4LF5K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lf5K00
4DV2K 1N33K 1XNRK 2UXBK 1XNQK 4LF6K 5LL6Z 1XMQK 4DUYK 4DR2K 1N36K 4DV5K 5FLXO 4GKJK 4DR5K 1HR0K 4B3TK 1IBMK 2F4VK 4DR4K 4DV0K 4JI2K 4JI4K 4CW7B 4NXMK 1N32K 4JI5K 4X65K 3T1YK 5IT9O 4DUZK 4LFAK 4OX9K 2VQEK 4YY3K 4B3SK 1HNXK 4X62K 4B3RK 4LF9K 3J7YP 2HHHK 4JI6K 4LF5K 1XMOK 4DV1K 5LMNK 3J80O 2VQFK 3J7AP 4DV3K 2E5LK 2UUCK 1IBKK 4LF7K 1HNWK 4CVNE 4KHPK 4DR3K 2UUBK 4K0KK 4GKKK 2ZM6K 4JI1K 4JV5K 4NXNK 1FJGK 4JI8K 4X64K 4JI7K 5LMUK 3T1HK 2UU9K 4DV6K 1J5EK 4YHHK 5BR8K 4DR7K 2UXDK 4LFBK 4AQYK 5A2QO 4JYAK 4JI0K 1HNZK 3J81O 4LF4K 3OTOK 4V19S 1N34K 2UXCK 4B3MK 4DV4K 3JAMO 4DV7K 4LFCK 2UUAK 4DR1K 4DR6K 1I94K 4LF8K 5IWAK 4X66K 1IBLK 4JI3K 5AJ3K
chains in the Genus database with same CATH superfamily
2F9WA 2I7NA 1NK4A 1DLOA 5BPLA 4CD3A 2XY5A 4F3OA 3QEIA 2VCPA 1EX4A 5M1OA 3VTHA 2F9TA 1J9AA 3ENBA 1JCGA 3WXMB 4GVMA 3WQTA 3CHWA 4NXMK 1W0HA 3ZSYA 4ILJA 2HBMA 3CG7A 2G8HA 3KJVA 3NFAA 1WOQA 4DLGA 4CEQA 5HL7L 4KHNA 4QS7A 5HRRA 1VQMN 4CD1A 1S22A 3WNFA 4B3SK 2P51A 3AO3A 3CIPA 3KWIA 1T3VA 2OTJN 2ZGZA 3I8BA 3DXMB 2FBTA 2DTUA 1KFDA 2ZWHA 3A5OC 4JEPA 4H03B 5JMVA 3QBXA 4CF8A 4FJNA 1KAYA 4CF0A 3TTFA 1Z6RA 5BN8A 5J1EA 3OYJA 2HF3A 1VQ8N 3SUPA 2UUCK 3O08A 1EKEA 4BC3A 2OPRA 4ID5A 4QCLA 1TGOA 4BQZA 4BACA 1YJ9N 4PKGA 3CCRN 1RT1A 2BTFA 3VQ6A 2V52B 3ZT2A 4FJ7A 4FWPA 4B8AB 2G8VA 4BG9A 4FWLA 1GLLO 4E1MA 2A41A 4B9SA 3UKUB 1DGKN 3K2PA 3RVCA 4DMNA 4I7FA 4H0XB 3EN9A 1X9SA 4JI0K 2NRHA 3AAPA 3HZ6A 1HYZA 3K5OA 5C24A 2P1JA 4J2BA 3KIOA 4FLZA 4DSFA 4JKAA 1X1PA 2OPSA 3G25A 1GLAG 1QHTA 2NRWA 4FM1A 2UUAK 3C7NA 2HNYA 3NMUA 2A1SA 5HRSA 1TKTA 2YX6A 3DYAA 4CBWA 2YJEA 1NGCA 4GVEA 3AVHA 5AJ3K 4FZXC 4M3YA 2B4JA 4FYDA 1RBRA 1Y97A 2FBXA 2HHXA 1VSIA 1KSPA 3C6UA 1QVFM 5I9EB 3A8YA 1XQSC 5FPNA 3L2WA 1X3MA 4H5RA 3ULEB 3ZT3A 4CW7B 4CJVA 5BPMA 1IG9A 4JKHA 3DLEA 3WUHA 3VOVA 4PL7A 3QIOA 4OLBA 1UA1A 2RPIA 5C42A 4CFBA 3OYGA 1K8KB 4MDAA 4DQPA 1B9DA 4H4MA 4CCHA 1NK9A 4JHDB 3DJCA 3FZFA 1NJXA 1HQUA 4CF9A 1RT5A 1RT3A 3AA2A 2QWRA 5M1FA 3VERA 2WBNA 4FK4A 4BRPA 3NGZA 2G8UA 5KQ8A 4FWQA 1NGGA 1XWLA 4FJHA 1IKYA 5KGXA 4JRQA 4JKGA 3EKUA 1BO5O 3QEWA 1C0FA 3NE6A 3NBPA 1TKZA 2A40A 3L4IA 4FWRA 4JI7K 5BN9A 1YTUA 1NLVA 4XH4A 4HTLA 2A6AA 4BRAA 1RDBA 3CJ7A 3ULDA 2UXDK 4BGBA 3LZIA 2V7ZA 4OPHA 4ELTA 3HJFA 3O9TA 4BG8A 2VWJA 4DCHA 3KWGA 2Q31A 4OGCA 3BZCA 1RILA 2RN2A 2QWNA 2OTLN 4C8NA 4H4OA 1S6QA 1BDGA 3FZLA 3V1QA 2P9LB 3TAPA 1IBLK 3AO2A 2E8AA 3QO9A 1HKCA 5AQWA 1ZBUA 5E84A 3D7EO 3L2RA 3AVJA 2P9NB 2IDOA 1KC8O 3HBTA 2ZJRL 2D5RA 1RGIA 4I2PA 4I9LA 1YT3A 4CJRA 2P5GA 3ZLJA 1N32K 3JYTA 4FWMA 4K43A 4JNEA 4IFVA 4M63C 4QOZB 3FGUA 1CZAN 1BI4B 3DXKB 5AQNA 3G6EN 4YY3K 4CJLA 3OYHA 3VGKA 4C8KA 3VQDA 2QI2A 5H1SQ 5GAGP 1VQ4N 1O13A 4JI6K 5M1KA 3HSCA 1W2BM 2Y1IA 3O8MA 4FM2A 1LWFA 4B1ZA 5HP1A 1KAZA 2DFEA 3ZT1A 4M42A 3J7AP 3CFRA 3VF6A 2EWSA 4OKJA 4R79A 4JD2A 5KPRA 3BGRA 3QEVA 1U45A 3CM6A 4K0KK 2E2PA 2FBVA 4CZIA 1LCUA 2PZSA 4BR4A 1UWBA 3AA4A 4JV5K 2HBKA 2P9PA 4DF8A 3QBWA 3EE9A 2CGJA 3ZX0A 1OH8A 5TKYA 1ESVA 2LSNA 4IZ9A 3SJHA 4E7IA 4KV8A 4AHSA 2KLAA 3THYB 4DV6K 1ZBIA 1GOBA 3O9RA 3SAFA 5DM7L 1OKJA 3NH1A 1C0TA 5J2QA 3U6FA 1HNZK 1DKGD 1R59O 3VEZA 3PY8A 4GV3A 1HLUA 3SBTA 2O8EA 3GBTA 3O4QA 4PHTX 4BC2A 3ZETB 5CZ1A 2O8BA 4M7XA 1NGFA 4IFYA 3L2VA 4DSLA 1NGEA 4M3WA 1S9GA 4XH5A 1YVUA 3FZHA 4KH4A 3IAYA 2Q36A 3AVKA 1NJZA 1NMNA 2W40A 2BANA 3KK1A 4B9VA 4NCBA 1JLGA 1FXXA 5HOOA 4F4KA 1L5UA 3NAEA 3KZBA 4DUYK 4DR2K 4JKBA 3A2FA 4Z4EA 5GADP 3KK2A 4IKFA 1VQKN 3AVCA 1UA0A 1BCOA 4O8KA 1Q18A 4E0DA 5BR9A 1TYQA 3T1YK 3THXB 2IVNA 2QKKA 1BOTO 1NWKA 4LFAK 3HT3A 3WXJA 3C94A 2BGGA 3S41A 1P8ZA 3OHRA 4FOIA 4B3RK 4BR5A 3HK2A 2QWLA 5CZ2A 4DTOA 4A5BA 2OANA 2YNGA 2KTQA 3F2KA 3VN5A 2X74A 4BRCA 4CEBA 1S5JA 1WSHA 2NUBA 4NCAA 1BWFO 4JLHA 2HHUA 1RBTA 4CZGA 4H0TB 4LC9B 3CXCM 4IDHA 3LZJA 2GV9A 2QWQA 1RDWX 2ASMA 4DQSA 3D0PA 1EWQA 4BRKA 4CK1A 5F2RA 3DM2A 2NNWA 1ZBLA 2V51B 4YOVA 3ZCMA 2FSJA 3IMXA 3CPWM 4A5AA 1S1UA 3SAHA 1NGHA 5KI6A 1FKOA 4CJFA 1IG8A 2FF6A 3CMEN 3VQAA 3I0SA 4K8ZA 3FE1A 4PKIA 3EY1A 1VQ6N 3K9JA 3BEXA 1RDCA 2HHVA 1IKWA 4KHUA 2CH5A 3E9OA 1S6PA 4K42A 3OTOK 2XY6A 4FJLA 1U2VA 4E3SA 4O44A 4CJ5A 3TAQA 3CCEN 1S1WA 1VK0A 4KO0A 2ZF5O 3AGKA 3MEEA 3H08A 3T19A 3CCJN 4E7KA 5ADXA 2XO7A 4DS4A 5CE3A 2I5JA 2XRIA 3C0BA 5BRDA 4JI3K 2XHBA 3ALYA 3SUNA 1NJIO 1V4TA 4DS5A 4E7HA 1LW0A 3OYBA 1KVBA 2X6SA 1D4XA 3OYLA 3M5RA 3VESA 4A61A 5DM6L 2HHQA 2D0PA 3IKMA 3LDQA 3SK3A 5FPDA 3OS1A 1Q82O 4MO4A 2NRTA 3HXMA 1SKSA 5IT9O 1M90O 1CLQA 3RMAA 5AQSA 2IS3A 4CJKA 1NJYA 1NOZA 4ISEA 1TV6A 4BREA 3U4LA 2QWOA 3LDNA 4JKFA 1WAJA 1T6CA 4HUFA 1EP4A 4JK7A 3SUQA 4EP4A 5ADXH 2O8DB 3MDQA 3DXMA 4H0YB 4H5WA 4IG3A 1NGJA 3KD1E 4HCBA 4OJRA 3C95A 5LMNK 1ITGA 4BRDA 3MN9A 4R5PA 3FFKB 4JAXA 3SCXA 1CXQA 1ASVA 4K25A 1RT2A 2HBLA 4WE1A 1WSGA 4KTWA 2F8TA 1IBKK 1U49A 3RTVA 3EKSA 1JKHA 4CVNE 