4CHPA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4chpA00
2KW4A 3PY8A 3L2VA 3I0RA 4IKFA 4Z0UA 2VG7A 3NFAA 3ITHA 1JLFA 4H4OA 5DMRA 4DTJA 3DYAA 1RCHA 1DTQA 4B8AB 5J1EA 2W42A 1T8EA 3PX0A 3LPUA 2KQ2A 5FROA 4CEOA 2VWKA 2KTQA 4KTWA 3DLGA 3AA4A 3VN5A 4QCLA 3M8RA 1L3VA 4FJJA 1C1BA 4J2EA 2KZMA 3QIPA 4CHNA 1RBTA 3I8DA 3HM9A 1KLMA 3TAGA 1NK7A 3RMAA 4KRFA 3C95A 1UA1A 2G8HA 2HB5A 4RW4A 4CJTA 3D0PA 4FJIA 3NGZA 4FZYA 5HROA 4FM1A 1IKXA 4OVLA 5E41A 2QKBA 3V9UA 2XHBA 4FXDA 2HHQA 4KTQA 1JLQA 3LP0A 3NGIA 3OS0A 1HMVA 4OGCA 3TAMA 4CK3A 1JLEA 1QS4A 3QIOA 3S9HA 4L8RB 3OYLA 4RW6A 3OYBA 2QK9A 2Z1GA 3QEIA 2YNHA 2BGGA 1XHXA 4HCBA 3LWLA 3BGRA 4E19A 1CLQA 4NYNA 4DTPA 3G10A 4J2AA 3T19A 4Z4EA 3SYZA 1HNIA 1BISA 3MEDA 3ZCMA 1C1AA 2B5JA 3OYIA 3V81A 4FM0A 2XRIA 3DLKA 3ZT3A 3K5LA 1BI4B 1RT2A 1RDDA 3M8QA 1RDBA 4M3YA 4B9UA 1VSEA 4OPJA 2YNIA 3SCXA 1B92A 3DLRA 4ZTFA 4I9QA 2X74A 3OYCA 3L2QA 3TI0A 4PWDA 4CGGA 5C42A 3KK2A 4M42A 1KVAA 4CGHA 2RN2A 1L3SA 3MECA 2GUIA 3V9XA 1TAUA 4CJ3A 1IKVA 1KSPA 3L2RA 1FKOA 3VQCA 3THVA 3QESA 3DM2A 4OKKA 4FJMA 1BIZA 4ICLA 3S3MA 3ASMA 1QHTA 5HRSA 3ZT4A 4H4MA 3AO3A 3SV4A 4DQQA 4OLAA 1IH7A 3AO2A 2FBVA 3WNEA 4CE9A 3KLFA 1I39A 1TK5A 2IAJA 2X78A 4CJPA 1VSKA 3HVTA 1QSYA 3TAQA 1Q8IA 4C8MA 3VQBA 4C8KA 4FK0A 4W5QA 3L2UA 3LWMA 4CHZA 1YTUA 3OYHA 3VQ5A 1SV5A 1W0HA 1VSMA 4B8CA 4CGDA 4EP5A 3DRPA 5JS2A 1KTQA 4PA1A 3V9SA 4CJEA 3E01A 5J2MA 1HJRA 2A1SA 3MAQA 1LWCA 3K5MA 3ZSWA 3EY1A 4B9LA 1K6YA 3K5NA 4OJRA 1C1CA 1BQMA 1IG9A 3OYKA 4ID1A 5C24A 3ZSQA 1U49A 3SNNA 4DTUA 3QINA 4RW7A 2KZZA 3VQ4A 1LAVA 1VSHA 1YT3A 2JLEA 4B9MA 4HVJA 4M3XA 1TAQA 1RT3A 1BCMA 2YKNA 4CECA 2BE2A 1YTAA 1DTTA 4DQIA 4CJUA 5KTQA 4C8OA 2HHUA 3NAEA 3HO1A 4GVMA 5KGXA 3DMJA 3K57A 3VA0A 3ZSYA 1TK0A 2D5RA 1GOBA 2WOMA 4DLGA 1VRUA 2QKKA 4F2RA 1NOZA 3SV3A 1LWFA 3IG1A 1XI1A 3RR7A 3QLHA 4RG8A 3V9ZA 1RT1A 1T03A 2ZE2A 3KIOA 4KFBA 4FLVA 4ELUA 4M3WA 5CY4A 2P51A 2F96A 3SPYA 4HTUA 3AV9A 4CHPA 1D5AA 3OYJA 3MXMA 2Z1IA 4CF9A 3QERA 2ITGA 2EX3A 4IFYA 3QEVA 3AA2A 1A5XA 4CCHA 4KHUA 1XC9A 4MQ3A 3V4IA 3U6FA 2XO7A 1LAWA 3U3GA 4DTMA 3HPHA 5I42A 4DSLA 2IC3A 1IO2A 3KLEA 3ULDA 3AO5A 3ZT1A 1ASUA 4JS5A 3LP2A 4DQSA 1KLNA 4EZ9A 3UIQA 3LDSA 4MFBA 4N76A 3KLHA 4YNQA 2XY6A 5KRTA 3WNHA 3C94A 1C0UA 2DFFA 3TR8A 4CJQA 3NF6A 1RT4A 4Z4HA 1R0AA 1HYSA 1RBUA 1SUQA 4Q5VA 4DFKA 3T1AA 4F2SA 4B9NA 2IGIA 3NHGA 4DU4A 1L3UA 1B9FA 5KRSA 4E1MA 4FJGA 1SL0A 4CERA 4KB1A 5DK5A 3O3HA 1Y97A 4FLYA 4FVMA 3HK2A 1A5WA 4ID5A 4AHSA 3PX4A 3AVGA 1TGOA 3VQ6A 4F8RA 1C0TA 2HNDA 4BACA 4FLZA 1HQUA 4CF0A 1ZBFA 2YKMA 2O4GA 1S1UA 2NUBA 3QO9A 4GMJB 3LPTA 4H8KA 4DFPA 1JLGA 3MEGA 3NDKA 4DU3A 4CJFA 4FLWA 2G8VA 1FXXA 3B6PA 3AVCA 1WSFA 3QNOA 2DTUA 2OA8A 1JLCA 4M3TA 2YHBA 4CF2A 2G8KA 4KAZA 4PQUA 4CJSA 4CIEA 4E7JA 4I7FA 4B9VA 2G8IA 1WAFA 3RMCA 4OGEA 4J2BA 3PO5A 1ZYQA 1NK9A 4LSNA 3L8BA 3SQ4A 3V9WA 4AHVA 5T7BA 4AHUA 1KVCA 1A5VA 3DRSA 5FDLA 1Q9XA 1TVRA 4DTRA 2PZSA 2OZSA 1S5JA 4FJXA 3T3FA 4NYFA 4O0IA 2HVIA 4CIGA 5HLFA 1QE1A 3LANA 4W5RA 3WNFA 4O4GA 2DFHA 3KKSA 4R5PA 4DFMA 5CYMA 2Z1HA 4C8LA 4CJ4A 3LAKA 3MEEA 1WSJA 4B3OA 1TKZA 1JXBA 1RT7A 3LALA 4IBNA 3NH1A 2VWJA 2I5JA 1NJWA 1L3TA 4KI6A 1VK0A 3KLIA 3G0ZA 1U47A 3PO4A 1VSDA 4FYDA 2QXFA 4FJ9A 1T7PA 3PV8A 4CEAA 2B6AA 4JRPA 5HBMA 3CM5A 3F9KA 4Z4GA 4DG1A 3HT3A 4BWMA 3TWHA 4CEDA 2Y1JA 3C6UA 2OPPA 2FBYA 3ZSZA 1UA0A 4TSXA 4O5BA 3KLGA 1RILA 1JL1A 3O4NA 4JRQA 3SJJA 3K2PA 3O3FA 1N6QA 3ISNC 1QSSA 3NGYA 4CFCA 3F73A 4BDPA 4NCBA 3ZSRA 2OPQA 2X6NA 1JXEA 4DQRA 5J2PA 4FW2A 5JS1A 4CGFA 1D9DA 3TANA 1RDAA 3AVFA 2PYLA 4PY5A 1U04A 4CESA 1NOYA 4FLTA 4F4KA 3TARA 1HYZA 1J53A 2HHVA 1X9WA 1RTJA 1UWBA 3MXJA 4CEZA 4LY7A 3AA5X 4CFDA 2OYQA 3V1OA 3AVHA 4HUEA 1S1TA 4CF8A 3QNNA 3CG7A 3CFOA 3RTVA 2A1RA 5EU7A 4KHQA 1NK6A 1RTDA 3M8SA 1XWLA 2YV0X 1S1XA 2LSNA 1ITGA 4I9LA 3KJVA 4CGJA 2HVHA 3ZT2A 1ZBUA 2P1JA 3NBPA 1BI4A 1VSJA 1UOCA 3DLHA 3VQAA 3U3YA 2KFNA 3SUOA 4KHSA 4W5OA 3OS1A 1LWEA 1HNVA 3HP9A 1HPZA 3KKRA 3OYNA 3QETA 4FZZA 2D0CA 3AVAA 4DQPA 1BGXT 4DTXA 3RRHA 2E6LA 2FBXA 3AVJA 1KFDA 3DLBA 3VQEA 1SKRA 3VQ8A 1RBVA 3OJSA 4YFUA 2DY4A 1UAXA 4FW1A 4AHCA 3B6OA 3JYTA 3S3NA 1NK0A 1D8YA 3OYGA 3HVRA 4FJNA 3KK3A 5J2QA 1WSEA 3OYEA 4KHYA 1Q9YA 4LH4A 3V6DA 3TAEA 3SPZA 5K14A 1J5OA 3HJFA 4DSIA 1O1WA 1CZBA 4LSLA 2VG5A 2HW3A 4Z4FA 4CEFA 4FJKA 4CJWA 4CEBA 2G8FA 4O44A 4BWJA 2PY5A 4PUOA 3CFPA 4J2DA 1RBSA 3ZT0A 3SUPA 4CHYA 1EXQA 4KB0A 1MU2A 4E7LA 4FLUA 1Z26A 2HHWA 4B9SA 4OLBA 1KFSA 1TKTA 1TKXA 3K5OA 4ZTJA 3KD5E 3TAFA 4OPKA 1L5UA 2O4IA 1DLOA 1J54A 4OKJA 3QEPA 3S3OA 4CHQA 4KREA 3SQ1A 4M3UA 3NF9A 4E89A 4DSJA 3SUNA 3EYZA 5SWMA 4LD0A 4FZXC 1GOCA 3CQ8A 4W5NA 1NJZA 1SL2A 2PYJA 1SKSA 1S1VA 3ZSXA 2IDOA 3OYAA 4N47A 4KHWA 1KCFA 1VSLA 2GV9A 3VQ7A 3V1RA 1G15A 2HHSA 2IOCA 2FBTA 3LP3A 4I2QA 4CJRA 4FK4A 1EETA 3DI6A 1NJXA 2HNZA 2GBZA 3MXIA 3DOKA 1BIUA 1CXQA 2F8TA 5J2NA 4DMNA 4LH5A 4HUGA 3SUQA 1TKDA 1JLBA 1VSIA 1D9FA 3NF7A 4DS4A 3IAYA 1TK8A 3OY9A 1BL3A 1KVBA 2G8UA 4DTOA 4Y1CA 4BE0A 4HCCA 2EHGA 3OJUA 5FRMA 5HRPA 4EP4A 1RT5A 2Q3SA 4DSKA 3HXMA 2XY5A 1S1WA 1WN7A 4UQGA 3HL8A 1NK8A 1X9SA 2YNGA 4E1NA 2RPIA 5HP1A 3TABA 5CYQA 1SL1A 4B08A 2KFZA 2AJQA 1FKPA 3VA3A 1B9DA 1LV5A 5I3UA 3CM6A 4Z4IA 3AVNA 3LAMA 3M8PA 3DOLA 4DTNA 4AILC 1IKYA 1S6PA 4DS5A 1RTIA 2XY8A 1NK4A 3QEXA 4KPYA 4DF4A 4HHTA 2ZD1A 3AVBA 3D45A 1JL2A 4M45A 1HYVA 2YNFA 4E3SA 3AVIA 1WSHA 3V1QA 5FRNA 1CZ9A 3SI6A 1XHZA 1HQEA 2WONA 3DRRA 1IKWA 3L3VA 4QAGA 3AVKA 5C25A 3RMBA 3L3UA 2HHXA 1ZBIA 2OPSA 3CYMA 3KTQA 2BANA 4FJHA 4QOZB 1ZBLA 1X9MA 2JGUA 2F8SA 3C6TA 1NKEA 3NH0A 1KRPA 2D0AA 2E6MA 4I2PA 5CZ2A 4CK2A 3NE6A 2OPRA 4E7KA 2Y1IA 2FC0A 3KK1A 3TAPA 1T05A 4E7IA 3AO1A 3EZ5A 1WLJA 3VQ9A 4M3RA 4KO0A 3ZSOA 4HUFA 2BDPA 1N5YA 2G8WA 1RT6A 5HRNA 1ASWA 4CGIA 4NCGA 2ZQBA 2XY7A 4ELVA 1X1PA 4KV8A 3AO4A 1C6VA 1Z25A 3NH2A 3NF8A 4KI4A 1HRHA 1C0MA 1RBRA 3H08A 3VQQA 4FLXA 4BE1A 4KTZA 3NCIA 1GOAA 1CXUA 3A2FA 3P5JA 1S9EA 4K8XA 4GW6A 1TV6A 3AVLA 3BDPA 4JS4A 2OZMA 4M41A 3HP6A 2VG6A 3ALYA 1QSLA 4F3TA 3LZJA 4E7HA 2ATQA 3RR8A 1ASVA 1TL1A 2HMIA 4G1QA 1S9GA 3O4QA 3FFIA 4CIFA 3OYDA 5KI6A 2RF2A 3LP1A 4WE1A 3IS9A 1BQNA 4N5SA 3I0SA 2D0BA 1EX4A 2P5OA 1JLAA 3VQPA 4FJ7A 4M3ZA 1WNSA 3P83D 3L2WA 1LW2A 4F3OA 3WNGA 4CF1A 1QQCA 2HNYA 3VQDA 4CHOA 1NJYA 2X6SA 4AHRA 1JKHA 1VRTA 1WSGA 4DF8A 4N41A 5CZ1A 4W5TA 1RDCA 3ZSVA 4IDKA 4C8NA 4CEEA 1TL3A 4RW8A 3SQ2A 4B9TA 1EKEA 4DSEA 4ELTA 4CFBA 4N56A 3PX6A 3SQ0A 4BDZA 4FJ8A 1VSFA 4O0JA 1U48A 4XIUA 1I3AA 4AH9A 4AHTA 1U4BA 4BDYA 1WSIA 1U45A 5D3GA 2P5GA 2B4JA 3DLEA 3JSMA 1J9AA 3OYFA 1EP4A 4JLHA 2HHTA 4Q0BA 4IG0A 3QEWA 4FCYA 4DTSA 3KD1E 4OKEA 4E0DA 2ETJA 1LW0A 4CFAA 4BE2A 3HPOA 3OVNA 2DFEA 4DU1A 5KGWA 4CJVA 3LZIA 3O3GA 1NKBA 3RMDA 4CEQA 4CJLA 4EZ6A 1NKCA 3SZ2A 2IS3A 3IRXA 3HYFA 4KKOA 3HPGA 5HRRA 4CJ5A 3CFRA 1BCOA 4DFJA 3RWUA 4IFVA 4FJ5A 4FJLA 4FK2A 3K59A 1S6QA 4ZHRA 1ZBHA 1FK9A 1RTHA 1RNHA 2YHAA 4IG3A 4FM2A 4DWIA 4NCAA 4DSFA 4O55A 4KHNA 1F21A 4CJKA 1NK5A 4CK1A 2E4LA 1REVA 3AVMA 3PUFA 1W9HA 1WAJA 3P1GA 1YVUA 3OS2A 1BHLA 4RW9A 3K58A 4DLEA 4Y1DA 2R7YA 4Z4CA 1SKWA 3RRGA 3HSTB 2RKIA 3AA3A 2Z1JA 5SZTA 3OYMA 1QTMA 4K8ZA
chains in the Genus database with same CATH superfamily
5AQGA 4IKFA 1HKBA 3ITHA 3J8AA 4H4OA 4DTJA 3DYAA 4B8AB 3LPUA 5FPEA 4J8FA 5HOOA 4KTWA 3DLGA 3VN5A 5GINA 3M8RA 2KZMA 1J6ZA 3QIPA 3TAGA 4CJ7A 4YOYA 3SMSA 3HBTA 2G8HA 2Q97A 2HB5A 4CJTA 4YOXA 4FZYA 5HROA 4K0KK 3KK7A 3THXA 4OVLA 4C1NK 4FXDA 3V9UA 3THYA 3RWUA 3S9HA 1QS4A 3QEIA 5BR8K 1QZ5A 3PIOL 3T19A 3SYZA 1HNIA 1M1KO 3ZCMA 1C1AA 3ZYYX 4C1NI 4KH6A 1TAUA 3K5LA 1RT2A 1RDDA 3M8QA 1RDBA 4B9UA 3M6GA 2YNIA 3DLRA 1KQSM 5M1PA 3KK2A 4H5RA 3MECA 3TPQA 1IKVA 1ILYA 1FKOA 3QESA 1NM1A 4OKKA 1IV0A 1QHTA 2FF3B 4M7XA 3W3DA 1NLVA 2YHXA 4GV9A 1HPMA 1IH7A 5TKYA 1DT9A 3SAGA 1VQ7N 3HVTA 4C8MA 5CHIA 3EL2A 4OX9K 1YTUA 3OYHA 3QBXA 2WC9A 1W0HA 3DRPA 1KTQA 3V9SA 3MX5A 3E01A 4CJEA 5J2MA 2A1SA 4DR5K 3THWB 4B9LA 4RTFD 4BRFA 4JKGA 4ISGA 4OJRA 3K5NA 3AAQA 1IG9A 3OYKA 3L4IA 4H0VB 5GIOA 3ZSQA 3SNNA 4O8UA 2KZZA 3VEOA 3VGKA 1VSHA 4M3XA 4NO7A 4CECA 1N36K 4BRIA 3NAEA 3CIPA 2HSTA 2QKKA 1GOBA 2WOMA 4F2RA 3IG1A 2ITMA 5FPDA 2P9SB 2D4WA 5CY4A 1RDUA 3AV9A 1D5AA 3MXMA 2EX3A 3QEVA 1A5XA 2UUBK 1XC9A 3U3GA 4DTMA 4IFEA 3D2FB 5GAHP 3KLEA 1EO1A 3DXKA 3ZT1A 2O8EA 4M63C 1KLNA 4YNQA 1C0UA 2DPNA 3NF6A 1RT4A 3Q7CA 4DFKA 3T1AA 4NXMK 4B9NA 4F2SA 4LF6K 3L6QA 5DK5A 3CC2N 1Y97A 4FLYA 3HK2A 1JJ2M 1GLLO 1XC3A 1ZBFA 1NGGA 3ZLJA 1JLGA 3MEGA 3RSEA 4CJFA 4FLWA 4DU3A 2G8VA 1FXXA 3AVCA 4CF2A 3LDNA 3WXIA 4I7FA 2G8IA 4J2BA 3PO5A 1NK9A 3VEVA 4LSNA 1Q9XA 5FDLA 2HF3A 3T3FA 4O0IA 3LANA 1W7AA 2DFHA 3KKSA 5CYMA 4IDHA 4CJ4A 1WSJA 2FXUA 5EVZA 2KKZA 4XH5A 1L3TA 2I5JA 1NJWA 1VK0A 3KLIA 3G0ZA 4QS9A 5C2FA 1U47A 1T7PA 5AQLA 3VF2A 3F9KA 4LF8K 1VQON 2GWKA 3KLGA 3U9DA 1J5EK 3SJJA 3O3FA 1NMNA 2YHWA 3ISNC 1QSSA 1QHAA 4BDPA 2X6NA 4CZIA 2PYLA 3TARA 1J53A 1U2VB 2HHVA 2YHYA 2OYQA 3V1OA 