3WNGA

Cyclic hexapeptide pkidnp in complex with hiv-1 integrase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
138
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/peptide
molecule keywords Gag-Pol polyprotein
publication title Hexapeptide mimetics of LEDGF in complex with HIV-1 integrase
rcsb
source organism Human immunodeficiency virus type 1
total genus 49
structure length 138
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3wngA00
1WSHA 4CHYA 1RBTA 3QLHA 4DTXA 2X6NA 4FM1A 3S3MA 4M3WA 4FJNA 4FJJA 2Y1JA 3NF8A 3SUNA 1KRPA 1SL0A 3QIOA 2FBXA 3D0PA 3QEIA 1X9SA 4W5QA 4CEQA 3QEPA 4FYDA 3OYEA 4H4OA 5C24A 1NKCA 4KAZA 4DQPA 1FKPA 4IBNA 3ZCMA 2D5RA 5K14A 2O4IA 1LWCA 1WSEA 4HVJA 4C8MA 3V9WA 1BI4B 3KD1E 2Z1HA 1RBRA 2EHGA 4I7FA 1UA0A 2HNYA 3U6FA 4DS4A 3AVNA 3TAMA 1XHXA 3HM9A 4HHTA 4BDPA 3ULDA 2BGGA 1Q8IA 3KK2A 4DFKA 5CY4A 4CFAA 4O0JA 3LANA 4ELTA 3RR7A 2XO7A 1ZBHA 4CK1A 4DLGA 5FRMA 1J9AA 3SV4A 3PUFA 1A5WA 4CJSA 2OPQA 3TANA 4DQRA 4KRFA 4KV8A 3HYFA 1RILA 2IC3A 3P5JA 3LP1A 3NF9A 4CJQA 5KGXA 1VSLA 3AA3A 3MEGA 4I2PA 4CEZA 5J2NA 1SKRA 3KLHA 2XRIA 3KKRA 3VA3A 1LAWA 3DRRA 1NK8A 1JXEA 2OYQA 4PQUA 4EZ9A 1LW0A 4Q0BA 1K6YA 1X1PA 2VG7A 2X6SA 2D0AA 4DTUA 4QCLA 3KK3A 3QIPA 3I0SA 3NGYA 4E7KA 1ZBIA 3BGRA 1KFDA 3T3FA 3TR8A 4W5TA 1KVAA 2XHBA 3SPYA 4OLAA 4CFDA 3KJVA 4DWIA 3VQEA 1TL1A 3OYLA 4DSJA 4CJEA 3G0ZA 4FJGA 1RNHA 3LALA 3HP6A 4FW2A 1RDAA 2FBTA 4JLHA 3V81A 3VQ7A 1U47A 2B5JA 2Z1JA 4Z4CA 1UAXA 1JLBA 4CEFA 5FRNA 1L3SA 4LY7A 5KRSA 1NJWA 2VWKA 2GUIA 3U3GA 3LZJA 3VQ5A 4ID1A 3UIQA 1WLJA 4KTQA 4KPYA 3AO3A 3KLFA 4OKKA 4FM2A 5FROA 4PUOA 1BCMA 3RR8A 2G8UA 3QEVA 3SZ2A 1U48A 4F2SA 2FBVA 4B9LA 4PA1A 4O0IA 3K59A 3VQ6A 2BANA 2QXFA 2YKMA 2PYLA 5FDLA 3NCIA 4EZ6A 1B92A 1TV6A 4J2DA 2EX3A 2HW3A 4E0DA 5HLFA 1NKEA 1ASWA 4H4MA 4E19A 3TWHA 3LAMA 1C1AA 3TAQA 1UA1A 1J54A 1Z25A 4FZYA 3MAQA 4J2BA 3F73A 1S1XA 3V9XA 5I42A 3L2WA 1ASUA 5HBMA 2IAJA 3ZSZA 1QSYA 4M3UA 4FLVA 2E6LA 3TI0A 4E7IA 4M3XA 3KKSA 3ALYA 1HYSA 1WAFA 3DOLA 5J2QA 2JGUA 1DLOA 4CIFA 2GBZA 3K5OA 4J2AA 4NYNA 1BHLA 1BGXT 1BQMA 1C0MA 1JLQA 1YT3A 4DU4A 4DTRA 3RMAA 4N41A 4KHNA 2G8IA 4W5OA 3M8SA 1VSEA 1HNVA 1TL3A 3OJUA 4RW7A 3V9SA 4CECA 1JL2A 4E3SA 1L3TA 4OLBA 3HXMA 5HP1A 1A5VA 1WN7A 1IKWA 4EP5A 3RMDA 1RTIA 4BWJA 2YNIA 4EP4A 1HQEA 3HSTB 4ID5A 3D45A 3QEWA 3LDSA 3ZSYA 4CF2A 1NJZA 1SL1A 3IAYA 3L2UA 3OYDA 3AVGA 3RRGA 3SYZA 3NFAA 2LSNA 1U4BA 1ITGA 1JLGA 2P1JA 4DMNA 3KTQA 2B4JA 3LPTA 3MXIA 4K8XA 5EU7A 3L8BA 3S3OA 2PZSA 1HQUA 1NK7A 1RBUA 1FKOA 3SV3A 4B3OA 1N6QA 4CGHA 5KGWA 1NK0A 4LD0A 4I9QA 4FK4A 3SUOA 4HTUA 1EETA 4RW9A 4ELVA 1S1VA 1KSPA 1L5UA 2PY5A 1ZYQA 3CYMA 1JL1A 3EYZA 4DU1A 1BQNA 4RW8A 2RN2A 1QSSA 1I3AA 3DLEA 3K5NA 3ZSQA 5KTQA 4FJKA 1IH7A 3LWMA 4DTJA 4W5RA 2VG6A 3T19A 4CJRA 1I39A 5SZTA 4QAGA 2YV0X 1IO2A 4OKEA 3VA0A 1W9HA 1S1WA 5CYQA 4E7LA 1BISA 4DF8A 4CGGA 3OS1A 1DTTA 5T7BA 1IKYA 5HRSA 4FLUA 4FVMA 4FJ7A 1JLEA 4CK3A 4F3OA 4BDYA 3HP9A 3IG1A 3TARA 2OPRA 4B9VA 4HCCA 4FJ9A 3C95A 3HPGA 4KHWA 1RBSA 1VSDA 1WSFA 3DRSA 3E01A 3JYTA 4N47A 4CEDA 1CLQA 5C25A 1KLNA 1QSLA 1VSIA 1NJXA 3ZT0A 4ICLA 1VSKA 4CJTA 2RF2A 2AJQA 1Z26A 3AVCA 3RMBA 4F3TA 3AVBA 2OZMA 4C8KA 4CF8A 1KVCA 3ASMA 1UOCA 3NDKA 1IG9A 2X74A 3WNEA 3AVHA 2HNZA 1QS4A 4CF1A 1RT3A 1VSHA 1T7PA 1T8EA 4DFPA 4WE1A 1B9FA 3LP2A 4KI4A 4CHNA 4JRQA 4N56A 3AA5X 4PWDA 2G8HA 4DF4A 1S9EA 2KZMA 4AHCA 4LSNA 2BDPA 4DG1A 1XC9A 4M3ZA 1VK0A 3RWUA 1RTDA 5JS1A 2F8SA 4FJXA 4OGCA 2KW4A 4OVLA 4QOZB 4BACA 4FZXC 3OYAA 1HYVA 3NE6A 4FJ8A 1NOZA 1EKEA 1RDDA 2DFEA 3OYHA 3ISNC 4B08A 3PX4A 4LH5A 3TABA 1XWLA 3LWLA 2WOMA 3TAPA 4KB0A 4FJLA 3TAGA 1IKVA 1SL2A 4UQGA 4KI6A 1BCOA 4NCGA 1D9DA 3I8DA 4DTMA 3ZSWA 4FLXA 4IFVA 4KHUA 4DQIA 3L3VA 2W42A 3OYNA 1KCFA 3RRHA 3QO9A 4BE1A 3THVA 4G1QA 4ZTJA 3DYAA 4DTPA 3U3YA 1LWEA 3F9KA 1ZBLA 3RTVA 4O4GA 4FM0A 3NBPA 4DQSA 3AA4A 4YFUA 2X78A 2Z1GA 3K58A 4W5NA 1RT5A 4CEEA 1KFSA 1C1CA 3L2QA 4OPJA 1HMVA 3HO1A 1TK5A 1T03A 1VRUA 4BDZA 3O4NA 1KVBA 2OZSA 2OA8A 1JLAA 3OYMA 3SUPA 4CCHA 3QEXA 4F4KA 1N5YA 3NH0A 2I5JA 2RPIA 3LZIA 4FJHA 1W0HA 3VQBA 4JRPA 3O3FA 4M45A 4L8RB 2ZE2A 4KHSA 4M41A 1EX4A 2XY5A 2YNFA 1ZBFA 3MECA 1X9WA 4BE0A 5KI6A 4FK2A 3PY8A 4CHPA 3QNNA 4CIEA 3VQDA 3OYIA 2QKKA 3NHGA 4F2RA 4RG8A 2IDOA 3WNHA 4Z0UA 3SQ1A 3CM5A 4CFCA 4CGJA 1TKTA 2R7YA 3AO1A 3VQ9A 4ZHRA 4M42A 3HPOA 4E1MA 1QE1A 2FC0A 3OY9A 3S9HA 4Y1CA 2G8FA 4ZTFA 1BIZA 1TK0A 4CEBA 4C8NA 1SKSA 3IS9A 2P5OA 2P5GA 3V6DA 1SKWA 4CJPA 4KTZA 4HUGA 4DTOA 3K57A 3NF6A 4FLWA 3V1OA 1L3UA 4NCBA 3AVJA 5HRNA 3QINA 5I3UA 3MEDA 4DFMA 3CFPA 2WONA 3HK2A 4OJRA 1HYZA 4B8AB 3NGZA 3M8PA 3NAEA 1U04A 3SQ2A 1C0UA 1LAVA 3DI6A 4CGFA 1LWFA 4Z4GA 1TKZA 4DLEA 1RDCA 1U49A 4LSLA 3A2FA 3ITHA 3P1GA 4CEOA 1VSFA 2YKNA 2YNHA 1RBVA 3CM6A 4O44A 4E89A 4CHQA 4FLTA 1TK8A 2KQ2A 4AHVA 3NH1A 3OYBA 2Y1IA 3NH2A 2DFHA 1U45A 4DSLA 3EY1A 4PY5A 3CG7A 5J2MA 2ZD1A 4Z4EA 2HHQA 4B9NA 4IG0A 1HJRA 1JXBA 2A1SA 3OYGA 2P51A 1S1UA 5DMRA 4OGEA 3LPUA 4CESA 2Z1IA 1EXQA 3LP3A 3VQAA 3ZT4A 3PX6A 4DSFA 4HCBA 1MU2A 4CJVA 4DU3A 1S9GA 4R5PA 3K5MA 1NOYA 2HHVA 1RTHA 4CJKA 1J53A 1EP4A 1REVA 3H08A 2HHSA 2KFNA 4NCAA 1TAUA 1YTUA 4DS5A 4CIGA 4FXDA 2DFFA 4KTWA 3EZ5A 1SUQA 2HVIA 3HVTA 4FJIA 3PO4A 1CXUA 1RT7A 2HNDA 1JKHA 3WNFA 4CHZA 3NGIA 4FLZA 1NK9A 3M8QA 5SWMA 1D9FA 4DSEA 1KTQA 1RDBA 5KRTA 2ITGA 3AVKA 4CEAA 4B9SA 2YHAA 4IDKA 3OYFA 4DSKA 4BE2A 4E7JA 3SJJA 3WNGA 1HNIA 1CZBA 4KFBA 3DM2A 3MEEA 4JS5A 4F8RA 1O1WA 2RKIA 4N5SA 3QNOA 4IKFA 2XY8A 3G10A 3L3UA 1WSIA 2IOCA 4M3RA 1QHTA 2IS3A 3B6OA 1FXXA 4B8CA 2PYJA 1YVUA 3AO4A 2NUBA 1BI4A 3CFOA 4FJ5A 2HB5A 4DTSA 3CFRA 3KK1A 2ETJA 4E7HA 3DRPA 1A5XA 2D0BA 3VN5A 1ASVA 1VSJA 2YNGA 4I9LA 2HHTA 1WSJA 3HPHA 3NF7A 4FW1A 4CGDA 3PV8A 3MXJA 4CHOA 4IFYA 3OS2A 1F21A 3I0RA 3KD5E 2XY6A 1QTMA 4E1NA 2HMIA 4Y1DA 3V1RA 3SCXA 2DY4A 2Q3SA 4IG3A 3VQQA 2E6MA 3AV9A 4CJ3A 1B9DA 1Q9XA 4CERA 3V4IA 1WAJA 1CZ9A 2HHXA 3AVLA 3V9UA 4CFBA 3OVNA 4KO0A 4DSIA 2E4LA 3KLIA 4KKOA 4FZZA 5E41A 4KREA 2B6AA 3B6PA 3AVMA 4NYFA 1RT4A 1LW2A 1C6VA 3V9ZA 4B9UA 3DLRA 3O3HA 1ZBUA 2YHBA 3C6TA 1RT6A 3HT3A 5HROA 5D3GA 1VSMA 1YTAA 4AHUA 4RW6A 4CE9A 5HRRA 3QERA 4GVMA 2IGIA 3DLKA 1Y97A 5JS2A 3ZT3A 1RCHA 4BWMA 2FBYA 4AILC 1HRHA 4I2QA 1FK9A 4AHTA 4HUFA 2KTQA 1CXQA 4GW6A 4O5BA 4K8ZA 3FFIA 3BDPA 4C8LA 2HHUA 4Z4IA 2F8TA 3M8RA 3T1AA 1DTQA 4CGIA 1SV5A 3OYJA 4DQQA 4KHYA 1G15A 3VQPA 2F96A 3LAKA 3C94A 3ZSXA 2KZZA 3HJFA 3P83D 4XIUA 3L2VA 1NKBA 3VQ4A 4HUEA 2GV9A 1R0AA 4FLYA 1D5AA 3K2PA 3ZSOA 3AVAA 4OPKA 3RMCA 3KLGA 2G8KA 3QETA 4AHRA 2XY7A 1WNSA 2DTUA 3OJSA 3VQ8A 2VG5A 2D0CA 4CJLA 3OYCA 4KHQA 3QESA 5C42A 3AO5A 1L3VA 1D8YA 4GMJB 4CF0A 4Z4HA 5CZ1A 3JSMA 4KB1A 1IKXA 1S5JA 3VQCA 3HVRA 3DLBA 1C0TA 3K5LA 3DLHA 1S6PA 2VWJA 2OPSA 5HRPA 4B9MA 4CJWA 4FJMA 4CF9A 2QK9A 1NK5A 4CK2A 3DOKA 1X9MA 4FK0A 1GOAA 2BE2A 4DFJA 5J1EA 4CJ5A 5CZ2A 3LP0A 3AA2A 1C1BA 1KLMA 1S6QA 4H8KA 3ZT2A 1NJYA 3C6UA 1GOBA 5J2PA 3SUQA 4OKJA 3SPZA 1J5OA 1NK6A 4Z4FA 1QQCA 3ZSVA 4JS4A 4J2EA 1S1TA 4TSXA 3KIOA 3MXMA 4CJUA 2QKBA 5DK5A 3CQ8A 3O4QA 2HVHA 3L2RA 4MQ3A 3KLEA 4FCYA 1BIUA 3ZSRA 2HHWA 1XHZA 2KFZA 1GOCA 1BL3A 1XI1A 4YNQA 2JLEA 3S3NA 4AH9A 3SQ4A 4Q5VA 1TGOA 1Q9YA 1JLFA 3AVFA 3PX0A 5CYMA 1LV5A 3SNNA 1TKDA 1VRTA 3TAEA 3AO2A 1UWBA 1T05A 3SI6A 1RT2A 1NK4A 4ELUA 1HPZA 2ZQBA 4MFBA 2G8WA 1TKXA 2O4GA 3SQ0A 4C8OA 4CJFA 3O3GA 3V1QA 3OS0A 3TAFA 4LH4A 1TAQA 2A1RA 3PO5A 1JLCA 4M3TA 4RW4A 2ATQA 4O55A 4M3YA 3ZT1A 3IRXA 4CJ4A 3DLGA 3AVIA 4N76A 1WSGA 2G8VA 3HL8A 1RTJA 3DMJA 4DTNA 2OPPA 3OYKA 1RT1A 4AHSA 1TVRA 4B9TA
chains in the Genus database with same CATH superfamily
4QS9A 3MN5A 2OTJN 2Y1JA 1KRPA 3D0PA 4WYBA 1IJJA 2OCEA 1NKCA 3CCEN 3SMPA 4IBNA 2O4IA 3KZBA 4FWQA 1T3VA 3KD1E 2P9KA 2Z1HA 4I7FA 4NLBA 4JV5K 1XHXA 5BPMA 3ULDA 2ZF5O 4H0PA 3THXB 2XO7A 4DLGA 3CI5A 3PUFA 3TTDA 4CJSA 1S3XA 2E2OA 3HYFA 2IC3A 4NO7A 5KGXA 3NF9A 5J2NA 3J8AA 3M1FA 1SKRA 3EE8A 2XRIA 4GVEA 5FPMA 1JCFA 1EQYA 3ULEA 5HL7L 4YOUA 1MDUB 1NGCA 2IVNA 3NGYA 3BGRA 3CXCM 1ZBIA 3T3FA 2W41A 4DR7K 5AQGA 4DSJA 4CJEA 3MDQA 1RNHA 3LALA 3HP6A 1RDAA 4DR5K 3VQ7A 2Z1JA 3DLLL 4Z4CA 3JS6A 2NRRA 3N4PA 4PL7A 3U3GA 3LDLA 4KTQA 4RWTA 1DEJA 3AO3A 3GE1A 4FSVA 4OKKA 4FM2A 5BRHA 2G8UA 4DR6K 4IZ9A 4KBOA 4JI0K 2QXFA 3CCUN 5FDLA 3NCIA 4EZ6A 1B92A 1TV6A 4J2DA 3ZETB 3HOTA 5HLFA 3H1QA 4H4MA 1C1AA 2IVPA 1UA1A 3WXLA 3MAQA 5HBMA 2IAJA 4EHUA 4M3UA 1KC8O 5C12A 1IBLK 3T7ZA 3WEEB 1IV0A 1MWKA 3TI0A 1K9MO 4M3XA 3FLCO 2JGUA 4GV6A 3IKMA 3P31A 4H0VB 1BQMA 1JLQA 1HNVA 3A8YA 3WXIA 1FW6A 4CECA 4B3TK 4E3SA 5JMVA 4OLBA 5HP1A 3L4QA 1BUPA 3RMDA 2O8DB 1RTIA 2F9TA 5AQFA 4BWJA 1NGIA 4BRKA 4EP4A 2O8FB 4ID5A 3HSCA 3LDSA 3E9OA 3M5RA 3AVGA 3SJHA 1U4BA 4WQ4C 4WCEL 3KTQA 4K8XA 5EU7A 3L8BA 3FZFA 1YJNN 5AQHA 2A40A 2IIRA 3I33A 1S1VA 5A2QO 3W0LA 3CERA 4DR4K 4BRFA 4IO8A 4RW8A 5EX5A 1I3AA 3RVCA 2P9UA 3LM9A 5KTQA 4JI2K 1ILYA 4BRNA 5SZTA 4QAGA 1IO2A 5CYQA 3O9UA 4JD2A 4BRPA 3OS1A 4WFBL 5T7BA 1IKYA 2YHYA 1JLEA 3HP9A 3IG1A 