1VSKA

Asv integrase core domain d64n mutation in citrate buffer ph 6.0
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
b'GLGPLQIWQTNFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Structural basis for inactivating mutations and pH-dependent activity of avian sarcoma virus integrase.
pubmed doi rcsb
source organism Rous sarcoma virus - schmidt-ruppin b
molecule tags Hydrolase
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vskA00
2O4GA 3PY8A 5CZ2A 2WOMA 1Q8IA 2VG7A 3HSTB 1BIUA 1LW2A 4NYFA 4CF1A 3DMJA 3ZSYA 4CHQA 5E41A 2G8KA 3PO4A 3RWUA 4KPYA 5J1EA 4N5SA 4KFBA 2ATQA 2QKBA 3AVHA 1U47A 4NCAA 1NKCA 3DM2A 4BE0A 4YFUA 3VQCA 1NJYA 1S6QA 4B9UA 4Z4HA 3KLGA 2EHGA 3SUQA 2KZZA 3VQQA 4CJ4A 3NDKA 5HROA 3KLIA 3DLKA 1S1UA 3V9XA 2EX3A 4J2BA 2XY6A 2E6LA 1C0MA 2PZSA 3OYIA 2HHQA 2IS3A 3QIOA 3L3VA 3ZSOA 4CJ5A 1T03A 3NBPA 4HUFA 2DFHA 1CLQA 3L8BA 1SKSA 3OYHA 3ZT2A 3OYMA 4CJLA 3SQ2A 4DSFA 3DLHA 4N47A 1RT2A 4RW9A 4OPJA 5EU7A 4DU3A 4KTZA 1TL3A 4FLYA 3LAMA 4CGIA 4CEAA 3HVTA 2FBXA 4FJIA 1VSEA 3V1RA 1NK6A 5C25A 1NOZA 2D0BA 1XHZA 1QQCA 2PYJA 1EXQA 1CZBA 1EX4A 3HP9A 4GMJB 2NUBA 1RT3A 3G10A 4E7IA 2Z1HA 4AHUA 4MQ3A 4CHOA 2Y1IA 4IFYA 4DF4A 4FJGA 3UIQA 1JLBA 1WAFA 4FJ8A 3KJVA 1D9FA 4PY5A 1VSIA 4FW2A 4CJSA 1U45A 1O1WA 2BE2A 3H08A 3EY1A 4BDYA 3OYAA 3AVCA 3CFRA 1JLCA 4DQQA 3OYEA 4F4KA 3AVAA 2GBZA 3C6TA 3NH1A 1X9WA 1KVAA 4C8OA 4B9SA 3L2UA 1NKEA 4PUOA 2VWJA 4FJNA 3HL8A 4DSKA 2YHBA 3SQ0A 5KRSA 3VQDA 3LP1A 1VSKA 3ZCMA 3OYKA 3DRPA 2OPPA 1NK9A 1KSPA 2OYQA 5D3GA 3SUPA 4Z0UA 4Z4EA 3HM9A 3OYFA 3SQ1A 3AA4A 1RT7A 2G8VA 3OYNA 3THVA 1VSJA 1BIZA 1K6YA 4EZ6A 3PX6A 4I7FA 1HYSA 2XY5A 1L3TA 1UOCA 3O4NA 4FW1A 1RT1A 4M3ZA 1EP4A 4FJLA 2VG6A 5KRTA 4CERA 4IDKA 4O0JA 4J2AA 4HUEA 5I42A 4CGFA 4CJFA 4CHYA 3QINA 5J2MA 1C1CA 1WN7A 4HVJA 4DLEA 1BISA 5HP1A 2OZMA 3ZT1A 4ELUA 4W5NA 3VQAA 3KLFA 3EZ5A 2JGUA 1S5JA 3V9ZA 3TAMA 1ZBLA 4B9MA 3IS9A 5C42A 3IG1A 3SNNA 2KFZA 1F21A 3LP0A 3AVFA 4JS5A 1D8YA 3AO1A 1J5OA 5DMRA 3V9SA 4AHTA 3KKRA 1A5WA 3ULDA 3LAKA 2HHVA 1WNSA 3I8DA 4K8ZA 1S6PA 5CYMA 2YNHA 4DU4A 1RT5A 3P1GA 4NCGA 3VA0A 1I39A 3OVNA 4ELTA 1NK5A 5FRNA 4I9LA 4LSLA 3L2WA 1GOBA 3TAEA 1U49A 4FK4A 2DFEA 2RPIA 3DRSA 4F2SA 3T3FA 4FM0A 2GV9A 3SUNA 3SJJA 2BANA 1FXXA 3LPUA 2YV0X 2IC3A 4OGEA 3C94A 2Z1GA 2Z1IA 3TI0A 4QOZB 4JRPA 3KKSA 3HK2A 4E1NA 4DG1A 3SI6A 4M3TA 3SUOA 1N6QA 4J2EA 3T19A 1RTHA 2IAJA 3MAQA 1X1PA 1RT6A 3RMBA 4W5OA 3M8SA 1KLNA 1ZBHA 2ZQBA 3LZIA 3SPYA 1U4BA 3QEWA 4BDZA 4Z4IA 4KV8A 4LH5A 4B9VA 1TAUA 2WONA 4KKOA 1NKBA 2VWKA 3PX4A 4KTQA 2DY4A 2P1JA 2IDOA 4E3SA 2HMIA 3SZ2A 2G8UA 2YNIA 4Y1DA 4B8CA 3ZT3A 4CECA 4KHWA 1XI1A 1D5AA 3AVLA 4B3OA 2ZE2A 2G8FA 2O4IA 1TGOA 1NJZA 1W0HA 4CFBA 1Q9XA 4M3YA 3SV3A 1JLQA 4FJ9A 1BHLA 3LANA 4CHNA 4M41A 4ZTFA 4CGDA 1S1WA 3LALA 1CXUA 1S9EA 4E19A 1WSIA 5KGWA 1FKPA 3QNNA 1UAXA 3TABA 4QCLA 4FJJA 4OKJA 1RNHA 4BE1A 4EP4A 4CEDA 3M8PA 4M3UA 3RMAA 3DLEA 4O55A 4N76A 2P51A 1CXQA 1L5UA 1RTIA 2OPSA 3QIPA 3NGZA 4DTNA 4CJPA 1JL2A 4DSEA 3BGRA 3AVBA 1A5VA 3K5OA 3F9KA 4IBNA 4CEBA 3KLEA 3SYZA 3ZSXA 3AA5X 4IG0A 3NHGA 1IKVA 1RBVA 4F8RA 4I9QA 2KFNA 3VQ5A 3TAQA 4DTRA 4CF0A 1TAQA 2RN2A 4F3TA 3ZSQA 4H8KA 1HNIA 1SUQA 1RBRA 4O5BA 4AHCA 4LD0A 4AHVA 2G8IA 1TK5A 1L3VA 2FBTA 4FZZA 5C24A 1RBTA 3L3UA 2P5GA 4DSIA 4CJWA 3L2VA 3OYCA 4FM2A 3OS0A 5HRNA 3VQ9A 3SCXA 3O3GA 2YHAA 4CFAA 3B6PA 4DLGA 3RMDA 4FLTA 1SKWA 2W42A 1RDBA 3L2RA 3JSMA 2F8TA 1T8EA 2OA8A 5KI6A 4CESA 4O0IA 4ZTJA 4FZXC 1WSFA 3F73A 3QEPA 3RRHA 4K8XA 4B9LA 4CGJA 1HQUA 3ZSRA 4NYNA 4R5PA 1S1VA 3KK3A 3D0PA 4B9TA 5T7BA 1YVUA 1RBSA 3HJFA 1Z26A 3G0ZA 1JLAA 3NGYA 1ASWA 4PA1A 4KHQA 4CFCA 4EP5A 4DFPA 3ITHA 3KTQA 4W5TA 4ID1A 1IH7A 3HPOA 1MU2A 2A1SA 3V9UA 3MEEA 1Y97A 3LDSA 4L8RB 1ZBFA 2KQ2A 4FJKA 1TV6A 4CFDA 1XWLA 4CEQA 4IKFA 5KGXA 5HRRA 1J54A 3OS1A 4B9NA 1HJRA 1NK4A 3V1QA 4E7JA 1VSFA 4FCYA 4CEOA 5SZTA 1SKRA 2OPQA 3OJSA 3S3NA 4CIGA 4HCCA 1B9DA 1VSHA 2IOCA 1TKTA 4Y1CA 3CFPA 3QEXA 4FYDA 3HPHA 3OY9A 1KTQA 4KTWA 3NF8A 4OGCA 4FJHA 4AHRA 4BWMA 4CE9A 3OJUA 3WNGA 1JLGA 1BQMA 4FK0A 1VK0A 3AA3A 2PYLA 2HHWA 1L3UA 3HT3A 4DTOA 1WAJA 3QEIA 2OZSA 1HPZA 3QESA 5J2NA 2OPRA 5HRSA 4E7KA 2Y1JA 1BGXT 2YKNA 3VQ4A 1B92A 3OYGA 5J2PA 1IG9A 4FJ7A 1YTUA 3L2QA 5HBMA 3ZSWA 1YT3A 3LP3A 1UWBA 3VQEA 3S3OA 2E4LA 2X74A 5KTQA 4KHSA 1C0TA 2XRIA 4C8LA 3E01A 3K5LA 1L3SA 1VSDA 3VQBA 4JRQA 1BI4B 3AVKA 4FJ5A 1DTQA 3NAEA 3IRXA 4DFMA 5CZ1A 1IO2A 1LWCA 1C6VA 4DSJA 4Z4FA 3HPGA 1GOCA 4Z4GA 3SQ4A 1KVBA 2FBYA 3IAYA 2HW3A 3PV8A 3AVIA 3MEGA 1Q9YA 3WNEA 4E7HA 4F2RA 3B6OA 4F3OA 1HNVA 4JLHA 4DS4A 1BI4A 3VA3A 1C0UA 3DRRA 4C8NA 1ASUA 1VRTA 3A2FA 1NJWA 4CK2A 3KIOA 1HQEA 2D0AA 3WNFA 4CJEA 3KD1E 4CJKA 2LSNA 4BACA 1KFDA 4FLXA 1RTJA 4I2QA 3FFIA 3AVMA 4BDPA 3VQPA 1N5YA 3KLHA 2FBVA 4C8KA 4OVLA 4KB1A 3KK2A 3MXJA 3TARA 3K58A 1JKHA 1LAVA 1B9FA 4TSXA 3AO2A 3LP2A 3NF6A 3OYBA 3S3MA 3P5JA 5FRMA 4KHYA 4LH4A 4CHZA 4HUGA 1SL0A 4M45A 1IKYA 4CJ3A 3VQ6A 3VN5A 3TR8A 1VSLA 2KZMA 3ZSVA 3MXMA 4W5QA 2ETJA 3NF7A 1HYZA 3QLHA 1RBUA 4GW6A 4C8MA 3KK1A 4QAGA 3K59A 1S1XA 2Q3SA 1UA1A 2PY5A 3NF9A 1BCMA 3O3FA 2D5RA 3DLBA 3HYFA 1R0AA 4H4OA 2B5JA 4KRFA 4ICLA 4FM1A 4DQSA 1KCFA 3HP6A 2XHBA 4DMNA 2G8WA 4KI6A 3ALYA 3AO4A 4LY7A 1QSYA 4CIEA 1JLFA 1J53A 1HMVA 4FLUA 1QSSA 4JS4A 1XHXA 2VG5A 4FLZA 4J2DA 1VSMA 2I5JA 4FLWA 3AVGA 2YNFA 2G8HA 3OYJA 1DLOA 2XY8A 3V1OA 5J2QA 1TL1A 3PO5A 3RR7A 5I3UA 3LZJA 3QERA 1WSGA 4B8AB 2ITGA 2KTQA 4HTUA 3NH0A 4KO0A 4CF8A 1WSJA 3LWMA 1KFSA 4KHUA 4ELVA 1JXBA 1LV5A 4RW8A 4CEFA 5CYQA 3V4IA 4KAZA 2XO7A 2P5OA 1JXEA 2A1RA 2HHSA 2YKMA 2XY7A 1HYVA 3HO1A 2D0CA 1NK7A 1ZYQA 3DOLA 3TWHA 3U6FA 1TK8A 1LWFA 1BL3A 4FJMA 4G1QA 3VQ8A 3AVNA 4CIFA 3K2PA 1IKWA 5HRPA 3RRGA 4E1MA 2BDPA 1NJXA 4CJRA 3K57A 3NGIA 4DWIA 1ASVA 3AA2A 4M42A 3CM6A 4DTJA 4N41A 4OKKA 4FXDA 4KHNA 3O4QA 3NFAA 1GOAA 3V9WA 1T7PA 1RDCA 5DK5A 4CHPA 3NE6A 2F8SA 4FVMA 4BE2A 1J9AA 4HCBA 4DTXA 1LW0A 2HNZA 5SWMA 1TKZA 4CJQA 3SPZA 1X9MA 1TKXA 3P83D 2R7YA 2ZD1A 4M3RA 3QO9A 1DTTA 1RILA 3O3HA 4XIUA 5FROA 4CGGA 4Q5VA 2JLEA 3DOKA 4IFVA 1JLEA 4RW4A 3T1AA 3CM5A 2FC0A 3MEDA 3ZT0A 5JS2A 4HHTA 4DTMA 1SL1A 1SL2A 4OLBA 1KVCA 4NCBA 1KLMA 4OJRA 1T05A 4EZ9A 1NK0A 1ITGA 2E6MA 1WSHA 4UQGA 3AO3A 2X6NA 3M8RA 2B4JA 4ZHRA 4N56A 3HXMA 1BQNA 3LPTA 1U04A 2DFFA 1EKEA 4PWDA 1TK0A 2BGGA 3OYLA 4DTPA 1NOYA 1LWEA 1QHTA 1QS4A 3DI6A 4DTUA 5K14A 3CYMA 4Q0BA 2QK9A 4DQPA 1TKDA 2HHTA 4DF8A 3TANA 1NK8A 1YTAA 4YNQA 3CQ8A 3EYZA 2IGIA 1LAWA 2YNGA 1QSLA 4E0DA 3C6UA 3I0RA 1QE1A 4WE1A 3K5MA 3RMCA 1KRPA 4CF9A 1S1TA 1WLJA 3D45A 1RTDA 5JS1A 4FJXA 3NH2A 4DSLA 4DFKA 1REVA 3TAGA 1WSEA 3V6DA 4OLAA 4CJUA 3NCIA 1FK9A 3ISNC 4ID5A 4IG3A 4DU1A 4DFJA 3V81A 4E7LA 4GVMA 1X9SA 3ZSZA 4KI4A 1RCHA 2HHUA 3PX0A 2AJQA 1S9GA 1ZBUA 2B6AA 1EETA 3TAFA 1UA0A 2X78A 3OYDA 3S9HA 1IKXA 3DLGA 4CEZA 4Z4CA 4AH9A 3JYTA 2HNYA 3AV9A 4H4MA 1VRUA 4CF2A 4DTSA 4FLVA 2HVIA 1BCOA 2HVHA 4I2PA 3OS2A 3CG7A 2HB5A 2RKIA 4RG8A 1U48A 4DQIA 3QNOA 3QETA 1G15A 3M8QA 4CEEA 1CZ9A 2QXFA 2X6SA 4B08A 3DLRA 2F96A 4M3WA 3AVJA 2KW4A 3WNHA 4O4GA 3C95A 4O44A 3KD5E 2HHXA 3U3YA 3RTVA 3QEVA 4BWJA 4CGHA 5FDLA 3TAPA 3MXIA 4CCHA 4PQUA 4FK2A 4RW7A 1I3AA 4FZYA 1W9HA 4CK1A 2Z1JA 3ASMA 4AILC 1C1BA 5HLFA 4DQRA 1D9DA 5CY4A 4M3XA 4CJVA 2QKKA 3DYAA 1SV5A 4E89A 1TVRA 2GUIA 4OKEA 4OPKA 2HNDA 4LSNA 1A5XA 4W5RA 3VQ7A 1RDAA 3LWLA 4RW6A 3U3GA 3SV4A 4CJTA 1ZBIA 1RDDA 1JL1A 1RT4A 2RF2A 1XC9A 4AHSA 4KREA 3BDPA 3AO5A 2DTUA 1QTMA 1Z25A 3ZT4A 3HVRA 4KB0A 3CFOA 4CK3A 3PUFA 4DS5A 1FKOA 3MECA 3K5NA 3I0SA 4MFBA 1C1AA 1HRHA 3RR8A
chains in the Genus database with same CATH superfamily
3HSTB 2VG7A 5E41A 5J1EA 3IMXA 3AVHA 2FLOA 2VGMA 3DM2A 1S6QA 3VEZA 4Z4HA 2IVPA 3SUQA 4JKDA 4CJ4A 1MA9B 3NDKA 3CJ1A 4J2BA 4CJ5A 4IEIA 3NBPA 2DFHA 1SKSA 3U4LA 3OYMA 3SQ2A 4N47A 2YHYA 4OPJA 5EU7A 3TPQA 3HVTA 4WQ4C 3V1RA 1GLDG 3SAHA 1T3VA 2D0BA 4I6MA 4BRLA 3HP9A 2E5LK 3F5TA 2E2QA 4BR4A 3M1FA 3I55N 5BPLA 4H5VA 1JLBA 3UE5A 4FW2A 3O9TA 3EY1A 3V81A 3AAPA 5AQQA 3CFRA 4DQQA 3EEQA 3OYEA 4YHHK 1X9WA 4XH5A 4BRHA 4JKCA 2YHBA 4JKAA 1VSKA 5D3GA 4DV4K 3OYFA 3AA4A 1VSJA 4A57A 4GKKK 5JVHL 4QS7A 1UOCA 1RT1A 4M3ZA 2YI1A 1VQ6N 1EP4A 4FJLA 5KRTA 4FWNA 3O4WA 4O0JA 1KAYA 4IXCA 4MO4A 4CHYA 3QINA 5J2MA 3GL1A 3BP8A 2HMPA 4HVJA 1BISA 4W5NA 4JI3K 3MK6A 4B9QA 3EZ5A 4WFAL 2P9PB 1ZBLA 2QWMA 5AQPA 4FOIA 4ISEA 3IG1A 3GBTA 4U67L 1F21A 3LP0A 3AO1A 1V4SA 3J8AA 2P9PA 2GX9A 2HF4A 3CCJN 3D2EB 1WNSA 3I8DA 1S6PA 4O5FA 3JAMO 3CF5L 1YIJN 5ELZA 3VA0A 3SMPA 4PL7A 4DV3K 4FK4A 4F2SA 4AM6A 3D2EA 1CZAN 4NO7A 4AM7A 3C0BA 2YV0X 1BA0A 4JRPA 3KKSA 3HK2A 5AJ3K 1N6QA 1HKBA 2ZJQL 1KLNA 3J81O 1EQYA 2ZJRL 4U7BA 4BDZA 1YI2N 4CZFA 3MN7A 1TAUA 2WONA 3GDQA 2DY4A 2IDOA 3SZ2A 3AGRA 3SK3A 1E3MA 3AVLA 2O4IA 1TGOA 4GY2B 3R8EA 4PHTX 3SV3A 1JLQA 3LANA 4M41A 2HSTA 4ZTFA 2HBJA 1FKPA 3TABA 4QCLA 2GELA 3R9PA 3P4IA 3DLEA 4O55A 2HBLA 2P9IB 1JL2A 4H0TB 4DSEA 1C0FA 3K5OA 1T44A 3SYZA 5ADXH 3HBTA 3MCAB 5FPDA 1RBVA 2KFNA 3VQ5A 1QQOA 4DTRA 