2O8FB 2GX9A 1S1TA 3EN9A 3M8SA 3GG4A 1GLEG 1S1XA 1XWLA 4CZLA 2HVHA 3ZT2A 1XMOK 3VTHA 5BPNA 4K41A 3VEZA 2KFNA 2ASOA 3BEXA 3W0LA 3KKRA 3OYNA 3VESA 3QETA 4FZZA 2E1ZA 1M90O 4DQPA 1KAXA 2WBNA 3AVJA 1KFDA 1RFQA 4AHCA 3S3NA 1NK0A 4FJNA 3OYGA 1MWKA 3HVRA 3KK3A 2VQEK 4GKJK 3CCMN 3DJCA 1J5OA 4Z4FA 3G25A 4KBOA 1VAZA 4H03B 4DCHA 3E1YA 1RBSA 4KB0A 5HL7L 1Z26A 2HHWA 4B9SA 1KFSA 2BUPA 1HKGA 3VENA 3O6WA 1L5UA 2E1YA 2W40A 4AM7A 4OKJA 3QEPA 4CHQA 3JS6A 4M3UA 3EYZA 4LD0A 1GOCA 3CQ8A 4W5NA 4RCHA 3QFUA 4Z94A 4IEIA 4ISFA 3VQ7A 3ID8A 2HHSA 2IOCA 3LP3A 4FK4A 3DOKA 2F8TA 3U8XA 4JKHA 4DMNA 3IAYA 3A8YA 1D9FA 4BRNA 1TK8A 3VPZA 1BO5O 3D2FA 5C12A 1KD1O 4ISEA 4BE0A 5HRPA 3FLCO 4NLBA 1RT5A 5CR4A 3VOVA 1S1WA 1WN7A 4E1NA 2ZGYA 2QEXN 3HOTA 1JCGA 4PKGA 4CBXA 4B9QA 1FKPA 1B9DA 1LV5A 2E2QA 3CM6A 2P9UB 3DOLA 1IKYA 1D4XA 1Q81O 1S6PA 4DS5A 2XY8A 2NRTA 2WUSA 4KPYA 2UXBK 2YNFA 1WSHA 1CZ9A 3SI6A 1XHZA 2WONA 4QAGA 3RMBA 4JK7A 5C25A 3C65A 3KTQA 4FJHA 2F8SA 1KRPA 3NH0A 3LDLA 2Y1IA 2E2PA 2FC0A 3TAPA 3AO1A 3EZ5A 4M3RA 4KO0A 4HUFA 3QDKA 2BDPA 2NRXA 1RT6A 5KQ8A 4ELVA 3VERA 1X1PA 4OPAA 1W97L 4KV8A 3UKUB 3VQQA 2QWPA 4FWNA 3JAMO 5M1KA 3WQUA 1VQ5N 4V19S 3MX2A 1MA9B 1TV6A 3AVLA 4JS4A 5AFUA 1HR0K 5BPMA 3ALYA 2VCPA 2YX6A 3RR8A 1C0FA 1V4SA 5F0XA 3ZX0A 3VEYA 1VQ4N 2O8DB 3LP1A 3BF1A 4N5SA 3EE8A 1T3VA 4FJ7A 5ADXH 1HNZK 3SK3A 3VQDA 1P8ZA 4CHOA 4AHRA 4A62A 1JKHA 1U2VA 2OCEA 1RDCA 1TL3A 4RW8A 4LFBK 4DSEA 4Y0WA 1NMDA 4FJ8A 4DV6K 4QS8A 4CZFA 1U4BA 4IG0A 3HPOA 3OVNA 2W6LA 3J7ZO 2QI2A 5AZJB 4H0OA 4JKAA 3CJAA 3RMDA 3IRXA 4JI2K 3HYFA 3HPGA 4FJ5A 4DFJA 4FJLA 4H0TB 1S6QA 4ZHRA 1RNHA 4DWIA 4DSFA 3BY5A 4GVEA 2CGLA 3C7NB 1BA1A 3LDQA 4CK1A 3PUFA 1WAJA 1YVUA 1BHLA 1SKWA 4Y1DA 1NJIO 3RRGA 2RKIA 3AA3A 3R8EA 5SZTA 4K8ZA 4YDUA 4PKHA 1EWRA 2VG7A 3NFAA 4FWMA 5DMRA 4YOWA 1XNRK 2W42A 3PX0A 1VQPN 5FROA 2KTQA 1IJJA 3BF3A 2FSNA 1L3VA 4FJJA 1C1BA 4J2EA 1NNEA 3ENHA 3RMAA 2QWQA 1NG9A 3NGZA 2ZJQL 3NMUA 3CCLN 3O1BA 1GLAG 4FM1A 5F1XA 2XHBA 3NVKA 3OS0A 1HMVA 4OGCA 4CK3A 1WBDA 3OYLA 2BGGA 4EHUA 4NYNA 3G10A 3CPEA 1KAYA 4Z4EA 3MEDA 4DHYA 3OYIA 3CETA 5AQUA 4FM0A 1BI4B 2NRWA 4M3YA 1VSEA 3O8MA 3LM9A 2X74A 4CZMA 3L2QA 1YJNN 3BZCA 4M42A 1OKJA 1L3SA 1KSPA 2GELA 3QBWA 3THVA 3DM2A 4FJMA 3O80A 1BIZA 2P9UA 3S3MA 1NBWA 3O5BA 3ZT4A 3HM8A 4BG8A 5AQWA 4DQQA 4OLAA 3AO2A 3SJHA 1E4GT 1TK5A 2IAJA 4CJPA 3TAQA 3VQBA 2HF4A 1SV5A 4CGDA 5JS2A 3PIPL 4PA1A 1HJRA 3MAQA 5EXWA 4JN4A 1SS6A 3WT0A 3FZFA 2BH1A 4O8KA 1U49A 3UKUA 5EX5A 4JI4K 3QINA 4JI3K 1LAVA 2YJFA 4B9MA 4HVJA 1RT3A 1KAZA 5KTQA 4A59A 2EWSA 4GVMA 2QA4N 1VRUA 1NOZA 4IWVA 3SV3A 4JV5K 2GWJA 3QLHA 4PL7A 4H0PA 4FLVA 2O8DA 4WCEL 4HTUA 2E20A 3QERA 4IFYA 4MQ3A 2Q31A 3V4IA 2XO7A 3E66A 3VGMA 4DV3K 2F9WA 3F9MA 3CCUN 2I7PA 4JS5A 3A5NC 1HKCA 3LP2A 4FPBA 4BQZA 4DQSA 3UIQA 1QQMA 3S41A 3ZEUB 2XY6A 4FWRA 5KRTA 3C94A 2DFFA 3TR8A 1HYSA 1RBUA 1SUQA 3NHGA 4DU4A 2E2NA 1B9FA 1SL0A 4CERA 5AQYA 3AVGA 1TGOA 4BR7A 3T7ZA 4F8RA 5GADP 5AZIA 4BACA 1NGBA 5AZJA 2NUBA 3QO9A 4DFPA 4UY8O 1ZBSA 1NWKA 2FLOA 5EOYA 3QNOA 1JLCA 5AQSA 1N32K 2YHBA 4JKBA 4B9VA 4FOIA 4JKDA 2F7TA 1ZYQA 4DV5K 4LF9K 4DTRA 2QW9A 4FJXA 1S5JA 4FWPA 3WQTA 4CIGA 3WNFA 4R5PA 2P9PB 3CQXA 3MEEA 3NH1A 2CH6A 4IBNA 3K0SA 2QXFA 3H3NO 2E2OA 3HT3A 4NB4A 2VWBA 2OPPA 1GLCG 2FBYA 3GE1A 1T6CA 4JRQA 1HJOA 2UXDK 4NCBA 2OPQA 1JXEA 1DKGD 2QWNA 5JS1A 1D9DA 4B1WB 1U04A 4FLTA 4CZHA 4G9ZA 1K8KB 4K43A 4CEZA 4CZJA 4GV6A 5F2RA 3CG7A 4JI0K 1RTDA 2YV0X 4I9LA 1ITGA 3H3OB 4CGJA 2BTFA 5JICA 1BI4A 3DLHA 2D1KA 3VQAA 3K9KA 1OH8A 2F9TA 3TTCA 3HP9A 1HPZA 3OBWA 4B1YB 4MDBA 3AVAA 3LM2A 2FBXA 1GLJO 3E9OA 4JI7K 1RBVA 3CI5A 3OJSA 2ZF5O 2JWLA 2NRZA 3IMXA 4WQ4C 2AP1A 2DY4A 4FW1A 2IVPA 4EIAA 3GBTA 1ESVA 3OYEA 4KHYA 4LH4A 3V6DA 2PBDA 3M1FA 1E4FT 3HJFA 2RHKA 4LSLA 4BR2A 4CEFA 4CJWA 4JNEA 3A5LC 3P38A 4B1VA 4EAHD 2J4RA 4DR1K 4PUOA 2VGMA 4J2DA 3ZT0A 1MU2A 4QS7A 4E7LA 4FLUA 2D0OA 4H5NA 4IZ9A 2GEMA 3A5MC 3ENOA 3TAFA 3GDQA 2QTDA 1P90A 2O4IA 1J54A 3S3OA 4DV1K 4KREA 3ATUA 4DSJA 2YI1A 3SUNA 1Q86O 3F5TA 4IOAL 5IT9O 4DR7K 3OYAA 4KHPK 4N47A 1KCFA 3VEXA 1VSLA 5GAGP 5M1OA 1G15A 3O9UA 4I2QA 1TUUA 3DI6A 2GBZA 3MXIA 3H46O 3SUQA 1H1VA 1ZC6A 4ILHA 3OY9A 1KVBA 2G8UA 2V7YA 2EHGA 5FRMA 1E3MA 4EP4A 4HWIA 2Q3SA 4DSKA 5BR9A 3HXMA 3ZEUA 5M1FA 1SL1A 3N4QA 4NXNK 3VA3A 2YCHA 2UXCK 3LAMA 4DTNA 5JVGL 1RTIA 4DF4A 2ZD1A 3AVBA 2QWOA 4M45A 3AVIA 4BQLA 5DM7L 1IKWA 3L3VA 2OPSA 4MLEA 4QOZB 1ZBLA 4A57A 3OBYA 5IWAK 1X9MA 1NKEA 5LMNK 3NE6A 4CK2A 3TSPA 2OPRA 3KK1A 1T05A 3EZWA 3N4PA 3ZSOA 1N5YA 1ASWA 2FSKA 2XY7A 4AM6A 1T6DA 3AO4A 3NH2A 1HRHA 1RBRA 5GAEP 1WBBA 2UU9K 4GV3A 4DV2K 4A5AA 3P5JA 4K8XA 1N33K 4M41A 3EEQA 4BR4A 3H1VX 1G99A 3LZJA 5CE3A 4BRGA 1ATRA 4JI5K 1ASVA 1TL1A 4WQ5C 3J80O 3O4QA 2D0PA 3AARA 3OHRA 2RF2A 4WE1A 3IS9A 5BRDA 3I0SA 4CVNE 5AJ3K 2Q1NA 2P5OA 3WEEB 4BRPA 4M3ZA 3VF6A 3L2WA 1W2BM 2PFUA 3A5OC 4YORA 3WNGA 1QQCA 2HNYA 1KC8O 2CGKA 4DF8A 1K8KA 4N41A 4FSVA 3I8BA 4IDKA 4C8NA 4BRLA 1EKEA 4ELTA 3PX6A 3SQ0A 3CQYA 1VSFA 2ASMA 1HNXK 5AFUH 2GTDA 1U48A 4XIUA 3THWA 2UYTA 4BDYA 4CBUA 2B4JA 3DLEA 4GY2B 3OYFA 4CI6A 4BGBA 1IBLK 3MN5A 3KD1E 2FF6A 4OKEA 3KWIA 2DFEA 5KGWA 3LZIA 2HBLA 1S22A 2CH5A 3O3GA 1NKBA 4CEQA 1NKCA 3SZ2A 5BRHA 2IS3A 4CJ5A 5HRRA 2NRHA 1ATNA 1BCOA 4JYAK 4BRKA 4FK2A 4YOUA 2YHAA 4O55A 3CCVN 2P9SA 1T44A 4CJKA 1NK5A 4DUYK 4X62K 4OPHA 1REVA 3MCAB 3K58A 3HSTB 3R1XA 3ATVA 3OYMA 4B3SK 3L2VA 3I0RA 3MN6A 3PSIA 4Z0UA 2NZTA 1JLFA 4K25A 5J1EA 1T8EA 3J81O 1YI2N 4A2BA 2VWKA 1EQYA 4FWKA 3I33A 3HOSA 1VQLN 2JWKA 4CHNA 1RBTA 3O9SA 3HM9A 5DM6L 1KLMA 3C95A 1UA1A 4N76A 3D0PA 4FJIA 1ATSA 1MDUB 3LL3A 1IKXA 2QKBA 3FFKB 1JLQA 4L8RB 4RW6A 2YNHA 4A2AA 3CJCA 3LWLA 3BGRA 1CLQA 4J2AA 4BRMA 4C23A 3DLKA 4BVPA 3ZETB 3ZT3A 2VQFK 4ZTFA 3F2KA 4BRCA 3TI0A 5KPZA 4CGGA 5C42A 1KVAA 4CGHA 2RN2A 5AQTA 3V9XA 4CJ3A 1RGIA 1VQKN 4I6MB 5AR0A 4ICLA 5HRSA 1OH5A 4H4MA 3SBTA 1QVFM 2ZJPL 1FW6A 3KLFA 1I39A 3T1HK 2P9LB 2X78A 1VSKA 1VQMN 1QSYA 3TTDA 3MMVA 4FK0A 4W5QA 5AQZA 3LWMA 4BRAA 3VQ5A 4B8CA 1JCFA 1LWCA 4BR9A 3K5MA 3ZSWA 1K6YA 4ID1A 5C24A 4PL8A 4RW7A 2O8FA 1LCUA 3VQ4A 1YT3A 2JLEA 1TAQA 5AQPA 2YKNA 1YTAA 1DTTA 1O13A 1HLUA 3K57A 5KGXA 2Q0RA 3ZSYA 1TK0A 4DLGA 4K42A 4WF9L 4YOTA 4H0YB 2QWMA 1XI1A 4RG8A 1RT1A 4FWOA 4OO1J 3C6AA 4L3QA 4KFBA 4DUZK 4ELUA 4JKCA 1IG8A 5KQDA 2P51A 2CGJA 4CBWA 3WEEA 3OYJA 2Z1IA 4CF9A 1C0GA 2ITGA 1ZXOA 4KHUA 3U6FA 4BGAA 5FLXO 3FZKA 3HPHA 4JI8K 4DSLA 3AO5A 3H6EA 4EZ9A 3G4SN 4CJQA 3UKRB 2A6AA 2IGIA 3ENBA 2IIRA 4E1MA 4KB1A 5JLHA 1A5WA 4AHSA 4XH4A 3VQ6A 1C0TA 2A41A 4IO9L 4KH4A 4FLZA 1NU0A 1HQUA 2YKMA 2O4GA 1X3NA 1S1UA 4YHHK 4DR2K 4CD3A 2OA8A 4M3TA 2DTUA 2G8KA 4PQUA 4CIEA 4E7JA 1WAFA 3RMCA 4IJAA 3L8BA 4AHVA 5T7BA 4AHUA 1KVCA 1A5VA 3DRSA 1TVRA 4BG9A 2V52B 4IEEA 2HVIA 4NYFA 4DR6K 1BWFO 4B3MK 1QE1A 4DFMA 1CZAN 2Z1HA 3AAPA 1LOTB 4B1XB 4B3OA 1TKZA 2VWJA 3PO4A 2GUPA 1VSDA 4IXCA 3DAWA 2B6AA 1OVQA 4JRPA 5JMVA 4LF5K 4LFAK 5LJWA 3ZSZA 4TSXA 4O5BA 1RILA 3CJ7A 3U9ZA 3K2PA 2O8BB 1N6QA 5MLCQ 3ZSRA 3AY9A 5J2PA 3EE9A 5ADXA 3TANA 3PSFA 3CJBA 3AVFA 4PY5A 1NGJA 4F4KA 2IVNA 1HYZA 3L0QA 1UWBA 2Q0UA 4LY7A 3AA5X 2V7ZA 3AVHA 4CF8A 3CFOA 5EY4A 5C10A 3RTVA 5EU7A 2A1RA 4KHQA 3HSCA 2IVOA 1I94K 1TUYA 3VGLA 2LSNA 4JEPA 1ZBUA 3ZETA 1VSJA 5FPMA 3U3YA 4KHSA 4B3RK 1YIJN 3CJ9A 3OS1A 4E1JA 1HNWK 1HNVA 4I6MA 2D0CA 3DWLA 1BGXT 4LC9B 2E88A 3VQEA 3VQ8A 4KH5A 1UAXA 5J2QA 3EKSA 1WSEA 4JKFA 2P9LA 3TAEA 2O8EB 5K14A 4DSIA 1O1WA 1CZBA 5AQFA 3OTOK 3PLAA 2G8FA 4O44A 3CFPA 4MO5A 3SUPA 4CHYA 3CCSN 5C15A 3ID6A 5AQMA 1OH6A 4OLBA 1TKTA 1TKXA 3K5OA 4ZTJA 3KD5E 3U4LA 1V4TA 4OPKA 2HBKA 3WXJA 1DLOA 3NF9A 4E89A 3CCQN 5SWMA 4BVOA 3RVCA 1SZ2A 2P9KB 1NJZA 2PYJA 3MDQA 1S1VA 3C6HA 3C0BA 3ZSXA 4KHWA 2A5XA 4BC3A 2FBTA 4CJRA 3FZHA 1NJXA 1CXQA 5BREA 1JLBA 1EWQA 4DS4A 3KHYA 1BL3A 4RWTA 1YITN 4Y1CA 3C7NA 3HTVA 3OJUA 3E9LA 3TSQA 1NGHA 3HL8A 1NK8A 5AQQA 2QWLA 3TABA 1Z6RA 1Q18A 5KPTA 3SBGA 3UKRA 5AQKA 2HHHK 5AQIA 5I3UA 1WB9A 3M8PA 4AILC 2HBMA 4NLCA 4U67L 3DXMB 3QEXA 4HHTA 4E3SA 1HYVA 3V1QA 1YHQN 1XQSC 1HQEA 3DRRA 5B8HA 3CYMA 2BANA 3EKUA 2JGUA 3CCRN 4I2PA 5CZ2A 3J7AP 4E7IA 4O5FA 3FR0A 4BRQA 2G8WA 4BR0A 4NCGA 3FZLA 2ZQBA 1Y64A 1C6VA 4LFCK 5I9EB 1GOAA 1S9EA 3M3ZA 4DV0K 3BDPA 1NGFA 2NLXA 4XEIA 3HP6A 1QSLA 4F3TA 4E7HA 2ATQA 4G1QA 3BP8A 3OYDA 4JK8A 4YDUC 3O9RA 2O8BA 4A5BA 1BG3A 1XUPO 1JLAA 4EHTA 3VQPA 1WNSA 3P83D 2ZJRL 4WYBA 1LW2A 5C2DA 3WXMB 1BU6O 4DKWA 1NJYA 2Q2RA 4W5TA 3ZSVA 4CEEA 3SQ2A 4B9TA 4JHDB 4N56A 2E5LK 4O0JA 4U7BA 4F9OA 4AH9A 4AHTA 5D3GA 4FPAA 4JLHA 2HHTA 2P9IB 4Q0BA 4FCYA 4DTSA 1LW0A 4BE2A 3TTFA 4DU1A 4CJVA 1GLBG 4XH1A 4CJLA 3O08A 4Z4IA 4KKOA 5C0YA 3CFRA 1NGAA 1VQNN 4IFVA 1HX1A 2ZM6K 3K59A 3CD6N 4IG3A 3CCEN 4NCAA 1S72N 3KWGA 4FWQA 4KHNA 1F21A 4BREA 2I7NA 3GOIA 3AVMA 3BZKA 4WFNL 2R7YA 4Z4CA 2Z1JA 3R3LA 3MWPA 2KW4A 2O8CB 3A0IX 3D2EB 3PY8A 3CC7N 2ZWHA 3SLCA 3CHWA 4DV4K 1RCHA 1DTQA 2P9NB 1VQ8N 1R59O 5A2QO 2KQ2A 