4CHPA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4chpA00
4FZYA 1RBUA 3C6TA 4FM1A 4RW8A 1VSLA 1YTAA 1HNVA 4CJTA 3T19A 4OPJA 3C95A 3HT3A 1I39A 1NK5A 3DOKA 4DS5A 1TK8A 1NK0A 1QSYA 4B9TA 4DSIA 4L8RB 4CIEA 4CF2A 3QIOA 1D9DA 3VN5A 1YVUA 4KI6A 1J54A 1RBSA 3CG7A 2IS3A 3TABA 4I9LA 2QKKA 3IRXA 3VQPA 2YKNA 2P5OA 3ALYA 1WSJA 3WNEA 1GOCA 4CJ3A 3QERA 1T7PA 4FCYA 1A5VA 3AA2A 4PQUA 4DTPA 4CGFA 1RT3A 4OGCA 3V1OA 4N5SA 3NH0A 3OJSA 1U47A 2E4LA 2F8TA 1KVBA 2YNFA 3SUPA 2PY5A 4O4GA 3D0PA 3K59A 3ZSRA 1SL1A 1FKOA 4E7KA 1T03A 4KAZA 4TSXA 3AVAA 4CJWA 1VSFA 1ZBLA 1CLQA 4CJKA 2GUIA 3C94A 1D9FA 2HW3A 3AO5A 3MAQA 1JXEA 2FBYA 4DTRA 4M3RA 3LAKA 1HPZA 1RT2A 4CJVA 2KZZA 3BGRA 5FROA 4EP5A 3QEPA 1IH7A 3TWHA 1EKEA 4CJFA 4ZTFA 4FZZA 3OYAA 1KLMA 3OY9A 1R0AA 4CEEA 1CZBA 4M3TA 3QEWA 3U3GA 1JLEA 3S3NA 3OYCA 3AV9A 1U48A 4AHTA 3LALA 3LWLA 3SYZA 4CIGA 3EZ5A 4E0DA 1ZBIA 3ZSXA 4M3WA 5HRSA 4KFBA 1D5AA 1VSEA 3HYFA 4NYFA 5E41A 4B9UA 4KPYA 4E7IA 4DSFA 3K5OA 1JL1A 3PO5A 4J2AA 4CF9A 3VQ5A 2E6LA 2X78A 1ASUA 4GVMA 3VQ7A 1HQEA 3VQDA 4CJ5A 5KRSA 4R5PA 3L2RA 4DQPA 1WNSA 3ZT1A 3NF6A 2PYJA 3KLEA 4NCBA 1TKXA 2A1SA 3V1QA 4CFCA 3KLHA 3NBPA 1FKPA 4IG0A 4BDYA 1EETA 3ZSVA 3E01A 3MEDA 4CEQA 1CZ9A 4CEDA 4G1QA 3SZ2A 2XHBA 5HROA 5KRTA 4M3YA 3CM5A 4J2EA 4FJHA 4C8NA 1S1TA 2X6SA 4NYNA 4CGJA 1KLNA 4F3OA 4PWDA 1ZBFA 1VRTA 4J2BA 3HL8A 2HB5A 2O4GA 1S6QA 2IOCA 4M3UA 1KCFA 2ITGA 3CM6A 4FJXA 1VSHA 2RKIA 4E7HA 2EHGA 2ZQBA 3PY8A 2VWKA 3DRPA 1B92A 3AA5X 3MECA 3LZJA 2HNYA 4DFKA 3HVRA 4FJMA 4FM0A 1B9DA 4KHQA 3CFOA 3KK1A 2XY8A 4Q5VA 3WNFA 4O0IA 3QEVA 1Q9XA 4DMNA 4IDKA 5SZTA 1KRPA 4Q0BA 1EXQA 1WSIA 1NOYA 2X74A 4HCBA 5C25A 3SUQA 3LPTA 1T8EA 3I0SA 1HJRA 4BWJA 4CHPA 1ITGA 1N6QA 2XO7A 2DTUA 4KB1A 3ITHA 2IC3A 1UA0A 1O1WA 1WN7A 3OYFA 4YNQA 4JS5A 4E7LA 3OYEA 3VA3A 3NF9A 3OYDA 3RMAA 3IG1A 4FLTA 4CF1A 1SKSA 3VA0A 1TAQA 4DTJA 4AILC 2OPQA 1TKDA 1BCOA 2BDPA 4B9VA 3VQ9A 5EU7A 1VK0A 3CFRA 4OVLA 3AVLA 5J2MA 5HLFA 1NK8A 5J2NA 4H8KA 3VQ8A 3I8DA 2KTQA 3AVNA 1X9WA 1JL2A 2YNGA 3DLHA 2OPSA 1TKZA 5CZ2A 1TL3A 2HHXA 1RBRA 3DRRA 3AVCA 3DLEA 4E19A 1JXBA 4CECA 3QESA 5CZ1A 3NH1A 1HYVA 2F8SA 1HYZA 2DY4A 1TVRA 4ID1A 4E7JA 1NJXA 4CE9A 2DFEA 3DOLA 4CF0A 1BI4A 1XI1A 1RCHA 4O55A 2E6MA 4HUGA 4AHVA 3DMJA 1Y97A 1XC9A 2YNIA 3OYGA 1X9SA 4EZ6A 3I0RA 3K57A 4FLVA 4B3OA 4LH4A 2B6AA 1LWCA 2KFNA 2JLEA 3K5MA 4FLUA 1VSJA 1IG9A 3OYKA 3SNNA 1U45A 4IKFA 4OJRA 3TI0A 4CJ4A 1NJWA 4CJQA 1RTJA 1J53A 1BGXT 3AO2A 4AH9A 3V4IA 4PY5A 4RW7A 3TAMA 3OS2A 3K58A 2FBTA 4O5BA 3KJVA 5HRRA 3RMCA 5CYQA 5DMRA 4CJPA 4CHYA 2GV9A 4O0JA 3KLGA 1XWLA 4KHSA 4F2SA 1S1UA 1RTHA 2KZMA 2ETJA 3QO9A 3M8QA 2D5RA 4CK2A 2GBZA 2WONA 3TANA 3M8PA 4DFMA 4DF8A 1GOBA 3DRSA 3IS9A 1K6YA 3JSMA 3ISNC 3AVFA 4KKOA 3QIPA 3RMBA 2DFHA 2RPIA 3DLGA 1JLCA 4FYDA 4FJ5A 1SUQA 1NK6A 2Z1GA 1QHTA 4DSJA 3RRHA 3P1GA 1WLJA 3DLRA 4NCAA 2G8FA 2Y1IA 4CIFA 1JLFA 4CEFA 2HMIA 4FJKA 2FC0A 2B4JA 4BE0A 3OYNA 4CFDA 4YFUA 4FLYA 3FFIA 2HNZA 2G8UA 1HMVA 3KKSA 2YNHA 2DFFA 4H4MA 1C1BA 4LY7A 1JLAA 5HRPA 4FJIA 1S9EA 3AVIA 5CYMA 4CK1A 1ZBUA 1UA1A 2D0AA 4FW1A 2IDOA 4IG3A 4CEBA 1S1VA 4E89A 4DTXA 4OPKA 3AVGA 3U6FA 1S9GA 3CYMA 1C0TA 1S1XA 3RMDA 4JRPA 4FJ9A 4ICLA 3TAEA 1T05A 5J1EA 3SQ2A 4FJ8A 3NAEA 3V9XA 5HRNA 4ELTA 4W5NA 4MFBA 2OZSA 4M42A 3O3HA 3ZSZA 1NKEA 4CERA 1NK4A 4QCLA 2HHTA 4K8XA 3G10A 4W5QA 1C6VA 3SCXA 4KHUA 1BQNA 4F3TA 3SUNA 1DTTA 3O4NA 3VQ4A 3TAFA 3MEGA 3DLKA 3L8BA 3LANA 3DLBA 1TV6A 4CGGA 3ZSWA 3AA4A 3OYJA 3O4QA 2AJQA 4Z4FA 4FW2A 2P1JA 4CGDA 2KQ2A 4FLXA 2QKBA 5HP1A 2IGIA 2LSNA 1BCMA 3ZT3A 4DU3A 3SI6A 3DM2A 3ZT0A 4FJGA 4DF4A 1F21A 3VQAA 3O3GA 1NJYA 4CGHA 4FLZA 4KRFA 3ZSYA 3HSTB 1IKVA 1ASVA 1BISA 5FRMA 3UIQA 4DSLA 2RN2A 4NCGA 1S5JA 4IBNA 3QETA 2HNDA 3TAPA 2W42A 1SV5A 4Z4CA 4FVMA 3OVNA 4W5OA 4B8CA 1LW0A 1L3TA 3K2PA 2XY6A 3QEIA 4FK4A 4B9LA 1RT5A 3KKRA 5K14A 4OKKA 4Z0UA 4N41A 3O3FA 1HQUA 3WNGA 3S3MA 1SKWA 1FK9A 1RT6A 3KIOA 5KTQA 3EY1A 1U04A 1UOCA 1YTUA 1NK7A 4DQIA 4Z4IA 3L2WA 3RTVA 2P5GA 4PUOA 4KHWA 4DQQA 1EP4A 3TARA 2VG6A 1DLOA 4K8ZA 3HPHA 2R7YA 3DI6A 4CFAA 4CEZA 4C8OA 3PX4A 2I5JA 1NK9A 1CXQA 4Z4HA 4RW9A 1UAXA 3QEXA 2XY5A 1RT4A 3DYAA 3G0ZA 2BGGA 3AVHA 1NKBA 3RR8A 1REVA 5C42A 1WSEA 1JLGA 1U4BA 1RBVA 3L2UA 1ZYQA 5KI6A 3THVA 1KTQA 1TGOA 1RT7A 4CK3A 4B9MA 2OPPA 4Y1DA 4B9SA 2BE2A 4CCHA 1L3VA 3CQ8A 2Q3SA 3PX6A 4M3ZA 2HHVA 1LAWA 1RDAA 1UWBA 4FK2A 2QXFA 2YHAA 4DWIA 1VSDA 3L2VA 3LP0A 2HVIA 4WE1A 2IAJA 2NUBA 4FM2A 2FBXA 4C8LA 3EYZA 1RDBA 1HNIA 3ZSOA 3SJJA 2G8IA 1A5WA 1NJZA 1Z25A 3KD5E 4AHRA 3HPOA 2Y1JA 3M8SA 1TL1A 4CF8A 4HHTA 3D45A 4JRQA 4ELVA 4QOZB 4LSLA 1N5YA 4CJUA 3HK2A 1ASWA 4ID5A 1XHZA 3KK2A 5KGWA 1FXXA 2F96A 4FJ7A 3S3OA 1IO2A 2VG7A 3QNOA 1G15A 1KVAA 1A5XA 4RW4A 1C1CA 4CGIA 3K5LA 4DTSA 4N56A 4DQSA 1QTMA 4F4KA 1L5UA 1Q8IA 3NGZA 3KD1E 4J2DA 1BHLA 2YHBA 4BE1A 4I9QA 1JLQA 5DK5A 4DTOA 3RWUA 2B5JA 3TAGA 1QSLA 4FXDA 1SKRA 1TKTA 4AHCA 1KFSA 1S6PA 3P5JA 1WAJA 3CFPA 3SQ4A 4KTWA 4AHUA 1U49A 4B08A 1LWFA 3OJUA 3SV3A 3V81A 3F9KA 3NF7A 1BQMA 1WAFA 3QLHA 2P51A 4OKJA 4FLWA 2XRIA 3ZT4A 3T3FA 3PO4A 1RNHA 2A1RA 4BDZA 3B6OA 4CFBA 3PV8A 1RT1A 4OLBA 3HJFA 3OYIA 1LV5A 4N76A 4E3SA 3HO1A 3BDPA 4GMJB 3B6PA 2JGUA 3SUOA 4Y1CA 3V6DA 2HHSA 3ZT2A 4I2QA 5J2PA 1W9HA 4HUFA 3MXJA 3JYTA 3OS1A 4DFJA 3OYMA 3LP1A 2HHQA 2OA8A 3L2QA 4I7FA 4LH5A 4FJJA 4E1NA 4N47A 2G8VA 3KLIA 1SL0A 4AHSA 1DTQA 2VG5A 3QINA 3VQ6A 4MQ3A 3VQCA 5SWMA 3LAMA 3VQEA 3AO3A 1WSGA 2PZSA 2HHWA 2OPRA 1BIUA 1C0MA 1I3AA 5FDLA 3L3UA 3NE6A 3SQ0A 4KTZA 1GOAA 1L3UA 4KREA 4XIUA 3V9WA 5I3UA 3MXMA 3T1AA 2BANA 4DQRA 4B9NA 3H08A 3AVMA 3KLFA 4F8RA 1JLBA 2ATQA 1BI4B 1XHXA 3VQBA 4DU1A 3M8RA 1TK0A 4OLAA 2X6NA 3LP3A 2KFZA 1VSIA 3NGYA 3NCIA 4BWMA 3F73A 1RDCA 2XY7A 4DG1A 3TR8A 4CESA 3NFAA 4CJEA 4DS4A 3L3VA 5T7BA 5FRNA 2KW4A 2OZMA 4HUEA 3SPZA 1RTIA 3AVBA 1YT3A 3P83D 4W5TA 4CHQA 3V9SA 4FZXC 4W5RA 1IKWA 1IKYA 4H4OA 1NOZA 3LWMA 4IFVA 1RDDA 1D8YA 1VSKA 2Z1JA 3KTQA 4M41A 1MU2A 4B8AB 4ZTJA 5I42A 3OYLA 3LP2A 4DFPA 3MXIA 2YKMA 3NH2A 2ZD1A 3A2FA 3OYBA 1J9AA 2VWJA 1HYSA 4FJNA 4CEAA 4EZ9A 1BIZA 1NKCA 5D3GA 3K5NA 3AO1A 2PYLA 3VQQA 3S9HA 4ELUA 1HRHA 4CHNA 4DSKA 1S1WA 4IFYA 1QS4A 3HXMA 4RW6A 3RR7A 1W0HA 3U3YA 4I2PA 4BDPA 1SL2A 4DTMA 4HTUA 4C8MA 4HCCA 1EX4A 4FJLA 3PUFA 3OYHA 4CHZA 1VSMA 3IAYA 3ASMA 4RG8A 3KK3A 2HVHA 1C1AA 1QSSA 1TAUA 3SV4A 3V9UA 3V1RA 3HVTA 4DTNA 4KHNA 1QE1A 3TAQA 2YV0X 1QQCA 4OGEA 1Z26A 3WNHA 4DLEA 1WSFA 4O44A 2D0CA 1IKXA 1RILA 4DSEA 3AA3A 2WOMA 3NDKA 4CHOA 1TK5A 4F2RA 1X1PA 4JLHA 3SPYA 3LDSA 1X9MA 3HP9A 1LWEA 1L3SA 1WSHA 3AVJA 4KHYA 5JS1A 3OS0A 3HM9A 4JS4A 3AVKA 4CJLA 2G8WA 2D0BA 3ZSQA 1JKHA 3SQ1A 3NGIA 4E1MA 4Z4GA 2G8KA 1B9FA 4OKEA 4DU4A 1LW2A 4C8KA 2Z1IA 4KV8A 3NHGA 2OYQA 4KI4A 4EP4A 5KGXA 3QNNA 1VRUA 1CXUA 4CJRA 4KO0A 1ZBHA 4M45A 3ULDA 1KSPA 2Z1HA 4CJSA 1RTDA 4ZHRA 4BE2A 2RF2A 4PA1A 2EX3A 4Z4EA 3LPUA 4QAGA 2HHUA 1LAVA 2FBVA 3NF8A 3HP6A 4DLGA 3LZIA 3AO4A 3C6UA 2QK9A 4BACA 4KB0A 5CY4A 1KFDA 4DTUA 5HBMA 3RRGA 2ZE2A 1J5OA 1Q9YA 5C24A 4CEOA 1RBTA 5JS2A 3PX0A 4FK0A 3V9ZA 3HPGA 2O4IA 1BL3A 1C0UA 4UQGA 3MEEA 4GW6A 4KTQA 4M3XA 4LSNA 2G8HA 4LD0A 3ZCMA 4HVJA 1KVCA 5J2QA
chains in the Genus database with same CATH superfamily
4FPAA 4H0OA 2HBJA 3C6TA 4FM1A 1ATNA 1VSLA 3M1FA 3NVMA 1I39A 1TK8A 4L8RB 5GAGP 1IBKK 1D9DA 2CGLA 3ALYA 3LL3A 1GOCA 4FCYA 4FWLA 3GE1A 3VGKA 4CGFA 5HOOA 3OJSA 3NH0A 2E4LA 4YOYA 1KD1O 2F8TA 4O4GA 4KAZA 3ZSRA 4E7KA 4TSXA 1Y64A 3AVAA 1VSFA 1WOQA 3C94A 2FBYA 4YHHK 4IZ9A 5AQTA 1S22A 4DV7K 3OBYA 4EP5A 4CJFA 3OYAA 4WF9L 1VQ7N 4MO4A 4M3TA 3OYCA 4BREA 3LALA 3J8AA 1K8KA 1ZBIA 5KPRA 4KFBA 4B9UA 1ILYA 4KPYA 4E7IA 4DSFA 3K5OA 1DEJA 2QWRA 4J2AA 1ASUA 4R5PA 1HQEA 4CJ5A 1HNWK 4JI1K 4BR7A 3K0SA 3IKMA 2D0PA 4DQ8A 2QWMA 3HRGA 5HROA 2E2NA 4J2EA 2X6SA 4CGJA 3G6EN 1ZBFA 1VRTA 4J2BA 3HL8A 2O4GA 3O08A 3C7NA 2FF6A 2RKIA 3P4IA 3LZJA 3PIOL 4BR5A 2HNYA 4B1WB 3FGUA 3KK1A 3QEVA 4DMNA 3VPZA 4IDKA 5SZTA 4Q0BA 1HLUA 2X74A 4IXCA 4HCBA 4M7XA 5C2DA 4JI7K 1YIJN 2DTUA 3E9LA 4ILGB 3OYFA 3DJCA 3VA3A 3NF9A 3OYDA 3IG1A 2KLAA 4CF1A 4AILC 1TAQA 3MX2A 1TKDA 2BDPA 2QXLA 2W40A 4BRDA 4OVLA 5CHIA 1SZ2A 5J2MA 5HLFA 4IFEA 1ZXOA 1TKZA 1TL3A 4LFBK 3CERA 3DRRA 1MWMA 3QESA 4OO1J 2HHXA 3O9QA 5AQMA 3NH1A 5DM7L 2DY4A 2GWKA 2E8AA 2E6MA 2QI2A 3DMJA 4LH4A 3O5BA 2JLEA 3K5MA 3C7NB 4ISFA 1IG9A 4OJRA 4CZLA 1RTJA 4CZIA 1J53A 2GX9A 4IOCL 4AH9A 1HKBA 3O4WA 4CJPA 1K8AO 3CJCA 4KHSA 1S1UA 4YORA 1GLCG 1EWRA 1U6ZA 3WEEA 2GBZA 3TANA 3VESA 1ATRA 3ISNC 3AVFA 2ZJPL 2RPIA 5LMNK 1BA0A 4I6MA 1NK6A 1DT9A 1U2VB 2G8FA 3DXMA 2Y1IA 5AQJA 3VTHA 4FJKA 4FWOA 4CFDA 4FLYA 1HMVA 2FF3B 3KKSA 5HRPA 1GLAG 2RE2A 1N32K 1P90A 4DR2K 5CYMA 4KH4A 1UA1A 4IG3A 2BUPA 1S1VA 3FZHA 3QBWA 4DTXA 1C0TA 4BVPA 1XUPO 3KVGA 4BGBA 3RMDA 3ENBA 3SQ2A 2ASMA 1X3MA 1NKEA 4QCLA 1ZC6A 3G25A 3LDPA 3G10A 3N4QA 5AJ3K 2HF4A 4E1JA 1C6VA 2V51B 3O1BA 3O4NA 1IBLK 3MEGA 3DLKA 5AZIB 3L8BA 1TV6A 4H03B 1EO1A 3ZSWA 3AA4A 