2G8KA

B. halodurans rnase h catalytic domain d192n mutant in complex with ca2+ and rna/dna hybrid (non-p nick at the active site)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
136
structure length
136
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKANYGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna/dna
molecule keywords 5'-R(*UP*CP*GP*AP*CP*A)-3'
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
total genus 42
structure length 136
sequence length 136
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8kA00
2Y1IA 2EX3A 4BDZA 1ASVA 4DSKA 1VSHA 2B5JA 2QK9A 1WSHA 2X78A 3HPHA 4OPKA 4DFKA 1VSLA 1GOCA 4ZHRA 4I2QA 4J2BA 4CJFA 3P1GA 3AA5X 4B8AB 3S9HA 5KI6A 4FJMA 4DQRA 3THVA 3NE6A 4KB1A 5C24A 3AVGA 1HYZA 1JLFA 1EP4A 3DMJA 3VA0A 1KVBA 1A5WA 3TAMA 1RDBA 3ZSZA 4ELTA 3TABA 4DFPA 3DYAA 4B8CA 4KHUA 1RBRA 3QEVA 3OYJA 4KAZA 5I42A 4N5SA 4DF8A 1HNIA 3EYZA 4FJXA 4BWJA 1TGOA 4B9SA 3PX4A 3AVIA 2OZMA 4MFBA 3TAGA 1IKXA 3VQQA 2X6NA 1IO2A 1JL2A 1KRPA 3NH2A 1BL3A 3TANA 3QO9A 2ATQA 3RMAA 4CHPA 1S1TA 3SQ4A 1JLBA 3RMCA 2PY5A 2AJQA 1S1VA 3DOLA 4BWMA 1NKCA 4YFUA 1NOZA 3U3YA 3LPUA 4FJJA 2KQ2A 4HUGA 1IKVA 1IH7A 4W5NA 1RT3A 3HL8A 4H4MA 1ASUA 3KLFA 4AILC 4JLHA 4BE2A 1X9WA 4RW7A 1T05A 1HRHA 1NJYA 4DSJA 1HMVA 3ZT3A 1N5YA 1UA1A 3HK2A 3JSMA 4OKKA 3HM9A 3E01A 4E1MA 3SCXA 1ZBUA 4IKFA 5FROA 3EY1A 1LW2A 2XRIA 1JL1A 4DQSA 2Q3SA 4GVMA 3KKSA 1TAUA 3S3OA 4B9TA 4CJ3A 1I3AA 1IKYA 2B4JA 2HNDA 4GMJB 3S3NA 2XY6A 4FZZA 4B9MA 3TAQA 3AVCA 1LWFA 3OYIA 3OJUA 5JS2A 3AVJA 4B9LA 4OLAA 2YV0X 1ZBHA 3DLRA 3K57A 4BACA 1UA0A 4KHYA 3L2RA 4Y1CA 3F9KA 2D5RA 1TK0A 4M3UA 4PWDA 2OPPA 4EZ6A 4NYFA 3OS2A 4CHZA 1L5UA 1D8YA 2HHSA 1L3TA 4CJVA 4M3XA 1JLEA 5C25A 2ZD1A 1GOBA 3OS0A 1NK4A 2E4LA 1VRUA 2FBYA 4IFVA 4FW1A 1NKEA 2G8KA 4F8RA 3KK1A 1ASWA 3ZCMA 4EP5A 4E0DA 4E7JA 1VSMA 1QSSA 3QIOA 4PA1A 4DMNA 4E19A 2YNFA 4JRPA 1WN7A 3SNNA 2KZZA 4H4OA 3C6TA 5SWMA 4MQ3A 3LZJA 3OYBA 3HJFA 3DOKA 3HP9A 3M8PA 4CHNA 5HROA 3L8BA 1LAVA 3P5JA 4N56A 3HSTB 4DU4A 4O4GA 1KLNA 3B6PA 2HHTA 1GOAA 2P51A 3C95A 4DTMA 4KHWA 3ZSVA 4BE0A 2HNZA 3TWHA 3C6UA 1D5AA 3IG1A 2GUIA 5KTQA 4PQUA 1UAXA 2E6LA 5JS1A 1Q8IA 1W9HA 4CF9A 5E41A 1BIUA 1U47A 4FLVA 1FKPA 3V4IA 5CZ2A 3LP0A 1CXUA 1C1BA 3TI0A 1KSPA 4FLYA 2PYJA 4CIGA 3QERA 3WNFA 1S6PA 1XI1A 3LP2A 1WSEA 3BGRA 3ZSOA 4DS4A 1DTQA 2F8TA 5CY4A 2ITGA 4DTUA 3NF9A 3DLEA 3OYEA 4DU3A 4AHSA 3T3FA 3EZ5A 2B6AA 4CJ5A 4CFDA 4DSIA 2EHGA 3SUNA 1C0UA 1FK9A 5CYQA 4O0IA 4JRQA 4DTNA 2KTQA 3SJJA 1TL3A 4DLGA 4Y1DA 3RMBA 4HCBA 1VSJA 1D9DA 1VSFA 1KFSA 4Z4FA 1RDAA 3AVAA 4AHRA 4ICLA 4B08A 5SZTA 3QLHA 4CJSA 3LDSA 3QNOA 4DTJA 4IDKA 1KFDA 3ZT0A 1NJZA 3QETA 1BI4A 1VSIA 3LZIA 3V9WA 2XY5A 2OA8A 5CZ1A 1L3UA 3DI6A 4RW8A 3BDPA 4W5RA 3SPYA 1X9MA 1S9EA 3ITHA 1TK8A 1RT2A 4CERA 3LWMA 2BGGA 1SL0A 1KVAA 3ZT2A 2IOCA 1O1WA 4FVMA 1EXQA 3AVMA 3SYZA 3RWUA 3MEDA 3VQ6A 3AO2A 3M8QA 1NJXA 3V6DA 1L3VA 3OYGA 4TSXA 1ITGA 1DLOA 3V81A 4M3RA 5DK5A 5EU7A 3ISNC 5CYMA 3VQ8A 3DLKA 1I39A 1NK5A 2FBVA 3SQ1A 4H8KA 3QESA 1XC9A 4FXDA 1LAWA 4CEOA 1RTJA 2YHAA 1LWCA 4NYNA 3O4NA 1BCOA 3V9XA 4CEQA 4N76A 4FZYA 1BI4B 1J9AA 1G15A 3RR8A 1ZYQA 3LP1A 4GW6A 4CGDA 3TAFA 2WOMA 3G10A 3VQ7A 3DRPA 4JS4A 4N41A 1JLAA 4M41A 3MEGA 4E89A 3OY9A 3OYKA 3LWLA 2W42A 3RMDA 4DQPA 5J1EA 1F21A 1RBUA 1JLGA 1XWLA 1J54A 4CGGA 2HNYA 2ZE2A 1REVA 3K58A 4K8ZA 4N47A 4Z4IA 4DSLA 4AH9A 2IS3A 2LSNA 5T7BA 3HXMA 3MXIA 1RT6A 3K5MA 4M3YA 1VSDA 3AA2A 3SQ2A 3OYFA 2QKKA 2DFFA 1X1PA 1EETA 3ASMA 1EX4A 5KGXA 4DTXA 4C8OA 2JGUA 3LAKA 1BQNA 3HPOA 4FJHA 3KLGA 3L3UA 4RW6A 3WNHA 3CM6A 3ZSXA 1NK9A 2G8IA 2OPRA 1WAJA 3ZSYA 1CXQA 4KTWA 4W5TA 4C8KA 4DQQA 1W0HA 3OYCA 3DRRA 3LPTA 4OJRA 1S1UA 4QAGA 4B9VA 1Q9XA 1JLCA 4M3WA 1XHZA 4NCBA 3V1QA 4C8LA 1TAQA 3H08A 4L8RB 4I2PA 1BISA 1JXBA 3MEEA 4IG0A 3CM5A 2QXFA 4I9LA 4Z4CA 1WNSA 3NDKA 1RTDA 4E7HA 3NAEA 3ZT4A 1SUQA 4W5OA 3G0ZA 3LANA 4KTZA 2I5JA 1RT1A 5FDLA 2HVIA 3SUQA 1U48A 4CJQA 1C0MA 4OKJA 4Z0UA 4C8NA 3V1RA 4EP4A 3O3GA 3RRHA 5J2MA 3U6FA 1T7PA 3RR7A 3VQPA 1WAFA 3AA4A 5KGWA 4CEEA 3TR8A 4KV8A 3AVHA 3RTVA 4KREA 4LSNA 3VQAA 4PY5A 2HB5A 5HRNA 4E7IA 3KK3A 1S1WA 3M8SA 4F3OA 3B6OA 1RDCA 4J2EA 2X74A 4CFCA 4XIUA 3KK2A 1VRTA 1A5VA 4CEAA 3PX0A 4CIFA 2A1RA 2HMIA 1U4BA 3DLGA 4O55A 3AVKA 5I3UA 4FJLA 3P83D 1BGXT 3LAMA 3OYMA 3MAQA 3IAYA 1S1XA 2XY7A 4FJNA 2G8WA 3C94A 4KHQA 5FRNA 3DM2A 2HHVA 2FC0A 4B3OA 4G1QA 4LSLA 3T1AA 4DFJA 4F4KA 4CE9A 4F3TA 2RF2A 1ZBIA 1T03A 2Z1IA 4DG1A 3ULDA 4OPJA 1IG9A 4YNQA 4Z4EA 3QINA 4HTUA 4FM0A 1R0AA 3MXMA 5HLFA 3VQBA 1RT4A 1D9FA 2O4GA 3F73A 4DSFA 2ZQBA 4RG8A 1QTMA 4C8MA 4J2DA 4FK0A 4KB0A 2OPSA 3PX6A 4CEDA 4FM1A 4FJKA 3HP6A 1HPZA 3NF7A 1A5XA 3VQCA 1QQCA 3O4QA 1KLMA 3SUPA 2PZSA 2IDOA 1CZ9A 3AA3A 2BDPA 2HW3A 4I7FA 4NCAA 3KJVA 3DLHA 4AHUA 4FK2A 1B9FA 3AO5A 2BE2A 4IBNA 5HBMA 2Z1HA 3L2WA 3HVRA 4I9QA 4HHTA 3NGYA 2G8HA 4QCLA 4JS5A 4FLWA 4BDYA 2Z1JA 2OYQA 4K8XA 4OGEA 1WSFA 4E1NA 3L2QA 3AVBA 1CZBA 2DFHA 2G8FA 2HHXA 4CK2A 3L2VA 1WSGA 1RBVA 3TAPA 2HHWA 4CHOA 3KD5E 1TKXA 1U04A 4CEZA 3CG7A 1S9GA 5J2NA 3IS9A 1ZBFA 1WLJA 4M3TA 4DS5A 2DY4A 1C6VA 3IRXA 3KKRA 2XY8A 1KCFA 2Z1GA 3KLIA 4CK1A 1RCHA 4FW2A 4HVJA 4OVLA 3OYAA 3SZ2A 2A1SA 4CEBA 1LW0A 3LP3A 1C1CA 2XO7A 4KI6A 3MXJA 4CEFA 1EKEA 3OYNA 3SUOA 4Z4GA 3CFPA 2HHUA 1HNVA 1TL1A 3PUFA 3VQEA 1YVUA 2WONA 1BIZA 1JLQA 4KO0A 1SKWA 5J2QA 1YTUA 4J2AA 2D0AA 4CGFA 4CJWA 1NK8A 2F8SA 4KHSA 3U3GA 4LH4A 1HQUA 2F96A 5DMRA 3L3VA 4CGIA 4E3SA 1J5OA 4AHTA 4CECA 2YKNA 3ZSQA 4CJ4A 3NCIA 3NBPA 2KFZA 1RT5A 4Q5VA 3CYMA 2DTUA 4FYDA 3NFAA 3HYFA 4DLEA 4BE1A 3QEWA 1YTAA 1DTTA 4E7KA 3FFIA 2P5OA 4CJRA 3NHGA 1XHXA 5HRSA 3NGIA 2VWJA 1TKDA 3TARA 3K5NA 1HYSA 3UIQA 3NH0A 1JKHA 1UOCA 1SL2A 3VQ5A 3K2PA 4LY7A 3VQDA 4CESA 3SQ0A 3OVNA 2O4IA 1L3SA 2Y1JA 2GV9A 1RBSA 1Y97A 4FLXA 3VA3A 4M3ZA 4Q0BA 4NCGA 4RW4A 2JLEA 1YT3A 4O5BA 2NUBA 3WNEA 4QOZB 4OLBA 2RPIA 3OS1A 1T8EA 3AO4A 3D45A 1SV5A 4F2SA 4FJ8A 1MU2A 2QKBA 2RN2A 1B92A 1S5JA 1HYVA 1NK6A 3V9UA 4KTQA 4FK4A 2PYLA 4KPYA 1VK0A 2VWKA 3KLHA 3I0SA 1X9SA 1Q9YA 4O44A 4UQGA 1IKWA 2D0CA 1UWBA 2D0BA 4CFBA 4DF4A 4CCHA 4FJ7A 4CHYA 3I0RA 1Z25A 3OYDA 3OJSA 3I8DA 3V9ZA 3NGZA 1NK7A 4FZXC 2HVHA 4CJTA 3AVLA 4CIEA 1BHLA 2FBTA 3PO5A 1TK5A 4HCCA 4KRFA 3NF8A 2HHQA 3HPGA 1QSYA 1WSIA 3L2UA 3NF6A 2KW4A 4R5PA 1KVCA 4ZTFA 4DTRA 3LALA 1CLQA 4Z4HA 3AO1A 1RTIA 4AHCA 3O3HA 2RKIA 3DRSA 3OYHA 4FLTA 2GBZA 1QSLA 1NKBA 1HQEA 1VSKA 2IGIA 4CJEA 4CJKA 3QEIA 4FJIA 4CK3A 4DU1A 3HT3A 1C0TA 5HP1A 4M42A 3SV4A 3M8RA 1K6YA 3QIPA 3A2FA 2YNHA 2BANA 4RW9A 4DTPA 2G8VA 1BCMA 4FJGA 1VSEA 4DTOA 2OPQA 1ZBLA 3AVNA 2P5GA 1QS4A 3O3FA 4FLZA 3SPZA 1QE1A 4CFAA 4CGJA 2P1JA 3CFRA 4CF8A 3PY8A 4ELVA 3VQ4A 3QEPA 4FJ5A 1RBTA 1TVRA 1WSJA 4IFYA 2FBXA 4KFBA 4W5QA 1C1AA 4B9UA 2YKMA 2IC3A 1RT7A 3JYTA 1RNHA 4LH5A 3ZT1A 3NH1A 4FLUA 2G8UA 3V9SA 3HO1A 4OKEA 1B9DA 3K5OA 4CJLA 4DQIA 3VQ9A 3HVTA 1TKTA 4E7LA 4CF2A 3WNGA 5HRRA 1BQMA 1NK0A 2IAJA 2YNGA 1NJWA 2E6MA 4AHVA 3D0PA 2VG7A 4DFMA 2YHBA 1FKOA 4HUFA 2ETJA 3KLEA 2KFNA 5HRPA 4BDPA 2DFEA 4ELUA 3MECA 4M45A 4WE1A 4KI4A 1SKRA 1LV5A 4CF1A 2YNIA 1SL1A 1N6QA 3SV3A 4FCYA 4DTSA 3PV8A 1SKSA 2OZSA 4PUOA 3OYLA 1LWEA 1RDDA 1U49A 4KKOA 1KTQA 4CJPA 2VG6A 3QEXA 2R7YA 1RILA 4HUEA 4LD0A 3PO4A 4KHNA 3KIOA 1NOYA 1J53A 3ZSWA 4CHQA 1TKZA 3S3MA 4DWIA 3QNNA 3AO3A 4DSEA 1Z26A 4ID5A 4CGHA 5J2PA 3KD1E 2VG5A 5D3GA 3ZSRA 2X6SA 4OGCA 3CFOA 1JXEA 1TV6A 1HJRA 3ALYA 3AV9A 5C42A 4CJUA 5KRTA 3KTQA 4ZTJA 4CF0A 4F2RA 1QHTA 3SI6A 3RRGA 4ID1A 3K5LA 4O0JA 3T19A 3K59A 4FM2A 1RTHA 1S6QA 3TAEA 1U45A 3DLBA 4B9NA 4EZ9A 5FRMA 3V1OA 2XHBA 3VN5A 4FJ9A 1FXXA 5KRSA 3AVFA 2KZMA 3CQ8A 4IG3A 5K14A
chains in the Genus database with same CATH superfamily
