4ICLA

Hiv-1 reverse transcriptase with bound fragment at the incoming dntp binding site
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
total genus 150
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4iclA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iclA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iclA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iclA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4iclA05
4CF2A 1NK4A 2VWJA 5KFIA 3SQ0A 1UA1A 1NK6A 4RW4B 5K14B 4G1QB 2A1RA 3QEPA 3KTQA 4B9TA 4K8XA 4MK7A 1TGOA 4DU3A 3I5BA 2QXFA 2IS3A 4Q8FA 4DEZA 5T14A 4GMJB 2EHGA 5I42B 4CHYA 2IGIA 1NHVA 3K5NA 1SKSA 4Q5VA 4DQSA 4IFYB 3I0SB 4NLYA 3AA4A 1XWLA 1QTMA 3RBDA 5KG0A 3MXIA 1RT3A 1C1BB 3O4QA 4CJFA 4PA1A 1A5VA 2HNYB 3LP0B 3EZUA 4QW8A 4RW7A 2IOCA 3H98A 1FK9A 4CEZA 1CSJA 4O3QA 1IG9A 4NRUA 5KG3A 2IBKA 4CFDA 5J2NA 3V4IA 4TYBA 3ALYA 1LWEB 1HNIA 2VG5B 3MEDA 3QYYA 4O5BA 1IH7A 2X78A 1L5UA 4DS4A 3SUOA 2C2DA 5L1KA 1CZBA 3OJUA 1KHWA 3DOKB 4DSLA 1TKZA 2G8KA 3B6OA 4IDKB 2WHOA 4CK1A 3MEEA 4WYWA 4MK8A 1N56A 2XCPA 2JGUA 3IS9A 3SUNA 4HKQA 1I39A 1C0UA 4NZ0A 5DLGA 2R8HA 4M3UA 5KFDA 1JLGB 3QEXA 4JS4A 2VA3A 5EWFA 1BQNA 1RT2A 4ECWA 4N56A 2GIQA 4NLUA 5DQIA 4DF8A 2W9BA 2YNHA 1HPZA 1N5YA 4DQRA 4O3PA 4DS5A 1HYSA 1RT4B 4EYIB 2ILYA 1DLOB 2YNGB 2QE5A 1ZYQA 3SV4A 3DMJB 5K14A 2W7PA 4DLEA 4WYLA 3QLHA 3WNEA 4FJMA 5KFHA 2KW4A 3QGIA 4YFUA 4KHMA 3I8DA 1RA6A 2FJWA 5FRMA 1FKOB 1RT2B 4Q44A 4DF4A 3NH2A 4NLXA 1TKDA 2OZMA 3VN5A 4C8NA 1JL2A 4MIBA 4O3NA 4CEAA 1RBVA 4J9RA 3QESA 1ASWA 4F50A 2KZZA 1D8YA 1RT7B 1SH3A 3ICLA 3IGVA 4LQ3A 4G3IA 1IKYB 4OKJA 4FBTA 1REVB 3VQCA 1QAIA 1NK0A 4CEBA 1DTTA 1UWBB 2W7OA 4URGA 4DSIA 4KI4A 3RMDA 1IKYA 1C6VA 1RTHA 4KHUA 1RDCA 4RW9A 3BDPA 3CG7A 4CESA 2YKMA 4ZPCA 5DG9A 5CYMA 5KFGA 1T3NA 2KZMA 1ASUA 3MEDB 1TK5A 4PQUB 3G6XA 3LZJA 1TV6B 1JLAB 4HUFA 5L1JA 4J2BA 4PUOB 1RNHA 5KFRA 1T7PA 1HPZB 3DDKA 1EXQA 1Z26A 2X6NA 3HPOA 1RYSA 2E4LA 3ZSQA 2ALZA 3L2QA 3EY1A 2HHXA 5KFMA 1SKRA 4LSLB 2UVRA 1D1UA 4CJEA 3T19A 3V6DA 4RUAA 2FVPA 3QEVA 1C1BA 3GIKA 3WNHA 4ECVA 1J53A 3IG1B 4U7CA 1RDAA 3MEEB 4JS5A 4CJSA 3K58A 3AO2A 3BSCA 2NUBA 1U48A 1J54A 1Q9YA 2G8WA 4DTUA 4B9SA 3OYBA 4EO8A 1F21A 3CFOA 4KAZA 4O44B 5F8LA 1YTUA 2B6AB 1VRTA 2AX1A 4CJ4A 4K4ZA 4TN2A 2G8IA 3QGGA 1LAVA 1VSFA 4E3SA 3OYGA 2XY8A 4MFBB 3OYLA 4FW1A 3PJXA 2V4QA 3CDWA 4O4RA 2FLNA 4CJRA 4ZP8A 3KHRA 1U45A 3AVBA 1N5YB 4MK9A 1TV6A 3ISND 1ZBIA 4OLBA 4EZ6A 1S4FA 1RTDB 4DSFA 4M3XA 4IR9A 4ID5B 1FKPA 2UUTA 2XY5A 4B9UA 2AGOA 4JV2A 4MIAA 2HHUA 3HVTA 1A5XA 3E51A 4IRCA 1YVFA 4QWBA 2YNFA 4B8CA 3S9HA 3V6HA 1NNDA 4CK2A 3CJ3A 1JXLA 3AO3A 5KGXA 3ULDA 3OHAA 5CZ1A 3V9XA 5EWEA 4CFAA 3NAEA 4CK3A 1TKTB 4ED2A 3DRSB 5F8NA 4IOBA 3LAKA 2P51A 3SJJA 5KG1A 4KTWA 4RNOA 3PV8A 2KTQA 3I0RB 4LSNB 5HRPA 1JLQA 3RRGA 4C8MA 3RMAA 5HRRA 3OYKA 1HNIB 3PJWA 2P1JA 4KTQA 2ASJA 4CJLA 5KFVA 2B43A 2W8KA 1IKVB 3PW0A 4BDPA 4H54A 1HJRA 2FBVA 1WAJA 1HYSB 5HROA 2JEFA 3CM6A 1JLAA 5KT5A 4DQQA 3KLVA 2C28A 3JYTA 4CHQA 1HQUA 3TAPA 3VQ8A 1TAQA 2YKNA 3KK1A 1NHUA 1JLFA 3PO4A 4YR2A 4RW6B 3TABA 3HVRA 1TK0A 3TAEA 1TKXB 3FQLA 3HYFA 2OPPB 2BGGA 2RF2A 4H4OA 4FS2A 4AHSA 1NKCA 4FJ5A 4DTSA 5DQGA 2HVIA 1C2PA 4K4YA 1RT5A 1HYZA 4GW6A 4FM1A 4J2AA 4Z4CA 3H5XA 3SFUA 2HWHA 3BQ0A 4HUGA 3KLFB 3H4DA 1DLOA 2HNZB 1B9DA 2WOMB 1HMVB 3VQQA 5CYMB 3QLHB 3SQ2A 5HLFA 1LWFA 2OYQA 4FK4A 3KKRA 1N6QB 3VQ5A 1RT3B 4NYZA 4GC6A 4IG0B 3NE6A 4JRPA 4JV1A 1BIZA 1RTHB 5EU7A 4FZXC 5KG4A 3TAQA 3NBPA 4ECTA 1S5JA 3L3UA 4FBUA 1TKTA 1S9EB 3E01B 3SYZA 4DSJA 2PYLA 2YNFB 3GIIA 4J9KA 4CFBA 4LD0A 1S0MA 2OH2A 1DTTB 1T05A 1RBRA 1XR7A 3V9WA 2RDIA 4CEDA 3IN5A 2BR0A 5KFEA 4ZPDA 3IGNA 4KTZA 4I2PB 3NBPB 4NLWA 5D3GB 4H4MA 3L2RA 4KPYA 5KFUA 3AVJA 2HHVA 5T7BA 3PX0A 1RTIB 4QPXA 4KHYA 4CEFA 2ETJA 3DLRA 2ATQA 3AA3A 3T5HA 3VQBA 4E7KA 1UOCA 4FLTA 1IKVA 4CHPA 2HVHA 4NLQA 1WSGA 3T5KA 4TY8B 1K6YA 2ZD1B 5FDLB 1Z4UA 3D0PA 4J9PA 2YHBA 2VG7A 1VSMA 3NH1A 3K2PA 2ASLA 3M8PA 4NCAA 4KSEB 3MF5A 2UVVA 1LWCB 4FJXA 4CF8A 4RUCA 4ECYA 4BE2A 3BSNA 1BIUA 4M3ZA 3PW2A 3UIQA 4E1NA 4LH4A 3ZSWA 4IRKA 1HQEA 2AGQA 3TANA 1LWCA 2P5GA 2RPIA 1VSEA 4NLSA 2XGPA 5I3UA 4WE1B 1JXBA 4KHRA 4NYFA 2ILZA 4AH9A 1JLCA 3BSOA 1IM4A 3C6UB 5C42A 4E1MA 3IAYA 1ZBFA 3V1QA 2FBTA 1LWFB 2IJNA 3GQCA 1WNEA 1S1VB 5KFYA 5KFQA 3QEIA 1S1UA 1S1WA 4ELTA 1WAFA 4B9VA 1YTAA 3B6PA 2HNDA 4Q0BB 1FXXA 3GV5B 1C0TB 3QO9B 4WFYA 3G6YA 3TI0A 3C6UA 4O0IA 1T8EA 3K5MA 3DLGB 5KRSA 3T3FA 1S49A 5JUMA 4TYAA 1GX6A 3NGDA 3PHEA 2FC0A 4RNFA 4NLVA 4YR0A 2XY7A 3LWLA 3MR5A 3KLHA 2O4GA 1Z25A 3LALA 5J2MA 4JRQA 4KHSA 5KFWA 3RAQA 2C2EA 3BGRA 3HVTB 3CFRA 4J9LA 3T5JA 1X1PA 3NGZA 3SNNA 4IG3B 3KLGA 1N48A 3VQ9A 3GIJA 5JS2A 1XC9A 1N6QA 3PY8A 1T94A 1NJYA 4NLGA 2BRKA 5DG8A 3SI6A 2XI2A 4O4GB 2Z1IA 4I2QA 4KKOA 4QWCA 5KTQA 4FJIA 4KB1A 4F4XA 4Y2AA 3CYMA 4KFBA 2YNGA 1S6PA 3MEGB 3NH0A 1RDBA 1XI1A 4O4GA 4C8OA 3DOLB 3ZSXA 4ZVFA 2BDPA 4IFVA 2GV9A 4CJPA 4CJ3A 3NFAA 4Y1DA 2W9CA 3JSMA 4TY9A 4CEOA 2HHSA 4KRFA 4IH6A 2HB5A 4OVLA 3IG1A 3VQ7A 2G8VA 3H59A 5J2PA 2W9AA 1O1WA 2YKNB 3KK1B 3SPYA 3V6DB 5KFBA 