3DLLL

The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect trna positioning
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords rRNA-23S ribosomal RNA
publication title The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect tRNA positioning
pubmed doi rcsb
total genus 16
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dllL01
1VQKN 5DM7L 4WF9L 3CD6N 1Q81O 3CCLN 1YIJN 4WFAL 5GAEP 3CCMN 1K9MO 1VQ9N 4WFNL 1VQPN 4UY8O 1YHQN 1NJIO 4U67L 1VQ8N 3CMEN 1YI2N 1VQ6N 3CCRN 1Q86O 3I55N 1YJWN 1N8RO 3CMAN 3G4SN 1VQON 1VQNN 1ILYA 1KC8O 4IO9L 1VQLN 1M90O 3G71N 5GADP 3CCSN 1VQ5N 3DLLL 1YJ9N 1OVYA 5JVHL 1K73O 1QVFM 3CCVN 5JVGL 3I56N 4IOCL 1VQ7N 2QEXN 3CCEN 3J7ZO 3PIOL 5GAHP 3CPWM 3CC4N 2ZJRL 1JJ2M 1VQMN 1KD1O 3G6EN 3CF5L 5HL7L 1K8AO 3OW2M 5H1SQ 1KQSM 5MLCQ 3CXCM 1YITN 3CCUN 1Q82O 1VQ4N 1QVGM 2ZJQL 3CCQN 1M1KO 3CC7N 2OTJN 2OTLN 5DM6L 2QA4N 3CCJN 1W2BM 1YJNN 1Q7YO 4IOAL 5GAGP 1S72N 2ZJPL 3PIPL 4WCEL 4WFBL 3CC2N
chains in the Genus database with same CATH superfamily
5BRDA 2YKNA 2I7NA 4X65K 3VQ6A 1BIZA 2YX6A 5BRHA 3U3GA 1W97L 3BF3A 1RT7A 3O4QA 3OVNA 2WFBA 3QBWA 3B6OA 3ZT1A 4CJVA 2YKMA 3NVMA 3CJ7A 2GWJA 2E8AA 4KHPK 1RILA 4B9MA 1WBBA 3S9HA 4KO0A 4H0XB 3WXJA 4B1WB 4E7JA 3CI5A 5AQKA 3HSCA 3T19A 4F3OA 4CGGA 4A5AA 4KI4A 4EHUA 2XY8A 3U4LA 4DUYK 3HO1A 2VGNA 5TKYA 3SMPA 3TAQA 1YJWN 3DOLA 5AQXA 4FVUA 1B9FA 4CF9A 5BN8A 4FM2A 4OVLA 2ZQBA 4JS4A 3ZLJA 1VQ5N 3ZEUB 3O9QA 2ATQA 3I8DA 1N6QA 4OLBA 1SKRA 4DB3A 3ZX2A 1W9HA 4CGIA 1S3XA 3MK6A 3THYA 3O9TA 1TL1A 5AQHA 4HTUA 2VWKA 4DFJA 5CY4A 1CXQA 3RMAA 4CF1A 1WN7A 3MEDA 3TAMA 3AGRA 4GKJK 3QEWA 2HHSA 5AQLA 1K8AO 1MWKA 3MN5A 4DU1A 2V52B 4PKHA 1RTDA 1NGGA 3MEEA 2A1SA 2HNYA 2XRIA 4KH4A 4W5TA 4AF1A 5LMNK 2E4LA 4NCGA 4CEQA 2HHWA 3AA4A 2ZJQL 1Q18A 3DRPA 4BR5A 2NUBA 4GV3A 1S5JA 4H0YB 2O4GA 5BPLA 4V19S 5KPRA 2NRVA 2IVPA 1NLVA 2AP1A 1S72N 4FZYA 2ZJPL 1MU2A 4I2PA 4OKEA 3ZSRA 3HOTA 3JSMA 1NOZA 3AO2A 1KFDA 3I33A 3E01A 3TPQA 1NG9A 1Q81O 3CIPA 4CJTA 5GAEP 2OANA 1I94K 1LWFA 4CD3A 2HSTA 4B1VA 4CJWA 4JI4K 3QDKA 4CJ5A 2GBZA 1N5YA 3CETA 4DR7K 5IT9O 4XH1A 3ZSWA 1TKXA 4KHWA 1CLQA 4H5TA 4PL8A 1Y64A 4CGFA 2PFUA 2GTDA 4CJQA 1VSIA 3M5RA 4N47A 1JKHA 1VQLN 1XWLA 4BGAA 1SKWA 1JLEA 2Q1NA 3EZWA 1RFQA 2D0PA 2HBMA 4JD2B 1RBVA 4WQ4C 3LM2A 4J2EA 4CZMA 3RSEB 5F1XA 3HP6A 1JL1A 4DR6K 1ASWA 3JYTA 1U4BA 4K8XA 5C12A 1K6YA 2BDPA 2IVNA 1YVNA 4EFHA 4CHNA 3SUOA 4CHYA 1HNXK 2QI2A 4WQ4A 4CF2A 4IFEA 3L8BA 5J2PA 4Z4IA 4DLGA 3ENBA 3PUFA 4JI8K 4DSJA 1YF5L 2UUCK 3MECA 1HJRA 3HRGA 4PA1A 3WXLA 4LF5K 1KAXA 3CF5L 3NF9A 4JK9A 2P9NB 2O8FB 1CXUA 1X9SA 2CH5A 4KH6A 2P5GA 4ILHA 3RMCA 3AA5X 1C1CA 4CGHA 4O4GA 3SJJA 4LH4A 3DLRA 4XIUA 2G8VA 1IH7A 3OYAA 3PY8A 1WAFA 2KFNA 4MO4A 3DRRA 1RDWX 3CCJN 4N56A 2WC9A 4B3MK 3K9KA 3PO5A 4I9QA 2JGUA 3NAEA 3ULDA 3GE1A 2QW9A 5AQYA 4CIEA 1BO5O 2DFEA 3AAQA 3LAKA 4ZTFA 1U04A 4HVJA 3VTHA 3O80A 4BVOA 3VEZA 1HPZA 3CJCA 1K9MO 3QB0A 4U7BA 4DSIA 4LF9K 1BI4B 1HKCA 1ASVA 1JLCA 1TAQA 1KAYA 2GV9A 4ILJA 4BRGA 5AQUA 4K25A 3CCRN 1QZ6A 4QS9A 1Q86O 4GW6A 4E0DA 1DTQA 2FXUA 4UQGA 1S6PA 5EOYA 4K8ZA 1XQSC 1TYQA 1T6CA 3CHWA 2QKKA 4KHQA 1ZBFA 1IJJA 3QIPA 4CHQA 4DSKA 4BG8A 3LAMA 4CFCA 1VSLA 5M1OA 1GOAA 2YHWA 1FW6A 4CF0A 3QLHA 5M1FA 3QERA 5E41A 4RW4A 3IS9A 4ISGA 4PL7A 4I6MB 3DLKA 5AQVA 1RT6A 4AM6A 3J8AA 3VGLA 3IG1A 3U9ZA 3CM6A 4LY7A 5C2DA 3T1AA 2KTQA 4BRHA 5C25A 3O5BA 1U6ZA 3MX2A 2X6SA 1ZYQA 4NXNK 3KKRA 2G8FA 5BPMA 3BEXA 1XI1A 5AQSA 5CYMA 3E9LA 2G8IA 4YORA 3SBGA 1NNEA 1XMQK 4IZ9A 1NKBA 2KFZA 4GV6A 4F3TA 1QVGM 1SL0A 3VQAA 4NB4A 1M1KO 2DTUA 4FJ8A 3W0LA 4DSFA 3OYEA 1YJNN 3K58A 3SPYA 4KB1A 4DU4A 4Y1CA 1GLJO 3K5MA 4KPYA 2YNIA 3O08A 3L2QA 2Q0RA 5EX5A 3EO3A 2W42A 4JI3K 3ZX0A 1DT9A 1EXQA 2XY6A 5B8HA 1J5OA 3CJAA 2UU9K 4GY2B 2CH6A 1X9JA 2EX3A 3IMXA 2E2OA 4Z0UA 4H4MA 5KTQA 3QESA 5FPMA 3TAGA 3KK2A 4C8OA 3VEOA 2P9KA 5CR4A 4OO1J 3CQXA 3HOSA 4FVMA 4FJHA 3HXMA 1YTUA 4A2AA 3QFPA 4KB0A 3GL1A 1V4SA 3SQ4A 2F8TA 4DQSA 1W0HA 5KPZA 5AFUA 1BOTO 3NH2A 1U45A 2O8EB 4BR7A 4XH5A 4RW6A 4DR1K 4FLZA 3LZIA 4JI6K 2HBJA 4KAZA 5AZJA 4DF4A 4B3TK 2OZSA 2Z1GA 3BY5A 4JKHA 4CFDA 4ELTA 3VQ7A 1IKYA 2P5OA 5JLFA 4F9OA 4BRAA 1RDUA 4IOCL 1HRHA 3PIOL 3UB5A 1TKZA 1NOYA 4CZLA 4E7KA 1DEJA 1CZAN 3ZSOA 4DTOA 2A3ZA 3G6EN 3BZCA 5JMVA 1TK5A 5DMRA 3MCPA 3VTIA 3SAGA 1X1PA 3NE6A 4M3YA 3D2EA 3L2RA 5MLCQ 1LAWA 3O3FA 1HX1A 4DCHA 3QEXA 3CC7N 3B6PA 5LL6Z 3BZKA 3HL8A 3NF7A 4H0TB 2YHBA 4Q5VA 2PBDA 3V6DA 4RW9A 1TV6A 4WCEL 3O9UA 2HHTA 4BR0A 4MDAA 4DTNA 1K8KA 1NGEA 3A5LC 4M45A 5DM7L 5F2RA 3WQUA 4DR5K 1WNSA 3D6RA 4C1NI 1RCHA 1SS6A 4WFAL 4JHDB 3HP9A 4M42A 2ITGA 4IEEA 4KTWA 3ZSYA 3HK2A 2ASOA 2QWMA 4JYAK 1BQNA 4CD1A 3QMLA 2G8HA 3TAPA 1C1BA 2WTUA 1YI2N 2VQEK 3TARA 4DR3K 4K41A 4O5BA 1N8RO 5FPDA 1NGAA 4XEIA 1IBMK 2O8BA 4H5NA 4BROA 1NMNA 3AO3A 1VSFA 2E2QA 4CESA 4YDUA 4BDPA 1OVYA 3T69A 1UOCA 3LP3A 3FZHA 4JKDA 1RT4A 1DLOA 2PY5A 1OH6A 1B92A 1C0TA 5M1PA 5T7BA 3KJVA 4NCAA 3AVHA 4A61A 4Q0BA 5KRSA 2ASPA 4ID1A 3HJFA 3L6QA 3LDLA 3AVFA 1ZBLA 1VSMA 1ZBUA 3OBWA 4Z4HA 3AARA 1EO1A 4FWMA 3THXA 3OS0A 1HJOA 1L3SA 1KRPA 4L8RB 2A6AA 3MXIA 4KHNA 4RTFD 2P9SA 3JXUA 2F7TA 3DLGA 3AO5A 1HYSA 4KRFA 2OPQA 3RMBA 4H5RA 4BRQA 1YTAA 3P83D 1KQSM 4FWQA 1BG3A 1T05A 3AVMA 3SZ2A 2E20A 1DKGD 1JLAA 3SV3A 3CCUN 1GLCG 3HYFA 1HPMA 2R7YA 2H3GX 2YHXA 3L2UA 4K42A 2A40A 2DFFA 2FBYA 2HVHA 2IOCA 2QA4N 2WUSA 1W2BM 1BCOA 5C24A 3TTDA 2YV0X 4DTJA 3OYNA 2Q3SA 4DTRA 3PX4A 4BG9A 1JCEA 3H1QA 4BC2A 3BGRA 1T8EA 3ATVA 4IO8A 4AHSA 1D8YA 3CD6N 4B8CA 1VAZA 3PV8A 3LDPA 1LAVA 3DLHA 3E1YA 1D5AA 1S22A 2ZGYA 3AGKA 1SQKA 3OA9A 3ULEA 4BRLA 2KZZA 5SWMA 5JS1A 1VQPN 3IAYA 3CQ8A 3NMUA 4EIAA 2OPRA 1IO2A 5BR8K 4H5WA 1VQ6N 3NF8A 4N41A 4YOUA 4DUZK 4DWIA 3RWUA 4CZHA 2QKBA 3R9PA 4CEZA 3ZSQA 3EZ5A 2LSNA 2RPIA 4AHUA 3AVAA 4CZEA 3RRGA 4DQPA 4DTSA 4FLWA 4BREA 3ZT2A 4TSXA 5JVHL 1X3MA 5EVZA 1SL1A 1S1TA 4CEFA 2I7PA 1NJWA 2QWQA 4I9LA 1P8ZA 3V9XA 3G25A 4DV6K 4O44A 1RGIA 4FM0A 1N34K 3AVGA 3AO4A 1RTIA 1Z05A 3U9DA 3UIQA 2O8CA 2ZM6K 3ZSZA 4DQRA 1MDUB 1XUPO 3OYKA 1EKEA 1VQMN 3TAFA 2JLEA 4IDHA 2NRRA 4Y0WA 4E1JA 1G99A 2O8DA 1WAJA 2HMPA 3ZETA 3IFRA 5AQRA 1ZBSA 4CZIA 1SKSA 4R79A 4M3ZA 3AVIA 4JLHA 3ZX3A 4M7XA 1T6DA 4A62A 4Z4EA 2Q0UA 1I39A 3SCXA 2FSNA 5KGWA 1U47A 4M3TA 5AQIA 4H03B 3F5TA 1HYVA 3QINA 3HVRA 5AZIB 4E19A 4DG1A 2FLOA 3HTVA 5JLHA 4E7LA 3GG4A 4DS5A 3FE1A 3L3UA 3VERA 3PIPL 2D5RA 4CZJA 1T44A 4CJKA 3EN9A 1NKCA 2IGIA 2DY4A 4JK8A 1S1UA 3VN5A 2OPSA 3MAQA 2Z1HA 3CCLN 4CERA 1NGCA 4OX9K 4HUFA 4B9NA 4IFVA 3ID6A 2D0OA 1NGBA 4MFBA 1NJXA 4JI7K 4FK4A 4XH4A 4B9VA 5HBMA 1ZBIA 4UY8O 3OJUA 3HPGA 3IRXA 2YCHA 1NGFA 4ELVA 1XMOK 4FJMA 2RHKA 