1VSKA

Asv integrase core domain d64n mutation in citrate buffer ph 6.0
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTNFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Structural basis for inactivating mutations and pH-dependent activity of avian sarcoma virus integrase.
pubmed doi rcsb
source organism Rous sarcoma virus - schmidt-ruppin b
molecule tags Hydrolase
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vskA00
4CJVA 3KD1E 4OPJA 3V4IA 1WSHA 1JLCA 1VSHA 3AVLA 1XHXA 3KLFA 1RDAA 3DLRA 3S9HA 1U47A 4FLXA 2DY4A 3V6DA 4CK1A 3A2FA 4RW8A 1KRPA 5HRPA 4H8KA 2BE2A 4IG3A 3P5JA 3AO3A 3NCIA 3RTVA 4I7FA 1JLAA 1WN7A 2YV0X 1SKWA 5JS2A 3AA3A 4OKEA 3CM5A 1I3AA 4F4KA 2PYLA 2G8WA 4CJ3A 3RMDA 3OYFA 4N76A 3VQPA 3OYIA 1JKHA 1VSIA 3NFAA 4H4MA 3PX0A 1QS4A 5HRRA 3OYNA 4FLVA 3HYFA 1TKTA 3QINA 1NKBA 1LAWA 1NK0A 1HYSA 1EXQA 3AV9A 2PYJA 2OZSA 4FW2A 3LWLA 1A5XA 1O1WA 5K14A 5I42A 2HNYA 4KAZA 1S9EA 1WAFA 5J2QA 1IG9A 2IC3A 2X78A 4F8RA 3AA2A 2G8HA 2QXFA 3SZ2A 4FK0A 1BI4B 5HROA 1WSEA 4CEOA 1HRHA 2IAJA 4CEEA 2YNIA 4DMNA 3L3VA 3OYAA 3M8RA 3I8DA 4JS5A 2YNFA 5D3GA 1RNHA 1W0HA 4CGJA 4CEZA 1RT1A 4W5NA 1C0UA 1KLMA 4B3OA 3SUQA 1HYVA 1TK8A 2QK9A 4RW7A 1X9MA 1YTUA 2WONA 3OJUA 1RTDA 1F21A 3QEPA 4ELTA 4RW4A 4KRFA 1CZ9A 5HP1A 2GBZA 1SL0A 4OPKA 5KGXA 4DTMA 2RPIA 3O4NA 1VSLA 4PUOA 5C25A 4BE2A 3ITHA 4F3TA 3AO1A 4DS5A 3TAMA 1C6VA 3DLKA 3OVNA 5C24A 1S1TA 4Y1CA 5T7BA 2I5JA 1SL2A 3KKSA 4FLZA 2WOMA 2B6AA 4CJTA 3HVRA 2OZMA 4ELVA 4FM2A 4DSKA 4DWIA 3MECA 3AA4A 3NF7A 1CXQA 3AVFA 1RT5A 4CK3A 3KTQA 1C0MA 3LANA 4LH4A 3ZT0A 3JYTA 1WSFA 3T3FA 4IFYA 3KD5E 2OYQA 4F2RA 2B4JA 2YKMA 3TR8A 1N6QA 4B9MA 1NK5A 2G8FA 4CESA 2F8SA 2HHUA 3PX4A 1VSMA 1S1VA 5FROA 3L2QA 4BDPA 1U04A 4O5BA 1BIUA 4Z4EA 1EKEA 2DFHA 3AO2A 3CFOA 4HUFA 3SQ2A 3TWHA 2P51A 4DF4A 4KHSA 4CFAA 3OYCA 1JLGA 3PO5A 3NF8A 3HM9A 2XY6A 3ZSRA 1QSYA 4CHNA 1X1PA 4CHYA 1BQMA 4CGFA 1TKDA 2KZMA 3AVMA 2XO7A 3DLGA 5JS1A 3QEWA 4Z0UA 3V9XA 2HB5A 4CJEA 3PY8A 4CGIA 5KGWA 3C6UA 1NK6A 4KV8A 4M3TA 1TV6A 4MQ3A 4FJHA 4KFBA 4W5OA 4FJNA 3V9WA 2RF2A 3NH2A 4B8CA 4CHQA 3K5LA 3QNOA 2NUBA 4QOZB 3ULDA 4DQSA 5J2NA 3AVBA 4DTXA 4CJWA 4DLEA 3ZT4A 3KLIA 1Z26A 1B92A 4FLTA 4FJIA 1BHLA 1IKXA 2OA8A 1NJYA 1JLFA 4BWJA 4OLAA 4FJKA 4C8LA 3VQQA 1LW0A 3QO9A 3T19A 1UA1A 3AVJA 1EP4A 1JXBA 1S5JA 4B9UA 2HVHA 4BACA 3ASMA 1KLNA 1RT2A 4CHZA 1KFSA 1W9HA 4AHRA 3DMJA 1A5VA 4OLBA 4FJ9A 3NH0A 3KJVA 1KVBA 3G0ZA 1VRTA 2FBYA 2HW3A 2VWKA 4NCGA 3AA5X 4CEFA 4CJFA 4EP5A 2R7YA 3QETA 1NKEA 4F2SA 4OGCA 1VSFA 4JRPA 2RN2A 3ZSQA 1NOYA 3F9KA 3AVGA 4M45A 3OJSA 1QSLA 5J1EA 4DSIA 4FJ8A 2Y1JA 2LSNA 4PQUA 4O4GA 4CERA 3K57A 3K59A 1TK5A 1FXXA 1LW2A 3LAMA 4M42A 1CXUA 3K5NA 3DYAA 3M8SA 1KFDA 4MFBA 4CF1A 4W5TA 4DTUA 1ZBLA 2FC0A 3NF9A 1NK8A 3MEEA 3LPTA 5CZ2A 3WNGA 5KTQA 2KTQA 3ZT2A 5KRSA 3IS9A 3OYMA 3AO5A 3HXMA 4FJXA 3SUPA 1RDDA 3L8BA 4DS4A 4IFVA 4B9TA 4O0IA 4CCHA 4C8OA 2KZZA 5CY4A 4L8RB 4B08A 5J2MA 1VSEA 4YNQA 1IKVA 4DU3A 4CGHA 3TAEA 4CF0A 3PV8A 3THVA 4IBNA 1L5UA 1T7PA 1ASWA 3SV3A 3KLGA 4FXDA 4DTRA 4NYFA 2D0BA 4ZTFA 2FBXA 4AH9A 4CFBA 3RMCA 1JLBA 4M41A 4E7LA 4FJ5A 4KI4A 2OPRA 5HRNA 3NDKA 3HO1A 4CIFA 2BANA 4PY5A 3NGIA 1RTJA 2YKNA 4DTOA 3LDSA 3NGYA 4B9LA 4Z4IA 4CEBA 2HHTA 4DQRA 1RBVA 3SV4A 4KHYA 1WSJA 1IKWA 5EU7A 3EZ5A 4IDKA 4K8ZA 1NK9A 1LV5A 2E4LA 4B9NA 1GOAA 4M3ZA 1IH7A 1XI1A 1IKYA 3TABA 3PUFA 2P5GA 4FZZA 1HMVA 1XHZA 2OPPA 3T1AA 4FJJA 4FW1A 1L3VA 4KTZA 1JL2A 3RWUA 4KPYA 3DM2A 4QCLA 5HBMA 3HPGA 1HYZA 2Z1HA 4M3RA 4ELUA 4DSJA 4C8MA 1BCMA 1D8YA 4EZ6A 3ZSVA 4KO0A 2FBTA 3SQ1A 2HMIA 1S1UA 3V81A 3TAGA 3B6PA 2AJQA 3K58A 4E19A 3OS1A 3OYGA 4M3UA 3NF6A 1DLOA 3VQ6A 4E89A 1S1WA 1Z25A 4LH5A 3EYZA 4E3SA 1G15A 4DFPA 3TANA 5HLFA 1EX4A 3LWMA 3H08A 1T05A 5FRNA 4M3WA 3OS2A 3NH1A 4FLYA 1UA0A 1Q9YA 3HK2A 4AHSA 1U49A 3K5OA 3HL8A 1QQCA 1ASUA 1KVCA 2EX3A 4OJRA 2XRIA 4DSLA 2YHBA 2Z1JA 4HHTA 1GOBA 1MU2A 5HRSA 2D0AA 4YFUA 3D0PA 4CECA 4W5RA 3HP9A 4FCYA 1RILA 3CYMA 4NCBA 3O3GA 3ZCMA 1T8EA 2ETJA 4I9QA 3SYZA 4C8NA 3LALA 3ISNC 2KFNA 3VA0A 1CZBA 4E7HA 4ZTJA 3S3MA 2BDPA 3AVIA 4E1NA 2P5OA 2DTUA 1KCFA 1LAVA 4AHTA 4E7IA 3O3FA 2HNDA 4FJLA 3VQCA 2GV9A 4CE9A 4C8KA 1RT3A 4E7KA 1UOCA 1BCOA 1BI4A 3NBPA 5E41A 3V1OA 3U3YA 4LSLA 4OKJA 3SJJA 1U48A 1J5OA 1TGOA 3LP2A 4DSFA 1LWEA 4BDYA 3ZSZA 2IS3A 4CIGA 4LD0A 3VQBA 3OYHA 1QTMA 1TKZA 1J53A 1C0TA 3VA3A 4CK2A 4DU4A 2KQ2A 1VSJA 3RMBA 2G8UA 4J2BA 1ITGA 4DTPA 3HT3A 2X74A 1ZBFA 4DQPA 1Y97A 1RT4A 4DFJA 4ID5A 3LZJA 1KVAA 1CLQA 3AVAA 2D0CA 4RG8A 4AILC 5C42A 4BDZA 3V9ZA 3K2PA 4HUEA 3BDPA 4FM0A 3IG1A 3SUNA 3C6TA 3AO4A 3SCXA 4J2DA 1BGXT 3S3NA 1J9AA 2EHGA 3AVHA 4R5PA 1KSPA 1RBRA 4CF8A 4AHCA 3NHGA 3MXIA 3RMAA 1RDCA 3CFRA 4FLWA 1R0AA 3VQDA 3HPOA 3OY9A 1RT6A 1KTQA 3P1GA 1JLQA 4I2PA 5DK5A 3SI6A 1HQUA 3L3UA 4HVJA 4QAGA 2W42A 4Z4FA 5J2PA 4KB1A 2JGUA 1HQEA 3QLHA 4IG0A 3SPYA 1HNIA 2G8KA 2VWJA 1J54A 1VSKA 1S6PA 1WNSA 4WE1A 5FDLA 4CGDA 3ZSXA 4HUGA 1K6YA 4KTQA 1RDBA 4KI6A 3HJFA 2VG6A 4FYDA 1BL3A 4CHOA 5CZ1A 1D5AA 3RRHA 4GVMA 3U6FA 2KW4A 3I0RA 2A1SA 1A5WA 3QEXA 5I3UA 1TAUA 5CYQA 2Y1IA 4NYNA 1LWFA 3AVCA 1YVUA 4RW9A 1GOCA 4IKFA 3KK1A 3MEDA 4N47A 1SV5A 4DLGA 3KIOA 4DQIA 1HPZA 2O4GA 4LY7A 2PY5A 4EP4A 1RBTA 2IDOA 1NJZA 4DTNA 4XIUA 3DLBA 1FKPA 4JS4A 1RCHA 1TVRA 1JLEA 1LWCA 4Z4HA 4CEAA 3KLHA 4I2QA 2E6LA 1DTTA 3ALYA 1QHTA 1S6QA 2VG7A 3C94A 4LSNA 4CJSA 4OVLA 1FK9A 3VQ7A 3SPZA 1UAXA 4KHQA 4G1QA 1RTIA 4FJGA 2YHAA 1BISA 1XWLA 3QESA 5KI6A 4GW6A 3ZT3A 3AVNA 5SWMA 1NK7A 2OPQA 3CM6A 3DI6A 4Z4GA 4FJ7A 1B9DA 4O55A 3O4QA 2PZSA 4HCCA 4K8XA 2ATQA 3ZSWA 2HHWA 1RBUA 3OYJA 1SKSA 3DOLA 4UQGA 1DTQA 1QE1A 1S9GA 1YTAA 1S1XA 3WNEA 2XY7A 2A1RA 4RW6A 3V1RA 3G10A 5KRTA 3SNNA 3FFIA 3TAQA 3VQEA 4EZ9A 2YNGA 4AHVA 3OYLA 1L3UA 2HVIA 4B9SA 4E0DA 4GMJB 4DF8A 3LZIA 4ZHRA 3ZSYA 2ZD1A 3U3GA 3PX6A 3BGRA 5DMRA 4CJRA 2JLEA 4CF2A 3VQ4A 4CEQA 4PWDA 1JXEA 4HCBA 3QIPA 3QNNA 3KK2A 4KHUA 4FZYA 3P83D 1ZYQA 1X9WA 4J2AA 1D9FA 4B9VA 1JL1A 4KHWA 1XC9A 2ZQBA 1RTHA 2Z1IA 3RRGA 1NJWA 1C1CA 3UIQA 4O44A 3F73A 2DFEA 2Q3SA 4DTJA 3WNHA 3OYDA 1RT7A 1WSGA 2RKIA 3DRSA 1ZBUA 4CJPA 5CYMA 3K5MA 3NAEA 3OYEA 1I39A 1QSSA 4DTSA 1Q8IA 1UWBA 3L2VA 1T03A 4F3OA 1C1BA 3LP0A 4CJ5A 2B5JA 2HHVA 3LP3A 4KB0A 4Z4CA 4DSEA 4JRQA 4J2EA 3RR8A 3CG7A 3MEGA 4DFKA 1TL3A 3LP1A 3ZSOA 4Q0BA 3VQ5A 2XHBA 1BQNA 3MXJA 3M8QA 4CF9A 3S3OA 1ZBIA 3DRRA 1L3TA 2DFFA 1X9SA 1L3SA 3VN5A 4FK4A 3I0SA 3TAFA 3NGZA 1REVA 2XY8A 3IAYA 4CJQA 4FVMA 3QEVA 5SZTA 4PA1A 2QKBA 4BWMA 1SUQA 1TAQA 1VSDA 2ITGA 4CFDA 4W5QA 3V9SA 4KHNA 1HNVA 3DLEA 2F8TA 3EY1A 3L2RA 4N41A 4OGEA 3VQAA 1B9FA 4E1MA 4ID1A 3KK3A 5FRMA 2Z1GA 3DOKA 2IOCA 3OYKA 2YNHA 3M8PA 2G8VA 4Y1DA 4JLHA 1TKXA 1NKCA 4FJMA 2D5RA 3IRXA 4AHUA 3HPHA 3RR7A 1WLJA 4CIEA 3TAPA 4CJLA 4BE1A 1U4BA 3QEIA 2HHXA 3DRPA 3OS0A 4DFMA 4FK2A 3HSTB 1NJXA 1FKOA 3VQ8A 3B6OA 4OKKA 4CEDA 1BIZA 1YT3A 2IGIA 4DG1A 1NOZA 3OYBA 3WNFA 4BE0A 3V9UA 1WAJA 2XY5A 1SKRA 1Q9XA 1D9DA 2QKKA 4CHPA 4I9LA 2E6MA 1EETA 2F96A 3L2UA 3CFPA 4N56A 2OPSA 3HP6A 1IO2A 1RBSA 3TARA 4KREA 4TSXA 4M3YA 3CQ8A 4E7JA 1U45A 4CJUA 3D45A 3E01A 4KKOA 3NE6A 3JSMA 4DQQA 3SQ4A 1WSIA 1ASVA 2ZE2A 4KTWA 3ZT1A 4Q5VA 1NK4A 3MXMA 3MAQA 2P1JA 3DLHA 2G8IA 3HVTA 2HHQA 2GUIA 3SQ0A 4HTUA 2BGGA 1TK0A 2FBVA 4CJKA 4DU1A 3QIOA 3V1QA 2VG5A 2X6NA 1VRUA 4FM1A 1HJRA 4M3XA 4FZXC 3KLEA 4B8AB 2HHSA 4FLUA 1ZBHA 3LPUA 4O0JA 3AVKA 3LAKA 4N5SA 4ICLA 3VQ9A 4H4OA 4CFCA 4CGGA 1VK0A 3TI0A 4NCAA 3KKRA 2X6SA 3O3HA 3QERA 1TL1A 3SUOA 4CJ4A 1SL1A 2HNZA 3PO4A 2O4IA 2KFZA 1N5YA 3L2WA 3C95A 1C1AA
chains in the Genus database with same CATH superfamily
4BVOA 1WSHA 1XHXA 1U47A 2DY4A 3J7AP 4CK1A 3GOIA 4H8KA 1U2VA 4IG3A 1JLAA 1SKWA 3DWLA 3AA3A 1YJNN 3CM5A 1I3AA 4F4KA 2PYLA 2YX6A 5LL6Z 3KVGA 4KH6A 3OYFA 3OYIA 3NFAA 4H4MA 3P31A 1N34K 3HYFA 2NRVA 3QINA 4DV7K 1LAWA 2HBMA 2P9KA 1HYSA 2NNWA 3LWLA 1WBDA 1A5XA 4PKIA 4XH4A 5I42A 1IG9A 2I7NA 2X78A 2IIRA 4DR1K 3JXUA 5LMUK 4CZIA 3KWGA 5HROA 1HRHA 2YNIA 3U4LA 4C1NK 1RNHA 2WFBA 4W5NA 1C0UA 3SUQA 3U9ZA 4RW7A 3G71N 3QEPA 3WXJA 4KRFA 5HP1A 3SAFA 1SL0A 1VSLA 3NVKA 5C25A 3HSCA 4F3TA 3AO1A 3VMFB 4HWIA 4FO0A 4DV2K 1SL2A 3KKSA 3WQUA 2WOMA 3HVRA 4CJTA 2OZMA 4ELVA 4FM2A 3AA4A 3AVFA 3DLLL 1RT5A 3LANA 3ZT0A 4DR4K 3T3FA 3KD5E 2B4JA 2GWJA 2YKMA 3AAPA 2G8FA 2F8SA 1YJ9N 2YJEA 1T6CA 1EKEA 2DFHA 3LDNA 4KHSA 4CFAA 3OYCA 3O4WA 3NF8A 5F0XA 3HM9A 3JAMO 4B9QA 3FGUA 3VTIA 5BN8A 3I33A 4CHNA 4A5BA 4IO8A 2GX9A 4YY3K 2P9UB 3TTCA 3VEOA 1NK6A 3K9JA 2YHXA 1XC3A 1WUAA 2E2QA 3ZT4A 1Z26A 1GLLO 4BWJA 4OLAA 3EZWA 2E5LK 4C8LA 3Q7CA 1VHXA 4B9UA 3ASMA 1RT2A 4YOTA 5DM6L 1W9HA 3SAGA 2QWMA 3KJVA 3G0ZA 4CJFA 4CEFA 3AAQA 1MWMA 2RN2A 3F9KA 3WXIA 2A6AA 4FJ8A 3VEVA 1HNXK 4BR0A 4BR9A 4H0XB 4O4GA 3VF4A 4MFBA 4W5TA 1BA0A 3H45C 1VQNN 2F4VK 1ZBLA 3DXKB 4O8KA 4BG8A 3LPTA 3WNGA 5KQ8A 5KRSA 3IS9A 2YCHA 3EO3A 1RDDA 4IFVA 5KPRA 2QEXN 4C8OA 5CY4A 4L8RB 3A5MC 5J2MA 3D6RA 4DV3K 3O1WA 3PV8A 4CGHA 2VGNA 2HF3A 4YDUC 1T7PA 4ILJA 4NYFA 5C10A 