2G8KA

B. halodurans rnase h catalytic domain d192n mutant in complex with ca2+ and rna/dna hybrid (non-p nick at the active site)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
136
structure length
136
Chain Sequence
b'EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKANYGRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*UP*CP*GP*AP*CP*A)-3'
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 42
structure length 136
sequence length 136
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8kA00
4B8CA 2NUBA 3H08A 5CZ2A 1YTUA 1JLBA 1RDCA 4CJWA 1RTJA 3L3UA 3ZSQA 4IG0A 1J53A 3QETA 3V6DA 4B9TA 1DLOA 4FLYA 4C8LA 4GMJB 4HTUA 3IS9A 1VSFA 1VSDA 4I2PA 3FFIA 3RMAA 1D8YA 4IFVA 4O4GA 1WSEA 2AJQA 1C1CA 2ATQA 3SQ2A 1U4BA 3MAQA 2X6NA 1JXEA 3AVGA 3QIOA 4BACA 1HYSA 2FC0A 4CJPA 3WNEA 3LP3A 4GW6A 2G8WA 2IDOA 1IG9A 1SKRA 2OPSA 3HSTB 3MXIA 3KLFA 3QIPA 1LAWA 4ELUA 2QXFA 3AV9A 4CF8A 3DI6A 4CJRA 1NJYA 4IKFA 3D45A 4IBNA 5KI6A 1Z25A 3SUQA 1ZBFA 4CEOA 4CJVA 1NJZA 2A1SA 2X74A 4H4OA 2W42A 5FRNA 4KRFA 2P5GA 4KHYA 3HO1A 4KI6A 1RILA 1RT6A 3AA5X 4M3TA 3T3FA 4CEBA 3CYMA 4MQ3A 3PX6A 1JLFA 1T8EA 3TAFA 1RDBA 5KGXA 3DMJA 4C8MA 4CJ3A 3SPYA 3K5OA 3B6PA 1BHLA 4OJRA 3SCXA 5HLFA 2OPRA 1EP4A 4RW4A 3O3HA 3AA3A 2D0CA 1JLAA 3ISNC 5CYQA 3LANA 1LAVA 3WNHA 3CM6A 4M41A 3TAPA 4FXDA 4E89A 3NH0A 3OYAA 3OYNA 3QLHA 1TAQA 3TAQA 3OJSA 1KVCA 4TSXA 5HRRA 4Z4CA 3LPUA 5J2NA 2G8FA 3KD5E 2FBTA 1ZYQA 1DTQA 3O3GA 3AVCA 1REVA 1SV5A 1D9FA 4K8XA 3LP0A 2PZSA 3DOKA 3K59A 3NFAA 4FLXA 2HNYA 3O4NA 5HROA 4DS4A 1NK5A 4ID5A 5JS2A 3AVAA 4OPJA 2DY4A 1RT3A 2GBZA 1VRTA 1RBSA 2GV9A 1EKEA 3DLRA 4IDKA 3BDPA 3SQ4A 2OZMA 1S6QA 4AHUA 4BE0A 1S1TA 2IGIA 3L8BA 4FJGA 4C8KA 3ZSOA 3QEIA 4FK2A 3VQBA 3V1OA 1SL0A 2KFZA 4M42A 2PY5A 1NK7A 4FJMA 4PUOA 5FRMA 2DTUA 1RNHA 2RPIA 2G8KA 4NCBA 4DF4A 4DG1A 3RMCA 4M3RA 1KLMA 3AVLA 4CHOA 1RDAA 3ZT3A 3AVMA 1EETA 3P5JA 3L2QA 3CM5A 4FJLA 2Z1GA 3KD1E 4Y1CA 1L5UA 1JLGA 4F4KA 1ZBLA 3AO1A 1ASUA 1SL1A 1SL2A 4E19A 3ULDA 3PY8A 2VWJA 3C95A 4DSLA 4DTMA 4CEAA 1L3UA 3IAYA 1HRHA 5C42A 3AO2A 3OYJA 4CK2A 3DRSA 5J1EA 4CGFA 3SZ2A 3SPZA 4FLVA 2RKIA 1Q8IA 3KIOA 2YV0X 3RWUA 4FJ5A 2ITGA 4OLBA 1N5YA 3NH1A 1B92A 3U3GA 3VA0A 2YNHA 3ZT0A 1VK0A 4IG3A 4CECA 2I5JA 2F8SA 2HW3A 1KLNA 4M3WA 3S3MA 4OKKA 3ZT4A 4DFKA 1NOZA 5CYMA 1LV5A 1JXBA 1WLJA 4KO0A 4OPKA 3L2RA 3K58A 4ZTJA 2PYJA 1BIUA 1S1XA 2YHAA 4KREA 2HB5A 3ZCMA 3ZSZA 4C8OA 1X9MA 3V9WA 4DFJA 4B9SA 3QERA 1WSIA 3VQQA 4FCYA 4XIUA 1VSMA 1QS4A 4EZ9A 4QOZB 4ICLA 3VQPA 4CJLA 1W9HA 4E7IA 3LP2A 1CZ9A 3PO5A 3S9HA 3AVHA 3ITHA 4FLWA 5T7BA 2HHXA 1B9DA 4FM2A 1IH7A 1VSLA 2VG7A 1UOCA 4B8AB 3LPTA 4CF2A 1F21A 4DLEA 2ETJA 2B6AA 2WONA 1X1PA 3DLHA 1G15A 4ID1A 3OYFA 1LWCA 1T7PA 2HMIA 3HP9A 4FK0A 1C0UA 3AVIA 4HVJA 3LDSA 1C6VA 5FDLA 2FBXA 3V81A 4O5BA 4RW8A 1I39A 3K5NA 1WNSA 1U48A 3BGRA 3DLKA 1HQUA 4IFYA 3P83D 1KTQA 1T03A 3CQ8A 3OYKA 1RTHA 2HHQA 2IC3A 3RMDA 1TK0A 1RBTA 2BDPA 4W5NA 5KGWA 3WNFA 1RBVA 2F96A 3AO5A 5KRTA 4CGGA 2YNFA 4QCLA 4DQRA 1SUQA 4KTQA 2ZQBA 2HHTA 1XHXA 1GOBA 5JS1A 1ZBUA 4HUFA 4DTNA 3CFOA 5CZ1A 4CJ5A 4KHNA 4FJIA 1JL1A 4N5SA 3HPHA 3DRRA 1JLCA 2GUIA 3ZT2A 3OJUA 1JL2A 4WE1A 4M3XA 2DFFA 1U49A 4Z0UA 2OYQA 4OGCA 1CXQA 1RT5A 4PA1A 1VSIA 4I7FA 4FJNA 1FKOA 4CGJA 2DFHA 1L3VA 2QK9A 1KRPA 1IKXA 3TARA 5DK5A 3K5LA 1S1UA 3OYBA 3V1RA 4CJEA 4B08A 1IKVA 3M8QA 3AO4A 3MXMA 1SKWA 4B9LA 2HHUA 4M45A 4OLAA 1KSPA 3V9UA 4CFDA 1TV6A 4GVMA 3EZ5A 3PX0A 2G8UA 3SQ1A 1KCFA 1S6PA 3LAMA 3VN5A 3SQ0A 4Z4EA 3QEVA 4LSNA 3ZSRA 4CJQA 4Z4IA 3SUOA 1QQCA 4BE2A 3QESA 4DQPA 4DSJA 4OGEA 2FBYA 3TR8A 4CCHA 3NHGA 2BE2A 1A5XA 4CK1A 4E1MA 3VA3A 3HXMA 2D0AA 1RDDA 4G1QA 4BWMA 4W5QA 4CFCA 1I3AA 3LZIA 1XI1A 3I0SA 2ZD1A 2OPPA 3DM2A 3G0ZA 1ASVA 3M8RA 2RN2A 4KHQA 3PV8A 4KI4A 4I9LA 4DTUA 1FK9A 1S9GA 4DS5A 2KFNA 3DLEA 4PY5A 4CEFA 4CF0A 3RRHA 1WSGA 1CLQA 5D3GA 1TL3A 4N56A 4CHZA 4KPYA 1NK4A 3MEGA 1NKEA 2XY8A 4I2QA 1XWLA 1TL1A 3DYAA 3M8SA 3CFPA 1NK8A 1LW2A 4KFBA 1RBUA 3IG1A 2YKMA 3IRXA 3S3OA 4CERA 4FYDA 3OYMA 1HQEA 1R0AA 4B9VA 4BDYA 3KTQA 5C24A 2BGGA 1BL3A 3F9KA 1FXXA 3NBPA 4FLUA 3VQ5A 3KK3A 1LW0A 4NYFA 3OS1A 2Y1JA 1NKCA 3JYTA 3SV3A 3AVFA 2KW4A 3KKRA 4KV8A 3VQ9A 4DTJA 3QEPA 4KAZA 4OKJA 2HVIA 1VSEA 4DTSA 1WAFA 5HP1A 3L2VA 4N47A 1VRUA 3LALA 3PUFA 2IAJA 1J54A 1TKTA 2P51A 3L3VA 4AHRA 3SI6A 1RT4A 1LWEA 2HNZA 3LZJA 2Z1IA 5J2MA 1BCOA 3C6TA 4B9MA 4F3TA 1S5JA 3OS0A 4C8NA 4DTPA 4E7HA 4CEQA 2D5RA 2P5OA 2XY5A 1BQNA 1QSSA 4HUGA 1TVRA 4CF1A 4LD0A 3NH2A 3MEEA 3V9ZA 4FW1A 1RBRA 3VQ4A 4YFUA 1NK0A 4DMNA 4CEEA 1DTTA 1BGXT 3QNNA 4KB1A 1L3SA 2YNIA 4HUEA 3ALYA 3KLHA 1CZBA 3D0PA 4BDPA 2XRIA 4AHSA 3QINA 4LH5A 1KFDA 3NF9A 3OYGA 3SJJA 4RW6A 5E41A 1GOAA 3TI0A 3SV4A 2IOCA 3THVA 3A2FA 3F73A 3KKSA 1Q9XA 3AA2A 3AO3A 1W0HA 1HNVA 4FZZA 5J2QA 2QKKA 4F3OA 1IKYA 2D0BA 1EX4A 3MECA 4Y1DA 2G8IA 3LAKA 1X9SA 3QNOA 3PO4A 4BE1A 2Z1JA 3HM9A 3VQCA 4AHVA 4JLHA 3NF6A 4KTWA 4Z4GA 4DSFA 3U6FA 3AA4A 2YNGA 3MXJA 4CHNA 3EYZA 4FK4A 3KK2A 4FJ8A 3DRPA 4B3OA 1WSFA 1J5OA 4JRPA 4FJXA 4FLTA 1U45A 5K14A 1NJXA 3HK2A 4BWJA 1ZBHA 4J2AA 4DTXA 3B6OA 4CJTA 4W5TA 1BISA 1RTIA 4LY7A 2XY7A 3RRGA 3VQEA 3NDKA 4DLGA 2G8VA 4CF9A 3AVNA 3K57A 3TABA 1IKWA 2B4JA 3VQ8A 5KRSA 4RG8A 4CGIA 1VSKA 1GOCA 4H8KA 3TAEA 3OY9A 1XC9A 4CESA 4J2BA 4FM1A 2HHWA 2X78A 4E1NA 4DFMA 1HYVA 1HMVA 1TGOA 5C25A 4FM0A 4DQQA 1KVBA 4Q0BA 3OYCA 4AH9A 3HJFA 1S1VA 3CG7A 1A5VA 3NF7A 3DLBA 4N76A 2OPQA 3V9XA 1C1AA 5I3UA 2XY6A 1TKDA 1NK9A 4CEDA 5KTQA 4FZYA 3NCIA 1RT7A 2KQ2A 5HBMA 4PQUA 3I8DA 1J9AA 1SKSA 3HP6A 4DQIA 1A5WA 3PX4A 4EP5A 4HCCA 1VSJA 2VWKA 5FROA 2KZMA 2Q3SA 3LP1A 4M3ZA 3KLIA 1NOYA 4AHTA 3VQ6A 4EP4A 3NGZA 1LWFA 3ZSWA 4DU3A 1ZBIA 5HRSA 4DSEA 4CJ4A 2XHBA 1RCHA 1QE1A 2HNDA 3OYDA 4ZTFA 4ELVA 2P1JA 4MFBA 4LSLA 4M3UA 2JLEA 3KJVA 4O0JA 3OVNA 4NYNA 4CHQA 4AHCA 4DF8A 1QHTA 3S3NA 3RR8A 3AVJA 4E0DA 2HHVA 2VG6A 3V1QA 4DTOA 3HVRA 4CIEA 1C0TA 2Z1HA 4CHYA 2ZE2A 1CXUA 3MEDA 3L2WA 3V4IA 4Z4FA 4FJHA 2RF2A 1FKPA 3G10A 1O1WA 1TKXA 3CFRA 3UIQA 3AVKA 4F2SA 4F2RA 3TANA 3T19A 3ZT1A 1WSJA 2BANA 4W5OA 5SZTA 4YNQA 4DFPA 4PWDA 3L2UA 3SNNA 1JLQA 5J2PA 3KLGA 3HVTA 3P1GA 3VQDA 3NF8A 4KKOA 1HYZA 3HPOA 2QKBA 1Z26A 2KTQA 2G8HA 1NJWA 2EHGA 4J2EA 4NCAA 2O4IA 4CJFA 4FLZA 3LWLA 1HPZA 4B9UA 4FJKA 1UWBA 2PYLA 3I0RA 4E7LA 1QSLA 4J2DA 4AILC 1WAJA 3RR7A 4CFAA 5HRNA 4O0IA 1KFSA 4FZXC 4CHPA 4RW9A 4CGHA 3EY1A 1X9WA 1RTDA 1TK5A 2FBVA 4O44A 1C1BA 1WN7A 4KHWA 1UA0A 2IS3A 1MU2A 1U47A 1BIZA 1C0MA 1UAXA 4CFBA 1B9FA 1TAUA 3NGIA 2R7YA 4O55A 3M8PA 5CY4A 1QSYA 4N41A 3OYHA 1T05A 1BI4B 4R5PA 3NAEA 1JLEA 4KHSA 2Y1IA 2LSNA 3ZSVA 3O4QA 5HRPA 1HJRA 3DOLA 4KTZA 3C94A 4CIFA 1BCMA 3JSMA 3E01A 1D5AA 3HL8A 3T1AA 3KK1A 2F8TA 4JS4A 4E3SA 4M3YA 3QEXA 4DTRA 4B9NA 1U04A 4CGDA 3AVBA 3HPGA 4I9QA 1BI4A 5I42A 4EZ6A 4UQGA 3TAGA 2KZZA 4JRQA 2VG5A 3OYEA 3OYIA 2O4GA 2YHBA 3KLEA 3ZSXA 4E7JA 1NK6A 1L3TA 4ELTA 4F8RA 4Z4HA 2DFEA 3SYZA 1YVUA 2JGUA 3ASMA 4FJ9A 3DLGA 2HVHA 5EU7A 3RTVA 3SUNA 1N6QA 2E4LA 3TAMA 1NKBA 4FJ7A 4L8RB 3QEWA 3HT3A 3K2PA 1S9EA 4RW7A 4H4MA 4CJUA 1WSHA 3OYLA 1BQMA 1ASWA 2A1RA 2OA8A 4FVMA 4DSKA 4KHUA 3VQAA 2EX3A 1S1WA 5DMRA 3O3FA 3LWMA 4E7KA 3TWHA 2E6LA 2E6MA 1TK8A 1Y97A 2B5JA 1HNIA 3NE6A 1VSHA 4OKEA 1K6YA 3VQ7A 4DQSA 1EXQA 4OVLA 3U3YA 1D9DA 4FJJA 4NCGA 4Q5VA 1XHZA 5SWMA 4DSIA 1KVAA 1YTAA 2XO7A 3K5MA 4CE9A 1UA1A 2HHSA 3SUPA 4HCBA 4K8ZA 1JKHA 4BDZA 1RT1A 4CJSA 3C6UA 2OZSA 1TKZA 3QO9A 4QAGA 4CEZA 3HYFA 4FW2A 4ZHRA 4DWIA 4LH4A 4KB0A 3ZSYA 4DU1A 1ITGA 2YKNA 1IO2A 2WOMA 4JS5A 1QTMA 4W5RA 3OS2A 3V9SA 4DU4A 2X6SA 1RT2A 3WNGA 3NGYA 4CIGA 4CJKA 4HHTA 3RMBA 1Q9YA 1YT3A 4CK3A
chains in the Genus database with same CATH superfamily
