3THY B;  4F4K A;  1VSK A;  5CZ1 A;  4YOX A;  1NJX A;  2PZS A;  1DEJ A;  2HHQ A;  1X9J A;  4JV5 K;  1YTU A;  1BO5 O;  4OKE A;  1TGO A;  1QVF M;  2HMP A;  4QAG A;  4BAC A;  4JI8 K;  3ULE B;  1IKY A;  4KHW A;  4Z4I A;  1NWK A;  5KQD A;  2WTU A;  2Q36 A;  4EZ6 A;  2Y1I A;  3SBG A;  3HXM A;  3ZSR A;  4GVE A;  5ELZ A;  4MQ3 A;  4IJA A;  1BL3 A;  4FK4 A;  2ATQ A;  4B9V A;  3A5N C;  3A0I X;  5FRM A;  1XNQ K;  5I9E B;  1L3U A;  4OJR A;  3HBT A;  3ENO A;  3RSE A;  3KJV A;  4AM7 A;  2KHO A;  4CJL A;  2RE2 A;  1KVA A;  3DRR A;  2OZM A;  2Z1H A;  4B3T K;  3D2F A;  4CJV A;  5F0X A;  1YUW A;  4DR1 K;  3BGR A;  3SBT A;  3SCX A;  2F4V K;  2EHG A;  3EE8 A;  2Q1N A;  2OPR A;  2VWB A;  4FM0 A;  2YKM A;  3OYN A;  2G8I A;  3LZI A;  5AQX A;  5GAH P;  3UIQ A;  2E1Y A;  3MXI A;  4PQU A;  1U49 A;  3R1X A;  1TKZ A;  1WB9 A;  3U4L A;  1EO1 A;  4YOV A;  3OJS A;  3FR0 A;  3PV8 A;  2E2O A;  2P9U B;  5HRR A;  5M1F A;  2IAJ A;  5E26 A;  4U7B A;  2XY5 A;  3OYF A;  2KW4 A;  2YHX A;  4C8L A;  1BQM A;  1D4X A;  3M8S A;  5AQP A;  2G8H A;  1S1T A;  4JI3 K;  4ISE A;  4HCC A;  1B92 A;  1A5V A;  1YF5 L;  4O5B A;  5CZ2 A;  4KHP K;  2NRR A;  1U6Z A;  4KTZ A;  5TKY A;  1IH7 A;  3M8P A;  4NLB A;  4XEI A;  1VQP N;  1VQL N;  1VSM A;  4JI0 K;  3LAK A;  1N6Q A;  4UY8 O;  4Q0B A;  5AQV A;  2BDP A;  3TAG A;  3OS1 A;  4EP5 A;  1SUQ A;  3ZT0 A;  3S9H A;  3EY1 A;  1D9F A;  4LFC K;  4GV3 A;  1U4B A;  2A40 A;  3OW2 M;  1SQK A;  3EZ5 A;  4BDP A;  5JIC A;  4DSK A;  4IFE A;  2Q2R A;  1RT7 A;  1D8Y A;  1HJO A;  1IG9 A;  4JKF A;  1LCU A;  2QWQ A;  4J2E A;  1C1A A;  2W40 A;  4QCL A;  1YVU A;  3I0S A;  1YJN N;  4JD2 B;  2OCE A;  4DU4 A;  4BG8 A;  3THW A;  4DSF A;  1QSL A;  2E8A A;  1SKS A;  3QIP A;  3OYI A;  3ZSO A;  2HND A;  3VEN A;  3AVM A;  5HRS A;  1X3N A;  4CHQ A;  3KK3 A;  3ZT4 A;  2HNY A;  4HCB A;  2BUP A;  1EWR A;  3DLB A;  4FLU A;  4CGG A;  1U48 A;  3K5N A;  5C42 A;  1JLB A;  4DQR A;  1KQS M;  1HKB A;  2G8K A;  3SPZ A;  1X9M A;  5E41 A;  4L3Q A;  3HTV A;  5AQG A;  1BA1 A;  3WEE B;  3LPT A;  3E9L A;  4HVJ A;  1Q9X A;  5E84 A;  5HLF A;  4K25 A;  4KHU A;  4JHD