2G8KA

B. halodurans rnase h catalytic domain d192n mutant in complex with ca2+ and rna/dna hybrid (non-p nick at the active site)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
136
structure length
136
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKANYGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*UP*CP*GP*AP*CP*A)-3'
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 42
structure length 136
sequence length 136
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8kA00
4CF1A 4DTRA 2BGGA 4B8CA 4O4GA 3OS2A 5EU7A 3AVKA 4LH5A 1JKHA 4WE1A 3U6FA 5D3GA 4FLUA 4CEAA 4M42A 1N6QA 3TAGA 3PUFA 4QCLA 3VQEA 1J54A 1L3TA 1IKVA 3HVTA 4CEQA 4HVJA 2PY5A 1RTDA 1S9GA 1RBSA 5CZ2A 3O3GA 3LP3A 4MFBA 3OYDA 2YKNA 2ZE2A 3L2WA 4EP5A 3QETA 3TAPA 4EZ6A 4KB0A 4F3OA 3I0RA 2BANA 1RDAA 2B6AA 4RW7A 4FLXA 5HLFA 1U49A 3KK2A 1S5JA 3RMBA 1KSPA 4KHQA 4Z4CA 4F2SA 3AA5X 4CJEA 4ZTFA 4FK0A 4NCGA 4CIGA 1XWLA 2VWKA 3OYCA 4BDZA 1A5VA 1BL3A 3K5LA 3PX0A 1HRHA 4W5OA 1RDDA 2XY8A 3KKSA 3LANA 4FJ5A 3D45A 3RR7A 3O4QA 4FZXC 1J53A 1TAUA 3M8PA 3MXJA 3AVFA 2IOCA 2D5RA 2E4LA 5KRTA 3S3MA 1NK8A 4N76A 1RT7A 4FM2A 4RW4A 3TANA 1BCMA 2YNFA 4N41A 2B5JA 3U3GA 3NH2A 5J2PA 2YKMA 5KGXA 4M3RA 1KFSA 4DFPA 1KVBA 3AO4A 1BISA 1RBVA 2GUIA 2I5JA 4EP4A 1NJWA 3TAEA 1U45A 3KLHA 3AA2A 2F8SA 5KRSA 4MQ3A 3VQ5A 3LP1A 4I7FA 1T7PA 3F73A 1RT6A 1S1UA 3P1GA 4CIFA 2Z1JA 2ETJA 4CJKA 4N5SA 3KLGA 3TAFA 3SQ2A 3L3VA 1JLCA 1RBRA 3F9KA 4DFJA 3ULDA 1IH7A 3BDPA 4I9LA 3OJUA 3MAQA 1KVCA 4KV8A 4CJ4A 4N47A 3C95A 5J2NA 3DLHA 1SKWA 4PQUA 4IFVA 5T7BA 3ALYA 1L5UA 3IAYA 4Q0BA 4BWJA 4HCCA 3K57A 4IDKA 2HVIA 4CK2A 2HVHA 2D0AA 3VQAA 1TKTA 3C6UA 1RTHA 1ASVA 2HB5A 3DLKA 3ZSZA 1HQUA 4BDYA 1SKSA 1BQNA 4CHNA 1TK0A 5J2MA 1G15A 1MU2A 3NAEA 1WLJA 4O55A 4C8NA 1JXEA 4H4OA 4HTUA 4CF0A 4R5PA 4CESA 3OYAA 5C24A 4IG0A 3NH1A 4DQIA 3V1RA 1LWEA 4B9MA 1FKPA 1KLMA 1RNHA 2ZQBA 1RCHA 4KTQA 5CY4A 1RT4A 4CFBA 3TR8A 4CHZA 4HUFA 2A1RA 1FK9A 4W5QA 2OPRA 1JL1A 4CFAA 4OKEA 3JYTA 3MEGA 1CZBA 3S9HA 1IKWA 4Z4HA 4E7JA 2IS3A 4EZ9A 4DMNA 3SUNA 3OS1A 4BACA 4FJ8A 3SCXA 3LPUA 1WAFA 2XRIA 4CGIA 4DG1A 3ZT0A 1GOAA 4ICLA 4DF8A 1NKBA 3AVBA 4E3SA 1NK6A 4N56A 2XY5A 4CHOA 3ASMA 4IG3A 4IFYA 4Z4FA 2KFNA 1S6PA 4H8KA 3TWHA 4PWDA 5HRRA 3VQCA 4CK1A 1U04A 3OYJA 1WN7A 4TSXA 3QEVA 4RW6A 5DMRA 3HL8A 3MXMA 2OZSA 4M45A 3HP6A 3EZ5A 2D0CA 1WSHA 4OKKA 4FYDA 2NUBA 1LW2A 2XO7A 4FM1A 2PZSA 2KFZA 5KGWA 3DLRA 4KRFA 3O3HA 3T3FA 2PYLA 4BE1A 2KZMA 1QSLA 4KHUA 1TK5A 2QXFA 4CEZA 2Y1IA 4DTPA 1WSGA 3THVA 4W5RA 3OY9A 1HPZA 3AO3A 4DFKA 3EY1A 4B9LA 3LWLA 1JL2A 1ASUA 3AO2A 4FVMA 4CJ3A 5CYMA 1RT3A 1JLAA 4KTZA 2BE2A 1VSKA 4CCHA 1A5XA 4KREA 2RPIA 2IC3A 4BDPA 4BWMA 4E19A 3PO4A 3PV8A 2DFHA 4CEEA 4J2BA 2RN2A 1BIUA 4ELTA 1ZBFA 3B6OA 3L2VA 1D9FA 3SQ4A 3U3YA 3AVJA 1WSIA 2O4GA 3IRXA 3VA3A 4KAZA 1F21A 4AHVA 1HQEA 3E01A 5SZTA 1TL3A 2P5OA 4CF9A 2HNYA 4BE0A 1UA0A 3OVNA 4DTNA 2YNHA 4CERA 1BQMA 2G8UA 3CG7A 3HXMA 1SKRA 3K5MA 1S9EA 3O4NA 1DLOA 5HRNA 1S6QA 1NKEA 3C6TA 1LAWA 4FJLA 4KHYA 1HMVA 2FBVA 3AVLA 3DLGA 2D0BA 1XHXA 4AHCA 3DOKA 3RWUA 3K2PA 3P5JA 2Z1GA 4KTWA 1HJRA 3HPHA 3ZCMA 3OS0A 3SJJA 2OA8A 2G8FA 4Y1DA 4DTXA 4E89A 4GVMA 4CF8A 1D9DA 1W0HA 1KRPA 4M3ZA 1J9AA 3V9SA 3OYIA 3L2QA 4NCBA 3TAMA 1D8YA 2HMIA 4B9VA 1VRUA 3ITHA 1CXUA 2YNGA 2GV9A 4F8RA 1C6VA 5KTQA 1ITGA 3HP9A 3LPTA 3AVIA 1HYVA 3UIQA 3AVAA 4UQGA 4FJNA 3M8RA 3V1QA 2VWJA 2Y1JA 3HM9A 3SV3A 3SI6A 1VRTA 3WNGA 4DSFA 2G8IA 3HVRA 1Z25A 5HRPA 3WNHA 4DTOA 3SPYA 2RF2A 3MECA 3NF9A 4AHRA 3M8SA 3QINA 3OYKA 3VQ7A 3RRHA 1TK8A 5J1EA 4FK2A 4FZZA 1SL0A 2HHVA 3V9ZA 3BGRA 1HNIA 1VSFA 4KKOA 5FDLA 4YFUA 4OLBA 1KTQA 5CYQA 1TV6A 4DU4A 3LZIA 2X6SA 3OYLA 3P83D 3KK3A 3CFPA 3SQ0A 2DFFA 1NK9A 1KLNA 3DMJA 1U4BA 3O3FA 1NOYA 3CFRA 5FROA 3WNEA 3ZSWA 1D5AA 5JS1A 4OKJA 1VSJA 2WOMA 3LAMA 3I8DA 1C0MA 2FBYA 3KD5E 4B9TA 1C1CA 4ELVA 3KLIA 2G8VA 2YHAA 4CEOA 4DLEA 4FJXA 2KTQA 3I0SA 4O44A 2DTUA 3AO5A 4CGFA 1S1WA 4LD0A 3AVGA 1U48A 3G0ZA 3TI0A 2HHUA 3CQ8A 3HK2A 3OYBA 2IAJA 3V4IA 5SWMA 4JRQA 4Z4IA 3QNOA 4E1NA 2G8WA 4CGGA 2DFEA 1X1PA 5DK5A 4B3OA 1TVRA 3NFAA 4CE9A 2G8HA 1NK7A 4DSJA 1CXQA 4KFBA 4Z0UA 4DTJA 4DS4A 4Y1CA 1TL1A 3QEWA 1X9MA 3TARA 2G8KA 1L3SA 1S1VA 2FBTA 3K5OA 4CF2A 2OPSA 1U47A 1T8EA 2HHQA 2X74A 3L2RA 1BI4B 4Z4GA 4F3TA 2ZD1A 1EX4A 4IKFA 1NOZA 4CHQA 1FKOA 3T19A 1C1BA 1RDCA 3OYFA 1ZBLA 1NJXA 1N5YA 1VSHA 1VSIA 3WNFA 5I3UA 2E6LA 1HYSA 2R7YA 2VG5A 5HROA 2HNDA 4C8MA 3NH0A 4OGCA 4CJSA 2XY7A 1IKYA 3KIOA 4FZYA 3DYAA 1Z26A 4E7IA 3RTVA 1X9WA 1UOCA 3QIOA 4DU1A 4M3UA 4CECA 4XIUA 1XI1A 4CGDA 1RT2A 3AVNA 4F2RA 4M3XA 3QEIA 3KKRA 4L8RB 3DM2A 4DSIA 3G10A 4DTUA 4FM0A 1EETA 4DWIA 1BI4A 1Q9XA 3DLBA 1WAJA 4DU3A 1XC9A 3LP0A 1EKEA 4Z4EA 1YT3A 5C25A 5HRSA 3NGZA 5C42A 1EP4A 1VSMA 1C0UA 4FK4A 2OPPA 4O0JA 3AO1A 1T05A 1KCFA 3NF7A 4CJUA 4E1MA 3AA4A 5HBMA 4KB1A 3FFIA 1HYZA 5CZ1A 4QAGA 2B4JA 3OYHA 2F8TA 4LSNA 1VK0A 4RW8A 2QK9A 4FJJA 3JSMA 1UA1A 3RMCA 3CM5A 2EHGA 1FXXA 1QE1A 1TKZA 4E7LA 5I42A 1RT1A 2P51A 4FCYA 3SNNA 1NJZA 4C8LA 3TABA 1LAVA 1B9FA 3LALA 3QNNA 3ZSRA 1EXQA 3SUQA 3AV9A 3H08A 3DRSA 5J2QA 4CHPA 3SUPA 3LZJA 2JLEA 2BDPA 3NDKA 4CEBA 3HJFA 2KQ2A 1UWBA 2ITGA 3NGYA 4JLHA 3ZSYA 2EX3A 3V81A 3A2FA 1O1WA 2HNZA 3QESA 3KD1E 4CJRA 1R0AA 1DTQA 1HNVA 1WSFA 3SPZA 4B9NA 4KI4A 1L3VA 3DRPA 1RT5A 3OYMA 1VSLA 3RR8A 1Y97A 4AILC 4OJRA 4HUEA 1KFDA 1GOCA 4FW1A 2WONA 4FJIA 3MEEA 1JLFA 2P1JA 3K59A 4CJ5A 4FLYA 4PUOA 4I2QA 4HUGA 3LWMA 1WSEA 1L3UA 3IS9A 3C94A 4I2PA 1XHZA 2VG7A 3VQBA 1NJYA 4C8KA 4M41A 4CJPA 4OPJA 4DLGA 3KLFA 1A5WA 4CK3A 4NYNA 4KO0A 4B9UA 1QSYA 4M3WA 2W42A 1LW0A 3SV4A 3NF8A 4W5TA 1T03A 4HCBA 3KJVA 3V9WA 1TKDA 2FC0A 4DTMA 1JLQA 4KPYA 2HHWA 4AHTA 2E6MA 4CJVA 2VG6A 3SQ1A 4HHTA 3SUOA 1NKCA 3PX4A 5K14A 3B6PA 1BIZA 3MXIA 3TAQA 4Q5VA 3V6DA 1IKXA 1J5OA 1SV5A 4DF4A 4JS4A 1C0TA 1I3AA 5E41A 4ZHRA 2DY4A 1REVA 3AVCA 1QQCA 3OJSA 3L2UA 3T1AA 1QSSA 4QOZB 1RBTA 2OPQA 4JRPA 3HSTB 3RRGA 2LSNA 4DSKA 1RTJA 1RTIA 4KHWA 1ZBHA 2HHTA 1QTMA 3ZT2A 1QS4A 2A1SA 3CYMA 1DTTA 4OGEA 3KK1A 1ZYQA 4RW9A 4DQRA 3NF6A 4LSLA 2YHBA 1SL1A 3IG1A 3QERA 3ZT3A 4B08A 4ID5A 1SL2A 2OZMA 4FLZA 3ZT1A 2Q3SA 3QEXA 4AHUA 3MEDA 3EYZA 1SUQA 4ZTJA 2P5GA 4K8XA 1CLQA 3AVMA 4M3TA 3CFOA 3M8QA 3VQ9A 4NYFA 3LP2A 2IGIA 1IO2A 4DQQA 2X78A 3HPGA 1CZ9A 4DTSA 2QKBA 4DSEA 1NK4A 3ZSXA 3VQ6A 3ZSOA 4CEDA 1JXBA 3DRRA 3NGIA 3S3NA 2F96A 3V9UA 3RMDA 1NK5A 1NK0A 1S1XA 4CJWA 4YNQA 3NBPA 3K58A 2AJQA 4FLWA 2JGUA 4CGJA 2YV0X 2GBZA 4FJMA 4M3YA 1I39A 4B9SA 3CM6A 3PY8A 4CJQA 3AA3A 4LH4A 3QO9A 3VQDA 4ELUA 4FJ9A 4LY7A 1WSJA 2Z1IA 4G1QA 4FJ7A 4DSLA 4PA1A 4KHSA 2HHXA 4CJFA 2YNIA 1BGXT 2Z1HA 4O0IA 1YTUA 1JLGA 1YVUA 1JLEA 1VSEA 4H4MA 5FRNA 1KVAA 1VSDA 3DOLA 3V1OA 2OYQA 4CEFA 4IBNA 1S1TA 5KI6A 4W5NA 3PX6A 4K8ZA 1W9HA 3VQ8A 3HPOA 3SYZA 3PO5A 4FLTA 3ZSQA 3OYNA 1RDBA 2FBXA 1B92A 4KI6A 4FXDA 3D0PA 4GMJB 3HYFA 3LDSA 4PY5A 1LV5A 2RKIA 4OVLA 3VQ4A 1RBUA 4E0DA 4J2EA 3KLEA 1ZBIA 4O5BA 4KHNA 1LWCA 1X9SA 4DFMA 1RILA 4E7KA 2KZZA 3VA0A 4J2AA 4CIEA 2XY6A 1GOBA 1BHLA 3NHGA 4OPKA 4RG8A 3VN5A 3KTQA 4F4KA 1Q9YA 5JS2A 3HT3A 4DS5A 2X6NA 4FW2A 3SZ2A 4ID1A 1TAQA 1JLBA 3NE6A 1TGOA 3QLHA 4GW6A 1QHTA 3L3UA 4C8OA 3QIPA 4OLAA 4B8AB 4JS5A 1ZBUA 4CJTA 2XHBA 4CFDA 4DQPA 3DI6A 1LWFA 1TKXA 2PYJA 4FJHA 1ASWA 4FLVA 2KW4A 3OYGA 4CJLA 4I9QA 3DLEA 3ZT4A 3ZSVA 3V9XA 4BE2A 4CGHA 4NCAA 2HHSA 1IG9A 3VQQA 3RMAA 3AVHA 1K6YA 4CFCA 2ATQA 4CHYA 3QEPA 4AH9A 5HP1A 3NCIA 4FJKA 2O4IA 1B9DA 2HW3A 1UAXA 1YTAA 4DQSA 1BCOA 1C1AA 3L8BA 3S3OA 3HO1A 3VQPA 3OYEA 3ISNC 4AHSA 4J2DA 4E7HA 1Q8IA 2QKKA 5FRMA 4FJGA 3K5NA 2IDOA 3LAKA 1WNSA
chains in the Genus database with same CATH superfamily
