3DLLL

The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect trna positioning
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
104
structure length
104
Chain Sequence
b'RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rRNA-23S ribosomal RNA
publication title The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect tRNA positioning
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dllL01
3CC7N 3CCJN 1VQKN 5H1SQ 3I56N 4WCEL 3CCUN 1OVYA 5GAEP 2ZJPL 5HL7L 3G71N 1YJWN 3CD6N 1VQ7N 3CCLN 3CMAN 5DM6L 4WF9L 1NJIO 4IOCL 3G6EN 5GAHP 1VQ5N 1ILYA 1JJ2M 1YJ9N 1YIJN 1QVFM 1Q7YO 1VQ9N 4WFBL 1S72N 2ZJRL 1YI2N 5JVHL 3G4SN 3CXCM 3CCMN 5JVGL 3PIPL 4WFAL 5GAGP 3CF5L 3CCQN 3CCEN 1Q86O 3CC4N 1YHQN 2QA4N 2ZJQL 1K73O 3PIOL 3CCVN 5MLCQ 1YJNN 4IOAL 3J7ZO 1VQ6N 1K8AO 1VQMN 5DM7L 1K9MO 3CC2N 1M90O 3CPWM 1VQNN 1Q82O 1Q81O 1KC8O 4UY8O 3OW2M 1N8RO 1YITN 3CCRN 2OTLN 1VQLN 1VQPN 5GADP 1W2BM 3I55N 1VQON 3CCSN 1QVGM 1VQ8N 3DLLL 1M1KO 4U67L 3CMEN 4WFNL 1KQSM 2QEXN 1KD1O 1VQ4N 4IO9L 2OTJN
chains in the Genus database with same CATH superfamily
1E3MA 1RFQA 3D6RA 1NK0A 2FF6A 4CFAA 2HBKA 3F73A 2QM1A 3CJBA 3QEIA 4DR3K 4BRGA 3EEQA 3CD6N 3CJ9A 4BG8A 3G10A 3CCLN 1C0TA 2BGGA 1YF5L 3GE1A 3T19A 4DFPA 2OANA 4O8KA 4CGJA 1X3MA 2E6LA 5A2QO 1TUYA 3ZEUB 3ZSRA 1HX1A 4FXDA 3D2EB 4N5SA 3VF6A 1R0AA 2OYQA 4LY7A 4C23A 2ITGA 3CCMN 5JVGL 4JV5K 5M1OA 4CZIA 4DQSA 1WSIA 3SV4A 3CF5L 3L0QA 4JN4A 3MN6A 2P9NB 1P8ZA 4FLWA 3JXUA 1ZBSA 5BPLA 1JLBA 4JKHA 3MXIA 4CZHA 2G8HA 4KH4A 5E26A 4B1WB 3WT0A 1BUPA 2CH6A 1RTJA 3DOKA 3SQ0A 1GLFO 5D3GA 3LP1A 4M3WA 3TAQA 1SL0A 3O9RA 1TL1A 3CIPA 3K58A 4DQPA 3JAMO 1C1CA 1K9MO 3VQAA 5LJWA 2FBTA 2VG5A 3BZCA 4FM0A 1M90O 1U6ZA 1GOBA 4MLEA 1HNIA 3S3MA 2LSNA 2KKZA 3R9PA 1KC8O 2FSKA 4KBOA 4KHNA 5M1KA 1LWFA 5FRMA 2D5RA 1L5UA 3K0SA 1GLLO 1S1XA 1S6QA 1WSEA 3RWUA 3QIOA 1D4XA 5AQUA 1N5YA 1HLUA 4CZEA 2IS3A 4EAHD 3C65A 2IOCA 5BN9A 3K5NA 3NF6A 3TR8A 4UQGA 4IDHA 1BISA 4RW4A 4FW2A 2HMPA 5IWAK 5J2NA 3K5LA 4AM6A 1XNRK 1JCEA 4E7IA 3B8AX 5H1SQ 1HJRA 3I56N 3ZX0A 1HKCA 1RT1A 4CE9A 2UXDK 1N34K 4JKAA 2WUSA 3N4QA 2YJEA 3B6OA 2PAVA 3PSFA 1NGFA 3DAWA 1DGKN 1UOCA 4B9NA 4DV4K 4B3TK 2ETJA 4CJTA 2NRHA 2E5LK 4IOCL 2UXBK 3T1YK 2IDOA 3O4NA 3L2UA 5ELZA 3BDPA 3THXB 4HVJA 2FLOA 4CJ3A 1Q7YO 4FZYA 5JS2A 3C6HA 4BRDA 3NVMA 3ZSYA 3RSEB 4IDKA 3TSPA 4CFBA 4X66K 1S1WA 3PX0A 1NGDA 3AVLA 4CZKA 4DG1A 3L8BA 4C8LA 4LD0A 3ZETA 4BE1A 4CGIA 4OGEA 1NGBA 1REVA 3K59A 1NGEA 4C1NI 1XHXA 2KHOA 3LP3A 2PYLA 3BUZB 5LL6Z 2P5OA 4RW7A 2Z1HA 3ULEB 3SBTA 4JKBA 3ZX3A 1K73O 2FSJA 4DU3A 2UU9K 5MLCQ 2HVHA 2IVOA 4GV3A 1T03A 1VQNN 4RW8A 4JEPA 1J53A 4PUOA 3PLAA 4H4OA 1L3SA 4QS8A 4EIAA 3EN9A 5M1NA 4BWJA 4E1JA 1LAWA 2QWLA 3VQQA 5GINA 4R79A 1BI4A 2Q97A 1HNZK 3ZT4A 4BC5A 2D0BA 1NK7A 3KK2A 1SV5A 4NYFA 1NM1A 3OYMA 3H1VX 3I33A 3SAHA 5EY4A 1NK4A 2Q31A 3O5BA 5M1QA 3VTHA 4O5BA 3VOVA 3W0LA 3FZHA 4E1MA 4GV9A 4JHDA 1VQKN 4CJEA 1NGIA 2P9KA 5BRDA 1Z26A 3OYJA 3TU5A 4DFMA 4BC4A 1QE1A 4JK7A 4YNQA 4A59A 4JKCA 3O3HA 1G15A 4CEQA 2A1RA 4BR0A 4BRQA 4FCYA 3R6MA 4WQ4A 1JJ2M 1KAXA 2G8IA 3OYNA 2ASPA 1RTDA 2FBYA 1WSFA 3H46O 3HPHA 1C0FA 4KO0A 3KVGA 5TKWA 4PQUA 3P83D 3KLHA 1J9AA 2QWPA 1SL1A 4YOUA 2RHKA 1LW0A 3LL3A 2YX6A 1R59O 2O8EA 3OTOK 1YVNA 2G8WA 1V4SA 4KB0A 1CLQA 5C25A 3PUFA 2A42A 1IBLK 3O4QA 3W3DA 2NZTA 1WOQA 5LJVA 4DSJA 4OGCA 5I42A 2BANA 4KHUA 3O9QA 4YORA 3ZLJA 5KQ8A 1UA1A 1TL3A 3QB0A 3F9KA 4FJHA 4FSVA 4A57A 3MX5A 1E4FT 2F7TA 4FLXA 1Q81O 3UKUA 3HOSA 4F3TA 4G9ZA 4ILHA 4CHQA 4FM2A 4CHPA 2G8KA 4DV3K 3O80A 4DSIA 2BTFA 3E9OA 1EKEA 1RT2A 3PX4A 4XH5A 3IFRA 4DR1K 4JKFA 3O9UA 1T05A 5C10A 3J80O 4GNIA 1I94K 1EQYA 3VEVA 4N41A 3O8MA 3VEZA 2FXUA 4F2RA 3H3NO 5B8HA 3NH1A 2EHGA 4NB4A 3V9XA 2VQEK 1M1KO 3O1BA 3IAYA 4FJKA 3PV8A 1NK5A 3VEYA 2DTUA 1ZBIA 1JCFA 3TSUA 4W5NA 3LP2A 4H5NA 3QINA 2V51B 2KLAA 5HL7L 1OH7A 5BR8K 3VQ5A 3VQ9A 1O1WA 1JLCA 1GLCG 2A1SA 3CYMA 4CJWA 3HYFA 3SNNA 4NCAA 3UKRA 2YCHA 3SUQA 1EETA 4KAZA 3M3ZA 4A61A 3NDKA 3L6QA 3KIOA 2HHWA 3WXMB 3C6TA 1O13A 3RMCA 5FPEA 2VG7A 3TSQA 4Z4CA 4BDPA 4LF5K 3VQ7A 3G0ZA 3VQ6A 3TI0A 4WFAL 3VF4A 1B9DA 5GIOA 3EL2A 3EY1A 1IKYA 1IV0A 2F96A 4KKOA 1RDCA 1IJJA 2G8VA 1P90A 3TARA 3ZYYX 1BA0A 3NMUA 2PZSA 4CF2A 3K5OA 2P9LA 3AV9A 4YOXA 4JI4K 3I8DA 3UE5A 2ZQBA 4OPAA 3IRXA 4CZGA 3HVTA 3VA0A 5AQRA 4OPKA 1VQMN 5GIPA 2HHTA 5DK5A 3AY9A 3AO1A 4DR6K 5AQNA 1YITN 1G99A 3E9LA 2B5JA 4Y1CA 3KK3A 3E66A 3L2RA 1CZ9A 2OZSA 4CECA 4MLHA 2V7ZA 2BDPA 3FFIA 5GADP 1MA9B 1T6DA 1YUWA 5KGWA 3AAPA 3L2QA 2IAJA 4H0XB 3SUNA 2HBMA 1WAJA 5CZ1A 1BCOA 1SZ2A 4GV6A 3MX2A 2OPSA 3OYIA 5FPDA 4IG0A 1F21A 2HB5A 1XHZA 4DS4A 4L8RB 2F8SA 1WSJA 1NLVA 4FWKA 2YKMA 1X1PA 2HBJA 4KFBA 3ZETB 4BRPA 1OVYA 1ASVA 5C0YA 4DMNA 3VTIA 3OHRA 3DI6A 4B8AB 5AQPA 4AHCA 4BC3A 4B8CA 1ATSA 1Z6RA 4DFKA 1NJIO 4ISGA 3QIPA 3SYZA 5HBMA 2QTDA 3FZFA 3K9JA 3A8YA 4IG3A 1VQ9N 4WFBL 1GOCA 4DUYK 4A2AA 4CZFA 2YHWA 1C1BA 2E1YA 1U48A 3RR7A 4MDBA 2ASMA 2PFUA 1NU0A 2P9SB 4FZZA 1MU2A 2WBNA 2D4WA 3LM2A 4M3UA 2O8CA 1VSLA 4I7FA 1J5EK 4DKWA 4OO1J 3SPYA 3LZIA 3MEEA 3CCEN 1IG9A 4FJ9A 2D0PA 5E84A 4BGBA 4CBWA 4JI7K 1BI4B 4MO4A 4PA1A 5LY3A 3MECA 4ZTJA 2RPIA 2G8FA 2NRRA 1ATNA 1I39A 3DXKA 4B3RK 4EZ6A 1GLEG 4GKKK 1ZBUA 4DWIA 2VWBA 1NJYA 4CIFA 3HPOA 5C12A 1DTTA 3C0BA 4JHDB 4NLBA 4B1ZA 2ZD1A 2NRXA 4LF8K 1VQLN 3MWTA 1NK6A 3SAFA 1BDGA 3KLEA 4H5VA 1C0MA 3VA3A 1NKBA 2YHYA 4JRQA 4J2BA 4A62A 1OH6A 4CHOA 3Q7CA 4LFBK 3VEOA 4M3TA 4NCGA 1QZ5A 3T7ZA 3EE9A 1H1VA 2NNWA 2FBXA 2YHAA 4CZJA 4CGDA 4X62K 4X65K 1XC3A 4CJUA 3BEXA 2QEXN 4J2AA 1VQ4N 2E8AA 4M3YA 3CCJN 1DT9A 1K8KA 4M42A 1C1AA 3AO2A 1KFSA 4DR2K 2DY4A 2Q2RA 2I5JA 3OYFA 3HVRA 4LFCK 3J7AP 1V4TA 3H08A 3DLRA 2P51A 4H0PA 2P1JA 4O55A 3ISNC 1JCGA 5BPNA 4FLTA 3AAQA 3G6EN 3MEDA 4NLCA 4J2EA 4C8OA 1U49A 4FVUA 1YTAA 4XEIA 3VQEA 4H03B 4MO5A 4AF1A 4BG9A 4CZLA 3VMFB 4Z4EA 2OA8A 4V19S 4E7HA 3UKUB 3J7YP 4OKEA 3U4LA 5FPMA 4RW9A 4XIUA 4ISFA 3EKSA 1WN7A 4DS5A 4BR9A 4CF1A 1VSDA 3OVNA 1NJXA 4YHHK 5EU7A 4CJPA 4IFEA 2O8BA 1BQMA 2Q0RA 3G25A 5J2MA 5FPNA 1ZBHA 1JXEA 5KQDA 2QA4N 4IXCA 3R8EA 1X9WA 2VGMA 4Z4HA 4FO0A 3QEPA 4CGHA 5C42A 1K8AO 2RF2A 2D0CA 4HWIA 1RBSA 4U7BA 3V9WA 4PY5A 2UUBK 4ZHRA 5I9EB 3CFPA 1RDUA 1C0GA 4O4GA 3DYAA 1QSLA 3SUOA 1JL2A 2HNDA 1W7AA 5KPTA 4KI4A 1K6YA 3UKRB 2GWKA 4NXMK 4DUZK 4IO8A 4IBNA 4JI2K 4JI8K 1KLMA 1TK5A 1EXQA 4YDUC 5BR9A 1I3AA 4JKEA 3CJAA 1RDDA 1YXQA 3LWLA 4JD2A 4E7JA 3T3FA 3AVKA 3TTFA 5TKYA 2Q3SA 2I7NA 4CHYA 1BQNA 3J8AA 5T7BA 2D0OA 3AA5X 4DF8A 1XQSC 2CH5A 3WXIA 5HP1A 4B9QA 4CIEA 1HUXA 4K43A 4KTZA 1BIZA 4H5TA 4DSFA 3QEWA 3NH0A 2XY7A 4RW6A 4A5BA 3OA9A 4CEOA 2P9LB 3E1YA 4BE2A 4FWSA 1HQUA 2NRTA 