4CGFA 4YP3A 4RW8B 3RB0A 4WZMA 3DOKA 3UQSA 3QZ7A 5KFOA 1Y97A 2IJFA 3A2FA 5F8MA 1HMVA 4FW2A 3L2UA 4TLRA 1D0EA 3PUFA 3OL9A 2XHBA 3C94A 4KV8A 5HRSA 4EO6A 4IR1A 4I2QB 4KKOB 4DTMA 2RKIA 3TAFA 3QINA 3SPZA 4K4VA 4W5NA 3TAMB 5DLFA 1VSKA 4ZMMA 3AVFA 4IQXA 4KAIA 2Z1GA 1R0AB 4EBEA 2JEIA 3I0SA 4TQSA 1WLJA 4W5QA 5KT7A 3OYAA 3TVKA 2LSNA 1S9EA 3E01A 3DRPA 1S9FA 4ED1A 3BSAA 3G10A 3WNGA 1YT3A 1W9HA 4J2EA 2FJVA 4DG1A 5KFKA 2D0AA 4DFMA 4HYKA 1B92A 1S6QA 3OVNA 3M9OB 4FJ7A 4O3RA 2ZD1A 5FDLA 1S6PB 3BJYA 5HBMA 4WFXA 2RDJA 2YNIB 4F3TA 3N6MA 4Y3CA 4OJRA 3AVHA 5KT2A 3UR0A 2PYJA 1L3UA 1TL3A 2V9WA 3MTKA 3L2WA 3OJSA 4Y34A 2OPQA 2R2TA 3KLIA 3LP2B 3M8SA 4ED7A 1NOZA 3OS0A 4N5SA 1X9WA 4TSXA 4LSNA 5F8HA 1D9DA 4CJKA 1C0UB 3CO9A 4M94A 2HW3A 3HHKA 1BL3A 3KK2A 4ED8A 4ED0A 1J5OB 2C22A 3HP9A 2JC1A 1QUVA 2QKBA 4R0EA 4B3OB 1ZETA 3AVLA 1BGXT 5F9LA 1JLFB 4ZP7A 2IC3A 2R8IA 3V9UA 3OS1A 1KFDA 4K8ZA 4Q0BA 4J9OA 4ECRA 4DL7A 2E9RX 4NLPA 4DSKA 1NJXA 3C95A 3HL8A 4FK2A 2YHAA 3VA0A 3NF9A 3DI6B 2G8UA 4HCBA 3DLEA 4ICLA 4CEQA 4DL5A 3RBEA 4DL6A 2BANB 2J6SA 3UPFA 1S0NA 1RCHA 1WN7A 3DM2A 2D0CA 1TK8A 3VQEA 4B9MA 4H8KA 4FJ9A 1LV5A 2JLEA 4CJQA 1UA0A 5KFLA 3RAXA 4JUZA 5HP1A 4M45A 1SH2A 5I3UB 3KLGB 1K1QA 4E7HA 3KHHA 4PWDB 3K59A 3WNFA 2F8TA 1KLMA 1L3SA 3BGRB 4RW6A 3D45A 5KG7A 3KJVA 4EP5A 4FJKA 4DTNA 4ZP6A 3KHLA 3AVKA 5HP1B 3V81B 4BWMA 1KLMB 2I5JA 2OPSA 3PZPA 1IO2A 2AU0A 4Z4FA 4TQRA 1RTDA 3KLEB 4MKBA 4CJ5A 3KD5E 4NLOA 5KFFA 4TY8A 3D28A 5JXSA 4KFBB 4KB0A 1TL3B 2AWZA 1WSJA 3HKWA 1S1TB 2GBZA 3DLKB 1W25A 4Q8EA 4EP4A 3KMSA 1RTIA 1FK9B 4F4WA 5HBMB 4ZTJA 4O0JA 3RR7A 3RB4A 3FFIA 4NCGA 2FLPA 4EZ9A 2QKKA 5KI6A 1VSLA 3M8RA 4DU4A 3CDEA 2FLLA 1JLGA 3NL0A 2W8LA 2J6UA 2X6SA 2YKMB 2DFEA 3CFPA 1JKHA 4ECQA 4FK0A 3LPTA 3ZSVA 2EC0A 2WB4A 3VQSA 3RB3A 3OL6A 2DFFA 1VRUA 4FLWA 2VG6A 3SV3A 3HVWA 3AA5X 3T1AA 1CXQA 3NGIA 3KK2B 1RDRA 1RILA 2IDOA 3NMAA 4E7LA 3HVAA 3MR3A 2OPRA 2BE2B 4ID5A 2ZQBA 2RKIB 1ASVA 4KI6A 1QE1B 1EX4A 3CDUA 3LP2A 2HHTA 2XGQA 3QZ8A 5J1EA 3SQ1A 3DMJA 2WOMA 3HXMA 1NOYA 4F3OA 4JLHA 4DQIA 1S9GB 2RN2A 3LDSA 4ICLB 4RG8A 1SL0A 4ZTFA 5C42B 1S1TA 2CKWA 1SV5B 1EKEA 2OPRB 1NJWA 2E9ZA 4IG3A 3AVCA 2UVWA 4CGDA 3NF8A 3U6FA 3BR9A 5KFPA 1T03B 3QETA 3NAHA 3KIOA 3DYAB 2JEJA 1JIHA 5C24B 1S97A 4GC7A 2E9TA 2O5DA 3LP1B 4M95A 4E89A 1RTJB 3L2VA 4CGHA 3DLGA 3L3VA 4CGGA 2IM1A 5CYQB 1TVRB 2AX0A 3JYTB 4ZP9A 4DTOA 3ZCMA 1FKPB 3QEWA 1S48A 1LWEA 4W5TA 3GIMA 1GOBA 4M3RA 4IRDA 3OYEA 3DLKA 1XHZA 3V4IB 3BREA 4HVJA 2HMIA 4KHQA 4KB7A 2J6TA 3Q8SB 4PQUA 5DGBA 2BRLA 5KG6A 4J9QA 1S10A 1MU2A 2XCAA 4YR3A 4ZVGA 1LW2B 3ITHB 3MXJA 4CHNA 1VSIA 3QERA 2OPSB 1RT5B 1HQEB 4QW9A 4H4OB 3OYIA 1RT1B 3NAIA 3SFGA 4RNMA 3AV9A 1JLBB 1Q9XA 3ISNC 3MFIA 1REVA 5DQHA 4FJHA 2ATLA 2VA2A 1UWBA 1IKWA 3Q8RB 2RF2B 1EETA 1NK5A 4I9QA 3N6LA 2DPJA 3JSMB 4C8KA 4FLXA 1WSIA 2IM2A 3AVIA 3P5JA 4CERA 1LW2A 4LY7A 4FJGA 3M8QA 1IKXB 4E7IA 4OGCA 1FKOA 4TXSA 4IG0A 2F8SA 3OLBA 3O3FA 3EZ5A 1R0AA 2FVCA 4CHOA 4W5OA 1QS4A 3LZIA 1HYVA 5FRNA 1BCOA 2Q3SA 5KFAA 1WNSA 4MQ3A 3LWMA 4RNNA 1BI4B 1ZTTA 2PY5A 4B9NA 5L9XA 1S9GA 3VQDA 4WXOA 1RBTA 1VRTB 1JLEB 4QWAA 2XWYA 3VA3A 3H4BA 4BE0A 1U4BA 1SH0A 1RYRA 1KVCA 4W5RA 3KLHB 4F4KA 4NLDA 4K4UA 2D41A 3ZT2A 4F2RA 4PWDA 1BISA 3EYZA 3ZT1A 1T05B 5EWGA 3LP1A 4LH5A 3Q8PB 4DSEA 1T03A 3DRRA 2Y1JA 3DYAA 5C25A 1VSJA 3KD1E 4ECUA 5F8GA 1BQMB 4CJUA 3RRHA 3QO9A 3RR8A 3T5LA 3C6TA 3V6JA 1SV5A 3I5CA 3HK2A 2DPIA 3AVNA 3OYDA 2FBXA 2HMIB 4OKKA 4HHTA 2OA8A 4ELUA 1B9FA 3G0ZA 3CJ5A 4F8RA 2UVUA 3QIOA 5EUHA 3TR8A 1NK8A 4FJLA 3H08A 4BE1A 4ZVEA 1Q8IA 3C6TB 3PX6A 1BQNB 4EBDA 2YNIA 5KFXA 5J2QA 5KFZA 2QK9A 4K4SA 4F4YA 1X9SA 1D9FA 1TVRA 3OYFA 1QQCA 3RWUA 4RNHA 4J9SA 3AO4A 4ZHRB 5FROA 3OSPA 4K50A 3TQ1A 3ASMA 1ZBHA 5L1IA 1RBUA 3IS9B 4CJTA 2OZSA 3AVAA 2B4JA 5J2QB 1JLBA 1LW0A 1S1XB 3V1RA 4CIGA 4Z0UA 3NKYA 4I7FA 1JL1A 4K4TA 3NGYA 2XO7A 4DQPA 1TKZB 1NKEA 4KO0B 2VG7B 5DMRA 3F73A 2IAJA 4R8UA 1TQLA 5L1LA 4CFCA 1C0TA 3HSTB 3MXMA 4DLGA 3I5AA 3KKSA 4KHNA 2HNZA 3K57A 5F9NA 1NK9A 4AHTA 2P5OA 3F9KA 3OS2A 3G86A 3M9MB 3HPHA 4DTPA 3P1GA 4DFPA 2KFNA 5KG5A 5KGWA 1RT6A 4CGIA 4WE1A 4Y2CA 3KLEA 4ELVA 4KREA 2R8GA 4I2PA 5J2MB 4C8LA 3GYNA 1RTJA 1G15A 2ZKUA 1I6JA 3ZSYA 4M42A 1L3TA 1MMLA 4ZPBA 3DRSA 2Z1HA 1U47A 3RMCA 3QIPB 2D5RA 3AVMA 3CVKA 3O3GA 4ZHRA 4FJJA 4LSLA 3HPGA 4DWIA 3CWJA 1KSPA 1CLQA 3TAMA 4FYDA 3OYJA 2EX3A 4OKEA 2XRIA 1C1AA 4BWJA 3VQ4A 3MR2A 3N6NA 3KK3A 2OPQB 2Y1IA 3DOLA 4NCGB 3LPUA 1EP4B 3KLIB 3PR4A 2AQ4A 2BQRA 2R2UA 3PW7A 3AVGA 4CF0A 3OYCA 2GIRA 3OL7A 4DL3A 1KVBA 3IRXA 2X74A 4AILC 3QGHA 1HARA 4DL4A 1RA7A 4U6PA 4F4ZA 2W9BB 3HP6A 3SQ4A 4AHCA 1S6QB 5J2PB 4FLYA 3AA2A 1IKWB 2E6MA 1WSEA 2VWKA 5I42A 3PVXA 1SL1A 4CJWA 1NJZA 1XR5A 1CZ9A 4OLAA 3LP3A 3CJ2A 1VRUB 3ZSOA 5KT6A 1RT1A 1JKHB 2WCXA 4FS1A 3M8PB 4EEYA 1TP7A 3AO1A 3U3GA 3HJFA 2IA6A 4KV8B 1J9AA 1GOAA 5J2NB 4HUEA 4URSA 3DLEB 2Z1JA 4CF1A 3VQ6A 1S1VA 3PR5B 4QWDA 2F96A 4M3WA 3KNAA 2BANA 2C2RA 1ITGA 1S1UB 1S1WB 4DTJA 2QV6A 3H2LA 1QAJA 1QE1A 5F8IA 4KBIA 3LANA 1SUQA 2R2SA 1X9MA 3I0RA 4CCHA 2D3ZA 1C1CA 3BQ2A 2B6AA 3NDKA 4FM0A 4FJ8A 2HNYA 