4Z4FA 4CGDA 2KQ2A 2QKBA 2P9UA 5HP1A 2FSKA 2O8EB 3ZT3A 2NRXA 3TSPA 4FJGA 3O3GA 1NGGA 4LF4K 2E2OA 1IKVA 1BISA 5FRMA 3D7EO 2RN2A 1S5JA 4IBNA 5FPDA 4W5OA 3J81O 4K0KK 1LW0A 2BH1A 4JK7A 4B9LA 4L3QA 3KKRA 4N41A 3O3FA 1HQUA 3WNGA 1FK9A 4JK8A 3KIOA 4C23A 4YOTA 4R79A 1YHQN 3L2WA 4KHWA 1VQ4N 3N4PA 3HPHA 3IUCA 3W3DA 3DI6A 1YUWA 4CEZA 1SS6A 2GWJA 1WBBA 4JI5K 4Z4HA 1UAXA 4A2AA 3QEXA 4B3SK 2O8DB 3AVHA 2ZGZA 3VMFB 3J7ZO 5C42A 4DUZK 4O8UA 3EKUA 4BRHA 3THVA 1KTQA 4BRLA 3C65A 1RT7A 1YJ9N 3ID8A 2GUPA 2Q0RA 3ZX2A 3CQ8A 1NGFA 4M3ZA 1LAWA 4FK2A 5KQDA 2NRRA 4DUYK 2AA4A 4FM2A 1SAZA 3EYZA 1HNIA 3SJJA 1A5WA 4JHDA 1TL1A 4QOZB 3W0LA 1N5YA 3UKUB 4JKHA 4DR6K 4A5BA 5JMVA 2VG7A 4CGIA 4DTSA 1QTMA 5TKWA 4IO9L 4BC4A 3NGZA 1Q7YO 5M1FA 2P9SA 2B5JA 1QSLA 4BQLA 1TKTA 1KFSA 3P5JA 1TYQA 4Y0WA 3WQUA 4AHUA 1LWFA 3ZETA 3WXJA 3SV3A 3F9KA 3AY9A 1WAFA 1KAZA 1QQMA 2VCPA 2XRIA 3ZT4A 4BDZA 2QA4N 3P31A 1RT1A 3HJFA 5AQXA 4E3SA 4BC3A 3WUHA 3HO1A 3D2EA 4K25A 3EKSA 2JGUA 4Y1CA 2UUBK 2HHSA 4I2QA 4C1NK 3MN9A 2IVPA 1QHAA 3CD6N 5AQIA 4N47A 2G8VA 4XH5A 2PZSA 1WSGA 4IJAA 1C0MA 3SQ0A 1GLFO 3PSFA 5TKYA 3H08A 3KLFA 1EQYA 1XHXA 4Z94A 3FLCO 4OLAA 3NGYA 2XY7A 4DS4A 4CESA 3NFAA 2KW4A 2KKZA 3EE8A 1ZBSA 4HUEA 3T7ZA 1YT3A 2O8FB 4FZXC 3MK6A 3V9SA 4A59A 4XEIA 4EHTA 1NOZA 1RDDA 5CE3A 5C12A 5I42A 3LP2A 3NH2A 3A2FA 3SK3A 3UKRA 4G9ZA 1NKCA 1S3XA 3HTVA 1YJWN 2NRZA 2PYLA 3S9HA 1XMQK 1WBDA 3VEXA 4DSKA 1S1WA 4BROA 5JVHL 1QS4A 3RR7A 1NGBA 4FWKA 2WBNA 3ASMA 5M1OA 5BRDA 1QSSA 4DTNA 3V9UA 5BPLA 4LF8K 3MCAB 2YV0X 3TSUA 4QS8A 1HNZK 4K42A 3L6QA 4O44A 1IKXA 3RVCA 5ADXA 4F2RA 3O9SA 4JEPA 5KPZA 1X9MA 3SAHA 4CBXA 2G8WA 3EZWA 3NGIA 5GAEP 4E1MA 2G8KA 1XMOK 5FLXO 4DU4A 2Z1IA 4KV8A 4F9OA 4WQ5A 4YDUA 3AAPA 5A2QO 1VRUA 4CJRA 3I55N 1KSPA 1NLVA 2Z1HA 5M1KA 4BE2A 4DV2K 4PA1A 4H0PA 3CMAN 4BACA 4BRIA 5HBMA 3UB5A 1NGAA 2VGMA 3BP8A 1BWFO 2A6AA 3PX0A 3VETA 2FLOA 2O4IA 4UQGA 4M3XA 3QBXA 3R3LA 1K9MO 5AQPA 4AF1A 1YTAA 4CJTA 3SJHA 3HT3A 1NK5A 4DSIA 2ZGYA 3CCMN 2E1ZA 3R6MA 4CIEA 4KI6A 2QKKA 3TABA 4I9LA 3G71N 3IRXA 3VQPA 4FVUA 3KK7A 2IVOA 3GG4A 1M1KO 4CJ3A 3GDQA 3QERA 1A5VA 1TUUA 3AA2A 4PQUA 1RT3A 4OGCA 2V7ZA 5MLCQ 4BR4A 2UUAK 2JWKA 3K59A 1T03A 1SL1A 1CLQA 4DV0K 4IOAL 4CJWA 5E84A 5FPEA 3CCUN 2GUIA 2HW3A 3GL1A 4DV3K 4M3RA 3LAKA 4LF9K 2J4RA 1RT2A 4CJVA 2NZTA 5FROA 5LL6Z 1IH7A 4ZTFA 3A0IX 3OY9A 1R0AA 4CEEA 3QEWA 3U3GA 4X66K 3S3NA 4FWSA 2O8EA 5JVGL 4AHTA 1O13A 3SYZA 3L4QA 3CXCM 4E0DA 2VYPA 1HUXA 5HRSA 1VSEA 4NYFA 4WCEL 5E41A 4WQ4A 3PO5A 4CF9A 3F2KA 3VQ5A 4GVMA 5KRSA 3VQDA 4DQPA 1NGCA 3KLEA 3NBPA 4BDYA 5LJVA 4JHDB 4CEQA 1CZ9A 4FL9A 3CM5A 4FJHA 4C8NA 4A62A 1KLNA 2A40A 1BDGA 2HB5A 1MWKA 2GTDA 2IOCA 2ITGA 4FJXA 1VSHA 4CD1A 3U4LA 3HVRA 4FJMA 4Q5VA 4HTLA 1Q9XA 1NOYA 4BR0A 3Q7BA 5C25A 3LPTA 1T8EA 3I0SA 4BWJA 1ITGA 1NU0A 2XO7A 1N6QA 1LOTB 2A5XA 2IC3A 4WQ4C 5AQWA 1UA0A 1O1WA 3RSEB 4EAHD 3ID6A 4E7LA 2PBDA 1NGIA 4CZFA 1SKSA 4DTJA 4B9VA 5EU7A 5KPTA 3DXKB 5J2NA 3AVNA 2YNGA 3BZKA 2FXUA 4E19A 3AVCA 3DLEA 4PKIA 5CZ1A 1HYZA 4E7JA 4CE9A 1QQNA 1RCHA 4O55A 2UXBK 1Y97A 5BRHA 4JI3K 3O9RA 3I0RA 3K57A 3NVKA 1LWCA 1VSJA 3OYKA 2P9KB 1U45A 5BREA 1NJWA 1BGXT 4JI2K 2YJEA 1KAXA 4JV5K 4CHYA 5DMRA 3NMUA 2ZJQL 1E4FT 4DV6K 3M8QA 2D5RA 5BR9A 2W41A 3M8PA 4DF8A 3EL2A 1GOBA 3SAFA 4KKOA 2DFHA 4FYDA 4GVEA 2HMPA 2HSTA 3RRHA 3ENOA 3DLRA 3QB0A 1QVGM 5F1XA 4BE0A 3OYNA 2G8UA 2YNHA 1JLAA 4XH1A 3UKUA 4FW1A 3MN7A 3AVGA 1S9GA 1HJOA 3BF1A 4BY9C 4ICLA 5HRNA 5M1PA 2P9KA 3O3HA 4DV1K 4CERA 2O8CA 4YY3K 3VF6A 4DB3A 4KHUA 1BQNA 3VQ4A 2AJQA 2P1JA 2IGIA 3ZT0A 4DF4A 3SBTA 4FLZA 1NJYA 3HSTB 3HOTA 3ATUA 4NCGA 3C6HA 2HNDA 4GV6A 3LM9A 1SV5A 4X65K 3OVNA 1L3TA 3PSIA 3VEYA 2XY6A 3QEIA 1RT5A 4Z0UA 2D1KA 3EO3A 5KTQA 1U04A 1UOCA 3EY1A 3KHYA 4DQIA 4JYAK 4Z4IA 2P5GA 2FSNA 3DWLA 1VQ8N 2R7YA 1BA1A 4BRQA 2I5JA 4O8KA 4UY8O 1CXQA 1IJJA 5AQYA 3VGMA 3TTFA 2QTDA 1RT4A 1RFQA 4BRKA 2V7YA 1WSEA 4I6MB 1JLGA 1RBVA 3H3NO 3L2UA 5KI6A 3WT0A 5AQRA 1TGOA 3GBTA 2OPPA 3E9OA 2BE2A 3CC4N 1L3VA 2ASOA 2HHVA 1RDAA 1VQ6N 3VEOA 2QXFA 4BR9A 3LP0A 3P38A 2IAJA 1NWKA 2NUBA 4C8LA 1RDBA 3ZSOA 3ULEA 2G8IA 1Q86O 1NJZA 1QZ6A 4CF8A 4JRQA 4LSLA 3HK2A 1XC3A 1XHZA 2F96A 1VQPN 4FJ7A 4JN4A 3S3OA 5AZJB 3QNOA 3CIPA 3CCQN 4RW4A 1C1CA 4F4KA 1L5UA 2QWQA 1JLQA 3QFUA 2P9NB 1FJGK 2HOEA 1WB9A 3TU5A 4KTWA 4B08A 3NF7A 1CZAN 3QLHA 3THWB 3PO4A 1RNHA 3RSEA 3H6EA 3BF3A 4N76A 2YI1A 4GMJB 2ITMA 3V6DA 3EE9A 2HHQA 2ZF5O 4CJ7A 3OS1A 4B3RK 2HF3A 4FJJA 4GY2B 5AQSA 3KLIA 2WC9A 1SL0A 4AHSA 2VGNA 1DTQA 3VQ6A 3AO3A 1T3VA 2OPRA 3O1WA 5FDLA 4KREA 2BANA 1NGHA 4B9NA 3AVMA 2ZWHA 1JLBA 2ATQA 4BRCA 4RTFD 3VQBA 4DU1A 3ZYYX 2KFZA 2Q1NA 3NCIA 5T7BA 1E3MA 5GINA 1NJIO 2WTUA 3M3ZA 3LWMA 4BVOA 4IFVA 1VSKA 4B1ZA 3KTQA 4M41A 4IEEA 3I56N 2JWLA 4FOIA 4JKGA 2VWJA 1HYSA 4CEAA 2QWOA 3MWTA 1BIZA 4NLBA 4DR4K 3OHRA 2H3GX 3FZKA 1HRHA 3FE1A 5GADP 4IFYA 5F0XA 2NLXA 3HXMA 3SAGA 4BDPA 4I2PA 1BG3A 4RCHA 5GIOA 4HTUA 1VSMA 1SQKA 3KK3A 1TAUA 4KHNA 4BG8A 3HVTA 2E88A 4LF6K 3IDHA 3WNHA 3CPWM 1WSFA 2D0CA 2P9SB 1K8KB 1RILA 3NDKA 4CHOA 1X1PA 1GLLO 1LWEA 1WSHA 1JCEA 5JS1A 3L0QA 4CJLA 2YHXA 1T44A 3ZEUA 2CGKA 4ILHA 4KI4A 2OYQA 1P8ZA 4DCHA 4WYBA 1CXUA 3LDLA 3OTOK 4ZHRA 2RF2A 1QVFM 1KQSM 4ISEA 2IIRA 3R1XA 2E20A 2FBVA 3NF8A 2QK9A 3LZIA 1V4SA 4JNEA 4DR1K 3HZ6A 5CY4A 1KFDA 1W2BM 2HBLA 3CCRN 5C24A 3AGKA 1YAGA 1C0UA 2FSJA 4B3TK 1KVCA 1OH8A 5J2QA 4FZYA 1RBUA 2UXCK 3A5MC 1HNVA 3C95A 4B9TA 3DOKA 4DS5A 1QSYA 5AFUA 3CMEN 4CF2A 1W97L 3VN5A 1YVUA 5AQVA 1VQNN 1J54A 1NBWA 1RBSA 2P5OA 4CZGA 4H0VB 1WSJA 3WNEA 4NB4A 4LF7K 1T7PA 3IFRA 3ATVA 5AFUH 5LMUK 1U47A 1G99A 3ZEUB 2Q2RA 1FKOA 2UXDK 3FZFA 4CJKA 5AQNA 1U2VA 1YITN 3MAQA 4DTRA 3CC2N 4BRAA 3AAQA 1HPZA 3BY5A 3TWHA 1KLMA 1OH6A 1CZBA 4CD3A 1JLEA 1OVQA 4OX9K 3LWLA 3EZ5A 3H1VX 1JL1A 4FSVA 4MLHA 2E6LA 2X78A 3L2RA 3VQ7A 2HBMA 2QW9A 4OPHA 3NF6A 3TPQA 4BRPA 5FPNA 1Q82O 1JJ2M 3MX5A 3KLHA 4IG0A 3ZSVA 4CEDA 4G1QA 3F9MA 4IO8A 4M3YA 2P9PB 4NYNA 4F3OA 5AQLA 3K9JA 1GLDG 4M3UA 1KCFA 4FWMA 3WEEB 4E7HA 2VWKA 4H5WA 4YOVA 1B92A 3AA5X 3MECA 4DFKA 2WFBA 1B9DA 4KHQA 4J8FA 5AQHA 2VQEK 2DPNA 3WNFA 4O0IA 1J5EK 1KRPA 4MLEA 1H1VA 4OPAA 1WSIA 3SUQA 4YOWA 3QFPA 2CH6A 1HJRA 4CHPA 4KB1A 3ITHA 3QICA 3WXLA 3CCLN 4YNQA 4JS5A 2O8CB 3OYEA 3CJAA 4DV4K 4JK9A 3T1YK 3VQ9A 2VQFK 1BUPA 3PLAA 3T69A 3VENA 4AQYK 3AVLA 1NM1A 4WQ5C 4FWRA 4H8KA 2KTQA 1LCUA 1JL2A 2OPSA 5CZ2A 3HSCA 4BG9A 1JCGA 3TSQA 1JXBA 4CECA 3WQTA 1TVRA 4ID1A 5CR4A 2DFEA 3DOLA 4CF0A 1XI1A 3ZLJA 4GKKK 3MCPA 2A41A 1VQKN 4EZ6A 4FLVA 2QWPA 1OH5A 3THWA 1KC8O 4FPBA 4FLUA 3SNNA 1OVYA 3TI0A 4BC2A 4CJ4A 1YXQA 1NMNA 3E1YA 4CJQA 4PL7A 4DV5K 3V4IA 2OTJN 3TAMA 2QWNA 3OS2A 3K58A 4O5BA 3RMCA 3KLGA 1XWLA 3T1HK 4JKBA 4F2SA 3G4SN 4CK2A 2NNWA 2WONA 4DFMA 3DRSA 1ATSA 3IS9A 3QIPA 3DLGA 1SUQA 4A5AA 3IMXA 3P1GA 3CCJN 1YF5L 4M7YA 1NG9A 3O6WA 1JLFA 4CEFA 4CIFA 2HMIA 2FC0A 1M90O 4YFUA 3H46O 3FFIA 3VEVA 4LY7A 4FJIA 3MWPA 4CZJA 3UKRB 3SBGA 3H45C 1ZBUA 4CBWA 3U9DA 2IDOA 4E89A 2QEXN 4EFHA 5JICA 3E66A 4OPKA 1QZ5A 3ULEB 1S1XA 5AQUA 3TAEA 5J1EA 3OW2M 3NAEA 4PKGA 3L4IA 4MFBA 3SMPA 3ZSZA 4WFNL 2HHTA 1D4XA 4K8XA 3FZMA 4W5QA 4B1YB 1ESVA 3SUNA 3R8EA 1YVNA 1DTTA 3TAFA 3LANA 3DLBA 5BN8A 4CZMA 3OYJA 2O8FA 4H5TA 4FLXA 4BR2A 4DU3A 1XQSC 1F21A 4HWIA 4KRFA 3ZSYA 5GAHP 1BOTO 3SLCA 3D2EB 3QETA 2NRVA 2W42A 4FVMA 5DM6L 4B8CA 3K2PA 1V4TA 4KH6A 4JI0K 4MDAA 5K14A 4OKKA 1C0FA 4DR3K 1SKWA 1YTUA 1NK7A 5ADXH 4PUOA 4DQQA 3HOSA 3TARA 4JKAA 4K8ZA 3CHWA 5EXWA 3DXMB 3VOVA 1NK9A 3THXB 3C0BA 1QQOA 2XY5A 3PIPL 1NKBA 3ENHA 1REVA 3U9ZA 1ZYQA 3CPEA 4CK3A 4B9SA 4CCHA 3PX6A 1NGJA 3CETA 2RHKA 1UWBA 1VSDA 3H1QA 4KH5A 3TTCA 4CZHA 2A3ZA 3FFKB 4X62K 3KD5E 4AHRA 3HPOA 4M63C 5IWAK 3D45A 4ELVA 4CJUA 4JKDA 1IBMK 5KGWA 4DHYA 5EOYA 1G15A 1KVAA 3K5LA 4N56A 1Q8IA 3KD1E 1BHLA 4IWVA 4I9QA 4DTOA 5DK5A 3RWUA 3TAGA 4JD2A 2EWSA 4FXDA 5EVZA 1GLBG 1SKRA 2QM1A 1S6PA 3CFPA 3JAMO 4EHUA 1XNQK 4DR7K 2PAVA 1BQMA 3D6RA 2P51A 2P9UB 1N36K 3T3FA 3B6OA 4FOEA 4CFBA 3OYIA 1LV5A 4YOUA 4H0YB 2YCHA 3BDPA 5J2PA 1W9HA 4DKWA 3MXJA 3H3OB 4JI4K 3OYMA 4E1NA 2Q97A 2VG5A 3QINA 5SWMA 4MQ3A 3A5OC 3VQCA 4ISGA 2HHWA 1I3AA 3L3UA 5EY4A 2ZM6K 1L3UA 3OA9A 4XIUA 3MXMA 3T1AA 3I8BA 1VQON 3AARA 1BI4B 1BO5O 1HPMA 2KHOA 3M8RA 2OANA 2X6NA 5E26A 4BC5A 5AZJA 4BWMA 1RDCA 1X3NA 5JLFA 4CJEA 5FRNA 2OZMA 3VGLA 1RTIA 4YDUC 2P9LA 4W5TA 4CHQA 3O80A 4W5RA 5C0YA 4BRNA 1IKWA 4H4OA 1Q81O 4ILJA 2Z1JA 1MU2A 4B8AB 4ZTJA 4K43A 2ZD1A 3LM2A 1J9AA 2OCEA 4FJNA 5D3GA 1Z05A 1GLEG 3CJ9A 2HHHK 4RW6A 4PL8A 3U3YA 2P9NA 4C8MA 5GIPA 4HCCA 4FJLA 3PUFA 3IAYA 2HVHA 3O9UA 1C1AA 3SV4A 3BUZB 5AQGA 4OGEA 4DLEA 3BEXA 3KZBA 2WOMA 3HM8A 1OH7A 3SPYA 4K41A 1W7AA 4JD2B 1L3SA 4KHYA 3HM9A 4JS4A 3FR0A 2PFUA 2D0BA 3ZSQA 1JKHA 4X64K 2OTLN 1XNRK 4AM7A 2CH5A 4OKEA 1J6ZA 4EP4A 5KGXA 3QNNA 3LDNA 4KO0A 1ZBHA 4M45A 3C6AA 1RTDA 1VAZA 2HHUA 3HP6A 4DLGA 4FWNA 1VQMN 4DTUA 4BRGA 1J5OA 3EEQA 4CEOA 1RBTA 5JS2A 3V9ZA 2F9WA 4IDHA 