4JI0K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji0K00
4JI3K 3J7AP 2UU9K 4JI6K 4LF6K 4DR6K 5A2QO 4X66K 2F4VK 3J7YP 1I94K 1N33K 4JI8K 4GKKK 4DUYK 4AQYK 3T1HK 3J81O 4OX9K 1HNXK 2UUAK 4V19S 4DV0K 4LF8K 4LF4K 1N34K 1N36K 4YY3K 4GKJK 5LMUK 1XMQK 4DR5K 4X65K 5BR8K 1HNZK 4DV2K 1XNRK 1HNWK 4DR7K 4NXMK 3T1YK 4LF5K 4LFBK 3JAMO 4DV7K 4JI2K 2UXCK 4DR1K 1XMOK 4X64K 4JV5K 5IWAK 4LF9K 5LL6Z 2ZM6K 5IT9O 1IBMK 1IBKK 4DV5K 4DV1K 2VQFK 4LFAK 4DR3K 4CVNE 1J5EK 1FJGK 4JI1K 5LMNK 3OTOK 4JI4K 1XNQK 4LF7K 1HR0K 2E5LK 4X62K 4B3MK 4JI0K 4DR4K 4KHPK 2UUBK 4DV3K 4JI7K 3J80O 4K0KK 4LFCK 4B3RK 2HHHK 1IBLK 1N32K 2VQEK 4JYAK 4JI5K 4DUZK 4DR2K 2UUCK 4DV4K 4DV6K 5FLXO 4B3SK 4B3TK 5AJ3K 2UXDK 4NXNK 2UXBK 4YHHK 4CW7B
chains in the Genus database with same CATH superfamily
2G8FA 3TAGA 4J2DA 1NK0A 1WLJA 3CI5A 4DF4A 1U49A 4IJNA 4A5BA 4CI6A 4JAXA 4AM7A 4DSIA 1QE1A 5KRTA 2F4VK 1Z26A 4FM0A 4DFPA 3IKMA 2OA8A 2XO7A 1QZ6A 2HSTA 2FC0A 1VQ9N 4YDUA 4ICLA 4WFAL 4OX9K 3CJAA 3QFUA 4H4OA 1ASVA 4WFNL 3CF5L 2NRTA 3O80A 3P4IA 3D6RA 3VEZA 4YY3K 1JLQA 2PBDA 3CMAN 1NGJA 4DMNA 1HNZK 4ISEA 4ELTA 2D0CA 3CQYA 1KVCA 4OLBA 1UA0A 3RWUA 5CY4A 5AQOA 3DXKB 3VOVA 4CJEA 2QWNA 3HM8A 1OH8A 4JI2K 3F5TA 3L8BA 1CLQA 4DKWA 3VQBA 4E1NA 4BRNA 3ZT3A 3IDHA 2BANA 3KK3A 4DV1K 5KRSA 3ZSQA 3FZFA 3KHYA 1FJGK 3L0QA 1GOBA 2NUBA 4DLGA 3CQXA 4ZHRA 4U67L 3AVFA 2FBVA 3FZHA 3EKSA 3SQ4A 1VK0A 4CGHA 3WQUA 1TV6A 4C23A 3L2WA 4F3TA 4CFAA 4IJAA 3NAEA 3VF4A 3AVJA 3WXJA 3H1VX 4CJPA 2Q1NA 3K9KA 1XUPO 4I2QA 3I0SA 4K0KK 2HF3A 2O8CB 2HHHK 5AFUH 3ULEB 1RT6A 4JYAK 3J8AA 3FZLA 1BA0A 2YNGA 3S3MA 4HWIA 2UUCK 4DV4K 4J2BA 3BEXA 4FWSA 3CCJN 2ASPA 4JKFA 3AVHA 2NRXA 3OA9A 3GG4A 5F1XA 3ITHA 5CYQA 2OPRA 3D7EO 3F9MA 3AV9A 3QEXA 1LWFA 1EWRA 3VMFB 2OPSA 1XI1A 3O8MA 4Z4CA 3PUFA 3DJCA 4M3YA 4FJ9A 2R7YA 1TL1A 4CZLA 1WN7A 4KH4A 5E41A 1YXQA 1IKYA 3AGKA 1TKTA 4MO5A 3TWHA 1ZC6A 3A5OC 4K43A 3CMEN 5GADP 1WSIA 1NKEA 4ILGB 1VSMA 4A57A 1XNRK 1RBRA 2QK9A 2FBYA 3HXMA 4E0DA 3M8QA 5C12A 3HZ6A 4NYFA 3P5JA 5FDLA 2BTFA 1JXEA 3JAMO 2E6MA 4FK0A 4H03B 4WQ5A 4BVPA 4JRPA 1GLCG 2YHXA 3SV3A 4NYNA 1Q9XA 2KTQA 4PUOA 4CZHA 3SNNA 1MU2A 4C8MA 3MEGA 4BRCA 2O8DB 1VSDA 3WNFA 3QEPA 3HP9A 4CVNE 1TYQB 1EQYA 1U4BA 3NFAA 3DM2A 3CJ1A 2OPQA 2XRIA 3DXMB 3QFPA 3SQ0A 2Q36A 5LMNK 3LZIA 2Z1JA 4LF7K 1GLAG 3OYIA 4H0YB 4FOIA 2B4JA 1JLAA 3V6DA 4CFBA 3EY1A 3QNNA 4N41A 5C24A 3KLFA 4FXDA 4RWTA 4B3RK 4FK4A 1U6ZA 1RBVA 3RMAA 5AQUA 2VG5A 2KKZA 2O4IA 3N4PA 3I8BA 4LD0A 4J2AA 4Z4IA 4BRDA 4FOEA 2WONA 4B3SK 1ASWA 1VQON 4CW7B 1P8ZA 1NWKA 2RE2A 4MLEA 3VESA 3J7AP 4ISFA 4PL7A 5HLFA 4FJLA 4JN4A 2ETJA 3PLAA 1HKBA 4CHPA 3A0IX 4YDUC 4BWJA 5AQLA 3U8XA 1KFDA 1GOAA 1VSHA 4AHUA 1W9HA 1RT3A 4Z4GA 2D5RA 4AF1A 4H0TB 3LP1A 3DXKA 3P31A 4W5TA 2WTUA 1Q8IA 3HOTA 4NB4A 2HW3A 5KTQA 1NKCA 4DV0K 3FR0A 4BRPA 3CC2N 4GKJK 4UQGA 4FLWA 1JCFA 2YHYA 1VQPN 1C0UA 5BR8K 1RDDA 5HROA 3EL2A 3OVNA 5E84A 4FZZA 3D2EB 1FKPA 5B8HA 2E8AA 5J1EA 5KPZA 3EZ5A 1QTMA 4DR7K 5FPNA 3CC7N 4NXMK 3TAEA 1YAGA 4W5QA 4DSJA 3VQ9A 2ZJQL 3MXMA 2E2QA 2D0AA 3VQ6A 4CF1A 4KKOA 3AY9A 4BRLA 1D9FA 2Q0UA 3QO9A 4JV5K 3ULDA 1RDUA 3CYMA 3SBTA 1Q9YA 1FW6A 3K5OA 4IFEA 1S9EA 3VF2A 4DR3K 1XHZA 1ZBFA 2ITGA 3HI0A 1Y64A 3WNHA 4M42A 2QTDA 4FLYA 5AQWA 2O8CA 4BGAA 4I9QA 5EX5A 3ULEA 3GBTA 2IGIA 5EU7A 2E5LK 1TKZA 3DRPA 3EEQA 3DLLL 3ZSVA 2I7PA 3AVIA 4DS5A 4BDPA 2OANA 4LY7A 1LW2A 4CEDA 2ZE2A 1VHXA 1JCEA 5JLFA 3KJVA 3VF6A 2KZMA 4BRIA 3K5LA 5AFUA 4FM1A 4B3TK 4I7FA 5AJ3K 2Y1IA 4B1VA 4KHQA 4ILHA 2HMPA 4KHUA 4WYBA 4QCLA 4CJTA 3SMPA 4DTNA 4ISGA 4EFHA 1EKEA 5J2NA 3QLHA 1CZAN 4X66K 1NMDA 2A6AA 3HPHA 1T05A 3OYGA 2KW4A 4BR5A 4FWRA 2CH5A 4KI4A 3TAQA 3SI6A 4NCBA 4AQYK 4H4MA 1VQ5N 2EHGA 3CJ9A 4GY2B 1NOYA 2ITMA 3E9LA 1YF5L 1TKXA 3AO2A 4HUEA 1N34K 2YV0X 3LDSA 2HBMA 5CR4A 1HLUA 2F8SA 3E9PA 3SQ2A 1NK8A 4WQ5C 4DTOA 4FCYA 1ITGA 3VTHA 3E1YA 1BOTO 3I56N 4O5FA 3MX2A 4B9NA 2QEXN 3CCLN 1KAZA 4LFBK 3HO1A 2HHQA 2PAVA 3DXMA 3HK2A 4CJ5A 1RBSA 1VQ8N 3B6PA 4IG3A 4B08A 3WEEB 4ID5A 4C1NK 2RHKA 3JYTA 3LANA 2ZM6K 1HKCA 1KVBA 3VQ5A 3OYKA 3VPZA 5JMVA 2NLXA 2YNHA 4E19A 1U2VB 4CGJA 3IMXA 3QEWA 4B9LA 1G15A 2G8VA 3V4IA 2PYJA 4Z4EA 3BZKA 1T8EA 3EE8A 3BF1A 3O5BA 4NO7A 4CBXA 4M3RA 3LP2A 2QA4N 4DQ8A 4CZJA 1HPMA 1DTTA 4FVMA 3KK1A 3AVNA 2DFHA 4H0OA 5SZTA 3I55N 3HRGA 5KI6A 4YOUA 1SKRA 3VQCA 3NGZA 4PQUA 4DR2K 1RDCA 3VEOA 2QWMA 1ZXOA 1HJOA 1N6QA 2FBXA 2P5OA 3VA3A 3AVGA 1HQUA 4DQRA 1KSPA 3WNEA 4XH5A 4FLUA 1X9MA 2Q97A 2E1ZA 3MK6A 4JD2B 1K9MO 3T19A 2JGUA 4A5AA 2HHVA 4CHOA 1NNEA 3AVCA 1M90O 2WOMA 4CJ4A 1IG8A 3OYHA 2A41A 1UAXA 3D2EA 4GKKK 4FZYA 1X3NA 1NGIA 1REVA 1WSGA 1RTIA 1RBTA 2NRVA 2CGLA 3DLRA 4JKEA 5EVZA 3AVBA 4BRGA 3MMVA 5J2PA 2XY6A 4CJVA 3TSUA 3NBPA 3BP8A 4MFBA 4PHTX 1S9GA 5BN9A 2CH6A 3SV4A 3TI0A 3VQPA 2HBLA 4H5TA 1VRTA 4O0IA 5FPMA 4YNQA 5AQMA 3FZKA 4JNEA 5BR9A 3M8SA 3D2FB 3M8PA 5IWAK 3KIOA 4W5RA 4OPKA 5AQFA 4FYDA 1A5VA 3Q7CA 