1R0AA 2Z1JA 4RW7A 4MQ3A 4LSLA 1YUWA 4FWSA 3GOIA 3WEEA 4JKAA 2QWPA 3WNEA 1ZXOA 3DLLL 4CCHA 3HM9A 5CZ1A 3VQEA 2WONA 3AO1A 4B08A 3LP1A 2A1RA 3IDHA 4IG0A 4M3WA 4F8RA 1KCFA 4CZGA 1QQCA 1REVA 2OCEA 4FXDA 3M8RA 4CBUA 4BRMA 4FLUA 4G9ZA 4KKOA 5KRTA 4CI6A 2JWLA 4A2BA 3DJCA 3HPOA 4K43A 1N32K 4X62K 4HWIA 2QK9A 3K5LA 4CGJA 3SMSA 3OYFA 4IEIA 1F21A 3ATUA 1LCUA 3OW2M 1DTTA 4H4OA 1XHXA 1VSJA 3EE9A 4O0JA 5AR0A 2X74A 1XNQK 4QS8A 1HKGA 4BVPA 3O4NA 4PUOA 1NWKA 3C7NB 1Q9XA 2YNFA 2D0BA 3T1HK 3QFUA 1L5UA 2FBXA 3H08A 2B5JA 2YI1A 3TU5A 3B8AX 1KVAA 3MN9A 3KD5E 4LF4K 2A41A 2RKIA 1FKOA 1IBKK 1EX4A 1VQKN 4DTPA 1HNZK 4AM7A 1HNIA 4FJ5A 3VEVA 4CECA 4DFPA 2CGLA 4RG8A 2GELA 3O3HA 2F9WA 1NBWA 5AQFA 5AZJB 3ID8A 4FJNA 5GINA 3NBPA 4M63C 3LDNA 5GIOA 2YHYA 4M7YA 3T3FA 1S9GA 3R8EA 3L4IA 4Y1DA 3DXKB 3WNFA 2HMIA 2FSKA 4DTUA 2QTDA 4BWMA 2W6LA 4GVEA 3KK3A 3SV4A 1HYZA 5AQOA 4H0PA 4HUEA 4DF8A 3HPHA 1XC3A 2X78A 4Z94A 4NYFA 1J54A 2E2NA 3AVNA 3ZEUA 3KIOA 3C94A 5BR9A 3KK7A 3PSFA 4IBNA 4I2QA 3I56N 3DLEA 3FZKA 1GLBG 2E6MA 3KWGA 5FPEA 2P9LB 3WQTA 4F2SA 4ELUA 3FZFA 2PZSA 2EHGA 3LANA 2G8WA 4YOTA 3R1XA 2P1JA 4JI1K 4FWPA 3NH0A 3K2PA 3NGIA 3LPUA 1IKXA 5ADXA 3C0BA 5AQPA 3IKMA 5C42A 4BY9C 1OKJA 1K8KB 2VYPA 4ICLA 2IS3A 2KHOA 2YJFA 1RBSA 3QNNA 1EWQA 2HOEA 3RRHA 4KFBA 3E9PA 3TSQA 1VRUA 2JWKA 4EZ6A 1J6ZA 4B9SA 3AVCA 3MN6A 4C8LA 3F73A 4FW2A 3WUHA 4CZFA 2Y1JA 2E6LA 3NGYA 1ATRA 3QBXA 4J2DA 2F8SA 1TUUA 4Z4GA 3BP8A 4W5QA 2O8BB 1B9DA 1ESVA 2HHXA 3R6MA 1NK6A 1JLGA 1RTJA 4R5PA 5EY4A 1VSEA 3OYMA 3ALYA 2W40A 1KTQA 1RTHA 4CBWA 1TGOA 4X64K 1X3NA 4FJ9A 3R3LA 4PQUA 4FCYA 3D7EO 3H6EA 1U2VB 4NLBA 4C8NA 3V81A 4U67L 5I3UA 5KPTA 3P4IA 3O9RA 3UKRA 3VA0A 5GIPA 3A5NC 5CZ2A 1QSYA 4ILGB 4RW8A 1BU6O 3QEIA 1TAUA 4JK7A 4CK1A 2OPPA 4JD2A 2P9SB 4E89A 5I9EB 1HQUA 3DXMB 4CJLA 3RSEA 4BDZA 1QVFM 4DSEA 3VQDA 3RR8A 2ZWHA 4CHOA 4DV2K 2BANA 4CW7B 4E7IA 2ZF5O 2E5LK 4E1NA 1VQ7N 1L3TA 3OHRA 4O8KA 1WB9A 5EXWA 4ZHRA 4BRCA 1JXEA 2QXLA 2AA4A 4GNIA 3VMFB 2ZJRL 3VQQA 3OYBA 4BR2A 2NRXA 4FL9A 5HL7L 4IKFA 2UUAK 2O8FA 4ZTJA 2ZE2A 4JKGA 1VQ4N 4A57A 1BQMA 3V9ZA 3UKUB 5KGXA 3A0IX 3ULEB 2OTLN 4DV3K 2P9IB 4FM1A 4CZKA 3NF6A 3H45C 3SQ2A 2RN2A 1Q9YA 1EWRA 3D2FA 4JNEA 5KQDA 3KD1E 3I0RA 4WF9L 4JAXA 3U8XA 4LF6K 2P9PA 3AVJA 4W5RA 1UWBA 4BC5A 4EP4A 1NJZA 4CE9A 4YY3K 3TSPA 3MWTA 3C6AA 3ZYYX 5C0YA 4BACA 1KXPA 3V9SA 3LP0A 2UYTA 4B9QA 3AVLA 3VEYA 3OYIA 1MA9B 3CFRA 1NK7A 3VPZA 3VQPA 5HLFA 1NGIA 4JRQA 4RWTA 3FR0A 1XHZA 3QNOA 1VQNN 1BL3A 3M8QA 4DV5K 2A42A 4X66K 5HRNA 4FK2A 4KTZA 5GADP 5FROA 1YJ9N 1NGHA 1WSFA 4WQ5C 4YFUA 2IVOA 3DLBA 4DKWA 1K73O 1RDCA 3K5NA 4FJIA 5M1NA 4E1MA 2DPNA 3C65A 2XY5A 1NK5A 3BUZB 3THYB 1HKBA 3HZ6A 5KI6A 4HUGA 2G8UA 2Q2RA 3ASMA 5ELZA 4WQ5A 3JAMO 4FJLA 3DRSA 4Z4CA 1LWCA 2NLXA 3E66A 2HHHK 1JJ2M 4CIFA 3HSTB 1NKEA 4FOIA 5AFUH 2V51B 2P9UA 2GX9A 3ZCMA 3CM5A 3TR8A 5C2FA 5E84A 4FJKA 2GEMA 5CYQA 2NRZA 1O13A 4Z4FA 4FWRA 1NJYA 1E3MA 3ZT4A 2UXCK 2NRHA 3LP2A 5D3GA 4B8AB 2FBVA 5BREA 4BE0A 3CXCM 3P5JA 3VEXA 2E2PA 4FPAA 4ISEA 1C0UA 3MCAB 4DR2K 3OYGA 1SV5A 1D9DA 3Q7BA 1SAZA 4OKJA 4M3UA 3O9SA 1WSHA 3IUCA 4FWKA 1TK0A 3QO9A 5K14A 3M8PA 1I3AA 3V9WA 3C6TA 1C6VA 1XNRK 2E1ZA 3THWA 1J9AA 1FK9A 4B1YB 4WFBL 3CG7A 3LDOA 3FFIA 3VA3A 3SBTA 2Q31A 4DFKA 3LWLA 3F9KA 1RBTA 3CPEA 3H3NO 4CIGA 1WUAA 4I7FA 1X9WA 4WFNL 1HR0K 5BRFA 1LWEA 5J2QA 2GUPA 3K59A 4FZXC 1YHQN 3ZT0A 1A5XA 2HHQA 3BF1A 1NM1A 3QIOA 1O1WA 3L3VA 3WXMB 3AVKA 4OPJA 4PWDA 5M1KA 4H5VA 4KHSA 4CK2A 3G4SN 1N33K 3AV9A 4MLHA 3F9MA 1M90O 3HM8A 4DTXA 3DOKA 4NLCA 1VK0A 2VG5A 1QHTA 3VEWA 4H0VB 3E9OA 4CFAA 1KVCA 3OS1A 3MEGA 3FLCO 4AH9A 2YNGA 1WBDA 4C1NK 4BRNA 4IXCA 3O8MA 3U3YA 3EYZA 1GLLO 4CF8A 5JICA 4QAGA 3WT0A 3ZSVA 2ZD1A 3KLGA 1QZ5A 4B9LA 1LOTB 4BWJA 3V9UA 4CVNE 2UUBK 4CEOA 2F9TA 1RDDA 1GLAG 4MDBA 5FDLA 2BGGA 4AILC 3EKUA 4FO0A 4G1QA 5C10A 4YNQA 3LL3A 1OH5A 1XC9A 1BGXT 2QWRA 1U48A 3G0ZA 3LM9A 3KLIA 1NMDA 2B6AA 3SYZA 1Q82O 4JV5K 1JLBA 1TKTA 4CBXA 4YOXA 5HRSA 4FLYA 5EU7A 4PKGA 5SZTA 5DM6L 4NXMK 4BR4A 1JLFA 3DI6A 3WXIA 4IG3A 3L0QA 4CJRA 2ITMA 3QETA 1TL3A 5TKWA 3S3MA 1D4XA 4HCBA 1HLUA 3G10A 1NGDA 1S6QA 1Z6RA 4LFCK 1YVUA 3EL2A 5AJ3K 3SAHA 3K0SA 2BE2A 3P1GA 5AQMA 3O6WA 1YIJN 1SUQA 4JHDA 5AQZA 4CJUA 3CCMN 3O4WA 2IAJA 4E3SA 3RR7A 3M6GA 2NNWA 2XO7A 4FYDA 4N5SA 3V1RA 3FZMA 1RBRA 4AHRA 1IG9A 4CK3A 2YJEA 2A5XA 1BWFO 3A5MC 1RT3A 1TYQB 3G71N 1NU0A 4IFYA 3PX6A 2Y1IA 1E4FT 2QM1A 3ZSXA 3SI6A 4CFBA 1C0MA 2HF3A 3FZLA 2KQ2A 3N4PA 2FF6A 4F2RA 3L4QA 4YOYA 4DSLA 2KLAA 1SZ2A 3J7ZO 4OLAA 5GAHP 4JKFA 4FW1A 3J7YP 3NCIA 4FLVA 3RTVA 3M3ZA 3GDQA 5AQNA 5LMUK 3KKSA 4BRFA 3OYDA 1WSJA 3N4QA 2PYLA 5I42A 2YHAA 2WBNA 4OGCA 5JS2A 1W7AA 1QE1A 3TSUA 4B1UB 4CJ7A 4N76A 5F0XA 5LY3A 1BISA 3MWPA 1T03A 3HI0A 1QQMA 5J1EA 4B1XB 3HVTA 4GVMA 1N36K 4KTQA 2Z1IA 4DS4A 1WSEA 4CJ3A 1LW2A 3MXJA 1BUPA 3KK1A 4J2AA 3M1FA 3ENHA 4FWLA 4DLEA 3VESA 3NGZA 5J2NA 3TANA 3UKRB 4NCBA 3KZBA 3AA3A 1QHAA 1S1VA 3ITHA 4QOZB 5CHIA 3RMDA 4DV4K 3M8SA 3LALA 4DQQA 1QTMA 4QCLA 5LJWA 1YT3A 1JL2A 3WNGA 4B9UA 4FK0A 1VQ9N 3SJHA 3C95A 3F2KA 1WSGA 4BQZA 4AQYK 4FLTA 1NJIO 1WLJA 3H3OB 2P9KB 1NGJA 4OJRA 3NDKA 4CEDA 4EAHD 4FWNA 1NK4A 2E88A 4OGEA 2HBLA 2VWJA 1YAGA 1ILYA 4KI6A 5HOOA 1KAZA 2RF2A 4JEPA 4BE2A 2GUIA 3K5OA 2VG6A 3CYMA 4DHYA 3J80O 2HNDA 4HCCA 3SAFA 4LD0A 1NK8A 1L3VA 3LDSA 1NK9A 3VF6A 4FJGA 3KLFA 5IWAK 1Z26A 3T1YK 4CJEA 3CCVN 5JVGL 1T3VA 3VENA 3P39A 3CCEN 3P31A 3LWMA 4JKGB 1RBUA 2V7ZA 4K0KK 3CC4N 4KV8A 3CERA 3TAEA 3SNNA 4JN4A 3EE8A 1KLMA 1LW0A 2IDOA 2FSJA 2VGMA 4ID5A 4DV0K 4E7HA 3C6HA 3GBTA 5J2MA 2HHUA 1JLQA 5AQJA 2CGJA 2CGKA 3D2FB 3D0PA 2FC0A 5BPNA 1CZBA 3D2EB 4DMNA 4JRPA 3PLAA 4FWOA 3ISNC 1WOQA 3QICA 1VSKA 4AHVA 2P9PB 4AHTA 4RCHA 3CJ1A 3EEQA 1G15A 4FSVA 4JI5K 4JKEA 1DGKN 4C8KA 1IKWA 4JI2K 2VWBA 5AZIA 1Q7YO 5AQTA 3VQ8A 2XY7A 3OBYA 2J4RA 2VG7A 3ZT3A 1BCMA 5A2QO 3BDPA 1JCGA 4C23A 1BA1A 2BTFA 3CC2N 4ISFA 4KH5A 1HUXA 4PHTX 4KREA 3C6UA 4F4KA 4O0IA 1TVRA 5FLXO 5C15A 1U49A 4CEEA 3A5OC 2V7YA 1UAXA 1MWMA 4JKBA 3SQ0A 3DWLA 3A8YA 3VF2A 4IJAA 4W5OA 2BUPA 4CEAA 2ZGZA 1GOBA 4YOVA 3OS2A 4DTMA 1IV0A 1WSIA 3MX5A 2ASMA 1HMVA 2BH1A 3CJ9A 4MO5A 3VQ5A 1Z25A 3MN7A 1RT5A 3NHGA 2UXBK 4DU3A 4JKCA 3CMAN 1KC8O 4IWVA 2DFHA 1Y97A 4FPBA 3VF4A 1HNWK 2P9UB 1ATSA 2PYJA 3H1VX 1L3UA 3KTQA 3O1BA 3VQBA 3OTOK 5AQGA 1IKVA 4BRDA 1KSPA 3TTFA 2WOMA 3LDQA 3AY9A 4O55A 3V1OA 4JS5A 5M1QA 3OJSA 1J53A 4M3RA 1IBLK 2UXDK 3EKSA 4GMJB 3S41A 1RT1A 3O3GA 4C8MA 3V4IA 4IDKA 1QQNA 2FBTA 4CHPA 3THXB 3KVGA 1RNHA 3Q7CA 1UA0A 1A5WA 1RT2A 2HW3A 1ATNA 1IG8A 2YNHA 3THWB 2EWSA 4KHYA 4CJFA 1FXXA 4GV9A 1C0FA 2ETJA 3S3OA 1EETA 2HB5A 2NRWA 3P38A 2PAVA 3NVKA 3OYCA 5HRPA 