4WQ4C 3OYIA 2AA4A 1UAXA 4W5RA 1QSYA 1KFSA 2OZSA 3SI6A 1J6ZA 3ZYYX 4RWTA 3MX2A 3GDQA 1WBDA 4FVUA 4RTFD 5E41A 4N76A 4QS8A 5LJVA 2HSTA 3H3NO 4FLXA 1VSLA 4YHHK 3UKUA 2E2OA 4FL9A 2ETJA 3U3YA 3I33A 2NRRA 3SLCA 2HF4A 4ELUA 5JLHA 3O9UA 3WXIA 4FM0A 1B92A 4U7BA 3AY9A 3CJCA 4HUEA 1SL1A 3CCSN 2O8FB 1KRPA 5M1QA 1VSFA 4KREA 4KRFA 1HRHA 4XH1A 2Q97A 4Z4GA 3O3GA 2G8FA 3O4WA 2E1ZA 4J8FA 2GWKA 4DU4A 4BRHA 3AVLA 3KLHA 3PUFA 3IG1A 2IGIA 3MEDA 4UQGA 5C15A 4FWKA 1JL1A 4C8OA 2YI1A 2ITGA 3QFUA 3E9LA 2VG5A 2ZQBA 5LL6Z 1L3UA 1BU6O 3HM8A 2H3GX 3OYNA 4DQIA 1N36K 1XC3A 5KTQA 3FFIA 1RTJA 5AQVA 5JLFA 4DR5K 2CGKA 4B3TK 2D0BA 2Z1JA 1WN7A 4JI4K 3VPZA 3QESA 1ILYA 3LWMA 2RE2A 1X9JA 3P38A 3ULEA 3ZT0A 1ASWA 3U3GA 1KLMA 2F96A 3QFPA 4FJGA 3T1AA 4RCHA 2PBDA 2Q0RA 1K8KA 4RW4A 4DLEA 1XC9A 4Y0WA 3F9KA 4JHDA 4IOXA 3TAMA 3O1BA 3TAEA 1A5WA 5FRMA 3AVGA 2P9UB 5BRHA 2B6AA 5EY4A 4YOYA 3KHYA 3A5MC 4U67L 4KHWA 2CGLA 2B5JA 2VWBA 4DR3K 3K5MA 1EO1A 4GKKK 4FXDA 1HKBA 3MN7A 2NZTA 4DQ8A 2RKIA 4JKDA 1GOCA 1REVA 1B9FA 3K5LA 3H1QA 3AO5A 3CQ8A 3PX4A 3QB0A 3LL3A 4E1JA 4BDZA 3GE1A 3O5BA 4CEFA 3LAKA 5AQGA 1RT4A 1SZ2A 3OYFA 3J81O 2E20A 3AARA 1NK8A 4BRIA 4FPAA 3NHGA 4FJXA 4EHTA 3PIPL 1LW2A 5AQTA 4LFCK 1HYSA 1TK0A 4CJ7A 3DOLA 4MO5A 3WNHA 4KI6A 1I39A 4AHUA 3L0QA 4PUOA 4GMJB 3LDOA 4WQ4A 5AQXA 4CEEA 5DMRA 2YV0X 4Z4CA 2PFUA 4IOCL 1SKRA 1W97L 3AAQA 2VG7A 3MECA 2P9LA 1VQ9N 4KH5A 4E7LA 3QEPA 3VQ4A 4GKJK 5C25A 3HI0A 1SS6A 2E88A 4DQQA 2VWKA 1GOAA 4J2AA 4BRNA 2IC3A 2P9NA 1BQNA 4FWSA 2V7YA 1HUXA 4CGDA 3ENHA 4JS5A 5HROA 3PX0A 2QXLA 3CYMA 4B08A 3LDLA 2DFFA 1K9MO 1EXQA 1BI4A 2J4RA 3TSQA 3DXKA 1OH7A 3VQ9A 3AVNA 1L3SA 4FPBA 3J7YP 3A0IX 3SYZA 3MXIA 4B9NA 4N41A 2JLEA 4CEOA 2I7PA 5SZTA 1XI1A 3HO1A 3L6QA 3M8QA 5AQJA 4MDBA 3DRSA 4DTSA 4B1XB 2O4GA 1QHAA 4I6MB 3NF7A 3D6RA 3L2UA 3IDHA 1MWKA 2JWKA 3IUCA 3VQBA 1Q9YA 3R6MA 3AGRA 3PIOL 4FK2A 4W5QA 3VEXA 5LMUK 3WEEB 4CBUA 3RRHA 2HW3A 1YI2N 3TSUA 4GNIA 4AM6A 3VTIA 4KHYA 2QEXN 3O3HA 3V4IA 4DTPA 3M8SA 3THYA 1U48A 2HMIA 4ICLA 3AVIA 2X6NA 2RF2A 3RMBA 3BZKA 4V19S 4BE0A 3O4NA 4Q5VA 2PYLA 2P9KB 4AHVA 3TR8A 1VQ7N 5M1PA 4M45A 3KLIA 3HVTA 3MN5A 2G8WA 1J53A 1X9WA 3ZETA 5JVHL 4IXCA 4AHRA 1Z26A 3UKRB 5F0XA 2KZZA 2YNHA 1BUPA 3FR0A 4YOTA 1R0AA 4IOAL 1T44A 2QTDA 4ID1A 1XNRK 3B6PA 3VEYA 4DSKA 4BWJA 4YFUA 3HP9A 3D2EB 3HYFA 5FLXO 3SV3A 3DRRA 1HR0K 5AZJB 4ZHRA 1RT6A 4DTXA 4CK2A 4JK8A 3VGMA 3DLGA 1OVQA 1ASUA 1K6YA 3SZ2A 3E1YA 4O8UA 4OPKA 4F2RA 4DSJA 4KHSA 2NRZA 5KPZA 3ZSWA 4DFMA 3THXA 5AQMA 3CFPA 1U04A 3O1WA 1HNXK 3G10A 3MCAB 1Q8IA 4Z4IA 1NGIA 1FKPA 2A3ZA 2W42A 1VSHA 1HQEA 3QICA 3J80O 1JXEA 4FW2A 5GIOA 3RMCA 2E5LK 1WAFA 1VSJA 1DTQA 5CYQA 3LPUA 3FLCO 4Y1CA 1KVCA 1Y64A 5AQHA 4DSIA 3BF3A 3DLLL 2D1KA 4ILGB 4JI1K 1WSFA 3RWUA 4NXNK 2GUIA 2FLOA 3J7ZO 3CJ1A 1IKXA 4CIFA 2E2QA 4IDKA 5BREA 1N6QA 4YNQA 4FVMA 4C1NI 3OYEA 3E9PA 3VF4A 3ZEUB 3OYCA 3LPTA 2GELA 3RSEB 4LF4K 3QINA 1N34K 4DWIA 2KW4A 5M1NA 4DB3A 4CJPA 3JAMO 4A62A 3SPZA 1U47A 4K41A 2GBZA 1TUYA 3CMAN 4GY2B 3SAGA 2PAVA 4EAHD 2R7YA 3VQQA 1XUPO 1I94K 1QSSA 3DLRA 1BL3A 4LF8K 3HOSA 3VQ5A 5B8HA 4CJEA 5T7BA 3L3VA 2HHWA 3R9PA 5ELZA 4CECA 4DF4A 4MQ3A 3IRXA 3GOIA 3U8XA 2ZJQL 2G8KA 1HKGA 1EETA 3OYMA 3M1FA 3WXKA 4DV5K 3MWPA 1IBMK 1IV0A 3QERA 4IO8A 1VSEA 1ATRA 3F73A 1TAUA 4O0JA 5CYMA 4BROA 4DUZK 4B9MA 1Q9XA 3OW2M 4CI6A 4BC4A 4PY5A 1JLQA 1VSDA 4NLCA 3CM5A 2IIRA 4AH9A 3DWLA 3VGLA 1JLAA 3MXJA 5JS2A 1NU0A 4G1QA 1WSIA 1TAQA 4KFBA 4H0PA 3C6HA 4QS9A 4H8KA 4Z94A 4DU1A 3EL2A 3SQ0A 4CE9A 4DV1K 2O8DA 1NKCA 2VQFK 3IS9A 1QSLA 4F9OA 2DFHA 4FO0A 3G71N 1HYVA 4FJMA 5D3GA 1VHXA 5AZIB 1JCFA 3T7ZA 4CERA 1D9FA 1WBBA 4DHYA 2KZMA 3OJSA 2BE2A 3WXLA 1DTTA 4CGFA 4HVJA 1JL2A 2YHBA 5AQOA 4DTNA 4CJUA 2YKNA 2ZD1A 2YHWA 4MLEA 5TKWA 3O9SA 3QNOA 3UIQA 2P5OA 1RBVA 3WNGA 1J54A 5I42A 1EQYA 5BRFA 1YTAA 4E7JA 1ZXOA 5CHIA 3T69A 1QQNA 2FXUA 3HPOA 3TWHA 2HBJA 3ZX2A 5AQYA 3O6WA 4BQLA 1RT7A 3FZKA 3I0RA 3F9MA 3NDKA 4RW8A 3A5NC 4KH6A 3NVMA 1K8AO 1NKBA 4HUGA 4M3UA 1V4SA 1GLDG 3TTCA 2O8FA 1HPMA 4CFCA 3NH0A 4AHTA 3AA3A 1L3VA 1ZBHA 5EU7A 4OKKA 4ISGA 4CFAA 3B8AX 5KRTA 2EX3A 4Z0UA 2UXBK 1XMQK 4I9QA 1SV5A 1NK7A 1Q86O 3ZSOA 3TARA 1C1BA 1VSKA 1RDAA 3K57A 3IFRA 4DV0K 1U6ZA 1JLBA 1SUQA 4ILHA 4JI2K 3ZSXA 4ELVA 1GLCG 3BY5A 4C8MA 4B9TA 2F7TA 2FBYA 3ISNC 4H5VA 3C6TA 4CHQA 1G15A 4IWVA 3S3NA 2GTDA 4DU3A 1ATSA 4CFDA 2YKMA 4CZHA 1QQCA 3D2FB 2KFZA 4LF5K 4KB0A 4IO9L 4J2DA 3H46O 4RW7A 4WQ5C 1NOYA 1JLEA 3RR8A 5F1XA 2D0CA 5FRNA 2W6LA 5FROA 2P9UA 3U9DA 3L2QA 1JLFA 4A59A 1J5OA 3OA9A 3H3OB 3ATUA 3VMFB 3SQ1A 1RNHA 4CEZA 2GWJA 1E3MA 4EFHA 1FJGK 2OYQA 2VYPA 4DFKA 1BIZA 4CHPA 3OVNA 2Z1HA 3O80A 1QQMA 1P90A 1WUAA 3MXMA 1RFQA 4OVLA 4KB1A 2EHGA 3HRGA 4ZTFA 1YVNA 4PQUA 2XY7A 1LV5A 2WFBA 3KK3A 3MAQA 1SQKA 3V9ZA 4DV4K 4HCCA 3KLFA 4KKOA 4M3RA 5HLFA 1ZYQA 2PYJA 2HVHA 4A2BA 1RTDA 2W41A 1TKDA 2Q0UA 5C2FA 2QXFA 2HOEA 5IWAK 5HBMA 1GLJO 5GAEP 3Q7BA 3FZMA 