1ASVA 4M7YA 4DV4K 2QK9A 3HPHA 2NLXA 1DEJA 4EAHD 4J2BA 4WCEL 4EIAA 4B8AB 5KI6A 3THVA 4KB1A 2GWJA 5AQJA 1KVBA 1A5WA 3ZSZA 1N8RO 2QWOA 1U6ZA 3BF1A 3QEVA 4KAZA 2V51B 3UKRA 4B9SA 2OZMA 3TAGA 1IKXA 4K0KK 3NH2A 3BZCA 1BL3A 3W0LA 4BQZA 1JCEA 1JLBA 3CCUN 2PY5A 1Q81O 3DOLA 1NKCA 2BH1A 3RSEA 3D2FA 1NOZA 1IH7A 3HL8A 2QWNA 4JLHA 4X65K 1X9WA 1NJYA 4DSJA 1HMVA 3ZT3A 1UA1A 3HK2A 1WBBA 3SCXA 3A5MC 1WB9A 2XRIA 4GVMA 1KD1O 4JKBA 1IKYA 2HNDA 2W6KA 4GMJB 2XY6A 4FZZA 5A2QO 4JYAK 3U9DA 3DJCA 2H3GX 2YCHA 4BG8A 4Y1CA 3OW2M 4JI6K 2OPPA 2HHSA 4M3XA 1NK4A 1VRUA 2FBYA 2HBJA 2QWPA 4EP5A 2UXCK 4B1YB 1VHXA 3FZHA 2NRVA 3H6EA 1N36K 3C6TA 3LZJA 3F2KA 4DR2K 3I8BA 3HJFA 3DOKA 5HROA 4K25A 5BREA 3P5JA 4N56A 2GELA 3HSTB 1NU0A 4O4GA 3SK3A 3C95A 4KHWA 4DR3K 2D0OA 4QS9A 2FF6A 2QWRA 2DPNA 5KTQA 1MWMA 2E6LA 1W9HA 4CF9A 1U47A 4FLVA 3V4IA 3VOVA 1S22A 4QS7A 5AQLA 4FLYA 1XI1A 5E26A 1JCFA 4DS4A 1GLFO 3GG4A 3EO3A 3NF9A 3DLEA 3CJ7A 4DU3A 4AHSA 3DAWA 2QA4N 1NGHA 3TTCA 3SAFA 5EVZA 1FK9A 2JWKA 4JRQA 2KTQA 5GADP 3IMXA 1KFSA 3AVAA 4B08A 5IWAK 3MWPA 4CZKA 1NG9A 4IDKA 1KFDA 5GINA 3LZIA 2OA8A 2XY5A 1L3UA 4RW8A 4DR7K 3U9ZA 1T44A 4CD3A 1X9MA 1TK8A 3FE1A 4CERA 1O1WA 3HBTA 3RWUA 3MEDA 5EX5A 5E84A 1HLUA 4X64K 4JI7K 1DLOA 5AJ3K 5DK5A 1NK5A 2FBVA 4MDBA 4CEOA 4NYNA 2YHAA 5AZJA 4CEQA 3VPZA 4N76A 1J9AA 3RR8A 3LP1A 1SS6A 4GW6A 5FPDA 4BG9A 3G10A 2ZJPL 4M41A 1HUXA 3J7ZO 3CCQN 3VF6A 4JEPA 3CQYA 4K8ZA 4OO1J 4N47A 1CZAN 4Z4IA 2LSNA 3MXIA 3TSPA 3SQ2A 4DTXA 1EX4A 4C8OA 1Q7YO 3HPOA 3E9PA 3VTIA 3ZSXA 4C8KA 4W5TA 1W0HA 2P9IA 3O9QA 3SMPA 1S1UA 1YHQN 4B1VA 2Q97A 4NCBA 3V1QA 1TAQA 1JXBA 4I9LA 4A2BA 5FDLA 4CJQA 1C0MA 4OKJA 4Z0UA 5J2MA 3RRHA 2NRWA 3VGLA 3UKUB 3VQPA 4FPAA 1E4GT 4O8UA 1WAFA 3EKSA 2AP1A 1HNZK 3RTVA 4KREA 4E7IA 3KK3A 3M8SA 3VEVA 4BGAA 4XIUA 5EXWA 1ATNA 4CEAA 3KVGA 4WQ4A 4Y0WA 3DLGA 4O55A 3AVKA 4OPHA 5BRFA 4I6MB 1BGXT 3IAYA 2YJEA 5FRNA 4JHDA 4G1QA 5AFUH 3T1AA 4DFJA 4CE9A 2RF2A 1T03A 2Z1IA 4CZIA 3ULDA 4YNQA 4Z4EA 1TUYA 2FSNA 4JD2A 1VQ7N 1RT4A 4DSFA 4J2DA 1QTMA 4KB0A 3PX6A 2P9KB 3MDQA 4BRGA 3NF7A 1A5XA 3VQCA 3O4QA 2VGNA 3FR0A 5GIOA 1CZ9A 3TPQA 4FK2A 2A41A 3L2WA 2Z1HA 3VENA 3CD6N 1G99A 5F0XA 1N34K 4QCLA 2OYQA 5M1KA 3K0SA 1CZBA 2G8FA 3ZLJA 3L2VA 3ZETA 3TAPA 3AY9A 4CHOA 3KD5E 4CEZA 3ZX2A 2HF3A 2F7TA 2O8CA 3IS9A 3FGUA 1ZBFA 3CHWA 2QEXN 2GX9A 4HVJA 3O1WA 5C12A 3SZ2A 1D8YA 4CEBA 1LW0A 3D6RA 5AQHA 4Z4GA 1TL1A 2J4RA 1YVUA 1JLQA 3GBTA 3BZKA 1YTUA 5M1QA 2OCEA 4J2AA 2WBNA 3C7NB 4XH5A 1HQUA 2F96A 3THWA 1MDUB 4E3SA 4CJ4A 1V4TA 3G6EN 3H3OB 4J8FA 4Q5VA 4LF8K 3SMSA 1RFQA 4BC2A 4DLEA 3Q7CA 1YTAA 1DTTA 1OH7A 3NHGA 1XHXA 2A6AA 2BTFA 4WFNL 1VAZA 5C15A 3WQTA 3PSFA 1IG8A 2Y1JA 4M3ZA 1Y97A 2D1KA 4ILJA 4QOZB 4FWKA 3OS1A 3AO4A 4F2SA 2QKBA 1X3NA 2RN2A 4FOEA 1B92A 4KTQA 3KLHA 1X9SA 1O13A 3CI5A 3R1XA 5LY3A 4ISGA 4DF4A 4CHYA 3OJSA 1NK7A 2HVHA 4FPBA 3AVLA 1N33K 2FBTA 3WQUA 1WSIA 1SZ2A 3NF6A 4DTRA 1BDGA 4AHCA 4Z4HA 1QSLA 3OYHA 1HQEA 1VSKA 4K43A 4CK3A 5AQSA 2V7ZA 3LDQA 3G4SN 4DTPA 3WXLA 3CFRA 4ELVA 2HF4A 3VQ4A 1C0GA 3MCAB 4B9UA 1GLBG 2YKMA 3QDKA 5BR9A 3K9JA 5AQUA 1RNHA 4LH5A 2G8UA 5AZIA 3WT0A 4CJLA 3FFKB 3HVTA 1XNQK 1Y64A 1TKTA 5AFUA 1BQMA 1NK0A 2IAJA 1JJ2M 2VG7A 3GOIA 2KFNA 5HRPA 2DFEA 3MECA 4M45A 4JKGA 1SKRA 1LV5A 1SL1A 2YNIA 3PV8A 2OZSA 1LWEA 4KKOA 1KTQA 1V4SA 3MMVA 4HUEA 4LD0A 4KHNA 3KIOA 4CHQA 4DWIA 3QNNA 4DSEA 1Z26A 4ID5A 4CGHA 4YOXA 1M90O 5J2PA 3CCEN 3KD1E 5D3GA 4QS8A 3ALYA 3MN6A 2VGMA 1QHTA 3FZMA 3RRGA 3K59A 4EZ9A 2XHBA 2ASMA 1S3XA 4FJ9A 3IDHA 3AVFA 2UUAK 3OY9A 4E7LA 2O8EA 2EX3A 4WQ5A 1DKGD 2X78A 4DFKA 2P9SB 3ID6A 1K8AO 4DQRA 1M1KO 5C24A 3AVGA 2CGJA 2UYTA 3DMJA 3VA0A 2G8KA 3JS6A 1RDBA 2D0PA 4ELTA 3TABA 4DFPA 3CMEN 5BRHA 5AQQA 3OYJA 5I42A 3C6HA 4BWJA 5GAEP 4MLHA 1TGOA 5AQTA 1IO2A 3GE1A 4KHPK 3TANA 2ATQA 1QQOA 4CHPA 1QZ6A 1S1VA 4BWMA 1QZ5A 1TUUA 3CQXA 3U3YA 1RT3A 3TSUA 4BE2A 1T05A 4RW7A 1N5YA 3JSMA 4WFAL 3HM9A 4E1MA 5BPNA 1LW2A 1JL1A 4M63C 1NGFA 4CJ3A 2E5LK 5BRDA 2FXUA 2QI2A 4BRCA 3S3NA 3WEEA 4BGBA 4DV1K 4B9MA 3TAQA 3OJUA 5JS2A 3AVJA 3RSEB 4B9LA 4OLAA 2ZGZA 1UA0A 1P8ZA 4KHYA 3L2RA 3F9KA 2D5RA 1TK0A 3H46O 3S41A 4NLCA 1VQLN 3OS2A 4CHZA 3QFUA 5C25A 5KQDA 1NMDA 1NKEA 3ZCMA 4H5WA 4BVPA 1BA1A 3MCPA 2F8TA 4LF9K 3SNNA 2UU9K 3H45C 2YHYA 4CZJA 4BQLA 2QXLA 5SWMA 3OYBA 3C65A 4IJNA 3L8BA 4JNEA 1XMQK 1Q82O 4PL8A 2O8BA 5M1PA 1ZC6A 3B6PA 3G71N 1GOAA 2F9TA 3ZSVA 4BE0A 2HNZA 3TWHA 1D5AA 4AM7A 3EN9A 5KPTA 4WYBA 4JI1K 4G9ZA 5AR0A 3LDPA 4IOCL 3LP0A 4PKGA 3TI0A 1C1BA 1OH5A 1KSPA 3CCJN 2PYJA 3N4QA 3QERA 3WNFA 1S6PA 1X3MA 1GLLO 3CPWM 4DTUA 3OYEA 5JVGL 5LL6Z 2PFUA 2B6AA 4CJ5A 4CFDA 4DSIA 1C0UA 5CYQA 2Q36A 3SJJA 3CJAA 1TL3A 4DLGA 4HCBA 5H1SQ 5LJWA 5SZTA 4CJSA 1QVGM 5IT9O 3ZT0A 3OHRA 1BI4A 1VSIA 4DV6K 3V9WA 3DI6A 3BDPA 1S9EA 4FVMA 3CPEA 3SYZA 3AO2A 3M8QA 3PIOL 3VEZA 3OYGA 1ITGA 3TTFA 1QHAA 4M3RA 5EU7A 3ISNC 3VQ8A 3HTVA 2A40A 1LAWA 1BCOA 4FZYA 1G15A 4AQYK 2GTDA 2Q31A 3Q7BA 2WOMA 3I55N 4N41A 1JLAA 4E89A 3LWLA 5AQZA 4FWSA 1OVQA 3SAHA 4YDUA 1C0FA 3L6QA 1MWKA 1XWLA 4C1NK 4AH9A 1H1VA 5T7BA 1RT6A 3K5MA 4M3YA 1VSDA 3OYFA 1EETA 3AGKA 2CH5A 2JGUA 3J81O 3DLLL 1BQNA 1XNRK 3KLGA 5AZJB 3L3UA 3WNHA 4BRNA 3ZX0A 1NK9A 2G8IA 3ZSYA 1WAJA 1CXQA 4KTWA 4GVEA 1Q9XA 4M3WA 1LCUA 5GAGP 4DV0K 3NDKA 1VQ6N 3MEEA 4CJ7A 5KQ8A 1RTDA 3NAEA 1U2VA 4W5OA 4CBXA 4YOWA 5FPEA 4KTZA 2I5JA 1RT1A 2HVIA 4IOAL 3VEYA 3UB5A 5FLXO 3O3GA 3AA4A 4B1XB 2WTUA 1LOTB 4YOUA 3VQAA 4PY5A 4FO0A 5HRNA 2FSJA 1VRTA 3IUCA 1U4BA 5I3UA 4BVOA 4FJLA 1VQNN 3MAQA 3THXA 1R59O 4FJNA 1KAYA 1EWRA 3C94A 4KHQA 2FC0A 4JKDA 4H0VB 2YJFA 4BREA 1D9FA 4PKHA 1HKCA 2O4GA 3F73A 1ILYA 3HSCA 4IFEA 2ZQBA 4RG8A 4FM1A 3CF5L 2QWLA 4DV5K 4FJKA 4YORA 3HP6A 3NMUA 1BU6O 1QQCA 2VQEK 1KLMA 3AA3A 2BDPA 2QW9A 3HVRA 4HHTA 3NGYA 1HNXK 5AQIA 2G8HA 4BDYA 3U4LA 4WQ5C 4OGEA 4C23A 3AVBA 2DFHA 3OBYA 3DXMA 4JD2B 1TKXA 3CG7A 1S9GA 1T3VA 4A61A 4DS5A 3K9KA 3H3NO 2Z1GA 1KCFA 1NKBA 4OVLA 2P9PA 2A1SA 2W40A 3LP3A 1C1CA 2XO7A 1XC3A 4E1JA 1HNVA 3PUFA 5DM6L 4JI8K 4KO0A 3MN5A 1SKWA 5JMVA 4CJWA 2GWKA 4LH4A 3QB0A 4LC9B 5DMRA 3L3VA 3ZETB 4CGIA 4YOYA 4CECA 3KK7A 3NBPA 1RT5A 3CYMA 4JKAA 4BRHA 2DTUA 1KAZA 2O8CB 3NFAA 3VF2A 1EO1A 4CZHA 4E7KA 4CJRA 4BRLA 3NGIA 1TKDA 3K5NA 1K8KA 3M6GA 4A5AA 2KHOA 2A5XA 3UIQA 1UOCA 3ULEA 4LY7A 3O9TA 3SQ0A 3OVNA 4BRQA 3P31A 1RBSA 1IBLK 1YT3A 2NUBA 4OLBA 3THWB 2RPIA 3CC4N 1SV5A 2PAVA 1MU2A 3DWLA 1NK6A 1QQNA 4RWTA 1VK0A 3I0SA 1Q9YA 3VEWA 4UQGA 4IO9L 1VQPN 1OVYA 1UWBA 3LDOA 3I8DA 3I0RA 3V9ZA 3OYDA 2P9UA 5B8HA 4BR4A 1YJNN 1BHLA 3CJBA 5GAHP 1QSYA 3L2UA 2KW4A 1KVCA 4ZTFA 3CCMN 2KKZA 1BUPA 4X62K 3J7YP 1RTIA 4FLTA 3DRSA 4YY3K 5AQKA 3F9MA 5TKWA 3VGKA 1YITN 3T1HK 4FJIA 4DU1A 3HT3A 1C0TA 2HOEA 4DV2K 3SV4A 5KPRA 3M8RA 3A2FA 2ASOA 2UXBK 2Q2RA 3T1YK 4BR0A 4FJGA 4ILHA 4C1NI 3O3FA 4FLZA 3SPZA 1QE1A 4CFAA 3QEPA 1RBTA 1TVRA 2FBXA 4W5QA 2VCPA 1RT7A 5AQOA 3JYTA 3NH1A 5JLHA 4GNIA 1Z05A 3SJHA 1B9DA 3VQ9A 3WNGA 1NGCA 2YNGA 4DFMA 2YHBA 3GL1A 1WUAA 4DQ8A 4BDPA 1N6QA 4CZLA 2RHKA 3OYLA 4B9QA 2ASPA 3QEXA 1TYQA 4PHTX 1WBDA 3A5OC 3HOTA 3QMLA 1NOYA 1J53A 1HNWK 2OTLN 2HBMA 5AZIB 3ZSRA 2X6SA 4OGCA 5C42A 4JI4K 4CJUA 3KTQA 5DM7L 4CF0A 4F2RA 4BRAA 3K5LA 4FM2A 4RCHA 1RTHA 1U45A 3TAEA 5FRMA 4JKGB 3V1OA 3CQ8A 1KC8O 4IG3A 3OA9A 2Y1IA 4BDZA 1VSHA 2B5JA 3EZWA 5ADXH 1WSHA 3CCRN 1VSLA 3LL3A 1JCGA 3P1GA 3AA5X 3S9HA 4YDUC 3L0QA 1NGGA 4V19S 1EP4A 3TAMA 4BROA 4IZ9A 1BO5O 4KBOA 2FLOA 4GKKK 3DYAA 4B8CA 4KHUA 3IFRA 2NRTA 2I7NA 4DF8A 4FJXA 3EYZA 4LFBK 3BF3A 2NRHA 5AQGA 2ZF5O 4MFBA 3VQQA 2QWMA 1YJ9N 4IDHA 2O8EB 3HZ6A 3QO9A 3CCSN 3SQ4A 3RMCA 4BRMA 2AJQA 4AF1A 1J5EK 1W2BM 4YFUA 4H5RA 2WC9A 2KQ2A 4HUGA 2E1ZA 1IKVA 4W5NA 4H4MA 4A2AA 4H0OA 1ASUA 4NXMK 1RDWX 5LJVA 3KLFA 4OX9K 3L4QA 4JI3K 5C0YA 4JKFA 4BY9C 3E01A 5FROA 3EY1A 3ENOA 2ZM6K 4ILGB 1TAUA 4B9TA 4EHTA 1I3AA 2B4JA 2KLAA 3H1VX 1LWFA 4FWPA 3OYIA 3CMAN 1ZBHA 1KXPA 3DLRA 1YUWA 4BACA 2O8DB 3FZKA 1VQMN 3M1FA 4EZ6A 3ENHA 1DGKN 4NYFA 4BRKA 1L5UA 2Q0RA 1L3TA 3TTDA 4CJVA 2ZD1A 1GOBA 3OS0A 2E4LA 3BY5A 4F8RA 4IFVA 4FW1A 3WXKA 3KK1A 1NGJA 2UUBK 2JWLA 2P9LA 3JXUA 4AM6A 4E7JA 1VSMA 1QSSA 4JRPA 2KZZA 4DMNA 2YNFA 3WEEB 4H4OA 2P9KA 4MQ3A 2E2OA 3HP9A 3M8PA 4CHNA 4A59A 4B3MK 1LAVA 3EL2A 1HJOA 2V52B 3QBWA 2P51A 4DTMA 1P90A 3IG1A 1K73O 1Q8IA 5E41A 1ESVA 4IO8A 1BIUA 5CZ2A 1CXUA 3LP2A 3BGRA 1DTQA 5CY4A 3E1YA 3T3FA 2VYPA 2O8BB 4H03B 5BN9A 5JICA 4BRDA 4B1ZA 4DTNA 3DXKA 4Y1DA 4Z4FA 4AHRA 4ICLA 3QLHA 3LDSA 4DTJA 4DV3K 5AQPA 3QETA 3EEQA 4MLEA 3NVKA 3SPYA 3AARA 3ITHA 2BGGA 2NRRA 1KVAA 1HKBA 2A42A 4MO4A 4IWVA 3AVMA 5F2RA 1NJXA 3QICA 5KPZA 3V6DA 1L3VA 5ADXA 3THYA 5CYMA 3R9PA 3DLKA 4H8KA 4FXDA 1LWCA 4B1UB 3O4NA 3V9XA 1BI4B 1NNEA 1ZYQA 2NZTA 3IKMA 3O08A 3WXMB 4CGDA 1KAXA 3TAFA 4JS4A 3MEGA 3OYKA 5J1EA 4MO5A 1OH6A 1F21A 3HRGA 1JLGA 4U67L 1J54A 2HNYA 1GLJO 1RDUA 3LDLA 1GLDG 2IS3A 4BRIA 4JI0K 3AA2A 4FWRA 3VESA 5CR4A 4H0PA 3UKRB 3OBWA 4JKEA 4RW6A 3CM6A 2O8FA 4B3OA 4ISFA 4DQQA 4QAGA 2D4WA 1JLCA 4WQ4C 3D2FB 1BISA 2HHQA 4Z4CA 2QXFA 1WNSA 2QWQA 3ZT4A 4FOIA 1OKJA 1SUQA 5LMNK 3LANA 3SUQA 4C8NA 3O9SA 3V1RA 4EP4A 1T7PA 3RR7A 2E2PA 5KGWA 4CEEA 3TR8A 4KV8A 3AVHA 2YI1A 1Q86O 4F3OA 3B6OA 1RDCA 1HX1A 3PSIA 3ENBA 3G25A 2IVPA 4H0TB 2UUCK 3P83D 3LAMA 3OYMA 1U2VB 2E20A 2HHVA 3C0BA 4LSLA 4F4KA 3MX2A 1ZBIA 4DG1A 4DR1K 1IG9A 4YOVA 3QINA 4HTUA 4FM0A 5HLFA 3A5NC 4A57A 2YHWA 3VEXA 4C8MA 4DUYK 1X9JA 4FK0A 1XQSC 2OPSA 4CEDA 4DHYA 5AQMA 1HPZA 3SUPA 4H5VA 4I7FA 4NCAA 3THXB 3DLHA 4AHUA 3ATVA 2BE2A 3O9UA 4JS5A 1YVNA 4K8XA 5M1FA 5M1OA 1WSFA 1FJGK 2HHXA 4GV9A 1NGAA 1Z6RA 4DCHA 4KH5A 5J2NA 4M3TA 2DY4A 4A5BA 3IRXA 3KLIA 4FW2A 3OYAA 2YX6A 4BC5A 1VQON 4KI6A 4CEFA 5HOOA 5F1XA 1GLCG 2E2NA 2HHUA 4H0YB 1GLAG 1BIZA 2WONA 4K42A 5ELZA 2F4VK 3LM9A 5J2QA 4CGFA 4B1WB 1NK8A 2F8SA 4JKCA 3DXMB 3U3GA 2Q0UA 1NGDA 2P9NA 5I9EB 1J5OA 3NCIA 2YKNA 3SLCA 1W97L 5EOYA 3FZFA 4FYDA 2NNWA 3HYFA 3QEWA 4BE1A 2P5OA 3FFIA 2ZJQL 2P9PB 3KWIA 3NH0A 2GEMA 1SL2A 4CD1A 4XH1A 3D2EA 3W3DA 1L3SA 3BUZB 3VA3A 1GLEG 4CZFA 4B3TK 4NCGA 4RW4A 3WNEA 5HL7L 3O8MA 4BR5A 2A3ZA 3D45A 3O6WA 2BUPA 3CJ9A 3WUHA 1S5JA 4KPYA 4JAXA 3TU5A 4O44A 1YI2N 2D0CA 4CVNE 1NGIA 2D0BA 2WFBA 4CCHA 1K8KB 5FPMA 4FJ7A 1Z25A 1YF5L 3NGZA 3C6AA 3ULEB 4KRFA 1TK5A 4HCCA 3NF8A 3HPGA 3QFPA 4R5PA 3E9LA 