1VSKA

Asv integrase core domain d64n mutation in citrate buffer ph 6.0
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTNFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INTEGRASE
publication title Structural basis for inactivating mutations and pH-dependent activity of avian sarcoma virus integrase.
pubmed doi rcsb
source organism Rous sarcoma virus - schmidt-ruppin b
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vskA00
4KTWA 3VQEA 1UA1A 1WSHA 1BI4B 3AA5X 3V9ZA 3CM6A 2F96A 3HYFA 3WNHA 3DLBA 4QOZB 3QESA 2KQ2A 4Z4HA 5CZ1A 1JLCA 2EHGA 4UQGA 2YHBA 3DLKA 3CFRA 4RW9A 3WNGA 5J2NA 4DQPA 4RG8A 2B4JA 4CEQA 3RRHA 4AHSA 2VG6A 3OS2A 1ZYQA 1NK6A 4QCLA 3ZSVA 1RILA 5E41A 1HYVA 1HNIA 1VSJA 1XI1A 4J2DA 4FJKA 2KTQA 4CHZA 4LH5A 4DQRA 3V81A 1LAWA 4BWMA 3AVIA 1S1WA 3OVNA 4FLWA 4FK0A 1HYSA 3AO4A 1KFSA 2HMIA 2ZQBA 4KFBA 3SI6A 4ZHRA 3O3FA 1HRHA 3VQ5A 2ITGA 4BE0A 1KFDA 3HSTB 3VA3A 3HP6A 1C1CA 3ZT0A 3JSMA 3CQ8A 3THVA 1KRPA 1YTUA 3OYLA 3KK2A 4DFMA 4L8RB 2P1JA 4IBNA 2HHVA 1TV6A 3E01A 4DTJA 1NKEA 4EZ9A 4KHWA 1F21A 5CY4A 3OYHA 3FFIA 4AILC 4F2RA 4CJRA 3IG1A 4CESA 4H4OA 1EXQA 2R7YA 4AH9A 4DSFA 1XHZA 4E3SA 3HPHA 4C8NA 4M45A 4FM0A 3TAMA 4E7HA 2Z1HA 1JXEA 3QEXA 4KI6A 1JL1A 4FW1A 3T3FA 1FK9A 3SPYA 3AVCA 3DOKA 1RTHA 3U3YA 1UWBA 4B08A 1SKWA 4E0DA 4F3OA 1N5YA 3P1GA 2YV0X 2DFEA 4KV8A 4W5TA 3TAFA 4LD0A 3MAQA 1WSJA 3L2UA 3B6PA 1JLQA 2Q3SA 1ZBLA 4OKJA 4FJLA 2HNZA 4LH4A 2HHWA 2YKNA 2Z1IA 2FBYA 3HJFA 4NCAA 1TVRA 1XHXA 4BDPA 4K8ZA 4KTQA 4HVJA 3LWLA 4KI4A 3OS0A 2D5RA 2Z1JA 1LV5A 3KK3A 3ULDA 1NK0A 1G15A 5KRSA 3K5OA 3T19A 1L5UA 2FBVA 3LAMA 1NKCA 1RT3A 4DMNA 3ZT1A 4JS5A 1NJZA 3B6OA 4HUEA 2RF2A 1EX4A 3F73A 3TI0A 1NK7A 4I2PA 4Y1CA 5J1EA 4CHNA 2G8HA 1WSGA 1IKXA 4FLTA 4FZXC 1ZBIA 2OPRA 1X9WA 4QAGA 4CJ4A 4Z4EA 1J5OA 4PWDA 4DTUA 1YVUA 3NH0A 3TWHA 3OJUA 4FLZA 3KLHA 3TAEA 2OPPA 3UIQA 3PO5A 4CK2A 4BDYA 1TK0A 4OKKA 3OYNA 3O3HA 1LAVA 4DF8A 2X6NA 4Z4GA 4XIUA 3WNEA 2G8FA 1C1BA 1RDCA 4DWIA 3SUQA 5C24A 3QIOA 1VSFA 1VSIA 4YFUA 4HTUA 4DQIA 1S6QA 2E6MA 3MEEA 1ASWA 3VQ4A 1KTQA 2DFHA 3HO1A 3V9XA 4KKOA 3I0RA 2QKBA 2P5GA 3TR8A 4I9QA 4CJLA 1U48A 4ELTA 3HK2A 4DSKA 3TAPA 4FVMA 4BDZA 4FZZA 3LALA 3DRPA 4B3OA 1WAFA 1LWEA 2YNFA 3MXIA 2PZSA 4E19A 4FJ8A 3KLFA 4FZYA 1QE1A 3RTVA 1TKXA 3SZ2A 1UA0A 3ZT4A 2OYQA 2Z1GA 1DTQA 5KGWA 1S9EA 3CFPA 1I39A 4AHRA 3QNNA 2PYLA 1O1WA 3U3GA 4CF0A 4M3RA 2KFZA 2I5JA 4IFVA 3LPUA 5KTQA 3AVGA 1BIUA 1JLBA 2P5OA 2E4LA 1RTIA 3OS1A 1T8EA 4O4GA 3QLHA 4KTZA 3LP2A 4C8KA 4B9TA 3OYKA 5JS2A 3MXJA 4W5RA 3SNNA 3NCIA 1SV5A 1QHTA 4OGCA 1NK8A 4E1NA 3P5JA 1WLJA 3DMJA 3KLGA 1JLEA 4YNQA 4CHPA 4AHVA 3LPTA 4O0JA 4CJSA 2G8WA 4F4KA 3QINA 4R5PA 4W5OA 2D0BA 4CGFA 1RTDA 1NKBA 2Y1JA 4CEZA 3ZCMA 2OA8A 1RDAA 4F3TA 4N76A 2WOMA 1CLQA 3JYTA 4BE2A 3L2QA 3DRRA 1EP4A 3CYMA 5CYQA 1Z26A 1C1AA 4CCHA 1BQNA 1RDBA 4CK3A 1D8YA 4HUFA 1X9MA 3K5NA 3LANA 3TABA 3O4QA 1J54A 3TARA 4FLUA 4DU3A 3LZIA 4KPYA 4DTXA 4KHYA 1BL3A 3SCXA 4W5NA 4CJ5A 2IOCA 4CJKA 1GOCA 1A5WA 4IKFA 1S1TA 5KRTA 5DK5A 2VWKA 4KB1A 4CJUA 2D0CA 3SUNA 1WSIA 4FJXA 1VRUA 1RNHA 1S9GA 1VSLA 3NF9A 3V9UA 1SL1A 4HCBA 4FLXA 1RBVA 3SQ0A 4FJIA 3PV8A 4CJPA 1RT7A 3HXMA 3D0PA 3HPOA 4DLEA 4K8XA 3SJJA 3RR8A 3NFAA 1CXQA 2WONA 4FJMA 1YTAA 4IDKA 3VQ6A 2KFNA 2FBXA 2XY7A 1Z25A 3ZSXA 4CFAA 4CEBA 3C95A 3D45A 1BGXT 3AVNA 3MXMA 2P51A 1RT2A 3ZSOA 3HVTA 1IKWA 3AO1A 1LWCA 2GV9A 1BI4A 3I0SA 4CECA 1Q8IA 2VG5A 3NAEA 2RKIA 4IG0A 2DTUA 5SZTA 1GOBA 3SUPA 3HPGA 3VQDA 4AHTA 1FKOA 4HHTA 1J53A 3DLGA 3H08A 1RT6A 3ASMA 4ID5A 5C25A 4DTRA 3ALYA 3K59A 1L3SA 4GW6A 4KAZA 1J9AA 1NK5A 3DLRA 3ZT3A 4CEEA 3AA4A 1JXBA 4EP4A 1NOYA 4CHOA 3CFOA 3TAGA 3NHGA 1CZ9A 3SV3A 4E1MA 2BDPA 2BE2A 1WAJA 1Q9YA 4KO0A 2HB5A 3AVKA 4F2SA 3SQ1A 3RRGA 4BACA 2NUBA 1KLMA 3ZSRA 4C8LA 4DU1A 4FJNA 2ZD1A 3CM5A 3NH1A 1QSYA 2G8UA 2F8TA 2HNDA 3ZSQA 3ZSWA 3TANA 2GBZA 4B9LA 3WNFA 3O3GA 1S1UA 4DFPA 3L3VA 2F8SA 1VSHA 3SUOA 2KZMA 1U49A 4DQQA 4OLAA 1TKTA 4CHQA 1LWFA 1NOZA 3ZT2A 1RT4A 1EKEA 2IDOA 1KCFA 4M3YA 4B9UA 1Y97A 3V1RA 4I9LA 4KHQA 5J2MA 1TGOA 4M3TA 4CIGA 3G10A 1RTJA 4IFYA 4ICLA 3SQ2A 1T7PA 1D9FA 4M3ZA 4HUGA 5FRNA 3V4IA 4BWJA 3ZSZA 3KLIA 3AO2A 4AHCA 4G1QA 2YNHA 3VN5A 3HVRA 3VA0A 2JLEA 3AVJA 4LY7A 4CGHA 3M8QA 1VK0A 1VSEA 2FBTA 4JLHA 3VQBA 4CJEA 1JLAA 3K58A 1N6QA 4J2AA 3SV4A 1S1VA 1BQMA 1WN7A 4DSLA 1XC9A 2XY8A 5J2QA 5D3GA 4JRQA 2DY4A 4Z0UA 2A1RA 3AO3A 3NF6A 3S9HA 2KZZA 1HYZA 1VSMA 4CGJA 3ISNC 1U47A 1VSDA 3RMBA 4B9NA 3S3NA 4KHUA 1D5AA 1I3AA 3VQPA 3L2WA 2OZSA 4C8MA 3DYAA 3I8DA 3PX6A 3OYFA 1ZBHA 2PY5A 4ELVA 5CYMA 4CF9A 2HHTA 2IAJA 3QIPA 2BGGA 3AVAA 3V9WA 2ATQA 3KKRA 5K14A 1T05A 1QS4A 4DTMA 2XHBA 3L2RA 4E7IA 1RBSA 2ZE2A 3T1AA 3ZSYA 4CE9A 4CIEA 3M8SA 4CIFA 3RMAA 5I3UA 2D0AA 1RBTA 3P83D 5HRSA 1TKDA 2HVIA 3VQAA 3HT3A 3OYEA 4CHYA 3OYJA 3QEVA 4M3XA 4M41A 4E7JA 1HNVA 5CZ2A 1IKVA 3PUFA 1SKSA 1KLNA 4B9MA 3NGYA 1BCMA 4OPKA 1KSPA 3HM9A 3RWUA 1B92A 4OLBA 4LSLA 4E7LA 2B6AA 2X74A 5HRNA 5I42A 1GOAA 5FDLA 4RW6A 4M3UA 3QERA 1BIZA 3NGZA 4ID1A 2JGUA 1IKYA 3LAKA 5FRMA 3OYMA 2QKKA 3NGIA 3PO4A 4DTNA 5HP1A 1HJRA 2IGIA 3KJVA 4FJHA 4DTSA 2HW3A 1WNSA 1ZBUA 3VQ9A 5HRRA 4N47A 3U6FA 3QNOA 1LW2A 3ITHA 4DLGA 1QSLA 1REVA 3LP0A 3TAQA 3MEGA 3V1OA 1S6PA 4CJVA 2KW4A 3QO9A 4OPJA 2X78A 2XY5A 4CEDA 4F8RA 4FJGA 4CERA 1XWLA 3OJSA 1IO2A 3V9SA 1HQEA 1TL3A 4FJ7A 2PYJA 1RT5A 3EY1A 2AJQA 1U04A 3S3OA 3IAYA 3IS9A 4GVMA 2Y1IA 3PX0A 1MU2A 3RMCA 4WE1A 1RT1A 1WSEA 3V1QA 2A1SA 4FK2A 3NF8A 4CJTA 3K57A 4ELUA 4H4MA 4E7KA 3K5LA 3OYDA 3A2FA 3DM2A 3MEDA 3NF7A 5HLFA 1L3TA 1TAQA 1B9DA 4O0IA 3LZJA 4CEFA 4JRPA 1RCHA 1NK9A 1C0MA 1SL0A 4ZTFA 3K2PA 5SWMA 3C6UA 3IRXA 3DLEA 4FW2A 4PY5A 2RN2A 3DRSA 3KD5E 4M3WA 3OYAA 3AO5A 1CXUA 1QQCA 2E6LA 3LWMA 4FXDA 3AVMA 4KHSA 2HHXA 4Z4FA 4LSNA 5HRPA 3LP1A 3AA2A 1TK5A 2YKMA 2X6SA 4MFBA 4OGEA 1ASVA 1YT3A 3MECA 4NYFA 3QETA 1TK8A 4CGIA 1W9HA 1SKRA 4FCYA 1EETA 1UOCA 4DG1A 4DQSA 4DFJA 4KREA 2HVHA 2IC3A 3AVHA 5C42A 1HMVA 3DI6A 4N56A 3OYBA 4DF4A 3OYCA 1KVBA 1C0UA 4Q5VA 3EYZA 1U45A 2GUIA 1U4BA 1TKZA 1ZBFA 4PA1A 1NJYA 4CF8A 1X1PA 3SPZA 2W42A 3QEIA 4CFDA 4N41A 3DLHA 4BE1A 4EZ6A 2HNYA 4RW8A 3VQQA 1W0HA 1KVAA 4DSEA 3S3MA 1DTTA 3M8RA 3EZ5A 1K6YA 1WSFA 3VQCA 5KGXA 3KK1A 4C8OA 4FLYA 1KVCA 2RPIA 4OKEA 3KTQA 4FK4A 1BHLA 2DFFA 4PQUA 1HQUA 1C6VA 4NCGA 3AVLA 4NYNA 5HBMA 2QK9A 4B9VA 2VG7A 2OPQA 4CGDA 3NE6A 4FJJA 4FJ5A 4KHNA 1QSSA 2HHUA 1TAUA 4B8CA 2EX3A 4FM2A 1A5XA 3AV9A 3L3UA 1JKHA 3VQ7A 1Q9XA 1NJWA 3C94A 3NH2A 3AA3A 1RBUA 4OJRA 3OYGA 1IH7A 2YNGA 3BGRA 3LDSA 4FLVA 1A5VA 1TL1A 3AVBA 3PY8A 4DTPA 2HHSA 4KB0A 3L8BA 2XRIA 2YHAA 4CJ3A 2YNIA 5J2PA 4FYDA 1UAXA 5DMRA 4CK1A 4W5QA 4O44A 3G0ZA 4CJQA 3O4NA 4B8AB 1B9FA 4JS4A 2G8KA 1JLFA 2ETJA 4DS5A 2O4GA 4CEAA 3NDKA 1HPZA 1L3UA 2B5JA 4IG3A 4CFCA 1QTMA 4J2BA 3RR7A 4EP5A 4OVLA 3K5MA 3QEWA 3AVFA 3RMDA 1DLOA 1X9SA 1NK4A 1NJXA 4PUOA 1C0TA 4CGGA 1LW0A 3DOLA 5FROA 4DSJA 2G8IA 4J2EA 4HCCA 2HHQA 3F9KA 4CJFA 3C6TA 3LP3A 3HL8A 3PX4A 1D9DA 4DSIA 1S5JA 1S1XA 1R0AA 3HP9A 2IS3A 3QEPA 3BDPA 3SYZA 1JLGA 4E89A 1FKPA 3KIOA 4O5BA 5HROA 4CF1A 1L3VA 3OYIA 2G8VA 4M42A 4Z4IA 1BISA 4FJ9A 3V6DA 1JL2A 3VQ8A 2O4IA 4Y1DA 1RBRA 5EU7A 1ASUA 4O55A 4TSXA 3SQ4A 4FM1A 1VSKA 1SUQA 2XO7A 1BCOA 4CF2A 1RDDA 4RW4A 4DU4A 5JS1A 4GMJB 4CJWA 4N5SA 4DS4A 4KRFA 4H8KA 1FXXA 3KKSA 2VWJA 2OPSA 4DFKA 3KD1E 3KLEA 2XY6A 5T7BA 3OY9A 4B9SA 2QXFA 1ITGA 4I2QA 3M8PA 4RW7A 4MQ3A 1IG9A 1CZBA 4DTOA 1SL2A 2FC0A 2OZMA 2LSNA 4ZTJA 1T03A 3L2VA 4AHUA 4Q0BA 3NBPA 2BANA 5KI6A 4NCBA 4CFBA 4CEOA 4Z4CA 1VRTA 4I7FA 3CG7A
chains in the Genus database with same CATH superfamily
4KTWA 1UA1A 1WSHA 1BI4B 5C10A 2F96A 3HYFA 3IMXA 5F2RA 5LL6Z 4FSVA 1XMOK 1MA9B 5C0YA 4UQGA 2YHBA 5J2NA 4DQPA 4RW9A 4RG8A 4CEQA 1HYVA 5EOYA 4DQRA 5C12A 4IWVA 3SAFA 1HYSA 1KFSA 3SI6A 4ZHRA 3O3FA 1HRHA 3HSTB 4FWKA 1KRPA 3ZT0A 3CQ8A 4DFMA 3E66A 2P1JA 3MN5A 4H0OA 5CY4A 2YHXA 5KQ8A 3JS6A 3HPHA 3ID6A 4C8NA 1KQSM 3QEXA 4KI6A 2Z1HA 1JXEA 4NB4A 4FW1A 3AGRA 3SPYA 1FK9A 3AVCA 3DOKA 2YJFA 3U3YA 4V19S 1BA0A 4B08A 1SKWA 3CCSN 2UUCK 1N5YA 2NRXA 1YJ9N 4YOVA 3E9OA 4W5TA 1Z6RA 4LD0A 2CH5A 4HWIA 3MWTA 3B6PA 2HNZA 4LH4A 2HHWA 2FSNA 2Z1IA 4NCAA 1TVRA 4BDPA 1SQKA 4HVJA 3HM8A 3O4WA 4U7BA 4KI4A 2FBVA 5JLHA 1RT3A 4DMNA 1NJZA 1XNQK 3B6OA 2RF2A 4CJ7A 4XEIA 5J1EA 5HL7L 4Z4EA 1V4TA 3THXA 1YVUA 3NH0A 4FLZA 3OJUA 4FOEA 1JJ2M 2PFUA 3O3HA 4A5BA 1C1BA 1RDCA 4DWIA 3SUQA 3TSQA 1NWKA 1VSFA 4YFUA 4HTUA 2YI1A 3HO1A 1NLVA 3V9XA 2QKBA 2P5GA 1E4FT 3TR8A 2WTUA 4DSKA 3HK2A 3EE9A 5FPMA 4IO8A 3DRPA 3MXIA 2PZSA 4E19A 3HOSA 3CC4N 1TKXA 3ZT4A 1FW6A 4LF8K 1NGEA 1DTQA 1I39A 4AHRA 1Q81O 4CZMA 1GLAG 2F4VK 1OVQA 5M1KA 5KTQA 2O8DB 4DV2K 1RTIA 3RSEB 3UKRB 3OYKA 2FF3B 4DR1K 3NCIA 4BR4A 1VQMN 3LM9A 4B1YB 1JLEA 4YNQA 4AHVA 4O0JA 4FOIA 3QB0A 4CJSA 3DLLL 4CEZA 3ZCMA 1RDAA 4BE2A 3WXMB 3O1BA 3EKUA 1X9MA 4DQ8A 3HOTA 3LANA 4BRKA 3TABA 3TARA 4FLUA 4DTXA 1QHAA 2BTFA 1BL3A 2IOCA 2P9KA 1GOCA 2ASPA 4IO9L 1MDUB 4DV6K 4CJUA 3SUNA 4EIAA 