4CF0A 2O8FB 1TAQA 3G25A 2RN2A 1ATNA 3ZSQA 5BR8K 3G71N 1L3VA 5KQDA 1RBTA 4DSIA 3OYCA 3OS0A 5HRNA 2YJFA 2O8FA 4LF7K 3O3GA 3B6PA 4FLTA 3BF1A 1DEJA 1M1KO 5KI6A 3O1BA 4ZTJA 4IOXA 2P9LB 4CGJA 3TTFA 3M3ZA 1YVUA 1RBSA 4IZ9A 4CFCA 4EP5A 4DR1K 3HOTA 3ITHA 2P9LA 4ID1A 3HPOA 3V9UA 3ZX2A 4L8RB 1ZBFA 2QWQA 3B8AX 4CFDA 4CEQA 3OS1A 3Q7CA 4H5RA 1SKRA 5HL7L 2OPQA 3S3NA 1VQ7N 1VSHA 1MDUB 4JNEA 3HPHA 3OY9A 1KTQA 4JI7K 4OGCA 4FJHA 3AA3A 2HHWA 3A5MC 1L3UA 2OZSA 1HPZA 3LL3A 2W6KA 5HRSA 1K9MO 1FJGK 1VQ8N 2YKNA 1OVQA 4JI5K 1YT3A 3LP3A 5BPMA 4IFEA 3S3OA 4KHSA 4YOXA 1W7AA 2CH6A 3LM9A 1DTQA 5CZ1A 1IO2A 3M6GA 4Z4GA 2HW3A 3IAYA 1KVBA 3O9RA 3WNEA 5JVGL 1KQSM 2P9SB 1C0UA 1VRTA 3S41A 5LMUK 4B1YB 4A62A 4CJEA 3EZWA 2OANA 4RCHA 1NWKA 2P9SA 4FPAA 3VQPA 2E1ZA 3CI5A 1JKHA 3AO2A 3NF6A 4X64K 3S3MA 5FRMA 3HOSA 4KHYA 4M45A 4CJ3A 4NB4A 4B3RK 2KZMA 3ZSVA 3QLHA 4Z4EA 1HYZA 3R3LA 3O9UA 4QAGA 3KK1A 3DWLA 3O3FA 1VQ4N 3FZMA 3HYFA 4DV0K 1R0AA 4CZGA 4ICLA 4FWQA 1KCFA 4BC3A 3T69A 3ALYA 3R1XA 4CIEA 1JLFA 1HMVA 3VESA 4JI4K 4J2DA 1NU0A 1OH6A 1VSMA 4FLWA 3BZKA 3CJ9A 3VF2A 3PO5A 1WSGA 4CVNE 4MDAA 5AQGA 3NH0A 5H1SQ 3LWMA 1LV5A 4BRNA 2XO7A 1JXEA 2A1RA 2YKMA 3HO1A 1NK7A 3DOLA 1TK8A 1LWFA 3VQ8A 4CIFA 1BO5O 2YX6A 3RRGA 1QZ6A 3K57A 3NGIA 1ASVA 3AA2A 2QWOA 3NVKA 4M42A 4DTJA 5E84A 4KHNA 1T7PA 4GKJK 4CI6A 2F8SA 4FVMA 2HNZA 4X65K 3SPZA 1X9MA 2HBKA 3L6QA 1DTTA 5FROA 1SZ2A 4Q5VA 1JLEA 5JLHA 4HHTA 1SL1A 1KVCA 2V7ZA 1KLMA 4BR9A 1ITGA 1DKGD 1VQKN 2X6NA 4N56A 4DV1K 3HXMA 4BC4A 5AQTA 1EKEA 1OKJA 4PWDA 1U2VB 5M1QA 4BRIA 1QHTA 2Q31A 3CYMA 2BUPA 4DF8A 3TANA 1U2VA 1VQ9N 5AQMA 1QSLA 3C6UA 1QE1A 4WE1A 3RMCA 3D45A 3O9QA 5EX5A 2O8CB 3A8YA 1Q18A 4FJXA 4ID5A 4DFJA 4ILGB 3E9PA 1X9SA 3VEXA 1NLVA 4GVMA 4E7LA 2AJQA 1RCHA 3PX0A 3D2FB 1S9GA 1ZBUA 1VQMN 3RSEB 3ENOA 4K25A 2O8CA 2A41A 4H5NA 4AH9A 2YJEA 5JLFA 1TYQA 1VQ5N 5AQWA 2GUPA 1BCOA 3ZEUB 2HB5A 2RKIA 3RSEA 1U48A 2FXUA 4DQIA 3QETA 1G15A 3MMVA 4B08A 5C2DA 1GLEG 2HHXA 3C95A 3EKSA 3QEVA 3TAPA 1IG8A 2P9KB 1C1BA 1HNZK 4CJVA 3IUCA 2QKKA 2GUIA 4OKEA 2HNDA 4LSNA 2P9KA 3U3GA 1FW6A 5AQLA 5MLCQ 2FF3B 1HNXK 1RT4A 1XC9A 5E26A 4KREA 3BDPA 2DTUA 1QTMA 1Z25A 4PKHA 3CFOA 4CK3A 3PUFA 3SAGA 4FO0A 3MECA 4MFBA 1C1AA 1HRHA 1WUAA 1BIUA 1LW2A 1K73O 3PO4A 3RWUA 4MDBA 2PFUA 4LFBK 1T6DA 1NGEA 3WEEA 4YFUA 4IJNA 1IV0A 4O8KA 4BRFA 3VENA 3VQQA 4BQZA 5BRDA 3KLIA 3DLKA 4FVUA 3OYIA 1K8KB 3L3VA 1T03A 3SMSA 4HUFA 3L8BA 3ZT2A 3LDPA 3EL2A 1TL3A 3ZX0A 3LAMA 4CGIA 4CEAA 2FBXA 2UUBK 1K8KA 3H1QA 1NK6A 5C25A 1NOZA 3A0IX 1XHZA 1QQCA 3CHWA 5AZIB 4HWIA 1CZBA 1EX4A 4V19S 3VETA 4R79A 2NUBA 1MWKA 4E7IA 1U6ZA 2QWLA 4CHOA 4JD2B 5IWAK 1WAFA 5AZIA 3LDLA 1TUUA 1VSIA 3C6AA 4CJSA 5F0XA 1NJIO 1U45A 1NK9A 3OYAA 1JLCA 3UB5A 3THXB 3AVAA 3C6TA 3NH1A 4C8OA 4JD2A 1XQSC 4DV2K 3DXMB 1NKEA 4PUOA 4FJNA 4DSKA 4AQYK 3T1YK 1H1VA 1HKCA 2OYQA 2OPPA 3HM9A 2NRVA 3THXA 1RT7A 2G8VA 3DXMA 3WQTA 1XMQK 1BIZA 1K6YA 5GIOA 5M1OA 3VTIA 1L3TA 4YOVA 4FW1A 5AFUA 1IBLK 2ITMA 3MX5A 4A2BA 5F1XA 4IDKA 4HUEA 4CGFA 4CJFA 3H46O 1C1CA 1WN7A 4BR7A 4DLEA 4ELUA 3ZT1A 3TAMA 3QMLA 4FWPA 1Q81O 3SNNA 2UXBK 4LC9B 4B1ZA 1J5OA 5DMRA 3ULDA 5EXWA 3LAKA 5CYMA 4DU4A 3U9ZA 1Q82O 3P1GA 4JAXA 1I39A 1NK5A 5FRNA 4I9LA 3L2WA 1GOBA 1M90O 3DRSA 2RPIA 2V51B 4YORA 3SUNA 3ZETA 3RVCA 1FXXA 5C12A 3QFPA 4JKGB 4OGEA 2Z1GA 3TI0A 4UY8O 3FZLA 4A5AA 3SUOA 2IAJA 1RT6A 2D0PA 4W5OA 1ZBHA 3LZIA 4JKGA 1VQLN 4LH5A 1O13A 3UKUA 4KKOA 1NKBA 2VWKA 4KTQA 2P1JA 4B8CA 4CECA 3ZX3A 2ZE2A 5M1FA 1NJZA 5FPEA 4IWVA 3CMEN 2W40A 3LALA 4E19A 1WSIA 1X3NA 5KGWA 3QNNA 4FJJA 4BE1A 1K8AO 3HSCA 4EP4A 1KD1O 3J7YP 4I6MB 3PSIA 3NGZA 4CJPA 1DT9A 3BGRA 4ISGA 3ULEA 3F9KA 2DPNA 3BY5A 4IG0A 4JI1K 4F8RA 2WUSA 4F3TA 1SUQA 1RBRA 1EWRA 2GWKA 4JEPA 4DR6K 2FBTA 4CJWA 3L2VA 2KLAA 4GV3A 1V4TA 4DLGA 1SKWA 5CE3A 2W42A 3L4QA 2F8TA 1T8EA 3ZYYX 4FZXC 1WSFA 3F73A 3M5RA 3ZSRA 1HX1A 1S1VA 3D0PA 2GTDA 2P9UB 3A5OC 1N8RO 4EHUA 1MU2A 2A1SA 4BRAA 2FSKA 3MEEA 4DB3A 2P9UA 4LFCK 1TV6A 1XWLA 5KGXA 2VYPA 1J54A 5HRRA 3VPZA 1NK4A 4CEOA 5SZTA 3NMUA 4CIGA 1B9DA 4Y1CA 2IOCA 4FYDA 2E2PA 1X9JA 4GNIA 3EO3A 3OJUA 4IOCL 4FK0A 1BQMA 1VK0A 4NLBA 1JCGA 1ILYA 5JICA 4FJ7A 3L2QA 3Q7BA 2X74A 1C0TA 3E01A 1L3SA 3FR0A 3NAEA 4Z4FA 4DSJA 4MLHA 3HPGA 3PLAA 3AVIA 3MEGA 2UU9K 3B6OA 3VA3A 4KH4A 1NJWA 3A2FA 3WNFA 4BACA 4JV5K 5AQOA 3KLHA 2FBVA 2NRXA 3KK2A 1HKGA 4DR2K 3TARA 4TSXA 1B9FA 3BUZB 3OYBA 3P5JA 4CHZA 3UKRB 4DHYA 3TR8A 1VSLA 2F9WA 4GW6A 3N4QA 1NGDA 1UA1A 1BCMA 3TTCA 2D5RA 2KKZA 4H4OA 2B5JA 3LDQA 3UKRA 1S72N 2VCPA 2G8WA 3CJ7A 3ENHA 3F9MA 3AO4A 3J7ZO 1QSYA 4FSVA 3H1VX 4JS4A 4K0KK 2YNFA 2G8HA 5J2QA 3RR7A 3LZJA 4JKBA 4KO0A 1KFSA 4WQ5A 4KAZA 5CYQA 3V4IA 5LL6Z 3MWTA 2P5OA 2HHSA 3D6RA 4CZIA 2AA4A 3TWHA 1BL3A 2UXDK 3WXKA 3HTVA 2BDPA 4BG9A 4CZKA 1GLCG 3NE6A 4BE2A 1J9AA 4HCBA 4YOUA 1NGCA 4CJQA 2UXCK 1WOQA 3T1AA 2FC0A 4OLBA 1NGIA 1SL2A 4JKFA 5AQIA 4CZMA 4OJRA 3ZLJA 1Z6RA 3AO3A 4JKEA 1YHQN 1BQNA 1BUPA 4CZJA 4DTPA 5F2RA 1NOYA 3CC2N 1R59O 3TSQA 5GINA 4Q0BA 2E2OA 3CCVN 4DV5K 2HHTA 5AR0A 5AQYA 3CQ8A 2IGIA 3GE1A 1LAWA 4E0DA 3I0RA 2WBNA 1KRPA 1S1TA 1WLJA 2A40A 1RTDA 5JS1A 1ZXOA 3NH2A 4DSLA 4A59A 1REVA 2E2NA 3FE1A 3VEVA 3MN6A 5GIPA 2BTFA 1VHXA 4M7XA 3IKMA 2Q97A 1N32K 3AGKA 1SAZA 3OHRA 2B6AA 2YCHA 1EETA 4YOYA 4CEZA 1OH7A 1KC8O 3U9DA 2ZGYA 4H4MA 4DTSA 4FLVA 3OS2A 3QNOA 4BVOA 5FLXO 2F7TA 2NRWA 4Z94A 2D4WA 2X6SA 5CR4A 2ZM6K 3CERA 3U3YA 4PKGA 1BA1A 3MXIA 3OA9A 4CCHA 4FK2A 4K43A 1I3AA 3IDHA 1W9HA 2Z1JA 4AILC 3FZKA 4DQRA 1LCUA 5CY4A 3H45C 3EKUA 2I7NA 2Q0UA 2FSNA 2D0OA 4W5RA 1YAGA 3VQ7A 1RDAA 3K9KA 5LY3A 3FGUA 2H3GX 2HHHK 1RDDA 1VQNN 2F9TA 3HVRA 3VOVA 3K5NA 5DM7L 1TUYA 3PY8A 5CZ2A 1Q8IA 4NYFA 3G6EN 3MN5A 1YJ9N 4KPYA 2ATQA 3PIPL 1U47A 3QICA 1NKCA 3CCLN 3MX2A 5CHIA 1YJNN 2CGKA 1NJYA 4B9UA 2E88A 2EHGA 2UYTA 2KZZA 3G4SN 5HROA 1S1UA 4H0VB 2XY6A 2PZSA 1C0MA 2ZWHA 2IS3A 4CBXA 3WQUA 1CLQA 4BG8A 3OYHA 4CJLA 4DSFA 5AZJA 3DLHA 3TTDA 1RT2A 4KTZA 3VMFB 3THYA 3CCSN 5FPMA 4FJIA 1VSEA 3J7AP 4CD1A 4B3SK 2PYJA 4CJ7A 2IVOA 4JHDB 3VEOA 3G10A 3MWPA 4WF9L 3QFUA 5AQUA 2Y1IA 3EE8A 4IFYA 4FJGA 4FJ8A 3UIQA 3L0QA 1D9FA 4PY5A 4JHDA 2P5GA 3H08A 3QB0A 4F4KA 2GBZA 5EY4A 2D1KA 2VWJA 3HL8A 3THWA 3LP1A 3ZCMA 3OYKA 4FWLA 3EE9A 1KSPA 3SUPA 4Z0UA 4KBOA 2JWLA 5LJWA 3DLLL 3R6MA 3A5NC 3T7ZA 4EHTA 1NG9A 3OYNA 4ILJA 3THVA 4BC2A 4I7FA 1N33K 1BWFO 3C6HA 4H0PA 2VG6A 4CERA 4H03B 1TYQB 4DR7K 5I42A 3SBTA 4JK9A 1I94K 2ZJPL 1HJOA 3CCQN 2OZMA 3W3DA 2HBMA 4E1JA 2JGUA 1S5JA 4JI6K 1QVGM 2RHKA 1NGFA 4B1WB 5C42A 2KFZA 1D8YA 4AHTA 3KKRA 3O08A 2YNHA 1RT5A 4NCGA 4K41A 1GLFO 2QWNA 4ELTA 4WQ5C 1U49A 4OX9K 2DFEA 4FM0A 4JI0K 5A2QO 3LPUA 3C94A 2Z1IA 4O8UA 1ATSA 4DG1A 4M3TA 4J2EA 3T19A 1RTHA 1X1PA 3M8SA 2QI2A 2ZQBA 4X62K 3WT0A 3FFKB 4KV8A 2PAVA 3WEEB 1EO1A 3PX4A 4E3SA 2G8UA 2YNIA 4Y1DA 4B3OA 4CZLA 1HUXA 4BRGA 4M3YA 4FJ9A 1BHLA 4CHNA 2NRZA 1S1WA 1S9EA 3MN9A 1UAXA 4OKJA 4M3UA 3RMAA 4N76A 4NLCA 1L5UA 2VWBA 1RTIA 4HTLA 4M63C 2OPSA 3QIPA 1NNEA 4MO5A 4C23A 3FLCO 4A61A 3AVBA 1A5VA 4IBNA 1ATRA 3VERA 3AA5X 3NHGA 3OBWA 5GAHP 3C7NA 2G8IA 1HNIA 2CGLA 4O5BA 4LD0A 4AHVA 3O6WA 3DAWA 4FM2A 2HOEA 4FOEA 3VQ9A 5AQXA 2YHAA 4CFAA 3LM2A 2OA8A 1P8ZA 4CESA 4O0IA 1YVNA 4B1UB 3RRHA 1KAZA 3CJAA 5C2FA 1HQUA 4NYNA 3KK3A 1BG3A 1RDUA 3OBYA 3T1HK 3HJFA 1ZBSA 1JLAA 4KHQA 4PA1A 3P31A 5AQRA 1YITN 4DFPA 1IH7A 4JN4A 1IBMK 3CCEN 4CD3A 2V52B 4FJKA 4DUYK 2EWSA 1WBDA 3VGLA 5LJVA 2ZF5O 3V1QA 1VSFA 3KWGA 4QS9A 4YDUA 1HLUA 1KAXA 4H5WA 1XNRK 4JKHA 4KTWA 4CE9A 2PBDA 3WNGA 1JLGA 3DJCA 3D7EO 2PYLA 4CBUA 3HT3A 4DTOA 3QEIA 3QESA 2Y1JA 3VQ4A 3OYGA 1B92A 5J2PA 1IG9A 5EOYA 5HBMA 3ZSWA 4YY3K 1UWBA 5KTQA 4B1XB 4C8LA 2VQFK 3ZETB 5C0YA 2KHOA 1VSDA 3AY9A 3VF4A 1BI4B 1LWCA 4KHPK 3PIOL 2BH1A 5GAGP 3PV8A 1P90A 4F2RA 1DGKN 1HNVA 4JLHA 4DS4A 1BI4A 4C8NA 3DRRA 1ASUA 4CK2A 4BR5A 1HQEA 4BRMA 2D0AA 4DQ8A 3UKUB 4CJKA 2LSNA 1KFDA 4FLXA 3FFIA 4C8KA 4KB1A 3K58A 2GWJA 1NM1A 2AP1A 3NVMA 4LH4A 4HUGA 1SL0A 1IKYA 3VQ6A 3VN5A 4M3XA 3MXMA 2ETJA 3NF7A 1JCFA 3DLBA 4GVEA 5AQVA 2Q36A 1HNWK 1W97L 4FM1A 2UUCK 3HP6A 2XHBA 1NGAA 4DMNA 4KI6A 1S3XA 4LY7A 2CGJA 4FLUA 2ZGZA 4GV9A 3L4IA 1XHXA 4FLZA 3ULEB 2I5JA 2FF6A 3AVGA 1VQPN 3I56N 2VQEK 5BREA 4B8AB 5ADXA 2ITGA 2KTQA 1WSJA 3LDOA 4KHUA 4ELVA 2YHWA 1GLBG 3VGKA 2NRHA 2D0CA 4G1QA 5HRPA 1HR0K 4PKIA 1IKWA 3N4PA 4CJRA 3CC4N 2QXLA 4XH4A 4N41A 4OKKA 4CW7B 1GOAA 5HOOA 4DR4K 3V9WA 1RDCA 5DK5A 4GV6A 4OPAA 4DTXA 5SWMA 2ZD1A 4M3RA 3O3HA 3ATVA 4CGGA 2JLEA 3DOKA 3DXKB 4RW4A 5GAEP 4DTMA 5JS2A 1NK0A 3M8RA 2P9NB 4ZHRA 2ASOA 3DXKA 4XEIA 4BRDA 3F2KA 4EIAA 2BGGA 3OYLA 3CCUN 3VTHA 1LWEA 3DI6A 1S22A 4JI2K 4BRPA 4NXNK 2P9NA 3CPEA 4DKWA 1TKDA 1XUPO 4YNQA 3EYZA 3CCMN 4OPHA 3VEWA 3J80O 4IDHA 3TSUA 4CF9A 3OW2M 3WXLA 1E4GT 1QHAA 3TAGA 1BOTO 1NBWA 4BRQA 4CJUA 3MCPA 2A5XA 4OLAA 1FK9A 3ISNC 1Y64A 4IG3A 2O8DB 1KXPA 4KI4A 4WFBL 3ZSZA 5AFUH 1QQNA 2QWPA 4DR3K 3AARA 3TAFA 1UA0A 3GG4A 3S9HA 1IKXA 1LOTB 3O1WA 3JYTA 2O8DA 2HNYA 4CZHA 3AV9A 3VGMA 5EVZA 4CF2A 