B;  4AF1 A;  4FJI A;  2PFU A;  2FLO A;  2F9T A;  1SL0 A;  4CFC A;  4B9S A;  1O1W A;  1K73 O;  4E7I A;  3THX B;  1YXQ A;  3DXK B;  4B9U A;  4DV5 K;  1GLA G;  4Z94 A;  1NMD A;  4DR4 K;  5HL7 L;  1WLJ A;  2QI2 A;  1LAW A;  1I39 A;  5C2D A;  3I33 A;  1M90 O;  2HBL A;  1JLA A;  2CH6 A;  3LDO A;  4JYA K;  4BRH A;  5HP1 A;  1XMO K;  1QQO A;  2ASO A;  4FK2 A;  3O4W A;  4EFH A;  2RPI A;  1HKG A;  4IG0 A;  2VG6 A;  3ZT3 A;  5GAD P;  4DR2 K;  3I8D A;  2Q31 A;  3NFA A;  4FO0 A;  1RBR A;  1G15 A;  3HT3 A;  4IO9 L;  4BR9 A;  2HHT A;  4N76 A;  3ZT2 A;  3VF6 A;  5EXW A;  2X6S A;  1TK8 A;  1FW6 A;  3AVN A;  3M8R A;  3DLG A;  2O8B A;  2F96 A;  3N4P A;  3T69 A;  2EX3 A;  4KHS A;  2W6L A;  4K41 A;  4R79 A;  3VEY A;  5CHI A;  3LM9 A;  3TI0 A;  1OH5 A;  2UYT A;  4N5S A;  4B3S K;  4ICL A;  3VQ6 A;  3FZH A;  4U67 L;  2NRH A;  4E7H A;  2UXB K;  4IFY A;  1RDC A;  5AQO A;  1VSH A;  1HR0 K;  4KAZ A;  5LMU K;  1NK8 A;  3TAQ A;  4CK1 A;  2YHA A;  4RW6 A;  3QET A;  1EP4 A;  1IBK K;  4KHN A;  1MWM A;  4BGA A;  2OYQ A;  3H3O B;  1ZBU A;  3SPY A;  4CJ4 A;  2W42 A;  1NJW A;  5A2Q O;  1N32 K;  4JI4 K;  3PIO L;  4GW6 A;  1S22 A;  1LW0 A;  3TAE A;  4B1X B;  4CJE A;  3ITH A;  2KZM A;  3LZJ A;  3CM6 A;  1K8A O;  3EEQ A;  2UXD K;  2AJQ A;  3SQ0 A;  4JI1 K;  4K8X A;  4GKK K;  3KK1 A;  4GVM A;  1HNV A;  4PL7 A;  4A57 A;  4KB0 A;  4LY7 A;  3K58 A;  1RFQ A;  1E4G T;  3LAL A;  1LOT B;  2HHU A;  3CJC A;  2QWL A;  4KHY A;  4DF8 A;  2JWL A;  3TTF A;  2O8E B;  3VQ8 A;  1RDA A;  1Q9Y A;  5FRN A;  5BRE A;  4MDA A;  4BRE A;  3DXM B;  4YOY A;  3DRS A;  4FWR A;  1J5O A;  5JVG L;  4B9Q A;  4WYB A;  4RW8 A;  3W0L A;  1NGJ A;  3OVN A;  1DT9 A;  3VGM A;  3S41 A;  3EZW A;  4B1Z A;  4FJL A;  3LP1 A;  3FLC O;  3IFR A;  2NRW A;  3AGK A;  3QLH A;  4DCH A;  2P51 A;  3NDK A;  1M1K O;  2VWJ A;  4B9N A;  4Z4E A;  3AVF A;  1DTQ A;  2FSK A;  2P5G A;  1KTQ A;  2Z1I A;  4HTL A;  4ISF A;  1WSG A;  4BRC A;  3SAH A;  3E1Y A;  2YX6 A;  3EL2 A;  3U8X A;  2QA4 N;  4IDH A;  4KKO A;  3PSF A;  4J2B A;  1RGI A;  4EAH D;  3C7N A;  1YI2 N;  3U3Y A;  2BTF A;  1C6V A;  3DLK A;  1RNH