3C7NA 2QWOA 1P90A 4M41A 2QXFA 4J8FA 4J2BA 3CCQN 1H1VA 3SQ1A 2Q36A 1FKPA 4YOWA 1QSLA 4GKKK 2QWNA 3TWHA 3KWIA 1TKDA 1S1WA 1EP4A 2W41A 2P9NA 3UE5A 5ADXH 1QQOA 3DAWA 4EZ9A 1V4TA 2D4WA 5DK5A 2HVIA 2OYQA 4W5NA 3KHYA 3QEPA 4WE1A 3DM2A 3MXMA 2QWLA 5FRMA 1GLEG 2D1KA 2D0CA 5CE3A 1ZBHA 3SLCA 3VOVA 5LJVA 3THVA 2Q97A 3D45A 4LC9B 1X9MA 1A5VA 1OH7A 4OPAA 1VQ8N 3CMEN 2X6NA 3CFPA 1OH8A 2VCPA 3DXKA 2P51A 4FJJA 4LH5A 3AVBA 1GLFO 3ENOA 4IJNA 3VETA 3CQYA 1RDAA 1BI4A 5FRNA 4LF8K 1RDBA 2B4JA 5HP1A 3L2WA 3WNHA 3W3DA 3FGUA 2FF3B 5FPNA 3I0SA 3J7AP 1BIUA 4B3RK 2QEXN 4FJXA 4KHUA 3H46O 2F96A 3VGMA 2O8CB 3CPWM 3SUNA 1BHLA 4DFMA 4OKKA 2P9LA 3OYHA 2KW4A 1HNVA 2GWKA 2HNZA 4NYNA 1YXQA 4PKIA 4LFBK 5HROA 2O8DB 1UA1A 3HT3A 5H1SQ 3KLEA 4CGDA 3ZETB 3PO4A 4B3SK 4DQIA 4B1ZA 3DYAA 3I8BA 3OY9A 2IC3A 2F4VK 2HF4A 1YITN 3VQ4A 4AHCA 4CHZA 4I6MA 4OPKA 1SL2A 3PX0A 4A5BA 1C1AA 1JXBA 1BA0A 3AAPA 2OTJN 4BQLA 3SPZA 3AA2A 1CZ9A 4CJPA 4IOAL 3QEVA 5GAGP 3TI0A 3MDQA 1JCFA 3CJBA 2IIRA 4EHTA 4IOXA 4YDUC 2O4IA 1BDGA 4O8UA 4LF7K 4BR9A 1QSSA 4EP5A 5E26A 3CFOA 4FLXA 1ITGA 1TUYA 1HQEA 1OVQA 3J81O 1T7PA 2RE2A 3K9JA 2AJQA 1GOCA 3LZJA 1VHXA 3SUPA 3NFAA 4WYBA 3DMJA 3A2FA 3VQCA 1U2VA 4CJSA 3V1QA 4HHTA 1E4GT 5AQWA 4CJ4A 3KLHA 3MMVA 2KZMA 3I55N 4MLEA 1VQON 1R59O 4IO9L 3SUQA 3LPTA 4FJ7A 2HBKA 2I5JA 3WEEB 4QS7A 4BRPA 4JI0K 2OA8A 4DR4K 3T7ZA 3CCSN 1C0GA 4NO7A 4OPHA 3RVCA 3DXMA 4HTLA 3WXKA 5AQQA 2KKZA 1J5EK 3O1WA 4H0OA 2HHVA 1QS4A 5HRRA 3HBTA 4BGBA 3EY1A 3U6FA 1FJGK 4O5FA 1ZC6A 5KQ8A 4H8KA 4BDYA 4KBOA 4YHHK 4B3OA 2XHBA 2O8EA 4DQ8A 1NK0A 1KD1O 1S9EA 2G8KA 2W6KA 1GLDG 1Q8IA 4LFAK 3K57A 1ASUA 3SK3A 3OYJA 1KLNA 4B9TA 3PSIA 4BRIA 4L3QA 3VQ9A 3OYLA 3TABA 3S3NA 3FFKB 1VSDA 4A59A 3JS6A 4M3XA 4BC4A 3NH1A 4DV1K 3TTCA 4CEBA 3L2VA 1TK8A 1LV5A 4PY5A 3UKUA 5BN9A 4DV7K 4FOEA 1VRTA 2E1YA 2D0AA 1KVBA 2P9IA 4BRKA 2NRTA 4LSNA 2VQFK 1S1XA 1VSHA 4FZZA 4BE1A 1EQYA 1KFSA 1D9FA 2OZMA 2NZTA 3VGKA 4BC3A
chains in the Genus database with same CATH topology
1K8KA 1NGEA 1TUUA 3A5LC 5BRDA 5CHIA 5DM7L 5F2RA 2I7NA 3WQUA 3BP8A 2YX6A 3D6RA 4C1NI 1SS6A 4WFAL 4JHDB 5LJWA 5BRHA 1ESVA 1W97L 3BF3A 3R6MA 4IEEA 2WFBA 3QBWA 5EY4A 1VQ9N 3SJHA 2ASOA 2W40A 3NVMA 3CJ7A 3F2KA 2GWJA 2E8AA 4CBWA 2QWMA 1X3NA 3R3LA 4BQZA 3D7EO 4CD1A 3H6EA 1U2VB 4H0XB 4NLBA 3WXJA 4B1WB 3QMLA 3CI5A 4U67L 1NJIO 3H3OB 5KPTA 5AQKA 3HSCA 2P9KB 3P4IA 3O9RA 1NGJA 3UKRA 1YI2N 4A5AA 4EAHD 4FWNA 2E88A 4EHUA 4K41A 3U4LA 5GIPA 3A5NC 2VGNA 2HBLA 5TKYA 3SMPA 1YJWN 1N8RO 1YAGA 4ILGB 1ILYA 5FPDA 5AQXA 1BU6O 1NGAA 1KAZA 4XEIA 5HOOA 4FVUA 4JEPA 5BN8A 4JK7A 4H5NA 4BROA 1VQ5N 4JD2A 4DHYA 2P9SB 2E2QA 5I9EB 4YDUA 3DXMB 3SAFA 1OVYA 3T69A 3ZEUB 3RSEA 1QVFM 3O9QA 3VF6A 2ZWHA 4DB3A 3FZHA 3ZX2A 4JKDA 5M1PA 3CCVN 1S3XA 3MK6A 2ZF5O 5JVGL 1T3VA 4A61A 3VENA 1VQ7N 3P39A 3CCEN 2ASPA 3O9TA 3P31A 3OHRA 4O8KA 5AQHA 3L6QA 3LDLA 4JKGB 2V7ZA 4BR0A 3CC4N 5EXWA 4BRCA 3OBWA 2QXLA 3AARA 2AA4A 4FWMA 3CERA 4GNIA 3VMFB 2ZJRL 1EO1A 1HJOA 4BR2A 2NRXA 4JN4A 3AGRA 3EE8A 2A6AA 2VGMA 2FSJA 4RTFD 2P9SA 3JXUA 2F7TA 3C6HA 4FL9A 3GBTA 5AQLA 5HL7L 1K8AO 1MWKA 3MN5A 5AQJA 2CGJA 2CGKA 2V52B 3D2FB 4PKHA 1NGGA 4H5RA 4BRQA 5BPNA 3D2EB 1KQSM 3PLAA 4FWQA 4FWOA 1BG3A 1WOQA 3QICA 2E20A 1DKGD 2P9PB 4KH4A 3CCUN 4AF1A 1GLCG 4RCHA 1HPMA 3CJ1A 4FSVA 2H3GX 2YHXA 4JKGA 4A57A 1VQ4N 4JKEA 4K42A 3UKUB 1DGKN 2ZJQL 2A40A 1Q18A 3A0IX 3ULEB 2OTLN 4BR5A 2QA4N 2P9IB 2WUSA 1W2BM 4GV3A 2VWBA 4H0YB 5AZIA 5BPLA 3TTDA 5AQTA 5KPRA 1Q7YO 4CZKA 3OBYA 2J4RA 3H45C 2NRVA 2IVPA 1NLVA 2AP1A 1S72N 2ZJPL 4BG9A 3D2FA 1JCEA 3H1QA 1JCGA 4JNEA 4C23A 4BC2A 5KQDA 2BTFA 1BA1A 3HOTA 3CC2N 4ISFA 3ATVA 3I33A 4KH5A 1HUXA 4JAXA 3U8XA 4IO8A 3TPQA 4PHTX 4WF9L 3CD6N 2P9PA 1Q81O 5C15A 3A5OC 4BC5A 3CIPA 1VAZA 5GAEP 2V7YA 2OANA 4JKBA 1MWMA 3LDPA 3DWLA 3A8YA 3TSPA 3C6AA 3E1YA 1S22A 2HSTA 3MWTA 2BUPA 3AGKA 2ZGYA 1SQKA 4IJAA 3ZYYX 4B1VA 5C0YA 2ZGZA 3OA9A 3ULEA 4YOVA 4BRLA 1VQPN 3QDKA 1KXPA 3CETA 4B9QA 2UYTA 3MX5A 2ASMA 3NMUA 4XH1A 3VEYA 4EIAA 1MA9B 2BH1A 3CJ9A 3VPZA 4H5TA 4MO5A 4H5WA 4PL8A 1VQ6N 1Y64A 3MN7A 2PFUA 2GTDA 4YOUA 1NGIA 4CZHA 4RWTA 3FR0A 3R9PA 4JKCA 3CMAN 3M5RA 1VQNN 1KC8O 4IWVA 2A42A 1VQLN 4BGAA 4CZEA 4FPBA 2Q1NA 3EZWA 1RFQA 2D0PA 2HBMA 2P9UB 1ATSA 3VF4A 4JD2B 3H1VX 4BREA 5GADP 4WQ4C 3O1BA 1YJ9N 1NGHA 3LM2A 4WQ5C 5JVHL 2IVOA 4CZMA 3RSEB 1X3MA 4DKWA 5F1XA 1K73O 5AQGA 5EVZA 4BRDA 5M1NA 2I7PA 3TTFA 2DPNA 2QWQA 3C65A 1P8ZA 3LDQA 5C12A 3G25A 3AY9A 2IVNA 1RGIA 1YVNA 5M1QA 4EFHA 3BUZB 1HKBA 3EKSA 3HZ6A 3S41A 2QI2A 1Z05A 3U9DA 2Q2RA 4WQ4A 5ELZA 4WQ5A 4IFEA 1QQNA 1MDUB 1XUPO 2NLXA 3E66A 3ENBA 1JJ2M 1VQMN 3KVGA 3Q7CA 4FOIA 1YF5L 2V51B 4IDHA 2NRRA 4Y0WA 2P9UA 2GX9A 3HRGA 5AFUH 4E1JA 3WXLA 5C2FA 1KAXA 5E84A 1G99A 2GEMA 3CF5L 1ATNA 2NRZA 1IG8A 1O13A 4JK9A 4FWRA 2EWSA 2HMPA 2P9NB 3ZETA 3IFRA 2CH5A 5AQRA 1ZBSA 2NRHA 4CZIA 4KH6A 4R79A 4ILHA 5BREA 1C0FA 4GV9A 3CXCM 3ZX3A 2NRWA 3P38A 2PAVA 3VEXA 2E2PA 4M7XA 1T6DA 4FPAA 4ISEA 4A62A 3NVKA 3MCAB 3C7NA 2Q0UA 2QWOA 1P90A 3Q7BA 1SAZA 4J8FA 2FSNA 4MO4A 3O9SA 3CCQN 1H1VA 3IUCA 4FWKA 1RDWX 5AQIA 2Q36A 3F5TA 4H03B 2WC9A 3CCJN 4YOWA 5AZIB 2FLOA 3HTVA 2QWNA 5JLHA 3GG4A 3FE1A 3KWIA 2E1ZA 3VERA 3PIPL 3K9KA 2W41A 4B1YB 4CZJA 1T44A 2P9NA 3EN9A 4WFBL 3UE5A 3LDOA 4JK8A 1QQOA 5ADXH 3DAWA 3GE1A 2QW9A 3SBTA 1V4TA 2Q31A 5AQYA 2D4WA 1BO5O 3CCLN 3AAQA 1NGCA 3KHYA 3ID6A 3VTHA 2D0OA 3O80A 1NGBA 3CPEA 4BVOA 3VEZA 1K9MO 3CJCA 3H3NO 3QB0A 4U7BA 2QWLA 1WUAA 1GLEG 2D1KA 4XH4A 4WFNL 5BRFA 1HKCA 5CE3A 3SLCA 2GUPA 4UY8O 3VOVA 1YHQN 1KAYA 3BF1A 5LJVA 1NM1A 2Q97A 4LC9B 4ILJA 2YCHA 3WXMB 4BRGA 4OPAA 1VQ8N 1NGFA 5AQUA 3CMEN 2VCPA 3DXKA 4K25A 1QZ6A 4QS9A 3CCRN 2RHKA 1Q86O 5M1KA 4H5VA 1GLFO 2FXUA 3G4SN 3ENOA 5EOYA 4MLHA 4IJNA 3VETA 1XQSC 1YUWA 4FWSA 1TYQA 1T6CA 3CHWA 3CQYA 3F9MA 3GOIA 3HM8A 3WEEA 1M90O 4JKAA 1IJJA 2QWPA 4NLCA 1ZXOA 3VEWA 3DLLL 4H0VB 3E9OA 4BG8A 3FLCO 4C1NK 4BRNA 5M1OA 3IDHA 3W3DA 2YHWA 4IXCA 5M1FA 3O8MA 4CZGA 3FGUA 2FF3B 5FPNA 2QEXN 1GLLO 3H46O 4CBUA 4ISGA 3VGMA 4I6MB 3WT0A 4BRMA 4PL7A 5JICA 3CPWM 4G9ZA 4CI6A 2P9LA 2JWLA 5AQVA 1QZ5A 4A2BA 1LOTB 4AM6A 3J8AA 3DJCA 3VGLA 2GWKA 3U9ZA 5C2DA 4K43A 2F9TA 4HWIA 1YXQA 4BRHA 3O5BA 3SMSA 1U6ZA 3MX2A 4PKIA 1GLAG 4IEIA 4MDBA 3ATUA 1LCUA 3OW2M 3EKUA 4FO0A 5C10A 5H1SQ 5BPMA 3BEXA 3LL3A 5AQSA 3ZETB 3E9LA 3EE9A 4B1ZA 5AR0A 3I8BA 2QWRA 4QS8A 2HF4A 1HKGA 4YORA 4BVPA 3SBGA 1YITN 4IZ9A 3LM9A 1Q82O 1NMDA 1NWKA 3C7NB 4GV6A 4I6MA 4CBXA 3QFUA 4YOXA 1QVGM 4A5BA 3AAPA 1BA0A 4NB4A 1M1KO 2OTJN 4PKGA 4BQLA 5DM6L 2YI1A 3TU5A 3W0LA 4BR4A 3WXIA 3B8AX 3MN9A 1YJNN 3L0QA 2A41A 2ITMA 4IOAL 5TKWA 5GAGP 3MDQA 1JCFA 3CJBA 2IIRA 4EHTA 4IOXA 4YDUC 1GLJO 1D4XA 