3CERA 5HRSA 2PBDA 1RT5A 3DXMB 5C15A 3MN9A 4N56A 1HNXK 2VCPA 3BP8A 4H0YB 4FWPA 1NK8A 3U3YA 4BRMA 2XY5A 3LDOA 2QI2A 5AQMA 3SI6A 3PIPL 2D0AA 3QFPA 1WLJA 3MN7A 3KJVA 4ILJA 1Q86O 3OBYA 3S3NA 3WXLA 4IEIA 1WSGA 3D0PA 3TANA 3A5LC 4OPJA 3TAFA 4GW6A 4KPYA 4FZXC 2HNZA 4KV8A 4CFDA 3CCVN 2PY5A 5HRPA 3U3GA 4BR4A 5AQWA 3LALA 4ISEA 4O8UA 2RKIA 2W6KA 4DV0K 4WQ5A 1S6PA 3KKSA 3QMLA 1X9MA 3O3FA 3UB5A 1RDWX 3K2PA 3NBPA 5CE3A 4EP5A 3NHGA 2QXLA 3HM8A 3VETA 2O8DA 4RG8A 3P4IA 1FJGK 4BC2A 1L3VA 1BO5O 2HVIA 4B1XB 4IWVA 4XH1A 2P5GA 1HKGA 2NRVA 3CCSN 4C8NA 3C95A 2A41A 4F8RA 3VPZA 3AA4A 3HBTA 4DQIA 4CD3A 2CGJA 4BGAA 3D2FA 3FLCO 2P9SA 2ITMA 3FZKA 2OCEA 1EO1A 1HKBA 4CESA 1WBDA 3ITHA 2O8CB 1Y64A 4F2SA 1RCHA 1L3TA 1QSSA 4YOWA 2ZJPL 4M45A 4E3SA 3AA2A 3ENHA 1C0UA 4EHTA 4B3MK 4KHWA 3VEXA 3AVBA 1VHXA 3OYKA 3S41A 1T7PA 2O8FA 1NWKA 2YNIA 5FDLA 1NOZA 3DXKB 2GUPA 1RNHA 4K0KK 1QVFM 4PKGA 1S72N 1KSPA 2VQFK 2AA4A 3K57A 4CFCA 3TAEA 4MDAA 1Q9XA 3PX6A 5KI6A 1HYVA 2AP1A 4W5RA 4DTMA 1WB9A 5AR0A 2XY8A 4F3OA 3CCQN 1KXPA 3WNEA 4B3SK 4XH4A 1YHQN 4ELVA 4HUFA 3LDPA 3HK2A 3A5OC 3V1OA 4OVLA 4DR4K 5F1XA 1X9SA 1JLAA 1XMOK 3L2VA 4R5PA 1FKOA 3ZT3A 4BRLA 3AVJA 4HUEA 5JLFA 3KWIA 4QOZB 2Q1NA 4FJMA 1ZBLA 1NNEA 1S3XA 3CM5A 1K8KB 1QS4A 4BQZA 3TABA 4KHQA 2UUCK 4KHPK 4E1NA 5ADXA 4DR7K 1RBUA 2A5XA 4JKDA 3CJ7A 3HI0A 4Z0UA 4OLBA 3IMXA 1ASUA 2B6AA 4O44A 4BQLA 5F0XA 4B08A 3HRGA 4DV1K 2X74A 2UYTA 4CGFA 1TAUA 2IVPA 3OYCA 3THVA 3CMEN 3AVCA 4H0OA 2F8TA 4Y1DA 3O6WA 2YHBA 4YOVA 1TKDA 4I9LA 3QFUA 1NGJA 3WXJA 3KLIA 1T3VA 4DLEA 4FJJA 1U2VA 4BR5A 1NJZA 1HPZA 5AQSA 4OLAA 4AQYK 2O8BB 1SAZA 3KK7A 3OYBA 3DLBA 2F4VK 5BN8A 2XO7A 3PO4A 5CHIA 3OBWA 4LH4A 4DCHA 5AZJA 5DM6L 1YTUA 3QBWA 1WUAA 1ATRA 4N47A 3ZT1A 4DFJA 4AM7A 1S9EA 3K5MA 4KH5A 3AGKA 4FK2A 1YVUA 3ULDA 3SQ1A 1GOAA 1WBBA 4B9UA 1WAFA 5HRRA 1BHLA 5JVHL 4FJGA 3RVCA 1XWLA 3PSIA 5FROA 4M63C 1KLNA 3RR8A 2JWKA 3NGYA 4Z4GA 3VESA 4LH5A 3OYHA 1YT3A 2VYPA 3U8XA 3VQ8A 4JK8A 3MAQA 5HLFA 2QKKA 3IUCA 2HW3A 1RT6A 3E9PA 3KKRA 3JYTA 4H5RA 1HPMA 5AQYA 4PL7A 1KAYA 2Z1JA 1SUQA 4E19A 3SK3A 4CJ4A 4CK1A 3VEWA 1U4BA 2GV9A 3THWB 3DLKA 1IKWA 4RCHA 1QSYA 1XMQK 4JD2B 1LW2A 3IDHA 1ITGA 3EO3A 3MDQA 4RWTA 3CC2N 3FE1A 4CGGA 3S3OA 3LDSA 4LFAK 4ID5A 3I0RA 1NGCA 4UY8O 3OW2M 1Q9YA 3CETA 4DF4A 4BWMA 2OTLN 4CJKA 1VSHA 1KAZA 2A6AA 1D9DA 1ASWA 3HTVA 3H3OB 5ADXH 4CK3A 4FJ8A 1HJOA 4CHZA 3DWLA 3DXMA 3KLFA 4PKIA 4CJRA 4DSEA 2KW4A 5LMNK 4W5QA 3RMBA 3AVNA 4DQ8A 4YOYA 1SKRA 3BF3A 2ZM6K 3HSCA 5AQFA 4CZMA 4IO9L 5BRHA 4JLHA 4H5WA 4AHUA 3VQBA 3THYA 3ENBA 3FZMA 3CCUN 2Q36A 3QEVA 2HOEA 1S22A 2QWOA 4BDYA 1VRTA 5AQLA 2CGKA 4KB1A 2E1ZA 4CF8A 2KFNA 4CBXA 4O5FA 1GLDG 4CERA 5BPMA 4JI0K 4C8MA 3NVKA 1HNWK 5LMUK 4FYDA 5CYMA 5AQKA 4JS4A 1QQMA 2WFBA 2KZZA 1JL1A 3VN5A 2QWRA 4JI1K 1NK9A 4BACA 4B1YB 3K9KA 3WQUA 3CXCM 4BREA 1LAVA 4QS7A 3HT3A 4WQ5C 5KTQA 1RTIA 1NMNA 2W41A 2O8DB 4FPBA 3CC4N 3I8BA 3V1QA 1IH7A 3SQ4A 3ENOA 1Z25A 4X64K 4CEEA 4I9QA 3I0SA 1C6VA 1X9JA 3V9UA 3A2FA 4Q5VA 3KTQA 3D2FB 3WEEA 4DV2K 4Z4FA 1VQ6N 1A5VA 1KFDA 5DM7L 4M3XA 1NJWA 1ZXOA 3U9DA 4F4KA 4DTXA 3LPUA 1DEJA 1N8RO 3FGUA 3CCRN 4FWRA 3QBXA 2O8FB 4BDZA 4CF0A 4IFVA 2ZF5O 2GEMA 1UA0A 3O4WA 4LF4K 4FWMA 4FJXA 3QICA 2ZGYA 3AVIA 1MDUB 3V81A 3HOTA 3D45A 1CXQA 2WOMA 3LAMA 2A40A 3H1QA 4BRAA 1T44A 3SPZA 5HRNA 1N32K 1DLOA 3F5TA 3WNHA 1KD1O 4I6MA 4BE0A 3SQ2A 2HHQA 2EWSA 3S9HA 2IC3A 2Z1IA 3MMVA 4CJSA 3TWHA 4NCBA 5GAEP 3DLHA 1VSFA 5AQHA 4IEEA 1RGIA 3DOLA 3ATUA 3KK1A 3P31A 3VGMA 2E2QA 3RRGA 3SMPA 2HHHK 3SCXA 1HQEA 3IKMA 1QHAA 4WQ4C 1N36K 5HROA 2DFFA 3LANA 3LP0A 4QAGA 1YIJN 3TTCA 1TGOA 3EZ5A 2ZJRL 1YI2N 3HM9A 1DKGD 4E0DA 3FFKB 5C2FA 3H45C 2QKBA 4O0JA 4CJ5A 1RT7A 3C7NA 3BGRA 3V6DA 2ZWHA 3R3LA 1KTQA 3M5RA 4B9VA 4K41A 2Q0UA 3R1XA 3CFRA 3HO1A 4FLZA 1QZ6A 2QWMA 3L4IA 4CF9A 3ZSXA 2QWQA 3OYAA 4MQ3A 4FOEA 5EVZA 3NGIA 4DU1A 3SUPA 1NKEA 3P38A 1OH5A 1U2VB 5AQOA 4E7LA 3ZT0A 5E41A 4CEZA 1ZC6A 1S1UA 3SJHA 3HPGA 1VSEA 4EP4A 3FR0A 4CBUA 1JXBA 3CQYA 4CJVA 3WNGA 2RE2A 4DV7K 3AA3A 3ZCMA 4CEAA 4YY3K 3KWGA 3WUHA 3T1HK 3BZKA 5AZJB 1VQPN 1EP4A 1B92A 3OS0A 1TKZA 1E4GT 2PYJA 3CJCA 3CG7A 3F9MA 3OYLA 4JKGA 5EX5A 4Z94A 1SS6A 5JMVA 3NCIA 4ID1A 1SQKA 4AHSA 4J2DA 4Z4IA 4JYAK 4JRPA 4DTPA 4M41A 3EKUA 2BUPA 3ATVA 2OTJN 3EYZA 5KPZA 2HF4A 4EZ9A 3AO5A 3L2WA 4BRKA 2V52B 3OYEA 3NH2A 5EOYA 1D5AA 2QWNA 2VGNA 5KPRA 2IGIA 3UIQA 3THWA 2YV0X 3VF2A 3AO4A 1XUPO 1GLBG 2ZE2A 5SZTA 1UWBA 3T1AA 3HJFA 1Y97A 2P9IA 1YJ9N 2HHUA 2Y1JA 4PL8A 4CEBA 4M3RA 1B9FA 3LZJA 3MCAB 4H0TB 3KLGA 2DFEA 2P9PA 1VAZA 4I2PA 5IT9O 3B6PA 4NXNK 1KVCA 1NOYA 3P1GA 4IFYA 1BGXT 1QQOA 2XY6A 3AO3A 4DV5K 1GLJO 3NF7A 3QLHA 4FJLA 4M7YA 3CQ8A 1RBVA 3NAEA 4FM1A 1IKXA 4IZ9A 5AZIB 1RILA 2VWKA 3C94A 1JLQA 4FWNA 4E89A 1NGHA 3RMDA 4CVNE 4KREA 2UXCK 4OJRA 4KHSA 3OS1A 1MWMA 1TKXA 3M8QA 4BVPA 2RN2A 4H4MA 4FVMA 1KCFA 3CPWM 3MN5A 5AQGA 3THYB 4GY2B 2E2NA 2QW9A 2OPPA 4RTFD 5CR4A 3CM6A 2KZMA 3HP9A 3VGLA 4M7XA 1W2BM 2YKNA 2P9UA 3V4IA 3ZSWA 1VQON 5AQXA 4CEDA 3V1RA 2KTQA 2XRIA 4FJNA 4LC9B 3DLLL 4U67L 5J2PA 4DLGA 4FW1A 1EX4A 3M1FA 1Q18A 4PKHA 5I3UA 4BR7A 1BU6O 5AJ3K 1IKVA 4AHTA 2W42A 4DR5K 4DB3A 3P39A 4K8XA 3GG4A 1YJWN 1OKJA 2B4JA 4CJ7A 3LDNA 4L3QA 2X6SA 1VQ7N 2OPQA 4B9TA 1T8EA 1ESVA 5M1PA 1VQ5N 2HBLA 2EX3A 3KZBA 4CCHA 4OX9K 3WEEB 1FW6A 4IKFA 3ID6A 3OYDA 1NMDA 1BWFO 1W97L 3ID8A 3TTDA 4DTRA 4GKJK 1XC9A 3M6GA 1HRHA 5KRSA 2JGUA 4GVMA 2F9TA 4BRNA 4DU4A 3NGZA 1BA1A 5AQIA 3OJUA 5KRTA 3WXKA 2E2OA 5GAGP 2YNHA 3P5JA 1VSKA 3A5MC 3AVHA 2YI1A 4JNEA 3ZSQA 2GWJA 4WE1A 3SAGA 4FWLA 4BRHA 3CQXA 1LOTB 5CY4A 3ZX2A 1KVBA 5AQVA 3RRHA 4TSXA 4OPHA 2UUAK 2KQ2A 5CYQA 1VSMA 1YJNN 3J7ZO 4DTJA 4JAXA 2ASOA 4I6MB 4FK4A 4BR2A 4FJIA 2O4GA 4LF7K 3HZ6A 3A5NC 3TPQA 2GTDA 3D7EO 1KVAA 3F2KA 3Q7BA 4OKKA 1W9HA 3L3VA 3HP6A 2WTUA 4B9SA 1RBTA 2HNYA 4H8KA 1Z05A 1NG9A 1ZYQA 2F9WA 3I55N 3DLGA 3QO9A 3LDQA 4LF9K 4DTSA 4WFNL 3M8RA 3O9TA 1BOTO 1KQSM 2JLEA 2XHBA 4K42A 3SBGA 3NE6A 4WCEL 3C7NB 3IG1A 1XI1A 1T6CA 3OY9A 4FWOA 2CGLA 1VK0A 1RDAA 2W40A 2AJQA 1TYQA 3QDKA 1CXUA 4AH9A 1HYZA 4WF9L 4KTQA 2NLXA 4CJFA 1WNSA 5AQZA 5GAHP 2HF3A 2OZMA 4ELTA 4ELUA 1S1TA 1U04A 3RTVA 3NF8A 4BY9C 3LWMA 4JS5A 5C2DA 1JKHA 3G4SN 1SL2A 4JI5K 3KHYA 1CZAN 3VERA 2IVNA 4PWDA 3HSTB 3GOIA 3LAKA 1EWRA 1NGAA 1DTQA 2HHSA 3ALYA 3DMJA 4LSNA 3EZWA 3DJCA 1BIUA 4LF6K 4K25A 3PO5A 5SWMA 1BCMA 2HHXA 1OH8A 2O4IA 3AGRA 4C1NK 3MEGA 1IO2A 3ZSOA 3FZLA 1D8YA 4ICLA 5AQTA 1U45A 4JKGB 3NFAA 4FK0A 3VGKA 3PIOL 5JS1A 2E6MA 2A3ZA 4CI6A 3OS2A 3CJ1A 3ZEUA 5AFUA 3D2EA 5FLXO 1A5WA 2FF3B 4GVEA 3CPEA 3T69A 3MK6A 4NO7A 3WQTA 1J54A 4FLVA 1D9FA 2E20A 4YOTA 3HXMA 2GX9A 1J5OA 4CEFA 2P9NA 1FK9A 3VQ4A 3KD1E 1QQNA 