1JLBA 5HRNA 3HO1A 2WC9A 4JEPA 3BUZB 2HHTA 4H0YB 4CI6A 1RBVA 4JI7K 4M7YA 3VETA 5ADXH 3EZ5A 1XNQK 1NGDA 4IDKA 4M3ZA 1IH7A 4FZZA 4BGBA 4FW1A 3EEQA 5C0YA 2Z1HA 3MN6A 4M3RA 4ELUA 3FZHA 2HBKA 2GTDA 1N8RO 5AQLA 1S1UA 3V81A 3B6PA 4E19A 4YOYA 2YHWA 3VQ6A 4E89A 1S1WA 1WBBA 3ATVA 1G15A 5HLFA 3TANA 2W6LA 3IUCA 4AHSA 4XH5A 1X9JA 2YHBA 2Z1JA 1GOBA 4YFUA 2D0PA 2HBLA 2QWNA 2QA4N 5JLFA 3KK7A 1EWQA 2DTUA 4ZTJA 4E1NA 2P5OA 1U2VB 1LAVA 4E7IA 4FJLA 3WUHA 1RT3A 3SJJA 4FOIA 5AQOA 3ZX0A 4BDYA 1HR0K 4LD0A 3O9UA 4LF9K 4X62K 1J53A 3CCLN 2P9KB 4CK2A 1VSJA 5IWAK 2X74A 4PKHA 1Y97A 1RT4A 4DFJA 4H0VB 4AILC 5C42A 1TUUA 4FM0A 3SUNA 3C6TA 4GNIA 3SCXA 1BGXT 3S3NA 4R5PA 4CD3A 3H6EA 4AHCA 4KH5A 5ADXA 3NHGA 2ZJPL 3RMAA 3CFRA 3D2FA 1RT6A 1KTQA 5DK5A 5AQQA 3L3UA 2PAVA 5J2PA 5AQJA 3QLHA 2G8KA 3QB0A 1HNIA 4MO5A 5AQKA 1VSKA 1S6PA 1WNSA 4K43A 1K6YA 1NGBA 5AQWA 4FYDA 4FWLA 3LDQA 3SMSA 5CZ1A 1D5AA 2KW4A 1VQKN 3FE1A 2A1SA 4JKAA 2Y1IA 4NYNA 4JKDA 5BRFA 3U8XA 1HPZA 1VQ7N 1GLBG 2NRWA 5FPEA 2PY5A 4PL7A 4YOUA 4BRCA 2VQFK 1KAZA 1ZC6A 4XIUA 4CZFA 4CJSA 4FPBA 4OVLA 3VQ7A 4G1QA 1RTIA 3VTHA 1XWLA 4GW6A 3AVNA 2OPQA 3M1FA 4FJ7A 3GL1A 3RSEB 2ATQA 2JWKA 2HHWA 1SKSA 1Z6RA 1S9GA 2XY7A 2A1RA 4RW6A 4FOEA 5KRTA 5M1PA 1YITN 3TSPA 3B8AX 3ZETA 4BRPA 4KHPK 2HSTA 3CMAN 4DF8A 3AGKA 3PX6A 5M1OA 1I94K 5AFUH 4CJRA 4CF2A 1JXEA 4HCBA 4DR3K 4KHUA 4WQ4C 1D9FA 2QXLA 1JL1A 3OBYA 1QHAA 4H0PA 5CE3A 4IOCL 3L0QA 4H5TA 2DFEA 3SJHA 1YJWN 5CHIA 3DRSA 1QSSA 1TYQA 5CYMA 3OYEA 1OH6A 4PL8A 1Q8IA 3L2VA 1T03A 4F3OA 1C1BA 3LP0A 1S3XA 2B5JA 3MEGA 1TL3A 3H3NO 3ZSOA 4BGAA 3VQ5A 3CCQN 3H46O 3TTFA 3J7ZO 3M8QA 1L3TA 2DFFA 4YOXA 4FK4A 3NGZA 1REVA 1YF5L 4BWMA 3VF6A 4KHNA 1ATSA 3EY1A 3MX5A 4FWQA 4DQ8A 4E1MA 4ID1A 5FRMA 5JVGL 1TKXA 1ATRA 3IRXA 2CH6A 4JI1K 1U4BA 1HNWK 2O8FA 3OS0A 1NJXA 3VQ8A 4CEDA 4IWVA 3VGLA 3MWPA 4DG1A 1NOZA 1WAJA 2ZJRL 2XY5A 1SKRA 1D9DA 2QKKA 4V19S 4BRKA 3L2UA 3CFPA 5TKYA 4U67L 2RE2A 3MK6A 4TSXA 4E7JA 4A57A 3E01A 3QDKA 1W2BM 4DQQA 3SQ4A 1NGFA 4BREA 1H1VA 3MAQA 2W6KA 1FW6A 2X6NA 5CR4A 1HJRA 2QWOA 3E66A 1K8KB 5C2FA 5AFUA 2X6SA 4AM7A 2GUPA 1TL1A 3QERA 4CJ4A 3PO4A 1VQ6N 4GV6A 3DXMA 3KWIA 1GLEG 2W42A 1JJ2M 3C95A 1J6ZA 3SBTA 4CJVA 2Q36A 3KLFA 3DLRA 3VEYA 5JLHA 1Q18A 1KRPA 4RW8A 1C0GA 4FWRA 5HRPA 1RFQA 4C23A 3RTVA 4I7FA 1XQSC 1NNEA 5JS2A 3G25A 4BC3A 4GKJK 3VQPA 1JKHA 2V7YA 4H03B 3CC7N 5HRRA 4FLVA 1NK0A 3J7YP 2V52B 2IVNA 3AV9A 3W3DA 4KAZA 4JK8A 4F8RA 2IC3A 1G99A 3BF1A 3G6EN 2IAJA 5D3GA 3NVMA 1W0HA 3PSIA 3ULEA 1KLMA 4B3OA 3K0SA 2W40A 3OHRA 4IXCA 1X9MA 2WONA 3OJUA 1RTDA 1F21A 2O8EA 4FWMA 4OPKA 1WOQA 2RPIA 3O4NA 4BE2A 3OW2M 3TAMA 1C6VA 5AZJA 5T7BA 5BRHA 1N36K 2I5JA 4FLZA 3NF7A 1CXQA 3M6GA 4CK3A 2AA4A 3KTQA 3D2FB 4LH4A 3JYTA 2P9NA 1WSFA 1NGAA 4OO1J 1D4XA 4IFYA 2OYQA 4QS7A 4B9MA 1EQYA 2O8CA 2HHUA 1GLDG 3ID8A 3L2QA 4BDPA 2PFUA 1U04A 1BIUA 3R8EA 3SQ2A 3ID6A 3M3ZA 5AQYA 1JLGA 3PO5A 3ZSRA 3C65A 5LMNK 1X1PA 5B8HA 1TKDA 2ITMA 3AVMA 4BRGA 3DLGA 4GVEA 4JKFA 2HB5A 4CJEA 3FR0A 4U7BA 4CGIA 3C6UA 4KV8A 4M3TA 4FJHA 3V9WA 3NH2A 4B8CA 3K5LA 4A59A 2NUBA 3ULDA 3AVBA 3QICA 2P9IA 1C0FA 4FLTA 1BHLA 1QQOA 1J5EK 1NWKA 1NJYA 3T19A 3GBTA 4WF9L 4X64K 1UA1A 3AVJA 3THYA 4B1XB 1Y64A 1KLNA 4OX9K 2BH1A 3ZETB 1QVGM 4AHRA 2E2OA 1S22A 1O13A 4WYBA 1VQ9N 2VWKA 4NCGA 3AA5X 4B1VA 4EP5A 2UXBK 2HW3A 3QFPA 4OGCA 1SZ2A 3BZCA 4JK7A 1KC8O 1NOYA 2OANA 3AVGA 3OJSA 1QSLA 2UXDK 2Y1JA 4PQUA 1FXXA 1LW2A 3LAMA 4WQ5A 4M42A 1CXUA 2NRHA 3M8SA 1KFDA 4CF1A 4EIAA 4DB3A 4DTUA 4CJ7A 1NK8A 1NMNA 1TYQB 5KTQA 3EE8A 2DPNA 4JKCA 1HNZK 5GAEP 3L8BA 2KZZA 4JD2A 4BRHA 1VSEA 4DU3A 1IKVA 3TAEA 1L5UA 3VGKA 2A3ZA 3KLGA 3SV3A 4DTRA 4ZTFA 4AH9A 3RMCA 3UKUA 4M41A 4FJ5A 3R1XA 4KI4A 2ZF5O 2BANA 3NGIA 1RTJA 4DTOA 1BWFO 4JI2K 3LDSA 3THWA 5EX5A 2KLAA 4PKGA 4CBXA 4B9LA 3SV4A 3IMXA 2UXCK 1WSJA 1IKWA 1NGHA 5EU7A 3CJ1A 3O9QA 1GOAA 2O8FB 3D7EO 1IKYA 2O8BB 2P5GA 4GV9A 4H0OA 3RWUA 5HBMA 1R59O 1VQ8N 1HYZA 1QZ6A 4JI0K 4EZ6A 4BG9A 1VQ5N 3A0IX 2AJQA 3OS1A 5AQSA 3NF6A 1DEJA 4LH5A 3EYZA 1ILYA 1EX4A 3H08A 1T05A 3S41A 3NH1A 4AM6A 3K5OA 1ASUA 1KVCA 1NM1A 2KKZA 2XRIA 4FWNA 4DSLA 4MLEA 3HM8A 3RSEA 3DXMB 1CZAN 1YAGA 3QFUA 4FCYA 1KAYA 4NCBA 3O3GA 1KXPA 5E84A 4BQZA 1T8EA 4LF7K 4I9QA 1XNRK 4C8NA 3VOVA 2KFNA 3VA0A 1CZBA 3S3MA 2BDPA 3AVIA 3CCRN 1KCFA 3VQCA 2GV9A 4CE9A 1UOCA 3U3YA 1J5OA 4IEEA 1VQLN 3KHYA 4OKJA 2UUBK 4NLBA 3L4QA 3LP2A 5F1XA 2E2NA 1LWEA 4CIGA 4YOWA 1GLAG 2KQ2A 2A41A 3A5NC 5AQVA 3VGMA 4J2BA 4DTPA 1ZBFA 1SS6A 3J81O 2P9LA 1CLQA 3CETA 3LL3A 4IZ9A 5DM7L 3V9ZA 4HUEA 2KTQA 2E88A 3IG1A 1Z05A 4H5RA 3ULEB 1J9AA 3AVHA 1RGIA 1RBRA 3JS6A 5AQPA 2QW9A 3C0BA 3MXIA 1RDCA 2O8EB 4LF8K 3VQDA 3HPOA 1U6ZA 4QAGA 5IT9O 5GAGP 4KB1A 4QS9A 2OCEA 5C12A 1HQEA 2F9WA 4IG0A 3FZMA 4IOXA 4CGDA 3T7ZA 5AZJB 1RDBA 3ENOA 4IFEA 1VQMN 4CHOA 5CYQA 3VEXA 1LWFA 3MEDA 5AQRA 1SV5A 1V4SA 4YORA 2P9NB 3QBXA 4LY7A 3ZX3A 4DTNA 3DLBA 2O8CB 1FKPA 1TVRA 1LWCA 4I2QA 4DF4A 4A62A 3SPZA 2VG7A 1FK9A 3J80O 1UAXA 1YXQA 4KHQA 4FJGA 1BISA 3QESA 4Z4GA 3O4QA 4I6MA 3ZSWA 1RBUA 4PHTX 3LDPA 1K8AO 1S1XA 3WNEA 3SNNA 3VQEA 3P38A 2YNGA 3OYLA 1L3UA 3J8AA 3LZIA 2BUPA 1GLFO 2P9IB 1K8KA 4XH1A 3E9LA 4EHTA 5AQIA 3KK2A 3P83D 1ZYQA 4J2AA 2QWLA 3THYB 2CGJA 3CJAA 3CPEA 1RTHA 1C1CA 3UIQA 4A5AA 1OVQA 3WNHA 3OYDA 3NAEA 1M1KO 3EKSA 1UWBA 3RR8A 4DFKA 3CCUN 4CZEA 3T1HK 4JI6K 4Q0BA 3SK3A 5BREA 5EXWA 4CF9A 1ZBIA 3VN5A 1VQON 2RHKA 2XY8A 2QKBA 3OTOK 5SZTA 3V9SA 4W5QA 2E1YA 2FF3B 3L2RA 4JD2B 4LF5K 3KK3A 3DOKA 2G8VA 4FSVA 2D5RA 3CI5A 1WLJA 4CIEA 4BE1A 3QEIA 3DRPA 4DFMA 3O08A 5AQMA 3MDQA 3UKUB 1YT3A 4H5NA 4DUZK 1GLJO 3O6WA 3R3LA 4B3RK 2IVOA 2QWQA 3THWB 4CHPA 4I9LA 4ILHA 3E1YA 1DGKN 5AZIA 2OPSA 1RBSA 3VPZA 3BY5A 4JYAK 3CQ8A 4LF4K 2E1ZA 4CJUA 4AF1A 3NE6A 4KTWA 2E2PA 3HVTA 1NGJA 2GUIA 2NLXA 2BGGA 3NMUA 4DU1A 3T69A 3CQYA 1GLCG 1VRUA 4M3XA 4FLUA 4O0JA 3AVKA 3LAKA 4KH4A 2P9SA 3KKRA 4NLCA 3O3HA 2KFZA 3DJCA 3V4IA 3AVLA 3TU5A 1RDAA 2ZJQL 4FLXA 2HBJA 1HLUA 3AO3A 3HTVA 1WN7A 5KPTA 3HBTA 4OKEA 1T3VA 4C1NI 4A61A 4CJ3A 3RMDA 1QS4A 3OYNA 1NJIO 1TKTA 2NZTA 2PYJA 4FW2A 1S9EA 1ZBSA 1WAFA 4NB4A 5J2QA 2G8HA 3SZ2A 4FK0A 4FVUA 1WSEA 4CEEA 3M8RA 3L3VA 3OYAA 1HPMA 3I8DA 5ELZA 5FPDA 1RT1A 3F5TA 1K73O 1HYVA 3ZX2A 2QK9A 1YTUA 2QWRA 4RW4A 4Z94A 5KGXA 2P9LB 1NGEA 4PUOA 3ITHA 2YJFA 3VENA 3DLKA 3WXLA 1S1TA 4DSKA 3MMVA 4DR2K 2ZWHA 4X65K 5LY3A 1T44A 4BQLA 3TR8A 1NK5A 2WUSA 3PX4A 1S1VA 5FROA 4JHDA 4O5BA 3CFOA 4HUFA 3AO2A 3EE9A 2P51A 1MDUB 1YIJN 1KAXA 2ASOA 1FJGK 2KZMA 5JS1A 2F7TA 3V9XA 2O8BA 3I56N 3C6HA 3PY8A 3H3OB 4MQ3A 1BU6O 3MCAB 2RF2A 3QMLA 4CHQA 4DQSA 5J2NA 3E9PA 4CJWA 2PBDA 4I6MB 1B92A 4LFAK 4FJIA 1IKXA 2OA8A 2FLOA 5AQGA 3VQQA 3QO9A 1JXBA 2HVHA 4BACA 4BC2A 4CHZA 2D1KA 4BRMA 3DMJA 2O8DB 4WFNL 4FJ9A 3R6MA 3WXMB 1KVBA 3SAHA 1VRTA 2FBYA 2R7YA 1NKEA 4F2SA 1QZ5A 4JKHA 3AGRA 3ZSQA 1NGIA 5J1EA 5AQUA 3K57A 1K9MO 3K5NA 4Y0WA 2NRRA 2FC0A 3ZYYX 2W41A 1Q82O 3ZT2A 3OYMA 3AO5A 3SUPA 4DS4A 4B9TA 4YOVA 4O0IA 4CCHA 3L6QA 3ZLJA 4B08A 4YNQA 4CF0A 4IBNA 3PIPL 4JI8K 3H1QA 4CFBA 4XEIA 2OPRA 5JICA 5HOOA 3NDKA 4PY5A 2YKNA 3IDHA 2Q1NA 4BC5A 3NGYA 4Z4IA 4LF6K 3ENHA 4KHYA 1JCFA 2NRTA 3OBWA 1LV5A 2E4LA 3I8BA 1IJJA 4JKEA 1XI1A 4M63C 3TABA 4E1JA 2OPPA 3T1AA 3A5OC 3MX2A 4DV0K 1L3VA 4KTZA 5A2QO 4KPYA 3DM2A 4QCLA 2A5XA 3HPGA 3BF3A 4DSJA 3CCEN 3MCPA 5AZIB 1BCMA 3ZSVA 4KO0A 2FBTA 3SQ1A 2HMIA 1YUWA 3TAGA 4MDAA 3K58A 3OYGA 3O9TA 4M3UA 1Z25A 4ISEA 4E3SA 3DAWA 3LWMA 5FRNA 3OS2A 1UA0A 4FLYA 1U49A 1QQCA 1TUYA 2QTDA 4WQ4A 2P9SB 4HHTA 1MU2A 4CVNE 5HRSA 2D0AA 4CECA 5M1NA 4W5RA 1RILA 3GG4A 3SYZA 5JMVA 5KPZA 5M1KA 3LALA 3ISNC 5TKWA 3CJBA 3VEWA 2HNDA 4C8KA 4E7KA 1BCOA 1BI4A 3NBPA 3V1OA 2Q97A 4YHHK 5KQDA 1TGOA 4DSFA 4B3TK 5I9EB 4BY9C 4DR6K 3ZSZA 2HOEA 2IS3A 2FSJA 3VQBA 2WTUA 2CGLA 4EFHA 4CZJA 3VA3A 1HKGA 4DU4A 3VERA 4JK9A 3GDQA 3MN7A 3LZJA 3AVAA 3LM2A 4RG8A 2UUCK 4BDZA 3CXCM 3K2PA 3AO4A 4CW7B 4DV6K 2EHGA 1EO1A 2ASPA 3O9SA 4B3SK 1P8ZA 4FLWA 1R0AA 4ISFA 2ZM6K 1OH8A 4Z4FA 4BRDA 3SPYA 1J54A 3HJFA 3O5BA 4HUGA 4KI6A 4KTQA 2F9TA 1E4GT 1KD1O 1BL3A 4DR5K 4WFBL 3RRHA 4GVMA 1MA9B 3I0RA 4NXNK 1TAUA 5I3UA 4L3QA 1YVUA 4RW9A 1GOCA 1W7AA 4NCAA 4DLGA 4K25A 3CC4N 1RBTA 1NJZA 2QI2A 4JKGB 3BZKA 3O1BA 1RCHA 3KLHA 1JLEA 4CEAA 4CBUA 2E6LA 3ALYA 4JNEA 3C94A 1OKJA 2XO7A 1NK7A 4JHDB 1QVFM 4JN4A 5KI6A 5SWMA 4O8UA 4HCCA 4O55A 4K8XA 4FWSA 5M1QA 4DKWA 2UUAK 4DUYK 5AJ3K 2VYPA 3A5LC 3OYJA 3DOLA 2YHYA 1QE1A 3EKUA 3CD6N 3IFRA 4H5WA 5GIPA 3PSFA 2UU9K 3V1RA 3FFIA 4EZ9A 2FF6A 4CZKA 2I7PA 2HVIA 3HOTA 4GV3A 4E0DA 2V51B 3ZSYA 5DMRA 2JLEA 4CEQA 4PWDA 3FZFA 3QIPA 3QNNA 2FSKA 5EOYA 3FLCO 4CZMA 4O44A 3F73A 2Q3SA 1WSGA 2RKIA 4CJPA 1ZXOA 1I39A 1NGGA 4DTSA 2HMPA 4CJ5A 2HHVA 1X3MA 3LP3A 2GEMA 4KB0A 4JRQA 4BRFA 3K9KA 2XHBA 3MXJA 3T1YK 3DRRA 1X9SA 1L3SA 3U9DA 4A2AA 5AQFA 3IAYA 4FVMA 1VSDA 3DLEA 4N41A 3EL2A 5GIOA 2IOCA 3GE1A 3OYKA 2YNHA 3CF5L 1Q81O 3PLAA 4Y1DA 4IOAL 4JLHA 4K0KK 4DV4K 4FJMA 4BRLA 4AHUA 4LC9B 3RR7A 3TAPA 4CJLA 2QM1A 1FKOA 4OKKA 1IG8A 