4ICLA

Hiv-1 reverse transcriptase with bound fragment at the incoming dntp binding site
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 150
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4iclA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iclA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iclA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iclA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4iclA05
3H5XA 4NYFA 3LP2B 2IAJB 3KLGA 1JLQB 2EC0A 4K8ZA 2ILZA 3RMAA 2VA3A 1JLBA 5KFBA 4DF4A 1REVB 5L1LA 3MXMA 1L3VA 4BDZA 2IGIA 3OYEA 4DFMA 3FRZA 2OA8A 4M41A 3MEDA 1RYSA 3MEEB 1WSEA 1XR5A 3ZT0A 5KFSA 1C0MA 4Z4EA 1FXXA 2G8KA 2WOMB 3MF5A 1C0UA 1IH7A 1RILA 3VQAA 4ECYA 3PJXA 2O5DA 2XCAA 4NYNA 3HVTA 3IS9B 4YQWA 2IAJA 3ZSWA 4C8KA 2HHQA 4DL4A 3MFHA 2I5JB 1TV6B 4B9SA 1C0TB 4AH9A 4PUOA 5DMRA 1Q9XA 2B43A 3V9XA 3G86A 3UDLA 4J9LA 4FBTA 4NYZA 4YP3A 1RNHA 4CJ4A 3RAQA 3CFPA 5JS1A 4JUZA 2HHWA 1OS5A 2WOMA 3TR8A 2BQ3A 2HVHA 3SNNA 5KG1A 4IRCA 2HNDB 2UVUA 1JXLA 2HNYB 3H2LA 3VQQA 3IG1B 4RUAA 4M3UA 3MFIA 1FK9B 2E6MA 1O1WA 4OGCA 2VG7A 3T3FA 2I5JA 1HJRA 5CYMB 2D0AA 1S9GB 2HNZA 4ELTA 2GC8A 2F8SA 3PX6A 1B9FA 5KG7A 5KFMA 1I3AA 3QETA 2D5RA 3H5SA 2R8JA 3QIPA 2F8EX 1S1VB 4HUFA 5KFVA 4NLSA 4EO6A 3OYKA 4E0DA 5JUMA 3RMCA 2KZMA 4ED3A 4JS4A 3MR2A 4MK8A 1A5WA 3DLRA 3SQ1A 1U09A 1W0HA 4JRPA 2HNDA 4BE2A 2HWIA 2G8IA 4CK1A 1LWFA 1CSJA 1VK0A 2UVVA 4KHQA 3OLBA 5J2NB 5DG8A 3I0SB 1SH2A 4FLTA 1NJXA 4J9MA 1Z25A 4KHSA 4QWAA 2XY8A 1JXBA 4RW6B 4URGA 4Z4CA 3SUNA 1B9DA 4XIUA 5EDWA 4TLRA 1S1VA 3QYYA 4YMEA 3DYAB 2FC0A 3I5BA 1EKEA 2YKMB 4H54A 1RBUA 1LAWA 1WNEA 4WZMA 4FVMA 3H98A 4BWMA 5SWMA 2XGQA 1NK6A 5F8JA 2R2UA 5KFTA 4TQRA 4O3QA 1RTJA 2RF2B 4B08A 3KK3A 1TKTA 5KG2A 3CQ8A 5J1EA 2W9AA 3I0SA 4MQ3A 4MIBA 3Q8SB 1DLOB 1FKPA 5E41A 3E01A 5KFAA 4GW6A 1GOAA 4RW6A 3N6MA 4CGGA 3OLAA 2YKNA 5D3GA 4K4SA 4DSKA 3RMDA 5KFIA 3DYAA 4DG1B 4EBDA 4CFDA 4FZXC 2YKMA 3ZSOA 5HRSA 2YHBA 4B9VA 4QWCA 4EEYA 4YFUA 3V1OA 1U45A 2HHXA 4MK9A 4F2SA 4EBEA 5KRSA 1ZBFA 2RF2A 1WLJA 5KGWA 1NOYA 4CHZA 1JXEA 2IJFA 2XO7A 1DLOA 1RT6B 4ZPAA 4FJNA 3KKRA 2AWZA 3IGNA 3LPUA 4MFBB 3KLHB 2W8LA 3ZSRA 4CESA 1S0OA 4DG1A 2VA2A 2R8KA 2D3UA 2ZQBA 2VWJA 3TAEA 2GUIA 3PW0A 2HVIA 1JLAB 4QWEA 1RBRA 3UQSA 4URSA 5FDLA 3QINA 4DLEA 4FM1A 2HAIA 4W5OA 4K4YA 3OYCA 1SL0A 1QSLA 4M3WA 2R8HA 2RKIB 2WONB 2AX1A 1TK5A 4KHYA 1EETA 3L8BA 3DLEB 4ZMMA 4ELVA 1TGOA 2QXFA 5KFJA 3KLHA 1JIHA 3AVCA 3RB0A 4RW4B 2WCXA 1VSKA 3OYMA 5KG0A 3KHRA 4F4WA 4TXSA 3NH0A 2IC3A 4QW9A 3GV5B 1UWBB 1WSFA 4RW7B 1JLAA 2W9CB 3V81B 1BL3A 3M9MB 3CVKA 3V6JA 3KOAA 1ZBIA 3IGVA 2X6NA 4KB7A 5HBMA 5L1KA 3EPIA 4B9TA 4O5BA 2RKIA 4QW8A 2WONA 3HYFA 4WFYA 3KLEB 3DLEA 1CZBA 1GX5A 1LAVA 4ED2A 3OS2A 4GC6A 3OYIA 4QPXA 3ZCMA 1RCHA 2IS3A 4F3TA 1HRHA 5J2PA 2BANA 2ATLA 4E1NA 2OZSA 3FFIA 5CYQB 4AHTA 4RUCA 4CGJA 2IBKA 4AHRA 2DY4A 2W9CA 3V81A 1SV5B 4WFZA 4KAIA 1VRTA 3AVJA 1QTMA 3CJ4A 3NKYA 4FJGA 1RDCA 2B5JB 2OPQB 1EP4B 1T05B 3V9WA 4F4XA 1NK8A 4FW1A 1QQCA 5KT4A 4QAGA 4FCYA 3NAHA 4RNOA 2R2SA 3PVXA 4B9MA 3L2VA 1T7PA 4OJRA 3PR5B 1TK8A 1MU2B 4AHSA 2EHGA 2E9TA 3SUQA 2OPRA 4IQXA 1NJYA 5FRNA 4ZVFA 3C6UA 5K14B 4C8MA 2FJWA 2C22A 1B92A 5KG6A 4JV1A 3T19A 2V0NA 3HP6A 3SQ4A 3KHGA 3TAGA 3QEXA 3QIDA 2DPJA 5KT6A 4F50A 4QCLA 4CEAA 4DTNA 4M42A 1BQMB 3VQEA 2IOCA 3ZT2A 1BIZA 1RT5A 3GIIA 5DQHA 4OPKA 4Z4IA 3I5CA 2C2EA 1C1CA 4O4GB 4ZP7A 2O4IA 1KHWA 2DFHA 5DK5A 4DSLA 3HKWA 1DTTA 3KJVB 2OYQA 2ASLA 1S10A 1NNDA 4YNQA 3RWUA 3SPYA 4MK7A 4KI6A 3RAXA 4RW9B 3DLGA 3VQ5A 2HHVA 4O0JA 2XI3A 5C24B 3HSTB 2J6UA 4C8LA 3M8QA 2HMIB 4M3RA 4JV2A 3CJ2A 1VSDA 1X9WA 1S9EB 5KFPA 2GIQA 3RBEA 1ASVA 3TQ1A 2WB4A 4WFXA 4ECVA 4TY8B 4FK4A 3RR8A 3H5YA 3OYBA 5HROB 2IMWP 2Z1GA 3THVA 1ZBHA 1UOCA 4DU3A 4RW9A 2G8FA 1NJZA 5C24A 4RZRA 4BDYA 3B6PA 3QIOA 2E9ZA 2HMIA 4EYHB 4EZ6A 4FBUA 4ZPCA 2D0BA 3MEGA 3KK1B 4RW8B 4DQIA 3PV8A 5KFUA 4FJIA 4FJMA 5HLFA 2Y1IA 4DQSA 3OSPA 1TL3B 3OL8A 2IDOA 4KTZA 4TY8A 3M8RA 3TAFA 3ALYA 2YHAA 2BDPA 1C1AA 1S0MA 4DTUA 4KTWA 2W7PA 4KKOB 1LW0A 4TYAA 2XRIA 4G3IA 1QAIA 4O3PA 3AO5A 4OKJA 1RBVA 1NK7A 1QS4A 4I9LA 3LP3A 2D7SA 3ZT1A 3VA0A 1RDRA 3ITHB 4KO0B 3LZJA 4RW8A 3DI6B 1N4LA 1F21A 3L2UA 2BRLA 4GC7A 3QNNA 1S4FA 3WNGA 1TL3A 4FJLA 4NLRA 3ZT3A 1JLFA 1A5XA 4OGEA 1JKHA 2F96A 1UA0A 5JS2A 4KKOA 1HYSA 1RTDB 1KCFA 4IKFA 1RTHB 1SL1A 3BREA 4IOBA 4G1QA 4BWJA 4FZZA 4ID5A 1Q8IA 4WYLA 3S9HA 3I0RA 3DMJB 4ICLB 4O3NA 4NLDA 4IR9A 3PW7A 4CJLA 2ASDA 3ITHA 4H4OB 4FS2A 4KO0A 1Y97A 3OSNA 1K1QA 4ECTA 4CEDA 4H4MB 4IFYB 3DRPA 2AGPA 4NLXA 4NCGB 3SI8A 4K4XA 3AO1A 1S1TB 5DG7A 4DFKA 4CIGA 4NCAA 5KT5A 1RT1B 3AVLA 4RNHA 1RTHA 4MIAA 4IKAA 3OYDA 5I42B 4CEEA 4LQ9A 5KT7A 1SH0A 3D45A 4FS1A 3HJFA 2IM2A 2QE5A 3VA3A 3DMJA 3KK2A 3H08A 4R5PB 1BIUA 5I3UB 1N6QB 3NL0A 1LW2B 3HVWA 4DU4A 5KFKA 4I2PB 4DL6A 1RTIB 3V1QA 3LP2A 4RNFA 4H4OA 4PQUB 1JLQA 3NBPB 4IDKB 2YNIB 3QESA 3IRXB 4J9RA 2IA6A 1REVA 2HHSA 4NCGA 3I8DA 4CHPA 1MMLA 4NLTA 1S1WB 1ASUA 1RDDA 1XWLA 2CKWA 2G8WA 1RT3B 3K5MA 2QKBA 1RT1A 3ZSYA 3MEEA 3NGZA 5F8GA 1TKZB 3AVFA 4CHOA 1RT4B 3KIOA 1TP7A 3GILA 