4CD1A 2BE2A 4HCBA 1QQCA 2OPRA 2P9IB 1VQ8N 4C8KA 3VENA 3EE8A 1BL3A 3DRPA 4QCLA 1LWEA 1RBRA 4YDUA 4J8FA 2P9PB 1UAXA 1OVQA 3QEXA 4ZTFA 3CC7N 5FRNA 4B3OA 3V9ZA 2WC9A 4A5AA 1VSJA 3DLEA 2QXFA 4FJ7A 5AZIA 4YFUA 1FXXA 1WSHA 4BRCA 3DRRA 3CMAN 3AARA 4NYNA 3C6AA 3TAMA 2NRWA 3DRSA 5J2QA 2GBZA 3MXJA 1ILYA 4HCCA 5HOOA 1SKWA 4DSLA 4LSLA 1ZBFA 1NKCA 3QNOA 3DM2A 3L4QA 1TK0A 3AVMA 2GUIA 2E4LA 4IJAA 3AVGA 2X6NA 4HUGA 3L3UA 2WONA 1TKTA 4E7KA 1TUUA 4DSKA 1S1VA 5M1FA 3NF9A 4EFHA 4HTLA 4BRIA 2YNFA 2FBVA 1XNQK 2YHXA 3SJJA 1YAGA 2YNGA 5BREA 4W5OA 2Y1IA 4BRFA 4B1VA 4O0IA 3LPTA 2P9UB 1HR0K 2GELA 1JLFA 4DV6K 2ZJQL 4FL9A 5DMRA 3M8SA 3O08A 3THXA 1NBWA 1Q8IA 1NGGA 2FC0A 4GMJB 3TAGA 2ATQA 3MWPA 3RSEA 3ASMA 3BY5A 1J6ZA 5AQQA 4Q0BA 4PHTX 2QK9A 5AFUH 4QS9A 1JLEA 3J81O 1LV5A 4CJQA 3O3GA 1FKPA 4EHUA 2YJFA 3U9ZA 4Y0WA 2IIRA 3CI5A 4BROA 4ILGB 3AVFA 1IBMK 4H0VB 4AHRA 3V9SA 2KFZA 3SZ2A 4HTUA 2R7YA 3ULEA 4CIGA 2V7YA 4DHYA 2FSNA 2NRZA 3QETA 3RMAA 3QESA 3SV3A 2ZGZA 1TVRA 1GLAG 4KRFA 3IS9A 4AHVA 1U47A 4B9MA 4A2BA 1HYSA 1RT3A 3JS6A 4WYBA 3QNNA 4FJ5A 1KRPA 3VQDA 2HMIA 3M8PA 3CHWA 4CW7B 4IJNA 3O1WA 4M3ZA 3GL1A 4BVOA 5BRFA 5AQJA 3VQCA 3MXMA 4G1QA 3G71N 3KD5E 1LCUA 3JSMA 3VQPA 4KI6A 1W0HA 1S9GA 1RTHA 2D1KA 4IOXA 3CFOA 3HL8A 1S5JA 2W6LA 3SLCA 3H6EA 3O9SA 3SMSA 5F2RA 2HHVA 2Z1GA 4F9OA 3OYGA 4DTOA 1TK8A 2X78A 5JICA 1N33K 3ZSVA 4DTNA 1EWQA 4HHTA 4FLYA 4FOIA 2NUBA 4W5TA 1N6QA 3PY8A 2E2PA 2BH1A 4K8ZA 3QERA 1BG3A 3AVAA 4DTUA 1QHTA 1QTMA 4CK2A 4JI3K 2P9KB 1RT4A 3N4PA 1LWCA 4MFBA 4FPAA 3OJSA 4I2QA 3E01A 4B1UB 1HMVA 1L3UA 3LM9A 3ZT2A 3TAPA 5EXWA 2H3GX 5K14A 5C24A 1SKSA 2E88A 3ZSZA 1A5XA 4IOAL 1CZBA 1RDBA 5JLHA 4DQRA 1IBKK 3GDQA 4B9LA 3MCPA 4KH6A 4FWQA 4JK9A 1TAQA 1TV6A 1Q82O 2I7PA 2DPNA 3C6UA 5J1EA 4N76A 5KGXA 2VWJA 2DFHA 3BF1A 3LDLA 4AILC 1MWKA 4KHYA 1TYQB 3A0IX 2O8EB 4OKJA 2J4RA 2JWLA 4CJLA 4FLUA 4CHNA 1HNVA 5CZ2A 1VSIA 1QVGM 1IG8A 4KTWA 1VRUA 3U6FA 2HSTA 1X3NA 3GBTA 1JLGA 4DQQA 3WNFA 4JI6K 2VG6A 2G8UA
chains in the Genus database with same CATH topology
3QFUA 1NGJA 1RFQA 3WXJA 1BU6O 4BR7A 3D6RA 1NLVA 1T3VA 2FF6A 1U2VA 4FWKA 4BR5A 2HBJA 3ZETB 4BRPA 1OVYA 5AQSA 5C0YA 2HBKA 2QM1A 3VTIA 4DB3A 3CJBA 1SAZA 3KK7A 3GG4A 3P39A 1YJWN 1OKJA 3OHRA 4BRGA 5BN8A 4CJ7A 3CJ9A 3CD6N 3LDNA 4L3QA 4BG8A 3OBWA 5CHIA 1VQ7N 3CCLN 4DCHA 5AQPA 5AZJA 5DM6L 4BC3A 3QBWA 1ATSA 1ATRA 1WUAA 1ESVA 1YF5L 1Z6RA 3GE1A 4ISGA 5M1PA 4AM7A 1NJIO 1VQ5N 2HBLA 2OANA 4KH5A 4O8KA 2QTDA 3AGKA 3FZFA 3K9JA 3KZBA 3A8YA 1X3MA 3WEEB 1VQ9N 4WFBL 3ID6A 1NMDA 1BWFO 1TUYA 3ZEUB 1W97L 1HX1A 4A2AA 3D2EB 2YHWA 4CZFA 3ID8A 3VF6A 3TTDA 2E1YA 4C23A 5JVHL 3RVCA 3CCMN 3M6GA 4MDBA 2ASMA 2PFUA 5JVGL 2P9SB 5M1OA 2F9TA 4BRNA 4CZIA 2WBNA 2D4WA 3LM2A 1BA1A 4M63C 2JWKA 5AQIA 3VESA 3WXKA 2E2OA 5GAGP 4DKWA 3CF5L 4OO1J 2VYPA 3L0QA 3U8XA 4JN4A 4JK8A 2D0PA 2P9NB 3A5MC 1P8ZA 2YI1A 3MN6A 4JNEA 5E84A 3JXUA 1ZBSA 4BGBA 4CBWA 5BPLA 3IUCA 4JKHA 2GWJA 4MO4A 4KH4A 4CZHA 3SAGA 4FWLA 5E26A 3E9PA 5LY3A 4BRHA 4H5RA 3CQXA 4B1WB 1HPMA 1LOTB 3WT0A 1BUPA 2CH6A 5AQYA 1KAYA 4PL7A 3ZX2A 2NRRA 1ATNA 5AQVA 3SK3A 1GLFO 3DXKA 3VEWA 4OPHA 1GLEG 4RCHA 2VWBA 1YJNN 3O9RA 3J7ZO 3CIPA 4JAXA 5C12A 2ASOA 4I6MB 4JD2B 3IDHA 4BR2A 1K9MO 5LJWA 3EO3A 3MDQA 4RWTA 3CC2N 1M90O 1U6ZA 3FE1A 4MLEA 3C0BA 4JHDB 4NLBA 2KKZA 3R9PA 4B1ZA 1KC8O 2FSKA 4KBOA 1NGCA 4UY8O 2NRXA 3OW2M 3HZ6A 5M1KA 3A5NC 3TPQA 3CETA 2OTLN 2GTDA 3D7EO 3F2KA 3Q7BA 1VQLN 1KAZA 2A6AA 3MWTA 3SAFA 1BDGA 1GLLO 4H5VA 2YHYA 4BROA 3HTVA 4A62A 3H3OB 5ADXH 1D4XA 5AQUA 1HJOA 3Q7CA 1HLUA 1Z05A 4CZEA 4EAHD 3VEOA 3DWLA 3C65A 3DXMA 5BN9A 2F9WA 4PKIA 3I55N 1QZ5A 3T7ZA 3EE9A 1H1VA 4IDHA 2NNWA 3LDQA 4CZJA 4DQ8A 4YOYA 3BF3A 3HSCA 1XC3A 5AQFA 4WFNL 3BEXA 3O9TA 1BOTO 1KQSM 2QEXN 2HMPA 1VQ4N 4CZMA 4IO9L 2E8AA 5BRHA 4AM6A 1JCEA 4K42A 4H5WA 3CCJN 3B8AX 3SBGA 1DT9A 5H1SQ 3I56N 1K8KA 3ENBA 1HKCA 3FZMA 3C7NB 3ZX0A 4WCEL 3CCUN 2Q36A 1T6CA 2Q2RA 2HOEA 4FWOA 4JKAA 2WUSA 2CGLA 3N4QA 1S22A 2YJEA 2PAVA 2W40A 2QWOA 1V4TA 5AQLA 2CGKA 1NGFA 1TYQA 3DAWA 2E1ZA 4CBXA 1DGKN 3QDKA 4H0PA 4O5FA 4WF9L 1GLDG 5BPMA 1JCGA 2NRHA 2NLXA 3AAQA 5AQZA 5BPNA 5GAHP 3G6EN 4IOCL 3NVKA 2HF3A 4NLCA 5ELZA 5AQKA 4FVUA 1QQMA 4XEIA 2FLOA 2WFBA 1Q7YO 3C6HA 4H03B 4MO5A 3CCEN 4BRDA 2QWRA 3NVMA 4AF1A 4BG9A 4CZLA 4BY9C 3RSEB 3VMFB 5C2DA 3TSPA 4B1YB 3G4SN 3K9KA 3WQUA 3CXCM 1NGDA 3UKUB 4BREA 3KHYA 1CZAN 3U4LA 5FPMA 2IVNA 3VERA 4CZKA 3GOIA 4ISFA 4QS7A 4WQ5C 3EKSA 4BR9A 3ZETA 1NGAA 2W41A 1NGBA 3EZWA 3DJCA 4FPBA 3CC4N 3I8BA 1NGEA 4IFEA 4K25A 3G25A 2Q0RA 4C1NI 2KHOA 3ENOA 3BUZB 5FPNA 3AGRA 4C1NK 5KQDA 1X9JA 3ULEB 2QA4N 3FZLA 3SBTA 4JKBA 4IXCA 5AQTA 3R8EA 2VGMA 4JKGB 3ZX3A 1K73O 4FO0A 2FSJA 3VGKA 3PIOL 5MLCQ 2A3ZA 3D2FB 3WEEA 4CI6A 3CJ1A 1VQ6N 1K8AO 3ZEUA 5DM7L 2IVOA 5AFUA 3D2EA 1ZXOA 3U9DA 4HWIA 4GV3A 2FF3B 1VQNN 4GVEA 3CPEA 4JEPA 3T69A 1DEJA 3MK6A 4NO7A 3PLAA 4U7BA 1N8RO 3WQTA 4QS8A 3FGUA 4EIAA 3CCRN 3EN9A 5I9EB 5M1NA 2E20A 1RDUA 4YOTA 1C0GA 2GX9A 4FWRA 4E1JA 3QBXA 2P9NA 2QWLA 1QQNA 4CD1A 4R79A 5KPTA 2Q97A 5GINA 3UKRB 2GWKA 2ZF5O 2GEMA 4IO8A 4BC5A 3O4WA 4FWMA 2P9IB 3QICA 2ZGYA 1NM1A 1MDUB 1VQ8N 3HOTA 3VENA 4YDUC 3EE8A 5BR9A 4BRAA 2A40A 3H1QA 3H1VX 1T44A 3I33A 4YDUA 4JKEA 5EY4A 3CJAA 2Q31A 3SAHA 3O5BA 4J8FA 5M1QA 1YXQA 2P9PB 3F5TA 3VTHA 1KD1O 4I6MA 4JD2A 3VOVA 3W0LA 3CC7N 3TTFA 3FZHA 5TKYA 4GV9A 4JHDA 2EWSA 2I7NA 1VQKN 3MMVA 3J8AA 1NGIA 2D0OA 2WC9A 2P9KA 4A5AA 5BRDA 5GAEP 1XQSC 5AZIA 2CH5A 3TU5A 5AQHA 3WXIA 4BC4A 4B9QA 4JK7A 4IEEA 1RGIA 1HUXA 3ATUA 4K43A 3P31A 4H5TA 3VGMA 2E2QA 4A59A 4JKCA 4A5BA 3OA9A 3SMPA 4BRCA 3CMAN 2P9LB 3AARA 3E1YA 3C6AA 3IKMA 4FWSA 1QHAA 2NRWA 2NRTA 3CERA 4WQ4C 4BR0A 4BRQA 3R6MA 1ILYA 2PBDA 4WQ4A 5HOOA 1JJ2M 3DXMB 5C15A 1KAXA 3MN9A 3TTCA 1YIJN 2VCPA 3BP8A 4H0YB 4FWPA 2ASPA 3L4QA 4BRMA 3LDOA 2QI2A 2ZJRL 1YI2N 5AQMA 1DKGD 4IJAA 3H46O 3FFKB 5C2FA 3H45C 1C0FA 3KVGA 5TKWA 3PIPL 2QWPA 1TUUA 3QFPA 4YOUA 2RHKA 3C7NA 4EFHA 5M1FA 4HTLA 3MN7A 4BRIA 3LL3A 2YX6A 1R59O 4ILJA 1Q86O 2YHXA 1YAGA 2ZWHA 3OBYA 5BREA 3WXLA 4IEIA 4BRFA 1YVNA 4B1VA 3R3LA 1V4SA 2P9UB 2A42A 2GELA 3M5RA 3W3DA 2ZJQL 3A5LC 2NZTA 4FL9A 4K41A 1WOQA 5LJVA 2Q0UA 3R1XA 3O9QA 3O08A 4YORA 3CCVN 1NBWA 1QZ6A 2QWMA 3L4IA 5KQ8A 1NGGA 5AQWA 4BR4A 2QWQA 3QB0A 4ISEA 4O8UA 4FSVA 3MWPA 4FOEA 3MX5A 5EVZA 1E4FT 3RSEA 4A57A 4WQ5A 4CBUA 1J6ZA 2F7TA 3QMLA 5AQQA 1Q81O 3UKUA 3P38A 3UB5A 3HOSA 4G9ZA 4ILHA 1U2VB 1RDWX 4PHTX 5AQOA 5AFUH 4QS9A 5CE3A 1ZC6A 3SJHA 4EHUA 2YJFA 3O80A 3U9ZA 3FR0A 4Y0WA 2BTFA 2IIRA 2QXLA 3CI5A 3E9OA 3CQYA 3HM8A 4ILGB 3IFRA 4XH5A 4JKFA 3O9UA 3VETA 2RE2A 5C10A 3P4IA 3KWGA 4GNIA 4H0VB 3WUHA 5AZJB 1EQYA 4BC2A 1VQPN 3VEVA 3O8MA 1BO5O 