1K8AO 4DV5K 1D8YA 2Q0RA 1TKDA 5JLHA 1IG9A 1QSYA 1J5EK 5I42A 1Q18A 4DTXA 2HHSA 3KLHA 4GV6A 4O5BA 4TSXA 3OTOK 4B1UB 4B8AB 2CGKA 4AHCA 4PKGA 2QM1A 3G10A 4U7BA 4DV3K 3AA3A 2GBZA 4J8FA 1SZ2A 4LFCK 3L6QA 4F9OA 5C42A 4QS9A 4EP4A 3THYB 1X9WA 1W7AA 4DUZK 4ZTFA 1WSJA 3EE9A 3ZSOA 4JS5A 1GLJO 2H3GX 4JK8A 4E3SA 3THVA 2CGJA 3NMUA 3H6EA 3WXIA 3C95A 4JI6K 3LALA 4DG1A 3O08A 4WCEL 4CEBA 4KB0A 4LH5A 4Z94A 1RT7A 5KGWA 3VENA 2YNIA 1O13A 4CFDA 1Q82O 1RBUA 3O4WA 4JKGB 5KQ8A 3QBXA 1JLCA 1NGBA 1S6PA 2JWKA 2HNZA 4NLCA 4DTRA 4LF4K 3R3LA 5DK5A 3R6MA 3TAMA 2EWSA 1XHXA 5C2FA 4DSEA 1NK5A 1Z05A 3MECA 1TUYA 1DTQA 4A59A 3RRHA 3VEXA 2IOCA 3MDQA 1KD1O 1HPZA 1NJZA 2PY5A 1U2VA 4NCAA 5F0XA 3DAWA 3NF7A 5GAHP 1S22A 2BUPA 1D5AA 4FWLA 4H0XB 4E7HA 1RDWX 4CZIA 1NJXA 2X6SA 4WQ4A 3RMBA 1SKWA 2HMIA 3E9OA 3ZETB 3IG1A 2YJEA 4OVLA 3QIPA 5FRMA 4JI1K 3NVMA 4C8NA 1NK6A 4CZKA 3ZX3A 2OTJN 2OYQA 4BRQA 1IH7A 2WFBA 3C6UA 4JKCA 3P39A 4CEQA 2P9LB 4FWOA 4RG8A 4Z0UA 3OYCA 4BR0A 2J4RA 3KLGA 5CZ1A 4DFJA 3DI6A 4KAZA 2HBJA 3K5NA 4FWNA 1VSKA 3ZT1A 1JLEA 3ALYA 3O4NA 3LPUA 3QEIA 4JI5K 5ELZA 4M3TA 1JL1A 3OS1A 3DOLA 4CJWA 5AZIB 4DFMA 1LAWA 4DV6K 4CESA 2E88A 4JD2A 2FF3B 1H1VA 1MWMA 3C7NB 4YFUA 3KK7A 3HL8A 4KH5A 3HSCA 4BWMA 3LAKA 4BR2A 4JI3K 4KI6A 4FLXA 3T69A 1B9FA 4DHYA 4O0JA 5A2QO 2YX6A 4OJRA 2ZD1A 2DY4A 1KXPA 5HRNA 1VQKN 3EN9A 2UYTA 4M7XA 3RR8A 1JJ2M 2KZZA 1BCMA 5J2QA 1GOCA 4M45A 4BDYA 4B9VA 3T1HK 4EAHD 3LWLA 4CJSA 3CXCM 4FW2A 1YTAA 3DWLA 3CPWM 4XH1A 3TARA 4BE2A 3HTVA 4KHNA 4IBNA 3D2FA 3ENHA 4ID1A 2W40A 3P38A 2A5XA 4QAGA 3H1QA 3PX4A 1HNWK 3K0SA 1RT2A 3AO1A 4AH9A 1OH7A 3T3FA 3QETA 3KTQA 4LF5K 3NH1A 4B1YB 1SL1A 4CHQA 1U45A 3ZSWA 3P83D 4C8LA 5JS1A 4BG8A 3EZWA 2NRRA 3K2PA 4FSVA 5GAGP 4IFYA 4CF9A 2PFUA 2KFZA 2WBNA 1S1WA 3OW2M 5AQYA 3ZYYX 1BG3A 4GVMA 1NG9A 1SQKA 1JKHA 5BPLA 1CZBA 3A8YA 3THYA 4JKDA 4FLTA 1TGOA 1UWBA 3PV8A 4HCBA 1U04A 4JHDB 4CERA 4W5NA 3VQ7A 4KPYA 4KFBA 2LSNA 2HHXA 3WQTA 3LPTA 1VQNN 3IAYA 4OKKA 5HOOA 2YHBA 2QXFA 3JS6A 3ZSXA 2RPIA 3OY9A 2D0BA 2P1JA 4JLHA 4HTUA 3SUPA 4M3WA 4DF8A 1RTDA 4C1NI 5FPDA 2P9UB 4JKGA 1MDUB 4CJQA 1VSLA 2DFEA 2QXLA 5LJWA 2HOEA 3O9RA 3AO3A 1KC8O 1RT4A 1ATRA 4DTSA 2O4GA 3NF8A 1QVGM 2QI2A 2V7ZA 5GAEP 3V9WA 3OYNA 1E3MA 3OYLA 3R8EA 3TAPA 4DSFA 4FZXC 4CZFA 4FJ5A 4OPHA 4RW9A 3KZBA 3SQ1A 1RDBA 1BQNA 4FPAA 2RF2A 1WAFA 2W6LA 4B9QA 3T1AA 3UKRB 5KPRA 4IFVA 3AVLA 3BGRA 4B9SA 3TSQA 4EIAA 3L2QA 2A3ZA 3TSPA 3OS2A 1Q7YO 3ENOA 4B9UA 4O8KA 2GX9A 5AQNA 1LWEA 4DV2K 4GV3A 4YOTA 4M3UA 1CZ9A 3WT0A 3OBYA 3MCPA 5ADXH 4RW6A 4CF0A 1KTQA 4FW1A 3SJHA 3GE1A 1MA9B 3C6AA 3ZETA 1L3SA 3QERA 5JVGL 3VEYA 4KTWA 3CPEA 4WQ4C 4DR1K 3SLCA 1ZYQA 4IXCA 4WF9L 4F3OA 4KV8A 2P9LA 3A5LC 5IT9O 2P9IB 1VAZA 4PY5A 1IBKK 4FK2A 3KLIA 4CEFA 1OVQA 3HYFA 3CFOA 2IVNA 4E7LA 3V1RA 5BRDA 3F73A 3M1FA 1WUAA 2O8FB 2DTUA 3MXJA 4CJ3A 1DLOA 4HCCA 1QQNA 3C65A 3GDQA 3THWB 4IOAL 1RILA 1HR0K 1WSFA 4X62K 5AZIA 5HRRA 1F21A 3O1BA 3VGMA 1HYVA 2FSKA 5AQTA 2P9KB 1XWLA 2GEMA 2YKMA 2JWLA 3C6HA 3C7NA 4E1JA 4DQPA 1VSIA 3SUNA 1NJYA 1VQ4N 2ZJRL 2A1SA 2VQEK 1C0MA 3VGKA 5BPMA 1Z25A 1YUWA 3KWIA 1ATSA 1C0FA 1LW0A 1T3VA 1KFSA 1OKJA 3E66A 5AQQA 3ZEUB 4CEAA 1YVNA 5AQVA 5H1SQ 3V1QA 2HVIA 4BQLA 3DRSA 3ZSRA 3R9PA 4JRQA 2E6LA 4FJJA 1NK4A 4K42A 3SK3A 2UU9K 3IS9A 5JVHL 3RMCA 4DTMA 3VA0A 2WC9A 4BC3A 4BQZA 3FZMA 2AA4A 3LP3A 2A1RA 2YI1A 4MQ3A 2G8IA 3JXUA 3SBGA 3O3HA 2OZSA 2GV9A 3NHGA 1QQMA 4Y0WA 5CYMA 4JKAA 1NGDA 3HOSA 1S1VA 3MN6A 4L3QA 3LDQA 4DQIA 3TTDA 4O44A 4CJLA 4XEIA 3HJFA 4DSKA 4FJHA 1XMQK 2ZWHA 2W42A 3NCIA 5BRHA 1GLLO 2NRWA 1WB9A 3QDKA 4EHUA 4L8RB 1HYSA 1HX1A 2EX3A 5M1PA 2I7NA 4H5RA 5M1NA 4BC2A 1DKGD 1FXXA 3S41A 1SKSA 4RW7A 4K41A 4CJKA 5AQHA 2ZJPL 2D0OA 2FSNA 4JHDA 3CCQN 3D0PA 2G8HA 3Q7BA 1RTHA 4CE9A 1ATNA 4BREA 4Z4HA 4FJGA 4YOVA 4CK2A 1C1AA 2O8DA 4CF2A 4OPJA 2BDPA 4DCHA 4JKBA 3WNGA 2IDOA 1TYQA 3PO4A 4OPAA 4K8ZA 3L3VA 3L4QA 2PYLA 4FJ8A 4Q0BA 4WFBL 1ZBSA 3NH2A 1VQ6N 3NVKA 3G6EN 2NZTA 3L2VA 2HHUA 4N5SA 4G1QA 3OYDA 2UUBK 3IRXA 2G8WA 2P9UA 2D0PA 1Z6RA 3AO5A 1NJWA 3SMSA 4CJUA 2NNWA 3OHRA 1HKGA 4HUFA 3HVRA 3U6FA 3IFRA 3CFRA 3NF9A 3GL1A 4YOYA 2VCPA 2P5GA 4BR4A 1OH5A 4DQQA 1B9DA 1BA1A 1X9JA 3M5RA 1JXBA 4DFKA 4Z4FA 2P9NB 2F9TA 3U9ZA 4CZEA 3FLCO 3WXMB 2IVOA 4A2AA 5AZJB 4RCHA 1YJ9N 2GUIA 4LF6K 4O4GA 3O3GA 5JICA 4DR6K 2E1YA 3BUZB 3ID6A 3C94A 1DT9A 5DM6L 1C0GA 1E4GT 4CD3A 2B6AA 1P90A 1N33K 1JCGA 4CJFA 3CCRN 1I39A 4BRMA 2HHWA 4J2EA 3O6WA 4KBOA 5AQRA 4E7KA 1EETA 1GLEG 1J53A 5AQGA 4C8KA 4M41A 2E20A 4BR7A 3TAFA 1UA1A 3A2FA 1U48A 4IEEA 3S9HA 3MEEA 4FWMA 2KFNA 1LCUA 4RTFD 2P9IA 3RSEB 1ZBLA 4H5WA 4CJRA 2ASOA 4CIEA 5BN8A 4IDHA 1N5YA 4OGEA 3OYEA 2ZGZA 3A5NC 2O8FA 4CGDA 1WAJA 5ADXA 3H3OB 4X64K 5CE3A 3THWA 1BWFO 3H45C 1A5WA 4BE0A 3HPGA 3NH0A 3CD6N 1SUQA 1V4SA 1CXQA 1NBWA 2Q2RA 4IO8A 5EY4A 1TUUA 2YHAA 4ZTJA 3VTIA 2P9PB 3UE5A 3OYAA 4IOCL 2YCHA 4E89A 4FL9A 3V1OA 2F9WA 3ZEUA 4AILC 4KHPK 