1RNHA 3K0SA 3T1YK 4BRFA 2P9NA 4FJIA 1RBVA 4HCBA 4I6MB 4DLEA 3QFUA 2QWMA 3ENOA 3SJJA 3RR8A 2KFNA 1Z25A 4A57A 1BGXT 3DXKA 2GV9A 3NAEA 2RKIA 5ADXA 1GOBA 1NGAA 3I56N 3DLGA 3FZLA 3H46O 5C25A 4DTRA 1L3SA 4GW6A 1XNRK 1KAZA 1VAZA 1JCFA 4EP4A 1NOYA 3CFOA 3NHGA 2VQFK 3ENHA 2BDPA 2BE2A 5ADXH 1VQPN 1WAJA 2UXBK 3RRGA 1KAXA 4FJNA 4WYBA 3C7NA 4K41A 2KKZA 4B9LA 2GBZA 1S1UA 3L3VA 4BRPA 5JMVA 4OLAA 1NOZA 1EKEA 1IBKK 1KCFA 4M3YA 5AQFA 1Y97A 3BY5A 4GV9A 4I9LA 1NMNA 4M3TA 4O5FA 1X3NA 1DKGD 1RTJA 3SQ2A 3O9TA 4PHTX 4AHCA 4G1QA 2D4WA 3PSFA 4IFEA 3HVRA 3AVJA 4CGHA 5A2QO 3J7YP 3VQBA 2D0PA 1JLAA 3SV4A 4B1WB 4DSLA 5EVZA 2E88A 1M1KO 2O8EB 2PAVA 1TYQA 4Z0UA 4CVNE 3CCVN 4JHDA 3T1HK 1VQ7N 4ISGA 1QVFM 3RMBA 4B9NA 3S3NA 1WOQA 3L2WA 3I8DA 2A40A 3R8EA 3EEQA 2PY5A 2UXDK 1OH5A 4DTMA 2XHBA 3L2RA 3RMAA 1YUWA 2D0AA 1N32K 5HRSA 5EY4A 4BRGA 3HT3A 5BREA 4CHYA 3OYEA 3OYJA 4M41A 3CPWM 1T3VA 5AQQA 1KLNA 5M1OA 3VTHA 3NGYA 4B9MA 3VERA 3A0IX 4LF9K 2IIRA 4LSLA 2Q36A 5C2DA 2ASMA 4LF7K 4RW6A 2P9NB 1NG9A 2JGUA 5FRMA 3OYMA 5AQWA 3DXMB 1EO1A 2GWKA 3KJVA 4FJHA 2BUPA 2I7NA 3VQ9A 3QNOA 1LW2A 4DLGA 1VQON 1REVA 5GIPA 4H0YB 3TAQA 3V1OA 1S6PA 4CJVA 4FJGA 1EWQA 4KBOA 2QTDA 3BZCA 1HQEA 1TL3A 4JKFA 5AFUA 3IAYA 4GVMA 4NO7A 4WE1A 1RT1A 1WSEA 4FK2A 3K57A 1L3TA 3A2FA 1ZC6A 4JRPA 1RCHA 3BP8A 4ZTFA 1V4SA 3C6UA 5AFUH 2RN2A 3KD5E 2E5LK 3VENA 3C7NB 1QQCA 2E6LA 4ISEA 3LWMA 4JKBA 4LSNA 3LP1A 3CJ9A 3AA2A 4LF4K 3QETA 2QW9A 3CMAN 3A8YA 1EETA 4DQSA 3P38A 1HMVA 4N56A 1KVBA 2GUIA 1ZBFA 3DJCA 1NJYA 4CF8A 5JVGL 3EKSA 1BWFO 4EZ6A 3VQQA 1K6YA 1WSFA 4C8OA 1KVCA 2RPIA 1U2VB 4BR7A 4JAXA 2QK9A 1HKGA 2OPQA 4CGDA 3NE6A 4FJ5A 4B8CA 5AQYA 3VQ7A 3E1YA 1RBUA 2YNGA 2E1YA 2FSKA 4FLVA 4YOTA 2HHSA 1ESVA 4Y0WA 1IBLK 4CK1A 4W5QA 3O4NA 3QBXA 5ELZA 5LY3A 4WFBL 5FLXO 3ZEUB 1G99A 2RHKA 1HPZA 4J2BA 3RR7A 4EP5A 3K5MA 3AVFA 1NK4A 3DOLA 5IT9O 2HHQA 4CJFA 2NRRA 4DSIA 3PX4A 1R0AA 4DR6K 2KLAA 2ZM6K 1FKPA 5HROA 2GTDA 3HI0A 4BRCA 4Z4IA 4FJ9A 3CXCM 1SS6A 2IVNA 3D2EA 5EU7A 1BCOA 4CF2A 1S22A 4X62K 5JS1A 3PIOL 4H8KA 4FWNA 4B9SA 1NJIO 1IG9A 4B9QA 1CZBA 4DTOA 4MO5A 1SL2A 2OZMA 2D0OA 2P9SA 4BR9A 5MLCQ 4AHUA 2NRHA 3N4PA 4DR4K 4CFBA 4Z4CA 4I7FA 3ZX2A 5BRDA 3AA5X 3CM6A 4H0PA 1NGDA 3DLBA 1JLCA 2EHGA 2NRWA 3DLKA 3M5RA 4DR7K 2B4JA 3RRHA 3N4QA 4AHSA 4FL9A 2QWQA 2KTQA 4CHZA 4LH5A 2HBLA 3MX2A 1S1WA 4DKWA 2HMIA 4KFBA 4IJAA 3VQ5A 2ITGA 4BE0A 1KFDA 4EFHA 4B1ZA 1YTUA 4L8RB 2HHVA 2Q2RA 4GKJK 3E01A 4DTJA 4KHWA 3OYHA 4CJRA 2R7YA 1XHZA 1BU6O 4H5WA 4DR5K 4H5VA 1DGKN 3A5MC 3H45C 1RTHA 3EO3A 2YJEA 3P1GA 3CJ1A 3TAFA 3M6GA 2W40A 3MAQA 1WSJA 1IJJA 1VHXA 1JLQA 4OKJA 4K42A 2I7PA 2CGKA 3E9LA 2Z1JA 1LV5A 3ULDA 4DV4K 3TSPA 3LAMA 3ZT1A 3WXIA 3ZETB 3F73A 3NVKA 5EX5A 1NK7A 4Y1CA 2G8HA 4FLTA 4RWTA 1RDWX 5BRFA 1J5OA 5KPZA 2OPPA 3UIQA 4NXMK 4OKKA 5GADP 1LAVA 2X6NA 5AQXA 3THYA 5AQJA 2E6MA 2DFHA 1VQ8N 3I0RA 3MN7A 2V7YA 1U48A 4JKEA 4BDZA 1WAFA 1LWEA 2YNFA 2P9SB 3SZ2A 2Z1GA 2E2QA 1HJOA 3U3GA 4JKDA 4CF0A 3SJHA 3LPUA 1OVYA 3AVGA 1BIUA 5LMNK 4A61A 3OS1A 5EXWA 2HHHK 4WCEL 4FVUA 4PL7A 3Q7BA 4C8KA 5JS2A 3VF4A 3CJCA 3C6AA 1QHTA 1WBBA 3P5JA 1WLJA 4CHPA 3LPTA 2G8WA 3QINA 4R5PA 2D0BA 1WBDA 3GOIA 2Y1JA 3U4LA 2WOMA 5AQMA 3L2QA 3CYMA 4CD3A 3TU5A 4WFAL 4CCHA 1RDBA 2P9UA 3OBWA 2QWNA 5JICA 4CK3A 1D8YA 4HUFA 4IJNA 2QXLA 3K5NA 2EWSA 4DU3A 3O9UA 1HR0K 3QBWA 4W5NA 4CJ5A 1A5WA 4IKFA 3KWIA 4LFAK 5KRTA 4KB1A 2F7TA 3A5NC 4J8FA 1S9GA 1VSLA 4B1UB 4FLXA 4OPHA 4CJPA 1RT7A 3HXMA 3D0PA 3HPOA 4K8XA 2WONA 2FBXA 1GLFO 4CFAA 5E26A 3C95A 2P51A 1RT2A 1LWCA 5JLFA 4CECA 5B8HA 1Q8IA 4CZIA 2NZTA 1BUPA 1BDGA 5SZTA 4BG8A 3ID8A 4YDUC 4AHTA 2F9WA 4ID5A 1RT6A 3K59A 3L4QA 5H1SQ 3J7ZO 3ZT3A 3AA4A 4CHOA 3TAGA 4E1MA 2HB5A 4BACA 2NUBA 1KLMA 3ZSRA 4C8LA 2YX6A 4IOAL 3CM5A 1NGCA 3BEXA 2F8TA 3ZSWA 1S72N 1VSHA 1NM1A 1E4GT 5IWAK 2P9LA 4CHQA 4JKGB 5GIOA 2OANA 3U9ZA 4B9UA 3V1RA 3ATUA 4LC9B 3CCJN 4JK7A 4IFYA 4JI6K 4CZEA 4LF5K 4HUGA 3V4IA 3KLIA 4JN4A 3VEZA 3VA0A 3M8QA 1XMQK 1S1VA 1WN7A 3T69A 3C65A 5D3GA 2A1RA 2ZF5O 3AO3A 3S9HA 2NNWA 4CGJA 4CZFA 3K9JA 4JD2A 2FLOA 4YHHK 1VSDA 4KHUA 5AQRA 1I3AA 2D1KA 4R79A 5C2FA 3DYAA 4RCHA 3PX6A 3OYFA 1NGBA 3FZMA 4JI5K 4ELVA 2GEMA 4CF9A 4HTLA 3L0QA 2O8BA 1YI2N 3QIPA 2BGGA 3V9WA 3KKRA 1T05A 3EN9A 1RBSA 3T1AA 3M8SA 4E7IA 3QMLA 1NGIA 1H1VA 3VQAA 4A59A 2O8CA 3J80O 4M3XA 4E7JA 2WC9A 1IKVA 3B8AX 3HBTA 4X66K 3CD6N 1KSPA 5M1QA 5C15A 1B92A 4OLBA 2Q97A 3O5BA 5FDLA 5I42A 2JWKA 3QERA 4CBWA 1LCUA 3LAKA 4FWSA 2Q0RA 4BR0A 4H0TB 3UKUA 3AY9A 4M7YA 1HJRA 2IGIA 3VEYA 4DTSA 3G6EN 2HW3A 3SLCA 5HRRA 4N47A 2QWPA 3M1FA 3LP0A 3MEGA 4MO4A 2KW4A 2X78A 4CERA 4FJ7A 1RGIA 2Y1IA 3UE5A 3RMCA 1TUYA 4DV1K 3NF8A 4CJTA 2GX9A 4DCHA 1ILYA 1ATRA 3VGMA 4EHUA 4H5TA 4CEFA 4IDHA 1NK9A 3PLAA 3K2PA 5SWMA 3IRXA 1FJGK 2HOEA 4FW2A 4FWQA 4NLCA 3DRSA 4JI0K 3CQXA 3DWLA 3AO5A 5AQNA 4NXNK 3M3ZA 5HRPA 4CBXA 1T6CA 2YKMA 2X6SA 1TK8A 2NRVA 3THXB 3WEEA 2P9LB 3L6QA 3O9SA 4KREA 1YAGA 1IV0A 4DFJA 3NMUA 4DUZK 5C42A 4DF4A 1C0UA 3CCEN 4BVOA 1ZXOA 4PA1A 1X1PA 2WUSA 3DLHA 4BROA 4BE1A 2HNYA 4PL8A 3WQTA 4PKHA 4YOWA 5CR4A 1DTTA 3KK1A 5KGXA 1KC8O 4FLYA 4FK4A 4OKEA 3KTQA 1BHLA 3LL3A 1SZ2A 4PQUA 1HQUA 5HBMA 4BRQA 4B9VA 1KAYA 4JI7K 3CCLN 4EAHD 5KQDA 3AV9A 2OTJN 1Q9XA 3WT0A 3L4IA 3MMVA 4OJRA 1IH7A 3BGRA 1A5VA 2ITMA 3PY8A 1C0GA 3H1VX 4DTPA 4KB0A 4CJ3A 4JV5K 2YNIA 4FYDA 1UAXA 5JVHL 3U9DA 4QS7A 4BG9A 1N33K 4MLEA 4BRDA 3JAMO 4IOCL 2O4GA 1P90A 4CEAA 1CZAN 4FWPA 3NDKA 1L3UA 4IG3A 3CJBA 3QEWA 3RMDA 1DLOA 3VPZA 1C0TA 4CZGA 4DSJA 1K8AO 2CH6A 3C6TA 1HX1A 3HL8A 3LP3A 1S5JA 2IS3A 1JLGA 3KIOA 1L3VA 1HNXK 3OYIA 1HKBA 4DV7K 4M42A 3CHWA 2GELA 3ULEA 4TSXA 4O55A 2P9KB 1RDDA 4RW4A 4DS4A 3KD1E 1WUAA 5T7BA 3OY9A 4I2QA 3OW2M 4KH6A 4O8KA 1Z05A 1T6DA 1OKJA 3LDQA 3G4SN 3NBPA 2O8FA 2BANA 1DEJA 3DXKB 4QS9A 1X9WA 3CG7A 3MN6A 1OH6A 3QESA 4Z4HA 4G9ZA 1QQNA 1QZ6A 2VG6A 4QCLA 3ZSVA 4J2DA 4C1NK 4FJKA 2E2NA 3V81A 1LAWA 2HMPA 4FLWA 3AVIA 3OVNA 1XC3A 4A5AA 3AO4A 5CE3A 4PKGA 3CCQN 1C1CA 4AM7A 5AZJA 4IBNA 1I94K 5GAGP 4LFBK 3FFIA 2AP1A 4F2RA 4PKIA 3IG1A 3OHRA 4CESA 4H4OA 1EXQA 1QQOA 4AH9A 4E3SA 4M45A 3TAMA 4BGAA 4FWLA 1UWBA 4XH1A 4BC3A 4E0DA 4F3OA 2DFEA 4KV8A 3WXJA 3MCAB 2Q3SA 4FJLA 2IVPA 5BN9A 5LJVA 2YKNA 4JK9A 3KWGA 1RDUA 3LWLA 1VQ4N 3VF6A 3OS0A 2D5RA 2GUPA 3I8BA 3KHYA 1G15A 3ENBA 3K5OA 1C0FA 3T19A 1NKCA 4JS5A 1GLDG 3CCMN 3P39A 1TYQB 3TI0A 4LF6K 4I2PA 4JHDB 1IKXA 4A2AA 4FZXC 2OPRA 3VEXA 3U8XA 4PWDA 2A42A 4CI6A 3TWHA 1BOTO 3KLHA 3TAEA 1OH7A 1RFQA 4JI8K 3W0LA 4DR3K 1K8KA 1ZBSA 2YCHA 4Z4GA 3WNEA 4ILGB 3THWA 3QIOA 3ULEB 2GWJA 1S6QA 3MEEA 3VQ4A 1ASWA 1KTQA 1HUXA 4B3SK 4CJLA 3CI5A 4WQ4C 3LALA 5AZIA 4B3OA 2JWLA 4BC5A 4FJ8A 1NGHA 4AM6A 3KLFA 3RTVA 4BY9C 1S9EA 3QNNA 2NRTA 1O1WA 2KFZA 4M3RA 4IFVA 2E2OA 2UU9K 2E4LA 4GNIA 2P9IA 1T8EA 4DHYA 4O4GA 3BF1A 3CC7N 3FGUA 3LP2A 3MK6A 1M90O 4B9TA 3MXJA 3SNNA 3O9QA 1NK8A 4OGCA 1W97L 4E1NA 3TPQA 3KLGA 4KH4A 4F4KA 1NGGA 1RTDA 3H3OB 4N76A 5AZJB 1QQMA 2UXCK 4WQ5C 5CYQA 1Z26A 3AAPA 1KD1O 1BQNA 3H3NO 2P9PA 4U67L 1JCEA 4CZJA 4A62A 2A41A 3O4QA 4JKCA 3LZIA 4H0XB 4KPYA 4KHYA 3SCXA 4JI4K 3QICA 2VWKA 1WSIA 3NF9A 3V9UA 2PBDA 3SQ0A 4BVPA 3PV8A 4AQYK 4FJMA 3NFAA 3H6EA 5BR8K 1YTAA 3MN9A 3VQ6A 3FR0A 3GE1A 3MXMA 1IKWA 3AO1A 1BI4A 1K9MO 2VG5A 3FLCO 3SAGA 2DTUA 4AF1A 3SUPA 3HPGA 3VQDA 2WBNA 5CHIA 3ALYA 4JKHA 3DLRA 3QDKA 1YJWN 4GV3A 2RE2A 5AQIA 4ILJA 4F2SA 1IG8A 2E2PA 2BH1A 1YIJN 4DU1A 2ASOA 2ZD1A 3O1WA 1QSYA 3R6MA 2HNDA 3CETA 3ZSQA 4YY3K 2KZMA 3W3DA 1U49A 4DQQA 1RT4A 1K73O 5AQZA 5AQHA 1HNZK 4KH5A 4B1XB 5J2MA 1TGOA 4LFCK 5KPRA 1T7PA 3D2EB 4ICLA 4Z94A 4BRIA 2H3GX 2YNHA 3VN5A 2JLEA 1Y64A 3O6WA 2FBTA 4JLHA 4CJEA 5F0XA 4OX9K 3VETA 3VTIA 1NGFA 5AQVA 4JRQA 2DY4A 1HYZA 4MDBA 1VQKN 1D5AA 3VQPA 3F9MA 2OZSA 1ZBHA 5BN8A 1LOTB 2IAJA 3AVAA 3H1QA 2HF4A 2ZE2A 3ZSYA 5I3UA 4CIFA 3P83D 2HVIA 1TKDA 4IEEA 1NU0A 1HLUA 5CZ2A 3PUFA 1SKSA 1BCMA 4OPKA 3HM9A 1D4XA 2OCEA 2DPNA 3ZLJA 4E7LA 3R1XA 1Q18A 2B6AA 2X74A 3GG4A 5HRNA 1GOAA 2QA4N 4M3UA 1BIZA 3NGZA 2QKKA 5LJWA 1Q86O 3NGIA 5HP1A 1X3MA 3U6FA 1VQ9N 3ITHA 1QSLA 5LMUK 2FSJA 4F8RA 4CEDA 3TTDA 1XWLA 4OPAA 2O8DA 1S3XA 2PYJA 1YXQA 1RT5A 3EY1A 3SBTA 1U04A 3S3OA 3RSEA 3R9PA 3PX0A 3UKRA 1MU2A 4IOXA 2A1SA 3TSUA 5HLFA 3K5LA 3OYDA 3DM2A 2QWOA 2E1ZA 3BUZB 3LZJA 2HBKA 1EQYA 1C0MA 1J5EK 3WXKA 3DLEA 4JI1K 4H5NA 4PY5A 4BREA 3VEWA 4M3WA 3OYAA 3CC2N 3AVMA 4KHSA 2HHXA 4YORA 4FWRA 2IVOA 1TK5A 4C23A 4OGEA 1SKRA 4FCYA 1UOCA 4DG1A 1Q82O 2HVHA 2IC3A 3EYZA 1U45A 3THYB 3EE8A 4IEIA 3SPZA 4UY8O 4CFDA 3AGKA 4I6MA 5TKYA 4RW8A 4ILHA 4BR5A 4DSEA 3S3MA 4YDUA 3EZ5A 3JXUA 3VQCA 5AQKA 3P31A 2DFFA 3CJ7A 4JI2K 1C6VA 2CGLA 4NCGA 2VG7A 2HHUA 4FJJA 3UB5A 4CZKA 2VWBA 1N36K 3O8MA 4FM2A 2VQEK 3C94A 5BPLA 4K0KK 1TL1A 3AVBA 3HTVA 1ATNA 2YHAA 1MWKA 5DMRA 4O44A 5DM7L 3G0ZA 4B8AB 4H03B 2ETJA 4YOYA 3WQUA 5I9EB 4YOUA 3GL1A 1QTMA 4OVLA 4DV0K 4BQLA 4PUOA 2VCPA 3CIPA 4HCCA 3F9KA 5KPTA 3G25A 1D9DA 3HRGA 1S1XA 3ZX0A 3QEPA 1N8RO 3SYZA 1VQ5N 2P9UB 4JK8A 1YITN 4B1VA 