3P1GA 5I3UA 1KTQA 2C2RA 2DFFA 3IS9A 1RTIA 5F9LA 4FLXA 4FLWA 4PQUA 4CFBA 3U3GA 3Q8PB 2YNIA 3OYFA 3IRXA 5DG9A 3HT3A 1TV6A 4WZQA 3PO5A 1C0TA 1S1WA 3L3UA 2R2TA 2UUWA 4FJ5A 4HUEA 4PY5A 4K4VA 2KQ2A 1S6QB 3GQCA 4CF8A 4E7KA 3V6DB 2JEIA 4HVJA 1RT4A 1K6YA 2XWYA 1RAJA 3KLFB 1NJWA 3KD5E 4CF9A 2HNYA 1HYVA 1XHZA 1XC9A 3IG1A 4I7FB 3K5LA 2FBYA 1FK9A 3HVRA 1ZETA 4Q44A 3AVIA 3HL8A 3VQCA 4DF8A 1D5AA 5CYMA 1S9GA 2V4QA 1WAJA 2VG5B 4U6PA 2HHTA 5KFGA 3TAMB 3H40A 1S6QA 4N56A 2AX0A 3D28A 3V6DA 3A2FA 1GX6A 1JLEB 2IM0A 4BE1A 2FVRA 2HHUA 4CFCA 4B9UA 4DS5A 4ED1A 2KTQA 4LH5A 3SFUA 4DL5A 1CXUA 2AQ4A 3WNEA 2I1RA 1VRUB 3G6VA 3K5NA 5J2NA 3KMSA 4YR2A 1HQUB 2DFEA 1S1UB 3ICLA 1C1BB 3DLKB 3ULDA 4IR1A 4NLPA 3BGRB 5DQGA 1HNIB 3SFGA 3UPFA 3TAMA 1NK9A 1IM4A 1J9AA 3CFOA 4OVLA 4M3YA 3OHBA 3DM2B 3H4BA 5DLFA 3QZ8A 3PZPA 4E7HA 2QKKA 3OJUA 5KFRA 4PWDB 1T94A 4AILC 3QNOA 1VRUA 4E3SA 5CZ2A 5F8IA 4K50A 4J9QA 2XY7A 3SPZA 2OPPB 3GIJA 2G8HA 4LY7A 4H8KA 4HCBA 3V9ZA 4C8OA 4F8RA 4WXWA 3ZSQA 1WN7A 4CF1A 3KHHA 1XI1A 3NF9A 4ID1A 1Q9YA 4HCCA 4CJTA 1LWCB 1HPZB 5EUHA 4DQQA 2XY6A 2FVSA 4PWDA 2WRMA 4TYBA 4TY9A 2ILYA 3Q8QB 4BACA 4R8UB 4OPJA 3O3GA 3OYHA 3F73A 3RR7A 4HTUA 4LD0A 1BQNB 4QWBA 3AA2A 4KHRA 3CJ5A 3HVAA 1D8YA 3G10A 1RT6A 4CJVA 1S48A 3FQLA 3NGYA 2OPPA 1HMVB 2ETJA 3V4IB 4CJ3A 4MFBA 1RT7B 4ED6A 5C25B 5KI6A 1IKWB 2JGUA 3C94A 3OJSA 4CFAA 3AV9A 3VQBA 1R0AB 3KD1E 1HPZA 4CJPA 3AVGA 4DFJA 4FJJA 2ITGA 4TSXA 3NH2A 3PX0A 4DU1A 3M8PB 1U4BA 3HHKA 3CM6A 3SUOA 1QE1B 3OVNA 1IKVB 3KNAA 5F8LA 4J2BA 1HMVA 1RT2B 3V4IA 2F8TA 1W25A 4RW4A 1S97A 3PUFA 1UA1A 4QWDA 2C2DA 4K8XA 4CHYA 2YNGB 1UWBA 3BSOA 4O3OA 4RW7A 4Q8FA 1NK4A 3RRGA 1QSSA 2D3ZA 4ECUA 4CGDA 3AA4A 4Z4HA 4N47A 3U6FA 4KB1A 3NGIA 1TVRB 4FW2A 3C95A 4DLGA 2W9BB 3RB3A 1HQEB 2V4RA 1TK0A 4W5QA 4R0EA 4CEBA 3KLEA 2PYJA 4O4RA 4RU9A 3RRHA 2O4GA 1YVFA 3HXMA 4DTRA 4DTOA 2HB5A 1L3UA 3NAIA 4OKEA 5CYQA 1RDBA 5KFOA 1SV5A 3LAKA 2P1JA 3DOKB 4FLYA 3KKSA 5L1IA 2B5JA 3JSMB 3DRSB 2OPQA 1EP4A 1T05A 4DSFA 3KTQA 3NF8A 4N76A 3AVHA 1VSEA 2R8GA 1HQEA 2G8VA 1ITGA 1SUQB 5SZTA 4ECWA 3LAMA 4J9PA 4K4UA 2BGGA 4CGHA 1D9FA 1KRPA 1MU2A 2R7YA 3KHLA 2UVRA 1S9FA 1HNVB 3OYLA 3LDSA 5J2QB 4AHCA 3QEWA 1S1XB 1TKXB 4KRFA 2J6SA 5K14A 4Q8EA 3K5OA 1FKOB 2EX3A 2UVWA 1BHLA 2ATQA 2JEJA 2KFZA 4CE9A 1VSJA 2BE2B 3DOKA 4QOZB 3TAQA 1C2PA 1D9DA 3OL6A 5CZ1A 3JSMA 3QZ7A 3SV4A 5KT2A 3CDEA 3B6OA 1TL1B 2WTFA 3CYMA 5HRNA 1BQMA 1UAXA 4E19A 4NLOA 2W42A 3NH1A 1IO2A 2RPIA 2ZE2B 1TAUA 3CJ0A 1SUQA 1IKXB 4ZVEA 3OHAA 1G15A 3P5JA 1BCOA 3SQ2A 3KLIB 4KE5A 2XC9A 4GVMA 4O4GA 3MAQA 3QGIA 1HNVA 3FSIA 4XPEA 1CXQA 1TKXA 1KHVA 4FZYA 3KJVA 3NGDA 4LSLB 3QGHA 1YVUA 5FROA 1DTQB 4KBIA 1HARA 4B9NA 3RBDA 4ZHRB 4KREA 2FBTA 3F9KA 2AGOA 1TL1A 4NLWA 5C42B 3V6KA 4CJQA 4IH5A 1WAFA 1WSGA 3MXIA 5KFYA 3VQ4A 1QSYA 4KHNA 4JS5A 4FM2A 1IKXA 3HK2A 1TQLA 4Z4FA 1SL2A 1N56A 3HM9A 3DRRB 1RA7A 4EYIB 4NRUA 1A5VA 3U3YA 3BSAA 4LSNB 1S9EA 1ZTWA 1RBSA 3NDKA 4J2DA 4FK2A 2OZMA 3N6LA 4LSLA 3K2PA 3JYTB 4EBCA 5HROA 5KG4A 2E6LA 3VQ9A 4ZHRA 4W5TA 1RYRA 4B8AB 1L3TA 1YTUA 1SKRA 1ASWA 5C42A 4WYWA 1T3NA 2KW4A 2B6AB 3ZSZA 4TN2A 1XR6A 4MKAA 4NLVA 3TI0A 5KFZA 3SI6A 3MXJA 3G6YA 3NE6A 4ZVHA 4F2RA 4FJ7A 3KK1A 4JV0A 4LSNA 3RB6A 4DMNA 2IM3A 1BCMA 5J2MB 4CHQA 3L3VA 1JLCB 3SQ0A 3LWLA 2YNHB 2A1SA 2XHBA 4ECQA 5KFQA 4DQPA 1BI4B 5KFLA 3G6XA 1EXQA 5T7BA 3HPHA 4U7CA 5HP1B 3KLGB 3IN5A 4EO8A 4KHMA 4FJ8A 2CJQA 4HUGA 2ALZA 4B9LA 4CHNA 3TVKA 3GV7B 4NRTA 1L3SA 3ZT4A 4Y1DA 3AVAA 5EU7A 3O3HA 2JC1A 5HRRA 3DI6A 1JX4A 3D5MA 4CJWA 3MTKA 3OYJA 4KAZA 3DLHA 3BSNA 1C0UB 3PW4A 2ASJA 4KPYA 1LWEB 1J5OB 3HVTB 1JL1A 3BQ2A 1BI4A 3LZIA 3VQ6A 1RTDA 5KT3A 3FQKA 5HP1A 1ZYQA 2YV0X 4Y3CA 3HPGA 4Q5VA 2DPIA 3EZ5A 4KTQA 3E51A 1WSHA 4EP5A 4ICLA 4MH8A 3ISND 4E7LA 4PUOB 3UIQA 4EP4A 4DL2A 3OL7A 3K57A 3OY9A 1RBTA 1X9MA 3ASMA 3ZSVA 4YR3A 4H4MA 4N41A 4IFYA 4CF2A 2X78A 3AO3A 4K4TA 4CK2A 1S1TA 1SH3A 4KI4A 1LWEA 3LANA 1J5OA 1NKCA 4CEQA 3K58A 4LH4A 1IKYB 4CK3A 4E7JA 4IG0B 3OYNA 4J9OA 1NKEA 5I42A 4FXDA 5KFHA 4CCHA 4IRDA 2VG7B 3CM5A 4M95A 3DOLB 4DQRA 4R5PA 1I6JA 2FJXA 1N6QA 1LW2A 2HNZB 4DL7A 4I2PA 4O44B 3BJYA 3RMBA 4RNMA 2FLNA 1KVBA 3QIPB 3MR6A 4ECZA 3NBPA 3MECB 4IDKA 2QK9A 4W5NA 2R8IA 1YT3A 2WHOA 4K4ZA 4W5RA 5C5JA 4AHUA 4XO0A 1RT3A 5KG3A 2P51A 1LWFB 1IKYA 3BQ0A 3Q8RB 4FJXA 4IG0A 4JLHA 4ZPDA 1TKZA 2D0CA 1T8EA 4E7IA 4FLVA 1GOCA 3PHEA 2FVPA 3CDWA 3AVBA 3EZUA 3DOLA 3BQ1A 3AA5X 2Z1JA 2Q3SA 4AHVA 3M9OB 3SUPA 4O44A 5JXSA 4WE1B 3ISNC 4DL3A 3MECA 4JRQA 2W7OA 4DS4A 3QGGA 3M9NB 1ZBUA 2E4LA 1XHXA 3EY1A 4M45A 3H59A 3O3FA 2FBVA 3QERA 3DDKA 3H5UA 4O0IA 4NLGA 4HYKA 4NCBA 1RTJB 4NLQA 3LP1B 3KK3B 1TKTB 5J1EB 3VQ7A 3T1AA 2C28A 5KFCA 3AVMA 5EWEA 4ZVGA 2RDIA 4DFPA 3KLFA 4CIFA 1FKPB 3E01B 3VQPA 1T03B 2YKNB 1U49A 5D3GB 4I7FA 3RTVA 4WE1A 4CJ5A 1L5UA 4IG3B 4WXOA 5L9XA 4FYDA 4CEOA 3QEVA 1KFDA 2RDJA 4CGFA 1SKSA 1S6PB 4NLUA 3TABA 4IFVB 2VG5A 5F8NA 1U47A 2D41A 3LP1A 3SYZA 4J9NA 4CEZA 4ED7A 3WNHA 4TQSA 1JLEA 2XI2A 4CJKA 4CECA 1J53A 1WNSA 2QV6A 4IH6A 3PW5A 3H4DA 1T03A 3NMAA 4K4WA 4Y2CA 4BE0A 1W9HA 4IG3A 2G8UA 3PX4A 2JEFA 3AA3A 3GV8B 4CGIA 