1E4GT 2FXUA 4IWVA 4XH1A 3VEZA 4B1XB 1HKGA 3H3NO 2NRVA 3ULEA 4DHYA 2V7YA 3CCSN 5B8HA 3CJCA 2FSNA 2NRZA 3F9MA 2A41A 4JKGA 4NB4A 5EX5A 2ZGZA 3VPZA 4Z94A 3HBTA 1M1KO 1GLAG 1SS6A 4CD3A 5JMVA 3O1BA 1SQKA 2CGJA 4A2BA 3D2FA 4BGAA 3FLCO 2P9SA 2ITMA 3FZKA 3JS6A 3EKUA 2BUPA 4WYBA 3ATVA 3VEYA 2OTJN 1EO1A 1HKBA 5KPZA 2HF4A 1JCFA 3TSUA 4BRKA 2V52B 1Y64A 3CHWA 4IJNA 3O1WA 3GL1A 4H5NA 5EOYA 2V51B 4BVOA 2KLAA 5BRFA 4YOWA 2ZJPL 5AQJA 3ENHA 5HL7L 4EHTA 2QWNA 2VGNA 3G71N 1GLCG 1LCUA 5KPRA 3VEXA 3S41A 3UKRA 1NWKA 3VF2A 2YCHA 2D1KA 3DXKB 1XUPO 1GLBG 2GUPA 4IOXA 2P9IA 3M3ZA 1YJ9N 1QVFM 4PKGA 4A61A 4PL8A 3L6QA 1S72N 3SLCA 2AA4A 3H6EA 3O9SA 3WXMB 4MDAA 3MCAB 5F2RA 1O13A 4H0TB 3SMSA 2P9PA 4F9OA 1VAZA 5FPEA 3TSQA 5JICA 2AP1A 4WFAL 3VF4A 5AR0A 4FOIA 1QQOA 3EL2A 5GIOA 2E2PA 2BH1A 1BG3A 1GLJO 3CCQN 1KXPA 4M7YA 4XH4A 2P9KB 1IJJA 1P90A 3ZYYX 1BA0A 4IZ9A 1YHQN 3N4PA 5AZIB 3NMUA 4FPAA 3LDPA 4B1UB 3A5OC 2P9LA 4FWNA 3LM9A 5F1XA 1NGHA 4YOXA 5EXWA 2H3GX 3UE5A 4OPAA 2E88A 1MWMA 4CZGA 4IOAL 4BVPA 4BRLA 5AQRA 5JLHA 1VQMN 5GIPA 3GDQA 5JLFA 3KWIA 3MCPA 2Q1NA 3CPWM 4KH6A 4FWQA 3AY9A 3MN5A 4JK9A 5AQGA 1Q82O 1S3XA 2I7PA 1K8KB 2DPNA 4GY2B 5AQNA 4BQZA 1YITN 1G99A 3E9LA 5ADXA 2E2NA 2QW9A 3BF1A 4RTFD 3LDLA 3E66A 5CR4A 2A5XA 4JKDA 1MWKA 3CJ7A 3HI0A 3IMXA 1TYQB 3A0IX 4MLHA 2V7ZA 3VGLA 4M7XA 2J4RA 4BQLA 2JWLA 5F0XA 5GADP 1W2BM 1MA9B 3HRGA 2P9UA 1T6DA 1YUWA 1VQON 5AQXA 3AAPA 4H0XB 2UYTA 2HBMA 1QVGM 1IG8A 4LC9B 1SZ2A 3DLLL 4GV6A 2HSTA 1X3NA 2IVPA 3GBTA 4U67L 3MX2A 3CMEN 5FPDA 4H0OA 3M1FA 1Q18A 3O6WA 4PKHA 4YOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 N;  3CCJ N;  1VQK N;  5H1S Q;  3I56 N;  4WCE L;  3CCU N;  1OVY A;  5GAE P;  2ZJP L;  5HL7 L;  3G71 N;  1YJW N;  3CD6 N;  1VQ7 N;  3CCL N;  3CMA N;  5DM6 L;  4WF9 L;  1NJI O;  4IOC L;  3G6E N;  5GAH P;  1VQ5 N;  1ILY A;  1JJ2 M;  1YJ9 N;  1YIJ N;  1QVF M;  1Q7Y O;  1VQ9 N;  4WFB L;  1S72 N;  2ZJR L;  1YI2 N;  5JVH L;  3G4S N;  3CXC M;  3CCM N;  5JVG L;  3PIP L;  4WFA L;  5GAG P;  3CF5 L;  3CCQ N;  3CCE N;  1Q86 O;  3CC4 N;  1YHQ N;  2QA4 N;  2ZJQ L;  1K73 O;  3PIO L;  3CCV N;  5MLC Q;  1YJN N;  4IOA L;  3J7Z O;  1VQ6 N;  1K8A O;  1VQM N;  5DM7 L;  1K9M O;  3CC2 N;  1M90 O;  3CPW M;  1VQN N;  1Q82 O;  1Q81 O;  1KC8 O;  4UY8 O;  3OW2 M;  1N8R O;  1YIT N;  3CCR N;  2OTL N;  1VQL N;  1VQP N;  5GAD P;  1W2B M;  3I55 N;  1VQO N;  3CCS N;  1QVG M;  1VQ8 N;  3DLL L;  1M1K O;  4U67 L;  3CME N;  4WFN L;  1KQS M;  2QEX N;  1KD1 O;  1VQ4 N;  4IO9 L;  2OTJ N; 
#chains in the Genus database with same CATH topology
 1E3M A;  1RFQ A;  3D6R A;  1NK0 A;  2FF6 A;  4CFA A;  2HBK A;  3F73 A;  2QM1 A;  3CJB A;  3QEI A;  4DR3 K;  4BRG A;  3EEQ A;  3CD6 N;  3CJ9 A;  4BG8 A;  3G10 A;  3CCL N;  1C0T A;  2BGG A;  1YF5 L;  3GE1 A;  3T19 A;  4DFP A;  2OAN A;  4O8K A;  4CGJ A;  1X3M A;  2E6L A;  5A2Q O;  1TUY A;  3ZEU B;  3ZSR A;  1HX1 A;  4FXD A;  3D2E B;  4N5S A;  3VF6 A;  1R0A A;  2OYQ A;  4LY7 A;  4C23 A;  2ITG A;  3CCM N;  5JVG L;  4JV5 K;  5M1O A;  4CZI A;  4DQS A;  1WSI A;  3SV4 A;  3CF5 L;  3L0Q A;  4JN4 A;  3MN6 A;  2P9N B;  1P8Z A;  4FLW A;  3JXU A;  1ZBS A;  5BPL A;  1JLB A;  4JKH A;  3MXI A;  4CZH A;  2G8H A;  4KH4 A;  5E26 A;  4B1W B;  3WT0 A;  1BUP A;  2CH6 A;  1RTJ A;  3DOK A;  3SQ0 A;  1GLF O;  5D3G A;  3LP1 A;  4M3W A;  3TAQ A;  1SL0 A;  3O9R A;  1TL1 A;  3CIP A;  3K58 A;  4DQP A;  3JAM O;  1C1C A;  1K9M O;  3VQA A;  5LJW A;  2FBT A;  2VG5 A;  3BZC A;  4FM0 A;  1M90 O;  1U6Z A;  1GOB A;  4MLE A;  1HNI A;  3S3M A;  2LSN A;  2KKZ A;  3R9P A;  1KC8 O;  2FSK A;  4KBO A;  4KHN A;  5M1K A;  1LWF A;  5FRM A;  2D5R A;  1L5U A;  3K0S A;  1GLL O;  1S1X A;  1S6Q A;  1WSE A;  3RWU A;  3QIO A;  1D4X A;  5AQU A;  1N5Y A;  1HLU A;  4CZE A;  2IS3 A;  4EAH D;  3C65 A;  2IOC A;  5BN9 A;  3K5N A;  3NF6 A;  3TR8 A;  4UQG A;  4IDH A;  1BIS A;  4RW4 A;  4FW2 A;  2HMP A;  5IWA K;  5J2N A;  3K5L A;  4AM6 A;  1XNR K;  1JCE A;  4E7I A;  3B8A X;  5H1S Q;  1HJR A;  3I56 N;  3ZX0 A;  1HKC A;  1RT1 A;  4CE9 A;  2UXD K;  1N34 K;  4JKA A;  2WUS A;  3N4Q A;  2YJE A;  3B6O A;  2PAV A;  3PSF A;  1NGF A;  3DAW A;  1DGK N;  1UOC A;  4B9N A;  4DV4 K;  4B3T K;  2ETJ A;  4CJT A;  2NRH A;  2E5L K;  4IOC L;  2UXB K;  3T1Y K;  2IDO A;  3O4N A;  3L2U A;  5ELZ A;  3BDP A;  3THX B;  4HVJ A;  2FLO A;  4CJ3 A;  1Q7Y O;  4FZY A;  5JS2 A;  3C6H A;  4BRD A;  3NVM A;  3ZSY A;  3RSE B;  4IDK A;  3TSP A;  4CFB A;  4X66 K;  1S1W A;  3PX0 A;  1NGD A;  3AVL A;  4CZK A;  4DG1 A;  3L8B A;  4C8L A;  4LD0 A;  3ZET A;  4BE1 A;  4CGI A;  4OGE A;  1NGB A;  1REV A;  3K59 A;  1NGE A;  4C1N I;  1XHX A;  2KHO A;  3LP3 A;  2PYL A;  3BUZ B;  5LL6 Z;  2P5O A;  4RW7 A;  2Z1H A;  3ULE B;  3SBT A;  4JKB A;  3ZX3 A;  1K73 O;  2FSJ A;  4DU3 A;  2UU9 K;  5MLC Q;  2HVH A;  2IVO A;  4GV3 A;  1T03 A;  1VQN N;  4RW8 A;  4JEP A;  1J53 A;  4PUO A;  3PLA A;  4H4O A;  1L3S A;  4QS8 A;  4EIA A;  3EN9 A;  5M1N A;  4BWJ A;  4E1J A;  1LAW A;  2QWL A;  3VQQ A;  5GIN A;  4R79 A;  1BI4 A;  2Q97 A;  1HNZ K;  3ZT4 A;  4BC5 A;  2D0B A;  1NK7 A;  3KK2 A;  1SV5 A;  4NYF A;  1NM1 A;  3OYM A;  3H1V X;  3I33 A;  3SAH A;  5EY4 A;  1NK4 A;  2Q31 A;  3O5B A;  5M1Q A;  3VTH A;  4O5B A;  3VOV A;  3W0L A;  3FZH A;  4E1M A;  4GV9 A;  4JHD A;  1VQK N;  4CJE A;  1NGI A;  2P9K A;  5BRD A;  1Z26 A;  3OYJ A;  3TU5 A;  4DFM A;  4BC4 A;  1QE1 A;  4JK7 A;  4YNQ A;  4A59 A;  4JKC A;  3O3H A;  1G15 A;  4CEQ A;  2A1R A;  4BR0 A;  4BRQ A;  4FCY A;  3R6M A;  4WQ4 A;  1JJ2 M;  1KAX A;  2G8I A;  3OYN A;  2ASP A;  1RTD A;  2FBY A;  1WSF A;  3H46 O;  3HPH A;  1C0F A;  4KO0 A;  3KVG A;  5TKW A;  4PQU A;  3P83 D;  3KLH A;  1J9A A;  2QWP A;  1SL1 A;  4YOU A;  2RHK A;  1LW0 A;  3LL3 A;  2YX6 A;  1R59 O;  2O8E A;  3OTO K;  1YVN A;  2G8W A;  1V4S A;  4KB0 A;  1CLQ A;  5C25 A;  3PUF A;  2A42 A;  1IBL K;  3O4Q A;  3W3D A;  2NZT A;  1WOQ A;  5LJV A;  4DSJ A;  4OGC A;  5I42 A;  2BAN A;  4KHU A;  3O9Q A;  4YOR A;  3ZLJ A;  5KQ8 A;  1UA1 A;  1TL3 A;  3QB0 A;  3F9K A;  4FJH A;  4FSV A;  4A57 A;  3MX5 A;  1E4F T;  2F7T A;  4FLX A;  1Q81 O;  3UKU A;  3HOS A;  4F3T A;  4G9Z A;  4ILH A;  4CHQ A;  4FM2 A;  4CHP A;  2G8K A;  4DV3 K;  3O80 A;  4DSI A;  2BTF A;  3E9O A;  1EKE A;  1RT2 A;  3PX4 A;  4XH5 A;  3IFR A;  4DR1 K;  4JKF A;  3O9U A;  1T05 A;  5C10 A;  3J80 O;  4GNI A;  1I94 K;  1EQY A;  3VEV A;  4N41 A;  3O8M A;  3VEZ A;  2FXU A;  4F2R A;  3H3N O;  5B8H A;  3NH1 A;  2EHG A;  4NB4 A;  3V9X A;  2VQE K;  1M1K O;  3O1B A;  3IAY A;  4FJK A;  3PV8 A;  1NK5 A;  3VEY A;  2DTU A;  1ZBI A;  