3LP0A 5KFSA 2BE2A 3V81A 2V4RA 5C25B 4Z4EA 4WFZA 2FVRA 5KFJA 4PY5A 3H40A 4CECA 4DFJA 1HNVA 4OL8A 1K1SA 3PW5A 3KMQA 3NF7A 5SWMA 3TAGA 4AHVA 3SI8A 3AO5A 4F2SA 4NYNA 3V9ZA 5KRTA 4YQWA 3SCXA 4HTUA 3CIZA 4O55A 4ED6A 2BQ3A 3DM2B 2GUIA 4NLTA 2WRMA 4IH5A 4Y1CA 4AHRA 1NK7A 4O3OA 4CHZA 3SUQA 4FJNA 3MFHA 4DTXA 4QWEA 2D0BA 4J2DA 3OY9A 4PUOA 3KHGA 5J1EB 3O4NA 3MEGA 5C5JA 4NRTA 4FLUA 1KLNA 2FVQA 1XR6A 2IAJB 5SZTA 3RMBA 5DK5A 4RW7B 1KVAA 3OYHA 3D5MA 1W0HA 4FCYA 4NLRA 2IC3B 5CYQA 2FVSA 1GOCA 4OPJA 4ECXA 1QSLA 2VG6B 2IMWP 3K5OA 1DTQB 4I7FB 3V1OA 2O4IA 4EYHB 3ZT3A 2B5JA 3HM9A 2HHWA 4N76A 1GX5A 2KFZA 2JEGA 4N41A 1LAWA 2E6LA 2UUWA 3GILA 5JS1A 1N4LA 2WONB 4IDKA 4X2BA 1BHLA 4M41A 3ITHA 2IM0A 4Z4GA 5KT3A 4FXDA 1RT6B 4NCBA 4FVMA 1JLEA 2AJQA 4CGJA 4URQU 2WTFA 2ASDA 4MFBA 4QOZB 4XPEA 4CJVA 1TAUA 3KK3B 3TWHA 3QNNA 2ZE2B 3OHBA 1C0MA 1JLCB 3S3OA 1QSSA 4B08A 4ZVHA 3MAQA 3RB6A 3FQKA 4WXWA 2XC9A 4DL2A 3NF6A 3MECA 1U49A 3PO5A 2I5JB 4RW9B 2XI3A 3QIPA 4FLZA 5DGAA 1BCMA 4RU9A 2I1RA 3KOAA 3SZ2A 3H5UA 4B9LA 4KHWA 3K5LA 3Q8QB 1KRPA 3MECB 3PX4A 2G8FA 3HO1A 1KTQA 1ZBLA 4ZPAA 2BQUA 4RZRA 2XY6A 3FRZA 1S0OA 4KE5A 2HAIA 4IKAA 4EBCA 4IFVB 3G6VA 3FDSA 4DU1A 2R8JA 4AHUA 3H5SA 3THVA 4G1QA 3NHGA 2AGPA 3TARA 3NCIA 4L8RB 3LAMA 2JC0A 1VSHA 2D3UA 3S3NA 2V0NA 3GV7B 5KFTA 3DLHA 3OLAA 4UQGA 1EP4A 4XIUA 4K4WA 3OL8A 4DTRA 4E7JA 5D3GA 4Z4HA 1U09A 4RW8A 4KO0A 3CJ4A 4IFYA 3EPIA 3GV8B 4N47A 4YNQA 4O44A 2FJXA 5KFCA 2DTUA 2A1SA 4FZZA 1TL1B 3PW4A 1KCFA 3OYNA 5EDWA 4B3OA 4IH7A 3DRPB 1WSHA 1TKXA 1HQUB 1J5OA 1HNVB 4QAGA 3VQPA 5KT4A 4BDYA 3RTVA 1JXEA 3FFIB 1SUQB 4OPKA 4MKAA 4CEEA 1L3VA 1ZBUA 1RBSA 3OSNA 3SUPA 2FBYA 4JV0A 1BI4A 2R7YA 4IKFA 2HNDB 3QNOA 1SL2A 4R8UB 1RT4A 1OS5A 2YV0X 5KG2A 3QIDA 2YNHB 4O3SA 1HRHA 1VSDA 1CXUA 5CZ2A 2ITGA 4DG1B 4CE9A 1VK0A 3DRRB 4LQ9A 5KFNA 2WONA 4R5PB 4ECZA 4I9LA 4FLVA 3ZSRA 1BQMA 4Z4IA 1KHVA 2W42A 1KFSA 3VQAA 3M9NB 3KJVB 4WZQA 3CM5A 1U04A 4DFKA 2G8HA 1DTQA 4R5PA 5C24A 2R8KA 3ZT0A 2HWIA 1YVUA 4DMNA 3IRXB 1RT7A 4FZYA 4K4XA 1UAXA 4E19A 3S3MA 4GVMA 3O3HA 2DY4A 5HROB 1JX4A 3KLFA 1MU2B 1XHXA 4J9MA 1NKBA 4RW4A 2GC8A 3DI6A 4XPCA 1I3AA 5CY4A 1D5AA 1QSYA 2HHQA 1ZTWA 4QCLA 4H4MB 4MH8A 4IBNA 3H5YA 3EPGA 1WSFA 4Q43A 1IKXA 2F8EX 3FSIA 3UDLA 2CJQA 2IM3A 4BACA 2WK4A 3ZT4A 1JLQB 3V9SA 5E41A 4ED3A 1LW0B 1S1XA 4FM2A 3BQ1A 4M3YA 4ECSA 4CF9A 3M8QB 2OPPA 5F8JA 3U3YA 4ID1A 5DG7A 1TL1A 2R2RA 1EETB 3HT3A 1QHTA 2B5JB 3P83D 2D7SA 4YMEA 4E0DA 1A5WA 2W9CB 3L8BA 1RAJA 4BDZA 3CQ8A 1RDDA 2KQ2A 1C1CB 3ZSZA 3CJ0A 2ZE2A 4B8AB 4CIEA 5HLFB 4OGEA 4Q45A 3DLBA 2VG5A 3V6KA 3OYMA 4XO0A 4M3TA 4CIFA 1SKWA 2PZSA 4J9NA 3MR6A 5HRNA 4HCCA 2DFHA
chains in the Genus database with same CATH superfamily
3Q22A 5IM0B 4E8UA 3CJ8A 1WC5A 3SQ0A 1NK6A 4RW4B 5K14B 1HBOB 3CJKB 2YJEA 2A1RA 3LTOA 2JFDA 1EZZB 2F8HA 4MK7A 3G4SN 4NWBA 2OI2A 4EK2A 3J81O 2KJWA 2XBPA 4AM6A 2QXFA 3SQGB 4Q8FA 4EMDA 3QBXA 3QGPA 5I42B 4CHYA 1N36J 1C4CA 4XAKA 4ZS6A 1SKSA 4Q5VA 2WVDA 4CO0A 2GQQA 3RBDA 2HURA 4HHJA 3MXIA 1RT3A 5EX0A 1C1BB 3O4QA 3WXMB 1RBLA 5IWAJ 3LP0B 5BPNA 4JYAK 4DR3F 1L3KA 2VV5A 4GKKK 1IG9A 1W2BR 4X65F 2D9PA 2XQCA 2IBKA 4CFDA 3V4IA 3HHNB 4IUFA 2NLXA 4O5BA 2X78A 4B3MJ 2J9EA 5AFUH 1YITN 4DUZF 3C3LA 4AYBD 3MDFA 4DSLA 2DK2A 2RHSB 4YB1P 3B6OA 2E44A 2CNLB 4F9OA 1QQNA 1FRXA 2N4CA 4X4RA 3THXA 4NXNK 4MK8A 4X66F 3TJ8A 4ZN1A 1PYSB 2XYPB 5AQOA 3CC4S 1LXNA 4ZN3A 2ZDPA 4M3UA 3QRPA 1YWXA 1YBUA 4I6WA 3BV8A 4K2XA 4CO1A 5F1XA 1IXKA 1RT2A 1MROA 1V5VA 3KJQB 4N56A 1NMNA 4NLUA 5DQIA 2YCHA 3MDQA 2YNHA 1T02A 1BG3A 4DS5A 4LF9J 1XNQK 1DLOB 3QLHA 5E3PA 3MXHP 5KFHA 4YFUA 3KK7A 4FO0A 2FJWA 1FKOB 5A8KB 3VTHA 1RT2B 1MROB 4WFNQ 3NH2A 1TKDA 3W8PA 1FXRA 3VN5A 1JXVA 1RBVA 3Q0AA 1D8YA 1CPZA 1RT7B 1AFJA 3TVZA 4G3IA 1IKYB 4ISFA 4B1ZA 3VQCA 1VGYA 3KZBA 2PT0A 1ZM4A 1VBZA 2IRXA 5AQWA 4URGA 4ZVTB 1KP6A 4DSIA 3CCVS 5AJ3J 3RMDA 5IV3A 1C6VA 4LF7K 1U0HB 3VALA 3RUBL 5C2CA 1QAXA 2YWEA 4HACB 2E5LJ 3QAUA 3CCLN 3THYB 1N36K 4B02A 1T3NA 2ZOFA 3HD1A 2KJVA 1TK5A 5A76A 1TV6B 4HUFA 3P45B 4FKXA 2OJ3A 1T7PA 3DU5A 4A5AA 3KJFB 2D69A 1Z26A 1MW7A 2HHXA 5M1KA 2E1CA 3J8AA 4CIOA 5GAHI 4R0JA 3JTPA 1CZAN 4L72B 3LDNA 2FVPA 3JAMO 3WNHA 2G9OA 3IG1B 4U7CA 2KO1A 4BRPA 3FEYB 5EX5A 4Z94A 2XS5A 3K7RA 3AO2A 2XNQA 3BSCA 1U48A 1J54A 3CPWR 1CEZA 3C15B 3CFOA 1WF0A 1QZ5A 2B6AB 2CQ4A 3FEZA 2AX1A 4A8SA 1IBMK 4DR7F 3MCMA 2DNHA 1VSFA 1V3SA 3CO0P 4E3SA 2XY8A 4MFBB 4ES2A 2O8CB 3PJXA 2DH8A 3N5BA 4ZP8A 4MK9A 1PYOB 1FTRA 5IOLA 4DSFA 4IR9A 4ID5B 2XY5A 4QIWD 3CGIA 2AGOA 4XH5A 4JV2A 4LF5J 4L3KA 2HHUA 3E51A 4BRHA 1YVFA 3MX2A 5IC4B 5E2QA 5DJBA 2R7VA 1JXLA 1OPZA 5CZ1A 1ZBSA 4CFAA 1HWLA 1XMOK 1Q0NA 4IOBA 1K8KB 4CLSA 4KTWA 1VIOA 4RNOA 1S79A 3I0RB 3MURP 3RRGA 4CO3A 1S6OA 3CCMN 5HRRA 3U1NA 2A18A 4KTQA 5E26A 3FBBA 2ASJA 2CVIA 4CP5A 2RRBA 1X4BA 2B9YA 4KQZA 1YVNA 3T41A 4AXIA 4KT0C 3B6BA 2D74B 1VQ7N 4IDHA 3LA0A 2DBBA 1LNQA 3KLVA 2NRXA 3S01A 1IBLK 4L75A 3K9JA 2HF3A 1FE4A 1HW8A 3VQ8A 4CT8A 1NHUA 4FDFA 1JLFA 3BF4A 3VZIA 2O8BB 1SKUB 4PXBA 4RW6B 3QRRA 4JEPA 3WXJA 1VK8A 3MUMP 1REGX 3VZHA 1TKXB 2ADCA 3ADAC 2QLBB 3P96A 2OPPB 