1HQUA 1U04A 1S1UA 3LP0B 1C1BA 3DLKA 3HO1A 1S6PA 4IFVA 3BGRA 1HNIA 2BR0A 4HHTA 3VQSA 5FDLB 3EPGA 2FLLA 2UUTA 4O55A 3PW2A 3O4QA 4GMJB 2ZKUA 1J54A 4NZ0A 3EYZA 3DM2A 2IM1A 1GOBA 1NK0A 3NAEA 2PY5A 1KLNA 1EETB 5KFEA 3LALA 1CZ9A 3TANA 1Z4UA 1KLMB 3V9SA 1RA6A 4ED0A 4IBNA 3S3MA 3CFRA 3O4NA 2B4JA 2IC3B 3IAYA 4F4ZA 4DWIA 1WSJA 3CWJA 3LP0A 3TWHA 4F4KA 4J2EA 3C6TB 5KFWA 3BDPA 2KFNA 2AU0A 4M3ZA 4ECRA 4L8RB 3NF7A 1S0NA 3RB4A 4DTSA 1LWCA 5F8MA 5HBMB 1X1PA 3FDSA 3PR4A 2P5GA 1N48A 4ZP6A 3OYGA 1BISA 4HKQA 5KG5A 5KGXA 4R8UA 1KLMA 1K1SA 2OH2A 2AJQA 1HYZA 1BQNA 4F3OA 2FBXA 3T5JA 5J2PB 3NHGA 4KHUA 2BANB 2FJVA 3SZ2A 1XR7A 4M3TA 3FFIB 5EWGA 3C6TA 5F9NA 4PA1A 1VRTB 4I2QB 4DTJA 2P5OA 1U48A 1RT7A 4N5SA 5T14A 3I5AA 5C25A 1NOZA 1IKWA 1NKBA 2KZZA 2VG6B 1QHTA 4I9QA 1CLQA 3MR3A 3KMQA 3ZSXA 2WK4A 2RN2A 2DTUA 4FJ9A 1R0AA 3PJWA 3HP9A 3GIMA 4RG8A 4FLUA 2A1RA 4Y2AA 1KFSA 4URQU 4ZTFA 1EX4A 4LQ3A 2IJNA 4FJKA 2LSNA 4DTPA 1TKDA 2FVQA 4M94A 3LPTA 4BDPA 2NUBA 4DEZA 3M8PA 2OPRB 2GBZA 3C6UB 1QE1A 1JL2A 1VSLA 1D1UA 1IKVA 5F8HA 3T5LA 1D0EA 4CIEA 1RT2A 4I2QA 2FVCA 2PZSA 1QUVA 1VSFA 1NK5A 1KVAA 2VG6A 3T5KA 4Z4GA 3NCIA 4IH7A 2YNGA 2Z1HA 5KFXA 1RT5B 1X9SA 2J6TA 4XPCA 3V6HA 2XCPA 4X2BA 1JLGB 1C1CB 5FRMA 4J9SA 3SCXA 1I39A 1TVRA 3KLVA 2W9BA 3BR9A 1VSIA 1DTTB 5DGBA 3G0ZA 3VN5A 4F4YA 4DSJA 3M8SA 4Y1CA 3L2WA 3V1RA 3NF6A 3CG7A 4FLZA 3NFAA 3CIZA 3DLGB 5KFDA 2V9WA 4YR0A 3AVKA 2Y1JA 5DLGA 2BQRA 5HRPA 5DQIA 3S3OA 3M8QB 4E1MA 4IRKA 3S3NA 1JLGA 2ZD1B 3L2RA 3DRSA 4DTMA 2AGQA 4CJFA 4Q0BB 1NHVA 2OPSB 4RNNA 2JC0A 4OLBA 4ZP8A 2GV9A 4FK0A 2JLEA 2X6SA 4B8CA 1KVCA 3CDUA 5KFNA 1ZTTA 2FLPA 5J2QA 1NHUA 3CO9A 3QEIA 1S1XA 3OL9A 1FKOA 4J9KA 1VSMA 3D0PA 4FM0A 3VQ8A 4Q45A 3UR0A 2BE2A 4O3SA 2YNFB 3TARA 4KSEB 3WNFA 3MEGB 1S5JA 2ZD1A 4UQGA 4DTXA 3QEPA 4Q0BA 5L1JA 2E9RX 2OPSA 5HLFB 1N5YB 4KV8B 4B3OB 2ZE2A 3OYAA 1C6VA 3OS1A 1ZBLA 3MR5A 4KB0A 4MKBA 3KLIA 3CJ3A 1IG9A 3AVNA 3LWMA 3PY8A 4KHWA 4Q43A 1LW0B 4ED8A 3GYNA 2X74A 3T5HA 3QO9B 4ZP9A 5KRTA 4Y34A 4EZ9A 4CJRA 4FJHA 4J2AA 4ZTJA 1SKWA 2VWKA 1DTQA 4DSEA 2YNFA 3QLHB 4OL8A 3P83D 5EWFA 4KFBB 2XGPA 4CJUA 3PO4A 3L2QA 1BGXT 4C8NA 1N5YA 3K59A 3TAPA 4KV8A 4B3OA 1S49A 4NLYA 1JLFB 2HWHA 2Z1IA 3VQDA 2W8KA 1JKHB 3DRRA 3BSCA 4CF0A 1HYSB 4G1QB 1TAQA 2PYLA 3QO9A 4OKKA 1VSHA 4DSIA 3GIKA 4CJEA 4ID5B 3DLBA 3I0RB 2XY5A 4ECXA 4CEFA 3JYTA 4Z0UA 2HW3A 1KSPA 1LV5A 1RDAA 2JEGA 1QAJA 3DRPB 4O3RA 3QLHA 3SJJA 2BQUA 3AO4A 2B6AA 1Z26A 4KFBA 4M3XA 1JLBB 4CJSA 4ECSA 4ELUA 4ZPBA 3N6NA 5CY4A 1YTAA 5DGAA 5KTQA 2R2RA 1WSIA 3MEDB 4E89A 3OS0A 3V9UA 4CERA 3HPOA 5J2MA 3AO2A 1JLCA 2BRKA 3SV3A 2YNHA 2GIRA 3KK2B 4OLAA 5KFFA
chains in the Genus database with same CATH superfamily
4NYFA 1NSKL 2MZSA 2B51A 4ZA1A 4Y00A 2HF3A 4O5FA 3H3OB 2EC0A 4K8ZA 2ILZA 3UB5A 1TTHB 1REVB 4V19S 3M8ZA 4ZLNA 5BXIA 4BDZA 2CXEA 5C15A 4JI1F 4M41A 1FFWB 5ETOA 1Y9OA 2H54B 4LRAA 1XR5A 2V8GA 2WOMB 1WOOA 3MF5A 1C0UA 3PJXA 1PKUA 2IAJA 2KL8A 2QO3A 2F5GA 3CC2S 3QJJA 3HSZA 4OZ1A 3JAMO 1OO0B 1Q1KA 3VEWA 4B9SA 2JVRA 4PUOA 4ZIWA 2K7KA 3M6VA 3UDLA 4FBTA 4NYZA 1DFDA 4YP3A 4CJ4A 4JUZA 2HHWA 3TQEA 3NMRA 4JK7A 3DXMA 4GV9A 1Q5YA 1ICEB 2UVUA 1JXLA 1GAOA 2HNYB 1O5JA 1WDTA 2QYGA 1T9YA 1GLCG 1NGJA 4RUAA 2XQCA 1O1WA 1IM6A 2P9SB 2DT9A 1JMTA 2I5JA 3S7RA 4K7QA 2QRRA 4A2AA 2HNZA 1RE1B 2GC8A 2PAVA 2GVDB 1FERA 1V3SA 5KFMA 4IWVA 4NLSA 3A3PB 4JS4A 4MK8A 1G6BA 3P96A 2WUSA 2HWTA 4WFAQ 4BE2A 2Q43A 4H0OA 2ZKTA 4CK1A 2DNLA 2BW2A 2NYHA 3NY0A 4C0OC 3IAS9 4NA1A 3R97A 2XS2A 5DG8A 1XMOK 3HSJA 3LO3A 3ID6A 4BQLA 4CZJA 4Y28C 1NJXA 3GCXP 1HNWJ 1HFEL 4M63A 2QW9A 2XY8A 1JXBA 4DV1J 3CW2C 2YPYA 5IWAJ 3FFKB 2YWEA 2W01A 3UD3P 2BJEA 2F9WA 3H6EA 1EO1A 3HD1A 4H54A 4GMKA 1WNEA 2O8CA 4BWMA 5SWMA 3GFZA 2XGQA 1F60B 2DXDA 3FZMA 5GAHI 3TRGA 3QPIA 2VBYA 5KG2A 4IQMA 1DHMA 3PG9A 2CQIA 2BM0A 4YOYA 1W2IA 1GTEA 3N28A 2VC1A 1F5BA 2DITA 5GMDA 1FKPA 3E01A 5KFAA 1XMQK 4GW6A 1GOAA 5THWA 1RU1A 3VEYA 1F3FA 4IO1A 4K4SA 4A8XA 3GG1A 1MW7A 2OO4A 4H0TB 1VBKA 3DYAA 3DGPA 3HLUA 4EBDA 4CFDA 5HRSA 2D4WA 5I4MA 1C4CA 4EBEA 1BU6O 2KG1A 4G65A 4BY9C 1NOYA 1U0SA 5GMEA 1JXVA 3DRYA 1FRJA 4JEPA 2IJFA 3TR5A 1RT6B 2RT3A 2LDYA 2Z2MA 3LPUA 3FEZA 4YDUC 3ZSRA 1EWQA 1RHQB 3OTEA 1OWXA 3CT9A 1HHTP 2VWJA 2GUIA 4OO1J 3PW0A 2JVOA 1VQLN 1RBRA 2AJ1A 3U02A 1M1KT 4URSA 5E2QA 5FDLA 3BF3A 4DLEA 1REGX 4K4YA 4CZCA 2WTUA 3W7BA 1QSLA 2C42A 2ACYA 4M3WA 1TUGB 2R8HA 1PCAA 2CDRB 2RKIB 2AA4A 1OH7A 4RUBA 4AL5A 3DLEB 4ELVA 1TGOA 2QXFA 1Y0HA 5KFJA 1RZMA 2CJAA 4NZ7A 4ES1A 1VSKA 1K8AT 1RWMB 3KHRA 1GLLO 4QW9A 2NXCA 3A8JA 4MDAA 4BR9A 4N7TA 3TO8A 2YHYA 1OPIA 2W9CB 2A6OA 1Q82O 3IBFB 2Y8WA 3WIVA 1GEHA 3KOAA 5M1QA 3CJKB 4QR2A 1T44A 3BKUA 3UWTA 1GX5A 1F3VA 3GU0A 4ED2A 1HNZF 3OYIA 1Y4ZB 3ZCMA 1RCHA 2IS3A 2O8DB 4F3TA 2BANA 2ATLA 1VJQA 2OZSA 4MKYA 4AHTA 3ZLJA 2IBKA 4WFZA 4FWSA 1VRTA 3AVJA 2CQ0A 2K1RA 1WHXA 2HVDA 2B5JB 2E2PA 4C7QA 2V69A 4DR2K 4FPRA 3V9WA 4N8NA 3MM5B 1XMQJ 1VC6A 5KT4A 4DPOA 4B9MA 2VPXB 1T7PA 3SCKE 3VHQA 3SUQA 2LU1A 4GKKF 5FRNA 4C8MA 2XB2D 2OD6A 1YJUA 3JQMA 1GMWA 4JV1A 3HP6A 3ADAC 3H45C 2HFVA 2Q0UA 2HS4A 5KT6A 4F50A 1VR6A 