2G8VA 3WUHA 2QI2A 5FPEA 3SMPA 3V6DA 1JL2A 4Y1DA 1ASUA 5M1PA 4DU4A 2QWRA 4GMJB 4CJWA 4N5SA 1FXXA 3VF2A 3PIPL 2FF6A 4DFKA 2XY6A 1ITGA 3GBTA 2UUAK 4WFNL 1YVNA 2FC0A 4DV5K 1X9JA 3AARA 4ZTJA 2O8EA 3ZYYX 3SAHA 1JCGA 2YHWA 4DR2K 2E8AA 4Q0BA 5AQTA 5KI6A 5AR0A 4NCBA 4CEOA 2A3ZA 1NMDA 1VRTA 3VQEA 3V9ZA 1BO5O 3WNHA 4QOZB 2KQ2A 5AQUA 5CZ1A 3CFRA 3WNGA 3MDQA 3OS2A 1ZYQA 1NK6A 4X65K 1RILA 5E41A 1E3MA 1HNIA 1VSJA 1XI1A 3FFKB 4BWMA 2OTLN 2F9TA 2A5XA 2ZQBA 1VQLN 3VA3A 3Q7CA 3HP6A 3JSMA 3D6RA 3P4IA 3THVA 3OYLA 3KK2A 1TV6A 1NKEA 4EZ9A 1F21A 4AILC 1XQSC 4DSFA 3DXMA 1VQNN 1HNWK 4FM0A 1ATSA 4E7HA 1JL1A 3T3FA 2WFBA 4X64K 2YV0X 1BG3A 3WXLA 2HBJA 3L2UA 4JI3K 5FPDA 1ZBLA 2HSTA 4B3MK 2V7ZA 2FBYA 3HJFA 1XHXA 1R59O 4K8ZA 4BQZA 4KTQA 3KK3A 3CQYA 1NK0A 5KRSA 1L5UA 4JKAA 3VEOA 3HSCA 4HUEA 1EX4A 4DUYK 4BC2A 4CHNA 4JD2B 1N34K 1WSGA 5HOOA 1ZBIA 4QAGA 4CJ4A 4DTUA 2ZJQL 4NLBA 3SBGA 2O8BB 4BRHA 1Q7YO 3PO5A 4CK2A 4BDYA 1TK0A 3OYNA 3MX5A 4DF8A 3VMFB 4XIUA 2G8FA 2O8CB 3C6HA 5BR9A 5C24A 3J81O 1VSIA 3KK7A 4L3QA 4DV3K 4DQIA 4XH4A 5AQPA 3K9KA 1GLJO 1P8ZA 4KKOA 3F2KA 4I9QA 3CCRN 2NRZA 4ELTA 3TAPA 2VGMA 4FVMA 2E20A 4FZZA 1U2VA 4GY2B 3CCUN 4FZYA 1QE1A 3QFPA 3UKUB 1UA0A 5AJ3K 3VEVA 4GV6A 2OYQA 5KGWA 3CFPA 2ZJRL 3CMEN 3J8AA 1NGJA 2PYLA 2I5JA 5BRHA 4WF9L 1JLBA 2KHOA 2P5OA 3O9RA 3QLHA 4KTZA 4XH5A 3ZEUA 2Q1NA 4W5RA 3I55N 1SV5A 3DMJA 4JYAK 3HZ6A 4FPAA 3BZKA 4W5OA 4CGFA 4IXCA 1NKBA 2OA8A 4F3TA 3D7EO 1CLQA 3JYTA 2W41A 3DRRA 1EP4A 4QS8A 1GLBG 4IZ9A 1C1AA 5AQGA 3VGLA 3WEEB 1J54A 4CJKA 1S1TA 3SMSA 4BRMA 3T7ZA 4FWMA 5DK5A 4FJXA 2D0CA 2ZGZA 1VQ6N 3VOVA 2ZJPL 1VRUA 1T44A 1SL1A 3C0BA 2CGJA 2VYPA 1WB9A 2HF3A 3I33A 1CXQA 1QZ5A 2UYTA 4IDKA 3LM2A 2XY7A 3ZSXA 4CEBA 3G71N 4GVEA 3D45A 3D2FA 3AVNA 3LDPA 3ZSOA 4B3RK 3HVTA 4ISFA 3I0SA 3IKMA 3VGKA 2AA4A 4IG0A 4O8UA 1GLEG 1FKOA 3CERA 4CBUA 4HHTA 1J53A 3H08A 3ASMA 4F9OA 4KAZA 1J9AA 1NK5A 4BRNA 2UUBK 4CEEA 1JXBA 4M63C 1CZ9A 3SV3A 1Q9YA 1TUUA 1GLCG 2V52B 4KO0A 3AVKA 3KZBA 2FXUA 3SQ1A 1BA1A 3NH1A 4A2BA 2G8UA 3TANA 3IFRA 4BRAA 3WNFA 5DM6L 3O3GA 4DFPA 2F8SA 3SUOA 1TKTA 1LWFA 3ZT2A 4BR2A 2IDOA 3FZFA 4CW7B 4KHQA 3S41A 3FZKA 4CIGA 3G10A 1EWRA 1D9FA 4M3ZA 5FRNA 3OTOK 4BWJA 3ZSZA 3AO2A 4MDAA 5FPNA 3ZX3A 3CJAA 5E84A 5M1NA 4LY7A 3R3LA 1GLLO 1VK0A 3VESA 1VSEA 3K58A 1N6QA 4J2AA 1BQMA 1YF5L 1YHQN 1XC9A 2XY8A 1OH8A 1NBWA 5J2QA 2QM1A 4OO1J 2O8FB 3ZETA 3EZWA 4FWOA 3NF6A 2KZZA 4GKKK 1VSMA 1U47A 3ISNC 4K43A 1W2BM 4C8MA 5CYMA 2HHTA 2NLXA 2ATQA 5K14A 1QS4A 4FK0A 4CIEA 1QVGM 4CE9A 4WQ4A 1RBTA 3QEVA 1HNVA 3TTCA 4B3TK 4BGBA 4FPBA 3MWPA 2YHYA 3O80A 4CZHA 3RWUA 4BRLA 3LDNA 5M1FA 4H5RA 1HPMA 4ID1A 1IKYA 3PO4A 4DTNA 1WNSA 1ZBUA 3D2FB 5GAHP 1J6ZA 3O08A 4DB3A 3NVMA 3LDLA 3QO9A 4OPJA 2XY5A 2Q31A 3V9SA 3OJSA 1IO2A 4CD1A 2AJQA 1KXPA 4RTFD 3IS9A 1IBMK 4WQ5A 1HKCA 3V1QA 2QEXN 2VGNA 2A6AA 1MWMA 2V51B 4ELUA 3OA9A 3PSIA 4H4MA 4E7KA 2W6LA 2W6KA 3MEDA 3NF7A 1TAQA 1B9DA 4C1NI 1SL0A 3CF5L 4K25A 4H0VB 3GDQA 3FE1A 1CXUA 4FXDA 1O13A 4Z4FA 4MFBA 1ASVA 1YT3A 3MECA 4NYFA 5BPMA 4CGIA 3A5OC 1W9HA 4BC4A 1K8KB 3AVHA 3DI6A 3OYBA 1W7AA 3OYCA 3BF3A 3A5LC 1XUPO 4Q5VA 3THWB 1U4BA 1TKZA 5TKWA 3EL2A 3DAWA 3IUCA 2W42A 4JEPA 3QEIA 4N41A 3AAQA 4CZLA 1W0HA 1KVAA 3M8RA 1YJNN 5AZIB 3SK3A 4EHTA 3AVLA 4NYNA 4KHNA 1TAUA 2J4RA 2HBMA 1QSSA 5AQLA 2EX3A 1A5XA 3L3UA 1JKHA 1NJWA 3NH2A 3AA3A 3OYGA 1U6ZA 3LDSA 3CPEA 3L8BA 2XRIA 2ZWHA 5J2PA 2P9IB 4CJQA 4YOXA 1B9FA 4JS4A 2G8KA 1JLFA 4DS5A 3OBYA 2B5JA 4CFCA 4E1JA 1X9SA 4KHPK 1NJXA 2G8IA 4CGGA 1LW0A 5F1XA 5FROA 4J2EA 2Q0UA 4M7XA 3FZHA 2ZGYA 3HP9A 4JKGA 4FO0A 3ATVA 5AQOA 3BDPA 4JNEA 3E9PA 4E89A 1SAZA 4O5BA 3TTFA 4CF1A 2P9PB 5AQSA 3KVGA 2QWLA 1BISA 3VQ8A 2O4IA 5BPNA 1RBRA 3SQ4A 3LDOA 4FM1A 1VSKA 1SUQA 2XO7A 5GINA 1NNEA 4KRFA 3KKSA 2VWJA 2OPSA 3IDHA 1DT9A 3KLEA 2QXFA 3RVCA 3M8PA 4RW7A 4MQ3A 4MLHA 5GAEP 2LSNA 3MCPA 1T03A 3L2VA 3F5TA 4O0IA 3J7AP
chains in the Genus database with same CATH topology
4KTWA 3VQEA 1UA1A 1WSHA 1BI4B 3AA5X 3V9ZA 3CM6A 2F96A 3HYFA 3WNHA 3DLBA 4QOZB 3QESA 2KQ2A 4Z4HA 5CZ1A 1JLCA 2EHGA 4UQGA 2YHBA 3DLKA 3CFRA 4RW9A 3WNGA 5J2NA 4DQPA 4RG8A 2B4JA 4CEQA 3RRHA 4AHSA 2VG6A 3OS2A 1ZYQA 1NK6A 4QCLA 3ZSVA 1RILA 5E41A 1HYVA 1HNIA 1VSJA 1XI1A 4J2DA 4FJKA 2KTQA 4CHZA 4LH5A 4DQRA 3V81A 1LAWA 4BWMA 3AVIA 1S1WA 3OVNA 4FLWA 4FK0A 1HYSA 3AO4A 1KFSA 2HMIA 2ZQBA 4KFBA 3SI6A 4ZHRA 3O3FA 1HRHA 3VQ5A 2ITGA 4BE0A 1KFDA 3HSTB 3VA3A 3HP6A 1C1CA 3ZT0A 3JSMA 3CQ8A 3THVA 1KRPA 1YTUA 3OYLA 3KK2A 4DFMA 4L8RB 2P1JA 4IBNA 2HHVA 1TV6A 3E01A 4DTJA 1NKEA 4EZ9A 4KHWA 1F21A 5CY4A 3OYHA 3FFIA 4AILC 4F2RA 4CJRA 3IG1A 4CESA 4H4OA 1EXQA 2R7YA 4AH9A 4DSFA 1XHZA 4E3SA 3HPHA 4C8NA 4M45A 4FM0A 3TAMA 4E7HA 2Z1HA 1JXEA 3QEXA 4KI6A 1JL1A 4FW1A 3T3FA 1FK9A 3SPYA 3AVCA 3DOKA 1RTHA 3U3YA 1UWBA 4B08A 1SKWA 4E0DA 4F3OA 1N5YA 3P1GA 2YV0X 2DFEA 4KV8A 4W5TA 3TAFA 4LD0A 3MAQA 1WSJA 3L2UA 3B6PA 1JLQA 2Q3SA 1ZBLA 4OKJA 4FJLA 2HNZA 4LH4A 2HHWA 2YKNA 2Z1IA 2FBYA 3HJFA 4NCAA 1TVRA 1XHXA 4BDPA 4K8ZA 4KTQA 4HVJA 3LWLA 4KI4A 3OS0A 2D5RA 2Z1JA 1LV5A 3KK3A 3ULDA 1NK0A 1G15A 5KRSA 3K5OA 3T19A 1L5UA 2FBVA 3LAMA 1NKCA 1RT3A 4DMNA 3ZT1A 4JS5A 1NJZA 3B6OA 4HUEA 2RF2A 1EX4A 3F73A 3TI0A 1NK7A 4I2PA 4Y1CA 5J1EA 4CHNA 2G8HA 1WSGA 1IKXA 4FLTA 4FZXC 1ZBIA 2OPRA 1X9WA 4QAGA 4CJ4A 4Z4EA 1J5OA 4PWDA 4DTUA 1YVUA 3NH0A 3TWHA 3OJUA 4FLZA 3KLHA 3TAEA 2OPPA 3UIQA 3PO5A 4CK2A 4BDYA 1TK0A 4OKKA 3OYNA 3O3HA 1LAVA 4DF8A 2X6NA 4Z4GA 4XIUA 3WNEA 2G8FA 1C1BA 1RDCA 4DWIA 3SUQA 5C24A 3QIOA 1VSFA 1VSIA 4YFUA 4HTUA 4DQIA 1S6QA 2E6MA 3MEEA 1ASWA 3VQ4A 1KTQA 2DFHA 3HO1A 3V9XA 4KKOA 3I0RA 2QKBA 2P5GA 3TR8A 4I9QA 4CJLA 1U48A 4ELTA 3HK2A 4DSKA 3TAPA 4FVMA 4BDZA 4FZZA 3LALA 3DRPA 4B3OA 1WAFA 1LWEA 2YNFA 3MXIA 2PZSA 4E19A 4FJ8A 3KLFA 4FZYA 1QE1A 3RTVA 1TKXA 3SZ2A 1UA0A 3ZT4A 2OYQA 2Z1GA 1DTQA 5KGWA 1S9EA 3CFPA 1I39A 4AHRA 3QNNA 2PYLA 1O1WA 3U3GA 4CF0A 4M3RA 2KFZA 2I5JA 4IFVA 3LPUA 5KTQA 3AVGA 1BIUA 1JLBA 2P5OA 2E4LA 1RTIA 3OS1A 1T8EA 4O4GA 3QLHA 4KTZA 3LP2A 4C8KA 4B9TA 3OYKA 5JS2A 3MXJA 4W5RA 3SNNA 3NCIA 1SV5A 1QHTA 4OGCA 1NK8A 4E1NA 3P5JA 1WLJA 3DMJA 3KLGA 1JLEA 4YNQA 4CHPA 4AHVA 3LPTA 4O0JA 4CJSA 2G8WA 4F4KA 3QINA 4R5PA 4W5OA 2D0BA 4CGFA 1RTDA 1NKBA 2Y1JA 4CEZA 3ZCMA 2OA8A 1RDAA 4F3TA 4N76A 2WOMA 1CLQA 3JYTA 4BE2A 3L2QA 3DRRA 1EP4A 3CYMA 5CYQA 1Z26A 1C1AA 4CCHA 1BQNA 1RDBA 4CK3A 1D8YA 4HUFA 1X9MA 3K5NA 3LANA 3TABA 3O4QA 1J54A 3TARA 4FLUA 4DU3A 3LZIA 4KPYA 4DTXA 4KHYA 1BL3A 3SCXA 4W5NA 4CJ5A 2IOCA 4CJKA 1GOCA 1A5WA 4IKFA 1S1TA 5KRTA 5DK5A 2VWKA 4KB1A 4CJUA 2D0CA 3SUNA 1WSIA 4FJXA 1VRUA 1RNHA 1S9GA 1VSLA 3NF9A 3V9UA 1SL1A 4HCBA 4FLXA 1RBVA 3SQ0A 4FJIA 3PV8A 4CJPA 1RT7A 3HXMA 3D0PA 3HPOA 4DLEA 4K8XA 3SJJA 3RR8A 3NFAA 1CXQA 2WONA 4FJMA 1YTAA 4IDKA 3VQ6A 2KFNA 2FBXA 2XY7A 1Z25A 3ZSXA 4CFAA 4CEBA 3C95A 3D45A 1BGXT 3AVNA 3MXMA 2P51A 1RT2A 3ZSOA 3HVTA 1IKWA 3AO1A 1LWCA 2GV9A 1BI4A 3I0SA 4CECA 1Q8IA 2VG5A 3NAEA 2RKIA 4IG0A 2DTUA 5SZTA 1GOBA 3SUPA 3HPGA 3VQDA 4AHTA 1FKOA 4HHTA 1J53A 3DLGA 3H08A 1RT6A 3ASMA 4ID5A 5C25A 4DTRA 3ALYA 3K59A 1L3SA 4GW6A 4KAZA 1J9AA 1NK5A 3DLRA 3ZT3A 4CEEA 3AA4A 1JXBA 4EP4A 1NOYA 4CHOA 3CFOA 3TAGA 3NHGA 1CZ9A 3SV3A 4E1MA 2BDPA 2BE2A 1WAJA 1Q9YA 4KO0A 2HB5A 3AVKA 4F2SA 3SQ1A 3RRGA 4BACA 2NUBA 1KLMA 3ZSRA 4C8LA 4DU1A 4FJNA 2ZD1A 3CM5A 3NH1A 1QSYA 2G8UA 2F8TA 2HNDA 3ZSQA 3ZSWA 3TANA 2GBZA 4B9LA 3WNFA 3O3GA 1S1UA 4DFPA 3L3VA 2F8SA 1VSHA 3SUOA 2KZMA 1U49A 4DQQA 4OLAA 1TKTA 4CHQA 1LWFA 1NOZA 3ZT2A 1RT4A 1EKEA 2IDOA 1KCFA 4M3YA 4B9UA 1Y97A 3V1RA 4I9LA 4KHQA 5J2MA 1TGOA 4M3TA 4CIGA 3G10A 1RTJA 4IFYA 4ICLA 3SQ2A 1T7PA 1D9FA 4M3ZA 4HUGA 5FRNA 3V4IA 4BWJA 3ZSZA 3KLIA 3AO2A 4AHCA 4G1QA 2YNHA 3VN5A 3HVRA 3VA0A 2JLEA 3AVJA 4LY7A 4CGHA 3M8QA 1VK0A 1VSEA 2FBTA 4JLHA 3VQBA 4CJEA 1JLAA 3K58A 1N6QA 4J2AA 3SV4A 1S1VA 1BQMA 1WN7A 4DSLA 1XC9A 2XY8A 5J2QA 5D3GA 4JRQA 2DY4A 4Z0UA 2A1RA 3AO3A 3NF6A 3S9HA 2KZZA 1HYZA 1VSMA 4CGJA 3ISNC 1U47A 1VSDA 3RMBA 4B9NA 3S3NA 4KHUA 1D5AA 1I3AA 3VQPA 3L2WA 2OZSA 4C8MA 3DYAA 3I8DA 3PX6A 3OYFA 1ZBHA 2PY5A 4ELVA 5CYMA 4CF9A 2HHTA 2IAJA 3QIPA 2BGGA 3AVAA 3V9WA 2ATQA 3KKRA 5K14A 1T05A 1QS4A 4DTMA 2XHBA 3L2RA 4E7IA 1RBSA 2ZE2A 3T1AA 3ZSYA 4CE9A 4CIEA 3M8SA 4CIFA 3RMAA 5I3UA 2D0AA 1RBTA 3P83D 5HRSA 1TKDA 2HVIA 3VQAA 3HT3A 3OYEA 4CHYA 3OYJA 3QEVA 4M3XA 4M41A 4E7JA 1HNVA 5CZ2A 1IKVA 3PUFA 1SKSA 1KLNA 4B9MA 3NGYA 1BCMA 4OPKA 1KSPA 3HM9A 3RWUA 1B92A 4OLBA 4LSLA 4E7LA 2B6AA 2X74A 5HRNA 5I42A 1GOAA 5FDLA 4RW6A 4M3UA 3QERA 1BIZA 3NGZA 4ID1A 2JGUA 1IKYA 3LAKA 5FRMA 3OYMA 2QKKA 3NGIA 3PO4A 4DTNA 5HP1A 1HJRA 2IGIA 3KJVA 4FJHA 4DTSA 2HW3A 1WNSA 1ZBUA 3VQ9A 5HRRA 4N47A 3U6FA 3QNOA 1LW2A 3ITHA 4DLGA 1QSLA 1REVA 3LP0A 3TAQA 3MEGA 3V1OA 1S6PA 4CJVA 2KW4A 3QO9A 4OPJA 2X78A 2XY5A 4CEDA 4F8RA 4FJGA 4CERA 1XWLA 3OJSA 1IO2A 3V9SA 1HQEA 1TL3A 4FJ7A 2PYJA 1RT5A 3EY1A 2AJQA 1U04A 3S3OA 3IAYA 3IS9A 4GVMA 2Y1IA 3PX0A 1MU2A 3RMCA 4WE1A 1RT1A 1WSEA 3V1QA 2A1SA 4FK2A 3NF8A 4CJTA 3K57A 