A;  3WXI A;  4CHN A;  1LWF A;  2B6A A;  4JRP A;  1YVN A;  4CFD A;  3TTD A;  3CG7 A;  3ZSY A;  5JS2 A;  1XC3 A;  1NK6 A;  4JKG B;  3KTQ A;  1KLM A;  5KRS A;  3WQT A;  4LF4 K;  4C1N I;  4FZX C;  4FW2 A;  4KTQ A;  2D5R A;  4PL8 A;  1HNZ K;  3D2E A;  1JLC A;  2FSJ A;  1HPZ A;  4CBX A;  3ENB A;  1S3X A;  2YHY A;  3QDK A;  4RCH A;  4JRQ A;  1NGH A;  1BGX T;  4LSN A;  2QWN A;  2ZJQ L;  1W9H A;  4CIF A;  2FBT A;  4CFB A;  1WSH A;  4DG1 A;  1O13 A;  5AQW A;  3AVB A;  3JXU A;  2GTD A;  3N4Q A;  3AAP A;  2OZS A;  4DUY K;  4JLH A;  3ZET B;  1TAQ A;  4B9L A;  1SZ2 A;  4JS5 A;  4M3U A;  1NGA A;  3DOL A;  3W3D A;  4BC2 A;  4K42 A;  3U9Z A;  5KTQ A;  4YDU C;  1HNX K;  3CQX A;  5DK5 A;  3ZLJ A;  4ILJ A;  5FPD A;  3V9S A;  3UKU A;  5IT9 O;  3TAR A;  3DLE A;  1VQ9 N;  3THY A;  2H3G X;  5AQN A;  5KPR A;  1XHZ A;  2CGK A;  1TKT A;  3KLG A;  3P1G A;  2GUP A;  1OH7 A;  3VQ9 A;  3V9U A;  3U6F A;  3A5L C;  1R0A A;  1NGI A;  5AQF A;  5CE3 A;  3BUZ B;  4Z4H A;  3L3V A;  1OVY A;  4DQQ A;  3AVC A;  1CXQ A;  3VEV A;  4W5O A;  3ULE A;  4MO5 A;  1A5W A;  3KWI A;  4H0P A;  4CK2 A;  5EY4 A;  3DMJ A;  3K5M A;  4YNQ A;  2V7Y A;  3OYE A;  3NF6 A;  1YIT N;  1TV6 A;  3QFP A;  4CJU A;  4MFB A;  3OBY A;  3CET A;  3GOI A;  3CFR A;  3FZM A;  3VEW A;  2E2P A;  1F21 A;  3AO1 A;  2WUS A;  2NNW A;  4FM1 A;  1ATN A;  2A6A A;  1WSE A;  1Q81 O;  3A8Y A;  4PUO A;  3QFU A;  1NG9 A;  4FK0 A;  3HL8 A;  3NF7 A;  1KRP A;  5JS1 A;  3ALY A;  5GAE P;  1HPM A;  3VQA A;  3NCI A;  4AQY K;  1JKH A;  4BDY A;  2J4R A;  2A42 A;  3HOT A;  3CCE N;  1S1X A;  2HMI A;  3L2Q A;  2E5L K;  5DM7 L;  4WQ4 A;  1GLJ O;  1LWC A;  3VQ5 A;  3M5R A;  4Y0W A;  4Z4F A;  4M7Y A;  3VTI A;  3DM2 A;  1S9E A;  3NGZ A;  4MLE A;  2V7Z A;  3EN9 A;  2I7N A;  2P9U A;  4AHU A;  3CYM A;  1CXU A;  3O9R A;  1MA9 B;  4FLT A;  3A5O C;  3BZK A;  1HYZ A;  4DFP A;  4GMJ B;  3P38 A;  4RG8 A;  3O9U A;  2IS3 A;  4E7L A;  4B1V A;  1VAZ A;  2W41 A;  3WQU A;  3M1F A;  4DKW A;  3RTV A;  2YHW A;  1VRT A;  4ZTF A;  3H1Q A;  3P39 A;  5AQM A;  3AVK A;  5HRN A;  3FZL A;  4FWP A;  4FJ9 A;  2E2N A;  3G25 A;  4CFA A;  