3HPGA 4A59A 3DRSA 3JYTA 4N47A 1HNWK 1CLQA 5C25A 1SAZA 1VSIA 4ICLA 1VSKA 5AQXA 3VF2A 3KHYA 2AJQA 3SAFA 4C8KA 4CF8A 4ILJA 3NDKA 2X74A 3WNEA 1VSHA 1T8EA 4WE1A 5BN8A 1T44A 1B9FA 3U8XA 4OPHA 4JAXA 1S9EA 1JJ2M 2BDPA 4DG1A 1VK0A 2D0PA 4KH5A 3CCSN 2KW4A 3CETA 4OVLA 5DM7L 1RDDA 2DFEA 5AQIA 4CBWA 1ZBSA 3LWLA 3UB5A 3TAGA 1IKVA 4DV6K 4KI6A 1D9DA 2NLXA 4DQIA 4H5WA 2W42A 4IXCA 3G71N 4ZTJA 3QB0A 5AZJA 3U3YA 4YHHK 5CE3A 4JHDA 2FXUA 3NBPA 3AA4A 2X78A 3RSEB 3K58A 4W5NA 1KFSA 1C1CA 1HMVA 3OBYA 3HO1A 5TKWA 1T03A 2W40A 3FZLA 3EE9A 3CCLN 3OYMA 5JICA 1QHAA 2I5JA 5M1FA 1CZAN 4JRPA 2Q0RA 2NRHA 5FPDA 4KHSA 2XY5A 4MLEA 1ZBFA 3CCJN 3VF4A 3O1WA 4BR7A 1U6ZA 3LDPA 1NGEA 3S9HA 3WQUA 4CZHA 3AARA 2G8FA 1GLAG 1BIZA 1J6ZA 4ZTFA 4CEBA 4C8NA 1SKSA 1TK0A 4XH5A 3UKUB 3V6DA 4CJPA 1SKWA 2P5GA 5HRNA 4DFMA 3CFPA 3NGZA 2VGMA 3M8PA 1OH6A 1C0UA 1LAVA 3DI6A 4Z4GA 4DLEA 3VEZA 3ITHA 2O8BA 1VSFA 2YKNA 2YNHA 3CM6A 2QWPA 3IDHA 4CHQA 4FLTA 1TK8A 2KQ2A 3D7EO 2DFHA 4I6MA 4PY5A 5J2MA 4PL8A 4Z4EA 3I55N 4B9NA 4BREA 4M63C 3K0SA 1S1UA 5DMRA 4OGEA 4CESA 4DSFA 4R5PA 3K5MA 3T1YK 1J53A 4JKEA 2KFNA 1TAUA 1YTUA 4DS5A 3PLAA 4FXDA 4KTWA 3Q7BA 1SUQA 2P9KB 4J8FA 1CXUA 3M8QA 3THWA 1RDBA 2ZM6K 5KRTA 4YDUA 5BPLA 3CC2N 4GKKK 4IDKA 4K41A 4DV0K 3WNGA 4CI6A 4PKHA 4KFBA 3MEEA 4F8RA 3WXKA 4N5SA 2XY8A 3G10A 1VQLN 1WSIA 3VGLA 1DKGD 5GADP 1YUWA 3F5TA 2PYJA 3AO4A 3ULEB 3CFOA 4C1NI 4FJ5A 2HB5A 1I94K 3CFRA 4E7HA 2BH1A 4CZJA 3VN5A 2YNGA 2HHTA 3HPHA 4EFHA 3NF7A 4FOIA 5E84A 4CHOA 2CGLA 4IFYA 4KH6A 2E1YA 2Q3SA 3VQQA 2ZWHA 4KO0A 4FZZA 3B6PA 1RT4A 3PIOL 3DLRA 3LDNA 3VPZA 5D3GA 5AQVA 2QWQA 5HRRA 5C15A 1HLUA 4BC2A 5C2DA 4X65K 4GVMA 3ZT3A 3ID8A 4I2QA 4HUFA 4GW6A 3FFIA 5LJWA 4WF9L 2YI1A 1WB9A 2F8TA 3OYJA 4CGIA 1SV5A 3UKRA 3VQPA 2V7ZA 3O9RA 2F96A 3C94A 3ZSXA 2V51B 4DV5K 3VQ4A 3VETA 1R0AA 3RMCA 1E3MA 5AQJA 3CMEN 1P8ZA 2XY7A 4FWRA 4KHQA 3AO5A 4BVOA 3FFKB 4CF0A 4KB1A 3ZX0A 1C0GA 3DLBA 3QBWA 3G4SN 4GV9A 1M90O 4FJMA 4DFJA 1V4TA 4JKDA 3ZT2A 1C1BA 3WEEA 4G9ZA 5J2PA 3SUQA 2OTLN 3OA9A 3ZSVA 4DQ8A 3D2FA 4TSXA 4CJUA 3CC7N 1O13A 2YX6A 4MQ3A 4FCYA 3T69A 1BIUA 2EWSA 1GOCA 2OANA 4YNQA 1N8RO 3AVFA 5CYMA 2AA4A 3OW2M 3AO2A 1X3NA 1T05A 1NGHA 1RT2A 1NK4A 1OH5A 4MFBA 3O3GA 4M3TA 2UXDK 3CPWM 1BDGA 4CJ4A 4YDUC 2G8VA 4CZGA 2NRZA 1WSHA 3E66A 1RBTA 4CHYA 4FM1A 3S3MA 1XMQK 5MLCQ 4FJJA 5LL6Z 4YOYA 3QFPA 2FBXA 3AAQA 3QEPA 4FYDA 3WXMB 3ZCMA 2D5RA 5K14A 1LWCA 1YF5L 5AQLA 3FZKA 4H5NA 3V9WA 1BI4B 2HNYA 4JK7A 3AGKA 4DS4A 3AVNA 4DFKA 5CY4A 3LANA 3RR7A 1ZBHA 4CK1A 1J9AA 3HOSA 4NB4A 4KRFA 4KV8A 3LP1A 1KXPA 3J7YP 5AFUA 4BR9A 3KKRA 1W97L 3DRRA 4Q0BA 1K6YA 1X1PA 2X6SA 4BRAA 2WUSA 2ZGZA 4JHDB 3HM8A 4W5TA 1XQSC 3DXKA 4DCHA 4CFDA 4DWIA 3VQEA 4FJGA 4FW2A 1U47A 4DR2K 2B5JA 3L0QA 5KRSA 1NLVA 3CCMN 3LZJA 3KVGA 3CJCA 4B1VA 3VQ5A 4B9QA 4ID1A 3CQXA 3UIQA 3H3OB 4X64K 3U4LA 5FROA 4PUOA 2P9PB 3S41A 4F2SA 4B9LA 2QWNA 3VQ6A 2YKMA 4ISGA 5AQOA 3RSEA 5F1XA 2EX3A 2HW3A 2E5LK 4E19A 3TWHA 3TPQA 3F73A 2WBNA 2QEXN 3O1BA 4E1JA 3ZSZA 3CJAA 4FL9A 3OBWA 4E7IA 3K5OA 5GIOA 1C0MA 4N41A 2O8BB 1KAXA 1VSEA 4AF1A 4X62K 4FWNA 1RFQA 1TL3A 2A42A 4RW7A 3V9SA 2QXLA 1L3TA 3VERA 3BUZB 4HWIA 4YOTA 1IKWA 4LFCK 3UKUA 3P4IA 4BR0A 1NG9A 4CF2A 5I9EB 5KPRA 3GBTA 2UXCK 3SYZA 4CZFA 2P1JA 2PZSA 1RBUA 4B3OA 4WQ4A 4CGHA 3THWB 1NK0A 4I9QA 3C6AA 3CD6N 5F0XA 1EETA 1HNZK 1ZYQA 3CYMA 3QBXA 3EYZA 4XH1A 1E4GT 1QSSA 2HF3A 3P38A 2ITMA 2QTDA 1IBMK 4CJRA 3T19A 5AQKA 4OKEA 3VA0A 1W9HA 2NNWA 4FWKA 1BU6O 4FJ7A 4O8KA 2PFUA 3TARA 4HCCA 4B9VA 2OPRA 2P9SB 4KHWA 4CEDA 3BZCA 1VQ7N 4GV3A 1Z26A 4F3TA 1HUXA 3WUHA 1XC3A 4IOAL 5AQNA 1IG9A 1QS4A 1Y64A 5AQWA 3R8EA 5AQUA 1Q7YO 3LP2A 3VESA 4PWDA 4DF4A 4AHCA 1KAYA 1XC9A 2UU9K 2F7TA 2F4VK 1HNXK 3GL1A 4BACA 5GAGP 3VMFB 3TABA 4H5TA 1VQ8N 3UKRB 4UQGA 3VEYA 1BCOA 4NCGA 3I8DA 4DTMA 4BC5A 2A3ZA 3N4QA 3RRHA 3FZHA 4BR5A 3ENBA 3THVA 3SMSA 3G6EN 1LWEA 1HKGA 3F9KA 2E2PA 4B1WB 3NVKA 4O4GA 2ASOA 4BQLA 4YFUA 3VEXA 1RT5A 4OPJA 1VRUA 4BDZA 3O4NA 1KVBA 2OZSA 2OA8A 4FOEA 4F4KA 4IOCL 2RPIA 3VTHA 4FJHA 3O3FA 5GIPA 2Q36A 4M41A 1VQ6N 3D2FB 3DJCA 2WC9A 1GLDG 1X3MA 4FK2A 4CHPA 4CIEA 3OYIA 3NHGA 4RG8A 3WNHA 5AQZA 1TKTA 3VQ9A 5CR4A 2GWJA 3HPOA 1ATSA 3OY9A 4IO9L 4X66K 3D2EA 4HTLA 1L3UA 3K57A 3QINA 5I3UA 5H1SQ 5E26A 3HK2A 3QICA 1GLCG 1LCUA 1U04A 4IOXA 5LJVA 3UE5A 2QWOA 2HHHK 1TKZA 4K25A 4LSLA 2ZJPL 4E89A 1D4XA 4BVPA 3NH1A 3NH2A 2O8CA 1W7AA 1HJRA 1JXBA 4KH4A 3ZEUA 2A1SA 3MN9A 3OYGA 2P51A 1BA0A 3LPUA 4FO0A 2Z1IA 3MN7A 4ISFA 4JI6K 1MU2A 2QA4N 4A2AA 1RTHA 4CJKA 1REVA 2HSTA 3I56N 4CIGA 4BRIA 5AQPA 2HVIA 4B1ZA 4YOXA 5KPTA 3PO4A 1RT7A 4LFBK 1JKHA 4A5AA 4CZEA 2YHAA 4DSKA 1HNIA 4BGBA 4NLCA 2RKIA 3QNOA 3NVMA 1YVUA 2NUBA 1BI4A 3ZYYX 2ETJA 3CJ9A 3J7AP 3DXKB 3VEOA 2D0BA 4CGDA 1YJWN 4V19S 1JCEA 2XY6A 3V1RA 3SCXA 3NMUA 2E6MA 3QFUA 4CJ3A 4CERA 2GELA 3V9UA 4CFBA 4DSIA 2NRXA 4KKOA 3SBGA 2B6AA 3AVMA 3FGUA 2FLOA 3V9ZA 3O3HA 3BF3A 1ZBUA 1RT6A 3HT3A 1VSMA 3IMXA 4CE9A 3GG4A 3O6WA 3DLKA 1Y97A 4CD3A 4NXNK 1CXQA 4FWSA 2KTQA 4O5BA 3BDPA 1RDWX 1GLLO 4FPAA 1QZ5A 2YJEA 3P83D 4XIUA 1NKBA 4HUEA 3SAHA 3U9DA 4FLYA 1D5AA 3K2PA 3ZSOA 3AVAA 4H5VA 2H3GX 2G8KA 4JYAK 2P9PA 4AHRA 3QMLA 4FPBA 2D0CA 1L3VA 3EO3A 5C42A 3TTFA 4LF8K 4Z4HA 5CZ1A 5AQTA 2UXBK 1IKXA 1S5JA 3CJ1A 1Z6RA 1C0TA 4A2BA 2VWJA 1ZXOA 4CJWA 5M1KA 3DOKA 3QDKA 3LP0A 4RTFD 1S6QA 2VWBA 4OKJA 3KIOA 2E2NA 3C6HA 1EWQA 2QKBA 1XUPO 5DK5A 3L2RA 2I7PA 1WUAA 3ZSRA 4CW7B 3AGRA 3EEQA 1BOTO 4A57A 4BY9C 1BL3A 4AH9A 4Q5VA 1ZC6A 1JLFA 3PX0A 1VRTA 4Y0WA 1XNQK 1UWBA 3SI6A 5BN9A 4ELUA 2G8WA 1TKXA 3SQ0A 4PHTX 4C8OA 4CJFA 3OS0A 3PO5A 4IJNA 4O55A 1N36K 3DXMB 3H45C 5GAEP 3HL8A 1RTJA 4AM7A 1YIJN 3EL2A 1ESVA 2NZTA 3GOIA 3QLHA 2E2QA 5GINA 2NRTA 5B8HA 2VQFK 1OVYA 3VEVA 4FJNA 4JK9A 2ZGYA 2P9NB 4CEQA 4KAZA 3BEXA 4DQPA 1FKPA 4HVJA 4C8MA 5AZIB 1K8KA 3SBTA 2BGGA 4BDPA 5AQRA 4MDBA 1Q8IA 2P9SA 3KK2A 4CFAA 4ELTA 3U9ZA 3WXJA 4WQ5A 5EY4A 3SV4A 2OPQA 2P9LA 1BO5O 3TANA 3VGKA 4DQRA 4BRDA 1RILA 3P5JA 5C0YA 3BZKA 3MEGA 3AA3A 4CEZA 1K8AO 3KLHA 4JN4A 2V52B 4IWVA 3LDOA 3VA3A 1NK8A 4PQUA 4FWMA 2D0AA 3KK3A 2FSJA 3QIPA 4E7KA 3TR8A 2XHBA 5C2FA 4CVNE 3L4IA 2FF3B 1TL1A 3OYLA 4B3RK 2D4WA 3G0ZA 3V81A 2FBTA 4JLHA 4H0YB 1QQNA 4CEFA 5FRNA 4DUZK 4BG9A 1NJWA 2VWKA 2GUIA 4KHPK 3O4WA 1WLJA 3H1VX 5ADXA 3KLFA 3EN9A 2I7NA 1BCMA 3RR8A 2E1ZA 4IFEA 4JEPA 3SZ2A 1U48A 2FBVA 4O0IA 1V4SA 4NXMK 2BANA 2PYLA 3MX5A 4BRCA 4E0DA 1NKEA 3TAQA 3LAMA 1J54A 3D2EB 5FLXO 4J2BA 3L2WA 1QSYA 4FLVA 3R9PA 3KKSA 3ALYA 3DOLA 1DLOA 1EWRA 2GBZA 4EAHD 4J2AA 4NYNA 2G8IA 3RMAA 1TYQA 3M8SA 3HTVA 5M1PA 2GEMA 3VEWA 3HXMA 1A5VA 1WN7A 2O8CB 3BP8A 2JWLA 2ASPA 2YNIA 3ZEUB 4CJ7A 2O8EA 2PAVA 3MK6A 2Q97A 3D45A 3QEWA 1NJZA 1VQPN 3IAYA 3RRGA 3NFAA 5CHIA 1JLGA 4DMNA 3MXIA 1HQUA 4H03B 1NK7A 2DPNA 1FKOA 1N6QA 2BTFA 5KGWA 2ASMA 4FK4A 4HTUA 4RW9A 4ELVA 1L5UA 2PY5A 4DU1A 1H1VA 1BQNA 2RN2A 2F9WA 4JKCA 3L6QA 3K5NA 3ZSQA 4FJKA 4RCHA 1BWFO 3FR0A 4DTJA 1I39A 1RDUA 4E7LA 4DF8A 4CGGA 4FLUA 4FVMA 1N32K 5AFUH 3BF1A 4BDYA 4WQ5C 1RBSA 1VSDA 1WSFA 3E01A 3ZX3A 4GKJK 1KLNA 3W3DA 4BRLA 2YHWA 4K43A 3ZT0A 4CJTA 4CBXA 3AVCA 4H0XB 3RMBA 1KVCA 1UOCA 3EZWA 2HNZA 4CF1A 1YITN 1K73O 4DFPA 4JKAA 1OH8A 5HOOA 1TUYA 4CHNA 3JXUA 5FPNA 3VOVA 5AQSA 4O5FA 2G8HA 2KKZA 1QVGM 4LSNA 2UYTA 1VAZA 5JS1A 2RHKA 2F8SA 2GTDA 4FJXA 4H0OA 4QOZB 4O8UA 3NE6A 1NOZA 3OYHA 3ISNC 3PX4A 4DV4K 3MWTA 4LH5A 1XNRK 3TAPA 4DB3A 1R59O 4KB0A 4IEIA 1SL2A 1YJ9N 4BG8A 3ZSWA 4IFVA 1QQMA 4KHUA 3C7NA 3OYNA 1KCFA 3QO9A 4DTPA 4BC4A 4CBUA 4DKWA 1RGIA 4FM0A 4ILGB 4JKBA 2Z1GA 2VQEK 1N33K 1TK5A 1OH7A 3C0BA 1JLAA 2CH5A 4CCHA 1IG8A 1ATRA 1N5YA 3LZIA 5JLFA 3VQBA 4M45A 2ZE2A 3D6RA 3ID6A 4DR1K 1EX4A 2YNFA 5LY3A 1X9WA 4BE0A 2PBDA 2HOEA 3PY8A 1VQNN 3VQDA 4F2RA 2IDOA 1HPMA 2P9IB 3SQ1A 4Z0UA 3CM5A 4F9OA 2R7YA 3AO1A 4ZHRA 3AY9A 4M42A 1NBWA 3E9LA 2FC0A 4Y1CA 2J4RA 2P5OA 3IS9A 3O9SA 3EKUA 1QQOA 3NF6A 4FLWA 3V1OA 3AVJA 3MEDA 2WONA 4OJRA 4B8AB 4JI4K 3NAEA 3J7ZO 3CCQN 1RDCA 1U49A 3A2FA 3A5MC 1HKBA 1RBVA 4AHVA 5M1NA 4AM6A 3OYBA 2Y1IA 4DSLA 3EY1A 3CG7A 2GUPA 2HMPA 1WBDA 3LP3A 1EXQA 2Q0UA 3VQAA 3ZT4A 4BROA 4HCBA 4CJVA 3M3ZA 1S9GA 2HF4A 4PKIA 1NOYA 2HHVA 2HHSA 3H08A 3ATUA 3EZ5A 5AQYA 1K8KB 4FJIA 3DXMA 4EIAA 1GLEG 2HNDA 3WNFA 4FLZA 1NK9A 3DAWA 1D9FA 4C1NK 3ENOA 5JVHL 3AVKA 4B9SA 3B8AX 2P9LB 3OYFA 3THYA 4JKGB 4H5RA 3DM2A 4JS5A 2W6KA 2P9NA 4IKFA 4GY2B 2ZJRL 3L3UA 1WOQA 3EKSA 3HZ6A 2NRVA 5AZIA 3O08A 4DTSA 1LOTB 2QWLA 3KK1A 3CJ7A 1A5XA 5EOYA 4A61A 1ASVA 1WSJA 4FW1A 3PV8A 4QS8A 2YJFA 3MXJA 1VQON 3OS2A 3KD5E 3I0RA 1QTMA 4E1NA 2HMIA 2DY4A 2Q1NA 4IG3A 3TSPA 2VCPA 3AV9A 1B9DA 3V4IA 2HHXA 3AVLA 4FWPA 3OVNA 3R6MA 2E4LA 5E41A 3CCVN 1GLBG 4NYFA 2HBKA 1LW2A 1C6VA 4B9UA 2YHBA 3C6TA 2D1KA 1YTAA 3CC4N 2WFBA 3OTOK 2IGIA 1RCHA 4BWMA 4AILC 1FK9A 5FPEA 4K8ZA 4MO4A 1G99A 4C8LA 2HHUA 3M8RA 4DQQA 3O9TA 3ZX2A 2KZZA 3HJFA 2GV9A 1FJGK 4OPKA 2KLAA 3P39A 3OJSA 2CGKA 3OYCA 1TYQB 2QM1A 4YOVA 3M6GA 3JSMA 3VQCA 3HVRA 2QI2A 1XMOK 4C23A 3DLHA 3VGMA 3K5LA 