4I6MB 4EFHA 4FF3A 3MM9A 5F2RA 1HNXF 1BIZA 1RT5A 2WSFC 3KWMA 2DCLA 2YKOA 5JMVA 2HQGA 3KUHA 4LREA 3I5CA 1C1CA 3CMQA 1XUPO 1VQON 1KVKA 4ZP7A 2M2BA 2O4IA 2DFHA 5DK5A 1BWEA 2CJXB 3HKWA 1IXKA 1DTTA 3G8QA 2XTJP 2OYQA 4LF6K 1SZ2A 2ASLA 5D4LA 4ZOSA 1LCUA 4DV6K 4KI6A 2B9XA 3TA2A 2GHWA 3VAFA 3MAAA 2E5JA 1Q81O 3IFRA 4O0JA 2XI3A 1XNRJ 3EN9A 2CQGA 1QVGR 1X31C 3R1LA 2ZDPA 3B4MA 5LMUK 4M3RA 4QR1A 2ZWHA 2X3DA 1X9WA 4RBTA 4USMA 3DCAA 3CCRS 4GVEA 3EGWB 2WB4A 1KQSM 4TY8B 2W40A 1HKBA 2HSEB 3ENQA 3CC4N 2IMWP 1GXUA 1ZBHA 3WZ0A 3L4BC 1UOCA 3CCUN 1SCJB 2UUCJ 4J8FA 2G8FA 4CJ7A 5JLHA 5DDPC 2CWXA 2DRAA 2CPYA 5C24A 2DY1A 3QRQA 3EICA 1FRXA 4BDYA 4YB7A 1G1XA 3B6PA 3QIOA 5EY4A 4Z94A 2HMIA 4FBUA 4PXBA 1TMJA 3CCWA 4ZPCA 4B3TJ 1YBUA 5KOXA 5KFUA 2MKHA 3NNAA 4FJMA 6FD1A 2ZOGA 5K20B 4BVOA 4KTZA 1YJRA 2CPXA 4H5TA 4KKOB 4QIWD 1LW0A 4YOTA 1QAIA 3CNQP 2JJ4D 2J0SD 2JLFA 2D9PA 4M5DB 4O3PA 1HI1A 3LDNA 3E9LA 1NK7A 4A5BA 1WELA 1UWAA 4ITSA 4I9LA 3LP3A 3TW0A 3T1YK 3J7Z5 1P27B 3ITHB 4CZEA 4KO0B 1NHKL 4P7VA 2I8EA 4ZVPB 1F21A 3HZGA 3QNNA 1HD1A 3WNGA 1TL3A 5IT0A 1NMDA 1RDWX 1JKHA 2F96A 2YX1A 2XMAA 3PYGA 1S22A 3VENA 3WUHA 5JS2A 5GAEU 1YI2S 3THXB 2E2NA 4FZZA 3S9HA 2HLUA 4ICLB 2YCHA 3SSQA 1W7AA 2C3UA 4U7UD 2ASDA 3G9CA 1RBAA 3OSNA 1K1QA 4QR0A 2F40A 3DRPA 1BUPA 3JTPA 2CYYA 4NLXA 4DV6J 1T9TA 4C97A 4WP9A 3WXLA 4M7YA 4OYIA 4DFKA 4HACB 3D67A 4CIGA 1HQ2A 1FEHA 2DHGA 3U9DA 1NGAA 3D4JA 1JNZB 3W60A 1PSDA 4LQ9A 1YGYA 1SH0A 1IBLJ 2QE5A 3GJRB 1RLDA 3AJDA 5I3UB 1U26A 1LW2B 4DU4A 1UVNA 2Z2YB 4A62A 1GQEA 4RNFA 2U2FA 4U67Q 4IDKB 3ILJA 3OV7A 4DV5F 1REVA 4NCGA 3FUYA 2VFRA 1FNXH 1Z2LA 5B08A 5E5NA 4NLTA 5DM7Q 1XWLA 4FN5A 2QKBA 1KC8T 4CLUA 3P8BB 1HBUB 2MTLA 1RT4B 4ZLJA 1H6KX 4U7BA 1K44A 5M2RA 1F5CA 1IWGA 1T3OA 3MHYA 1UMJA 2HHHF 5CE3A 1G4CA 4GNIA 3Q8PB 4X64K 1X4CA 3R8YA 5IC4B 3IRXA 3PIPL 2F4VF 3OBWA 5DG9A 2UUWA 4Q2LA 2GELA 4BR5A 4UOHA 4CF8A 3V6DB 4X65F 3MXHP 2JEIA 2QA4G 3BH7B 2XWYA 2DHXA 1GH8A 2HNYA 2R42A 4CO3A 5AXNA 1D8ZA 2QLWA 3AVIA 2DR8A 4OPHA 2Z2ZA 2A42A 3VQCA 1CS4B 3AOBA 2AF6A 2GVDA 2XMVA 2QTWA 3TAMB 2IY5B 3ZNUA 1S6QA 2DNYA 1S57A 4H0XB 1JLEB 2IM0A 4B9UA 1H72C 4I56A 2GWJA 2PA3A 4DS5A 4ED1A 2W25A 2VGNA 1VQPS 4FP9A 3SFUA 4JK9A 1X3NA 4EUVA 2AQ4A 4DR6J 1N0UA 3K5NA 3WNEA 1VRUB 1NMNA 1XERA 4HR2A 4U7UK 4J7CA 4YR2A 1HQUB 5ETPA 1HBMB 1URRA 3DLKB 2M70A 4OMFG 3BGRB 3VF6A 3UPFA 5IV4A 3THYA 3OVAA 4USKA 4M3YA 2B4UA 3DM2B 3O5BA 3QZ8A 2J9CA 1C4AA 3CD6N 1T94A 2PI4A 4ANCA 4E3SA 3JS6A 3R9LA 2MEWA 3MWBA 4IOAQ 2X7IA 5HVHA 5DZ7A 2XY7A 4IO9L 2XHWA 3T9NA 3GE9A 1U2RA 3GIJA 1MG7A 4HCBA 4PG5A 4F8RA 5AQZA 2V2VA 4WXWA 3ZSQA 4CF1A 1Q95G 4JHDB 3NF9A 2DISA 1HPZB 1AUDA 2Q6BA 2NR0A 2XY6A 4UY8O 4MT1A 4WCEL 4R25A 4RBUA 3IMQJ 4TY9A 4BACA 3W9IA 2CNOB 1XMOF 4X64J 4NI2A 3HRGA 3RR7A 1BQNB 2GQCA 3VF2A 3AA2A 4OX7A 3AODA 2RILA 1CG2A 3J7ZT 2ASOA 1RT6A 4CJVA 2RU3A 4ZN3A 2OPPA 2DD8S 3D7EO 2GEMA 1RT7B 1IJEB 4BR4A 1IKWB 3B8HA 1SS6A 4OX6A 3C94A 3AV9A 1R0AB 4OHZA 3KD1E 3H25A 2RRAA 3AVGA 3CETA 3BKTA 4DFJA 2Z8QA 3E8OA 2ITGA 4TSXA 3ZEUB 5E3RA 1FKAF 4L3KA 2NPIA 2ZNYA 2E7XA 4DPYA 3HHKA 4BRAA 1QE1B 4MDBA 1A6LA 3RW7A 2IVNA 1IKVB 3CIMA 8ATCB 3KNAA 4J2BA 1HMVA 3V4IA 1W25A 1S97A 1JJHA 3VETA 1LFWA 3L7PA 1T0TV 2OD4A 1NK4A 2ADBA 3MMAB 3O08A 5AQPA 2D3ZA 4ECUA 4ZLPA 2G0IA 2COLA 4Z4HA 4OJ1A 3GB0A 1QQNA 4LT6A 2RQKA 3AQPA 5A2QY 2CGLA 3NGIA 4DR7J 4NX9A 2V4RA 4CZIA 3CJKA 2YI1A 3J80U 3WQPA 3RRHA 2GVZB 1B70B 2OUGA 2QLBB 3MD3A 3HXMA 1X9JA 9RUBA 3NAIA 2MHEA 2V6AA 4JV5J 3R7NB 1RDBA 2HFZA 1YSJA 1Q53A 2W24A 5L1IA 1EB0A 1VHFA 3K7RA 2B5JA 2IDEA 4DSFA 1R89A 3DLLQ 3I96A 4N76A 5AFUA 3MM5A 5IS2A 2HOEA 2DTJA 1NH7A 1ITGA 5SZTA 2ZJPQ 2OEJA 4P72A 3H7HB 5HO4A 4GKJF 2XHCA 4CGHA 1D9FA 3LDSA 5J2QB 4WFNQ 3O6WA 3MWPA 2GWKA 2MMYA 4P71A 2EX3A 1BHLA 1JJ2M 4ZVUB 3Q22A 2SXLA 4QOZB 2CZ9A 3RGIA 3TAQA 3FNNA 3OL6A 5CZ1A 3JSMA 4C3LA 3A8KA 2CQ3A 2HMPA 4QIEA 2W42A 2ZE2B 1U8WA 3OHAA 4JKCA 3KKFA 1ZBTA 3DFEA 1IR0A 1HNVA 4FXWA 1TKXA 4KIAA 2V5HG 1KHVA 3NGDA 2WAQD 2WVBA 3BYPA 3K2YA 4DR3K 4KBIA 3Q23A 4BRDA 1JCEA 4DR2F 3AGKA 3QSYB 4ISFA 1RHUB 2LA6A 2VQFJ 4YOXA 3EKSA 1TL1A 5C42B 2CPFA 5FD1A 4IH5A 3MXIA 3VEXA 4ENOA 1N5SA 4KHNA 1IKXA 3IP0A 1SL2A 3SBMA 1N56A 1S12A 4F3QA 4LF4F 1Q4RA 4OI1A 1FEEA 4YEAA 1ZTWA 2L9WA 2BTFA 4LSLA 4HH1A 3K2PA 1P9YA 3JYTB 2XYPB 3FSXA 1FRIA 5IOLA 1LOUA 2E6LA 3CCJS 3WXKA 1RYRA 3VZIA 1FJCA 2PA8D 2QL9B 3ZSZA 1XQSC 4O8KA 3O1WA 4V1Ak 1XR6A 1U7LA 3VR1A 2VGMA 5AQVA 3AOCA 5AE1A 3UVJA 2CQCA 1VBYA 2DY9A 4OJ3A 4F2RA 3BF1A 3VCDA 1X5PA 4ETXA 3CJQA 2BE7D 4JV0A 1BCMA 2E5LJ 4DV7K 4PYDA 4LF6F 4CHQA 3MK6A 3D6MB 2YNHB 1DURA 3I4PA 3NLCA 5KFQA 4JI0K 3G6XA 3FSYA 4JI6J 5HP1B 4LR7A 2FZKB 5A6WA 4WF9L 4FJ8A 4B9LA 1VK3A 1VAZA 4M5DA 3OR2B 2MKCA 5LMUF 1NPRA 5EGYA 2JC1A 1T02A 1JX4A 1GT8A 5BJRA 3TPQA 3F41A 3CF5L 2DBBA 1RBLA 4FSVA 3DDNA 2AYMA 3BSNA 1LWEB 2P9IB 3W2WB 1SC4B 2QA1A 3ZZPA 1URNA 2A10A 1JL1A 1BI4A 3B4DA 3SXLA 1TR0A 1D3WA 2DYAA 1GLBG 3THXA 1GTHA 4BRHA 2DPIA 5BR9A 4KTQA 3E51A 2JNJA 1WSHA 4EP5A 4ICLA 4LF5J 1UAWA 4E7LA 2VODA 4B1YB 2V51B 2OTJN 1RBTA 4ZDNA 1QAYA 1FE0A 3O9QA 1IV0A 1YF5L 3AO3A 