1JCF A;  3TSU A;  4W5N A;  3LP2 A;  4H5N A;  3QIN A;  2V51 B;  2KLA A;  5HL7 L;  1OH7 A;  5BR8 K;  3VQ5 A;  3VQ9 A;  1O1W A;  1JLC A;  1GLC G;  2A1S A;  3CYM A;  4CJW A;  3HYF A;  3SNN A;  4NCA A;  3UKR A;  2YCH A;  3SUQ A;  1EET A;  4KAZ A;  3M3Z A;  4A61 A;  3NDK A;  3L6Q A;  3KIO A;  2HHW A;  3WXM B;  3C6T A;  1O13 A;  3RMC A;  5FPE A;  2VG7 A;  3TSQ A;  4Z4C A;  4BDP A;  4LF5 K;  3VQ7 A;  3G0Z A;  3VQ6 A;  3TI0 A;  4WFA L;  3VF4 A;  1B9D A;  5GIO A;  3EL2 A;  3EY1 A;  1IKY A;  1IV0 A;  2F96 A;  4KKO A;  1RDC A;  1IJJ A;  2G8V A;  1P90 A;  3TAR A;  3ZYY X;  1BA0 A;  3NMU A;  2PZS A;  4CF2 A;  3K5O A;  2P9L A;  3AV9 A;  4YOX A;  4JI4 K;  3I8D A;  3UE5 A;  2ZQB A;  4OPA A;  3IRX A;  4CZG A;  3HVT A;  3VA0 A;  5AQR A;  4OPK A;  1VQM N;  5GIP A;  2HHT A;  5DK5 A;  3AY9 A;  3AO1 A;  4DR6 K;  5AQN A;  1YIT N;  1G99 A;  3E9L A;  2B5J A;  4Y1C A;  3KK3 A;  3E66 A;  3L2R A;  1CZ9 A;  2OZS A;  4CEC A;  4MLH A;  2V7Z A;  2BDP A;  3FFI A;  5GAD P;  1MA9 B;  1T6D A;  1YUW A;  5KGW A;  3AAP A;  3L2Q A;  2IAJ A;  4H0X B;  3SUN A;  2HBM A;  1WAJ A;  5CZ1 A;  1BCO A;  1SZ2 A;  4GV6 A;  3MX2 A;  2OPS A;  3OYI A;  5FPD A;  4IG0 A;  1F21 A;  2HB5 A;  1XHZ A;  4DS4 A;  4L8R B;  2F8S A;  1WSJ A;  1NLV A;  4FWK A;  2YKM A;  1X1P A;  2HBJ A;  4KFB A;  3ZET B;  4BRP A;  1OVY A;  1ASV A;  5C0Y A;  4DMN A;  3VTI A;  3OHR A;  3DI6 A;  4B8A B;  5AQP A;  4AHC A;  4BC3 A;  4B8C A;  1ATS A;  1Z6R A;  4DFK A;  1NJI O;  4ISG A;  3QIP A;  3SYZ A;  5HBM A;  2QTD A;  3FZF A;  3K9J A;  3A8Y A;  4IG3 A;  1VQ9 N;  4WFB L;  1GOC A;  4DUY K;  4A2A A;  4CZF A;  2YHW A;  1C1B A;  2E1Y A;  1U48 A;  3RR7 A;  4MDB A;  2ASM A;  2PFU A;  1NU0 A;  2P9S B;  4FZZ A;  1MU2 A;  2WBN A;  2D4W A;  3LM2 A;  4M3U A;  2O8C A;  1VSL A;  4I7F A;  1J5E K;  4DKW A;  4OO1 J;  3SPY A;  3LZI A;  3MEE A;  3CCE N;  1IG9 A;  4FJ9 A;  2D0P A;  5E84 A;  4BGB A;  4CBW A;  4JI7 K;  1BI4 B;  4MO4 A;  4PA1 A;  5LY3 A;  3MEC A;  4ZTJ A;  2RPI A;  2G8F A;  2NRR A;  1ATN A;  1I39 A;  3DXK A;  4B3R K;  4EZ6 A;  1GLE G;  4GKK K;  1ZBU A;  4DWI A;  2VWB A;  1NJY A;  4CIF A;  3HPO A;  5C12 A;  1DTT A;  3C0B A;  4JHD B;  4NLB A;  4B1Z A;  2ZD1 A;  2NRX A;  4LF8 K;  1VQL N;  3MWT A;  1NK6 A;  3SAF A;  1BDG A;  3KLE A;  4H5V A;  1C0M A;  3VA3 A;  1NKB A;  2YHY A;  4JRQ A;  4J2B A;  4A62 A;  1OH6 A;  4CHO A;  3Q7C A;  4LFB K;  3VEO A;  4M3T A;  4NCG A;  1QZ5 A;  3T7Z A;  3EE9 A;  1H1V A;  2NNW A;  2FBX A;  2YHA A;  4CZJ A;  4CGD A;  4X62 K;  4X65 K;  1XC3 A;  4CJU A;  3BEX A;  2QEX N;  4J2A A;  1VQ4 N;  2E8A A;  4M3Y A;  3CCJ N;  1DT9 A;  1K8K A;  4M42 A;  1C1A A;  3AO2 A;  1KFS A;  4DR2 K;  2DY4 A;  2Q2R A;  2I5J A;  3OYF A;  3HVR A;  4LFC K;  3J7A P;  1V4T A;  3H08 A;  3DLR A;  2P51 A;  4H0P A;  2P1J A;  4O55 A;  3ISN C;  1JCG A;  5BPN A;  4FLT A;  3AAQ A;  3G6E N;  3MED A;  4NLC A;  4J2E A;  4C8O A;  1U49 A;  4FVU A;  1YTA A;  4XEI A;  3VQE A;  4H03 B;  4MO5 A;  4AF1 A;  4BG9 A;  4CZL A;  3VMF B;  4Z4E A;  2OA8 A;  4V19 S;  4E7H A;  3UKU B;  3J7Y P;  4OKE A;  3U4L A;  5FPM A;  4RW9 A;  4XIU A;  4ISF A;  3EKS A;  1WN7 A;  4DS5 A;  4BR9 A;  4CF1 A;  1VSD A;  3OVN A;  1NJX A;  4YHH K;  5EU7 A;  4CJP A;  4IFE A;  2O8B A;  1BQM A;  2Q0R A;  3G25 A;  5J2M A;  5FPN A;  1ZBH A;  1JXE A;  5KQD A;  2QA4 N;  4IXC A;  3R8E A;  1X9W A;  2VGM A;  4Z4H A;  4FO0 A;  3QEP A;  4CGH A;  5C42 A;  1K8A O;  2RF2 A;  2D0C A;  4HWI A;  1RBS A;  4U7B A;  3V9W A;  4PY5 A;  2UUB K;  4ZHR A;  5I9E B;  3CFP A;  1RDU A;  1C0G A;  4O4G A;  3DYA A;  1QSL A;  3SUO A;  1JL2 A;  2HND A;  1W7A A;  5KPT A;  4KI4 A;  1K6Y A;  3UKR B;  2GWK A;  4NXM K;  4DUZ K;  4IO8 A;  4IBN A;  4JI2 K;  4JI8 K;  1KLM A;  1TK5 A;  1EXQ A;  4YDU C;  5BR9 A;  1I3A A;  4JKE A;  3CJA A;  1RDD A;  1YXQ A;  3LWL A;  4JD2 A;  4E7J A;  3T3F A;  3AVK A;  3TTF A;  5TKY A;  2Q3S A;  2I7N A;  4CHY A;  1BQN A;  3J8A A;  5T7B A;  2D0O A;  3AA5 X;  4DF8 A;  1XQS C;  2CH5 A;  3WXI A;  5HP1 A;  4B9Q A;  4CIE A;  1HUX A;  4K43 A;  4KTZ A;  1BIZ A;  4H5T A;  4DSF A;  3QEW A;  3NH0 A;  2XY7 A;  4RW6 A;  4A5B A;  3OA9 A;  4CEO A;  2P9L B;  3E1Y A;  4BE2 A;  4FWS A;  1HQU A;  2NRT A;  3CER A;  5HRS A;  2PBD A;  1RT5 A;  3DXM B;  5C15 A;  3MN9 A;  4N56 A;  1HNX K;  2VCP A;  3BP8 A;  4H0Y B;  4FWP A;  1NK8 A;  3U3Y A;  4BRM A;  2XY5 A;  3LDO A;  2QI2 A;  5AQM A;  3SI6 A;  3PIP L;  2D0A A;  3QFP A;  1WLJ A;  3MN7 A;  3KJV A;  4ILJ A;  1Q86 O;  3OBY A;  3S3N A;  3WXL A;  4IEI A;  1WSG A;  3D0P A;  3TAN A;  3A5L C;  4OPJ A;  3TAF A;  4GW6 A;  4KPY A;  4FZX C;  2HNZ A;  4KV8 A;  4CFD A;  3CCV N;  2PY5 A;  5HRP A;  3U3G A;  4BR4 A;  5AQW A;  3LAL A;  4ISE A;  4O8U A;  2RKI A;  2W6K A;  4DV0 K;  4WQ5 A;  1S6P A;  3KKS A;  3QML A;  1X9M A;  3O3F A;  3UB5 A;  1RDW X;  3K2P A;  3NBP A;  5CE3 A;  4EP5 A;  3NHG A;  2QXL A;  3HM8 A;  3VET A;  2O8D A;  4RG8 A;  3P4I A;  1FJG K;  4BC2 A;  1L3V A;  1BO5 O;  2HVI A;  4B1X B;  4IWV A;  4XH1 A;  2P5G A;  1HKG A;  2NRV A;  3CCS N;  4C8N A;  3C95 A;  2A41 A;  4F8R A;  3VPZ A;  3AA4 A;  3HBT A;  4DQI A;  4CD3 A;  2CGJ A;  4BGA A;  3D2F A;  3FLC O;  2P9S A;  2ITM A;  3FZK A;  2OCE A;  1EO1 A;  1HKB A;  4CES A;  1WBD A;  3ITH A;  2O8C B;  1Y64 A;  4F2S A;  1RCH A;  1L3T A;  1QSS A;  4YOW A;  2ZJP L;  4M45 A;  4E3S A;  3AA2 A;  3ENH A;  1C0U A;  4EHT A;  4B3M K;  4KHW A;  3VEX A;  3AVB A;  1VHX A;  3OYK A;  3S41 A;  1T7P A;  2O8F A;  1NWK A;  2YNI A;  5FDL A;  1NOZ A;  3DXK B;  2GUP A;  1RNH A;  4K0K K;  1QVF M;  4PKG A;  1S72 N;  1KSP A;  2VQF K;  2AA4 A;  3K57 A;  4CFC A;  3TAE A;  4MDA A;  1Q9X A;  3PX6 A;  5KI6 A;  1HYV A;  2AP1 A;  4W5R A;  4DTM A;  1WB9 A;  5AR0 A;  2XY8 A;  4F3O A;  3CCQ N;  1KXP A;  3WNE A;  4B3S K;  4XH4 A;  1YHQ N;  4ELV A;  4HUF A;  3LDP A;  3HK2 A;  3A5O C;  3V1O A;  4OVL A;  4DR4 K;  5F1X A;  1X9S A;  1JLA A;  1XMO K;  3L2V A;  4R5P A;  1FKO A;  3ZT3 A;  4BRL A;  3AVJ A;  4HUE A;  5JLF A;  3KWI A;  4QOZ B;  2Q1N A;  4FJM A;  1ZBL A;  1NNE A;  1S3X A;  3CM5 A;  1K8K B;  1QS4 A;  4BQZ A;  3TAB A;  4KHQ A;  2UUC K;  4KHP K;  4E1N A;  5ADX A;  4DR7 K;  1RBU A;  2A5X A;  4JKD A;  3CJ7 A;  3HI0 A;  4Z0U A;  4OLB A;  3IMX A;  1ASU A;  2B6A A;  4O44 A;  4BQL A;  5F0X A;  4B08 A;  3HRG A;  4DV1 K;  2X74 A;  2UYT A;  4CGF A;  1TAU A;  2IVP A;  3OYC A;  3THV A;  3CME N;  3AVC A;  4H0O A;  2F8T A;  4Y1D A;  3O6W A;  2YHB A;  4YOV A;  1TKD A;  4I9L A;  3QFU A;  1NGJ A;  3WXJ A;  3KLI A;  1T3V A;  4DLE A;  4FJJ A;  1U2V A;  4BR5 A;  1NJZ A;  1HPZ A;  