1S1W A;  2FC0 A;  1ASV A;  3VTH A;  4H0T B;  2IDO A;  4ID1 A;  1N36 K;  1QSY A;  4KV8 A;  4NLC A;  4A59 A;  1HMV A;  3AO3 A;  1QS4 A;  4DTM A;  4B3R K;  1LW2 A;  4CGD A;  3G6E N;  4OLA A;  2WFB A;  4IWV A;  4JI6 K;  3IS9 A;  4FL9 A;  4JAX A;  4NO7 A;  3FFK B;  3L2V A;  4JD2 A;  2F7T A;  1T03 A;  1VSF A;  1RDB A;  4NXM K;  3EYZ A;  2I5J A;  4B1Y B;  4A5A A;  4BR5 A;  1EQY A;  1HKC A;  5SZT A;  5CYM A;  5MLC Q;  4CGF A;  1GLL O;  3WNG A;  4Z4C A;  2P9I B;  4O0I A;  2VGN A;  3WEE A;  4IEI A;  4DWI A;  1L5U A;  1HLU A;  3SNN A;  4OVL A;  3ZSW A;  2O8C B;  1YAG A;  1NMN A;  4JHD A;  4CF9 A;  3PIP L;  1S1U A;  4NYF A;  4BR7 A;  4DR6 K;  4H5W A;  3IKM A;  4B08 A;  2R7Y A;  2CH5 A;  3HPH A;  3PSI A;  1QQN A;  4A2A A;  3QNN A;  3O9T A;  3VN5 A;  3THX A;  4IKF A;  3DXK A;  4AH9 A;  2DFE A;  5BR8 K;  4TSX A;  1BG3 A;  3SJJ A;  2RKI A;  1OKJ A;  2QK9 A;  3BF1 A;  3QB0 A;  3BDP A;  2O4G A;  3BZC A;  3CER A;  3ATV A;  1SKR A;  3LL3 A;  5DM6 L;  3JS6 A;  3AA5 X;  1I3A A;  3HYF A;  3KD5 E;  3OA9 A;  2HBJ A;  2P9P B;  4E7K A;  1NNE A;  5AQS A;  2YNF A;  2KTQ A;  2NRZ A;  3CJA A;  1HNW K;  2YCH A;  4O0J A;  5BRD A;  3OYK A;  2YV0 X;  1S72 N;  4H0O A;  4FWS A;  3LP0 A;  4B3M K;  4PKH A;  2HW3 A;  3HSC A;  3AA3 A;  4DFJ A;  2V52 B;  3CCR N;  3HP6 A;  1UA1 A;  4CES A;  1Z6R A;  1EX4 A;  2BE2 A;  4NXN K;  1Y64 A;  3AAQ A;  1JCG A;  4FLX A;  3VQP A;  2A1R A;  5IWA K;  1QQM A;  3GBT A;  3VQD A;  1RT5 A;  2HVH A;  4CF1 A;  3CCL N;  4IJN A;  2DFH A;  3L8B A;  2YJE A;  4C8M A;  2HHX A;  4M63 C;  1C0M A;  2OPP A;  3CFO A;  4CER A;  1SS6 A;  2D0C A;  1WNS A;  4CZL A;  4FJM A;  3PX4 A;  3V9Z A;  2JWK A;  4M42 A;  2JGU A;  4BWM A;  4WFN L;  1OH6 A;  2KZZ A;  4FJ7 A;  4FJH A;  1BIS A;  2PYJ A;  4M7X A;  3J7Z O;  4H0V B;  1Y97 A;  3VQ4 A;  3DRP A;  3RWU A;  5FPN A;  1UOC A;  2P9N B;  4BRA A;  3MMV A;  3H45 C;  3ZEU B;  1GLE G;  3H6E A;  3KLH A;  3E9O A;  3TWH A;  4CVN E;  3SUN A;  3EKU A;  1K8K B;  4DTJ A;  2DFF A;  3GE1 A;  1KD1 O;  3TSP A;  5CR4 A;  3V81 A;  3AV9 A;  3QIC A;  3HST B;  4B1U B;  2O8F B;  1N5Y A;  2HOE A;  4H4O A;  2V51 