3WNGA

Cyclic hexapeptide pkidnp in complex with hiv-1 integrase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
138
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hexapeptide mimetics of LEDGF in complex with HIV-1 integrase
rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/peptide
molecule keywords Gag-Pol polyprotein
total genus 49
structure length 138
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3wngA00
3LDSA 1JLCA 1VSMA 3VQ5A 3BGRA 2EX3A 1S9EA 2BE2A 5KI6A 3V9WA 3QEXA 4F3OA 4CERA 1UOCA 4N76A 3SQ4A 4E7JA 3AA5X 1TGOA 4HUEA 2VWJA 1RTHA 1QSYA 1WSHA 2E6MA 3OY9A 3OYEA 3IRXA 3NFAA 5DMRA 2KW4A 3AVHA 3KIOA 3ZT1A 5DK5A 2ZD1A 1VSDA 4E1NA 4W5RA 3S9HA 4B9NA 4CGGA 3QEVA 4B9MA 2DY4A 1LWCA 5EU7A 1I3AA 1UWBA 1VSFA 1HYVA 4CEZA 3RR7A 1L3UA 3ZSWA 4KHNA 2B6AA 5I3UA 1QTMA 3KKRA 4FM0A 4W5TA 4AHUA 2HVIA 4FLTA 5FROA 3LAMA 5C24A 2DFFA 4B3OA 1BI4A 4CJ5A 3NHGA 4ZHRA 2GBZA 3O3GA 2JLEA 1WSGA 3ZSQA 4Z4FA 4CHNA 3K5NA 2HHTA 4RW8A 2KZMA 4LSNA 4GW6A 1NKEA 3HL8A 4G1QA 1WLJA 3NH0A 1L3SA 3TAGA 4FJIA 4FJ9A 4DLGA 1RBSA 4FZYA 4FXDA 2HHXA 1KRPA 1YVUA 4O0IA 3DRRA 2AJQA 4J2EA 3AVBA 4NYFA 1S9GA 1TKTA 4CHZA 4FLZA 4OPJA 3IS9A 4Q5VA 1S6PA 3OYHA 5KRTA 3RRGA 4PY5A 2ITGA 1WSFA 2VG7A 1A5XA 4DTOA 1QS4A 5T7BA 2XY6A 2YNFA 2B4JA 4CFBA 4DTPA 3QEIA 4CEBA 4FJNA 2QXFA 1C1AA 2OPSA 4OKEA 2PYJA 4KTQA 4FJKA 2KQ2A 4KB0A 1XWLA 3TAMA 4L8RB 1NK6A 2Z1HA 3QIOA 5I42A 1HNIA 2R7YA 4CGHA 1BIUA 1RT4A 1EETA 1RT6A 3OVNA 4CF8A 4CEOA 4JS4A 4FJMA 4OPKA 1W9HA 1RT1A 1TL1A 4M3RA 1NK5A 1RBRA 4QOZB 3MXIA 4DSIA 3ZSVA 4CK2A 4B9SA 1HRHA 4DQRA 1NKBA 4H4OA 2ETJA 3ZT0A 4BDPA 1BCMA 2FBTA 2BDPA 1KSPA 3PX4A 2P5GA 1QQCA 3DOKA 4LSLA 1KTQA 1CZ9A 4CEDA 3EY1A 4DU4A 1D9FA 4JRPA 4FJ5A 2HHWA 1J53A 1MU2A 3RRHA 1C6VA 1FKOA 4RW7A 4N56A 4DFKA 4FJ7A 3WNGA 1XHXA 1SV5A 3MECA 4B9LA 4FJXA 3OYDA 2OA8A 4C8KA 3IAYA 4M3TA 1ZBIA 4CJEA 3T3FA 3AVNA 3OYAA 3QIPA 1NJYA 1KVBA 4Y1CA 4F3TA 4O5BA 4DQPA 3M8RA 3SI6A 1J9AA 3HSTB 3S3NA 2ZQBA 4RW6A 3S3MA 4CEQA 1LAVA 3LZJA 4XIUA 3KLEA 1JLQA 2F8TA 4C8MA 1RT5A 4HUFA 5C42A 2DFHA 3LP0A 3CM5A 3SUPA 1RT7A 4FJHA 2KFZA 3NF9A 3DLKA 3I0RA 4Z0UA 2G8FA 1RILA 3DLEA 5E41A 4DU1A 4EZ9A 4M3ZA 1SKRA 4FK4A 4DTNA 1C1BA 1ZBLA 4DSEA 1WSIA 2GV9A 3DM2A 3HK2A 3ALYA 3VQBA 3VQCA 2WONA 1X1PA 4YNQA 3TARA 3DLHA 3HPOA 4KI4A 2HHUA 2EHGA 3K5OA 4DQSA 4CJLA 1TKZA 1VRTA 4KFBA 1X9MA 1Q8IA 3LPUA 3ULDA 4B9UA 1JKHA 2WOMA 2FC0A 3AO4A 5HROA 1JLEA 4E7IA 4AHRA 2HB5A 2O4IA 1SL1A 5KTQA 4AHVA 4DF4A 5HBMA 3C6UA 4E19A 5FRNA 1WSEA 3RR8A 3CFPA 4M41A 3NAEA 1RTIA 4FYDA 3KK1A 2LSNA 4NYNA 1EKEA 3I0SA 4H4MA 5CZ2A 3L2UA 1TKXA 1C0UA 2HNYA 2OPRA 1IKYA 4LH5A 