3MN9A 1U6ZA 4CEOA 4PKIA 1XNQK 3AGKA 3HRGA 3AA4A 3MCPA 4QCLA 1YUWA 2W6KA 3I8DA 1VQ9N 1NK7A 1N8RO 3ZX3A 2OANA 4KRFA 4RW4A 2P9KA 4B1ZA 2E8AA 3I55N 4H5VA 5E41A 5LJVA 2HHQA 4KTQA 3LP0A 3NGIA 3TAMA 1JLEA 3QIOA 2QK9A 3OYBA 2Z1GA 1XHXA 4HCBA 1SAZA 4E19A 4JD2B 4WFAL 4DTPA 2QXLA 1BISA 3V81A 2B5JA 2XRIA 5KPRA 4OPJA 4I9QA 3SCXA 1B92A 3Q7BA 3OYCA 4PWDA 2GUIA 4JKEA 1K9MO 5AQVA 3TU5A 3WUHA 1X9JA 3O4WA 3L2RA 3VQCA 2P9PA 1VQ6N 3L4QA 3OW2M 1IBKK 3ASMA 3AO3A 3SV4A 4GKKK 2FBVA 3DXMA 3HZ6A 3WNEA 4CE9A 2KLAA 3O9QA 5E26A 1GLFO 5BN8A 1VHXA 3EO3A 1QQOA 1Q8IA 1YF5L 4R79A 3FE1A 4C8KA 3L2UA 4CHZA 4FL9A 1VSMA 4EP5A 3WXLA 3EY1A 2HOEA 5TKWA 1TYQB 1C1CA 1BQMA 4BC2A 3QFPA 2NRVA 4DTUA 5FPNA 5JVHL 3CERA 3JXUA 4DQ8A 1BCMA 5LMUK 2BE2A 4DQIA 4CJUA 4C8OA 2HHUA 3HO1A 2YJEA 3DMJA 3VA0A 2D5RA 1XMQK 4FO0A 1LWFA 3RR7A 1YAGA 3V9ZA 1T03A 2OTJN 2ZE2A 3KIOA 2RE2A 4M3WA 2W41A 3ULEB 2F96A 3SPYA 4CHPA 1X3MA 3AA2A 4CCHA 1LAWA 5I42A 4AQYK 2IC3A 3UE5A 1IO2A 3ULDA 1RDWX 2A42A 1ASUA 3FZMA 3LDSA 4MFBA 4JHDA 3KLHA 4ILGB 3WNHA 4Z4HA 1R0AA 3TSUA 5AQHA 3VEWA 4Q5VA 4H5TA 1L3UA 5KRSA 4FJGA 1FJGK 4IOXA 3O3HA 1BUPA 2P9IA 4FVMA 4ID5A 3PX4A 5AQJA 3UB5A 2HNDA 4WFBL 4CF0A 4PHTX 3CF5L 4H8KA 4GMJB 3GL1A 3LPTA 3NDKA 3B6PA 1WSFA 1YVNA 4KAZA 4CJSA 4OGEA 3ZX2A 4IOCL 4CZEA 1S3XA 3SQ4A 4BC5A 3V9WA 3IUCA 1NGCA 2PZSA 2OZSA 5M1NA 5HLFA 4H5WA 4W5RA 4O4GA 2KHOA 5ELZA 3KZBA 4BC4A 4C8LA 4MLHA 3LAKA 3D2EA 2OTLN 1WOQA 2O8CA 1JXBA 1RT7A 3LALA 4KI6A 4FYDA 3H45C 1SQKA 4X66K 4FJ9A 2P9NA 3PV8A 4CEAA 4DR4K 5HBMA 2FSJA 3CM5A 1YXQA 5LY3A 3E9PA 4DG1A 3CMAN 4Z4GA 4BWMA 3TWHA 3O9TA 3FGUA 4CEDA 2Y1JA 3C6UA 1UA0A 1JL1A 3O4NA 4B3TK 2QM1A 3NGYA 4CFCA 3F73A 1YJWN 4DV7K 4DQRA 4FW2A 5GIPA 4CGFA 1RDAA 1BA0A 4CESA 3LDPA 4YY3K 1K8AO 1NOYA 1X9WA 1RTJA 3MXJA 4CFDA 3H1QA 4HUEA 4FWLA 3QNNA 4JD2A 1NK6A 1QZ6A 3KJVA 2A40A 3LDOA 2P1JA 3NBPA 2ASPA 1OH7A 1UOCA 2H3GX 3G71N 3SUOA 4W5OA 3P39A 1LWEA 4BROA 4AF1A 4DB3A 3D6RA 3T69A 4X65K 3RRHA 4DTXA 4JI1K 2E6LA 3VMFB 3DLBA 1SKRA 4BRHA 4YFUA 1DGKN 2ZGZA 4DR3K 1QVGM 3B6OA 3JYTA 2WTUA 1D8YA 5BN9A 1Q9YA 2A3ZA 4MDAA 3SPZA 2AA4A 1GLDG 2VG5A 2HW3A 4FJKA 4CEBA 5AQOA 4H0XB 4BRDA 2F4VK 4BWJA 2PY5A 1EXQA 3B8AX 3VTIA 3MWTA 3O1WA 1TYQA 3KVGA 4LF7K 5AZIB 3IKMA 4YOVA 2QWRA 2Q36A 3T1YK 1Q7YO 4X64K 3SQ1A 5AQRA 4FZXC 4CZKA 4CD1A 3QICA 3VF4A 4FOEA 3QMLA 1SL2A 4LF4K 3THXB 4CW7B 1SKSA 4MO4A 3THYB 2IDOA 2GV9A 3V1RA 1EETA 5LL6Z 3ULEA 3CPWM 2HNZA 1BIUA 2NNWA 5J2NA 1QQNA 4LH5A 5BRFA 3D7EO 1VSIA 4HUGA 1TKDA 3NF7A 4M7YA 3I56N 3R6MA 4DTOA 4HCCA 1BOTO 1NGDA 4WQ4A 3CCJN 5E84A 2XY5A 1OVYA 4UQGA 1X9SA 4JK9A 2YNGA 2RPIA 5HP1A 5CYQA 3QB0A 4B08A 2KFZA 3SMPA 2AJQA 2V51B 3AVNA 3CJ1A 1Z05A 1NK4A 3NVMA 1BDGA 3D45A 1YJ9N 1JL2A 3IDHA 3WXKA 3HI0A 1HUXA 4HTLA 5FRNA 3AVKA 3CC4N 3L3UA 2HHXA 3C6TA 1N34K 5BPLA 2D0AA 2E6MA 4E7KA 3CXCM 3P4IA 3R9PA 1WLJA 3VQ9A 4BY9C 2PAVA 3G6EN 4JKGB 5HRNA 4CGIA 4EFHA 4IO8A 4BR5A 1KXPA 1Z25A 4KI4A 3NF8A 3CMEN 1C0MA 3H08A 4FLXA 4BE1A 4KTZA 3NCIA 3MK6A 3J7YP 1CXUA 2WFBA 3A2FA 5M1QA 4GW6A 2OZMA 2NRRA 4A61A 2VG6A 4GNIA 2VGNA 2HMIA 1S9GA 4CIFA 3FFIA 4B1UB 5AQXA 5KI6A 2HMPA 5JLFA 1BQNA 2D0BA 1EX4A 4ILJA 3AGRA 4JAXA 5H1SQ 4CZGA 1JCEA 2HBJA 4F3OA 4CF1A 1NGEA 4FWSA 4JI6K 3BUZB 3DXKB 2X6SA 3DLLL 1WSGA 1VRTA 5CZ1A 1NGIA 4FVUA 1IBMK 3VETA 4CFBA 4BDZA 3K9JA 1I3AA 3SAFA 1WSIA 1U45A 2P5GA 3JSMA 1J9AA 2UUAK 1EP4A 3IFRA 3OA9A 1MWMA 3SAHA 3QEWA 4E0DA 2UUCK 2ETJA 4CFAA 3M5RA 4EZ6A 3RSEB 1ZBIA 1WUAA 3MN7A 1ZBHA 1FK9A 1RTHA 4FM2A 2VYPA 1Q82O 1K73O 3P31A 2E4LA 3OS2A 1W9HA 3P1GA 4RW9A 4WQ5A 5AQNA 4DLEA 1DEJA 4IJNA 1QTMA
chains in the Genus database with same CATH topology
2KW4A 3PY8A 3L2VA 3I0RA 4IKFA 4Z0UA 2VG7A 3NFAA 3ITHA 1JLFA 4H4OA 5DMRA 4DTJA 3DYAA 1RCHA 1DTQA 4B8AB 5J1EA 2W42A 1T8EA 3PX0A 3LPUA 2KQ2A 5FROA 4CEOA 2VWKA 2KTQA 4KTWA 3DLGA 3AA4A 3VN5A 4QCLA 3M8RA 1L3VA 4FJJA 1C1BA 4J2EA 2KZMA 3QIPA 4CHNA 1RBTA 3I8DA 3HM9A 1KLMA 3TAGA 1NK7A 3RMAA 4KRFA 3C95A 1UA1A 2G8HA 2HB5A 4RW4A 4CJTA 3D0PA 4FJIA 3NGZA 4FZYA 5HROA 4FM1A 1IKXA 4OVLA 5E41A 2QKBA 3V9UA 2XHBA 4FXDA 2HHQA 4KTQA 1JLQA 3LP0A 3NGIA 3OS0A 1HMVA 4OGCA 3TAMA 4CK3A 1JLEA 1QS4A 3QIOA 3S9HA 4L8RB 3OYLA 4RW6A 3OYBA 2QK9A 2Z1GA 3QEIA 2YNHA 2BGGA 1XHXA 4HCBA 3LWLA 3BGRA 4E19A 1CLQA 4NYNA 4DTPA 3G10A 4J2AA 3T19A 4Z4EA 3SYZA 1HNIA 1BISA 3MEDA 3ZCMA 1C1AA 2B5JA 3OYIA 3V81A 4FM0A 2XRIA 3DLKA 3ZT3A 3K5LA 1BI4B 1RT2A 1RDDA 3M8QA 1RDBA 4M3YA 4B9UA 1VSEA 4OPJA 2YNIA 3SCXA 1B92A 3DLRA 4ZTFA 4I9QA 2X74A 3OYCA 3L2QA 3TI0A 4PWDA 4CGGA 5C42A 3KK2A 4M42A 1KVAA 4CGHA 2RN2A 1L3SA 3MECA 2GUIA 3V9XA 1TAUA 4CJ3A 1IKVA 1KSPA 3L2RA 1FKOA 3VQCA 3THVA 3QESA 3DM2A 4OKKA 4FJMA 1BIZA 4ICLA 3S3MA 3ASMA 1QHTA 5HRSA 3ZT4A 4H4MA 3AO3A 3SV4A 4DQQA 4OLAA 1IH7A 3AO2A 2FBVA 3WNEA 4CE9A 3KLFA 1I39A 1TK5A 2IAJA 2X78A 4CJPA 1VSKA 3HVTA 1QSYA 3TAQA 1Q8IA 4C8MA 3VQBA 4C8KA 4FK0A 4W5QA 3L2UA 3LWMA 4CHZA 1YTUA 3OYHA 3VQ5A 1SV5A 1W0HA 1VSMA 4B8CA 4CGDA 4EP5A 3DRPA 5JS2A 1KTQA 4PA1A 3V9SA 4CJEA 3E01A 5J2MA 1HJRA 2A1SA 3MAQA 1LWCA 3K5MA 3ZSWA 3EY1A 4B9LA 1K6YA 3K5NA 4OJRA 1C1CA 1BQMA 1IG9A 3OYKA 4ID1A 5C24A 3ZSQA 1U49A 3SNNA 4DTUA 3QINA 4RW7A 2KZZA 3VQ4A 1LAVA 1VSHA 1YT3A 2JLEA 4B9MA 4HVJA 4M3XA 1TAQA 1RT3A 1BCMA 2YKNA 4CECA 2BE2A 1YTAA 1DTTA 4DQIA 4CJUA 5KTQA 4C8OA 2HHUA 3NAEA 3HO1A 4GVMA 5KGXA 3DMJA 3K57A 3VA0A 3ZSYA 1TK0A 2D5RA 1GOBA 2WOMA 4DLGA 1VRUA 2QKKA 4F2RA 1NOZA 3SV3A 1LWFA 3IG1A 1XI1A 3RR7A 3QLHA 4RG8A 3V9ZA 1RT1A 1T03A 2ZE2A 3KIOA 4KFBA 4FLVA 4ELUA 4M3WA 5CY4A 2P51A 2F96A 3SPYA 4HTUA 3AV9A 4CHPA 1D5AA 3OYJA 3MXMA 2Z1IA 4CF9A 3QERA 2ITGA 2EX3A 4IFYA 3QEVA 3AA2A 1A5XA 4CCHA 4KHUA 1XC9A 4MQ3A 3V4IA 3U6FA 2XO7A 1LAWA 3U3GA 4DTMA 3HPHA 5I42A 4DSLA 2IC3A 1IO2A 3KLEA 3ULDA 3AO5A 3ZT1A 1ASUA 4JS5A 3LP2A 4DQSA 1KLNA 4EZ9A 3UIQA 3LDSA 4MFBA 4N76A 3KLHA 4YNQA 2XY6A 5KRTA 3WNHA 3C94A 1C0UA 2DFFA 3TR8A 4CJQA 3NF6A 1RT4A 4Z4HA 1R0AA 1HYSA 1RBUA 1SUQA 4Q5VA 4DFKA 3T1AA 4F2SA 4B9NA 2IGIA 3NHGA 4DU4A 1L3UA 1B9FA 5KRSA 4E1MA 4FJGA 1SL0A 4CERA 4KB1A 5DK5A 3O3HA 1Y97A 4FLYA 4FVMA 3HK2A 1A5WA 4ID5A 4AHSA 3PX4A 3AVGA 1TGOA 3VQ6A 4F8RA 1C0TA 2HNDA 4BACA 4FLZA 1HQUA 4CF0A 1ZBFA 2YKMA 2O4GA 1S1UA 2NUBA 3QO9A 4GMJB 3LPTA 4H8KA 4DFPA 1JLGA 3MEGA 3NDKA 4DU3A 4CJFA 4FLWA 2G8VA 1FXXA 3B6PA 3AVCA 1WSFA 3QNOA 2DTUA 2OA8A 1JLCA 4M3TA 2YHBA 4CF2A 2G8KA 4KAZA 4PQUA 4CJSA 4CIEA 4E7JA 4I7FA 4B9VA 2G8IA 1WAFA 3RMCA 4OGEA 4J2BA 3PO5A 1ZYQA 1NK9A 4LSNA 3L8BA 3SQ4A 3V9WA 4AHVA 5T7BA 4AHUA 1KVCA 1A5VA 3DRSA 5FDLA 1Q9XA 1TVRA 4DTRA 2PZSA 2OZSA 1S5JA 4FJXA 3T3FA 4NYFA 4O0IA 2HVIA 4CIGA 5HLFA 1QE1A 3LANA 4W5RA 3WNFA 4O4GA 2DFHA 3KKSA 4R5PA 4DFMA 5CYMA 2Z1HA 4C8LA 4CJ4A 3LAKA 3MEEA 1WSJA 4B3OA 1TKZA 1JXBA 1RT7A 3LALA 4IBNA 3NH1A 2VWJA 2I5JA 1NJWA 1L3TA 4KI6A 1VK0A 3KLIA 3G0ZA 1U47A 3PO4A 1VSDA 4FYDA 2QXFA 4FJ9A 1T7PA 3PV8A 4CEAA 2B6AA 4JRPA 5HBMA 3CM5A 3F9KA 4Z4GA 4DG1A 3HT3A 4BWMA 3TWHA 4CEDA 2Y1JA 3C6UA 2OPPA 2FBYA 3ZSZA 1UA0A 4TSXA 4O5BA 3KLGA 1RILA 1JL1A 3O4NA 4JRQA 3SJJA 3K2PA 3O3FA 1N6QA 3ISNC 1QSSA 3NGYA 4CFCA 3F73A 4BDPA 4NCBA 3ZSRA 2OPQA 2X6NA 1JXEA 4DQRA 5J2PA 4FW2A 5JS1A 4CGFA 1D9DA 3TANA 1RDAA 3AVFA 2PYLA 4PY5A 1U04A 4CESA 1NOYA 4FLTA 4F4KA 3TARA 1HYZA 1J53A 2HHVA 1X9WA 1RTJA 1UWBA 3MXJA 4CEZA 4LY7A 3AA5X 4CFDA 2OYQA 3V1OA 3AVHA 4HUEA 1S1TA 4CF8A 3QNNA 3CG7A 3CFOA 3RTVA 2A1RA 5EU7A 4KHQA 1NK6A 1RTDA 3M8SA 1XWLA 2YV0X 1S1XA 2LSNA 1ITGA 4I9LA 3KJVA 4CGJA 2HVHA 3ZT2A 1ZBUA 2P1JA 3NBPA 1BI4A 1VSJA 1UOCA 3DLHA 3VQAA 3U3YA 2KFNA 3SUOA 4KHSA 4W5OA 3OS1A 1LWEA 1HNVA 3HP9A 1HPZA 3KKRA 3OYNA 3QETA 4FZZA 2D0CA 3AVAA 4DQPA 1BGXT 4DTXA 3RRHA 2E6LA 2FBXA 3AVJA 1KFDA 3DLBA 3VQEA 1SKRA 3VQ8A 1RBVA 3OJSA 4YFUA 2DY4A 1UAXA 4FW1A 4AHCA 3B6OA 3JYTA 3S3NA 1NK0A 1D8YA 3OYGA 3HVRA 4FJNA 3KK3A 5J2QA 1WSEA 3OYEA 4KHYA 1Q9YA 4LH4A 3V6DA 3TAEA 3SPZA 5K14A 1J5OA 3HJFA 4DSIA 1O1WA 1CZBA 4LSLA 2VG5A 2HW3A 4Z4FA 4CEFA 4FJKA 4CJWA 4CEBA 2G8FA 4O44A 4BWJA 2PY5A 4PUOA 3CFPA 4J2DA 1RBSA 3ZT0A 3SUPA 4CHYA 1EXQA 4KB0A 1MU2A 4E7LA 4FLUA 1Z26A 2HHWA 4B9SA 4OLBA 1KFSA 1TKTA 1TKXA 3K5OA 4ZTJA 3KD5E 3TAFA 4OPKA 1L5UA 2O4IA 1DLOA 1J54A 4OKJA 3QEPA 3S3OA 4CHQA 4KREA 3SQ1A 4M3UA 3NF9A 4E89A 4DSJA 3SUNA 3EYZA 5SWMA 4LD0A 4FZXC 1GOCA 3CQ8A 4W5NA 1NJZA 1SL2A 2PYJA 1SKSA 1S1VA 3ZSXA 2IDOA 3OYAA 4N47A 4KHWA 1KCFA 1VSLA 2GV9A 3VQ7A 3V1RA 1G15A 2HHSA 2IOCA 2FBTA 3LP3A 4I2QA 4CJRA 4FK4A 1EETA 3DI6A 1NJXA 2HNZA 2GBZA 3MXIA 3DOKA 1BIUA 1CXQA 2F8TA 5J2NA 4DMNA 4LH5A 4HUGA 3SUQA 1TKDA 1JLBA 1VSIA 1D9FA 3NF7A 4DS4A 3IAYA 1TK8A 3OY9A 1BL3A 1KVBA 2G8UA 4DTOA 4Y1CA 4BE0A 4HCCA 2EHGA 3OJUA 5FRMA 5HRPA 4EP4A 1RT5A 2Q3SA 4DSKA 3HXMA 2XY5A 1S1WA 1WN7A 4UQGA 3HL8A 1NK8A 1X9SA 2YNGA 4E1NA 2RPIA 5HP1A 3TABA 5CYQA 1SL1A 4B08A 2KFZA 2AJQA 1FKPA 3VA3A 1B9DA 1LV5A 5I3UA 3CM6A 4Z4IA 3AVNA 3LAMA 3M8PA 3DOLA 4DTNA 4AILC 1IKYA 1S6PA 4DS5A 1RTIA 2XY8A 1NK4A 3QEXA 4KPYA 4DF4A 4HHTA 2ZD1A 3AVBA 