4ICLA

Hiv-1 reverse transcriptase with bound fragment at the incoming dntp binding site
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
556
structure length
556
Chain Sequence
b'MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 150
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4iclA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iclA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iclA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iclA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4iclA05
1WSHA 4Z0UA 4DU1A 1UA0A 2WK4A 4F4XA 4WXWA 3AO1A 1QE1A 4PA1A 4CGHA 1FXXA 3G6XA 3K5NA 3T5JA 2B43A 1O1WA 4KTWA 2IAJB 1ZTTA 2DY4A 1S5JA 4IRKA 4EYIB 1T03B 3AVCA 2HHQA 2F8SA 3NAHA 1ASWA 3H08A 4DL3A 3RR7A 4FZYA 1IKXA 2YNGA 3PW2A 4CK2A 1SUQB 4BE1A 4LQ3A 5KG6A 5CYMA 3KK3A 5DQGA 1S1TB 1S6PA 3DRSB 2XI2A 1S6QA 3KLFB 4DEZA 4N5SA 1BIUA 2QXFA 1QSSA 3CFRA 2W9BB 2WCXA 1BI4A 3PX6A 4ED8A 4O3RA 5HROB 3M9NB 4ZPBA 2XY7A 1C1BB 4AHVA 3HPOA 2O4GA 3T5HA 4IKFA 1VSEA 1IKVB 3ZT2A 4NZ0A 5KT4A 5F8NA 1LAWA 2ATQA 2I1RA 1WN7A 1S0NA 1WAJA 4DTRA 2QKBA 3CDWA 4CK1A 3NF6A 3GIKA 1WNSA 3O3GA 2PYJA 1SV5B 1U04A 4GVMA 1XR5A 4H8KA 2IM0A 4O3PA 4O44A 2KFZA 4MH8A 1VSLA 2HNZA 3LZJA 4KV8B 1RTDA 3BSAA 4DQRA 3TI0A 1KFSA 1KRPA 3NH1A 3GIJA 1VSHA 1FK9B 2R8IA 3CFPA 2V4QA 1IKWA 3DLKA 1L3UA 1KVCA 3ALYA 3V1OA 4EO6A 5KFIA 4CIFA 4JV1A 1C0TA 1VRUA 4KHUA 3TQ1A 3N6MA 3LP0B 2XHBA 3SPZA 1U45A 3SQ1A 3NH2A 3LWLA 1S10A 3S3OA 4DG1B 1S9FA 2Z1IA 2D0AA 3VQ7A 1RILA 4IFVB 2C2DA 1J53A 1QQCA 5DG8A 4ECTA 3VQEA 1X9WA 4NRTA 3NAIA 1JLGB 4RW8A 2D41A 4RW4B 3KK2B 4FS1A 3MXMA 3F9KA 1JX4A 2KW4A 4W5QA 3I5BA 3DM2B 4DF8A 4HCCA 4FCYA 4KAZA 3VQDA 3OVNA 2O4IA 2NUBA 5FDLA 2WRMA 1REVB 2UVWA 3DLGB 3FFIB 3BQ0A 1SL1A 1NNDA 1S49A 4BE0A 5KT3A 1QUVA 4O5BA 3VQCA 4FJNA 2HHWA 2WOMB 5HRSA 3CM6A 2IA6A 4F3OA 3AVIA 3KJVB 4Z4GA 3EZ5A 4DSFA 2IJNA 4DL5A 5J2NA 3OYMA 1S4FA 1Y97A 1J5OB 1RBRA 4FJGA 4KSEB 1S9EA 1VSFA 2J6SA 2HW3A 2HNYA 4C8OA 5K14A 4OLBA 3TARA 3DRRB 4KFBB 3KLVA 4E0DA 3DRPB 2AX1A 5L9XA 4DU4A 1BISA 3ZSZA 1BQNA 2J6TA 3DLRA 3CQ8A 4ECUA 1C1CA 1QHTA 4W5NA 4ZPCA 3M8PB 4YR2A 4K8ZA 4ZPAA 3U3YA 3G86A 5KGWA 1LV5A 3QGHA 3NF8A 4B8CA 4PUOA 4LSNA 3AVNA 2UUTA 2C28A 4CJTA 4B9VA 1FKOB 3GILA 4R5PA 2Q3SA 1X1PA 3LPTA 4FYDA 4J9KA 4DTXA 1HQUA 5J2PA 4OJRA 1LWCA 2AJQA 1HYVA 1TQLA 1JLFB 3BQ1A 1QAIA 3RB0A 4FXDA 3WNGA 4AH9A 1TKDA 4ELTA 5FRMA 3HJFA 3MR5A 2BANA 1JLCA 3O3HA 1BQMB 3KK1A 4DL6A 2OZMA 2OZSA 4QAGA 2GIQA 2FVPA 1YVFA 1A5VA 3HVTA 3KD1E 3ZT1A 5I3UA 1UA1A 2FVSA 3BSNA 4FJLA 4MFBB 3THVA 4CJKA 3V6DA 4IG3B 1KSPA 4RW9A 4IKAA 4DSIA 2WONA 2XGQA 3ZCMA 3ULDA 2JEIA 3VN5A 2D0BA 1N6QB 4I2QB 1SKSA 3N6NA 4CHOA 4QCLA 3SUNA 3UR0A 4Y34A 4OPKA 2FLNA 1TKZB 1SKRA 2IC3B 4OVLA 4MIAA 3PW7A 1ZBFA 4NCAA 4CGGA 3OYKA 3VQ8A 2OPRA 1KCFA 4DFJA 4H54A 3KMQA 1N56A 5J2QB 3MEGA 4IH6A 2J6UA 4WZQA 1S1VB 4ED0A 1SH3A 3SFUA 3GYNA 4LQ9A 4F4YA 2HNDA 3B6PA 3DOLB 5KT7A 3NGDA 1N5YB 2W7PA 3KLGA 3QNOA 1KVAA 3VQQA 5F8IA 2R2UA 5C24B 3MECB 1TL1B 3CO9A 4EZ9A 4CF0A 4J9PA 3OL9A 3EY1A 4BDPA 1CXUA 3ZT3A 3QIPB 5KFMA 2YKNB 3S3MA 3SZ2A 4U6PA 1KLMB 3DYAB 4RNNA 2D7SA 4EO8A 4LSLB 5KG7A 3NMAA 1IM4A 5KFLA 4ZHRA 3Q8SB 5HP1A 1QE1B 1HJRA 4DWIA 5D3GA 4FZXC 4K4SA 1NK9A 4J2BA 1EETA 2ZQBA 4ED7A 4ELUA 1WNEA 3I0SA 4K4ZA 3PZPA 4FJIA 1TAUA 1TK8A 2XGPA 4TXSA 4F4ZA 3TAQA 4CHQA 4YR3A 3G0ZA 2R8GA 3MF5A 1BCOA 1NHVA 4DFMA 4FZZA 3VA3A 1QAJA 3BDPA 5JUMA 2YNGB 3RRGA 2QE5A 4OL8A 1EP4A 5CYMB 1QSYA 1NKCA 4TYAA 3KK3B 2YNFA 3HVWA 1S6PB 3ZSRA 4K8XA 1D0EA 4Q0BA 1S6QB 2VA3A 1SL0A 1XWLA 1S97A 5KFJA 4RW6A 3AVKA 4M95A 4NLUA 3KLEA 1BI4B 1SH0A 1S1UB 1L5UA 3AA5X 2BE2A 3QO9A 2XCAA 2OYQA 3P1GA 4NLWA 3IS9A 1YVUA 1U48A 3I0RA 1B9DA 4DS5A 4ECQA 2YV0X 2JC1A 2WHOA 5CZ1A 3RBDA 1RBUA 4NCGA 3CYMA 4WE1A 2X74A 1DTQA 4NLYA 4LY7A 2RDIA 3D28A 3V9UA 2YKMA 2Z1GA 3C94A 2XWYA 3AO2A 1HPZB 4KHRA 5KFSA 2YHBA 1GOAA 3VQSA 3GQCA 2C22A 1HNIA 4CHNA 2B4JA 4M3XA 2ZE2A 4O44B 2HNZB 3DOKA 3AVGA 2PZSA 4IR1A 1RTDB 3RAQA 3B6OA 1IKYA 4HTUA 3KLHA 3NL0A 1D8YA 1IKWB 5SWMA 3DLKB 5T14A 5E41A 3V9XA 3AA3A 2HWHA 5KG0A 4OKJA 1B92A 3V9ZA 1C0TB 2CJQA 1VRUB 3KHGA 3TANA 3PO4A 3EPGA 1BIZA 1XC9A 3HKWA 4W5TA 2G8UA 4PWDA 4Y1CA 4M3WA 5L1JA 4CEFA 3KTQA 3QZ8A 4GMJB 1WLJA 3RB3A 2C2EA 3MFHA 1LW2A 3PJWA 4ED1A 3CM5A 5F9NA 4L8RB 3NBPA 3PW4A 4EBCA 3HPHA 4RW8B 4R8UA 3PW5A 2GBZA 5HBMA 3OYIA 2PY5A 2VA2A 4FK2A 4Z4FA 4CERA 4CEQA 4MK8A 4KO0A 2ZKUA 2X6SA 4B9NA 3HSTB 5FDLB 3GV8B 3ITHA 2I5JA 2ALZA 1G15A 4Y1DA 4CJVA 4DTOA 2FBXA 4CK3A 1NK5A 1RTJA 3BQ2A 4IRCA 2PYLA 4DSJA 3KLIA 4JS5A 3GIMA 1VSKA 2IS3A 4HUFA 4ZVEA 1XI1A 5J2NB 3NCIA 1S9EB 4MQ3A 2UVRA 2ASJA 3TR8A 1U47A 2HNYB 3S3NA 5KFVA 4AHCA 5K14B 4ZP7A 4F50A 3VQBA 3AVLA 4KTZA 1S1XA 1I3AA 4Y2AA 3AVJA 4QWBA 4ZP8A 3SUOA 1KHVA 5J2MA 4AHSA 2W9CA 4MIBA 4CF2A 4ECXA 1C1CB 1J54A 4CFCA 2HMIB 1EXQA 5JS1A 3O4QA 2OA8A 1CLQA 3BGRA 4OKEA 3V9WA 2B5JA 3T1AA 5KRTA 4CF9A 3PUFA 1Q9XA 4M94A 4PUOB 2JEFA 4LSNB 4LD0A 4GC7A 1C0UB 4KB1A 3MEDA 4R5PB 4DFPA 4QPXA 3TABA 2HVHA 3LALA 3G6VA 4DL4A 3CIZA 1HQUB 3WNHA 5J2PB 4DL7A 3U6FA 1W25A 1YTUA 2R8KA 4B9TA 3QYYA 