1VSKA

Asv integrase core domain d64n mutation in citrate buffer ph 6.0
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTNFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inactivating mutations and pH-dependent activity of avian sarcoma virus integrase.
pubmed doi rcsb
source organism Rous sarcoma virus - schmidt-ruppin b
molecule tags Hydrolase
molecule keywords INTEGRASE
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vskA00
1TVRA 1RDDA 4H4OA 4CJEA 2FC0A 4DQPA 4AHUA 4E0DA 3WNGA 3V9SA 4KI6A 1WLJA 3SUOA 4F3OA 3MEGA 3SPZA 3HK2A 4RW7A 1R0AA 1XI1A 1S9EA 5J2MA 2PZSA 4DF8A 4FK0A 1TAQA 2X78A 3DLRA 4DFPA 4RG8A 3DOLA 4Y1CA 1KFDA 4B8AB 4JS4A 4XIUA 4ELUA 4JLHA 4AHRA 1TK5A 4EZ9A 4UQGA 1L5UA 4BWJA 2ITGA 1HYZA 2X74A 3CG7A 4ICLA 3OYNA 4GVMA 4KKOA 1NK7A 4CESA 1X9SA 2XY7A 4CK1A 5HRNA 4KB1A 3K5OA 3NF9A 4FJJA 4LH5A 4BWMA 3EY1A 3ZT1A 2XY6A 1VSHA 2OZMA 1HQEA 2HHSA 3K5MA 3VQ6A 2HW3A 4CJFA 4FLYA 4C8MA 1B92A 3ZSVA 2QKBA 2P1JA 4Y1DA 1EKEA 1DTTA 1VSKA 1WN7A 1XHXA 2NUBA 1A5XA 1VRTA 1HNVA 2XRIA 3MEEA 3VQ5A 5T7BA 3O3HA 3OYHA 1VSLA 1JXBA 2O4GA 3ZT2A 3I8DA 4JRPA 4KTZA 4E7HA 1EX4A 5HLFA 1WSJA 3DRPA 1C0TA 3NBPA 3VN5A 3HPOA 3K5LA 4DTJA 4FZXC 4BDYA 2HHTA 2OPPA 1NOYA 1ZBIA 4CF0A 3V9UA 3HXMA 4CGIA 4DFKA 4FJIA 1BCOA 4HUFA 4FLTA 3OYAA 3AV9A 4B08A 1VSIA 5KGWA 3AO2A 3ZT3A 4B3OA 4KB0A 3LANA 4CECA 3AVGA 4IFYA 1XC9A 1NKBA 1REVA 4CJLA 3OYMA 1QS4A 4ZTFA 4NYFA 1NOZA 2WOMA 3V4IA 3ZSYA 4DQRA 2YNGA 3PO4A 1FKPA 1IKXA 5HROA 1RBUA 3QINA 4LH4A 3QERA 4M3ZA 2HHQA 1TL1A 4EZ6A 4CF2A 3OYDA 4CJUA 4PA1A 3L2WA 1YT3A 1JL1A 3WNEA 4CCHA 4FJMA 4Z4EA 1MU2A 3LAKA 4DTUA 3T3FA 2QK9A 2Y1JA 5KGXA 5SZTA 4AHVA 2YV0X 4E89A 4OLAA 4CJVA 3ULDA 4FYDA 3M8PA 1Q9XA 4CEQA 4BE1A 1TKDA 3B6OA 3SNNA 1LWEA 4B9TA 3PO5A 1C0UA 3CM5A 5K14A 4O5BA 1U4BA 4FJHA 1KVAA 3QEVA 3LP1A 2FBXA 4FW1A 4FXDA 3PY8A 1L3VA 3V81A 1QQCA 3AVCA 4KHYA 2D5RA 4ELVA 4N41A 1SL1A 1KCFA 4FLVA 3TWHA 1U45A 2DTUA 3DLBA 4I2PA 1TL3A 3KTQA 3C6UA 3NGYA 4LY7A 1TGOA 3OYLA 4CHZA 2IGIA 3HO1A 3KKSA 4E7KA 2RKIA 3LZIA 4ELTA 3F9KA 4FM2A 2Z1IA 5C42A 1JLBA 1FK9A 3LWLA 1JKHA 3KK3A 3I0SA 1S1WA 1S6PA 1LW0A 4H8KA 3AVAA 1BIZA 1ITGA 3MXMA 5CY4A 2DFFA 2HNYA 4KFBA 1BIUA 4DU1A 3DMJA 1RT2A 1RT6A 1RT1A 3L2VA 3OYJA 5I3UA 3MECA 1U47A 4CEDA 5CZ1A 3RTVA 4OKKA 1QSSA 4FJ9A 3HL8A 3PUFA 1N5YA 1BISA 3AA4A 2PY5A 4R5PA 2XO7A 3L8BA 3BDPA 4I9QA 3ZCMA 1WSFA 3TAGA 3ZT4A 4FLUA 3QLHA 4CF9A 2G8HA 4B9LA 3LZJA 4TSXA 1U49A 4E7IA 2KFZA 1S6QA 3V6DA 2F8TA 3AVKA 4DSLA 4F4KA 3C6TA 1RT5A 5JS2A 4EP4A 4DFMA 5J2NA 3SQ0A 3DLHA 2HHXA 1KLMA 4AHTA 1NK6A 4KAZA 3L2RA 1D9FA 4KTQA 1NJZA 3CFRA 4O44A 4W5QA 3SCXA 3P5JA 1RT7A 1ZBFA 4I9LA 5HRRA 2W42A 3IG1A 4J2EA 2YKNA 4DMNA 3V9XA 5J2QA 1QSLA 1YTUA 2F8SA 3OS1A 3RRHA 4CJ3A 4AILC 3TAMA 4OGCA 3ZT0A 4N56A 2GV9A 3BGRA 2VWKA 1D5AA 2BE2A 3FFIA 3AVHA 4M3XA 1BQMA 3OYGA 3V9ZA 1BI4B 1W0HA 4FJNA 3MXIA 2PYLA 4ID5A 2OPRA 3IRXA 4MQ3A 1KSPA 1RTJA 4LSLA 3A2FA 4CK3A 4DS4A 3TAEA 1NK4A 1T7PA 4CFCA 4DQIA 4CGHA 5CYQA 3OVNA 2D0BA 1I3AA 3AA2A 4LD0A 4CHPA 4HUGA 3U6FA 3S3OA 4IKFA 4J2DA 4HCCA 2WONA 3KJVA 2D0CA 4O0JA 3T1AA 2RN2A 2X6NA 1EXQA 1LAWA 3VQ8A 2O4IA 4F2RA 3SV4A 4B9NA 2HVIA 1WSIA 4FJLA 4FCYA 1DLOA 2KZMA 2F96A 3RRGA 4CHYA 3AVLA 4M3WA 3NH2A 4CJQA 2P5OA 4IBNA 1U04A 4KREA 3OYIA 2AJQA 2BDPA 1I39A 1HYVA 4FM0A 4DFJA 1L3UA 4O55A 4CJ4A 3ZSOA 3SPYA 3NHGA 3NH1A 1QTMA 1IH7A 2OA8A 4PWDA 1CZ9A 1L3TA 4NCGA 4C8OA 1IKWA 5C25A 3F73A 2XY5A 4M41A 4CHNA 3CQ8A 5FROA 4B9SA 4B8CA 3QEPA 3SI6A 1WSEA 4PY5A 3DLGA 1Y97A 3EZ5A 1U48A 2P5GA 3CFPA 3MAQA 1LV5A 1ZBHA 3HVTA 4E1NA 5HP1A 1VSMA 3P1GA 1KFSA 3VQ4A 2I5JA 4LSNA 3SUPA 4FJGA 3O4QA 3VQBA 3JSMA 4Q0BA 1NK0A 4FW2A 2Y1IA 3SUQA 4CFBA 2HNZA 3OYCA 2VG6A 4CGFA 4EP5A 4BDPA 4PQUA 3HVRA 1L3SA 3PX4A 4K8ZA 1TKTA 3T19A 1NKEA 3TABA 4DQQA 2OPSA 4BDZA 1NKCA 2BGGA 2HHWA 1GOCA 5CYMA 3ISNC 4RW4A 3DLKA 4ZHRA 5KRSA 3LP3A 3O4NA 4CFDA 3O3FA 1IKYA 4M3TA 1JLEA 1QHTA 1WSGA 4J2BA 1NK5A 5FRNA 2Z1HA 3PX6A 1IKVA 4DTRA 1JLCA 1C1CA 3RR7A 1RDAA 3S3NA 2DFHA 3HM9A 4J2AA 4JRQA 2YNFA 4KHWA 2KW4A 3OY9A 3OJUA 2HB5A 4M3RA 3SUNA 1UAXA 3G10A 3ZSRA 1ASWA 3QNNA 1S1XA 4KHNA 4E7JA 3VA0A 2YHBA 3KIOA 2ATQA 3AVBA 3C94A 3VQEA 1A5VA 1C0MA 1NJXA 3TARA 4N5SA 2DFEA 3DM2A 1WAJA 4Z4GA 4DSIA 4FJ5A 4OPKA 5FRMA 4QCLA 1SL0A 3G0ZA 3LWMA 1BCMA 4WE1A 4M3UA 3NAEA 1KLNA 3RR8A 3RWUA 3S3MA 2Z1JA 3I0RA 4DTOA 4GW6A 3ZSZA 1C6VA 2VWJA 4FZZA 4Z0UA 3TANA 1KVBA 1HNIA 3LALA 3VQ9A 1ZYQA 4KHUA 2RPIA 1VSDA 1QSYA 4KRFA 1SV5A 4DU4A 4B9MA 2GUIA 4CGJA 2VG7A 5EU7A 3VQAA 1RTIA 1HMVA 4RW8A 4DS5A 4C8KA 1BHLA 3VQDA 4O0IA 4FJ8A 4CHQA 1CLQA 4CGGA 2G8WA 5JS1A 2X6SA 4KPYA 2IS3A 3AVJA 2JGUA 4KO0A 4B9VA 4W5OA 4FJKA 3KLHA 3L2QA 1CXQA 2D0AA 3WNFA 1VSJA 4CEFA 3L3VA 3VQ7A 1A5WA 3SV3A 1VSFA 3K59A 3RMAA 2Q3SA 4DLEA 3AVMA 2HNDA 1UWBA 1BQNA 3KLIA 4KTWA 4KV8A 4RW9A 3TI0A 3SYZA 3THVA 4DWIA 1Z26A 3AO5A 3DLEA 4QAGA 4KHQA 2HVHA 4CK2A 1GOAA 1RTDA 1CXUA 2Z1GA 1TV6A 3OYBA 4FJXA 3EYZA 4KHSA 1DTQA 3U3YA 4E3SA 2E4LA 2YKMA 3D0PA 4DG1A 3NGZA 3KKRA 4Q5VA 1IG9A 2PYJA 3CFOA 2B4JA 4M3YA 2GBZA 3LP0A 4CJPA 3K2PA 2LSNA 1RBRA 4FLXA 1Q9YA 1RBSA 3VQQA 4AH9A 4OGEA 2IDOA 4ID1A 3PV8A 1SKWA 4G1QA 4CF1A 1S5JA 2B6AA 3OYKA 3AVNA 3NCIA 4NCBA 3JYTA 2XHBA 4K8XA 3DI6A 4KI4A 4YNQA 2FBTA 4HVJA 3IAYA 1X1PA 1J9AA 3RMCA 3S9HA 4CJTA 3QESA 4GMJB 4Z4FA 1ZBLA 2KFNA 4BE2A 4CEBA 3NGIA 3VQPA 3ASMA 4M42A 3OS0A 3TAFA 2ETJA 4CJSA 2KQ2A 2G8VA 1EP4A 1Q8IA 3NF7A 4CEAA 1TKZA 1YVUA 4DSEA 3HP9A 4DSKA 5CZ2A 1XHZA 3DYAA 5HRSA 1J5OA 3UIQA 2YNHA 3MXJA 2ZE2A 4F3TA 3QEWA 3H08A 4I7FA 4DTPA 3OYFA 4DTMA 3HYFA 1TK8A 4NYNA 1XWLA 4CIGA 4E7LA 3QEXA 4L8RB 5SWMA 2QKKA 1RNHA 3DOKA 3PX0A 2ZD1A 4F2SA 3V9WA 3ZSQA 4CEEA 4IG0A 2XY8A 4ZTJA 4C8LA 3QNOA 1SL2A 1JXEA 3SZ2A 2G8UA 3AVFA 2YNIA 1LWCA 3V1QA 1UOCA 3AVIA 1UA0A 3DRSA 1VK0A 1W9HA 2JLEA 4O4GA 1NK8A 3HP6A 1SUQA 3QEIA 1Z25A 1ASUA 1JLAA 3QIPA 2A1SA 3E01A 4AHCA 4QOZB 3LP2A 2B5JA 4IG3A 4DSFA 1T8EA 1FXXA 3HPHA 3CM6A 3KK1A 3AA3A 4FLWA 3TAPA 5J2PA 1TK0A 2KZZA 4OPJA 1WAFA 1IO2A 2KTQA 3M8RA 3RMBA 5E41A 4W5TA 4NCAA 1RTHA 4C8NA 3DRRA 4DQSA 3OYEA 4HTUA 1KRPA 3NFAA 3QO9A 1T05A 3SJJA 1VSEA 4OVLA 4FK4A 1BI4A 4DLGA 1FKOA 3QETA 4JS5A 3LPTA 4H4MA 3K58A 5HBMA 3ZSWA 2G8FA 1B9FA 4DSJA 5KI6A 2HHVA 1D9DA 4FVMA 2DY4A 1S9GA 1RT3A 5I42A 1QE1A 3C95A 3NF8A 4CJ5A 2IOCA 1RILA 4CGDA 1F21A 4F8RA 4YFUA 3M8QA 1KVCA 1VRUA 3SQ2A 4OJRA 2FBVA 4IDKA 4OKJA 3TAQA 3B6PA 2EX3A 4CJWA 4OLBA 4FLZA 2A1RA 1RCHA 2R7YA 3D45A 3L3UA 1RBTA 1BL3A 1ZBUA 3QIOA 4CE9A 2OPQA 1HPZA 1LAVA 3P83D 4E1MA 4RW6A 3VA3A 3NH0A 3SQ4A 2IC3A 3SQ1A 2G8KA 1CZBA 1LW2A 4DTNA 3IS9A 1B9DA 4IFVA 5HRPA 3ALYA 3M8SA 1X9WA 3AA5X 4FJ7A 1C1AA 3KD1E 4CHOA 5D3GA 3LAMA 4FZYA 4FM1A 1YTAA 2E6LA 2EHGA 4CJKA 4BACA 4N76A 1SKRA 4FK2A 2YHAA 4Z4CA 1HQUA 1RDCA 4W5RA 4DU3A 3ITHA 3KD5E 2FBYA 1GOBA 5DMRA 5KTQA 2QXFA 3KLEA 2P51A 2RF2A 4HHTA 4BE0A 4PUOA 4HUEA 4CEOA 5KRTA 5FDLA 3V1RA 4CERA 2HHUA 3TR8A 3NDKA 4AHSA 4CFAA 4E19A 1SKSA 3HJFA 3RMDA 3LPUA 1S1UA 2OZSA 4W5NA 3K57A 5J1EA 1S1TA 3K5NA 1HJRA 1WSHA 2VG5A 4CEZA 3NF6A 4CF8A 1NJWA 5C24A 3KLGA 1HYSA 4I2QA 2OYQA 1O1WA 4OKEA 3LDSA 3V1OA 1RBVA 1C1BA 1RDBA 2HMIA 1LWFA 2IAJA 4CJRA 4N47A 2BANA 3OS2A 1HRHA 3HT3A 1TKXA 3KK2A 2E6MA 1S1VA 1N6QA 1J53A 4CIFA 1J54A 1WNSA 3MEDA 4B9UA 4MFBA 4DTSA 1EETA 1D8YA 1BGXT 1RT4A 1T03A 3KLFA 1G15A 4DF4A 3L2UA 4Z4IA 1JLGA 4M45A 4DTXA 1ASVA 1JLQA 1JL2A 3CYMA 3WNHA 1NJYA 3AO3A 3VQCA 3U3GA 3AO4A 3OJSA 3NE6A 1UA1A 1K6YA 1KTQA 4Z4HA 1X9MA 1NK9A 3HPGA 1JLFA 4HCBA 3AO1A 4CIEA 2G8IA 3HSTB 3O3GA 1TAUA 2ZQBA 3ZSXA 5DK5A
chains in the Genus database with same CATH superfamily
3ZEUB 4H4OA 2FC0A 4E0DA 4AHUA 4DR2K 5GINA 3JS6A 2GWJA 3IFRA 3SPZA 1XI1A 4DF8A 3O08A 2X78A 2NZTA 1N32K 4RG8A 3DOLA 3ATUA 4ELUA 3MWPA 2QWNA 3LDLA 4BWJA 5B8HA 2XY7A 4CK1A 4LH5A 2VCPA 1HQEA 2HHSA 2IVOA 3VQ6A 3GDQA 2PAVA 3A5NC 3WXJA 4C8MA 1B92A 2QKBA 3CCUN 3HOTA 1EKEA 1WN7A 2XRIA 3O3HA 1VRTA 3V4IA 3OW2M 2O8EB 1EX4A 5HLFA 1WSJA 3NBPA 3K5LA 4DTJA 4BR0A 4DFKA 4JKBA 4B3SK 4H5NA 1BUPA 3OYAA 4B3OA 5KGWA 3LANA 4CECA 3AVGA 3O9TA 1REVA 4CJLA 2VYPA 2ITMA 1QS4A 4ZTFA 4NYFA 4DQRA 2FSJA 3PO4A 3NVMA 3CETA 1JL1A 3WNEA 4FJMA 1MU2A 3LAKA 2QK9A 4LC9B 5KGXA 1NMNA 3FZKA 4JHDA 1TKDA 3GBTA 4JV5K 3FZLA 3CM5A 4O5BA 2V7ZA 5EX5A 1Q81O 3V81A 1T44A 3TWHA 1QVFM 5A2QO 4FWOA 3C6HA 2RE2A 4LY7A 4LFBK 2HF4A 2IGIA 2O8EA 5C42A 1QQMA 1S1WA 1S6PA 1BIZA 3THWA 4BR9A 5CY4A 3EEQA 3TAEA 4KFBA 4DU1A 3DMJA 5I3UA 3FE1A 3MECA 3RTVA 3HL8A 1BISA 3O9QA 4B1XB 4PL7A 4U7BA 4BRPA 4FLUA 4E7IA 3M5RA 4CZGA 1W7AA 4F4KA 1RDUA 4OPAA 4EP4A 4AHTA 5F0XA 1D9FA 2YI1A 1XMQK 4J2EA 1RT7A 4I9LA 3K9JA 4IOAL 4FWRA 4DMNA 4H0OA 2QM1A 4YOUA 4N56A 1KC8O 1JCGA 5GAHP 3AVHA 3V9ZA 1YIJN 4MQ3A 2OPRA 3IRXA 4FK0A 3R9PA 1T7PA 4CGHA 1WBDA 4FWMA 1I3AA 5AQJA 3U6FA 4IKFA 1R59O 5CE3A 4O0JA 2WFBA 3T1AA 2X6NA 1X9JA 2QWPA 3SV4A 5AQTA 3J7AP 3LDNA 4JI3K 1HKGA 5IT9O 3AVLA 3L0QA 3DXKB 3NH2A 4JI7K 1QQOA 3SJHA 4IBNA 5GIPA 4L3QA 1E3MA 1L3UA 4O55A 2HBMA 4CJ4A 