4ICLA

Hiv-1 reverse transcriptase with bound fragment at the incoming dntp binding site
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
total genus 150
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4iclA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iclA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iclA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iclA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4iclA05
2AQ4A 3EY1A 3DLBA 4ZMMA 5KGWA 4EBDA 2VG7A 3BJYA 3FQKA 4CJ4A 4BWJA 4CHZA 4PUOB 3QLHA 4OL8A 3RTVA 5L9XA 2VA3A 1HQUA 3HPGA 4CJVA 2AU0A 1SKRA 1TL3B 4O4GA 1U4BA 3D0PA 5KT7A 1TKTA 3M9OB 1UWBA 5F9NA 2V4QA 4Y3CA 2FBYA 3LPTA 3OYJA 4K8XA 2YKNB 4QPXA 2D0AA 4FS1A 3HVAA 4DL3A 1NJWA 3G10A 2IBKA 5FDLA 3PW5A 2KQ2A 1SUQB 3OSNA 5L1IA 5DLGA 3IN5A 3HO1A 3PW7A 4CFBA 4WE1B 4J9LA 1TGOA 4N5SA 2IJNA 1QS4A 1VSIA 3KLHA 3VQ7A 2W9BA 2WTFA 3B6PA 4F50A 1A5VA 5HROA 4E1MA 2HB5A 3V1OA 3RB0A 4E89A 3K5MA 1EP4A 2XWYA 4E19A 1HQEB 3HVWA 2XGPA 2O4GA 4RUAA 3OYBA 3DMJA 3ZT4A 3H98A 1S1VB 1RT7B 4MFBA 2G8KA 3OYLA 1KLMB 4KTWA 3LALA 5C42A 2G8FA 3PUFA 5KG7A 4BE0A 2WB4A 1RTHB 4BE1A 1N5YB 4ZVHA 3KTQA 2WONB 4OGCA 1S1UA 1TQLA 1HMVB 2GIRA 3OYCA 5KFYA 3KHGA 1ZBLA 3TAQA 4HYKA 3AVLA 5KFFA 3GIMA 4FXDA 1JLQA 3AVKA 4R5PB 3DOLB 2FLNA 3CJ4A 2YNGB 3CVKA 4RW6B 4BDPA 1S1TA 4OPJA 5DMRA 3ZT2A 5J2QA 2EX3A 3MFIA 4RNNA 3ULDA 2VG6B 3K5OA 3SPYA 4CESA 1BIUA 4ECSA 3CDEA 1T94A 3GYNA 3NKYA 2Q3SA 3ASMA 5I42B 2F8SA 4NRUA 3HVTB 3K58A 3LZIA 4B9SA 3QO9B 2AX0A 2VG5B 4KPYA 1RT4A 2XI3A 4O4GB 3WNFA 3HKWA 2OPPA 3SUPA 4N41A 1N56A 1TV6A 1NK4A 1C0MA 2Z1HA 4OJRA 2D41A 4YQWA 3IRXB 4M95A 5HLFA 2R2UA 5DG7A 4FLTA 3BGRB 3LP1A 3VA3A 3OYFA 4LSNA 4H4MA 3PR4A 2BRKA 1D1UA 1SH2A 1N6QB 1WLJA 2OA8A 3S3MA 4IRCA 3DLEA 2HWHA 1WSGA 3G6XA 3SFGA 1XR6A 1RT3B 1UAXA 1LW2A 1HYSB 4ID1A 4CCHA 4B9TA 3VQSA 5DQGA 1BCMA 5KFGA 3H59A 4ZP6A 2O4IA 2JEGA 2AGOA 4ZVGA 3ZT0A 1S9FA 3HT3A 4G1QA 4Z4FA 3PZPA 3ZT1A 4C8OA 1IKXB 1C2PA 5F9LA 3AVJA 3KK1A 2OPQA 2XY6A 1SKWA 1FKPB 2JEFA 4J9NA 4J2EA 4Q8FA 4RNFA 1J53A 3LP2B 3K2PA 4Y2CA 3DLGA 4DTRA 1ASVA 4I7FA 4XO0A 1LW0B 2VG5A 4BDZA 4IFVA 4KHQA 1HARA 1RBUA 3JSMA 3NBPA 4CIGA 3BQ1A 1X9SA 4BWMA 1Y97A 3WNEA 2R8IA 5I42A 4IFYB 3CFRA 4F4ZA 4FBTA 3SQ1A 2YNHB 4K4XA 4IG3B 1HPZB 1REVA 3HPHA 4CERA 2E6MA 3KD5E 4YFUA 1I6JA 5C24B 1MU2A 4OVLA 4Z4GA 2BQ3A 3LANA 3OL6A 2B4JA 4I2QB 3CFPA 3MEDB 4CFAA 4O3PA 1Z26A 4DTJA 3OYHA 4ECVA 2R2SA 1T7PA 1K6YA 2Z1IA 1LWCA 2DPIA 3HPOA 4ZPBA 1C1BB 3NF7A 2E6LA 3TARA 3WNHA 4J2DA 3OL7A 1CZBA 2YKMA 5FRNA 2XC9A 4KB1A 1RBTA 3SUNA 3C95A 2DPJA 3KLIA 2QE5A 5HRNA 4CF1A 4FJ7A 3DMJB 4GW6A 1RTDB 4JLHA 2G8UA 3NH1A 4M45A 2IS3A 3HL8A 1L5UA 5KRSA 3CDWA 4WXWA 1IKVA 2F8TA 3NH0A 5KG5A 5KT2A 5DGBA 4O3SA 3E51A 2B5JB 1TKZB 1U48A 3LDSA 1K1SA 2OPSB 1S1XB 4MQ3A 5KI6A 4DU1A 1RAJA 2R8HA 1KSPA 3SI8A 4RW8B 1NK7A 1S9EB 3V4IB 4WYWA 3ZSXA 2UUWA 3TAMB 1EETA 1BGXT 4MIBA 2DFFA 2G8VA 2PY5A 4FCYA 3GIJA 5DG9A 2ZKUA 1Q9XA 4LSLA 1BCOA 1I3AA 4PQUB 3AVNA 1JLCA 4DL4A 1ITGA 4BACA 1VSFA 3I5BA 5CYMA 3NMAA 3TAGA 1S1XA 3RBDA 3PJWA 4ZHRA 2C28A 4B8AB 3I0RA 2X6NA 4XIUA 3KLGB 1MU2B 3U3GA 3H40A 2WOMB 2JC1A 2JEJA 3GQCA 4ZTFA 4TXSA 3KIOA 4F4WA 1NJYA 4J9QA 4ED1A 4YP3A 4FW2A 1RTDA 2J6SA 4U7CA 5J2MA 4Y1CA 4MK8A 3PW4A 2W9CA 4FJ8A 1FK9B 4DTPA 3NBPB 5KFCA 3MR2A 1Q9YA 3PR5B 3L2WA 1C0UA 4Y2AA 1JXLA 2UVRA 2ASLA 3DRPB 1XR7A 1KVCA 2D3UA 3KKSA 2BDPA 2IC3B 4NLTA 4DTMA 1OS5A 5KG1A 1S6QB 3BREA 1R0AA 2B6AB 3FRZA 3DRRA 1QE1B 2FBVA 2D7SA 5DK5A 4ELTA 4PWDA 3ZT3A 2OPQB 2OZSA 1JLEA 1NHUA 4K8ZA 3MR5A 1C1CA 3MF5A 1BQMB 2AGPA 4DTUA 4NLOA 5F8JA 3TQ1A 2IAJA 2HNZA 3RB6A 4CJSA 5KG6A 1JL2A 3IGNA 1T03B 2IDOA 1XHXA 3C6TA 3H5UA 3L3UA 1L3SA 4KE5A 3BQ0A 3TWHA 4CEBA 4PWDB 3TABA 1UA1A 1TP7A 1ZTTA 3DLEB 3DRRB 3SNNA 4IFYA 5KFPA 3DDKA 2VA2A 3AA3A 5KRTA 3SPZA 3FDSA 3Q8PB 4H4MB 1XWLA 1UA0A 3TR8A 4KV8B 1C0TA 1RT6A 3V9UA 1WSHA 2JC0A 1KHVA 2XY8A 4HUEA 4B3OA 5FRMA 2GIQA 1X1PA 4DMNA 3CIZA 3KK1B 5EWGA 1Z25A 4KHMA 3NAHA 1SH0A 2P5OA 4JV1A 1RDAA 1YTUA 3ZSVA 3CWJA 3BSNA 1ASUA 4TYBA 4OKJA 1HNVA 1TAQA 4Y1DA 4AHCA 3EZUA 3CYMA 4HTUA 3TI0A 1RT1A 2UVWA 3F73A 3HVTA 5SZTA 4C8LA 4M42A 3V9SA 2DY4A 1W25A 1JLCB 4PQUA 2UUTA 1BIZA 4JS4A 2I5JA 2BANB 3CG7A 4ED7A 3AVCA 4OGEA 2YKMB 3IS9A 5CZ2A 3TAFA 3IG1B 4IH6A 3NH2A 2YNGA 4MKAA 2DFHA 1U09A 4Q44A 3GILA 3RBEA 4OLAA 4YR3A 5J2PB 3K57A 4ZPDA 3QEVA 3OSPA 1NK5A 3OLBA 4FZYA 4CEEA 2HHUA 3QIOA 3OJSA 4HHTA 1S9GB 3AVIA 3SQ2A 1UOCA 2IJFA 3PO5A 4QOZB 2RF2B 3KMQA 1KFSA 4M3WA 3I5AA 3SZ2A 4EEYA 3OYMA 3DRSA 1RT4B 2WONA 3IGVA 1HPZA 4FW1A 3DRPA 4ED8A 4QCLA 4ZVEA 4LQ9A 1YTAA 4I2PA 4JV0A 4KI6A 2FVQA 4M94A 3OYAA 3AVHA 1BISA 2GV9A 3AA4A 5KFEA 4U6PA 3RMCA 4O55A 1S48A 4CIEA 4JRQA 5KG2A 1DTTA 1EP4B 1VRUA 3LWLA 3BDPA 5J2NA 4AHRA 3KLGA 2XHBA 4IBNA 3O3HA 1XR5A 4CFDA 2D0BA 1S9GA 4NLWA 4CF9A 3DYAB 4E1NA 2XGQA 4W5TA 4ECXA 5CYQA 3SUQA 5CYMB 4WZQA 5EU7A 4IR9A 2HNYB 4K50A 1C1AA 3M8QB 4URQU 4CK2A 4NZ0A 1KVBA 3NGZA 4E7HA 1YVUA 4ELVA 2AWZA 4TYAA 2ATLA 4RW4B 1LWFA 1VSEA 1RT3A 1S4FA 4R8UB 4N56A 3VQ4A 1UWBB 1ZYQA 1D9FA 4CJWA 4W5OA 1A5WA 1IO2A 5KFZA 