1HLUA 1BDGA 4O8UA 3O08A 1VQKN 1NGDA 1Z6RA 3EL2A 4BR9A 2Q0RA 5EX5A 3SAHA 3EO3A 5E26A 4AM7A 1TUYA 5AQMA 3O6WA 1YIJN 3ZX0A 3VEVA 1DT9A 4JHDA 2CGLA 5AQZA 3CCMN 2GELA 2RE2A 3CJAA 3K9JA 5B8HA 4GY2B 2CH6A 1NBWA 1X9JA 2F9WA 3O4WA 5AQFA 5AZJB 3ID8A 3IMXA 2E2OA 4WYBA 3M6GA 2NNWA 5GINA 4M63C 3LDNA 5FPMA 1U2VA 2YHYA 4M7YA 3VEOA 5GIOA 3FZMA 2P9KA 5CR4A 3R8EA 1E4GT 3L4IA 3CQXA 5AQWA 3DXKB 3HOSA 4OO1J 2FSKA 3MMVA 4A2AA 3QFPA 3I55N 3GL1A 1V4SA 4MLEA 2YJEA 1VQON 2A5XA 1R59O 5KPZA 2QTDA 4IO9L 1BWFO 4GVEA 5AFUA 1BOTO 5AQOA 3A5MC 4BR7A 1TYQB 4H0PA 4XH5A 2HBKA 3G71N 3WEEB 4QS7A 4BRPA 3T7ZA 3CCSN 1C0GA 1E4FT 4NO7A 1XC3A 4OPHA 2QM1A 2HBJA 3RVCA 3DXMA 4HTLA 3WXKA 5AQQA 4Z94A 5AZJA 2KKZA 2E2NA 3ZEUA 3O1WA 5BR9A 3KK7A 4JKHA 4H0OA 2HF3A 3FZLA 3HBTA 5JLFA 4BGBA 3N4PA 2FF6A 4F9OA 4BRAA 1RDUA 3I56N 3L4QA 4IOCL 4YOYA 2KLAA 1SZ2A 3FZKA 3J7ZO 3PIOL 1GLBG 3UB5A 3KWGA 4O5FA 5GAHP 1ZC6A 4JKFA 5KQ8A 5FPEA 2P9LB 4KBOA 3WQTA 3M3ZA 3GDQA 5AQNA 4CZLA 4BRFA 3FZFA 4CD3A 1DEJA 1CZAN 3N4QA 4DQ8A 2A3ZA 1KD1O 3G6EN 1GLDG 3R1XA 4YOTA 2WBNA 5JMVA 3SK3A 3TSUA 4FWPA 4B1UB 3MCPA 3VTIA 4CJ7A 5ADXA 3SAGA 3C0BA 5AQPA 3IKMA 5F0XA 4BRIA 4BY9C 4L3QA 1OKJA 1K8KB 3D2EA 2VYPA 5MLCQ 5LY3A 3MWPA 3FFKB 4A59A 3JS6A 2KHOA 4BC4A 3HI0A 1QQMA 2YJFA 1HX1A 4B1XB 3TTCA 2HOEA 4DCHA 3E9PA 3UKUA 3TSQA 2JWKA 5BN9A 3CC7N 1J6ZA 1BUPA 2E1YA 4FOEA 3MN6A 4BRKA 2P9IA 3M1FA 2NRTA 3ENHA 4FWLA 3VESA 3WUHA 4CZFA 4H0TB 1EQYA 1ATRA 2PBDA 3QBXA 3VF2A 3UKRB 4WCEL 2NZTA 3KZBA 1QHAA 3O9UA 3VGKA 4MDAA 4BC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQK N;  5DM7 L;  4WF9 L;  3CD6 N;  1Q81 O;  3CCL N;  1YIJ N;  4WFA L;  5GAE P;  3CCM N;  1K9M O;  1VQ9 N;  4WFN L;  1VQP N;  4UY8 O;  1YHQ N;  1NJI O;  4U67 L;  1VQ8 N;  3CME N;  1YI2 N;  1VQ6 N;  3CCR N;  1Q86 O;  3I55 N;  1YJW N;  1N8R O;  3CMA N;  3G4S N;  1VQO N;  1VQN N;  1ILY A;  1KC8 O;  4IO9 L;  1VQL N;  1M90 O;  3G71 N;  5GAD P;  3CCS N;  1VQ5 N;  3DLL L;  1YJ9 N;  1OVY A;  5JVH L;  1K73 O;  1QVF M;  3CCV N;  5JVG L;  3I56 N;  4IOC L;  1VQ7 N;  2QEX N;  3CCE N;  3J7Z O;  3PIO L;  5GAH P;  3CPW M;  3CC4 N;  2ZJR L;  1JJ2 M;  1VQM N;  1KD1 O;  3G6E N;  3CF5 L;  5HL7 L;  1K8A O;  3OW2 M;  5H1S Q;  1KQS M;  5MLC Q;  3CXC M;  1YIT N;  3CCU N;  1Q82 O;  1VQ4 N;  1QVG M;  2ZJQ L;  3CCQ N;  1M1K O;  3CC7 N;  2OTJ N;  2OTL N;  5DM6 L;  2QA4 N;  3CCJ N;  1W2B M;  1YJN N;  1Q7Y O;  4IOA L;  5GAG P;  1S72 N;  2ZJP L;  3PIP L;  4WCE L;  4WFB L;  3CC2 N; 
#chains in the Genus database with same CATH topology
 5BRD A;  2YKN A;  2I7N A;  4X65 K;  3VQ6 A;  1BIZ A;  2YX6 A;  5BRH A;  3U3G A;  1W97 L;  3BF3 A;  1RT7 A;  3O4Q A;  3OVN A;  2WFB A;  3QBW A;  3B6O A;  3ZT1 A;  4CJV A;  2YKM A;  3NVM A;  3CJ7 A;  2GWJ A;  2E8A A;  4KHP K;  1RIL A;  4B9M A;  1WBB A;  3S9H A;  4KO0 A;  4H0X B;  3WXJ A;  4B1W B;  4E7J A;  3CI5 A;  5AQK A;  3HSC A;  3T19 A;  4F3O A;  4CGG A;  4A5A A;  4KI4 A;  4EHU A;  2XY8 A;  3U4L A;  4DUY K;  3HO1 A;  2VGN A;  5TKY A;  3SMP A;  3TAQ A;  1YJW N;  3DOL A;  5AQX A;  4FVU A;  1B9F A;  4CF9 A;  5BN8 A;  4FM2 A;  4OVL A;  2ZQB A;  4JS4 A;  3ZLJ A;  1VQ5 N;  3ZEU B;  3O9Q A;  2ATQ A;  3I8D A;  1N6Q A;  4OLB A;  1SKR A;  4DB3 A;  3ZX2 A;  1W9H A;  4CGI A;  1S3X A;  3MK6 A;  3THY A;  3O9T A;  1TL1 A;  5AQH A;  4HTU A;  2VWK A;  4DFJ A;  5CY4 A;  1CXQ A;  3RMA A;  4CF1 A;  1WN7 A;  3MED A;  3TAM A;  3AGR A;  4GKJ K;  3QEW A;  2HHS A;  5AQL A;  1K8A O;  1MWK A;  3MN5 A;  4DU1 A;  2V52 B;  4PKH A;  1RTD A;  1NGG A;  3MEE A;  2A1S A;  2HNY A;  2XRI A;  4KH4 A;  4W5T A;  4AF1 A;  5LMN K;  2E4L A;  4NCG A;  4CEQ A;  2HHW A;  3AA4 A;  2ZJQ L;  1Q18 A;  3DRP A;  4BR5 A;  2NUB A;  4GV3 A;  1S5J A;  4H0Y B;  2O4G A;  5BPL A;  4V19 S;  5KPR A;  2NRV A;  2IVP A;  1NLV A;  2AP1 A;  1S72 N;  4FZY A;  2ZJP L;  1MU2 A;  4I2P A;  4OKE A;  3ZSR A;  3HOT A;  3JSM A;  1NOZ A;  3AO2 A;  1KFD A;  3I33 A;  3E01 A;  3TPQ A;  1NG9 A;  1Q81 O;  3CIP A;  4CJT A;  5GAE P;  2OAN A;  1I94 K;  1LWF A;  4CD3 A;  2HST A;  4B1V A;  4CJW A;  4JI4 K;  3QDK A;  4CJ5 A;  2GBZ A;  1N5Y A;  3CET A;  4DR7 K;  5IT9 O;  4XH1 A;  3ZSW A;  1TKX A;  4KHW A;  1CLQ A;  4H5T A;  4PL8 A;  1Y64 A;  4CGF A;  2PFU A;  2GTD A;  4CJQ A;  1VSI A;  3M5R A;  4N47 A;  1JKH A;  1VQL N;  1XWL A;  4BGA A;  1SKW A;  1JLE A;  2Q1N A;  3EZW A;  1RFQ A;  2D0P A;  2HBM A;  4JD2 B;  1RBV A;  4WQ4 C;  3LM2 A;  4J2E A;  4CZM A;  3RSE B;  5F1X A;  3HP6 A;  1JL1 A;  4DR6 K;  1ASW A;  3JYT A;  1U4B A;  4K8X A;  5C12 A;  1K6Y A;  2BDP A;  2IVN A;  1YVN A;  4EFH A;  4CHN A;  3SUO A;  4CHY A;  1HNX K;  2QI2 A;  4WQ4 A;  4CF2 A;  4IFE A;  3L8B A;  5J2P A;  4Z4I A;  4DLG A;  3ENB A;  3PUF A;  4JI8 K;  4DSJ A;  1YF5 L;  2UUC K;  3MEC A;  1HJR A;  3HRG A;  4PA1 A;  3WXL A;  4LF5 K;  1KAX A;  3CF5 L;  3NF9 A;  4JK9 A;  2P9N B;  2O8F B;  1CXU A;  1X9S A;  2CH5 A;  4KH6 A;  2P5G A;  4ILH A;  3RMC A;  3AA5 X;  1C1C A;  4CGH A;  4O4G A;  3SJJ A;  4LH4 A;  3DLR A;  4XIU A;  2G8V A;  1IH7 A;  3OYA A;  3PY8 A;  1WAF A;  2KFN A;  4MO4 A;  3DRR A;  1RDW X;  3CCJ N;  4N56 A;  2WC9 A;  4B3M K;  3K9K A;  3PO5 A;  4I9Q A;  2JGU A;  3NAE A;  3ULD A;  3GE1 A;  2QW9 A;  5AQY A;  4CIE A;  1BO5 O;  2DFE A;  3AAQ A;  3LAK A;  4ZTF A;  1U04 A;  4HVJ A;  3VTH A;  3O80 A;  4BVO A;  3VEZ A;  1HPZ A;  3CJC A;  1K9M O;  3QB0 A;  4U7B A;  4DSI A;  4LF9 K;  1BI4 B;  1HKC A;  1ASV A;  1JLC A;  1TAQ A;  1KAY A;  2GV9 A;  4ILJ A;  4BRG A;  5AQU A;  4K25 A;  3CCR N;  1QZ6 A;  4QS9 A;  1Q86 O;  4GW6 A;  4E0D A;  1DTQ A;  2FXU A;  4UQG A;  1S6P A;  5EOY A;  4K8Z A;  1XQS C;  1TYQ A;  1T6C A;  3CHW A;  2QKK A;  4KHQ A;  1ZBF A;  1IJJ A;  3QIP A;  4CHQ A;  4DSK A;  4BG8 A;  3LAM A;  4CFC A;  1VSL A;  5M1O A;  1GOA A;  2YHW A;  1FW6 A;  4CF0 A;  3QLH A;  5M1F A;  3QER A;  5E41 A;  4RW4 A;  3IS9 A;  4ISG A;  4PL7 A;  4I6M B;  3DLK A;  5AQV A;  1RT6 A;  4AM6 A;  3J8A A;  3VGL A;  3IG1 A;  3U9Z A;  3CM6 A;  4LY7 A;  5C2D A;  3T1A A;  2KTQ A;  4BRH A;  5C25 A;  3O5B A;  1U6Z A;  3MX2 A;  2X6S A;  1ZYQ A;  4NXN K;  3KKR A;  2G8F A;  5BPM A;  3BEX A;  1XI1 A;  5AQS A;  5CYM A;  3E9L A;  2G8I A;  4YOR A;  3SBG A;  1NNE A;  1XMQ K;  4IZ9 A;  1NKB A;  2KFZ A;  4GV6 A;  4F3T A;  1QVG M;  1SL0 A;  3VQA A;  4NB4 A;  1M1K O;  2DTU A;  4FJ8 A;  3W0L A;  4DSF A;  3OYE A;  1YJN N;  3K58 A;  3SPY A;  4KB1 A;  4DU4 A;  4Y1C A;  1GLJ O;  3K5M A;  4KPY A;  2YNI A;  3O08 A;  3L2Q A;  2Q0R A;  5EX5 A;  3EO3 A;  2W42 A;  4JI3 K;  3ZX0 A;  1DT9 A;  1EXQ A;  2XY6 A;  5B8H A;  1J5O A;  3CJA A;  2UU9 