5AQS A;  4OLA A;  4AQY K;  2O8B B;  1SAZ A;  3KK7 A;  3OYB A;  3DLB A;  2F4V K;  5BN8 A;  2XO7 A;  3PO4 A;  5CHI A;  3OBW A;  4LH4 A;  4DCH A;  5AZJ A;  5DM6 L;  1YTU A;  3QBW A;  1WUA A;  1ATR A;  4N47 A;  3ZT1 A;  4DFJ A;  4AM7 A;  1S9E A;  3K5M A;  4KH5 A;  3AGK A;  4FK2 A;  1YVU A;  3ULD A;  3SQ1 A;  1GOA A;  1WBB A;  4B9U A;  1WAF A;  5HRR A;  1BHL A;  5JVH L;  4FJG A;  3RVC A;  1XWL A;  3PSI A;  5FRO A;  4M63 C;  1KLN A;  3RR8 A;  2JWK A;  3NGY A;  4Z4G A;  3VES A;  4LH5 A;  3OYH A;  1YT3 A;  2VYP A;  3U8X A;  3VQ8 A;  4JK8 A;  3MAQ A;  5HLF A;  2QKK A;  3IUC A;  2HW3 A;  1RT6 A;  3E9P A;  3KKR A;  3JYT A;  4H5R A;  1HPM A;  5AQY A;  4PL7 A;  1KAY A;  2Z1J A;  1SUQ A;  4E19 A;  3SK3 A;  4CJ4 A;  4CK1 A;  3VEW A;  1U4B A;  2GV9 A;  3THW B;  3DLK A;  1IKW A;  4RCH A;  1QSY A;  1XMQ K;  4JD2 B;  1LW2 A;  3IDH A;  1ITG A;  3EO3 A;  3MDQ A;  4RWT A;  3CC2 N;  3FE1 A;  4CGG A;  3S3O A;  3LDS A;  4LFA K;  4ID5 A;  3I0R A;  1NGC A;  4UY8 O;  3OW2 M;  1Q9Y A;  3CET A;  4DF4 A;  4BWM A;  2OTL N;  4CJK A;  1VSH A;  1KAZ A;  2A6A A;  1D9D A;  1ASW A;  3HTV A;  3H3O B;  5ADX H;  4CK3 A;  4FJ8 A;  1HJO A;  4CHZ A;  3DWL A;  3DXM A;  3KLF A;  4PKI A;  4CJR A;  4DSE A;  2KW4 A;  5LMN K;  4W5Q A;  3RMB A;  3AVN A;  4DQ8 A;  4YOY A;  1SKR A;  3BF3 A;  2ZM6 K;  3HSC A;  5AQF A;  4CZM A;  4IO9 L;  5BRH A;  4JLH A;  4H5W A;  4AHU A;  3VQB A;  3THY A;  3ENB A;  3FZM A;  3CCU N;  2Q36 A;  3QEV A;  2HOE A;  1S22 A;  2QWO A;  4BDY A;  1VRT A;  5AQL A;  2CGK A;  4KB1 A;  2E1Z A;  4CF8 A;  2KFN A;  4CBX A;  4O5F A;  1GLD G;  4CER A;  5BPM A;  4JI0 K;  4C8M A;  3NVK A;  1HNW K;  5LMU K;  4FYD A;  5CYM A;  5AQK A;  4JS4 A;  1QQM A;  2WFB A;  2KZZ A;  1JL1 A;  3VN5 A;  2QWR A;  4JI1 K;  1NK9 A;  4BAC A;  4B1Y B;  3K9K A;  3WQU A;  3CXC M;  4BRE A;  1LAV A;  4QS7 A;  3HT3 A;  4WQ5 C;  5KTQ A;  1RTI A;  1NMN A;  2W41 A;  2O8D B;  4FPB A;  3CC4 N;  3I8B A;  3V1Q A;  1IH7 A;  3SQ4 A;  3ENO A;  1Z25 A;  4X64 K;  4CEE A;  4I9Q A;  3I0S A;  1C6V A;  1X9J A;  3V9U A;  3A2F A;  4Q5V A;  3KTQ A;  3D2F B;  3WEE A;  4DV2 K;  4Z4F A;  1VQ6 N;  1A5V A;  1KFD A;  5DM7 L;  4M3X A;  1NJW A;  1ZXO A;  3U9D A;  4F4K A;  4DTX A;  3LPU A;  1DEJ A;  1N8R O;  3FGU A;  3CCR N;  4FWR A;  3QBX A;  2O8F B;  4BDZ A;  4CF0 A;  4IFV A;  2ZF5 O;  2GEM A;  1UA0 A;  3O4W A;  4LF4 K;  4FWM A;  4FJX A;  3QIC A;  2ZGY A;  3AVI A;  1MDU B;  3V81 A;  3HOT A;  3D45 A;  1CXQ A;  2WOM A;  3LAM A;  2A40 A;  3H1Q A;  4BRA A;  1T44 A;  3SPZ A;  5HRN A;  1N32 K;  1DLO A;  3F5T A;  3WNH A;  1KD1 O;  4I6M A;  4BE0 A;  3SQ2 A;  2HHQ A;  2EWS A;  3S9H A;  2IC3 A;  2Z1I A;  3MMV A;  4CJS A;  3TWH A;  4NCB A;  5GAE P;  3DLH A;  1VSF A;  5AQH A;  4IEE A;  1RGI A;  3DOL A;  3ATU A;  3KK1 A;  3P31 A;  3VGM A;  2E2Q A;  3RRG A;  3SMP A;  2HHH K;  3SCX A;  1HQE A;  3IKM A;  1QHA A;  4WQ4 C;  1N36 K;  5HRO A;  2DFF A;  3LAN A;  3LP0 A;  4QAG A;  1YIJ N;  3TTC A;  1TGO A;  3EZ5 A;  2ZJR L;  1YI2 N;  3HM9 A;  1DKG D;  4E0D A;  3FFK B;  5C2F A;  3H45 C;  2QKB A;  4O0J A;  4CJ5 A;  1RT7 A;  3C7N A;  3BGR A;  3V6D A;  2ZWH A;  3R3L A;  1KTQ A;  3M5R A;  4B9V A;  4K41 A;  2Q0U A;  3R1X A;  3CFR A;  3HO1 A;  4FLZ A;  1QZ6 A;  2QWM A;  3L4I A;  4CF9 A;  3ZSX A;  2QWQ A;  3OYA A;  4MQ3 A;  4FOE A;  5EVZ A;  3NGI A;  4DU1 A;  3SUP A;  1NKE A;  3P38 A;  1OH5 A;  1U2V B;  5AQO A;  4E7L A;  3ZT0 A;  5E41 A;  4CEZ A;  1ZC6 A;  1S1U A;  3SJH A;  3HPG A;  1VSE A;  4EP4 A;  3FR0 A;  4CBU A;  1JXB A;  3CQY A;  4CJV A;  3WNG A;  2RE2 A;  4DV7 K;  3AA3 A;  3ZCM A;  4CEA A;  4YY3 K;  3KWG A;  3WUH A;  3T1H K;  3BZK A;  5AZJ B;  1VQP N;  1EP4 A;  1B92 A;  3OS0 A;  1TKZ A;  1E4G T;  2PYJ A;  3CJC A;  3CG7 A;  3F9M A;  3OYL A;  4JKG A;  5EX5 A;  4Z94 A;  1SS6 A;  5JMV A;  3NCI A;  4ID1 A;  1SQK A;  4AHS A;  4J2D A;  4Z4I A;  4JYA K;  4JRP A;  4DTP A;  4M41 A;  3EKU A;  2BUP A;  3ATV A;  2OTJ N;  3EYZ A;  5KPZ A;  2HF4 A;  4EZ9 A;  3AO5 A;  3L2W A;  4BRK A;  2V52 B;  3OYE A;  3NH2 A;  5EOY A;  1D5A A;  2QWN A;  2VGN A;  5KPR A;  2IGI A;  3UIQ A;  3THW A;  2YV0 X;  3VF2 A;  3AO4 A;  1XUP O;  1GLB G;  2ZE2 A;  5SZT A;  1UWB A;  3T1A A;  3HJF A;  1Y97 A;  2P9I A;  1YJ9 N;  2HHU A;  2Y1J A;  4PL8 A;  4CEB A;  4M3R A;  1B9F A;  3LZJ A;  3MCA B;  4H0T B;  3KLG A;  2DFE A;  2P9P A;  1VAZ A;  4I2P A;  5IT9 O;  3B6P A;  4NXN K;  1KVC A;  1NOY A;  3P1G A;  4IFY A;  1BGX T;  1QQO A;  2XY6 A;  3AO3 A;  4DV5 K;  1GLJ O;  3NF7 A;  3QLH A;  4FJL A;  4M7Y A;  3CQ8 A;  1RBV A;  3NAE A;  4FM1 A;  1IKX A;  4IZ9 A;  5AZI B;  1RIL A;  2VWK A;  3C94 A;  1JLQ A;  4FWN A;  4E89 A;  1NGH A;  3RMD A;  4CVN E;  4KRE A;  2UXC K;  4OJR A;  4KHS A;  3OS1 A;  1MWM A;  1TKX A;  3M8Q A;  4BVP A;  2RN2 A;  4H4M A;  4FVM A;  1KCF A;  3CPW M;  3MN5 A;  5AQG A;  3THY B;  4GY2 B;  2E2N A;  2QW9 A;  2OPP A;  4RTF D;  5CR4 A;  3CM6 A;  2KZM A;  3HP9 A;  3VGL A;  4M7X A;  1W2B M;  2YKN A;  2P9U A;  3V4I A;  3ZSW A;  1VQO N;  5AQX A;  4CED A;  3V1R A;  2KTQ A;  2XRI A;  4FJN A;  4LC9 B;  3DLL L;  4U67 L;  5J2P A;  4DLG A;  4FW1 A;  1EX4 A;  3M1F A;  1Q18 A;  4PKH A;  5I3U A;  4BR7 A;  1BU6 O;  5AJ3 K;  1IKV A;  4AHT A;  2W42 A;  4DR5 K;  4DB3 A;  3P39 A;  4K8X A;  3GG4 A;  1YJW N;  1OKJ A;  2B4J A;  4CJ7 A;  3LDN A;  4L3Q A;  2X6S A;  1VQ7 N;  2OPQ A;  4B9T A;  1T8E A;  1ESV A;  5M1P A;  1VQ5 N;  2HBL A;  2EX3 A;  3KZB A;  4CCH A;  4OX9 K;  3WEE B;  1FW6 A;  4IKF A;  3ID6 A;  3OYD A;  1NMD A;  1BWF O;  1W97 L;  3ID8 A;  3TTD A;  4DTR A;  4GKJ K;  1XC9 A;  3M6G A;  1HRH A;  5KRS A;  2JGU A;  4GVM A;  2F9T A;  4BRN A;  4DU4 A;  3NGZ A;  1BA1 A;  5AQI A;  3OJU A;  5KRT A;  3WXK A;  2E2O A;  5GAG P;  2YNH A;  3P5J A;  1VSK A;  3A5M C;  3AVH A;  2YI1 A;  4JNE A;  3ZSQ A;  2GWJ A;  4WE1 A;  3SAG A;  4FWL A;  4BRH A;  3CQX A;  1LOT B;  5CY4 A;  3ZX2 A;  1KVB A;  5AQV A;  3RRH A;  4TSX A;  4OPH A;  2UUA K;  2KQ2 A;  5CYQ A;  1VSM A;  1YJN N;  3J7Z O;  4DTJ A;  4JAX A;  2ASO A;  4I6M B;  4FK4 A;  4BR2 A;  4FJI A;  2O4G A;  4LF7 K;  3HZ6 A;  3A5N C;  3TPQ A;  2GTD A;  3D7E O;  1KVA A;  3F2K A;  3Q7B A;  4OKK A;  1W9H A;  3L3V A;  3HP6 A;  2WTU A;  4B9S A;  1RBT A;  2HNY A;  4H8K A;  1Z05 A;  1NG9 A;  1ZYQ A;  2F9W A;  3I55 N;  3DLG A;  3QO9 A;  3LDQ A;  4LF9 K;  4DTS A;  4WFN L;  3M8R A;  3O9T A;  1BOT O;  1KQS M;  2JLE A;  2XHB A;  4K42 A;  3SBG A;  3NE6 A;  4WCE L;  3C7N B;  3IG1 A;  1XI1 A;  1T6C A;  3OY9 A;  4FWO A;  2CGL A;  1VK0 A;  1RDA A;  2W40 A;  2AJQ A;  1TYQ A;  3QDK A;  1CXU A;  