1W9HA 2PYLA 1T03A 2HHVA 3KNAA 3NCIA 4DU4A 3JSMB 3LP1B 4URGA 5C25B 3CJ5A 1BQMA 2RDJA 1CLQA 1HNVB 3CJ2A 4EZ9A 4FJ5A 1KLNA 4DQIA 2PYJA 1GOCA 3AO5A 4HUGA 3V1RA 3FSIA 3MR3A 4YR2A 3OJUA 3EPGA 4X2BA 3PVXA 4J9KA 3QIDA 3L2VA 3NE6A 4CFCA 1IKWA 4WFXA 5KFHA 1HYZA 2G8WA 4KO0B 4Q45A 1C0TB 3RAQA 4DSKA 3BSOA 1VSLA 3NGDA 3NDKA 1EKEA 4HCBA 3SQ4A 3KJVB 2O5DA 4QWEA 4J9SA 2BANA 3OHBA 1QSSA 4F3TA 1HQUB 2WOMA 5KFAA 4O3QA 3AA5X 1J54A 2V9WA 3RMBA 1WNSA 3I0RB 4NYFA 4ECRA 5SWMA 4Z0UA 4CF2A 4CK1A 3GV7B 5F8IA 4ELUA 4ECZA 4FM1A 3Q8SB 4CGGA 4FM2A 3L8BA 2OPRA 1REVB 3LWMA 1CXUA 3B6OA 1NOZA 3DOKB 1N48A 4GC7A 2B6AA 4NLYA 4TQRA 3KKRA 5T14A 1VRUB 5KT3A 3V4IA 2CKWA 3K59A 4RNHA 2HHXA 1FK9A 2HMIA 4KHUA 3A2FA 1KLMA 5KFSA 3UPFA 3IAYA 2C2EA 1QSYA 4DQRA 4GMJB 2XCAA 4DLEA 5J2MB 3SJJA 3Q8RB 1VSKA 4H54A 4E0DA 2CJQA 5L1LA 4B9LA 4F4KA 4O3OA 5HROB 2AX1A 4RNOA 2W9BB 2V4RA 2W8KA 4FLVA 4KB7A 4TY9A 4ZHRB 4IR1A 1WNEA 3NL0A 4FZZA 1S5JA 2ALZA 3NFAA 1WSIA 4ZPAA 1D0EA 2W7PA 4J9PA 3PV8A 4LSLB 4R8UA 1S6QA 4E7LA 4DWIA 3IG1A 1TKTB 1JLFA 3LAMA 5K14B 3OL8A 1TK0A 2BE2A 5KFIA 1WSJA 4DL2A 3M8QA 1RDDA 2ATQA 1IKWB 1S9EA 2XRIA 3KLVA 3ZSOA 2FJVA 3IRXA 4PUOA 2JGUA 4H8KA 4E7IA 3DYAA 4I2QA 4I9LA 2EHGA 1TV6B 1VSJA 4DSJA 1HNIA 4DF8A 3VQEA 4CEZA 3KMSA 4IRKA 3CO9A 3V6JA 4B3OB 4O5BA 3UIQA 1FKOB 3M8PB 1EXQA 1TKDA 4FS2A 3CM5A 4O3RA 1QUVA 1RT6B 4DU3A 1QQCA 4IKFA 3OS2A 2X74A 1JIHA 4CHNA 4KKOA 3GIKA 3NGYA 4CEAA 4DSEA 2YKNA 3T5LA 4LH5A 4DTSA 2ILZA 4E7JA 1ZBFA 4TSXA 1IH7A 3H5SA 3V1QA 3ISND 1NKEA 1C1BA 4CJRA 1JLQB 3KD1E 3ICLA 3AO3A 2D3ZA 1SL0A 4RW8A 1W0HA 3SYZA 2OPRB 4O3NA 4GC6A 3VQ8A 3HM9A 1U45A 3MEDA 3JYTA 1LV5A 4Z4EA 4DSIA 1ZBIA 1SL1A 3AV9A 2FLPA 3THVA 4CHYA 2ETJA 1VRTB 1SKSA 1C1CB 3QYYA 4J2AA 2HVHA 4IOBA 2ZE2A 2HHSA 3QESA 3M8RA 3RR8A 4EBCA 3M9MB 4LD0A 4NYZA 1CXQA 4KAIA 3HP6A 3VN5A 1RTHA 3QNNA 2KZMA 1DTTB 2YNFA 2FLLA 4FJXA 4FLZA 4OKEA 4QW8A 4AH9A 4CJFA 4DTNA 3K5NA 1TVRB 4XPEA 1U04A 1JLAB 4KO0A 2F8EX 3ISNC 3QZ8A 3CDUA 5KFXA 1LW0A 4M3RA 3SI6A 2XI2A 4F3OA 2A1SA 2IM1A 3DRSB 4Q43A 2FVRA 4AILC 3KOAA 3ZSZA 4YNQA 1TL1A 4DFJA 1RTIB 3ZCMA 1KHWA 1X9WA 2WRMA 1SUQA 3S3NA 3Q8QB 2C2DA 5KFJA 4DL5A 3P1GA 4KV8A 5DGAA 4EBEA 4G3IA 4ECQA 4K4WA 2IA6A 1RCHA 1LW2B 4CJLA 1L3VA 4MIAA 4K4VA 5DQHA 3OLAA 3IS9B 1BL3A 4LH4A 4IG3A 4ECUA 5KFWA 3O4QA 3ALYA 1JL1A 2FJXA 4FJLA 1N6QA 4DQSA 4FK2A 3DM2B 2HNZB 1S1WA 3VQQA 3BGRA 2IOCA 4DFKA 4L8RB 5DG8A 3C94A 4QWBA 3T5HA 4RW9B 3OYKA 1RNHA 2ZD1B 3DI6B 3QGHA 2FBTA 4URSA 1T8EA 1WN7A 2J6UA 2E9RX 4J9RA 5KFRA 3DLRA 2G8IA 3KLEA 1TKZA 3L2UA 4FBUA 1IKXA 3OL9A 3O3GA 1BHLA 3I0SA 4TY8A 4ZTJA 4KRFA 2P51A 4QWAA 1TAUA 3S3OA 3QO9A 1RA7A 1NK0A 5KFBA 1S0NA 4ZP9A 4K4UA 4W5NA 2QKKA 4Z4IA 3PY8A 3T5KA 4BE2A 4J9MA 3AA2A 2EC0A 1WSFA 3VA0A 2G8HA 4IH7A 1ZBHA 3VQDA 2ASDA 4RW4A 5KFDA 4KAZA 4DG1A 4JS5A 4NLDA 4K4TA 3MXMA 1NK6A 3KK2A 2YHAA 2RF2A 4FLYA 4DF4A 5JUMA 3AO2A 4EYHB 3GIIA 4KHNA 3TAPA 4CJEA 3JYTB 3TAEA 2RKIB 2XO7A 3NF6A 4DFPA 3PW2A 5CYQB 1U47A 4DEZA 1S6PA 2P1JA 4YMEA 4QWCA 3OYIA 1TK8A 5JXSA 5F8HA 3CFOA 2R7YA 3UDLA 4DTOA 2BQRA 4AHTA 4W5QA 4MK9A 1IG9A 4FZXC 3M9NB 4RW7A 1NK9A 4CECA 2QXFA 1SL2A 4CGDA 1XHZA 3M8PA 2NUBA 1NHVA 1S1VA 3HXMA 4B9VA 1RT1B 4K4YA 1WSEA 4WXOA 1T05A 4DQQA 5KT4A 3TANA 1HQEA 3DLGB 5KTQA 4NLXA 1HNIB 1D5AA 5FROA 2B43A 5KFOA 3GV8B 4CHQA 4ED3A 3AO1A 2XCPA 3KLHB 1L3TA 4FM0A 5L1KA 3LP0B 1RYSA 4B8CA 3BSAA 4UQGA 3E01A 2HAIA 5J1EB 4FK0A 2A1RA 5K14A 5KFUA 1S1UB 4Q5VA 4YR0A 1JLFB 3RRGA 1L3UA 2IM3A 5KT6A 3O4NA 3CJ0A 3HP9A 1MMLA 3I0SB 4TY8B 4KB0A 2BQUA 4AHVA 3QZ7A 3VQ5A 5KFKA 3VQCA 1NOYA 5KFMA 1NKCA 1HJRA 2R8GA 4NCGB 3D45A 3F9KA 4LSNB 3CQ8A 4GVMA 4RW9A 4OKKA 3QIPB 2YHBA 3RWUA 4KHYA 5JS2A 3WNGA 5HLFB 1RYRA 1K1QA 5HBMA 4CGIA 1S1WB 1KVAA 3DM2A 1JLEB 2GBZA 1NNDA 2E9ZA 4WZMA 4FJGA 4ICLB 1I39A 3VQ9A 3SV4A 3C6UA 4FJ9A 3MEEA 3AVMA 3KLFA 2IM0A 4CJQA 3FQLA 3QNOA 4IFVB 3SQ0A 1NJXA 2HMIB 4I7FB 3OVNA 4RG8A 4B9UA 3AVBA 1EX4A 1VSMA 1B9DA 2P5GA 1FKPA 1ZBUA 3VQ6A 4CE9A 3BSCA 3HYFA 5E41A 5J2QB 3DLKB 1WAJA 2GC8A 3G6YA 3VQAA 4JRPA 3G86A 3C6TB 3ZSYA 1RT2B 4F8RA 4FK4A 2JEIA 4FLXA 4QAGA 4IQXA 4KTZA 2IAJB 4NLUA 3N6NA 5KFLA 4IG0A 3HSTB 3FFIA 5D3GA 1LWEA 4O0IA 5KFTA 2IM2A 4PA1A 1RDBA 3RB4A 3S9HA 3PX0A 2X6SA 3QETA 1XI1A 2DTUA 1R0AB 3OYDA 3QGGA 3AVFA 2J6TA 1G15A 2VWKA 4ICLA 5L1JA 3OYNA 1JXEA 4TN2A 4CEDA 2W8LA 2IMWP 1FXXA 2OZMA 1C0UB 1JLGA 5C42B 2ZE2B 1D8YA 3H4DA 3FFIB 3QGIA 3V81A 2ITGA 5KG3A 1F21A 1LAVA 3LP2A 3T5JA 4CJKA 2WHOA 5KFNA 4QW9A 3MECA 3MXIA 4WFZA 4EO8A 2IGIA 4RUCA 1SH3A 2YV0X 2KZZA 3DLKA 1SV5B 1JLBA 4EYIB 5C25A 4E7KA 4DL6A 1RBSA 3PO4A 4ZP8A 5EWFA 3E01B 1QTMA 1HYSA 4DS4A 3DLHA 1JX4A 2WK4A 3H2LA 3KLIB 2ILYA 1FKOA 1QAJA 2R8KA 3LP0A 4QWDA 4JUZA 2KW4A 2QK9A 1EETB 3TAMA 1NK8A 1SV5A 4KHSA 3HJFA 4XPCA 4KHRA 3HK2A 3VQPA 4LQ3A 3LPUA 3T3FA 4NCGA 3PX6A 1J5OB 4NLQA 2W42A 3H5XA 3MFHA 1HMVA 1JXBA 1Q8IA 4DSFA 2W9AA 2VG7B 3H5YA 4J2BA 2HHWA 3V6DB 1WAFA 5C24A 1N5YA 2BE2B 5J2NB 3RMAA 4KFBB 2R2RA 4M3XA 1A5XA 4N76A 1XC9A 1RT7A 4MFBB 4HUFA 4MH8A 1IM4A 2RPIA 4NLVA 3QEIA 4C8KA 4ECWA 4K4SA 1BI4A 4I2PB 1RBVA 3M8SA 1LWEB 2VG6A 3NGIA 3ITHB 