4ICLA

Hiv-1 reverse transcriptase with bound fragment at the incoming dntp binding site
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 150
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4iclA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iclA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iclA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iclA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4iclA05
5HROB 4O44B 2FBYA 1T03A 1I39A 2HHVA 1J5OA 5KFBA 1U45A 3QGHA 4E89A 4DQPA 2IMWP 1TP7A 3F73A 4PWDB 1S6PA 4DSIA 4CE9A 5F8MA 1D0EA 1SKRA 3V9XA 4YQWA 4DLEA 4GW6A 4IRKA 3RRGA 3GYNA 4N56A 1X9SA 5DLFA 3TAMA 4FM0A 3WNEA 4DWIA 4RW6A 1RYSA 4L8RB 4RW9B 1VRTB 2W9CA 3G10A 4CIGA 1TK8A 1ASVA 2OPQB 3MXIA 1S6QB 1KLNA 3T19A 1LWEB 3O4NA 1KVAA 1Y97A 4CGIA 3RTVA 2ILYA 1IKWB 4KFBB 5HLFB 1OS5A 1HQEA 4HUEA 1U48A 4QWEA 4DU1A 4Y2AA 3CDUA 4DTSA 1X1PA 1RDBA 1TL1B 4M3YA 2GBZA 3EYZA 3PW4A 1I6JA 3CO9A 2FJXA 5F8JA 4CJLA 2E9TA 1RTIA 2X6SA 1RTHB 1QAIA 4LH5A 4YFUA 3KLIB 5KG1A 3VA3A 2E9ZA 2W8KA 1C1BB 3QLHA 2FLPA 2AQ4A 2VWKA 2IOCA 3SUOA 3VQ6A 3NGIA 4WZMA 4DL6A 2ZQBA 5DGBA 1DTQB 3GV8B 3LALA 1QE1B 1CLQA 1KFDA 2VG6B 5CYQB 2OZMA 1RT4B 3PHEA 2ATLA 2YKNA 2DY4A 1KFSA 3QGGA 3KJVA 3DOLB 5KTQA 1TKTA 1UWBB 5KFOA 3M8SA 3ZSZA 1X9MA 1UA0A 1D8YA 4M41A 1HYSB 2E9RX 2GV9A 4IKFA 3DYAB 3V6HA 4CEEA 4F4WA 3LP1B 4WXOA 3ZT0A 4NLUA 2OPSB 2C2RA 4WFZA 4NLOA 1REVA 4KHRA 5KG4A 3OYGA 4QWCA 4FK4A 3SQ4A 2W8LA 1GX5A 2HNDB 1QHTA 2YKMB 4ZPDA 1XWLA 1R0AA 5KFEA 2FVCA 1NK4A 4Q44A 4RW8B 2PYLA 1JLAB 4RG8A 4CJFA 3N6NA 1LWCA 4KO0B 3V9ZA 4MKAA 2G8WA 4MK9A 4CIFA 3MFHA 4FLYA 3I0RB 4O3NA 2PYJA 4NCGA 2OH2A 1Z25A 4EBCA 4ID5B 4LH4A 1LAVA 4FJNA 4FW1A 4DQRA 3HPGA 1S1WB 3C6TA 2WOMB 2AX0A 4ECWA 2B5JA 4DFJA 4E1MA 4DTXA 3AVLA 1TKZA 5KFWA 4LY7A 3O3FA 4ICLA 1XR7A 3HPHA 1TKXA 4R8UA 3DLBA 1RT3B 4IFVA 3KLGB 4NCAA 4MKBA 3AVNA 1KRPA 3CJ3A 4OGEA 1RDAA 3V81A 3D45A 5HRSA 2KFZA 4Q43A 4CHZA 4PY5A 4CEQA 1L3SA 2GUIA 2KZMA 4TQRA 3MEDB 2Z1GA 2R8KA 3Q8PB 1S1VA 2VG5B 3KK2A 4ED3A 1KTQA 3DDKA 1KVCA 3MR5A 4FJMA 4GVMA 1N6QB 5I42A 1NK8A 4TY8A 1BIZA 1T3NA 4O3QA 4OKKA 3SZ2A 5HBMA 2JC0A 4EP5A 4DG1B 3LPTA 3OYAA 2AGQA 1ZBIA 4DL5A 2G8KA 2G8IA 3NF6A 3O4QA 3KLFA 4CIEA 3CJ0A 1FKOA 4CEBA 4M94A 4DTNA 2J6UA 5HRRA 2HHSA 4FJ8A 5CZ2A 4CJQA 3AO4A 4ZVEA 1JKHA 4CJKA 3JYTA 4DTPA 4K4XA 3KMQA 3HO1A 4IKAA 3M9NB 4MIAA 5F8NA 4J9MA 3V6DA 4IH5A 1U47A 2W9AA 1BL3A 3PV8A 5DGAA 3SFUA 4Z4GA 3NCIA 3GIJA 1HYVA 4Q0BB 1WAJA 3QEWA 4KAZA 3AA2A 3MR6A 3OL7A 2XI3A 1RDCA 3OYDA 4URQU 2V4RA 4FZXC 3VN5A 1JLBA 4K4WA 1N48A 2GIRA 2IAJA 1S10A 4R5PA 4F4KA 3NF8A 4I2QB 4B8CA 5J2QA 3U3YA 4DTOA 2HB5A 3QEXA 2O5DA 3AVMA 4IDKA 1WSJA 1ZBLA 3QIPB 4GC6A 2R8IA 4RW7B 3CVKA 1A5XA 1NKBA 2HHQA 2YNGA 4B3OA 3HVWA 3CJ5A 3QIOA 2VA2A 2R2TA 1NJZA 1DTTB 3H5XA 4KTQA 4RW4A 3FFIA 5KFXA 4OL8A 3MR2A 3QNOA 4O3PA 1CZ9A 4J9NA 1D9DA 3HVRA 1JLFA 4HTUA 3OL6A 3SQ0A 3NBPA 1CSJA 4Q8EA 1LW0B 3A2FA 2V0NA 4XPCA 1KHVA 4IBNA 3DOKA 1L5UA 4NLXA 3OYIA 2HVHA 2RDIA 3RR8A 1RT6A 4E7LA 5C24B 1S0OA 4DS4A 5KFRA 4B9SA 1HNVB 3IS9A 2IA6A 1SV5A 5K14A 1MMLA 3O3HA 1GOBA 2R2UA 4M3ZA 3DI6A 3MXJA 1C0UA 1LW2B 4J2BA 3DRPB 4CHNA 3V1RA 3NAHA 2HNYA 4X2BA 5DLGA 3NDKA 2FVQA 3QINA 1LWFB 4Y2CA 3PW0A 1BQNB 1LV5A 4MFBA 4AHVA 1RDDA 5C25B 3Q8QB 2ILZA 3NE6A 1T94A 4Z4CA 4CF8A 4OPJA 1S1UB 4OJRA 5KT4A 4CEZA 4LSLA 3C94A 3K2PA 2QXFA 4FJ5A 1JLQA 2OZSA 4MK7A 3MTKA 3SCXA 4O3RA 2P51A 1T03B 5KFGA 2DPIA 3DRRA 1J5OB 4FJ9A 1JLEA 4HCBA 3OYHA 3IN5A 3QO9A 5KG0A 1JLCA 1L3VA 3S9HA 1T05A 3OLBA 3OYFA 4DF8A 4KHWA 4QW9A 3BR9A 3TI0A 4G1QB 4C8OA 5KFYA 3NHGA 3OYLA 2QV6A 3K59A 4C8LA 4DTUA 1NHUA 4E19A 4OVLA 1KVBA 4AILC 1DLOA 1QSYA 3TAMB 4CF2A 3KLVA 4JS4A 4CK1A 1RT5B 1VSFA 5JS2A 4RW6B 4CJSA 3CFRA 4LSNA 4U6PA 3QZ8A 1BQMA 4KAIA 2W9CB 3VQPA 4WFXA 5EWEA 3I8DA 5KG6A 4GC7A 5DG7A 3KK1A 1TL3A 3TQ1A 1VRUA 4MK8A 4HUFA 1HQEB 2YNIA 5DG8A 4TLRA 3IGVA 5KGWA 3AO1A 3C6UA 1K1SA 3SI8A 3TR8A 2Z1JA 3OLAA 1J54A 4DQIA 4DTMA 4CJ4A 4DSKA 2IDOA 1C0TA 3PO5A 3QLHB 4FJHA 2OPRA 4CF9A 4CFBA 2I1RA 3RWUA 4CF1A 1JL2A 4FW2A 4PQUA 4O5BA 4C8MA 3LP0A 3OVNA 3NGDA 1BISA 1U09A 5CYMA 1S5JA 5KT3A 3TANA 4U7CA 4AHTA 1RT1A 4KKOA 3DLKA 4EBEA 2YKNB 3KJVB 3I5BA 5KFQA 3VQ4A 1TKTB 3PR4A 1TAUA 2EC0A 3FQLA 4H54A 3ZSYA 3L2RA 2IS3A 4Q45A 5I3UA 4KPYA 3VQQA 4J9SA 2HMIA 5KFHA 1YTUA 3MXMA 5KFNA 4FJXA 3ICLA 4EO8A 3KLHA 5DMRA 2DPJA 4FLZA 1S1TA 4FYDA 1R0AB 1RTJB 4CGDA 2BRLA 5JS1A 4W5OA 5DQIA 1NOZA 2HAIA 2JEJA 3SFGA 4NCGB 3EPGA 4IG0A 1RA7A 3K5MA 3RB4A 4RU9A 3C6TB 3BSAA 4I9QA 5J2MA 3RB6A 3SQ2A 2B5JB 2D41A 3OSPA 3CDWA 4CHQA 3HYFA 3DLHA 3HKWA 1TKZB 2B6AA 1SH2A 1TKXB 3ZSQA 3BSNA 3NGYA 1CZBA 4IFVB 3AO5A 2QKBA 3SUNA 3PX6A 1ZBUA 3H5SA 3ZT3A 1QS4A 1S9EA 4ELVA 3AA4A 3AVGA 4CESA 4CEAA 2IM1A 4CHOA 4HKQA 4ED1A 4DL3A 1S1VB 3KK2B 3OL9A 2F96A 2EX3A 1S4FA 3QYYA 5KT7A 3L8BA 2KTQA 1S97A 2IBKA 3ZSRA 5I42B 2DFEA 3QZ7A 5KFUA 5C5JA 2HNZA 1S0NA 5HBMB 3QEVA 3KK3A 4WXWA 2ITGA 4G3IA 4IH6A 4E0DA 1J53A 3RMAA 3KD5E 2FLLA 3V1OA 5J1EB 3TAEA 3VQAA 2A1RA 3TAQA 1Q8IA 5KFAA 4Q8FA 4JUZA 4KHNA 1JKHB 3JYTB 1RT2A 2UUWA 4M45A 2BANA 