1VQ9N 3KHYA 4IOXA 3AO1A 4DR4K 3A0IX 2IGIA 4CJKA 2P9IB 4X66K 4O5FA 4PL7A 5HP1A 4GKJK 2CGKA 3UE5A 1K6YA 3QIPA 4RW9A 2G8VA 4KH4A 1BCMA 1VSEA 5C10A 4LFAK 1HR0K 2P9UB 3MWTA 1WSJA 4KFBA 2IC3A 4PKIA 3FLCO 3ZT1A 4BR9A 4FLUA 1FW6A 3O9RA 4OKEA 3K5OA 4DQIA 3CCVN 3M3ZA 2V7YA 3J7AP 4CF2A 1ZXOA 3HI0A 2E6MA 4AHVA 1FKOA 1RGIA 4HUFA 2ETJA 3KLEA 4WE1A 3ZEUA 3EE8A 4EHUA 4DR5K 3AAQA 4JHDB 4DKWA 1SKSA 5CHIA 4CJPA 1RILA 3PO4A 3ZSWA 2HBKA 4FWLA 3S3MA 3PIPL 4IEEA 4BC3A 4U7BA 1JXEA 5KRTA 3AV9A 4FWNA 5C2FA 4ZTJA 3SI6A 4ID1A 2NRXA 3VN5A 1Q18A 5KRSA 3NVMA 4DSKA 1BWFO 4OPKA 1TYQB 1GOCA 4ZHRA 4I2QA 4CJFA 3VEOA 4FJMA 4CZMA 3NE6A 2GUPA 1HYZA 1JLFA 3CJCA 2ZWHA 3R3LA 1RBRA 2ZJRL 3WXIA 4N5SA 1HNIA 4FWQA 1N32K 2WUSA 3PX4A 3AVIA 2X6NA 3PLAA 4H0XB 1JL2A 3OTOK 1W7AA 3T69A 1KRPA 1S72N 3EE9A 4CBUA 3ATUA 3B8AX 3RMAA 1S1TA 4B3SK 3CERA 5BN8A 3LPUA 4FJJA 1XUPO 1T6CA 4AILC 3P39A 1HRHA 2EWSA 4XH4A 4OKKA 1ZBUA 4IKFA 3KWGA 4DQSA 2Q3SA 3KKSA 3S3OA 3H1QA 4NLBA 3O1BA 1HPMA 4F9OA 1YJWN 3HOSA 3AVCA 2UXDK 2PBDA 2YV0X 4FWOA 3VERA 3K57A 4UY8O 4CZEA 4M3UA 4PWDA 3O5BA 4DUZK 1K9MO 4DV7K 1JLEA 4M7XA 4O8KA 3TSQA 3VGMA 1ASWA 4E0DA 4M42A 3QIOA 4PA1A 4E19A 1WN7A 3E66A 3RVCA 1BOTO 5JVHL 4JK9A 2QTDA 1NLVA 1YAGA 3CIPA 4DU4A 1KLNA 2HHTA 4YOTA 4KH6A 1D4XA 3T7ZA 1J6ZA 3C6UA 2GUIA 4PQUA 1UAXA 5JS1A 3A5LC 4FSVA 2I7PA 1FKPA 2P9LB 3AAPA 4CIGA 1WSEA 3CC7N 3ID8A 3BEXA 3ZSOA 2ITGA 4CI6A 1NBWA 2IVNA 4FWMA 3EZ5A 2ZGYA 2EHGA 2FF3B 3SUNA 3VMFB 4O0IA 4A62A 3E9OA 3RMBA 3JAMO 1VQ8N 1VSJA 1D9DA 1VSFA 4FVUA 1RDAA 3VF4A 3QNOA 4NO7A 1NJZA 2CH6A 5CZ1A 1OH8A 2HHHK 4MDAA 4W5RA 5AQVA 1RT2A 4IXCA 3LWMA 1SL0A 3ZT2A 2IOCA 3M5RA 1KQSM 5AQYA 1EXQA 4GV3A 1NMNA 3VQ6A 3FZLA 4TSXA 1IV0A 1VQ4N 3DXKB 3V81A 4LF7K 5CE3A 3R6MA 1I39A 3SQ1A 4K41A 2RE2A 3QESA 1XC9A 2E2QA 1RTJA 3VQ7A 3DRPA 2E8AA 2W42A 4DQPA 3RMDA 1RBUA 4CGGA 2Q1NA 4GY2B 2ZE2A 1REVA 3K58A 1NGBA 5AQXA 4LFCK 4DSLA 3HXMA 4JN4A 2QKKA 1ZBSA 1DT9A 2DFFA 1X1PA 3ASMA 5KGXA 3THYB 3F5TA 3LAKA 3UKUA 1YIJN 1NJIO 3D7EO 4FJHA 2OPRA 5TKYA 3OYCA 3DRRA 3QBXA 3LPTA 4OJRA 4JI2K 4B9VA 1XHZA 3I33A 4C8LA 1SQKA 3H08A 4RTFD 3LDNA 4I2PA 4IG0A 5JLFA 4L8RB 3CM5A 3SAGA 1IBKK 4I6MA 4E7HA 4BRFA 4GV6A 3ZX3A 3G0ZA 1U48A 4DB3A 3U6FA 3P38A 4H5TA 4JI5K 2O8FB 4LSNA 2HB5A 1S1WA 1I94K 4J2EA 2X74A 4CFCA 3KK2A 1A5VA 3PX0A 4CIFA 2A1RA 2YHXA 2HMIA 4LF6K 1E4FT 4NXNK 3P4IA 1S1XA 2XY7A 1EQYA 3ZYYX 2G8WA 4B3RK 5AQNA 3DM2A 3VETA 3J8AA 4R79A 4F3TA 4OPJA 2F9WA 1R0AA 3MXMA 3VQBA 1MA9B 4WF9L 4Z94A 5C2DA 2PZSA 2IDOA 4CBWA 2HW3A 4FL9A 1NM1A 3KJVA 1B9FA 3AO5A 4IBNA 5AQFA 5HBMA 4BR7A 4I9QA 1WOQA 4H5NA 4JK8A 4ISEA 4FLWA 2Z1JA 1E3MA 4E1NA 3L2QA 3C7NA 4CK2A 3EKUA 1WSGA 1RBVA 2HHWA 5M1NA 4LF5K 1U04A 5BR8K 4HWIA 5LMUK 1WLJA 4OPAA 4CZGA 1C6VA 4CK1A 3KKRA 2XY8A 3O4WA 1RCHA 4L3QA 4YHHK 1NWKA 3MXJA 1EKEA 1IJJA 4JK7A 1NGEA 3OYNA 3SUOA 3CFPA 2CGLA 3VQEA 3VTHA 2OANA 2D0AA 3GDQA 4KHSA 4JV5K 2HMPA 4AHTA 3ZSQA 1QVFM 3CXCM 2KFZA 1HKGA 2E1YA 4BRPA 3BP8A 4BR2A 5HRSA 2VWJA 4LF4K 3TARA 1HYSA 3LM2A 1JKHA 3VQ5A 3K2PA 3VQDA 4CESA 1IBMK 3SBTA 2O4IA 2VWBA 2GV9A 3MN7A 1ATSA 1BG3A 4FLXA 4Q0BA 2JLEA 4O5BA 5BPMA 4BC4A 2P9NB 1T8EA 4FJ8A 2O8DA 1HYVA 4FK4A 3V9UA 2HBLA 2PYLA 2VWKA 3J80O 1IKWA 4HTLA 2AA4A 4CFBA 4EFHA 2IVOA 3CJ1A 2ITMA 4FZXC 1QQMA 4CJTA 5EY4A 4CIEA 1SAZA 2NRZA 3PO5A 3A8YA 3D2EB 2E88A 1XMOK 1VQKN 3LALA 1CLQA 3O3HA 1YXQA 2RKIA 3HM8A 2GBZA 3CC2N 3CCLN 2VQFK 2W41A 2OTJN 4CJEA 1EWQA 3QEIA 1BA0A 2YNHA 2BANA 4DTOA 2OPQA 1ZBLA 3AVNA 2P5GA 1QS4A 4CGJA 2P1JA 3U8XA 4CF8A 5GIPA 3PY8A 4FJ5A 4DR6K 4IFYA 1C1AA 3L4IA 3HO1A 3V9SA 3SBGA 3AGRA 1T6DA 5HRRA 3I56N 1NJWA 3R8EA 3D0PA 5AQWA 4IJAA 1VQ5N 4ELUA 4KI4A 2W6LA 4CF1A 3N4PA 4NB4A 3SV3A 4FCYA 4DTSA 4PUOA 5BPLA 1RDDA 3CETA 1U49A 5MLCQ 2VG6A 4XEIA 2HSTA 2R7YA 3MK6A 3MX5A 2P9SA 1TKZA 3AO3A 2VG5A 2IIRA 3O80A 3CFOA 1TV6A 5AQRA 1HJRA 3MN9A 3KZBA 4IEIA 5FPNA 2FSKA 2QM1A 4WFBL 4O0JA 3T19A 1S6QA 3DLBA 4B9NA 3ZEUB 1FXXA 3WXJA 2KZMA 4CW7B 1ATRA 4JKHA 5K14A
chains in the Genus database with same CATH topology
2Y1IA 2EX3A 4BDZA 1ASVA 4DSKA 1VSHA 2B5JA 2QK9A 1WSHA 2X78A 3HPHA 4OPKA 4DFKA 1VSLA 1GOCA 4ZHRA 4I2QA 4J2BA 4CJFA 3P1GA 3AA5X 4B8AB 3S9HA 5KI6A 4FJMA 4DQRA 3THVA 3NE6A 4KB1A 5C24A 3AVGA 1HYZA 1JLFA 1EP4A 3DMJA 3VA0A 1KVBA 1A5WA 3TAMA 1RDBA 3ZSZA 4ELTA 3TABA 4DFPA 3DYAA 4B8CA 4KHUA 1RBRA 3QEVA 3OYJA 4KAZA 5I42A 4N5SA 4DF8A 1HNIA 3EYZA 4FJXA 4BWJA 1TGOA 4B9SA 3PX4A 3AVIA 2OZMA 4MFBA 3TAGA 1IKXA 3VQQA 2X6NA 1IO2A 1JL2A 1KRPA 3NH2A 1BL3A 3TANA 3QO9A 2ATQA 3RMAA 4CHPA 1S1TA 3SQ4A 1JLBA 3RMCA 2PY5A 2AJQA 1S1VA 3DOLA 4BWMA 1NKCA 4YFUA 1NOZA 3U3YA 3LPUA 4FJJA 2KQ2A 4HUGA 1IKVA 1IH7A 4W5NA 1RT3A 3HL8A 4H4MA 1ASUA 3KLFA 4AILC 4JLHA 4BE2A 1X9WA 4RW7A 1T05A 1HRHA 1NJYA 4DSJA 1HMVA 3ZT3A 1N5YA 1UA1A 3HK2A 3JSMA 4OKKA 3HM9A 3E01A 4E1MA 3SCXA 1ZBUA 4IKFA 5FROA 3EY1A 1LW2A 2XRIA 1JL1A 4DQSA 2Q3SA 4GVMA 3KKSA 1TAUA 3S3OA 4B9TA 4CJ3A 1I3AA 1IKYA 2B4JA 2HNDA 4GMJB 3S3NA 2XY6A 4FZZA 4B9MA 3TAQA 3AVCA 1LWFA 3OYIA 3OJUA 5JS2A 3AVJA 4B9LA 4OLAA 2YV0X 1ZBHA 3DLRA 3K57A 4BACA 1UA0A 4KHYA 3L2RA 4Y1CA 3F9KA 2D5RA 1TK0A 4M3UA 4PWDA 2OPPA 4EZ6A 4NYFA 3OS2A 4CHZA 1L5UA 1D8YA 2HHSA 1L3TA 4CJVA 4M3XA 1JLEA 5C25A 2ZD1A 1GOBA 3OS0A 1NK4A 2E4LA 1VRUA 2FBYA 4IFVA 4FW1A 1NKEA 2G8KA 4F8RA 3KK1A 1ASWA 3ZCMA 4EP5A 4E0DA 4E7JA 1VSMA 1QSSA 3QIOA 4PA1A 4DMNA 4E19A 2YNFA 4JRPA 1WN7A 3SNNA 2KZZA 4H4OA 3C6TA 5SWMA 4MQ3A 3LZJA 3OYBA 3HJFA 3DOKA 3HP9A 3M8PA 4CHNA 5HROA 3L8BA 1LAVA 3P5JA 4N56A 3HSTB 4DU4A 4O4GA 1KLNA 3B6PA 2HHTA 1GOAA 2P51A 3C95A 4DTMA 4KHWA 3ZSVA 4BE0A 2HNZA 3TWHA 3C6UA 1D5AA 3IG1A 2GUIA 5KTQA 4PQUA 1UAXA 2E6LA 5JS1A 1Q8IA 1W9HA 4CF9A 5E41A 1BIUA 1U47A 4FLVA 1FKPA 3V4IA 5CZ2A 3LP0A 1CXUA 1C1BA 3TI0A 1KSPA 4FLYA 2PYJA 4CIGA 3QERA 3WNFA 1S6PA 1XI1A 3LP2A 1WSEA 3BGRA 3ZSOA 4DS4A 1DTQA 2F8TA 5CY4A 2ITGA 4DTUA 3NF9A 3DLEA 3OYEA 4DU3A 4AHSA 3T3FA 3EZ5A 2B6AA 4CJ5A 4CFDA 4DSIA 2EHGA 3SUNA 1C0UA 1FK9A 5CYQA 4O0IA 4JRQA 4DTNA 2KTQA 3SJJA 1TL3A 4DLGA 4Y1DA 3RMBA 4HCBA 1VSJA 1D9DA 1VSFA 1KFSA 4Z4FA 1RDAA 3AVAA 4AHRA 4ICLA 4B08A 5SZTA 3QLHA 4CJSA 3LDSA 3QNOA 4DTJA 4IDKA 1KFDA 3ZT0A 1NJZA 3QETA 1BI4A 1VSIA 3LZIA 3V9WA 2XY5A 2OA8A 5CZ1A 1L3UA 3DI6A 4RW8A 3BDPA 4W5RA 3SPYA 1X9MA 1S9EA 3ITHA 1TK8A 1RT2A 4CERA 3LWMA 2BGGA 1SL0A 1KVAA 3ZT2A 2IOCA 1O1WA 4FVMA 1EXQA 3AVMA 3SYZA 3RWUA 3MEDA 3VQ6A 3AO2A 3M8QA 1NJXA 3V6DA 1L3VA 3OYGA 4TSXA 1ITGA 1DLOA 3V81A 4M3RA 5DK5A 5EU7A 3ISNC 5CYMA 3VQ8A 3DLKA 1I39A 1NK5A 2FBVA 3SQ1A 4H8KA 3QESA 1XC9A 4FXDA 1LAWA 4CEOA 1RTJA 2YHAA 1LWCA 4NYNA 3O4NA 1BCOA 3V9XA 4CEQA 4N76A 4FZYA 1BI4B 1J9AA 1G15A 3RR8A 1ZYQA 3LP1A 4GW6A 4CGDA 3TAFA 2WOMA 3G10A 3VQ7A 3DRPA 4JS4A 4N41A 1JLAA 4M41A 3MEGA 4E89A 3OY9A 3OYKA 3LWLA 2W42A 3RMDA 4DQPA 5J1EA 1F21A 1RBUA 1JLGA 1XWLA 1J54A 4CGGA 2HNYA 2ZE2A 1REVA 3K58A 4K8ZA 4N47A 4Z4IA 4DSLA 4AH9A 2IS3A 2LSNA 5T7BA 3HXMA 3MXIA 1RT6A 3K5MA 4M3YA 1VSDA 3AA2A 3SQ2A 3OYFA 2QKKA 2DFFA 1X1PA 1EETA 3ASMA 1EX4A 5KGXA 4DTXA 4C8OA 2JGUA 3LAKA 1BQNA 3HPOA 4FJHA 3KLGA 3L3UA 4RW6A 3WNHA 3CM6A 3ZSXA 1NK9A 2G8IA 2OPRA 1WAJA 3ZSYA 1CXQA 4KTWA 4W5TA 4C8KA 4DQQA 1W0HA 3OYCA 3DRRA 3LPTA 4OJRA 1S1UA 4QAGA 4B9VA 1Q9XA 1JLCA 4M3WA 1XHZA 4NCBA 3V1QA 4C8LA 1TAQA 3H08A 4L8RB 4I2PA 1BISA 1JXBA 3MEEA 4IG0A 3CM5A 2QXFA 4I9LA 4Z4CA 1WNSA 3NDKA 1RTDA 4E7HA 3NAEA 3ZT4A 1SUQA 4W5OA 3G0ZA 3LANA 4KTZA 2I5JA 1RT1A 5FDLA 2HVIA 3SUQA 1U48A 4CJQA 1C0MA 4OKJA 4Z0UA 4C8NA 3V1RA 4EP4A 3O3GA 3RRHA 5J2MA 3U6FA 1T7PA 3RR7A 3VQPA 1WAFA 3AA4A 5KGWA 4CEEA 3TR8A 4KV8A 3AVHA 3RTVA 4KREA 4LSNA 3VQAA 4PY5A 2HB5A 5HRNA 4E7IA 3KK3A 1S1WA 3M8SA 4F3OA 3B6OA 1RDCA 4J2EA 2X74A 4CFCA 4XIUA 3KK2A 1VRTA 1A5VA 4CEAA 3PX0A 4CIFA 2A1RA 2HMIA 1U4BA 3DLGA 4O55A 3AVKA 5I3UA 4FJLA 3P83D 1BGXT 3LAMA 3OYMA 3MAQA 3IAYA 1S1XA 2XY7A 4FJNA 2G8WA 3C94A 4KHQA 5FRNA 3DM2A 2HHVA 2FC0A 4B3OA 4G1QA 4LSLA 3T1AA 4DFJA 4F4KA 4CE9A 4F3TA 2RF2A 1ZBIA 1T03A 2Z1IA 4DG1A 3ULDA 4OPJA 1IG9A 4YNQA 4Z4EA 3QINA 4HTUA 4FM0A 1R0AA 3MXMA 5HLFA 3VQBA 1RT4A 1D9FA 2O4GA 3F73A 4DSFA 2ZQBA 4RG8A 1QTMA 4C8MA 4J2DA 4FK0A 4KB0A 2OPSA 3PX6A 4CEDA 4FM1A 4FJKA 3HP6A 1HPZA 3NF7A 1A5XA 3VQCA 1QQCA 3O4QA 1KLMA 3SUPA 2PZSA 2IDOA 1CZ9A 3AA3A 2BDPA 2HW3A 4I7FA 4NCAA 3KJVA 3DLHA 4AHUA 4FK2A 1B9FA 3AO5A 2BE2A 4IBNA 5HBMA 2Z1HA 3L2WA 3HVRA 4I9QA 4HHTA 3NGYA 2G8HA 4QCLA 4JS5A 4FLWA 4BDYA 2Z1JA 2OYQA 4K8XA 4OGEA 1WSFA 4E1NA 3L2QA 3AVBA 1CZBA 2DFHA 2G8FA 2HHXA 4CK2A 3L2VA 1WSGA 1RBVA 3TAPA 2HHWA 4CHOA 3KD5E 1TKXA 1U04A 4CEZA 3CG7A 1S9GA 5J2NA 3IS9A 1ZBFA 1WLJA 4M3TA 4DS5A 2DY4A 1C6VA 3IRXA 3KKRA 2XY8A 1KCFA 2Z1GA 3KLIA 4CK1A 1RCHA 4FW2A 4HVJA 4OVLA 3OYAA 3SZ2A 2A1SA 4CEBA 1LW0A 3LP3A 1C1CA 2XO7A 4KI6A 3MXJA 4CEFA 1EKEA 3OYNA 3SUOA 4Z4GA 3CFPA 2HHUA 1HNVA 1TL1A 3PUFA 3VQEA 1YVUA 2WONA 1BIZA 1JLQA 4KO0A 1SKWA 5J2QA 1YTUA 4J2AA 2D0AA 4CGFA 4CJWA 1NK8A 2F8SA 4KHSA 3U3GA 4LH4A 1HQUA 2F96A 5DMRA 3L3VA 4CGIA 4E3SA 1J5OA 4AHTA 4CECA 2YKNA 3ZSQA 4CJ4A 3NCIA 3NBPA 