4GV9A 3BH6B 2PA3A 1NKCA 1H98A 5K8MA 3RAMA 1NLKL 1ZH5A 3OBIA 4ZPVR 3QWPA 1RT5A 3EXCX 4ZPTR 4CJ7A 5B09A 4GW6A 4FM1A 4RBVA 4J2AA 2B9EA 1CLFA 4I67A 3CUNA 1KKHA 2DB1A 2PSZA 1EIYB 4HUGA 2GX8A 3IAS9 3VQQA 3G4SS 1HMVB 1NLVA 1YUWA 3FK4A 1VJWA 1QM9A 3QLHB 2CQBA 5HLFA 2KLAA 2OYQA 4KJIA 3KKRA 1RT3B 4NYZA 4Y2IA 4GC6A 3NE6A 2CNOB 4JV1A 2V67A 4DX7A 2VGNA 3TAQA 3A5LC 3MMAB 1TKTA 1S9EB 4LR7A 3G6ES 2UXCF 2PYLA 2YNFB 3GIIA 3IMXA 2YHWA 2OH2A 3HF5A 5K8PA 1FJGJ 3FCWA 1VJQA 4B3SF 2CJ9A 3AXKA 4ZPDA 2DGTA 2RT3A 1KQSR 1FRLA 2E1AA 1U25A 2MLZA 5BJRA 5KFUA 1YJ7A 2C2KB 3Q83A 4QPXA 4CEFA 1UVKA 1J2VA 4C97A 1YHQN 4GKJF 3PHTA 2P9GA 1E3MA 2DHGA 2E2OA 1IUJA 1Q81O 3CSKA 3N4PA 2ZD1B 3O9RA 1Z4UA 4JKFA 1R8AA 1O5JA 1VSMA 3NH1A 2ASLA 1M1KO 2Y8WA 3LUYA 4FJXA 3D2EB 4CF8A 2QI2A 1PBUA 1BIUA 3CJ7A 4M3ZA 2FB0A 3PW2A 1UEUA 3TANA 3SMZA 3BGFA 1VSEA 4KHRA 1Q53A 1H1VA 4AH9A 1IBMJ 2PIIA 3BSOA 4XTTA 5C42A 1VQPN 1ZC6A 3PSIA 3OR1A 5H9FK 1KOHA 2DNOA 2PC6A 3DGVA 4P71A 1IBKJ 4ELTA 4B9VA 3D67A 4XEIA 4GV6A 4Q0BB 1FXXA 4ZVSB 1O8BA 1GLAG 1C0TB 4WFYA 3G6YA 5IZHA 1T8EA 4PG7A 4MYUA 2B4UA 5JUMA 1GX6A 2I8EA 3KG1A 2ABYA 4YR0A 3FGVA 3MZIA 4LJMA 5J2MA 4KHSA 2K06A 4TU9A 3TSUA 2B8QA 4J9LA 4JI4F 5HMYA 2P6SA 1IM6A 4EUVA 2R3VA 2CRLA 1HBUB 3MM8A 5JS2A 1XC9A 1T94A 1VYAA 3U27A 3SBGA 2YXLA 2XI2A 2PE8A 5I3PA 3SI6A 3P8BB 4KKOA 5A8RB 1T9UA 4KFBA 4X66J 2P6TA 1YK9A 4O4GA 3DN9A 1OPIA 4OZNA 2UXBJ 4IFEA 2NRTA 2K7KA 2GV9A 2BJ9A 4CJ3A 2XMMA 5AE1A 4Y1DA 2W9CA 3JSMA 2H5EA 2BVZA 2D0OA 4P10A 4KH6A 3FZFA 2OSRA 4YDXA 5D78A 1NBWA 2KM8B 3VQ7A 1Z05A 1VHXA 2FC8A 3KK1B 2KL8A 3V6DB 2O8BA 3VEWA 2XZWA 2WBRA 4CGFA 3GR1A 4YP3A 4W98A 2GO9A 4RW8B 3RB0A 3VF0B 3WC0A 3UQSA 2YPZA 2HF4A 1DFDA 3A2FA 4DV2F 3GSDA 1HFEL 4FW2A 3R7SB 2QWPA 1VK3A 4OX8A 7AT1B 1HX1A 2UU9K 2HHHJ 4JYAF 3KDNA 1WC1A 2XHBA 2QFJA 4ZJOA 3E3XA 3PNIA 1IBLF 4L76A 3QINA 3SPZA 3TAMB 5HK4A 3SAGA 5LMUJ 2ZHBA 3ZEUB 4ZMMA 3AOCA 5D4NA 2Z1GA 4EBEA 1WOPA 2X3DA 1K8KA 2W24A 1F9HA 3S8SA 3O6WA 3DHWC 2GA7A 2LSNA 4CI0B 1X0FA 3ZX2A 4GO5X 4OZ2A 4AQYF 3E1YA 1MN7A 2ZEJA 2PN6A 3MMAA 1YT3A 1W9HA 2QGFB 4GKKJ 3VERA 2D0PA 4DFMA 2V2QA 3CCRN 1WTBA 1S6QA 4CZFA 3OVNA 5CH7B 2AMCB 3BJYA 3J7ZT 4USKA 2V51B 2MKJA 1IQZA 3SBMA 4Y3CA 2HFZA 3AVHA 4IO8A 3UR0A 2PYJA 1K8AO 2O8CA 1XNQF 1VFJA 1VLYA 4KGVB 3OJSA 2V9KA 4USMA 4Y34A 3R7BB 3UKUB 3LP2B 1SJRA 3M8SA 1NOZA 4TSXA 2E2NA 2ZJQL 2MKKA 1C0UB 2UU9J 4M94A 3ULEB 1JJ4A 3MM9A 5LOQA 1VQOS 4ED8A 1J5OB 4R0EA 2UXCJ 4FF3A 3QT5A 1ZETA 5G0RB 4RCHA 2OUGA 1BGXT 3PSFA 4Y0FA 5RUBA 2IC3A 3JQKA 3PCOB 3M8WA 2R8IA 3OS1A 1KFDA 5D0GA 3KJNB 2LQ8A 3ZZUA 2F9DA 4WP8A 4DL7A 2E5IA 2GWJA 4KH1B 1KWMA 2HRYA 2A42A 3P38A 1E6YA 3R27A 2BH1A 4XK8C 3M6UA 1ZM3A 2UUAJ 1QVGM 3NF9A 3DI6B 4UQTA 1CS4A 4HCBA 4B9QA 3HMJG 4ICLA 2MZJA 4DL5A 4DL6A 4Q2MA 2A3JA 4HTJA 1S0NA 1R43A 4ANEA 1KD1O 3VQEA 3FBEA 1UMJA 4B9MA 4LFBK 4CJQA 1RDWX 3AD8C 3FNNA 5I3UB 3KLGB 1U0HA 1K1QA 4E7HA 2EWHA 3WQTA 1KVKA 1V3ZA 2E1RA 4QR2A 2F8TA 1MWZA 4J90A 3BGRB 5K8OA 2CPYA 4X4NA 5AXLA 3KJVA 4FJKA 4ZP6A 2KXNB 2A0FB 1N33K 4JKDA 2NS1B 3KWMA 3EXYA 4FWNA 1SPBP 3CC7N 1DQ9A 1NJIT 1RTDA 4MKBA 4CJ5A 3KD5E 5GMKa 4JI2K 2OEMA 5JXSA 1WSJA 2YQ1A 4DCPB 5BXIA 2QWQA 1GK8A 4QPTA 1W25A 2DY1A 1PGZA 1Q5VA 2OD4A 4EP4A 3KMSA 3T1HK 2FGOA 3CEDA 3MM8B 4B3TF 3J7YU 4O0JA 4NA2A 1JWWA 5GADP 2AW0A 1VSLA 3M8RA 3CDEA 2B4VA 1ZM9A 4ZA1A 2C3MA 3EDQB 3JS9A 1QAYA 3LPTA 3N5FA 3ZSVA 2LYVA 1U1LA 2EC0A 1HI0P 3VQSA 2AHOB 1ZOTA 3OL6A 1YIJN 1VRUA 3WXLA 3FSYA 4FLWA 2VDHA 3HVWA 1X4CA 3ZETB 4LF5F 3T1AA 3LGMA 1CXQA 3CMQA 2RQCA 1RILA 2VUGA 3HVAA 3BF3A 2OPRA 3GJSB 2BE2B 1VQNS 1PIEA 4KI6A 4H5NA 2LQJA 4CLZA 4H03B 3HXMA 1KVIA 4JLHA 2XZDB 4DQIA 1S9GB 3R3LA 3S7RA 1SL0A 1S1TA 1FFGB 3SJHA 2FJAB 1EKEA 2OPRB 2E9ZA 4PG4A 1UFLA 3NF8A 1M5OC 3QSYB 4HACA 2HSTA 1G99A 2MEWA 1T03B 3EUNA 4CO4A 3LOUA 3NY0A 1FE0A 3D0HE 3MI7X 1R89A 2DRDA 1JIHA 5C24B 4IOCQ 3CQXA 1S97A 1VQMN 2ZJPL 4GC7A 2E9TA 4M95A 4FF4A 4E89A 3ZFVA 4CGHA 2DHSA 1FJEB 4BR9A 4X4OA 1YJNS 4BC7A 2AX0A 4K7QA 2ZJPQ 3MPYA 1NGHA 5HVHA 4DV4F 5AZIB 1FKPB 2R7TA 1LWEA 1GOBA 3FGUA 2M2BA 3PLAA 3OYEA 3DLKA 5B8HA 3V4IB 2X1BA 4O5FA 4WPAA 4PQUA 3Q8SB 1DRZA 4J7CA 2BZ2A 1MU2A 3VEOA 3GE1A 3UR3C 1FDNA 3MXJA 2I9SA 1FA0A 1HQEB 4C1NI 4LFAJ 1ESVA 4MO4A 3P31A 3TZZA 1RGIA 1WDTA 1RWUA 1REVA 4FJHA 2ATLA 1UWBA 3PYGA 1IKWA 2RF2B 2UXDF 3ZZOA 2OGUA 1QDUB 4X64J 5HL7L 4FLXA 3AVIA 1HBNA 1WOOA 4UOFA 4CERA 4FJGA 1VQ6S 3M8QA 4B1WB 2ZWHA 1IKXB 4ETXA 5HI7A 2UUAF 1WUUA 2OKQA 4IG0A 2ZNYA 3O6QA 3UE5A 4USIA 4A2AA 1NAQA 4H0TB 3AOAA 1Q18A 5CCMA 5KFAA 3UNGC 1WNSA 2QA4G 4DV0J 3NMRA 2W25A 1ZM2A 3EZWA 1M90T 5CQGA 2PY5A 3UN3A 4I64A 2W41A 4BR4A 3DGPA 1RBTA 1JLEB 2QEXS 2RRNA 4LF6K 4DV3J 2VFVA 4BE0A 1U4BA 1LQ9A 1FHTA 5AQMA 2IVMA 2HKEA 2EG1A 3KLHB 4NLDA 2D41A 3EYZA 2XSJB 3Q8PB 3TX8A 4HH0A 2LEBA 4EHUA 1W2BM 2EW9A 5C25A 1VSJA 3MOZA 5F8GA 1RTZA 5F0WA 4CJUA 3TJAA 3C6TA 3X1LB 2L3MA 5HQMA 3I5CA 1O13A 3JAMU 1Y4ZB 4ELUA 4IEEA 3ENAA 2G13A 2FF6A 1B9FA 2VJVA 3G0ZA 4B3SK 3AAQA 2UVUA 4DMZA 5M2PA 3TR8A 4CRJA 1Q8IA 3C6TB 3PX6A 4AT1B 1N5SA 4UOGA 3MWPA 2HBZB 2QK9A 1WUAA 3OYFA 3HZ6A 3SMPA 4X4SA 4ZHRB 