1ZTWA 4ED8A 2J6SA 1ZBHA 3DLGA 2FVPA 5F8HA 1G15A 3KKRA 3CDEA 5DQGA 5D3GA 3B6PA 1XC9A 3UR0A 3V6DB 4BACA 4F4ZA 4NLPA 1T7PA 4NCBA 1JX4A 3I0SA 5J2NB 2IM2A 1A5VA 1TK5A 1WSFA 3KLEB 1S0MA 3GIMA 5KT6A 5F9NA 3KTQA 4CEFA 1MU2A 1JL1A 2B43A 1XR6A 4RNNA 2C22A 1TKDA 1HPZB 2Y1IA 3VQ8A 1JLBB 1XHXA 1RT7A 5HP1A 2YNHA 3BREA 4DEZA 3ULDA 1GOAA 3RAXA 5SZTA 2IAJB 1ASWA 4OPKA 2ALZA 5DQHA 3H4BA 3H40A 4TQSA 2VG7B 3S3NA 4DS5A 4IDKB 4CJWA 3SNNA 3LAKA 2Q3SA 4CGJA 4IG3A 4ECVA 5C42A 2HW3A 1TGOA 3KHGA 4EP4A 5L9XA 4DFMA 3SI6A 5KFDA 3GV7B 3HP9A 2BGGA 2ZKUA 1NK5A 3VQBA 5JUMA 4RW4B 3FFIB 2P1JA 3IG1A 1JLFB 1EX4A 4ZHRA 3CM5A 1Q9XA 2FJWA 1FKPA 4I2PA 1ZTTA 5L1IA 2AX1A 4ECSA 2KZZA 3K5OA 3UQSA 4WYWA 3DOKB 4GMJB 2IC3B 3L3VA 2GC8A 4Z4IA 1IKVB 1RT6B 4E3SA 2BDPA 3NKYA 1C0MA 4EZ9A 1EXQA 3MEGB 3V9WA 5T14A 4DF4A 4M3XA 4K8XA 3ZT2A 4IFYB 5K14B 2EHGA 3EZUA 3DI6B 2RKIA 4I7FA 3RMDA 3KKSA 1C0UB 5FDLA 3OJUA 2E6LA 2HHWA 2WONA 2O4IA 2HNYB 4FLWA 3VQCA 2BQUA 5KFFA 3ASMA 4LD0A 2R2SA 4ED0A 4KB1A 1HNIA 1TQLA 3KHHA 4TY9A 3BGRB 4DLGA 1NK0A 4ZP6A 1HRHA 5EU7A 1D5AA 4E1NA 4CF0A 1QE1A 4NYZA 4EEYA 1QUVA 1SL1A 4B9MA 3WNHA 1N4LA 2ASDA 3RR7A 2D3ZA 4LSLB 3PX0A 4E7HA 2RPIA 1B9FA 4KI4A 1JLQB 2YHBA 3NH1A 4ZVFA 5KFCA 5KFKA 3LZIA 3MEEB 4J2DA 3IRXB 3HK2A 3DRRB 1JLEB 4KRFA 3L2QA 3JSMB 4CFAA 3QO9B 1KSPA 1BCMA 3DMJA 4C8KA 4IRCA 2XGPA 2XCAA 1T05B 1ZETA 3DYAA 3RBEA 2OPPA 4ED6A 2XY8A 3RB3A 4RNHA 3AVHA 4NLTA 4QWAA 1EP4A 1F21A 3MECA 4O4GA 1DLOB 1IKXA 3DM2B 1VSMA 4FCYA 4FLUA 4LSNB 1BQMB 1RBSA 2R7YA 3K5NA 1JLAA 1N56A 4YR2A 3BJYA 1YT3A 5SWMA 1ZBFA 3KK1B 4KO0A 3TVKA 2KW4A 4MQ3A 1VRUB 3LPUA 4N76A 3U3GA 2YNIB 4Y3CA 2RF2B 1C1CA 4W5QA 3I0RA 1IKYA 5J2PA 3C6UB 4WZQA 4DSLA 5KG2A 3HXMA 1W25A 2OA8A 1VK0A 1NOYA 4CECA 1C0TB 5DG9A 5F8IA 2F8TA 1N5YA 3QNNA 3EY1A 3L2WA 5KT5A 4EYIB 4WYLA 3T5KA 5L1LA 4ZP7A 4FJKA 4F3TA 1VSDA 3LDSA 4PQUB 5DK5A 3LP0B 2QK9A 1I3AA 5CYMB 1SUQA 1RT1B 1L3TA 4KKOB 3DLKB 4J9RA 3AO2A 2D0CA 4J9PA 1RNHA 3AVCA 3T5LA 3P1GA 2ZE2A 3DLEA 2FBVA 2XWYA 3MF5A 4F4YA 1RAJA 4ECTA 5T7BA 2I5JB 1KLMB 4KV8B 3LAMA 3HPOA 5I3UB 5HRPA 4FVMA 3RRHA 3MEDA 2HWIA 2VG5A 3ZSWA 1QQCA 4OLAA 2QKKA 5EWGA 2Y1JA 2RDJA 3NL0A 2HMIB 4RZRA 1N6QA 3BQ1A 4DTRA 1VSIA 4CGGA 1HJRA 3QERA 3UIQA 3KLHB 2VA3A 4B9LA 3ZSXA 4F50A 1NK7A 3SUPA 1CXUA 2E6MA 4O0IA 1JXLA 3TWHA 4MIBA 1S1TB 4ECQA 4CJ5A 2JEIA 4QAGA 3KD1E 4EBDA 4ED7A 4QCLA 2Z1HA 4TYBA 4Y1CA 1B92A 3P5JA 2ZD1A 4FK0A 3QEPA 4IG0B 4RUCA 3UDLA 3E01A 2G8VA 1U4BA 2G8UA 1S6PB 4DU4A 2P5GA 4QOZB 3ITHA 3HVAA 4Q0BA 5J2MB 3T3FA 1RBTA 3KMSA 3DRSA 3NMAA 2YV0X 5KRTA 3M9MB 2B6AB 3G0ZA 3LWLA 3D28A 4ZPCA 4YR3A 3M8QA 3SV3A 3KOAA 2D0AA 2AU0A 2X74A 1U04A 5KG3A 4DFKA 1CXQA 1EKEA 4BE2A 2Z1IA 3ZSOA 4K4ZA 1S9EB 4OLBA 4QPXA 5EWFA 4DL2A 3B6OA 2XY6A 1O1WA 3WNGA 4FXDA 3OY9A 2W42A 4PUOA 1LAWA 4HYKA 3QIPA 1ITGA 4Z4FA 2FVSA 4W5TA 1GX6A 1RTIB 2O4GA 2HNZB 4H4OA 4KBIA 1Z4UA 2E4LA 2ETJA 3CM6A 4AH9A 1WNEA 4YP3A 4O55A 1WSEA 4ECZA 3HHKA 2XGQA 1S9GA 5KFZA 5CZ1A 4ZP8A 3SQ1A 3T1AA 3FDSA 1W0HA 2W7OA 3LZJA 4B8AB 3QGIA 1LW0A 1RT2B 3TABA 4K4SA 2IJNA 2BANB 3DLGB 4ZVGA 4K4UA 4FBUA 3T5HA 3V4IA 5D3GB 1RTDA 4IH7A 4FZZA 2CKWA 4FS1A 4YR0A 2W9BA 4ELTA 2WB4A 1WSIA 3I0SB 5KFLA 4FS2A 2YHAA 1NJXA 4M95A 3AVBA 3ZSVA 1UA1A 1LW2A 1REVB 1MU2B 2UUTA 3DRPA 4CJPA 4ZMMA 4DTJA 3HT3A 4HUGA 4Z0UA 1RT7B 5HP1B 2YNHB 4CGFA 3AV9A 4OKJA 4DFPA 2YNFA 1SL0A 4K4VA 4CJUA 3HP6A 3EPIA 1LWCB 1SH0A 2V9WA 4JS5A 1BI4A 1QTMA 5F8GA 1HMVA 4FBTA 4KREA 2C2EA 3L3UA 5EUHA 2FJVA 2UVRA 2UVVA 4ECRA 4IG3B 4HCCA 3O3GA 1D9FA 4URSA 3G6XA 4KHUA 5FRMA 4EO6A 2WCXA 2D7SA 3PJXA 3H08A 3HVTA 1BGXT 5KFTA 5KFJA 4K8ZA 3IG1B 3M9OB 4BE0A 3CG7A 4W5RA 2DTUA 2HHXA 3Q8SB 4FLVA 4DQQA 3AVJA 4ICLB 4W5NA 2ASLA 2GIQA 1NHVA 4R8UB 2FBXA 4ZHRB 4CK2A 4PA1A 1FKPB 4I2PB 3BSCA 4ECYA 4NLGA 4CCHA 1SL2A 4NLRA 3BSOA 2BRKA 4G1QA 4AHRA 4UQGA 1NK9A 3V81B 3H2LA 5KFPA 3OYMA 4J2EA 1BCOA 4NYNA 4EYHB 4E7IA 3I5AA 4FJGA 3OYNA 1RT5A 2BE2A 3SPYA 4CERA 1TVRA 2JEFA 1K6YA 2RKIB 4I7FB 3SPZA 4DU3A 1K1QA 3AA5X 1TK0A 1Q9YA 5FDLB 4TY8B 3VQ7A 4M3RA 3GILA 3V1QA 2WONB 4F2SA 4IR1A 3LP2A 3E51A 1NKCA 1TV6A 3QESA 3VQSA 3KLFB 1IH7A 4KTWA 4KHYA 3OHAA 4OGCA 1S1XA 4WE1A 1FKOB 1HNIB 1U49A 3KHRA 5EDWA 3ZCMA 1XHZA 3CJ4A 4AHCA 3CWJA 4QWBA 2KQ2A 4H4MA 1JIHA 1RBVA 2R8JA 2C28A 4IRDA 1WNSA 1EETA 3C95A 2VWJA 3VQEA 4N41A 4RUAA 1C2PA 4Q5VA 4BDZA 5KFMA 3M8PA 3PUFA 1FK9A 3BQ0A 4NLSA 3WNFA 1NNDA 4CJRA 3DMJB 4CHPA 3AVFA 1UOCA 2XO7A 4TXSA 3K57A 1HQUA 4TYAA 4R5PB 3IAYA 2XHBA 1XI1A 2OPPB 5J2QB 4F3OA 4N47A 3LP3A 4CGHA 1JLGA 1EP4B 2R2RA 4ECXA 3PO4A 3MECB 4O4GB 3AA3A 1IKXB 1B9DA 1YTAA 4TSXA 4WFYA 2G8HA 2IJFA 4ZPBA 4FK2A 2UVWA 2YNGB 4B3OB 3OYKA 4FM2A 1RCHA 4FZYA 1RTJA 3VQ5A 3MAQA 4JV2A 4EZ6A 4LQ3A 5HROA 4O44A 4BE1A 1C1CB 1IKYB 4B9UA 5J2PB 4CJTA 3S3OA 5CY4A 3CFPA 5FROA 3P83D 1WSHA 1GOCA 2X6NA 3SV4A 4J2AA 3L2UA 3NBPB 2FLNA 1WN7A 4CJ3A 3NH2A 4ZTJA 4PWDA 3G6YA 3FQKA 3U6FA 2F8SA 1N5YB 2J6TA 4ID1A 3FSIA 4RNFA 3I5CA 5L1JA 2LSNA 1SUQB 4RW9A 3RBDA 1VSJA 1VRTA 3IS9B 1SV5B 2OPQA 4NRUA 2DFFA 1S6QA 4QW8A 3KIOA 2ZE2B 1LWEA 3DLEB 2BR0A 4K50A 1IKWA 4KFBA 5HLFA 2D5RA 4DQSA 1YVUA 1QSSA 3RMBA 1TL1A 1XR5A 4B08A 2IM3A 4E7KA 5KFSA 4IR9A 1SKSA 4MFBB 4KHQA 4KE5A 3OS0A 4YMEA 1RTHA 4XO0A 3KLIA 5HRNA 1C1BA 1RYRA 4FJLA 3LWMA 1L3UA 1WSGA 4F8RA 1A5WA 1UAXA 3S3MA 1DTQA 3PW2A 3OYJA 2BQRA 3PW5A 2VG6A 5CYQA 1RT4A 5J1EA 4ELUA 4JV0A 3T5JA 1VSEA 1ZYQA 3LANA 3PVXA 4XIUA 3AVKA 1RDRA 3DOLA 3OHBA 1VSLA 3OYEA 2R8GA 1UWBA 4CFDA 4CJVA 2ZD1B 3TAFA 1D1UA 3DLRA 1HYSA 1JLCB 3H5UA 4M42A 1JXBA 3TARA 3V9UA 3E01B 5J2NA 2QE5A 4RNOA 3ZT1A 3ITHB 4O3SA 3KLEA 4DL7A 1W9HA 3PW7A 3LP1A 3DRSB 1NK6A 2OPSA 4BDPA 3CFOA 2XY5A 1HPZA 1KHWA 4Z4HA 1KCFA 4JV1A 3M8QB 2JEGA 5KT2A 3PZPA 2HNDA 2WHOA 3AVAA 1QSLA 3Q8RB 2YKMA 2PZSA 4NRTA 1C6VA 3N6LA 1NJYA 4ZP9A 5KRSA 4RW8A 5F9LA 1TL3B 2HHTA 2OYQA 2VG7A 1RA6A 1C1AA 4JLHA 4PUOB 1Z26A 1VSHA 3RAQA 4ID5A 3KHLA 4DMNA 5E41A 3CYMA 4Y1DA 1S1WA 4BDYA 4IQXA 2WOMA 4XPEA 4CK3A 2ATQA 3ALYA 4H4OB 2OPRB 4FLXA 4CEOA 4JRQA 4C8NA 1S9GB 2FBTA 4NLDA 1RT3A 3OYCA 4AHSA 4FM1A 2C2DA 2BQ3A 3BDPA 4M3WA 3KLGA 1WLJA 4HVJA 3HM9A 3V4IB 4FLTA 1RTDB 2IC3A 3MFIA 2IGIA 4NZ0A 3H5YA 4Z4EA 2W9BB 4J9OA 4DSEA 1VSKA 1IKVA 3KNAA 3F9KA 4O0JA 4B9TA 3NH0A 4DSFA 3HL8A 3VQ9A 3MEGA 3H98A 2KFNA 3K5LA 3H4DA 4IFYA 2HVIA 5KG7A 1S9FA 4TN2A 3ISNC 4NYFA 2V4QA 4H8KA 4DG1A 3PY8A 3PX4A 2AGPA 5KI6A 3D5MA 5KG5A 4IOBA 4ZTFA 3ZT4A 1IM4A 4KI6A 3VQDA 3GV5B 2CJQA 3OS1A 4B9VA 4F4XA 1RBRA 2YNFB 3SYZA 1SKWA 2JLEA 4KHMA 4HHTA 1S48A 1BI4B 3CJ2A 2XRIA 3BGRA 3TAGA 4K4TA 3D0PA 1HMVB 1IO2A 4QWDA 3CQ8A 4OKEA 2NUBA 2JGUA 2FVRA 2WK4A 4CEDA 1NJWA 2XC9A 3GIIA 1TAQA 4O4RA 3TAPA 3HVTB 2X78A 5F8LA 1IG9A 3MEEA 3MR3A 3IRXA 3RMCA 3IGNA 3AVIA 4FJIA 2HHUA 3V6JA 2P5OA 3JSMA 4CHYA 1WAFA 2UVUA 3SUQA 3AO3A 2ASJA 3N6MA 1RILA 1YVFA 4NLQA 4KB7A 4DL4A 3FRZA 4I2QA 4LQ9A 4KTZA 4AHUA 3H59A 2DFHA 3OL8A 3THVA 4URGA 4CJEA 2XY7A 1NKEA 3DM2A 4YNQA 4FJJA 4M3UA 2BE2B 2A1SA 2XI2A 1TVRB 4RW7A 2WRMA 5JXSA 2AJQA 4ECUA 4CFCA 2XCPA 4NLWA 1HYZA 4NLYA 5KGXA 4DSJA 3GQCA 4JRPA 3V6KA 3ISND 1QAJA 1BHLA 1DTTA 4O3OA 2RF2A 5KFVA 3LP2B 3KK3B 1TV6B 3QEIA 4KSEB 4BWJA 4I9LA 1S1XB 4WE1B 2IM0A 4J9KA 1SH3A 1J9AA 4J9QA 3HJFA 4Y34A 2B4JA 4H4MB 3RB0A 1HARA 3OYBA 4KB0A 1RBUA 4F2RA 1EETB 5C24A 2F8EX 4RNMA 1HNVA 2RN2A 3NF7A 1X9WA 4MH8A 3G86A 3M8PB 3L2VA 3CIZA 1FK9B 5FRNA 4ZVHA 3GIKA 3QETA 2G8FA 1FXXA 2W7PA 4FJ7A 2JC1A 2I5JA 4ED2A 1KLMA 4J9LA 4KV8A 2AGOA 3PR5B 3G6VA 1S49A 3OSNA 3HSTB 1LWFA 2WTFA 3K58A 2R8HA 2AWZA 1HQUB 1BQNA 4N5SA 2PY5A 3EZ5A 5L1KA 3BQ2A 3NGZA 3OS2A 3OJSA 2D0BA 3M8RA 5C25A 4R0EA 3QIDA 4M3TA 3NAIA 3PJWA 5KFIA 4K4YA 1JLGB 3NAEA 3VA0A 4E7JA 1S1UA 4BWMA 5C42B 1T8EA 1ASUA 4KHSA 2D3UA 3NF9A 4NLVA 1BIUA 2HWHA 4B9NA 3SJJA 2FC0A 3V9SA 3NFAA 4ZPAA 3UPFA 1JXEA
chains in the Genus database with same CATH superfamily
1HL6A 1DQ9A 5B0DA 3PM9A 1J5OA 3LDOA 3QGHA 3CCJS 3O80A 1NH7A 3WQUA 3W63A 1S6PA 2VASA 3BB5A 1VQKS 3LGMA 3VGSA 4DSIA 1SS6A 4DLEA 1VQPS 3O6WA 3RRGA 4IRKA 1U1KA 3LW5C 3Q83A 1X9SA 4QIVA 2J0SD 2OTLS 5D0GA 2XBPA 5M2RA 4RW9B 2GWKA 3U1NA 1TK8A 3G10A 4CLPA 2IIHA 3W61A 1YVNA 2DPNA 4O8KA 3T19A 1LWEB 4CGIA 1IKWB 5HLFB 4FZVA 1MWMA 1OPIA 4QWEA 3CDUA 1X1PA 2OSRA 3UD3P 1RDBA 1TL1B 3SMPA 3LDNA 4C3MA 4PXBA 1FE0A 1RB0A 3OFFA 2GBZA 3EYZA 5JICA 1I6JA 3WEEB 1LKZA 4CJLA 1RTIA 2A42A 2JX2A 4YFUA 3KLIB 3RRKA 5KG1A 3CEDA 1FERA 2VWKA 1RUSA 4WCEL 3NGIA 4LRDA 4WZMA 4DV7K 2UUCK 1WBBA 4OZ0A 3R2DJ 3LALA 1KFDA 1VQ4N 3ZLJA 2A1BA 3CJ7A 2DGXA 3CCLN 3GMGA 4V1Ak 2YKNA 2PT0A 1KFSA 3KJVA 4RO0A 5KTQA 1MROA 5AQWA 5C2FA 4CZJA 1ZPVA 3G6ES 5D0EA 1NM2A 1NBWA 1X3NA 1U8SA 2NRHA 5JLFA 1C0GA 3V6HA 3LTOA 2RU9A 4F4WA 4F7VA 2W4PA 4K0KJ 3ZT0A 1KD1T 4JHDB 4JI8K 2XTJP 2YHXA 1REVA 1YWXA 2E5LF 2V68A 3TWZA 3HJVA 3CC7S 5ELZA 3U8XA 3I82A 3BKTA 4ZPDA 3JS6A 2QWPA 4PG4A 3PYEA 1R0AA 2VICA 1YJ7A 2FVCA 3H8YA 5LMUJ 2RIJA 3N6NA 2QSWA 2A6MA 4MK9A 3M8ZA 2ZDPA 5H9EJ 3IWXA 1K44A 1PIEA 2Q36A 2ZH1A 5IXUA 2OH2A 4F36A 3C2PA 1IJJA 1JNZB 2PO4A 4EBCA 4LH4A 1LAVA 1JK9B 3FZKA 3C6TA 5LL6Z 4ECWA 3A8EA 3A5LC 2Z8QA 3O3FA 3M5RA 1N32K 4WBFA 4P10A 4R8UA 4Q2MA 3DLBA 1CULB 2YX7A 1TU0B 4DR1F 3KLGB 3CJ3A 1VQ8S 1IJFB 5B0BA 4OX9F 3V81A 1VQKN 1CS4B 5FPEA 4I1TA 2KFZA 5HRSA 3D0HE 4PY5A 4PKGA 1VQPN 4HVZA 2DVIA 4CEQA 1VBZA 3HTVA 2GUIA 2FDNA 2VKRA 4CW7B 4DN0A 3NVMA 3QB0A 4JKAA 4DR3J 4Y0WA 5T41A 4GVMA 1N6QB 5ADZA 4TY8A 3UE2A 2LMIA 3B8AX 4B1ZA 2AGQA 4DL5A 2G8KA 3AJ1A 3VV2B 5EGYA 1R0CB 3O4QA 3LM9A 3THWA 5E3QA 4CEBA 3TZYA 5HRRA 4B3MJ 3KVGA 5CZ2A 1G2EA 3C8YA 2IRUA 3EDRB 4QIEA 4AUKA 4K4XA 4IKAA 2GMHA 3M9NB 2BA9A 3AJ2A 2DGOA 2XULA 1OYDA 2ZJRQ 1YITS 2VODA 3SFUA 1RHJB 1EO1A 1FI4A 4RX6A 1HYVA 3NWGA 1UCNA 3QEWA 3VAMA 2FF6A 3AA2A 3D68A 4DHVA 3MN5A 1RDCA 3OYDA 2VV5A 3J7Z5 3LL3A 1WG5A 4OYZA 2J4RA 1IM6A 4BQZA 3RJMB 3G6EN 1HBUA 3NF8A 3U3YA 1EHWA 2HB5A 1PG5B 2PEBA 4IDKA 1QM9A 1ZBLA 2FC8A 4FOEA 5C2GA 2COLA 4JI6K 2CAJA 3CC7N 1A5XA 3HVWA 3DLJA 3QIOA 2R2TA 1QVGR 5ADXH 4RW4A 4XH4A 3MR2A 2O8DB 4FF2A 1S7HA 2KDOA 2RD5C 2CZ9A 1JLFA 3Q2TC 2P5VA 3OL6A 4HH0A 2ITMA 2K1RB 1PJ5A 3MUMP 3NBPA 1DURA 2MGZB 5LSRA 3O44A 4AD6A 1LW0B 2V0NA 4OX6A 3H1VX 4IBNA 3DOKA 2VFVA 3WXJA 2EG1A 1IBLK 3RSEA 2MJUA 2DGSA 4DS4A 1UP1A 4B9SA 1HNVB 3NNCA 1IUJA 4G1PA 