3DLLL

The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect trna positioning
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect tRNA positioning
pubmed doi rcsb
molecule tags Ribosome
molecule keywords rRNA-23S ribosomal RNA
total genus 16
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dllL01
1VQMN 1VQLN 4UY8O 1K9MO 1QVFM 5GAGP 1VQ5N 1VQ8N 5GAHP 1VQ6N 3I55N 1VQ4N 5MLCQ 1K73O 1YJNN 5JVHL 1N8RO 1NJIO 1VQKN 1YITN 3CCLN 4WCEL 1KD1O 5DM7L 3CXCM 1VQPN 1KC8O 3CPWM 3CCUN 4WFNL 2QA4N 5HL7L 3CCVN 1ILYA 3CC2N 3DLLL 3CCMN 4IO9L 1YHQN 1VQNN 3CMEN 1Q81O 3CCJN 1Q86O 2ZJPL 4WFBL 4WF9L 3PIOL 3G4SN 1YI2N 3G71N 3CMAN 5DM6L 1VQON 3I56N 4IOCL 1YJ9N 1QVGM 3CCEN 1VQ7N 3OW2M 2ZJRL 2ZJQL 1OVYA 3CD6N 2OTLN 3CC7N 1Q7YO 1VQ9N 1JJ2M 5GADP 1K8AO 3G6EN 1YIJN 1M1KO 5JVGL 5GAEP 3CCQN 3CCRN 3CF5L 3J7ZO 3CCSN 1M90O 1KQSM 4U67L 3CC4N 2OTJN 4IOAL 3PIPL 1Q82O 1YJWN 5H1SQ 4WFAL 1W2BM 2QEXN 1S72N
chains in the Genus database with same CATH superfamily
2VG7A 1LW2A 4KREA 1I3AA 2O8DB 3D2FB 3AAPA 4DQIA 4EHTA 4H4MA 2D0BA 2VWKA 4DTMA 4JKCA 2E2QA 5M1PA 1C0MA 4C8NA 4OGEA 1D9FA 4E7LA 4BR5A 4I6MB 4J2DA 2VYPA 1NOYA 1NJWA 1OH7A 3JSMA 1YITN 4AHSA 2BDPA 4HUFA 4GV6A 4Y0WA 2RE2A 2WUSA 3H45C 3P31A 3TAMA 3HZ6A 3T69A 4M7YA 4LH5A 4N5SA 4FWLA 4W5RA 1VQPN 4CF0A 4KKOA 5AZIA 2CGKA 1KAZA 4PQUA 2UUBK 4XH5A 2QA4N 3QNOA 2ITGA 3EKSA 1BA1A 1ASUA 3LAMA 3D7EO 4M3RA 2KZMA 4IWVA 4BRPA 3VEOA 5HOOA 4CJSA 3A5OC 4DTRA 1JCGA 1MU2A 2V52B 1GOAA 3EO3A 4BR0A 1S6PA 5BN8A 4FCYA 1TKZA 1JL2A 2QI2A 3AO4A 2QWPA 3SBGA 4F8RA 2HNYA 1S1XA 4GVEA 5KPTA 4JN4A 4B08A 3L4IA 4KO0A 3QEWA 1A5XA 2PAVA 3Q7CA 2IVNA 4IXCA 1YXQA 3T1AA 4DTUA 1JLBA 1HRHA 2YI1A 2F7TA 3RRGA 1HUXA 5BRFA 2NRTA 5FRNA 4LF7K 1OH8A 4Y1DA 3PY8A 2HHSA 3KLIA 4H5VA 4FK2A 2UXDK 3RMCA 3VQCA 1BDGA 4CK2A 3V9WA 1IKVA 2XY6A 4BRFA 1RT7A 3WNHA 1SKRA 1TL1A 4H4OA 4CF9A 5AQKA 5AQUA 2Q1NA 3TAEA 4DTSA 4LF9K 1FJGK 4EIAA 3NF9A 3FFIA 4CCHA 1IJJA 1Q9YA 1IG9A 2D5RA 1RBTA 5E26A 3LZIA 1EXQA 1RNHA 4U7BA 3PLAA 1TV6A 3EL2A 3K5NA 1WB9A 2XO7A 1YF5L 3HXMA 1BGXT 1WUAA 3IKMA 3L2RA 4DUZK 4BE1A 3FR0A 3VQQA 2JWKA 2W40A 1NGIA 3VTIA 5KPZA 4DR2K 3I55N 5MLCQ 4B3SK 5EXWA 4CEDA 2OPRA 2DFFA 1RT3A 3FZKA 4DSEA 1J9AA 1XUPO 3HL8A 4B1ZA 4CGIA 3AV9A 3O9SA 4K43A 5BREA 2CGJA 4XEIA 3QO9A 3S3OA 2D4WA 4MO5A 1Y64A 1YVNA 2ETJA 3AA4A 3CC2N 2YHYA 2UUCK 1RTJA 4G1QA 5ELZA 4IDKA 4CEFA 5C15A 1ZBSA 2NRZA 2A41A 3SQ1A 2IOCA 1KCFA 4GV3A 1DEJA 4B9NA 1RT5A 2KZZA 2QW9A 2HW3A 4KI6A 3C6AA 4AF1A 4DQRA 4FM1A 1FW6A 5AQNA 5EX5A 4YFUA 1VQ7N 1IV0A 4RCHA 3HYFA 2ZJQL 2X6SA 3DXMB 3C6TA 2VQFK 2O8BB 3PSFA 5SWMA 3AVGA 2ZWHA 1QQMA 3JXUA 2WOMA 2P9PA 1LOTB 3N4QA 1QE1A 4IOXA 3THYA 2EWSA 4O0IA 4DQSA 4GV9A 2NRVA 4DSFA 1C6VA 3ZEUB 3VQ5A 3L2UA 3EKUA 4FWSA 4MFBA 1YUWA 5AQWA 3QLHA 2E20A 3LPUA 1ZBLA 2P9LA 4BC3A 1VQLN 4UY8O 4IG3A 4NLCA 3SK3A 1NNEA 5KTQA 3SQ2A 1S1UA 5SZTA 4LD0A 3F9MA 1VQ5N 1W0HA 2FF6A 4DB3A 4I2QA 1W97L 2ASMA 4GKKK 3SQ4A 3MN6A 3V9ZA 5FPMA 3VERA 4IO8A 4Y1CA 4CHZA 4Z4EA 1NJYA 3WQTA 4E1NA 1K73O 1SKWA 3I0SA 5CZ2A 4KHQA 1NLVA 3MX2A 4WCEL 1VSLA 4RW6A 3NH0A 4CJEA 5A2QO 3E01A 1VSHA 1QZ5A 3TPQA 3PO4A 4FVMA 3DWLA 3VEYA 5M1OA 4H0OA 4KHUA 1JLAA 2ATQA 1KXPA 5BPMA 3HPHA 1LWFA 3NGYA 4FWPA 1HKCA 3CIPA 5E41A 5AQMA 2XY5A 4C1NI 1EWQA 3O9QA 1DTTA 1Y97A 3CJ1A 1Q86O 4ID5A 5KI6A 3I0RA 4CEQA 4WFBL 1BUPA 2PYJA 3LWLA 3PIOL 4YDUC 3PX4A 2P1JA 1U47A 4DS4A 1QS4A 4B8CA 4JRQA 2W41A 4MDAA 3I56N 4JI8K 1RDAA 3ALYA 2YKMA 4KH5A 4FLVA 4E19A 3NGZA 4DV5K 2BTFA 4CBUA 3NE6A 5KGWA 5KRTA 1VSMA 2FSKA 1TKXA 2I7NA 3VETA 3QESA 3A2FA 3U3GA 4CEZA 2P5OA 4DSLA 4B3OA 3G0ZA 3KKSA 3C6UA 1XHZA 4CGDA 1KAYA 3MAQA 2VWJA 2JLEA 1TL3A 4K41A 3VA0A 4R79A 1Z05A 4IFYA 1BWFO 2F9TA 2KQ2A 2YHXA 2KKZA 3N4PA 1J5OA 4PL7A 4MO4A 3NVKA 4CD1A 5AZJB 3DXKB 3HM8A 2YV0X 3D2FA 3RR7A 2OA8A 4CEAA 3ZETA 4L8RB 3O1BA 4FLYA 2O8FA 5M1FA 4DV4K 3R8EA 4DTNA 5HRSA 4DKWA 4XIUA 4CJ7A 1UA1A 4Z4FA 3RSEA 3V6DA 4WQ4A 3D45A 3HVTA 2P9IA 1CXQA 4CGJA 2X78A 2QM1A 3SZ2A 2YJEA 3C65A 3M6GA 2IDOA 4FLUA 3HBTA 4CEBA 4DR6K 5J1EA 4DFKA 5JVHL 3AAQA 2ZGZA 4FJ8A 2E2PA 5HLFA 4KI4A 3J7AP 2IIRA 4BDYA 1XC9A 3OYHA 4CBWA 3AGRA 3DRRA 3SUQA 3LP2A 1VSIA 3EZ5A 3CPEA 3KLEA 1IBKK 5FPNA 3S9HA 2A42A 5AQHA 3WXKA 1GLAG 1WSGA 4BVPA 1OKJA 1HKGA 3FZHA 2A1SA 3DI6A 1HMVA 4BR2A 4NO7A 1NBWA 4BWMA 2UUAK 1NMNA 3L6QA 3TU5A 3CFPA 3WXJA 4RW9A 4ZTFA 1E3MA 3CCEN 4BACA 2UYTA 4DTXA 4PWDA 2Q0UA 3WNFA 2F8SA 1ZBUA 3CJBA 2ZE2A 1GLDG 1ASVA 4CK1A 3G6EN 1L3UA 1J6ZA 5KQDA 4AHCA 5GINA 3FLCO 3OTOK 1LWCA 2E6LA 1CZBA 3E9LA 1SUQA 2QWRA 3TAFA 1KQSM 2HBKA 3C7NB 4IOAL 4CGHA 2D1KA 4OPJA 4CHQA 4FJNA 2IVPA 3K5LA 5C0YA 5AQLA 3AVJA 2QEXN 3U3YA 3V4IA 4CJLA 4FK0A 4FJ5A 3BEXA 1MDUB 5J2NA 5AQTA 3WXIA 3KJVA 4FLXA 4ZHRA 5C24A 5JLHA 5DK5A 5FDLA 3OBYA 3VA3A 2FF3B 3G10A 4PKGA 3ZT1A 1VSKA 2NUBA 4CE9A 1XNRK 3RMBA 1EWRA 1WSFA 2Z1JA 2BE2A 1GOBA 4FJMA 1HJOA 4FWOA 1WN7A 4FJHA 4MLEA 1WSJA 1DLOA 3SCXA 3SBTA 1BHLA 1TVRA 2WBNA 4Q0BA 5EY4A 4HCBA 1TUUA 5FROA 4CF2A 4WYBA 1NKBA 3ZX2A 4JI4K 3LZJA 5FLXO 4OKKA 2JWLA 4FWKA 2NRHA 1JXBA 1X9JA 2QK9A 5AQPA 4RG8A 4FJ9A 1NGFA 3K9JA 3AA2A 3AVAA 4RW7A 2HNDA 1T03A 4QOZB 4N76A 3OJSA 3EEQA 5M1KA 4OPHA 4DHYA 3M3ZA 2ZJPL 2FBYA 3NGIA 2GEMA 3HPGA 1YI2N 1SKSA 1O1WA 2O4IA 3M1FA 4B1WB 3O1WA 1TAUA 1IH7A 1X3NA 3VOVA 3MWTA 4NXMK 3LDNA 2P9SA 3A5LC 3HPOA 1JLFA 5IT9O 1QSYA 3ZSYA 4QCLA 2FXUA 2RF2A 3RVCA 4ILHA 4JI1K 3OYFA 1Q7YO 3T1YK 4DV7K 1N32K 3AVCA 4B9UA 2DFEA 4H0YB 4ELTA 3CCQN 1NGGA 4H0XB 3GE1A 3TI0A 1ZC6A 3HK2A 1TK8A 4FO0A 4GNIA 1Q8IA 4E1JA 4J8FA 1GLFO 4DV3K 1EX4A 5ADXH 1BCMA 3B6OA 3ZSXA 5CY4A 4BC5A 3DOKA 1QQOA 4LFAK 3CFRA 5B8HA 3VPZA 1VHXA 4W5QA 5BR8K 2G8WA 5AQZA 1UWBA 3ZSZA 1NK8A 2GTDA 2QWQA 3RRHA 1ZBFA 4CHNA 1NJXA 1QZ6A 4QS8A 3AO3A 3CCLN 4H0PA 1QHTA 4XH4A 3VN5A 1KD1O 1NKEA 4LF6K 3UKUA 5AQXA 3ZYYX 1NGJA 1HPZA 4ISFA 5CYQA 1F21A 3LM2A 3VF6A 3THXA 4OVLA 1DTQA 1HNXK 1LWEA 3HRGA 4BDPA 1J54A 2HF3A 3DM2A 3LALA 4ELUA 3PO5A 4JKEA 4IFEA 1TYQA 2WTUA 1WAJA 1Q9XA 3ENBA 4N47A 3WUHA 2Q31A 2KFZA 4CHOA 1KSPA 4DU4A 4EZ9A 3CM6A 3I33A 4FWNA 2P9UB 1P8ZA 2ASPA 4M3XA 3ZSRA 4BGBA 4AQYK 4WQ5C 4CZHA 4E1MA 1I39A 4KHYA 4M7XA 4BRIA 3QFUA 4X62K 4BE0A 1R59O 4F2RA 2IC3A 4JD2B 3OYKA 1KTQA 4IJNA 1ATNA 2ITMA 3L4QA 3ID8A 4W5TA 2Z1HA 4LSLA 4FM2A 3F5TA 3OYCA 1OH6A 1L5UA 5J2PA 1M90O 1T3VA 2VGNA 3O3HA 1UOCA 4O55A 2OTJN 1REVA 4A5AA 1NK4A 3CG7A 3AVIA 4LSNA 3H6EA 4IBNA 3UKRA 3FGUA 4PA1A 3MXIA 4FVUA 3ENHA 4A2AA 1BL3A 2OPQA 4PL8A 1JXEA 2GUIA 4HHTA 4FYDA 2P9LB 1C1BA 1QVFM 4DU3A 5GAGP 3WNEA 2B6AA 4IEIA 2HSTA 4JLHA 3QDKA 5JLFA 1MWKA 2QKKA 2IVOA 3ZT2A 1RBRA 4CJKA 4DR5K 4FZZA 1U48A 1GLBG 4BWJA 3SMSA 3TAGA 3THWA 3P83D 4KBOA 