4FBUA 4CHYA 2BANB 3KHHA 1FKPA 2HHUA 3KK1B 2G8VA 2E9ZA 4WYWA 2P5OA 3HVTB 4Y3CA 3ZSQA 4DTSA 1WAFA 4OGCA 3MXJA 5I3UB 3QLHA 4E19A 3SPYA 2AU0A 2KTQA 3DLEA 4I2PA 3V6DB 4BE2A 4RW9B 3Q8RB 2WONB 4KHSA 5KG2A 3I5AA 3C6TA 4KHMA 2R2RA 4ZTJA 3CJ3A 2HB5A 3L3UA 1D1UA 1LWEA 2BDPA 2BR0A 2QK9A 2HVIA 2FVRA 2OPRB 5KFTA 1RNHA 3SI6A 2XO7A 3LDSA 3H5UA 4FLWA 2BQUA 1TL3A 3MEGB 1CXQA 4KE5A 3NHGA 4NLVA 3PY8A 2JLEA 4ID5A 1LW0A 2X6NA 3NGYA 1I6JA 5KFPA 1JKHA 3DLHA 2HNDB 4ZVHA 4MK9A 5EWFA 2YNHA 4YNQA 2JEJA 3KLGB 3L2VA 5KT5A 3MAQA 5HLFA 4TN2A 4B9LA 3NDKA 2D3ZA 2YNIB 3V81A 2E4LA 1Q8IA 2G8HA 1S1WA 3H5YA 4I9LA 1XR7A 1RT7A 3V6KA 5C25A 3OYBA 4TLRA 2D5RA 4CEEA 3M8QB 1U49A 3M8RA 4B9UA 4ZHRB 3M9OB 4FJ5A 1TKXA 5I42A 5D3GB 3QZ7A 4J9SA 1T05A 5DGBA 1LWFA 4J9RA 4FK4A 3L3VA 5C5JA 4FLUA 3I0SB 4H4OA 2KFNA 3RMBA 1DLOA 3O4NA 4B08A 1RA7A 4E7HA 1U4BA 4NLTA 2FJVA 4FM1A 1RT6B 3E51A 3LPUA 4ICLA 4O4GA 4M3RA 4F4KA 4KRFA 4R0EA 3GV7B 1EP4B 3V4IB 4HUEA 2ILZA 2YNFB 1RDRA 4TYBA 4CESA 1IH7A 4EP4A 4Q0BB 2VG5A 3CVKA 2C2RA 5KG5A 5DG9A 4CJ3A 1D9DA 4ZP6A 1Z26A 1QTMA 3LZIA 2BE2B 3QO9B 2JEGA 1ZBHA 3T3FA 4DS4A 4QWCA 4XIUA 3IS9B 5KFAA 3I0RB 2G8KA 4U7CA 3L2WA 2F8TA 3SQ2A 4WYLA 2XI3A 4W5OA 5HRRA 4NCGB 4WE1B 4E89A 2DTUA 3BSCA 2EHGA 4CEZA 2DPIA 4CCHA 2E6LA 1SUQA 1I39A 2YKMB 5KFNA 5C42A 3MR6A 3RAXA 2IJFA 4WFZA 2Z1JA 3DRSA 1HNIB 3FQLA 2ZE2B 1NOYA 4URSA 4AHUA 3CJ2A 2KZZA 3FDSA 3DOKB 1NOZA 2BQ3A 1XHZA 4G1QA 1RBSA 1HYZA 3RR8A 1QS4A 1IKYB 3DMJA 4IFYA 3KLHB 4BACA 3TAFA 4EBEA 1C1BA 1LAVA 3H4BA 4RW7B 2OPPA 3HL8A 2HHVA 4KREA 2RKIA 4E3SA 1ZBUA 1T8EA 4CJSA 4CFBA 4I7FB 3CJ4A 4PWDB 1N4LA 3OYCA 2P1JA 1K1QA 4Y2CA 3UQSA 3CJ5A 4CJEA 4JLHA 5KFCA 1RBTA 2VWJA 4CEBA 3MR2A 4IDKA 3D5MA 4J2AA 4RUAA 3RB4A 1LW2B 2FJXA 4O3OA 4CJUA 4DLGA 2W42A 3L2UA 1RDAA 3QEXA 1K6YA 3NGZA 4E7KA 3NBPB 2AGQA 3VQ4A 3QEPA 3OS1A 1S48A 4FW1A 4R8UB 4K4UA 4J2DA 1TVRB 3AA4A 3RBEA 4CECA 1JXLA 3H5SA 4ED3A 1RT4A 5KFOA 4KO0B 4CJ5A 1ZYQA 2IOCA 2OPQA 4PY5A 3OL8A 1RBVA 5F8GA 3ITHB 5EWGA 3HP9A 2I5JB 3QGIA 4JV0A 4HUGA 3BSOA 3S9HA 3CG7A 4RNMA 4Q8FA 4IQXA 1WSFA 1S0MA 3M9MB 1RTJB 3K2PA 3VA0A 1NKBA 3BREA 3ASMA 1C1AA 4FJ8A 5HRNA 1GOCA 3KLIB 1RCHA 3QIDA 4DSLA 3T19A 2FLPA 3SUPA 4IFVA 4F8RA 3QETA 4Q5VA 3GV5B 3WNEA 4ZMMA 1TK0A 2ASLA 3OHBA 4BWJA 1TKTA 3KKSA 3QERA 5DQIA 5SZTA 3LP2A 2AQ4A 1NJXA 3OSNA 5J2MB 2W9CB 4RNFA 3FSIA 1REVA 3HT3A 4KB0A 4TSXA 4URQU 4FM0A 1IKXB 5EWEA 3BGRB 1OS5A 4NYFA 4Z4EA 3K5LA 4ECSA 3EZUA 3FRZA 2RPIA 4O0JA 4YFUA 3MEDB 4MKAA 5DK5A 5DQHA 2W8KA 1UAXA 4MK7A 2DPJA 3KHLA 4IH7A 1RT3A 3ZSWA 3CDEA 4DU3A 1NJWA 3RB6A 1VSDA 2CKWA 4FBTA 3V1RA 3V1QA 3EYZA 3H4DA 4K4YA 3TVKA 1NHUA 5J1EA 1FKPB 1NJZA 1RT2A 1HYSA 4ZVGA 3SFGA 2OPSA 4KI6A 4KBIA 3SCXA 5KFKA 3T5KA 5KRSA 3JSMA 4E7JA 3Q8PB 4OPJA 4LH5A 3BJYA 3QLHB 3BR9A 4UQGA 1JLQA 4FJMA 4QW9A 1VK0A 1RT1A 1RT5A 5F8HA 1FKOA 3DLEB 2XY8A 2FC0A 1A5XA 1RTHA 4I2PB 1T94A 5EDWA 4RUCA 4KHYA 1BHLA 2R7YA 4NLRA 2QV6A 4DQIA 3AO3A 4KI4A 3C6TB 1LWEB 2V9WA 4ECWA 4M42A 4RU9A 3V6HA 4O0IA 1NK6A 5CYQA 2FLLA 4FLZA 2BRLA 1TL3B 1JXBA 2HAIA 4ID5B 4JS4A 1NK0A 1LW0B 4G3IA 1B9FA 1JKHB 3C6UA 3SYZA 3AA2A 3VQ6A 3G10A 2YNHB 2RF2A 4JRQA 3H2LA 4YMEA 1TV6A 4DSKA 4MFBA 5HLFB 5JS2A 3HYFA 4F3TA 3AO4A 2AWZA 1L3TA 4KKOA 2ATLA 5DLGA 2EX3A 2D3UA 2FBYA 2FBTA 2DFEA 1N6QA 1S1WB 3QEVA 3RMDA 3ZT0A 4DTJA 4TQRA 5DGAA 4HCBA 2IDOA 1RDCA 3SUQA 4FLYA 4FM2A 2AGOA 5C25B 4I9QA 4HKQA 2XY5A 3P5JA 3QINA 3SNNA 1KLNA 1TKXB 5I42B 4F2RA 1HNVA 1LWFB 5KFYA 1HQEA 3LP1A 4GW6A 5KFZA 3OSPA 5T7BA 2O5DA 3PV8A 2JC0A 5EUHA 4H4OB 2ASDA 3F73A 3VQ9A 4FLTA 1DLOB 4M3YA 3KD5E 5C24A 1WSIA 3ZSVA 1TL1A 4IOBA 1RDBA 3V6JA 4J9OA 1K1SA 4ICLB 4O4GB 4K4VA 3JYTA 5KFUA 3QIPA 3NE6A 2JGUA 1KLMA 4DQSA 4IG0A 3TAGA 4KB7A 2VG5B 1BQNB 2DFFA 2B6AA 3UPFA 2FVQA 4WXOA 1VSJA 4DL2A 4OGEA 4GC6A 3PX0A 3OYDA 4BDYA 1TP7A 1DTTA 3ICLA 2BRKA 4DSEA 4M3TA 4H4MA 4EZ6A 4Q45A 1N48A 4NLGA 3SQ4A 2P51A 1JLAA 1JLEA 3FQKA 4NLDA 3OYFA 5KFBA 3AVHA 4Z4HA 1F21A 3TAEA 3HK2A 1IO2A 4FJJA 5C42B 3NGIA 1LWCB 2BQRA 3NAEA 1RYRA 1GX5A 4FW2A 3SJJA 1T3NA 2E9TA 1Z25A 3NF7A 1JLCB 2G8FA 4CJ4A 3TAMA 4CJWA 5KGXA 4C8KA 4G1QB 3PJXA 4W5RA 1S1UA 1RTIA 3DMJB 3VQ5A 3RMCA 4IFYB 5KG1A 3HPGA 4ZVFA 3K57A 3AVMA 1KTQA 2BGGA 3IRXA 4B9SA 4J9QA 2OPPB 3IAYA 3DI6A 2IMWP 4PQUA 3HVRA 3TAPA 1NK7A 2RKIB 2F96A 1HRHA 4IBNA 1JXEA 4YQWA 3SI8A 3OS0A 1MU2A 3HVAA 2WTFA 1TAQA 2ETJA 1HPZA 4FVMA 4CE9A 3OY9A 2V4RA 4IDKB 2E6MA 3G6YA 5FROA 1UWBA 1HMVA 1U09A 2VG7A 4NLOA 4WFYA 4M3UA 3QESA 1CZ9A 3IGNA 1TGOA 1S9GA 1R0AA 4EP5A 2G8IA 2VWKA 2UVVA 4ECYA 5HRPA 3RTVA 1RT4B 4WFXA 4E7IA 2VG6A 2OPQB 3H59A 3MEEA 1RYSA 4O4RA 2R8JA 3ISNC 1KHWA 2G8WA 1VSIA 3ZT4A 4AHRA 1L3SA 3ZSOA 5F8MA 4TY8A 4Q43A 3I8DA 3E01A 4N47A 4FJ7A 4ECZA 4TY9A 1JL2A 4M41A 2XCPA 3H98A 4DLEA 3V9SA 3K5MA 2DFHA 1X9SA 4JRPA 5HP1B 1ASVA 4BWMA 1GOBA 4KHQA 5EU7A 4DTMA 1WSGA 2A1SA 1ASUA 5KFGA 1TKTB 1EETB 4B3OA 1NKEA 3IG1A 2R2TA 4NYZA 3LP2B 1WSEA 3D0PA 5L1IA 4RG8A 2ZD1A 3M8SA 3Q8QB 1CZBA 3H40A 3DDKA 1VRTA 3LAMA 4WZMA 3DLBA 1JLBA 4KAIA 5KFXA 3QNNA 3AVBA 5KTQA 4NLSA 3T5LA 3NKYA 4ZPDA 3PVXA 3OLBA 3QGGA 3KMSA 4CJLA 3CDUA 4KPYA 3NFAA 4RW6B 4HHTA 