1U4BA 4FWOA 3HVRA 4DV2K 1NNEA 4N56A 1NBWA 3HPGA 2WTUA 5AQKA 2IVOA 4WFBL 2BH1A 1HNIA 2YHYA 4DR4K 3HOTA 4TSXA 3S9HA 1Z05A 4CGHA 2FF3B 4RG8A 2A5XA 4OLAA 1W9HA 3R1XA 1L3TA 2BUPA 4CHNA 5JS1A 3VENA 2WC9A 4FJIA 4CZFA 4O4GA 3OYAA 4LF9K 1VRUA 4BR2A 5E26A 1NKEA 4WYBA 4CGJA 1KXPA 1LAWA 2UYTA 5FDLA 4H5NA 3UE5A 2YCHA 1LWCA 3BP8A 3VEVA 1JJ2M 4CF2A 1C0UA 1OVYA 4CK3A 2ITMA 4PL8A 3CJ9A 1MDUB 4I6MA 4B1UB 4LY7A 4NYNA 1I3AA 3AO4A 5KQDA 2O8CB 1HNVA 3TSPA 2O4IA 5DK5A 3P5JA 1YJWN 2F8SA 2E6MA 4JN4A 3WEEA 1NGAA 3LDSA 5HRPA 3F5TA 4JYAK 1BGXT 2IVPA 1ZBFA 1ZC6A 2RHKA 3GL1A 4JKCA 3ITHA 3N4QA 4WQ5A 4PKHA 4Q0BA 3AVAA 4N5SA 1CXUA 3THWB 1DEJA 5AQUA 2P9KA 3U9ZA 1QTMA 4E19A 1C0GA 4BR9A 3CC7N 4DR6K 2A42A 1FK9A 1C0MA 3UKRA 3NH2A 2YHXA 4DQRA 3T3FA 4FJ9A 4LH5A 2Z1IA 1KAXA 4DTRA 3R3LA 3O3FA 4LF6K 2FSNA 3AV9A 4G9ZA 3J8AA 5MLCQ 1WB9A 4F2SA 4LD0A 3D2EA 1YITN 5AFUA 4E1NA 3EYZA 2KKZA 5AZJA 2P9SB 3M6GA 1E4GT 3DRPA 4OGEA 4JI5K 3KKRA 3PO5A 3VQPA 4B8CA 3CQXA 4NCGA 3I55N 3CPEA 1T8EA 3D45A 3VA3A 2Y1JA 3QDKA 4BE2A 3JSMA 3P31A 4F3TA 3C6AA 3JXUA 2W6KA 1BA0A 1MA9B 1E4FT 3K5NA 4B1VA 3DLBA 4YOWA 3OS2A 3GG4A 1C1CA 3P4IA 4DV3K 4HTUA 1D5AA 3VQCA 4MLHA 1HNWK 1JXBA 3SV4A 3CCVN 4OO1J 1QVGM 3MMVA 2HB5A 5AFUH 4C23A 3BUZB 2X78A 1S72N 2ZGYA 4MFBA 4JI8K 3AO1A 4KTZA 4EIAA 2DPNA 4CZLA 5AQRA 5BPNA 3NGIA 3T1HK 3THVA 1TVRA 3TU5A 3L4QA 3OYDA 3LWLA 3PLAA 1O1WA 2ASPA 5A2QO 1QZ6A 5EOYA 3VF2A 4DFJA 3ZSQA 1NJWA 4M3TA 3ZEUA 2UXCK 3SJJA 3RSEA 3OBYA 3VETA 5C2DA 5K14A 4DR1K 1Q7YO 4LSLA 5FPEA 1SAZA 1CZBA 3EO3A 4AF1A 4BC5A 3L8BA 3KKSA 3CF5L 2P9IB 4DG1A 4ISFA 1XHZA 3TTDA 4BRMA 4FJ8A 2QKBA 3CCMN 1N33K 4IEIA 1BHLA 2AJQA 5J2NA 1HJRA 3HM9A 3VEOA 1EWRA 4H5TA 2KFNA 1BISA 3LP1A 1RTHA 2A1RA 1VQLN 1BQMA 3QETA 5EXWA 1ZBSA 2WOMA 3G0ZA 2NRXA 2F4VK 3RRGA 3SBGA 3CFOA 5AR0A 3ID8A 3TAFA 5C12A 1QS4A 4NB4A 3BF1A 4K8XA 4CHYA 4CGGA 2YNFA 3R8EA 1NK5A 4BVOA 4B1YB 2ZE2A 4BY9C 3DAWA 4CJ4A 1SL2A 2WUSA 2OPPA 3AVMA 2Q3SA 3MX5A 3H6EA 3OS0A 3ZT4A 4WF9L 3CERA 2FC0A 2VG6A 3CI5A 2KQ2A 3VEWA 3K0SA 4Z4HA 4B9LA 5GAHP 4Z4FA 4CIEA 3V9UA 2XY8A 1M1KO 4CZEA 1RTIA 4LF7K 1T05A 1T6DA 3A5LC 4KHPK 3PV8A 5AQZA 3DMJA 4FLWA 4FOEA 5J2MA 2HMPA 3MK6A 4NLBA 1WLJA 3NF9A 4BGAA 3CQYA 5AZIA 4JKEA 3PO4A 1LAVA 1WNSA 3V9SA 3K9KA 1IKVA 2HHTA 2E2NA 1ATNA 3OYKA 3PSIA 1UOCA 2UU9K 1BIUA 2VGMA 4EZ6A 1GLBG 5BR8K 1HPZA 1T7PA 4FJ5A 4AQYK 3VQ8A 2FSKA 5AQIA 4KI4A 3MCPA 4FJKA 4NO7A 5I3UA 2HNZA 3C7NB 5GINA 2VGNA 1FW6A 4CESA 3KK7A 3JS6A 1JCEA 4M7YA 1YIJN 3MN6A 4OPAA 3I56N 4CHZA 4UY8O 3VQ7A 4FLUA 1YUWA 2KHOA 4CJWA 3WNEA 3TAGA 1N5YA 1XNQK 2YJFA 3KD5E 3ZSZA 3V6DA 4FK0A 4FLYA 4CIGA 1TKXA 3CJAA 4CZMA 1X9MA 4IBNA 3CCLN 3E01A 1IO2A 2D0OA 1OH5A 1QE1A 2QWPA 3LALA 4IG0A 2VQEK 1WSEA 3OY9A 4XIUA 4X62K 4FLTA 3CCQN 2DY4A 4DTMA 3RMDA 3WT0A 4YDUC 5AQFA 4FW1A 4FLVA 4KAZA 3HSTB 3H1VX 4O0IA 3ZX3A 4FCYA 2OZMA 2QA4N 1XMOK 3M8RA 3D2FA 1YHQN 1NMDA 2HHSA 1DT9A 2GX9A 2IOCA 4JKGB 3NGYA 4BWMA 3SUOA 1A5VA 4W5TA 2ATQA 4M41A 1IJJA 4N47A 4F8RA 2Q2RA 4M3XA 4C1NK 4XEIA 4AM7A 1KTQA 3LM2A 4FSVA 4C8LA 1LOTB 1TL1A 4BDPA 3AA5X 3EE8A 4GV6A 3ZSVA 4DR7K 1TUUA 4H0VB 4EZ9A 4WFAL 4DTUA 2OPQA 4CEDA 3H45C 2CH6A 2BDPA 4YORA 3LAMA 4KBOA 3CCUN 1SL0A 2QWMA 3W0LA 2OCEA 3WQUA 4CBXA 3CC2N 2QM1A 4ZTJA 4BR7A 1VQPN 1RCHA 1S1VA 4RW6A 4DFPA 1TK5A 1YAGA 3DLKA 2Z1GA 4BR0A 3P83D 3P39A 1GLEG 3QEXA 3S3OA 3MWTA 4B1WB 5C10A 3B6OA 3M8PA 5CY4A 1A5XA 4OKEA 3TANA 4B9UA 4GW6A 2OA8A 4JRPA 3PX6A 1MU2A 4EP5A 4AILC 1RBSA 3S3MA 2NLXA 4H0OA 3KLGA 1YXQA 3TI0A 4A2AA 4BRQA 1Z25A 4X65K 3VQEA 2HVIA 1S3XA 3NCIA 3EZ5A 4OX9K 4LH4A 3LANA 3M3ZA 1N8RO 3DOKA 3V81A 5J2PA 4CJSA 4KTQA 3G4SN 4BRGA 3KVGA 4WCEL 1VQNN 3QMLA 4DSEA 4I2QA 3TABA 1Q81O 2GUPA 1HMVA 4BVPA 2QW9A 1S9EA 3UB5A 5JVGL 1RDDA 4JD2B 3V9WA 4CEAA 2WONA 3E66A 2D0AA 4FZYA 2QK9A 2UUBK 3QLHA 2AP1A 2P9PB 2PY5A 4IFEA 3KTQA 1NGDA 3K58A 3I8DA 1NK6A 3ID6A 1F21A 4JS4A 3LM9A 1JLCA 1VRTA 5CR4A 1C6VA 3LP0A 3PSFA 2O8CA 4OPJA 1C1AA 4YDUA 1VSMA 4KHQA 4B9QA 5FPMA 1VQ5N 2O8EB 4NYFA 5EVZA 3NF8A 3BDPA 1RDUA 2O8BB 1K73O 3CETA 1KCFA 3NF6A 4DKWA 4JK9A 3Q7CA 2GEMA 3SPYA 3SQ4A 3KLEA 3THWA 3OBWA 1T03A 1W7AA 3ENOA 3HPHA 3ASMA 5HRNA 3V1OA 4B3OA 3DLHA 1WSJA 4X66K 4AHCA 5KPTA 3SQ2A 3QIPA 4O5BA 3EZWA 4DTJA 2ZJPL 4LSNA 4L3QA 2JWLA 1TL3A 4CHOA 4YOXA 5LJWA 5LY3A 1NK0A 3CC4N 1TYQB 1NM1A 4BRLA 4CZJA 3LDPA 3CJBA 5KRSA 4KPYA 3HTVA 5AQQA 3LP2A 4CJTA 5SWMA 2P9SA 3AVBA 1YJNN 1YF5L 1MWMA 4O5FA 4BRFA 1OH6A 1KQSM 1CZ9A 4FWNA 1H1VA 3V1RA 1X3NA 1QZ5A 4HWIA 4IJAA 1NG9A 4RW9A 5KGWA 4BE1A 3AVFA 1BCMA 4PA1A 3SMSA 1D9DA 4CJ3A 4W5OA 3CD6N 4J2EA 2HNDA 4Y1DA 3HP6A 2HHHK 4CGIA 2JGUA 4FZZA 2E6LA 4WFNL 2E4LA 3L3UA 3TPQA 3K59A 4EHUA 4HHTA 1HJOA 3V9XA 3W3DA 3OJUA 3N4PA 1RBUA 1BG3A 3SMPA 3ZSRA 2Q1NA 1VAZA 1XHXA 3LP3A 2ZM6K 4W5NA 2YHAA 4X64K 4FJJA 4L8RB 1KVAA 1HX1A 2YNIA 4GV9A 1SKWA 5GIPA 1IH7A 1TK8A 3NVKA 4PWDA 1J5EK 4IJNA 5EX5A 3P1GA 1KLNA 1D8YA 1NGBA 2D4WA 3SNNA 3RR7A 4LFBK 4YOUA 2NRVA 1U2VB 3EEQA 4BDYA 2G8IA 1GLFO 5C0YA 1S1XA 2IAJA 3MEGA 1G99A 1BA1A 4CF1A 4B3MK 5AQLA 3O9QA 1QQOA 3QNNA 3C65A 4DV7K 3DI6A 2E1YA 4CZKA 1S1TA 4M3ZA 4E89A 4QAGA 2ASOA 1LWEA 4IEEA 3VA0A 4A57A 4CJQA 3HL8A 5JICA 4O55A 1VQON 5AQPA 3ATVA 1KD1O 2P9IA