4B8CA 5CZ2A 2OANA 4CJWA 3L3UA 4IG0A 3CERA 4B9TA 4BG8A 3H6EA 1VSDA 3RMAA 3FFIA 1C1CA 3CJCA 1JXEA 1MA9B 2CGJA 4GW6A 4H5RA 2IDOA 2HBMA 3HSTB 3LDNA 2O8EA 2QXFA 4CF8A 5AZJA 3DI6A 5B8HA 4IKFA 5AQOA 2A1SA 4DV7K 4OPHA 4KI6A 1HKBA 1RILA 3O08A 5EVZA 4JI6K 4M3TA 3T3FA 2UU9K 5KGXA 3SPYA 4LF9K 1NU0A 2KKZA 3P38A 2QWNA 3K5OA 1FJGK 5HLFA 1EP4A 4RW4A 3ISNC 2YJFA 4M41A 4BR0A 3TAPA 3THWB 2WTUA 4JD2A 3OJSA 5HRRA 4H5NA 5J2NA 2FBTA 1KAZA 4DUYK 1ZYQA 1SV5A 1WOQA 3E66A 3O9RA 4FLXA 2GX9A 5HROA 1NK5A 5JS2A 4OPJA 1VRTA 3BDPA 2GV9A 2E2NA 4BE0A 1GLDG 4FWKA 4FK2A 3UKRB 3D7EO 4IO9L 4NCBA 3AVLA 4CHOA 1BG3A 1K9MO 1OVQA 1JLGA 3LM2A 1SL2A 4E19A 3O9TA 3ULDA 3C95A 4CEAA 1L3UA 5C42A 4HTLA 4FLVA 1N5YA 1YUWA 3NH1A 3U3GA 3VA0A 2F8SA 2VQEK 1R59O 3S3MA 3O80A 1LV5A 1JXBA 2PYJA 3R9PA 2HB5A 3ZSZA 5EOYA 5E84A 4DFJA 1HNWK 5M1NA 1QS4A 2QI2A 4EZ9A 3VQPA 2NRHA 2D0OA 3N4PA 4BRIA 1EQYA 3S9HA 1T3VA 5ELZA 4QS9A 1W2BM 5T7BA 1QQOA 2VG7A 1VSLA 3THXA 4CF2A 4DLEA 5LY3A 4WQ4C 3OYFA 1LWCA 1C0UA 5MLCQ 3V81A 1U48A 3BGRA 1NGDA 3WXIA 4XH5A 3CQ8A 3RMDA 1QQNA 1RBTA 2Q97A 4W5NA 3CXCM 4JV5K 3DXKB 3AO5A 4QCLA 1VQ4N 2ZQBA 4A2BA 1GOBA 2CH5A 4FJIA 1Z6RA 4BC4A 2E88A 4Z0UA 4FJNA 4CGJA 3D2FA 2OCEA 2KHOA 4FWOA 3OYBA 3V1RA 5CE3A 3MXMA 2HHUA 3CCLN 1KSPA 4FWQA 3V9UA 3PX0A 2UXBK 3SQ1A 2GUPA 3VN5A 2NRVA 3ZSRA 2KLAA 3SUOA 4DSJA 3QESA 1YF5L 3HTVA 1O13A 3OBWA 3VA3A 2D0AA 1RDDA 4W5QA 4CFCA 1GLAG 4YOXA 1U2VA 2WC9A 2OPPA 3DM2A 4FPBA 2ZWHA 3M8RA 3KHYA 3JXUA 4KI4A 4DTUA 5F0XA 1FK9A 3CJ7A 4DS5A 3K9JA 4H5TA 4PY5A 5D3GA 4C23A 4BC2A 4BQLA 3O9QA 3MEGA 3PIPL 4WFNL 1NK8A 4KFBA 1NGBA 3KK7A 1VQKN 4CERA 4FYDA 3OYMA 4IO8A 1HQEA 3H3NO 5ADXA 4X64K 3NBPA 5JLFA 3CD6N 3LDPA 4KAZA 3LM9A 1VSEA 2E8AA 4MLHA 4N47A 1VRUA 2Q1NA 3PUFA 3L3VA 3SI6A 1RT4A 1NGGA 2HNZA 1J6ZA 4B9MA 4DTPA 4CZIA 4E7HA 4CEQA 1QHAA 1XUPO 3ZETB 3NH2A 4GNIA 4YFUA 3QNNA 1VQ5N 1L3SA 2QXLA 4HUEA 2VWBA 3QINA 3DAWA 5AQPA 4BRMA 3VENA 4WQ5C 3C7NA 3A2FA 4GVEA 3KKSA 3AO3A 3S41A 1HNVA 4RWTA 3AARA 3M1FA 4Y1DA 4IXCA 1X9SA 3PO4A 3MWTA 4KTWA 2H3GX 4DSFA 5LMNK 1WBBA 3DRPA 3UKUA 4FLTA 1U45A 1ZBHA 4BREA 4EAHD 1BISA 4LY7A 4Y0WA 2XY7A 3RRGA 4CF9A 3K57A 5KRSA 3TAEA 1YJ9N 3HSCA 4JK7A 4FL9A 1HMVA 1TGOA 2A42A 3MK6A 2P9NA 3HJFA 3DLBA 5BPMA 4GV3A 5KTQA 4IOCL 1RT7A 3I8DA 4FO0A 3TSQA 2JWKA 5F2RA 3R8EA 4EP5A 2VWKA 5FROA 4EP4A 2P9SA 2E1YA 1IBLK 4A57A 5HRSA 4CJ4A 1HJOA 3J8AA 2HNDA 3RSEB 4WFAL 4MFBA 4YOWA 2JLEA 2DPNA 5BR9A 3CJAA 1ZBSA 1QHTA 3QBWA 4DF8A 3RR8A 4E0DA 2HHVA 4DTOA 3LDOA 3HVRA 5EX5A 4CHYA 3MEDA 4Z4FA 1FKPA 3UIQA 3T19A 4WYBA 1WSJA 3BF3A 3TSPA 3L2UA 3SNNA 1JLQA 1SQKA 3UB5A 2P9KA 4JN4A 1HNXK 1NJWA 5AZIA 4J2EA 3HI0A 3LWLA 4FJKA 4J2DA 4AILC 5HRNA 4O0IA 4CGHA 1SZ2A 4O44A 1C1BA 1UA0A 4V19S 1QZ5A 1UAXA 1B9FA 3A5OC 1MWKA 3NGIA 5FPMA 3ZX3A 4KHSA 2LSNA 2HBKA 4GV6A 1ATRA 1YAGA 3R1XA 1BCMA 2P9PA 3ZX0A 1NNEA 2QWQA 5I42A 1SAZA 4UQGA 4A61A 2VG5A 3OYEA 4OX9K 4E7JA 2HVHA 3K2PA 1ESVA 1S9EA 4H03B 3OYLA 4CW7B 4A62A 2OA8A 2VYPA 4KHUA 4BR5A 2EX3A 5DMRA 4FOEA 4JEPA 4Z94A 3TWHA 1YVNA 3NE6A 1VSHA 1K6YA 1EXQA 1SS6A 3H1QA 2ZGYA 3AGKA 1UA1A 2HHSA 4HCBA 5BRFA 4L3QA 3DWLA 4ELUA 3C6UA 2IVOA 3HYFA 4ZHRA 4LH4A 5DM6L 4JS5A 4B1ZA 4W5RA 4CIGA 1RT2A 1YJWN 2QA4N 2VQFK 3FZKA 2F4VK 2WFBA 4A5BA 4BC5A 3ZSQA 2HF4A 1J53A 3QETA 4C1NI 4GMJB 4HTUA 4I2PA 3O9UA 2A40A 2IIRA 2AJQA 4H5WA 3MAQA 4DV6K 1HYSA 3QMLA 2D0PA 4CJPA 3WNEA 3LP3A 1IG9A 3QIPA 2Q31A 3AV9A 1BA0A 4CJRA 1NJYA 3FZLA 1Z25A 2YJEA 3SUQA 4CZGA 4H4OA 2X74A 2W42A 1VQ9N 5FRNA 3HO1A 1RT6A 4F9OA 3I56N 4H0PA 1T8EA 1T44A 5AQGA 3DMJA 4FWLA 4C8MA 4CJ3A 1EWQA 2ZM6K 1OKJA 1BHLA 3AA3A 2D0CA 1JLAA 1LAVA 4H0OA 4FXDA 5AQHA 5FPEA 3SK3A 5HOOA 2G8FA 2QWOA 4Z4CA 1D4XA 4B1XB 4X66K 3O3GA 3AVCA 4BGBA 4K8XA 4B1YB 3DOKA 4B9QA 3NFAA 3THWA 4BRFA 3AVAA 5AFUA 3U4LA 1RT3A 1RBSA 3DLRA 1EKEA 4IDKA 3SQ4A 1IBKK 1NLVA 1S6QA 2OZMA 4AHUA 3L8BA 3VETA 3AAPA 5KPZA 4PHTX 2FF3B 4FJMA 2DTUA 4BRKA 1RNHA 2G8KA 2QM1A 2P9UA 5BR8K 3ZT3A 3AVMA 4FJLA 3CM5A 4NO7A 1TUUA 3UKRA 4FWPA 3AO1A 1ASUA 3VEWA 1HRHA 3P39A 3DRSA 3U9DA 5J1EA 3SPZA 1Q81O 2RKIA 1Q8IA 1H1VA 3KIOA 4JKGA 4YY3K 4OLBA 1B92A 1VK0A 1KXPA 4IG3A 1N8RO 2V52B 3VPZA 3I8BA 3WUHA 1NOZA 3IKMA 1K8KB 5CYMA 1WLJA 3L2RA 3MN5A 4KREA 4YDUA 4C8OA 1NJIO 3V9WA 1WSIA 4H0XB 4DV5K 4XIUA 4CBUA 4ICLA 2I7NA 4IEIA 3ITHA 2QWLA 4O8UA 4DUZK 1B9DA 4CZHA 3NVMA 4FM2A 3A5LC 3BEXA 4AQYK 3DLHA 4GKJK 4ID1A 2HMIA 4FK0A 3ZEUB 4R79A 5KQ8A 1VQNN 1RFQA 3K5NA 5AQXA 3DLKA 4BVPA 3KWIA 4IFYA 1GLLO 1RTHA 2HHQA 5LL6Z 2HBJA 2F96A 2HHHK 4K25A 3SLCA 2HHTA 1XHXA 4CZMA 4JI1K 4N5SA 2GUIA 2O8DB 1G99A 3DXKA 1CXQA 1FKOA 1L3VA 4YOYA 5DK5A 3K5LA 1HLUA 1S1UA 4CJEA 1SKWA 3C65A 5LJWA 4UY8O 3W0LA 1W7AA 1Q82O 1KCFA 3LAMA 3SQ0A 3QEVA 4CJQA 4I6MB 4Z4IA 4BE2A 3LDLA 3NHGA 2BE2A 3HXMA 4M7XA 4G1QA 4AM6A 3FLCO 3J7AP 1OH6A 2W6LA 1ASVA 3WT0A 2RN2A 4I9LA 4MLEA 3QFPA 1S9GA 4FVUA 2KFNA 4CF0A 3CJBA 1WSGA 1CLQA 1U6ZA 1WUAA 4HWIA 4CHZA 3D6RA 2ASMA 1XWLA 4XH4A 5C2DA 1RBUA 3IRXA 3VF2A 3WEEB 1QVFM 4ISEA 3BZKA 3KTQA 3F9KA 4K42A 1FXXA 3HM8A 2HMPA 3AAQA 1LW0A 1NKCA 3SV3A 2QW9A 5AQIA 3CIPA 3EL2A 4DTJA 1WAFA 5HP1A 3L2VA 3A5MC 1TKTA 1WBDA 4YOVA 5J2MA 4JKEA 1BCOA 3C6TA 3CMAN 1S5JA 1GLBG 4DR5K 4K43A 5GAHP 3E9PA 2V51B 2XY5A 4LF6K 1TVRA 4CF1A 4LD0A 4M63C 3V9ZA 2PFUA 2ZGZA 4CEEA 3O5BA 1DTTA 3F2KA 4IZ9A 3GDQA 3EKSA 3D0PA 4BDPA 4AHSA 4LH5A 4JAXA 2ITMA 3SJJA 4RW6A 3TI0A 3SV4A 3THVA 2VCPA 4DHYA 4FZZA 4F3OA 2QEXN 4U7BA 3MECA 1S72N 3AY9A 3SMSA 4BE1A 2Z1JA 3HM9A 3THYB 3NF6A 4Z4GA 3U6FA 3MXJA 3EYZA 4FK4A 3KK2A 3MCAB 1J5OA 1NJXA 3HK2A 4XH1A 4BWJA 3FZHA 4BQZA 4W5TA 1RTIA 3NDKA 3H45C 3AVNA 5GADP 1IKWA 2B4JA 3VOVA 3VQ8A 4LF8K 4RG8A 4H8KA 1GOCA 3MN7A 4CESA 2X78A 3J7ZO 1HYVA 2UYTA 4DQQA 4B1UB 3FE1A 4AH9A 4N76A 3V9XA 1C1AA 4ISGA 3E1YA 2KQ2A 3OW2M 5BREA 3SBGA 3HP6A 3QBXA 3IFRA 4M3ZA 5AJ3K 4DV4K 1JCEA 4IWVA 3VQ6A 4CZEA 4DU3A 2I7PA 3TU5A 1RCHA 3OYDA 1XQSC 4CZFA 4JI4K 2P1JA 4BGAA 3KJVA 3ATVA 2VGMA 4O0JA 3OVNA 5C15A 1M90O 3ENBA 4AHCA 3BZCA 2HF3A 1V4SA 4CIEA 4DR6K 3RSEA 4PKIA 4FJHA 2RF2A 3G10A 1O1WA 2RHKA 4DR7K 4W5OA 1RDWX 4PWDA 2UXDK 3VQDA 3NF8A 4KKOA 1HYZA 1VQ7N 5BN9A 4FLZA 2O4IA 4B9UA 5H1SQ 4JNEA 4BRHA 3I0RA 4E7LA 3RR7A 1KFSA 4FZXC 2FXUA 4YOUA 4RW9A 5GAGP 1RTDA 3CPWM 1TK5A 3T1HK 4KHWA 3O1WA 2D1KA 1NGIA 4O55A 3M8PA 3IDHA 3OYHA 1T05A 3NAEA 1JLEA 3RVCA 3ZSVA 4O8KA 3O4QA 3C94A 4NXMK 4CIFA 3JSMA 3E01A 3T1AA 3KK1A 2F8TA 2YX6A 4DTRA 4B9NA 1U04A 5HL7L 1JCGA 3O4WA 3OYIA 1NK6A 4NLBA 1X3NA 4ELTA 4F8RA 4PL8A 3CJ1A 3K9KA 2DFEA 3F5TA 4DV1K 4WFBL 3RTVA 3WQTA 4JKHA 2E4LA 3QEWA 3HT3A 4CJUA 1NGEA 2QWRA 1NG9A 3HOSA 3VF4A 3VQAA 1DGKN 2GELA 5M1FA 3L0QA 4FWMA 4JI5K 1Y97A 1HKCA 4DQSA 1Q86O 3U3YA 4FJJA 3BY5A 4NCGA 2A6AA 2ZJPL 4Q5VA 1IV0A 5SWMA 2W6KA 5AQMA 5GIPA 2UUCK 1JKHA 2FLOA 4BDZA 4DWIA 4FW2A 4DU1A 2AA4A 2WOMA 4AF1A 3OS2A 5AQJA 5TKYA 4CJKA 4HHTA 1Q9YA 3D2EB 1YT3A 2NZTA 3H08A 4BRCA 3VTHA 4YHHK 4BRQA 1EO1A 3MX5A 4B3TK 3IS9A 1VSFA 1D8YA 4IFVA 4O4GA 1WSEA 3CCMN 3SQ2A 1U4BA 1WB9A 2G8WA 5KPRA 2OPSA 3KLFA 1LAWA 4DR2K 4CZKA 3D45A 3M5RA 4IBNA 3WXLA 5KI6A 1ZBFA 4CJVA 2O8CA 5EY4A 4JI3K 3EO3A 5KQDA 1M1KO 4H5VA 1NMDA 3AA5X 2P5GA 4KHYA 3GL1A 1T6DA 3PX6A 4MQ3A 1YXQA 2E1ZA 4FSVA 4J8FA 4KBOA 3B6PA 2AP1A 2OPRA 1BOTO 3O3HA 3TPQA 5CYQA 1BWFO 3NH0A 4BR4A 3CQXA 3QLHA 1TAQA 3TAQA 1KVCA 3KD5E 5AQFA 1X3MA 1REVA 4K41A 1D9FA 4XEIA 5BRHA 3G6EN 3PSIA 3CC2N 2O8FB 4YDUC 4FOIA 3K59A 2HNYA 2DY4A 2IVPA 1DKGD 2E2PA 2GBZA 1NGAA 1KC8O 3VTIA 2O8BB 5AQRA 4FJGA 4DR1K 4C8KA 3ZSOA 3GG4A 4M42A 2PY5A 1NK7A 1QQMA 5CHIA 4LFCK 2WBNA 1KLMA 4ISFA 1RDAA 3P5JA 1EETA 3KD1E 4Y1CA 1L5UA 4BRNA 4F4KA 5C12A 3MMVA 4DTMA 2P9IB 3AO2A 5IT9O 2RE2A 4FJ5A 2YV0X 4YORA 4JK8A 3FR0A 2HW3A 2A5XA 2YNHA 4BR9A 3BUZB 2I5JA 2FSKA 1KLNA 3MN6A 4CZLA 3ZT4A 3CQYA 3ZLJA 4OPKA 3K58A 1NGHA 3CCJN 1X9MA 5C0YA 4JI2K 4B9SA 3QERA 1V4TA 1K8KA 5BPLA 4QOZB 4CJLA 1HUXA 1W9HA 1ATSA 3IMXA 3TTCA 4E7IA 3LP2A 3AVHA 3ENHA 2HHXA 2JWLA 2NRWA 1UOCA 4B8AB 1P90A 3LPTA 1F21A 2ETJA 1VQMN 1X1PA 3C6HA 3FFKB 1T7PA 3AVIA 4HVJA 3LDSA 1OH7A 3CC7N 1C6VA 5FDLA 1I39A 3KZBA 4KH4A 2F7TA 4BRAA 1HQUA 3R3LA 4DB3A 1KTQA 3QB0A 5LMUK 3OYKA 2IC3A 3ULEB 1LOTB 3ZEUA 1JJ2M 4DR4K 2NRZA 4FWNA 1SUQA 3R6MA 5JS1A 3QDKA 1GLCG 5AQNA 4DTNA 3CFOA 3L4QA 5CZ1A 4CJ5A 1JL1A 4NB4A 1C0FA 1JLCA 3ZT2A 1JL2A 1U49A 2YCHA 4OGCA 2QTDA 1VSIA 4I7FA 1DEJA 2DFHA 2QK9A 1KRPA 3K0SA 1IKVA 4M45A 2O8DA 2G8UA 3MN9A 4LSNA 2Q0RA 1QQCA 4DQPA 4OGEA 4CCHA 3OBYA 3FGUA 3O6WA 1XC3A 2NNWA 3LZIA 2PBDA 3KWGA 5F1XA 1BDGA 1S22A 2ZD1A 4I6MA 3G0ZA 3PV8A 3HRGA 5BPNA 2E2OA 4CEFA 3VEOA 2PAVA 4N56A 1T6CA 4KPYA 2NLXA 1NK4A 1NKEA 4I2QA 1Q18A 1W97L 1X9JA 1TL1A 3MX2A 3BP8A 3CFPA 1LW2A 3S3OA 1NBWA 5C24A 2BGGA 1BL3A 4FLUA 3VQ5A 2CH6A 4LF5K 4NYFA 3OS1A 2Y1JA 3KKRA 4KV8A 4LC9B 3WEEA 3VQ9A 4JI8K 3QEPA 4ILHA 3LALA 2IAJA 1J54A 2P51A 1LWEA 2P9LB 1YITN 4LFAK 1TYQB 4C8NA 4A59A 3H3OB 2D5RA 1BQNA 3MEEA 4FW1A 1RBRA 3VQ4A 1BGXT 4IDHA 4KB1A 3MCPA 2BUPA 1NGCA 2GEMA 3NF9A 3OYGA 4CJ7A 3B8AX 5E41A 3FZFA 3MWPA 3F73A 2OTJN 1Q9XA 1W0HA 5J2QA 2QKKA 3J80O 1C0GA 1E3MA 1IKYA 3CF5L 1EX4A 2G8IA 3LAKA 3QNOA 4AHVA 3JAMO 4JLHA 4CVNE 4RTFD 2YNGA 4FJ8A 1WSFA 3CCEN 2VGNA 5AR0A 3Q7CA 5JMVA 4CJTA 3THYA 5E26A 3VQEA 4DLGA 2G8VA 2UUAK 2ZJRL 3W3DA 4WF9L 1ILYA 2CGKA 4JHDB 1VSKA 4CGIA 4OO1J 2HHWA 4FM1A 4H0VB 3VEXA 4Q0BA 3OYCA 1MWMA 3I55N 1S1VA 3NF7A 1A5VA 5C10A 2OPQA 5I3UA 1TKDA 4LF4K 1NK9A 4CEDA 3PSFA 2BH1A 1KD1O 1J9AA 3DXMB 1SKSA 4DQIA 3SAGA 3VGKA 3PX4A 4HCCA 1GLJO 2W40A 2KZMA 5C2FA 3KLIA 1NOYA 1TUYA 4A2AA 3O8MA 4CBWA 4FWRA 4ELVA 4NXNK 4LF7K 4QS8A 3G4SN 4M3UA 4NYNA 3GE1A 4GY2B 3GOIA 3S3NA 1VQLN 3AVJA 5AQZA 2VG6A 3V1QA 4PL7A 1C0TA 2ZE2A 4JI0K 3CFRA 5TKWA 3AVKA 4F2SA 5BN8A 4F2RA 3Q7BA 3L4IA 1XNRK 5IWAK 2BANA 1NM1A 5SZTA 4BROA 2Q36A 2Q2RA 3KLGA 1ATNA 2BTFA 3P1GA 4PKHA 3HPOA 3VGLA 2KTQA 2G8HA 2EHGA 2E2QA 3I33A 4NCAA 1XMQK 1J5EK 1UWBA 1LCUA 5ADXH 2PYLA 1QSLA 1WAJA 2P9UB 4CFAA 4B3RK 4CHPA 3EY1A 1X9WA 2FBVA 1WN7A 2V7YA 2IS3A 1MU2A 1U47A 4CFBA 1TAUA 4N41A 1BI4B 4R5PA 4GKKK 4MO5A 2F9WA 4IJAA 4JKGB 1XMOK 1HJRA 3DOLA 4KTZA 3CJ9A 1VAZA 3HL8A 1IJJA 4LFBK 4E3SA 4M3YA 4KH6A 3AVBA 3WXMB 3EE8A 3TAGA 2KZZA 4JRQA 2OYQA 4CD1A 5JLHA 1DT9A 1L3TA 1BUPA 3ZETA 4Z4HA 5EU7A 1N6QA 3TAMA 1NKBA 4FJ7A 4L8RB 5FPDA 4H4MA 3EEQA 1MDUB 2A1RA 1ZC6A 4KH5A 4DSKA 