4CI6A 3CJ7A 1BL3A 1YI2N 4KTQA 1R59O 3CC7N 4LD0A 3ZCMA 4FJ8A 3CQXA 4MO5A 4RW8A 3TTDA 3T19A 4OPJA 1NK0A 1VQLN 4A57A 3QIOA 3ZX0A 4B9QA 3A5LC 3CG7A 2IS3A 3OBWA 2YKNA 2W6LA 4H5NA 3MMVA 4WFAL 4DTPA 2P9IB 1N33K 3VTIA 1BU6O 3V1OA 4N5SA 3CJBA 1KVBA 2YNFA 2P9IA 3SUPA 2PY5A 3D0PA 4YOXA 1ZBLA 1D9FA 3AO5A 1JXEA 3MN5A 2YHYA 2BTFA 2KZZA 3BGRA 3QEPA 4GV9A 1EKEA 4FZZA 2YX6A 2W6KA 5B8HA 5I9EB 4QS7A 3AV9A 1U48A 1HR0K 5AQKA 4CIGA 3ZSXA 4M3WA 1D5AA 4RWTA 1WUAA 3HYFA 4JKGB 1FW6A 4B1VA 2GELA 1WNSA 3ZT1A 2PYJA 1MA9B 4NCBA 3J7YP 1TKXA 4U7BA 3JXUA 2A1SA 3V1QA 4CFCA 1FKPA 1DGKN 1Q18A 1EETA 3A5NC 3E01A 3MEDA 4JKCA 3CCVN 3SZ2A 2XHBA 5KRTA 3WXKA 1S1TA 4IOXA 4PWDA 1S6QA 2CGJA 4CBUA 3CM6A 2GEMA 3D2FB 3B8AX 3DAWA 4H0TB 4KHPK 2EHGA 2ZQBA 3THYB 3PY8A 5BR8K 1RGIA 2AP1A 3AGRA 3DRPA 5C10A 4FM0A 3MDQA 3CFOA 4XH4A 2XY8A 5F2RA 5HL7L 1RDWX 1NMDA 1EXQA 4WFBL 1X9JA 2F9TA 4NXNK 2O8BA 1WN7A 3ZX3A 5BPNA 3RMAA 3WXMB 4BRFA 4FLTA 3VEWA 3VA0A 1RDUA 2OPQA 1BCOA 3HI0A 5AQFA 1VK0A 3CFRA 5BN9A 3A8YA 1HKCA 1NK8A 3VQ8A 3I8DA 1X9WA 3DLHA 3E9PA 1RBRA 2F8SA 1HYVA 3I33A 4FWQA 1NJXA 2P9LB 1BI4A 3J80O 4HUGA 4AHVA 3M5RA 1XC9A 1JCFA 2YNIA 3OYGA 1X9SA 4LFAK 4B3MK 4B3OA 2B6AA 2KFNA 1HX1A 2UYTA 4IKFA 3AO2A 1NGEA 2A42A 4H0XB 4PY5A 4RW7A 2FBTA 1EWQA 4GKJK 2O8BB 3KJVA 5HRRA 4H5VA 5CYQA 3WXIA 2GV9A 4O0JA 2UUCK 1YJNN 1RTHA 2KZMA 2ETJA 5H1SQ 3QO9A 2NRHA 1IV0A 4B1XB 1K6YA 3JSMA 3RMBA 3LDQA 2E1YA 1JLCA 2D4WA 4FJ5A 1QHTA 2Z1GA 4DSJA 1WLJA 2Q0UA 3P39A 4NCAA 5IT9O 3KWGA 3ZETB 2B4JA 1TYQB 1VQ5N 3QDKA 2E2PA 2HNZA 2HBKA 2DFFA 4H4MA 1C1BA 1S9EA 3AVIA 4MDBA 4CK1A 2D0AA 4IJNA 2Q31A 4CEBA 1OKJA 1GLJO 3U6FA 3CYMA 5C15A 4JRPA 4FJ9A 1T05A 3V9XA 4W5NA 4ELTA 2V52B 2OZSA 1IG8A 4M42A 2I7PA 1NK4A 5AR0A 4DR5K 4FO0A 2YHWA 2E2QA 3SCXA 4F3TA 4BGAA 4IEIA 5LY3A 4LC9B 3SMSA 3O4QA 4H5RA 1KAYA 4FW2A 2LSNA 1BCMA 2I7NA 3SI6A 5ELZA 3DM2A 2ASPA 3VQAA 4CGHA 4JI6K 5BRFA 5AQQA 5LJWA 2IVNA 1MDUB 1ASVA 2WUSA 3UIQA 4DSLA 1N34K 5FPMA 3TAPA 3O8MA 4Z4CA 4NO7A 4AM6A 3HBTA 1HNXK 4FK4A 3S3MA 1RT6A 4CZKA 2Q36A 3RTVA 1EP4A 3DXKA 4NXMK 2VG6A 1DLOA 4CFAA 2VWBA 4C8OA 3PX4A 4CVNE 1I94K 4RW9A 4A2BA 3THYA 3DYAA 3D2FA 3G0ZA 2BGGA 3RR8A 1KXPA 1U4BA 4B9MA 5M1QA 1T6DA 4Y1DA 3CI5A 2Q3SA 4GV3A 2YHAA 4DWIA 5M1NA 3L2VA 2HVIA 4WE1A 2FBXA 1N8RO 1Z25A 2Y1JA 3M8SA 4HHTA 1ASWA 4ID5A 3KK2A 1FXXA 3MN6A 4LF5K 1IO2A 5BPMA 4PHTX 1A5XA 4DQSA 1HKGA 3VERA 4J2DA 4BE1A 2YHBA 2NRWA 2NRTA 3KWIA 4JKEA 4BRMA 2F4VK 4AHCA 3SQ4A 1WAJA 1U49A 3OJUA 3V81A 4OKJA 1Z6RA 4FLWA 2D0OA 2A1RA 4A61A 3PV8A 3O9TA 4OLBA 5EX5A 4LFCK 2ZJRL 3SUOA 3B6PA 3ZT2A 4HUFA 2YJFA 3JYTA 4DFJA 3LP1A 2OA8A 5KQ8A 3L2QA 4I7FA 4LH5A 1S72N 3LAMA 3VQEA 1BIUA 3GOIA 4KBOA 3JS6A 3NE6A 4KTZA 1GOAA 3DLLL 3V9WA 5I3UA 1TUYA 4DQRA 1NNEA 1VQ9N 5AQOA 4F8RA 1TK0A 3LP3A 1K73O 3M6GA 1VSIA 3BZCA 3F73A 3CCEN 4DG1A 3TR8A 3L3VA 3K9KA 1DKGD 3VF4A 3SPZA 3AVBA 3P83D 1IKYA 1D8YA 3VEZA 3OYLA 4DFPA 3MXIA 2YKMA 3OYBA 2QWLA 3F5TA 4EZ9A 3LDOA 3K5NA 3AO1A 3VQQA 4ELUA 3J7AP 4U67L 4CHNA 3CJ1A 1W0HA 1SL2A 4DTMA 1EX4A 4V19S 3OYHA 4CHZA 4CZEA 1C0GA 4RG8A 2P9PA 3V1RA 5C2FA 1QE1A 3THXA 3TAQA 3UE5A 1E4GT 1QQCA 1VHXA 1Z26A 4PKHA 4B1UB 4DSEA 1TK5A 3AA3A 5AQZA 4BQZA 3QMLA 4JLHA 1T6CA 4CW7B 4JKFA 3LDSA 3HP9A 3AVJA 3OS0A 3AVKA 4JAXA 4GNIA 3SQ1A 4QS9A 4JI8K 4Z4GA 1B9FA 4NLCA 3U8XA 1LW2A 4C8KA 3NHGA 4O5FA 3CCSN 3ULDA 4EIAA 4CJSA 3R9PA 4C1NI 4Z4EA 2EX3A 3Q7CA 2UU9K 3LPUA 1NGDA 4QAGA 5JLHA 1LAVA 2F7TA 3AO4A 3C6UA 4KB0A 3RRGA 2ZE2A 3S41A 3CQYA 1Q9YA 5AZIA 3CF5L 4FK0A 3HPGA 2E5LK 4FWPA 2O8DA 3MEEA 4GW6A 4LSNA 3FZLA 2G8HA 3EN9A 4HVJA 4CGGA 3VF2A
chains in the Genus database with same CATH topology
4FZYA 1RBUA 3C6TA 4FM1A 4RW8A 1VSLA 1YTAA 1HNVA 4CJTA 3T19A 4OPJA 3C95A 3HT3A 1I39A 1NK5A 3DOKA 4DS5A 1TK8A 1NK0A 1QSYA 4B9TA 4DSIA 4L8RB 4CIEA 4CF2A 3QIOA 1D9DA 3VN5A 1YVUA 4KI6A 1J54A 1RBSA 3CG7A 2IS3A 3TABA 4I9LA 2QKKA 3IRXA 3VQPA 2YKNA 2P5OA 3ALYA 1WSJA 3WNEA 1GOCA 4CJ3A 3QERA 1T7PA 4FCYA 1A5VA 3AA2A 4PQUA 4DTPA 4CGFA 1RT3A 4OGCA 3V1OA 4N5SA 3NH0A 3OJSA 1U47A 2E4LA 2F8TA 1KVBA 2YNFA 3SUPA 2PY5A 4O4GA 3D0PA 3K59A 3ZSRA 1SL1A 1FKOA 4E7KA 1T03A 4KAZA 4TSXA 3AVAA 4CJWA 1VSFA 1ZBLA 1CLQA 4CJKA 2GUIA 3C94A 1D9FA 2HW3A 3AO5A 3MAQA 1JXEA 2FBYA 4DTRA 4M3RA 3LAKA 1HPZA 1RT2A 4CJVA 2KZZA 3BGRA 5FROA 4EP5A 3QEPA 1IH7A 3TWHA 1EKEA 4CJFA 4ZTFA 4FZZA 3OYAA 1KLMA 3OY9A 1R0AA 4CEEA 1CZBA 4M3TA 3QEWA 3U3GA 1JLEA 3S3NA 3OYCA 3AV9A 1U48A 4AHTA 3LALA 3LWLA 3SYZA 4CIGA 3EZ5A 4E0DA 1ZBIA 3ZSXA 4M3WA 5HRSA 4KFBA 1D5AA 1VSEA 3HYFA 4NYFA 5E41A 4B9UA 4KPYA 4E7IA 4DSFA 3K5OA 1JL1A 3PO5A 4J2AA 4CF9A 3VQ5A 2E6LA 2X78A 1ASUA 4GVMA 3VQ7A 1HQEA 3VQDA 4CJ5A 5KRSA 4R5PA 3L2RA 4DQPA 1WNSA 3ZT1A 3NF6A 2PYJA 3KLEA 4NCBA 1TKXA 2A1SA 3V1QA 4CFCA 3KLHA 3NBPA 1FKPA 4IG0A 4BDYA 1EETA 3ZSVA 3E01A 3MEDA 4CEQA 1CZ9A 4CEDA 4G1QA 3SZ2A 2XHBA 5HROA 5KRTA 4M3YA 3CM5A 4J2EA 4FJHA 4C8NA 1S1TA 2X6SA 4NYNA 4CGJA 1KLNA 4F3OA 4PWDA 1ZBFA 1VRTA 4J2BA 3HL8A 2HB5A 2O4GA 1S6QA 2IOCA 4M3UA 1KCFA 2ITGA 3CM6A 4FJXA 1VSHA 2RKIA 4E7HA 2EHGA 2ZQBA 3PY8A 2VWKA 3DRPA 1B92A 3AA5X 3MECA 3LZJA 2HNYA 4DFKA 3HVRA 4FJMA 4FM0A 1B9DA 4KHQA 3CFOA 3KK1A 2XY8A 4Q5VA 3WNFA 4O0IA 3QEVA 1Q9XA 4DMNA 4IDKA 5SZTA 1KRPA 4Q0BA 1EXQA 1WSIA 1NOYA 2X74A 4HCBA 5C25A 3SUQA 3LPTA 1T8EA 3I0SA 1HJRA 4BWJA 4CHPA 1ITGA 1N6QA 2XO7A 2DTUA 4KB1A 3ITHA 2IC3A 1UA0A 1O1WA 1WN7A 3OYFA 4YNQA 4JS5A 4E7LA 3OYEA 3VA3A 3NF9A 3OYDA 3RMAA 3IG1A 4FLTA 4CF1A 1SKSA 3VA0A 1TAQA 4DTJA 4AILC 2OPQA 1TKDA 1BCOA 2BDPA 4B9VA 3VQ9A 5EU7A 1VK0A 3CFRA 4OVLA 3AVLA 5J2MA 5HLFA 1NK8A 5J2NA 4H8KA 3VQ8A 3I8DA 2KTQA 3AVNA 1X9WA 1JL2A 2YNGA 3DLHA 2OPSA 1TKZA 5CZ2A 1TL3A 2HHXA 1RBRA 3DRRA 3AVCA 3DLEA 4E19A 1JXBA 4CECA 3QESA 5CZ1A 3NH1A 1HYVA 2F8SA 1HYZA 2DY4A 1TVRA 4ID1A 4E7JA 1NJXA 4CE9A 2DFEA 3DOLA 4CF0A 1BI4A 1XI1A 1RCHA 4O55A 2E6MA 4HUGA 4AHVA 3DMJA 1Y97A 1XC9A 2YNIA 3OYGA 1X9SA 4EZ6A 3I0RA 3K57A 4FLVA 4B3OA 4LH4A 2B6AA 1LWCA 2KFNA 2JLEA 3K5MA 4FLUA 1VSJA 1IG9A 3OYKA 3SNNA 1U45A 4IKFA 4OJRA 3TI0A 4CJ4A 1NJWA 4CJQA 1RTJA 1J53A 1BGXT 3AO2A 4AH9A 3V4IA 4PY5A 4RW7A 3TAMA 3OS2A 3K58A 2FBTA 4O5BA 3KJVA 5HRRA 3RMCA 5CYQA 5DMRA 4CJPA 4CHYA 2GV9A 4O0JA 3KLGA 1XWLA 4KHSA 4F2SA 1S1UA 1RTHA 2KZMA 2ETJA 3QO9A 3M8QA 2D5RA 4CK2A 2GBZA 2WONA 3TANA 3M8PA 4DFMA 4DF8A 1GOBA 3DRSA 3IS9A 1K6YA 3JSMA 3ISNC 3AVFA 4KKOA 3QIPA 3RMBA 2DFHA 2RPIA 3DLGA 1JLCA 4FYDA 4FJ5A 1SUQA 1NK6A 2Z1GA 1QHTA 4DSJA 3RRHA 3P1GA 1WLJA 3DLRA 4NCAA 2G8FA 2Y1IA 4CIFA 1JLFA 4CEFA 2HMIA 4FJKA 2FC0A 2B4JA 4BE0A 3OYNA 4CFDA 4YFUA 4FLYA 3FFIA 2HNZA 2G8UA 1HMVA 3KKSA 2YNHA 2DFFA 4H4MA 1C1BA 4LY7A 1JLAA 5HRPA 4FJIA 1S9EA 3AVIA 5CYMA 4CK1A 1ZBUA 1UA1A 2D0AA 4FW1A 2IDOA 4IG3A 4CEBA 1S1VA 4E89A 4DTXA 4OPKA 3AVGA 3U6FA 1S9GA 3CYMA 1C0TA 1S1XA 3RMDA 4JRPA 4FJ9A 4ICLA 3TAEA 1T05A 5J1EA 3SQ2A 4FJ8A 3NAEA 3V9XA 5HRNA 4ELTA 4W5NA 4MFBA 2OZSA 4M42A 3O3HA 3ZSZA 1NKEA 4CERA 1NK4A 4QCLA 2HHTA 4K8XA 3G10A 4W5QA 1C6VA 3SCXA 4KHUA 1BQNA 4F3TA 3SUNA 1DTTA 3O4NA 3VQ4A 3TAFA 3MEGA 3DLKA 3L8BA 3LANA 3DLBA 1TV6A 4CGGA 3ZSWA 3AA4A 3OYJA 3O4QA 2AJQA 4Z4FA 4FW2A 2P1JA 4CGDA 2KQ2A 4FLXA 2QKBA 5HP1A 2IGIA 2LSNA 1BCMA 3ZT3A 4DU3A 3SI6A 3DM2A 3ZT0A 4FJGA 4DF4A 1F21A 3VQAA 3O3GA 1NJYA 4CGHA 4FLZA 4KRFA 3ZSYA 3HSTB 1IKVA 1ASVA 1BISA 5FRMA 3UIQA 4DSLA 2RN2A 4NCGA 1S5JA 4IBNA 3QETA 2HNDA 3TAPA 2W42A 1SV5A 4Z4CA 4FVMA 3OVNA 4W5OA 4B8CA 1LW0A 1L3TA 3K2PA 2XY6A 3QEIA 4FK4A 4B9LA 1RT5A 3KKRA 5K14A 4OKKA 4Z0UA 4N41A 3O3FA 1HQUA 3WNGA 3S3MA 1SKWA 1FK9A 1RT6A 3KIOA 5KTQA 3EY1A 1U04A 1UOCA 1YTUA 1NK7A 4DQIA 4Z4IA 3L2WA 3RTVA 2P5GA 4PUOA 4KHWA 4DQQA 1EP4A 3TARA 2VG6A 1DLOA 4K8ZA 3HPHA 2R7YA 3DI6A 4CFAA 4CEZA 4C8OA 3PX4A 2I5JA 1NK9A 1CXQA 4Z4HA 4RW9A 1UAXA 3QEXA 2XY5A 1RT4A 3DYAA 3G0ZA 2BGGA 3AVHA 1NKBA 3RR8A 1REVA 5C42A 1WSEA 1JLGA 1U4BA 1RBVA 3L2UA 1ZYQA 5KI6A 3THVA 1KTQA 1TGOA 1RT7A 4CK3A 4B9MA 2OPPA 4Y1DA 4B9SA 2BE2A 4CCHA 1L3VA 3CQ8A 2Q3SA 3PX6A 4M3ZA 2HHVA 1LAWA 1RDAA 1UWBA 4FK2A 2QXFA 2YHAA 4DWIA 1VSDA 3L2VA 3LP0A 2HVIA 4WE1A 2IAJA 2NUBA 4FM2A 2FBXA 4C8LA 3EYZA 1RDBA 1HNIA 3ZSOA 3SJJA 2G8IA 1A5WA 1NJZA 1Z25A 3KD5E 4AHRA 3HPOA 2Y1JA 3M8SA 1TL1A 4CF8A 4HHTA 3D45A 4JRQA 4ELVA 4QOZB 4LSLA 1N5YA 4CJUA 3HK2A 1ASWA 4ID5A 1XHZA 3KK2A 5KGWA 1FXXA 2F96A 4FJ7A 3S3OA 1IO2A 2VG7A 3QNOA 1G15A 1KVAA 1A5XA 4RW4A 1C1CA 4CGIA 3K5LA 4DTSA 4N56A 4DQSA 1QTMA 4F4KA 1L5UA 1Q8IA 3NGZA 3KD1E 4J2DA 1BHLA 2YHBA 4BE1A 4I9QA 1JLQA 5DK5A 4DTOA 3RWUA 2B5JA 3TAGA 1QSLA 4FXDA 1SKRA 1TKTA 4AHCA 1KFSA 1S6PA 3P5JA 1WAJA 3CFPA 3SQ4A 4KTWA 4AHUA 1U49A 4B08A 1LWFA 3OJUA 3SV3A 3V81A 3F9KA 3NF7A 1BQMA 1WAFA 3QLHA 2P51A 4OKJA 4FLWA 2XRIA 3ZT4A 3T3FA 3PO4A 1RNHA 2A1RA 4BDZA 3B6OA 4CFBA 3PV8A 1RT1A 4OLBA 3HJFA 3OYIA 1LV5A 4N76A 4E3SA 3HO1A 3BDPA 4GMJB 3B6PA 2JGUA 3SUOA 4Y1CA 3V6DA 2HHSA 3ZT2A 4I2QA 5J2PA 1W9HA 4HUFA 3MXJA 3JYTA 3OS1A 4DFJA 3OYMA 3LP1A 2HHQA 2OA8A 3L2QA 4I7FA 4LH5A 4FJJA 4E1NA 