1WAFA 4LY7A 3NCIA 3F73A 1VSLA 1XC9A 1RDAA 3QETA 1HYSA 5CY4A 1KVAA 1YTAA 3K58A 4KTZA 4CK1A 3LANA 1YTUA 1TK5A 4CJ4A 3CG7A 2HVHA 2F96A 3V6DA 3MEDA 3TAEA 1D8YA 1CZBA 1NKCA 3LAKA 3QO9A 2IS3A 3P5JA 4EP5A 1GOBA 1VK0A 4QCLA 3NBPA 3B6OA 3RMDA 3P1GA 3SJJA 3SCXA 5HP1A 2IC3A 2HHQA 4FJLA 3DLRA 1NJWA 3CYMA 1N5YA 2ZE2A 1XI1A 4NCAA 1JXBA 4EZ6A 3HPHA 4DS4A 1NK4A 3M8SA 5HLFA 1NK7A 5FRMA 4WE1A 2OYQA 3SQ1A 4CF9A 4ID1A 3U6FA 4N41A 3K57A 4FLUA 4DSKA 1RDBA 4RW4A 3LP2A 4ELUA 1HQUA 2D0CA 3ASMA 1NK8A 3K5MA 1WNSA 3L8BA 4PUOA 3ZT2A 3DRSA 4CEAA 3O4NA 1X9WA 2QK9A 1SKSA 3IG1A 2D0BA 4CHOA 3AVMA 1B92A 4CK3A 1I39A 3AVLA 2VWKA 4OKKA 4M45A 3TAPA 1FK9A 2YHAA 3VQDA 2Y1JA 4DQIA 3H08A 1TVRA 3M8QA 2FBVA 1EP4A 2YHBA 1JLBA 4CIFA 3L2VA 1KVCA 2IAJA 4BWJA 3HJFA 1RT3A 1NK9A 4HVJA 3EYZA 1JXEA 4CJSA 4KREA 1RDDA 4CJVA 3TWHA 4F2RA 3AO1A 3G10A 3NDKA 4I9QA 4FLWA 3AVKA 4HCBA 3LP3A 3OYGA 3KK3A 2Q3SA 1SUQA 4OLBA 3LPTA 2X6SA 4ICLA 3SPZA 1BHLA 3KJVA 3RMBA 3UIQA 3KLHA 4CF1A 3NGZA 3A2FA 2W42A 4DTXA 1RBVA 4LH4A 3ZT4A 1RCHA 1HJRA 4DG1A 4PWDA 4E7HA 1N6QA 4E1MA 3AO5A 4CFAA 1O1WA 1D5AA 1TL3A 1IKWA 1GOAA 3HPGA 4B8AB 1J5OA 4CHQA 5KRSA 2X6NA 4FVMA 5FDLA 4N5SA 5D3GA 1KLMA 3HYFA 1S1UA 3CQ8A 4DSFA 4Z4EA 3TAFA 1EX4A 1LWFA 5K14A 3SUQA 3CFRA 1Z25A 4OKJA 4OLAA 3V9UA 3V4IA 4FCYA 4E3SA 3HP9A 3NF7A 3SV4A 1JL2A 3SUOA 3SZ2A 1LV5A 4M3XA 3TR8A 1DTQA 1K6YA 3PX6A 1U49A 2Z1JA 4ID5A 2A1SA 2G8VA 3KKSA 4ELTA 3KLGA 3S3OA 2YNHA 2XRIA 3E01A 1C0TA 3ZSOA 2E4LA 3V9SA 3QEPA 2XO7A 1KLNA 1D9DA 1WAJA 4FW1A 4C8NA 4DMNA 3QEWA 5J2QA 4I2QA 3NF8A 4BE1A 5J2NA 4DQQA 4BACA 1JLAA 4CE9A 1T05A 4FK2A 4KHWA 1F21A 4BE0A 4CFDA 1L5UA 4B9VA 1S1WA 5KGXA 4E7KA 2B5JA 2NUBA 4IG0A 4OGCA 5JS2A 4CGIA 2G8IA 3AA2A 4J2BA 2FBYA 4CGDA 3LWMA 4FK0A 4DU3A 2YNIA 1IKXA 1DLOA 4KRFA 4CHYA 1VRUA 3D45A 4BE2A 4GVMA 1Z26A 3CM6A 5CZ1A 2PY5A 4C8OA 3MXJA 4AH9A 3KD1E 2I5JA 3LALA 3MEEA 3QNNA 4AILC 4W5OA 4MQ3A 3L3VA 3SV3A 4CIGA 3WNHA 1TK0A 3O3FA 1RT2A 1LWEA 1T8EA 4FJGA 3OYBA 4BDZA 1B9FA 1VSKA 2HHVA 3C95A 3THVA 1C0MA 1KFDA 3VQ6A 4BDYA 3U3GA 3BDPA 2P1JA 1TKDA 4Z4IA 4LD0A 4HCCA 4E7LA 2XHBA 2Z1GA 4AHSA 1BL3A 2BANA 4QAGA 3AVAA 1VSJA 5HRRA 1R0AA 1A5VA 1QHTA 2OPQA 3AA4A 3SQ0A 1L3VA 2PYLA 3KK2A 4CCHA 3QESA 1BIZA 4JLHA 4CJFA 1RBTA 4KTWA 2KFNA 3ITHA 4DTSA 1RBUA 5HRSA 1IG9A 2G8UA 4AHTA 4IKFA 2XY7A 5SZTA 1NOZA 4R5PA 3RMCA 1UA1A 3DI6A 4F8RA 4CIEA 4OJRA 5SWMA 3VA0A 1CXUA 3VQ7A 4CEEA 1TAQA 2E6LA 3AO2A 3DLBA 1HMVA 2P51A 3QERA 1HPZA 4Z4HA 1BQMA 2HNDA 3AVGA 3VQAA 4AHCA 3L2WA 1ITGA 3RMAA 4M3WA 3ZSZA 4CESA 4HTUA 4MFBA 1U45A 1ZBHA 3HO1A 4KO0A 1BI4B 4CF0A 3VA3A 4F2SA 3PUFA 1VSHA 1IH7A 3NE6A 3OYFA 4DSLA 3C6TA 4K8XA 