1NWKA 4CF1A 4DTRA 3OS2A 3U6FA 4FPBA 3PUFA 3VQEA 1J54A 3HVTA 2PY5A 2W40A 1RTDA 3VESA 3O3GA 4KB0A 2OCEA 1HKBA 3AARA 2B6AA 3KK2A 1P90A 4F2SA 1NGAA 2PAVA 3THYB 5EOYA 2QA4N 1ATSA 1BL3A 3PX0A 1KAZA 3K9KA 3CCMN 4DR6K 1RDDA 3WXJA 2BTFA 3D45A 1BDGA 4FZXC 4IEIA 5M1QA 2D5RA 2E4LA 3S3MA 1TUYA 3FZHA 4DUYK 3O8MA 1RBVA 2ITMA 3TAEA 3KLHA 3AA2A 3THYA 2ZJPL 3LL3A 3VQ5A 3KLGA 1RBRA 3F9KA 3BDPA 2VWBA 4I9LA 3DXMB 1KVCA 3U9ZA 4CJ4A 4N47A 5J2NA 4PQUA 1K8AO 3ALYA 1L5UA 4NXNK 2HVIA 4CK2A 1SS6A 4BC2A 2D0AA 1GLLO 2GUPA 2HB5A 3DLKA 1SKSA 1HQUA 4CHNA 4WYBA 3NAEA 4C8NA 5KPTA 3CQYA 3I55N 3OYAA 5C24A 1G99A 3L6QA 4YOXA 3WXIA 1KLMA 1RNHA 2HSTA 2NNWA 2A1RA 2OPRA 2QWLA 4OKEA 3J7AP 1CZBA 5DM7L 4WQ4A 4E7JA 3OW2M 4EZ9A 5A2QO 3SUNA 3LPUA 2XRIA 4DG1A 1NK6A 4FWSA 5LMUK 3ASMA 1YI2N 5AQOA 4H8KA 3TWHA 3MDQA 5HRRA 3VQCA 1U04A 4TSXA 3HL8A 3QMLA 3HP6A 1HNXK 4FYDA 3WXMB 3ZX3A 3O3HA 2PYLA 4BE1A 2KZMA 2I7PA 4KHUA 3FZFA 3EN9A 5TKWA 4BRLA 1X3MA 1ASUA 4FVMA 3HI0A 4WQ4C 4KREA 2IC3A 1XQSC 4E19A 4A2BA 1ZBFA 3B6OA 5FPNA 4Z94A 3AVJA 1WSIA 3VA3A 1F21A 3TTDA 4JK9A 3P39A 1X9JA 2HNYA 4BE0A 1WB9A 3OVNA 4DTNA 4CZKA 4M7XA 3DXKB 4BQZA 4GVEA 1WOQA 1QVGM 1DLOA 3GE1A 1QQNA 1S6QA 4KHYA 5BRFA 3G25A 3P5JA 3K2PA 3HPHA 3OS0A 4DR7K 4DTXA 4E89A 3T1HK 4M3ZA 1J9AA 3C6AA 4NCBA 5AQKA 1Q82O 1D8YA 4B9VA 1VRUA 1CXUA 3VF2A 3DWLA 3GBTA 2UUBK 4A62A 3HZ6A 3V1QA 4H5NA 2Y1JA 2A41A 1IBMK 3SV3A 3VERA 5HRPA 1LCUA 2UU9K 3MECA 1I94K 1HX1A 4IDHA 3VQ7A 4FZZA 5M1OA 3U9DA 3EZWA 3S41A 1HNIA 2H3GX 5ELZA 4CBWA 4YFUA 4A59A 1KTQA 1TV6A 4BC3A 1BWFO 4ILGB 1U4BA 1NOYA 3O3FA 5H1SQ 5FROA 1D5AA 3U4LA 1VHXA 4V19S 5BRHA 4ELVA 4B1ZA 2A5XA 4JI0K 4CGFA 1S1WA 3THXB 4FO0A 3FE1A 2V52B 3OYBA 4BRCA 2IAJA 3CXCM 5SWMA 4LF4K 4Z4IA 4CBXA 4E1NA 2G8WA 4PHTX 1Q86O 3VEYA 2D4WA 1O13A 1TVRA 2VQEK 4B1UB 4DSJA 4F8RA 1CXQA 4GV6A 3QEWA 4DS4A 2G8KA 1S1VA 1YJNN 2OPSA 1U47A 2HHQA 4JV5K 4F3TA 1EX4A 1NOZA 4GNIA 5GINA 1C1BA 3OYFA 1NJXA 5AQXA 4FWQA 1VSIA 3WNFA 2E6LA 2NRWA 4YOWA 2VGNA 3O9QA 1YITN 2HNDA 4BR2A 3NH0A 4C1NI 4FWLA 3KIOA 2V51B 1ATRA 2IVNA 5JICA 4DV7K 4CECA 1RT2A 4M3XA 5BN9A 4L3QA 3G10A 3UE5A 1WAJA 1XC9A 3LP0A 2E1YA 3UKUA 4BVOA 1C0UA 2E5LK 3E9LA 4BVPA 3CCLN 4E1MA 2BH1A 3AA4A 1HYZA 4BG8A 3HRGA 3H46O 3PSFA 3O80A 3F2KA 3CM5A 4B3SK 1NM1A 5E26A 4E7LA 1RT1A 2P51A 4U7BA 3LALA 3QNNA 3ZSRA 2D1KA 3AV9A 3H08A 1OVYA 5AQUA 4CEBA 3HJFA 3H1VX 1UWBA 1VAZA 2ITGA 3NGYA 3VOVA 5AFUA 3IMXA 2D0OA 1WSFA 4B9NA 1BG3A 3CC2N 1OKJA 4HUEA 1JCEA 3SBGA 1KAYA 2HBKA 2P9IB 3MEEA 3K59A 4FLYA 4PUOA 4JKAA 4JHDB 1L3UA 4HUGA 1C0FA 3C94A 1XHZA 1K73O 1NJYA 4XEIA 3TPQA 4NYNA 3O9TA 1LW0A 4HCBA 3V9WA 1IG8A 5AQZA 2HHWA 2FLOA 1K9MO 4YOUA 5FPDA 4IOCL 2P9IA 4Q5VA 5GADP 4JHDA 3IKMA 2DY4A 3AVCA 1ZBSA 3KK7A 4LF9K 3IDHA 2BUPA 1NGJA 2ZGYA 4PKIA 4DSKA 4JD2B 3ZT2A 4K43A 2PBDA 4DQRA 3NF6A 3IG1A 4WF9L 3CJ1A 3TTFA 3ZT3A 3QERA 4ID5A 1SL2A 2OZMA 5FPMA 4JI3K 3ZT1A 3MEDA 2P5GA 3PIOL 4YDUC 3AVMA 4M7YA 1W2BM 1IO2A 2X78A 3FR0A 1CZ9A 4GV3A 3ZSOA 3VENA 4H0OA 2F96A 5AQTA 4H5RA 1DGKN 3CI5A 1S1XA 2GBZA 4JD2A 2A6AA 3PY8A 3ID8A 4FJ9A 3BF1A 2HHXA 2E20A 2YNIA 3LDPA 1JLGA 3L4QA 1YVUA 5JVHL 4H4MA 3V1OA 2OYQA 4CEFA 2CGLA 5KI6A 3PX6A 4K8ZA 3PO5A 4FXDA 3ZSQA 4CD3A 5F2RA 1LV5A 2RKIA 3P4IA 3VQ4A 1RBUA 2F4VK 4O5BA 1WUAA 4KHNA 4DFMA 1VQMN 4J2AA 2CH6A 1GOBA 3VN5A 4FW2A 1RDWX 4DHYA 3QLHA 4GW6A 1QHTA 2ZF5O 3QIPA 4B3RK 5AQSA 1TKXA 4BRPA 1U6ZA 4FSVA 3OYGA 3ZSVA 1T6DA 1U2VB 3O1WA 4JKCA 4CGHA 1NGBA 3RMAA 5HP1A 1B9DA 4U67L 3CJ9A 3UKRB 3S3OA 2V7ZA 4BRIA 4J2DA 3QFUA 4H03B 4DV4K 2QEXN 1XNQK 2IIRA 4QS7A 3OYDA 3LDNA 5CHIA 1WNSA 4DV1K 4B8CA 4O4GA 4LH5A 4WE1A 5D3GA 3CJBA 3M3ZA 4HVJA 3FFKB 4CEQA 1S9GA 5TKYA 2UXDK 5I42A 4EZ6A 3L2WA 3TAPA 3AAPA 1VQPN 1YJWN 3E9OA 1U2VA 2BANA 1RDAA 4FLXA 1KSPA 4A5AA 3AA5X 3BZKA 4FK0A 4NCGA 3VETA 3OYCA 4BDZA 1HRHA 4W5OA 4FJ5A 3SAHA 1NG9A 3RR7A 3E9PA 2DPNA 1TAUA 3BY5A 3M8PA 2IOCA 5KRTA 3D6RA 4RW4A 4FOIA 4IOXA 1NGGA 5KGXA 4WFNL 4FWKA 4DFPA 1KFSA 4JYAK 3AO4A 1BISA 2GUIA 4EP4A 5KPZA 1T7PA 4MQ3A 2HBMA 4I7FA 3VEXA 5HOOA 1RT6A 1S1UA 4CIFA 4JKEA 2Z1JA 4N5SA 1OH7A 3P38A 3TSUA 3TSQA 1JLCA 2P9PB 1RFQA 4BQLA 3OJUA 3C95A 1SKWA 1K8KA 4IFVA 3CJCA 5T7BA 3H45C 4FWMA 3QFPA 4HCCA 4IDKA 3EEQA 1TKTA 3C6UA 2QXLA 1RTHA 5AZIB 3VF6A 4I6MA 2KLAA 3M1FA 5J2MA 1WLJA 4K0KK 2IVPA 1GLFO 4HTUA 2O8CB 1YXQA 3N4QA 3Q7CA 1JJ2M 2ZQBA 1RCHA 4CFBA 3CCEN 1OH5A 4X65K 3JYTA 3MEGA 4X62K 5AZIA 4FJ8A 3SCXA 1IBKK 4CHOA 4A57A 4Z4FA 2KFNA 4MO5A 2YI1A 4PWDA 3KWGA 4CK1A 1WN7A 1DKGD 4RW6A 3EZ5A 2D0CA 4OKKA 4PL7A 3VPZA 1EQYA 3FGUA 3A5MC 4KRFA 3DLRA 3T3FA 2A42A 4DTPA 1WSGA 1HPZA 3AO3A 3LWLA 5BPNA 4CJ3A 4A2AA 5CYMA 1VSKA 2E88A 4BWMA 3PV8A 2DFHA 2P9KB 4B3TK 2E2OA 3SQ4A 5AQPA 2O4GA 4MO4A 3CHWA 1BA1A 3E01A 4BC5A 1TL3A 4CF9A 3K0SA 1UA0A 4JK8A 3EKSA 2G8UA 3ZYYX 1S9EA 2HHHK 1FJGK 1HMVA 4DQ8A 1XHXA 4AHCA 4BR4A 4BRHA 1YUWA 2Q36A 3ID6A 4KTWA 1HJRA 2HBLA 1NBWA 2E1ZA 5MLCQ 4O8KA 2FF6A 3SAGA 1D9DA 1KXPA 1W0HA 1HPMA 2QWMA 3L2QA 2EWSA 3TAMA 3CPEA 2P9KA 2HF4A 2JWKA 2YNGA 3I56N 5AQVA 1C6VA 3HP9A 2O8DB 5BRDA 1SZ2A 1HNZK 1WBDA 5GIPA 1WBBA 1BU6O 4UY8O 1VRTA 2WUSA 3WNGA 3HVRA 1Z25A 4DTOA 3M8SA 4AHRA 4GV9A 3ATVA 3RRHA 5J1EA 1SL0A 2HHVA 3V9ZA 1OVQA 3BGRA 4LFAK 5FDLA 4OLBA 3VEWA 4DU4A 1NK9A 3KK3A 1QZ6A 2DFFA 2E2NA 4JKGB 2O8DA 2NRZA 2QWNA 4OKJA 1ILYA 3I8DA 2FBYA 3KD5E 2G8VA 4CEOA 4O44A 4BR9A 3AVGA 2GEMA 1W7AA 5C0YA 3HK2A 1QZ5A 3PLAA 3NMUA 3V4IA 1ZXOA 5AQNA 1YIJN 4IOAL 4OX9K 1N33K 4B1VA 1X1PA 5DK5A 1EO1A 4CBUA 3GOIA 2G8HA 1Q81O 3DXMA 3K5OA 3LM2A 5BPLA 2ZD1A 2D0PA 5FPEA 1FKOA 4NXMK 1RDCA 1ZBLA 3M5RA 3CIPA 1N5YA 1VSHA 5I3UA 1IBLK 2R7YA 4OGCA 5F1XA 4FZYA 3DYAA 3QIOA 4DU1A 1BOTO 5AQYA 5AZJB 3AVNA 4F2RA 3KKRA 3DM2A 4DWIA 1Q9XA 4AF1A 1EKEA 2W6KA 3PSIA 5C42A 1EP4A 1VSMA 5M1FA 4FK4A 4ISGA 4CZEA 2QWPA 2A3ZA 1T05A 1KCFA 3OBYA 1RGIA 2E2PA 1XMQK 5GAGP 3OYHA 4FJJA 3O4WA 4H0VB 1XUPO 2EHGA 1FXXA 4CZGA 2YCHA 1XMOK 5LMNK 3MCPA 3TABA 1B9FA 1GLJO 5J2QA 3DRSA 4CHPA 3SUPA 4MLEA 3ZSYA 2FSNA 2EX3A 1O1WA 2HNZA 3QESA 4CJRA 1R0AA 5AQLA 3DRPA 1VSLA 1NGHA 4IXCA 2ASPA 2NRHA 2VYPA 3C7NB 3Q7BA 4WFBL 2P1JA 4CJ5A 4H0YB 2O8EB 2NRXA 3LWMA 3IS9A 4I2PA 4JKFA 3VQBA 3WQTA 4C8KA 4H5VA 4CJPA 2P9UB 3DXKA 4ILJA 4KO0A 4B9UA 3SMSA 1GLAG 2GWJA 3NF8A 4W5TA 1H1VA 1NGIA 2GTDA 4DTMA 4AHTA 3HOTA 1CZAN 4CJVA 1J5EK 4HHTA 4OPHA 3CJAA 4M63C 1N32K 4BRKA 2P9SB 1BIZA 3MXIA 2QWQA 3C7NA 3TAQA 3V6DA 1VQNN 2O8EA 4JS4A 1I3AA 4ZHRA 4IO9L 1REVA 1QQCA 3L2UA 4FWOA 3T1AA 1Z05A 5ADXH 4BR7A 4QOZB 1SAZA 3RRGA 2LSNA 2OTJN 1QS4A 4LSLA 4BRMA 3QEXA 1CLQA 4AHUA 3EYZA 1SUQA 2AP1A 3M8QA 3VQ9A 2P9SA 4NYFA 3LP2A 1KQSM 3SMPA 4AQYK 4DTSA 1NK4A 3ZSXA 5AQHA 3DRRA 1GLDG 4QS8A 3V9UA 3RMDA 1NK0A 4YNQA 3K58A 2AJQA 3THXA 2OANA 4CGJA 4FJMA 4M3YA 4B9SA 3AA3A 4LH4A 3VQDA 2Z1IA 3DLLL 3BZCA 4CJFA 4DV2K 1YTUA 5FRNA 4JKBA 5M1NA 4IBNA 1SQKA 1W9HA 3UB5A 3VEVA 3SYZA 4FLTA 3CMAN 3LDOA 4GMJB 4BGBA 4PY5A 2E2QA 4OVLA 3O5BA 4E0DA 3KLEA 1LWCA 3ZETB 4E7KA 2YHYA 4H0XB 4CIEA 3NHGA 4F4KA 4RG8A 1JLBA 1TGOA 4C8OA 5AQQA 4CZJA 4F9OA 4B8AB 3G6EN 1JCGA 1ZBUA 2XHBA 2HF3A 3AAQA 4CFDA 4EFHA 4DCHA 1LWFA 4FJHA 1Z6RA 4FLVA 5GAEP 2QWRA 4BE2A 2HHSA 3FLCO 4DUZK 4CJ7A 2ATQA 4AH9A 2O4IA 3MWTA 1BCOA 1C1AA 3L8BA 4KBOA 4Y0WA 1Q8IA 3MWPA 2IDOA 3LAKA 4DB3A 2BGGA 3L4IA 5EU7A 3AVKA 1JKHA 3M6GA 1V4TA 4RTFD 3TAGA 3VTIA 3CJ7A 1RBSA 4DV5K 3LP3A 3QETA 2ZE2A 4EP5A 4F3OA 3I0RA 4RW7A 5HLFA 1U49A 1S5JA 3RMBA 4Z4CA 4CJEA 1XWLA 3QBWA 2VWKA 1HUXA 1A5VA 3K5LA 3ULEB 3KKSA 3LANA 3EE8A 3R9PA 3SAFA 1FW6A 4N76A 4FM2A 1BCMA 2YNFA 3JS6A 2B5JA 4N41A 3NH2A 2YKMA 3TU5A 4M3RA 4NLCA 1NJWA 2KHOA 3LP1A 5EY4A 3P1GA 4CJKA 2ETJA 2ZWHA 3L3VA 4DFJA 1IH7A 3MAQA 1VQLN 4KV8A 3VGKA 3IFRA 1MWMA 3DLHA 5CR4A 3O9RA 3MN7A 3CETA 3IAYA 1NU0A 4Q0BA 4BWJA 4YOYA 2HVHA 3VQAA 1X3NA 4LC9B 4CZLA 5JLFA 1TK0A 3ZSZA 1BQNA 3P31A 1G15A 1MU2A 4O55A 1EWQA 1Y64A 3MX5A 4B3MK 4H4OA 4CF0A 4R5PA 4CESA 4WCEL 4IG0A 2UXCK 3V1RA 4B9MA 5CY4A 4GY2B 1FK9A 1JL1A 4CFAA 1D4XA 3S9HA 1IKWA 4Z4HA 2IS3A 4DMNA 4CGIA 3ZT0A 4E1JA 1GOAA 4ICLA 3AVBA 4E3SA 1N36K 3CQXA 4NLBA 5HL7L 3OYJA 5DMRA 2OZSA 1WSHA 2NUBA 1LW2A 2RE2A 1ZC6A 3BUZB 4FM1A 5KGWA 3PIPL 1QSLA 1XC3A 2Y1IA 3CCRN 4W5RA 3O1BA 3EY1A 4DV3K 3SLCA 3THWB 1RT3A 4KTZA 4CCHA 2P9LB 3A5LC 1E4FT 5AJ3K 2RN2A 1BIUA 1VQ8N 1LOTB 1NGEA 4ELTA 3L2VA 3IRXA 4JAXA 5C2FA 4AHVA 2HMPA 2P5OA 4XH5A 2UYTA 2YNHA 4B9QA 3R8EA 4DR1K 4FJLA 5HRNA 3C6TA 3D2EB 1YAGA 3DOKA 2OA8A 3VGMA 5CE3A 5C15A 3SJJA 2G8FA 4Y1DA 4BRNA 1KRPA 5E84A 3UKRA 2HMIA 3ITHA 1TYQB 1TUUA 4B1XB 2YHWA 2GX9A 5KTQA 2QW9A 3AVIA 3UIQA 3AVAA 5FLXO 4FJNA 3ATUA 3OHRA 3M8RA 2VWJA 3SI6A 2V7YA 4DSFA 3SPYA 2Q31A 2RF2A 3NF9A 3D2EA 3QINA 3OYKA 4FK2A 1NLVA 2QWOA 1DT9A 1VSFA 3L0QA 4B1WB 4IO8A 5CYQA 4G9ZA 3SK3A 3LZIA 2X6SA 3A5NC 1KLNA 3SQ0A 3O6WA 4BGAA 3DMJA 1Q7YO 3CFRA 4JK7A 4CZFA 2O8BB 3WNEA 3ZSWA 5F0XA 5BREA 1VSJA 2WOMA 3LAMA 1C1CA 3O9UA 5BPMA 4DLEA 3MK6A 4IWVA 2DTUA 1KD1O 4LD0A 4CZHA 4FPAA 3TI0A 2Q2RA 3G71N 2QM1A 5LJWA 2FSJA 2Q1NA 2RHKA 4JI4K 3HOSA 2DFEA 4YOTA 3NFAA 4CE9A 4CVNE 3AGRA 4Z0UA 4KFBA 3N4PA 2P9PA 3TARA 1L3SA 1T8EA 2X74A 3L2RA 2WC9A 2IVOA 4QS9A 1YF5L 4IZ9A 1IV0A 3OA9A 4R79A 1T44A 2VG5A 5HROA 2XY7A 4C8MA 1R59O 1IKYA 2O8CA 3RTVA 4CW7B 1XI1A 4IFEA 3QEIA 4DTUA 1QQOA 4JEPA 3DLBA 4Z4EA 2QTDA 5HRSA 1GLCG 1VQKN 3W0LA 4XH1A 3HM8A 5HBMA 5KPRA 5LL6Z 4GKJK 3FFIA 4QAGA 2B4JA 4LSNA 4RW8A 2FF3B 3JSMA 5I9EB 3RMCA 4C23A 1QE1A 1VQ6N 1TKZA 4C8LA 3U8XA 1J6ZA 3SNNA 1LAVA 1EXQA 3SUQA 1VQON 2WBNA 1NJIO 3LZJA 2JLEA 2BDPA 3NDKA 2KQ2A 4JLHA 3GL1A 3A2FA 2UXBK 3J80O 1HNVA 3ENHA 2Q0UA 4H5TA 3SPZA 3OYMA 3EE9A 4KH4A 1Y97A 3RSEB 3CF5L 1JCFA 1GOCA 1JLFA 2Q97A 4J8FA 4X66K 3B8AX 4I2QA 5AQFA 1WSEA 1NNEA 2VG7A 1HKCA 4DR3K 4OPJA 4DLGA 4CK3A 1QSYA 3FZKA 2W42A 1TKDA 2FC0A 1JLQA 1N8RO 4KPYA 1RDUA 1NKCA 3RSEA 3PX4A 3OBWA 5K14A 3B6PA 4LF8K 4H5WA 1OH8A 4PKHA 4AM7A 4OO1J 3CC4N 1QHAA 3MCAB 2PFUA 5IT9O 4JKHA 4JKDA 4JNEA 1KC8O 2NLXA 4BG9A 3OJSA 1RBTA 4WQ5A 2OPQA 4JRPA 3HSTB 4KHWA 2HHTA 1RTIA 4H0TB 2A1SA 3CYMA 1DTTA 1ZYQA 3KK1A 5AQMA 1HR0K 1HJOA 2YHBA 4DR4K 4FLZA 2Q3SA 4ZTJA 3JAMO 1QQMA 3J8AA 2O8FB 2FSKA 4DQQA 2QKBA 4JKGA 3TTCA 3LM9A 3VQ6A 4CEDA 1JXBA 2A40A 4EAHD 1NK5A 1YHQN 4JN4A 4FLWA 2JGUA 3NVKA 2YV0X 4OPAA 2W6LA 1I39A 3GG4A 3CM6A 4WQ5C 3ZEUB 1VQ5N 3QO9A 4ELUA 3SJHA 4A61A 1WSJA 4FJ7A 4PA1A 3W3DA 3F5TA 