4CHPA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4chpA00
1HMVA 2FC0A 3C95A 5E41A 1TGOA 1SUQA 3QO9A 4BDPA 2DFFA 5EU7A 4PWDA 1CXUA 1C0UA 1NJXA 3QINA 3K5LA 1XHZA 1KFSA 4B9LA 2Z1IA 4N56A 4M3WA 3LPUA 3ZSVA 1JLQA 4DFJA 4KTQA 4CGJA 4FK2A 3KLGA 4KO0A 4FK0A 4JLHA 3NE6A 3VQ8A 4ELVA 4KREA 4CHOA 1UWBA 3KJVA 1WSGA 3QERA 2D0BA 1QSYA 4C8NA 4DTMA 4DTOA 2G8HA 4FW2A 3NH0A 2A1RA 1DTTA 4TSXA 4Z4FA 3LALA 3U3YA 3AVBA 1LAWA 3D0PA 3KKRA 3MEGA 3A2FA 3TAFA 2ZE2A 3AO3A 4CFAA 4DFKA 2YKNA 4PUOA 1RT3A 3LP2A 4O4GA 5CY4A 4CGIA 1U45A 1TKXA 3C94A 2QK9A 3L2WA 1D9DA 4ICLA 1BCOA 2VG7A 4DTSA 3TWHA 4FJLA 4OJRA 4DWIA 3RR7A 5KGXA 3OYCA 2P1JA 3LAMA 4CJ4A 4Z4CA 1W0HA 1BI4B 5HRSA 3ZSQA 1NK9A 4CGFA 3SUOA 1J54A 5FROA 4HCCA 4I2PA 4FLXA 1S9EA 1XC9A 4N76A 3C6TA 3HPOA 1F21A 1VSDA 2YNFA 2Z1HA 4EZ6A 2Y1JA 3ITHA 4NCGA 1WLJA 5DK5A 2HB5A 3NCIA 4ID5A 3VQAA 4CJ3A 4AILC 4CFDA 3KKSA 3CYMA 2VWJA 3PX0A 2IS3A 1IKWA 2VWKA 5HP1A 4BE2A 3OYEA 3I8DA 1EX4A 2PZSA 1NOZA 4KRFA 3AO5A 2HVHA 2KW4A 1NKBA 3K2PA 5T7BA 4W5NA 4F3OA 2EHGA 2G8WA 3MAQA 2JLEA 3ZT3A 3LP1A 4KKOA 4N41A 1S6QA 3DOLA 1I3AA 1JXEA 4CEBA 4JS4A 1HYSA 4F2SA 4HUGA 1YTUA 2F96A 4ZHRA 3RMAA 4CESA 1VSMA 1A5VA 4JRPA 1LWCA 3KIOA 4KFBA 2IC3A 1KTQA 4DFPA 4E3SA 4FLZA 1UOCA 1GOBA 4H4MA 3T1AA 2G8FA 5KI6A 1WNSA 5I3UA 4DSKA 3IG1A 1B9FA 3WNHA 1MU2A 4Z4HA 3SZ2A 4K8ZA 3ZT1A 4DSLA 2XO7A 3ZCMA 1JLEA 3U6FA 3PX6A 5HLFA 1ZBIA 1TL3A 3QNNA 1WAFA 3L2UA 3HO1A 3D45A 4Q5VA 3O3HA 4DQPA 1C6VA 3JYTA 4IKFA 2PYJA 3NHGA 1B92A 3O4NA 3AVHA 4OKEA 1CZBA 5CYMA 3LANA 4CF2A 1KVBA 3VQQA 1BIUA 4M42A 1RT5A 2DFEA 3DOKA 1NKCA 3MXIA 1DTQA 3DLBA 2HHXA 2FBTA 1VSHA 4RG8A 1C0TA 3NH1A 3AVKA 3AA5X 3HL8A 4LD0A 4CJWA 4OLBA 5FRMA 3B6OA 4CEFA 3DM2A 3SJJA 1X9SA 2OPSA 3AVJA 4CGGA 1SL2A 1RT7A 3T3FA 3PO5A 3MXJA 1TAUA 1RDDA 4CGDA 4FM1A 3VQDA 4NYNA 3VQCA 1ITGA 2XHBA 3EZ5A 3SNNA 3DRRA 3ZT2A 2KFNA 1BQNA 3OVNA 2B4JA 3V9SA 3L2VA 3HPHA 2ATQA 4DQSA 3IS9A 3NGYA 4YFUA 4BE1A 2E6LA 4DS5A 2YNHA 1VSFA 4BWMA 1SKRA 3ZT0A 3OYJA 1S5JA 1Z25A 1NJWA 1VSIA 2X74A 3EY1A 1T7PA 3IRXA 4FCYA 3M8QA 4IG3A 3RR8A 2GUIA 4FJJA 4FJHA 1JLBA 3P1GA 3NDKA 2QKKA 4G1QA 1EETA 2KZMA 5HRPA 2FBXA 2ZQBA 3L3VA 4DTJA 3QNOA 2KZZA 3TANA 4Y1DA 4B8CA 4CJ5A 3OYAA 1RTDA 3AVLA 3B6PA 1QTMA 4E89A 3OS1A 2HHWA 4I7FA 4AHUA 4R5PA 1S1XA 3QEXA 1HNVA 5K14A 3WNEA 1KCFA 4Z0UA 4M3YA 4DLEA 4AHTA 4AHCA 2ETJA 3OYLA 1FXXA 1SL0A 2KFZA 1NJYA 4CJUA 1WAJA 4GW6A 3CFRA 5J2PA 5CZ2A 3VQ9A 3O3GA 1Q9YA 4CEAA 3MXMA 1R0AA 4Y1CA 4GMJB 1JL2A 3S9HA 1Y97A 3K5OA 2OZMA 1A5XA 2VG6A 4DF4A 4QOZB 4FYDA 4J2DA 1BCMA 3ZSRA 1LWEA 4C8LA 4LY7A 3LWMA 1WSJA 2YKMA 1J53A 4KHNA 3KLIA 4ZTJA 4KTWA 2YV0X 1SL1A 4FLVA 4KHSA 1CZ9A 1DLOA 1HRHA 3DLEA 2JGUA 3ULDA 1ZYQA 2AJQA 4CECA 1LW2A 1JLCA 1TL1A 2GBZA 2XRIA 3SQ4A 5JS1A 1XWLA 3NBPA 3VN5A 2A1SA 4DLGA 1ZBHA 1X9MA 3IAYA 2Z1JA 1VRUA 2RF2A 2YNIA 3SYZA 4QAGA 4GVMA 4DMNA 1SKSA 3AO1A 4LH4A 3VQ4A 2F8SA 3TAPA 3HM9A 3SPYA 2E6MA 1J5OA 1HQEA 3V1QA 4E7LA 4FJ8A 1HYZA 4IFVA 1KVCA 4N5SA 3OYIA 2G8KA 4E7KA 1U49A 1VSKA 4FJ9A 4EP5A 4DU4A 3V9UA 4FK4A 2D0CA 2OPPA 4RW6A 2O4IA 3CQ8A 4FZZA 3DRPA 1C1AA 4KHWA 1VSEA 3U3GA 2OZSA 2HNZA 1RDBA 4WE1A 4CE9A 2PYLA 3SUQA 1EXQA 4FJXA 2HNYA 2EX3A 4FLYA 2OPQA 1EP4A 3ZSXA 2XY6A 3CM6A 4CEEA 2HMIA 3QEWA 4DU3A 1TAQA 1WSHA 4CEDA 2IGIA 5JS2A 3MEDA 3NFAA 3PUFA 4OGEA 1RCHA 3K58A 1QSSA 1RT2A 4CIFA 3AO2A 2BE2A 2GV9A 4FJKA 4NYFA 4OKKA 1NOYA 4F4KA 4I9QA 3AO4A 3FFIA 3NH2A 2KTQA 3LP0A 1RBTA 4CJPA 3QEPA 4KHYA 4B9MA 4NCAA 4HTUA 2BGGA 3MEEA 4CF9A 4E7JA 4CIGA 3RRGA 1RBSA 1WSEA 3CM5A 4CHQA 1RDAA 1G15A 3ZT4A 3AVCA 1C0MA 2WONA 2IOCA 1BIZA 1IKXA 4FM0A 3MECA 2XY8A 2D5RA 1QQCA 4E19A 3DRSA 3EYZA 4CIEA 2BANA 4B9UA 2G8IA 1LAVA 4DQIA 2HHTA 1JXBA 4DSFA 4XIUA 2G8UA 3C6UA 1S6PA 1XHXA 3ZSYA 3TR8A 3HPGA 4B08A 4HCBA 4DG1A 4I9LA 1CXQA 4BWJA 1LV5A 1JL1A 4ELTA 4KHUA 1ZBLA 2OPRA 4E0DA 3CFOA 4CEQA 1BHLA 3ALYA 4OPJA 3VA0A 3L2QA 4Q0BA 4F8RA 3KLHA 4B9NA 4ZTFA 3KK1A 1WN7A 3AVIA 1T03A 2DY4A 3S3NA 3KD1E 4B3OA 1U04A 4CK1A 2LSNA 1HPZA 3S3OA 4O0IA 5SWMA 1KRPA 2Q3SA 3LPTA 3F73A 4EP4A 3DLHA 1JLGA 3T19A 1BGXT 4YNQA 1N5YA 4B9VA 3OYFA 3VQ5A 4CF0A 3OJUA 3V9ZA 1ASVA 1S1UA 4KV8A 2G8VA 4CJTA 3OYMA 1O1WA 1KFDA 1NK0A 1SKWA 2HVIA 3ASMA 1T8EA 3WNGA 3THVA 1KLMA 4CF8A 1D9FA 2B5JA 1YT3A 4M41A 1NKEA 4FJIA 4FJGA 4CJSA 5J2NA 1IKVA 4H8KA 4FXDA 3CG7A 3V4IA 3ISNC 2Y1IA 4LSNA 2RN2A 4UQGA 3TI0A 1UA0A 4PQUA 3TAQA 3VA3A 3SUPA 4AHVA 4FJ7A 4JRQA 4ID1A 2I5JA 2X6SA 4O55A 2XY5A 1Z26A 1NK4A 3QEIA 4F2RA 4KI6A 3P5JA 4FJ5A 2NUBA 5KRSA 1HNIA 3K5NA 3AVGA 4AHSA 4BE0A 4C8MA 3F9KA 3OYHA 2P5GA 4KTZA 4DU1A 3H08A 3LZIA 4RW4A 1N6QA 5DMRA 4CJEA 4W5OA 4N47A 1UAXA 2RKIA 1WSFA 4OPKA 3KLFA 4O0JA 1BI4A 4RW7A 2FBVA 1X1PA 4M3UA 1ZBFA 1S1TA 4Z4IA 4FLWA 1YVUA 3TAEA 4CK2A 1IH7A 5HRRA 5SZTA 3OS2A 2W42A 4HHTA 2FBYA 4E1MA 3L8BA 4C8KA 3AVFA 3M8PA 4C8OA 4FLUA 1TKZA 3L3UA 3LAKA 2YHBA 4DS4A 1RBVA 1C1CA 3V9WA 3SCXA 1ASUA 5I42A 1VK0A 3KTQA 3HJFA 4CJRA 3AA3A 5FDLA 4CFBA 2DTUA 4L8RB 3BGRA 4IDKA 1LW0A 4KB0A 4DTNA 2P5OA 2YNGA 3P83D 1LWFA 3LZJA 1U47A 1IO2A 5KGWA 5HROA 3I0SA 3SQ0A 3OYKA 4E1NA 3QIOA 1FKPA 3CFPA 1U48A 4KPYA 4FM2A 4O44A 2IDOA 5CZ1A 2DFHA 3RMBA 2HHSA 2R7YA 3PO4A 5KRTA 3KD5E 4K8XA 3NF8A 3ZSOA 1Q9XA 4FVMA 4HUFA 3VQ7A 2YHAA 1SV5A 3RMDA 1L3VA 4I2QA 3SUNA 3BDPA 4B8AB 3HYFA 4E7HA 3RRHA 2HNDA 3DLGA 1NK6A 1YTAA 1QSLA 4F3TA 3L2RA 3AV9A 4Z4EA 4B9SA 5D3GA 1WSIA 4DTUA 3WNFA 3PY8A 4CHZA 5J2MA 1RBRA 3QETA 3V9XA 3QIPA 4KAZA 1A5WA 4OGCA 4DTPA 3V81A 1VSLA 4CEOA 2X6NA 3PX4A 3SPZA 4OLAA 4W5RA 2ITGA 3NAEA 1I39A 1HYVA 4CJQA 1NK8A 1GOAA 1BQMA 3G10A 4FW1A 4CK3A 4DSJA 3AA4A 4JS5A 1D5AA 3HP9A 1RTHA 4IBNA 4CCHA 4BACA 3QESA 4DQQA 1GOCA 1RILA 4DFMA 1FK9A 4AH9A 1XI1A 4DSIA 3ZSZA 3O3FA 4QCLA 3HVTA 3AVNA 1L3UA 3NF6A 3HSTB 4CJFA 4CEZA 4RW9A 2HW3A 5C25A 3I0RA 3VQBA 1J9AA 1FKOA 3VQEA 4HVJA 3LWLA 1HJRA 3JSMA 1X9WA 2F8TA 1K6YA 3DYAA 3SQ2A 3K57A 3LDSA 3S3MA 4FJMA 1RTJA 4PA1A 3RWUA 3E01A 3SV3A 3KLEA 3G0ZA 1VSJA 1TK0A 1QE1A 5HBMA 5C24A 1JKHA 3DI6A 4DF8A 2WOMA 3NF9A 3K59A 4LSLA 3OYGA 2P51A 1D8YA 4IG0A 2OYQA 4CGHA 3TAGA 4RW8A 1TV6A 3SV4A 3HP6A 3K5MA 4FJNA 4O5BA 5FRNA 1TK5A 4CHNA 2BDPA 3DLKA 2E4LA 4KHQA 1CLQA 1S1WA 1QS4A 1S1VA 3OYNA 3RTVA 4EZ9A 1UA1A 2RPIA 2HHUA 1NK5A 3OYDA 3QEVA 1IG9A 4J2AA 3HXMA 3NGZA 1TVRA 2PY5A 4M3XA 1TK8A 1JLFA 3M8RA 4BDYA 1KVAA 4CJKA 5J2QA 4M3RA 4FLTA 3TABA 3SQ1A 3KK2A 3RMCA 4E7IA 4B9TA 4W5QA 4M3TA 1S9GA 4OVLA 1ASWA 3NGIA 1L3TA 1KSPA 1TKTA 4CJVA 4J2EA 1RT4A 3V6DA 2X78A 1ZBUA 1Q8IA 3AVMA 1L5UA 1QHTA 4PY5A 4LH5A 4M3ZA 3VQPA 3OYBA 2QKBA 2OA8A 3ZSWA 3M8SA 5CYQA 1BL3A 2Z1GA 4DTRA 1NK7A 1C1BA 2O4GA 3O4QA 1T05A 4CHYA 2KQ2A 1RTIA 3LP3A 1RDCA 3V1RA 4FZYA 3OS0A 1U4BA 2HHVA 3V1OA 4OKJA 1TKDA 2XY7A 4DTXA 3SI6A 1RT1A 2B6AA 4CERA 1REVA 1BISA 4H4OA 4DQRA 4BDZA 4Z4GA 3AA2A 4MFBA 4CJLA 2QXFA 1HQUA 3TAMA 3OJSA 4DSEA 4ELUA 1VRTA 3HT3A 4IFYA 1IKYA 1RNHA 4CHPA 4HUEA 4KI4A 2ZD1A 4MQ3A 4AHRA 2IAJA 4J2BA 4FZXC 4KB1A 5KTQA 5C42A 1KLNA 4W5TA 5J1EA 3HVRA 1EKEA 1JLAA 3TARA 1NJZA 3VQ6A 1RBUA 3UIQA 3DMJA 1W9HA 1RT6A 1B9DA 2HHQA 4CF1A 3DLRA 1L3SA 3OY9A 3AVAA 4NCBA 3NF7A 3PV8A 4CFCA 5HRNA 4M45A 3QLHA 2D0AA 3KK3A 2VG5A 3HK2A
chains in the Genus database with same CATH superfamily
3CC7N 3IFRA 4BDPA 3G25A 3QO9A 2DFFA 4WFAL 1C0UA 3A0IX 1WB9A 4IJNA 3PSFA 2V51B 3ZSVA 4FK2A 3KLGA 2FF3B 3VQ8A 4JI5K 2P9KA 2D0BA 2UU9K 4C8NA 4DTMA 3MWTA 2G8HA 2P9UA 3U3YA 2WUSA 3A5LC 2P9NA 3D0PA 2FF6A 1Q7YO 2ZE2A 5AQSA 4DQ8A 3RSEA 5CY4A 4BG9A 2PFUA 3L2WA 1D9DA 4DTSA 3I8BA 4OJRA 4PKIA 5KGXA 3OYCA 1BI4B 4LF9K 4IWVA 3ZSQA 3CCMN 5FROA 3QFUA 1VSDA 4H0YB 4LF7K 4OO1J 3THWB 2Y1JA 1QVGM 5DK5A 1VQMN 4CFDA 3PX0A 3O1BA 3CETA 2PZSA 1NOZA 4KRFA 2HVHA 3E9PA 2CGJA 4FWRA 2A41A 3VENA 2JLEA 1RDWX 3ZT3A 4JS4A 1Q82O 4FOIA 4A61A 1VSMA 1LWCA 1QHAA 2IC3A 1KTQA 1K8AO 4E3SA 2QTDA 1MWKA 2G8FA 4H0TB 1JJ2M 4DSKA 3SK3A 3WNHA 4Z4HA 3SZ2A 3ZT1A 3ZCMA 3QNNA 3HO1A 3O3HA 4DQPA 1M90O 3JYTA 3TTCA 1FW6A 4IKFA 2PYJA 3NHGA 1BG3A 2KHOA 4CF2A 1NG9A 1GLEG 3VQQA 3ZX0A 1WOQA 3DLBA 3D2EB 2FBTA 3AVKA 3AA5X 5LL6Z 4O8UA 3CJ9A 3ULEB 1RT7A 2F9WA 2W41A 1BWFO 3VQCA 4LC9B 3SNNA 2KFNA 5BPMA 4YFUA 4DS5A 3OBWA 4FWMA 3U8XA 2VQFK 3ZT0A 3KHYA 1S5JA 1Z25A 3BEXA 4BR5A 2E2OA 3O9UA 1IBLK 1JLBA 3CC4N 1EETA 2VQEK 5HRPA 2FBXA 3L3VA 1S22A 4DTJA 4Y1DA 1K8KB 1RTDA 2F4VK 4MLHA 4DR2K 4DLEA 2ETJA 1FXXA 2KFZA 4LF4K 4BRMA 3T1YK 3QDKA 3WXJA 5C15A 3BUZB 4GMJB 1JL2A 2OZMA 1SS6A 1Y97A 1SL1A 2YV0X 1CZ9A 2J4RA 4JI7K 1HRHA 3ULDA 4A2BA 3SLCA 2AJQA 4CECA 3D6RA 1JLCA 5JS1A 4LF8K 3VN5A 4DLGA 4PKHA 2Z1JA 1VRUA 2RF2A 2YNIA 4IXCA 3SYZA 2UUCK 1OH6A 4DMNA 4EIAA 3HM9A 3VERA 1J5OA 2GWJA 3VF2A 1HR0K 4E7KA 1U49A 2QEXN 4DU4A 2CH6A 4RW6A 4KHWA 2OZSA 1RDBA 4BRHA 3CCVN 2HSTA 1O13A 3CPEA 4FLYA 4GV6A 3ZSXA 3CM6A 5AZJB 2HMIA 1GLFO 3HSCA 3QEWA 4JK8A 3FGUA 4JK9A 4KH6A 1VQKN 4CEDA 4OX9K 5JS2A 3NFAA 3K58A 3J80O 3K9KA 3EE9A 2BE2A 1J6ZA 4OKKA 4I9QA 3O4WA 2O8BB 4YY3K 2KTQA 3THXB 3QEPA 4KHYA 3O8MA 