3FBBA 1VHFA 3JTOA 2R2UA 4M3ZA 4OYMA 4YHHF 4CH1A 4DBQA 1AA1B 3DRPB 4BR4A 1VQ8N 3NDKA 1Z1ZA 4L73A 3Q0AA 3GU0A 2OGUA 2FSKA 3PW0A 1BG3A 4GVEA 3GCWP 1RDDA 2WVBA 2QL7B 3UD5A 4H03B 1T94A 1VIXA 3BZQA 1S1UB 5KT4A 4CEZA 4LJMA 2DIVA 4UY8T 3MCMA 4FJ5A 1HNZF 1A7GE 1JLQA 3VZIA 4MK7A 2MQ8A 3SCXA 1T03B 3R7BB 5KFGA 3TUZC 2A3ZA 3DRRA 4FJ9A 4JD2B 4R0JA 3IN5A 2Q1LA 3ZETB 4KYZA 1L3VA 3S9HA 4M5GA 3MAHA 2B4OA 1U7LA 5B0CA 4KHWA 2XWXA 2P6TA 1YITN 3F9MA 5KPTA 1SC1B 4C8OA 4DV2K 5KFYA 3NHGA 3FSXA 4C8LA 4X4NA 4E19A 3W9IA 2UXDF 4GKKJ 1KVBA 2EWSA 1QSYA 3R27A 2DR9A 4JS4A 1FXLA 4LSNA 1BQMA 2W9CB 3VQPA 4AQYK 5KG6A 1VMBA 4NMXA 1OY9A 3I4HX 3TQ1A 1VRUA 2HF4A 4B3TF 5JMVA 2YNIA 4LFAJ 4TLRA 3D6FB 4GVBB 2RILA 5C2DA 4FN5A 4ZJOA 4X66F 1JJCB 2Z1JA 3OLAA 1J54A 2HHPA 4CJ4A 3PO5A 5K9FA 3QLHB 3S6EA 2OPRA 2LLZA 3I33A 4CFBA 4X64F 2I1RA 4CF1A 3BBFA 2OANA 5CYMA 5KT3A 1RT1A 4KKOA 7AT1B 2CWKA 2EKNA 1UAWA 3W2VB 1HBMA 3VQ4A 1TKTB 3PR4A 2QWMA 2EKYA 3ZSYA 2AYBA 2IS3A 1VBXA 5I3UA 1XJWB 4OYAA 1URNA 1DKGD 4NXMJ 1YTUA 1VR6A 2DHSA 4P73A 3KLHA 3AD8C 3SLCA 2DGQA 4XEIA 4EHUA 5F1XA 3N4WA 4IJAA 3ADAC 2DNLA 1BLUA 4ZLJA 3G71N 2HPUA 5ITHA 3GSDA 3JQKA 1VAZA 1BD6A 1XBWA 3TYTA 4ILLA 3JAMY 4NCGB 3VAGA 3EPGA 3NLCA 4CLUA 1X4CA 2UV8G 4I9QA 3RBZA 2H51B 1G3OA 1PC4A 1XEZA 5D4OA 3OSPA 4O5FA 1XN9A 4BRIA 2CJAA 2B6AA 1SH2A 4F67A 1TKXB 3ZSQA 4BRCA 4U7UD 1D3WA 3AO5A 4IFVB 1ZBUA 2DK2A 3BR8A 2I7PA 2B9WA 3HHLD 5AJ3F 1Y64A 4HKQA 2NXUA 4ZKAA 1S1VB 3KK2B 3OL9A 4NB4A 1GLAG 4A4JA 4CI6A 1SJRA 3R6LB 1KKHA 4DDFA 2CJ9A 3N5FA 5I42B 4LF8K 2G9OA 4H0OA 5KFUA 1JCEA 2ZFHA 1VIOA 5IWAF 2GJIA 2I0XA 2PA3A 5JVHL 2ADCA 1S6UA 4CM2A 4DV4K 3RMAA 3KD5E 3VQAA 1TFWA 2A1RA 1BDGA 4JUZA 1KAXA 2FF3B 4KHNA 4C4WA 1J27A 1IQTA 1RT2A 1N0VC 1WEXA 4M45A 4LF4J 2BANA 5GADI 3DLGA 1G15A 3EEQA 1NGJA 3AH6A 2FZCB 5D3GA 4CWBA 3V6DB 3D6TB 2LECA 2ROGA 2FSJA 5AFUA 3OTOK 4JI1K 5FLXY 3KLEB 3C16B 3DGPB 3TA0A 3MCPA 5KT6A 4MT1A 4CEFA 3NS6A 2EK1A 2B43A 2VQEJ 2A3JA 4CM0A 3BY5A 4JYAJ 1BUXA 1X4EA 2YNHA 3MEKA 4DEZA 1UL3A 1GOAA 5SZTA 2MZ1A 3OXFA 2QI2A 3GLJA 5BR8F 3W7BA 5DQHA 2O8EB 3H40A 2CQIA 3S3NA 4E2FB 2E1RA 4M5HA 4CLZA 4LMZA 1Y3JA 4A8SA 4ECVA 3GFHA 2HW3A 2XMJA 1EAYC 4DFMA 3SI6A 3MDQA 4DCJB 3GV7B 1VOMA 4CNZA 3OPKA 3B4MA 3VQBA 4ZLPA 3FFIB 4IO1A 2P1JA 4AFFA 2YTCA 3EZOA 3MM8B 2JFDA 1SAZA 2BACA 2AEJA 2HRTA 2VFRA 1SBRA 1ZTTA 3NEKA 3RUBL 2AX1A 4QU7A 1V3ZA 4GMJB 2IC3B 3L3VA 3UN3A 1HWJA 2GIFA 1MSWD 4E3SA 3CJ1A 4MMOA 3CSKA 3MEGB 4JKGA 4K8XA 2DYAA 4IFYB 1M90O 1J5EF 3RMDA 2RKIA 4I7FA 2KN4A 5A8KA 2HF3A 1SIWB 3MN7A 2E6LA 5HN0A 2ZZNA 2O4IA 2HFSA 5I3PA 3J81Y 4O8UA 1OH6A 2P8IA 5MAOA 1HNIA 3WQPA 5ETVA 3M30B 3QWUA 3BGOP 3BGRB 2ZBRA 1NK0A 3UI3A 2P9NA 2NXEA 3LDLA 2MLZA 4ZP6A 4X4UA 5A6PA 3JQJA 4I4BA 4E1NA 4K7QA 1QUVA 1Q86T 1X7VA 3WNHA 2E5LK 4LSLB 1U0SA 4KGZB 2IMOA 1UVJA 5JVGQ 5KFCA 2Y9HA 4RCHA 2QA4G 4LF5F 4J2DA 3HK2A 4KRFA 3QATA 2FGOA 2VPYB 1BCMA 3DMJA 4OYPA 2XCAA 3DYAA 1U1OA 3DDIA 3UO0A 3MM5B 2HBKA 4UQTA 2OPPA 1MMNA 5DM7Q 2A6AA 6FDRA 4RNHA 1EP4A 1F21A 2HOEA 4O4GA 1NSAA 1IKXA 4FCYA 1RU2A 4WTYA 1OYEA 1RBSA 4KT0C 3OVAA 4PL8A 3K5NA 1IBKJ 1MNEA 1JLAA 4YR2A 3BJYA 3KK1B 4ILJA 1GMVA 1NZ8A 3HX9A 2RF2B 4DX5A 4DR1K 3I0RA 3C6UB 1FWPA 4OX9K 1KC8O 2GGPA 3HXMA 1DT9A 1VK0A 2CH5A 3W9HA 2P9PB 4Q7AA 1C0TB 1REGX 2ZGZA 5F8IA 2WSEC 3EY1A 3L2WA 4BC9A 5KT5A 3UD4P 4WYLA 3T5KA 4A8XA 1VSDA 2UUAF 2DCLA 1GLCG 1I3AA 2QK9A 1SUQA 2LA4A 3ET6B 3PRBA 4ZPVR 4ZVOB 2Y0BB 4J9PA 4FKYA 3DHWC 3CMQA 3AVCA 3T5LA 5AZJB 2FBVA 1YJVA 4ECTA 4KV8B 5GADP 3HPOA 2C3PA 4BHQA 3RRHA 3TP2A 1VGYA 2CQGA 3F56A 1QQCA 5EWGA 2GELA 4CBXA 2RDJA 2Q97A 1KOHA 4RZRA 1T6DA 2CRLA 4DTRA 4CGGA 4RTFD 3O5TB 3UIQA 4QR0A 1R43A 3VAHA 4DX7A 1NU0A 3EN9A 4B9LA 3SUPA 1CXUA 2E6MA 4O0IA 4JI3J 2P9UA 2KH9A 3U9DA 3FK4A 1S1TB 5ETPA 4ECQA 5T7LA 4CJ5A 3BDEA 4K41A 4QAGA 3T7ZA 2DT9A 4B1YB 3PHTA 4DV3K 4OHXA 2CQ1A 3CCQS 1FNXH 2ZD1A 4IG0B 1KP6A 1ULRA 1MN7A 4PCQA 1XUPO 5U47A 3PJ9A 2CYYA 5MLCQ 1FWKA 4Q0BA 1UEVA 1RBTA 3KMSA 3DRSA 3C7NA 3NMAA 2ZUAA 1UWAA 3H20A 5GAGI 3R1XA 1JNRB 3G0ZA 3D28A 4ZPCA 1SQEA 4YR3A 1IV0A 2X74A 1UVIA 4K4ZA 3UCGA 2XMUA 2VFTA 4OLBA 4QPXA 5EWFA 3B6OA 1Y10A 4YOTA 4LFCJ 2P9SA 3WNGA 1VBKA 2N3LA 4PUOA 1S72N 3J7YU 3A5NC 4HYKA 1X4BA 1ITGA 4DJBA 4Z4FA 1B7FA 3AOBA 1CBKA 5HSPA 3ENHA 3TSUA 2B51A 3VAKA 2LFVA 4KBIA 2IPOB 4O55A 4FYWB 4YHHK 2BM0A 2CQBA 2GJ2A 4RUHA 2YH0A 3SQ1A 5HQLA 1U2CA 3LZJA 3QRPA 4DCHA 5M1KA 1LQ9A 1DY3A 4ZVGA 3TX8A 3V4IA 3KKFA 3D4JA 3PKYA 2J8AA 4ED4A 2WB4A 5DM6L 1QLNA 1XNRF 1FFGB 4LR7A 3TVYA 3T1YF 1NJXA 2GHWA 3VEXA 4CJPA 3L4IA 5GVQA 1HNZK 4U8VA 4DTJA 4Z0UA 5J1PA 2YNFA 2B7CB 1SL0A 2JNJA 1SH0A 2BV3A 2YX6A 4JS5A 3JS9A 3ZO7A 2IHR1 4FBTA 2HS3A 2FJVA 4IG3B 5AQTA 1BO5O 5IS2A 1IBCB 1XMQF 4PG6A 4OX8A 2UXDK 5FRMA 3DOMB 2O66A 2OD4A 3H08A 3HVTA 1CJUA 1R8CA 1NPKA 1FD8A 3IA0A 1VHIA 2ZNYA 5E3AA 2QFIA 1ROFA 1NHVA 2EVZA 3CCQN 4ZHRB 3CQXA 3ULEB 1SL2A 2HURA 4X66K 1QVFM 1Q7YO 2IBOA 2BRKA 2CQ0A 1BA1A 3CO0P 1BCOA 4NYNA 2CNLB 1Q5VA 3GJTB 1K8AO 3EGZA 3CF5Q 4NLCA 4OX7A 2KVIA 2M88A 3R5GA 2WVFA 4DV6F 1TVRA 4YB7A 1TL4A 2MQQA 2RQCA 1K6YA 4X64K 1O51A 1TK0A 4DU3A 