3AVFA 3L2RA 3UDLA 3KLEB 5L1KA 3OJUA 4FJKA 4QOZB 3GIIA 1RT3B 1XR6A 5KFRA 3AV9A 1RA6A 3SQ0A 4LH4A 4CFAA 2XC9A 2IGIA 1ZTWA 2IAJA 4K4XA 4URGA 4CHPA 1T03A 2WB4A 4JV2A 5J1EB 4NCBA 3L2QA 1RT2B 1HYSB 1CSJA 4C8NA 2OPSB 3IN5A 1DTQB 5JXSA 2OH2A 4N76A 2IM3A 2HMIA 3QIOA 4J9NA 2Z1HA 3OS2A 4ED2A 3JSMB 3CWJA 1C6VA 3A2FA 4KTQA 4M3ZA 1JLQB 2Y1JA 1L3VA 2RDJA 3I5CA 1S1TA 2AX0A 3ISND 3KLFA 1WSJA 4CEOA 3PW0A 1RT1B 1C0UA 1RT5B 2IBKA 3NH0A 1RTHB 4O3SA 1SKWA 3K5OA 4DF4A 3LANA 2W9BA 1NK8A 2KZMA 4QWAA 5HROA 3ZSYA 3MTKA 1X9MA 2LSNA 1NK4A 4IR9A 5CYQB 4YR0A 2FJWA 2HWIA 4NLXA 4BDZA 2XRIA 4X2BA 1IKVA 2AGPA 4EYHB 4E1MA 4IRDA 2KQ2A 4CGFA 3O3FA 1ITGA 1EX4A 2IM2A 2P5GA 3C6UB 2W7OA 4ED6A 4K4WA 2RF2B 3KIOA 2FBVA 1TV6B 2V0NA 1SV5A 1J9AA 2GC8A 4J9LA 3NF9A 2W9AA 1S0OA 4KKOB 5KFFA 4KV8A 4F4WA 4FLVA 1FK9A 5HBMB 4KHWA 1D9FA 3PHEA 5KI6A 5FRNA 3VQPA 4E7LA 2QKKA 4MKBA 4CGIA 3D45A 3OYJA 3PO5A 3VQAA 2E9RX 4YP3A 3LP0A 3LAKA 4CGDA 1HNVB 3MFIA 4RNHA 1HQEB 5KG4A 3LP1B 3OYLA 4O3NA 3OLAA 1A5WA 3EPIA 3PX4A 3HXMA 4DG1A 2GUIA 1SL2A 1VSMA 3OL7A 2R8HA 4K50A 4RNOA 4NYNA 5DLFA 3K58A 5KFWA 1QSLA 4RZRA 2YNIA 1JLGA 4DQPA 4NRUA 4RW4A 3KK2A 3HP6A 3JYTB 1S1XB 4IH5A 4O3QA 4HVJA 4IG0B 1RAJA 3AO5A 3DM2A 2D0CA 3M8QA 2HHSA 3SV4A 2B6AB 1JIHA 3HM9A 2UVUA 4DQQA 5KG3A 4CHZA 3OHAA 5KFEA 3ZSXA 2HHTA 3DLGA 3FFIA 5DG7A 3OJSA 3RWUA 1DTTB 2R2SA 4CF8A 4H4MB 1C0MA 1D5AA 3KOAA 2WOMA 4NLPA 2B5JB 2GV9A 3KNAA 4CJFA 3KJVA 3HO1A 3OYNA 1JLAB 2GIRA 1JLEB 3IGVA 3CJ0A 2F8EX 4QW8A 1J5OA 4F2SA 2RN2A 4Z4IA 4C8MA 4FJ9A 3QEIA 1TK5A 1RT6A 5KT2A 4ECVA 4E1NA 4NLQA 3V4IA 1EKEA 4CJQA 4CEAA 3DRRA 4KFBA 3DRPA 4O55A 1W0HA 3LP3A 3K59A 5CZ2A 1NJYA 4ECRA 1YT3A 2W8LA 3OYHA 2A1RA 2FVCA 3TAMB 3SV3A 5KFQA 4CGJA 3M8PA 2HHXA 1RTIB 1GX6A 1Q9YA 4J9MA 4HYKA 4K4TA 3OYAA 3QEWA 4XPEA 4JUZA 3IRXB 1BGXT 4DTUA 4CIEA 3OYGA 3DI6B 4FLXA 1IG9A 4PQUB 4QWEA 5F9LA 4N56A 1MU2B 3KKRA 2X78A 2YHAA 3HHKA 4CFDA 2XY6A 3LWMA 4XPCA 4FK0A 5DMRA 2IM1A 1T7PA 4CJRA 1JLFA 3N6LA 3AVAA 4B8AB 4OKKA 1W9HA 1UWBB 1HMVB 1BCMA 3WNFA 4OLAA 5KFDA 2VG7B 5F8LA 1KFDA 2EC0A 3H5XA 4DMNA 1ZBLA 3RMAA 1RDDA 1BQMA 1S9GB 1R0AB 3PR4A 4EBDA 4DTPA 4TQSA 4DFKA 3RRHA 4CJPA 3U3GA 1HARA 3L8BA 4KHNA 3MR3A 3OYEA 3C95A 5KFHA 2UUWA 1UOCA 2VG6B 4RW7A 3MEEB 4J2EA 3UIQA 4FJXA 1Z4UA 1ZBIA 4Z4CA 3PR5B 4IG3A 3V81B 4C8LA 5KT6A 4I7FA 4XO0A 3KHRA 4TY8B 1MMLA 4I2QA 4QWDA 3E01B 2Y1IA 4ID1A 1RT7B 1TKZA 2IC3A 4N41A 1XHXA 4ZP9A 3P83D 1YTAA 4ZTFA 4CEDA 2ILYA 1JL1A 5J2QA 5L1LA 1SH2A 5CY4A 1T05B 5F8JA 1S1VA 1TVRA 4CIGA 4B3OB 3OL6A 4AILC 3IG1B 4FJHA 1KVBA 4Q8EA 3DOLA 1N5YA 1C2PA 2ZD1B 3TWHA 3MECA 3CFOA 4M45A 1VRTB 2ITGA 1BL3A 1JLBB 4Q44A 4DTNA 4ELVA 1ZETA 4AHTA 4FS2A 2YKNA 4B9MA 3DYAA 4EEYA 3MXIA 4LSLA 4CF1A
chains in the Genus database with same CATH superfamily
4KRWA 5AJ3J 1WSHA 2BUNA 1DHMA 1CJTA 2BJ7A 3LGNA 2O8FA 3BKTA 2YKPA 4PA1A 3TO8A 3K5NA 2R7WA 1N8RT 5A8KB 1O1WA 2ZWOA 1ZTTA 3TZZA 4EYIB 4BRQA 3AJ2A 4JB8B 4YEAA 2VIHA 4QBUA 5HJXA 3SQGB 1L3KA 1C4CA 1ASWA 2HRUA 3S1TA 4YDXA 1NEEA 3RR7A 4FZYA 1IKXA 1HNXJ 3I82A 2Z0GA 2OD6A 5KG6A 4KQZA 5LJ5Y 1NGJA 4WKRA 3OFFA 1S6PA 4WIQA 2AYBA 3L4IA 3ZZYA 1BIUA 1BUPA 1QSSA 3TR5A 1BI4A 2MQNA 2YWFA 4BVOA 2N7CA 4C0BA 1G6BA 4QIWD 2XY7A 3HPOA 3R6MA 1IKVB 1EKSA 1YGYA 1FX4A 2NXCA 4NZ0A 4OIXA 3BF1A 5F8NA 2DEJA 1WN7A 1S0NA 4GKKJ 1WB9A 4H0XB 4B3MJ 3CDWA 5HVFA 4H5TA 1X0PA 1K8KB 4ZN3A 1U04A 1XR5A 3IA0A 5M1NA 2VJVA 2AA4A 3AXKA 4DQRA 3ETMA 4Z7CA 2OLWA 1VSHA 2XSJA 1IKWA 3UNYA 3DLKA 4EU0A 2ZBIA 2LU2A 4RWXA 1N34K 2QFIA 1FD8A 2RD5C 3JXOA 2LXIA 4RUHA 5IZHA 4KHUA 3N6MA 3LP0B 4DXLA 5CCMA 3MMCB 3Q83A 4DZ6A 1RBLA 3HJVA 1U45A 4FWRA 1GLJO 3VAFA 1V3SA 3P31A 3S3OA 4ZLJA 1S9FA 3UKUA 2GTDA 2F4FA 3IM8A 3VQ7A 4Q7AA 1YF5L 5DG8A 2H51B 4ECTA 3VQEA 3CJSA 2D41A 3MXMA 1SJ3P 1C4AA 2W4CA 2PAVA 2PT0A 1O5JA 1JX4A 2KW4A 4W5QA 2A2DA 3OA9A 4BREA 2D1CA 4HCCA 3W1YC 1FRHA 4FWQA 2O4IA 4QR0A 2DNNA 2NUBA 1ZAXA 2WRMA 1HBOB 4K8RA 1SL1A 1NNDA 1T9XA 1X4AA 4BE0A 5KT3A 1QUVA 1QVGM 1TL7A 2X3DA 4FJNA 4BRDA 4LC9B 1DJ0A 4N77A 3RJMB 3OR1B 2IJNA 3VVUA 4MYUA 5ADXH 1Y97A 1RBRA 4LIWA 4KSEB 2OTLN 2QEXS 1VSFA 3PYEA 4OLBA 2F8MA 2ASMA 1V3ZA 2FHKA 3C65A 4KIAA 1UJ6A 4DU4A 4OYBA 3DLRA 1NHKL 2DYAA 2WUSA 1QHTA 3CQ8A 4A8MP 4YR2A 3M8PB 2W25A 2PDAA 3G86A 4MMOA 1XMOF 3THTA 2RILA 3NF8A 2HK3A 3MN9A 3PDNA 4B8CA 2RIJA 4B9VA 4JI5K 5ADZA 5CD4H 4R5PA 2XS7A 1TUYA 4WPAA 1NZAA 1FWPA 3H45C 2MLXA 3DGPB 2OKQA 1N88A 4FYDA 4J9KA 2IRXA 1MDUB 5JVGL 3FSYA 1MN9A 1IBKK 2AJQA 1NRKA 2OHDA 3BQ1A 3MWPA 2D9OA 3L95X 3RB0A 4FXDA 3WNGA 2RQMA 2XMWA 3JSBA 1TKDA 4OHXA 3VEVA 5FRMA 4CWBA 4PG6A 4PWWA 4UY85 3AAPA 3KK1A 2ZHOA 4J8FA 2ZM6J 2OZMA 4QAGA 5GMKa 1YUWA 1CJUA 1T3OA 2GIQA 1YVFA 2BKPA 2DCLA 4P71A 2DEIA 2PA8D 3GL1A 4KH4A 1RAOA 2LCWA 3W65A 3THVA 2Y8WA 4JN4A 3N5FA 1SQFA 5KOXA 2MY8A 5AQQA 4IG3B 4DSIA 2JEIA 2CPEA 1SKSA 3CTRA 4QIFA 3UR0A 3IRWP 3VALA 2IC3B 4MIAA 1NSKL 1ZBFA 5B0AA 1H3DA 2OPRA 2GQ2A 3KMQA 3O3LA 2F4VF 4IH6A 1U1NA 4YY3J 1QAXA 2L48A 4PKIA 2BW2A 5GVQA 2HNDA 2L41A 4FWSA 3NGDA 2W7PA 2H5IB 3PYGA 1YZ6A 1KVAA 4UQTA 2UUAK 3FBBA 5D0GA 4ZCKA 3CO9A 3M6GA 4LFCJ 4DV7F 4HDGA 3GR0A 