3ZSOA 4BC2A 1YJWN 4IFEA 3TPQA 1IH7A 4FWSA 5BPLA 5C25A 4YOTA 4M41A 2YHYA 2Q36A 1ZC6A 1JCFA 1VQKN 3BP8A 3LDQA 3QEPA 4PY5A 2A41A 1YVNA 1YAGA 1VSMA 4HWIA 4Q0BA 3SUQA 4CFBA 4PKIA 4BDPA 2VG6A 2ZWHA 1WBBA 4H5TA 4B1YB 3HVRA 1L3SA 1TKTA 3T19A 3ATVA 1HX1A 1ATRA 3O3FA 1JLEA 1WSGA 2Z1HA 5JMVA 1NGAA 4DTRA 1C1CA 2UXCK 4H5VA 4DB3A 3O9SA 3OY9A 3ENBA 4CVNE 4E7JA 3VQEA 2ATQA 1C0MA 3TARA 4N5SA 3UKUB 3N4QA 3L6QA 3VERA 4DSIA 5AQZA 1T6CA 3U9DA 3G0ZA 3KK7A 5BN8A 1VQ9N 4WE1A 4M3UA 3NAEA 3S3MA 4IOXA 4DTOA 1C6VA 4Z0UA 2E2OA 3BF1A 1VSDA 3DAWA 1W2BM 3MWTA 4WYBA 1VQ6N 3VQAA 4H0PA 4CZHA 4RW8A 4O0IA 4CHQA 1QZ5A 1CLQA 5EY4A 3KWIA 2VGMA 3MN7A 2UXDK 2JGUA 4B9VA 3A8YA 3D2EA 3EZWA 4A5AA 1NM1A 2D0AA 3WNFA 3J7YP 1VSJA 3L3VA 3VQ7A 3K59A 2Q3SA 2QWQA 3TI0A 3SYZA 2PFUA 4DWIA 1NGHA 3VMFB 4LFCK 4K25A 1RTDA 2Z1GA 4OO1J 4E3SA 2E4LA 3A5LC 1HNWK 2A6AA 2B4JA 2GBZA 3LP0A 3K2PA 4CBXA 4DCHA 1Q9YA 1WOQA 4IEEA 4OGEA 2W40A 3O4WA 4CF1A 4G1QA 3B8AX 2B6AA 3OYKA 3RVCA 4K8XA 4YNQA 4WCEL 1X1PA 1J9AA 4EIAA 3QESA 2KFNA 4CEBA 3NGIA 3VQPA 3A5OC 4M42A 4X66K 3TAFA 3BZKA 4CEAA 1TKZA 2W41A 4DSKA 2W6KA 3H08A 4DTPA 3OYFA 1VHXA 5LY3A 4GV3A 1TK8A 3LM9A 4CIGA 3QEXA 3L4IA 1KAXA 1RNHA 3V9WA 4IG0A 4YDUC 1E4GT 1SL2A 2G8UA 3ID8A 3V1QA 4BRGA 3NMUA 4O4GA 4R79A 3VEYA 4QOZB 3WUHA 4IG3A 4DSFA 1T8EA 1FXXA 3TAPA 5GAGP 5AFUA 1YXQA 3EKSA 3OYEA 1KRPA 2P9UB 3BY5A 2YJFA 1FKOA 4JS5A 5AJ3K 3F9MA 4AM7A 5KI6A 1D9DA 1GLCG 4FVMA 2NRWA 1FJGK 4CJ5A 5EXWA 4F8RA 4YFUA 4JK9A 1VRUA 3JAMO 1NMDA 4OLBA 2AA4A 1QHAA 2A1RA 3L3UA 1BL3A 4WQ5C 2OPQA 1HPZA 3P83D 3VA3A 4QCLA 3SQ4A 4KAZA 3SQ1A 1LW2A 1FW6A 3IS9A 1BU6O 3L4QA 2QW9A 3I8BA 1YTAA 4Z4CA 1HQUA 3VESA 4W5RA 4GV6A 3MMVA 4PUOA 3V1RA 2HHUA 3H1QA 1SKSA 3MCAB 5AFUH 1SZ2A 5ADXH 1JCEA 1S1TA 3VENA 1WSHA 4I6MB 3KLGA 4OKEA 4IZ9A 2GX9A 1CZAN 3LDSA 2IIRA 1VQLN 1N33K 2IAJA 4CJRA 3MN6A 4FOIA 4BRKA 3OS2A 1HRHA 3HT3A 1BO5O 1TKXA 2I7PA 3T7ZA 3DWLA 1N6QA 5GAEP 3UKUA 1WNSA 3MEDA 3MDQA 4MFBA 4FWLA 3KHYA 1TYQB 3CIPA 1MA9B 3PSIA 2YJEA 5C2DA 4DUYK 2W6LA 1JLQA 1JL2A 1NJYA 3AO3A 4RWTA 4JI0K 5AQGA 2A5XA 1UA1A 1X9MA 2Q31A 3HPGA 1NGFA 3HRGA 5DK5A 4A61A 2YHXA 2BH1A 4CJEA 3V9SA 3E9LA 1WLJA 3MEGA 3HK2A 4RW7A 4JD2B 3TSQA 4LF4K 1KFDA 5ELZA 5JICA 4B8AB 4JS4A 4XIUA 4AHRA 4EZ9A 1OVYA 1QQNA 1IJJA 4CBWA 2ITGA 3CG7A 5BPNA 3OYNA 1S72N 4PL8A 1NK7A 4KKOA 3CCMN 4CESA 1KQSM 4KH6A 3NF9A 4FJJA 3ULEA 4FWNA 3ZT1A 3CC7N 2PBDA 3HM8A 2HW3A 2H3GX 2P1JA 2QWOA 4Y1DA 4BR4A 1XHXA 1DTTA 3MEEA 1VQ5N 1A5XA 1DGKN 1HNVA 4FPBA 4E7HA 1VSLA 3TSUA 1NGJA 2KHOA 3HPOA 2IVNA 4FOEA 3H1VX 1EO1A 2OPPA 1NOYA 1ZBIA 3HXMA 4CI6A 2HBJA 4H0VB 4GNIA 4FLTA 1K8AO 3ZT3A 4CZJA 3KVGA 1WUAA 1NJIO 1YHQN 3VPZA 2HMPA 1FKPA 1RBUA 4LH4A 4M3ZA 2E1ZA 4BC5A 3L2WA 3FZHA 2ASOA 4JHDB 3QICA 3T3FA 3ENHA 2UUAK 4E89A 3A0IX 4OLAA 3ZX0A 3ULDA 3M8PA 4CEQA 5K14A 3RSEB 1KVAA 3QEVA 3PY8A 2O8CB 4BRMA 2IVPA 1QQCA 4KHYA 4ELVA 2DTUA 2ZJRL 3TTCA 4I2PA 3CXCM 1RGIA 3C6UA 4FWKA 2P9LA 1YF5L 3QDKA 3C65A 1TGOA 3OYLA 3KKSA 3LZIA 4GKJK 3F9KA 2OCEA 2Z1IA 1FK9A 3LWLA 3AVAA 2DFFA 1RT6A 1RT1A 4BQLA 3CPWM 1U47A 4CEDA 5CZ1A 3VF6A 3T69A 1XNRK 4BRLA 4CW7B 4MO4A 1N5YA 4R5PA 3L8BA 4I9QA 3BDPA 3PIOL 4CF9A 4WFAL 1S6QA 3V6DA 4BRQA 4DSLA 3G6EN 1RT5A 5JS2A 4BRDA 4DV7K 3L2RA 4MO5A 5AQHA 4KTQA 3CFRA 3SBTA 5C15A 4BQZA 1ZBFA 5HRRA 3IG1A 2F8SA 4DR7K 3OS1A 4AILC 3TAMA 1WB9A 3U9ZA 2VWKA 1D5AA 3FFIA 5KQ8A 1BI4B 1H1VA 4FJNA 2PYLA 1YUWA 3A2FA 4EFHA 4BRNA 5AQNA 3WXMB 2D0BA 3AA2A 4CHPA 5AQKA 3UB5A 4LD0A 4XH4A 2WONA 4B1WB 1BA0A 1XC3A 3R8EA 4F2RA 1XNQK 2O8CA 5BN9A 4CHYA 4CJQA 2GUPA 4DV5K 2P5OA 4BR2A 3OYIA 2BDPA 4IXCA 3J80O 1I39A 1HYVA 3CQYA 5JVHL 3C7NB 2OA8A 4NCGA 3F73A 1I94K 4B9SA 1Y97A 4ISEA 1LV5A 3HVTA 5AQLA 4E1NA 3VEWA 3SUPA 3O4QA 1NK0A 4FW2A 4CGFA 4EP5A 5IWAK 4K8ZA 4LF6K 3TABA 2QWRA 3C6AA 4CZKA 2OPSA 1NKCA 4FSVA 1GOCA 5KPTA 2FF6A 4M3TA 4J2BA 5AZIB 5BPMA 5BRDA 3VTHA 3RR7A 1RDAA 3S3NA 2DFHA 3HM9A 3G25A 4J2AA 2YCHA 2KW4A 3OJUA 1UAXA 3G10A 1S3XA 1ASWA 3ZSRA 4KHNA 4EAHD 3C94A 4ISGA 4Z4GA 3HOSA 4OPKA 5FRMA 4KBOA 4A2BA 1SL0A 4ILHA 1IBKK 3I0RA 3HSCA 4GW6A 3O1BA 4DKWA 1KVBA 1HNIA 3FZFA 1ZYQA 4KHUA 5BR9A 4KRFA 1SV5A 4DU4A 4B9MA 4BROA 4C8KA 1GLDG 4JKHA 2HBKA 3T1HK 2X6SA 4CZIA 4W5OA 3CPEA 1EQYA 3QFUA 1CXQA 1O13A 1A5WA 1VSFA 4FWPA 5C2FA 1BQNA 3KLIA 4KV8A 4K41A 4KHQA 3P4IA 4CK2A 1TV6A 3QB0A 3OYBA 3UKRA 3O5BA 3EYZA 1DTQA 1K73O 3D0PA 4DG1A 3KKRA 4PKGA 4BVPA 3CFOA 2E5LK 4M3YA 4CJPA 2LSNA 1RBRA 5AQUA 3PIPL 4IOCL 4AH9A 4JKEA 3PV8A 3ZETA 3D2FB 2P9SB 1S5JA 3AVNA 1GLFO 3IMXA 3JYTA 4F9OA 4KI4A 4Z4FA 3S9HA 4H5RA 2ZF5O 4O8UA 4BE2A 4C1NK 4CJSA 2FF3B 1EP4A 1Z05A 4DSEA 3HP9A 3U8XA 5CZ2A 5HRSA 3CCVN 2YNHA 2ZE2A 3QEWA 2O8BB 4DTMA 3HYFA 1OH6A 4NYNA 4E7LA 4L8RB 2F9TA 5AQYA 2F7TA 3PX0A 1V4TA 4ZTJA 1YI2N 3F5TA 2YNIA 3CCQN 3AVIA 1VQ8N 1W9HA 4LF7K 3M6GA 3ZYYX 3QEIA 1ASUA 2ZGZA 3CJ1A 4A57A 3E01A 4AHCA 3MX2A 3CM6A 4B3RK 3KK1A 4FLWA 3EE8A 1WAFA 1IO2A 3M8RA 5M1NA 3FZMA 3E9PA 4NCAA 1RTHA 3THYB 3DRRA 4DQSA 3NFAA 4OX9K 5KPRA 3G4SN 1VSEA 2HOEA 4OVLA 1BI4A 4DLGA 5F2RA 3QETA 3NVKA 3LPTA 1B9FA 1HNZK 2V7YA 2DY4A 1RT3A 1QE1A 1GLJO 3NF8A 1NG9A 4B3TK 2IOCA 1N34K 3M8QA 1NLVA 5CR4A 4IDKA 3B6PA 4CJWA 2QTDA 2R7YA 4HTUA 1BWFO 4RW6A 2G8KA 1CZBA 3M8SA 2WC9A 3KD1E 4CHOA 4B9QA 4O8KA 5TKYA 4FM1A 2E6LA 4CJKA 4FK2A 4JI6K 2KLAA 2YHAA 3VGLA 3QBXA 3DLLL 1RDCA 4DR3K 3ITHA 4HHTA 5KTQA 4BE0A 2RF2A 4HUEA 4CEOA 2P9NA 2RHKA 2WTUA 4K43A 5FDLA 4CERA 3SAHA 5HL7L 4H5WA 3TR8A 3HJFA 3RMDA 3LPUA 5M1FA 4W5NA 3K57A 4CEZA 4M7XA 5C24A 1NWKA 4I2QA 5AQQA 1O1WA 1VQ7N 1U6ZA 1RBVA 4WF9L 1C1BA 1RDBA 2D4WA 2WBNA 3H3OB 3LM2A 5BREA 3E1YA 1TYQA 1J53A 4CIFA 1J54A 4DTSA 5M1KA 1EETA 1D8YA 1BGXT 2NRTA 4CJ7A 4H0XB 4M45A 2P9IA 3BF3A 1SQKA 3VQCA 3P39A 3U3GA 2YHWA 3TTDA 1K6YA 1KTQA 4Z4HA 1KD1O 3HSTB 3O3GA 2ZQBA 4JKAA 1TVRA 4DQPA 3WNGA 1TUUA 4KI6A 4YDUA 3FR0A 1HJOA 5J2MA 1K8KA 3DLRA 4DFPA 4PKHA 4Y1CA 5GADP 4FO0A 4JLHA 1TK5A 4ICLA 3OHRA 4KB1A 3K5OA 1VSHA 2OZMA 5AQPA 4CJFA 3ZSVA 4QS7A 1W97L 1VSKA 1T05A 4FJHA 5T7BA 4JRPA 2UU9K 2O4GA 3ZT2A 2OTLN 3DRPA 1C0TA 2HHTA 4BDYA 5FPDA 4WFNL 4BVOA 4HUFA 4YOWA 1BDGA 3D2FA 3AV9A 4B08A 1Y64A 4KB0A 3LL3A 4IFYA 4GV9A 1NOZA 2WOMA 4LF5K 2UUCK 1IKXA 5HROA 3QINA 2ZJPL 1M1KO 3WXLA 4CF2A 4PA1A 1YT3A 4CCHA 3D2EB 4DTUA 2D0OA 2Y1JA 2A3ZA 3VGMA 4AHVA 5SZTA 4CJVA 1ATSA 3B6OA 3SNNA 1YJ9N 1C0FA 3PO5A 1C0UA 3H6EA 2NRZA 2FBXA 2P9KB 4FW1A 3DXMA 3AVCA 2D5RA 3SAGA 4N41A 1SL1A 1BA1A 1KCFA 1U45A 4DV2K 1T3VA 2CH6A 1OH5A 3H45C 3O1WA 4I6MA 3FGUA 1NGBA 3NGYA 4WFBL 4CHZA 3HO1A 4BR7A 5LMNK 3VF4A 4E7KA 4FM2A 1JLBA 2CGJA 1JKHA 1LW0A 3VTIA 1ITGA 1VQPN 2HNYA 1RT2A 3L2VA 2J4RA 3CJ7A 3VEZA 4OKKA 1QSSA 3PUFA 3R1XA 2XO7A 3ZCMA 3TAGA 3ZT4A 3QLHA 4CZLA 2G8HA 3LZJA 4TSXA 2KFZA 2E1YA 2F8TA 3C6TA 2HHXA 1VQON 1GLBG 4BG9A 1NK6A 5GIOA 2BUPA 1NJZA 1NBWA 4O44A 3SCXA 3P5JA 2W42A 3J81O 2YKNA 4KH5A 2O8FA 3V9XA 5J2QA 1YTUA 5AQFA 1P90A 5JLFA 4X64K 3ZT0A 2QXLA 5M1PA 3RSEA 4M3XA 1BQMA 1GLLO 3OYGA 3AGKA 3THXA 3MXIA 4ID5A 4X62K 4LSLA 4DS4A 3PLAA 5CYQA 3OVNA 1ESVA 3S41A 3HBTA 4HUGA 4B1UB 3UKRB 4J2DA 4B1ZA 2D0CA 2RN2A 3VQ8A 2O4IA 4AQYK 4B9NA 2HVIA 4FJLA 3HI0A 2KZMA 3RRGA 3H3NO 1U04A 4KREA 1Q18A 1NGCA 4YHHK 1L3TA 4CHNA 3CCRN 5FROA 5FLXO 2ZJQL 3SI6A 1U48A 2P5GA 1ZBHA 3I55N 3P31A 1KFSA 1VQMN 4FJGA 3VQBA 2NRXA 3IDHA 3OYCA 5M1QA 3BEXA 4PQUA 3PX4A 2P9NB 4BRFA 3FFKB 4DQQA 2HHWA 4BDZA 2BGGA 3UE5A 4ZHRA 5KRSA 5AQXA 3LP3A 3O4NA 5BRFA 1NK5A 1IKVA 4AF1A 1JLCA 4LF8K 4B3MK 2HBLA 2HB5A 4M3RA 3OBWA 4JKGB 3QNNA 1S1XA 3CF5L 3VA0A 3KIOA 4HTLA 3AVBA 1A5VA 4C23A 3DM2A 5MLCQ 4XEIA 2NLXA 5F1XA 2CGKA 3C7NA 3MN9A 3LWMA 1BCMA 3OTOK 1P8ZA 3CC2N 4DV6K 3RWUA 2Z1JA 2OTJN 4O5FA 4FZZA 1J6ZA 3CJAA 3TANA 3VQ9A 3LALA 4ILJA 2DPNA 3O9UA 1QSYA 2A40A 2GUIA 2VG7A 5EU7A 1RTIA 1HMVA 1BHLA 4JI2K 4BR5A 4CGGA 5H1SQ 2O8BA 4KO0A 3IKMA 4FJKA 3Q7BA 3L2QA 4JI4K 5AQOA 4H03B 3WT0A 3AVMA 4KHPK 2HNDA 3KZBA 4KTWA 4RW9A 4FYDA 1MWMA 3O6WA 3D6RA 1Z26A 3AO5A 3DLEA 1GOAA 1CXUA 4DR1K 3G71N 2NRHA 5M1OA 3U3YA 2YKMA 3NGZA 3SMSA 3MN5A 4JKCA 4WQ5A 1RBSA 1OVQA 3TTFA 1SAZA 2IDOA 1VQ4N 3VETA 5HOOA 4BGBA 2E2QA 4NCBA 3CJ9A 5C0YA 3IAYA 3THWB 4H0TB 3RMCA 3QFPA 4CJTA 4MLHA 2E20A 1ZBLA 4JKFA 1ZXOA 3ASMA 3DXKA 2HF3A 3WQUA 3ZX2A 1MWKA 2ETJA 2KQ2A 1HPMA 2G8VA 1Q8IA 3NF7A 4IJAA 1YVUA 1J5OA 4I7FA 2E2PA 1Q82O 2Q2RA 5SWMA 5LL6Z 4IDHA 4JI5K 4F2SA 2ZD1A 4C8LA 4NB4A 3VEOA 3QNOA 1JXEA 3TU5A 2QWLA 1LWCA 4BRAA 3DRSA 1VK0A 4NLBA 1SUQA 2VQFK 1Z25A 3QIPA 2QEXN 2A1SA 2P9LB 3LP2A 3CQXA 3LDOA 3KWGA 3SMPA 3AA3A 3JXUA 1TK0A 1D4XA 3RMBA 1RDWX 1HNXK 5AZJB 3QO9A 5AQVA 1DT9A 4MDAA 3K58A 5HBMA 3ZSWA 1QVGM 3O80A 2HHVA 2P9PB 5TKWA 2P9KA 3C95A 4CGDA 1F21A 1DEJA 4OJRA 3CJCA 4JI8K 2FBVA 4OKJA 4C1NI 4FLZA 4BG8A 3ZX3A 1ILYA 4CZMA 4CE9A 1RBTA 1ZBUA 3QIOA 1KSPA 2ZM6K 4ELTA 3NH0A 2IC3A 4DTNA 4IFVA 1B9DA 5HRPA 3CCSN 3ALYA 1X9WA 3AA5X 4FJ7A 1C1AA 5ADXA 4JKGA 5D3GA 2EHGA 4N76A 2GWKA 4DV3K 4BACA 1SKRA 3I56N 3KD5E 2VGNA 5FPEA 1GOBA 3KLEA 2QXFA 2D1KA 1J5EK 1HLUA 3NDKA 4BY9C 1VAZA 