2Q0UA 2IGIA 5BR9A 1BOTO 1XMOK 3OYBA 3WNFA 2F96A 4N56A 1Q7YO 4B1WB 3HP6A 3TARA 4KREA 1U45A 2CGKA 1N32K 1HUXA 2ZE2A 5FPNA 4EAHD 3ZT1A 4MO4A 4Q5VA 3HZ6A 3MXMA 1NK4A 4CBWA 3DLHA 2G8IA 2HHQA 3SQ0A 4HTUA 2FBVA 4AQYK 3V1QA 5LJVA 2VG5A 3HRGA 4B8AB 1HKBA 4ICLA 3VQ9A 4JAXA 4CFCA 3TI0A 1YHQN 1VQ4N 3SUOA 2OTJN 1SL1A 3HI0A 5GINA 2O4IA 1IBLK 4LFCK 3KD1E 3L4IA 2UYTA 4OPJA 1JLCA 1VSHA 3S9HA 3V6DA 3A2FA 2BE2A 3P5JA 3NCIA 4MLHA 2YV0X 3VESA 3FZKA 4BRAA 2G8WA 4N76A 1HKCA 1VSIA 4LFBK 3PX0A 1NG9A 4DV1K 1NKBA 3FFKB 5EY4A 1EXQA 2OZSA 3BP8A 3LDLA 1W97L 1O1WA 5K14A 3CCVN 2HNYA 3AA2A 2O8DA 2QXFA 4B1YB 4BVPA 5GADP 1BI4B 4CEOA 2VGMA 4DMNA 3WEEA 4JS5A 2YNFA 4CGJA 4CEZA 2D4WA 4MDBA 1TK8A 4A2BA 4ELTA 5BN9A 1CZ9A 2GBZA 4WFAL 1DT9A 3N4PA 4DTMA 3C6AA 3MN5A 4BRIA 4CZHA 4DS5A 3OVNA 5C24A 4Y1CA 3BEXA 2B6AA 1OH5A 5LJWA 4DWIA 2Q0RA 2FXUA 3MECA 1BUPA 1HJOA 5C2DA 1C0MA 3C7NA 4F2RA 1N6QA 4CESA 1VSMA 4CZLA 4Z4EA 4CZGA 3TWHA 2XY6A 1QSYA 4GY2B 4CHYA 1BQMA 4CGFA 4H0TB 3QEWA 4Z0UA 5AQZA 4DCHA 3I55N 5KGWA 1TV6A 4KFBA 4W5OA 4FJNA 3RVCA 4BR2A 3CQXA 4ILGB 3QNOA 4QOZB 5JVHL 2AP1A 4DTXA 1IBMK 1E3MA 5H1SQ 4DLEA 3KLIA 5GAHP 5F2RA 1JLFA 3F9MA 4FJKA 3THXA 1LW0A 3VEZA 1EP4A 1S5JA 3CCSN 5AQTA 2E8AA 2Q2RA 1KFSA 3ZEUA 3M5RA 1BA1A 1VAZA 3UKRA 2P9PA 1A5VA 4O5FA 4OLBA 3NH0A 3CIPA 4H5VA 3QETA 3O80A 2BTFA 5BPLA 1SAZA 3G4SN 1VSFA 1RDUA 1BG3A 1T6DA 4JRPA 1MWKA 4M45A 4DSIA 1NLVA 2LSNA 3K59A 4CERA 1TK5A 3TPQA 3IKMA 1RDWX 3DYAA 4WCEL 5AQNA 3NF9A 3MEEA 5AQHA 3VF2A 4B1ZA 5CZ2A 1ATNA 1SQKA 4FWPA 3HXMA 4FJXA 4BR4A 3LDOA 2E20A 4QS8A 3D2EA 3THVA 3CJCA 3P39A 1ASWA 4FXDA 3CJ7A 3TSUA 2D0BA 2WBNA 2FBXA 4OPHA 4E7LA 1DKGD 3CC2N 3TTDA 4CIFA 2JWLA 1BDGA 4BR5A 3FZLA 4CEBA 4YDUA 4DQRA 4ISGA 3LM9A 3N4QA 2J4RA 4M7XA 4K8ZA 4JKBA 1NK9A 4B9NA 3PIOL 4K41A 3PUFA 2OTLN 1HMVA 1XHZA 3AARA 4FJJA 3SLCA 1JL2A 4K42A 2FSNA 3TSQA 4IEIA 4C8MA 4DHYA 1D8YA 4F9OA 1JCEA 1OH7A 2HF4A 1DLOA 3CERA 4B3MK 4DFPA 1X3NA 4JKGA 1KQSM 4DV5K 2D0OA 4M3WA 1Q9YA 4CD1A 4B1UB 3HK2A 5C15A 3HL8A 2EX3A 4OJRA 3EN9A 3D0PA 3HP9A 3CPWM 5AR0A 3CYMA 3ZCMA 2ETJA 2ZGYA 4RCHA 4NXMK 2H3GX 4BRNA 4E7HA 4AHTA 3O3FA 1M90O 5HL7L 1NU0A 5E41A 4LSLA 1U48A 3OYHA 1QTMA 1TKZA 1C0TA 1XMQK 4RTFD 3RMBA 2G8UA 4FWOA 1ITGA 3HT3A 4WQ5C 4DQPA 4ID5A 1KVAA 2D0CA 2GWKA 3BDPA 4KBOA 5AQXA 4BR7A 3WEEB 4J2DA 2IVPA 3O8MA 3E9OA 1KSPA 1VQPN 4CF8A 3MN9A 4HTLA 3KZBA 3OY9A 3P1GA 4I2PA 1JLQA 3SI6A 1HQUA 4HVJA 1XUPO 2JGUA 2EWSA 3R9PA 2VWJA 4WE1A 5FDLA 3ZSXA 1NGCA 4OPAA 2NRXA 3WXKA 2VG6A 4BRQA 3O9RA 3U6FA 4BC4A 1A5WA 3QEXA 3AVCA 2V7ZA 4IKFA 3KK1A 4DQIA 4N47A 5BRDA 3KIOA 2O4GA 3C7NB 4JI4K 4EP4A 2IDOA 3CHWA 4IJAA 4JI3K 3CCMN 4JS4A 2P9UA 4Z4HA 1DTTA 1QHTA 1S6QA 4LSNA 3MWTA 1ESVA 4UY8O 4FL9A 2ZGZA 2YHAA 3ZT3A 4FWKA 3DI6A 3CM6A 1B9DA 2PZSA 5MLCQ 1BO5O 1OVYA 1YI2N 4UQGA 1DTQA 1QQNA 1YTAA 3A8YA 5BR8K 3G10A 3TAQA 1N33K 4AHVA 4B9SA 4GMJB 4G9ZA 4ZHRA 2A40A 2A42A 4NO7A 2ZD1A 3U3GA 4FPAA 3BGRA 3F2KA 3VQ4A 2Q31A 2KHOA 1V4TA 3THXB 4DR7K 3WT0A 4FZYA 1LCUA 1X9WA 4B9VA 4KHWA 1XC9A 2ZQBA 2Z1IA 3RRGA 3OA9A 1NJWA 3ZEUB 3UKRB 2VWBA 5M1FA 3CMEN 4DTJA 2P9PB 3DXKA 1RT7A 1ZBUA 4JV5K 3K5MA 2CH5A 3SMPA 1HX1A 4Z4CA 4DSEA 4J2EA 3CG7A 3LP1A 1BQNA 5EVZA 5BPMA 3S3OA 3P4IA 1IBKK 4IO9L 1EWRA 3I0SA 3TAFA 4CJQA 3CJ9A 3QEVA 4PA1A 1NMDA 1SUQA 1TAQA 2ITGA 4CFDA 5FLXO 2NRZA 1HNVA 3SBGA 2F8TA 4OGEA 4BROA 3VQAA 1B9FA 2Z1GA 1E4FT 3D2EB 3M8PA 1NKCA 3UE5A 1LOTB 5E26A 3CCJN 3HPHA 2HHXA 1YVNA 1S72N 4FK2A 3HSTB 3HOSA 3B6OA 3ENBA 1BIZA 3UB5A 4R79A 1QQMA 5BPNA 3Q7BA 4BE0A 3V9UA 1Q86O 1Q9XA 1IV0A 4JI5K 3QBWA 2YI1A 2E6MA 1EETA 2QWPA 4RWTA 4J8FA 3H1VX 4EHUA 3ATUA 4X66K 1IO2A 5FPMA 4M3YA 2GELA 2VCPA 3D45A 2HHHK 4KKOA 3JSMA 1WSIA 1ASVA 2P1JA 1TK0A 4CJKA 2ASMA 3W0LA 3QIOA 4IDHA 3AY9A 4IJNA 1JCGA 4FM1A 4GKKK 4FZXC 3KLEA 2HHSA 1ZBHA 3LPUA 1P90A 4N5SA 1NBWA 4H4OA 3WQTA 4CGGA 1VK0A 1WB9A 2HNZA 1N5YA 3L2WA 2VQEK 1C1AA
chains in the Genus database with same CATH topology
4CJVA 3KD1E 4OPJA 3V4IA 1WSHA 1JLCA 1VSHA 3AVLA 1XHXA 3KLFA 1RDAA 3DLRA 3S9HA 1U47A 4FLXA 2DY4A 3V6DA 4CK1A 3A2FA 4RW8A 1KRPA 5HRPA 4H8KA 2BE2A 4IG3A 3P5JA 3AO3A 3NCIA 3RTVA 4I7FA 1JLAA 1WN7A 2YV0X 1SKWA 5JS2A 3AA3A 4OKEA 3CM5A 1I3AA 4F4KA 2PYLA 2G8WA 4CJ3A 3RMDA 3OYFA 4N76A 3VQPA 3OYIA 1JKHA 1VSIA 3NFAA 4H4MA 3PX0A 1QS4A 5HRRA 3OYNA 4FLVA 3HYFA 1TKTA 3QINA 1NKBA 1LAWA 1NK0A 1HYSA 1EXQA 3AV9A 2PYJA 2OZSA 4FW2A 3LWLA 1A5XA 1O1WA 5K14A 5I42A 2HNYA 4KAZA 1S9EA 1WAFA 5J2QA 1IG9A 2IC3A 2X78A 4F8RA 3AA2A 2G8HA 2QXFA 3SZ2A 4FK0A 1BI4B 5HROA 1WSEA 4CEOA 1HRHA 2IAJA 4CEEA 2YNIA 4DMNA 3L3VA 3OYAA 3M8RA 3I8DA 4JS5A 2YNFA 5D3GA 1RNHA 1W0HA 4CGJA 4CEZA 1RT1A 4W5NA 1C0UA 1KLMA 4B3OA 3SUQA 1HYVA 1TK8A 2QK9A 4RW7A 1X9MA 1YTUA 2WONA 3OJUA 1RTDA 1F21A 3QEPA 4ELTA 4RW4A 4KRFA 1CZ9A 5HP1A 2GBZA 1SL0A 4OPKA 5KGXA 4DTMA 2RPIA 3O4NA 1VSLA 4PUOA 5C25A 4BE2A 3ITHA 4F3TA 3AO1A 4DS5A 3TAMA 1C6VA 3DLKA 3OVNA 5C24A 1S1TA 4Y1CA 5T7BA 2I5JA 1SL2A 3KKSA 4FLZA 2WOMA 2B6AA 4CJTA 3HVRA 2OZMA 4ELVA 4FM2A 4DSKA 4DWIA 3MECA 3AA4A 3NF7A 1CXQA 3AVFA 1RT5A 4CK3A 3KTQA 1C0MA 3LANA 4LH4A 3ZT0A 3JYTA 1WSFA 3T3FA 4IFYA 3KD5E 2OYQA 4F2RA 2B4JA 2YKMA 3TR8A 1N6QA 4B9MA 1NK5A 2G8FA 4CESA 2F8SA 2HHUA 3PX4A 1VSMA 1S1VA 5FROA 3L2QA 4BDPA 1U04A 4O5BA 1BIUA 4Z4EA 1EKEA 2DFHA 3AO2A 3CFOA 4HUFA 3SQ2A 3TWHA 2P51A 4DF4A 4KHSA 4CFAA 3OYCA 1JLGA 3PO5A 3NF8A 3HM9A 2XY6A 3ZSRA 1QSYA 4CHNA 1X1PA 4CHYA 1BQMA 4CGFA 1TKDA 2KZMA 3AVMA 2XO7A 3DLGA 5JS1A 3QEWA 4Z0UA 3V9XA 2HB5A 4CJEA 3PY8A 4CGIA 5KGWA 3C6UA 1NK6A 4KV8A 4M3TA 1TV6A 4MQ3A 4FJHA 4KFBA 4W5OA 4FJNA 3V9WA 2RF2A 3NH2A 4B8CA 4CHQA 3K5LA 3QNOA 2NUBA 4QOZB 3ULDA 4DQSA 5J2NA 3AVBA 4DTXA 4CJWA 4DLEA 3ZT4A 3KLIA 1Z26A 1B92A 4FLTA 4FJIA 1BHLA 1IKXA 2OA8A 1NJYA 1JLFA 4BWJA 4OLAA 4FJKA 4C8LA 3VQQA 1LW0A 3QO9A 3T19A 1UA1A 3AVJA 1EP4A 1JXBA 1S5JA 4B9UA 2HVHA 4BACA 3ASMA 1KLNA 1RT2A 4CHZA 1KFSA 1W9HA 4AHRA 3DMJA 1A5VA 4OLBA 4FJ9A 3NH0A 3KJVA 1KVBA 3G0ZA 1VRTA 2FBYA 2HW3A 2VWKA 4NCGA 3AA5X 4CEFA 4CJFA 4EP5A 2R7YA 3QETA 1NKEA 4F2SA 4OGCA 1VSFA 4JRPA 2RN2A 3ZSQA 1NOYA 3F9KA 3AVGA 4M45A 3OJSA 1QSLA 5J1EA 4DSIA 4FJ8A 2Y1JA 2LSNA 4PQUA 4O4GA 4CERA 3K57A 3K59A 1TK5A 1FXXA 1LW2A 3LAMA 4M42A 1CXUA 3K5NA 3DYAA 3M8SA 1KFDA 4MFBA 4CF1A 4W5TA 4DTUA 1ZBLA 2FC0A 3NF9A 1NK8A 3MEEA 3LPTA 5CZ2A 3WNGA 5KTQA 2KTQA 3ZT2A 5KRSA 3IS9A 3OYMA 3AO5A 3HXMA 4FJXA 3SUPA 1RDDA 3L8BA 4DS4A 4IFVA 4B9TA 4O0IA 4CCHA 4C8OA 2KZZA 5CY4A 4L8RB 4B08A 5J2MA 1VSEA 4YNQA 1IKVA 4DU3A 4CGHA 3TAEA 4CF0A 3PV8A 3THVA 4IBNA 1L5UA 1T7PA 1ASWA 3SV3A 3KLGA 4FXDA 4DTRA 4NYFA 2D0BA 4ZTFA 2FBXA 4AH9A 4CFBA 3RMCA 1JLBA 4M41A 4E7LA 4FJ5A 4KI4A 2OPRA 5HRNA 3NDKA 3HO1A 4CIFA 2BANA 4PY5A 3NGIA 1RTJA 2YKNA 4DTOA 3LDSA 3NGYA 4B9LA 4Z4IA 4CEBA 2HHTA 4DQRA 1RBVA 3SV4A 4KHYA 1WSJA 1IKWA 5EU7A 3EZ5A 4IDKA 4K8ZA 1NK9A 1LV5A 2E4LA 4B9NA 1GOAA 4M3ZA 1IH7A 1XI1A 1IKYA 3TABA 3PUFA 2P5GA 4FZZA 1HMVA 1XHZA 2OPPA 3T1AA 4FJJA 4FW1A 1L3VA 4KTZA 1JL2A 3RWUA 4KPYA 3DM2A 4QCLA 5HBMA 3HPGA 1HYZA 2Z1HA 4M3RA 4ELUA 4DSJA 4C8MA 1BCMA 1D8YA 4EZ6A 3ZSVA 4KO0A 2FBTA 3SQ1A 2HMIA 1S1UA 3V81A 3TAGA 3B6PA 2AJQA 3K58A 4E19A 3OS1A 3OYGA 4M3UA 3NF6A 1DLOA 3VQ6A 4E89A 1S1WA 1Z25A 4LH5A 3EYZA 4E3SA 1G15A 4DFPA 3TANA 5HLFA 1EX4A 3LWMA 3H08A 1T05A 5FRNA 4M3WA 3OS2A 3NH1A 4FLYA 1UA0A 1Q9YA 3HK2A 4AHSA 1U49A 3K5OA 3HL8A 1QQCA 1ASUA 1KVCA 2EX3A 4OJRA 2XRIA 4DSLA 2YHBA 2Z1JA 4HHTA 1GOBA 1MU2A 5HRSA 2D0AA 4YFUA 3D0PA 4CECA 4W5RA 3HP9A 4FCYA 1RILA 3CYMA 4NCBA 3O3GA 3ZCMA 1T8EA 2ETJA 4I9QA 3SYZA 4C8NA 3LALA 3ISNC 2KFNA 3VA0A 1CZBA 4E7HA 4ZTJA 3S3MA 2BDPA 3AVIA 4E1NA 2P5OA 2DTUA 1KCFA 1LAVA 4AHTA 4E7IA 3O3FA 2HNDA 4FJLA 3VQCA 2GV9A 4CE9A 4C8KA 1RT3A 4E7KA 1UOCA 1BCOA 1BI4A 3NBPA 5E41A 3V1OA 3U3YA 4LSLA 4OKJA 3SJJA 1U48A 1J5OA 1TGOA 3LP2A 4DSFA 1LWEA 4BDYA 3ZSZA 2IS3A 4CIGA 4LD0A 3VQBA 3OYHA 1QTMA 1TKZA 1J53A 1C0TA 3VA3A 4CK2A 4DU4A 2KQ2A 1VSJA 3RMBA 2G8UA 4J2BA 1ITGA 4DTPA 3HT3A 2X74A 1ZBFA 4DQPA 1Y97A 1RT4A 4DFJA 4ID5A 3LZJA 1KVAA 1CLQA 3AVAA 2D0CA 4RG8A 4AILC 5C42A 4BDZA 3V9ZA 3K2PA 4HUEA 3BDPA 4FM0A 3IG1A 3SUNA 3C6TA 3AO4A 3SCXA 4J2DA 1BGXT 3S3NA 1J9AA 2EHGA 3AVHA 4R5PA 1KSPA 1RBRA 4CF8A 4AHCA 3NHGA 3MXIA 3RMAA 1RDCA 3CFRA 4FLWA 1R0AA 3VQDA 3HPOA 3OY9A 1RT6A 1KTQA 3P1GA 1JLQA 4I2PA 5DK5A 3SI6A 1HQUA 3L3UA 4HVJA 4QAGA 2W42A 4Z4FA 5J2PA 4KB1A 2JGUA 1HQEA 3QLHA 4IG0A 3SPYA 1HNIA 2G8KA 2VWJA 1J54A 1VSKA 1S6PA 1WNSA 4WE1A 5FDLA 4CGDA 3ZSXA 4HUGA 1K6YA 4KTQA 1RDBA 4KI6A 3HJFA 2VG6A 4FYDA 1BL3A 4CHOA 5CZ1A 1D5AA 3RRHA 4GVMA 3U6FA 2KW4A 3I0RA 2A1SA 1A5WA 3QEXA 5I3UA 1TAUA 5CYQA 2Y1IA 4NYNA 1LWFA 3AVCA 1YVUA 4RW9A 1GOCA 4IKFA 3KK1A 3MEDA 4N47A 1SV5A 4DLGA 3KIOA 4DQIA 1HPZA 2O4GA 4LY7A 2PY5A 4EP4A 1RBTA 2IDOA 1NJZA 4DTNA 4XIUA 3DLBA 1FKPA 4JS4A 1RCHA 1TVRA 1JLEA 1LWCA 4Z4HA 4CEAA 3KLHA 4I2QA 2E6LA 1DTTA 3ALYA 1QHTA 1S6QA 2VG7A 3C94A 4LSNA 4CJSA 4OVLA 1FK9A 3VQ7A 3SPZA 1UAXA 4KHQA 4G1QA 1RTIA 4FJGA 2YHAA 1BISA 1XWLA 3QESA 5KI6A 4GW6A 3ZT3A 