1LXJA 1UEUA 3NP5A 1S22A 4WFAQ 3QIPB 1LEOA 5KFMA 2RRNA 3CCUS 5C2FA 4DV0J 4RWTA 3VQTA 3NMAA 5ADXA 1VCTA 3IR5B 5HP1A 1QE1B 1HJRA 1FVSA 5D3GA 2JWKA 1K47A 1NK9A 1EETA 3R7BB 3ZZUA 3I0SA 4F0HA 1TK8A 4QS7A 3AA9A 2QRRA 3D7SB 3A5MC 1NHVA 4OZ5A 4FZZA 1QAJA 3BDPA 4NWBA 5JUMA 2YNGB 4HACB 3QWPA 4OL8A 1RZMA 2B9XA 5HANA 1EP4A 3MD3A 1HNZJ 5ETKA 2CUYA 3HVWA 5CD4A 2GHWA 2Z2ZA 5KFJA 2GVZA 5ETMA 1SH0A 4ZCLA 3LOUA 3WDOA 1AZSA 1VQPS 4OX9J 5ETTA 1U48A 1B9DA 2VDHA 1MA9B 4XH5A 2I7PA 2GHVC 2PMWA 4PYAA 5H9FJ 1JJ2R 4LY7A 3D28A 3AO2A 1HPZB 1P90A 3NEKA 5BR8F 3VQSA 3GQCA 4CHNA 4OYXA 2ZE2A 2CADA 4B3TK 4XEIA 4O44B 4OZJA 1VHXA 3DOKA 2PZSA 3W2VA 1N0UA 3ATUA 3KLHA 3A4TA 5SWMA 2CQ2A 5E41A 5HJYA 1B92A 2CJQA 1HBMA 4F0KA 1VRUB 2BZ2A 4DV4J 2Q6BA 3PO4A 3EPGA 3EE8A 5FPDA 2ZHBA 3VAIA 3MM8A 4OX7A 3JQMA 3DKDA 1T0TV 4M3WA 1S5ZA 3W0LA 5IT4A 3FCWA 5B0EA 5EX0A 1FXLA 1VQNN 3MFHA 4ED1A 4YOUA 1H74A 4OI6A 3QT8A 5LMNF 3H2VE 1Y5IB 4RW8B 4PL7A 2V8VA 1Z2LA 2PY5A 3DXBA 3DLLL 4FK2A 4Z4FA 4CERA 4M7YA 2ZKUA 1F2GA 2HF4A 2MKJA 3HSTB 3JS6A 2DGQA 3EXYA 2VZ9A 3GV8B 4NPOA 2I5JA 2HK2A 2UXDK 4LF4J 2FBXA 1NK5A 4CK3A 3BQ2A 3NG8A 4ED4A 3DGVA 1Y00A 5C2DA 5LMUJ 3V5RA 1FT8A 3M8ZA 1WDDA 1S99A 4FXVA 1HD0A 4LF8K 4GO7X 2R7OA 3S3NA 4Z7YA 4F50A 2K8GA 4M5JA 3WXKA 4Y2AA 2E5LK 4ZP8A 4F0MA 3GONA 5J2MA 4AHSA 3NXZA 4DN9A 1U2RA 5BYSA 4CF9A 3PUFA 3ET6A 4M94A 1BC6A 4PUOB 2CGKA 2JEFA 4LD0A 2XS5A 4DFPA 3VV2B 1K0VA 3TABA 4KHPJ 5GADP 3P5TL 4DL4A 1AUDA 4EAHD 2C2NA 1HQUB 3IBFB 3U6FA 1EB0A 2MKYA 1SZ2A 4B9TA 2VKRA 3HSDA 2HFVA 5GAEP 2QA1A 2UU9J 2G8VA 3UO0A 2E9ZA 2JL9A 4WYWA 1BWVA 4BC4A 3WHIA 4FDFA 2NZCA 2ZZMA 4DOZA 1M90O 2CNOB 2NCKL 2GMJA 5JLFA 2VUGA 3V6DB 4BROA 4BE2A 4NMLA 2WONB 1AUSL 3TUIC 2E5HA 4KHMA 2R2RA 2FYXA 4LFBF 4UW2A 1LWEA 2ZVSA 2CJKA 2VICA 2HVIA 2IVFB 5GAEU 2NQPA 1RNHA 2XO7A 1I51B 1BD6A 4YB7A 4FLWA 2BQUA 1TL3A 3MEGB 4KE5A 2JLEA 2BYCA 4H5VA 4ID5A 4GVBB 1LW0A 1JK9B 2ZJQL 1I6JA 5KFPA 2GMHA 7FD1A 2YWEA 2JEJA 3KLGB 1TUWA 3N4QA 3BBCA 1BA1A 4GNIA 2XLJA 1P8ZA 2DJWA 3FZ2A 4AM6A 2AJ4A 3H5YA 2RS2A 5FLXU 1XR7A 4Y2MA 3V6KA 1RAEB 2U1AA 2D5RA 1ATSA 3C15A 1QTNB 3VEXA 1KD1T 1U49A 3ZZPA 4B9UA 5M2PA 1U2VB 1SI9A 3GJSB 1T05A 1LWFA 3O80A 2M2BA 2B9YA 3MR7A 2J9EA 2KFNA 3RMBA 2RUSA 5HMYA 4E7HA 1U4BA 2FJVA 4B1ZA 4LR8A 3FKBA 4DV3K 3T1YF 3RUBL 1RT6B 3E51A 2W2PP 2DIUA 3LM2A 4F4KA 4KRFA 4OYPA 4S0MA 4A8WA 1IH7A 4Q0BB 2GVDB 1OWXA 3CVKA 2C2RA 4GVLA 3ADAC 3VAHA 1FX2A 1D9DA 3MDQA 2VQFJ 2C2ZB 3WXIA 1QTMA 3LZIA 2BE2B 3QO9B 3QMQA 3J7ZT 3FGUA 3SXLA 1G1XA 4E89A 3BSCA 4I4BA 2EHGA 2KM8C 2E6LA 3V2UC 1I39A 2YKMB 4M7XA 5C42A 2ZOFA 1QZ5A 3MR6A 2J9CA 3RAXA 2MHNA 4OJGA 2BUPA 4WFZA 4F3QA 2JDJA 2Z1JA 1HNIB 1CQNA 4ERDA 3FQLA 4OFZA 4URSA 2WB1D 2KZZA 2MQQA 1NSQA 2BQ3A 4AXIA 4G1QA 2B8PA 4P73A 1RBSA 1WC6A 3GSIA 2QX0A 2Z4PA 1X4HA 3RW7A 1NJIT 2ROPA 1C1BA 4R25A 1FRXA 3MUVP 3H4BA 4NMXA 4RW7B 2XBPA 4YHHJ 4K5SA 2BKNA 3HL8A 4A57A 1ZBUA 3CJ4A 4PWDB 1N4LA 2UV8A 2P1JA 1K1QA 2CNLB 4CZEA 1QY7A 4LF6J 4CRJA 4JLHA 2NRZA 5AQJA 2HS3A 3PFOA 2BE7D 4IDKA 3CCVN 4CJUA 3MMBA 4PZVA 3L2UA 4G9ZA 2HRYA 3SMSA 5LSLA 3AQPA 1FWLA 4DV5K 2YWGA 1DEJA 1SIZA 3NBPB 1WELA 4NI2A 5AZJB 1S48A 2BE9B 1TVRB 2Q97A 5BR8K 4EGLA 3RBEA 1JXLA 4DR5J 3H5SA 4ED3A 4KO0B 4BRIA 4K2JA 4AM7A 5EWGA 1T95A 2WSFC 2LP4A 4QS8A 1RWPB 3S9HA 3D2EB 3KG4A 4Q8FA 4IQXA 3K2PA 1S0MA 1NKBA 3DXKA 3ASMA 4FJ8A 5HRNA 2VBWA 2HVEA 2B9WA 1RCHA 3QIDA 3SUPA 1AA1B 4QR2A 1U7LA 2FPHX 3GBTA 5F3ZA 2YKOA 4DR2F 5IT0A 2DNHA 4NXMK 2ASLA 2CJBA 3OHBA 3KKSA 3CIMA 3Q8VA 3HM8A 3SAFA 5L9NA 3C6AA 4BRGA 2W9CB 5LMNK 3CXCM 4AD6A 1S7HA 5BYQA 1Q7YO 4C11B 1UJ4A 2VQEJ 5I4MA 2CQIA 3TSUA 1OS5A 2NRVA 4Z4EA 4HVZA 3MURP 3G6ES 2WZ1A 2WFBA 4CO1A 4UOCA 1JNZB 3FZLA 5DK5A 2J9DE 5DQHA 2W8KA 3BKUA 1UAXA 4JD2B 1N36F 3C6HA 2HLTA 4DU3A 3P5BP 2HS0A 4FBTA 3V1QA 2FZGB 1RTZA 2QMXA 5J1EA 2X1GA 3BH6B 4DUZF 4ZVGA 4ISFA 4ED5A 4BHQA 4E7JA 3BJYA 3BR9A 3M30A 3OBYA 2HSTA 4X66F 2FXUA 2Y0SD 2FC0A 5EDWA 4KR0B 2CRLA 2YVSA 2MLYA 5ETQA 2Q1LA 2A10A 5M1KA 3OTOF 1OH5A 3PHTA 4HTIA 1JXBA 1VBKA 4CZKA 1HR0F 4JS4A 2QEXN 1JJ4A 4G3IA 1JKHB 1YRTA 3SYZA 2E1RA 1E4FT 2YNHB 2RU3A 5GAGI 3T1HJ 4JRQA 2DB1A 1TV6A 3HYFA 5CZVA 4BR2A 5DLGA 1FNXH 3W8GA 4ATNA 4FKXA 1S72S 3VAMA 5DGAA 4JKDA 1XNRF 3SUQA 2V50A 1XTZA 4P2SA 1HQ2A 4FLYA 4CO3A 5C25B 3US5A 3VGSA 1GLAG 3NNCA 5C2GA 3ILIA 3VF2A 2Z2YB 4BG9A 2D0OA 1FXDA 3C46A 3LP1A 3OSPA 2O5DA 2DGUA 1ZPVA 3TZYA 2JC0A 2OD4A 2CPYA 2VBYA 4CZIA 2NXEA 4YORA 3ZSVA 2MY7A 1U8SA 1RWKB 2ASPA 5DS7A 2H65B 4IOBA 1K8AO 3H3NO 3AGKA 4O4GB 5IV3A 5AQTA 5KFUA 4K2XA 4K43A 1HL6A 2VG5B 5A8RA 2NR0A 3UPFA 5TKWA 5CH7B 4DV1F 4WXOA 3UCUP 3M6WA 5FD1A 3PX0A 3M7VA 4NLBA 3OYDA 2HHHJ 1Q0NA 2F7TA 3G96A 4AYBD 3WBZA 2D0PA 1Z2ZA 2G0CA 3NNHA 3KZBA 3FQKA 1NWKA 3TAEA 1HLWA 3HK2A 2Q3PA 5D0EA 5CCLA 4FJJA 1GT8A 4CLPA 2ADCA 2IYGA 3GZ7A 1DQAA 3O9QA 2EFQA 2COLA 1LWCB 3M6VA 2W4PA 3T7ZA 1IG8A 4FW2A 2C1EB 4ANCA 4Y6IA 1Z25A 3FE1A 1JLCB 1UJ5A 3PRBA 4CJ4A 1Q81O 3QGPA 4C8KA 1HBUA 2DHAA 4C0HA 5AQXA 5DJBA 2E20A 2XMMA 4X65F 1HIYA 1KQGB 3AVMA 1KTQA 2VPWB 3CCUN 1F60B 4B9SA 2XULA 4ZVUB 4J9QA 1NB7A 4N8NA 2RKIB 4JI8K 2OEJA 4BGBA 3OS0A 2QMWA 