4HTUA 1BUPA 4CIGA 3RRGA 1WSEA 2OTJN 1RDAA 2I7PA 3ZT4A 2QWNA 4H0XB 4DCHA 2WONA 3MECA 4BR2A 3DRSA 2A3ZA 4CIEA 2BANA 2YI1A 3HZ6A 3ENBA 4FWOA 4DSFA 5CHIA 2G8UA 1S6PA 3MMVA 2GEMA 4HCBA 3H3NO 4I9LA 1JL1A 4B9QA 1GLDG 5BN9A 4CEQA 1BHLA 3ALYA 3SAFA 4Q0BA 1NGAA 1WN7A 3AVIA 3VEXA 1OH7A 3KD1E 2LSNA 4FL9A 3VEOA 3S3OA 1KRPA 2Q3SA 3P4IA 2P9PB 4DKWA 1N5YA 3OYFA 4X66K 3NVMA 4CF0A 5GADP 3WXMB 3NMUA 3AGKA 1KLMA 1HKCA 2P9IB 5LJWA 1NKEA 3PLAA 4J8FA 3ISNC 1HNXK 4UQGA 2IVPA 4WQ4A 1UA0A 3VA3A 1ATNA 4O55A 3O80A 1NK4A 3P5JA 1HNIA 1YJ9N 3OYHA 1XMQK 4BVPA 2RKIA 4OPKA 3KLFA 3CCQN 1BI4A 1X1PA 4M3UA 1S1TA 3CD6N 2W42A 1E4FT 4FLUA 4FWSA 4C1NI 3THWA 1X3NA 3KTQA 3AA3A 4L8RB 1LW0A 4KB0A 2YNGA 4CZJA 2P9SB 3TPQA 4JV5K 4PL8A 4FWKA 2IDOA 4O44A 5CZ1A 5BPLA 3PO4A 3KD5E 4K8XA 5AQKA 4HUFA 1D4XA 3HBTA 1XNRK 3VF4A 3CC2N 1GLBG 4I2QA 3BDPA 2ZJPL 2HNDA 3DLGA 3P39A 3UE5A 1VQ5N 5AQLA 1EWQA 2VCPA 4I6MB 3WNFA 4FOEA 4CHZA 5FPNA 2ZJRL 3QETA 4DR4K 4OGCA 3PX4A 3ENOA 4W5RA 4CJQA 3B8AX 4EHTA 1GOAA 1OVQA 4AH9A 4DSIA 3D2EA 3HVTA 3AVNA 3HSTB 4CEZA 1J9AA 3LWLA 3ZLJA 3JSMA 3ULEA 3S3MA 3SQ2A 3VTHA 3E01A 3G0ZA 3QMLA 1QE1A 3WXLA 5JVHL 4H5VA 2WOMA 4CZGA 4CGHA 1WBBA 2E4LA 1S1VA 3OYNA 4GV3A 2HHUA 1BU6O 4B3MK 2YX6A 4FO0A 1K8KA 1TVRA 3WUHA 5C0YA 3FZHA 4M3XA 1JLFA 3H1QA 3M8RA 2JWLA 4FLTA 4BROA 3TABA 3N4PA 4W5QA 1S9GA 1L3TA 2V7ZA 3V6DA 1ZBUA 3AVMA 5BREA 1YHQN 4PY5A 3ZSWA 3M8SA 1FJGK 1BL3A 3LDNA 1C1BA 2O4GA 1T05A 3CCRN 3LP3A 1T6DA 3G6EN 4ISEA 2HHVA 1U4BA 3THYB 4NLBA 3OTOK 3TTDA 4DV2K 3AA2A 4ELUA 4CJLA 1NGHA 4DSEA 4KI4A 4BRIA 4HUEA 4CHPA 4FZXC 2AP1A 3BF3A 5KTQA 4GKKK 4IFEA 4X65K 1IV0A 1W9HA 4JKFA 2HHQA 1HNWK 3ZEUB 3DLRA 2Q0UA 4B1YB 5HRNA 3QLHA 2B4JA 4PWDA 3JAMO 3C95A 1YXQA 1TGOA 3TTFA 3QINA 3K5LA 4MDBA 1XHZA 4YOWA 3IMXA 5AZJA 4DFJA 4CGJA 2O8FB 3JXUA 3TSPA 4ELVA 4KREA 2QXLA 1HUXA 4CHOA 1UWBA 2Q1NA 1QZ5A 4BRFA 3ATVA 2YJEA 1W7AA 4DTOA 4FW2A 4Z4FA 1DTTA 2O8BA 3AVBA 3VEWA 3THXA 3KKRA 3A2FA 3ENHA 4DFKA 5BR8K 3VMFB 3LP2A 4CGIA 3O6WA 1BCOA 1GLAG 2IIRA 3TWHA 4FJLA 1RDUA 3ZETB 3O9QA 2P1JA 3LAMA 4CD3A 3SUOA 5AQWA 4BC5A 1S9EA 4CBXA 4N76A 4DV1K 2YNFA 2Z1HA 4YOXA 3ITHA 1WLJA 4JI2K 3NCIA 4ID5A 2W40A 3R6MA 5HP1A 3I8DA 3AO5A 3I33A 1NKBA 4K43A 4W5NA 2EHGA 1BOTO 5H1SQ 2P9PA 1HX1A 2UXCK 3CI5A 1I3AA 3QBXA 4IDHA 4QS7A 4F2SA 2F96A 1GLJO 4ZHRA 3RMAA 3M5RA 3SMSA 3KIOA 4KFBA 4OPHA 1BO5O 4DFPA 2P9IA 1S72N 4NXMK 2NRXA 2CGLA 4IEEA 3FE1A 2XO7A 3U6FA 2WBNA 1TL3A 1ESVA 1XUPO 3H6EA 3L2UA 3D45A 5LMUK 1C6VA 2W6KA 4MO4A 1VQNN 1B92A 2ZWHA 1CZBA 3ZX2A 1RT5A 2DFEA 3TSQA 1DTQA 2NLXA 1VSHA 3NH1A 4CJWA 1QVFM 3SJJA 2NZTA 3AVJA 1SL2A 3PO5A 4BRKA 4H03B 4CGDA 3L6QA 4CVNE 1ITGA 3AARA 1BQNA 4WFBL 3HPHA 2ATQA 1HJOA 3NGYA 5DM7L 2YNHA 1SKRA 4BWMA 3OYJA 2E5LK 3CJ7A 1NJWA 2X74A 4MLEA 1T7PA 4CZKA 3M8QA 1NLVA 4FJJA 2E2QA 2P9SA 2YCHA 5AQHA 4FJHA 3C7NB 4G1QA 4BRQA 2ZQBA 3DXKB 2KZZA 2WFBA 3SMPA 4AHUA 1HNVA 2UXBK 3WNEA 1KCFA 4AHTA 4AHCA 3UB5A 5E84A 4CI6A 5GAEP 3VTIA 3TSUA 2NRWA 4GW6A 1C0GA 5J2PA 5CZ2A 5AQVA 3VQ9A 4I6MA 1R0AA 3DJCA 3CXCM 4DF4A 4WQ5A 2HHHK 4FYDA 4J2DA 3ZSRA 4WFNL 2V52B 4LY7A 1WSJA 1NM1A 2YKMA 4BVOA 3LWMA 5IT9O 4FLVA 4BGAA 4EAHD 1OKJA 2JGUA 2Q31A 4BQLA 3GBTA 2XRIA 3GE1A 5M1QA 2A1SA 2RE2A 3IAYA 3HOTA 3HM8A 3SAHA 1SKSA 3AO1A 2F8SA 3H45C 3TAPA 1YITN 3MX5A 4IFVA 3SBTA 4N5SA 2IVNA 2G8KA 1VSKA 4FJ9A 3V9UA 3DAWA 3VETA 2O4IA 2VGNA 4JI8K 3U3GA 4BQZA 2PYLA 3VGKA 3CCUN 4WF9L 2OPQA 1EP4A 1NNEA 4BRPA 5HL7L 1TUYA 3MEDA 2GV9A 4NYFA 1NOYA 3FFIA 3CMAN 3T1HK 1RBTA 4NCAA 2WC9A 3MEEA 2VYPA 3CM5A 4IEIA 5KQ8A 2IOCA 1BIZA 1IKXA 4FM0A 1N8RO 2E20A 3R8EA 3UKRB 3HI0A 3CF5L 3THYA 4ILHA 4B9UA 4DQIA 2HHTA 1JXBA 3EO3A 4XIUA 2QA4N 3ZSYA 1YUWA 3HPGA 3MN7A 4JKAA 4H0OA 1CXQA 4ELTA 5KPTA 1VQON 5F1XA 2OPRA 4IO8A 3FZLA 3CFOA 3VEVA 3L2QA 4BRDA 4B9NA 4ZTFA 3KK1A 2DY4A 3SAGA 5E26A 3ZEUA 5FPMA 1JCGA 2VGMA 5SWMA 3LPTA 1JLGA 4JEPA 4CZMA 4YNQA 4G9ZA 3VQ5A 3OJUA 3V9ZA 4OLBA 1S1UA 2G8VA 3OYMA 3ASMA 1U2VB 1KAXA 4JHDB 1YT3A 4M41A 3EN9A 5GINA 4FJIA 4ISFA 5J2NA 1IKVA 4H8KA 4FXDA 2O8FA 2RN2A 3TI0A 3TAQA 1VQ4N 3SUPA 5AQUA 4AHVA 4B3SK 4JRQA 1DKGD 1Z26A 4FJ5A 3CIPA 4AHSA 2GX9A 4C8MA 5EXWA 1K73O 3H08A 1N6QA 5DMRA 4CJEA 4QS9A 4N47A 3ZETA 2QWLA 1WSFA 3CJBA 2HOEA 4XEIA 4RW7A 2FBVA 4CW7B 1ZBFA 4BG8A 5M1NA 4FLWA 4JYAK 3A5OC 3TAEA 5HRRA 3J8AA 5BPNA 2FBYA 4E1MA 3L8BA 1N36K 1TKZA 3R1XA 1RBVA 1OH5A 5M1OA 4BRLA 5FDLA 1ZBSA 5A2QO 5GAGP 2P5OA 3P83D 5AZIB 1U47A 3N4QA 4KPYA 4FM2A 1QQMA 2HHSA 2Q97A 1KAZA 2E88A 2R7YA 5BRFA 4DV3K 3HOSA 4FVMA 4L3QA 3LDLA 3RMDA 3MX2A 1L3VA 4KH4A 1QQNA 2D0OA 4B8AB 3HYFA 4E7HA 3WEEB 3RRHA 4DV5K 1NK6A 1YTAA 5MLCQ 5AQOA 3CCEN 1WSIA 1NGEA 4M7YA 5J2MA 3QIPA 4JD2B 1A5WA 4DTPA 2QW9A 2X6NA 2ITGA 4A57A 1BQMA 4FW1A 1ATSA 3HP9A 4RWTA 4CCHA 2YHXA 3QESA 4XH5A 4DFMA 1FK9A 2FSKA 3O3FA 3ZYYX 4KH5A 5C12A 5BRHA 1NGJA 3IDHA 3I0RA 4DR3K 1HJRA 3K9JA 3LDSA 3SV3A 3CERA 1MA9B 4MDAA 5C24A 1JKHA 2GUPA 3DI6A 4IOAL 2E1YA 1NMDA 3FR0A 4DV7K 4DF8A 1NGGA 3NF9A 1D8YA 2P51A 3BF1A 5AQZA 3TAGA 3U9ZA 3HP6A 4O5BA 5GIOA 5FRNA 3C7NA 1IBMK 3RTVA 1NK5A 3OYDA 3DXKA 1Z05A 5GAHP 1U6ZA 4CJKA 1NGIA 3SQ1A 3KK2A 3OW2M 4E7IA 4B9TA 1KD1O 1KSPA 4CJVA 1RT4A 4BC4A 3O9TA 2QWQA 4JI3K 4M3ZA 3VPZA 2QKBA 2HF3A 2Z1GA 2NRRA 3M3ZA 4CHYA 1YJWN 4FZYA 1TKDA 2QWPA 1RT1A 2HMPA 1REVA 4CERA 4Z4GA 2HF4A 2O8DB 1IKYA 1TYQB 2ZD1A 4MQ3A 3AAQA 2IAJA 3HTVA 4AHRA 4J2BA 4KB1A 5C42A 4PHTX 5J1EA 1HKGA 1NJZA 1NMNA 1RBUA 4FWNA 3DMJA 1RT6A 3J81O 1B9DA 3OY9A 3NF7A 3KK3A 5CYQA 1HMVA 2HBKA 4A5AA 1SUQA 1NJXA 2FXUA 2Z1IA 5M1FA 4KTQA 1JLQA 4KO0A 1Y64A 5AFUA 5EX5A 2FSNA 3NH0A 4TSXA 3LALA 1LAWA 1KXPA 2QI2A 1X3MA 5AQMA 3MEGA 3TAFA 3AO3A 2YKNA 1RT3A 4O4GA 1U45A 2QK9A 3C94A 3CJ1A 4ICLA 2HBJA 3EEQA 3M1FA 3UKRA 3VESA 3R9PA 3WT0A 3RR7A 4CJ4A 1LOTB 4Z4CA 1W0HA 5HRSA 1NK9A 3RVCA 1J54A 4I2PA 3A8YA 4FLXA 1XC9A 4JN4A 3C6TA 3HPOA 1F21A 5JLFA 5ELZA 3VQAA 4CJ3A 2VWJA 2VWKA 4BE2A 2BTFA 1EX4A 2Q2RA 4JKHA 3K2PA 5T7BA 4F3OA 3E66A 1EO1A 3UKUB 3LDQA 5GIPA 1S6QA 1JXEA 1YTUA 4CESA 1HLUA 1U2VA 4JHDA 4RTFD 5BR9A 1ATRA 4FLZA 1UOCA 4H4MA 1MU2A 4K8ZA 4DSLA 4CZFA 5AQTA 4A62A 1EWRA 4Q5VA 3SBGA 5ADXA 1S3XA 4C23A 5AJ3K 2ASPA 3O4NA 3AVHA 2ZM6K 4OKEA 3LANA 1NKCA 3DOKA 2E2NA 2O8CB 2HHXA 5I9EB 4B1XB 4RG8A 1C0TA 5C10A 3HL8A 5FRMA 4YDUA 1JCEA 4CEFA 3DM2A 1X9SA 5EOYA 3VGLA 4CGGA 2OANA 5FLXO 2QM1A 2NRVA 3MXJA 1TAUA 4BR9A 4BRAA 1DEJA 3EL2A 2XHBA 5KPZA 3DRRA 3OVNA 3QBWA 1N34K 4BE1A 1VSFA 3QFPA 4YOTA 4GY2B 5AZIA 3IRXA 1MDUB 3E1YA 4FCYA 3RR8A 2GUIA 3P1GA 3NDKA 1J5EK 5AQYA 1P90A 3TANA 3OYAA 4CJ5A 3AVLA 1QTMA 5CE3A 5AQJA 4E89A 3OS1A 2HHWA 4XH1A 3QEXA 1S1XA 4JKCA 3GDQA 4B1VA 4Z0UA 4M3YA 3WEEA 1SL0A 3OA9A 3CFRA 3O3GA 2NRZA 3MXMA 4H5WA 1A5XA 2VG6A 4QOZB 4JD2A 5AQPA 3KLIA 4ZTJA 2QWOA 1T6CA 4DR6K 4JKEA 1ZYQA 4LFBK 1LW2A 1OH8A 3OBYA 1TL1A 1XWLA 1I94K 3ID8A 4DR5K 3BP8A 1G99A 3T69A 4IO9L 3J7ZO 2F9TA 3P31A 2RHKA 3D2FB 3VQ4A 2YJFA 3V1QA 2E8AA 4E7LA 4FJ8A 4H5TA 4WCEL 3OYIA 4PL7A 4FK4A 4RCHA 4U67L 2D0CA 1SQKA 3IUCA 3CQ8A 4FZZA 3DRPA 3W3DA 1VSEA 4C1NK 2HNZA 4WE1A 2HNYA 3J7AP 4JI0K 2XY6A 3ATUA 3KK7A 5BN8A 4WYBA 1RFQA 2CGKA 4JAXA 4DU3A 4EHUA 4V19S 4NO7A 1W2BM 1WSHA 2IGIA 4OGEA 4AQYK 1QSSA 1RCHA 4B9MA 2BGGA 4O5FA 1NWKA 3CQXA 4CF9A 4IJAA 4E7JA 4CHQA 3AVCA 4B3TK 1QQCA 4E19A 3T7ZA 3O1WA 2E2PA 4FVUA 2CH5A 2O8DA 1TYQA 4BRGA 4KHUA 3SJHA 3QB0A 4OPJA 2ZJQL 3VA0A 4F8RA 3U9DA 4DR7K 1T03A 4B3OA 1U04A 4CK1A 1HPZA 4O0IA 1WBDA 4BC3A 5M1PA 3DLHA 3T19A 1BGXT 1ASVA 3M6GA 4KV8A 4B1ZA 1O1WA 1KFDA 4BC2A 2KKZA 1NK0A 2HVIA 1T8EA 3WNGA 3LDOA 3THVA 2B5JA 2NRTA 4FWLA 3V4IA 2Y1IA 4ID1A 2X6SA 2XY5A 4B1UB 5KRSA 3AVGA 1VQPN 4BE0A 1IG8A 4EFHA 4KTZA 5AQRA 1VHXA 3LZIA 2FSJA 3H46O 4FPBA 3GG4A 1OVYA 3C6HA 3A5NC 4Z4IA 3CQYA 4K41A 3CCSN 4C8KA 3AVFA 3L3UA 3LAKA 4DS4A 2P9LB 2YHBA 3FZMA 1C1CA 2O8EB 1ASUA 5LMNK 5I42A 4BRNA 2IVOA 3FFKB 1GLCG 4CFBA 4CJRA 3I56N 2DTUA 4DTNA 3LZJA 1YF5L 1IO2A 4HWIA 4OPAA 3ID6A 3I0SA 1U48A 3OYKA 3KWGA 3QIOA 1FKPA 5TKYA 4E1NA 3CFPA 5AQNA 3FZFA 2DFHA 3O9RA 3PSIA 3UKUA 2OTLN 2EWSA 3NF8A 3VQ7A 3O08A 1NGFA 1E3MA 4F3TA 3L2RA 4Z4EA 4B9SA 5D3GA 3AY9A 5JLHA 4DTUA 4DV4K 1IBKK 3PY8A 2F7TA 1RBRA 3V9XA 1IJJA 4KAZA 3V81A 3SPZA 1VSLA 4DV0K 3MDQA 1I39A 2ITMA 4LF5K 4DR1K 3A5MC 3AA4A 4B1WB 4JS5A 3CCJN 1D5AA 4IBNA 4H5RA 4BACA 4DQQA 1RILA 2O8CA 3MCPA 3ZSZA 1L3UA 3NF6A 4U7BA 1X9WA 3Q7CA 4IOCL 3RWUA 4PA1A 2ZGYA 1TK0A 4JK7A 1LCUA 3ZX3A 1BA0A 4MO5A 1YIJN 2A42A 5AQXA 3K59A 2AA4A 5KQDA 4IG0A 1X9JA 1TV6A 1BA1A 4HTLA 4CZIA 4CHNA 2BDPA 4KHQA 4A2AA 1S1WA 1QS4A 5C2DA 3QEVA 3NGZA 1N32K 2GELA 3VOVA 1KVAA 4M3RA 4NLCA 3RMCA 1HPMA 4OVLA 1ASWA 3NGIA 1TKTA 3BZCA 2KLAA 3MN5A 4BY9C 2X78A 1Q8IA 2HBMA 1L5UA 1QHTA 2H3GX 3VQPA 3D7EO 3DXMB 3L0QA 3O4QA 2KQ2A 1RDCA 3OS0A 3O9SA 3V1OA 1EQYA 2XY7A 3SI6A 2B6AA 3F2KA 4BGBA 4CD1A 4H4OA 4DQRA 4BDZA 4MFBA 4KHNA 2QXFA 1HQUA 3OJSA 1YAGA 4BR0A 4K42A 3TU5A 3AAPA 5AQGA 3HVRA 4JI4K 1EKEA 1QQOA 5AQQA 3TARA 2I7NA 3D2FA 3VQ6A 4CBUA 