1VRUA 3QBWA 4CZEA 3CG7A 4H0YB 3CD6N 3I33A 4B3MK 5AQFA 1CZ9A 1NGBA 2V7YA 1IBKK 2F96A 2E20A 3AVJA 3WNHA 3E9LA 4O4GA 3RTVA 4BWJA 4CGHA 5FDLA 5BN9A 4PQUA 1RFQA 4RW7A 1C0GA 5LMNK 4CK1A 4J8FA 1EWQA 4JK7A 4CBWA 2HF3A 1D9DA 5KPTA 3QBXA 5M1NA 4OO1J 3WXIA 3VF6A 3DYAA 1SV5A 1TVRA 3O80A 3FZFA 4BR0A 4CJTA 3K9JA 1Z05A 1ZBIA 3E66A 1FKOA 1YJWN 2YHXA 3I0SA 1XI1A 4B9LA 3RR8A 2O4GA 2Q1NA 2WOMA 4CHQA 2G8KA 4CF1A 3DMJA 4IEEA 3ZSYA 1VQON 4C1NI 4BREA 4N5SA 5KPZA 4KFBA 2QKBA 4NCAA 5DM6L 4BE0A 4YOWA 3VQCA 1YUWA 3KLGA 4IO8A 2W41A 3KWIA 2EX3A 3V9XA 2OTLN 2E6LA 2QEXN 2HHQA 3QIOA 3CETA 3ZSOA 2O8EB 4YDUC 3AAQA 4RW9A 1QQMA 4DU3A 4FLYA 4BQLA 4BC5A 2O8EA 5BRFA 1EXQA 2P9IA 4GMJB 3HRGA 1RT3A 3IFRA 3P38A 2Z1HA 3SBGA 4MQ3A 4AHUA 4BROA 3P39A 4DF4A 5KQ8A 3KJVA 4L3QA 1O1WA 2BE2A 4BDYA 3AVCA 3CPWM 1RDWX 1KVAA 4B9SA 3L2UA 3SAFA 4LF4K 3SQ0A 5KRSA 3VQDA 2RE2A 5AQNA 3DRPA 5I9EB 2A6AA 3SQ1A 3A5LC 4F9OA 2VGNA 4LF9K 4EZ6A 5M1PA 3PX6A 4FWOA 1HYSA 2XY5A 3O4NA 1JJ2M 3HZ6A 1XC3A 3ATUA 4B1VA 2W6LA 4J2AA 4LFAK 5HP1A 3QDKA 3VQAA 3KLFA 3BZCA 3V9ZA 4B9MA 3IS9A 4BVPA 4G9ZA 3AVFA 3H3NO 4JS5A 4KH6A 3V9SA 1A5WA 2WTUA 4FWKA 2HHVA 4K8ZA 1SS6A 3FZHA 1YXQA 3OVNA 4LSLA 3TAEA 3WXJA 3T3FA 2GV9A 3SJJA 2BANA 2IC3A 4RWTA 4C1NK 4QOZB 4E1NA 4DR5K 3CXCM 3SI6A 3MAQA 3RMBA 1U4BA 3SPYA 3I8BA 2IVNA 3QEWA 4Z4IA 4B9VA 1MWMA 4AF1A 3CJBA 2A3ZA 1GLAG 2HMIA 3ID8A 4A5BA 3ZT3A 2NRTA 4KHWA 1D5AA 2G8FA 1W0HA 4CFBA 1Q9XA 3JXUA 1BU6O 3CIPA 4CGDA 1Q86O 1CXUA 5AZJB 4RTFD 3THYB 1RGIA 1RNHA 4BR2A 4DV7K 1OVYA 4JYAK 4CEDA 3M8PA 2P51A 1CXQA 4QS8A 4DTNA 4LF6K 1OH5A 1N34K 5AQHA 4DV6K 5BR9A 4CEBA 3KLEA 4K42A 3SJHA 2E1YA 3ZSXA 1IKVA 4I9QA 3TAQA 4EFHA 2O8BB 4H8KA 4AHCA 4JI8K 1TK5A 4FZZA 3WUHA 5C24A 3L3UA 4BRKA 1GLJO 1G99A 3THWB 4FPBA 2O8BA 3SCXA 3RMDA 1RDBA 4ILHA 3L2RA 3JSMA 3CMAN 5TKWA 3QEPA 4K8XA 4H5TA 4R5PA 4B9TA 5T7BA 1Z26A 3G0ZA 3NGYA 1ASWA 1WB9A 3MDQA 3KTQA 4W5TA 5C10A 1IJJA 5BRHA 1XMOK 1Y97A 3LDSA 2KQ2A 4IKFA 4B9NA 1HJRA 2NZTA 4FCYA 4E7JA 2Q0RA 4LF8K 4YOTA 3OJSA 4HCCA 3SLCA 1D4XA 1TKTA 3CFPA 3QEXA 4FWRA 4WQ4A 3CCRN 2ASMA 3NF8A 4AHRA 2I7PA 5FPNA 4BWMA 1NMNA 4LF5K 3H3OB 3HM8A 1GLLO 1WAJA 5J2NA 2OPRA 4E7KA 5JMVA 1BGXT 4XH1A 1YTUA 4A2AA 3VQEA 2E4LA 2XRIA 1QVFM 5AQZA 3K5LA 3VQBA 4JRQA 4FJ5A 3AVKA 2JWKA 3IRXA 4JK8A 4DFMA 3CQXA 1C6VA 1GOCA 3D2FA 2FBYA 3SQ4A 1Q9YA 4E7HA 4F3OA 2WFBA 3WXMB 3O8MA 3KIOA 5GADP 2ASPA 3KD1E 3ZEUA 1RTJA 4I2QA 4MLEA 3AVMA 3K0SA 4BDPA 1N5YA 4OVLA 3ID6A 1VAZA 3MXJA 1LAVA 3LP2A 1BDGA 4WFNL 2NNWA 4W5QA 2Q2RA 4C8MA 3K59A 1RBUA 1S1XA 2Q3SA 2PY5A 3NF9A 3CQYA 4KRFA 5TKYA 4DQSA 3E9OA 2NRRA 4BGAA 1QSSA 1J53A 3CC7N 4FWSA 2FSJA 2VG5A 3PSFA 4IOAL 5IT9O 4IJAA 1DLOA 2XY8A 3CJCA 3V1OA 3OYJA 1TL1A 5KPRA 5I3UA 3QERA 5AQJA 2NLXA 1W2BM 4HTUA 4CF8A 3C7NB 1N36K 4B3TK 1JXBA 4RW8A 4CEFA 3JS6A 3TSPA 4BRCA 2XY7A 1HYVA 3EN9A 1ZYQA 4FJMA 3U6FA 3KHYA 5AQKA 3KZBA 3AVNA 1YF5L 3K2PA 3C65A 4E1MA 3TU5A 1NJXA 4DWIA 4WCEL 3CM6A 2F4VK 4FXDA 4H0OA 4FL9A 3O4QA 3NFAA 3BF3A 4H0XB 3U8XA 5B8HA 2OTJN 4CHPA 1LW0A 1TKZA 1X3MA 4DCHA 1TKXA 3P83D 2R7YA 3QO9A 1RILA 2QA4N 1J5EK 4XIUA 2QW9A 4M7YA 5C15A 1ESVA 4IFVA 1XNQK 1WBBA 3BEXA 3CM5A 3MEDA 3H6EA 3ZT0A 1ZC6A 3GOIA 4NCBA 1T05A 4EZ9A 2E6MA 1WSHA 4UQGA 3VEYA 2B4JA 3KK7A 3LPTA 1U04A 2DFFA 5M1KA 1TK0A 2QWRA 4FWMA 1Q7YO 4IO9L 1QS4A 4DTUA 5K14A 2IIRA 2QK9A 4DQPA 1NK8A 1YTAA 1HPMA 2YNGA 3O9SA 3K5MA 3O5BA 1J6ZA 4WYBA 4DFKA 1WSEA 3V6DA 2CH5A 5BPNA 3NCIA 1NGGA 4DU1A 2HHUA 5BN8A 4KH5A 2QM1A 2OCEA 3HI0A 1NGJA 1QZ5A 2X78A 3OYDA 3DLGA 4Z4CA 4NXMK 4X66K 1E4FT 4Y0WA 3W0LA 2HVIA 2HVHA 4I2PA 2J4RA 4RG8A 3M8QA 4CEEA 2QXFA 2WC9A 3DLRA 4M3WA 2UUAK 2KW4A 4BGBA 4O44A 3KD5E 3KVGA 2QTDA 3LDNA 3E1YA 4PL8A 2GEMA 4FZYA 4DUZK 1NGHA 1NMDA 3OTOK 3ASMA 5HLFA 1SQKA 2A42A 4BY9C 1T6CA 1OH8A 4E89A 4EAHD 4OPKA 3ENBA 1A5XA 4ISFA 3LWLA 4RW6A 3SV4A 1JL1A 2RF2A 2E8AA 4AHSA 3AO5A 3ZT4A 4KB0A 4DS5A 5AQSA 1JCEA
chains in the Genus database with same CATH topology
2O4GA 3PY8A 5CZ2A 2WOMA 1Q8IA 2VG7A 3HSTB 1BIUA 1LW2A 4NYFA 4CF1A 3DMJA 3ZSYA 4CHQA 5E41A 2G8KA 3PO4A 3RWUA 4KPYA 5J1EA 4N5SA 4KFBA 2ATQA 2QKBA 3AVHA 1U47A 4NCAA 1NKCA 3DM2A 4BE0A 4YFUA 3VQCA 1NJYA 1S6QA 4B9UA 4Z4HA 3KLGA 2EHGA 3SUQA 2KZZA 3VQQA 4CJ4A 3NDKA 5HROA 3KLIA 3DLKA 1S1UA 3V9XA 2EX3A 4J2BA 2XY6A 2E6LA 1C0MA 2PZSA 3OYIA 2HHQA 2IS3A 3QIOA 3L3VA 3ZSOA 4CJ5A 1T03A 3NBPA 4HUFA 2DFHA 1CLQA 3L8BA 1SKSA 3OYHA 3ZT2A 3OYMA 4CJLA 3SQ2A 4DSFA 3DLHA 4N47A 1RT2A 4RW9A 4OPJA 5EU7A 4DU3A 4KTZA 1TL3A 4FLYA 3LAMA 4CGIA 4CEAA 3HVTA 2FBXA 4FJIA 1VSEA 3V1RA 1NK6A 5C25A 1NOZA 2D0BA 1XHZA 1QQCA 2PYJA 1EXQA 1CZBA 1EX4A 3HP9A 4GMJB 2NUBA 1RT3A 3G10A 4E7IA 2Z1HA 4AHUA 4MQ3A 4CHOA 2Y1IA 4IFYA 4DF4A 4FJGA 3UIQA 1JLBA 1WAFA 4FJ8A 3KJVA 1D9FA 4PY5A 1VSIA 4FW2A 4CJSA 1U45A 1O1WA 2BE2A 3H08A 3EY1A 4BDYA 3OYAA 3AVCA 3CFRA 1JLCA 4DQQA 3OYEA 4F4KA 3AVAA 2GBZA 3C6TA 3NH1A 1X9WA 1KVAA 4C8OA 4B9SA 3L2UA 1NKEA 4PUOA 2VWJA 4FJNA 3HL8A 4DSKA 2YHBA 3SQ0A 5KRSA 3VQDA 3LP1A 1VSKA 3ZCMA 3OYKA 3DRPA 2OPPA 1NK9A 1KSPA 2OYQA 5D3GA 3SUPA 4Z0UA 4Z4EA 3HM9A 3OYFA 3SQ1A 3AA4A 1RT7A 2G8VA 3OYNA 3THVA 1VSJA 1BIZA 1K6YA 4EZ6A 3PX6A 4I7FA 1HYSA 2XY5A 1L3TA 1UOCA 3O4NA 4FW1A 1RT1A 4M3ZA 1EP4A 4FJLA 2VG6A 5KRTA 4CERA 4IDKA 4O0JA 4J2AA 4HUEA 5I42A 4CGFA 4CJFA 4CHYA 3QINA 5J2MA 1C1CA 1WN7A 4HVJA 4DLEA 1BISA 5HP1A 2OZMA 3ZT1A 4ELUA 4W5NA 3VQAA 3KLFA 3EZ5A 2JGUA 1S5JA 3V9ZA 3TAMA 1ZBLA 4B9MA 3IS9A 5C42A 3IG1A 3SNNA 2KFZA 1F21A 3LP0A 3AVFA 4JS5A 1D8YA 3AO1A 1J5OA 5DMRA 3V9SA 4AHTA 3KKRA 1A5WA 3ULDA 3LAKA 2HHVA 1WNSA 3I8DA 4K8ZA 1S6PA 5CYMA 2YNHA 4DU4A 1RT5A 3P1GA 4NCGA 3VA0A 1I39A 3OVNA 4ELTA 1NK5A 5FRNA 4I9LA 4LSLA 3L2WA 1GOBA 3TAEA 1U49A 4FK4A 2DFEA 2RPIA 3DRSA 4F2SA 3T3FA 4FM0A 2GV9A 3SUNA 3SJJA 2BANA 1FXXA 3LPUA 2YV0X 2IC3A 4OGEA 3C94A 2Z1GA 2Z1IA 3TI0A 4QOZB 4JRPA 3KKSA 3HK2A 4E1NA 4DG1A 3SI6A 4M3TA 3SUOA 1N6QA 4J2EA 3T19A 1RTHA 2IAJA 3MAQA 1X1PA 1RT6A 3RMBA 4W5OA 3M8SA 1KLNA 1ZBHA 2ZQBA 3LZIA 3SPYA 1U4BA 3QEWA 4BDZA 4Z4IA 4KV8A 4LH5A 4B9VA 1TAUA 2WONA 4KKOA 1NKBA 2VWKA 3PX4A 4KTQA 2DY4A 2P1JA 2IDOA 4E3SA 2HMIA 3SZ2A 2G8UA 2YNIA 4Y1DA 4B8CA 3ZT3A 4CECA 4KHWA 1XI1A 1D5AA 3AVLA 4B3OA 2ZE2A 2G8FA 2O4IA 1TGOA 1NJZA 1W0HA 4CFBA 1Q9XA 4M3YA 3SV3A 1JLQA 4FJ9A 1BHLA 3LANA 4CHNA 4M41A 4ZTFA 4CGDA 1S1WA 3LALA 1CXUA 1S9EA 4E19A 1WSIA 5KGWA 1FKPA 3QNNA 1UAXA 3TABA 4QCLA 4FJJA 4OKJA 1RNHA 4BE1A 4EP4A 4CEDA 3M8PA 4M3UA 3RMAA 3DLEA 4O55A 4N76A 2P51A 1CXQA 1L5UA 1RTIA 2OPSA 3QIPA 3NGZA 4DTNA 4CJPA 1JL2A 4DSEA 3BGRA 3AVBA 1A5VA 3K5OA 3F9KA 4IBNA 4CEBA 3KLEA 3SYZA 3ZSXA 3AA5X 4IG0A 3NHGA 1IKVA 1RBVA 4F8RA 4I9QA 2KFNA 3VQ5A 3TAQA 4DTRA 4CF0A 1TAQA 2RN2A 4F3TA 3ZSQA 4H8KA 1HNIA 1SUQA 1RBRA 4O5BA 4AHCA 4LD0A 4AHVA 2G8IA 1TK5A 1L3VA 2FBTA 4FZZA 5C24A 1RBTA 3L3UA 2P5GA 4DSIA 4CJWA 3L2VA 3OYCA 4FM2A 3OS0A 5HRNA 3VQ9A 3SCXA 3O3GA 2YHAA 4CFAA 3B6PA 4DLGA 3RMDA 4FLTA 1SKWA 2W42A 1RDBA 3L2RA 3JSMA 2F8TA 1T8EA 2OA8A 5KI6A 4CESA 4O0IA 4ZTJA 4FZXC 1WSFA 3F73A 3QEPA 3RRHA 4K8XA 4B9LA 4CGJA 1HQUA 3ZSRA 4NYNA 4R5PA 1S1VA 3KK3A 3D0PA 4B9TA 5T7BA 1YVUA 1RBSA 3HJFA 1Z26A 3G0ZA 1JLAA 3NGYA 1ASWA 4PA1A 4KHQA 4CFCA 4EP5A 4DFPA 3ITHA 3KTQA 4W5TA 4ID1A 1IH7A 3HPOA 1MU2A 2A1SA 3V9UA 3MEEA 1Y97A 3LDSA 4L8RB 1ZBFA 2KQ2A 4FJKA 1TV6A 4CFDA 1XWLA 4CEQA 4IKFA 5KGXA 5HRRA 1J54A 3OS1A 4B9NA 1HJRA 1NK4A 3V1QA 4E7JA 1VSFA 4FCYA 4CEOA 5SZTA 1SKRA 2OPQA 3OJSA 3S3NA 4CIGA 4HCCA 1B9DA 1VSHA 2IOCA 1TKTA 4Y1CA 3CFPA 3QEXA 4FYDA 3HPHA 3OY9A 1KTQA 4KTWA 3NF8A 4OGCA 4FJHA 4AHRA 4BWMA 4CE9A 3OJUA 3WNGA 1JLGA 1BQMA 4FK0A 1VK0A 3AA3A 2PYLA 2HHWA 1L3UA 3HT3A 4DTOA 1WAJA 3QEIA 2OZSA 1HPZA 3QESA 5J2NA 2OPRA 5HRSA 4E7KA 2Y1JA 1BGXT 2YKNA 3VQ4A 1B92A 3OYGA 5J2PA 1IG9A 4FJ7A 1YTUA 3L2QA 5HBMA 3ZSWA 1YT3A 3LP3A 1UWBA 3VQEA 3S3OA 2E4LA 2X74A 5KTQA 4KHSA 1C0TA 2XRIA 4C8LA 3E01A 3K5LA 1L3SA 1VSDA 3VQBA 4JRQA 1BI4B 3AVKA 4FJ5A 1DTQA 3NAEA 3IRXA 4DFMA 5CZ1A 1IO2A 1LWCA 1C6VA 4DSJA 4Z4FA 3HPGA 1GOCA 4Z4GA 3SQ4A 1KVBA 2FBYA 3IAYA 2HW3A 3PV8A 3AVIA 3MEGA 1Q9YA 3WNEA 4E7HA 4F2RA 3B6OA 4F3OA 1HNVA 4JLHA 4DS4A 1BI4A 3VA3A 1C0UA 3DRRA 4C8NA 1ASUA 1VRTA 3A2FA 1NJWA 4CK2A 3KIOA 1HQEA 2D0AA 3WNFA 4CJEA 3KD1E 4CJKA 2LSNA 4BACA 1KFDA 4FLXA 1RTJA 4I2QA 3FFIA 3AVMA 4BDPA 3VQPA 1N5YA 3KLHA 2FBVA 4C8KA 4OVLA 4KB1A 3KK2A 3MXJA 3TARA 3K58A 1JKHA 1LAVA 1B9FA 4TSXA 3AO2A 3LP2A 3NF6A 3OYBA 3S3MA 3P5JA 5FRMA 4KHYA 4LH4A 4CHZA 4HUGA 1SL0A 4M45A 1IKYA 4CJ3A 3VQ6A 3VN5A 3TR8A 1VSLA 2KZMA 3ZSVA 3MXMA 4W5QA 2ETJA 3NF7A 1HYZA 3QLHA 1RBUA 4GW6A 4C8MA 3KK1A 4QAGA 3K59A 1S1XA 2Q3SA 1UA1A 2PY5A 3NF9A 1BCMA 3O3FA 2D5RA 3DLBA 3HYFA 1R0AA 4H4OA 2B5JA 4KRFA 4ICLA 4FM1A 4DQSA 1KCFA 3HP6A 2XHBA 4DMNA 2G8WA 4KI6A 3ALYA 3AO4A 4LY7A 1QSYA 4CIEA 1JLFA 1J53A 1HMVA 4FLUA 1QSSA 4JS4A 1XHXA 2VG5A 4FLZA 4J2DA 1VSMA 2I5JA 4FLWA 3AVGA 2YNFA 2G8HA 3OYJA 1DLOA 2XY8A 3V1OA 5J2QA 1TL1A 3PO5A 3RR7A 5I3UA 3LZJA 3QERA 1WSGA 4B8AB 2ITGA 2KTQA 4HTUA 3NH0A 4KO0A 4CF8A 1WSJA 3LWMA 1KFSA 