4F9OA 1U6ZA 1WG1A 2ZF5O 2P9SB 3RVCA 3HHLC 4CE9A 3OY9A 2V4RA 4AT1B 5FROA 3HRGA 1WI8A 4AXJA 4AQYK 1U09A 2E5IA 1HWKA 4I0WA 3AH6A 3QESA 1CZ9A 1XMQK 5AXLA 2UVVA 5BR9A 2YX7A 3H8YA 3EZOA 2CJAA 3LDLA 4E7IA 2R8JA 1KHWA 3OXFA 3D0IE 1VSIA 2QO3A 3ZT4A 5EHHA 3ZSOA 3G2XA 1IV0A 3BP8A 4Q43A 2RE2A 4ECZA 4GV3A 1Q1KA 5F0UA 4GKJJ 2C2OB 3K17A 1CJKB 4M41A 7AT1B 2C2MB 3C3LA 5HK4A 1SS6A 4J7CA 3TJ8A 3THXA 4KHQA 1DQ8A 1WF0A 3EL2A 2A1SA 1ASUA 1BMQB 1KC8O 3IG1A 4DHYA 2R2TA 2DK2A 4NYZA 3LP2B 1WSEA 1JCEA 5K9FA 4BC5A 1OKJA 3IDHA 5L1IA 4RG8A 3Q8QB 3FJ2A 1RU2A 3DLBA 3AAWB 3NS6A 4F4AA 3OFEA 4B3RJ 3MM6A 4KAIA 2Z8QA 5CR4A 2KT2A 5IT9Y 3VWSA 3KG1A 2AT1B 1HNXF 4KPYA 3AVFA 1JJCB 4JV5K 3NLCA 4FJKA 4QOZB 2B3TB 2J8AA 2V34A 2HOEA 5KFRA 5HMWA 1FRJA 5A8KA 1W26A 4USUA 5JICA 4CO0A 4ZCMA 2YHXA 2LVWA 3HD1A 2FD2A 3SQGA 3HKZD 3WXLA 1RT2B 4IFEA 1CSJA 1VBZA 1FJGJ 4FYXB 4XDCA 2OEMA 5JXSA 3OS2A 4ED2A 1AT1B 3CWJA 1AROP 2Y1JA 5JVGQ 4K41A 1WSJA 4NXNJ 4B3MF 1RTHB 2OCEA 3B82A 3BZKA 1SKWA 4DKWA 2CDQA 3QQCD 3LANA 4CZHA 2O01C 2KZMA 2OTJS 2RHQB 1BLUA 3K8WA 4M5NA 4LVOP 1RAGB 1NK4A 2LSNA 4XK8C 1WKJA 4YR0A 5AZIB 2G13A 2XRIA 1IKVA 2VCPA 2AGPA 1Q16B 1GXUA 4DX5A 4LBHA 4EYHB 3F44A 4IRDA 3RSEB 1TTHB 2KQ2A 4DN0A 1UVJA 1RBOB 1U25A 2DCUB 4CGFA 4L3QA 3O3FA 3ZZTA 2P5GA 3C6UB 2V2ZA 2VWBA 3KIOA 4JI0F 2BJ3A 4BS2A 1K8KA 3C19A 1RWVB 3HCXA 2GC8A 4LFAK 4BQLA 3BYPA 1NB2A 4MO4A 2P2CB 3LA0A 3UE2A 3PIOL 2MKKA 2KKZA 4Y65A 5CZXA 2GWKA 1FRMA 1ELOA 2ZNZA 1D9FA 5FRNA 2YX6A 1H2TZ 4RJVA 2CGLA 1VIOA 4M5HA 3D45A 5T7LB 1TMMA 2HG4A 2QL5B 2VPXB 5AXNA 3PO5A 3W7BA 1RABB 3LP0A 4I69A 3FMWA 1HNVB 3MMCA 4Y0FA 1HQEB 5KG4A 1ZC6A 3OLAA 2J7WA 3N01A 4CZJA 3PX4A 4DV6K 3OL7A 2R8HA 4K50A 4RNOA 1VC0A 3S7RA 2KXHA 3CPEA 1HR0K 1XEZA 1GMVA 3W63A 3JYTB 2MQPA 1SBRA 1MROB 5BJRA 1IJJA 4IG0B 2K7KA 2HHSA 2E7XA 1OH6A 1JIHA 4DR4K 2IJRA 3HM9A 3BYRA 2UVUA 2ZEJA 5KG3A 1HBOA 2APOA 3A8YA 2HHTA 2C3OA 4KY3A 3JQKA 3RWUA 2DNMA 4JI3F 4BRKA 2B5JB 2E2OA 3OR1A 4CJFA 1RFQA 3O1BA 3MCMA 3ZZZA 1HWLA 4NLCA 2F8EX 1FVQA 1N32K 5THWA 4FJ9A 1DQ9A 1TK5A 1UWAA 5KT2A 3V4IA 2XHWA 2KXFA 4CJQA 2IPOB 2BA9A 2VL1A 3HSCA 1WF1A 3ZZRA 2CWKA 4ECRA 2Q66A 1YRUA 1IWGA 1U1QA 3TAMB 4CGJA 3R7NB 3M8PA 2JLFA 1RTIB 4DMZA 2KT5A 5DO2A 2CG8A 5HQ8A 1RWNB 4DHVA 2V63A 2ZM6F 3IRXB 1BGXT 2IFXA 4B17A 4PPDA 3DI6B 4BY9C 4CLKA 5F9LA 3DGPA 5HO4A 4ZPWR 3O8MA 4FYVB 5I3QA 4XPCA 1T7PA 2IM1A 4JYAJ 4CO5A 2AV5A 3N6LA 3OD2A 3AVAA 4B8AB 1PYSB 4OKKA 1UWBB 1OYDA 2Q36A 1N5TA 2IMOA 6AT1B 1ZBLA 1S9GB 1R0AB 1GFWB 1GK8A 5K8MA 1HKBA 4CP5A 4ZS6A 1CJVB 1NGEA 2RMLA 3CCZA 3MR3A 2UXCF 4YY3F 3O5TB 1OMSA 5F41A 1ZBIA 1NUEA 5E33A 3Q7CA 3PR5B 4IG3A 3F56A 4C8LA 4U96A 4LR7A 5KT6A 4I7FA 2ZH6A 1ATNA 4TY8B 1SIWB 1T6DA 4UUWA 2QXLA 3TP2A 4JK7A 2IC3A 2DY9A 4N41A 4LF2A 4LFCF 1YTAA 4ZTFA 4CEDA 2RU9A 4JI1J 4CT9A 2MYFA 3NMUA 5L1LA 1NMNA 5F8JA 4DV0F 4N8OA 1NGCA 2W6LA 4B3OB 3TTFA 4FJHA 2NSBA 3VMFB 3SAHA 2I8EA 2KU7A 2PFUA 5IT9O 3TWHA 4CZLA 1PC5A 1S6UA 1VC5A 2H48B 4JI2K 1CEZA 4Q44A 1ZETA 3UE5A 1OO0B 2ZH4A 2MZJA 4X64K 4B9MA 2WSEC 2D3O1 2NRTA 4Y00A 1P9QC 3IWXA 1NMEB 5KPTA 3CCWA 4CF1A 1EARA 1GLLO 1UA0A 1NPPA 4MDAA 5B0BA 1XNQJ 2QG9B 4OYWA 4F4XA 4OHZA 4ANDA 3AO1A 1QE1A 3CJCA 2R9LA 4BRMA 3MCPA 2VHGA 3CCLN 2YPZA 4CGHA 1FXXA 2CQBA 1XIQA 2V2VA 3MAAB 2M70A 4IRKA 4DR3K 2HHQA 3AVCA 2F8SA 3KDNA 5M1OA 1VGYA 2KVIA 4OX9F 4DL3A 5AJ3K 2YNGA 5EX3A 3PW2A 4HACA 3D6MB 1Q53A 2CQHA 1VLYA 5DQGA 3Q24A 2LQ9A 2XI2A 2FGOA 3AODA 3N28A 1NM1A 3H90A 2B4PA 5GMEA 1VQ7N 1E6VB 2WCXA 3P49B 1ZPWX 3WEEB 4ZPBA 1N8RO 1U1KA 1ZM3A 3X3UA 2AD9A 1PILA 1IUJA 4KYZA 1XMOJ 1S6OA 4RUBA 4LF7F 2I1RA 1UZDA 3CW2C 3WC0A 4OJ1A 3NF6A 4DV4F 1FDNA 3M6UA 4C3LA 3HHNB 2P9UB 2PYJA 4IOCL 2Y8YA 5A2QY 3GDQA 4H8KA 4O3PA 3UNGC 4O44A 1KBRA 4ZA1A 3LZJA 1EHWA 3TI0A 3NH1A 2Q0UA 1FA0A 4ILMA 3D54A 4FKYA 4GKKK 4V19X 1L3UA 3V1OA 4EO6A 3IFRA 5KFIA 4CIFA 4JV1A 1K9MT 1VRUA 1SKUB 3TQ1A 2XQCA 2RH3A 3W66A 2XHBA 3SPZA 2VB6A 1S10A 3C8YA 4O23A 4DG1B 1WSRA 2F8HA 1RILA 4IFVB 2O8DB 2C2DA 1QQCA 5LJVA 1M5OC 1X9WA 4NRTA 1NH8A 3NAIA 4RW8A 3F9KA 2H5EA 3UN5A 1T9YA 1I1GA 3DM2B 4A47A 1IR1A 2FY1A 4JK8A 3VQDA 4OI1A 3TX0A 2X1AA 1PJ7A 3R3TA 1DRZA 3I55S 2N3OA 3L6QA 4P7TA 1RHJB 1YJNS 3E8OA 2GQCA 3CULA 4O5BA 2HHWA 5FPNA 1BE4A 2IA6A 4F3OA 4DV7J 2OMLA 2X51A 3EZ5A 3G25A 2YXLA 5DDOC 4DL5A 3DOMB 3OYMA 3CCSS 4FJGA 1KEKA 2J6SA 3QRPA 4C8OA 3AOCA 5A8WB 1KAXA 3JS9A 4WQ5A 1IN0A 3TARA 3EGZA 4KHPF 4OYIA 4E0DA 3DRPB 1BISA 3ZSZA 4ZVRB 1BQNA 1OPZA 2XMJA 1R59O 4ECUA 3CC4S 2PGCA 2GFFA 3U3YA 2RVJA 3EVWA 5LSRA 4OO1J 1UPMB 3DN9A 1S72N 3LF0A 4RWWA 3QGHA 1NPRA 2NRXA 4PUOA 2CH5A 3AVNA 2UUTA 4RCHA 1FKOB 4CI6A 4HL9A 2A6AA 2Q3SA 5IOLA 3K0SA 1X4BA 3GTYX 3DLJA 3LPTA 3KK7A 2VPYB 1HQUA 4A48A 2KI2A 4NO7A 4Z94A 3SCLE 4OJRA 3J81U 1TQLA 1QAIA 2HAFA 2YWWA 3AY0A 2EEYA 4DX6A 4ELTA 4NYOA 3FEXB 1RHUB 1B3TA 1BQMB 1GLFO 3W60A 3WXJA 2OZSA 4K42A 4CQ1A 2FVPA 1A5VA 3G87A 1UA1A 3J7YI 3EZWA 4FJLA 4CJKA 2NREA 4FVCA 3V6DA 1KSPA 4FPIA 4ENOA 2WONA 3ZCMA 2VOOA 3N6NA 4QCLA 5D0RA 2QWMA 3UB5A 2ZM6K 4Y34A 5DDPC 3NGUA 1SKRA 2QWOA 4CGGA 3VQ8A 3VESA 4DFJA 2FHJD 2L08A 3MEGA 2KXNB 2EXUA 8AT1B 2J6UA 