2ROPA 4DUZJ 3IM9A 4WIQA 1NKCA 4HACA 1K0TA 4GO5X 1IKYB 4PG8A 3A3OB 5CZXA 5B09A 2HKEA 2LXIA 2DIVA 2VG7B 1S0VA 4LF7K 3T1YF 1R8CA 2N7YA 1LW2A 2VICA 2CPZA 2QT7A 5B0AA 4O44B 2ZVSA 1TYQA 3ZETB 4CYUB 3QIPB 4ECZA 3MECB 4IDKA 2QL5B 4W5NA 4DX5A 2OTLS 1WBDA 2Y0SD 4W5RA 5C5JA 4JI8K 4WK3A 2NUUG 4A8YA 2QA4N 5KG3A 1LWFB 4CZHA 2QLJB 4FJXA 2D0CA 3EKUA 3QB0A 4U9RA 3SCJE 3I82A 1GOCA 4AUKA 3EZUA 5AQTA 4JD2A 3DOLA 2Q3SA 4AHVA 4JI5K 2HQDA 1TELA 5EX5A 2ACMA 4CH0S 4JKGB 2LEBA 4HT7A 4WE1B 4DL3A 3J81Y 2CQ1A 4DS4A 4F3MA 2E4LA 3H59A 3GSDA 3O3FA 4ZPTR 5FPNA 4RTFD 2CNLB 4NCBA 1RTJB 2HURA 4NXMF 3LP1B 2E7VA 5J1EB 3I6PA 2C28A 1MWMA 4DMZA 3BGOP 1HKAA 5EWEA 2YJEA 3R5CA 2OSRA 1WSVA 3JQJA 2O1PA 3E2EA 3MUTP 3DLJA 1ULRA 1TUVA 4WXOA 2CPDA 5L9XA 5LXYA 5MLCV 1CS4A 2CH5A 3VAJA 1GLJO 3IR5B 2I0XA 3TABA 4B3RF 2MQMA 1CC8A 3CD7A 3M1VA 4BRPA 4J9NA 4IDHA 2GJFA 2G1HA 2HSTA 1JLEA 4CJKA 4CM2A 3PW5A 4DR5J 3H4DA 2P9LB 2E20A 3W2VA 3GV8B 2DJWA 1HQUA 1AB8A 2EG2A 3R7SB 4YHHK 5KPTA 1HBMA 3A5OC 3DLKA 3BGRA 1VQ8S 3C65A 3BBFA 4EI2A 3GIRA 3EPGA 1DZ5A 4FOEA 3TZXA 3EYZA 3DM2A 2D9OA 1AZSB 2Y9HA 3NAEA 1EZZB 3TANA 3V9SA 2NZTA 3UE2A 2UXCK 4OI6A 2IC3B 3IAYA 4DWIA 2WW4A 3TNVA 4BC4A 1G3OA 4JI8J 3LP0A 1FWLA 3BP8A 3C6TB 4AXJA 1N88A 2K3IA 2KFNA 2IYIA 4WK1A 5HANA 3CCQN 4NMLA 4OX9F 4L8RB 1Y3JA 3ULEB 1WACA 4JKEA 1VS3A 3ZTQA 3JAMU 1X1PA 3FDSA 4JI5J 1N48A 3IAM9 4HKQA 2BOAA 3MPUB 1U1QA 2RQCA 1KLMA 4YOUA 4JKDA 1BQNA 4LBPA 1XR7A 4FYVB 1K9MT 4BS2A 5F9NA 1WTBA 1Z6RA 3MPYA 1RT7A 4B1ZA 5T14A 3I5AA 1IKWA 1NZAA 5CCLA 1CLQA 3MR3A 3ZSXA 1XEZA 1R0AA 1ZBSA 4FLUA 4OLOA 4URQU 2IVOA 4ZTFA 3CJ1A 2QLFB 4NASA 4FJKA 2VQEF 5E0OA 3N9UC 3QFHA 1X60A 3MDQA 1YJ9S 2W2PP 3HHDA 2IBOA 2FVQA 4M94A 4LVNP 3LPTA 4NO7A 2HHPA 1FTCA 1IBMJ 1RISA 2BM1A 1YHQS 1Y3KA 3CC2N 3C6UB 1QE1A 1DQ9A 3HSGA 1R59O 1IKVA 5F8HA 3PXGa 4CIEA 1TUYA 4I2QA 4EMDA 1NK5A 5IT9O 2VG6A 2UUAJ 2Z58B 4D3HA 3IR7B 3MN6A 1S6OA 3ET6B 2ZWOA 4M5GA 1RWWB 3NG8A 2VDHA 3UKRB 3SBGA 3GTYX 1RK8A 3GFYA 4LF9J 4UF4A 5B8HA 1I39A 1NAQA 4B3MK 3BR9A 1VSIA 2OEMA 4F4YA 4DSJA 3M8SA 3AAQA 2MJUA 1RWPB 4IOXA 2AW0A 3HHLD 3D1QA 2GVZA 3T9ZA 2V9WA 3OBYA 2ZM6F 4DN0A 1QM9A 3M8QB 1VQ7S 4DV0F 3MX5A 2LXUA 3EWGA 3L2RA 4DTMA 1WKLA 5CZVA 4LFBJ 1Y7PA 2C3OA 3TX8A 1I94J 4ATNA 3CQXA 1X4BA 4NE9C 2P9UB 4N8OA 3TJ9A 1OY9A 1ZTTA 3H3NO 2B9WA 1SVDA 2B7BB 5J2QA 3MM8B 4PG6A 4ED4A 2RS2A 4M5KA 1XMBA 2FSNA 1SQFA 1VSMA 1N32J 2V2QA 2RDDA 5FJ4A 3VQ8A 2YX6A 2ZGZA 5T7LB 1OH8A 4O3SA 3KVGA 5HMWA 3MEGB 3WNFA 3U1MA 3SSRA 1YAGA 4Q0BA 1N33J 2OPSA 3SLCA 1M90T 5G0RB 5GIPA 1ZM2A 2ZE2A 3CD5A 1OSCA 4MKBA 3R7BB 3CJ3A 3CXCM 1IG9A 3R6MA 1BC6A 2G2YA 2X74A 5L9NA 4EZ9A 3LGNA 5AQOA 1RFQA 1WKJA 3HHLC 2VKRA 2QEXS 5M1OA 4DSEA 3ILOA 3M6WA 1H3DA 2O8EB 2NS1B 1MLAA 5EWFA 2BUNA 4CJUA 3L2QA 3TAPA 4KV8A 4USTA 8RUCA 3W8GA 2Z1IA 4DCHA 2IDLA 1HBNB 3Q89A 5ETQA 5LJ3Y 3GOIA 1V5IB 2MKYA 1LK5A 2PYLA 3QO9A 4OKKA 3DLBA 4WTOB 4ECXA 3JYTA 5D0RA 2DNKA 1V5VA 3AHPA 2HW3A 1FW6A 1KSPA 4X62K 1LV5A 2NZCA 2GGPB 1SB6A 4B3MJ 4OHWA 2V8PA 4ZVRB 3Q24A 1JLBB 4BRIA 2UV8A 1DY3A 1JNRB 3POTB 3OS0A 3V9UA 3ZTOA 2OKQA 4OHVA 2GAHC 2B4PA 3T6JA 2BRKA 2ZZNA 2YNHA 3C14B 4DR3F 3KK2B 1WF0A 1QVGM 3H5XA 2QMUB 2AD9A 2UUBK 3EJMA 3LP2B 2LVWA 4UUWA 5A0YB 1J2VA 1JLQB 4NYOA 2Q3PA 5E84A 2VA3A 2KKZA 5KFBA 3OR2A 1U1NA 3P3DA 2GIFA 1DQAA 2KRRA 1FDNA 1HW9A 4DFMA 3FRZA 2WVDA 2OA8A 1RYSA 3MN5A 3N4WA 2RB7A 2DPNA 2DXFA 2RH3A 1IH7A 2ZEJA 4ECYA 2CVIA 2XCAA 3ENHA 2P9IA 3W2WA 4B3SK 3AJ2A 2OLWA 2A2DA 2VWBA 4BGBA 3SQOP 1FXRA 2CQ2A 3EE3A 3PYDA 2CJ9A 5D4PA 3TUIC 2MGZB 3HI0A 2Q36A 3FLCO 2BOPA 1YBTA 2F9DA 4ZVOB 4DV7F 1KD1T 3SDEB 4J9LA 2PT0A 1XNQJ 3RAQA 5JS1A 1FFGB 3EEQA 1OS5A 3FMWA 3TR8A 2BQ3A 2HVHA 2LQ9A 1VFJA 1GLAG 5KQ8A 4JI0F 2HNDB 2W7AA 5FPMA 3H2LA 2F1FA 4DUTA 1CEZA 2XLKA 1YIJN 4AQYJ 3MFIA 2VG7A 4LF1A 4GVBA 1RAOA 1HJRA 1UZDA 1JJCB 5CYMB 4FOIA 2D0AA 4BGAA 2F8SA 1WHVA 2UYTA 2HQCA 3PX6A 4CW7B 1B9FA 5ADXH 3H20A 4P10A 1S72S 1AFIA 3H5SA 4CYUA 3QIPA 2R8JA 4AM6A 4HUFA 4A57A 5KFVA 5AQKA 4EO6A 1WOQA 5JUMA 1X5OA 1QHAA 1U09A 3ZYYX 2MZQA 3WIUA 1S77D 1LWFA 5IXUA 5TKYA 3I0SB 1SH2A 1AT1B 4ERDA 4KHSA 4QWAA 4C6AA 3SUNA 5EDWA 3MUVP 1S1VA 4LF2A 1C0FA 2DNPA 3QYYA 4H4KC 1EKEA 1F5AA 4LUBA 3R5AA 4G6VB 3WC0A 1LAWA 1RAFB 2UUBJ 3I32A 1NK6A 1HWJA 5F8JA 2VYPA 3OTOK 1RTJA 4LF7F 2A3JA 2MY8A 5J1EA 2VASA 4I64A 4LFCJ 4LIRA 4MIBA 5LMNK 4TKTA 4RW6A 3N6MA 2W1BA 2GZOA 2CPIA 1IJJA 5KFIA 3OQ2A 3W9JA 4FZXC 3NGKA 2YKMA 3ZSOA 4KH6A 4QWCA 4BCAA 4MK9A 4DQ8A 2IRXA 5A8RA 3B6BA 1ZBFA 2FPHX 3VESA 4P7TA 2RF2A 2BJDA 3J7YI 2M3DA 3FCHA 4LFAJ 3GE1A 3AJ1A 4CHZA 1W26A 3NMUA 1FJEB 3N4QA 1H2UX 1DLOA 2VOOA 4RBVA 4XDCA 3KKRA 1HR0J 3BO3A 4ID8A 4DPWA 3D3BJ 2P9LA 4CESA 2W2NP 1F6TA 1BD6A 4DG1A 2ZQBA 3MDFA 2UXBJ 4CBUA 2HVIA 1ZPVA 3WC2A 1JLAB 2VFUA 1W97L 1KN6A 2CZ4A 3UQSA 1YI2N 3D66A 3K8VA 1WC0A 2HAIA 2ZZTA 3CJ9A 1SL0A 3L7UA 1IUJA 2O3DA 1B0TA 2FJAB 1AZSA 1KAXA 2ZBCA 5BPNA 1TK5A 4KHYA 4O23A 4ZMMA 3W5XA 5EX0A 3MN9A 3KLHA 1JIHA 2KRBA 3AVCA 1Q16B 4F4WA 4TXSA 2IC3A 5L39A 3GV5B 5DS7A 3ENWA 5CD4A 3EE8A 1UWBB 5HMYA 4RW7B 3LPYA 2BMBA 3OFEA 4B1VA 2C2OB 4WBFA 4X4QA 4Y6IA 