4CJPA 3U3YA 4FZZA 2F8SA 3K59A 3FFIA 4Z4GA 3O4QA 3OYIA 4ZTFA 1SL2A 2RF2A 3D0PA 3PO5A 4B9TA 4H8KA 2QKBA 3HP6A 1BCOA 1BGXT 1ASWA 2O4GA 3DYAA 1TV6A 1EXQA 2X74A 3VQ9A 1X9SA 3VQ8A 4FLXA 1KFSA 3HVRA 3OS2A 4FW2A 4IFVA 3VQPA 3RTVA 1REVA 3OJUA 1QSSA 2RN2A 2YNGA 1FKPA 2OPPA 3SQ2A 1A5WA 3DLGA 2D5RA 4KHSA 3OS0A 1DTTA 1L3TA 3LWLA 4ZTJA 4CJWA 3SYZA 3AA3A 3QLHA 3KLFA 1NJXA 1ZBUA 4CEFA 4Y1DA 3V1QA 3HM9A 3NGIA 3KD5E 3T1AA 1T7PA 4K8ZA 1HYZA 3ISNC 3HT3A 3AVIA 3SUNA 4KI6A 2BGGA 3OYLA 1T03A 1NK0A 4C8LA 4W5NA 1UAXA 3OS1A 1U04A 2RKIA 3AVJA 4OGEA 4E89A 4NCBA 2YKMA 3AVCA 3EZ5A 3SNNA 3TABA 3K2PA 3V1RA 1SL0A 3LZIA 3AVFA 5HRPA 4W5QA 3ZSXA 4DTRA 4CJTA 3OYJA 3VN5A 3V81A 1RTDA 1JLGA 4UQGA 4TSXA 3B6PA 2FBXA 2Z1IA 3ZSYA 5KGWA 3K5LA 1C1CA 4J2AA 3LP1A 2GUIA 5J2MA 5CYMA 1J54A 1RTJA 2YV0X 4OVLA 4J2DA 4F4KA 2JGUA 4N47A 3WNFA 4Q0BA 3OJSA 1Q9YA 4KHUA 2VG6A 1S1VA 3DRPA 1QE1A 4I9LA 4DTJA 3V1OA 4KV8A 1U48A 3PO4A 4KB1A 1IO2A 3NF6A 4O55A 3MAQA 4HUGA 2HHSA 4CJRA 1NJZA 4EP4A 4DTUA 3RWUA 4RW9A 4KKOA 3L2QA 1Q9XA 3OYKA 4FJJA 3AV9A 4DWIA 3VQEA 1U47A 3I8DA 1YT3A 3F9KA 4B08A 3G0ZA 4DFMA 4FM2A 2OZSA 2RPIA 2Y1IA 1JL1A 1S6QA 4DTMA 1ZYQA 4YFUA 4DF8A 1FXXA 4KHQA 4FJ8A 5J1EA 4CGFA 2VG5A 2QKKA 3WNEA 4DLEA 4M3YA 1TK8A 3L2RA 3PV8A 1BQNA 2XY8A 4CF2A 1U4BA 1HNVA 3M8PA 4O4GA 2KZZA 4M3UA 3TAQA 4JRQA 4DS5A 1BISA 1WSJA 4I2PA 2XY5A 2YKNA 2HMIA 4BWMA 3VQQA 3NH2A 2P5OA 2ATQA 4CJ3A 4O0JA 3TANA 3MXMA 5J2PA 4DSJA 1ZBFA 1SKWA 4KPYA 3V9XA 3HXMA 1S1TA 3KLIA 4IG3A 3ZCMA 3T19A 3OYMA 1RDCA 4RG8A 1CXQA 2DTUA 4FLYA 3DMJA 3C94A 3PY8A 3QINA 2HW3A 2D0AA 3NGYA 4GMJB 3JSMA 4FLVA 1ASVA 2G8HA 1WN7A 4CECA 4E0DA 4FM1A 2PZSA 2OZMA 2A1RA 1HQEA 5CYQA 1KCFA 4B8CA 2DFEA 3HVTA 5JS1A 5HRNA 2G8KA 1IKVA 1ASUA 3VQ4A 3TI0A 3MEGA 4PA1A 4Z4CA 3O3HA 1NOYA 3SPYA 4M42A 1B9DA 2IGIA 2IDOA 1S1XA 4CJKA 1VSEA 3NH1A 1LAWA 3DOLA 4IFYA 4JS5A 4CFCA 1UA0A 4FZXC 1W0HA 1CLQA 3V9ZA 2IOCA 3AO3A 3JYTA 4PQUA 2G8WA 4I7FA 4CGJA 1TAUA 1QSLA 3PX0A 5C25A 4HHTA 1JLFA 3L3UA 3OYNA 4KHYA 3ZSRA 1XHZA 1S5JA 4NCGA 3OYCA 2HNZA 4CJQA 3P83D 4IBNA 4CJUA 1Y97A 1G15A 1LW2A 1GOCA 1RNHA 1VSIA 2X78A 4IDKA 4DFPA 3CFOA 4DFJA 4CHPA 3KTQA 4ELVA 3QNOA 2KTQA 4KAZA 3ZT3A 1LW0A 4O44A
chains in the Genus database with same CATH superfamily