4GVBA 4ED0A 1YX2A 4M5MA 1SH3A 4LQ9A 2QN6B 2VU5A 4F4YA 2DNGA 3B6PA 5KT7A 1PJ5A 3KLGA 3QNOA 3FZFA 1QD1A 3TUZC 2K1RB 5C24B 1TL1B 2DXEA 3EJMA 3QT5A 1XQIA 2F7VA 3MMJA 4X4RA 3ZT3A 2YKNB 3S3MA 2XWXA 1JCGA 3M2RB 3SCIE 1GQEA 3ILOA 1OSDA 2MTLA 1IM4A 4QIVA 3KUEA 2GGPB 2CJYB 4DWIA 3IO1A 1U2VA 1LOTB 4ED7A 4ELUA 1DY3A 4YOWA 3J8AA 4K4ZA 4FJIA 4TXSA 1DAXA 4F4ZA 3TAQA 4YR3A 3G0ZA 2XS2A 2R8GA 4BRHA 4JI7J 2X1BA 3VA3A 1XK8A 1KVKA 2BMBA 4A2AA 3LO3A 2QE5A 2BV3A 1NKCA 1QJHA 4TYAA 3KK3B 1PKUA 2GAHC 1PIEA 1CPZA 2HBMA 2VPZB 1D0EA 4Q0BA 1S6QB 2GVDA 4ALZA 1SL0A 2VA3A 3QRQA 1WHYA 4M95A 3KLEA 2E1ZA 1DFDA 2AW0A 1S1UB 1X60A 2BE2A 4IQMA 1AW0A 3QO9A 2OYQA 1Y3JA 2O8EB 2QC3A 3D6TB 3SDEA 1YVUA 1HNZK 1QQOA 3CCES 1KAYA 5A2QO 3C16B 3VTIA 1DTQA 3EKUA 2HS4A 3V9UA 2YKMA 1R8BA 2XWYA 3GJRB 2E2NA 2YHBA 1RACB 1HWUA 1T9TA 2Z57B 2D74B 2C22A 1HNIA 2AJ2A 4M3XA 3VHQA 3VAGA 4OX9K 4LF6F 3V4MA 1H7WA 2HNZB 3AVGA 3IR6B 5H9FK 2QLXA 1RADB 2LDYA 1Y10A 3AA3A 5KG0A 1NH7A 3MPWA 2AKWB 4OKJA 2W2OP 2F63A 1C0TB 3L7UA 4CBXA 2KL8A 1BIZA 3I8BA 1XC9A 3HKWA 3J80U 4DBQA 4PWDA 4Y1CA 1M5KC 3B78A 4GMJB 1M5VC 3Q8UA 2LQJA 2CNNB 4LFBJ 1WLJA 3RB3A 2C2EA 3PYDA 4DCHA 3N0VA 4ETZA 3KHYA 4DL0C 3NBPA 1S79A 4EBCA 2YJFA 5AZJA 3JTPA 1ZS6A 1CQMA 4Q2LA 2GCFA 4R0JA 3PW5A 5HBMA 5HL7Q 3GR1A 4YDUA 2VA2A 3WX8A 4MK8A 2IVNA 1KKHA 2E8AA 3GOIA 4KO0A 1YITN 1Y64A 3Q89A 1WC5A 3MPUB 2ACYA 3VF4A 2ALZA 4Y1DA 4CJVA 1W7AA 2KYZA 2OTJN 3TWZA 1S4EA 3MN5A 2PYLA 3BH7B 3B8AX 3QSYB 4JS5A 1VSKA 4PG8A 4ZVEA 5LJ3Y 5J2NB 2QZ8A 3H7HB 5AFUH 3IXQA 5AQYA 4BBYA 1AXQA 2PFDA 2ZH1A 2YX1A 1U47A 3TR8A 2ASJA 2HNYB 5KFVA 4AHCA 2BM0A 1UFLA 4KTZA 1S1XA 2EK1A 3A8KA 1JB0C 5RUBA 2UP1A 1HX1A 4LF4K 4U95A 3U8XA 2CPIA 2W9CA 5LMUK 1RHKB 3GFXA 3TUPA 2H4WB 1C1CB 2VC1A 3OT9A 1J54A 4CFCA 4TU7A 2ADBA 4LF9K 3O4QA 4K0KF 3PFEA 2MHEA 3C2PA 3T1AA 4KGZB 4CYUB 4I64A 4LSNB 3X1LB 4QPXA 3QBWA 4JD2A 2F40A 5ETVA 3E2EA 3CJQA 4DL7A 1W25A 1YTUA 2WVCA 3QYYA 3TA0A 1ZM4A 3KHHA 2HHUA 3R5AA 3CD6S 3KDOA 5AQZA 2MKCA 3SQOP 5ETRA 1KVIA 2HRTA 5AQUA 2P5OA 4KHPK 1CULB 2YBVA 2I9SA 4DTSA 1A6LA 1R8CA 5I3UB 3EWGA 2BBEA 1RK8A 3DJCA 3WUHA 2ATCB 4A8KA 2EC2A 1KNZA 3FCVA 2AU0A 1KQSR 5M2UA 3CPWM 2LXUA 1R0CB 4K7QA 5B09A 4RW9B 4A8SA 4U8VA 3SCJE 5C12A 4ZTJA 2HB5A 2UU9K 2A41A 3POTB 3IC1A 2BDPA 2BR0A 2QK9A 4KH6A 4DB3A 2MZQA 1FRIA 3SI6A 3MCAB 4ZVTB 2QL7B 3LDSA 3H5UA 4QR1A 1XMBA 2N3LA 1TYQB 4NLVA 1QHAA 4FPBA 2X6NA 4C1NI 1JKHA 5LSOA 3R7SB 3PLAA 4ZVHA 3HHDA 2YNHA 4YNQA 3EN9A 4ID8A 4QIGA 5B0FA 1VRQC 4DPWA 3D2FA 4HLBA 3V81A 3QAUA 3Q8YA 2G8HA 1IJFB 5D77A 1NLKL 1RT7A 5C25A 3M8QB 5AFUA 5L38A 3AHPA 3M9OB 1HHQA 4CDIA 2ZUAA 3EUNA 3LDPA 4J9SA 4J9VA 4J9RA 4FK4A 1VQ4N 3L3VA 2V94A 1I5OB 4FF4A 2OSRA 3MTJA 3R6GB 4CLUA 4ILRA 1VR6A 4WKYA 2F9TA 4NLTA 3I4PA 2HHHF 2VASA 4IXCA 3QAEA 4FM1A 3AY9A 2RHSB 3A3PB 4O4GA 3QWUA 4YB1P 1YHQS 1RDRA 3HF5A 4CESA 4DR2J 2WVFA 4JI5J 4WK1A 2JFDA 2VG5A 2R7SA 5DG9A 1RP5A 4DV2J 2QT7A 3OTEA 5ETSA 4CNZA 3HBTA 5FPMA 4M5KA 3T3FA 1IBLF 2RUGA 3I0RB 4X62F 2F8TA 2IDEA 2PC6A 3SQ2A 2XI3A 5HRRA 5H1SQ 2UUBF 3L9ZA 3Q86A 4C8ZA 2HQIA 2XNQA 2DPIA 4EI2A 1VQLS 1SUQA 3LW5C 5KOWA 3GFHA 3LGHA 2VQFK 3TYTA 1I94J 4BRPA 3DRSA 5IQQA 1NGAA 3RW6A 4AHUA 1FW6A 2FHMA 4MYTA 3PG9A 1IKYB 1WEYA 3NOCA 4QQBA 1FESA 2CVIA 4DUZJ 3E9OA 2V4JB 2B4VA 3OPKA 4ZVQB 2RKIA 3A5NC 3CD5A 4CJSA 4CFBA 1NBEB 3AFGA 2HFSA 1G3OA 3OHRA 2P9SA 5KFCA 1RBTA 2VWJA 1NM2A 5K20B 3VTHA 2E1YA 4J2AA 3CDAA 4IO1A 4AFFA 3CQXA 4M63A 4DLGA 4NASA 1URNA 3ILLA 3QEXA 5A0YB 1K6YA 4E7KA 4GKJF 1OIAA 3OTOJ 4YHHK 3QEPA 3AA4A 5H9EK 2CAJA 3VETA 1NBWA 5KFOA 4OI2A 5KQ8A 4LF6K 4CJ5A 1TL4A 4PY5A 1M5HA 3ITHB 4OPHA 4PQAA 2DNZA 4USIA 4CTAB 4RNMA 5CXTA 4C1NK 2K2PA 1GMWA 3KLIB 3R6LB 2ZGYA 3OXLA 1U1OA 2RQ4A 4F8RA 3TRGA 2CPJA 4DR5K 3LM9A 3GV5B 5E3PA 4Z2XA 1TK0A 4FO0A 4BWJA 1SC6A 2FJBB 5AQFA 5FLXY 5BPNA 5B8HA 4DR7F 1VQ6S 3LP2A 4U7UD 2G4BA 3FSIA 1REVA 1YBTA 3DDNA 4KGMA 1IKXB 1EWQA 3BGRB 4NYFA 2VDIA 2V51B 4ECSA 4O0JA 4CW7B 5AQWA 2M9KA 1YJWS 2ROEA 1JXVA 3VZIA 2DPJA 2QWLA 4IH7A 4KJIA 1H2UX 1B4SA 2VGNA 4NXNF 1YJ9S 2NYIA 5IFMA 3AB2B 2MZ1A 1VK8A 1VSDA 2VQEK 3OW2M 3JB9k 2K3IA 4UUXA 3MMAB 3H4DA 4K4YA 1NDLA 4QPTA 4DR6K 4P74A 4QU7A 1FKPB 1RT2A 2D69A 4QIEA 4OZ1A 3I9ZA 4KBIA 5KFKA 1MWZA 3Q8PB 1NDKA 4LH5A 1UVKA 1Y11A 5J1NA 2MKSA 4FJMA 4QW9A 1VK0A 2B56A 3DLEB 1RTHA 4I2PB 4GV6A 4FOEA 4DQIA 3AO3A 3C6TB 1KOHA 4DPOA 2HVDA 1YJNN 1Q78A 3G8TA 2V9WA 2XSJB 3T9ZA 4A8FA 1VQMS 5AZIA 1WG5A 1WC4A 2FLLA 2BRLA 1YBUA 1EWRA 3RSEA 1S12A 4CIOA 2HAIA 3O1WA 4YOEA 3C6UA 4NL5A 4I6YA 4UOHA 3H2LA 1WHXA 5JMNA 4MFBA 5JS2A 4RLEA 2PMZD 1UVMA 3SAGA 5KAKA 3HSJA 1NLVA 1N54B 2AWZA 2BX6A 5L39A 3CC4N 4G1IA 4H4KA 4CNYA 2DFEA 1N6QA 3EMTA 3ZT0A 4DTJA 4TQRA 4H0YB 1P1LA 3FSXA 4LF8J 2V6AA 1H0HB 5T7LA 3T1HK 3P5JA 5EVZA 2H54B 4AL7A 5I42B 1HNVA 3S01A 3RRKA 2WVEA 2E5LJ 1HQEA 1R8HA 2BEFA 5KFZA 5T7BA 4DPXA 3HMJG 3PV8A 3PRVA 5EUHA 4H4OB 5L46A 3VQ9A 4FLTA 2EFNA 1DLOB 2KKHA 3CCTA 1W2BM 3V6JA 1N5VA 4J9OA 1K1SA 4K4VA 1HPMA 3K89A 3JYTA 1MROA 4USTA 1KLMA 2EKNA 3FCHA 4IG0A 4KB7A 5IWAF 5HN0A 1M0SA 2FVQA 1WOQA 4G65A 3WXMB 3CGIA 1IBCB 1VSJA 4PG4A 4OGEA 5M2RA 