4JI0K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji0K00
4YY3K 4CVNE 3OTOK 5LMNK 4DV2K 3J7AP 4JV5K 4DV5K 4JI6K 5LL6Z 2E5LK 1IBKK 1XMQK 4DV1K 3T1HK 4DR3K 4LF5K 4X62K 4CW7B 1XNQK 1HNWK 4OX9K 3JAMO 4DR6K 4NXNK 4GKKK 5AJ3K 4DR1K 3T1YK 4LF9K 5IWAK 4NXMK 5A2QO 2UXBK 1HNZK 4LFAK 4DUYK 1XMOK 1IBMK 4DV6K 4B3RK 4DR5K 4LFBK 4X66K 1HNXK 4JI3K 2UUAK 4DV4K 3J81O 2UUCK 2UUBK 2F4VK 4JI2K 4JI5K 4DV7K 4JI7K 4GKJK 1N34K 4LF7K 2VQFK 3J80O 4KHPK 4DV0K 3J7YP 5FLXO 4JYAK 1N36K 1HR0K 4YHHK 4X65K 4DUZK 4B3TK 2VQEK 1IBLK 2UU9K 2UXCK 5BR8K 5IT9O 4LF4K 4K0KK 4JI1K 1XNRK 2ZM6K 4DR4K 4DR2K 5LMUK 4LF8K 4DV3K 4AQYK 4DR7K 4LF6K 4B3MK 4V19S 4B3SK 1FJGK 1N32K 4JI0K 4LFCK 1J5EK 2HHHK 4JI8K 4X64K 1N33K 1I94K 4JI4K 2UXDK
chains in the Genus database with same CATH superfamily
5C10A 3QEWA 3SQ2A 4DTPA 4C1NK 1NLVA 1S72N 1SQKA 2O8EA 4CJWA 3KK2A 4FJJA 5AQIA 4EAHD 2HBKA 2F9TA 2AA4A 1WLJA 4I2PA 5BRFA 1IBKK 3VQDA 1XMQK 4KHYA 3PIOL 1NBWA 3HI0A 3THXA 3AVCA 4JRQA 4HTUA 4CE9A 2WTUA 4RW6A 4FLZA 1JCFA 1N8RO 2X6SA 1RDUA 2W6LA 5BRHA 1DTQA 3MMVA 5J2MA 1YJNN 4E7HA 5AQPA 4CJLA 3AV9A 3A5MC 2RPIA 5JMVA 4I9QA 3O3GA 4DUYK 1VQMN 3V6DA 1ZBUA 4KRFA 4OLAA 3CFRA 2KZMA 3L2UA 3OYNA 1YT3A 4EIAA 4B8AB 4FJ5A 5GIOA 3A0IX 4JHDB 3QICA 4JI2K 4EZ6A 3OS0A 1JLGA 4LH5A 4FJXA 3D2EA 3AVBA 4E89A 5C2FA 4ISGA 3KTQA 1VSHA 3SMPA 4DTMA 4PWDA 2YI1A 3I56N 1S3XA 4DQQA 3U8XA 2WFBA 1LW0A 3K5NA 3HT3A 4B3OA 3UKRA 3CMEN 2XY8A 3VN5A 3KIOA 5I3UA 3EKUA 3C6AA 4HUGA 4BRMA 2Z1GA 3CXCM 1JLQA 3B8AX 3OYIA 4IO9L 3CERA 3ENHA 3SUQA 4O4GA 4CZGA 2EX3A 2F8SA 4BE2A 1HKGA 4NB4A 3G10A 4MDAA 3PX4A 3CI5A 1BU6O 4IOCL 5HBMA 4CK2A 3DM2A 2VG5A 3BZKA 3ZT3A 3K59A 3SJJA 3RR7A 5DK5A 3LM2A 4Z4GA 2LSNA 3A5NC 1NGCA 1WAJA 1NMDA 2DFHA 2V7ZA 3K5OA 4CJEA 1IKVA 4IFVA 1TKDA 3OHRA 1KFSA 2E6LA 1TYQB 2D0OA 2GX9A 2F96A 2HSTA 3WUHA 4BRAA 5BPLA 5AR0A 2P9LA 1JKHA 1Q86O 1XHXA 2BUPA 4CHPA 4O5BA 3EEQA 4DSKA 4M63C 4H0VB 1R59O 3KWIA 4DQRA 4DR3K 4LF5K 4FK4A 3NF6A 5CY4A 1YJWN 1C6VA 5JLFA 1VAZA 3L3UA 3CHWA 4WQ5A 3QNNA 4PKIA 3GL1A 1VSLA 4C8NA 5HRPA 4JLHA 2G8FA 3HJFA 3WT0A 3SJHA 3ZETA 1EXQA 4B3RK 2FBYA 1T05A 2VG6A 2UUAK 3ASMA 1BISA 4JK7A 4K25A 2ITGA 2OPPA 3KK7A 2OYQA 5KTQA 3PO4A 3I0RA 4CCHA 4CJSA 3LDQA 1DGKN 4OJRA 5CE3A 3W3DA 3VQ4A 1WN7A 5C2DA 4OLBA 5GIPA 2OTLN 1U6ZA 1D9DA 4B1VA 1NGFA 3EO3A 4BC5A 1EP4A 3V1QA 4G9ZA 3CFPA 4H4OA 1S1XA 1N36K 4AHVA 1TAQA 4B3TK 4M3XA 3LPTA 5SWMA 4DQPA 4FWRA 1TKZA 3NH1A 4Z0UA 4ILHA 2E2NA 4ISFA 1WBDA 4OO1J 4ISEA 4CGIA 5AQLA 1J9AA 2HBLA 2FF3B 2ASMA 3LAKA 4Q5VA 1MWKA 2YV0X 3MWPA 3DLBA 2IOCA 5AQFA 1SAZA 4E19A 3VGKA 4CJTA 4Z4HA 1BIUA 4KB0A 1Q82O 4IKFA 4DTXA 3CCLN 5FDLA 5I9EB 2UXDK 1HKCA 3UKUB 4B08A 3KKRA 4FK0A 3OTOK 3OBWA 3FZMA 3MN7A 3K5LA 1J54A 1RT6A 4BRFA 1SV5A 4DTRA 3D7EO 4BWJA 4AHUA 3CCQN 4HUFA 2YNHA 4AH9A 4EP5A 1SKSA 5KPZA 1GLBG 4CFBA 3TANA 3VPZA 4YDUC 4ELVA 1VQNN 3T1HK 3L4IA 3PX6A 1S9GA 4CZFA 1W7AA 3QEIA 1OH7A 3L4QA 2ZGZA 4QAGA 3ZETB 2YCHA 3UKUA 2I7PA 4HWIA 5HP1A 5AQQA 2YHWA 1LW2A 3T1YK 2QWPA 4QS7A 1B9DA 1D9FA 3DLLL 3AVLA 4GV9A 1NGEA 3L0QA 4YOYA 4E7JA 5A2QO 5HL7L 1XC9A 1C0GA 3VEWA 3SK3A 1T8EA 3CJ1A 1YAGA 5JLHA 4IBNA 1VHXA 3OYGA 3SZ2A 4MQ3A 4YOTA 3WNGA 2JWLA 4JD2B 3QERA 2HHTA 2AP1A 2E2OA 3HOTA 3SPYA 4DF8A 4O0IA 4C8KA 4CGFA 1GOAA 3V9ZA 1ATSA 3CJ9A 3ZSQA 4GV3A 3OS1A 1GOCA 3QIOA 4KHUA 2O8BB 1BI4A 3FLCO 4BREA 3S3OA 2HHVA 2UU9K 2UXCK 1BL3A 2QWNA 4E3SA 2DFFA 2P9KB 4YNQA 1Y97A 5GINA 1VQ9N 3CYMA 4KTWA 2PZSA 4FJIA 4DR2K 5LMUK 5J2QA 3VF2A 1OVYA 3IMXA 4CJVA 2NRZA 3VEOA 5KQDA 2HHWA 1OH8A 1IG8A 3A5LC 1YF5L 1KAXA 1QQMA 1NK4A 2Q97A 4IFYA 5GAEP 1N33K 5AQRA 3OYHA 3PSFA 3MEGA 4JKGB 1NNEA 4UY8O 1RDCA 5C42A 2O4IA 4ELTA 1Q9YA 3NF7A 2B5JA 2QWRA 1JL2A 1GLLO 4FVMA 3VEZA 2X6NA 3P4IA 3MN9A 4BRNA 5FPMA 1Q9XA 3RMCA 2O8FA 4CIFA 1XNQK 2VWJA 4MO4A 4JKCA 4OKJA 3KD5E 4CK1A 1I3AA 1VSDA 2QKKA 3MX5A 3EL2A 4KTQA 3HBTA 3ZSOA 4I2QA 4R5PA 3G71N 4ICLA 4BG8A 3O3FA 2UYTA 3O6WA 1C0FA 3KD1E 1RBUA 4LFBK 3WXMB 1TL1A 3LWLA 3OYAA 1J5OA 1VSJA 2VCPA 5AQHA 4CI6A 4KHNA 3FZFA 4CZHA 2UUBK 5KGXA 3V4IA 1KRPA 4CJRA 2XHBA 4M7XA 4FWQA 3OYBA 3E9OA 4JS5A 3AO4A 4FJHA 4DTNA 5KRTA 4OPAA 1NK6A 3LZJA 4JN4A 2VYPA 2BTFA 3PLAA 1GLFO 1X9SA 5JS1A 4YFUA 3EKSA 2V52B 2Y1IA 3LAMA 4GY2B 4M3UA 1IO2A 2YJFA 4LC9B 2PFUA 4H8KA 4E7IA 1LV5A 1KVCA 3IUCA 1FXXA 4KTZA 1EX4A 5DM7L 3L2RA 4LF4K 3QESA 1NGAA 4PUOA 3VQEA 3MN6A 4Y1CA 1YIJN 4G1QA 2NRHA 5AQYA 3I55N 3TAMA 3SAHA 4CEOA 3AARA 2Z1HA 1Q81O 4B3MK 1FKOA 4R79A 1S1TA 2NUBA 3I8DA 3NCIA 4CZIA 1VSKA 3TSQA 4QOZB 3O4WA 4KHSA 1XHZA 1GLDG 2P1JA 3RVCA 3KWGA 3RMDA 4JRPA 5I42A 3MEEA 2ZQBA 1DLOA 2FSNA 4YDUA 4BR7A 3VQ7A 5CHIA 1QQOA 2GWKA 4W5NA 1K8AO 1LWFA 1CZBA 5BRDA 4BRQA 1RTHA 4KKOA 3AGRA 3VF6A 4F2SA 4L8RB 2P9SA 3B6OA 2W41A 2CGKA 3WXIA 4LF9K 4FLTA 4RW9A 2YNIA 3ATVA 1A5VA 5IWAK 3CCSN 3GOIA 3QEXA 3ULEA 1ASWA 3HVRA 2DFEA 2OANA 4CF2A 5FRMA 1RILA 3ZX3A 3ZEUB 4YOVA 4CFAA 3H3OB 3ZX0A 3C6TA 4WFAL 