5AQXA 3NGYA 3C6TA 3J80O 1SAZA 3FE1A 4Y1DA 5CZ2A 3SUOA 2AP1A 2ASMA 5C2DA 2FBTA 3V9UA 3K9JA 4MDBA 4DS4A 2Z1IA 1KAYA 5FLXO 1S5JA 3G4SN 1L3VA 3G71N 1X3MA 2YKNA 5C10A 2O8EB 4KB1A 3EYZA 3ID8A 4NXNK 2UXBK 4NLBA 2XY7A 4I2PA 1UOCA 4CEZA 3HSTB 4GNIA 1S6QA 1Q86O 4B3OA 4I6MB 3THXB 2XY5A 5M1FA 3QINA 3VQ8A 3J7ZO 1TL3A 1KLMA 4R79A 5C0YA 1BU6O 5DM7L 3M8RA 3WUHA 3KKRA 3BZCA 1IKWA 4JK9A 4DU1A 3TABA 2NRHA 5HP1A 1BI4B 4BRFA 2P51A 3SAGA 1N36K 3ATVA 5LMUK 5BRFA 4GW6A 5BREA 3TR8A 3U9DA 1JLGA 1WOQA 3GOIA 3O3FA 3M6GA 4R5PA 3KLEA 4YOWA 3R1XA 1HNVA 5D3GA 2VWJA 2HNDA 1KCFA 2B5JA 4IG0A 4CGGA 5J2MA 3N4QA 4EZ6A 2V7YA 4FM2A 2UXCK 3KKSA 2P9SB 2AJQA 3VN5A 3DLEA 4AHRA 1C6VA 1IBMK 1K6YA 4GMJB 3B6OA 4AHSA 4EZ9A 3WEEA 1QHAA 3TTFA 2GUPA 4RW8A 3LL3A 4FJKA 2VGMA 1XNQK 4BACA 1YHQN 4H8KA 4DU4A 3MX5A 4E7JA 3DRRA 4MO4A 1NM1A 3CQ8A 1C1CA 5KPTA 5JS2A 3K58A 3W0LA 1Y97A 4CBWA 2P9NA 1G99A 1FKOA 1YJWN 3RRGA 5AZJA 1NK7A 3QESA 3ZX0A 2D4WA 1WSHA 1VSFA 4IEIA 2BH1A 4A62A 5HRPA 1Q81O 1E4FT 1RFQA 1YIJN 2UXDK 2ZF5O 2ATQA 4H0PA 1ZBUA 1T03A 2OTLN 4ELUA 4DU3A 1JL2A 1W2BM 3LP0A 5EXWA 3CJCA 2Q3SA 1RT1A 4JI8K 3AGRA 5K14A 3V9XA 4KO0A 1D9DA 2IC3A 3RSEA 1BISA 1L5UA 2VGNA 4OGCA 1NGHA 4LH4A 2VG6A 5AR0A 4LF8K 3RTVA 1LAVA 3CJBA 4BGBA 2KQ2A 3CCEN 4M63C 1BUPA 1BL3A 2KHOA 4B1XB 3KWGA 3D45A 3UB5A 3M3ZA 4KTZA 4CEOA 1S72N 1K73O 4DV7K 1QSLA 3K59A 4H5NA 3CM5A 3O9QA 1HJRA 3BY5A 1NK9A 2P9PA 3AAQA 3DYAA 4LF9K 3V9ZA 5TKYA 4OKEA 1RNHA 4KH6A 2VQFK 1VSJA 4CD1A 1BO5O 1TK0A 3SZ2A 2QKKA 2KLAA 4KHYA 3DLBA 5M1KA 1N8RO 4FO0A 4IDKA 4BR9A 4PL8A 3DOKA 3U3YA 4CF8A 2HNYA 4DWIA 3CM6A 1ZBHA 1JLBA 3RVCA 1DEJA 3SCXA 3AVKA 2QWLA 4I6MA 3THXA 2FXUA 5I3UA 1RCHA 1U47A 1GLBG 4F8RA 4DTJA 4KTQA 4GVEA 4CK1A 4M3ZA 4M7YA 2FF6A 1GLDG 4B9MA 1I3AA 1BI4A 3G0ZA 2GWKA 3TPQA 4IOXA 1YTUA 2HVHA 2E2OA 3PY8A 3CHWA 1J54A 1NMNA 4Y1CA 4O8UA 5AQPA 4BY9C 1NJIO 3NDKA 1QHTA 3LWMA 4DTPA 3CCUN 3G25A 1HNXK 4FJIA 1NKBA 4YOXA 4CIFA 3U4LA 2P9SA 4F2RA 2X6NA 4AHTA 3H3NO 3ZLJA 4FVUA 3VEWA 3AA5X 5AQJA 2FSJA 4A61A 2E4LA 5CHIA 4H0VB 4BC4A 3T1YK 2YJFA 3OBWA 4CJ7A 1VSEA 3K5MA 4YORA 2I5JA 1YVUA 3QMLA 4DTUA 4RW4A 2HF4A 3HP6A 4KREA 4IKFA 3L2UA 4JS4A 5LL6Z 4QS7A 3PIOL 4HUGA 4LFAK 1NLVA 3MN7A 1QZ5A 4FLVA 2NRZA 2OZMA 4ELVA 4PA1A 3HVTA 1SL2A 1QQCA 2E2PA 1BIZA 3NE6A 1YITN 3L4IA 4JI0K 1QS4A 3B8AX 3QEVA 3V81A 1CXUA 1RGIA 1DGKN 3NF6A 3UKUB 1KAXA 5M1QA 1IBLK 3OYJA 1IV0A 4N47A 3VQ4A 4N76A 4LSNA 4DB3A 3EKUA 1KLNA 3O1WA 1BDGA 4OO1J 5SWMA 3CJ7A 4XH4A 1J6ZA 1EWQA 3UIQA 3QIOA 4CHZA 3AVMA 4CBUA 1NGFA 3LM2A 3A5MC 2F96A 4G9ZA 4A2BA 3CFPA 1VQLN 2G8UA 3ISNC 5LJVA 3EO3A 4XIUA 3MEDA 2GWJA 4DQSA 1XQSC 5GIPA 4PKIA 4CGFA 2ZGYA 1VQMN 3VQDA 5AQSA 3H08A 2Y1JA 1ASUA 2IS3A 3OYBA 1SV5A 4E1MA 3ZT4A 4MDAA 3MN5A 3AO4A 2Z1HA 3VETA 1RT5A 5GIOA 2O8EA 4UY8O 1HYZA 5HL7L 3O4QA 3CERA 3HBTA 2X78A 1EX4A 1NGEA 1WNSA 3TANA 1HRHA 3VQAA 1MWKA 2A42A 1M1KO 1S3XA 3VQQA 3PO5A 4ILJA 4F4KA 5FPEA 3PX0A 1W0HA 3OYMA 4DSLA 4B8CA 4FWQA 3ZT2A 4IWVA 1WBBA 3AAPA 4QS8A 3PIPL 2JLEA 3CCSN 1KQSM 4FJ7A 2Q31A 3DMJA 4K8XA 1EP4A 3AA2A 5M1OA 4K25A 5F2RA 3KD1E 4JI4K 3CCVN 3SAHA 4B3MK 4H5VA 1RTJA 3AVAA 2O8BB 3WXLA 3K57A 3VERA 1S1TA 4NCGA 1A5XA 2GTDA 5AQZA 1BHLA 5I9EB 2V52B 5FROA 2QKBA 4CZGA 3IUCA 5C25A 5KQDA 3LAMA 4WE1A 3OS0A 4KHSA 1QQOA 4BE1A 5FRNA 3LDPA 1V4TA 4CIGA 3SJJA 2PZSA 2QWRA 3ZSYA 1K8KB 3OJUA 3QNOA 3CC4N 2HBKA 4YHHK 3H46O 3ASMA 4HHTA 5T7BA 1X9SA 1NGCA 3O9UA 4BVOA 3U3GA 1KRPA 2V51B 4LSLA 4FWPA 1JLFA 1S1UA 2FLOA 3WXKA 1T44A 1J5OA 3MAQA 1WBDA 1VQ7N 4B1WB 1ILYA 4BRHA 1RDAA 3ZSZA 4DLEA 2Z1GA 3S3NA 4KRFA 1TVRA 1LWCA 2UUAK 3DLKA 3PSFA 4V19S 2RKIA 4EP5A 3CG7A 1R59O 1D4XA 4BROA 3FFIA 1XC9A 3HT3A 4O55A 5BPNA 5AQIA 1HMVA 4DR5K 4OKJA 4JKHA 2W41A 2QW9A 3UKRA 1HNIA 2BE2A 1T6DA 4BC5A 4CEEA 2W6KA 3LDNA 2XY8A 2VYPA 3I8DA 3PSIA 4F2SA 4BG9A 2DFFA 2IVPA 5LY3A 1XMOK 4CHNA 3AARA 1S1XA 1W97L 4PKHA 3CCMN 1QVFM 4AM6A 1O1WA 2QWOA 4W5OA 1YT3A 3LM9A 3VQEA 4B9TA 3UKUA 5KGXA 3LZJA 1TK8A 3QB0A 3VEVA 1LOTB 2OPPA 1T6CA 2A40A 3E01A 3MN9A 1ZBIA 3O9TA 3BF3A 3ATUA 3ZCMA 3TU5A 3BDPA 1C0TA 1L3TA 5HBMA 2YHWA 4DR4K 1IKXA 4CFCA 1VRUA 3C0BA 3KVGA 2QWPA 3I0RA 4CECA 3L2RA 3KD5E 4FJNA 2GELA 1EXQA 3O9SA 5AQKA 2P9KA 1N32K 3ZT0A 3W3DA 4FWKA 2F7TA 2VWKA 4CZMA 3F9KA 1NOZA 3ZX2A 1HUXA 2D1KA 2DPNA 3LDOA 3P1GA 4BDZA 1YI2N 2BGGA 1IJJA 3TTCA 5E26A 4B1ZA 3SAFA 1NGGA 3V9SA 3SUQA 3SYZA 3VGLA 1GLFO 3J7YP 1LV5A 2ZQBA 1I94K 4FLZA 3QICA 4CK3A 4IO9L 3NGIA 2XHBA 3F2KA 3MXIA 1X1PA 3FGUA 4DUYK 3KK2A 3CETA 2IAJA 2OCEA 2F8TA 5DMRA 3J81O 1BCOA 2YNFA 2G8KA 1NU0A 3SPYA 4HTLA 1HQEA 1B92A 3RMDA 5TKWA 1BQMA 3DLGA 4X65K 4C8OA 2IIRA 3SPZA 1QSSA 3FFKB 1YJNN 4FPBA 1EO1A 3HM9A 4PWDA 3RR7A 2WUSA 5C15A 1WSEA 3S3OA 5MLCQ 4CGIA 4HVJA 3LDLA 1SL0A 1BIUA 3L3UA 2VWBA 2X74A 5GINA 3ENBA 5HRSA 3OJSA 4CCHA 1OVYA 1T7PA 1IO2A 1FK9A 2O8BA 1ESVA 2VG7A 4N56A 5EOYA 3MWPA 4EHTA 4JEPA 2RN2A 2QWQA 1C1BA 4KHWA 1OH6A 3OYFA 1R0AA 1L3UA 4QOZB 4FJXA 4FJMA 4BRAA 1TK5A 4I9LA 3MCAB 4E7IA 1NGAA 3I33A 3DLHA 4MLHA 4JI7K 1K8KA 1TAUA 2HB5A 3PX6A 3T7ZA 4JK7A 4M3XA 2HHTA 3HPOA 1XC3A 4BRKA 4CHYA 3AA4A 4LC9B 1KVAA 1J9AA 4AHVA 3MWTA 4IZ9A 1TAQA 1IKVA 4GV9A 4OLAA 1SS6A 3QBWA 4Q5VA 2E2NA 1BGXT 3JSMA 3CIPA