4PKGA 3J7YP 4CF1A 4BR7A 3AVAA 1JCFA 3FZKA 4CFCA 4M45A 3PIOL 1Q81O 2VG5A 4CJUA 3HK2A 2FC0A 5E41A 3LM2A 5EU7A 1CXUA 2JWKA 4M63C 5F0XA 3EKUA 1KAYA 1KFSA 4B9LA 4AM6A 4N56A 4M3WA 3LPUA 4JI6K 5JMVA 1NGDA 4FK0A 4JLHA 3NE6A 3KJVA 1WSGA 3QERA 4GV9A 1QSYA 4DV6K 1VQ6N 4IOXA 2A1RA 1CZAN 2E1ZA 1SAZA 4CFAA 1N33K 2BUPA 4PUOA 1SZ2A 5AQIA 1TKXA 2YHWA 2FLOA 2VG7A 1XNQK 4JNEA 4DWIA 3KVGA 4R79A 2D0PA 1V4SA 4X62K 3BY5A 4CGFA 2W6LA 2UYTA 4HCCA 3F9MA 4UY8O 5EVZA 4EZ6A 4NCGA 4DHYA 2HB5A 2NRHA 3BZKA 4AILC 5FPDA 3KKSA 3CYMA 2IS3A 1IKWA 3OYEA 1YJNN 2KW4A 4ILJA 3C6AA 2G8WA 3H1VX 3MAQA 3LP1A 4KKOA 4N41A 3DOLA 4AF1A 4CEBA 4JKGB 3S41A 5M1KA 1HYSA 4HUGA 1A5VA 4JRPA 2UUBK 3WQUA 3H3OB 5F2RA 1GOBA 3T1AA 5KI6A 1WNSA 5I3UA 3IG1A 1B9FA 5EY4A 5HLFA 1JLEA 4NXNK 3PX6A 3P38A 1ZBIA 1WAFA 5IWAK 2ASOA 2ASMA 5CYMA 1KVBA 4Y0WA 1BIUA 4M42A 1VQ7N 4LFCK 1Q18A 3MXIA 4LD0A 4YHHK 3B6OA 4WQ4C 2OPSA 5LY3A 3T3FA 1RDDA 4FM1A 3VQDA 4NYNA 4DUZK 3EZ5A 3ZT2A 4QS8A 2PBDA 3V9SA 3L2VA 2P9LA 4DQSA 3IS9A 3GOIA 2O8EA 2E6LA 4X64K 4BRCA 2D4WA 1VSIA 3EY1A 4IG3A 4FWQA 2QKKA 3L4IA 1E4GT 1TUUA 1ZC6A 2KZMA 3QNOA 4B8CA 4CBWA 3B6PA 4H0PA 1ZXOA 3E9LA 4I7FA 4R5PA 3WXKA 5K14A 4BR4A 3JS6A 1P8ZA 3OYLA 2A40A 1NJYA 5CR4A 1WAJA 3EE8A 1Q9YA 1KQSM 4KHPK 4CEAA 1VQLN 4Y1CA 1QZ6A 3MWPA 3S9HA 3K5OA 1BCMA 1LWEA 4C8LA 1J53A 4KTWA 4KHSA 3W0LA 1DLOA 3DLEA 5FPEA 5BRDA 1XC3A 4FSVA 2GBZA 3SQ4A 3NBPA 1ZBHA 1X9MA 4QAGA 3LM9A 4GVMA 1NGBA 4LH4A 2ZGZA 3SPYA 2NNWA 2E6MA 1HQEA 4A59A 1HYZA 1XQSC 3NVKA 1KVCA 4EP5A 4GKJK 2OPPA 1C1AA 3AGRA 4DB3A 2BH1A 4YOYA 4CE9A 1ILYA 3SUQA 1EXQA 4FJXA 2EX3A 4DUYK 3WXIA 4CEEA 3HRGA 5C2FA 1TAQA 2P9KB 4YOUA 3PUFA 1RT2A 4ISGA 4CIFA 3AO2A 3R3LA 2P9UB 4FJKA 4F4KA 3AO4A 3EZWA 3U4LA 4ILGB 3NH2A 1DT9A 2P9NB 3EKSA 3LP0A 3MN6A 4CJPA 1RBSA 1H1VA 2DPNA 1G15A 3RSEB 1C0MA 1HKBA 3DXMA 2XY8A 2D5RA 3IKMA 2QWRA 4JI1K 1VQ9N 3E9OA 4XH4A 3EYZA 2Q36A 1RGIA 5JVGL 2G8IA 1LAVA 4K0KK 3C6UA 1XHXA 3TR8A 5AFUH 4B08A 4DG1A 4BWJA 1LV5A 1ZBLA 4E0DA 4YDUC 3KLHA 1KC8O 3S3NA 3KWIA 3CMEN 1XMOK 3F73A 4EP4A 1Z6RA 5B8HA 2UUAK 2VWBA 4KBOA 5JICA 4GNIA 4B9VA 4CJTA 1SKWA 1W97L 4AM7A 1R59O 2Q0RA 1D9FA 4CF8A 3F5TA 3I55N 4FJGA 4CJSA 1T3VA 3CG7A 1V4TA 4LSNA 5HOOA 4PQUA 4FJ7A 4LFAK 2I5JA 3QEIA 4F2RA 4KI6A 2NUBA 2PAVA 3VF6A 3K5NA 3C65A 3FLCO 2P5GA 3F9KA 4M7XA 4DU1A 4RW4A 2QWMA 4W5OA 4YOVA 1UAXA 3VEZA 1VQ8N 2V7YA 4YORA 3PIPL 4CJ7A 4O0JA 5TKWA 1Q86O 1YVUA 3CHWA 1NGCA 4CK2A 1IH7A 3CJAA 5SZTA 3OS2A 4HHTA 5AR0A 1T44A 3M8PA 4C8OA 5ADXH 3V9WA 2A6AA 1BDGA 3SCXA 1VK0A 2GTDA 3HJFA 3BGRA 3C0BA 4IDKA 4GVEA 1YVNA 1LWFA 2ZF5O 1WUAA 5KGWA 5HROA 3SQ0A 1NU0A 3K0SA 3RMBA 4H5NA 1GLLO 5KRTA 1M1KO 4CZLA 3OHRA 3ZSOA 5LJVA 4IZ9A 1Q9XA 4JKGA 2YHAA 4NB4A 1SV5A 4JKDA 3SUNA 1QSLA 3MK6A 4K25A 3AV9A 1C0FA 3WQTA 4Z94A 2UXDK 3QICA 1MWMA 3O5BA 4CEOA 4OLAA 3NAEA 1HYVA 4A5BA 1NK8A 3G10A 4CK3A 4DSJA 1RTHA 1GOCA 4CZEA 1XI1A 4QCLA 4CJFA 4RW9A 2HW3A 5C25A 5AQFA 3VQBA 4HVJA 1FKOA 3VQEA 2F8TA 5KPRA 1K6YA 3DYAA 4FJMA 3K57A 1RTJA 3LDPA 1VAZA 3KLEA 3LL3A 1VSJA 3KZBA 5HBMA 4B3RK 4CZHA 3CJCA 4E1JA 2OYQA 4F9OA 4LSLA 3OYGA 4RW8A 3SV4A 3K5MA 4FJNA 2D1KA 1TK5A 3DLKA 2GWKA 1CLQA 3L4QA 4EZ9A 2OCEA 1UA1A 2RPIA 1DGKN 1IG9A 4J2AA 3HXMA 2PY5A 1TK8A 2A5XA 4BDYA 1NJIO 5J2QA 3CPWM 4M3TA 5DM6L 3MN9A 1YI2N 4J2EA 4LF6K 3Q7BA 2YHYA 4LH5A 3DLLL 2WTUA 3DWLA 3OYBA 2OA8A 4DTRA 1NK7A 4O8KA 3VGMA 1RTIA 3G71N 1HNZK 3V1RA 3CCLN 4OKJA 4DTXA 3VEYA 1BISA 3MCAB 3G4SN 3TAMA 4FWPA 1VRTA 3HT3A 4IFYA 1RNHA 1K9MO 4FPAA 4H0VB 1KLNA 4W5TA 1NBWA 1JLAA 4WQ5C 3UIQA 3GL1A 2HBLA 1L3SA 4JKBA 4NCBA 3PV8A 2D0AA 4BREA
chains in the Genus database with same CATH topology
1HMVA 2FC0A 3C95A 5E41A 1TGOA 1SUQA 3QO9A 4BDPA 2DFFA 5EU7A 4PWDA 1CXUA 1C0UA 1NJXA 3QINA 3K5LA 1XHZA 1KFSA 4B9LA 2Z1IA 4N56A 4M3WA 3LPUA 3ZSVA 1JLQA 4DFJA 4KTQA 4CGJA 4FK2A 3KLGA 4KO0A 4FK0A 4JLHA 3NE6A 3VQ8A 4ELVA 4KREA 4CHOA 1UWBA 3KJVA 1WSGA 3QERA 2D0BA 1QSYA 4C8NA 4DTMA 4DTOA 2G8HA 4FW2A 3NH0A 2A1RA 1DTTA 4TSXA 4Z4FA 3LALA 3U3YA 3AVBA 1LAWA 3D0PA 3KKRA 3MEGA 3A2FA 3TAFA 2ZE2A 3AO3A 4CFAA 4DFKA 2YKNA 4PUOA 1RT3A 3LP2A 4O4GA 5CY4A 4CGIA 1U45A 1TKXA 3C94A 2QK9A 3L2WA 1D9DA 4ICLA 1BCOA 2VG7A 4DTSA 3TWHA 4FJLA 4OJRA 4DWIA 3RR7A 5KGXA 3OYCA 2P1JA 3LAMA 4CJ4A 4Z4CA 1W0HA 1BI4B 5HRSA 3ZSQA 1NK9A 4CGFA 3SUOA 1J54A 5FROA 4HCCA 4I2PA 4FLXA 1S9EA 1XC9A 4N76A 3C6TA 3HPOA 1F21A 1VSDA 2YNFA 2Z1HA 4EZ6A 2Y1JA 3ITHA 4NCGA 1WLJA 5DK5A 2HB5A 3NCIA 4ID5A 3VQAA 4CJ3A 4AILC 4CFDA 3KKSA 3CYMA 2VWJA 3PX0A 2IS3A 1IKWA 2VWKA 5HP1A 4BE2A 3OYEA 3I8DA 1EX4A 2PZSA 1NOZA 4KRFA 3AO5A 2HVHA 2KW4A 1NKBA 3K2PA 5T7BA 4W5NA 4F3OA 2EHGA 2G8WA 3MAQA 2JLEA 3ZT3A 3LP1A 4KKOA 4N41A 1S6QA 3DOLA 1I3AA 1JXEA 4CEBA 4JS4A 1HYSA 4F2SA 4HUGA 1YTUA 2F96A 4ZHRA 3RMAA 4CESA 1VSMA 1A5VA 4JRPA 1LWCA 3KIOA 4KFBA 2IC3A 1KTQA 4DFPA 4E3SA 4FLZA 1UOCA 1GOBA 4H4MA 3T1AA 2G8FA 5KI6A 1WNSA 5I3UA 4DSKA 3IG1A 1B9FA 3WNHA 1MU2A 4Z4HA 3SZ2A 4K8ZA 3ZT1A 4DSLA 2XO7A 3ZCMA 1JLEA 3U6FA 3PX6A 5HLFA 1ZBIA 1TL3A 3QNNA 1WAFA 3L2UA 3HO1A 3D45A 4Q5VA 3O3HA 4DQPA 1C6VA 3JYTA 4IKFA 2PYJA 3NHGA 1B92A 3O4NA 3AVHA 4OKEA 1CZBA 5CYMA 3LANA 4CF2A 1KVBA 3VQQA 1BIUA 4M42A 1RT5A 2DFEA 3DOKA 1NKCA 3MXIA 1DTQA 3DLBA 2HHXA 2FBTA 1VSHA 4RG8A 1C0TA 3NH1A 3AVKA 3AA5X 3HL8A 4LD0A 4CJWA 4OLBA 5FRMA 3B6OA 4CEFA 3DM2A 3SJJA 1X9SA 2OPSA 3AVJA 4CGGA 1SL2A 1RT7A 3T3FA 3PO5A 3MXJA 1TAUA 1RDDA 4CGDA 4FM1A 3VQDA 4NYNA 3VQCA 1ITGA 2XHBA 3EZ5A 3SNNA 3DRRA 3ZT2A 2KFNA 1BQNA 3OVNA 2B4JA 3V9SA 3L2VA 3HPHA 2ATQA 4DQSA 3IS9A 3NGYA 4YFUA 4BE1A 2E6LA 4DS5A 2YNHA 1VSFA 4BWMA 1SKRA 3ZT0A 3OYJA 1S5JA 1Z25A 1NJWA 1VSIA 2X74A 3EY1A 1T7PA 3IRXA 4FCYA 3M8QA 4IG3A 3RR8A 2GUIA 4FJJA 4FJHA 1JLBA 3P1GA 3NDKA 2QKKA 4G1QA 1EETA 2KZMA 5HRPA 2FBXA 2ZQBA 3L3VA 4DTJA 3QNOA 2KZZA 3TANA 4Y1DA 4B8CA 4CJ5A 3OYAA 1RTDA 3AVLA 3B6PA 1QTMA 4E89A 3OS1A 2HHWA 4I7FA 4AHUA 4R5PA 1S1XA 3QEXA 1HNVA 5K14A 3WNEA 1KCFA 4Z0UA 4M3YA 4DLEA 4AHTA 4AHCA 2ETJA 3OYLA 1FXXA 1SL0A 2KFZA 1NJYA 4CJUA 1WAJA 4GW6A 3CFRA 5J2PA 5CZ2A 3VQ9A 3O3GA 1Q9YA 4CEAA 3MXMA 1R0AA 4Y1CA 4GMJB 1JL2A 3S9HA 1Y97A 3K5OA 2OZMA 1A5XA 2VG6A 4DF4A 4QOZB 4FYDA 4J2DA 1BCMA 3ZSRA 1LWEA 4C8LA 4LY7A 3LWMA 1WSJA 2YKMA 1J53A 4KHNA 3KLIA 4ZTJA 4KTWA 2YV0X 1SL1A 4FLVA 4KHSA 1CZ9A 1DLOA 1HRHA 3DLEA 2JGUA 3ULDA 1ZYQA 2AJQA 4CECA 1LW2A 1JLCA 1TL1A 2GBZA 2XRIA 3SQ4A 5JS1A 1XWLA 3NBPA 3VN5A 2A1SA 4DLGA 1ZBHA 1X9MA 3IAYA 2Z1JA 1VRUA 2RF2A 2YNIA 3SYZA 4QAGA 4GVMA 4DMNA 1SKSA 3AO1A 4LH4A 3VQ4A 2F8SA 3TAPA 3HM9A 3SPYA 2E6MA 1J5OA 1HQEA 3V1QA 4E7LA 4FJ8A 1HYZA 4IFVA 1KVCA 4N5SA 3OYIA 2G8KA 4E7KA 1U49A 1VSKA 4FJ9A 4EP5A 4DU4A 3V9UA 4FK4A 2D0CA 2OPPA 4RW6A 2O4IA 3CQ8A 4FZZA 3DRPA 1C1AA 4KHWA 1VSEA 3U3GA 2OZSA 2HNZA 1RDBA 4WE1A 4CE9A 2PYLA 3SUQA 1EXQA 4FJXA 2HNYA 2EX3A 4FLYA 2OPQA 1EP4A 3ZSXA 2XY6A 3CM6A 4CEEA 2HMIA 3QEWA 4DU3A 1TAQA 1WSHA 4CEDA 2IGIA 5JS2A 3MEDA 3NFAA 3PUFA 4OGEA 1RCHA 3K58A 1QSSA 1RT2A 4CIFA 3AO2A 2BE2A 2GV9A 4FJKA 4NYFA 4OKKA 1NOYA 4F4KA 4I9QA 3AO4A 3FFIA 3NH2A 2KTQA 3LP0A 1RBTA 4CJPA 3QEPA 4KHYA 4B9MA 4NCAA 4HTUA 2BGGA 3MEEA 4CF9A 4E7JA 4CIGA 3RRGA 1RBSA 1WSEA 3CM5A 4CHQA 1RDAA 1G15A 3ZT4A 3AVCA 1C0MA 2WONA 2IOCA 1BIZA 1IKXA 4FM0A 3MECA 2XY8A 2D5RA 1QQCA 4E19A 3DRSA 3EYZA 4CIEA 2BANA 4B9UA 2G8IA 1LAVA 4DQIA 2HHTA 1JXBA 4DSFA 4XIUA 2G8UA 3C6UA 1S6PA 1XHXA 3ZSYA 3TR8A 3HPGA 4B08A 4HCBA 4DG1A 4I9LA 1CXQA 4BWJA 1LV5A 1JL1A 4ELTA 4KHUA 1ZBLA 2OPRA 4E0DA 3CFOA 4CEQA 1BHLA 3ALYA 4OPJA 3VA0A 3L2QA 4Q0BA 4F8RA 3KLHA 4B9NA 4ZTFA 3KK1A 1WN7A 3AVIA 1T03A 2DY4A 3S3NA 3KD1E 4B3OA 1U04A 4CK1A 2LSNA 1HPZA 3S3OA 4O0IA 5SWMA 1KRPA 2Q3SA 3LPTA 3F73A 4EP4A 3DLHA 1JLGA 3T19A 1BGXT 4YNQA 1N5YA 4B9VA 3OYFA 3VQ5A 4CF0A 3OJUA 3V9ZA 1ASVA 1S1UA 4KV8A 2G8VA 4CJTA 3OYMA 1O1WA 1KFDA 1NK0A 1SKWA 2HVIA 3ASMA 1T8EA 3WNGA 3THVA 1KLMA 4CF8A 1D9FA 2B5JA 1YT3A 4M41A 1NKEA 4FJIA 4FJGA 4CJSA 5J2NA 1IKVA 4H8KA 4FXDA 3CG7A 3V4IA 3ISNC 2Y1IA 4LSNA 2RN2A 4UQGA 3TI0A 1UA0A 4PQUA 3TAQA 3VA3A 3SUPA 4AHVA 4FJ7A 4JRQA 4ID1A 2I5JA 2X6SA 4O55A 2XY5A 1Z26A 1NK4A 3QEIA 4F2RA 4KI6A 3P5JA 4FJ5A 2NUBA 5KRSA 1HNIA 3K5NA 3AVGA 4AHSA 4BE0A 4C8MA 3F9KA 3OYHA 2P5GA 4KTZA 4DU1A 3H08A 3LZIA 4RW4A 1N6QA 5DMRA 4CJEA 4W5OA 4N47A 1UAXA 2RKIA 1WSFA 4OPKA 3KLFA 4O0JA 1BI4A 4RW7A 2FBVA 1X1PA 4M3UA 1ZBFA 1S1TA 4Z4IA 4FLWA 1YVUA 3TAEA 4CK2A 1IH7A 5HRRA 5SZTA 3OS2A 2W42A 4HHTA 2FBYA 4E1MA 3L8BA 4C8KA 3AVFA 3M8PA 4C8OA 4FLUA 1TKZA 3L3UA 3LAKA 2YHBA 4DS4A 1RBVA 1C1CA 3V9WA 3SCXA 1ASUA 5I42A 1VK0A 3KTQA 3HJFA 4CJRA 3AA3A 5FDLA 4CFBA 2DTUA 4L8RB 3BGRA 4IDKA 1LW0A 4KB0A 4DTNA 2P5OA 2YNGA 3P83D 1LWFA 3LZJA 1U47A 1IO2A 5KGWA 5HROA 3I0SA 3SQ0A 3OYKA 4E1NA 3QIOA 1FKPA 3CFPA 1U48A 4KPYA 4FM2A 4O44A 2IDOA 5CZ1A 2DFHA 3RMBA 2HHSA 2R7YA 3PO4A 5KRTA 3KD5E 4K8XA 3NF8A 3ZSOA 1Q9XA 4FVMA 4HUFA 3VQ7A 2YHAA 1SV5A 3RMDA 1L3VA 4I2QA 3SUNA 3BDPA 4B8AB 3HYFA 4E7HA 3RRHA 2HNDA 3DLGA 1NK6A 1YTAA 1QSLA 4F3TA 