1VSKA

Asv integrase core domain d64n mutation in citrate buffer ph 6.0
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTNFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Structural basis for inactivating mutations and pH-dependent activity of avian sarcoma virus integrase.
pubmed doi rcsb
source organism Rous sarcoma virus - schmidt-ruppin b
molecule tags Hydrolase
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vskA00
3VQBA 3K59A 3PV8A 3V9WA 3NF9A 1NKEA 3HVRA 5FRMA 1RDDA 3M8QA 2P5GA 3LDSA 3OYLA 2OPPA 5J2NA 1VSDA 1T7PA 3KLFA 3NFAA 3CFOA 3PO5A 4BACA 2XRIA 2YNIA 4DTNA 1LAWA 3DMJA 3DOKA 1NJWA 3UIQA 4M3YA 3AA3A 4ZHRA 3ZSQA 1TL3A 1QS4A 1SL2A 2FBYA 1EETA 3SUNA 2FBVA 1VSHA 1JL1A 3TR8A 4CFAA 4N41A 1ZBIA 4FZXC 3HO1A 1RNHA 3DOLA 4JS4A 4DS5A 4JS5A 3I0SA 5CZ1A 4FLZA 3K58A 3RR7A 1X9MA 2YV0X 3RR8A 3SI6A 1C1CA 1U04A 4DQRA 4DTRA 4BDYA 5C25A 1NK0A 3D45A 4C8KA 1HMVA 4FJKA 4JLHA 3V1OA 4FZYA 1HYZA 1JLGA 3F9KA 4CGDA 3QNNA 4LSNA 4CHNA 1RBTA 2OPSA 1WSJA 3OYBA 3NAEA 4KREA 3PX0A 3AO5A 4FLUA 3SQ1A 5D3GA 3KD1E 3AVMA 2YNHA 4N47A 3AVNA 3OYHA 2RF2A 4CGIA 3SPZA 4C8OA 3ZT4A 2G8IA 2ZE2A 1QSSA 4FLWA 4CFCA 1ZBUA 2YKNA 4OKKA 2VWKA 3VQ5A 2YKMA 4FM1A 3NCIA 4B9NA 4FJ7A 3QIPA 2B6AA 2XY8A 3ULDA 4DS4A 3T3FA 1QSYA 3NGYA 1Q9YA 3RRHA 3ZSWA 3KD5E 2OZMA 3VQ6A 3RMCA 2RN2A 3AVGA 2RKIA 4PA1A 4ELVA 3RWUA 3I8DA 4NCAA 4PY5A 3DRSA 2GUIA 5K14A 1BGXT 3C6TA 3LP2A 4DQQA 1CLQA 3D0PA 3AVLA 5DK5A 1CXUA 4M3UA 3LALA 3IS9A 3TANA 2HW3A 3SPYA 3ZSRA 1JLAA 1Q8IA 4CF2A 3SJJA 1W9HA 4M3TA 3V9ZA 3AVIA 3HXMA 1WAJA 4KFBA 1GOCA 2YHAA 3VQQA 3V9UA 3P83D 4E7KA 3V4IA 1NJYA 4CJPA 4M3ZA 4FK4A 1EX4A 1KRPA 2PZSA 4FJ5A 2ZD1A 1TKZA 1WN7A 1B92A 1KCFA 4H4MA 3MAQA 1VSKA 4CE9A 2ATQA 4PQUA 1S5JA 4CHPA 4KHQA 3OYGA 3ZSOA 3QLHA 4CJFA 1LW0A 3T19A 2ITGA 4J2AA 4GMJB 1NK6A 5CZ2A 2BDPA 2RPIA 1A5WA 1X1PA 3ZT2A 1A5XA 4AH9A 4CHYA 1C0MA 3AVAA 3MEEA 4AHSA 4CJUA 3OJSA 4CESA 4CJ5A 3NH1A 5J2PA 4FJIA 2KFNA 3KK3A 1L3SA 3CM6A 3OYEA 4DTXA 3OYIA 2P5OA 1S6QA 4F4KA 4C8LA 3AVJA 3QIOA 1VSEA 1BIUA 1JLFA 3LAMA 5CY4A 2O4GA 4B08A 1TKDA 4K8XA 3NH2A 1D8YA 3SUQA 3IRXA 3DLRA 4Z4EA 3KJVA 3NGIA 1TK8A 3QEXA 1KFDA 1NK8A 4CEFA 5JS1A 1YVUA 1ASWA 3VQCA 3AVCA 1UA1A 5J2MA 3HPOA 1A5VA 1L3VA 3DRRA 1I39A 4DFPA 3V9SA 3TWHA 4M3WA 2XY6A 2HHSA 1IG9A 1NJZA 4Z4FA 4HCCA 1L3TA 1VSJA 3B6PA 4CFBA 1ZBFA 4OVLA 3JSMA 4DQSA 1YTAA 4RW9A 3VQPA 1LWCA 3G10A 3P1GA 4C8NA 3L2UA 4DF4A 1RT2A 3S9HA 1N6QA 2VG6A 3M8PA 1BI4A 1LW2A 1REVA 3C6UA 1HNVA 4DU4A 3M8RA 4B9MA 4Q0BA 1KFSA 4IFVA 3DYAA 4KB0A 1Y97A 4FLYA 4CIEA 3SNNA 1WSHA 4DLEA 5HRSA 4PUOA 3NGZA 4CF9A 1DLOA 4CEDA 3DLKA 4CEEA 4G1QA 4KAZA 3EY1A 1BQMA 2VG7A 4FJMA 4DTPA 4Z4GA 4F2RA 4O0JA 3KLGA 1S1WA 4I2QA 1NK5A 5KRSA 2XY7A 1F21A 4OPJA 2YNGA 1SKWA 4DMNA 1NK4A 4OGCA 3QINA 5CYQA 1B9DA 4I9QA 4XIUA 1IKXA 3OYCA 1UA0A 1S9GA 1IKVA 3S3MA 1NK7A 4DSLA 1C0TA 3HVTA 2NUBA 4DU1A 3ZSVA 1NOZA 4B9VA 1QHTA 2Q3SA 2B5JA 4F8RA 4O0IA 4E1MA 4DQPA 3V1RA 2F96A 3RMAA 4CIFA 3ZT3A 3K5LA 1EXQA 1DTQA 2EHGA 2YNFA 3U3YA 1T05A 3ZT0A 4NYFA 3DM2A 2Y1IA 1ZBHA 1FKPA 2BANA 3HL8A 4F2SA 2IC3A 3VQ4A 4AHUA 4W5TA 4B9TA 4RW4A 3PX4A 1WSFA 1XHXA 1UOCA 2JLEA 4FLTA 4M41A 3PX6A 4CCHA 4KI4A 2D0BA 1UWBA 1S1XA 4Z4IA 3V6DA 5HLFA 1Q9XA 4Z0UA 1KVBA 4CGHA 3OS1A 3EYZA 3M8SA 1BISA 1ASVA 3S3OA 4N56A 3MXJA 4EZ6A 1KLNA 4E3SA 3KTQA 3OYAA 3DRPA 1RT3A 3P5JA 1S1UA 1S6PA 3OYJA 3QNOA 3KLEA 4JRPA 4FYDA 4UQGA 3RMBA 3WNGA 2XHBA 1XI1A 1XHZA 1WNSA 2G8UA 2D5RA 4E7JA 3JYTA 4CECA 3VQ9A 2OPQA 4E7IA 2IAJA 3SZ2A 3IG1A 4Y1CA 4DSIA 1IH7A 1QSLA 4KHSA 1TGOA 4M3XA 4BWJA 4I7FA 4KKOA 3L2VA 1ASUA 4AHVA 4CJWA 3OS2A 4B9SA 4KHYA 4KTWA 3TAQA 2GBZA 4KV8A 2PYJA 3L3VA 2ETJA 2D0CA 3MXIA 1U4BA 4OKEA 4HHTA 3VQ7A 4FK0A 3VQ8A 1QQCA 3O3FA 1RDAA 4LH4A 4O44A 4DFKA 1X9WA 4FVMA 4CJSA 3HYFA 4HUEA 5KTQA 3KKRA 3HP9A 4JRQA 1Z25A 1Z26A 4FJXA 4QCLA 3QO9A 1BHLA 1TKXA 1JXBA 2KZZA 4O4GA 2HMIA 1NKBA 4CJRA 3QEWA 1D5AA 2X6SA 3OJUA 3NF7A 2Y1JA 5J1EA 3AA2A 3I0RA 2R7YA 2HVIA 4OGEA 3SQ2A 3LZIA 3SYZA 1IKYA 1JLQA 4DF8A 3HPGA 5JS2A 5J2QA 1TK5A 3RRGA 1XWLA 4CIGA 4BE2A 2JGUA 3MEGA 2GV9A 3OYKA 3E01A 4CJTA 4ID5A 4FJGA 2E6MA 3F73A 1NOYA 1RT6A 4ELUA 3OVNA 4E89A 4ZTFA 2OZSA 4OLAA 4DSJA 2DTUA 4E19A 4E7LA 4I9LA 5SWMA 4RW6A 3SCXA 3ZSZA 3MXMA 1U45A 1SL1A 1I3AA 3QETA 2VG5A 3G0ZA 3AO2A 3CFPA 3V81A 4L8RB 4FK2A 4NCBA 2Z1IA 4FLVA 1U47A 2F8SA 4N76A 5T7BA 1HNIA 3PY8A 5I42A 2HHWA 1RBSA 3C94A 2O4IA 4AHTA 3RTVA 4B9UA 4DSKA 4AILC 2B4JA 3IAYA 1BL3A 3AO3A 2HHVA 3OYDA 3TAEA 1FK9A 4FW1A 4LD0A 5KI6A 2Z1GA 2X6NA 1U48A 1UAXA 1VK0A 4OKJA 2EX3A 4CJKA 4FJNA 3ZSXA 4DTMA 1LWEA 1KVAA 2P51A 4KTZA 3NHGA 4NYNA 1L3UA 3FFIA 4GVMA 1JKHA 1HJRA 3HPHA 3MEDA 4CJ4A 3VQAA 4KHNA 3V1QA 3PUFA 4DFMA 1QE1A 2X78A 2Z1HA 3KIOA 3TI0A 5I3UA 1BQNA 4F3TA 3LANA 4CJLA 4J2BA 1FKOA 1KVCA 1BIZA 4CJEA 1SKSA 1D9DA 3NF6A 5HBMA 2A1SA 3C95A 4DQIA 4CGGA 4DLGA 1J53A 1LWFA 4Y1DA 1BCMA 2G8VA 4FJLA 3AO1A 2FBXA 3L2RA 2DFHA 1S9EA 4BDPA 3LWLA 3LP3A 4HTUA 1TVRA 4N5SA 1X9SA 3ASMA 1YTUA 4DWIA 1C0UA 2E6LA 3LWMA 3LP0A 3NDKA 3QESA 4MFBA 4Z4HA 2KFZA 3HM9A 2LSNA 1KSPA 1K6YA 3OYNA 4B8AB 4AHRA 4W5RA 3QEVA 1TK0A 4FJHA 2HHQA 3ZCMA 1W0HA 4DTSA 4EP4A 4DTJA 1U49A 1T8EA 1T03A 1ZYQA 1L5UA 2HVHA 4DTOA 1SUQA 3K5OA 2I5JA 4CEBA 4ZTJA 1BCOA 2KQ2A 3OY9A 5FROA 3SV4A 4CFDA 3O4QA 4GW6A 4CK1A 4DFJA 3TAMA 5HRNA 5HROA 4FW2A 4CF1A 4BE0A 4FJ8A 3B6OA 4FZZA 1C6VA 1N5YA 1GOBA 1NJXA 1DTTA 3SUPA 1TKTA 1JL2A 2G8WA 5FDLA 3TAGA 1QTMA 3LPUA 4KHWA 1ITGA 4CK2A 4M45A 2G8HA 1TL1A 3CM5A 4CJVA 2W42A 4RW7A 3VA3A 3PO4A 1J54A 3KK1A 3ALYA 3WNFA 1RTJA 4R5PA 3HSTB 3DLGA 3WNHA 3TARA 1HQUA 2F8TA 1RTIA 1YT3A 4FXDA 1WSIA 4C8MA 4DU3A 1G15A 3LAKA 4AHCA 5KGXA 1SV5A 2BE2A 4MQ3A 4CGJA 2KW4A 3L8BA 2XY5A 4TSXA 1WSEA 3L2QA 4CEZA 3VQEA 4KRFA 4IBNA 1VSLA 1HYVA 1WSGA 3AVFA 3V9XA 3K57A 2QXFA 1J5OA 3LP1A 4B3OA 1RBVA 3BGRA 5CYMA 5HRRA 4PWDA 1FXXA 4IG0A 3OYMA 3CG7A 4J2EA 4QOZB 4O55A 3CYMA 2IDOA 4CHQA 1NK9A 1D9FA 2A1RA 1RTDA 3HJFA 2FC0A 1WAFA 1KTQA 5HRPA 3QERA 4F3OA 4M42A 5KRTA 1RDBA 3DI6A 1VRTA 4YNQA 2HHUA 4KTQA 4CJ3A 3QEIA 3DLHA 1EP4A 3MECA 2D0AA 2X74A 1ZBLA 3T1AA 4H8KA 4RW8A 4E7HA 2YHBA 2DY4A 1RDCA 3O4NA 2FBTA 3KLHA 4K8ZA 4KB1A 3AV9A 3AA5X 3O3GA 1TAUA 4WE1A 3OYFA 1GOAA 4LY7A 3A2FA 3AVBA 2WONA 4FCYA 1VRUA 2VWJA 3ZSYA 1LV5A 3THVA 4B8CA 4RG8A 2G8FA 4I2PA 1SL0A 2HHXA 1J9AA 3EZ5A 2HB5A 3NBPA 3QEPA 1C1AA 4OPKA 1TAQA 4CEQA 3TAFA 4ELTA 2PYLA 2Z1JA 4E1NA 1R0AA 4ICLA 4FLXA 4CEOA 1NKCA 2HNZA 3L3UA 4CJQA 3NE6A 4B9LA 3ZT1A 3RMDA 3SV3A 4CK3A 4FJ9A 4CERA 1IO2A 3VQDA 4KO0A 1VSIA 1HPZA 3K5NA 4DTUA 4CHOA 1O1WA 4Z4CA 3NF8A 1SKRA 1RILA 1XC9A 2PY5A 4LH5A 1HQEA 1RTHA 3O3HA 1RBRA 4HUGA 1RBUA 4QAGA 4IKFA 3H08A 1VSMA 4IFYA 2QKKA 3OS0A 3AVHA 2HNYA 1S1VA 3VN5A 3HT3A 3HK2A 4EZ9A 2BGGA 3KLIA 2IOCA 4LSLA 3S3NA 2OYQA 4W5NA 4EP5A 3L2WA 2KTQA 1TV6A 5KGWA 1EKEA 3CFRA 4KHUA 3ISNC 4W5OA 1IKWA 2WOMA 5C42A 5SZTA 3KK2A 4CGFA 3DLEA 3SQ0A 2HNDA 1CXQA 3SUOA 2G8KA 3U6FA 3LPTA 1BI4B 3U3GA 2QKBA 3TAPA 2OA8A 2IGIA 4IG3A 4BDZA 4DG1A 2HHTA 1MU2A 4IDKA 4M3RA 1RT1A 2E4LA 4KPYA 4YFUA 4HVJA 1JLCA 4HUFA 1CZBA 4E0DA 2QK9A 3SQ4A 3TABA 1HYSA 1HRHA 3AA4A 2AJQA 5C24A 3ITHA 4CEAA 3K5MA 1WLJA 1C1BA 1S1TA 4OJRA 4KI6A 3LZJA 2P1JA 3KKSA 1B9FA 2DFFA 1JLEA 1RT7A 5EU7A 1JXEA 3AO4A 3K2PA 1RT5A 4O5BA 3WNEA 1LAVA 1VSFA 4FM0A 3DLBA 1CZ9A 2IS3A 3AVKA 4HCBA 5E41A 4J2DA 2DFEA 5HP1A 4Q5VA 4DSFA 4FM2A 1RT4A 5DMRA 3VA0A 4OLBA 4NCGA 5FRNA 2XO7A 1RCHA 4CF0A 3BDPA 2KZMA 4BWMA 4DSEA 2ZQBA 4W5QA 4ID1A 1JLBA 3HP6A 2OPRA 3CQ8A 4FJJA 4H4OA 4CHZA 1KLMA 4CF8A 3NH0A 4BE1A
chains in the Genus database with same CATH superfamily
3ATUA 4FWSA 1WBDA 1HJOA 4YOWA 4U7BA 3V9WA 3NF9A 1GLCG 3QFPA 3H45C 2O8EA 3LDSA 1VSDA 1N8RO 3PO5A 4BACA 2XRIA 4IOCL 4DTNA 1LAWA 3DOKA 3UIQA 2HF3A 3BP8A 5FPDA 3TR8A 1JL1A 4CFAA 1ZBIA 5AQGA 3JS6A 3DXKA 4FLZA 1GLAG 1QQMA 1X9MA 3TSUA 2D0PA 4DTRA 1NGIA 4C8KA 4ISGA 1JLGA 4BRMA 1HR0K 1E4GT 4DV2K 2QM1A 3NAEA 4CD3A 3SQ1A 3KD1E 3AVMA 1IG8A 4UY8O 2RF2A 4CGIA 5AZIA 1QSSA 4FLWA 3HOSA 2VWKA 1BUPA 2YHWA 1VQLN 2QW9A 2XY8A 3SLCA 1Q9YA 3CCVN 2P9NB 3VQ6A 5LJWA 3LP2A 5I9EB 4DV5K 4DCHA 5KPRA 4M3UA 3TANA 3ZSRA 3V9ZA 3V4IA 1NJYA 4CJPA 5CHIA 1KRPA 3D2FA 1WN7A 1XC3A 1HKCA 4JD2B 4PKIA 1VSKA 4YORA 1S5JA 5HL7L 5CE3A 3QLHA 1KC8O 1DGKN 1X1PA 1A5XA 5MLCQ 4MO4A 4CJ5A 5J2PA 3IMXA 2Q2RA 4FVUA 3AVJA 1JLFA 5CY4A 1D8YA 2ZWHA 3SAGA 4Z4EA 1TK8A 3QEXA 2CGJA 3MX2A 3CJBA 1NK8A 5JS1A 4NXMK 1UA1A 3H3OB 4DFPA 4LFBK 3QBWA 3O6WA 3F9MA 2HHSA 1IG9A 3UKRB 4HCCA 4BRLA 3JSMA 3P1GA 3L2UA 3S9HA 3VENA 3W3DA 1P8ZA 4DV7K 1Y97A 4DLEA 4K43A 4BRCA 4CZGA 4CF9A 4BGAA 1OVQA 3LL3A 1GLBG 3KLGA 4I2QA 3BZKA 2O8EB 2XY7A 2UXDK 4OPJA 4DV1K 1QQNA 1J6ZA 4OGCA 1IKXA 1UA0A 2QWQA 1IKVA 4B3MK 1NK7A 3U9ZA 1DT9A 4B9VA 4E1MA 3KWGA 2YNFA 3DXKB 3OW2M 4FWOA 4NYFA 2QWPA 4YDUA 3AGKA 3C6HA 3A5OC 2A40A 5GAEP 1XHXA 3WQTA 1UWBA 1S1XA 1U2VA 4Z4IA 4Z0UA 1KVBA 1BISA 4BR7A 1M1KO 4N56A 1KLNA 5AZIB 2HOEA 5C12A 3DRPA 1RT3A 2P9UA 4FYDA 1S6PA 4FL9A 1XI1A 3WNGA 