3J7YP 5AQSA 3O3FA 1S1WA 3LWMA 4E7KA 1IG8A 3VEYA 2B5JA 3H1VX 4OKEA 3VQ7A 3VEVA 3VGMA 4DKWA 2CGLA 1KVAA 1YTAA 2XO7A 3K5MA 1IBMK 4CZJA 1RT1A 1BU6O 3LL3A 4EFHA 1TKZA 4QAGA 2OTLN 3LDQA 1QVGM 4KB0A 3ZSYA 1ITGA 2YKNA 1IO2A 2WUSA 3E9LA 3PIOL 1QTMA 3V9SA 4DU4A 1GLEG 2NUBA 4B1WB 2E5LK 1JLBA 1YTUA 1RDCA 1RTJA 2W41A 4G9ZA 3V6DA 3CCRN 1DLOA 4FLYA 4C8LA 2O8EB 1RDUA 3D2EA 5AZJB 4M7YA 5EXWA 3U8XA 2ATQA 2X6NA 3AVGA 3QIOA 4BACA 2FC0A 3HBTA 1SKRA 3MXIA 3A0IX 3L6QA 4KRFA 4CEOA 1NJZA 4KHPK 3M6GA 3VERA 4CEBA 3CYMA 1JLFA 3ZX2A 3TAFA 3O1BA 1RDBA 3P31A 2YI1A 2UXCK 4B3MK 2ZJQL 4JD2B 3DJCA 4OJRA 2A3ZA 3SCXA 2QWPA 3LANA 3WNHA 3CM6A 4IJNA 4E89A 1E4FT 2NRXA 3OYAA 3OYNA 1RGIA 4TSXA 3LPUA 3NMUA 1DTQA 5GIOA 3SJHA 1YHQN 3WQUA 3LP0A 2PZSA 3O4NA 4IOXA 4DS4A 4ID5A 2D4WA 1NMNA 1S1TA 1XNQK 2IGIA 2GWKA 3G25A 1HR0K 4H0TB 3QEIA 3J81O 3EE9A 3V1OA 3VQBA 4CI6A 1SL0A 2KFZA 2O8FA 3OHRA 4PUOA 5FRMA 4O5FA 4GV9A 5JVHL 2RPIA 3SAFA 4DF4A 4DG1A 3RMCA 4M3RA 2O8BA 3BF1A 3FZMA 3L2QA 4BVOA 2Z1GA 3QFUA 1ZBLA 2A41A 3EN9A 1SL1A 3PY8A 5AQTA 2VWJA 3CHWA 4DSLA 3IAYA 1CZAN 3OYJA 4CK2A 5BRDA 4CGFA 3SZ2A 3RWUA 3DLLL 3CI5A 2ITGA 4DV3K 3PLAA 2F9TA 3ZT0A 4CECA 4B1VA 3CETA 4M3WA 4OKKA 5JICA 4DFKA 2P9IA 4IFEA 4KO0A 3MDQA 4ZTJA 1BIUA 1S1XA 4MDAA 2YHAA 4JKBA 3ZCMA 3VQQA 3ID6A 4FCYA 3THXB 1VSMA 4BRDA 5FPNA 1KQSM 3PO5A 1CZ9A 3TTFA 3CCSN 4BRGA 1N33K 4K0KK 4FLWA 4E1JA 5AQVA 1ZXOA 1Q7YO 3IUCA 2EWSA 4X65K 1IH7A 3O9SA 5DM7L 2WONA 2B6AA 3WXJA 1G15A 5FLXO 3HP9A 4JYAK 2FBXA 4DQ8A 4O5BA 4RW8A 3WXKA 1WNSA 3OA9A 3A8YA 3P83D 4X62K 1T03A 4JKDA 1TK0A 4OPAA 2BDPA 1BA1A 3CC4N 5KGWA 1RBVA 5KRTA 4CGGA 2YNFA 3CCQN 5AQYA 4DQRA 3C0BA 3D2FB 3UE5A 1N34K 4KTQA 1ZBUA 1VQPN 4HUFA 4KHNA 3CPEA 3HPHA 1Y64A 3DRRA 3ULEA 3OJUA 4WE1A 4M3XA 1EWRA 2DFFA 1RT5A 4PA1A 2V7ZA 2YHYA 1IKXA 3TARA 4EIAA 3TSUA 4B08A 3M8QA 3AO4A 4B9LA 4OLAA 4CFDA 1TV6A 4GVMA 3EZ5A 4Z4EA 1S6PA 3H46O 1U2VB 4FPAA 2FBYA 3TR8A 1A5XA 4A5AA 4CK1A 1OH8A 5AQLA 4E1MA 1E4GT 5AQQA 3VESA 4WQ4A 4BWMA 1I3AA 1XI1A 3I0SA 4B3SK 3CMEN 4KHQA 3SBTA 2GWJA 3C6AA 4H0YB 3DLEA 3RRHA 3HZ6A 5AFUH 1TL3A 1KAYA 1NWKA 2IVNA 3VF6A 2XY8A 3DYAA 3M8SA 4EHTA 3IG1A 2YKMA 4BRPA 1R0AA 4IOAL 4B9VA 4BDYA 2GTDA 3EZWA 3KK3A 1N32K 3JYTA 3AVFA 2KW4A 5GAEP 4OKJA 2HVIA 4DTSA 4FWSA 3HOTA 4AHRA 3LZJA 2Z1IA 4BY9C 4F3TA 4CD3A 3OS0A 2P5OA 1QSSA 4HUGA 2HBLA 1NGFA 1NK0A 1VQ8N 4DMNA 4DV0K 3C7NB 2P9LA 2YNIA 3QICA 1TYQA 3ALYA 3KLHA 1CZBA 2XRIA 2ASPA 4MDBA 1KFDA 4QS7A 1KAXA 4ILGB 1YIJN 1GOAA 2IOCA 1Z05A 5GINA 3AA2A 4JKFA 3UKUB 2D0BA 2HOEA 3VQCA 1HKGA 5KPTA 3AA4A 4CHNA 3M3ZA 4B3OA 4CBXA 2YHWA 2FSJA 5AQWA 4JRPA 4FJXA 5K14A 4J2AA 4DTXA 3B6OA 1OVYA 3AGRA 4JKCA 2P9NB 3VEZA 3TABA 3CCVN 3OY9A 1XC9A 4J2BA 2UUBK 4E1NA 4DFMA 3KVGA 5C25A 3VMFB 4FM0A 1KVBA 3ATUA 4JKAA 3CG7A 3U9ZA 5M1KA 2XY6A 2P9SB 2NRTA 1S3XA 4JHDA 4PKGA 4FZYA 3NCIA 4PQUA 5HBMA 2O8CB 3T1YK 1A5WA 1VSJA 3TTDA 2QWMA 4YOTA 1FW6A 1K73O 1HPMA 2Q3SA 3LP1A 4AHTA 3NVKA 4WQ5A 3NGZA 1LWFA 3ZSWA 1ZBIA 3CCUN 4DSEA 3DXMA 2XHBA 5LJVA 1QE1A 4ZTFA 2FSNA 2J4RA 4LSLA 4CHQA 1QZ6A 4U67L 3ID8A 2Z1HA 3V4IA 3JS6A 1CXUA 3L2WA 3ENOA 5AQKA 2P9KB 3OTOK 4BR7A 1TKXA 4BRLA 4RCHA 3TANA 5AZIB 3ZT1A 3G71N 1K8AO 4YNQA 4DFPA 5J2PA 2Q0UA 3HVTA 3T7ZA 1YJNN 5M1PA 2QKBA 1Z26A 5M1QA 1I94K 1BO5O 3P4IA 1NGJA 4CJFA 2ZF5O 1HPZA 4IEEA 3SMPA 4C1NK 1YI2N 1VHXA 2NRRA 4NLCA 1BIZA 1C0MA 3F9MA 2P9PB 5CR4A 3SAHA 2R7YA 1VQ6N 5CY4A 1QSYA 3E9OA 5M1OA 1P8ZA 2Y1IA 3ZYYX 4ILJA 1JCFA 4MO4A 4AM7A 5I9EB 5HRPA 4BG9A 1D5AA 2YHXA 4JS4A 3A5NC 1OH5A 3QEXA 3EKUA 4I9QA 4CGDA 2HSTA 3HPGA 1BI4A 4EZ6A 2E20A 4BR2A 3KLEA 2O4GA 2YHBA 3ZSXA 3SYZA 4FJ9A 1YVUA 2JGUA 3ASMA 4EHUA 3DLGA 5JVGL 3SUNA 4DR3K 4RW7A 1WSHA 1BQMA 1ASWA 1HX1A 3N4QA 4FVMA 4JI7K 3T69A 2E6LA 5AQUA 1GLFO 2E6MA 1TK8A 5A2QO 1HNIA 4JK9A 4OVLA 2ASOA 1XHZA 4DSIA 1N36K 4CE9A 3SUPA 2FF6A 4DV2K 1HNZK 4K8ZA 4CJSA 2OZSA 3QO9A 4CEZA 1VQON 4BC3A 3GBTA 4WCEL 3RMBA 2X6SA 3WNGA 1D9DA 3NGYA 4DCHA 3WNFA 4CK3A
chains in the Genus database with same CATH topology
4B8CA 2NUBA 3H08A 5CZ2A 1YTUA 1JLBA 1RDCA 4CJWA 1RTJA 3L3UA 3ZSQA 4IG0A 1J53A 3QETA 3V6DA 4B9TA 1DLOA 4FLYA 4C8LA 4GMJB 4HTUA 3IS9A 1VSFA 1VSDA 4I2PA 3FFIA 3RMAA 1D8YA 4IFVA 4O4GA 1WSEA 2AJQA 1C1CA 2ATQA 3SQ2A 1U4BA 3MAQA 2X6NA 1JXEA 3AVGA 3QIOA 4BACA 1HYSA 2FC0A 4CJPA 3WNEA 3LP3A 4GW6A 2G8WA 2IDOA 1IG9A 1SKRA 2OPSA 3HSTB 3MXIA 3KLFA 3QIPA 1LAWA 4ELUA 2QXFA 3AV9A 4CF8A 3DI6A 4CJRA 1NJYA 4IKFA 3D45A 4IBNA 5KI6A 1Z25A 3SUQA 1ZBFA 4CEOA 4CJVA 1NJZA 2A1SA 2X74A 4H4OA 2W42A 5FRNA 4KRFA 2P5GA 4KHYA 3HO1A 4KI6A 1RILA 1RT6A 3AA5X 4M3TA 3T3FA 4CEBA 3CYMA 4MQ3A 3PX6A 1JLFA 1T8EA 3TAFA 1RDBA 5KGXA 3DMJA 4C8MA 4CJ3A 3SPYA 3K5OA 3B6PA 1BHLA 4OJRA 3SCXA 5HLFA 2OPRA 1EP4A 4RW4A 3O3HA 3AA3A 2D0CA 1JLAA 3ISNC 5CYQA 3LANA 1LAVA 3WNHA 3CM6A 4M41A 3TAPA 4FXDA 4E89A 3NH0A 3OYAA 3OYNA 3QLHA 1TAQA 3TAQA 3OJSA 1KVCA 4TSXA 5HRRA 4Z4CA 3LPUA 5J2NA 2G8FA 3KD5E 2FBTA 1ZYQA 1DTQA 3O3GA 3AVCA 1REVA 1SV5A 1D9FA 4K8XA 3LP0A 2PZSA 3DOKA 3K59A 3NFAA 4FLXA 2HNYA 3O4NA 5HROA 4DS4A 1NK5A 4ID5A 5JS2A 3AVAA 4OPJA 2DY4A 1RT3A 2GBZA 1VRTA 1RBSA 2GV9A 1EKEA 3DLRA 4IDKA 3BDPA 3SQ4A 2OZMA 1S6QA 4AHUA 4BE0A 1S1TA 2IGIA 3L8BA 4FJGA 4C8KA 3ZSOA 3QEIA 4FK2A 3VQBA 3V1OA 1SL0A 2KFZA 4M42A 2PY5A 1NK7A 4FJMA 4PUOA 5FRMA 2DTUA 1RNHA 2RPIA 2G8KA 4NCBA 4DF4A 4DG1A 3RMCA 4M3RA 1KLMA 3AVLA 4CHOA 1RDAA 3ZT3A 3AVMA 1EETA 3P5JA 3L2QA 3CM5A 4FJLA 2Z1GA 3KD1E 4Y1CA 1L5UA 1JLGA 4F4KA 1ZBLA 3AO1A 1ASUA 1SL1A 1SL2A 4E19A 3ULDA 3PY8A 2VWJA 3C95A 4DSLA 4DTMA 4CEAA 1L3UA 3IAYA 1HRHA 5C42A 3AO2A 3OYJA 4CK2A 3DRSA 5J1EA 4CGFA 3SZ2A 3SPZA 4FLVA 2RKIA 1Q8IA 3KIOA 2YV0X 3RWUA 4FJ5A 2ITGA 4OLBA 1N5YA 3NH1A 1B92A 3U3GA 3VA0A 2YNHA 3ZT0A 1VK0A 4IG3A 4CECA 2I5JA 2F8SA 2HW3A 1KLNA 4M3WA 3S3MA 4OKKA 3ZT4A 4DFKA 1NOZA 5CYMA 1LV5A 1JXBA 1WLJA 4KO0A 4OPKA 3L2RA 3K58A 4ZTJA 2PYJA 1BIUA 1S1XA 2YHAA 4KREA 2HB5A 3ZCMA 3ZSZA 4C8OA 1X9MA 3V9WA 4DFJA 4B9SA 3QERA 1WSIA 3VQQA 4FCYA 4XIUA 1VSMA 1QS4A 4EZ9A 4QOZB 4ICLA 3VQPA 4CJLA 1W9HA 4E7IA 3LP2A 1CZ9A 3PO5A 3S9HA 3AVHA 3ITHA 4FLWA 5T7BA 2HHXA 1B9DA 4FM2A 1IH7A 1VSLA 2VG7A 1UOCA 4B8AB 3LPTA 4CF2A 1F21A 4DLEA 2ETJA 2B6AA 2WONA 1X1PA 3DLHA 1G15A 4ID1A 3OYFA 1LWCA 1T7PA 2HMIA 3HP9A 4FK0A 1C0UA 3AVIA 4HVJA 3LDSA 1C6VA 5FDLA 2FBXA 3V81A 4O5BA 4RW8A 1I39A 3K5NA 1WNSA 1U48A 3BGRA 3DLKA 1HQUA 4IFYA 3P83D 1KTQA 1T03A 3CQ8A 3OYKA 1RTHA 2HHQA 2IC3A 3RMDA 1TK0A 1RBTA 2BDPA 4W5NA 5KGWA 3WNFA 1RBVA 2F96A 3AO5A 5KRTA 4CGGA 2YNFA 4QCLA 4DQRA 1SUQA 4KTQA 2ZQBA 2HHTA 1XHXA 1GOBA 5JS1A 1ZBUA 4HUFA 4DTNA 3CFOA 5CZ1A 4CJ5A 4KHNA 4FJIA 1JL1A 4N5SA 3HPHA 3DRRA 1JLCA 2GUIA 3ZT2A 3OJUA 1JL2A 4WE1A 4M3XA 2DFFA 1U49A 4Z0UA 2OYQA 4OGCA 1CXQA 1RT5A 4PA1A 1VSIA 4I7FA 4FJNA 1FKOA 4CGJA 2DFHA 1L3VA 2QK9A 1KRPA 1IKXA 3TARA 5DK5A 3K5LA 1S1UA 3OYBA 3V1RA 4CJEA 4B08A 1IKVA 3M8QA 3AO4A 3MXMA 1SKWA 4B9LA 2HHUA 4M45A 4OLAA 1KSPA 3V9UA 4CFDA 1TV6A 4GVMA 3EZ5A 3PX0A 2G8UA 3SQ1A 1KCFA 1S6PA 3LAMA 3VN5A 3SQ0A 4Z4EA 3QEVA 4LSNA 3ZSRA 4CJQA 4Z4IA 3SUOA 1QQCA 4BE2A 3QESA 4DQPA 4DSJA 4OGEA 2FBYA 3TR8A 4CCHA 3NHGA 2BE2A 1A5XA 4CK1A 4E1MA 3VA3A 3HXMA 2D0AA 1RDDA 4G1QA 4BWMA 4W5QA 4CFCA 1I3AA 3LZIA 1XI1A 3I0SA 2ZD1A 2OPPA 3DM2A 3G0ZA 1ASVA 3M8RA 2RN2A 4KHQA 3PV8A 4KI4A 4I9LA 4DTUA 1FK9A 1S9GA 4DS5A 2KFNA 3DLEA 4PY5A 4CEFA 4CF0A 3RRHA 1WSGA 1CLQA 5D3GA 1TL3A 4N56A 4CHZA 4KPYA 1NK4A 3MEGA 1NKEA 2XY8A 4I2QA 1XWLA 1TL1A 3DYAA 3M8SA 3CFPA 1NK8A 1LW2A 4KFBA 1RBUA 3IG1A 2YKMA 3IRXA 3S3OA 4CERA 4FYDA 3OYMA 1HQEA 1R0AA 4B9VA 4BDYA 3KTQA 5C24A 2BGGA 1BL3A 3F9KA 1FXXA 3NBPA 4FLUA 3VQ5A 3KK3A 1LW0A 4NYFA 3OS1A 2Y1JA 1NKCA 3JYTA 3SV3A 3AVFA 2KW4A 3KKRA 4KV8A 3VQ9A 4DTJA 3QEPA 4KAZA 4OKJA 2HVIA 1VSEA 4DTSA 1WAFA 5HP1A 3L2VA 4N47A 1VRUA 3LALA 3PUFA 2IAJA 1J54A 1TKTA 2P51A 3L3VA 4AHRA 3SI6A 1RT4A 1LWEA 2HNZA 3LZJA 2Z1IA 5J2MA 1BCOA 3C6TA 4B9MA 4F3TA 1S5JA 3OS0A 4C8NA 4DTPA 4E7HA 4CEQA 2D5RA 2P5OA 2XY5A 1BQNA 1QSSA 4HUGA 1TVRA 4CF1A 4LD0A 3NH2A 3MEEA 3V9ZA 4FW1A 1RBRA 3VQ4A 4YFUA 1NK0A 4DMNA 4CEEA 1DTTA 1BGXT 3QNNA 4KB1A 1L3SA 2YNIA 4HUEA 3ALYA 3KLHA 1CZBA 3D0PA 4BDPA 2XRIA 4AHSA 3QINA 4LH5A 1KFDA 3NF9A 3OYGA 3SJJA 4RW6A 5E41A 1GOAA 3TI0A 3SV4A 2IOCA 3THVA 3A2FA 3F73A 3KKSA 1Q9XA 3AA2A 3AO3A 1W0HA 1HNVA 4FZZA 5J2QA 2QKKA 4F3OA 1IKYA 2D0BA 1EX4A 3MECA 4Y1DA 2G8IA 3LAKA 1X9SA 3QNOA 3PO4A 4BE1A 2Z1JA 3HM9A 3VQCA 4AHVA 4JLHA 3NF6A 4KTWA 4Z4GA 4DSFA 3U6FA 3AA4A 2YNGA 3MXJA 4CHNA 3EYZA 4FK4A 3KK2A 4FJ8A 3DRPA 4B3OA 1WSFA 1J5OA 4JRPA 4FJXA 4FLTA 1U45A 5K14A 1NJXA 3HK2A 4BWJA 1ZBHA 4J2AA 4DTXA 3B6OA 4CJTA 4W5TA 1BISA 1RTIA 4LY7A 2XY7A 3RRGA 3VQEA 3NDKA 4DLGA 2G8VA 4CF9A 3AVNA 3K57A 3TABA 1IKWA 2B4JA 3VQ8A 5KRSA 4RG8A 4CGIA 1VSKA 1GOCA 4H8KA 3TAEA 3OY9A 1XC9A 4CESA 4J2BA 4FM1A 2HHWA 2X78A 4E1NA 4DFMA 1HYVA 1HMVA 1TGOA 5C25A 4FM0A 4DQQA 1KVBA 4Q0BA 3OYCA 4AH9A 3HJFA 1S1VA 3CG7A 1A5VA 3NF7A 3DLBA 4N76A 2OPQA 3V9XA 1C1AA 5I3UA 2XY6A 1TKDA 1NK9A 4CEDA 5KTQA 4FZYA 3NCIA 1RT7A 2KQ2A 