2KFZA 1RT5A 4Q5VA 3CYMA 2DTUA 4FYDA 3NFAA 3HYFA 4DLEA 4BE1A 3QEWA 1YTAA 1DTTA 4E7KA 3FFIA 2P5OA 4CJRA 3NHGA 1XHXA 5HRSA 3NGIA 2VWJA 1TKDA 3TARA 3K5NA 1HYSA 3UIQA 3NH0A 1JKHA 1UOCA 1SL2A 3VQ5A 3K2PA 4LY7A 3VQDA 4CESA 3SQ0A 3OVNA 2O4IA 1L3SA 2Y1JA 2GV9A 1RBSA 1Y97A 4FLXA 3VA3A 4M3ZA 4Q0BA 4NCGA 4RW4A 2JLEA 1YT3A 4O5BA 2NUBA 3WNEA 4QOZB 4OLBA 2RPIA 3OS1A 1T8EA 3AO4A 3D45A 1SV5A 4F2SA 4FJ8A 1MU2A 2QKBA 2RN2A 1B92A 1S5JA 1HYVA 1NK6A 3V9UA 4KTQA 4FK4A 2PYLA 4KPYA 1VK0A 2VWKA 3KLHA 3I0SA 1X9SA 1Q9YA 4O44A 4UQGA 1IKWA 2D0CA 1UWBA 2D0BA 4CFBA 4DF4A 4CCHA 4FJ7A 4CHYA 3I0RA 1Z25A 3OYDA 3OJSA 3I8DA 3V9ZA 3NGZA 1NK7A 4FZXC 2HVHA 4CJTA 3AVLA 4CIEA 1BHLA 2FBTA 3PO5A 1TK5A 4HCCA 4KRFA 3NF8A 2HHQA 3HPGA 1QSYA 1WSIA 3L2UA 3NF6A 2KW4A 4R5PA 1KVCA 4ZTFA 4DTRA 3LALA 1CLQA 4Z4HA 3AO1A 1RTIA 4AHCA 3O3HA 2RKIA 3DRSA 3OYHA 4FLTA 2GBZA 1QSLA 1NKBA 1HQEA 1VSKA 2IGIA 4CJEA 4CJKA 3QEIA 4FJIA 4CK3A 4DU1A 3HT3A 1C0TA 5HP1A 4M42A 3SV4A 3M8RA 1K6YA 3QIPA 3A2FA 2YNHA 2BANA 4RW9A 4DTPA 2G8VA 1BCMA 4FJGA 1VSEA 4DTOA 2OPQA 1ZBLA 3AVNA 2P5GA 1QS4A 3O3FA 4FLZA 3SPZA 1QE1A 4CFAA 4CGJA 2P1JA 3CFRA 4CF8A 3PY8A 4ELVA 3VQ4A 3QEPA 4FJ5A 1RBTA 1TVRA 1WSJA 4IFYA 2FBXA 4KFBA 4W5QA 1C1AA 4B9UA 2YKMA 2IC3A 1RT7A 3JYTA 1RNHA 4LH5A 3ZT1A 3NH1A 4FLUA 2G8UA 3V9SA 3HO1A 4OKEA 1B9DA 3K5OA 4CJLA 4DQIA 3VQ9A 3HVTA 1TKTA 4E7LA 4CF2A 3WNGA 5HRRA 1BQMA 1NK0A 2IAJA 2YNGA 1NJWA 2E6MA 4AHVA 3D0PA 2VG7A 4DFMA 2YHBA 1FKOA 4HUFA 2ETJA 3KLEA 2KFNA 5HRPA 4BDPA 2DFEA 4ELUA 3MECA 4M45A 4WE1A 4KI4A 1SKRA 1LV5A 4CF1A 2YNIA 1SL1A 1N6QA 3SV3A 4FCYA 4DTSA 3PV8A 1SKSA 2OZSA 4PUOA 3OYLA 1LWEA 1RDDA 1U49A 4KKOA 1KTQA 4CJPA 2VG6A 3QEXA 2R7YA 1RILA 4HUEA 4LD0A 3PO4A 4KHNA 3KIOA 1NOYA 1J53A 3ZSWA 4CHQA 1TKZA 3S3MA 4DWIA 3QNNA 3AO3A 4DSEA 1Z26A 4ID5A 4CGHA 5J2PA 3KD1E 2VG5A 5D3GA 3ZSRA 2X6SA 4OGCA 3CFOA 1JXEA 1TV6A 1HJRA 3ALYA 3AV9A 5C42A 4CJUA 5KRTA 3KTQA 4ZTJA 4CF0A 4F2RA 1QHTA 3SI6A 3RRGA 4ID1A 3K5LA 4O0JA 3T19A 3K59A 4FM2A 1RTHA 1S6QA 3TAEA 1U45A 3DLBA 4B9NA 4EZ9A 5FRMA 3V1OA 2XHBA 3VN5A 4FJ9A 1FXXA 5KRSA 3AVFA 2KZMA 3CQ8A 4IG3A 5K14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y1I A;  2EX3 A;  4BDZ A;  1ASV A;  4DSK A;  1VSH A;  2B5J A;  2QK9 A;  1WSH A;  2X78 A;  3HPH A;  4OPK A;  4DFK A;  1VSL A;  1GOC A;  4ZHR A;  4I2Q A;  4J2B A;  4CJF A;  3P1G A;  3AA5 X;  4B8A B;  3S9H A;  5KI6 A;  4FJM A;  4DQR A;  3THV A;  3NE6 A;  4KB1 A;  5C24 A;  3AVG A;  1HYZ A;  1JLF A;  1EP4 A;  3DMJ A;  3VA0 A;  1KVB A;  1A5W A;  3TAM A;  1RDB A;  3ZSZ A;  4ELT A;  3TAB A;  4DFP A;  3DYA A;  4B8C A;  4KHU A;  1RBR A;  3QEV A;  3OYJ A;  4KAZ A;  5I42 A;  4N5S A;  4DF8 A;  1HNI A;  3EYZ A;  4FJX A;  4BWJ A;  1TGO A;  4B9S A;  3PX4 A;  3AVI A;  2OZM A;  4MFB A;  3TAG A;  1IKX A;  3VQQ A;  2X6N A;  1IO2 A;  1JL2 A;  1KRP A;  3NH2 A;  1BL3 A;  3TAN A;  3QO9 A;  2ATQ A;  3RMA A;  4CHP A;  1S1T A;  3SQ4 A;  1JLB A;  3RMC A;  2PY5 A;  2AJQ A;  1S1V A;  3DOL A;  4BWM A;  1NKC A;  4YFU A;  1NOZ A;  3U3Y A;  3LPU A;  4FJJ A;  2KQ2 A;  4HUG A;  1IKV A;  1IH7 A;  4W5N A;  1RT3 A;  3HL8 A;  4H4M A;  1ASU A;  3KLF A;  4AIL C;  4JLH A;  4BE2 A;  1X9W A;  4RW7 A;  1T05 A;  1HRH A;  1NJY A;  4DSJ A;  1HMV A;  3ZT3 A;  1N5Y A;  1UA1 A;  3HK2 A;  3JSM A;  4OKK A;  3HM9 A;  3E01 A;  4E1M A;  3SCX A;  1ZBU A;  4IKF A;  5FRO A;  3EY1 A;  1LW2 A;  2XRI A;  1JL1 A;  4DQS A;  2Q3S A;  4GVM A;  3KKS A;  1TAU A;  3S3O A;  4B9T A;  4CJ3 A;  1I3A A;  1IKY A;  2B4J A;  2HND A;  4GMJ B;  3S3N A;  2XY6 A;  4FZZ A;  4B9M A;  3TAQ A;  3AVC A;  1LWF A;  3OYI A;  3OJU A;  5JS2 A;  3AVJ A;  4B9L A;  4OLA A;  2YV0 X;  1ZBH A;  3DLR A;  3K57 A;  4BAC A;  1UA0 A;  4KHY A;  3L2R A;  4Y1C A;  3F9K A;  2D5R A;  1TK0 A;  4M3U A;  4PWD A;  2OPP A;  4EZ6 A;  4NYF A;  3OS2 A;  4CHZ A;  1L5U A;  1D8Y A;  2HHS A;  1L3T A;  4CJV A;  4M3X A;  1JLE A;  5C25 A;  2ZD1 A;  1GOB A;  3OS0 A;  1NK4 A;  2E4L A;  1VRU A;  2FBY A;  4IFV A;  4FW1 A;  1NKE A;  2G8K A;  4F8R A;  3KK1 A;  1ASW A;  3ZCM A;  4EP5 A;  4E0D A;  4E7J A;  1VSM A;  1QSS A;  3QIO A;  4PA1 A;  4DMN A;  4E19 A;  2YNF A;  4JRP A;  1WN7 A;  3SNN A;  2KZZ A;  4H4O A;  3C6T A;  5SWM A;  4MQ3 A;  3LZJ A;  3OYB A;  3HJF A;  3DOK A;  3HP9 A;  3M8P A;  4CHN A;  5HRO A;  3L8B A;  1LAV A;  3P5J A;  4N56 A;  3HST B;  4DU4 A;  4O4G A;  1KLN A;  3B6P A;  2HHT A;  1GOA A;  2P51 A;  3C95 A;  4DTM A;  4KHW A;  3ZSV A;  4BE0 A;  2HNZ A;  3TWH A;  3C6U A;  1D5A A;  3IG1 A;  2GUI A;  5KTQ A;  4PQU A;  1UAX A;  2E6L A;  5JS1 A;  1Q8I A;  1W9H A;  4CF9 A;  5E41 A;  1BIU A;  1U47 A;  4FLV A;  1FKP A;  3V4I A;  5CZ2 A;  3LP0 A;  1CXU A;  1C1B A;  3TI0 A;  1KSP A;  4FLY A;  2PYJ A;  4CIG A;  3QER A;  3WNF A;  1S6P A;  1XI1 A;  3LP2 A;  1WSE A;  3BGR A;  3ZSO A;  4DS4 A;  1DTQ A;  2F8T A;  5CY4 A;  2ITG A;  4DTU A;  3NF9 A;  3DLE A;  3OYE A;  4DU3 A;  4AHS A;  3T3F A;  3EZ5 A;  2B6A A;  4CJ5 A;  4CFD A;  4DSI A;  2EHG A;  3SUN A;  1C0U A;  1FK9 A;  5CYQ A;  4O0I A;  4JRQ A;  4DTN A;  2KTQ A;  3SJJ A;  1TL3 A;  4DLG A;  4Y1D A;  3RMB A;  4HCB A;  1VSJ A;  1D9D A;  1VSF A;  1KFS A;  4Z4F A;  1RDA A;  3AVA A;  4AHR A;  4ICL A;  4B08 A;  5SZT A;  3QLH A;  4CJS A;  3LDS A;  3QNO A;  4DTJ A;  4IDK A;  1KFD A;  3ZT0 A;  1NJZ A;  3QET A;  1BI4 A;  1VSI A;  3LZI A;  3V9W A;  2XY5 A;  2OA8 A;  5CZ1 A;  1L3U A;  3DI6 A;  4RW8 A;  3BDP A;  4W5R A;  3SPY A;  1X9M A;  1S9E A;  3ITH A;  1TK8 A;  1RT2 A;  4CER A;  3LWM A;  2BGG A;  1SL0 A;  1KVA A;  3ZT2 A;  2IOC A;  1O1W A;  4FVM A;  1EXQ A;  3AVM A;  3SYZ A;  3RWU A;  3MED A;  3VQ6 A;  3AO2 A;  3M8Q A;  1NJX A;  3V6D A;  1L3V A;  3OYG A;  4TSX A;  1ITG A;  1DLO A;  3V81 A;  4M3R A;  5DK5 A;  5EU7 A;  3ISN C;  5CYM A;  3VQ8 A;  3DLK A;  1I39 A;  1NK5 A;  2FBV A;  3SQ1 A;  4H8K A;  3QES A;  1XC9 A;  4FXD A;  1LAW A;  4CEO A;  1RTJ A;  2YHA A;  1LWC A;  4NYN A;  3O4N A;  1BCO A;  3V9X A;  4CEQ A;  4N76 A;  4FZY A;  1BI4 B;  1J9A A;  1G15 A;  3RR8 A;  1ZYQ A;  3LP1 A;  4GW6 A;  4CGD A;  3TAF A;  2WOM A;  3G10 A;  3VQ7 A;  3DRP A;  4JS4 A;  4N41 A;  1JLA A;  4M41 A;  3MEG A;  4E89 A;  3OY9 A;  3OYK A;  3LWL A;  2W42 A;  3RMD A;  4DQP A;  5J1E A;  1F21 A;  1RBU A;  1JLG A;  1XWL A;  1J54 A;  4CGG A;  2HNY A;  2ZE2 A;  1REV A;  3K58 A;  4K8Z A;  4N47 A;  4Z4I A;  4DSL A;  4AH9 A;  2IS3 A;  2LSN A;  5T7B A;  3HXM A;  3MXI A;  1RT6 A;  3K5M A;  4M3Y A;  1VSD A;  3AA2 A;  3SQ2 A;  3OYF A;  2QKK A;  2DFF A;  1X1P A;  1EET A;  3ASM A;  1EX4 A;  5KGX A;  4DTX A;  4C8O A;  2JGU A;  3LAK A;  1BQN A;  3HPO A;  4FJH A;  3KLG A;  3L3U A;  4RW6 A;  3WNH A;  3CM6 A;  3ZSX A;  1NK9 A;  2G8I A;  2OPR A;  1WAJ A;  3ZSY A;  1CXQ A;  4KTW A;  4W5T A;  4C8K A;  4DQQ A;  1W0H A;  3OYC A;  3DRR A;  3LPT A;  4OJR A;  1S1U A;  4QAG A;  4B9V A;  1Q9X A;  1JLC A;  4M3W A;  1XHZ A;  4NCB A;  3V1Q A;  4C8L A;  1TAQ A;  3H08 A;  4L8R B;  4I2P A;  1BIS A;  1JXB A;  3MEE A;  4IG0 A;  3CM5 A;  2QXF A;  4I9L A;  4Z4C A;  1WNS A;  3NDK A;  1RTD A;  4E7H A;  3NAE A;  3ZT4 A;  1SUQ A;  4W5O A;  3G0Z A;  3LAN A;  4KTZ A;  2I5J A;  1RT1 A;  5FDL A;  2HVI A;  3SUQ A;  1U48 A;  4CJQ A;  1C0M A;  4OKJ A;  4Z0U A;  4C8N A;  3V1R A;  4EP4 A;  3O3G A;  3RRH A;  5J2M A;  3U6F A;  1T7P A;  3RR7 A;  3VQP A;  1WAF A;  3AA4 A;  5KGW A;  4CEE A;  3TR8 A;  4KV8 A;  3AVH A;  3RTV A;  4KRE A;  4LSN A;  3VQA A;  4PY5 A;  2HB5 A;  5HRN A;  4E7I A;  3KK3 A;  1S1W A;  3M8S A;  4F3O A;  3B6O A;  1RDC A;  4J2E A;  2X74 A;  4CFC A;  4XIU A;  3KK2 A;  1VRT A;  1A5V A;  4CEA A;  3PX0 A;  4CIF A;  2A1R A;  2HMI A;  1U4B A;  3DLG A;  4O55 A;  3AVK A;  5I3U A;  4FJL A;  3P83 D;  1BGX T;  3LAM A;  3OYM A;  3MAQ A;  3IAY A;  1S1X A;  2XY7 A;  4FJN A;  2G8W A;  3C94 A;  4KHQ A;  5FRN A;  3DM2 A;  2HHV A;  2FC0 A;  4B3O A;  4G1Q A;  4LSL A;  3T1A A;  4DFJ A;  4F4K A;  4CE9 A;  4F3T A;  2RF2 A;  1ZBI A;  1T03 A;  2Z1I A;  4DG1 A;  3ULD A;  4OPJ A;  1IG9 A;  4YNQ A;  4Z4E A;  3QIN A;  4HTU A;  4FM0 A;  1R0A A;  3MXM A;  5HLF A;  3VQB A;  1RT4 A;  1D9F A;  2O4G A;  3F73 A;  4DSF A;  2ZQB A;  4RG8 A;  1QTM A;  4C8M A;  4J2D A;  4FK0 A;  4KB0 A;  2OPS A;  3PX6 A;  4CED A;  4FM1 A;  4FJK A;  3HP6 A;  1HPZ A;  3NF7 A;  1A5X A;  3VQC A;  1QQC A;  3O4Q A;  1KLM A;  3SUP A;  2PZS A;  2IDO A;  1CZ9 A;  3AA3 A;  2BDP A;  2HW3 A;  4I7F A;  4NCA A;  3KJV A;  3DLH A;  4AHU A;  4FK2 A;  1B9F A;  3AO5 A;  2BE2 A;  4IBN A;  5HBM A;  2Z1H A;  3L2W A;  3HVR A;  4I9Q A;  4HHT A;  3NGY A;  2G8H A;  4QCL A;  4JS5 A;  4FLW A;  4BDY A;  2Z1J A;  2OYQ A;  4K8X A;  4OGE A;  1WSF A;  4E1N A;  3L2Q A;  3AVB A;  1CZB A;  2DFH A;  2G8F A;  2HHX A;  4CK2 A;  3L2V A;  1WSG A;  1RBV A;  3TAP A;  2HHW A;  4CHO A;  3KD5 E;  1TKX A;  1U04 A;  4CEZ A;  3CG7 A;  1S9G A;  5J2N A;  3IS9 A;  1ZBF A;  1WLJ A;  4M3T A;  4DS5 A;  2DY4 A;  1C6V