3D45A 1JL2A 4M45A 1HYVA 2YNFA 4E3SA 3AVIA 1WSHA 3V1QA 5FRNA 1CZ9A 3SI6A 1XHZA 1HQEA 2WONA 3DRRA 1IKWA 3L3VA 4QAGA 3AVKA 5C25A 3RMBA 3L3UA 2HHXA 1ZBIA 2OPSA 3CYMA 3KTQA 2BANA 4FJHA 4QOZB 1ZBLA 1X9MA 2JGUA 2F8SA 3C6TA 1NKEA 3NH0A 1KRPA 2D0AA 2E6MA 4I2PA 5CZ2A 4CK2A 3NE6A 2OPRA 4E7KA 2Y1IA 2FC0A 3KK1A 3TAPA 1T05A 4E7IA 3AO1A 3EZ5A 1WLJA 3VQ9A 4M3RA 4KO0A 3ZSOA 4HUFA 2BDPA 1N5YA 2G8WA 1RT6A 5HRNA 1ASWA 4CGIA 4NCGA 2ZQBA 2XY7A 4ELVA 1X1PA 4KV8A 3AO4A 1C6VA 1Z25A 3NH2A 3NF8A 4KI4A 1HRHA 1C0MA 1RBRA 3H08A 3VQQA 4FLXA 4BE1A 4KTZA 3NCIA 1GOAA 1CXUA 3A2FA 3P5JA 1S9EA 4K8XA 4GW6A 1TV6A 3AVLA 3BDPA 4JS4A 2OZMA 4M41A 3HP6A 2VG6A 3ALYA 1QSLA 4F3TA 3LZJA 4E7HA 2ATQA 3RR8A 1ASVA 1TL1A 2HMIA 4G1QA 1S9GA 3O4QA 3FFIA 4CIFA 3OYDA 5KI6A 2RF2A 3LP1A 4WE1A 3IS9A 1BQNA 4N5SA 3I0SA 2D0BA 1EX4A 2P5OA 1JLAA 3VQPA 4FJ7A 4M3ZA 1WNSA 3P83D 3L2WA 1LW2A 4F3OA 3WNGA 4CF1A 1QQCA 2HNYA 3VQDA 4CHOA 1NJYA 2X6SA 4AHRA 1JKHA 1VRTA 1WSGA 4DF8A 4N41A 5CZ1A 4W5TA 1RDCA 3ZSVA 4IDKA 4C8NA 4CEEA 1TL3A 4RW8A 3SQ2A 4B9TA 1EKEA 4DSEA 4ELTA 4CFBA 4N56A 3PX6A 3SQ0A 4BDZA 4FJ8A 1VSFA 4O0JA 1U48A 4XIUA 1I3AA 4AH9A 4AHTA 1U4BA 4BDYA 1WSIA 1U45A 5D3GA 2P5GA 2B4JA 3DLEA 3JSMA 1J9AA 3OYFA 1EP4A 4JLHA 2HHTA 4Q0BA 4IG0A 3QEWA 4FCYA 4DTSA 3KD1E 4OKEA 4E0DA 2ETJA 1LW0A 4CFAA 4BE2A 3HPOA 3OVNA 2DFEA 4DU1A 5KGWA 4CJVA 3LZIA 3O3GA 1NKBA 3RMDA 4CEQA 4CJLA 4EZ6A 1NKCA 3SZ2A 2IS3A 3IRXA 3HYFA 4KKOA 3HPGA 5HRRA 4CJ5A 3CFRA 1BCOA 4DFJA 3RWUA 4IFVA 4FJ5A 4FJLA 4FK2A 3K59A 1S6QA 4ZHRA 1ZBHA 1FK9A 1RTHA 1RNHA 2YHAA 4IG3A 4FM2A 4DWIA 4NCAA 4DSFA 4O55A 4KHNA 1F21A 4CJKA 1NK5A 4CK1A 2E4LA 1REVA 3AVMA 3PUFA 1W9HA 1WAJA 3P1GA 1YVUA 3OS2A 1BHLA 4RW9A 3K58A 4DLEA 4Y1DA 2R7YA 4Z4CA 1SKWA 3RRGA 3HSTB 2RKIA 3AA3A 2Z1JA 5SZTA 3OYMA 1QTMA 4K8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW4 A;  3PY8 A;  3L2V A;  3I0R A;  4IKF A;  4Z0U A;  2VG7 A;  3NFA A;  3ITH A;  1JLF A;  4H4O A;  5DMR A;  4DTJ A;  3DYA A;  1RCH A;  1DTQ A;  4B8A B;  5J1E A;  2W42 A;  1T8E A;  3PX0 A;  3LPU A;  2KQ2 A;  5FRO A;  4CEO A;  2VWK A;  2KTQ A;  4KTW A;  3DLG A;  3AA4 A;  3VN5 A;  4QCL A;  3M8R A;  1L3V A;  4FJJ A;  1C1B A;  4J2E A;  2KZM A;  3QIP A;  4CHN A;  1RBT A;  3I8D A;  3HM9 A;  1KLM A;  3TAG A;  1NK7 A;  3RMA A;  4KRF A;  3C95 A;  1UA1 A;  2G8H A;  2HB5 A;  4RW4 A;  4CJT A;  3D0P A;  4FJI A;  3NGZ A;  4FZY A;  5HRO A;  4FM1 A;  1IKX A;  4OVL A;  5E41 A;  2QKB A;  3V9U A;  2XHB A;  4FXD A;  2HHQ A;  4KTQ A;  1JLQ A;  3LP0 A;  3NGI A;  3OS0 A;  1HMV A;  4OGC A;  3TAM A;  4CK3 A;  1JLE A;  1QS4 A;  3QIO A;  3S9H A;  4L8R B;  3OYL A;  4RW6 A;  3OYB A;  2QK9 A;  2Z1G A;  3QEI A;  2YNH A;  2BGG A;  1XHX A;  4HCB A;  3LWL A;  3BGR A;  4E19 A;  1CLQ A;  4NYN A;  4DTP A;  3G10 A;  4J2A A;  3T19 A;  4Z4E A;  3SYZ A;  1HNI A;  1BIS A;  3MED A;  3ZCM A;  1C1A A;  2B5J A;  3OYI A;  3V81 A;  4FM0 A;  2XRI A;  3DLK A;  3ZT3 A;  3K5L A;  1BI4 B;  1RT2 A;  1RDD A;  3M8Q A;  1RDB A;  4M3Y A;  4B9U A;  1VSE A;  4OPJ A;  2YNI A;  3SCX A;  1B92 A;  3DLR A;  4ZTF A;  4I9Q A;  2X74 A;  3OYC A;  3L2Q A;  3TI0 A;  4PWD A;  4CGG A;  5C42 A;  3KK2 A;  4M42 A;  1KVA A;  4CGH A;  2RN2 A;  1L3S A;  3MEC A;  2GUI A;  3V9X A;  1TAU A;  4CJ3 A;  1IKV A;  1KSP A;  3L2R A;  1FKO A;  3VQC A;  3THV A;  3QES A;  3DM2 A;  4OKK A;  4FJM A;  1BIZ A;  4ICL A;  3S3M A;  3ASM A;  1QHT A;  5HRS A;  3ZT4 A;  4H4M A;  3AO3 A;  3SV4 A;  4DQQ A;  4OLA A;  1IH7 A;  3AO2 A;  2FBV A;  3WNE A;  4CE9 A;  3KLF A;  1I39 A;  1TK5 A;  2IAJ A;  2X78 A;  4CJP A;  1VSK A;  3HVT A;  1QSY A;  3TAQ A;  1Q8I A;  4C8M A;  3VQB A;  4C8K A;  4FK0 A;  4W5Q A;  3L2U A;  3LWM A;  4CHZ A;  1YTU A;  3OYH A;  3VQ5 A;  1SV5 A;  1W0H A;  1VSM A;  4B8C A;  4CGD A;  4EP5 A;  3DRP A;  5JS2 A;  1KTQ A;  4PA1 A;  3V9S A;  4CJE A;  3E01 A;  5J2M A;  1HJR A;  2A1S A;  3MAQ A;  1LWC A;  3K5M A;  3ZSW A;  3EY1 A;  4B9L A;  1K6Y A;  3K5N A;  4OJR A;  1C1C A;  1BQM A;  1IG9 A;  3OYK A;  4ID1 A;  5C24 A;  3ZSQ A;  1U49 A;  3SNN A;  4DTU A;  3QIN A;  4RW7 A;  2KZZ A;  3VQ4 A;  1LAV A;  1VSH A;  1YT3 A;  2JLE A;  4B9M A;  4HVJ A;  4M3X A;  1TAQ A;  1RT3 A;  1BCM A;  2YKN A;  4CEC A;  2BE2 A;  1YTA A;  1DTT A;  4DQI A;  4CJU A;  5KTQ A;  4C8O A;  2HHU A;  3NAE A;  3HO1 A;  4GVM A;  5KGX A;  3DMJ A;  3K57 A;  3VA0 A;  3ZSY A;  1TK0 A;  2D5R A;  1GOB A;  2WOM A;  4DLG A;  1VRU A;  2QKK A;  4F2R A;  1NOZ A;  3SV3 A;  1LWF A;  3IG1 A;  1XI1 A;  3RR7 A;  3QLH A;  4RG8 A;  3V9Z A;  1RT1 A;  1T03 A;  2ZE2 A;  3KIO A;  4KFB A;  4FLV A;  4ELU A;  4M3W A;  5CY4 A;  2P51 A;  2F96 A;  3SPY A;  4HTU A;  3AV9 A;  4CHP A;  1D5A A;  3OYJ A;  3MXM A;  2Z1I A;  4CF9 A;  3QER A;  2ITG A;  2EX3 A;  4IFY A;  3QEV A;  3AA2 A;  1A5X A;  4CCH A;  4KHU A;  1XC9 A;  4MQ3 A;  3V4I A;  3U6F A;  2XO7 A;  1LAW A;  3U3G A;  4DTM A;  3HPH A;  5I42 A;  4DSL A;  2IC3 A;  1IO2 A;  3KLE A;  3ULD A;  3AO5 A;  3ZT1 A;  1ASU A;  4JS5 A;  3LP2 A;  4DQS A;  1KLN A;  4EZ9 A;  3UIQ A;  3LDS A;  4MFB A;  4N76 A;  3KLH A;  4YNQ A;  2XY6 A;  5KRT A;  3WNH A;  3C94 A;  1C0U A;  2DFF A;  3TR8 A;  4CJQ A;  3NF6 A;  1RT4 A;  4Z4H A;  1R0A A;  1HYS A;  1RBU A;  1SUQ A;  4Q5V A;  4DFK A;  3T1A A;  4F2S A;  4B9N A;  2IGI A;  3NHG A;  4DU4 A;  1L3U A;  1B9F A;  5KRS A;  4E1M A;  4FJG A;  1SL0 A;  4CER A;  4KB1 A;  5DK5 A;  3O3H A;  1Y97 A;  4FLY A;  4FVM A;  3HK2 A;  1A5W A;  4ID5 A;  4AHS A;  3PX4 A;  3AVG A;  1TGO A;  3VQ6 A;  4F8R A;  1C0T A;  2HND A;  4BAC A;  4FLZ A;  1HQU A;  4CF0 A;  1ZBF A;  2YKM A;  2O4G A;  1S1U A;  2NUB A;  3QO9 A;  4GMJ B;  3LPT A;  4H8K A;  4DFP A;  1JLG A;  3MEG A;  3NDK A;  4DU3 A;  4CJF A;  4FLW A;  2G8V A;  1FXX A;  3B6P A;  3AVC A;  1WSF A;  3QNO A;  2DTU A;  2OA8 A;  1JLC A;  4M3T A;  2YHB A;  4CF2 A;  2G8K A;  4KAZ A;  4PQU A;  4CJS A;  4CIE A;  4E7J A;  4I7F A;  4B9V A;  2G8I A;  1WAF A;  3RMC A;  4OGE A;  4J2B A;  3PO5 A;  1ZYQ A;  1NK9 A;  4LSN A;  3L8B A;  3SQ4 A;  3V9W A;  4AHV A;  5T7B A;  4AHU A;  1KVC A;  1A5V A;  3DRS A;  5FDL A;  1Q9X A;  1TVR A;  4DTR A;  2PZS A;  2OZS A;  1S5J A;  4FJX A;  3T3F A;  4NYF A;  4O0I A;  2HVI A;  4CIG A;  5HLF A;  1QE1 A;  3LAN A;  4W5R A;  3WNF A;  4O4G A;  2DFH A;  3KKS A;  4R5P A;  4DFM A;  5CYM A;  2Z1H A;  4C8L A;  4CJ4 A;  3LAK A;  3MEE A;  1WSJ A;  4B3O A;  1TKZ A;  1JXB A;  1RT7 A;  3LAL A;  4IBN A;  3NH1 A;  2VWJ A;  2I5J A;  1NJW A;  1L3T A;  4KI6 A;  1VK0 A;  3KLI A;  3G0Z A;  1U47 A;  3PO4 A;  1VSD A;  4FYD A;  2QXF A;  4FJ9 A;  1T7P A;  3PV8 A;  4CEA A;  2B6A A;  4JRP A;  5HBM A;  3CM5 A;  3F9K A;  4Z4G A;  4DG1 A;  3HT3 A;  4BWM A;  3TWH A;  4CED A;  2Y1J A;  3C6U A;  2OPP A;  2FBY A;  3ZSZ A;  1UA0 A;  4TSX A;  4O5B A;  3KLG A;  1RIL A;  1JL1 A;  3O4N A;  4JRQ A;  3SJJ A;  3K2P A;  3O3F A;  1N6Q A;  3ISN C;  1QSS A;  3NGY A;  4CFC A;  3F73 A;  4BDP A;  4NCB A;  3ZSR A;  2OPQ A;  2X6N A;  1JXE A;  4DQR A;  5J2P A;  4FW2 A;  5JS1 A;  4CGF A;  1D9D A;  3TAN A;  1RDA A;  3AVF A;  2PYL A;  4PY5 A;  1U04 A;  4CES A;  1NOY A;  4FLT A;  4F4K A;  3TAR A;  1HYZ A;  1J53 A;  2HHV A;  1X9W A;  1RTJ A;  1UWB A;  3MXJ A;  4CEZ A;  4LY7 A;  3AA5 X;  4CFD A;  2OYQ A;  3V1O A;  3AVH A;  4HUE A;  1S1T A;  4CF8 A;  3QNN A;  3CG7 A;  3CFO A;  3RTV A;  2A1R A;  5EU7 A;  4KHQ A;  1NK6 A;  1RTD A;  3M8S A;  1XWL A;  2YV0 X;  1S1X A;  2LSN A;  1ITG A;  4I9L A;  3KJV A;  4CGJ A;  2HVH A;  3ZT2 A;  1ZBU A;  2P1J A;  3NBP A;  1BI4 A;  1VSJ A;  1UOC A;  3DLH A;  3VQA A;  3U3Y A;  2KFN A;  3SUO A;  4KHS A;  4W5O A;  3OS1 A;  1LWE A;  1HNV A;  3HP9 A;  1HPZ A;  3KKR A;  3OYN A;  3QET A;  4FZZ A;  2D0C A;  3AVA A;  4DQP A;  1BGX T;  4DTX A;  3RRH A;  2E6L A;  2FBX A;  3AVJ A;  1KFD A;  3DLB A;  3VQE A;  1SKR A;  3VQ8 A;  1RBV A;  3OJS A;  4YFU A;  2DY4 A;  1UAX A;  4FW1 A;  4AHC A;  3B6O A;  3JYT A;  3S3N A;  1NK0 A;  1D8Y A;  3OYG A;  3HVR A;  4FJN A;  3KK3 A;  5J2Q A;  1WSE A;  3OYE A;  4KHY A;  1Q9Y A;  4LH4 A;  3V6D A;  3TAE A;  3SPZ A;  5K14 A;  1J5O A;  3HJF A;  4DSI A;  1O1W A;  1CZB A;  4LSL A;  2VG5 A;  2HW3 A;  4Z4F A;  4CEF A;  4FJK A;  4CJW A;  4CEB A;  2G8F A;  4O44 A;  4BWJ A;  2PY5 A;  4PUO A;  3CFP A;  4J2D A;  1RBS A;  3ZT0 A;  3SUP A;  4CHY A;  1EXQ A;  4KB0 A;  1MU2 A;  4E7L A;  4FLU A;  1Z26 A;  2HHW A;  4B9S A;  4OLB A;  1KFS A;  1TKT A;  1TKX A;  3K5O A;  4ZTJ A;  3KD5 E;  3TAF A;  4OPK A;  1L5U A;  2O4I A;  1DLO A;  1J54 A;  4OKJ A;  3QEP A;  3S3O A;  4CHQ A;  4KRE A;  3SQ1 A;  4M3U A;  3NF9 A;  4E89 A;  4DSJ A;  3SUN A;  3EYZ A;  5SWM A;  4LD0 A;  4FZX C;  1GOC A;  3CQ8 A;  4W5N A;  1NJZ A;  1SL2 A;  2PYJ A;  1SKS A;  1S1V A;  3ZSX A;  2IDO A;  3OYA A;  4N47 A;  4KHW A;  1KCF A;  1VSL A;  2GV9 A;  3VQ7 A;  3V1R A;  1G15 A;  2HHS A;  2IOC A;  