chains in the Genus database with same CATH topology
4DV2K 1N33K 1XNRK 2UXBK 1XNQK 4LF6K 5LL6Z 1XMQK 4DUYK 4DR2K 1N36K 4DV5K 5FLXO 4GKJK 4DR5K 1HR0K 4B3TK 1IBMK 2F4VK 4DR4K 4DV0K 4JI2K 4JI4K 4CW7B 4NXMK 1N32K 4JI5K 4X65K 3T1YK 5IT9O 4DUZK 4LFAK 4OX9K 2VQEK 4YY3K 4B3SK 1HNXK 4X62K 4B3RK 4LF9K 3J7YP 2HHHK 4JI6K 4LF5K 1XMOK 4DV1K 5LMNK 3J80O 2VQFK 3J7AP 4DV3K 2E5LK 2UUCK 1IBKK 4LF7K 1HNWK 4CVNE 4KHPK 4DR3K 2UUBK 4K0KK 4GKKK 2ZM6K 4JI1K 4JV5K 4NXNK 1FJGK 4JI8K 4X64K 4JI7K 5LMUK 3T1HK 2UU9K 4DV6K 1J5EK 4YHHK 5BR8K 4DR7K 2UXDK 4LFBK 4AQYK 5A2QO 4JYAK 4JI0K 1HNZK 3J81O 4LF4K 3OTOK 4V19S 1N34K 2UXCK 4B3MK 4DV4K 3JAMO 4DV7K 4LFCK 2UUAK 4DR1K 4DR6K 1I94K 4LF8K 5IWAK 4X66K 1IBLK 4JI3K 5AJ3K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 K;  1N33 K;  1XNR K;  2UXB K;  1XNQ K;  4LF6 K;  5LL6 Z;  1XMQ K;  4DUY K;  4DR2 K;  1N36 K;  4DV5 K;  5FLX O;  4GKJ K;  4DR5 K;  1HR0 K;  4B3T K;  1IBM K;  2F4V K;  4DR4 K;  4DV0 K;  4JI2 K;  4JI4 K;  4CW7 B;  4NXM K;  1N32 K;  4JI5 K;  4X65 K;  3T1Y K;  5IT9 O;  4DUZ K;  4LFA K;  4OX9 K;  2VQE K;  4YY3 K;  4B3S K;  1HNX K;  4X62 K;  4B3R K;  4LF9 K;  3J7Y P;  2HHH K;  4JI6 K;  4LF5 K;  1XMO K;  4DV1 K;  5LMN K;  3J80 O;  2VQF K;  3J7A P;  4DV3 K;  2E5L K;  2UUC K;  1IBK K;  4LF7 K;  1HNW K;  4CVN E;  4KHP K;  4DR3 K;  2UUB K;  4K0K K;  4GKK K;  2ZM6 K;  4JI1 K;  4JV5 K;  4NXN K;  1FJG K;  4JI8 K;  4X64 K;  4JI7 K;  5LMU K;  3T1H K;  2UU9 K;  4DV6 K;  1J5E K;  4YHH K;  5BR8 K;  4DR7 K;  2UXD K;  4LFB K;  4AQY K;  5A2Q O;  4JYA K;  4JI0 K;  1HNZ K;  3J81 O;  4LF4 K;  3OTO K;  4V19 S;  1N34 K;  2UXC K;  4B3M K;  4DV4 K;  3JAM O;  4DV7 K;  4LFC K;  2UUA K;  4DR1 K;  4DR6 K;  1I94 K;  4LF8 K;  5IWA K;  4X66 K;  1IBL K;  4JI3 K;  5AJ3 K; 
#chains in the Genus database with same CATH topology
 2F9W A;  2I7N A;  1NK4 A;  1DLO A;  5BPL A;  4CD3 A;  2XY5 A;  4F3O A;  3QEI A;  2VCP A;  1EX4 A;  5M1O A;  3VTH A;  2F9T A;  1J9A A;  3ENB A;  1JCG A;  3WXM B;  4GVM A;  3WQT A;  3CHW A;  4NXM K;  1W0H A;  3ZSY A;  4ILJ A;  2HBM A;  3CG7 A;  2G8H A;  3KJV A;  3NFA A;  1WOQ A;  4DLG A;  4CEQ A;  5HL7 L;  4KHN A;  4QS7 A;  5HRR A;  1VQM N;  4CD1 A;  1S22 A;  3WNF A;  4B3S K;  2P51 A;  3AO3 A;  3CIP A;  3KWI A;  1T3V A;  2OTJ N;  2ZGZ A;  3I8B A;  3DXM B;  2FBT A;  2DTU A;  1KFD A;  2ZWH A;  3A5O C;  4JEP A;  4H03 B;  5JMV A;  3QBX A;  4CF8 A;  4FJN A;  1KAY A;  4CF0 A;  3TTF A;  1Z6R A;  5BN8 A;  5J1E A;  3OYJ A;  2HF3 A;  1VQ8 N;  3SUP A;  2UUC K;  3O08 A;  1EKE A;  4BC3 A;  2OPR A;  4ID5 A;  4QCL A;  1TGO A;  4BQZ A;  4BAC A;  1YJ9 N;  4PKG A;  3CCR N;  1RT1 A;  2BTF A;  3VQ6 A;  2V52 B;  3ZT2 A;  4FJ7 A;  4FWP A;  4B8A B;  2G8V A;  4BG9 A;  4FWL A;  1GLL O;  4E1M A;  2A41 A;  4B9S A;  3UKU B;  1DGK N;  3K2P A;  3RVC A;  4DMN A;  4I7F A;  4H0X B;  3EN9 A;  1X9S A;  4JI0 K;  2NRH A;  3AAP A;  3HZ6 A;  1HYZ A;  3K5O A;  5C24 A;  2P1J A;  4J2B A;  3KIO A;  4FLZ A;  4DSF A;  4JKA A;  1X1P A;  2OPS A;  3G25 A;  1GLA G;  1QHT A;  2NRW A;  4FM1 A;  2UUA K;  3C7N A;  2HNY A;  3NMU A;  2A1S A;  5HRS A;  1TKT A;  2YX6 A;  3DYA A;  4CBW A;  2YJE A;  1NGC A;  4GVE A;  3AVH A;  5AJ3 K;  4FZX C;  4M3Y A;  2B4J A;  4FYD A;  1RBR A;  1Y97 A;  2FBX A;  2HHX A;  1VSI A;  1KSP A;  3C6U A;  1QVF M;  5I9E B;  3A8Y A;  1XQS C;  5FPN A;  3L2W A;  1X3M A;  4H5R A;  3ULE B;  3ZT3 A;  4CW7 B;  4CJV A;  5BPM A;  1IG9 A;  4JKH A;  3DLE A;  3WUH A;  3VOV A;  4PL7 A;  3QIO A;  4OLB A;  1UA1 A;  2RPI A;  5C42 A;  4CFB A;  3OYG A;  1K8K B;  4MDA A;  4DQP A;  1B9D A;  4H4M A;  4CCH A;  1NK9 A;  4JHD B;  3DJC A;  3FZF A;  1NJX A;  1HQU A;  4CF9 A;  1RT5 A;  1RT3 A;  3AA2 A;  2QWR A;  5M1F A;  3VER A;  2WBN A;  4FK4 A;  4BRP A;  3NGZ A;  2G8U A;  5KQ8 A;  4FWQ A;  1NGG A;  1XWL A;  4FJH A;  1IKY A;  5KGX A;  4JRQ A;  4JKG A;  3EKU A;  1BO5 O;  3QEW A;  1C0F A;  3NE6 A;  3NBP A;  1TKZ A;  2A40 A;  3L4I A;  4FWR A;  4JI7 K;  5BN9 A;  1YTU A;  1NLV A;  4XH4 A;  4HTL A;  2A6A A;  4BRA A;  1RDB A;  3CJ7 A;  3ULD A;  2UXD K;  4BGB A;  3LZI A;  2V7Z A;  4OPH A;  4ELT A;  3HJF A;  3O9T A;  4BG8 A;  2VWJ A;  4DCH A;  3KWG A;  2Q31 A;  4OGC A;  3BZC A;  1RIL A;  2RN2 A;  2QWN A;  2OTL N;  4C8N A;  4H4O A;  1S6Q A;  1BDG A;  3FZL A;  3V1Q A;  2P9L B;  3TAP A;  1IBL K;  3AO2 A;  2E8A A;  3QO9 A;  1HKC A;  5AQW A;  1ZBU A;  5E84 A;  3D7E O;  3L2R A;  3AVJ A;  2P9N B;  2IDO A;  1KC8 O;  3HBT A;  2ZJR L;  2D5R A;  1RGI A;  4I2P A;  4I9L A;  1YT3 A;  4CJR A;  2P5G A;  3ZLJ A;  1N32 K;  3JYT A;  4FWM A;  4K43 A;  4JNE