5L1KA 3VAGA 4QW8A 2WONA 5GAGI 4Z2XA 3HYFA 3T41A 1CZBA 2XSJB 4L3QA 4WQ4C 2P6SA 4YHHF 4QPXA 1HIYA 5LL6d 3VEOA 1HRHA 2D0PA 4BRNA 4J9UE 4E1NA 2W6LA 5CYQB 3A8YA 4RUCA 4CGJA 1K73O 3K17A 3V81A 4KAIA 1SIWB 1QTMA 4FJGA 3WQUA 1RDCA 2ZGYA 2OPQB 2VJUA 3GWCA 4DV2K 1WORA 4HTJA 2ZBPA 5LMNJ 2FD2A 1WF2A 2WFBA 3VGTA 1B99A 1SC3B 2R2SA 2ZDOA 4OJRA 4FO0A 1IR2A 2MHNA 2UXCF 1TK8A 1MU2B 4AHSA 3KUGA 2JL9A 2I2YA 4IQXA 3LQVA 2FHKA 1NJYA 2HK3A 3C6UA 3EM1A 4ZVFA 1S3XA 2FJWA 2C22A 3LGHA 2JZ5A 2V0NA 3KHGA 1ITPA 4Y65A 3HZ6A 3VAKA 4BR7A 2D3OR 4DTNA 1Q82T 3NWRA 1BQMB 3PDNA 2BBEA 3R2CJ 2YWWA 3Q7CA 4V19J 3PJ9A 5DQHA 4OPKA 1U1OA 4U95A 3MCPA 2C2EA 3UKRA 4O4GB 3ZZTA 1NJIO 1KHWA 1X8DA 1Y5NB 4OLPA 4DSLA 2I6WA 4CWBA 1NU0A 1M1HA 3CCVN 2QFJA 3DOMB 1NNDA 3X1LB 3CSKA 3PIPQ 3RWUA 3PIOQ 4MK7A 4Z7CA 1M5VC 3RAXA 2NSCA 3D1HA 4EAHD 4LF8K 4B1XB 5BRDA 1QZ5A 4JYAK 1HL6A 2KVIA 2B4VA 3MCOA 4C8LA 3M8QA 2RMLA 4RR5A 2E66A 4P2XA 1YZ7A 3CJ2A 1S9EB 1Q86O 4ZS6A 1HW8A 2IFXA 2GIQA 5KFPA 5D77A 2WC9A 3R1XA 7FDRA 3TQ1A 4WFXA 4ECVA 2DK2A 1UEUA 3RR8A 3H5YA 2P9UA 1OMSA 1N8RO 2CGJA 3THVA 2Z1GA 1XN9A 3W3SA 3M6XA 3DJCA 3MM8A 4RW9A 2XM3A 3BUZB 4C1NK 1NJZA 4IYQA 1E6VB 2L3MA 2B7CB 4QYZJ 3MEGA 3KK1B 4RW8B 3LDOA 3PV8A 4ED5A 4M7XA 4PPDA 1HHQA 2LKZA 5G0RA 3OSPA 3OL8A 4YOEA 3GR1A 4LC9B 4K2XA 2N82B 4KTWA 2W7PA 4DV2J 3ENAA 1FRMA 3UR3C 4G3IA 1UW9A 3QBWA 5CQGA 4FYWB 1HX1A 3AO5A 3CCZA 2L9NA 1Q81T 2D7SA 3ZT1A 2P9KA 1RDRA 2KDOA 1N4LA 2MZRA 2ZUAA 2ZC3A 3ZZYA 2E5IA 4NLRA 3N01A 3CQYA 3ZT3A 1KKHA 1FNMA 1HKCA 2BJ8A 1HBNA 5JICA 2LDIA 1UA0A 1BQXA 1OKJA 1KNZA 1RTHB 3QFPA 4IOBA 1UW4A 4IO9Q 4BWJA 1Q8IA 2NRTA 3RAMA 1KDNA 1WG1A 1RWKB 1S79A 4IR9A 1ZM3A 4H4OB 2KT5A 2GGPA 4H4MB 3IBCB 3KWGA 2EFVA 1UCNA 1S1TB 4JI4J 2F8MA 4NCAA 4H5NA 2X1GA 3TVZA 2J0WA 5H9EJ 4RNHA 4CZKA 4LF8J 4MIAA 4IKAA 5ETMA 3EZWA 3CCSS 4UY85 5B0FA 3G4SS 3D45A 4IFEA 2YHXA 3DMJA 3C14A 3KK2A 2MLXA 3CB4A 3H08A 3HX9A 1N6QB 3HTVA 2A5XA 8AT1B 5KFKA 4I2PB 1RTIB 1H0HB 3LP2A 1TU0B 5A0YA 1JLQA 4YB1P 3D2WA 2YNIB 4GRSA 1FXLA 3OFGA 4FNIA 4J9RA 1V6HA 3GJSB 5H1SQ 4CHPA 2NXUA 1ASUA 1S1WB 1RDDA 3ZZ0A 4JI7F 4Q7AA 4WQ5C 3PEJA 1RT1A 2IRYA 3ZSYA 3SCIE 2ZJPL 5F8GA 1TKZB 2Z0GA 1MWKA 4FKXA 3RW6A 1D09B 1TP7A 1FTRA 1Q79A 2VD3A 4BRQA 3GILA 1YJ7A 4UOGA 4X62F 4CH1A 4WFNL 2QN6B 3CCMS 2DO0A 5F9LA 4JI1J 3A8IA 4FLWA 4PQUA 5M2PA 3B8AX 1RLCL 2XG8A 1MA9B 3OT9A 3UE5A 2MGZA 3L3UA 2R2TA 2FQQB 2VOPA 1H1VA 4FJ5A 3TZYA 3B54A 2AV5A 1FWPA 4TNOA 2V7ZA 1WF1A 1WUUA 1K6YA 3O8WA 1PC4A 4BHQA 4C3KA 3AB2B 3QGPA 1G2EA 4CF9A 1HYVA 5AJ3K 2OSQA 1XHZA 5HL7Q 3K5LA 2CUYA 4E98A 4DDFA 1ZETA 2EW9A 4AE5A 5E3QA 5CYMA 3PKMA 3D2FA 2EWHA 2HS3A 4HVZA 2V8HA 1VQ4S 1OVQA 2HHTA 1NGFA 2RRBA 4OYXA 2K06A 2AX0A 2IA0A 3D28A 5D78A 2YVSA 2F65A 3ZXWA 1GX6A 4CD1A 1TL7B 4BE1A 4B3SF 2HK2A 2FVRA 4CFCA 2UU9K 5BRFA 3BBBA 3M32B 1SJQA 1PYTA 2KYZA 5IFMA 2FDNA 4X4NA 2I1RA 3G6VA 2OANA 3AA9A 2F7TA 3NOCA 1C1BB 2QM1A 5DQGA 1YWXA 5M2UA 4RWWA 2W4DA 2QI2A 2WZ1A 4JI3F 2AP6A 3Q7BA 1I3OB 3I4HX 2XMUA 3CFOA 1RGIA 4OVLA 2ZITA 3O8MA 3OHBA 1PJ6A 5DLFA 4TU7A 3PZPA 1VK8A 3FCWA 5HQMA 4A4JA 4KPCA 2BJ1A 5KFRA 3EUNA 2C3YA 2NRVA 2LFVA 4X4VA 2KXHA 1RHRB 3I87A 5H9FK 4I6WA 3M1FA 2ZH7A 2G8HA 5GAEP 3V9ZA 1FRKA 5GVQA 5BRHA 1WN7A 1ATRA 1Q9YA 1GMUA 4CJTA 2NQPA 1PYSB 2DEJA 1Y5LB 1RHMB 1BDGA 4PWDA 4TYBA 4L76A 4OPJA 3F73A 3OYHA 2JWKA 4LD0A 3GJQB 2GMJA 4BBYA 3FVYA 3SQGB 5L38A 3CJ5A 1NXIA 3G10A 4GKKK 1HWIA 3NGYA 3SK3A 2AEJA 4BG8A 5C25B 3GZ7A 3PRDA 3H2UB 3OJSA 3W5YA 1U1RA 1RB0A 2PMWA 1JJ2R 2IHR1 4CJPA 3GMGA 3OTOF 3HOSA 1WOPA 4FJJA 4H0PA 1HNXK 3NH2A 3QWPA 3PX0A 3KXDA 4ZVTB 5AQRA 4BC2A 3M8PB 3RU0A 1U4BA 4ES2A 3M2UA 3CM6A 4WF9Q 4DX7A 2B9EA 1RT2B 2FSJA 3K0JA 2ZWPA 2GO8A 3D6FB 2HFSA 3PUFA 4FWRA 1WEYA 4A5AA 4C48A 5CHIA 1T9VA 3VGKA 4CHYA 1KBRA 2YNGB 1UWBA 4BLGA 1LXJA 4RW7A 3CF5Q 2KU7A 3M05A 1OY6A 2IIRA 2EFOA 2NXJA 1VQNN 3U6FA 2APOA 4KB1A 4QIVA 2W9BB 2BV3A 4R0EA 3KWIA 3SIPB 4I69A 4CEBA 2CQHA 4NLBA 4TU8A 2XSJA 3H2VE 3H42A 2W2MP 2FC8A 5DDRC 2PE8A 5CYQA 5KFOA 3VAIA 3O9TA 3DOKB 3NGTA 1PJ7A 3KKSA 3D6RA 4PKIA 2OPQA 3T1HF 1HNZJ 3K8WA 3NF8A 1HUXA 2XS5A 3I56N 2R8GA 1HQEA 1JWWA 4BG9A 1CJVB 1UFLA 2RVJA 3LAMA 2UXDF 1NZ8A 2M8HA 1MU2A 3MM7B 3KHLA 1S9FA 1CJTA 2J7KA 4ES3A 3MI7X 3K5OA 3HFVA 4UZBA 2ATQA 1EX8A 1WI6A 5GINA 3G96A 1U25A 4QU7A 1C2PA 3NS5A 3CDEA 2G2ZA 4XEIA 4A59A 4X4PA 3E3XA 2LYVA 5KPRA 1BQMA 1UAXA 4GKKJ 3GDQA 3PEHA 1IO2A 1DARA 3T6BA 2M5YA 3CJ0A 1TAUA 1SUQA 1CBKA 1G15A 1BCOA 3HM8A 3KLIB 2HZCA 3FGUA 4O4GA 4GVMA 4LR9A 3TUPA 1BY9A 1FJ7A 4MMOA 1T9UA 1Y00A 1RWNB 5A8WB 1UJ4A 5FROA 2MKIA 3DOMA 1BMQB 1HNXJ 2L41A 1DTQB 4BRLA 1HARA 2DGSA 2F8HA 3CMAN 4B9NA 2ROGA 1OQ6A 3FZFA 1CPZA 3W62A 2P5VA 4CJQA 5ADZA 5DJBA 1WAFA 4LRDA 1WSGA 1QSYA 4FWLA 1UFKA 2O8FB 4FM2A 3Q83A 4QIGA 3HK2A 3HM9A 3DRRB 2GAGC 4EYIB 2X1FA 2VBWA 1R8AA 3U3YA 1A5VA 3BSAA 4LSNB 1S9EA 1RAHB 5CABA 5LJ5Y 2NLXA 1RBSA 4J2DA 3NDKA 1R8BA 1M5SA 1GLFO 2FGCA 3O9UA 2VUGA 1J6ZA 2ZC4A 4EBCA 1YVNA 4ZHRA 1GMWD 3SBTA 1H38A 2FF3B 4JNEA 4JOUA 4WP3A 3EGNA 2BYCA 4MKAA 1K8KB 1E6VA 3FZLA 3SI6A 1IVZA 3MXJA 4KRWA 3NE6A 2X1AA 4ZVHA 4FJ7A 3KK1A 2DNOA 