4CJTA 4DF8A 3HSTB 1ZYQA 1U45A 4NCAA 4DU1A 3LP3A 4FWQA 4DTJA 3L3UA 4IDHA 4XH1A 4CFBA 1B92A 3OHRA 1GLJO 3K59A 2VGMA 5KPRA 5LMNK 3VQ8A 3FE1A 3NAEA 3KD1E 3ZETB 2QWOA 4DFMA 1JLGA 2GX9A 1TAQA 3SJHA 3OA9A 4BRHA 5JS2A 4BRAA 3HVRA 3O4WA 1VSDA 3VGKA 3Q7BA 2GWJA 2E4LA 5D3GA 2A6AA 4IFVA 4E0DA 3NBPA 4B3MK 1BOTO 4JK7A 4BREA 2D0CA 2F9WA 4WF9L 4DV6K 3G71N 3DAWA 5F2RA 4JHDB 3C94A 1RBVA 3KKRA 3VF2A 1HNWK 1O13A 3PSIA 1RT1A 4KFBA 1BIZA 1C1AA 1BIUA 2O8EA 3JAMO 1K8KB 3BP8A 3HM9A 4BRDA 5C2FA 1LCUA 4UQGA 1Q18A 4J2BA 4B1XB 4K42A 3M8PA 3PV8A 2F96A 4H5TA 1S6QA 3GBTA 3D0PA 4CF1A 1EETA 2WONA 3V1RA 4YNQA 1R0AA 4JI7K 4H0TB 1BQMA 3IUCA 3TSQA 3VQ9A 2V7ZA 3SPYA 4YOWA 4B3TK 1VK0A 1W2BM 4G9ZA 3MEGA 3WEEA 5BPNA 5LL6Z 1VSEA 3V1QA 3DRSA 2JGUA 1VQMN 3T19A 4FWMA 3V81A 2HF4A 1WNSA 4C23A 3ISNC 4W5NA 2IS3A 3F9KA 1BISA 4PKHA 2X74A 4CEOA 3KZBA 2VQEK 1S1VA 3VTHA 3SAHA 3NF8A 5GIPA 1WSIA 3CHWA 4DR4K 3QB0A 2RKIA 2H3GX 4CFAA 4LF8K 3CQYA 1NWKA 4RTFD 5AQVA 4DG1A 1XMQK 5LMUK 4AM7A 1GLEG 1QTMA 3LAKA 4CK3A 1FKOA 2YNFA 1CZ9A 3NH2A 1CLQA 3O3FA 3CJ7A 1IKXA 4CJUA 4IO9L 1YHQN 3CQ8A 3BZKA 1L3SA 2P9UA 3V9UA 3CM5A 3MWPA 4IEEA 3HI0A 2AA4A 5HRRA 4A61A 1U6ZA 1X9WA 4X66K 2P9NB 3KD5E 3BGRA 4X64K 2I7PA 2HB5A 1HKBA 2HBLA 4BG9A 3TSUA 4IOCL 1X3MA 4LY7A 2OPPA 4M42A 1C1CA 4JI6K 5HRPA 3OW2M 2DFHA 3OYMA 4I9QA 3VQ4A 3QEXA 1RFQA 3ULEB 3OYBA 2Y1JA 2OTLN 3J81O 4C1NK 4JKHA 3AO5A 4Z0UA 1W9HA 3GG4A 3OYLA 3TANA 4J2EA 4BC2A 4B9VA 2BGGA 1YAGA 4B9LA 3FZLA 3H3NO 1D5AA 4F2SA 1A5WA 3NVMA 4AILC 3ZSQA 2RHKA 3OVNA 1S9GA 1C0UA 4ICLA 4CZEA 2KLAA 4FK4A 2RPIA 5T7BA 4OLBA 4CJWA 3H46O 4BR9A 4CZKA 3I8DA 4BRCA 3AVBA 3K0SA 1RDWX 2QKBA 1ATRA 4B8AB 2R7YA 2E2NA 4FW2A 2BH1A 4CIEA 2FBXA 4H03B 2YHWA 1BA0A 3AVNA 4HVJA 4FWRA 3ATVA 3U8XA 3A5MC 3CQXA 1L3TA 1EQYA 3CERA 1KFSA 4E3SA 5J2MA 1SS6A 2Q36A 1VAZA 1SV5A 3QIPA 1VQKN 4DR7K 2KHOA 3TTDA 1XHXA 3MECA 3GOIA 4YOYA 3ZSWA 5AJ3K 3ENOA 4NXNK 2A1RA 2GUPA 3KWIA 3QEVA 4M45A 4NCBA 2F8TA 3LDOA 4Z4GA 5HROA 3SV4A 4OLAA 4KTZA 3TR8A 1XNQK 4EP4A 3E1YA 2KFNA 3BF1A 1Z6RA 4CGFA 3CCMN 4CD3A 5F1XA 4JKFA 1SZ2A 3MCAB 1D4XA 5C25A 1G15A 1TK0A 3TSPA 2HBMA 3AVFA 3CMEN 4FJLA 4M3WA 4CIGA 3H3OB 1VSFA 1NGBA 4BRLA 4M3UA 3G4SN 1KFDA 4RW4A 3VGMA 5I3UA 3UE5A 2HMPA 3TTFA 4QS9A 4FZYA 1K8KA 5AQGA 3TTCA 4DLEA 4KV8A 3ZT0A 4NCGA 3RMAA 3SUPA 4IZ9A 2ZJRL 5DMRA 3SI6A 2E8AA 3M8QA 5E84A 3DXMA 1P90A 3VGLA 4CZIA 5FRMA 1RCHA 2P9KB 2E6MA 2DTUA 3MX5A 1D9DA 3KK7A 3EE8A 4AHUA 3L2VA 3K58A 4OJRA 1KAXA 2A3ZA 3CCRN 2G8IA 1XMOK 2P9PB 3CJAA 2D0PA 4LC9B 1QSLA 3FZMA 3SLCA 4U67L 3NMUA 2DPNA 3MDQA 2HHHK 1XWLA 2E1YA 1JCEA 1S5JA 5AR0A 1RDUA 2G8FA 1IG8A 4FLZA 1YJWN 3K9KA 2O8CB 3ATUA 1ZBIA 1H1VA 1C0TA 4C8LA 1C0FA 1S1TA 4X65K 4AM6A 4FJIA 1HJRA 2OANA 3LL3A 1YT3A 4OPAA 3KTQA 3TAQA 4I7FA 1RDBA 1N6QA 3T1HK 3AGKA 4LFBK 3DJCA 1T8EA 5GAHP 1ATSA 4BRMA 3AVLA 2Q97A 4CFCA 4KTWA 1VQ6N 1ZBHA 1V4TA 5FPEA 4I6MA 1RTIA 2XY7A 4M63C 4CBXA 3NDKA 4CIFA 4CGGA 3LDSA 3AY9A 3SQ0A 4Z94A 4EZ6A 4OO1J 4FZXC 4DWIA 3PX0A 1QSSA 5M1NA 5DM7L 5JMVA 3THYB 5IWAK 4CJQA 4WE1A 3O08A 3MN9A 3JYTA 3CCVN 3RWUA 1ILYA 4QS7A 1NM1A 3U6FA 1T44A 2HHQA 1XC3A 4CJFA 1L3VA 4JS4A 3SPZA 3LANA 4GW6A 4IKFA 3J7YP 3M8SA 1XI1A 3P5JA 3NFAA 4DS5A 2CGLA 3HSCA 3L3VA 5AQRA 4Z4CA 5LY3A 2VG6A 1TKTA 2NZTA 5BRDA 1RBSA 2HHWA 3JS6A 2NLXA 1G99A 4OGCA 1HNIA 4JRPA 1N33K 3C6HA 2NRXA 1QVGM 2I5JA 4RWTA 2V7YA 3MMVA 3KHYA 4DQQA 1RBUA 3AVKA 1CXUA 4B1YB 1NGAA 3O8MA 3VQPA 3RTVA 3SV3A 2PBDA 4FJ7A 1NGDA 1QQNA 3K5OA 3RMDA 3F73A 3D2EA 2HNZA 1Z25A 2V51B 3VQAA 4JV5K 4KH6A 3CC4N 1SL0A 2Q2RA 1WOQA 4CJPA 4YOTA 5J2QA 4CZGA 4LF5K 1JL1A 1J53A 4JAXA 3HJFA 5AQOA 4OKJA 4BQZA 1S72N 3SMPA 3WT0A 1WBBA 3OS0A 1TUYA 1TK5A 3WQUA 4DSKA 4B3RK 2G8VA 4N56A 2P9IB 4JK9A 4B9QA 3OYEA 4BC4A 3I8BA 1HQEA 4K0KK 1JLEA 4E7IA 4BR4A 1W7AA 1VQ4N 3MK6A 4GY2B 5EU7A 2GWKA 3KLFA 4AH9A 4KHSA 1NJIO 3OYGA 2UXCK 2FLOA 3R9PA 3DMJA 3UKRB 4O44A 3CPWM 2HHXA 2QTDA 4FW1A 4PKIA 1CZAN 2QWLA 2YHAA 2O8BA 2ZD1A 1BI4A 5C2DA 3OYIA 1JCFA 3QEPA 1WSHA 5HP1A 5ADXA 2YCHA 3CJCA 1LV5A 4PY5A 3VEVA 4H0VB 2WC9A 3CI5A 4HTUA 3DLRA 1Q81O 4E7JA 4E89A 1RT2A 1E4FT 1WLJA 3ZT4A 3ULEA 5K14A 2W6KA 3NF7A 3QIOA 4O0JA 4DR3K 4DFPA 4CHPA 4K25A 4AHTA 4FLWA 4B9TA 3GDQA 3MXMA 1YJ9N 3LP1A 4F9OA 3ZLJA 1HYVA 3LPTA 1B9DA 3AO1A 3IRXA 1RDDA 1ASWA 4YY3K 4BRKA 1JJ2M 5GADP 5CE3A 3L2WA 5JVGL 1ITGA 4TSXA 2B4JA 4MDBA 1FK9A 3UKUB 1OVQA 5HBMA 3P39A 2E88A 5CHIA 3IS9A 1T6CA 4PHTX 1U4BA 4A2BA 3IFRA 2IGIA 4KHWA 3VEXA 2PY5A 5CZ1A 4DMNA 5EVZA 3OYDA 4DV2K 4DUYK 4NLBA 3LDQA 4CZLA 4DV1K 3IDHA 4M41A 3V9SA 4DLGA 1LW0A 3OYNA 3T7ZA 1U2VA 5F0XA 3TARA 3TAPA 3MXJA 3LM9A 3RSEB 1VRUA 3U9ZA 1RDCA 4J2AA 3CYMA 4EFHA 4IJAA 3B6PA 3S3MA 2YX6A 3WXLA 2YJFA 4DTOA 2UXBK 4LF4K 2FSJA 1N36K 3DLHA 3SNNA 5BR9A 1U04A 1NMDA 1EP4A 1RTHA 2VWBA 4KAZA 1WBDA 1K6YA 4Q5VA 1HYSA 2CH5A 4R5PA 3C0BA 3OS1A 4JI0K 1QHAA 3WXMB 3KWGA 1KVBA 1S22A 4KB0A 1X9MA 3W0LA 1JLCA 1IBMK 3KIOA 1T7PA 4H8KA 3O3GA 5CYMA 4ILGB 2LSNA 3OY9A 3U9DA 1VQNN 1NK9A 2UU9K 3CCJN 1FXXA 4KHPK 1WSEA 3VQDA 1UAXA 4MLHA 4CF8A 5LJWA 1SQKA 1RT6A 4JKGB 1JKHA 4CJ5A 4AHRA 3B8AX 4H5RA 4MQ3A 2GBZA 1JLQA 4FOEA 3O4QA 2A5XA 4KH4A 4BRNA 3K57A 3AA5X 4JEPA 3EZWA 4O8UA 4C8OA 1YIJN 2OPSA 5GAEP 3PUFA 2Z1IA 4YDUA 3AA3A 3CF5L 3CCSN 3THXB 4BQLA 1HPMA 3CETA 4JNEA 1S9EA 3DXKA 4CJ3A 1NK6A 3VF4A 4FM0A 4FPAA 3MEEA 5GIOA 1IO2A 1X9SA 2VG5A 1KRPA 2NRRA 3L0QA 2P5GA 1RGIA 3KK1A 4M3YA 3BUZB 2FSNA 1NG9A 1KLNA 4YORA 4I2PA 2PFUA 3QETA 5AQIA 1IKWA 2Q3SA 2AJQA 3BDPA 1HYZA 1ZXOA 3ZCMA 2BUPA 5TKYA 5AZIB 4I9LA 4GMJB 2IAJA 3CXCM 4BGAA 4M3ZA 5HRNA 3CCUN 3MN5A 3BZCA 4CHYA 1KVCA 1V4SA 2FBTA 5AQQA 5AQSA 3DLLL 4YOXA 3F2KA 4GKJK 3KVGA 4RW8A 4CESA 4KRFA 3HOTA 3SYZA 1YTUA 4CJRA 3C7NA 2ZM6K 1BQNA 3QERA 3CMAN 5BPLA 3K2PA 3SAFA 4FOIA 2KW4A 4DTPA 1S1WA 3DLBA 3THWB 2YNGA 1IKYA 1QQCA 3QBWA 1VQ9N 1HNVA 1DGKN 3ID6A 1D8YA 2P9KA 1YVUA 3EE9A 4DV0K 1NOZA 4N41A 3P4IA 4A59A 1BU6O 2QWNA 3J7ZO 4EHUA 4HUEA 1KLMA 3BF3A 4YOVA 3QEIA 3AO2A 3OJUA 1N5YA 4FLTA 1NK7A 3D6RA 3PIPL 1TYQB 5H1SQ 2B5JA 3TABA 4FXDA 1IBLK 2YKNA 2W42A 4L3QA 3ZSOA 1EKEA 3SAGA 4BRGA 4A62A 2XRIA 2HVHA 1K9MO 5JS1A 3W3DA 2E1ZA 2P9NA 4JI5K 3BY5A 1U49A 1LAWA 5AQJA 3IMXA 4C8MA 2KTQA 3H08A 4DFJA 1TKDA 3QINA 3HT3A 4O5FA 3HP9A 2XY8A 2AP1A 4PUOA 2X6NA 3E66A 4Z4HA 4B9MA 4O8KA 4DR1K 3QICA 4QAGA 3QMLA 4CJ4A 1GLCG 2O8CA 4WFNL 4F3OA 4FJGA 2HMIA 2WFBA 4FJXA 3LWMA 4CZMA 3V9XA 4JYAK 4CERA 1RT4A 4JS5A 3O9RA 3H1QA 2YNHA 1N34K 4WQ4C 1HR0K 2QWMA 4V19S 2O4GA 2A40A 3FFKB 2D0OA 4CZJA 2HVIA 3RR8A 1C0GA 4DCHA 2CH6A 2GV9A 1RILA 2PYLA 1VQON 4JI2K 3MN7A 5I42A 3OYAA 4JD2A 2OZMA 1SL2A 1HNZK 1YTAA 3AVHA 3CD6N 5LJVA 3ZX3A 4LH4A 2O8EB 3E9PA 4FPBA 