4AH9 A;  1HYZ A;  4WF9 L;  4KTQ A;  2NLX A;  4CJF A;  1WNS A;  5AQZ A;  5GAH P;  2HF3 A;  2OZM A;  4ELT A;  4ELU A;  1S1T A;  1U04 A;  3RTV A;  3NF8 A;  4BY9 C;  3LWM A;  4JS5 A;  5C2D A;  1JKH A;  3G4S N;  1SL2 A;  4JI5 K;  3KHY A;  1CZA N;  3VER A;  2IVN A;  4PWD A;  3HST B;  3GOI A;  3LAK A;  1EWR A;  1NGA A;  1DTQ A;  2HHS A;  3ALY A;  3DMJ A;  4LSN A;  3EZW A;  3DJC A;  1BIU A;  4LF6 K;  4K25 A;  3PO5 A;  5SWM A;  1BCM A;  2HHX A;  1OH8 A;  2O4I A;  3AGR A;  4C1N K;  3MEG A;  1IO2 A;  3ZSO A;  3FZL A;  1D8Y A;  4ICL A;  5AQT A;  1U45 A;  4JKG B;  3NFA A;  4FK0 A;  3VGK A;  3PIO L;  5JS1 A;  2E6M A;  2A3Z A;  4CI6 A;  3OS2 A;  3CJ1 A;  3ZEU A;  5AFU A;  3D2E A;  5FLX O;  1A5W A;  2FF3 B;  4GVE A;  3CPE A;  3T69 A;  3MK6 A;  4NO7 A;  3WQT A;  1J54 A;  4FLV A;  1D9F A;  2E20 A;  4YOT A;  3HXM A;  2GX9 A;  1J5O A;  4CEF A;  2P9N A;  1FK9 A;  3VQ4 A;  3KD1 E;  1QQN A;  4CD1 A;  2BE2 A;  4HCB A;  1QQC A;  2OPR A;  2P9I B;  1VQ8 N;  4C8K A;  3VEN A;  3EE8 A;  1BL3 A;  3DRP A;  4QCL A;  1LWE A;  1RBR A;  4YDU A;  4J8F A;  2P9P B;  1UAX A;  1OVQ A;  3QEX A;  4ZTF A;  3CC7 N;  5FRN A;  4B3O A;  3V9Z A;  2WC9 A;  4A5A A;  1VSJ A;  3DLE A;  2QXF A;  4FJ7 A;  5AZI A;  4YFU A;  1FXX A;  1WSH A;  4BRC A;  3DRR A;  3CMA N;  3AAR A;  4NYN A;  3C6A A;  3TAM A;  2NRW A;  3DRS A;  5J2Q A;  2GBZ A;  3MXJ A;  1ILY A;  4HCC A;  5HOO A;  1SKW A;  4DSL A;  4LSL A;  1ZBF A;  1NKC A;  3QNO A;  3DM2 A;  3L4Q A;  1TK0 A;  3AVM A;  2GUI A;  2E4L A;  4IJA A;  3AVG A;  2X6N A;  4HUG A;  3L3U A;  2WON A;  1TKT A;  4E7K A;  1TUU A;  4DSK A;  1S1V A;  5M1F A;  3NF9 A;  4EFH A;  4HTL A;  4BRI A;  2YNF A;  2FBV A;  1XNQ K;  2YHX A;  3SJJ A;  1YAG A;  2YNG A;  5BRE A;  4W5O A;  2Y1I A;  4BRF A;  4B1V A;  4O0I A;  3LPT A;  2P9U B;  1HR0 K;  2GEL A;  1JLF A;  4DV6 K;  2ZJQ L;  4FL9 A;  5DMR A;  3M8S A;  3O08 A;  3THX A;  1NBW A;  1Q8I A;  1NGG A;  2FC0 A;  4GMJ B;  3TAG A;  2ATQ A;  3MWP A;  3RSE A;  3ASM A;  3BY5 A;  1J6Z A;  5AQQ A;  4Q0B A;  4PHT X;  2QK9 A;  5AFU H;  4QS9 A;  1JLE A;  3J81 O;  1LV5 A;  4CJQ A;  3O3G A;  1FKP A;  4EHU A;  2YJF A;  3U9Z A;  4Y0W A;  2IIR A;  3CI5 A;  4BRO A;  4ILG B;  3AVF A;  1IBM K;  4H0V B;  4AHR A;  3V9S A;  2KFZ A;  3SZ2 A;  4HTU A;  2R7Y A;  3ULE A;  4CIG A;  2V7Y A;  4DHY A;  2FSN A;  2NRZ A;  3QET A;  3RMA A;  3QES A;  3SV3 A;  2ZGZ A;  1TVR A;  1GLA G;  4KRF A;  3IS9 A;  4AHV A;  1U47 A;  4B9M A;  4A2B A;  1HYS A;  1RT3 A;  3JS6 A;  4WYB A;  3QNN A;  4FJ5 A;  1KRP A;  3VQD A;  2HMI A;  3M8P A;  3CHW A;  4CW7 B;  4IJN A;  3O1W A;  4M3Z A;  3GL1 A;  4BVO A;  5BRF A;  5AQJ A;  3VQC A;  3MXM A;  4G1Q A;  3G71 N;  3KD5 E;  1LCU A;  3JSM A;  3VQP A;  4KI6 A;  1W0H A;  1S9G A;  1RTH A;  2D1K A;  4IOX A;  3CFO A;  3HL8 A;  1S5J A;  2W6L A;  3SLC A;  3H6E A;  3O9S A;  3SMS A;  5F2R A;  2HHV A;  2Z1G A;  4F9O A;  3OYG A;  4DTO A;  1TK8 A;  2X78 A;  5JIC A;  1N33 K;  3ZSV A;  4DTN A;  1EWQ A;  4HHT A;  4FLY A;  4FOI A;  2NUB A;  4W5T A;  1N6Q A;  3PY8 A;  2E2P A;  2BH1 A;  4K8Z A;  3QER A;  1BG3 A;  3AVA A;  4DTU A;  1QHT A;  1QTM A;  4CK2 A;  4JI3 K;  2P9K B;  1RT4 A;  3N4P A;  1LWC A;  4MFB A;  4FPA A;  3OJS A;  4I2Q A;  3E01 A;  4B1U B;  1HMV A;  1L3U A;  3LM9 A;  3ZT2 A;  3TAP A;  5EXW A;  2H3G X;  5K14 A;  5C24 A;  1SKS A;  2E88 A;  3ZSZ A;  1A5X A;  4IOA L;  1CZB A;  1RDB A;  5JLH A;  4DQR A;  1IBK K;  3GDQ A;  4B9L A;  3MCP A;  4KH6 A;  4FWQ A;  4JK9 A;  1TAQ A;  1TV6 A;  1Q82 O;  2I7P A;  2DPN A;  3C6U A;  5J1E A;  4N76 A;  5KGX A;  2VWJ A;  2DFH A;  3BF1 A;  3LDL A;  4AIL C;  1MWK A;  4KHY A;  1TYQ B;  3A0I X;  2O8E B;  4OKJ A;  2J4R A;  2JWL A;  4CJL A;  4FLU A;  4CHN A;  1HNV A;  5CZ2 A;  1VSI A;  1QVG M;  1IG8 A;  4KTW A;  1VRU A;  3U6F A;  2HST A;  1X3N A;  3GBT A;  1JLG A;  4DQQ A;  3WNF A;  4JI6 K;  2VG6 A;  2G8U A; 
#chains in the Genus database with same CATH homology
 3QFU A;  1NGJ A;  1RFQ A;  3WXJ A;  1BU6 O;  4BR7 A;  3D6R A;  1NLV A;  1T3V A;  2FF6 A;  1U2V A;  4FWK A;  4BR5 A;  2HBJ A;  3ZET B;  4BRP A;  1OVY A;  5AQS A;  5C0Y A;  2HBK A;  2QM1 A;  3VTI A;  4DB3 A;  3CJB A;  1SAZ A;  3KK7 A;  3GG4 A;  3P39 A;  1YJW N;  1OKJ A;  3OHR A;  4BRG A;  5BN8 A;  4CJ7 A;  3CJ9 A;  3CD6 N;  3LDN A;  4L3Q A;  4BG8 A;  3OBW A;  5CHI A;  1VQ7 N;  3CCL N;  4DCH A;  5AQP A;  5AZJ A;  5DM6 L;  4BC3 A;  3QBW A;  1ATS A;  1ATR A;  1WUA A;  1ESV A;  1YF5 L;  1Z6R A;  3GE1 A;  4ISG A;  5M1P A;  4AM7 A;  1NJI O;  1VQ5 N;  2HBL A;  2OAN A;  4KH5 A;  4O8K A;  2QTD A;  3AGK A;  3FZF A;  3K9J A;  3KZB A;  3A8Y A;  1X3M A;  3WEE B;  1VQ9 N;  4WFB L;  3ID6 A;  1NMD A;  1BWF O;  1TUY A;  3ZEU B;  1W97 L;  1HX1 A;  4A2A A;  3D2E B;  2YHW A;  4CZF A;  3ID8 A;  3VF6 A;  3TTD A;  2E1Y A;  4C23 A;  5JVH L;  3RVC A;  3CCM N;  3M6G A;  4MDB A;  2ASM A;  2PFU A;  5JVG L;  2P9S B;  5M1O A;  2F9T A;  4BRN A;  4CZI A;  2WBN A;  2D4W A;  3LM2 A;  1BA1 A;  4M63 C;  2JWK A;  5AQI A;  3VES A;  3WXK A;  2E2O A;  5GAG P;  4DKW A;  3CF5 L;  4OO1 J;  2VYP A;  3L0Q A;  3U8X A;  4JN4 A;  4JK8 A;  2D0P A;  2P9N B;  3A5M C;  1P8Z A;  2YI1 A;  3MN6 A;  4JNE A;  5E84 A;  3JXU A;  1ZBS A;  4BGB A;  4CBW A;  5BPL A;  3IUC A;  4JKH A;  2GWJ A;  4MO4 A;  4KH4 A;  4CZH A;  3SAG A;  4FWL A;  5E26 A;  3E9P A;  5LY3 A;  4BRH A;  4H5R A;  3CQX A;  4B1W B;  1HPM A;  1LOT B;  3WT0 A;  1BUP A;  2CH6 A;  5AQY A;  1KAY A;  4PL7 A;  3ZX2 A;  2NRR A;  1ATN A;  5AQV A;  3SK3 A;  1GLF O;  3DXK A;  3VEW A;  4OPH A;  1GLE G;  4RCH A;  2VWB A;  1YJN N;  3O9R A;  3J7Z O;  3CIP A;  4JAX A;  5C12 A;  2ASO A;  4I6M B;  4JD2 B;  3IDH A;  4BR2 A;  1K9M O;  5LJW A;  3EO3 A;  3MDQ A;  4RWT A;  3CC2 N;  1M90 O;  1U6Z A;  3FE1 A;  4MLE A;  3C0B A;  4JHD B;  4NLB A;  2KKZ A;  3R9P A;  4B1Z A;  1KC8 O;  2FSK A;  4KBO A;  1NGC A;  4UY8 O;  2NRX A;  3OW2 M;  3HZ6 A;  5M1K A;  3A5N C;  3TPQ A;  3CET A;  2OTL N;  2GTD A;  3D7E O;  3F2K A;  3Q7B A;  1VQL N;  1KAZ A;  2A6A A;  3MWT A;  3SAF A;  1BDG A;  1GLL O;  4H5V A;  2YHY A;  4BRO A;  3HTV A;  4A62 A;  3H3O B;  5ADX H;  1D4X A;  5AQU A;  1HJO A;  3Q7C A;  1HLU A;  1Z05 A;  4CZE A;  4EAH D;  3VEO A;  3DWL A;  3C65 A;  3DXM A;  5BN9 A;  2F9W A;  4PKI A;  3I55 N;  1QZ5 A;  3T7Z A;  3EE9 A;  1H1V A;  4IDH A;  2NNW A;  3LDQ A;  4CZJ A;  4DQ8 A;  4YOY A;  3BF3 A;  3HSC A;  1XC3 A;  5AQF A;  4WFN L;  3BEX A;  3O9T A;  1BOT O;  1KQS M;  2QEX N;  2HMP A;  1VQ4 N;  4CZM A;  4IO9 L;  2E8A A;  5BRH A;  4AM6 A;  1JCE A;  4K42 A;  4H5W A;  3CCJ N;  3B8A X;  3SBG