1VRUA 5J2PA 1R0AA 4CGHA 3NFAA 2XY5A 1L3SA 1LOTB 1K8KA 2JGUA 2VQFK 3DLHA 4DSJA 4KBOA 1Z25A 4OKEA 4FL9A 3TAEA 3FFIA 2P9KA 1S5JA 3FZLA 1C1CA 3BDPA 3TAFA 1QE1A 1TVRA 5KGWA 1VSIA 1NGDA 1KXPA 4DS5A 4FZYA 3VOVA 1G99A 3T3FA 3O5BA 2QKBA 3EN9A 3FFKB 3ENBA 3NH2A 4DV3K 1UA1A 4NCAA 4ZHRA 2HF4A 1KAYA 3G6EN 3PUFA 3DAWA 1BCMA 4JNEA 4BR9A 3HSCA 2HHHK 3SLCA 4OGEA 1JCEA 1SL0A 5E26A 2FBVA 2A1RA 2QWLA 3DLRA 2P9UA 4H0OA 5BPNA 3MN5A 1X1PA 4XH4A 4DQSA 4YY3K 2YHYA 5LMNK 5C24A 3J7AP 3DXMA 1ATNA 4HCBA 2IIRA 1W2BM 3CCEN 4JI6K 4DKWA 4DLEA 5LL6Z 1Q8IA 3NVKA 3MK6A 4E0DA 2D1KA 4Y0WA 3R3LA 2W40A 4CBWA 4IG0A 3ZSXA 3NGIA 1L3TA 3SI6A 5ADXH 4CHZA 3LL3A 1BUPA 4YOUA 1OH5A 4DB3A 3OS2A 1RGIA 3A8YA 1CZ9A 1HPMA 2HHXA 4WQ4C 2VWKA 2BE2A 5HLFA 2HVHA 2Q36A 2D0BA 4BE1A 1EO1A 3DMJA 3HPOA 3CPWM 1RTJA 3OJSA 4BQZA 1WUAA 4CJ5A 4PA1A 3QFUA 1KLMA 2DPNA 4FJNA 4CEEA 5TKWA 2NRTA 3CC4N 1ESVA 3HSTB 4IOXA 1RT4A 4CHOA 3U9ZA 2NLXA 2P9SB 1RDAA 3UIQA 2HHUA 1NGIA 2CGLA 3HM9A 1MDUB 2P9NA 2QXLA 1BI4B 1NJXA 1BA0A 4DV0K 3KLGA 3V9WA 2BH1A 3J7YP 4FOIA 1NGJA 1QSYA 4BRIA 5M1PA 4B9UA 4FZZA 1RBSA 2KTQA 3DLGA 3MCPA 2Q3SA 3P39A 5CYMA 4BWMA 4RWTA 4DR4K 4DLGA 1GLEG 4DU4A 2D4WA 3G25A 1YITN 4M3TA 3OYJA 3ID6A 2IVOA 3I8BA 4V19S 3DI6A 3O8MA 4OKKA 4CEAA 4KH4A 1SS6A 3VETA 1WSFA 3IAYA 3O9UA 1J5EK 3QB0A 4KB1A 4MO5A 3HZ6A 2WOMA 4Z4CA 1IKXA 1TK0A 2B6AA 3CPEA 4DV2K 1X3NA 1NJYA 2EHGA 5HRSA 3S9HA 1C1BA 3RR8A 3HYFA 4CEFA 1YJ9N 5C0YA 1YTAA 4W5OA 2Q2RA 1HYZA 4FJKA 3PIPL 4BRGA 1RFQA 3KLHA 2FXUA 2P9IB 1KAZA 1ZBLA 3RTVA 4KI4A 4IZ9A 4KHWA 1TKXA 5AJ3K 1K6YA 4AF1A 2ZD1A 4BACA 2HB5A 4CERA 3P31A 4F9OA 3F2KA 3G4SN 4FWMA 3F9MA 4Q0BA 4IFEA 1NK0A 3P5JA 3ZSZA 1HNZK 3H1VX 4IWVA 3KHYA 1TUUA 3HPGA 4NYFA 5EVZA 2XRIA 4JKHA 4X66K 3K58A 3ZSRA 4J2EA 4MFBA 2UUCK 3SQ0A 2PY5A 1JXBA 5FROA 4BVPA 5F0XA 3J80O 1NK7A 3R1XA 1JL1A 2O8FB 4O8KA 3L8BA 2R7YA 3OBYA 3IFRA 2A3ZA 3KLFA 2O8EB 3LPUA 3AVHA 5LJVA 3SQ1A 1D4XA 4DS4A 3OYEA 3SUOA 3BF3A 1SZ2A 2V51B 2FSKA 2E20A 3D2FA 1X9JA 4CD1A 3AO3A 2P5OA 4QS8A 1CXUA 2ZM6K 4XH5A 2GELA 4AHCA 3PO5A 3VERA 4WE1A 4B1YB 3U9DA 5E84A 4LF6K 4JK9A 3ZT0A 4NO7A 1EETA 4YOWA 4F4KA 1ZBFA 4LFCK 4FWSA 2X74A 3L6QA 3TAQA 3GG4A 1V4TA 1I39A 4FWPA 4K8ZA 2JLEA 2RE2A 4FW1A 1Q7YO 1T6CA 4FYDA 3NGYA 1M1KO 4JYAK 3K57A 1WSHA 3H45C 1EWRA 3M5RA 3NF9A 4BROA 3O1WA 1IKWA 5EXWA 3BF1A 5JVHL 1ZBSA 3D2EB 2G8IA 2VGMA 2GUIA 5BN8A 2YHBA 5AZJA 5EOYA 2BANA 2I5JA 2NRWA 3T1AA 4RW4A 4OX9K 2OTJN 1XUPO 3V9XA 2BDPA 3WEEB 2KQ2A 3DOKA 1RTIA 1EKEA 3SAGA 5CR4A 4KO0A 2EWSA 4XIUA 3K2PA 4RTFD 2HNYA 4M42A 1RDWX 4YORA 1QTMA 1RT2A 1SUQA 1FKPA 3SPZA 1HNXK 3G0ZA 2D0CA 1NJZA 4H4MA 4MLEA 3SYZA 3BEXA 1RBTA 1LAVA 3VTHA 3AVJA 4FJLA 4Z4FA 4C8OA 4ID1A 4B9SA 3TTDA 3ZLJA 1J6ZA 1TAUA 1S1UA 4CZKA 3SMSA 1DT9A 3QNOA 1MWMA 3OYFA 3CJAA 4DU1A 3ISNC 1BIZA 5AQWA 2VWBA 4DSLA 4F3TA 3CD6N 1IJJA 3R9PA 3WQTA 3LP0A 3VQCA 1RDBA 4J8FA 2KHOA 3LALA 4H03B 5BR8K 1KD1O 4JK8A 4DG1A 3RWUA 4JKFA 1RBVA 2D5RA 4DQIA 3AVAA 2RN2A 3DLKA 1YHQN 3TAPA 5M1FA 3CCVN 4DTJA 4H5WA 3E9LA 3O80A 2ZF5O 3O4QA 1IG9A 3AA5X 3Q7BA 4E1NA 3P38A 1UWBA 4RCHA 4ZTJA 3CG7A 4BRKA 2QXFA 2Y1JA 4CZEA 3QO9A 3NHGA 2GBZA 1GLCG 1T3VA 4O5FA 4LY7A 4RW8A 3ZX2A 4BR4A 4CFCA 3V9SA 4EP4A 3E1YA 1JLBA 1T7PA 1JLCA 1NU0A 4QS9A 5ADXA 1ITGA 3OY9A 3EY1A 4KAZA 1JLAA 3ZEUA 3NE6A 4FK2A 1TGOA 4X62K 3VEYA 3NMUA 3HRGA 3TTFA 5CZ2A 3NDKA 1HJOA 4CF0A 4CECA 4FM1A 4FXDA 3E01A 2FF6A 4DTSA 3LP1A 3M8SA 3VESA 1P90A 2KFNA 5JS2A 1NMNA 2YNGA 4B1UB 4K43A 2E6MA 4JHDA 2IC3A 4BR2A 4U7BA 3WXKA 2JWKA 1SL2A 5AQJA 4J2AA 1RT5A 4BDYA 3C7NB 2NRXA 3RRGA 2A40A 4CF8A 3PSIA 4MLHA 2A42A 1NGBA 2GEMA 3T19A 2WONA 3QINA 2OA8A 2Z1IA 3M1FA 3P1GA 1NJIO 5FRNA 3FZKA 4W5RA 1VK0A 1TK8A 2OPRA 1W9HA 3LDLA 3SCXA 4FVUA 4BRPA 5FPEA 2VQEK 1NKEA 1BCOA 1HQEA 3DXMB 4L3QA 3NVMA 3AA2A 2V7YA 3DRSA 2P9UB 1HQUA 1NM1A 3NF8A 4DHYA 4DR7K 1U47A 2E1YA 1N32K 1KQSM 4HHTA 1JJ2M 5BN9A 4CZLA 1U2VB 1IKYA 4LSNA 3NAEA 3WQUA 4X64K 1BOTO 2PYLA 4M3RA 4AHTA 2IVPA 3ZT2A 4CJPA 4DU3A 3TABA 5TKYA 4FJGA 4CHQA 3VEXA 1WSJA 4CEDA 3VA3A 4GW6A 4DV5K 1KCFA 2ZJRL 1SKRA 2IAJA 3MEDA 1WSIA 3V9UA 3DXKA 4ILJA 1VQ4N 1KFDA 1QQCA 1GOBA 3RRHA 4NLBA 3K5MA 4NXNK 1YVNA 3K0SA 3LP2A 5AQTA 4JEPA 3KLEA 5J2NA 1TK5A 1VQ7N 2QWOA 1F21A 1QHTA 3TI0A 4RW7A 3MX2A 1BG3A 4CZMA 1RCHA 3ZT4A 3VENA 1QQNA 1HRHA 3QEPA 1XMOK 4DV6K 2F9WA 3T7ZA 2ZJPL 5BREA 3ULEB 4BRLA 4AHSA 1ZC6A 3THWA 5K14A 4H0XB 2F4VK 1S22A 4JI7K 1JLFA 1BDGA 3GBTA 3JXUA 5AQUA 5AQSA 3D0PA 3ULDA 3LDPA 1U48A 4FO0A 4GVEA 1E3MA 4C8LA 4DCHA 2ZWHA 4PKHA 4CFDA 4Z94A 5FLXO 1LAWA 1IBLK 3AO1A 2NNWA 1TYQA 4A5BA 5IT9O 3S3NA 2O8DA 3CM5A 4CJ4A 4LD0A 3GE1A 4CK3A 4B1ZA 4IOAL 5F2RA 1YTUA 4FM2A 1L3UA 1S9EA 4U67L 5MLCQ 3QBWA 5C12A 3ALYA 4B3SK 3H3NO 3HPHA 3B6PA 4JI0K 1HLUA 3AO5A 3VQPA 5AQZA 3ZSYA 3SQ4A 4M7YA 2W42A 4FLVA 5AFUA 4A2AA 4CZJA 4J2BA 5AQNA 3SNNA 3CCMN 1XQSC 2HNZA 1N5YA 2XY6A 2P9IA 4OPKA 2ETJA 3TSUA 3LANA 2HHSA 3EE8A 4OPHA 5GADP 