1VQ4N 2OPSA 4GNIA 1IBKK 4B9MA 4CF9A 1NK5A 2BE2A 5F2RA 1NWKA 5J1EA 2O8EB 3AA2A 1KLMA 3C6UA 1NM1A 3SPZA 1J5OA 1NK6A 4Z4FA 1QQCA 4JS4A 4J2EA 2NRWA 3CQ8A 3O4QA 1GLFO 2QWRA 3Q7CA 3CCRN 1XHZA 5M1OA 2KFZA 2JLEA 3S3NA 4XH4A 3SQ4A 4B3MK 1TGOA 4FVUA 1LV5A 3TAEA 1NU0A 3TU5A 5JLHA 2ZQBA 3LDQA 3V1QA 2A1RA 3TAFA 1TAQA 1QVFM 4RW4A 1VQKN 3BY5A 3ZT1A 1YXQA 2D0OA 3R3LA 2KHOA 3DMJA 1ATNA 3TSQA 1W2BM 5IT9O 4AHSA 1TVRA 4DTXA 2X6NA 2CH6A 1OVQA 4M3WA 3SUNA 3NF8A 2FF6A 5KQ8A 1SL0A 3QIOA 5JVGL 3A5LC 5IWAK 4B1XB 4CZLA 4W5QA 3QEIA 1X9SA 3OYEA 4H4OA 5C24A 4JNEA 1WSEA 1KQSM 1VHXA 1RBRA 2EHGA 1UA0A 3U6FA 3J81O 3TAMA 3HM9A 4HHTA 2YCHA 4O0JA 3A0IX 1Z05A 1NGDA 5FRMA 1A5WA 4B1YB 3GDQA 1BA1A 4CJQA 1VSLA 4I2PA 4CZMA 3F9MA 5KQDA 3T1HK 1LAWA 2AP1A 1JXEA 4FWOA 2OYQA 4EZ9A 1LW0A 3C7NB 2VG7A 3PIPL 4QCLA 2GX9A 4DTUA 3CF5L 3I0SA 1KFDA 1T6DA 1KVAA 3SPYA 4OLAA 3KJVA 4ISEA 4EHTA 2UUAK 1M1KO 1NGGA 2RE2A 1UAXA 4WFNL 1JLBA 1L3SA 4LY7A 3E9PA 3CQYA 3SLCA 4KPYA 4UY8O 1E4FT 5LMUK 3ENHA 4K42A 3QEVA 4ILHA 4PA1A 3SAGA 3K59A 4U67L 1MA9B 1NMDA 1ASWA 2GWKA 1Z25A 4FZYA 1S1XA 3V9XA 2YHXA 4JI1K 5I42A 1ASUA 2FSKA 4PKGA 3ATVA 4B1UB 2E6LA 3A5NC 1HYSA 3VF6A 3DWLA 4K0KK 1WAFA 2UUCK 4A62A 5J2QA 3VTIA 1T6CA 4CIFA 1BHLA 1BGXT 4DU4A 1YT3A 4DTRA 4KHNA 3MCAB 4W5OA 2BUPA 2P9IA 3K9KA 3OJUA 1JL2A 2VYPA 1U2VA 3MMVA 4EP5A 4JI7K 5KPZA 4CZKA 1HQEA 3HSTB 3WQTA 1SL1A 3ZSYA 1HKCA 3L2UA 3OYDA 3KWIA 2LSNA 1ITGA 1YAGA 2W6LA 2B4JA 3LPTA 3S3OA 4BR2A 3SV3A 5BREA 5AQMA 4LD0A 4A5BA 3SUOA 1KSPA 4WFAL 1JL1A 4FWLA 3DLEA 3THYB 1NGBA 1IH7A 3LWMA 4W5RA 2VG6A 4R79A 2YV0X 1S1WA 1BISA 1KAZA 1VQMN 1DTTA 5HRSA 4YY3K 3OHRA 4CK3A 4F3OA 4FJ9A 4JI3K 3C95A 4JI8K 1TUUA 2IVOA 1QSLA 1NJXA 4OO1J 4BRHA 2ZJQL 3KK7A 2RF2A 3R1XA 4OX9K 4DV1K 3AVBA 2OZMA 4JKGA 3ASMA 2E8AA 3AVHA 3FZMA 2V7YA 1T7PA 1RT3A 3HI0A 2Q2RA 3KWGA 4KI4A 4JRQA 4N56A 1VQ9N 3AA5X 3AAPA 2KZMA 3THXA 4BRMA 5ADXH 4M3ZA 3RWUA 1RTDA 4OGCA 4FZXC 3OYAA 1DT9A 1HYVA 3MCPA 4FJ8A 3TTCA 1EKEA 4B08A 1XWLA 4M7XA 2WOMA 4IDHA 4FJLA 4CZIA 1SQKA 4FLXA 3L3VA 1X9JA 3G25A 4BE1A 4G1QA 3DYAA 1Q82O 1ZBLA 3RTVA 2E88A 3CJBA 4DQSA 1NJIO 3CPEA 1P90A 4CEEA 3L2QA 2A41A 4OPAA 3H46O 4JI5K 4CD1A 2Q31A 3SUPA 1NNEA 3QEXA 3NH0A 3PSIA 1W0HA 4L8RB 1KD1O 4AQYK 2A5XA 3HBTA 3MECA 5KI6A 3QNNA 2QKKA 4BQZA 3ZETA 4CFCA 1NMNA 4CGJA 4E1MA 1QE1A 4JKHA 3CIPA 2JWKA 1N34K 4DV7K 2E20A 4DV2K 4KTZA 4HUGA 4DTOA 4NCBA 4LF6K 4XEIA 3JAMO 1HYZA 3H3NO 3SQ2A 4DHYA 4CGFA 1LWFA 3CHWA 1YHQN 3SK3A 4DV3K 1C0FA 5ELZA 5M1QA 4CEOA 3P1GA 3HRGA 5BR9A 4O44A 1YVNA 5AJ3K 2HBJA 1U45A 2ZD1A 4L3QA 2HHQA 2O8DA 4IG0A 1NGFA 2O8FA 2P9UB 5DM6L 3PX6A 1HJOA 1SS6A 5BPNA 4DU3A 4LFAK 3I8BA 1EP4A 3MX2A 1EO1A 4NCAA 4JD2B 2DFFA 4Z94A 3HVTA 4CHZA 3NGIA 3O80A 5SWMA 4DSEA 1KTQA 1GLJO 4YOWA 2ITGA 1S72N 4CEAA 1NGJA 3IUCA 3O8MA 4BE2A 4E7JA 3SJJA 1CZBA 1O1WA 1SZ2A 2IOCA 4M3RA 1QHTA 1S22A 2IS3A 1FXXA 3B6OA 4B8CA 1J5EK 2FSNA 1JCGA 5C10A 3A5OC 3DRPA 1VSJA 4I9LA 1Q81O 4BRGA 3J80O 3LM2A 3H6EA 1F21A 2HBMA 4Y1DA 4LF9K 1Q9XA 1WAJA 1CZ9A 4KREA 3KLIA 4LF4K 2WTUA 4LF7K 5AZJB 5HROA 2QWMA 4AHUA 4RW6A 3QERA 4JKFA 5JS2A 1QZ6A 1DGKN 2FBYA 4JK8A 1HRHA 3FE1A 4AHTA 3E1YA 4LC9B 5EXWA 1HX1A 4Z4IA 3MWPA 3T1AA 1DTQA 4KHYA 1MWMA 1G15A 4H0TB 4LF5K 4BC3A 1Q18A 5BR8K 3LAKA 1Q86O 3L2VA 4DUYK 1BG3A 3KLGA 3QETA 3K9JA 1WNSA 2DTUA 1VQ5N 4IEEA 3VQ8A 4MLHA 2VG5A 4CJLA 4M7YA 4MO5A 3QESA 1D8YA 4GMJB 2UUBK 3VENA 2A6AA 4MDAA 3IFRA 3CMAN 1S6PA 1U2VB 5HRPA 3PSFA 5EVZA 2QK9A 4CK2A 2QW9A 1X9MA 4FK0A 1GOAA 3TSUA 4BGAA 4CJ5A 5CZ2A 1NJYA 4H8KA 1GOBA 4DR3K 1OKJA 1S1TA 5GAHP 3MXMA 2HVHA 3LL3A 3O9QA 3MN6A 3KLEA 4IJAA 2HHWA 3C65A 3ZLJA 1XI1A 4I6MB 1Q9YA 3SNNA 4U7BA 1TKDA 4B3SK 2CGJA 5BRFA 1HR0K 4BRQA 1HPZA 2O4GA 4QS7A 4BR4A 3WT0A 4LH4A 5AQQA 1JLCA 3O5BA 2ATQA 4M3YA 5BRDA 3IRXA 3DLGA 3AVIA 4N76A 2VGNA 5TKYA 1WSGA 5LMNK 1YI2N 3F2KA 4YORA 5AR0A 1WBBA 2HBLA 4DTNA 2OPPA 1NGAA 3OYKA 1RT1A 4B9TA
chains in the Genus database with same CATH topology
1WSHA 4CHYA 1RBTA 3QLHA 4DTXA 2X6NA 4FM1A 3S3MA 4M3WA 4FJNA 4FJJA 2Y1JA 3NF8A 3SUNA 1KRPA 1SL0A 3QIOA 2FBXA 3D0PA 3QEIA 1X9SA 4W5QA 4CEQA 3QEPA 4FYDA 3OYEA 4H4OA 5C24A 1NKCA 4KAZA 4DQPA 1FKPA 4IBNA 3ZCMA 2D5RA 5K14A 2O4IA 1LWCA 1WSEA 4HVJA 4C8MA 3V9WA 1BI4B 3KD1E 2Z1HA 1RBRA 2EHGA 4I7FA 1UA0A 2HNYA 3U6FA 4DS4A 3AVNA 3TAMA 1XHXA 3HM9A 4HHTA 4BDPA 3ULDA 2BGGA 1Q8IA 3KK2A 4DFKA 5CY4A 4CFAA 4O0JA 3LANA 4ELTA 3RR7A 2XO7A 1ZBHA 4CK1A 4DLGA 5FRMA 1J9AA 3SV4A 3PUFA 1A5WA 4CJSA 2OPQA 3TANA 4DQRA 4KRFA 4KV8A 3HYFA 1RILA 2IC3A 3P5JA 3LP1A 3NF9A 4CJQA 5KGXA 1VSLA 3AA3A 3MEGA 4I2PA 4CEZA 5J2NA 1SKRA 3KLHA 2XRIA 3KKRA 3VA3A 1LAWA 3DRRA 1NK8A 1JXEA 2OYQA 4PQUA 4EZ9A 1LW0A 4Q0BA 1K6YA 1X1PA 2VG7A 2X6SA 2D0AA 4DTUA 4QCLA 3KK3A 3QIPA 3I0SA 3NGYA 4E7KA 1ZBIA 3BGRA 1KFDA 3T3FA 3TR8A 4W5TA 1KVAA 2XHBA 3SPYA 4OLAA 4CFDA 3KJVA 4DWIA 3VQEA 1TL1A 3OYLA 4DSJA 4CJEA 3G0ZA 4FJGA 1RNHA 3LALA 3HP6A 4FW2A 1RDAA 2FBTA 4JLHA 3V81A 3VQ7A 1U47A 2B5JA 2Z1JA 4Z4CA 1UAXA 1JLBA 4CEFA 5FRNA 1L3SA 4LY7A 5KRSA 1NJWA 2VWKA 2GUIA 3U3GA 3LZJA 3VQ5A 4ID1A 3UIQA 1WLJA 4KTQA 4KPYA 3AO3A 3KLFA 4OKKA 4FM2A 5FROA 4PUOA 1BCMA 3RR8A 2G8UA 3QEVA 3SZ2A 1U48A 4F2SA 2FBVA 4B9LA 4PA1A 4O0IA 3K59A 3VQ6A 2BANA 2QXFA 2YKMA 2PYLA 5FDLA 3NCIA 4EZ6A 1B92A 1TV6A 4J2DA 2EX3A 2HW3A 4E0DA 5HLFA 1NKEA 1ASWA 4H4MA 4E19A 3TWHA 3LAMA 1C1AA 3TAQA 1UA1A 1J54A 1Z25A 4FZYA 3MAQA 4J2BA 3F73A 1S1XA 3V9XA 5I42A 3L2WA 1ASUA 5HBMA 2IAJA 3ZSZA 1QSYA 4M3UA 4FLVA 2E6LA 3TI0A 4E7IA 4M3XA 3KKSA 3ALYA 1HYSA 1WAFA 3DOLA 5J2QA 2JGUA 1DLOA 4CIFA 2GBZA 3K5OA 4J2AA 4NYNA 1BHLA 1BGXT 1BQMA 1C0MA 1JLQA 1YT3A 4DU4A 4DTRA 3RMAA 4N41A 4KHNA 2G8IA 4W5OA 3M8SA 1VSEA 1HNVA 1TL3A 3OJUA 4RW7A 3V9SA 4CECA 1JL2A 4E3SA 1L3TA 4OLBA 3HXMA 5HP1A 1A5VA 1WN7A 1IKWA 4EP5A 3RMDA 1RTIA 4BWJA 2YNIA 4EP4A 1HQEA 3HSTB 4ID5A 3D45A 3QEWA 3LDSA 3ZSYA 4CF2A 1NJZA 1SL1A 3IAYA 3L2UA 3OYDA 3AVGA 3RRGA 3SYZA 3NFAA 2LSNA 1U4BA 1ITGA 1JLGA 2P1JA 4DMNA 3KTQA 2B4JA 3LPTA 3MXIA 4K8XA 5EU7A 3L8BA 3S3OA 2PZSA 1HQUA 1NK7A 1RBUA 1FKOA 3SV3A 4B3OA 1N6QA 4CGHA 5KGWA 1NK0A 4LD0A 4I9QA 4FK4A 3SUOA 4HTUA 1EETA 4RW9A 4ELVA 1S1VA 1KSPA 1L5UA 2PY5A 1ZYQA 3CYMA 1JL1A 3EYZA 4DU1A 1BQNA 4RW8A 2RN2A 1QSSA 1I3AA 3DLEA 3K5NA 3ZSQA 5KTQA 4FJKA 1IH7A 3LWMA 4DTJA 4W5RA 2VG6A 3T19A 4CJRA 1I39A 5SZTA 4QAGA 2YV0X 1IO2A 4OKEA 3VA0A 1W9HA 1S1WA 5CYQA 4E7LA 1BISA 4DF8A 4CGGA 3OS1A 1DTTA 5T7BA 1IKYA 5HRSA 4FLUA 4FVMA 4FJ7A 1JLEA 4CK3A 4F3OA 4BDYA 3HP9A 3IG1A 3TARA 2OPRA 4B9VA 4HCCA 4FJ9A 3C95A 3HPGA 4KHWA 1RBSA 1VSDA 1WSFA 3DRSA 3E01A 3JYTA 4N47A 4CEDA 1CLQA 5C25A 1KLNA 1QSLA 1VSIA 1NJXA 3ZT0A 4ICLA 1VSKA 4CJTA 2RF2A 2AJQA 1Z26A 3AVCA 3RMBA 4F3TA 3AVBA 2OZMA 4C8KA 4CF8A 1KVCA 3ASMA 1UOCA 3NDKA 1IG9A 2X74A 3WNEA 3AVHA 2HNZA 1QS4A 4CF1A 1RT3A 1VSHA 1T7PA 1T8EA 4DFPA 4WE1A 1B9FA 3LP2A 4KI4A 4CHNA 4JRQA 4N56A 3AA5X 4PWDA 2G8HA 4DF4A 1S9EA 2KZMA 4AHCA 4LSNA 2BDPA 4DG1A 1XC9A 4M3ZA 1VK0A 3RWUA 1RTDA 5JS1A 2F8SA 4FJXA 4OGCA 2KW4A 4OVLA 4QOZB 4BACA 4FZXC 3OYAA 1HYVA 3NE6A 4FJ8A 1NOZA 1EKEA 1RDDA 2DFEA 3OYHA 3ISNC 4B08A 3PX4A 4LH5A 3TABA 1XWLA 3LWLA 2WOMA 3TAPA 4KB0A 4FJLA 3TAGA 1IKVA 1SL2A 4UQGA 4KI6A 1BCOA 4NCGA 1D9DA 3I8DA 4DTMA 3ZSWA 4FLXA 4IFVA 4KHUA 4DQIA 3L3VA 2W42A 3OYNA 1KCFA 3RRHA 3QO9A 4BE1A 3THVA 4G1QA 4ZTJA 3DYAA 4DTPA 3U3YA 1LWEA 3F9KA 1ZBLA 3RTVA 4O4GA 4FM0A 3NBPA 4DQSA 3AA4A 4YFUA 2X78A 2Z1GA 3K58A 4W5NA 1RT5A 4CEEA 1KFSA 1C1CA 3L2QA 4OPJA 1HMVA 3HO1A 1TK5A 1T03A 1VRUA 4BDZA 3O4NA 1KVBA 2OZSA 2OA8A 1JLAA 3OYMA 3SUPA 4CCHA 3QEXA 4F4KA 1N5YA 3NH0A 2I5JA 2RPIA 3LZIA 4FJHA 1W0HA 3VQBA 4JRPA 3O3FA 4M45A 4L8RB 2ZE2A 4KHSA 4M41A 1EX4A 2XY5A 2YNFA 1ZBFA 3MECA 1X9WA 4BE0A 5KI6A 4FK2A 3PY8A 4CHPA 3QNNA 4CIEA 3VQDA 3OYIA 2QKKA 3NHGA 4F2RA 4RG8A 2IDOA 3WNHA 4Z0UA 3SQ1A 3CM5A 4CFCA 4CGJA 1TKTA 2R7YA 3AO1A 3VQ9A 4ZHRA 4M42A 3HPOA 4E1MA 1QE1A 2FC0A 3OY9A 3S9HA 4Y1CA 2G8FA 4ZTFA 1BIZA 1TK0A 4CEBA 4C8NA 1SKSA 3IS9A 2P5OA 2P5GA 3V6DA 1SKWA 4CJPA 4KTZA 4HUGA 4DTOA 3K57A 3NF6A 4FLWA 3V1OA 1L3UA 4NCBA 3AVJA 5HRNA 3QINA 5I3UA 3MEDA 4DFMA 3CFPA 2WONA 3HK2A 4OJRA 1HYZA 4B8AB 3NGZA 3M8PA 3NAEA 1U04A 3SQ2A 1C0UA 1LAVA 3DI6A 4CGFA 1LWFA 4Z4GA 1TKZA 4DLEA 1RDCA 1U49A 4LSLA 3A2FA 3ITHA 3P1GA 4CEOA 1VSFA 2YKNA 2YNHA 1RBVA 3CM6A 4O44A 4E89A 4CHQA 4FLTA 1TK8A 2KQ2A 4AHVA 3NH1A 3OYBA 2Y1IA 3NH2A 2DFHA 1U45A 4DSLA 3EY1A 4PY5A 3CG7A 5J2MA 2ZD1A 4Z4EA 2HHQA 4B9NA 4IG0A 1HJRA 1JXBA 2A1SA 3OYGA 2P51A 1S1UA 5DMRA 4OGEA 3LPUA 4CESA 2Z1IA 1EXQA 3LP3A 3VQAA 3ZT4A 3PX6A 4DSFA 4HCBA 1MU2A 4CJVA 4DU3A 1S9GA 4R5PA 3K5MA 1NOYA 2HHVA 1RTHA 4CJKA 1J53A 1EP4A 1REVA 3H08A 2HHSA 2KFNA 4NCAA 1TAUA 1YTUA 4DS5A 4CIGA 4FXDA 2DFFA 4KTWA 3EZ5A 1SUQA 2HVIA 3HVTA 4FJIA 3PO4A 1CXUA 1RT7A 2HNDA 1JKHA 3WNFA 4CHZA 3NGIA 4FLZA 1NK9A 3M8QA 5SWMA 1D9FA 4DSEA 1KTQA 1RDBA 5KRTA 2ITGA 3AVKA 4CEAA 4B9SA 2YHAA 4IDKA 3OYFA 4DSKA 4BE2A 4E7JA 3SJJA 3WNGA 1HNIA 1CZBA 4KFBA 3DM2A 3MEEA 4JS5A 4F8RA 1O1WA 2RKIA 4N5SA 3QNOA 