4A5BA 5KRSA 1K8AO 3KK3A 3O5BA 2FC0A 3IG1A 4OKEA 4F4KA 4DSIA 3MCPA 3ITHA 4YHHK 3A8YA 1T6DA 1XQSC 3GL1A 1NJZA 1HX1A 1RTDA 3DOLA 5C12A 5I9EB 5AZJA 4JK8A 2YNIA 3EN9A 1WAFA 4WFAL 4HUGA 1NK0A 4FJJA 2VCPA 4FJKA 4CW7B 2OYQA 4GVMA 3VMFB 3VESA 2PZSA 3R3LA 4JHDA 4ELVA 4DF4A 2O8FB 4BDZA 4O5BA 3G25A 1HQUA 3MEDA 2YHBA 3SUNA 1VQ8N 4ISEA 3OS2A 2BANA 2ZQBA 3PX6A 1BG3A 4NYNA 2O8DA 2P9SB 2EHGA 3TWHA 3VQEA 3D2EB 1KVAA 1YJNN 3WNGA 4DQ8A 3LDPA 4BROA 4K8XA 3K5MA 4ZTJA 4CECA 4DQPA 3HO1A 1BO5O 4CZFA 3EY1A 3J80O 3KLHA 5FPDA 4EP5A 1I94K 1J5EK 5AFUA 3NHGA 1DKGD 3VQBA 2GELA 4BG8A 1EO1A 4A57A 3KK2A 5AFUH 2ZF5O 3O80A 4K8ZA 3DLKA 1S3XA 4HWIA 3CJ9A 3CFOA 3LP0A 3ZX0A 3HTVA 3VEZA 4JKDA 4NB4A 1SL1A 1NU0A 4OPKA 2DY4A 1TGOA 3EYZA 4CEEA 3LDLA 3VQ7A 5EOYA 3AARA 5TKWA 2G8KA 3IAYA 3ASMA 4YOUA 4CVNE 3C95A 5BN9A 1VRTA 4E7KA 3OYJA 1M1KO 1UA0A 1NK5A 3O6WA 3VQ6A 3ZT3A 3UIQA 4ID1A 4JI3K 3SUOA 1NGCA 1SAZA 3KLGA 3E9OA 5JICA 3S3NA 1X1PA 1GLLO 4CJVA 3ULDA 1OH5A 1Q82O 3J8AA 4CI6A 3NCIA 2Q0RA 4KPYA 2ASOA 3DLEA 4DSJA 1LAVA 4JKAA 4F3TA 3DYAA 1NGEA 4C8KA 5C10A 2NNWA 1T05A 2P51A 2OCEA 3O9UA 4M3TA 3O4NA 5BRHA 2ZGYA 3R6MA 4H5NA 3HOSA 4KB1A 1HLUA 4HTLA 2OZSA 2NRWA 5CR4A 4AHVA 3NH1A 2HHVA 2Z1GA 3FZFA 1DT9A 1Z26A 3M5RA 3ZSVA 1N8RO 1MA9B 3HP6A 4IG0A 1MWMA 4EAHD 4HCCA 1NKCA 4OX9K 1KC8O 3L2QA 4FL9A 3O9TA 1VSJA 3VEWA 2QXLA 5HL7L 5C42A 1U2VB 1B9FA 3A0IX 2HHTA 5AQYA 4E7HA 2QXFA 4W5OA 4H5WA 4BE2A 2HBJA 4NYFA 2Y1IA 1NGHA 2RN2A 5KQ8A 3L8BA 4B1UB 5KGXA 5DM6L 1FKPA 4BY9C 2F4VK 4KTQA 4LFCK 3WEEB 3DRPA 2G8HA 1A5VA 2FBVA 1OVYA 2XHBA 4B1VA 3AVMA 3VENA 3CC7N 3NF6A 4BVOA 2HHUA 4ILJA 2EX3A 3QBXA 4JKBA 4Z4IA 4KHNA 4CFDA 3DLGA 3THVA 3U4LA 5AQFA 2W6LA 3SJJA 2E5LK 2J4RA 1ESVA 3V1OA 3M8RA 1BI4B 1GOCA 4ISGA 3A5NC 3S41A 3QNNA 4JKGA 3UB5A 3T3FA 3OBWA 3P1GA 1BCOA 3QFPA 4B9SA 2HOEA 4BR7A 3R1XA 1E4GT 4WQ5A 2G8UA 5M1QA 3P38A 4BRQA 3H1VX 4O4GA 4FSVA 2E2OA 3ZEUA 2D0AA
chains in the Genus database with same CATH topology
1MDUB 2E2NA 5AQTA 3WXIA 5JLHA 2BH1A 2NRRA 3L0QA 3OBYA 3D2FB 3AAPA 4H03B 4EHTA 2YHWA 2FF3B 4PKGA 1BA0A 1RGIA 4JKCA 2E2QA 5M1PA 4FWRA 3BUZB 2FSNA 3ATVA 3U8XA 4BR5A 4YORA 1HJOA 4FWOA 3A5MC 3CQXA 2PFUA 1EQYA 2VYPA 3CERA 4I6MB 1SS6A 2Q36A 1VAZA 4MLEA 5AQIA 1VQKN 1YITN 2KHOA 3TTDA 3GOIA 4YOYA 1ZXOA 4GV6A 4Y0WA 2RE2A 2BUPA 2WBNA 2WUSA 3ENOA 3H45C 3HZ6A 3P31A 4M7YA 1TUUA 2GUPA 4FWLA 4WYBA 3KWIA 5AZIB 3T69A 3ZX2A 3CXCM 1VQPN 4BGAA 5AZIA 2CGKA 3LDOA 3CCUN 3MN5A 1KAZA 4XH5A 2QA4N 3EKSA 3E1YA 1V4SA 2JWLA 4FWKA 5AQQA 5AQSA 2NRHA 1BA1A 3DLLL 3BF1A 1Z6RA 4YOXA 3CCMN 5EY4A 4CD3A 3F2KA 1X9JA 3D7EO 5F1XA 5AQPA 4JKFA 1SZ2A 3MCAB 3KVGA 1D4XA 1NGFA 3K9JA 3TSPA 2HBMA 3CMEN 4IWVA 4BRPA 5M1KA 3H3OB 4OPHA 3VEOA 3M3ZA 4DHYA 5HOOA 3HOTA 1NGBA 2ZJPL 3A5OC 3C7NA 4BRLA 3G4SN 1JCGA 2GEMA 1YI2N 2V52B 3M1FA 3CMAN 3VGMA 4B1WB 5BPLA 3EO3A 4BR0A 3UE5A 3SAFA 2HMPA 3O1WA 3TTFA 5BN8A 4QS9A 1X3NA 1K8KA 3VOVA 5AQGA 4FOIA 3TTCA 3MWTA 2QI2A 2QWPA 3SBGA 3LDNA 2P9SA 4GVEA 3A5LC 4IZ9A 4JN4A 5KPTA 2ZJRL 3L4IA 2E8AA 2FXUA 2PAVA 3Q7CA 3RVCA 2IVNA 4ILHA 4IXCA 1YXQA 5E84A 3DXMA 1P90A 1Q7YO 3VGLA 3QBWA 4CZIA 2YI1A 1VQ9N 2F7TA 2P9KB 1DGKN 1HUXA 5BRFA 3ID6A 2NRTA 3MX5A 2P9KA 4H0YB 3KK7A 3EE8A 3EE9A 3CCQN 1KAXA 3P4IA 1NGGA 2A3ZA 4H5VA 4A59A 3CCRN 1BU6O 4H0XB 2P9PB 3GE1A 2QWNA 3J7ZO 3CJAA 1BDGA 2D0PA 4EHUA 1ZC6A 4LC9B 3BF3A 4YOVA 3FZMA 3SLCA 4FO0A 4GNIA 4U67L 3NMUA 2DPNA 3MDQA 2E1YA 1JCEA 4BRFA 5AR0A 3D6RA 4J8FA 5AQKA 5AQUA 2Q1NA 1RDUA 1TYQB 4E1JA 1GLFO 3PIPL 1IG8A 5H1SQ 1YJWN 3K9KA 4EIAA 3ATUA 5ADXH 1H1VA 1IJJA 4L3QA 1C0FA 3SAGA 4BRGA 4A62A 4AM6A 5E26A 4BC5A 2OANA 1K9MO 3LL3A 1QQOA 4OPAA 3W3DA 3EL2A 4U7BA 2E1ZA 3PLAA 2P9NA 5B8HA 3VPZA 3AGKA 1YF5L 3DJCA 5AQZA 5AQJA 3IMXA 1WUAA 3IKMA 1ATSA 5GAHP 4BRMA 2Q97A 1VQ6N 3FR0A 1V4TA 5FPEA 4O5FA 2JWKA 2W40A 4I6MA 1NGIA 3VTIA 5KPZA 2AP1A 2GTDA 2QWQA 3E66A 3I55N 4M63C 5MLCQ 1QZ6A 4CBXA 4QS8A 5EXWA 3AY9A 3CCLN 4H0PA 4Z94A 3FZKA 4O8KA 4OO1J 3QICA 4XH4A 1KD1O 1XUPO 4B1ZA 5M1NA 3UKUA 5DM7L 5AQXA 3QMLA 3ZYYX 5JMVA 1GLCG 3O9SA 1NGJA 4ISFA 4K43A 3LM2A 3VF6A 4WFNL 5BREA 2CGJA 3O08A 4XEIA 3MN9A 2WFBA 2D4WA 4MO5A 3HRGA 3CCVN 1Y64A 4CZMA 1YVNA 1ILYA 2HF3A 4QS7A 3CC2N 2YHYA 3O9RA 1NM1A 3H1QA 4JKEA 4WQ4C 4IFEA 1T44A 2QWMA 5ELZA 1XC3A 2A40A 3FFKB 2D0OA 4CZJA 1TYQA 5C15A 1ZBSA 2NRZA 2A41A 3ENBA 1C0GA 4DCHA 3WUHA 2CGLA 3HSCA 2Q31A 5AQRA 4GV3A 1DEJA 2CH6A 5LY3A 5BRDA 2NZTA 3I33A 4FWNA 2P9UB 2QW9A 1P8ZA 3JS6A 2ASPA 2NLXA 3C6AA 4AF1A 1G99A 1VQON 4BGBA 4WQ5C 5AQNA 4CZHA 3MN7A 3C6HA 5EX5A 2NRXA 1QVGM 4M7XA 4BRIA 3QFUA 1VQ7N 1R59O 4RCHA 4JD2A 2ZJQL 3DXMB 4JD2B 3CD6N 5LJVA 2V7YA 3MMVA 3KHYA 3ZX3A 4RWTA 4IJNA 3E9PA 1ATNA 2ZWHA 2ITMA 4FPBA 4A5BA 1K8AO 4B1YB 1QQMA 3JXUA 3ID8A 1NGAA 3L4QA 3O5BA 2P9PA 3O8MA 3F5TA 2PBDA 1LOTB 3N4QA 1NGDA 1QQNA 3MCPA 1M90O 4IOXA 3A8YA 1T6DA 2EWSA 3D2EA 1T3VA 2V51B 2VGNA 1XQSC 3GL1A 4GV9A 1HX1A 2NRVA 4KH6A 3CC4N 5C12A 2OTJN 5I9EB 4A5AA 5AZJA 2Q2RA 3ZEUB 1WOQA 4JK8A 4YOTA 4CZGA 3EKUA 4FWSA 3H6EA 3UKRA 3FGUA 3EN9A 4WFAL 1YUWA 2VCPA 4JAXA 5AQWA 4FVUA 3ENHA 3VMFB 2E20A 3VESA 4A2AA 4PL8A 5AQOA 4BQZA 1S72N 3SMPA 3WT0A 2P9LA 4BC3A 3R3LA 1VQLN 4UY8O 4JHDA 1TUYA 4NLCA 2P9LB 3WQUA 3SK3A 1QVFM 5GAGP 4IEIA 3G25A 2HSTA 3F9MA 1VQ5N 3QDKA 5JLFA 1VQ8N 2FF6A 4ISEA 1MWKA 2P9IB 2IVOA 4DB3A 1W97L 4JK9A 4B9QA 2ASMA 4BC4A 3I8BA 1GLBG 3SMSA 3MN6A 5FPMA 1BG3A 3VERA 4BR4A 4IO8A 2P9SB 3WQTA 1VQ4N 3MK6A 4GY2B 2GWKA 4KBOA 3D2EB 1K73O 1YJNN 1NLVA 1NJIO 4DQ8A 3MX2A 3LDPA 4WCEL 4BROA 2FLOA 4FWQA 3R9PA 1QZ5A 4IDHA 4XH1A 3UKRB 3OHRA 3CPWM 1GLJO 3TPQA 1BO5O 2QTDA 2VGMA 5KPRA 4PKIA 3FE1A 4CZFA 1CZAN 2QWLA 5FPDA 3DWLA 3VEYA 5M1OA 4H0OA 3ZETB 2QWOA 5C2DA 1KXPA 5BPMA 5AFUA 1JCFA 2GX9A 4FWPA 1HKCA 1DKGD 3CIPA 3SJHA 2GELA 5AQMA 3OA9A 4BG8A 4BRHA 1EO1A 4BRAA 5ADXA 2YCHA 3CJCA 4A57A 4C1NI 3O4WA 3O9QA 5AFUH 3Q7BA 4H0VB 2WC9A 2ZF5O 3CI5A 3O80A 3VEVA 3VGKA 2GWJA 1S3XA 1Q81O 2A6AA 4HWIA 3CJ9A 3CJ1A 1Q86O 1BOTO 4WFBL 4JK7A 1BUPA 4BREA 2F9WA 3ZX0A 4WF9L 1E4FT 4YDUC 3PIOL 3HTVA 3VEZA 4JKDA 3G71N 3DAWA 4NB4A 5F2RA 3ULEA 4JHDB 4K25A 2W41A 4MDAA 3VF2A 3I56N 3GDQA 1YJ9N 1O13A 4KH5A 3LDLA 4F9OA 5EOYA 3AARA 5TKWA 2BTFA 4CBUA 1K8KB 3BP8A 2FSKA 4BRDA 2I7NA 3VETA 5C2FA 1LCUA 4YOUA 1Q18A 5BN9A 4B1XB 4BRKA 4K42A 1JJ2M 5GADP 5CE3A 1M1KO 5JVGL 1KAYA 3O6WA 4H5TA 3GBTA 4K41A 4MDBA 3UKUB 4R79A 1Z05A 3P39A 1BWFO 1NGCA 2E88A 5CHIA 1SAZA 2YHXA 1T6CA 2F9TA 2KKZA 3N4PA 4PHTX 4A2BA 3E9OA 3IFRA 4PL7A 5JICA 4MO4A 4H0TB 3NVKA 3IUCA 1GLLO 4CD1A 3VEXA 3TSQA 5AZJB 3DXKB 3HM8A 5EVZA 3D2FA 1Q82O 2V7ZA 3J8AA 4YOWA 3ZETA 4CI6A 3O1BA 2Q0RA 4NLBA 3LDQA 4CZLA 5M1FA 2ASOA 1W2BM 3WEEA 3R8EA 5BPNA 4G9ZA 