4AHSA 4CFAA 3FLCO 4E19A 1S1UA 3MCPA 4QS8A 2VG5A 3NF6A 4CF8A 2E8AA 3EL2A 3CJBA 1HYSA 5AQIA 2OYQA 3WXKA 2F9WA 2OANA 2AP1A 4A5BA 4BC3A 1JJ2M 4JN4A 3QBWA 4N47A 2BANA 3AY9A 3KK2A 4DR5K 2E6MA 1S1VA 1RT4A 3SBGA 4QS9A 1T03A 4V19S 4DF4A 3L2UA 3VEXA 1JLGA 2Q0UA 4JK7A 4DTXA 1ASVA 3WNHA 2P9PA 4YOVA 1NK9A 3AO4A 4E1JA 3OJSA 4HCBA 4PWDA 3HZ6A 3AO1A 1TAUA 3ZSXA 4BGAA 1RDDA 2FXUA 1V4SA 3DJCA 4F3OA 1KAYA 3SUOA 1R0AA 1DKGD 1S9EA 2PZSA 1TAQA 2GTDA 4DHYA 1NNEA 4OPHA 1Q86O 1K9MO 2UXBK 4BRHA 4UQGA 1Z6RA 1L5UA 2X74A 1HYZA 2A42A 3F2KA 4GVMA 1X9SA 5HRNA 4DR6K 4BWMA 3EY1A 5KQDA 2XY6A 3K5MA 3EE9A 1X3MA 3WQTA 4IO9L 4FLYA 4WQ4A 3J8AA 2UUBK 3ZLJA 2KZZA 2NUBA 3M3ZA 4NO7A 3VQ5A 3SQ2A 4B9UA 3I8DA 3OYHA 1JXBA 4KTZA 4PHTX 5AQRA 5JVGL 4FZXC 3VN5A 1ATNA 4CF0A 3V9UA 4CGIA 4FJIA 3M1FA 1BCOA 5EOYA 1VSIA 5AZJA 3AO2A 1HR0K 1IBLK 2P9IB 4FWQA 1XC9A 1NKBA 3OYMA 3ZSYA 2YNGA 1MDUB 2CH5A 1EWQA 3QERA 2HHQA 1TL1A 2E2NA 3CCLN 4EZ6A 1T6DA 4CJUA 3OYDA 3H46O 4UY8O 4Z4EA 3MK6A 2HHHK 2YV0X 1IV0A 1Q9XA 4RCHA 4BE1A 1LWEA 4B9TA 2FLOA 1U4BA 1S22A 3LP1A 3O8MA 5C10A 4FXDA 3E66A 1L3VA 5DM6L 1X3NA 3SAFA 4FLVA 4CBUA 3DLBA 4EHTA 3KTQA 1TL3A 1NGIA 4EHUA 3AGRA 1RFQA 4A59A 3K0SA 2RKIA 3P38A 3KK3A 3I0SA 2NNWA 4H8KA 2P9UA 3W3DA 4MDBA 2VWBA 3J7ZO 3MXMA 1NU0A 4FVUA 1BIUA 4LFAK 3LDPA 3OYJA 2EWSA 5LJWA 4FJ9A 3AA4A 2PY5A 4GY2B 1WSFA 3GE1A 4B9LA 1U49A 3AVKA 3SQ0A 4MLEA 4DFMA 5J2NA 3DLHA 4DUZK 1KLMA 3IUCA 3CMEN 4LF9K 4W5QA 1QSLA 3RRHA 4CJ3A 4OGCA 3THYA 2GV9A 3BGRA 4Z94A 2BE2A 3MX5A 3VEVA 1IBMK 1W0HA 3CD6N 1RTJA 4CK3A 3BZCA 1NK4A 4CFCA 4CZFA 4DQIA 3R6MA 4JI1K 1LCUA 3CMAN 3S3OA 4HCCA 3KJVA 1G99A 1EXQA 1LAWA 2QA4N 1WSIA 4JKDA 2NRVA 4FCYA 1DLOA 2F96A 4CD1A 2ASMA 4M3WA 1BOTO 2P9SA 2AJQA 3N4PA 5AQSA 4FM0A 4DFJA 1HKBA 3SPYA 3NHGA 3NH1A 2O8DB 1QTMA 4X65K 1CZ9A 4C8OA 1IKWA 2XY5A 5FPMA 4JEPA 3CQ8A 4DR4K 2O8DA 4B8CA 3C0BA 3GOIA 1WSEA 3DLGA 4CD3A 3EZ5A 3CFPA 3MAQA 3ENOA 2D0PA 5LJVA 5HP1A 3P1GA 3VQ4A 2I5JA 4JNEA 4LSNA 4YY3K 2CGLA 4H0YB 3WEEB 3JSMA 1YJNN 2Y1IA 4YOYA 2Q97A 2HNZA 4GKKK 4K42A 2UYTA 4A2AA 4KH4A 3E9OA 1NKEA 3VGKA 1U2VB 5AZIA 4NXNK 5CYMA 3ISNC 4RW4A 3DLKA 4CFDA 1IKYA 1QHTA 3AAQA 5FRNA 3PX6A 5AQMA 3CHWA 5LMUK 3ZETB 4JRQA 2YNFA 4KHWA 1K8KB 3SUNA 3CI5A 3Q7CA 2YHBA 3QMLA 3WXIA 1HKCA 1NJXA 3TSPA 2DFEA 2GELA 3CERA 1WAJA 4FJ5A 5DM7L 1EWRA 1KLNA 3RR8A 3ZSZA 2VWJA 2RPIA 2QWMA 5C12A 4DV1K 2ASPA 4M7YA 4CGJA 4DS5A 2FSNA 3VQDA 2QI2A 4ILGB 5E84A 4FJ8A 1XUPO 3EKUA 2G8WA 3HTVA 2Q1NA 5JS1A 4KPYA 2IS3A 3AVJA 4CZEA 4RTFD 3KLHA 3A5MC 3EO3A 4CEFA 4YOXA 2BTFA 3SV3A 3RMAA 4DLEA 5BR8K 1UWBA 1OKJA 4FPAA 2HVHA 3THVA 4IEIA 4QAGA 1N36K 2NRRA 4DV4K 1NGDA 3K9KA 4FJXA 4KHSA 4GVEA 3OBYA 4Q5VA 4DV0K 1IG9A 2PYJA 4JD2A 4FLXA 3VQQA 2VQEK 3PSFA 4ID1A 3DXMB 1SKWA 1M90O 4NLCA 1GLEG 1SS6A 3NCIA 1TUYA 2XHBA 3CCJN 3DI6A 2FBTA 4HVJA 1IG8A 4GMJB 4WQ4C 3GL1A 1BG3A 2Q0RA 2V52B 3OS0A 2YX6A 2FSKA 1VQNN 3BUZB 4JYAK 1XHZA 3DYAA 1XQSC 2V51B 3UIQA 1NGGA 3MXJA 4F3TA 5CHIA 3O9RA 3GG4A 1LOTB 3ULEB 1XWLA 4YORA 1XMOK 2QKKA 3DOKA 3ZSQA 4CEEA 3CC4N 2XY8A 4IJNA 4J8FA 4IO8A 5FPNA 3SZ2A 4BRCA 3AVFA 1UOCA 1UA0A 1NK8A 2JLEA 4ISFA 3HP6A 1GLAG 1JLAA 4BREA 4K0KK 2B5JA 3HPHA 2JWKA 4M63C 5J2PA 4OPJA 2KTQA 5E41A 4W5TA 3AARA 1YITN 4C8NA 1ZBSA 2HSTA 4U67L 1KAZA 3R3LA 4B1VA 3SJJA 1OH7A 4FK4A 3OA9A 5AR0A 4H4MA 3D7EO 1Q7YO 2G8FA 4DSJA 1OH8A 5BRHA 2F4VK 1S9GA 5I42A 4BRIA 1RILA 2ZGYA 3T1YK 1KVCA 3EN9A 3TAQA 2EX3A 1RCHA 1N8RO 3D45A 1QZ6A 2E88A 2JWLA 1LAVA 4JAXA 4E1MA 3I33A 1E4FT 4JK8A 2I7NA 1KXPA 3ZEUA 4FL9A 3LAMA 4FZYA 4DU3A 1HUXA 3ID6A 2FBYA 5DMRA 4A62A 2P51A 3W0LA 3VF2A 4IWVA 5KRTA 3CCEN 2KKZA 4XH5A 4G9ZA 4BC4A 5KPZA 2OZSA 5J1EA 3K5NA 1HJRA 1NJWA 3U4LA 2WUSA 1NGEA 3V1OA 4Y0WA 2HMIA 1LWFA 5I9EB 5E26A 4NXMK 3SK3A 1C0GA 4DQ8A 5AQWA 3VOVA 3SLCA 5JLHA 3WEEA 4XH1A 4AM6A 3KLFA 1G15A 4Z4IA 2O8FB 3AAPA 3CYMA 1U2VA 5EVZA 3NE6A 1JLFA 4CIEA 2G8IA 2GEMA 3THXB
chains in the Genus database with same CATH topology
1TVRA 1RDDA 4H4OA 4CJEA 2FC0A 4DQPA 4AHUA 4E0DA 3WNGA 3V9SA 4KI6A 1WLJA 3SUOA 4F3OA 3MEGA 3SPZA 3HK2A 4RW7A 1R0AA 1XI1A 1S9EA 5J2MA 2PZSA 4DF8A 4FK0A 1TAQA 2X78A 3DLRA 4DFPA 4RG8A 3DOLA 4Y1CA 1KFDA 4B8AB 4JS4A 4XIUA 4ELUA 4JLHA 4AHRA 1TK5A 4EZ9A 4UQGA 1L5UA 4BWJA 2ITGA 1HYZA 2X74A 3CG7A 4ICLA 3OYNA 4GVMA 4KKOA 1NK7A 4CESA 1X9SA 2XY7A 4CK1A 5HRNA 4KB1A 3K5OA 3NF9A 4FJJA 4LH5A 4BWMA 3EY1A 3ZT1A 2XY6A 1VSHA 2OZMA 1HQEA 2HHSA 3K5MA 3VQ6A 2HW3A 4CJFA 4FLYA 4C8MA 1B92A 3ZSVA 2QKBA 2P1JA 4Y1DA 1EKEA 1DTTA 1VSKA 1WN7A 1XHXA 2NUBA 1A5XA 1VRTA 1HNVA 2XRIA 3MEEA 3VQ5A 5T7BA 3O3HA 3OYHA 1VSLA 1JXBA 2O4GA 3ZT2A 3I8DA 4JRPA 4KTZA 4E7HA 1EX4A 5HLFA 1WSJA 3DRPA 1C0TA 3NBPA 3VN5A 3HPOA 3K5LA 4DTJA 4FZXC 4BDYA 2HHTA 2OPPA 1NOYA 1ZBIA 4CF0A 3V9UA 3HXMA 4CGIA 4DFKA 4FJIA 1BCOA 4HUFA 4FLTA 3OYAA 3AV9A 4B08A 1VSIA 5KGWA 3AO2A 3ZT3A 4B3OA 4KB0A 3LANA 4CECA 3AVGA 4IFYA 1XC9A 1NKBA 1REVA 4CJLA 3OYMA 1QS4A 4ZTFA 4NYFA 1NOZA 2WOMA 3V4IA 3ZSYA 4DQRA 2YNGA 3PO4A 1FKPA 1IKXA 5HROA 1RBUA 3QINA 4LH4A 3QERA 4M3ZA 2HHQA 1TL1A 4EZ6A 4CF2A 3OYDA 4CJUA 4PA1A 3L2WA 1YT3A 1JL1A 3WNEA 4CCHA 4FJMA 4Z4EA 1MU2A 3LAKA 4DTUA 3T3FA 2QK9A 2Y1JA 5KGXA 5SZTA 4AHVA 2YV0X 4E89A 4OLAA 4CJVA 3ULDA 4FYDA 3M8PA 1Q9XA 4CEQA 4BE1A 1TKDA 3B6OA 3SNNA 1LWEA 4B9TA 3PO5A 1C0UA 3CM5A 5K14A 4O5BA 1U4BA 4FJHA 1KVAA 3QEVA 3LP1A 2FBXA 4FW1A 4FXDA 3PY8A 1L3VA 3V81A 1QQCA 3AVCA 4KHYA 2D5RA 4ELVA 4N41A 1SL1A 1KCFA 4FLVA 3TWHA 1U45A 2DTUA 3DLBA 4I2PA 1TL3A 3KTQA 3C6UA 3NGYA 4LY7A 1TGOA 3OYLA 4CHZA 2IGIA 3HO1A 3KKSA 4E7KA 2RKIA 3LZIA 4ELTA 3F9KA 4FM2A 2Z1IA 5C42A 1JLBA 1FK9A 3LWLA 1JKHA 3KK3A 3I0SA 1S1WA 1S6PA 1LW0A 4H8KA 3AVAA 1BIZA 1ITGA 3MXMA 5CY4A 2DFFA 2HNYA 4KFBA 1BIUA 4DU1A 3DMJA 1RT2A 1RT6A 1RT1A 3L2VA 3OYJA 5I3UA 3MECA 1U47A 4CEDA 5CZ1A 3RTVA 4OKKA 1QSSA 4FJ9A 3HL8A 3PUFA 1N5YA 1BISA 3AA4A 2PY5A 4R5PA 2XO7A 3L8BA 3BDPA 4I9QA 3ZCMA 1WSFA 3TAGA 3ZT4A 4FLUA 3QLHA 4CF9A 2G8HA 4B9LA 3LZJA 4TSXA 1U49A 4E7IA 2KFZA 1S6QA 3V6DA 2F8TA 3AVKA 4DSLA 4F4KA 3C6TA 1RT5A 5JS2A 4EP4A 4DFMA 5J2NA 3SQ0A 3DLHA 2HHXA 1KLMA 4AHTA 1NK6A 4KAZA 3L2RA 1D9FA 4KTQA 1NJZA 3CFRA 4O44A 4W5QA 3SCXA 3P5JA 1RT7A 1ZBFA 4I9LA 5HRRA 2W42A 3IG1A 4J2EA 2YKNA 4DMNA 3V9XA 5J2QA 1QSLA 1YTUA 2F8SA 3OS1A 3RRHA 4CJ3A 4AILC 3TAMA 4OGCA 3ZT0A 4N56A 2GV9A 3BGRA 2VWKA 1D5AA 2BE2A 3FFIA 3AVHA 4M3XA 1BQMA 3OYGA 3V9ZA 1BI4B 1W0HA 4FJNA 3MXIA 2PYLA 4ID5A 2OPRA 3IRXA 4MQ3A 1KSPA 1RTJA 4LSLA 3A2FA 4CK3A 4DS4A 3TAEA 1NK4A 1T7PA 4CFCA 4DQIA 4CGHA 5CYQA 3OVNA 2D0BA 1I3AA 3AA2A 4LD0A 4CHPA 4HUGA 3U6FA 3S3OA 4IKFA 4J2DA 4HCCA 2WONA 3KJVA 2D0CA 4O0JA 3T1AA 2RN2A 2X6NA 1EXQA 1LAWA 3VQ8A 2O4IA 4F2RA 3SV4A 4B9NA 2HVIA 1WSIA 4FJLA 4FCYA 1DLOA 2KZMA 2F96A 3RRGA 4CHYA 3AVLA 4M3WA 3NH2A 4CJQA 2P5OA 4IBNA 1U04A 4KREA 3OYIA 2AJQA 2BDPA 1I39A 1HYVA 4FM0A 4DFJA 1L3UA 4O55A 4CJ4A 3ZSOA 3SPYA 3NHGA 3NH1A 1QTMA 1IH7A 2OA8A 4PWDA 1CZ9A 1L3TA 4NCGA 4C8OA 1IKWA 5C25A 3F73A 2XY5A 4M41A 4CHNA 3CQ8A 5FROA 4B9SA 4B8CA 3QEPA 3SI6A 1WSEA 4PY5A 3DLGA 1Y97A 3EZ5A 1U48A 2P5GA 3CFPA 3MAQA 1LV5A 1ZBHA 3HVTA 4E1NA 5HP1A 1VSMA 3P1GA 1KFSA 3VQ4A 2I5JA 4LSNA 3SUPA 4FJGA 3O4QA 3VQBA 3JSMA 4Q0BA 1NK0A 4FW2A 2Y1IA 3SUQA 4CFBA 2HNZA 3OYCA 2VG6A 4CGFA 4EP5A 4BDPA 4PQUA 3HVRA 1L3SA 3PX4A 4K8ZA 1TKTA 3T19A 1NKEA 3TABA 4DQQA 2OPSA 4BDZA 1NKCA 2BGGA 2HHWA 1GOCA 5CYMA 3ISNC 4RW4A 3DLKA 4ZHRA 5KRSA 3LP3A 3O4NA 4CFDA 3O3FA 1IKYA 4M3TA 1JLEA 1QHTA 1WSGA 4J2BA 1NK5A 5FRNA 2Z1HA 3PX6A 1IKVA 4DTRA 1JLCA 1C1CA 3RR7A 1RDAA 3S3NA 2DFHA 3HM9A 4J2AA 4JRQA 2YNFA 4KHWA 2KW4A 3OY9A 3OJUA 2HB5A 4M3RA 3SUNA 1UAXA 3G10A 3ZSRA 1ASWA 3QNNA 1S1XA 4KHNA 4E7JA 3VA0A 2YHBA 3KIOA 2ATQA 3AVBA 3C94A 3VQEA 1A5VA 1C0MA 1NJXA 3TARA 4N5SA 2DFEA 3DM2A 1WAJA 4Z4GA 4DSIA 4FJ5A 4OPKA 5FRMA 4QCLA 1SL0A 3G0ZA 3LWMA 1BCMA 4WE1A 4M3UA 3NAEA 1KLNA 3RR8A 3RWUA 3S3MA 2Z1JA 3I0RA 4DTOA 4GW6A 3ZSZA 1C6VA 2VWJA 4FZZA 4Z0UA 3TANA 1KVBA 1HNIA 3LALA 3VQ9A 1ZYQA 4KHUA 2RPIA 1VSDA 1QSYA 4KRFA 1SV5A 4DU4A 4B9MA 2GUIA 4CGJA 2VG7A 5EU7A 3VQAA 1RTIA 1HMVA 4RW8A 4DS5A 4C8KA 1BHLA 3VQDA 4O0IA 4FJ8A 4CHQA 1CLQA 4CGGA 2G8WA 5JS1A 2X6SA 4KPYA 2IS3A 3AVJA 2JGUA 4KO0A 4B9VA 4W5OA 4FJKA 3KLHA 3L2QA 1CXQA 2D0AA 3WNFA 1VSJA 4CEFA 3L3VA 3VQ7A 1A5WA 3SV3A 1VSFA 3K59A 3RMAA 2Q3SA 4DLEA 3AVMA 2HNDA 1UWBA 1BQNA 3KLIA 4KTWA 4KV8A 4RW9A 3TI0A 3SYZA 3THVA 4DWIA 1Z26A 3AO5A 3DLEA 4QAGA 4KHQA 2HVHA 4CK2A 1GOAA 1RTDA 1CXUA 2Z1GA 1TV6A 3OYBA 4FJXA 3EYZA 4KHSA 1DTQA 3U3YA 4E3SA 2E4LA 2YKMA 3D0PA 4DG1A 3NGZA 3KKRA 4Q5VA 1IG9A 2PYJA 3CFOA 2B4JA 4M3YA 2GBZA 3LP0A 4CJPA 3K2PA 2LSNA 1RBRA 4FLXA 1Q9YA 1RBSA 3VQQA 4AH9A 4OGEA 2IDOA 4ID1A 3PV8A 1SKWA 4G1QA 4CF1A 1S5JA 2B6AA 3OYKA 3AVNA 3NCIA 4NCBA 3JYTA 2XHBA 4K8XA 3DI6A 4KI4A 4YNQA 2FBTA 4HVJA 3IAYA 1X1PA 1J9AA 3RMCA 3S9HA 4CJTA 3QESA 4GMJB 4Z4FA 1ZBLA 2KFNA 4BE2A 4CEBA 3NGIA 3VQPA 3ASMA 4M42A 3OS0A 3TAFA 2ETJA 4CJSA 2KQ2A 2G8VA 1EP4A 1Q8IA 3NF7A 4CEAA 1TKZA 1YVUA 4DSEA 3HP9A 4DSKA 5CZ2A 1XHZA 3DYAA 