B;  1NK5 A;  3PY8 A;  3FFI A;  3M6G A;  3VA3 A;  2GV9 A;  5SWM A;  3RR8 A;  2NUB A;  1X9S A;  4H0Y B;  3C95 A;  4CF8 A;  1QE1 A;  3WXM B;  3HZ6 A;  3CD6 N;  2O8E A;  4CF2 A;  3NH0 A;  1ATR A;  1HJR A;  4CJS A;  4DHY A;  4LF5 K;  2HF3 A;  3L4Q A;  1NOZ A;  3DXM A;  4CW7 B;  3TAB A;  1NOY A;  4DLG A;  1IKV A;  4YY3 K;  3HI0 A;  3M3Z A;  4C8K A;  2P9K B;  1IO2 A;  4OKK A;  1ATS A;  2IC3 A;  2OA8 A;  3HRG A;  3LDS A;  4M3X A;  3MDQ A;  1NKE A;  1C1C A;  1S9G A;  1Q8I A;  4JKB A;  1RTH A;  4IDK A;  4DSL A;  5C24 A;  3KLF A;  4EHU A;  3K0S A;  5AZJ B;  1RBU A;  4DS4 A;  4F3O A;  3LM2 A;  2BH1 A;  3TR8 A;  4CGI A;  2HHV A;  3C6A A;  4FVU A;  4GV6 A;  5B8H A;  2XY7 A;  4E1M A;  4WFB L;  1X3M A;  3JAM O;  5J1E A;  1BQN A;  4CZM A;  4N56 A;  1XNR K;  4F8R A;  4NCB A;  1KLN A;  1KFD A;  4A5B A;  3K5O A;  4JKG A;  2WOM A;  4W5T A;  1RBT A;  2IVP A;  4JKE A;  3ISN C;  4DTU A;  3ULD A;  4FWQ A;  3OS2 A;  5LY3 A;  1MDU B;  3F2K A;  4IXC A;  4CEA A;  5M1N A;  4MDB A;  1NGC A;  1FXX A;  2E6L A;  3JYT A;  1ASW A;  4O5F A;  4LF7 K;  3P5J A;  3QML A;  3I55 N;  3CJ1 A;  1NK0 A;  4I6M B;  2G8F A;  3KZB A;  1P90 A;  2E88 A;  4KO0 A;  1VSJ A;  3WXL A;  3G0Z A;  3QO9 A;  3QES A;  3MX2 A;  3HP9 A;  1J5E K;  4LF8 K;  4DV6 K;  4E3S A;  2NRV A;  3Q7B A;  4BRD A;  2HB5 A;  2YHB A;  3T3F A;  4AM6 A;  1RBS A;  3HM9 A;  3ZET A;  3ZSZ A;  3QEV A;  3AVJ A;  5J2N A;  4CHP A;  5T7B A;  3TU5 A;  3HOS A;  4BRP A;  3SMS A;  4FJ5 A;  2PBD A;  2KFZ A;  3SLC A;  4JI2 K;  3CMA N;  1WAF A;  1W0H A;  4RW7 A;  1U2V B;  5AQK A;  5BR9 A;  1E3M A;  2B4J A;  4O55 A;  3MXM A;  4DF4 A;  5J2M A;  4ILH A;  3MWT A;  3OYG A;  3C65 A;  4IO8 A;  5K14 A;  1VQ4 N;  3EKS A;  1VHX A;  3QIO A;  3VQ7 A;  1T7P A;  2FXU A;  1P8Z A;  3HPG A;  2VYP A;  1Q7Y O;  4CCH A;  4DU3 A;  3M8Q A;  3OBW A;  2DY4 A;  2QM1 A;  2YKN A;  5AQZ A;  4CEB A;  4ZTJ A;  2UUC K;  5HRP A;  1YIJ N;  3UKR B;  3I56 N;  3KD1 E;  3AAR A;  4FOE A;  1GOA A;  1XQS C;  4I9Q A;  4AHS A;  5LJV A;  1RT6 A;  4BQZ A;  5AQU A;  1RT1 A;  1BA0 A;  4QS8 A;  3RMC A;  1D9D A;  3AO4 A;  1KSP A;  4C8O A;  1EET A;  