3IDHA 4JKAA 3T7ZA 1U2VA 4DKWA 5F0XA 4CJ7A 1VQMN 4FWMA 2HF4A 1NGEA 3RSEA 4C23A 5C10A 2NNWA 3LM9A 4WQ4A 3RSEB 3U9ZA 2P9IA 4PKHA 4EFHA 3O9UA 4IJAA 5BRHA 2ZGYA 3R6MA 4H5NA 3HOSA 1HLUA 4HTLA 2NRWA 2QM1A 3KZBA 2YJEA 3VTHA 2YX6A 5TKYA 3C65A 3M6GA 3WXLA 3SAHA 5CR4A 5GIPA 3CHWA 3HBTA 3QB0A 2YJFA 2H3GX 2FSJA 3FZFA 1DT9A 3M5RA 3CQYA 5JVHL 1N8RO 1MA9B 3AAQA 5BR9A 2ZGZA 2E2PA 1NWKA 4RTFD 1NMDA 1MWMA 5AQVA 4EAHD 2VWBA 4AM7A 1KC8O 1GLEG 2CH5A 2IIRA 3C0BA 4FL9A 1QHAA 3KWGA 3AGRA 3WXMB 1S22A 4CBWA 3O9TA 3SBTA 3VEWA 2QXLA 3CPEA 3W0LA 5HL7L 3CJ7A 1U2VB 5FPNA 2A42A 5AQHA 3WXKA 4IO9L 3A0IX 1GLAG 5AQYA 1YHQN 4ILGB 4BVPA 1OKJA 1HKGA 3FZHA 3U9DA 2P9UA 4H5WA 3MWPA 2HBJA 4IEEA 1VQNN 3HI0A 2AA4A 4A61A 4BR2A 3CCJN 1NGHA 1U6ZA 4NO7A 5KQ8A 1NBWA 2P9NB 3L6QA 3TU5A 4B1UB 2I7PA 4MLHA 5LJWA 1HKBA 2HBLA 1SQKA 4JKGB 3WXJA 5DM6L 4BY9C 4BG9A 3TSUA 4IOCL 3WEEB 1X3MA 3B8AX 4H5RA 4FOEA 3CCEN 2UYTA 3OW2M 2A5XA 2Q0UA 4KH4A 4BRNA 1OVYA 4JEPA 1RFQA 3ULEB 4B1VA 3CJBA 2OTLN 3VENA 3CC7N 4C1NK 3EZWA 4JKHA 4BVOA 4ILJA 4O8UA 3QBXA 1GLDG 3GG4A 4JKBA 3G6EN 1J6ZA 4BC2A 1YIJN 5KQDA 5GAEP 1YAGA 3FZLA 3H3NO 5GINA 3FLCO 3NVMA 4YDUA 3U4LA 5AQFA 3CF5L 2RHKA 2J4RA 3CCSN 3E9LA 4BQLA 1ESVA 1HPMA 3CETA 2QWRA 4JNEA 1KQSM 2HBKA 4CZEA 3C7NB 2KLAA 4IOAL 3DXKA 4ISGA 3A5NC 2D1KA 3S41A 3H46O 4JKGA 3VF4A 3UB5A 4BR9A 4CZKA 2IVPA 3OBWA 4FPAA 3QFPA 2HOEA 4BR7A 5C0YA 4BRCA 5GIOA 3R1XA 1E4GT 4WQ5A 1RDWX 5AQLA 2QEXN 5M1QA 3P38A 4BRQA 3H1VX 1ATRA 4FSVA 2E2OA 3ZEUA 3BEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM N;  1VQL N;  4UY8 O;  1K9M O;  1QVF M;  5GAG P;  1VQ5 N;  1VQ8 N;  5GAH P;  1VQ6 N;  3I55 N;  1VQ4 N;  5MLC Q;  1K73 O;  1YJN N;  5JVH L;  1N8R O;  1NJI O;  1VQK N;  1YIT N;  3CCL N;  4WCE L;  1KD1 O;  5DM7 L;  3CXC M;  1VQP N;  1KC8 O;  3CPW M;  3CCU N;  4WFN L;  2QA4 N;  5HL7 L;  3CCV N;  1ILY A;  3CC2 N;  3DLL L;  3CCM N;  4IO9 L;  1YHQ N;  1VQN N;  3CME N;  1Q81 O;  3CCJ N;  1Q86 O;  2ZJP L;  4WFB L;  4WF9 L;  3PIO L;  3G4S N;  1YI2 N;  3G71 N;  3CMA N;  5DM6 L;  1VQO N;  3I56 N;  4IOC L;  1YJ9 N;  1QVG M;  3CCE N;  1VQ7 N;  3OW2 M;  2ZJR L;  2ZJQ L;  1OVY A;  3CD6 N;  2OTL N;  3CC7 N;  1Q7Y O;  1VQ9 N;  1JJ2 M;  5GAD P;  1K8A O;  3G6E N;  1YIJ N;  1M1K O;  5JVG L;  5GAE P;  3CCQ N;  3CCR N;  3CF5 L;  3J7Z O;  3CCS N;  1M90 O;  1KQS M;  4U67 L;  3CC4 N;  2OTJ N;  4IOA L;  3PIP L;  1Q82 O;  1YJW N;  5H1S Q;  4WFA L;  1W2B M;  2QEX N;  1S72 N; 
#chains in the Genus database with same CATH topology
 2VG7 A;  1LW2 A;  4KRE A;  1I3A A;  2O8D B;  3D2F B;  3AAP A;  4DQI A;  4EHT A;  4H4M A;  2D0B A;  2VWK A;  4DTM A;  4JKC A;  2E2Q A;  5M1P A;  1C0M A;  4C8N A;  4OGE A;  1D9F A;  4E7L A;  4BR5 A;  4I6M B;  4J2D A;  2VYP A;  1NOY A;  1NJW A;  1OH7 A;  3JSM A;  1YIT N;  4AHS A;  2BDP A;  4HUF A;  4GV6 A;  4Y0W A;  2RE2 A;  2WUS A;  3H45 C;  3P31 A;  3TAM A;  3HZ6 A;  3T69 A;  4M7Y A;  4LH5 A;  4N5S A;  4FWL A;  4W5R A;  1VQP N;  4CF0 A;  4KKO A;  5AZI A;  2CGK A;  1KAZ A;  4PQU A;  2UUB K;  4XH5 A;  2QA4 N;  3QNO A;  2ITG A;  3EKS A;  1BA1 A;  1ASU A;  3LAM A;  3D7E O;  4M3R A;  2KZM A;  4IWV A;  4BRP A;  3VEO A;  5HOO A;  4CJS A;  3A5O C;  4DTR A;  1JCG A;  1MU2 A;  2V52 B;  1GOA A;  3EO3 A;  4BR0 A;  1S6P A;  5BN8 A;  4FCY A;  1TKZ A;  1JL2 A;  2QI2 A;  3AO4 A;  2QWP A;  3SBG A;  4F8R A;  2HNY A;  1S1X A;  4GVE A;  5KPT A;  4JN4 A;  4B08 A;  3L4I A;  4KO0 A;  3QEW A;  1A5X A;  2PAV A;  3Q7C A;  2IVN A;  4IXC A;  1YXQ A;  3T1A A;  4DTU A;  1JLB A;  1HRH A;  2YI1 A;  2F7T A;  3RRG A;  1HUX A;  5BRF A;  2NRT A;  5FRN A;  4LF7 K;  1OH8 A;  4Y1D A;  3PY8 A;  2HHS A;  3KLI A;  4H5V A;  4FK2 A;  2UXD K;  3RMC A;  3VQC A;  1BDG A;  4CK2 A;  3V9W A;  1IKV A;  2XY6 A;  4BRF A;  1RT7 A;  3WNH A;  1SKR A;  1TL1 A;  4H4O A;  4CF9 A;  5AQK A;  5AQU A;  2Q1N A;  3TAE A;  4DTS A;  4LF9 K;  1FJG K;  4EIA A;  3NF9 A;  3FFI A;  4CCH A;  1IJJ A;  1Q9Y A;  1IG9 A;  2D5R A;  1RBT A;  5E26 A;  3LZI A;  1EXQ A;  1RNH A;  4U7B A;  3PLA A;  1TV6 A;  3EL2 A;  3K5N A;  1WB9 A;  2XO7 A;  1YF5 L;  3HXM A;  1BGX T;  1WUA A;  3IKM A;  3L2R A;  4DUZ K;  4BE1 A;  3FR0 A;  3VQQ A;  2JWK A;  2W40 A;  1NGI A;  3VTI A;  5KPZ A;  4DR2 K;  3I55 N;  5MLC Q;  4B3S K;  5EXW A;  4CED A;  2OPR A;  2DFF A;  1RT3 A;  3FZK A;  4DSE A;  1J9A A;  1XUP O;  3HL8 A;  4B1Z A;  4CGI A;  3AV9 A;  3O9S A;  4K43 A;  5BRE A;  2CGJ A;  4XEI A;  3QO9 A;  3S3O A;  2D4W A;  4MO5 A;  1Y64 A;  1YVN A;  2ETJ A;  3AA4 A;  3CC2 N;  2YHY A;  2UUC K;  1RTJ A;  4G1Q A;  5ELZ A;  4IDK A;  4CEF A;  5C15 A;  1ZBS A;  2NRZ A;  2A41 A;  3SQ1 A;  2IOC A;  1KCF A;  4GV3 A;  1DEJ A;  4B9N A;  1RT5 A;  2KZZ A;  2QW9 A;  2HW3 A;  4KI6 A;  3C6A A;  4AF1 A;  4DQR A;  4FM1 A;  1FW6 A;  5AQN A;  5EX5 A;  4YFU A;  1VQ7 N;  1IV0 A;  4RCH A;  3HYF A;  2ZJQ L;  2X6S A;  3DXM B;  3C6T A;  2VQF K;  2O8B B;  3PSF A;  5SWM A;  3AVG A;  2ZWH A;  1QQM A;  3JXU A;  2WOM A;  2P9P A;  1LOT B;  3N4Q A;  1QE1 A;  4IOX A;  3THY A;  2EWS A;  4O0I A;  4DQS A;  4GV9 A;  2NRV A;  4DSF A;  1C6V A;  3ZEU B;  3VQ5 A;  3L2U A;  3EKU A;  4FWS A;  4MFB A;  1YUW A;  5AQW A;  3QLH A;  2E20 A;  3LPU A;  1ZBL A;  2P9L A;  4BC3 A;  1VQL N;  4UY8 O;  4IG3 A;  4NLC A;  3SK3 A;  1NNE A;  5KTQ A;  3SQ2 A;  1S1U A;  5SZT A;  4LD0 A;  3F9M A;  1VQ5 N;  1W0H A;  2FF6 A;  4DB3 A;  4I2Q A;  1W97 L;  2ASM A;  4GKK K;  3SQ4 A;  3MN6 A;  3V9Z A;  5FPM A;  3VER A;  4IO8 A;  4Y1C A;  4CHZ A;  4Z4E A;  1NJY A;  3WQT A;  4E1N A;  1K73 O;  1SKW A;  3I0S A;  5CZ2 A;  4KHQ A;  1NLV A;  3MX2 A;  4WCE L;  1VSL A;  4RW6 A;  3NH0 A;  4CJE A;  5A2Q O;  3E01 A;  1VSH A;  1QZ5 A;  3TPQ A;  3PO4 A;  4FVM A;  3DWL A;  3VEY A;  5M1O A;  4H0O A;  4KHU A;  1JLA A;  2ATQ A;  1KXP A;  5BPM A;  3HPH A;  1LWF A;  3NGY A;  4FWP A;  1HKC A;  3CIP A;  5E41 A;  5AQM A;  2XY5 A;  4C1N I;  1EWQ A;  3O9Q A;  1DTT A;  1Y97 A;  3CJ1 A;  1Q86 O;  4ID5 A;  5KI6 A;  3I0R A;  4CEQ A;  4WFB L;  1BUP A;  2PYJ A;  3LWL A;  3PIO L;  4YDU C;  3PX4 A;  2P1J A;  1U47 A;  4DS4 A;  1QS4 A;  4B8C A;  4JRQ A;  2W41 A;  4MDA A;  3I56 N;  4JI8 K;  1RDA A;  3ALY A;  2YKM A;  4KH5 A;  4FLV A;  4E19 A;  3NGZ A;  4DV5 K;  2BTF A;  4CBU A;  3NE6 A;  5KGW A;  5KRT A;  1VSM A;  2FSK A;  1TKX A;  2I7N A;  3VET A;  3QES A;  3A2F A;  3U3G A;  4CEZ A;  2P5O A;  4DSL A;  4B3O A;  3G0Z A;  3KKS A;  3C6U A;  1XHZ A;  4CGD A;  1KAY A;  3MAQ A;  2VWJ A;  2JLE A;  1TL3 A;  4K41 A;  3VA0 A;  4R79 A;  1Z05 A;  4IFY A;  1BWF O;  2F9T A;  2KQ2 A;  2YHX A;  2KKZ A;  3N4P A;  1J5O