5HRSA 1J5OA 3UIQA 2YNHA 3MXJA 2ZE2A 4F3TA 3QEWA 3H08A 4I7FA 4DTPA 3OYFA 4DTMA 3HYFA 1TK8A 4NYNA 1XWLA 4CIGA 4E7LA 3QEXA 4L8RB 5SWMA 2QKKA 1RNHA 3DOKA 3PX0A 2ZD1A 4F2SA 3V9WA 3ZSQA 4CEEA 4IG0A 2XY8A 4ZTJA 4C8LA 3QNOA 1SL2A 1JXEA 3SZ2A 2G8UA 3AVFA 2YNIA 1LWCA 3V1QA 1UOCA 3AVIA 1UA0A 3DRSA 1VK0A 1W9HA 2JLEA 4O4GA 1NK8A 3HP6A 1SUQA 3QEIA 1Z25A 1ASUA 1JLAA 3QIPA 2A1SA 3E01A 4AHCA 4QOZB 3LP2A 2B5JA 4IG3A 4DSFA 1T8EA 1FXXA 3HPHA 3CM6A 3KK1A 3AA3A 4FLWA 3TAPA 5J2PA 1TK0A 2KZZA 4OPJA 1WAFA 1IO2A 2KTQA 3M8RA 3RMBA 5E41A 4W5TA 4NCAA 1RTHA 4C8NA 3DRRA 4DQSA 3OYEA 4HTUA 1KRPA 3NFAA 3QO9A 1T05A 3SJJA 1VSEA 4OVLA 4FK4A 1BI4A 4DLGA 1FKOA 3QETA 4JS5A 3LPTA 4H4MA 3K58A 5HBMA 3ZSWA 2G8FA 1B9FA 4DSJA 5KI6A 2HHVA 1D9DA 4FVMA 2DY4A 1S9GA 1RT3A 5I42A 1QE1A 3C95A 3NF8A 4CJ5A 2IOCA 1RILA 4CGDA 1F21A 4F8RA 4YFUA 3M8QA 1KVCA 1VRUA 3SQ2A 4OJRA 2FBVA 4IDKA 4OKJA 3TAQA 3B6PA 2EX3A 4CJWA 4OLBA 4FLZA 2A1RA 1RCHA 2R7YA 3D45A 3L3UA 1RBTA 1BL3A 1ZBUA 3QIOA 4CE9A 2OPQA 1HPZA 1LAVA 3P83D 4E1MA 4RW6A 3VA3A 3NH0A 3SQ4A 2IC3A 3SQ1A 2G8KA 1CZBA 1LW2A 4DTNA 3IS9A 1B9DA 4IFVA 5HRPA 3ALYA 3M8SA 1X9WA 3AA5X 4FJ7A 1C1AA 3KD1E 4CHOA 5D3GA 3LAMA 4FZYA 4FM1A 1YTAA 2E6LA 2EHGA 4CJKA 4BACA 4N76A 1SKRA 4FK2A 2YHAA 4Z4CA 1HQUA 1RDCA 4W5RA 4DU3A 3ITHA 3KD5E 2FBYA 1GOBA 5DMRA 5KTQA 2QXFA 3KLEA 2P51A 2RF2A 4HHTA 4BE0A 4PUOA 4HUEA 4CEOA 5KRTA 5FDLA 3V1RA 4CERA 2HHUA 3TR8A 3NDKA 4AHSA 4CFAA 4E19A 1SKSA 3HJFA 3RMDA 3LPUA 1S1UA 2OZSA 4W5NA 3K57A 5J1EA 1S1TA 3K5NA 1HJRA 1WSHA 2VG5A 4CEZA 3NF6A 4CF8A 1NJWA 5C24A 3KLGA 1HYSA 4I2QA 2OYQA 1O1WA 4OKEA 3LDSA 3V1OA 1RBVA 1C1BA 1RDBA 2HMIA 1LWFA 2IAJA 4CJRA 4N47A 2BANA 3OS2A 1HRHA 3HT3A 1TKXA 3KK2A 2E6MA 1S1VA 1N6QA 1J53A 4CIFA 1J54A 1WNSA 3MEDA 4B9UA 4MFBA 4DTSA 1EETA 1D8YA 1BGXT 1RT4A 1T03A 3KLFA 1G15A 4DF4A 3L2UA 4Z4IA 1JLGA 4M45A 4DTXA 1ASVA 1JLQA 1JL2A 3CYMA 3WNHA 1NJYA 3AO3A 3VQCA 3U3GA 3AO4A 3OJSA 3NE6A 1UA1A 1K6YA 1KTQA 4Z4HA 1X9MA 1NK9A 3HPGA 1JLFA 4HCBA 3AO1A 4CIEA 2G8IA 3HSTB 3O3GA 1TAUA 2ZQBA 3ZSXA 5DK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TVR A;  1RDD A;  4H4O A;  4CJE A;  2FC0 A;  4DQP A;  4AHU A;  4E0D A;  3WNG A;  3V9S A;  4KI6 A;  1WLJ A;  3SUO A;  4F3O A;  3MEG A;  3SPZ A;  3HK2 A;  4RW7 A;  1R0A A;  1XI1 A;  1S9E A;  5J2M A;  2PZS A;  4DF8 A;  4FK0 A;  1TAQ A;  2X78 A;  3DLR A;  4DFP A;  4RG8 A;  3DOL A;  4Y1C A;  1KFD A;  4B8A B;  4JS4 A;  4XIU A;  4ELU A;  4JLH A;  4AHR A;  1TK5 A;  4EZ9 A;  4UQG A;  1L5U A;  4BWJ A;  2ITG A;  1HYZ A;  2X74 A;  3CG7 A;  4ICL A;  3OYN A;  4GVM A;  4KKO A;  1NK7 A;  4CES A;  1X9S A;  2XY7 A;  4CK1 A;  5HRN A;  4KB1 A;  3K5O A;  3NF9 A;  4FJJ A;  4LH5 A;  4BWM A;  3EY1 A;  3ZT1 A;  2XY6 A;  1VSH A;  2OZM A;  1HQE A;  2HHS A;  3K5M A;  3VQ6 A;  2HW3 A;  4CJF A;  4FLY A;  4C8M A;  1B92 A;  3ZSV A;  2QKB A;  2P1J A;  4Y1D A;  1EKE A;  1DTT A;  1VSK A;  1WN7 A;  1XHX A;  2NUB A;  1A5X A;  1VRT A;  1HNV A;  2XRI A;  3MEE A;  3VQ5 A;  5T7B A;  3O3H A;  3OYH A;  1VSL A;  1JXB A;  2O4G A;  3ZT2 A;  3I8D A;  4JRP A;  4KTZ A;  4E7H A;  1EX4 A;  5HLF A;  1WSJ A;  3DRP A;  1C0T A;  3NBP A;  3VN5 A;  3HPO A;  3K5L A;  4DTJ A;  4FZX C;  4BDY A;  2HHT A;  2OPP A;  1NOY A;  1ZBI A;  4CF0 A;  3V9U A;  3HXM A;  4CGI A;  4DFK A;  4FJI A;  1BCO A;  4HUF A;  4FLT A;  3OYA A;  3AV9 A;  4B08 A;  1VSI A;  5KGW A;  3AO2 A;  3ZT3 A;  4B3O A;  4KB0 A;  3LAN A;  4CEC A;  3AVG A;  4IFY A;  1XC9 A;  1NKB A;  1REV A;  4CJL A;  3OYM A;  1QS4 A;  4ZTF A;  4NYF A;  1NOZ A;  2WOM A;  3V4I A;  3ZSY A;  4DQR A;  2YNG A;  3PO4 A;  1FKP A;  1IKX A;  5HRO A;  1RBU A;  3QIN A;  4LH4 A;  3QER A;  4M3Z A;  2HHQ A;  1TL1 A;  4EZ6 A;  4CF2 A;  3OYD A;  4CJU A;  4PA1 A;  3L2W A;  1YT3 A;  1JL1 A;  3WNE A;  4CCH A;  4FJM A;  4Z4E A;  1MU2 A;  3LAK A;  4DTU A;  3T3F A;  2QK9 A;  2Y1J A;  5KGX A;  5SZT A;  4AHV A;  2YV0 X;  4E89 A;  4OLA A;  4CJV A;  3ULD A;  4FYD A;  3M8P A;  1Q9X A;  4CEQ A;  4BE1 A;  1TKD A;  3B6O A;  3SNN A;  1LWE A;  4B9T A;  3PO5 A;  1C0U A;  3CM5 A;  5K14 A;  4O5B A;  1U4B A;  4FJH A;  1KVA A;  3QEV A;  3LP1 A;  2FBX A;  4FW1 A;  4FXD A;  3PY8 A;  1L3V A;  3V81 A;  1QQC A;  3AVC A;  4KHY A;  2D5R A;  4ELV A;  4N41 A;  1SL1 A;  1KCF A;  4FLV A;  3TWH A;  1U45 A;  2DTU A;  3DLB A;  4I2P A;  1TL3 A;  3KTQ A;  3C6U A;  3NGY A;  4LY7 A;  1TGO A;  3OYL A;  4CHZ A;  2IGI A;  3HO1 A;  3KKS A;  4E7K A;  2RKI A;  3LZI A;  4ELT A;  3F9K A;  4FM2 A;  2Z1I A;  5C42 A;  1JLB A;  1FK9 A;  3LWL A;  1JKH A;  3KK3 A;  3I0S A;  1S1W A;  1S6P A;  1LW0 A;  4H8K A;  3AVA A;  1BIZ A;  1ITG A;  3MXM A;  5CY4 A;  2DFF A;  2HNY A;  4KFB A;  1BIU A;  4DU1 A;  3DMJ A;  1RT2 A;  1RT6 A;  1RT1 A;  3L2V A;  3OYJ A;  5I3U A;  3MEC A;  1U47 A;  4CED A;  5CZ1 A;  3RTV A;  4OKK A;  1QSS A;  4FJ9 A;  3HL8 A;  3PUF A;  1N5Y A;  1BIS A;  3AA4 A;  2PY5 A;  4R5P A;  2XO7 A;  3L8B A;  3BDP A;  4I9Q A;  3ZCM A;  1WSF A;  3TAG A;  3ZT4 A;  4FLU A;  3QLH A;  4CF9 A;  2G8H A;  4B9L A;  3LZJ A;  4TSX A;  1U49 A;  4E7I A;  2KFZ A;  1S6Q A;  3V6D A;  2F8T A;  3AVK A;  4DSL A;  4F4K A;  3C6T A;  1RT5 A;  5JS2 A;  4EP4 A;  4DFM A;  5J2N A;  3SQ0 A;  3DLH A;  2HHX A;  1KLM A;  4AHT A;  1NK6 A;  4KAZ A;  3L2R A;  1D9F A;  4KTQ A;  1NJZ A;  3CFR A;  4O44 A;  4W5Q A;  3SCX A;  3P5J A;  1RT7 A;  1ZBF A;  4I9L A;  5HRR A;  2W42 A;  3IG1 A;  4J2E A;  2YKN A;  4DMN A;  3V9X A;  5J2Q A;  1QSL A;  1YTU A;  2F8S A;  3OS1 A;  3RRH A;  4CJ3 A;  4AIL C;  3TAM A;  4OGC A;  3ZT0 A;  4N56 A;  2GV9 A;  3BGR A;  2VWK A;  1D5A A;  2BE2 A;  3FFI A;  3AVH A;  4M3X A;  1BQM A;  3OYG A;  3V9Z A;  1BI4 B;  1W0H A;  4FJN A;  3MXI A;  2PYL A;  4ID5 A;  2OPR A;  3IRX A;  4MQ3 A;  1KSP A;  1RTJ A;  4LSL A;  3A2F A;  4CK3 A;  4DS4 A;  3TAE A;  1NK4 A;  1T7P A;  4CFC A;  4DQI A;  4CGH A;  5CYQ A;  3OVN A;  2D0B A;  1I3A A;  3AA2 A;  4LD0 A;  4CHP A;  4HUG A;  3U6F A;  3S3O A;  4IKF A;  4J2D A;  4HCC A;  2WON A;  3KJV A;  2D0C A;  4O0J A;  3T1A A;  2RN2 A;  2X6N A;  1EXQ A;  1LAW A;  3VQ8 A;  2O4I A;  4F2R A;  3SV4 A;  4B9N A;  2HVI A;  1WSI A;  4FJL A;  4FCY A;  1DLO A;  2KZM A;  2F96 A;  3RRG A;  4CHY A;  3AVL A;  4M3W A;  3NH2 A;  4CJQ A;  2P5O A;  4IBN A;  1U04 A;  4KRE A;  3OYI A;  2AJQ A;  2BDP A;  1I39 A;  1HYV A;  4FM0 A;  4DFJ A;  1L3U A;  4O55 A;  4CJ4 A;  3ZSO A;  3SPY A;  3NHG A;  3NH1 A;  1QTM A;  1IH7 A;  2OA8 A;  4PWD A;  1CZ9 A;  1L3T A;  4NCG A;  4C8O A;  1IKW A;  5C25 A;  3F73 A;  2XY5 A;  4M41 A;  4CHN A;  3CQ8 A;  5FRO A;  4B9S A;  4B8C A;  3QEP A;  3SI6 A;  1WSE A;  4PY5 A;  3DLG A;  1Y97 A;  3EZ5 A;  1U48 A;  2P5G A;  3CFP A;  3MAQ A;  1LV5 A;  1ZBH A;  3HVT A;  4E1N A;  5HP1 A;  1VSM A;  3P1G A;  1KFS A;  3VQ4 A;  2I5J A;  4LSN A;  3SUP A;  4FJG A;  3O4Q A;  3VQB A;  3JSM A;  4Q0B A;  1NK0 A;  4FW2 A;  2Y1I A;  3SUQ A;  4CFB A;  2HNZ A;  3OYC A;  2VG6 A;  4CGF A;  4EP5 A;  4BDP A;  4PQU A;  3HVR A;  1L3S A;  3PX4 A;  4K8Z A;  1TKT A;  3T19 A;  1NKE A;  3TAB A;  4DQQ A;  2OPS A;  4BDZ A;  1NKC A;  2BGG A;  2HHW A;  1GOC A;  5CYM A;  3ISN C;  4RW4 A;  3DLK A;  4ZHR A;  5KRS A;  3LP3 A;  3O4N A;  4CFD A;  3O3F A;  1IKY A;  4M3T A;  1JLE A;  1QHT A;  1WSG A;  4J2B A;  1NK5 A;  5FRN A;  2Z1H A;  3PX6 A;  1IKV A;  4DTR A;  1JLC A;  1C1C A;  3RR7 A;  1RDA A;  3S3N A;  2DFH A;  3HM9 A;  4J2A A;  4JRQ A;  2YNF A;  4KHW A;  2KW4 A;  3OY9 A;  3OJU A;  2HB5 A;  4M3R A;  3SUN A;  1UAX A;  3G10 A;  3ZSR A;  1ASW A;  3QNN A;  1S1X A;  4KHN A;  4E7J A;  3VA0 A;  2YHB A;  3KIO A;  2ATQ A;  3AVB A;  3C94 A;  3VQE A;  1A5V A;  1C0M A;  1NJX A;  3TAR A;  4N5S A;  2DFE A;  3DM2 A;  1WAJ A;  4Z4G A;  4DSI A;  4FJ5 A;  4OPK A;  5FRM A;  4QCL A;  1SL0 A;  3G0Z A;  3LWM A;  1BCM A;  4WE1 A;  4M3U A;  3NAE A;  1KLN A;  3RR8 A;  3RWU A;  3S3M A;  2Z1J A;  3I0R A;  4DTO A;  4GW6 A;  3ZSZ A;  1C6V A;  2VWJ A;  4FZZ A;  4Z0U A;  3TAN A;  1KVB A;  1HNI A;  3LAL A;  3VQ9 A;  1ZYQ A;  4KHU A;  2RPI A;  1VSD A;  1QSY A;  4KRF A;  1SV5 A;  4DU4 A;  4B9M A;  2GUI A;  4CGJ A;  2VG7 A;  5EU7 A;  3VQA A;  1RTI A;  1HMV A;  4RW8 A;  4DS5 A;  4C8K A;  1BHL A;  3VQD A;  4O0I A;  4FJ8 A;  4CHQ A;  1CLQ A;  4CGG A;  2G8W A;  5JS1 A;  2X6S A;  4KPY A;  2IS3 A;  3AVJ A;  2JGU A;  4KO0 A;  4B9V A;  4W5O A;  4FJK A;  3KLH A;  3L2Q A;  1CXQ A;  2D0A A;  3WNF A;  1VSJ A;  4CEF A;  3L3V A;  3VQ7 A;  1A5W A;  3SV3 A;  1VSF A;  3K59 A;  3RMA A;  2Q3S A;  4DLE A;  3AVM A;  2HND A;  1UWB A;  1BQN A;  3KLI A;  4KTW A;  4KV8 A;  4RW9 A;  3TI0 A;  3SYZ A;  3THV A;  4DWI A;  1Z26 A;  3AO5 A;  3DLE A;  4QAG A;  4KHQ A;  2HVH A;  4CK2 A;  1GOA A;  1RTD A;  1CXU A;  2Z1G A;  1TV6 A;  3OYB A;  4FJX A;  3EYZ A;  4KHS A;  1DTQ A;  3U3Y A;  4E3S A;  2E4L A;  2YKM A;  3D0P A;  4DG1 A;  3NGZ A;  3KKR A;  4Q5V A;  1IG9 A;  2PYJ A;  3CFO A;  2B4J A;  