4N47A 2G8VA 3KLIA 1SL0A 4AHSA 1DTQA 2VG5A 3QINA 3VQ6A 4MQ3A 3VQCA 5SWMA 3LAMA 3VQEA 3AO3A 1WSGA 2PZSA 2HHWA 2OPRA 1BIUA 1C0MA 1I3AA 5FDLA 3L3UA 3NE6A 3SQ0A 4KTZA 1GOAA 1L3UA 4KREA 4XIUA 3V9WA 5I3UA 3MXMA 3T1AA 2BANA 4DQRA 4B9NA 3H08A 3AVMA 3KLFA 4F8RA 1JLBA 2ATQA 1BI4B 1XHXA 3VQBA 4DU1A 3M8RA 1TK0A 4OLAA 2X6NA 3LP3A 2KFZA 1VSIA 3NGYA 3NCIA 4BWMA 3F73A 1RDCA 2XY7A 4DG1A 3TR8A 4CESA 3NFAA 4CJEA 4DS4A 3L3VA 5T7BA 5FRNA 2KW4A 2OZMA 4HUEA 3SPZA 1RTIA 3AVBA 1YT3A 3P83D 4W5TA 4CHQA 3V9SA 4FZXC 4W5RA 1IKWA 1IKYA 4H4OA 1NOZA 3LWMA 4IFVA 1RDDA 1D8YA 1VSKA 2Z1JA 3KTQA 4M41A 1MU2A 4B8AB 4ZTJA 5I42A 3OYLA 3LP2A 4DFPA 3MXIA 2YKMA 3NH2A 2ZD1A 3A2FA 3OYBA 1J9AA 2VWJA 1HYSA 4FJNA 4CEAA 4EZ9A 1BIZA 1NKCA 5D3GA 3K5NA 3AO1A 2PYLA 3VQQA 3S9HA 4ELUA 1HRHA 4CHNA 4DSKA 1S1WA 4IFYA 1QS4A 3HXMA 4RW6A 3RR7A 1W0HA 3U3YA 4I2PA 4BDPA 1SL2A 4DTMA 4HTUA 4C8MA 4HCCA 1EX4A 4FJLA 3PUFA 3OYHA 4CHZA 1VSMA 3IAYA 3ASMA 4RG8A 3KK3A 2HVHA 1C1AA 1QSSA 1TAUA 3SV4A 3V9UA 3V1RA 3HVTA 4DTNA 4KHNA 1QE1A 3TAQA 2YV0X 1QQCA 4OGEA 1Z26A 3WNHA 4DLEA 1WSFA 4O44A 2D0CA 1IKXA 1RILA 4DSEA 3AA3A 2WOMA 3NDKA 4CHOA 1TK5A 4F2RA 1X1PA 4JLHA 3SPYA 3LDSA 1X9MA 3HP9A 1LWEA 1L3SA 1WSHA 3AVJA 4KHYA 5JS1A 3OS0A 3HM9A 4JS4A 3AVKA 4CJLA 2G8WA 2D0BA 3ZSQA 1JKHA 3SQ1A 3NGIA 4E1MA 4Z4GA 2G8KA 1B9FA 4OKEA 4DU4A 1LW2A 4C8KA 2Z1IA 4KV8A 3NHGA 2OYQA 4KI4A 4EP4A 5KGXA 3QNNA 1VRUA 1CXUA 4CJRA 4KO0A 1ZBHA 4M45A 3ULDA 1KSPA 2Z1HA 4CJSA 1RTDA 4ZHRA 4BE2A 2RF2A 4PA1A 2EX3A 4Z4EA 3LPUA 4QAGA 2HHUA 1LAVA 2FBVA 3NF8A 3HP6A 4DLGA 3LZIA 3AO4A 3C6UA 2QK9A 4BACA 4KB0A 5CY4A 1KFDA 4DTUA 5HBMA 3RRGA 2ZE2A 1J5OA 1Q9YA 5C24A 4CEOA 1RBTA 5JS2A 3PX0A 4FK0A 3V9ZA 3HPGA 2O4IA 1BL3A 1C0UA 4UQGA 3MEEA 4GW6A 4KTQA 4M3XA 4LSNA 2G8HA 4LD0A 3ZCMA 4HVJA 1KVCA 5J2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZY A;  1RBU A;  3C6T A;  4FM1 A;  4RW8 A;  1VSL A;  1YTA A;  1HNV A;  4CJT A;  3T19 A;  4OPJ A;  3C95 A;  3HT3 A;  1I39 A;  1NK5 A;  3DOK A;  4DS5 A;  1TK8 A;  1NK0 A;  1QSY A;  4B9T A;  4DSI A;  4L8R B;  4CIE A;  4CF2 A;  3QIO A;  1D9D A;  3VN5 A;  1YVU A;  4KI6 A;  1J54 A;  1RBS A;  3CG7 A;  2IS3 A;  3TAB A;  4I9L A;  2QKK A;  3IRX A;  3VQP A;  2YKN A;  2P5O A;  3ALY A;  1WSJ A;  3WNE A;  1GOC A;  4CJ3 A;  3QER A;  1T7P A;  4FCY A;  1A5V A;  3AA2 A;  4PQU A;  4DTP A;  4CGF A;  1RT3 A;  4OGC A;  3V1O A;  4N5S A;  3NH0 A;  3OJS A;  1U47 A;  2E4L A;  2F8T A;  1KVB A;  2YNF A;  3SUP A;  2PY5 A;  4O4G A;  3D0P A;  3K59 A;  3ZSR A;  1SL1 A;  1FKO A;  4E7K A;  1T03 A;  4KAZ A;  4TSX A;  3AVA A;  4CJW A;  1VSF A;  1ZBL A;  1CLQ A;  4CJK A;  2GUI A;  3C94 A;  1D9F A;  2HW3 A;  3AO5 A;  3MAQ A;  1JXE A;  2FBY A;  4DTR A;  4M3R A;  3LAK A;  1HPZ A;  1RT2 A;  4CJV A;  2KZZ A;  3BGR A;  5FRO A;  4EP5 A;  3QEP A;  1IH7 A;  3TWH A;  1EKE A;  4CJF A;  4ZTF A;  4FZZ A;  3OYA A;  1KLM A;  3OY9 A;  1R0A A;  4CEE A;  1CZB A;  4M3T A;  3QEW A;  3U3G A;  1JLE A;  3S3N A;  3OYC A;  3AV9 A;  1U48 A;  4AHT A;  3LAL A;  3LWL A;  3SYZ A;  4CIG A;  3EZ5 A;  4E0D A;  1ZBI A;  3ZSX A;  4M3W A;  5HRS A;  4KFB A;  1D5A A;  1VSE A;  3HYF A;  4NYF A;  5E41 A;  4B9U A;  4KPY A;  4E7I A;  4DSF A;  3K5O A;  1JL1 A;  3PO5 A;  4J2A A;  4CF9 A;  3VQ5 A;  2E6L A;  2X78 A;  1ASU A;  4GVM A;  3VQ7 A;  1HQE A;  3VQD A;  4CJ5 A;  5KRS A;  4R5P A;  3L2R A;  4DQP A;  1WNS A;  3ZT1 A;  3NF6 A;  2PYJ A;  3KLE A;  4NCB A;  1TKX A;  2A1S A;  3V1Q A;  4CFC A;  3KLH A;  3NBP A;  1FKP A;  4IG0 A;  4BDY A;  1EET A;  3ZSV A;  3E01 A;  3MED A;  4CEQ A;  1CZ9 A;  4CED A;  4G1Q A;  3SZ2 A;  2XHB A;  5HRO A;  5KRT A;  4M3Y A;  3CM5 A;  4J2E A;  4FJH A;  4C8N A;  1S1T A;  2X6S A;  4NYN A;  4CGJ A;  1KLN A;  4F3O A;  4PWD A;  1ZBF A;  1VRT A;  4J2B A;  3HL8 A;  2HB5 A;  2O4G A;  1S6Q A;  2IOC A;  4M3U A;  1KCF A;  2ITG A;  3CM6 A;  4FJX A;  1VSH A;  2RKI A;  4E7H A;  2EHG A;  2ZQB A;  3PY8 A;  2VWK A;  3DRP A;  1B92 A;  3AA5 X;  3MEC A;  3LZJ A;  2HNY A;  4DFK A;  3HVR A;  4FJM A;  4FM0 A;  1B9D A;  4KHQ A;  3CFO A;  3KK1 A;  2XY8 A;  4Q5V A;  3WNF A;  4O0I A;  3QEV A;  1Q9X A;  4DMN A;  4IDK A;  5SZT A;  1KRP A;  4Q0B A;  1EXQ A;  1WSI A;  1NOY A;  2X74 A;  4HCB A;  5C25 A;  3SUQ A;  3LPT A;  1T8E A;  3I0S A;  1HJR A;  4BWJ A;  4CHP A;  1ITG A;  1N6Q A;  2XO7 A;  2DTU A;  4KB1 A;  3ITH A;  2IC3 A;  1UA0 A;  1O1W A;  1WN7 A;  3OYF A;  4YNQ A;  4JS5 A;  4E7L A;  3OYE A;  3VA3 A;  3NF9 A;  3OYD A;  3RMA A;  3IG1 A;  4FLT A;  4CF1 A;  1SKS A;  3VA0 A;  1TAQ A;  4DTJ A;  4AIL C;  2OPQ A;  1TKD A;  1BCO A;  2BDP A;  4B9V A;  3VQ9 A;  5EU7 A;  1VK0 A;  3CFR A;  4OVL A;  3AVL A;  5J2M A;  5HLF A;  1NK8 A;  5J2N A;  4H8K A;  3VQ8 A;  3I8D A;  2KTQ A;  3AVN A;  1X9W A;  1JL2 A;  2YNG A;  3DLH A;  2OPS A;  1TKZ A;  5CZ2 A;  1TL3 A;  2HHX A;  1RBR A;  3DRR A;  3AVC A;  3DLE A;  4E19 A;  1JXB A;  4CEC A;  3QES A;  5CZ1 A;  3NH1 A;  1HYV A;  2F8S A;  1HYZ A;  2DY4 A;  1TVR A;  4ID1 A;  4E7J A;  1NJX A;  4CE9 A;  2DFE A;  3DOL A;  4CF0 A;  1BI4 A;  1XI1 A;  1RCH A;  4O55 A;  2E6M A;  4HUG A;  4AHV A;  3DMJ A;  1Y97 A;  1XC9 A;  2YNI A;  3OYG A;  1X9S A;  4EZ6 A;  3I0R A;  3K57 A;  4FLV A;  4B3O A;  4LH4 A;  2B6A A;  1LWC A;  2KFN A;  2JLE A;  3K5M A;  4FLU A;  1VSJ A;  1IG9 A;  3OYK A;  3SNN A;  1U45 A;  4IKF A;  4OJR A;  3TI0 A;  4CJ4 A;  1NJW A;  4CJQ A;  1RTJ A;  1J53 A;  1BGX T;  3AO2 A;  4AH9 A;  3V4I A;  4PY5 A;  4RW7 A;  3TAM A;  3OS2 A;  3K58 A;  2FBT A;  4O5B A;  3KJV A;  5HRR A;  3RMC A;  5CYQ A;  5DMR A;  4CJP A;  4CHY A;  2GV9 A;  4O0J A;  3KLG A;  1XWL A;  4KHS A;  4F2S A;  1S1U A;  1RTH A;  2KZM A;  2ETJ A;  3QO9 A;  3M8Q A;  2D5R A;  4CK2 A;  2GBZ A;  2WON A;  3TAN A;  3M8P A;  4DFM A;  4DF8 A;  1GOB A;  3DRS A;  3IS9 A;  1K6Y A;  3JSM A;  3ISN C;  3AVF A;  4KKO A;  3QIP A;  3RMB A;  2DFH A;  2RPI A;  3DLG A;  1JLC A;  4FYD A;  4FJ5 A;  1SUQ A;  1NK6 A;  2Z1G A;  1QHT A;  4DSJ A;  3RRH A;  3P1G A;  1WLJ A;  3DLR A;  4NCA A;  2G8F A;  2Y1I A;  4CIF A;  1JLF A;  4CEF A;  2HMI A;  4FJK A;  2FC0 A;  2B4J A;  4BE0 A;  3OYN A;  4CFD A;  4YFU A;  4FLY A;  3FFI A;  2HNZ A;  2G8U A;  1HMV A;  3KKS A;  2YNH A;  2DFF A;  4H4M A;  1C1B A;  4LY7 A;  1JLA A;  5HRP A;  4FJI A;  1S9E A;  3AVI A;  5CYM A;  4CK1 A;  1ZBU A;  1UA1 A;  2D0A A;  4FW1 A;  2IDO A;  4IG3 A;  4CEB A;  1S1V A;  4E89 A;  4DTX A;  4OPK A;  3AVG A;  3U6F A;  1S9G A;  3CYM A;  1C0T A;  1S1X A;  3RMD A;  4JRP A;  4FJ9 A;  4ICL A;  3TAE A;  1T05 A;  5J1E A;  3SQ2 A;  4FJ8 A;  3NAE A;  3V9X A;  5HRN A;  4ELT A;  4W5N A;  4MFB A;  2OZS A;  4M42 A;  3O3H A;  3ZSZ A;  1NKE A;  4CER A;  1NK4 A;  4QCL A;  2HHT A;  4K8X A;  3G10 A;  4W5Q A;  1C6V A;  3SCX A;  4KHU A;  1BQN A;  4F3T A;  3SUN A;  1DTT A;  3O4N A;  3VQ4 A;  3TAF A;  3MEG A;  3DLK A;  3L8B A;  3LAN A;  3DLB A;  1TV6 A;  4CGG A;  3ZSW A;  3AA4 A;  3OYJ A;  3O4Q A;  2AJQ A;  4Z4F A;  4FW2 A;  2P1J A;  4CGD A;  2KQ2 A;  4FLX A;  2QKB A;  5HP1 A;  2IGI A;  2LSN A;  1BCM A;  3ZT3 A;  4DU3 A;  3SI6 A;  3DM2 A;  3ZT0 A;  4FJG A;  4DF4 A;  1F21 A;  3VQA A;  3O3G A;  1NJY A;  4CGH A;  4FLZ A;  4KRF A;  3ZSY A;  3HST B;  1IKV A;  1ASV A;  1BIS A;  5FRM A;  3UIQ A;  4DSL A;  2RN2 A;  4NCG A;  1S5J A;  4IBN A;  3QET A;  2HND A;  3TAP A;  2W42 A;  1SV5 A;  4Z4C A;  4FVM A;  3OVN A;  4W5O A;  4B8C A;  1LW0 A;  1L3T A;  3K2P A;  2XY6 A;  3QEI A;  4FK4 A;  4B9L A;  1RT5 A;  3KKR A;  5K14 A;  4OKK A;  4Z0U A;  4N41 A;  3O3F A;  1HQU A;  3WNG A;  3S3M A;  1SKW A;  1FK9 A;  1RT6 A;  3KIO A;  5KTQ A;  3EY1 A;  1U04 A;  1UOC A;  1YTU A;  1NK7 A;  4DQI A;  4Z4I A;  3L2W A;  3RTV A;  2P5G A;  4PUO A;  4KHW A;  4DQQ A;  1EP4 A;  3TAR A;  2VG6 A;  1DLO A;  4K8Z A;  3HPH A;  2R7Y A;  3DI6 A;  4CFA A;  4CEZ A;  4C8O A;  3PX4 A;  2I5J A;  1NK9 A;  1CXQ A;  4Z4H A;  4RW9 A;  1UAX A;  3QEX A;  2XY5 A;  1RT4 A;  3DYA A;  3G0Z A;  2BGG A;  3AVH A;  1NKB A;  3RR8 A;  1REV A;  5C42 A;  1WSE A;  1JLG A;  1U4B A;  1RBV A;  3L2U A;  1ZYQ A;  5KI6 A;  3THV A;  1KTQ A;  1TGO A;  1RT7 A;  4CK3 A;  4B9M A;  2OPP A;  4Y1D A;  4B9S A;  2BE2 A;  4CCH A;  1L3V A;  3CQ8 A;  2Q3S A;  3PX6 A;  4M3Z A;  2HHV A;  1LAW A;  1RDA A;  1UWB A;  4FK2 A;  2QXF A;  2YHA A;  4DWI A;  1VSD A;  3L2V A;  3LP0 A;  2HVI A;  4WE1 A;  2IAJ A;  2NUB A;  4FM2 A;  2FBX A;  4C8L A;  3EYZ A;  1RDB A;  1HNI A;  3ZSO A;  3SJJ A;  2G8I A;  1A5W A;  1NJZ A;  1Z25 A;  3KD5 E;  4AHR A;  3HPO A;  2Y1J A;  3M8S A;  1TL1 A;  4CF8 A;  4HHT A;  3D45 A;  4JRQ A;  4ELV A;  4QOZ B;  4LSL A;  1N5Y A;  4CJU A;  3HK2 A;  1ASW A;  4ID5 A;  1XHZ A;  3KK2 A;  5KGW A;  1FXX A;  2F96 A;  4FJ7 A;  3S3O A;  1IO2 A;  2VG7 A;  3QNO A;  1G15 A;  1KVA A;  1A5X A;  4RW4 A;  1C1C A;  4CGI A;  3K5L A;  4DTS A;  4N56 A;  4DQS A;  1QTM A;  