A;  4PL7 A;  4MO4 A;  3NVK A;  4CD1 A;  5AZJ B;  3DXK B;  3HM8 A;  2YV0 X;  3D2F A;  3RR7 A;  2OA8 A;  4CEA A;  3ZET A;  4L8R B;  3O1B A;  4FLY A;  2O8F A;  5M1F A;  4DV4 K;  3R8E A;  4DTN A;  5HRS A;  4DKW A;  4XIU A;  4CJ7 A;  1UA1 A;  4Z4F A;  3RSE A;  3V6D A;  4WQ4 A;  3D45 A;  3HVT A;  2P9I A;  1CXQ A;  4CGJ A;  2X78 A;  2QM1 A;  3SZ2 A;  2YJE A;  3C65 A;  3M6G A;  2IDO A;  4FLU A;  3HBT A;  4CEB A;  4DR6 K;  5J1E A;  4DFK A;  5JVH L;  3AAQ A;  2ZGZ A;  4FJ8 A;  2E2P A;  5HLF A;  4KI4 A;  3J7A P;  2IIR A;  4BDY A;  1XC9 A;  3OYH A;  4CBW A;  3AGR A;  3DRR A;  3SUQ A;  3LP2 A;  1VSI A;  3EZ5 A;  3CPE A;  3KLE A;  1IBK K;  5FPN A;  3S9H A;  2A42 A;  5AQH A;  3WXK A;  1GLA G;  1WSG A;  4BVP A;  1OKJ A;  1HKG A;  3FZH A;  2A1S A;  3DI6 A;  1HMV A;  4BR2 A;  4NO7 A;  1NBW A;  4BWM A;  2UUA K;  1NMN A;  3L6Q A;  3TU5 A;  3CFP A;  3WXJ A;  4RW9 A;  4ZTF A;  1E3M A;  3CCE N;  4BAC A;  2UYT A;  4DTX A;  4PWD A;  2Q0U A;  3WNF A;  2F8S A;  1ZBU A;  3CJB A;  2ZE2 A;  1GLD G;  1ASV A;  4CK1 A;  3G6E N;  1L3U A;  1J6Z A;  5KQD A;  4AHC A;  5GIN A;  3FLC O;  3OTO K;  1LWC A;  2E6L A;  1CZB A;  3E9L A;  1SUQ A;  2QWR A;  3TAF A;  1KQS M;  2HBK A;  3C7N B;  4IOA L;  4CGH A;  2D1K A;  4OPJ A;  4CHQ A;  4FJN A;  2IVP A;  3K5L A;  5C0Y A;  5AQL A;  3AVJ A;  2QEX N;  3U3Y A;  3V4I A;  4CJL A;  4FK0 A;  4FJ5 A;  3BEX A;  1MDU B;  5J2N A;  5AQT A;  3WXI A;  3KJV A;  4FLX A;  4ZHR A;  5C24 A;  5JLH A;  5DK5 A;  5FDL A;  3OBY A;  3VA3 A;  2FF3 B;  3G10 A;  4PKG A;  3ZT1 A;  1VSK A;  2NUB A;  4CE9 A;  1XNR K;  3RMB A;  1EWR A;  1WSF A;  2Z1J A;  2BE2 A;  1GOB A;  4FJM A;  1HJO A;  4FWO A;  1WN7 A;  4FJH A;  4MLE A;  1WSJ A;  1DLO A;  3SCX A;  3SBT A;  1BHL A;  1TVR A;  2WBN A;  4Q0B A;  5EY4 A;  4HCB A;  1TUU A;  5FRO A;  4CF2 A;  4WYB A;  1NKB A;  3ZX2 A;  4JI4 K;  3LZJ A;  5FLX O;  4OKK A;  2JWL A;  4FWK A;  2NRH A;  1JXB A;  1X9J A;  2QK9 A;  5AQP A;  4RG8 A;  4FJ9 A;  1NGF A;  3K9J A;  3AA2 A;  3AVA A;  4RW7 A;  2HND A;  1T03 A;  4QOZ B;  4N76 A;  3OJS A;  3EEQ A;  5M1K A;  4OPH A;  4DHY A;  3M3Z A;  2ZJP L;  2FBY A;  3NGI A;  2GEM A;  3HPG A;  1YI2 N;  1SKS A;  1O1W A;  2O4I A;  3M1F A;  4B1W B;  3O1W A;  1TAU A;  1IH7 A;  1X3N A;  3VOV A;  3MWT A;  4NXM K;  3LDN A;  2P9S A;  3A5L C;  3HPO A;  1JLF A;  5IT9 O;  1QSY A;  3ZSY A;  4QCL A;  2FXU A;  2RF2 A;  3RVC A;  4ILH A;  4JI1 K;  3OYF A;  1Q7Y O;  3T1Y K;  4DV7 K;  1N32 K;  3AVC A;  4B9U A;  2DFE A;  4H0Y B;  4ELT A;  3CCQ N;  1NGG A;  4H0X B;  3GE1 A;  3TI0 A;  1ZC6 A;  3HK2 A;  1TK8 A;  4FO0 A;  4GNI A;  1Q8I A;  4E1J A;  4J8F A;  1GLF O;  4DV3 K;  1EX4 A;  5ADX H;  1BCM A;  3B6O A;  3ZSX A;  5CY4 A;  4BC5 A;  3DOK A;  1QQO A;  4LFA K;  3CFR A;  5B8H A;  3VPZ A;  1VHX A;  4W5Q A;  5BR8 K;  2G8W A;  5AQZ A;  1UWB A;  3ZSZ A;  1NK8 A;  2GTD A;  2QWQ A;  3RRH A;  1ZBF A;  4CHN A;  1NJX A;  1QZ6 A;  4QS8 A;  3AO3 A;  3CCL N;  4H0P A;  1QHT A;  4XH4 A;  3VN5 A;  1KD1 O;  1NKE A;  4LF6 K;  3UKU A;  5AQX A;  3ZYY X;  1NGJ A;  1HPZ A;  4ISF A;  5CYQ A;  1F21 A;  3LM2 A;  3VF6 A;  3THX A;  4OVL A;  1DTQ A;  1HNX K;  1LWE A;  3HRG A;  4BDP A;  1J54 A;  2HF3 A;  3DM2 A;  3LAL A;  4ELU A;  3PO5 A;  4JKE A;  4IFE A;  1TYQ A;  2WTU A;  1WAJ A;  1Q9X A;  3ENB A;  4N47 A;  3WUH A;  2Q31 A;  2KFZ A;  4CHO A;  1KSP A;  4DU4 A;  4EZ9 A;  3CM6 A;  3I33 A;  4FWN A;  2P9U B;  1P8Z A;  2ASP A;  4M3X A;  3ZSR A;  4BGB A;  4AQY K;  4WQ5 C;  4CZH A;  4E1M A;  1I39 A;  4KHY A;  4M7X A;  4BRI A;  3QFU A;  4X62 K;  4BE0 A;  1R59 O;  4F2R A;  2IC3 A;  4JD2 B;  3OYK A;  1KTQ A;  4IJN A;  1ATN A;  2ITM A;  3L4Q A;  3ID8 A;  4W5T A;  2Z1H A;  4LSL A;  4FM2 A;  3F5T A;  3OYC A;  1OH6 A;  1L5U A;  5J2P A;  1M90 O;  1T3V A;  2VGN A;  3O3H A;  1UOC A;  4O55 A;  2OTJ N;  1REV A;  4A5A A;  1NK4 A;  3CG7 A;  3AVI A;  4LSN A;  3H6E A;  4IBN A;  3UKR A;  3FGU A;  4PA1 A;  3MXI A;  4FVU A;  3ENH A;  4A2A A;  1BL3 A;  2OPQ A;  4PL8 A;  1JXE A;  2GUI A;  4HHT A;  4FYD A;  2P9L B;  1C1B A;  1QVF M;  4DU3 A;  5GAG P;  3WNE A;  2B6A A;  4IEI A;  2HST A;  4JLH A;  3QDK A;  5JLF A;  1MWK A;  2QKK A;  2IVO A;  3ZT2 A;  1RBR A;  4CJK A;  4DR5 K;  4FZZ A;  1U48 A;  1GLB G;  4BWJ A;  3SMS A;  3TAG A;  3THW A;  3P83 D;  4KBO A;  4CJT A;  4DF8 A;  3HST B;  1ZYQ A;  1U45 A;  4NCA A;  4DU1 A;  3LP3 A;  4FWQ A;  4DTJ A;  3L3U A;  4IDH A;  4XH1 A;  4CFB A;  1B92 A;  3OHR A;  1GLJ O;  3K59 A;  2VGM A;  5KPR A;  5LMN K;  3VQ8 A;  3FE1 A;  3NAE A;  3KD1 E;  3ZET B;  2QWO A;  4DFM A;  1JLG A;  2GX9 A;  1TAQ A;  3SJH A;  3OA9 A;  4BRH A;  5JS2 A;  4BRA A;  3HVR A;  3O4W A;  1VSD A;  3VGK A;  3Q7B A;  2GWJ A;  2E4L A;  5D3G A;  2A6A A;  4IFV A;  4E0D A;  3NBP A;  4B3M K;  1BOT O;  4JK7 A;  4BRE A;  2D0C A;  2F9W A;  4WF9 L;  4DV6 K;  3G71 N;  3DAW A;  5F2R A;  4JHD B;  3C94 A;  1RBV A;  3KKR A;  3VF2 A;  1HNW K;  1O13 A;  3PSI A;  1RT1 A;  4KFB A;  1BIZ A;  1C1A A;  1BIU A;  2O8E A;  3JAM O;  1K8K B;  3BP8 A;  3HM9 A;  4BRD A;  5C2F A;  1LCU A;  4UQG A;  1Q18 A;  4J2B A;  4B1X B;  4K42 A;  3M8P A;  3PV8 A;  2F96 A;  4H5T A;  1S6Q A;  3GBT A;  3D0P A;  4CF1 A;  1EET A;  2WON A;  3V1R A;  4YNQ A;  1R0A A;  4JI7 K;  4H0T B;  1BQM A;  3IUC A;  3TSQ A;  3VQ9 A;  2V7Z A;  3SPY A;  4YOW A;  4B3T K;  1VK0 A;  1W2B M;  4G9Z A;  3MEG A;  3WEE A;  5BPN A;  5LL6 Z;  1VSE A;  3V1Q A;  3DRS A;  2JGU A;  1VQM N;  3T19 A;  4FWM A;  3V81 A;  2HF4 A;  1WNS A;  4C23 A;  3ISN C;  4W5N A;  2IS3 A;  3F9K A;  1BIS A;  4PKH A;  2X74 A;  4CEO A;  3KZB A;  2VQE K;  1S1V A;  3VTH A;  3SAH A;  3NF8 A;  5GIP A;  1WSI A;  3CHW A;  4DR4 K;  3QB0 A;  2RKI A;  2H3G X;  4CFA A;  4LF8 K;  3CQY A;  1NWK A;  4RTF D;  5AQV A;  4DG1 A;  1XMQ K;  5LMU K;  4AM7 A;  1GLE G;  1QTM A;  3LAK A;  4CK3 A;  1FKO A;  2YNF A;  1CZ9 A;  3NH2 A;  1CLQ A;  3O3F A;  3CJ7 A;  1IKX A;  4CJU A;  4IO9 L;  1YHQ N;  3CQ8 A;  3BZK A;  1L3S A;  2P9U A;  3V9U A;  3CM5 A;  3MWP A;  4IEE A;  3HI0 A;  2AA4 A;  5HRR A;  4A61 A;  1U6Z A;  1X9W A;  4X66 K;  2P9N B;  3KD5 E;  3BGR A;  4X64 K;  2I7P A;  2HB5 A;  1HKB A;  2HBL A;  4BG9 A;  3TSU A;  4IOC L;  1X3M A;  4LY7 A;  2OPP A;  4M42 A;  1C1C A;  4JI6 K;  5HRP A;  3OW2 M;  2DFH A;  3OYM A;  4I9Q A;  3VQ4 A;  3QEX A;  1RFQ A;  3ULE B;  3OYB A;  2Y1J A;  2OTL N;  3J81 O;  4C1N K;  4JKH A;  3AO5 A;  4Z0U A;  1W9H A;  3GG4 A;  3OYL A;  3TAN A;  4J2E A;  4BC2 A;  4B9V A;  2BGG A;  1YAG A;  4B9L A;  3FZL A;  3H3N O;  1D5A A;  4F2S A;  1A5W A;  3NVM A;  4AIL C;  3ZSQ A;  