3LDSA 1JLCA 3VQ5A 3DXMB 1NGDA 3G71N 1TGOA 4JK8A 5AR0A 3C7NB 4HUEA 3UKRA 3P38A 3NVKA 2KW4A 3ZT1A 3S9HA 2ZD1A 4K0KK 4FPAA 4WFNL 1VSFA 1HYVA 1K8KA 3ZSWA 3ULEB 4W5TA 5FROA 5C24A 4B3OA 1BI4A 3NHGA 2E8AA 4C1NK 4ZHRA 3J81O 2JLEA 4MDBA 3L0QA 4CHNA 3D2FB 1NGBA 3FZLA 4K43A 4DLGA 4YOYA 4O0IA 1LCUA 3AVBA 3EKSA 1S9GA 1TKTA 4NYFA 4DQ8A 5AQGA 4OPJA 3IS9A 4Q5VA 3OYHA 2VG7A 4H0VB 5T7BA 4CFBA 3QEIA 2FSJA 2QXFA 2PYJA 4IO8A 4R79A 4FJKA 1W7AA 2KQ2A 4KB0A 5I42A 3O5BA 1NMDA 5C2DA 4JD2A 4CF8A 3CF5L 3CC7N 4M3RA 2D1KA 1NK5A 2V52B 3ZSVA 2P9IA 3NVMA 4CK2A 4LC9B 4H4OA 2W6LA 2FBTA 1QQCA 2ZWHA 4KH6A 3LDNA 1KTQA 3EY1A 4FJ5A 4JRPA 1YVNA 1KAXA 3CQYA 4H0YB 4RW7A 4DFKA 2O8FB 1YAGA 4GV9A 1SV5A 4B9LA 4FL9A 5BR8K 1ZBIA 4F3TA 4IO9L 4DQPA 2HSTA 4X65K 1J9AA 5KQDA 3M8RA 2ZQBA 3S3MA 3KVGA 3KLEA 3PIOL 2DFHA 3LP0A 2O8DA 3Q7BA 1S22A 4UY8O 3R1XA 3HOSA 4CZEA 3ALYA 3VQBA 3EL2A 3TARA 3DLHA 2P9LA 4BG9A 3K5OA 2E1ZA 4CJLA 1GLLO 1X9MA 3LPUA 5HROA 4BRPA 1E4GT 3RSEA 5HBMA 3C6UA 3CETA 1XUPO 1WSEA 3CERA 4Y0WA 4M41A 4BG8A 3E1YA 5BRHA 2LSNA 4NYNA 5KQ8A 3VEVA 3L2UA 1VQ8N 1VQLN 4LY7A 2V51B 1WAFA 5BRFA 3LDQA 3NCIA 1HYSA 3QETA 1YTAA 2P9PB 1NG9A 2EWSA 1CZBA 3O08A 3CCSN 3EZWA 3J7YP 2GEMA 4DUYK 2ZGZA 4EP5A 2P9NB 1GOBA 1HNWK 3NBPA 4DV2K 1NGJA 4BC4A 3RMDA 3T1HK 4JI2K 4RTFD 3SJJA 5HP1A 4B1ZA 1EQYA 2YHXA 3AGRA 5GAHP 5AQUA 3I56N 1NK4A 2P9SB 2GWJA 2OYQA 1YHQN 3SQ1A 4GV3A 4IJNA 3U6FA 4BRQA 1CZAN 3QFUA 1HQUA 2D0CA 3ASMA 4O8KA 3VETA 3QICA 1WNSA 3L8BA 3DRSA 2QK9A 1X9WA 2UU9K 3O4WA 4FSVA 3PLAA 4M45A 2VWKA 2Y1JA 2YHAA 3BZCA 2FBVA 4CIFA 1KVCA 4JHDB 3HJFA 1RT3A 1NK9A 4BRLA 4KH5A 4CJSA 1RDDA 4F2RA 3AO1A 4A59A 4HCBA 5H1SQ 4BRGA 3RMBA 1HJOA 3NGZA 2W42A 4DTXA 3ZEUA 1RCHA 1HJRA 4GVEA 1FW6A 5JVGL 2GTDA 2UXBK 4CFAA 3AO5A 3GE1A 4BRDA 5LMUK 1J5OA 5KRSA 4M7XA 2O8CB 3O1WA 4FVMA 4Z4EA 4FO0A 4IOCL 2JWKA 5K14A 2F4VK 3L4IA 3V9UA 4FWLA 4DV0K 1N33K 3SZ2A 3MWPA 1NU0A 4CI6A 1U49A 2A1SA 2HBKA 4AM7A 3S3OA 3V9SA 5BREA 2UUCK 2XO7A 4BR7A 1WAJA 3NF8A 2J4RA 1X3NA 1JLAA 3WXIA 1T05A 4KHWA 1F21A 4DCHA 2NUBA 5JS2A 2G8IA 4JI7K 3AA2A 4JKCA 2BTFA 5CZ1A 3MXJA 1DEJA 3KD1E 3LALA 3QNNA 4AILC 4W5OA 3U9ZA 4MQ3A 3QFPA 3SV3A 1T8EA 2ITMA 4BR2A 3DAWA 3THVA 5AQFA 1C0MA 1M90O 4AM6A 2P1JA 3MK6A 4JV5K 4LD0A 2XHBA 2Z1GA 2BH1A 1A5VA 4MLHA 3SQ0A 2YHWA 4CJFA 3UKUA 2HHHK 5HRSA 3D2EA 1IG9A 4M63C 4PL7A 4BRHA 2HBJA 4OJRA 1BUPA 3VQ7A 1TAQA 3DLBA 1HMVA 1Q86O 4LF4K 2A41A 3H46O 3EEQA 1HPZA 3VQAA 4LF5K 3ATUA 1ATRA 1ZBHA 2O8BA 3EO3A 4CF0A 1HR0K 2UYTA 4MDAA 3OYFA 3CJ7A 4Z4GA 3O4QA 4ZTFA 2FSNA 2YCHA 3N4PA 3DYAA 3CC4N 3SAFA 1WBDA 2WFBA 4FW2A 3T1YK 1P8ZA 3VQPA 1GLJO 2FXUA 3ZX2A 3CJ1A 1QSSA 3SQ2A 2OPPA 2D5RA 4ISEA 3CPEA 1L3TA 3SAGA 3LWLA 4CZFA 3UE5A 3AA3A 3KLFA 1Q81O 1ZBUA 3V1QA 2OCEA 2BGGA 5AQZA 3HT3A 1T03A 4XH1A 5CE3A 4BQZA 1U04A 4E89A 4OGEA 5GAGP 3DWLA 2YKMA 3EZ5A 1S3XA 3TABA 5HRPA 2NLXA 3U8XA 4BC2A 1W97L 3VGKA 1ZC6A 1JLGA 3B6PA 2Z1IA 4Z94A 5LY3A 5E26A 2GUIA 4X62K 5J2MA 5CYMA 4N47A 4KHUA 3DRPA 1QE1A 4DTJA 4CZKA 4B1WB 4CJRA 1NJZA 4EP4A 3WXJA 4H5WA 3PSIA 4KKOA 