4ELUA 4H4MA 4E7KA 3K5LA 3OYDA 3A2FA 3DM2A 3MEDA 3NF7A 5HLFA 1L3TA 1TAQA 1B9DA 4O0IA 3LZJA 4CEFA 4JRPA 1RCHA 1NK9A 1C0MA 1SL0A 4ZTFA 3K2PA 5SWMA 3C6UA 3IRXA 3DLEA 4FW2A 4PY5A 2RN2A 3DRSA 3KD5E 4M3WA 3OYAA 3AO5A 1CXUA 1QQCA 2E6LA 3LWMA 4FXDA 3AVMA 4KHSA 2HHXA 4Z4FA 4LSNA 5HRPA 3LP1A 3AA2A 1TK5A 2YKMA 2X6SA 4MFBA 4OGEA 1ASVA 1YT3A 3MECA 4NYFA 3QETA 1TK8A 4CGIA 1W9HA 1SKRA 4FCYA 1EETA 1UOCA 4DG1A 4DQSA 4DFJA 4KREA 2HVHA 2IC3A 3AVHA 5C42A 1HMVA 3DI6A 4N56A 3OYBA 4DF4A 3OYCA 1KVBA 1C0UA 4Q5VA 3EYZA 1U45A 2GUIA 1U4BA 1TKZA 1ZBFA 4PA1A 1NJYA 4CF8A 1X1PA 3SPZA 2W42A 3QEIA 4CFDA 4N41A 3DLHA 4BE1A 4EZ6A 2HNYA 4RW8A 3VQQA 1W0HA 1KVAA 4DSEA 3S3MA 1DTTA 3M8RA 3EZ5A 1K6YA 1WSFA 3VQCA 5KGXA 3KK1A 4C8OA 4FLYA 1KVCA 2RPIA 4OKEA 3KTQA 4FK4A 1BHLA 2DFFA 4PQUA 1HQUA 1C6VA 4NCGA 3AVLA 4NYNA 5HBMA 2QK9A 4B9VA 2VG7A 2OPQA 4CGDA 3NE6A 4FJJA 4FJ5A 4KHNA 1QSSA 2HHUA 1TAUA 4B8CA 2EX3A 4FM2A 1A5XA 3AV9A 3L3UA 1JKHA 3VQ7A 1Q9XA 1NJWA 3C94A 3NH2A 3AA3A 1RBUA 4OJRA 3OYGA 1IH7A 2YNGA 3BGRA 3LDSA 4FLVA 1A5VA 1TL1A 3AVBA 3PY8A 4DTPA 2HHSA 4KB0A 3L8BA 2XRIA 2YHAA 4CJ3A 2YNIA 5J2PA 4FYDA 1UAXA 5DMRA 4CK1A 4W5QA 4O44A 3G0ZA 4CJQA 3O4NA 4B8AB 1B9FA 4JS4A 2G8KA 1JLFA 2ETJA 4DS5A 2O4GA 4CEAA 3NDKA 1HPZA 1L3UA 2B5JA 4IG3A 4CFCA 1QTMA 4J2BA 3RR7A 4EP5A 4OVLA 3K5MA 3QEWA 3AVFA 3RMDA 1DLOA 1X9SA 1NK4A 1NJXA 4PUOA 1C0TA 4CGGA 1LW0A 3DOLA 5FROA 4DSJA 2G8IA 4J2EA 4HCCA 2HHQA 3F9KA 4CJFA 3C6TA 3LP3A 3HL8A 3PX4A 1D9DA 4DSIA 1S5JA 1S1XA 1R0AA 3HP9A 2IS3A 3QEPA 3BDPA 3SYZA 1JLGA 4E89A 1FKPA 3KIOA 4O5BA 5HROA 4CF1A 1L3VA 3OYIA 2G8VA 4M42A 4Z4IA 1BISA 4FJ9A 3V6DA 1JL2A 3VQ8A 2O4IA 4Y1DA 1RBRA 5EU7A 1ASUA 4O55A 4TSXA 3SQ4A 4FM1A 1VSKA 1SUQA 2XO7A 1BCOA 4CF2A 1RDDA 4RW4A 4DU4A 5JS1A 4GMJB 4CJWA 4N5SA 4DS4A 4KRFA 4H8KA 1FXXA 3KKSA 2VWJA 2OPSA 4DFKA 3KD1E 3KLEA 2XY6A 5T7BA 3OY9A 4B9SA 2QXFA 1ITGA 4I2QA 3M8PA 4RW7A 4MQ3A 1IG9A 1CZBA 4DTOA 1SL2A 2FC0A 2OZMA 2LSNA 4ZTJA 1T03A 3L2VA 4AHUA 4Q0BA 3NBPA 2BANA 5KI6A 4NCBA 4CFBA 4CEOA 4Z4CA 1VRTA 4I7FA 3CG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KTW A;  3VQE A;  1UA1 A;  1WSH A;  1BI4 B;  3AA5 X;  3V9Z A;  3CM6 A;  2F96 A;  3HYF A;  3WNH A;  3DLB A;  4QOZ B;  3QES A;  2KQ2 A;  4Z4H A;  5CZ1 A;  1JLC A;  2EHG A;  4UQG A;  2YHB A;  3DLK A;  3CFR A;  4RW9 A;  3WNG A;  5J2N A;  4DQP A;  4RG8 A;  2B4J A;  4CEQ A;  3RRH A;  4AHS A;  2VG6 A;  3OS2 A;  1ZYQ A;  1NK6 A;  4QCL A;  3ZSV A;  1RIL A;  5E41 A;  1HYV A;  1HNI A;  1VSJ A;  1XI1 A;  4J2D A;  4FJK A;  2KTQ A;  4CHZ A;  4LH5 A;  4DQR A;  3V81 A;  1LAW A;  4BWM A;  3AVI A;  1S1W A;  3OVN A;  4FLW A;  4FK0 A;  1HYS A;  3AO4 A;  1KFS A;  2HMI A;  2ZQB A;  4KFB A;  3SI6 A;  4ZHR A;  3O3F A;  1HRH A;  3VQ5 A;  2ITG A;  4BE0 A;  1KFD A;  3HST B;  3VA3 A;  3HP6 A;  1C1C A;  3ZT0 A;  3JSM A;  3CQ8 A;  3THV A;  1KRP A;  1YTU A;  3OYL A;  3KK2 A;  4DFM A;  4L8R B;  2P1J A;  4IBN A;  2HHV A;  1TV6 A;  3E01 A;  4DTJ A;  1NKE A;  4EZ9 A;  4KHW A;  1F21 A;  5CY4 A;  3OYH A;  3FFI A;  4AIL C;  4F2R A;  4CJR A;  3IG1 A;  4CES A;  4H4O A;  1EXQ A;  2R7Y A;  4AH9 A;  4DSF A;  1XHZ A;  4E3S A;  3HPH A;  4C8N A;  4M45 A;  4FM0 A;  3TAM A;  4E7H A;  2Z1H A;  1JXE A;  3QEX A;  4KI6 A;  1JL1 A;  4FW1 A;  3T3F A;  1FK9 A;  3SPY A;  3AVC A;  3DOK A;  1RTH A;  3U3Y A;  1UWB A;  4B08 A;  1SKW A;  4E0D A;  4F3O A;  1N5Y A;  3P1G A;  2YV0 X;  2DFE A;  4KV8 A;  4W5T A;  3TAF A;  4LD0 A;  3MAQ A;  1WSJ A;  3L2U A;  3B6P A;  1JLQ A;  2Q3S A;  1ZBL A;  4OKJ A;  4FJL A;  2HNZ A;  4LH4 A;  2HHW A;  2YKN A;  2Z1I A;  2FBY A;  3HJF A;  4NCA A;  1TVR A;  1XHX A;  4BDP A;  4K8Z A;  4KTQ A;  4HVJ A;  3LWL A;  4KI4 A;  3OS0 A;  2D5R A;  2Z1J A;  1LV5 A;  3KK3 A;  3ULD A;  1NK0 A;  1G15 A;  5KRS A;  3K5O A;  3T19 A;  1L5U A;  2FBV A;  3LAM A;  1NKC A;  1RT3 A;  4DMN A;  3ZT1 A;  4JS5 A;  1NJZ A;  3B6O A;  4HUE A;  2RF2 A;  1EX4 A;  3F73 A;  3TI0 A;  1NK7 A;  4I2P A;  4Y1C A;  5J1E A;  4CHN A;  2G8H A;  1WSG A;  1IKX A;  4FLT A;  4FZX C;  1ZBI A;  2OPR A;  1X9W A;  4QAG A;  4CJ4 A;  4Z4E A;  1J5O A;  4PWD A;  4DTU A;  1YVU A;  3NH0 A;  3TWH A;  3OJU A;  4FLZ A;  3KLH A;  3TAE A;  2OPP A;  3UIQ A;  3PO5 A;  4CK2 A;  4BDY A;  1TK0 A;  4OKK A;  3OYN A;  3O3H A;  1LAV A;  4DF8 A;  2X6N A;  4Z4G A;  4XIU A;  3WNE A;  2G8F A;  1C1B A;  1RDC A;  4DWI A;  3SUQ A;  5C24 A;  3QIO A;  1VSF A;  1VSI A;  4YFU A;  4HTU A;  4DQI A;  1S6Q A;  2E6M A;  3MEE A;  1ASW A;  3VQ4 A;  1KTQ A;  2DFH A;  3HO1 A;  3V9X A;  4KKO A;  3I0R A;  2QKB A;  2P5G A;  3TR8 A;  4I9Q A;  4CJL A;  1U48 A;  4ELT A;  3HK2 A;  4DSK A;  3TAP A;  4FVM A;  4BDZ A;  4FZZ A;  3LAL A;  3DRP A;  4B3O A;  1WAF A;  1LWE A;  2YNF A;  3MXI A;  2PZS A;  4E19 A;  4FJ8 A;  3KLF A;  4FZY A;  1QE1 A;  3RTV A;  1TKX A;  3SZ2 A;  1UA0 A;  3ZT4 A;  2OYQ A;  2Z1G A;  1DTQ A;  5KGW A;  1S9E A;  3CFP A;  1I39 A;  4AHR A;  3QNN A;  2PYL A;  1O1W A;  3U3G A;  4CF0 A;  4M3R A;  2KFZ A;  2I5J A;  4IFV A;  3LPU A;  5KTQ A;  3AVG A;  1BIU A;  1JLB A;  2P5O A;  2E4L A;  1RTI A;  3OS1 A;  1T8E A;  4O4G A;  3QLH A;  4KTZ A;  3LP2 A;  4C8K A;  4B9T A;  3OYK A;  5JS2 A;  3MXJ A;  4W5R A;  3SNN A;  3NCI A;  1SV5 A;  1QHT A;  4OGC A;  1NK8 A;  4E1N A;  3P5J A;  1WLJ A;  3DMJ A;  3KLG A;  1JLE A;  4YNQ A;  4CHP A;  4AHV A;  3LPT A;  4O0J A;  4CJS A;  2G8W A;  4F4K A;  3QIN A;  4R5P A;  4W5O A;  2D0B A;  4CGF A;  1RTD A;  1NKB A;  2Y1J A;  4CEZ A;  3ZCM A;  2OA8 A;  1RDA A;  4F3T A;  4N76 A;  2WOM A;  1CLQ A;  3JYT A;  4BE2 A;  3L2Q A;  3DRR A;  1EP4 A;  3CYM A;  5CYQ A;  1Z26 A;  1C1A A;  4CCH A;  1BQN A;  1RDB A;  4CK3 A;  1D8Y A;  4HUF A;  1X9M A;  3K5N A;  3LAN A;  3TAB A;  3O4Q A;  1J54 A;  3TAR A;  4FLU A;  4DU3 A;  3LZI A;  4KPY A;  4DTX A;  4KHY A;  1BL3 A;  3SCX A;  4W5N A;  4CJ5 A;  2IOC A;  4CJK A;  1GOC A;  1A5W A;  4IKF A;  1S1T A;  5KRT A;  5DK5 A;  2VWK A;  4KB1 A;  4CJU A;  2D0C A;  3SUN A;  1WSI A;  4FJX A;  1VRU A;  1RNH A;  1S9G A;  1VSL A;  3NF9 A;  3V9U A;  1SL1 A;  4HCB A;  4FLX A;  1RBV A;  3SQ0 A;  4FJI A;  3PV8 A;  4CJP A;  1RT7 A;  3HXM A;  3D0P A;  3HPO A;  4DLE A;  4K8X A;  3SJJ A;  3RR8 A;  3NFA A;  1CXQ A;  2WON A;  4FJM A;  1YTA A;  4IDK A;  3VQ6 A;  2KFN A;  2FBX A;  2XY7 A;  1Z25 A;  3ZSX A;  4CFA A;  4CEB A;  3C95 A;  3D45 A;  1BGX T;  3AVN A;  3MXM A;  2P51 A;  1RT2 A;  3ZSO A;  3HVT A;  1IKW A;  3AO1 A;  1LWC A;  2GV9 A;  1BI4 A;  3I0S A;  4CEC A;  1Q8I A;  2VG5 A;  3NAE A;  2RKI A;  4IG0 A;  2DTU A;  5SZT A;  1GOB A;  3SUP A;  3HPG A;  3VQD A;  4AHT A;  1FKO A;  4HHT A;  1J53 A;  3DLG A;  3H08 A;  1RT6 A;  3ASM A;  4ID5 A;  5C25 A;  4DTR A;  3ALY A;  3K59 A;  1L3S A;  4GW6 A;  4KAZ A;  1J9A A;  1NK5 A;  3DLR A;  3ZT3 A;  4CEE A;  3AA4 A;  1JXB A;  4EP4 A;  1NOY A;  4CHO A;  3CFO A;  3TAG A;  3NHG A;  1CZ9 A;  3SV3 A;  4E1M A;  2BDP A;  2BE2 A;  1WAJ A;  1Q9Y A;  4KO0 A;  2HB5 A;  3AVK A;  4F2S A;  3SQ1 A;  3RRG A;  4BAC A;  2NUB A;  1KLM A;  3ZSR A;  4C8L A;  4DU1 A;  4FJN A;  2ZD1 A;  3CM5 A;  3NH1 A;  1QSY A;  2G8U A;  2F8T A;  2HND A;  3ZSQ A;  3ZSW A;  3TAN A;  2GBZ A;  4B9L A;  3WNF A;  3O3G A;  1S1U A;  4DFP A;  3L3V A;  2F8S A;  1VSH A;  3SUO A;  2KZM A;  1U49 A;  4DQQ A;  4OLA A;  1TKT A;  4CHQ A;  1LWF A;  1NOZ A;  3ZT2 A;  1RT4 A;  1EKE A;  2IDO A;  1KCF A;  4M3Y A;  4B9U A;  1Y97 A;  3V1R A;  4I9L A;  4KHQ A;  5J2M A;  1TGO A;  4M3T A;  4CIG A;  3G10 A;  1RTJ A;  4IFY A;  4ICL A;  3SQ2 A;  1T7P A;  1D9F A;  4M3Z A;  4HUG A;  5FRN A;  3V4I A;  4BWJ A;  3ZSZ A;  3KLI A;  3AO2 A;  4AHC A;  4G1Q A;  2YNH A;  3VN5 A;  3HVR A;  3VA0 A;  2JLE A;  3AVJ A;  4LY7 A;  4CGH A;  3M8Q A;  1VK0 A;  1VSE A;  2FBT A;  4JLH A;  3VQB A;  4CJE A;  1JLA A;  3K58 A;  1N6Q A;  4J2A A;  3SV4 A;  1S1V A;  1BQM A;  1WN7 A;  4DSL A;  1XC9 A;  2XY8 A;  5J2Q A;  5D3G A;  4JRQ A;  2DY4 A;  4Z0U A;  2A1R A;  3AO3 A;  3NF6 A;  3S9H A;  2KZZ A;  1HYZ A;  1VSM A;  4CGJ A;  3ISN C;  1U47 A;  1VSD A;  3RMB A;  4B9N A;  3S3N A;  4KHU A;  1D5A A;  1I3A A;  3VQP A;  3L2W A;  2OZS A;  4C8M A;  3DYA A;  3I8D A;  3PX6 A;  3OYF A;  1ZBH A;  2PY5 A;  4ELV A;  5CYM A;  4CF9 A;  2HHT A;  2IAJ A;  3QIP A;  2BGG A;  3AVA A;  3V9W A;  2ATQ A;  3KKR A;  5K14 A;  1T05 A;  1QS4 A;  4DTM A;  2XHB A;  3L2R A;  4E7I A;  1RBS A;  2ZE2 A;  3T1A A;  3ZSY A;  4CE9 A;  4CIE A;  3M8S A;  4CIF A;  3RMA A;  5I3U A;  2D0A A;  1RBT A;  3P83 D;  5HRS A;  1TKD A;  2HVI A;  3VQA A;  3HT3 A;  3OYE A;  4CHY A;  3OYJ A;  3QEV A;  4M3X A;  4M41 A;  4E7J A;  1HNV A;  5CZ2 A;  1IKV A;  3PUF A;  1SKS A;  1KLN A;  4B9M A;  3NGY A;  1BCM A;  4OPK A;  1KSP A;  3HM9 A;  3RWU A;  1B92 A;  4OLB A;  4LSL A;  4E7L A;  2B6A A;  2X74 A;  5HRN A;  5I42 A;  1GOA A;  5FDL A;  4RW6 A;  4M3U A;  3QER A;  1BIZ A;  3NGZ A;  4ID1 A;  2JGU A;  1IKY A;  3LAK A;  