1S5J A;  4BRK A;  5C10 A;  5GIN A;  1JL2 A;  3R6M A;  3TAN A;  3HJF A;  2Q3S A;  5AQQ A;  4DMN A;  3PX0 A;  3CHW A;  4BRI A;  3SUO A;  5AQH A;  2QWR A;  5EOY A;  2RN2 A;  1C0G A;  3QEW A;  3D0P A;  1T6D A;  4CJQ A;  1J53 A;  3VET A;  1RCH A;  1C0T A;  4HUG A;  5HBM A;  2GWJ A;  3R9P A;  2VCP A;  1Z05 A;  3VOV A;  1L3S A;  1N33 K;  5KGW A;  4M3R A;  3O9S A;  1Z26 A;  4C23 A;  3QEP A;  3MCP A;  5AJ3 K;  3OYC A;  3AA4 A;  3F9M A;  2KLA A;  1HX1 A;  3KIO A;  4CEZ A;  1HRH A;  2F8T A;  4CZG A;  3ENH A;  5JLH A;  4BVP A;  1BDG A;  3DOK A;  1C0U A;  4BRF A;  3SUP A;  3NVM A;  1S6P A;  4BRM A;  3D45 A;  2Q97 A;  3J7Y P;  3CJB A;  4CJR A;  4LFB K;  3ASM A;  5KQ8 A;  1QQC A;  1JJ2 M;  1DLO A;  2CGJ A;  3B8A X;  1ZC6 A;  4CHO A;  3TAF A;  3V4I A;  1FK9 A;  3KHY A;  4LF6 K;  3A2F A;  2A1S A;  4JNE A;  5AR0 A;  2WBN A;  5BPL A;  2IOC A;  1ESV A;  3CXC M;  1CZA N;  2O4I A;  3P4I A;  4FZZ A;  3OTO K;  3H46 O;  4DFM A;  2FBY A;  2BAN A;  3VGK A;  2P1J A;  4EP4 A;  5CY4 A;  4O44 A;  3BY5 A;  4FWO A;  2ZWH A;  3O4Q A;  4XH4 A;  5JLF A;  4Y1C A;  3L4I A;  4EHT A;  4X66 K;  2OAN A;  3ZX0 A;  1OVQ A;  2IIR A;  2DTU A;  1U04 A;  2ZF5 O;  3QNO A;  2HNZ A;  3O3H A;  4CJ7 A;  1NGE A;  3O9Q A;  4BRL A;  2E6M A;  2YJF A;  4DR5 K;  4CZH A;  4CED A;  1W97 L;  2CGL A;  1HUX A;  5FPE A;  4FJJ A;  3WNF A;  4WQ4 C;  4CJ5 A;  1QTM A;  4LC9 B;  4CZJ A;  4CEQ A;  3MN6 A;  4FJX A;  3SAF A;  3F73 A;  3MEC A;  1BOT O;  1T05 A;  2QXL A;  4ELT A;  3VER A;  2HF4 A;  3MED A;  2IVN A;  3AGR A;  1JXB A;  3C6T A;  1T44 A;  4BE0 A;  3AVI A;  3BP8 A;  4FM2 A;  3GL1 A;  5KPZ A;  3VEZ A;  4LD0 A;  1BI4 B;  4Q5V A;  4CJW A;  3OYL A;  2ZGY A;  3ZCM A;  2P9I A;  2O8D B;  4KRE A;  2VGM A;  1MWK A;  4JI7 K;  1JXE A;  4W5N A;  1K6Y A;  2NRX A;  3DJC A;  3VF2 A;  3DYA A;  3B6O A;  2O8C A;  5LL6 Z;  4F2R A;  2I7P A;  1ITG A;  4JKH A;  5D3G A;  2G8W A;  3RVC A;  3T1H K;  3T1A A;  4H5R A;  4FWK A;  4B3O A;  2NLX A;  3I0R A;  4BRO A;  4OX9 K;  4LH5 A;  1QZ6 A;  4BC3 A;  3HPO A;  1JLF A;  1YHQ N;  1VQ8 N;  1JLE A;  5GIO A;  1RDU A;  4CHZ A;  4AHV A;  1CZB A;  