2G8UA 2D5RA 5FPNA 4BRQA 1WOQA 2GWJA 3BF1A 3DWLA 4EAHD 4NO7A 1T44A 1TGOA 1Z05A 2CH5A 4CJWA 4O8KA 2FF3B 2GBZA 2UXCK 5H1SQ 2D0CA 3O08A 4OKEA 4FK0A 3I8BA 4K42A 1QQCA 3RSEA 1RDAA 4O44A 3VQ8A 4B9QA 2QTDA 1X9WA 1QVFM 1Q7YO 4BR2A 3B8AX 5KTQA 3D2FB 4JRQA 4QCLA 1JXBA 4WFAL 1NKBA 3QEWA 2R7YA 2FLOA 3SQ2A 2IVNA 1YUWA 5J2QA 3RRGA 5BN9A 3HPGA 1QHAA 3CHWA 3CCUN 2JGUA 2E6MA 2YHXA 2DTUA 1FJGK 5SWMA 1SL1A 1NJIO 2VG5A 1QZ5A 3G0ZA 3CFPA 4FK2A 4RWTA 1Q86O 2P9IB 1HNIA 2ZF5O 4JEPA 5I42A 3MWTA 2HHWA 1RBSA 4YHHK 4AHTA 4B9UA 2B4JA 3IAYA 3M1FA 3TAEA 1MA9B 5KI6A 1U48A 2Z1GA 4FWQA 4FJNA 1N36K 4BC3A 2P51A 3U8XA 2F4VK 3NHGA 3HTVA 3HPHA 4CJ4A 4DFMA 2X78A 3JXUA 4KH4A 2Z1HA 3TI0A 5I3UA 3EL2A 4CJLA 4NLCA 1BIZA 3THWA 2Q0UA 4Y1DA 3THXA 4FJLA 1TVRA 4N5SA 3ASMA 3LWMA 4BC4A 4BR9A 2KFZA 4DV6K 4B8AB 5M1FA 4AHRA 3QEVA 2HHQA 3ZCMA 1T8EA 4JYAK 1ZYQA 2HVHA 4CFDA 5C2DA 4DFJA 4A2AA 4BE0A 1C6VA 2A41A 3SUPA 3UKUA 3QDKA 3VGMA 1C0GA 1ITGA 4KHWA 4CK2A 2AA4A 4M45A 2W40A 3VA3A 1WUAA 4IO8A 1T6DA 4IEIA 1U2VB 4BREA 1VQMN 1RTIA 1YT3A 3BF3A 4C8MA 4B1VA 1G15A 4EHUA 3LAKA 1DKGD 4AHCA 3CCEN 2NRVA 3PSFA 3LDQA 4OPAA 3EKUA 1BDGA 3VEOA 1VSLA 1WSGA 3V9XA 2QXFA 3BGRA 5HRRA 4IG0A 5ELZA 4G9ZA 3VF2A 2IDOA 4CHQA 2IVPA 4ILHA 1RTDA 2O8DA 4M42A 4JI5K 4XH4A 3VEVA 4YDUC 5AQQA 3CMAN 4KHPK 1VRTA 3FR0A 4KTQA 1HLUA 2VQEK 4R79A 4MDBA 3RVCA 4PL7A 4E7HA 4DR4K 3O4NA 2FBTA 4K8ZA 4KB1A 3AA5X 3O3GA 4WE1A 1GOAA 1X3MA 3ZSYA 4A57A 3CERA 3QMLA 4MO5A 1BG3A 1J9AA 2HB5A 4JI1K 3O1WA 1C1AA 2Q1NA 1NGHA 4WFBL 1YJNN 3HBTA 1SZ2A 4BRGA 1K73O 2V7YA 3NE6A 3ZT1A 3SV3A 4CERA 1VSIA 4H0TB 1HPZA 2YCHA 4CHOA 3NF8A 1RILA 4QAGA 1IBLK 1N33K 1VSMA 3AVHA 2HNYA 3VN5A 3HT3A 5M1KA 3CCJN 1YJ9N 1VQKN 2BGGA 3KLIA 2IOCA 3K0SA 4LSLA 2KTQA 3ISNC 3ULEA 2V52B 2WOMA 5SZTA 3KK2A 3DLEA 3SQ0A 1CXQA 3U6FA 3H46O 3TAPA 2OA8A 2HHTA 1OH6A 4DUYK 3THWB 1RT1A 2E4LA 4YFUA 4HVJA 4HUFA 3THXB 1CZBA 3TABA 1HRHA 3AA4A 5BR9A 1WLJA 4OJRA 4AM6A 1B9FA 1RT7A 3HSCA 3CPEA 3J8AA 3K2PA 4JI6K 1VSFA 3SBGA 2ZM6K 4Q5VA 3VA0A 1GLLO 3KZBA 4BWMA 4A62A 3T1HK 2OPRA 3CQ8A 4FJJA 3ENOA 4CHZA 1G99A 4Z4FA 3CC2N 1EWRA 3TPQA 3O9UA 3MN7A 3PV8A 3E9OA 3FZHA 5EVZA 1VQ7N 3OYLA 2OPPA 5J2NA 3THYA 1NJWA 4M3YA 3O9SA 3AGRA 2A42A 1QS4A 1SL2A 5M1NA 3VF4A 4CJ7A 4N41A 4DS5A 4JS5A 2O8DB 5CZ1A 1NK0A 1HMVA 3V1OA 4FZYA 2QWOA 3F9KA 4CGDA 4YOYA 3SK3A 4M7XA 3OYBA 4KREA 3AO5A 4FLUA 2YNHA 3AVNA 5JLHA 3OYHA 3SPZA 4C8OA 2YJEA 5FPMA 1XMOK 2FSKA 2YKMA 1K8AO 3NCIA 3R3LA 3MCPA 2B6AA 4DS4A 1QSYA 3QFUA 3NGYA 5AJ3K 3ZSWA 3KD5E 2RKIA 4PY5A 1HNZK 1CLQA 3C6TA 4DQQA 4IO9L 5DK5A 3F2KA 3LALA 4C1NK 4CF2A 4M3TA 3HXMA 3VQQA 3V9UA 4E7KA 1YXQA 3PSIA 4FK4A 2ZD1A 1TKZA 1YIJN 3CD6N 1JJ2M 4BRIA 1KCFA 4CHPA 4KHQA 3ZSOA 3T19A 2UU9K 3ULEB 1NMNA 1NK6A 2WUSA 3AVAA 4AHSA 4CJUA 1TUUA 3OJSA 4BGBA 2KFNA 1X9JA 1NGFA 3U9DA 2RE2A 2P5OA 1S6QA 3TSPA 4B08A 3J7ZO 4K8XA 3SUQA 3IRXA 3PIPL 3NGIA 1KFDA 4CEFA 4KH6A 1ASWA 3VQCA 3A8YA 1A5VA 2ITMA 2BH1A 2XY6A 4X64K 1NJZA 3B6PA 3TU5A 4DR6K 1RT2A 5AFUH 2VG6A 3ENBA 3M8PA 1BI4A 1REVA 4DU4A 1KFSA 4H5NA 1WSHA 3T69A 2F9WA 5AQKA 5HRSA 2WTUA 3AY9A 4CEDA 4BR4A 3DLKA 4CEEA 2VG7A 3SMSA 4DTPA 4Z4GA 2WBNA 2RHKA 1S1WA 1HUXA 4DR2K 1NK5A 3CI5A 5KRSA 2YNGA 5AFUA 3THYB 1H1VA 2O8FA 3E9LA 3O4WA 3CETA 4H5RA 4BY9C 4PL8A 1ZC6A 4B1UB 3IDHA 3J7YP 3J7AP 3ATVA 5FPEA 1QHTA 2Q3SA 2B5JA 4O0IA 4DQPA 3V1RA 2E2OA 4CIFA 3K5LA 1EXQA 2EHGA 3H6EA 3U3YA 1T05A 3DM2A 2Y1IA 1ZBHA 2BANA 3HL8A 4F2SA 2IC3A 4CBXA 4AHUA 4B9TA 2JLEA 3GOIA 1NGDA 4KI4A 5ADXH 3KK7A 3MDQA 5HLFA 3OS1A 3EYZA 3MXJA 4E3SA 4GV3A 3FE1A 4GV6A 4PKHA 5LJVA 3QNOA 3OYJA 3H1VX 3KLEA 4WF9L 4UQGA 1WNSA 1HPMA 4E7JA 3JYTA 4GNIA 1ATSA 4CECA 2OPQA 4DQ8A 4E7IA 2IAJA 3IG1A 4KH5A 4KHSA 5FLXO 5ADXA 4KKOA 4BRPA 3BY5A 3IKMA 4KTWA 5BR8K 3MXIA 1U4BA 5LMUK 3O3FA 4FVMA 3KVGA 4CJSA 1VHXA 3CJ7A 1Z25A 3QO9A 3A5LC 4BRKA 3O9TA 4CJRA 2X6SA 3OJUA 5J1EA 3ID8A 3SYZA 1TK5A 2OTJN 3L0QA 3IUCA 2V7ZA 1KAZA 5BPNA 1M90O 5AQYA 5GINA 3Q7BA 3CJCA 3F73A 1NOYA 1RT6A 3OVNA 4BRFA 4CVNE 3BZCA 4OLAA 4H5VA 4DSJA 4E7LA 4I9LA 4RW6A 3SCXA 3MXMA 1TYQA 4IXCA 3WEEA 3AO2A 4N76A 5T7BA 3PY8A 3M5RA 1K9MO 1FK9A 1XMQK 2X6NA 4CJKA 4JKEA 4X66K 3ZSXA 4JHDA 4KTZA 4X65K 4JK7A 1SAZA 1OVYA 4GVMA 3MEDA 4KHNA 3R9PA 3KIOA 1HNWK 1BQNA 5KQDA 2V51B 1XNRK 1NGJA 3NF6A 2A1SA 4NXNK 4CGGA 1LWFA 2HSTA 3L2RA 5LY3A 2DFHA 3CC4N 4BDPA 2PFUA 3LP3A 4HTUA 1X9SA 1YTUA 3VOVA 4IZ9A 3QESA 4JV5K 4IEEA 3OHRA 4DUZK 2LSNA 1KSPA 1K6YA 1NMDA 1TK0A 1W0HA 4DTJA 2HHHK 3TSQA 1T03A 1L5UA 4DTOA 1SUQA 3K5OA 2I5JA 4I6MA 2JWKA 4ZTJA 5AQFA 5FROA 3SV4A 5BN8A 4CK1A 4M7YA 5HROA 4FJ8A 4FZZA 3EKSA 3SJHA 3VGKA 4RTFD 4CZIA 1TKTA 3TAGA 1NGBA 4CJVA 4WQ4A 3WNFA 1WB9A 4F9OA 3LDNA 1BO5O 2F8TA 2WC9A 4DR3K 1WSIA 4DU3A 2IIRA 1YHQN 3GDQA 4QS8A 2BE2A 1Q81O 4CGJA 3L8BA 1WSEA 3MN9A 4BRAA 2WFBA 3VEWA 4CEZA 3VQEA 3EO3A 2O8CA 3AVFA 3K57A 3VEXA 3SMPA 4B3OA 3H3NO 4PWDA 3OYMA 4J2EA 4QOZB 1MDUB 4J8FA 5BREA 1KTQA 5HRPA 4YOTA 1BOTO 3FZKA 2W6KA 3G25A 4CD1A 3E9PA 3DLHA 1EP4A 3MECA 3P38A 2YHBA 5M1OA 3KLHA 4BRNA 4AF1A 3AV9A 1TAUA 4LY7A 2FF6A 2KLAA 2WONA 3AVBA 3THVA 4DHYA 1SL0A 1RGIA 3EZ5A 3QEPA 4B3RK 1TAQA 5IWAK 5AQIA 4CEQA 4ELTA 1J5EK 1KAYA 2Z1JA 4FLXA 3U4LA 1NKCA 2GX9A 3L3UA 3RMDA 4CK3A 3DXMA 4C23A 4FJ9A 3FZLA 4KO0A 3IFRA 1TYQB 1HQEA 1RTHA 1CZAN 2OCEA 3O3HA 1RBUA 4IKFA 3O8MA 2H3GX 3H08A 4IFYA 2VCPA 2OYQA 3MMVA 4JN4A 4W5NA 4JHDB 3TTDA 3NVMA 3CCSN 4BQZA 5JMVA 3SUOA 2G8KA 3LPTA 3CMEN 2QKBA 4IG3A 4DG1A 3CJAA 4M3RA 4L3QA 4KPYA 1JLCA 1HYSA 4JI8K 3N4QA 1RFQA 3ITHA 4BC5A 1LOTB 4O5FA 1S1TA 3KKSA 4M63C 2DFFA 1JLEA 4BRHA 3ZETA 4EFHA 1RT5A 4I6MB 3DLBA 1CZ9A 4J2DA 3AVKA 2HVIA 4OLBA 1RT4A 4NCGA 1JCFA 5AQUA 4CF0A 3BDPA 2KZMA 3BEXA 4FOEA 4DSEA 1IJJA 4W5QA 4XH5A 5AQZA 1EO1A 1KXPA 3EN9A 1HX1A 4JK9A 3FZMA 4BE1A 3DAWA 4B3TK 1NKEA 4A59A 3HVRA 5FRMA 3M8QA 2P5GA 3KLFA 3CFOA 3EE8A 3UB5A 2YNIA 3AA3A 1TL3A 2P9UB 2D4WA 2O8CB 5EY4A 3SUNA 1VSHA 5EXWA 3NVKA 1RNHA 3DOLA 4JS4A 3I0SA 1HKBA 3T7ZA 3RR7A 4K41A 4BVPA 3RR8A 1C1CA 4H0PA 4DQRA 1S72N 1SS6A 3D45A 1NGCA 1HYZA 4HWIA 4CHNA 1RBTA 2OPSA 4WQ4C 2F9TA 3RSEB 5JICA 1T3VA 1GLEG 3PIOL 3PX0A 3VMFB 3I56N 3Q7CA 5D3GA 3A5NC 4N47A 3SAFA 1C0FA 4MLHA 4MDAA 3K9KA 3ZT4A 2YKNA 4OKKA 3QIPA 3T3FA 1ATNA 1SQKA 2RN2A 4PA1A 4NCAA 3DRSA 4FWKA 3DXMB 3AVLA 4DKWA 1CXUA 5DM6L 4GV9A 1W9HA 3FZFA 1WAJA 1GOCA 4FWPA 1NWKA 3JAMO 2E5LK 4M3ZA 1EX4A 5DM7L 4CW7B 1B92A 1S22A 1V4SA 2ZJRL 1RDUA 4XH1A 4J2AA 5CZ2A 2RPIA 3ZT2A 4AH9A 3MEEA 3FLCO 4WQ5A 4FJIA 1L3SA 4DTXA 3QIOA 1VSEA 3LAMA 4IFEA 1NG9A 1TKDA 3KJVA 4OPHA 3G4SN 5J2MA 2D1KA 3HPOA 1L3VA 3DRRA 3ZLJA 3V9SA 3TWHA 2HF4A 3ENHA 2ZGZA 2F7TA 5AQLA 4OVLA 3VQPA 1YTAA 1LWCA 3G10A 4JK8A 3GG4A 3ZYYX 4Z94A 3C6UA 1LW2A 3O80A 4BVOA 3GL1A 4Q0BA 4IFVA 3DYAA 4KB0A 4FLYA 4JI0K 4FWLA 2ZJPL 3UKUB 2AP1A 4IOAL 3KWIA 4G1QA 3EY1A 4WYBA 4O0JA 3VEZA 4JNEA 1ATRA 1F21A 2GELA 1SKWA 3QINA 5LL6Z 3ZEUA 3NMUA 3VEYA 3S3MA 3HRGA 1NGEA 2QWLA 4PKGA 3N4PA 3ZSVA 5JVHL 3P31A 2F96A 5JLFA 3RMAA 3ZT3A 2P9KA 1GLFO 3QBXA 2HBLA 4LFAK 1X3NA 4LF4K 4RW4A 1WSFA 4AM7A 4FLTA 4CCHA 4NLBA 2OANA 4M41A 3V6DA 1Q9XA 4ISEA 4CGHA 2P9LA 3SAHA 4EZ6A 5E84A 1XUPO 3P5JA 1S1UA 4JRPA 3LM2A 3RMBA 4LF6K 5KPTA 2QA4N 4H0YB 4CZLA 2Q36A 1XHZA 2NZTA 3BUZB 4Y1CA 4X62K 1QSLA 4YOXA 2NRZA 4BWJA 3WXLA 4I7FA 3L2VA 1ASUA 4AHVA 4KHYA 4H0VB 3TAQA 3VPZA 2PYJA 3L3VA 3VTIA 4HHTA 3VQ7A 3W0LA 4YOUA 4JI7K 4DFKA 3HYFA 2EWSA 2CGLA 3HP9A 4FJXA 4IOXA 1OH5A 2KZZA 4O4GA 3D7EO 5BPLA 3AA2A 3I0RA 3LZIA 1IKYA 1JLQA 4JKBA 5JS2A 2CH6A 2GV9A 3OA9A 3OYKA 4CJTA 4ID5A 4FJGA 3KHYA 4JKAA 4ZTFA 5AQPA 1D4XA 4E19A 1BA1A 2CGKA 4A5AA 2I7NA 2E8AA 2IVOA 4L8RB 1U47A 1E4FT 4C1NI 2QI2A 4BR5A 3WUHA 1W7AA 2O4IA 2HHVA 4DSKA 4AILC 3AO3A 3L4QA 1NBWA 4FW1A 1UAXA 1VK0A 4OKJA 1LWEA 1KVAA 5KQ8A 1L3UA 4H0XB 4NYNA 4H03B 1JKHA 1HJRA 3VQAA 3F5TA 1QE1A 3LANA 3HI0A 5F2RA 1FKOA 1KVCA 4CJEA 3HM8A 4WQ5C 1VQPN 1SKSA 1D9DA 4DLGA 1GLJO 2P9SA 1GLDG 2FBXA 5AR0A 5LMNK 2E20A 3NDKA 4Y0WA 2VWBA 1OKJA 3TTFA 3ZEUB 1VQON 4FJHA 1U49A 5AQJA 3A5MC 4CEBA 1BCOA 2KQ2A 3O4QA 3J80O 2P9KB 5HRNA 1VQNN 3OBYA 3B6OA 1N5YA 1NJXA 1ZBSA 4JKHA 5FDLA 4JI4K 2G8HA 3CM5A 4OX9K 2W42A 3CIPA 3LDOA 1K8KA 1J54A 3PO4A 3ALYA 4WCEL 3WNHA 5A2QO 2I7PA 3VF6A 2P9LB 4FXDA 3CPWM 3VERA 1SV5A 2GWKA 4MQ3A 2XY5A 1J5OA 1RBVA 5EOYA 5CYMA 3WXJA 2UXBK 5M1QA 3CG7A 4YOVA 5TKWA 2VGNA 3CYMA 1NK9A 1D9FA 2A1RA 2FC0A 1WAFA 3QERA 4F3OA 3ZX0A 3UE5A 5KRTA 5F0XA 1RDBA 1OH8A 2X74A 1ZBLA 3T1AA 4RW8A 3OTOK 4CZFA 1VQ4N 4LF8K 1KD1O 3G71N 4JI3K 4JAXA 4CZEA 5F1XA 3OYFA 1LV5A 4FCYA 1VRUA 2VWJA 4AQYK 4RG8A 1N32K 2HHXA 3C0BA 2W41A 2PYLA 1R0AA 4ICLA 4CEOA 4CJQA 4B9LA 3VQDA 3D6RA 2QWMA 4FWRA 3K5NA 4DTUA 1QVGM 1XC9A 2PY5A 2DPNA 4HUGA 4EIAA 5C15A 1S1VA 3S3NA 1IBKK 4EP5A 1TV6A 3CFRA 4BG8A 4KHUA 4W5OA 1WBBA 4CGFA 4CBUA 3T1YK 3I33A 1BI4B 4IDKA 2P9SB 4BROA 3L6QA 5C24A 3K5MA 2P9IA 3M6GA 3S41A 4B1ZA 2Q31A 3HZ6A 4GKJK 4A2BA 4KI6A 3LZJA 4DV4K 1JXEA 4O5BA 2O8FB 3VETA 3WNEA 1LAVA 4HCBA 3CCMN 5E41A 2DFEA 5HP1A 4DSFA 3AAPA 1VQ6N 