4FJJA 3OYKA 4DWIA 1YT3A 3L6QA 3G0ZA 2FF6A 3EE8A 4JI8K 4YFUA 1FXXA 3WQUA 2VG5A 3WXKA 1TK8A 3L2RA 1ZBSA 4X64K 2NRVA 4JNEA 3M8PA 1OH5A 4PKIA 2OTLN 4DS5A 2QI2A 5JICA 2HMIA 2P9LB 3VQQA 1Y64A 2P5OA 4O0JA 3TANA 1ZBFA 3TTDA 5GINA 3KLIA 2HF4A 4IG3A 4DHYA 5BN8A 3T19A 3P4IA 4RG8A 4FLYA 1KD1O 3PY8A 3QINA 4CD1A 2D0AA 4FLVA 1T6CA 4BREA 4CECA 4IXCA 2A1RA 1HQEA 4ILJA 5DM7L 3VGLA 2G8KA 3VQ4A 3VF2A 3MEGA 4PA1A 4Z4CA 1NOYA 2IDOA 4PKHA 3H1VX 3NH1A 3IDHA 4IFYA 1RDUA 1IG8A 1UA0A 1KC8O 1W0HA 3V9ZA 3AO3A 4PQUA 4IFEA 3O9RA 1BA1A 2E2QA 4I7FA 1TAUA 1JLFA 2A6AA 3L3UA 4CBWA 4IBNA 1RNHA 4DFJA 1EO1A 4G9ZA 2H3GX 1VSMA 1S9EA 5KI6A 3V9WA 4F3OA 3SQ4A 4E7JA 3AA5X 5ELZA 2IVNA 3E66A 4RWTA 1QSYA 1WSHA 3OY9A 2Q2RA 5DMRA 1NWKA 4DV4K 1M1KO 3FFKB 2V7ZA 1L3UA 4BRCA 2VCPA 4K25A 4BGBA 3O1BA 1NGFA 4BGAA 3LAMA 2Q0UA 1IJJA 4CJ5A 3K0SA 2GBZA 4GKKK 5MLCQ 3WUHA 3SK3A 1V4SA 1YXQA 3HI0A 3HRGA 4FJIA 1YVUA 2E5LK 4YOUA 3RRGA 5KRTA 4PY5A 2B4JA 4JYAK 3LDLA 4CEBA 4OKEA 5AQHA 5KPRA 4L3QA 4BRMA 1NK6A 1QQNA 3QIOA 5C12A 2R7YA 4CGHA 1BIUA 4JS4A 4CEOA 1W9HA 1Q18A 1TL1A 1MDUB 1RBRA 1T6DA 1TYQA 2QTDA 3MXIA 4B9SA 1HRHA 5AZIA 2ETJA 3CCUN 4BDPA 5AQJA 3PX4A 3DOKA 4I6MA 4LSLA 1CZ9A 3HM8A 1D9FA 2Q0RA 3CQXA 3CMAN 3O9QA 1FKOA 3N4QA 4C8KA 3WXLA 3T3FA 3AAQA 3ZEUB 3JXUA 4RW6A 3S3NA 3VF6A 5EX5A 4C8MA 5LMNK 3ULEA 4HUFA 4BRAA 4B1VA 3CM5A 4BRFA 2G8FA 4DU1A 3M6GA 2VQFK 1YITN 4FK4A 1C1BA 3HK2A 1WSIA 4YNQA 3C6AA 4AF1A 1TKZA 4KFBA 4IWVA 1Q8IA 4V19S 4YOVA 2WOMA 1QZ6A 4JKDA 4E7IA 2HB5A 1BG3A 3CIPA 4E19A 5LJVA 5FRNA 4QS7A 1RTIA 4LF6K 1EKEA 5CZ2A 4PHTX 4CVNE 1IKYA 1XC9A 2GX9A 3F73A 1RDAA 3E9OA 5CY4A 5C10A 4CK1A 3LANA 1KXPA 3H1QA 4MO4A 3CG7A 2HVHA 4CJ7A 3TAEA 4NO7A 4KH4A 2QWRA 5GAEP 2P9UB 3SCXA 3H3NO 3DLRA 2P9UA 3UKUB 1JXBA 4EZ6A 3M8SA 3VEYA 5AQTA 4EFHA 4CF9A 3WQTA 3VF4A 4BROA 3CCEN 4FOIA 4RW4A 3LP2A 4ELUA 1NK8A 3K5MA 3E9PA 4CEAA 3M3ZA 3IG1A 2D0BA 5F0XA 1B92A 4CK3A 2O8DB 4OKKA 3H08A 2ZJPL 3TPQA 1JLBA 3JAMO 3IMXA 4HVJA 3EYZA 1X3MA 4CJVA 3TWHA 1WUAA 1J5EK 3LP3A 1QQOA 1K8AO 4ICLA 1NJIO 3CJAA 3JS6A 1RBVA 4LH4A 1HKGA 2FSKA 2HOEA 3LM9A 1IV0A 4H5NA 3HPGA 1SZ2A 4OPAA 1VQ7N 4FWRA 4N5SA 5D3GA 1S1UA 1EX4A 3AARA 3SUQA 4OKJA 1U2VB 3M5RA 4CBXA 4OLAA 4E3SA 5GADP 3SV4A 1JL2A 1DTQA 4FPBA 3KLGA 5CR4A 2XRIA 2E4LA 5BN9A 1IBMK 4I2QA 4JKGB 4BACA 1HX1A 3HTVA 4CFDA 3BUZB 5KGXA 4E7KA 4I6MB 4CGDA 3LWMA 4BE2A 4GVMA 3CM6A 2NRZA 5AZJB 3MEEA 5BR9A 4FJGA 3O3FA 1DKGD 1LWEA 1RT2A 5TKWA 1R59O 3CCRN 1B9FA 1BOTO 4Z4IA 3J7ZO 3Q7CA 2BANA 5HRRA 1R0AA 2OPQA 3AA4A 2WC9A 2KFNA 4KTWA 3H3OB 4DR1K 1RBUA 4DV5K 2G8UA 4IKFA 4AHTA 3E9LA 5SZTA 1NOZA 4R5PA 3RMCA 3ZX3A 4CIEA 5BPMA 2UUBK 1CXUA 