4BDYA 1WUUA 2BRKA 2ZJPQ 2KO1A 4DSEA 4M3TA 2BABA 3TOQA 2QW9A 4LSZB 3MCSA 1M90T 1N48A 4O5FA 4ZJQA 2KDOA 4PXCA 3QT6A 1F21A 1N5SA 3BEGB 3P38A 2EFGA 3U27A 3NGIA 3NAEA 4MAKA 3GFZA 3K8VA 3SJJA 5CAAA 3TAMA 4CJWA 3D66A 5KGXA 4JYAF 5DZ6A 1RTIA 1T11A 4IFYB 5BPLA 1RGVA 5AQNA 2XYHB 1GTHA 3K57A 3MGJA 1K0TA 3IRXA 2J0SD 4HH0A 1PO6A 3DI6A 4IOCQ 3W5YA 1NK7A 3NOGA 3GIRA 4RU2A 1X4FA 4ES3A 2KFYA 3SBMA 1QVFR 1WC1A 2LYVA 2RT3A 2E6MA 3G6YA 5G0RB 1HKGA 1UWBA 4D3HA 4NLOA 3U1NA 4PWUA 4I1TA 2GEMA 1S9GA 1R0AA 1OYEA 1Q82O 1CJVA 5HRPA 3RTVA 3DRYA 1HW8A 4YB5A 4JI1F 2PSZA 1RT4B 1FDAA 2OPQB 2EBGA 1RYSA 4O4RA 5D4PA 3ISNC 2IRUA 1Q79A 2JH3A 4JI0J 5EOYA 4AHRA 2DPNA 2K06A 4TY8A 3I8DA 1XJWB 2JJ4D 4HT7A 4USHA 2MPUA 2XCPA 4DV3J 1R8AA 1UW9A 3V9SA 4Q2MA 5AE1A 4C48A 1X9SA 4LREA 1WSVA 2ZZNA 3CCEN 1U8WA 1N33F 5HP1B 1ASVA 2G2OA 3CCMS 1WSGA 1JMTA 1LXNA 1WDTA 3N5BA 1TKTB 1EETB 4B3OA 1XNQF 3BGFA 3VOVA 3D0PA 1NAQA 4JK9A 1YJRA 3D1OA 4C3KA 2VGMA 4GKJK 3I32A 4YN3B 2HSEB 3DDKA 1UPPA 1V6HA 1RBAA 1ICEB 5KFXA 3I31A 4PABA 3KUHA 2VV5A 3OLBA 3QGGA 3CMES 4HHTA 1FFWB 2KHOA 2GVZB 3OJUA 3GIIA 1RT3B 4ILLA 3S6EA 3CQYA 3HHLD 5I3PA 2BOAA 3IP0A 3BN4A 3TNVA 3QJPA 3AV9A 3SQ0A 3HZEA 4LH4A 3L0QA 2IGIA 3MAAA 2OUGA 2HF3A 3ZEUA 4B3RK 1EZZB 2W2NP 4JI3J 2WB4A 3NS5A 4JV2A 1A9NB 4Y0WA 2N4DA 4R79A 4ETXA 2J0QD 3I56S 4N76A 2HMIA 4OYMA 2AYEA 5DETA 3JSMB 2X3GA 2R7QA 2NRWA 1HLUA 1GMWD 3LGMA 2GHPA 1L3VA 5JVHL 2P9LB 1R31A 1C0UA 3L7PA 4O3SA 3ENAA 3K5OA 4I67A 1NK8A 4WQ4C 2DNRA 1GXTA 3CCRS 2QI2A 2DR5A 4QWAA 3VGUA 3ZSYA 4BVPA 1FJGK 3WEEA 4WF9Q 3MTKA 3G82B 3HDSA 5CYQB 2FJWA 2HWIA 4RBTA 2H4YB 4X2BA 3FEZA 4WWSA 2YY3A 5HMZA 2W7OA 3DXSX 3VZHA 3W62A 4DUYF 4ED6A 2P9UA 2FBVA 2NZTA 1UVLA 1R6VA 2V0NA 1J5EJ 1UFKA 1OY9A 1MWQA 4KKOB 5KFFA 2OAUA 1CVJA 4KHWA 3J7Z5 5KI6A 2IRYA 2KJWA 2QKKA 4FL9A 4MKBA 3OYJA 2UXCJ 1RCOB 2E9RX 3AT1B 1SJ1A 4NXMJ 3VQAA 4YP3A 3ZTRA 1Q7YT 4W92B 1ZOTA 1WC0A 3MFIA 2M8HA 5MAOA 4TNOA 3C14B 2DXFA 2HPUA 3PTWA 2BJ9A 2B51A 5G4DA 4DG1A 2CH6A 3D68A 3VAJA 2DO4A 4ILGB 2O8DA 2RJZA 5DLFA 2DR8A 4JI6K 2GO8A 5KFWA 4C0OC 1TELA 5E3RA 2YNIA 4WFAL 2V67A 4DQPA 4OJ3A 1IWAA 1VBYA 4NRUA 3HP6A 4IH5A 1DBDA 1U1RA 4PKHA 1UTAA 3AO5A 3DM2A 2P9IB 1H73A 3SV4A 2B6AB 1IXKA 2O8CB 3EVOA 4NX9A 4DDFA 4F36A 2JZ5A 5DG7A 1DTTB 4ZCIA 2WBRA 3MMVA 3OFGA 2R2SA 3IWLA 4UT4A 4H4MB 1D5AA 4NLPA 2GX9A 2CQ4A 4L3KA 2CJ9A 2GIRA 3IGVA 2L3MA 4RBVA 3DOMA 3CJ0A 5EY4A 4QW8A 2LQ8A 2BKOA 4F2SA 4Z4IA 5EX5A 4C8MA 3QEIA 5A8WA 1VQOS 4ECVA 2ZKTA 1EKEA 4FYYB 3A8JA 1APSA 3LPYA 1F0XA 2DH8A 4NB4A 3DRPA 2V69A 2UYTA 1LFPA 5GAGP 3OYHA 3I87A 2FVCA 3SV3A 5KFQA 4OI0A 5ETLA 5HSPA 2FIUA 3B54A 1VBXA 4YB6A 3EICA 3MUTP 2DTJA 4HR2A 4J9MA 3QEWA 2HFZA 3O5BA 3NRBA 4XPEA 4LJMA 3AD9C 1P8GA 2F3JA 1YDLA 4RBUA 3BZQA 3CT9A 4PQUB 4N56A 3KKRA 1WG4A 1NSAA 1JQGA 3HHKA 4CFDA 5MLCV 2XY6A 1R7IA 4BG8A 5F0XA 1GLEG 1Q8LA 3BF4A 1TL5A 1OJ4A 5GAGU 2CPXA 2NLWA 1HMVB 3VF0B 4FF2A 1Q7LB 5KFDA 4OLAA 5F8LA 1N5QA 3RMAA 3O9RA 1BQMA 4JI4F 2OTLS 2KRBA 7FDRA 2ZWHA 4DFKA 3RRHA 4CJPA 3U3GA 4PXDA 5E5NA 4JP8A 2CFXA 4ILJA 3LH2S 3OYEA 4LF7J 3ZXWA 1O8BA 3L3CA 1FFGB 3ZETB 2VG6B 3R5JB 4BRCA 4JYAK 3UIQA 4JKBA 4Z4CA 1K8AT 1Z6RA 1JNRB 2P9PB 4ZIVA 4XO0A 3OUYB 2QWRA 1VI7A 1MMLA 3E01B 2ZH7A 3OVBA 2Y1IA 3MM5B 1NU0A 4ID1A 4ZP9A 2CIMA 1IBMF 5C10A 2ILYA 1JL1A 3QJJA 1SC3B 2KRRA 3RG6A 3FBEA 2QA4G 1T05B 1VQLN 2EG2A 4DX7A 4JAXA 4X4PA 4ZPVR 4Q8EA 5IT9U 3C7NB 2K1RA 2XHCA 1RGIA 3Q2SC 1P1TA 2ITGA 5C0YA 1BL3A 1JLBB 4DTNA 4ELVA 5GIPA 3DU6A 4FS2A 4JI7F 2YKNA 4WQ5C 4EEYA 5U47A 2G9OA 3M2RA 4DU1A 1JJ2M 2WK4A 4C98A 2GGPA 3F5TA 2MKHA 3P3DA 1FDDA 3UD3P 2PE8A 3G6XA 1EQYA 3R3LA 2IAJB 2FLOA 2NNWA 1T03B 3OTCA 4ZOSA 3GPAA 4FWMA 2A1BA 3H08A 1Z05A 4ITSA 1HHSA 1XNQK 2QWNA 1XBWA 4BE1A 5CA5A 2DHXA 1NPKA 3KK3A 2UUCF 5D0HA 1S1TB 1S6QA 4JI8J 3KLFB 2IVMA 2Z30B 2C3MA 3A3OB 3SBTA 5KQDA 2X7IA 3PX6A 2YH0A 1B0PA 2IHR1 2MMYA 2PIIA 3M9NB 2O8EA 2HWTA 2XM3A 2UXBF 4ZLNA 1C1BB 3VCDA 4AHVA 4C6AA 3P4IA 2O4GA 3F9MA 5F2RA 4IKFA 5FIIA 4B3SF 1RAIB 3C16A 1NDCA 5KT4A 4ZPTR 4J9UE 1WAJA 4DTRA 4AL6A 1RHQB 2EVZA 1WNSA 1EO1A 1U02A 2HQ3A 2DY1A 1VQ6N 4OV6A 3QATA 1YK9A 3R2DJ 2KYXA 3BV8A 2EK6A 1OVQA 4NEYA 1VSLA 2HNZA 1MG7A 1XMOK 1KFSA 3SJHA 2P9EA 1ROFA 1FK9B 2R8IA 1KC8T 4PEOA 2V4QA 2ABYA 3NWRA 1KVCA 4OHVA 3CUNA 1C0TA 3OV7A 4JKEA 4CD1A 4DU8A 1YJWN 3Q2TC 2KT3A 4I6MB 2WAQD 5KPRA 3MX5A 3NH2A 1YJ9N 4WK3A 3D1QA 3ENWA 1HI0P 2DHGA 2Z1IA 4A62A 4OZLA 1FXRA 3K5PA 5HQLA 1G2EA 3J81j 2I0XA 1J53A 3Q23A 2E1PA 2XMAA 2DRBA 2F9DA 3U1MA 3W3SA 4RW4B 4FS1A 1E4GT 3H1QA 1MWYA 3G4SS 1WKKA 4L6V3 4DQ8A 3NMRA 3I5BA 4DF8A 4A8QA 4JKGB 4JV5J 4FCYA 4KAZA 2CQDA 1K9MO 1FKAF 5E2QA 3FFIB 3BQ0A 2AJ1A 2BJDA 1X4GA 3VQCA 5HRSA 3CM6A 4P7VA 2VJUA 3FEYB 4MIWA 3AVIA 2F4VK 1VLOA 5BN8A 1VQMN 5J2NA 5AE2A 3DWLA 1M1HA 1J5OB 2VFTA 2DIVA 2HNYA 1X3MA 5M1QA 5A76A 1CLFA 3QBXA 4PR6A 2HYIB 2O3DA 3HOTA 4KFBB 1DARA 2AX1A 4OX8A 4DUTA 1VQNS 3CJ7A 4B1VA 2J6TA 2E1MC 4DJBA 4DV7K 1CZAN 1C1CA 4ZPCA 4K8ZA 3ID8A 4ZPAA 1S57A 5KGWA 4CYUA 2IVOA 4CLTA 4LSNA 2C28A 1HNWJ 4PHTX 1N34F 4EFHA 4BRNA 1X1PA 4DPTA 1FE4A 4IDHA 3CCQN 2NS1B 3UDVA 4DTXA 2CGJA 2Q6CA 3TZWA 