2RHK A;  3OVN A;  1S9G A;  1C0U A;  4ICL A;  4CZE A;  2KLA A;  4FK4 A;  2RPI A;  5T7B A;  4OLB A;  4CJW A;  3H46 O;  4BR9 A;  4CZK A;  3I8D A;  4BRC A;  3AVB A;  3K0S A;  1RDW X;  2QKB A;  1ATR A;  4B8A B;  2R7Y A;  2E2N A;  4FW2 A;  2BH1 A;  4CIE A;  2FBX A;  4H03 B;  2YHW A;  1BA0 A;  3AVN A;  4HVJ A;  4FWR A;  3ATV A;  3U8X A;  3A5M C;  3CQX A;  1L3T A;  1EQY A;  3CER A;  1KFS A;  4E3S A;  5J2M A;  1SS6 A;  2Q36 A;  1VAZ A;  1SV5 A;  3QIP A;  1VQK N;  4DR7 K;  2KHO A;  3TTD A;  1XHX A;  3MEC A;  3GOI A;  4YOY A;  3ZSW A;  5AJ3 K;  3ENO A;  4NXN K;  2A1R A;  2GUP A;  3KWI A;  3QEV A;  4M45 A;  4NCB A;  2F8T A;  3LDO A;  4Z4G A;  5HRO A;  3SV4 A;  4OLA A;  4KTZ A;  3TR8 A;  1XNQ K;  4EP4 A;  3E1Y A;  2KFN A;  3BF1 A;  1Z6R A;  4CGF A;  3CCM N;  4CD3 A;  5F1X A;  4JKF A;  1SZ2 A;  3MCA B;  1D4X A;  5C25 A;  1G15 A;  1TK0 A;  3TSP A;  2HBM A;  3AVF A;  3CME N;  4FJL A;  4M3W A;  4CIG A;  3H3O B;  1VSF A;  1NGB A;  4BRL A;  4M3U A;  3G4S N;  1KFD A;  4RW4 A;  3VGM A;  5I3U A;  3UE5 A;  2HMP A;  3TTF A;  4QS9 A;  4FZY A;  1K8K A;  5AQG A;  3TTC A;  4DLE A;  4KV8 A;  3ZT0 A;  4NCG A;  3RMA A;  3SUP A;  4IZ9 A;  2ZJR L;  5DMR A;  3SI6 A;  2E8A A;  3M8Q A;  5E84 A;  3DXM A;  1P90 A;  3VGL A;  4CZI A;  5FRM A;  1RCH A;  2P9K B;  2E6M A;  2DTU A;  3MX5 A;  1D9D A;  3KK7 A;  3EE8 A;  4AHU A;  3L2V A;  3K58 A;  4OJR A;  1KAX A;  2A3Z A;  3CCR N;  2G8I A;  1XMO K;  2P9P B;  3CJA A;  2D0P A;  4LC9 B;  1QSL A;  3FZM A;  3SLC A;  4U67 L;  3NMU A;  2DPN A;  3MDQ A;  2HHH K;  1XWL A;  2E1Y A;  1JCE A;  1S5J A;  5AR0 A;  1RDU A;  2G8F A;  1IG8 A;  4FLZ A;  1YJW N;  3K9K A;  2O8C B;  3ATU A;  1ZBI A;  1H1V A;  1C0T A;  4C8L A;  1C0F A;  1S1T A;  4X65 K;  4AM6 A;  4FJI A;  1HJR A;  2OAN A;  3LL3 A;  1YT3 A;  4OPA A;  3KTQ A;  3TAQ A;  4I7F A;  1RDB A;  1N6Q A;  3T1H K;  3AGK A;  4LFB K;  3DJC A;  1T8E A;  5GAH P;  1ATS A;  4BRM A;  3AVL A;  2Q97 A;  4CFC A;  4KTW A;  1VQ6 N;  1ZBH A;  1V4T A;  5FPE A;  4I6M A;  1RTI A;  2XY7 A;  4M63 C;  4CBX A;  3NDK A;  4CIF A;  4CGG A;  3LDS A;  3AY9 A;  3SQ0 A;  4Z94 A;  4EZ6 A;  4OO1 J;  4FZX C;  4DWI A;  3PX0 A;  1QSS A;  5M1N A;  5DM7 L;  5JMV A;  3THY B;  5IWA K;  4CJQ A;  4WE1 A;  3O08 A;  3MN9 A;  3JYT A;  3CCV N;  3RWU A;  1ILY A;  4QS7 A;  1NM1 A;  3U6F A;  1T44 A;  2HHQ A;  1XC3 A;  4CJF A;  1L3V A;  4JS4 A;  3SPZ A;  3LAN A;  4GW6 A;  4IKF A;  3J7Y P;  3M8S A;  1XI1 A;  3P5J A;  3NFA A;  4DS5 A;  2CGL A;  3HSC A;  3L3V A;  5AQR A;  4Z4C A;  5LY3 A;  2VG6 A;  1TKT A;  2NZT A;  5BRD A;  1RBS A;  2HHW A;  3JS6 A;  2NLX A;  1G99 A;  4OGC A;  1HNI A;  4JRP A;  1N33 K;  3C6H A;  2NRX A;  1QVG M;  2I5J A;  4RWT A;  2V7Y A;  3MMV A;  3KHY A;  4DQQ A;  1RBU A;  3AVK A;  1CXU A;  4B1Y B;  1NGA A;  3O8M A;  3VQP A;  3RTV A;  3SV3 A;  2PBD A;  4FJ7 A;  1NGD A;  1QQN A;  3K5O A;  3RMD A;  3F73 A;  3D2E A;  2HNZ A;  1Z25 A;  2V51 B;  3VQA A;  4JV5 K;  4KH6 A;  3CC4 N;  1SL0 A;  2Q2R A;  1WOQ A;  4CJP A;  4YOT A;  5J2Q A;  4CZG A;  4LF5 K;  1JL1 A;  1J53 A;  4JAX A;  3HJF A;  5AQO A;  4OKJ A;  4BQZ A;  1S72 N;  3SMP A;  3WT0 A;  1WBB A;  3OS0 A;  1TUY A;  1TK5 A;  3WQU A;  4DSK A;  4B3R K;  2G8V A;  4N56 A;  2P9I B;  4JK9 A;  4B9Q A;  3OYE A;  4BC4 A;  3I8B A;  1HQE A;  4K0K K;  1JLE A;  4E7I A;  4BR4 A;  1W7A A;  1VQ4 N;  3MK6 A;  4GY2 B;  5EU7 A;  2GWK A;  3KLF A;  4AH9 A;  4KHS A;  1NJI O;  3OYG A;  2UXC K;  2FLO A;  3R9P A;  3DMJ A;  3UKR B;  4O44 A;  3CPW M;  2HHX A;  2QTD A;  4FW1 A;  4PKI A;  1CZA N;  2QWL A;  2YHA A;  2O8B A;  2ZD1 A;  1BI4 A;  5C2D A;  3OYI A;  1JCF A;  3QEP A;  1WSH A;  5HP1 A;  5ADX A;  2YCH A;  3CJC A;  1LV5 A;  4PY5 A;  3VEV A;  4H0V B;  2WC9 A;  3CI5 A;  4HTU A;  3DLR A;  1Q81 O;  4E7J A;  4E89 A;  1RT2 A;  1E4F T;  1WLJ A;  3ZT4 A;  3ULE A;  5K14 A;  2W6K A;  3NF7 A;  3QIO A;  4O0J A;  4DR3 K;  4DFP A;  4CHP A;  4K25 A;  4AHT A;  4FLW A;  4B9T A;  3GDQ A;  3MXM A;  1YJ9 N;  3LP1 A;  4F9O A;  3ZLJ A;  1HYV A;  3LPT A;  1B9D A;  3AO1 A;  3IRX A;  1RDD A;  1ASW A;  4YY3 K;  4BRK A;  1JJ2 M;  5GAD P;  5CE3 A;  3L2W A;  5JVG L;  1ITG A;  4TSX A;  2B4J A;  4MDB A;  1FK9 A;  3UKU B;  1OVQ A;  5HBM A;  3P39 A;  2E88 A;  5CHI A;  3IS9 A;  1T6C A;  4PHT X;  1U4B A;  4A2B A;  3IFR A;  2IGI A;  4KHW A;  3VEX A;  2PY5 A;  5CZ1 A;  4DMN A;  5EVZ A;  3OYD A;  4DV2 K;  4DUY K;  4NLB A;  3LDQ A;  4CZL A;  4DV1 K;  3IDH A;  4M41 A;  3V9S A;  4DLG A;  1LW0 A;  3OYN A;  3T7Z A;  1U2V A;  5F0X A;  3TAR A;  3TAP A;  3MXJ A;  3LM9 A;  3RSE B;  1VRU A;  3U9Z A;  1RDC A;  4J2A A;  3CYM A;  4EFH A;  4IJA A;  3B6P A;  3S3M A;  2YX6 A;  3WXL A;  2YJF A;  4DTO A;  2UXB K;  4LF4 K;  2FSJ A;  1N36 K;  3DLH A;  3SNN A;  5BR9 A;  1U04 A;  1NMD A;  1EP4 A;  1RTH A;  2VWB A;  4KAZ A;  1WBD A;  1K6Y A;  4Q5V A;  1HYS A;  2CH5 A;  4R5P A;  3C0B A;  3OS1 A;  4JI0 K;  1QHA A;  3WXM B;  3KWG A;  1KVB A;  1S22 A;  4KB0 A;  1X9M A;  3W0L A;  1JLC A;  1IBM K;  3KIO A;  1T7P A;  4H8K A;  3O3G A;  5CYM A;  4ILG B;  2LSN A;  3OY9 A;  3U9D A;  1VQN N;  1NK9 A;  2UU9 K;  3CCJ N;  1FXX A;  4KHP K;  1WSE A;  3VQD A;  1UAX A;  4MLH A;  4CF8 A;  5LJW A;  1SQK A;  1RT6 A;  4JKG B;  1JKH A;  4CJ5 A;  4AHR A;  3B8A X;  4H5R A;  4MQ3 A;  2GBZ A;  1JLQ A;  4FOE A;  3O4Q A;  2A5X A;  4KH4 A;  4BRN A;  3K57 A;  3AA5 X;  4JEP A;  3EZW A;  4O8U A;  4C8O A;  1YIJ N;  2OPS A;  5GAE P;  3PUF A;  2Z1I A;  4YDU A;  3AA3 A;  3CF5 L;  3CCS N;  3THX B;  4BQL A;  1HPM A;  3CET A;  4JNE A;  1S9E A;  3DXK A;  4CJ3 A;  1NK6 A;  3VF4 A;  4FM0 A;  4FPA A;  3MEE A;  5GIO A;  1IO2 A;  1X9S A;  2VG5 A;  1KRP A;  2NRR A;  3L0Q A;  2P5G A;  1RGI A;  3KK1 A;  4M3Y A;  3BUZ B;  2FSN A;  1NG9 A;  1KLN A;  4YOR A;  4I2P A;  2PFU A;  3QET A;  5AQI A;  1IKW A;  2Q3S A;  2AJQ A;  3BDP A;  1HYZ A;  1ZXO A;  3ZCM A;  2BUP A;  5TKY A;  5AZI B;  4I9L A;  4GMJ B;  2IAJ A;  3CXC M;  4BGA A;  4M3Z A;  5HRN A;  3CCU N;  3MN5 A;  3BZC A;  4CHY A;  1KVC A;  1V4S A;  2FBT A;  5AQQ A;  5AQS A;  3DLL L;  4YOX A;  3F2K A;  4GKJ K;  3KVG A;  4RW8 A;  4CES A;  4KRF A;  3HOT A;  3SYZ A;  1YTU A;  4CJR A;  3C7N A;  2ZM6 K;  1BQN A;  3QER A;  3CMA N;  5BPL A;  3K2P A;  3SAF A;  4FOI A;  2KW4 A;  4DTP A;  1S1W A;  3DLB A;  3THW B;  2YNG A;  1IKY A;  1QQC A;  3QBW A;  1VQ9 N;  1HNV A;  1DGK N;  3ID6 A;  1D8Y A;  2P9K A;  1YVU A;  3EE9 A;  4DV0 K;  1NOZ A;  4N41 A;  3P4I A;  4A59 A;  1BU6 O;  2QWN A;  3J7Z O;  4EHU A;  4HUE A;  1KLM A;  3BF3 A;  4YOV A;  3QEI A;  3AO2 A;  3OJU A;  1N5Y