A;  3IRX A;  3KKR A;  2XY8 A;  1KCF A;  2Z1G A;  3KLI A;  4CK1 A;  1RCH A;  4FW2 A;  4HVJ A;  4OVL A;  3OYA A;  3SZ2 A;  2A1S A;  4CEB A;  1LW0 A;  3LP3 A;  1C1C A;  2XO7 A;  4KI6 A;  3MXJ A;  4CEF A;  1EKE A;  3OYN A;  3SUO A;  4Z4G A;  3CFP A;  2HHU A;  1HNV A;  1TL1 A;  3PUF A;  3VQE A;  1YVU A;  2WON A;  1BIZ A;  1JLQ A;  4KO0 A;  1SKW A;  5J2Q A;  1YTU A;  4J2A A;  2D0A A;  4CGF A;  4CJW A;  1NK8 A;  2F8S A;  4KHS A;  3U3G A;  4LH4 A;  1HQU A;  2F96 A;  5DMR A;  3L3V A;  4CGI A;  4E3S A;  1J5O A;  4AHT A;  4CEC A;  2YKN A;  3ZSQ A;  4CJ4 A;  3NCI A;  3NBP A;  2KFZ A;  1RT5 A;  4Q5V A;  3CYM A;  2DTU A;  4FYD A;  3NFA A;  3HYF A;  4DLE A;  4BE1 A;  3QEW A;  1YTA A;  1DTT A;  4E7K A;  3FFI A;  2P5O A;  4CJR A;  3NHG A;  1XHX A;  5HRS A;  3NGI A;  2VWJ A;  1TKD A;  3TAR A;  3K5N A;  1HYS A;  3UIQ A;  3NH0 A;  1JKH A;  1UOC A;  1SL2 A;  3VQ5 A;  3K2P A;  4LY7 A;  3VQD A;  4CES A;  3SQ0 A;  3OVN A;  2O4I A;  1L3S A;  2Y1J A;  2GV9 A;  1RBS A;  1Y97 A;  4FLX A;  3VA3 A;  4M3Z A;  4Q0B A;  4NCG A;  4RW4 A;  2JLE A;  1YT3 A;  4O5B A;  2NUB A;  3WNE A;  4QOZ B;  4OLB A;  2RPI A;  3OS1 A;  1T8E A;  3AO4 A;  3D45 A;  1SV5 A;  4F2S A;  4FJ8 A;  1MU2 A;  2QKB A;  2RN2 A;  1B92 A;  1S5J A;  1HYV A;  1NK6 A;  3V9U A;  4KTQ A;  4FK4 A;  2PYL A;  4KPY A;  1VK0 A;  2VWK A;  3KLH A;  3I0S A;  1X9S A;  1Q9Y A;  4O44 A;  4UQG A;  1IKW A;  2D0C A;  1UWB A;  2D0B A;  4CFB A;  4DF4 A;  4CCH A;  4FJ7 A;  4CHY A;  3I0R A;  1Z25 A;  3OYD A;  3OJS A;  3I8D A;  3V9Z A;  3NGZ A;  1NK7 A;  4FZX C;  2HVH A;  4CJT A;  3AVL A;  4CIE A;  1BHL A;  2FBT A;  3PO5 A;  1TK5 A;  4HCC A;  4KRF A;  3NF8 A;  2HHQ A;  3HPG A;  1QSY A;  1WSI A;  3L2U A;  3NF6 A;  2KW4 A;  4R5P A;  1KVC A;  4ZTF A;  4DTR A;  3LAL A;  1CLQ A;  4Z4H A;  3AO1 A;  1RTI A;  4AHC A;  3O3H A;  2RKI A;  3DRS A;  3OYH A;  4FLT A;  2GBZ A;  1QSL A;  1NKB A;  1HQE A;  1VSK A;  2IGI A;  4CJE A;  4CJK A;  3QEI A;  4FJI A;  4CK3 A;  4DU1 A;  3HT3 A;  1C0T A;  5HP1 A;  4M42 A;  3SV4 A;  3M8R A;  1K6Y A;  3QIP A;  3A2F A;  2YNH A;  2BAN A;  4RW9 A;  4DTP A;  2G8V A;  1BCM A;  4FJG A;  1VSE A;  4DTO A;  2OPQ A;  1ZBL A;  3AVN A;  2P5G A;  1QS4 A;  3O3F A;  4FLZ A;  3SPZ A;  1QE1 A;  4CFA A;  4CGJ A;  2P1J A;  3CFR A;  4CF8 A;  3PY8 A;  4ELV A;  3VQ4 A;  3QEP A;  4FJ5 A;  1RBT A;  1TVR A;  1WSJ A;  4IFY A;  2FBX A;  4KFB A;  4W5Q A;  1C1A A;  4B9U A;  2YKM A;  2IC3 A;  1RT7 A;  3JYT A;  1RNH A;  4LH5 A;  3ZT1 A;  3NH1 A;  4FLU A;  2G8U A;  3V9S A;  3HO1 A;  4OKE A;  1B9D A;  3K5O A;  4CJL A;  4DQI A;  3VQ9 A;  3HVT A;  1TKT A;  4E7L A;  4CF2 A;  3WNG A;  5HRR A;  1BQM A;  1NK0 A;  2IAJ A;  2YNG A;  1NJW A;  2E6M A;  4AHV A;  3D0P A;  2VG7 A;  4DFM A;  2YHB A;  1FKO A;  4HUF A;  2ETJ A;  3KLE A;  2KFN A;  5HRP A;  4BDP A;  2DFE A;  4ELU A;  3MEC A;  4M45 A;  4WE1 A;  4KI4 A;  1SKR A;  1LV5 A;  4CF1 A;  2YNI A;  1SL1 A;  1N6Q A;  3SV3 A;  4FCY A;  4DTS A;  3PV8 A;  1SKS A;  2OZS A;  4PUO A;  3OYL A;  1LWE A;  1RDD A;  1U49 A;  4KKO A;  1KTQ A;  4CJP A;  2VG6 A;  3QEX A;  2R7Y A;  1RIL A;  4HUE A;  4LD0 A;  3PO4 A;  4KHN A;  3KIO A;  1NOY A;  1J53 A;  3ZSW A;  4CHQ A;  1TKZ A;  3S3M A;  4DWI A;  3QNN A;  3AO3 A;  4DSE A;  1Z26 A;  4ID5 A;  4CGH A;  5J2P A;  3KD1 E;  2VG5 A;  5D3G A;  3ZSR A;  2X6S A;  4OGC A;  3CFO A;  1JXE A;  1TV6 A;  1HJR A;  3ALY A;  3AV9 A;  5C42 A;  4CJU A;  5KRT A;  3KTQ A;  4ZTJ A;  4CF0 A;  4F2R A;  1QHT A;  3SI6 A;  3RRG A;  4ID1 A;  3K5L A;  4O0J A;  3T19 A;  3K59 A;  4FM2 A;  1RTH A;  1S6Q A;  3TAE A;  1U45 A;  3DLB A;  4B9N A;  4EZ9 A;  5FRM A;  3V1O A;  2XHB A;  3VN5 A;  4FJ9 A;  1FXX A;  5KRS A;  3AVF A;  2KZM A;  3CQ8 A;  4IG3 A;  5K14 A; 
#chains in the Genus database with same CATH topology
 1ASV A;  4M7Y A;  4DV4 K;  2QK9 A;  3HPH A;  2NLX A;  1DEJ A;  4EAH D;  4J2B A;  4WCE L;  4EIA A;  4B8A B;  5KI6 A;  3THV A;  4KB1 A;  2GWJ A;  5AQJ A;  1KVB A;  1A5W A;  3ZSZ A;  1N8R O;  2QWO A;  1U6Z A;  3BF1 A;  3QEV A;  4KAZ A;  2V51 B;  3UKR A;  4B9S A;  2OZM A;  3TAG A;  1IKX A;  4K0K K;  3NH2 A;  3BZC A;  1BL3 A;  3W0L A;  4BQZ A;  1JCE A;  1JLB A;  3CCU N;  2PY5 A;  1Q81 O;  3DOL A;  1NKC A;  2BH1 A;  3RSE A;  3D2F A;  1NOZ A;  1IH7 A;  3HL8 A;  2QWN A;  4JLH A;  4X65 K;  1X9W A;  1NJY A;  4DSJ A;  1HMV A;  3ZT3 A;  1UA1 A;  3HK2 A;  1WBB A;  3SCX A;  3A5M C;  1WB9 A;  2XRI A;  4GVM A;  1KD1 O;  4JKB A;  1IKY A;  2HND A;  2W6K A;  4GMJ B;  2XY6 A;  4FZZ A;  5A2Q O;  4JYA K;  3U9D A;  3DJC A;  2H3G X;  2YCH A;  4BG8 A;  4Y1C A;  3OW2 M;  4JI6 K;  2OPP A;  2HHS A;  4M3X A;  1NK4 A;  1VRU A;  2FBY A;  2HBJ A;  2QWP A;  4EP5 A;  2UXC K;  4B1Y B;  1VHX A;  3FZH A;  2NRV A;  3H6E A;  1N36 K;  3C6T A;  3LZJ A;  3F2K A;  4DR2 K;  3I8B A;  3HJF A;  3DOK A;  5HRO A;  4K25 A;  5BRE A;  3P5J A;  4N56 A;  2GEL A;  3HST B;  1NU0 A;  4O4G A;  3SK3 A;  3C95 A;  4KHW A;  4DR3 K;  2D0O A;  4QS9 A;  2FF6 A;  2QWR A;  2DPN A;  5KTQ A;  1MWM A;  2E6L A;  1W9H A;  4CF9 A;  1U47 A;  4FLV A;  3V4I A;  3VOV A;  1S22 A;  4QS7 A;  5AQL A;  4FLY A;  1XI1 A;  5E26 A;  1JCF A;  4DS4 A;  1GLF O;  3GG4 A;  3EO3 A;  3NF9 A;  3DLE A;  3CJ7 A;  4DU3 A;  4AHS A;  3DAW A;  2QA4 N;  1NGH A;  3TTC A;  3SAF A;  5EVZ A;  1FK9 A;  2JWK A;  4JRQ A;  2KTQ A;  5GAD P;  3IMX A;  1KFS A;  3AVA A;  4B08 A;  5IWA K;  3MWP A;  4CZK A;  1NG9 A;  4IDK A;  1KFD A;  5GIN A;  3LZI A;  2OA8 A;  2XY5 A;  1L3U A;  4RW8 A;  4DR7 K;  3U9Z A;  1T44 A;  4CD3 A;  1X9M A;  1TK8 A;  3FE1 A;  4CER A;  1O1W A;  3HBT A;  3RWU A;  3MED A;  5EX5 A;  5E84 A;  1HLU A;  4X64 K;  4JI7 K;  1DLO A;  5AJ3 K;  5DK5 A;  1NK5 A;  2FBV A;  4MDB A;  4CEO A;  4NYN A;  2YHA A;  5AZJ A;  4CEQ A;  3VPZ A;  4N76 A;  1J9A A;  3RR8 A;  3LP1 A;  1SS6 A;  4GW6 A;  5FPD A;  4BG9 A;  3G10 A;  2ZJP L;  4M41 A;  1HUX A;  3J7Z O;  3CCQ N;  3VF6 A;  4JEP A;  3CQY A;  4K8Z A;  4OO1 J;  4N47 A;  1CZA N;  4Z4I A;  2LSN A;  3MXI A;  3TSP A;  3SQ2 A;  4DTX A;  1EX4 A;  4C8O A;  1Q7Y O;  3HPO A;  3E9P A;  3VTI A;  3ZSX A;  4C8K A;  4W5T A;  1W0H A;  2P9I A;  3O9Q A;  3SMP A;  1S1U A;  1YHQ N;  4B1V A;  2Q97 A;  4NCB A;  3V1Q A;  1TAQ A;  1JXB A;  4I9L A;  4A2B A;  5FDL A;  4CJQ A;  1C0M A;  4OKJ A;  4Z0U A;  5J2M A;  3RRH A;  2NRW A;  3VGL A;  3UKU B;  3VQP A;  4FPA A;  1E4G T;  4O8U A;  1WAF A;  3EKS A;  2AP1 A;  1HNZ K;  3RTV A;  4KRE A;  4E7I A;  3KK3 A;  3M8S A;  3VEV A;  4BGA A;  4XIU A;  5EXW A;  1ATN A;  4CEA A;  3KVG A;  4WQ4 A;  4Y0W A;  3DLG A;  4O55 A;  3AVK A;  4OPH A;  5BRF A;  4I6M B;  1BGX T;  3IAY A;  2YJE A;  5FRN A;  4JHD A;  4G1Q A;  5AFU H;  3T1A A;  4DFJ A;  4CE9 A;  2RF2 A;  1T03 A;  2Z1I A;  4CZI A;  3ULD A;  4YNQ A;  4Z4E A;  1TUY A;  2FSN A;  4JD2 A;  1VQ7 N;  1RT4 A;  4DSF A;  4J2D A;  1QTM A;  4KB0 A;  3PX6 A;  2P9K B;  3MDQ A;  4BRG A;  3NF7 A;  1A5X A;  3VQC A;  3O4Q A;  2VGN A;  3FR0 A;  5GIO A;  1CZ9 A;  3TPQ A;  4FK2 A;  2A41 A;  3L2W A;  2Z1H A;  3VEN A;  3CD6 N;  1G99 A;  5F0X A;  1N34 K;  4QCL A;  2OYQ A;  5M1K A;  3K0S A;  1CZB A;  2G8F A;  3ZLJ A;  3L2V A;  3ZET A;  3TAP A;  3AY9 A;  4CHO A;  3KD5 E;  4CEZ A;  3ZX2 A;  2HF3 A;  2F7T A;  2O8C A;  3IS9 A;  3FGU A;  1ZBF A;  3CHW A;  2QEX N;  2GX9 A;  4HVJ A;  3O1W A;  5C12 A;  3SZ2 A;  1D8Y A;  4CEB A;  1LW0 A;  3D6R A;  5AQH A;  4Z4G A;  1TL1 A;  2J4R A;  1YVU A;  1JLQ A;  3GBT A;  3BZK A;  1YTU A;  5M1Q A;  2OCE A;  4J2A A;  2WBN A;  3C7N B;  4XH5 A;  1HQU A;  2F96 A;  3THW A;  1MDU B;  4E3S A;  4CJ4 A;  1V4T A;  3G6E N;  3H3O B;  4J8F A;  4Q5V A;  4LF8 K;  3SMS A;  1RFQ A;  4BC2 A;  4DLE A;  3Q7C A;  1YTA A;  1DTT A;  1OH7 A;  3NHG A;  1XHX A;  2A6A A;  2BTF A;  4WFN L;  1VAZ A;  5C15 A;  3WQT A;  3PSF A;  1IG8 A;  2Y1J A;  4M3Z A;  1Y97 A;  2D1K A;  4ILJ A;  4QOZ B;  4FWK A;  3OS1 A;  3AO4 A;  4F2S A;  2QKB A;  1X3N A;  2RN2 A;  4FOE A;  1B92 A;  4KTQ A;  3KLH A;  1X9S A;  1O13 A;  3CI5 A;  3R1X A;  5LY3 A;  4ISG A;  4DF4 A;  4CHY A;  3OJS A;  1NK7 A;  2HVH A;  4FPB A;  3AVL A;  1N33 K;  2FBT A;  3WQU A;  1WSI A;  1SZ2 A;  3NF6 A;  4DTR A;  1BDG A;  4AHC A;  4Z4H A;  1QSL A;  3OYH A;  1HQE A;  1VSK A;  4K43 A;  4CK3 A;  5AQS A;  2V7Z A;  3LDQ A;  3G4S N;  4DTP A;  3WXL A;  3CFR A;  4ELV A;  2HF4 A;  3VQ4 A;  1C0G A;  3MCA B;  4B9U A;  1GLB G;  2YKM A;  3QDK A;  5BR9 A;  3K9J A;  5AQU A;  1RNH A;  4LH5 A;  2G8U A;  5AZI A;  3WT0 A;  4CJL A;  3FFK B;  3HVT A;  1XNQ K;  1Y64 A;  1TKT A;  5AFU A;  1BQM A;  1NK0 A;  2IAJ A;  1JJ2 M;  2VG7 A;  3GOI A;  2KFN A;  5HRP A;  2DFE A;  3MEC A;  4M45 A;  4JKG A;  1SKR A;  1LV5 A;  1SL1 A;  2YNI A;  3PV8 A;  2OZS A;  1LWE A;  4KKO A;  1KTQ A;  1V4S A;  3MMV A;  4HUE A;  4LD0 A;  4KHN A;  3KIO A;  4CHQ A;  4DWI A;  3QNN A;  4DSE A;  1Z26 A;  4ID5 A;  4CGH A;  4YOX A;  1M90 O;  5J2P A;  