3L2RA 3AV9A 4Z4EA 4B9SA 5D3GA 1WSIA 4DTUA 3WNFA 3PY8A 4CHZA 5J2MA 1RBRA 3QETA 3V9XA 3QIPA 4KAZA 1A5WA 4OGCA 4DTPA 3V81A 1VSLA 4CEOA 2X6NA 3PX4A 3SPZA 4OLAA 4W5RA 2ITGA 3NAEA 1I39A 1HYVA 4CJQA 1NK8A 1GOAA 1BQMA 3G10A 4FW1A 4CK3A 4DSJA 3AA4A 4JS5A 1D5AA 3HP9A 1RTHA 4IBNA 4CCHA 4BACA 3QESA 4DQQA 1GOCA 1RILA 4DFMA 1FK9A 4AH9A 1XI1A 4DSIA 3ZSZA 3O3FA 4QCLA 3HVTA 3AVNA 1L3UA 3NF6A 3HSTB 4CJFA 4CEZA 4RW9A 2HW3A 5C25A 3I0RA 3VQBA 1J9AA 1FKOA 3VQEA 4HVJA 3LWLA 1HJRA 3JSMA 1X9WA 2F8TA 1K6YA 3DYAA 3SQ2A 3K57A 3LDSA 3S3MA 4FJMA 1RTJA 4PA1A 3RWUA 3E01A 3SV3A 3KLEA 3G0ZA 1VSJA 1TK0A 1QE1A 5HBMA 5C24A 1JKHA 3DI6A 4DF8A 2WOMA 3NF9A 3K59A 4LSLA 3OYGA 2P51A 1D8YA 4IG0A 2OYQA 4CGHA 3TAGA 4RW8A 1TV6A 3SV4A 3HP6A 3K5MA 4FJNA 4O5BA 5FRNA 1TK5A 4CHNA 2BDPA 3DLKA 2E4LA 4KHQA 1CLQA 1S1WA 1QS4A 1S1VA 3OYNA 3RTVA 4EZ9A 1UA1A 2RPIA 2HHUA 1NK5A 3OYDA 3QEVA 1IG9A 4J2AA 3HXMA 3NGZA 1TVRA 2PY5A 4M3XA 1TK8A 1JLFA 3M8RA 4BDYA 1KVAA 4CJKA 5J2QA 4M3RA 4FLTA 3TABA 3SQ1A 3KK2A 3RMCA 4E7IA 4B9TA 4W5QA 4M3TA 1S9GA 4OVLA 1ASWA 3NGIA 1L3TA 1KSPA 1TKTA 4CJVA 4J2EA 1RT4A 3V6DA 2X78A 1ZBUA 1Q8IA 3AVMA 1L5UA 1QHTA 4PY5A 4LH5A 4M3ZA 3VQPA 3OYBA 2QKBA 2OA8A 3ZSWA 3M8SA 5CYQA 1BL3A 2Z1GA 4DTRA 1NK7A 1C1BA 2O4GA 3O4QA 1T05A 4CHYA 2KQ2A 1RTIA 3LP3A 1RDCA 3V1RA 4FZYA 3OS0A 1U4BA 2HHVA 3V1OA 4OKJA 1TKDA 2XY7A 4DTXA 3SI6A 1RT1A 2B6AA 4CERA 1REVA 1BISA 4H4OA 4DQRA 4BDZA 4Z4GA 3AA2A 4MFBA 4CJLA 2QXFA 1HQUA 3TAMA 3OJSA 4DSEA 4ELUA 1VRTA 3HT3A 4IFYA 1IKYA 1RNHA 4CHPA 4HUEA 4KI4A 2ZD1A 4MQ3A 4AHRA 2IAJA 4J2BA 4FZXC 4KB1A 5KTQA 5C42A 1KLNA 4W5TA 5J1EA 3HVRA 1EKEA 1JLAA 3TARA 1NJZA 3VQ6A 1RBUA 3UIQA 3DMJA 1W9HA 1RT6A 1B9DA 2HHQA 4CF1A 3DLRA 1L3SA 3OY9A 3AVAA 4NCBA 3NF7A 3PV8A 4CFCA 5HRNA 4M45A 3QLHA 2D0AA 3KK3A 2VG5A 3HK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HMV A;  2FC0 A;  3C95 A;  5E41 A;  1TGO A;  1SUQ A;  3QO9 A;  4BDP A;  2DFF A;  5EU7 A;  4PWD A;  1CXU A;  1C0U A;  1NJX A;  3QIN A;  3K5L A;  1XHZ A;  1KFS A;  4B9L A;  2Z1I A;  4N56 A;  4M3W A;  3LPU A;  3ZSV A;  1JLQ A;  4DFJ A;  4KTQ A;  4CGJ A;  4FK2 A;  3KLG A;  4KO0 A;  4FK0 A;  4JLH A;  3NE6 A;  3VQ8 A;  4ELV A;  4KRE A;  4CHO A;  1UWB A;  3KJV A;  1WSG A;  3QER A;  2D0B A;  1QSY A;  4C8N A;  4DTM A;  4DTO A;  2G8H A;  4FW2 A;  3NH0 A;  2A1R A;  1DTT A;  4TSX A;  4Z4F A;  3LAL A;  3U3Y A;  3AVB A;  1LAW A;  3D0P A;  3KKR A;  3MEG A;  3A2F A;  3TAF A;  2ZE2 A;  3AO3 A;  4CFA A;  4DFK A;  2YKN A;  4PUO A;  1RT3 A;  3LP2 A;  4O4G A;  5CY4 A;  4CGI A;  1U45 A;  1TKX A;  3C94 A;  2QK9 A;  3L2W A;  1D9D A;  4ICL A;  1BCO A;  2VG7 A;  4DTS A;  3TWH A;  4FJL A;  4OJR A;  4DWI A;  3RR7 A;  5KGX A;  3OYC A;  2P1J A;  3LAM A;  4CJ4 A;  4Z4C A;  1W0H A;  1BI4 B;  5HRS A;  3ZSQ A;  1NK9 A;  4CGF A;  3SUO A;  1J54 A;  5FRO A;  4HCC A;  4I2P A;  4FLX A;  1S9E A;  1XC9 A;  4N76 A;  3C6T A;  3HPO A;  1F21 A;  1VSD A;  2YNF A;  2Z1H A;  4EZ6 A;  2Y1J A;  3ITH A;  4NCG A;  1WLJ A;  5DK5 A;  2HB5 A;  3NCI A;  4ID5 A;  3VQA A;  4CJ3 A;  4AIL C;  4CFD A;  3KKS A;  3CYM A;  2VWJ A;  3PX0 A;  2IS3 A;  1IKW A;  2VWK A;  5HP1 A;  4BE2 A;  3OYE A;  3I8D A;  1EX4 A;  2PZS A;  1NOZ A;  4KRF A;  3AO5 A;  2HVH A;  2KW4 A;  1NKB A;  3K2P A;  5T7B A;  4W5N A;  4F3O A;  2EHG A;  2G8W A;  3MAQ A;  2JLE A;  3ZT3 A;  3LP1 A;  4KKO A;  4N41 A;  1S6Q A;  3DOL A;  1I3A A;  1JXE A;  4CEB A;  4JS4 A;  1HYS A;  4F2S A;  4HUG A;  1YTU A;  2F96 A;  4ZHR A;  3RMA A;  4CES A;  1VSM A;  1A5V A;  4JRP A;  1LWC A;  3KIO A;  4KFB A;  2IC3 A;  1KTQ A;  4DFP A;  4E3S A;  4FLZ A;  1UOC A;  1GOB A;  4H4M A;  3T1A A;  2G8F A;  5KI6 A;  1WNS A;  5I3U A;  4DSK A;  3IG1 A;  1B9F A;  3WNH A;  1MU2 A;  4Z4H A;  3SZ2 A;  4K8Z A;  3ZT1 A;  4DSL A;  2XO7 A;  3ZCM A;  1JLE A;  3U6F A;  3PX6 A;  5HLF A;  1ZBI A;  1TL3 A;  3QNN A;  1WAF A;  3L2U A;  3HO1 A;  3D45 A;  4Q5V A;  3O3H A;  4DQP A;  1C6V A;  3JYT A;  4IKF A;  2PYJ A;  3NHG A;  1B92 A;  3O4N A;  3AVH A;  4OKE A;  1CZB A;  5CYM A;  3LAN A;  4CF2 A;  1KVB A;  3VQQ A;  1BIU A;  4M42 A;  1RT5 A;  2DFE A;  3DOK A;  1NKC A;  3MXI A;  1DTQ A;  3DLB A;  2HHX A;  2FBT A;  1VSH A;  4RG8 A;  1C0T A;  3NH1 A;  3AVK A;  3AA5 X;  3HL8 A;  4LD0 A;  4CJW A;  4OLB A;  5FRM A;  3B6O A;  4CEF A;  3DM2 A;  3SJJ A;  1X9S A;  2OPS A;  3AVJ A;  4CGG A;  1SL2 A;  1RT7 A;  3T3F A;  3PO5 A;  3MXJ A;  1TAU A;  1RDD A;  4CGD A;  4FM1 A;  3VQD A;  4NYN A;  3VQC A;  1ITG A;  2XHB A;  3EZ5 A;  3SNN A;  3DRR A;  3ZT2 A;  2KFN A;  1BQN A;  3OVN A;  2B4J A;  3V9S A;  3L2V A;  3HPH A;  2ATQ A;  4DQS A;  3IS9 A;  3NGY A;  4YFU A;  4BE1 A;  2E6L A;  4DS5 A;  2YNH A;  1VSF A;  4BWM A;  1SKR A;  3ZT0 A;  3OYJ A;  1S5J A;  1Z25 A;  1NJW A;  1VSI A;  2X74 A;  3EY1 A;  1T7P A;  3IRX A;  4FCY A;  3M8Q A;  4IG3 A;  3RR8 A;  2GUI A;  4FJJ A;  4FJH A;  1JLB A;  3P1G A;  3NDK A;  2QKK A;  4G1Q A;  1EET A;  2KZM A;  5HRP A;  2FBX A;  2ZQB A;  3L3V A;  4DTJ A;  3QNO A;  2KZZ A;  3TAN A;  4Y1D A;  4B8C A;  4CJ5 A;  3OYA A;  1RTD A;  3AVL A;  3B6P A;  1QTM A;  4E89 A;  3OS1 A;  2HHW A;  4I7F A;  4AHU A;  4R5P A;  1S1X A;  3QEX A;  1HNV A;  5K14 A;  3WNE A;  1KCF A;  4Z0U A;  4M3Y A;  4DLE A;  4AHT A;  4AHC A;  2ETJ A;  3OYL A;  1FXX A;  1SL0 A;  2KFZ A;  1NJY A;  4CJU A;  1WAJ A;  4GW6 A;  3CFR A;  5J2P A;  5CZ2 A;  3VQ9 A;  3O3G A;  1Q9Y A;  4CEA A;  3MXM A;  1R0A A;  4Y1C A;  4GMJ B;  1JL2 A;  3S9H A;  1Y97 A;  3K5O A;  2OZM A;  1A5X A;  2VG6 A;  4DF4 A;  4QOZ B;  4FYD A;  4J2D A;  1BCM A;  3ZSR A;  1LWE A;  4C8L A;  4LY7 A;  3LWM A;  1WSJ A;  2YKM A;  1J53 A;  4KHN A;  3KLI A;  4ZTJ A;  4KTW A;  2YV0 X;  1SL1 A;  4FLV A;  4KHS A;  1CZ9 A;  1DLO A;  1HRH A;  3DLE A;  2JGU A;  3ULD A;  1ZYQ A;  2AJQ A;  4CEC A;  1LW2 A;  1JLC A;  1TL1 A;  2GBZ A;  2XRI A;  3SQ4 A;  5JS1 A;  1XWL A;  3NBP A;  3VN5 A;  2A1S A;  4DLG A;  1ZBH A;  1X9M A;  3IAY A;  2Z1J A;  1VRU A;  2RF2 A;  2YNI A;  3SYZ A;  4QAG A;  4GVM A;  4DMN A;  1SKS A;  3AO1 A;  4LH4 A;  3VQ4 A;  2F8S A;  3TAP A;  3HM9 A;  3SPY A;  2E6M A;  1J5O A;  1HQE A;  3V1Q A;  4E7L A;  4FJ8 A;  1HYZ A;  4IFV A;  1KVC A;  4N5S A;  3OYI A;  2G8K A;  4E7K A;  1U49 A;  1VSK A;  4FJ9 A;  4EP5 A;  4DU4 A;  3V9U A;  4FK4 A;  2D0C A;  2OPP A;  4RW6 A;  2O4I A;  3CQ8 A;  4FZZ A;  3DRP A;  1C1A A;  4KHW A;  1VSE A;  3U3G A;  2OZS A;  2HNZ A;  1RDB A;  4WE1 A;  4CE9 A;  2PYL A;  3SUQ A;  1EXQ A;  4FJX A;  2HNY A;  2EX3 A;  4FLY A;  2OPQ A;  1EP4 A;  3ZSX A;  2XY6 A;  3CM6 A;  4CEE A;  2HMI A;  3QEW A;  4DU3 A;  1TAQ A;  1WSH A;  4CED A;  2IGI A;  5JS2 A;  3MED A;  3NFA A;  3PUF A;  4OGE A;  1RCH A;  3K58 A;  1QSS A;  1RT2 A;  4CIF A;  3AO2 A;  2BE2 A;  2GV9 A;  4FJK A;  4NYF A;  4OKK A;  1NOY A;  4F4K A;  4I9Q A;  3AO4 A;  3FFI A;  3NH2 A;  2KTQ A;  3LP0 A;  1RBT A;  4CJP A;  3QEP A;  4KHY A;  4B9M A;  4NCA A;  4HTU A;  2BGG A;  3MEE A;  4CF9 A;  4E7J A;  4CIG A;  3RRG A;  1RBS A;  1WSE A;  3CM5 A;  4CHQ A;  1RDA A;  1G15 A;  3ZT4 A;  3AVC A;  1C0M A;  2WON A;  2IOC A;  1BIZ A;  1IKX A;  4FM0 A;  3MEC A;  2XY8 A;  2D5R A;  1QQC A;  4E19 A;  3DRS A;  3EYZ A;  4CIE A;  2BAN A;  4B9U A;  2G8I A;  1LAV A;  4DQI A;  2HHT A;  1JXB A;  4DSF A;  4XIU A;  2G8U A;  3C6U A;  1S6P A;  1XHX A;  3ZSY A;  3TR8 A;  3HPG A;  4B08 A;  4HCB A;  4DG1 A;  4I9L A;  1CXQ A;  4BWJ A;  1LV5 A;  1JL1 A;  4ELT A;  4KHU A;  1ZBL A;  2OPR A;  4E0D A;  3CFO A;  4CEQ A;  1BHL A;  3ALY A;  4OPJ A;  3VA0 A;  3L2Q A;  4Q0B A;  4F8R A;  3KLH A;  4B9N A;  4ZTF A;  3KK1 A;  1WN7 A;  3AVI A;  1T03 A;  2DY4 A;  3S3N A;  3KD1 E;  4B3O A;  1U04 A;  4CK1 A;  2LSN A;  1HPZ A;  3S3O A;  4O0I A;  5SWM A;  1KRP A;  2Q3S A;  3LPT A;  3F73 A;  4EP4 A;  3DLH A;  1JLG A;  3T19 A;  1BGX T;  4YNQ A;  1N5Y A;  4B9V A;  3OYF A;  3VQ5 A;  4CF0 A;  3OJU A;  3V9Z A;  1ASV A;  1S1U A;  4KV8 A;  2G8V A;  4CJT A;  3OYM A;  1O1W A;  1KFD A;  1NK0 A;  1SKW A;  2HVI A;  3ASM A;  1T8E A;  3WNG A;  3THV A;  1KLM A;  4CF8 A;  1D9F A;  2B5J A;  1YT3 A;  4M41 A;  1NKE A;  4FJI A;  4FJG A;  4CJS A;  5J2N A;  1IKV A;  4H8K A;  4FXD A;  3CG7 A;  3V4I A;  3ISN C;  2Y1I A;  4LSN A;  2RN2 A;  4UQG A;  3TI0 A;  1UA0 A;  4PQU A;  3TAQ A;  3VA3 A;  3SUP A;  4AHV A;  4FJ7 A;  4JRQ A;  4ID1 A;  2I5J A;  2X6S A;  4O55 A;  2XY5 A;  1Z26 A;  1NK4 A;  3QEI A;  4F2R A;  4KI6 A;  3P5J A;  4FJ5 A;  2NUB A;  5KRS A;  1HNI A;  3K5N A;  3AVG A;  4AHS A;  4BE0 A;  4C8M A;  3F9K A;  3OYH A;  2P5G A;  4KTZ A;  4DU1 A;  3H08 A;  3LZI A;  4RW4 A;  1N6Q A;  5DMR A;  4CJE A;  4W5O A;  4N47 A;  1UAX A;  2RKI A;  1WSF A;  4OPK A;  3KLF A;  4O0J A;  1BI4 A;  4RW7 A;  2FBV A;  1X1P A;  4M3U A;  1ZBF A;  1S1T A;  4Z4I A;  4FLW A;  1YVU A;  3TAE A;  4CK2 A;  1IH7 A;  5HRR A;  5SZT A;  3OS2 A;  2W42 A;  