1S1TB 2UVUA 4CF8A 4FJMA 3N6LA 3T19A 4CEFA 3KK2B 4CJ5A 3UR0A 1JLBB 4KTQA 5HRSA 1RT2A 2R2TA 4FVMA 2VWJA 1ASWA 1GOBA 4M3ZA 5FDLB 3O3FA 2AJQA 4JV2A 3L3VA 1S49A 5F8LA 4IKAA 2BR0A 3UQSA 4NLSA 4E3SA 3CJ3A 3EZ5A 2YNIB 3U3YA 2Z1GA 1BQNA 1GOAA 2FVPA 3V9ZA 2YNHA 3I5CA 1QHTA 3ZSQA 4I9QA 4DFMA 2BGGA 1RDRA 3G6VA 2HHTA 1S6PB 3OYGA 4CIFA 4H4OB 1C6VA 2I1RA 4KHWA 5I3UA 3QIPA 3PJXA 4CJUA 3MR6A 4NYNA 3MEGA 3RB3A 3QEWA 4WE1A 1YT3A 5EWEA 3NHGA 1RBRA 3SFUA 2HNDB 3OYEA 4G1QB 4B9MA 1D9DA 2FVCA 3H4BA 1DLOA 3SV3A 3LP3A 2W7OA 4TQSA 2HVIA 5KG0A 3KHRA 4CGFA 2C2RA 2QKBA 2GUIA 3OY9A 3GV5B 2XY5A 4NRTA 2JLEA 4F4YA 3C6UB 1J9AA 3HHKA 2OYQA 1TL3A 3VQBA 3P5JA 4EO6A 4KREA 3MECB 3SUOA 4CGHA 3MEGB 2Z1JA 3QLHB 2HW3A 4IDKA 2OH2A 2FBXA 4ED6A 4Z4CA 4K4ZA 1GX5A 1KTQA 5HRRA 1VSHA 3ITHA 2UVVA 1NJZA 1S0OA 4EP4A 3TVKA 4CK3A 4RU9A 5JS1A 3NF9A 5KT5A 3AO4A 1IKYB 4C8MA 4CF0A 2OPPB 1B92A 3U6FA 4RW7B 1RDCA 2FVSA 2HHQA 4KSEB 2ZQBA 2IC3A 4KFBA 2FJWA 3MTKA 3L2RA 2X78A 4CJ3A 3LAKA 4CEOA 1LWFB 2YNIA 1TKXA 4CHOA 1NKBA 1DTQB 5HP1A 5DQIA 2FC0A 4CGJA 3I8DA 2W9CB 4Q8EA 1DLOB 4ID5B 2HNYA 2F96A 1Z4UA 3RMDA 4CJPA 4Q0BB 1U49A 4RW6A 4MK7A 3CM6A 4HKQA 5T7BA 3ZSRA 2V0NA 2XY7A 1QSLA 4LY7A 3DOLA 3H08A 1O1WA 4R5PA 3NAIA 1RA6A 4IRDA 1LAWA 4FLUA 1HYVA 2D0CA 1VSDA 4KKOB 5I3UB 3K5LA 1TVRA 3PX4A 5KFVA 5CY4A 4ECTA 3KHHA 2Y1JA 1TKXB 3OS0A 4N47A 2YNFB 1RTJB 4NLRA 4ED2A 2KTQA 4OPKA 4HVJA 4F2RA 1VRTA 3SCXA 1VK0A 1J5OA 4WFYA 4ED0A 4CHPA 4W5RA 5F8MA 4CEQA 3N6MA 5KFQA 2OPSA 2RKIA 2B5JA 1S10A 3BR9A 5J2PA 2QV6A 1JLGB 4DL7A 2R8JA 3PW0A 2RN2A 2PZSA 1KRPA 4WYLA 4IDKB 5EDWA 1IKVB 1RTJA 4O4RA 1ZTWA 2ASJA 3RR7A 2Y1IA 4FJIA 3V6HA 1B9FA 3D5MA 5CZ1A 4M3UA 4M3YA 2I5JB 3RAXA 3KK3A 3QEXA 4IH5A 4MKBA 4F2SA 5F8NA 1HRHA 1BI4B 3V9WA 4DQPA 3V6KA 3KK3B 5D3GB 3LZJA 4IG0B 2DFEA 4O0JA 3AVGA 3T1AA 1CSJA 1KCFA 3PHEA 4DS5A 4OLBA 4TLRA 4NCAA 3V6DA 3ZSWA 1TL1B 1T05B 2HNDA 1LWCB 3V9XA 3QEPA 4FLWA 4O44A 2ZD1A 3DI6A 2E4LA 4BDYA 3NF8A 5C5JA 3V81B 3OHAA 5HRPA 4HCCA 1N4LA 1KFDA 4H4OA 4FYDA 1CZ9A 4NLPA 5KGXA 4F4XA 4FJNA 4DLGA 1S0MA 1IKYA 1X9MA 1ZETA 4M3TA 3EPIA 1YVFA 2KFZA 3OS1A 2BRLA 1BQNB 3MAQA 3BQ2A 2HWIA 3RRHA 3L2QA 3P83D 5KG4A 4AHUA 3AVAA 4FJHA 1JKHB 4NLGA 4O44B 4PY5A 3QINA 4RZRA 4KI4A 4DG1B 4Y34A 1RT5A 3G0ZA 4ZP7A 4B08A 4FJKA 2E9TA 1RTIA 4EZ6A 1RT5B 4R0EA 1QE1A 2WCXA 1GX6A 3HVRA 4Q0BA 1JKHA 4ECYA 4J9OA 2D5RA 3KJVA 2KFNA 4M41A 4ID5A 5DLFA 4DTXA 3QERA 1DTQA 5HP1B 3KHLA 5J1EA 2RDIA 3KLFB 1JLAA 3MXJA 4AHSA 4KBIA 4C8NA 4NCBA 1RILA 4B9NA 1T3NA 3MEEB 4CJTA 3DOKA 5EUHA 4ZVFA 1S97A 1QAIA 2LSNA 3KLEB 4RNMA 2C22A 2AGQA 4DSLA 3EYZA 4FJJA 5F8GA 1TK5A 3D28A 4Z4HA 5HBMB 4EP5A 4ZPCA 3NAEA
chains in the Genus database with same CATH superfamily
4M8LA 3MM7B 2HHPA 3EY1A 3LO3A 4AFFA 1IBLK 3TJ9A 2YPYA 3PYDA 5KGWA 2VG7A 3D2FB 2YKAA 3FQKA 4BWJA 1DHMA 1IQZA 5DM7Q 2VA3A 3HPGA 4CJVA 5GAEI 3MTJA 1TL3B 4ES2A 3CF5Q 4O4GA 3D6HB 1U4BA 3HRGA 3BGOP 3B82A 1R0BG 5ETRA 3CCJN 2YKNB 2ACYA 4QPXA 2UUAF 2OANA 2HWTA 4C3KA 1ATNA 2GNKA 2WFBA 1VQ8N 2GJFA 1SUQB 1F1BB 3OSNA 3AH6A 5L1IA 5DLGA 3IN5A 2KT5A 4N5SA 2IJNA 3VQ7A 4DPTA 3B6PA 2J7KA 4GKKF 4E1MA 3V1OA 3RB0A 1NM2A 4M7XA 4E19A 1WTFA 2V7ZA 3HVWA 2CQ2A 2HF4A 5C2FA 4JEPA 1KAZA 5AQYA 4B3RF 1RT7B 2G8KA 2H1YA 4KTWA 2ADCA 2H3GX 3MMJA 3OBIA 2WB4A 5IV3A 3K7RA 3GJRB 4DX5A 4OIXA 3KTQA 3A8YA 1FHTA 2WONB 5LMNJ 2PGCA 3WQTA 2V8PA 5JLFA 1S1UA 3IXQA 2GIRA 3J7YU 1M90O 4B3SJ 3NGRA 4GKJJ 3LW5C 4OI0A 5KFYA 4CRJA 4JNEA 3C6HA 1Q7LB 4HTIA 3U8XA 1DRZA 4FXDA 4OHZA 3AVKA 3CCJS 4ZN3A 2R4FA 4WYBA 4OI6A 3CVKA 4X4TA 1VQMN 3DLLQ 4RW6B 4BDPA 3ZT2A 2OEKA 5AXKA 1T94A 2Q3SA 2ASMA 4ZVUB 1MWQA 3GR1A 2IRYA 3K58A 1HD1A 4DV4F 2VG5B 3DU6A 5CAAA 2XI3A 1TTHB 2BKPA 1VQPS 3OTEA 4LF7F 4MO5A 2YQ1A 1FVSA 1LK7A 2UUAJ 2JX2A 2D41A 2C2OB 4DV3F 3WT0A 2X1FA 4PHTX 3THYB 3CCVN 3MGJA 2ZH7A 4UTGA 2QO3A 3OYFA 3EN9A 2XMJA 2RIJA 2G2OA 3WXIA 3MK6A 5ADXH 3K8WA 3VEYA 1WLJA 2B4VA 3D0IE 3S3MA 2DIVA 1WHWA 5L39A 1QHAA 3EGWB 2YHYA 1U8SA 4DR2F 5JMVA 3LDPA 5C7PA 4QS8A 1AFJA 4NXMJ 3VPZA 2JLFA 2LQBA 3GTYX 4M5DA 2O4IA 1DAXA 2YHXA 1YSJA 4BRPA 3ZT1A 1IBMF 1IKXB 4JI0F 5HI7A 4K0KJ 3KK1A 2OPQA 4A4JA 2P9NB 2XTJP 2HK2A 2EC2A 3P3DA 2HBRB 4EIAA 4RNFA 1J53A 1BDGA 1XNRK 4ZDNA 3DLGA 5DDOC 1M1KO 1RWWB 4DTRA 2UUAK 1ASVA 3PJ9A 5T41A 3TSPA 3GONA 2M88A 2G2ZA 1OH5A 5I42A 3DXMA 2A6MA 2GX8A 1Z6RA 4FBTA 1OH8A 2YNHB 2QWPA 3HPHA 4YFUA 4L72B 4OQJA 5C24B 1EJ7L 5RUBA 1YJNS 2FF6A 4C0OC 4I2QB 3CFPA 3MEDB 4CFAA 4BRIA 4DUZK 5FLXO 1NBWA 4BS2A 3HPOA 1C1BB 1IV0A 3NF7A 3EVMA 1B0VA 2YVSA 2E1CA 2YKMA 4FPRA 2GZOA 4ZCKA 2D1CA 2EFNA 3GG4A 2IVOA 1TZ0A 4M5IA 1A9NB 1GMWA 4B3TJ 5HRNA 3W5XA 3GE1A 4JLHA 5GADP 2F7TA 3NS6A 2ZDOA 3CDWA 4W4MA 2A2CA 1RAEB 1BHNA 1TU0B 2V6AA 2XHWA 2P9SA 5E84A 2ZH3A 3E51A 3D6TB 1RHJB 4UT4A 1TKZB 2OPSB 1X9JA 3PKYA 4X66J 1HBUB 1GK8A 5HL7L 3SI8A 5SUHA 3SSRA 2DNGA 3M2UB 4QR1A 5LJ5Y 1ZXOA 3TAMB 1B3TA 3ZC4A 1EETA 3QWUA 5IT9Y 5D0RA 1H72C 2IVYA 5DG9A 3CJQA 4BRKA 4UOCA 2F4FA 4LVOP 3EE3A 4PQUB 4DL4A 4BACA 3I5BA 5CYMA 3TAGA 3M2RB 3HZ6A 3PJWA 2NRWA 4ZHRA 4WQ4C 4H5VA 3RJMB 2QN6B 3VWSA 2HS0A 2X6NA 2P6SA 3KLGB 1MU2B 