A;  4IFV A;  4M63 C;  4QOZ B;  3FGU A;  1CZA N;  1BI4 B;  3DXK B;  5AQN A;  3G6E N;  4YY3 K;  4CJL A;  3OYH A;  3VGK A;  4C8K A;  3VQD A;  2QI2 A;  5H1S Q;  5GAG P;  1VQ4 N;  1O13 A;  4JI6 K;  5M1K A;  3HSC A;  1W2B M;  2Y1I A;  3O8M A;  4FM2 A;  1LWF A;  4B1Z A;  5HP1 A;  1KAZ A;  2DFE A;  3ZT1 A;  4M42 A;  3J7A P;  3CFR A;  3VF6 A;  2EWS A;  4OKJ A;  4R79 A;  4JD2 A;  5KPR A;  3BGR A;  3QEV A;  1U45 A;  3CM6 A;  4K0K K;  2E2P A;  2FBV A;  4CZI A;  1LCU A;  2PZS A;  4BR4 A;  1UWB A;  3AA4 A;  4JV5 K;  2HBK A;  2P9P A;  4DF8 A;  3QBW A;  3EE9 A;  2CGJ A;  3ZX0 A;  1OH8 A;  5TKY A;  1ESV A;  2LSN A;  4IZ9 A;  3SJH A;  4E7I A;  4KV8 A;  4AHS A;  2KLA A;  3THY B;  4DV6 K;  1ZBI A;  1GOB A;  3O9R A;  3SAF A;  5DM7 L;  1OKJ A;  3NH1 A;  1C0T A;  5J2Q A;  3U6F A;  1HNZ K;  1DKG D;  1R59 O;  3VEZ A;  3PY8 A;  4GV3 A;  1HLU A;  3SBT A;  2O8E A;  3GBT A;  3O4Q A;  4PHT X;  4BC2 A;  3ZET B;  5CZ1 A;  2O8B A;  4M7X A;  1NGF A;  4IFY A;  3L2V A;  4DSL A;  1NGE A;  4M3W A;  1S9G A;  4XH5 A;  1YVU A;  3FZH A;  4KH4 A;  3IAY A;  2Q36 A;  3AVK A;  1NJZ A;  1NMN A;  2W40 A;  2BAN A;  3KK1 A;  4B9V A;  4NCB A;  1JLG A;  1FXX A;  5HOO A;  4F4K A;  1L5U A;  3NAE A;  3KZB A;  4DUY K;  4DR2 K;  4JKB A;  3A2F A;  4Z4E A;  5GAD P;  3KK2 A;  4IKF A;  1VQK N;  3AVC A;  1UA0 A;  1BCO A;  4O8K A;  1Q18 A;  4E0D A;  5BR9 A;  1TYQ A;  3T1Y K;  3THX B;  2IVN A;  2QKK A;  1BOT O;  1NWK A;  4LFA K;  3HT3 A;  3WXJ A;  3C94 A;  2BGG A;  3S41 A;  1P8Z A;  3OHR A;  4FOI A;  4B3R K;  4BR5 A;  3HK2 A;  2QWL A;  5CZ2 A;  4DTO A;  4A5B A;  2OAN A;  2YNG A;  2KTQ A;  3F2K A;  3VN5 A;  2X74 A;  4BRC A;  4CEB A;  1S5J A;  1WSH A;  2NUB A;  4NCA A;  1BWF O;  4JLH A;  2HHU A;  1RBT A;  4CZG A;  4H0T B;  4LC9 B;  3CXC M;  4IDH A;  3LZJ A;  2GV9 A;  2QWQ A;  1RDW X;  2ASM A;  4DQS A;  3D0P A;  1EWQ A;  4BRK A;  4CK1 A;  5F2R A;  3DM2 A;  2NNW A;  1ZBL A;  2V51 B;  4YOV A;  3ZCM A;  2FSJ A;  3IMX A;  3CPW M;  4A5A A;  1S1U A;  3SAH A;  1NGH A;  5KI6 A;  1FKO A;  4CJF A;  1IG8 A;  2FF6 A;  3CME N;  3VQA A;  3I0S A;  4K8Z A;  3FE1 A;  4PKI A;  3EY1 A;  1VQ6 N;  3K9J A;  3BEX A;  1RDC A;  2HHV A;  1IKW A;  4KHU A;  2CH5 A;  3E9O A;  1S6P A;  4K42 A;  3OTO K;  2XY6 A;  4FJL A;  1U2V A;  4E3S A;  4O44 A;  4CJ5 A;  3TAQ A;  3CCE N;  1S1W A;  1VK0 A;  4KO0 A;  2ZF5 O;  3AGK A;  3MEE A;  3H08 A;  3T19 A;  3CCJ N;  4E7K A;  5ADX A;  2XO7 A;  4DS4 A;  5CE3 A;  2I5J A;  2XRI A;  3C0B A;  5BRD A;  4JI3 K;  2XHB A;  3ALY A;  3SUN A;  1NJI O;  1V4T A;  4DS5 A;  4E7H A;  1LW0 A;  3OYB A;  1KVB A;  2X6S A;  1D4X A;  3OYL A;  3M5R A;  3VES A;  4A61 A;  5DM6 L;  2HHQ A;  2D0P A;  3IKM A;  3LDQ A;  3SK3 A;  5FPD A;  3OS1 A;  1Q82 O;  4MO4 A;  2NRT A;  3HXM A;  1SKS A;  5IT9 O;  1M90 O;  1CLQ A;  3RMA A;  5AQS A;  2IS3 A;  4CJK A;  1NJY A;  1NOZ A;  4ISE A;  1TV6 A;  4BRE A;  3U4L A;  2QWO A;  3LDN A;  4JKF A;  1WAJ A;  1T6C A;  4HUF A;  1EP4 A;  4JK7 A;  3SUQ A;  4EP4 A;  5ADX H;  2O8D B;  3MDQ A;  3DXM A;  4H0Y B;  4H5W A;  4IG3 A;  1NGJ A;  3KD1 E;  4HCB A;  4OJR A;  3C95 A;  5LMN K;  1ITG A;  4BRD A;  3MN9 A;  4R5P A;  3FFK B;  4JAX A;  3SCX A;  1CXQ A;  1ASV A;  4K25 A;  1RT2 A;  2HBL A;  4WE1 A;  1WSG A;  4KTW A;  2F8T A;  1IBK K;  1U49 A;  3RTV A;  3EKS A;  1JKH A;  4CVN E;  4WQ4 C;  3OYI A;  2AA4 A;  1UAX A;  4W5R A;  1QSY A;  1KFS A;  2OZS A;  3SI6 A;  1J6Z A;  3ZYY X;  4RWT A;  3MX2 A;  3GDQ A;  1WBD A;  4FVU A;  4RTF D;  5E41 A;  4N76 A;  4QS8 A;  5LJV A;  2HST A;  3H3N O;  4FLX A;  1VSL A;  4YHH K;  3UKU A;  2E2O A;  4FL9 A;  2ETJ A;  3U3Y A;  3I33 A;  2NRR A;  3SLC A;  2HF4 A;  4ELU A;  5JLH A;  3O9U A;  3WXI A;  4FM0 A;  1B92 A;  4U7B A;  3AY9 A;  3CJC A;  4HUE A;  1SL1 A;  3CCS N;  2O8F B;  1KRP A;  5M1Q A;  1VSF A;  4KRE A;  4KRF A;  1HRH A;  4XH1 A;  2Q97 A;  4Z4G A;  3O3G A;  2G8F A;  3O4W A;  2E1Z A;  4J8F A;  2GWK A;  4DU4 A;  4BRH A;  3AVL A;  3KLH A;  3PUF A;  3IG1 A;  2IGI A;  3MED A;  4UQG A;  5C15 A;  4FWK A;  1JL1 A;  4C8O A;  2YI1 A;  2ITG A;  3QFU A;  3E9L A;  2VG5 A;  2ZQB A;  5LL6 Z;  1L3U A;  1BU6 O;  3HM8 A;  2H3G X;  3OYN A;  4DQI A;  1N36 K;  1XC3 A;  5KTQ A;  3FFI A;  1RTJ A;  5AQV A;  5JLF A;  4DR5 K;  2CGK A;  4B3T K;  2D0B A;  2Z1J A;  1WN7 A;  4JI4 K;  3VPZ A;  3QES A;  1ILY A;  3LWM A;  2RE2 A;  1X9J A;  3P38 A;  3ULE A;  3ZT0 A;  1ASW A;  3U3G A;  1KLM A;  2F96 A;  3QFP A;  4FJG A;  3T1A A;  4RCH A;  2PBD A;  2Q0R A;  1K8K A;  4RW4 A;  4DLE A;  1XC9 A;  4Y0W A;  3F9K A;  4JHD A;  4IOX A;  3TAM A;  3O1B A;  3TAE A;  1A5W A;  5FRM A;  3AVG A;  2P9U B;  5BRH A;  2B6A A;  5EY4 A;  4YOY A;  3KHY A;  3A5M C;  4U67 L;  4KHW A;  2CGL A;  2B5J A;  2VWB A;  4DR3 K;  3K5M A;  1EO1 A;  4GKK K;  4FXD A;  1HKB A;  3MN7 A;  2NZT A;  4DQ8 A;  2RKI A;  4JKD A;  1GOC A;  1REV