4HHT A;  2FBY A;  4E1M A;  3L8B A;  4C8K A;  3AVF A;  3M8P A;  4C8O A;  4FLU A;  1TKZ A;  3L3U A;  3LAK A;  2YHB A;  4DS4 A;  1RBV A;  1C1C A;  3V9W A;  3SCX A;  1ASU A;  5I42 A;  1VK0 A;  3KTQ A;  3HJF A;  4CJR A;  3AA3 A;  5FDL A;  4CFB A;  2DTU A;  4L8R B;  3BGR A;  4IDK A;  1LW0 A;  4KB0 A;  4DTN A;  2P5O A;  2YNG A;  3P83 D;  1LWF A;  3LZJ A;  1U47 A;  1IO2 A;  5KGW A;  5HRO A;  3I0S A;  3SQ0 A;  3OYK A;  4E1N A;  3QIO A;  1FKP A;  3CFP A;  1U48 A;  4KPY A;  4FM2 A;  4O44 A;  2IDO A;  5CZ1 A;  2DFH A;  3RMB A;  2HHS A;  2R7Y A;  3PO4 A;  5KRT A;  3KD5 E;  4K8X A;  3NF8 A;  3ZSO A;  1Q9X A;  4FVM A;  4HUF A;  3VQ7 A;  2YHA A;  1SV5 A;  3RMD A;  1L3V A;  4I2Q A;  3SUN A;  3BDP A;  4B8A B;  3HYF A;  4E7H A;  3RRH A;  2HND A;  3DLG A;  1NK6 A;  1YTA A;  1QSL A;  4F3T A;  3L2R A;  3AV9 A;  4Z4E A;  4B9S A;  5D3G A;  1WSI A;  4DTU A;  3WNF A;  3PY8 A;  4CHZ A;  5J2M A;  1RBR A;  3QET A;  3V9X A;  3QIP A;  4KAZ A;  1A5W A;  4OGC A;  4DTP A;  3V81 A;  1VSL A;  4CEO A;  2X6N A;  3PX4 A;  3SPZ A;  4OLA A;  4W5R A;  2ITG A;  3NAE A;  1I39 A;  1HYV A;  4CJQ A;  1NK8 A;  1GOA A;  1BQM A;  3G10 A;  4FW1 A;  4CK3 A;  4DSJ A;  3AA4 A;  4JS5 A;  1D5A A;  3HP9 A;  1RTH A;  4IBN A;  4CCH A;  4BAC A;  3QES A;  4DQQ A;  1GOC A;  1RIL A;  4DFM A;  1FK9 A;  4AH9 A;  1XI1 A;  4DSI A;  3ZSZ A;  3O3F A;  4QCL A;  3HVT A;  3AVN A;  1L3U A;  3NF6 A;  3HST B;  4CJF A;  4CEZ A;  4RW9 A;  2HW3 A;  5C25 A;  3I0R A;  3VQB A;  1J9A A;  1FKO A;  3VQE A;  4HVJ A;  3LWL A;  1HJR A;  3JSM A;  1X9W A;  2F8T A;  1K6Y A;  3DYA A;  3SQ2 A;  3K57 A;  3LDS A;  3S3M A;  4FJM A;  1RTJ A;  4PA1 A;  3RWU A;  3E01 A;  3SV3 A;  3KLE A;  3G0Z A;  1VSJ A;  1TK0 A;  1QE1 A;  5HBM A;  5C24 A;  1JKH A;  3DI6 A;  4DF8 A;  2WOM A;  3NF9 A;  3K59 A;  4LSL A;  3OYG A;  2P51 A;  1D8Y A;  4IG0 A;  2OYQ A;  4CGH A;  3TAG A;  4RW8 A;  1TV6 A;  3SV4 A;  3HP6 A;  3K5M A;  4FJN A;  4O5B A;  5FRN A;  1TK5 A;  4CHN A;  2BDP A;  3DLK A;  2E4L A;  4KHQ A;  1CLQ A;  1S1W A;  1QS4 A;  1S1V A;  3OYN A;  3RTV A;  4EZ9 A;  1UA1 A;  2RPI A;  2HHU A;  1NK5 A;  3OYD A;  3QEV A;  1IG9 A;  4J2A A;  3HXM A;  3NGZ A;  1TVR A;  2PY5 A;  4M3X A;  1TK8 A;  1JLF A;  3M8R A;  4BDY A;  1KVA A;  4CJK A;  5J2Q A;  4M3R A;  4FLT A;  3TAB A;  3SQ1 A;  3KK2 A;  3RMC A;  4E7I A;  4B9T A;  4W5Q A;  4M3T A;  1S9G A;  4OVL A;  1ASW A;  3NGI A;  1L3T A;  1KSP A;  1TKT A;  4CJV A;  4J2E A;  1RT4 A;  3V6D A;  2X78 A;  1ZBU A;  1Q8I A;  3AVM A;  1L5U A;  1QHT A;  4PY5 A;  4LH5 A;  4M3Z A;  3VQP A;  3OYB A;  2QKB A;  2OA8 A;  3ZSW A;  3M8S A;  5CYQ A;  1BL3 A;  2Z1G A;  4DTR A;  1NK7 A;  1C1B A;  2O4G A;  3O4Q A;  1T05 A;  4CHY A;  2KQ2 A;  1RTI A;  3LP3 A;  1RDC A;  3V1R A;  4FZY A;  3OS0 A;  1U4B A;  2HHV A;  3V1O A;  4OKJ A;  1TKD A;  2XY7 A;  4DTX A;  3SI6 A;  1RT1 A;  2B6A A;  4CER A;  1REV A;  1BIS A;  4H4O A;  4DQR A;  4BDZ A;  4Z4G A;  3AA2 A;  4MFB A;  4CJL A;  2QXF A;  1HQU A;  3TAM A;  3OJS A;  4DSE A;  4ELU A;  1VRT A;  3HT3 A;  4IFY A;  1IKY A;  1RNH A;  4CHP A;  4HUE A;  4KI4 A;  2ZD1 A;  4MQ3 A;  4AHR A;  2IAJ A;  4J2B A;  4FZX C;  4KB1 A;  5KTQ A;  5C42 A;  1KLN A;  4W5T A;  5J1E A;  3HVR A;  1EKE A;  1JLA A;  3TAR A;  1NJZ A;  3VQ6 A;  1RBU A;  3UIQ A;  3DMJ A;  1W9H A;  1RT6 A;  1B9D A;  2HHQ A;  4CF1 A;  3DLR A;  1L3S A;  3OY9 A;  3AVA A;  4NCB A;  3NF7 A;  3PV8 A;  4CFC A;  5HRN A;  4M45 A;  3QLH A;  2D0A A;  3KK3 A;  2VG5 A;  3HK2 A; 
#chains in the Genus database with same CATH topology
 3CC7 N;  3IFR A;  4BDP A;  3G25 A;  3QO9 A;  2DFF A;  4WFA L;  1C0U A;  3A0I X;  1WB9 A;  4IJN A;  3PSF A;  2V51 B;  3ZSV A;  4FK2 A;  3KLG A;  2FF3 B;  3VQ8 A;  4JI5 K;  2P9K A;  2D0B A;  2UU9 K;  4C8N A;  4DTM A;  3MWT A;  2G8H A;  2P9U A;  3U3Y A;  2WUS A;  3A5L C;  2P9N A;  3D0P A;  2FF6 A;  1Q7Y O;  2ZE2 A;  5AQS A;  4DQ8 A;  3RSE A;  5CY4 A;  4BG9 A;  2PFU A;  3L2W A;  1D9D A;  4DTS A;  3I8B A;  4OJR A;  4PKI A;  5KGX A;  3OYC A;  1BI4 B;  4LF9 K;  4IWV A;  3ZSQ A;  3CCM N;  5FRO A;  3QFU A;  1VSD A;  4H0Y B;  4LF7 K;  4OO1 J;  3THW B;  2Y1J A;  1QVG M;  5DK5 A;  1VQM N;  4CFD A;  3PX0 A;  3O1B A;  3CET A;  2PZS A;  1NOZ A;  4KRF A;  2HVH A;  3E9P A;  2CGJ A;  4FWR A;  2A41 A;  3VEN A;  2JLE A;  1RDW X;  3ZT3 A;  4JS4 A;  1Q82 O;  4FOI A;  4A61 A;  1VSM A;  1LWC A;  1QHA A;  2IC3 A;  1KTQ A;  1K8A O;  4E3S A;  2QTD A;  1MWK A;  2G8F A;  4H0T B;  1JJ2 M;  4DSK A;  3SK3 A;  3WNH A;  4Z4H A;  3SZ2 A;  3ZT1 A;  3ZCM A;  3QNN A;  3HO1 A;  3O3H A;  4DQP A;  1M90 O;  3JYT A;  3TTC A;  1FW6 A;  4IKF A;  2PYJ A;  3NHG A;  1BG3 A;  2KHO A;  4CF2 A;  1NG9 A;  1GLE G;  3VQQ A;  3ZX0 A;  1WOQ A;  3DLB A;  3D2E B;  2FBT A;  3AVK A;  3AA5 X;  5LL6 Z;  4O8U A;  3CJ9 A;  3ULE B;  1RT7 A;  2F9W A;  2W41 A;  1BWF O;  3VQC A;  4LC9 B;  3SNN A;  2KFN A;  5BPM A;  4YFU A;  4DS5 A;  3OBW A;  4FWM A;  3U8X A;  2VQF K;  3ZT0 A;  3KHY A;  1S5J A;  1Z25 A;  3BEX A;  4BR5 A;  2E2O A;  3O9U A;  1IBL K;  1JLB A;  3CC4 N;  1EET A;  2VQE K;  5HRP A;  2FBX A;  3L3V A;  1S22 A;  4DTJ A;  4Y1D A;  1K8K B;  1RTD A;  2F4V K;  4MLH A;  4DR2 K;  4DLE A;  2ETJ A;  1FXX A;  2KFZ A;  4LF4 K;  4BRM A;  3T1Y K;  3QDK A;  3WXJ A;  5C15 A;  3BUZ B;  4GMJ B;  1JL2 A;  2OZM A;  1SS6 A;  1Y97 A;  1SL1 A;  2YV0 X;  1CZ9 A;  2J4R A;  4JI7 K;  1HRH A;  3ULD A;  4A2B A;  3SLC A;  2AJQ A;  4CEC A;  3D6R A;  1JLC A;  5JS1 A;  4LF8 K;  3VN5 A;  4DLG A;  4PKH A;  2Z1J A;  1VRU A;  2RF2 A;  2YNI A;  4IXC A;  3SYZ A;  2UUC K;  1OH6 A;  4DMN A;  4EIA A;  3HM9 A;  3VER A;  1J5O A;  2GWJ A;  3VF2 A;  1HR0 K;  4E7K A;  1U49 A;  2QEX N;  4DU4 A;  2CH6 A;  4RW6 A;  4KHW A;  2OZS A;  1RDB A;  4BRH A;  3CCV N;  2HST A;  1O13 A;  3CPE A;  4FLY A;  4GV6 A;  3ZSX A;  3CM6 A;  5AZJ B;  2HMI A;  1GLF O;  3HSC A;  3QEW A;  4JK8 A;  3FGU A;  4JK9 A;  4KH6 A;  1VQK N;  4CED A;  4OX9 K;  5JS2 A;  3NFA A;  3K58 A;  3J80 O;  3K9K A;  3EE9 A;  2BE2 A;  1J6Z A;  4OKK A;  4I9Q A;  3O4W A;  2O8B B;  4YY3 K;  2KTQ A;  3THX B;  3QEP A;  4KHY A;  3O8M A;  4HTU A;  1BUP A;  4CIG A;  3RRG A;  1WSE A;  2OTJ N;  1RDA A;  2I7P A;  3ZT4 A;  2QWN A;  4H0X B;  4DCH A;  2WON A;  3MEC A;  4BR2 A;  3DRS A;  2A3Z A;  4CIE A;  2BAN A;  2YI1 A;  3HZ6 A;  3ENB A;  4FWO A;  4DSF A;  5CHI A;  2G8U A;  1S6P A;  3MMV A;  2GEM A;  4HCB A;  3H3N O;  4I9L A;  1JL1 A;  4B9Q A;  1GLD G;  5BN9 A;  4CEQ A;  1BHL A;  3ALY A;  3SAF A;  4Q0B A;  1NGA A;  1WN7 A;  3AVI A;  3VEX A;  1OH7 A;  3KD1 E;  2LSN A;  4FL9 A;  3VEO A;  3S3O A;  1KRP A;  2Q3S A;  3P4I A;  2P9P B;  4DKW A;  1N5Y A;  3OYF A;  4X66 K;  3NVM A;  4CF0 A;  5GAD P;  3WXM B;  3NMU A;  3AGK A;  1KLM A;  1HKC A;  2P9I B;  5LJW A;  1NKE A;  3PLA A;  4J8F A;  3ISN C;  1HNX K;  4UQG A;  2IVP A;  4WQ4 A;  1UA0 A;  3VA3 A;  1ATN A;  4O55 A;  3O80 A;  1NK4 A;  3P5J A;  1HNI A;  1YJ9 N;  3OYH A;  1XMQ K;  4BVP A;  2RKI A;  4OPK A;  3KLF A;  3CCQ N;  1BI4 A;  1X1P A;  4M3U A;  1S1T A;  3CD6 N;  2W42 A;  1E4F T;  4FLU A;  4FWS A;  4C1N I;  3THW A;  1X3N A;  3KTQ A;  3AA3 A;  4L8R B;  1LW0 A;  4KB0 A;  2YNG A;  4CZJ A;  2P9S B;  3TPQ A;  4JV5 K;  4PL8 A;  4FWK A;  2IDO A;  4O44 A;  5CZ1 A;  5BPL A;  3PO4 A;  3KD5 E;  4K8X A;  5AQK A;  4HUF A;  1D4X A;  3HBT A;  1XNR K;  3VF4 A;  3CC2 N;  1GLB G;  4I2Q A;  3BDP A;  2ZJP L;  2HND A;  3DLG A;  3P39 A;  3UE5 A;  1VQ5 N;  5AQL A;  1EWQ A;  2VCP A;  4I6M B;  3WNF A;  4FOE A;  4CHZ A;  5FPN A;  2ZJR L;  3QET A;  4DR4 K;  4OGC A;  3PX4 A;  3ENO A;  4W5R A;  4CJQ A;  3B8A X;  4EHT A;  1GOA A;  1OVQ A;  4AH9 A;  4DSI A;  3D2E A;  3HVT A;  3AVN A;  3HST B;  4CEZ A;  1J9A A;  3LWL A;  3ZLJ A;  3JSM A;  3ULE A;  3S3M A;  3SQ2 A;  3VTH A;  3E01 A;  3G0Z A;  3QML A;  1QE1 A;  3WXL A;  5JVH L;  4H5V A;  2WOM A;  4CZG A;  4CGH A;  1WBB A;  2E4L A;  1S1V A;  3OYN A;  4GV3 A;  2HHU A;  1BU6 O;  4B3M K;  2YX6 A;  4FO0 A;  1K8K A;  1TVR A;  3WUH A;  5C0Y A;  3FZH A;  4M3X A;  1JLF A;  3H1Q A;  3M8R A;  2JWL A;  4FLT A;  4BRO A;  3TAB A;  3N4P A;  4W5Q A;  1S9G A;  1L3T A;  2V7Z A;  3V6D A;  1ZBU A;  3AVM A;  5BRE A;  1YHQ N;  4PY5 A;  3ZSW A;  3M8S A;  1FJG K;  1BL3 A;  3LDN A;  1C1B A;  2O4G A;  1T05 A;  3CCR N;  3LP3 A;  1T6D A;  3G6E N;  4ISE A;  2HHV A;  1U4B A;  3THY B;  4NLB A;  3OTO K;  3TTD A;  4DV2 K;  3AA2 A;  4ELU A;  4CJL A;  1NGH A;  4DSE A;  4KI4 A;  4BRI A;  4HUE A;  4CHP A;  4FZX C;  2AP1 A;  3BF3 A;  5KTQ A;  4GKK K;  4IFE A;  4X65 K;  1IV0 A;  1W9H A;  4JKF A;  2HHQ A;  1HNW K;  3ZEU B;  3DLR A;  2Q0U A;  4B1Y B;  5HRN A;  3QLH A;  2B4J A;  4PWD A;  3JAM O;  3C95 A;  1YXQ A;  1TGO A;  3TTF A;  3QIN A;  3K5L A;  4MDB A;  1XHZ A;  4YOW A;  3IMX A;  5AZJ A;  4DFJ A;  4CGJ A;  2O8F B;  3JXU A;  3TSP