5AQMA 3AO2A 3RSEB 3AVGA 4AHCA 3L2WA 3RMAA 4M3WA 3ZSZA 4CESA 1U45A 4KO0A 3MMVA 3G25A 1NBWA 5CHIA 3NE6A 4DSLA 3C6TA 4K8XA 4H0TB 4A57A 3U3YA 3K59A 3PO5A 3OYIA 4B9TA 1BGXT 4H5VA 1EXQA 2X74A 3VQ8A 3HVRA 1NNEA 3OS2A 5AQXA 4IFVA 1EWRA 2RN2A 1FKPA 3DLGA 3OS0A 4CJWA 1NJXA 4CEFA 4Y1DA 3HM9A 3NGIA 1T7PA 4K8ZA 4B9QA 2CH6A 2GELA 1UAXA 4NCBA 3AVCA 2BUPA 3AVFA 1LOTB 3FZMA 3I55N 3OYJA 4NXMK 4NLBA 3K5LA 3LP1A 4XEIA 4O5FA 1H1VA 4BR9A 3DXMA 1J54A 1ESVA 1KAYA 3WNFA 1Q9YA 2ZJQL 1GLAG 3V1OA 4KV8A 3PO4A 1IO2A 4O55A 5AQPA 4CZHA 3FZHA 5AQIA 1ATSA 4RW9A 3OBYA 2YI1A 3L2QA 1VQKN 1K8KB 3SLCA 3ATVA 3HSCA 3RVCA 3F9KA 4B08A 3I8DA 5HL7L 1YJ9N 3SBGA 1NGCA 4DF8A 4KHQA 4FJ8A 4CGFA 4FWKA 4M3YA 4C23A 1VQNN 2XY8A 2IVPA 4A5BA 4O4GA 2XY5A 2F9WA 1OH8A 2WUSA 4BWMA 1DT9A 5IT9O 1SKWA 2ASOA 3HXMA 5FLXO 3ZCMA 4FVUA 1RDCA 2O8EB 1OH7A 3OBWA 5JLFA 3C94A 3D7EO 3NGYA 4GMJB 3JSMA 3F2KA 2G8HA 4OO1J 1WN7A 1ATNA 4FM1A 1QVFM 2DFEA 5HRNA 1YJNN 3TI0A 3FE1A 3O3HA 5FPDA 3CPWM 1VSEA 4FOEA 5ADXA 1LAWA 1DGKN 2UXDK 1TYQB 1GLBG 2IOCA 1I94K 4DR7K 1QSLA 1XHZA 3GBTA 1S5JA 4B1UB 2HNZA 3P83D 4LFAK 4AQYK 1Y97A 1G15A 1NLVA 4NCAA 2X78A 4IDKA 3CFOA 5BPNA 3QNOA 1E4FT 3ZX0A 2F7TA 4IG0A 1LW0A 3BZKA 4KBOA 2BE2A 4DB3A 5EVZA 1SQKA 4CZLA 3OYEA 3NFAA 4B9NA 4PKGA 5DK5A 4W5RA 2HBLA 4B9MA 4CGGA 2W41A 4FWPA 4CEZA 4U7BA 3RR7A 1OVQA 4KHNA 5I3UA 1QTMA 3GOIA 3THYA 4MO5A 3KKRA 4AHUA 2HVIA 4FLTA 3C6HA 2DFFA 3PIPL 3H6EA 3O3GA 3C65A 1WSGA 3ZSQA 4Z4FA 3K5NA 4RW8A 4GW6A 3HL8A 1WLJA 2YHYA 3NH0A 4JI1K 3TAGA 2P9IB 1RBSA 3CXCM 5AFUA 4FZYA 3WEEB 2RE2A 1KRPA 2HHXA 1U6ZA 3B8AX 1XQSC 4CHZA 1MWMA 3BF3A 2ITGA 1A5XA 4DTOA 3I33A 2XY6A 1C1AA 2OPSA 4GY2B 4PL8A 4KTQA 3FGUA 3THWB 2YJEA 3SMSA 1YI2N 2HMPA 2Z1HA 3VENA 1HNIA 1VHXA 2P9PA 1RT4A 3OVNA 1EETA 4FJMA 1NGGA 1RFQA 4QOZB 4DSIA 3R8EA 4DQRA 1NKBA 1SS6A 1HNXK 4XH4A 1IBKK 3P39A 4A62A 2P5GA 1VQ9N 4BR5A 3THXB 3CD6N 2HHWA 1MU2A 3F5TA 4FJ7A 3KZBA 4JKFA 1XHXA 3AGKA 4FJXA 2OA8A 5AQWA 3H45C 2ZF5O 3IAYA 4CJEA 1NJYA 3QIPA 4Y1CA 3HSTB 3C7NA 4CEQA 1LAVA 5C2FA 2QWMA 1JLQA 2F8TA 1RT5A 1T44A 2AA4A 3PSFA 5C42A 5LL6Z 4M7YA 3SUPA 5KPZA 1RT7A 4OPHA 4BR0A 3DLKA 3I0RA 3WXMB 4M3ZA 1T3VA 3DLEA 3BP8A 1SKRA 3S41A 4DTNA 3DM2A 4JEPA 2KFZA 3HPOA 3CI5A 2CGJA 3ULDA 3MN7A 4LF8K 4MLEA 3AO4A 4EHUA 5FPMA 1JLEA 1JCGA 4AHRA 2O4IA 1SL1A 4DV6K 5KTQA 3VMFB 3ENBA 4AHVA 4DF4A 4WQ4A 3W0LA 2Q31A 4WCEL 3I0SA 1TKXA 1C0UA 3M1FA 4LH5A 1KVAA 3K58A 4KTZA 3T69A 1RDWX 2NRRA 2WTUA 1YTUA 2Q97A 4JK9A 4CJ4A 1J6ZA 3V6DA 3MEDA 4B3SK 5AQNA 1NKCA 2QWQA 4KHPK 2A3ZA 3IKMA 3P5JA 4QCLA 1VAZA 5AJ3K 3B6OA 3P1GA 2IC3A 2HHQA 4FJLA 1NJWA 3LDOA 3CYMA 1N5YA 3HPHA 4WE1A 3J80O 4ID1A 