4DMNA 2IM3A 3L3VA 1OIAA 1JLCB 3BKFA 2WBRA 2E1AA 3SQ0A 2WVCA 3O1BA 1KC8O 1CJUB 1GNKA 4ECQA 2XHBA 3HFZB 3QBXA 1BWVA 1VQLS 1NMEB 4DQPA 4HHJA 1EXQA 1FJGK 5T7BA 3HPHA 2OAUA 4JYAF 2HHHK 2CJQA 2ALZA 1U1PA 1ZAWA 3KZBA 4LRBA 2JLGA 3TVKA 1DEJA 2J7UA 3GV7B 4K8RA 1L3SA 3ZT4A 2F4VK 3AVAA 5EU7A 1FDDA 4IOCL 1PAEX 5HRRA 3N4PA 3TUZC 5IT9U 2VL1A 5BPMA 1IBKK 5D6GA 1N5QA 3D5MA 4CJWA 1NPPA 4X65K 2DR5A 2ASJA 2EK6A 4KPYA 3KJFB 3HVTB 2IJRA 1FVSA 3BQ2A 1NH8A 5I3PA 3TEHB 4DN9A 3FQKA 3HJVA 1YX2A 2NPFA 3EZ5A 1R6YA 3ISND 2HGMA 2I38A 4DL2A 3K57A 4MKVA 3ZSVA 4H4MA 4N41A 1A7GE 2X78A 3CMEN 4ILLA 4KC5A 1CLFA 2P9NA 1S1TA 1SH3A 2CNKB 1J5OA 4KGZB 2R3VA 2LXFA 1AROP 4CK3A 1U6BA 1E3MA 2E2OA 1NKEA 2EKNA 1Y5IB 4IRDA 3CM5A 3NCRA 2LQ8A 5EN1A 3GR0A 4PL8A 4DQRA 1N6QA 4ZK7M 1VDHA 4I2PA 3W61A 2DH7A 1NGEA 5K8MA 3RMBA 3MR6A 2V68A 2MB0B 1ZC6A 2QK9A 2HQFA 1VQMS 2D74B 2MDAA 3W64A 1YJTA 4CT9A 2WHOA 1TFYA 1F0XA 3MR7A 4AHUA 1P1LA 4PKHA 2P51A 2FGOA 2CQ4A 4YB5A 1O0PA 2RIJA 3Q8RB 4IG0A 1TKZA 2BACA 3TEGA 4QS7A 1WEXA 3ENOA 3RVCA 1T95A 3CJTA 4DV5J 4C0BA 1Q78A 3FBEA 3AA5X 2Z1JA 3J7AP 4CQ1A 3CCEN 1NLKL 1VQ9N 3M9OB 2NRWA 5JXSA 3TP2A 3ISNC 1VQOS 4ILMA 2E44A 1M5HA 4A61A 4TVAB 3M9NB 2AKWB 2D1CA 4M45A 4OHYA 1BO5O 3QERA 3CI5A 3H5UA 2JDJA 4O0IA 2HHHJ 3FRYA 3KK3B 4KGVB 4LJMA 3G87A 3NNCA 1E6YA 4DFPA 2F4VJ 3J80Y 4DX6A 1WB9A 5LT5A 3TZZA 3A13A 3VQPA 4J90A 4YDXA 3FZ2A 3RTVA 5EVZA 2C3PA 4X65J 3RJMB 1S6PB 4NLUA 3PKYA 1MMDA 5DRKA 3CC4S 3AQOA 4EWTA 4I4BA 3CCUS 4FWPA 1CVJA 3SYZA 3QMLA 2I9SA 2XI2A 1TL7A 4CECA 2DGQA 2H5JB 1J53A 1WNSA 4IH6A 3B82A 1F9HA 1T03A 1EKRA 3D6TB 4BE0A 4IG3A 1S7HA 2AP1A 2JEFA 5LJVA 1U04A 3MOJB 2XYHB 3MAHA 4OJHA 1NGBA 3OD2A 1C1BA 4O8UA 1SC6A 4IFVA 1V4SA 1RSCA 4B02A 2Y0BB 2BR0A 4OPAA 4HHTA 3VV2B 1TMMA 2HIQA 3O2IA 2FLLA 4O55A 3PW2A 3AD8C 4CDIA 2CQBA 2VU5A 1VQ6N 1J54A 3FR0A 5FLXU 3MMBA 1GOBA 3EXCX 4KGXB 2VH7A 5AJ3F 4CTAA 2GUPA 4RWXA 5KFEA 3FBFA 3UKUA 4K43A 3UDVA 2H65B 2N3LA 2B4JA 3OXLA 1F9EB 4Y2IA 1WSJA 2GV1A 4PXEA 3N5BA 4F4KA 3A5NC 2AU0A 4KHPF 2KVQE 1KS2A 4AT1B 4GO7X 1I1GA 3I55N 2KN4A 1X0FA 1RTZA 4CVNE 2UU9F 4JKFA 2GHVC 4CZFA 2DB1A 5K9FA 3PR4A 2DNGA 1N36F 2CA9A 4RLEA 4FWMA 2PN6A 1BISA 2RAQA 5KG5A 5KGXA 4GKJK 1K1SA 4CNYA 1HYZA 3VERA 3H1QA 2PMHA 3S8SA 5ETRA 1U2VB 3FFIB 5EWGA 2ROEA 2IVPA 4OJGA 1RKIA 4PA1A 4DTJA 2P5OA 1U48A 4N5SA 1XMOJ 5C25A 4RWTA 2P8IA 4I9QA 1Q8BA 2RN2A 1UEKA 4USHA 2DTUA 3BN4A 3PJWA 3GIMA 3UD4P 3GJTB 4PG4A 3TTCA 4LQ3A 3E66A 4ILGB 4DEZA 2NUBA 3M8PA 4HL9A 2OPRB 4MLHA 4DPTA 2YWHA 5C2CA 1N34K 2E29A 3AD7C 1VC5A 1JL2A 1VSLA 2HBYB 3T5LA 2GQ2A 1WDDA 3CXCR 1RT2A 1BUXA 3H90A 4E1JA 2FVCA 3FJ2A 3O9RA 4Z4GA 2YNGA 4YY3F 1ATNA 2HF4A 1EARA 1ZM4A 2FJDB 4DR4F 1X9SA 2J6TA 1VGYA 4XPCA 3S1TA 2V2ZA 1JLGB 4J9SA 1V3RA 1EQMA 2O8BA 4LF4K 2E5GA 2W9BA 2GX8A 3ZO7A 2J9DE 4WU3A 3MN7A 4PWUA 2V52B 3ATUA 4Y2KA 1R31A 2DGUA 3V1RA 1S72N 4A8OA 1MDUB 2DNNA 3DLGB 3MWTA 5JJBA 3AVKA 2FHJA 5HRPA 4OV6A 2RU9A 4OI3A 2LQBA 2Y8YA 3S3NA 3OVBA 4NL5A 2PEHA 3OW2M 1S6UA 1MNEA 1UVJA 2BEFA 3QBCA 4OLBA 5JVHL 1CULA 5DZ6A 2X6SA 1CJVA 2HBLA 4HHHA 2ZF5O 5AQHA 2FLPA 3MM7A 1NHUA 3QEIA 4WJBA 2P9PB 4BC3A 1J5EK 3DDIA 1VC0A 3KJNB 2N7CA 2H4WB 4OYOA 3B78A 4Q45A 4GKJJ 2G13A 1VLOA 4P2MA 2VDIA 2H1YA 2ZD1A 3DN9A 2V50A 3ZC4A 4ZPVR 1LK7A 3JSYA 5L1JA 2ZFHA 3C3LA 4B3OB 1VHIA 2EPIA 1ZZFA 4KB0A 4USVA 4F26A 5ETKA 3KLIA 2VKZG 5K5MA 3LWMA 2HVZA 4Q43A 5CR4A 3KG0A 2P9GA 4ED8A 4X4TA 2F4FA 1QQOA 5KRTA 4CJRA 4IZ9A 2MKJA 3QDKA 4J2AA 4ZTJA 1SKWA 5M1FA 1DTQA 1PBUA 3CD6S 2YNFA 2RE1A 1F2GA 1A0OB 5BPLA 4OL8A 3C2PA 4KFBB 1RAEB 1N5YA 1WOSA 2YWFA 1QTNB 1V9OA 3DXKB 3FCVA 4NLYA 1JLFB 2HWHA 1SJ4P 2W8KA 3DRRA 3BSCA 3LDLA 5HVGA 3OR1B 4DR2J 2DHHA 3O5TB 4G1QB 3WXJA 1IBCB 5I3QA 4ID5B 5DO2A 3I0RB 2XY5A 3N5FA 2YJFA 3V2UC 4CEFA 3Q2SC 4NA3A 4Z0UA 2QLXA 1CC7A 5KAKA 2QWLA 4LF4J 1S76D 2NRHA 3QLHA 3IO1A 3SJJA 3AO4A 1VLYA 3NGUA 1D9AA 4BRMA 1K8KA 5CY4A 1YTAA 2HLTA 4ZVQB 3L4IA 1NSAA 6FDRA 3JXUA 2ZJRQ 2DNQA 4E89A 3FZBA 4CERA 3BYRA 3HPOA 3GG0A 3R5DA 2JSXA 1JLCA 3CGIA 4JKHA 4OYAA 1SXLA 4OLAA 4L75A 5KFFA 4L73A 1X5SA 2I7NA 2HBRB 1QY7A 2IAJB 3EGVA 4WKRA 4A47A 4K0KK 4LF6J 4XH1A 2B8PA 2HG4A 3UCUP 4C2MA 3KFWX 2VPYB 5L1LA 4FF4A 4NXNK 3MXMA 3OYEA 3K89A 1YRXA 3MEDA 1WHWA 1T3VA 5HN0A 2NYIA 1WSEA 4DZ6A 4YN3B 5KFSA 3MURP 1C0MA 4Z4EA 1FXXA 4NXMK 1RILA 3VQAA 2XO6A 4CI0B 5LMUJ 1KWMA 3HVTA 3IS9B 3TSUA 1T11A 3ZSWA 4C8KA 2HHQA 1FFSB 1UJ6A 4HTLA 2KH9A 1OPZA 3C6HA 1FX2A 2I5JB 1UEVA 3MMJA 3C6AA 1TV6B 4LSZB 1C0TB 4AH9A 2ZH2A 3CJBA 5BYSA 3G86A 4P73A 5IQQA 2KFYA 3K9JA 4B3RK 1RNHA 3JAMY 2QMXA 1JCFA 4KH5A 2WOMA 2XEXA 3EMTA 4IRCA 2R9LA 1FJGF 3PHTA 4PWWA 3VQQA 2FYXA 4M3UA 2E6MA 3G71N 3OTDA 2K3KA 4DV4F 3T3FA 2FXUA 3PIOL 3U4LA 3RSEB 4ELTA 4K42A 4UZCA 1IBKF 5KG7A 1SJFA 4OFZA 2JHEA 2F8EX 4P74A 1PILA 4USIA 3OYKA 4E0DA 2KZMA 4CLWA 4ED3A 3T1YJ 3MR2A 3SQ1A 3DLRA 2ZNZA 4JRPA 2DGWA 3BO2A 2G8IA 1R3NA 4MYTA 4KHQA 5L46A 1XC3A 2P9SA 5C12A 4KH4A 5CHCB 1Z25A 3GFXA 2FB0A 3U1LA 5ETVA 4URGA 1B9DA 2LA4A 3TZWA 4DU7A 1FNOA 3ILIA 3DYAB 3DGPB 3EX7B 3M6UA 4OX9K 3I5BA 5GAHP 1RBUA 3H98A 3NEKA 3VF0B 1CZAN 4DXLA 1M5KC 2R2UA 