5FRM A;  3OYM A;  2QKK A;  3NGI A;  3PO4 A;  4DTN A;  5HP1 A;  1HJR A;  2IGI A;  3KJV A;  4FJH A;  4DTS A;  2HW3 A;  1WNS A;  1ZBU A;  3VQ9 A;  5HRR A;  4N47 A;  3U6F A;  3QNO A;  1LW2 A;  3ITH A;  4DLG A;  1QSL A;  1REV A;  3LP0 A;  3TAQ A;  3MEG A;  3V1O A;  1S6P A;  4CJV A;  2KW4 A;  3QO9 A;  4OPJ A;  2X78 A;  2XY5 A;  4CED A;  4F8R A;  4FJG A;  4CER A;  1XWL A;  3OJS A;  1IO2 A;  3V9S A;  1HQE A;  1TL3 A;  4FJ7 A;  2PYJ A;  1RT5 A;  3EY1 A;  2AJQ A;  1U04 A;  3S3O A;  3IAY A;  3IS9 A;  4GVM A;  2Y1I A;  3PX0 A;  1MU2 A;  3RMC A;  4WE1 A;  1RT1 A;  1WSE A;  3V1Q A;  2A1S A;  4FK2 A;  3NF8 A;  4CJT A;  3K57 A;  4ELU A;  4H4M A;  4E7K A;  3K5L A;  3OYD A;  3A2F A;  3DM2 A;  3MED A;  3NF7 A;  5HLF A;  1L3T A;  1TAQ A;  1B9D A;  4O0I A;  3LZJ A;  4CEF A;  4JRP A;  1RCH A;  1NK9 A;  1C0M A;  1SL0 A;  4ZTF A;  3K2P A;  5SWM A;  3C6U A;  3IRX A;  3DLE A;  4FW2 A;  4PY5 A;  2RN2 A;  3DRS A;  3KD5 E;  4M3W A;  3OYA A;  3AO5 A;  1CXU A;  1QQC A;  2E6L A;  3LWM A;  4FXD A;  3AVM A;  4KHS A;  2HHX A;  4Z4F A;  4LSN A;  5HRP A;  3LP1 A;  3AA2 A;  1TK5 A;  2YKM A;  2X6S A;  4MFB A;  4OGE A;  1ASV A;  1YT3 A;  3MEC A;  4NYF A;  3QET A;  1TK8 A;  4CGI A;  1W9H A;  1SKR A;  4FCY A;  1EET A;  1UOC A;  4DG1 A;  4DQS A;  4DFJ A;  4KRE A;  2HVH A;  2IC3 A;  3AVH A;  5C42 A;  1HMV A;  3DI6 A;  4N56 A;  3OYB A;  4DF4 A;  3OYC A;  1KVB A;  1C0U A;  4Q5V A;  3EYZ A;  1U45 A;  2GUI A;  1U4B A;  1TKZ A;  1ZBF A;  4PA1 A;  1NJY A;  4CF8 A;  1X1P A;  3SPZ A;  2W42 A;  3QEI A;  4CFD A;  4N41 A;  3DLH A;  4BE1 A;  4EZ6 A;  2HNY A;  4RW8 A;  3VQQ A;  1W0H A;  1KVA A;  4DSE A;  3S3M A;  1DTT A;  3M8R A;  3EZ5 A;  1K6Y A;  1WSF A;  3VQC A;  5KGX A;  3KK1 A;  4C8O A;  4FLY A;  1KVC A;  2RPI A;  4OKE A;  3KTQ A;  4FK4 A;  1BHL A;  2DFF A;  4PQU A;  1HQU A;  1C6V A;  4NCG A;  3AVL A;  4NYN A;  5HBM A;  2QK9 A;  4B9V A;  2VG7 A;  2OPQ A;  4CGD A;  3NE6 A;  4FJJ A;  4FJ5 A;  4KHN A;  1QSS A;  2HHU A;  1TAU A;  4B8C A;  2EX3 A;  4FM2 A;  1A5X A;  3AV9 A;  3L3U A;  1JKH A;  3VQ7 A;  1Q9X A;  1NJW A;  3C94 A;  3NH2 A;  3AA3 A;  1RBU A;  4OJR A;  3OYG A;  1IH7 A;  2YNG A;  3BGR A;  3LDS A;  4FLV A;  1A5V A;  1TL1 A;  3AVB A;  3PY8 A;  4DTP A;  2HHS A;  4KB0 A;  3L8B A;  2XRI A;  2YHA A;  4CJ3 A;  2YNI A;  5J2P A;  4FYD A;  1UAX A;  5DMR A;  4CK1 A;  4W5Q A;  4O44 A;  3G0Z A;  4CJQ A;  3O4N A;  4B8A B;  1B9F A;  4JS4 A;  2G8K A;  1JLF A;  2ETJ A;  4DS5 A;  2O4G A;  4CEA A;  3NDK A;  1HPZ A;  1L3U A;  2B5J A;  4IG3 A;  4CFC A;  1QTM A;  4J2B A;  3RR7 A;  4EP5 A;  4OVL A;  3K5M A;  3QEW A;  3AVF A;  3RMD A;  1DLO A;  1X9S A;  1NK4 A;  1NJX A;  4PUO A;  1C0T A;  4CGG A;  1LW0 A;  3DOL A;  5FRO A;  4DSJ A;  2G8I A;  4J2E A;  4HCC A;  2HHQ A;  3F9K A;  4CJF A;  3C6T A;  3LP3 A;  3HL8 A;  3PX4 A;  1D9D A;  4DSI A;  1S5J A;  1S1X A;  1R0A A;  3HP9 A;  2IS3 A;  3QEP A;  3BDP A;  3SYZ A;  1JLG A;  4E89 A;  1FKP A;  3KIO A;  4O5B A;  5HRO A;  4CF1 A;  1L3V A;  3OYI A;  2G8V A;  4M42 A;  4Z4I A;  1BIS A;  4FJ9 A;  3V6D A;  1JL2 A;  3VQ8 A;  2O4I A;  4Y1D A;  1RBR A;  5EU7 A;  1ASU A;  4O55 A;  4TSX A;  3SQ4 A;  4FM1 A;  1VSK A;  1SUQ A;  2XO7 A;  1BCO A;  4CF2 A;  1RDD A;  4RW4 A;  4DU4 A;  5JS1 A;  4GMJ B;  4CJW A;  4N5S A;  4DS4 A;  4KRF A;  4H8K A;  1FXX A;  3KKS A;  2VWJ A;  2OPS A;  4DFK A;  3KD1 E;  3KLE A;  2XY6 A;  5T7B A;  3OY9 A;  4B9S A;  2QXF A;  1ITG A;  4I2Q A;  3M8P A;  4RW7 A;  4MQ3 A;  1IG9 A;  1CZB A;  4DTO A;  1SL2 A;  2FC0 A;  2OZM A;  2LSN A;  4ZTJ A;  1T03 A;  3L2V A;  4AHU A;  4Q0B A;  3NBP A;  2BAN A;  5KI6 A;  4NCB A;  4CFB A;  4CEO A;  4Z4C A;  1VRT A;  4I7F A;  3CG7 A; 
#chains in the Genus database with same CATH topology
 4KTW A;  1UA1 A;  1WSH A;  1BI4 B;  5C10 A;  2F96 A;  3HYF A;  3IMX A;  5F2R A;  5LL6 Z;  4FSV A;  1XMO K;  1MA9 B;  5C0Y A;  4UQG A;  2YHB A;  5J2N A;  4DQP A;  4RW9 A;  4RG8 A;  4CEQ A;  1HYV A;  5EOY A;  4DQR A;  5C12 A;  4IWV A;  3SAF A;  1HYS A;  1KFS A;  3SI6 A;  4ZHR A;  3O3F A;  1HRH A;  3HST B;  4FWK A;  1KRP A;  3ZT0 A;  3CQ8 A;  4DFM A;  3E66 A;  2P1J A;  3MN5 A;  4H0O A;  5CY4 A;  2YHX A;  5KQ8 A;  3JS6 A;  3HPH A;  3ID6 A;  4C8N A;  1KQS M;  3QEX A;  4KI6 A;  2Z1H A;  1JXE A;  4NB4 A;  4FW1 A;  3AGR A;  3SPY A;  1FK9 A;  3AVC A;  3DOK A;  2YJF A;  3U3Y A;  4V19 S;  1BA0 A;  4B08 A;  1SKW A;  3CCS N;  2UUC K;  1N5Y A;  2NRX A;  1YJ9 N;  4YOV A;  3E9O A;  4W5T A;  1Z6R A;  4LD0 A;  2CH5 A;  4HWI A;  3MWT A;  3B6P A;  2HNZ A;  4LH4 A;  2HHW A;  2FSN A;  2Z1I A;  4NCA A;  1TVR A;  4BDP A;  1SQK A;  4HVJ A;  3HM8 A;  3O4W A;  4U7B A;  4KI4 A;  2FBV A;  5JLH A;  1RT3 A;  4DMN A;  1NJZ A;  1XNQ K;  3B6O A;  2RF2 A;  4CJ7 A;  4XEI A;  5J1E A;  5HL7 L;  4Z4E A;  1V4T A;  3THX A;  1YVU A;  3NH0 A;  4FLZ A;  3OJU A;  4FOE A;  1JJ2 M;  2PFU A;  3O3H A;  4A5B A;  1C1B A;  1RDC A;  4DWI A;  3SUQ A;  3TSQ A;  1NWK A;  1VSF A;  4YFU A;  4HTU A;  2YI1 A;  3HO1 A;  1NLV A;  3V9X A;  2QKB A;  2P5G A;  1E4F T;  3TR8 A;  2WTU A;  4DSK A;  3HK2 A;  3EE9 A;  5FPM A;  4IO8 A;  3DRP A;  3MXI A;  2PZS A;  4E19 A;  3HOS A;  3CC4 N;  1TKX A;  3ZT4 A;  1FW6 A;  4LF8 K;  1NGE A;  1DTQ A;  1I39 A;  4AHR A;  1Q81 O;  4CZM A;  1GLA G;  2F4V K;  1OVQ A;  5M1K A;  5KTQ A;  2O8D B;  4DV2 K;  1RTI A;  3RSE B;  3UKR B;  3OYK A;  2FF3 B;  4DR1 K;  3NCI A;  4BR4 A;  1VQM N;  3LM9 A;  4B1Y B;  1JLE A;  4YNQ A;  4AHV A;  4O0J A;  4FOI A;  3QB0 A;  4CJS A;  3DLL L;  4CEZ A;  3ZCM A;  1RDA A;  4BE2 A;  3WXM B;  3O1B A;  3EKU A;  1X9M A;  4DQ8 A;  3HOT A;  3LAN A;  4BRK A;  3TAB A;  3TAR A;  4FLU A;  4DTX A;  1QHA A;  2BTF A;  1BL3 A;  2IOC A;  2P9K A;  1GOC A;  2ASP A;  4IO9 L;  1MDU B;  4DV6 K;  4CJU A;  3SUN A;  4EIA A;  1RNH A;  3K0S A;  3T1Y K;  4BRF A;  2P9N A;  4FJI A;  1RBV A;  4HCB A;  4I6M B;  4DLE A;  3QFU A;  2QWM A;  3ENO A;  3SJJ A;  3RR8 A;  2KFN A;  1Z25 A;  4A57 A;  1BGX T;  3DXK A;  2GV9 A;  3NAE A;  2RKI A;  5ADX A;  1GOB A;  1NGA A;  3I56 N;  3DLG A;  3FZL A;  3H46 O;  5C25 A;  4DTR A;  1L3S A;  4GW6 A;  1XNR K;  1KAZ A;  1VAZ A;  1JCF A;  4EP4 A;  1NOY A;  3CFO A;  3NHG A;  2VQF K;  3ENH A;  2BDP A;  2BE2 A;  5ADX H;  1VQP N;  1WAJ A;  2UXB K;  3RRG A;  1KAX A;  4FJN A;  4WYB A;  3C7N A;  4K41 A;  2KKZ A;  4B9L A;  2GBZ A;  1S1U A;  3L3V A;  4BRP A;  5JMV A;  4OLA A;  1NOZ A;  1EKE A;  1IBK K;  1KCF A;  4M3Y A;  5AQF A;  1Y97 A;  3BY5 A;  4GV9 A;  4I9L A;  1NMN A;  4M3T A;  4O5F A;  1X3N A;  1DKG D;  1RTJ A;  3SQ2 A;  3O9T A;  4PHT X;  4AHC A;  4G1Q A;  2D4W A;  3PSF A;  4IFE A;  3HVR A;  3AVJ A;  4CGH A;  5A2Q O;  3J7Y P;  3VQB A;  2D0P A;  1JLA A;  3SV4 A;  4B1W B;  4DSL A;  5EVZ A;  2E88 A;  1M1K O;  2O8E B;  2PAV A;  1TYQ A;  4Z0U A;  4CVN E;  3CCV N;  4JHD A;  3T1H K;  1VQ7 N;  4ISG A;  1QVF M;  3RMB A;  4B9N A;  3S3N A;  1WOQ A;  3L2W A;  3I8D A;  2A40 A;  3R8E A;  3EEQ A;  2PY5 A;  2UXD K;  1OH5 A;  4DTM A;  2XHB A;  3L2R A;  3RMA A;  1YUW A;  2D0A A;  1N32 K;  5HRS A;  5EY4 A;  4BRG A;  3HT3 A;  5BRE A;  4CHY A;  3OYE A;  3OYJ A;  4M41 A;  3CPW M;  1T3V A;  5AQQ A;  1KLN A;  5M1O A;  3VTH A;  3NGY A;  4B9M A;  3VER A;  3A0I X;  4LF9 K;  2IIR A;  4LSL A;  2Q36 A;  5C2D A;  2ASM A;  4LF7 K;  4RW6 A;  2P9N B;  1NG9 A;  2JGU A;  5FRM A;  3OYM A;  5AQW A;  3DXM B;  1EO1 A;  2GWK A;  3KJV A;  4FJH A;  2BUP A;  2I7N A;  3VQ9 A;  3QNO A;  1LW2 A;  4DLG A;  1VQO N;  1REV A;  5GIP A;  4H0Y B;  3TAQ A;  3V1O A;  1S6P A;  4CJV A;  4FJG A;  1EWQ A;  4KBO A;  2QTD A;  3BZC A;  1HQE A;  1TL3 A;  4JKF A;  5AFU A;  3IAY A;  4GVM A;  4NO7 A;  4WE1 A;  1RT1 A;  1WSE A;  4FK2 A;  3K57 A;  1L3T A;  3A2F A;  1ZC6 A;  4JRP A;  1RCH A;  3BP8 A;  4ZTF A;  1V4S A;  3C6U A;  5AFU H;  2RN2 A;  3KD5 E;  2E5L K;  3VEN A;  3C7N B;  1QQC A;  2E6L A;  4ISE A;  3LWM A;  4JKB A;  4LSN A;  3LP1 A;  3CJ9 A;  3AA2 A;  4LF4 K;  3QET A;  2QW9 A;  3CMA N;  3A8Y A;  1EET A;  4DQS A;  3P38 A;  1HMV A;  4N56 A;  1KVB A;  2GUI A;  1ZBF A;  3DJC A;  1NJY A;  4CF8 A;  5JVG L;  3EKS A;  1BWF O;  4EZ6 A;  3VQQ A;  1K6Y A;  1WSF A;  4C8O A;  1KVC A;  2RPI A;  1U2V B;  4BR7 A;  4JAX A;  2QK9 A;  1HKG A;  2OPQ A;  4CGD A;  3NE6 A;  4FJ5 A;  4B8C A;  5AQY A;  3VQ7 A;  3E1Y A;  1RBU A;  2YNG A;  2E1Y A;  2FSK A;  4FLV A;  4YOT A;  2HHS A;  1ESV A;  4Y0W A;  1IBL K;  4CK1 A;  4W5Q A;  3O4N A;  3QBX A;  5ELZ A;  5LY3 A;  4WFB L;  5FLX O;  3ZEU B;  1G99 A;  2RHK A;  1HPZ A;  4J2B A;  3RR7 A;  4EP5 A;  3K5M A;  3AVF A;  1NK4 A;  3DOL A;  5IT9 O;  2HHQ A;  4CJF A;  2NRR A;  4DSI A;  3PX4 A;  1R0A A;  4DR6 K;  2KLA A;  2ZM6 K;  1FKP A;  5HRO A;  2GTD A;  3HI0 A;  4BRC A;  4Z4I A;  4FJ9 A;  3CXC M;  1SS6 A;  2IVN A;  3D2E A;  5EU7 A;  1BCO A;  4CF2 A;  1S22 A;  4X62 K;  5JS1 A;  3PIO L;  4H8K A;  4FWN A;  4B9S A;  