2P9SB 1R43A 2JEJA 3GQCA 4ZN1A 4J9QA 2RB7A 4YP3A 4FW2A 2CPXA 4Y65A 4Y2IA 3HT0A 3PW4A 3HM8A 1FK9B 3NBPB 3L2WA 3C15B 4KH1B 2OELA 2Q36A 2U2FA 1KVCA 4NZ6A 1FJGF 1X0PA 1Q86O 3I33A 3UR3C 4F4AA 2PN6A 3FRZA 3W2WA 2FBVA 2D7SA 4ELTA 4PWDA 4OX9F 2EEYA 3IKMA 3KJFB 1D8ZA 1CC7A 1NSQA 4JI4F 2Q2RA 2OZSA 2W01A 1XNRF 4LFCJ 3QSIA 2KO1A 3E2EA 2E66A 3UN2A 3MF5A 5LMUK 1BQMB 1T9UA 4DTUA 4CJ7A 5F8JA 4CJSA 3DRXA 2FB0A 3IGNA 2H4YB 1T03B 1N88A 1U2VA 2BJEA 3CD0A 3C6TA 2XS5A 3Q89A 1L3SA 4S0MA 1HA1A 2BM1A 4CEBA 1UA1A 1ZBTA 1ZTTA 3BV8A 2VA2A 1WJ9A 3HF5A 4ZCIA 1NB2A 4IOAL 2MQPA 4X4QA 3AOCA 1UA0A 1RWVB 3CC4N 1MG7A 1LWXA 4OZ0A 3V9UA 1WSHA 3PSFA 4OJHA 2JC0A 4DHYA 2XY8A 5FRMA 3WIVA 1B64A 2F4VK 3KK1B 2E5JA 3OPKA 5EWGA 3W7BA 3NAHA 2KG1A 3T9ZA 2BABA 3ZSVA 3BSNA 3NGKA 2GVZA 1DQAA 2ZH9A 1O51A 3H6EA 3W2VA 3P31A 2JWLA 1WUAA 3TI0A 4K7QA 1SI9A 4M42A 2D69A 4R25A 2GJIA 2UUTA 2I5JA 1I3OB 2YH0A 1IJEB 1RAAB 1OSCA 3NH2A 4Q44A 3ZTOA 5J2PB 4PXEA 3AJ1A 1NK5A 4I64A 3R8EA 4QU7A 3C16B 3I55S 3SCKE 2YQ0A 3MAAA 3OJSA 2MKCA 3U1MA 3OFEA 3SQ2A 4Y2MA 2IJFA 3PO5A 1KFSA 3I5AA 4E1JA 4EEYA 3VGSA 4JI6J 4LR7A 2XQCA 3UKUB 4WFBQ 4CO0A 1HPZA 4FW1A 2QEXN 4P52A 1R6VA 2JL9A 5AQQA 1NGCA 4ZVPB 4ITSA 3V5RA 3HSJA 2FVQA 3OYAA 1BISA 5KFEA 3RMCA 1Y7PA 1Q8KA 4CIEA 4CYUB 2HBQB 3LWLA 3BDPA 2MB0B 3HKZD 4A8QA 2V8GA 4PAAA 3KDOA 2R7RA 2QMUB 3C0BA 3NEKA 5E26A 2D9PA 5HAOA 1S9GA 4NLWA 4ES1A 2XGQA 3FBCA 3CIMA 4C3LA 1KR4A 4B3RK 2QGFB 2HNYB 4OLOA 4K50A 4F26A 2JDJA 1RHQB 4NZ0A 4K25A 1YVUA 4ELVA 1HD0A 4ZVRB 2DK2A 3UCZP 1FO1A 4R8UB 3MCPA 1X4BA 1UWBB 4A8XA 1UMJA 3AQPA 2FJDB 4DV0K 1A5WA 5A8WA 1NPPA 2CVIA 5CH7B 3TJ8A 1HNZJ 4P2FA 3ZETB 1KS2A 1RAFB 2HHVA 3VGUA 3IMQJ 5LJWA 3LP1B 1A7GE 5C25B 1B7FA 3CJSA 4H4KC 5AFUA 4DR1F 1AUDA 3AD7C 3O8MA 4CLSA 4I67A 4NB4A 4DQIA 3UDVA 1GOCA 3ADAC 3TYTA 5IZHA 4LRDA 2BEFA 3V1RA 2MZ1A 3MR3A 1Q7YT 3MAAB 4YR2A 3W3SA 3EPGA 4X2BA 4J9KA 1OKJA 1Q82O 4CFCA 3MM9A 4Q45A 2BX6A 2VFSA 3PYEA 1VSLA 4DR1K 3I4PA 1I94F 4HCBA 3N28A 2WBMA 3KJVB 4CZEA 1FT8A 4J9SA 4ID8A 1SXLA 1WOQA 4EFAC 4DR7K 5KFAA 5M1QA 2C2KB 1RBOB 4M5KA 3GSIA 1NMDA 3S1TA 4ECRA 1PC5A 3H1QA 4B02A 5SWMA 4CK1A 1H7WA 4K41A 2XYPB 3Q8SB 1ITPA 4FM2A 2X3DA 3RZAA 1V5IB 1H3DA 3AODA 2RU3A 4ZITA 1IBMK 3FJ2A 1GEHA 3GMGA 3KKRA 1E6VB 4ED4A 3V4IA 2CKWA 3K59A 4RNHA 2HHXA 3NMUA 5GAGP 2HMIA 3D67A 5GAHU 5KFSA 3UPFA 1JQGA 1QQMA 2FJAB 2C2EA 4DQRA 2B9YA 4GMJB 4DLEA 1M0SA 4JK8A 5J2MB 2AZ1A 1VSKA 4H54A 2W25A 4E0DA 2G13A 3AAQA 3D1OA 2AX1A 2LU1A 4NE9C 2FGCA 2RSQA 1MN9A 3BGUA 3UE2A 5A76A 5D8HB 2BZ2A 4X62J 3RW6A 3KUGA 3NNAA 3NY0A 4LBIA 2Y8WA 1R27B 2UV8G 3ZX0A 5BYQA 1O0PA 4R8UA 4FWRA 4CO5A 5AQOA 2MYFA 2V2ZA 3LAMA 4AQYJ 1MWZA 4D3HA 5AZJA 2CNLB 4K5SA 2ADBA 1TMMA 2R7OA 1SQGA 3TSQA 1KEKA 4PUOA 4NEYA 3VEVA 4OHXA 4WP9A 1Q82T 4U9RA 1TV6B 3C2PA 1OYDA 5H9FK 2KH9A 2FTRA 2B51A 2CH6A 1NBEB 2PMZD 3L4BC 1ICEB 4WPAA 3KMSA 3BGFA 4IRKA 1FESA 3M05A 4O5BA 3QQCD 3PYGA 3M8PB 4FS2A 3RRKA 5KOXA 4CBWA 2ZNZA 1XMBA 4QIWD 3OS2A 1SQFA 3GPAA 3T5LA 4DTSA 1IH7A 2B8QA 4HT5A 3ISND 1IBKF 1JLQB 4ILGB 3KD1E 1UVMA 4B1VA 1SL0A 2ZITA 2CGJA 4B3TF 2OPRB 4H0VB 2QWQA 4O3NA 4C9DA 4GC6A 3CO0P 5AQTA 3Q2SC 3AAWB 1ZBIA 2G0CA 1JK9B 3THVA 4OZ2A 1KQFB 4JI7F 3QYYA 4J2AA 1ZM4A 4IOBA 2ZE2A 3M8RA 4LD0A 1CXQA 3FZMA 3VN5A 1DTTB 1I5OB 3M2VA 2FLLA 1QY7A 4FJXA 2OTJN 4FLZA 4OKEA 2FHJD 3D3BJ 2VGNA 4CI6A 2QWLA 3TEHB 3DWLA 3JS6A 3F5TA 2KXHA 2CJKA 3J8AA 4KO0A 2LP4A 2H9ZA 1RKIA 3CDUA 1HBMB 1N8RO 5BXIA 2A1SA 2IM1A 3DRSB 4I6MB 2V67A 2HRUA 1FJCA 1AZSA 3Q8QB 5KFJA 5AR0A 2BM0A 4KY3A 4DL5A 3P1GA 2E44A 1CS4A 1ZC6A 5A2QO 4ECQA 1JJCB 2IA6A 1RCHA 3N4QA 1LW2B 4WIQA 2AA4A 1K9MT 1ATSA 4J91A 1VQ6S 4JI5F 2OD4A 3ALYA 2CQ4A 2VPZB 4FJLA 3DXMB 3A12A 3QJJA 1N6QA 4DQSA 4LSZB 4FNHA 4DFKA 2DNLA 4L8RB 4LIWA 4QWBA 3T5HA 4RW9B 2P8IA 4UZBA 2CQ3A 1T8EA 2J6UA 2E9RX 5E5NA 2UUCK 3IM9A 1HR0F 3L2UA 4FBUA 2XMWA 3DKDA 3EL2A 1IKXA 4B1YB 2VDHA 3D3CJ 4TY8A 8AT1B 2WSEC 2RDDA 3QT7A 3M6WA 3S3OA 5KFBA 1N34K 2FY8A 3GFZA 3OT9A 4USKA 4K4UA 4W5NA 1TYQB 3ATVA 1SBRA 2Z58B 4YY3J 5AQJA 1WSFA 1RWNB 4IH7A 4OPHA 3VQDA 4OV6A 1M1KT 1SC1B 1URNA 3CC2S 2YHAA 2BJ7A 3AO2A 3MM8A 3O6QA 4EYHB 4KHNA 1FFGB 1JNZB 4CJEA 3TAEA 3SCJE 2XO7A 1U47A 1UL3A 1FDDA 1FTRA 1NMEB 2NRTA 4KGKA 1K47A 5AXNA 1FX2A 4LFCF 1IUJA 2FC8A 2OI2A 3UDLA 3CCLN 4MK9A 3CJ8A 3QWPA 1WG1A 2LCWA 4WP8A 3WUHA 2QXFA 1SL2A 2JWNA 5AFUH 3M8PA 1NHVA 1S1VA 2X3GA 4Z7CA 3U4LA 2B56A 4USTA 1M5SA 1VC6A 4JI5J 1T05A 2MZSA 2UXDF 1HQEA 2QWMA 2DB1A 2CUYA 5AQNA 5HQ8A 5FROA 4ED3A 1NUEA 2XCPA 2ZH4A 3I6PA 1XMQK 1L3TA 3VESA 3GCWP 4LF8K 3KWGA 4DV2K 1HPMA 3MM6A 4MLEA 4B8CA 1VFJA 2XMMA 3A5NC 4CZIA 4YOYA 5J1EB 1S1UB 3G4SS 1NU4A 3MN5A 5HJYA 2CA9A 3O4NA 4U67L 2NXEA 3I0SB 2YTCA 3T6JA 5KFKA 2JVRA 1Q81T 1RCXB 2YKPA 1HJRA 4DV3K 3JS9A 2R8GA 5A0YB 3K0SA 3F9KA 4JKDA 3G71N 2N4CA 4KH4A 3CMAS 4OKKA 3A8KA 4JOUA 1RYRA 4CGIA 3DM2A 1JLEB 2JFKA 1HR0K 2GBZA 5FIIA 2E9ZA 1CVJA 2MXYA 2M3DA 1CEZA 3VQ9A 1GMWD 3C6UA 4FJ9A 2AEFA 2ZGYA 3AVMA 2E1RA 3GG0A 3BO4A 3TUJC 3M32B 3SQ0A 2HMIB 2L48A 3OVNA 3TW0A 4RG8A 1UFKA 1S72N 4Y0WA 2DGXA 2HBKA 1HJOA 2WUSA 2RD5C 4UOFA 1B9DA 1W26A 3TQEA 