5KFTA 4TQRA 4B08A 3KK3A 2KLAA 4OIXA 5ETSA 3CQ8A 4EHUA 3FBBA 5CD4H 2PMZD 4Y0FA 4MQ3A 3RBXA 3K5PA 1NG9A 3Q8SB 4OZLA 5E41A 4K2JA 1ZAVA 5HVFA 2XNQA 1NB7A 4H5RA 3RMDA 4NXMJ 1NNEA 1VQ5N 3MTJA 2MKKA 4YFUA 3NXZA 2W41A 1U45A 2C2MB 2HHXA 2OMOA 2E1RA 2A0FB 1MMNA 1WLJA 2VQEK 2VFSA 3S41A 2XO7A 3O6QA 2AWZA 4USUA 4B3RJ 3IGNA 2BJ7A 4X84A 4A8QA 4MFBB 2CQPA 2W8LA 1S0OA 4X66F 2NREA 2R8KA 2D3UA 2OGUA 5BN8A 4QWEA 1MWYA 5BR8F 5D8HB 1YBAA 2HYIB 4CO4A 3OYCA 2R7UA 4RPFA 3MCAB 2O01C 2VJVA 3CCLS 1T9XA 3NS6A 3L8BA 3J8AA 2B3TB 3OYMA 3RB0A 4RW4B 5AE3A 5CAAA 4JP8A 5AT1B 3W5ZA 3IC1A 1RBOB 2ZM6K 2KI2A 3CD0A 4CO0A 3M9MB 2NNWA 3AOAA 4DV0K 1ZBIA 1QD1A 1NB2A 3WX8A 2X6NA 2WBMA 3HKZD 1WKKA 2FC9A 4B9TA 4O5BA 4GV3A 4NA2A 2RKIA 5DM6Q 4WFYA 3QT8A 3KLEB 3DLEA 2OTJS 1FVQA 1RHJB 1LAVA 4KY3A 4OX9J 1MSWD 2ZBQA 4GC6A 3H1VX 3TX0A 2QC3A 1YJWN 1U2VA 4OZ3A 3G2XA 3FFIA 4AHRA 2W9CA 1I51B 1SV5B 2DVIA 3PM9A 4DV3K 3CJ4A 1EP4B 1T05B 4NLCA 2K8GA 4F4XA 4E2FB 2KYXA 1QQCA 1H7WA 3D0HE 1HLWA 3NAHA 3PVXA 3L2VA 1M90O 2EHGA 1QQMA 2OPRA 2Z57B 4FPIA 3J7A1 2O8DA 1B92A 5KG6A 5HL7L 3T19A 3CJAA 3ENBA 3TAGA 1H2VZ 3QIDA 3K0SA 2K7JA 2VQEJ 3VAMA 4QCLA 4I0WA 3LH2S 3MAAB 4CEAA 4DUYK 4M42A 3VQEA 3FZKA 3ZT2A 5KOWA 3TUJC 2AEMA 3KK7A 2GHPA 2HRTA 4Z4IA 1E4FT 4OZ5A 3LPEA 4FF2A 2G9OA 1TL4A 3KJVB 4WWSA 2F3JA 3EDQB 1K0VA 4K5SA 2GMLA 4YNQA 1NM1A 1AUSL 1VBXA 3SPYA 4NYPA 1V4TA 2AZ3A 4I6MA 3DLGA 1B7YB 2BZ2A 3VF4A 1YTYA 5C24B 3HSTB 2J6UA 1WEZA 3I9V9 2E1ZA 2HMIB 2MQOA 4JV2A 2LCWA 4J5OA 1VSDA 1YJNN 2XLJA 1N34F 3DU5A 5BN9A 3D0IE 3PLAA 1ASVA 2ZM6J 4BREA 1NDKA 4A8MP 1DKGD 2DNRA 5HROB 4PYAA 4DV0J 3X3UA 2QTDA 2RD5C 2P9PA 4DU3A 3AAPA 2VIHA 2DIUA 1UPMB 4RZRA 3THTA 1Q5VA 4C23A 3VPZA 1YITN 4HDGA 2E9ZA 4EYHB 2VBXA 3ETOA 3UNYA 5HAOA 3NP5A 4FJIA 1P6TA 3C8YA 1VQKN 1SQKA 1TL3B 1NJIT 4TY8A 4CIOA 3M8RA 3W8PA 1C1AA 2J8SA 1S0MA 3A8EA 4DTUA 3BPSP 1OQ3A 1RCOB 5FPDA 4TYAA 2XRIA 5ETTA 1CQMA 4GVLA 5LJWA 2GCFA 4DPUA 4OKJA 4CLYA 1ROFA 2RHQB 1NGDA 1QS4A 3RBZA 1WJ9A 3PRBA 2IMOA 4OZ0A 1EKSA 3HHNB 4CLSA 3JQKA 2J8AA 5AXMA 3LZJA 1O8BA 3DI6B 1WD6A 5AQSA 2BRLA 4W98A 3KDOA 1S4FA 4M1KA 1KD1O 1Q86T 5C2FA 4FJLA 2DKOB 1PAUB 1HNWK 1JLFA 4OGEA 4MIWA 4DV1K 4KKOA 3CCQS 1KCFA 1J5EF 3KNGA 4YORA 1SL1A 5IWAK 3BREA 4G1QA 2R7OA 1N8RT 4ID5A 4WYLA 3ETMA 3I0RA 3TU5A 4O3NA 4NLDA 3AT1B 3L0QA 3PW7A 4QJVA 4R0JA 4LR8A 5HOOA 4CJLA 4K59A 2V67A 3ITHA 4KBOA 4KO0A 3LDPA 3R8EA 4CEDA 4IFYB 2VF3A 2QG9B 1ILYA 4NCGB 2KHOA 3F2KA 4K4XA 3AO1A 3VQTA 5DG7A 1ZH5A 2U1AA 5KT5A 1O13A 3LM2A 3JXOA 3AVLA 3G6EN 2MPUA 3OYDA 4H0YB 5I42B 5KT7A 4FWNA 3HJFA 4FS1A 2VFVA 2EK1A 3VA3A 4R5PB 1BIUA 3NL0A 3JSBA 2RE2A 4A46A 3NBPB 3QESA 2QL7B 3IRXB 2QGFB 4M5IA 2J5AA 1P8GA 3C19A 3ENVA 4YUDA 4ZCMA 2HHSA 3VTHA 1Q8LA 4DR3J 3P45B 2G8WA 3BPDA 1RT3B 3K5MA 3D1OA 2BVZA 2CRLA 2CJKA 4Z37A 3AVFA 4BC9A 3SJHA 3KIOA 2LMIA 5AQQA 4H03B 3IWNC 5I3UA 2OJ3A 1KTQA 4B1UB 3QQCD 2C2RA 3IS9A 4FLXA 4MLEA 3DXSX 2RRNA 3NS7B 5A6PA 4B9QA 3EZOA 4EGLA 3HT3A 1TV6A 2PEBA 1UPPA 1C0TA 1Q8KA 3IUCA 2E8AA 3ZX3A 2CH6A 3F5TA 2CZVC 3AFGA 3L09A 4HUEA 4PY5A 4K4VA 2KQ2A 1HBUA 1S6QB 3GQCA 4E7KA 4PCQA 3R5BA 5J1PA 4HVJA 1RT4A 4CLTA 1RAJA 3KLFB 1R6VA 2A40A 5LXRA 4QS9A 4EHTA 4K0KF 2WBNA 3QATA 4DV7J 4I7FB 2ZJQQ 2FBYA 2GTDA 3VOVA 2P9EA 3HVRA 4Q44A 3PTWA 3HL8A 4NXNF 3CO0P 2P9CA 1D5AA 3CC7N 3RSEA 4JI0J 3ONQA 3LTOA 1WAJA 4CRJA 3RRKA 3H40A 3THYB 1JQGA 3JTNA 3V6DA 2H4YB 3A2FA 3R3LA 3R3TA 1CJKB 2HHUA 1WHYA 2M4MA 2KTQA 2R7XA 1CQNA 4F0KA 5K8NA 4DL5A 3J81j 4RJVA 2F63A 3EL2A 3DRXA 2NXEA 4UTGA 1S1UB 1RCXB 4AYBD 3ULDA 1VBZA 4IR1A 4NLPA 4CZLA 2CG4A 1C0GA 3SFGA 4QS8A 3TAMA 1NK9A 1NGIA 1J9AA 5M1PA 2DGVA 1W2BR 4E7HA 2D3O1 4KYZA 5IZHA 5BYRA 2FSKA 3OJUA 3M4XA 3ZTRA 5ADXA 1EQ0A 3S6EA 4A8SA 7AT1B 4ZJOA 1RWUA 4NI2B 4FL9A 3VVTA 1VRUA 1NDCA 2GS8A 4JI2F 5CZ2A 2MQPA 2FHOB 3VTIA 4J9QA 4AF1A 2OPPB 1UL3A 4H8KA 1YZ6A 3U27A 4J37A 4LF7J 3BV8A 5AQUA 2EFQA 2XNRA 1LWCB 2QYCA 5EUHA 4FYYB 2FVSA 1DT9A 2EVZA 2WRMA 5AQIA 3D68A 2ZH4A 3CPEA 4GY2B 4HTUA 5CH7B 4QWBA 5E7OB 5TKWA 3AB4B 4KHRA 1D8YA 5HMZA 3C66A 4MO4A 3IR6B 3FQLA 1XNRK 1HMVB 3V4IB 2IVFB 4MFBA 3VGMA 2JGUA 4JHDA 3D0GE 2MZJA 2XMWA 4CFAA 1KAZA 1YRUA 1HPZA 3F0NA 3O4WA 4EFAC 1Q7YO 4PPZA 4DHVA 3FKBA 5EX3A 1X4EA 2VPWB 4DU1A 3UFCX 2UUCK 2EWSA 2GW8A 3OVNA 3CDBA 2Y3YA 3BGLA 3TYTA 4EU0A 3UNGC 4G1IA 2ZBIA 2HPUA 4RW4A 4B3TK 2Y1LB 2MSTA 4IOCQ 3UI3A 3NGRA 5A2QO 1VIXA 1U1LA 3IMXA 1Y64A 2W4PA 3RRGA 1QSSA 1EAYC 3ZEUA 2C3MA 1QLNA 4N47A 3CHWA 1BXNA 2M9KA 1I5OB 1TVRB 5HQLA 4FW2A 3C95A 3NWGA 4USWA 4W5QA 4CZGA 4AL7A 4H5VA 3KLEA 2PYJA 4O4RA 2G4BA 1ZAXA 2O4GA 2RJZA 3VEZA 4DTOA 3MGJA 2HB5A 1VQMN 2MLZA 3BM7A 1X3MA 1BE4A 4OKEA 3HULA 1OVYA 3PRVA 1SV5A 3LAKA 3MMAA 2P1JA 5D0HA 3JSMB 3D3CJ 1YIJS 1EP4A 3QICA 1T05A 2YTCA 4YHHJ 3AVHA 1VSEA 4ECWA 1RWVB 4J9PA 1VOMA 1KRPA 2ASMA 2UVRA 1HNVB 4NPOA 4AHCA 3QEWA 1S1XB 1TKXB 3GONA 3K9KA 2HFOA 3CE8A 4Q8EA 2JEJA 1YXQA 3IWXA 2KFZA 5AQYA 4CE9A 1VSJA 3BB5A 3CPWM 2BE2B 2C2KB 1KEKA 2GO9A 1EJ7L 1HWUA 1D9DA 3FE1A 2UXCJ 1TL1B 2WTFA 5CCMA 3CYMA 3HBTA 1MROB 1IKXB 1IBLK 4ZVEA 3P5JA 4BRFA 2XC9A 3MAQA 1RP5A 1R7IA 3FSIA 4XPEA