4O0IA 1BGXT 3DAWA 1E4GT 2O8FA 1VQ9N 3KHYA 1VSEA 1KVAA 1VSDA 1S1TA 4W5NA 3VQ8A 4MDBA 3HPOA 2NRRA 1RDBA 2FBXA 3I33A 3HYFA 3LDSA 4J2EA 5JMVA 1X9SA 5EVZA 1RILA 3EO3A 3VA0A 5AFUH 2VCPA 3QDKA 1BHLA 3ZEUA 4OPKA 3KTQA 1NGDA 3HT3A 2X6NA 5JLHA 3NE6A 4OLAA 5AZJA 4O8UA 5IWAK 4JS5A 3DI6A 2PYJA 1ASWA 2KW4A 3DLEA 1HKGA 3AVHA 1K6YA 2UUAK 4BY9C 3HTVA 4CHYA 3QEPA 4FJKA 4JI6K 1UAXA 1YTAA 4DQSA 3FZMA 3OYEA 2CH5A 5FRMA 3K5NA 5C25A 3MN6A 4CEAA 4FLUA 1N6QA 4M42A 4QCLA 1L3TA 4K41A 1IKVA 1ATNA 3EKUA 5CZ2A 4MFBA 2YKNA 3CCQN 5BR8K 1BO5O 3ENBA 4KHQA 1N34K 2F8TA 4DV6K 4ZTFA 4NB4A 4CIGA 2NZTA 1MDUB 3ZX2A 2XY8A 3H1QA 3EL2A 4X64K 3O4QA 3QB0A 1J53A 3E1YA 3MXJA 3AVFA 4AM6A 1NK8A 1RT7A 3TANA 2YJFA 3U3GA 1HLUA 5J2PA 1P8ZA 2P9UA 1KVBA 5BN8A 2I5JA 4XH4A 1U45A 4BRDA 2F8SA 5KRSA 3OTOK 3J7YP 3F73A 2FXUA 3TAFA 2VGMA 3SQ2A 2ASMA 3ULDA 4LF7K 1KAXA 3H3NO 2GELA 3WXKA 3K57A 1S22A 1ASVA 3IUCA 4BDYA 1JXEA 4O5FA 4BR0A 4FVUA 4BROA 3NH1A 4DQIA 1LWEA 1FKPA 3CC7N 4BRFA 4KTQA 1RT4A 3TR8A 4CHZA 4HUFA 4W5QA 4BRGA 4LFCK 3ZX0A 3UKUB 4KHPK 3OS1A 4C1NK 4YHHK 4BACA 1WAFA 4DF8A 1NKBA 3C6HA 4N56A 4MLHA 2XY5A 4IG3A 4IFYA 1S72N 1S6PA 2ZM6K 2GWKA 3CERA 3BF3A 3CCVN 3BP8A 2CGJA 3QEVA 3VF4A 3MXMA 1QVFM 2F9TA 4CZIA 1OH6A 2XO7A 2PZSA 2KFZA 2ZJQL 1TK5A 2QXFA 5AQWA 4JI2K 4CEZA 4RWTA 4DV0K 1NGCA 3THVA 3OY9A 4JI5K 4DR2K 4DFKA 4B9LA 1JL2A 3AO2A 1JLAA 2BE2A 1A5XA 4IJNA 2RPIA 4BDPA 2VQFK 3PO4A 2ZJRL 4CEEA 4J2BA 3ZETA 1D9FA 2I7NA 1BUPA 1V4SA 3U3YA 4KAZA 2P9NB 1HQEA 2KKZA 3LDQA 5EXWA 5SZTA 5KQDA 4BRAA 4GKKK 4CERA 1BQMA 4KH5A 3CG7A 3HXMA 1SKRA 3K5MA 3O4NA 4ILHA 1DEJA 4YORA 1NKEA 2G8IA 1LAWA 2FBVA 3AVLA 3DLGA 2D0BA 2CGKA 3RWUA 3ZCMA 2Z1GA 5KQ8A 2WTUA 4ISFA 4GVMA 4CF8A 3V9SA 3MN5A 3OYIA 2OTLN 3MX2A 3KVGA 2GV9A 1ITGA 3LPTA 4FOEA 2UUCK 1HYVA 4PKGA 2P9NA 4UQGA 3HM9A 3VEZA 3WNHA 4B1YB 5C2DA 3ZLJA 1TK8A 2ZGZA 3WQUA 4YDUA 4BRQA 4KKOA 2YJEA 1C0GA 3R1XA 3F9MA 3P83D 3OYLA 3CFPA 3C0BA 3ULEA 5AR0A 2HBJA 3R3LA 3TSPA 5JS1A 3AGKA 1C0MA 4B9TA 3KLIA 2YHAA 2KTQA 4FJXA 3I0SA 3AO5A 1U48A 3G0ZA 2HHUA 3CQ8A 5JVGL 3WUHA 4JRQA 3QNOA 3D7EO 3QICA 4WFAL 4CGGA 2W41A 1T3VA 4B3OA 3AY9A 3T1YK 4CZMA 1NK7A 4YY3K 4DTJA 1X9MA 2JWLA 1TL1A 4Y1CA 2FBTA 1Q18A 4CF2A 2NRVA 1BI4B 4Z4GA 5ADXA 4EHTA 4RCHA 4HWIA 4IKFA 4FWNA 4CHQA 4PL8A 4LF6K 3GDQA 3T19A 4EHUA 3HBTA 3HSCA 3WXLA 1HYSA 3K9JA 4DR5K 1IJJA 2F7TA 4CJSA 1Z26A 4E7IA 3J7ZO 1UOCA 3CCSN 1X9WA 4JI8K 4JI7K 4M3UA 4XIUA 4CGDA 3JXUA 5AQJA 4L8RB 1BA0A 3T69A 4DSIA 4FM0A 1EETA 3QBXA 4CD1A 1BI4A 4LFBK 4DU3A 1YT3A 3NGZA 2AA4A 5C12A 2OPPA 4O0JA 3AO1A 4FWRA 5LJVA 3NF7A 4CJUA 3A5OC 1EWRA 4KB1A 5GIOA 5M1PA 5CZ1A 4LF5K 3A8YA 3O08A 1VK0A 2QK9A 2F9WA 5B8HA 1YJ9N 1UA1A 4FCYA 1NJZA 3KWIA 3C65A 3I8BA 4BC4A 1T6CA 2YX6A 1XNRK 3V81A 3KD1E 3THWA 1DTQA 4KI4A 1L3VA 4JI1K 3A0IX 1RT5A 2P9LA 3RR8A 4AILC 4OJRA 4FW1A 1KFDA 2WONA 4FJIA 4K42A 1S3XA 1M1KO 3ENOA 3CPWM 3J81O 3LDLA 3KZBA 4M41A 4EIAA 3KLFA 1A5WA 1GLBG 4M3WA 3SV4A 1T03A 2ASOA 3KJVA 4A5BA 3NVMA 5AQRA 2YHXA 2E6MA 3SQ1A 2VG6A 3CD6N 3O9SA 3SUOA 1NMNA 5BR9A 1K8KB 5AQGA 1TYQA 1IKXA 1J5OA 1NMDA 3BEXA 1SV5A 3CCUN 4DF4A 4KH6A 1C0TA 5E41A 3E66A 4I6MB 1QSSA 1GLEG 1RTJA 1YVNA 3H3OB 1ZBHA 5LY3A 2WFBA 1QTMA 1W97L 2E8AA 4OGEA 4RW9A 1NGFA 3DJCA 1SL1A 3CMEN 3MMVA 5EX5A 3R6MA 4B08A 5GAHP 4K8XA 4BREA 4M3TA 3CFOA 2IGIA 3VTHA 3SBTA 3MN9A 2Q0RA 3HPGA 4YOVA 2O8BA 1VQ4N 4DSEA 3RVCA 3S3NA 3NGIA 4DKWA 4CJWA 3NBPA 4FL9A 4K25A 4NO7A 4FWPA 4CJQA 3H6EA 4LY7A 3WEEB 4G1QA 4H0PA 1VQ7N 4DSLA 3FZLA 4KHSA 4ISEA 2Z1HA 3D2FB 3VEOA 2NRTA 1JLEA 5C10A 4HTLA 3DOLA 4IJAA 4BR5A 1E3MA 4KI6A 3OYNA 1B92A 3D0PA 5AQIA 3CCJN 3G4SN 1ZBIA 2KZZA 4MDAA 5DM6L 2J4RA 2XY6A 1MWKA 1Q9YA 5JS2A 3WEEA 4DS5A 3SZ2A 4ID1A 1TAQA 3D2FA 3L3UA 5M1KA 2QI2A 4CJTA 4IEEA 4DQPA 4CJLA 4I9QA 3ZT4A 3V9XA 4NCAA 1IG9A 2HOEA 3VQQA 1MA9B 4CFCA 3NCIA 2HW3A 3T7ZA 3HO1A 3WT0A 3VGLA 3VQPA 1M90O 3ISNC 4AHSA 4E7HA 4CI6A 3VMFB 1ESVA 2QKKA 1HNWK 4FJGA 4M45A
chains in the Genus database with same CATH topology
4CF1A 4DTRA 2BGGA 4B8CA 4O4GA 3OS2A 5EU7A 3AVKA 4LH5A 1JKHA 4WE1A 3U6FA 5D3GA 4FLUA 4CEAA 4M42A 1N6QA 3TAGA 3PUFA 4QCLA 3VQEA 1J54A 1L3TA 1IKVA 3HVTA 4CEQA 4HVJA 2PY5A 1RTDA 1S9GA 1RBSA 5CZ2A 3O3GA 3LP3A 4MFBA 3OYDA 2YKNA 2ZE2A 3L2WA 4EP5A 3QETA 3TAPA 4EZ6A 4KB0A 4F3OA 3I0RA 2BANA 1RDAA 2B6AA 4RW7A 4FLXA 5HLFA 1U49A 3KK2A 1S5JA 3RMBA 1KSPA 4KHQA 4Z4CA 4F2SA 3AA5X 4CJEA 4ZTFA 4FK0A 4NCGA 4CIGA 1XWLA 2VWKA 3OYCA 4BDZA 1A5VA 1BL3A 3K5LA 3PX0A 1HRHA 4W5OA 1RDDA 2XY8A 3KKSA 3LANA 4FJ5A 3D45A 3RR7A 3O4QA 4FZXC 1J53A 1TAUA 3M8PA 3MXJA 3AVFA 2IOCA 2D5RA 2E4LA 5KRTA 3S3MA 1NK8A 4N76A 1RT7A 4FM2A 4RW4A 3TANA 1BCMA 2YNFA 4N41A 2B5JA 3U3GA 3NH2A 5J2PA 2YKMA 5KGXA 4M3RA 1KFSA 4DFPA 1KVBA 3AO4A 1BISA 1RBVA 2GUIA 2I5JA 4EP4A 1NJWA 3TAEA 1U45A 3KLHA 3AA2A 2F8SA 5KRSA 4MQ3A 3VQ5A 3LP1A 4I7FA 1T7PA 3F73A 1RT6A 1S1UA 3P1GA 4CIFA 2Z1JA 2ETJA 4CJKA 4N5SA 3KLGA 3TAFA 3SQ2A 3L3VA 1JLCA 1RBRA 3F9KA 4DFJA 3ULDA 1IH7A 3BDPA 4I9LA 3OJUA 3MAQA 1KVCA 4KV8A 4CJ4A 4N47A 3C95A 5J2NA 3DLHA 1SKWA 4PQUA 4IFVA 5T7BA 3ALYA 1L5UA 3IAYA 4Q0BA 4BWJA 4HCCA 3K57A 4IDKA 2HVIA 4CK2A 2HVHA 2D0AA 3VQAA 1TKTA 3C6UA 1RTHA 1ASVA 2HB5A 3DLKA 3ZSZA 1HQUA 4BDYA 1SKSA 1BQNA 4CHNA 1TK0A 5J2MA 1G15A 1MU2A 3NAEA 1WLJA 4O55A 4C8NA 1JXEA 4H4OA 4HTUA 4CF0A 4R5PA 4CESA 3OYAA 5C24A 4IG0A 3NH1A 4DQIA 3V1RA 1LWEA 4B9MA 1FKPA 1KLMA 1RNHA 2ZQBA 1RCHA 4KTQA 5CY4A 1RT4A 4CFBA 3TR8A 4CHZA 4HUFA 2A1RA 1FK9A 4W5QA 2OPRA 1JL1A 4CFAA 4OKEA 3JYTA 3MEGA 1CZBA 3S9HA 1IKWA 4Z4HA 4E7JA 2IS3A 4EZ9A 4DMNA 3SUNA 3OS1A 4BACA 4FJ8A 3SCXA 3LPUA 1WAFA 2XRIA 4CGIA 4DG1A 3ZT0A 1GOAA 4ICLA 4DF8A 1NKBA 3AVBA 4E3SA 1NK6A 4N56A 2XY5A 4CHOA 3ASMA 4IG3A 4IFYA 4Z4FA 2KFNA 1S6PA 4H8KA 3TWHA 4PWDA 5HRRA 3VQCA 4CK1A 1U04A 3OYJA 1WN7A 4TSXA 3QEVA 4RW6A 5DMRA 3HL8A 3MXMA 2OZSA 4M45A 3HP6A 3EZ5A 2D0CA 1WSHA 4OKKA 4FYDA 2NUBA 1LW2A 2XO7A 4FM1A 2PZSA 2KFZA 5KGWA 3DLRA 4KRFA 3O3HA 3T3FA 2PYLA 4BE1A 2KZMA 1QSLA 4KHUA 1TK5A 2QXFA 4CEZA 2Y1IA 4DTPA 1WSGA 3THVA 4W5RA 3OY9A 1HPZA 3AO3A 4DFKA 3EY1A 4B9LA 3LWLA 1JL2A 1ASUA 3AO2A 4FVMA 4CJ3A 5CYMA 1RT3A 1JLAA 4KTZA 2BE2A 1VSKA 4CCHA 1A5XA 4KREA 2RPIA 2IC3A 4BDPA 4BWMA 4E19A 3PO4A 3PV8A 2DFHA 4CEEA 4J2BA 2RN2A 1BIUA 4ELTA 1ZBFA 3B6OA 3L2VA 1D9FA 3SQ4A 3U3YA 3AVJA 1WSIA 2O4GA 3IRXA 3VA3A 4KAZA 1F21A 4AHVA 1HQEA 3E01A 5SZTA 1TL3A 2P5OA 4CF9A 2HNYA 4BE0A 1UA0A 3OVNA 4DTNA 2YNHA 4CERA 1BQMA 2G8UA 3CG7A 3HXMA 1SKRA 3K5MA 1S9EA 3O4NA 1DLOA 5HRNA 1S6QA 1NKEA 3C6TA 1LAWA 4FJLA 4KHYA 1HMVA 2FBVA 3AVLA 3DLGA 2D0BA 1XHXA 4AHCA 3DOKA 3RWUA 3K2PA 3P5JA 2Z1GA 4KTWA 1HJRA 3HPHA 3ZCMA 3OS0A 3SJJA 2OA8A 2G8FA 4Y1DA 4DTXA 4E89A 4GVMA 4CF8A 1D9DA 1W0HA 1KRPA 4M3ZA 1J9AA 3V9SA 3OYIA 3L2QA 4NCBA 3TAMA 1D8YA 2HMIA 4B9VA 1VRUA 3ITHA 1CXUA 2YNGA 2GV9A 4F8RA 1C6VA 5KTQA 1ITGA 3HP9A 3LPTA 3AVIA 1HYVA 3UIQA 3AVAA 4UQGA 4FJNA 3M8RA 3V1QA 2VWJA 2Y1JA 3HM9A 3SV3A 3SI6A 1VRTA 3WNGA 4DSFA 2G8IA 3HVRA 1Z25A 5HRPA 3WNHA 4DTOA 3SPYA 2RF2A 3MECA 3NF9A 4AHRA 3M8SA 3QINA 3OYKA 3VQ7A 3RRHA 1TK8A 5J1EA 4FK2A 4FZZA 1SL0A 2HHVA 3V9ZA 3BGRA 1HNIA 1VSFA 4KKOA 5FDLA 4YFUA 4OLBA 1KTQA 5CYQA 1TV6A 4DU4A 3LZIA 2X6SA 3OYLA 3P83D 3KK3A 3CFPA 3SQ0A 2DFFA 1NK9A 1KLNA 3DMJA 1U4BA 3O3FA 1NOYA 3CFRA 5FROA 3WNEA 3ZSWA 1D5AA 5JS1A 4OKJA 1VSJA 2WOMA 3LAMA 3I8DA 1C0MA 2FBYA 3KD5E 4B9TA 1C1CA 4ELVA 3KLIA 2G8VA 2YHAA 4CEOA 4DLEA 4FJXA 2KTQA 3I0SA 4O44A 2DTUA 3AO5A 4CGFA 1S1WA 4LD0A 3AVGA 1U48A 3G0ZA 3TI0A 2HHUA 3CQ8A 3HK2A 3OYBA 2IAJA 3V4IA 5SWMA 4JRQA 4Z4IA 3QNOA 4E1NA 2G8WA 4CGGA 2DFEA 1X1PA 5DK5A 4B3OA 1TVRA 3NFAA 4CE9A 2G8HA 1NK7A 4DSJA 1CXQA 4KFBA 4Z0UA 4DTJA 4DS4A 4Y1CA 1TL1A 3QEWA 1X9MA 3TARA 2G8KA 1L3SA 1S1VA 2FBTA 3K5OA 4CF2A 2OPSA 1U47A 1T8EA 2HHQA 2X74A 3L2RA 1BI4B 4Z4GA 4F3TA 2ZD1A 1EX4A 4IKFA 1NOZA 4CHQA 1FKOA 3T19A 1C1BA 1RDCA 3OYFA 1ZBLA 1NJXA 1N5YA 1VSHA 1VSIA 3WNFA 5I3UA 2E6LA 1HYSA 2R7YA 2VG5A 5HROA 2HNDA 4C8MA 3NH0A 4OGCA 4CJSA 2XY7A 1IKYA 3KIOA 4FZYA 3DYAA 1Z26A 4E7IA 3RTVA 1X9WA 1UOCA 3QIOA 4DU1A 4M3UA 4CECA 4XIUA 1XI1A 4CGDA 1RT2A 3AVNA 4F2RA 4M3XA 3QEIA 3KKRA 4L8RB 3DM2A 4DSIA 3G10A 4DTUA 4FM0A 1EETA 4DWIA 1BI4A 1Q9XA 3DLBA 1WAJA 4DU3A 1XC9A 3LP0A 1EKEA 4Z4EA 1YT3A 5C25A 5HRSA 3NGZA 5C42A 1EP4A 1VSMA 1C0UA 4FK4A 2OPPA 4O0JA 3AO1A 1T05A 1KCFA 3NF7A 4CJUA 4E1MA 3AA4A 5HBMA 4KB1A 3FFIA 1HYZA 5CZ1A 4QAGA 2B4JA 3OYHA 2F8TA 4LSNA 1VK0A 4RW8A 2QK9A 4FJJA 3JSMA 1UA1A 3RMCA 3CM5A 2EHGA 1FXXA 1QE1A 1TKZA 4E7LA 5I42A 1RT1A 2P51A 4FCYA 3SNNA 1NJZA 4C8LA 3TABA 1LAVA 1B9FA 3LALA 3QNNA 3ZSRA 1EXQA 3SUQA 3AV9A 3H08A 3DRSA 5J2QA 4CHPA 3SUPA 3LZJA 2JLEA 2BDPA 3NDKA 4CEBA 3HJFA 2KQ2A 1UWBA 2ITGA 3NGYA 4JLHA 3ZSYA 2EX3A 3V81A 3A2FA 1O1WA 2HNZA 3QESA 3KD1E 4CJRA 1R0AA 1DTQA 1HNVA 1WSFA 3SPZA 4B9NA 4KI4A 1L3VA 3DRPA 1RT5A 3OYMA 1VSLA 3RR8A 1Y97A 4AILC 4OJRA 4HUEA 1KFDA 1GOCA 4FW1A 2WONA 4FJIA 3MEEA 1JLFA 2P1JA 3K59A 4CJ5A 4FLYA 4PUOA 4I2QA 4HUGA 3LWMA 1WSEA 1L3UA 3IS9A 3C94A 4I2PA 1XHZA 2VG7A 