5DM6Q 2NPIA 1FJ7A 4K5RA 1QTNB 4PG6A 2KJWA 5IWAF 4FVUA 1S5ZA 2LXIA 2GAGC 1NGAA 1E3MA 3CCSS 3WC2A 2MQOA 5GIPA 3G86A 2W7AA 4FLXA 1KQSR 4UY8O 2DCUB 2E7VA 2DR6A 4CQ1A 3HSTB 1VQ8S 3VEOA 3Q0AA 5D3GA 1LWEA 5I4MA 5KFTA 3TR5A 3O9TA 2IM2A 3MM7A 5IWAK 2E2QA 4LF9F 4BC2A 2XS7A 1YKWA 5CZXA 3PCOB 2A42A 3OYDA 4P7TA 3QGGA 2J6TA 2OJ3A 2Y1LB 5L1JA 2EXUA 1JXEA 1JJHA 1ZM2A 2CZ4A 4TN2A 2W8LA 2YJFA 5T7LA 2IMWP 2VICA 3SMSA 2CPIA 2OZMA 1C0UB 3UD3P 1D8YA 5HJXA 4CLUA 3V81A 1Y9OA 2C3OA 2ZBRA 3T5JA 4WFAL 4WFZA 2IGIA 4K59A 1SH3A 2KZZA 4ISFA 2HKEA 3DLKA 4OYMA 1K44A 3QAEA 5AXLA 1SV5B 3HJVA 4LBHA 5C25A 1WDTA 2E29A 4DL6A 4ZVOB 4X65J 4XEIA 4TU9A 5EWFA 4WF9Q 2VFTA 1YQHA 1QTMA 2PAVA 3MN9A 5LJVA 5E0OA 1UEUA 2R8KA 4JI3K 2BMBA 2W2OP 3M1VA 2W2QP 4DUTA 2YWHA 2KW4A 2QK9A 4PL8A 1SV5A 3HJFA 2KXNB 5C15A 4YN3B 1U0SA 5AQVA 2B7BB 1VHXA 4MO4A 1XTZA 1IBLF 3VQPA 1VHFA 2AYEA 1J5OB 1G3OA 4P7VA 2W42A 2AJ0A 2HRTA 4DSFA 1S77D 2W9AA 3PM9A 3POTA 1VLOA 2HHWA 1WAFA 3BUZB 2C3UA 2QX0A 4CYUA 1XEZA 2PC6A 1M1GA 1NDLA 2RUGA 5FLXY 1RT7A 4F36A 2LEPA 2I0XA 4JD2B 3D2EA 1VDHA 2RS2A 3M8SA 1LWEB 2VG6A 3NGIA 2G9OA 1WF2A 1XMOF 3ITHB 3BR8A 4CZKA 1S1TB 2NRVA 3BEXA 3MMVA 2KHCA 2ROPA 3UKUA 2XHCA 3UR0A 4FWSA 2HIYA 1PIEA 3A13A 1D09B 3M7VA 3DCAA 2VWJA 2MKKA 4JI1J 1TL4A 1U25A 1R8PA 2M8HA 3R9PA 2GV1A 3CUNA 5DO2A 4E3SA 4YOTA 3RSEA 3CJ3A 5AQKA 1H2UX 4DV7J 5D77A 4RKUC 3M32A 1B7YB 2Z1GA 1CJVA 3V9ZA 1QHTA 4LF5K 2I38A 3E1YA 4Y00A 4DFMA 2FF3B 1KD1T 4YUDA 2HHTA 4CLWA 4RTFD 2GFFA 1WSRA 4CIFA 1JJ2M 1C6VA 2DHSA 4KHWA 1TL5A 3DHXA 3FCWA 4RBTA 2Q31A 3PJXA 1IM6A 2ZWPA 3AQOA 4OYOA 1ACMB 4NYNA 2R9LA 2ALYB 2CPFA 2CDRB 4JI1F 3OYEA 4G1QB 1Q81O 2FVCA 2V7YA 1X31C 5G0RA 3C7NB 3MCAB 2HZAA 1NO8A 2HVIA 3VALA 2ZHOA 4BR2A 1CJTA 3MM6B 4NRTA 2JLEA 3BZCA 3HHKA 4BR5A 3TX8A 2AV5A 3D1HA 2OP5A 4YY3F 3P5JA 3NGSA 5AE2A 4JYAF 2H5JB 2CWXA 3MEGB 2DRDA 3QLHB 2HW3A 1FRJA 2ERRA 2VFVA 1LK5A 4NYPA 4DUZJ 2UVVA 2AD9A 2HFUA 1S0OA 4QYRA 3TVKA 4EP4A 2NLWA 4RU9A 2B9XA 5KT5A 1CQMA 4C8MA 2MQLA 3PEHA 1M5HA 2FHOB 3O9SA 3U6FA 2ZQBA 2J9DA 3L2RA 2X78A 4YOUA 3OR1B 4X66K 4X4UA 4QJVA 1CULB 1S3XA 1RU1A 1DTQB 5HP1A 2P9EA 2FC0A 4DDFA 2DHAA 4O5FA 1K8KB 2VL1A 2EKNA 1WI8A 3RMDA 1RK8A 4F0HA 3PFEA 1F9FA 4NYOA 4KQZA 3C46A 3CM6A 4HKQA 1IG8A 1N36K 1NJIO 4LY7A 2CQGA 4FLUA 3T69A 4C1NI 2EI5A 1KD1O 3CD5A 2OGUA 3ZNUA 1X3NA 4DKWA 1Q18A 2J0QD 3R6GB 1NDPA 4LFAJ 2O8BA 2GWJA 4A61A 5IT4A 4OPKA 3HBTA 1VK0A 1UW4A 1U1NA 2IRXA 5DM7L 2JLGA 3W65A 2YJEA 4L3QA 4DV7K 5F8MA 3IBFB 2E5IA 2OPSA 3HDSA 4YEAA 3BR9A 3PW0A 3HHNB 5EDWA 1RJJA 2ASJA 1RTJA 4DR6F 1ZTWA 2QI2A 2Y1IA 1B9FA 1VQ9S 2HEKA 3D5MA 5TKYA 4NEZA 4M3UA 4P73A 2QLJB 3QEXA 1J5EF 4MKBA 5BR9A 3AY0A 1C0GA 2D9OA 3V9WA 2XM3A 2F65A 1QVFM 3V6KA 4DV6F 2M52A 1OVYA 3FR0A 3KWMA 3ZTPA 4CBXA 3QICA 4IG0B 3T1YF 4EK2A 3T1AA 4OLBA 1GTHA 2LA4A 3ZSWA 1T05B 4KPCA 4CI0B 5DJBA 3P96A 4FLWA 1EHWA 4A48A 4O44A 4J9UE 3O44A 3DI6A 1F3FA 1GLCG 4HR2A 1N4LA 1KFDA 3L0QA 5F41A 4DQ8A 4FL9A 4CP5A 1YI2N 2GCFA 2RQKA 4WJBA 4M3TA 1YVFA 2KFZA 1KAXA 1KVJA 1OPIA 3MAQA 1URRA 3R1LA 3RRHA 2VDIA 5KG4A 3P83D 2HMPA 5HATA 3AVAA 3R5CA 4FJHA 3DLLL 4JI2J 4HH0A 4USUA 4RZRA 4W98A 4ZP7A 4DV5J 1NEEA 1APSA 1RT5B 1GX6A 3HVRA 4JKCA 4HDGA 4M5DB 2D5RA 2OCEA 2KFNA 4M41A 2EFQA 3QBWA 2QA4G 4B3MJ 5BRFA 1DTQA 5HP1B 2RDIA 3KLFB 4USJC 3TUPA 3MXJA 1WF0A 3BM7A 4NCBA 5LJ3Y 5EN1A 3HFKA 5KOWA 3OBYA 4L3KA 1U1RA 2AGQA 3NMRA 5F8GA 2M7SA 1TK5A 3PIPL 1F5BA 1NSPA 3TRGA 5A8KA 2ZOGA 5IM0B 1YG0A 4CJ4A 4PUOB 5E3PA 3BO3A 3EEQA 5I9EB 3QLHA 4OL8A 3RTVA 5L9XA 4JK7A 3Q2TC 4TVAB 4TNOA 3IWLA 1SKRA 4PZVA 5D4LA 4KGXB 1OJ4A 5M2UA 3H2VE 4IEIA 3WEEB 2RRBA 1RWOB 2W2MP 3AJ2A 3C6AA 2VHGA 2MSTA 2PMHA 3HVAA 2GHPA 4DL3A 1NJWA 3H8YA 4UW2A 3D7EO 4JN4A 3JAMU 3I8BA 2W40A 4V19X 3W62A 1HLWA 3PW7A 4CFBA 1BU6O 4J9LA 4C11B 3ZX2A 1QS4A 3QFHA 3RW7A 1XNQK 4G9ZA 4JYAK 3IC1A 4F50A 1A5VA 4OJ3A 3UFCX 3K5MA 2PBDA 2O4GA 2LECA 3GR0A 4A8OA 3OYBA 3MMCA 3DMJA 2BBEA 2X1AA 2CYYA 3OYLA 2BUPA 5KG7A 4X4VA 1GLLO 4QS9A 1N5YB 5AE3A 3G4SN 1GLAG 1VCTA 4DR2J 2VFRA 1WC0A 4ZS6A 2PFFB 1XIQA 4OYPA 3HSZA 1ZBLA 5L46A 4ZJLA 1CPZA 3GIMA 1JLQA 4R5PB 2D0OA 3DOLB 2F1FA 5M2RA 4BC4A 3NXZA 2LQ9A 3J81O 2YNGB 3DU5A 4DI6A 3CMES 2HHHJ 4C1NK 3F2KA 1S1TA 2CJAA 1K0VA 2DITA 5DMRA 3A4TA 4BY9C 1PCAA 2VG6B 3SPYA 1BIUA 4ECSA 3CDEA 2V50A 3GYNA 3ASMA 3VAJA 1S7HA 4HDHA 3QO9B 3BYRA 2IVFB 3D0GE 3IBWA 4KPYA 1RT4A 4O4GB 1GLBG 3CTRA 2OPPA 4N41A 2NRXA 1YITS 1N56A 4XTTA 1TV6A 1SIWB 2Z1HA 2QJ3A 1WKJA 1OMSA 3MPUB 4OJRA 4YQWA 1SC6A 2LMIA 4ZVQB 4M95A 2QFJA 4ANEA 4DR3K 2AYGA 5D15A 3LP1A 3CF5L 4MLHA 4JI7K 4H4MA 1KQGB 3PR4A 1QQOA 5A0YA 4CM2A 1VBYA 1X7VA 1Y5LB 2HG4A 5A8WB 3DLEA 1H0HB 1VC5A 2AHOB 2GUPA 2QTDA 1SZ2A 5DRKA 3FCHA 5ETLA 3OXFA 3HX9A 1VQKS 1BCMA 4OZ1A 1FD8A 4J7CA 4ZP6A 4P2MA 1T9WA 4CO1A 2Q0UA 1S9FA 1AROP 3HT3A 3L7PA 1C2PA 1N33K 1KTVA 3ZX3A 1SKWA 4PPDA 4YY3K 1GMVA 2UV8A 4J2EA 1SJFA 1DT9A 3R2DJ 4LF8F 3D9BA 4Y2CA 2AJ1A 1LW0B 4KRWA 1VOMA 1HNWF 1K8AO 2FYXA 3BQ1A 3J7YP 4IFYB 3CFRA 2EFGA 1M1HA 1WC1A 2VF3A 5BN8A 1XNRJ 1HPZB 4BG8A 2E6MA 3KD5E 4TU7A 1BWVA 4Z4GA 2PT0A 3LANA 2ROEA 3J80U 3FZ2A 1R8HA 