chains in the Genus database with same CATH topology
4JI3K 3J7AP 2UU9K 4JI6K 4LF6K 4DR6K 5A2QO 4X66K 2F4VK 3J7YP 1I94K 1N33K 4JI8K 4GKKK 4DUYK 4AQYK 3T1HK 3J81O 4OX9K 1HNXK 2UUAK 4V19S 4DV0K 4LF8K 4LF4K 1N34K 1N36K 4YY3K 4GKJK 5LMUK 1XMQK 4DR5K 4X65K 5BR8K 1HNZK 4DV2K 1XNRK 1HNWK 4DR7K 4NXMK 3T1YK 4LF5K 4LFBK 3JAMO 4DV7K 4JI2K 2UXCK 4DR1K 1XMOK 4X64K 4JV5K 5IWAK 4LF9K 5LL6Z 2ZM6K 5IT9O 1IBMK 1IBKK 4DV5K 4DV1K 2VQFK 4LFAK 4DR3K 4CVNE 1J5EK 1FJGK 4JI1K 5LMNK 3OTOK 4JI4K 1XNQK 4LF7K 1HR0K 2E5LK 4X62K 4B3MK 4JI0K 4DR4K 4KHPK 2UUBK 4DV3K 4JI7K 3J80O 4K0KK 4LFCK 4B3RK 2HHHK 1IBLK 1N32K 2VQEK 4JYAK 4JI5K 4DUZK 4DR2K 2UUCK 4DV4K 4DV6K 5FLXO 4B3SK 4B3TK 5AJ3K 2UXDK 4NXNK 2UXBK 4YHHK 4CW7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 K;  3J7A P;  2UU9 K;  4JI6 K;  4LF6 K;  4DR6 K;  5A2Q O;  4X66 K;  2F4V K;  3J7Y P;  1I94 K;  1N33 K;  4JI8 K;  4GKK K;  4DUY K;  4AQY K;  3T1H K;  3J81 O;  4OX9 K;  1HNX K;  2UUA K;  4V19 S;  4DV0 K;  4LF8 K;  4LF4 K;  1N34 K;  1N36 K;  4YY3 K;  4GKJ K;  5LMU K;  1XMQ K;  4DR5 K;  4X65 K;  5BR8 K;  1HNZ K;  4DV2 K;  1XNR K;  1HNW K;  4DR7 K;  4NXM K;  3T1Y K;  4LF5 K;  4LFB K;  3JAM O;  4DV7 K;  4JI2 K;  2UXC K;  4DR1 K;  1XMO K;  4X64 K;  4JV5 K;  5IWA K;  4LF9 K;  5LL6 Z;  2ZM6 K;  5IT9 O;  1IBM K;  1IBK K;  4DV5 K;  4DV1 K;  2VQF K;  4LFA K;  4DR3 K;  4CVN E;  1J5E K;  1FJG K;  4JI1 K;  5LMN K;  3OTO K;  4JI4 K;  1XNQ K;  4LF7 K;  1HR0 K;  2E5L K;  4X62 K;  4B3M K;  4JI0 K;  4DR4 K;  4KHP K;  2UUB K;  4DV3 K;  4JI7 K;  3J80 O;  4K0K K;  4LFC K;  4B3R K;  2HHH K;  1IBL K;  1N32 K;  2VQE K;  4JYA K;  4JI5 K;  4DUZ K;  4DR2 K;  2UUC K;  4DV4 K;  4DV6 K;  5FLX O;  4B3S K;  4B3T K;  5AJ3 K;  2UXD K;  4NXN K;  2UXB K;  4YHH K;  4CW7 B; 
#chains in the Genus database with same CATH topology
 2G8F A;  3TAG A;  4J2D A;  1NK0 A;  1WLJ A;  3CI5 A;  4DF4 A;  1U49 A;  4IJN A;  4A5B A;  4CI6 A;  4JAX A;  4AM7 A;  4DSI A;  1QE1 A;  5KRT A;  2F4V K;  1Z26 A;  4FM0 A;  4DFP A;  3IKM A;  2OA8 A;  2XO7 A;  1QZ6 A;  2HST A;  2FC0 A;  1VQ9 N;  4YDU A;  4ICL A;  4WFA L;  4OX9 K;  3CJA A;  3QFU A;  4H4O A;  1ASV A;  4WFN L;  3CF5 L;  2NRT A;  3O80 A;  3P4I A;  3D6R A;  3VEZ A;  4YY3 K;  1JLQ A;  2PBD A;  3CMA N;  1NGJ A;  4DMN A;  1HNZ K;  4ISE A;  4ELT A;  2D0C A;  3CQY A;  1KVC A;  4OLB A;  1UA0 A;  3RWU A;  5CY4 A;  5AQO A;  3DXK B;  3VOV A;  4CJE A;  2QWN A;  3HM8 A;  1OH8 A;  4JI2 K;  3F5T A;  3L8B A;  1CLQ A;  4DKW A;  3VQB A;  4E1N A;  4BRN A;  3ZT3 A;  3IDH A;  2BAN A;  3KK3 A;  4DV1 K;  5KRS A;  3ZSQ A;  3FZF A;  3KHY A;  1FJG K;  3L0Q A;  1GOB A;  2NUB A;  4DLG A;  3CQX A;  4ZHR A;  4U67 L;  3AVF A;  2FBV A;  3FZH A;  3EKS A;  3SQ4 A;  1VK0 A;  4CGH A;  3WQU A;  1TV6 A;  4C23 A;  3L2W A;  4F3T A;  4CFA A;  4IJA A;  3NAE A;  3VF4 A;  3AVJ A;  3WXJ A;  3H1V X;  4CJP A;  2Q1N A;  3K9K A;  1XUP O;  4I2Q A;  3I0S A;  4K0K K;  2HF3 A;  2O8C B;  2HHH K;  5AFU H;  3ULE B;  1RT6 A;  4JYA K;  3J8A A;  3FZL A;  1BA0 A;  2YNG A;  3S3M A;  4HWI A;  2UUC K;  4DV4 K;  4J2B A;  3BEX A;  4FWS A;  3CCJ N;  2ASP A;  4JKF A;  3AVH A;  2NRX A;  3OA9 A;  3GG4 A;  5F1X A;  3ITH A;  5CYQ A;  2OPR A;  3D7E O;  3F9M A;  3AV9 A;  3QEX A;  1LWF A;  1EWR A;  3VMF B;  2OPS A;  1XI1 A;  3O8M A;  4Z4C A;  3PUF A;  3DJC A;  4M3Y A;  4FJ9 A;  2R7Y A;  1TL1 A;  4CZL A;  1WN7 A;  4KH4 A;  5E41 A;  1YXQ A;  1IKY A;  3AGK A;  1TKT A;  4MO5 A;  3TWH A;  1ZC6 A;  3A5O C;  4K43 A;  3CME N;  5GAD P;  1WSI A;  1NKE A;  4ILG B;  1VSM A;  4A57 A;  1XNR K;  1RBR A;  2QK9 A;  2FBY A;  3HXM A;  4E0D A;  3M8Q A;  5C12 A;  3HZ6 A;  4NYF A;  3P5J A;  5FDL A;  2BTF A;  1JXE A;  3JAM O;  2E6M A;  4FK0 A;  4H03 B;  4WQ5 A;  4BVP A;  4JRP A;  1GLC G;  2YHX A;  3SV3 A;  4NYN A;  1Q9X A;  2KTQ A;  4PUO A;  4CZH A;  3SNN A;  1MU2 A;  4C8M A;  3MEG A;  4BRC A;  2O8D B;  1VSD A;  3WNF A;  3QEP A;  3HP9 A;  4CVN E;  1TYQ B;  1EQY A;  1U4B A;  3NFA A;  3DM2 A;  3CJ1 A;  2OPQ A;  2XRI A;  3DXM B;  3QFP A;  3SQ0 A;  2Q36 A;  5LMN K;  3LZI A;  2Z1J A;  4LF7 K;  1GLA G;  3OYI A;  4H0Y B;  4FOI A;  2B4J A;  1JLA A;  3V6D A;  4CFB A;  3EY1 A;  3QNN A;  4N41 A;  5C24 A;  3KLF A;  4FXD A;  4RWT A;  4B3R K;  4FK4 A;  1U6Z A;  1RBV A;  3RMA A;  5AQU A;  2VG5 A;  2KKZ A;  2O4I A;  3N4P A;  3I8B A;  4LD0 A;  4J2A A;  4Z4I A;  4BRD A;  4FOE A;  2WON A;  4B3S K;  1ASW A;  1VQO N;  4CW7 B;  1P8Z A;  1NWK A;  2RE2 A;  4MLE A;  3VES A;  3J7A P;  4ISF A;  4PL7 A;  5HLF A;  4FJL A;  4JN4 A;  2ETJ A;  3PLA A;  1HKB A;  4CHP A;  3A0I X;  4YDU