2FBTA 3U3YA 1GLJO 5H1SQ 1B9FA 3MCAB 1U49A 5BPMA 5GAHP 4O55A 2A41A 5HRRA 3OYMA 3VQAA 4BG9A 3JYTA 4CW7B 2GWJA 4H5VA 3C7NA 3JAMO 4DMNA 1QZ6A 1UA0A 1O1WA 4M45A 1WB9A 3C6UA 4FZXC 3H08A 3CC2N 4B9QA 4KREA 4CEZA 3WXLA 4IDKA 2UXBK 5DMRA 2QI2A 2D0AA 5FPDA 3HVTA 4GNIA 3UE5A 1U04A 2IDOA 3O9RA 3W0LA 1QVFM 1Y64A 3D45A 2QWQA 3T69A 1RT7A 4DV7K 3IS9A 4BY9C 3MDQA 2O8DB 1YVUA 1N34K 4H0YB 3C6HA 4I6MB 4BC4A 5HRNA 5M1KA 4DFKA 3AVMA 4BR0A 4IG3A 2E4LA 3BZCA 4BDPA 5KRSA 4AM7A 2QTDA 3WNFA 4N56A 3TWHA 1VSMA 3O9SA 4CJUA 3AAPA 3OW2M 3R8EA 3DWLA 4KHQA 5F1XA 4CESA 3GDQA 3DLEA 2GTDA 3ZYYX 1XWLA 2A5XA 5B8HA 1BQNA 2X78A 4DTUA 4BRCA 3ATUA 3CJ7A 4BRDA 2P9NB 3QIPA 1KSPA 3LM9A 4F2RA 3THYA 1V4SA 2PYJA 3MXMA 1BO5O 5EU7A 5J1EA 5GAGP 3VQ5A 1ZBHA 1KTQA 3D2FB 2G8WA 2W6KA 3V81A 4JKAA 1YI2N 3BP8A 3DXKB 5AZIA 1WNSA 3LP3A 1DEJA 3QEVA 5C15A 3K9KA 4CD3A 1RT3A 4H0TB 3H6EA 1NK5A 1OKJA 2P51A 4A57A 3TAGA 2KLAA 1RTDA 2H3GX 1XC3A 4BC3A 4GKKK 4I6MA 1JXEA 4DR1K 4C8MA 1EQYA 1U45A 3AY9A 1B92A 4FWNA 4A61A 1ASUA 3HK2A 4KI6A 4HCCA 3U3GA 3O9TA 3ENOA 1NK8A 1UOCA 1QSSA 2YJEA 1N6QA 2HW3A 4CGDA 2G8KA 3AVNA 4DR5K 4E1MA 5KQ8A 3M8RA 1CLQA 4BQLA 4EHUA 2A1SA 4H5NA 2OPSA 4GKJK 1DTTA 5DM6L 3CCRN 3TU5A 4LF7K 1Z26A 4DFJA 4BC2A 1VQLN 4LSLA 3PY8A 4KH6A 4Y1DA 3N4QA 3MXJA 4Z4EA 4DUZK 3C0BA 3BUZB 3LDSA 2HNDA 3N4PA 2RKIA 2VG7A 3AVFA 5AQVA 2KFZA 4FLXA 4J2DA 4DFPA 4E7KA 2DY4A 5KPRA 4CIGA 3VGLA 2O8CB 3CMAN 4CJQA 3HM8A 4A59A 2E2PA 5JVGL 1CZAN 4M3ZA 4A62A 3DJCA 3UB5A 3LDNA 5AQMA 1T6DA 2YKMA 4CEQA 4K42A 4KV8A 1HMVA 3OJUA 4JI4K 2YX6A 4H0PA 5LJWA 1U4BA 4CVNE 4W5TA 4IJAA 2QK9A 2O8BA 4FOEA 4JS4A 3QFPA 3F73A 2A6AA 1WSGA 4WYBA 3CQXA 3WNHA 2G8UA 3C95A 4IJNA 3ID8A 3VF4A 3OYDA 3PX0A 1NKCA 1RT1A 3ZCMA 3TARA 3CIPA 1WSEA 1HKBA 3P83D 3QMLA 5LY3A 5BR9A 2IVNA 2QA4N 3F5TA 4M3YA 1NOYA 4FLYA 3KKSA 3WXJA 4BR5A 3FR0A 4B1XB 1QHAA 1JLEA 3WEEA 2QWMA 1C0MA 2OPQA 3O1BA 3TPQA 3KK3A 3HP6A 3OYCA 3LWMA 3BGRA 2J4RA 3V1OA 1VQ6N 1MU2A 5HROA 1HUXA 1C1AA 1TUYA 5E41A 3TR8A 4CBXA 4N76A 1G15A 3JS6A 4IEIA 4AILC 1E4FT 3J81O 4DWIA 4DTOA 2F7TA 1OVQA 3RSEB 1NOZA 3CCJN 1RDDA 5AQXA 2WBNA 3R6MA 1WBBA 2KKZA 3DRPA 4FWLA 3H1QA 4E7LA 3VQ8A 4ID5A 1UAXA 4B9TA 3MECA 3CFOA 4DQ8A 4YHHK 1H1VA 2E1ZA 2ASOA 3VA0A 2CGJA 3RSEA 1HYVA 1VQON 4GVMA 2HHQA 1C0TA 1VRTA 3SBTA 3CJCA 1X9MA 2KZZA 3PV8A 2ZJQL 2IS3A 2Q0RA 1VQPN 1K9MO 1OH6A 3MXIA 1HPZA 4OPJA 4B8CA 3OYKA 2HBJA 3I0SA 1BWFO 1FJGK 3I33A 3SV3A 4W5QA 4QCLA 4KFBA 4OGCA 4B9NA 4NCBA 3L2WA 3EZWA 3ZSVA 4AM6A 3THXB 1SKWA 5D3GA 3SUNA 1ASVA 3K9JA 2AJQA 4BE0A 4H5TA 1NWKA 2NRVA 4O0JA 2FC0A 2HF3A 4BGAA 4PHTX 3QETA 4CGJA 2OZMA 4Z4IA 1J53A 2CH5A 4WFBL 4F3OA 3S41A 1ZXOA 1HYSA 2DTUA 4DR6K 1K8KB 4CBUA 3JSMA 3THWB 3H46O 1QSLA 3THYB 4O8UA 1QZ5A 4DFMA 1X3MA 4ZTFA 1MA9B 4NXMK 1NG9A 4B9MA 2PAVA 2P9LB 3AVKA 4FPAA 4A5AA 4LFAK 2QEXN 2XO7A 4CJ7A 3HTVA 4DV4K 4DSFA 3FGUA 3OA9A 3OVNA 1QVGM 3WNEA 1YUWA 4NLCA 3RMAA 1W0HA 1QS4A 3DOLA 3CQYA 2P9PB 5EX5A 4WCEL 4IDHA 1WAFA 2Q31A 5C25A 1KVBA 4B9LA 4PL8A 1XI1A 3VGMA 3CC7N 1S1WA 1YXQA 3HL8A 5M1QA 3BY5A 2QM1A 1HR0K 2HMIA 2Q1NA 4FJ9A 2FSJA 4X65K 1SL1A 1W97L 3M8PA 3E9PA 2ATQA 3EE9A 1RNHA 3O08A 2HMPA 3RMBA 3MAQA 1VQKN 1XNRK 4WF9L 4K8XA 3OYLA 1E4GT 3KLIA 3L2VA 1NK9A 4ELUA 3M6GA 3Q7CA 1LWCA 1TL3A 2NRRA 1DKGD 1A5WA 3D6RA 5FPNA 5ELZA 4HVJA 1GLAG 4CF9A 3O4NA 2OCEA 1HJRA 5AQKA 4XH1A 4M41A 3TSPA 2PBDA 2E88A 3VEVA 2ZE2A 3CF5L 3QBXA 1K73O 2O8CA 4FLUA 3IRXA 5T7BA 4BVOA 1Z6RA 2YHXA 5AZIB 3HOSA 5M1OA 4NCGA 1LCUA 1HNVA 3O3HA 4EZ9A 4JV5K 4PQUA 2KW4A 4CIEA 4UQGA 4XEIA 2RF2A 5KI6A 3U4LA 4CHNA 3EYZA 3IKMA 4FLWA 1VSEA 2Q0UA 4WQ4A 2ITMA 1CXQA 4DV1K 1WOQA 2QW9A 4WQ5C 5CZ1A 3L2QA 4B1WB 5AFUH 3NH0A 4JAXA 4CHYA 1RBRA 1LWEA 3AO2A 3HP9A 4H5RA 2D0PA 1KVAA 4KPYA 1NGGA 4B9VA 3AVIA 2B4JA 4AHRA 1Z05A 4GMJB 4IO8A 4RG8A 1S6QA 4PKGA 5M1NA 4PL7A 3LDOA 4FWOA 4CJKA 3DYAA 4E1JA 2CH6A 3VMFB 1IBMK 1FW6A 4EHTA 1IH7A 3HXMA 1BA1A 4C23A 4FPBA 4FM0A 1ZYQA 4JI5K 4BRHA 5EY4A 1FK9A 4N41A 3KK1A 4IXCA 1TKTA 4FSVA 3J7ZO 1VQ5N 3VTIA 4CJ3A 2E8AA 3NGZA 3CJBA 1D8YA 3ZT1A 5SZTA 2YHAA 3SAFA 4CEBA 4BDZA 1REVA 3SV4A 1T03A 4FCYA 4IEEA 4DF4A 4JI1K 4PY5A 1EWQA 5KPTA 3V1RA 3DRRA 4LF8K 1ATRA 5HOOA 3F9KA 2XY7A 4GV6A 4WFNL 5AQGA 1ILYA 2P5GA 1M90O 2YKNA 2NZTA 3A5OC 3QLHA 4I9LA 2WUSA 4CJFA 4JI8K 3UKRB 2HVIA 3CCUN 1I94K 1VQ8N 4YOXA 1ZBIA 4C1NI 4CGGA 1KC8O 3ZSWA 3S3MA 5AQOA 4K41A 3E66A 1A5XA 3A2FA 4N47A 3L3VA 3KVGA 2FLOA 2E5LK 2ASPA 5CYQA 3VQQA 2FBXA 1VSFA 3AA4A 1P8ZA 4ILGB 4JKDA 4HUEA 3KJVA 1S1VA 2F8TA 2GUPA 1HNWK 2O4GA 3KZBA 1T44A 3TTCA 2VGNA 4MDBA 4TSXA 4FJ8A 4LH4A 1D5AA 1BGXT 4JD2A 2BGGA 2YNFA 1BQMA 4OVLA 1S6PA 3CQ8A 3FZHA 3QDKA 4N5SA 2E2QA 3O9QA 3FE1A 4CF1A 1L5UA 2ZGYA 3THVA 4JKGA 4O44A 4JI3K 4F8RA 3IG1A 1NGHA 1X9WA 1TV6A 3SUPA 1JCGA 3ITHA 2HOEA 1C0UA 3AAQA 1IV0A 2HBMA 4HTLA 4M3WA 2Z1JA 4FW2A 2WC9A 1HNIA 1NJWA 1Q18A 4KHPK 3AVGA 3VQ9A 1L3VA 2OZSA 4NYNA 3CM6A 2G8HA 4JKEA 2P9PA 3HO1A 3LZIA 1NKBA 4FWKA 4K0KK 1BHLA 3EZ5A 4I7FA 2I7NA 3VQ6A 3SBGA 2RHKA 3CETA 3AGKA 1HX1A 3C94A 3M8QA 4AQYK 2GV9A 5AZJB 5JICA 2IGIA 3M3ZA 3VQBA 4BGBA 4EFHA 4DSEA 4FJ7A 3J8AA 3NBPA 1KLNA 3IDHA 4KH5A 3AA3A 3C65A 3MWTA 4FJMA 4JKBA 1O13A 2G8VA 1U2VA 4DSIA 3U6FA 4A2BA