2B4JA 5MAOA 1X4DA 2NRRA 3OYHA 2MHNA 1R8AA 1T0TV 3C16A 1QDUB 4DV6K 2R2SA 1K6YA 2DPIA 2ITMA 4ZPBA 3NWGA 4OYXA 2CQHA 4BREA 3WNHA 3R5DA 4U67Q 4LF8J 1CZBA 3FZHA 1GXTA 5AQUA 9ATCB 1GQEA 4X66F 1X5PA 4A62A 4LREA 1RBTA 3IDHA 3MWPA 3C95A 2IDEA 5HL7Q 2XNRA 4IOXA 2GGPA 1O5JA 4FJ7A 3DMJB 6FD1A 1RTDB 2G8UA 3PSIA 2OMLA 1FJGJ 3GE9A 4M45A 2MHEA 4WWSA 1JWWA 2XLIA 4WXWA 3DXSX 2IVMA 2F8TA 5A8RA 1OY8A 2V9KA 4FXVA 4W90B 1U48A 2PIIA 1HUXA 2ASPA 3JQJA 5KPTA 1NAQA 4A8FA 1X4HA 3MUMP 2AJFE 2MQ8A 2R8HA 3KG1A 1OH6A 4RW8B 1VQ4S 4W92B 3ZSXA 2O8CB 1BGXT 3TU5A 4MIBA 5AJ3K 4FCYA 2QXLA 5GVQA 3FZFA 2HOEA 4CLYA 3KJQB 2ZKUA 3VTIA 1BCOA 2MKHA 3CSKA 1YGYA 2P9PB 1VSFA 2VB6A 3MPWA 1JB0C 4LFAF 5H9EJ 1S1XA 1RSCA 2ZJRL 3I0RA 2CDQA 4XIUA 5LM7E 3H40A 1AZSB 2WOMB 2MPUA 3UB5A 4ZTFA 3EM1A 3KIOA 1NJYA 5D4PA 2HQGA 4KGMA 3UWTA 2J6SA 1OO0B 4U7CA 4Y1CA 2H4WB 4MYTA 2DRBA 1G2EA 3ZYYX 2ATCB 4C4WA 1Q9YA 3PR5B 5BYSA 1P27B 2D3UA 2F5GA 4NLTA 2QG9B 4WFAQ 2OUGA 1OS5A 4DTMA 4MDBA 3BREA 1S6QB 5KG1A 3H7HB 2B6AB 1SJ1A 3S8SA 2I2YA 2HLUA 4UOGA 1XNQJ 4K8ZA 2I8EA 4CZJA 3MR5A 2PEBA 4M5LA 1GXLA 3M2RA 4NLOA 3TQ1A 2IAJA 3RB6A 5DDPC 5KG6A 3MPDA 1VRQC 1BA0A 3L3UA 2V8DA 3IWXA 3A5MC 3BQ0A 1KP6A 4DR7F 5C2CA 3CCES 1TYQA 1RI7A 2MKSA 5KRTA 4GNIA 4L74A 3TZZA 4BC3A 4C23A 3T1HK 2N3LA 3Q8PB 1J5EK 5IQ6A 3M2UA 2UXDJ 4KV8B 1C0TA 3ZLJA 2L9WA 4LUBA 3T41A 3THWB 1KHVA 1HBUA 2RMLA 3KZBA 2GIQA 1TMJA 1X1PA 2MQMA 1AYEA 3CIZA 2GS8A 2VZ9A 4JV1A 4P71A 3I82A 2DYAA 3CWJA 1ASUA 5ITHA 1FRKA 4LF5J 3EO3A 4OKJA 4HI1A 1HNVA 2XO6A 1TAQA 3EZUA 4HTUA 1RT1A 2UVWA 3F73A 3HVTA 1R0CB 2Y0BB 1IBLJ 3LTOA 4C8LA 2FDNA 4DXLA 2QL9B 3V9SA 2DY4A 2O3DA 3AFGA 4I1TA 5AZJB 1Q5VA 3ZZOA 2C2ZB 4JS4A 2O01C 3VEWA 2YPZA 4JV5F 1OVQA 1B0PA 2IIRA 2YKMB 1C4CA 5CZ2A 3ZZYA 5CQGA 4MKAA 2ABYA 3SBMA 2DFHA 3CCWA 4OLAA 1P8GA 4HT7A 4RPFA 3EKUA 4ZPDA 1RAGB 3B78A 3AD8C 1VBKA 3OLBA 3G87A 2XBPA 4HHTA 4DN9A 1E4GT 1YJNN 3SZ2A 3DRSA 4JI0K 4NI2A 2W2NP 2H5EA 2XLKA 4CBUA 5A8RB 4BROA 4ED8A 4QCLA 4ZVEA 3P39A 1HWIA 3BS9A 4JV0A 2RQ4A 3SQGB 4H0OA 3AVHA 3AA4A 1LFPA 4JI6K 4U6PA 1VYAA 1UJ6A 4I0WA 2QLXA 3MCSA 2FY1A 4O55A 2UXBF 2GQCA 1S48A 3C14B 1DTTA 1EP4B 3GL1A 2F4VF 1SKUB 3W8PA 4LVNP 3KLGA 4BR0A 4IBNA 2BH1A 2QW9A 2HRYA 1LOTB 3O3HA 1XR5A 2D0BA 1RBAA 1VBXA 5HMWA 4CF9A 5IS2A 4E1NA 4ECXA 3SSQA 5CYMB 4ZJOA 5EU7A 3LPEA 3N4WA 5ETNA 4CK2A 3VF6A 4HWIA 2Q6BA 4IDHA 6FDRA 3OTOF 4E2FB 3DN9A 4TYAA 4RW4B 4I6YA 4N56A 3VQ4A 1WACA 4Q7AA 2QZ8A 4X64K 2MSSA 1N36J 2XMTA 3GOIA 5KFZA 1FRLA 2PYLA 4KT0C 3CCQN 1OH7A 3G82B 4A8KA 1H6KX 5D6GA 3NCIA 3MM9B 2HQIA 3HLUA 2AJ4A 2F9DA 1AA1B 3O9UA 4IUFA 2G1HA 3GBTA 2JRSA 2VD3A 4HUGA 3FEXB 2XS2A 4B17A 1RQ0A 1TR0A 2CQDA 3QIDA 1XQIA 3NE6A 1UFWA 4WFXA 5LT5A 1HYZA 2G8WA 2JNJA 4ENOA 3RAQA 4RBVA 2CZ9A 1QAYA 3SQ4A 4FYWB 2WSCC 1T3VA 1E6YA 4ZKAA 1V3RA 1MSWD 2AEJA 1QSSA 1KQKA 2LXFA 4F3TA 1HQUB 2WOMA 1ZBSA 4O3QA 3AA5X 3DLJA 2HF3A 3PG9A 1WBDA 2VQEK 1WNSA 3I0RB 4NYFA 2JZ5A 2G2YA 4N8NA 2DNNA 1IWGA 3D6RA 4Z0UA 2OKQA 5F3ZA 4LF1A 3P5BP 4ECZA 4R79A 4CGGA 2B0GA 1HWLA 3EGNA 1CXUA 3R3TA 4JI5K 3CULA 5EX0A 1YK9A 3HOSA 4FZVA 4H0TB 4GC7A 4NLYA 1F5CA 5T14A 4OJGA 2DNMA 4MKYA 5GADI 3RSEB 1MMDA 3R5GA 1E6VA 4FF2A 1RUSA 3SJJA 1SCJB 3Q8RB 4DCOB 1FJGK 4HACB 5L1LA 4B9LA 1WHYA 2HFZA 1UCNA 1N36F 5A2QY 1TELA 2P9LB 2W8KA 2Q1NA 3VGLA 4EI2A 1WNEA 1N34F 2R7QA 4WBFA 1S5JA 4U8YA 1WSIA 3H46O 2W7PA 4PXBA 3SCLE 1Y00A 1QZ6A 2NUUG 4LSLB 4DWIA 4OV1A 2EBEA 4F25A 1TK0A 1S59A 3TUZC 1N32F 3M8QA 1S9EA 2XRIA 3GFHA 1CJUB 2OFHX 3FCVA 1S72S 3THTA 3DGPA 2ZFHA 3R6MA 2EHGA 1HNXJ 4JAXA 3KFWX 5L38A 4P9SA 2LQJA 2YWFA 3OTBA 3ZZ0A 1YITN 2OEMA 4DR5F 3VQEA 1KNZA 1NGEA 3UIQA 2HSEB 1EXQA 3CM5A 3TPQA 2UXCK 3K89A 3U1NA 4H03B 3G71S 1HL6A 2X74A 1JIHA 5FPEA 1TFWA 3CPEA 5A6PA 4CEAA 3QFUA 1X60A 4LH5A 2ILZA 2DNHA 4LF4K 4OHWA 4TSXA 3H5SA 3CCMS 1SJ3P 4G1PA 1VQ9N 2MQNA 3LQVA 3B4DA 5IC4B 1W0HA 4CZFA 3HM9A 4P72A 4Z4EA 2HFSA 7AT1B 2YQ3A 4DSIA 3TA1A 1FDNA 3W9JA 4HHUA 5B8HA 7FDRA 3J81j 2JHEA 4WKRA 4HTJA 2HVHA 3U02A 2HHSA 4QIFA 4V19S 4JI2K 2KZMA 2YNFA 5KQ8A 5EGYA 4AH9A 3MOJB 2CFXA 4DTNA 4LF6J 1PBAA 3H3OB 1ZZFA 2YH1A 1TVRB 4XPEA 1VQ4N 4B3SK 4GKJK 2F8EX 1DJ0A 1J6ZA 3FSXA 4M3RA 4QIGA 4FDFA 3OUYB 2NLXA 2KXFA 2LXUA 2DGSA 4Q43A 2F9WA 2QA1A 4AILC 3KOAA 3R3LA 4YNQA 3ET6B 4JV5K 1J5EJ 1X9WA 2FPHX 1SUQA 2A41A 2C3YA 1X4FA 2GVDB 1IBCB 4EBEA 3EKSA 2P6TA 4Z2XA 2CJ9A 4K4WA 4BRMA 1RDWX 4CJLA 3RGIA 5DQHA 4F0MA 3OLAA 1FFWB 1BL3A 2DR7A 4P10A 3EJMA 4IG3A 3P4UB 5KFWA 3O4QA 3LL3A 3J80Y 2EK6A 3N0VA 3RAMA 5JVHQ 1NLKL 4FK2A 3DM2B 2MY8A 2HNZB 3TA0A 3MCOA 3VQQA 3BGRA 2IOCA 1AW0A 3W2VB 5DG8A 3C94A 3VAMA 2X51A 4EU0A 2MTLA 1M5KC 4GO5X 3DI6B 3QGHA 3P45B 2L9DA 3OVBA 4J9RA 4BVOA 5KFRA 1TKZA 4FPIA 3I0SA 4OX6A 4XDDA 1RA7A 4ZK7M 3VF0B 2GQQA 1DQ9A 2CAJA 4Z4IA 3O9RA 1HI8A 3CE8A 4J9MA 1ESVA 4BE2A 2IRUA 3QMLA 1PO6A 3R97A 5I3PA 3VA0A 3BKUA 4K43A 3EZWA 2ASDA 1MNEA 3QNWB 5KFDA 4DG1A 2ZKTA 5GMEA 1NK6A 4JHDB 3KK2A 2EPIA 5JUMA 2Y8YA 4LF9J 5CYQB 1S6PA 4JI3F 4N77A 4YMEA 2P1JA 5AQZA 2FSNA 3NS5A 3O4WA 2R7YA 4FWPA 4DTOA 1HKCA 4AHTA 1IG9A 4FZXC 2I9SA 4RW7A 4J9VA 1AUSL 3WC0A 1NK9A 1YIJN 3ZZPA 