1NJI O;  1IG9 A;  4B9Q A;  1CZB A;  4DTO A;  4MO5 A;  1SL2 A;  2OZM A;  2D0O A;  2P9S A;  4BR9 A;  5MLC Q;  4AHU A;  2NRH A;  3N4P A;  4DR4 K;  4CFB A;  4Z4C A;  4I7F A;  3ZX2 A;  5BRD A;  3AA5 X;  3CM6 A;  4H0P A;  1NGD A;  3DLB A;  1JLC A;  2EHG A;  2NRW A;  3DLK A;  3M5R A;  4DR7 K;  2B4J A;  3RRH A;  3N4Q A;  4AHS A;  4FL9 A;  2QWQ A;  2KTQ A;  4CHZ A;  4LH5 A;  2HBL A;  3MX2 A;  1S1W A;  4DKW A;  2HMI A;  4KFB A;  4IJA A;  3VQ5 A;  2ITG A;  4BE0 A;  1KFD A;  4EFH A;  4B1Z A;  1YTU A;  4L8R B;  2HHV A;  2Q2R A;  4GKJ K;  3E01 A;  4DTJ A;  4KHW A;  3OYH A;  4CJR A;  2R7Y A;  1XHZ A;  1BU6 O;  4H5W A;  4DR5 K;  4H5V A;  1DGK N;  3A5M C;  3H45 C;  1RTH A;  3EO3 A;  2YJE A;  3P1G A;  3CJ1 A;  3TAF A;  3M6G A;  2W40 A;  3MAQ A;  1WSJ A;  1IJJ A;  1VHX A;  1JLQ A;  4OKJ A;  4K42 A;  2I7P A;  2CGK A;  3E9L A;  2Z1J A;  1LV5 A;  3ULD A;  4DV4 K;  3TSP A;  3LAM A;  3ZT1 A;  3WXI A;  3ZET B;  3F73 A;  3NVK A;  5EX5 A;  1NK7 A;  4Y1C A;  2G8H A;  4FLT A;  4RWT A;  1RDW X;  5BRF A;  1J5O A;  5KPZ A;  2OPP A;  3UIQ A;  4NXM K;  4OKK A;  5GAD P;  1LAV A;  2X6N A;  5AQX A;  3THY A;  5AQJ A;  2E6M A;  2DFH A;  1VQ8 N;  3I0R A;  3MN7 A;  2V7Y A;  1U48 A;  4JKE A;  4BDZ A;  1WAF A;  1LWE A;  2YNF A;  2P9S B;  3SZ2 A;  2Z1G A;  2E2Q A;  1HJO A;  3U3G A;  4JKD A;  4CF0 A;  3SJH A;  3LPU A;  1OVY A;  3AVG A;  1BIU A;  5LMN K;  4A61 A;  3OS1 A;  5EXW A;  2HHH K;  4WCE L;  4FVU A;  4PL7 A;  3Q7B A;  4C8K A;  5JS2 A;  3VF4 A;  3CJC A;  3C6A A;  1QHT A;  1WBB A;  3P5J A;  1WLJ A;  4CHP A;  3LPT A;  2G8W A;  3QIN A;  4R5P A;  2D0B A;  1WBD A;  3GOI A;  2Y1J A;  3U4L A;  2WOM A;  5AQM A;  3L2Q A;  3CYM A;  4CD3 A;  3TU5 A;  4WFA L;  4CCH A;  1RDB A;  2P9U A;  3OBW A;  2QWN A;  5JIC A;  4CK3 A;  1D8Y A;  4HUF A;  4IJN A;  2QXL A;  3K5N A;  2EWS A;  4DU3 A;  3O9U A;  1HR0 K;  3QBW A;  4W5N A;  4CJ5 A;  1A5W A;  4IKF A;  3KWI A;  4LFA K;  5KRT A;  4KB1 A;  2F7T A;  3A5N C;  4J8F A;  1S9G A;  1VSL A;  4B1U B;  4FLX A;  4OPH A;  4CJP A;  1RT7 A;  3HXM A;  3D0P A;  3HPO A;  4K8X A;  2WON A;  2FBX A;  1GLF O;  4CFA A;  5E26 A;  3C95 A;  2P51 A;  1RT2 A;  1LWC A;  5JLF A;  4CEC A;  5B8H A;  1Q8I A;  4CZI A;  2NZT A;  1BUP A;  1BDG A;  5SZT A;  4BG8 A;  3ID8 A;  4YDU C;  4AHT A;  2F9W A;  4ID5 A;  1RT6 A;  3K59 A;  3L4Q A;  5H1S Q;  3J7Z O;  3ZT3 A;  3AA4 A;  4CHO A;  3TAG A;  4E1M A;  2HB5 A;  4BAC A;  2NUB A;  1KLM A;  3ZSR A;  4C8L A;  2YX6 A;  4IOA L;  3CM5 A;  1NGC A;  3BEX A;  2F8T A;  3ZSW A;  1S72 N;  1VSH A;  1NM1 A;  1E4G T;  5IWA K;  2P9L A;  4CHQ A;  4JKG B;  5GIO A;  2OAN A;  3U9Z A;  4B9U A;  3V1R A;  3ATU A;  4LC9 B;  3CCJ N;  4JK7 A;  4IFY A;  4JI6 K;  4CZE A;  4LF5 K;  4HUG A;  3V4I A;  3KLI A;  4JN4 A;  3VEZ A;  3VA0 A;  3M8Q A;  1XMQ K;  1S1V A;  1WN7 A;  3T69 A;  3C65 A;  5D3G A;  2A1R A;  2ZF5 O;  3AO3 A;  3S9H A;  2NNW A;  4CGJ A;  4CZF A;  3K9J A;  4JD2 A;  2FLO A;  4YHH K;  1VSD A;  4KHU A;  5AQR A;  1I3A A;  2D1K A;  4R79 A;  5C2F A;  3DYA A;  4RCH A;  3PX6 A;  3OYF A;  1NGB A;  3FZM A;  4JI5 K;  4ELV A;  2GEM A;  4CF9 A;  4HTL A;  3L0Q A;  2O8B A;  1YI2 N;  3QIP A;  2BGG A;  3V9W A;  3KKR A;  1T05 A;  3EN9 A;  1RBS A;  3T1A A;  3M8S A;  4E7I A;  3QML A;  1NGI A;  1H1V A;  3VQA A;  4A59 A;  2O8C A;  3J80 O;  4M3X A;  4E7J A;  2WC9 A;  1IKV A;  3B8A X;  3HBT A;  4X66 K;  3CD6 N;  1KSP A;  5M1Q A;  5C15 A;  1B92 A;  4OLB A;  2Q97 A;  3O5B A;  5FDL A;  5I42 A;  2JWK A;  3QER A;  4CBW A;  1LCU A;  3LAK A;  4FWS A;  2Q0R A;  4BR0 A;  4H0T B;  3UKU A;  3AY9 A;  4M7Y A;  1HJR A;  2IGI A;  3VEY A;  4DTS A;  3G6E N;  2HW3 A;  3SLC A;  5HRR A;  4N47 A;  2QWP A;  3M1F A;  3LP0 A;  3MEG A;  4MO4 A;  2KW4 A;  2X78 A;  4CER A;  4FJ7 A;  1RGI A;  2Y1I A;  3UE5 A;  3RMC A;  1TUY A;  4DV1 K;  3NF8 A;  4CJT A;  2GX9 A;  4DCH A;  1ILY A;  1ATR A;  3VGM A;  4EHU A;  4H5T A;  4CEF A;  4IDH A;  1NK9 A;  3PLA A;  3K2P A;  5SWM A;  3IRX A;  1FJG K;  2HOE A;  4FW2 A;  4FWQ A;  4NLC A;  3DRS A;  4JI0 K;  3CQX A;  3DWL A;  3AO5 A;  5AQN A;  4NXN K;  3M3Z A;  5HRP A;  4CBX A;  1T6C A;  2YKM A;  2X6S A;  1TK8 A;  2NRV A;  3THX B;  3WEE A;  2P9L B;  3L6Q A;  3O9S A;  4KRE A;  1YAG A;  1IV0 A;  4DFJ A;  3NMU A;  4DUZ K;  5C42 A;  4DF4 A;  1C0U A;  3CCE N;  4BVO A;  1ZXO A;  4PA1 A;  1X1P A;  2WUS A;  3DLH A;  4BRO A;  4BE1 A;  2HNY A;  4PL8 A;  3WQT A;  4PKH A;  4YOW A;  5CR4 A;  1DTT A;  3KK1 A;  5KGX A;  1KC8 O;  4FLY A;  4FK4 A;  4OKE A;  3KTQ A;  1BHL A;  3LL3 A;  1SZ2 A;  4PQU A;  1HQU A;  5HBM A;  4BRQ A;  4B9V A;  1KAY A;  4JI7 K;  3CCL N;  4EAH D;  5KQD A;  3AV9 A;  2OTJ N;  1Q9X A;  3WT0 A;  3L4I A;  3MMV A;  4OJR A;  1IH7 A;  3BGR A;  1A5V A;  2ITM A;  3PY8 A;  1C0G A;  3H1V X;  4DTP A;  4KB0 A;  4CJ3 A;  4JV5 K;  2YNI A;  4FYD A;  1UAX A;  5JVH L;  3U9D A;  4QS7 A;  4BG9 A;  1N33 K;  4MLE A;  4BRD A;  3JAM O;  4IOC L;  2O4G A;  1P90 A;  4CEA A;  1CZA N;  4FWP A;  3NDK A;  1L3U A;  4IG3 A;  3CJB A;  3QEW A;  3RMD A;  1DLO A;  3VPZ A;  1C0T A;  4CZG A;  4DSJ A;  1K8A O;  2CH6 A;  3C6T A;  1HX1 A;  3HL8 A;  3LP3 A;  1S5J A;  2IS3 A;  1JLG A;  3KIO A;  1L3V A;  1HNX K;  3OYI A;  1HKB A;  4DV7 K;  4M42 A;  3CHW A;  2GEL A;  3ULE A;  4TSX A;  4O55 A;  2P9K B;  1RDD A;  4RW4 A;  4DS4 A;  3KD1 E;  1WUA A;  5T7B A;  3OY9 A;  4I2Q A;  3OW2 M;  4KH6 A;  4O8K A;  1Z05 A;  1T6D A;  1OKJ A;  3LDQ A;  3G4S N;  3NBP A;  2O8F A;  2BAN A;  1DEJ A;  3DXK B;  4QS9 A;  1X9W A;  3CG7 A;  3MN6 A;  1OH6 A;  3QES A;  4Z4H A;  4G9Z A;  1QQN A;  1QZ6 A;  2VG6 A;  4QCL A;  3ZSV A;  4J2D A;  4C1N K;  4FJK A;  2E2N A;  3V81 A;  1LAW A;  2HMP A;  4FLW A;  3AVI A;  3OVN A;  1XC3 A;  4A5A A;  3AO4 A;  5CE3 A;  4PKG A;  3CCQ N;  1C1C A;  4AM7 A;  5AZJ A;  4IBN A;  1I94 K;  5GAG P;  4LFB K;  3FFI A;  2AP1 A;  4F2R A;  4PKI A;  3IG1 A;  3OHR A;  4CES A;  4H4O A;  1EXQ A;  1QQO A;  4AH9 A;  4E3S A;  4M45 A;  3TAM A;  4BGA A;  4FWL A;  1UWB A;  4XH1 A;  4BC3 A;  4E0D A;  4F3O A;  2DFE A;  4KV8 A;  3WXJ A;  3MCA B;  2Q3S A;  4FJL A;  2IVP A;  5BN9 A;  5LJV A;  2YKN A;  4JK9 A;  3KWG A;  1RDU A;  3LWL A;  1VQ4 N;  3VF6 A;  3OS0 A;  2D5R A;  2GUP A;  3I8B A;  3KHY A;  1G15 A;  3ENB A;  3K5O A;  1C0F A;  3T19 A;  1NKC A;  4JS5 A;  1GLD G;  3CCM N;  3P39 A;  1TYQ B;  3TI0 A;  4LF6 K;  4I2P A;  4JHD B;  1IKX A;  4A2A A;  4FZX C;  2OPR A;  3VEX A;  3U8X A;  4PWD A;  2A42 A;  4CI6 A;  3TWH A;  1BOT O;  3KLH A;  3TAE A;  1OH7 A;  1RFQ A;  4JI8 K;  3W0L A;  4DR3 K;  1K8K A;  1ZBS A;  2YCH A;  4Z4G A;  3WNE A;  4ILG B;  3THW A;  3QIO A;  3ULE B;  2GWJ A;  1S6Q A;  3MEE A;  3VQ4 A;  1ASW A;  1KTQ A;  1HUX A;  4B3S K;  4CJL A;  3CI5 A;  4WQ4 C;  3LAL A;  5AZI A;  4B3O A;  2JWL A;  4BC5 A;  4FJ8 A;  1NGH A;  4AM6 A;  3KLF A;  3RTV A;  4BY9 C;  1S9E A;  3QNN A;  2NRT A;  1O1W A;  2KFZ A;  4M3R A;  4IFV A;  2E2O A;  2UU9 K;  2E4L A;  4GNI A;  2P9I A;  1T8E A;  4DHY A;  4O4G A;  3BF1 A;  3CC7 N;  3FGU A;  3LP2 A;  3MK6 A;  1M90 O;  4B9T A;  3MXJ A;  3SNN A;  3O9Q A;  1NK8 A;  4OGC A;  1W97 L;  4E1N A;  3TPQ A;  3KLG A;  4KH4 A;  4F4K A;  1NGG A;  1RTD A;  3H3O B;  4N76 A;  5AZJ B;  1QQM A;  2UXC K;  4WQ5 C;  5CYQ A;  1Z26 A;  3AAP A;  1KD1 O;  1BQN A;  3H3N O;  2P9P A;  4U67 L;  1JCE A;  4CZJ A;  4A62 A;  2A41 A;  3O4Q A;  4JKC A;  3LZI A;  4H0X B;  4KPY A;  4KHY A;  3SCX A;  4JI4 K;  3QIC A;  2VWK A;  1WSI A;  3NF9 A;  3V9U A;  2PBD A;  3SQ0 A;  4BVP A;  3PV8 A;  4AQY K;  4FJM A;  3NFA A;  3H6E A;  5BR8 K;  1YTA A;  3MN9 A;  3VQ6 A;  3FR0 A;  3GE1 A;  3MXM A;  1IKW A;  3AO1 A;  1BI4 A;  1K9M O;  2VG5 A;  3FLC O;  3SAG A;  2DTU A;  4AF1 A;  3SUP A;  3HPG A;  3VQD A;  2WBN A;  5CHI A;  3ALY A;  4JKH A;  3DLR A;  3QDK A;  1YJW N;  4GV3 A;  2RE2 A;  5AQI A;  4ILJ A;  4F2S A;  1IG8 A;  2E2P A;  2BH1 A;  1YIJ N;  4DU1 A;  2ASO A;  2ZD1 A;  3O1W A;  1QSY A;  3R6M A;  2HND A;  3CET A;  3ZSQ A;  4YY3 K;  2KZM A;  3W3D A;  1U49 A;  4DQQ A;  1RT4 A;  1K73 O;  5AQZ A;  5AQH A;  1HNZ K;  4KH5 A;  4B1X B;  5J2M A;  1TGO A;  4LFC K;  5KPR A;  1T7P A;  3D2E B;  4ICL A;  4Z94 A;  4BRI A;  2H3G X;  2YNH A;  3VN5 A;  2JLE A;  1Y64 A;  3O6W A;  2FBT A;  4JLH A;  4CJE A;  5F0X A;  4OX9 K;  3VET A;  3VTI A;  1NGF A;  5AQV A;  4JRQ A;  2DY4 A;  1HYZ A;  4MDB A;  1VQK N;  1D5A A;  3VQP A;  3F9M A;  2OZS A;  1ZBH A;  5BN8 A;  1LOT B;  2IAJ A;  3AVA A;  3H1Q A;  2HF4 A;  2ZE2 A;  3ZSY A;  5I3U A;  4CIF A;  3P83 D;  2HVI A;  1TKD A;  4IEE A;  1NU0 A;  1HLU A;  5CZ2 A;  3PUF A;  1SKS A;  1BCM A;  4OPK A;  3HM9 A;  1D4X A;  2OCE A;  2DPN A;  3ZLJ A;  4E7L A;  3R1X A;  1Q18 A;  2B6A A;  2X74 A;  3GG4 A;  5HRN A;  1GOA A;  2QA4 N;  4M3U A;  1BIZ A;  3NGZ A;  2QKK A;  5LJW A;  1Q86 O;  3NGI A;  5HP1 A;  1X3M A;  3U6F A;  1VQ9 N;  3ITH A;  1QSL A;  5LMU K;  