4KHUA 4ELVA 1JXBA 1LV5A 4RW8A 4CEFA 5CYQA 3V4IA 4KAZA 2XO7A 2P5OA 1JXEA 2A1RA 2HHSA 2YKMA 2XY7A 1HYVA 3HO1A 2D0CA 1NK7A 1ZYQA 3DOLA 3TWHA 3U6FA 1TK8A 1LWFA 1BL3A 4FJMA 4G1QA 3VQ8A 3AVNA 4CIFA 3K2PA 1IKWA 5HRPA 3RRGA 4E1MA 2BDPA 1NJXA 4CJRA 3K57A 3NGIA 4DWIA 1ASVA 3AA2A 4M42A 3CM6A 4DTJA 4N41A 4OKKA 4FXDA 4KHNA 3O4QA 3NFAA 1GOAA 3V9WA 1T7PA 1RDCA 5DK5A 4CHPA 3NE6A 2F8SA 4FVMA 4BE2A 1J9AA 4HCBA 4DTXA 1LW0A 2HNZA 5SWMA 1TKZA 4CJQA 3SPZA 1X9MA 1TKXA 3P83D 2R7YA 2ZD1A 4M3RA 3QO9A 1DTTA 1RILA 3O3HA 4XIUA 5FROA 4CGGA 4Q5VA 2JLEA 3DOKA 4IFVA 1JLEA 4RW4A 3T1AA 3CM5A 2FC0A 3MEDA 3ZT0A 5JS2A 4HHTA 4DTMA 1SL1A 1SL2A 4OLBA 1KVCA 4NCBA 1KLMA 4OJRA 1T05A 4EZ9A 1NK0A 1ITGA 2E6MA 1WSHA 4UQGA 3AO3A 2X6NA 3M8RA 2B4JA 4ZHRA 4N56A 3HXMA 1BQNA 3LPTA 1U04A 2DFFA 1EKEA 4PWDA 1TK0A 2BGGA 3OYLA 4DTPA 1NOYA 1LWEA 1QHTA 1QS4A 3DI6A 4DTUA 5K14A 3CYMA 4Q0BA 2QK9A 4DQPA 1TKDA 2HHTA 4DF8A 3TANA 1NK8A 1YTAA 4YNQA 3CQ8A 3EYZA 2IGIA 1LAWA 2YNGA 1QSLA 4E0DA 3C6UA 3I0RA 1QE1A 4WE1A 3K5MA 3RMCA 1KRPA 4CF9A 1S1TA 1WLJA 3D45A 1RTDA 5JS1A 4FJXA 3NH2A 4DSLA 4DFKA 1REVA 3TAGA 1WSEA 3V6DA 4OLAA 4CJUA 3NCIA 1FK9A 3ISNC 4ID5A 4IG3A 4DU1A 4DFJA 3V81A 4E7LA 4GVMA 1X9SA 3ZSZA 4KI4A 1RCHA 2HHUA 3PX0A 2AJQA 1S9GA 1ZBUA 2B6AA 1EETA 3TAFA 1UA0A 2X78A 3OYDA 3S9HA 1IKXA 3DLGA 4CEZA 4Z4CA 4AH9A 3JYTA 2HNYA 3AV9A 4H4MA 1VRUA 4CF2A 4DTSA 4FLVA 2HVIA 1BCOA 2HVHA 4I2PA 3OS2A 3CG7A 2HB5A 2RKIA 4RG8A 1U48A 4DQIA 3QNOA 3QETA 1G15A 3M8QA 4CEEA 1CZ9A 2QXFA 2X6SA 4B08A 3DLRA 2F96A 4M3WA 3AVJA 2KW4A 3WNHA 4O4GA 3C95A 4O44A 3KD5E 2HHXA 3U3YA 3RTVA 3QEVA 4BWJA 4CGHA 5FDLA 3TAPA 3MXIA 4CCHA 4PQUA 4FK2A 4RW7A 1I3AA 4FZYA 1W9HA 4CK1A 2Z1JA 3ASMA 4AILC 1C1BA 5HLFA 4DQRA 1D9DA 5CY4A 4M3XA 4CJVA 2QKKA 3DYAA 1SV5A 4E89A 1TVRA 2GUIA 4OKEA 4OPKA 2HNDA 4LSNA 1A5XA 4W5RA 3VQ7A 1RDAA 3LWLA 4RW6A 3U3GA 3SV4A 4CJTA 1ZBIA 1RDDA 1JL1A 1RT4A 2RF2A 1XC9A 4AHSA 4KREA 3BDPA 3AO5A 2DTUA 1QTMA 1Z25A 3ZT4A 3HVRA 4KB0A 3CFOA 4CK3A 3PUFA 4DS5A 1FKOA 3MECA 3K5NA 3I0SA 4MFBA 1C1AA 1HRHA 3RR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O4G A;  3PY8 A;  5CZ2 A;  2WOM A;  1Q8I A;  2VG7 A;  3HST B;  1BIU A;  1LW2 A;  4NYF A;  4CF1 A;  3DMJ A;  3ZSY A;  4CHQ A;  5E41 A;  2G8K A;  3PO4 A;  3RWU A;  4KPY A;  5J1E A;  4N5S A;  4KFB A;  2ATQ A;  2QKB A;  3AVH A;  1U47 A;  4NCA A;  1NKC A;  3DM2 A;  4BE0 A;  4YFU A;  3VQC A;  1NJY A;  1S6Q A;  4B9U A;  4Z4H A;  3KLG A;  2EHG A;  3SUQ A;  2KZZ A;  3VQQ A;  4CJ4 A;  3NDK A;  5HRO A;  3KLI A;  3DLK A;  1S1U A;  3V9X A;  2EX3 A;  4J2B A;  2XY6 A;  2E6L A;  1C0M A;  2PZS A;  3OYI A;  2HHQ A;  2IS3 A;  3QIO A;  3L3V A;  3ZSO A;  4CJ5 A;  1T03 A;  3NBP A;  4HUF A;  2DFH A;  1CLQ A;  3L8B A;  1SKS A;  3OYH A;  3ZT2 A;  3OYM A;  4CJL A;  3SQ2 A;  4DSF A;  3DLH A;  4N47 A;  1RT2 A;  4RW9 A;  4OPJ A;  5EU7 A;  4DU3 A;  4KTZ A;  1TL3 A;  4FLY A;  3LAM A;  4CGI A;  4CEA A;  3HVT A;  2FBX A;  4FJI A;  1VSE A;  3V1R A;  1NK6 A;  5C25 A;  1NOZ A;  2D0B A;  1XHZ A;  1QQC A;  2PYJ A;  1EXQ A;  1CZB A;  1EX4 A;  3HP9 A;  4GMJ B;  2NUB A;  1RT3 A;  3G10 A;  4E7I A;  2Z1H A;  4AHU A;  4MQ3 A;  4CHO A;  2Y1I A;  4IFY A;  4DF4 A;  4FJG A;  3UIQ A;  1JLB A;  1WAF A;  4FJ8 A;  3KJV A;  1D9F A;  4PY5 A;  1VSI A;  4FW2 A;  4CJS A;  1U45 A;  1O1W A;  2BE2 A;  3H08 A;  3EY1 A;  4BDY A;  3OYA A;  3AVC A;  3CFR A;  1JLC A;  4DQQ A;  3OYE A;  4F4K A;  3AVA A;  2GBZ A;  3C6T A;  3NH1 A;  1X9W A;  1KVA A;  4C8O A;  4B9S A;  3L2U A;  1NKE A;  4PUO A;  2VWJ A;  4FJN A;  3HL8 A;  4DSK A;  2YHB A;  3SQ0 A;  5KRS A;  3VQD A;  3LP1 A;  1VSK A;  3ZCM A;  3OYK A;  3DRP A;  2OPP A;  1NK9 A;  1KSP A;  2OYQ A;  5D3G A;  3SUP A;  4Z0U A;  4Z4E A;  3HM9 A;  3OYF A;  3SQ1 A;  3AA4 A;  1RT7 A;  2G8V A;  3OYN A;  3THV A;  1VSJ A;  1BIZ A;  1K6Y A;  4EZ6 A;  3PX6 A;  4I7F A;  1HYS A;  2XY5 A;  1L3T A;  1UOC A;  3O4N A;  4FW1 A;  1RT1 A;  4M3Z A;  1EP4 A;  4FJL A;  2VG6 A;  5KRT A;  4CER A;  4IDK A;  4O0J A;  4J2A A;  4HUE A;  5I42 A;  4CGF A;  4CJF A;  4CHY A;  3QIN A;  5J2M A;  1C1C A;  1WN7 A;  4HVJ A;  4DLE A;  1BIS A;  5HP1 A;  2OZM A;  3ZT1 A;  4ELU A;  4W5N A;  3VQA A;  3KLF A;  3EZ5 A;  2JGU A;  1S5J A;  3V9Z A;  3TAM A;  1ZBL A;  4B9M A;  3IS9 A;  5C42 A;  3IG1 A;  3SNN A;  2KFZ A;  1F21 A;  3LP0 A;  3AVF A;  4JS5 A;  1D8Y A;  3AO1 A;  1J5O A;  5DMR A;  3V9S A;  4AHT A;  3KKR A;  1A5W A;  3ULD A;  3LAK A;  2HHV A;  1WNS A;  3I8D A;  4K8Z A;  1S6P A;  5CYM A;  2YNH A;  4DU4 A;  1RT5 A;  3P1G A;  4NCG A;  3VA0 A;  1I39 A;  3OVN A;  4ELT A;  1NK5 A;  5FRN A;  4I9L A;  4LSL A;  3L2W A;  1GOB A;  3TAE A;  1U49 A;  4FK4 A;  2DFE A;  2RPI A;  3DRS A;  4F2S A;  3T3F A;  4FM0 A;  2GV9 A;  3SUN A;  3SJJ A;  2BAN A;  1FXX A;  3LPU A;  2YV0 X;  2IC3 A;  4OGE A;  3C94 A;  2Z1G A;  2Z1I A;  3TI0 A;  4QOZ B;  4JRP A;  3KKS A;  3HK2 A;  4E1N A;  4DG1 A;  3SI6 A;  4M3T A;  3SUO A;  1N6Q A;  4J2E A;  3T19 A;  1RTH A;  2IAJ A;  3MAQ A;  1X1P A;  1RT6 A;  3RMB A;  4W5O A;  3M8S A;  1KLN A;  1ZBH A;  2ZQB A;  3LZI A;  3SPY A;  1U4B A;  3QEW A;  4BDZ A;  4Z4I A;  4KV8 A;  4LH5 A;  4B9V A;  1TAU A;  2WON A;  4KKO A;  1NKB A;  2VWK A;  3PX4 A;  4KTQ A;  2DY4 A;  2P1J A;  2IDO A;  4E3S A;  2HMI A;  3SZ2 A;  2G8U A;  2YNI A;  4Y1D A;  4B8C A;  3ZT3 A;  4CEC A;  4KHW A;  1XI1 A;  1D5A A;  3AVL A;  4B3O A;  2ZE2 A;  2G8F A;  2O4I A;  1TGO A;  1NJZ A;  1W0H A;  4CFB A;  1Q9X A;  4M3Y A;  3SV3 A;  1JLQ A;  4FJ9 A;  1BHL A;  3LAN A;  4CHN A;  4M41 A;  4ZTF A;  4CGD A;  1S1W A;  3LAL A;  1CXU A;  1S9E A;  4E19 A;  1WSI A;  5KGW A;  1FKP A;  3QNN A;  1UAX A;  3TAB A;  4QCL A;  4FJJ A;  4OKJ A;  1RNH A;  4BE1 A;  4EP4 A;  4CED A;  3M8P A;  4M3U A;  3RMA A;  3DLE A;  4O55 A;  4N76 A;  2P51 A;  1CXQ A;  1L5U A;  1RTI A;  2OPS A;  3QIP A;  3NGZ A;  4DTN A;  4CJP A;  1JL2 A;  4DSE A;  3BGR A;  3AVB A;  1A5V A;  3K5O A;  3F9K A;  4IBN A;  4CEB A;  3KLE A;  3SYZ A;  3ZSX A;  3AA5 X;  4IG0 A;  3NHG A;  1IKV A;  1RBV A;  4F8R A;  4I9Q A;  2KFN A;  3VQ5 A;  3TAQ A;  4DTR A;  4CF0 A;  1TAQ A;  2RN2 A;  4F3T A;  3ZSQ A;  4H8K A;  1HNI A;  1SUQ A;  1RBR A;  4O5B A;  4AHC A;  4LD0 A;  4AHV A;  2G8I A;  1TK5 A;  1L3V A;  2FBT A;  4FZZ A;  5C24 A;  1RBT A;  3L3U A;  2P5G A;  4DSI A;  4CJW A;  3L2V A;  3OYC A;  4FM2 A;  3OS0 A;  5HRN A;  3VQ9 A;  3SCX A;  3O3G A;  2YHA A;  4CFA A;  3B6P A;  4DLG A;  3RMD A;  4FLT A;  1SKW A;  2W42 A;  1RDB A;  3L2R A;  3JSM A;  2F8T A;  1T8E A;  2OA8 A;  5KI6 A;  4CES A;  4O0I A;  4ZTJ A;  4FZX C;  1WSF A;  3F73 A;  3QEP A;  3RRH A;  4K8X A;  4B9L A;  4CGJ A;  1HQU A;  3ZSR A;  4NYN A;  4R5P A;  1S1V A;  3KK3 A;  3D0P A;  4B9T A;  5T7B A;  1YVU A;  1RBS A;  3HJF A;  1Z26 A;  3G0Z A;  1JLA A;  3NGY A;  1ASW A;  4PA1 A;  4KHQ A;  4CFC A;  4EP5 A;  4DFP A;  3ITH A;  3KTQ A;  4W5T A;  4ID1 A;  1IH7 A;  3HPO A;  1MU2 A;  2A1S A;  3V9U A;  3MEE A;  1Y97 A;  3LDS A;  4L8R B;  1ZBF A;  2KQ2 A;  4FJK A;  1TV6 A;  4CFD A;  1XWL A;  4CEQ A;  4IKF A;  5KGX A;  5HRR A;  1J54 A;  3OS1 A;  4B9N A;  1HJR A;  1NK4 A;  3V1Q A;  4E7J A;  1VSF A;  4FCY A;  4CEO A;  5SZT A;  1SKR A;  2OPQ A;  3OJS A;  3S3N A;  4CIG A;  4HCC A;  1B9D A;  1VSH A;  2IOC A;  1TKT A;  4Y1C A;  3CFP A;  3QEX A;  4FYD A;  3HPH A;  3OY9 A;  1KTQ A;  4KTW A;  3NF8 A;  4OGC A;  4FJH A;  4AHR A;  4BWM A;  4CE9 A;  3OJU A;  3WNG A;  1JLG A;  1BQM A;  4FK0 A;  1VK0 A;  3AA3 A;  2PYL A;  2HHW A;  1L3U A;  3HT3 A;  4DTO A;  1WAJ A;  3QEI A;  2OZS A;  1HPZ A;  3QES A;  5J2N A;  2OPR A;  5HRS A;  4E7K A;  2Y1J A;  1BGX T;  2YKN A;  3VQ4 A;  1B92 A;  3OYG A;  5J2P A;  1IG9 A;  4FJ7 A;  1YTU A;  3L2Q A;  5HBM A;  3ZSW A;  1YT3 A;  3LP3 A;  1UWB A;  3VQE A;  3S3O A;  2E4L A;  2X74 A;  5KTQ A;  4KHS A;  1C0T A;  2XRI A;  4C8L A;  3E01 A;  3K5L A;  1L3S A;  1VSD A;  3VQB A;  4JRQ A;  1BI4 B;  3AVK A;  4FJ5 A;  1DTQ A;  3NAE A;  3IRX A;  4DFM A;  5CZ1 A;  1IO2 A;  1LWC A;  1C6V A;  4DSJ A;  4Z4F A;  3HPG A;  1GOC A;  4Z4G A;  3SQ4 A;  1KVB A;  2FBY A;  3IAY A;  2HW3 A;  3PV8 A;  3AVI A;  3MEG A;  1Q9Y A;  3WNE A;  4E7H A;  4F2R A;  3B6O A;  4F3O A;  1HNV A;  4JLH A;  4DS4 A;  1BI4 A;  3VA3 A;  1C0U A;  3DRR A;  4C8N A;  1ASU A;  1VRT A;  3A2F A;  1NJW A;  4CK2 A;  3KIO A;  1HQE A;  2D0A A;  3WNF A;  4CJE A;  3KD1 E;  4CJK A;  2LSN A;  4BAC A;  1KFD A;  4FLX A;  1RTJ A;  4I2Q A;  3FFI A;  3AVM A;  4BDP A;  3VQP A;  1N5Y A;  3KLH A;  2FBV A;  4C8K A;  4OVL A;  4KB1 A;  3KK2 A;  3MXJ A;  3TAR A;  3K58 A;  1JKH A;  1LAV A;  1B9F A;  4TSX A;  3AO2 A;  3LP2 A;  3NF6 A;  3OYB A;  3S3M A;  3P5J A;  5FRM A;  4KHY A;  4LH4 A;  4CHZ A;  4HUG A;  1SL0 A;  4M45 A;  1IKY A;  4CJ3 A;  3VQ6 A;  3VN5 A;  3TR8 A;  1VSL A;  2KZM A;  3ZSV A;  3MXM A;  4W5Q A;  2ETJ A;  3NF7 A;  1HYZ A;  3QLH A;  1RBU A;  4GW6 A;  4C8M A;  3KK1 