chains in the Genus database with same CATH topology
4YY3K 4CVNE 3OTOK 5LMNK 4DV2K 3J7AP 4JV5K 4DV5K 4JI6K 5LL6Z 2E5LK 1IBKK 1XMQK 4DV1K 3T1HK 4DR3K 4LF5K 4X62K 4CW7B 1XNQK 1HNWK 4OX9K 3JAMO 4DR6K 4NXNK 4GKKK 5AJ3K 4DR1K 3T1YK 4LF9K 5IWAK 4NXMK 5A2QO 2UXBK 1HNZK 4LFAK 4DUYK 1XMOK 1IBMK 4DV6K 4B3RK 4DR5K 4LFBK 4X66K 1HNXK 4JI3K 2UUAK 4DV4K 3J81O 2UUCK 2UUBK 2F4VK 4JI2K 4JI5K 4DV7K 4JI7K 4GKJK 1N34K 4LF7K 2VQFK 3J80O 4KHPK 4DV0K 3J7YP 5FLXO 4JYAK 1N36K 1HR0K 4YHHK 4X65K 4DUZK 4B3TK 2VQEK 1IBLK 2UU9K 2UXCK 5BR8K 5IT9O 4LF4K 4K0KK 4JI1K 1XNRK 2ZM6K 4DR4K 4DR2K 5LMUK 4LF8K 4DV3K 4AQYK 4DR7K 4LF6K 4B3MK 4V19S 4B3SK 1FJGK 1N32K 4JI0K 4LFCK 1J5EK 2HHHK 4JI8K 4X64K 1N33K 1I94K 4JI4K 2UXDK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 K;  4CVN E;  3OTO K;  5LMN K;  4DV2 K;  3J7A P;  4JV5 K;  4DV5 K;  4JI6 K;  5LL6 Z;  2E5L K;  1IBK K;  1XMQ K;  4DV1 K;  3T1H K;  4DR3 K;  4LF5 K;  4X62 K;  4CW7 B;  1XNQ K;  1HNW K;  4OX9 K;  3JAM O;  4DR6 K;  4NXN K;  4GKK K;  5AJ3 K;  4DR1 K;  3T1Y K;  4LF9 K;  5IWA K;  4NXM K;  5A2Q O;  2UXB K;  1HNZ K;  4LFA K;  4DUY K;  1XMO K;  1IBM K;  4DV6 K;  4B3R K;  4DR5 K;  4LFB K;  4X66 K;  1HNX K;  4JI3 K;  2UUA K;  4DV4 K;  3J81 O;  2UUC K;  2UUB K;  2F4V K;  4JI2 K;  4JI5 K;  4DV7 K;  4JI7 K;  4GKJ K;  1N34 K;  4LF7 K;  2VQF K;  3J80 O;  4KHP K;  4DV0 K;  3J7Y P;  5FLX O;  4JYA K;  1N36 K;  1HR0 K;  4YHH K;  4X65 K;  4DUZ K;  4B3T K;  2VQE K;  1IBL K;  2UU9 K;  2UXC K;  5BR8 K;  5IT9 O;  4LF4 K;  4K0K K;  4JI1 K;  1XNR K;  2ZM6 K;  4DR4 K;  4DR2 K;  5LMU K;  4LF8 K;  4DV3 K;  4AQY K;  4DR7 K;  4LF6 K;  4B3M K;  4V19 S;  4B3S K;  1FJG K;  1N32 K;  4JI0 K;  4LFC K;  1J5E K;  2HHH K;  4JI8 K;  4X64 K;  1N33 K;  1I94 K;  4JI4 K;  2UXD K; 
#chains in the Genus database with same CATH topology
 5C10 A;  3QEW A;  3SQ2 A;  4DTP A;  4C1N K;  1NLV A;  1S72 N;  1SQK A;  2O8E A;  4CJW A;  3KK2 A;  4FJJ A;  5AQI A;  4EAH D;  2HBK A;  2F9T A;  2AA4 A;  1WLJ A;  4I2P A;  5BRF A;  1IBK K;  3VQD A;  1XMQ K;  4KHY A;  3PIO L;  1NBW A;  3HI0 A;  3THX A;  3AVC A;  4JRQ A;  4HTU A;  4CE9 A;  2WTU A;  4RW6 A;  4FLZ A;  1JCF A;  1N8R O;  2X6S A;  1RDU A;  2W6L A;  5BRH A;  1DTQ A;  3MMV A;  5J2M A;  1YJN N;  4E7H A;  5AQP A;  4CJL A;  3AV9 A;  3A5M C;  2RPI A;  5JMV A;  4I9Q A;  3O3G A;  4DUY K;  1VQM N;  3V6D A;  1ZBU A;  4KRF A;  4OLA A;  3CFR A;  2KZM A;  3L2U A;  3OYN A;  1YT3 A;  4EIA A;  4B8A B;  4FJ5 A;  5GIO A;  3A0I X;  4JHD B;  3QIC A;  4JI2 K;  4EZ6 A;  3OS0 A;  1JLG A;  4LH5 A;  4FJX A;  3D2E A;  3AVB A;  4E89 A;  5C2F A;  4ISG A;  3KTQ A;  1VSH A;  3SMP A;  4DTM A;  4PWD A;  2YI1 A;  3I56 N;  1S3X A;  4DQQ A;  3U8X A;  2WFB A;  1LW0 A;  3K5N A;  3HT3 A;  4B3O A;  3UKR A;  3CME N;  2XY8 A;  3VN5 A;  3KIO A;  5I3U A;  3EKU A;  3C6A A;  4HUG A;  4BRM A;  2Z1G A;  3CXC M;  1JLQ A;  3B8A X;  3OYI A;  4IO9 L;  3CER A;  3ENH A;  3SUQ A;  4O4G A;  4CZG A;  2EX3 A;  2F8S A;  4BE2 A;  1HKG A;  4NB4 A;  3G10 A;  4MDA A;  3PX4 A;  3CI5 A;  1BU6 O;  4IOC L;  5HBM A;  4CK2 A;  3DM2 A;  2VG5 A;  3BZK A;  3ZT3 A;  3K59 A;  3SJJ A;  3RR7 A;  5DK5 A;  3LM2 A;  4Z4G A;  2LSN A;  3A5N C;  1NGC A;  1WAJ A;  1NMD A;  2DFH A;  2V7Z A;  3K5O A;  4CJE A;  1IKV A;  4IFV A;  1TKD A;  3OHR A;  1KFS A;  2E6L A;  1TYQ B;  2D0O A;  2GX9 A;  2F96 A;  2HST A;  3WUH A;  4BRA A;  5BPL A;  5AR0 A;  2P9L A;  1JKH A;  1Q86 O;  1XHX A;  2BUP A;  4CHP A;  4O5B A;  3EEQ A;  4DSK A;  4M63 C;  4H0V B;  1R59 O;  3KWI A;  4DQR A;  4DR3 K;  4LF5 K;  4FK4 A;  3NF6 A;  5CY4 A;  1YJW N;  1C6V A;  5JLF A;  1VAZ A;  3L3U A;  3CHW A;  4WQ5 A;  3QNN A;  4PKI A;  3GL1 A;  1VSL A;  4C8N A;  5HRP A;  4JLH A;  2G8F A;  3HJF A;  3WT0 A;  3SJH A;  3ZET A;  1EXQ A;  4B3R K;  2FBY A;  1T05 A;  2VG6 A;  2UUA K;  3ASM A;  1BIS A;  4JK7 A;  4K25 A;  2ITG A;  2OPP A;  3KK7 A;  2OYQ A;  5KTQ A;  3PO4 A;  3I0R A;  4CCH A;  4CJS A;  3LDQ A;  1DGK N;  4OJR A;  5CE3 A;  3W3D A;  3VQ4 A;  1WN7 A;  5C2D A;  4OLB A;  5GIP A;  2OTL N;  1U6Z A;  1D9D A;  4B1V A;  1NGF A;  3EO3 A;  4BC5 A;  1EP4 A;  3V1Q A;  4G9Z A;  3CFP A;  4H4O A;  1S1X A;  1N36 K;  4AHV A;  1TAQ A;  4B3T K;  4M3X A;  3LPT A;  5SWM A;  4DQP A;  4FWR A;  1TKZ A;  3NH1 A;  4Z0U A;  4ILH A;  2E2N A;  4ISF A;  1WBD A;  4OO1 J;  4ISE A;  4CGI A;  5AQL A;  1J9A A;  2HBL A;  2FF3 B;  2ASM A;  3LAK A;  4Q5V A;  1MWK A;  2YV0 X;  3MWP A;  3DLB A;  2IOC A;  5AQF A;  1SAZ A;  4E19 A;  3VGK A;  4CJT A;  4Z4H A;  1BIU A;  4KB0 A;  1Q82 O;  4IKF A;  4DTX A;  3CCL N;  5FDL A;  5I9E B;  2UXD K;  1HKC A;  3UKU B;  4B08 A;  3KKR A;  4FK0 A;  3OTO K;  3OBW A;  3FZM A;  3MN7 A;  3K5L A;  1J54 A;  1RT6 A;  4BRF A;  1SV5 A;  4DTR A;  3D7E O;  4BWJ A;  4AHU A;  3CCQ N;  4HUF A;  2YNH A;  4AH9 A;  4EP5 A;  1SKS A;  5KPZ A;  1GLB G;  4CFB A;  3TAN A;  3VPZ A;  4YDU C;  4ELV A;  1VQN N;  3T1H K;  3L4I A;  3PX6 A;  1S9G A;  4CZF A;  1W7A A;  3QEI A;  1OH7 A;  3L4Q A;  2ZGZ A;  4QAG A;  3ZET B;  2YCH A;  3UKU A;  2I7P A;  4HWI A;  5HP1 A;  5AQQ A;  2YHW A;  1LW2 A;  3T1Y K;  2QWP A;  4QS7 A;  1B9D A;  1D9F A;  3DLL L;  3AVL A;  4GV9 A;  1NGE A;  3L0Q A;  4YOY A;  4E7J A;  5A2Q O;  5HL7 L;  1XC9 A;  1C0G A;  3VEW A;  3SK3 A;  1T8E A;  3CJ1 A;  1YAG A;  5JLH A;  4IBN A;  1VHX A;  3OYG A;  3SZ2 A;  4MQ3 A;  4YOT A;  3WNG A;  2JWL A;  4JD2 B;  3QER A;  2HHT A;  2AP1 A;  2E2O A;  3HOT A;  3SPY A;  4DF8 A;  4O0I A;  4C8K A;  4CGF A;  1GOA A;  3V9Z A;  1ATS A;  3CJ9 A;  3ZSQ A;  4GV3 A;  3OS1 A;  1GOC A;  3QIO A;  4KHU A;  2O8B B;  1BI4 A;  3FLC O;  4BRE A;  3S3O A;  2HHV A;  2UU9 K;  2UXC K;  1BL3 A;  2QWN A;  4E3S A;  2DFF A;  2P9K B;  4YNQ A;  1Y97 A;  5GIN A;  1VQ9 N;  3CYM A;  4KTW A;  2PZS A;  4FJI A;  4DR2 K;  5LMU K;  5J2Q A;  3VF2 A;  1OVY A;  3IMX A;  4CJV A;  2NRZ A;  3VEO A;  5KQD A;  2HHW A;  1OH8 A;  1IG8 A;  3A5L C;  1YF5 L;  1KAX A;  1QQM A;  1NK4 A;  2Q97 A;  4IFY A;  5GAE P;  1N33 K;  5AQR A;  3OYH A;  3PSF A;  3MEG A;  4JKG B;  1NNE A;  4UY8 O;  1RDC A;  5C42 A;  2O4I A;  4ELT A;  1Q9Y A;  3NF7 A;  2B5J A;  2QWR A;  1JL2 A;  1GLL O;  4FVM A;  3VEZ A;  2X6N A;  3P4I A;  3MN9 A;  4BRN A;  5FPM A;  1Q9X A;  3RMC A;  2O8F A;  4CIF A;  1XNQ K;  2VWJ A;  4MO4 A;  4JKC A;  4OKJ A;  3KD5 E;  4CK1 A;  1I3A A;  1VSD A;  2QKK A;  3MX5 A;  3EL2 A;  4KTQ A;  3HBT A;  3ZSO A;  4I2Q A;  4R5P A;  3G71 N;  4ICL A;  4BG8 A;  3O3F A;  2UYT A;  3O6W A;  1C0F A;  3KD1 E;  1RBU A;  4LFB K;  3WXM B;  1TL1 A;  3LWL A;  3OYA A;  1J5O A;  1VSJ A;  2VCP A;  5AQH A;  4CI6 A;  4KHN A;  3FZF A;  4CZH A;  2UUB K;  5KGX A;  3V4I A;  1KRP A;  4CJR A;  2XHB A;  4M7X A;  4FWQ A;  3OYB A;  3E9O A;  4JS5 A;  3AO4 A;  4FJH A;  4DTN A;  5KRT A;  4OPA A;  1NK6 A;  3LZJ A;  4JN4 A;  2VYP A;  2BTF A;  3PLA A;  1GLF O;  1X9S A;  5JS1 A;  4YFU A;  3EKS A;  2V52 B;  2Y1I A;  3LAM A;  4GY2 B;  4M3U A;  1IO2 A;  2YJF A;  4LC9 B;  2PFU A;  4H8K A;  4E7I A;  1LV5 A;  1KVC A;  3IUC A;  1FXX A;  4KTZ A;  1EX4 A;  5DM7 L;  3L2R A;  4LF4 K;  3QES A;  1NGA A;  4PUO A;  3VQE A;  3MN6 A;  4Y1C A;  1YIJ N;  4G1Q A;  2NRH A;  5AQY A;  3I55 N;  3TAM A;  3SAH A;  4CEO A;  3AAR A;  2Z1H A;  1Q81 O;  4B3M K;  1FKO A;  4R79 A;  1S1T A;  2NUB A;  3I8D A;  3NCI A;  4CZI A;  1VSK A;  3TSQ A;  4QOZ B;  3O4W A;  4KHS A;  1XHZ A;  1GLD G;  2P1J A;  3RVC A;  3KWG A;  3RMD A;  4JRP A;  5I42 A;  3MEE A;  2ZQB A;  1DLO A;  2FSN A;  4YDU A;  4BR7 A;  3VQ7 A;  5CHI A;  1QQO A;  2GWK A;  4W5N A;  1K8A O;  1LWF A;  1CZB A;  5BRD A;  4BRQ A;  1RTH A;  4KKO A;  3AGR A;  3VF6 A;  4F2S A;  4L8R B;  2P9S A;  3B6O A;  2W41 A;  2CGK A;  3WXI A;  4LF9 K;  4FLT A;  4RW9 A;  2YNI A;  3ATV A;  1A5V A;  5IWA K;  3CCS N;  3GOI A;  3QEX A;  3ULE A;  1ASW A;  3HVR A;  2DFE A;  2OAN A;  4CF2 A;  5FRM A;  1RIL A;  3ZX3 A;  3ZEU B;  4YOV A;  4CFA A;  3H3O B;  3ZX0 A;  3C6T A;  4WFA L;  1VRU A;  5J2P A;  1R0A A;  4CGH A;  3NFA A;  2XY5 A;  1L3S A;  1LOT B;  1K8K A;  2JGU A;  2VQF K;  3DLH A;  4DSJ A;  4KBO A;  1Z25 A;  4OKE A;  4FL9 A;  3TAE A;  3FFI A;  2P9K A;  1S5J A;  3FZL A;  1C1C A;  3BDP A;  3TAF A;  1QE1 A;  1TVR A;  5KGW A;  1VSI A;  1NGD A;  1KXP A;  4DS5 A;  4FZY A;  3VOV A;  1G99 A;  3T3F A;  3O5B A;  2QKB A;  3EN9 A;  3FFK B;  3ENB A;  3NH2 A;  4DV3 K;  1UA1 A;  4NCA A;  4ZHR A;  2HF4 A;  1KAY A;  3G6E N;  3PUF A;  3DAW A;  1BCM A;  4JNE A;  4BR9 A;  3HSC A;  2HHH K;  3SLC A;  4OGE A;  1JCE A;  1SL0 A;  5E26 A;  2FBV A;  2A1R A;  2QWL A;  3DLR A;  2P9U A;  4H0O A;  5BPN A;  3MN5 A;  1X1P A;  4XH4 A;  4DQS A;  4YY3 K;  2YHY A;  5LMN K;  5C24 A;  3J7A P;  3DXM A;  1ATN A;  4HCB A;  2IIR A;  1W2B M;  3CCE N;  4JI6 K;  4DKW A;  4DLE A;  5LL6 Z;  1Q8I A;  3NVK A;  3MK6 A;  4E0D A;  2D1K A;  4Y0W A;  3R3L A;  2W40 A;  4CBW A;  4IG0 A;  3ZSX A;  3NGI A;  1L3T A;  3SI6 A;  5ADX H;  4CHZ A;  3LL3 A;  1BUP A;  4YOU A;  1OH5 A;  4DB3 A;  3OS2 A;  1RGI A;  3A8Y A;  1CZ9 A;  1HPM A;  2HHX A;  4WQ4 C;  2VWK A;  2BE2 A;  5HLF A;  2HVH A;  2Q36 A;  2D0B A;  4BE1 A;  1EO1 A;  3DMJ A;  3HPO A;  3CPW M;  1RTJ A;  3OJS A;  4BQZ A;  1WUA A;  4CJ5 A;  4PA1 A;  3QFU A;  1KLM A;  2DPN A;  4FJN A;  4CEE A;  5TKW A;  2NRT A;  3CC4 N;  1ESV A;  3HST B;  4IOX A;  1RT4 A;  4CHO A;  3U9Z A;  2NLX A;  2P9S B;  1RDA A;  3UIQ A;  2HHU A;  1NGI A;  2CGL A;  3HM9 A;  1MDU B;  2P9N A;  2QXL A;  1BI4 B;  1NJX A;  1BA0 A;  4DV0 