K;  4GY2 B;  2CH6 A;  1X9J A;  2EX3 A;  3IMX A;  2E2O A;  4Z0U A;  4H4M A;  5KTQ A;  3QES A;  5FPM A;  3TAG A;  3KK2 A;  4C8O A;  3VEO A;  2P9K A;  5CR4 A;  4OO1 J;  3CQX A;  3HOS A;  4FVM A;  4FJH A;  3HXM A;  1YTU A;  4A2A A;  3QFP A;  4KB0 A;  3GL1 A;  1V4S A;  3SQ4 A;  2F8T A;  4DQS A;  1W0H A;  5KPZ A;  5AFU A;  1BOT O;  3NH2 A;  1U45 A;  2O8E B;  4BR7 A;  4XH5 A;  4RW6 A;  4DR1 K;  4FLZ A;  3LZI A;  4JI6 K;  2HBJ A;  4KAZ A;  5AZJ A;  4DF4 A;  4B3T K;  2OZS A;  2Z1G A;  3BY5 A;  4JKH A;  4CFD A;  4ELT A;  3VQ7 A;  1IKY A;  2P5O A;  5JLF A;  4F9O A;  4BRA A;  1RDU A;  4IOC L;  1HRH A;  3PIO L;  3UB5 A;  1TKZ A;  1NOY A;  4CZL A;  4E7K A;  1DEJ A;  1CZA N;  3ZSO A;  4DTO A;  2A3Z A;  3G6E N;  3BZC A;  5JMV A;  1TK5 A;  5DMR A;  3MCP A;  3VTI A;  3SAG A;  1X1P A;  3NE6 A;  4M3Y A;  3D2E A;  3L2R A;  5MLC Q;  1LAW A;  3O3F A;  1HX1 A;  4DCH A;  3QEX A;  3CC7 N;  3B6P A;  5LL6 Z;  3BZK A;  3HL8 A;  3NF7 A;  4H0T B;  2YHB A;  4Q5V A;  2PBD A;  3V6D A;  4RW9 A;  1TV6 A;  4WCE L;  3O9U A;  2HHT A;  4BR0 A;  4MDA A;  4DTN A;  1K8K A;  1NGE A;  3A5L C;  4M45 A;  5DM7 L;  5F2R A;  3WQU A;  4DR5 K;  1WNS A;  3D6R A;  4C1N I;  1RCH A;  1SS6 A;  4WFA L;  4JHD B;  3HP9 A;  4M42 A;  2ITG A;  4IEE A;  4KTW A;  3ZSY A;  3HK2 A;  2ASO A;  2QWM A;  4JYA K;  1BQN A;  4CD1 A;  3QML A;  2G8H A;  3TAP A;  1C1B A;  2WTU A;  1YI2 N;  2VQE K;  3TAR A;  4DR3 K;  4K41 A;  4O5B A;  1N8R O;  5FPD A;  1NGA A;  4XEI A;  1IBM K;  2O8B A;  4H5N A;  4BRO A;  1NMN A;  3AO3 A;  1VSF A;  2E2Q A;  4CES A;  4YDU A;  4BDP A;  1OVY A;  3T69 A;  1UOC A;  3LP3 A;  3FZH A;  4JKD A;  1RT4 A;  1DLO A;  2PY5 A;  1OH6 A;  1B92 A;  1C0T A;  5M1P A;  5T7B A;  3KJV A;  4NCA A;  3AVH A;  4A61 A;  4Q0B A;  5KRS A;  2ASP A;  4ID1 A;  3HJF A;  3L6Q A;  3LDL A;  3AVF A;  1ZBL A;  1VSM A;  1ZBU A;  3OBW A;  4Z4H A;  3AAR A;  1EO1 A;  4FWM A;  3THX A;  3OS0 A;  1HJO A;  1L3S A;  1KRP A;  4L8R B;  2A6A A;  3MXI A;  4KHN A;  4RTF D;  2P9S A;  3JXU A;  2F7T A;  3DLG A;  3AO5 A;  1HYS A;  4KRF A;  2OPQ A;  3RMB A;  4H5R A;  4BRQ A;  1YTA A;  3P83 D;  1KQS M;  4FWQ A;  1BG3 A;  1T05 A;  3AVM A;  3SZ2 A;  2E20 A;  1DKG D;  1JLA A;  3SV3 A;  3CCU N;  1GLC G;  3HYF A;  1HPM A;  2R7Y A;  2H3G X;  2YHX A;  3L2U A;  4K42 A;  2A40 A;  2DFF A;  2FBY A;  2HVH A;  2IOC A;  2QA4 N;  2WUS A;  1W2B M;  1BCO A;  5C24 A;  3TTD A;  2YV0 X;  4DTJ A;  3OYN A;  2Q3S A;  4DTR A;  3PX4 A;  4BG9 A;  1JCE A;  3H1Q A;  4BC2 A;  3BGR A;  1T8E A;  3ATV A;  4IO8 A;  4AHS A;  1D8Y A;  3CD6 N;  4B8C A;  1VAZ A;  3PV8 A;  3LDP A;  1LAV A;  3DLH A;  3E1Y A;  1D5A A;  1S22 A;  2ZGY A;  3AGK A;  1SQK A;  3OA9 A;  3ULE A;  4BRL A;  2KZZ A;  5SWM A;  5JS1 A;  1VQP N;  3IAY A;  3CQ8 A;  3NMU A;  4EIA A;  2OPR A;  1IO2 A;  5BR8 K;  4H5W A;  1VQ6 N;  3NF8 A;  4N41 A;  4YOU A;  4DUZ K;  4DWI A;  3RWU A;  4CZH A;  2QKB A;  3R9P A;  4CEZ A;  3ZSQ A;  3EZ5 A;  2LSN A;  2RPI A;  4AHU A;  3AVA A;  4CZE A;  3RRG A;  4DQP A;  4DTS A;  4FLW A;  4BRE A;  3ZT2 A;  4TSX A;  5JVH L;  1X3M A;  5EVZ A;  1SL1 A;  1S1T A;  4CEF A;  2I7P A;  1NJW A;  2QWQ A;  4I9L A;  1P8Z A;  3V9X A;  3G25 A;  4DV6 K;  4O44 A;  1RGI A;  4FM0 A;  1N34 K;  3AVG A;  3AO4 A;  1RTI A;  1Z05 A;  3U9D A;  3UIQ A;  2O8C A;  2ZM6 K;  3ZSZ A;  4DQR A;  1MDU B;  1XUP O;  3OYK A;  1EKE A;  1VQM N;  3TAF A;  2JLE A;  4IDH A;  2NRR A;  4Y0W A;  4E1J A;  1G99 A;  2O8D A;  1WAJ A;  2HMP A;  3ZET A;  3IFR A;  5AQR A;  1ZBS A;  4CZI A;  1SKS A;  4R79 A;  4M3Z A;  3AVI A;  4JLH A;  3ZX3 A;  4M7X A;  1T6D A;  4A62 A;  4Z4E A;  2Q0U A;  1I39 A;  3SCX A;  2FSN A;  5KGW A;  1U47 A;  4M3T A;  5AQI A;  4H03 B;  3F5T A;  1HYV A;  3QIN A;  3HVR A;  5AZI B;  4E19 A;  4DG1 A;  2FLO A;  3HTV A;  5JLH A;  4E7L A;  3GG4 A;  4DS5 A;  3FE1 A;  3L3U A;  3VER A;  3PIP L;  2D5R A;  4CZJ A;  1T44 A;  4CJK A;  3EN9 A;  1NKC A;  2IGI A;  2DY4 A;  4JK8 A;  1S1U A;  3VN5 A;  2OPS A;  3MAQ A;  2Z1H A;  3CCL N;  4CER A;  1NGC A;  4OX9 K;  4HUF A;  4B9N A;  4IFV A;  3ID6 A;  2D0O A;  1NGB A;  4MFB A;  1NJX A;  4JI7 K;  4FK4 A;  4XH4 A;  4B9V A;  5HBM A;  1ZBI A;  4UY8 O;  3OJU A;  3HPG A;  3IRX A;  2YCH A;  1NGF A;  4ELV A;  1XMO K;  4FJM A;  2RHK A;  1R0A A;  2Z1J A;  4RW7 A;  4MQ3 A;  4LSL A;  1YUW A;  4FWS A;  3GOI A;  3WEE A;  4JKA A;  2QWP A;  3WNE A;  1ZXO A;  3DLL L;  4CCH A;  3HM9 A;  5CZ1 A;  3VQE A;  2WON A;  3AO1 A;  4B08 A;  3LP1 A;  2A1R A;  3IDH A;  4IG0 A;  4M3W A;  4F8R A;  1KCF A;  4CZG A;  1QQC A;  1REV A;  2OCE A;  4FXD A;  3M8R A;  4CBU A;  4BRM A;  4FLU A;  4G9Z A;  4KKO A;  5KRT A;  4CI6 A;  2JWL A;  4A2B A;  3DJC A;  3HPO A;  4K43 A;  1N32 K;  4X62 K;  4HWI A;  2QK9 A;  3K5L A;  4CGJ A;  3SMS A;  3OYF A;  4IEI A;  1F21 A;  3ATU A;  1LCU A;  3OW2 M;  1DTT A;  4H4O A;  1XHX A;  1VSJ A;  3EE9 A;  4O0J A;  5AR0 A;  2X74 A;  1XNQ K;  4QS8 A;  1HKG A;  4BVP A;  3O4N A;  4PUO A;  1NWK A;  3C7N B;  1Q9X A;  2YNF A;  2D0B A;  3T1H K;  3QFU A;  1L5U A;  2FBX A;  3H08 A;  2B5J A;  2YI1 A;  3TU5 A;  3B8A X;  1KVA A;  3MN9 A;  3KD5 E;  4LF4 K;  2A41 A;  2RKI A;  1FKO A;  1IBK K;  1EX4 A;  1VQK N;  4DTP A;  1HNZ K;  4AM7 A;  1HNI A;  4FJ5 A;  3VEV A;  4CEC A;  4DFP A;  2CGL A;  4RG8 A;  2GEL A;  3O3H A;  2F9W A;  1NBW A;  5AQF A;  5AZJ B;  3ID8 A;  4FJN A;  5GIN A;  3NBP A;  4M63 C;  3LDN A;  5GIO A;  2YHY A;  4M7Y A;  3T3F A;  1S9G A;  3R8E A;  3L4I A;  4Y1D A;  3DXK B;  3WNF A;  2HMI A;  2FSK A;  4DTU A;  2QTD A;  4BWM A;  2W6L A;  4GVE A;  3KK3 A;  3SV4 A;  1HYZ A;  5AQO A;  4H0P A;  4HUE A;  4DF8 A;  3HPH A;  1XC3 A;  2X78 A;  4Z94 A;  4NYF A;  1J54 A;  2E2N A;  3AVN A;  3ZEU A;  3KIO A;  3C94 A;  5BR9 A;  3KK7 A;  3PSF A;  4IBN A;  4I2Q A;  3I56 N;  3DLE A;  3FZK A;  1GLB G;  2E6M A;  3KWG A;  5FPE A;  2P9L B;  3WQT A;  4F2S A;  4ELU A;  3FZF A;  2PZS A;  2EHG A;  3LAN A;  2G8W A;  4YOT A;  3R1X A;  2P1J A;  4JI1 K;  4FWP A;  3NH0 A;  3K2P A;  3NGI A;  3LPU A;  1IKX A;  5ADX A;  3C0B A;  5AQP A;  3IKM A;  5C42 A;  4BY9 C;  1OKJ A;  1K8K B;  2VYP A;  4ICL A;  2IS3 A;  2KHO A;  2YJF A;  1RBS A;  3QNN A;  1EWQ A;  2HOE A;  3RRH A;  4KFB A;  3E9P A;  3TSQ A;  1VRU A;  2JWK A;  4EZ6 A;  1J6Z A;  4B9S A;  3AVC A;  3MN6 A;  4C8L A;  3F73 A;  4FW2 A;  3WUH A;  4CZF A;  2Y1J A;  2E6L A;  3NGY A;  1ATR A;  3QBX A;  4J2D A;  2F8S A;  1TUU A;  4Z4G A;  3BP8 A;  4W5Q A;  2O8B B;  1B9D A;  1ESV A;  2HHX A;  3R6M A;  1NK6 A;  1JLG A;  1RTJ A;  4R5P A;  5EY4 A;  1VSE A;  3OYM A;  3ALY A;  2W40 A;  1KTQ A;  1RTH A;  4CBW A;  1TGO A;  4X64 K;  1X3N A;  4FJ9 A;  3R3L A;  4PQU A;  4FCY A;  3D7E O;  3H6E A;  1U2V B;  4NLB A;  4C8N A;  3V81 A;  4U67 L;  5I3U A;  5KPT A;  3P4I A;  3O9R A;  3UKR A;  3VA0 A;  5GIP A;  3A5N C;  5CZ2 A;  1QSY A;  4ILG B;  4RW8 A;  1BU6 O;  3QEI A;  1TAU A;  4JK7 A;  4CK1 A;  2OPP A;  4JD2 A;  2P9S B;  4E89 A;  5I9E B;  1HQU A;  3DXM B;  4CJL A;  3RSE A;  4BDZ A;  1QVF M;  4DSE A;  3VQD A;  3RR8 A;  2ZWH A;  4CHO A;  4DV2 K;  2BAN A;  4CW7 B;  4E7I A;  2ZF5 O;  2E5L K;  4E1N A;  1VQ7 N;  1L3T A;  3OHR A;  4O8K A;  1WB9 A;  5EXW A;  4ZHR A;  4BRC A;  1JXE A;  2QXL A;  2AA4 A;  4GNI A;  3VMF B;  2ZJR L;  3VQQ A;  3OYB A;  4BR2 A;  2NRX A;  4FL9 A;  5HL7 L;  4IKF A;  2UUA K;  2O8F A;  4ZTJ A;  2ZE2 A;  4JKG A;  1VQ4 N;  4A57 A;  1BQM A;  3V9Z A;  3UKU B;  5KGX A;  3A0I X;  3ULE B;  2OTL N;  4DV3 K;  2P9I B;  4FM1 A;  4CZK A;  3NF6 A;  3H45 C;  3SQ2 A;  2RN2 A;  1Q9Y A;  1EWR A;  3D2F A;  4JNE A;  5KQD A;  3KD1 E;  3I0R A;  4WF9 L;  4JAX A;  3U8X A;  4LF6 K;  2P9P A;  3AVJ A;  4W5R A;  1UWB A;  4BC5 A;  4EP4 A;  1NJZ A;  4CE9 A;  4YY3 K;  3TSP A;  3MWT A;  3C6A A;  3ZYY X;  5C0Y A;  4BAC A;  1KXP A;  3V9S A;  3LP0 A;  2UYT A;  4B9Q A;  3AVL A;  3VEY A;  3OYI A;  1MA9 B;  3CFR A;  1NK7 A;  3VPZ A;  3VQP A;  5HLF A;  1NGI A;  4JRQ A;  4RWT A;  3FR0 A;  1XHZ A;  3QNO A;  1VQN N;  1BL3 A;  3M8Q A;  4DV5 K;  2A42 A;  4X66 K;  5HRN A;  4FK2 A;  4KTZ A;  5GAD P;  5FRO A;  1YJ9 N;  1NGH A;  1WSF A;  4WQ5 C;  4YFU A;  2IVO A;  3DLB A;  4DKW A;  1K73 O;  1RDC A;  3K5N A;  4FJI A;  5M1N A;  4E1M A;  2DPN A;  3C65 A;  2XY5 A;  1NK5 A;  3BUZ B;  3THY B;  1HKB A;  3HZ6 A;  5KI6 A;  4HUG A;  2G8U A;  2Q2R A;  3ASM A;  5ELZ A;  4WQ5 A;  3JAM O;  4FJL A;  3DRS A;  4Z4C A;  1LWC A;  2NLX A;  3E66 A;  2HHH K;  1JJ2 M;  4CIF A;  3HST B;  1NKE A;  4FOI A;  5AFU H;  2V51 B;  2P9U A;  2GX9 A;  3ZCM A;  3CM5 A;  3TR8 A;  5C2F A;  5E84 A;  4FJK A;  2GEM A;  5CYQ A;  2NRZ A;  1O13 A;  4Z4F A;  4FWR A;  1NJY A;  1E3M A;  3ZT4 A;  2UXC K;  2NRH A;  3LP2 A;  5D3G A;  4B8A B;  2FBV A;  5BRE A;  4BE0 A;  3CXC M;  3P5J A;  3VEX A;  2E2P A;  4FPA A;  4ISE A;  1C0U A;  3MCA B;  4DR2 K;  3OYG A;  1SV5 A;  1D9D A;  3Q7B A;  1SAZ A;  4OKJ A;  4M3U A;  3O9S A;  1WSH A;  3IUC A;  4FWK A;  1TK0 A;  3QO9 A;  5K14 A;  3M8P A;  1I3A A;  3V9W A;  3C6T A;  1C6V A;  1XNR K;  2E1Z A;  3THW A;  1J9A A;  1FK9 A;  4B1Y B;  4WFB L;  3CG7 A;  3LDO A;  3FFI A;  3VA3 A;  3SBT A;  2Q31 A;  4DFK A;  3LWL A;  3F9K A;  1RBT A;  3CPE A;  3H3N O;  4CIG A;  1WUA A;  4I7F A;  1X9W A;  4WFN L;  1HR0 K;  5BRF A;  1LWE A;  5J2Q A;  2GUP A;  3K59 A;  4FZX C;  1YHQ N;  3ZT0 A;  1A5X A;  2HHQ A;  3BF1 A;  1NM1 A;  3QIO A;  1O1W A;  3L3V A;  3WXM B;  3AVK A;  4OPJ A;  4PWD A;  5M1K A;  4H5V A;  4KHS A;  4CK2 A;  3G4S N;  1N33 K;  3AV9 A;  4MLH A;  3F9M A;  1M90 O;  3HM8 A;  4DTX A;  3DOK A;  4NLC A;  1VK0 A;  2VG5 A;  1QHT A;  3VEW A;  4H0V B;  3E9O A;  4CFA A;  1KVC A;  3OS1 A;  3MEG A;  3FLC O;  4AH9 A;  2YNG A;  1WBD A;  4C1N K;  4BRN A;  4IXC A;  3O8M A;  3U3Y A;  3EYZ A;  1GLL O;  4CF8 A;  5JIC A;  4QAG A;  3WT0 A;  3ZSV A;  2ZD1 A;  3KLG A;  1QZ5 A;  4B9L A;  1LOT B;  4BWJ A;  3V9U A;  4CVN E;  2UUB K;  4CEO A;  2F9T A;  1RDD A;  1GLA G;  4MDB A;  5FDL A;  2BGG A;  4AIL C;  3EKU A;  4FO0 A;  4G1Q A;  5C10 A;  4YNQ A;  3LL3 A;  1OH5 A;  1XC9 A;  1BGX T;  2QWR A;  1U48 A;  3G0Z A;  3LM9 A;  3KLI A;  1NMD A;  2B6A A;  3SYZ A;  1Q82 O;  4JV5 K;  1JLB A;  1TKT A;  4CBX A;  4YOX A;  5HRS A;  4FLY A;  5EU7 A;  4PKG A;  5SZT A;  5DM6 L;  4NXM K;  4BR4 A;  1JLF A;  3DI6 A;  3WXI A;  4IG3 A;  3L0Q A;  4CJR A;  2ITM A;  3QET A;  1TL3 A;  5TKW A;  3S3M A;  1D4X A;  4HCB A;  1HLU A;  3G10 A;  1NGD A;  1S6Q A;  1Z6R A;  4LFC K;  1YVU A;  3EL2 A;  5AJ3 K;  3SAH A;  3K0S A;  2BE2 A;  3P1G A;  5AQM A;  3O6W A;  1YIJ N;  1SUQ A;  4JHD A;  5AQZ A;  4CJU A;  3CCM N;  3O4W A;  2IAJ A;  4E3S A;  3RR7 A;  3M6G A;  2NNW A;  2XO7 A;  4FYD A;  4N5S A;  3V1R A;  3FZM A;  1RBR A;  4AHR A;  1IG9 A;  4CK3 A;  2YJE A;  2A5X A;  1BWF O;  3A5M C;  1RT3 A;  1TYQ B;  3G71 N;  1NU0 A;  4IFY A;  3PX6 A;  2Y1I A;  1E4F T;  2QM1 A;  3ZSX A;  3SI6 A;  4CFB A;  1C0M A;  2HF3 A;  3FZL A;  2KQ2 A;  3N4P A;  2FF6 A;  4F2R A;  3L4Q A;  4YOY A;  4DSL A;  2KLA A;  1SZ2 A;  3J7Z O;  4OLA A;  5GAH P;  4JKF A;  4FW1 A;  3J7Y P;  3NCI A;  4FLV A;  3RTV A;  3M3Z A;  3GDQ A;  5AQN A;  5LMU K;  3KKS A;  4BRF A;  3OYD A;  1WSJ A;  3N4Q A;  2PYL A;  5I42 A;  2YHA A;  2WBN A;  4OGC A;  5JS2 A;  1W7A A;  1QE1 A;  3TSU A;  4B1U B;  4CJ7 A;  4N76 A;  5F0X A;  5LY3 A;  1BIS A;  3MWP A;  1T03 A;  3HI0 A;  1QQM A;  5J1E A;  4B1X B;  3HVT A;  4GVM A;  1N36 K;  4KTQ A;  2Z1I A;  4DS4 A;  1WSE A;  4CJ3 A;  1LW2 A;  3MXJ A;  1BUP A;  3KK1 A;  4J2A A;  3M1F A;  3ENH A;  4FWL A;  4DLE A;  3VES A;  3NGZ A;  5J2N A;  3TAN A;  3UKR B;  4NCB A;  3KZB A;  3AA3 A;  1QHA A;  1S1V A;  3ITH A;  4QOZ B;  5CHI A;  3RMD A;  4DV4 K;  3M8S A;  3LAL A;  4DQQ A;  1QTM A;  4QCL A;  5LJW A;  1YT3 A;  1JL2 A;  3WNG A;  4B9U A;  4FK0 A;  1VQ9 N;  3SJH A;  3C95 A;  3F2K A;  1WSG A;  4BQZ A;  4AQY K;  4FLT A;  1NJI O;  1WLJ A;  3H3O B;  2P9K B;  1NGJ A;  4OJR A;  3NDK A;  4CED A;  4EAH D;  4FWN A;  1NK4 A;  2E88 A;  4OGE A;  2HBL A;  2VWJ A;  1YAG A;  1ILY A;  4KI6 A;  5HOO A;  1KAZ A;  2RF2 A;  4JEP A;  4BE2 A;  2GUI A;  3K5O A;  2VG6 A;  3CYM A;  4DHY A;  3J80 O;  2HND A;  4HCC A;  3SAF A;  4LD0 A;  1NK8 A;  1L3V A;  3LDS A;  1NK9 A;  3VF6 A;  4FJG A;  3KLF A;  5IWA K;  1Z26 A;  3T1Y K;  4CJE A;  3CCV N;  5JVG L;  1T3V A;  3VEN A;  3P39 A;  3CCE N;  3P31 A;  3LWM A;  4JKG B;  1RBU A;  2V7Z A;  4K0K K;  3CC4 N;  4KV8 A;  3CER A;  3TAE A;  3SNN A;  4JN4 A;  3EE8 A;  1KLM A;  1LW0 A;  2IDO A;  2FSJ A;  2VGM A;  4ID5 A;  4DV0 K;  4E7H A;  3C6H A;  3GBT A;  5J2M A;  2HHU A;  1JLQ A;  5AQJ A;  2CGJ A;  2CGK A;  3D2F B;  3D0P A;  2FC0 A;  5BPN A;  1CZB A;  3D2E B;  4DMN A;  4JRP A;  3PLA A;  4FWO A;  3ISN C;  1WOQ A;  3QIC A;  1VSK A;  4AHV A;  2P9P B;  4AHT A;  4RCH A;  3CJ1 A;  3EEQ A;  1G15 A;  4FSV A;  4JI5 K;  4JKE A;  1DGK N;  4C8K A;  1IKW A;  4JI2 K;  2VWB A;  5AZI A;  1Q7Y O;  5AQT A;  3VQ8 A;  2XY7 A;  3OBY A;  2J4R A;  2VG7 A;  3ZT3 A;  1BCM A;  5A2Q O;  3BDP A;  1JCG A;  4C23 A;  1BA1 A;  2BTF A;  3CC2 N;  4ISF A;  4KH5 A;  1HUX A;  4PHT X;  4KRE A;  3C6U A;  4F4K A;  4O0I A;  1TVR A;  5FLX O;  5C15 A;  1U49 A;  4CEE A;  3A5O C;  2V7Y A;  1UAX A;  1MWM