3VQBA 1NJYA 4C8KA 4M41A 4CJPA 4OPJA 4DLGA 3KLFA 1A5WA 4CK3A 4NYNA 4KO0A 4B9UA 1QSYA 4M3WA 2W42A 1LW0A 3SV4A 3NF8A 4W5TA 1T03A 4HCBA 3KJVA 3V9WA 1TKDA 2FC0A 4DTMA 1JLQA 4KPYA 2HHWA 4AHTA 2E6MA 4CJVA 2VG6A 3SQ1A 4HHTA 3SUOA 1NKCA 3PX4A 5K14A 3B6PA 1BIZA 3MXIA 3TAQA 4Q5VA 3V6DA 1IKXA 1J5OA 1SV5A 4DF4A 4JS4A 1C0TA 1I3AA 5E41A 4ZHRA 2DY4A 1REVA 3AVCA 1QQCA 3OJSA 3L2UA 3T1AA 1QSSA 4QOZB 1RBTA 2OPQA 4JRPA 3HSTB 3RRGA 2LSNA 4DSKA 1RTJA 1RTIA 4KHWA 1ZBHA 2HHTA 1QTMA 3ZT2A 1QS4A 2A1SA 3CYMA 1DTTA 4OGEA 3KK1A 1ZYQA 4RW9A 4DQRA 3NF6A 4LSLA 2YHBA 1SL1A 3IG1A 3QERA 3ZT3A 4B08A 4ID5A 1SL2A 2OZMA 4FLZA 3ZT1A 2Q3SA 3QEXA 4AHUA 3MEDA 3EYZA 1SUQA 4ZTJA 2P5GA 4K8XA 1CLQA 3AVMA 4M3TA 3CFOA 3M8QA 3VQ9A 4NYFA 3LP2A 2IGIA 1IO2A 4DQQA 2X78A 3HPGA 1CZ9A 4DTSA 2QKBA 4DSEA 1NK4A 3ZSXA 3VQ6A 3ZSOA 4CEDA 1JXBA 3DRRA 3NGIA 3S3NA 2F96A 3V9UA 3RMDA 1NK5A 1NK0A 1S1XA 4CJWA 4YNQA 3NBPA 3K58A 2AJQA 4FLWA 2JGUA 4CGJA 2YV0X 2GBZA 4FJMA 4M3YA 1I39A 4B9SA 3CM6A 3PY8A 4CJQA 3AA3A 4LH4A 3QO9A 3VQDA 4ELUA 4FJ9A 4LY7A 1WSJA 2Z1IA 4G1QA 4FJ7A 4DSLA 4PA1A 4KHSA 2HHXA 4CJFA 2YNIA 1BGXT 2Z1HA 4O0IA 1YTUA 1JLGA 1YVUA 1JLEA 1VSEA 4H4MA 5FRNA 1KVAA 1VSDA 3DOLA 3V1OA 2OYQA 4CEFA 4IBNA 1S1TA 5KI6A 4W5NA 3PX6A 4K8ZA 1W9HA 3VQ8A 3HPOA 3SYZA 3PO5A 4FLTA 3ZSQA 3OYNA 1RDBA 2FBXA 1B92A 4KI6A 4FXDA 3D0PA 4GMJB 3HYFA 3LDSA 4PY5A 1LV5A 2RKIA 4OVLA 3VQ4A 1RBUA 4E0DA 4J2EA 3KLEA 1ZBIA 4O5BA 4KHNA 1LWCA 1X9SA 4DFMA 1RILA 4E7KA 2KZZA 3VA0A 4J2AA 4CIEA 2XY6A 1GOBA 1BHLA 3NHGA 4OPKA 4RG8A 3VN5A 3KTQA 4F4KA 1Q9YA 5JS2A 3HT3A 4DS5A 2X6NA 4FW2A 3SZ2A 4ID1A 1TAQA 1JLBA 3NE6A 1TGOA 3QLHA 4GW6A 1QHTA 3L3UA 4C8OA 3QIPA 4OLAA 4B8AB 4JS5A 1ZBUA 4CJTA 2XHBA 4CFDA 4DQPA 3DI6A 1LWFA 1TKXA 2PYJA 4FJHA 1ASWA 4FLVA 2KW4A 3OYGA 4CJLA 4I9QA 3DLEA 3ZT4A 3ZSVA 3V9XA 4BE2A 4CGHA 4NCAA 2HHSA 1IG9A 3VQQA 3RMAA 3AVHA 1K6YA 4CFCA 2ATQA 4CHYA 3QEPA 4AH9A 5HP1A 3NCIA 4FJKA 2O4IA 1B9DA 2HW3A 1UAXA 1YTAA 4DQSA 1BCOA 1C1AA 3L8BA 3S3OA 3HO1A 3VQPA 3OYEA 3ISNC 4AHSA 4J2DA 4E7HA 1Q8IA 2QKKA 5FRMA 4FJGA 3K5NA 2IDOA 3LAKA 1WNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CF1 A;  4DTR A;  2BGG A;  4B8C A;  4O4G A;  3OS2 A;  5EU7 A;  3AVK A;  4LH5 A;  1JKH A;  4WE1 A;  3U6F A;  5D3G A;  4FLU A;  4CEA A;  4M42 A;  1N6Q A;  3TAG A;  3PUF A;  4QCL A;  3VQE A;  1J54 A;  1L3T A;  1IKV A;  3HVT A;  4CEQ A;  4HVJ A;  2PY5 A;  1RTD A;  1S9G A;  1RBS A;  5CZ2 A;  3O3G A;  3LP3 A;  4MFB A;  3OYD A;  2YKN A;  2ZE2 A;  3L2W A;  4EP5 A;  3QET A;  3TAP A;  4EZ6 A;  4KB0 A;  4F3O A;  3I0R A;  2BAN A;  1RDA A;  2B6A A;  4RW7 A;  4FLX A;  5HLF A;  1U49 A;  3KK2 A;  1S5J A;  3RMB A;  1KSP A;  4KHQ A;  4Z4C A;  4F2S A;  3AA5 X;  4CJE A;  4ZTF A;  4FK0 A;  4NCG A;  4CIG A;  1XWL A;  2VWK A;  3OYC A;  4BDZ A;  1A5V A;  1BL3 A;  3K5L A;  3PX0 A;  1HRH A;  4W5O A;  1RDD A;  2XY8 A;  3KKS A;  3LAN A;  4FJ5 A;  3D45 A;  3RR7 A;  3O4Q A;  4FZX C;  1J53 A;  1TAU A;  3M8P A;  3MXJ A;  3AVF A;  2IOC A;  2D5R A;  2E4L A;  5KRT A;  3S3M A;  1NK8 A;  4N76 A;  1RT7 A;  4FM2 A;  4RW4 A;  3TAN A;  1BCM A;  2YNF A;  4N41 A;  2B5J A;  3U3G A;  3NH2 A;  5J2P A;  2YKM A;  5KGX A;  4M3R A;  1KFS A;  4DFP A;  1KVB A;  3AO4 A;  1BIS A;  1RBV A;  2GUI A;  2I5J A;  4EP4 A;  1NJW A;  3TAE A;  1U45 A;  3KLH A;  3AA2 A;  2F8S A;  5KRS A;  4MQ3 A;  3VQ5 A;  3LP1 A;  4I7F A;  1T7P A;  3F73 A;  1RT6 A;  1S1U A;  3P1G A;  4CIF A;  2Z1J A;  2ETJ A;  4CJK A;  4N5S A;  3KLG A;  3TAF A;  3SQ2 A;  3L3V A;  1JLC A;  1RBR A;  3F9K A;  4DFJ A;  3ULD A;  1IH7 A;  3BDP A;  4I9L A;  3OJU A;  3MAQ A;  1KVC A;  4KV8 A;  4CJ4 A;  4N47 A;  3C95 A;  5J2N A;  3DLH A;  1SKW A;  4PQU A;  4IFV A;  5T7B A;  3ALY A;  1L5U A;  3IAY A;  4Q0B A;  4BWJ A;  4HCC A;  3K57 A;  4IDK A;  2HVI A;  4CK2 A;  2HVH A;  2D0A A;  3VQA A;  1TKT A;  3C6U A;  1RTH A;  1ASV A;  2HB5 A;  3DLK A;  3ZSZ A;  1HQU A;  4BDY A;  1SKS A;  1BQN A;  4CHN A;  1TK0 A;  5J2M A;  1G15 A;  1MU2 A;  3NAE A;  1WLJ A;  4O55 A;  4C8N A;  1JXE A;  4H4O A;  4HTU A;  4CF0 A;  4R5P A;  4CES A;  3OYA A;  5C24 A;  4IG0 A;  3NH1 A;  4DQI A;  3V1R A;  1LWE A;  4B9M A;  1FKP A;  1KLM A;  1RNH A;  2ZQB A;  1RCH A;  4KTQ A;  5CY4 A;  1RT4 A;  4CFB A;  3TR8 A;  4CHZ A;  4HUF A;  2A1R A;  1FK9 A;  4W5Q A;  2OPR A;  1JL1 A;  4CFA A;  4OKE A;  3JYT A;  3MEG A;  1CZB A;  3S9H A;  1IKW A;  4Z4H A;  4E7J A;  2IS3 A;  4EZ9 A;  4DMN A;  3SUN A;  3OS1 A;  4BAC A;  4FJ8 A;  3SCX A;  3LPU A;  1WAF A;  2XRI A;  4CGI A;  4DG1 A;  3ZT0 A;  1GOA A;  4ICL A;  4DF8 A;  1NKB A;  3AVB A;  4E3S A;  1NK6 A;  4N56 A;  2XY5 A;  4CHO A;  3ASM A;  4IG3 A;  4IFY A;  4Z4F A;  2KFN A;  1S6P A;  4H8K A;  3TWH A;  4PWD A;  5HRR A;  3VQC A;  4CK1 A;  1U04 A;  3OYJ A;  1WN7 A;  4TSX A;  3QEV A;  4RW6 A;  5DMR A;  3HL8 A;  3MXM A;  2OZS A;  4M45 A;  3HP6 A;  3EZ5 A;  2D0C A;  1WSH A;  4OKK A;  4FYD A;  2NUB A;  1LW2 A;  2XO7 A;  4FM1 A;  2PZS A;  2KFZ A;  5KGW A;  3DLR A;  4KRF A;  3O3H A;  3T3F A;  2PYL A;  4BE1 A;  2KZM A;  1QSL A;  4KHU A;  1TK5 A;  2QXF A;  4CEZ A;  2Y1I A;  4DTP A;  1WSG A;  3THV A;  4W5R A;  3OY9 A;  1HPZ A;  3AO3 A;  4DFK A;  3EY1 A;  4B9L A;  3LWL A;  1JL2 A;  1ASU A;  3AO2 A;  4FVM A;  4CJ3 A;  5CYM A;  1RT3 A;  1JLA A;  4KTZ A;  2BE2 A;  1VSK A;  4CCH A;  1A5X A;  4KRE A;  2RPI A;  2IC3 A;  4BDP A;  4BWM A;  4E19 A;  3PO4 A;  3PV8 A;  2DFH A;  4CEE A;  4J2B A;  2RN2 A;  1BIU A;  4ELT A;  1ZBF A;  3B6O A;  3L2V A;  1D9F A;  3SQ4 A;  3U3Y A;  3AVJ A;  1WSI A;  2O4G A;  3IRX A;  3VA3 A;  4KAZ A;  1F21 A;  4AHV A;  1HQE A;  3E01 A;  5SZT A;  1TL3 A;  2P5O A;  4CF9 A;  2HNY A;  4BE0 A;  1UA0 A;  3OVN A;  4DTN A;  2YNH A;  4CER A;  1BQM A;  2G8U A;  3CG7 A;  3HXM A;  1SKR A;  3K5M A;  1S9E A;  3O4N A;  1DLO A;  5HRN A;  1S6Q A;  1NKE A;  3C6T A;  1LAW A;  4FJL A;  4KHY A;  1HMV A;  2FBV A;  3AVL A;  3DLG A;  2D0B A;  1XHX A;  4AHC A;  3DOK A;  3RWU A;  3K2P A;  3P5J A;  2Z1G A;  4KTW A;  1HJR A;  3HPH A;  3ZCM A;  3OS0 A;  3SJJ A;  2OA8 A;  2G8F A;  4Y1D A;  4DTX A;  4E89 A;  4GVM A;  4CF8 A;  1D9D A;  1W0H A;  1KRP A;  4M3Z A;  1J9A A;  3V9S A;  3OYI A;  3L2Q A;  4NCB A;  3TAM A;  1D8Y A;  2HMI A;  4B9V A;  1VRU A;  3ITH A;  1CXU A;  2YNG A;  2GV9 A;  4F8R A;  1C6V A;  5KTQ A;  1ITG A;  3HP9 A;  3LPT A;  3AVI A;  1HYV A;  3UIQ A;  3AVA A;  4UQG A;  4FJN A;  3M8R A;  3V1Q A;  2VWJ A;  2Y1J A;  3HM9 A;  3SV3 A;  3SI6 A;  1VRT A;  3WNG A;  4DSF A;  2G8I A;  3HVR A;  1Z25 A;  5HRP A;  3WNH A;  4DTO A;  3SPY A;  2RF2 A;  3MEC A;  3NF9 A;  4AHR A;  3M8S A;  3QIN A;  3OYK A;  3VQ7 A;  3RRH A;  1TK8 A;  5J1E A;  4FK2 A;  4FZZ A;  1SL0 A;  2HHV A;  3V9Z A;  3BGR A;  1HNI A;  1VSF A;  4KKO A;  5FDL A;  4YFU A;  4OLB A;  1KTQ A;  5CYQ A;  1TV6 A;  4DU4 A;  3LZI A;  2X6S A;  3OYL A;  3P83 D;  3KK3 A;  3CFP A;  3SQ0 A;  2DFF A;  1NK9 A;  1KLN A;  3DMJ A;  1U4B A;  3O3F A;  1NOY A;  3CFR A;  5FRO A;  3WNE A;  3ZSW A;  1D5A A;  5JS1 A;  4OKJ A;  1VSJ A;  2WOM A;  3LAM A;  3I8D A;  1C0M A;  2FBY A;  3KD5 E;  4B9T A;  1C1C A;  4ELV A;  3KLI A;  2G8V A;  2YHA A;  4CEO A;  4DLE A;  4FJX A;  2KTQ A;  3I0S A;  4O44 A;  2DTU A;  3AO5 A;  4CGF A;  1S1W A;  4LD0 A;  3AVG A;  1U48 A;  3G0Z A;  3TI0 A;  2HHU A;  3CQ8 A;  3HK2 A;  3OYB A;  2IAJ A;  3V4I A;  5SWM A;  4JRQ A;  4Z4I A;  3QNO A;  4E1N A;  2G8W A;  4CGG A;  2DFE A;  1X1P A;  5DK5 A;  4B3O A;  1TVR A;  3NFA A;  4CE9 A;  2G8H A;  1NK7 A;  4DSJ A;  1CXQ A;  4KFB A;  4Z0U A;  4DTJ A;  4DS4 A;  4Y1C A;  1TL1 A;  3QEW A;  1X9M A;  3TAR A;  2G8K A;  1L3S A;  1S1V A;  2FBT A;  3K5O A;  4CF2 A;  2OPS A;  1U47 A;  1T8E A;  2HHQ A;  2X74 A;  3L2R A;  1BI4 B;  4Z4G A;  4F3T A;  2ZD1 A;  1EX4 A;  4IKF A;  1NOZ A;  4CHQ A;  1FKO A;  3T19 A;  1C1B A;  1RDC A;  3OYF A;  1ZBL A;  1NJX A;  1N5Y A;  1VSH A;  1VSI A;  3WNF A;  5I3U A;  2E6L A;  1HYS A;  2R7Y A;  2VG5 A;  5HRO A;  2HND A;  4C8M A;  3NH0 A;  4OGC A;  4CJS A;  2XY7 A;  1IKY A;  3KIO A;  4FZY A;  3DYA A;  1Z26 A;  4E7I A;  3RTV A;  1X9W A;  1UOC A;  3QIO A;  4DU1 A;  4M3U A;  4CEC A;  4XIU A;  1XI1 A;  4CGD A;  1RT2 A;  3AVN A;  4F2R A;  4M3X A;  3QEI A;  3KKR A;  4L8R B;  3DM2 A;  4DSI A;  3G10 A;  4DTU A;  4FM0 A;  1EET A;  4DWI A;  1BI4 A;  1Q9X A;  3DLB A;  1WAJ A;  4DU3 A;  1XC9 A;  3LP0 A;  1EKE A;  4Z4E A;  1YT3 A;  5C25 A;  5HRS A;  3NGZ A;  5C42 A;  1EP4 A;  1VSM A;  1C0U A;  4FK4 A;  2OPP A;  4O0J A;  3AO1 A;  1T05 A;  1KCF A;  3NF7 A;  4CJU A;  4E1M A;  3AA4 A;  5HBM A;  4KB1 A;  3FFI A;  1HYZ A;  5CZ1 A;  4QAG A;  2B4J A;  3OYH A;  2F8T A;  4LSN A;  1VK0 A;  4RW8 A;  2QK9 A;  4FJJ A;  3JSM A;  1UA1 A;  3RMC A;  3CM5 A;  2EHG A;  1FXX A;  1QE1 A;  1TKZ A;  4E7L A;  5I42 A;  1RT1 A;  2P51 A;  4FCY A;  3SNN A;  1NJZ A;  4C8L A;  3TAB A;  1LAV A;  1B9F A;  3LAL A;  3QNN A;  3ZSR A;  1EXQ A;  