4IKFA 2XY8A 3G10A 3L3UA 1WSIA 2IOCA 4M3RA 1QHTA 2IS3A 3B6OA 1FXXA 4B8CA 2PYJA 1YVUA 3AO4A 2NUBA 1BI4A 3CFOA 4FJ5A 2HB5A 4DTSA 3CFRA 3KK1A 2ETJA 4E7HA 3DRPA 1A5XA 2D0BA 3VN5A 1ASVA 1VSJA 2YNGA 4I9LA 2HHTA 1WSJA 3HPHA 3NF7A 4FW1A 4CGDA 3PV8A 3MXJA 4CHOA 4IFYA 3OS2A 1F21A 3I0RA 3KD5E 2XY6A 1QTMA 4E1NA 2HMIA 4Y1DA 3V1RA 3SCXA 2DY4A 2Q3SA 4IG3A 3VQQA 2E6MA 3AV9A 4CJ3A 1B9DA 1Q9XA 4CERA 3V4IA 1WAJA 1CZ9A 2HHXA 3AVLA 3V9UA 4CFBA 3OVNA 4KO0A 4DSIA 2E4LA 3KLIA 4KKOA 4FZZA 5E41A 4KREA 2B6AA 3B6PA 3AVMA 4NYFA 1RT4A 1LW2A 1C6VA 3V9ZA 4B9UA 3DLRA 3O3HA 1ZBUA 2YHBA 3C6TA 1RT6A 3HT3A 5HROA 5D3GA 1VSMA 1YTAA 4AHUA 4RW6A 4CE9A 5HRRA 3QERA 4GVMA 2IGIA 3DLKA 1Y97A 5JS2A 3ZT3A 1RCHA 4BWMA 2FBYA 4AILC 1HRHA 4I2QA 1FK9A 4AHTA 4HUFA 2KTQA 1CXQA 4GW6A 4O5BA 4K8ZA 3FFIA 3BDPA 4C8LA 2HHUA 4Z4IA 2F8TA 3M8RA 3T1AA 1DTQA 4CGIA 1SV5A 3OYJA 4DQQA 4KHYA 1G15A 3VQPA 2F96A 3LAKA 3C94A 3ZSXA 2KZZA 3HJFA 3P83D 4XIUA 3L2VA 1NKBA 3VQ4A 4HUEA 2GV9A 1R0AA 4FLYA 1D5AA 3K2PA 3ZSOA 3AVAA 4OPKA 3RMCA 3KLGA 2G8KA 3QETA 4AHRA 2XY7A 1WNSA 2DTUA 3OJSA 3VQ8A 2VG5A 2D0CA 4CJLA 3OYCA 4KHQA 3QESA 5C42A 3AO5A 1L3VA 1D8YA 4GMJB 4CF0A 4Z4HA 5CZ1A 3JSMA 4KB1A 1IKXA 1S5JA 3VQCA 3HVRA 3DLBA 1C0TA 3K5LA 3DLHA 1S6PA 2VWJA 2OPSA 5HRPA 4B9MA 4CJWA 4FJMA 4CF9A 2QK9A 1NK5A 4CK2A 3DOKA 1X9MA 4FK0A 1GOAA 2BE2A 4DFJA 5J1EA 4CJ5A 5CZ2A 3LP0A 3AA2A 1C1BA 1KLMA 1S6QA 4H8KA 3ZT2A 1NJYA 3C6UA 1GOBA 5J2PA 3SUQA 4OKJA 3SPZA 1J5OA 1NK6A 4Z4FA 1QQCA 3ZSVA 4JS4A 4J2EA 1S1TA 4TSXA 3KIOA 3MXMA 4CJUA 2QKBA 5DK5A 3CQ8A 3O4QA 2HVHA 3L2RA 4MQ3A 3KLEA 4FCYA 1BIUA 3ZSRA 2HHWA 1XHZA 2KFZA 1GOCA 1BL3A 1XI1A 4YNQA 2JLEA 3S3NA 4AH9A 3SQ4A 4Q5VA 1TGOA 1Q9YA 1JLFA 3AVFA 3PX0A 5CYMA 1LV5A 3SNNA 1TKDA 1VRTA 3TAEA 3AO2A 1UWBA 1T05A 3SI6A 1RT2A 1NK4A 4ELUA 1HPZA 2ZQBA 4MFBA 2G8WA 1TKXA 2O4GA 3SQ0A 4C8OA 4CJFA 3O3GA 3V1QA 3OS0A 3TAFA 4LH4A 1TAQA 2A1RA 3PO5A 1JLCA 4M3TA 4RW4A 2ATQA 4O55A 4M3YA 3ZT1A 3IRXA 4CJ4A 3DLGA 3AVIA 4N76A 1WSGA 2G8VA 3HL8A 1RTJA 3DMJA 4DTNA 2OPPA 3OYKA 1RT1A 4AHSA 1TVRA 4B9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WSH A;  4CHY A;  1RBT A;  3QLH A;  4DTX A;  2X6N A;  4FM1 A;  3S3M A;  4M3W A;  4FJN A;  4FJJ A;  2Y1J A;  3NF8 A;  3SUN A;  1KRP A;  1SL0 A;  3QIO A;  2FBX A;  3D0P A;  3QEI A;  1X9S A;  4W5Q A;  4CEQ A;  3QEP A;  4FYD A;  3OYE A;  4H4O A;  5C24 A;  1NKC A;  4KAZ A;  4DQP A;  1FKP A;  4IBN A;  3ZCM A;  2D5R A;  5K14 A;  2O4I A;  1LWC A;  1WSE A;  4HVJ A;  4C8M A;  3V9W A;  1BI4 B;  3KD1 E;  2Z1H A;  1RBR A;  2EHG A;  4I7F A;  1UA0 A;  2HNY A;  3U6F A;  4DS4 A;  3AVN A;  3TAM A;  1XHX A;  3HM9 A;  4HHT A;  4BDP A;  3ULD A;  2BGG A;  1Q8I A;  3KK2 A;  4DFK A;  5CY4 A;  4CFA A;  4O0J A;  3LAN A;  4ELT A;  3RR7 A;  2XO7 A;  1ZBH A;  4CK1 A;  4DLG A;  5FRM A;  1J9A A;  3SV4 A;  3PUF A;  1A5W A;  4CJS A;  2OPQ A;  3TAN A;  4DQR A;  4KRF A;  4KV8 A;  3HYF A;  1RIL A;  2IC3 A;  3P5J A;  3LP1 A;  3NF9 A;  4CJQ A;  5KGX A;  1VSL A;  3AA3 A;  3MEG A;  4I2P A;  4CEZ A;  5J2N A;  1SKR A;  3KLH A;  2XRI A;  3KKR A;  3VA3 A;  1LAW A;  3DRR A;  1NK8 A;  1JXE A;  2OYQ A;  4PQU A;  4EZ9 A;  1LW0 A;  4Q0B A;  1K6Y A;  1X1P A;  2VG7 A;  2X6S A;  2D0A A;  4DTU A;  4QCL A;  3KK3 A;  3QIP A;  3I0S A;  3NGY A;  4E7K A;  1ZBI A;  3BGR A;  1KFD A;  3T3F A;  3TR8 A;  4W5T A;  1KVA A;  2XHB A;  3SPY A;  4OLA A;  4CFD A;  3KJV A;  4DWI A;  3VQE A;  1TL1 A;  3OYL A;  4DSJ A;  4CJE A;  3G0Z A;  4FJG A;  1RNH A;  3LAL A;  3HP6 A;  4FW2 A;  1RDA A;  2FBT A;  4JLH A;  3V81 A;  3VQ7 A;  1U47 A;  2B5J A;  2Z1J A;  4Z4C A;  1UAX A;  1JLB A;  4CEF A;  5FRN A;  1L3S A;  4LY7 A;  5KRS A;  1NJW A;  2VWK A;  2GUI A;  3U3G A;  3LZJ A;  3VQ5 A;  4ID1 A;  3UIQ A;  1WLJ A;  4KTQ A;  4KPY A;  3AO3 A;  3KLF A;  4OKK A;  4FM2 A;  5FRO A;  4PUO A;  1BCM A;  3RR8 A;  2G8U A;  3QEV A;  3SZ2 A;  1U48 A;  4F2S A;  2FBV A;  4B9L A;  4PA1 A;  4O0I A;  3K59 A;  3VQ6 A;  2BAN A;  2QXF A;  2YKM A;  2PYL A;  5FDL A;  3NCI A;  4EZ6 A;  1B92 A;  1TV6 A;  4J2D A;  2EX3 A;  2HW3 A;  4E0D A;  5HLF A;  1NKE A;  1ASW A;  4H4M A;  4E19 A;  3TWH A;  3LAM A;  1C1A A;  3TAQ A;  1UA1 A;  1J54 A;  1Z25 A;  4FZY A;  3MAQ A;  4J2B A;  3F73 A;  1S1X A;  3V9X A;  5I42 A;  3L2W A;  1ASU A;  5HBM A;  2IAJ A;  3ZSZ A;  1QSY A;  4M3U A;  4FLV A;  2E6L A;  3TI0 A;  4E7I A;  4M3X A;  3KKS A;  3ALY A;  1HYS A;  1WAF A;  3DOL A;  5J2Q A;  2JGU A;  1DLO A;  4CIF A;  2GBZ A;  3K5O A;  4J2A A;  4NYN A;  1BHL A;  1BGX T;  1BQM A;  1C0M A;  1JLQ A;  1YT3 A;  4DU4 A;  4DTR A;  3RMA A;  4N41 A;  4KHN A;  2G8I A;  4W5O A;  3M8S A;  1VSE A;  1HNV A;  1TL3 A;  3OJU A;  4RW7 A;  3V9S A;  4CEC A;  1JL2 A;  4E3S A;  1L3T A;  4OLB A;  3HXM A;  5HP1 A;  1A5V A;  1WN7 A;  1IKW A;  4EP5 A;  3RMD A;  1RTI A;  4BWJ A;  2YNI A;  4EP4 A;  1HQE A;  3HST B;  4ID5 A;  3D45 A;  3QEW A;  3LDS A;  3ZSY A;  4CF2 A;  1NJZ A;  1SL1 A;  3IAY A;  3L2U A;  3OYD A;  3AVG A;  3RRG A;  3SYZ A;  3NFA A;  2LSN A;  1U4B A;  1ITG A;  1JLG A;  2P1J A;  4DMN A;  3KTQ A;  2B4J A;  3LPT A;  3MXI A;  4K8X A;  5EU7 A;  3L8B A;  3S3O A;  2PZS A;  1HQU A;  1NK7 A;  1RBU A;  1FKO A;  3SV3 A;  4B3O A;  1N6Q A;  4CGH A;  5KGW A;  1NK0 A;  4LD0 A;  4I9Q A;  4FK4 A;  3SUO A;  4HTU A;  1EET A;  4RW9 A;  4ELV A;  1S1V A;  1KSP A;  1L5U A;  2PY5 A;  1ZYQ A;  3CYM A;  1JL1 A;  3EYZ A;  4DU1 A;  1BQN A;  4RW8 A;  2RN2 A;  1QSS A;  1I3A A;  3DLE A;  3K5N A;  3ZSQ A;  5KTQ A;  4FJK A;  1IH7 A;  3LWM A;  4DTJ A;  4W5R A;  2VG6 A;  3T19 A;  4CJR A;  1I39 A;  5SZT A;  4QAG A;  2YV0 X;  1IO2 A;  4OKE A;  3VA0 A;  1W9H A;  1S1W A;  5CYQ A;  4E7L A;  1BIS A;  4DF8 A;  4CGG A;  3OS1 A;  1DTT A;  5T7B A;  1IKY A;  5HRS A;  4FLU A;  4FVM A;  4FJ7 A;  1JLE A;  4CK3 A;  4F3O A;  4BDY A;  3HP9 A;  3IG1 A;  3TAR A;  2OPR A;  4B9V A;  4HCC A;  4FJ9 A;  3C95 A;  3HPG A;  4KHW A;  1RBS A;  1VSD A;  1WSF A;  3DRS A;  3E01 A;  3JYT A;  4N47 A;  4CED A;  1CLQ A;  5C25 A;  1KLN A;  1QSL A;  1VSI A;  1NJX A;  3ZT0 A;  4ICL A;  1VSK A;  4CJT A;  2RF2 A;  2AJQ A;  1Z26 A;  3AVC A;  3RMB A;  4F3T A;  3AVB A;  2OZM A;  4C8K A;  4CF8 A;  1KVC A;  3ASM A;  1UOC A;  3NDK A;  1IG9 A;  2X74 A;  3WNE A;  3AVH A;  2HNZ A;  1QS4 A;  4CF1 A;  1RT3 A;  1VSH A;  1T7P A;  1T8E A;  4DFP A;  4WE1 A;  1B9F A;  3LP2 A;  4KI4 A;  4CHN A;  4JRQ A;  4N56 A;  3AA5 X;  4PWD A;  2G8H A;  4DF4 A;  1S9E A;  2KZM A;  4AHC A;  4LSN A;  2BDP A;  4DG1 A;  1XC9 A;  4M3Z A;  1VK0 A;  3RWU A;  1RTD A;  5JS1 A;  2F8S A;  4FJX A;  4OGC A;  2KW4 A;  4OVL A;  4QOZ B;  4BAC A;  4FZX C;  3OYA A;  1HYV A;  3NE6 A;  4FJ8 A;  1NOZ A;  1EKE A;  1RDD A;  2DFE A;  3OYH A;  3ISN C;  4B08 A;  3PX4 A;  4LH5 A;  3TAB A;  1XWL A;  3LWL A;  2WOM A;  3TAP A;  4KB0 A;  4FJL A;  3TAG A;  1IKV A;  1SL2 A;  4UQG A;  4KI6 A;  1BCO A;  4NCG A;  1D9D A;  3I8D A;  4DTM A;  3ZSW A;  4FLX A;  4IFV A;  4KHU A;  4DQI A;  3L3V A;  2W42 A;  3OYN A;  1KCF A;  3RRH A;  3QO9 A;  4BE1 A;  3THV A;  4G1Q A;  4ZTJ A;  3DYA A;  4DTP A;  3U3Y A;  1LWE A;  3F9K A;  1ZBL A;  3RTV A;  4O4G A;  4FM0 A;  3NBP A;  4DQS A;  3AA4 A;  4YFU A;  2X78 A;  2Z1G A;  3K58 A;  4W5N A;  1RT5 A;  4CEE A;  1KFS A;  1C1C A;  3L2Q A;  4OPJ A;  1HMV A;  3HO1 A;  1TK5 A;  1T03 A;  1VRU A;  4BDZ A;  3O4N A;  1KVB A;  2OZS A;  2OA8 A;  1JLA A;  3OYM A;  3SUP A;  4CCH A;  3QEX A;  4F4K A;  1N5Y A;  3NH0 A;  2I5J A;  2RPI A;  3LZI A;  4FJH A;  1W0H A;  3VQB A;  4JRP A;  3O3F A;  4M45 A;  4L8R B;  2ZE2 A;  4KHS A;  4M41 A;  1EX4 A;  2XY5 A;  2YNF A;  1ZBF A;  3MEC A;  1X9W A;  4BE0 A;  5KI6 A;  4FK2 A;  3PY8 A;  4CHP A;  3QNN A;  4CIE A;  3VQD A;  3OYI A;  2QKK A;  3NHG A;  4F2R A;  4RG8 A;  2IDO A;  3WNH A;  4Z0U A;  3SQ1 A;  3CM5 A;  4CFC A;  4CGJ A;  1TKT A;  2R7Y A;  3AO1 A;  3VQ9 A;  4ZHR A;  4M42 A;  3HPO A;  4E1M A;  1QE1 A;  2FC0 A;  3OY9 A;  3S9H A;  4Y1C A;  2G8F A;  4ZTF A;  1BIZ A;  1TK0 A;  4CEB A;  4C8N A;  1SKS A;  3IS9 A;  2P5O A;  2P5G A;  3V6D A;  1SKW A;  4CJP A;  4KTZ A;  4HUG A;  4DTO A;  3K57 A;  3NF6 A;  4FLW A;  3V1O A;  1L3U A;  4NCB A;  3AVJ A;  5HRN A;  3QIN A;  5I3U A;  3MED A;  4DFM A;  3CFP A;  2WON A;  3HK2 A;  4OJR A;  1HYZ A;  4B8A B;  3NGZ A;  3M8P A;  3NAE A;  1U04 A;  3SQ2 A;  1C0U A;  1LAV A;  3DI6 A;  4CGF A;  1LWF A;  4Z4G A;  1TKZ A;  4DLE A;  1RDC A;  1U49 A;  4LSL A;  3A2F A;  3ITH A;  3P1G A;  4CEO A;  1VSF A;  2YKN A;  2YNH A;  1RBV A;  3CM6 A;  4O44 A;  4E89 A;  4CHQ A;  4FLT A;  1TK8 A;  2KQ2 A;  4AHV A;  3NH1 A;  3OYB A;  2Y1I A;  3NH2 A;  2DFH A;  1U45 A;  4DSL A;  3EY1 A;  4PY5 A;  3CG7 A;  5J2M A;  2ZD1 A;  4Z4E A;  2HHQ A;  4B9N A;  4IG0 A;  1HJR A;  1JXB A;  2A1S A;  3OYG A;  2P51 A;  1S1U A;  5DMR A;  4OGE A;  3LPU A;  4CES A;  2Z1I A;  1EXQ A;  3LP3 A;  3VQA A;  3ZT4 A;  3PX6 A;  4DSF A;  4HCB A;  1MU2 A;  4CJV