A;  4JKB A;  3SQ0 A;  3DWL A;  3A8Y A;  3VF2 A;  4IJA A;  4W5O A;  2BUP A;  4CEA A;  2ZGZ A;  1GOB A;  4YOV A;  3OS2 A;  4DTM A;  1IV0 A;  1WSI A;  3MX5 A;  2ASM A;  1HMV A;  2BH1 A;  3CJ9 A;  4MO5 A;  3VQ5 A;  1Z25 A;  3MN7 A;  1RT5 A;  3NHG A;  2UXB K;  4DU3 A;  4JKC A;  3CMA N;  1KC8 O;  4IWV A;  2DFH A;  1Y97 A;  4FPB A;  3VF4 A;  1HNW K;  2P9U B;  1ATS A;  2PYJ A;  3H1V X;  1L3U A;  3KTQ A;  3O1B A;  3VQB A;  3OTO K;  5AQG A;  1IKV A;  4BRD A;  1KSP A;  3TTF A;  2WOM A;  3LDQ A;  3AY9 A;  4O55 A;  3V1O A;  4JS5 A;  5M1Q A;  3OJS A;  1J53 A;  4M3R A;  1IBL K;  2UXD K;  3EKS A;  4GMJ B;  3S41 A;  1RT1 A;  3O3G A;  4C8M A;  3V4I A;  4IDK A;  1QQN A;  2FBT A;  4CHP A;  3THX B;  3KVG A;  1RNH A;  3Q7C A;  1UA0 A;  1A5W A;  1RT2 A;  2HW3 A;  1ATN A;  1IG8 A;  2YNH A;  3THW B;  2EWS A;  4KHY A;  4CJF A;  1FXX A;  4GV9 A;  1C0F A;  2ETJ A;  3S3O A;  1EET A;  2HB5 A;  2NRW A;  3P38 A;  2PAV A;  3NVK A;  3OYC A;  5HRP A;  3C7N A;  2QWO A;  1P90 A;  4M41 A;  2QXF A;  4J8F A;  4J2B A;  3CCQ N;  1H1V A;  3SQ1 A;  2Q36 A;  1FKP A;  4YOW A;  1QSL A;  4GKK K;  2QWN A;  3TWH A;  3KWI A;  1TKD A;  1S1W A;  1EP4 A;  2W41 A;  2P9N A;  3UE5 A;  5ADX H;  1QQO A;  3DAW A;  4EZ9 A;  1V4T A;  2D4W A;  5DK5 A;  2HVI A;  2OYQ A;  4W5N A;  3KHY A;  3QEP A;  4WE1 A;  3DM2 A;  3MXM A;  2QWL A;  5FRM A;  1GLE G;  2D1K A;  2D0C A;  5CE3 A;  1ZBH A;  3SLC A;  3VOV A;  5LJV A;  3THV A;  2Q97 A;  3D45 A;  4LC9 B;  1X9M A;  1A5V A;  1OH7 A;  4OPA A;  1VQ8 N;  3CME N;  2X6N A;  3CFP A;  1OH8 A;  2VCP A;  3DXK A;  2P51 A;  4FJJ A;  4LH5 A;  3AVB A;  1GLF O;  3ENO A;  4IJN A;  3VET A;  3CQY A;  1RDA A;  1BI4 A;  5FRN A;  4LF8 K;  1RDB A;  2B4J A;  5HP1 A;  3L2W A;  3WNH A;  3W3D A;  3FGU A;  2FF3 B;  5FPN A;  3I0S A;  3J7A P;  1BIU A;  4B3R K;  2QEX N;  4FJX A;  4KHU A;  3H46 O;  2F96 A;  3VGM A;  2O8C B;  3CPW M;  3SUN A;  1BHL A;  4DFM A;  4OKK A;  2P9L A;  3OYH A;  2KW4 A;  1HNV A;  2GWK A;  2HNZ A;  4NYN A;  1YXQ A;  4PKI A;  4LFB K;  5HRO A;  2O8D B;  1UA1 A;  3HT3 A;  5H1S Q;  3KLE A;  4CGD A;  3ZET B;  3PO4 A;  4B3S K;  4DQI A;  4B1Z A;  3DYA A;  3I8B A;  3OY9 A;  2IC3 A;  2F4V K;  2HF4 A;  1YIT N;  3VQ4 A;  4AHC A;  4CHZ A;  4I6M A;  4OPK A;  1SL2 A;  3PX0 A;  4A5B A;  1C1A A;  1JXB A;  1BA0 A;  3AAP A;  2OTJ N;  4BQL A;  3SPZ A;  3AA2 A;  1CZ9 A;  4CJP A;  4IOA L;  3QEV A;  5GAG P;  3TI0 A;  3MDQ A;  1JCF A;  3CJB A;  2IIR A;  4EHT A;  4IOX A;  4YDU C;  2O4I A;  1BDG A;  4O8U A;  4LF7 K;  4BR9 A;  1QSS A;  4EP5 A;  5E26 A;  3CFO A;  4FLX A;  1ITG A;  1TUY A;  1HQE A;  1OVQ A;  3J81 O;  1T7P A;  2RE2 A;  3K9J A;  2AJQ A;  1GOC A;  3LZJ A;  1VHX A;  3SUP A;  3NFA A;  4WYB A;  3DMJ A;  3A2F A;  3VQC A;  1U2V A;  4CJS A;  3V1Q A;  4HHT A;  1E4G T;  5AQW A;  4CJ4 A;  3KLH A;  3MMV A;  2KZM A;  3I55 N;  4MLE A;  1VQO N;  1R59 O;  4IO9 L;  3SUQ A;  3LPT A;  4FJ7 A;  2HBK A;  2I5J A;  3WEE B;  4QS7 A;  4BRP A;  4JI0 K;  2OA8 A;  4DR4 K;  3T7Z A;  3CCS N;  1C0G A;  4NO7 A;  4OPH A;  3RVC A;  3DXM A;  4HTL A;  3WXK A;  5AQQ A;  2KKZ A;  1J5E K;  3O1W A;  4H0O A;  2HHV A;  1QS4 A;  5HRR A;  3HBT A;  4BGB A;  3EY1 A;  3U6F A;  1FJG K;  4O5F A;  1ZC6 A;  5KQ8 A;  4H8K A;  4BDY A;  4KBO A;  4YHH K;  4B3O A;  2XHB A;  2O8E A;  4DQ8 A;  1NK0 A;  1KD1 O;  1S9E A;  2G8K A;  2W6K A;  1GLD G;  1Q8I A;  4LFA K;  3K57 A;  1ASU A;  3SK3 A;  3OYJ A;  1KLN A;  4B9T A;  3PSI A;  4BRI A;  4L3Q A;  3VQ9 A;  3OYL A;  3TAB A;  3S3N A;  3FFK B;  1VSD A;  4A59 A;  3JS6 A;  4M3X A;  4BC4 A;  3NH1 A;  4DV1 K;  3TTC A;  4CEB A;  3L2V A;  1TK8 A;  1LV5 A;  4PY5 A;  3UKU A;  5BN9 A;  4DV7 K;  4FOE A;  1VRT A;  2E1Y A;  2D0A A;  1KVB A;  2P9I A;  4BRK A;  2NRT A;  4LSN A;  2VQF K;  1S1X A;  1VSH A;  4FZZ A;  4BE1 A;  1EQY A;  1KFS A;  1D9F A;  2OZM A;  2NZT A;  3VGK A;  4BC3 A; 
#chains in the Genus database with same CATH homology
 1K8K A;  1NGE A;  1TUU A;  3A5L C;  5BRD A;  5CHI A;  5DM7 L;  5F2R A;  2I7N A;  3WQU A;  3BP8 A;  2YX6 A;  3D6R A;  4C1N I;  1SS6 A;  4WFA L;  4JHD B;  5LJW A;  5BRH A;  1ESV A;  1W97 L;  3BF3 A;  3R6M A;  4IEE A;  2WFB A;  3QBW A;  5EY4 A;  1VQ9 N;  3SJH A;  2ASO A;  2W40 A;  3NVM A;  3CJ7 A;  3F2K A;  2GWJ A;  2E8A A;  4CBW A;  2QWM A;  1X3N A;  3R3L A;  4BQZ A;  3D7E O;  4CD1 A;  3H6E A;  1U2V B;  4H0X B;  4NLB A;  3WXJ A;  4B1W B;  3QML A;  3CI5 A;  4U67 L;  1NJI O;  3H3O B;  5KPT A;  5AQK A;  3HSC A;  2P9K B;  3P4I A;  3O9R A;  1NGJ A;  3UKR A;  1YI2 N;  4A5A A;  4EAH D;  4FWN A;  2E88 A;  4EHU A;  4K41 A;  3U4L A;  5GIP A;  3A5N C;  2VGN A;  2HBL A;  5TKY A;  3SMP A;  1YJW N;  1N8R O;  1YAG A;  4ILG B;  1ILY A;  5FPD A;  5AQX A;  1BU6 O;  1NGA A;  1KAZ A;  4XEI A;  5HOO A;  4FVU A;  4JEP A;  5BN8 A;  4JK7 A;  4H5N A;  4BRO A;  1VQ5 N;  4JD2 A;  4DHY A;  2P9S B;  2E2Q A;  5I9E B;  4YDU A;  3DXM B;  3SAF A;  1OVY A;  3T69 A;  3ZEU B;  3RSE A;  1QVF M;  3O9Q A;  3VF6 A;  2ZWH A;  4DB3 A;  3FZH A;  3ZX2 A;  4JKD A;  5M1P A;  3CCV N;  1S3X A;  3MK6 A;  2ZF5 O;  5JVG L;  1T3V A;  4A61 A;  3VEN A;  1VQ7 N;  3P39 A;  3CCE N;  2ASP A;  3O9T A;  3P31 A;  3OHR A;  4O8K A;  5AQH A;  3L6Q A;  3LDL A;  4JKG B;  2V7Z A;  4BR0 A;  3CC4 N;  5EXW A;  4BRC A;  3OBW A;  2QXL A;  3AAR A;  2AA4 A;  4FWM A;  3CER A;  4GNI A;  3VMF B;  2ZJR L;  1EO1 A;  1HJO A;  4BR2 A;  2NRX A;  4JN4 A;  3AGR A;  3EE8 A;  2A6A A;  2VGM A;  2FSJ A;  4RTF D;  2P9S A;  3JXU A;  2F7T A;  3C6H A;  4FL9 A;  3GBT A;  5AQL A;  5HL7 L;  1K8A O;  1MWK A;  3MN5 A;  5AQJ A;  2CGJ A;  2CGK A;  2V52 B;  3D2F B;  4PKH A;  1NGG A;  4H5R A;  4BRQ A;  5BPN A;  3D2E B;  1KQS M;  3PLA A;  4FWQ A;  4FWO A;  1BG3 A;  1WOQ A;  3QIC A;  2E20 A;  1DKG D;  2P9P B;  4KH4 A;  3CCU N;  4AF1 A;  1GLC G;  4RCH A;  1HPM A;  3CJ1 A;  4FSV A;  2H3G X;  2YHX A;  4JKG A;  4A57 A;  1VQ4 N;  4JKE A;  4K42 A;  3UKU B;  1DGK N;  2ZJQ L;  2A40 A;  1Q18 A;  3A0I X;  3ULE B;  2OTL N;  4BR5 A;  2QA4 N;  2P9I B;  2WUS A;  1W2B M;  4GV3 A;  2VWB A;  4H0Y B;  5AZI A;  5BPL A;  3TTD A;  5AQT A;  5KPR A;  1Q7Y O;  4CZK A;  3OBY A;  2J4R A;  3H45 C;  2NRV A;  2IVP A;  1NLV A;  2AP1 A;  1S72 N;  2ZJP L;  4BG9 A;  3D2F A;  1JCE A;  3H1Q A;  1JCG A;  4JNE A;  4C23 A;  4BC2 A;  5KQD A;  2BTF A;  1BA1 A;  3HOT A;  3CC2 N;  4ISF A;  3ATV A;  3I33 A;  4KH5 A;  1HUX A;  4JAX A;  3U8X A;  4IO8 A;  3TPQ A;  4PHT X;  4WF9 L;  3CD6 N;  2P9P A;  1Q81 O;  5C15 A;  3A5O C;  4BC5 A;  3CIP A;  1VAZ A;  5GAE P;  2V7Y A;  2OAN A;  4JKB A;  1MWM A;  3LDP A;  3DWL