5HBMA 4PQUA 3I8DA 1J9AA 1SKSA 3HP6A 4DQIA 1A5WA 3PX4A 4EP5A 4HCCA 1VSJA 2VWKA 5FROA 2KZMA 2Q3SA 3LP1A 4M3ZA 3KLIA 1NOYA 4AHTA 3VQ6A 4EP4A 3NGZA 1LWFA 3ZSWA 4DU3A 1ZBIA 5HRSA 4DSEA 4CJ4A 2XHBA 1RCHA 1QE1A 2HNDA 3OYDA 4ZTFA 4ELVA 2P1JA 4MFBA 4LSLA 4M3UA 2JLEA 3KJVA 4O0JA 3OVNA 4NYNA 4CHQA 4AHCA 4DF8A 1QHTA 3S3NA 3RR8A 3AVJA 4E0DA 2HHVA 2VG6A 3V1QA 4DTOA 3HVRA 4CIEA 1C0TA 2Z1HA 4CHYA 2ZE2A 1CXUA 3MEDA 3L2WA 3V4IA 4Z4FA 4FJHA 2RF2A 1FKPA 3G10A 1O1WA 1TKXA 3CFRA 3UIQA 3AVKA 4F2SA 4F2RA 3TANA 3T19A 3ZT1A 1WSJA 2BANA 4W5OA 5SZTA 4YNQA 4DFPA 4PWDA 3L2UA 3SNNA 1JLQA 5J2PA 3KLGA 3HVTA 3P1GA 3VQDA 3NF8A 4KKOA 1HYZA 3HPOA 2QKBA 1Z26A 2KTQA 2G8HA 1NJWA 2EHGA 4J2EA 4NCAA 2O4IA 4CJFA 4FLZA 3LWLA 1HPZA 4B9UA 4FJKA 1UWBA 2PYLA 3I0RA 4E7LA 1QSLA 4J2DA 4AILC 1WAJA 3RR7A 4CFAA 5HRNA 4O0IA 1KFSA 4FZXC 4CHPA 4RW9A 4CGHA 3EY1A 1X9WA 1RTDA 1TK5A 2FBVA 4O44A 1C1BA 1WN7A 4KHWA 1UA0A 2IS3A 1MU2A 1U47A 1BIZA 1C0MA 1UAXA 4CFBA 1B9FA 1TAUA 3NGIA 2R7YA 4O55A 3M8PA 5CY4A 1QSYA 4N41A 3OYHA 1T05A 1BI4B 4R5PA 3NAEA 1JLEA 4KHSA 2Y1IA 2LSNA 3ZSVA 3O4QA 5HRPA 1HJRA 3DOLA 4KTZA 3C94A 4CIFA 1BCMA 3JSMA 3E01A 1D5AA 3HL8A 3T1AA 3KK1A 2F8TA 4JS4A 4E3SA 4M3YA 3QEXA 4DTRA 4B9NA 1U04A 4CGDA 3AVBA 3HPGA 4I9QA 1BI4A 5I42A 4EZ6A 4UQGA 3TAGA 2KZZA 4JRQA 2VG5A 3OYEA 3OYIA 2O4GA 2YHBA 3KLEA 3ZSXA 4E7JA 1NK6A 1L3TA 4ELTA 4F8RA 4Z4HA 2DFEA 3SYZA 1YVUA 2JGUA 3ASMA 4FJ9A 3DLGA 2HVHA 5EU7A 3RTVA 3SUNA 1N6QA 2E4LA 3TAMA 1NKBA 4FJ7A 4L8RB 3QEWA 3HT3A 3K2PA 1S9EA 4RW7A 4H4MA 4CJUA 1WSHA 3OYLA 1BQMA 1ASWA 2A1RA 2OA8A 4FVMA 4DSKA 4KHUA 3VQAA 2EX3A 1S1WA 5DMRA 3O3FA 3LWMA 4E7KA 3TWHA 2E6LA 2E6MA 1TK8A 1Y97A 2B5JA 1HNIA 3NE6A 1VSHA 4OKEA 1K6YA 3VQ7A 4DQSA 1EXQA 4OVLA 3U3YA 1D9DA 4FJJA 4NCGA 4Q5VA 1XHZA 5SWMA 4DSIA 1KVAA 1YTAA 2XO7A 3K5MA 4CE9A 1UA1A 2HHSA 3SUPA 4HCBA 4K8ZA 1JKHA 4BDZA 1RT1A 4CJSA 3C6UA 2OZSA 1TKZA 3QO9A 4QAGA 4CEZA 3HYFA 4FW2A 4ZHRA 4DWIA 4LH4A 4KB0A 3ZSYA 4DU1A 1ITGA 2YKNA 1IO2A 2WOMA 4JS5A 1QTMA 4W5RA 3OS2A 3V9SA 4DU4A 2X6SA 1RT2A 3WNGA 3NGYA 4CIGA 4CJKA 4HHTA 3RMBA 1Q9YA 1YT3A 4CK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B8C A;  2NUB A;  3H08 A;  5CZ2 A;  1YTU A;  1JLB A;  1RDC A;  4CJW A;  1RTJ A;  3L3U A;  3ZSQ A;  4IG0 A;  1J53 A;  3QET A;  3V6D A;  4B9T A;  1DLO A;  4FLY A;  4C8L A;  4GMJ B;  4HTU A;  3IS9 A;  1VSF A;  1VSD A;  4I2P A;  3FFI A;  3RMA A;  1D8Y A;  4IFV A;  4O4G A;  1WSE A;  2AJQ A;  1C1C A;  2ATQ A;  3SQ2 A;  1U4B A;  3MAQ A;  2X6N A;  1JXE A;  3AVG A;  3QIO A;  4BAC A;  1HYS A;  2FC0 A;  4CJP A;  3WNE A;  3LP3 A;  4GW6 A;  2G8W A;  2IDO A;  1IG9 A;  1SKR A;  2OPS A;  3HST B;  3MXI A;  3KLF A;  3QIP A;  1LAW A;  4ELU A;  2QXF A;  3AV9 A;  4CF8 A;  3DI6 A;  4CJR A;  1NJY A;  4IKF A;  3D45 A;  4IBN A;  5KI6 A;  1Z25 A;  3SUQ A;  1ZBF A;  4CEO A;  4CJV A;  1NJZ A;  2A1S A;  2X74 A;  4H4O A;  2W42 A;  5FRN A;  4KRF A;  2P5G A;  4KHY A;  3HO1 A;  4KI6 A;  1RIL A;  1RT6 A;  3AA5 X;  4M3T A;  3T3F A;  4CEB A;  3CYM A;  4MQ3 A;  3PX6 A;  1JLF A;  1T8E A;  3TAF A;  1RDB A;  5KGX A;  3DMJ A;  4C8M A;  4CJ3 A;  3SPY A;  3K5O A;  3B6P A;  1BHL A;  4OJR A;  3SCX A;  5HLF A;  2OPR A;  1EP4 A;  4RW4 A;  3O3H A;  3AA3 A;  2D0C A;  1JLA A;  3ISN C;  5CYQ A;  3LAN A;  1LAV A;  3WNH A;  3CM6 A;  4M41 A;  3TAP A;  4FXD A;  4E89 A;  3NH0 A;  3OYA A;  3OYN A;  3QLH A;  1TAQ A;  3TAQ A;  3OJS A;  1KVC A;  4TSX A;  5HRR A;  4Z4C A;  3LPU A;  5J2N A;  2G8F A;  3KD5 E;  2FBT A;  1ZYQ A;  1DTQ A;  3O3G A;  3AVC A;  1REV A;  1SV5 A;  1D9F A;  4K8X A;  3LP0 A;  2PZS A;  3DOK A;  3K59 A;  3NFA A;  4FLX A;  2HNY A;  3O4N A;  5HRO A;  4DS4 A;  1NK5 A;  4ID5 A;  5JS2 A;  3AVA A;  4OPJ A;  2DY4 A;  1RT3 A;  2GBZ A;  1VRT A;  1RBS A;  2GV9 A;  1EKE A;  3DLR A;  4IDK A;  3BDP A;  3SQ4 A;  2OZM A;  1S6Q A;  4AHU A;  4BE0 A;  1S1T A;  2IGI A;  3L8B A;  4FJG A;  4C8K A;  3ZSO A;  3QEI A;  4FK2 A;  3VQB A;  3V1O A;  1SL0 A;  2KFZ A;  4M42 A;  2PY5 A;  1NK7 A;  4FJM A;  4PUO A;  5FRM A;  2DTU A;  1RNH A;  2RPI A;  2G8K A;  4NCB A;  4DF4 A;  4DG1 A;  3RMC A;  4M3R A;  1KLM A;  3AVL A;  4CHO A;  1RDA A;  3ZT3 A;  3AVM A;  1EET A;  3P5J A;  3L2Q A;  3CM5 A;  4FJL A;  2Z1G A;  3KD1 E;  4Y1C A;  1L5U A;  1JLG A;  4F4K A;  1ZBL A;  3AO1 A;  1ASU A;  1SL1 A;  1SL2 A;  4E19 A;  3ULD A;  3PY8 A;  2VWJ A;  3C95 A;  4DSL A;  4DTM A;  4CEA A;  1L3U A;  3IAY A;  1HRH A;  5C42 A;  3AO2 A;  3OYJ A;  4CK2 A;  3DRS A;  5J1E A;  4CGF A;  3SZ2 A;  3SPZ A;  4FLV A;  2RKI A;  1Q8I A;  3KIO A;  2YV0 X;  3RWU A;  4FJ5 A;  2ITG A;  4OLB A;  1N5Y A;  3NH1 A;  1B92 A;  3U3G A;  3VA0 A;  2YNH A;  3ZT0 A;  1VK0 A;  4IG3 A;  4CEC A;  2I5J A;  2F8S A;  2HW3 A;  1KLN A;  4M3W A;  3S3M A;  4OKK A;  3ZT4 A;  4DFK A;  1NOZ A;  5CYM A;  1LV5 A;  1JXB A;  1WLJ A;  4KO0 A;  4OPK A;  3L2R A;  3K58 A;  4ZTJ A;  2PYJ A;  1BIU A;  1S1X A;  2YHA A;  4KRE A;  2HB5 A;  3ZCM A;  3ZSZ A;  4C8O A;  1X9M A;  3V9W A;  4DFJ A;  4B9S A;  3QER A;  1WSI A;  3VQQ A;  4FCY A;  4XIU A;  1VSM A;  1QS4 A;  4EZ9 A;  4QOZ B;  4ICL A;  3VQP A;  4CJL A;  1W9H A;  4E7I A;  3LP2 A;  1CZ9 A;  3PO5 A;  3S9H A;  3AVH A;  3ITH A;  4FLW A;  5T7B A;  2HHX A;  1B9D A;  4FM2 A;  1IH7 A;  1VSL A;  2VG7 A;  1UOC A;  4B8A B;  3LPT A;  4CF2 A;  1F21 A;  4DLE A;  2ETJ A;  2B6A A;  2WON A;  1X1P A;  3DLH A;  1G15 A;  4ID1 A;  3OYF A;  1LWC A;  1T7P A;  2HMI A;  3HP9 A;  4FK0 A;  1C0U A;  3AVI A;  4HVJ A;  3LDS A;  1C6V A;  5FDL A;  2FBX A;  3V81 A;  4O5B A;  4RW8 A;  1I39 A;  3K5N A;  1WNS A;  1U48 A;  3BGR A;  3DLK A;  1HQU A;  4IFY A;  3P83 D;  1KTQ A;  1T03 A;  3CQ8 A;  3OYK A;  1RTH A;  2HHQ A;  2IC3 A;  3RMD A;  1TK0 A;  1RBT A;  2BDP A;  4W5N A;  5KGW A;  3WNF A;  1RBV A;  2F96 A;  3AO5 A;  5KRT A;  4CGG A;  2YNF A;  4QCL A;  4DQR A;  1SUQ A;  4KTQ A;  2ZQB A;  2HHT A;  1XHX A;  1GOB A;  5JS1 A;  1ZBU A;  4HUF A;  4DTN A;  3CFO A;  5CZ1 A;  4CJ5 A;  4KHN A;  4FJI A;  1JL1 A;  4N5S A;  3HPH A;  3DRR A;  1JLC A;  2GUI A;  3ZT2 A;  3OJU A;  1JL2 A;  4WE1 A;  4M3X A;  2DFF A;  1U49 A;  4Z0U A;  2OYQ A;  4OGC A;  1CXQ A;  1RT5 A;  4PA1 A;  1VSI A;  4I7F A;  4FJN A;  1FKO A;  4CGJ A;  2DFH A;  1L3V A;  2QK9 A;  1KRP A;  1IKX A;  3TAR A;  5DK5 A;  3K5L A;  1S1U A;  3OYB A;  3V1R A;  4CJE A;  4B08 A;  1IKV A;  3M8Q A;  3AO4 A;  3MXM A;  1SKW A;  4B9L A;  2HHU A;  4M45 A;  4OLA A;  1KSP A;  3V9U A;  4CFD A;  1TV6 A;  4GVM A;  3EZ5 A;  3PX0 A;  2G8U A;  3SQ1 A;  1KCF A;  1S6P A;  3LAM A;  3VN5 A;  3SQ0 A;  4Z4E A;  3QEV A;  4LSN A;  3ZSR A;  4CJQ A;  4Z4I A;  3SUO A;  1QQC A;  4BE2 A;  3QES A;  4DQP A;  4DSJ A;  4OGE A;  2FBY A;  3TR8 A;  4CCH A;  3NHG A;  2BE2 A;  1A5X A;  4CK1 A;  4E1M A;  3VA3 A;  3HXM A;  2D0A A;  1RDD A;  4G1Q A;  4BWM A;  4W5Q A;  4CFC A;  1I3A A;  3LZI A;  1XI1 A;  3I0S A;  2ZD1 A;  2OPP A;  3DM2 A;  3G0Z A;  1ASV A;  3M8R A;  2RN2 A;  4KHQ A;  3PV8 A;  4KI4 A;  4I9L A;  4DTU A;  1FK9 A;  1S9G A;  4DS5 A;  2KFN A;  3DLE A;  4PY5 A;  4CEF A;  4CF0 A;  3RRH A;  1WSG A;  1CLQ A;  5D3G A;  1TL3 A;  4N56 A;  4CHZ A;  4KPY A;  1NK4 A;  3MEG A;  1NKE A;  2XY8 A;  4I2Q A;  1XWL A;  1TL1 A;  3DYA A;  3M8S A;  3CFP A;  1NK8 A;  1LW2 A;  4KFB A;  1RBU A;  3IG1 A;  2YKM A;  3IRX A;  3S3O A;  4CER A;  4FYD A;  3OYM A;  1HQE A;  1R0A A;  4B9V A;  4BDY A;  3KTQ A;  5C24 A;  2BGG A;  1BL3 A;  3F9K A;  1FXX A;  3NBP A;  4FLU A;  3VQ5 A;  3KK3 A;  1LW0 A;  4NYF A;  3OS1 A;  2Y1J A;  1NKC A;  3JYT A;  3SV3 A;  3AVF A;  2KW4 A;  3KKR A;  4KV8 A;  3VQ9 A;  4DTJ A;  3QEP A;  4KAZ A;  4OKJ A;  2HVI A;  1VSE A;  4DTS A;  1WAF A;  5HP1 A;  3L2V A;  4N47 A;  1VRU A;  3LAL A;  3PUF A;  2IAJ A;  1J54 A;  1TKT A;  2P51 A;  3L3V A;  4AHR A;  3SI6 A;  1RT4 A;  1LWE A;  2HNZ A;  3LZJ A;  2Z1I A;  5J2M A;  1BCO A;  3C6T A;  4B9M A;  4F3T A;  1S5J A;  3OS0 A;  4C8N A;  4DTP A;  4E7H A;  4CEQ A;  2D5R A;  2P5O A;  2XY5 A;  1BQN A;  1QSS A;  4HUG A;  1TVR A;  4CF1 A;  4LD0 A;  3NH2 A;  3MEE A;  3V9Z A;  4FW1 A;  1RBR A;  3VQ4 A;  4YFU A;  1NK0 A;  4DMN A;  4CEE A;  1DTT A;  1BGX T;  3QNN A;  4KB1 A;  1L3S A;  2YNI A;  4HUE A;  3ALY A;  3KLH A;  1CZB A;  3D0P A;  4BDP A;  2XRI A;  4AHS A;  3QIN A;  4LH5 A;  1KFD A;  3NF9 A;  3OYG A;  3SJJ A;  4RW6 A;  5E41 A;  1GOA A;  3TI0 A;  3SV4 A;  2IOC A;  3THV A;  3A2F A;  3F73 A;  3KKS A;  1Q9X A;  3AA2 A;  3AO3 A;  1W0H A;  1HNV A;  4FZZ A;  5J2Q A;  2QKK A;  4F3O A;  1IKY A;  2D0B A;  1EX4 A;  3MEC A;  4Y1D A;  2G8I A;  3LAK A;  1X9S A;  3QNO A;  3PO4 A;  4BE1 A;  2Z1J A;  3HM9 A;  3VQC A;  4AHV A;  4JLH A;  3NF6 A;  4KTW A;  4Z4G A;  4DSF A;  3U6F A;  3AA4 A;  2YNG A;  3MXJ A;  4CHN A;  3EYZ A;  4FK4 A;  3KK2 A;  4FJ8 A;  3DRP A;  4B3O A;  1WSF A;  1J5O A;  4JRP A;  4FJX A;  4FLT A;  1U45 A;  5K14 A;  1NJX A;  3HK2 A;  4BWJ A;  1ZBH A;  4J2A A;  4DTX A;  