2FBT A;  3LP3 A;  4I2Q A;  4CJR A;  4FK4 A;  1EET A;  3DI6 A;  1NJX A;  2HNZ A;  2GBZ A;  3MXI A;  3DOK A;  1BIU A;  1CXQ A;  2F8T A;  5J2N A;  4DMN A;  4LH5 A;  4HUG A;  3SUQ A;  1TKD A;  1JLB A;  1VSI A;  1D9F A;  3NF7 A;  4DS4 A;  3IAY A;  1TK8 A;  3OY9 A;  1BL3 A;  1KVB A;  2G8U A;  4DTO A;  4Y1C A;  4BE0 A;  4HCC A;  2EHG A;  3OJU A;  5FRM A;  5HRP A;  4EP4 A;  1RT5 A;  2Q3S A;  4DSK A;  3HXM A;  2XY5 A;  1S1W A;  1WN7 A;  4UQG A;  3HL8 A;  1NK8 A;  1X9S A;  2YNG A;  4E1N A;  2RPI A;  5HP1 A;  3TAB A;  5CYQ A;  1SL1 A;  4B08 A;  2KFZ A;  2AJQ A;  1FKP A;  3VA3 A;  1B9D A;  1LV5 A;  5I3U A;  3CM6 A;  4Z4I A;  3AVN A;  3LAM A;  3M8P A;  3DOL A;  4DTN A;  4AIL C;  1IKY A;  1S6P A;  4DS5 A;  1RTI A;  2XY8 A;  1NK4 A;  3QEX A;  4KPY A;  4DF4 A;  4HHT A;  2ZD1 A;  3AVB A;  3D45 A;  1JL2 A;  4M45 A;  1HYV A;  2YNF A;  4E3S A;  3AVI A;  1WSH A;  3V1Q A;  5FRN A;  1CZ9 A;  3SI6 A;  1XHZ A;  1HQE A;  2WON A;  3DRR A;  1IKW A;  3L3V A;  4QAG A;  3AVK A;  5C25 A;  3RMB A;  3L3U A;  2HHX A;  1ZBI A;  2OPS A;  3CYM A;  3KTQ A;  2BAN A;  4FJH A;  4QOZ B;  1ZBL A;  1X9M A;  2JGU A;  2F8S A;  3C6T A;  1NKE A;  3NH0 A;  1KRP A;  2D0A A;  2E6M A;  4I2P A;  5CZ2 A;  4CK2 A;  3NE6 A;  2OPR A;  4E7K A;  2Y1I A;  2FC0 A;  3KK1 A;  3TAP A;  1T05 A;  4E7I A;  3AO1 A;  3EZ5 A;  1WLJ A;  3VQ9 A;  4M3R A;  4KO0 A;  3ZSO A;  4HUF A;  2BDP A;  1N5Y A;  2G8W A;  1RT6 A;  5HRN A;  1ASW A;  4CGI A;  4NCG A;  2ZQB A;  2XY7 A;  4ELV A;  1X1P A;  4KV8 A;  3AO4 A;  1C6V A;  1Z25 A;  3NH2 A;  3NF8 A;  4KI4 A;  1HRH A;  1C0M A;  1RBR A;  3H08 A;  3VQQ A;  4FLX A;  4BE1 A;  4KTZ A;  3NCI A;  1GOA A;  1CXU A;  3A2F A;  3P5J A;  1S9E A;  4K8X A;  4GW6 A;  1TV6 A;  3AVL A;  3BDP A;  4JS4 A;  2OZM A;  4M41 A;  3HP6 A;  2VG6 A;  3ALY A;  1QSL A;  4F3T A;  3LZJ A;  4E7H A;  2ATQ A;  3RR8 A;  1ASV A;  1TL1 A;  2HMI A;  4G1Q A;  1S9G A;  3O4Q A;  3FFI A;  4CIF A;  3OYD A;  5KI6 A;  2RF2 A;  3LP1 A;  4WE1 A;  3IS9 A;  1BQN A;  4N5S A;  3I0S A;  2D0B A;  1EX4 A;  2P5O A;  1JLA A;  3VQP A;  4FJ7 A;  4M3Z A;  1WNS A;  3P83 D;  3L2W A;  1LW2 A;  4F3O A;  3WNG A;  4CF1 A;  1QQC A;  2HNY A;  3VQD A;  4CHO A;  1NJY A;  2X6S A;  4AHR A;  1JKH A;  1VRT A;  1WSG A;  4DF8 A;  4N41 A;  5CZ1 A;  4W5T A;  1RDC A;  3ZSV A;  4IDK A;  4C8N A;  4CEE A;  1TL3 A;  4RW8 A;  3SQ2 A;  4B9T A;  1EKE A;  4DSE A;  4ELT A;  4CFB A;  4N56 A;  3PX6 A;  3SQ0 A;  4BDZ A;  4FJ8 A;  1VSF A;  4O0J A;  1U48 A;  4XIU A;  1I3A A;  4AH9 A;  4AHT A;  1U4B A;  4BDY A;  1WSI A;  1U45 A;  5D3G A;  2P5G A;  2B4J A;  3DLE A;  3JSM A;  1J9A A;  3OYF A;  1EP4 A;  4JLH A;  2HHT A;  4Q0B A;  4IG0 A;  3QEW A;  4FCY A;  4DTS A;  3KD1 E;  4OKE A;  4E0D A;  2ETJ A;  1LW0 A;  4CFA A;  4BE2 A;  3HPO A;  3OVN A;  2DFE A;  4DU1 A;  5KGW A;  4CJV A;  3LZI A;  3O3G A;  1NKB A;  3RMD A;  4CEQ A;  4CJL A;  4EZ6 A;  1NKC A;  3SZ2 A;  2IS3 A;  3IRX A;  3HYF A;  4KKO A;  3HPG A;  5HRR A;  4CJ5 A;  3CFR A;  1BCO A;  4DFJ A;  3RWU A;  4IFV A;  4FJ5 A;  4FJL A;  4FK2 A;  3K59 A;  1S6Q A;  4ZHR A;  1ZBH A;  1FK9 A;  1RTH A;  1RNH A;  2YHA A;  4IG3 A;  4FM2 A;  4DWI A;  4NCA A;  4DSF A;  4O55 A;  4KHN A;  1F21 A;  4CJK A;  1NK5 A;  4CK1 A;  2E4L A;  1REV A;  3AVM A;  3PUF A;  1W9H A;  1WAJ A;  3P1G A;  1YVU A;  3OS2 A;  1BHL A;  4RW9 A;  3K58 A;  4DLE A;  4Y1D A;  2R7Y A;  4Z4C A;  1SKW A;  3RRG A;  3HST B;  2RKI A;  3AA3 A;  2Z1J A;  5SZT A;  3OYM A;  1QTM A;  4K8Z A; 
#chains in the Genus database with same CATH topology
 5AQG A;  4IKF A;  1HKB A;  3ITH A;  3J8A A;  4H4O A;  4DTJ A;  3DYA A;  4B8A B;  3LPU A;  5FPE A;  4J8F A;  5HOO A;  4KTW A;  3DLG A;  3VN5 A;  5GIN A;  3M8R A;  2KZM A;  1J6Z A;  3QIP A;  3TAG A;  4CJ7 A;  4YOY A;  3SMS A;  3HBT A;  2G8H A;  2Q97 A;  2HB5 A;  4CJT A;  4YOX A;  4FZY A;  5HRO A;  4K0K K;  3KK7 A;  3THX A;  4OVL A;  4C1N K;  4FXD A;  3V9U A;  3THY A;  3RWU A;  3S9H A;  1QS4 A;  3QEI A;  5BR8 K;  1QZ5 A;  3PIO L;  3T19 A;  3SYZ A;  1HNI A;  1M1K O;  3ZCM A;  1C1A A;  3ZYY X;  4C1N I;  4KH6 A;  1TAU A;  3K5L A;  1RT2 A;  1RDD A;  3M8Q A;  1RDB A;  4B9U A;  3M6G A;  2YNI A;  3DLR A;  1KQS M;  5M1P A;  3KK2 A;  4H5R A;  3MEC A;  3TPQ A;  1IKV A;  1ILY A;  1FKO A;  3QES A;  1NM1 A;  4OKK A;  1IV0 A;  1QHT A;  2FF3 B;  4M7X A;  3W3D A;  1NLV A;  2YHX A;  4GV9 A;  1HPM A;  1IH7 A;  5TKY A;  1DT9 A;  3SAG A;  1VQ7 N;  3HVT A;  4C8M A;  5CHI A;  3EL2 A;  4OX9 K;  1YTU A;  3OYH A;  3QBX A;  2WC9 A;  1W0H A;  3DRP A;  1KTQ A;  3V9S A;  3MX5 A;  3E01 A;  4CJE A;  5J2M A;  2A1S A;  4DR5 K;  3THW B;  4B9L A;  4RTF D;  4BRF A;  4JKG A;  4ISG A;  4OJR A;  3K5N A;  3AAQ A;  1IG9 A;  3OYK A;  3L4I A;  4H0V B;  5GIO A;  3ZSQ A;  3SNN A;  4O8U A;  2KZZ A;  3VEO A;  3VGK A;  1VSH A;  4M3X A;  4NO7 A;  4CEC A;  1N36 K;  4BRI A;  3NAE A;  3CIP A;  2HST A;  2QKK A;  1GOB A;  2WOM A;  4F2R A;  3IG1 A;  2ITM A;  5FPD A;  2P9S B;  2D4W A;  5CY4 A;  1RDU A;  3AV9 A;  1D5A A;  3MXM A;  2EX3 A;  3QEV A;  1A5X A;  2UUB K;  1XC9 A;  3U3G A;  4DTM A;  4IFE A;  3D2F B;  5GAH P;  3KLE A;  1EO1 A;  3DXK A;  3ZT1 A;  2O8E A;  4M63 C;  1KLN A;  4YNQ A;  1C0U A;  2DPN A;  3NF6 A;  1RT4 A;  3Q7C A;  4DFK A;  3T1A A;  4NXM K;  4B9N A;  4F2S A;  4LF6 K;  3L6Q A;  5DK5 A;  3CC2 N;  1Y97 A;  4FLY A;  3HK2 A;  1JJ2 M;  1GLL O;  1XC3 A;  1ZBF A;  1NGG A;  3ZLJ A;  1JLG A;  3MEG A;  3RSE A;  4CJF A;  4FLW A;  4DU3 A;  2G8V A;  1FXX A;  3AVC A;  4CF2 A;  3LDN A;  3WXI A;  4I7F A;  2G8I A;  4J2B A;  3PO5 A;  1NK9 A;  3VEV A;  4LSN A;  1Q9X A;  5FDL A;  2HF3 A;  3T3F A;  4O0I A;  3LAN A;  1W7A A;  2DFH A;  3KKS A;  5CYM A;  4IDH A;  4CJ4 A;  1WSJ A;  2FXU A;  5EVZ A;  2KKZ A;  4XH5 A;  1L3T A;  2I5J A;  1NJW A;  1VK0 A;  3KLI A;  3G0Z A;  4QS9 A;  5C2F A;  1U47 A;  1T7P A;  5AQL A;  3VF2 A;  3F9K A;  4LF8 K;  1VQO N;  2GWK A;  3KLG A;  3U9D A;  1J5E K;  3SJJ A;  3O3F A;  1NMN A;  2YHW A;  3ISN C;  1QSS A;  1QHA A;  4BDP A;  2X6N A;  4CZI A;  2PYL A;  3TAR A;  1J53 A;  1U2V B;  2HHV A;  2YHY A;  2OYQ A;  3V1O A;  2O8F B;  2GX9 A;  1S1T A;  3EN9 A;  3M8S A;  3GG4 A;  1GLE G;  1S1X A;  1XWL A;  4CZL A;  2HVH A;  3ZT2 A;  1XMO K;  3VTH A;  5BPN A;  4K41 A;  3VEZ A;  2KFN A;  2ASO A;  3BEX A;  3W0L A;  3KKR A;  3OYN A;  3VES A;  3QET A;  4FZZ A;  2E1Z A;  1M90 O;  4DQP A;  1KAX A;  2WBN A;  3AVJ A;  1KFD A;  1RFQ A;  4AHC A;  3S3N A;  1NK0 A;  4FJN A;  3OYG A;  1MWK A;  3HVR A;  3KK3 A;  2VQE K;  4GKJ K;  3CCM N;  3DJC A;  1J5O A;  4Z4F A;  3G25 A;  4KBO A;  1VAZ A;  4H03 B;  4DCH A;  3E1Y A;  1RBS A;  4KB0 A;  5HL7 L;  1Z26 A;  2HHW A;  4B9S A;  1KFS A;  2BUP A;  1HKG A;  3VEN A;  3O6W A;  1L5U A;  2E1Y A;  2W40 A;  4AM7 A;  4OKJ A;  3QEP A;  4CHQ A;  3JS6 A;  4M3U A;  3EYZ A;  4LD0 A;  1GOC A;  3CQ8 A;  4W5N A;  4RCH A;  3QFU A;  4Z94 A;  4IEI A;  4ISF A;  3VQ7 A;  3ID8 A;  2HHS A;  2IOC A;  3LP3 A;  4FK4 A;  3DOK A;  2F8T A;  3U8X A;  4JKH A;  4DMN A;  3IAY A;  3A8Y A;  1D9F A;  4BRN A;  1TK8 A;  3VPZ A;  1BO5 O;  3D2F A;  5C12 A;  1KD1 O;  4ISE A;  4BE0 A;  5HRP A;  3FLC O;  4NLB A;  1RT5 A;  5CR4 A;  3VOV A;  1S1W A;  1WN7 A;  4E1N A;  2ZGY A;  2QEX N;  3HOT A;  1JCG A;  4PKG A;  4CBX A;  4B9Q A;  1FKP A;  1B9D A;  1LV5 A;  2E2Q A;  3CM6 A;  2P9U B;  3DOL A;  1IKY A;  1D4X A;  1Q81 O;  1S6P A;  4DS5 A;  2XY8 A;  2NRT A;  2WUS A;  4KPY A;  2UXB K;  2YNF A;  1WSH A;  1CZ9 A;  3SI6 A;  1XHZ A;  2WON A;  4QAG A;  3RMB A;  4JK7 A;  5C25 A;  3C65 A;  3KTQ A;  4FJH A;  2F8S A;  1KRP A;  3NH0 A;  3LDL A;  2Y1I A;  2E2P A;  2FC0 A;  3TAP A;  3AO1 A;  3EZ5 A;  4M3R A;  4KO0 A;  4HUF A;  3QDK A;  2BDP A;  2NRX A;  1RT6 A;  5KQ8 A;  4ELV A;  3VER A;  1X1P A;  4OPA A;  1W97 L;  4KV8 A;  3UKU B;  3VQQ A;  2QWP A;  4FWN A;  3JAM O;  5M1K A;  3WQU A;  1VQ5 N;  4V19 S;  3MX2 A;  1MA9 B;  1TV6 A;  3AVL A;  4JS4 A;  5AFU A;  1HR0 K;  5BPM A;  3ALY A;  2VCP A;  2YX6 A;  3RR8 A;  1C0F A;  1V4S A;  5F0X A;  3ZX0 A;  3VEY A;  1VQ4 N;  2O8D B;  3LP1 A;  3BF1 A;  4N5S A;  3EE8 A;  1T3V A;  4FJ7 A;  5ADX H;  1HNZ K;  3SK3 A;  3VQD A;  1P8Z A;  4CHO A;  4AHR A;  4A62 A;  1JKH A;  1U2V A;  2OCE A;  1RDC A;  1TL3 A;  4RW8 A;  4LFB K;  4DSE A;  4Y0W A;  1NMD A;  4FJ8 A;  4DV6 K;  4QS8 A;  4CZF A;  1U4B A;  4IG0 A;  3HPO A;  3OVN A;  2W6L A;  3J7Z O;  2QI2 A;  5AZJ B;  4H0O A;  4JKA A;  3CJA A;  3RMD A;  3IRX A;  4JI2 K;  3HYF A;  3HPG A;  4FJ5 A;  4DFJ A;  4FJL A;  4H0T B;  1S6Q A;  4ZHR A;  1RNH A;  4DWI A;  4DSF A;  3BY5 A;  4GVE A;  2CGL A;  3C7N B;  1BA1 A;  3LDQ A;  4CK1 A;  3PUF A;  1WAJ A;  1YVU A;  1BHL A;  1SKW A;  4Y1D A;  1NJI O;  3RRG A;  2RKI A;  3AA3 A;  3R8E A;  5SZT A;  4K8Z A;  4YDU A;  4PKH A;  1EWR A;  2VG7 A;  3NFA A;  4FWM A;  5DMR