4F4K A;  1L5U A;  1Q8I A;  3NGZ A;  3KD1 E;  4J2D A;  1BHL A;  2YHB A;  4BE1 A;  4I9Q A;  1JLQ A;  5DK5 A;  4DTO A;  3RWU A;  2B5J A;  3TAG A;  1QSL A;  4FXD A;  1SKR A;  1TKT A;  4AHC A;  1KFS A;  1S6P A;  3P5J A;  1WAJ A;  3CFP A;  3SQ4 A;  4KTW A;  4AHU A;  1U49 A;  4B08 A;  1LWF A;  3OJU A;  3SV3 A;  3V81 A;  3F9K A;  3NF7 A;  1BQM A;  1WAF A;  3QLH A;  2P51 A;  4OKJ A;  4FLW A;  2XRI A;  3ZT4 A;  3T3F A;  3PO4 A;  1RNH A;  2A1R A;  4BDZ A;  3B6O A;  4CFB A;  3PV8 A;  1RT1 A;  4OLB A;  3HJF A;  3OYI A;  1LV5 A;  4N76 A;  4E3S A;  3HO1 A;  3BDP A;  4GMJ B;  3B6P A;  2JGU A;  3SUO A;  4Y1C A;  3V6D A;  2HHS A;  3ZT2 A;  4I2Q A;  5J2P A;  1W9H A;  4HUF A;  3MXJ A;  3JYT A;  3OS1 A;  4DFJ A;  3OYM A;  3LP1 A;  2HHQ A;  2OA8 A;  3L2Q A;  4I7F A;  4LH5 A;  4FJJ A;  4E1N A;  4N47 A;  2G8V A;  3KLI A;  1SL0 A;  4AHS A;  1DTQ A;  2VG5 A;  3QIN A;  3VQ6 A;  4MQ3 A;  3VQC A;  5SWM A;  3LAM A;  3VQE A;  3AO3 A;  1WSG A;  2PZS A;  2HHW A;  2OPR A;  1BIU A;  1C0M A;  1I3A A;  5FDL A;  3L3U A;  3NE6 A;  3SQ0 A;  4KTZ A;  1GOA A;  1L3U A;  4KRE A;  4XIU A;  3V9W A;  5I3U A;  3MXM A;  3T1A A;  2BAN A;  4DQR A;  4B9N A;  3H08 A;  3AVM A;  3KLF A;  4F8R A;  1JLB A;  2ATQ A;  1BI4 B;  1XHX A;  3VQB A;  4DU1 A;  3M8R A;  1TK0 A;  4OLA A;  2X6N A;  3LP3 A;  2KFZ A;  1VSI A;  3NGY A;  3NCI A;  4BWM A;  3F73 A;  1RDC A;  2XY7 A;  4DG1 A;  3TR8 A;  4CES A;  3NFA A;  4CJE A;  4DS4 A;  3L3V A;  5T7B A;  5FRN A;  2KW4 A;  2OZM A;  4HUE A;  3SPZ A;  1RTI A;  3AVB A;  1YT3 A;  3P83 D;  4W5T A;  4CHQ A;  3V9S A;  4FZX C;  4W5R A;  1IKW A;  1IKY A;  4H4O A;  1NOZ A;  3LWM A;  4IFV A;  1RDD A;  1D8Y A;  1VSK A;  2Z1J A;  3KTQ A;  4M41 A;  1MU2 A;  4B8A B;  4ZTJ A;  5I42 A;  3OYL A;  3LP2 A;  4DFP A;  3MXI A;  2YKM A;  3NH2 A;  2ZD1 A;  3A2F A;  3OYB A;  1J9A A;  2VWJ A;  1HYS A;  4FJN A;  4CEA A;  4EZ9 A;  1BIZ A;  1NKC A;  5D3G A;  3K5N A;  3AO1 A;  2PYL A;  3VQQ A;  3S9H A;  4ELU A;  1HRH A;  4CHN A;  4DSK A;  1S1W A;  4IFY A;  1QS4 A;  3HXM A;  4RW6 A;  3RR7 A;  1W0H A;  3U3Y A;  4I2P A;  4BDP A;  1SL2 A;  4DTM A;  4HTU A;  4C8M A;  4HCC A;  1EX4 A;  4FJL A;  3PUF A;  3OYH A;  4CHZ A;  1VSM A;  3IAY A;  3ASM A;  4RG8 A;  3KK3 A;  2HVH A;  1C1A A;  1QSS A;  1TAU A;  3SV4 A;  3V9U A;  3V1R A;  3HVT A;  4DTN A;  4KHN A;  1QE1 A;  3TAQ A;  2YV0 X;  1QQC A;  4OGE A;  1Z26 A;  3WNH A;  4DLE A;  1WSF A;  4O44 A;  2D0C A;  1IKX A;  1RIL A;  4DSE A;  3AA3 A;  2WOM A;  3NDK A;  4CHO A;  1TK5 A;  4F2R A;  1X1P A;  4JLH A;  3SPY A;  3LDS A;  1X9M A;  3HP9 A;  1LWE A;  1L3S A;  1WSH A;  3AVJ A;  4KHY A;  5JS1 A;  3OS0 A;  3HM9 A;  4JS4 A;  3AVK A;  4CJL A;  2G8W A;  2D0B A;  3ZSQ A;  1JKH A;  3SQ1 A;  3NGI A;  4E1M A;  4Z4G A;  2G8K A;  1B9F A;  4OKE A;  4DU4 A;  1LW2 A;  4C8K A;  2Z1I A;  4KV8 A;  3NHG A;  2OYQ A;  4KI4 A;  4EP4 A;  5KGX A;  3QNN A;  1VRU A;  1CXU A;  4CJR A;  4KO0 A;  1ZBH A;  4M45 A;  3ULD A;  1KSP A;  2Z1H A;  4CJS A;  1RTD A;  4ZHR A;  4BE2 A;  2RF2 A;  4PA1 A;  2EX3 A;  4Z4E A;  3LPU A;  4QAG A;  2HHU A;  1LAV A;  2FBV A;  3NF8 A;  3HP6 A;  4DLG A;  3LZI A;  3AO4 A;  3C6U A;  2QK9 A;  4BAC A;  4KB0 A;  5CY4 A;  1KFD A;  4DTU A;  5HBM A;  3RRG A;  2ZE2 A;  1J5O A;  1Q9Y A;  5C24 A;  4CEO A;  1RBT A;  5JS2 A;  3PX0 A;  4FK0 A;  3V9Z A;  3HPG A;  2O4I A;  1BL3 A;  1C0U A;  4UQG A;  3MEE A;  4GW6 A;  4KTQ A;  4M3X A;  4LSN A;  2G8H A;  4LD0 A;  3ZCM A;  4HVJ A;  1KVC A;  5J2Q A; 
#chains in the Genus database with same CATH topology
 4FPA A;  4H0O A;  2HBJ A;  3C6T A;  4FM1 A;  1ATN A;  1VSL A;  3M1F A;  3NVM A;  1I39 A;  1TK8 A;  4L8R B;  5GAG P;  1IBK K;  1D9D A;  2CGL A;  3ALY A;  3LL3 A;  1GOC A;  4FCY A;  4FWL A;  3GE1 A;  3VGK A;  4CGF A;  5HOO A;  3OJS A;  3NH0 A;  2E4L A;  4YOY A;  1KD1 O;  2F8T A;  4O4G A;  4KAZ A;  3ZSR A;  4E7K A;  4TSX A;  1Y64 A;  3AVA A;  1VSF A;  1WOQ A;  3C94 A;  2FBY A;  4YHH K;  4IZ9 A;  5AQT A;  1S22 A;  4DV7 K;  3OBY A;  4EP5 A;  4CJF A;  3OYA A;  4WF9 L;  1VQ7 N;  4MO4 A;  4M3T A;  3OYC A;  4BRE A;  3LAL A;  3J8A A;  1K8K A;  1ZBI A;  5KPR A;  4KFB A;  4B9U A;  1ILY A;  4KPY A;  4E7I A;  4DSF A;  3K5O A;  1DEJ A;  2QWR A;  4J2A A;  1ASU A;  4R5P A;  1HQE A;  4CJ5 A;  1HNW K;  4JI1 K;  4BR7 A;  3K0S A;  3IKM A;  2D0P A;  4DQ8 A;  2QWM A;  3HRG A;  5HRO A;  2E2N A;  4J2E A;  2X6S A;  4CGJ A;  3G6E N;  1ZBF A;  1VRT A;  4J2B A;  3HL8 A;  2O4G A;  3O08 A;  3C7N A;  2FF6 A;  2RKI A;  3P4I A;  3LZJ A;  3PIO L;  4BR5 A;  2HNY A;  4B1W B;  3FGU A;  3KK1 A;  3QEV A;  4DMN A;  3VPZ A;  4IDK A;  5SZT A;  4Q0B A;  1HLU A;  2X74 A;  4IXC A;  4HCB A;  4M7X A;  5C2D A;  4JI7 K;  1YIJ N;  2DTU A;  3E9L A;  4ILG B;  3OYF A;  3DJC A;  3VA3 A;  3NF9 A;  3OYD A;  3IG1 A;  2KLA A;  4CF1 A;  4AIL C;  1TAQ A;  3MX2 A;  1TKD A;  2BDP A;  2QXL A;  2W40 A;  4BRD A;  4OVL A;  5CHI A;  1SZ2 A;  5J2M A;  5HLF A;  4IFE A;  1ZXO A;  1TKZ A;  1TL3 A;  4LFB K;  3CER A;  3DRR A;  1MWM A;  3QES A;  4OO1 J;  2HHX A;  3O9Q A;  5AQM A;  3NH1 A;  5DM7 L;  2DY4 A;  2GWK A;  2E8A A;  2E6M A;  2QI2 A;  3DMJ A;  4LH4 A;  3O5B A;  2JLE A;  3K5M A;  3C7N B;  4ISF A;  1IG9 A;  4OJR A;  4CZL A;  1RTJ A;  4CZI A;  1J53 A;  2GX9 A;  4IOC L;  4AH9 A;  1HKB A;  3O4W A;  4CJP A;  1K8A O;  3CJC A;  4KHS A;  1S1U A;  4YOR A;  1GLC G;  1EWR A;  1U6Z A;  3WEE A;  2GBZ A;  3TAN A;  3VES A;  1ATR A;  3ISN C;  3AVF A;  2ZJP L;  2RPI A;  5LMN K;  1BA0 A;  4I6M A;  1NK6 A;  1DT9 A;  1U2V B;  2G8F A;  3DXM A;  2Y1I A;  5AQJ A;  3VTH A;  4FJK A;  4FWO A;  4CFD A;  4FLY A;  1HMV A;  2FF3 B;  3KKS A;  5HRP A;  1GLA G;  2RE2 A;  1N32 K;  1P90 A;  4DR2 K;  5CYM A;  4KH4 A;  1UA1 A;  4IG3 A;  2BUP A;  1S1V A;  3FZH A;  3QBW A;  4DTX A;  1C0T A;  4BVP A;  1XUP O;  3KVG A;  4BGB A;  3RMD A;  3ENB A;  3SQ2 A;  2ASM A;  1X3M A;  1NKE A;  4QCL A;  1ZC6 A;  3G25 A;  3LDP A;  3G10 A;  3N4Q A;  5AJ3 K;  2HF4 A;  4E1J A;  1C6V A;  2V51 B;  3O1B A;  3O4N A;  1IBL K;  3MEG A;  3DLK A;  5AZI B;  3L8B A;  1TV6 A;  4H03 B;  1EO1 A;  3ZSW A;  3AA4 A;  4Z4F A;  4CGD A;  2KQ2 A;  2QKB A;  2P9U A;  5HP1 A;  2FSK A;  2O8E B;  3ZT3 A;  2NRX A;  3TSP A;  4FJG A;  3O3G A;  1NGG A;  4LF4 K;  2E2O A;  1IKV A;  1BIS A;  5FRM A;  3D7E O;  2RN2 A;  1S5J A;  4IBN A;  5FPD A;  4W5O A;  3J81 O;  4K0K K;  1LW0 A;  2BH1 A;  4JK7 A;  4B9L A;  4L3Q A;  3KKR A;  4N41 A;  3O3F A;  1HQU A;  3WNG A;  1FK9 A;  4JK8 A;  3KIO A;  4C23 A;  4YOT A;  4R79 A;  1YHQ N;  3L2W A;  4KHW A;  1VQ4 N;  3N4P A;  3HPH A;  3IUC A;  3W3D A;  3DI6 A;  1YUW A;  4CEZ A;  1SS6 A;  2GWJ A;  1WBB A;  4JI5 K;  4Z4H A;  1UAX A;  4A2A A;  3QEX A;  4B3S K;  2O8D B;  3AVH A;  2ZGZ A;  3VMF B;  3J7Z O;  5C42 A;  4DUZ K;  4O8U A;  3EKU A;  4BRH A;  3THV A;  1KTQ A;  4BRL A;  3C65 A;  1RT7 A;  1YJ9 N;  3ID8 A;  2GUP A;  2Q0R A;  3ZX2 A;  3CQ8 A;  1NGF A;  4M3Z A;  1LAW A;  4FK2 A;  5KQD A;  2NRR A;  4DUY K;  2AA4 A;  4FM2 A;  1SAZ A;  3EYZ A;  1HNI A;  3SJJ A;  1A5W A;  4JHD A;  1TL1 A;  4QOZ B;  3W0L A;  1N5Y A;  3UKU B;  4JKH A;  4DR6 K;  4A5B A;  5JMV A;  2VG7 A;  4CGI A;  4DTS A;  1QTM A;  5TKW A;  4IO9 L;  4BC4 A;  3NGZ A;  1Q7Y O;  5M1F A;  2P9S A;  2B5J A;  1QSL A;  4BQL A;  1TKT A;  1KFS A;  3P5J A;  1TYQ A;  4Y0W A;  3WQU A;  4AHU A;  1LWF A;  3ZET A;  3WXJ A;  3SV3 A;  3F9K A;  3AY9 A;  1WAF A;  1KAZ A;  1QQM A;  2VCP A;  2XRI A;  3ZT4 A;  4BDZ A;  2QA4 N;  3P31 A;  1RT1 A;  3HJF A;  5AQX A;  4E3S A;  4BC3 A;  3WUH A;  3HO1 A;  3D2E A;  4K25 A;  3EKS A;  2JGU A;  4Y1C A;  2UUB K;  2HHS A;  4I2Q A;  4C1N K;  3MN9 A;  2IVP A;  1QHA A;  3CD6 N;  5AQI A;  4N47 A;  2G8V A;  4XH5 A;  2PZS A;  1WSG A;  4IJA A;  1C0M A;  3SQ0 A;  1GLF O;  3PSF A;  5TKY A;  3H08 A;  3KLF A;  1EQY A;  1XHX A;  4Z94 A;  3FLC O;  4OLA A;  3NGY A;  2XY7 A;  4DS4 A;  4CES A;  3NFA A;  2KW4 A;  2KKZ A;  3EE8 A;  1ZBS A;  4HUE A;  3T7Z A;  1YT3 A;  2O8F B;  4FZX C;  3MK6 A;  3V9S A;  4A59 A;  4XEI A;  4EHT A;  1NOZ A;  1RDD A;  5CE3 A;  5C12 A;  5I42 A;  3LP2 A;  3NH2 A;  3A2F A;  3SK3 A;  3UKR A;  4G9Z A;  1NKC A;  1S3X A;  3HTV A;  1YJW N;  2NRZ A;  2PYL A;  3S9H A;  1XMQ K;  1WBD A;  3VEX A;  4DSK A;  1S1W A;  4BRO A;  5JVH L;  1QS4 A;  3RR7 A;  1NGB A;  4FWK A;  2WBN A;  3ASM A;  5M1O A;  5BRD A;  1QSS A;  4DTN A;  3V9U A;  5BPL A;  4LF8 K;  3MCA B;  2YV0 X;  3TSU A;  4QS8 A;  1HNZ K;  4K42 A;  3L6Q A;  4O44 A;  1IKX A;  3RVC A;  5ADX A;  4F2R A;  3O9S A;  4JEP A;  5KPZ A;  1X9M A;  3SAH A;  4CBX A;  2G8W A;  3EZW A;  3NGI A;  5GAE P;  4E1M A;  2G8K A;  1XMO K;  5FLX O;  4DU4 A;  2Z1I A;  4KV8 A;  4F9O A;  4WQ5 A;  4YDU A;  3AAP A;  5A2Q O;  1VRU A;  4CJR A;  3I55 N;  1KSP A;  1NLV A;  2Z1H A;  5M1K A;  4BE2 A;  4DV2 K;  4PA1 A;  4H0P