4M3Y A;  2GBZ A;  3LP0 A;  4CJP A;  3K2P A;  2LSN A;  1RBR A;  4FLX A;  1Q9Y A;  1RBS A;  3VQQ A;  4AH9 A;  4OGE A;  2IDO A;  4ID1 A;  3PV8 A;  1SKW A;  4G1Q A;  4CF1 A;  1S5J A;  2B6A A;  3OYK A;  3AVN A;  3NCI A;  4NCB A;  3JYT A;  2XHB A;  4K8X A;  3DI6 A;  4KI4 A;  4YNQ A;  2FBT A;  4HVJ A;  3IAY A;  1X1P A;  1J9A A;  3RMC A;  3S9H A;  4CJT A;  3QES A;  4GMJ B;  4Z4F A;  1ZBL A;  2KFN A;  4BE2 A;  4CEB A;  3NGI A;  3VQP A;  3ASM A;  4M42 A;  3OS0 A;  3TAF A;  2ETJ A;  4CJS A;  2KQ2 A;  2G8V A;  1EP4 A;  1Q8I A;  3NF7 A;  4CEA A;  1TKZ A;  1YVU A;  4DSE A;  3HP9 A;  4DSK A;  5CZ2 A;  1XHZ A;  3DYA A;  5HRS A;  1J5O A;  3UIQ A;  2YNH A;  3MXJ A;  2ZE2 A;  4F3T A;  3QEW A;  3H08 A;  4I7F A;  4DTP A;  3OYF A;  4DTM A;  3HYF A;  1TK8 A;  4NYN A;  1XWL A;  4CIG A;  4E7L A;  3QEX A;  4L8R B;  5SWM A;  2QKK A;  1RNH A;  3DOK A;  3PX0 A;  2ZD1 A;  4F2S A;  3V9W A;  3ZSQ A;  4CEE A;  4IG0 A;  2XY8 A;  4ZTJ A;  4C8L A;  3QNO A;  1SL2 A;  1JXE A;  3SZ2 A;  2G8U A;  3AVF A;  2YNI A;  1LWC A;  3V1Q A;  1UOC A;  3AVI A;  1UA0 A;  3DRS A;  1VK0 A;  1W9H A;  2JLE A;  4O4G A;  1NK8 A;  3HP6 A;  1SUQ A;  3QEI A;  1Z25 A;  1ASU A;  1JLA A;  3QIP A;  2A1S A;  3E01 A;  4AHC A;  4QOZ B;  3LP2 A;  2B5J A;  4IG3 A;  4DSF A;  1T8E A;  1FXX A;  3HPH A;  3CM6 A;  3KK1 A;  3AA3 A;  4FLW A;  3TAP A;  5J2P A;  1TK0 A;  2KZZ A;  4OPJ A;  1WAF A;  1IO2 A;  2KTQ A;  3M8R A;  3RMB A;  5E41 A;  4W5T A;  4NCA A;  1RTH A;  4C8N A;  3DRR A;  4DQS A;  3OYE A;  4HTU A;  1KRP A;  3NFA A;  3QO9 A;  1T05 A;  3SJJ A;  1VSE A;  4OVL A;  4FK4 A;  1BI4 A;  4DLG A;  1FKO A;  3QET A;  4JS5 A;  3LPT A;  4H4M A;  3K58 A;  5HBM A;  3ZSW A;  2G8F A;  1B9F A;  4DSJ A;  5KI6 A;  2HHV A;  1D9D A;  4FVM A;  2DY4 A;  1S9G A;  1RT3 A;  5I42 A;  1QE1 A;  3C95 A;  3NF8 A;  4CJ5 A;  2IOC A;  1RIL A;  4CGD A;  1F21 A;  4F8R A;  4YFU A;  3M8Q A;  1KVC A;  1VRU A;  3SQ2 A;  4OJR A;  2FBV A;  4IDK A;  4OKJ A;  3TAQ A;  3B6P A;  2EX3 A;  4CJW A;  4OLB A;  4FLZ A;  2A1R A;  1RCH A;  2R7Y A;  3D45 A;  3L3U A;  1RBT A;  1BL3 A;  1ZBU A;  3QIO A;  4CE9 A;  2OPQ A;  1HPZ A;  1LAV A;  3P83 D;  4E1M A;  4RW6 A;  3VA3 A;  3NH0 A;  3SQ4 A;  2IC3 A;  3SQ1 A;  2G8K A;  1CZB A;  1LW2 A;  4DTN A;  3IS9 A;  1B9D A;  4IFV A;  5HRP A;  3ALY A;  3M8S A;  1X9W A;  3AA5 X;  4FJ7 A;  1C1A A;  3KD1 E;  4CHO A;  5D3G A;  3LAM A;  4FZY A;  4FM1 A;  1YTA A;  2E6L A;  2EHG A;  4CJK A;  4BAC A;  4N76 A;  1SKR A;  4FK2 A;  2YHA A;  4Z4C A;  1HQU A;  1RDC A;  4W5R A;  4DU3 A;  3ITH A;  3KD5 E;  2FBY A;  1GOB A;  5DMR A;  5KTQ A;  2QXF A;  3KLE A;  2P51 A;  2RF2 A;  4HHT A;  4BE0 A;  4PUO A;  4HUE A;  4CEO A;  5KRT A;  5FDL A;  3V1R A;  4CER A;  2HHU A;  3TR8 A;  3NDK A;  4AHS A;  4CFA A;  4E19 A;  1SKS A;  3HJF A;  3RMD A;  3LPU A;  1S1U A;  2OZS A;  4W5N A;  3K57 A;  5J1E A;  1S1T A;  3K5N A;  1HJR A;  1WSH A;  2VG5 A;  4CEZ A;  3NF6 A;  4CF8 A;  1NJW A;  5C24 A;  3KLG A;  1HYS A;  4I2Q A;  2OYQ A;  1O1W A;  4OKE A;  3LDS A;  3V1O A;  1RBV A;  1C1B A;  1RDB A;  2HMI A;  1LWF A;  2IAJ A;  4CJR A;  4N47 A;  2BAN A;  3OS2 A;  1HRH A;  3HT3 A;  1TKX A;  3KK2 A;  2E6M A;  1S1V A;  1N6Q A;  1J53 A;  4CIF A;  1J54 A;  1WNS A;  3MED A;  4B9U A;  4MFB A;  4DTS A;  1EET A;  1D8Y A;  1BGX T;  1RT4 A;  1T03 A;  3KLF A;  1G15 A;  4DF4 A;  3L2U A;  4Z4I A;  1JLG A;  4M45 A;  4DTX A;  1ASV A;  1JLQ A;  1JL2 A;  3CYM A;  3WNH A;  1NJY A;  3AO3 A;  3VQC A;  3U3G A;  3AO4 A;  3OJS A;  3NE6 A;  1UA1 A;  1K6Y A;  1KTQ A;  4Z4H A;  1X9M A;  1NK9 A;  3HPG A;  1JLF A;  4HCB A;  3AO1 A;  4CIE A;  2G8I A;  3HST B;  3O3G A;  1TAU A;  2ZQB A;  3ZSX A;  5DK5 A; 
#chains in the Genus database with same CATH topology
 3ZEU B;  4H4O A;  2FC0 A;  4E0D A;  4AHU A;  4DR2 K;  5GIN A;  3JS6 A;  2GWJ A;  3IFR A;  3SPZ A;  1XI1 A;  4DF8 A;  3O08 A;  2X78 A;  2NZT A;  1N32 K;  4RG8 A;  3DOL A;  3ATU A;  4ELU A;  3MWP A;  2QWN A;  3LDL A;  4BWJ A;  5B8H A;  2XY7 A;  4CK1 A;  4LH5 A;  2VCP A;  1HQE A;  2HHS A;  2IVO A;  3VQ6 A;  3GDQ A;  2PAV A;  3A5N C;  3WXJ A;  4C8M A;  1B92 A;  2QKB A;  3CCU N;  3HOT A;  1EKE A;  1WN7 A;  2XRI A;  3O3H A;  1VRT A;  3V4I A;  3OW2 M;  2O8E B;  1EX4 A;  5HLF A;  1WSJ A;  3NBP A;  3K5L A;  4DTJ A;  4BR0 A;  4DFK A;  4JKB A;  4B3S K;  4H5N A;  1BUP A;  3OYA A;  4B3O A;  5KGW A;  3LAN A;  4CEC A;  3AVG A;  3O9T A;  1REV A;  4CJL A;  2VYP A;  2ITM A;  1QS4 A;  4ZTF A;  4NYF A;  4DQR A;  2FSJ A;  3PO4 A;  3NVM A;  3CET A;  1JL1 A;  3WNE A;  4FJM A;  1MU2 A;  3LAK A;  2QK9 A;  4LC9 B;  5KGX A;  1NMN A;  3FZK A;  4JHD A;  1TKD A;  3GBT A;  4JV5 K;  3FZL A;  3CM5 A;  4O5B A;  2V7Z A;  5EX5 A;  1Q81 O;  3V81 A;  1T44 A;  3TWH A;  1QVF M;  5A2Q O;  4FWO A;  3C6H A;  2RE2 A;  4LY7 A;  4LFB K;  2HF4 A;  2IGI A;  2O8E A;  5C42 A;  1QQM A;  1S1W A;  1S6P A;  1BIZ A;  3THW A;  4BR9 A;  5CY4 A;  3EEQ A;  3TAE A;  4KFB A;  4DU1 A;  3DMJ A;  5I3U A;  3FE1 A;  3MEC A;  3RTV A;  3HL8 A;  1BIS A;  3O9Q A;  4B1X B;  4PL7 A;  4U7B A;  4BRP A;  4FLU A;  4E7I A;  3M5R A;  4CZG A;  1W7A A;  4F4K A;  1RDU A;  4OPA A;  4EP4 A;  4AHT A;  5F0X A;  1D9F A;  2YI1 A;  1XMQ K;  4J2E A;  1RT7 A;  4I9L A;  3K9J A;  4IOA L;  4FWR A;  4DMN A;  4H0O A;  2QM1 A;  4YOU A;  4N56 A;  1KC8 O;  1JCG A;  5GAH P;  3AVH A;  3V9Z A;  1YIJ N;  4MQ3 A;  2OPR A;  3IRX A;  4FK0 A;  3R9P A;  1T7P A;  4CGH A;  1WBD A;  4FWM A;  1I3A A;  5AQJ A;  3U6F A;  4IKF A;  1R59 O;  5CE3 A;  4O0J A;  2WFB A;  3T1A A;  2X6N A;  1X9J A;  2QWP A;  3SV4 A;  5AQT A;  3J7A P;  3LDN A;  4JI3 K;  1HKG A;  5IT9 O;  3AVL A;  3L0Q A;  3DXK B;  3NH2 A;  4JI7 K;  1QQO A;  3SJH A;  4IBN A;  5GIP A;  4L3Q A;  1E3M A;  1L3U A;  4O55 A;  2HBM A;  4CJ4 A;  3ZSO A;  4BC2 A;  1YJW N;  4IFE A;  3TPQ A;  1IH7 A;  4FWS A;  5BPL A;  5C25 A;  4YOT A;  4M41 A;  2YHY A;  2Q36 A;  1ZC6 A;  1JCF A;  1VQK N;  3BP8 A;  3LDQ A;  3QEP A;  4PY5 A;  2A41 A;  1YVN A;  1YAG A;  1VSM A;  4HWI A;  4Q0B A;  3SUQ A;  4CFB A;  4PKI A;  4BDP A;  2VG6 A;  2ZWH A;  1WBB A;  4H5T A;  4B1Y B;  3HVR A;  1L3S A;  1TKT A;  3T19 A;  3ATV A;  1HX1 A;  1ATR A;  3O3F A;  1JLE A;  1WSG A;  2Z1H A;  5JMV A;  1NGA A;  4DTR A;  1C1C A;  2UXC K;  4H5V A;  4DB3 A;  3O9S A;  3OY9 A;  3ENB A;  4CVN E;  4E7J A;  3VQE A;  2ATQ A;  1C0M A;  3TAR A;  4N5S A;  3UKU B;  3N4Q A;  3L6Q A;  3VER A;  4DSI A;  5AQZ A;  1T6C A;  3U9D A;  3G0Z A;  3KK7 A;  5BN8 A;  1VQ9 N;  4WE1 A;  4M3U A;  3NAE A;  3S3M A;  4IOX A;  4DTO A;  1C6V A;  4Z0U A;  2E2O A;  3BF1 A;  1VSD A;  3DAW A;  1W2B M;  3MWT A;  4WYB A;  1VQ6 N;  3VQA A;  4H0P A;  4CZH A;  4RW8 A;  4O0I A;  4CHQ A;  1QZ5 A;  1CLQ A;  5EY4 A;  3KWI A;  2VGM A;  3MN7 A;  2UXD K;  2JGU A;  4B9V A;  3A8Y A;  3D2E A;  3EZW A;  4A5A A;  1NM1 A;  2D0A A;  3WNF A;  3J7Y P;  1VSJ A;  3L3V A;  3VQ7 A;  3K59 A;  2Q3S A;  2QWQ A;  3TI0 A;  3SYZ A;  2PFU A;  4DWI A;  1NGH A;  3VMF B;  4LFC K;  4K25 A;  1RTD A;  2Z1G A;  4OO1 J;  4E3S A;  2E4L A;  3A5L C;  1HNW K;  2A6A A;  2B4J A;  2GBZ A;  3LP0 A;  3K2P A;  4CBX A;  4DCH A;  1Q9Y A;  1WOQ A;  4IEE A;  4OGE A;  2W40 A;  3O4W A;  4CF1 A;  4G1Q A;  3B8A X;  2B6A A;  3OYK A;  3RVC A;  4K8X A;  4YNQ A;  4WCE L;  1X1P A;  1J9A A;  4EIA A;  3QES A;  2KFN A;  4CEB A;  3NGI A;  3VQP A;  3A5O C;  4M42 A;  4X66 K;  3TAF A;  3BZK A;  4CEA A;  1TKZ A;  2W41 A;  4DSK A;  2W6K A;  3H08 A;  4DTP A;  3OYF A;  1VHX A;  5LY3 A;  4GV3 A;  1TK8 A;  3LM9 A;  4CIG A;  3QEX A;  3L4I A;  1KAX A;  1RNH A;  3V9W A;  4IG0 A;  4YDU C;  1E4G T;  1SL2 A;  2G8U A;  3ID8 A;  3V1Q A;  4BRG A;  3NMU A;  4O4G A;  4R79 A;  3VEY A;  4QOZ B;  3WUH A;  4IG3 A;  4DSF A;  1T8E A;  1FXX A;  3TAP A;  5GAG P;  5AFU A;  1YXQ A;  3EKS A;  3OYE A;  1KRP A;  2P9U B;  3BY5 A;  2YJF A;  1FKO A;  4JS5 A;  5AJ3 K;  3F9M A;  4AM7 A;  5KI6 A;  1D9D A;  1GLC G;  4FVM A;  2NRW A;  1FJG K;  4CJ5 A;  5EXW A;  4F8R A;  4YFU A;  4JK9 A;  1VRU A;  3JAM O;  1NMD A;  4OLB A;  2AA4 A;  1QHA A;  2A1R A;  3L3U A;  1BL3 A;  4WQ5 C;  2OPQ A;  1HPZ A;  3P83 D;  3VA3 A;  4QCL A;  3SQ4 A;  4KAZ A;  3SQ1 A;  1LW2 A;  1FW6 A;  3IS9 A;  1BU6 O;  3L4Q A;  2QW9 A;  3I8B A;  1YTA A;  4Z4C A;  1HQU A;  3VES A;  4W5R A;  4GV6 A;  3MMV A;  4PUO A;  3V1R A;  2HHU A;  3H1Q A;  1SKS A;  3MCA B;  5AFU H;  1SZ2 A;  5ADX H;  1JCE A;  1S1T A;  3VEN A;  1WSH A;  4I6M B;  3KLG A;  4OKE A;  4IZ9 A;  2GX9 A;  1CZA N;  3LDS A;  2IIR A;  1VQL N;  1N33 K;  2IAJ A;  4CJR A;  3MN6 A;  4FOI A;  4BRK A;  3OS2 A;  1HRH A;  3HT3 A;  1BO5 O;  1TKX A;  2I7P A;  3T7Z A;  3DWL A;  1N6Q A;  5GAE P;  3UKU A;  1WNS A;  3MED A;  3MDQ A;  4MFB A;  4FWL A;  3KHY A;  1TYQ B;  3CIP A;  1MA9 B;  3PSI A;  2YJE A;  5C2D A;  4DUY K;  2W6L A;  1JLQ A;  1JL2 A;  1NJY A;  3AO3 A;  4RWT A;  4JI0 K;  5AQG A;  