1ZZNA 3MMJA 4F7VA 1X5SA 2CQ3A 1ZBHA 3ASMA 1S3XA 4M5KA 5L1IA 5LL6d 1DURA 3CMEN 4CJTA 1NZAA 2A2CA 1JLBA 2DR9A 2VPXB 4DR5F 2MGZB 1I94J 1JL1A 3NGYA 4I6MA 4CZLA 4DQPA 2RE1A 1TKZB 1NKEA 3OQ2A 5IXUA 5DMRA 5AE2A 4ES1A 5JVGL 2G0JA 2FJDB 4R8UA 1SVDA 3NGSA 4DPUA 3U1MA 1TELA 4DLGA 3CE8A 2OEJA 3K57A 5F9NA 1NK9A 2RDDA 1RB0A 2ZITA 3F9KA 3AY0A 2XYGB 4DTPA 3P1GA 4DFPA 1Q82T 5LMUF 5BYQA 2CQDA 3CJQA 5KG5A 5KGWA 2X1GA 1BC6A 4YDDB 3L4IA 1SC4B 1KS2A 4NYPA 4YY3J 5J2MB 4JI5F 4C8LA 3P3DA 1HR0F 3CJ9A 1G15A 2W2MP 3CXCR 2HHHF 3AJDA 2VGMA 4DR1K 3UVJA 3QIPB 2D5RA 4DUYK 4P74A 1T95A 4DR3K 3UDEA 2LKZA 3HPGA 4DWIA 4X62K 3TNVA 3A5MC 1IVZA 5DETA 5IV4A 4OKEA 5EY4A 5IQQA 2FIUA 3M1VA 3N6NA 3KK3A 3U7JA 2Y1IA 3TX0A 2VODA 2HBJA 4NCGB 2EEYA 4DKWA 3UKRA 2CAJA 2AQ4A 1NDCA 3VENA 4BRMA 3K9KA 3MHYA 3V2UC 3OYCA 2GIRA 2QC3A 4MIWA 3PIOQ 1SS6A 1XTZA 1T9XA 5HANA 2WAQD 2X74A 5DM6Q 3D1QA 1RA7A 1KD1T 3HSZA 5D4PA 5EXWA 1RWOB 4FLYA 2R7WA 2YQ0A 2E6MA 5I42A 3JQMA 4H0XB 4M7XA 4CO5A 1CZ9A 1DJ0A 3CCMS 2B7BB 3JSBA 2NZTA 4WFNL 3CJ2A 4IEIA 3ZSOA 2V7ZA 5MLCV 2CVEA 1N52B 4OYZA 5KAKA 4CWBA 4IYQA 5FPEA 3JAMY 1S57A 4EEYA 3D2FA 1FCAA 1TZ0A 3AO1A 4PL7A 1VBKA 2IA6A 3VQTA 2C42A 4KV8B 1J9AA 2KU7A 2VPWB 4RL1A 4HUEA 4URSA 3DLEB 1RAHB 2Z1JA 5ETMA 2F96A 2BANA 1GXUA 2ZJRQ 2C2RA 4UUWA 3G82B 5ETVA 1ITGA 3LDLA 2QV6A 5GAGP 2OFGX 3LANA 2NXEA 1X9MA 1BUXA 1BHNA 2ZM6J 1KTVA 4CCHA 3NDKA 3CD0A 4FJ8A 3LP0A 2V4RA 5KFSA 3G25A 3V81A 4JK7A 3M2RB 1RI7A 1FRKA 5KFJA 2MGZA 2UUCJ 3H20A 2O66A 4G65A 2CZ4A 1K1SA 3PW5A 3KMQA 4M63C 2V8VA 5HQ8A 3OR2B 2XMWA 2B8PA 2P9CA 3HFVA 2BQ3A 4DV5J 3H25A 1RAOA 5IFMA 1KDNA 2R42A 1VC0A 1B0VA 2OP5A 2F9JA 2AP1A 4HTIA 1U2FA 4PUOA 4DR3J 3NNAA 5C5JA 3CCTA 4BC3A 4HEA9 2CDRB 4RW7B 4PWUA 4NLRA 2VQFF 3M3ZA 2NPFA 1GOCA 2VG6B 2F4FA 2IMWP 5AFUA 4CZJA 4LRBA 2O4IA 4EYHB 5T41A 2B4OA 3WQPA 5AQUA 5D4LA 1RUSA 1N32F 3O1BA 3E66A 2E6LA 1FWKA 3CJAA 3GILA 5JS1A 3R5JB 4DV6F 4M41A 2IM0A 4Z4GA 3MD3A 3NGTA 5JVHL 1YRTA 1JLEA 1FKAF 1HBOA 5ADXH 2YPYA 2IPOB 4MFBA 1WC3A 4FYVB 1WWHA 4LRDA 4XPEA 4CJVA 3KK3B 4M5NA 3TWHA 3QNNA 2ZE2B 2MKIA 4WFBL 4V1Ak 1JLCB 2AYEA 1Q8BA 3N0VA 2JL9A 5CABA 2H54B 3FSXA 3RB6A 3FQKA 4WXWA 3VVUA 1GLLO 2K3KA 3PO5A 2I5JB 4RW9B 2XI3A 4ZITA 5DGAA 1IWGA 1SB6A 2XHWA 3B54A 1UZHA 3UB5A 3KOAA 1FVQA 3MM6B 3H5UA 3SZ2A 4B9LA 1R6VA 4B1VA 2FJEB 2AD9A 3MECB 1N34K 2G8FA 1CBKA 3NVKA 4B3SJ 2E5HA 4ZPAA 2BQUA 3VWSA 4PKHA 3S6EA 2XY6A 2V6AA 2DR6A 3CC4N 3NCRA 3ISZA 2HAIA 1R7IA 3MN7A 3DCAA 1FJCA 3THVA 1LXJA 3BKTA 4ILJA 4OQJA 4QYRA 3TOQA 3PYDA 1HKAA 3GV7B 5KFTA 5HJYA 3OLAA 4UQGA 1EP4A 1NPPA 4CLUA 2XYHB 1MMDA 2W6LA 1VQ8S 1U7LA 3MN5A 5EVZA 4YNQA 3CHWA 2DTUA 1HD0A 4JI1F 3GE9A 1JCFA 4BRGA 3RYLA 1VR6A 1TKXA 1HQUB 4HLBA 3AAWB 2WUSA 2LA4A 3BB5A 3VQPA 2A1BA 3RTVA 2DNYA 1JXEA 1YGYA 1RBSA 1ZBUA 1ITPA 3OSNA 1F6TA 3G9CA 1BI4A 2LXFA 2R7YA 3NS7B 4O23A 1NMDA 2HNDB 5M2UA 3TEGA 3CJRA 4DR4F 1OYDA 4OYAA 3D68A 4X64K 4CLTA 2FSJA 2YV0X 5KG2A 2NREA 3QIDA 4Q2LA 2P9IB 2BJ3A 1T0TV 1CXUA 5CZ2A 2ITGA 1XQIA 4KH5A 1WKLA 3KWIA 3ZC4A 4A8FA 3VQAA 4LBPA 3SDEA 2K8GA 4CLKA 2UV8A 3KJVB 1OQ6A 3VAJA 4OX9J 1U04A 1JJ2M 2YHXA 2G8HA 1DTQA 4R5PA 5C24A 2R8KA 2K1RB 3ZT0A 4QZVB 2DVIA 4JP8A 4Y65A 5KPTA 4PAAA 4E19A 3S3MA 5HROB 2ROGA 4UT4A 4J9MA 1K9MT 1T9YA 1NKBA 5GINA 2GC8A 3LDPA 4NMLA 2FHOB 4GO7X 1I3AA 3CJBA 1K8AT 1QSYA 1SJFA 1ZTWA 1F0XA 3VPZA 2ZVSA 2XNRA 4DHVA 4MH8A 4IBNA 3HT0A 3Q24A 2JX2A 1Q82O 3FSIA 2IM3A 4ED3A 2OMLA 3AXMA 4CD3A 3QNWB 1TL1A 1EETB 2B5JB 5G0RA 3P83D 3D2EA 2W4DA 3MM5B 4E0DA 2W9CB 3C7NA 1B3TA 2Q36A 3O9QA 1RAJA 1AUDA 1WJ9A 1C1CB 2QWMA 4CLWA 3PFEA 4Y28C 3L4QA 3DLBA 3V6KA 4XO0A 4FYYB 1TYQA 1NB2A 2N7CA 4C0HA 2XZTB 4HCCA 4CF2A 1X31C 2UXCK 5B7WA 1QZ6A 3QEPA 3C8YA 3R8YA 3FCHA 2ZJQQ 2CNKB 3IFEA 4L73A 1BMQB 4K59A 3SIPB 1FEHA 2IS3A 1CJKB 4DEZA 2GS8A 1UP1A 3CF5L 1TMJA 3IDHA 4ISEA 4GMJB 2O8DB 3EVMA 1G4CA 1TUGB 2Q0RA 5GIPA 5M1FA 3IM8A 4CZKA 4IJNA 2R7SA 4F3MA 3CCJS 2ZF5O 1XWLA 3N28A 4PG8A 1SC3B 5AJ3F 1I51B 1HA1A 1NZ8A 3GOIA 4QW8A 4RW7A 1NDLA 2ERRA 3H98A 1FK9A 4NRUA 3MM7A 3BEGB 1BWVA 4NE9C 3ATUA 2HS0A 2RQMA 2VFUA 3MEDA 3SSQA 4JKEA 2GJIA 4RLEA 2E5GA 4DS4A 1EKRA 3SUOA 1YDLA 2C2DA 3KHYA 1WHVA 1NDKA 3OJUA 2PO4A 1B0PA 3JSRA 1FTCA 2B51A 4IDKB 1XC3A 3AB2B 2WHOA 4WYWA 4LFBJ 1R27B 2NLWA 2XCPA 2HWTA 2JGUA 3IS9A 1DQAA 2FZCB 2LP4A 3SUNA 3J7AN 3A13A 1JNRB 3OD2A 1SQGA 1C0UA 4ZLJA 3R1HA 5DLGA 5KFDA 3QEXA 4JS4A 2VA3A 5EWFA 3DU6A 4DF8A 2H5IB 4WP9A 1HPZA 5AQSA 4F25A 3SV4A 5K14A 4P75A 3FJ2A 3WNEA 3HCXA 2DIVA 2QWNA 1X4AA 2KW4A 4KHMA 3EKSA 3KWGA 3I8DA 4M8LA 4Q44A 5BRDA 4FP9A 2BYCA 4NXMJ 3M30A 1JL2A 3QESA 2MHNA 4L3NA 2KZZA 4KR0B 4X65J 4CYUA 3IGVA 4LQ3A 3HHLA 3Q8YA 2W6KA 2QA4S 1REVB 1ULRA 1QAIA 4U7BA 2E1MC 2GHVC 4KI4A 1CC8A 2YH1A 4ISGA 4BRIA 3I33A 4FWQA 1RTHA 3AJ2A 3CG7A 4NA1A 2YKMA 6AT1B 5CYMA 2KZMA 3EICA 4DV1J 2PFDA 3MEDB 4USTA 3LZJA 4CLPA 4J2BA 4PUOB 4AF1A 2CJBA 5KFRA 4YY3K 3A8EA 3MMBA 1YZ7A 3DDKA 4A8YA 5HMWA 4N77A 2LECA 2E4LA 2OTLS 2O8FB 3EY1A 1Y0HA 3N01A 4DV2J 4LSLB 2UVRA 4ZVQB 3A1YG 6FD1A 1HWUA 2NUHA 2CQHA 1C1BA 3GIKA 5EN1A 2HEKA 2FSKA 2MYFA 2GVZB 3MEEB 3KFWX 2MSTA 