A;  4QAG A;  3K59 A;  1S1X A;  2Q3S A;  1UA1 A;  2PY5 A;  3NF9 A;  1BCM A;  3O3F A;  2D5R A;  3DLB A;  3HYF A;  1R0A A;  4H4O A;  2B5J A;  4KRF A;  4ICL A;  4FM1 A;  4DQS A;  1KCF A;  3HP6 A;  2XHB A;  4DMN A;  2G8W A;  4KI6 A;  3ALY A;  3AO4 A;  4LY7 A;  1QSY A;  4CIE A;  1JLF A;  1J53 A;  1HMV A;  4FLU A;  1QSS A;  4JS4 A;  1XHX A;  2VG5 A;  4FLZ A;  4J2D A;  1VSM A;  2I5J A;  4FLW A;  3AVG A;  2YNF A;  2G8H A;  3OYJ A;  1DLO A;  2XY8 A;  3V1O A;  5J2Q A;  1TL1 A;  3PO5 A;  3RR7 A;  5I3U A;  3LZJ A;  3QER A;  1WSG A;  4B8A B;  2ITG A;  2KTQ A;  4HTU A;  3NH0 A;  4KO0 A;  4CF8 A;  1WSJ A;  3LWM A;  1KFS A;  4KHU A;  4ELV A;  1JXB A;  1LV5 A;  4RW8 A;  4CEF A;  5CYQ A;  3V4I A;  4KAZ A;  2XO7 A;  2P5O A;  1JXE A;  2A1R A;  2HHS A;  2YKM A;  2XY7 A;  1HYV A;  3HO1 A;  2D0C A;  1NK7 A;  1ZYQ A;  3DOL A;  3TWH A;  3U6F A;  1TK8 A;  1LWF A;  1BL3 A;  4FJM A;  4G1Q A;  3VQ8 A;  3AVN A;  4CIF A;  3K2P A;  1IKW A;  5HRP A;  3RRG A;  4E1M A;  2BDP A;  1NJX A;  4CJR A;  3K57 A;  3NGI A;  4DWI A;  1ASV A;  3AA2 A;  4M42 A;  3CM6 A;  4DTJ A;  4N41 A;  4OKK A;  4FXD A;  4KHN A;  3O4Q A;  3NFA A;  1GOA A;  3V9W A;  1T7P A;  1RDC A;  5DK5 A;  4CHP A;  3NE6 A;  2F8S A;  4FVM A;  4BE2 A;  1J9A A;  4HCB A;  4DTX A;  1LW0 A;  2HNZ A;  5SWM A;  1TKZ A;  4CJQ A;  3SPZ A;  1X9M A;  1TKX A;  3P83 D;  2R7Y A;  2ZD1 A;  4M3R A;  3QO9 A;  1DTT A;  1RIL A;  3O3H A;  4XIU A;  5FRO A;  4CGG A;  4Q5V A;  2JLE A;  3DOK A;  4IFV A;  1JLE A;  4RW4 A;  3T1A A;  3CM5 A;  2FC0 A;  3MED A;  3ZT0 A;  5JS2 A;  4HHT A;  4DTM A;  1SL1 A;  1SL2 A;  4OLB A;  1KVC A;  4NCB A;  1KLM A;  4OJR A;  1T05 A;  4EZ9 A;  1NK0 A;  1ITG A;  2E6M A;  1WSH A;  4UQG A;  3AO3 A;  2X6N A;  3M8R A;  2B4J A;  4ZHR A;  4N56 A;  3HXM A;  1BQN A;  3LPT A;  1U04 A;  2DFF A;  1EKE A;  4PWD A;  1TK0 A;  2BGG A;  3OYL A;  4DTP A;  1NOY A;  1LWE A;  1QHT A;  1QS4 A;  3DI6 A;  4DTU A;  5K14 A;  3CYM A;  4Q0B A;  2QK9 A;  4DQP A;  1TKD A;  2HHT A;  4DF8 A;  3TAN A;  1NK8 A;  1YTA A;  4YNQ A;  3CQ8 A;  3EYZ A;  2IGI A;  1LAW A;  2YNG A;  1QSL A;  4E0D A;  3C6U A;  3I0R A;  1QE1 A;  4WE1 A;  3K5M A;  3RMC A;  1KRP A;  4CF9 A;  1S1T A;  1WLJ A;  3D45 A;  1RTD A;  5JS1 A;  4FJX A;  3NH2 A;  4DSL A;  4DFK A;  1REV A;  3TAG A;  1WSE A;  3V6D A;  4OLA A;  4CJU A;  3NCI A;  1FK9 A;  3ISN C;  4ID5 A;  4IG3 A;  4DU1 A;  4DFJ A;  3V81 A;  4E7L A;  4GVM A;  1X9S A;  3ZSZ A;  4KI4 A;  1RCH A;  2HHU A;  3PX0 A;  2AJQ A;  1S9G A;  1ZBU A;  2B6A A;  1EET A;  3TAF A;  1UA0 A;  2X78 A;  3OYD A;  3S9H A;  1IKX A;  3DLG A;  4CEZ A;  4Z4C A;  4AH9 A;  3JYT A;  2HNY A;  3AV9 A;  4H4M A;  1VRU A;  4CF2 A;  4DTS A;  4FLV A;  2HVI A;  1BCO A;  2HVH A;  4I2P A;  3OS2 A;  3CG7 A;  2HB5 A;  2RKI A;  4RG8 A;  1U48 A;  4DQI A;  3QNO A;  3QET A;  1G15 A;  3M8Q A;  4CEE A;  1CZ9 A;  2QXF A;  2X6S A;  4B08 A;  3DLR A;  2F96 A;  4M3W A;  3AVJ A;  2KW4 A;  3WNH A;  4O4G A;  3C95 A;  4O44 A;  3KD5 E;  2HHX A;  3U3Y A;  3RTV A;  3QEV A;  4BWJ A;  4CGH A;  5FDL A;  3TAP A;  3MXI A;  4CCH A;  4PQU A;  4FK2 A;  4RW7 A;  1I3A A;  4FZY A;  1W9H A;  4CK1 A;  2Z1J A;  3ASM A;  4AIL C;  1C1B A;  5HLF A;  4DQR A;  1D9D A;  5CY4 A;  4M3X A;  4CJV A;  2QKK A;  3DYA A;  1SV5 A;  4E89 A;  1TVR A;  2GUI A;  4OKE A;  4OPK A;  2HND A;  4LSN A;  1A5X A;  4W5R A;  3VQ7 A;  1RDA A;  3LWL A;  4RW6 A;  3U3G A;  3SV4 A;  4CJT A;  1ZBI A;  1RDD A;  1JL1 A;  1RT4 A;  2RF2 A;  1XC9 A;  4AHS A;  4KRE A;  3BDP A;  3AO5 A;  2DTU A;  1QTM A;  1Z25 A;  3ZT4 A;  3HVR A;  4KB0 A;  3CFO A;  4CK3 A;  3PUF A;  4DS5 A;  1FKO A;  3MEC A;  3K5N A;  3I0S A;  4MFB A;  1C1A A;  1HRH A;  3RR8 A; 
#chains in the Genus database with same CATH topology
 3HST B;  2VG7 A;  5E41 A;  5J1E A;  3IMX A;  3AVH A;  2FLO A;  2VGM A;  3DM2 A;  1S6Q A;  3VEZ A;  4Z4H A;  2IVP A;  3SUQ A;  4JKD A;  4CJ4 A;  1MA9 B;  3NDK A;  3CJ1 A;  4J2B A;  4CJ5 A;  4IEI A;  3NBP A;  2DFH A;  1SKS A;  3U4L A;  3OYM A;  3SQ2 A;  4N47 A;  2YHY A;  4OPJ A;  5EU7 A;  3TPQ A;  3HVT A;  4WQ4 C;  3V1R A;  1GLD G;  3SAH A;  1T3V A;  2D0B A;  4I6M A;  4BRL A;  3HP9 A;  2E5L K;  3F5T A;  2E2Q A;  4BR4 A;  3M1F A;  3I55 N;  5BPL A;  4H5V A;  1JLB A;  3UE5 A;  4FW2 A;  3O9T A;  3EY1 A;  3V81 A;  3AAP A;  5AQQ A;  3CFR A;  4DQQ A;  3EEQ A;  3OYE A;  4YHH K;  1X9W A;  4XH5 A;  4BRH A;  4JKC A;  2YHB A;  4JKA A;  1VSK A;  5D3G A;  4DV4 K;  3OYF A;  3AA4 A;  1VSJ A;  4A57 A;  4GKK K;  5JVH L;  4QS7 A;  1UOC A;  1RT1 A;  4M3Z A;  2YI1 A;  1VQ6 N;  1EP4 A;  4FJL A;  5KRT A;  4FWN A;  3O4W A;  4O0J A;  1KAY A;  4IXC A;  4MO4 A;  4CHY A;  3QIN A;  5J2M A;  3GL1 A;  3BP8 A;  2HMP A;  4HVJ A;  1BIS A;  4W5N A;  4JI3 K;  3MK6 A;  4B9Q A;  3EZ5 A;  4WFA L;  2P9P B;  1ZBL A;  2QWM A;  5AQP A;  4FOI A;  4ISE A;  3IG1 A;  3GBT A;  4U67 L;  1F21 A;  3LP0 A;  3AO1 A;  1V4S A;  3J8A A;  2P9P A;  2GX9 A;  2HF4 A;  3CCJ N;  3D2E B;  1WNS A;  3I8D A;  1S6P A;  4O5F A;  3JAM O;  3CF5 L;  1YIJ N;  5ELZ A;  3VA0 A;  3SMP A;  4PL7 A;  4DV3 K;  4FK4 A;  4F2S A;  4AM6 A;  3D2E A;  1CZA N;  4NO7 A;  4AM7 A;  3C0B A;  2YV0 X;  1BA0 A;  4JRP A;  3KKS A;  3HK2 A;  5AJ3 K;  1N6Q A;  1HKB A;  2ZJQ L;  1KLN A;  3J81 O;  1EQY A;  2ZJR L;  4U7B A;  4BDZ A;  1YI2 N;  4CZF A;  3MN7 A;  1TAU A;  2WON A;  3GDQ A;  2DY4 A;  2IDO A;  3SZ2 A;  3AGR A;  3SK3 A;  1E3M A;  3AVL A;  2O4I A;  1TGO A;  4GY2 B;  3R8E A;  4PHT X;  3SV3 A;  1JLQ A;  3LAN A;  4M41 A;  2HST A;  4ZTF A;  2HBJ A;  1FKP A;  3TAB A;  4QCL A;  2GEL A;  3R9P A;  3P4I A;  3DLE A;  4O55 A;  2HBL A;  2P9I B;  1JL2 A;  4H0T B;  4DSE A;  1C0F A;  3K5O A;  1T44 A;  3SYZ A;  5ADX H;  3HBT A;  3MCA B;  5FPD A;  1RBV A;  2KFN A;  3VQ5 A;  1QQO A;  4DTR A;  4CF0 A;  2O8F B;  1TAQ A;  3G25 A;  2RN2 A;  1ATN A;  3ZSQ A;  5BR8 K;  3G71 N;  1L3V A;  5KQD A;  1RBT A;  4DSI A;  3OYC A;  3OS0 A;  5HRN A;  2YJF A;  2O8F A;  4LF7 K;  3O3G A;  3B6P A;  4FLT A;  3BF1 A;  1DEJ A;  1M1K O;  5KI6 A;  3O1B A;  4ZTJ A;  4IOX A;  2P9L B;  4CGJ A;  3TTF A;  3M3Z A;  1YVU A;  1RBS A;  4IZ9 A;  4CFC A;  4EP5 A;  4DR1 K;  3HOT A;  3ITH A;  2P9L A;  4ID1 A;  3HPO A;  3V9U A;  3ZX2 A;  4L8R B;  1ZBF A;  2QWQ A;  3B8A X;  4CFD A;  4CEQ A;  3OS1 A;  3Q7C A;  4H5R A;  1SKR A;  5HL7 L;  2OPQ A;  3S3N A;  1VQ7 N;  1VSH A;  1MDU B;  4JNE A;  3HPH A;  3OY9 A;  1KTQ A;  4JI7 K;  4OGC A;  4FJH A;  3AA3 A;  2HHW A;  3A5M C;  1L3U A;  2OZS A;  1HPZ A;  3LL3 A;  2W6K A;  5HRS A;  1K9M O;  1FJG K;  1VQ8 N;  2YKN A;  1OVQ A;  4JI5 K;  1YT3 A;  3LP3 A;  5BPM A;  4IFE A;  3S3O A;  4KHS A;  4YOX A;  1W7A A;  2CH6 A;  3LM9 A;  1DTQ A;  5CZ1 A;  1IO2 A;  3M6G A;  4Z4G A;  2HW3 A;  3IAY A;  1KVB A;  3O9R A;  3WNE A;  5JVG L;  1KQS M;  2P9S B;  1C0U A;  1VRT A;  3S41 A;  5LMU K;  4B1Y B;  4A62 A;  4CJE A;  3EZW A;  2OAN A;  4RCH A;  1NWK A;  2P9S A;  4FPA A;  3VQP A;  2E1Z A;  3CI5 A;  1JKH A;  3AO2 A;  3NF6 A;  4X64 K;  3S3M A;  5FRM A;  3HOS A;  4KHY A;  4M45 A;  4CJ3 A;  4NB4 A;  4B3R K;  2KZM A;  3ZSV A;  3QLH A;  4Z4E A;  1HYZ A;  3R3L A;  3O9U A;  4QAG A;  3KK1 A;  3DWL A;  3O3F A;  1VQ4 N;  3FZM A;  3HYF A;  4DV0 K;  1R0A A;  4CZG A;  4ICL A;  4FWQ A;  1KCF A;  4BC3 A;  3T69 A;  3ALY A;  3R1X A;  4CIE A;  1JLF A;  1HMV A;  3VES A;  4JI4 K;  4J2D A;  1NU0 A;  1OH6 A;  1VSM A;  4FLW A;  3BZK A;  3CJ9 A;  3VF2 A;  3PO5 A;  1WSG A;  4CVN E;  4MDA A;  5AQG A;  3NH0 A;  5H1S Q;  3LWM A;  1LV5 A;  4BRN A;  2XO7 A;  1JXE A;  2A1R A;  2YKM A;  3HO1 A;  1NK7 A;  3DOL A;  1TK8 A;  1LWF A;  3VQ8 A;  4CIF A;  1BO5 O;  2YX6 A;  3RRG A;  1QZ6 A;  3K57 A;  3NGI A;  1ASV A;  3AA2 A;  2QWO A;  3NVK A;  4M42 A;  4DTJ A;  5E84 A;  4KHN A;  1T7P A;  4GKJ K;  4CI6 A;  2F8S A;  4FVM A;  2HNZ A;  4X65 K;  3SPZ A;  1X9M A;  2HBK A;  3L6Q A;  1DTT A;  5FRO A;  1SZ2 A;  4Q5V A;  1JLE A;  5JLH A;  4HHT A;  1SL1 A;  1KVC A;  2V7Z A;  1KLM A;  4BR9 A;  1ITG A;  1DKG D;  1VQK N;  2X6N A;  4N56 A;  4DV1 K;  3HXM A;  4BC4 A;  5AQT A;  1EKE A;  1OKJ A;  4PWD A;  1U2V B;  5M1Q A;  4BRI A;  1QHT A;  2Q31 A;  3CYM A;  2BUP A;  4DF8 A;  3TAN A;  1U2V A;  1VQ9 N;  5AQM A;  1QSL A;  3C6U A;  1QE1 A;  4WE1 A;  3RMC A;  3D45 A;  3O9Q A;  5EX5 A;  2O8C B;  3A8Y A;  1Q18 A;  4FJX A;  4ID5 A;  4DFJ A;  4ILG B;  3E9P A;  1X9S A;  3VEX A;  1NLV A;  4GVM A;  4E7L A;  2AJQ A;  1RCH A;  3PX0 A;  3D2F B;  1S9G A;  1ZBU A;  1VQM N;  3RSE B;  3ENO A;  4K25 A;  2O8C A;  2A41 A;  4H5N A;  4AH9 A;  2YJE A;  5JLF A;  1TYQ A;  1VQ5 N;  5AQW A;  2GUP A;  1BCO A;  3ZEU B;  2HB5 A;  2RKI A;  3RSE A;  1U48 A;  2FXU A;  4DQI A;  3QET A;  1G15 A;  3MMV A;  4B08 A;  5C2D A;  1GLE G;  2HHX A;  3C95 A;  3EKS A;  3QEV A;  3TAP A;  1IG8 A;  2P9K B;  1C1B A;  1HNZ K;  4CJV A;  3IUC A;  2QKK A;  2GUI A;  4OKE A;  2HND A;  4LSN