3CCE N;  3KD1 E;  5D3G A;  4QS8 A;  3ALY A;  3MN6 A;  2VGM A;  1QHT A;  3FZM A;  3RRG A;  3K59 A;  4EZ9 A;  2XHB A;  2ASM A;  1S3X A;  4FJ9 A;  3IDH A;  3AVF A;  2UUA K;  3OY9 A;  4E7L A;  2O8E A;  2EX3 A;  4WQ5 A;  1DKG D;  2X78 A;  4DFK A;  2P9S B;  3ID6 A;  1K8A O;  4DQR A;  1M1K O;  5C24 A;  3AVG A;  2CGJ A;  2UYT A;  3DMJ A;  3VA0 A;  2G8K A;  3JS6 A;  1RDB A;  2D0P A;  4ELT A;  3TAB A;  4DFP A;  3CME N;  5BRH A;  5AQQ A;  3OYJ A;  5I42 A;  3C6H A;  4BWJ A;  5GAE P;  4MLH A;  1TGO A;  5AQT A;  1IO2 A;  3GE1 A;  4KHP K;  3TAN A;  2ATQ A;  1QQO A;  4CHP A;  1QZ6 A;  1S1V A;  4BWM A;  1QZ5 A;  1TUU A;  3CQX A;  3U3Y A;  1RT3 A;  3TSU A;  4BE2 A;  1T05 A;  4RW7 A;  1N5Y A;  3JSM A;  4WFA L;  3HM9 A;  4E1M A;  5BPN A;  1LW2 A;  1JL1 A;  4M63 C;  1NGF A;  4CJ3 A;  2E5L K;  5BRD A;  2FXU A;  2QI2 A;  4BRC A;  3S3N A;  3WEE A;  4BGB A;  4DV1 K;  4B9M A;  3TAQ A;  3OJU A;  5JS2 A;  3AVJ A;  3RSE B;  4B9L A;  4OLA A;  2ZGZ A;  1UA0 A;  1P8Z A;  4KHY A;  3L2R A;  3F9K A;  2D5R A;  1TK0 A;  3H46 O;  3S41 A;  4NLC A;  1VQL N;  3OS2 A;  4CHZ A;  3QFU A;  5C25 A;  5KQD A;  1NMD A;  1NKE A;  3ZCM A;  4H5W A;  4BVP A;  1BA1 A;  3MCP A;  2F8T A;  4LF9 K;  3SNN A;  2UU9 K;  3H45 C;  2YHY A;  4CZJ A;  4BQL A;  2QXL A;  5SWM A;  3OYB A;  3C65 A;  4IJN A;  3L8B A;  4JNE A;  1XMQ K;  1Q82 O;  4PL8 A;  2O8B A;  5M1P A;  1ZC6 A;  3B6P A;  3G71 N;  1GOA A;  2F9T A;  3ZSV A;  4BE0 A;  2HNZ A;  3TWH A;  1D5A A;  4AM7 A;  3EN9 A;  5KPT A;  4WYB A;  4JI1 K;  4G9Z A;  5AR0 A;  3LDP A;  4IOC L;  3LP0 A;  4PKG A;  3TI0 A;  1C1B A;  1OH5 A;  1KSP A;  3CCJ N;  2PYJ A;  3N4Q A;  3QER A;  3WNF A;  1S6P A;  1X3M A;  1GLL O;  3CPW M;  4DTU A;  3OYE A;  5JVG L;  5LL6 Z;  2PFU A;  2B6A A;  4CJ5 A;  4CFD A;  4DSI A;  1C0U A;  5CYQ A;  2Q36 A;  3SJJ A;  3CJA A;  1TL3 A;  4DLG A;  4HCB A;  5H1S Q;  5LJW A;  5SZT A;  4CJS A;  1QVG M;  5IT9 O;  3ZT0 A;  3OHR A;  1BI4 A;  1VSI A;  4DV6 K;  3V9W A;  3DI6 A;  3BDP A;  1S9E A;  4FVM A;  3CPE A;  3SYZ A;  3AO2 A;  3M8Q A;  3PIO L;  3VEZ A;  3OYG A;  1ITG A;  3TTF A;  1QHA A;  4M3R A;  5EU7 A;  3ISN C;  3VQ8 A;  3HTV A;  2A40 A;  1LAW A;  1BCO A;  4FZY A;  1G15 A;  4AQY K;  2GTD A;  2Q31 A;  3Q7B A;  2WOM A;  3I55 N;  4N41 A;  1JLA A;  4E89 A;  3LWL A;  5AQZ A;  4FWS A;  1OVQ A;  3SAH A;  4YDU A;  1C0F A;  3L6Q A;  1MWK A;  1XWL A;  4C1N K;  4AH9 A;  1H1V A;  5T7B A;  1RT6 A;  3K5M A;  4M3Y A;  1VSD A;  3OYF A;  1EET A;  3AGK A;  2CH5 A;  2JGU A;  3J81 O;  3DLL L;  1BQN A;  1XNR K;  3KLG A;  5AZJ B;  3L3U A;  3WNH A;  4BRN A;  3ZX0 A;  1NK9 A;  2G8I A;  3ZSY A;  1WAJ A;  1CXQ A;  4KTW A;  4GVE A;  1Q9X A;  4M3W A;  1LCU A;  5GAG P;  4DV0 K;  3NDK A;  1VQ6 N;  3MEE A;  4CJ7 A;  5KQ8 A;  1RTD A;  3NAE A;  1U2V A;  4W5O A;  4CBX A;  4YOW A;  5FPE A;  4KTZ A;  2I5J A;  1RT1 A;  2HVI A;  4IOA L;  3VEY A;  3UB5 A;  5FLX O;  3O3G A;  3AA4 A;  4B1X B;  2WTU A;  1LOT B;  4YOU A;  3VQA A;  4PY5 A;  4FO0 A;  5HRN A;  2FSJ A;  1VRT A;  3IUC A;  1U4B A;  5I3U A;  4BVO A;  4FJL A;  1VQN N;  3MAQ A;  3THX A;  1R59 O;  4FJN A;  1KAY A;  1EWR A;  3C94 A;  4KHQ A;  2FC0 A;  4JKD A;  4H0V B;  2YJF A;  4BRE A;  1D9F A;  4PKH A;  1HKC A;  2O4G A;  3F73 A;  1ILY A;  3HSC A;  4IFE A;  2ZQB A;  4RG8 A;  4FM1 A;  3CF5 L;  2QWL A;  4DV5 K;  4FJK A;  4YOR A;  3HP6 A;  3NMU A;  1BU6 O;  1QQC A;  2VQE K;  1KLM A;  3AA3 A;  2BDP A;  2QW9 A;  3HVR A;  4HHT A;  3NGY A;  1HNX K;  5AQI A;  2G8H A;  4BDY A;  3U4L A;  4WQ5 C;  4OGE A;  4C23 A;  3AVB A;  2DFH A;  3OBY A;  3DXM A;  4JD2 B;  1TKX A;  3CG7 A;  1S9G A;  1T3V A;  4A61 A;  4DS5 A;  3K9K A;  3H3N O;  2Z1G A;  1KCF A;  1NKB A;  4OVL A;  2P9P A;  2A1S A;  2W40 A;  3LP3 A;  1C1C A;  2XO7 A;  1XC3 A;  4E1J A;  1HNV A;  3PUF A;  5DM6 L;  4JI8 K;  4KO0 A;  3MN5 A;  1SKW A;  5JMV A;  4CJW A;  2GWK A;  4LH4 A;  3QB0 A;  4LC9 B;  5DMR A;  3L3V A;  3ZET B;  4CGI A;  4YOY A;  4CEC A;  3KK7 A;  3NBP A;  1RT5 A;  3CYM A;  4JKA A;  4BRH A;  2DTU A;  1KAZ A;  2O8C B;  3NFA A;  3VF2 A;  1EO1 A;  4CZH A;  4E7K A;  4CJR A;  4BRL A;  3NGI A;  1TKD A;  3K5N A;  1K8K A;  3M6G A;  4A5A A;  2KHO A;  2A5X A;  3UIQ A;  1UOC A;  3ULE A;  4LY7 A;  3O9T A;  3SQ0 A;  3OVN A;  4BRQ A;  3P31 A;  1RBS A;  1IBL K;  1YT3 A;  2NUB A;  4OLB A;  3THW B;  2RPI A;  3CC4 N;  1SV5 A;  2PAV A;  1MU2 A;  3DWL A;  1NK6 A;  1QQN A;  4RWT A;  1VK0 A;  3I0S A;  1Q9Y A;  3VEW A;  4UQG A;  4IO9 L;  1VQP N;  1OVY A;  1UWB A;  3LDO A;  3I8D A;  3I0R A;  3V9Z A;  3OYD A;  2P9U A;  5B8H A;  4BR4 A;  1YJN N;  1BHL A;  3CJB A;  5GAH P;  1QSY A;  3L2U A;  2KW4 A;  1KVC A;  4ZTF A;  3CCM N;  2KKZ A;  1BUP A;  4X62 K;  3J7Y P;  1RTI A;  4FLT A;  3DRS A;  4YY3 K;  5AQK A;  3F9M A;  5TKW A;  3VGK A;  1YIT N;  3T1H K;  4FJI A;  4DU1 A;  3HT3 A;  1C0T A;  2HOE A;  4DV2 K;  3SV4 A;  5KPR A;  3M8R A;  3A2F A;  2ASO A;  2UXB K;  2Q2R A;  3T1Y K;  4BR0 A;  4FJG A;  4ILH A;  4C1N I;  3O3F A;  4FLZ A;  3SPZ A;  1QE1 A;  4CFA A;  3QEP A;  1RBT A;  1TVR A;  2FBX A;  4W5Q A;  2VCP A;  1RT7 A;  5AQO A;  3JYT A;  3NH1 A;  5JLH A;  4GNI A;  1Z05 A;  3SJH A;  1B9D A;  3VQ9 A;  3WNG A;  1NGC A;  2YNG A;  4DFM A;  2YHB A;  3GL1 A;  1WUA A;  4DQ8 A;  4BDP A;  1N6Q A;  4CZL A;  2RHK A;  3OYL A;  4B9Q A;  2ASP A;  3QEX A;  1TYQ A;  4PHT X;  1WBD A;  3A5O C;  3HOT A;  3QML A;  1NOY A;  1J53 A;  1HNW K;  2OTL N;  2HBM A;  5AZI B;  3ZSR A;  2X6S A;  4OGC A;  5C42 A;  4JI4 K;  4CJU A;  3KTQ A;  5DM7 L;  4CF0 A;  4F2R A;  4BRA A;  3K5L A;  4FM2 A;  4RCH A;  1RTH A;  1U45 A;  3TAE A;  5FRM A;  4JKG B;  3V1O A;  3CQ8 A;  1KC8 O;  4IG3 A;  3OA9 A;  2Y1I A;  4BDZ A;  1VSH A;  2B5J A;  3EZW A;  5ADX H;  1WSH A;  3CCR N;  1VSL A;  3LL3 A;  1JCG A;  3P1G A;  3AA5 X;  3S9H A;  4YDU C;  3L0Q A;  1NGG A;  4V19 S;  1EP4 A;  3TAM A;  4BRO A;  4IZ9 A;  1BO5 O;  4KBO A;  2FLO A;  4GKK K;  3DYA A;  4B8C A;  4KHU A;  3IFR A;  2NRT A;  2I7N A;  4DF8 A;  4FJX A;  3EYZ A;  4LFB K;  3BF3 A;  2NRH A;  5AQG A;  2ZF5 O;  4MFB A;  3VQQ A;  2QWM A;  1YJ9 N;  4IDH A;  2O8E B;  3HZ6 A;  3QO9 A;  3CCS N;  3SQ4 A;  3RMC A;  4BRM A;  2AJQ A;  4AF1 A;  1J5E K;  1W2B M;  4YFU A;  4H5R A;  2WC9 A;  2KQ2 A;  4HUG A;  2E1Z A;  1IKV A;  4W5N A;  4H4M A;  4A2A A;  4H0O A;  1ASU A;  4NXM K;  1RDW X;  5LJV A;  3KLF A;  4OX9 K;  3L4Q A;  4JI3 K;  5C0Y A;  4JKF A;  4BY9 C;  3E01 A;  5FRO A;  3EY1 A;  3ENO A;  2ZM6 K;  4ILG B;  1TAU A;  4B9T A;  4EHT A;  1I3A A;  2B4J A;  2KLA A;  3H1V X;  1LWF A;  4FWP A;  3OYI A;  3CMA N;  1ZBH A;  1KXP A;  3DLR A;  1YUW A;  4BAC A;  2O8D B;  3FZK A;  1VQM N;  3M1F A;  4EZ6 A;  3ENH A;  1DGK N;  4NYF A;  4BRK A;  1L5U A;  2Q0R A;  1L3T A;  3TTD A;  4CJV A;  2ZD1 A;  1GOB A;  3OS0 A;  2E4L A;  3BY5 A;  4F8R A;  4IFV A;  4FW1 A;  3WXK A;  3KK1 A;  1NGJ A;  2UUB K;  2JWL A;  2P9L A;  3JXU A;  4AM6 A;  4E7J A;  1VSM A;  1QSS A;  4JRP A;  2KZZ A;  4DMN A;  2YNF A;  3WEE B;  4H4O A;  2P9K A;  4MQ3 A;  2E2O A;  3HP9 A;  3M8P A;  4CHN A;  4A59 A;  4B3M K;  1LAV A;  3EL2 A;  1HJO A;  2V52 B;  3QBW A;  2P51 A;  4DTM A;  1P90 A;  3IG1 A;  1K73 O;  1Q8I A;  5E41 A;  1ESV A;  4IO8 A;  1BIU A;  5CZ2 A;  1CXU A;  3LP2 A;  3BGR A;  1DTQ A;  5CY4 A;  3E1Y A;  3T3F A;  2VYP A;  2O8B B;  4H03 B;  5BN9 A;  5JIC A;  4BRD A;  4B1Z A;  4DTN A;  3DXK A;  4Y1D A;  4Z4F A;  4AHR A;  4ICL A;  3QLH A;  3LDS A;  4DTJ A;  4DV3 K;  5AQP A;  3QET A;  3EEQ A;  4MLE A;  3NVK A;  3SPY A;  3AAR A;  3ITH A;  2BGG A;  2NRR A;  1KVA A;  1HKB A;  2A42 A;  4MO4 A;  4IWV A;  3AVM A;  5F2R A;  1NJX A;  3QIC A;  5KPZ A;  3V6D A;  1L3V A;  5ADX A;  3THY A;  5CYM A;  3R9P A;  3DLK A;  4H8K A;  4FXD A;  1LWC A;  4B1U B;  3O4N A;  3V9X A;  1BI4 B;  1NNE A;  1ZYQ A;  2NZT A;  3IKM A;  3O08 A;  3WXM B;  4CGD A;  1KAX A;  3TAF A;  4JS4 A;  3MEG A;  3OYK A;  5J1E A;  4MO5 A;  1OH6 A;  1F21 A;  3HRG A;  1JLG A;  4U67 L;  1J54 A;  2HNY A;  1GLJ O;  1RDU A;  3LDL A;  1GLD G;  2IS3 A;  4BRI A;  4JI0 K;  3AA2 A;  4FWR A;  3VES A;  5CR4 A;  4H0P A;  3UKR B;  3OBW A;  4JKE A;  4RW6 A;  3CM6 A;  2O8F A;  4B3O A;  4ISF A;  4DQQ A;  4QAG A;  2D4W A;  1JLC A;  4WQ4 C;  3D2F B;  1BIS A;  2HHQ A;  4Z4C A;  2QXF A;  1WNS A;  2QWQ A;  3ZT4 A;  4FOI A;  1OKJ A;  1SUQ A;  5LMN K;  3LAN A;  3SUQ A;  4C8N A;  3O9S A;  3V1R A;  4EP4 A;  1T7P A;  3RR7 A;  2E2P A;  5KGW A;  4CEE A;  3TR8 A;  4KV8 A;  3AVH A;  2YI1 A;  1Q86 O;  4F3O A;  3B6O A;  1RDC A;  1HX1 A;  3PSI A;  3ENB A;  3G25 A;  2IVP A;  4H0T B;  2UUC K;  3P83 D;  3LAM A;  3OYM A;  1U2V B;  2E20 A;  2HHV A;  3C0B A;  4LSL A;  4F4K A;  3MX2 A;  1ZBI A;  4DG1 A;  4DR1 K;  1IG9 A;  4YOV A;  3QIN A;  4HTU A;  4FM0 A;  5HLF A;  3A5N C;  4A57 A;  2YHW A;  3VEX A;  4C8M A;  4DUY K;  1X9J A;  4FK0 A;  1XQS C;  2OPS A;  4CED A;  4DHY A;  