A;  1DT9 A;  5H1S Q;  3I56 N;  1K8K A;  3ENB A;  1HKC A;  3FZM A;  3C7N B;  3ZX0 A;  4WCE L;  3CCU N;  2Q36 A;  1T6C A;  2Q2R A;  2HOE A;  4FWO A;  4JKA A;  2WUS A;  2CGL A;  3N4Q A;  1S22 A;  2YJE A;  2PAV A;  2W40 A;  2QWO A;  1V4T A;  5AQL A;  2CGK A;  1NGF A;  1TYQ A;  3DAW A;  2E1Z A;  4CBX A;  1DGK N;  3QDK A;  4H0P A;  4O5F A;  4WF9 L;  1GLD G;  5BPM A;  1JCG A;  2NRH A;  2NLX A;  3AAQ A;  5AQZ A;  5BPN A;  5GAH P;  3G6E N;  4IOC L;  3NVK A;  2HF3 A;  4NLC A;  5ELZ A;  5AQK A;  4FVU A;  1QQM A;  4XEI A;  2FLO A;  2WFB A;  1Q7Y O;  3C6H A;  4H03 B;  4MO5 A;  3CCE N;  4BRD A;  2QWR A;  3NVM A;  4AF1 A;  4BG9 A;  4CZL A;  4BY9 C;  3RSE B;  3VMF B;  5C2D A;  3TSP A;  4B1Y B;  3G4S N;  3K9K A;  3WQU A;  3CXC M;  1NGD A;  3UKU B;  4BRE A;  3KHY A;  1CZA N;  3U4L A;  5FPM A;  2IVN A;  3VER A;  4CZK A;  3GOI A;  4ISF A;  4QS7 A;  4WQ5 C;  3EKS A;  4BR9 A;  3ZET A;  1NGA A;  2W41 A;  1NGB A;  3EZW A;  3DJC A;  4FPB A;  3CC4 N;  3I8B A;  1NGE A;  4IFE A;  4K25 A;  3G25 A;  2Q0R A;  4C1N I;  2KHO A;  3ENO A;  3BUZ B;  5FPN A;  3AGR A;  4C1N K;  5KQD A;  1X9J A;  3ULE B;  2QA4 N;  3FZL A;  3SBT A;  4JKB A;  4IXC A;  5AQT A;  3R8E A;  2VGM A;  4JKG B;  3ZX3 A;  1K73 O;  4FO0 A;  2FSJ A;  3VGK A;  3PIO L;  5MLC Q;  2A3Z A;  3D2F B;  3WEE A;  4CI6 A;  3CJ1 A;  1VQ6 N;  1K8A O;  3ZEU A;  5DM7 L;  2IVO A;  5AFU A;  3D2E A;  1ZXO A;  3U9D A;  4HWI A;  4GV3 A;  2FF3 B;  1VQN N;  4GVE A;  3CPE A;  4JEP A;  3T69 A;  1DEJ A;  3MK6 A;  4NO7 A;  3PLA A;  4U7B A;  1N8R O;  3WQT A;  4QS8 A;  3FGU A;  4EIA A;  3CCR N;  3EN9 A;  5I9E B;  5M1N A;  2E20 A;  1RDU A;  4YOT A;  1C0G A;  2GX9 A;  4FWR A;  4E1J A;  3QBX A;  2P9N A;  2QWL A;  1QQN A;  4CD1 A;  4R79 A;  5KPT A;  2Q97 A;  5GIN A;  3UKR B;  2GWK A;  2ZF5 O;  2GEM A;  4IO8 A;  4BC5 A;  3O4W A;  4FWM A;  2P9I B;  3QIC A;  2ZGY A;  1NM1 A;  1MDU B;  1VQ8 N;  3HOT A;  3VEN A;  4YDU C;  3EE8 A;  5BR9 A;  4BRA A;  2A40 A;  3H1Q A;  3H1V X;  1T44 A;  3I33 A;  4YDU A;  4JKE A;  5EY4 A;  3CJA A;  2Q31 A;  3SAH A;  3O5B A;  4J8F A;  5M1Q A;  1YXQ A;  2P9P B;  3F5T A;  3VTH A;  1KD1 O;  4I6M A;  4JD2 A;  3VOV A;  3W0L A;  3CC7 N;  3TTF A;  3FZH A;  5TKY A;  4GV9 A;  4JHD A;  2EWS A;  2I7N A;  1VQK N;  3MMV A;  3J8A A;  1NGI A;  2D0O A;  2WC9 A;  2P9K A;  4A5A A;  5BRD A;  5GAE P;  1XQS C;  5AZI A;  2CH5 A;  3TU5 A;  5AQH A;  3WXI A;  4BC4 A;  4B9Q A;  4JK7 A;  4IEE A;  1RGI A;  1HUX A;  3ATU A;  4K43 A;  3P31 A;  4H5T A;  3VGM A;  2E2Q A;  4A59 A;  4JKC A;  4A5B A;  3OA9 A;  3SMP A;  4BRC A;  3CMA N;  2P9L B;  3AAR A;  3E1Y A;  3C6A A;  3IKM A;  4FWS A;  1QHA A;  2NRW A;  2NRT A;  3CER A;  4WQ4 C;  4BR0 A;  4BRQ A;  3R6M A;  1ILY A;  2PBD A;  4WQ4 A;  5HOO A;  1JJ2 M;  3DXM B;  5C15 A;  1KAX A;  3MN9 A;  3TTC A;  1YIJ N;  2VCP A;  3BP8 A;  4H0Y B;  4FWP A;  2ASP A;  3L4Q A;  4BRM A;  3LDO A;  2QI2 A;  2ZJR L;  1YI2 N;  5AQM A;  1DKG D;  4IJA A;  3H46 O;  3FFK B;  5C2F A;  3H45 C;  1C0F A;  3KVG A;  5TKW A;  3PIP L;  2QWP A;  1TUU A;  3QFP A;  4YOU A;  2RHK A;  3C7N A;  4EFH A;  5M1F A;  4HTL A;  3MN7 A;  4BRI A;  3LL3 A;  2YX6 A;  1R59 O;  4ILJ A;  1Q86 O;  2YHX A;  1YAG A;  2ZWH A;  3OBY A;  5BRE A;  3WXL A;  4IEI A;  4BRF A;  1YVN A;  4B1V A;  3R3L A;  1V4S A;  2P9U B;  2A42 A;  2GEL A;  3M5R A;  3W3D A;  2ZJQ L;  3A5L C;  2NZT A;  4FL9 A;  4K41 A;  1WOQ A;  5LJV A;  2Q0U A;  3R1X A;  3O9Q A;  3O08 A;  4YOR A;  3CCV N;  1NBW A;  1QZ6 A;  2QWM A;  3L4I A;  5KQ8 A;  1NGG A;  5AQW A;  4BR4 A;  2QWQ A;  3QB0 A;  4ISE A;  4O8U A;  4FSV A;  3MWP A;  4FOE A;  3MX5 A;  5EVZ A;  1E4F T;  3RSE A;  4A57 A;  4WQ5 A;  4CBU A;  1J6Z A;  2F7T A;  3QML A;  5AQQ A;  1Q81 O;  3UKU A;  3P38 A;  3UB5 A;  3HOS A;  4G9Z A;  4ILH A;  1U2V B;  1RDW X;  4PHT X;  5AQO A;  5AFU H;  4QS9 A;  5CE3 A;  1ZC6 A;  3SJH A;  4EHU A;  2YJF A;  3O80 A;  3U9Z A;  3FR0 A;  4Y0W A;  2BTF A;  2IIR A;  2QXL A;  3CI5 A;  3E9O A;  3CQY A;  3HM8 A;  4ILG B;  3IFR A;  4XH5 A;  4JKF A;  3O9U A;  3VET A;  2RE2 A;  5C10 A;  3P4I A;  3KWG A;  4GNI A;  4H0V B;  3WUH A;  5AZJ B;  1EQY A;  4BC2 A;  1VQP N;  3VEV A;  3O8M A;  1BO5 O;  1E4G T;  2FXU A;  4IWV A;  4XH1 A;  3VEZ A;  4B1X B;  1HKG A;  3H3N O;  2NRV A;  3ULE A;  4DHY A;  2V7Y A;  3CCS N;  5B8H A;  3CJC A;  2FSN A;  2NRZ A;  3F9M A;  2A41 A;  4JKG A;  4NB4 A;  5EX5 A;  2ZGZ A;  3VPZ A;  4Z94 A;  3HBT A;  1M1K O;  1GLA G;  1SS6 A;  4CD3 A;  5JMV A;  3O1B A;  1SQK A;  2CGJ A;  4A2B A;  3D2F A;  4BGA A;  3FLC O;  2P9S A;  2ITM A;  3FZK A;  3JS6 A;  3EKU A;  2BUP A;  4WYB A;  3ATV A;  3VEY A;  2OTJ N;  1EO1 A;  1HKB A;  5KPZ A;  2HF4 A;  1JCF A;  3TSU A;  4BRK A;  2V52 B;  1Y64 A;  3CHW A;  4IJN A;  3O1W A;  3GL1 A;  4H5N A;  5EOY A;  2V51 B;  4BVO A;  2KLA A;  5BRF A;  4YOW A;  2ZJP L;  5AQJ A;  3ENH A;  5HL7 L;  4EHT A;  2QWN A;  2VGN A;  3G71 N;  1GLC G;  1LCU A;  5KPR A;  3VEX A;  3S41 A;  3UKR A;  1NWK A;  3VF2 A;  2YCH A;  2D1K A;  3DXK B;  1XUP O;  1GLB G;  2GUP A;  4IOX A;  2P9I A;  3M3Z A;  1YJ9 N;  1QVF M;  4PKG A;  4A61 A;  4PL8 A;  3L6Q A;  1S72 N;  3SLC A;  2AA4 A;  3H6E A;  3O9S A;  3WXM B;  4MDA A;  3MCA B;  5F2R A;  1O13 A;  4H0T B;  3SMS A;  2P9P A;  4F9O A;  1VAZ A;  5FPE A;  3TSQ A;  5JIC A;  2AP1 A;  4WFA L;  3VF4 A;  5AR0 A;  4FOI A;  1QQO A;  3EL2 A;  5GIO A;  2E2P A;  2BH1 A;  1BG3 A;  1GLJ O;  3CCQ N;  1KXP A;  4M7Y A;  4XH4 A;  2P9K B;  1IJJ A;  1P90 A;  3ZYY X;  1BA0 A;  4IZ9 A;  1YHQ N;  3N4P A;  5AZI B;  3NMU A;  4FPA A;  3LDP A;  4B1U B;  3A5O C;  2P9L A;  4FWN A;  3LM9 A;  5F1X A;  1NGH A;  4YOX A;  5EXW A;  2H3G X;  3UE5 A;  4OPA A;  2E88 A;  1MWM A;  4CZG A;  4IOA L;  4BVP A;  4BRL A;  5AQR A;  5JLH A;  1VQM N;  5GIP A;  3GDQ A;  5JLF A;  3KWI A;  3MCP A;  2Q1N A;  3CPW M;  4KH6 A;  4FWQ A;  3AY9 A;  3MN5 A;  4JK9 A;  5AQG A;  1Q82 O;  1S3X A;  2I7P A;  1K8K B;  2DPN A;  4GY2 B;  5AQN A;  4BQZ A;  1YIT N;  1G99 A;  3E9L A;  5ADX A;  2E2N A;  2QW9 A;  3BF1 A;  4RTF D;  3LDL A;  3E66 A;  5CR4 A;  2A5X A;  4JKD A;  1MWK A;  3CJ7 A;  3HI0 A;  3IMX A;  1TYQ B;  3A0I X;  4MLH A;  2V7Z A;  3VGL A;  4M7X A;  2J4R A;  4BQL A;  2JWL A;  5F0X A;  5GAD P;  1W2B M;  1MA9 B;  3HRG A;  2P9U A;  1T6D A;  1YUW A;  1VQO N;  5AQX A;  3AAP A;  4H0X B;  2UYT A;  2HBM A;  1QVG M;  1IG8 A;  4LC9 B;  1SZ2 A;  3DLL L;  4GV6 A;  2HST A;  1X3N A;  2IVP A;  3GBT A;  4U67 L;  3MX2 A;  3CME N;  5FPD A;  4H0O A;  3M1F A;  1Q18 A;  3O6W A;  4PKH A;  4YOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...