A;  2P9K A;  3U3G A;  1FW6 A;  5AQL A;  5MLC Q;  2FF3 B;  1HNX K;  1RT4 A;  1XC9 A;  5E26 A;  4KRE A;  3BDP A;  2DTU A;  1QTM A;  1Z25 A;  4PKH A;  3CFO A;  4CK3 A;  3PUF A;  3SAG A;  4FO0 A;  3MEC A;  4MFB A;  1C1A A;  1HRH A;  1WUA A;  1BIU A;  1LW2 A;  1K73 O;  3PO4 A;  3RWU A;  4MDB A;  2PFU A;  4LFB K;  1T6D A;  1NGE A;  3WEE A;  4YFU A;  4IJN A;  1IV0 A;  4O8K A;  4BRF A;  3VEN A;  3VQQ A;  4BQZ A;  5BRD A;  3KLI A;  3DLK A;  4FVU A;  3OYI A;  1K8K B;  3L3V A;  1T03 A;  3SMS A;  4HUF A;  3L8B A;  3ZT2 A;  3LDP A;  3EL2 A;  1TL3 A;  3ZX0 A;  3LAM A;  4CGI A;  4CEA A;  2FBX A;  2UUB K;  1K8K A;  3H1Q A;  1NK6 A;  5C25 A;  1NOZ A;  3A0I X;  1XHZ A;  1QQC A;  3CHW A;  5AZI B;  4HWI A;  1CZB A;  1EX4 A;  4V19 S;  3VET A;  4R79 A;  2NUB A;  1MWK A;  4E7I A;  1U6Z A;  2QWL A;  4CHO A;  4JD2 B;  5IWA K;  1WAF A;  5AZI A;  3LDL A;  1TUU A;  1VSI A;  3C6A A;  4CJS A;  5F0X A;  1NJI O;  1U45 A;  1NK9 A;  3OYA A;  1JLC A;  3UB5 A;  3THX B;  3AVA A;  3C6T A;  3NH1 A;  4C8O A;  4JD2 A;  1XQS C;  4DV2 K;  3DXM B;  1NKE A;  4PUO A;  4FJN A;  4DSK A;  4AQY K;  3T1Y K;  1H1V A;  1HKC A;  2OYQ A;  2OPP A;  3HM9 A;  2NRV A;  3THX A;  1RT7 A;  2G8V A;  3DXM A;  3WQT A;  1XMQ K;  1BIZ A;  1K6Y A;  5GIO A;  5M1O A;  3VTI A;  1L3T A;  4YOV A;  4FW1 A;  5AFU A;  1IBL K;  2ITM A;  3MX5 A;  4A2B A;  5F1X A;  4IDK A;  4HUE A;  4CGF A;  4CJF A;  3H46 O;  1C1C A;  1WN7 A;  4BR7 A;  4DLE A;  4ELU A;  3ZT1 A;  3TAM A;  3QML A;  4FWP A;  1Q81 O;  3SNN A;  2UXB K;  4LC9 B;  4B1Z A;  1J5O A;  5DMR A;  3ULD A;  5EXW A;  3LAK A;  5CYM A;  4DU4 A;  3U9Z A;  1Q82 O;  3P1G A;  4JAX A;  1I39 A;  1NK5 A;  5FRN A;  4I9L A;  3L2W A;  1GOB A;  1M90 O;  3DRS A;  2RPI A;  2V51 B;  4YOR A;  3SUN A;  3ZET A;  3RVC A;  1FXX A;  5C12 A;  3QFP A;  4JKG B;  4OGE A;  2Z1G A;  3TI0 A;  4UY8 O;  3FZL A;  4A5A A;  3SUO A;  2IAJ A;  1RT6 A;  2D0P A;  4W5O A;  1ZBH A;  3LZI A;  4JKG A;  1VQL N;  4LH5 A;  1O13 A;  3UKU A;  4KKO A;  1NKB A;  2VWK A;  4KTQ A;  2P1J A;  4B8C A;  4CEC A;  3ZX3 A;  2ZE2 A;  5M1F A;  1NJZ A;  5FPE A;  4IWV A;  3CME N;  2W40 A;  3LAL A;  4E19 A;  1WSI A;  1X3N A;  5KGW A;  3QNN A;  4FJJ A;  4BE1 A;  1K8A O;  3HSC A;  4EP4 A;  1KD1 O;  3J7Y P;  4I6M B;  3PSI A;  3NGZ A;  4CJP A;  1DT9 A;  3BGR A;  4ISG A;  3ULE A;  3F9K A;  2DPN A;  3BY5 A;  4IG0 A;  4JI1 K;  4F8R A;  2WUS A;  4F3T A;  1SUQ A;  1RBR A;  1EWR A;  2GWK A;  4JEP A;  4DR6 K;  2FBT A;  4CJW A;  3L2V A;  2KLA A;  4GV3 A;  1V4T A;  4DLG A;  1SKW A;  5CE3 A;  2W42 A;  3L4Q A;  2F8T A;  1T8E A;  3ZYY X;  4FZX C;  1WSF A;  3F73 A;  3M5R A;  3ZSR A;  1HX1 A;  1S1V A;  3D0P A;  2GTD A;  2P9U B;  3A5O C;  1N8R O;  4EHU A;  1MU2 A;  2A1S A;  4BRA A;  2FSK A;  3MEE A;  4DB3 A;  2P9U A;  4LFC K;  1TV6 A;  1XWL A;  5KGX A;  2VYP A;  1J54 A;  5HRR A;  3VPZ A;  1NK4 A;  4CEO A;  5SZT A;  3NMU A;  4CIG A;  1B9D A;  4Y1C A;  2IOC A;  4FYD A;  2E2P A;  1X9J A;  4GNI A;  3EO3 A;  3OJU A;  4IOC L;  4FK0 A;  1BQM A;  1VK0 A;  4NLB A;  1JCG A;  1ILY A;  5JIC A;  4FJ7 A;  3L2Q A;  3Q7B A;  2X74 A;  1C0T A;  3E01 A;  1L3S A;  3FR0 A;  3NAE A;  4Z4F A;  4DSJ A;  4MLH A;  3HPG A;  3PLA A;  3AVI A;  3MEG A;  2UU9 K;  3B6O A;  3VA3 A;  4KH4 A;  1NJW A;  3A2F A;  3WNF A;  4BAC A;  4JV5 K;  5AQO A;  3KLH A;  2FBV A;  2NRX A;  3KK2 A;  1HKG A;  4DR2 K;  3TAR A;  4TSX A;  1B9F A;  3BUZ B;  3OYB A;  3P5J A;  4CHZ A;  3UKR B;  4DHY A;  3TR8 A;  1VSL A;  2F9W A;  4GW6 A;  3N4Q A;  1NGD A;  1UA1 A;  1BCM A;  3TTC A;  2D5R A;  2KKZ A;  4H4O A;  2B5J A;  3LDQ A;  3UKR A;  1S72 N;  2VCP A;  2G8W A;  3CJ7 A;  3ENH A;  3F9M A;  3AO4 A;  3J7Z O;  1QSY A;  4FSV A;  3H1V X;  4JS4 A;  4K0K K;  2YNF A;  2G8H A;  5J2Q A;  3RR7 A;  3LZJ A;  4JKB A;  4KO0 A;  1KFS A;  4WQ5 A;  4KAZ A;  5CYQ A;  3V4I A;  5LL6 Z;  3MWT A;  2P5O A;  2HHS A;  3D6R A;  4CZI A;  2AA4 A;  3TWH A;  1BL3 A;  2UXD K;  3WXK A;  3HTV A;  2BDP A;  4BG9 A;  4CZK A;  1GLC G;  3NE6 A;  4BE2 A;  1J9A A;  4HCB A;  4YOU A;  1NGC A;  4CJQ A;  2UXC K;  1WOQ A;  3T1A A;  2FC0 A;  4OLB A;  1NGI A;  1SL2 A;  4JKF A;  5AQI A;  4CZM A;  4OJR A;  3ZLJ A;  1Z6R A;  3AO3 A;  4JKE A;  1YHQ N;  1BQN A;  1BUP A;  4CZJ A;  4DTP A;  5F2R A;  1NOY A;  3CC2 N;  1R59 O;  3TSQ A;  5GIN A;  4Q0B A;  2E2O A;  3CCV N;  4DV5 K;  2HHT A;  5AR0 A;  5AQY A;  3CQ8 A;  2IGI A;  3GE1 A;  1LAW A;  4E0D A;  3I0R A;  2WBN A;  1KRP A;  1S1T A;  1WLJ A;  2A40 A;  1RTD A;  5JS1 A;  1ZXO A;  3NH2 A;  4DSL A;  4A59 A;  1REV A;  2E2N A;  3FE1 A;  3VEV A;  3MN6 A;  5GIP A;  2BTF A;  1VHX A;  4M7X A;  3IKM A;  2Q97 A;  1N32 K;  3AGK A;  1SAZ A;  3OHR A;  2B6A A;  2YCH A;  1EET A;  4YOY A;  4CEZ A;  1OH7 A;  1KC8 O;  3U9D A;  2ZGY A;  4H4M A;  4DTS A;  4FLV A;  3OS2 A;  3QNO A;  4BVO A;  5FLX O;  2F7T A;  2NRW A;  4Z94 A;  2D4W A;  2X6S A;  5CR4 A;  2ZM6 K;  3CER A;  3U3Y A;  4PKG A;  1BA1 A;  3MXI A;  3OA9 A;  4CCH A;  4FK2 A;  4K43 A;  1I3A A;  3IDH A;  1W9H A;  2Z1J A;  4AIL C;  3FZK A;  4DQR A;  1LCU A;  5CY4 A;  3H45 C;  3EKU A;  2I7N A;  2Q0U A;  2FSN A;  2D0O A;  4W5R A;  1YAG A;  3VQ7 A;  1RDA A;  3K9K A;  5LY3 A;  3FGU A;  2H3G X;  2HHH K;  1RDD A;  1VQN N;  2F9T A;  3HVR A;  3VOV A;  3K5N A;  5DM7 L;  1TUY A;  3PY8 A;  5CZ2 A;  1Q8I A;  4NYF A;  3G6E N;  3MN5 A;  1YJ9 N;  4KPY A;  2ATQ A;  3PIP L;  1U47 A;  3QIC A;  1NKC A;  3CCL N;  3MX2 A;  5CHI A;  1YJN N;  2CGK A;  1NJY A;  4B9U A;  2E88 A;  2EHG A;  2UYT A;  2KZZ A;  3G4S N;  5HRO A;  1S1U A;  4H0V B;  2XY6 A;  2PZS A;  1C0M A;  2ZWH A;  2IS3 A;  4CBX A;  3WQU A;  1CLQ A;  4BG8 A;  3OYH A;  4CJL A;  4DSF A;  5AZJ A;  3DLH A;  3TTD A;  1RT2 A;  4KTZ A;  3VMF B;  3THY A;  3CCS N;  5FPM A;  4FJI A;  1VSE A;  3J7A P;  4CD1 A;  4B3S K;  2PYJ A;  4CJ7 A;  2IVO A;  4JHD B;  3VEO A;  3G10 A;  3MWP A;  4WF9 L;  3QFU A;  5AQU A;  2Y1I A;  3EE8 A;  4IFY A;  4FJG A;  4FJ8 A;  3UIQ A;  3L0Q A;  1D9F A;  4PY5 A;  4JHD A;  2P5G A;  3H08 A;  3QB0 A;  4F4K A;  2GBZ A;  5EY4 A;  2D1K A;  2VWJ A;  3HL8 A;  3THW A;  3LP1 A;  3ZCM A;  3OYK A;  4FWL A;  3EE9 A;  1KSP A;  3SUP A;  4Z0U A;  4KBO A;  2JWL A;  5LJW A;  3DLL L;  3R6M A;  3A5N C;  3T7Z A;  4EHT A;  1NG9 A;  3OYN A;  4ILJ A;  3THV A;  4BC2 A;  4I7F A;  1N33 K;  1BWF O;  3C6H A;  4H0P A;  2VG6 A;  4CER A;  4H03 B;  1TYQ B;  4DR7 K;  5I42 A;  3SBT A;  4JK9 A;  1I94 K;  2ZJP L;  1HJO A;  3CCQ N;  2OZM A;  3W3D A;  2HBM A;  4E1J A;  2JGU A;  1S5J A;  4JI6 K;  1QVG M;  2RHK A;  1NGF A;  4B1W B;  5C42 A;  2KFZ A;  1D8Y A;  4AHT A;  3KKR A;  3O08 A;  2YNH A;  1RT5 A;  4NCG A;  4K41 A;  1GLF O;  2QWN A;  4ELT A;  4WQ5 C;  1U49 A;  4OX9 K;  2DFE A;  4FM0 A;  4JI0 K;  5A2Q O;  3LPU A;  3C94 A;  2Z1I A;  4O8U A;  1ATS A;  4DG1 A;  4M3T A;  4J2E A;  3T19 A;  1RTH A;  1X1P A;  3M8S A;  2QI2 A;  2ZQB A;  4X62 K;  3WT0 A;  3FFK B;  4KV8 A;  2PAV A;  3WEE B;  1EO1 A;  3PX4 A;  4E3S A;  2G8U A;  2YNI A;  4Y1D A;  4B3O A;  4CZL A;  1HUX A;  4BRG A;  4M3Y A;  4FJ9 A;  1BHL A;  4CHN A;  2NRZ A;  1S1W A;  1S9E A;  3MN9 A;  1UAX A;  4OKJ A;  4M3U A;  3RMA A;  4N76 A;  4NLC A;  1L5U A;  2VWB A;  1RTI A;  4HTL A;  4M63 C;  2OPS A;  3QIP A;  1NNE A;  4MO5 A;  4C23 A;  3FLC O;  4A61 A;  3AVB A;  1A5V A;  4IBN A;  1ATR A;  3VER A;  3AA5 X;  3NHG A;  3OBW A;  5GAH P;  3C7N A;  2G8I A;  1HNI A;  2CGL A;  4O5B A;  4LD0 A;  4AHV A;  3O6W A;  3DAW A;  4FM2 A;  2HOE A;  4FOE A;  3VQ9 A;  5AQX A;  2YHA A;  4CFA A;  3LM2 A;  2OA8 A;  1P8Z A;  4CES A;  4O0I A;  1YVN A;  4B1U B;  3RRH A;  1KAZ A;  3CJA A;  5C2F A;  1HQU A;  4NYN A;  3KK3 A;  1BG3 A;  1RDU A;  3OBY A;  3T1H K;  3HJF A;  1ZBS A;  1JLA A;  4KHQ A;  4PA1 A;  3P31 A;  5AQR A;  1YIT N;  4DFP A;  1IH7 A;  4JN4 A;  1IBM K;  3CCE N;  4CD3 A;  2V52 B;  4FJK A;  4DUY K;  2EWS A;  1WBD A;  3VGL A;  5LJV A;  2ZF5 O;  3V1Q A;  1VSF A;  3KWG A;  4QS9 A;  4YDU A;  1HLU A;  1KAX A;  4H5W A;  1XNR K;  4JKH A;  4KTW A;  4CE9 A;  2PBD A;  3WNG A;  1JLG A;  3DJC A;  3D7E O;  2PYL A;  4CBU A;  3HT3 A;  4DTO A;  3QEI A;  3QES A;  2Y1J A;  3VQ4 A;  3OYG A;  1B92 A;  5J2P A;  1IG9 A;  5EOY A;  5HBM A;  3ZSW A;  4YY3 K;  1UWB A;  5KTQ A;  4B1X B;  4C8L A;  2VQF K;  3ZET B;  5C0Y A;  2KHO A;  1VSD A;  3AY9 A;  3VF4 A;  1BI4 B;  1LWC A;  4KHP K;  3PIO L;  2BH1 A;  5GAG P;  3PV8 A;  1P90 A;  4F2R A;  1DGK N;  1HNV A;  4JLH A;  4DS4 A;  1BI4 A;  4C8N A;  3DRR A;  1ASU A;  4CK2 A;  4BR5 A;  1HQE A;  4BRM A;  2D0A A;  4DQ8 A;  3UKU B;  4CJK A;  2LSN A;  1KFD A;  4FLX A;  3FFI A;  4C8K A;  4KB1 A;  3K58 A;  2GWJ A;  1NM1 A;  2AP1 A;  3NVM A;  4LH4 A;  4HUG A;  1SL0 A;  1IKY A;  3VQ6 A;  3VN5 A;  4M3X A;  3MXM A;  2ETJ A;  3NF7 A;  1JCF A;  3DLB A;  4GVE A;  5AQV A;  2Q36 A;  1HNW K;  1W97 L;  4FM1 A;  2UUC K;  3HP6 A;  2XHB A;  1NGA