A;  4DU3 A;  1S9G A;  4R5P A;  3K5M A;  1NOY A;  2HHV A;  1RTH A;  4CJK A;  1J53 A;  1EP4 A;  1REV A;  3H08 A;  2HHS A;  2KFN A;  4NCA A;  1TAU A;  1YTU A;  4DS5 A;  4CIG A;  4FXD A;  2DFF A;  4KTW A;  3EZ5 A;  1SUQ A;  2HVI A;  3HVT A;  4FJI A;  3PO4 A;  1CXU A;  1RT7 A;  2HND A;  1JKH A;  3WNF A;  4CHZ A;  3NGI A;  4FLZ A;  1NK9 A;  3M8Q A;  5SWM A;  1D9F A;  4DSE A;  1KTQ A;  1RDB A;  5KRT A;  2ITG A;  3AVK A;  4CEA A;  4B9S A;  2YHA A;  4IDK A;  3OYF A;  4DSK A;  4BE2 A;  4E7J A;  3SJJ A;  3WNG A;  1HNI A;  1CZB A;  4KFB A;  3DM2 A;  3MEE A;  4JS5 A;  4F8R A;  1O1W A;  2RKI A;  4N5S A;  3QNO A;  4IKF A;  2XY8 A;  3G10 A;  3L3U A;  1WSI A;  2IOC A;  4M3R A;  1QHT A;  2IS3 A;  3B6O A;  1FXX A;  4B8C A;  2PYJ A;  1YVU A;  3AO4 A;  2NUB A;  1BI4 A;  3CFO A;  4FJ5 A;  2HB5 A;  4DTS A;  3CFR A;  3KK1 A;  2ETJ A;  4E7H A;  3DRP A;  1A5X A;  2D0B A;  3VN5 A;  1ASV A;  1VSJ A;  2YNG A;  4I9L A;  2HHT A;  1WSJ A;  3HPH A;  3NF7 A;  4FW1 A;  4CGD A;  3PV8 A;  3MXJ A;  4CHO A;  4IFY A;  3OS2 A;  1F21 A;  3I0R A;  3KD5 E;  2XY6 A;  1QTM A;  4E1N A;  2HMI A;  4Y1D A;  3V1R A;  3SCX A;  2DY4 A;  2Q3S A;  4IG3 A;  3VQQ A;  2E6M A;  3AV9 A;  4CJ3 A;  1B9D A;  1Q9X A;  4CER A;  3V4I A;  1WAJ A;  1CZ9 A;  2HHX A;  3AVL A;  3V9U A;  4CFB A;  3OVN A;  4KO0 A;  4DSI A;  2E4L A;  3KLI A;  4KKO A;  4FZZ A;  5E41 A;  4KRE A;  2B6A A;  3B6P A;  3AVM A;  4NYF A;  1RT4 A;  1LW2 A;  1C6V A;  3V9Z A;  4B9U A;  3DLR A;  3O3H A;  1ZBU A;  2YHB A;  3C6T A;  1RT6 A;  3HT3 A;  5HRO A;  5D3G A;  1VSM A;  1YTA A;  4AHU A;  4RW6 A;  4CE9 A;  5HRR A;  3QER A;  4GVM A;  2IGI A;  3DLK A;  1Y97 A;  5JS2 A;  3ZT3 A;  1RCH A;  4BWM A;  2FBY A;  4AIL C;  1HRH A;  4I2Q A;  1FK9 A;  4AHT A;  4HUF A;  2KTQ A;  1CXQ A;  4GW6 A;  4O5B A;  4K8Z A;  3FFI A;  3BDP A;  4C8L A;  2HHU A;  4Z4I A;  2F8T A;  3M8R A;  3T1A A;  1DTQ A;  4CGI A;  1SV5 A;  3OYJ A;  4DQQ A;  4KHY A;  1G15 A;  3VQP A;  2F96 A;  3LAK A;  3C94 A;  3ZSX A;  2KZZ A;  3HJF A;  3P83 D;  4XIU A;  3L2V A;  1NKB A;  3VQ4 A;  4HUE A;  2GV9 A;  1R0A A;  4FLY A;  1D5A A;  3K2P A;  3ZSO A;  3AVA A;  4OPK A;  3RMC A;  3KLG A;  2G8K A;  3QET A;  4AHR A;  2XY7 A;  1WNS A;  2DTU A;  3OJS A;  3VQ8 A;  2VG5 A;  2D0C A;  4CJL A;  3OYC A;  4KHQ A;  3QES A;  5C42 A;  3AO5 A;  1L3V A;  1D8Y A;  4GMJ B;  4CF0 A;  4Z4H A;  5CZ1 A;  3JSM A;  4KB1 A;  1IKX A;  1S5J A;  3VQC A;  3HVR A;  3DLB A;  1C0T A;  3K5L A;  3DLH A;  1S6P A;  2VWJ A;  2OPS A;  5HRP A;  4B9M A;  4CJW A;  4FJM A;  4CF9 A;  2QK9 A;  1NK5 A;  4CK2 A;  3DOK A;  1X9M A;  4FK0 A;  1GOA A;  2BE2 A;  4DFJ A;  5J1E A;  4CJ5 A;  5CZ2 A;  3LP0 A;  3AA2 A;  1C1B A;  1KLM A;  1S6Q A;  4H8K A;  3ZT2 A;  1NJY A;  3C6U A;  1GOB A;  5J2P A;  3SUQ A;  4OKJ A;  3SPZ A;  1J5O A;  1NK6 A;  4Z4F A;  1QQC A;  3ZSV A;  4JS4 A;  4J2E A;  1S1T A;  4TSX A;  3KIO A;  3MXM A;  4CJU A;  2QKB A;  5DK5 A;  3CQ8 A;  3O4Q A;  2HVH A;  3L2R A;  4MQ3 A;  3KLE A;  4FCY A;  1BIU A;  3ZSR A;  2HHW A;  1XHZ A;  2KFZ A;  1GOC A;  1BL3 A;  1XI1 A;  4YNQ A;  2JLE A;  3S3N A;  4AH9 A;  3SQ4 A;  4Q5V A;  1TGO A;  1Q9Y A;  1JLF A;  3AVF A;  3PX0 A;  5CYM A;  1LV5 A;  3SNN A;  1TKD A;  1VRT A;  3TAE A;  3AO2 A;  1UWB A;  1T05 A;  3SI6 A;  1RT2 A;  1NK4 A;  4ELU A;  1HPZ A;  2ZQB A;  4MFB A;  2G8W A;  1TKX A;  2O4G A;  3SQ0 A;  4C8O A;  4CJF A;  3O3G A;  3V1Q A;  3OS0 A;  3TAF A;  4LH4 A;  1TAQ A;  2A1R A;  3PO5 A;  1JLC A;  4M3T A;  4RW4 A;  2ATQ A;  4O55 A;  4M3Y A;  3ZT1 A;  3IRX A;  4CJ4 A;  3DLG A;  3AVI A;  4N76 A;  1WSG A;  2G8V A;  3HL8 A;  1RTJ A;  3DMJ A;  4DTN A;  2OPP A;  3OYK A;  1RT1 A;  4AHS A;  1TVR A;  4B9T A; 
#chains in the Genus database with same CATH topology
 4QS9 A;  3MN5 A;  2OTJ N;  2Y1J A;  1KRP A;  3D0P A;  4WYB A;  1IJJ A;  2OCE A;  1NKC A;  3CCE N;  3SMP A;  4IBN A;  2O4I A;  3KZB A;  4FWQ A;  1T3V A;  3KD1 E;  2P9K A;  2Z1H A;  4I7F A;  4NLB A;  4JV5 K;  1XHX A;  5BPM A;  3ULD A;  2ZF5 O;  4H0P A;  3THX B;  2XO7 A;  4DLG A;  3CI5 A;  3PUF A;  3TTD A;  4CJS A;  1S3X A;  2E2O A;  3HYF A;  2IC3 A;  4NO7 A;  5KGX A;  3NF9 A;  5J2N A;  3J8A A;  3M1F A;  1SKR A;  3EE8 A;  2XRI A;  4GVE A;  5FPM A;  1JCF A;  1EQY A;  3ULE A;  5HL7 L;  4YOU A;  1MDU B;  1NGC A;  2IVN A;  3NGY A;  3BGR A;  3CXC M;  1ZBI A;  3T3F A;  2W41 A;  4DR7 K;  5AQG A;  4DSJ A;  4CJE A;  3MDQ A;  1RNH A;  3LAL A;  3HP6 A;  1RDA A;  4DR5 K;  3VQ7 A;  2Z1J A;  3DLL L;  4Z4C A;  3JS6 A;  2NRR A;  3N4P A;  4PL7 A;  3U3G A;  3LDL A;  4KTQ A;  4RWT A;  1DEJ A;  3AO3 A;  3GE1 A;  4FSV A;  4OKK A;  4FM2 A;  5BRH A;  2G8U A;  4DR6 K;  4IZ9 A;  4KBO A;  4JI0 K;  2QXF A;  3CCU N;  5FDL A;  3NCI A;  4EZ6 A;  1B92 A;  1TV6 A;  4J2D A;  3ZET B;  3HOT A;  5HLF A;  3H1Q A;  4H4M A;  1C1A A;  2IVP A;  1UA1 A;  3WXL A;  3MAQ A;  5HBM A;  2IAJ A;  4EHU A;  4M3U A;  1KC8 O;  5C12 A;  1IBL K;  3T7Z A;  3WEE B;  1IV0 A;  1MWK A;  3TI0 A;  1K9M O;  4M3X A;  3FLC O;  2JGU A;  4GV6 A;  3IKM A;  3P31 A;  4H0V B;  1BQM A;  1JLQ A;  1HNV A;  3A8Y A;  3WXI A;  1FW6 A;  4CEC A;  4B3T K;  4E3S A;  5JMV A;  4OLB A;  5HP1 A;  3L4Q A;  1BUP A;  3RMD A;  2O8D B;  1RTI A;  2F9T A;  5AQF A;  4BWJ A;  1NGI A;  4BRK A;  4EP4 A;  2O8F B;  4ID5 A;  3HSC A;  3LDS A;  3E9O A;  3M5R A;  3AVG A;  3SJH A;  1U4B A;  4WQ4 C;  4WCE L;  3KTQ A;  4K8X A;  5EU7 A;  3L8B A;  3FZF A;  1YJN N;  5AQH A;  2A40 A;  2IIR A;  3I33 A;  1S1V A;  5A2Q O;  3W0L A;  3CER A;  4DR4 K;  4BRF A;  4IO8 A;  4RW8 A;  5EX5 A;  1I3A A;  3RVC A;  2P9U A;  3LM9 A;  5KTQ A;  4JI2 K;  1ILY A;  4BRN A;  5SZT A;  4QAG A;  1IO2 A;  5CYQ A;  3O9U A;  4JD2 A;  4BRP A;  3OS1 A;  4WFB L;  5T7B A;  1IKY A;  2YHY A;  1JLE A;  3HP9 A;  3IG1 A;  3HPG A;  4A59 A;  3DRS A;  3JYT A;  4N47 A;  1HNW K;  1CLQ A;  5C25 A;  1SAZ A;  1VSI A;  4ICL A;  1VSK A;  5AQX A;  3VF2 A;  3KHY A;  2AJQ A;  3SAF A;  4C8K A;  4CF8 A;  4ILJ A;  3NDK A;  2X74 A;  3WNE A;  1VSH A;  1T8E A;  4WE1 A;  5BN8 A;  1T44 A;  1B9F A;  3U8X A;  4OPH A;  4JAX A;  1S9E A;  1JJ2 M;  2BDP A;  4DG1 A;  1VK0 A;  2D0P A;  4KH5 A;  3CCS N;  2KW4 A;  3CET A;  4OVL A;  5DM7 L;  1RDD A;  2DFE A;  5AQI A;  4CBW A;  1ZBS A;  3LWL A;  3UB5 A;  3TAG A;  1IKV A;  4DV6 K;  4KI6 A;  1D9D A;  2NLX A;  4DQI A;  4H5W A;  2W42 A;  4IXC A;  3G71 N;  4ZTJ A;  3QB0 A;  5AZJ A;  3U3Y A;  4YHH K;  5CE3 A;  4JHD A;  2FXU A;  3NBP A;  3AA4 A;  2X78 A;  3RSE B;  3K58 A;  4W5N A;  1KFS A;  1C1C A;  1HMV A;  3OBY A;  3HO1 A;  5TKW A;  1T03 A;  2W40 A;  3FZL A;  3EE9 A;  3CCL N;  3OYM A;  5JIC A;  1QHA A;  2I5J A;  5M1F A;  1CZA N;  4JRP A;  2Q0R A;  2NRH A;  5FPD A;  4KHS A;  2XY5 A;  4MLE A;  1ZBF A;  3CCJ N;  3VF4 A;  3O1W A;  4BR7 A;  1U6Z A;  3LDP A;  1NGE A;  3S9H A;  3WQU A;  4CZH A;  3AAR A;  2G8F A;  1GLA G;  1BIZ A;  1J6Z A;  4ZTF A;  4CEB A;  4C8N A;  1SKS A;  1TK0 A;  4XH5 A;  3UKU B;  3V6D A;  4CJP A;  1SKW A;  2P5G A;  5HRN A;  4DFM A;  3CFP A;  3NGZ A;  2VGM A;  3M8P A;  1OH6 A;  1C0U A;  1LAV A;  3DI6 A;  4Z4G A;  4DLE A;  3VEZ A;  3ITH A;  2O8B A;  1VSF A;  2YKN A;  2YNH A;  3CM6 A;  2QWP A;  3IDH A;  4CHQ A;  4FLT A;  1TK8 A;  2KQ2 A;  3D7E O;  2DFH A;  4I6M A;  4PY5 A;  5J2M A;  4PL8 A;  4Z4E A;  3I55 N;  4B9N A;  4BRE A;  4M63 C;  3K0S A;  1S1U A;  5DMR A;  4OGE A;  4CES A;  4DSF A;  4R5P A;  3K5M A;  3T1Y K;  1J53 A;  4JKE A;  2KFN A;  1TAU A;  1YTU A;  4DS5 A;  3PLA A;  4FXD A;  4KTW A;  3Q7B A;  1SUQ A;  2P9K B;  4J8F A;  1CXU A;  3M8Q A;  3THW A;  1RDB A;  2ZM6 K;  5KRT A;  4YDU A;  5BPL A;  3CC2 N;  4GKK K;  4IDK A;  4K41 A;  4DV0 K;  3WNG A;  4CI6 A;  4PKH A;  4KFB A;  3MEE A;  4F8R A;  3WXK A;  4N5S A;  2XY8 A;  3G10 A;  1VQL N;  1WSI A;  3VGL A;  1DKG D;  5GAD P;  1YUW A;  3F5T A;  2PYJ A;  3AO4 A;  3ULE B;  3CFO A;  4C1N I;  4FJ5 A;  2HB5 A;  1I94 K;  3CFR A;  4E7H A;  2BH1 A;  4CZJ A;  3VN5 A;  2YNG A;  2HHT A;  3HPH A;  4EFH A;  3NF7 A;  4FOI A;  5E84 A;  4CHO A;  2CGL A;  4IFY A;  4KH6 A;  2E1Y A;  2Q3S A;  3VQQ A;  2ZWH A;  4KO0 A;  4FZZ A;  3B6P A;  1RT4 A;  3PIO L;  3DLR A;  3LDN A;  3VPZ A;  5D3G A;  5AQV A;  2QWQ A;  5HRR A;  5C15 A;  1HLU A;  4BC2 A;  5C2D A;  4X65 K;  4GVM A;  3ZT3 A;  3ID8 A;  4I2Q A;  4HUF A;  4GW6 A;  3FFI A;  5LJW A;  4WF9 L;  2YI1 A;  1WB9 A;  2F8T A;  3OYJ A;  4CGI A;  1SV5 A;  3UKR A;  3VQP A;  2V7Z A;  3O9R A;  2F96 A;  3C94 A;  3ZSX A;  2V51 B;  4DV5 K;  3VQ4 A;  3VET A;  1R0A A;  3RMC A;  1E3M A;  5AQJ A;  3CME N;  1P8Z A;  2XY7 A;  4FWR A;  4KHQ A;  3AO5 A;  4BVO A;  3FFK B;  4CF0 A;  4KB1 A;  3ZX0 A;  1C0G A;  3DLB A;  3QBW A;  3G4S N;  4GV9 A;  1M90 O;  4FJM A;  4DFJ A;  1V4T A;  4JKD A;  3ZT2 A;  1C1B A;  3WEE A;  4G9Z A;  5J2P A;  3SUQ A;  2OTL N;  3OA9 A;  3ZSV A;  4DQ8 A;  3D2F A;  4TSX A;  4CJU A;  3CC7 N;  1O13 