1K73T 4M8LA 4USKA 1PBAA 4LFAJ 1HYVA 1PAUB 4AH9A 3PCOB 1N0VC 3LPEA 2RNEA 2HQCA 3O3HA 3L09A 4DL6A 4WP9A 3B4MA 1H1VA 3E1YA 1X5TA 1CULA 3H6EA 3M6XA 5I3UA 3BSNA 1GMUA 1YQHA 1QM9A 1MN7A 4L75A 2R7UA 4RW9A 4IKAA 5E3CA 3NCPA 1YBAA 3ULDA 3CERA 4I2QB 5IXUA 3POTA 2ZC3A 4H0PA 4OPKA 2FLNA 3EEQA 3D3BJ 3PW7A 2RE1A 4OVLA 4NCAA 4YDUC 3OTDA 3OYKA 2OIHA 1KCFA 2C3UA 4H54A 1RKIA 4LRFA 1YVNA 1N56A 5J2QB 5AXMA 5HI7A 1TYQA 4IOAQ 1S1VB 3WC2A 3FK4A 3DU5A 4Y2IA 4DR4J 1VAZA 3DOLB 1FD2A 2FY8A 1YG0A 2DH9A 2R2UA 3A13A 3MECB 2GA7A 2LXFA 4CF0A 2ZH3A 1H72C 5DM7Q 4C3MA 4H0TB 3W5XA 3TA2A 1RDUA 2CPHA 3EY1A 2F65A 4U6PA 5C15A 4TKTA 4RNNA 1S0VA 2R3VA 1KQFB 5KG7A 4HHJA 3U1LA 4IZ9A 1CC7A 3Q8SB 3UKRB 4JI5F 1VHFA 3GG4A 4USJC 2YQ0A 2RSQA 1HWJA 4DV2F 3PZPA 4CLFA 1IBKF 3IMQJ 1Y4ZB 4CHQA 3MF5A 1BCOA 1R6YA 4QS9A 1LCUA 2QTWA 2HKEA 2AEMA 4PCQA 3CF5L 1Q86T 2YJEA 5CYMB 2A0FB 2E1AA 2EKYA 4K8XA 3LQVA 3W61A 1XWLA 2HBZB 4FXWA 1S97A 3SK3A 4B9QA 4RW6A 3OTBA 2VFVA 3ZTOA 3KJFB 1HBUB 1I94F 4X84A 3AA5X 4CBUA 1TFYA 4A5AA 2XCAA 5A6WA 1BWFO 2BXJA 3I0RA 3BPSP 4ECQA 5A2QU 2WHOA 4K0KJ 1RBUA 2F1FA 3TPQA 2QWQA 3ZO7A 2NPIA 2QTDA 5KFSA 2DGXA 2GZOA 2MGZB 2B4JA 2O66A 1SJ4P 3UVJB 2MZRA 2UUAF 3EKSA 4XTTA 1RTDB 1VQYA 1IKYA 3MPYA 2V8DA 1D8YA 1IQZA 3J81Y 2V4JA 3V9ZA 3J7AN 4TU9A 3KHGA 3CC2S 3TANA 3HZ6A 3CEDA 3CMEN 2OFHX 2GW8A 3MPVA 1QZ6A 4QJVA 2OANA 3KWGA 2G8UA 3BO4A 9ATCB 3C66A 5L1JA 4L74A 4CEFA 3KTQA 4UZBA 1HWIA 5GAHI 4JKFA 2GS8A 1S7IA 3PJWA 3PKMA 3CM5A 3CC7S 4X4NA 5A0YA 3I56N 4X64J 4L8RB 3PW4A 3CHWA 2GBZA 2R42A 1M1KO 2X6SA 4B9NA 3OFHA 4ZJOA 2DGTA 2OGUA 3AD8C 5FDLB 2AP1A 1VQKS 3ITHA 1UEVA 1T44A 2YQ1A 2FC8A 2IVYA 1G15A 4LFBK 1YSJA 1B64A 1RB0A 4CTAA 4WFNL 3I9V9 3CCRN 3MM6B 2CQ1A 1RXOB 4DSJA 3KLIA 3CO0P 4GMKA 2RRBA 2IS3A 5AXKA 3OVAA 1XI1A 1KTVA 4RX6A 4OLOA 3NCIA 2HBRB 2O8BB 1S9EB 4MQ3A 2MSSA 1D9AA 2E1CA 5K14B 4ZP7A 4FWPA 5GINA 3UN3A 4JKAA 2YHYA 3AVJA 2FGCA 4QWBA 1RU1A 3CCVS 3O8WA 4ECXA 1OPIA 4F3MA 3JXUA 4B3TF 1JJHA 1UVIA 1E3MA 1EXQA 2N4CA 2OA8A 3BGRA 2MZTA 4ZLPA 4NA2A 1Q5VA 2EFOA 3O9TA 1Q9XA 1GAOA 2V8HA 1XERA 4GC7A 2QLFB 4NOHA 2HVHA 3BO3A 1U0HB 3LALA 1VQ9S 3HI9A 5J2PB 4EWTA 2R8KA 4BRFA 1YJTA 3MMAA 4LRBA 1QVGR 1LQ9A 1IBLJ 2EFPA 3T1YK 2BANB 1FKPA 3IBCB 4X62J 1HBNB 5T41A 1H38A 3HVTB 1RLDA 2UUBJ 1WAFA 3U9DA 4E19A 1X5OA 4AE5A 1FHTA 3BUZB 2GQQA 2KTQA 4DI6A 3MXHP 2D9PA 2O67A 3DLEA 2DNYA 4I2PA 2M0GB 3MCNA 4M63C 3Q8RB 5KG2A 3I5AA 1CS4B 1X3NA 3C6TA 1ZH5A 2UXDF 4F02A 1J27A 3L3UA 4WTYA 4C8YA 2ZH8A 2FVRA 5GMDA 3QB0A 4B1WB 1FJ7A 1R0BG 3F41A 3PY8A 4LF8F 4JKHA 4H0OA 2DNLA 1VQON 2J0WA 3KXDA 5EWFA 3W2WB 2E5LF 5KT5A 2HFNA 4TN2A 4B9LA 2DO0A 2FF3B 2D3ZA 2XLIA 3J80Y 3IMXA 1Q8IA 4I9LA 1FTRA 1VHIA 1VQPN 1X4EA 2HHPA 5L8RC 4LF5J 2FSNA 1WHWA 2P5VA 4DPYA 3OYBA 4MDBA 2LA4A 4A8XA 3M8RA 4ZHRB 2FUG9 4FJ5A 2XMUA 3CJKB 2U2FA 5I42A 1R89A 3QZ7A 5LL6Z 3CDBA 5DGBA 5BRHA 3BKFA 2POKA 4WBFA 2LEAA 5C5JA 4FLUA 4X4QA 4GY2B 4M1KA 4H4OA 1DLOA 3O4NA 4B08A 1RA7A 3E3XA 2WVBA 4ZJLA 5CHCB 3PXGa 3BN7A 3KVGA 2KVQE 3LPUA 4CLYA 4PPZA 3V4IB 2ILZA 2YNFB 4TYBA 3MPDA 3ENBA 4DU7A 2QWPA 4EP4A 2KG0A 3J7YP 2JOQA 4M5IA 5KG5A 4JEPA 2MQMA 4DR7J 4CJ3A 4BR7A 3TJ9A 3AJ1A 1VISA 3EDQB 2JEGA 1ZBHA 2DHSA 2G0JA 3DC2A 4DS4A 4QWCA 3IS9B 2G8KA 4U7CA 1P9YA 4WYLA 5JVHQ 4DR2K 4W5OA 4NCGB 4ZVPB 4BC7A 4WE1B 2DTUA 4CEZA 4RTFD 1TU0B 2FSJA 4DV2K 2AYMA 5KFNA 3UW1A 3AAQA 2IJFA 3J7YU 1FNOA 2ZHAA 3CNQP 4DX8H 3P6YC 3J81O 3TVZA 4A8OA 3JAMY 1NOYA 3NGTA 4UOGA 5AT1B 2HIYA 3N4PA 2ZH2A 2SXLA 1XHZA 3CD7A 1HYZA 2QA4S 4IFYA 4BACA 4IEEA 3I33A 1PYOB 1YRXA 4EBEA 5ELZA 3ZX0A 3GJTB 3D3CJ 2QYGA 2LU1A 4CLWA 3PM9A 3QSIA 3GG0A 3VERA 1I94K 1N36K 2MB0B 2HHVA 2GJIA 2HBLA 4E3SA 2WVDA 3UDEA 1T8EA 4I7FB 4U67L 2BJEA 4XH1A 4Y2CA 3A3NB 4CJEA 4H4KC 1SJFA 3MR2A 4KPCA 2M4MA 5G0RA 3ZTQA 4DUZK 1LW2B 4O3OA 2V2KA 4FWKA 2W42A 1RDAA 2RB7A 3NGZA 2LA6A 3PEHA 3MOJB 4R8UB 4DV3F 3TSQA 2PMHA 2CQCA 4IOXA 3JQJA 3A12A 1U26A 3Q7BA 4X66K 4FVUA 1RT4A 4CZMA 1WHVA 3BO2A 1ZYQA 2AIRB 2OPQA 3OL8A 1RBVA 5F8GA 2VF3A 4LF1A 3HP9A 2Z2MA 4JV0A 3BSOA 4IWVA 2NZ4A 1RTJB 3VA0A 4WCEL 4L3NA 4HEA9 3OTOK 1RCXB 4DSLA 3T19A 2FLPA 3GB0A 4A46A 9RUBA 1ACMB 2XEXA 3QETA 4Q5VA 5AQIA 3I6PA 4ZMMA 2DR9A 2EW9A 2P9KB 2YKQA 4PG5A 1TKTA 5DQIA 2LEPA 2PD1A 1AFJA 1CBKA 2AQ4A 2ZGZA 3OSNA 2J4RA 1WEZA 2HBKA 5HVGA 3DXMB 2O1PA 3CJ1A 3HT3A 4KB0A 4TSXA 3QFUA 4URQU 2JVRA 2QMUB 3R5BA 4FM0A 1XNRK 4W90B 5EWEA 2OMOA 1F9HA 1WORA 3EO3A 3K5LA 3EZUA 3VEZA 4OPAA 3FRZA 1KOOA 2CQ3A 3EM1A 1J6ZA 4G6VB 1EJ7L 3MEDB 2JWNA 3B4DA 4L72B 5IWAJ 3KHLA 1RT3A 1BG3A 1NJWA 1NGHA 2RHKA 3QPIA 3EYZA 3QMLA 3MEKA 3TVKA 3JTNA 3RBXA 1HKCA 3KWIA 5EXWA 3MD1A 3SFGA 4KI6A 4RPFA 2JRSA 3SCXA 3T5KA 3JSMA 4DV5F 4OPJA 3H46O 3QLHB 2LLZA 3G4SN 4DV1K 2P9LA 3EE3A 4NZ7A 2AMCB 1T9VA 2XY8A 1A5XA 1T94A 3RZAA 4RUCA 4KHYA 1BHLA 2R7YA 1PBUA 2XO6A 2JHEA 2RRAA 2VOPA 2GELA 1J5EF 2I6WA 1VFJA 4M42A 3QFHA 2GV1A 2ZJRL 3G82A 4RU9A 1RHMB 1NK6A 5CYQA 3U7JA 4PRFA 4FLZA 4WQ4A 4A4JA 3SIPB 3GYGA 1NK0A 3THWB 3J80O 3O9UA 1M5PC 2FJAB 3AA2A 1V3RA 3VQ6A 4NXMF 1WTFA 2BACA 5K8NA 5HLFB 3R5GA 1ZXOA 3DAWA 2AYGA 4F3TA 4KKOA 2ATLA 2EX3A 4K5RA 1R3NA