3B6O A;  4CJT A;  4W5T A;  1BIS A;  1RTI A;  4LY7 A;  2XY7 A;  3RRG A;  3VQE A;  3NDK A;  4DLG A;  2G8V A;  4CF9 A;  3AVN A;  3K57 A;  3TAB A;  1IKW A;  2B4J A;  3VQ8 A;  5KRS A;  4RG8 A;  4CGI A;  1VSK A;  1GOC A;  4H8K A;  3TAE A;  3OY9 A;  1XC9 A;  4CES A;  4J2B A;  4FM1 A;  2HHW A;  2X78 A;  4E1N A;  4DFM A;  1HYV A;  1HMV A;  1TGO A;  5C25 A;  4FM0 A;  4DQQ A;  1KVB A;  4Q0B A;  3OYC A;  4AH9 A;  3HJF A;  1S1V A;  3CG7 A;  1A5V A;  3NF7 A;  3DLB A;  4N76 A;  2OPQ A;  3V9X A;  1C1A A;  5I3U A;  2XY6 A;  1TKD A;  1NK9 A;  4CED A;  5KTQ A;  4FZY A;  3NCI A;  1RT7 A;  2KQ2 A;  5HBM A;  4PQU A;  3I8D A;  1J9A A;  1SKS A;  3HP6 A;  4DQI A;  1A5W A;  3PX4 A;  4EP5 A;  4HCC A;  1VSJ A;  2VWK A;  5FRO A;  2KZM A;  2Q3S A;  3LP1 A;  4M3Z A;  3KLI A;  1NOY A;  4AHT A;  3VQ6 A;  4EP4 A;  3NGZ A;  1LWF A;  3ZSW A;  4DU3 A;  1ZBI A;  5HRS A;  4DSE A;  4CJ4 A;  2XHB A;  1RCH A;  1QE1 A;  2HND A;  3OYD A;  4ZTF A;  4ELV A;  2P1J A;  4MFB A;  4LSL A;  4M3U A;  2JLE A;  3KJV A;  4O0J A;  3OVN A;  4NYN A;  4CHQ A;  4AHC A;  4DF8 A;  1QHT A;  3S3N A;  3RR8 A;  3AVJ A;  4E0D A;  2HHV A;  2VG6 A;  3V1Q A;  4DTO A;  3HVR A;  4CIE A;  1C0T A;  2Z1H A;  4CHY A;  2ZE2 A;  1CXU A;  3MED A;  3L2W A;  3V4I A;  4Z4F A;  4FJH A;  2RF2 A;  1FKP A;  3G10 A;  1O1W A;  1TKX A;  3CFR A;  3UIQ A;  3AVK A;  4F2S A;  4F2R A;  3TAN A;  3T19 A;  3ZT1 A;  1WSJ A;  2BAN A;  4W5O A;  5SZT A;  4YNQ A;  4DFP A;  4PWD A;  3L2U A;  3SNN A;  1JLQ A;  5J2P A;  3KLG A;  3HVT A;  3P1G A;  3VQD A;  3NF8 A;  4KKO A;  1HYZ A;  3HPO A;  2QKB A;  1Z26 A;  2KTQ A;  2G8H A;  1NJW A;  2EHG A;  4J2E A;  4NCA A;  2O4I A;  4CJF A;  4FLZ A;  3LWL A;  1HPZ A;  4B9U A;  4FJK A;  1UWB A;  2PYL A;  3I0R A;  4E7L A;  1QSL A;  4J2D A;  4AIL C;  1WAJ A;  3RR7 A;  4CFA A;  5HRN A;  4O0I A;  1KFS A;  4FZX C;  4CHP A;  4RW9 A;  4CGH A;  3EY1 A;  1X9W A;  1RTD A;  1TK5 A;  2FBV A;  4O44 A;  1C1B A;  1WN7 A;  4KHW A;  1UA0 A;  2IS3 A;  1MU2 A;  1U47 A;  1BIZ A;  1C0M A;  1UAX A;  4CFB A;  1B9F A;  1TAU A;  3NGI A;  2R7Y A;  4O55 A;  3M8P A;  5CY4 A;  1QSY A;  4N41 A;  3OYH A;  1T05 A;  1BI4 B;  4R5P A;  3NAE A;  1JLE A;  4KHS A;  2Y1I A;  2LSN A;  3ZSV A;  3O4Q A;  5HRP A;  1HJR A;  3DOL A;  4KTZ A;  3C94 A;  4CIF A;  1BCM A;  3JSM A;  3E01 A;  1D5A A;  3HL8 A;  3T1A A;  3KK1 A;  2F8T A;  4JS4 A;  4E3S A;  4M3Y A;  3QEX A;  4DTR A;  4B9N A;  1U04 A;  4CGD A;  3AVB A;  3HPG A;  4I9Q A;  1BI4 A;  5I42 A;  4EZ6 A;  4UQG A;  3TAG A;  2KZZ A;  4JRQ A;  2VG5 A;  3OYE A;  3OYI A;  2O4G A;  2YHB A;  3KLE A;  3ZSX A;  4E7J A;  1NK6 A;  1L3T A;  4ELT A;  4F8R A;  4Z4H A;  2DFE A;  3SYZ A;  1YVU A;  2JGU A;  3ASM A;  4FJ9 A;  3DLG A;  2HVH A;  5EU7 A;  3RTV A;  3SUN A;  1N6Q A;  2E4L A;  3TAM A;  1NKB A;  4FJ7 A;  4L8R B;  3QEW A;  3HT3 A;  3K2P A;  1S9E A;  4RW7 A;  4H4M A;  4CJU A;  1WSH A;  3OYL A;  1BQM A;  1ASW A;  2A1R A;  2OA8 A;  4FVM A;  4DSK A;  4KHU A;  3VQA A;  2EX3 A;  1S1W A;  5DMR A;  3O3F A;  3LWM A;  4E7K A;  3TWH A;  2E6L A;  2E6M A;  1TK8 A;  1Y97 A;  2B5J A;  1HNI A;  3NE6 A;  1VSH A;  4OKE A;  1K6Y A;  3VQ7 A;  4DQS A;  1EXQ A;  4OVL A;  3U3Y A;  1D9D A;  4FJJ A;  4NCG A;  4Q5V A;  1XHZ A;  5SWM A;  4DSI A;  1KVA A;  1YTA A;  2XO7 A;  3K5M A;  4CE9 A;  1UA1 A;  2HHS A;  3SUP A;  4HCB A;  4K8Z A;  1JKH A;  4BDZ A;  1RT1 A;  4CJS A;  3C6U A;  2OZS A;  1TKZ A;  3QO9 A;  4QAG A;  4CEZ A;  3HYF A;  4FW2 A;  4ZHR A;  4DWI A;  4LH4 A;  4KB0 A;  3ZSY A;  4DU1 A;  1ITG A;  2YKN A;  1IO2 A;  2WOM A;  4JS5 A;  1QTM A;  4W5R A;  3OS2 A;  3V9S A;  4DU4 A;  2X6S A;  1RT2 A;  3WNG A;  3NGY A;  4CIG A;  4CJK A;  4HHT A;  3RMB A;  1Q9Y A;  1YT3 A;  4CK3 A; 
#chains in the Genus database with same CATH topology
 4B8C A;  5CZ2 A;  2OAN A;  4CJW A;  3L3U A;  4IG0 A;  3CER A;  4B9T A;  4BG8 A;  3H6E A;  1VSD A;  3RMA A;  3FFI A;  1C1C A;  3CJC A;  1JXE A;  1MA9 B;  2CGJ A;  4GW6 A;  4H5R A;  2IDO A;  2HBM A;  3HST B;  3LDN A;  2O8E A;  2QXF A;  4CF8 A;  5AZJ A;  3DI6 A;  5B8H A;  4IKF A;  5AQO A;  2A1S A;  4DV7 K;  4OPH A;  4KI6 A;  1HKB A;  1RIL A;  3O08 A;  5EVZ A;  4JI6 K;  4M3T A;  3T3F A;  2UU9 K;  5KGX A;  3SPY A;  4LF9 K;  1NU0 A;  2KKZ A;  3P38 A;  2QWN A;  3K5O A;  1FJG K;  5HLF A;  1EP4 A;  4RW4 A;  3ISN C;  2YJF A;  4M41 A;  4BR0 A;  3TAP A;  3THW B;  2WTU A;  4JD2 A;  3OJS A;  5HRR A;  4H5N A;  5J2N A;  2FBT A;  1KAZ A;  4DUY K;  1ZYQ A;  1SV5 A;  1WOQ A;  3E66 A;  3O9R A;  4FLX A;  2GX9 A;  5HRO A;  1NK5 A;  5JS2 A;  4OPJ A;  1VRT A;  3BDP A;  2GV9 A;  2E2N A;  4BE0 A;  1GLD G;  4FWK A;  4FK2 A;  3UKR B;  3D7E O;  4IO9 L;  4NCB A;  3AVL A;  4CHO A;  1BG3 A;  1K9M O;  1OVQ A;  1JLG A;  3LM2 A;  1SL2 A;  4E19 A;  3O9T A;  3ULD A;  3C95 A;  4CEA A;  1L3U A;  5C42 A;  4HTL A;  4FLV A;  1N5Y A;  1YUW A;  3NH1 A;  3U3G A;  3VA0 A;  2F8S A;  2VQE K;  1R59 O;  3S3M A;  3O80 A;  1LV5 A;  1JXB A;  2PYJ A;  3R9P A;  2HB5 A;  3ZSZ A;  5EOY A;  5E84 A;  4DFJ A;  1HNW K;  5M1N A;  1QS4 A;  2QI2 A;  4EZ9 A;  3VQP A;  2NRH A;  2D0O A;  3N4P A;  4BRI A;  1EQY A;  3S9H A;  1T3V A;  5ELZ A;  4QS9 A;  1W2B M;  5T7B A;  1QQO A;  2VG7 A;  1VSL A;  3THX A;  4CF2 A;  4DLE A;  5LY3 A;  4WQ4 C;  3OYF A;  1LWC A;  1C0U A;  5MLC Q;  3V81 A;  1U48 A;  3BGR A;  1NGD A;  3WXI A;  4XH5 A;  3CQ8 A;  3RMD A;  1QQN A;  1RBT A;  2Q97 A;  4W5N A;  3CXC M;  4JV5 K;  3DXK B;  3AO5 A;  4QCL A;  1VQ4 N;  2ZQB A;  4A2B A;  1GOB A;  2CH5 A;  4FJI A;  1Z6R A;  4BC4 A;  2E88 A;  4Z0U A;  4FJN A;  4CGJ A;  3D2F A;  2OCE A;  2KHO A;  4FWO A;  3OYB A;  3V1R A;  5CE3 A;  3MXM A;  2HHU A;  3CCL N;  1KSP A;  4FWQ A;  3V9U A;  3PX0 A;  2UXB K;  3SQ1 A;  2GUP A;  3VN5 A;  2NRV A;  3ZSR A;  2KLA A;  3SUO A;  4DSJ A;  3QES A;  1YF5 L;  3HTV A;  1O13 A;  3OBW A;  3VA3 A;  2D0A A;  1RDD A;  4W5Q A;  4CFC A;  1GLA G;  4YOX A;  1U2V A;  2WC9 A;  2OPP A;  3DM2 A;  4FPB A;  2ZWH A;  3M8R A;  3KHY A;  3JXU A;  4KI4 A;  4DTU A;  5F0X A;  1FK9 A;  3CJ7 A;  4DS5 A;  3K9J A;  4H5T A;  4PY5 A;  5D3G A;  4C23 A;  4BC2 A;  4BQL A;  3O9Q A;  3MEG A;  3PIP L;  4WFN L;  1NK8 A;  4KFB A;  1NGB A;  3KK7 A;  1VQK N;  4CER A;  4FYD A;  3OYM A;  4IO8 A;  1HQE A;  3H3N O;  5ADX A;  4X64 K;  3NBP A;  5JLF A;  3CD6 N;  3LDP A;  4KAZ A;  3LM9 A;  1VSE A;  2E8A A;  4MLH A;  4N47 A;  1VRU A;  2Q1N A;  3PUF A;  3L3V A;  3SI6 A;  1RT4 A;  1NGG A;  2HNZ A;  1J6Z A;  4B9M A;  4DTP A;  4CZI A;  4E7H A;  4CEQ A;  1QHA A;  1XUP O;  3ZET B;  3NH2 A;  4GNI A;  4YFU A;  3QNN A;  1VQ5 N;  1L3S A;  2QXL A;  4HUE A;  2VWB A;  3QIN A;  3DAW A;  5AQP A;  4BRM A;  3VEN A;  4WQ5 C;  3C7N A;  3A2F A;  4GVE A;  3KKS A;  3AO3 A;  3S41 A;  1HNV A;  4RWT A;  3AAR A;  3M1F A;  4Y1D A;  4IXC A;  1X9S A;  3PO4 A;  3MWT A;  4KTW A;  2H3G X;  4DSF A;  5LMN K;  1WBB A;  3DRP A;  3UKU A;  4FLT A;  1U45 A;  1ZBH A;  4BRE A;  4EAH D;  1BIS A;  4LY7 A;  4Y0W A;  2XY7 A;  3RRG A;  4CF9 A;  3K57 A;  5KRS A;  3TAE A;  1YJ9 N;  3HSC A;  4JK7 A;  4FL9 A;  1HMV A;  1TGO A;  2A42 A;  3MK6 A;  2P9N A;  3HJF A;  3DLB A;  5BPM A;  4GV3 A;  5KTQ A;  4IOC L;  1RT7 A;  3I8D A;  4FO0 A;  3TSQ A;  2JWK A;  5F2R A;  3R8E A;  4EP5 A;  2VWK A;  5FRO A;  4EP4 A;  2P9S A;  2E1Y A;  1IBL K;  4A57 A;  5HRS A;  4CJ4 A;  1HJO A;  3J8A A;  2HND A;  3RSE B;  4WFA L;  4MFB A;  4YOW A;  2JLE A;  2DPN A;  5BR9 A;  3CJA A;  1ZBS A;  1QHT A;  3QBW A;  4DF8 A;  3RR8 A;  4E0D A;  2HHV A;  4DTO A;  3LDO A;  3HVR A;  5EX5 A;  4CHY A;  3MED A;  4Z4F A;  1FKP A;  3UIQ A;  3T19 A;  4WYB A;  1WSJ A;  3BF3 A;  3TSP A;  3L2U A;  3SNN A;  1JLQ A;  1SQK A;  3UB5 A;  2P9K A;  4JN4 A;  1HNX K;  1NJW A;  5AZI A;  4J2E A;  3HI0 A;  3LWL A;  4FJK A;  4J2D A;  4AIL C;  5HRN A;  4O0I A;  4CGH A;  1SZ2 A;  4O44 A;  1C1B A;  1UA0 A;  4V19 S;  1QZ5 A;  1UAX A;  1B9F A;  3A5O C;  1MWK A;  3NGI A;  5FPM A;  3ZX3 A;  4KHS A;  2LSN A;  2HBK A;  4GV6 A;  1ATR A;  1YAG A;  3R1X A;  1BCM A;  2P9P A;  3ZX0 A;  1NNE A;  2QWQ A;  5I42 A;  1SAZ A;  4UQG A;  4A61 A;  2VG5 A;  3OYE A;  4OX9 K;  4E7J A;  2HVH A;  3K2P A;  1ESV A;  1S9E A;  4H03 B;  3OYL A;  4CW7 B;  4A62 A;  2OA8 A;  2VYP A;  4KHU A;  4BR5 A;  2EX3 A;  5DMR A;  4FOE A;  4JEP A;  4Z94 A;  3TWH A;  1YVN A;  3NE6 A;  1VSH A;  1K6Y A;  1EXQ A;  1SS6 A;  3H1Q A;  2ZGY A;  3AGK A;  1UA1 A;  2HHS A;  4HCB A;  5BRF A;  4L3Q A;  3DWL A;  4ELU A;  3C6U A;  2IVO A;  3HYF A;  4ZHR A;  4LH4 A;  5DM6 L;  4JS5 A;  4B1Z A;  4W5R A;  4CIG A;  1RT2 A;  1YJW N;  2QA4 N;  2VQF K;  3FZK A;  2F4V K;  2WFB A;  4A5B A;  4BC5 A;  3ZSQ A;  2HF4 A;  1J53 A;  3QET A;  4C1N I;  4GMJ B;  4HTU A;  4I2P A;  3O9U A;  2A40 A;  2IIR A;  2AJQ A;  4H5W A;  3MAQ A;  4DV6 K;  1HYS A;  3QML A;  2D0P A;  4CJP A;  3WNE A;  3LP3 A;  1IG9 A;  3QIP A;  2Q31 A;  3AV9 A;  1BA0 A;  