3SUQ A;  3AV9 A;  3H08 A;  3DRS A;  5J2Q A;  4CHP A;  3SUP A;  3LZJ A;  2JLE A;  2BDP A;  3NDK A;  4CEB A;  3HJF A;  2KQ2 A;  1UWB A;  2ITG A;  3NGY A;  4JLH A;  3ZSY A;  2EX3 A;  3V81 A;  3A2F A;  1O1W A;  2HNZ A;  3QES A;  3KD1 E;  4CJR A;  1R0A A;  1DTQ A;  1HNV A;  1WSF A;  3SPZ A;  4B9N A;  4KI4 A;  1L3V A;  3DRP A;  1RT5 A;  3OYM A;  1VSL A;  3RR8 A;  1Y97 A;  4AIL C;  4OJR A;  4HUE A;  1KFD A;  1GOC A;  4FW1 A;  2WON A;  4FJI A;  3MEE A;  1JLF A;  2P1J A;  3K59 A;  4CJ5 A;  4FLY A;  4PUO A;  4I2Q A;  4HUG A;  3LWM A;  1WSE A;  1L3U A;  3IS9 A;  3C94 A;  4I2P A;  1XHZ A;  2VG7 A;  3VQB A;  1NJY A;  4C8K A;  4M41 A;  4CJP A;  4OPJ A;  4DLG A;  3KLF A;  1A5W A;  4CK3 A;  4NYN A;  4KO0 A;  4B9U A;  1QSY A;  4M3W A;  2W42 A;  1LW0 A;  3SV4 A;  3NF8 A;  4W5T A;  1T03 A;  4HCB A;  3KJV A;  3V9W A;  1TKD A;  2FC0 A;  4DTM A;  1JLQ A;  4KPY A;  2HHW A;  4AHT A;  2E6M A;  4CJV A;  2VG6 A;  3SQ1 A;  4HHT A;  3SUO A;  1NKC A;  3PX4 A;  5K14 A;  3B6P A;  1BIZ A;  3MXI A;  3TAQ A;  4Q5V A;  3V6D A;  1IKX A;  1J5O A;  1SV5 A;  4DF4 A;  4JS4 A;  1C0T A;  1I3A A;  5E41 A;  4ZHR A;  2DY4 A;  1REV A;  3AVC A;  1QQC A;  3OJS A;  3L2U A;  3T1A A;  1QSS A;  4QOZ B;  1RBT A;  2OPQ A;  4JRP A;  3HST B;  3RRG A;  2LSN A;  4DSK A;  1RTJ A;  1RTI A;  4KHW A;  1ZBH A;  2HHT A;  1QTM A;  3ZT2 A;  1QS4 A;  2A1S A;  3CYM A;  1DTT A;  4OGE A;  3KK1 A;  1ZYQ A;  4RW9 A;  4DQR A;  3NF6 A;  4LSL A;  2YHB A;  1SL1 A;  3IG1 A;  3QER A;  3ZT3 A;  4B08 A;  4ID5 A;  1SL2 A;  2OZM A;  4FLZ A;  3ZT1 A;  2Q3S A;  3QEX A;  4AHU A;  3MED A;  3EYZ A;  1SUQ A;  4ZTJ A;  2P5G A;  4K8X A;  1CLQ A;  3AVM A;  4M3T A;  3CFO A;  3M8Q A;  3VQ9 A;  4NYF A;  3LP2 A;  2IGI A;  1IO2 A;  4DQQ A;  2X78 A;  3HPG A;  1CZ9 A;  4DTS A;  2QKB A;  4DSE A;  1NK4 A;  3ZSX A;  3VQ6 A;  3ZSO A;  4CED A;  1JXB A;  3DRR A;  3NGI A;  3S3N A;  2F96 A;  3V9U A;  3RMD A;  1NK5 A;  1NK0 A;  1S1X A;  4CJW A;  4YNQ A;  3NBP A;  3K58 A;  2AJQ A;  4FLW A;  2JGU A;  4CGJ A;  2YV0 X;  2GBZ A;  4FJM A;  4M3Y A;  1I39 A;  4B9S A;  3CM6 A;  3PY8 A;  4CJQ A;  3AA3 A;  4LH4 A;  3QO9 A;  3VQD A;  4ELU A;  4FJ9 A;  4LY7 A;  1WSJ A;  2Z1I A;  4G1Q A;  4FJ7 A;  4DSL A;  4PA1 A;  4KHS A;  2HHX A;  4CJF A;  2YNI A;  1BGX T;  2Z1H A;  4O0I A;  1YTU A;  1JLG A;  1YVU A;  1JLE A;  1VSE A;  4H4M A;  5FRN A;  1KVA A;  1VSD A;  3DOL A;  3V1O A;  2OYQ A;  4CEF A;  4IBN A;  1S1T A;  5KI6 A;  4W5N A;  3PX6 A;  4K8Z A;  1W9H A;  3VQ8 A;  3HPO A;  3SYZ A;  3PO5 A;  4FLT A;  3ZSQ A;  3OYN A;  1RDB A;  2FBX A;  1B92 A;  4KI6 A;  4FXD A;  3D0P A;  4GMJ B;  3HYF A;  3LDS A;  4PY5 A;  1LV5 A;  2RKI A;  4OVL A;  3VQ4 A;  1RBU A;  4E0D A;  4J2E A;  3KLE A;  1ZBI A;  4O5B A;  4KHN A;  1LWC A;  1X9S A;  4DFM A;  1RIL A;  4E7K A;  2KZZ A;  3VA0 A;  4J2A A;  4CIE A;  2XY6 A;  1GOB A;  1BHL A;  3NHG A;  4OPK A;  4RG8 A;  3VN5 A;  3KTQ A;  4F4K A;  1Q9Y A;  5JS2 A;  3HT3 A;  4DS5 A;  2X6N A;  4FW2 A;  3SZ2 A;  4ID1 A;  1TAQ A;  1JLB A;  3NE6 A;  1TGO A;  3QLH A;  4GW6 A;  1QHT A;  3L3U A;  4C8O A;  3QIP A;  4OLA A;  4B8A B;  4JS5 A;  1ZBU A;  4CJT A;  2XHB A;  4CFD A;  4DQP A;  3DI6 A;  1LWF A;  1TKX A;  2PYJ A;  4FJH A;  1ASW A;  4FLV A;  2KW4 A;  3OYG A;  4CJL A;  4I9Q A;  3DLE A;  3ZT4 A;  3ZSV A;  3V9X A;  4BE2 A;  4CGH A;  4NCA A;  2HHS A;  1IG9 A;  3VQQ A;  3RMA A;  3AVH A;  1K6Y A;  4CFC A;  2ATQ A;  4CHY A;  3QEP A;  4AH9 A;  5HP1 A;  3NCI A;  4FJK A;  2O4I A;  1B9D A;  2HW3 A;  1UAX A;  1YTA A;  4DQS A;  1BCO A;  1C1A A;  3L8B A;  3S3O A;  3HO1 A;  3VQP A;  3OYE A;  3ISN C;  4AHS A;  4J2D A;  4E7H A;  1Q8I A;  2QKK A;  5FRM A;  4FJG A;  3K5N A;  2IDO A;  3LAK A;  1WNS A; 
#chains in the Genus database with same CATH topology
 1NWK A;  4CF1 A;  4DTR A;  3OS2 A;  3U6F A;  4FPB A;  3PUF A;  3VQE A;  1J54 A;  3HVT A;  2PY5 A;  2W40 A;  1RTD A;  3VES A;  3O3G A;  4KB0 A;  2OCE A;  1HKB A;  3AAR A;  2B6A A;  3KK2 A;  1P90 A;  4F2S A;  1NGA A;  2PAV A;  3THY B;  5EOY A;  2QA4 N;  1ATS A;  1BL3 A;  3PX0 A;  1KAZ A;  3K9K A;  3CCM N;  4DR6 K;  1RDD A;  3WXJ A;  2BTF A;  3D45 A;  1BDG A;  4FZX C;  4IEI A;  5M1Q A;  2D5R A;  2E4L A;  3S3M A;  1TUY A;  3FZH A;  4DUY K;  3O8M A;  1RBV A;  2ITM A;  3TAE A;  3KLH A;  3AA2 A;  3THY A;  2ZJP L;  3LL3 A;  3VQ5 A;  3KLG A;  1RBR A;  3F9K A;  3BDP A;  2VWB A;  4I9L A;  3DXM B;  1KVC A;  3U9Z A;  4CJ4 A;  4N47 A;  5J2N A;  4PQU A;  1K8A O;  3ALY A;  1L5U A;  4NXN K;  2HVI A;  4CK2 A;  1SS6 A;  4BC2 A;  2D0A A;  1GLL O;  2GUP A;  2HB5 A;  3DLK A;  1SKS A;  1HQU A;  4CHN A;  4WYB A;  3NAE A;  4C8N A;  5KPT A;  3CQY A;  3I55 N;  3OYA A;  5C24 A;  1G99 A;  3L6Q A;  4YOX A;  3WXI A;  1KLM A;  1RNH A;  2HST A;  2NNW A;  2A1R A;  2OPR A;  2QWL A;  4OKE A;  3J7A P;  1CZB A;  5DM7 L;  4WQ4 A;  4E7J A;  3OW2 M;  4EZ9 A;  5A2Q O;  3SUN A;  3LPU A;  2XRI A;  4DG1 A;  1NK6 A;  4FWS A;  5LMU K;  3ASM A;  1YI2 N;  5AQO A;  4H8K A;  3TWH A;  3MDQ A;  5HRR A;  3VQC A;  1U04 A;  4TSX A;  3HL8 A;  3QML A;  3HP6 A;  1HNX K;  4FYD A;  3WXM B;  3ZX3 A;  3O3H A;  2PYL A;  4BE1 A;  2KZM A;  2I7P A;  4KHU A;  3FZF A;  3EN9 A;  5TKW A;  4BRL A;  1X3M A;  1ASU A;  4FVM A;  3HI0 A;  4WQ4 C;  4KRE A;  2IC3 A;  1XQS C;  4E19 A;  4A2B A;  1ZBF A;  3B6O A;  5FPN A;  4Z94 A;  3AVJ A;  1WSI A;  3VA3 A;  1F21 A;  3TTD A;  4JK9 A;  3P39 A;  1X9J A;  2HNY A;  4BE0 A;  1WB9 A;  3OVN A;  4DTN A;  4CZK A;  4M7X A;  3DXK B;  4BQZ A;  4GVE A;  1WOQ A;  1QVG M;  1DLO A;  3GE1 A;  1QQN A;  1S6Q A;  4KHY A;  5BRF A;  3G25 A;  3P5J A;  3K2P A;  3HPH A;  3OS0 A;  4DR7 K;  4DTX A;  4E89 A;  3T1H K;  4M3Z A;  1J9A A;  3C6A A;  4NCB A;  5AQK A;  1Q82 O;  1D8Y A;  4B9V A;  1VRU A;  1CXU A;  3VF2 A;  3DWL A;  3GBT A;  2UUB K;  4A62 A;  3HZ6 A;  3V1Q A;  4H5N A;  2Y1J A;  2A41 A;  1IBM K;  3SV3 A;  3VER A;  5HRP A;  1LCU A;  2UU9 K;  3MEC A;  1I94 K;  1HX1 A;  4IDH A;  3VQ7 A;  4FZZ A;  5M1O A;  3U9D A;  3EZW A;  3S41 A;  1HNI A;  2H3G X;  5ELZ A;  4CBW A;  4YFU A;  4A59 A;  1KTQ A;  1TV6 A;  4BC3 A;  1BWF O;  4ILG B;  1U4B A;  1NOY A;  3O3F A;  5H1S Q;  5FRO A;  1D5A A;  3U4L A;  1VHX A;  4V19 S;  5BRH A;  4ELV A;  4B1Z A;  2A5X A;  4JI0 K;  4CGF A;  1S1W A;  3THX B;  4FO0 A;  3FE1 A;  2V52 B;  3OYB A;  4BRC A;  2IAJ A;  3CXC M;  5SWM A;  4LF4 K;  4Z4I A;  4CBX A;  4E1N A;  2G8W A;  4PHT X;  1Q86 O;  3VEY A;  2D4W A;  1O13 A;  1TVR A;  2VQE K;  4B1U B;  4DSJ A;  4F8R A;  1CXQ A;  4GV6 A;  3QEW A;  4DS4 A;  2G8K A;  1S1V A;  1YJN N;  2OPS A;  1U47 A;  2HHQ A;  4JV5 K;  4F3T A;  1EX4 A;  1NOZ A;  4GNI A;  5GIN A;  1C1B A;  3OYF A;  1NJX A;  5AQX A;  4FWQ A;  1VSI A;  3WNF A;  2E6L A;  2NRW A;  4YOW A;  2VGN A;  3O9Q A;  1YIT N;  2HND A;  4BR2 A;  3NH0 A;  4C1N I;  4FWL A;  3KIO A;  2V51 B;  1ATR A;  2IVN A;  5JIC A;  4DV7 K;  4CEC A;  1RT2 A;  4M3X A;  5BN9 A;  4L3Q A;  3G10 A;  3UE5 A;  1WAJ A;  1XC9 A;  3LP0 A;  2E1Y A;  3UKU A;  4BVO A;  1C0U A;  2E5L K;  3E9L A;  4BVP A;  3CCL N;  4E1M A;  2BH1 A;  3AA4 A;  1HYZ A;  4BG8 A;  3HRG A;  3H46 O;  3PSF A;  3O80 A;  3F2K A;  3CM5 A;  4B3S K;  1NM1 A;  5E26 A;  4E7L A;  1RT1 A;  2P51 A;  4U7B A;  3LAL A;  3QNN A;  3ZSR A;  2D1K A;  3AV9 A;  3H08 A;  1OVY A;  5AQU A;  4CEB A;  3HJF A;  3H1V X;  1UWB A;  1VAZ A;  2ITG A;  3NGY A;  3VOV A;  5AFU A;  3IMX A;  2D0O A;  1WSF A;  4B9N A;  1BG3 A;  3CC2 N;  1OKJ A;  4HUE A;  1JCE A;  3SBG A;  1KAY A;  2HBK A;  2P9I B;  3MEE A;  3K59 A;  4FLY A;  4PUO A;  4JKA A;  4JHD B;  1L3U A;  4HUG A;  1C0F A;  3C94 A;  1XHZ A;  1K73 O;  1NJY A;  4XEI A;  3TPQ A;  4NYN A;  3O9T A;  1LW0 A;  4HCB A;  3V9W A;  1IG8 A;  5AQZ A;  2HHW A;  2FLO A;  1K9M O;  4YOU A;  5FPD A;  4IOC L;  2P9I A;  4Q5V A;  5GAD P;  4JHD A;  3IKM A;  2DY4 A;  3AVC A;  1ZBS A;  3KK7 A;  4LF9 K;  3IDH A;  2BUP A;  1NGJ A;  2ZGY A;  4PKI A;  4DSK A;  4JD2 B;  3ZT2 A;  4K43 A;  2PBD A;  4DQR A;  3NF6 A;  3IG1 A;  4WF9 L;  3CJ1 A;  3TTF A;  3ZT3 A;  3QER A;  4ID5 A;  1SL2 A;  2OZM A;  5FPM A;  4JI3 K;  3ZT1 A;  3MED A;  2P5G A;  3PIO L;  4YDU C;  3AVM A;  4M7Y A;  1W2B M;  1IO2 A;  2X78 A;  3FR0 A;  1CZ9 A;  4GV3 A;  3ZSO A;  3VEN A;  4H0O A;  2F96 A;  5AQT A;  4H5R A;  1DGK N;  3CI5 A;  1S1X A;  2GBZ A;  4JD2 A;  2A6A A;  3PY8 A;  3ID8 A;  4FJ9 A;  3BF1 A;  2HHX A;  2E20 A;  2YNI A;  3LDP A;  1JLG A;  3L4Q A;  1YVU A;  5JVH L;  4H4M A;  3V1O A;  2OYQ A;  4CEF A;  2CGL A;  5KI6 A;  3PX6 A;  4K8Z A;  3PO5 A;  4FXD A;  3ZSQ A;  4CD3 A;  5F2R A;  1LV5 A;  2RKI A;  3P4I A;  3VQ4 A;  1RBU A;  2F4V K;  4O5B A;  1WUA A;  4KHN A;  4DFM A;  1VQM N;  4J2A A;  2CH6 A;  1GOB A;  3VN5 A;  4FW2 A;  1RDW X;  4DHY A;  3QLH A;  4GW6 A;  1QHT A;  2ZF5 O;  3QIP A;  4B3R K;  5AQS A;  1TKX A;  4BRP A;  1U6Z A;  4FSV A;  3OYG A;  3ZSV A;  1T6D A;  1U2V