A;  3CMA N;  4BAC A;  4BRI A;  5HBM A;  3UB5 A;  1NGA A;  2VGM A;  3BP8 A;  1BWF O;  2A6A A;  3PX0 A;  3VET A;  2FLO A;  2O4I A;  4UQG A;  4M3X A;  3QBX A;  3R3L A;  1K9M O;  5AQP A;  4AF1 A;  1YTA A;  4CJT A;  3SJH A;  3HT3 A;  1NK5 A;  4DSI A;  2ZGY A;  3CCM N;  2E1Z A;  3R6M A;  4CIE A;  4KI6 A;  2QKK A;  3TAB A;  4I9L A;  3G71 N;  3IRX A;  3VQP A;  4FVU A;  3KK7 A;  2IVO A;  3GG4 A;  1M1K O;  4CJ3 A;  3GDQ A;  3QER A;  1A5V A;  1TUU A;  3AA2 A;  4PQU A;  1RT3 A;  4OGC A;  2V7Z A;  5MLC Q;  4BR4 A;  2UUA K;  2JWK A;  3K59 A;  1T03 A;  1SL1 A;  1CLQ A;  4DV0 K;  4IOA L;  4CJW A;  5E84 A;  5FPE A;  3CCU N;  2GUI A;  2HW3 A;  3GL1 A;  4DV3 K;  4M3R A;  3LAK A;  4LF9 K;  2J4R A;  1RT2 A;  4CJV A;  2NZT A;  5FRO A;  5LL6 Z;  1IH7 A;  4ZTF A;  3A0I X;  3OY9 A;  1R0A A;  4CEE A;  3QEW A;  3U3G A;  4X66 K;  3S3N A;  4FWS A;  2O8E A;  5JVG L;  4AHT A;  1O13 A;  3SYZ A;  3L4Q A;  3CXC M;  4E0D A;  2VYP A;  1HUX A;  5HRS A;  1VSE A;  4NYF A;  4WCE L;  5E41 A;  4WQ4 A;  3PO5 A;  4CF9 A;  3F2K A;  3VQ5 A;  4GVM A;  5KRS A;  3VQD A;  4DQP A;  1NGC A;  3KLE A;  3NBP A;  4BDY A;  5LJV A;  4JHD B;  4CEQ A;  1CZ9 A;  4FL9 A;  3CM5 A;  4FJH A;  4C8N A;  4A62 A;  1KLN A;  2A40 A;  1BDG A;  2HB5 A;  1MWK A;  2GTD A;  2IOC A;  2ITG A;  4FJX A;  1VSH A;  4CD1 A;  3U4L A;  3HVR A;  4FJM A;  4Q5V A;  4HTL A;  1Q9X A;  1NOY A;  4BR0 A;  3Q7B A;  5C25 A;  3LPT A;  1T8E A;  3I0S A;  4BWJ A;  1ITG A;  1NU0 A;  2XO7 A;  1N6Q A;  1LOT B;  2A5X A;  2IC3 A;  4WQ4 C;  5AQW A;  1UA0 A;  1O1W A;  3RSE B;  4EAH D;  3ID6 A;  4E7L A;  2PBD A;  1NGI A;  4CZF A;  1SKS A;  4DTJ A;  4B9V A;  5EU7 A;  5KPT A;  3DXK B;  5J2N A;  3AVN A;  2YNG A;  3BZK A;  2FXU A;  4E19 A;  3AVC A;  3DLE A;  4PKI A;  5CZ1 A;  1HYZ A;  4E7J A;  4CE9 A;  1QQN A;  1RCH A;  4O55 A;  2UXB K;  1Y97 A;  5BRH A;  4JI3 K;  3O9R A;  3I0R A;  3K57 A;  3NVK A;  1LWC A;  1VSJ A;  3OYK A;  2P9K B;  1U45 A;  5BRE A;  1NJW A;  1BGX T;  4JI2 K;  2YJE A;  1KAX A;  4JV5 K;  4CHY A;  5DMR A;  3NMU A;  2ZJQ L;  1E4F T;  4DV6 K;  3M8Q A;  2D5R A;  5BR9 A;  2W41 A;  3M8P A;  4DF8 A;  3EL2 A;  1GOB A;  3SAF A;  4KKO A;  2DFH A;  4FYD A;  4GVE A;  2HMP A;  2HST A;  3RRH A;  3ENO A;  3DLR A;  3QB0 A;  1QVG M;  5F1X A;  4BE0 A;  3OYN A;  2G8U A;  2YNH A;  1JLA A;  4XH1 A;  3UKU A;  4FW1 A;  3MN7 A;  3AVG A;  1S9G A;  1HJO A;  3BF1 A;  4BY9 C;  4ICL A;  5HRN A;  5M1P A;  2P9K A;  3O3H A;  4DV1 K;  4CER A;  2O8C A;  4YY3 K;  3VF6 A;  4DB3 A;  4KHU A;  1BQN A;  3VQ4 A;  2AJQ A;  2P1J A;  2IGI A;  3ZT0 A;  4DF4 A;  3SBT A;  4FLZ A;  1NJY A;  3HST B;  3HOT A;  3ATU A;  4NCG A;  3C6H A;  2HND A;  4GV6 A;  3LM9 A;  1SV5 A;  4X65 K;  3OVN A;  1L3T A;  3PSI A;  3VEY A;  2XY6 A;  3QEI A;  1RT5 A;  4Z0U A;  2D1K A;  3EO3 A;  5KTQ A;  1U04 A;  1UOC A;  3EY1 A;  3KHY A;  4DQI A;  4JYA K;  4Z4I A;  2P5G A;  2FSN A;  3DWL A;  1VQ8 N;  2R7Y A;  1BA1 A;  4BRQ A;  2I5J A;  4O8K A;  4UY8 O;  1CXQ A;  1IJJ A;  5AQY A;  3VGM A;  3TTF A;  2QTD A;  1RT4 A;  1RFQ A;  4BRK A;  2V7Y A;  1WSE A;  4I6M B;  1JLG A;  1RBV A;  3H3N O;  3L2U A;  5KI6 A;  3WT0 A;  5AQR A;  1TGO A;  3GBT A;  2OPP A;  3E9O A;  2BE2 A;  3CC4 N;  1L3V A;  2ASO A;  2HHV A;  1RDA A;  1VQ6 N;  3VEO A;  2QXF A;  4BR9 A;  3LP0 A;  3P38 A;  2IAJ A;  1NWK A;  2NUB A;  4C8L A;  1RDB A;  3ZSO A;  3ULE A;  2G8I A;  1Q86 O;  1NJZ A;  1QZ6 A;  4CF8 A;  4JRQ A;  4LSL A;  3HK2 A;  1XC3 A;  1XHZ A;  2F96 A;  1VQP N;  4FJ7 A;  4JN4 A;  3S3O A;  5AZJ B;  3QNO A;  3CIP A;  3CCQ N;  4RW4 A;  1C1C A;  4F4K A;  1L5U A;  2QWQ A;  1JLQ A;  3QFU A;  2P9N B;  1FJG K;  2HOE A;  1WB9 A;  3TU5 A;  4KTW A;  4B08 A;  3NF7 A;  1CZA N;  3QLH A;  3THW B;  3PO4 A;  1RNH A;  3RSE A;  3H6E A;  3BF3 A;  4N76 A;  2YI1 A;  4GMJ B;  2ITM A;  3V6D A;  3EE9 A;  2HHQ A;  2ZF5 O;  4CJ7 A;  3OS1 A;  4B3R K;  2HF3 A;  4FJJ A;  4GY2 B;  5AQS A;  3KLI A;  2WC9 A;  1SL0 A;  4AHS A;  2VGN A;  1DTQ A;  3VQ6 A;  3AO3 A;  1T3V A;  2OPR A;  3O1W A;  5FDL A;  4KRE A;  2BAN A;  1NGH A;  4B9N A;  3AVM A;  2ZWH A;  1JLB A;  2ATQ A;  4BRC A;  4RTF D;  3VQB A;  4DU1 A;  3ZYY X;  2KFZ A;  2Q1N A;  3NCI A;  5T7B A;  1E3M A;  5GIN A;  1NJI O;  2WTU A;  3M3Z A;  3LWM A;  4BVO A;  4IFV A;  1VSK A;  4B1Z A;  3KTQ A;  4M41 A;  4IEE A;  3I56 N;  2JWL A;  4FOI A;  4JKG A;  2VWJ A;  1HYS A;  4CEA A;  2QWO A;  3MWT A;  1BIZ A;  4NLB A;  4DR4 K;  3OHR A;  2H3G X;  3FZK A;  1HRH A;  3FE1 A;  5GAD P;  4IFY A;  5F0X A;  2NLX A;  3HXM A;  3SAG A;  4BDP A;  4I2P A;  1BG3 A;  4RCH A;  5GIO A;  4HTU A;  1VSM A;  1SQK A;  3KK3 A;  1TAU A;  4KHN A;  4BG8 A;  3HVT A;  2E88 A;  4LF6 K;  3IDH A;  3WNH A;  3CPW M;  1WSF A;  2D0C A;  2P9S B;  1K8K B;  1RIL A;  3NDK A;  4CHO A;  1X1P A;  1GLL O;  1LWE A;  1WSH A;  1JCE A;  5JS1 A;  3L0Q A;  4CJL A;  2YHX A;  1T44 A;  3ZEU A;  2CGK A;  4ILH A;  4KI4 A;  2OYQ A;  1P8Z A;  4DCH A;  4WYB A;  1CXU A;  3LDL A;  3OTO K;  4ZHR A;  2RF2 A;  1QVF M;  1KQS M;  4ISE A;  2IIR A;  3R1X A;  2E20 A;  2FBV A;  3NF8 A;  2QK9 A;  3LZI A;  1V4S A;  4JNE A;  4DR1 K;  3HZ6 A;  5CY4 A;  1KFD A;  1W2B M;  2HBL A;  3CCR N;  5C24 A;  3AGK A;  1YAG A;  1C0U A;  2FSJ A;  4B3T K;  1KVC A;  1OH8 A;  5J2Q A;  4FZY A;  1RBU A;  2UXC K;  3A5M C;  1HNV A;  3C95 A;  4B9T A;  3DOK A;  4DS5 A;  1QSY A;  5AFU A;  3CME N;  4CF2 A;  1W97 L;  3VN5 A;  1YVU A;  5AQV A;  1VQN N;  1J54 A;  1NBW A;  1RBS A;  2P5O A;  4CZG A;  4H0V B;  1WSJ A;  3WNE A;  4NB4 A;  4LF7 K;  1T7P A;  3IFR A;  3ATV A;  5AFU H;  5LMU K;  1U47 A;  1G99 A;  3ZEU B;  2Q2R A;  1FKO A;  2UXD K;  3FZF A;  4CJK A;  5AQN A;  1U2V A;  1YIT N;  3MAQ A;  4DTR A;  3CC2 N;  4BRA A;  3AAQ A;  1HPZ A;  3BY5 A;  3TWH A;  1KLM A;  1OH6 A;  1CZB A;  4CD3 A;  1JLE A;  1OVQ A;  4OX9 K;  3LWL A;  3EZ5 A;  3H1V X;  1JL1 A;  4FSV A;  4MLH A;  2E6L A;  2X78 A;  3L2R A;  3VQ7 A;  2HBM A;  2QW9 A;  4OPH A;  3NF6 A;  3TPQ A;  4BRP A;  5FPN A;  1Q82 O;  1JJ2 M;  3MX5 A;  3KLH A;  4IG0 A;  3ZSV A;  4CED A;  4G1Q A;  3F9M A;  4IO8 A;  4M3Y A;  2P9P B;  4NYN A;  4F3O A;  5AQL A;  3K9J A;  1GLD G;  4M3U A;  1KCF A;  4FWM A;  3WEE B;  4E7H A;  2VWK A;  4H5W A;  4YOV A;  1B92 A;  3AA5 X;  3MEC A;  4DFK A;  2WFB A;  1B9D A;  4KHQ A;  4J8F A;  5AQH A;  2VQE K;  2DPN A;  3WNF A;  4O0I A;  1J5E K;  1KRP A;  4MLE A;  1H1V A;  4OPA A;  1WSI A;  3SUQ A;  4YOW A;  3QFP A;  2CH6 A;  1HJR A;  4CHP A;  4KB1 A;  3ITH A;  3QIC A;  3WXL A;  3CCL N;  4YNQ A;  4JS5 A;  2O8C B;  3OYE A;  3CJA A;  4DV4 K;  4JK9 A;  3T1Y K;  3VQ9 A;  2VQF K;  1BUP A;  3PLA A;  3T69 A;  3VEN A;  4AQY K;  3AVL A;  1NM1 A;  4WQ5 C;  4FWR A;  4H8K A;  2KTQ A;  1LCU A;  1JL2 A;  2OPS A;  5CZ2 A;  3HSC A;  4BG9 A;  1JCG A;  3TSQ A;  1JXB A;  4CEC A;  3WQT A;  1TVR A;  4ID1 A;  5CR4 A;  2DFE A;  3DOL A;  4CF0 A;  1XI1 A;  3ZLJ A;  4GKK K;  3MCP A;  2A41 A;  1VQK N;  4EZ6 A;  4FLV A;  2QWP A;  1OH5 A;  3THW A;  1KC8 O;  4FPB A;  4FLU A;  3SNN A;  1OVY A;  3TI0 A;  4BC2 A;  4CJ4 A;  1YXQ A;  1NMN A;  3E1Y A;  4CJQ A;  4PL7 A;  4DV5 K;  3V4I A;  2OTJ N;  3TAM A;  2QWN A;  3OS2 A;  3K58 A;  4O5B A;  3RMC A;  3KLG A;  1XWL A;  3T1H K;  4JKB A;  4F2S A;  3G4S N;  4CK2 A;  2NNW A;  2WON A;  4DFM A;  3DRS A;  1ATS A;  3IS9 A;  3QIP A;  3DLG A;  1SUQ A;  4A5A A;  3IMX A;  3P1G A;  3CCJ N;  1YF5 L;  4M7Y A;  1NG9 A;  3O6W A;  1JLF A;  4CEF A;  4CIF A;  2HMI A;  2FC0 A;  1M90 O;  4YFU A;  3H46 O;  3FFI A;  3VEV A;  4LY7 A;  4FJI A;  3MWP A;  4CZJ A;  3UKR B;  3SBG A;  3H45 C;  1ZBU A;  4CBW A;  3U9D A;  2IDO A;  4E89 A;  2QEX N;  4EFH A;  5JIC A;  3E66 A;  4OPK A;  1QZ5 A;  3ULE B;  1S1X A;  5AQU A;  3TAE A;  5J1E A;  3OW2 M;  3NAE A;  4PKG A;  3L4I A;  4MFB A;  3SMP A;  3ZSZ A;  4WFN L;  2HHT A;  1D4X A;  4K8X A;  3FZM A;  4W5Q A;  4B1Y B;  1ESV A;  3SUN A;  3R8E A;  1YVN A;  1DTT A;  3TAF A;  3LAN A;  3DLB A;  5BN8 A;  4CZM A;  3OYJ A;  2O8F A;  4H5T A;  4FLX A;  4BR2 A;  4DU3 A;  1XQS C;  1F21 A;  4HWI A;  4KRF A;  3ZSY A;  5GAH P;  1BOT O;  3SLC A;  3D2E B;  3QET A;  2NRV A;  2W42 A;  4FVM A;  5DM6 L;  4B8C A;  3K2P A;  1V4T A;  4KH6 A;  4JI0 K;  4MDA A;  5K14 A;  4OKK A;  1C0F A;  4DR3 K;  1SKW A;  1YTU A;  1NK7 A;  5ADX H;  4PUO A;  4DQQ A;  3HOS A;  3TAR A;  4JKA A;  4K8Z A;  3CHW A;  5EXW A;  3DXM B;  3VOV A;  1NK9 A;  3THX B;  3C0B A;  1QQO A;  2XY5 A;  3PIP L;  1NKB A;  3ENH A;  1REV A;  3U9Z A;  1ZYQ A;  3CPE A;  4CK3 A;  4B9S A;  4CCH A;  3PX6 A;  1NGJ A;  3CET A;  2RHK A;  1UWB A;  1VSD A;  3H1Q A;  4KH5 A;  3TTC A;  4CZH A;  2A3Z A;  3FFK B;  4X62 K;  3KD5 E;  4AHR A;  3HPO A;  4M63 C;  5IWA K;  3D45 A;  4ELV A;  4CJU A;  4JKD A;  1IBM K;  5KGW A;  4DHY A;  5EOY A;  1G15 A;  1KVA A;  3K5L A;  4N56 A;  1Q8I A;  3KD1 