4FNIA 1Q9YA 5AQXA 3IUCA 2GHWA 1NGDA 4DTUA 4EO8A 4KAZA 4O44B 5F8LA 4I6YA 4IOXA 4CJ4A 3C2PA 2O8EB 1U1OA 2E88A 2G8IA 3MMCB 3OYGA 3BZQA 3CDWA 2FLNA 1U45A 9RUBA 5GMDA 4UY8O 1UJ6A 2CWXA 1S4FA 1U6BA 2E29A 1BUPA 1FKPA 2UUTA 2WW8A 4M5DB 1U24A 4NA3A 2FDNA 1UVLA 3CMES 3T1YK 1B7FA 4B8CA 2RB7A 1HR0J 3JSYA 4CK2A 3CJ3A 2CPZA 3O9SA 3THWB 3ULDA 3OBYA 5AQJA 3V9XA 5EWEA 3TEHB 4M7YA 2XEXA 3TPQA 1WD6A 3PV8A 2KTQA 3RVCA 3J80O 3C19A 4BVOA 5JLHA 5HRPA 1FX4A 5ETLA 5AQHA 3RMAA 2ZH6A 3OYKA 1HNIB 1HKGA 2P1JA 4LBHA 4CJLA 2VBXA 1WHYA 2RU9A 2KI2A 4BDPA 4H54A 3NNCA 5AQTA 2FBVA 4LR8A 2MZ1A 3CM6A 5KT5A 2VOOA 2B4PA 3AGKA 2Y1RI 1E4FT 1XERA 2DXFA 3TAPA 1TAQA 2CQIA 3KK1A 4DU8A 2H4YB 2W1BA 3RBXA 3F44A 3A8YA 3HVRA 1OMSA 3MCOA 4PYDA 5D0EA 4UTGA 2VKZG 4IQMA 1YF5L 2P5VA 4NEZA 2HVIA 1C2PA 3DRXA 1T6CA 4K4YA 3VGMA 3CW2C 1HYZA 2J0QD 3ENWA 4C3LA 1YJNN 1FEEA 4WIQA 4A57A 1DLOA 3H4DA 2I7PA 1B9DA 2WOMB 2HQ3A 1LWFA 2EWSA 4FK4A 5C15A 1PJ7A 3IR6B 3WEEB 4IG0B 1ELOA 4O8UA 3PFOA 2E1ZA 3EEQA 4JAXA 3I55S 3ENQA 4CO2A 3SDEB 3E01B 4JI2F 2W2PP 5I4MA 3IP0A 1TFWA 1Y3JA 2V2ZA 1RBRA 4JI3K 4LFAF 1XR7A 2O1PA 1FXDA 1N5VA 3T1HF 4CEDA 4EFAC 3IGNA 4LF8K 3OT9A 4PQAA 4I2PB 3D7SB 2CG4A 4I4BA 5D3GB 2DRBA 4MT1A 1EJ7L 3VAHA 3L2RA 2V2VA 2HHVA 1UEKA 3E9LA 1DGKN 1RTIB 5LJ3Y 2ETJA 3DLRA 1S6UA 1R0CB 3G82A 3VQBA 4E7KA 5FLXO 1UOCA 1IKVA 4CHPA 4JI3J 2HVHA 2Z57B 4H5RA 1EARA 1WSGA 3OTCA 2LA6A 1K6YA 5FDLB 4IXCA 3CC2N 2HG4A 1NSKL 2HQDA 3K2PA 4WU2A 1GLBG 2JWKA 5KPRA 2BJ7A 5DZ6A 2OTLN 3BH7B 1V4SA 1Z6RA 3BEXA 4BE2A 2GVZA 3SSSA 5D0HA 3DNCA 3J81Y 4R25A 4E1NA 3ZSWA 1AYEA 2F4VF 5G4DA 1LWCA 4QU6A 2P5GA 4NLSA 5I3UA 4WE1B 1XEZA 2ZZNA 1JXBA 4LVOP 4NYFA 2ILZA 1JLCA 1IM4A 3C6UB 3CERA 2CFXA 2DGQA 5HO4A 1ZBFA 1LWFB 2V8GA 5BR8K 5KFYA 5KFQA 3QEIA 4DV4J 4FWOA 1S1UA 1S1WA 4NPOA 2EKNA 2YKAA 1HNXK 2HNDA 3QO9B 3M2VA 3QWUA 3LGNA 3C6UA 3SQOP 2LDYA 1RWPB 1HI8A 3HX9A 1S49A 1IV0A 4RNFA 3WIUA 5CZVA 4DR2F 1U1NA 3MR5A 3KLHA 4UOHA 3ZTRA 3UWTA 3RAQA 3CFRA 5AE3A 4WF9L 4YOYA 1N33J 5HMZA 2RE2A 2ZBRA 3VF2A 3GFYA 3VQ9A 1Z2ZA 1HQ2A 4LRCA 3BPDA 2BRKA 3VGLA 1RWNB 3UD4P 1YBAA 2HFVA 4IOCL 2Z1IA 2IDLA 2DNQA 5KTQA 4YDUA 4KB1A 4Y2AA 1XMOJ 2M5YA 1S6PA 2N4DA 4OYPA 2AV5A 2CQ1A 2RQKA 4C8OA 2ZM6F 4ATNA 4ZVFA 1SXLA 4OYWA 4CJPA 3MD1A 2MLXA 4TY9A 2CJYB 2YTCA 3UW1A 1URRA 3IXQA 1Q79A 2WFBA 3MCSA 3U9ZA 4MDAA 4IH6A 3JQJA 3T7ZA 4BS2A 2OLWA 2G8VA 3H59A 1TL7A 2IFXA 1BE4A 1O1WA 2HVDA 2A6MA 3D6FB 2FHJD 2POKA 4WZMA 3UDCA 5LM7E 1Y10A 3I31A 5F8MA 1H3DA 3L2UA 5F3TA 5MAOA 1WC0A 3OA9A 4H0PA 1HNWK 1UJ5A 4Z7CA 3OL9A 4OZ1A 3TQEA 4FL9A 4KV8A 2ZNZA 4EO6A 3TAFA 2LQ9A 2RKIA 2QWLA 5DLFA 1VSKA 2HQIA 2ZWOA 3AVFA 4IQXA 2ZBIA 2O01C 2E66A 3T1HJ 1XJWB 1VC6A 1WEXA 4K43A 3HOTA 1S9EA 2ZHAA 3MM6A 5BRFA 4ED1A 2ZBPA 4JI2J 3BSAA 3G10A 4J2EA 1S72N 4DG1A 5KFKA 3DLLQ 1Z1ZA 2D0AA 1S59A 1B92A 2H4WB 2YWKA 1BWFO 2KDOA 1KC8T 1Q4RA 2F63A 4FJ7A 5KQ8A 4O3RA 2ZD1A 1S6PB 1WG4A 4BROA 5HBMA 1W7WA 3N6MA 4ID8A 5KT2A 4LF7J 1F5AA 1TL3A 1NPRA 1MNEA 3QJJA 3MTKA 5LL6Z 1IR0A 2E2PA 2R2TA 1RWXB 3KLIA 4LF4K 3C16B 2VQEJ 1F2GA 3OS0A 1RACB 5F8HA 1I5OB 2I0XA 1DT9A 1QVGR 2HW3A 3HHKA 3EX7B 2V7YA 3IWLA 1QUVA 1OY8A 4DV4K 5ITHA 3R7NB 2AP6A 1T3OA 4DX5A 2F9TA 3FZ2A 2L9NA 1Q7YO 2BJ8A 1A9NB 1J6ZA 3QMLA 2B9XA 2V69A 1U26A 2E9RX 2NSCA 1NJXA 3C95A 1ZS6A 2YHAA 3TYTA 3DLEA 2EG2A 3ET6A 5ETSA 2F1FA 2BANB 3BGOP 3UPFA 2NPIA 3VETA 2BJEA 1TK8A 1LV5A 3MWTA 2JLEA 3NRBA 1CULA 3RAXA 1Q7LB 2XO6A 2CIMA 5HP1A 4M45A 2VBZA 1HKCA 4L3QA 5IT9Y 4PWDB 2XM3A 3A5OC 1M5VC 5GAEP 1ILYA 2GW8A 2KG0A 3VEZA 5A8WA 3L7PA 4FWKA 5KG7A 2MQMA 4WQ5A 3KHLA 2HBMA 2YX7A 4BWMA 1GT8A 3PIOL 4HR2A 2I5JA 2OPSA 1R3NA 2OSQA 2AU0A 3WEEA 4Z4FA 1OYEA 2KHCA 4K0KF 2DGWA 3O08A 1OH6A 4LF8J 3RJMB 4CD1A 4KB0A 2IVYA 2V63A 1S1TB 3O80A 4LF6F 1NBEB 5C10A 1HJOA 4JV5F 3BN4A 1WTFA 3W2VA 4WJBA 5HBMB 2PA8D 4ZTJA 3RR7A 3OTDA 4NCGA 4EZ9A 2NXNA 4DU4A 4JI4J 5E84A 2YKMB 1GLDG 1NGGA 1U6FA 4ECQA 3QSIA 1HNWJ 2JVRA 3CCUS 4OPAA 4I6AA 1FESA 4DB3A 2DFFA 2EBGA 3CDAA 2QW9A 4JKBA 1YJ9N 2VU5A 2OTJS 3IMQJ 2P9KA 2ALYB 3NGIA 3D6MB 1AFIA 2FHKA 1RU1A 3NMAA 4EAHD 4E7LA 4FYWB 2ZQBA 1ASVA 1XUPO 2MPUA 3UCGA 4RO0A 3LP2A 2MZTA 2J0XA 2C3YA 3QZ8A 4PXDA 5J1EA 2UXDK 3DMJA 4H4KC 2WOMA 3LDSA 3R5BA 2MJNA 3RZAA 5C42B 2CKWA 1ZAWA 1VLOA 4F3QA 1NJWA 3AVCA 3IAM9 2UVWA 2UXBK 3OW2M 1F1BB 4P2MA 2M70A 2KYXA 3THYA 2RUSA 2P8IA 2YKQA 3J81U 2BABA 2DITA 2O5DA 1RHKB 3LP1B 1G1XA 4ZCLA 1GAOA 5E3CA 2QXLA 2UUBF 2IM1A 4FKYA 1FXLA 4B3RF 3T9ZA 5CYQB 2ACMA 3EWGA 3JYTB 4OIXA 3HHLC 5LJVA 2PGCA 1ZA1B 4X4VA 4IRDA 1TR0A 4ETZA 3P4UB 1VQ9S 1XHZA 1QTNB 4HVJA 2HMIA 4KHPJ 3PEHA 5KG6A 2ZH4A 1S10A 2XCAA 3FZLA 3KYLA 1LW2B 1VSIA 3QERA 2OPSB 3QBCA 3OYIA 1UKUA 1XMQJ 3B82A 4CZIA 2E7VA 1JLBB 1Q9XA 4ALZA 4JKAA 2KT2A 5DQHA 3OBWA 1T9WA 3DHXA 5JJBA 5A2QY 1XNRF 2DPJA 3JSMB 1WSIA 2IM2A 4LY7A 3ZNJ1 3UD3P 2V94A 1OH8A 5KPZA 2CJAA 2ZH8A 4Z7YA 4E7IA 2Q43A 2KKZA 4GKJJ 2AA4A 4W5OA 5FRNA 2Q3SA 2CWKA 4OMFG 5C7PA 4GKJK 1M5SA 1FVSA 4FPAA 1NSQA 4RNNA 1BI4B 4CBUA 1ZTTA 4X4QA 5L9XA 3HDSA 1K9MO 2VB6A 5A2QU 1FRJA 2XWYA 3W60A 1DHMA 3M6WA 1SH0A 4MMOA 1RYRA 2I38A 3OVBA 5AQQA 2DD8S 2VYPA 