A;  4ELV A;  4KRE A;  2QXL A;  1HUX A;  4CHO A;  1UWB A;  2Q1N A;  1QZ5 A;  4BRF A;  3ATV A;  2YJE A;  1W7A A;  4DTO A;  4FW2 A;  4Z4F A;  1DTT A;  2O8B A;  3AVB A;  3VEW A;  3THX A;  3KKR A;  3A2F A;  3ENH A;  4DFK A;  5BR8 K;  3VMF B;  3LP2 A;  4CGI A;  3O6W A;  1BCO A;  1GLA G;  2IIR A;  3TWH A;  4FJL A;  1RDU A;  3ZET B;  3O9Q A;  2P1J A;  3LAM A;  4CD3 A;  3SUO A;  5AQW A;  4BC5 A;  1S9E A;  4CBX A;  4N76 A;  4DV1 K;  2YNF A;  2Z1H A;  4YOX A;  3ITH A;  1WLJ A;  4JI2 K;  3NCI A;  4ID5 A;  2W40 A;  3R6M A;  5HP1 A;  3I8D A;  3AO5 A;  3I33 A;  1NKB A;  4K43 A;  4W5N A;  2EHG A;  1BOT O;  5H1S Q;  2P9P A;  1HX1 A;  2UXC K;  3CI5 A;  1I3A A;  3QBX A;  4IDH A;  4QS7 A;  4F2S A;  2F96 A;  1GLJ O;  4ZHR A;  3RMA A;  3M5R A;  3SMS A;  3KIO A;  4KFB A;  4OPH A;  1BO5 O;  4DFP A;  2P9I A;  1S72 N;  4NXM K;  2NRX A;  2CGL A;  4IEE A;  3FE1 A;  2XO7 A;  3U6F A;  2WBN A;  1TL3 A;  1ESV A;  1XUP O;  3H6E A;  3L2U A;  3D45 A;  5LMU K;  1C6V A;  2W6K A;  4MO4 A;  1VQN N;  1B92 A;  2ZWH A;  1CZB A;  3ZX2 A;  1RT5 A;  2DFE A;  3TSQ A;  1DTQ A;  2NLX A;  1VSH A;  3NH1 A;  4CJW A;  1QVF M;  3SJJ A;  2NZT A;  3AVJ A;  1SL2 A;  3PO5 A;  4BRK A;  4H03 B;  4CGD A;  3L6Q A;  4CVN E;  1ITG A;  3AAR A;  1BQN A;  4WFB L;  3HPH A;  2ATQ A;  1HJO A;  3NGY A;  5DM7 L;  2YNH A;  1SKR A;  4BWM A;  3OYJ A;  2E5L K;  3CJ7 A;  1NJW A;  2X74 A;  4MLE A;  1T7P A;  4CZK A;  3M8Q A;  1NLV A;  4FJJ A;  2E2Q A;  2P9S A;  2YCH A;  5AQH A;  4FJH A;  3C7N B;  4G1Q A;  4BRQ A;  2ZQB A;  3DXK B;  2KZZ A;  2WFB A;  3SMP A;  4AHU A;  1HNV A;  2UXB K;  3WNE A;  1KCF A;  4AHT A;  4AHC A;  3UB5 A;  5E84 A;  4CI6 A;  5GAE P;  3VTI A;  3TSU A;  2NRW A;  4GW6 A;  1C0G A;  5J2P A;  5CZ2 A;  5AQV A;  3VQ9 A;  4I6M A;  1R0A A;  3DJC A;  3CXC M;  4DF4 A;  4WQ5 A;  2HHH K;  4FYD A;  4J2D A;  3ZSR A;  4WFN L;  2V52 B;  4LY7 A;  1WSJ A;  1NM1 A;  2YKM A;  4BVO A;  3LWM A;  5IT9 O;  4FLV A;  4BGA A;  4EAH D;  1OKJ A;  2JGU A;  2Q31 A;  4BQL A;  3GBT A;  2XRI A;  3GE1 A;  5M1Q A;  2A1S A;  2RE2 A;  3IAY A;  3HOT A;  3HM8 A;  3SAH A;  1SKS A;  3AO1 A;  2F8S A;  3H45 C;  3TAP A;  1YIT N;  3MX5 A;  4IFV A;  3SBT A;  4N5S A;  2IVN A;  2G8K A;  1VSK A;  4FJ9 A;  3V9U A;  3DAW A;  3VET A;  2O4I A;  2VGN A;  4JI8 K;  3U3G A;  4BQZ A;  2PYL A;  3VGK A;  3CCU N;  4WF9 L;  2OPQ A;  1EP4 A;  1NNE A;  4BRP A;  5HL7 L;  1TUY A;  3MED A;  2GV9 A;  4NYF A;  1NOY A;  3FFI A;  3CMA N;  3T1H K;  1RBT A;  4NCA A;  2WC9 A;  3MEE A;  2VYP A;  3CM5 A;  4IEI A;  5KQ8 A;  2IOC A;  1BIZ A;  1IKX A;  4FM0 A;  1N8R O;  2E20 A;  3R8E A;  3UKR B;  3HI0 A;  3CF5 L;  3THY A;  4ILH A;  4B9U A;  4DQI A;  2HHT A;  1JXB A;  3EO3 A;  4XIU A;  2QA4 N;  3ZSY A;  1YUW A;  3HPG A;  3MN7 A;  4JKA A;  4H0O A;  1CXQ A;  4ELT A;  5KPT A;  1VQO N;  5F1X A;  2OPR A;  4IO8 A;  3FZL A;  3CFO A;  3VEV A;  3L2Q A;  4BRD A;  4B9N A;  4ZTF A;  3KK1 A;  2DY4 A;  3SAG A;  5E26 A;  3ZEU A;  5FPM A;  1JCG A;  2VGM A;  5SWM A;  3LPT A;  1JLG A;  4JEP A;  4CZM A;  4YNQ A;  4G9Z A;  3VQ5 A;  3OJU A;  3V9Z A;  4OLB A;  1S1U A;  2G8V A;  3OYM A;  3ASM A;  1U2V B;  1KAX A;  4JHD B;  1YT3 A;  4M41 A;  3EN9 A;  5GIN A;  4FJI A;  4ISF A;  5J2N A;  1IKV A;  4H8K A;  4FXD A;  2O8F A;  2RN2 A;  3TI0 A;  3TAQ A;  1VQ4 N;  3SUP A;  5AQU A;  4AHV A;  4B3S K;  4JRQ A;  1DKG D;  1Z26 A;  4FJ5 A;  3CIP A;  4AHS A;  2GX9 A;  4C8M A;  5EXW A;  1K73 O;  3H08 A;  1N6Q A;  5DMR A;  4CJE A;  4QS9 A;  4N47 A;  3ZET A;  2QWL A;  1WSF A;  3CJB A;  2HOE A;  4XEI A;  4RW7 A;  2FBV A;  4CW7 B;  1ZBF A;  4BG8 A;  5M1N A;  4FLW A;  4JYA K;  3A5O C;  3TAE A;  5HRR A;  3J8A A;  5BPN A;  2FBY A;  4E1M A;  3L8B A;  1N36 K;  1TKZ A;  3R1X A;  1RBV A;  1OH5 A;  5M1O A;  4BRL A;  5FDL A;  1ZBS A;  5A2Q O;  5GAG P;  2P5O A;  3P83 D;  5AZI B;  1U47 A;  3N4Q A;  4KPY A;  4FM2 A;  1QQM A;  2HHS A;  2Q97 A;  1KAZ A;  2E88 A;  2R7Y A;  5BRF A;  4DV3 K;  3HOS A;  4FVM A;  4L3Q A;  3LDL A;  3RMD A;  3MX2 A;  1L3V A;  4KH4 A;  1QQN A;  2D0O A;  4B8A B;  3HYF A;  4E7H A;  3WEE B;  3RRH A;  4DV5 K;  1NK6 A;  1YTA A;  5MLC Q;  5AQO A;  3CCE N;  1WSI A;  1NGE A;  4M7Y A;  5J2M A;  3QIP A;  4JD2 B;  1A5W A;  4DTP A;  2QW9 A;  2X6N A;  2ITG A;  4A57 A;  1BQM A;  4FW1 A;  1ATS A;  3HP9 A;  4RWT A;  4CCH A;  2YHX A;  3QES A;  4XH5 A;  4DFM A;  1FK9 A;  2FSK A;  3O3F A;  3ZYY X;  4KH5 A;  5C12 A;  5BRH A;  1NGJ A;  3IDH A;  3I0R A;  4DR3 K;  1HJR A;  3K9J A;  3LDS A;  3SV3 A;  3CER A;  1MA9 B;  4MDA A;  5C24 A;  1JKH A;  2GUP A;  3DI6 A;  4IOA L;  2E1Y A;  1NMD A;  3FR0 A;  4DV7 K;  4DF8 A;  1NGG A;  3NF9 A;  1D8Y A;  2P51 A;  3BF1 A;  5AQZ A;  3TAG A;  3U9Z A;  3HP6 A;  4O5B A;  5GIO A;  5FRN A;  3C7N A;  1IBM K;  3RTV A;  1NK5 A;  3OYD A;  3DXK A;  1Z05 A;  5GAH P;  1U6Z A;  4CJK A;  1NGI A;  3SQ1 A;  3KK2 A;  3OW2 M;  4E7I A;  4B9T A;  1KD1 O;  1KSP A;  4CJV A;  1RT4 A;  4BC4 A;  3O9T A;  2QWQ A;  4JI3 K;  4M3Z A;  3VPZ A;  2QKB A;  2HF3 A;  2Z1G A;  2NRR A;  3M3Z A;  4CHY A;  1YJW N;  4FZY A;  1TKD A;  2QWP A;  1RT1 A;  2HMP A;  1REV A;  4CER A;  4Z4G A;  2HF4 A;  2O8D B;  1IKY A;  1TYQ B;  2ZD1 A;  4MQ3 A;  3AAQ A;  2IAJ A;  3HTV A;  4AHR A;  4J2B A;  4KB1 A;  5C42 A;  4PHT X;  5J1E A;  1HKG A;  1NJZ A;  1NMN A;  1RBU A;  4FWN A;  3DMJ A;  1RT6 A;  3J81 O;  1B9D A;  3OY9 A;  3NF7 A;  3KK3 A;  5CYQ A;  1HMV A;  2HBK A;  4A5A A;  1SUQ A;  1NJX A;  2FXU A;  2Z1I A;  5M1F A;  4KTQ A;  1JLQ A;  4KO0 A;  1Y64 A;  5AFU A;  5EX5 A;  2FSN A;  3NH0 A;  4TSX A;  3LAL A;  1LAW A;  1KXP A;  2QI2 A;  1X3M A;  5AQM A;  3MEG A;  3TAF A;  3AO3 A;  2YKN A;  1RT3 A;  4O4G A;  1U45 A;  2QK9 A;  3C94 A;  3CJ1 A;  4ICL A;  2HBJ A;  3EEQ A;  3M1F A;  3UKR A;  3VES A;  3R9P A;  3WT0 A;  3RR7 A;  4CJ4 A;  1LOT B;  4Z4C A;  1W0H A;  5HRS A;  1NK9 A;  3RVC A;  1J54 A;  4I2P A;  3A8Y A;  4FLX A;  1XC9 A;  4JN4 A;  3C6T A;  3HPO A;  1F21 A;  5JLF A;  5ELZ A;  3VQA A;  4CJ3 A;  2VWJ A;  2VWK A;  4BE2 A;  2BTF A;  1EX4 A;  2Q2R A;  4JKH A;  3K2P A;  5T7B A;  4F3O A;  3E66 A;  1EO1 A;  3UKU B;  3LDQ A;  5GIP A;  1S6Q A;  1JXE A;  1YTU A;  4CES A;  1HLU A;  1U2V A;  4JHD A;  4RTF D;  5BR9 A;  1ATR A;  4FLZ A;  1UOC A;  4H4M A;  1MU2 A;  4K8Z A;  4DSL A;  4CZF A;  5AQT A;  4A62 A;  1EWR A;  4Q5V A;  3SBG A;  5ADX A;  1S3X A;  4C23 A;  5AJ3 K;  2ASP A;  3O4N A;  3AVH A;  2ZM6 K;  4OKE A;  3LAN A;  1NKC A;  3DOK A;  2E2N A;  2O8C B;  2HHX A;  5I9E B;  4B1X B;  4RG8 A;  1C0T A;  5C10 A;  3HL8 A;  5FRM A;  4YDU A;  1JCE A;  4CEF A;  3DM2 A;  1X9S A;  5EOY A;  3VGL A;  4CGG A;  2OAN A;  5FLX O;  2QM1 A;  2NRV A;  3MXJ A;  1TAU A;  4BR9 A;  4BRA A;  1DEJ A;  3EL2 A;  2XHB A;  5KPZ A;  3DRR A;  3OVN A;  3QBW A;  1N34 K;  4BE1 A;  1VSF A;  3QFP A;  4YOT A;  4GY2 B;  5AZI A;  3IRX A;  1MDU B;  3E1Y A;  4FCY A;  3RR8 A;  2GUI A;  3P1G A;  3NDK A;  1J5E K;  5AQY A;  1P90 A;  3TAN A;  3OYA A;  4CJ5 A;  3AVL A;  1QTM A;  5CE3 A;  5AQJ A;  4E89 A;  3OS1 A;  2HHW A;  4XH1 A;  3QEX A;  1S1X A;  4JKC A;  3GDQ A;  4B1V A;  4Z0U A;  4M3Y A;  3WEE A;  1SL0 A;  3OA9 A;  3CFR A;  3O3G A;  2NRZ A;  3MXM A;  4H5W A;  1A5X A;  2VG6 A;  4QOZ B;  4JD2 A;  5AQP A;  3KLI A;  4ZTJ A;  2QWO A;  1T6C A;  4DR6 K;  4JKE A;  1ZYQ A;  4LFB K;  1LW2 A;  1OH8 A;  3OBY A;  1TL1 A;  1XWL A;  1I94 K;  3ID8 A;  4DR5 K;  3BP8 A;  1G99 A;  3T69 A;  4IO9 L;  3J7Z O;  2F9T A;  3P31 A;  2RHK A;  3D2F B;  3VQ4 A;  2YJF A;  3V1Q A;  2E8A A;  4E7L A;  4FJ8 A;  4H5T A;  4WCE L;  3OYI A;  4PL7 A;  4FK4 A;  4RCH A;  4U67 L;  2D0C A;  1SQK A;  3IUC A;  3CQ8 A;  4FZZ A;  3DRP A;  3W3D A;  1VSE A;  4C1N K;  2HNZ A;  4WE1 A;  2HNY A;  3J7A P;  4JI0 K;  2XY6 A;  3ATU A;  3KK7 A;  5BN8 A;  4WYB A;  1RFQ A;  2CGK A;  4JAX A;  4DU3 A;  4EHU A;  4V19 S;  4NO7 A;  1W2B M;  1WSH A;  2IGI A;  4OGE A;  4AQY K;  1QSS A;  1RCH A;  4B9M A;  2BGG A;  4O5F A;  1NWK A;  3CQX A;  4CF9 A;  4IJA A;  4E7J A;  4CHQ A;  3AVC A;  4B3T K;  1QQC A;  4E19 A;  3T7Z A;  3O1W A;  2E2P A;  4FVU A;  2CH5 A;  2O8D A;  1TYQ A;  4BRG A;  4KHU A;  3SJH A;  3QB0 A;  4OPJ A;  2ZJQ L;  3VA0 A;  4F8R A;  3U9D A;  4DR7 K;  1T03 A;  4B3O A;  1U04 A;  4CK1 A;  1HPZ A;  4O0I A;  1WBD A;  4BC3 A;  5M1P A;  3DLH A;  3T19 A;  1BGX T;  1ASV A;  3M6G A;  4KV8 A;  4B1Z A;  1O1W A;  1KFD A;  4BC2 A;  2KKZ A;  1NK0 A;  2HVI A;  1T8E A;  3WNG A;  3LDO A;  3THV A;  2B5J A;  2NRT A;  4FWL A;  3V4I A;  2Y1I A;  4ID1 A;  2X6S A;  2XY5 A;  4B1U B;  5KRS A;  3AVG A;  1VQP N;  4BE0 A;  1IG8 A;  4EFH A;  4KTZ A;  5AQR A;  1VHX A;  3LZI A;  2FSJ A;  3H46 O;  4FPB A;  3GG4 A;  1OVY A;  3C6H A;  3A5N C;  4Z4I A;  3CQY A;  4K41 A;  3CCS N;  4C8K A;  3AVF A;  3L3U A;  3LAK A;  4DS4 A;  2P9L B;  2YHB A;  3FZM A;  1C1C