A;  4YOW A;  1XNR K;  2W42 A;  3PX0 A;  1VQP N;  5FRO A;  2KTQ A;  1IJJ A;  3BF3 A;  2FSN A;  1L3V A;  4FJJ A;  1C1B A;  4J2E A;  1NNE A;  3ENH A;  3RMA A;  2QWQ A;  1NG9 A;  3NGZ A;  2ZJQ L;  3NMU A;  3CCL N;  3O1B A;  1GLA G;  4FM1 A;  5F1X A;  2XHB A;  3NVK A;  3OS0 A;  1HMV A;  4OGC A;  4CK3 A;  1WBD A;  3OYL A;  2BGG A;  4EHU A;  4NYN A;  3G10 A;  3CPE A;  1KAY A;  4Z4E A;  3MED A;  4DHY A;  3OYI A;  3CET A;  5AQU A;  4FM0 A;  1BI4 B;  2NRW A;  4M3Y A;  1VSE A;  3O8M A;  3LM9 A;  2X74 A;  4CZM A;  3L2Q A;  1YJN N;  3BZC A;  4M42 A;  1OKJ A;  1L3S A;  1KSP A;  2GEL A;  3QBW A;  3THV A;  3DM2 A;  4FJM A;  3O80 A;  1BIZ A;  2P9U A;  3S3M A;  1NBW A;  3O5B A;  3ZT4 A;  3HM8 A;  4BG8 A;  5AQW A;  4DQQ A;  4OLA A;  3AO2 A;  3SJH A;  1E4G T;  1TK5 A;  2IAJ A;  4CJP A;  3TAQ A;  3VQB A;  2HF4 A;  1SV5 A;  4CGD A;  5JS2 A;  3PIP L;  4PA1 A;  1HJR A;  3MAQ A;  5EXW A;  4JN4 A;  1SS6 A;  3WT0 A;  3FZF A;  2BH1 A;  4O8K A;  1U49 A;  3UKU A;  5EX5 A;  4JI4 K;  3QIN A;  4JI3 K;  1LAV A;  2YJF A;  4B9M A;  4HVJ A;  1RT3 A;  1KAZ A;  5KTQ A;  4A59 A;  2EWS A;  4GVM A;  2QA4 N;  1VRU A;  1NOZ A;  4IWV A;  3SV3 A;  4JV5 K;  2GWJ A;  3QLH A;  4PL7 A;  4H0P A;  4FLV A;  2O8D A;  4WCE L;  4HTU A;  2E20 A;  3QER A;  4IFY A;  4MQ3 A;  2Q31 A;  3V4I A;  2XO7 A;  3E66 A;  3VGM A;  4DV3 K;  2F9W A;  3F9M A;  3CCU N;  2I7P A;  4JS5 A;  3A5N C;  1HKC A;  3LP2 A;  4FPB A;  4BQZ A;  4DQS A;  3UIQ A;  1QQM A;  3S41 A;  3ZEU B;  2XY6 A;  4FWR A;  5KRT A;  3C94 A;  2DFF A;  3TR8 A;  1HYS A;  1RBU A;  1SUQ A;  3NHG A;  4DU4 A;  2E2N A;  1B9F A;  1SL0 A;  4CER A;  5AQY A;  3AVG A;  1TGO A;  4BR7 A;  3T7Z A;  4F8R A;  5GAD P;  5AZI A;  4BAC A;  1NGB A;  5AZJ A;  2NUB A;  3QO9 A;  4DFP A;  4UY8 O;  1ZBS A;  1NWK A;  2FLO A;  5EOY A;  3QNO A;  1JLC A;  5AQS A;  1N32 K;  2YHB A;  4JKB A;  4B9V A;  4FOI A;  4JKD A;  2F7T A;  1ZYQ A;  4DV5 K;  4LF9 K;  4DTR A;  2QW9 A;  4FJX A;  1S5J A;  4FWP A;  3WQT A;  4CIG A;  3WNF A;  4R5P A;  2P9P B;  3CQX A;  3MEE A;  3NH1 A;  2CH6 A;  4IBN A;  3K0S A;  2QXF A;  3H3N O;  2E2O A;  3HT3 A;  4NB4 A;  2VWB A;  2OPP A;  1GLC G;  2FBY A;  3GE1 A;  1T6C A;  4JRQ A;  1HJO A;  2UXD K;  4NCB A;  2OPQ A;  1JXE A;  1DKG D;  2QWN A;  5JS1 A;  1D9D A;  4B1W B;  1U04 A;  4FLT A;  4CZH A;  4G9Z A;  1K8K B;  4K43 A;  4CEZ A;  4CZJ A;  4GV6 A;  5F2R A;  3CG7 A;  4JI0 K;  1RTD A;  2YV0 X;  4I9L A;  1ITG A;  3H3O B;  4CGJ A;  2BTF A;  5JIC A;  1BI4 A;  3DLH A;  2D1K A;  3VQA A;  3K9K A;  1OH8 A;  2F9T A;  3TTC A;  3HP9 A;  1HPZ A;  3OBW A;  4B1Y B;  4MDB A;  3AVA A;  3LM2 A;  2FBX A;  1GLJ O;  3E9O A;  4JI7 K;  1RBV A;  3CI5 A;  3OJS A;  2ZF5 O;  2JWL A;  2NRZ A;  3IMX A;  4WQ4 C;  2AP1 A;  2DY4 A;  4FW1 A;  2IVP A;  4EIA A;  3GBT A;  1ESV A;  3OYE A;  4KHY A;  4LH4 A;  3V6D A;  2PBD A;  3M1F A;  1E4F T;  3HJF A;  2RHK A;  4LSL A;  4BR2 A;  4CEF A;  4CJW A;  4JNE A;  3A5L C;  3P38 A;  4B1V A;  4EAH D;  2J4R A;  4DR1 K;  4PUO A;  2VGM A;  4J2D A;  3ZT0 A;  1MU2 A;  4QS7 A;  4E7L A;  4FLU A;  2D0O A;  4H5N A;  4IZ9 A;  2GEM A;  3A5M C;  3ENO A;  3TAF A;  3GDQ A;  2QTD A;  1P90 A;  2O4I A;  1J54 A;  3S3O A;  4DV1 K;  4KRE A;  3ATU A;  4DSJ A;  2YI1 A;  3SUN A;  1Q86 O;  3F5T A;  4IOA L;  5IT9 O;  4DR7 K;  3OYA A;  4KHP K;  4N47 A;  1KCF A;  3VEX A;  1VSL A;  5GAG P;  5M1O A;  1G15 A;  3O9U A;  4I2Q A;  1TUU A;  3DI6 A;  2GBZ A;  3MXI A;  3H46 O;  3SUQ A;  1H1V A;  1ZC6 A;  4ILH A;  3OY9 A;  1KVB A;  2G8U A;  2V7Y A;  2EHG A;  5FRM A;  1E3M A;  4EP4 A;  4HWI A;  2Q3S A;  4DSK A;  5BR9 A;  3HXM A;  3ZEU A;  5M1F A;  1SL1 A;  3N4Q A;  4NXN K;  3VA3 A;  2YCH A;  2UXC K;  3LAM A;  4DTN A;  5JVG L;  1RTI A;  4DF4 A;  2ZD1 A;  3AVB A;  2QWO A;  4M45 A;  3AVI A;  4BQL A;  5DM7 L;  1IKW A;  3L3V A;  2OPS A;  4MLE A;  4QOZ B;  1ZBL A;  4A57 A;  3OBY A;  5IWA K;  1X9M A;  1NKE A;  5LMN K;  3NE6 A;  4CK2 A;  3TSP A;  2OPR A;  3KK1 A;  1T05 A;  3EZW A;  3N4P A;  3ZSO A;  1N5Y A;  1ASW A;  2FSK A;  2XY7 A;  4AM6 A;  1T6D A;  3AO4 A;  3NH2 A;  1HRH A;  1RBR A;  5GAE P;  1WBB A;  2UU9 K;  4GV3 A;  4DV2 K;  4A5A A;  3P5J A;  4K8X A;  1N33 K;  4M41 A;  3EEQ A;  4BR4 A;  3H1V X;  1G99 A;  3LZJ A;  5CE3 A;  4BRG A;  1ATR A;  4JI5 K;  1ASV A;  1TL1 A;  4WQ5 C;  3J80 O;  3O4Q A;  2D0P A;  3AAR A;  3OHR A;  2RF2 A;  4WE1 A;  3IS9 A;  5BRD A;  3I0S A;  4CVN E;  5AJ3 K;  2Q1N A;  2P5O A;  3WEE B;  4BRP A;  4M3Z A;  3VF6 A;  3L2W A;  1W2B M;  2PFU A;  3A5O C;  4YOR A;  3WNG A;  1QQC A;  2HNY A;  1KC8 O;  2CGK A;  4DF8 A;  1K8K A;  4N41 A;  4FSV A;  3I8B A;  4IDK A;  4C8N A;  4BRL A;  1EKE A;  4ELT A;  3PX6 A;  3SQ0 A;  3CQY A;  1VSF A;  2ASM A;  1HNX K;  5AFU H;  2GTD A;  1U48 A;  4XIU A;  3THW A;  2UYT A;  4BDY A;  4CBU A;  2B4J A;  3DLE A;  4GY2 B;  3OYF A;  4CI6 A;  4BGB A;  1IBL K;  3MN5 A;  3KD1 E;  2FF6 A;  4OKE A;  3KWI A;  2DFE A;  5KGW A;  3LZI A;  2HBL A;  1S22 A;  2CH5 A;  3O3G A;  1NKB A;  4CEQ A;  1NKC A;  3SZ2 A;  5BRH A;  2IS3 A;  4CJ5 A;  5HRR A;  2NRH A;  1ATN A;  1BCO A;  4JYA K;  4BRK A;  4FK2 A;  4YOU A;  2YHA A;  4O55 A;  3CCV N;  2P9S A;  1T44 A;  4CJK A;  1NK5 A;  4DUY K;  4X62 K;  4OPH A;  1REV A;  3MCA B;  3K58 A;  3HST B;  3R1X A;  3ATV A;  3OYM A;  4B3S K;  3L2V A;  3I0R A;  3MN6 A;  3PSI A;  4Z0U A;  2NZT A;  1JLF A;  4K25 A;  5J1E A;  1T8E A;  3J81 O;  1YI2 N;  4A2B A;  2VWK A;  1EQY A;  4FWK A;  3I33 A;  3HOS A;  1VQL N;  2JWK A;  4CHN A;  1RBT A;  3O9S A;  3HM9 A;  5DM6 L;  1KLM A;  3C95 A;  1UA1 A;  4N76 A;  3D0P A;  4FJI A;  1ATS A;  1MDU B;  3LL3 A;  1IKX A;  2QKB A;  3FFK B;  1JLQ A;  4L8R B;  4RW6 A;  2YNH A;  4A2A A;  3CJC A;  3LWL A;  3BGR A;  1CLQ A;  4J2A A;  4BRM A;  4C23 A;  3DLK A;  4BVP A;  3ZET B;  3ZT3 A;  2VQF K;  4ZTF A;  3F2K A;  4BRC A;  3TI0 A;  5KPZ A;  4CGG A;  5C42 A;  1KVA A;  4CGH A;  2RN2 A;  5AQT A;  3V9X A;  4CJ3 A;  1RGI A;  1VQK N;  4I6M B;  5AR0 A;  4ICL A;  5HRS A;  1OH5 A;  4H4M A;  3SBT A;  1QVF M;  2ZJP L;  1FW6 A;  3KLF A;  1I39 A;  3T1H K;  2P9L B;  2X78 A;  1VSK A;  1VQM N;  1QSY A;  3TTD A;  3MMV A;  4FK0 A;  4W5Q A;  5AQZ A;  3LWM A;  4BRA A;  3VQ5 A;  4B8C A;  1JCF A;  1LWC A;  4BR9 A;  3K5M A;  3ZSW A;  1K6Y A;  4ID1 A;  5C24 A;  4PL8 A;  4RW7 A;  2O8F A;  1LCU A;  3VQ4 A;  1YT3 A;  2JLE A;  1TAQ A;  5AQP A;  2YKN A;  1YTA A;  1DTT A;  1O13 A;  1HLU A;  3K57 A;  5KGX A;  2Q0R A;  3ZSY A;  1TK0 A;  4DLG A;  4K42 A;  4WF9 L;  4YOT A;  4H0Y B;  2QWM A;  1XI1 A;  4RG8 A;  1RT1 A;  4FWO A;  4OO1 J;  3C6A A;  4L3Q A;  4KFB A;  4DUZ K;  4ELU A;  4JKC A;  1IG8 A;  5KQD A;  2P51 A;  2CGJ A;  4CBW A;  3WEE A;  3OYJ A;  2Z1I A;  4CF9 A;  1C0G A;  2ITG A;  1ZXO A;  4KHU A;  3U6F A;  4BGA A;  5FLX O;  3FZK A;  3HPH A;  4JI8 K;  4DSL A;  3AO5 A;  3H6E A;  4EZ9 A;  3G4S N;  4CJQ A;  3UKR B;  2A6A A;  2IGI A;  3ENB A;  2IIR A;  4E1M A;  4KB1 A;  5JLH A;  1A5W A;  4AHS A;  4XH4 A;  3VQ6 A;  1C0T A;  2A41 A;  4IO9 L;  4KH4 A;  4FLZ A;  1NU0 A;  1HQU A;  2YKM A;  2O4G A;  1X3N A;  1S1U A;  4YHH K;  4DR2 K;  4CD3 A;  2OA8 A;  4M3T A;  2DTU A;  2G8K A;  4PQU A;  4CIE A;  4E7J A;  1WAF A;  3RMC A;  4IJA A;  3L8B A;  4AHV A;  5T7B A;  4AHU A;  1KVC A;  1A5V A;  3DRS A;  1TVR A;  4BG9 A;  2V52 B;  4IEE A;  2HVI A;  4NYF A;  4DR6 K;  1BWF O;  4B3M K;  1QE1 A;  4DFM A;  1CZA N;  2Z1H A;  3AAP A;  1LOT B;  4B1X B;  4B3O A;  1TKZ A;  2VWJ A;  3PO4 A;  2GUP A;  1VSD A;  4IXC A;  3DAW A;  2B6A A;  1OVQ A;  4JRP A;  5JMV A;  4LF5 K;  4LFA K;  5LJW A;  3ZSZ A;  4TSX A;  4O5B A;  1RIL A;  3CJ7 A;  3U9Z A;  3K2P A;  2O8B B;  1N6Q A;  5MLC Q;  3ZSR A;  3AY9 A;  5J2P A;  3EE9 A;  5ADX A;  3TAN A;  3PSF A;  3CJB A;  3AVF A;  4PY5 A;  1NGJ A;  4F4K A;  2IVN A;  1HYZ A;  3L0Q A;  1UWB A;  2Q0U A;  4LY7 A;  3AA5 X;  2V7Z A;  3AVH A;  4CF8 A;  3CFO A;  5EY4 A;  5C10 A;  3RTV A;  5EU7 A;  2A1R A;  4KHQ A;  3HSC A;  2IVO A;  1I94 K;  1TUY A;  3VGL A;  2LSN A;  4JEP A;  1ZBU A;  3ZET A;  1VSJ A;  5FPM A;  3U3Y A;  4KHS A;  4B3R K;  1YIJ N;  3CJ9 A;  3OS1 A;  4E1J A;  1HNW K;  1HNV A;  4I6M A;  2D0C A;  3DWL A;  1BGX T;  4LC9 B;  2E88 A;  3VQE A;  3VQ8 A;  4KH5 A;  1UAX A;  5J2Q A;  3EKS A;  1WSE A;  4JKF A;  2P9L A;  3TAE A;  2O8E B;  5K14 A;  4DSI A;  1O1W A;  1CZB A;  5AQF A;  3OTO K;  3PLA A;  2G8F A;  4O44 A;  3CFP A;  4MO5 A;  3SUP A;  4CHY A;  3CCS N;  5C15 A;  3ID6 A;  5AQM A;  1OH6 A;  4OLB A;  1TKT A;  1TKX A;  3K5O A;  4ZTJ A;  3KD5 E;  3U4L A;  1V4T A;  4OPK A;  2HBK A;  3WXJ A;  1DLO A;  3NF9 A;  4E89 A;  3CCQ N;  5SWM A;  4BVO A;  3RVC A;  1SZ2 A;  2P9K B;  1NJZ A;  2PYJ A;  3MDQ A;  1S1V A;  3C6H A;  3C0B A;  3ZSX A;  4KHW A;  2A5X A;  4BC3 A;  2FBT A;  4CJR A;  3FZH A;  1NJX A;  1CXQ A;  5BRE A;  1JLB