A;  4DMN A;  4KI6 A;  1S3X A;  4LY7 A;  2CGJ A;  4FLU A;  2ZGZ A;  4GV9 A;  3L4I A;  1XHX A;  4FLZ A;  3ULE B;  2I5J A;  2FF6 A;  3AVG A;  1VQP N;  3I56 N;  2VQE K;  5BRE A;  4B8A B;  5ADX A;  2ITG A;  2KTQ A;  1WSJ A;  3LDO A;  4KHU A;  4ELV A;  2YHW A;  1GLB G;  3VGK A;  2NRH A;  2D0C A;  4G1Q A;  5HRP A;  1HR0 K;  4PKI A;  1IKW A;  3N4P A;  4CJR A;  3CC4 N;  2QXL A;  4XH4 A;  4N41 A;  4OKK A;  4CW7 B;  1GOA A;  5HOO A;  4DR4 K;  3V9W A;  1RDC A;  5DK5 A;  4GV6 A;  4OPA A;  4DTX A;  5SWM A;  2ZD1 A;  4M3R A;  3O3H A;  3ATV A;  4CGG A;  2JLE A;  3DOK A;  3DXK B;  4RW4 A;  5GAE P;  4DTM A;  5JS2 A;  1NK0 A;  3M8R A;  2P9N B;  4ZHR A;  2ASO A;  3DXK A;  4XEI A;  4BRD A;  3F2K A;  4EIA A;  2BGG A;  3OYL A;  3CCU N;  3VTH A;  1LWE A;  3DI6 A;  1S22 A;  4JI2 K;  4BRP A;  4NXN K;  2P9N A;  3CPE A;  4DKW A;  1TKD A;  1XUP O;  4YNQ A;  3EYZ A;  3CCM N;  4OPH A;  3VEW A;  3J80 O;  4IDH A;  3TSU A;  4CF9 A;  3OW2 M;  3WXL A;  1E4G T;  1QHA A;  3TAG A;  1BOT O;  1NBW A;  4BRQ A;  4CJU A;  3MCP A;  2A5X A;  4OLA A;  1FK9 A;  3ISN C;  1Y64 A;  4IG3 A;  2O8D B;  1KXP A;  4KI4 A;  4WFB L;  3ZSZ A;  5AFU H;  1QQN A;  2QWP A;  4DR3 K;  3AAR A;  3TAF A;  1UA0 A;  3GG4 A;  3S9H A;  1IKX A;  1LOT B;  3O1W A;  3JYT A;  2O8D A;  2HNY A;  4CZH A;  3AV9 A;  3VGM A;  5EVZ A;  4CF2 A;  1VRU A;  3QBW A;  4CZE A;  3CG7 A;  4H0Y B;  3CD6 N;  3I33 A;  4B3M K;  5AQF A;  1CZ9 A;  1NGB A;  2V7Y A;  1IBK K;  2F96 A;  2E20 A;  3AVJ A;  3WNH A;  3E9L A;  4O4G A;  3RTV A;  4BWJ A;  4CGH A;  5FDL A;  5BN9 A;  4PQU A;  1RFQ A;  4RW7 A;  1C0G A;  5LMN K;  4CK1 A;  4J8F A;  1EWQ A;  4JK7 A;  4CBW A;  2HF3 A;  1D9D A;  5KPT A;  3QBX A;  5M1N A;  4OO1 J;  3WXI A;  3VF6 A;  3DYA A;  1SV5 A;  1TVR A;  3O80 A;  3FZF A;  4BR0 A;  4CJT A;  3K9J A;  1Z05 A;  1ZBI A;  3E66 A;  1FKO A;  1YJW N;  2YHX A;  3I0S A;  1XI1 A;  4B9L A;  3RR8 A;  2O4G A;  2Q1N A;  2WOM A;  4CHQ A;  2G8K A;  4CF1 A;  3DMJ A;  4IEE A;  3ZSY A;  1VQO N;  4C1N I;  4BRE A;  4N5S A;  5KPZ A;  4KFB A;  2QKB A;  4NCA A;  5DM6 L;  4BE0 A;  4YOW A;  3VQC A;  1YUW A;  3KLG A;  4IO8 A;  2W41 A;  3KWI A;  2EX3 A;  3V9X A;  2OTL N;  2E6L A;  2QEX N;  2HHQ A;  3QIO A;  3CET A;  3ZSO A;  2O8E B;  4YDU C;  3AAQ A;  4RW9 A;  1QQM A;  4DU3 A;  4FLY A;  4BQL A;  4BC5 A;  2O8E A;  5BRF A;  1EXQ A;  2P9I A;  4GMJ B;  3HRG A;  1RT3 A;  3IFR A;  3P38 A;  2Z1H A;  3SBG A;  4MQ3 A;  4AHU A;  4BRO A;  3P39 A;  4DF4 A;  5KQ8 A;  3KJV A;  4L3Q A;  1O1W A;  2BE2 A;  4BDY A;  3AVC A;  3CPW M;  1RDW X;  1KVA A;  4B9S A;  3L2U A;  3SAF A;  4LF4 K;  3SQ0 A;  5KRS A;  3VQD A;  2RE2 A;  5AQN A;  3DRP A;  5I9E B;  2A6A A;  3SQ1 A;  3A5L C;  4F9O A;  2VGN A;  4LF9 K;  4EZ6 A;  5M1P A;  3PX6 A;  4FWO A;  1HYS A;  2XY5 A;  3O4N A;  1JJ2 M;  3HZ6 A;  1XC3 A;  3ATU A;  4B1V A;  2W6L A;  4J2A A;  4LFA K;  5HP1 A;  3QDK A;  3VQA A;  3KLF A;  3BZC A;  3V9Z A;  4B9M A;  3IS9 A;  4BVP A;  4G9Z A;  3AVF A;  3H3N O;  4JS5 A;  4KH6 A;  3V9S A;  1A5W A;  2WTU A;  4FWK A;  2HHV A;  4K8Z A;  1SS6 A;  3FZH A;  1YXQ A;  3OVN A;  4LSL A;  3TAE A;  3WXJ A;  3T3F A;  2GV9 A;  3SJJ A;  2BAN A;  2IC3 A;  4RWT A;  4C1N K;  4QOZ B;  4E1N A;  4DR5 K;  3CXC M;  3SI6 A;  3MAQ A;  3RMB A;  1U4B A;  3SPY A;  3I8B A;  2IVN A;  3QEW A;  4Z4I A;  4B9V A;  1MWM A;  4AF1 A;  3CJB A;  2A3Z A;  1GLA G;  2HMI A;  3ID8 A;  4A5B A;  3ZT3 A;  2NRT A;  4KHW A;  1D5A A;  2G8F A;  1W0H A;  4CFB A;  1Q9X A;  3JXU A;  1BU6 O;  3CIP A;  4CGD A;  1Q86 O;  1CXU A;  5AZJ B;  4RTF D;  3THY B;  1RGI A;  1RNH A;  4BR2 A;  4DV7 K;  1OVY A;  4JYA K;  4CED A;  3M8P A;  2P51 A;  1CXQ A;  4QS8 A;  4DTN A;  4LF6 K;  1OH5 A;  1N34 K;  5AQH A;  4DV6 K;  5BR9 A;  4CEB A;  3KLE A;  4K42 A;  3SJH A;  2E1Y A;  3ZSX A;  1IKV A;  4I9Q A;  3TAQ A;  4EFH A;  2O8B B;  4H8K A;  4AHC A;  4JI8 K;  1TK5 A;  4FZZ A;  3WUH A;  5C24 A;  3L3U A;  4BRK A;  1GLJ O;  1G99 A;  3THW B;  4FPB A;  2O8B A;  3SCX A;  3RMD A;  1RDB A;  4ILH A;  3L2R A;  3JSM A;  3CMA N;  5TKW A;  3QEP A;  4K8X A;  4H5T A;  4R5P A;  4B9T A;  5T7B A;  1Z26 A;  3G0Z A;  3NGY A;  1ASW A;  1WB9 A;  3MDQ A;  3KTQ A;  4W5T A;  5C10 A;  1IJJ A;  5BRH A;  1XMO K;  1Y97 A;  3LDS A;  2KQ2 A;  4IKF A;  4B9N A;  1HJR A;  2NZT A;  4FCY A;  4E7J A;  2Q0R A;  4LF8 K;  4YOT A;  3OJS A;  4HCC A;  3SLC A;  1D4X A;  1TKT A;  3CFP A;  3QEX A;  4FWR A;  4WQ4 A;  3CCR N;  2ASM A;  3NF8 A;  4AHR A;  2I7P A;  5FPN A;  4BWM A;  1NMN A;  4LF5 K;  3H3O B;  3HM8 A;  1GLL O;  1WAJ A;  5J2N A;  2OPR A;  4E7K A;  5JMV A;  1BGX T;  4XH1 A;  1YTU A;  4A2A A;  3VQE A;  2E4L A;  2XRI A;  1QVF M;  5AQZ A;  3K5L A;  3VQB A;  4JRQ A;  4FJ5 A;  3AVK A;  2JWK A;  3IRX A;  4JK8 A;  4DFM A;  3CQX A;  1C6V A;  1GOC A;  3D2F A;  2FBY A;  3SQ4 A;  1Q9Y A;  4E7H A;  4F3O A;  2WFB A;  3WXM B;  3O8M A;  3KIO A;  5GAD P;  2ASP A;  3KD1 E;  3ZEU A;  1RTJ A;  4I2Q A;  4MLE A;  3AVM A;  3K0S A;  4BDP A;  1N5Y A;  4OVL A;  3ID6 A;  1VAZ A;  3MXJ A;  1LAV A;  3LP2 A;  1BDG A;  4WFN L;  2NNW A;  4W5Q A;  2Q2R A;  4C8M A;  3K59 A;  1RBU A;  1S1X A;  2Q3S A;  2PY5 A;  3NF9 A;  3CQY A;  4KRF A;  5TKY A;  4DQS A;  3E9O A;  2NRR A;  4BGA A;  1QSS A;  1J53 A;  3CC7 N;  4FWS A;  2FSJ A;  2VG5 A;  3PSF A;  4IOA L;  5IT9 O;  4IJA A;  1DLO A;  2XY8 A;  3CJC A;  3V1O A;  3OYJ A;  1TL1 A;  5KPR A;  5I3U A;  3QER A;  5AQJ A;  2NLX A;  1W2B M;  4HTU A;  4CF8 A;  3C7N B;  1N36 K;  4B3T K;  1JXB A;  4RW8 A;  4CEF A;  3JS6 A;  3TSP A;  4BRC A;  2XY7 A;  1HYV A;  3EN9 A;  1ZYQ A;  4FJM A;  3U6F A;  3KHY A;  5AQK A;  3KZB A;  3AVN A;  1YF5 L;  3K2P A;  3C65 A;  4E1M A;  3TU5 A;  1NJX A;  4DWI A;  4WCE L;  3CM6 A;  2F4V K;  4FXD A;  4H0O A;  4FL9 A;  3O4Q A;  3NFA A;  3BF3 A;  4H0X B;  3U8X A;  5B8H A;  2OTJ N;  4CHP A;  1LW0 A;  1TKZ A;  1X3M A;  4DCH A;  1TKX A;  3P83 D;  2R7Y A;  3QO9 A;  1RIL A;  2QA4 N;  1J5E K;  4XIU A;  2QW9 A;  4M7Y A;  5C15 A;  1ESV A;  4IFV A;  1XNQ K;  1WBB A;  3BEX A;  3CM5 A;  3MED A;  3H6E A;  3ZT0 A;  1ZC6 A;  3GOI A;  4NCB A;  1T05 A;  4EZ9 A;  2E6M A;  1WSH A;  4UQG A;  3VEY A;  2B4J A;  3KK7 A;  3LPT A;  1U04 A;  2DFF A;  5M1K A;  1TK0 A;  2QWR A;  4FWM A;  1Q7Y O;  4IO9 L;  1QS4 A;  4DTU A;  5K14 A;  2IIR A;  2QK9 A;  4DQP A;  1NK8 A;  1YTA A;  1HPM A;  2YNG A;  3O9S A;  3K5M A;  3O5B A;  1J6Z A;  4WYB A;  4DFK A;  1WSE A;  3V6D A;  2CH5 A;  5BPN A;  3NCI A;  1NGG A;  4DU1 A;  2HHU A;  5BN8 A;  4KH5 A;  2QM1 A;  2OCE A;  3HI0 A;  1NGJ A;  1QZ5 A;  2X78 A;  3OYD A;  3DLG A;  4Z4C A;  4NXM K;  4X66 K;  1E4F T;  4Y0W A;  3W0L A;  2HVI A;  2HVH A;  4I2P A;  2J4R A;  4RG8 A;  3M8Q A;  4CEE A;  2QXF A;  2WC9 A;  3DLR A;  4M3W A;  2UUA K;  2KW4 A;  4BGB A;  4O44 A;  3KD5 E;  3KVG A;  2QTD A;  3LDN A;  3E1Y A;  4PL8 A;  2GEM A;  4FZY A;  4DUZ K;  1NGH A;  1NMD A;  3OTO K;  3ASM A;  5HLF A;  1SQK A;  2A42 A;  4BY9 C;  1T6C A;  1OH8 A;  4E89 A;  4EAH D;  4OPK A;  3ENB A;  1A5X A;  4ISF A;  3LWL A;  4RW6 A;  3SV4 A;  1JL1 A;  2RF2 A;  2E8A A;  4AHS A;  3AO5 A;  3ZT4 A;  4KB0 A;  4DS5 A;  5AQS A;  1JCE A; 
#chains in the Genus database with same CATH homology
 2O4G A;  3PY8 A;  5CZ2 A;  2WOM A;  1Q8I A;  2VG7 A;  3HST B;  1BIU A;  1LW2 A;  4NYF A;  4CF1 A;  3DMJ A;  3ZSY A;  4CHQ A;  5E41 A;  2G8K A;  3PO4 A;  3RWU A;  4KPY A;  5J1E A;  4N5S A;  4KFB A;  2ATQ A;  2QKB A;  3AVH A;  1U47 A;  4NCA A;  1NKC A;  3DM2 A;  4BE0 A;  4YFU A;  3VQC A;  1NJY A;  1S6Q A;  4B9U A;  4Z4H A;  3KLG A;  2EHG A;  3SUQ A;  2KZZ A;  3VQQ A;  4CJ4 A;  3NDK A;  5HRO A;  3KLI A;  3DLK A;  1S1U A;  3V9X A;  2EX3 A;  4J2B A;  2XY6 A;  2E6L A;  1C0M A;  2PZS A;  3OYI A;  2HHQ A;  2IS3 A;  3QIO A;  3L3V A;  3ZSO A;  4CJ5 A;  1T03 A;  3NBP A;  4HUF A;  2DFH A;  1CLQ A;  3L8B A;  1SKS A;  3OYH A;  3ZT2 A;  3OYM A;  4CJL A;  3SQ2 A;  4DSF A;  3DLH A;  4N47 A;  1RT2 A;  4RW9 A;  4OPJ A;  5EU7 A;  4DU3 A;  4KTZ A;  1TL3 A;  4FLY A;  3LAM A;  4CGI A;  4CEA A;  3HVT A;  2FBX A;  4FJI A;  1VSE A;  3V1R A;  1NK6 A;  5C25 A;  1NOZ A;  2D0B A;  1XHZ A;  1QQC A;  2PYJ A;  1EXQ A;  1CZB A;  1EX4 A;  3HP9 A;  4GMJ B;  2NUB A;  1RT3 A;  3G10 A;  4E7I A;  2Z1H A;  4AHU A;  4MQ3 A;  4CHO A;  2Y1I A;  4IFY A;  4DF4 A;  4FJG A;  3UIQ A;  1JLB A;  1WAF A;  4FJ8 A;  3KJV A;  1D9F A;  4PY5 A;  1VSI A;  4FW2 A;  4CJS A;  1U45 A;  1O1W A;  2BE2 A;  3H08 A;  3EY1 A;  4BDY A;  3OYA A;  3AVC A;  3CFR A;  1JLC A;  4DQQ A;  3OYE A;  4F4K A;  3AVA A;  2GBZ A;  3C6T A;  3NH1 A;  1X9W A;  1KVA A;  4C8O A;  4B9S A;  3L2U A;  1NKE A;  4PUO A;  2VWJ A;  4FJN A;  3HL8 A;  4DSK A;  2YHB A;  3SQ0 A;  5KRS A;  3VQD A;  3LP1 A;  1VSK A;  3ZCM A;  3OYK A;  3DRP A;  2OPP A;  1NK9 A;  1KSP A;  2OYQ A;  5D3G A;  3SUP A;  4Z0U A;  4Z4E A;  3HM9 A;  3OYF A;  3SQ1 A;  3AA4 A;  1RT7 