A;  2O8E B;  1ASU A;  5LMN K;  5I42 A;  4BRN A;  2IVO A;  3FFK B;  1GLC G;  4CFB A;  4CJR A;  3I56 N;  2DTU A;  4DTN A;  3LZJ A;  1YF5 L;  1IO2 A;  4HWI A;  4OPA A;  3ID6 A;  3I0S A;  1U48 A;  3OYK A;  3KWG A;  3QIO A;  1FKP A;  5TKY A;  4E1N A;  3CFP A;  5AQN A;  3FZF A;  2DFH A;  3O9R A;  3PSI A;  3UKU A;  2OTL N;  2EWS A;  3NF8 A;  3VQ7 A;  3O08 A;  1NGF A;  1E3M A;  4F3T A;  3L2R A;  4Z4E A;  4B9S A;  5D3G A;  3AY9 A;  5JLH A;  4DTU A;  4DV4 K;  1IBK K;  3PY8 A;  2F7T A;  1RBR A;  3V9X A;  1IJJ A;  4KAZ A;  3V81 A;  3SPZ A;  1VSL A;  4DV0 K;  3MDQ A;  1I39 A;  2ITM A;  4LF5 K;  4DR1 K;  3A5M C;  3AA4 A;  4B1W B;  4JS5 A;  3CCJ N;  1D5A A;  4IBN A;  4H5R A;  4BAC A;  4DQQ A;  1RIL A;  2O8C A;  3MCP A;  3ZSZ A;  1L3U A;  3NF6 A;  4U7B A;  1X9W A;  3Q7C A;  4IOC L;  3RWU A;  4PA1 A;  2ZGY A;  1TK0 A;  4JK7 A;  1LCU A;  3ZX3 A;  1BA0 A;  4MO5 A;  1YIJ N;  2A42 A;  5AQX A;  3K59 A;  2AA4 A;  5KQD A;  4IG0 A;  1X9J A;  1TV6 A;  1BA1 A;  4HTL A;  4CZI A;  4CHN A;  2BDP A;  4KHQ A;  4A2A A;  1S1W A;  1QS4 A;  5C2D A;  3QEV A;  3NGZ A;  1N32 K;  2GEL A;  3VOV A;  1KVA A;  4M3R A;  4NLC A;  3RMC A;  1HPM A;  4OVL A;  1ASW A;  3NGI A;  1TKT A;  3BZC A;  2KLA A;  3MN5 A;  4BY9 C;  2X78 A;  1Q8I A;  2HBM A;  1L5U A;  1QHT A;  2H3G X;  3VQP A;  3D7E O;  3DXM B;  3L0Q A;  3O4Q A;  2KQ2 A;  1RDC A;  3OS0 A;  3O9S A;  3V1O A;  1EQY A;  2XY7 A;  3SI6 A;  2B6A A;  3F2K A;  4BGB A;  4CD1 A;  4H4O A;  4DQR A;  4BDZ A;  4MFB A;  4KHN A;  2QXF A;  1HQU A;  3OJS A;  1YAG A;  4BR0 A;  4K42 A;  3TU5 A;  3AAP A;  5AQG A;  3HVR A;  4JI4 K;  1EKE A;  1QQO A;  5AQQ A;  3TAR A;  2I7N A;  3D2F A;  3VQ6 A;  4CBU A;  4PKG A;  3J7Y P;  4CF1 A;  4BR7 A;  3AVA A;  1JCF A;  3FZK A;  4CFC A;  4M45 A;  3PIO L;  1Q81 O;  2VG5 A;  4CJU A;  3HK2 A;  2FC0 A;  5E41 A;  3LM2 A;  5EU7 A;  1CXU A;  2JWK A;  4M63 C;  5F0X A;  3EKU A;  1KAY A;  1KFS A;  4B9L A;  4AM6 A;  4N56 A;  4M3W A;  3LPU A;  4JI6 K;  5JMV A;  1NGD A;  4FK0 A;  4JLH A;  3NE6 A;  3KJV A;  1WSG A;  3QER A;  4GV9 A;  1QSY A;  4DV6 K;  1VQ6 N;  4IOX A;  2A1R A;  1CZA N;  2E1Z A;  1SAZ A;  4CFA A;  1N33 K;  2BUP A;  4PUO A;  1SZ2 A;  5AQI A;  1TKX A;  2YHW A;  2FLO A;  2VG7 A;  1XNQ K;  4JNE A;  4DWI A;  3KVG A;  4R79 A;  2D0P A;  1V4S A;  4X62 K;  3BY5 A;  4CGF A;  2W6L A;  2UYT A;  4HCC A;  3F9M A;  4UY8 O;  5EVZ A;  4EZ6 A;  4NCG A;  4DHY A;  2HB5 A;  2NRH A;  3BZK A;  4AIL C;  5FPD A;  3KKS A;  3CYM A;  2IS3 A;  1IKW A;  3OYE A;  1YJN N;  2KW4 A;  4ILJ A;  3C6A A;  2G8W A;  3H1V X;  3MAQ A;  3LP1 A;  4KKO A;  4N41 A;  3DOL A;  4AF1 A;  4CEB A;  4JKG B;  3S41 A;  5M1K A;  1HYS A;  4HUG A;  1A5V A;  4JRP A;  2UUB K;  3WQU A;  3H3O B;  5F2R A;  1GOB A;  3T1A A;  5KI6 A;  1WNS A;  5I3U A;  3IG1 A;  1B9F A;  5EY4 A;  5HLF A;  1JLE A;  4NXN K;  3PX6 A;  3P38 A;  1ZBI A;  1WAF A;  5IWA K;  2ASO A;  2ASM A;  5CYM A;  1KVB A;  4Y0W A;  1BIU A;  4M42 A;  1VQ7 N;  4LFC K;  1Q18 A;  3MXI A;  4LD0 A;  4YHH K;  3B6O A;  4WQ4 C;  2OPS A;  5LY3 A;  3T3F A;  1RDD A;  4FM1 A;  3VQD A;  4NYN A;  4DUZ K;  3EZ5 A;  3ZT2 A;  4QS8 A;  2PBD A;  3V9S A;  3L2V A;  2P9L A;  4DQS A;  3IS9 A;  3GOI A;  2O8E A;  2E6L A;  4X64 K;  4BRC A;  2D4W A;  1VSI A;  3EY1 A;  4IG3 A;  4FWQ A;  2QKK A;  3L4I A;  1E4G T;  1TUU A;  1ZC6 A;  2KZM A;  3QNO A;  4B8C A;  4CBW A;  3B6P A;  4H0P A;  1ZXO A;  3E9L A;  4I7F A;  4R5P A;  3WXK A;  5K14 A;  4BR4 A;  3JS6 A;  1P8Z A;  3OYL A;  2A40 A;  1NJY A;  5CR4 A;  1WAJ A;  3EE8 A;  1Q9Y A;  1KQS M;  4KHP K;  4CEA A;  1VQL N;  4Y1C A;  1QZ6 A;  3MWP A;  3S9H A;  3K5O A;  1BCM A;  1LWE A;  4C8L A;  1J53 A;  4KTW A;  4KHS A;  3W0L A;  1DLO A;  3DLE A;  5FPE A;  5BRD A;  1XC3 A;  4FSV A;  2GBZ A;  3SQ4 A;  3NBP A;  1ZBH A;  1X9M A;  4QAG A;  3LM9 A;  4GVM A;  1NGB A;  4LH4 A;  2ZGZ A;  3SPY A;  2NNW A;  2E6M A;  1HQE A;  4A59 A;  1HYZ A;  1XQS C;  3NVK A;  1KVC A;  4EP5 A;  4GKJ K;  2OPP A;  1C1A A;  3AGR A;  4DB3 A;  2BH1 A;  4YOY A;  4CE9 A;  1ILY A;  3SUQ A;  1EXQ A;  4FJX A;  2EX3 A;  4DUY K;  3WXI A;  4CEE A;  3HRG A;  5C2F A;  1TAQ A;  2P9K B;  4YOU A;  3PUF A;  1RT2 A;  4ISG A;  4CIF A;  3AO2 A;  3R3L A;  2P9U B;  4FJK A;  4F4K A;  3AO4 A;  3EZW A;  3U4L A;  4ILG B;  3NH2 A;  1DT9 A;  2P9N B;  3EKS A;  3LP0 A;  3MN6 A;  4CJP A;  1RBS A;  1H1V A;  2DPN A;  1G15 A;  3RSE B;  1C0M A;  1HKB A;  3DXM A;  2XY8 A;  2D5R A;  3IKM A;  2QWR A;  4JI1 K;  1VQ9 N;  3E9O A;  4XH4 A;  3EYZ A;  2Q36 A;  1RGI A;  5JVG L;  2G8I A;  1LAV A;  4K0K K;  3C6U A;  1XHX A;  3TR8 A;  5AFU H;  4B08 A;  4DG1 A;  4BWJ A;  1LV5 A;  1ZBL A;  4E0D A;  4YDU C;  3KLH A;  1KC8 O;  3S3N A;  3KWI A;  3CME N;  1XMO K;  3F73 A;  4EP4 A;  1Z6R A;  5B8H A;  2UUA K;  2VWB A;  4KBO A;  5JIC A;  4GNI A;  4B9V A;  4CJT A;  1SKW A;  1W97 L;  4AM7 A;  1R59 O;  2Q0R A;  1D9F A;  4CF8 A;  3F5T A;  3I55 N;  4FJG A;  4CJS A;  1T3V A;  3CG7 A;  1V4T A;  4LSN A;  5HOO A;  4PQU A;  4FJ7 A;  4LFA K;  2I5J A;  3QEI A;  4F2R A;  4KI6 A;  2NUB A;  2PAV A;  3VF6 A;  3K5N A;  3C65 A;  3FLC O;  2P5G A;  3F9K A;  4M7X A;  4DU1 A;  4RW4 A;  2QWM A;  4W5O A;  4YOV A;  1UAX A;  3VEZ A;  1VQ8 N;  2V7Y A;  4YOR A;  3PIP L;  4CJ7 A;  4O0J A;  5TKW A;  1Q86 O;  1YVU A;  3CHW A;  1NGC A;  4CK2 A;  1IH7 A;  3CJA A;  5SZT A;  3OS2 A;  4HHT A;  5AR0 A;  1T44 A;  3M8P A;  4C8O A;  5ADX H;  3V9W A;  2A6A A;  1BDG A;  3SCX A;  1VK0 A;  2GTD A;  3HJF A;  3BGR A;  3C0B A;  4IDK A;  4GVE A;  1YVN A;  1LWF A;  2ZF5 O;  1WUA A;  5KGW A;  5HRO A;  3SQ0 A;  1NU0 A;  3K0S A;  3RMB A;  4H5N A;  1GLL O;  5KRT A;  1M1K O;  4CZL A;  3OHR A;  3ZSO A;  5LJV A;  4IZ9 A;  1Q9X A;  4JKG A;  2YHA A;  4NB4 A;  1SV5 A;  4JKD A;  3SUN A;  1QSL A;  3MK6 A;  4K25 A;  3AV9 A;  1C0F A;  3WQT A;  4Z94 A;  2UXD K;  3QIC A;  1MWM A;  3O5B A;  4CEO A;  4OLA A;  3NAE A;  1HYV A;  4A5B A;  1NK8 A;  3G10 A;  4CK3 A;  4DSJ A;  1RTH A;  1GOC A;  4CZE A;  1XI1 A;  4QCL A;  4CJF A;  4RW9 A;  2HW3 A;  5C25 A;  5AQF A;  3VQB A;  4HVJ A;  1FKO A;  3VQE A;  2F8T A;  5KPR A;  1K6Y A;  3DYA A;  4FJM A;  3K57 A;  1RTJ A;  3LDP A;  1VAZ A;  3KLE A;  3LL3 A;  1VSJ A;  3KZB A;  5HBM A;  4B3R K;  4CZH A;  3CJC A;  4E1J A;  2OYQ A;  4F9O A;  4LSL A;  3OYG A;  4RW8 A;  3SV4 A;  3K5M A;  4FJN A;  2D1K A;  1TK5 A;  3DLK A;  2GWK A;  1CLQ A;  3L4Q A;  4EZ9 A;  2OCE A;  1UA1 A;  2RPI A;  1DGK N;  1IG9 A;  4J2A A;  3HXM A;  2PY5 A;  1TK8 A;  2A5X A;  4BDY A;  1NJI O;  5J2Q A;  3CPW M;  4M3T A;  5DM6 L;  3MN9 A;  1YI2 N;  4J2E A;  4LF6 K;  3Q7B A;  2YHY A;  4LH5 A;  3DLL L;  2WTU A;  3DWL A;  3OYB A;  2OA8 A;  4DTR A;  1NK7 A;  4O8K A;  3VGM A;  1RTI A;  3G71 N;  1HNZ K;  3V1R A;  3CCL N;  4OKJ A;  4DTX A;  3VEY A;  1BIS A;  3MCA B;  3G4S N;  3TAM A;  4FWP A;  1VRT A;  3HT3 A;  4IFY A;  1RNH A;  1K9M O;  4FPA A;  4H0V B;  1KLN A;  4W5T A;  1NBW A;  1JLA A;  4WQ5 C;  3UIQ A;  3GL1 A;  2HBL A;  1L3S A;  4JKB A;  4NCB A;  3PV8 A;  2D0A A;  4BRE A; 
#chains in the Genus database with same CATH homology
 1HMV A;  2FC0 A;  3C95 A;  5E41 A;  1TGO A;  1SUQ A;  3QO9 A;  4BDP A;  2DFF A;  5EU7 A;  4PWD A;  1CXU A;  1C0U A;  1NJX A;  3QIN A;  3K5L A;  1XHZ A;  1KFS A;  4B9L A;  2Z1I A;  4N56 A;  4M3W A;  3LPU A;  3ZSV A;  1JLQ A;  4DFJ A;  4KTQ A;  4CGJ A;  4FK2 A;  3KLG A;  4KO0 A;  4FK0 A;  4JLH A;  3NE6 A;  3VQ8 A;  4ELV A;  4KRE A;  4CHO A;  1UWB A;  3KJV A;  1WSG A;  3QER A;  2D0B A;  1QSY A;  4C8N A;  4DTM A;  4DTO A;  2G8H A;  4FW2 A;  3NH0 A;  2A1R A;  1DTT A;  4TSX A;  4Z4F A;  3LAL A;  3U3Y A;  3AVB A;  1LAW A;  3D0P A;  3KKR A;  3MEG A;  3A2F A;  3TAF A;  2ZE2 A;  3AO3 A;  4CFA A;  4DFK A;  2YKN A;  4PUO A;  1RT3 A;  3LP2 A;  4O4G A;  5CY4 A;  4CGI A;  1U45 A;  1TKX A;  3C94 A;  2QK9 A;  3L2W A;  1D9D A;  4ICL A;  1BCO A;  2VG7 A;  4DTS A;  3TWH A;  4FJL A;  4OJR A;  4DWI A;  3RR7 A;  5KGX A;  3OYC A;  2P1J A;  3LAM A;  4CJ4 A;  4Z4C A;  1W0H A;  1BI4 B;  5HRS A;  3ZSQ A;  1NK9 A;  4CGF A;  3SUO A;  1J54 A;  5FRO A;  4HCC A;  4I2P A;  4FLX A;  1S9E A;  1XC9 A;  4N76 A;  3C6T A;  3HPO A;  1F21 A;  1VSD A;  2YNF A;  2Z1H A;  4EZ6 A;  2Y1J A;  3ITH A;  4NCG A;  1WLJ A;  5DK5 A;  2HB5 A;  3NCI A;  4ID5 A;  3VQA A;  4CJ3 A;  4AIL C;  4CFD A;  3KKS A;  3CYM A;  2VWJ A;  3PX0 A;  2IS3 A;  1IKW A;  2VWK A;  5HP1 A;  4BE2 A;  3OYE A;  3I8D A;  1EX4 A;  2PZS A;  1NOZ A;  4KRF A;  3AO5 A;  2HVH A;  2KW4 A;  1NKB A;  3K2P A;  5T7B A;  4W5N A;  4F3O A;  2EHG A;  2G8W A;  3MAQ A;  2JLE A;  3ZT3 A;  3LP1 A;  4KKO A;  4N41 A;  1S6Q A;  3DOL A;  1I3A A;  1JXE A;  4CEB A;  4JS4 A;  1HYS A;  4F2S A;  4HUG A;  1YTU A;  2F96 A;  4ZHR A;  3RMA A;  4CES A;  1VSM A;  1A5V A;  4JRP A;  1LWC A;  3KIO A;  4KFB A;  2IC3 A;  