3MI7X 4UOHA 1WC6A 1RT1B 2R7UA 3UDEA 4K4YA 3TANA 1FXRA 2EKYA 3DLGB 4CHQA 2W4CA 3AO1A 3KLHB 2WVFA 4FM0A 3LP0B 4RUBA 5GAGI 3UCUP 2G0IA 1HHSA 3QBCA 2E5HA 4BHQA 3WQUA 2HAIA 2RU9A 1NRKA 4X4RA 2PFUA 4YR0A 4LF9K 3R5BA 3VGVA 4CH7A 1WC4A 3MHYA 3JTOA 4BCAA 3HP9A 2R7XA 4TY8B 1VIXA 1NGBA 3VQ5A 1YRTA 1U2RA 1NKCA 3IFEA 2M9KA 1NXIA 4RW9A 2HFVA 2YHBA 1FE4A 3WNGA 5LL6Z 5M2PA 5CHIA 2LLZA 5HBMA 2IYIA 5ETTA 3I56S 2F8MA 2VBWA 3RG6A 3EZOA 3I31A 3Q23A 3W9HA 1WG5A 3SV4A 3MEEA 2DR9A 2IM0A 2B9WA 3PYFA 3UDCA 1S7IA 3K0JA 4IFVB 3O2IA 1Y3JA 3FC9A 4CW7B 1FF2A 5GAGU 4M5MA 2DIUA 2P5GA 3VQ6A 3HYFA 3PTWA 5G0RB 3C7NA 3L09A 2IBOA 3PDNA 4FK4A 2JEIA 2VCPA 4QAGA 1NHKL 3W60A 5KFLA 2J7WA 4IG0A 3VEXA 4BQLA 3A3OB 5B0EA 2V5HG 2SXLA 3THXB 1FKAF 1HWUA 3NCRA 4NL5A 1FD2A 1F9HA 2DTUA 3A0IX 1R0AB 2XWXA 1G15A 4JI8F 2VWKA 4LFCK 3FEZA 4JI0J 3EE9A 2YI1A 4OLPA 2NSBA 3ULEB 2CRLA 3NG8A 2RAQA 1TUVA 2ZE2B 1ZA1B 3FFIB 4F0KA 1Q7YO 2ZM6F 5BYRA 5KG3A 1XC3A 2V8VA 3ZFVA 5ADZA 1EO1A 5JVGL 4ZPTR 1K8AT 2UUCF 1TUYA 5KFNA 3G8TA 3MXIA 1HNXK 3QGPA 4BRGA 4EYIB 1YRXA 2E2OA 1ZH5A 4ES3A 5I3QA 1MWYA 1D3WA 1Q95G 1QUPA 1RBSA 4ZP8A 2BV3A 3MURP 4RR5A 3QRRA 4DS4A 3H2LA 3TWZA 3DAWA 1DBDA 3LP0A 1PAEX 4QWDA 2XSJA 3Q83A 4JUZA 1YJTA 1NK8A 2AP6A 1Y3KA 2PA3A 3MMAA 2DNZA 2VU5A 3HHLA 1O13A 4BR9A 2V34A 3T3FA 4NCGA 4AQYF 4Z7YA 4U7UK 3ETOA 1UPMB 1JXBA 4F67A 2VG7B 3H5YA 1CULA 2BE7D 1UTAA 4ATNA 5J2NB 1WBBA 2BJ9A 1YBAA 2FZCB 2HK3A 1WUUA 4N76A 4D3GA 4GVLA 4HUFA 3M1VB 1QAXA 4ZJQA 2CPDA 4HL9A 4K4SA 4AQYK 1BI4A 1PYOB 4ISEA 4I2PB 1M5VC 2DO4A 5KPZA 2ZJPQ 3W61A 4CF8A 2E20A 4IOCQ 2Z2LA 1WHVA 4ZPWR 3N6LA 3T19A 4CEFA 3KK2B 4CJ5A 1FA0A 1CQNA 1NDCA 3CI5A 5HANA 1RT2A 3TUIC 2R2TA 3R9LA 1U0HB 1ASWA 4CD3A 4M3ZA 3O3FA 4JV2A 1QQNA 1W7AA 2E2NA 4TLQA 3OFFA 2YNIB 2FUG9 2JWKA 2CGLA 3FSYA 4Y6IA 2NR0A 1BQNA 1GOAA 5C2DA 5GAEP 3KK7A 2MGZB 3K17A 3I5CA 2G0JA 4EWTA 2F40A 2QYCA 2K1RA 3G6VA 4NX9A 1I1GA 1X8DA 3DXKB 4H4OB 2I1RA 1RB0A 1BWEA 5K9FA 2IYGA 3FKBA 2YBVA 4JB8B 3QEWA 3CC2N 3H90A 4JI8K 1KQSM 4GO7X 1B99A 1ELOA 4B9MA 3TSUA 4BGAA 3KVGA 1DLOA 3SV3A 2QSWA 4DV0J 2BKNA 4AYBD 3KHRA 4EGLA 2XYHB 3MXHP 4JI6F 1S12A 3ELHA 1F6TA 2GVDA 4F4YA 3W64A 3C6UB 3OR2A 1MMNA 3MMBB 1TL3A 2E5GA 3VQBA 2YKOA 4YHHF 4EO6A 4KREA 2WVDA 1RHKB 4IJNA 4OZ3A 2PSZA 2MMYA 1KAYA 4ED6A 4KC5A 4Y2KA 1KTQA 2KL8A 1WC3A 3ITHA 1NJZA 1ZAXA 1RACB 5HK4A 1I51B 4CK3A 3AO4A 1IKYB 3B54A 4FYVB 2DY1A 1RP5A 4OYIA 2FVSA 2HHQA 4KSEB 3BF3A 3KG4A 1U2CA 2IC3A 2FJWA 3MTKA 3CC7N 3LAKA 2NRZA 2EG2A 4OFZA 2YNIA 4FN5A 1TKXA 4JI4J 5DQIA 3S41A 3I8DA 2W9CB 4H0YB 3MMCB 2HNYA 4C2MA 2F96A 4CJPA 3LGHA 4Q0BB 1HQ2A 1U49A 4MK7A 1NPRA 4YHHJ 1V5VA 3TNVA 5T7BA 3TVZA 4X4PA 4DBQA 2XY7A 3EICA 2DH9A 3H08A 1O1WA 2DNQA 2V2VA 1QVGM 2CPHA 4M5NA 1HYVA 5IT0A 4CO2A 3OW2R 5I3UB 1H1VA 4BRHA 5M1FA 3K5LA 3FLCO 4WK3A 1SQKA 3CB4A 5KFVA 2XULA 3H0PA 3KJNB 4ILMA 4ECTA 3FK4A 2HSTA 4NLRA 1Y0HA 1XNQF 3GZ7A 3G6ES 3B8HA 4HVJA 4F2RA 3FNNA 1VRTA 5IWAJ 4L3NA 3J7ZO 5IM0A 2MLZA 1UETA 3QT8A 3LDNA 1K73O 3FBEA 1W2IA 3IFRA 5J2PA 2R8JA 3OVSA 3TOQA 2PZSA 1RISA 1KRPA 4YOEA 2P9IA 1T9YA 3RR7A 3I9V9 4FJIA 3ZZZA 2I5JB 2E5LJ 3N9UC 3KK3A 4F2SA 3T1HF 1HRHA 1V4SA 4H5RA 4DQPA 4G1IA 5D3GB 2YWWA 2E1ZA 3CCRN 3PHEA 4TLRA 4Z37A 4DB3A 3CD6N 4NCAA 2Q3PA 3V6DA 3SK3A 4FWOA 5AQIA 1TL1B 1TUWA 2BW7A 2YCHA 3B6BA 3GFYA 2DT9A 3QEPA 5B7WA 4RJVA 2HGMA 2CQCA 3NF8A 1NWKA 1KC8T 5C5JA 4GY2B 1DFDA 1X5SA 5BN9A 4USHA 1ZM9A 2R7SA 2DD8S 4HCCA 4FYDA 2P9GA 1IR0A 4LBPA 3ULEA 4BRDA 2IJRA 2UU9F 1ZZNA 3KUEA 4YB5A 3CXCM 3L7UA 5C12A 1ZETA 4DX6A 2AYMA 4ANCA 3EPIA 4LF7J 4AM7A 2VQFJ 2A40A 2HZCA 3S7RA 1R3NA 1WHXA 3BQ2A 1XK8A 3THXA 2QMWA 4EHTA 3M4XA 1JKHB 4O44B 1S57A 2HGLA 1SQEA 1NG9A 2DH8A 4WIIA 2CQ0A 2Z8QA 4A2BA 1N33F 4FJKA 1HKAA 3IP0A 3IR5B 1JKHA 4LF4J 4ID5A 5IV4A 2BOPA 2MDAA 3KHLA 5J1EA 2ZVIA 3CPWM 5FPDA 1N52B 1MA9B 4AHSA 3MEEB 1FJEB 3DOKA 3HZGA 5EUHA 4PKDB 4A8YA 1QAIA 2LSNA 2C22A 4DSLA 4FJJA 4Z4HA 5ETVA 5HBMB 1VQLS 4EP5A 3M2VB 3NAEA 2N7YA 4DUYF 1WKKA 4AXIA 5FPMA 2K3IA 4EBDA 4DR3F 2RQCA 3CJCA 2DHHA 4CHZA 1SC3B 3NGUA 2HBYB 2QEXS 1Z2ZA 3TZWA 5D0HA 5GIOA 8RUCA 4TU8A 1CC8A 4LRAA 4NXNK 2RH3A 5F9NA 2V4QA 4LC9B 4Y3CA 4ZVTB 2FBYA 1ZA2B 2VASA 3H3NO 1U1KA 3LPTA 2O8BB 3OYJA 4CWBA 5B0FA 4K8XA 4I68A 4FS1A 5CCLA 2HVEA 4L76A 3E9PA 2W24A 2H5IB 2IBKA 5FDLA 3ZTSA 2KQ2A 1WWHA 3PRVA 1TFYA 3BF1A 4KJIA 2K8GA 3SCIE 2Z2MA 1ZM3A 1P1TA 3KLHA 2GJ2A 1GNKA 3SDEB 4PWWA 5HROA 3OVAA 4DR4J 1EP4A 4YDXA 3C14A 3HHDA 3LA0A 2XGPA 4DV2F 5IT9O 3J81Y 1X5OA 4RUAA 4DV1F 5A2QU 3VVTA 1U1OA 3PRBA 3ZT4A 4MFBA 2GELA 1KLMB 4NA1A 1FWPA 3PUFA 4LF4F 1RTHB 1X4AA 3BN4A 1FEEA 1HMVB 5DZ7A 3HSGA 2A2DA 4LFBJ 3BDEA 5B0AA 3CJKA 1IXKA 1EWQA 1Z2LA 3TAQA 3FE1A 1PYTA 2AIRB 4LR9A 3CDBA 3NCQA 2FLNA 5LSOA 3Q8YA 4JI1K 4B1XB 3FVYA 3TEGA 1F2HA 1VQNS 4OPJA 3VEZA 2J8SA 3MFIA 4RNNA 3G25A 3K5OA 4CESA 3G9CA 1UAWA 2QL7B 5I42B 2F8SA 3HVTB 2V2KA 1RADB 3M3ZA 4B9SA 5CE3A 3LZIA 4WK1A 4PR6A 1NGDA 2YXLA 3EXYA 3T6BA 3WNFA 5L9NA 1NGJA 3HKWA 3TZYA 4DL0C 3SUPA 3A8JA 1RCOB 1K9MO 1NK4A 2J8AA 1RWXB 1AT1B 1EZZB 2IA0A 3IRXB 5HLFA 2R2UA 5JLHA 2CNKB 4FLTA 3BGRB 2ZNYA 3NLCA 