A;  2YX6 A;  4MQ3 A;  4FCY A;  3T69 A;  1BIU A;  2EWS A;  1GOC A;  2OAN A;  4YNQ A;  1N8R O;  3AVF A;  5CYM A;  2AA4 A;  3OW2 M;  3AO2 A;  1X3N A;  1T05 A;  1NGH A;  1RT2 A;  1NK4 A;  1OH5 A;  4MFB A;  3O3G A;  4M3T A;  2UXD K;  3CPW M;  1BDG A;  4CJ4 A;  4YDU C;  2G8V A;  4CZG A;  2NRZ A;  1WSH A;  3E66 A;  1RBT A;  4CHY A;  4FM1 A;  3S3M A;  1XMQ K;  5MLC Q;  4FJJ A;  5LL6 Z;  4YOY A;  3QFP A;  2FBX A;  3AAQ A;  3QEP A;  4FYD A;  3WXM B;  3ZCM A;  2D5R A;  5K14 A;  1LWC A;  1YF5 L;  5AQL A;  3FZK A;  4H5N A;  3V9W A;  1BI4 B;  2HNY A;  4JK7 A;  3AGK A;  4DS4 A;  3AVN A;  4DFK A;  5CY4 A;  3LAN A;  3RR7 A;  1ZBH A;  4CK1 A;  1J9A A;  3HOS A;  4NB4 A;  4KRF A;  4KV8 A;  3LP1 A;  1KXP A;  3J7Y P;  5AFU A;  4BR9 A;  3KKR A;  1W97 L;  3DRR A;  4Q0B A;  1K6Y A;  1X1P A;  2X6S A;  4BRA A;  2WUS A;  2ZGZ A;  4JHD B;  3HM8 A;  4W5T A;  1XQS C;  3DXK A;  4DCH A;  4CFD A;  4DWI A;  3VQE A;  4FJG A;  4FW2 A;  1U47 A;  4DR2 K;  2B5J A;  3L0Q A;  5KRS A;  1NLV A;  3CCM N;  3LZJ A;  3KVG A;  3CJC A;  4B1V A;  3VQ5 A;  4B9Q A;  4ID1 A;  3CQX A;  3UIQ A;  3H3O B;  4X64 K;  3U4L A;  5FRO A;  4PUO A;  2P9P B;  3S41 A;  4F2S A;  4B9L A;  2QWN A;  3VQ6 A;  2YKM A;  4ISG A;  5AQO A;  3RSE A;  5F1X A;  2EX3 A;  2HW3 A;  2E5L K;  4E19 A;  3TWH A;  3TPQ A;  3F73 A;  2WBN A;  2QEX N;  3O1B A;  4E1J A;  3ZSZ A;  3CJA A;  4FL9 A;  3OBW A;  4E7I A;  3K5O A;  5GIO A;  1C0M A;  4N41 A;  2O8B B;  1KAX A;  1VSE A;  4AF1 A;  4X62 K;  4FWN A;  1RFQ A;  1TL3 A;  2A42 A;  4RW7 A;  3V9S A;  2QXL A;  1L3T A;  3VER A;  3BUZ B;  4HWI A;  4YOT A;  1IKW A;  4LFC K;  3UKU A;  3P4I A;  4BR0 A;  1NG9 A;  4CF2 A;  5I9E B;  5KPR A;  3GBT A;  2UXC K;  3SYZ A;  4CZF A;  2P1J A;  2PZS A;  1RBU A;  4B3O A;  4WQ4 A;  4CGH A;  3THW B;  1NK0 A;  4I9Q A;  3C6A A;  3CD6 N;  5F0X A;  1EET A;  1HNZ K;  1ZYQ A;  3CYM A;  3QBX A;  3EYZ A;  4XH1 A;  1E4G T;  1QSS A;  2HF3 A;  3P38 A;  2ITM A;  2QTD A;  1IBM K;  4CJR A;  3T19 A;  5AQK A;  4OKE A;  3VA0 A;  1W9H A;  2NNW A;  4FWK A;  1BU6 O;  4FJ7 A;  4O8K A;  2PFU A;  3TAR A;  4HCC A;  4B9V A;  2OPR A;  2P9S B;  4KHW A;  4CED A;  3BZC A;  1VQ7 N;  4GV3 A;  1Z26 A;  4F3T A;  1HUX A;  3WUH A;  1XC3 A;  4IOA L;  5AQN A;  1IG9 A;  1QS4 A;  1Y64 A;  5AQW A;  3R8E A;  5AQU A;  1Q7Y O;  3LP2 A;  3VES A;  4PWD A;  4DF4 A;  4AHC A;  1KAY A;  1XC9 A;  2UU9 K;  2F7T A;  2F4V K;  1HNX K;  3GL1 A;  4BAC A;  5GAG P;  3VMF B;  3TAB A;  4H5T A;  1VQ8 N;  3UKR B;  4UQG A;  3VEY A;  1BCO A;  4NCG A;  3I8D A;  4DTM A;  4BC5 A;  2A3Z A;  3N4Q A;  3RRH A;  3FZH A;  4BR5 A;  3ENB A;  3THV A;  3SMS A;  3G6E N;  1LWE A;  1HKG A;  3F9K A;  2E2P A;  4B1W B;  3NVK A;  4O4G A;  2ASO A;  4BQL A;  4YFU A;  3VEX A;  1RT5 A;  4OPJ A;  1VRU A;  4BDZ A;  3O4N A;  1KVB A;  2OZS A;  2OA8 A;  4FOE A;  4F4K A;  4IOC L;  2RPI A;  3VTH A;  4FJH A;  3O3F A;  5GIP A;  2Q36 A;  4M41 A;  1VQ6 N;  3D2F B;  3DJC A;  2WC9 A;  1GLD G;  1X3M A;  4FK2 A;  4CHP A;  4CIE A;  3OYI A;  3NHG A;  4RG8 A;  3WNH A;  5AQZ A;  1TKT A;  3VQ9 A;  5CR4 A;  2GWJ A;  3HPO A;  1ATS A;  3OY9 A;  4IO9 L;  4X66 K;  3D2E A;  4HTL A;  1L3U A;  3K57 A;  3QIN A;  5I3U A;  5H1S Q;  5E26 A;  3HK2 A;  3QIC A;  1GLC G;  1LCU A;  1U04 A;  4IOX A;  5LJV A;  3UE5 A;  2QWO A;  2HHH K;  1TKZ A;  4K25 A;  4LSL A;  2ZJP L;  4E89 A;  1D4X A;  4BVP A;  3NH1 A;  3NH2 A;  2O8C A;  1W7A A;  1HJR A;  1JXB A;  4KH4 A;  3ZEU A;  2A1S A;  3MN9 A;  3OYG A;  2P51 A;  1BA0 A;  3LPU A;  4FO0 A;  2Z1I A;  3MN7 A;  4ISF A;  4JI6 K;  1MU2 A;  2QA4 N;  4A2A A;  1RTH A;  4CJK A;  1REV A;  2HST A;  3I56 N;  4CIG A;  4BRI A;  5AQP A;  2HVI A;  4B1Z A;  4YOX A;  5KPT A;  3PO4 A;  1RT7 A;  4LFB K;  1JKH A;  4A5A A;  4CZE A;  2YHA A;  4DSK A;  1HNI A;  4BGB A;  4NLC A;  2RKI A;  3QNO A;  3NVM A;  1YVU A;  2NUB A;  1BI4 A;  3ZYY X;  2ETJ A;  3CJ9 A;  3J7A P;  3DXK B;  3VEO A;  2D0B A;  4CGD A;  1YJW N;  4V19 S;  1JCE A;  2XY6 A;  3V1R A;  3SCX A;  3NMU A;  2E6M A;  3QFU A;  4CJ3 A;  4CER A;  2GEL A;  3V9U A;  4CFB A;  4DSI A;  2NRX A;  4KKO A;  3SBG A;  2B6A A;  3AVM A;  3FGU A;  2FLO A;  3V9Z A;  3O3H A;  3BF3 A;  1ZBU A;  1RT6 A;  3HT3 A;  1VSM A;  3IMX A;  4CE9 A;  3GG4 A;  3O6W A;  3DLK A;  1Y97 A;  4CD3 A;  4NXN K;  1CXQ A;  4FWS A;  2KTQ A;  4O5B A;  3BDP A;  1RDW X;  1GLL O;  4FPA A;  1QZ5 A;  2YJE A;  3P83 D;  4XIU A;  1NKB A;  4HUE A;  3SAH A;  3U9D A;  4FLY A;  1D5A A;  3K2P A;  3ZSO A;  3AVA A;  4H5V A;  2H3G X;  2G8K A;  4JYA K;  2P9P A;  4AHR A;  3QML A;  4FPB A;  2D0C A;  1L3V A;  3EO3 A;  5C42 A;  3TTF A;  4LF8 K;  4Z4H A;  5CZ1 A;  5AQT A;  2UXB K;  1IKX A;  1S5J A;  3CJ1 A;  1Z6R A;  1C0T A;  4A2B A;  2VWJ A;  1ZXO A;  4CJW A;  5M1K A;  3DOK A;  3QDK A;  3LP0 A;  4RTF D;  1S6Q A;  2VWB A;  4OKJ A;  3KIO A;  2E2N A;  3C6H A;  1EWQ A;  2QKB A;  1XUP O;  5DK5 A;  3L2R A;  2I7P A;  1WUA A;  3ZSR A;  4CW7 B;  3AGR A;  3EEQ A;  1BOT O;  4A57 A;  4BY9 C;  1BL3 A;  4AH9 A;  4Q5V A;  1ZC6 A;  1JLF A;  3PX0 A;  1VRT A;  4Y0W A;  1XNQ K;  1UWB A;  3SI6 A;  5BN9 A;  4ELU A;  2G8W A;  1TKX A;  3SQ0 A;  4PHT X;  4C8O A;  4CJF A;  3OS0 A;  3PO5 A;  4IJN A;  4O55 A;  1N36 K;  3DXM B;  3H45 C;  5GAE P;  3HL8 A;  1RTJ A;  4AM7 A;  1YIJ N;  3EL2 A;  1ESV A;  2NZT A;  3GOI A;  3QLH A;  2E2Q A;  5GIN A;  2NRT A;  5B8H A;  2VQF K;  1OVY A;  3VEV A;  4FJN A;  4JK9 A;  2ZGY A;  2P9N B;  4CEQ A;  4KAZ A;  3BEX A;  4DQP A;  1FKP A;  4HVJ A;  4C8M A;  5AZI B;  1K8K A;  3SBT A;  2BGG A;  4BDP A;  5AQR A;  4MDB A;  1Q8I A;  2P9S A;  3KK2 A;  4CFA A;  4ELT A;  3U9Z A;  3WXJ A;  4WQ5 A;  5EY4 A;  3SV4 A;  2OPQ A;  2P9L A;  1BO5 O;  3TAN A;  3VGK A;  4DQR A;  4BRD A;  1RIL A;  3P5J A;  5C0Y A;  3BZK A;  3MEG A;  3AA3 A;  4CEZ A;  1K8A O;  3KLH A;  4JN4 A;  2V52 B;  4IWV A;  3LDO A;  3VA3 A;  1NK8 A;  4PQU A;  4FWM A;  2D0A A;  3KK3 A;  2FSJ A;  3QIP A;  4E7K A;  3TR8 A;  2XHB A;  5C2F A;  4CVN E;  3L4I A;  2FF3 B;  1TL1 A;  3OYL A;  4B3R K;  2D4W A;  3G0Z A;  3V81 A;  2FBT A;  4JLH A;  4H0Y B;  1QQN A;  4CEF A;  5FRN A;  4DUZ K;  4BG9 A;  1NJW A;  2VWK A;  2GUI A;  4KHP K;  3O4W A;  1WLJ A;  3H1V X;  5ADX A;  3KLF A;  3EN9 A;  2I7N A;  1BCM A;  3RR8 A;  2E1Z A;  4IFE A;  4JEP A;  3SZ2 A;  1U48 A;  2FBV A;  4O0I A;  1V4S A;  4NXM K;  2BAN A;  2PYL A;  3MX5 A;  4BRC A;  4E0D A;  1NKE A;  3TAQ A;  3LAM A;  1J54 A;  3D2E B;  5FLX O;  4J2B A;  3L2W A;  1QSY A;  4FLV A;  3R9P A;  3KKS A;  3ALY A;  3DOL A;  1DLO A;  1EWR A;  2GBZ A;  4EAH D;  4J2A A;  4NYN A;  2G8I A;  3RMA A;  1TYQ A;  3M8S A;  3HTV A;  5M1P A;  2GEM A;  3VEW A;  3HXM A;  1A5V A;  1WN7 A;  2O8C B;  3BP8 A;  2JWL A;  2ASP A;  2YNI A;  3ZEU B;  4CJ7 A;  2O8E A;  2PAV A;  3MK6 A;  2Q97 A;  3D45 A;  3QEW A;  1NJZ A;  1VQP N;  3IAY A;  3RRG A;  3NFA A;  5CHI A;  1JLG A;  4DMN A;  3MXI A;  1HQU A;  4H03 B;  1NK7 A;  2DPN A;  1FKO A;  1N6Q A;  2BTF A;  5KGW A;  2ASM A;  4FK4 A;  4HTU A;  4RW9 A;  4ELV A;  1L5U A;  2PY5 A;  4DU1 A;  1H1V A;  1BQN A;  2RN2 A;  2F9W A;  4JKC A;  3L6Q A;  3K5N A;  3ZSQ A;  4FJK A;  4RCH A;  1BWF O;  3FR0 A;  4DTJ A;  1I39 A;  1RDU A;  4E7L A;  4DF8 A;  4CGG A;  4FLU A;  4FVM A;  1N32 K;  5AFU H;  3BF1 A;  4BDY A;  4WQ5 C;  1RBS A;  1VSD A;  1WSF A;  3E01 A;  3ZX3 A;  4GKJ K;  1KLN A;  3W3D A;  4BRL A;  2YHW A;  4K43 A;  3ZT0 A;  4CJT A;  4CBX A;  3AVC A;  4H0X B;  3RMB A;  1KVC A;  1UOC A;  3EZW A;  2HNZ A;  4CF1 A;  1YIT N;  1K73 O;  4DFP A;  4JKA A;  1OH8 A;  5HOO A;  1TUY A;  4CHN A;  3JXU A;  5FPN A;  3VOV A;  5AQS A;  4O5F A;  2G8H A;  2KKZ A;  1QVG M;  4LSN A;  2UYT A;  1VAZ A;  5JS1 A;  2RHK A;  2F8S A;  2GTD A;  4FJX A;  4H0O A;  4QOZ B;  4O8U A;  3NE6 A;  1NOZ A;  3OYH A;  3ISN C;  3PX4 A;  4DV4 K;  3MWT A;  4LH5 A;  1XNR K;  3TAP A;  4DB3 A;  1R59 O;  4KB0 A;  4IEI A;  1SL2 A;  1YJ9 N;  4BG8 A;  3ZSW A;  4IFV A;  1QQM A;  4KHU A;  3C7N A;  3OYN A;  1KCF A;  3QO9 A;  4DTP A;  4BC4 A;  4CBU A;  4DKW A;  1RGI A;  4FM0 A;  4ILG B;  4JKB A;  2Z1G A;  2VQE K;  1N33 K;  1TK5 A;  1OH7 A;  3C0B A;  1JLA A;  2CH5 A;  4CCH A;  1IG8 A;  1ATR A;  1N5Y A;  3LZI A;  5JLF A;  3VQB A;  4M45 A;  2ZE2 A;  3D6R A;  3ID6 A;  4DR1 K;  1EX4 A;  2YNF A;  5LY3 A;  1X9W A;  4BE0 A;  2PBD A;  2HOE A;  3PY8 A;  1VQN N;  3VQD A;  4F2R A;  2IDO A;  1HPM A;  2P9I B;  3SQ1 A;  4Z0U A;  3CM5 A;  4F9O A;  2R7Y A;  3AO1 A;  4ZHR A;  3AY9 A;  4M42 A;  1NBW A;  3E9L A;  2FC0 A;  4Y1C A;  2J4R A;  2P5O A;  3IS9 A;  3O9S A;  3EKU A;  1QQO A;  3NF6 A;  4FLW A;  3V1O A;  3AVJ A;  3MED A;  2WON A;  4OJR A;  4B8A B;  4JI4 K;  3NAE A;  3J7Z O;  3CCQ N;  1RDC A;  1U49 A;  3A2F A;  3A5M C;  1HKB A;  1RBV A;  4AHV A;  5M1N A;  4AM6 A;  3OYB A;  2Y1I A;  4DSL A;  3EY1 A;  3CG7 A;  2GUP A;  2HMP A;  1WBD A;  3LP3 A;  1EXQ A;  2Q0U