E;  1BHL A;  4IWV A;  4I9Q A;  4DTO A;  5DK5 A;  3RWU A;  3TAG A;  4JD2 A;  2EWS A;  4FXD A;  5EVZ A;  1GLB G;  1SKR A;  2QM1 A;  1S6P A;  3CFP A;  3JAM O;  4EHU A;  1XNQ K;  4DR7 K;  2PAV A;  1BQM A;  3D6R A;  2P51 A;  2P9U B;  1N36 K;  3T3F A;  3B6O A;  4FOE A;  4CFB A;  3OYI A;  1LV5 A;  4YOU A;  4H0Y B;  2YCH A;  3BDP A;  5J2P A;  1W9H A;  4DKW A;  3MXJ A;  3H3O B;  4JI4 K;  3OYM A;  4E1N A;  2Q97 A;  2VG5 A;  3QIN A;  5SWM A;  4MQ3 A;  3A5O C;  3VQC A;  4ISG A;  2HHW A;  1I3A A;  3L3U A;  5EY4 A;  2ZM6 K;  1L3U A;  3OA9 A;  4XIU A;  3MXM A;  3T1A A;  3I8B A;  1VQO N;  3AAR A;  1BI4 B;  1BO5 O;  1HPM A;  2KHO A;  3M8R A;  2OAN A;  2X6N A;  5E26 A;  4BC5 A;  5AZJ A;  4BWM A;  1RDC A;  1X3N A;  5JLF A;  4CJE A;  5FRN A;  2OZM A;  3VGL A;  1RTI A;  4YDU C;  2P9L A;  4W5T A;  4CHQ A;  3O80 A;  4W5R A;  5C0Y A;  4BRN A;  1IKW A;  4H4O A;  1Q81 O;  4ILJ A;  2Z1J A;  1MU2 A;  4B8A B;  4ZTJ A;  4K43 A;  2ZD1 A;  3LM2 A;  1J9A A;  2OCE A;  4FJN A;  5D3G A;  1Z05 A;  1GLE G;  3CJ9 A;  2HHH K;  4RW6 A;  4PL8 A;  3U3Y A;  2P9N A;  4C8M A;  5GIP A;  4HCC A;  4FJL A;  3PUF A;  3IAY A;  2HVH A;  3O9U A;  1C1A A;  3SV4 A;  3BUZ B;  5AQG A;  4OGE A;  4DLE A;  3BEX A;  3KZB A;  2WOM A;  3HM8 A;  1OH7 A;  3SPY A;  4K41 A;  1W7A A;  4JD2 B;  1L3S A;  4KHY A;  3HM9 A;  4JS4 A;  3FR0 A;  2PFU A;  2D0B A;  3ZSQ A;  1JKH A;  4X64 K;  2OTL N;  1XNR K;  4AM7 A;  2CH5 A;  4OKE A;  1J6Z A;  4EP4 A;  5KGX A;  3QNN A;  3LDN A;  4KO0 A;  1ZBH A;  4M45 A;  3C6A A;  1RTD A;  1VAZ A;  2HHU A;  3HP6 A;  4DLG A;  4FWN A;  1VQM N;  4DTU A;  4BRG A;  1J5O A;  3EEQ A;  4CEO A;  1RBT A;  5JS2 A;  3V9Z A;  2F9W A;  4IDH A;  4CI6 A;  3CJ7 A;  1BL3 A;  1YI2 N;  4KTQ A;  1R59 O;  3CC7 N;  4LD0 A;  3ZCM A;  4FJ8 A;  3CQX A;  4MO5 A;  4RW8 A;  3TTD A;  3T19 A;  4OPJ A;  1NK0 A;  1VQL N;  4A57 A;  3QIO A;  3ZX0 A;  4B9Q A;  3A5L C;  3CG7 A;  2IS3 A;  3OBW A;  2YKN A;  2W6L A;  4H5N A;  3MMV A;  4WFA L;  4DTP A;  2P9I B;  1N33 K;  3VTI A;  1BU6 O;  3V1O A;  4N5S A;  3CJB A;  1KVB A;  2YNF A;  2P9I A;  3SUP A;  2PY5 A;  3D0P A;  4YOX A;  1ZBL A;  1D9F A;  3AO5 A;  1JXE A;  3MN5 A;  2YHY A;  2BTF A;  2KZZ A;  3BGR A;  3QEP A;  4GV9 A;  1EKE A;  4FZZ A;  2YX6 A;  2W6K A;  5B8H A;  5I9E B;  4QS7 A;  3AV9 A;  1U48 A;  1HR0 K;  5AQK A;  4CIG A;  3ZSX A;  4M3W A;  1D5A A;  4RWT A;  1WUA A;  3HYF A;  4JKG B;  1FW6 A;  4B1V A;  2GEL A;  1WNS A;  3ZT1 A;  2PYJ A;  1MA9 B;  4NCB A;  3J7Y P;  1TKX A;  4U7B A;  3JXU A;  2A1S A;  3V1Q A;  4CFC A;  1FKP A;  1DGK N;  1Q18 A;  1EET A;  3A5N C;  3E01 A;  3MED A;  4JKC A;  3CCV N;  3SZ2 A;  2XHB A;  5KRT A;  3WXK A;  1S1T A;  4IOX A;  4PWD A;  1S6Q A;  2CGJ A;  4CBU A;  3CM6 A;  2GEM A;  3D2F B;  3B8A X;  3DAW A;  4H0T B;  4KHP K;  2EHG A;  2ZQB A;  3THY B;  3PY8 A;  5BR8 K;  1RGI A;  2AP1 A;  3AGR A;  3DRP A;  5C10 A;  4FM0 A;  3MDQ A;  3CFO A;  4XH4 A;  2XY8 A;  5F2R A;  5HL7 L;  1RDW X;  1NMD A;  1EXQ A;  4WFB L;  1X9J A;  2F9T A;  4NXN K;  2O8B A;  1WN7 A;  3ZX3 A;  5BPN A;  3RMA A;  3WXM B;  4BRF A;  4FLT A;  3VEW A;  3VA0 A;  1RDU A;  2OPQ A;  1BCO A;  3HI0 A;  5AQF A;  1VK0 A;  3CFR A;  5BN9 A;  3A8Y A;  1HKC A;  1NK8 A;  3VQ8 A;  3I8D A;  1X9W A;  3DLH A;  3E9P A;  1RBR A;  2F8S A;  1HYV A;  3I33 A;  4FWQ A;  1NJX A;  2P9L B;  1BI4 A;  3J80 O;  4HUG A;  4AHV A;  3M5R A;  1XC9 A;  1JCF A;  2YNI A;  3OYG A;  1X9S A;  4LFA K;  4B3M K;  4B3O A;  2B6A A;  2KFN A;  1HX1 A;  2UYT A;  4IKF A;  3AO2 A;  1NGE A;  2A42 A;  4H0X B;  4PY5 A;  4RW7 A;  2FBT A;  1EWQ A;  4GKJ K;  2O8B B;  3KJV A;  5HRR A;  4H5V A;  5CYQ A;  3WXI A;  2GV9 A;  4O0J A;  2UUC K;  1YJN N;  1RTH A;  2KZM A;  2ETJ A;  5H1S Q;  3QO9 A;  2NRH A;  1IV0 A;  4B1X B;  1K6Y A;  3JSM A;  3RMB A;  3LDQ A;  2E1Y A;  1JLC A;  2D4W A;  4FJ5 A;  1QHT A;  2Z1G A;  4DSJ A;  1WLJ A;  2Q0U A;  3P39 A;  4NCA A;  5IT9 O;  3KWG A;  3ZET B;  2B4J A;  1TYQ B;  1VQ5 N;  3QDK A;  2E2P A;  2HNZ A;  2HBK A;  2DFF A;  4H4M A;  1C1B A;  1S9E A;  3AVI A;  4MDB A;  4CK1 A;  2D0A A;  4IJN A;  2Q31 A;  4CEB A;  1OKJ A;  1GLJ O;  3U6F A;  3CYM A;  5C15 A;  4JRP A;  4FJ9 A;  1T05 A;  3V9X A;  4W5N A;  4ELT A;  2V52 B;  2OZS A;  1IG8 A;  4M42 A;  2I7P A;  1NK4 A;  5AR0 A;  4DR5 K;  4FO0 A;  2YHW A;  2E2Q A;  3SCX A;  4F3T A;  4BGA A;  4IEI A;  5LY3 A;  4LC9 B;  3SMS A;  3O4Q A;  4H5R A;  1KAY A;  4FW2 A;  2LSN A;  1BCM A;  2I7N A;  3SI6 A;  5ELZ A;  3DM2 A;  2ASP A;  3VQA A;  4CGH A;  4JI6 K;  5BRF A;  5AQQ A;  5LJW A;  2IVN A;  1MDU B;  1ASV A;  2WUS A;  3UIQ A;  4DSL A;  1N34 K;  5FPM A;  3TAP A;  3O8M A;  4Z4C A;  4NO7 A;  4AM6 A;  3HBT A;  1HNX K;  4FK4 A;  3S3M A;  1RT6 A;  4CZK A;  2Q36 A;  3RTV A;  1EP4 A;  3DXK A;  4NXM K;  2VG6 A;  1DLO A;  4CFA A;  2VWB A;  4C8O A;  3PX4 A;  4CVN E;  1I94 K;  4RW9 A;  4A2B A;  3THY A;  3DYA A;  3D2F A;  3G0Z A;  2BGG A;  3RR8 A;  1KXP A;  1U4B A;  4B9M A;  5M1Q A;  1T6D A;  4Y1D A;  3CI5 A;  2Q3S A;  4GV3 A;  2YHA A;  4DWI A;  5M1N A;  3L2V A;  2HVI A;  4WE1 A;  2FBX A;  1N8R O;  1Z25 A;  2Y1J A;  3M8S A;  4HHT A;  1ASW A;  4ID5 A;  3KK2 A;  1FXX A;  3MN6 A;  4LF5 K;  1IO2 A;  5BPM A;  4PHT X;  1A5X A;  4DQS A;  1HKG A;  3VER A;  4J2D A;  4BE1 A;  2YHB A;  2NRW A;  2NRT A;  3KWI A;  4JKE A;  4BRM A;  2F4V K;  4AHC A;  3SQ4 A;  1WAJ A;  1U49 A;  3OJU A;  3V81 A;  4OKJ A;  1Z6R A;  4FLW A;  2D0O A;  2A1R A;  4A61 A;  3PV8 A;  3O9T A;  4OLB A;  5EX5 A;  4LFC K;  2ZJR L;  3SUO A;  3B6P A;  3ZT2 A;  4HUF A;  2YJF A;  3JYT A;  4DFJ A;  3LP1 A;  2OA8 A;  5KQ8 A;  3L2Q A;  4I7F A;  4LH5 A;  1S72 N;  3LAM A;  3VQE A;  1BIU A;  3GOI A;  4KBO A;  3JS6 A;  3NE6 A;  4KTZ A;  1GOA A;  3DLL L;  3V9W A;  5I3U A;  1TUY A;  4DQR A;  1NNE A;  1VQ9 N;  5AQO A;  4F8R A;  1TK0 A;  3LP3 A;  1K73 O;  3M6G A;  1VSI A;  3BZC A;  3F73 A;  3CCE N;  4DG1 A;  3TR8 A;  3L3V A;  3K9K A;  1DKG D;  3VF4 A;  3SPZ A;  3AVB A;  3P83 D;  1IKY A;  1D8Y A;  3VEZ A;  3OYL A;  4DFP A;  3MXI A;  2YKM A;  3OYB A;  2QWL A;  3F5T A;  4EZ9 A;  3LDO A;  3K5N A;  3AO1 A;  3VQQ A;  4ELU A;  3J7A P;  4U67 L;  4CHN A;  3CJ1 A;  1W0H A;  1SL2 A;  4DTM A;  1EX4 A;  4V19 S;  3OYH A;  4CHZ A;  4CZE A;  1C0G A;  4RG8 A;  2P9P A;  3V1R A;  5C2F A;  1QE1 A;  3THX A;  3TAQ A;  3UE5 A;  1E4G T;  1QQC A;  1VHX A;  1Z26 A;  4PKH A;  4B1U B;  4DSE A;  1TK5 A;  3AA3 A;  5AQZ A;  4BQZ A;  3QML A;  4JLH A;  1T6C A;  4CW7 B;  4JKF A;  3LDS A;  3HP9 A;  3AVJ A;  3OS0 A;  3AVK A;  4JAX A;  4GNI A;  3SQ1 A;  4QS9 A;  4JI8 K;  4Z4G A;  1B9F A;  4NLC A;  3U8X A;  1LW2 A;  4C8K A;  3NHG A;  4O5F A;  3CCS N;  3ULD A;  4EIA A;  4CJS A;  3R9P A;  4C1N I;  4Z4E A;  2EX3 A;  3Q7C A;  2UU9 K;  3LPU A;  1NGD A;  4QAG A;  5JLH A;  1LAV A;  2F7T A;  3AO4 A;  3C6U A;  4KB0 A;  3RRG A;  2ZE2 A;  3S41 A;  3CQY A;  1Q9Y A;  5AZI A;  3CF5 L;  4FK0 A;  3HPG A;  2E5L K;  4FWP A;  2O8D A;  3MEE A;  4GW6 A;  4LSN A;  3FZL A;  2G8H A;  3EN9 A;  4HVJ A;  4CGG A;  3VF2 A; 
#chains in the Genus database with same CATH homology
 4FZY A;  1RBU A;  3C6T A;  4FM1 A;  4RW8 A;  1VSL A;  1YTA A;  1HNV A;  4CJT A;  3T19 A;  4OPJ A;  3C95 A;  3HT3 A;  1I39 A;  1NK5 A;  3DOK A;  4DS5 A;  1TK8 A;  1NK0 A;  1QSY A;  4B9T A;  4DSI A;  4L8R B;  4CIE A;  4CF2 A;  3QIO A;  1D9D A;  3VN5 A;  1YVU A;  4KI6 A;  1J54 A;  1RBS A;  3CG7 A;  2IS3 A;  3TAB A;  4I9L A;  2QKK A;  3IRX A;  3VQP A;  2YKN A;  2P5O A;  3ALY A;  1WSJ A;  3WNE A;  1GOC A;  4CJ3 A;  3QER A;  1T7P A;  4FCY A;  1A5V A;  3AA2 A;  4PQU A;  4DTP A;  4CGF A;  1RT3 A;  4OGC A;  3V1O A;  4N5S A;  3NH0 A;  3OJS A;  1U47 A;  2E4L A;  2F8T A;  1KVB A;  2YNF A;  3SUP A;  2PY5 A;  4O4G A;  3D0P A;  3K59 A;  3ZSR A;  1SL1 A;  1FKO A;  4E7K A;  1T03 A;  4KAZ A;  4TSX A;  3AVA A;  4CJW A;  1VSF A;  1ZBL A;  1CLQ A;  4CJK A;  2GUI A;  3C94 A;  1D9F A;  2HW3 A;  3AO5 A;  3MAQ A;  1JXE A;  2FBY A;  4DTR A;  4M3R A;  3LAK A;  1HPZ A;  1RT2 A;  4CJV A;  2KZZ A;  3BGR A;  5FRO A;  4EP5 A;  3QEP A;  1IH7 A;  3TWH A;  1EKE A;  4CJF A;  4ZTF A;  4FZZ A;  3OYA A;  1KLM A;  3OY9 A;  1R0A A;  4CEE A;  1CZB A;  4M3T A;  3QEW A;  3U3G A;  1JLE A;  3S3N A;  3OYC A;  3AV9 A;  1U48 A;  4AHT A;  3LAL A;  3LWL A;  3SYZ A;  4CIG A;  3EZ5 A;  4E0D A;  1ZBI A;  3ZSX A;  4M3W A;  5HRS A;  4KFB A;  1D5A A;  1VSE A;  3HYF A;  4NYF A;  5E41 A;  4B9U A;  4KPY A;  4E7I A;  4DSF A;  3K5O A;  1JL1 A;  3PO5 A;  4J2A A;  4CF9 A;  3VQ5 A;  2E6L A;  2X78 A;  1ASU A;  4GVM A;  3VQ7 A;  1HQE A;  3VQD A;  4CJ5 A;  5KRS A;  4R5P A;  3L2R A;  4DQP A;  1WNS A;  3ZT1 A;  3NF6 A;  2PYJ A;  3KLE A;  4NCB A;  1TKX A;  2A1S A;  3V1Q A;  4CFC A;  3KLH A;  3NBP A;  1FKP A;  4IG0 A;  4BDY A;  1EET A;  3ZSV A;  3E01 A;  3MED A;  4CEQ A;  