K;  3KLG A;  3V9W A;  2BH1 A;  3J7Y P;  4FOI A;  1NGJ A;  1QSY A;  4BRI A;  5M1P A;  4B9U A;  4FZZ A;  1RBS A;  2KTQ A;  3DLG A;  3MCP A;  2Q3S A;  3P39 A;  5CYM A;  4BWM A;  4RWT A;  4DR4 K;  4DLG A;  1GLE G;  4DU4 A;  2D4W A;  3G25 A;  1YIT N;  4M3T A;  3OYJ A;  3ID6 A;  2IVO A;  3I8B A;  4V19 S;  3DI6 A;  3O8M A;  4OKK A;  4CEA A;  4KH4 A;  1SS6 A;  3VET A;  1WSF A;  3IAY A;  3O9U A;  1J5E K;  3QB0 A;  4KB1 A;  4MO5 A;  3HZ6 A;  2WOM A;  4Z4C A;  1IKX A;  1TK0 A;  2B6A A;  3CPE A;  4DV2 K;  1X3N A;  1NJY A;  2EHG A;  5HRS A;  3S9H A;  1C1B A;  3RR8 A;  3HYF A;  4CEF A;  1YJ9 N;  5C0Y A;  1YTA A;  4W5O A;  2Q2R A;  1HYZ A;  4FJK A;  3PIP L;  4BRG A;  1RFQ A;  3KLH A;  2FXU A;  2P9I B;  1KAZ A;  1ZBL A;  3RTV A;  4KI4 A;  4IZ9 A;  4KHW A;  1TKX A;  5AJ3 K;  1K6Y A;  4AF1 A;  2ZD1 A;  4BAC A;  2HB5 A;  4CER A;  3P31 A;  4F9O A;  3F2K A;  3G4S N;  4FWM A;  3F9M A;  4Q0B A;  4IFE A;  1NK0 A;  3P5J A;  3ZSZ A;  1HNZ K;  3H1V X;  4IWV A;  3KHY A;  1TUU A;  3HPG A;  4NYF A;  5EVZ A;  2XRI A;  4JKH A;  4X66 K;  3K58 A;  3ZSR A;  4J2E A;  4MFB A;  2UUC K;  3SQ0 A;  2PY5 A;  1JXB A;  5FRO A;  4BVP A;  5F0X A;  3J80 O;  1NK7 A;  3R1X A;  1JL1 A;  2O8F B;  4O8K A;  3L8B A;  2R7Y A;  3OBY A;  3IFR A;  2A3Z A;  3KLF A;  2O8E B;  3LPU A;  3AVH A;  5LJV A;  3SQ1 A;  1D4X A;  4DS4 A;  3OYE A;  3SUO A;  3BF3 A;  1SZ2 A;  2V51 B;  2FSK A;  2E20 A;  3D2F A;  1X9J A;  4CD1 A;  3AO3 A;  2P5O A;  4QS8 A;  1CXU A;  2ZM6 K;  4XH5 A;  2GEL A;  4AHC A;  3PO5 A;  3VER A;  4WE1 A;  4B1Y B;  3U9D A;  5E84 A;  4LF6 K;  4JK9 A;  3ZT0 A;  4NO7 A;  1EET A;  4YOW A;  4F4K A;  1ZBF A;  4LFC K;  4FWS A;  2X74 A;  3L6Q A;  3TAQ A;  3GG4 A;  1V4T A;  1I39 A;  4FWP A;  4K8Z A;  2JLE A;  2RE2 A;  4FW1 A;  1Q7Y O;  1T6C A;  4FYD A;  3NGY A;  1M1K O;  4JYA K;  3K57 A;  1WSH A;  3H45 C;  1EWR A;  3M5R A;  3NF9 A;  4BRO A;  3O1W A;  1IKW A;  5EXW A;  3BF1 A;  5JVH L;  1ZBS A;  3D2E B;  2G8I A;  2VGM A;  2GUI A;  5BN8 A;  2YHB A;  5AZJ A;  5EOY A;  2BAN A;  2I5J A;  2NRW A;  3T1A A;  4RW4 A;  4OX9 K;  2OTJ N;  1XUP O;  3V9X A;  2BDP A;  3WEE B;  2KQ2 A;  3DOK A;  1RTI A;  1EKE A;  3SAG A;  5CR4 A;  4KO0 A;  2EWS A;  4XIU A;  3K2P A;  4RTF D;  2HNY A;  4M42 A;  1RDW X;  4YOR A;  1QTM A;  1RT2 A;  1SUQ A;  1FKP A;  3SPZ A;  1HNX K;  3G0Z A;  2D0C A;  1NJZ A;  4H4M A;  4MLE A;  3SYZ A;  3BEX A;  1RBT A;  1LAV A;  3VTH A;  3AVJ A;  4FJL A;  4Z4F A;  4C8O A;  4ID1 A;  4B9S A;  3TTD A;  3ZLJ A;  1J6Z A;  1TAU A;  1S1U A;  4CZK A;  3SMS A;  1DT9 A;  3QNO A;  1MWM A;  3OYF A;  3CJA A;  4DU1 A;  3ISN C;  1BIZ A;  5AQW A;  2VWB A;  4DSL A;  4F3T A;  3CD6 N;  1IJJ A;  3R9P A;  3WQT A;  3LP0 A;  3VQC A;  1RDB A;  4J8F A;  2KHO A;  3LAL A;  4H03 B;  5BR8 K;  1KD1 O;  4JK8 A;  4DG1 A;  3RWU A;  4JKF A;  1RBV A;  2D5R A;  4DQI A;  3AVA A;  2RN2 A;  3DLK A;  1YHQ N;  3TAP A;  5M1F A;  3CCV N;  4DTJ A;  4H5W A;  3E9L A;  3O80 A;  2ZF5 O;  3O4Q A;  1IG9 A;  3AA5 X;  3Q7B A;  4E1N A;  3P38 A;  1UWB A;  4RCH A;  4ZTJ A;  3CG7 A;  4BRK A;  2QXF A;  2Y1J A;  4CZE A;  3QO9 A;  3NHG A;  2GBZ A;  1GLC G;  1T3V A;  4O5F A;  4LY7 A;  4RW8 A;  3ZX2 A;  4BR4 A;  4CFC A;  3V9S A;  4EP4 A;  3E1Y A;  1JLB A;  1T7P A;  1JLC A;  1NU0 A;  4QS9 A;  5ADX A;  1ITG A;  3OY9 A;  3EY1 A;  4KAZ A;  1JLA A;  3ZEU A;  3NE6 A;  4FK2 A;  1TGO A;  4X62 K;  3VEY A;  3NMU A;  3HRG A;  3TTF A;  5CZ2 A;  3NDK A;  1HJO A;  4CF0 A;  4CEC A;  4FM1 A;  4FXD A;  3E01 A;  2FF6 A;  4DTS A;  3LP1 A;  3M8S A;  3VES A;  1P90 A;  2KFN A;  5JS2 A;  1NMN A;  2YNG A;  4B1U B;  4K43 A;  2E6M A;  4JHD A;  2IC3 A;  4BR2 A;  4U7B A;  3WXK A;  2JWK A;  1SL2 A;  5AQJ A;  4J2A A;  1RT5 A;  4BDY A;  3C7N B;  2NRX A;  3RRG A;  2A40 A;  4CF8 A;  3PSI A;  4MLH A;  2A42 A;  1NGB A;  2GEM A;  3T19 A;  2WON A;  3QIN A;  2OA8 A;  2Z1I A;  3M1F A;  3P1G A;  1NJI O;  5FRN A;  3FZK A;  4W5R A;  1VK0 A;  1TK8 A;  2OPR A;  1W9H A;  3LDL A;  3SCX A;  4FVU A;  4BRP A;  5FPE A;  2VQE K;  1NKE A;  1BCO A;  1HQE A;  3DXM B;  4L3Q A;  3NVM A;  3AA2 A;  2V7Y A;  3DRS A;  2P9U B;  1HQU A;  1NM1 A;  3NF8 A;  4DHY A;  4DR7 K;  1U47 A;  2E1Y A;  1N32 K;  1KQS M;  4HHT A;  1JJ2 M;  5BN9 A;  4CZL A;  1U2V B;  1IKY A;  4LSN A;  3NAE A;  3WQU A;  4X64 K;  1BOT O;  2PYL A;  4M3R A;  4AHT A;  2IVP A;  3ZT2 A;  4CJP A;  4DU3 A;  3TAB A;  5TKY A;  4FJG A;  4CHQ A;  3VEX A;  1WSJ A;  4CED A;  3VA3 A;  4GW6 A;  4DV5 K;  1KCF A;  2ZJR L;  1SKR A;  2IAJ A;  3MED A;  1WSI A;  3V9U A;  3DXK A;  4ILJ A;  1VQ4 N;  1KFD A;  1QQC A;  1GOB A;  3RRH A;  4NLB A;  3K5M A;  4NXN K;  1YVN A;  3K0S A;  3LP2 A;  5AQT A;  4JEP A;  3KLE A;  5J2N A;  1TK5 A;  1VQ7 N;  2QWO A;  1F21 A;  1QHT A;  3TI0 A;  4RW7 A;  3MX2 A;  1BG3 A;  4CZM A;  1RCH A;  3ZT4 A;  3VEN A;  1QQN A;  1HRH A;  3QEP A;  1XMO