3A12A 4BRKA 2L48A 3GILA 2FHOB 7FD1A 2WONB 4F2SA 4CZCA 2M0GB 4IR1A 3LP2A 4B9QA 2Y1RI 4KHYA 3OHAA 4DCOB 5FPDA 4OLOA 3KHRA 5EDWA 1XHZA 1YBTA 3CWJA 4DX8H 3T41A 1FJGF 2B9EA 1JIHA 4GY2B 5E3CA 2XYPB 1P9YA 3TEGA 3FEZA 2UXCF 3VQEA 1XMOJ 4DQ8A 2G2ZA 4DPUA 1IR0A 2VBWA 1MDUB 2AJFE 2MQNA 3PYGA 3O08A 3MX5A 4LREA 4YEAA 3WNFA 1AYEA 4KR0B 4TXSA 4TYAA 3IAYA 2XSFA 3H2VE 4F3OA 3CPEA 3PO4A 1I94J 2ASMA 4F02A 1B9DA 2GWJA 2N4CA 2IJFA 1E4FT 4FPBA 1LWXA 1WC6A 5HQMA 3M2UB 1RAHB 1PJ7A 4FZYA 2B3TB 4CQ1A 1MWQA 2ZWHA 1NLKL 2NYHA 5A8RB 4B9UA 5J2PB 1WSHA 2VU5A 1GOCA 2LXIA 1VCTA 4J2AA 2X3DA 4JI2F 2FLNA 3QJPA 4CJ3A 3G96A 1MWYA 5AJ3K 3CCWA 1XC3A 5C15A 3TTCA 3G8TA 2YWHA 5E84A 4NYOA 3C0BA 3GDQA 1ZM4A 1WORA 5IWAK 1ZZFA 4RW9A 2WW8A 3CMAN 3IS9B 2DNPA 1RTZA 2G0CA 1LWEA 1AFIA 1IKWA 4H5TA 5HLFA 4P74A 4AL6A 1TL1A 2V2ZA 4OHYA 5BPMA 4B02A 4E7KA 4OZ3A 3EE9A 3WEEA 2I8EA 1SKSA 1UJ6A 3DXMB 3DXSX 3KLIA 5HRNA 2B7BB 4DR6J 3LWMA 1L3UA 4CDIA 1WSGA 3N9UC 1A5WA 2XMVA 4E1JA 3GPAA 5J1EA 1E3MA 3H0PA 3W9JA 2HFUA 2LEBA 5ETRA 1VSEA 2AYEA 4HTJA 1M5SA 1RDRA 4IOAQ 2NR0A 2R3VA 3MM6B 5C0YA 5BPLA 1YJ9N 5BR8K 2V34A 2U1AA 3DLRA 3ULHA 5A0YB 3JB9k 1AUSL 4F04B 2HS0A 3E01B 5J2NA 2A6OA 1WBDA 4A47A 3BGUA 4RNOA 3ITHB 3BGFA 3BO3A 4JHDA 1RWKB 4H4KA 3H46O 3CFOA 1NPPA 1HPZA 1KHWA 1ZS6A 4K2XA 3M8QB 2WHOA 4HACB 1QSLA 3AVAA 1NGHA 2QWQA 3Q8RB 4NRTA 2HG4A 5KRSA 4PL7A 1TL3B 1M1KO 1Z05A 3J80Y 4HL9A 1CEZA 1HBOB 2HSTA 4JLHA 1YJUA 5CCMA 5IC6B 2ZM6F 2ROPA 2PMHA 4OYWA 4AT1B 3R9LA 4CK3A 2HK3A 2V50A 1J5EK 2L9NA 3K8VA 4B1XB 1S9GB 1EQMA 5H9FK 2FBTA 4NLDA 1CULA 2CIMA 3VEYA 4AHSA 4M3WA 3KLGA 4BRQA 2KG0A 3OVBA 3IBCB 2GQQA 4FLTA 1CS4A 4NZ0A 4OHVA 4FNHA 2NRZA 1K47A 5D0HA 1GLDG 1IKVA 5AQSA 3NH0A 2VFUA 4D3HA 4JKHA 3H98A 1G4CA 1XERA 2KFNA 3DHXA 4DV1F 5KG7A 4TN2A 3ISNC 2X1AA 3PFOA 3MN6A 2NLXA 1U1RA 4ZVTB 3HHEA 4WP8A 3G4SS 4LF5K 2PFDA 3SCJE 4B9VA 3CC4S 1TTHB 3OS1A 3IDHA 4DU8A 3HFKA 4HHTA 3CJ2A 3TAGA 4ZPTR 3FZ2A 4K4TA 3D0PA 1HMVB 3CUNA 1AROP 2YKPA 2CQHA 2DNMA 4JI7K 5AQJA 2JGUA 2XC9A 4DV0J 1TAQA 2XNRA 1ZBTA 2IJRA 2RE2A 1HD1A 1M5KC 2IVNA 2VJUA 3AVIA 4MDAA 3ILLA 1T3VA 1I5OB 3OTOJ 2ASJA 3O8WA 4H5RA 3R1HA 1R0BG 1OJ4A 4KB7A 4DL4A 5BRDA 3FRZA 3VGKA 1W2BM 2MZQA 5ADXA 3BPSP 5IQ6A 4LUBA 1Q82T 5CD4H 2XY7A 1N5VA 4YNQA 4FJJA 3EICA 2BE2B 2XI2A 4A62A 2PEHA 5JXSA 1V3RA 1RHKB 2UUAK 4GKJJ 1UVNA 2J0WA 3IXQA 3H90A 3UDCA 1BHLA 4O3OA 1AT1B 3BF3A 4KSEB 2O67A 4BWJA 4U95A 1S1XB 4WE1B 4NZ6A 2IM0A 1F0XA 2MGZA 1KTVA 3HI9A 4K25A 4ENOA 4WFBQ 3UWTA 2B4JA 3GE9A 3AQOA 4F2RA 3O1BA 3BPDA 2D9PA 2IA0A 4RNMA 4MKYA 1HNVA 3D7EO 3HSGA 1Z2LA 4GNIA 1PSDA 4PG7A 3DFEA 3HSJA 2NUUG 4ZVHA 3GIKA 4C23A 3ZEUB 4HLBA 3IWNC 4ITSA 1KLMA 1WTFA 3MDFA 6FD1A 3HSTB 3OSNA 3QNWB 1SQKA 1RWPB 1U1LA 3CJCA 2PY5A 3PSFA 3P39A 4CH0S 3TJ8A 3G8QA 3OJSA 1YDLA 3QIDA 4ZCLA 2V8HA 3T9ZA 2RU3A 3VA0A 4OHZA 1S4EA 1S1UA 4JKCA 2RB7A 5C42B 3EDQB 3J7AP 2D3UA 1U6FA 1YIJS 1BIUA 2HWHA 3HHNB 3G4SN 3CC4N 3CULA 4LFBF 1JXEA 3JSBA 3ENQA 1PAEX 4O44B 1HNWJ 1T03A 2OEMA 3GBTA 1U45A 2VD3A 4JD2A 1HJOA 3MX2A 3ZETA 4DQPA 2VBYA 2QA1A 1TP7A 4CBWA 3F73A 2V63A 4PWDB 1OH5A 4OQJA 1SKRA 4KRWA 3QQCD 4ZLLA 1R59O 3HRGA 1KVJA 3GYNA 1WG1A 4IQMA 3QBXA 4FM0A 4AXIA 3WNEA 4B1UB 1DRZA 4BG8A 1RYSA 2M70A 2DRDA 1M1GA 2W9CA 4CIGA 4IJNA 3VGVA 1WB9A 1S6QB 4LF7F 1Q81T 1OS5A 2RSQA 3EXCX 4EFAC 4Y2AA 3T1HJ 2KXNB 4CT9A 4GVBA 3VAFA 3FLCO 3W1YC 1H72C 2FJXA 3O9QA 4PKHA 5F8JA 2PC6A 1RTHB 4LH5A 3ZTPA 3GR0A 2W8KA 2E9ZA 3T6JA 4ISEA 2HGLA 1W7AA 3QLHA 2AQ4A 3BZCA 1XNRK 3AOCA 3T1YK 2GA7A 3H7HB 1IBMJ 3QT8A 4M5DB 1GK8A 3TO8A 2ZQBA 5DGBA 2NXJA 1CLQA 2VG6B 5CYQB 4QS9A 3B54A 3CCTA 4MJKA 1ESVA 2ATLA 2DO4A 2HHHJ 2DY4A 3W2VA 4ZVSB 3FR0A 3AY9A 1TKTA 5KFOA 3ZSZA 3QWPA 1D8YA 4M41A 5K8NA 2RAQA 4PZVA 1B70B 4A8OA 1HYSB 3QJJA 4ER8A 9RUBA 4IKFA 3R3TA 5HO4A 3OBWA 1C4CA 3GG0A 2C2OB 1U1MA 4NLUA 3W62A 1XMQK 4NLOA 2HK2A 1V5VA 2ZOFA 4JP8A 2W8LA 1UEUA 2VYPA 1TMMA 3UFCX 5KPZA 4Q44A 4RW8B 1URRA 2XLIA 4RG8A 3I9V9 3R3LA 1G6BA 4Z2XA 4MKAA 4ILHA 1Z6RA 4AF1A 3MFHA 4FLYA 1WHVA 1T3OA 3ZX2A 3CCUN 1PJ6A 2PYJA 3LM2A 4NCGA 3L7UA 3MD3A 1Z25A 2OLWA 3NMRA 4H5VA 2M52A 3G25A 3OR2A 3C66A 3AA8A 2JJ4D 3PRVA 4DV3J 2QLWA 2HVZA 2ZJQL 2ZH2A 4FW1A 4JKDA 3CCZA 2HSEB 1FESA 5GAEI 1YIJN 4C0OC 3NGSA 4DV6K 2ZH6A 4DFJA 4OPAA 4E1MA 2HBYB 5CABA 4DTXA 2XMMA 3AAWB 2P9LB 4CLFA 3ZZ0A 4ICLA 2ACMA 4BC3A 1TKXA 4OI3A 3JSYA 2WUSA 2HQ3A 1RFQA 1LXNA 4IFVA 4JK9A 4FF1A 1FJ7A 4MKBA 1H0HB 1Y00A 3WIUA 5B0EA 4X62F 3C6HA 1NJIT 1L3SA 2KZMA 3KDOA 2XNQA 4USJC 3CJKB 4CLKA 3ENVA 1Q1KA 1S1VA 2VG5B 3KK2A 1FJGK 2MQPA 3VVTA 1KVCA 4FJMA 1VQSA 5I42A 2DNOA 2J9CA 1HKBA 2IVMA 1U2VB 3SAGA 1T3NA 4O3QA 1K73T 2UXCK 1KQKA 3P5TL 3M6UA 2LA6A 4AL5A 4CIEA 2C2NA 4DTNA 2J6UA 5AE1A 1F5AA 2HHSA 4FJ8A 3S01A 3PLAA 2F9TA 4LF9J 4ZVEA 5KOWA 3K9KA 2ZZMA 2HGMA 4DTPA 3Q24A 3GSIA 3V6DA 3UNYA 2ZNZA 4IH5A 3PV8A 4DKWA 3H42A 5F0WA 3VWSA 3C16A 3OFEA 3DGPA 2V2KA 2PGCA 2X1FA 2F9WA 5AXLA 1WELA 2GZOA 1SI9A 4E8UA 2V4RA 3WIVA 4FZXC 1DGKN 2JFKA 1XNQJ 4HEA9 4K4WA 7FDRA 2V94A 1N48A 4PR6A 2LQ5A 1TL7B 1M5OC 5J2QA 4DTOA 2Z0GA 4JI2K 2YQ3A 3QEXA 2UU9F 3UKUA 3F41A 4YN3B 