A;  1EWQ A;  4DS4 A;  3KHY A;  1BL3 A;  4RWT A;  1YIT N;  4Y1C A;  3C7N A;  3HTV A;  3OJU A;  3E9L A;  3TSQ A;  1NGH A;  3HL8 A;  1NK8 A;  5AQQ A;  2QWL A;  3TAB A;  1Z6R A;  1Q18 A;  5KPT A;  3SBG A;  3UKR A;  5AQK A;  2HHH K;  5AQI A;  5I3U A;  1WB9 A;  3M8P A;  4AIL C;  2HBM A;  4NLC A;  4U67 L;  3DXM B;  3QEX A;  4HHT A;  4E3S A;  1HYV A;  3V1Q A;  1YHQ N;  1XQS C;  1HQE A;  3DRR A;  5B8H A;  3CYM A;  2BAN A;  3EKU A;  2JGU A;  3CCR N;  4I2P A;  5CZ2 A;  3J7A P;  4E7I A;  4O5F A;  3FR0 A;  4BRQ A;  2G8W A;  4BR0 A;  4NCG A;  3FZL A;  2ZQB A;  1Y64 A;  1C6V A;  4LFC K;  5I9E B;  1GOA A;  1S9E A;  3M3Z A;  4DV0 K;  3BDP A;  1NGF A;  2NLX A;  4XEI A;  3HP6 A;  1QSL A;  4F3T A;  4E7H A;  2ATQ A;  4G1Q A;  3BP8 A;  3OYD A;  4JK8 A;  4YDU C;  3O9R A;  2O8B A;  4A5B A;  1BG3 A;  1XUP O;  1JLA A;  4EHT A;  3VQP A;  1WNS A;  3P83 D;  2ZJR L;  4WYB A;  1LW2 A;  5C2D A;  3WXM B;  1BU6 O;  4DKW A;  1NJY A;  2Q2R A;  4W5T A;  3ZSV A;  4CEE A;  3SQ2 A;  4B9T A;  4JHD B;  4N56 A;  2E5L K;  4O0J A;  4U7B A;  4F9O A;  4AH9 A;  4AHT A;  5D3G A;  4FPA A;  4JLH A;  2HHT A;  2P9I B;  4Q0B A;  4FCY A;  4DTS A;  1LW0 A;  4BE2 A;  3TTF A;  4DU1 A;  4CJV A;  1GLB G;  4XH1 A;  4CJL A;  3O08 A;  4Z4I A;  4KKO A;  5C0Y A;  3CFR A;  1NGA A;  1VQN N;  4IFV A;  1HX1 A;  2ZM6 K;  3K59 A;  3CD6 N;  4IG3 A;  3CCE N;  4NCA A;  1S72 N;  3KWG A;  4FWQ A;  4KHN A;  1F21 A;  4BRE A;  2I7N A;  3GOI A;  3AVM A;  3BZK A;  4WFN L;  2R7Y A;  4Z4C A;  2Z1J A;  3R3L A;  3MWP A;  2KW4 A;  2O8C B;  3A0I X;  3D2E B;  3PY8 A;  3CC7 N;  2ZWH A;  3SLC A;  3CHW A;  4DV4 K;  1RCH A;  1DTQ A;  2P9N B;  1VQ8 N;  1R59 O;  5A2Q O;  2KQ2 A;  3MN9 A;  1U6Z A;  4CEO A;  4PKI A;  1XNQ K;  3AGK A;  3HRG A;  3AA4 A;  3MCP A;  4QCL A;  1YUW A;  2W6K A;  3I8D A;  1VQ9 N;  1NK7 A;  1N8R O;  3ZX3 A;  2OAN A;  4KRF A;  4RW4 A;  2P9K A;  4B1Z A;  2E8A A;  3I55 N;  4H5V A;  5E41 A;  5LJV A;  2HHQ A;  4KTQ A;  3LP0 A;  3NGI A;  3TAM A;  1JLE A;  3QIO A;  2QK9 A;  3OYB A;  2Z1G A;  1XHX A;  4HCB A;  1SAZ A;  4E19 A;  4JD2 B;  4WFA L;  4DTP A;  2QXL A;  1BIS A;  3V81 A;  2B5J A;  2XRI A;  5KPR A;  4OPJ A;  4I9Q A;  3SCX A;  1B92 A;  3Q7B A;  3OYC A;  4PWD A;  2GUI A;  4JKE A;  1K9M O;  5AQV A;  3TU5 A;  3WUH A;  1X9J A;  3O4W A;  3L2R A;  3VQC A;  2P9P A;  1VQ6 N;  3L4Q A;  3OW2 M;  1IBK K;  3ASM A;  3AO3 A;  3SV4 A;  4GKK K;  2FBV A;  3DXM A;  3HZ6 A;  3WNE A;  4CE9 A;  2KLA A;  3O9Q A;  5E26 A;  1GLF O;  5BN8 A;  1VHX A;  3EO3 A;  1QQO A;  1Q8I A;  1YF5 L;  4R79 A;  3FE1 A;  4C8K A;  3L2U A;  4CHZ A;  4FL9 A;  1VSM A;  4EP5 A;  3WXL A;  3EY1 A;  2HOE A;  5TKW A;  1TYQ B;  1C1C A;  1BQM A;  4BC2 A;  3QFP A;  2NRV A;  4DTU A;  5FPN A;  5JVH L;  3CER A;  3JXU A;  4DQ8 A;  1BCM A;  5LMU K;  2BE2 A;  4DQI A;  4CJU A;  4C8O A;  2HHU A;  3HO1 A;  2YJE A;  3DMJ A;  3VA0 A;  2D5R A;  1XMQ K;  4FO0 A;  1LWF A;  3RR7 A;  1YAG A;  3V9Z A;  1T03 A;  2OTJ N;  2ZE2 A;  3KIO A;  2RE2 A;  4M3W A;  2W41 A;  3ULE B;  2F96 A;  3SPY A;  4CHP A;  1X3M A;  3AA2 A;  4CCH A;  1LAW A;  5I42 A;  4AQY K;  2IC3 A;  3UE5 A;  1IO2 A;  3ULD A;  1RDW X;  2A42 A;  1ASU A;  3FZM A;  3LDS A;  4MFB A;  4JHD A;  3KLH A;  4ILG B;  3WNH A;  4Z4H A;  1R0A A;  3TSU A;  5AQH A;  3VEW A;  4Q5V A;  4H5T A;  1L3U A;  5KRS A;  4FJG A;  1FJG K;  4IOX A;  3O3H A;  1BUP A;  2P9I A;  4FVM A;  4ID5 A;  3PX4 A;  5AQJ A;  3UB5 A;  2HND A;  4WFB L;  4CF0 A;  4PHT X;  3CF5 L;  4H8K A;  4GMJ B;  3GL1 A;  3LPT A;  3NDK A;  3B6P A;  1WSF A;  1YVN A;  4KAZ A;  4CJS A;  4OGE A;  3ZX2 A;  4IOC L;  4CZE A;  1S3X A;  3SQ4 A;  4BC5 A;  3V9W A;  3IUC A;  1NGC A;  2PZS A;  2OZS A;  5M1N A;  5HLF A;  4H5W A;  4W5R A;  4O4G A;  2KHO A;  5ELZ A;  3KZB A;  4BC4 A;  4C8L A;  4MLH A;  3LAK A;  3D2E A;  2OTL N;  1WOQ A;  2O8C A;  1JXB A;  1RT7 A;  3LAL A;  4KI6 A;  4FYD A;  3H45 C;  1SQK A;  4X66 K;  4FJ9 A;  2P9N A;  3PV8 A;  4CEA A;  4DR4 K;  5HBM A;  2FSJ A;  3CM5 A;  1YXQ A;  5LY3 A;  3E9P A;  4DG1 A;  3CMA N;  4Z4G A;  4BWM A;  3TWH A;  3O9T A;  3FGU A;  4CED A;  2Y1J A;  3C6U A;  1UA0 A;  1JL1 A;  3O4N A;  4B3T K;  2QM1 A;  3NGY A;  4CFC A;  3F73 A;  1YJW N;  4DV7 K;  4DQR A;  4FW2 A;  5GIP A;  4CGF A;  1RDA A;  1BA0 A;  4CES A;  3LDP A;  4YY3 K;  1K8A O;  1NOY A;  1X9W A;  1RTJ A;  3MXJ A;  4CFD A;  3H1Q A;  4HUE A;  4FWL A;  3QNN A;  4JD2 A;  1NK6 A;  1QZ6 A;  3KJV A;  2A40 A;  3LDO A;  2P1J A;  3NBP A;  2ASP A;  1OH7 A;  1UOC A;  2H3G X;  3G71 N;  3SUO A;  4W5O A;  3P39 A;  1LWE A;  4BRO A;  4AF1 A;  4DB3 A;  3D6R A;  3T69 A;  4X65 K;  3RRH A;  4DTX A;  4JI1 K;  2E6L A;  3VMF B;  3DLB A;  1SKR A;  4BRH A;  4YFU A;  1DGK N;  2ZGZ A;  4DR3 K;  1QVG M;  3B6O A;  3JYT A;  2WTU A;  1D8Y A;  5BN9 A;  1Q9Y A;  2A3Z A;  4MDA A;  3SPZ A;  2AA4 A;  1GLD G;  2VG5 A;  2HW3 A;  4FJK A;  4CEB A;  5AQO A;  4H0X B;  4BRD A;  2F4V K;  4BWJ A;  2PY5 A;  1EXQ A;  3B8A X;  3VTI A;  3MWT A;  3O1W A;  1TYQ A;  3KVG A;  4LF7 K;  5AZI B;  3IKM A;  4YOV A;  2QWR A;  2Q36 A;  3T1Y K;  1Q7Y O;  4X64 K;  3SQ1 A;  5AQR A;  4FZX C;  4CZK A;  4CD1 A;  3QIC A;  3VF4 A;  4FOE A;  3QML A;  1SL2 A;  4LF4 K;  3THX B;  4CW7 B;  1SKS A;  4MO4 A;  3THY B;  2IDO A;  2GV9 A;  3V1R A;  1EET A;  5LL6 Z;  3ULE A;  3CPW M;  2HNZ A;  1BIU A;  2NNW A;  5J2N A;  1QQN A;  4LH5 A;  5BRF A;  3D7E O;  1VSI A;  4HUG A;  1TKD A;  3NF7 A;  4M7Y A;  3I56 N;  3R6M A;  4DTO A;  4HCC A;  1BOT O;  1NGD A;  4WQ4 A;  3CCJ N;  5E84 A;  2XY5 A;  1OVY A;  4UQG A;  1X9S A;  4JK9 A;  2YNG A;  2RPI A;  5HP1 A;  5CYQ A;  3QB0 A;  4B08 A;  2KFZ A;  3SMP A;  2AJQ A;  2V51 B;  3AVN A;  3CJ1 A;  1Z05 A;  1NK4 A;  3NVM A;  1BDG A;  3D45 A;  1YJ9 N;  1JL2 A;  3IDH A;  3WXK A;  3HI0 A;  1HUX A;  4HTL A;  5FRN A;  3AVK A;  3CC4 N;  3L3U A;  2HHX A;  3C6T A;  1N34 K;  5BPL A;  2D0A A;  2E6M A;  4E7K A;  3CXC M;  3P4I A;  3R9P A;  1WLJ A;  3VQ9 A;  4BY9 C;  2PAV A;  3G6E N;  4JKG B;  5HRN A;  4CGI A;  4EFH A;  4IO8 A;  4BR5 A;  1KXP A;  1Z25 A;  4KI4 A;  3NF8 A;  3CME N;  1C0M A;  3H08 A;  4FLX A;  4BE1 A;  4KTZ A;  3NCI A;  3MK6 A;  3J7Y P;  1CXU A;  2WFB A;  3A2F A;  5M1Q A;  4GW6 A;  2OZM A;  2NRR A;  4A61 A;  2VG6 A;  4GNI A;  2VGN A;  2HMI A;  1S9G A;  4CIF A;  3FFI A;  4B1U B;  5AQX A;  5KI6 A;  2HMP A;  5JLF A;  1BQN A;  2D0B A;  1EX4 A;  4ILJ A;  3AGR A;  4JAX A;  5H1S Q;  4CZG A;  1JCE A;  2HBJ A;  4F3O A;  4CF1 A;  1NGE A;  4FWS A;  4JI6 K;  3BUZ B;  3DXK B;  2X6S A;  3DLL L;  1WSG A;  1VRT A;  5CZ1 A;  1NGI A;  4FVU A;  1IBM K;  3VET A;  4CFB A;  4BDZ A;  3K9J A;  1I3A A;  3SAF A;  1WSI A;  1U45 A;  2P5G A;  3JSM A;  1J9A A;  2UUA K;  1EP4 A;  3IFR A;  3OA9 A;  1MWM A;  3SAH A;  3QEW A;  4E0D A;  2UUC K;  2ETJ A;  4CFA A;  3M5R A;  4EZ6 A;  3RSE B;  1ZBI A;  1WUA A;  3MN7 A;  1ZBH A;  1FK9 A;  1RTH A;  4FM2 A;  2VYP A;  1Q82 O;  1K73 O;  3P31 A;  2E4L A;  3OS2 A;  1W9H A;  3P1G A;  4RW9 A;  4WQ5 A;  5AQN A;  4DLE A;  1DEJ A;  4IJN A;  1QTM A; 
#chains in the Genus database with same CATH homology
 2KW4 A;  3PY8 A;  3L2V A;  3I0R A;  4IKF A;  4Z0U A;  2VG7 A;  3NFA A;  3ITH A;  1JLF A;  4H4O A;  5DMR A;  4DTJ A;  3DYA A;  1RCH A;  1DTQ A;  4B8A B;  5J1E A;  2W42 A;  1T8E A;  3PX0 A;  3LPU A;  2KQ2 A;  5FRO A;  4CEO A;  2VWK A;  2KTQ A;  4KTW A;  3DLG A;  3AA4 A;  3VN5 A;  4QCL A;  3M8R A;  1L3V A;  4FJJ A;  1C1B A;  4J2E A;  2KZM A;  3QIP A;  4CHN A;  1RBT A;  3I8D A;  3HM9 A;  1KLM A;  3TAG A;  1NK7 A;  3RMA A;  4KRF A;  3C95 A;  1UA1 A;  2G8H A;  2HB5 A;  4RW4 A;  4CJT A;  3D0P A;  4FJI A;  3NGZ A;  4FZY A;  5HRO A;  4FM1 A;  1IKX A;  4OVL A;  5E41 A;  2QKB A;  3V9U A;  2XHB A;  4FXD A;  2HHQ A;  4KTQ A;  1JLQ A;  3LP0 A;  3NGI A;  3OS0 A;  1HMV A;  4OGC A;  3TAM A;  4CK3 A;  1JLE A;  1QS4 A;  3QIO A;  3S9H A;  4L8R B;  3OYL A;  4RW6 A;  3OYB A;  2QK9 A;  2Z1G A;  3QEI A;  2YNH A;  2BGG A;  1XHX A;  4HCB A;  3LWL A;  3BGR A;  4E19 A;  1CLQ A;  4NYN A;  4DTP A;  3G10 A;  4J2A A;  3T19 A;  4Z4E A;  3SYZ A;  1HNI A;  1BIS A;  3MED A;  3ZCM A;  1C1A A;  2B5J A;  3OYI A;  3V81 A;  4FM0 A;  2XRI A;  3DLK A;  3ZT3 A;  3K5L A;  1BI4 B;  1RT2 A;  1RDD A;  3M8Q A;  1RDB A;  4M3Y A;  4B9U A;  1VSE A;  4OPJ A;  2YNI A;  3SCX A;  1B92 A;  3DLR A;  4ZTF A;  4I9Q A;  2X74 A;  3OYC A;  3L2Q A;  3TI0 A;  4PWD A;  4CGG A;  5C42 A;  3KK2 A;  4M42 A;  1KVA A;  4CGH A;  2RN2 A;  1L3S A;  3MEC A;  2GUI A;  3V9X A;  1TAU A;  4CJ3 A;  1IKV A;  1KSP A;  3L2R A;  1FKO A;  3VQC A;  3THV A;  3QES A;  3DM2 A;  4OKK A;  4FJM A;  1BIZ A;  4ICL A;  3S3M A;  3ASM A;  1QHT A;  5HRS A;  3ZT4 A;  4H4M A;  3AO3 A;  3SV4 A;  4DQQ A;  4OLA A;  1IH7 A;  3AO2 A;  2FBV A;  3WNE A;  4CE9 A;  3KLF A;  1I39 A;  1TK5 A;  2IAJ A;  2X78 A;  