5DMRA 1Q82O 3FFKB 5FRNA 2XO7A 1RCHA 1YVNA 2ASOA 3HP6A 2ASMA 4CF8A 3TAFA 4JKCA 3NH0A 3FGUA 3VQBA 3O5BA 4GY2B 1K8KB 3K59A 3PLAA 4FPBA 1RDDA 4CZHA 2J4RA 1T7PA 3NFAA 4FSVA 3DMJA 3G6EN 4DB3A 4ZHRA 3ZSQA 4IJNA 4ILGB 2FBYA 1EETA 3O9RA 2FBVA 2O8BA 4NB4A 3C6AA 4E1JA 4FZXC 3HO1A 5GIPA 1XNQK 1VQ9N 1EWQA 4FWNA 4DR1K 4FO0A 1EQYA 3K58A 2QWRA 2YV0X 3SI6A 1U04A 4BDYA 5C25A 1YITN 1U6ZA 4FJKA 4JLHA 3QNNA 4LSNA 1I94K 4B1WB 1N34K 2YHYA 1WSJA 3E66A 3LDPA 2G8IA 2ZE2A 3A0IX 3OBWA 4H5TA 4CFCA 2ASPA 1ZBUA 4FM1A 2QXLA 2E2PA 3VQ5A 2BUPA 2GTDA 4B9NA 5E26A 3ULDA 1YI2N 3RRHA 1NNEA 2HBMA 2OZMA 4GKKK 3RMCA 4U67L 3AVGA 3RWUA 4ELVA 3I8DA 2GUIA 5K14A 1BGXT 3D0PA 2HW3A 3IS9A 3SPYA 1JLAA 1Q8IA 3LM9A 3SJJA 2E88A 4PHTX 3AVIA 4OO1J 2A5XA 4KFBA 2YHAA 3P83D 2PZSA 3WEEB 3O1BA 4BRDA 4FJ5A 1VAZA 1W97L 2Q0RA 4RCHA 1NLVA 4H4MA 3MAQA 4CE9A 2ATQA 1Q18A 4PQUA 5AQVA 2QEXN 3WXKA 3OYGA 4CJFA 1LW0A 2ITGA 4GMJB 4JKFA 2BDPA 1A5WA 5BRHA 4CHYA 1C0MA 4CESA 2BTFA 3ZX3A 3NH1A 2QWNA 5AQHA 3KK3A 3CM6A 3OYEA 1KQSM 3OYIA 3DLLL 4F4KA 4C8LA 1BIUA 2O4GA 3EZWA 2GUPA 5AQNA 3NH2A 4LFCK 3DLRA 3MN6A 2NNWA 1NGGA 1P90A 1YVUA 1Y64A 3AVCA 1ILYA 4O8UA 2JWLA 1I39A 2NRHA 3D2EA 4M3WA 3CCQN 5GAGP 1BWFO 3R1XA 4HTLA 1L3TA 1VSJA 4CFBA 1ZBFA 2E2NA 3C65A 4DQSA 4RW9A 4ILJA 1TUYA 1N6QA 4DF4A 4C8NA 4B1YB 3AAQA 3TTCA 3VTHA 1HNVA 1RDWX 4B3SK 3M8RA 4B9MA 4DR5K 4EHTA 4CIEA 3SNNA 3C7NA 2D0OA 3MWPA 4PUOA 3NGZA 1IBMK 1DLOA 1IV0A 4KAZA 1OH7A 1BQMA 4FJMA 4F2RA 4H5WA 4A61A 2NRWA 4JI2K 4DMNA 5BPMA 1NK4A 5CYQA 1B9DA 4I9QA 4XIUA 1YJWN 3OYCA 2VGMA 1S9GA 5JVGL 4DSLA 5EX5A 2E1ZA 1C0TA 3HVTA 2NUBA 4DU1A 2OTLN 5BRFA 2O8BB 1NOZA 3J81O 4F8RA 2NRTA 4YY3K 1DTQA 3ZT0A 3CCLN 1FKPA 2P9PA 2UUAK 3VQ4A 3CC7N 1LCUA 4W5TA 3E1YA 5B8HA 3PX4A 5HOOA 1UOCA 3PX6A 2UYTA 2E2QA 1QQOA 2D0BA 4XEIA 2ZJQL 1DEJA 3GE1A 2KHOA 4MLEA 1BU6O 3M8SA 1JCEA 1ASVA 3S3OA 3CJ1A 2KKZA 3KTQA 3OYAA 2A3ZA 2XHBA 4BG9A 4GVEA 1R59O 3QICA 5GAHP 3QB0A 3VQ9A 2NRXA 3SZ2A 4DSIA 1IH7A 1ESVA 4M3XA 2UUCK 3OS2A 4B9SA 1HKGA 5AQWA 4B1XB 4KV8A 2NLXA 2ETJA 3MN5A 3R6MA 4IDHA 4LH4A 4HUEA 3R8EA 1QZ6A 3KKRA 1Z26A 1BHLA 1TKXA 2GEMA 5AZJA 2HMIA 1VQ8N 1D5AA 3NF7A 5AQRA 2Y1JA 3O9QA 4OGEA 1HNXK 4FJ7A 4DF8A 1XWLA 4CIGA 4BE2A 3MEGA 1O13A 3E01A 5AQOA 4ELUA 4E89A 2OZSA 1JCGA 4BC2A 4DV0K 4JKGA 1U45A 4DV3K 3ZSZA 1I3AA 4KBOA 3QETA 4NCBA 3V81A 2Z1IA 3I55N 4FLVA 4V19S 2F8SA 1S3XA 3D2EB 5GADP 3C94A 2FSNA 3RTVA 5AQXA 1BL3A 3OYDA 4LD0A 3ZETB 1NM1A 2EX3A 5TKYA 4DTMA 3FFIA 4IJAA 2Q97A 3V1QA 3PUFA 4F3TA 3C7NB 4J2BA 5HBMA 4DQIA 3C95A 2G8VA 1J53A 1ZXOA 5CR4A 1BCMA 3AO1A 5C10A 1S9EA 3CCRN 3LWLA 4DWIA 1C0UA 2E6LA 3LP0A 4MFBA 4BQLA 4Z4HA 2HMPA 3EE9A 5C0YA 3HM9A 3OYNA 4W5RA 1W2BM 3CJ9A 3P39A 4EP4A 4DTSA 2VQFK 4LF9K 3OY9A 3P4IA 2PBDA 3MX5A 4JKDA 1BA0A 2FSJA 3ZX2A 4GW6A 2YX6A 3TAMA 4FW2A 4CF1A 5KPZA 5AQTA 1GOBA 1DTTA 2P9PB 2G8WA 5IT9O 1JL2A 3WXMB 3MCAB 1QTMA 3LPUA 1TL1A 3M3ZA 3EEQA 4RW7A 4LF5K 3ID6A 4K0KK 3KK1A 1RTJA 4R5PA 3HSTB 3DLGA 3TARA 3K9JA 1HQUA 5C2FA 4CZJA 5KGXA 4QS9A 2KW4A 1T6CA 4TSXA 3L2QA 4KRFA 4IBNA 1HYVA 4ISFA 3LP1A 4FOIA 4IWVA 1FXXA 4BR0A 2A6AA 4O55A 3HJFA 5AQMA 5BRDA 3DI6A 4YNQA 2HHUA 4CJ3A 1YAGA 3QEIA 3CQXA 2D0AA 3WT0A 4CZKA 2ZGYA 4H8KA 1Z6RA 2DY4A 1RDCA 5AZJB 2PAVA 1XQSC 3SBTA 3A2FA 3CXCM 4B8CA 5GIOA 2G8FA 4I2PA 3NBPA 1YF5L 4OPKA 2FXUA 2P9NA 3AARA 4FWMA 4CBWA 4FPAA 4E1NA 3HOTA 2HNZA 2HBKA 3WXIA 1E3MA 1IO2A 4JKGB 1VQ5N 4K25A 1SKRA 1O1WA 4Z4CA 4LH5A 3CF5L 3MK6A 1RBRA 1FW6A 2QKKA 3WQUA 3OS0A 4DR7K 3L4IA 4JD2A 3HK2A 4EZ9A 3VGLA 3GBTA 3L2WA 5KGWA 1EKEA 3LDLA 3VESA 1IKWA 5C42A 4QS7A 2HNDA 4LF7K 3U3GA 2IGIA 2E1YA 4BDZA 1MU2A 1V4TA 4E0DA 2QK9A 3SQ4A 2AJQA 1MWKA 4H0OA 3CQYA 4CEAA 3H1QA 1NGAA 4CI6A 1C1BA 2P1JA 1KAXA 1NU0A 5EU7A 4CZMA 4WFNL 3AO4A 2YI1A 3UKRA 4FM0A 2IS3A 2NRRA 5AQSA 2HBJA 4FM2A 2UUBK 2YJFA 2VYPA 1MWMA 2W6LA 2ZQBA 3DJCA 1JLBA 4ID1A 4LC9B 4A5BA 4H4OA 1KLMA 5M1PA
chains in the Genus database with same CATH topology
3VQBA 3K59A 3PV8A 3V9WA 3NF9A 1NKEA 3HVRA 5FRMA 1RDDA 3M8QA 2P5GA 3LDSA 3OYLA 2OPPA 5J2NA 1VSDA 1T7PA 3KLFA 3NFAA 3CFOA 3PO5A 4BACA 2XRIA 2YNIA 4DTNA 1LAWA 3DMJA 3DOKA 1NJWA 3UIQA 4M3YA 3AA3A 4ZHRA 3ZSQA 1TL3A 1QS4A 1SL2A 2FBYA 1EETA 3SUNA 2FBVA 1VSHA 1JL1A 3TR8A 4CFAA 4N41A 1ZBIA 4FZXC 3HO1A 1RNHA 3DOLA 4JS4A 4DS5A 4JS5A 3I0SA 5CZ1A 4FLZA 3K58A 3RR7A 1X9MA 2YV0X 3RR8A 3SI6A 1C1CA 1U04A 4DQRA 4DTRA 4BDYA 5C25A 1NK0A 3D45A 4C8KA 1HMVA 4FJKA 4JLHA 3V1OA 4FZYA 1HYZA 1JLGA 3F9KA 4CGDA 3QNNA 4LSNA 4CHNA 1RBTA 2OPSA 1WSJA 3OYBA 3NAEA 4KREA 3PX0A 3AO5A 4FLUA 3SQ1A 5D3GA 3KD1E 3AVMA 2YNHA 4N47A 3AVNA 3OYHA 2RF2A 4CGIA 3SPZA 4C8OA 3ZT4A 2G8IA 2ZE2A 1QSSA 4FLWA 4CFCA 1ZBUA 2YKNA 4OKKA 2VWKA 3VQ5A 2YKMA 4FM1A 3NCIA 4B9NA 4FJ7A 3QIPA 2B6AA 2XY8A 3ULDA 4DS4A 3T3FA 1QSYA 3NGYA 1Q9YA 3RRHA 3ZSWA 3KD5E 2OZMA 3VQ6A 3RMCA 2RN2A 3AVGA 2RKIA 4PA1A 4ELVA 3RWUA 3I8DA 4NCAA 4PY5A 3DRSA 2GUIA 5K14A 1BGXT 3C6TA 3LP2A 4DQQA 1CLQA 3D0PA 3AVLA 5DK5A 1CXUA 4M3UA 3LALA 3IS9A 3TANA 2HW3A 3SPYA 3ZSRA 1JLAA 1Q8IA 4CF2A 3SJJA 1W9HA 4M3TA 3V9ZA 3AVIA 3HXMA 1WAJA 4KFBA 1GOCA 2YHAA 3VQQA 3V9UA 3P83D 4E7KA 3V4IA 1NJYA 4CJPA 4M3ZA 4FK4A 1EX4A 1KRPA 2PZSA 4FJ5A 2ZD1A 1TKZA 1WN7A 1B92A 1KCFA 4H4MA 3MAQA 1VSKA 4CE9A 2ATQA 4PQUA 1S5JA 4CHPA 4KHQA 3OYGA 3ZSOA 3QLHA 4CJFA 1LW0A 3T19A 2ITGA 4J2AA 4GMJB 1NK6A 5CZ2A 2BDPA 2RPIA 1A5WA 1X1PA 3ZT2A 1A5XA 4AH9A 4CHYA 1C0MA 3AVAA 3MEEA 4AHSA 4CJUA 3OJSA 4CESA 4CJ5A 3NH1A 5J2PA 4FJIA 2KFNA 3KK3A 1L3SA 3CM6A 3OYEA 4DTXA 3OYIA 2P5OA 1S6QA 4F4KA 4C8LA 3AVJA 3QIOA 1VSEA 1BIUA 1JLFA 3LAMA 5CY4A 2O4GA 4B08A 1TKDA 4K8XA 3NH2A 1D8YA 3SUQA 3IRXA 3DLRA 4Z4EA 3KJVA 3NGIA 1TK8A 3QEXA 1KFDA 1NK8A 4CEFA 5JS1A 1YVUA 1ASWA 3VQCA 3AVCA 1UA1A 5J2MA 3HPOA 1A5VA 1L3VA 3DRRA 1I39A 4DFPA 3V9SA 3TWHA 4M3WA 2XY6A 2HHSA 1IG9A 1NJZA 4Z4FA 4HCCA 1L3TA 1VSJA 3B6PA 4CFBA 1ZBFA 4OVLA 3JSMA 4DQSA 1YTAA 4RW9A 3VQPA 1LWCA 3G10A 3P1GA 4C8NA 3L2UA 4DF4A 1RT2A 3S9HA 1N6QA 2VG6A 3M8PA 1BI4A 1LW2A 1REVA 3C6UA 1HNVA 4DU4A 3M8RA 4B9MA 4Q0BA 1KFSA 4IFVA 3DYAA 4KB0A 1Y97A 4FLYA 4CIEA 3SNNA 1WSHA 4DLEA 5HRSA 4PUOA 3NGZA 4CF9A 1DLOA 4CEDA 3DLKA 4CEEA 4G1QA 4KAZA 3EY1A 1BQMA 2VG7A 4FJMA 4DTPA 4Z4GA 4F2RA 4O0JA 3KLGA 1S1WA 4I2QA 1NK5A 5KRSA 2XY7A 1F21A 4OPJA 2YNGA 1SKWA 4DMNA 1NK4A 4OGCA 3QINA 5CYQA 1B9DA 4I9QA 4XIUA 1IKXA 3OYCA 1UA0A 1S9GA 1IKVA 3S3MA 1NK7A 4DSLA 1C0TA 3HVTA 2NUBA 4DU1A 3ZSVA 1NOZA 4B9VA 1QHTA 2Q3SA 2B5JA 4F8RA 4O0IA 4E1MA 4DQPA 3V1RA 2F96A 3RMAA 4CIFA 3ZT3A 3K5LA 1EXQA 1DTQA 2EHGA 2YNFA 3U3YA 1T05A 3ZT0A 4NYFA 3DM2A 2Y1IA 1ZBHA 1FKPA 2BANA 3HL8A 4F2SA 2IC3A 3VQ4A 4AHUA 4W5TA 4B9TA 4RW4A 3PX4A 1WSFA 1XHXA 1UOCA 2JLEA 4FLTA 4M41A 3PX6A 4CCHA 4KI4A 2D0BA 1UWBA 1S1XA 4Z4IA 3V6DA 5HLFA 1Q9XA 4Z0UA 1KVBA 4CGHA 3OS1A 3EYZA 3M8SA 1BISA 1ASVA 3S3OA 4N56A 3MXJA 4EZ6A 1KLNA 4E3SA 3KTQA 3OYAA 3DRPA 1RT3A 3P5JA 1S1UA 1S6PA 3OYJA 3QNOA 3KLEA 4JRPA 4FYDA 4UQGA 3RMBA 3WNGA 2XHBA 1XI1A 1XHZA 1WNSA 2G8UA 2D5RA 4E7JA 3JYTA 4CECA 3VQ9A 2OPQA 4E7IA 2IAJA 3SZ2A 3IG1A 4Y1CA 4DSIA 1IH7A 1QSLA 4KHSA 1TGOA 4M3XA 4BWJA 4I7FA 4KKOA 3L2VA 1ASUA 4AHVA 4CJWA 3OS2A 4B9SA 4KHYA 4KTWA 3TAQA 2GBZA 4KV8A 2PYJA 3L3VA 2ETJA 2D0CA 3MXIA 1U4BA 4OKEA 4HHTA 3VQ7A 4FK0A 3VQ8A 1QQCA 3O3FA 1RDAA 4LH4A 4O44A 4DFKA 1X9WA 4FVMA 4CJSA 3HYFA 4HUEA 5KTQA 3KKRA 3HP9A 4JRQA 1Z25A 1Z26A 4FJXA 4QCLA 3QO9A 1BHLA 1TKXA 1JXBA 2KZZA 4O4GA 2HMIA 1NKBA 4CJRA 3QEWA 1D5AA 2X6SA 3OJUA 3NF7A 2Y1JA 5J1EA 3AA2A 3I0RA 2R7YA 2HVIA 4OGEA 3SQ2A 3LZIA 3SYZA 1IKYA 1JLQA 4DF8A 3HPGA 5JS2A 5J2QA 1TK5A 3RRGA 1XWLA 4CIGA 4BE2A 2JGUA 3MEGA 2GV9A 3OYKA 3E01A 4CJTA 4ID5A 4FJGA 2E6MA 3F73A 1NOYA 1RT6A 4ELUA 3OVNA 4E89A 4ZTFA 2OZSA 4OLAA 4DSJA 2DTUA 4E19A 4E7LA 4I9LA 5SWMA 4RW6A 3SCXA 3ZSZA 3MXMA 1U45A 1SL1A 1I3AA 3QETA 2VG5A 3G0ZA 3AO2A 3CFPA 3V81A 4L8RB 4FK2A 4NCBA 2Z1IA 4FLVA 1U47A 2F8SA 4N76A 5T7BA 1HNIA 3PY8A 5I42A 2HHWA 1RBSA 3C94A 2O4IA 4AHTA 3RTVA 4B9UA 4DSKA 4AILC 2B4JA 3IAYA 1BL3A 3AO3A 2HHVA 3OYDA 3TAEA 1FK9A 4FW1A 4LD0A 5KI6A 2Z1GA 2X6NA 1U48A 1UAXA 1VK0A 4OKJA 2EX3A 4CJKA 4FJNA 3ZSXA 4DTMA 1LWEA 1KVAA 2P51A 4KTZA 3NHGA 4NYNA 1L3UA 3FFIA 4GVMA 1JKHA 1HJRA 3HPHA 3MEDA 4CJ4A 3VQAA 4KHNA 3V1QA 3PUFA 4DFMA 1QE1A 2X78A 2Z1HA 3KIOA 3TI0A 5I3UA 1BQNA 4F3TA 3LANA 4CJLA 4J2BA 1FKOA 1KVCA 1BIZA 4CJEA 1SKSA 1D9DA 3NF6A 5HBMA 2A1SA 3C95A 4DQIA 4CGGA 4DLGA 1J53A 1LWFA 4Y1DA 1BCMA 2G8VA 4FJLA 3AO1A 2FBXA 3L2RA 2DFHA 1S9EA 4BDPA 3LWLA 3LP3A 4HTUA 1TVRA 4N5SA 1X9SA 3ASMA 1YTUA 4DWIA 1C0UA 2E6LA 3LWMA 3LP0A 3NDKA 3QESA 4MFBA 4Z4HA 2KFZA 3HM9A 2LSNA 1KSPA 1K6YA 3OYNA 4B8AB 4AHRA 4W5RA 3QEVA 1TK0A 4FJHA 2HHQA 3ZCMA 1W0HA 4DTSA 4EP4A 4DTJA 1U49A 1T8EA 1T03A 1ZYQA 1L5UA 2HVHA 4DTOA 1SUQA 3K5OA 2I5JA 4CEBA 4ZTJA 1BCOA 2KQ2A 3OY9A 5FROA 3SV4A 4CFDA 3O4QA 4GW6A 4CK1A 4DFJA 3TAMA 5HRNA 5HROA 4FW2A 4CF1A 4BE0A 4FJ8A 3B6OA 4FZZA 1C6VA 1N5YA 1GOBA 1NJXA 1DTTA 3SUPA 1TKTA 1JL2A 2G8WA 5FDLA 3TAGA 1QTMA 3LPUA 4KHWA 1ITGA 4CK2A 4M45A 2G8HA 