3AVNA 5SWMA 1NK7A 2OPQA 3CM6A 3DI6A 4Z4GA 4FJ7A 1B9DA 4O55A 3O4QA 2PZSA 4HCCA 4K8XA 2ATQA 3ZSWA 2HHWA 1RBUA 3OYJA 1SKSA 3DOLA 4UQGA 1DTQA 1QE1A 1S9GA 1YTAA 1S1XA 3WNEA 2XY7A 2A1RA 4RW6A 3V1RA 3G10A 5KRTA 3SNNA 3FFIA 3TAQA 3VQEA 4EZ9A 2YNGA 4AHVA 3OYLA 1L3UA 2HVIA 4B9SA 4E0DA 4GMJB 4DF8A 3LZIA 4ZHRA 3ZSYA 2ZD1A 3U3GA 3PX6A 3BGRA 5DMRA 4CJRA 2JLEA 4CF2A 3VQ4A 4CEQA 4PWDA 1JXEA 4HCBA 3QIPA 3QNNA 3KK2A 4KHUA 4FZYA 3P83D 1ZYQA 1X9WA 4J2AA 1D9FA 4B9VA 1JL1A 4KHWA 1XC9A 2ZQBA 1RTHA 2Z1IA 3RRGA 1NJWA 1C1CA 3UIQA 4O44A 3F73A 2DFEA 2Q3SA 4DTJA 3WNHA 3OYDA 1RT7A 1WSGA 2RKIA 3DRSA 1ZBUA 4CJPA 5CYMA 3K5MA 3NAEA 3OYEA 1I39A 1QSSA 4DTSA 1Q8IA 1UWBA 3L2VA 1T03A 4F3OA 1C1BA 3LP0A 4CJ5A 2B5JA 2HHVA 3LP3A 4KB0A 4Z4CA 4DSEA 4JRQA 4J2EA 3RR8A 3CG7A 3MEGA 4DFKA 1TL3A 3LP1A 3ZSOA 4Q0BA 3VQ5A 2XHBA 1BQNA 3MXJA 3M8QA 4CF9A 3S3OA 1ZBIA 3DRRA 1L3TA 2DFFA 1X9SA 1L3SA 3VN5A 4FK4A 3I0SA 3TAFA 3NGZA 1REVA 2XY8A 3IAYA 4CJQA 4FVMA 3QEVA 5SZTA 4PA1A 2QKBA 4BWMA 1SUQA 1TAQA 1VSDA 2ITGA 4CFDA 4W5QA 3V9SA 4KHNA 1HNVA 3DLEA 2F8TA 3EY1A 3L2RA 4N41A 4OGEA 3VQAA 1B9FA 4E1MA 4ID1A 3KK3A 5FRMA 2Z1GA 3DOKA 2IOCA 3OYKA 2YNHA 3M8PA 2G8VA 4Y1DA 4JLHA 1TKXA 1NKCA 4FJMA 2D5RA 3IRXA 4AHUA 3HPHA 3RR7A 1WLJA 4CIEA 3TAPA 4CJLA 4BE1A 1U4BA 3QEIA 2HHXA 3DRPA 3OS0A 4DFMA 4FK2A 3HSTB 1NJXA 1FKOA 3VQ8A 3B6OA 4OKKA 4CEDA 1BIZA 1YT3A 2IGIA 4DG1A 1NOZA 3OYBA 3WNFA 4BE0A 3V9UA 1WAJA 2XY5A 1SKRA 1Q9XA 1D9DA 2QKKA 4CHPA 4I9LA 2E6MA 1EETA 2F96A 3L2UA 3CFPA 4N56A 2OPSA 3HP6A 1IO2A 1RBSA 3TARA 4KREA 4TSXA 4M3YA 3CQ8A 4E7JA 1U45A 4CJUA 3D45A 3E01A 4KKOA 3NE6A 3JSMA 4DQQA 3SQ4A 1WSIA 1ASVA 2ZE2A 4KTWA 3ZT1A 4Q5VA 1NK4A 3MXMA 3MAQA 2P1JA 3DLHA 2G8IA 3HVTA 2HHQA 2GUIA 3SQ0A 4HTUA 2BGGA 1TK0A 2FBVA 4CJKA 4DU1A 3QIOA 3V1QA 2VG5A 2X6NA 1VRUA 4FM1A 1HJRA 4M3XA 4FZXC 3KLEA 4B8AB 2HHSA 4FLUA 1ZBHA 3LPUA 4O0JA 3AVKA 3LAKA 4N5SA 4ICLA 3VQ9A 4H4OA 4CFCA 4CGGA 1VK0A 3TI0A 4NCAA 3KKRA 2X6SA 3O3HA 3QERA 1TL1A 3SUOA 4CJ4A 1SL1A 2HNZA 3PO4A 2O4IA 2KFZA 1N5YA 3L2WA 3C95A 1C1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJV A;  3KD1 E;  4OPJ A;  3V4I A;  1WSH A;  1JLC A;  1VSH A;  3AVL A;  1XHX A;  3KLF A;  1RDA A;  3DLR A;  3S9H A;  1U47 A;  4FLX A;  2DY4 A;  3V6D A;  4CK1 A;  3A2F A;  4RW8 A;  1KRP A;  5HRP A;  4H8K A;  2BE2 A;  4IG3 A;  3P5J A;  3AO3 A;  3NCI A;  3RTV A;  4I7F A;  1JLA A;  1WN7 A;  2YV0 X;  1SKW A;  5JS2 A;  3AA3 A;  4OKE A;  3CM5 A;  1I3A A;  4F4K A;  2PYL A;  2G8W A;  4CJ3 A;  3RMD A;  3OYF A;  4N76 A;  3VQP A;  3OYI A;  1JKH A;  1VSI A;  3NFA A;  4H4M A;  3PX0 A;  1QS4 A;  5HRR A;  3OYN A;  4FLV A;  3HYF A;  1TKT A;  3QIN A;  1NKB A;  1LAW A;  1NK0 A;  1HYS A;  1EXQ A;  3AV9 A;  2PYJ A;  2OZS A;  4FW2 A;  3LWL A;  1A5X A;  1O1W A;  5K14 A;  5I42 A;  2HNY A;  4KAZ A;  1S9E A;  1WAF A;  5J2Q A;  1IG9 A;  2IC3 A;  2X78 A;  4F8R A;  3AA2 A;  2G8H A;  2QXF A;  3SZ2 A;  4FK0 A;  1BI4 B;  5HRO A;  1WSE A;  4CEO A;  1HRH A;  2IAJ A;  4CEE A;  2YNI A;  4DMN A;  3L3V A;  3OYA A;  3M8R A;  3I8D A;  4JS5 A;  2YNF A;  5D3G A;  1RNH A;  1W0H A;  4CGJ A;  4CEZ A;  1RT1 A;  4W5N A;  1C0U A;  1KLM A;  4B3O A;  3SUQ A;  1HYV A;  1TK8 A;  2QK9 A;  4RW7 A;  1X9M A;  1YTU A;  2WON A;  3OJU A;  1RTD A;  1F21 A;  3QEP A;  4ELT A;  4RW4 A;  4KRF A;  1CZ9 A;  5HP1 A;  2GBZ A;  1SL0 A;  4OPK A;  5KGX A;  4DTM A;  2RPI A;  3O4N A;  1VSL A;  4PUO A;  5C25 A;  4BE2 A;  3ITH A;  4F3T A;  3AO1 A;  4DS5 A;  3TAM A;  1C6V A;  3DLK A;  3OVN A;  5C24 A;  1S1T A;  4Y1C A;  5T7B A;  2I5J A;  1SL2 A;  3KKS A;  4FLZ A;  2WOM A;  2B6A A;  4CJT A;  3HVR A;  2OZM A;  4ELV A;  4FM2 A;  4DSK A;  4DWI A;  3MEC A;  3AA4 A;  3NF7 A;  1CXQ A;  3AVF A;  1RT5 A;  4CK3 A;  3KTQ A;  1C0M A;  3LAN A;  4LH4 A;  3ZT0 A;  3JYT A;  1WSF A;  3T3F A;  4IFY A;  3KD5 E;  2OYQ A;  4F2R A;  2B4J A;  2YKM A;  3TR8 A;  1N6Q A;  4B9M A;  1NK5 A;  2G8F A;  4CES A;  2F8S A;  2HHU A;  3PX4 A;  1VSM A;  1S1V A;  5FRO A;  3L2Q A;  4BDP A;  1U04 A;  4O5B A;  1BIU A;  4Z4E A;  1EKE A;  2DFH A;  3AO2 A;  3CFO A;  4HUF A;  3SQ2 A;  3TWH A;  2P51 A;  4DF4 A;  4KHS A;  4CFA A;  3OYC A;  1JLG A;  3PO5 A;  3NF8 A;  3HM9 A;  2XY6 A;  3ZSR A;  1QSY A;  4CHN A;  1X1P A;  4CHY A;  1BQM A;  4CGF A;  1TKD A;  2KZM A;  3AVM A;  2XO7 A;  3DLG A;  5JS1 A;  3QEW A;  4Z0U A;  3V9X A;  2HB5 A;  4CJE A;  3PY8 A;  4CGI A;  5KGW A;  3C6U A;  1NK6 A;  4KV8 A;  4M3T A;  1TV6 A;  4MQ3 A;  4FJH A;  4KFB A;  4W5O A;  4FJN A;  3V9W A;  2RF2 A;  3NH2 A;  4B8C A;  4CHQ A;  3K5L A;  3QNO A;  2NUB A;  4QOZ B;  3ULD A;  4DQS A;  5J2N A;  3AVB A;  4DTX A;  4CJW A;  4DLE A;  3ZT4 A;  3KLI A;  1Z26 A;  1B92 A;  4FLT A;  4FJI A;  1BHL A;  1IKX A;  2OA8 A;  1NJY A;  1JLF A;  4BWJ A;  4OLA A;  4FJK A;  4C8L A;  3VQQ A;  1LW0 A;  3QO9 A;  3T19 A;  1UA1 A;  3AVJ A;  1EP4 A;  1JXB A;  1S5J A;  4B9U A;  2HVH A;  4BAC A;  3ASM A;  1KLN A;  1RT2 A;  4CHZ A;  1KFS A;  1W9H A;  4AHR A;  3DMJ A;  1A5V A;  4OLB A;  4FJ9 A;  3NH0 A;  3KJV A;  1KVB A;  3G0Z A;  1VRT A;  2FBY A;  2HW3 A;  2VWK A;  4NCG A;  3AA5 X;  4CEF A;  4CJF A;  4EP5 A;  2R7Y A;  3QET A;  1NKE A;  4F2S A;  4OGC A;  1VSF A;  4JRP A;  2RN2 A;  3ZSQ A;  1NOY A;  3F9K A;  3AVG A;  4M45 A;  3OJS A;  1QSL A;  5J1E A;  4DSI A;  4FJ8 A;  2Y1J A;  2LSN A;  4PQU A;  4O4G A;  4CER A;  3K57 A;  3K59 A;  1TK5 A;  1FXX A;  1LW2 A;  3LAM A;  4M42 A;  1CXU A;  3K5N A;  3DYA A;  3M8S A;  1KFD A;  4MFB A;  4CF1 A;  4W5T A;  4DTU A;  1ZBL A;  2FC0 A;  3NF9 A;  1NK8 A;  3MEE A;  3LPT A;  5CZ2 A;  3WNG A;  5KTQ A;  2KTQ A;  3ZT2 A;  5KRS A;  3IS9 A;  3OYM A;  3AO5 A;  3HXM A;  4FJX A;  3SUP A;  1RDD A;  3L8B A;  4DS4 A;  4IFV A;  4B9T A;  4O0I A;  4CCH A;  4C8O A;  2KZZ A;  5CY4 A;  4L8R B;  4B08 A;  5J2M A;  1VSE A;  4YNQ A;  1IKV A;  4DU3 A;  4CGH A;  3TAE A;  4CF0 A;  3PV8 A;  3THV A;  4IBN A;  1L5U A;  1T7P A;  1ASW A;  3SV3 A;  3KLG A;  4FXD A;  4DTR A;  4NYF A;  2D0B A;  4ZTF A;  2FBX A;  4AH9 A;  4CFB A;  3RMC A;  1JLB A;  4M41 A;  4E7L A;  4FJ5 A;  4KI4 A;  2OPR A;  5HRN A;  3NDK A;  3HO1 A;  4CIF A;  2BAN A;  4PY5 A;  3NGI A;  1RTJ A;  2YKN A;  4DTO A;  3LDS A;  3NGY A;  4B9L A;  4Z4I A;  4CEB A;  2HHT A;  4DQR A;  1RBV A;  3SV4 A;  4KHY A;  1WSJ A;  1IKW A;  5EU7 A;  3EZ5 A;  4IDK A;  4K8Z A;  1NK9 A;  1LV5 A;  2E4L A;  4B9N A;  1GOA A;  4M3Z A;  1IH7 A;  1XI1 A;  1IKY A;  3TAB A;  3PUF A;  2P5G A;  4FZZ A;  1HMV A;  1XHZ A;  2OPP A;  3T1A A;  4FJJ A;  4FW1 A;  1L3V A;  4KTZ A;  1JL2 A;  3RWU A;  4KPY A;  3DM2 A;  4QCL A;  5HBM A;  3HPG A;  1HYZ A;  2Z1H A;  4M3R A;  4ELU A;  4DSJ A;  4C8M A;  1BCM A;  1D8Y A;  4EZ6 A;  3ZSV A;  4KO0 A;  2FBT A;  3SQ1 A;  2HMI A;  1S1U A;  3V81 A;  3TAG A;  3B6P A;  2AJQ A;  3K58 A;  4E19 A;  3OS1 A;  3OYG A;  4M3U A;  3NF6 A;  1DLO A;  3VQ6 A;  4E89 A;  1S1W A;  1Z25 A;  4LH5 A;  3EYZ A;  4E3S A;  1G15 A;  4DFP A;  3TAN A;  5HLF A;  1EX4 A;  3LWM A;  3H08 A;  1T05 A;  5FRN A;  4M3W A;  3OS2 A;  3NH1 A;  4FLY A;  1UA0 A;  1Q9Y A;  3HK2 A;  4AHS A;  1U49 A;  3K5O A;  3HL8 A;  1QQC A;  1ASU A;  1KVC A;  2EX3 A;  4OJR A;  2XRI A;  4DSL A;  2YHB A;  2Z1J A;  4HHT A;  1GOB A;  1MU2 A;  5HRS A;  2D0A A;  4YFU A;  3D0P A;  4CEC A;  4W5R A;  3HP9 A;  4FCY A;  1RIL A;  3CYM A;  4NCB A;  3O3G A;  3ZCM A;  1T8E A;  2ETJ A;  4I9Q A;  3SYZ A;  4C8N A;  3LAL A;  3ISN C;  2KFN A;  3VA0 A;  1CZB A;  4E7H A;  4ZTJ A;  3S3M A;  2BDP A;  3AVI A;  4E1N A;  2P5O A;  2DTU A;  1KCF A;  1LAV A;  4AHT A;  4E7I A;  3O3F A;  2HND A;  4FJL A;  3VQC A;  2GV9 A;  4CE9 A;  4C8K A;  1RT3 A;  4E7K A;  1UOC A;  1BCO A;  1BI4 A;  3NBP A;  5E41 A;  3V1O A;  3U3Y A;  4LSL A;  4OKJ A;  3SJJ A;  1U48 A;  1J5O A;  1TGO A;  3LP2 A;  4DSF A;  1LWE A;  4BDY A;  3ZSZ A;  2IS3 A;  4CIG A;  4LD0 A;  3VQB A;  3OYH A;  1QTM A;  1TKZ A;  1J53 A;  1C0T A;  3VA3 A;  4CK2 A;  4DU4 A;  2KQ2 A;  1VSJ A;  3RMB A;  2G8U A;  4J2B A;  1ITG A;  4DTP A;  3HT3 A;  2X74 A;  1ZBF A;  4DQP A;  1Y97 A;  1RT4 A;  4DFJ A;  4ID5 A;  3LZJ A;  1KVA A;  1CLQ A;  3AVA A;  2D0C A;  4RG8 A;  4AIL C;  5C42 A;  4BDZ A;  3V9Z A;  3K2P A;  4HUE A;  3BDP A;  4FM0 A;  3IG1 A;  3SUN A;  3C6T A;  3AO4 A;  3SCX A;  4J2D A;  1BGX T;  3S3N A;  1J9A A;  2EHG A;  3AVH A;  4R5P A;  1KSP A;  1RBR A;  4CF8 A;  4AHC A;  3NHG A;  3MXI A;  3RMA A;  1RDC A;  3CFR A;  4FLW A;  1R0A A;  3VQD A;  3HPO A;  3OY9 A;  1RT6 A;  1KTQ A;  3P1G A;  1JLQ A;  4I2P A;  5DK5 A;  3SI6 A;  1HQU A;  3L3U A;  4HVJ A;  4QAG A;  2W42 A;  4Z4F A;  5J2P A;  4KB1 A;  2JGU A;  1HQE A;  3QLH A;  4IG0 A;  3SPY A;  1HNI A;  2G8K A;  2VWJ A;  1J54 A;  1VSK A;  1S6P A;  1WNS A;  4WE1 A;  5FDL A;  4CGD A;  3ZSX A;  4HUG A;  1K6Y A;  4KTQ A;  1RDB A;  4KI6 A;  3HJF A;  2VG6 A;  4FYD A;  1BL3 A;  4CHO A;  5CZ1 A;  1D5A A;  3RRH A;  4GVM A;  3U6F A;  2KW4 