A;  4FLT A;  1NK7 A;  3D6R A;  3PIP L;  1TYQ B;  5H1S Q;  2B5J A;  3TAB A;  4FXD A;  1IBL K;  2YKN A;  2W42 A;  4L3Q A;  3ZSO A;  1EKE A;  3SAG A;  4BRG A;  4A62 A;  2XRI A;  2HVH A;  1K9M O;  5JS1 A;  3W3D A;  2E1Z A;  2P9N A;  4JI5 K;  3BY5 A;  1U49 A;  1LAW A;  5AQJ A;  3IMX A;  4C8M A;  2KTQ A;  3H08 A;  4DFJ A;  1TKD A;  3QIN A;  3HT3 A;  4O5F A;  3HP9 A;  2XY8 A;  2AP1 A;  4PUO A;  2X6N A;  3E66 A;  4Z4H A;  4B9M A;  4O8K A;  4DR1 K;  3QIC A;  4QAG A;  3QML A;  4CJ4 A;  1GLC G;  2O8C A;  4WFN L;  4F3O A;  4FJG A;  2HMI A;  2WFB A;  4FJX A;  3LWM A;  4CZM A;  3V9X A;  4JYA K;  4CER A;  1RT4 A;  4JS5 A;  3O9R A;  3H1Q A;  2YNH A;  1N34 K;  4WQ4 C;  1HR0 K;  2QWM A;  4V19 S;  2O4G A;  2A40 A;  3FFK B;  2D0O A;  4CZJ A;  2HVI A;  3RR8 A;  1C0G A;  4DCH A;  2CH6 A;  2GV9 A;  1RIL A;  2PYL A;  1VQO N;  4JI2 K;  3MN7 A;  5I42 A;  3OYA A;  4JD2 A;  2OZM A;  1SL2 A;  1HNZ K;  1YTA A;  3AVH A;  3CD6 N;  5LJV A;  3ZX3 A;  4LH4 A;  2O8E B;  3E9P A;  4FPB A;  4A5B A;  5KRS A;  1K8A O;  3KK3 A;  3O5B A;  2FC0 A;  3IG1 A;  4OKE A;  4F4K A;  4DSI A;  3MCP A;  3ITH A;  4YHH K;  3A8Y A;  1T6D A;  1XQS C;  3GL1 A;  1NJZ A;  1HX1 A;  1RTD A;  3DOL A;  5C12 A;  5I9E B;  5AZJ A;  4JK8 A;  2YNI A;  3EN9 A;  1WAF A;  4WFA L;  4HUG A;  1NK0 A;  4FJJ A;  2VCP A;  4FJK A;  4CW7 B;  2OYQ A;  4GVM A;  3VMF B;  3VES A;  2PZS A;  3R3L A;  4JHD A;  4ELV A;  4DF4 A;  2O8F B;  4BDZ A;  4O5B A;  3G25 A;  1HQU A;  3MED A;  2YHB A;  3SUN A;  1VQ8 N;  4ISE A;  3OS2 A;  2BAN A;  2ZQB A;  3PX6 A;  1BG3 A;  4NYN A;  2O8D A;  2P9S B;  2EHG A;  3TWH A;  3VQE A;  3D2E B;  1KVA A;  1YJN N;  3WNG A;  4DQ8 A;  3LDP A;  4BRO A;  4K8X A;  3K5M A;  4ZTJ A;  4CEC A;  4DQP A;  3HO1 A;  1BO5 O;  4CZF A;  3EY1 A;  3J80 O;  3KLH A;  5FPD A;  4EP5 A;  1I94 K;  1J5E K;  5AFU A;  3NHG A;  1DKG D;  3VQB A;  2GEL A;  4BG8 A;  1EO1 A;  4A57 A;  3KK2 A;  5AFU H;  2ZF5 O;  3O80 A;  4K8Z A;  3DLK A;  1S3X A;  4HWI A;  3CJ9 A;  3CFO A;  3LP0 A;  3ZX0 A;  3HTV A;  3VEZ A;  4JKD A;  4NB4 A;  1SL1 A;  1NU0 A;  4OPK A;  2DY4 A;  1TGO A;  3EYZ A;  4CEE A;  3LDL A;  3VQ7 A;  5EOY A;  3AAR A;  5TKW A;  2G8K A;  3IAY A;  3ASM A;  4YOU A;  4CVN E;  3C95 A;  5BN9 A;  1VRT A;  4E7K A;  3OYJ A;  1M1K O;  1UA0 A;  1NK5 A;  3O6W A;  3VQ6 A;  3ZT3 A;  3UIQ A;  4ID1 A;  4JI3 K;  3SUO A;  1NGC A;  1SAZ A;  3KLG A;  3E9O A;  5JIC A;  3S3N A;  1X1P A;  1GLL O;  4CJV A;  3ULD A;  1OH5 A;  1Q82 O;  3J8A A;  4CI6 A;  3NCI A;  2Q0R A;  4KPY A;  2ASO A;  3DLE A;  4DSJ A;  1LAV A;  4JKA A;  4F3T A;  3DYA A;  1NGE A;  4C8K A;  5C10 A;  2NNW A;  1T05 A;  2P51 A;  2OCE A;  3O9U A;  4M3T A;  3O4N A;  5BRH A;  2ZGY A;  3R6M A;  4H5N A;  3HOS A;  4KB1 A;  1HLU A;  4HTL A;  2OZS A;  2NRW A;  5CR4 A;  4AHV A;  3NH1 A;  2HHV A;  2Z1G A;  3FZF A;  1DT9 A;  1Z26 A;  3M5R A;  3ZSV A;  1N8R O;  1MA9 B;  3HP6 A;  4IG0 A;  1MWM A;  4EAH D;  4HCC A;  1NKC A;  4OX9 K;  1KC8 O;  3L2Q A;  4FL9 A;  3O9T A;  1VSJ A;  3VEW A;  2QXL A;  5HL7 L;  5C42 A;  1U2V B;  1B9F A;  3A0I X;  2HHT A;  5AQY A;  4E7H A;  2QXF A;  4W5O A;  4H5W A;  4BE2 A;  2HBJ A;  4NYF A;  2Y1I A;  1NGH A;  2RN2 A;  5KQ8 A;  3L8B A;  4B1U B;  5KGX A;  5DM6 L;  1FKP A;  4BY9 C;  2F4V K;  4KTQ A;  4LFC K;  3WEE B;  3DRP A;  2G8H A;  1A5V A;  2FBV A;  1OVY A;  2XHB A;  4B1V A;  3AVM A;  3VEN A;  3CC7 N;  3NF6 A;  4BVO A;  2HHU A;  4ILJ A;  2EX3 A;  3QBX A;  4JKB A;  4Z4I A;  4KHN A;  4CFD A;  3DLG A;  3THV A;  3U4L A;  5AQF A;  2W6L A;  3SJJ A;  2E5L K;  2J4R A;  1ESV A;  3V1O A;  3M8R A;  1BI4 B;  1GOC A;  4ISG A;  3A5N C;  3S41 A;  3QNN A;  4JKG A;  3UB5 A;  3T3F A;  3OBW A;  3P1G A;  1BCO A;  3QFP A;  4B9S A;  2HOE A;  4BR7 A;  3R1X A;  1E4G T;  4WQ5 A;  2G8U A;  5M1Q A;  3P38 A;  4BRQ A;  3H1V X;  4O4G A;  4FSV A;  2E2O A;  3ZEU A;  2D0A A; 
#chains in the Genus database with same CATH homology
 1MDU B;  2E2N A;  5AQT A;  3WXI A;  5JLH A;  2BH1 A;  2NRR A;  3L0Q A;  3OBY A;  3D2F B;  3AAP A;  4H03 B;  4EHT A;  2YHW A;  2FF3 B;  4PKG A;  1BA0 A;  1RGI A;  4JKC A;  2E2Q A;  5M1P A;  4FWR A;  3BUZ B;  2FSN A;  3ATV A;  3U8X A;  4BR5 A;  4YOR A;  1HJO A;  4FWO A;  3A5M C;  3CQX A;  2PFU A;  1EQY A;  2VYP A;  3CER A;  4I6M B;  1SS6 A;  2Q36 A;  1VAZ A;  4MLE A;  5AQI A;  1VQK N;  1YIT N;  2KHO A;  3TTD A;  3GOI A;  4YOY A;  1ZXO A;  4GV6 A;  4Y0W A;  2RE2 A;  2BUP A;  2WBN A;  2WUS A;  3ENO A;  3H45 C;  3HZ6 A;  3P31 A;  4M7Y A;  1TUU A;  2GUP A;  4FWL A;  4WYB A;  3KWI A;  5AZI B;  3T69 A;  3ZX2 A;  3CXC M;  1VQP N;  4BGA A;  5AZI A;  2CGK A;  3LDO A;  3CCU N;  3MN5 A;  1KAZ A;  4XH5 A;  2QA4 N;  3EKS A;  3E1Y A;  1V4S A;  2JWL A;  4FWK A;  5AQQ A;  5AQS A;  2NRH A;  1BA1 A;  3DLL L;  3BF1 A;  1Z6R A;  4YOX A;  3CCM N;  5EY4 A;  4CD3 A;  3F2K A;  1X9J A;  3D7E O;  5F1X A;  5AQP A;  4JKF A;  1SZ2 A;  3MCA B;  3KVG A;  1D4X A;  1NGF A;  3K9J A;  3TSP A;  2HBM A;  3CME N;  4IWV A;  4BRP A;  5M1K A;  3H3O B;  4OPH A;  3VEO A;  3M3Z A;  4DHY A;  5HOO A;  3HOT A;  1NGB A;  2ZJP L;  3A5O C;  3C7N A;  4BRL A;  3G4S N;  1JCG A;  2GEM A;  1YI2 N;  2V52 B;  3M1F A;  3CMA N;  3VGM A;  4B1W B;  5BPL A;  3EO3 A;  4BR0 A;  3UE5 A;  3SAF A;  2HMP A;  3O1W A;  3TTF A;  5BN8 A;  4QS9 A;  1X3N A;  1K8K A;  3VOV A;  5AQG A;  4FOI A;  3TTC A;  3MWT A;  2QI2 A;  2QWP A;  3SBG A;  3LDN A;  2P9S A;  4GVE A;  3A5L C;  4IZ9 A;  4JN4 A;  5KPT A;  2ZJR L;  3L4I A;  2E8A A;  2FXU A;  2PAV A;  3Q7C A;  3RVC A;  2IVN A;  4ILH A;  4IXC A;  1YXQ A;  5E84 A;  3DXM A;  1P90 A;  1Q7Y O;  3VGL A;  3QBW A;  4CZI A;  2YI1 A;  1VQ9 N;  2F7T A;  2P9K B;  1DGK N;  1HUX A;  5BRF A;  3ID6 A;  2NRT A;  3MX5 A;  2P9K A;  4H0Y B;  3KK7 A;  3EE8 A;  3EE9 A;  3CCQ N;  1KAX A;  3P4I A;  1NGG A;  2A3Z A;  4H5V A;  4A59 A;  3CCR N;  1BU6 O;  4H0X B;  2P9P B;  3GE1 A;  2QWN A;  3J7Z O;  3CJA A;  1BDG A;  2D0P A;  4EHU A;  1ZC6 A;  4LC9 B;  3BF3 A;  4YOV A;  3FZM A;  3SLC A;  4FO0 A;  4GNI A;  4U67 L;  3NMU A;  2DPN A;  3MDQ A;  2E1Y A;  1JCE A;  4BRF A;  5AR0 A;  3D6R A;  4J8F A;  5AQK A;  5AQU A;  2Q1N A;  1RDU A;  1TYQ B;  4E1J A;  1GLF O;  3PIP L;  1IG8 A;  5H1S Q;  1YJW N;  3K9K A;  4EIA A;  3ATU A;  5ADX H;  1H1V A;  1IJJ A;  4L3Q A;  1C0F A;  3SAG A;  4BRG A;  4A62 A;  4AM6 A;  5E26 A;  4BC5 A;  2OAN A;  1K9M O;  3LL3 A;  1QQO A;  4OPA A;  3W3D A;  3EL2 A;  4U7B A;  2E1Z A;  3PLA A;  2P9N A;  5B8H A;  3VPZ A;  3AGK A;  1YF5 L;  3DJC A;  5AQZ A;  5AQJ A;  3IMX A;  1WUA A;  3IKM A;  1ATS A;  5GAH P;  4BRM A;  2Q97 A;  1VQ6 N;  3FR0 A;  1V4T A;  5FPE A;  4O5F A;  2JWK A;  2W40 A;  4I6M A;  1NGI A;  3VTI A;  5KPZ A;  2AP1 A;  2GTD A;  2QWQ A;  3E66 A;  3I55 N;  4M63 C;  5MLC Q;  1QZ6 A;  4CBX A;  4QS8 A;  5EXW A;  3AY9 A;  3CCL N;  4H0P A;  4Z94 A;  3FZK A;  4O8K A;  4OO1 J;  3QIC A;  4XH4 A;  1KD1 O;  1XUP O;  4B1Z A;  5M1N A;  3UKU A;  5DM7 L;  5AQX A;  3QML A;  3ZYY X;  5JMV A;  1GLC G;  3O9S A;  1NGJ A;  4ISF A;  4K43 A;  3LM2 A;  3VF6 A;  4WFN L;  5BRE A;  2CGJ A;  3O08 A;  4XEI A;  3MN9 A;  2WFB A;  2D4W A;  4MO5 A;  3HRG A;  3CCV N;  1Y64 A;  4CZM A;  1YVN A;  1ILY A;  2HF3 A;  4QS7 A;  3CC2 N;  2YHY A;  3O9R A;  1NM1 A;  3H1Q A;  4JKE A;  4WQ4 C;  4IFE A;  1T44 A;  2QWM A;  5ELZ A;  1XC3 A;  2A40 A;  3FFK B;  2D0O A;  4CZJ A;  1TYQ A;  5C15 A;  1ZBS A;  2NRZ A;  2A41 A;  3ENB A;  1C0G A;  4DCH A;  3WUH A;  2CGL A;  3HSC A;  2Q31 A;  5AQR A;  4GV3 A;  1DEJ A;  2CH6 A;  5LY3 A;  5BRD A;  2NZT A;  3I33 A;  4FWN A;  2P9U B;  2QW9 A;  1P8Z A;  3JS6 A;  2ASP A;  2NLX A;  3C6A A;  4AF1 A;  1G99 A;  1VQO N;  4BGB A;  4WQ5 C;  5AQN A;  4CZH A;  3MN7 A;  3C6H A;  5EX5 A;  2NRX A;  1QVG M;  4M7X A;  4BRI A;  3QFU A;  1VQ7 N;  1R59 O;  4RCH A;  4JD2 A;  2ZJQ L;  3DXM B;  4JD2 B;  3CD6 N;  5LJV A;  2V7Y A;  3MMV A;  3KHY A;  3ZX3 A;  4RWT A;  4IJN A;  3E9P A;  1ATN A;  2ZWH A;  2ITM A;  4FPB A;  4A5B A;  1K8A O;  4B1Y B;  1QQM A;  3JXU A;  3ID8 A;  1NGA A;  3L4Q A;  3O5B A;  2P9P A;  3O8M A;  3F5T A;  2PBD A;  1LOT B;  3N4Q A;  1NGD A;  1QQN A;  3MCP A;  1M90 O;  4IOX A;  3A8Y A;  1T6D A;  2EWS A;  3D2E A;  1T3V A;  2V51 B;  2VGN A;  1XQS C;  3GL1 A;  4GV9 A;  1HX1 A;  2NRV A;  4KH6 A;  3CC4 N;  5C12 A;  2OTJ N;  5I9E B;  4A5A A;  5AZJ A;  2Q2R A;  3ZEU B;  1WOQ A;  4JK8 A;  4YOT A;  4CZG A;  3EKU A;  4FWS A;  3H6E A;  3UKR A;  3FGU A;  3EN9 A;  4WFA L;  1YUW A;  2VCP A;  4JAX A;  5AQW A;  4FVU A;  3ENH A;  3VMF B;  2E20 A;  3VES A;  4A2A A;  4PL8 A;  5AQO A;  4BQZ A;  1S72 N;  3SMP A;  3WT0 A;  2P9L A;  4BC3 A;  3R3L A;  1VQL N;  4UY8 O;  4JHD A;  1TUY A;  4NLC A;  2P9L B;  3WQU A;  3SK3 A;  1QVF M;  5GAG P;  4IEI A;  3G25 A;  2HST A;  3F9M A;  1VQ5 N;  3QDK A;  5JLF A;  1VQ8 N;  2FF6 A;  4ISE A;  1MWK A;  2P9I B;  2IVO A;  4DB3 A;  1W97 L;  4JK9 A;  4B9Q A;  2ASM A;  4BC4 A;  3I8B A;  1GLB G;  3SMS A;  3MN6 A;  5FPM A;  1BG3 A;  3VER A;  4BR4 A;  4IO8 A;  2P9S B;  3WQT A;  1VQ4 N;  3MK6 A;  4GY2 B;  2GWK A;  4KBO A;  3D2E B;  1K73 O;  1YJN N;  1NLV A;  1NJI O;  4DQ8 A;  3MX2 A;  3LDP A;  4WCE L;  4BRO A;  2FLO A;  4FWQ A;  3R9P A;  1QZ5 A;  4IDH A;  4XH1 A;  3UKR B;  3OHR A;  3CPW M;  1GLJ O;  3TPQ A;  1BO5 O;  2QTD A;  2VGM A;  5KPR A;  4PKI A;  3FE1 A;  4CZF A;  1CZA N;  2QWL A;  5FPD A;  3DWL A;  3VEY A;  5M1O A;  4H0O A;  3ZET B;  2QWO A;  5C2D A;  1KXP A;  5BPM A;  5AFU A;  1JCF A;  2GX9 A;  4FWP A;  1HKC A;  1DKG D;  3CIP A;  3SJH A;  2GEL A;  5AQM A;  3OA9 A;  4BG8 A;  4BRH A;  1EO1 A;  4BRA A;  5ADX A;  2YCH A;  3CJC A;  4A57 A;  4C1N I;  3O4W A;  3O9Q A;  5AFU H;  3Q7B A;  4H0V B;  2WC9 A;  2ZF5 O;  3CI5 A;  3O80 A;  3VEV A;  3VGK A;  2GWJ A;  1S3X A;  1Q81 O;  2A6A A;  4HWI A;  3CJ9 A;  3CJ1 A;  1Q86 O;  1BOT O;  4WFB L;  4JK7 A;  1BUP A;  4BRE A;  2F9W A;  3ZX0 A;  4WF9 L;  1E4F T;  4YDU C;  3PIO L;  3HTV A;  3VEZ A;  4JKD A;  3G71 N;  3DAW A;  4NB4 A;  5F2R A;  3ULE A;  4JHD B;  4K25 A;  2W41 A;  4MDA A;  3VF2 A;  3I56 N;  3GDQ A;  1YJ9 N;  1O13 A;  4KH5 A;  3LDL A;  4F9O A;  5EOY A;  3AAR A;  5TKW A;  2BTF A;  4CBU A;  1K8K B;  3BP8 A;  2FSK A;  4BRD A;  2I7N A;  3VET A;  5C2F A;  1LCU A;  4YOU A;  1Q18 A;  5BN9 A;  4B1X B;  4BRK A;  4K42 A;  1JJ2 M;  5GAD P;  5CE3 A;  1M1K O;  5JVG L;  1KAY A;  3O6W A;  4H5T A;  3GBT A;  4K41 A;  4MDB A;  3UKU B;  4R79 A;  1Z05 A;  3P39 A;  1BWF O;  1NGC A;  2E88 A;  5CHI A;  1SAZ A;  2YHX A;  1T6C A;  2F9T A;  2KKZ A;  3N4P A;  4PHT X;  4A2B A;  3E9O A;  3IFR A;  4PL7 A;  5JIC A;  4MO4 A;  4H0T B;  3NVK A;  3IUC A;  1GLL O;  4CD1 A;  3VEX A;  3TSQ A;  5AZJ B;  3DXK B;  3HM8 A;  5EVZ A;  3D2F A;  1Q82 O;  2V7Z A;  3J8A A;  4YOW A;  3ZET A;  4CI6 A;  3O1B A;  2Q0R A;  4NLB A;  3LDQ A;  4CZL A;  5M1F A;  2ASO A;  1W2B M;  3WEE A;  3R8E A;  5BPN A;  4G9Z A;  3IDH A;  4JKA A;  3T7Z A;  1U2V A;  4DKW A;  5F0X A;  4CJ7 A;  1VQM N;  4FWM A;  2HF4 A;  1NGE A;  3RSE A;  4C23 A;  5C10 A;  2NNW A;  3LM9 A;  4WQ4 A;  3RSE B;  3U9Z A;  2P9I A;  4PKH A;  4EFH A;  3O9U A;  4IJA A;  5BRH A;  2ZGY A;  3R6M A;  4H5N A;  3HOS A;  1HLU A;  4HTL A;  2NRW A;  2QM1 A;  3KZB A;  2YJE A;  3VTH A;  2YX6 A;  5TKY A;  3C65 A;  3M6G A;  3WXL A;  3SAH A;  5CR4 A;  5GIP A;  3CHW A;  3HBT A;  3QB0 A;  2YJF A;  2H3G X;  2FSJ A;  3FZF A;  1DT9 A;  3M5R A;  3CQY A;  5JVH L;  1N8R O;  1MA9 B;  3AAQ A;  5BR9 A;  2ZGZ A;  2E2P A;  1NWK A;  4RTF D;  1NMD A;  1MWM A;  5AQV A;  4EAH D;  2VWB A;  4AM7 A;  1KC8 O;  1GLE G;  2CH5 A;  2IIR A;  3C0B A;  4FL9 A;  1QHA A;  3KWG A;  3AGR A;  3WXM B;  1S22 A;  4CBW A;  3O9T A;  3SBT A;  3VEW A;  2QXL A;  3CPE A;  3W0L A;  5HL7 L;  3CJ7 A;  1U2V B;  5FPN A;  2A42 A;  5AQH A;  3WXK A;  4IO9 L;  3A0I X;  1GLA G;  5AQY A;  1YHQ N;  4ILG B;  4BVP A;  1OKJ A;  1HKG A;  3FZH A;  3U9D A;  2P9U A;  4H5W A;  3MWP A;  2HBJ A;  4IEE A;  1VQN N;  3HI0 A;  2AA4 A;  4A61 A;  4BR2 A;  3CCJ N;  1NGH A;  1U6Z A;  4NO7 A;  5KQ8 A;  1NBW A;  2P9N B;  3L6Q A;  3TU5 A;  4B1U B;  2I7P A;  4MLH A;  5LJW A;  1HKB A;  2HBL A;  1SQK A;  4JKG B;  3WXJ A;  5DM6 L;  4BY9 C;  4BG9 A;  3TSU A;  4IOC L;  3WEE B;  1X3M A;  3B8A X;  4H5R A;  4FOE A;  3CCE N;  2UYT A;  3OW2 M;  2A5X A;  2Q0U A;  4KH4 A;  4BRN A;  1OVY A;  4JEP A;  1RFQ A;  3ULE B;  4B1V A;  3CJB A;  2OTL N;  3VEN A;  3CC7 N;  4C1N K;  3EZW A;  4JKH A;  4BVO A;  4ILJ A;  4O8U A;  3QBX A;  1GLD G;  3GG4 A;  4JKB A;  3G6E N;  1J6Z A;  4BC2 A;  1YIJ N;  5KQD A;  5GAE P;  1YAG A;  3FZL A;  3H3N O;  5GIN A;  3FLC O;  3NVM A;  4YDU A;  3U4L A;  5AQF A;  3CF5 L;  2RHK A;  2J4R A;  3CCS N;  3E9L A;  4BQL A;  1ESV A;  1HPM A;  3CET A;  2QWR A;  4JNE A;  1KQS M;  2HBK A;  4CZE A;  3C7N B;  2KLA A;  4IOA L;  3DXK A;  4ISG A;  3A5N C;  2D1K A;  3S41 A;  3H46 O;  4JKG A;  3VF4 A;  3UB5 A;  4BR9 A;  4CZK A;  2IVP A;  3OBW A;  4FPA A;  3QFP A;  2HOE A;  4BR7 A;  5C0Y A;  4BRC A;  5GIO A;  3R1X A;  1E4G T;  4WQ5 A;  1RDW X;  5AQL A;  2QEX N;  5M1Q A;  3P38 A;  4BRQ A;  3H1V X;  1ATR A;  4FSV A;  2E2O A;  3ZEU A;  3BEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...