1TL1A 3CM5A 4CJVA 2W42A 4RW7A 3VA3A 3PO4A 1J54A 3KK1A 3ALYA 3WNFA 1RTJA 4R5PA 3HSTB 3DLGA 3WNHA 3TARA 1HQUA 2F8TA 1RTIA 1YT3A 4FXDA 1WSIA 4C8MA 4DU3A 1G15A 3LAKA 4AHCA 5KGXA 1SV5A 2BE2A 4MQ3A 4CGJA 2KW4A 3L8BA 2XY5A 4TSXA 1WSEA 3L2QA 4CEZA 3VQEA 4KRFA 4IBNA 1VSLA 1HYVA 1WSGA 3AVFA 3V9XA 3K57A 2QXFA 1J5OA 3LP1A 4B3OA 1RBVA 3BGRA 5CYMA 5HRRA 4PWDA 1FXXA 4IG0A 3OYMA 3CG7A 4J2EA 4QOZB 4O55A 3CYMA 2IDOA 4CHQA 1NK9A 1D9FA 2A1RA 1RTDA 3HJFA 2FC0A 1WAFA 1KTQA 5HRPA 3QERA 4F3OA 4M42A 5KRTA 1RDBA 3DI6A 1VRTA 4YNQA 2HHUA 4KTQA 4CJ3A 3QEIA 3DLHA 1EP4A 3MECA 2D0AA 2X74A 1ZBLA 3T1AA 4H8KA 4RW8A 4E7HA 2YHBA 2DY4A 1RDCA 3O4NA 2FBTA 3KLHA 4K8ZA 4KB1A 3AV9A 3AA5X 3O3GA 1TAUA 4WE1A 3OYFA 1GOAA 4LY7A 3A2FA 3AVBA 2WONA 4FCYA 1VRUA 2VWJA 3ZSYA 1LV5A 3THVA 4B8CA 4RG8A 2G8FA 4I2PA 1SL0A 2HHXA 1J9AA 3EZ5A 2HB5A 3NBPA 3QEPA 1C1AA 4OPKA 1TAQA 4CEQA 3TAFA 4ELTA 2PYLA 2Z1JA 4E1NA 1R0AA 4ICLA 4FLXA 4CEOA 1NKCA 2HNZA 3L3UA 4CJQA 3NE6A 4B9LA 3ZT1A 3RMDA 3SV3A 4CK3A 4FJ9A 4CERA 1IO2A 3VQDA 4KO0A 1VSIA 1HPZA 3K5NA 4DTUA 4CHOA 1O1WA 4Z4CA 3NF8A 1SKRA 1RILA 1XC9A 2PY5A 4LH5A 1HQEA 1RTHA 3O3HA 1RBRA 4HUGA 1RBUA 4QAGA 4IKFA 3H08A 1VSMA 4IFYA 2QKKA 3OS0A 3AVHA 2HNYA 1S1VA 3VN5A 3HT3A 3HK2A 4EZ9A 2BGGA 3KLIA 2IOCA 4LSLA 3S3NA 2OYQA 4W5NA 4EP5A 3L2WA 2KTQA 1TV6A 5KGWA 1EKEA 3CFRA 4KHUA 3ISNC 4W5OA 1IKWA 2WOMA 5C42A 5SZTA 3KK2A 4CGFA 3DLEA 3SQ0A 2HNDA 1CXQA 3SUOA 2G8KA 3U6FA 3LPTA 1BI4B 3U3GA 2QKBA 3TAPA 2OA8A 2IGIA 4IG3A 4BDZA 4DG1A 2HHTA 1MU2A 4IDKA 4M3RA 1RT1A 2E4LA 4KPYA 4YFUA 4HVJA 1JLCA 4HUFA 1CZBA 4E0DA 2QK9A 3SQ4A 3TABA 1HYSA 1HRHA 3AA4A 2AJQA 5C24A 3ITHA 4CEAA 3K5MA 1WLJA 1C1BA 1S1TA 4OJRA 4KI6A 3LZJA 2P1JA 3KKSA 1B9FA 2DFFA 1JLEA 1RT7A 5EU7A 1JXEA 3AO4A 3K2PA 1RT5A 4O5BA 3WNEA 1LAVA 1VSFA 4FM0A 3DLBA 1CZ9A 2IS3A 3AVKA 4HCBA 5E41A 4J2DA 2DFEA 5HP1A 4Q5VA 4DSFA 4FM2A 1RT4A 5DMRA 3VA0A 4OLBA 4NCGA 5FRNA 2XO7A 1RCHA 4CF0A 3BDPA 2KZMA 4BWMA 4DSEA 2ZQBA 4W5QA 4ID1A 1JLBA 3HP6A 2OPRA 3CQ8A 4FJJA 4H4OA 4CHZA 1KLMA 4CF8A 3NH0A 4BE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQB A;  3K59 A;  3PV8 A;  3V9W A;  3NF9 A;  1NKE A;  3HVR A;  5FRM A;  1RDD A;  3M8Q A;  2P5G A;  3LDS A;  3OYL A;  2OPP A;  5J2N A;  1VSD A;  1T7P A;  3KLF A;  3NFA A;  3CFO A;  3PO5 A;  4BAC A;  2XRI A;  2YNI A;  4DTN A;  1LAW A;  3DMJ A;  3DOK A;  1NJW A;  3UIQ A;  4M3Y A;  3AA3 A;  4ZHR A;  3ZSQ A;  1TL3 A;  1QS4 A;  1SL2 A;  2FBY A;  1EET A;  3SUN A;  2FBV A;  1VSH A;  1JL1 A;  3TR8 A;  4CFA A;  4N41 A;  1ZBI A;  4FZX C;  3HO1 A;  1RNH A;  3DOL A;  4JS4 A;  4DS5 A;  4JS5 A;  3I0S A;  5CZ1 A;  4FLZ A;  3K58 A;  3RR7 A;  1X9M A;  2YV0 X;  3RR8 A;  3SI6 A;  1C1C A;  1U04 A;  4DQR A;  4DTR A;  4BDY A;  5C25 A;  1NK0 A;  3D45 A;  4C8K A;  1HMV A;  4FJK A;  4JLH A;  3V1O A;  4FZY A;  1HYZ A;  1JLG A;  3F9K A;  4CGD A;  3QNN A;  4LSN A;  4CHN A;  1RBT A;  2OPS A;  1WSJ A;  3OYB A;  3NAE A;  4KRE A;  3PX0 A;  3AO5 A;  4FLU A;  3SQ1 A;  5D3G A;  3KD1 E;  3AVM A;  2YNH A;  4N47 A;  3AVN A;  3OYH A;  2RF2 A;  4CGI A;  3SPZ A;  4C8O A;  3ZT4 A;  2G8I A;  2ZE2 A;  1QSS A;  4FLW A;  4CFC A;  1ZBU A;  2YKN A;  4OKK A;  2VWK A;  3VQ5 A;  2YKM A;  4FM1 A;  3NCI A;  4B9N A;  4FJ7 A;  3QIP A;  2B6A A;  2XY8 A;  3ULD A;  4DS4 A;  3T3F A;  1QSY A;  3NGY A;  1Q9Y A;  3RRH A;  3ZSW A;  3KD5 E;  2OZM A;  3VQ6 A;  3RMC A;  2RN2 A;  3AVG A;  2RKI A;  4PA1 A;  4ELV A;  3RWU A;  3I8D A;  4NCA A;  4PY5 A;  3DRS A;  2GUI A;  5K14 A;  1BGX T;  3C6T A;  3LP2 A;  4DQQ A;  1CLQ A;  3D0P A;  3AVL A;  5DK5 A;  1CXU A;  4M3U A;  3LAL A;  3IS9 A;  3TAN A;  2HW3 A;  3SPY A;  3ZSR A;  1JLA A;  1Q8I A;  4CF2 A;  3SJJ A;  1W9H A;  4M3T A;  3V9Z A;  3AVI A;  3HXM A;  1WAJ A;  4KFB A;  1GOC A;  2YHA A;  3VQQ A;  3V9U A;  3P83 D;  4E7K A;  3V4I A;  1NJY A;  4CJP A;  4M3Z A;  4FK4 A;  1EX4 A;  1KRP A;  2PZS A;  4FJ5 A;  2ZD1 A;  1TKZ A;  1WN7 A;  1B92 A;  1KCF A;  4H4M A;  3MAQ A;  1VSK A;  4CE9 A;  2ATQ A;  4PQU A;  1S5J A;  4CHP A;  4KHQ A;  3OYG A;  3ZSO A;  3QLH A;  4CJF A;  1LW0 A;  3T19 A;  2ITG A;  4J2A A;  4GMJ B;  1NK6 A;  5CZ2 A;  2BDP A;  2RPI A;  1A5W A;  1X1P A;  3ZT2 A;  1A5X A;  4AH9 A;  4CHY A;  1C0M A;  3AVA A;  3MEE A;  4AHS A;  4CJU A;  3OJS A;  4CES A;  4CJ5 A;  3NH1 A;  5J2P A;  4FJI A;  2KFN A;  3KK3 A;  1L3S A;  3CM6 A;  3OYE A;  4DTX A;  3OYI A;  2P5O A;  1S6Q A;  4F4K A;  4C8L A;  3AVJ A;  3QIO A;  1VSE A;  1BIU A;  1JLF A;  3LAM A;  5CY4 A;  2O4G A;  4B08 A;  1TKD A;  4K8X A;  3NH2 A;  1D8Y A;  3SUQ A;  3IRX A;  3DLR A;  4Z4E A;  3KJV A;  3NGI A;  1TK8 A;  3QEX A;  1KFD A;  1NK8 A;  4CEF A;  5JS1 A;  1YVU A;  1ASW A;  3VQC A;  3AVC A;  1UA1 A;  5J2M A;  3HPO A;  1A5V A;  1L3V A;  3DRR A;  1I39 A;  4DFP A;  3V9S A;  3TWH A;  4M3W A;  2XY6 A;  2HHS A;  1IG9 A;  1NJZ A;  4Z4F A;  4HCC A;  1L3T A;  1VSJ A;  3B6P A;  4CFB A;  1ZBF A;  4OVL A;  3JSM A;  4DQS A;  1YTA A;  4RW9 A;  3VQP A;  1LWC A;  3G10 A;  3P1G A;  4C8N A;  3L2U A;  4DF4 A;  1RT2 A;  3S9H A;  1N6Q A;  2VG6 A;  3M8P A;  1BI4 A;  1LW2 A;  1REV A;  3C6U A;  1HNV A;  4DU4 A;  3M8R A;  4B9M A;  4Q0B A;  1KFS A;  4IFV A;  3DYA A;  4KB0 A;  1Y97 A;  4FLY A;  4CIE A;  3SNN A;  1WSH A;  4DLE A;  5HRS A;  4PUO A;  3NGZ A;  4CF9 A;  1DLO A;  4CED A;  3DLK A;  4CEE A;  4G1Q A;  4KAZ A;  3EY1 A;  1BQM A;  2VG7 A;  4FJM A;  4DTP A;  4Z4G A;  4F2R A;  4O0J A;  3KLG A;  1S1W A;  4I2Q A;  1NK5 A;  5KRS A;  2XY7 A;  1F21 A;  4OPJ A;  2YNG A;  1SKW A;  4DMN A;  1NK4 A;  4OGC A;  3QIN A;  5CYQ A;  1B9D A;  4I9Q A;  4XIU A;  1IKX A;  3OYC A;  1UA0 A;  1S9G A;  1IKV A;  3S3M A;  1NK7 A;  4DSL A;  1C0T A;  3HVT A;  2NUB A;  4DU1 A;  3ZSV A;  1NOZ A;  4B9V A;  1QHT A;  2Q3S A;  2B5J A;  4F8R A;  4O0I A;  4E1M A;  4DQP A;  3V1R A;  2F96 A;  3RMA A;  4CIF A;  3ZT3 A;  3K5L A;  1EXQ A;  1DTQ A;  2EHG A;  2YNF A;  3U3Y A;  1T05 A;  3ZT0 A;  4NYF A;  3DM2 A;  2Y1I A;  1ZBH A;  1FKP A;  2BAN A;  3HL8 A;  4F2S A;  2IC3 A;  3VQ4 A;  4AHU A;  4W5T A;  4B9T A;  4RW4 A;  3PX4 A;  1WSF A;  1XHX A;  1UOC A;  2JLE A;  4FLT A;  4M41 A;  3PX6 A;  4CCH A;  4KI4 A;  2D0B A;  1UWB A;  1S1X A;  4Z4I A;  3V6D A;  5HLF A;  1Q9X A;  4Z0U A;  1KVB A;  4CGH A;  3OS1 A;  3EYZ A;  3M8S A;  1BIS A;  1ASV A;  3S3O A;  4N56 A;  3MXJ A;  4EZ6 A;  1KLN A;  4E3S A;  3KTQ A;  3OYA A;  3DRP A;  1RT3 A;  3P5J A;  1S1U A;  1S6P A;  3OYJ A;  3QNO A;  3KLE A;  4JRP A;  4FYD A;  4UQG A;  3RMB A;  3WNG A;  2XHB A;  1XI1 A;  1XHZ A;  1WNS A;  2G8U A;  2D5R A;  4E7J A;  3JYT A;  4CEC A;  3VQ9 A;  2OPQ A;  4E7I A;  2IAJ A;  3SZ2 A;  3IG1 A;  4Y1C A;  4DSI A;  1IH7 A;  1QSL A;  4KHS A;  1TGO A;  4M3X A;  4BWJ A;  4I7F A;  4KKO A;  3L2V A;  1ASU A;  4AHV A;  4CJW A;  3OS2 A;  4B9S A;  4KHY A;  4KTW A;  3TAQ A;  2GBZ A;  4KV8 A;  2PYJ A;  3L3V A;  2ETJ A;  2D0C A;  3MXI A;  1U4B A;  4OKE A;  4HHT A;  3VQ7 A;  4FK0 A;  3VQ8 A;  1QQC A;  3O3F A;  1RDA A;  4LH4 A;  4O44 A;  4DFK A;  1X9W A;  4FVM A;  4CJS A;  3HYF A;  4HUE A;  5KTQ A;  3KKR A;  3HP9 A;  4JRQ A;  1Z25 A;  1Z26 A;  4FJX A;  4QCL A;  3QO9 A;  1BHL A;  1TKX A;  1JXB A;  2KZZ A;  4O4G A;  2HMI A;  1NKB A;  4CJR A;  3QEW A;  1D5A A;  2X6S A;  3OJU A;  3NF7 A;  2Y1J A;  5J1E A;  3AA2 A;  3I0R A;  2R7Y A;  2HVI A;  4OGE A;  3SQ2 A;  3LZI A;  3SYZ A;  1IKY A;  1JLQ A;  4DF8 A;  3HPG A;  5JS2 A;  5J2Q A;  1TK5 A;  3RRG A;  1XWL A;  4CIG A;  4BE2 A;  2JGU A;  3MEG A;  2GV9 A;  3OYK A;  3E01 A;  4CJT A;  4ID5 A;  4FJG A;  2E6M A;  3F73 A;  1NOY A;  1RT6 A;  4ELU A;  3OVN A;  4E89 A;  4ZTF A;  2OZS A;  4OLA A;  4DSJ A;  2DTU A;  4E19 A;  4E7L A;  4I9L A;  5SWM A;  4RW6 A;  3SCX A;  3ZSZ A;  3MXM A;  1U45 A;  1SL1 A;  1I3A A;  3QET A;  2VG5 A;  3G0Z A;  3AO2 A;  3CFP A;  3V81 A;  4L8R B;  4FK2 A;  4NCB A;  2Z1I A;  4FLV A;  1U47 A;  2F8S A;  4N76 A;  5T7B A;  1HNI A;  3PY8 A;  5I42 A;  2HHW A;  1RBS A;  3C94 A;  2O4I A;  4AHT A;  3RTV A;  4B9U A;  4DSK A;  4AIL C;  2B4J A;  3IAY A;  1BL3 A;  3AO3 A;  2HHV A;  3OYD A;  3TAE A;  1FK9 A;  4FW1 A;  4LD0 A;  5KI6 A;  2Z1G A;  2X6N A;  1U48 A;  1UAX A;  1VK0 A;  4OKJ A;  2EX3 A;  4CJK A;  4FJN A;  3ZSX A;  4DTM A;  1LWE A;  1KVA A;  2P51 A;  4KTZ A;  3NHG A;  4NYN A;  1L3U A;  3FFI A;  4GVM A;  1JKH A;  1HJR A;  3HPH A;  3MED A;  4CJ4 A;  3VQA A;  4KHN A;  3V1Q A;  3PUF A;  4DFM A;  1QE1 A;  2X78 A;  2Z1H A;  3KIO A;  3TI0 A;  5I3U A;  1BQN A;  4F3T A;  3LAN A;  4CJL A;  4J2B A;  1FKO A;  1KVC A;  1BIZ A;  4CJE A;  1SKS A;  1D9D A;  3NF6 A;  5HBM A;  2A1S A;  3C95 A;  4DQI A;  4CGG A;  4DLG A;  1J53 A;  1LWF A;  4Y1D A;  1BCM A;  2G8V A;  4FJL A;  3AO1 A;  2FBX A;  3L2R A;  2DFH A;  1S9E A;  4BDP A;  3LWL A;  3LP3 A;  4HTU A;  1TVR A;  4N5S A;  1X9S A;  3ASM A;  1YTU A;  4DWI A;  1C0U A;  2E6L A;  3LWM A;  3LP0 A;  3NDK A;  3QES A;  4MFB