4CJP A;  1VSK A;  3HVT A;  1QSY A;  3TAQ A;  1Q8I A;  4C8M A;  3VQB A;  4C8K A;  4FK0 A;  4W5Q A;  3L2U A;  3LWM A;  4CHZ A;  1YTU A;  3OYH A;  3VQ5 A;  1SV5 A;  1W0H A;  1VSM A;  4B8C A;  4CGD A;  4EP5 A;  3DRP A;  5JS2 A;  1KTQ A;  4PA1 A;  3V9S A;  4CJE A;  3E01 A;  5J2M A;  1HJR A;  2A1S A;  3MAQ A;  1LWC A;  3K5M A;  3ZSW A;  3EY1 A;  4B9L A;  1K6Y A;  3K5N A;  4OJR A;  1C1C A;  1BQM A;  1IG9 A;  3OYK A;  4ID1 A;  5C24 A;  3ZSQ A;  1U49 A;  3SNN A;  4DTU A;  3QIN A;  4RW7 A;  2KZZ A;  3VQ4 A;  1LAV A;  1VSH A;  1YT3 A;  2JLE A;  4B9M A;  4HVJ A;  4M3X A;  1TAQ A;  1RT3 A;  1BCM A;  2YKN A;  4CEC A;  2BE2 A;  1YTA A;  1DTT A;  4DQI A;  4CJU A;  5KTQ A;  4C8O A;  2HHU A;  3NAE A;  3HO1 A;  4GVM A;  5KGX A;  3DMJ A;  3K57 A;  3VA0 A;  3ZSY A;  1TK0 A;  2D5R A;  1GOB A;  2WOM A;  4DLG A;  1VRU A;  2QKK A;  4F2R A;  1NOZ A;  3SV3 A;  1LWF A;  3IG1 A;  1XI1 A;  3RR7 A;  3QLH A;  4RG8 A;  3V9Z A;  1RT1 A;  1T03 A;  2ZE2 A;  3KIO A;  4KFB A;  4FLV A;  4ELU A;  4M3W A;  5CY4 A;  2P51 A;  2F96 A;  3SPY A;  4HTU A;  3AV9 A;  4CHP A;  1D5A A;  3OYJ A;  3MXM A;  2Z1I A;  4CF9 A;  3QER A;  2ITG A;  2EX3 A;  4IFY A;  3QEV A;  3AA2 A;  1A5X A;  4CCH A;  4KHU A;  1XC9 A;  4MQ3 A;  3V4I A;  3U6F A;  2XO7 A;  1LAW A;  3U3G A;  4DTM A;  3HPH A;  5I42 A;  4DSL A;  2IC3 A;  1IO2 A;  3KLE A;  3ULD A;  3AO5 A;  3ZT1 A;  1ASU A;  4JS5 A;  3LP2 A;  4DQS A;  1KLN A;  4EZ9 A;  3UIQ A;  3LDS A;  4MFB A;  4N76 A;  3KLH A;  4YNQ A;  2XY6 A;  5KRT A;  3WNH A;  3C94 A;  1C0U A;  2DFF A;  3TR8 A;  4CJQ A;  3NF6 A;  1RT4 A;  4Z4H A;  1R0A A;  1HYS A;  1RBU A;  1SUQ A;  4Q5V A;  4DFK A;  3T1A A;  4F2S A;  4B9N A;  2IGI A;  3NHG A;  4DU4 A;  1L3U A;  1B9F A;  5KRS A;  4E1M A;  4FJG A;  1SL0 A;  4CER A;  4KB1 A;  5DK5 A;  3O3H A;  1Y97 A;  4FLY A;  4FVM A;  3HK2 A;  1A5W A;  4ID5 A;  4AHS A;  3PX4 A;  3AVG A;  1TGO A;  3VQ6 A;  4F8R A;  1C0T A;  2HND A;  4BAC A;  4FLZ A;  1HQU A;  4CF0 A;  1ZBF A;  2YKM A;  2O4G A;  1S1U A;  2NUB A;  3QO9 A;  4GMJ B;  3LPT A;  4H8K A;  4DFP A;  1JLG A;  3MEG A;  3NDK A;  4DU3 A;  4CJF A;  4FLW A;  2G8V A;  1FXX A;  3B6P A;  3AVC A;  1WSF A;  3QNO A;  2DTU A;  2OA8 A;  1JLC A;  4M3T A;  2YHB A;  4CF2 A;  2G8K A;  4KAZ A;  4PQU A;  4CJS A;  4CIE A;  4E7J A;  4I7F A;  4B9V A;  2G8I A;  1WAF A;  3RMC A;  4OGE A;  4J2B A;  3PO5 A;  1ZYQ A;  1NK9 A;  4LSN A;  3L8B A;  3SQ4 A;  3V9W A;  4AHV A;  5T7B A;  4AHU A;  1KVC A;  1A5V A;  3DRS A;  5FDL A;  1Q9X A;  1TVR A;  4DTR A;  2PZS A;  2OZS A;  1S5J A;  4FJX A;  3T3F A;  4NYF A;  4O0I A;  2HVI A;  4CIG A;  5HLF A;  1QE1 A;  3LAN A;  4W5R A;  3WNF A;  4O4G A;  2DFH A;  3KKS A;  4R5P A;  4DFM A;  5CYM A;  2Z1H A;  4C8L A;  4CJ4 A;  3LAK A;  3MEE A;  1WSJ A;  4B3O A;  1TKZ A;  1JXB A;  1RT7 A;  3LAL A;  4IBN A;  3NH1 A;  2VWJ A;  2I5J A;  1NJW A;  1L3T A;  4KI6 A;  1VK0 A;  3KLI A;  3G0Z A;  1U47 A;  3PO4 A;  1VSD A;  4FYD A;  2QXF A;  4FJ9 A;  1T7P A;  3PV8 A;  4CEA A;  2B6A A;  4JRP A;  5HBM A;  3CM5 A;  3F9K A;  4Z4G A;  4DG1 A;  3HT3 A;  4BWM A;  3TWH A;  4CED A;  2Y1J A;  3C6U A;  2OPP A;  2FBY A;  3ZSZ A;  1UA0 A;  4TSX A;  4O5B A;  3KLG A;  1RIL A;  1JL1 A;  3O4N A;  4JRQ A;  3SJJ A;  3K2P A;  3O3F A;  1N6Q A;  3ISN C;  1QSS A;  3NGY A;  4CFC A;  3F73 A;  4BDP A;  4NCB A;  3ZSR A;  2OPQ A;  2X6N A;  1JXE A;  4DQR A;  5J2P A;  4FW2 A;  5JS1 A;  4CGF A;  1D9D A;  3TAN A;  1RDA A;  3AVF A;  2PYL A;  4PY5 A;  1U04 A;  4CES A;  1NOY A;  4FLT A;  4F4K A;  3TAR A;  1HYZ A;  1J53 A;  2HHV A;  1X9W A;  1RTJ A;  1UWB A;  3MXJ A;  4CEZ A;  4LY7 A;  3AA5 X;  4CFD A;  2OYQ A;  3V1O A;  3AVH A;  4HUE A;  1S1T A;  4CF8 A;  3QNN A;  3CG7 A;  3CFO A;  3RTV A;  2A1R A;  5EU7 A;  4KHQ A;  1NK6 A;  1RTD A;  3M8S A;  1XWL A;  2YV0 X;  1S1X A;  2LSN A;  1ITG A;  4I9L A;  3KJV A;  4CGJ A;  2HVH A;  3ZT2 A;  1ZBU A;  2P1J A;  3NBP A;  1BI4 A;  1VSJ A;  1UOC A;  3DLH A;  3VQA A;  3U3Y A;  2KFN A;  3SUO A;  4KHS A;  4W5O A;  3OS1 A;  1LWE A;  1HNV A;  3HP9 A;  1HPZ A;  3KKR A;  3OYN A;  3QET A;  4FZZ A;  2D0C A;  3AVA A;  4DQP A;  1BGX T;  4DTX A;  3RRH A;  2E6L A;  2FBX A;  3AVJ A;  1KFD A;  3DLB A;  3VQE A;  1SKR A;  3VQ8 A;  1RBV A;  3OJS A;  4YFU A;  2DY4 A;  1UAX A;  4FW1 A;  4AHC A;  3B6O A;  3JYT A;  3S3N A;  1NK0 A;  1D8Y A;  3OYG A;  3HVR A;  4FJN A;  3KK3 A;  5J2Q A;  1WSE A;  3OYE A;  4KHY A;  1Q9Y A;  4LH4 A;  3V6D A;  3TAE A;  3SPZ A;  5K14 A;  1J5O A;  3HJF A;  4DSI A;  1O1W A;  1CZB A;  4LSL A;  2VG5 A;  2HW3 A;  4Z4F A;  4CEF A;  4FJK A;  4CJW A;  4CEB A;  2G8F A;  4O44 A;  4BWJ A;  2PY5 A;  4PUO A;  3CFP A;  4J2D A;  1RBS A;  3ZT0 A;  3SUP A;  4CHY A;  1EXQ A;  4KB0 A;  1MU2 A;  4E7L A;  4FLU A;  1Z26 A;  2HHW A;  4B9S A;  4OLB A;  1KFS A;  1TKT A;  1TKX A;  3K5O A;  4ZTJ A;  3KD5 E;  3TAF A;  4OPK A;  1L5U A;  2O4I A;  1DLO A;  1J54 A;  4OKJ A;  3QEP A;  3S3O A;  4CHQ A;  4KRE A;  3SQ1 A;  4M3U A;  3NF9 A;  4E89 A;  4DSJ A;  3SUN A;  3EYZ A;  5SWM A;  4LD0 A;  4FZX C;  1GOC A;  3CQ8 A;  4W5N A;  1NJZ A;  1SL2 A;  2PYJ A;  1SKS A;  1S1V A;  3ZSX A;  2IDO A;  3OYA A;  4N47 A;  4KHW A;  1KCF A;  1VSL A;  2GV9 A;  3VQ7 A;  3V1R A;  1G15 A;  2HHS A;  2IOC A;  2FBT A;  3LP3 A;  4I2Q A;  4CJR A;  4FK4 A;  1EET A;  3DI6 A;  1NJX A;  2HNZ A;  2GBZ A;  3MXI A;  3DOK A;  1BIU A;  1CXQ A;  2F8T A;  5J2N A;  4DMN A;  4LH5 A;  4HUG A;  3SUQ A;  1TKD A;  1JLB A;  1VSI A;  1D9F A;  3NF7 A;  4DS4 A;  3IAY A;  1TK8 A;  3OY9 A;  1BL3 A;  1KVB A;  2G8U A;  4DTO A;  4Y1C A;  4BE0 A;  4HCC A;  2EHG A;  3OJU A;  5FRM A;  5HRP A;  4EP4 A;  1RT5 A;  2Q3S A;  4DSK A;  3HXM A;  2XY5 A;  1S1W A;  1WN7 A;  4UQG A;  3HL8 A;  1NK8 A;  1X9S A;  2YNG A;  4E1N A;  2RPI A;  5HP1 A;  3TAB A;  5CYQ A;  1SL1 A;  4B08 A;  2KFZ A;  2AJQ A;  1FKP A;  3VA3 A;  1B9D A;  1LV5 A;  5I3U A;  3CM6 A;  4Z4I A;  3AVN A;  3LAM A;  3M8P A;  3DOL A;  4DTN A;  4AIL C;  1IKY A;  1S6P A;  4DS5 A;  1RTI A;  2XY8 A;  1NK4 A;  3QEX A;  4KPY A;  4DF4 A;  4HHT A;  2ZD1 A;  3AVB A;  3D45 A;  1JL2 A;  4M45 A;  1HYV A;  2YNF A;  4E3S A;  3AVI A;  1WSH A;  3V1Q A;  5FRN A;  1CZ9 A;  3SI6 A;  1XHZ A;  1HQE A;  2WON A;  3DRR A;  1IKW A;  3L3V A;  4QAG A;  3AVK A;  5C25 A;  3RMB A;  3L3U A;  2HHX A;  1ZBI A;  2OPS A;  3CYM A;  3KTQ A;  2BAN A;  4FJH A;  4QOZ B;  1ZBL A;  1X9M A;  2JGU A;  2F8S A;  3C6T A;  1NKE A;  3NH0 A;  1KRP A;  2D0A A;  2E6M A;  4I2P A;  5CZ2 A;  4CK2 A;  3NE6 A;  2OPR A;  4E7K A;  2Y1I A;  2FC0 A;  3KK1 A;  3TAP A;  1T05 A;  4E7I A;  3AO1 A;  3EZ5 A;  1WLJ A;  3VQ9 A;  4M3R A;  4KO0 A;  3ZSO A;  4HUF A;  2BDP A;  1N5Y A;  2G8W A;  1RT6 A;  5HRN A;  1ASW A;  4CGI A;  4NCG A;  2ZQB A;  2XY7 A;  4ELV A;  1X1P A;  4KV8 A;  3AO4 A;  1C6V A;  1Z25 A;  3NH2 A;  3NF8 A;  4KI4 A;  1HRH A;  1C0M A;  1RBR A;  3H08 A;  3VQQ A;  4FLX A;  4BE1 A;  4KTZ A;  3NCI A;  1GOA A;  1CXU A;  3A2F A;  3P5J A;  1S9E A;  4K8X A;  4GW6 A;  1TV6 A;  3AVL A;  3BDP A;  4JS4 A;  2OZM A;  4M41 A;  3HP6 A;  2VG6 A;  3ALY A;  1QSL A;  4F3T A;  3LZJ A;  4E7H A;  2ATQ A;  3RR8 A;  1ASV A;  1TL1 A;  2HMI A;  4G1Q A;  1S9G A;  3O4Q A;  3FFI A;  4CIF A;  3OYD A;  5KI6 A;  2RF2 A;  3LP1 A;  4WE1 A;  3IS9 A;  1BQN A;  4N5S A;  3I0S A;  2D0B A;  1EX4 A;  2P5O A;  1JLA A;  3VQP A;  4FJ7 A;  4M3Z A;  1WNS A;  3P83 D;  3L2W A;  1LW2 A;  4F3O A;  3WNG A;  4CF1 A;  1QQC A;  2HNY A;  3VQD A;  4CHO A;  1NJY A;  2X6S A;  4AHR A;  1JKH A;  1VRT A;  1WSG A;  4DF8 A;  4N41 A;  5CZ1 A;  4W5T A;  1RDC A;  3ZSV A;  4IDK A;  4C8N A;  4CEE A;  1TL3 A;  4RW8 A;  3SQ2 A;  4B9T A;  1EKE A;  4DSE A;  4ELT A;  4CFB A;  4N56 A;  3PX6 A;  3SQ0 A;  4BDZ A;  4FJ8 A;  1VSF A;  4O0J A;  1U48 A;  4XIU A;  1I3A A;  4AH9 A;  4AHT A;  1U4B A;  4BDY A;  1WSI A;  1U45 A;  5D3G A;  2P5G A;  2B4J A;  3DLE A;  3JSM A;  1J9A A;  3OYF A;  1EP4 A;  4JLH A;  2HHT A;  4Q0B A;  4IG0 A;  3QEW A;  4FCY A;  4DTS A;  3KD1 E;  4OKE A;  4E0D A;  2ETJ A;  1LW0 A;  4CFA A;  4BE2 A;  3HPO A;  3OVN A;  2DFE A;  4DU1 A;  5KGW A;  4CJV A;  3LZI A;  3O3G A;  1NKB A;  3RMD A;  4CEQ A;  4CJL A;  4EZ6 A;  1NKC A;  3SZ2 A;  2IS3 A;  3IRX A;  3HYF A;  4KKO A;  3HPG A;  5HRR A;  4CJ5 A;  3CFR A;  1BCO A;  4DFJ A;  3RWU A;  4IFV A;  4FJ5 A;  4FJL A;  4FK2 A;  3K59 A;  1S6Q A;  4ZHR A;  1ZBH A;  1FK9 A;  1RTH A;  1RNH A;  2YHA A;  4IG3 A;  4FM2 A;  4DWI A;  4NCA A;  4DSF A;  4O55 A;  4KHN A;  1F21 A;  4CJK A;  1NK5 A;  4CK1 A;  2E4L A;  1REV A;  3AVM A;  3PUF A;  1W9H A;  1WAJ A;  3P1G A;  1YVU A;  3OS2 A;  1BHL A;  4RW9 A;  3K58 A;  4DLE A;  4Y1D A;  2R7Y A;  4Z4C A;  1SKW A;  3RRG A;  3HST B;  2RKI A;  3AA3 A;  2Z1J A;  5SZT A;  3OYM A;  1QTM A;  4K8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...