5GAHU 4W5RA 2V4JB 4F2RA 5DS7A 4PWDA 3ILLA 5M2RA 3ZT1A 1T05B 2W7AA 2RIJA 4DSEA 5E33A 1R6YA 4A48A 3DRRA 5AQNA 1QQOA 1GLEG 1TUWA 5GVQA 3NEKA 2Z4PA 3HK2A 3VCDA 5L8RC 4HHTA 4ILHA 2ZH5A 2OA8A 4LREA 1HNZF 3BR8A 4LBIA 4UUXA 4F8RA 3D66A 4NYOA 4BE1A 2DEJA 1FFSB 4WFBQ 2RNEA 4C48A 2YNIA 2HFOA 4M5HA 2AJ2A 5KFZA 2F7TA 1QJHA 4K4SA 4F4YA 1HBUA 2HZAA 1ZBTA 4FOIA 1X8DA 4RNHA 2ZGYA 4WYBA 3D1OA 3CNQP 4A8KA 5CXTA 2V68A 2R4FA 3M6XA 3L3CA 4YOUA 3I6PA 3A3NB 4ZLLA 3QATA 3AVAA 1S1XB 1E4GT 4W92B 1RQ0A 3IBFB 4X64F 2RHQB 3M30B 3QJPA 2UXDJ 4ILMA 2D3OR 4KO0B 2EFOA 2EXUA 4USUA 4A47A 2IAJA 1TQLA 5L1LA 4ZJLA 4CFCA 2QN6B 2UUBJ 3KKSA 4KHNA 5ELZA 2XLJA 5AXKA 4KGZB 5CA5A 3M9MB 5ADXA 1RE1B 4MDBA 4WE1A 4Y2CA 5C2GA 4ELVA 2R8GA 2HS4A 4AL7A 1CJTA 2QIFA 1RTJA 1WEZA 1I6JA 2ZKUA 3KXDA 4ZCMA 3ZSYA 5DRKA 4JK8A 4M42A 2VC1A 2XMKA 2DNPA 1U47A 2QWRA 4I69A 1DARA 3AVMA 1EX8A 3QBWA 2I7NA 4JI7J 1UEVA 3BS9A 4BG9A 4LSLA 1KOOA 3HHLB 3N4WA 4K8RA 4GRSA 3A0IX 2EX3A 2MJUA 5LSRA 3CD5A 2VFTA 4EFHA 2OPQB 4DX8H 3DOLA 1H2VZ 1EP4B 3RW7A 3LPYA 1X5TA 2YWWA 1IJJA 1JK9B 2R2UA 2UV8G 4GV3A 3W1YC 2VONA 1XK8A 4CF0A 3UFCX 2RH3A 1RAGB 5CHIA 4TVAB 1WHWA 4AILC 1HARA 4DL4A 2O3DA 3CCQN 2W9BB 2ZZTA 2OO4A 2VWKA 3LGHA 3J7A1 1WB9A 1SL1A 8RUCA 4CJWA 1XR5A 3ZTOA 3BZCA 1G3OA 1Z2LA 3A5NC 1H2TZ 1ZPWX 5AQPA 1P8GA 1JKHB 2K2PA 3P5TL 5GMEA 4M5DA 3CCJN 4DZ6A 3MK6A 3GJRB 1SI9A 1GOAA 1RISA 2QYGA 5D6GA 2W40A 1M90O 3QFHA 4P7VA 3VQ6A 3PR5B 1M5PC 2JWLA 2J0SD 1S1UB 1S1WB 4DTJA 3KUGA 1TMMA 3H90A 1QE1A 1PAUB 2IHR1 4QS9A 2XS2A 2R2SA 3D2FB 2Z56B 4FSVA 1R8CA 2D3ZA 2HGMA 3BQ2A 2B6AA 4ED5A 1NGJA 5C25B 2G4BA 1Y9OA 2MZSA 3H40A 2ZUGA 4DI6A 1GMUA 3BO4A 4MJKA 4D3GA 3NF7A 2LEPA 4LF4J 2J7WA 2FJBB 1G6BA 4F2SA 3T6JA 4QYZK 3CIZA 4O55A 5A0YB 3L09A 1GLJO 3SBTA 2WSEC 5CZXA 4QYZJ 4IH5A 3CPEA 4Y1CA 3I4PA 5DM7L 1NK7A 3SUQA 4JNEA 1VQ6N 1FD2A 5F3ZA 1N34F 2ASPA 3OY9A 3FKBA 5J1EB 1KAZA 3JXUA 1WHXA 3C0BA 2Z2ZA 3CDBA 4AQYJ 1EWQA 1YI2S 2IAJB 3RMBA 2DGUA 4ZDNA 4NXMK 4FCYA 5CYQA 2X51A 2FVSA 5F0XA 2VWBA 3LF0A 4I7FB 1B7YB 3H8YA 3V1OA 3NGKA 2HHWA 2GZOA 2JOQA 4CZEA 2KFZA 1XNQJ 1CQNA 2CH6A 2JNJA 2DYAA 1GMWD 2YQ3A 3E9OA 1JMTA 3NS5A 4AUKA 4OJHA 2ZUAA 3DXKA 4PXCA 2H3GX 3K0JA 3R1XA 4IDKA 1F9FA 3ATVA 4UY85 1BHLA 3H1VX 2IA0A 1VQLN 4KPCA 1W26A 3EE9A 5C0YA 2M0GB 4CVNE 4FVMA 4FXVA 1FNOA 4OZ3A 4ZIVA 4FWRA 2F65A 2ASDA 2BTFA 4FZVA 2AJ1A 3EGWB 2B0GA 4QOZB 2VQEF 4CNYA 1V3RA 3AT1B 1U2RA 1K0TA 1C0MA 3CTRA 4RTFD 3S3OA 4B1YB 1QSSA 1VBXA 5HATA 4UOCA 1IBCB 3U9DA 1U8SA 3NF6A 2HQFA 1VQ5N 3MR7A 4FLZA 4JBCA 4RU9A 2I1RA 3K5LA 1KRPA 3PX4A 1KTQA 1GTEA 2MLYA 4BHQA 4DU7A 5IWAK 3I32A 4RZRA 4RU2A 2IDEA 3FRZA 1GMWA 2W01A 3V4MA 1JNZB 3K89A 4LFCF 3R8EA 4IFVB 3G6VA 2R8JA 3DXBA 4G1QA 2DNGA 3NHGA 3TARA 1IJEB 2RS8A 5ETPA 4L8RB 4A2BA 1Y7PA 2IVFB 2JC0A 4QBUA 1VSHA 3TO8A 2D3UA 1TUYA 4LMZA 3S3NA 2V0NA 5HVGA 1U6ZA 1UFKA 1RHRB 2E7XA 4QIVA 4XH1A 3OL8A 5D3GA 1FJ7A 1YHQS 3K8VA 3O3LA 3MGJA 2QX0A 3CJ4A 2A1SA 1P9QC 1S7HA 2FD2A 1KCFA 3OYNA 5EDWA 2CQGA 1N8RO 3K8WA 3N79A 3GG4A 2Z2YB 2WB1D 1NRKA 4YB7A 4C8ZA 3RRKA 4BDYA 2DPNA 1A6LA 1SUQB 4OPKA 2ZGZA 4MKAA 1U1KA 1L3VA 4CM0A 2FBYA 3W65A 3N9UC 1YJWS 3BKUA 3OR1B 3R9PA 1SL2A 3FR0A 3SCKE 5LSLA 2DGOA 3ZX3A 4UZBA 3GCWP 1WBBA 1OS5A 2VHGA 2QLWA 2CPHA 4NI2B 4DX6A 2YNHB 2ZH1A 1N5QA 4O3SA 1VSDA 1MMNA 1UPPA 2QWOA 5AQGA 4LQ9A 2HRUA 3KUEA 4ECZA 4I9LA 1WI8A 3BPSP 3IC1A 1KFSA 2Y9HA 2LU1A 2FGCA 2P9PA 4FOEA 4OO1J 4C6AA 5CD4A 3THPA 1RT7A 4KRWA 2BKOA 1H38A 3MUTP 4FZYA 1XNRK 1UAXA 2BJ1A 3B4MA 1M1HA 1KC8O 2DY4A 4DR2J 1KBRA 1Q86O 5D0RA 1JX4A 2GGPB 3KLFA 1XHXA 5ETRA 2C1EB 4RW4A 4XPCA 2EFPA 2EK1A 3ET6B 2DISA 5CY4A 2JDJA 4QCLA 2L08A 5A2QO 3PEJA 3FBCA 4Q43A 1SIWB 2F8EX 3M6VA 3UDLA 1JLQB 2CGKA 3OTOK 4BGBA 3W3SA 1S77D 4M3YA 2F40A 1SJ4P 3GP9A 4NZ7A 2OPPA 5F8JA 3U3YA 2LU2A 2R2RA 3HT3A 1MWMA 1QHTA 2D7SA 3THTA 1NGEA 1FD8A 2NRRA 3LO3A 1RDDA 4DCJB 2R7RA 2DR7A 5GADI 3ZSZA 2HAFA 3CJ0A 2EFQA 2ZE2A 3I56N 3KKFA 4CIEA 3TRGA 5HLFB 4BRNA 1SKWA 2PZSA 5GAGI 2BKNA 3BN7A 5HRNA 1J27A 1RCOB 3MMCA 4DV2K 1NK4A 1GFWB 1RP5A 5KFIA 4DPWA 1HNZJ 2L48A 2GFFA 4YUDA 2RU3A 4CZHA 2HBQB 3WXKA 5T7LA 1RKIA 3KTQA 2JFKA 2A41A 2QA4N 3DXMB 1TGOA 2M88A 4FWMA 3TSPA 4KHPK 4CBXA 2BW2A 1EKSA 4ES3A 2P9UA 2EHGA 1S12A 4CTAB 5HAOA 2F4VJ 2IGIA 1NHVA 3K5NA 3LM2A 3M2RA 3I0SB 3AA4A 1MG7A 4OX7A 3I96A 5KG0A 1SJ1A 4CJFA 4PA1A 4USJC 1LFWA 1A5VA 2HNYB 3EZUA 1AZSB 2A10A 2IOCA 4CEZA 4FPRA 4DPOA 3J7YI 2VG5B 3G8TA 3EVOA 3QYYA 2RSQA 1IH7A 2HK3A 2GGPA 1Q8LA 5L1KA 5JLFA 2EC2A 4U9RA 1ZZFA 1HR0K 1KHWA 3UO0A 3DOKB 3L7OA 2G8KA 3TVYA 2DRAA 2SXLA 4LR9A 3K17A 2CPEA 4CK1A 3MAAB 3BO3A 1Y5NB 2DKOB 4JI0K 3MN6A 4LF2A 1N56A 3EGZA 3Q89A 4JD2B 2CADA 2W4PA 2BKPA 4LUBA 1I39A 5M1PA 1JLGB 4BC5A 3CCVN 2A3ZA 2PEBA 5E3RA 4ECWA 3DJCA 5HVFA 2GIQA 3MPWA 3O4WA 4DJBA 1HYSA 1RT4B 1H7WA 2ILYA 2YNGB 3M2UB 1ZYQA 1VQKS 3DMJB 3WC2A 2CUYA 4WYLA 1J5EF 3VAKA 2MKHA 1NWKA 4FJMA 1U1RA 1FF2A 4NLXA 3A8JA 3B8HA 4C8NA 1IR1A 4CEAA 4J9RA 1ASWA 1C0FA 1SH3A 3ICLA 2M8DB 2CJXB 2X3GA 4OHWA 2R7OA 3ZZTA 1VDHA 1NK0A 1UWBB 3P4IA 4ZVRB 2R7XA 1OO0B 1IKYA 3TZWA 2FY8A 1B70B 1RDCA 2H9ZA 3ZLJA 