4N41A 5A2QO 3K57A 4FLUA 3THWA 4DSKA 1RDBA 2HF3A 2A5XA 4JKAA 4PUOA 4BRIA 1SAZA 1SKSA 4CHOA 1I39A 3TAPA 4B1XB 4EIAA 4DQIA 1YF5L 1TVRA 3QDKA 3M8QA 3J7AP 2IAJA 1V4TA 1JXEA 1MA9B 4KREA 3G10A 4I9QA 4FLWA 3AVKA 4DV1K 3MCAB 3OYGA 3A5OC 3LPTA 1BHLA 3SBTA 3WEEA 3UIQA 3UKRB 3A2FA 4PWDA 4DG1A 4YDUC 4E1MA 3F9MA 3TTCA 1O1WA 1TUYA 1GOAA 4CHQA 5JMVA 2X6NA 2KKZA 3HYFA 1GLDG 4DSFA 3EKUA 4DR6K 3KWGA 1LWFA 3V4IA 4FCYA 3HP9A 3NF7A 1LV5A 3TR8A 3VEZA 2AP1A 2Z1JA 4ID5A 1BWFO 5M1PA 3LDPA 4BY9C 3KKSA 1HNZK 3E01A 3ZSOA 3KWIA 1KAZA 1D9DA 4C8NA 3QEWA 2E2NA 1YUWA 1XNQK 4DQQA 1XNRK 3LM2A 4FK2A 1QZ5A 4WYBA 3OA9A 5F1XA 4BE0A 1BU6O 4CGIA 2FBYA 4FK0A 4DU3A 2YNIA 4DV3K 4KRFA 4GV6A 1VRUA 5EXWA 1Z26A 4B3RK 4AH9A 2I5JA 4GNIA 4YDUA 1D4XA 4IEEA 4CIGA 1NGIA 3QBWA 1HPMA 2NRXA 4QS8A 4YORA 3VQ6A 3U3GA 3BDPA 2IVOA 2QWPA 3SJHA 4E7LA 4HCCA 1BL3A 3EN9A 4QAGA 1VSJA 3W3DA 3QMLA 2PYLA 3KK2A 4CCHA 3QESA 1BIZA 1RBTA 3GL1A 4H5RA 4DTSA 4FWQA 3FLCO 2PAVA 2XY7A 1NGHA 1NGAA 5GIPA 1UA1A 5SWMA 4JAXA 4CEEA 4YOXA 3O80A 4BC5A 4Z4HA 4A5AA 3HO1A 3THYB 5AQRA 3VA3A 1U2VA 3PUFA 4EHTA 3CMEN 1VSHA 3UB5A 1Z6RA 4CJPA 2F8SA 3VEOA 1SL2A 4H8KA 1VQMN 1ASWA 1TV6A 2VGMA 5AQYA 4FLXA 3OJUA 4JI5K 3P31A 4FWOA 1DTTA 4JKEA 2DPNA 4JI4K 2HBMA 4J8FA 2QEXN 1NGEA 3T1AA 3O9UA 4JD2B 3SUNA 3AVIA 4W5NA 3OYLA 1NK0A 3OS1A 2JWLA 4FWSA 3O6WA 3OTOK 3V1RA 2P9KB 3LZIA 2NNWA 4W5QA 3ZSXA 4CJTA 3VN5A 1RTDA 5KPTA 4UQGA 3DLLL 3TSPA 3ZSYA 4QS9A 2P9NA 4BVPA 3ZETA 1OH6A 1OKJA 3L4QA 4DR2K 4F4KA 2JGUA 4Q0BA 4WQ5C 3OJSA 2VG6A 1S1VA 3D2EB 4I9LA 1U48A 4JI6K 2HHSA 1Q7YO 4DTUA 5AQKA 4B1YB 4JK7A 4FWMA 3VQEA 3VGMA 1U47A 2IIRA 1VQ5N 4FM2A 2OZSA 2Y1IA 1S6QA 4DTMA 1ZYQA 3VERA 5J1EA 3WNEA 4DLEA 3SMPA 3PV8A 1O13A 1BQNA 4JHDA 1U4BA 3O8MA 1Z05A 1BISA 1WSJA 4I2PA 3NH2A 4WQ4C 3QB0A 4CJ3A 3MXMA 5J2PA 4DSJA 4KPYA 4IEIA 1S1TA 4H0PA 3ID8A 2WBNA 2V7YA 2DTUA 3THXA 1ASVA 4JKGA 4JI0K 3MX2A 4HTLA 4WF9L 1GLCG 5CYQA 5AQQA 3HVTA 5JS1A 3MWTA 1ASUA 3AAPA 4M42A 1NMNA 3EE9A 2IGIA 1S1XA 4H0OA 3DOLA 4CFCA 1JJ2M 4CBUA 5AZJA 3AY9A 3TU5A 3MN6A 3CJBA 4K41A 4OX9K 5C25A 4BR4A 3ZSRA 4NCGA 3BEXA 1ILYA 4CJUA 1VSIA 4DFPA 3KTQA 1GLEG 1C0GA 3MN5A 2P9SA 4BRNA 2KTQA 4KAZA 3ZT3A 3WNHA 3BGRA 2EX3A 3CHWA 1BA0A 4WFAL 3QEXA 4CERA 1UOCA 2FF3B 4N76A 3A8YA 1N32K 2VWJA 1RTHA 1S72N 3CCVN 2E6MA 4CZMA 1JCEA 3QBXA 3IRXA 4K42A 3AVHA 3KIOA 2Q1NA 1VSDA 4E1NA 2DY4A 3QEVA 3NMUA 1LWCA 5EU7A 1I3AA 1UWBA 4CZJA 3GG4A 3G6EN 3KHYA 3ID6A 2B6AA 3A0IX 4YHHK 3DJCA 4FM0A 3TTFA 2CGKA 2HHTA 2KZMA 2GWKA 4LSNA 1NKEA 3MN9A 1BO5O 4G1QA 1L3SA 3BY5A 4LFCK 4F9OA 1X9JA 4FJ9A 4FXDA 1BDGA 5BPLA 2VWBA 3MDQA 3DRRA 2AJQA 4J2EA 4FLZA 1S6PA 4NXNK 1WSFA 