A;  3I0R A;  2A1S A;  1A5W A;  3QEX A;  5I3U A;  1TAU A;  5CYQ A;  2Y1I A;  4NYN A;  1LWF A;  3AVC A;  1YVU A;  4RW9 A;  1GOC A;  4IKF A;  3KK1 A;  3MED A;  4N47 A;  1SV5 A;  4DLG A;  3KIO A;  4DQI A;  1HPZ A;  2O4G A;  4LY7 A;  2PY5 A;  4EP4 A;  1RBT A;  2IDO A;  1NJZ A;  4DTN A;  4XIU A;  3DLB A;  1FKP A;  4JS4 A;  1RCH A;  1TVR A;  1JLE A;  1LWC A;  4Z4H A;  4CEA A;  3KLH A;  4I2Q A;  2E6L A;  1DTT A;  3ALY A;  1QHT A;  1S6Q A;  2VG7 A;  3C94 A;  4LSN A;  4CJS A;  4OVL A;  1FK9 A;  3VQ7 A;  3SPZ A;  1UAX A;  4KHQ A;  4G1Q A;  1RTI A;  4FJG A;  2YHA A;  1BIS A;  1XWL A;  3QES A;  5KI6 A;  4GW6 A;  3ZT3 A;  3AVN A;  5SWM A;  1NK7 A;  2OPQ A;  3CM6 A;  3DI6 A;  4Z4G A;  4FJ7 A;  1B9D A;  4O55 A;  3O4Q A;  2PZS A;  4HCC A;  4K8X A;  2ATQ A;  3ZSW A;  2HHW A;  1RBU A;  3OYJ A;  1SKS A;  3DOL A;  4UQG A;  1DTQ A;  1QE1 A;  1S9G A;  1YTA A;  1S1X A;  3WNE A;  2XY7 A;  2A1R A;  4RW6 A;  3V1R A;  3G10 A;  5KRT A;  3SNN A;  3FFI A;  3TAQ A;  3VQE A;  4EZ9 A;  2YNG A;  4AHV A;  3OYL A;  1L3U A;  2HVI A;  4B9S A;  4E0D A;  4GMJ B;  4DF8 A;  3LZI A;  4ZHR A;  3ZSY A;  2ZD1 A;  3U3G A;  3PX6 A;  3BGR A;  5DMR A;  4CJR A;  2JLE A;  4CF2 A;  3VQ4 A;  4CEQ A;  4PWD A;  1JXE A;  4HCB A;  3QIP A;  3QNN A;  3KK2 A;  4KHU A;  4FZY A;  3P83 D;  1ZYQ A;  1X9W A;  4J2A A;  1D9F A;  4B9V A;  1JL1 A;  4KHW A;  1XC9 A;  2ZQB A;  1RTH A;  2Z1I A;  3RRG A;  1NJW A;  1C1C A;  3UIQ A;  4O44 A;  3F73 A;  2DFE A;  2Q3S A;  4DTJ A;  3WNH A;  3OYD A;  1RT7 A;  1WSG A;  2RKI A;  3DRS A;  1ZBU A;  4CJP A;  5CYM A;  3K5M A;  3NAE A;  3OYE A;  1I39 A;  1QSS A;  4DTS A;  1Q8I A;  1UWB A;  3L2V A;  1T03 A;  4F3O A;  1C1B A;  3LP0 A;  4CJ5 A;  2B5J A;  2HHV A;  3LP3 A;  4KB0 A;  4Z4C A;  4DSE A;  4JRQ A;  4J2E A;  3RR8 A;  3CG7 A;  3MEG A;  4DFK A;  1TL3 A;  3LP1 A;  3ZSO A;  4Q0B A;  3VQ5 A;  2XHB A;  1BQN A;  3MXJ A;  3M8Q A;  4CF9 A;  3S3O A;  1ZBI A;  3DRR A;  1L3T A;  2DFF A;  1X9S A;  1L3S A;  3VN5 A;  4FK4 A;  3I0S A;  3TAF A;  3NGZ A;  1REV A;  2XY8 A;  3IAY A;  4CJQ A;  4FVM A;  3QEV A;  5SZT A;  4PA1 A;  2QKB A;  4BWM A;  1SUQ A;  1TAQ A;  1VSD A;  2ITG A;  4CFD A;  4W5Q A;  3V9S A;  4KHN A;  1HNV A;  3DLE A;  2F8T A;  3EY1 A;  3L2R A;  4N41 A;  4OGE A;  3VQA A;  1B9F A;  4E1M A;  4ID1 A;  3KK3 A;  5FRM A;  2Z1G A;  3DOK A;  2IOC A;  3OYK A;  2YNH A;  3M8P A;  2G8V A;  4Y1D A;  4JLH A;  1TKX A;  1NKC A;  4FJM A;  2D5R A;  3IRX A;  4AHU A;  3HPH A;  3RR7 A;  1WLJ A;  4CIE A;  3TAP A;  4CJL A;  4BE1 A;  1U4B A;  3QEI A;  2HHX A;  3DRP A;  3OS0 A;  4DFM A;  4FK2 A;  3HST B;  1NJX A;  1FKO A;  3VQ8 A;  3B6O A;  4OKK A;  4CED A;  1BIZ A;  1YT3 A;  2IGI A;  4DG1 A;  1NOZ A;  3OYB A;  3WNF A;  4BE0 A;  3V9U A;  1WAJ A;  2XY5 A;  1SKR A;  1Q9X A;  1D9D A;  2QKK A;  4CHP A;  4I9L A;  2E6M A;  1EET A;  2F96 A;  3L2U A;  3CFP A;  4N56 A;  2OPS A;  3HP6 A;  1IO2 A;  1RBS A;  3TAR A;  4KRE A;  4TSX A;  4M3Y A;  3CQ8 A;  4E7J A;  1U45 A;  4CJU A;  3D45 A;  3E01 A;  4KKO A;  3NE6 A;  3JSM A;  4DQQ A;  3SQ4 A;  1WSI A;  1ASV A;  2ZE2 A;  4KTW A;  3ZT1 A;  4Q5V A;  1NK4 A;  3MXM A;  3MAQ A;  2P1J A;  3DLH A;  2G8I A;  3HVT A;  2HHQ A;  2GUI A;  3SQ0 A;  4HTU A;  2BGG A;  1TK0 A;  2FBV A;  4CJK A;  4DU1 A;  3QIO A;  3V1Q A;  2VG5 A;  2X6N A;  1VRU A;  4FM1 A;  1HJR A;  4M3X A;  4FZX C;  3KLE A;  4B8A B;  2HHS A;  4FLU A;  1ZBH A;  3LPU A;  4O0J A;  3AVK A;  3LAK A;  4N5S A;  4ICL A;  3VQ9 A;  4H4O A;  4CFC A;  4CGG A;  1VK0 A;  3TI0 A;  4NCA A;  3KKR A;  2X6S A;  3O3H A;  3QER A;  1TL1 A;  3SUO A;  4CJ4 A;  1SL1 A;  2HNZ A;  3PO4 A;  2O4I A;  2KFZ A;  1N5Y A;  3L2W A;  3C95 A;  1C1A A; 
#chains in the Genus database with same CATH topology
 4BVO A;  1WSH A;  1XHX A;  1U47 A;  2DY4 A;  3J7A P;  4CK1 A;  3GOI A;  4H8K A;  1U2V A;  4IG3 A;  1JLA A;  1SKW A;  3DWL A;  3AA3 A;  1YJN N;  3CM5 A;  1I3A A;  4F4K A;  2PYL A;  2YX6 A;  5LL6 Z;  3KVG A;  4KH6 A;  3OYF A;  3OYI A;  3NFA A;  4H4M A;  3P31 A;  1N34 K;  3HYF A;  2NRV A;  3QIN A;  4DV7 K;  1LAW A;  2HBM A;  2P9K A;  1HYS A;  2NNW A;  3LWL A;  1WBD A;  1A5X A;  4PKI A;  4XH4 A;  5I42 A;  1IG9 A;  2I7N A;  2X78 A;  2IIR A;  4DR1 K;  3JXU A;  5LMU K;  4CZI A;  3KWG A;  5HRO A;  1HRH A;  2YNI A;  3U4L A;  4C1N K;  1RNH A;  2WFB A;  4W5N A;  1C0U A;  3SUQ A;  3U9Z A;  4RW7 A;  3G71 N;  3QEP A;  3WXJ A;  4KRF A;  5HP1 A;  3SAF A;  1SL0 A;  1VSL A;  3NVK A;  5C25 A;  3HSC A;  4F3T A;  3AO1 A;  3VMF B;  4HWI A;  4FO0 A;  4DV2 K;  1SL2 A;  3KKS A;  3WQU A;  2WOM A;  3HVR A;  4CJT A;  2OZM A;  4ELV A;  4FM2 A;  3AA4 A;  3AVF A;  3DLL L;  1RT5 A;  3LAN A;  3ZT0 A;  4DR4 K;  3T3F A;  3KD5 E;  2B4J A;  2GWJ A;  2YKM A;  3AAP A;  2G8F A;  2F8S A;  1YJ9 N;  2YJE A;  1T6C A;  1EKE A;  2DFH A;  3LDN A;  4KHS A;  4CFA A;  3OYC A;  3O4W A;  3NF8 A;  5F0X A;  3HM9 A;  3JAM O;  4B9Q A;  3FGU A;  3VTI A;  5BN8 A;  3I33 A;  4CHN A;  4A5B A;  4IO8 A;  2GX9 A;  4YY3 K;  2P9U B;  3TTC A;  3VEO A;  1NK6 A;  3K9J A;  2YHX A;  1XC3 A;  1WUA A;  2E2Q A;  3ZT4 A;  1Z26 A;  1GLL O;  4BWJ A;  4OLA A;  3EZW A;  2E5L K;  4C8L A;  3Q7C A;  1VHX A;  4B9U A;  3ASM A;  1RT2 A;  4YOT A;  5DM6 L;  1W9H A;  3SAG A;  2QWM A;  3KJV A;  3G0Z A;  4CJF A;  4CEF A;  3AAQ A;  1MWM A;  2RN2 A;  3F9K A;  3WXI A;  2A6A A;  4FJ8 A;  3VEV A;  1HNX K;  4BR0 A;  4BR9 A;  4H0X B;  4O4G A;  3VF4 A;  4MFB A;  4W5T A;  1BA0 A;  3H45 C;  1VQN N;  2F4V K;  1ZBL A;  3DXK B;  4O8K A;  4BG8 A;  3LPT A;  3WNG A;  5KQ8 A;  5KRS A;  3IS9 A;  2YCH A;  3EO3 A;  1RDD A;  4IFV A;  5KPR A;  2QEX N;  4C8O A;  5CY4 A;  4L8R B;  3A5M C;  5J2M A;  3D6R A;  4DV3 K;  3O1W A;  3PV8 A;  4CGH A;  2VGN A;  2HF3 A;  4YDU C;  1T7P A;  4ILJ A;  4NYF A;  5C10 A;  1JLB A;  5HRN A;  3HO1 A;  2WC9 A;  4JEP A;  3BUZ B;  2HHT A;  4H0Y B;  4CI6 A;  1RBV A;  4JI7 K;  4M7Y A;  3VET A;  5ADX H;  3EZ5 A;  1XNQ K;  1NGD A;  4IDK A;  4M3Z A;  1IH7 A;  4FZZ A;  4BGB A;  4FW1 A;  3EEQ A;  5C0Y A;  2Z1H A;  3MN6 A;  4M3R A;  4ELU A;  3FZH A;  2HBK A;  2GTD A;  1N8R O;  5AQL A;  1S1U A;  3V81 A;  3B6P A;  4E19 A;  4YOY A;  2YHW A;  3VQ6 A;  4E89 A;  1S1W A;  1WBB A;  3ATV A;  1G15 A;  5HLF A;  3TAN A;  2W6L A;  3IUC A;  4AHS A;  4XH5 A;  1X9J A;  2YHB A;  2Z1J A;  1GOB A;  4YFU A;  2D0P A;  2HBL A;  2QWN A;  2QA4 N;  5JLF A;  3KK7 A;  1EWQ A;  2DTU A;  4ZTJ A;  4E1N A;  2P5O A;  1U2V B;  1LAV A;  4E7I A;  4FJL A;  3WUH A;  1RT3 A;  3SJJ A;  4FOI A;  5AQO A;  3ZX0 A;  4BDY A;  1HR0 K;  4LD0 A;  3O9U A;  4LF9 K;  4X62 K;  1J53 A;  3CCL N;  2P9K B;  4CK2 A;  1VSJ A;  5IWA K;  2X74 A;  4PKH A;  1Y97 A;  1RT4 A;  4DFJ A;  4H0V B;  4AIL C;  5C42 A;  1TUU A;  4FM0 A;  3SUN A;  3C6T A;  4GNI A;  3SCX A;  1BGX T;  3S3N A;  4R5P A;  4CD3 A;  3H6E A;  4AHC A;  4KH5 A;  5ADX A;  3NHG A;  2ZJP L;  3RMA A;  3CFR A;  3D2F A;  1RT6 A;  1KTQ A;  5DK5 A;  5AQQ A;  3L3U A;  2PAV A;  5J2P A;  5AQJ A;  3QLH A;  2G8K A;  3QB0 A;  1HNI A;  4MO5 A;  5AQK A;  1VSK A;  1S6P A;  1WNS A;  4K43 A;  1K6Y A;  1NGB A;  5AQW A;  4FYD A;  4FWL A;  3LDQ A;  3SMS A;  5CZ1 A;  1D5A A;  2KW4 A;  1VQK N;  3FE1 A;  2A1S A;  4JKA A;  2Y1I A;  4NYN A;  4JKD A;  5BRF A;  3U8X A;  1HPZ A;  1VQ7 N;  1GLB G;  2NRW A;  5FPE A;  2PY5 A;  4PL7 A;  4YOU A;  4BRC A;  2VQF K;  1KAZ A;  1ZC6 A;  4XIU A;  4CZF A;  4CJS A;  4FPB A;  4OVL A;  3VQ7 A;  4G1Q A;  1RTI A;  3VTH A;  1XWL A;  4GW6 A;  3AVN A;  2OPQ A;  3M1F A;  4FJ7 A;  3GL1 A;  3RSE B;  2ATQ A;  2JWK A;  2HHW A;  1SKS A;  1Z6R A;  1S9G A;  2XY7 A;  2A1R A;  4RW6 A;  4FOE A;  5KRT A;  5M1P A;  1YIT N;  3TSP A;  3B8A X;  3ZET A;  4BRP A;  4KHP K;  2HST A;  3CMA N;  4DF8 A;  3AGK A;  3PX6 A;  5M1O A;  1I94 K;  5AFU H;  4CJR A;  4CF2 A;  1JXE A;  4HCB A;  4DR3 K;  4KHU A;  4WQ4 C;  1D9F A;  2QXL A;  1JL1 A;  3OBY A;  1QHA A;  4H0P A;  5CE3 A;  4IOC L;  3L0Q A;  4H5T A;  2DFE A;  3SJH A;  1YJW N;  5CHI A;  3DRS A;  1QSS A;  1TYQ A;  5CYM A;  3OYE A;  1OH6 A;  4PL8 A;  1Q8I A;  3L2V A;  1T03 A;  4F3O A;  1C1B A;  3LP0 A;  1S3X A;  2B5J A;  3MEG A;  1TL3 A;  3H3N O;  3ZSO A;  4BGA A;  3VQ5 A;  3CCQ N;  3H46 O;  3TTF A;  3J7Z O;  3M8Q A;  1L3T A;  2DFF A;  4YOX A;  4FK4 A;  3NGZ A;  1REV A;  1YF5 L;  4BWM A;  3VF6 A;  4KHN A;  1ATS A;  3EY1 A;  3MX5 A;  4FWQ A;  4DQ8 A;  4E1M A;  4ID1 A;  5FRM A;  5JVG L;  1TKX A;  1ATR A;  3IRX A;  2CH6 A;  4JI1 K;  1U4B A;  1HNW K;  2O8F A;  3OS0 A;  1NJX A;  3VQ8 A;  4CED A;  4IWV A;  3VGL A;  3MWP A;  4DG1 A;  1NOZ A;  1WAJ A;  2ZJR L;  2XY5 A;  1SKR A;  1D9D A;  2QKK A;  4V19 S;  4BRK A;  3L2U A;  3CFP A;  5TKY A;  4U67 L;  2RE2 A;  3MK6 A;  4TSX A;  4E7J A;  4A57 A;  3E01 A;  3QDK A;  1W2B M;  4DQQ A;  3SQ4 A;  1NGF A;  4BRE A;  1H1V A;  3MAQ A;  2W6K A;  1FW6 A;  2X6N A;  5CR4 A;  1HJR A;  2QWO A;  