2A5X A;  1UA1 A;  1X9M A;  2Q31 A;  3HPG A;  1NGF A;  3HRG A;  5DK5 A;  4A61 A;  2YHX A;  2BH1 A;  4CJE A;  3V9S A;  3E9L A;  1WLJ A;  3MEG A;  3HK2 A;  4RW7 A;  4JD2 B;  3TSQ A;  4LF4 K;  1KFD A;  5ELZ A;  5JIC A;  4B8A B;  4JS4 A;  4XIU A;  4AHR A;  4EZ9 A;  1OVY A;  1QQN A;  1IJJ A;  4CBW A;  2ITG A;  3CG7 A;  5BPN A;  3OYN A;  1S72 N;  4PL8 A;  1NK7 A;  4KKO A;  3CCM N;  4CES A;  1KQS M;  4KH6 A;  3NF9 A;  4FJJ A;  3ULE A;  4FWN A;  3ZT1 A;  3CC7 N;  2PBD A;  3HM8 A;  2HW3 A;  2H3G X;  2P1J A;  2QWO A;  4Y1D A;  4BR4 A;  1XHX A;  1DTT A;  3MEE A;  1VQ5 N;  1A5X A;  1DGK N;  1HNV A;  4FPB A;  4E7H A;  1VSL A;  3TSU A;  1NGJ A;  2KHO A;  3HPO A;  2IVN A;  4FOE A;  3H1V X;  1EO1 A;  2OPP A;  1NOY A;  1ZBI A;  3HXM A;  4CI6 A;  2HBJ A;  4H0V B;  4GNI A;  4FLT A;  1K8A O;  3ZT3 A;  4CZJ A;  3KVG A;  1WUA A;  1NJI O;  1YHQ N;  3VPZ A;  2HMP A;  1FKP A;  1RBU A;  4LH4 A;  4M3Z A;  2E1Z A;  4BC5 A;  3L2W A;  3FZH A;  2ASO A;  4JHD B;  3QIC A;  3T3F A;  3ENH A;  2UUA K;  4E89 A;  3A0I X;  4OLA A;  3ZX0 A;  3ULD A;  3M8P A;  4CEQ A;  5K14 A;  3RSE B;  1KVA A;  3QEV A;  3PY8 A;  2O8C B;  4BRM A;  2IVP A;  1QQC A;  4KHY A;  4ELV A;  2DTU A;  2ZJR L;  3TTC A;  4I2P A;  3CXC M;  1RGI A;  3C6U A;  4FWK A;  2P9L A;  1YF5 L;  3QDK A;  3C65 A;  1TGO A;  3OYL A;  3KKS A;  3LZI A;  4GKJ K;  3F9K A;  2OCE A;  2Z1I A;  1FK9 A;  3LWL A;  3AVA A;  2DFF A;  1RT6 A;  1RT1 A;  4BQL A;  3CPW M;  1U47 A;  4CED A;  5CZ1 A;  3VF6 A;  3T69 A;  1XNR K;  4BRL A;  4CW7 B;  4MO4 A;  1N5Y A;  4R5P A;  3L8B A;  4I9Q A;  3BDP A;  3PIO L;  4CF9 A;  4WFA L;  1S6Q A;  3V6D A;  4BRQ A;  4DSL A;  3G6E N;  1RT5 A;  5JS2 A;  4BRD A;  4DV7 K;  3L2R A;  4MO5 A;  5AQH A;  4KTQ A;  3CFR A;  3SBT A;  5C15 A;  4BQZ A;  1ZBF A;  5HRR A;  3IG1 A;  2F8S A;  4DR7 K;  3OS1 A;  4AIL C;  3TAM A;  1WB9 A;  3U9Z A;  2VWK A;  1D5A A;  3FFI A;  5KQ8 A;  1BI4 B;  1H1V A;  4FJN A;  2PYL A;  1YUW A;  3A2F A;  4EFH A;  4BRN A;  5AQN A;  3WXM B;  2D0B A;  3AA2 A;  4CHP A;  5AQK A;  3UB5 A;  4LD0 A;  4XH4 A;  2WON A;  4B1W B;  1BA0 A;  1XC3 A;  3R8E A;  4F2R A;  1XNQ K;  2O8C A;  5BN9 A;  4CHY A;  4CJQ A;  2GUP A;  4DV5 K;  2P5O A;  4BR2 A;  3OYI A;  2BDP A;  4IXC A;  3J80 O;  1I39 A;  1HYV A;  3CQY A;  5JVH L;  3C7N B;  2OA8 A;  4NCG A;  3F73 A;  1I94 K;  4B9S A;  1Y97 A;  4ISE A;  1LV5 A;  3HVT A;  5AQL A;  4E1N A;  3VEW A;  3SUP A;  3O4Q A;  1NK0 A;  4FW2 A;  4CGF A;  4EP5 A;  5IWA K;  4K8Z A;  4LF6 K;  3TAB A;  2QWR A;  3C6A A;  4CZK A;  2OPS A;  1NKC A;  4FSV A;  1GOC A;  5KPT A;  2FF6 A;  4M3T A;  4J2B A;  5AZI B;  5BPM A;  5BRD A;  3VTH A;  3RR7 A;  1RDA A;  3S3N A;  2DFH A;  3HM9 A;  3G25 A;  4J2A A;  2YCH A;  2KW4 A;  3OJU A;  1UAX A;  3G10 A;  1S3X A;  1ASW A;  3ZSR A;  4KHN A;  4EAH D;  3C94 A;  4ISG A;  4Z4G A;  3HOS A;  4OPK A;  5FRM A;  4KBO A;  4A2B A;  1SL0 A;  4ILH A;  1IBK K;  3I0R A;  3HSC A;  4GW6 A;  3O1B A;  4DKW A;  1KVB A;  1HNI A;  3FZF A;  1ZYQ A;  4KHU A;  5BR9 A;  4KRF A;  1SV5 A;  4DU4 A;  4B9M A;  4BRO A;  4C8K A;  1GLD G;  4JKH A;  2HBK A;  3T1H K;  2X6S A;  4CZI A;  4W5O A;  3CPE A;  1EQY A;  3QFU A;  1CXQ A;  1O13 A;  1A5W A;  1VSF A;  4FWP A;  5C2F A;  1BQN A;  3KLI A;  4KV8 A;  4K41 A;  4KHQ A;  3P4I A;  4CK2 A;  1TV6 A;  3QB0 A;  3OYB A;  3UKR A;  3O5B A;  3EYZ A;  1DTQ A;  1K73 O;  3D0P A;  4DG1 A;  3KKR A;  4PKG A;  4BVP A;  3CFO A;  2E5L K;  4M3Y A;  4CJP A;  2LSN A;  1RBR A;  5AQU A;  3PIP L;  4IOC L;  4AH9 A;  4JKE A;  3PV8 A;  3ZET A;  3D2F B;  2P9S B;  1S5J A;  3AVN A;  1GLF O;  3IMX A;  3JYT A;  4F9O A;  4KI4 A;  4Z4F A;  3S9H A;  4H5R A;  2ZF5 O;  4O8U A;  4BE2 A;  4C1N K;  4CJS A;  2FF3 B;  1EP4 A;  1Z05 A;  4DSE A;  3HP9 A;  3U8X A;  5CZ2 A;  5HRS A;  3CCV N;  2YNH A;  2ZE2 A;  3QEW A;  2O8B B;  4DTM A;  3HYF A;  1OH6 A;  4NYN A;  4E7L A;  4L8R B;  2F9T A;  5AQY A;  2F7T A;  3PX0 A;  1V4T A;  4ZTJ A;  1YI2 N;  3F5T A;  2YNI A;  3CCQ N;  3AVI A;  1VQ8 N;  1W9H A;  4LF7 K;  3M6G A;  3ZYY X;  3QEI A;  1ASU A;  2ZGZ A;  3CJ1 A;  4A57 A;  3E01 A;  4AHC A;  3MX2 A;  3CM6 A;  4B3R K;  3KK1 A;  4FLW A;  3EE8 A;  1WAF A;  1IO2 A;  3M8R A;  5M1N A;  3FZM A;  3E9P A;  4NCA A;  1RTH A;  3THY B;  3DRR A;  4DQS A;  3NFA A;  4OX9 K;  5KPR A;  3G4S N;  1VSE A;  2HOE A;  4OVL A;  1BI4 A;  4DLG A;  5F2R A;  3QET A;  3NVK A;  3LPT A;  1B9F A;  1HNZ K;  2V7Y A;  2DY4 A;  1RT3 A;  1QE1 A;  1GLJ O;  3NF8 A;  1NG9 A;  4B3T K;  2IOC A;  1N34 K;  3M8Q A;  1NLV A;  5CR4 A;  4IDK A;  3B6P A;  4CJW A;  2QTD A;  2R7Y A;  4HTU A;  1BWF O;  4RW6 A;  2G8K A;  1CZB A;  3M8S A;  2WC9 A;  3KD1 E;  4CHO A;  4B9Q A;  4O8K A;  5TKY A;  4FM1 A;  2E6L A;  4CJK A;  4FK2 A;  4JI6 K;  2KLA A;  2YHA A;  3VGL A;  3QBX A;  3DLL L;  1RDC A;  4DR3 K;  3ITH A;  4HHT A;  5KTQ A;  4BE0 A;  2RF2 A;  4HUE A;  4CEO A;  2P9N A;  2RHK A;  2WTU A;  4K43 A;  5FDL A;  4CER A;  3SAH A;  5HL7 L;  4H5W A;  3TR8 A;  3HJF A;  3RMD A;  3LPU A;  5M1F A;  4W5N A;  3K57 A;  4CEZ A;  4M7X A;  5C24 A;  1NWK A;  4I2Q A;  5AQQ A;  1O1W A;  1VQ7 N;  1U6Z A;  1RBV A;  4WF9 L;  1C1B A;  1RDB A;  2D4W A;  2WBN A;  3H3O B;  3LM2 A;  5BRE A;  3E1Y A;  1TYQ A;  1J53 A;  4CIF A;  1J54 A;  4DTS A;  5M1K A;  1EET A;  1D8Y A;  1BGX T;  2NRT A;  4CJ7 A;  4H0X B;  4M45 A;  2P9I A;  3BF3 A;  1SQK A;  3VQC A;  3P39 A;  3U3G A;  2YHW A;  3TTD A;  1K6Y A;  1KTQ A;  4Z4H A;  1KD1 O;  3HST B;  3O3G A;  2ZQB A;  4JKA A;  1TVR A;  4DQP A;  3WNG A;  1TUU A;  4KI6 A;  4YDU A;  3FR0 A;  1HJO A;  5J2M A;  1K8K A;  3DLR A;  4DFP A;  4PKH A;  4Y1C A;  5GAD P;  4FO0 A;  4JLH A;  1TK5 A;  4ICL A;  3OHR A;  4KB1 A;  3K5O A;  1VSH A;  2OZM A;  5AQP A;  4CJF A;  3ZSV A;  4QS7 A;  1W97 L;  1VSK A;  1T05 A;  4FJH A;  5T7B A;  4JRP A;  2UU9 K;  2O4G A;  3ZT2 A;  2OTL N;  3DRP A;  1C0T A;  2HHT A;  4BDY A;  5FPD A;  4WFN L;  4BVO A;  4HUF A;  4YOW A;  1BDG A;  3D2F A;  3AV9 A;  4B08 A;  1Y64 A;  4KB0 A;  3LL3 A;  4IFY A;  4GV9 A;  1NOZ A;  2WOM A;  4LF5 K;  2UUC K;  1IKX A;  5HRO A;  3QIN A;  2ZJP L;  1M1K O;  3WXL A;  4CF2 A;  4PA1 A;  1YT3 A;  4CCH A;  3D2E B;  4DTU A;  2D0O A;  2Y1J A;  2A3Z A;  3VGM A;  4AHV A;  5SZT A;  4CJV A;  1ATS A;  3B6O A;  3SNN A;  1YJ9 N;  1C0F A;  3PO5 A;  1C0U A;  3H6E A;  2NRZ A;  2FBX A;  2P9K B;  4FW1 A;  3DXM A;  3AVC A;  2D5R A;  3SAG A;  4N41 A;  1SL1 A;  1BA1 A;  1KCF A;  1U45 A;  4DV2 K;  1T3V A;  2CH6 A;  1OH5 A;  3H45 C;  3O1W A;  4I6M A;  3FGU A;  1NGB A;  3NGY A;  4WFB L;  4CHZ A;  3HO1 A;  4BR7 A;  5LMN K;  3VF4 A;  4E7K A;  4FM2 A;  1JLB A;  2CGJ A;  1JKH A;  1LW0 A;  3VTI A;  1ITG A;  1VQP N;  2HNY A;  1RT2 A;  3L2V A;  2J4R A;  3CJ7 A;  3VEZ A;  4OKK A;  1QSS A;  3PUF A;  3R1X A;  2XO7 A;  3ZCM A;  3TAG A;  3ZT4 A;  3QLH A;  4CZL A;  2G8H A;  3LZJ A;  4TSX A;  2KFZ A;  2E1Y A;  2F8T A;  3C6T A;  2HHX A;  1VQO N;  1GLB G;  4BG9 A;  1NK6 A;  5GIO A;  2BUP A;  1NJZ A;  1NBW A;  4O44 A;  3SCX A;  3P5J A;  2W42 A;  3J81 O;  2YKN A;  4KH5 A;  2O8F A;  3V9X A;  5J2Q A;  1YTU A;  5AQF A;  1P90 A;  5JLF A;  4X64 K;  3ZT0 A;  2QXL A;  5M1P A;  3RSE A;  4M3X A;  1BQM A;  1GLL O;  3OYG A;  3AGK A;  3THX A;  3MXI A;  4ID5 A;  4X62 K;  4LSL A;  4DS4 A;  3PLA A;  5CYQ A;  3OVN A;  1ESV A;  3S41 A;  3HBT A;  4HUG A;  4B1U B;  3UKR B;  4J2D A;  4B1Z A;  2D0C A;  2RN2 A;  3VQ8 A;  2O4I A;  4AQY K;  4B9N A;  2HVI A;  4FJL A;  3HI0 A;  2KZM A;  3RRG A;  3H3N O;  1U04 A;  4KRE A;  1Q18 A;  1NGC A;  4YHH K;  1L3T A;  4CHN A;  3CCR N;  5FRO A;  5FLX O;  2ZJQ L;  3SI6 A;  1U48 A;  2P5G A;  1ZBH A;  3I55 N;  3P31 A;  1KFS A;  1VQM N;  4FJG A;  3VQB A;  2NRX A;  3IDH A;  3OYC A;  5M1Q A;  3BEX A;  4PQU A;  3PX4 A;  2P9N B;  4BRF A;  3FFK B;  4DQQ A;  2HHW A;  4BDZ A;  2BGG A;  3UE5 A;  4ZHR A;  5KRS A;  5AQX A;  3LP3 A;  3O4N A;  5BRF A;  1NK5 A;  1IKV A;  4AF1 A;  1JLC A;  4LF8 K;  4B3M K;  2HBL A;  2HB5 A;  4M3R A;  3OBW A;  4JKG B;  3QNN A;  1S1X A;  3CF5 L;  3VA0 A;  3KIO A;  4HTL A;  3AVB A;  1A5V A;  4C23 A;  3DM2 A;  5MLC Q;  4XEI A;  2NLX A;  5F1X A;  2CGK A;  3C7N A;  3MN9 A;  3LWM A;  1BCM A;  3OTO K;  1P8Z A;  3CC2 N;  4DV6 K;  3RWU A;  2Z1J A;  2OTJ N;  4O5F A;  4FZZ A;  1J6Z A;  3CJA A;  3TAN A;  3VQ9 A;  3LAL A;  4ILJ A;  2DPN A;  3O9U A;  1QSY A;  2A40 A;  2GUI A;  2VG7 A;  5EU7 A;  1RTI A;  1HMV A;  1BHL A;  4JI2 K;  4BR5 A;  4CGG A;  5H1S Q;  2O8B A;  4KO0 A;  3IKM A;  4FJK A;  3Q7B A;  3L2Q A;  4JI4 K;  5AQO A;  4H03 B;  3WT0 A;  3AVM A;  4KHP K;  2HND A;  3KZB A;  4KTW A;  4RW9 A;  4FYD A;  1MWM A;  3O6W A;  3D6R A;  1Z26 A;  3AO5 A;  3DLE A;  1GOA A;  1CXU A;  4DR1 K;  3G71 N;  2NRH A;  5M1O A;  3U3Y A;  2YKM A;  3NGZ A;  3SMS A;  3MN5 A;  4JKC A;  4WQ5 A;  1RBS A;  1OVQ A;  3TTF A;  1SAZ A;  2IDO A;  1VQ4 N;  3VET A;  5HOO