2GQ2A 3MURP 4NPOA 2QYCA 3BF4A 4ATNA 3IMQJ 3QIPB 2A10A 3FMWA 2AKWB 1H2UX 3A1YG 4RW7B 4PHTX 4QYZJ 1S77D 2YNGA 4B3OA 1VQ6S 3LDQA 2FJDB 1BMQB 4WF9L 1VQMN 1VISA 4BR2A 4IEEA 1DTTB 3FFIA 1WJ9A 3ILOA 4CD3A 1F9HA 4O3PA 4BRDA 3IBWA 3D2WA 1D9DA 3QFHA 3HVRA 2GW8A 2DGVA 2DD8S 4RPFA 3QMLA 1RCXB 1CSJA 2MB0B 4FPIA 4Q8EA 4P9SA 4CLLA 4NXNJ 4UF4A 2VONA 1KHVA 4BC4A 4NE9C 3E9LA 2QGFB 1L5UA 2CADA 1IVZA 3G2XA 1A9NB 4E98A 4E7LA 5C24B 1YG0A 5JVGL 4M8LA 1UPPA 3PNIA 3QSIA 3JTPA 1SV5A 2BJ1A 3O3HA 2YH1A 3P38A 3V1RA 3NAHA 3EE3A 2KRBA 2XQCA 1FX4A 5DDRC 3NNHA 4HTLA 5CE3A 5DM7L 2MHNA 4KHPF 3M30A 3Q8QB 3I4PA 4I6YA 4F4AA 3U1MA 3NE6A 4CF8A 2YVSA 3AARA 1Y7PA 3K89A 5F3TA 3VF0B 1SJQA 4LSLA 3C94A 3K2PA 1IJEB 3GJRB 1RWXB 2CG4A 2R7VA 1KBRA 4O3RA 2P51A 3MPYA 1G1XA 2DPIA 4HCBA 1RQ0A 3TRGA 1N5QA 1JLCA 5KG0A 5DDPC 2MKCA 2YXLA 4DF8A 3MM5A 5B0GA 2BOAA 5L8RC 4ZCIA 4P2XA 1WG4A 2ZM6K 1H74A 2ASPA 3E66A 3TAMB 1RT5B 3SCLE 1HKGA 1VSFA 2AD9A 4RW6B 1X5PA 5JS2A 3QZ8A 4WFXA 2NZTA 4JNEA 3DWLA 5DG7A 2DY9A 3KK1A 1NNEA 4F3MA 1YXQA 2RHQB 4MK8A 3M3ZA 1HQEB 5DG8A 3IGVA 5KGWA 2M5YA 3OVSA 3C6UA 1SJ3P 3SI8A 1JJHA 1SB6A 4DL0C 5F41A 4DTMA 1F5BA 2P9PA 1M5HA 1C0TA 4DR2J 4M5LA 1VQ6N 4YY3J 3SCKE 4CF9A 4DV1K 4X4VA 4MIWA 2EW9A 4LIWA 1YLXA 2G0JA 4OZJA 4YDDB 4C8MA 4O5BA 4UY85 1NZAA 1S5JA 5AXNA 2GX8A 2HKEA 3TANA 2CH6A 3H25A 3ET6A 1YRTA 1B99A 5AZJA 2VOOA 1MWZA 1KQFB 4H54A 2LXFA 3W3SA 4CT8A 3NG8A 2YKQA 4C6AA 3VQQA 4PAAA 5AXMA 3LH2S 4J9SA 2Q0UA 1RCOB 5LY3A 4BS2A 3BKFA 4WPAA 3BN4A 1WC1A 3O9UA 2XMTA 4WIQA 2VBXA 4BRHA 2F3JA 4ES2A 2Z2YB 4R79A 1S1TA 4FYDA 4P6QA 3O1LA 1HNXJ 4G6VB 4CGDA 2BRLA 3QRRA 4LF1A 3O8MA 2HAIA 2OKQA 1DQ8A 4OJGA 1H3DA 2HZVA 3BYRA 3HKZD 3SFGA 2CNNB 2KT3A 4HR2A 4IG0A 2CPIA 1B64A 2HQIA 1SC4B 1NDKA 3UVJB 2DNKA 4X4RA 3DXBA 4BR9A 5C10A 2XZTB 4CHQA 3DLHA 3HYFA 4ZPWR 1TKZB 5AQFA 4X65J 4HT7A 1CJTB 3AHPA 3C65A 4UZCA 3NGYA 4YORA 2ASYA 3SUNA 3PX6A 1FRLA 4PWUA 3AAPA 2R7RA 4ELVA 4H0XB 1Y5IB 3A5OC 2E2QA 4ED1A 4DL3A 4EUVA 2YPZA 2JLFA 2F96A 2EX3A 2LDIA 3L8BA 1N33F 4KY3A 2ZUGA 3UNGC 4PKDB 4X4PA 4H0PA 1XQIA 1YJWS 3QEVA 5IQQA 1JCGA 3KK3A 2BTFA 3BN7A 2HAFA 4E0DA 2EBEA 2D3O1 1J53A 2QX0A 1Q8IA 5KFAA 1JKHB 3MPUB 3JYTB 2CJKA 2FVPA 5F8HA 3CDEA 5D4LA 1O6XA 2EFVA 3CJQA 5H9FJ 2M2BA 2YHYA 1XK8A 1WC5A 3KG1A 2EFOA 2KJVA 3I87A 2IM2A 3PIOL 1A5VA 2E88A 2EFPA 1QAXA 5FPMA 2OD6A 2C2MB 1JL1A 1DFDA 2C22A 4LBPA 3VQ8A 4LFBK 4L72B 5AZIB 1JLBB 1XHXA 2HLUA 3BREA 3W65A 3WXMB 4DB3A 2IAJB 2P6SA 1LFPA 1U8WA 3E9PA 4DS5A 3PIPQ 3SNNA 3LAKA 2Q3SA 2IVOA 3IR6B 1YF5L 4IG3A 2DH7A 4YOVA 4LIRA 3KHGA 3A4TA 5BYRA 3HP9A 2ZKUA 3IUCA 5A76A 3DOMA 1NK5A 2CA9A 3A5MC 2V52B 2JDJA 3KUHA 4HI2A 4JI7J 4LF7K 4ZHRA 3CM5A 1BC6A 4P7TA 4ECSA 2DRAA 4WYWA 3MWPA 3CXCM 4ZOSA 3W5XA 4FYXB 4Z4IA 3FEYB 2V6AA 1RT6B 3CIPA 3CCVS 4M3XA 4DF4A 1VQYA 1VQNS 3OQ2A 5MLCV 3ZT2A 2WTUA 4M5MA 3EZUA 3DI6B 3HDSA 5GAGU 1C0UB 1EJ7L 3I6PA 2ZH7A 1YHQS 1QQNA 3FEXB 2B9XA 2WONA 3MK6A 3VQCA 3KUEA 2BQUA 3L95X 5LXYA 3AY0A 2EI5A 4K0KF 2NRVA 4HHJA 4ED0A 3LDPA 1I3OB 5IT9U 3KYLA 5IZHA 3W5YA 3OTCA 3TZXA 2G2YA 3KWMA 4CF0A 1QE1A 4EEYA 1SQGA 2I9SA 3VPZA 1FWLA 5LMUF 3PX0A 4E7HA 2EC2A 3C15B 4KI4A 4OMFG 1K8KB 4C0BA 3CD7A 3NH1A 2OI2A 3R97A 5KFKA 5D77A 3MEEB 4WQ4A 1V4TA 1JLEB 3NS7B 4J90A 4CFAA 3QO9B 4V19S 2OO4A 2NRXA 3TA1A 3HZ6A 4C8KA 2XGPA 4BRFA 3WXLA 1RBAA 2Z4PA 4J9UE 3TUPA 3PACA 1P8ZA 3TOQA 3H45C 2XY8A 1X5OA 3BM7A 3UE5A 4NLTA 4QWAA 2M7SA 1DLOB 2JZ5A 2CVEA 3KJNB 3NWRA 2ZKTA 1DEJA 3KDNA 1RKJA 3ETMA 3M2UA 2GFFA 1YT3A 3NY0A 1ZBFA 5SWMA 4KO0A 2KW4A 4U8YA 4IEIA 4MQ3A 3LPUA 4N76A 5A8RA 1N8RO 5J2PA 4DSLA 4WZQA 5KG2A 4DR3F 4X62K 1W25A 4UTGA 5B0AA 4ZCKA 1T9VA 2OEJA 4MO4A 2OJ3A 3EUNA 3K7RA 2FHKA 2QWNA 4OYOA 4OIXA 2M8HA 4B3MF 3LDSA 3VR1A 2XB2D 4DUYJ 4DR5J 4BY9C 4Y0FA 1KONA 4J9RA 4IOAL 3SQGB 3BYPA 1RNHA 9ATCB 3P49B 2CNOB 2HYIB 3P1GA 3W8GA 3S1TA 4UUWA 2HBRB 4A8WA 1GLJO 4L76A 5T7BA 3LAMA 2MJNA 5HRPA 4FVMA 3J8AA 3MEDA 3HZGA 2MQOA 2HWIA 3L6QA 2NNWA 2D4WA 1VLYA 2QKKA 4OLAA 2LU2A 1VFJA 2HMIB 3NP5A 3VHQA 3DXMA 3CCVN 3ONQA 1VSIA 4L74A 2PN6A 1VQNN 3QMQA 4Y2IA 1YHQN 2H5EA 3QGPA 4A2BA 3MXHP 5JMNA 3TWHA 2DGWA 2IYIA 2V4JB 4EBDA 3QRQA 2C42A 4PG5A 4ED7A 3J7YP 2LQ9A 3R6MA 4TYBA 3MM6A 2RS8A 5A8WB 4PPDA 4CZHA 3QEPA 2UU9K 5A0YA 2B0GA 5IFMA 4RUCA 3UDLA 3E01A 3QFPA 4CLTA 1S6PB 4DU4A 4CZFA 3ITHA 5J2MB 4HDGA 2C3UA 5KRTA 3LWLA 4FWPA 3M8QA 4HACA 2D0AA 2AU0A 4JV5J 3GR1A 3ISZA 4DFKA 4BE2A 3ZSOA 3D1QA 2LCWA 3TUJC 4A61A 3CC2S 4JI0J 3IAM9 4WWSA 1HBOA 5CR4A 3OY9A 2W42A 2DR5A 5HVFA 1QZ5A 5C2CA 2RMLA 5ETNA 5D78A 1LAWA 2V7ZA 4ZN3A 3FGVA 3CGIA 2FVSA 4W5TA 1RTIB 4BGAA 5B08A 1UVKA 2QA2A 1KQGB 4ES1A 2GHPA 1W26A 2HFOA 2ZVSA 2DB1A 4LF6F 1WSEA 4J8FA 4USWA 2XGQA 1S9GA 2ATCB 5HMWA 1W0HA 2JVOA 2VJVA 3RZAA 2W7OA 4B8AB 4K4SA 1Y11A 4FZZA 3KWIA 4FS1A 3FCVA 1X9JA 4KHPK 2QZ8A 1UETA 1HKAA 3EVWA 3HM8A 3D2EB 1ZAWA 4ISGA 4HT5A 3DRYA 4WU2A 2D1KA 3I0SB 2GO8A 4ZA1A 1HHSA 1WHXA 3WQTA 3ZSVA 2BJ7A 2O8BB 1LW2A 1REVB 1MU2B 2UUTA 2VDIA 4LVNP 2F4FA 4PKIA 1V3SA 1WI6A 4CP5A 4WCEQ 3HT3A 4HUGA 3UN5A 1FRXA 4CLYA 4TU9A 1RT7B 3AV9A 3LF0A 4K4VA 1GLFO 3X1LB 2AYGA 4GKKF 