4CJR A;  1NJY A;  3FZL A;  1Z25 A;  2YJE A;  3SUQ A;  4CZG A;  4H4O A;  2X74 A;  2W42 A;  1VQ9 N;  5FRN A;  3HO1 A;  1RT6 A;  4F9O A;  3I56 N;  4H0P A;  1T8E A;  1T44 A;  5AQG A;  3DMJ A;  4FWL A;  4C8M A;  4CJ3 A;  1EWQ A;  2ZM6 K;  1OKJ A;  1BHL A;  3AA3 A;  2D0C A;  1JLA A;  1LAV A;  4H0O A;  4FXD A;  5AQH A;  5FPE A;  3SK3 A;  5HOO A;  2G8F A;  2QWO A;  4Z4C A;  1D4X A;  4B1X B;  4X66 K;  3O3G A;  3AVC A;  4BGB A;  4K8X A;  4B1Y B;  3DOK A;  4B9Q A;  3NFA A;  3THW A;  4BRF A;  3AVA A;  5AFU A;  3U4L A;  1RT3 A;  1RBS A;  3DLR A;  1EKE A;  4IDK A;  3SQ4 A;  1IBK K;  1NLV A;  1S6Q A;  2OZM A;  4AHU A;  3L8B A;  3VET A;  3AAP A;  5KPZ A;  4PHT X;  2FF3 B;  4FJM A;  2DTU A;  4BRK A;  1RNH A;  2G8K A;  2QM1 A;  2P9U A;  5BR8 K;  3ZT3 A;  3AVM A;  4FJL A;  3CM5 A;  4NO7 A;  1TUU A;  3UKR A;  4FWP A;  3AO1 A;  1ASU A;  3VEW A;  1HRH A;  3P39 A;  3DRS A;  3U9D A;  5J1E A;  3SPZ A;  1Q81 O;  2RKI A;  1Q8I A;  1H1V A;  3KIO A;  4JKG A;  4YY3 K;  4OLB A;  1B92 A;  1VK0 A;  1KXP A;  4IG3 A;  1N8R O;  2V52 B;  3VPZ A;  3I8B A;  3WUH A;  1NOZ A;  3IKM A;  1K8K B;  5CYM A;  1WLJ A;  3L2R A;  3MN5 A;  4KRE A;  4YDU A;  4C8O A;  1NJI O;  3V9W A;  1WSI A;  4H0X B;  4DV5 K;  4XIU A;  4CBU A;  4ICL A;  2I7N A;  4IEI A;  3ITH A;  2QWL A;  4O8U A;  4DUZ K;  1B9D A;  4CZH A;  3NVM A;  4FM2 A;  3A5L C;  3BEX A;  4AQY K;  3DLH A;  4GKJ K;  4ID1 A;  2HMI A;  4FK0 A;  3ZEU B;  4R79 A;  5KQ8 A;  1VQN N;  1RFQ A;  3K5N A;  5AQX A;  3DLK A;  4BVP A;  3KWI A;  4IFY A;  1GLL O;  1RTH A;  2HHQ A;  5LL6 Z;  2HBJ A;  2F96 A;  2HHH K;  4K25 A;  3SLC A;  2HHT A;  1XHX A;  4CZM A;  4JI1 K;  4N5S A;  2GUI A;  2O8D B;  1G99 A;  3DXK A;  1CXQ A;  1FKO A;  1L3V A;  4YOY A;  5DK5 A;  3K5L A;  1HLU A;  1S1U A;  4CJE A;  1SKW A;  3C65 A;  5LJW A;  4UY8 O;  3W0L A;  1W7A A;  1Q82 O;  1KCF A;  3LAM A;  3SQ0 A;  3QEV A;  4CJQ A;  4I6M B;  4Z4I A;  4BE2 A;  3LDL A;  3NHG A;  2BE2 A;  3HXM A;  4M7X A;  4G1Q A;  4AM6 A;  3FLC O;  3J7A P;  1OH6 A;  2W6L A;  1ASV A;  3WT0 A;  2RN2 A;  4I9L A;  4MLE A;  3QFP A;  1S9G A;  4FVU A;  2KFN A;  4CF0 A;  3CJB A;  1WSG A;  1CLQ A;  1U6Z A;  1WUA A;  4HWI A;  4CHZ A;  3D6R A;  2ASM A;  1XWL A;  4XH4 A;  5C2D A;  1RBU A;  3IRX A;  3VF2 A;  3WEE B;  1QVF M;  4ISE A;  3BZK A;  3KTQ A;  3F9K A;  4K42 A;  1FXX A;  3HM8 A;  2HMP A;  3AAQ A;  1LW0 A;  1NKC A;  3SV3 A;  2QW9 A;  5AQI A;  3CIP A;  3EL2 A;  4DTJ A;  1WAF A;  5HP1 A;  3L2V A;  3A5M C;  1TKT A;  1WBD A;  4YOV A;  5J2M A;  4JKE A;  1BCO A;  3C6T A;  3CMA N;  1S5J A;  1GLB G;  4DR5 K;  4K43 A;  5GAH P;  3E9P A;  2V51 B;  2XY5 A;  4LF6 K;  1TVR A;  4CF1 A;  4LD0 A;  4M63 C;  3V9Z A;  2PFU A;  2ZGZ A;  4CEE A;  3O5B A;  1DTT A;  3F2K A;  4IZ9 A;  3GDQ A;  3EKS A;  3D0P A;  4BDP A;  4AHS A;  4LH5 A;  4JAX A;  2ITM A;  3SJJ A;  4RW6 A;  3TI0 A;  3SV4 A;  3THV A;  2VCP A;  4DHY A;  4FZZ A;  4F3O A;  2QEX N;  4U7B A;  3MEC A;  1S72 N;  3AY9 A;  3SMS A;  4BE1 A;  2Z1J A;  3HM9 A;  3THY B;  3NF6 A;  4Z4G A;  3U6F A;  3MXJ A;  3EYZ A;  4FK4 A;  3KK2 A;  3MCA B;  1J5O A;  1NJX A;  3HK2 A;  4XH1 A;  4BWJ A;  3FZH A;  4BQZ A;  4W5T A;  1RTI A;  3NDK A;  3H45 C;  3AVN A;  5GAD P;  1IKW A;  2B4J A;  3VOV A;  3VQ8 A;  4LF8 K;  4RG8 A;  4H8K A;  1GOC A;  3MN7 A;  4CES A;  2X78 A;  3J7Z O;  1HYV A;  2UYT A;  4DQQ A;  4B1U B;  3FE1 A;  4AH9 A;  4N76 A;  3V9X A;  1C1A A;  4ISG A;  3E1Y A;  2KQ2 A;  3OW2 M;  5BRE A;  3SBG A;  3HP6 A;  3QBX A;  3IFR A;  4M3Z A;  5AJ3 K;  4DV4 K;  1JCE A;  4IWV A;  3VQ6 A;  4CZE A;  4DU3 A;  2I7P A;  3TU5 A;  1RCH A;  3OYD A;  1XQS C;  4CZF A;  4JI4 K;  2P1J A;  4BGA A;  3KJV A;  3ATV A;  2VGM A;  4O0J A;  3OVN A;  5C15 A;  1M90 O;  3ENB A;  4AHC A;  3BZC A;  2HF3 A;  1V4S A;  4CIE A;  4DR6 K;  3RSE A;  4PKI A;  4FJH A;  2RF2 A;  3G10 A;  1O1W A;  2RHK A;  4DR7 K;  4W5O A;  1RDW X;  4PWD A;  2UXD K;  3VQD A;  3NF8 A;  4KKO A;  1HYZ A;  1VQ7 N;  5BN9 A;  4FLZ A;  2O4I A;  4B9U A;  5H1S Q;  4JNE A;  4BRH A;  3I0R A;  4E7L A;  3RR7 A;  1KFS A;  4FZX C;  2FXU A;  4YOU A;  4RW9 A;  5GAG P;  1RTD A;  3CPW M;  1TK5 A;  3T1H K;  4KHW A;  3O1W A;  2D1K A;  1NGI A;  4O55 A;  3M8P A;  3IDH A;  3OYH A;  1T05 A;  3NAE A;  1JLE A;  3RVC A;  3ZSV A;  4O8K A;  3O4Q A;  3C94 A;  4NXM K;  4CIF A;  3JSM A;  3E01 A;  3T1A A;  3KK1 A;  2F8T A;  2YX6 A;  4DTR A;  4B9N A;  1U04 A;  5HL7 L;  1JCG A;  3O4W A;  3OYI A;  1NK6 A;  4NLB A;  1X3N A;  4ELT A;  4F8R A;  4PL8 A;  3CJ1 A;  3K9K A;  2DFE A;  3F5T A;  4DV1 K;  4WFB L;  3RTV A;  3WQT A;  4JKH A;  2E4L A;  3QEW A;  3HT3 A;  4CJU A;  1NGE A;  2QWR A;  1NG9 A;  3HOS A;  3VF4 A;  3VQA A;  1DGK N;  2GEL A;  5M1F A;  3L0Q A;  4FWM A;  4JI5 K;  1Y97 A;  1HKC A;  4DQS A;  1Q86 O;  3U3Y A;  4FJJ A;  3BY5 A;  4NCG A;  2A6A A;  2ZJP L;  4Q5V A;  1IV0 A;  5SWM A;  2W6K A;  5AQM A;  5GIP A;  2UUC K;  1JKH A;  2FLO A;  4BDZ A;  4DWI A;  4FW2 A;  4DU1 A;  2AA4 A;  2WOM A;  4AF1 A;  3OS2 A;  5AQJ A;  5TKY A;  4CJK A;  4HHT A;  1Q9Y A;  3D2E B;  1YT3 A;  2NZT A;  3H08 A;  4BRC A;  3VTH A;  4YHH K;  4BRQ A;  1EO1 A;  3MX5 A;  4B3T K;  3IS9 A;  1VSF A;  1D8Y A;  4IFV A;  4O4G A;  1WSE A;  3CCM N;  3SQ2 A;  1U4B A;  1WB9 A;  2G8W A;  5KPR A;  2OPS A;  3KLF A;  1LAW A;  4DR2 K;  4CZK A;  3D45 A;  3M5R A;  4IBN A;  3WXL A;  5KI6 A;  1ZBF A;  4CJV A;  2O8C A;  5EY4 A;  4JI3 K;  3EO3 A;  5KQD A;  1M1K O;  4H5V A;  1NMD A;  3AA5 X;  2P5G A;  4KHY A;  3GL1 A;  1T6D A;  3PX6 A;  4MQ3 A;  1YXQ A;  2E1Z A;  4FSV A;  4J8F A;  4KBO A;  3B6P A;  2AP1 A;  2OPR A;  1BOT O;  3O3H A;  3TPQ A;  5CYQ A;  1BWF O;  3NH0 A;  4BR4 A;  3CQX A;  3QLH A;  1TAQ A;  3TAQ A;  1KVC A;  3KD5 E;  5AQF A;  1X3M A;  1REV A;  4K41 A;  1D9F A;  4XEI A;  5BRH A;  3G6E N;  3PSI A;  3CC2 N;  2O8F B;  4YDU C;  4FOI A;  3K59 A;  2HNY A;  2DY4 A;  2IVP A;  1DKG D;  2E2P A;  2GBZ A;  1NGA A;  1KC8 O;  3VTI A;  2O8B B;  5AQR A;  4FJG A;  4DR1 K;  4C8K A;  3ZSO A;  3GG4 A;  4M42 A;  2PY5 A;  1NK7 A;  1QQM A;  5CHI A;  4LFC K;  2WBN A;  1KLM A;  4ISF A;  1RDA A;  3P5J A;  1EET A;  3KD1 E;  4Y1C A;  1L5U A;  4BRN A;  4F4K A;  5C12 A;  3MMV A;  4DTM A;  2P9I B;  3AO2 A;  5IT9 O;  2RE2 A;  4FJ5 A;  2YV0 X;  4YOR A;  4JK8 A;  3FR0 A;  2HW3 A;  2A5X A;  2YNH A;  4BR9 A;  3BUZ B;  2I5J A;  2FSK A;  1KLN A;  3MN6 A;  4CZL A;  3ZT4 A;  3CQY A;  3ZLJ A;  4OPK A;  3K58 A;  1NGH A;  3CCJ N;  1X9M A;  5C0Y A;  4JI2 K;  4B9S A;  3QER A;  1V4T A;  1K8K A;  5BPL A;  4QOZ B;  4CJL A;  1HUX A;  1W9H A;  1ATS A;  3IMX A;  3TTC A;  4E7I A;  3LP2 A;  3AVH A;  3ENH A;  2HHX A;  2JWL A;  2NRW A;  1UOC A;  4B8A B;  1P90 A;  3LPT A;  1F21 A;  2ETJ A;  1VQM N;  1X1P A;  3C6H A;  3FFK B;  1T7P A;  3AVI A;  4HVJ A;  3LDS A;  1OH7 A;  3CC7 N;  1C6V A;  5FDL A;  1I39 A;  3KZB A;  4KH4 A;  2F7T A;  4BRA A;  1HQU A;  3R3L A;  4DB3 A;  1KTQ A;  3QB0 A;  5LMU K;  3OYK A;  2IC3 A;  3ULE B;  1LOT B;  3ZEU A;  1JJ2 M;  4DR4 K;  2NRZ A;  4FWN A;  1SUQ A;  3R6M A;  5JS1 A;  3QDK A;  1GLC G;  5AQN A;  4DTN A;  3CFO A;  3L4Q A;  5CZ1 A;  4CJ5 A;  1JL1 A;  4NB4 A;  1C0F A;  1JLC A;  3ZT2 A;  1JL2 A;  1U49 A;  2YCH A;  4OGC A;  2QTD A;  1VSI A;  4I7F A;  1DEJ A;  2DFH A;  2QK9 A;  1KRP A;  3K0S A;  1IKV A;  4M45 A;  2O8D A;  2G8U A;  3MN9 A;  4LSN A;  2Q0R A;  1QQC A;  4DQP A;  4OGE A;  4CCH A;  3OBY A;  3FGU A;  3O6W A;  1XC3 A;  2NNW A;  3LZI A;  2PBD A;  3KWG A;  5F1X A;  1BDG A;  1S22 A;  2ZD1 A;  4I6M A;  3G0Z A;  3PV8 A;  3HRG A;  5BPN A;  2E2O A;  4CEF A;  3VEO A;  2PAV A;  4N56 A;  1T6C A;  4KPY A;  2NLX A;  1NK4 A;  1NKE A;  4I2Q A;  1Q18 A;  1W97 L;  1X9J A;  1TL1 A;  3MX2 A;  3BP8 A;  3CFP A;  1LW2 A;  3S3O A;  1NBW A;  5C24 A;  2BGG A;  1BL3 A;  4FLU A;  3VQ5 A;  2CH6 A;  4LF5 K;  4NYF A;  3OS1 A;  2Y1J A;  3KKR A;  4KV8 A;  4LC9 B;  3WEE A;  3VQ9 A;  4JI8 K;  3QEP A;  4ILH A;  3LAL A;  2IAJ A;  1J54 A;  2P51 A;  1LWE A;  2P9L B;  1YIT N;  4LFA K;  1TYQ B;  4C8N A;  4A59 A;  3H3O B;  2D5R A;  1BQN A;  3MEE A;  4FW1 A;  1RBR A;  3VQ4 A;  1BGX T;  4IDH A;  4KB1 A;  3MCP A;  2BUP A;  1NGC A;  2GEM A;  3NF9 A;  3OYG A;  4CJ7 A;  3B8A X;  5E41 A;  3FZF A;  3MWP A;  3F73 A;  2OTJ N;  1Q9X A;  1W0H A;  5J2Q A;  2QKK A;  3J80 O;  1C0G A;  1E3M A;  1IKY A;  3CF5 L;  1EX4 A;  2G8I A;  3LAK A;  3QNO A;  4AHV A;  3JAM O;  4JLH A;  4CVN E;  4RTF D;  2YNG A;  4FJ8 A;  1WSF A;  3CCE N;  2VGN A;  5AR0 A;  3Q7C A;  5JMV A;  4CJT A;  3THY A;  5E26 A;  3VQE A;  4DLG A;  2G8V A;  2UUA K;  2ZJR L;  3W3D A;  4WF9 L;  1ILY A;  2CGK A;  4JHD B;  1VSK A;  4CGI A;  4OO1 J;  2HHW A;  4FM1 A;  4H0V B;  3VEX A;  4Q0B A;  3OYC A;  1MWM A;  3I55 N;  1S1V A;  3NF7 A;  1A5V A;  5C10 A;  2OPQ A;  5I3U A;  1TKD A;  4LF4 K;  1NK9 A;  4CED A;  3PSF A;  2BH1 A;  1KD1 O;  1J9A A;  3DXM B;  1SKS