A;  4BGB A;  2E2Q A;  4NCB A;  3CJ9 A;  5C0Y A;  3IAY A;  3THW B;  4H0T B;  3RMC A;  3QFP A;  4CJT A;  4MLH A;  2E20 A;  1ZBL A;  4JKF A;  1ZXO A;  3ASM A;  3DXK A;  2HF3 A;  3WQU A;  3ZX2 A;  1MWK A;  2ETJ A;  2KQ2 A;  1HPM A;  2G8V A;  1Q8I A;  3NF7 A;  4IJA A;  1YVU A;  1J5O A;  4I7F A;  2E2P A;  1Q82 O;  2Q2R A;  5SWM A;  5LL6 Z;  4IDH A;  4JI5 K;  4F2S A;  2ZD1 A;  4C8L A;  4NB4 A;  3VEO A;  3QNO A;  1JXE A;  3TU5 A;  2QWL A;  1LWC A;  4BRA A;  3DRS A;  1VK0 A;  4NLB A;  1SUQ A;  2VQF K;  1Z25 A;  3QIP A;  2QEX N;  2A1S A;  2P9L B;  3LP2 A;  3CQX A;  3LDO A;  3KWG A;  3SMP A;  3AA3 A;  3JXU A;  1TK0 A;  1D4X A;  3RMB A;  1RDW X;  1HNX K;  5AZJ B;  3QO9 A;  5AQV A;  1DT9 A;  4MDA A;  3K58 A;  5HBM A;  3ZSW A;  1QVG M;  3O80 A;  2HHV A;  2P9P B;  5TKW A;  2P9K A;  3C95 A;  4CGD A;  1F21 A;  1DEJ A;  4OJR A;  3CJC A;  4JI8 K;  2FBV A;  4OKJ A;  4C1N I;  4FLZ A;  4BG8 A;  3ZX3 A;  1ILY A;  4CZM A;  4CE9 A;  1RBT A;  1ZBU A;  3QIO A;  1KSP A;  2ZM6 K;  4ELT A;  3NH0 A;  2IC3 A;  4DTN A;  4IFV A;  1B9D A;  5HRP A;  3CCS N;  3ALY A;  1X9W A;  3AA5 X;  4FJ7 A;  1C1A A;  5ADX A;  4JKG A;  5D3G A;  2EHG A;  4N76 A;  2GWK A;  4DV3 K;  4BAC A;  1SKR A;  3I56 N;  3KD5 E;  2VGN A;  5FPE A;  1GOB A;  3KLE A;  2QXF A;  2D1K A;  1J5E K;  1HLU A;  3NDK A;  4BY9 C;  1VAZ A;  4AHS A;  4CFA A;  3FLC O;  4E19 A;  1S1U A;  3MCP A;  4QS8 A;  2VG5 A;  3NF6 A;  4CF8 A;  2E8A A;  3EL2 A;  3CJB A;  1HYS A;  5AQI A;  2OYQ A;  3WXK A;  2F9W A;  2OAN A;  2AP1 A;  4A5B A;  4BC3 A;  1JJ2 M;  4JN4 A;  3QBW A;  4N47 A;  2BAN A;  3AY9 A;  3KK2 A;  4DR5 K;  2E6M A;  1S1V A;  1RT4 A;  3SBG A;  4QS9 A;  1T03 A;  4V19 S;  4DF4 A;  3L2U A;  3VEX A;  1JLG A;  2Q0U A;  4JK7 A;  4DTX A;  1ASV A;  3WNH A;  2P9P A;  4YOV A;  1NK9 A;  3AO4 A;  4E1J A;  3OJS A;  4HCB A;  4PWD A;  3HZ6 A;  3AO1 A;  1TAU A;  3ZSX A;  4BGA A;  1RDD A;  2FXU A;  1V4S A;  3DJC A;  4F3O A;  1KAY A;  3SUO A;  1R0A A;  1DKG D;  1S9E A;  2PZS A;  1TAQ A;  2GTD A;  4DHY A;  1NNE A;  4OPH A;  1Q86 O;  1K9M O;  2UXB K;  4BRH A;  4UQG A;  1Z6R A;  1L5U A;  2X74 A;  1HYZ A;  2A42 A;  3F2K A;  4GVM A;  1X9S A;  5HRN A;  4DR6 K;  4BWM A;  3EY1 A;  5KQD A;  2XY6 A;  3K5M A;  3EE9 A;  1X3M A;  3WQT A;  4IO9 L;  4FLY A;  4WQ4 A;  3J8A A;  2UUB K;  3ZLJ A;  2KZZ A;  2NUB A;  3M3Z A;  4NO7 A;  3VQ5 A;  3SQ2 A;  4B9U A;  3I8D A;  3OYH A;  1JXB A;  4KTZ A;  4PHT X;  5AQR A;  5JVG L;  4FZX C;  3VN5 A;  1ATN A;  4CF0 A;  3V9U A;  4CGI A;  4FJI A;  3M1F A;  1BCO A;  5EOY A;  1VSI A;  5AZJ A;  3AO2 A;  1HR0 K;  1IBL K;  2P9I B;  4FWQ A;  1XC9 A;  1NKB A;  3OYM A;  3ZSY A;  2YNG A;  1MDU B;  2CH5 A;  1EWQ A;  3QER A;  2HHQ A;  1TL1 A;  2E2N A;  3CCL N;  4EZ6 A;  1T6D A;  4CJU A;  3OYD A;  3H46 O;  4UY8 O;  4Z4E A;  3MK6 A;  2HHH K;  2YV0 X;  1IV0 A;  1Q9X A;  4RCH A;  4BE1 A;  1LWE A;  4B9T A;  2FLO A;  1U4B A;  1S22 A;  3LP1 A;  3O8M A;  5C10 A;  4FXD A;  3E66 A;  1L3V A;  5DM6 L;  1X3N A;  3SAF A;  4FLV A;  4CBU A;  3DLB A;  4EHT A;  3KTQ A;  1TL3 A;  1NGI A;  4EHU A;  3AGR A;  1RFQ A;  4A59 A;  3K0S A;  2RKI A;  3P38 A;  3KK3 A;  3I0S A;  2NNW A;  4H8K A;  2P9U A;  3W3D A;  4MDB A;  2VWB A;  3J7Z O;  3MXM A;  1NU0 A;  4FVU A;  1BIU A;  4LFA K;  3LDP A;  3OYJ A;  2EWS A;  5LJW A;  4FJ9 A;  3AA4 A;  2PY5 A;  4GY2 B;  1WSF A;  3GE1 A;  4B9L A;  1U49 A;  3AVK A;  3SQ0 A;  4MLE A;  4DFM A;  5J2N A;  3DLH A;  4DUZ K;  1KLM A;  3IUC A;  3CME N;  4LF9 K;  4W5Q A;  1QSL A;  3RRH A;  4CJ3 A;  4OGC A;  3THY A;  2GV9 A;  3BGR A;  4Z94 A;  2BE2 A;  3MX5 A;  3VEV A;  1IBM K;  1W0H A;  3CD6 N;  1RTJ A;  4CK3 A;  3BZC A;  1NK4 A;  4CFC A;  4CZF A;  4DQI A;  3R6M A;  4JI1 K;  1LCU A;  3CMA N;  3S3O A;  4HCC A;  3KJV A;  1G99 A;  1EXQ A;  1LAW A;  2QA4 N;  1WSI A;  4JKD A;  2NRV A;  4FCY A;  1DLO A;  2F96 A;  4CD1 A;  2ASM A;  4M3W A;  1BOT O;  2P9S A;  2AJQ A;  3N4P A;  5AQS A;  4FM0 A;  4DFJ A;  1HKB A;  3SPY A;  3NHG A;  3NH1 A;  2O8D B;  1QTM A;  4X65 K;  1CZ9 A;  4C8O A;  1IKW A;  2XY5 A;  5FPM A;  4JEP A;  3CQ8 A;  4DR4 K;  2O8D A;  4B8C A;  3C0B A;  3GOI A;  1WSE A;  3DLG A;  4CD3 A;  3EZ5 A;  3CFP A;  3MAQ A;  3ENO A;  2D0P A;  5LJV A;  5HP1 A;  3P1G A;  3VQ4 A;  2I5J A;  4JNE A;  4LSN A;  4YY3 K;  2CGL A;  4H0Y B;  3WEE B;  3JSM A;  1YJN N;  2Y1I A;  4YOY A;  2Q97 A;  2HNZ A;  4GKK K;  4K42 A;  2UYT A;  4A2A A;  4KH4 A;  3E9O A;  1NKE A;  3VGK A;  1U2V B;  5AZI A;  4NXN K;  5CYM A;  3ISN C;  4RW4 A;  3DLK A;  4CFD A;  1IKY A;  1QHT A;  3AAQ A;  5FRN A;  3PX6 A;  5AQM A;  3CHW A;  5LMU K;  3ZET B;  4JRQ A;  2YNF A;  4KHW A;  1K8K B;  3SUN A;  3CI5 A;  3Q7C A;  2YHB A;  3QML A;  3WXI A;  1HKC A;  1NJX A;  3TSP A;  2DFE A;  2GEL A;  3CER A;  1WAJ A;  4FJ5 A;  5DM7 L;  1EWR A;  1KLN A;  3RR8 A;  3ZSZ A;  2VWJ A;  2RPI A;  2QWM A;  5C12 A;  4DV1 K;  2ASP A;  4M7Y A;  4CGJ A;  4DS5 A;  2FSN A;  3VQD A;  2QI2 A;  4ILG B;  5E84 A;  4FJ8 A;  1XUP O;  3EKU A;  2G8W A;  3HTV A;  2Q1N A;  5JS1 A;  4KPY A;  2IS3 A;  3AVJ A;  4CZE A;  4RTF D;  3KLH A;  3A5M C;  3EO3 A;  4CEF A;  4YOX A;  2BTF A;  3SV3 A;  3RMA A;  4DLE A;  5BR8 K;  1UWB A;  1OKJ A;  4FPA A;  2HVH A;  3THV A;  4IEI A;  4QAG A;  1N36 K;  2NRR A;  4DV4 K;  1NGD A;  3K9K A;  4FJX A;  4KHS A;  4GVE A;  3OBY A;  4Q5V A;  4DV0 K;  1IG9 A;  2PYJ A;  4JD2 A;  4FLX A;  3VQQ A;  2VQE K;  3PSF A;  4ID1 A;  3DXM B;  1SKW A;  1M90 O;  4NLC A;  1GLE G;  1SS6 A;  3NCI A;  1TUY A;  2XHB A;  3CCJ N;  3DI6 A;  2FBT A;  4HVJ A;  1IG8 A;  4GMJ B;  4WQ4 C;  3GL1 A;  1BG3 A;  2Q0R A;  2V52 B;  3OS0 A;  2YX6 A;  2FSK A;  1VQN N;  3BUZ B;  4JYA K;  1XHZ A;  3DYA A;  1XQS C;  2V51 B;  3UIQ A;  1NGG A;  3MXJ A;  4F3T A;  5CHI A;  3O9R A;  3GG4 A;  1LOT B;  3ULE B;  1XWL A;  4YOR A;  1XMO K;  2QKK A;  3DOK A;  3ZSQ A;  4CEE A;  3CC4 N;  2XY8 A;  4IJN A;  4J8F A;  4IO8 A;  5FPN A;  3SZ2 A;  4BRC A;  3AVF A;  1UOC A;  1UA0 A;  1NK8 A;  2JLE A;  4ISF A;  3HP6 A;  1GLA G;  1JLA A;  4BRE A;  4K0K K;  2B5J A;  3HPH A;  2JWK A;  4M63 C;  5J2P A;  4OPJ A;  2KTQ A;  5E41 A;  4W5T A;  3AAR A;  1YIT N;  4C8N A;  1ZBS A;  2HST A;  4U67 L;  1KAZ A;  3R3L A;  4B1V A;  3SJJ A;  1OH7 A;  4FK4 A;  3OA9 A;  5AR0 A;  4H4M A;  3D7E O;  1Q7Y O;  2G8F A;  4DSJ A;  1OH8 A;  5BRH A;  2F4V K;  1S9G A;  5I42 A;  4BRI A;  1RIL A;  2ZGY A;  3T1Y K;  1KVC A;  3EN9 A;  3TAQ A;  2EX3 A;  1RCH A;  1N8R O;  3D45 A;  1QZ6 A;  2E88 A;  2JWL A;  1LAV A;  4JAX A;  4E1M A;  3I33 A;  1E4F T;  4JK8 A;  2I7N A;  1KXP A;  3ZEU A;  4FL9 A;  3LAM A;  4FZY A;  4DU3 A;  1HUX A;  3ID6 A;  2FBY A;  5DMR A;  4A62 A;  2P51 A;  3W0L A;  3VF2 A;  4IWV A;  5KRT A;  3CCE N;  2KKZ A;  4XH5 A;  4G9Z A;  4BC4 A;  5KPZ A;  2OZS A;  5J1E A;  3K5N A;  1HJR A;  1NJW A;  3U4L A;  2WUS A;  1NGE A;  3V1O A;  4Y0W A;  2HMI A;  1LWF A;  5I9E B;  5E26 A;  4NXM K;  3SK3 A;  1C0G A;  4DQ8 A;  5AQW A;  3VOV A;  3SLC A;  5JLH A;  3WEE A;  4XH1 A;  4AM6 A;  3KLF A;  1G15 A;  4Z4I A;  2O8F B;  3AAP A;  3CYM A;  1U2V A;  5EVZ A;  3NE6 A;  1JLF A;  4CIE A;  2G8I A;  2GEM A;  3THX B; 
#chains in the Genus database with same CATH homology
 1TVR A;  1RDD A;  4H4O A;  4CJE A;  2FC0 A;  4DQP A;  4AHU A;  4E0D A;  3WNG A;  3V9S A;  4KI6 A;  1WLJ A;  3SUO A;  4F3O A;  3MEG A;  3SPZ A;  3HK2 A;  4RW7 A;  1R0A A;  1XI1 A;  1S9E A;  5J2M A;  2PZS A;  4DF8 A;  4FK0 A;  1TAQ A;  2X78 A;  3DLR A;  4DFP A;  4RG8 A;  3DOL A;  4Y1C A;  1KFD A;  4B8A B;  4JS4 A;  4XIU A;  4ELU A;  4JLH A;  4AHR A;  1TK5 A;  4EZ9 A;  4UQG A;  1L5U A;  4BWJ A;  2ITG A;  1HYZ A;  2X74 A;  3CG7 A;  4ICL A;  3OYN A;  4GVM A;  4KKO A;  1NK7 A;  4CES A;  1X9S A;  2XY7 A;  4CK1 A;  5HRN A;  4KB1 A;  3K5O A;  3NF9 A;  4FJJ A;  4LH5 A;  4BWM A;  3EY1 A;  3ZT1 A;  2XY6 A;  1VSH A;  2OZM A;  1HQE A;  2HHS A;  3K5M A;  3VQ6 A;  2HW3 A;  4CJF A;  4FLY A;  4C8M A;  1B92 A;  3ZSV A;  2QKB A;  2P1J A;  4Y1D A;  1EKE A;  1DTT A;  1VSK A;  1WN7 A;  1XHX A;  2NUB A;  1A5X A;  1VRT A;  1HNV A;  2XRI A;  3MEE A;  3VQ5 A;  5T7B A;  3O3H A;  3OYH A;  1VSL A;  1JXB A;  2O4G A;  3ZT2 A;  3I8D A;  4JRP A;  4KTZ A;  4E7H A;  1EX4 A;  5HLF A;  1WSJ A;  3DRP A;  1C0T A;  3NBP A;  3VN5 A;  3HPO A;  3K5L A;  4DTJ A;  4FZX C;  4BDY A;  2HHT A;  2OPP A;  1NOY A;  1ZBI A;  4CF0 A;  3V9U A;  3HXM A;  4CGI A;  4DFK A;  4FJI A;  1BCO A;  4HUF A;  4FLT A;  3OYA A;  3AV9 A;  4B08 A;  1VSI A;  5KGW A;  3AO2 A;  3ZT3 A;  4B3O A;  4KB0 A;  3LAN A;  4CEC A;  3AVG A;  4IFY A;  1XC9 A;  1NKB A;  1REV A;  4CJL A;  3OYM A;  1QS4 A;  4ZTF A;  4NYF A;  1NOZ A;  2WOM A;  3V4I A;  3ZSY A;  4DQR A;  2YNG A;  3PO4 A;  1FKP A;  1IKX A;  5HRO A;  1RBU A;  3QIN A;  4LH4 A;  3QER A;  4M3Z A;  2HHQ A;  1TL1 A;  4EZ6 A;  4CF2 A;  3OYD A;  4CJU A;  4PA1 A;  3L2W A;  1YT3 A;  1JL1 