A;  3VQA A;  3ZT4 A;  4BRO A;  4HCB A;  4CJV A;  3M3Z A;  1S9G A;  2HF4 A;  4PKI A;  1NOY A;  2HHV A;  2HHS A;  3H08 A;  3ATU A;  3EZ5 A;  5AQY A;  1K8K B;  4FJI A;  3DXM A;  4EIA A;  1GLE G;  2HND A;  3WNF A;  4FLZ A;  1NK9 A;  3DAW A;  1D9F A;  4C1N K;  3ENO A;  5JVH L;  3AVK A;  4B9S A;  3B8A X;  2P9L B;  3OYF A;  3THY A;  4JKG B;  4H5R A;  3DM2 A;  4JS5 A;  2W6K A;  2P9N A;  4IKF A;  4GY2 B;  2ZJR L;  3L3U A;  1WOQ A;  3EKS A;  3HZ6 A;  2NRV A;  5AZI A;  3O08 A;  4DTS A;  1LOT B;  2QWL A;  3KK1 A;  3CJ7 A;  1A5X A;  5EOY A;  4A61 A;  1ASV A;  1WSJ A;  4FW1 A;  3PV8 A;  4QS8 A;  2YJF A;  3MXJ A;  1VQO N;  3OS2 A;  3KD5 E;  3I0R A;  1QTM A;  4E1N A;  2HMI A;  2DY4 A;  2Q1N A;  4IG3 A;  3TSP A;  2VCP A;  3AV9 A;  1B9D A;  3V4I A;  2HHX A;  3AVL A;  4FWP A;  3OVN A;  3R6M A;  2E4L A;  5E41 A;  3CCV N;  1GLB G;  4NYF A;  2HBK A;  1LW2 A;  1C6V A;  4B9U A;  2YHB A;  3C6T A;  2D1K A;  1YTA A;  3CC4 N;  2WFB A;  3OTO K;  2IGI A;  1RCH A;  4BWM A;  4AIL C;  1FK9 A;  5FPE A;  4K8Z A;  4MO4 A;  1G99 A;  4C8L A;  2HHU A;  3M8R A;  4DQQ A;  3O9T A;  3ZX2 A;  2KZZ A;  3HJF A;  2GV9 A;  1FJG K;  4OPK A;  2KLA A;  3P39 A;  3OJS A;  2CGK A;  3OYC A;  1TYQ B;  2QM1 A;  4YOV A;  3M6G A;  3JSM A;  3VQC A;  3HVR A;  2QI2 A;  1XMO K;  4C23 A;  3DLH A;  3VGM A;  3K5L A;  1VQ4 N;  2OPS A;  4GNI A;  1IBK K;  4B9M A;  4CF9 A;  1NK5 A;  2BE2 A;  5F2R A;  1NWK A;  5J1E A;  2O8E B;  3AA2 A;  1KLM A;  3C6U A;  1NM1 A;  3SPZ A;  1J5O A;  1NK6 A;  4Z4F A;  1QQC A;  4JS4 A;  4J2E A;  2NRW A;  3CQ8 A;  3O4Q A;  1GLF O;  2QWR A;  3Q7C A;  3CCR N;  1XHZ A;  5M1O A;  2KFZ A;  2JLE A;  3S3N A;  4XH4 A;  3SQ4 A;  4B3M K;  1TGO A;  4FVU A;  1LV5 A;  3TAE A;  1NU0 A;  3TU5 A;  5JLH A;  2ZQB A;  3LDQ A;  3V1Q A;  2A1R A;  3TAF A;  1TAQ A;  1QVF M;  4RW4 A;  1VQK N;  3BY5 A;  3ZT1 A;  1YXQ A;  2D0O A;  3R3L A;  2KHO A;  3DMJ A;  1ATN A;  3TSQ A;  1W2B M;  5IT9 O;  4AHS A;  1TVR A;  4DTX A;  2X6N A;  2CH6 A;  1OVQ A;  4M3W A;  3SUN A;  3NF8 A;  2FF6 A;  5KQ8 A;  1SL0 A;  3QIO A;  5JVG L;  3A5L C;  5IWA K;  4B1X B;  4CZL A;  4W5Q A;  3QEI A;  1X9S A;  3OYE A;  4H4O A;  5C24 A;  4JNE A;  1WSE A;  1KQS M;  1VHX A;  1RBR A;  2EHG A;  1UA0 A;  3U6F A;  3J81 O;  3TAM A;  3HM9 A;  4HHT A;  2YCH A;  4O0J A;  3A0I X;  1Z05 A;  1NGD A;  5FRM A;  1A5W A;  4B1Y B;  3GDQ A;  1BA1 A;  4CJQ A;  1VSL A;  4I2P A;  4CZM A;  3F9M A;  5KQD A;  3T1H K;  1LAW A;  2AP1 A;  1JXE A;  4FWO A;  2OYQ A;  4EZ9 A;  1LW0 A;  3C7N B;  2VG7 A;  3PIP L;  4QCL A;  2GX9 A;  4DTU A;  3CF5 L;  3I0S A;  1KFD A;  1T6D A;  1KVA A;  3SPY A;  4OLA A;  3KJV A;  4ISE A;  4EHT A;  2UUA K;  1M1K O;  1NGG A;  2RE2 A;  1UAX A;  4WFN L;  1JLB A;  1L3S A;  4LY7 A;  3E9P A;  3CQY A;  3SLC A;  4KPY A;  4UY8 O;  1E4F T;  5LMU K;  3ENH A;  4K42 A;  3QEV A;  4ILH A;  4PA1 A;  3SAG A;  3K59 A;  4U67 L;  1MA9 B;  1NMD A;  1ASW A;  2GWK A;  1Z25 A;  4FZY A;  1S1X A;  3V9X A;  2YHX A;  4JI1 K;  5I42 A;  1ASU A;  2FSK A;  4PKG A;  3ATV A;  4B1U B;  2E6L A;  3A5N C;  1HYS A;  3VF6 A;  3DWL A;  4K0K K;  1WAF A;  2UUC K;  4A62 A;  5J2Q A;  3VTI A;  1T6C A;  4CIF A;  1BHL A;  1BGX T;  4DU4 A;  1YT3 A;  4DTR A;  4KHN A;  3MCA B;  4W5O A;  2BUP A;  2P9I A;  3K9K A;  3OJU A;  1JL2 A;  2VYP A;  1U2V A;  3MMV A;  4EP5 A;  4JI7 K;  5KPZ A;  4CZK A;  1HQE A;  3HST B;  3WQT A;  1SL1 A;  3ZSY A;  1HKC A;  3L2U A;  3OYD A;  3KWI A;  2LSN A;  1ITG A;  1YAG A;  2W6L A;  2B4J A;  3LPT A;  3S3O A;  4BR2 A;  3SV3 A;  5BRE A;  5AQM A;  4LD0 A;  4A5B A;  3SUO A;  1KSP A;  4WFA L;  1JL1 A;  4FWL A;  3DLE A;  3THY B;  1NGB A;  1IH7 A;  3LWM A;  4W5R A;  2VG6 A;  4R79 A;  2YV0 X;  1S1W A;  1BIS A;  1KAZ A;  1VQM N;  1DTT A;  5HRS A;  4YY3 K;  3OHR A;  4CK3 A;  4F3O A;  4FJ9 A;  4JI3 K;  3C95 A;  4JI8 K;  1TUU A;  2IVO A;  1QSL A;  1NJX A;  4OO1 J;  4BRH A;  2ZJQ L;  3KK7 A;  2RF2 A;  3R1X A;  4OX9 K;  4DV1 K;  3AVB A;  2OZM A;  4JKG A;  3ASM A;  2E8A A;  3AVH A;  3FZM A;  2V7Y A;  1T7P A;  1RT3 A;  3HI0 A;  2Q2R A;  3KWG A;  4KI4 A;  4JRQ A;  4N56 A;  1VQ9 N;  3AA5 X;  3AAP A;  2KZM A;  3THX A;  4BRM A;  5ADX H;  4M3Z A;  3RWU A;  1RTD A;  4OGC A;  4FZX C;  3OYA A;  1DT9 A;  1HYV A;  3MCP A;  4FJ8 A;  3TTC A;  1EKE A;  4B08 A;  1XWL A;  4M7X A;  2WOM A;  4IDH A;  4FJL A;  4CZI A;  1SQK A;  4FLX A;  3L3V A;  1X9J A;  3G25 A;  4BE1 A;  4G1Q A;  3DYA A;  1Q82 O;  1ZBL A;  3RTV A;  2E88 A;  3CJB A;  4DQS A;  1NJI O;  3CPE A;  1P90 A;  4CEE A;  3L2Q A;  2A41 A;  4OPA A;  3H46 O;  4JI5 K;  4CD1 A;  2Q31 A;  3SUP A;  1NNE A;  3QEX A;  3NH0 A;  3PSI A;  1W0H A;  4L8R B;  1KD1 O;  4AQY K;  2A5X A;  3HBT A;  3MEC A;  5KI6 A;  3QNN A;  2QKK A;  4BQZ A;  3ZET A;  4CFC A;  1NMN A;  4CGJ A;  4E1M A;  1QE1 A;  4JKH A;  3CIP A;  2JWK A;  1N34 K;  4DV7 K;  2E20 A;  4DV2 K;  4KTZ A;  4HUG A;  4DTO A;  4NCB A;  4LF6 K;  4XEI A;  3JAM O;  1HYZ A;  3H3N O;  3SQ2 A;  4DHY A;  4CGF A;  1LWF A;  3CHW A;  1YHQ N;  3SK3 A;  4DV3 K;  1C0F A;  5ELZ A;  5M1Q A;  4CEO A;  3P1G A;  3HRG A;  5BR9 A;  4O44 A;  1YVN A;  5AJ3 K;  2HBJ A;  1U45 A;  2ZD1 A;  4L3Q A;  2HHQ A;  2O8D A;  4IG0 A;  1NGF A;  2O8F A;  2P9U B;  5DM6 L;  3PX6 A;  1HJO A;  1SS6 A;  5BPN A;  4DU3 A;  4LFA K;  3I8B A;  1EP4 A;  3MX2 A;  1EO1 A;  4NCA A;  4JD2 B;  2DFF A;  4Z94 A;  3HVT A;  4CHZ A;  3NGI A;  3O80 A;  5SWM A;  4DSE A;  1KTQ A;  1GLJ O;  4YOW A;  2ITG A;  1S72 N;  4CEA A;  1NGJ A;  3IUC A;  3O8M A;  4BE2 A;  4E7J A;  3SJJ A;  1CZB A;  1O1W A;  1SZ2 A;  2IOC A;  4M3R A;  1QHT A;  1S22 A;  2IS3 A;  1FXX A;  3B6O A;  4B8C A;  1J5E K;  2FSN A;  1JCG A;  5C10 A;  3A5O C;  3DRP A;  1VSJ A;  4I9L A;  1Q81 O;  4BRG A;  3J80 O;  3LM2 A;  3H6E A;  1F21 A;  2HBM A;  4Y1D A;  4LF9 K;  1Q9X A;  1WAJ A;  1CZ9 A;  4KRE A;  3KLI A;  4LF4 K;  2WTU A;  4LF7 K;  5AZJ B;  5HRO A;  2QWM A;  4AHU A;  4RW6 A;  3QER A;  4JKF A;  5JS2 A;  1QZ6 A;  1DGK N;  2FBY A;  4JK8 A;  1HRH A;  3FE1 A;  4AHT A;  3E1Y A;  4LC9 B;  5EXW A;  1HX1 A;  4Z4I A;  3MWP A;  3T1A A;  1DTQ A;  4KHY A;  1MWM A;  1G15 A;  4H0T B;  4LF5 K;  4BC3 A;  1Q18 A;  5BR8 K;  3LAK A;  1Q86 O;  3L2V A;  4DUY K;  1BG3 A;  3KLG A;  3QET A;  3K9J A;  1WNS A;  2DTU A;  1VQ5 N;  4IEE A;  3VQ8 A;  4MLH A;  2VG5 A;  4CJL A;  4M7Y A;  4MO5 A;  3QES A;  1D8Y A;  4GMJ B;  2UUB K;  3VEN A;  2A6A A;  4MDA A;  3IFR A;  3CMA N;  1S6P A;  1U2V B;  5HRP A;  3PSF A;  5EVZ A;  2QK9 A;  4CK2 A;  2QW9 A;  1X9M A;  4FK0 A;  1GOA A;  3TSU A;  4BGA A;  4CJ5 A;  5CZ2 A;  1NJY A;  4H8K A;  1GOB A;  4DR3 K;  1OKJ A;  1S1T A;  5GAH P;  3MXM A;  2HVH A;  3LL3 A;  3O9Q A;  3MN6 A;  3KLE A;  4IJA A;  2HHW A;  3C65 A;  3ZLJ A;  1XI1 A;  4I6M B;  1Q9Y A;  3SNN A;  4U7B A;  1TKD A;  4B3S K;  2CGJ A;  5BRF A;  1HR0 K;  4BRQ A;  1HPZ A;  2O4G A;  4QS7 A;  4BR4 A;  3WT0 A;  4LH4 A;  5AQQ A;  1JLC A;  3O5B A;  2ATQ A;  4M3Y A;  5BRD A;  3IRX A;  3DLG A;  3AVI A;  4N76 A;  2VGN A;  5TKY A;  1WSG A;  5LMN K;  1YI2 N;  3F2K A;  4YOR A;  5AR0 A;  1WBB A;  2HBL A;  4DTN A;  2OPP A;  1NGA A;  3OYK A;  1RT1 A;  4B9T A; 
#chains in the Genus database with same CATH homology
 1WSH A;  4CHY A;  1RBT A;  3QLH A;  4DTX A;  2X6N A;  4FM1 A;  3S3M A;  4M3W A;  4FJN A;  4FJJ A;  2Y1J A;  3NF8 A;  3SUN A;  1KRP A;  1SL0 A;  3QIO A;  2FBX A;  3D0P A;  3QEI A;  1X9S A;  4W5Q A;  4CEQ A;  3QEP A;  4FYD A;  3OYE A;  4H4O A;  5C24 A;  1NKC A;  4KAZ A;  4DQP A;  1FKP A;  4IBN A;  3ZCM A;  2D5R A;  5K14 A;  2O4I A;  1LWC A;  1WSE A;  4HVJ A;  4C8M A;  3V9W A;  1BI4 B;  3KD1 E;  2Z1H A;  1RBR A;  2EHG A;  4I7F A;  1UA0 A;  2HNY A;  3U6F A;  4DS4 A;  3AVN A;  3TAM A;  1XHX A;  3HM9 A;  4HHT A;  4BDP A;  3ULD A;  2BGG A;  1Q8I A;  3KK2 A;  4DFK A;  5CY4 A;  4CFA A;  4O0J A;  3LAN A;  4ELT A;  3RR7 A;  2XO7 A;  1ZBH A;  4CK1 A;  4DLG A;  5FRM A;  1J9A A;  3SV4 A;  3PUF A;  1A5W A;  4CJS A;  2OPQ A;  3TAN A;  4DQR A;  4KRF A;  4KV8 A;  3HYF A;  1RIL A;  2IC3 A;  3P5J A;  3LP1 A;  3NF9 A;  4CJQ A;  5KGX A;  1VSL A;  3AA3 A;  3MEG A;  4I2P A;  4CEZ A;  5J2N A;  1SKR A;  3KLH A;  2XRI A;  3KKR A;  3VA3 A;  1LAW A;  3DRR A;  1NK8 A;  1JXE A;  2OYQ A;  4PQU A;  4EZ9 A;  1LW0 A;  4Q0B A;  1K6Y A;  1X1P A;  2VG7 A;  2X6S A;  2D0A A;  4DTU A;  4QCL A;  3KK3 A;  3QIP A;  3I0S A;  3NGY A;  4E7K A;  1ZBI A;  3BGR A;  1KFD A;  3T3F A;  3TR8 A;  4W5T A;  1KVA A;  2XHB A;  3SPY A;  4OLA A;  4CFD A;  3KJV A;  4DWI A;  3VQE A;  1TL1 A;  3OYL A;  4DSJ A;  4CJE A;  3G0Z A;  4FJG A;  1RNH A;  3LAL A;  3HP6 A;  4FW2 A;  1RDA A;  2FBT A;  4JLH A;  3V81 A;  3VQ7 A;  1U47 A;  2B5J A;  2Z1J A;  4Z4C A;  1UAX A;  1JLB A;  4CEF A;  5FRN A;  1L3S A;  4LY7 A;  5KRS A;  1NJW A;  2VWK A;  2GUI A;  3U3G A;  3LZJ A;  3VQ5 A;  4ID1 A;  3UIQ A;  1WLJ A;  4KTQ A;  4KPY A;  3AO3 