2PEHA 3M4XA 4ZPCA 4DV6J 4QOTA 5KFGA 1JJ2R 2CPXA 2IYIA 1RK8A 1Q95G 3G2XA 4PQUB 2GIFA 1YJ9S 1F3FA 1RNHA 2WBNA 2LQ5A 2MY8A 3SEOA 3TWZA 3QT8A 2A5XA 2C3UA 3AY9A 1EXQA 2X6NA 2CGJA 3CCES 3I87A 3L2QA 1P1LA 3TSQA 5FD1A 5KFMA 1SKRA 4YHHK 5AQZA 3D3CJ 3DAWA 4B3RJ 3ZO7A 1NH7A 3VVTA 4CJEA 2ASYA 3V6DA 4JD2A 1J53A 4BR5A 3B4DA 4RR5A 3BP8A 3J7YP 3CIMA 3D7EO 3O5BA 3EDRB 4JI6F 2ZBQA 2NUBA 3HLUA 3HHLD 2FPHX 2G8WA 1OSCA 4Y2KA 3MPDA 3H3NO 5LJWA 3OYBA 3R2CJ 3MM9B 3FMBA 1NGBA 2DNLA 4WQ4A 1PO6A 1YTUA 4TN2A 4NI2A 2I2YA 1VHFA 4RUBA 3BGLA 2LCWA 2MQLA 3Q23A 2FF3B 3BYPA 4FW1A 3AH6A 4OHYA 2RHKA 2DT9A 2V4QA 5A6WA 1TV6A 3ISND 1A0OB 2EK6A 2Q0UA 4EZ6A 1RTDB 1PILA 4M3XA 3NMUA 4NO7A 3A3OB 2O67A 4NXMF 5L38A 4MIAA 4ZVOB 1AB8A 1A5XA 1FNXH 1EO1A 2YNFA 2UZAA 3AO3A 5KGXA 3GU0A 5DDPC 4QR0A 1BQXA 1IQTA 3NAEA 4CK3A 2NZCA 4ZPWR 2NXUA 1OIAA 1VAZA 2EBEA 3LAKA 2P51A 2KT3A 3SJJA 5KG1A 4OX9K 3ENHA 1HUXA 2FUG9 3CJKA 1F5CA 3VGVA 2LVWA 2VD3A 1B4SA 2YX1A 4YB5A 5KFVA 2W8KA 1IKVB 4ZLPA 5DDOC 4RJVA 1HJRA 4DR5J 4XDCA 1HYSB 5HROA 1N36F 2JEFA 5AQFA 3TJ9A 1HBMA 3JYTA 3D0IE 3VV2B 1HQUA 2AJFE 3HBTA 1OVYA 3PO4A 4YR2A 3Q8VA 3W9JA 2CG8A 3B8AX 4U7UK 5LXYA 4YN3B 1VQ7S 2VDIA 3HYFA 2RF2A 1VRQC 3FZHA 4H4OA 4AHSA 1SQFA 2QA1A 5LXRA 2DR5A 1UL3A 4FJ5A 4DTSA 5DQGA 5T7LB 4A59A 4DPTA 5IWAF 3DXMA 2WVEA 3J7AP 5FIIA 2IRUA 3FZBA 2YWFA 3H5XA 3SFUA 2HWHA 3BQ0A 4MKVA 1FO1A 1XQSC 2NXCA 1KVJA 3KLFB 4QJVA 5J1NA 4IO9Q 3VGSA 5CYMB 3TTDA 1KONA 3H3OB 1WOSA 1J5EJ 4ILRA 1FDBA 1NPKA 4JRPA 3HJVA 3L9ZA 3S41A 1BIZA 1RTHB 5EU7A 5BR8F 3UN5A 1S5JA 2G1DA 4FBUA 2CDQA 4DSJA 2BM0A 3P39A 4J9KA 4CFBA 4LD0A 5FJ4A 1S0MA 1H0HB 3V9WA 1RWVB 3HSCA 1YAGA 2RVJA 3B78A 3F2KA 2ZH7A 4ILLA 4HVZA 3IN5A 2BR0A 1N34J 4NLWA 1ICEB 3WBZA 4H4MA 4DR2K 2XMVA 4KPYA 3MN9A 3AVJA 4NZ6A 2GQCA 4KHYA 4GVBA 3CCQS 2ATQA 3AA3A 3K0SA 4HI1A 3SSRA 2MQNA 1FJGK 5D8HB 4FLTA 2VIHA 2V5HG 3C6AA 2EFVA 3VHQA 5LY3A 3T5KA 4TY8B 2DGSA 1NDPA 3D0PA 2YHBA 2DNNA 2CA9A 5BYSA 1RU2A 2E1PA 3C15A 2IIHA 3ZETA 3M8PA 1G2EA 4NCAA 1BY9A 2RQ4A 4YS2A 5MLCQ 4KSEB 3MF5A 2UVVA 4ECYA 3PKMA 3BSNA 2AEFA 4EI2A 3UIQA 3GFZA 4NB4A 3WZ0A 4LH4A 4IRKA 1YJVA 3TA2A 4DQ8A 4KY3A 4OZLA 4WTYA 4DBQA 4M5JA 2P9LB 3GONA 2QJ3A 3OXGA 4WBFA 4TU8A 1WDDA 2HSEB 3IAYA 4JKGA 1U2VB 4H5TA 4BRAA 2Z2MA 4WKRA 3V1QA 3GQCA 1JB0C 1WNEA 1S1VB 1KAYA 3C14A 1E6YB 5JMVA 3U4LA 3J80Y 5BN9A 1YTAA 3QMQA 2Y3YA 2ZKTA 4AQYK 2K7JA 4QQBA 2NQPA 4B3RK 3K5MA 3DLGB 1N33F 5KRSA 3T3FA 2J7KA 5B0GA 4YHHJ 2QRRA 4PRFA 4TYAA 2FZGB 3NGDA 1XN9A 2FC0A 2PMZD 5E7OB 3OTOF 1Y00A 2AYGA 4JI8K 3QICA 2DXDA 2O4GA 1Z25A 4DR4J 1X9JA 4DV5K 1ATNA 2V52B 3BGRA 4RKUC 3QDKA 3HVTB 4C8YA 4IO1A 4UF4A 3T5JA 2OCEA 1X1PA 2P9EA 3NGZA 3SNNA 4IG3B 3KLGA 5THWA 1D09B 4AE5A 1N48A 4P2XA 4TKTA 3PY8A 3HSGA 1RAEB 5DG8A 1MWYA 2UUCK 3ETOA 1WEYA 2L9WA 2JJ4D 4QWCA 3ETMA 2NRHA 3HHDA 1SAZA 4F4XA 2G2ZA 1NXIA 3J80U 1IBKF 3CYMA 2YNGA 3M2UA 3MEGB 3NH0A 3DOLB 2CJKA 2ZJRL 4JKHA 2BDPA 4MAKA 4IFVA 1J5EK 2Q2RA 4J5OA 2JVOA 4LF5K 4CEOA 2HHSA 2DNMA 4DOZA 3FCVA 3W66A 2HB5A 1M1KT 3IG1A 2J7UA 4PCQA 2KXFA 4PABA 3LQVA 2YKNB 1RSCA 3SPYA 3AARA 3GR0A 4B3TJ 4PKIA 4OV6A 5KFOA 1K73T 2IJFA 1RHUB 4GY2B 2ATCB 1H7XA 4H5VA 1NNEA 5B0BA 3EKUA 4TLRA 5DM6L 1YX2A 1D0EA 1BA0A 1X3NA 2ZOMA 3L95X 3C94A 3QJLA 3E2EA 5HRSA 2HFSA 4JKGB 3I55N 4IR1A 4I2QB 4DV7F 4DTMA 4W5NA 4K4VA 1A7GE 4J8FA 3EO3A 4E98A 4GMKA 3C66A 3DKDA 1R0AB 2JEIA 4N8OA 4BBYA 2CQ2A 3I0SA 1WLJA 4RBUA 1H2UX 3OYAA 1U2CA 2BMBA 3CCWA 2QLFB 3E01A 2M9KA 3DRPA 1NJIO 3WQUA 3NXZA 4OYIA 5M1NA 2BA9A 2KT5A 4N7TA 3SXLA 1NUEA 3OVSA 5ETQA 3H45C 4WQ4C 3CIPA 5FDLA 2XSFA 2ZC3A 3LL3A 4F3TA 4W4MA 1RLDA 2E5LK 1IG8A 4OJRA 4G9ZA 1YKWA 3AOBA 1SQKA 4V19J 3PRDA 1L3UA 2V9WA 4YORA 4PKGA 3L2WA 1URNA 3G8SA 5AQYA 2G1HA 5AZIA 3UKRB 1VQ9N 2HZCA 1KNZA 1D9DA 1CC7A 3AFGA 3IBCB 1T3VA 5JVGQ 2UUBK 3H1QA 4CJKA 2HOEA 3CO9A 2CQCA 2W2QP 2PD1A 5M1QA 2UUAK 2RJZA 2Y8YA 4NMXA 3CJCA 1VI7A 2IVPA 3AVLA 5H9FJ 2HIYA 4JK9A 3R2DJ 3R9LA 4GVEA 1JLFB 3E9PA 2KRBA 1HBMB 4Q0BA 3R5AA 4IWVA 2WSFC 4JI0F 1O51A 1N32J 2FHJA 4NLPA 3S1TA 3VA0A 4OYOA 5H1SQ 4C4WA 1YRXA 1HIYA 1VHIA 3TZYA 3DM2A 4DPXA 3C6HA 4H0VB 4FJ9A 2AIRB 1Q5YA 4PL8A 5L39A 3EE8A 3M6GA 5KFLA 4Z37A 4JUZA 1Y3KA 5K9FA 5L46A 2P9KB 3K59A 1P9YA 1WG5A 1HKBA 1KLMA 5B0EA 1L3SA 1MLAA 2VH7A 4EP5A 4DTNA 3AVKA 4B3MK 1BOTO 5HP1B 1PCAA 3SLCA 1H6KX 4KHPF 1B0TA 3M7VA 1CULB 1NM2A 2DCLA 4TQRA 3KNGA 4TY8A 3CJ1A 4HDGA 3L0QA 3Q8UA 4KFBB 2YJFA 1TL3B 2CPDA 2AWZA 2Y0BB 1BU6O 2DHXA 3DLKB 3P49B 1XIQA 2ZOGA 3VAFA 4X62J 2XMTA 2GMJA 3EE3A 4DV3K 2B56A 1BXNA 1P27B 4M5GA 4F4WA 2BOPA 2V8HA 4ENOA 3IR7B 3RB4A 2FLLA 2P9LA 4A62A 2X6SA 1LOUA 2DFEA 3O9TA 4FK0A 1M1GA 2BV3A 2WB4A 4F0KA 3RB3A 2HRTA 5DZ7A 2OIHA 4CTAA 1TUVA 2VZ9A 2X1FA 2KB2A 2VG6A 2CZ9A 4NLBA 3AA5X 5HL7Q 3HRGA 3KK2B 2JH3A 3GSIA 1YXQA 2E7WA 2ASOA 3MR3A 3HULA 4WK3A 3PRBA 4QU7A 2RKIB 4CZGA 1EX4A 3C16A 2HLTA 1BDGA 3UNYA 3GTYX 2XGQA 3SQ1A 4BQZA 1NOYA 1LWXA 4GNIA 1RWKB 2RN2A 4RG8A 2KHOA 4C98A 4H0OA 5SUHA 1SV5B 5ETKA 1V6HA 3CI5A 1RWWB 3RSEA 4YY3F 3V5RA 5KFPA 1PSDA 3QETA 4D3HA 1JJHA 2ZDOA 3KIOA 2JEJA 2D9OA 4JI6J 1EHWA 1YQHA 4F4AA 2M52A 1RTJB