A;  4Z4H A;  2KFZ A;  3HM9 A;  2LSN A;  1KSP A;  1K6Y A;  3OYN A;  4B8A B;  4AHR A;  4W5R A;  3QEV A;  1TK0 A;  4FJH A;  2HHQ A;  3ZCM A;  1W0H A;  4DTS A;  4EP4 A;  4DTJ A;  1U49 A;  1T8E A;  1T03 A;  1ZYQ A;  1L5U A;  2HVH A;  4DTO A;  1SUQ A;  3K5O A;  2I5J A;  4CEB A;  4ZTJ A;  1BCO A;  2KQ2 A;  3OY9 A;  5FRO A;  3SV4 A;  4CFD A;  3O4Q A;  4GW6 A;  4CK1 A;  4DFJ A;  3TAM A;  5HRN A;  5HRO A;  4FW2 A;  4CF1 A;  4BE0 A;  4FJ8 A;  3B6O A;  4FZZ A;  1C6V A;  1N5Y A;  1GOB A;  1NJX A;  1DTT A;  3SUP A;  1TKT A;  1JL2 A;  2G8W A;  5FDL A;  3TAG A;  1QTM A;  3LPU A;  4KHW A;  1ITG A;  4CK2 A;  4M45 A;  2G8H A;  1TL1 A;  3CM5 A;  4CJV A;  2W42 A;  4RW7 A;  3VA3 A;  3PO4 A;  1J54 A;  3KK1 A;  3ALY A;  3WNF A;  1RTJ A;  4R5P A;  3HST B;  3DLG A;  3WNH A;  3TAR A;  1HQU A;  2F8T A;  1RTI A;  1YT3 A;  4FXD A;  1WSI A;  4C8M A;  4DU3 A;  1G15 A;  3LAK A;  4AHC A;  5KGX A;  1SV5 A;  2BE2 A;  4MQ3 A;  4CGJ A;  2KW4 A;  3L8B A;  2XY5 A;  4TSX A;  1WSE A;  3L2Q A;  4CEZ A;  3VQE A;  4KRF A;  4IBN A;  1VSL A;  1HYV A;  1WSG A;  3AVF A;  3V9X A;  3K57 A;  2QXF A;  1J5O A;  3LP1 A;  4B3O A;  1RBV A;  3BGR A;  5CYM A;  5HRR A;  4PWD A;  1FXX A;  4IG0 A;  3OYM A;  3CG7 A;  4J2E A;  4QOZ B;  4O55 A;  3CYM A;  2IDO A;  4CHQ A;  1NK9 A;  1D9F A;  2A1R A;  1RTD A;  3HJF A;  2FC0 A;  1WAF A;  1KTQ A;  5HRP A;  3QER A;  4F3O A;  4M42 A;  5KRT A;  1RDB A;  3DI6 A;  1VRT A;  4YNQ A;  2HHU A;  4KTQ A;  4CJ3 A;  3QEI A;  3DLH A;  1EP4 A;  3MEC A;  2D0A A;  2X74 A;  1ZBL A;  3T1A A;  4H8K A;  4RW8 A;  4E7H A;  2YHB A;  2DY4 A;  1RDC A;  3O4N A;  2FBT A;  3KLH A;  4K8Z A;  4KB1 A;  3AV9 A;  3AA5 X;  3O3G A;  1TAU A;  4WE1 A;  3OYF A;  1GOA A;  4LY7 A;  3A2F A;  3AVB A;  2WON A;  4FCY A;  1VRU A;  2VWJ A;  3ZSY A;  1LV5 A;  3THV A;  4B8C A;  4RG8 A;  2G8F A;  4I2P A;  1SL0 A;  2HHX A;  1J9A A;  3EZ5 A;  2HB5 A;  3NBP A;  3QEP A;  1C1A A;  4OPK A;  1TAQ A;  4CEQ A;  3TAF A;  4ELT A;  2PYL A;  2Z1J A;  4E1N A;  1R0A A;  4ICL A;  4FLX A;  4CEO A;  1NKC A;  2HNZ A;  3L3U A;  4CJQ A;  3NE6 A;  4B9L A;  3ZT1 A;  3RMD A;  3SV3 A;  4CK3 A;  4FJ9 A;  4CER A;  1IO2 A;  3VQD A;  4KO0 A;  1VSI A;  1HPZ A;  3K5N A;  4DTU A;  4CHO A;  1O1W A;  4Z4C A;  3NF8 A;  1SKR A;  1RIL A;  1XC9 A;  2PY5 A;  4LH5 A;  1HQE A;  1RTH A;  3O3H A;  1RBR A;  4HUG A;  1RBU A;  4QAG A;  4IKF A;  3H08 A;  1VSM A;  4IFY A;  2QKK A;  3OS0 A;  3AVH A;  2HNY A;  1S1V A;  3VN5 A;  3HT3 A;  3HK2 A;  4EZ9 A;  2BGG A;  3KLI A;  2IOC A;  4LSL A;  3S3N A;  2OYQ A;  4W5N A;  4EP5 A;  3L2W A;  2KTQ A;  1TV6 A;  5KGW A;  1EKE A;  3CFR A;  4KHU A;  3ISN C;  4W5O A;  1IKW A;  2WOM A;  5C42 A;  5SZT A;  3KK2 A;  4CGF A;  3DLE A;  3SQ0 A;  2HND A;  1CXQ A;  3SUO A;  2G8K A;  3U6F A;  3LPT A;  1BI4 B;  3U3G A;  2QKB A;  3TAP A;  2OA8 A;  2IGI A;  4IG3 A;  4BDZ A;  4DG1 A;  2HHT A;  1MU2 A;  4IDK A;  4M3R A;  1RT1 A;  2E4L A;  4KPY A;  4YFU A;  4HVJ A;  1JLC A;  4HUF A;  1CZB A;  4E0D A;  2QK9 A;  3SQ4 A;  3TAB A;  1HYS A;  1HRH A;  3AA4 A;  2AJQ A;  5C24 A;  3ITH A;  4CEA A;  3K5M A;  1WLJ A;  1C1B A;  1S1T A;  4OJR A;  4KI6 A;  3LZJ A;  2P1J A;  3KKS A;  1B9F A;  2DFF A;  1JLE A;  1RT7 A;  5EU7 A;  1JXE A;  3AO4 A;  3K2P A;  1RT5 A;  4O5B A;  3WNE A;  1LAV A;  1VSF A;  4FM0 A;  3DLB A;  1CZ9 A;  2IS3 A;  3AVK A;  4HCB A;  5E41 A;  4J2D A;  2DFE A;  5HP1 A;  4Q5V A;  4DSF A;  4FM2 A;  1RT4 A;  5DMR A;  3VA0 A;  4OLB A;  4NCG A;  5FRN A;  2XO7 A;  1RCH A;  4CF0 A;  3BDP A;  2KZM A;  4BWM A;  4DSE A;  2ZQB A;  4W5Q A;  4ID1 A;  1JLB A;  3HP6 A;  2OPR A;  3CQ8 A;  4FJJ A;  4H4O A;  4CHZ A;  1KLM A;  4CF8 A;  3NH0 A;  4BE1 A; 
#chains in the Genus database with same CATH topology
 3ATU A;  4FWS A;  1WBD A;  1HJO A;  4YOW A;  4U7B A;  3V9W A;  3NF9 A;  1GLC G;  3QFP A;  3H45 C;  2O8E A;  3LDS A;  1VSD A;  1N8R O;  3PO5 A;  4BAC A;  2XRI A;  4IOC L;  4DTN A;  1LAW A;  3DOK A;  3UIQ A;  2HF3 A;  3BP8 A;  5FPD A;  3TR8 A;  1JL1 A;  4CFA A;  1ZBI A;  5AQG A;  3JS6 A;  3DXK A;  4FLZ A;  1GLA G;  1QQM A;  1X9M A;  3TSU A;  2D0P A;  4DTR A;  1NGI A;  4C8K A;  4ISG A;  1JLG A;  4BRM A;  1HR0 K;  1E4G T;  4DV2 K;  2QM1 A;  3NAE A;  4CD3 A;  3SQ1 A;  3KD1 E;  3AVM A;  1IG8 A;  4UY8 O;  2RF2 A;  4CGI A;  5AZI A;  1QSS A;  4FLW A;  3HOS A;  2VWK A;  1BUP A;  2YHW A;  1VQL N;  2QW9 A;  2XY8 A;  3SLC A;  1Q9Y A;  3CCV N;  2P9N B;  3VQ6 A;  5LJW A;  3LP2 A;  5I9E B;  4DV5 K;  4DCH A;  5KPR A;  4M3U A;  3TAN A;  3ZSR A;  3V9Z A;  3V4I A;  1NJY A;  4CJP A;  5CHI A;  1KRP A;  3D2F A;  1WN7 A;  1XC3 A;  1HKC A;  4JD2 B;  4PKI A;  1VSK A;  4YOR A;  1S5J A;  5HL7 L;  5CE3 A;  3QLH A;  1KC8 O;  1DGK N;  1X1P A;  1A5X A;  5MLC Q;  4MO4 A;  4CJ5 A;  5J2P A;  3IMX A;  2Q2R A;  4FVU A;  3AVJ A;  1JLF A;  5CY4 A;  1D8Y A;  2ZWH A;  3SAG A;  4Z4E A;  1TK8 A;  3QEX A;  2CGJ A;  3MX2 A;  3CJB A;  1NK8 A;  5JS1 A;  4NXM K;  1UA1 A;  3H3O B;  4DFP A;  4LFB K;  3QBW A;  3O6W A;  3F9M A;  2HHS A;  1IG9 A;  3UKR B;  4HCC A;  4BRL A;  3JSM A;  3P1G A;  3L2U A;  3S9H A;  3VEN A;  3W3D A;  1P8Z A;  4DV7 K;  1Y97 A;  4DLE A;  4K43 A;  4BRC A;  4CZG A;  4CF9 A;  4BGA A;  1OVQ A;  3LL3 A;  1GLB G;  3KLG A;  4I2Q A;  3BZK A;  2O8E B;  2XY7 A;  2UXD K;  4OPJ A;  4DV1 K;  1QQN A;  1J6Z A;  4OGC A;  1IKX A;  1UA0 A;  2QWQ A;  1IKV A;  4B3M K;  1NK7 A;  3U9Z A;  1DT9 A;  4B9V A;  4E1M A;  3KWG A;  2YNF A;  3DXK B;  3OW2 M;  4FWO A;  4NYF A;  2QWP A;  4YDU A;  3AGK A;  3C6H A;  3A5O C;  2A40 A;  5GAE P;  1XHX A;  3WQT A;  1UWB A;  1S1X A;  1U2V A;  4Z4I A;  4Z0U A;  1KVB A;  1BIS A;  4BR7 A;  1M1K O;  4N56 A;  1KLN A;  5AZI B;  2HOE A;  5C12 A;  3DRP A;  1RT3 A;  2P9U A;  4FYD A;  1S6P A;  4FL9 A;  1XI1 A;  3WNG A;  2G8U A;  2D5R A;  5FPN A;  4BRQ A;  1WOQ A;  2GWJ A;  3BF1 A;  3DWL A;  4EAH D;  4NO7 A;  1T44 A;  1TGO A;  1Z05 A;  2CH5 A;  4CJW A;  4O8K A;  2FF3 B;  2GBZ A;  2UXC K;  5H1S Q;  2D0C A;  3O08 A;  4OKE A;  4FK0 A;  3I8B A;  4K42 A;  1QQC A;  3RSE A;  1RDA A;  4O44 A;  3VQ8 A;  4B9Q A;  2QTD A;  1X9W A;  1QVF M;  1Q7Y O;  4BR2 A;  3B8A X;  5KTQ A;  3D2F B;  4JRQ A;  4QCL A;  1JXB A;  4WFA L;  1NKB A;  3QEW A;  2R7Y A;  2FLO A;  3SQ2 A;  2IVN A;  1YUW A;  5J2Q A;  3RRG A;  5BN9 A;  3HPG A;  1QHA A;  3CHW A;  3CCU N;  2JGU A;  2E6M A;  2YHX A;  2DTU A;  1FJG K;  5SWM A;  1SL1 A;  1NJI O;  2VG5 A;  1QZ5 A;  3G0Z A;  3CFP A;  4FK2 A;  4RWT A;  1Q86 O;  2P9I B;  1HNI A;  2ZF5 O;  4JEP A;  5I42 A;  3MWT A;  2HHW A;  1RBS A;  4YHH K;  4AHT A;  4B9U A;  2B4J A;  3IAY A;  3M1F A;  3TAE A;  1MA9 B;  5KI6 A;  1U48 A;  2Z1G A;  4FWQ A;  4FJN A;  1N36 K;  4BC3 A;  2P51 A;  3U8X A;  2F4V K;  3NHG A;  3HTV A;  3HPH A;  4CJ4 A;  4DFM A;  2X78 A;  3JXU A;  4KH4 A;  2Z1H A;  3TI0 A;  5I3U A;  3EL2 A;  4CJL A;  4NLC A;  1BIZ A;  3THW A;  2Q0U A;  4Y1D A;  3THX A;  4FJL A;  1TVR A;  4N5S A;  3ASM A;  3LWM A;  4BC4 A;  4BR9 A;  2KFZ A;  4DV6 K;  4B8A B;  5M1F A;  4AHR A;  3QEV A;  2HHQ A;  3ZCM A;  1T8E A;  4JYA K;  1ZYQ A;  2HVH A;  4CFD A;  5C2D A;  4DFJ A;  4A2A A;  4BE0 A;  1C6V A;  2A41 A;  3SUP A;  3UKU A;  3QDK A;  3VGM A;  1C0G A;  1ITG A;  4KHW A;  4CK2 A;  2AA4 A;  4M45 A;  2W40 A;  3VA3 A;  1WUA A;  4IO8 A;  1T6D A;  4IEI A;  1U2V B;  4BRE A;  1VQM N;  1RTI A;  1YT3 A;  3BF3 A;  4C8M A;  4B1V A;  1G15 A;  4EHU A;  3LAK A;  1DKG D;  4AHC A;  3CCE N;  2NRV A;  3PSF A;  3LDQ A;  4OPA A;  3EKU A;  1BDG A;  3VEO A;  1VSL A;  1WSG A;  3V9X A;  2QXF A;  3BGR A;  5HRR A;  4IG0 A;  5ELZ A;  4G9Z A;  3VF2 A;  2IDO A;  4CHQ A;  2IVP A;  4ILH A;  1RTD A;  2O8D A;  4M42 A;  4JI5 K;  4XH4 A;  3VEV A;  4YDU C;  5AQQ A;  3CMA N;  4KHP K;  1VRT A;  3FR0 A;  4KTQ A;  1HLU A;  2VQE K;  4R79 A;  4MDB A;  3RVC A;  4PL7 A;  4E7H A;  4DR4 K;  3O4N A;  2FBT A;  4K8Z A;  4KB1 A;  3AA5 X;  3O3G A;  4WE1 A;  1GOA A;  1X3M A;  3ZSY A;  4A57 A;  3CER A;  3QML A;  4MO5 A;  1BG3 A;  1J9A A;  2HB5 A;  4JI1 K;  3O1W A;  1C1A A;  2Q1N A;  1NGH A;  4WFB L;  1YJN N;  3HBT A;  1SZ2 A;  4BRG A;  1K73 O;  2V7Y A;  3NE6 A;  3ZT1 A;  3SV3 A;  4CER A;  1VSI A;  4H0T B;  1HPZ A;  2YCH A;  4CHO A;  3NF8 A;  1RIL A;  4QAG A;  1IBL K;  1N33 K;  1VSM A;  3AVH A;  2HNY A;  3VN5 A;  3HT3 A;  5M1K A;  3CCJ N;  1YJ9 N;  1VQK N;  2BGG A;  3KLI A;  2IOC A;  3K0S A;  4LSL A;  2KTQ A;  3ISN C;  3ULE A;  2V52 B;  2WOM A;  5SZT A;  3KK2 A;  3DLE A;  3SQ0 A;  1CXQ A;  3U6F A;  3H46 O;  3TAP A;  2OA8 A;  2HHT A;  1OH6 A;  4DUY K;  3THW B;  1RT1 A;  2E4L A;  4YFU A;  4HVJ A;  4HUF A;  3THX B;  1CZB A;  3TAB A;  1HRH A;  3AA4 A;  5BR9 A;  1WLJ A;  4OJR A;  4AM6 A;  1B9F A;  1RT7 A;  3HSC A;  3CPE A;  3J8A A;  3K2P A;  4JI6 K;  1VSF A;  3SBG A;  2ZM6 K;  4Q5V A;  3VA0 A;  1GLL O;  3KZB A;  4BWM A;  4A62 A;  3T1H K;  2OPR A;  3CQ8 A;  