C;  4BWJ A;  5AQL A;  3U8X A;  1KFD A;  1GOA A;  1VSH A;  4AHU A;  1W9H A;  1RT3 A;  4Z4G A;  2D5R A;  4AF1 A;  4H0T B;  3LP1 A;  3DXK A;  3P31 A;  4W5T A;  2WTU A;  1Q8I A;  3HOT A;  4NB4 A;  2HW3 A;  5KTQ A;  1NKC A;  4DV0 K;  3FR0 A;  4BRP A;  3CC2 N;  4GKJ K;  4UQG A;  4FLW A;  1JCF A;  2YHY A;  1VQP N;  1C0U A;  5BR8 K;  1RDD A;  5HRO A;  3EL2 A;  3OVN A;  5E84 A;  4FZZ A;  3D2E B;  1FKP A;  5B8H A;  2E8A A;  5J1E A;  5KPZ A;  3EZ5 A;  1QTM A;  4DR7 K;  5FPN A;  3CC7 N;  4NXM K;  3TAE A;  1YAG A;  4W5Q A;  4DSJ A;  3VQ9 A;  2ZJQ L;  3MXM A;  2E2Q A;  2D0A A;  3VQ6 A;  4CF1 A;  4KKO A;  3AY9 A;  4BRL A;  1D9F A;  2Q0U A;  3QO9 A;  4JV5 K;  3ULD A;  1RDU A;  3CYM A;  3SBT A;  1Q9Y A;  1FW6 A;  3K5O A;  4IFE A;  1S9E A;  3VF2 A;  4DR3 K;  1XHZ A;  1ZBF A;  2ITG A;  3HI0 A;  1Y64 A;  3WNH A;  4M42 A;  2QTD A;  4FLY A;  5AQW A;  2O8C A;  4BGA A;  4I9Q A;  5EX5 A;  3ULE A;  3GBT A;  2IGI A;  5EU7 A;  2E5L K;  1TKZ A;  3DRP A;  3EEQ A;  3DLL L;  3ZSV A;  2I7P A;  3AVI A;  4DS5 A;  4BDP A;  2OAN A;  4LY7 A;  1LW2 A;  4CED A;  2ZE2 A;  1VHX A;  1JCE A;  5JLF A;  3KJV A;  3VF6 A;  2KZM A;  4BRI A;  3K5L A;  5AFU A;  4FM1 A;  4B3T K;  4I7F A;  5AJ3 K;  2Y1I A;  4B1V A;  4KHQ A;  4ILH A;  2HMP A;  4KHU A;  4WYB A;  4QCL A;  4CJT A;  3SMP A;  4DTN A;  4ISG A;  4EFH A;  1EKE A;  5J2N A;  3QLH A;  1CZA N;  4X66 K;  1NMD A;  2A6A A;  3HPH A;  1T05 A;  3OYG A;  2KW4 A;  4BR5 A;  4FWR A;  2CH5 A;  4KI4 A;  3TAQ A;  3SI6 A;  4NCB A;  4AQY K;  4H4M A;  1VQ5 N;  2EHG A;  3CJ9 A;  4GY2 B;  1NOY A;  2ITM A;  3E9L A;  1YF5 L;  1TKX A;  3AO2 A;  4HUE A;  1N34 K;  2YV0 X;  3LDS A;  2HBM A;  5CR4 A;  1HLU A;  2F8S A;  3E9P A;  3SQ2 A;  1NK8 A;  4WQ5 C;  4DTO A;  4FCY A;  1ITG A;  3VTH A;  3E1Y A;  1BOT O;  3I56 N;  4O5F A;  3MX2 A;  4B9N A;  2QEX N;  3CCL N;  1KAZ A;  4LFB K;  3HO1 A;  2HHQ A;  2PAV A;  3DXM A;  3HK2 A;  4CJ5 A;  1RBS A;  1VQ8 N;  3B6P A;  4IG3 A;  4B08 A;  3WEE B;  4ID5 A;  4C1N K;  2RHK A;  3JYT A;  3LAN A;  2ZM6 K;  1HKC A;  1KVB A;  3VQ5 A;  3OYK A;  3VPZ A;  5JMV A;  2NLX A;  2YNH A;  4E19 A;  1U2V B;  4CGJ A;  3IMX A;  3QEW A;  4B9L A;  1G15 A;  2G8V A;  3V4I A;  2PYJ A;  4Z4E A;  3BZK A;  1T8E A;  3EE8 A;  3BF1 A;  3O5B A;  4NO7 A;  4CBX A;  4M3R A;  3LP2 A;  2QA4 N;  4DQ8 A;  4CZJ A;  1HPM A;  1DTT A;  4FVM A;  3KK1 A;  3AVN A;  2DFH A;  4H0O A;  5SZT A;  3I55 N;  3HRG A;  5KI6 A;  4YOU A;  1SKR A;  3VQC A;  3NGZ A;  4PQU A;  4DR2 K;  1RDC A;  3VEO A;  2QWM A;  1ZXO A;  1HJO A;  1N6Q A;  2FBX A;  2P5O A;  3VA3 A;  3AVG A;  1HQU A;  4DQR A;  1KSP A;  3WNE A;  4XH5 A;  4FLU A;  1X9M A;  2Q97 A;  2E1Z A;  3MK6 A;  4JD2 B;  1K9M O;  3T19 A;  2JGU A;  4A5A A;  2HHV A;  4CHO A;  1NNE A;  3AVC A;  1M90 O;  2WOM A;  4CJ4 A;  1IG8 A;  3OYH A;  2A41 A;  1UAX A;  3D2E A;  4GKK K;  4FZY A;  1X3N A;  1NGI A;  1REV A;  1WSG A;  1RTI A;  1RBT A;  2NRV A;  2CGL A;  3DLR A;  4JKE A;  5EVZ A;  3AVB A;  4BRG A;  3MMV A;  5J2P A;  2XY6 A;  4CJV A;  3TSU A;  3NBP A;  3BP8 A;  4MFB A;  4PHT X;  1S9G A;  5BN9 A;  2CH6 A;  3SV4 A;  3TI0 A;  3VQP A;  2HBL A;  4H5T A;  1VRT A;  4O0I A;  5FPM A;  4YNQ A;  5AQM A;  3FZK A;  4JNE A;  5BR9 A;  3M8S A;  3D2F B;  3M8P A;  5IWA K;  3KIO A;  4W5R A;  4OPK A;  5AQF A;  4FYD A;  1A5V A;  3Q7C A;  1K8A O;  4DV5 K;  1D8Y A;  2Q0R A;  1TKD A;  5JLH A;  1IG9 A;  1QSY A;  1J5E K;  5I42 A;  1Q18 A;  4DTX A;  2HHS A;  3KLH A;  4GV6 A;  4O5B A;  4TSX A;  3OTO K;  4B1U B;  4B8A B;  2CGK A;  4AHC A;  4PKG A;  2QM1 A;  3G10 A;  4U7B A;  4DV3 K;  3AA3 A;  2GBZ A;  4J8F A;  1SZ2 A;  4LFC K;  3L6Q A;  4F9O A;  5C42 A;  4QS9 A;  4EP4 A;  3THY B;  1X9W A;  1W7A A;  4DUZ K;  4ZTF A;  1WSJ A;  3EE9 A;  3ZSO A;  4JS5 A;  1GLJ O;  2H3G X;  4JK8 A;  4E3S A;  3THV A;  2CGJ A;  3NMU A;  3H6E A;  3WXI A;  3C95 A;  4JI6 K;  3LAL A;  4DG1 A;  3O08 A;  4WCE L;  4CEB A;  4KB0 A;  4LH5 A;  4Z94 A;  1RT7 A;  5KGW A;  3VEN A;  2YNI A;  1O13 A;  4CFD A;  1Q82 O;  1RBU A;  3O4W A;  4JKG B;  5KQ8 A;  3QBX A;  1JLC A;  1NGB A;  1S6P A;  2JWK A;  2HNZ A;  4NLC A;  4DTR A;  4LF4 K;  3R3L A;  5DK5 A;  3R6M A;  3TAM A;  2EWS A;  1XHX A;  5C2F A;  4DSE A;  1NK5 A;  1Z05 A;  3MEC A;  1TUY A;  1DTQ A;  4A59 A;  3RRH A;  3VEX A;  2IOC A;  3MDQ A;  1KD1 O;  1HPZ A;  1NJZ A;  2PY5 A;  1U2V A;  4NCA A;  5F0X A;  3DAW A;  3NF7 A;  5GAH P;  1S22 A;  2BUP A;  1D5A A;  4FWL A;  4H0X B;  4E7H A;  1RDW X;  4CZI A;  1NJX A;  2X6S A;  4WQ4 A;  3RMB A;  1SKW A;  2HMI A;  3E9O A;  3ZET B;  3IG1 A;  2YJE A;  4OVL A;  3QIP A;  5FRM A;  4JI1 K;  3NVM A;  4C8N A;  1NK6 A;  4CZK A;  3ZX3 A;  2OTJ N;  2OYQ A;  4BRQ A;  1IH7 A;  2WFB A;  3C6U A;  4JKC A;  3P39 A;  4CEQ A;  2P9L B;  4FWO A;  4RG8 A;  4Z0U A;  3OYC A;  4BR0 A;  2J4R A;  3KLG A;  5CZ1 A;  4DFJ A;  3DI6 A;  4KAZ A;  2HBJ A;  3K5N A;  4FWN A;  1VSK A;  3ZT1 A;  1JLE A;  3ALY A;  3O4N A;  3LPU A;  3QEI A;  4JI5 K;  5ELZ A;  4M3T A;  1JL1 A;  3OS1 A;  3DOL A;  4CJW A;  5AZI B;  4DFM A;  1LAW A;  4DV6 K;  4CES A;  2E88 A;  4JD2 A;  2FF3 B;  1H1V A;  1MWM A;  3C7N B;  4YFU A;  3KK7 A;  3HL8 A;  4KH5 A;  3HSC A;  4BWM A;  3LAK A;  4BR2 A;  4JI3 K;  4KI6 A;  4FLX A;  3T69 A;  1B9F A;  4DHY A;  4O0J A;  5A2Q O;  2YX6 A;  4OJR A;  2ZD1 A;  2DY4 A;  1KXP A;  5HRN A;  1VQK N;  3EN9 A;  2UYT A;  4M7X A;  3RR8 A;  1JJ2 M;  2KZZ A;  1BCM A;  5J2Q A;  1GOC A;  4M45 A;  4BDY A;  4B9V A;  3T1H K;  4EAH D;  3LWL A;  4CJS A;  3CXC M;  4FW2 A;  1YTA A;  3DWL A;  3CPW M;  4XH1 A;  3TAR A;  4BE2 A;  3HTV A;  4KHN A;  4IBN A;  3D2F A;  3ENH A;  4ID1 A;  2W40 A;  3P38 A;  2A5X A;  4QAG A;  3H1Q A;  3PX4 A;  1HNW K;  3K0S A;  1RT2 A;  3AO1 A;  4AH9 A;  1OH7 A;  3T3F A;  3QET A;  3KTQ A;  4LF5 K;  3NH1 A;  4B1Y B;  1SL1 A;  4CHQ A;  1U45 A;  3ZSW A;  3P83 D;  4C8L A;  5JS1 A;  4BG8 A;  3EZW A;  2NRR A;  3K2P A;  4FSV A;  5GAG P;  4IFY A;  4CF9 A;  2PFU A;  2KFZ A;  2WBN A;  1S1W A;  3OW2 M;  5AQY A;  3ZYY X;  1BG3 A;  4GVM A;  1NG9 A;  1SQK A;  1JKH A;  5BPL A;  1CZB A;  3A8Y A;  3THY A;  4JKD A;  4FLT A;  1TGO A;  1UWB A;  3PV8 A;  4HCB A;  1U04 A;  4JHD B;  4CER A;  4W5N A;  3VQ7 A;  4KPY A;  4KFB A;  2LSN A;  2HHX A;  3WQT A;  3LPT A;  1VQN N;  3IAY A;  4OKK A;  5HOO A;  2YHB A;  2QXF A;  3JS6 A;  3ZSX A;  2RPI A;  3OY9 A;  2D0B A;  2P1J A;  4JLH A;  4HTU A;  3SUP A;  4M3W A;  4DF8 A;  1RTD A;  4C1N I;  5FPD A;  2P9U B;  4JKG A;  1MDU B;  4CJQ A;  1VSL A;  2DFE A;  2QXL A;  5LJW A;  2HOE A;  3O9R A;  3AO3 A;  1KC8 O;  1RT4 A;  1ATR A;  4DTS A;  2O4G A;  3NF8 A;  1QVG M;  2QI2 A;  2V7Z A;  5GAE P;  3V9W A;  3OYN A;  1E3M A;  3OYL A;  3R8E A;  3TAP A;  4DSF A;  4FZX C;  4CZF A;  4FJ5 A;  4OPH A;  4RW9 A;  3KZB A;  3SQ1 A;  1RDB A;  1BQN A;  4FPA A;  2RF2 A;  1WAF A;  2W6L A;  4B9Q A;  3T1A A;  3UKR B;  5KPR A;  4IFV A;  3AVL A;  3BGR A;  4B9S A;  3TSQ A;  4EIA A;  3L2Q A;  2A3Z A;  3TSP A;  3OS2 A;  1Q7Y O;  3ENO A;  4B9U A;  4O8K A;  2GX9 A;  5AQN A;  1LWE A;  4DV2 K;  4GV3 A;  4YOT A;  4M3U A;  1CZ9 A;  3WT0 A;  3OBY A;  3MCP A;  5ADX H;  4RW6 A;  4CF0 A;  1KTQ A;  4FW1 A;  3SJH A;  3GE1 A;  1MA9 B;  3C6A A;  3ZET A;  1L3S A;  3QER A;  5JVG L;  3VEY A;  4KTW A;  3CPE A;  4WQ4 C;  4DR1 K;  3SLC A;  1ZYQ A;  4IXC A;  4WF9 L;  4F3O A;  4KV8 A;  2P9L A;  3A5L C;  5IT9 O;  2P9I B;  1VAZ A;  4PY5 A;  1IBK K;  4FK2 A;  3KLI A;  4CEF A;  1OVQ A;  3HYF A;  3CFO A;  2IVN A;  4E7L A;  3V1R A;  5BRD A;  3F73 A;  3M1F A;  1WUA A;  2O8F B;  2DTU A;  3MXJ A;  4CJ3 A;  1DLO A;  4HCC A;  1QQN A;  3C65 A;  3GDQ A;  3THW B;  4IOA L;  1RIL A;  1HR0 K;  1WSF A;  4X62 K;  5AZI A;  5HRR A;  1F21 A;  3O1B A;  3VGM A;  1HYV A;  2FSK A;  5AQT A;  2P9K B;  1XWL A;  2GEM A;  2YKM A;  2JWL A;  3C6H A;  3C7N A;  4E1J A;  4DQP A;  1VSI A;  3SUN A;  1NJY A;  1VQ4 N;  2ZJR L;  2A1S A;  2VQE K;  1C0M A;  3VGK A;  5BPM A;  1Z25 A;  1YUW A;  3KWI A;  1ATS A;  1C0F A;  1LW0 A;  1T3V A;  1KFS A;  1OKJ A;  3E66 A;  5AQQ A;  3ZEU B;  4CEA A;  1YVN A;  5AQV A;  5H1S Q;  3V1Q A;  2HVI A;  4BQL A;  3DRS A;  3ZSR A;  3R9P A;  4JRQ A;  2E6L A;  4FJJ A;  1NK4 A;  4K42 A;  3SK3 A;  2UU9 K;  3IS9 A;  5JVH L;  3RMC A;  4DTM A;  3VA0 A;  2WC9 A;  4BC3 A;  4BQZ A;  3FZM A;  2AA4 A;  3LP3 A;  2A1R A;  2YI1 A;  4MQ3 A;  2G8I A;  3JXU A;  3SBG A;  3O3H A;  2OZS A;  2GV9 A;  3NHG A;  1QQM A;  4Y0W A;  5CYM A;  4JKA A;  1NGD A;  3HOS A;  1S1V A;  3MN6 A;  4L3Q A;  3LDQ A;  4DQI A;  3TTD A;  4O44 A;  4CJL A;  4XEI A;  3HJF A;  4DSK A;  4FJH A;  1XMQ K;  2ZWH A;  2W42 A;  3NCI A;  5BRH A;  1GLL O;  2NRW A;  1WB9 A;  3QDK A;  4EHU A;  4L8R B;  1HYS A;  1HX1 A;  2EX3 A;  5M1P A;  2I7N A;  4H5R A;  5M1N A;  4BC2 A;  1DKG D;  1FXX A;  3S41 A;  1SKS A;  4RW7 A;  4K41 A;  4CJK A;  5AQH A;  2ZJP L;  2D0O A;  2FSN A;  4JHD A;  3CCQ N;  3D0P A;  2G8H A;  3Q7B A;  1RTH A;  4CE9 A;  1ATN A;  4BRE A;  4Z4H A;  4FJG A;  4YOV A;  4CK2 A;  1C1A A;  2O8D A;  4CF2 A;  4OPJ A;  2BDP A;  4DCH A;  4JKB A;  3WNG A;  2IDO A;  1TYQ A;  3PO4 A;  4OPA A;  4K8Z A;  3L3V A;  3L4Q A;  2PYL A;  4FJ8 A;  4Q0B A;  4WFB L;  1ZBS A;  3NH2 A;  1VQ6 N;  3NVK A;  3G6E N;  2NZT A;  3L2V A;  2HHU A;  4N5S A;  4G1Q A;  3OYD A;  2UUB K;  3IRX A;  2G8W A;  2P9U A;  2D0P A;  1Z6R A;  3AO5 A;  1NJW A;  3SMS A;  4CJU A;  2NNW A;  3OHR A;  1HKG A;  4HUF A;  3HVR A;  3U6F A;  3IFR A;  3CFR A;  3NF9 A;  3GL1 A;  4YOY A;  2VCP A;  2P5G A;  4BR4 A;  1OH5 A;  4DQQ A;  1B9D A;  1BA1 A;  1X9J A;  3M5R A;  1JXB A;  4DFK A;  4Z4F A;  2P9N B;  2F9T A;  3U9Z A;  4CZE A;  3FLC O;  3WXM B;  2IVO A;  4A2A A;  5AZJ B;  4RCH A;  1YJ9 N;  2GUI A;  4LF6 K;  4O4G A;  3O3G A;  