3E66 A;  1K8K B;  5C2F A;  5AFU A;  2X6S A;  4AM7 A;  2GUP A;  1TL1 A;  3QER A;  4CJ4 A;  3PO4 A;  1VQ6 N;  4GV6 A;  3DXM A;  3KWI A;  1GLE G;  2W42 A;  1JJ2 M;  3C95 A;  1J6Z A;  3SBT A;  4CJV A;  2Q36 A;  3KLF A;  3DLR A;  3VEY A;  5JLH A;  1Q18 A;  1KRP A;  4RW8 A;  1C0G A;  4FWR A;  5HRP A;  1RFQ A;  4C23 A;  3RTV A;  4I7F A;  1XQS C;  1NNE A;  5JS2 A;  3G25 A;  4BC3 A;  4GKJ K;  3VQP A;  1JKH A;  2V7Y A;  4H03 B;  3CC7 N;  5HRR A;  4FLV A;  1NK0 A;  3J7Y P;  2V52 B;  2IVN A;  3AV9 A;  3W3D A;  4KAZ A;  4JK8 A;  4F8R A;  2IC3 A;  1G99 A;  3BF1 A;  3G6E N;  2IAJ A;  5D3G A;  3NVM A;  1W0H A;  3PSI A;  3ULE A;  1KLM A;  4B3O A;  3K0S A;  2W40 A;  3OHR A;  4IXC A;  1X9M A;  2WON A;  3OJU A;  1RTD A;  1F21 A;  2O8E A;  4FWM A;  4OPK A;  1WOQ A;  2RPI A;  3O4N A;  4BE2 A;  3OW2 M;  3TAM A;  1C6V A;  5AZJ A;  5T7B A;  5BRH A;  1N36 K;  2I5J A;  4FLZ A;  3NF7 A;  1CXQ A;  3M6G A;  4CK3 A;  2AA4 A;  3KTQ A;  3D2F B;  4LH4 A;  3JYT A;  2P9N A;  1WSF A;  1NGA A;  4OO1 J;  1D4X A;  4IFY A;  2OYQ A;  4QS7 A;  4B9M A;  1EQY A;  2O8C A;  2HHU A;  1GLD G;  3ID8 A;  3L2Q A;  4BDP A;  2PFU A;  1U04 A;  1BIU A;  3R8E A;  3SQ2 A;  3ID6 A;  3M3Z A;  5AQY A;  1JLG A;  3PO5 A;  3ZSR A;  3C65 A;  5LMN K;  1X1P A;  5B8H A;  1TKD A;  2ITM A;  3AVM A;  4BRG A;  3DLG A;  4GVE A;  4JKF A;  2HB5 A;  4CJE A;  3FR0 A;  4U7B A;  4CGI A;  3C6U A;  4KV8 A;  4M3T A;  4FJH A;  3V9W A;  3NH2 A;  4B8C A;  3K5L A;  4A59 A;  2NUB A;  3ULD A;  3AVB A;  3QIC A;  2P9I A;  1C0F A;  4FLT A;  1BHL A;  1QQO A;  1J5E K;  1NWK A;  1NJY A;  3T19 A;  3GBT A;  4WF9 L;  4X64 K;  1UA1 A;  3AVJ A;  3THY A;  4B1X B;  1Y64 A;  1KLN A;  4OX9 K;  2BH1 A;  3ZET B;  1QVG M;  4AHR A;  2E2O A;  1S22 A;  1O13 A;  4WYB A;  1VQ9 N;  2VWK A;  4NCG A;  3AA5 X;  4B1V A;  4EP5 A;  2UXB K;  2HW3 A;  3QFP A;  4OGC A;  1SZ2 A;  3BZC A;  4JK7 A;  1KC8 O;  1NOY A;  2OAN A;  3AVG A;  3OJS A;  1QSL A;  2UXD K;  2Y1J A;  4PQU A;  1FXX A;  1LW2 A;  3LAM A;  4WQ5 A;  4M42 A;  1CXU A;  2NRH A;  3M8S A;  1KFD A;  4CF1 A;  4EIA A;  4DB3 A;  4DTU A;  4CJ7 A;  1NK8 A;  1NMN A;  1TYQ B;  5KTQ A;  3EE8 A;  2DPN A;  4JKC A;  1HNZ K;  5GAE P;  3L8B A;  2KZZ A;  4JD2 A;  4BRH A;  1VSE A;  4DU3 A;  1IKV A;  3TAE A;  1L5U A;  3VGK A;  2A3Z A;  3KLG A;  3SV3 A;  4DTR A;  4ZTF A;  4AH9 A;  3RMC A;  3UKU A;  4M41 A;  4FJ5 A;  3R1X A;  4KI4 A;  2ZF5 O;  2BAN A;  3NGI A;  1RTJ A;  4DTO A;  1BWF O;  4JI2 K;  3LDS A;  3THW A;  5EX5 A;  2KLA A;  4PKG A;  4CBX A;  4B9L A;  3SV4 A;  3IMX A;  2UXC K;  1WSJ A;  1IKW A;  1NGH A;  5EU7 A;  3CJ1 A;  3O9Q A;  1GOA A;  2O8F B;  3D7E O;  1IKY A;  2O8B B;  2P5G A;  4GV9 A;  4H0O A;  3RWU A;  5HBM A;  1R59 O;  1VQ8 N;  1HYZ A;  1QZ6 A;  4JI0 K;  4EZ6 A;  4BG9 A;  1VQ5 N;  3A0I X;  2AJQ A;  3OS1 A;  5AQS A;  3NF6 A;  1DEJ A;  4LH5 A;  3EYZ A;  1ILY A;  1EX4 A;  3H08 A;  1T05 A;  3S41 A;  3NH1 A;  4AM6 A;  3K5O A;  1ASU A;  1KVC A;  1NM1 A;  2KKZ A;  2XRI A;  4FWN A;  4DSL A;  4MLE A;  3HM8 A;  3RSE A;  3DXM B;  1CZA N;  1YAG A;  3QFU A;  4FCY A;  1KAY A;  4NCB A;  3O3G A;  1KXP A;  5E84 A;  4BQZ A;  1T8E A;  4LF7 K;  4I9Q A;  1XNR K;  4C8N A;  3VOV A;  2KFN A;  3VA0 A;  1CZB A;  3S3M A;  2BDP A;  3AVI A;  3CCR N;  1KCF A;  3VQC A;  2GV9 A;  4CE9 A;  1UOC A;  3U3Y A;  1J5O A;  4IEE A;  1VQL N;  3KHY A;  4OKJ A;  2UUB K;  4NLB A;  3L4Q A;  3LP2 A;  5F1X A;  2E2N A;  1LWE A;  4CIG A;  4YOW A;  1GLA G;  2KQ2 A;  2A41 A;  3A5N C;  5AQV A;  3VGM A;  4J2B A;  4DTP A;  1ZBF A;  1SS6 A;  3J81 O;  2P9L A;  1CLQ A;  3CET A;  3LL3 A;  4IZ9 A;  5DM7 L;  3V9Z A;  4HUE A;  2KTQ A;  2E88 A;  3IG1 A;  1Z05 A;  4H5R A;  3ULE B;  1J9A A;  3AVH A;  1RGI A;  1RBR A;  3JS6 A;  5AQP A;  2QW9 A;  3C0B A;  3MXI A;  1RDC A;  2O8E B;  4LF8 K;  3VQD A;  3HPO A;  1U6Z A;  4QAG A;  5IT9 O;  5GAG P;  4KB1 A;  4QS9 A;  2OCE A;  5C12 A;  1HQE A;  2F9W A;  4IG0 A;  3FZM A;  4IOX A;  4CGD A;  3T7Z A;  5AZJ B;  1RDB A;  3ENO A;  4IFE A;  1VQM N;  4CHO A;  5CYQ A;  3VEX A;  1LWF A;  3MED A;  5AQR A;  1SV5 A;  1V4S A;  4YOR A;  2P9N B;  3QBX A;  4LY7 A;  3ZX3 A;  4DTN A;  3DLB A;  2O8C B;  1FKP A;  1TVR A;  1LWC A;  4I2Q A;  4DF4 A;  4A62 A;  3SPZ A;  2VG7 A;  1FK9 A;  3J80 O;  1UAX A;  1YXQ A;  4KHQ A;  4FJG A;  1BIS A;  3QES A;  4Z4G A;  3O4Q A;  4I6M A;  3ZSW A;  1RBU A;  4PHT X;  3LDP A;  1K8A O;  1S1X A;  3WNE A;  3SNN A;  3VQE A;  3P38 A;  2YNG A;  3OYL A;  1L3U A;  3J8A A;  3LZI A;  2BUP A;  1GLF O;  2P9I B;  1K8K A;  4XH1 A;  3E9L A;  4EHT A;  5AQI A;  3KK2 A;  3P83 D;  1ZYQ A;  4J2A A;  2QWL A;  3THY B;  2CGJ A;  3CJA A;  3CPE A;  1RTH A;  1C1C A;  3UIQ A;  4A5A A;  1OVQ A;  3WNH A;  3OYD A;  3NAE A;  1M1K O;  3EKS A;  1UWB A;  3RR8 A;  4DFK A;  3CCU N;  4CZE A;  3T1H K;  4JI6 K;  4Q0B A;  3SK3 A;  5BRE A;  5EXW A;  4CF9 A;  1ZBI A;  3VN5 A;  1VQO N;  2RHK A;  2XY8 A;  2QKB A;  3OTO K;  5SZT A;  3V9S A;  4W5Q A;  2E1Y A;  2FF3 B;  3L2R A;  4JD2 B;  4LF5 K;  3KK3 A;  3DOK A;  2G8V A;  4FSV A;  2D5R A;  3CI5 A;  1WLJ A;  4CIE A;  4BE1 A;  3QEI A;  3DRP A;  4DFM A;  3O08 A;  5AQM A;  3MDQ A;  3UKU B;  1YT3 A;  4H5N A;  4DUZ K;  1GLJ O;  3O6W A;  3R3L A;  4B3R K;  2IVO A;  2QWQ A;  3THW B;  4CHP A;  4I9L A;  4ILH A;  3E1Y A;  1DGK N;  5AZI A;  2OPS A;  1RBS A;  3VPZ A;  3BY5 A;  4JYA K;  3CQ8 A;  4LF4 K;  2E1Z A;  4CJU A;  4AF1 A;  3NE6 A;  4KTW A;  2E2P A;  3HVT A;  1NGJ A;  2GUI A;  2NLX A;  2BGG A;  3NMU A;  4DU1 A;  3T69 A;  3CQY A;  1GLC G;  1VRU A;  4M3X A;  4FLU A;  4O0J A;  3AVK A;  3LAK A;  4KH4 A;  2P9S A;  3KKR A;  4NLC A;  3O3H A;  2KFZ A;  3DJC A;  3V4I A;  3AVL A;  3TU5 A;  1RDA A;  2ZJQ L;  4FLX A;  2HBJ A;  1HLU A;  3AO3 A;  3HTV A;  1WN7 A;  5KPT A;  3HBT A;  4OKE A;  1T3V A;  4C1N I;  4A61 A;  4CJ3 A;  3RMD A;  1QS4 A;  3OYN A;  1NJI O;  1TKT A;  2NZT A;  2PYJ A;  4FW2 A;  1S9E A;  1ZBS A;  1WAF A;  4NB4 A;  5J2Q A;  2G8H A;  3SZ2 A;  4FK0 A;  4FVU A;  1WSE A;  4CEE A;  3M8R A;  3L3V A;  3OYA A;  1HPM A;  3I8D A;  5ELZ A;  5FPD A;  1RT1 A;  3F5T A;  1K73 O;  1HYV A;  3ZX2 A;  2QK9 A;  1YTU A;  2QWR A;  4RW4 A;  4Z94 A;  5KGX A;  2P9L B;  1NGE A;  4PUO A;  3ITH A;  2YJF A;  3VEN A;  3DLK A;  3WXL A;  1S1T A;  4DSK A;  3MMV A;  4DR2 K;  2ZWH A;  4X65 K;  5LY3 A;  1T44 A;  4BQL A;  3TR8 A;  1NK5 A;  2WUS A;  3PX4 A;  1S1V A;  5FRO A;  4JHD A;  4O5B A;  3CFO A;  4HUF A;  3AO2 A;  3EE9 A;  2P51 A;  1MDU B;  1YIJ N;  1KAX A;  2ASO A;  1FJG K;  2KZM A;  5JS1 A;  2F7T A;  3V9X A;  2O8B A;  3I56 N;  3C6H A;  3PY8 A;  3H3O B;  4MQ3 A;  1BU6 O;  3MCA B;  2RF2 A;  3QML A;  4CHQ A;  4DQS A;  5J2N A;  3E9P A;  4CJW A;  2PBD A;  4I6M B;  1B92 A;  4LFA K;  4FJI A;  1IKX A;  2OA8 A;  2FLO A;  5AQG A;  3VQQ A;  3QO9 A;  1JXB A;  2HVH A;  4BAC A;  4BC2 A;  4CHZ A;  2D1K A;  4BRM A;  3DMJ A;  2O8D B;  4WFN L;  4FJ9 A;  3R6M A;  3WXM B;  1KVB A;  3SAH A;  1VRT A;  2FBY A;  2R7Y A;  1NKE A;  4F2S A;  1QZ5 A;  4JKH A;  3AGR A;  3ZSQ A;  1NGI A;  5J1E A;  5AQU A;  3K57 A;  1K9M O;  3K5N A;  4Y0W A;  2NRR A;  2FC0 A;  3ZYY X;  2W41 A;  1Q82 O;  3ZT2 A;  3OYM A;  3AO5 A;  3SUP A;  4DS4 A;  4B9T A;  4YOV A;  4O0I A;  4CCH A;  3L6Q A;  3ZLJ A;  4B08 A;  4YNQ A;  4CF0 A;  4IBN A;  3PIP L;  4JI8 K;  3H1Q A;  4CFB A;  4XEI A;  2OPR A;  5JIC A;  5HOO A;  3NDK A;  4PY5 A;  2YKN A;  3IDH A;  2Q1N A;  4BC5 A;  3NGY A;  4Z4I A;  4LF6 K;  3ENH A;  4KHY A;  1JCF A;  2NRT A;  3OBW A;  1LV5 A;  2E4L A;  3I8B A;  1IJJ A;  4JKE A;  1XI1 A;  4M63 C;  3TAB A;  4E1J A;  2OPP A;  3T1A A;  3A5O C;  3MX2 A;  4DV0 K;  1L3V A;  4KTZ A;  5A2Q O;  4KPY A;  3DM2 A;  4QCL A;  2A5X A;  3HPG A;  3BF3 A;  4DSJ A;  3CCE N;  3MCP A;  5AZI B;  1BCM A;  3ZSV A;  4KO0 A;  2FBT A;  3SQ1 A;  2HMI A;  1YUW A;  3TAG A;  4MDA A;  3K58 A;  3OYG A;  3O9T A;  4M3U A;  1Z25 A;  4ISE A;  4E3S A;  3DAW A;  3LWM A;  5FRN A;  3OS2 A;  1UA0 A;  4FLY A;  1U49 A;  1QQC A;  1TUY A;  2QTD A;  4WQ4 A;  2P9S B;  4HHT A;  1MU2 A;  4CVN E;  5HRS A;  2D0A A;  4CEC A;  5M1N A;  4W5R A;  1RIL A;  3GG4 A;  3SYZ A;  5JMV A;  5KPZ A;  5M1K A;  3LAL A;  3ISN C;  5TKW A;  3CJB A;  3VEW A;  2HND A;  4C8K A;  4E7K A;  1BCO A;  1BI4 A;  3NBP A;  3V1O A;  2Q97 A;  4YHH K;  5KQD A;  1TGO A;  4DSF A;  4B3T K;  5I9E B;  4BY9 C;  4DR6 K;  3ZSZ A;  2HOE A;  2IS3 A;  2FSJ A;  3VQB A;  2WTU A;  2CGL A;  4EFH A;  4CZJ A;  3VA3 A;  1HKG A;  4DU4 A;  3VER A;  4JK9 A;  3GDQ A;  3MN7 A;  3LZJ A;  3AVA A;  3LM2 A;  4RG8 A;  2UUC K;  4BDZ A;  3CXC M;  3K2P A;  3AO4 A;  4CW7 B;  4DV6 K;  2EHG A;  1EO1 A;  2ASP A;  3O9S A;  4B3S K;  1P8Z A;  4FLW A;  1R0A A;  4ISF A;  2ZM6 K;  1OH8 A;  4Z4F A;  4BRD A;  3SPY A;  1J54 A;  3HJF A;  3O5B A;  4HUG A;  4KI6 A;  4KTQ A;  2F9T A;  1E4G T;  1KD1 O;  1BL3 A;  4DR5 K;  4WFB L;  3RRH A;  