B;  3O1W A;  4JKC A;  4CGH A;  1NGB A;  3RMA A;  5HP1 A;  1B9D A;  4U67 L;  3CJ9 A;  3UKR B;  3S3O A;  2V7Z A;  4BRI A;  4J2D A;  3QFU A;  4H03 B;  4DV4 K;  2QEX N;  1XNQ K;  2IIR A;  4QS7 A;  3OYD A;  3LDN A;  5CHI A;  1WNS A;  4DV1 K;  4B8C A;  4O4G A;  4LH5 A;  4WE1 A;  5D3G A;  3CJB A;  3M3Z A;  4HVJ A;  3FFK B;  4CEQ A;  1S9G A;  5TKY A;  2UXD K;  5I42 A;  4EZ6 A;  3L2W A;  3TAP A;  3AAP A;  1VQP N;  1YJW N;  3E9O A;  1U2V A;  2BAN A;  1RDA A;  4FLX A;  1KSP A;  4A5A A;  3AA5 X;  3BZK A;  4FK0 A;  4NCG A;  3VET A;  3OYC A;  4BDZ A;  1HRH A;  4W5O A;  4FJ5 A;  3SAH A;  1NG9 A;  3RR7 A;  3E9P A;  2DPN A;  1TAU A;  3BY5 A;  3M8P A;  2IOC A;  5KRT A;  3D6R A;  4RW4 A;  4FOI A;  4IOX A;  1NGG A;  5KGX A;  4WFN L;  4FWK A;  4DFP A;  1KFS A;  4JYA K;  3AO4 A;  1BIS A;  2GUI A;  4EP4 A;  5KPZ A;  1T7P A;  4MQ3 A;  2HBM A;  4I7F A;  3VEX A;  5HOO A;  1RT6 A;  1S1U A;  4CIF A;  4JKE A;  2Z1J A;  4N5S A;  1OH7 A;  3P38 A;  3TSU A;  3TSQ A;  1JLC A;  2P9P B;  1RFQ A;  4BQL A;  3OJU A;  3C95 A;  1SKW A;  1K8K A;  4IFV A;  3CJC A;  5T7B A;  3H45 C;  4FWM A;  3QFP A;  4HCC A;  4IDK A;  3EEQ A;  1TKT A;  3C6U A;  2QXL A;  1RTH A;  5AZI B;  3VF6 A;  4I6M A;  2KLA A;  3M1F A;  5J2M A;  1WLJ A;  4K0K K;  2IVP A;  1GLF O;  4HTU A;  2O8C B;  1YXQ A;  3N4Q A;  3Q7C A;  1JJ2 M;  2ZQB A;  1RCH A;  4CFB A;  3CCE N;  1OH5 A;  4X65 K;  3JYT A;  3MEG A;  4X62 K;  5AZI A;  4FJ8 A;  3SCX A;  1IBK K;  4CHO A;  4A57 A;  4Z4F A;  2KFN A;  4MO5 A;  2YI1 A;  4PWD A;  3KWG A;  4CK1 A;  1WN7 A;  1DKG D;  4RW6 A;  3EZ5 A;  2D0C A;  4OKK A;  4PL7 A;  3VPZ A;  1EQY A;  3FGU A;  3A5M C;  4KRF A;  3DLR A;  3T3F A;  2A42 A;  4DTP A;  1WSG A;  1HPZ A;  3AO3 A;  3LWL A;  5BPN A;  4CJ3 A;  4A2A A;  5CYM A;  1VSK A;  2E88 A;  4BWM A;  3PV8 A;  2DFH A;  2P9K B;  4B3T K;  2E2O A;  3SQ4 A;  5AQP A;  2O4G A;  4MO4 A;  3CHW A;  1BA1 A;  3E01 A;  4BC5 A;  1TL3 A;  4CF9 A;  3K0S A;  1UA0 A;  4JK8 A;  3EKS A;  2G8U A;  3ZYY X;  1S9E A;  2HHH K;  1FJG K;  1HMV A;  4DQ8 A;  1XHX A;  4AHC A;  4BR4 A;  4BRH A;  1YUW A;  2Q36 A;  3ID6 A;  4KTW A;  1HJR A;  2HBL A;  1NBW A;  2E1Z A;  5MLC Q;  4O8K A;  2FF6 A;  3SAG A;  1D9D A;  1KXP A;  1W0H A;  1HPM A;  2QWM A;  3L2Q A;  2EWS A;  3TAM A;  3CPE A;  2P9K A;  2HF4 A;  2JWK A;  2YNG A;  3I56 N;  5AQV A;  1C6V A;  3HP9 A;  2O8D B;  5BRD A;  1SZ2 A;  1HNZ K;  1WBD A;  5GIP A;  1WBB A;  1BU6 O;  4UY8 O;  1VRT A;  2WUS A;  3WNG A;  3HVR A;  1Z25 A;  4DTO A;  3M8S A;  4AHR A;  4GV9 A;  3ATV A;  3RRH A;  5J1E A;  1SL0 A;  2HHV A;  3V9Z A;  1OVQ A;  3BGR A;  4LFA K;  5FDL A;  4OLB A;  3VEW A;  4DU4 A;  1NK9 A;  3KK3 A;  1QZ6 A;  2DFF A;  2E2N A;  4JKG B;  2O8D A;  2NRZ A;  2QWN A;  4OKJ A;  1ILY A;  3I8D A;  2FBY A;  3KD5 E;  2G8V A;  4CEO A;  4O44 A;  4BR9 A;  3AVG A;  2GEM A;  1W7A A;  5C0Y A;  3HK2 A;  1QZ5 A;  3PLA A;  3NMU A;  3V4I A;  1ZXO A;  5AQN A;  1YIJ N;  4IOA L;  4OX9 K;  1N33 K;  4B1V A;  1X1P A;  5DK5 A;  1EO1 A;  4CBU A;  3GOI A;  2G8H A;  1Q81 O;  3DXM A;  3K5O A;  3LM2 A;  5BPL A;  2ZD1 A;  2D0P A;  5FPE A;  1FKO A;  4NXM K;  1RDC A;  1ZBL A;  3M5R A;  3CIP A;  1N5Y A;  1VSH A;  5I3U A;  1IBL K;  2R7Y A;  4OGC A;  5F1X A;  4FZY A;  3DYA A;  3QIO A;  4DU1 A;  1BOT O;  5AQY A;  5AZJ B;  3AVN A;  4F2R A;  3KKR A;  3DM2 A;  4DWI A;  1Q9X A;  4AF1 A;  1EKE A;  2W6K A;  3PSI A;  5C42 A;  1EP4 A;  1VSM A;  5M1F A;  4FK4 A;  4ISG A;  4CZE A;  2QWP A;  2A3Z A;  1T05 A;  1KCF A;  3OBY A;  1RGI A;  2E2P A;  1XMQ K;  5GAG P;  3OYH A;  4FJJ A;  3O4W A;  4H0V B;  1XUP O;  2EHG A;  1FXX A;  4CZG A;  2YCH A;  1XMO K;  5LMN K;  3MCP A;  3TAB A;  1B9F A;  1GLJ O;  5J2Q A;  3DRS A;  4CHP A;  3SUP A;  4MLE A;  3ZSY A;  2FSN A;  2EX3 A;  1O1W A;  2HNZ A;  3QES A;  4CJR A;  1R0A A;  5AQL A;  3DRP A;  1VSL A;  1NGH A;  4IXC A;  2ASP A;  2NRH A;  2VYP A;  3C7N B;  3Q7B A;  4WFB L;  2P1J A;  4CJ5 A;  4H0Y B;  2O8E B;  2NRX A;  3LWM A;  3IS9 A;  4I2P A;  4JKF A;  3VQB A;  3WQT A;  4C8K A;  4H5V A;  4CJP A;  2P9U B;  3DXK A;  4ILJ A;  4KO0 A;  4B9U A;  3SMS A;  1GLA G;  2GWJ A;  3NF8 A;  4W5T A;  1H1V A;  1NGI A;  2GTD A;  4DTM A;  4AHT A;  3HOT A;  1CZA N;  4CJV A;  1J5E K;  4HHT A;  4OPH A;  3CJA A;  4M63 C;  1N32 K;  4BRK A;  2P9S B;  1BIZ A;  3MXI A;  2QWQ A;  3C7N A;  3TAQ A;  3V6D A;  1VQN N;  2O8E A;  4JS4 A;  1I3A A;  4ZHR A;  4IO9 L;  1REV A;  1QQC A;  3L2U A;  4FWO A;  3T1A A;  1Z05 A;  5ADX H;  4BR7 A;  4QOZ B;  1SAZ A;  3RRG A;  2LSN A;  2OTJ N;  1QS4 A;  4LSL A;  4BRM A;  3QEX A;  1CLQ A;  4AHU A;  3EYZ A;  1SUQ A;  2AP1 A;  3M8Q A;  3VQ9 A;  2P9S A;  4NYF A;  3LP2 A;  1KQS M;  3SMP A;  4AQY K;  4DTS A;  1NK4 A;  3ZSX A;  5AQH A;  3DRR A;  1GLD G;  4QS8 A;  3V9U A;  3RMD A;  1NK0 A;  4YNQ A;  3K58 A;  2AJQ A;  3THX A;  2OAN A;  4CGJ A;  4FJM A;  4M3Y A;  4B9S A;  3AA3 A;  4LH4 A;  3VQD A;  2Z1I A;  3DLL L;  3BZC A;  4CJF A;  4DV2 K;  1YTU A;  5FRN A;  4JKB A;  5M1N A;  4IBN A;  1SQK A;  1W9H A;  3UB5 A;  3VEV A;  3SYZ A;  4FLT A;  3CMA N;  3LDO A;  4GMJ B;  4BGB A;  4PY5 A;  2E2Q A;  4OVL A;  3O5B A;  4E0D A;  3KLE A;  1LWC A;  3ZET B;  4E7K A;  2YHY A;  4H0X B;  4CIE A;  3NHG A;  4F4K A;  4RG8 A;  1JLB A;  1TGO A;  4C8O A;  5AQQ A;  4CZJ A;  4F9O A;  4B8A B;  3G6E N;  1JCG A;  1ZBU A;  2XHB A;  2HF3 A;  3AAQ A;  4CFD A;  4EFH A;  4DCH A;  1LWF A;  4FJH A;  1Z6R A;  4FLV A;  5GAE P;  2QWR A;  4BE2 A;  2HHS A;  3FLC O;  4DUZ K;  4CJ7 A;  2ATQ A;  4AH9 A;  2O4I A;  3MWT A;  1BCO A;  1C1A A;  3L8B A;  4KBO A;  4Y0W A;  1Q8I A;  3MWP A;  2IDO A;  3LAK A;  4DB3 A;  2BGG A;  3L4I A;  5EU7 A;  3AVK A;  1JKH A;  3M6G A;  1V4T A;  4RTF D;  3TAG A;  3VTI A;  3CJ7 A;  1RBS A;  4DV5 K;  3LP3 A;  3QET A;  2ZE2 A;  4EP5 A;  4F3O A;  3I0R A;  4RW7 A;  5HLF A;  1U49 A;  1S5J A;  3RMB A;  4Z4C A;  4CJE A;  1XWL A;  3QBW A;  2VWK A;  1HUX A;  1A5V A;  3K5L A;  3ULE B;  3KKS A;  3LAN A;  3EE8 A;  3R9P A;  3SAF A;  1FW6 A;  4N76 A;  4FM2 A;  1BCM A;  2YNF A;  3JS6 A;  2B5J A;  4N41 A;  3NH2 A;  2YKM A;  3TU5 A;  4M3R A;  4NLC A;  1NJW A;  2KHO A;  3LP1 A;  5EY4 A;  3P1G A;  4CJK A;  2ETJ A;  2ZWH A;  3L3V A;  4DFJ A;  1IH7 A;  3MAQ A;  1VQL N;  4KV8 A;  3VGK A;  3IFR A;  1MWM A;  3DLH A;  5CR4 A;  3O9R A;  3MN7 A;  3CET A;  3IAY A;  1NU0 A;  4Q0B A;  4BWJ A;  4YOY A;  2HVH A;  3VQA A;  1X3N A;  4LC9 B;  4CZL A;  5JLF A;  1TK0 A;  3ZSZ A;  1BQN A;  3P31 A;  1G15 A;  1MU2 A;  4O55 A;  1EWQ A;  1Y64 A;  3MX5 A;  4B3M K;  4H4O A;  4CF0 A;  4R5P A;  4CES A;  4WCE L;  4IG0 A;  2UXC K;  3V1R A;  4B9M A;  5CY4 A;  4GY2 B;  1FK9 A;  1JL1 A;  4CFA A;  1D4X A;  3S9H A;  1IKW A;  4Z4H A;  2IS3 A;  4DMN A;  4CGI A;  3ZT0 A;  4E1J A;  1GOA A;  4ICL A;  3AVB A;  4E3S A;  1N36 K;  3CQX A;  4NLB A;  5HL7 L;  3OYJ A;  5DMR A;  2OZS A;  1WSH A;  2NUB A;  1LW2 A;  2RE2 A;  1ZC6 A;  3BUZ B;  4FM1 A;  5KGW A;  3PIP L;  1QSL A;  1XC3 A;  2Y1I A;  3CCR N;  4W5R A;  3O1B A;  3EY1 A;  4DV3 K;  3SLC A;  3THW B;  1RT3 A;  4KTZ A;  4CCH A;  2P9L B;  3A5L C;  1E4F T;  5AJ3 K;  2RN2 A;  1BIU A;  1VQ8 N;  1LOT B;  1NGE A;  4ELT A;  3L2V A;  3IRX A;  4JAX A;  5C2F A;  4AHV A;  2HMP A;  2P5O A;  4XH5 A;  2UYT A;  2YNH A;  4B9Q A;  3R8E A;  4DR1 K;  4FJL A;  5HRN A;  3C6T A;  3D2E B;  1YAG A;  3DOK A;  2OA8 A;  3VGM A;  5CE3 A;  5C15 A;  3SJJ A;  2G8F A;  4Y1D A;  4BRN A;  1KRP A;  5E84 A;  3UKR A;  2HMI A;  3ITH A;  1TYQ B;  1TUU A;  4B1X B;  2YHW A;  2GX9 A;  5KTQ A;  2QW9 A;  3AVI A;  3UIQ A;  3AVA A;  5FLX O;  4FJN A;  3ATU A;  3OHR A;  3M8R A;  2VWJ A;  3SI6 A;  2V7Y A;  4DSF A;  3SPY A;  2Q31 A;  2RF2 A;  3NF9 A;  3D2E A;  3QIN A;  3OYK A;  4FK2 A;  1NLV A;  2QWO A;  1DT9 A;  1VSF A;  3L0Q A;  4B1W B;  4IO8 A;  5CYQ A;  4G9Z A;  3SK3 A;  3LZI A;  2X6S A;  3A5N C;  1KLN A;  3SQ0 A;  3O6W A;  4BGA A;  3DMJ A;  1Q7Y O;  3CFR A;  4JK7 A;  4CZF A;  2O8B B;  3WNE A;  3ZSW A;  5F0X A;  5BRE A;  1VSJ A;  2WOM A;  3LAM A;  1C1C A;  3O9U A;  5BPM A;  4DLE A;  3MK6 A;  4IWV A;  2DTU A;  1KD1 O;  4LD0 A;  4CZH A;  4FPA A;  3TI0 A;  2Q2R A;  3G71 N;  2QM1 A;  5LJW A;  2FSJ A;  2Q1N A;  2RHK A;  4JI4 K;  3HOS A;  2DFE A;  4YOT A;  3NFA A;  4CE9 A;  4CVN E;  3AGR A;  4Z0U A;  4KFB A;  3N4P A;  2P9P A;  3TAR A;  1L3S A;  1T8E A;  2X74 A;  3L2R A;  2WC9 A;  2IVO A;  4QS9 A;  1YF5 L;  4IZ9 A;  1IV0 A;  3OA9 A;  4R79 A;  1T44 A;  2VG5 A;  5HRO A;  2XY7 A;  4C8M A;  1R59 O;  1IKY A;  2O8C A;  3RTV A;  4CW7 B;  1XI1 A;  4IFE A;  3QEI A;  4DTU A;  1QQO A;  4JEP A;  3DLB A;  4Z4E A;  2QTD A;  5HRS A;  1GLC G;  1VQK N;  3W0L A;  4XH1 A;  3HM8 A;  5HBM A;  5KPR A;  5LL6 Z;  4GKJ K;  3FFI A;  4QAG A;  2B4J A;  4LSN A;  4RW8 A;  2FF3 B;  3JSM A;  5I9E B;  3RMC A;  4C23 A;  1QE1 A;  1VQ6 N;  1TKZ A;  4C8L A;  3U8X A;  1J6Z A;  3SNN A;  1LAV