5JIC A;  4DR6 K;  2E1Y A;  3BUZ B;  3ID6 A;  3C94 A;  1DT9 A;  5DM6 L;  1C0G A;  1E4G T;  4CD3 A;  2B6A A;  1P90 A;  1N33 K;  1JCG A;  4CJF A;  3CCR N;  1I39 A;  4BRM A;  2HHW A;  4J2E A;  3O6W A;  4KBO A;  5AQR A;  4E7K A;  1EET A;  1GLE G;  1J53 A;  5AQG A;  4C8K A;  4M41 A;  2E20 A;  4BR7 A;  3TAF A;  1UA1 A;  3A2F A;  1U48 A;  4IEE A;  3S9H A;  3MEE A;  4FWM A;  2KFN A;  1LCU A;  4RTF D;  2P9I A;  3RSE B;  1ZBL A;  4H5W A;  4CJR A;  2ASO A;  4CIE A;  5BN8 A;  4IDH A;  1N5Y A;  4OGE A;  3OYE A;  2ZGZ A;  3A5N C;  2O8F A;  4CGD A;  1WAJ A;  5ADX A;  3H3O B;  4X64 K;  5CE3 A;  3THW A;  1BWF O;  3H45 C;  1A5W A;  4BE0 A;  3HPG A;  3NH0 A;  3CD6 N;  1SUQ A;  1V4S A;  1CXQ A;  1NBW A;  2Q2R A;  4IO8 A;  5EY4 A;  1TUU A;  2YHA A;  4ZTJ A;  3VTI A;  2P9P B;  3UE5 A;  3OYA A;  4IOC L;  2YCH A;  4E89 A;  4FL9 A;  3V1O A;  2F9W A;  3ZEU A;  4AIL C;  4KHP K;  5AQX A;  3NGY A;  3C6T A;  3J80 O;  1SAZ A;  3FE1 A;  4Y1D A;  5CZ2 A;  3SUO A;  2AP1 A;  2ASM A;  5C2D A;  2FBT A;  3V9U A;  3K9J A;  4MDB A;  4DS4 A;  2Z1I A;  1KAY A;  5FLX O;  1S5J A;  3G4S N;  1L3V A;  3G71 N;  1X3M A;  2YKN A;  5C10 A;  2O8E B;  4KB1 A;  3EYZ A;  3ID8 A;  4NXN K;  2UXB K;  4NLB A;  2XY7 A;  4I2P A;  1UOC A;  4CEZ A;  3HST B;  4GNI A;  1S6Q A;  1Q86 O;  4B3O A;  4I6M B;  3THX B;  2XY5 A;  5M1F A;  3QIN A;  3VQ8 A;  3J7Z O;  1TL3 A;  1KLM A;  4R79 A;  5C0Y A;  1BU6 O;  5DM7 L;  3M8R A;  3WUH A;  3KKR A;  3BZC A;  1IKW A;  4JK9 A;  4DU1 A;  3TAB A;  2NRH A;  5HP1 A;  1BI4 B;  4BRF A;  2P51 A;  3SAG A;  1N36 K;  3ATV A;  5LMU K;  5BRF A;  4GW6 A;  5BRE A;  3TR8 A;  3U9D A;  1JLG A;  1WOQ A;  3GOI A;  3O3F A;  3M6G A;  4R5P A;  3KLE A;  4YOW A;  3R1X A;  1HNV A;  5D3G A;  2VWJ A;  2HND A;  1KCF A;  2B5J A;  4IG0 A;  4CGG A;  5J2M A;  3N4Q A;  4EZ6 A;  2V7Y A;  4FM2 A;  2UXC K;  3KKS A;  2P9S B;  2AJQ A;  3VN5 A;  3DLE A;  4AHR A;  1C6V A;  1IBM K;  1K6Y A;  4GMJ B;  3B6O A;  4AHS A;  4EZ9 A;  3WEE A;  1QHA A;  3TTF A;  2GUP A;  4RW8 A;  3LL3 A;  4FJK A;  2VGM A;  1XNQ K;  4BAC A;  1YHQ N;  4H8K A;  4DU4 A;  3MX5 A;  4E7J A;  3DRR A;  4MO4 A;  1NM1 A;  3CQ8 A;  1C1C A;  5KPT A;  5JS2 A;  3K58 A;  3W0L A;  1Y97 A;  4CBW A;  2P9N A;  1G99 A;  1FKO A;  1YJW N;  3RRG A;  5AZJ A;  1NK7 A;  3QES A;  3ZX0 A;  2D4W A;  1WSH A;  1VSF A;  4IEI A;  2BH1 A;  4A62 A;  5HRP A;  1Q81 O;  1E4F T;  1RFQ A;  1YIJ N;  2UXD K;  2ZF5 O;  2ATQ A;  4H0P A;  1ZBU A;  1T03 A;  2OTL N;  4ELU A;  4DU3 A;  1JL2 A;  1W2B M;  3LP0 A;  5EXW A;  3CJC A;  2Q3S A;  1RT1 A;  4JI8 K;  3AGR A;  5K14 A;  3V9X A;  4KO0 A;  1D9D A;  2IC3 A;  3RSE A;  1BIS A;  1L5U A;  2VGN A;  4OGC A;  1NGH A;  4LH4 A;  2VG6 A;  5AR0 A;  4LF8 K;  3RTV A;  1LAV A;  3CJB A;  4BGB A;  2KQ2 A;  3CCE N;  4M63 C;  1BUP A;  1BL3 A;  2KHO A;  4B1X B;  3KWG A;  3D45 A;  3UB5 A;  3M3Z A;  4KTZ A;  4CEO A;  1S72 N;  1K73 O;  4DV7 K;  1QSL A;  3K59 A;  4H5N A;  3CM5 A;  3O9Q A;  1HJR A;  3BY5 A;  1NK9 A;  2P9P A;  3AAQ A;  3DYA A;  4LF9 K;  3V9Z A;  5TKY A;  4OKE A;  1RNH A;  4KH6 A;  2VQF K;  1VSJ A;  4CD1 A;  1BO5 O;  1TK0 A;  3SZ2 A;  2QKK A;  2KLA A;  4KHY A;  3DLB A;  5M1K A;  1N8R O;  4FO0 A;  4IDK A;  4BR9 A;  4PL8 A;  3DOK A;  3U3Y A;  4CF8 A;  2HNY A;  4DWI A;  3CM6 A;  1ZBH A;  1JLB A;  3RVC A;  1DEJ A;  3SCX A;  3AVK A;  2QWL A;  4I6M A;  3THX A;  2FXU A;  5I3U A;  1RCH A;  1U47 A;  1GLB G;  4F8R A;  4DTJ A;  4KTQ A;  4GVE A;  4CK1 A;  4M3Z A;  4M7Y A;  2FF6 A;  1GLD G;  4B9M A;  1I3A A;  1BI4 A;  3G0Z A;  2GWK A;  3TPQ A;  4IOX A;  1YTU A;  2HVH A;  2E2O A;  3PY8 A;  3CHW A;  1J54 A;  1NMN A;  4Y1C A;  4O8U A;  5AQP A;  4BY9 C;  1NJI O;  3NDK A;  1QHT A;  3LWM A;  4DTP A;  3CCU N;  3G25 A;  1HNX K;  4FJI A;  1NKB A;  4YOX A;  4CIF A;  3U4L A;  2P9S A;  4F2R A;  2X6N A;  4AHT A;  3H3N O;  3ZLJ A;  4FVU A;  3VEW A;  3AA5 X;  5AQJ A;  2FSJ A;  4A61 A;  2E4L A;  5CHI A;  4H0V B;  4BC4 A;  3T1Y K;  2YJF A;  3OBW A;  4CJ7 A;  1VSE A;  3K5M A;  4YOR A;  2I5J A;  1YVU A;  3QML A;  4DTU A;  4RW4 A;  2HF4 A;  3HP6 A;  4KRE A;  4IKF A;  3L2U A;  4JS4 A;  5LL6 Z;  4QS7 A;  3PIO L;  4HUG A;  4LFA K;  1NLV A;  3MN7 A;  1QZ5 A;  4FLV A;  2NRZ A;  2OZM A;  4ELV A;  4PA1 A;  3HVT A;  1SL2 A;  1QQC A;  2E2P A;  1BIZ A;  3NE6 A;  1YIT N;  3L4I A;  4JI0 K;  1QS4 A;  3B8A X;  3QEV A;  3V81 A;  1CXU A;  1RGI A;  1DGK N;  3NF6 A;  3UKU B;  1KAX A;  5M1Q A;  1IBL K;  3OYJ A;  1IV0 A;  4N47 A;  3VQ4 A;  4N76 A;  4LSN A;  4DB3 A;  3EKU A;  1KLN A;  3O1W A;  1BDG A;  4OO1 J;  5SWM A;  3CJ7 A;  4XH4 A;  1J6Z A;  1EWQ A;  3UIQ A;  3QIO A;  4CHZ A;  3AVM A;  4CBU A;  1NGF A;  3LM2 A;  3A5M C;  2F96 A;  4G9Z A;  4A2B A;  3CFP A;  1VQL N;  2G8U A;  3ISN C;  5LJV A;  3EO3 A;  4XIU A;  3MED A;  2GWJ A;  4DQS A;  1XQS C;  5GIP A;  4PKI A;  4CGF A;  2ZGY A;  