A;  1B9F A;  3K5L A;  3H1Q A;  3AO5 A;  3CQ8 A;  3PX4 A;  3QB0 A;  3LL3 A;  4E1J A;  4BDZ A;  3GE1 A;  3O5B A;  4CEF A;  3LAK A;  5AQG A;  1RT4 A;  1SZ2 A;  3OYF A;  3J81 O;  2E20 A;  3AAR A;  1NK8 A;  4BRI A;  4FPA A;  3NHG A;  4FJX A;  4EHT A;  3PIP L;  1LW2 A;  5AQT A;  4LFC K;  1HYS A;  1TK0 A;  4CJ7 A;  3DOL A;  4MO5 A;  3WNH A;  4KI6 A;  1I39 A;  4AHU A;  3L0Q A;  4PUO A;  4GMJ B;  3LDO A;  4WQ4 A;  5AQX A;  4CEE A;  5DMR A;  2YV0 X;  4Z4C A;  2PFU A;  4IOC L;  1SKR A;  1W97 L;  3AAQ A;  2VG7 A;  3MEC A;  2P9L A;  1VQ9 N;  4KH5 A;  4E7L A;  3QEP A;  3VQ4 A;  4GKJ K;  5C25 A;  3HI0 A;  1SS6 A;  2E88 A;  4DQQ A;  2VWK A;  1GOA A;  4J2A A;  4BRN A;  2IC3 A;  2P9N A;  1BQN A;  4FWS A;  2V7Y A;  1HUX A;  4CGD A;  3ENH A;  4JS5 A;  5HRO A;  3PX0 A;  2QXL A;  3CYM A;  4B08 A;  3LDL A;  2DFF A;  1K9M O;  1EXQ A;  1BI4 A;  2J4R A;  3TSQ A;  3DXK A;  1OH7 A;  3VQ9 A;  3AVN A;  1L3S A;  4FPB A;  3J7Y P;  3A0I X;  3SYZ A;  3MXI A;  4B9N A;  4N41 A;  2JLE A;  4CEO A;  2I7P A;  5SZT A;  1XI1 A;  3HO1 A;  3L6Q A;  3M8Q A;  5AQJ A;  4MDB A;  3DRS A;  4DTS A;  4B1X B;  2O4G A;  1QHA A;  4I6M B;  3NF7 A;  3D6R A;  3L2U A;  3IDH A;  1MWK A;  2JWK A;  3IUC A;  3VQB A;  1Q9Y A;  3R6M A;  3AGR A;  3PIO L;  4FK2 A;  4W5Q A;  3VEX A;  5LMU K;  3WEE B;  4CBU A;  3RRH A;  2HW3 A;  1YI2 N;  3TSU A;  4GNI A;  4AM6 A;  3VTI A;  4KHY A;  2QEX N;  3O3H A;  3V4I A;  4DTP A;  3M8S A;  3THY A;  1U48 A;  2HMI A;  4ICL A;  3AVI A;  2X6N A;  2RF2 A;  3RMB A;  3BZK A;  4V19 S;  4BE0 A;  3O4N A;  4Q5V A;  2PYL A;  2P9K B;  4AHV A;  3TR8 A;  1VQ7 N;  5M1P A;  4M45 A;  3KLI A;  3HVT A;  3MN5 A;  2G8W A;  1J53 A;  1X9W A;  3ZET A;  5JVH L;  4IXC A;  4AHR A;  1Z26 A;  3UKR B;  5F0X A;  2KZZ A;  2YNH A;  1BUP A;  3FR0 A;  4YOT A;  1R0A A;  4IOA L;  1T44 A;  2QTD A;  4ID1 A;  1XNR K;  3B6P A;  3VEY A;  4DSK A;  4BWJ A;  4YFU A;  3HP9 A;  3D2E B;  3HYF A;  5FLX O;  3SV3 A;  3DRR A;  1HR0 K;  5AZJ B;  4ZHR A;  1RT6 A;  4DTX A;  4CK2 A;  4JK8 A;  3VGM A;  3DLG A;  1OVQ A;  1ASU A;  1K6Y A;  3SZ2 A;  3E1Y A;  4O8U A;  4OPK A;  4F2R A;  4DSJ A;  4KHS A;  2NRZ A;  5KPZ A;  3ZSW A;  4DFM A;  3THX A;  5AQM A;  3CFP A;  1U04 A;  3O1W A;  1HNX K;  3G10 A;  3MCA B;  1Q8I A;  4Z4I A;  1NGI A;  1FKP A;  2A3Z A;  2W42 A;  1VSH A;  1HQE A;  3QIC A;  3J80 O;  1JXE A;  4FW2 A;  5GIO A;  3RMC A;  2E5L K;  1WAF A;  1VSJ A;  1DTQ A;  5CYQ A;  3LPU A;  3FLC O;  4Y1C A;  1KVC A;  1Y64 A;  5AQH A;  4DSI A;  3BF3 A;  3DLL L;  2D1K A;  4ILG B;  4JI1 K;  1WSF A;  3RWU A;  4NXN K;  2GUI A;  2FLO A;  3J7Z O;  3CJ1 A;  1IKX A;  4CIF A;  2E2Q A;  4IDK A;  5BRE A;  1N6Q A;  4YNQ A;  4FVM A;  4C1N I;  3OYE A;  3E9P A;  3VF4 A;  3ZEU B;  3OYC A;  3LPT A;  2GEL A;  3RSE B;  4LF4 K;  3QIN A;  1N34 K;  4DWI A;  2KW4 A;  5M1N A;  4DB3 A;  4CJP A;  3JAM O;  4A62 A;  3SPZ A;  1U47 A;  4K41 A;  2GBZ A;  1TUY A;  3CMA N;  4GY2 B;  3SAG A;  2PAV A;  4EAH D;  2R7Y A;  3VQQ A;  1XUP O;  1I94 K;  1QSS A;  3DLR A;  1BL3 A;  4LF8 K;  3HOS A;  3VQ5 A;  5B8H A;  4CJE A;  5T7B A;  3L3V A;  2HHW A;  3R9P A;  5ELZ A;  4CEC A;  4DF4 A;  4MQ3 A;  3IRX A;  3GOI A;  3U8X A;  2ZJQ L;  2G8K A;  1HKG A;  1EET A;  3OYM A;  3M1F A;  3WXK A;  4DV5 K;  3MWP A;  1IBM K;  1IV0 A;  3QER A;  4IO8 A;  1VSE A;  1ATR A;  3F73 A;  1TAU A;  4O0J A;  5CYM A;  4BRO A;  4DUZ K;  4B9M A;  1Q9X A;  3OW2 M;  4CI6 A;  4BC4 A;  4PY5 A;  1JLQ A;  1VSD A;  4NLC A;  3CM5 A;  2IIR A;  4AH9 A;  3DWL A;  3VGL A;  1JLA A;  3MXJ A;  5JS2 A;  1NU0 A;  4G1Q A;  1WSI A;  1TAQ A;  4KFB A;  4H0P A;  3C6H A;  4QS9 A;  4H8K A;  4Z94 A;  4DU1 A;  3EL2 A;  3SQ0 A;  4CE9 A;  4DV1 K;  2O8D A;  1NKC A;  2VQF K;  3IS9 A;  1QSL A;  4F9O A;  2DFH A;  4FO0 A;  3G71 N;  1HYV A;  4FJM A;  5D3G A;  1VHX A;  5AZI B;  1JCF A;  3T7Z A;  4CER A;  1D9F A;  1WBB A;  4DHY A;  2KZM A;  3OJS A;  2BE2 A;  3WXL A;  1DTT A;  4CGF A;  4HVJ A;  1JL2 A;  2YHB A;  5AQO A;  4DTN A;  4CJU A;  2YKN A;  2ZD1 A;  2YHW A;  4MLE A;  5TKW A;  3O9S A;  3QNO A;  3UIQ A;  2P5O A;  1RBV A;  3WNG A;  1J54 A;  5I42 A;  1EQY A;  5BRF A;  1YTA A;  4E7J A;  1ZXO A;  5CHI A;  3T69 A;  1QQN A;  2FXU A;  3HPO A;  3TWH A;  2HBJ A;  3ZX2 A;  5AQY A;  3O6W A;  4BQL A;  1RT7 A;  3FZK A;  3I0R A;  3F9M A;  3NDK A;  4RW8 A;  3A5N C;  4KH6 A;  3NVM A;  1K8A O;  1NKB A;  4HUG A;  4M3U A;  1V4S A;  1GLD G;  3TTC A;  2O8F A;  1HPM A;  4CFC A;  3NH0 A;  4AHT A;  3AA3 A;  1L3V A;  1ZBH A;  5EU7 A;  4OKK A;  4ISG A;  4CFA A;  3B8A X;  5KRT A;  2EX3 A;  4Z0U A;  2UXB K;  1XMQ K;  4I9Q A;  1SV5 A;  1NK7 A;  1Q86 O;  3ZSO A;  3TAR A;  1C1B A;  1VSK A;  1RDA A;  3K57 A;  3IFR A;  4DV0 K;  1U6Z A;  1JLB A;  1SUQ A;  4ILH A;  4JI2 K;  3ZSX A;  4ELV A;  1GLC G;  3BY5 A;  4C8M A;  4B9T A;  2F7T A;  2FBY A;  3ISN C;  4H5V A;  