A;  3A8Y A;  3TSP A;  3C6A A;  3E1Y A;  1S22 A;  2HST A;  3MWT A;  2BUP A;  3AGK A;  2ZGY A;  1SQK A;  4IJA A;  3ZYY X;  4B1V A;  5C0Y A;  2ZGZ A;  3OA9 A;  3ULE A;  4YOV A;  4BRL A;  1VQP N;  3QDK A;  1KXP A;  3CET A;  4B9Q A;  2UYT A;  3MX5 A;  2ASM A;  3NMU A;  4XH1 A;  3VEY A;  4EIA A;  1MA9 B;  2BH1 A;  3CJ9 A;  3VPZ A;  4H5T A;  4MO5 A;  4H5W A;  4PL8 A;  1VQ6 N;  1Y64 A;  3MN7 A;  2PFU A;  2GTD A;  4YOU A;  1NGI A;  4CZH A;  4RWT A;  3FR0 A;  3R9P A;  4JKC A;  3CMA N;  3M5R A;  1VQN N;  1KC8 O;  4IWV A;  2A42 A;  1VQL N;  4BGA A;  4CZE A;  4FPB A;  2Q1N A;  3EZW A;  1RFQ A;  2D0P A;  2HBM A;  2P9U B;  1ATS A;  3VF4 A;  4JD2 B;  3H1V X;  4BRE A;  5GAD P;  4WQ4 C;  3O1B A;  1YJ9 N;  1NGH A;  3LM2 A;  4WQ5 C;  5JVH L;  2IVO A;  4CZM A;  3RSE B;  1X3M A;  4DKW A;  5F1X A;  1K73 O;  5AQG A;  5EVZ A;  4BRD A;  5M1N A;  2I7P A;  3TTF A;  2DPN A;  2QWQ A;  3C65 A;  1P8Z A;  3LDQ A;  5C12 A;  3G25 A;  3AY9 A;  2IVN A;  1RGI A;  1YVN A;  5M1Q A;  4EFH A;  3BUZ B;  1HKB A;  3EKS A;  3HZ6 A;  3S41 A;  2QI2 A;  1Z05 A;  3U9D A;  2Q2R A;  4WQ4 A;  5ELZ A;  4WQ5 A;  4IFE A;  1QQN A;  1MDU B;  1XUP O;  2NLX A;  3E66 A;  3ENB A;  1JJ2 M;  1VQM N;  3KVG A;  3Q7C A;  4FOI A;  1YF5 L;  2V51 B;  4IDH A;  2NRR A;  4Y0W A;  2P9U A;  2GX9 A;  3HRG A;  5AFU H;  4E1J A;  3WXL A;  5C2F A;  1KAX A;  5E84 A;  1G99 A;  2GEM A;  3CF5 L;  1ATN A;  2NRZ A;  1IG8 A;  1O13 A;  4JK9 A;  4FWR A;  2EWS A;  2HMP A;  2P9N B;  3ZET A;  3IFR A;  2CH5 A;  5AQR A;  1ZBS A;  2NRH A;  4CZI A;  4KH6 A;  4R79 A;  4ILH A;  5BRE A;  1C0F A;  4GV9 A;  3CXC M;  3ZX3 A;  2NRW A;  3P38 A;  2PAV A;  3VEX A;  2E2P A;  4M7X A;  1T6D A;  4FPA A;  4ISE A;  4A62 A;  3NVK A;  3MCA B;  3C7N A;  2Q0U A;  2QWO A;  1P90 A;  3Q7B A;  1SAZ A;  4J8F A;  2FSN A;  4MO4 A;  3O9S A;  3CCQ N;  1H1V A;  3IUC A;  4FWK A;  1RDW X;  5AQI A;  2Q36 A;  3F5T A;  4H03 B;  2WC9 A;  3CCJ N;  4YOW A;  5AZI B;  2FLO A;  3HTV A;  2QWN A;  5JLH A;  3GG4 A;  3FE1 A;  3KWI A;  2E1Z A;  3VER A;  3PIP L;  3K9K A;  2W41 A;  4B1Y B;  4CZJ A;  1T44 A;  2P9N A;  3EN9 A;  4WFB L;  3UE5 A;  3LDO A;  4JK8 A;  1QQO A;  5ADX H;  3DAW A;  3GE1 A;  2QW9 A;  3SBT A;  1V4T A;  2Q31 A;  5AQY A;  2D4W A;  1BO5 O;  3CCL N;  3AAQ A;  1NGC A;  3KHY A;  3ID6 A;  3VTH A;  2D0O A;  3O80 A;  1NGB A;  3CPE A;  4BVO A;  3VEZ A;  1K9M O;  3CJC A;  3H3N O;  3QB0 A;  4U7B A;  2QWL A;  1WUA A;  1GLE G;  2D1K A;  4XH4 A;  4WFN L;  5BRF A;  1HKC A;  5CE3 A;  3SLC A;  2GUP A;  4UY8 O;  3VOV A;  1YHQ N;  1KAY A;  3BF1 A;  5LJV A;  1NM1 A;  2Q97 A;  4LC9 B;  4ILJ A;  2YCH A;  3WXM B;  4BRG A;  4OPA A;  1VQ8 N;  1NGF A;  5AQU A;  3CME N;  2VCP A;  3DXK A;  4K25 A;  1QZ6 A;  4QS9 A;  3CCR N;  2RHK A;  1Q86 O;  5M1K A;  4H5V A;  1GLF O;  2FXU A;  3G4S N;  3ENO A;  5EOY A;  4MLH A;  4IJN A;  3VET A;  1XQS C;  1YUW A;  4FWS A;  1TYQ A;  1T6C A;  3CHW A;  3CQY A;  3F9M A;  3GOI A;  3HM8 A;  3WEE A;  1M90 O;  4JKA A;  1IJJ A;  2QWP A;  4NLC A;  1ZXO A;  3VEW A;  3DLL L;  4H0V B;  3E9O A;  4BG8 A;  3FLC O;  4C1N K;  4BRN A;  5M1O A;  3IDH A;  3W3D A;  2YHW A;  4IXC A;  5M1F A;  3O8M A;  4CZG A;  3FGU A;  2FF3 B;  5FPN A;  2QEX N;  1GLL O;  3H46 O;  4CBU A;  4ISG A;  3VGM A;  4I6M B;  3WT0 A;  4BRM A;  4PL7 A;  5JIC A;  3CPW M;  4G9Z A;  4CI6 A;  2P9L A;  2JWL A;  5AQV A;  1QZ5 A;  4A2B A;  1LOT B;  4AM6 A;  3J8A A;  3DJC A;  3VGL A;  2GWK A;  3U9Z A;  5C2D A;  4K43 A;  2F9T A;  4HWI A;  1YXQ A;  4BRH A;  3O5B A;  3SMS A;  1U6Z A;  3MX2 A;  4PKI A;  1GLA G;  4IEI A;  4MDB A;  3ATU A;  1LCU A;  3OW2 M;  3EKU A;  4FO0 A;  5C10 A;  5H1S Q;  5BPM A;  3BEX A;  3LL3 A;  5AQS A;  3ZET B;  3E9L A;  3EE9 A;  4B1Z A;  5AR0 A;  3I8B A;  2QWR A;  4QS8 A;  2HF4 A;  1HKG A;  4YOR A;  4BVP A;  3SBG A;  1YIT N;  4IZ9 A;  3LM9 A;  1Q82 O;  1NMD A;  1NWK A;  3C7N B;  4GV6 A;  4I6M A;  4CBX A;  3QFU A;  4YOX A;  1QVG M;  4A5B A;  3AAP A;  1BA0 A;  4NB4 A;  1M1K O;  2OTJ N;  4PKG A;  4BQL A;  5DM6 L;  2YI1 A;  3TU5 A;  3W0L A;  4BR4 A;  3WXI A;  3B8A X;  3MN9 A;  1YJN N;  3L0Q A;  2A41 A;  2ITM A;  4IOA L;  5TKW A;  5GAG P;  3MDQ A;  1JCF A;  3CJB A;  2IIR A;  4EHT A;  4IOX A;  4YDU C;  1GLJ O;  1D4X A;  1HLU A;  1BDG A;  4O8U A;  3O08 A;  1VQK N;  1NGD A;  1Z6R A;  3EL2 A;  4BR9 A;  2Q0R A;  5EX5 A;  3SAH A;  3EO3 A;  5E26 A;  4AM7 A;  1TUY A;  5AQM A;  3O6W A;  1YIJ N;  3ZX0 A;  3VEV A;  1DT9 A;  4JHD A;  2CGL A;  5AQZ A;  3CCM N;  2GEL A;  2RE2 A;  3CJA A;  3K9J A;  5B8H A;  4GY2 B;  2CH6 A;  1NBW A;  1X9J A;  2F9W A;  3O4W A;  5AQF A;  5AZJ B;  3ID8 A;  3IMX A;  2E2O A;  4WYB A;  3M6G A;  2NNW A;  5GIN A;  4M63 C;  3LDN A;  5FPM A;  1U2V A;  2YHY A;  4M7Y A;  3VEO A;  5GIO A;  3FZM A;  2P9K A;  5CR4 A;  3R8E A;  1E4G T;  3L4I A;  3CQX A;  5AQW A;  3DXK B;  3HOS A;  4OO1 J;  2FSK A;  3MMV A;  4A2A A;  3QFP A;  3I55 N;  3GL1 A;  1V4S A;  4MLE A;  2YJE A;  1VQO N;  2A5X A;  1R59 O;  5KPZ A;  2QTD A;  4IO9 L;  1BWF O;  4GVE A;  5AFU A;  1BOT O;  5AQO A;  3A5M C;  4BR7 A;  1TYQ B;  4H0P A;  4XH5 A;  2HBK A;  3G71 N;  3WEE B;  4QS7 A;  4BRP A;  3T7Z A;  3CCS N;  1C0G A;  1E4F T;  4NO7 A;  1XC3 A;  4OPH A;  2QM1 A;  2HBJ A;  3RVC A;  3DXM A;  4HTL A;  3WXK A;  5AQQ A;  4Z94 A;  5AZJ A;  2KKZ A;  2E2N A;  3ZEU A;  3O1W A;  5BR9 A;  3KK7 A;  4JKH A;  4H0O A;  2HF3 A;  3FZL A;  3HBT A;  5JLF A;  4BGB A;  3N4P A;  2FF6 A;  4F9O A;  4BRA A;  1RDU A;  3I56 N;  3L4Q A;  4IOC L;  4YOY A;  2KLA A;  1SZ2 A;  3FZK A;  3J7Z O;  3PIO L;  1GLB G;  3UB5 A;  3KWG A;  4O5F A;  5GAH P;  1ZC6 A;  4JKF A;  5KQ8 A;  5FPE A;  2P9L B;  4KBO A;  3WQT A;  3M3Z A;  3GDQ A;  5AQN A;  4CZL A;  4BRF A;  3FZF A;  4CD3 A;  1DEJ A;  1CZA N;  3N4Q A;  4DQ8 A;  2A3Z A;  1KD1 O;  3G6E N;  1GLD G;  3R1X A;  4YOT A;  2WBN A;  5JMV A;  3SK3 A;  3TSU A;  4FWP A;  4B1U B;  3MCP A;  3VTI A;  4CJ7 A;  5ADX A;  3SAG A;  3C0B A;  5AQP A;  3IKM A;  5F0X A;  4BRI A;  4BY9 C;  4L3Q A;  1OKJ A;  1K8K B;  3D2E A;  2VYP A;  5MLC Q;  5LY3 A;  3MWP A;  3FFK B;  4A59 A;  3JS6 A;  2KHO A;  4BC4 A;  3HI0 A;  1QQM A;  2YJF A;  1HX1 A;  4B1X B;  3TTC A;  2HOE A;  4DCH A;  3E9P A;  3UKU A;  3TSQ A;  2JWK A;  5BN9 A;  3CC7 N;  1J6Z A;  1BUP A;  2E1Y A;  4FOE A;  3MN6 A;  4BRK A;  2P9I A;  3M1F A;  2NRT A;  3ENH A;  4FWL A;  3VES A;  3WUH A;  4CZF A;  4H0T B;  1EQY A;  1ATR A;  2PBD A;  3QBX A;  3VF2 A;  3UKR B;  4WCE L;  2NZT A;  3KZB A;  1QHA A;  3O9U A;  3VGK A;  4MDA A;  4BC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...