1IV0 A;  3ZSQ A;  1GLB G;  2P9P A;  3LP3 A;  5AQI A;  3L2W A;  1REV A;  3PUF A;  2KKZ A;  4CIG A;  4IFV A;  1XC9 A;  1ZBS A;  3QER A;  2FSN A;  3LDN A;  1T3V A;  4HTU A;  4JI5 K;  3KLI A;  2ZE2 A;  3OYD A;  1ZBL A;  1Z25 A;  1YJ9 N;  1TL1 A;  4F9O A;  2QWP A;  1GOC A;  2ZD1 A;  2QKB A;  3LPU A;  4CZI A;  3DLR A;  4QOZ B;  2D4W A;  3D7E O;  4FZY A;  1UA0 A;  3CQY A;  3FGU A;  4FWN A;  5BN9 A;  4J8F A;  5GAG P;  4Z4G A;  2EWS A;  3LAN A;  3PO5 A;  3L6Q A;  5TKW A;  1KCF A;  2RHK A;  4B9T A;  3VEO A;  3J81 O;  2P9S B;  2KQ2 A;  3O1B A;  5J2Q A;  1U47 A;  3ID6 A;  4Y1D A;  4X62 K;  5FLX O;  4I2P A;  1OH8 A;  4MO4 A;  1BHL A;  2NZT A;  3ZX2 A;  3G10 A;  3U9D A;  5C25 A;  5BRH A;  3FZK A;  2P9L B;  3TSQ A;  3VGL A;  2W6K A;  4I7F A;  2P9N A;  4HUF A;  3ATU A;  1LWE A;  3Q7C A;  3ZEU A;  2FBX A;  4FJK A;  1Q18 A;  1RDD A;  4J2D A;  4OKJ A;  1R59 O;  4FCY A;  3C0B A;  1K8K A;  5F1X A;  4M3T A;  2FF3 B;  3G4S N;  1TK5 A;  2ZJR L;  1DKG D;  3LDL A;  3NBP A;  1RIL A;  4DQP A;  4BRG A;  4CZF A;  3NF9 A;  3CCV N;  1TKX A;  4FLY A;  1NGB A;  4F3T A;  2O8F A;  1VSD A;  2OPS A;  3AVG A;  3CCS N;  5M1K A;  3E9P A;  3C6U A;  3VMF B;  4ISG A;  3AO2 A;  3CCU N;  3S3M A;  5LJW A;  3NHG A;  1HQE A;  3O8M A;  3OYJ A;  3NE6 A;  1H1V A;  1SL2 A;  5C0Y A;  3AO5 A;  3AY9 A;  2XY6 A;  1G99 A;  1NGF A;  3AVL A;  4NYN A;  3VPZ A;  3CCJ N;  3PX6 A;  3SMP A;  2P9K A;  1MU2 A;  4RW4 A;  1XI1 A;  4O8K A;  3SQ4 A;  1HYV A;  2XRI A;  4LF9 K;  1UAX A;  1SAZ A;  4DV4 K;  3TTC A;  1XUP O;  3O3F A;  2XHB A;  1EXQ A;  1JL1 A;  1J54 A;  2D0B A;  2VWK A;  1ZYQ A;  5AZJ A;  2HHW A;  1RTI A;  1ZXO A;  3AVA A;  2ETJ A;  1BUP A;  4DFK A;  3RRG A;  4BR4 A;  1IJJ A;  3F5T A;  4DV2 K;  1RBV A;  3RMB A;  4BE1 A;  3RRH A;  2G8U A;  4K8Z A;  2D1K A;  1YTA A;  1BCO A;  3CJ9 A;  4I9L A;  2Z1J A;  2YNG A;  2B5J A;  4BWJ A;  1IBM K;  4FLZ A;  4XIU A;  1NJI O;  3NH2 A;  4ELV A;  4IEE A;  2OTL N;  3RR7 A;  5AZI B;  4M3W A;  3O5B A;  4OPJ A;  1JCE A;  2LSN A;  4M3Z A;  1HYS A;  1RT4 A;  4FLV A;  4GY2 B;  3DAW A;  2QWO A;  3MAQ A;  2F8S A;  2ZJP L;  2QW9 A;  2IGI