4FJJ A;  3ENO A;  4CHZ A;  1G99 A;  4Z4F A;  3CC2 N;  1EWR A;  3TPQ A;  3O9U A;  3MN7 A;  3PV8 A;  3E9O A;  3FZH A;  5EVZ A;  1VQ7 N;  3OYL A;  2OPP A;  5J2N A;  3THY A;  1NJW A;  4M3Y A;  3O9S A;  3AGR A;  2A42 A;  1QS4 A;  1SL2 A;  5M1N A;  3VF4 A;  4CJ7 A;  4N41 A;  4DS5 A;  4JS5 A;  2O8D B;  5CZ1 A;  1NK0 A;  1HMV A;  3V1O A;  4FZY A;  2QWO A;  3F9K A;  4CGD A;  4YOY A;  3SK3 A;  4M7X A;  3OYB A;  4KRE A;  3AO5 A;  4FLU A;  2YNH A;  3AVN A;  5JLH A;  3OYH A;  3SPZ A;  4C8O A;  2YJE A;  5FPM A;  1XMO K;  2FSK A;  2YKM A;  1K8A O;  3NCI A;  3R3L A;  3MCP A;  2B6A A;  4DS4 A;  1QSY A;  3QFU A;  3NGY A;  5AJ3 K;  3ZSW A;  3KD5 E;  2RKI A;  4PY5 A;  1HNZ K;  1CLQ A;  3C6T A;  4DQQ A;  4IO9 L;  5DK5 A;  3F2K A;  3LAL A;  4C1N K;  4CF2 A;  4M3T A;  3HXM A;  3VQQ A;  3V9U A;  4E7K A;  1YXQ A;  3PSI A;  4FK4 A;  2ZD1 A;  1TKZ A;  1YIJ N;  3CD6 N;  1JJ2 M;  4BRI A;  1KCF A;  4CHP A;  4KHQ A;  3ZSO A;  3T19 A;  2UU9 K;  3ULE B;  1NMN A;  1NK6 A;  2WUS A;  3AVA A;  4AHS A;  4CJU A;  1TUU A;  3OJS A;  4BGB A;  2KFN A;  1X9J A;  1NGF A;  3U9D A;  2RE2 A;  2P5O A;  1S6Q A;  3TSP A;  4B08 A;  3J7Z O;  4K8X A;  3SUQ A;  3IRX A;  3PIP L;  3NGI A;  1KFD A;  4CEF A;  4KH6 A;  1ASW A;  3VQC A;  3A8Y A;  1A5V A;  2ITM A;  2BH1 A;  2XY6 A;  4X64 K;  1NJZ A;  3B6P A;  3TU5 A;  4DR6 K;  1RT2 A;  5AFU H;  2VG6 A;  3ENB A;  3M8P A;  1BI4 A;  1REV A;  4DU4 A;  1KFS A;  4H5N A;  1WSH A;  3T69 A;  2F9W A;  5AQK A;  5HRS A;  2WTU A;  3AY9 A;  4CED A;  4BR4 A;  3DLK A;  4CEE A;  2VG7 A;  3SMS A;  4DTP A;  4Z4G A;  2WBN A;  2RHK A;  1S1W A;  1HUX A;  4DR2 K;  1NK5 A;  3CI5 A;  5KRS A;  2YNG A;  5AFU A;  3THY B;  1H1V A;  2O8F A;  3E9L A;  3O4W A;  3CET A;  4H5R A;  4BY9 C;  4PL8 A;  1ZC6 A;  4B1U B;  3IDH A;  3J7Y P;  3J7A P;  3ATV A;  5FPE A;  1QHT A;  2Q3S A;  2B5J A;  4O0I A;  4DQP A;  3V1R A;  2E2O A;  4CIF A;  3K5L A;  1EXQ A;  2EHG A;  3H6E A;  3U3Y A;  1T05 A;  3DM2 A;  2Y1I A;  1ZBH A;  2BAN A;  3HL8 A;  4F2S A;  2IC3 A;  4CBX A;  4AHU A;  4B9T A;  2JLE A;  3GOI A;  1NGD A;  4KI4 A;  5ADX H;  3KK7 A;  3MDQ A;  5HLF A;  3OS1 A;  3EYZ A;  3MXJ A;  4E3S A;  4GV3 A;  3FE1 A;  4GV6 A;  4PKH A;  5LJV A;  3QNO A;  3OYJ A;  3H1V X;  3KLE A;  4WF9 L;  4UQG A;  1WNS A;  1HPM A;  4E7J A;  3JYT A;  4GNI A;  1ATS A;  4CEC A;  2OPQ A;  4DQ8 A;  4E7I A;  2IAJ A;  3IG1 A;  4KH5 A;  4KHS A;  5FLX O;  5ADX A;  4KKO A;  4BRP A;  3BY5 A;  3IKM A;  4KTW A;  5BR8 K;  3MXI A;  1U4B A;  5LMU K;  3O3F A;  4FVM A;  3KVG A;  4CJS A;  1VHX A;  3CJ7 A;  1Z25 A;  3QO9 A;  3A5L C;  4BRK A;  3O9T A;  4CJR A;  2X6S A;  3OJU A;  5J1E A;  3ID8 A;  3SYZ A;  1TK5 A;  2OTJ N;  3L0Q A;  3IUC A;  2V7Z A;  1KAZ A;  5BPN A;  1M90 O;  5AQY A;  5GIN A;  3Q7B A;  3CJC A;  3F73 A;  1NOY A;  1RT6 A;  3OVN A;  4BRF A;  4CVN E;  3BZC A;  4OLA A;  4H5V A;  4DSJ A;  4E7L A;  4I9L A;  4RW6 A;  3SCX A;  3MXM A;  1TYQ A;  4IXC A;  3WEE A;  3AO2 A;  4N76 A;  5T7B A;  3PY8 A;  3M5R A;  1K9M O;  1FK9 A;  1XMQ K;  2X6N A;  4CJK A;  4JKE A;  4X66 K;  3ZSX A;  4JHD A;  4KTZ A;  4X65 K;  4JK7 A;  1SAZ A;  1OVY A;  4GVM A;  3MED A;  4KHN A;  3R9P A;  3KIO A;  1HNW K;  1BQN A;  5KQD A;  2V51 B;  1XNR K;  1NGJ A;  3NF6 A;  2A1S A;  4NXN K;  4CGG A;  1LWF A;  2HST A;  3L2R A;  5LY3 A;  2DFH A;  3CC4 N;  4BDP A;  2PFU A;  3LP3 A;  4HTU A;  1X9S A;  1YTU A;  3VOV A;  4IZ9 A;  3QES A;  4JV5 K;  4IEE A;  3OHR A;  4DUZ K;  2LSN A;  1KSP A;  1K6Y A;  1NMD A;  1TK0 A;  1W0H A;  4DTJ A;  2HHH K;  3TSQ A;  1T03 A;  1L5U A;  4DTO A;  1SUQ A;  3K5O A;  2I5J A;  4I6M A;  2JWK A;  4ZTJ A;  5AQF A;  5FRO A;  3SV4 A;  5BN8 A;  4CK1 A;  4M7Y A;  5HRO A;  4FJ8 A;  4FZZ A;  3EKS A;  3SJH A;  3VGK A;  4RTF D;  4CZI A;  1TKT A;  3TAG A;  1NGB A;  4CJV A;  4WQ4 A;  3WNF A;  1WB9 A;  4F9O A;  3LDN A;  1BO5 O;  2F8T A;  2WC9 A;  4DR3 K;  1WSI A;  4DU3 A;  2IIR A;  1YHQ N;  3GDQ A;  4QS8 A;  2BE2 A;  1Q81 O;  4CGJ A;  3L8B A;  1WSE A;  3MN9 A;  4BRA A;  2WFB A;  3VEW A;  4CEZ A;  3VQE A;  3EO3 A;  2O8C A;  3AVF A;  3K57 A;  3VEX A;  3SMP A;  4B3O A;  3H3N O;  4PWD A;  3OYM A;  4J2E A;  4QOZ B;  1MDU B;  4J8F A;  5BRE A;  1KTQ A;  5HRP A;  4YOT A;  1BOT O;  3FZK A;  2W6K A;  3G25 A;  4CD1 A;  3E9P A;  3DLH A;  1EP4 A;  3MEC A;  3P38 A;  2YHB A;  5M1O A;  3KLH A;  4BRN A;  4AF1 A;  3AV9 A;  1TAU A;  4LY7 A;  2FF6 A;  2KLA A;  2WON A;  3AVB A;  3THV A;  4DHY A;  1SL0 A;  1RGI A;  3EZ5 A;  3QEP A;  4B3R K;  1TAQ A;  5IWA K;  5AQI A;  4CEQ A;  4ELT A;  1J5E K;  1KAY A;  2Z1J A;  4FLX A;  3U4L A;  1NKC A;  2GX9 A;  3L3U A;  3RMD A;  4CK3 A;  3DXM A;  4C23 A;  4FJ9 A;  3FZL A;  4KO0 A;  3IFR A;  1TYQ B;  1HQE A;  1RTH A;  1CZA N;  2OCE A;  3O3H A;  1RBU A;  4IKF A;  3O8M A;  2H3G X;  3H08 A;  4IFY A;  2VCP A;  2OYQ A;  3MMV A;  4JN4 A;  4W5N A;  4JHD B;  3TTD A;  3NVM A;  3CCS N;  4BQZ A;  5JMV A;  3SUO A;  2G8K A;  3LPT A;  3CME N;  2QKB A;  4IG3 A;  4DG1 A;  3CJA A;  4M3R A;  4L3Q A;  4KPY A;  1JLC A;  1HYS A;  4JI8 K;  3N4Q A;  1RFQ A;  3ITH A;  4BC5 A;  1LOT B;  4O5F A;  1S1T A;  3KKS A;  4M63 C;  2DFF A;  1JLE A;  4BRH A;  3ZET A;  4EFH A;  1RT5 A;  4I6M B;  3DLB A;  1CZ9 A;  4J2D A;  3AVK A;  2HVI A;  4OLB A;  1RT4 A;  4NCG A;  1JCF A;  5AQU A;  4CF0 A;  3BDP A;  2KZM A;  3BEX A;  4FOE A;  4DSE A;  1IJJ A;  4W5Q A;  4XH5 A;  5AQZ A;  1EO1 A;  1KXP A;  3EN9 A;  1HX1 A;  4JK9 A;  3FZM A;  4BE1 A;  3DAW A;  4B3T K;  1NKE A;  4A59 A;  3HVR A;  5FRM A;  3M8Q A;  2P5G A;  3KLF A;  3CFO A;  3EE8 A;  3UB5 A;  2YNI A;  3AA3 A;  1TL3 A;  2P9U B;  2D4W A;  2O8C B;  5EY4 A;  3SUN A;  1VSH A;  5EXW A;  3NVK A;  1RNH A;  3DOL A;  4JS4 A;  3I0S A;  1HKB A;  3T7Z A;  3RR7 A;  4K41 A;  4BVP A;  3RR8 A;  1C1C A;  4H0P A;  4DQR A;  1S72 N;  1SS6 A;  3D45 A;  1NGC A;  1HYZ A;  4HWI A;  4CHN A;  1RBT A;  2OPS A;  4WQ4 C;  2F9T A;  3RSE B;  5JIC A;  1T3V A;  1GLE G;  3PIO L;  3PX0 A;  3VMF B;  3I56 N;  3Q7C A;  5D3G A;  3A5N C;  4N47 A;  3SAF A;  1C0F A;  4MLH A;  4MDA A;  3K9K A;  3ZT4 A;  2YKN A;  4OKK A;  3QIP A;  3T3F A;  1ATN A;  1SQK A;  2RN2 A;  4PA1 A;  4NCA A;  3DRS A;  4FWK A;  3DXM B;  3AVL A;  4DKW A;  1CXU A;  5DM6 L;  4GV9 A;  1W9H A;  3FZF A;  1WAJ A;  1GOC A;  4FWP A;  1NWK A;  3JAM O;  2E5L K;  4M3Z A;  1EX4 A;  5DM7 L;  4CW7 B;  1B92 A;  1S22 A;  1V4S A;  2ZJR L;  1RDU A;  4XH1 A;  4J2A A;  5CZ2 A;  2RPI A;  3ZT2 A;  4AH9 A;  3MEE A;  3FLC O;  4WQ5 A;  4FJI A;  1L3S A;  4DTX A;  3QIO A;  1VSE A;  3LAM A;  4IFE A;  1NG9 A;  1TKD A;  3KJV A;  4OPH A;  3G4S N;  5J2M A;  2D1K A;  3HPO A;  1L3V A;  3DRR A;  3ZLJ A;  3V9S A;  3TWH A;  2HF4 A;  3ENH A;  2ZGZ A;  2F7T A;  5AQL A;  4OVL A;  3VQP A;  1YTA A;  1LWC A;  3G10 A;  4JK8 A;  3GG4 A;  3ZYY X;  4Z94 A;  3C6U A;  1LW2 A;  3O80 A;  4BVO A;  3GL1 A;  4Q0B A;  4IFV A;  3DYA A;  4KB0 A;  4FLY A;  4JI0 K;  4FWL A;  2ZJP L;  3UKU B;  2AP1 A;  4IOA L;  3KWI A;  4G1Q A;  3EY1 A;  4WYB A;  4O0J A;  3VEZ A;  4JNE A;  1ATR A;  1F21 A;  2GEL A;  1SKW A;  3QIN A;  5LL6 Z;  3ZEU A;  3NMU A;  3VEY A;  3S3M A;  3HRG A;  1NGE A;  2QWL A;  4PKG A;  3N4P A;  3ZSV A;  5JVH L;  3P31 A;  2F96 A;  5JLF A;  3RMA A;  3ZT3 A;  2P9K A;  1GLF O;  3QBX A;  2HBL A;  4LFA K;  1X3N A;  4LF4 K;  4RW4 A;  1WSF A;  4AM7 A;  4FLT A;  4CCH A;  4NLB A;  2OAN A;  4M41 A;  3V6D A;  1Q9X A;  4ISE A;  4CGH A;  2P9L A;  3SAH A;  4EZ6 A;  5E84 A;  1XUP O;  3P5J A;  1S1U A;  4JRP A;  3LM2 A;  3RMB A;  4LF6 K;  5KPT A;  2QA4 N;  4H0Y B;  4CZL A;  2Q36 A;  1XHZ A;  2NZT A;  3BUZ B;  4Y1C A;  4X62 K;  1QSL A;  4YOX A;  2NRZ A;  4BWJ A;  3WXL A;  4I7F A;  3L2V A;  1ASU A;  4AHV A;  4KHY A;  4H0V B;  3TAQ A;  3VPZ A;  2PYJ A;  3L3V A;  3VTI A;  4HHT A;  3VQ7 A;  3W0L A;  4YOU A;  4JI7 K;  4DFK A;  3HYF A;  2EWS A;  2CGL A;  3HP9 A;  4FJX A;  4IOX A;  1OH5 A;  2KZZ A;  4O4G A;  3D7E O;  5BPL A;  3AA2 A;  3I0R A;  3LZI A;  1IKY A;  1JLQ A;  4JKB A;  5JS2 A;  2CH6 A;  2GV9 A;  3OA9 A;  3OYK A;  4CJT A;  4ID5 A;  4FJG A;  3KHY A;  4JKA A;  4ZTF A;  5AQP A;  1D4X A;  4E19 A;  1BA1 A;  2CGK A;  4A5A A;  2I7N A;  2E8A A;  2IVO A;  4L8R B;  1U47 A;  1E4F T;  4C1N I;  2QI2 A;  4BR5 A;  3WUH A;  1W7A A;  2O4I A;  2HHV A;  4DSK A;  4AIL C;  3AO3 A;  3L4Q A;  1NBW A;  4FW1 A;  1UAX A;  1VK0 A;  4OKJ A;  1LWE A;  1KVA A;  5KQ8 A;  1L3U A;  4H0X B;  4NYN A;  4H03 B;  1JKH A;  1HJR A;  3VQA A;  3F5T A;  1QE1 A;  3LAN A;  3HI0 A;  5F2R A;  1FKO A;  1KVC A;  4CJE A;  3HM8 A;  4WQ5 C;  1VQP N;  1SKS A;  1D9D A;  4DLG A;  1GLJ O;  2P9S A;  1GLD G;  2FBX A;  5AR0 A;  5LMN K;  2E20 A;  3NDK A;  4Y0W A;  2VWB A;  1OKJ A;  3TTF A;  3ZEU B;  1VQO N;  4FJH A;  1U49 A;  5AQJ A;  3A5M C;  4CEB A;  1BCO A;  2KQ2 A;  3O4Q A;  3J80 O;  2P9K B;  5HRN A;  1VQN N;  3OBY A;  3B6O A;  1N5Y A;  