1KTQ A;  4DFP A;  4E3S A;  4FLZ A;  1UOC A;  1GOB A;  4H4M A;  3T1A A;  2G8F A;  5KI6 A;  1WNS A;  5I3U A;  4DSK A;  3IG1 A;  1B9F A;  3WNH A;  1MU2 A;  4Z4H A;  3SZ2 A;  4K8Z A;  3ZT1 A;  4DSL A;  2XO7 A;  3ZCM A;  1JLE A;  3U6F A;  3PX6 A;  5HLF A;  1ZBI A;  1TL3 A;  3QNN A;  1WAF A;  3L2U A;  3HO1 A;  3D45 A;  4Q5V A;  3O3H A;  4DQP A;  1C6V A;  3JYT A;  4IKF A;  2PYJ A;  3NHG A;  1B92 A;  3O4N A;  3AVH A;  4OKE A;  1CZB A;  5CYM A;  3LAN A;  4CF2 A;  1KVB A;  3VQQ A;  1BIU A;  4M42 A;  1RT5 A;  2DFE A;  3DOK A;  1NKC A;  3MXI A;  1DTQ A;  3DLB A;  2HHX A;  2FBT A;  1VSH A;  4RG8 A;  1C0T A;  3NH1 A;  3AVK A;  3AA5 X;  3HL8 A;  4LD0 A;  4CJW A;  4OLB A;  5FRM A;  3B6O A;  4CEF A;  3DM2 A;  3SJJ A;  1X9S A;  2OPS A;  3AVJ A;  4CGG A;  1SL2 A;  1RT7 A;  3T3F A;  3PO5 A;  3MXJ A;  1TAU A;  1RDD A;  4CGD A;  4FM1 A;  3VQD A;  4NYN A;  3VQC A;  1ITG A;  2XHB A;  3EZ5 A;  3SNN A;  3DRR A;  3ZT2 A;  2KFN A;  1BQN A;  3OVN A;  2B4J A;  3V9S A;  3L2V A;  3HPH A;  2ATQ A;  4DQS A;  3IS9 A;  3NGY A;  4YFU A;  4BE1 A;  2E6L A;  4DS5 A;  2YNH A;  1VSF A;  4BWM A;  1SKR A;  3ZT0 A;  3OYJ A;  1S5J A;  1Z25 A;  1NJW A;  1VSI A;  2X74 A;  3EY1 A;  1T7P A;  3IRX A;  4FCY A;  3M8Q A;  4IG3 A;  3RR8 A;  2GUI A;  4FJJ A;  4FJH A;  1JLB A;  3P1G A;  3NDK A;  2QKK A;  4G1Q A;  1EET A;  2KZM A;  5HRP A;  2FBX A;  2ZQB A;  3L3V A;  4DTJ A;  3QNO A;  2KZZ A;  3TAN A;  4Y1D A;  4B8C A;  4CJ5 A;  3OYA A;  1RTD A;  3AVL A;  3B6P A;  1QTM A;  4E89 A;  3OS1 A;  2HHW A;  4I7F A;  4AHU A;  4R5P A;  1S1X A;  3QEX A;  1HNV A;  5K14 A;  3WNE A;  1KCF A;  4Z0U A;  4M3Y A;  4DLE A;  4AHT A;  4AHC A;  2ETJ A;  3OYL A;  1FXX A;  1SL0 A;  2KFZ A;  1NJY A;  4CJU A;  1WAJ A;  4GW6 A;  3CFR A;  5J2P A;  5CZ2 A;  3VQ9 A;  3O3G A;  1Q9Y A;  4CEA A;  3MXM A;  1R0A A;  4Y1C A;  4GMJ B;  1JL2 A;  3S9H A;  1Y97 A;  3K5O A;  2OZM A;  1A5X A;  2VG6 A;  4DF4 A;  4QOZ B;  4FYD A;  4J2D A;  1BCM A;  3ZSR A;  1LWE A;  4C8L A;  4LY7 A;  3LWM A;  1WSJ A;  2YKM A;  1J53 A;  4KHN A;  3KLI A;  4ZTJ A;  4KTW A;  2YV0 X;  1SL1 A;  4FLV A;  4KHS A;  1CZ9 A;  1DLO A;  1HRH A;  3DLE A;  2JGU A;  3ULD A;  1ZYQ A;  2AJQ A;  4CEC A;  1LW2 A;  1JLC A;  1TL1 A;  2GBZ A;  2XRI A;  3SQ4 A;  5JS1 A;  1XWL A;  3NBP A;  3VN5 A;  2A1S A;  4DLG A;  1ZBH A;  1X9M A;  3IAY A;  2Z1J A;  1VRU A;  2RF2 A;  2YNI A;  3SYZ A;  4QAG A;  4GVM A;  4DMN A;  1SKS A;  3AO1 A;  4LH4 A;  3VQ4 A;  2F8S A;  3TAP A;  3HM9 A;  3SPY A;  2E6M A;  1J5O A;  1HQE A;  3V1Q A;  4E7L A;  4FJ8 A;  1HYZ A;  4IFV A;  1KVC A;  4N5S A;  3OYI A;  2G8K A;  4E7K A;  1U49 A;  1VSK A;  4FJ9 A;  4EP5 A;  4DU4 A;  3V9U A;  4FK4 A;  2D0C A;  2OPP A;  4RW6 A;  2O4I A;  3CQ8 A;  4FZZ A;  3DRP A;  1C1A A;  4KHW A;  1VSE A;  3U3G A;  2OZS A;  2HNZ A;  1RDB A;  4WE1 A;  4CE9 A;  2PYL A;  3SUQ A;  1EXQ A;  4FJX A;  2HNY A;  2EX3 A;  4FLY A;  2OPQ A;  1EP4 A;  3ZSX A;  2XY6 A;  3CM6 A;  4CEE A;  2HMI A;  3QEW A;  4DU3 A;  1TAQ A;  1WSH A;  4CED A;  2IGI A;  5JS2 A;  3MED A;  3NFA A;  3PUF A;  4OGE A;  1RCH A;  3K58 A;  1QSS A;  1RT2 A;  4CIF A;  3AO2 A;  2BE2 A;  2GV9 A;  4FJK A;  4NYF A;  4OKK A;  1NOY A;  4F4K A;  4I9Q A;  3AO4 A;  3FFI A;  3NH2 A;  2KTQ A;  3LP0 A;  1RBT A;  4CJP A;  3QEP A;  4KHY A;  4B9M A;  4NCA A;  4HTU A;  2BGG A;  3MEE A;  4CF9 A;  4E7J A;  4CIG A;  3RRG A;  1RBS A;  1WSE A;  3CM5 A;  4CHQ A;  1RDA A;  1G15 A;  3ZT4 A;  3AVC A;  1C0M A;  2WON A;  2IOC A;  1BIZ A;  1IKX A;  4FM0 A;  3MEC A;  2XY8 A;  2D5R A;  1QQC A;  4E19 A;  3DRS A;  3EYZ A;  4CIE A;  2BAN A;  4B9U A;  2G8I A;  1LAV A;  4DQI A;  2HHT A;  1JXB A;  4DSF A;  4XIU A;  2G8U A;  3C6U A;  1S6P A;  1XHX A;  3ZSY A;  3TR8 A;  3HPG A;  4B08 A;  4HCB A;  4DG1 A;  4I9L A;  1CXQ A;  4BWJ A;  1LV5 A;  1JL1 A;  4ELT A;  4KHU A;  1ZBL A;  2OPR A;  4E0D A;  3CFO A;  4CEQ A;  1BHL A;  3ALY A;  4OPJ A;  3VA0 A;  3L2Q A;  4Q0B A;  4F8R A;  3KLH A;  4B9N A;  4ZTF A;  3KK1 A;  1WN7 A;  3AVI A;  1T03 A;  2DY4 A;  3S3N A;  3KD1 E;  4B3O A;  1U04 A;  4CK1 A;  2LSN A;  1HPZ A;  3S3O A;  4O0I A;  5SWM A;  1KRP A;  2Q3S A;  3LPT A;  3F73 A;  4EP4 A;  3DLH A;  1JLG A;  3T19 A;  1BGX T;  4YNQ A;  1N5Y A;  4B9V A;  3OYF A;  3VQ5 A;  4CF0 A;  3OJU A;  3V9Z A;  1ASV A;  1S1U A;  4KV8 A;  2G8V A;  4CJT A;  3OYM A;  1O1W A;  1KFD A;  1NK0 A;  1SKW A;  2HVI A;  3ASM A;  1T8E A;  3WNG A;  3THV A;  1KLM A;  4CF8 A;  1D9F A;  2B5J A;  1YT3 A;  4M41 A;  1NKE A;  4FJI A;  4FJG A;  4CJS A;  5J2N A;  1IKV A;  4H8K A;  4FXD A;  3CG7 A;  3V4I A;  3ISN C;  2Y1I A;  4LSN A;  2RN2 A;  4UQG A;  3TI0 A;  1UA0 A;  4PQU A;  3TAQ A;  3VA3 A;  3SUP A;  4AHV A;  4FJ7 A;  4JRQ A;  4ID1 A;  2I5J A;  2X6S A;  4O55 A;  2XY5 A;  1Z26 A;  1NK4 A;  3QEI A;  4F2R A;  4KI6 A;  3P5J A;  4FJ5 A;  2NUB A;  5KRS A;  1HNI A;  3K5N A;  3AVG A;  4AHS A;  4BE0 A;  4C8M A;  3F9K A;  3OYH A;  2P5G A;  4KTZ A;  4DU1 A;  3H08 A;  3LZI A;  4RW4 A;  1N6Q A;  5DMR A;  4CJE A;  4W5O A;  4N47 A;  1UAX A;  2RKI A;  1WSF A;  4OPK A;  3KLF A;  4O0J A;  1BI4 A;  4RW7 A;  2FBV A;  1X1P A;  4M3U A;  1ZBF A;  1S1T A;  4Z4I A;  4FLW A;  1YVU A;  3TAE A;  4CK2 A;  1IH7 A;  5HRR A;  5SZT A;  3OS2 A;  2W42 A;  4HHT A;  2FBY A;  4E1M A;  3L8B A;  4C8K A;  3AVF A;  3M8P A;  4C8O A;  4FLU A;  1TKZ A;  3L3U A;  3LAK A;  2YHB A;  4DS4 A;  1RBV A;  1C1C A;  3V9W A;  3SCX A;  1ASU A;  5I42 A;  1VK0 A;  3KTQ A;  3HJF A;  4CJR A;  3AA3 A;  5FDL A;  4CFB A;  2DTU A;  4L8R B;  3BGR A;  4IDK A;  1LW0 A;  4KB0 A;  4DTN A;  2P5O A;  2YNG A;  3P83 D;  1LWF A;  3LZJ A;  1U47 A;  1IO2 A;  5KGW A;  5HRO A;  3I0S A;  3SQ0 A;  3OYK A;  4E1N A;  3QIO A;  1FKP A;  3CFP A;  1U48 A;  4KPY A;  4FM2 A;  4O44 A;  2IDO A;  5CZ1 A;  2DFH A;  3RMB A;  2HHS A;  2R7Y A;  3PO4 A;  5KRT A;  3KD5 E;  4K8X A;  3NF8 A;  3ZSO A;  1Q9X A;  4FVM A;  4HUF A;  3VQ7 A;  2YHA A;  1SV5 A;  3RMD A;  1L3V A;  4I2Q A;  3SUN A;  3BDP A;  4B8A B;  3HYF A;  4E7H A;  3RRH A;  2HND A;  3DLG A;  1NK6 A;  1YTA A;  1QSL A;  4F3T A;  3L2R A;  3AV9 A;  4Z4E A;  4B9S A;  5D3G A;  1WSI A;  4DTU A;  3WNF A;  3PY8 A;  4CHZ A;  5J2M A;  1RBR A;  3QET A;  3V9X A;  3QIP A;  4KAZ A;  1A5W A;  4OGC A;  4DTP A;  3V81 A;  1VSL A;  4CEO A;  2X6N A;  3PX4 A;  3SPZ A;  4OLA A;  4W5R A;  2ITG A;  3NAE A;  1I39 A;  1HYV A;  4CJQ A;  1NK8 A;  1GOA A;  1BQM A;  3G10 A;  4FW1 A;  4CK3 A;  4DSJ A;  3AA4 A;  4JS5 A;  1D5A A;  3HP9 A;  1RTH A;  4IBN A;  4CCH A;  4BAC A;  3QES A;  4DQQ A;  1GOC A;  1RIL A;  4DFM A;  1FK9 A;  4AH9 A;  1XI1 A;  4DSI A;  3ZSZ A;  3O3F A;  4QCL A;  3HVT A;  3AVN A;  1L3U A;  3NF6 A;  3HST B;  4CJF A;  4CEZ A;  4RW9 A;  2HW3 A;  5C25 A;  3I0R A;  3VQB A;  1J9A A;  1FKO A;  3VQE A;  4HVJ A;  3LWL A;  1HJR A;  3JSM A;  1X9W A;  2F8T A;  1K6Y A;  3DYA A;  3SQ2 A;  3K57 A;  3LDS A;  3S3M A;  4FJM A;  1RTJ A;  4PA1 A;  3RWU A;  3E01 A;  3SV3 A;  3KLE A;  3G0Z A;  1VSJ A;  1TK0 A;  1QE1 A;  5HBM A;  5C24 A;  1JKH A;  3DI6 A;  4DF8 A;  2WOM A;  3NF9 A;  3K59 A;  4LSL A;  3OYG A;  2P51 A;  1D8Y A;  4IG0 A;  2OYQ A;  4CGH A;  3TAG A;  4RW8 A;  1TV6 A;  3SV4 A;  3HP6 A;  3K5M A;  4FJN A;  4O5B A;  5FRN A;  1TK5 A;  4CHN A;  2BDP A;  3DLK A;  2E4L A;  4KHQ A;  1CLQ A;  1S1W A;  1QS4 A;  1S1V A;  3OYN A;  3RTV A;  4EZ9 A;  1UA1 A;  2RPI A;  2HHU A;  1NK5 A;  3OYD A;  3QEV A;  1IG9 A;  4J2A A;  3HXM A;  3NGZ A;  1TVR A;  2PY5 A;  4M3X A;  1TK8 A;  1JLF A;  3M8R A;  4BDY A;  1KVA A;  4CJK A;  5J2Q A;  4M3R A;  4FLT A;  3TAB A;  3SQ1 A;  3KK2 A;  3RMC A;  4E7I A;  4B9T A;  4W5Q A;  4M3T A;  1S9G A;  4OVL A;  1ASW A;  3NGI A;  1L3T A;  1KSP A;  1TKT A;  4CJV A;  4J2E A;  1RT4 A;  3V6D A;  2X78 A;  1ZBU A;  1Q8I A;  3AVM A;  1L5U A;  1QHT A;  4PY5 A;  4LH5 A;  4M3Z A;  3VQP A;  3OYB A;  2QKB A;  2OA8 A;  3ZSW A;  3M8S A;  5CYQ A;  1BL3 A;  2Z1G A;  4DTR A;  1NK7 A;  1C1B A;  2O4G A;  3O4Q A;  1T05 A;  4CHY A;  2KQ2 A;  1RTI A;  3LP3 A;  1RDC A;  3V1R A;  4FZY A;  3OS0 A;  1U4B A;  2HHV A;  3V1O A;  4OKJ A;  1TKD A;  2XY7 A;  4DTX A;  3SI6 A;  1RT1 A;  2B6A A;  4CER A;  1REV A;  1BIS A;  4H4O A;  4DQR A;  4BDZ A;  4Z4G A;  3AA2 A;  4MFB A;  4CJL A;  2QXF A;  1HQU A;  3TAM A;  3OJS A;  4DSE A;  4ELU A;  1VRT A;  3HT3 A;  4IFY A;  1IKY A;  1RNH A;  4CHP A;  4HUE A;  4KI4 A;  2ZD1 A;  4MQ3 A;  4AHR A;  2IAJ A;  4J2B A;  4FZX C;  4KB1 A;  5KTQ A;  5C42 A;  1KLN A;  4W5T A;  5J1E A;  3HVR A;  1EKE A;  1JLA A;  3TAR A;  1NJZ A;  3VQ6 A;  1RBU A;  3UIQ A;  3DMJ A;  1W9H A;  1RT6 A;  1B9D A;  2HHQ A;  4CF1 A;  3DLR A;  1L3S A;  3OY9 A;  3AVA A;  4NCB A;  3NF7 A;  3PV8 A;  4CFC A;  5HRN A;  4M45 A;  3QLH A;  2D0A A;  3KK3 A;  2VG5 A;  3HK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...