2FSJ A;  4F8R A;  4CED A;  3TTD A;  1XWL A;  4OPA A;  2O8D A;  1S3X A;  2PYJ A;  1YXQ A;  1RT5 A;  3EY1 A;  3SBT A;  1U04 A;  3S3O A;  3RSE A;  3R9P A;  3PX0 A;  3UKR A;  1MU2 A;  4IOX A;  2A1S A;  3TSU A;  5HLF A;  3K5L A;  3OYD A;  3DM2 A;  2QWO A;  2E1Z A;  3BUZ B;  3LZJ A;  2HBK A;  1EQY A;  1C0M A;  1J5E K;  3WXK A;  3DLE A;  4JI1 K;  4H5N A;  4PY5 A;  4BRE A;  3VEW A;  4M3W A;  3OYA A;  3CC2 N;  3AVM A;  4KHS A;  2HHX A;  4YOR A;  4FWR A;  2IVO A;  1TK5 A;  4C23 A;  4OGE A;  1SKR A;  4FCY A;  1UOC A;  4DG1 A;  1Q82 O;  2HVH A;  2IC3 A;  3EYZ A;  1U45 A;  3THY B;  3EE8 A;  4IEI A;  3SPZ A;  4UY8 O;  4CFD A;  3AGK A;  4I6M A;  5TKY A;  4RW8 A;  4ILH A;  4BR5 A;  4DSE A;  3S3M A;  4YDU A;  3EZ5 A;  3JXU A;  3VQC A;  5AQK A;  3P31 A;  2DFF A;  3CJ7 A;  4JI2 K;  1C6V A;  2CGL A;  4NCG A;  2VG7 A;  2HHU A;  4FJJ A;  3UB5 A;  4CZK A;  2VWB A;  1N36 K;  3O8M A;  4FM2 A;  2VQE K;  3C94 A;  5BPL A;  4K0K K;  1TL1 A;  3AVB A;  3HTV A;  1ATN A;  2YHA A;  1MWK A;  5DMR A;  4O44 A;  5DM7 L;  3G0Z A;  4B8A B;  4H03 B;  2ETJ A;  4YOY A;  3WQU A;  5I9E B;  4YOU A;  3GL1 A;  1QTM A;  4OVL A;  4DV0 K;  4BQL A;  4PUO A;  2VCP A;  3CIP A;  4HCC A;  3F9K A;  5KPT A;  3G25 A;  1D9D A;  3HRG A;  1S1X A;  3ZX0 A;  3QEP A;  1N8R O;  3SYZ A;  1VQ5 N;  2P9U B;  4JK8 A;  1YIT N;  4B1V A;  2G8V A;  3WUH A;  2QI2 A;  5FPE A;  3SMP A;  3V6D A;  1JL2 A;  4Y1D A;  1ASU A;  5M1P A;  4DU4 A;  2QWR A;  4GMJ B;  4CJW A;  4N5S A;  1FXX A;  3VF2 A;  3PIP L;  2FF6 A;  4DFK A;  2XY6 A;  1ITG A;  3GBT A;  2UUA K;  4WFN L;  1YVN A;  2FC0 A;  4DV5 K;  1X9J A;  3AAR A;  4ZTJ A;  2O8E A;  3ZYY X;  3SAH A;  1JCG A;  2YHW A;  4DR2 K;  2E8A A;  4Q0B A;  5AQT A;  5KI6 A;  5AR0 A;  4NCB A;  4CEO A;  2A3Z A;  1NMD A;  1VRT A;  3VQE A;  3V9Z A;  1BO5 O;  3WNH A;  4QOZ B;  2KQ2 A;  5AQU A;  5CZ1 A;  3CFR A;  3WNG A;  3MDQ A;  3OS2 A;  1ZYQ A;  1NK6 A;  4X65 K;  1RIL A;  5E41 A;  1E3M A;  1HNI A;  1VSJ A;  1XI1 A;  3FFK B;  4BWM A;  2OTL N;  2F9T A;  2A5X A;  2ZQB A;  1VQL N;  3VA3 A;  3Q7C A;  3HP6 A;  3JSM A;  3D6R A;  3P4I A;  3THV A;  3OYL A;  3KK2 A;  1TV6 A;  1NKE A;  4EZ9 A;  1F21 A;  4AIL C;  1XQS C;  4DSF A;  3DXM A;  1VQN N;  1HNW K;  4FM0 A;  1ATS A;  4E7H A;  1JL1 A;  3T3F A;  2WFB A;  4X64 K;  2YV0 X;  1BG3 A;  3WXL A;  2HBJ A;  3L2U A;  4JI3 K;  5FPD A;  1ZBL A;  2HST A;  4B3M K;  2V7Z A;  2FBY A;  3HJF A;  1XHX A;  1R59 O;  4K8Z A;  4BQZ A;  4KTQ A;  3KK3 A;  3CQY A;  1NK0 A;  5KRS A;  1L5U A;  4JKA A;  3VEO A;  3HSC A;  4HUE A;  1EX4 A;  4DUY K;  4BC2 A;  4CHN A;  4JD2 B;  1N34 K;  1WSG A;  5HOO A;  1ZBI A;  4QAG A;  4CJ4 A;  4DTU A;  2ZJQ L;  4NLB A;  3SBG A;  2O8B B;  4BRH A;  1Q7Y O;  3PO5 A;  4CK2 A;  4BDY A;  1TK0 A;  3OYN A;  3MX5 A;  4DF8 A;  3VMF B;  4XIU A;  2G8F A;  2O8C B;  3C6H A;  5BR9 A;  5C24 A;  3J81 O;  1VSI A;  3KK7 A;  4L3Q A;  4DV3 K;  4DQI A;  4XH4 A;  5AQP A;  3K9K A;  1GLJ O;  1P8Z A;  4KKO A;  3F2K A;  4I9Q A;  3CCR N;  2NRZ A;  4ELT A;  3TAP A;  2VGM A;  4FVM A;  2E20 A;  4FZZ A;  1U2V A;  4GY2 B;  3CCU N;  4FZY A;  1QE1 A;  3QFP A;  3UKU B;  1UA0 A;  5AJ3 K;  3VEV A;  4GV6 A;  2OYQ A;  5KGW A;  3CFP A;  2ZJR L;  3CME N;  3J8A A;  1NGJ A;  2PYL A;  2I5J A;  5BRH A;  4WF9 L;  1JLB A;  2KHO A;  2P5O A;  3O9R A;  3QLH A;  4KTZ A;  4XH5 A;  3ZEU A;  2Q1N A;  4W5R A;  3I55 N;  1SV5 A;  3DMJ A;  4JYA K;  3HZ6 A;  4FPA A;  3BZK A;  4W5O A;  4CGF A;  4IXC A;  1NKB A;  2OA8 A;  4F3T A;  3D7E O;  1CLQ A;  3JYT A;  2W41 A;  3DRR A;  1EP4 A;  4QS8 A;  1GLB G;  4IZ9 A;  1C1A A;  5AQG A;  3VGL A;  3WEE B;  1J54 A;  4CJK A;  1S1T A;  3SMS A;  4BRM A;  3T7Z A;  4FWM A;  5DK5 A;  4FJX A;  2D0C A;  2ZGZ A;  1VQ6 N;  3VOV A;  2ZJP L;  1VRU A;  1T44 A;  1SL1 A;  3C0B A;  2CGJ A;  2VYP A;  1WB9 A;  2HF3 A;  3I33 A;  1CXQ A;  1QZ5 A;  2UYT A;  4IDK A;  3LM2 A;  2XY7 A;  3ZSX A;  4CEB A;  3G71 N;  4GVE A;  3D45 A;  3D2F A;  3AVN A;  3LDP A;  3ZSO A;  4B3R K;  3HVT A;  4ISF A;  3I0S A;  3IKM A;  3VGK A;  2AA4 A;  4IG0 A;  4O8U A;  1GLE G;  1FKO A;  3CER A;  4CBU A;  4HHT A;  1J53 A;  3H08 A;  3ASM A;  4F9O A;  4KAZ A;  1J9A A;  1NK5 A;  4BRN A;  2UUB K;  4CEE A;  1JXB A;  4M63 C;  1CZ9 A;  3SV3 A;  1Q9Y A;  1TUU A;  1GLC G;  2V52 B;  4KO0 A;  3AVK A;  3KZB A;  2FXU A;  3SQ1 A;  1BA1 A;  3NH1 A;  4A2B A;  2G8U A;  3TAN A;  3IFR A;  4BRA A;  3WNF A;  5DM6 L;  3O3G A;  4DFP A;  2F8S A;  3SUO A;  1TKT A;  1LWF A;  3ZT2 A;  4BR2 A;  2IDO A;  3FZF A;  4CW7 B;  4KHQ A;  3S41 A;  3FZK A;  4CIG A;  3G10 A;  1EWR A;  1D9F A;  4M3Z A;  5FRN A;  3OTO K;  4BWJ A;  3ZSZ A;  3AO2 A;  4MDA A;  5FPN A;  3ZX3 A;  3CJA A;  5E84 A;  5M1N A;  4LY7 A;  3R3L A;  1GLL O;  1VK0 A;  3VES A;  1VSE A;  3K58 A;  1N6Q A;  4J2A A;  1BQM A;  1YF5 L;  1YHQ N;  1XC9 A;  2XY8 A;  1OH8 A;  1NBW A;  5J2Q A;  2QM1 A;  4OO1 J;  2O8F B;  3ZET A;  3EZW A;  4FWO A;  3NF6 A;  2KZZ A;  4GKK K;  1VSM A;  1U47 A;  3ISN C;  4K43 A;  1W2B M;  4C8M A;  5CYM A;  2HHT A;  2NLX A;  2ATQ A;  5K14 A;  1QS4 A;  4FK0 A;  4CIE A;  1QVG M;  4CE9 A;  4WQ4 A;  1RBT A;  3QEV A;  1HNV A;  3TTC A;  4B3T K;  4BGB A;  4FPB A;  3MWP A;  2YHY A;  3O80 A;  4CZH A;  3RWU A;  4BRL A;  3LDN A;  5M1F A;  4H5R A;  1HPM A;  4ID1 A;  1IKY A;  3PO4 A;  4DTN A;  1WNS A;  1ZBU A;  3D2F B;  5GAH P;  1J6Z A;  3O08 A;  4DB3 A;  3NVM A;  3LDL A;  3QO9 A;  4OPJ A;  2XY5 A;  2Q31 A;  3V9S A;  3OJS A;  1IO2 A;  4CD1 A;  2AJQ A;  1KXP A;  4RTF D;  3IS9 A;  1IBM K;  4WQ5 A;  1HKC A;  3V1Q A;  2QEX N;  2VGN A;  2A6A A;  1MWM A;  2V51 B;  4ELU A;  3OA9 A;  3PSI A;  4H4M A;  4E7K A;  2W6L A;  2W6K A;  3MED A;  3NF7 A;  1TAQ A;  1B9D A;  4C1N I;  1SL0 A;  3CF5 L;  4K25 A;  4H0V B;  3GDQ A;  3FE1 A;  1CXU A;  4FXD A;  1O13 A;  4Z4F A;  4MFB A;  1ASV A;  1YT3 A;  3MEC A;  4NYF A;  5BPM A;  4CGI A;  3A5O C;  1W9H A;  4BC4 A;  1K8K B;  3AVH A;  3DI6 A;  3OYB A;  1W7A A;  3OYC A;  3BF3 A;  3A5L C;  1XUP O;  4Q5V A;  3THW B;  1U4B A;  1TKZ A;  5TKW A;  3EL2 A;  3DAW A;  3IUC A;  2W42 A;  4JEP A;  3QEI A;  4N41 A;  3AAQ A;  4CZL A;  1W0H A;  1KVA A;  3M8R A;  1YJN N;  5AZI B;  3SK3 A;  4EHT A;  3AVL A;  4NYN A;  4KHN A;  1TAU A;  2J4R A;  2HBM A;  1QSS A;  5AQL A;  2EX3 A;  1A5X A;  3L3U A;  1JKH A;  1NJW A;  3NH2 A;  3AA3 A;  3OYG A;  1U6Z A;  3LDS A;  3CPE A;  3L8B A;  2XRI A;  2ZWH A;  5J2P A;  2P9I B;  4CJQ A;  4YOX A;  1B9F A;  4JS4 A;  2G8K A;  1JLF A;  4DS5 A;  3OBY A;  2B5J A;  4CFC A;  4E1J A;  1X9S A;  4KHP K;  1NJX A;  2G8I A;  4CGG A;  1LW0 A;  5F1X A;  5FRO A;  4J2E A;  2Q0U A;  4M7X A;  3FZH A;  2ZGY A;  3HP9 A;  4JKG A;  4FO0 A;  3ATV A;  5AQO A;  3BDP A;  4JNE A;  3E9P A;  4E89 A;  1SAZ A;  4O5B A;  3TTF A;  4CF1 A;  2P9P B;  5AQS A;  3KVG A;  2QWL A;  1BIS A;  3VQ8 A;  2O4I A;  5BPN A;  1RBR A;  3SQ4 A;  3LDO A;  4FM1 A;  1VSK A;  1SUQ A;  2XO7 A;  5GIN A;  1NNE A;  4KRF A;  3KKS A;  2VWJ A;  2OPS A;  3IDH A;  1DT9 A;  3KLE A;  2QXF A;  3RVC A;  3M8P A;  4RW7 A;  4MQ3 A;  4MLH A;  5GAE P;  2LSN A;  3MCP A;  1T03 A;  3L2V A;  3F5T A;  4O0I A;  3J7A P; 
#chains in the Genus database with same CATH homology
 4KTW A;  3VQE A;  1UA1 A;  1WSH A;  1BI4 B;  3AA5 X;  3V9Z A;  3CM6 A;  2F96 A;  3HYF A;  3WNH A;  3DLB A;  4QOZ B;  3QES A;  2KQ2 A;  4Z4H A;  5CZ1 A;  1JLC A;  2EHG A;  4UQG A;  2YHB A;  3DLK A;  3CFR A;  4RW9 A;  3WNG A;  5J2N A;  4DQP A;  4RG8 A;  2B4J A;  4CEQ A;  3RRH A;  4AHS A;  2VG6 A;  3OS2 A;  1ZYQ A;  1NK6 A;  4QCL A;  3ZSV A;  1RIL A;  5E41 A;  1HYV A;  1HNI A;  1VSJ A;  1XI1 A;  4J2D A;  4FJK A;  2KTQ A;  4CHZ A;  4LH5 A;  4DQR A;  3V81 A;  1LAW A;  4BWM A;  3AVI A;  1S1W A;  3OVN A;  4FLW A;  4FK0 A;  1HYS A;  3AO4 A;  1KFS A;  2HMI A;  2ZQB A;  4KFB A;  3SI6 A;  4ZHR A;  3O3F A;  1HRH A;  3VQ5 A;  2ITG A;  4BE0 A;  1KFD A;  3HST B;  3VA3 A;  3HP6 A;  1C1C A;  3ZT0 A;  3JSM A;  3CQ8 A;  3THV A;  1KRP A;  1YTU A;  3OYL A;  3KK2 A;  4DFM A;  4L8R B;  2P1J A;  4IBN A;  2HHV A;  1TV6 A;  3E01 A;  4DTJ A;  1NKE A;  4EZ9 A;  4KHW A;  1F21 A;  5CY4 A;  3OYH A;  3FFI A;  4AIL C;  4F2R A;  4CJR A;  3IG1 A;  4CES A;  4H4O A;  1EXQ A;  2R7Y A;  4AH9 A;  4DSF A;  1XHZ A;  4E3S A;  3HPH A;  4C8N A;  4M45 A;  4FM0 A;  3TAM A;  4E7H A;  2Z1H A;  1JXE A;  3QEX A;  4KI6 A;  1JL1 A;  4FW1 A;  3T3F A;  1FK9 A;  3SPY A;  3AVC A;  3DOK A;  1RTH A;  3U3Y A;  1UWB A;  4B08 A;  1SKW A;  4E0D A;  4F3O A;  1N5Y A;  3P1G A;  2YV0 X;  2DFE A;  4KV8 A;  4W5T A;  3TAF A;  4LD0 A;  3MAQ A;  1WSJ A;  3L2U A;  3B6P A;  1JLQ A;  2Q3S A;  1ZBL A;  4OKJ A;  4FJL A;  2HNZ A;  4LH4 A;  2HHW A;  2YKN A;  2Z1I A;  2FBY A;  3HJF A;  4NCA A;  1TVR A;  1XHX A;  4BDP A;  4K8Z A;  4KTQ A;  4HVJ A;  3LWL A;  4KI4 A;  3OS0 A;  2D5R A;  2Z1J A;  1LV5 A;  3KK3 A;  3ULD A;  1NK0 A;  1G15 