A;  1EXQ A;  3SUQ A;  1VQO N;  2WBN A;  1NJI O;  3LZJ A;  2JLE A;  2BDP A;  3NDK A;  2KQ2 A;  4JLH A;  3GL1 A;  3A2F A;  2UXB K;  3J80 O;  1HNV A;  3ENH A;  2Q0U A;  4H5T A;  3SPZ A;  3OYM A;  3EE9 A;  4KH4 A;  1Y97 A;  3RSE B;  3CF5 L;  1JCF A;  1GOC A;  1JLF A;  2Q97 A;  4J8F A;  4X66 K;  3B8A X;  4I2Q A;  5AQF A;  1WSE A;  1NNE A;  2VG7 A;  1HKC A;  4DR3 K;  4OPJ A;  4DLG A;  4CK3 A;  1QSY A;  3FZK A;  2W42 A;  1TKD A;  2FC0 A;  1JLQ A;  1N8R O;  4KPY A;  1RDU A;  1NKC A;  3RSE A;  3PX4 A;  3OBW A;  5K14 A;  3B6P A;  4LF8 K;  4H5W A;  1OH8 A;  4PKH A;  4AM7 A;  4OO1 J;  3CC4 N;  1QHA A;  3MCA B;  2PFU A;  5IT9 O;  4JKH A;  4JKD A;  4JNE A;  1KC8 O;  2NLX A;  4BG9 A;  3OJS A;  1RBT A;  4WQ5 A;  2OPQ A;  4JRP A;  3HST B;  4KHW A;  2HHT A;  1RTI A;  4H0T B;  2A1S A;  3CYM A;  1DTT A;  1ZYQ A;  3KK1 A;  5AQM A;  1HR0 K;  1HJO A;  2YHB A;  4DR4 K;  4FLZ A;  2Q3S A;  4ZTJ A;  3JAM O;  1QQM A;  3J8A A;  2O8F B;  2FSK A;  4DQQ A;  2QKB A;  4JKG A;  3TTC A;  3LM9 A;  3VQ6 A;  4CED A;  1JXB A;  2A40 A;  4EAH D;  1NK5 A;  1YHQ N;  4JN4 A;  4FLW A;  2JGU A;  3NVK A;  2YV0 X;  4OPA A;  2W6L A;  1I39 A;  3GG4 A;  3CM6 A;  4WQ5 C;  3ZEU B;  1VQ5 N;  3QO9 A;  4ELU A;  3SJH A;  4A61 A;  1WSJ A;  4FJ7 A;  4PA1 A;  3W3D A;  3F5T A;  4O0I A;  1BGX T;  3DAW A;  1E4G T;  2O8F A;  1VQ9 N;  3KHY A;  1VSE A;  1KVA A;  1VSD A;  1S1T A;  4W5N A;  3VQ8 A;  4MDB A;  3HPO A;  2NRR A;  1RDB A;  2FBX A;  3I33 A;  3HYF A;  3LDS A;  4J2E A;  5JMV A;  1X9S A;  5EVZ A;  1RIL A;  3EO3 A;  3VA0 A;  5AFU H;  2VCP A;  3QDK A;  1BHL A;  3ZEU A;  4OPK A;  3KTQ A;  1NGD A;  3HT3 A;  2X6N A;  5JLH A;  3NE6 A;  4OLA A;  5AZJ A;  4O8U A;  5IWA K;  4JS5 A;  3DI6 A;  2PYJ A;  1ASW A;  2KW4 A;  3DLE A;  1HKG A;  3AVH A;  1K6Y A;  2UUA K;  4BY9 C;  3HTV A;  4CHY A;  3QEP A;  4FJK A;  4JI6 K;  1UAX A;  1YTA A;  4DQS A;  3FZM A;  3OYE A;  2CH5 A;  5FRM A;  3K5N A;  5C25 A;  3MN6 A;  4CEA A;  4FLU A;  1N6Q A;  4M42 A;  4QCL A;  1L3T A;  4K41 A;  1IKV A;  1ATN A;  3EKU A;  5CZ2 A;  4MFB A;  2YKN A;  3CCQ N;  5BR8 K;  1BO5 O;  3ENB A;  4KHQ A;  1N34 K;  2F8T A;  4DV6 K;  4ZTF A;  4NB4 A;  4CIG A;  2NZT A;  1MDU B;  3ZX2 A;  2XY8 A;  3H1Q A;  3EL2 A;  4X64 K;  3O4Q A;  3QB0 A;  1J53 A;  3E1Y A;  3MXJ A;  3AVF A;  4AM6 A;  1NK8 A;  1RT7 A;  3TAN A;  2YJF A;  3U3G A;  1HLU A;  5J2P A;  1P8Z A;  2P9U A;  1KVB A;  5BN8 A;  2I5J A;  4XH4 A;  1U45 A;  4BRD A;  2F8S A;  5KRS A;  3OTO K;  3J7Y P;  3F73 A;  2FXU A;  3TAF A;  2VGM A;  3SQ2 A;  2ASM A;  3ULD A;  4LF7 K;  1KAX A;  3H3N O;  2GEL A;  3WXK A;  3K57 A;  1S22 A;  1ASV A;  3IUC A;  4BDY A;  1JXE A;  4O5F A;  4BR0 A;  4FVU A;  4BRO A;  3NH1 A;  4DQI A;  1LWE A;  1FKP A;  3CC7 N;  4BRF A;  4KTQ A;  1RT4 A;  3TR8 A;  4CHZ A;  4HUF A;  4W5Q A;  4BRG A;  4LFC K;  3ZX0 A;  3UKU B;  4KHP K;  3OS1 A;  4C1N K;  4YHH K;  4BAC A;  1WAF A;  4DF8 A;  1NKB A;  3C6H A;  4N56 A;  4MLH A;  2XY5 A;  4IG3 A;  4IFY A;  1S72 N;  1S6P A;  2ZM6 K;  2GWK A;  3CER A;  3BF3 A;  3CCV N;  3BP8 A;  2CGJ A;  3QEV A;  3VF4 A;  3MXM A;  1QVF M;  2F9T A;  4CZI A;  1OH6 A;  2XO7 A;  2PZS A;  2KFZ A;  2ZJQ L;  1TK5 A;  2QXF A;  5AQW A;  4JI2 K;  4CEZ A;  4RWT A;  4DV0 K;  1NGC A;  3THV A;  3OY9 A;  4JI5 K;  4DR2 K;  4DFK A;  4B9L A;  1JL2 A;  3AO2 A;  1JLA A;  2BE2 A;  1A5X A;  4IJN A;  2RPI A;  4BDP A;  2VQF K;  3PO4 A;  2ZJR L;  4CEE A;  4J2B A;  3ZET A;  1D9F A;  2I7N A;  1BUP A;  1V4S A;  3U3Y A;  4KAZ A;  2P9N B;  1HQE A;  2KKZ A;  3LDQ A;  5EXW A;  5SZT A;  5KQD A;  4BRA A;  4GKK K;  4CER A;  1BQM A;  4KH5 A;  3CG7 A;  3HXM A;  1SKR A;  3K5M A;  3O4N A;  4ILH A;  1DEJ A;  4YOR A;  1NKE A;  2G8I A;  1LAW A;  2FBV A;  3AVL A;  3DLG A;  2D0B A;  2CGK A;  3RWU A;  3ZCM A;  2Z1G A;  5KQ8 A;  2WTU A;  4ISF A;  4GVM A;  4CF8 A;  3V9S A;  3MN5 A;  3OYI A;  2OTL N;  3MX2 A;  3KVG A;  2GV9 A;  1ITG A;  3LPT A;  4FOE A;  2UUC K;  1HYV A;  4PKG A;  2P9N A;  4UQG A;  3HM9 A;  3VEZ A;  3WNH A;  4B1Y B;  5C2D A;  3ZLJ A;  1TK8 A;  2ZGZ A;  3WQU A;  4YDU A;  4BRQ A;  4KKO A;  2YJE A;  1C0G A;  3R1X A;  3F9M A;  3P83 D;  3OYL A;  3CFP A;  3C0B A;  3ULE A;  5AR0 A;  2HBJ A;  3R3L A;  3TSP A;  5JS1 A;  3AGK A;  1C0M A;  4B9T A;  3KLI A;  2YHA A;  2KTQ A;  4FJX A;  3I0S A;  3AO5 A;  1U48 A;  3G0Z A;  2HHU A;  3CQ8 A;  5JVG L;  3WUH A;  4JRQ A;  3QNO A;  3D7E O;  3QIC A;  4WFA L;  4CGG A;  2W41 A;  1T3V A;  4B3O A;  3AY9 A;  3T1Y K;  4CZM A;  1NK7 A;  4YY3 K;  4DTJ A;  1X9M A;  2JWL A;  1TL1 A;  4Y1C A;  2FBT A;  1Q18 A;  4CF2 A;  2NRV A;  1BI4 B;  4Z4G A;  5ADX A;  4EHT A;  4RCH A;  4HWI A;  4IKF A;  4FWN A;  4CHQ A;  4PL8 A;  4LF6 K;  3GDQ A;  3T19 A;  4EHU A;  3HBT A;  3HSC A;  3WXL A;  1HYS A;  3K9J A;  4DR5 K;  1IJJ A;  2F7T A;  4CJS A;  1Z26 A;  4E7I A;  3J7Z O;  1UOC A;  3CCS N;  1X9W A;  4JI8 K;  4JI7 K;  4M3U A;  4XIU A;  4CGD A;  3JXU A;  5AQJ A;  4L8R B;  1BA0 A;  3T69 A;  4DSI A;  4FM0 A;  1EET A;  3QBX A;  4CD1 A;  1BI4 A;  4LFB K;  4DU3 A;  1YT3 A;  3NGZ A;  2AA4 A;  5C12 A;  2OPP A;  4O0J A;  3AO1 A;  4FWR A;  5LJV A;  3NF7 A;  4CJU A;  3A5O C;  1EWR A;  4KB1 A;  5GIO A;  5M1P A;  5CZ1 A;  4LF5 K;  3A8Y A;  3O08 A;  1VK0 A;  2QK9 A;  2F9W A;  5B8H A;  1YJ9 N;  1UA1 A;  4FCY A;  1NJZ A;  3KWI A;  3C65 A;  3I8B A;  4BC4 A;  1T6C A;  2YX6 A;  1XNR K;  3V81 A;  3KD1 E;  3THW A;  1DTQ A;  4KI4 A;  1L3V A;  4JI1 K;  3A0I X;  1RT5 A;  2P9L A;  3RR8 A;  4AIL C;  4OJR A;  4FW1 A;  1KFD A;  2WON A;  4FJI A;  4K42 A;  1S3X A;  1M1K O;  3ENO A;  3CPW M;  3J81 O;  3LDL A;  3KZB A;  4M41 A;  4EIA A;  3KLF A;  1A5W A;  1GLB G;  4M3W A;  3SV4 A;  1T03 A;  2ASO A;  3KJV A;  4A5B A;  3NVM A;  5AQR A;  2YHX A;  2E6M A;  3SQ1 A;  2VG6 A;  3CD6 N;  3O9S A;  3SUO A;  1NMN A;  5BR9 A;  1K8K B;  5AQG A;  1TYQ A;  1IKX A;  1J5O A;  1NMD A;  3BEX A;  1SV5 A;  3CCU N;  4DF4 A;  4KH6 A;  1C0T A;  5E41 A;  3E66 A;  4I6M B;  1QSS A;  1GLE G;  1RTJ A;  1YVN A;  3H3O B;  1ZBH A;  5LY3 A;  2WFB A;  1QTM A;  1W97 L;  2E8A A;  4OGE A;  4RW9 A;  1NGF A;  3DJC A;  1SL1 A;  3CME N;  3MMV A;  5EX5 A;  3R6M A;  4B08 A;  5GAH P;  4K8X A;  4BRE A;  4M3T A;  3CFO A;  2IGI A;  3VTH A;  3SBT A;  3MN9 A;  2Q0R A;  3HPG A;  4YOV A;  2O8B A;  1VQ4 N;  4DSE A;  3RVC A;  3S3N A;  3NGI A;  4DKW A;  4CJW A;  3NBP A;  4FL9 A;  4K25 A;  4NO7 A;  4FWP A;  4CJQ A;  3H6E A;  4LY7 A;  3WEE B;  4G1Q A;  4H0P A;  1VQ7 N;  4DSL A;  3FZL A;  4KHS A;  4ISE A;  2Z1H A;  3D2F B;  3VEO A;  2NRT A;  1JLE A;  5C10 A;  4HTL A;  3DOL A;  4IJA A;  4BR5 A;  1E3M A;  4KI6 A;  3OYN A;  1B92 A;  3D0P A;  5AQI A;  3CCJ N;  3G4S N;  1ZBI A;  2KZZ A;  4MDA A;  5DM6 L;  2J4R A;  2XY6 A;  1MWK A;  1Q9Y A;  5JS2 A;  3WEE A;  4DS5 A;  3SZ2 A;  4ID1 A;  1TAQ A;  3D2F A;  3L3U A;  5M1K A;  2QI2 A;  4CJT A;  4IEE A;  4DQP A;  4CJL A;  4I9Q A;  3ZT4 A;  3V9X A;  4NCA A;  1IG9 A;  2HOE A;  3VQQ A;  1MA9 B;  4CFC A;  3NCI A;  2HW3 A;  3T7Z A;  3HO1 A;  3WT0 A;  3VGL A;  3VQP A;  1M90 O;  3ISN C;  4AHS A;  4E7H A;  4CI6 A;  3VMF B;  1ESV A;  2QKK A;  1HNW K;  4FJG A;  4M45 A; 
#chains in the Genus database with same CATH homology
 4CF1 A;  4DTR A;  2BGG A;  4B8C A;  4O4G A;  3OS2 A;  5EU7 A;  3AVK A;  4LH5 A;  1JKH A;  4WE1 A;  3U6F A;  5D3G A;  4FLU A;  4CEA A;  4M42 A;  1N6Q A;  3TAG A;  3PUF A;  4QCL A;  3VQE A;  1J54 A;  1L3T A;  1IKV A;  3HVT A;  4CEQ A;  4HVJ A;  2PY5 A;  1RTD A;  1S9G A;  1RBS A;  5CZ2 A;  3O3G A;  3LP3 A;  4MFB A;  3OYD A;  2YKN A;  2ZE2 A;  3L2W A;  4EP5 A;  3QET A;  3TAP A;  4EZ6 A;  4KB0 A;  4F3O A;  3I0R A;  2BAN A;  1RDA A;  2B6A A;  4RW7 A;  4FLX A;  5HLF A;  1U49 A;  3KK2 A;  1S5J A;  3RMB A;  1KSP A;  4KHQ A;  4Z4C A;  4F2S A;  3AA5 X;  4CJE A;  4ZTF A;  4FK0 A;  4NCG A;  4CIG A;  1XWL A;  2VWK A;  3OYC A;  4BDZ A;  1A5V A;  1BL3 A;  3K5L A;  3PX0 A;  1HRH A;  4W5O A;  1RDD A;  2XY8 A;  3KKS A;  3LAN A;  4FJ5 A;  3D45 A;  3RR7 A;  3O4Q A;  4FZX C;  1J53 A;  1TAU A;  3M8P A;  3MXJ A;  3AVF A;  2IOC A;  2D5R A;  2E4L A;  5KRT A;  3S3M A;  1NK8 A;  4N76 A;  1RT7 A;  4FM2 A;  4RW4 A;  3TAN A;  1BCM A;  2YNF A;  4N41 A;  2B5J A;  3U3G A;  3NH2 A;  5J2P A;  2YKM A;  5KGX A;  4M3R A;  1KFS A;  4DFP A;  1KVB A;  3AO4 A;  1BIS A;  1RBV A;  2GUI A;  2I5J A;  4EP4 A;  1NJW A;  3TAE A;  1U45 A;  3KLH A;  3AA2 A;  2F8S A;  5KRS A;  4MQ3 A;  3VQ5 A;  3LP1 A;  4I7F A;  1T7P A;  3F73 A;  1RT6 A;  1S1U A;  3P1G A;  4CIF A;  2Z1J A;  2ETJ A;  4CJK A;  4N5S A;  3KLG A;  3TAF A;  3SQ2 A;  3L3V A;  1JLC A;  1RBR A;  3F9K A;  4DFJ A;  3ULD A;  1IH7 A;  3BDP A;  4I9L A;  3OJU A;  3MAQ A;  1KVC A;  4KV8 A;  4CJ4 A;  4N47 A;  3C95 A;  5J2N A;  3DLH A;  1SKW A;  4PQU A;  4IFV A;  5T7B A;  3ALY A;  1L5U A;  3IAY A;  4Q0B A;  4BWJ A;  4HCC A;  3K57 A;  4IDK A;  2HVI A;  