A;  4CEF A;  1YJW N;  4I6M A;  3KLE A;  4BE2 A;  3KK7 A;  3NF8 A;  3OYH A;  4BR2 A;  5AQY A;  3DLH A;  4H03 B;  3WT0 A;  5KPT A;  3OHR A;  4N41 A;  3CPE A;  4CK3 A;  3CCM N;  3K9J A;  1EKE A;  3KKS A;  4X65 K;  3NH1 A;  4CJT A;  4CI6 A;  3ZT1 A;  5AQJ A;  4H5T A;  1KFS A;  4CBW A;  3GG4 A;  3V6D A;  4JKC A;  1KAZ A;  3SV4 A;  2QXF A;  3KK2 A;  5I3U A;  2G8V A;  1TYQ B;  4E0D A;  4DV0 K;  3O4N A;  3LDQ A;  2Z1G A;  1L3T A;  4M3Y A;  1NK4 A;  1GOB A;  4E89 A;  2JLE A;  3PLA A;  2Y1J A;  4G9Z A;  5GIP A;  1U2V A;  4I2Q A;  4BRQ A;  2UUA K;  1TAU A;  4KH4 A;  3HK2 A;  4CJP A;  4BGB A;  4DTO A;  2ZM6 K;  3K9K A;  2E20 A;  4E1N A;  4CEE A;  1TKD A;  1ASU A;  1WUA A;  4DTS A;  2XY8 A;  4A61 A;  1N8R O;  4NB4 A;  2QEX N;  4GV9 A;  1GLC G;  2E1Z A;  3UKR A;  2YNH A;  1WSF A;  3T19 A;  2ASM A;  2RF2 A;  1JLQ A;  3V9X A;  1VQO N;  3IG1 A;  4JN4 A;  4HUE A;  1L3V A;  4KFB A;  1JCF A;  4JK7 A;  2X78 A;  3K5L A;  3EE9 A;  3B6P A;  2PYL A;  1KAY A;  2VQE K;  4PKG A;  3VEX A; 
#chains in the Genus database with same CATH homology
 4JV5 K;  4B3R K;  5IWA K;  3J81 O;  4JI8 K;  4K0K K;  2UUB K;  4LFC K;  1IBM K;  4JI6 K;  2UU9 K;  4X62 K;  5FLX O;  4DV3 K;  4V19 S;  3JAM O;  4DR2 K;  1XNR K;  4NXM K;  3J80 O;  1XNQ K;  1FJG K;  2HHH K;  4B3S K;  2UXB K;  1N33 K;  4AQY K;  4JI7 K;  4LF4 K;  4LF7 K;  1N34 K;  1HNZ K;  1HR0 K;  5AJ3 K;  5LMU K;  4DUZ K;  5LL6 Z;  4B3T K;  2E5L K;  4DR1 K;  5LMN K;  2F4V K;  1IBK K;  1J5E K;  4LF8 K;  3T1H K;  4DV6 K;  1XMQ K;  4CVN E;  4X65 K;  4DR6 K;  3J7A P;  3J7Y P;  4DR3 K;  5A2Q O;  1N32 K;  4JI4 K;  4LFB K;  4DV0 K;  4OX9 K;  4DR7 K;  4GKJ K;  5BR8 K;  4DUY K;  2UUA K;  2UXD K;  2ZM6 K;  4JI1 K;  4JI2 K;  4GKK K;  4DV5 K;  4YHH K;  4LF6 K;  4DR4 K;  4DV7 K;  1HNX K;  4DV1 K;  1IBL K;  3OTO K;  4LF5 K;  4CW7 B;  4JI3 K;  2UXC K;  4JI5 K;  1HNW K;  4JYA K;  4YY3 K;  1XMO K;  4LF9 K;  5IT9 O;  4LFA K;  4DV4 K;  4B3M K;  4X66 K;  2VQF K;  4KHP K;  1I94 K;  3T1Y K;  4X64 K;  2UUC K;  4DR5 K;  4NXN K;  1N36 K;  2VQE K;  4DV2 K;  4JI0 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...