A;  5KRS A;  3K5O A;  3T19 A;  1L5U A;  2FBV A;  3LAM A;  1NKC A;  1RT3 A;  4DMN A;  3ZT1 A;  4JS5 A;  1NJZ A;  3B6O A;  4HUE A;  2RF2 A;  1EX4 A;  3F73 A;  3TI0 A;  1NK7 A;  4I2P A;  4Y1C A;  5J1E A;  4CHN A;  2G8H A;  1WSG A;  1IKX A;  4FLT A;  4FZX C;  1ZBI A;  2OPR A;  1X9W A;  4QAG A;  4CJ4 A;  4Z4E A;  1J5O A;  4PWD A;  4DTU A;  1YVU A;  3NH0 A;  3TWH A;  3OJU A;  4FLZ A;  3KLH A;  3TAE A;  2OPP A;  3UIQ A;  3PO5 A;  4CK2 A;  4BDY A;  1TK0 A;  4OKK A;  3OYN A;  3O3H A;  1LAV A;  4DF8 A;  2X6N A;  4Z4G A;  4XIU A;  3WNE A;  2G8F A;  1C1B A;  1RDC A;  4DWI A;  3SUQ A;  5C24 A;  3QIO A;  1VSF A;  1VSI A;  4YFU A;  4HTU A;  4DQI A;  1S6Q A;  2E6M A;  3MEE A;  1ASW A;  3VQ4 A;  1KTQ A;  2DFH A;  3HO1 A;  3V9X A;  4KKO A;  3I0R A;  2QKB A;  2P5G A;  3TR8 A;  4I9Q A;  4CJL A;  1U48 A;  4ELT A;  3HK2 A;  4DSK A;  3TAP A;  4FVM A;  4BDZ A;  4FZZ A;  3LAL A;  3DRP A;  4B3O A;  1WAF A;  1LWE A;  2YNF A;  3MXI A;  2PZS A;  4E19 A;  4FJ8 A;  3KLF A;  4FZY A;  1QE1 A;  3RTV A;  1TKX A;  3SZ2 A;  1UA0 A;  3ZT4 A;  2OYQ A;  2Z1G A;  1DTQ A;  5KGW A;  1S9E A;  3CFP A;  1I39 A;  4AHR A;  3QNN A;  2PYL A;  1O1W A;  3U3G A;  4CF0 A;  4M3R A;  2KFZ A;  2I5J A;  4IFV A;  3LPU A;  5KTQ A;  3AVG A;  1BIU A;  1JLB A;  2P5O A;  2E4L A;  1RTI A;  3OS1 A;  1T8E A;  4O4G A;  3QLH A;  4KTZ A;  3LP2 A;  4C8K A;  4B9T A;  3OYK A;  5JS2 A;  3MXJ A;  4W5R A;  3SNN A;  3NCI A;  1SV5 A;  1QHT A;  4OGC A;  1NK8 A;  4E1N A;  3P5J A;  1WLJ A;  3DMJ A;  3KLG A;  1JLE A;  4YNQ A;  4CHP A;  4AHV A;  3LPT A;  4O0J A;  4CJS A;  2G8W A;  4F4K A;  3QIN A;  4R5P A;  4W5O A;  2D0B A;  4CGF A;  1RTD A;  1NKB A;  2Y1J A;  4CEZ A;  3ZCM A;  2OA8 A;  1RDA A;  4F3T A;  4N76 A;  2WOM A;  1CLQ A;  3JYT A;  4BE2 A;  3L2Q A;  3DRR A;  1EP4 A;  3CYM A;  5CYQ A;  1Z26 A;  1C1A A;  4CCH A;  1BQN A;  1RDB A;  4CK3 A;  1D8Y A;  4HUF A;  1X9M A;  3K5N A;  3LAN A;  3TAB A;  3O4Q A;  1J54 A;  3TAR A;  4FLU A;  4DU3 A;  3LZI A;  4KPY A;  4DTX A;  4KHY A;  1BL3 A;  3SCX A;  4W5N A;  4CJ5 A;  2IOC A;  4CJK A;  1GOC A;  1A5W A;  4IKF A;  1S1T A;  5KRT A;  5DK5 A;  2VWK A;  4KB1 A;  4CJU A;  2D0C A;  3SUN A;  1WSI A;  4FJX A;  1VRU A;  1RNH A;  1S9G A;  1VSL A;  3NF9 A;  3V9U A;  1SL1 A;  4HCB A;  4FLX A;  1RBV A;  3SQ0 A;  4FJI A;  3PV8 A;  4CJP A;  1RT7 A;  3HXM A;  3D0P A;  3HPO A;  4DLE A;  4K8X A;  3SJJ A;  3RR8 A;  3NFA A;  1CXQ A;  2WON A;  4FJM A;  1YTA A;  4IDK A;  3VQ6 A;  2KFN A;  2FBX A;  2XY7 A;  1Z25 A;  3ZSX A;  4CFA A;  4CEB A;  3C95 A;  3D45 A;  1BGX T;  3AVN A;  3MXM A;  2P51 A;  1RT2 A;  3ZSO A;  3HVT A;  1IKW A;  3AO1 A;  1LWC A;  2GV9 A;  1BI4 A;  3I0S A;  4CEC A;  1Q8I A;  2VG5 A;  3NAE A;  2RKI A;  4IG0 A;  2DTU A;  5SZT A;  1GOB A;  3SUP A;  3HPG A;  3VQD A;  4AHT A;  1FKO A;  4HHT A;  1J53 A;  3DLG A;  3H08 A;  1RT6 A;  3ASM A;  4ID5 A;  5C25 A;  4DTR A;  3ALY A;  3K59 A;  1L3S A;  4GW6 A;  4KAZ A;  1J9A A;  1NK5 A;  3DLR A;  3ZT3 A;  4CEE A;  3AA4 A;  1JXB A;  4EP4 A;  1NOY A;  4CHO A;  3CFO A;  3TAG A;  3NHG A;  1CZ9 A;  3SV3 A;  4E1M A;  2BDP A;  2BE2 A;  1WAJ A;  1Q9Y A;  4KO0 A;  2HB5 A;  3AVK A;  4F2S A;  3SQ1 A;  3RRG A;  4BAC A;  2NUB A;  1KLM A;  3ZSR A;  4C8L A;  4DU1 A;  4FJN A;  2ZD1 A;  3CM5 A;  3NH1 A;  1QSY A;  2G8U A;  2F8T A;  2HND A;  3ZSQ A;  3ZSW A;  3TAN A;  2GBZ A;  4B9L A;  3WNF A;  3O3G A;  1S1U A;  4DFP A;  3L3V A;  2F8S A;  1VSH A;  3SUO A;  2KZM A;  1U49 A;  4DQQ A;  4OLA A;  1TKT A;  4CHQ A;  1LWF A;  1NOZ A;  3ZT2 A;  1RT4 A;  1EKE A;  2IDO A;  1KCF A;  4M3Y A;  4B9U A;  1Y97 A;  3V1R A;  4I9L A;  4KHQ A;  5J2M A;  1TGO A;  4M3T A;  4CIG A;  3G10 A;  1RTJ A;  4IFY A;  4ICL A;  3SQ2 A;  1T7P A;  1D9F A;  4M3Z A;  4HUG A;  5FRN A;  3V4I A;  4BWJ A;  3ZSZ A;  3KLI A;  3AO2 A;  4AHC A;  4G1Q A;  2YNH A;  3VN5 A;  3HVR A;  3VA0 A;  2JLE A;  3AVJ A;  4LY7 A;  4CGH A;  3M8Q A;  1VK0 A;  1VSE A;  2FBT A;  4JLH A;  3VQB A;  4CJE A;  1JLA A;  3K58 A;  1N6Q A;  4J2A A;  3SV4 A;  1S1V A;  1BQM A;  1WN7 A;  4DSL A;  1XC9 A;  2XY8 A;  5J2Q A;  5D3G A;  4JRQ A;  2DY4 A;  4Z0U A;  2A1R A;  3AO3 A;  3NF6 A;  3S9H A;  2KZZ A;  1HYZ A;  1VSM A;  4CGJ A;  3ISN C;  1U47 A;  1VSD A;  3RMB A;  4B9N A;  3S3N A;  4KHU A;  1D5A A;  1I3A A;  3VQP A;  3L2W A;  2OZS A;  4C8M A;  3DYA A;  3I8D A;  3PX6 A;  3OYF A;  1ZBH A;  2PY5 A;  4ELV A;  5CYM A;  4CF9 A;  2HHT A;  2IAJ A;  3QIP A;  2BGG A;  3AVA A;  3V9W A;  2ATQ A;  3KKR A;  5K14 A;  1T05 A;  1QS4 A;  4DTM A;  2XHB A;  3L2R A;  4E7I A;  1RBS A;  2ZE2 A;  3T1A A;  3ZSY A;  4CE9 A;  4CIE A;  3M8S A;  4CIF A;  3RMA A;  5I3U A;  2D0A A;  1RBT A;  3P83 D;  5HRS A;  1TKD A;  2HVI A;  3VQA A;  3HT3 A;  3OYE A;  4CHY A;  3OYJ A;  3QEV A;  4M3X A;  4M41 A;  4E7J A;  1HNV A;  5CZ2 A;  1IKV A;  3PUF A;  1SKS A;  1KLN A;  4B9M A;  3NGY A;  1BCM A;  4OPK A;  1KSP A;  3HM9 A;  3RWU A;  1B92 A;  4OLB A;  4LSL A;  4E7L A;  2B6A A;  2X74 A;  5HRN A;  5I42 A;  1GOA A;  5FDL A;  4RW6 A;  4M3U A;  3QER A;  1BIZ A;  3NGZ A;  4ID1 A;  2JGU A;  1IKY A;  3LAK A;  5FRM A;  3OYM A;  2QKK A;  3NGI A;  3PO4 A;  4DTN A;  5HP1 A;  1HJR A;  2IGI A;  3KJV A;  4FJH A;  4DTS A;  2HW3 A;  1WNS A;  1ZBU A;  3VQ9 A;  5HRR A;  4N47 A;  3U6F A;  3QNO A;  1LW2 A;  3ITH A;  4DLG A;  1QSL A;  1REV A;  3LP0 A;  3TAQ A;  3MEG A;  3V1O A;  1S6P A;  4CJV A;  2KW4 A;  3QO9 A;  4OPJ A;  2X78 A;  2XY5 A;  4CED A;  4F8R A;  4FJG A;  4CER A;  1XWL A;  3OJS A;  1IO2 A;  3V9S A;  1HQE A;  1TL3 A;  4FJ7 A;  2PYJ A;  1RT5 A;  3EY1 A;  2AJQ A;  1U04 A;  3S3O A;  3IAY A;  3IS9 A;  4GVM A;  2Y1I A;  3PX0 A;  1MU2 A;  3RMC A;  4WE1 A;  1RT1 A;  1WSE A;  3V1Q A;  2A1S A;  4FK2 A;  3NF8 A;  4CJT A;  3K57 A;  4ELU A;  4H4M A;  4E7K A;  3K5L A;  3OYD A;  3A2F A;  3DM2 A;  3MED A;  3NF7 A;  5HLF A;  1L3T A;  1TAQ A;  1B9D A;  4O0I A;  3LZJ A;  4CEF A;  4JRP A;  1RCH A;  1NK9 A;  1C0M A;  1SL0 A;  4ZTF A;  3K2P A;  5SWM A;  3C6U A;  3IRX A;  3DLE A;  4FW2 A;  4PY5 A;  2RN2 A;  3DRS A;  3KD5 E;  4M3W A;  3OYA A;  3AO5 A;  1CXU A;  1QQC A;  2E6L A;  3LWM A;  4FXD A;  3AVM A;  4KHS A;  2HHX A;  4Z4F A;  4LSN A;  5HRP A;  3LP1 A;  3AA2 A;  1TK5 A;  2YKM A;  2X6S A;  4MFB A;  4OGE A;  1ASV A;  1YT3 A;  3MEC A;  4NYF A;  3QET A;  1TK8 A;  4CGI A;  1W9H A;  1SKR A;  4FCY A;  1EET A;  1UOC A;  4DG1 A;  4DQS A;  4DFJ A;  4KRE A;  2HVH A;  2IC3 A;  3AVH A;  5C42 A;  1HMV A;  3DI6 A;  4N56 A;  3OYB A;  4DF4 A;  3OYC A;  1KVB A;  1C0U A;  4Q5V A;  3EYZ A;  1U45 A;  2GUI A;  1U4B A;  1TKZ A;  1ZBF A;  4PA1 A;  1NJY A;  4CF8 A;  1X1P A;  3SPZ A;  2W42 A;  3QEI A;  4CFD A;  4N41 A;  3DLH A;  4BE1 A;  4EZ6 A;  2HNY A;  4RW8 A;  3VQQ A;  1W0H A;  1KVA A;  4DSE A;  3S3M A;  1DTT A;  3M8R A;  3EZ5 A;  1K6Y A;  1WSF A;  3VQC A;  5KGX A;  3KK1 A;  4C8O A;  4FLY A;  1KVC A;  2RPI A;  4OKE A;  3KTQ A;  4FK4 A;  1BHL A;  2DFF A;  4PQU A;  1HQU A;  1C6V A;  4NCG A;  3AVL A;  4NYN A;  5HBM A;  2QK9 A;  4B9V A;  2VG7 A;  2OPQ A;  4CGD A;  3NE6 A;  4FJJ A;  4FJ5 A;  4KHN A;  1QSS A;  2HHU A;  1TAU A;  4B8C A;  2EX3 A;  4FM2 A;  1A5X A;  3AV9 A;  3L3U A;  1JKH A;  3VQ7 A;  1Q9X A;  1NJW A;  3C94 A;  3NH2 A;  3AA3 A;  1RBU A;  4OJR A;  3OYG A;  1IH7 A;  2YNG A;  3BGR A;  3LDS A;  4FLV A;  1A5V A;  1TL1 A;  3AVB A;  3PY8 A;  4DTP A;  2HHS A;  4KB0 A;  3L8B A;  2XRI A;  2YHA A;  4CJ3 A;  2YNI A;  5J2P A;  4FYD A;  1UAX A;  5DMR A;  4CK1 A;  4W5Q A;  4O44 A;  3G0Z A;  4CJQ A;  3O4N A;  4B8A B;  1B9F A;  4JS4 A;  2G8K A;  1JLF A;  2ETJ A;  4DS5 A;  2O4G A;  4CEA A;  3NDK A;  1HPZ A;  1L3U A;  2B5J A;  4IG3 A;  4CFC A;  1QTM A;  4J2B A;  3RR7 A;  4EP5 A;  4OVL A;  3K5M A;  3QEW A;  3AVF A;  3RMD A;  1DLO A;  1X9S A;  1NK4 A;  1NJX A;  4PUO A;  1C0T A;  4CGG A;  1LW0 A;  3DOL A;  5FRO A;  4DSJ A;  2G8I A;  4J2E A;  4HCC A;  2HHQ A;  3F9K A;  4CJF A;  3C6T A;  3LP3 A;  3HL8 A;  3PX4 A;  1D9D A;  4DSI A;  1S5J A;  1S1X A;  1R0A A;  3HP9 A;  2IS3 A;  3QEP A;  3BDP A;  3SYZ A;  1JLG A;  4E89 A;  1FKP A;  3KIO A;  4O5B A;  5HRO A;  4CF1 A;  1L3V A;  3OYI A;  2G8V A;  4M42 A;  4Z4I A;  1BIS A;  4FJ9 A;  3V6D A;  1JL2 A;  3VQ8 A;  2O4I A;  4Y1D A;  1RBR A;  5EU7 A;  1ASU A;  4O55 A;  4TSX A;  3SQ4 A;  4FM1 A;  1VSK A;  1SUQ A;  2XO7 A;  1BCO A;  4CF2 A;  1RDD A;  4RW4 A;  4DU4 A;  5JS1 A;  4GMJ B;  4CJW A;  4N5S A;  4DS4 A;  4KRF A;  4H8K A;  1FXX A;  3KKS A;  2VWJ A;  2OPS A;  4DFK A;  3KD1 E;  3KLE A;  2XY6 A;  5T7B A;  3OY9 A;  4B9S A;  2QXF A;  1ITG A;  4I2Q A;  3M8P A;  4RW7 A;  4MQ3 A;  1IG9 A;  1CZB A;  4DTO A;  1SL2 A;  2FC0 A;  2OZM A;  2LSN A;  4ZTJ A;  1T03 A;  3L2V A;  4AHU A;  4Q0B A;  3NBP A;  2BAN A;  5KI6 A;  4NCB A;  4CFB A;  4CEO A;  4Z4C A;  1VRT A;  4I7F A;  3CG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...