K;  4DV6 K;  2F9W A;  3T7Z A;  2ZJP L;  5BRE A;  3ULE B;  4BRL A;  4AHS A;  1ZC6 A;  3THW A;  5K14 A;  4H0X B;  2F4V K;  1S22 A;  4JI7 K;  1JLF A;  1BDG A;  3GBT A;  3JXU A;  5AQU A;  5AQS A;  3D0P A;  3ULD A;  3LDP A;  1U48 A;  4FO0 A;  4GVE A;  1E3M A;  4C8L A;  4DCH A;  2ZWH A;  4PKH A;  4CFD A;  4Z94 A;  5FLX O;  1LAW A;  1IBL K;  3AO1 A;  2NNW A;  1TYQ A;  4A5B A;  5IT9 O;  3S3N A;  2O8D A;  3CM5 A;  4CJ4 A;  4LD0 A;  3GE1 A;  4CK3 A;  4B1Z A;  4IOA L;  5F2R A;  1YTU A;  4FM2 A;  1L3U A;  1S9E A;  4U67 L;  5MLC Q;  3QBW A;  5C12 A;  3ALY A;  4B3S K;  3H3N O;  3HPH A;  3B6P A;  4JI0 K;  1HLU A;  3AO5 A;  3VQP A;  5AQZ A;  3ZSY A;  3SQ4 A;  4M7Y A;  2W42 A;  4FLV A;  5AFU A;  4A2A A;  4CZJ A;  4J2B A;  5AQN A;  3SNN A;  3CCM N;  1XQS C;  2HNZ A;  1N5Y A;  2XY6 A;  2P9I A;  4OPK A;  2ETJ A;  3TSU A;  3LAN A;  2HHS A;  3EE8 A;  4OPH A;  5GAD P;  2FBT A;  3U3Y A;  1GLJ O;  5H1S Q;  1B9F A;  3MCA B;  1U49 A;  5BPM A;  5GAH P;  4O55 A;  2A41 A;  5HRR A;  3OYM A;  3VQA A;  4BG9 A;  3JYT A;  4CW7 B;  2GWJ A;  4H5V A;  3C7N A;  3JAM O;  4DMN A;  1QZ6 A;  1UA0 A;  1O1W A;  4M45 A;  1WB9 A;  3C6U A;  4FZX C;  3H08 A;  3CC2 N;  4B9Q A;  4KRE A;  4CEZ A;  3WXL A;  4IDK A;  2UXB K;  5DMR A;  2QI2 A;  2D0A A;  5FPD A;  3HVT A;  4GNI A;  3UE5 A;  1U04 A;  2IDO A;  3O9R A;  3W0L A;  1QVF M;  1Y64 A;  3D45 A;  2QWQ A;  3T69 A;  1RT7 A;  4DV7 K;  3IS9 A;  4BY9 C;  3MDQ A;  2O8D B;  1YVU A;  1N34 K;  4H0Y B;  3C6H A;  4I6M B;  4BC4 A;  5HRN A;  5M1K A;  4DFK A;  3AVM A;  4BR0 A;  4IG3 A;  2E4L A;  3BZC A;  4BDP A;  5KRS A;  4AM7 A;  2QTD A;  3WNF A;  4N56 A;  3TWH A;  1VSM A;  3O9S A;  4CJU A;  3AAP A;  3OW2 M;  3R8E A;  3DWL A;  4KHQ A;  5F1X A;  4CES A;  3GDQ A;  3DLE A;  2GTD A;  3ZYY X;  1XWL A;  2A5X A;  5B8H A;  1BQN A;  2X78 A;  4DTU A;  4BRC A;  3ATU A;  3CJ7 A;  4BRD A;  2P9N B;  3QIP A;  1KSP A;  3LM9 A;  4F2R A;  3THY A;  1V4S A;  2PYJ A;  3MXM A;  1BO5 O;  5EU7 A;  5J1E A;  5GAG P;  3VQ5 A;  1ZBH A;  1KTQ A;  3D2F B;  2G8W A;  2W6K A;  3V81 A;  4JKA A;  1YI2 N;  3BP8 A;  3DXK B;  5AZI A;  1WNS A;  3LP3 A;  1DEJ A;  3QEV A;  5C15 A;  3K9K A;  4CD3 A;  1RT3 A;  4H0T B;  3H6E A;  1NK5 A;  1OKJ A;  2P51 A;  4A57 A;  3TAG A;  2KLA A;  1RTD A;  2H3G X;  1XC3 A;  4BC3 A;  4GKK K;  4I6M A;  1JXE A;  4DR1 K;  4C8M A;  1EQY A;  1U45 A;  3AY9 A;  1B92 A;  4FWN A;  4A61 A;  1ASU A;  3HK2 A;  4KI6 A;  4HCC A;  3U3G A;  3O9T A;  3ENO A;  1NK8 A;  1UOC A;  1QSS A;  2YJE A;  1N6Q A;  2HW3 A;  4CGD A;  2G8K A;  3AVN A;  4DR5 K;  4E1M A;  5KQ8 A;  3M8R A;  1CLQ A;  4BQL A;  4EHU A;  2A1S A;  4H5N A;  2OPS A;  4GKJ K;  1DTT A;  5DM6 L;  3CCR N;  3TU5 A;  4LF7 K;  1Z26 A;  4DFJ A;  4BC2 A;  1VQL N;  4LSL A;  3PY8 A;  4KH6 A;  4Y1D A;  3N4Q A;  3MXJ A;  4Z4E A;  4DUZ K;  3C0B A;  3BUZ B;  3LDS A;  2HND A;  3N4P A;  2RKI A;  2VG7 A;  3AVF A;  5AQV A;  2KFZ A;  4FLX A;  4J2D A;  4DFP A;  4E7K A;  2DY4 A;  5KPR A;  4CIG A;  3VGL A;  2O8C B;  3CMA N;  4CJQ A;  3HM8 A;  4A59 A;  2E2P A;  5JVG L;  1CZA N;  4M3Z A;  4A62 A;  3DJC A;  3UB5 A;  3LDN A;  5AQM A;  1T6D A;  2YKM A;  4CEQ A;  4K42 A;  4KV8 A;  1HMV A;  3OJU A;  4JI4 K;  2YX6 A;  4H0P A;  5LJW A;  1U4B A;  4CVN E;  4W5T A;  4IJA A;  2QK9 A;  2O8B A;  4FOE A;  4JS4 A;  3QFP A;  3F73 A;  2A6A A;  1WSG A;  4WYB A;  3CQX A;  3WNH A;  2G8U A;  3C95 A;  4IJN A;  3ID8 A;  3VF4 A;  3OYD A;  3PX0 A;  1NKC A;  1RT1 A;  3ZCM A;  3TAR A;  3CIP A;  1WSE A;  1HKB A;  3P83 D;  3QML A;  5LY3 A;  5BR9 A;  2IVN A;  2QA4 N;  3F5T A;  4M3Y A;  1NOY A;  4FLY A;  3KKS A;  3WXJ A;  4BR5 A;  3FR0 A;  4B1X B;  1QHA A;  1JLE A;  3WEE A;  2QWM A;  1C0M A;  2OPQ A;  3O1B A;  3TPQ A;  3KK3 A;  3HP6 A;  3OYC A;  3LWM A;  3BGR A;  2J4R A;  3V1O A;  1VQ6 N;  1MU2 A;  5HRO A;  1HUX A;  1C1A A;  1TUY A;  5E41 A;  3TR8 A;  4CBX A;  4N76 A;  1G15 A;  3JS6 A;  4IEI A;  4AIL C;  1E4F T;  3J81 O;  4DWI A;  4DTO A;  2F7T A;  1OVQ A;  3RSE B;  1NOZ A;  3CCJ N;  1RDD A;  5AQX A;  2WBN A;  3R6M A;  1WBB A;  2KKZ A;  3DRP A;  4FWL A;  3H1Q A;  4E7L A;  3VQ8 A;  4ID5 A;  1UAX A;  4B9T A;  3MEC A;  3CFO A;  4DQ8 A;  4YHH K;  1H1V A;  2E1Z A;  2ASO A;  3VA0 A;  2CGJ A;  3RSE A;  1HYV A;  1VQO N;  4GVM A;  2HHQ A;  1C0T A;  1VRT A;  3SBT A;  3CJC A;  1X9M A;  2KZZ A;  3PV8 A;  2ZJQ L;  2IS3 A;  2Q0R A;  1VQP N;  1K9M O;  1OH6 A;  3MXI A;  1HPZ A;  4OPJ A;  4B8C A;  3OYK A;  2HBJ A;  3I0S A;  1BWF O;  1FJG K;  3I33 A;  3SV3 A;  4W5Q A;  4QCL A;  4KFB A;  4OGC A;  4B9N A;  4NCB A;  3L2W A;  3EZW A;  3ZSV A;  4AM6 A;  3THX B;  1SKW A;  5D3G A;  3SUN A;  1ASV A;  3K9J A;  2AJQ A;  4BE0 A;  4H5T A;  1NWK A;  2NRV A;  4O0J A;  2FC0 A;  2HF3 A;  4BGA A;  4PHT X;  3QET A;  4CGJ A;  2OZM A;  4Z4I A;  1J53 A;  2CH5 A;  4WFB L;  4F3O A;  3S41 A;  1ZXO A;  