A;  3KLF A;  4OKK A;  4FM2 A;  5FRO A;  4PUO A;  1BCM A;  3RR8 A;  2G8U A;  3QEV A;  3SZ2 A;  1U48 A;  4F2S A;  2FBV A;  4B9L A;  4PA1 A;  4O0I A;  3K59 A;  3VQ6 A;  2BAN A;  2QXF A;  2YKM A;  2PYL A;  5FDL A;  3NCI A;  4EZ6 A;  1B92 A;  1TV6 A;  4J2D A;  2EX3 A;  2HW3 A;  4E0D A;  5HLF A;  1NKE A;  1ASW A;  4H4M A;  4E19 A;  3TWH A;  3LAM A;  1C1A A;  3TAQ A;  1UA1 A;  1J54 A;  1Z25 A;  4FZY A;  3MAQ A;  4J2B A;  3F73 A;  1S1X A;  3V9X A;  5I42 A;  3L2W A;  1ASU A;  5HBM A;  2IAJ A;  3ZSZ A;  1QSY A;  4M3U A;  4FLV A;  2E6L A;  3TI0 A;  4E7I A;  4M3X A;  3KKS A;  3ALY A;  1HYS A;  1WAF A;  3DOL A;  5J2Q A;  2JGU A;  1DLO A;  4CIF A;  2GBZ A;  3K5O A;  4J2A A;  4NYN A;  1BHL A;  1BGX T;  1BQM A;  1C0M A;  1JLQ A;  1YT3 A;  4DU4 A;  4DTR A;  3RMA A;  4N41 A;  4KHN A;  2G8I A;  4W5O A;  3M8S A;  1VSE A;  1HNV A;  1TL3 A;  3OJU A;  4RW7 A;  3V9S A;  4CEC A;  1JL2 A;  4E3S A;  1L3T A;  4OLB A;  3HXM A;  5HP1 A;  1A5V A;  1WN7 A;  1IKW A;  4EP5 A;  3RMD A;  1RTI A;  4BWJ A;  2YNI A;  4EP4 A;  1HQE A;  3HST B;  4ID5 A;  3D45 A;  3QEW A;  3LDS A;  3ZSY A;  4CF2 A;  1NJZ A;  1SL1 A;  3IAY A;  3L2U A;  3OYD A;  3AVG A;  3RRG A;  3SYZ A;  3NFA A;  2LSN A;  1U4B A;  1ITG A;  1JLG A;  2P1J A;  4DMN A;  3KTQ A;  2B4J A;  3LPT A;  3MXI A;  4K8X A;  5EU7 A;  3L8B A;  3S3O A;  2PZS A;  1HQU A;  1NK7 A;  1RBU A;  1FKO A;  3SV3 A;  4B3O A;  1N6Q A;  4CGH A;  5KGW A;  1NK0 A;  4LD0 A;  4I9Q A;  4FK4 A;  3SUO A;  4HTU A;  1EET A;  4RW9 A;  4ELV A;  1S1V A;  1KSP A;  1L5U A;  2PY5 A;  1ZYQ A;  3CYM A;  1JL1 A;  3EYZ A;  4DU1 A;  1BQN A;  4RW8 A;  2RN2 A;  1QSS A;  1I3A A;  3DLE A;  3K5N A;  3ZSQ A;  5KTQ A;  4FJK A;  1IH7 A;  3LWM A;  4DTJ A;  4W5R A;  2VG6 A;  3T19 A;  4CJR A;  1I39 A;  5SZT A;  4QAG A;  2YV0 X;  1IO2 A;  4OKE A;  3VA0 A;  1W9H A;  1S1W A;  5CYQ A;  4E7L A;  1BIS A;  4DF8 A;  4CGG A;  3OS1 A;  1DTT A;  5T7B A;  1IKY A;  5HRS A;  4FLU A;  4FVM A;  4FJ7 A;  1JLE A;  4CK3 A;  4F3O A;  4BDY A;  3HP9 A;  3IG1 A;  3TAR A;  2OPR A;  4B9V A;  4HCC A;  4FJ9 A;  3C95 A;  3HPG A;  4KHW A;  1RBS A;  1VSD A;  1WSF A;  3DRS A;  3E01 A;  3JYT A;  4N47 A;  4CED A;  1CLQ A;  5C25 A;  1KLN A;  1QSL A;  1VSI A;  1NJX A;  3ZT0 A;  4ICL A;  1VSK A;  4CJT A;  2RF2 A;  2AJQ A;  1Z26 A;  3AVC A;  3RMB A;  4F3T A;  3AVB A;  2OZM A;  4C8K A;  4CF8 A;  1KVC A;  3ASM A;  1UOC A;  3NDK A;  1IG9 A;  2X74 A;  3WNE A;  3AVH A;  2HNZ A;  1QS4 A;  4CF1 A;  1RT3 A;  1VSH A;  1T7P A;  1T8E A;  4DFP A;  4WE1 A;  1B9F A;  3LP2 A;  4KI4 A;  4CHN A;  4JRQ A;  4N56 A;  3AA5 X;  4PWD A;  2G8H A;  4DF4 A;  1S9E A;  2KZM A;  4AHC A;  4LSN A;  2BDP A;  4DG1 A;  1XC9 A;  4M3Z A;  1VK0 A;  3RWU A;  1RTD A;  5JS1 A;  2F8S A;  4FJX A;  4OGC A;  2KW4 A;  4OVL A;  4QOZ B;  4BAC A;  4FZX C;  3OYA A;  1HYV A;  3NE6 A;  4FJ8 A;  1NOZ A;  1EKE A;  1RDD A;  2DFE A;  3OYH A;  3ISN C;  4B08 A;  3PX4 A;  4LH5 A;  3TAB A;  1XWL A;  3LWL A;  2WOM A;  3TAP A;  4KB0 A;  4FJL A;  3TAG A;  1IKV A;  1SL2 A;  4UQG A;  4KI6 A;  1BCO A;  4NCG A;  1D9D A;  3I8D A;  4DTM A;  3ZSW A;  4FLX A;  4IFV A;  4KHU A;  4DQI A;  3L3V A;  2W42 A;  3OYN A;  1KCF A;  3RRH A;  3QO9 A;  4BE1 A;  3THV A;  4G1Q A;  4ZTJ A;  3DYA A;  4DTP A;  3U3Y A;  1LWE A;  3F9K A;  1ZBL A;  3RTV A;  4O4G A;  4FM0 A;  3NBP A;  4DQS A;  3AA4 A;  4YFU A;  2X78 A;  2Z1G A;  3K58 A;  4W5N A;  1RT5 A;  4CEE A;  1KFS A;  1C1C A;  3L2Q A;  4OPJ A;  1HMV A;  3HO1 A;  1TK5 A;  1T03 A;  1VRU A;  4BDZ A;  3O4N A;  1KVB A;  2OZS A;  2OA8 A;  1JLA A;  3OYM A;  3SUP A;  4CCH A;  3QEX A;  4F4K A;  1N5Y A;  3NH0 A;  2I5J A;  2RPI A;  3LZI A;  4FJH A;  1W0H A;  3VQB A;  4JRP A;  3O3F A;  4M45 A;  4L8R B;  2ZE2 A;  4KHS A;  4M41 A;  1EX4 A;  2XY5 A;  2YNF A;  1ZBF A;  3MEC A;  1X9W A;  4BE0 A;  5KI6 A;  4FK2 A;  3PY8 A;  4CHP A;  3QNN A;  4CIE A;  3VQD A;  3OYI A;  2QKK A;  3NHG A;  4F2R A;  4RG8 A;  2IDO A;  3WNH A;  4Z0U A;  3SQ1 A;  3CM5 A;  4CFC A;  4CGJ A;  1TKT A;  2R7Y A;  3AO1 A;  3VQ9 A;  4ZHR A;  4M42 A;  3HPO A;  4E1M A;  1QE1 A;  2FC0 A;  3OY9 A;  3S9H A;  4Y1C A;  2G8F A;  4ZTF A;  1BIZ A;  1TK0 A;  4CEB A;  4C8N A;  1SKS A;  3IS9 A;  2P5O A;  2P5G A;  3V6D A;  1SKW A;  4CJP A;  4KTZ A;  4HUG A;  4DTO A;  3K57 A;  3NF6 A;  4FLW A;  3V1O A;  1L3U A;  4NCB A;  3AVJ A;  5HRN A;  3QIN A;  5I3U A;  3MED A;  4DFM A;  3CFP A;  2WON A;  3HK2 A;  4OJR A;  1HYZ A;  4B8A B;  3NGZ A;  3M8P A;  3NAE A;  1U04 A;  3SQ2 A;  1C0U A;  1LAV A;  3DI6 A;  4CGF A;  1LWF A;  4Z4G A;  1TKZ A;  4DLE A;  1RDC A;  1U49 A;  4LSL A;  3A2F A;  3ITH A;  3P1G A;  4CEO A;  1VSF A;  2YKN A;  2YNH A;  1RBV A;  3CM6 A;  4O44 A;  4E89 A;  4CHQ A;  4FLT A;  1TK8 A;  2KQ2 A;  4AHV A;  3NH1 A;  3OYB A;  2Y1I A;  3NH2 A;  2DFH A;  1U45 A;  4DSL A;  3EY1 A;  4PY5 A;  3CG7 A;  5J2M A;  2ZD1 A;  4Z4E A;  2HHQ A;  4B9N A;  4IG0 A;  1HJR A;  1JXB A;  2A1S A;  3OYG A;  2P51 A;  1S1U A;  5DMR A;  4OGE A;  3LPU A;  4CES A;  2Z1I A;  1EXQ A;  3LP3 A;  3VQA A;  3ZT4 A;  3PX6 A;  4DSF A;  4HCB A;  1MU2 A;  4CJV A;  4DU3 A;  1S9G A;  4R5P A;  3K5M A;  1NOY A;  2HHV A;  1RTH A;  4CJK A;  1J53 A;  1EP4 A;  1REV A;  3H08 A;  2HHS A;  2KFN A;  4NCA A;  1TAU A;  1YTU A;  4DS5 A;  4CIG A;  4FXD A;  2DFF A;  4KTW A;  3EZ5 A;  1SUQ A;  2HVI A;  3HVT A;  4FJI A;  3PO4 A;  1CXU A;  1RT7 A;  2HND A;  1JKH A;  3WNF A;  4CHZ A;  3NGI A;  4FLZ A;  1NK9 A;  3M8Q A;  5SWM A;  1D9F A;  4DSE A;  1KTQ A;  1RDB A;  5KRT A;  2ITG A;  3AVK A;  4CEA A;  4B9S A;  2YHA A;  4IDK A;  3OYF A;  4DSK A;  4BE2 A;  4E7J A;  3SJJ A;  3WNG A;  1HNI A;  1CZB A;  4KFB A;  3DM2 A;  3MEE A;  4JS5 A;  4F8R A;  1O1W A;  2RKI A;  4N5S A;  3QNO A;  4IKF A;  2XY8 A;  3G10 A;  3L3U A;  1WSI A;  2IOC A;  4M3R A;  1QHT A;  2IS3 A;  3B6O A;  1FXX A;  4B8C A;  2PYJ A;  1YVU A;  3AO4 A;  2NUB A;  1BI4 A;  3CFO A;  4FJ5 A;  2HB5 A;  4DTS A;  3CFR A;  3KK1 A;  2ETJ A;  4E7H A;  3DRP A;  1A5X A;  2D0B A;  3VN5 A;  1ASV A;  1VSJ A;  2YNG A;  4I9L A;  2HHT A;  1WSJ A;  3HPH A;  3NF7 A;  4FW1 A;  4CGD A;  3PV8 A;  3MXJ A;  4CHO A;  4IFY A;  3OS2 A;  1F21 A;  3I0R A;  3KD5 E;  2XY6 A;  1QTM A;  4E1N A;  2HMI A;  4Y1D A;  3V1R A;  3SCX A;  2DY4 A;  2Q3S A;  4IG3 A;  3VQQ A;  2E6M A;  3AV9 A;  4CJ3 A;  1B9D A;  1Q9X A;  4CER A;  3V4I A;  1WAJ A;  1CZ9 A;  2HHX A;  3AVL A;  3V9U A;  4CFB A;  3OVN A;  4KO0 A;  4DSI A;  2E4L A;  3KLI A;  4KKO A;  4FZZ A;  5E41 A;  4KRE A;  2B6A A;  3B6P A;  3AVM A;  4NYF A;  1RT4 A;  1LW2 A;  1C6V A;  3V9Z A;  4B9U A;  3DLR A;  3O3H A;  1ZBU A;  2YHB A;  3C6T A;  1RT6 A;  3HT3 A;  5HRO A;  5D3G A;  1VSM A;  1YTA A;  4AHU A;  4RW6 A;  4CE9 A;  5HRR A;  3QER A;  4GVM A;  2IGI A;  3DLK A;  1Y97 A;  5JS2 A;  3ZT3 A;  1RCH A;  4BWM A;  2FBY A;  4AIL C;  1HRH A;  4I2Q A;  1FK9 A;  4AHT A;  4HUF A;  2KTQ A;  1CXQ A;  4GW6 A;  4O5B A;  4K8Z A;  3FFI A;  3BDP A;  4C8L A;  2HHU A;  4Z4I A;  2F8T A;  3M8R A;  3T1A A;  1DTQ A;  4CGI A;  1SV5 A;  3OYJ A;  4DQQ A;  4KHY A;  1G15 A;  3VQP A;  2F96 A;  3LAK A;  3C94 A;  3ZSX A;  2KZZ A;  3HJF A;  3P83 D;  4XIU A;  3L2V A;  1NKB A;  3VQ4 A;  4HUE A;  2GV9 A;  1R0A A;  4FLY A;  1D5A A;  3K2P A;  3ZSO A;  3AVA A;  4OPK A;  3RMC A;  3KLG A;  2G8K A;  3QET A;  4AHR A;  2XY7 A;  1WNS A;  2DTU A;  3OJS A;  3VQ8 A;  2VG5 A;  2D0C A;  4CJL A;  3OYC A;  4KHQ A;  3QES A;  5C42 A;  3AO5 A;  1L3V A;  1D8Y A;  4GMJ B;  4CF0 A;  4Z4H A;  5CZ1 A;  3JSM A;  4KB1 A;  1IKX A;  1S5J A;  3VQC A;  3HVR A;  3DLB A;  1C0T A;  3K5L A;  3DLH A;  1S6P A;  2VWJ A;  2OPS A;  5HRP A;  4B9M A;  4CJW A;  4FJM A;  4CF9 A;  2QK9 A;  1NK5 A;  4CK2 A;  3DOK A;  1X9M A;  4FK0 A;  1GOA A;  2BE2 A;  4DFJ A;  5J1E A;  4CJ5 A;  5CZ2 A;  3LP0 A;  3AA2 A;  1C1B A;  1KLM A;  1S6Q A;  4H8K A;  3ZT2 A;  1NJY A;  3C6U A;  1GOB A;  5J2P A;  3SUQ A;  4OKJ A;  3SPZ A;  1J5O A;  1NK6 A;  4Z4F A;  1QQC A;  3ZSV A;  4JS4 A;  4J2E A;  1S1T A;  4TSX A;  3KIO A;  3MXM A;  4CJU A;  2QKB A;  5DK5 A;  3CQ8 A;  3O4Q A;  2HVH A;  3L2R A;  4MQ3 A;  3KLE A;  4FCY A;  1BIU A;  3ZSR A;  2HHW A;  1XHZ A;  2KFZ A;  1GOC A;  1BL3 A;  1XI1 A;  4YNQ A;  2JLE A;  3S3N A;  4AH9 A;  3SQ4 A;  4Q5V A;  1TGO A;  1Q9Y A;  1JLF A;  3AVF A;  3PX0 A;  5CYM A;  1LV5 A;  3SNN A;  1TKD A;  1VRT A;  3TAE A;  3AO2 A;  1UWB A;  1T05 A;  3SI6 A;  1RT2 A;  1NK4 A;  4ELU A;  1HPZ A;  2ZQB A;  4MFB A;  2G8W A;  1TKX A;  2O4G A;  3SQ0 A;  4C8O A;  4CJF A;  3O3G A;  3V1Q A;  3OS0 A;  3TAF A;  4LH4 A;  1TAQ A;  2A1R A;  3PO5 A;  1JLC A;  4M3T A;  4RW4 A;  2ATQ A;  4O55 A;  4M3Y A;  3ZT1 A;  3IRX A;  4CJ4 A;  3DLG A;  3AVI A;  4N76 A;  1WSG A;  2G8V A;  3HL8 A;  1RTJ A;  3DMJ A;  4DTN A;  2OPP A;  3OYK A;  1RT1 A;  4AHS A;  1TVR A;  4B9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...