4GVM A;  1MA9 B;  3I0R A;  4NXN K;  1TAU A;  5I3U A;  4L3Q A;  1YVU A;  4RW9 A;  1GOC A;  1W7A A;  4NCA A;  4DLG A;  4K25 A;  3CC4 N;  1RBT A;  1NJZ A;  2QI2 A;  4JKG B;  3BZK A;  3O1B A;  1RCH A;  3KLH A;  1JLE A;  4CEA A;  4CBU A;  2E6L A;  3ALY A;  4JNE A;  3C94 A;  1OKJ A;  2XO7 A;  1NK7 A;  4JHD B;  1QVF M;  4JN4 A;  5KI6 A;  5SWM A;  4O8U A;  4HCC A;  4O55 A;  4K8X A;  4FWS A;  5M1Q A;  4DKW A;  2UUA K;  4DUY K;  5AJ3 K;  2VYP A;  3A5L C;  3OYJ A;  3DOL A;  2YHY A;  1QE1 A;  3EKU A;  3CD6 N;  3IFR A;  4H5W A;  5GIP A;  3PSF A;  2UU9 K;  3V1R A;  3FFI A;  4EZ9 A;  2FF6 A;  4CZK A;  2I7P A;  2HVI A;  3HOT A;  4GV3 A;  4E0D A;  2V51 B;  3ZSY A;  5DMR A;  2JLE A;  4CEQ A;  4PWD A;  3FZF A;  3QIP A;  3QNN A;  2FSK A;  5EOY A;  3FLC O;  4CZM A;  4O44 A;  3F73 A;  2Q3S A;  1WSG A;  2RKI A;  4CJP A;  1ZXO A;  1I39 A;  1NGG A;  4DTS A;  2HMP A;  4CJ5 A;  2HHV A;  1X3M A;  3LP3 A;  2GEM A;  4KB0 A;  4JRQ A;  4BRF A;  3K9K A;  2XHB A;  3MXJ A;  3T1Y K;  3DRR A;  1X9S A;  1L3S A;  3U9D A;  4A2A A;  5AQF A;  3IAY A;  4FVM A;  1VSD A;  3DLE A;  4N41 A;  3EL2 A;  5GIO A;  2IOC A;  3GE1 A;  3OYK A;  2YNH A;  3CF5 L;  1Q81 O;  3PLA A;  4Y1D A;  4IOA L;  4JLH A;  4K0K K;  4DV4 K;  4FJM A;  4BRL A;  4AHU A;  4LC9 B;  3RR7 A;  3TAP A;  4CJL A;  2QM1 A;  1FKO A;  4OKK A;  1IG8 A;  2Q0U A;  2IGI A;  5BR9 A;  1BOT O;  1XMO K;  3OYB A;  3WNF A;  2F96 A;  4N56 A;  1Q7Y O;  4B1W B;  3HP6 A;  3TAR A;  4KRE A;  1U45 A;  2CGK A;  1N32 K;  1HUX A;  2ZE2 A;  5FPN A;  4EAH D;  3ZT1 A;  4MO4 A;  4Q5V A;  3HZ6 A;  3MXM A;  1NK4 A;  4CBW A;  3DLH A;  2G8I A;  2HHQ A;  3SQ0 A;  4HTU A;  2FBV A;  4AQY K;  3V1Q A;  5LJV A;  2VG5 A;  3HRG A;  4B8A B;  1HKB A;  4ICL A;  3VQ9 A;  4JAX A;  4CFC A;  3TI0 A;  1YHQ N;  1VQ4 N;  3SUO A;  2OTJ N;  1SL1 A;  3HI0 A;  5GIN A;  2O4I A;  1IBL K;  4LFC K;  3KD1 E;  3L4I A;  2UYT A;  4OPJ A;  1JLC A;  1VSH A;  3S9H A;  3V6D A;  3A2F A;  2BE2 A;  3P5J A;  3NCI A;  4MLH A;  2YV0 X;  3VES A;  3FZK A;  4BRA A;  2G8W A;  4N76 A;  1HKC A;  1VSI A;  4LFB K;  3PX0 A;  1NG9 A;  4DV1 K;  1NKB A;  3FFK B;  5EY4 A;  1EXQ A;  2OZS A;  3BP8 A;  3LDL A;  1W97 L;  1O1W A;  5K14 A;  3CCV N;  2HNY A;  3AA2 A;  2O8D A;  2QXF A;  4B1Y B;  4BVP A;  5GAD P;  1BI4 B;  4CEO A;  2VGM A;  4DMN A;  3WEE A;  4JS5 A;  2YNF A;  4CGJ A;  4CEZ A;  2D4W A;  4MDB A;  1TK8 A;  4A2B A;  4ELT A;  5BN9 A;  1CZ9 A;  2GBZ A;  4WFA L;  1DT9 A;  3N4P A;  4DTM A;  3C6A A;  3MN5 A;  4BRI A;  4CZH A;  4DS5 A;  3OVN A;  5C24 A;  4Y1C A;  3BEX A;  2B6A A;  1OH5 A;  5LJW A;  4DWI A;  2Q0R A;  2FXU A;  3MEC A;  1BUP A;  1HJO A;  5C2D A;  1C0M A;  3C7N A;  4F2R A;  1N6Q A;  4CES A;  1VSM A;  4CZL A;  4Z4E A;  4CZG A;  3TWH A;  2XY6 A;  1QSY A;  4GY2 B;  4CHY A;  1BQM A;  4CGF A;  4H0T B;  3QEW A;  4Z0U A;  5AQZ A;  4DCH A;  3I55 N;  5KGW A;  1TV6 A;  4KFB A;  4W5O A;  4FJN A;  3RVC A;  4BR2 A;  3CQX A;  4ILG B;  3QNO A;  4QOZ B;  5JVH L;  2AP1 A;  4DTX A;  1IBM K;  1E3M A;  5H1S Q;  4DLE A;  3KLI A;  5GAH P;  5F2R A;  1JLF A;  3F9M A;  4FJK A;  3THX A;  1LW0 A;  3VEZ A;  1EP4 A;  1S5J A;  3CCS N;  5AQT A;  2E8A A;  2Q2R A;  1KFS A;  3ZEU A;  3M5R A;  1BA1 A;  1VAZ A;  3UKR A;  2P9P A;  1A5V A;  4O5F A;  4OLB A;  3NH0 A;  3CIP A;  4H5V A;  3QET A;  3O80 A;  2BTF A;  5BPL A;  1SAZ A;  3G4S N;  1VSF A;  1RDU A;  1BG3 A;  1T6D A;  4JRP A;  1MWK A;  4M45 A;  4DSI A;  1NLV A;  2LSN A;  3K59 A;  4CER A;  1TK5 A;  3TPQ A;  3IKM A;  1RDW X;  3DYA A;  4WCE L;  5AQN A;  3NF9 A;  3MEE A;  5AQH A;  3VF2 A;  4B1Z A;  5CZ2 A;  1ATN A;  1SQK A;  4FWP A;  3HXM A;  4FJX A;  4BR4 A;  3LDO A;  2E20 A;  4QS8 A;  3D2E A;  3THV A;  3CJC A;  3P39 A;  1ASW A;  4FXD A;  3CJ7 A;  3TSU A;  2D0B A;  2WBN A;  2FBX A;  4OPH A;  4E7L A;  1DKG D;  3CC2 N;  3TTD A;  4CIF A;  2JWL A;  1BDG A;  4BR5 A;  3FZL A;  4CEB A;  4YDU A;  4DQR A;  4ISG A;  3LM9 A;  3N4Q A;  2J4R A;  4M7X A;  4K8Z A;  4JKB A;  1NK9 A;  4B9N A;  3PIO L;  4K41 A;  3PUF A;  2OTL N;  1HMV A;  1XHZ A;  3AAR A;  4FJJ A;  3SLC A;  1JL2 A;  4K42 A;  2FSN A;  3TSQ A;  4IEI A;  4C8M A;  4DHY A;  1D8Y A;  4F9O A;  1JCE A;  1OH7 A;  2HF4 A;  1DLO A;  3CER A;  4B3M K;  4DFP A;  1X3N A;  4JKG A;  1KQS M;  4DV5 K;  2D0O A;  4M3W A;  1Q9Y A;  4CD1 A;  4B1U B;  3HK2 A;  5C15 A;  3HL8 A;  2EX3 A;  4OJR A;  3EN9 A;  3D0P A;  3HP9 A;  3CPW M;  5AR0 A;  3CYM A;  3ZCM A;  2ETJ A;  2ZGY A;  4RCH A;  4NXM K;  2H3G X;  4BRN A;  4E7H A;  4AHT A;  3O3F A;  1M90 O;  5HL7 L;  1NU0 A;  5E41 A;  4LSL A;  1U48 A;  3OYH A;  1QTM A;  1TKZ A;  1C0T A;  1XMQ K;  4RTF D;  3RMB A;  2G8U A;  4FWO A;  1ITG A;  3HT3 A;  4WQ5 C;  4DQP A;  4ID5 A;  1KVA A;  2D0C A;  2GWK A;  3BDP A;  4KBO A;  5AQX A;  4BR7 A;  3WEE B;  4J2D A;  2IVP A;  3O8M A;  3E9O A;  1KSP A;  1VQP N;  4CF8 A;  3MN9 A;  4HTL A;  3KZB A;  3OY9 A;  3P1G A;  4I2P A;  1JLQ A;  3SI6 A;  1HQU A;  4HVJ A;  1XUP O;  2JGU A;  2EWS A;  3R9P A;  2VWJ A;  4WE1 A;  5FDL A;  3ZSX A;  1NGC A;  4OPA A;  2NRX A;  3WXK A;  2VG6 A;  4BRQ A;  3O9R A;  3U6F A;  4BC4 A;  1A5W A;  3QEX A;  3AVC A;  2V7Z A;  4IKF A;  3KK1 A;  4DQI A;  4N47 A;  5BRD A;  3KIO A;  2O4G A;  3C7N B;  4JI4 K;  4EP4 A;  2IDO A;  3CHW A;  4IJA A;  4JI3 K;  3CCM N;  4JS4 A;  2P9U A;  4Z4H A;  1DTT A;  1QHT A;  1S6Q A;  4LSN A;  3MWT A;  1ESV A;  4UY8 O;  4FL9 A;  2ZGZ A;  2YHA A;  3ZT3 A;  4FWK A;  3DI6 A;  3CM6 A;  1B9D A;  2PZS A;  5MLC Q;  1BO5 O;  1OVY A;  1YI2 N;  4UQG A;  1DTQ A;  1QQN A;  1YTA A;  3A8Y A;  5BR8 K;  3G10 A;  3TAQ A;  1N33 K;  4AHV A;  4B9S A;  4GMJ B;  4G9Z A;  4ZHR A;  2A40 A;  2A42 A;  4NO7 A;  2ZD1 A;  3U3G A;  4FPA A;  3BGR A;  3F2K A;  3VQ4 A;  2Q31 A;  2KHO A;  1V4T A;  3THX B;  4DR7 K;  3WT0 A;  4FZY A;  1LCU A;  1X9W A;  4B9V A;  4KHW A;  1XC9 A;  2ZQB A;  2Z1I A;  3RRG A;  3OA9 A;  1NJW A;  3ZEU B;  3UKR B;  2VWB A;  5M1F A;  3CME N;  4DTJ A;  2P9P B;  3DXK A;  1RT7 A;  1ZBU A;  4JV5 K;  3K5M A;  2CH5 A;  3SMP A;  1HX1 A;  4Z4C A;  4DSE A;  4J2E A;  3CG7 A;  3LP1 A;  1BQN A;  5EVZ A;  5BPM A;  3S3O A;  3P4I A;  1IBK K;  4IO9 L;  1EWR A;  3I0S A;  3TAF A;  4CJQ A;  3CJ9 A;  3QEV A;  4PA1 A;  1NMD A;  1SUQ A;  1TAQ A;  2ITG A;  4CFD A;  5FLX O;  2NRZ A;  1HNV A;  3SBG A;  2F8T A;  4OGE A;  4BRO A;  3VQA A;  1B9F A;  2Z1G A;  1E4F T;  3D2E B;  3M8P A;  1NKC A;  3UE5 A;  1LOT B;  5E26 A;  3CCJ N;  3HPH A;  2HHX A;  1YVN A;  1S72 N;  4FK2 A;  3HST B;  3HOS A;  3B6O A;  3ENB A;  1BIZ A;  3UB5 A;  4R79 A;  1QQM A;  5BPN A;  3Q7B A;  4BE0 A;  3V9U A;  1Q86 O;  1Q9X A;  1IV0 A;  4JI5 K;  3QBW A;  2YI1 A;  2E6M A;  1EET A;  2QWP A;  4RWT A;  4J8F A;  3H1V X;  4EHU A;  3ATU A;  4X66 K;  1IO2 A;  5FPM A;  4M3Y A;  2GEL A;  2VCP A;  3D45 A;  2HHH K;  4KKO A;  3JSM A;  1WSI A;  1ASV A;  2P1J A;  1TK0 A;  4CJK A;  2ASM A;  3W0L A;  3QIO A;  4IDH A;  3AY9 A;  4IJN A;  1JCG A;  4FM1 A;  4GKK K;  4FZX C;  3KLE A;  2HHS A;  1ZBH A;  3LPU A;  1P90 A;  4N5S A;  1NBW A;  4H4O A;  3WQT A;  4CGG A;  1VK0 A;  1WB9 A;  2HNZ A;  1N5Y A;  3L2W A;  2VQE K;  1C1A A; 
#chains in the Genus database with same CATH homology
 4CJV A;  3KD1 E;  4OPJ A;  3V4I A;  1WSH A;  1JLC A;  1VSH A;  3AVL A;  1XHX A;  3KLF A;  1RDA A;  3DLR A;  3S9H A;  1U47 A;  4FLX A;  2DY4 A;  3V6D A;  4CK1 A;  3A2F A;  4RW8 A;  1KRP A;  5HRP A;  4H8K A;  2BE2 A;  4IG3 A;  3P5J A;  3AO3 A;  3NCI A;  3RTV A;  4I7F A;  1JLA A;  1WN7 A;  2YV0 X;  1SKW A;  5JS2 A;  3AA3 A;  4OKE A;  3CM5 A;  1I3A A;  4F4K A;  2PYL A;  2G8W A;  4CJ3 A;  3RMD A;  3OYF A;  4N76 A;  3VQP A;  3OYI A;  1JKH A;  1VSI A;  3NFA A;  4H4M A;  3PX0 A;  1QS4 A;  5HRR A;  3OYN A;  4FLV A;  3HYF A;  1TKT A;  3QIN A;  1NKB A;  1LAW A;  1NK0 A;  1HYS A;  1EXQ A;  3AV9 A;  2PYJ A;  2OZS A;  4FW2 A;  3LWL A;  1A5X A;  1O1W A;  5K14 A;  5I42 A;  2HNY A;  4KAZ A;  1S9E A;  1WAF A;  5J2Q A;  1IG9 A;  2IC3 A;  2X78 A;  4F8R A;  3AA2 A;  2G8H A;  2QXF A;  3SZ2 A;  4FK0 A;  1BI4 B;  5HRO A;  1WSE A;  4CEO A;  1HRH A;  2IAJ A;  4CEE A;  2YNI A;  4DMN A;  3L3V A;  3OYA A;  3M8R A;  3I8D A;  4JS5 A;  2YNF A;  5D3G A;  1RNH A;  1W0H A;  4CGJ A;  4CEZ A;  1RT1 A;  4W5N A;  1C0U A;  1KLM A;  4B3O A;  3SUQ A;  1HYV A;  1TK8 A;  2QK9 A;  4RW7 A;  1X9M A;  1YTU A;  2WON A;  3OJU A;  1RTD A;  1F21 A;  3QEP A;  4ELT A;  4RW4 A;  4KRF A;  1CZ9 A;  5HP1 A;  2GBZ A;  1SL0 A;  4OPK A;  5KGX A;  4DTM A;  2RPI A;  3O4N A;  1VSL A;  4PUO A;  5C25 A;  4BE2 A;  3ITH A;  4F3T A;  3AO1 A;  4DS5 A;  3TAM A;  1C6V A;  3DLK A;  3OVN A;  5C24 A;  1S1T A;  4Y1C A;  5T7B A;  2I5J A;  1SL2 A;  3KKS A;  4FLZ A;  2WOM A;  2B6A A;  4CJT A;  3HVR A;  2OZM A;  4ELV A;  4FM2 A;  4DSK A;  4DWI A;  3MEC A;  3AA4 A;  3NF7 A;  1CXQ A;  3AVF A;  1RT5 A;  4CK3 A;  3KTQ A;  1C0M A;  3LAN