3C6T A;  4CHQ A;  1G15 A;  4IWV A;  3S3N A;  2GTD A;  4DU3 A;  1ATS A;  4CFD A;  2YKM A;  4CZH A;  1QQC A;  3D2F B;  2KFZ A;  4LF5 K;  4KB0 A;  4IO9 L;  4J2D A;  3H46 O;  4RW7 A;  4WQ5 C;  1NOY A;  1JLE A;  3RR8 A;  5F1X A;  2D0C A;  5FRN A;  2W6L A;  5FRO A;  2P9U A;  3U9D A;  3L2Q A;  1JLF A;  4A59 A;  1J5O A;  3OA9 A;  3H3O B;  3ATU A;  3VMF B;  3SQ1 A;  1RNH A;  4CEZ A;  2GWJ A;  1E3M A;  4EFH A;  1FJG K;  2OYQ A;  2VYP A;  4DFK A;  1BIZ A;  4CHP A;  3OVN A;  2Z1H A;  3O80 A;  1QQM A;  1P90 A;  1WUA A;  3MXM A;  1RFQ A;  4OVL A;  4KB1 A;  2EHG A;  3HRG A;  4ZTF A;  1YVN A;  4PQU A;  2XY7 A;  1LV5 A;  2WFB A;  3KK3 A;  3MAQ A;  1SQK A;  3V9Z A;  4DV4 K;  4HCC A;  3KLF A;  4KKO A;  4M3R A;  5HLF A;  1ZYQ A;  2PYJ A;  2HVH A;  4A2B A;  1RTD A;  2W41 A;  1TKD A;  2Q0U A;  5C2F A;  2QXF A;  2HOE A;  5IWA K;  5HBM A;  1GLJ O;  5GAE P;  3Q7B A;  3FZM A;  1U4B A;  4FWO A;  3HVR A;  4DV2 K;  1NNE A;  4N56 A;  1NBW A;  3HPG A;  2WTU A;  5AQK A;  2IVO A;  4WFB L;  2BH1 A;  1HNI A;  2YHY A;  4DR4 K;  3HOT A;  4TSX A;  3S9H A;  1Z05 A;  4CGH A;  2FF3 B;  4RG8 A;  2A5X A;  4OLA A;  1W9H A;  3R1X A;  1L3T A;  2BUP A;  4CHN A;  5JS1 A;  3VEN A;  2WC9 A;  4FJI A;  4CZF A;  4O4G A;  3OYA A;  4LF9 K;  1VRU A;  4BR2 A;  5E26 A;  1NKE A;  4WYB A;  4CGJ A;  1KXP A;  1LAW A;  2UYT A;  5FDL A;  4H5N A;  3UE5 A;  2YCH A;  1LWC A;  3BP8 A;  3VEV A;  1JJ2 M;  4CF2 A;  1C0U A;  1OVY A;  4CK3 A;  2ITM A;  4PL8 A;  3CJ9 A;  1MDU B;  4I6M A;  4B1U B;  4LY7 A;  4NYN A;  1I3A A;  3AO4 A;  5KQD A;  2O8C B;  1HNV A;  3TSP A;  2O4I A;  5DK5 A;  3P5J A;  1YJW N;  2F8S A;  2E6M A;  4JN4 A;  3WEE A;  1NGA A;  3LDS A;  5HRP A;  3F5T A;  4JYA K;  1BGX T;  2IVP A;  1ZBF A;  1ZC6 A;  2RHK A;  3GL1 A;  4JKC A;  3ITH A;  3N4Q A;  4WQ5 A;  4PKH A;  4Q0B A;  3AVA A;  4N5S A;  1CXU A;  3THW B;  1DEJ A;  5AQU A;  2P9K A;  3U9Z A;  1QTM A;  4E19 A;  1C0G A;  4BR9 A;  3CC7 N;  4DR6 K;  2A42 A;  1FK9 A;  1C0M A;  3UKR A;  3NH2 A;  2YHX A;  4DQR A;  3T3F A;  4FJ9 A;  4LH5 A;  2Z1I A;  1KAX A;  4DTR A;  3R3L A;  3O3F A;  4LF6 K;  2FSN A;  3AV9 A;  4G9Z A;  3J8A A;  5MLC Q;  1WB9 A;  4F2S A;  4LD0 A;  3D2E A;  1YIT N;  5AFU A;  4E1N A;  3EYZ A;  2KKZ A;  5AZJ A;  2P9S B;  3M6G A;  1E4G T;  3DRP A;  4OGE A;  4JI5 K;  3KKR A;  3PO5 A;  3VQP A;  4B8C A;  3CQX A;  4NCG A;  3I55 N;  3CPE A;  1T8E A;  3D45 A;  3VA3 A;  2Y1J A;  3QDK A;  4BE2 A;  3JSM A;  3P31 A;  4F3T A;  3C6A A;  3JXU A;  2W6K A;  1BA0 A;  1MA9 B;  1E4F T;  3K5N A;  4B1V A;  3DLB A;  4YOW A;  3OS2 A;  3GG4 A;  1C1C A;  3P4I A;  4DV3 K;  4HTU A;  1D5A A;  3VQC A;  4MLH A;  1HNW K;  1JXB A;  3SV4 A;  3CCV N;  4OO1 J;  1QVG M;  3MMV A;  2HB5 A;  5AFU H;  4C23 A;  3BUZ B;  2X78 A;  1S72 N;  2ZGY A;  4MFB A;  4JI8 K;  3AO1 A;  4KTZ A;  4EIA A;  2DPN A;  4CZL A;  5AQR A;  5BPN A;  3NGI A;  3T1H K;  3THV A;  1TVR A;  3TU5 A;  3L4Q A;  3OYD A;  3LWL A;  3PLA A;  1O1W A;  2ASP A;  5A2Q O;  1QZ6 A;  5EOY A;  3VF2 A;  4DFJ A;  3ZSQ A;  1NJW A;  4M3T A;  3ZEU A;  2UXC K;  3SJJ A;  3RSE A;  3OBY A;  3VET A;  5C2D A;  5K14 A;  4DR1 K;  1Q7Y O;  4LSL A;  5FPE A;  1SAZ A;  1CZB A;  3EO3 A;  4AF1 A;  4BC5 A;  3L8B A;  3KKS A;  3CF5 L;  2P9I B;  4DG1 A;  4ISF A;  1XHZ A;  3TTD A;  4BRM A;  4FJ8 A;  2QKB A;  3CCM N;  1N33 K;  4IEI A;  1BHL A;  2AJQ A;  5J2N A;  1HJR A;  3HM9 A;  3VEO A;  1EWR A;  4H5T A;  2KFN A;  1BIS A;  3LP1 A;  1RTH A;  2A1R A;  1VQL N;  1BQM A;  3QET A;  5EXW A;  1ZBS A;  2WOM A;  3G0Z A;  2NRX A;  2F4V K;  3RRG A;  3SBG A;  3CFO A;  5AR0 A;  3ID8 A;  3TAF A;  5C12 A;  1QS4 A;  4NB4 A;  3BF1 A;  4K8X A;  4CHY A;  4CGG A;  2YNF A;  3R8E A;  1NK5 A;  4BVO A;  4B1Y B;  2ZE2 A;  4BY9 C;  3DAW A;  4CJ4 A;  1SL2 A;  2WUS A;  2OPP A;  3AVM A;  2Q3S A;  3MX5 A;  3H6E A;  3OS0 A;  3ZT4 A;  4WF9 L;  3CER A;  2FC0 A;  2VG6 A;  3CI5 A;  2KQ2 A;  3VEW A;  3K0S A;  4Z4H A;  4B9L A;  5GAH P;  4Z4F A;  4CIE A;  3V9U A;  2XY8 A;  1M1K O;  4CZE A;  1RTI A;  4LF7 K;  1T05 A;  1T6D A;  3A5L C;  4KHP K;  3PV8 A;  5AQZ A;  3DMJ A;  4FLW A;  4FOE A;  5J2M A;  2HMP A;  3MK6 A;  4NLB A;  1WLJ A;  3NF9 A;  4BGA A;  3CQY A;  5AZI A;  4JKE A;  3PO4 A;  1LAV A;  1WNS A;  3V9S A;  3K9K A;  1IKV A;  2HHT A;  2E2N A;  1ATN A;  3OYK A;  3PSI A;  1UOC A;  2UU9 K;  1BIU A;  2VGM A;  4EZ6 A;  1GLB G;  5BR8 K;  1HPZ A;  1T7P A;  4FJ5 A;  4AQY K;  3VQ8 A;  2FSK A;  5AQI A;  4KI4 A;  3MCP A;  4FJK A;  4NO7 A;  5I3U A;  2HNZ A;  3C7N B;  5GIN A;  2VGN A;  1FW6 A;  4CES A;  3KK7 A;  3JS6 A;  1JCE A;  4M7Y A;  1YIJ N;  3MN6 A;  4OPA A;  3I56 N;  4CHZ A;  4UY8 O;  3VQ7 A;  4FLU A;  1YUW A;  2KHO A;  4CJW A;  3WNE A;  3TAG A;  1N5Y A;  1XNQ K;  2YJF A;  3KD5 E;  3ZSZ A;  3V6D A;  4FK0 A;  4FLY A;  4CIG A;  1TKX A;  3CJA A;  4CZM A;  1X9M A;  4IBN A;  3CCL N;  