A;  2G8V A;  3OYN A;  3THV A;  1VSJ A;  1BIZ A;  1K6Y A;  4EZ6 A;  3PX6 A;  4I7F A;  1HYS A;  2XY5 A;  1L3T A;  1UOC A;  3O4N A;  4FW1 A;  1RT1 A;  4M3Z A;  1EP4 A;  4FJL A;  2VG6 A;  5KRT A;  4CER A;  4IDK A;  4O0J A;  4J2A A;  4HUE A;  5I42 A;  4CGF A;  4CJF A;  4CHY A;  3QIN A;  5J2M A;  1C1C A;  1WN7 A;  4HVJ A;  4DLE A;  1BIS A;  5HP1 A;  2OZM A;  3ZT1 A;  4ELU A;  4W5N A;  3VQA A;  3KLF A;  3EZ5 A;  2JGU A;  1S5J A;  3V9Z A;  3TAM A;  1ZBL A;  4B9M A;  3IS9 A;  5C42 A;  3IG1 A;  3SNN A;  2KFZ A;  1F21 A;  3LP0 A;  3AVF A;  4JS5 A;  1D8Y A;  3AO1 A;  1J5O A;  5DMR A;  3V9S A;  4AHT A;  3KKR A;  1A5W A;  3ULD A;  3LAK A;  2HHV A;  1WNS A;  3I8D A;  4K8Z A;  1S6P A;  5CYM A;  2YNH A;  4DU4 A;  1RT5 A;  3P1G A;  4NCG A;  3VA0 A;  1I39 A;  3OVN A;  4ELT A;  1NK5 A;  5FRN A;  4I9L A;  4LSL A;  3L2W A;  1GOB A;  3TAE A;  1U49 A;  4FK4 A;  2DFE A;  2RPI A;  3DRS A;  4F2S A;  3T3F A;  4FM0 A;  2GV9 A;  3SUN A;  3SJJ A;  2BAN A;  1FXX A;  3LPU A;  2YV0 X;  2IC3 A;  4OGE A;  3C94 A;  2Z1G A;  2Z1I A;  3TI0 A;  4QOZ B;  4JRP A;  3KKS A;  3HK2 A;  4E1N A;  4DG1 A;  3SI6 A;  4M3T A;  3SUO A;  1N6Q A;  4J2E A;  3T19 A;  1RTH A;  2IAJ A;  3MAQ A;  1X1P A;  1RT6 A;  3RMB A;  4W5O A;  3M8S A;  1KLN A;  1ZBH A;  2ZQB A;  3LZI A;  3SPY A;  1U4B A;  3QEW A;  4BDZ A;  4Z4I A;  4KV8 A;  4LH5 A;  4B9V A;  1TAU A;  2WON A;  4KKO A;  1NKB A;  2VWK A;  3PX4 A;  4KTQ A;  2DY4 A;  2P1J A;  2IDO A;  4E3S A;  2HMI A;  3SZ2 A;  2G8U A;  2YNI A;  4Y1D A;  4B8C A;  3ZT3 A;  4CEC A;  4KHW A;  1XI1 A;  1D5A A;  3AVL A;  4B3O A;  2ZE2 A;  2G8F A;  2O4I A;  1TGO A;  1NJZ A;  1W0H A;  4CFB A;  1Q9X A;  4M3Y A;  3SV3 A;  1JLQ A;  4FJ9 A;  1BHL A;  3LAN A;  4CHN A;  4M41 A;  4ZTF A;  4CGD A;  1S1W A;  3LAL A;  1CXU A;  1S9E A;  4E19 A;  1WSI A;  5KGW A;  1FKP A;  3QNN A;  1UAX A;  3TAB A;  4QCL A;  4FJJ A;  4OKJ A;  1RNH A;  4BE1 A;  4EP4 A;  4CED A;  3M8P A;  4M3U A;  3RMA A;  3DLE A;  4O55 A;  4N76 A;  2P51 A;  1CXQ A;  1L5U A;  1RTI A;  2OPS A;  3QIP A;  3NGZ A;  4DTN A;  4CJP A;  1JL2 A;  4DSE A;  3BGR A;  3AVB A;  1A5V A;  3K5O A;  3F9K A;  4IBN A;  4CEB A;  3KLE A;  3SYZ A;  3ZSX A;  3AA5 X;  4IG0 A;  3NHG A;  1IKV A;  1RBV A;  4F8R A;  4I9Q A;  2KFN A;  3VQ5 A;  3TAQ A;  4DTR A;  4CF0 A;  1TAQ A;  2RN2 A;  4F3T A;  3ZSQ A;  4H8K A;  1HNI A;  1SUQ A;  1RBR A;  4O5B A;  4AHC A;  4LD0 A;  4AHV A;  2G8I A;  1TK5 A;  1L3V A;  2FBT A;  4FZZ A;  5C24 A;  1RBT A;  3L3U A;  2P5G A;  4DSI A;  4CJW A;  3L2V A;  3OYC A;  4FM2 A;  3OS0 A;  5HRN A;  3VQ9 A;  3SCX A;  3O3G A;  2YHA A;  4CFA A;  3B6P A;  4DLG A;  3RMD A;  4FLT A;  1SKW A;  2W42 A;  1RDB A;  3L2R A;  3JSM A;  2F8T A;  1T8E A;  2OA8 A;  5KI6 A;  4CES A;  4O0I A;  4ZTJ A;  4FZX C;  1WSF A;  3F73 A;  3QEP A;  3RRH A;  4K8X A;  4B9L A;  4CGJ A;  1HQU A;  3ZSR A;  4NYN A;  4R5P A;  1S1V A;  3KK3 A;  3D0P A;  4B9T A;  5T7B A;  1YVU A;  1RBS A;  3HJF A;  1Z26 A;  3G0Z A;  1JLA A;  3NGY A;  1ASW A;  4PA1 A;  4KHQ A;  4CFC A;  4EP5 A;  4DFP A;  3ITH A;  3KTQ A;  4W5T A;  4ID1 A;  1IH7 A;  3HPO A;  1MU2 A;  2A1S A;  3V9U A;  3MEE A;  1Y97 A;  3LDS A;  4L8R B;  1ZBF A;  2KQ2 A;  4FJK A;  1TV6 A;  4CFD A;  1XWL A;  4CEQ A;  4IKF A;  5KGX A;  5HRR A;  1J54 A;  3OS1 A;  4B9N A;  1HJR A;  1NK4 A;  3V1Q A;  4E7J A;  1VSF A;  4FCY A;  4CEO A;  5SZT A;  1SKR A;  2OPQ A;  3OJS A;  3S3N A;  4CIG A;  4HCC A;  1B9D A;  1VSH A;  2IOC A;  1TKT A;  4Y1C A;  3CFP A;  3QEX A;  4FYD A;  3HPH A;  3OY9 A;  1KTQ A;  4KTW A;  3NF8 A;  4OGC A;  4FJH A;  4AHR A;  4BWM A;  4CE9 A;  3OJU A;  3WNG A;  1JLG A;  1BQM A;  4FK0 A;  1VK0 A;  3AA3 A;  2PYL A;  2HHW A;  1L3U A;  3HT3 A;  4DTO A;  1WAJ A;  3QEI A;  2OZS A;  1HPZ A;  3QES A;  5J2N A;  2OPR A;  5HRS A;  4E7K A;  2Y1J A;  1BGX T;  2YKN A;  3VQ4 A;  1B92 A;  3OYG A;  5J2P A;  1IG9 A;  4FJ7 A;  1YTU A;  3L2Q A;  5HBM A;  3ZSW A;  1YT3 A;  3LP3 A;  1UWB A;  3VQE A;  3S3O A;  2E4L A;  2X74 A;  5KTQ A;  4KHS A;  1C0T A;  2XRI A;  4C8L A;  3E01 A;  3K5L A;  1L3S A;  1VSD A;  3VQB A;  4JRQ A;  1BI4 B;  3AVK A;  4FJ5 A;  1DTQ A;  3NAE A;  3IRX A;  4DFM A;  5CZ1 A;  1IO2 A;  1LWC A;  1C6V A;  4DSJ A;  4Z4F A;  3HPG A;  1GOC A;  4Z4G A;  3SQ4 A;  1KVB A;  2FBY A;  3IAY A;  2HW3 A;  3PV8 A;  3AVI A;  3MEG A;  1Q9Y A;  3WNE A;  4E7H A;  4F2R A;  3B6O A;  4F3O A;  1HNV A;  4JLH A;  4DS4 A;  1BI4 A;  3VA3 A;  1C0U A;  3DRR A;  4C8N A;  1ASU A;  1VRT A;  3A2F A;  1NJW A;  4CK2 A;  3KIO A;  1HQE A;  2D0A A;  3WNF A;  4CJE A;  3KD1 E;  4CJK A;  2LSN A;  4BAC A;  1KFD A;  4FLX A;  1RTJ A;  4I2Q A;  3FFI A;  3AVM A;  4BDP A;  3VQP A;  1N5Y A;  3KLH A;  2FBV A;  4C8K A;  4OVL A;  4KB1 A;  3KK2 A;  3MXJ A;  3TAR A;  3K58 A;  1JKH A;  1LAV A;  1B9F A;  4TSX A;  3AO2 A;  3LP2 A;  3NF6 A;  3OYB A;  3S3M A;  3P5J A;  5FRM A;  4KHY A;  4LH4 A;  4CHZ A;  4HUG A;  1SL0 A;  4M45 A;  1IKY A;  4CJ3 A;  3VQ6 A;  3VN5 A;  3TR8 A;  1VSL A;  2KZM A;  3ZSV A;  3MXM A;  4W5Q A;  2ETJ A;  3NF7 A;  1HYZ A;  3QLH A;  1RBU A;  4GW6 A;  4C8M A;  3KK1 A;  4QAG A;  3K59 A;  1S1X A;  2Q3S A;  1UA1 A;  2PY5 A;  3NF9 A;  1BCM A;  3O3F A;  2D5R A;  3DLB A;  3HYF A;  1R0A A;  4H4O A;  2B5J A;  4KRF A;  4ICL A;  4FM1 A;  4DQS A;  1KCF A;  3HP6 A;  2XHB A;  4DMN A;  2G8W A;  4KI6 A;  3ALY A;  3AO4 A;  4LY7 A;  1QSY A;  4CIE A;  1JLF A;  1J53 A;  1HMV A;  4FLU A;  1QSS A;  4JS4 A;  1XHX A;  2VG5 A;  4FLZ A;  4J2D A;  1VSM A;  2I5J A;  4FLW A;  3AVG A;  2YNF A;  2G8H A;  3OYJ A;  1DLO A;  2XY8 A;  3V1O A;  5J2Q A;  1TL1 A;  3PO5 A;  3RR7 A;  5I3U A;  3LZJ A;  3QER A;  1WSG A;  4B8A B;  2ITG A;  2KTQ A;  4HTU A;  3NH0 A;  4KO0 A;  4CF8 A;  1WSJ A;  3LWM A;  1KFS A;  4KHU A;  4ELV A;  1JXB A;  1LV5 A;  4RW8 A;  4CEF A;  5CYQ A;  3V4I A;  4KAZ A;  2XO7 A;  2P5O A;  1JXE A;  2A1R A;  2HHS A;  2YKM A;  2XY7 A;  1HYV A;  3HO1 A;  2D0C A;  1NK7 A;  1ZYQ A;  3DOL A;  3TWH A;  3U6F A;  1TK8 A;  1LWF A;  1BL3 A;  4FJM A;  4G1Q A;  3VQ8 A;  3AVN A;  4CIF A;  3K2P A;  1IKW A;  5HRP A;  3RRG A;  4E1M A;  2BDP A;  1NJX A;  4CJR A;  3K57 A;  3NGI A;  4DWI A;  1ASV A;  3AA2 A;  4M42 A;  3CM6 A;  4DTJ A;  4N41 A;  4OKK A;  4FXD A;  4KHN A;  3O4Q A;  3NFA A;  1GOA A;  3V9W A;  1T7P A;  1RDC A;  5DK5 A;  4CHP A;  3NE6 A;  2F8S A;  4FVM A;  4BE2 A;  1J9A A;  4HCB A;  4DTX A;  1LW0 A;  2HNZ A;  5SWM A;  1TKZ A;  4CJQ A;  3SPZ A;  1X9M A;  1TKX A;  3P83 D;  2R7Y A;  2ZD1 A;  4M3R A;  3QO9 A;  1DTT A;  1RIL A;  3O3H A;  4XIU A;  5FRO A;  4CGG A;  4Q5V A;  2JLE A;  3DOK A;  4IFV A;  1JLE A;  4RW4 A;  3T1A A;  3CM5 A;  2FC0 A;  3MED A;  3ZT0 A;  5JS2 A;  4HHT A;  4DTM A;  1SL1 A;  1SL2 A;  4OLB A;  1KVC A;  4NCB A;  1KLM A;  4OJR A;  1T05 A;  4EZ9 A;  1NK0 A;  1ITG A;  2E6M A;  1WSH A;  4UQG A;  3AO3 A;  2X6N A;  3M8R A;  2B4J A;  4ZHR A;  4N56 A;  3HXM A;  1BQN A;  3LPT A;  1U04 A;  2DFF A;  1EKE A;  4PWD A;  1TK0 A;  2BGG A;  3OYL A;  4DTP A;  1NOY A;  1LWE A;  1QHT A;  1QS4 A;  3DI6 A;  4DTU A;  5K14 A;  3CYM A;  4Q0B A;  2QK9 A;  4DQP A;  1TKD A;  2HHT A;  4DF8 A;  3TAN A;  1NK8 A;  1YTA A;  4YNQ A;  3CQ8 A;  3EYZ A;  2IGI A;  1LAW A;  2YNG A;  1QSL A;  4E0D A;  3C6U A;  3I0R A;  1QE1 A;  4WE1 A;  3K5M A;  3RMC A;  1KRP A;  4CF9 A;  1S1T A;  1WLJ A;  3D45 A;  1RTD A;  5JS1 A;  4FJX A;  3NH2 A;  4DSL A;  4DFK A;  1REV A;  3TAG A;  1WSE A;  3V6D A;  4OLA A;  4CJU A;  3NCI A;  1FK9 A;  3ISN C;  4ID5 A;  4IG3 A;  4DU1 A;  4DFJ A;  3V81 A;  4E7L A;  4GVM A;  1X9S A;  3ZSZ A;  4KI4 A;  1RCH A;  2HHU A;  3PX0 A;  2AJQ A;  1S9G A;  1ZBU A;  2B6A A;  1EET A;  3TAF A;  1UA0 A;  2X78 A;  3OYD A;  3S9H A;  1IKX A;  3DLG A;  4CEZ A;  4Z4C A;  4AH9 A;  3JYT A;  2HNY A;  3AV9 A;  4H4M A;  1VRU A;  4CF2 A;  4DTS A;  4FLV A;  2HVI A;  1BCO A;  2HVH A;  4I2P A;  3OS2 A;  3CG7 A;  2HB5 A;  2RKI A;  4RG8 A;  1U48 A;  4DQI A;  3QNO A;  3QET A;  1G15 A;  3M8Q A;  4CEE A;  1CZ9 A;  2QXF A;  2X6S A;  4B08 A;  3DLR A;  2F96 A;  4M3W A;  3AVJ A;  2KW4 A;  3WNH A;  4O4G A;  3C95 A;  4O44 A;  3KD5 E;  2HHX A;  3U3Y A;  3RTV A;  3QEV A;  4BWJ A;  4CGH A;  5FDL A;  3TAP A;  3MXI A;  4CCH A;  4PQU A;  4FK2 A;  4RW7 A;  1I3A A;  4FZY A;  1W9H A;  4CK1 A;  2Z1J A;  3ASM A;  4AIL C;  1C1B A;  5HLF A;  4DQR A;  1D9D A;  5CY4 A;  4M3X A;  4CJV A;  2QKK A;  3DYA A;  1SV5 A;  4E89 A;  1TVR A;  2GUI A;  4OKE A;  4OPK A;  2HND A;  4LSN A;  1A5X A;  4W5R A;  3VQ7 A;  1RDA A;  3LWL A;  4RW6 A;  3U3G A;  3SV4 A;  4CJT A;  1ZBI A;  1RDD A;  1JL1 A;  1RT4 A;  2RF2 A;  1XC9 A;  4AHS A;  4KRE A;  3BDP A;  3AO5 A;  2DTU A;  1QTM A;  1Z25 A;  3ZT4 A;  3HVR A;  4KB0 A;  3CFO A;  4CK3 A;  3PUF A;  4DS5 A;  1FKO A;  3MEC A;  3K5N A;  3I0S A;  4MFB A;  1C1A A;  1HRH A;  3RR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...