2UXBJ 5F8GA 3D3BJ 1HMVA 3DJCA 4W98A 4KREA 3L3UA 5GIOA 2B9YA 4HCCA 4ECRA 4CH7A 3O3GA 3UN2A 1YQHA 2JHEA 1UFWA 1RGVA 4BC7A 4LFAF 4EO6A 1N34J 3RYLA 3A8YA 1CZAN 3JQMA 5KFTA 5CD4A 3RW6A 4YOEA 2E1CA 4S0MA 1M5VC 3J81O 4R8UB 4PA1A 1FKPB 4FF3A 5C12A 3L3CA 1R7IA 1Q95G 2R7XA 4NLRA 2DCUB 4A5AA 5ETLA 2KVQE 4G1QA 3FMBA 3V81B 3X3UA 4Z7YA 4J2EA 1FRKA 3GTYX 2BE2A 4WQ4C 1NRKA 4CERA 5BN8A 2CVIA 3R6GB 2QA4S 4WFNQ 1K1QA 3AA5X 2HS4A 4TY8B 3VQ7A 2MKKA 3V1QA 1KNZA 3CC2N 1NKCA 3THPA 3EKUA 2QTWA 4W92B 1S1XA 4WE1A 3E2EA 3FZBA 4NXMF 2HZAA 1VQ7S 2L08A 2KQ2A 4DV5J 1H2TZ 4GMKA 2DXFA 4C9DA 1SPBP 4IRDA 4RWXA 4FDFA 3Q22A 2VWJA 4LRCA 2ZBIA 4FWKA 1HW8A 3PUFA 3TEHB 3ZEUA 4NLSA 3NRBA 1O5JA 2PSZA 2KKZA 3IWLA 3R5AA 1UOCA 4JI5J 1N88A 5TKYA 3K57A 3AD7C 1HBUB 2KM8B 1VQLS 2G4BA 4N47A 1SJFA 4WKRA 3LP3A 2ZHOA 4ECXA 2YQ1A 3AA3A 3K8WA 1YTAA 4TSXA 4FWSA 1AUDA 2VOPA 2F7TA 4ZPBA 2V2VA 4FK2A 2UVWA 2JSXA 4FM2A 1RTJA 4YB5A 3MAQA 3KUGA 4PRFA 4O44A 1LEOA 2Q6BA 3BGLA 1C1CB 4BE1A 2DRBA 2UZAA 4CJTA 3D1OA 1ACMB 3P83D 1VS3A 3SV4A 3NBPB 2MPUA 2GMJA 4DUZJ 2FB0A 2UP1A 3FZMA 4PWDA 2I6WA 2J7KA 3PRDA 5LM7E 3VQTA 3U6FA 4HHHA 2F8SA 2RQMA 4CO0A 5I9EB 2OFHX 1N33K 5TKWA 1FEHA 3LGHA 1QVFR 3I5CA 5L1JA 4DR7J 3J7ZO 4Y65A 1UPMB 3RBDA 5A2QU 2F8MA 2L9WA 2VB6A 4LF4F 1M90T 3AGKA 2J9DE 1S6QA 4QW8A 3KIOA 2HQDA 2OCEA 3DLEB 4ZVUB 4K50A 2DHHA 4ILRA 2Q66A 2MLXA 4P72A 2EXUA 1GLEG 4IOXA 2IM3A 4I64A 2PI5A 4A8YA 3PYDA 4KHQA 4KE5A 3OS0A 3KZBA 1RTHA 4XO0A 1JXVA 2VQEF 1GTEA 3P4UB 4FJLA 2BJ8A 4JYAF 2QA4N 4DPXA 4M5DA 2W2MP 1T9XA 1FW6A 2VG6A 5CYQA 4OFZA 1UFLA 2Q3PA 2RRBA 1ZYQA 3PVXA 3UDVA 1VQ7N 2FHMA 3EX7B 2VHGA 2GS8A 1VSLA 4CJVA 3TAFA 2VH7A 3MGJA 1R8BA 1FXRA 1X4AA 1VQ9S 1HYSA 1NSQA 2RRNA 2QEXS 2NZ4A 3WDOA 3ZT1A 4O0NA 3KNGA 3L09A 5LL6d 3P8BB 4CYUB 2AJ4A 2YWGA 5M1PA 1YBUA 2QXLA 1QJHA 2JEGA 4OYBA 5IOLA 1UEKA 5RUBA 2PZSA 4U7UK 3CD6S 3IFRA 4HDHA 4RW8A 5F9LA 3C19A 2HHTA 2OYQA 2VG7A 2H54B 1VQLN 4DMZA 2QLXA 4OO1J 5HL7L 1RA6A 3H3NO 5D4NA 1Z26A 1KC8T 3RAQA 3KHLA 5E41A 1H7XA 5I3QA 3QAUA 1IWGA 2G1DA 3VTHA 4FNIA 4XPEA 2NZCA 2ATQA 4H4OB 5GAHI 4YOXA 2OPRB 2DNHA 4JRQA 3TSPA 1RJJA 3MM7B 2P9LA 1T9WA 4CVNE 4Z94A 2CQPA 5F0UA 1LOUA 4FM1A 3BDPA 1WLJA 4HVJA 1TL5A 2QO3A 3D9BA 1HBMB 4K0KK 1YJRA 4BR5A 1RTDB 4Z4EA 2W9BB 1B3TA 4ZVRB 1VSKA 3U7JA 3NOGA 3QBCA 3KNAA 3F9KA 1B0VA 3KK7A 3CJKA 4DSFA 3HL8A 3VQ9A 3K5LA 3SK3A 3AAQA 2HVIA 2V2QA 3R2CJ 1FEEA 1WKKA 2V4QA 5LMUK 3OUYB 4P75A 4LSZB 1J2VA 1U02A 3TZWA 5DETA 4RLEA 4I6MB 3ZX3A 2EFGA 3ENAA 3PX4A 3OBYA 3I56S 3S8SA 5KG5A 5H9EK 4ZTFA 1IM4A 4CO4A 2CJQA 3RBXA 3G71S 1NPRA 1U26A 1DAXA 5AXKA 3VERA 1SKWA 4IYQA 4V19X 2O8CB 4EAHD 1BI4B 4Y6IA 2XRIA 2ZC4A 1WWHA 4USKA 1IO2A 4QWDA 4NX9A 3RVCA 1RI7A 3CQ8A 1IBKF 3Q8UA 2MKIA 2HFVA 1EIYB 2FVRA 2WK4A 1NJWA 3V2UC 3GIIA 1UKUA 1S5ZA 1IG9A 2F7VA 5F8LA 3MR7A 3OA9A 1VLOA 3IRXA 1YI2S 2HHUA 3EZWA 4BREA 3V6JA 3JSMA 3ZZRA 2DXEA 2UVUA 3VAIA 3N6MA 1YVFA 2DNNA 1VQ9N 3CJTA 1FF2A 1TL7A 4DR3K 4LQ9A 1EWQA 2QEXN 5BR9A 3H59A 1RBOB 3OL8A 1NMDA 2QN6B 1NKEA 3DM2A 2L9DA 2XS5A 2A1SA 2QL9B 4RW7A 2WVCA 2F4VJ 4B3MK 1HYZA 3CD6N 4NLYA 4DSJA 3WC2A 1DTTA 1VK8A 1HR0K 2IDLA 4UOGA 5HQ8A 2QFJA 4J9KA 1KQSR 3H2UB 1CQMA 1J9AA 3L7PA 3HJFA 2CZ4A 4JI3F 3AB2B 2QL5B 3K0JA 4W4MA 5HJYA 4H5WA 3I55N 2BE7D 3AODA 4KB0A 3M2VA 1FCAA 1Y0HA 2LU1A 4XAKA 5C24A 4J91A 2F8EX 5GAEU 3TU5A 1X9WA 4P52A 1WSRA 3K2YA 1RWNB 1DJ0A 4Y28C 3M8PB 2V67A 3L2VA 1FK9B 5FRNA 1FXXA 3CERA 1WI8A 2W7PA 2I5JA 4ED2A 3MAAB 4J9LA 2X3GA 3CI5A 1ZZNA 3DRXA 5AQZA 2WTFA 2R8HA 4OZNA 4YOWA 1WC4A 1HQUB 4N5SA 5LT5A 4H5NA 5AFUH 3EZ5A 5L1KA 3KJFB 1WEZA 3OS2A 4CBUA 3NAIA 3PJWA 1JLGB 5AQYA 2MY8A 3W66A 1MG7A 5DZ7A 2PFUA 3I56N 1NMEB 3ZZYA 4KH1B 1ASUA 5EX3A 4KHSA 2NQPA 3TR5A 3NF9A 4B9NA 2FC0A 2FY1A 4FWLA 3V9SA 2B56A 4WP3A 4LFCF 4MLEA 3UPFA 4A48A 1X3MA 5HROB 2MZJA 3SBTA 4JI4J 3DLLQ 1HUXA 5CYJA 5IT9O 2DY1A 2IMWP 1UJ5A 3GG1A 3DGVA 3AXKA 1Q7YT 1D0EA 1X5SA 3V9XA 2CQDA 4GW6A 2QWRA 2BJEA 1X4DA 3AA9A 4AL7A 1F5CA 4ERDA 4FWQA 4QYRA 1W2BR 1K8AT 3TAMA 2L41A 2CQCA 4WIIA 1A0OB 1YI2N 4RW6A 4L8RB 1HBNB 2WZ1A 4USTA 1ASVA 1Q8KA 1WOQA 1FXDA 4LF6K 5A8KB 3RTVA 1N5SA 4ANDA 1HQEA 1U2RA 3EWGA 3CJ9A 1T9YA 1WF1A 4M3YA 4DR4J 1O0PA 2BOPA 4JOUA 5G0RA 1HI0P 2Q0RA 2RDDA 3DKDA 2HWTA 2E9TA 2X6SA 4F25A 1QAIA 3PDNA 3VA3A 2Q6CA 1PILA 3SUOA 3FVYA 1E6YA 1DTQB 2D9OA 3JTNA 4X62J 1EZZB 2OZMA 1RT4B 2OSQA 5IT0A 5BRFA 2R7WA 5M1NA 1BA0A 2NPFA 2IVYA 3QGGA 4C48A 2CDRB 1WDTA 4ZIVA 2MDAA 2Q2RA 4NI2B 1RAFB 2UUBF 1BE4A 3DYAB 3LP1B 4IDHA 4WXOA 2KT5A 2NCKL 2OPSB 2MLYA 2ZJPQ 4WFZA 1N36F 2PBDA 2ZEJA 4KHRA 5KG4A 3O4WA 4QWCA 4LFAK 3IFEA 2HNDB 1QHTA 4ZJQA 2VC1A 3IBFB 1XWLA 5KFEA 1NK4A 2YWWA 3WUHA 1JLAB 4CJFA 1NAQA 2XSJB 1LWCA 2EPIA 1TYQB 3V9ZA 1X8DA 1QQMA 1AB8A 3I0RB 4O3NA 4TU7A 3R8EA 2QMWA 3HHLA 3PEJA 3UVJA 2E1PA 4UOCA 4ZCMA 2WOMB 2AX0A 1WHWA 4FWRA 3CD5A 2CGLA 2CQ3A 5C7PA 1TKZA 5KFWA 1BOTO 5F3ZA 2WVEA 2N7CA 3HPHA 3I9ZA 4KPCA 1M5PC 4LRFA 1FKAF 1RDUA 1NB2A 4BQLA 1RT3B 4NCAA 4B3RJ 4IXCA 3CJAA 1KRPA 3VGMA 4NXMK 3D45A 1T9UA 4YB6A 4TQRA 1XMOF 4OI0A 2R8KA 3Q8PB 5EY4A 1KEKA 4ED3A 3TJAA 4B3SJ 3DDKA 1PYTA 3POTA 2GAHC 