1VQM N;  3VQD A;  5AQS A;  3H08 A;  2Y1J A;  1ASU A;  2IS3 A;  3OYB A;  1SV5 A;  4E1M A;  3ZT4 A;  4MDA A;  3MN5 A;  3AO4 A;  2Z1H A;  3VET A;  1RT5 A;  5GIO A;  2O8E A;  4UY8 O;  1HYZ A;  5HL7 L;  3O4Q A;  3CER A;  3HBT A;  2X78 A;  1EX4 A;  1NGE A;  1WNS A;  3TAN A;  1HRH A;  3VQA A;  1MWK A;  2A42 A;  1M1K O;  1S3X A;  3VQQ A;  3PO5 A;  4ILJ A;  4F4K A;  5FPE A;  3PX0 A;  1W0H A;  3OYM A;  4DSL A;  4B8C A;  4FWQ A;  3ZT2 A;  4IWV A;  1WBB A;  3AAP A;  4QS8 A;  3PIP L;  2JLE A;  3CCS N;  1KQS M;  4FJ7 A;  2Q31 A;  3DMJ A;  4K8X A;  1EP4 A;  3AA2 A;  5M1O A;  4K25 A;  5F2R A;  3KD1 E;  4JI4 K;  3CCV N;  3SAH A;  4B3M K;  4H5V A;  1RTJ A;  3AVA A;  2O8B B;  3WXL A;  3K57 A;  3VER A;  1S1T A;  4NCG A;  1A5X A;  2GTD A;  5AQZ A;  1BHL A;  5I9E B;  2V52 B;  5FRO A;  2QKB A;  4CZG A;  3IUC A;  5C25 A;  5KQD A;  3LAM A;  4WE1 A;  3OS0 A;  4KHS A;  1QQO A;  4BE1 A;  5FRN A;  3LDP A;  1V4T A;  4CIG A;  3SJJ A;  2PZS A;  2QWR A;  3ZSY A;  1K8K B;  3OJU A;  3QNO A;  3CC4 N;  2HBK A;  4YHH K;  3H46 O;  3ASM A;  4HHT A;  5T7B A;  1X9S A;  1NGC A;  3O9U A;  4BVO A;  3U3G A;  1KRP A;  2V51 B;  4LSL A;  4FWP A;  1JLF A;  1S1U A;  2FLO A;  3WXK A;  1T44 A;  1J5O A;  3MAQ A;  1WBD A;  1VQ7 N;  4B1W B;  1ILY A;  4BRH A;  1RDA A;  3ZSZ A;  4DLE A;  2Z1G A;  3S3N A;  4KRF A;  1TVR A;  1LWC A;  2UUA K;  3DLK A;  3PSF A;  4V19 S;  2RKI A;  4EP5 A;  3CG7 A;  1R59 O;  1D4X A;  4BRO A;  3FFI A;  1XC9 A;  3HT3 A;  4O55 A;  5BPN A;  5AQI A;  1HMV A;  4DR5 K;  4OKJ A;  4JKH A;  2W41 A;  2QW9 A;  3UKR A;  1HNI A;  2BE2 A;  1T6D A;  4BC5 A;  4CEE A;  2W6K A;  3LDN A;  2XY8 A;  2VYP A;  3I8D A;  3PSI A;  4F2S A;  4BG9 A;  2DFF A;  2IVP A;  5LY3 A;  1XMO K;  4CHN A;  3AAR A;  1S1X A;  1W97 L;  4PKH A;  3CCM N;  1QVF M;  4AM6 A;  1O1W A;  2QWO A;  4W5O A;  1YT3 A;  3LM9 A;  3VQE A;  4B9T A;  3UKU A;  5KGX A;  3LZJ A;  1TK8 A;  3QB0 A;  3VEV A;  1LOT B;  2OPP A;  1T6C A;  2A40 A;  3E01 A;  3MN9 A;  1ZBI A;  3O9T A;  3BF3 A;  3ATU A;  3ZCM A;  3TU5 A;  3BDP A;  1C0T A;  1L3T A;  5HBM A;  2YHW A;  4DR4 K;  1IKX A;  4CFC A;  1VRU A;  3C0B A;  3KVG A;  2QWP A;  3I0R A;  4CEC A;  3L2R A;  3KD5 E;  4FJN A;  2GEL A;  1EXQ A;  3O9S A;  5AQK A;  2P9K A;  1N32 K;  3ZT0 A;  3W3D A;  4FWK A;  2F7T A;  2VWK A;  4CZM A;  3F9K A;  1NOZ A;  3ZX2 A;  1HUX A;  2D1K A;  2DPN A;  3LDO A;  3P1G A;  4BDZ A;  1YI2 N;  2BGG A;  1IJJ A;  3TTC A;  5E26 A;  4B1Z A;  3SAF A;  1NGG A;  3V9S A;  3SUQ A;  3SYZ A;  3VGL A;  1GLF O;  3J7Y P;  1LV5 A;  2ZQB A;  1I94 K;  4FLZ A;  3QIC A;  4CK3 A;  4IO9 L;  3NGI A;  2XHB A;  3F2K A;  3MXI A;  1X1P A;  3FGU A;  4DUY K;  3KK2 A;  3CET A;  2IAJ A;  2OCE A;  2F8T A;  5DMR A;  3J81 O;  1BCO A;  2YNF A;  2G8K A;  1NU0 A;  3SPY A;  4HTL A;  1HQE A;  1B92 A;  3RMD A;  5TKW A;  1BQM A;  3DLG A;  4X65 K;  4C8O A;  2IIR A;  3SPZ A;  1QSS A;  3FFK B;  1YJN N;  4FPB A;  1EO1 A;  3HM9 A;  4PWD A;  3RR7 A;  2WUS A;  5C15 A;  1WSE A;  3S3O A;  5MLC Q;  4CGI A;  4HVJ A;  3LDL A;  1SL0 A;  1BIU A;  3L3U A;  2VWB A;  2X74 A;  5GIN A;  3ENB A;  5HRS A;  3OJS A;  4CCH A;  1OVY A;  1T7P A;  1IO2 A;  1FK9 A;  2O8B A;  1ESV A;  2VG7 A;  4N56 A;  5EOY A;  3MWP A;  4EHT A;  4JEP A;  2RN2 A;  2QWQ A;  1C1B A;  4KHW A;  1OH6 A;  3OYF A;  1R0A A;  1L3U A;  4QOZ B;  4FJX A;  4FJM A;  4BRA A;  1TK5 A;  4I9L A;  3MCA B;  4E7I A;  1NGA A;  3I33 A;  3DLH A;  4MLH A;  4JI7 K;  1K8K A;  1TAU A;  2HB5 A;  3PX6 A;  3T7Z A;  4JK7 A;  4M3X A;  2HHT A;  3HPO A;  1XC3 A;  4BRK A;  4CHY A;  3AA4 A;  4LC9 B;  1KVA A;  1J9A A;  4AHV A;  3MWT A;  4IZ9 A;  1TAQ A;  1IKV A;  4GV9 A;  4OLA A;  1SS6 A;  3QBW A;  4Q5V A;  2E2N A;  1BGX T;  3JSM A;  3CIP A; 
#chains in the Genus database with same CATH homology
 4JI3 K;  3J7A P;  2UU9 K;  4JI6 K;  4LF6 K;  4DR6 K;  5A2Q O;  4X66 K;  2F4V K;  3J7Y P;  1I94 K;  1N33 K;  4JI8 K;  4GKK K;  4DUY K;  4AQY K;  3T1H K;  3J81 O;  4OX9 K;  1HNX K;  2UUA K;  4V19 S;  4DV0 K;  4LF8 K;  4LF4 K;  1N34 K;  1N36 K;  4YY3 K;  4GKJ K;  5LMU K;  1XMQ K;  4DR5 K;  4X65 K;  5BR8 K;  1HNZ K;  4DV2 K;  1XNR K;  1HNW K;  4DR7 K;  4NXM K;  3T1Y K;  4LF5 K;  4LFB K;  3JAM O;  4DV7 K;  4JI2 K;  2UXC K;  4DR1 K;  1XMO K;  4X64 K;  4JV5 K;  5IWA K;  4LF9 K;  5LL6 Z;  2ZM6 K;  5IT9 O;  1IBM K;  1IBK K;  4DV5 K;  4DV1 K;  2VQF K;  4LFA K;  4DR3 K;  4CVN E;  1J5E K;  1FJG K;  4JI1 K;  5LMN K;  3OTO K;  4JI4 K;  1XNQ K;  4LF7 K;  1HR0 K;  2E5L K;  4X62 K;  4B3M K;  4JI0 K;  4DR4 K;  4KHP K;  2UUB K;  4DV3 K;  4JI7 K;  3J80 O;  4K0K K;  4LFC K;  4B3R K;  2HHH K;  1IBL K;  1N32 K;  2VQE K;  4JYA K;  4JI5 K;  4DUZ K;  4DR2 K;  2UUC K;  4DV4 K;  4DV6 K;  5FLX O;  4B3S K;  4B3T K;  5AJ3 K;  2UXD K;  4NXN K;  2UXB K;  4YHH K;  4CW7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...