4LSNA 3T9NA 3OD2A 4ILRA 4ZLNA 4DR6J 1D1UA 1SH2A 2PMWA 5HVGA 3OTOK 2W2PP 3MMBA 3OA9A 2Z57B 4M5GA 3QFWA 5CR4A 1ZOTA 1WSGA 3G6XA 2Z56B 3SFGA 1N5SA 1XR6A 1RT3B 1UAXA 3IM8A 1HYSB 2VOPA 3U1LA 2HVZA 4NPOA 2EFOA 3TTDA 4AL7A 2VKRA 5KFGA 2VFUA 3FRYA 4ZVGA 2YHWA 1HWJA 1KOOA 4C8OA 5F9LA 2BA9A 2XY6A 1YZ7A 2DVIA 1Q8BA 1FKPB 5E7OB 4Q8FA 4B3RJ 3LP2B 4U7BA 4CLFA 3K2PA 1TUGB 4L75A 5KPRA 1DGKN 4I7FA 2VG5A 5BRDA 3W66A 3P8BB 1M90T 1HARA 4PYDA 3DXKA 4CIGA 2V2QA 4DUZF 2HVDA 2UXBK 1WOSA 3WNEA 2R8IA 4F4ZA 2L3MA 1DURA 1BUXA 4X84A 4K4XA 5HQMA 2GIFA 1REVA 2KU7A 2RE2A 3SJHA 1I6JA 4GVEA 2V4JB 4DV0F 2BQ3A 2AT1B 3OL6A 2F3JA 4DV6J 2C3PA 1Z26A 5ADXA 3MCMA 4ECVA 3J80O 2Z1IA 1LWCA 2P2CB 3HCXA 5LMUJ 4NXMK 2V8HA 1KWMA 3OL7A 2DH7A 1YXQA 5L8RC 3OTDA 4A47A 1AXQA 1U02A 5FRNA 2AF6A 4NOHA 4KB1A 5CXTA 2DPJA 4DR1J 2QE5A 4CF1A 3NH1A 2OTLS 4JP8A 4OZJA 2EW9A 3AAPA 8ATCB 3HD2A 1IKVA 3NH0A 5KG5A 2E7WA 5DGBA 2OMOA 4O3SA 1PILA 2AYBA 4BQZA 1Z1ZA 2B5JB 3WDOA 2NCKL 3LDSA 1WOOA 1K1SA 3BPSP 5KI6A 4FYYB 1HW8A 3R7NB 5LSRA 1S9EB 1XN9A 2R3VA 2NZTA 3V4IB 4WYWA 3ILLA 2QMXA 2UZAA 2PFDA 1IJFB 3HSDA 4MT1A 3ENQA 1KBRA 4OI1A 4X64F 1Q9XA 4LSLA 2Z2YB 4C3MA 3TTFA 4CDIA 1RKJA 3H2UB 3NMAA 3JTNA 2VJVA 1XMOK 2EBGA 2C28A 4NASA 4B8AB 3R7BB 3WX4A 1MROA 3U3GA 5B08A 2R7TA 4DU7A 5HMYA 1SS6A 4MK8A 4FJ8A 2E2PA 3F9MA 4DTPA 5KFCA 1Q0NA 3MR2A 4Y2AA 1JXLA 1K0TA 2UVRA 2ASLA 3ZZRA 4C98A 2P9CA 2DNYA 4OHVA 2BDPA 2IHR1 1R0AA 1VIOA 1QE1B 5DK5A 1YJ9N 2IFXA 4J5OA 1EKSA 3QATA 1JLEA 1NHUA 2QWNA 2G4BA 4UUXA 1XMOJ 4C8ZA 5FD1A 5H1SQ 1IJJA 3FGVA 1LEOA 2IDOA 1XHXA 2DNOA 2LVWA 3H5UA 2DXEA 4KE5A 1JXVA 1E6YB 3TWHA 3GG1A 4PWDB 1PJ7A 1TP7A 3DLEB 1XBWA 3SNNA 1Z05A 3H25A 2NPFA 4M1KA 3AA3A 3SPZA 3FDSA 3M1FA 3TA2A 3I9ZA 4H4MB 1XWLA 2E1MC 4GVBA 3R8YA 3KWIA 2CPYA 3X3UA 3QT5A 1H73A 5F0WA 3J7Z5 3VGKA 2UU9J 3D7SB 2WAQD 4K2XA 2FQQB 3MCNA 4DMNA 1EB0A 3O9QA 4OJ1A 3CCLS 1Z25A 4NMXA 2WW8A 1LOUA 1WI6A 3T1HJ 1SH0A 4C97A 2CQ1A 1YTUA 2E5LF 1HNZK 4HLBA 1GTEA 4RU2A 4NMLA 4A8WA 2UYTA 4Y1DA 1VQON 4AHCA 1J2VA 3SXLA 1HNWK 3IAS9 3G82A 4RUHA 3AGKA 4PQUA 2A6OA 3N79A 2BANB 3KUHA 2DTJA 3OFHA 5JMNA 5EY4A 3HHEA 2D3OR 3NWRA 5CCMA 1VQNN 3TAFA 4IH6A 2YNGA 1U09A 3GILA 2MEWA 4DPYA 3LDOA 3RBEA 1P6TA 4PYAA 4YR3A 1QVGR 3K57A 2FZKB 3OSPA 1G4CA 4CEEA 4DV7F 3UD5A 2HHUA 1QVFR 3QIOA 1OY9A 3LPYA 5DS7A 3L6QA 4CZMA 1U7LA 3AVIA 3MM8B 3RUBL 4QOZB 1JCFA 2DBBA 3LUYA 3CW2C 5HSPA 3I56N 3IGVA 3O80A 3DRPA 5IOLA 3F41A 1TL7B 1HNWJ 1YTAA 2OAUA 4IXCA 3SQGA 4OO1J 4KHPF 2OHDA 3C65A 1CJKB 4LF2A 4U7UD 2E7XA 4JRQA 3EVWA 1VRUA 1PSDA 1O6XA 3JAMY 1RWKB 3D1QA 3OQ2A 3EGZA 2PD1A 3BZKA 1WB9A 3DYAB 3ENWA 4PKIA 2A18A 5CYQA 3L4IA 3BYPA 3AXMA 1OQ3A 2VGMA 3UN3A 4WZQA 5CZVA 1C1AA 4OYAA 4CZGA 4QZVB 1T9VA 4JKBA 1KVBA 4E7HA 5GAHI 4FF1A 2ATLA 1LWFA 1Q1KA 3CCMN 1VSEA 1N8RT 3OTOJ 2B9EA 1D9FA 1HHTP 1N5VA 4ILLA 3ULHA 4PWUA 2PEHA 4JI4K 4OYWA 4CLPA 4CJWA 4W5OA 2HIQA 1PKUA 4B1ZA 2VBXA 1IO2A 1DZ5A 4CTAB 1T03A 2GQ2A 2ZM6J 1YUWA 1UEKA 3KNAA 4FPAA 1BQMA 1EQ0A 3HI0A 2RDJA 3ZZUA 1HNVB 2KT3A 4C7QA 3CJ2A 4EZ9A 1BE4A 1KLNA 2RRAA 3CC7S 3P4IA 2PYJA 3CDAA 5B09A 2ZJQQ 4NO7A 4Y28C 3THWA 1BMQB 2KKHA 3OJUA 2PI5A 2LU2A 4RL1A 3L2VA 4KO0B 1UZHA 1C0TB 1NM1A 5DDRC 4DSKA 3BSOA 2J7UA 3RYLA 3LGNA 1EKEA 3BPDA 2O5DA 2BANA 4UQTA 1UVKA 2HAFA 5F2RA 5GMKa 1IBKJ 5AQFA 2GX9A 1J54A 3P5TL 2OLWA 3F44A 3RMBA 5LSLA 5HN0A 3TO8A 3EWGA 4CF2A 5F8IA 2CNOB 4ELUA 4JKEA 3VZHA 3I55N 3ZEUA 1RHMB 3L8BA 3N5BA 3THYA 1MWMA 2OPRA 4JI7J 3ET6A 4MIWA 4NA2A 4OYBA 3CEDA 3QPIA 4NXNF 4OZLA 4ZLLA 3DOKB 2ZZTA 2B6AA 2WZ1A 3ENVA 5KT3A 2PE8A 3PFOA 4A5BA 3EE8A 1YJ7A 4KHUA 3CERA 1NLVA 3SMZA 3SBGA 1JJ4A 4DV4K 4AF1A 4LJMA 4F4KA 1NMNA 2P9UB 2W9BB 2V4RA 2ZC4A 3CQYA 3M6GA 4FLVA 3EUNA 2BOAA 2MKIA 4DV1K 2P9PA 2ALZA 1CBKA 4O8KA 3Q24A 2Z30B 2VH7A 4K42A 4ZPAA 3MWTA 2EFVA 4YOXA 1GLFO 4AUKA 3IG1A 1TKTB 4ANDA 1JLFA 4BBYA 5K14B 2YWGA 1Q4RA 2CXEA 5KFIA 1WSJA 2DHXA 2CJXB 4DL2A 2ATQA 4NWBA 3JB9k 3L7OA 4J90A 1FVQA 2MJUA 4FWLA 1IKWB 4QR2A 3CMQA 3KLVA 4Y0FA 1HBOB 2I7PA 1HKBA 1SJ4P 4E7IA 3DYAA 4I2QA 2QSFA 1QZ5A 2C2NA 5FJ4A 4DSJA 1UWAA 1UVJA 1HNIA 1UW9A 1RAOA 1HR0J 4N8OA 4PKHA 4RWWA 1BY9A 5K5MA 5AXMA 3CO9A 2C2MB 4B3OB 4A5AA 2KYXA 1FKOB 1TKDA 3MM5B 1RZMA 4IOAQ 3AOAA 1RT6B 1QQCA 1U6ZA 3VOVA 2GGPB 3F0NA 2E88A 2YKNA 4DV5F 4E7JA 2P9IB 3CQXA 3V1QA 1K73T 1NKEA 1OYEA 2KG0A 2KYZA 1V3SA 2QA2A 2FC9A 2ZH5A 3AO3A 1FDAA 4GV6A 2AMCB 3VQ8A 3CCVS 1U45A 3JYTA 4JI3J 4DU8A 3WXLA 1SL1A 3AV9A 2FLPA 2ETJA 3A5OC 1VRTB 2CWKA 1C1CB 2BACA 2ZJRQ 2P9LA 1YLXA 4NYZA 4LF5F 5AQLA 4K0KK 4DR6K 3WZ0A 3M8ZA 4QW8A 2CQPA 1KOHA 2CH5A 3D6FB 3T7ZA 4WQ5A 1U04A 3KKFA 1Q16B 4ZLPA 3I96A 5AQPA 1JLAB 4NA3A 5IT9U 4JK9A 5KFXA 4E8UA 2CVEA 4C0BA 1LW0A 3SI6A 2MY7A 2VODA 2OSQA 3J7AN 2FVRA 4PCQA 2DGUA 3BKTA 3ZCMA 4OX9K 2WRMA 1Y5NB 1T3OA 2AJ2A 2C1EB 5DGAA 1C0FA 3VVUA 3DOMB 2ZWHA 2DPNA 1W2BM 2LQ8A 1L3VA 5GINA 4K4VA 3MDFA 3IS9B 4FXWA 2OSRA 4LH4A 1LCUA 4WCEL 4ECUA 3UKRA 1JL1A 5JVGQ 2NUHA 1DEJA 3CJ1A 3PIOQ 4DR2K 2CG8A 2HLTA 4ZA1A 4C6AA 3OYKA 5E33A 1RNHA 3KXDA 2ZD1B 2MKJA 4C48A 2FBTA 1WN7A 4KYZA 2RNEA 4X64J 3KLEA 3DHWC 2D1KA 1Y10A 3UI3A 4CT9A