1HYS A;  2DTU A;  4DR6 K;  1K8K B;  4CBU A;  3JSM A;  3THW B;  3H46 O;  1QSL A;  3THY B;  4O8U A;  1QZ5 A;  4DFM A;  1X3M A;  4ZTF A;  1MA9 B;  4NXM K;  1NG9 A;  4B9M A;  2PAV A;  2P9L B;  3AVK A;  4FPA A;  4A5A A;  4LFA K;  2QEX N;  2XO7 A;  4CJ7 A;  3HTV A;  4DV4 K;  4DSF A;  3FGU A;  3OA9 A;  3OVN A;  1QVG M;  3WNE A;  1YUW A;  4NLC A;  3RMA A;  1W0H A;  1QS4 A;  3DOL A;  3CQY A;  2P9P B;  5EX5 A;  4WCE L;  4IDH A;  1WAF A;  2Q31 A;  5C25 A;  1KVB A;  4B9L A;  4PL8 A;  1XI1 A;  3VGM A;  3CC7 N;  1S1W A;  1YXQ A;  3HL8 A;  5M1Q A;  3BY5 A;  2QM1 A;  1HR0 K;  2HMI A;  2Q1N A;  4FJ9 A;  2FSJ A;  4X65 K;  1SL1 A;  1W97 L;  3M8P A;  3E9P A;  2ATQ A;  3EE9 A;  1RNH A;  3O08 A;  2HMP A;  3RMB A;  3MAQ A;  1VQK N;  1XNR K;  4WF9 L;  4K8X A;  3OYL A;  1E4G T;  3KLI A;  3L2V A;  1NK9 A;  4ELU A;  3M6G A;  3Q7C A;  1LWC A;  1TL3 A;  2NRR A;  1DKG D;  1A5W A;  3D6R A;  5FPN A;  5ELZ A;  4HVJ A;  1GLA G;  4CF9 A;  3O4N A;  2OCE A;  1HJR A;  5AQK A;  4XH1 A;  4M41 A;  3TSP A;  2PBD A;  2E88 A;  3VEV A;  2ZE2 A;  3CF5 L;  3QBX A;  1K73 O;  2O8C A;  4FLU A;  3IRX A;  5T7B A;  4BVO A;  1Z6R A;  2YHX A;  5AZI B;  3HOS A;  5M1O A;  4NCG A;  1LCU A;  1HNV A;  3O3H A;  4EZ9 A;  4JV5 K;  4PQU A;  2KW4 A;  4CIE A;  4UQG A;  4XEI A;  2RF2 A;  5KI6 A;  3U4L A;  4CHN A;  3EYZ A;  3IKM A;  4FLW A;  1VSE A;  2Q0U A;  4WQ4 A;  2ITM A;  1CXQ A;  4DV1 K;  1WOQ A;  2QW9 A;  4WQ5 C;  5CZ1 A;  3L2Q A;  4B1W B;  5AFU H;  3NH0 A;  4JAX A;  4CHY A;  1RBR A;  1LWE A;  3AO2 A;  3HP9 A;  4H5R A;  2D0P A;  1KVA A;  4KPY A;  1NGG A;  4B9V A;  3AVI A;  2B4J A;  4AHR A;  1Z05 A;  4GMJ B;  4IO8 A;  4RG8 A;  1S6Q A;  4PKG A;  5M1N A;  4PL7 A;  3LDO A;  4FWO A;  4CJK A;  3DYA A;  4E1J A;  2CH6 A;  3VMF B;  1IBM K;  1FW6 A;  4EHT A;  1IH7 A;  3HXM A;  1BA1 A;  4C23 A;  4FPB A;  4FM0 A;  1ZYQ A;  4JI5 K;  4BRH A;  5EY4 A;  1FK9 A;  4N41 A;  3KK1 A;  4IXC A;  1TKT A;  4FSV A;  3J7Z O;  1VQ5 N;  3VTI A;  4CJ3 A;  2E8A A;  3NGZ A;  3CJB A;  1D8Y A;  3ZT1 A;  5SZT A;  2YHA A;  3SAF A;  4CEB A;  4BDZ A;  1REV A;  3SV4 A;  1T03 A;  4FCY A;  4IEE A;  4DF4 A;  4JI1 K;  4PY5 A;  1EWQ A;  5KPT A;  3V1R A;  3DRR A;  4LF8 K;  1ATR A;  5HOO A;  3F9K A;  2XY7 A;  4GV6 A;  4WFN L;  5AQG A;  1ILY A;  2P5G A;  1M90 O;  2YKN A;  2NZT A;  3A5O C;  3QLH A;  4I9L A;  2WUS A;  4CJF A;  4JI8 K;  3UKR B;  2HVI A;  3CCU N;  1I94 K;  1VQ8 N;  4YOX A;  1ZBI A;  4C1N I;  4CGG A;  1KC8 O;  3ZSW A;  3S3M A;  5AQO A;  4K41 A;  3E66 A;  1A5X A;  3A2F A;  4N47 A;  3L3V A;  3KVG A;  2FLO A;  2E5L K;  2ASP A;  5CYQ A;  3VQQ A;  2FBX A;  1VSF A;  3AA4 A;  1P8Z A;  4ILG B;  4JKD A;  4HUE A;  3KJV A;  1S1V A;  2F8T A;  2GUP A;  1HNW K;  2O4G A;  3KZB A;  1T44 A;  3TTC A;  2VGN A;  4MDB A;  4TSX A;  4FJ8 A;  4LH4 A;  1D5A A;  1BGX T;  4JD2 A;  2BGG A;  2YNF A;  1BQM A;  4OVL A;  1S6P A;  3CQ8 A;  3FZH A;  3QDK A;  4N5S A;  2E2Q A;  3O9Q A;  3FE1 A;  4CF1 A;  1L5U A;  2ZGY A;  3THV A;  4JKG A;  4O44 A;  4JI3 K;  4F8R A;  3IG1 A;  1NGH A;  1X9W A;  1TV6 A;  3SUP A;  1JCG A;  3ITH A;  2HOE A;  1C0U A;  3AAQ A;  1IV0 A;  2HBM A;  4HTL A;  4M3W A;  2Z1J A;  4FW2 A;  2WC9 A;  1HNI A;  1NJW A;  1Q18 A;  4KHP K;  3AVG A;  3VQ9 A;  1L3V A;  2OZS A;  4NYN A;  3CM6 A;  2G8H A;  4JKE A;  2P9P A;  3HO1 A;  3LZI A;  1NKB A;  4FWK A;  4K0K K;  1BHL A;  3EZ5 A;  4I7F A;  2I7N A;  3VQ6 A;  3SBG A;  2RHK A;  3CET A;  3AGK A;  1HX1 A;  3C94 A;  3M8Q A;  4AQY K;  2GV9 A;  5AZJ B;  5JIC A;  2IGI A;  3M3Z A;  3VQB A;  4BGB A;  4EFH A;  4DSE A;  4FJ7 A;  3J8A A;  3NBP A;  1KLN A;  3IDH A;  4KH5 A;  3AA3 A;  3C65 A;  3MWT A;  4FJM A;  4JKB A;  1O13 A;  2G8V A;  1U2V A;  4DSI A;  3U6F A;  4A2B A; 
#chains in the Genus database with same CATH homology
 4YY3 K;  4CVN E;  3OTO K;  5LMN K;  4DV2 K;  3J7A P;  4JV5 K;  4DV5 K;  4JI6 K;  5LL6 Z;  2E5L K;  1IBK K;  1XMQ K;  4DV1 K;  3T1H K;  4DR3 K;  4LF5 K;  4X62 K;  4CW7 B;  1XNQ K;  1HNW K;  4OX9 K;  3JAM O;  4DR6 K;  4NXN K;  4GKK K;  5AJ3 K;  4DR1 K;  3T1Y K;  4LF9 K;  5IWA K;  4NXM K;  5A2Q O;  2UXB K;  1HNZ K;  4LFA K;  4DUY K;  1XMO K;  1IBM K;  4DV6 K;  4B3R K;  4DR5 K;  4LFB K;  4X66 K;  1HNX K;  4JI3 K;  2UUA K;  4DV4 K;  3J81 O;  2UUC K;  2UUB K;  2F4V K;  4JI2 K;  4JI5 K;  4DV7 K;  4JI7 K;  4GKJ K;  1N34 K;  4LF7 K;  2VQF K;  3J80 O;  4KHP K;  4DV0 K;  3J7Y P;  5FLX O;  4JYA K;  1N36 K;  1HR0 K;  4YHH K;  4X65 K;  4DUZ K;  4B3T K;  2VQE K;  1IBL K;  2UU9 K;  2UXC K;  5BR8 K;  5IT9 O;  4LF4 K;  4K0K K;  4JI1 K;  1XNR K;  2ZM6 K;  4DR4 K;  4DR2 K;  5LMU K;  4LF8 K;  4DV3 K;  4AQY K;  4DR7 K;  4LF6 K;  4B3M K;  4V19 S;  4B3S K;  1FJG K;  1N32 K;  4JI0 K;  4LFC K;  1J5E K;  2HHH K;  4JI8 K;  4X64 K;  1N33 K;  1I94 K;  4JI4 K;  2UXD K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...