A;  4LH4 A;  3ZT0 A;  3JYT A;  1WSF A;  3T3F A;  4IFY A;  3KD5 E;  2OYQ A;  4F2R A;  2B4J A;  2YKM A;  3TR8 A;  1N6Q A;  4B9M A;  1NK5 A;  2G8F A;  4CES A;  2F8S A;  2HHU A;  3PX4 A;  1VSM A;  1S1V A;  5FRO A;  3L2Q A;  4BDP A;  1U04 A;  4O5B A;  1BIU A;  4Z4E A;  1EKE A;  2DFH A;  3AO2 A;  3CFO A;  4HUF A;  3SQ2 A;  3TWH A;  2P51 A;  4DF4 A;  4KHS A;  4CFA A;  3OYC A;  1JLG A;  3PO5 A;  3NF8 A;  3HM9 A;  2XY6 A;  3ZSR A;  1QSY A;  4CHN A;  1X1P A;  4CHY A;  1BQM A;  4CGF A;  1TKD A;  2KZM A;  3AVM A;  2XO7 A;  3DLG A;  5JS1 A;  3QEW A;  4Z0U A;  3V9X A;  2HB5 A;  4CJE A;  3PY8 A;  4CGI A;  5KGW A;  3C6U A;  1NK6 A;  4KV8 A;  4M3T A;  1TV6 A;  4MQ3 A;  4FJH A;  4KFB A;  4W5O A;  4FJN A;  3V9W A;  2RF2 A;  3NH2 A;  4B8C A;  4CHQ A;  3K5L A;  3QNO A;  2NUB A;  4QOZ B;  3ULD A;  4DQS A;  5J2N A;  3AVB A;  4DTX A;  4CJW A;  4DLE A;  3ZT4 A;  3KLI A;  1Z26 A;  1B92 A;  4FLT A;  4FJI A;  1BHL A;  1IKX A;  2OA8 A;  1NJY A;  1JLF A;  4BWJ A;  4OLA A;  4FJK A;  4C8L A;  3VQQ A;  1LW0 A;  3QO9 A;  3T19 A;  1UA1 A;  3AVJ A;  1EP4 A;  1JXB A;  1S5J A;  4B9U A;  2HVH A;  4BAC A;  3ASM A;  1KLN A;  1RT2 A;  4CHZ A;  1KFS A;  1W9H A;  4AHR A;  3DMJ A;  1A5V A;  4OLB A;  4FJ9 A;  3NH0 A;  3KJV A;  1KVB A;  3G0Z A;  1VRT A;  2FBY A;  2HW3 A;  2VWK A;  4NCG A;  3AA5 X;  4CEF A;  4CJF A;  4EP5 A;  2R7Y A;  3QET A;  1NKE A;  4F2S A;  4OGC A;  1VSF A;  4JRP A;  2RN2 A;  3ZSQ A;  1NOY A;  3F9K A;  3AVG A;  4M45 A;  3OJS A;  1QSL A;  5J1E A;  4DSI A;  4FJ8 A;  2Y1J A;  2LSN A;  4PQU A;  4O4G A;  4CER A;  3K57 A;  3K59 A;  1TK5 A;  1FXX A;  1LW2 A;  3LAM A;  4M42 A;  1CXU A;  3K5N A;  3DYA A;  3M8S A;  1KFD A;  4MFB A;  4CF1 A;  4W5T A;  4DTU A;  1ZBL A;  2FC0 A;  3NF9 A;  1NK8 A;  3MEE A;  3LPT A;  5CZ2 A;  3WNG A;  5KTQ A;  2KTQ A;  3ZT2 A;  5KRS A;  3IS9 A;  3OYM A;  3AO5 A;  3HXM A;  4FJX A;  3SUP A;  1RDD A;  3L8B A;  4DS4 A;  4IFV A;  4B9T A;  4O0I A;  4CCH A;  4C8O A;  2KZZ A;  5CY4 A;  4L8R B;  4B08 A;  5J2M A;  1VSE A;  4YNQ A;  1IKV A;  4DU3 A;  4CGH A;  3TAE A;  4CF0 A;  3PV8 A;  3THV A;  4IBN A;  1L5U A;  1T7P A;  1ASW A;  3SV3 A;  3KLG A;  4FXD A;  4DTR A;  4NYF A;  2D0B A;  4ZTF A;  2FBX A;  4AH9 A;  4CFB A;  3RMC A;  1JLB A;  4M41 A;  4E7L A;  4FJ5 A;  4KI4 A;  2OPR A;  5HRN A;  3NDK A;  3HO1 A;  4CIF A;  2BAN A;  4PY5 A;  3NGI A;  1RTJ A;  2YKN A;  4DTO A;  3LDS A;  3NGY A;  4B9L A;  4Z4I A;  4CEB A;  2HHT A;  4DQR A;  1RBV A;  3SV4 A;  4KHY A;  1WSJ A;  1IKW A;  5EU7 A;  3EZ5 A;  4IDK A;  4K8Z A;  1NK9 A;  1LV5 A;  2E4L A;  4B9N A;  1GOA A;  4M3Z A;  1IH7 A;  1XI1 A;  1IKY A;  3TAB A;  3PUF A;  2P5G A;  4FZZ A;  1HMV A;  1XHZ A;  2OPP A;  3T1A A;  4FJJ A;  4FW1 A;  1L3V A;  4KTZ A;  1JL2 A;  3RWU A;  4KPY A;  3DM2 A;  4QCL A;  5HBM A;  3HPG A;  1HYZ A;  2Z1H A;  4M3R A;  4ELU A;  4DSJ A;  4C8M A;  1BCM A;  1D8Y A;  4EZ6 A;  3ZSV A;  4KO0 A;  2FBT A;  3SQ1 A;  2HMI A;  1S1U A;  3V81 A;  3TAG A;  3B6P A;  2AJQ A;  3K58 A;  4E19 A;  3OS1 A;  3OYG A;  4M3U A;  3NF6 A;  1DLO A;  3VQ6 A;  4E89 A;  1S1W A;  1Z25 A;  4LH5 A;  3EYZ A;  4E3S A;  1G15 A;  4DFP A;  3TAN A;  5HLF A;  1EX4 A;  3LWM A;  3H08 A;  1T05 A;  5FRN A;  4M3W A;  3OS2 A;  3NH1 A;  4FLY A;  1UA0 A;  1Q9Y A;  3HK2 A;  4AHS A;  1U49 A;  3K5O A;  3HL8 A;  1QQC A;  1ASU A;  1KVC A;  2EX3 A;  4OJR A;  2XRI A;  4DSL A;  2YHB A;  2Z1J A;  4HHT A;  1GOB A;  1MU2 A;  5HRS A;  2D0A A;  4YFU A;  3D0P A;  4CEC A;  4W5R A;  3HP9 A;  4FCY A;  1RIL A;  3CYM A;  4NCB A;  3O3G A;  3ZCM A;  1T8E A;  2ETJ A;  4I9Q A;  3SYZ A;  4C8N A;  3LAL A;  3ISN C;  2KFN A;  3VA0 A;  1CZB A;  4E7H A;  4ZTJ A;  3S3M A;  2BDP A;  3AVI A;  4E1N A;  2P5O A;  2DTU A;  1KCF A;  1LAV A;  4AHT A;  4E7I A;  3O3F A;  2HND A;  4FJL A;  3VQC A;  2GV9 A;  4CE9 A;  4C8K A;  1RT3 A;  4E7K A;  1UOC A;  1BCO A;  1BI4 A;  3NBP A;  5E41 A;  3V1O A;  3U3Y A;  4LSL A;  4OKJ A;  3SJJ A;  1U48 A;  1J5O A;  1TGO A;  3LP2 A;  4DSF A;  1LWE A;  4BDY A;  3ZSZ A;  2IS3 A;  4CIG A;  4LD0 A;  3VQB A;  3OYH A;  1QTM A;  1TKZ A;  1J53 A;  1C0T A;  3VA3 A;  4CK2 A;  4DU4 A;  2KQ2 A;  1VSJ A;  3RMB A;  2G8U A;  4J2B A;  1ITG A;  4DTP A;  3HT3 A;  2X74 A;  1ZBF A;  4DQP A;  1Y97 A;  1RT4 A;  4DFJ A;  4ID5 A;  3LZJ A;  1KVA A;  1CLQ A;  3AVA A;  2D0C A;  4RG8 A;  4AIL C;  5C42 A;  4BDZ A;  3V9Z A;  3K2P A;  4HUE A;  3BDP A;  4FM0 A;  3IG1 A;  3SUN A;  3C6T A;  3AO4 A;  3SCX A;  4J2D A;  1BGX T;  3S3N A;  1J9A A;  2EHG A;  3AVH A;  4R5P A;  1KSP A;  1RBR A;  4CF8 A;  4AHC A;  3NHG A;  3MXI A;  3RMA A;  1RDC A;  3CFR A;  4FLW A;  1R0A A;  3VQD A;  3HPO A;  3OY9 A;  1RT6 A;  1KTQ A;  3P1G A;  1JLQ A;  4I2P A;  5DK5 A;  3SI6 A;  1HQU A;  3L3U A;  4HVJ A;  4QAG A;  2W42 A;  4Z4F A;  5J2P A;  4KB1 A;  2JGU A;  1HQE A;  3QLH A;  4IG0 A;  3SPY A;  1HNI A;  2G8K A;  2VWJ A;  1J54 A;  1VSK A;  1S6P A;  1WNS A;  4WE1 A;  5FDL A;  4CGD A;  3ZSX A;  4HUG A;  1K6Y A;  4KTQ A;  1RDB A;  4KI6 A;  3HJF A;  2VG6 A;  4FYD A;  1BL3 A;  4CHO A;  5CZ1 A;  1D5A A;  3RRH A;  4GVM A;  3U6F A;  2KW4 A;  3I0R A;  2A1S A;  1A5W A;  3QEX A;  5I3U A;  1TAU A;  5CYQ A;  2Y1I A;  4NYN A;  1LWF A;  3AVC A;  1YVU A;  4RW9 A;  1GOC A;  4IKF A;  3KK1 A;  3MED A;  4N47 A;  1SV5 A;  4DLG A;  3KIO A;  4DQI A;  1HPZ A;  2O4G A;  4LY7 A;  2PY5 A;  4EP4 A;  1RBT A;  2IDO A;  1NJZ A;  4DTN A;  4XIU A;  3DLB A;  1FKP A;  4JS4 A;  1RCH A;  1TVR A;  1JLE A;  1LWC A;  4Z4H A;  4CEA A;  3KLH A;  4I2Q A;  2E6L A;  1DTT A;  3ALY A;  1QHT A;  1S6Q A;  2VG7 A;  3C94 A;  4LSN A;  4CJS A;  4OVL A;  1FK9 A;  3VQ7 A;  3SPZ A;  1UAX A;  4KHQ A;  4G1Q A;  1RTI A;  4FJG A;  2YHA A;  1BIS A;  1XWL A;  3QES A;  5KI6 A;  4GW6 A;  3ZT3 A;  3AVN A;  5SWM A;  1NK7 A;  2OPQ A;  3CM6 A;  3DI6 A;  4Z4G A;  4FJ7 A;  1B9D A;  4O55 A;  3O4Q A;  2PZS A;  4HCC A;  4K8X A;  2ATQ A;  3ZSW A;  2HHW A;  1RBU A;  3OYJ A;  1SKS A;  3DOL A;  4UQG A;  1DTQ A;  1QE1 A;  1S9G A;  1YTA A;  1S1X A;  3WNE A;  2XY7 A;  2A1R A;  4RW6 A;  3V1R A;  3G10 A;  5KRT A;  3SNN A;  3FFI A;  3TAQ A;  3VQE A;  4EZ9 A;  2YNG A;  4AHV A;  3OYL A;  1L3U A;  2HVI A;  4B9S A;  4E0D A;  4GMJ B;  4DF8 A;  3LZI A;  4ZHR A;  3ZSY A;  2ZD1 A;  3U3G A;  3PX6 A;  3BGR A;  5DMR A;  4CJR A;  2JLE A;  4CF2 A;  3VQ4 A;  4CEQ A;  4PWD A;  1JXE A;  4HCB A;  3QIP A;  3QNN A;  3KK2 A;  4KHU A;  4FZY A;  3P83 D;  1ZYQ A;  1X9W A;  4J2A A;  1D9F A;  4B9V A;  1JL1 A;  4KHW A;  1XC9 A;  2ZQB A;  1RTH A;  2Z1I A;  3RRG A;  1NJW A;  1C1C A;  3UIQ A;  4O44 A;  3F73 A;  2DFE A;  2Q3S A;  4DTJ A;  3WNH A;  3OYD A;  1RT7 A;  1WSG A;  2RKI A;  3DRS A;  1ZBU A;  4CJP A;  5CYM A;  3K5M A;  3NAE A;  3OYE A;  1I39 A;  1QSS A;  4DTS A;  1Q8I A;  1UWB A;  3L2V A;  1T03 A;  4F3O A;  1C1B A;  3LP0 A;  4CJ5 A;  2B5J A;  2HHV A;  3LP3 A;  4KB0 A;  4Z4C A;  4DSE A;  4JRQ A;  4J2E A;  3RR8 A;  3CG7 A;  3MEG A;  4DFK A;  1TL3 A;  3LP1 A;  3ZSO A;  4Q0B A;  3VQ5 A;  2XHB A;  1BQN A;  3MXJ A;  3M8Q A;  4CF9 A;  3S3O A;  1ZBI A;  3DRR A;  1L3T A;  2DFF A;  1X9S A;  1L3S A;  3VN5 A;  4FK4 A;  3I0S A;  3TAF A;  3NGZ A;  1REV A;  2XY8 A;  3IAY A;  4CJQ A;  4FVM A;  3QEV A;  5SZT A;  4PA1 A;  2QKB A;  4BWM A;  1SUQ A;  1TAQ A;  1VSD A;  2ITG A;  4CFD A;  4W5Q A;  3V9S A;  4KHN A;  1HNV A;  3DLE A;  2F8T A;  3EY1 A;  3L2R A;  4N41 A;  4OGE A;  3VQA A;  1B9F A;  4E1M A;  4ID1 A;  3KK3 A;  5FRM A;  2Z1G A;  3DOK A;  2IOC A;  3OYK A;  2YNH A;  3M8P A;  2G8V A;  4Y1D A;  4JLH A;  1TKX A;  1NKC A;  4FJM A;  2D5R A;  3IRX A;  4AHU A;  3HPH A;  3RR7 A;  1WLJ A;  4CIE A;  3TAP A;  4CJL A;  4BE1 A;  1U4B A;  3QEI A;  2HHX A;  3DRP A;  3OS0 A;  4DFM A;  4FK2 A;  3HST B;  1NJX A;  1FKO A;  3VQ8 A;  3B6O A;  4OKK A;  4CED A;  1BIZ A;  1YT3 A;  2IGI A;  4DG1 A;  1NOZ A;  3OYB A;  3WNF A;  4BE0 A;  3V9U A;  1WAJ A;  2XY5 A;  1SKR A;  1Q9X A;  1D9D A;  2QKK A;  4CHP A;  4I9L A;  2E6M A;  1EET A;  2F96 A;  3L2U A;  3CFP A;  4N56 A;  2OPS A;  3HP6 A;  1IO2 A;  1RBS A;  3TAR A;  4KRE A;  4TSX A;  4M3Y A;  3CQ8 A;  4E7J A;  1U45 A;  4CJU A;  3D45 A;  3E01 A;  4KKO A;  3NE6 A;  3JSM A;  4DQQ A;  3SQ4 A;  1WSI A;  1ASV A;  2ZE2 A;  4KTW A;  3ZT1 A;  4Q5V A;  1NK4 A;  3MXM A;  3MAQ A;  2P1J A;  3DLH A;  2G8I A;  3HVT A;  2HHQ A;  2GUI A;  3SQ0 A;  4HTU A;  2BGG A;  1TK0 A;  2FBV A;  4CJK A;  4DU1 A;  3QIO A;  3V1Q A;  2VG5 A;  2X6N A;  1VRU A;  4FM1 A;  1HJR A;  4M3X A;  4FZX C;  3KLE A;  4B8A B;  2HHS A;  4FLU A;  1ZBH A;  3LPU A;  4O0J A;  3AVK A;  3LAK A;  4N5S A;  4ICL A;  3VQ9 A;  4H4O A;  4CFC A;  4CGG A;  1VK0 A;  3TI0 A;  4NCA A;  3KKR A;  2X6S A;  3O3H A;  3QER A;  1TL1 A;  3SUO A;  4CJ4 A;  1SL1 A;  2HNZ A;  3PO4 A;  2O4I A;  2KFZ A;  1N5Y A;  3L2W A;  3C95 A;  1C1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...