A;  3WNE A;  4CCH A;  4FJM A;  4Z4E A;  1MU2 A;  3LAK A;  4DTU A;  3T3F A;  2QK9 A;  2Y1J A;  5KGX A;  5SZT A;  4AHV A;  2YV0 X;  4E89 A;  4OLA A;  4CJV A;  3ULD A;  4FYD A;  3M8P A;  1Q9X A;  4CEQ A;  4BE1 A;  1TKD A;  3B6O A;  3SNN A;  1LWE A;  4B9T A;  3PO5 A;  1C0U A;  3CM5 A;  5K14 A;  4O5B A;  1U4B A;  4FJH A;  1KVA A;  3QEV A;  3LP1 A;  2FBX A;  4FW1 A;  4FXD A;  3PY8 A;  1L3V A;  3V81 A;  1QQC A;  3AVC A;  4KHY A;  2D5R A;  4ELV A;  4N41 A;  1SL1 A;  1KCF A;  4FLV A;  3TWH A;  1U45 A;  2DTU A;  3DLB A;  4I2P A;  1TL3 A;  3KTQ A;  3C6U A;  3NGY A;  4LY7 A;  1TGO A;  3OYL A;  4CHZ A;  2IGI A;  3HO1 A;  3KKS A;  4E7K A;  2RKI A;  3LZI A;  4ELT A;  3F9K A;  4FM2 A;  2Z1I A;  5C42 A;  1JLB A;  1FK9 A;  3LWL A;  1JKH A;  3KK3 A;  3I0S A;  1S1W A;  1S6P A;  1LW0 A;  4H8K A;  3AVA A;  1BIZ A;  1ITG A;  3MXM A;  5CY4 A;  2DFF A;  2HNY A;  4KFB A;  1BIU A;  4DU1 A;  3DMJ A;  1RT2 A;  1RT6 A;  1RT1 A;  3L2V A;  3OYJ A;  5I3U A;  3MEC A;  1U47 A;  4CED A;  5CZ1 A;  3RTV A;  4OKK A;  1QSS A;  4FJ9 A;  3HL8 A;  3PUF A;  1N5Y A;  1BIS A;  3AA4 A;  2PY5 A;  4R5P A;  2XO7 A;  3L8B A;  3BDP A;  4I9Q A;  3ZCM A;  1WSF A;  3TAG A;  3ZT4 A;  4FLU A;  3QLH A;  4CF9 A;  2G8H A;  4B9L A;  3LZJ A;  4TSX A;  1U49 A;  4E7I A;  2KFZ A;  1S6Q A;  3V6D A;  2F8T A;  3AVK A;  4DSL A;  4F4K A;  3C6T A;  1RT5 A;  5JS2 A;  4EP4 A;  4DFM A;  5J2N A;  3SQ0 A;  3DLH A;  2HHX A;  1KLM A;  4AHT A;  1NK6 A;  4KAZ A;  3L2R A;  1D9F A;  4KTQ A;  1NJZ A;  3CFR A;  4O44 A;  4W5Q A;  3SCX A;  3P5J A;  1RT7 A;  1ZBF A;  4I9L A;  5HRR A;  2W42 A;  3IG1 A;  4J2E A;  2YKN A;  4DMN A;  3V9X A;  5J2Q A;  1QSL A;  1YTU A;  2F8S A;  3OS1 A;  3RRH A;  4CJ3 A;  4AIL C;  3TAM A;  4OGC A;  3ZT0 A;  4N56 A;  2GV9 A;  3BGR A;  2VWK A;  1D5A A;  2BE2 A;  3FFI A;  3AVH A;  4M3X A;  1BQM A;  3OYG A;  3V9Z A;  1BI4 B;  1W0H A;  4FJN A;  3MXI A;  2PYL A;  4ID5 A;  2OPR A;  3IRX A;  4MQ3 A;  1KSP A;  1RTJ A;  4LSL A;  3A2F A;  4CK3 A;  4DS4 A;  3TAE A;  1NK4 A;  1T7P A;  4CFC A;  4DQI A;  4CGH A;  5CYQ A;  3OVN A;  2D0B A;  1I3A A;  3AA2 A;  4LD0 A;  4CHP A;  4HUG A;  3U6F A;  3S3O A;  4IKF A;  4J2D A;  4HCC A;  2WON A;  3KJV A;  2D0C A;  4O0J A;  3T1A A;  2RN2 A;  2X6N A;  1EXQ A;  1LAW A;  3VQ8 A;  2O4I A;  4F2R A;  3SV4 A;  4B9N A;  2HVI A;  1WSI A;  4FJL A;  4FCY A;  1DLO A;  2KZM A;  2F96 A;  3RRG A;  4CHY A;  3AVL A;  4M3W A;  3NH2 A;  4CJQ A;  2P5O A;  4IBN A;  1U04 A;  4KRE A;  3OYI A;  2AJQ A;  2BDP A;  1I39 A;  1HYV A;  4FM0 A;  4DFJ A;  1L3U A;  4O55 A;  4CJ4 A;  3ZSO A;  3SPY A;  3NHG A;  3NH1 A;  1QTM A;  1IH7 A;  2OA8 A;  4PWD A;  1CZ9 A;  1L3T A;  4NCG A;  4C8O A;  1IKW A;  5C25 A;  3F73 A;  2XY5 A;  4M41 A;  4CHN A;  3CQ8 A;  5FRO A;  4B9S A;  4B8C A;  3QEP A;  3SI6 A;  1WSE A;  4PY5 A;  3DLG A;  1Y97 A;  3EZ5 A;  1U48 A;  2P5G A;  3CFP A;  3MAQ A;  1LV5 A;  1ZBH A;  3HVT A;  4E1N A;  5HP1 A;  1VSM A;  3P1G A;  1KFS A;  3VQ4 A;  2I5J A;  4LSN A;  3SUP A;  4FJG A;  3O4Q A;  3VQB A;  3JSM A;  4Q0B A;  1NK0 A;  4FW2 A;  2Y1I A;  3SUQ A;  4CFB A;  2HNZ A;  3OYC A;  2VG6 A;  4CGF A;  4EP5 A;  4BDP A;  4PQU A;  3HVR A;  1L3S A;  3PX4 A;  4K8Z A;  1TKT A;  3T19 A;  1NKE A;  3TAB A;  4DQQ A;  2OPS A;  4BDZ A;  1NKC A;  2BGG A;  2HHW A;  1GOC A;  5CYM A;  3ISN C;  4RW4 A;  3DLK A;  4ZHR A;  5KRS A;  3LP3 A;  3O4N A;  4CFD A;  3O3F A;  1IKY A;  4M3T A;  1JLE A;  1QHT A;  1WSG A;  4J2B A;  1NK5 A;  5FRN A;  2Z1H A;  3PX6 A;  1IKV A;  4DTR A;  1JLC A;  1C1C A;  3RR7 A;  1RDA A;  3S3N A;  2DFH A;  3HM9 A;  4J2A A;  4JRQ A;  2YNF A;  4KHW A;  2KW4 A;  3OY9 A;  3OJU A;  2HB5 A;  4M3R A;  3SUN A;  1UAX A;  3G10 A;  3ZSR A;  1ASW A;  3QNN A;  1S1X A;  4KHN A;  4E7J A;  3VA0 A;  2YHB A;  3KIO A;  2ATQ A;  3AVB A;  3C94 A;  3VQE A;  1A5V A;  1C0M A;  1NJX A;  3TAR A;  4N5S A;  2DFE A;  3DM2 A;  1WAJ A;  4Z4G A;  4DSI A;  4FJ5 A;  4OPK A;  5FRM A;  4QCL A;  1SL0 A;  3G0Z A;  3LWM A;  1BCM A;  4WE1 A;  4M3U A;  3NAE A;  1KLN A;  3RR8 A;  3RWU A;  3S3M A;  2Z1J A;  3I0R A;  4DTO A;  4GW6 A;  3ZSZ A;  1C6V A;  2VWJ A;  4FZZ A;  4Z0U A;  3TAN A;  1KVB A;  1HNI A;  3LAL A;  3VQ9 A;  1ZYQ A;  4KHU A;  2RPI A;  1VSD A;  1QSY A;  4KRF A;  1SV5 A;  4DU4 A;  4B9M A;  2GUI A;  4CGJ A;  2VG7 A;  5EU7 A;  3VQA A;  1RTI A;  1HMV A;  4RW8 A;  4DS5 A;  4C8K A;  1BHL A;  3VQD A;  4O0I A;  4FJ8 A;  4CHQ A;  1CLQ A;  4CGG A;  2G8W A;  5JS1 A;  2X6S A;  4KPY A;  2IS3 A;  3AVJ A;  2JGU A;  4KO0 A;  4B9V A;  4W5O A;  4FJK A;  3KLH A;  3L2Q A;  1CXQ A;  2D0A A;  3WNF A;  1VSJ A;  4CEF A;  3L3V A;  3VQ7 A;  1A5W A;  3SV3 A;  1VSF A;  3K59 A;  3RMA A;  2Q3S A;  4DLE A;  3AVM A;  2HND A;  1UWB A;  1BQN A;  3KLI A;  4KTW A;  4KV8 A;  4RW9 A;  3TI0 A;  3SYZ A;  3THV A;  4DWI A;  1Z26 A;  3AO5 A;  3DLE A;  4QAG A;  4KHQ A;  2HVH A;  4CK2 A;  1GOA A;  1RTD A;  1CXU A;  2Z1G A;  1TV6 A;  3OYB A;  4FJX A;  3EYZ A;  4KHS A;  1DTQ A;  3U3Y A;  4E3S A;  2E4L A;  2YKM A;  3D0P A;  4DG1 A;  3NGZ A;  3KKR A;  4Q5V A;  1IG9 A;  2PYJ A;  3CFO A;  2B4J A;  4M3Y A;  2GBZ A;  3LP0 A;  4CJP A;  3K2P A;  2LSN A;  1RBR A;  4FLX A;  1Q9Y A;  1RBS A;  3VQQ A;  4AH9 A;  4OGE A;  2IDO A;  4ID1 A;  3PV8 A;  1SKW A;  4G1Q A;  4CF1 A;  1S5J A;  2B6A A;  3OYK A;  3AVN A;  3NCI A;  4NCB A;  3JYT A;  2XHB A;  4K8X A;  3DI6 A;  4KI4 A;  4YNQ A;  2FBT A;  4HVJ A;  3IAY A;  1X1P A;  1J9A A;  3RMC A;  3S9H A;  4CJT A;  3QES A;  4GMJ B;  4Z4F A;  1ZBL A;  2KFN A;  4BE2 A;  4CEB A;  3NGI A;  3VQP A;  3ASM A;  4M42 A;  3OS0 A;  3TAF A;  2ETJ A;  4CJS A;  2KQ2 A;  2G8V A;  1EP4 A;  1Q8I A;  3NF7 A;  4CEA A;  1TKZ A;  1YVU A;  4DSE A;  3HP9 A;  4DSK A;  5CZ2 A;  1XHZ A;  3DYA A;  5HRS A;  1J5O A;  3UIQ A;  2YNH A;  3MXJ A;  2ZE2 A;  4F3T A;  3QEW A;  3H08 A;  4I7F A;  4DTP A;  3OYF A;  4DTM A;  3HYF A;  1TK8 A;  4NYN A;  1XWL A;  4CIG A;  4E7L A;  3QEX A;  4L8R B;  5SWM A;  2QKK A;  1RNH A;  3DOK A;  3PX0 A;  2ZD1 A;  4F2S A;  3V9W A;  3ZSQ A;  4CEE A;  4IG0 A;  2XY8 A;  4ZTJ A;  4C8L A;  3QNO A;  1SL2 A;  1JXE A;  3SZ2 A;  2G8U A;  3AVF A;  2YNI A;  1LWC A;  3V1Q A;  1UOC A;  3AVI A;  1UA0 A;  3DRS A;  1VK0 A;  1W9H A;  2JLE A;  4O4G A;  1NK8 A;  3HP6 A;  1SUQ A;  3QEI A;  1Z25 A;  1ASU A;  1JLA A;  3QIP A;  2A1S A;  3E01 A;  4AHC A;  4QOZ B;  3LP2 A;  2B5J A;  4IG3 A;  4DSF A;  1T8E A;  1FXX A;  3HPH A;  3CM6 A;  3KK1 A;  3AA3 A;  4FLW A;  3TAP A;  5J2P A;  1TK0 A;  2KZZ A;  4OPJ A;  1WAF A;  1IO2 A;  2KTQ A;  3M8R A;  3RMB A;  5E41 A;  4W5T A;  4NCA A;  1RTH A;  4C8N A;  3DRR A;  4DQS A;  3OYE A;  4HTU A;  1KRP A;  3NFA A;  3QO9 A;  1T05 A;  3SJJ A;  1VSE A;  4OVL A;  4FK4 A;  1BI4 A;  4DLG A;  1FKO A;  3QET A;  4JS5 A;  3LPT A;  4H4M A;  3K58 A;  5HBM A;  3ZSW A;  2G8F A;  1B9F A;  4DSJ A;  5KI6 A;  2HHV A;  1D9D A;  4FVM A;  2DY4 A;  1S9G A;  1RT3 A;  5I42 A;  1QE1 A;  3C95 A;  3NF8 A;  4CJ5 A;  2IOC A;  1RIL A;  4CGD A;  1F21 A;  4F8R A;  4YFU A;  3M8Q A;  1KVC A;  1VRU A;  3SQ2 A;  4OJR A;  2FBV A;  4IDK A;  4OKJ A;  3TAQ A;  3B6P A;  2EX3 A;  4CJW A;  4OLB A;  4FLZ A;  2A1R A;  1RCH A;  2R7Y A;  3D45 A;  3L3U A;  1RBT A;  1BL3 A;  1ZBU A;  3QIO A;  4CE9 A;  2OPQ A;  1HPZ A;  1LAV A;  3P83 D;  4E1M A;  4RW6 A;  3VA3 A;  3NH0 A;  3SQ4 A;  2IC3 A;  3SQ1 A;  2G8K A;  1CZB A;  1LW2 A;  4DTN A;  3IS9 A;  1B9D A;  4IFV A;  5HRP A;  3ALY A;  3M8S A;  1X9W A;  3AA5 X;  4FJ7 A;  1C1A A;  3KD1 E;  4CHO A;  5D3G A;  3LAM A;  4FZY A;  4FM1 A;  1YTA A;  2E6L A;  2EHG A;  4CJK A;  4BAC A;  4N76 A;  1SKR A;  4FK2 A;  2YHA A;  4Z4C A;  1HQU A;  1RDC A;  4W5R A;  4DU3 A;  3ITH A;  3KD5 E;  2FBY A;  1GOB A;  5DMR A;  5KTQ A;  2QXF A;  3KLE A;  2P51 A;  2RF2 A;  4HHT A;  4BE0 A;  4PUO A;  4HUE A;  4CEO A;  5KRT A;  5FDL A;  3V1R A;  4CER A;  2HHU A;  3TR8 A;  3NDK A;  4AHS A;  4CFA A;  4E19 A;  1SKS A;  3HJF A;  3RMD A;  3LPU A;  1S1U A;  2OZS A;  4W5N A;  3K57 A;  5J1E A;  1S1T A;  3K5N A;  1HJR A;  1WSH A;  2VG5 A;  4CEZ A;  3NF6 A;  4CF8 A;  1NJW A;  5C24 A;  3KLG A;  1HYS A;  4I2Q A;  2OYQ A;  1O1W A;  4OKE A;  3LDS A;  3V1O A;  1RBV A;  1C1B A;  1RDB A;  2HMI A;  1LWF A;  2IAJ A;  4CJR A;  4N47 A;  2BAN A;  3OS2 A;  1HRH A;  3HT3 A;  1TKX A;  3KK2 A;  2E6M A;  1S1V A;  1N6Q A;  1J53 A;  4CIF A;  1J54 A;  1WNS A;  3MED A;  4B9U A;  4MFB A;  4DTS A;  1EET A;  1D8Y A;  1BGX T;  1RT4 A;  1T03 A;  3KLF A;  1G15 A;  4DF4 A;  3L2U A;  4Z4I A;  1JLG A;  4M45 A;  4DTX A;  1ASV A;  1JLQ A;  1JL2 A;  3CYM A;  3WNH A;  1NJY A;  3AO3 A;  3VQC A;  3U3G A;  3AO4 A;  3OJS A;  3NE6 A;  1UA1 A;  1K6Y A;  1KTQ A;  4Z4H A;  1X9M A;  1NK9 A;  3HPG A;  1JLF A;  4HCB A;  3AO1 A;  4CIE A;  2G8I A;  3HST B;  3O3G A;  1TAU A;  2ZQB A;  3ZSX A;  5DK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...