3MN9A 2HGNA 3CMES 2HLTA 4JK8A 1BIZA 2MHEA 4OKKA 1OVQA 2JC0A 3LPTA 2Z2ZA 2RQ4A 3OYAA 1WUAA 1VRQC 5K20B 3U4LA 3KLFA 1VQOS 3ELHA 3CJ0A 4H0VB 1FKOA 2XEXA 3AQPA 1KOOA 2CPEA 4CJQA 1KDNA 2HMPA 1JKHA 3JYTA 1I94F 3KMQA 1EKSA 1CVJA 4P2MA 2RUSA 4ETZA 3HO1A 3PIPL 4OZLA 3MPDA 4QU6A 4J9MA 3HOSA 4OJ3A 1U47A 2W9AA 1BL3A 5DGAA 4DPOA 1RACB 3A0IX 2CWXA 4WU3A 3NCIA 3GIJA 4Q0BB 1U24A 3OL7A 1WF0A 1TMJA 2XI3A 4URQU 3MM9B 5AZIA 1HI1A 1JLBA 4C0HA 2O1PA 4JAXA 2KYXA 2VQFJ 4MO5A 2IAJA 1S10A 1VQ5S 4R5PA 2C3MA 2DR8A 1M1KT 4B8CA 2IY5B 1S72S 3MMCB 1VC0A 4IO9Q 1WSJA 5M1FA 3LGNA 1CJVB 2R8IA 3CVKA 2KLAA 2HHQA 3A13A 1UZDA 2VA2A 1H2VZ 1NJZA 4KTQA 3QNOA 4OL8A 5E0OA 2FXUA 4LF4K 1X0FA 2QLFB 1Z2ZA 5B0FA 4HTUA 1QD1A 2AA4A 1ZAXA 5E2QA 4DR6F 5GMKa 3HD2A 3A2FA 3FBEA 1OY6A 4TU8A 3P96A 1Q78A 3WZ0A 4XPCA 4NLXA 3OYIA 2HVHA 2VQEK 3RR8A 1RT6A 1X31C 4JYAK 1DBDA 2RHKA 1YTYA 5KFRA 4WTOB 4L3QA 1MMLA 2XMAA 4JN4A 3DI6A 1C0UA 2ZGYA 3D0IE 5DLGA 2H4YB 2FVQA 3QINA 1GMWD 2DHXA 2HBZB 1Q79A 4USUA 1LV5A 1BQNB 4WP9A 4M5NA 2W7AA 4MFBA 1OY8A 4AHVA 3ILIA 4L3NA 1Y5LB 3CMEN 3TJ9A 4OPHA 1S12A 4OPJA 1WKLA 3JSRA 2J8SA 3I32A 2GJFA 1NGDA 3BZKA 1VQON 5M1QA 1OKJA 2QXFA 1K8KA 2OZSA 3JXUA 2ZDOA 3OD2A 1CJUB 4DV7J 2UUCJ 4Y2KA 2D69A 5DJBA 1IG8A 1X4HA 1JLEA 3FSYA 3HLUA 1VC6A 2QC3A 3QO9A 3OTDA 3RAMA 1OSDA 1TFYA 3IM8A 3OYFA 4QW9A 3BR9A 3OBIA 3IM9A 1KXPA 4CO1A 2P9KB 2QRRA 4RBVA 4DTUA 1NHUA 4XDCA 4AILC 1DLOA 4CF2A 2A0FB 4CJSA 4G1IA 2MZTA 4KAIA 2A2CA 2GX9A 3I8DA 2MTLA 3EE8A 2C2ZB 4GC7A 3THTA 1FDDA 1I1GA 3BUZB 4JI8J 1BWFO 1RDWX 1VQ5N 3GFZA 2BVZA 3AO1A 4QR1A 5AQOA 1K1SA 3TR8A 5L39A 2CDQA 4CO2A 1RWWB 2YX1A 4DQIA 1X4GA 2YJEA 3RGIA 5AQXA 1FE4A 3BH7B 4BRAA 1GMWA 1P1TA 4FJHA 4QBUA 3MMBB 2ZC3A 4UOFA 1ITPA 3RWUA 3ENOA 2ZZTA 1BISA 1U09A 1E6VA 4U7CA 4AHTA 2QJ3A 1PCAA 4PABA 4EBEA 3SQGA 3HHLC 4QS7A 4WKYA 3CJRA 5KFQA 1TAUA 2EC0A 2FD2A 3FQLA 1N32J 2YKOA 4J7CA 3L2RA 2VGNA 1R27B 4CLWA 4DV0F 1RLCL 4DXLA 4DUTA 2HMIA 1IBKK 2BH1A 3TSQA 3NCQA 4USMA 1TUWA 3MXMA 4FJXA 3OXGA 5DMRA 3NGTA 2DPJA 1EB0A 5EHHA 5A2QO 4FLZA 2KHDA 2CJYB 2KKHA 2V4JA 2QLJB 2RS2A 2IDEA 2XLKA 4W5OA 4OJHA 5DS7A 2KT2A 1ZM3A 3G9CA 1FDNA 5ETQA 4RKUC 4IOCQ 5A8WA 4BLGA 2OAUA 4OHWA 1S79A 4C1NK 1RA7A 4GKJF 2F40A 1GXUA 1U0HB 3RB4A 4RU9A 5J2MA 3RB6A 2B5JB 2EFQA 4RJVA 1F3VA 1E4GT 4LC9B 5B7WA 1RBLA 3HKWA 4DN9A 4USHA 2BMBA 3CMAS 2DNGA 4B3TK 2DBBA 1Q16B 1XMBA 3ID6A 2QKBA 3H5SA 4RL1A 3ZT3A 1GAOA 4TKTA 4F9OA 2F63A 4NOHA 1OMSA 1WEYA 1BU6O 1PC5A 4CEAA 1AXQA 4P7VA 5HMXA 1FJCA 1D8ZA 2FTRA 4JI3K 1S4FA 1RAAB 2A2DA 2KTQA 2CPDA 2IBKA 2UYTA 3ZSRA 2HEKA 3QZ7A 1S3XA 5HBMB 3A3NB 3DN9A 2U2FA 4WXWA 2ITGA 3W0LA 4IH6A 4M63A 2W2OP 2HBLA 4JI6J 2FLLA 3V1OA 5J1EB 3TAEA 3TAQA 4Q8FA 2RUGA 1KR4A 4HH1A 3ZZOA 1HLUA 4RWTA 2XLJA 3R5JB 4A8QA 1JJ2M 3MUVP 1YJ9S 2HIYA 1ZTWA 4ED8A 3CDBA 2K06A 1F9EB 3A3PB 4NLPA 1T7PA 3PSIA 3D2EA 4NCBA 3I0SA 5J2NB 3SEOA 3R7NB 2NXCA 4G65A 4U9RA 1WSFA 1HNWF 1FT8A 1CQNA 5F9NA 4EMDA 3BEXA 3EL2A 2O8BA 1KS2A 1MU2A 2XZWA 2BX6A 1IBLJ 2H65B 4BRPA 1HPZB 2Y1IA 2M4MA 2PE8A 1QAYA 4LFCK 5KAKA 1V5IB 1RT7A 1SCJB 3FBCA 3ULDA 3RAXA 4OPKA 5AQPA 2BJ9A 3VAJA 2HVEA 4M5IA 3MZIA 3M32B 5GMEA 3CHWA 2C3YA 2Y1LB 5SUHA 4MYUA 1H98A 5GAGP 1YRUA 3OT9A 4EP4A 5L9XA 4WFNL 4DX6A 5KFDA 3N0VA 4JKBA 3CJBA 2OUGA 3T1HF 2JRSA 5JUMA 2AV5A 4J5OA 1W2IA 1LK7A 3P3DA 1IQZA 1UMJA 4OZ2A 3VCDA 2AEMA 1HPMA 4OI6A 4FO0A 2FJWA 2CUYA 1FKPA 3CCJN 5EVZA 4KGMA 2KZZA 3K5OA 1IBMF 2F65A 4A46A 4A8FA 4F0HA 3KXDA 4M7XA 4CJ7A 1IKVB 3GIRA 3NKYA 5AT1B 1C0MA 4EZ9A 2DITA 2HHHF 4Z7CA 4K8RA 1EXQA 4EIAA 3UKRB 3V9WA 2OTLN 5K14B 3R5DA 2EHGA 4DV2J 3KKSA 5AQMA 3OJUA 4PEOA 2HNYB 4F26A 2DO0A 4FLWA 1ATNA 3ENBA 2LVWA 3ASMA 1T6CA 4AQYJ 1ZA1B 2R2SA 3HSCA 2E29A 4KB1A 2AJ1A 3N28A 2IRXA 3KHHA 2UUBK 4X84A 1BWEA 1F1BB 1RHRB 1HI8A 2XZDB 1HR0J 1D5AA 1ZPWX 1N36K 1N4LA 2QMUB 1U1PA 3TUIC 2W2QP 2POKA 2Z2MA 2YHBA 3THXB 3R7SB 4FYVB 3OHRA 3LZIA 1DQAA 2V8PA 3SMSA 4BR0A 1YZ6A 1KSPA 4KJIA 4Q2LA 4DV3F 1GFWB 4IRCA 2NLWA 2PI4A 1T05B 3RBEA 1OH7A 3WC0A 2Y8YA 1VK3A 2MXYA 1DZ5A 2JVRA 2LP4A 1NCLA 3CPWM 2H3GX 3IP0A 4GV6A 3T6BA 1VSMA 4KC5A 4FLUA 2CJXB 5ETSA 2R7YA 3SXLA 2CZVC 4BC5A 2FQQB 2D1CA 3UCUP 3TVKA 3ZTQA 4CZKA 5LMNF 5IM0B 4FPRA 1NM1A 4Z37A 1C1CA 4W5QA 3CCES 2RJZA 3PEHA 3ILJA 4MDBA 5BREA 2EWHA 4CECA 4ZITA 1XMOK 5DG9A 2J7WA 3SAHA 2J76E 5HI7A 1KQSM 2KHOA 3HT0A 2ZBCA 4ZP7A 5BN9A 4F3TA 4F0MA 4PQUB 3CXCR 3LP0B 4LF9F 3SMZA 2M3DA 2WAQD 2DR7A 3DLKB 4XDDA 2D0CA 5DDQC 3DLEA 2NREA 3MF5A 4F4YA 1CJKB 1RAJA 2ZJRL 1KLMB 1I94K 4ID8A 3ZTOA 3LQVA 4WFAQ 3ZSWA 4LF6J 1P27B 3MMAB 2Y1JA 3NL0A 2V5HG 1N6QA 1HWKA 1HJRA 3IC1A 4YDUA 4N8NA 3M6WA 1XNQF 1NGBA 1FRIA 4F50A 2O8FB 1NGGA 3MWBA 3L0QA 1JXLA 4MIBA 2JEIA 3MTJA 4LF8J 4PXCA 4QCLA 2XO6A 2Z1HA 1B92A 4DHYA 5CHIA 3P5JA 4DV4J 4FK0A 1RKIA 2B4PA 2D3OR 1VC5A 2BBEA 1U4BA 2WSFC 3D6MB 4M63C 2P5GA 3E3XA 4QOZB 2RT3A 1GLLO 3N5BA 1Q5YA 3T3FA 1Q18A 2BUPA 2BKOA 4CYUA 2SXLA 2ZH5A 2BEFA 2CPYA 2DNQA 1FJEB 3W2WB 2GV1A 1NDLA 4NXNF 2Q31A 4JI1J 5KQDA 4NA2A 4WYBA 2Z1IA 2DH9A 1BY9A 3N79A 1S9EB 3WHIA 1XIQA 4BC2A 3F0NA 4C97A 2JL9A 2Z2LA 1O1WA 4DR6K 1IN0A 2ADBA