5AQM A;  1HPZ A;  3SUP A;  4H5V A;  4I7F A;  4NCA A;  3THX B;  3DLH A;  4AHU A;  3ATV A;  2BE2 A;  3O9U A;  4JS5 A;  1YVN A;  4K8X A;  5M1F A;  5M1O A;  1WSF A;  1FJG K;  2HHX A;  4GV9 A;  1NGA A;  1Z6R A;  4DCH A;  4KH5 A;  5J2N A;  4M3T A;  2DY4 A;  4A5B A;  3IRX A;  3KLI A;  4FW2 A;  3OYA A;  2YX6 A;  4BC5 A;  1VQO N;  4KI6 A;  4CEF A;  5HOO A;  5F1X A;  1GLC G;  2E2N A;  2HHU A;  4H0Y B;  1GLA G;  1BIZ A;  2WON A;  4K42 A;  5ELZ A;  2F4V K;  3LM9 A;  5J2Q A;  4CGF A;  4B1W B;  1NK8 A;  2F8S A;  4JKC A;  3DXM B;  3U3G A;  2Q0U A;  1NGD A;  2P9N A;  5I9E B;  1J5O A;  3NCI A;  2YKN A;  3SLC A;  1W97 L;  5EOY A;  3FZF A;  4FYD A;  2NNW A;  3HYF A;  3QEW A;  4BE1 A;  2P5O A;  3FFI A;  2ZJQ L;  2P9P B;  3KWI A;  3NH0 A;  2GEM A;  1SL2 A;  4CD1 A;  4XH1 A;  3D2E A;  3W3D A;  1L3S A;  3BUZ B;  3VA3 A;  1GLE G;  4CZF A;  4B3T K;  4NCG A;  4RW4 A;  3WNE A;  5HL7 L;  3O8M A;  4BR5 A;  2A3Z A;  3D45 A;  3O6W A;  2BUP A;  3CJ9 A;  3WUH A;  1S5J A;  4KPY A;  4JAX A;  3TU5 A;  4O44 A;  1YI2 N;  2D0C A;  4CVN E;  1NGI A;  2D0B A;  2WFB A;  4CCH A;  1K8K B;  5FPM A;  4FJ7 A;  1Z25 A;  1YF5 L;  3NGZ A;  3C6A A;  3ULE B;  4KRF A;  1TK5 A;  4HCC A;  3NF8 A;  3HPG A;  3QFP A;  4R5P A;  3E9L A;  1VQ9 N;  3KHY A;  4IOX A;  3AO1 A;  4DR4 K;  3A0I X;  2IGI A;  4CJK A;  2P9I B;  4X66 K;  4O5F A;  4PL7 A;  5HP1 A;  4GKJ K;  2CGK A;  3UE5 A;  1K6Y A;  3QIP A;  4RW9 A;  2G8V A;  4KH4 A;  1BCM A;  1VSE A;  5C10 A;  4LFA K;  1HR0 K;  2P9U B;  3MWT A;  1WSJ A;  4KFB A;  2IC3 A;  4PKI A;  3FLC O;  3ZT1 A;  4BR9 A;  4FLU A;  1FW6 A;  3O9R A;  4OKE A;  3K5O A;  4DQI A;  3CCV N;  3M3Z A;  2V7Y A;  3J7A P;  4CF2 A;  1ZXO A;  3HI0 A;  2E6M A;  4AHV A;  1FKO A;  1RGI A;  4HUF A;  2ETJ A;  3KLE A;  4WE1 A;  3ZEU A;  3EE8 A;  4EHU A;  4DR5 K;  3AAQ A;  4JHD B;  4DKW A;  1SKS A;  5CHI A;  4CJP A;  1RIL A;  3PO4 A;  3ZSW A;  2HBK A;  4FWL A;  3S3M A;  3PIP L;  4IEE A;  4BC3 A;  4U7B A;  1JXE A;  5KRT A;  3AV9 A;  4FWN A;  5C2F A;  4ZTJ A;  3SI6 A;  4ID1 A;  2NRX A;  3VN5 A;  1Q18 A;  5KRS A;  3NVM A;  4DSK A;  1BWF O;  4OPK A;  1TYQ B;  1GOC A;  4ZHR A;  4I2Q A;  4CJF A;  3VEO A;  4FJM A;  4CZM A;  3NE6 A;  2GUP A;  1HYZ A;  1JLF A;  3CJC A;  2ZWH A;  3R3L A;  1RBR A;  2ZJR L;  3WXI A;  4N5S A;  1HNI A;  4FWQ A;  1N32 K;  2WUS A;  3PX4 A;  3AVI A;  2X6N A;  3PLA A;  4H0X B;  1JL2 A;  3OTO K;  1W7A A;  3T69 A;  1KRP A;  1S72 N;  3EE9 A;  4CBU A;  3ATU A;  3B8A X;  3RMA A;  1S1T A;  4B3S K;  3CER A;  5BN8 A;  3LPU A;  4FJJ A;  1XUP O;  1T6C A;  4AIL C;  3P39 A;  1HRH A;  2EWS A;  4XH4 A;  4OKK A;  1ZBU A;  4IKF A;  3KWG A;  4DQS A;  2Q3S A;  3KKS A;  3S3O A;  3H1Q A;  4NLB A;  3O1B A;  1HPM A;  4F9O A;  1YJW N;  3HOS A;  3AVC A;  2UXD K;  2PBD A;  2YV0 X;  4FWO A;  3VER A;  3K57 A;  4UY8 O;  4CZE A;  4M3U A;  4PWD A;  3O5B A;  4DUZ K;  1K9M O;  4DV7 K;  1JLE A;  4M7X A;  4O8K A;  3TSQ A;  3VGM A;  1ASW A;  4E0D A;  4M42 A;  3QIO A;  4PA1 A;  4E19 A;  1WN7 A;  3E66 A;  3RVC A;  1BOT O;  5JVH L;  4JK9 A;  2QTD A;  1NLV A;  1YAG A;  3CIP A;  4DU4 A;  1KLN A;  2HHT A;  4YOT A;  4KH6 A;  1D4X A;  3T7Z A;  1J6Z A;  3C6U A;  2GUI A;  4PQU A;  1UAX A;  5JS1 A;  3A5L C;  4FSV A;  2I7P A;  1FKP A;  2P9L B;  3AAP A;  4CIG A;  1WSE A;  3CC7 N;  3ID8 A;  3BEX A;  3ZSO A;  2ITG A;  4CI6 A;  1NBW A;  2IVN A;  4FWM A;  3EZ5 A;  2ZGY A;  2EHG A;  2FF3 B;  3SUN A;  3VMF B;  4O0I A;  4A62 A;  3E9O A;  3RMB A;  3JAM O;  1VQ8 N;  1VSJ A;  1D9D A;  1VSF A;  4FVU A;  1RDA A;  3VF4 A;  3QNO A;  4NO7 A;  1NJZ A;  2CH6 A;  5CZ1 A;  1OH8 A;  2HHH K;  4MDA A;  4W5R A;  5AQV A;  1RT2 A;  4IXC A;  3LWM A;  1SL0 A;  3ZT2 A;  2IOC A;  3M5R A;  1KQS M;  5AQY A;  1EXQ A;  4GV3 A;  1NMN A;  3VQ6 A;  3FZL A;  4TSX A;  1IV0 A;  1VQ4 N;  3DXK B;  3V81 A;  4LF7 K;  5CE3 A;  3R6M A;  1I39 A;  3SQ1 A;  4K41 A;  2RE2 A;  3QES A;  1XC9 A;  2E2Q A;  1RTJ A;  3VQ7 A;  3DRP A;  2E8A A;  2W42 A;  4DQP A;  3RMD A;  1RBU A;  4CGG A;  2Q1N A;  4GY2 B;  2ZE2 A;  1REV A;  3K58 A;  1NGB A;  5AQX A;  4LFC K;  4DSL A;  3HXM A;  4JN4 A;  2QKK A;  1ZBS A;  1DT9 A;  2DFF A;  1X1P A;  3ASM A;  5KGX A;  3THY B;  3F5T A;  3LAK A;  3UKU A;  1YIJ N;  1NJI O;  3D7E O;  4FJH A;  2OPR A;  5TKY A;  3OYC A;  3DRR A;  3QBX A;  3LPT A;  4OJR A;  4JI2 K;  4B9V A;  1XHZ A;  3I33 A;  4C8L A;  1SQK A;  3H08 A;  4RTF D;  3LDN A;  4I2P A;  4IG0 A;  5JLF A;  4L8R B;  3CM5 A;  3SAG A;  1IBK K;  4I6M A;  4E7H A;  4BRF A;  4GV6 A;  3ZX3 A;  3G0Z A;  1U48 A;  4DB3 A;  3U6F A;  3P38 A;  4H5T A;  4JI5 K;  2O8F B;  4LSN A;  2HB5 A;  1S1W A;  1I94 K;  4J2E A;  2X74 A;  4CFC A;  3KK2 A;  1A5V A;  3PX0 A;  4CIF A;  2A1R A;  2YHX A;  2HMI A;  4LF6 K;  1E4F T;  4NXN K;  3P4I A;  1S1X A;  2XY7 A;  1EQY A;  3ZYY X;  2G8W A;  4B3R K;  5AQN A;  3DM2 A;  3VET A;  3J8A A;  4R79 A;  4F3T A;  4OPJ A;  2F9W A;  1R0A A;  3MXM A;  3VQB A;  1MA9 B;  4WF9 L;  4Z94 A;  5C2D A;  2PZS A;  2IDO A;  4CBW A;  2HW3 A;  4FL9 A;  1NM1 A;  3KJV A;  1B9F A;  3AO5 A;  4IBN A;  5AQF A;  5HBM A;  4BR7 A;  4I9Q A;  1WOQ A;  4H5N A;  4JK8 A;  4ISE A;  4FLW A;  2Z1J A;  1E3M A;  4E1N A;  3L2Q A;  3C7N A;  4CK2 A;  3EKU A;  1WSG A;  1RBV A;  2HHW A;  5M1N A;  4LF5 K;  1U04 A;  5BR8 K;  4HWI A;  5LMU K;  1WLJ A;  4OPA A;  4CZG A;  1C6V A;  4CK1 A;  3KKR A;  2XY8 A;  3O4W A;  1RCH A;  4L3Q A;  4YHH K;  1NWK A;  3MXJ A;  1EKE A;  1IJJ A;  4JK7 A;  1NGE A;  3OYN A;  3SUO A;  3CFP A;  2CGL A;  3VQE A;  3VTH A;  2OAN A;  2D0A A;  3GDQ A;  4KHS A;  4JV5 K;  2HMP A;  4AHT A;  3ZSQ A;  1QVF M;  3CXC M;  2KFZ A;  1HKG A;  2E1Y A;  4BRP A;  3BP8 A;  4BR2 A;  5HRS A;  2VWJ A;  4LF4 K;  3TAR A;  1HYS A;  3LM2 A;  1JKH A;  3VQ5 A;  3K2P A;  3VQD A;  4CES A;  1IBM K;  3SBT A;  2O4I A;  2VWB A;  2GV9 A;  3MN7 A;  1ATS A;  1BG3 A;  4FLX A;  4Q0B A;  2JLE A;  4O5B A;  5BPM A;  4BC4 A;  2P9N B;  1T8E A;  4FJ8 A;  2O8D A;  1HYV A;  4FK4 A;  3V9U A;  2HBL A;  2PYL A;  2VWK A;  3J80 O;  1IKW A;  4HTL A;  2AA4 A;  4CFB A;  4EFH A;  2IVO A;  3CJ1 A;  2ITM A;  4FZX C;  1QQM A;  4CJT A;  5EY4 A;  4CIE A;  1SAZ A;  2NRZ A;  3PO5 A;  3A8Y A;  3D2E B;  2E88 A;  1XMO K;  1VQK N;  3LAL A;  1CLQ A;  3O3H A;  1YXQ A;  2RKI A;  3HM8 A;  2GBZ A;  3CC2 N;  3CCL N;  2VQF K;  2W41 A;  2OTJ N;  4CJE A;  1EWQ A;  3QEI A;  1BA0 A;  2YNH A;  2BAN A;  4DTO A;  2OPQ A;  1ZBL A;  3AVN A;  2P5G A;  1QS4 A;  4CGJ A;  2P1J A;  3U8X A;  4CF8 A;  5GIP A;  3PY8 A;  4FJ5 A;  4DR6 K;  4IFY A;  1C1A A;  3L4I A;  3HO1 A;  3V9S A;  3SBG A;  3AGR A;  1T6D A;  5HRR A;  3I56 N;  1NJW A;  3R8E A;  3D0P A;  5AQW A;  4IJA A;  1VQ5 N;  4ELU A;  4KI4 A;  2W6L A;  4CF1 A;  3N4P A;  4NB4 A;  3SV3 A;  4FCY A;  4DTS A;  4PUO A;  5BPL A;  1RDD A;  3CET A;  1U49 A;  5MLC Q;  2VG6 A;  4XEI A;  2HST A;  2R7Y A;  3MK6 A;  3MX5 A;  2P9S A;  1TKZ A;  3AO3 A;  2VG5 A;  2IIR A;  3O80 A;  3CFO A;  1TV6 A;  5AQR A;  1HJR A;  3MN9 A;  3KZB A;  4IEI A;  5FPN A;  2FSK A;  2QM1 A;  4WFB L;  4O0J A;  3T19 A;  1S6Q A;  3DLB A;  4B9N A;  3ZEU B;  1FXX A;  3WXJ A;  2KZM A;  4CW7 B;  1ATR A;  4JKH A;  5K14 A; 
#chains in the Genus database with same CATH homology
 2Y1I A;  2EX3 A;  4BDZ A;  1ASV A;  4DSK A;  1VSH A;  2B5J A;  2QK9 A;  1WSH A;  2X78 A;  3HPH A;  4OPK A;  4DFK A;  1VSL A;  1GOC A;  4ZHR A;  4I2Q A;  4J2B A;  4CJF A;  3P1G A;  3AA5 X;  4B8A B;  3S9H A;  5KI6 A;  4FJM A;  4DQR A;  3THV A;  3NE6 A;  4KB1 A;  5C24 A;  3AVG A;  1HYZ A;  1JLF A;  1EP4 A;  3DMJ A;  3VA0 A;  1KVB A;  1A5W A;  3TAM A;  1RDB A;  3ZSZ A;  4ELT A;  3TAB A;  4DFP A;  3DYA A;  4B8C A;  4KHU A;  1RBR A;  3QEV A;  3OYJ A;  4KAZ A;  5I42 A;  4N5S A;  4DF8 A;  1HNI A;  3EYZ A;  4FJX A;  4BWJ A;  1TGO A;  4B9S A;  3PX4 A;  3AVI A;  2OZM A;  4MFB A;  3TAG A;  1IKX A;  3VQQ A;  2X6N A;  1IO2 A;  1JL2 A;  1KRP A;  3NH2 A;  1BL3 A;  3TAN A;  3QO9 A;  2ATQ A;  3RMA A;  4CHP A;  1S1T A;  3SQ4 A;  1JLB A;  3RMC A;  2PY5 A;  2AJQ A;  1S1V A;  3DOL A;  4BWM A;  1NKC A;  4YFU A;  1NOZ A;  3U3Y A;  3LPU A;  4FJJ A;  2KQ2 A;  4HUG A;  1IKV A;  1IH7 A;  4W5N A;  1RT3 A;  3HL8 A;  4H4M A;  1ASU A;  3KLF A;  4AIL C;  4JLH A;  4BE2 A;  1X9W A;  4RW7 A;  1T05 A;  1HRH A;  1NJY A;  4DSJ A;  1HMV A;  3ZT3 A;  1N5Y A;  1UA1 A;  3HK2 A;  3JSM A;  4OKK A;  3HM9 A;  3E01 A;  4E1M A;  3SCX A;  1ZBU A;  4IKF A;  5FRO A;  3EY1 A;  1LW2 A;  2XRI A;  1JL1 A;  4DQS A;  2Q3S A;  4GVM A;  3KKS A;  1TAU A;  3S3O A;  4B9T A;  4CJ3 A;  1I3A A;  1IKY A;  2B4J A;  2HND A;  4GMJ B;  3S3N A;  2XY6 A;  4FZZ A;  4B9M A;  3TAQ A;  3AVC A;  1LWF A;  3OYI A;  3OJU A;  5JS2 A;  3AVJ A;  4B9L A;  4OLA A;  2YV0 X;  1ZBH A;  3DLR A;  3K57 A;  4BAC A;  1UA0 A;  4KHY A;  3L2R A;  4Y1C A;  3F9K A;  2D5R A;  1TK0 A;  4M3U A;  4PWD A;  2OPP A;  4EZ6 A;  4NYF A;  3OS2 A;  4CHZ A;  1L5U A;  1D8Y A;  2HHS A;  1L3T A;  4CJV A;  4M3X A;  1JLE A;  5C25 A;  2ZD1 A;  1GOB A;  3OS0 A;  1NK4 A;  2E4L A;  1VRU A;  2FBY A;  4IFV A;  4FW1 A;  1NKE A;  2G8K A;  4F8R A;  3KK1 A;  1ASW A;  3ZCM A;  4EP5 A;  4E0D A;  4E7J A;  1VSM A;  1QSS A;  3QIO A;  4PA1 A;  4DMN A;  4E19 A;  2YNF A;  4JRP A;  1WN7 A;  3SNN A;  2KZZ A;  4H4O A;  3C6T A;  5SWM A;  4MQ3 A;  3LZJ A;  3OYB A;  3HJF A;  3DOK A;  3HP9 A;  3M8P A;  4CHN A;  5HRO A;  3L8B A;  1LAV A;  3P5J A;  4N56 A;  3HST B;  4DU4 A;  4O4G A;  1KLN A;  3B6P A;  2HHT A;  1GOA A;  2P51 A;  3C95 A;  4DTM A;  4KHW A;  3ZSV A;  4BE0 A;  2HNZ A;  3TWH A;  3C6U A;  1D5A A;  3IG1 A;  2GUI A;  5KTQ A;  4PQU A;  1UAX A;  2E6L A;  5JS1 A;  1Q8I A;  1W9H A;  4CF9 A;  5E41 A;  1BIU A;  1U47 A;  4FLV A;  1FKP A;  3V4I A;  5CZ2 A;  3LP0 A;  1CXU A;  1C1B A;  3TI0 A;  1KSP A;  4FLY A;  2PYJ A;  4CIG A;  3QER A;  3WNF A;  1S6P A;  1XI1 A;  3LP2 A;  1WSE A;  3BGR A;  3ZSO A;  4DS4 A;  1DTQ A;  2F8T A;  5CY4 A;  2ITG A;  4DTU A;  3NF9 A;  3DLE A;  3OYE A;  4DU3 A;  4AHS A;  3T3F A;  3EZ5 A;  2B6A A;  4CJ5 A;  4CFD A;  4DSI A;  2EHG A;  3SUN A;  1C0U A;  1FK9 A;  5CYQ A;  4O0I A;  4JRQ A;  4DTN A;  2KTQ A;  3SJJ A;  1TL3 A;  4DLG A;  4Y1D A;  3RMB A;  4HCB A;  1VSJ A;  1D9D A;  1VSF A;  1KFS A;  4Z4F A;  1RDA A;  3AVA A;  4AHR A;  4ICL A;  4B08 A;  5SZT A;  3QLH A;  4CJS A;  3LDS A;  3QNO A;  4DTJ A;  4IDK A;  1KFD A;  3ZT0 A;  1NJZ A;  3QET A;  1BI4 A;  1VSI A;  3LZI A;  3V9W A;  2XY5 A;  2OA8 A;  5CZ1 A;  1L3U A;  3DI6 A;  4RW8 A;  3BDP A;  4W5R A;  3SPY A;  1X9M A;  1S9E A;  3ITH A;  1TK8 A;  1RT2 A;  4CER A;  3LWM A;  2BGG A;  1SL0 A;  1KVA A;  3ZT2 A;  2IOC A;  1O1W A;  4FVM A;  1EXQ A;  3AVM A;  3SYZ A;  3RWU A;  3MED A;  3VQ6 A;  3AO2 A;  3M8Q A;  1NJX A;  3V6D A;  1L3V A;  3OYG A;  4TSX A;  1ITG A;  1DLO A;  3V81 A;  4M3R A;  5DK5 A;  5EU7 A;  3ISN C;  5CYM A;  3VQ8 A;  3DLK A;  1I39 A;  1NK5 A;  2FBV A;  3SQ1 A;  4H8K A;  3QES A;  1XC9 A;  4FXD A;  1LAW A;  4CEO A;  1RTJ A;  2YHA A;  1LWC A;  4NYN A;  3O4N A;  1BCO A;  3V9X A;  4CEQ A;  4N76 A;  4FZY A;  1BI4 B;  1J9A A;  1G15 A;  3RR8 A;  1ZYQ A;  3LP1 A;  4GW6 A;  4CGD A;  3TAF A;  2WOM A;  3G10 A;  3VQ7 A;  3DRP A;  4JS4 A;  4N41 A;  1JLA A;  4M41 A;  3MEG A;  4E89 A;  3OY9 A;  3OYK A;  3LWL A;  2W42 A;  3RMD A;  4DQP A;  5J1E A;  1F21 A;  1RBU A;  1JLG A;  1XWL A;  1J54 A;  4CGG A;  2HNY A;  2ZE2 A;  1REV A;  3K58 A;  4K8Z A;  4N47 A;  4Z4I A;  4DSL A;  4AH9 A;  2IS3 A;  2LSN A;  5T7B A;  3HXM A;  3MXI A;  1RT6 A;  3K5M A;  4M3Y A;  1VSD A;  3AA2 A;  3SQ2 A;  3OYF A;  2QKK A;  2DFF A;  1X1P A;  1EET A;  3ASM A;  1EX4 A;  5KGX A;  4DTX A;  4C8O A;  2JGU A;  3LAK A;  1BQN A;  3HPO A;  4FJH A;  3KLG A;  3L3U A;  4RW6 A;  3WNH A;  3CM6 A;  3ZSX A;  1NK9 A;  2G8I A;  2OPR A;  1WAJ A;  3ZSY A;  1CXQ A;  4KTW A;  4W5T A;  4C8K A;  4DQQ A;  1W0H A;  3OYC A;  3DRR A;  3LPT A;  4OJR A;  1S1U A;  4QAG A;  4B9V A;  1Q9X A;  1JLC A;  4M3W A;  1XHZ A;  4NCB A;  3V1Q A;  4C8L A;  1TAQ A;  3H08 A;  4L8R B;  4I2P A;  1BIS A;  1JXB A;  3MEE A;  4IG0 A;  3CM5 A;  2QXF A;  4I9L A;  4Z4C A;  1WNS A;  3NDK A;  1RTD A;  4E7H A;  3NAE A;  3ZT4 A;  1SUQ A;  4W5O A;  3G0Z A;  3LAN A;  4KTZ A;  2I5J A;  1RT1 A;  5FDL A;  2HVI A;  3SUQ A;  1U48 A;  4CJQ A;  1C0M A;  4OKJ A;  4Z0U A;  4C8N A;  3V1R A;  4EP4 A;  3O3G A;  3RRH A;  5J2M A;  3U6F A;  1T7P A;  3RR7 A;  3VQP A;  1WAF A;  3AA4 A;  5KGW A;  4CEE A;  3TR8 A;  4KV8 A;  3AVH A;  3RTV A;  4KRE A;  4LSN A;  3VQA A;  4PY5 A;  2HB5 A;  5HRN A;  4E7I A;  3KK3 A;  1S1W A;  3M8S A;  4F3O A;  3B6O A;  1RDC A;  4J2E A;  2X74 A;  4CFC A;  4XIU A;  3KK2 A;  1VRT A;  1A5V A;  4CEA A;  3PX0 A;  4CIF A;  2A1R A;  2HMI A;  1U4B A;  3DLG A;  4O55 A;  3AVK A;  5I3U A;  4FJL A;  3P83 D;  1BGX T;  3LAM A;  3OYM A;  3MAQ A;  3IAY A;  1S1X A;  2XY7 A;  4FJN A;  2G8W A;  3C94 A;  4KHQ A;  5FRN A;  3DM2 A;  2HHV A;  2FC0 A;  4B3O A;  4G1Q A;  4LSL A;  3T1A A;  4DFJ A;  4F4K A;  4CE9 A;  4F3T A;  2RF2 A;  1ZBI A;  1T03 A;  2Z1I A;  4DG1 A;  3ULD A;  4OPJ A;  1IG9 A;  4YNQ A;  4Z4E A;  3QIN A;  4HTU A;  4FM0 A;  1R0A A;  3MXM A;  5HLF A;  3VQB A;  1RT4 A;  1D9F A;  2O4G A;  3F73 A;  4DSF A;  2ZQB A;  4RG8 A;  1QTM A;  4C8M A;  4J2D A;  4FK0 A;  4KB0 A;  2OPS A;  3PX6 A;  4CED A;  4FM1 A;  4FJK A;  3HP6 A;  1HPZ A;  3NF7 A;  1A5X A;  3VQC A;  1QQC A;  3O4Q A;  1KLM A;  3SUP A;  2PZS A;  2IDO A;  1CZ9 A;  3AA3 A;  2BDP A;  2HW3 A;  4I7F A;  4NCA A;  3KJV A;  3DLH A;  4AHU A;  4FK2 A;  1B9F A;  3AO5 A;  2BE2 A;  4IBN A;  5HBM A;  2Z1H A;  3L2W A;  3HVR A;  4I9Q A;  4HHT A;  3NGY A;  2G8H A;  4QCL A;  4JS5 A;  4FLW A;  4BDY A;  2Z1J A;  2OYQ A;  4K8X A;  4OGE A;  1WSF A;  4E1N A;  3L2Q A;  3AVB A;  1CZB A;  2DFH A;  2G8F A;  2HHX A;  4CK2 A;  3L2V A;  1WSG A;  1RBV A;  3TAP A;  2HHW A;  4CHO A;  3KD5 E;  1TKX A;  1U04 A;  4CEZ A;  3CG7 A;  1S9G A;  5J2N A;  3IS9 A;  1ZBF A;  1WLJ A;  4M3T A;  4DS5 A;  2DY4 A;  1C6V A;  3IRX A;  3KKR A;  2XY8 A;  1KCF A;  2Z1G A;  3KLI A;  4CK1 A;  1RCH A;  4FW2 A;  4HVJ A;  4OVL A;  3OYA A;  3SZ2 A;  2A1S A;  4CEB A;  1LW0 A;  3LP3 A;  1C1C A;  2XO7 A;  4KI6 A;  3MXJ A;  4CEF A;  1EKE A;  3OYN A;  3SUO A;  4Z4G A;  3CFP A;  2HHU A;  1HNV A;  1TL1 A;  3PUF A;  3VQE A;  1YVU A;  2WON A;  1BIZ A;  1JLQ A;  4KO0 A;  1SKW A;  5J2Q A;  1YTU A;  4J2A A;  2D0A A;  4CGF A;  4CJW A;  1NK8 A;  2F8S A;  4KHS A;  3U3G A;  4LH4 A;  1HQU A;  2F96 A;  5DMR A;  3L3V A;  4CGI A;  4E3S A;  1J5O A;  4AHT A;  4CEC A;  2YKN A;  3ZSQ A;  4CJ4 A;  3NCI A;  3NBP A;  2KFZ A;  1RT5 A;  4Q5V A;  3CYM A;  2DTU A;  4FYD A;  3NFA A;  3HYF A;  4DLE A;  4BE1 A;  3QEW A;  1YTA A;  1DTT A;  4E7K A;  3FFI A;  2P5O A;  4CJR A;  3NHG A;  1XHX A;  5HRS A;  3NGI A;  2VWJ A;  1TKD A;  3TAR A;  3K5N A;  1HYS A;  3UIQ A;  3NH0 A;  1JKH A;  1UOC A;  1SL2 A;  3VQ5 A;  3K2P A;  4LY7 A;  3VQD A;  4CES A;  3SQ0 A;  3OVN A;  2O4I A;  1L3S A;  2Y1J A;  2GV9 A;  1RBS A;  1Y97 A;  4FLX A;  3VA3 A;  4M3Z A;  4Q0B A;  4NCG A;  4RW4 A;  2JLE A;  1YT3 A;  4O5B A;  2NUB A;  3WNE A;  4QOZ B;  4OLB A;  2RPI A;  3OS1 A;  1T8E A;  3AO4 A;  3D45 A;  1SV5 A;  4F2S A;  4FJ8 A;  1MU2 A;  2QKB A;  2RN2 A;  1B92 A;  1S5J A;  1HYV A;  1NK6 A;  3V9U A;  4KTQ A;  4FK4 A;  2PYL A;  4KPY A;  1VK0 A;  2VWK A;  3KLH A;  3I0S A;  1X9S A;  1Q9Y A;  4O44 A;  4UQG A;  1IKW A;  2D0C A;  1UWB A;  2D0B A;  4CFB A;  4DF4 A;  4CCH A;  4FJ7 A;  4CHY A;  3I0R A;  1Z25 A;  3OYD A;  3OJS A;  3I8D A;  3V9Z A;  3NGZ A;  1NK7 A;  4FZX C;  2HVH A;  4CJT A;  3AVL A;  4CIE A;  1BHL A;  2FBT A;  3PO5 A;  1TK5 A;  4HCC A;  4KRF A;  3NF8 A;  2HHQ A;  3HPG A;  1QSY A;  1WSI A;  3L2U A;  3NF6 A;  2KW4 A;  4R5P A;  1KVC A;  4ZTF A;  4DTR A;  3LAL A;  1CLQ A;  4Z4H A;  3AO1 A;  1RTI A;  4AHC A;  3O3H A;  2RKI A;  3DRS A;  3OYH A;  4FLT A;  2GBZ A;  1QSL A;  1NKB A;  1HQE A;  1VSK A;  2IGI A;  4CJE A;  4CJK A;  3QEI A;  4FJI A;  4CK3 A;  4DU1 A;  3HT3 A;  1C0T A;  5HP1 A;  4M42 A;  3SV4 A;  3M8R A;  1K6Y A;  3QIP A;  3A2F A;  2YNH A;  2BAN A;  4RW9 A;  4DTP A;  2G8V A;  1BCM A;  4FJG A;  1VSE A;  4DTO A;  2OPQ A;  1ZBL A;  3AVN A;  2P5G A;  1QS4 A;  3O3F A;  4FLZ A;  3SPZ A;  1QE1 A;  4CFA A;  4CGJ A;  2P1J A;  3CFR A;  4CF8 A;  3PY8 A;  4ELV A;  3VQ4 A;  3QEP A;  4FJ5 A;  1RBT A;  1TVR A;  1WSJ A;  4IFY A;  2FBX A;  4KFB A;  4W5Q A;  1C1A A;  4B9U A;  2YKM A;  2IC3 A;  1RT7 A;  3JYT A;  1RNH A;  4LH5 A;  3ZT1 A;  3NH1 A;  4FLU A;  2G8U A;  3V9S A;  3HO1 A;  4OKE A;  1B9D A;  3K5O A;  4CJL A;  4DQI A;  3VQ9 A;  3HVT A;  1TKT A;  4E7L A;  4CF2 A;  3WNG A;  5HRR A;  1BQM A;  1NK0 A;  2IAJ A;  2YNG A;  1NJW A;  2E6M A;  4AHV A;  3D0P A;  2VG7 A;  4DFM A;  2YHB A;  1FKO A;  4HUF A;  2ETJ A;  3KLE A;  2KFN A;  5HRP A;  4BDP A;  2DFE A;  4ELU A;  3MEC A;  4M45 A;  4WE1 A;  4KI4 A;  1SKR A;  1LV5 A;  4CF1 A;  2YNI A;  1SL1 A;  1N6Q A;  3SV3 A;  4FCY A;  4DTS A;  3PV8 A;  1SKS A;  2OZS A;  4PUO A;  3OYL A;  1LWE A;  1RDD A;  1U49 A;  4KKO A;  1KTQ A;  4CJP A;  2VG6 A;  3QEX A;  2R7Y A;  1RIL A;  4HUE A;  4LD0 A;  3PO4 A;  4KHN A;  3KIO A;  1NOY A;  1J53 A;  3ZSW A;  4CHQ A;  1TKZ A;  3S3M A;  4DWI A;  3QNN A;  3AO3 A;  4DSE A;  1Z26 A;  4ID5 A;  4CGH A;  5J2P A;  3KD1 E;  2VG5 A;  5D3G A;  3ZSR A;  2X6S A;  4OGC A;  3CFO A;  1JXE A;  1TV6 A;  1HJR A;  3ALY A;  3AV9 A;  5C42 A;  4CJU A;  5KRT A;  3KTQ A;  4ZTJ A;  4CF0 A;  4F2R A;  1QHT A;  3SI6 A;  3RRG A;  4ID1 A;  3K5L A;  4O0J A;  3T19 A;  3K59 A;  4FM2 A;  1RTH A;  1S6Q A;  3TAE A;  1U45 A;  3DLB A;  4B9N A;  4EZ9 A;  5FRM A;  3V1O A;  2XHB A;  3VN5 A;  4FJ9 A;  1FXX A;  5KRS A;  3AVF A;  2KZM A;  3CQ8 A;  4IG3 A;  5K14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...