A;  4DQI A;  3SAG A;  3VGK A;  3PX4 A;  4HCC A;  1GLJ O;  2W40 A;  2KZM A;  5C2F A;  3KLI A;  1NOY A;  1TUY A;  4A2A A;  3O8M A;  4CBW A;  4FWR A;  4ELV A;  4NXN K;  4LF7 K;  4QS8 A;  3G4S N;  4M3U A;  4NYN A;  3GE1 A;  4GY2 B;  3GOI A;  3S3N A;  1VQL N;  3AVJ A;  5AQZ A;  2VG6 A;  3V1Q A;  4PL7 A;  1C0T A;  2ZE2 A;  4JI0 K;  3CFR A;  5TKW A;  3AVK A;  4F2S A;  5BN8 A;  4F2R A;  3Q7B A;  3L4I A;  1XNR K;  5IWA K;  2BAN A;  1NM1 A;  5SZT A;  4BRO A;  2Q36 A;  2Q2R A;  3KLG A;  1ATN A;  2BTF A;  3P1G A;  4PKH A;  3HPO A;  3VGL A;  2KTQ A;  2G8H A;  2EHG A;  2E2Q A;  3I33 A;  4NCA A;  1XMQ K;  1J5E K;  1UWB A;  1LCU A;  5ADX H;  2PYL A;  1QSL A;  1WAJ A;  2P9U B;  4CFA A;  4B3R K;  4CHP A;  3EY1 A;  1X9W A;  2FBV A;  1WN7 A;  2V7Y A;  2IS3 A;  1MU2 A;  1U47 A;  4CFB A;  1TAU A;  4N41 A;  1BI4 B;  4R5P A;  4GKK K;  4MO5 A;  2F9W A;  4IJA A;  4JKG B;  1XMO K;  1HJR A;  3DOL A;  4KTZ A;  3CJ9 A;  1VAZ A;  3HL8 A;  1IJJ A;  4LFB K;  4E3S A;  4M3Y A;  4KH6 A;  3AVB A;  3WXM B;  3EE8 A;  3TAG A;  2KZZ A;  4JRQ A;  2OYQ A;  4CD1 A;  5JLH A;  1DT9 A;  1L3T A;  1BUP A;  3ZET A;  4Z4H A;  5EU7 A;  1N6Q A;  3TAM A;  1NKB A;  4FJ7 A;  4L8R B;  5FPD A;  4H4M A;  3EEQ A;  1MDU B;  2A1R A;  1ZC6 A;  4KH5 A;  4DSK A;  3J7Y P;  5AQS A;  3O3F A;  1S1W A;  3LWM A;  4E7K A;  1IG8 A;  3VEY A;  2B5J A;  3H1V X;  4OKE A;  3VQ7 A;  3VEV A;  3VGM A;  4DKW A;  2CGL A;  1KVA A;  1YTA A;  2XO7 A;  3K5M A;  1IBM K;  4CZJ A;  1RT1 A;  1BU6 O;  3LL3 A;  4EFH A;  1TKZ A;  4QAG A;  2OTL N;  3LDQ A;  1QVG M;  4KB0 A;  3ZSY A;  1ITG A;  2YKN A;  1IO2 A;  2WUS A;  3E9L A;  3PIO L;  1QTM A;  3V9S A;  4DU4 A;  1GLE G;  2NUB A;  4B1W B;  2E5L K;  1JLB A;  1YTU A;  1RDC A;  1RTJ A;  2W41 A;  4G9Z A;  3V6D A;  3CCR N;  1DLO A;  4FLY A;  4C8L A;  2O8E B;  1RDU A;  3D2E A;  5AZJ B;  4M7Y A;  5EXW A;  3U8X A;  2ATQ A;  2X6N A;  3AVG A;  3QIO A;  4BAC A;  2FC0 A;  3HBT A;  1SKR A;  3MXI A;  3A0I X;  3L6Q A;  4KRF A;  4CEO A;  1NJZ A;  4KHP K;  3M6G A;  3VER A;  4CEB A;  3CYM A;  1JLF A;  3ZX2 A;  3TAF A;  3O1B A;  1RDB A;  3P31 A;  2YI1 A;  2UXC K;  4B3M K;  2ZJQ L;  4JD2 B;  3DJC A;  4OJR A;  2A3Z A;  3SCX A;  2QWP A;  3LAN A;  3WNH A;  3CM6 A;  4IJN A;  4E89 A;  1E4F T;  2NRX A;  3OYA A;  3OYN A;  1RGI A;  4TSX A;  3LPU A;  3NMU A;  1DTQ A;  5GIO A;  3SJH A;  1YHQ N;  3WQU A;  3LP0 A;  2PZS A;  3O4N A;  4IOX A;  4DS4 A;  4ID5 A;  2D4W A;  1NMN A;  1S1T A;  1XNQ K;  2IGI A;  2GWK A;  3G25 A;  1HR0 K;  4H0T B;  3QEI A;  3J81 O;  3EE9 A;  3V1O A;  3VQB A;  4CI6 A;  1SL0 A;  2KFZ A;  2O8F A;  3OHR A;  4PUO A;  5FRM A;  4O5F A;  4GV9 A;  5JVH L;  2RPI A;  3SAF A;  4DF4 A;  4DG1 A;  3RMC A;  4M3R A;  2O8B A;  3BF1 A;  3FZM A;  3L2Q A;  4BVO A;  2Z1G A;  3QFU A;  1ZBL A;  2A41 A;  3EN9 A;  1SL1 A;  3PY8 A;  5AQT A;  2VWJ A;  3CHW A;  4DSL A;  3IAY A;  1CZA N;  3OYJ A;  4CK2 A;  5BRD A;  4CGF A;  3SZ2 A;  3RWU A;  3DLL L;  3CI5 A;  2ITG A;  4DV3 K;  3PLA A;  2F9T A;  3ZT0 A;  4CEC A;  4B1V A;  3CET A;  4M3W A;  4OKK A;  5JIC A;  4DFK A;  2P9I A;  4IFE A;  4KO0 A;  3MDQ A;  4ZTJ A;  1BIU A;  1S1X A;  4MDA A;  2YHA A;  4JKB A;  3ZCM A;  3VQQ A;  3ID6 A;  4FCY A;  3THX B;  1VSM A;  4BRD A;  5FPN A;  1KQS M;  3PO5 A;  1CZ9 A;  3TTF A;  3CCS N;  4BRG A;  1N33 K;  4K0K K;  4FLW A;  4E1J A;  5AQV A;  1ZXO A;  1Q7Y O;  3IUC A;  2EWS A;  4X65 K;  1IH7 A;  3O9S A;  5DM7 L;  2WON A;  2B6A A;  3WXJ A;  1G15 A;  5FLX O;  3HP9 A;  4JYA K;  2FBX A;  4DQ8 A;  4O5B A;  4RW8 A;  3WXK A;  1WNS A;  3OA9 A;  3A8Y A;  3P83 D;  4X62 K;  1T03 A;  4JKD A;  1TK0 A;  4OPA A;  2BDP A;  1BA1 A;  3CC4 N;  5KGW A;  1RBV A;  5KRT A;  4CGG A;  2YNF A;  3CCQ N;  5AQY A;  4DQR A;  3C0B A;  3D2F B;  3UE5 A;  1N34 K;  4KTQ A;  1ZBU A;  1VQP N;  4HUF A;  4KHN A;  3CPE A;  3HPH A;  1Y64 A;  3DRR A;  3ULE A;  3OJU A;  4WE1 A;  4M3X A;  1EWR A;  2DFF A;  1RT5 A;  4PA1 A;  2V7Z A;  2YHY A;  1IKX A;  3TAR A;  4EIA A;  3TSU A;  4B08 A;  3M8Q A;  3AO4 A;  4B9L A;  4OLA A;  4CFD A;  1TV6 A;  4GVM A;  3EZ5 A;  4Z4E A;  1S6P A;  3H46 O;  1U2V B;  4FPA A;  2FBY A;  3TR8 A;  1A5X A;  4A5A A;  4CK1 A;  1OH8 A;  5AQL A;  4E1M A;  1E4G T;  5AQQ A;  3VES A;  4WQ4 A;  4BWM A;  1I3A A;  1XI1 A;  3I0S A;  4B3S K;  3CME N;  4KHQ A;  3SBT A;  2GWJ A;  3C6A A;  4H0Y B;  3DLE A;  3RRH A;  3HZ6 A;  5AFU H;  1TL3 A;  1KAY A;  1NWK A;  2IVN A;  3VF6 A;  2XY8 A;  3DYA A;  3M8S A;  4EHT A;  3IG1 A;  2YKM A;  4BRP A;  1R0A A;  4IOA L;  4B9V A;  4BDY A;  2GTD A;  3EZW A;  3KK3 A;  1N32 K;  3JYT A;  3AVF A;  2KW4 A;  5GAE P;  4OKJ A;  2HVI A;  4DTS A;  4FWS A;  3HOT A;  4AHR A;  3LZJ A;  2Z1I A;  4BY9 C;  4F3T A;  4CD3 A;  3OS0 A;  2P5O A;  1QSS A;  4HUG A;  2HBL A;  1NGF A;  1NK0 A;  1VQ8 N;  4DMN A;  4DV0 K;  3C7N B;  2P9L A;  2YNI A;  3QIC A;  1TYQ A;  3ALY A;  3KLH A;  1CZB A;  2XRI A;  2ASP A;  4MDB A;  1KFD A;  4QS7 A;  1KAX A;  4ILG B;  1YIJ N;  1GOA A;  2IOC A;  1Z05 A;  5GIN A;  3AA2 A;  4JKF A;  3UKU B;  2D0B A;  2HOE A;  3VQC A;  1HKG A;  5KPT A;  3AA4 A;  4CHN A;  3M3Z A;  4B3O A;  4CBX A;  2YHW A;  2FSJ A;  5AQW A;  4JRP A;  4FJX A;  5K14 A;  4J2A A;  4DTX A;  3B6O A;  1OVY A;  3AGR A;  4JKC A;  2P9N B;  3VEZ A;  3TAB A;  3CCV N;  3OY9 A;  1XC9 A;  4J2B A;  2UUB K;  4E1N A;  4DFM A;  3KVG A;  5C25 A;  3VMF B;  4FM0 A;  1KVB A;  3ATU A;  4JKA A;  3CG7 A;  3U9Z A;  5M1K A;  2XY6 A;  2P9S B;  2NRT A;  1S3X A;  4JHD A;  4PKG A;  4FZY A;  3NCI A;  4PQU A;  5HBM A;  2O8C B;  3T1Y K;  1A5W A;  1VSJ A;  3TTD A;  2QWM A;  4YOT A;  1FW6 A;  1K73 O;  1HPM A;  2Q3S A;  3LP1 A;  4AHT A;  3NVK A;  4WQ5 A;  3NGZ A;  1LWF A;  3ZSW A;  1ZBI A;  3CCU N;  4DSE A;  3DXM A;  2XHB A;  5LJV A;  1QE1 A;  4ZTF A;  2FSN A;  2J4R A;  4LSL A;  4CHQ A;  1QZ6 A;  4U67 L;  3ID8 A;  2Z1H A;  3V4I A;  3JS6 A;  1CXU A;  3L2W A;  3ENO A;  5AQK A;  2P9K B;  3OTO K;  4BR7 A;  1TKX A;  4BRL A;  4RCH A;  3TAN A;  5AZI B;  3ZT1 A;  3G71 N;  1K8A O;  4YNQ A;  4DFP A;  5J2P A;  2Q0U A;  3HVT A;  3T7Z A;  1YJN N;  5M1P A;  2QKB A;  1Z26 A;  5M1Q A;  1I94 K;  1BO5 O;  3P4I A;  1NGJ A;  4CJF A;  2ZF5 O;  1HPZ A;  4IEE A;  3SMP A;  4C1N K;  1YI2 N;  1VHX A;  2NRR A;  4NLC A;  1BIZ A;  1C0M A;  3F9M A;  2P9P B;  5CR4 A;  3SAH A;  2R7Y A;  1VQ6 N;  5CY4 A;  1QSY A;  3E9O A;  5M1O A;  1P8Z A;  2Y1I A;  3ZYY X;  4ILJ A;  1JCF A;  4MO4 A;  4AM7 A;  5I9E B;  5HRP A;  4BG9 A;  1D5A A;  2YHX A;  4JS4 A;  3A5N C;  1OH5 A;  3QEX A;  3EKU A;  4I9Q A;  4CGD A;  2HST A;  3HPG A;  1BI4 A;  4EZ6 A;  2E20 A;  4BR2 A;  3KLE A;  2O4G A;  2YHB A;  3ZSX A;  3SYZ A;  4FJ9 A;  1YVU A;  2JGU A;  3ASM A;  4EHU A;  3DLG A;  5JVG L;  3SUN A;  4DR3 K;  4RW7 A;  1WSH A;  1BQM A;  1ASW A;  1HX1 A;  3N4Q A;  4FVM A;  4JI7 K;  3T69 A;  2E6L A;  5AQU A;  1GLF O;  2E6M A;  1TK8 A;  5A2Q O;  1HNI A;  4JK9 A;  4OVL A;  2ASO A;  1XHZ A;  4DSI A;  1N36 K;  4CE9 A;  3SUP A;  2FF6 A;  4DV2 K;  1HNZ K;  4K8Z A;  4CJS A;  2OZS A;  3QO9 A;  4CEZ A;  1VQO N;  4BC3 A;  3GBT A;  4WCE L;  3RMB A;  2X6S A;  3WNG A;  1D9D A;  3NGY A;  4DCH A;  3WNF A;  4CK3 A; 
#chains in the Genus database with same CATH homology
 4B8C A;  2NUB A;  3H08 A;  5CZ2 A;  1YTU A;  1JLB A;  1RDC A;  4CJW A;  1RTJ A;  3L3U A;  3ZSQ A;  4IG0 A;  1J53 A;  3QET A;  3V6D A;  4B9T A;  1DLO A;  4FLY A;  4C8L A;  4GMJ B;  4HTU A;  3IS9 A;  1VSF A;  1VSD A;  4I2P A;  3FFI A;  3RMA A;  1D8Y A;  4IFV A;  4O4G A;  1WSE A;  2AJQ A;  1C1C A;  2ATQ A;  3SQ2 A;  1U4B A;  3MAQ A;  2X6N A;  1JXE A;  3AVG A;  3QIO A;  4BAC A;  1HYS A;  2FC0 A;  4CJP A;  3WNE A;  3LP3 A;  4GW6 A;  2G8W A;  2IDO A;  1IG9 A;  1SKR A;  2OPS A;  3HST B;  3MXI A;  3KLF A;  3QIP A;  1LAW A;  4ELU A;  2QXF A;  3AV9 A;  4CF8 A;  3DI6 A;  4CJR A;  1NJY A;  4IKF A;  3D45 A;  4IBN A;  5KI6 A;  1Z25 A;  3SUQ A;  1ZBF A;  4CEO A;  4CJV A;  1NJZ A;  2A1S A;  2X74 A;  4H4O A;  2W42 A;  5FRN A;  4KRF A;  2P5G A;  4KHY A;  3HO1 A;  4KI6 A;  1RIL A;  1RT6 A;  3AA5 X;  4M3T A;  3T3F A;  4CEB A;  3CYM A;  4MQ3 A;  3PX6 A;  1JLF A;  1T8E A;  3TAF A;  1RDB A;  5KGX A;  3DMJ A;  4C8M A;  4CJ3 A;  3SPY A;  3K5O A;  3B6P A;  1BHL A;  4OJR A;  3SCX A;  5HLF A;  2OPR A;  1EP4 A;  4RW4 A;  3O3H A;  3AA3 A;  2D0C A;  1JLA A;  3ISN C;  5CYQ A;  3LAN A;  1LAV A;  3WNH A;  3CM6 A;  4M41 A;  3TAP A;  4FXD A;  4E89 A;  3NH0 A;  3OYA A;  3OYN A;  3QLH A;  1TAQ A;  3TAQ A;  3OJS A;  1KVC A;  4TSX A;  5HRR A;  4Z4C A;  3LPU A;  5J2N A;  2G8F A;  3KD5 E;  2FBT A;  1ZYQ A;  1DTQ A;  3O3G A;  3AVC A;  1REV A;  1SV5 A;  1D9F A;  4K8X A;  3LP0 A;  2PZS A;  3DOK A;  3K59 A;  3NFA A;  4FLX A;  2HNY A;  3O4N A;  5HRO A;  4DS4 A;  1NK5 A;  4ID5 A;  5JS2 A;  3AVA A;  4OPJ A;  2DY4 A;  1RT3 A;  2GBZ A;  1VRT A;  1RBS A;  2GV9 A;  1EKE A;  3DLR A;  4IDK A;  3BDP