1NJX A;  1ZBS A;  4JKH A;  5FDL A;  4JI4 K;  2G8H A;  3CM5 A;  4OX9 K;  2W42 A;  3CIP A;  3LDO A;  1K8K A;  1J54 A;  3PO4 A;  3ALY A;  4WCE L;  3WNH A;  5A2Q O;  2I7P A;  3VF6 A;  2P9L B;  4FXD A;  3CPW M;  3VER A;  1SV5 A;  2GWK A;  4MQ3 A;  2XY5 A;  1J5O A;  1RBV A;  5EOY A;  5CYM A;  3WXJ A;  2UXB K;  5M1Q A;  3CG7 A;  4YOV A;  5TKW A;  2VGN A;  3CYM A;  1NK9 A;  1D9F A;  2A1R A;  2FC0 A;  1WAF A;  3QER A;  4F3O A;  3ZX0 A;  3UE5 A;  5KRT A;  5F0X A;  1RDB A;  1OH8 A;  2X74 A;  1ZBL A;  3T1A A;  4RW8 A;  3OTO K;  4CZF A;  1VQ4 N;  4LF8 K;  1KD1 O;  3G71 N;  4JI3 K;  4JAX A;  4CZE A;  5F1X A;  3OYF A;  1LV5 A;  4FCY A;  1VRU A;  2VWJ A;  4AQY K;  4RG8 A;  1N32 K;  2HHX A;  3C0B A;  2W41 A;  2PYL A;  1R0A A;  4ICL A;  4CEO A;  4CJQ A;  4B9L A;  3VQD A;  3D6R A;  2QWM A;  4FWR A;  3K5N A;  4DTU A;  1QVG M;  1XC9 A;  2PY5 A;  2DPN A;  4HUG A;  4EIA A;  5C15 A;  1S1V A;  3S3N A;  1IBK K;  4EP5 A;  1TV6 A;  3CFR A;  4BG8 A;  4KHU A;  4W5O A;  1WBB A;  4CGF A;  4CBU A;  3T1Y K;  3I33 A;  1BI4 B;  4IDK A;  2P9S B;  4BRO A;  3L6Q A;  5C24 A;  3K5M A;  2P9I A;  3M6G A;  3S41 A;  4B1Z A;  2Q31 A;  3HZ6 A;  4GKJ K;  4A2B A;  4KI6 A;  3LZJ A;  4DV4 K;  1JXE A;  4O5B A;  2O8F B;  3VET A;  3WNE A;  1LAV A;  4HCB A;  3CCM N;  5E41 A;  2DFE A;  5HP1 A;  4DSF A;  3AAP A;  1VQ6 N;  5DMR A;  1Q82 O;  3FFK B;  5FRN A;  2XO7 A;  1RCH A;  1YVN A;  2ASO A;  3HP6 A;  2ASM A;  4CF8 A;  3TAF A;  4JKC A;  3NH0 A;  3FGU A;  3VQB A;  3O5B A;  4GY2 B;  1K8K B;  3K59 A;  3PLA A;  4FPB A;  1RDD A;  4CZH A;  2J4R A;  1T7P A;  3NFA A;  4FSV A;  3DMJ A;  3G6E N;  4DB3 A;  4ZHR A;  3ZSQ A;  4IJN A;  4ILG B;  2FBY A;  1EET A;  3O9R A;  2FBV A;  2O8B A;  4NB4 A;  3C6A A;  4E1J A;  4FZX C;  3HO1 A;  5GIP A;  1XNQ K;  1VQ9 N;  1EWQ A;  4FWN A;  4DR1 K;  4FO0 A;  1EQY A;  3K58 A;  2QWR A;  2YV0 X;  3SI6 A;  1U04 A;  4BDY A;  5C25 A;  1YIT N;  1U6Z A;  4FJK A;  4JLH A;  3QNN A;  4LSN A;  1I94 K;  4B1W B;  1N34 K;  2YHY A;  1WSJ A;  3E66 A;  3LDP A;  2G8I A;  2ZE2 A;  3A0I X;  3OBW A;  4H5T A;  4CFC A;  2ASP A;  1ZBU A;  4FM1 A;  2QXL A;  2E2P A;  3VQ5 A;  2BUP A;  2GTD A;  4B9N A;  5E26 A;  3ULD A;  1YI2 N;  3RRH A;  1NNE A;  2HBM A;  2OZM A;  4GKK K;  3RMC A;  4U67 L;  3AVG A;  3RWU A;  4ELV A;  3I8D A;  2GUI A;  5K14 A;  1BGX T;  3D0P A;  2HW3 A;  3IS9 A;  3SPY A;  1JLA A;  1Q8I A;  3LM9 A;  3SJJ A;  2E88 A;  4PHT X;  3AVI A;  4OO1 J;  2A5X A;  4KFB A;  2YHA A;  3P83 D;  2PZS A;  3WEE B;  3O1B A;  4BRD A;  4FJ5 A;  1VAZ A;  1W97 L;  2Q0R A;  4RCH A;  1NLV A;  4H4M A;  3MAQ A;  4CE9 A;  2ATQ A;  1Q18 A;  4PQU A;  5AQV A;  2QEX N;  3WXK A;  3OYG A;  4CJF A;  1LW0 A;  2ITG A;  4GMJ B;  4JKF A;  2BDP A;  1A5W A;  5BRH A;  4CHY A;  1C0M A;  4CES A;  2BTF A;  3ZX3 A;  3NH1 A;  2QWN A;  5AQH A;  3KK3 A;  3CM6 A;  3OYE A;  1KQS M;  3OYI A;  3DLL L;  4F4K A;  4C8L A;  1BIU A;  2O4G A;  3EZW A;  2GUP A;  5AQN A;  3NH2 A;  4LFC K;  3DLR A;  3MN6 A;  2NNW A;  1NGG A;  1P90 A;  1YVU A;  1Y64 A;  3AVC A;  1ILY A;  4O8U A;  2JWL A;  1I39 A;  2NRH A;  3D2E A;  4M3W A;  3CCQ N;  5GAG P;  1BWF O;  3R1X A;  4HTL A;  1L3T A;  1VSJ A;  4CFB A;  1ZBF A;  2E2N A;  3C65 A;  4DQS A;  4RW9 A;  4ILJ A;  1TUY A;  1N6Q A;  4DF4 A;  4C8N A;  4B1Y B;  3AAQ A;  3TTC A;  3VTH A;  1HNV A;  1RDW X;  4B3S K;  3M8R A;  4B9M A;  4DR5 K;  4EHT A;  4CIE A;  3SNN A;  3C7N A;  2D0O A;  3MWP A;  4PUO A;  3NGZ A;  1IBM K;  1DLO A;  1IV0 A;  4KAZ A;  1OH7 A;  1BQM A;  4FJM A;  4F2R A;  4H5W A;  4A61 A;  2NRW A;  4JI2 K;  4DMN A;  5BPM A;  1NK4 A;  5CYQ A;  1B9D A;  4I9Q A;  4XIU A;  1YJW N;  3OYC A;  2VGM A;  1S9G A;  5JVG L;  4DSL A;  5EX5 A;  2E1Z A;  1C0T A;  3HVT A;  2NUB A;  4DU1 A;  2OTL N;  5BRF A;  2O8B B;  1NOZ A;  3J81 O;  4F8R A;  2NRT A;  4YY3 K;  1DTQ A;  3ZT0 A;  3CCL N;  1FKP A;  2P9P A;  2UUA K;  3VQ4 A;  3CC7 N;  1LCU A;  4W5T A;  3E1Y A;  5B8H A;  3PX4 A;  5HOO A;  1UOC A;  3PX6 A;  2UYT A;  2E2Q A;  1QQO A;  2D0B A;  4XEI A;  2ZJQ L;  1DEJ A;  3GE1 A;  2KHO A;  4MLE A;  1BU6 O;  3M8S A;  1JCE A;  1ASV A;  3S3O A;  3CJ1 A;  2KKZ A;  3KTQ A;  3OYA A;  2A3Z A;  2XHB A;  4BG9 A;  4GVE A;  1R59 O;  3QIC A;  5GAH P;  3QB0 A;  3VQ9 A;  2NRX A;  3SZ2 A;  4DSI A;  1IH7 A;  1ESV A;  4M3X A;  2UUC K;  3OS2 A;  4B9S A;  1HKG A;  5AQW A;  4B1X B;  4KV8 A;  2NLX A;  2ETJ A;  3MN5 A;  3R6M A;  4IDH A;  4LH4 A;  4HUE A;  3R8E A;  1QZ6 A;  3KKR A;  1Z26 A;  1BHL A;  1TKX A;  2GEM A;  5AZJ A;  2HMI A;  1VQ8 N;  1D5A A;  3NF7 A;  5AQR A;  2Y1J A;  3O9Q A;  4OGE A;  1HNX K;  4FJ7 A;  4DF8 A;  1XWL A;  4CIG A;  4BE2 A;  3MEG A;  1O13 A;  3E01 A;  5AQO A;  4ELU A;  4E89 A;  2OZS A;  1JCG A;  4BC2 A;  4DV0 K;  4JKG A;  1U45 A;  4DV3 K;  3ZSZ A;  1I3A A;  4KBO A;  3QET A;  4NCB A;  3V81 A;  2Z1I A;  3I55 N;  4FLV A;  4V19 S;  2F8S A;  1S3X A;  3D2E B;  5GAD P;  3C94 A;  2FSN A;  3RTV A;  5AQX A;  1BL3 A;  3OYD A;  4LD0 A;  3ZET B;  1NM1 A;  2EX3 A;  5TKY A;  4DTM A;  3FFI A;  4IJA A;  2Q97 A;  3V1Q A;  3PUF A;  4F3T A;  3C7N B;  4J2B A;  5HBM A;  4DQI A;  3C95 A;  2G8V A;  1J53 A;  1ZXO A;  5CR4 A;  1BCM A;  3AO1 A;  5C10 A;  1S9E A;  3CCR N;  3LWL A;  4DWI A;  1C0U A;  2E6L A;  3LP0 A;  4MFB A;  4BQL A;  4Z4H A;  2HMP A;  3EE9 A;  5C0Y A;  3HM9 A;  3OYN A;  4W5R A;  1W2B M;  3CJ9 A;  3P39 A;  4EP4 A;  4DTS A;  2VQF K;  4LF9 K;  3OY9 A;  3P4I A;  2PBD A;  3MX5 A;  4JKD A;  1BA0 A;  2FSJ A;  3ZX2 A;  4GW6 A;  2YX6 A;  3TAM A;  4FW2 A;  4CF1 A;  5KPZ A;  5AQT A;  1GOB A;  1DTT A;  2P9P B;  2G8W A;  5IT9 O;  1JL2 A;  3WXM B;  3MCA B;  1QTM A;  3LPU A;  1TL1 A;  3M3Z A;  3EEQ A;  4RW7 A;  4LF5 K;  3ID6 A;  4K0K K;  3KK1 A;  1RTJ A;  4R5P A;  3HST B;  3DLG A;  3TAR A;  3K9J A;  1HQU A;  5C2F A;  4CZJ A;  5KGX A;  4QS9 A;  2KW4 A;  1T6C A;  4TSX A;  3L2Q A;  4KRF A;  4IBN A;  1HYV A;  4ISF A;  3LP1 A;  4FOI A;  4IWV A;  1FXX A;  4BR0 A;  2A6A A;  4O55 A;  3HJF A;  5AQM A;  5BRD A;  3DI6 A;  4YNQ A;  2HHU A;  4CJ3 A;  1YAG A;  3QEI A;  3CQX A;  2D0A A;  3WT0 A;  4CZK A;  2ZGY A;  4H8K A;  1Z6R A;  2DY4 A;  1RDC A;  5AZJ B;  2PAV A;  1XQS C;  3SBT A;  3A2F A;  3CXC M;  4B8C A;  5GIO A;  2G8F A;  4I2P A;  3NBP A;  1YF5 L;  4OPK A;  2FXU A;  2P9N A;  3AAR A;  4FWM A;  4CBW A;  4FPA A;  4E1N A;  3HOT A;  2HNZ A;  2HBK A;  3WXI A;  1E3M A;  1IO2 A;  4JKG B;  1VQ5 N;  4K25 A;  1SKR A;  1O1W A;  4Z4C A;  4LH5 A;  3CF5 L;  3MK6 A;  1RBR A;  1FW6 A;  2QKK A;  3WQU A;  3OS0 A;  4DR7 K;  3L4I A;  4JD2 A;  3HK2 A;  4EZ9 A;  3VGL A;  3GBT A;  3L2W A;  5KGW A;  1EKE A;  3LDL A;  3VES A;  1IKW A;  5C42 A;  4QS7 A;  2HND A;  4LF7 K;  3U3G A;  2IGI A;  2E1Y A;  4BDZ A;  1MU2 A;  1V4T A;  4E0D A;  2QK9 A;  3SQ4 A;  2AJQ A;  1MWK A;  4H0O A;  3CQY A;  4CEA A;  3H1Q A;  1NGA A;  4CI6 A;  1C1B A;  2P1J A;  1KAX A;  1NU0 A;  5EU7 A;  4CZM A;  4WFN L;  3AO4 A;  2YI1 A;  3UKR A;  4FM0 A;  2IS3 A;  2NRR A;  5AQS A;  2HBJ A;  4FM2 A;  2UUB K;  2YJF A;  2VYP A;  1MWM A;  2W6L A;  2ZQB A;  3DJC A;  1JLB A;  4ID1 A;  4LC9 B;  4A5B A;  4H4O A;  1KLM A;  5M1P A; 
#chains in the Genus database with same CATH homology
 3VQB A;  3K59 A;  3PV8 A;  3V9W A;  3NF9 A;  1NKE A;  3HVR A;  5FRM A;  1RDD A;  3M8Q A;  2P5G A;  3LDS A;  3OYL A;  2OPP A;  5J2N A;  1VSD A;  1T7P A;  3KLF A;  3NFA A;  3CFO A;  3PO5 A;  4BAC A;  2XRI A;  2YNI A;  4DTN A;  1LAW A;  3DMJ A;  3DOK A;  1NJW A;  3UIQ A;  4M3Y A;  3AA3 A;  4ZHR A;  3ZSQ A;  1TL3 A;  1QS4 A;  1SL2 A;  2FBY A;  1EET A;  3SUN A;  2FBV A;  1VSH A;  1JL1 A;  3TR8 A;  4CFA A;  4N41 A;  1ZBI A;  4FZX C;  3HO1 A;  1RNH A;  3DOL A;  4JS4 A;  4DS5 A;  4JS5 A;  3I0S A;  5CZ1 A;  4FLZ A;  3K58 A;  3RR7 A;  1X9M A;  2YV0 X;  3RR8 A;  3SI6 A;  1C1C A;  1U04 A;  4DQR A;  4DTR A;  4BDY A;  5C25 A;  1NK0 A;  3D45 A;  4C8K A;  1HMV A;  4FJK A;  4JLH A;  3V1O A;  4FZY A;  1HYZ A;  1JLG A;  3F9K A;  4CGD A;  3QNN A;  4LSN A;  4CHN A;  1RBT A;  2OPS A;  1WSJ A;  3OYB A;  3NAE A;  4KRE A;  3PX0 A;  3AO5 A;  4FLU A;  3SQ1 A;  5D3G A;  3KD1 E;  3AVM A;  2YNH A;  4N47 A;  3AVN A;  3OYH A;  2RF2 A;  4CGI A;  3SPZ A;  4C8O A;  3ZT4 A;  2G8I A;  2ZE2 A;  1QSS A;  4FLW A;  4CFC A;  1ZBU A;  2YKN A;  4OKK A;  2VWK A;  3VQ5 A;  2YKM A;  4FM1 A;  3NCI A;  4B9N A;  4FJ7 A;  3QIP A;  2B6A A;  2XY8 A;  3ULD A;  4DS4 A;  3T3F A;  1QSY A;  3NGY A;  1Q9Y A;  3RRH A;  3ZSW A;  3KD5 E;  2OZM A;  3VQ6 A;  3RMC A;  2RN2 A;  3AVG A;  2RKI A;  4PA1 A;  4ELV A;  3RWU A;  3I8D A;  4NCA A;  4PY5 A;  3DRS A;  2GUI A;  5K14 A;  1BGX T;  3C6T A;  3LP2 A;  4DQQ A;  1CLQ A;  3D0P A;  3AVL A;  5DK5 A;  1CXU A;  4M3U A;  3LAL A;  3IS9 A;  3TAN A;  2HW3 A;  3SPY A;  3ZSR A;  1JLA A;  1Q8I A;  4CF2 A;  3SJJ A;  1W9H A;  4M3T A;  3V9Z A;  3AVI A;  3HXM A;  1WAJ A;  4KFB A;  1GOC