4CK2 A;  2HVH A;  2D0A A;  3VQA A;  1TKT A;  3C6U A;  1RTH A;  1ASV A;  2HB5 A;  3DLK A;  3ZSZ A;  1HQU A;  4BDY A;  1SKS A;  1BQN A;  4CHN A;  1TK0 A;  5J2M A;  1G15 A;  1MU2 A;  3NAE A;  1WLJ A;  4O55 A;  4C8N A;  1JXE A;  4H4O A;  4HTU A;  4CF0 A;  4R5P A;  4CES A;  3OYA A;  5C24 A;  4IG0 A;  3NH1 A;  4DQI A;  3V1R A;  1LWE A;  4B9M A;  1FKP A;  1KLM A;  1RNH A;  2ZQB A;  1RCH A;  4KTQ A;  5CY4 A;  1RT4 A;  4CFB A;  3TR8 A;  4CHZ A;  4HUF A;  2A1R A;  1FK9 A;  4W5Q A;  2OPR A;  1JL1 A;  4CFA A;  4OKE A;  3JYT A;  3MEG A;  1CZB A;  3S9H A;  1IKW A;  4Z4H A;  4E7J A;  2IS3 A;  4EZ9 A;  4DMN A;  3SUN A;  3OS1 A;  4BAC A;  4FJ8 A;  3SCX A;  3LPU A;  1WAF A;  2XRI A;  4CGI A;  4DG1 A;  3ZT0 A;  1GOA A;  4ICL A;  4DF8 A;  1NKB A;  3AVB A;  4E3S A;  1NK6 A;  4N56 A;  2XY5 A;  4CHO A;  3ASM A;  4IG3 A;  4IFY A;  4Z4F A;  2KFN A;  1S6P A;  4H8K A;  3TWH A;  4PWD A;  5HRR A;  3VQC A;  4CK1 A;  1U04 A;  3OYJ A;  1WN7 A;  4TSX A;  3QEV A;  4RW6 A;  5DMR A;  3HL8 A;  3MXM A;  2OZS A;  4M45 A;  3HP6 A;  3EZ5 A;  2D0C A;  1WSH A;  4OKK A;  4FYD A;  2NUB A;  1LW2 A;  2XO7 A;  4FM1 A;  2PZS A;  2KFZ A;  5KGW A;  3DLR A;  4KRF A;  3O3H A;  3T3F A;  2PYL A;  4BE1 A;  2KZM A;  1QSL A;  4KHU A;  1TK5 A;  2QXF A;  4CEZ A;  2Y1I A;  4DTP A;  1WSG A;  3THV A;  4W5R A;  3OY9 A;  1HPZ A;  3AO3 A;  4DFK A;  3EY1 A;  4B9L A;  3LWL A;  1JL2 A;  1ASU A;  3AO2 A;  4FVM A;  4CJ3 A;  5CYM A;  1RT3 A;  1JLA A;  4KTZ A;  2BE2 A;  1VSK A;  4CCH A;  1A5X A;  4KRE A;  2RPI A;  2IC3 A;  4BDP A;  4BWM A;  4E19 A;  3PO4 A;  3PV8 A;  2DFH A;  4CEE A;  4J2B A;  2RN2 A;  1BIU A;  4ELT A;  1ZBF A;  3B6O A;  3L2V A;  1D9F A;  3SQ4 A;  3U3Y A;  3AVJ A;  1WSI A;  2O4G A;  3IRX A;  3VA3 A;  4KAZ A;  1F21 A;  4AHV A;  1HQE A;  3E01 A;  5SZT A;  1TL3 A;  2P5O A;  4CF9 A;  2HNY A;  4BE0 A;  1UA0 A;  3OVN A;  4DTN A;  2YNH A;  4CER A;  1BQM A;  2G8U A;  3CG7 A;  3HXM A;  1SKR A;  3K5M A;  1S9E A;  3O4N A;  1DLO A;  5HRN A;  1S6Q A;  1NKE A;  3C6T A;  1LAW A;  4FJL A;  4KHY A;  1HMV A;  2FBV A;  3AVL A;  3DLG A;  2D0B A;  1XHX A;  4AHC A;  3DOK A;  3RWU A;  3K2P A;  3P5J A;  2Z1G A;  4KTW A;  1HJR A;  3HPH A;  3ZCM A;  3OS0 A;  3SJJ A;  2OA8 A;  2G8F A;  4Y1D A;  4DTX A;  4E89 A;  4GVM A;  4CF8 A;  1D9D A;  1W0H A;  1KRP A;  4M3Z A;  1J9A A;  3V9S A;  3OYI A;  3L2Q A;  4NCB A;  3TAM A;  1D8Y A;  2HMI A;  4B9V A;  1VRU A;  3ITH A;  1CXU A;  2YNG A;  2GV9 A;  4F8R A;  1C6V A;  5KTQ A;  1ITG A;  3HP9 A;  3LPT A;  3AVI A;  1HYV A;  3UIQ A;  3AVA A;  4UQG A;  4FJN A;  3M8R A;  3V1Q A;  2VWJ A;  2Y1J A;  3HM9 A;  3SV3 A;  3SI6 A;  1VRT A;  3WNG A;  4DSF A;  2G8I A;  3HVR A;  1Z25 A;  5HRP A;  3WNH A;  4DTO A;  3SPY A;  2RF2 A;  3MEC A;  3NF9 A;  4AHR A;  3M8S A;  3QIN A;  3OYK A;  3VQ7 A;  3RRH A;  1TK8 A;  5J1E A;  4FK2 A;  4FZZ A;  1SL0 A;  2HHV A;  3V9Z A;  3BGR A;  1HNI A;  1VSF A;  4KKO A;  5FDL A;  4YFU A;  4OLB A;  1KTQ A;  5CYQ A;  1TV6 A;  4DU4 A;  3LZI A;  2X6S A;  3OYL A;  3P83 D;  3KK3 A;  3CFP A;  3SQ0 A;  2DFF A;  1NK9 A;  1KLN A;  3DMJ A;  1U4B A;  3O3F A;  1NOY A;  3CFR A;  5FRO A;  3WNE A;  3ZSW A;  1D5A A;  5JS1 A;  4OKJ A;  1VSJ A;  2WOM A;  3LAM A;  3I8D A;  1C0M A;  2FBY A;  3KD5 E;  4B9T A;  1C1C A;  4ELV A;  3KLI A;  2G8V A;  2YHA A;  4CEO A;  4DLE A;  4FJX A;  2KTQ A;  3I0S A;  4O44 A;  2DTU A;  3AO5 A;  4CGF A;  1S1W A;  4LD0 A;  3AVG A;  1U48 A;  3G0Z A;  3TI0 A;  2HHU A;  3CQ8 A;  3HK2 A;  3OYB A;  2IAJ A;  3V4I A;  5SWM A;  4JRQ A;  4Z4I A;  3QNO A;  4E1N A;  2G8W A;  4CGG A;  2DFE A;  1X1P A;  5DK5 A;  4B3O A;  1TVR A;  3NFA A;  4CE9 A;  2G8H A;  1NK7 A;  4DSJ A;  1CXQ A;  4KFB A;  4Z0U A;  4DTJ A;  4DS4 A;  4Y1C A;  1TL1 A;  3QEW A;  1X9M A;  3TAR A;  2G8K A;  1L3S A;  1S1V A;  2FBT A;  3K5O A;  4CF2 A;  2OPS A;  1U47 A;  1T8E A;  2HHQ A;  2X74 A;  3L2R A;  1BI4 B;  4Z4G A;  4F3T A;  2ZD1 A;  1EX4 A;  4IKF A;  1NOZ A;  4CHQ A;  1FKO A;  3T19 A;  1C1B A;  1RDC A;  3OYF A;  1ZBL A;  1NJX A;  1N5Y A;  1VSH A;  1VSI A;  3WNF A;  5I3U A;  2E6L A;  1HYS A;  2R7Y A;  2VG5 A;  5HRO A;  2HND A;  4C8M A;  3NH0 A;  4OGC A;  4CJS A;  2XY7 A;  1IKY A;  3KIO A;  4FZY A;  3DYA A;  1Z26 A;  4E7I A;  3RTV A;  1X9W A;  1UOC A;  3QIO A;  4DU1 A;  4M3U A;  4CEC A;  4XIU A;  1XI1 A;  4CGD A;  1RT2 A;  3AVN A;  4F2R A;  4M3X A;  3QEI A;  3KKR A;  4L8R B;  3DM2 A;  4DSI A;  3G10 A;  4DTU A;  4FM0 A;  1EET A;  4DWI A;  1BI4 A;  1Q9X A;  3DLB A;  1WAJ A;  4DU3 A;  1XC9 A;  3LP0 A;  1EKE A;  4Z4E A;  1YT3 A;  5C25 A;  5HRS A;  3NGZ A;  5C42 A;  1EP4 A;  1VSM A;  1C0U A;  4FK4 A;  2OPP A;  4O0J A;  3AO1 A;  1T05 A;  1KCF A;  3NF7 A;  4CJU A;  4E1M A;  3AA4 A;  5HBM A;  4KB1 A;  3FFI A;  1HYZ A;  5CZ1 A;  4QAG A;  2B4J A;  3OYH A;  2F8T A;  4LSN A;  1VK0 A;  4RW8 A;  2QK9 A;  4FJJ A;  3JSM A;  1UA1 A;  3RMC A;  3CM5 A;  2EHG A;  1FXX A;  1QE1 A;  1TKZ A;  4E7L A;  5I42 A;  1RT1 A;  2P51 A;  4FCY A;  3SNN A;  1NJZ A;  4C8L A;  3TAB A;  1LAV A;  1B9F A;  3LAL A;  3QNN A;  3ZSR A;  1EXQ A;  3SUQ A;  3AV9 A;  3H08 A;  3DRS A;  5J2Q A;  4CHP A;  3SUP A;  3LZJ A;  2JLE A;  2BDP A;  3NDK A;  4CEB A;  3HJF A;  2KQ2 A;  1UWB A;  2ITG A;  3NGY A;  4JLH A;  3ZSY A;  2EX3 A;  3V81 A;  3A2F A;  1O1W A;  2HNZ A;  3QES A;  3KD1 E;  4CJR A;  1R0A A;  1DTQ A;  1HNV A;  1WSF A;  3SPZ A;  4B9N A;  4KI4 A;  1L3V A;  3DRP A;  1RT5 A;  3OYM A;  1VSL A;  3RR8 A;  1Y97 A;  4AIL C;  4OJR A;  4HUE A;  1KFD A;  1GOC A;  4FW1 A;  2WON A;  4FJI A;  3MEE A;  1JLF A;  2P1J A;  3K59 A;  4CJ5 A;  4FLY A;  4PUO A;  4I2Q A;  4HUG A;  3LWM A;  1WSE A;  1L3U A;  3IS9 A;  3C94 A;  4I2P A;  1XHZ A;  2VG7 A;  3VQB A;  1NJY A;  4C8K A;  4M41 A;  4CJP A;  4OPJ A;  4DLG A;  3KLF A;  1A5W A;  4CK3 A;  4NYN A;  4KO0 A;  4B9U A;  1QSY A;  4M3W A;  2W42 A;  1LW0 A;  3SV4 A;  3NF8 A;  4W5T A;  1T03 A;  4HCB A;  3KJV A;  3V9W A;  1TKD A;  2FC0 A;  4DTM A;  1JLQ A;  4KPY A;  2HHW A;  4AHT A;  2E6M A;  4CJV A;  2VG6 A;  3SQ1 A;  4HHT A;  3SUO A;  1NKC A;  3PX4 A;  5K14 A;  3B6P A;  1BIZ A;  3MXI A;  3TAQ A;  4Q5V A;  3V6D A;  1IKX A;  1J5O A;  1SV5 A;  4DF4 A;  4JS4 A;  1C0T A;  1I3A A;  5E41 A;  4ZHR A;  2DY4 A;  1REV A;  3AVC A;  1QQC A;  3OJS A;  3L2U A;  3T1A A;  1QSS A;  4QOZ B;  1RBT A;  2OPQ A;  4JRP A;  3HST B;  3RRG A;  2LSN A;  4DSK A;  1RTJ A;  1RTI A;  4KHW A;  1ZBH A;  2HHT A;  1QTM A;  3ZT2 A;  1QS4 A;  2A1S A;  3CYM A;  1DTT A;  4OGE A;  3KK1 A;  1ZYQ A;  4RW9 A;  4DQR A;  3NF6 A;  4LSL A;  2YHB A;  1SL1 A;  3IG1 A;  3QER A;  3ZT3 A;  4B08 A;  4ID5 A;  1SL2 A;  2OZM A;  4FLZ A;  3ZT1 A;  2Q3S A;  3QEX A;  4AHU A;  3MED A;  3EYZ A;  1SUQ A;  4ZTJ A;  2P5G A;  4K8X A;  1CLQ A;  3AVM A;  4M3T A;  3CFO A;  3M8Q A;  3VQ9 A;  4NYF A;  3LP2 A;  2IGI A;  1IO2 A;  4DQQ A;  2X78 A;  3HPG A;  1CZ9 A;  4DTS A;  2QKB A;  4DSE A;  1NK4 A;  3ZSX A;  3VQ6 A;  3ZSO A;  4CED A;  1JXB A;  3DRR A;  3NGI A;  3S3N A;  2F96 A;  3V9U A;  3RMD A;  1NK5 A;  1NK0 A;  1S1X A;  4CJW A;  4YNQ A;  3NBP A;  3K58 A;  2AJQ A;  4FLW A;  2JGU A;  4CGJ A;  2YV0 X;  2GBZ A;  4FJM A;  4M3Y A;  1I39 A;  4B9S A;  3CM6 A;  3PY8 A;  4CJQ A;  3AA3 A;  4LH4 A;  3QO9 A;  3VQD A;  4ELU A;  4FJ9 A;  4LY7 A;  1WSJ A;  2Z1I A;  4G1Q A;  4FJ7 A;  4DSL A;  4PA1 A;  4KHS A;  2HHX A;  4CJF A;  2YNI A;  1BGX T;  2Z1H A;  4O0I A;  1YTU A;  1JLG A;  1YVU A;  1JLE A;  1VSE A;  4H4M A;  5FRN A;  1KVA A;  1VSD A;  3DOL A;  3V1O A;  2OYQ A;  4CEF A;  4IBN A;  1S1T A;  5KI6 A;  4W5N A;  3PX6 A;  4K8Z A;  1W9H A;  3VQ8 A;  3HPO A;  3SYZ A;  3PO5 A;  4FLT A;  3ZSQ A;  3OYN A;  1RDB A;  2FBX A;  1B92 A;  4KI6 A;  4FXD A;  3D0P A;  4GMJ B;  3HYF A;  3LDS A;  4PY5 A;  1LV5 A;  2RKI A;  4OVL A;  3VQ4 A;  1RBU A;  4E0D A;  4J2E A;  3KLE A;  1ZBI A;  4O5B A;  4KHN A;  1LWC A;  1X9S A;  4DFM A;  1RIL A;  4E7K A;  2KZZ A;  3VA0 A;  4J2A A;  4CIE A;  2XY6 A;  1GOB A;  1BHL A;  3NHG A;  4OPK A;  4RG8 A;  3VN5 A;  3KTQ A;  4F4K A;  1Q9Y A;  5JS2 A;  3HT3 A;  4DS5 A;  2X6N A;  4FW2 A;  3SZ2 A;  4ID1 A;  1TAQ A;  1JLB A;  3NE6 A;  1TGO A;  3QLH A;  4GW6 A;  1QHT A;  3L3U A;  4C8O A;  3QIP A;  4OLA A;  4B8A B;  4JS5 A;  1ZBU A;  4CJT A;  2XHB A;  4CFD A;  4DQP A;  3DI6 A;  1LWF A;  1TKX A;  2PYJ A;  4FJH A;  1ASW A;  4FLV A;  2KW4 A;  3OYG A;  4CJL A;  4I9Q A;  3DLE A;  3ZT4 A;  3ZSV A;  3V9X A;  4BE2 A;  4CGH A;  4NCA A;  2HHS A;  1IG9 A;  3VQQ A;  3RMA A;  3AVH A;  1K6Y A;  4CFC A;  2ATQ A;  4CHY A;  3QEP A;  4AH9 A;  5HP1 A;  3NCI A;  4FJK A;  2O4I A;  1B9D A;  2HW3 A;  1UAX A;  1YTA A;  4DQS A;  1BCO A;  1C1A A;  3L8B A;  3S3O A;  3HO1 A;  3VQP A;  3OYE A;  3ISN C;  4AHS A;  4J2D A;  4E7H A;  1Q8I A;  2QKK A;  5FRM A;  4FJG A;  3K5N A;  2IDO A;  3LAK A;  1WNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...