A;  3SQ4 A;  2OZM A;  1S6Q A;  4AHU A;  4BE0 A;  1S1T A;  2IGI A;  3L8B A;  4FJG A;  4C8K A;  3ZSO A;  3QEI A;  4FK2 A;  3VQB A;  3V1O A;  1SL0 A;  2KFZ A;  4M42 A;  2PY5 A;  1NK7 A;  4FJM A;  4PUO A;  5FRM A;  2DTU A;  1RNH A;  2RPI A;  2G8K A;  4NCB A;  4DF4 A;  4DG1 A;  3RMC A;  4M3R A;  1KLM A;  3AVL A;  4CHO A;  1RDA A;  3ZT3 A;  3AVM A;  1EET A;  3P5J A;  3L2Q A;  3CM5 A;  4FJL A;  2Z1G A;  3KD1 E;  4Y1C A;  1L5U A;  1JLG A;  4F4K A;  1ZBL A;  3AO1 A;  1ASU A;  1SL1 A;  1SL2 A;  4E19 A;  3ULD A;  3PY8 A;  2VWJ A;  3C95 A;  4DSL A;  4DTM A;  4CEA A;  1L3U A;  3IAY A;  1HRH A;  5C42 A;  3AO2 A;  3OYJ A;  4CK2 A;  3DRS A;  5J1E A;  4CGF A;  3SZ2 A;  3SPZ A;  4FLV A;  2RKI A;  1Q8I A;  3KIO A;  2YV0 X;  3RWU A;  4FJ5 A;  2ITG A;  4OLB A;  1N5Y A;  3NH1 A;  1B92 A;  3U3G A;  3VA0 A;  2YNH A;  3ZT0 A;  1VK0 A;  4IG3 A;  4CEC A;  2I5J A;  2F8S A;  2HW3 A;  1KLN A;  4M3W A;  3S3M A;  4OKK A;  3ZT4 A;  4DFK A;  1NOZ A;  5CYM A;  1LV5 A;  1JXB A;  1WLJ A;  4KO0 A;  4OPK A;  3L2R A;  3K58 A;  4ZTJ A;  2PYJ A;  1BIU A;  1S1X A;  2YHA A;  4KRE A;  2HB5 A;  3ZCM A;  3ZSZ A;  4C8O A;  1X9M A;  3V9W A;  4DFJ A;  4B9S A;  3QER A;  1WSI A;  3VQQ A;  4FCY A;  4XIU A;  1VSM A;  1QS4 A;  4EZ9 A;  4QOZ B;  4ICL A;  3VQP A;  4CJL A;  1W9H A;  4E7I A;  3LP2 A;  1CZ9 A;  3PO5 A;  3S9H A;  3AVH A;  3ITH A;  4FLW A;  5T7B A;  2HHX A;  1B9D A;  4FM2 A;  1IH7 A;  1VSL A;  2VG7 A;  1UOC A;  4B8A B;  3LPT A;  4CF2 A;  1F21 A;  4DLE A;  2ETJ A;  2B6A A;  2WON A;  1X1P A;  3DLH A;  1G15 A;  4ID1 A;  3OYF A;  1LWC A;  1T7P A;  2HMI A;  3HP9 A;  4FK0 A;  1C0U A;  3AVI A;  4HVJ A;  3LDS A;  1C6V A;  5FDL A;  2FBX A;  3V81 A;  4O5B A;  4RW8 A;  1I39 A;  3K5N A;  1WNS A;  1U48 A;  3BGR A;  3DLK A;  1HQU A;  4IFY A;  3P83 D;  1KTQ A;  1T03 A;  3CQ8 A;  3OYK A;  1RTH A;  2HHQ A;  2IC3 A;  3RMD A;  1TK0 A;  1RBT A;  2BDP A;  4W5N A;  5KGW A;  3WNF A;  1RBV A;  2F96 A;  3AO5 A;  5KRT A;  4CGG A;  2YNF A;  4QCL A;  4DQR A;  1SUQ A;  4KTQ A;  2ZQB A;  2HHT A;  1XHX A;  1GOB A;  5JS1 A;  1ZBU A;  4HUF A;  4DTN A;  3CFO A;  5CZ1 A;  4CJ5 A;  4KHN A;  4FJI A;  1JL1 A;  4N5S A;  3HPH A;  3DRR A;  1JLC A;  2GUI A;  3ZT2 A;  3OJU A;  1JL2 A;  4WE1 A;  4M3X A;  2DFF A;  1U49 A;  4Z0U A;  2OYQ A;  4OGC A;  1CXQ A;  1RT5 A;  4PA1 A;  1VSI A;  4I7F A;  4FJN A;  1FKO A;  4CGJ A;  2DFH A;  1L3V A;  2QK9 A;  1KRP A;  1IKX A;  3TAR A;  5DK5 A;  3K5L A;  1S1U A;  3OYB A;  3V1R A;  4CJE A;  4B08 A;  1IKV A;  3M8Q A;  3AO4 A;  3MXM A;  1SKW A;  4B9L A;  2HHU A;  4M45 A;  4OLA A;  1KSP A;  3V9U A;  4CFD A;  1TV6 A;  4GVM A;  3EZ5 A;  3PX0 A;  2G8U A;  3SQ1 A;  1KCF A;  1S6P A;  3LAM A;  3VN5 A;  3SQ0 A;  4Z4E A;  3QEV A;  4LSN A;  3ZSR A;  4CJQ A;  4Z4I A;  3SUO A;  1QQC A;  4BE2 A;  3QES A;  4DQP A;  4DSJ A;  4OGE A;  2FBY A;  3TR8 A;  4CCH A;  3NHG A;  2BE2 A;  1A5X A;  4CK1 A;  4E1M A;  3VA3 A;  3HXM A;  2D0A A;  1RDD A;  4G1Q A;  4BWM A;  4W5Q A;  4CFC A;  1I3A A;  3LZI A;  1XI1 A;  3I0S A;  2ZD1 A;  2OPP A;  3DM2 A;  3G0Z A;  1ASV A;  3M8R A;  2RN2 A;  4KHQ A;  3PV8 A;  4KI4 A;  4I9L A;  4DTU A;  1FK9 A;  1S9G A;  4DS5 A;  2KFN A;  3DLE A;  4PY5 A;  4CEF A;  4CF0 A;  3RRH A;  1WSG A;  1CLQ A;  5D3G A;  1TL3 A;  4N56 A;  4CHZ A;  4KPY A;  1NK4 A;  3MEG A;  1NKE A;  2XY8 A;  4I2Q A;  1XWL A;  1TL1 A;  3DYA A;  3M8S A;  3CFP A;  1NK8 A;  1LW2 A;  4KFB A;  1RBU A;  3IG1 A;  2YKM A;  3IRX A;  3S3O A;  4CER A;  4FYD A;  3OYM A;  1HQE A;  1R0A A;  4B9V A;  4BDY A;  3KTQ A;  5C24 A;  2BGG A;  1BL3 A;  3F9K A;  1FXX A;  3NBP A;  4FLU A;  3VQ5 A;  3KK3 A;  1LW0 A;  4NYF A;  3OS1 A;  2Y1J A;  1NKC A;  3JYT A;  3SV3 A;  3AVF A;  2KW4 A;  3KKR A;  4KV8 A;  3VQ9 A;  4DTJ A;  3QEP A;  4KAZ A;  4OKJ A;  2HVI A;  1VSE A;  4DTS A;  1WAF A;  5HP1 A;  3L2V A;  4N47 A;  1VRU A;  3LAL A;  3PUF A;  2IAJ A;  1J54 A;  1TKT A;  2P51 A;  3L3V A;  4AHR A;  3SI6 A;  1RT4 A;  1LWE A;  2HNZ A;  3LZJ A;  2Z1I A;  5J2M A;  1BCO A;  3C6T A;  4B9M A;  4F3T A;  1S5J A;  3OS0 A;  4C8N A;  4DTP A;  4E7H A;  4CEQ A;  2D5R A;  2P5O A;  2XY5 A;  1BQN A;  1QSS A;  4HUG A;  1TVR A;  4CF1 A;  4LD0 A;  3NH2 A;  3MEE A;  3V9Z A;  4FW1 A;  1RBR A;  3VQ4 A;  4YFU A;  1NK0 A;  4DMN A;  4CEE A;  1DTT A;  1BGX T;  3QNN A;  4KB1 A;  1L3S A;  2YNI A;  4HUE A;  3ALY A;  3KLH A;  1CZB A;  3D0P A;  4BDP A;  2XRI A;  4AHS A;  3QIN A;  4LH5 A;  1KFD A;  3NF9 A;  3OYG A;  3SJJ A;  4RW6 A;  5E41 A;  1GOA A;  3TI0 A;  3SV4 A;  2IOC A;  3THV A;  3A2F A;  3F73 A;  3KKS A;  1Q9X A;  3AA2 A;  3AO3 A;  1W0H A;  1HNV A;  4FZZ A;  5J2Q A;  2QKK A;  4F3O A;  1IKY A;  2D0B A;  1EX4 A;  3MEC A;  4Y1D A;  2G8I A;  3LAK A;  1X9S A;  3QNO A;  3PO4 A;  4BE1 A;  2Z1J A;  3HM9 A;  3VQC A;  4AHV A;  4JLH A;  3NF6 A;  4KTW A;  4Z4G A;  4DSF A;  3U6F A;  3AA4 A;  2YNG A;  3MXJ A;  4CHN A;  3EYZ A;  4FK4 A;  3KK2 A;  4FJ8 A;  3DRP A;  4B3O A;  1WSF A;  1J5O A;  4JRP A;  4FJX A;  4FLT A;  1U45 A;  5K14 A;  1NJX A;  3HK2 A;  4BWJ A;  1ZBH A;  4J2A A;  4DTX A;  3B6O A;  4CJT A;  4W5T A;  1BIS A;  1RTI A;  4LY7 A;  2XY7 A;  3RRG A;  3VQE A;  3NDK A;  4DLG A;  2G8V A;  4CF9 A;  3AVN A;  3K57 A;  3TAB A;  1IKW A;  2B4J A;  3VQ8 A;  5KRS A;  4RG8 A;  4CGI A;  1VSK A;  1GOC A;  4H8K A;  3TAE A;  3OY9 A;  1XC9 A;  4CES A;  4J2B A;  4FM1 A;  2HHW A;  2X78 A;  4E1N A;  4DFM A;  1HYV A;  1HMV A;  1TGO A;  5C25 A;  4FM0 A;  4DQQ A;  1KVB A;  4Q0B A;  3OYC A;  4AH9 A;  3HJF A;  1S1V A;  3CG7 A;  1A5V A;  3NF7 A;  3DLB A;  4N76 A;  2OPQ A;  3V9X A;  1C1A A;  5I3U A;  2XY6 A;  1TKD A;  1NK9 A;  4CED A;  5KTQ A;  4FZY A;  3NCI A;  1RT7 A;  2KQ2 A;  5HBM A;  4PQU A;  3I8D A;  1J9A A;  1SKS A;  3HP6 A;  4DQI A;  1A5W A;  3PX4 A;  4EP5 A;  4HCC A;  1VSJ A;  2VWK A;  5FRO A;  2KZM A;  2Q3S A;  3LP1 A;  4M3Z A;  3KLI A;  1NOY A;  4AHT A;  3VQ6 A;  4EP4 A;  3NGZ A;  1LWF A;  3ZSW A;  4DU3 A;  1ZBI A;  5HRS A;  4DSE A;  4CJ4 A;  2XHB A;  1RCH A;  1QE1 A;  2HND A;  3OYD A;  4ZTF A;  4ELV A;  2P1J A;  4MFB A;  4LSL A;  4M3U A;  2JLE A;  3KJV A;  4O0J A;  3OVN A;  4NYN A;  4CHQ A;  4AHC A;  4DF8 A;  1QHT A;  3S3N A;  3RR8 A;  3AVJ A;  4E0D A;  2HHV A;  2VG6 A;  3V1Q A;  4DTO A;  3HVR A;  4CIE A;  1C0T A;  2Z1H A;  4CHY A;  2ZE2 A;  1CXU A;  3MED A;  3L2W A;  3V4I A;  4Z4F A;  4FJH A;  2RF2 A;  1FKP A;  3G10 A;  1O1W A;  1TKX A;  3CFR A;  3UIQ A;  3AVK A;  4F2S A;  4F2R A;  3TAN A;  3T19 A;  3ZT1 A;  1WSJ A;  2BAN A;  4W5O A;  5SZT A;  4YNQ A;  4DFP A;  4PWD A;  3L2U A;  3SNN A;  1JLQ A;  5J2P A;  3KLG A;  3HVT A;  3P1G A;  3VQD A;  3NF8 A;  4KKO A;  1HYZ A;  3HPO A;  2QKB A;  1Z26 A;  2KTQ A;  2G8H A;  1NJW A;  2EHG A;  4J2E A;  4NCA A;  2O4I A;  4CJF A;  4FLZ A;  3LWL A;  1HPZ A;  4B9U A;  4FJK A;  1UWB A;  2PYL A;  3I0R A;  4E7L A;  1QSL A;  4J2D A;  4AIL C;  1WAJ A;  3RR7 A;  4CFA A;  5HRN A;  4O0I A;  1KFS A;  4FZX C;  4CHP A;  4RW9 A;  4CGH A;  3EY1 A;  1X9W A;  1RTD A;  1TK5 A;  2FBV A;  4O44 A;  1C1B A;  1WN7 A;  4KHW A;  1UA0 A;  2IS3 A;  1MU2 A;  1U47 A;  1BIZ A;  1C0M A;  1UAX A;  4CFB A;  1B9F A;  1TAU A;  3NGI A;  2R7Y A;  4O55 A;  3M8P A;  5CY4 A;  1QSY A;  4N41 A;  3OYH A;  1T05 A;  1BI4 B;  4R5P A;  3NAE A;  1JLE A;  4KHS A;  2Y1I A;  2LSN A;  3ZSV A;  3O4Q A;  5HRP A;  1HJR A;  3DOL A;  4KTZ A;  3C94 A;  4CIF A;  1BCM A;  3JSM A;  3E01 A;  1D5A A;  3HL8 A;  3T1A A;  3KK1 A;  2F8T A;  4JS4 A;  4E3S A;  4M3Y A;  3QEX A;  4DTR A;  4B9N A;  1U04 A;  4CGD A;  3AVB A;  3HPG A;  4I9Q A;  1BI4 A;  5I42 A;  4EZ6 A;  4UQG A;  3TAG A;  2KZZ A;  4JRQ A;  2VG5 A;  3OYE A;  3OYI A;  2O4G A;  2YHB A;  3KLE A;  3ZSX A;  4E7J A;  1NK6 A;  1L3T A;  4ELT A;  4F8R A;  4Z4H A;  2DFE A;  3SYZ A;  1YVU A;  2JGU A;  3ASM A;  4FJ9 A;  3DLG A;  2HVH A;  5EU7 A;  3RTV A;  3SUN A;  1N6Q A;  2E4L A;  3TAM A;  1NKB A;  4FJ7 A;  4L8R B;  3QEW A;  3HT3 A;  3K2P A;  1S9E A;  4RW7 A;  4H4M A;  4CJU A;  1WSH A;  3OYL A;  1BQM A;  1ASW A;  2A1R A;  2OA8 A;  4FVM A;  4DSK A;  4KHU A;  3VQA A;  2EX3 A;  1S1W A;  5DMR A;  3O3F A;  3LWM A;  4E7K A;  3TWH A;  2E6L A;  2E6M A;  1TK8 A;  1Y97 A;  2B5J A;  1HNI A;  3NE6 A;  1VSH A;  4OKE A;  1K6Y A;  3VQ7 A;  4DQS A;  1EXQ A;  4OVL A;  3U3Y A;  1D9D A;  4FJJ A;  4NCG A;  4Q5V A;  1XHZ A;  5SWM A;  4DSI A;  1KVA A;  1YTA A;  2XO7 A;  3K5M A;  4CE9 A;  1UA1 A;  2HHS A;  3SUP A;  4HCB A;  4K8Z A;  1JKH A;  4BDZ A;  1RT1 A;  4CJS A;  3C6U A;  2OZS A;  1TKZ A;  3QO9 A;  4QAG A;  4CEZ A;  3HYF A;  4FW2 A;  4ZHR A;  4DWI A;  4LH4 A;  4KB0 A;  3ZSY A;  4DU1 A;  1ITG A;  2YKN A;  1IO2 A;  2WOM A;  4JS5 A;  1QTM A;  4W5R A;  3OS2 A;  3V9S A;  4DU4 A;  2X6S A;  1RT2 A;  3WNG A;  3NGY A;  4CIG A;  4CJK A;  4HHT A;  3RMB A;  1Q9Y A;  1YT3 A;  4CK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...