3E01 A;  1IO2 A;  2D0O A;  1OH5 A;  1QE1 A;  2QWP A;  3LAL A;  4IG0 A;  2VQE K;  1WSE A;  3OY9 A;  4XIU A;  4X62 K;  4FLT A;  3CCQ N;  2DY4 A;  4DTM A;  3RMD A;  3WT0 A;  4YDU C;  5AQF A;  4FW1 A;  4FLV A;  4KAZ A;  3HST B;  3H1V X;  4O0I A;  3ZX3 A;  4FCY A;  2OZM A;  2QA4 N;  1XMO K;  3M8R A;  3D2F A;  1YHQ N;  1NMD A;  2HHS A;  1DT9 A;  2GX9 A;  2IOC A;  4JKG B;  3NGY A;  4BWM A;  3SUO A;  1A5V A;  4W5T A;  2ATQ A;  4M41 A;  1IJJ A;  4N47 A;  4F8R A;  2Q2R A;  4M3X A;  4C1N K;  4XEI A;  4AM7 A;  1KTQ A;  3LM2 A;  4FSV A;  4C8L A;  1LOT B;  1TL1 A;  4BDP A;  3AA5 X;  3EE8 A;  4GV6 A;  3ZSV A;  4DR7 K;  1TUU A;  4H0V B;  4EZ9 A;  4WFA L;  4DTU A;  2OPQ A;  4CED A;  3H45 C;  2CH6 A;  2BDP A;  4YOR A;  3LAM A;  4KBO A;  3CCU N;  1SL0 A;  2QWM A;  3W0L A;  2OCE A;  3WQU A;  4CBX A;  3CC2 N;  2QM1 A;  4ZTJ A;  4BR7 A;  1VQP N;  1RCH A;  1S1V A;  4RW6 A;  4DFP A;  1TK5 A;  1YAG A;  3DLK A;  2Z1G A;  4BR0 A;  3P83 D;  3P39 A;  1GLE G;  3QEX A;  3S3O A;  3MWT A;  4B1W B;  5C10 A;  3B6O A;  3M8P A;  5CY4 A;  1A5X A;  4OKE A;  3TAN A;  4B9U A;  4GW6 A;  2OA8 A;  4JRP A;  3PX6 A;  1MU2 A;  4EP5 A;  4AIL C;  1RBS A;  3S3M A;  2NLX A;  4H0O A;  3KLG A;  1YXQ A;  3TI0 A;  4A2A A;  4BRQ A;  1Z25 A;  4X65 K;  3VQE A;  2HVI A;  1S3X A;  3NCI A;  3EZ5 A;  4OX9 K;  4LH4 A;  3LAN A;  3M3Z A;  1N8R O;  3DOK A;  3V81 A;  5J2P A;  4CJS A;  4KTQ A;  3G4S N;  4BRG A;  3KVG A;  4WCE L;  1VQN N;  3QML A;  4DSE A;  4I2Q A;  3TAB A;  1Q81 O;  2GUP A;  1HMV A;  4BVP A;  2QW9 A;  1S9E A;  3UB5 A;  5JVG L;  1RDD A;  4JD2 B;  3V9W A;  4CEA A;  2WON A;  3E66 A;  2D0A A;  4FZY A;  2QK9 A;  2UUB K;  3QLH A;  2AP1 A;  2P9P B;  2PY5 A;  4IFE A;  3KTQ A;  1NGD A;  3K58 A;  3I8D A;  1NK6 A;  3ID6 A;  1F21 A;  4JS4 A;  3LM9 A;  1JLC A;  1VRT A;  5CR4 A;  1C6V A;  3LP0 A;  3PSF A;  2O8C A;  4OPJ A;  1C1A A;  4YDU A;  1VSM A;  4KHQ A;  4B9Q A;  5FPM A;  1VQ5 N;  2O8E B;  4NYF A;  5EVZ A;  3NF8 A;  3BDP A;  1RDU A;  2O8B B;  1K73 O;  3CET A;  1KCF A;  3NF6 A;  4DKW A;  4JK9 A;  3Q7C A;  2GEM A;  3SPY A;  3SQ4 A;  3KLE A;  3THW A;  3OBW A;  1T03 A;  1W7A A;  3ENO A;  3HPH A;  3ASM A;  5HRN A;  3V1O A;  4B3O A;  3DLH A;  1WSJ A;  4X66 K;  4AHC A;  5KPT A;  3SQ2 A;  3QIP A;  4O5B A;  3EZW A;  4DTJ A;  2ZJP L;  4LSN A;  4L3Q A;  2JWL A;  1TL3 A;  4CHO A;  4YOX A;  5LJW A;  5LY3 A;  1NK0 A;  3CC4 N;  1TYQ B;  1NM1 A;  4BRL A;  4CZJ A;  3LDP A;  3CJB A;  5KRS A;  4KPY A;  3HTV A;  5AQQ A;  3LP2 A;  4CJT A;  5SWM A;  2P9S A;  3AVB A;  1YJN N;  1YF5 L;  1MWM A;  4O5F A;  4BRF A;  1OH6 A;  1KQS M;  1CZ9 A;  4FWN A;  1H1V A;  3V1R A;  1X3N A;  1QZ5 A;  4HWI A;  4IJA A;  1NG9 A;  4RW9 A;  5KGW A;  4BE1 A;  3AVF A;  1BCM A;  4PA1 A;  3SMS A;  1D9D A;  4CJ3 A;  4W5O A;  3CD6 N;  4J2E A;  2HND A;  4Y1D A;  3HP6 A;  2HHH K;  4CGI A;  2JGU A;  4FZZ A;  2E6L A;  4WFN L;  2E4L A;  3L3U A;  3TPQ A;  3K59 A;  4EHU A;  4HHT A;  1HJO A;  3V9X A;  3W3D A;  3OJU A;  3N4P A;  1RBU A;  1BG3 A;  3SMP A;  3ZSR A;  2Q1N A;  1VAZ A;  1XHX A;  3LP3 A;  2ZM6 K;  4W5N A;  2YHA A;  4X64 K;  4FJJ A;  4L8R B;  1KVA A;  1HX1 A;  2YNI A;  4GV9 A;  1SKW A;  5GIP A;  1IH7 A;  1TK8 A;  3NVK A;  4PWD A;  1J5E K;  4IJN A;  5EX5 A;  3P1G A;  1KLN A;  1D8Y A;  1NGB A;  2D4W A;  3SNN A;  3RR7 A;  4LFB K;  4YOU A;  2NRV A;  1U2V B;  3EEQ A;  4BDY A;  2G8I A;  1GLF O;  5C0Y A;  1S1X A;  2IAJ A;  3MEG A;  1G99 A;  1BA1 A;  4CF1 A;  4B3M K;  5AQL A;  3O9Q A;  1QQO A;  3QNN A;  3C65 A;  4DV7 K;  3DI6 A;  2E1Y A;  4CZK A;  1S1T A;  4M3Z A;  4E89 A;  4QAG A;  2ASO A;  1LWE A;  4IEE A;  3VA0 A;  4A57 A;  4CJQ A;  3HL8 A;  5JIC A;  4O55 A;  1VQO N;  5AQP A;  3ATV A;  1KD1 O;  2P9I A; 
#chains in the Genus database with same CATH homology
 4DV2 K;  1N33 K;  1XNR K;  2UXB K;  1XNQ K;  4LF6 K;  5LL6 Z;  1XMQ K;  4DUY K;  4DR2 K;  1N36 K;  4DV5 K;  5FLX O;  4GKJ K;  4DR5 K;  1HR0 K;  4B3T K;  1IBM K;  2F4V K;  4DR4 K;  4DV0 K;  4JI2 K;  4JI4 K;  4CW7 B;  4NXM K;  1N32 K;  4JI5 K;  4X65 K;  3T1Y K;  5IT9 O;  4DUZ K;  4LFA K;  4OX9 K;  2VQE K;  4YY3 K;  4B3S K;  1HNX K;  4X62 K;  4B3R K;  4LF9 K;  3J7Y P;  2HHH K;  4JI6 K;  4LF5 K;  1XMO K;  4DV1 K;  5LMN K;  3J80 O;  2VQF K;  3J7A P;  4DV3 K;  2E5L K;  2UUC K;  1IBK K;  4LF7 K;  1HNW K;  4CVN E;  4KHP K;  4DR3 K;  2UUB K;  4K0K K;  4GKK K;  2ZM6 K;  4JI1 K;  4JV5 K;  4NXN K;  1FJG K;  4JI8 K;  4X64 K;  4JI7 K;  5LMU K;  3T1H K;  2UU9 K;  4DV6 K;  1J5E K;  4YHH K;  5BR8 K;  4DR7 K;  2UXD K;  4LFB K;  4AQY K;  5A2Q O;  4JYA K;  4JI0 K;  1HNZ K;  3J81 O;  4LF4 K;  3OTO K;  4V19 S;  1N34 K;  2UXC K;  4B3M K;  4DV4 K;  3JAM O;  4DV7 K;  4LFC K;  2UUA K;  4DR1 K;  4DR6 K;  1I94 K;  4LF8 K;  5IWA K;  4X66 K;  1IBL K;  4JI3 K;  5AJ3 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...