A;  2YHA A;  3VQQ A;  3V9U A;  3P83 D;  4E7K A;  3V4I A;  1NJY A;  4CJP A;  4M3Z A;  4FK4 A;  1EX4 A;  1KRP A;  2PZS A;  4FJ5 A;  2ZD1 A;  1TKZ A;  1WN7 A;  1B92 A;  1KCF A;  4H4M A;  3MAQ A;  1VSK A;  4CE9 A;  2ATQ A;  4PQU A;  1S5J A;  4CHP A;  4KHQ A;  3OYG A;  3ZSO A;  3QLH A;  4CJF A;  1LW0 A;  3T19 A;  2ITG A;  4J2A A;  4GMJ B;  1NK6 A;  5CZ2 A;  2BDP A;  2RPI A;  1A5W A;  1X1P A;  3ZT2 A;  1A5X A;  4AH9 A;  4CHY A;  1C0M A;  3AVA A;  3MEE A;  4AHS A;  4CJU A;  3OJS A;  4CES A;  4CJ5 A;  3NH1 A;  5J2P A;  4FJI A;  2KFN A;  3KK3 A;  1L3S A;  3CM6 A;  3OYE A;  4DTX A;  3OYI A;  2P5O A;  1S6Q A;  4F4K A;  4C8L A;  3AVJ A;  3QIO A;  1VSE A;  1BIU A;  1JLF A;  3LAM A;  5CY4 A;  2O4G A;  4B08 A;  1TKD A;  4K8X A;  3NH2 A;  1D8Y A;  3SUQ A;  3IRX A;  3DLR A;  4Z4E A;  3KJV A;  3NGI A;  1TK8 A;  3QEX A;  1KFD A;  1NK8 A;  4CEF A;  5JS1 A;  1YVU A;  1ASW A;  3VQC A;  3AVC A;  1UA1 A;  5J2M A;  3HPO A;  1A5V A;  1L3V A;  3DRR A;  1I39 A;  4DFP A;  3V9S A;  3TWH A;  4M3W A;  2XY6 A;  2HHS A;  1IG9 A;  1NJZ A;  4Z4F A;  4HCC A;  1L3T A;  1VSJ A;  3B6P A;  4CFB A;  1ZBF A;  4OVL A;  3JSM A;  4DQS A;  1YTA A;  4RW9 A;  3VQP A;  1LWC A;  3G10 A;  3P1G A;  4C8N A;  3L2U A;  4DF4 A;  1RT2 A;  3S9H A;  1N6Q A;  2VG6 A;  3M8P A;  1BI4 A;  1LW2 A;  1REV A;  3C6U A;  1HNV A;  4DU4 A;  3M8R A;  4B9M A;  4Q0B A;  1KFS A;  4IFV A;  3DYA A;  4KB0 A;  1Y97 A;  4FLY A;  4CIE A;  3SNN A;  1WSH A;  4DLE A;  5HRS A;  4PUO A;  3NGZ A;  4CF9 A;  1DLO A;  4CED A;  3DLK A;  4CEE A;  4G1Q A;  4KAZ A;  3EY1 A;  1BQM A;  2VG7 A;  4FJM A;  4DTP A;  4Z4G A;  4F2R A;  4O0J A;  3KLG A;  1S1W A;  4I2Q A;  1NK5 A;  5KRS A;  2XY7 A;  1F21 A;  4OPJ A;  2YNG A;  1SKW A;  4DMN A;  1NK4 A;  4OGC A;  3QIN A;  5CYQ A;  1B9D A;  4I9Q A;  4XIU A;  1IKX A;  3OYC A;  1UA0 A;  1S9G A;  1IKV A;  3S3M A;  1NK7 A;  4DSL A;  1C0T A;  3HVT A;  2NUB A;  4DU1 A;  3ZSV A;  1NOZ A;  4B9V A;  1QHT A;  2Q3S A;  2B5J A;  4F8R A;  4O0I A;  4E1M A;  4DQP A;  3V1R A;  2F96 A;  3RMA A;  4CIF A;  3ZT3 A;  3K5L A;  1EXQ A;  1DTQ A;  2EHG A;  2YNF A;  3U3Y A;  1T05 A;  3ZT0 A;  4NYF A;  3DM2 A;  2Y1I A;  1ZBH A;  1FKP A;  2BAN A;  3HL8 A;  4F2S A;  2IC3 A;  3VQ4 A;  4AHU A;  4W5T A;  4B9T A;  4RW4 A;  3PX4 A;  1WSF A;  1XHX A;  1UOC A;  2JLE A;  4FLT A;  4M41 A;  3PX6 A;  4CCH A;  4KI4 A;  2D0B A;  1UWB A;  1S1X A;  4Z4I A;  3V6D A;  5HLF A;  1Q9X A;  4Z0U A;  1KVB A;  4CGH A;  3OS1 A;  3EYZ A;  3M8S A;  1BIS A;  1ASV A;  3S3O A;  4N56 A;  3MXJ A;  4EZ6 A;  1KLN A;  4E3S A;  3KTQ A;  3OYA A;  3DRP A;  1RT3 A;  3P5J A;  1S1U A;  1S6P A;  3OYJ A;  3QNO A;  3KLE A;  4JRP A;  4FYD A;  4UQG A;  3RMB A;  3WNG A;  2XHB A;  1XI1 A;  1XHZ A;  1WNS A;  2G8U A;  2D5R A;  4E7J A;  3JYT A;  4CEC A;  3VQ9 A;  2OPQ A;  4E7I A;  2IAJ A;  3SZ2 A;  3IG1 A;  4Y1C A;  4DSI A;  1IH7 A;  1QSL A;  4KHS A;  1TGO A;  4M3X A;  4BWJ A;  4I7F A;  4KKO A;  3L2V A;  1ASU A;  4AHV A;  4CJW A;  3OS2 A;  4B9S A;  4KHY A;  4KTW A;  3TAQ A;  2GBZ A;  4KV8 A;  2PYJ A;  3L3V A;  2ETJ A;  2D0C A;  3MXI A;  1U4B A;  4OKE A;  4HHT A;  3VQ7 A;  4FK0 A;  3VQ8 A;  1QQC A;  3O3F A;  1RDA A;  4LH4 A;  4O44 A;  4DFK A;  1X9W A;  4FVM A;  4CJS A;  3HYF A;  4HUE A;  5KTQ A;  3KKR A;  3HP9 A;  4JRQ A;  1Z25 A;  1Z26 A;  4FJX A;  4QCL A;  3QO9 A;  1BHL A;  1TKX A;  1JXB A;  2KZZ A;  4O4G A;  2HMI A;  1NKB A;  4CJR A;  3QEW A;  1D5A A;  2X6S A;  3OJU A;  3NF7 A;  2Y1J A;  5J1E A;  3AA2 A;  3I0R A;  2R7Y A;  2HVI A;  4OGE A;  3SQ2 A;  3LZI A;  3SYZ A;  1IKY A;  1JLQ A;  4DF8 A;  3HPG A;  5JS2 A;  5J2Q A;  1TK5 A;  3RRG A;  1XWL A;  4CIG A;  4BE2 A;  2JGU A;  3MEG A;  2GV9 A;  3OYK A;  3E01 A;  4CJT A;  4ID5 A;  4FJG A;  2E6M A;  3F73 A;  1NOY A;  1RT6 A;  4ELU A;  3OVN A;  4E89 A;  4ZTF A;  2OZS A;  4OLA A;  4DSJ A;  2DTU A;  4E19 A;  4E7L A;  4I9L A;  5SWM A;  4RW6 A;  3SCX A;  3ZSZ A;  3MXM A;  1U45 A;  1SL1 A;  1I3A A;  3QET A;  2VG5 A;  3G0Z A;  3AO2 A;  3CFP A;  3V81 A;  4L8R B;  4FK2 A;  4NCB A;  2Z1I A;  4FLV A;  1U47 A;  2F8S A;  4N76 A;  5T7B A;  1HNI A;  3PY8 A;  5I42 A;  2HHW A;  1RBS A;  3C94 A;  2O4I A;  4AHT A;  3RTV A;  4B9U A;  4DSK A;  4AIL C;  2B4J A;  3IAY A;  1BL3 A;  3AO3 A;  2HHV A;  3OYD A;  3TAE A;  1FK9 A;  4FW1 A;  4LD0 A;  5KI6 A;  2Z1G A;  2X6N A;  1U48 A;  1UAX A;  1VK0 A;  4OKJ A;  2EX3 A;  4CJK A;  4FJN A;  3ZSX A;  4DTM A;  1LWE A;  1KVA A;  2P51 A;  4KTZ A;  3NHG A;  4NYN A;  1L3U A;  3FFI A;  4GVM A;  1JKH A;  1HJR A;  3HPH A;  3MED A;  4CJ4 A;  3VQA A;  4KHN A;  3V1Q A;  3PUF A;  4DFM A;  1QE1 A;  2X78 A;  2Z1H A;  3KIO A;  3TI0 A;  5I3U A;  1BQN A;  4F3T A;  3LAN A;  4CJL A;  4J2B A;  1FKO A;  1KVC A;  1BIZ A;  4CJE A;  1SKS A;  1D9D A;  3NF6 A;  5HBM A;  2A1S A;  3C95 A;  4DQI A;  4CGG A;  4DLG A;  1J53 A;  1LWF A;  4Y1D A;  1BCM A;  2G8V A;  4FJL A;  3AO1 A;  2FBX A;  3L2R A;  2DFH A;  1S9E A;  4BDP A;  3LWL A;  3LP3 A;  4HTU A;  1TVR A;  4N5S A;  1X9S A;  3ASM A;  1YTU A;  4DWI A;  1C0U A;  2E6L A;  3LWM A;  3LP0 A;  3NDK A;  3QES A;  4MFB A;  4Z4H A;  2KFZ A;  3HM9 A;  2LSN A;  1KSP A;  1K6Y A;  3OYN A;  4B8A B;  4AHR A;  4W5R A;  3QEV A;  1TK0 A;  4FJH A;  2HHQ A;  3ZCM A;  1W0H A;  4DTS A;  4EP4 A;  4DTJ A;  1U49 A;  1T8E A;  1T03 A;  1ZYQ A;  1L5U A;  2HVH A;  4DTO A;  1SUQ A;  3K5O A;  2I5J A;  4CEB A;  4ZTJ A;  1BCO A;  2KQ2 A;  3OY9 A;  5FRO A;  3SV4 A;  4CFD A;  3O4Q A;  4GW6 A;  4CK1 A;  4DFJ A;  3TAM A;  5HRN A;  5HRO A;  4FW2 A;  4CF1 A;  4BE0 A;  4FJ8 A;  3B6O A;  4FZZ A;  1C6V A;  1N5Y A;  1GOB A;  1NJX A;  1DTT A;  3SUP A;  1TKT A;  1JL2 A;  2G8W A;  5FDL A;  3TAG A;  1QTM A;  3LPU A;  4KHW A;  1ITG A;  4CK2 A;  4M45 A;  2G8H A;  1TL1 A;  3CM5 A;  4CJV A;  2W42 A;  4RW7 A;  3VA3 A;  3PO4 A;  1J54 A;  3KK1 A;  3ALY A;  3WNF A;  1RTJ A;  4R5P A;  3HST B;  3DLG A;  3WNH A;  3TAR A;  1HQU A;  2F8T A;  1RTI A;  1YT3 A;  4FXD A;  1WSI A;  4C8M A;  4DU3 A;  1G15 A;  3LAK A;  4AHC A;  5KGX A;  1SV5 A;  2BE2 A;  4MQ3 A;  4CGJ A;  2KW4 A;  3L8B A;  2XY5 A;  4TSX A;  1WSE A;  3L2Q A;  4CEZ A;  3VQE A;  4KRF A;  4IBN A;  1VSL A;  1HYV A;  1WSG A;  3AVF A;  3V9X A;  3K57 A;  2QXF A;  1J5O A;  3LP1 A;  4B3O A;  1RBV A;  3BGR A;  5CYM A;  5HRR A;  4PWD A;  1FXX A;  4IG0 A;  3OYM A;  3CG7 A;  4J2E A;  4QOZ B;  4O55 A;  3CYM A;  2IDO A;  4CHQ A;  1NK9 A;  1D9F A;  2A1R A;  1RTD A;  3HJF A;  2FC0 A;  1WAF A;  1KTQ A;  5HRP A;  3QER A;  4F3O A;  4M42 A;  5KRT A;  1RDB A;  3DI6 A;  1VRT A;  4YNQ A;  2HHU A;  4KTQ A;  4CJ3 A;  3QEI A;  3DLH A;  1EP4 A;  3MEC A;  2D0A A;  2X74 A;  1ZBL A;  3T1A A;  4H8K A;  4RW8 A;  4E7H A;  2YHB A;  2DY4 A;  1RDC A;  3O4N A;  2FBT A;  3KLH A;  4K8Z A;  4KB1 A;  3AV9 A;  3AA5 X;  3O3G A;  1TAU A;  4WE1 A;  3OYF A;  1GOA A;  4LY7 A;  3A2F A;  3AVB A;  2WON A;  4FCY A;  1VRU A;  2VWJ A;  3ZSY A;  1LV5 A;  3THV A;  4B8C A;  4RG8 A;  2G8F A;  4I2P A;  1SL0 A;  2HHX A;  1J9A A;  3EZ5 A;  2HB5 A;  3NBP A;  3QEP A;  1C1A A;  4OPK A;  1TAQ A;  4CEQ A;  3TAF A;  4ELT A;  2PYL A;  2Z1J A;  4E1N A;  1R0A A;  4ICL A;  4FLX A;  4CEO A;  1NKC A;  2HNZ A;  3L3U A;  4CJQ A;  3NE6 A;  4B9L A;  3ZT1 A;  3RMD A;  3SV3 A;  4CK3 A;  4FJ9 A;  4CER A;  1IO2 A;  3VQD A;  4KO0 A;  1VSI A;  1HPZ A;  3K5N A;  4DTU A;  4CHO A;  1O1W A;  4Z4C A;  3NF8 A;  1SKR A;  1RIL A;  1XC9 A;  2PY5 A;  4LH5 A;  1HQE A;  1RTH A;  3O3H A;  1RBR A;  4HUG A;  1RBU A;  4QAG A;  4IKF A;  3H08 A;  1VSM A;  4IFY A;  2QKK A;  3OS0 A;  3AVH A;  2HNY A;  1S1V A;  3VN5 A;  3HT3 A;  3HK2 A;  4EZ9 A;  2BGG A;  3KLI A;  2IOC A;  4LSL A;  3S3N A;  2OYQ A;  4W5N A;  4EP5 A;  3L2W A;  2KTQ A;  1TV6 A;  5KGW A;  1EKE A;  3CFR A;  4KHU A;  3ISN C;  4W5O A;  1IKW A;  2WOM A;  5C42 A;  5SZT A;  3KK2 A;  4CGF A;  3DLE A;  3SQ0 A;  2HND A;  1CXQ A;  3SUO A;  2G8K A;  3U6F A;  3LPT A;  1BI4 B;  3U3G A;  2QKB A;  3TAP A;  2OA8 A;  2IGI A;  4IG3 A;  4BDZ A;  4DG1 A;  2HHT A;  1MU2 A;  4IDK A;  4M3R A;  1RT1 A;  2E4L A;  4KPY A;  4YFU A;  4HVJ A;  1JLC A;  4HUF A;  1CZB A;  4E0D A;  2QK9 A;  3SQ4 A;  3TAB A;  1HYS A;  1HRH A;  3AA4 A;  2AJQ A;  5C24 A;  3ITH A;  4CEA A;  3K5M A;  1WLJ A;  1C1B A;  1S1T A;  4OJR A;  4KI6 A;  3LZJ A;  2P1J A;  3KKS A;  1B9F A;  2DFF A;  1JLE A;  1RT7 A;  5EU7 A;  1JXE A;  3AO4 A;  3K2P A;  1RT5 A;  4O5B A;  3WNE A;  1LAV A;  1VSF A;  4FM0 A;  3DLB A;  1CZ9 A;  2IS3 A;  3AVK A;  4HCB A;  5E41 A;  4J2D A;  2DFE A;  5HP1 A;  4Q5V A;  4DSF A;  4FM2 A;  1RT4 A;  5DMR A;  3VA0 A;  4OLB A;  4NCG A;  5FRN A;  2XO7 A;  1RCH A;  4CF0 A;  3BDP A;  2KZM A;  4BWM A;  4DSE A;  2ZQB A;  4W5Q A;  4ID1 A;  1JLB A;  3HP6 A;  2OPR A;  3CQ8 A;  4FJJ A;  4H4O A;  4CHZ A;  1KLM A;  4CF8 A;  3NH0 A;  4BE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...