1CZ9 A;  4CED A;  4G1Q A;  3SZ2 A;  2XHB A;  5HRO A;  5KRT A;  4M3Y A;  3CM5 A;  4J2E A;  4FJH A;  4C8N A;  1S1T A;  2X6S A;  4NYN A;  4CGJ A;  1KLN A;  4F3O A;  4PWD A;  1ZBF A;  1VRT A;  4J2B A;  3HL8 A;  2HB5 A;  2O4G A;  1S6Q A;  2IOC A;  4M3U A;  1KCF A;  2ITG A;  3CM6 A;  4FJX A;  1VSH A;  2RKI A;  4E7H A;  2EHG A;  2ZQB A;  3PY8 A;  2VWK A;  3DRP A;  1B92 A;  3AA5 X;  3MEC A;  3LZJ A;  2HNY A;  4DFK A;  3HVR A;  4FJM A;  4FM0 A;  1B9D A;  4KHQ A;  3CFO A;  3KK1 A;  2XY8 A;  4Q5V A;  3WNF A;  4O0I A;  3QEV A;  1Q9X A;  4DMN A;  4IDK A;  5SZT A;  1KRP A;  4Q0B A;  1EXQ A;  1WSI A;  1NOY A;  2X74 A;  4HCB A;  5C25 A;  3SUQ A;  3LPT A;  1T8E A;  3I0S A;  1HJR A;  4BWJ A;  4CHP A;  1ITG A;  1N6Q A;  2XO7 A;  2DTU A;  4KB1 A;  3ITH A;  2IC3 A;  1UA0 A;  1O1W A;  1WN7 A;  3OYF A;  4YNQ A;  4JS5 A;  4E7L A;  3OYE A;  3VA3 A;  3NF9 A;  3OYD A;  3RMA A;  3IG1 A;  4FLT A;  4CF1 A;  1SKS A;  3VA0 A;  1TAQ A;  4DTJ A;  4AIL C;  2OPQ A;  1TKD A;  1BCO A;  2BDP A;  4B9V A;  3VQ9 A;  5EU7 A;  1VK0 A;  3CFR A;  4OVL A;  3AVL A;  5J2M A;  5HLF A;  1NK8 A;  5J2N A;  4H8K A;  3VQ8 A;  3I8D A;  2KTQ A;  3AVN A;  1X9W A;  1JL2 A;  2YNG A;  3DLH A;  2OPS A;  1TKZ A;  5CZ2 A;  1TL3 A;  2HHX A;  1RBR A;  3DRR A;  3AVC A;  3DLE A;  4E19 A;  1JXB A;  4CEC A;  3QES A;  5CZ1 A;  3NH1 A;  1HYV A;  2F8S A;  1HYZ A;  2DY4 A;  1TVR A;  4ID1 A;  4E7J A;  1NJX A;  4CE9 A;  2DFE A;  3DOL A;  4CF0 A;  1BI4 A;  1XI1 A;  1RCH A;  4O55 A;  2E6M A;  4HUG A;  4AHV A;  3DMJ A;  1Y97 A;  1XC9 A;  2YNI A;  3OYG A;  1X9S A;  4EZ6 A;  3I0R A;  3K57 A;  4FLV A;  4B3O A;  4LH4 A;  2B6A A;  1LWC A;  2KFN A;  2JLE A;  3K5M A;  4FLU A;  1VSJ A;  1IG9 A;  3OYK A;  3SNN A;  1U45 A;  4IKF A;  4OJR A;  3TI0 A;  4CJ4 A;  1NJW A;  4CJQ A;  1RTJ A;  1J53 A;  1BGX T;  3AO2 A;  4AH9 A;  3V4I A;  4PY5 A;  4RW7 A;  3TAM A;  3OS2 A;  3K58 A;  2FBT A;  4O5B A;  3KJV A;  5HRR A;  3RMC A;  5CYQ A;  5DMR A;  4CJP A;  4CHY A;  2GV9 A;  4O0J A;  3KLG A;  1XWL A;  4KHS A;  4F2S A;  1S1U A;  1RTH A;  2KZM A;  2ETJ A;  3QO9 A;  3M8Q A;  2D5R A;  4CK2 A;  2GBZ A;  2WON A;  3TAN A;  3M8P A;  4DFM A;  4DF8 A;  1GOB A;  3DRS A;  3IS9 A;  1K6Y A;  3JSM A;  3ISN C;  3AVF A;  4KKO A;  3QIP A;  3RMB A;  2DFH A;  2RPI A;  3DLG A;  1JLC A;  4FYD A;  4FJ5 A;  1SUQ A;  1NK6 A;  2Z1G A;  1QHT A;  4DSJ A;  3RRH A;  3P1G A;  1WLJ A;  3DLR A;  4NCA A;  2G8F A;  2Y1I A;  4CIF A;  1JLF A;  4CEF A;  2HMI A;  4FJK A;  2FC0 A;  2B4J A;  4BE0 A;  3OYN A;  4CFD A;  4YFU A;  4FLY A;  3FFI A;  2HNZ A;  2G8U A;  1HMV A;  3KKS A;  2YNH A;  2DFF A;  4H4M A;  1C1B A;  4LY7 A;  1JLA A;  5HRP A;  4FJI A;  1S9E A;  3AVI A;  5CYM A;  4CK1 A;  1ZBU A;  1UA1 A;  2D0A A;  4FW1 A;  2IDO A;  4IG3 A;  4CEB A;  1S1V A;  4E89 A;  4DTX A;  4OPK A;  3AVG A;  3U6F A;  1S9G A;  3CYM A;  1C0T A;  1S1X A;  3RMD A;  4JRP A;  4FJ9 A;  4ICL A;  3TAE A;  1T05 A;  5J1E A;  3SQ2 A;  4FJ8 A;  3NAE A;  3V9X A;  5HRN A;  4ELT A;  4W5N A;  4MFB A;  2OZS A;  4M42 A;  3O3H A;  3ZSZ A;  1NKE A;  4CER A;  1NK4 A;  4QCL A;  2HHT A;  4K8X A;  3G10 A;  4W5Q A;  1C6V A;  3SCX A;  4KHU A;  1BQN A;  4F3T A;  3SUN A;  1DTT A;  3O4N A;  3VQ4 A;  3TAF A;  3MEG A;  3DLK A;  3L8B A;  3LAN A;  3DLB A;  1TV6 A;  4CGG A;  3ZSW A;  3AA4 A;  3OYJ A;  3O4Q A;  2AJQ A;  4Z4F A;  4FW2 A;  2P1J A;  4CGD A;  2KQ2 A;  4FLX A;  2QKB A;  5HP1 A;  2IGI A;  2LSN A;  1BCM A;  3ZT3 A;  4DU3 A;  3SI6 A;  3DM2 A;  3ZT0 A;  4FJG A;  4DF4 A;  1F21 A;  3VQA A;  3O3G A;  1NJY A;  4CGH A;  4FLZ A;  4KRF A;  3ZSY A;  3HST B;  1IKV A;  1ASV A;  1BIS A;  5FRM A;  3UIQ A;  4DSL A;  2RN2 A;  4NCG A;  1S5J A;  4IBN A;  3QET A;  2HND A;  3TAP A;  2W42 A;  1SV5 A;  4Z4C A;  4FVM A;  3OVN A;  4W5O A;  4B8C A;  1LW0 A;  1L3T A;  3K2P A;  2XY6 A;  3QEI A;  4FK4 A;  4B9L A;  1RT5 A;  3KKR A;  5K14 A;  4OKK A;  4Z0U A;  4N41 A;  3O3F A;  1HQU A;  3WNG A;  3S3M A;  1SKW A;  1FK9 A;  1RT6 A;  3KIO A;  5KTQ A;  3EY1 A;  1U04 A;  1UOC A;  1YTU A;  1NK7 A;  4DQI A;  4Z4I A;  3L2W A;  3RTV A;  2P5G A;  4PUO A;  4KHW A;  4DQQ A;  1EP4 A;  3TAR A;  2VG6 A;  1DLO A;  4K8Z A;  3HPH A;  2R7Y A;  3DI6 A;  4CFA A;  4CEZ A;  4C8O A;  3PX4 A;  2I5J A;  1NK9 A;  1CXQ A;  4Z4H A;  4RW9 A;  1UAX A;  3QEX A;  2XY5 A;  1RT4 A;  3DYA A;  3G0Z A;  2BGG A;  3AVH A;  1NKB A;  3RR8 A;  1REV A;  5C42 A;  1WSE A;  1JLG A;  1U4B A;  1RBV A;  3L2U A;  1ZYQ A;  5KI6 A;  3THV A;  1KTQ A;  1TGO A;  1RT7 A;  4CK3 A;  4B9M A;  2OPP A;  4Y1D A;  4B9S A;  2BE2 A;  4CCH A;  1L3V A;  3CQ8 A;  2Q3S A;  3PX6 A;  4M3Z A;  2HHV A;  1LAW A;  1RDA A;  1UWB A;  4FK2 A;  2QXF A;  2YHA A;  4DWI A;  1VSD A;  3L2V A;  3LP0 A;  2HVI A;  4WE1 A;  2IAJ A;  2NUB A;  4FM2 A;  2FBX A;  4C8L A;  3EYZ A;  1RDB A;  1HNI A;  3ZSO A;  3SJJ A;  2G8I A;  1A5W A;  1NJZ A;  1Z25 A;  3KD5 E;  4AHR A;  3HPO A;  2Y1J A;  3M8S A;  1TL1 A;  4CF8 A;  4HHT A;  3D45 A;  4JRQ A;  4ELV A;  4QOZ B;  4LSL A;  1N5Y A;  4CJU A;  3HK2 A;  1ASW A;  4ID5 A;  1XHZ A;  3KK2 A;  5KGW A;  1FXX A;  2F96 A;  4FJ7 A;  3S3O A;  1IO2 A;  2VG7 A;  3QNO A;  1G15 A;  1KVA A;  1A5X A;  4RW4 A;  1C1C A;  4CGI A;  3K5L A;  4DTS A;  4N56 A;  4DQS A;  1QTM A;  4F4K A;  1L5U A;  1Q8I A;  3NGZ A;  3KD1 E;  4J2D A;  1BHL A;  2YHB A;  4BE1 A;  4I9Q A;  1JLQ A;  5DK5 A;  4DTO A;  3RWU A;  2B5J A;  3TAG A;  1QSL A;  4FXD A;  1SKR A;  1TKT A;  4AHC A;  1KFS A;  1S6P A;  3P5J A;  1WAJ A;  3CFP A;  3SQ4 A;  4KTW A;  4AHU A;  1U49 A;  4B08 A;  1LWF A;  3OJU A;  3SV3 A;  3V81 A;  3F9K A;  3NF7 A;  1BQM A;  1WAF A;  3QLH A;  2P51 A;  4OKJ A;  4FLW A;  2XRI A;  3ZT4 A;  3T3F A;  3PO4 A;  1RNH A;  2A1R A;  4BDZ A;  3B6O A;  4CFB A;  3PV8 A;  1RT1 A;  4OLB A;  3HJF A;  3OYI A;  1LV5 A;  4N76 A;  4E3S A;  3HO1 A;  3BDP A;  4GMJ B;  3B6P A;  2JGU A;  3SUO A;  4Y1C A;  3V6D A;  2HHS A;  3ZT2 A;  4I2Q A;  5J2P A;  1W9H A;  4HUF A;  3MXJ A;  3JYT A;  3OS1 A;  4DFJ A;  3OYM A;  3LP1 A;  2HHQ A;  2OA8 A;  3L2Q A;  4I7F A;  4LH5 A;  4FJJ A;  4E1N A;  4N47 A;  2G8V A;  3KLI A;  1SL0 A;  4AHS A;  1DTQ A;  2VG5 A;  3QIN A;  3VQ6 A;  4MQ3 A;  3VQC A;  5SWM A;  3LAM A;  3VQE A;  3AO3 A;  1WSG A;  2PZS A;  2HHW A;  2OPR A;  1BIU A;  1C0M A;  1I3A A;  5FDL A;  3L3U A;  3NE6 A;  3SQ0 A;  4KTZ A;  1GOA A;  1L3U A;  4KRE A;  4XIU A;  3V9W A;  5I3U A;  3MXM A;  3T1A A;  2BAN A;  4DQR A;  4B9N A;  3H08 A;  3AVM A;  3KLF A;  4F8R A;  1JLB A;  2ATQ A;  1BI4 B;  1XHX A;  3VQB A;  4DU1 A;  3M8R A;  1TK0 A;  4OLA A;  2X6N A;  3LP3 A;  2KFZ A;  1VSI A;  3NGY A;  3NCI A;  4BWM A;  3F73 A;  1RDC A;  2XY7 A;  4DG1 A;  3TR8 A;  4CES A;  3NFA A;  4CJE A;  4DS4 A;  3L3V A;  5T7B A;  5FRN A;  2KW4 A;  2OZM A;  4HUE A;  3SPZ A;  1RTI A;  3AVB A;  1YT3 A;  3P83 D;  4W5T A;  4CHQ A;  3V9S A;  4FZX C;  4W5R A;  1IKW A;  1IKY A;  4H4O A;  1NOZ A;  3LWM A;  4IFV A;  1RDD A;  1D8Y A;  1VSK A;  2Z1J A;  3KTQ A;  4M41 A;  1MU2 A;  4B8A B;  4ZTJ A;  5I42 A;  3OYL A;  3LP2 A;  4DFP A;  3MXI A;  2YKM A;  3NH2 A;  2ZD1 A;  3A2F A;  3OYB A;  1J9A A;  2VWJ A;  1HYS A;  4FJN A;  4CEA A;  4EZ9 A;  1BIZ A;  1NKC A;  5D3G A;  3K5N A;  3AO1 A;  2PYL A;  3VQQ A;  3S9H A;  4ELU A;  1HRH A;  4CHN A;  4DSK A;  1S1W A;  4IFY A;  1QS4 A;  3HXM A;  4RW6 A;  3RR7 A;  1W0H A;  3U3Y A;  4I2P A;  4BDP A;  1SL2 A;  4DTM A;  4HTU A;  4C8M A;  4HCC A;  1EX4 A;  4FJL A;  3PUF A;  3OYH A;  4CHZ A;  1VSM A;  3IAY A;  3ASM A;  4RG8 A;  3KK3 A;  2HVH A;  1C1A A;  1QSS A;  1TAU A;  3SV4 A;  3V9U A;  3V1R A;  3HVT A;  4DTN A;  4KHN A;  1QE1 A;  3TAQ A;  2YV0 X;  1QQC A;  4OGE A;  1Z26 A;  3WNH A;  4DLE A;  1WSF A;  4O44 A;  2D0C A;  1IKX A;  1RIL A;  4DSE A;  3AA3 A;  2WOM A;  3NDK A;  4CHO A;  1TK5 A;  4F2R A;  1X1P A;  4JLH A;  3SPY A;  3LDS A;  1X9M A;  3HP9 A;  1LWE A;  1L3S A;  1WSH A;  3AVJ A;  4KHY A;  5JS1 A;  3OS0 A;  3HM9 A;  4JS4 A;  3AVK A;  4CJL A;  2G8W A;  2D0B A;  3ZSQ A;  1JKH A;  3SQ1 A;  3NGI A;  4E1M A;  4Z4G A;  2G8K A;  1B9F A;  4OKE A;  4DU4 A;  1LW2 A;  4C8K A;  2Z1I A;  4KV8 A;  3NHG A;  2OYQ A;  4KI4 A;  4EP4 A;  5KGX A;  3QNN A;  1VRU A;  1CXU A;  4CJR A;  4KO0 A;  1ZBH A;  4M45 A;  3ULD A;  1KSP A;  2Z1H A;  4CJS A;  1RTD A;  4ZHR A;  4BE2 A;  2RF2 A;  4PA1 A;  2EX3 A;  4Z4E A;  3LPU A;  4QAG A;  2HHU A;  1LAV A;  2FBV A;  3NF8 A;  3HP6 A;  4DLG A;  3LZI A;  3AO4 A;  3C6U A;  2QK9 A;  4BAC A;  4KB0 A;  5CY4 A;  1KFD A;  4DTU A;  5HBM A;  3RRG A;  2ZE2 A;  1J5O A;  1Q9Y A;  5C24 A;  4CEO A;  1RBT A;  5JS2 A;  3PX0 A;  4FK0 A;  3V9Z A;  3HPG A;  2O4I A;  1BL3 A;  1C0U A;  4UQG A;  3MEE A;  4GW6 A;  4KTQ A;  4M3X A;  4LSN A;  2G8H A;  4LD0 A;  3ZCM A;  4HVJ A;  1KVC A;  5J2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...