2ASPA 1QS4A 5EY4A 2D0PA 2YNFA 4CZIA 4DTPA 4FJNA 4E1JA 4BC3A 4YY3K 1WB9A 1XWLA 3TAMA 4L8RB 4HWIA 3R3LA 3ZYYX 1RT6A 4OPKA 1RT1A 2ZJRL 4LF9K 2QWOA 5M1NA 3VEWA 3ZT0A 1BCMA 2BDPA 1KSPA 3VESA 4CEDA 4DU4A 3CCLN 1XMOK 1J53A 3RRHA 5LJWA 1C6VA 4N56A 4JKHA 4U67L 3WNGA 3MECA 3OYDA 4M3TA 3BF1A 3R6MA 3AVNA 3OYAA 1KVBA 4O5BA 1P90A 3SI6A 2GUPA 3G4SN 3LZJA 4XIUA 1QQMA 4LFBK 1YIJN 4FJHA 3NF9A 3IUCA 4Z0UA 3VPZA 2YX6A 2E88A 5M1FA 1RILA 3VEXA 5E41A 3CCQN 4EZ9A 1ZBLA 4DSEA 2GV9A 2E2OA 3VQCA 2WONA 1X1PA 2HHUA 2ASMA 4KI4A 2EHGA 2UUAK 4DQSA 3VTIA 1VRTA 4B9UA 1JKHA 2FC0A 1HKCA 2F9TA 3CFPA 4YOWA 3NAEA 4FYDA 3KK1A 3O9TA 3U4LA 4H4MA 5C15A 1VQ6N 4IOXA 2HNYA 2OPRA 3RR8A 1XC3A 1EWQA 1VSLA 3FZKA 5AFUH 5FPEA 1YJWN 4CD3A 1E3MA 3I8BA 4BQLA 1TK5A 2F96A 1D8YA 2VGNA 3LAKA 3QO9A 2VYPA 2IS3A 3VOVA 1VK0A 3SAHA 4DR4K 2A42A 3HBTA 2W6KA 3HOTA 2ZE2A 1XI1A 4DS4A 2OTJN 2E2PA 4BRKA 5HLFA 1NK7A 5FRMA 3T7ZA 4WFBL 4WQ5A 2QWLA 3ZT2A 5E84A 5ADXH 1QHAA 2CH5A 1N34K 3O4NA 5IWAK 2P9KA 5M1QA 3AVMA 1GLFO 3AVLA 4JKBA 2NRWA 4B3MK 1FK9A 3VQDA 3DXKB 5AQVA 1KQSM 3O9SA 2NZTA 1EP4A 2YHBA 3D6RA 3L2VA 4BWJA 1HLUA 4H0XB 2NRTA 3NDKA 3KK3A 1WBBA 2Q3SA 1SUQA 4OLBA 1OVYA 2X6SA 3U9DA 5GIOA 5B8HA 3KJVA 3SPZA 3HZ6A 4CF1A 3KLHA 3CJ9A 2PFUA 3ZT4A 4X66K 4E7HA 1N6QA 1WOQA 2E20A 1D5AA 4JN4A 5JLHA 1TL3A 1IKWA 3C0BA 4B8AB 3K9KA 3R9PA 5FDLA 4FWNA 1KLMA 3CQ8A 3TAFA 2VQEK 3CFRA 1Z25A 4ISFA 3ENHA 3SUOA 4M3XA 2UXCK 1K6YA 3PX6A 2D0OA 1G99A 2G8VA 3CCMN 2QWNA 4ELTA 2YNHA 1KLNA 1C0TA 5AQOA 1HKBA 3QEPA 4FW1A 4DMNA 5J2QA 4BE1A 5J2NA 1XMQK 4CE9A 1VQ4N 2CGLA 2D4WA 1L5UA 2PBDA 1S1WA 1N36K 4B9VA 2B5JA 4OGCA 1MWKA 4J2BA 1IKXA 1DLOA 2E1YA 4CHYA 3D45A 1K73O 5TKYA 2PY5A 4C8OA 3CCJN 3CC2N 3L3VA 2QA4N 1TK0A 3OHRA 4CW7B 3J8AA 3OYBA 5F2RA 4BDZA 1TUUA 1VSKA 2HHVA 3C95A 1NM1A 1KFDA 4BDYA 2ZM6K 4DR3K 1TKDA 5AZIB 2O8BB 4AHSA 3AVAA 1QHTA 4YOTA 1L3VA 1ZXOA 4JLHA 4ILGB 3ITHA 2W40A 5FPNA 4EAHD 4C1NI 4H03B 2KLAA 3DI6A 4IZ9A 4F8RA 3VA0A 1RGIA 2E6LA 2P51A 2NRHA 5AQSA 3QERA 3A5NC 4B3TK 1BQMA 2HNDA 2QW9A 1ITGA 4HTUA 4MFBA 4NB4A 1BI4B 4BVOA 4F2SA 5AQLA 1IH7A 4RCHA 2RHKA 1N8RO 4CZGA 4FZZA 4DKWA 5DM6L 3FFIA 2RF2A 3D0PA 2QKBA 3HP6A 1BCOA 2O4GA 3VQ9A 1Q82O 1X9SA 1KFSA 2I7NA 3A5LC 5EOYA 3RTVA 3ZLJA 1REVA 2QXLA 2O8EA 2YNGA 1A5WA 3ENOA 4KHSA 2O8CA 3KK7A 4ZTJA 3SYZA 3QLHA 3KD5E 4KI6A 1HYZA 3ISNC 4C8LA 2RKIA 3AVJA 3SNNA 1SL0A 3K2PA 4DTRA 4DR5K 3V81A 3DXKA 4LF7K 4TSXA 2FBXA 2FLOA 5KGWA 1C0FA 1C1CA 4IJAA 5BRDA 4J2AA 1RTJA 3ZETB 2YV0X 4OVLA 1W2BM 4J2DA 5M1OA 2Q36A 4KB1A 3MX5A 3NF6A 1JCFA 4ILHA 4A61A 3MAQA 4HUGA 3IFRA 3D2FA 3RWUA 2ZGYA 1Q9XA 3AV9A 4IOAL 4DFMA 2RPIA 1QVGM 4XH5A 1JL1A 4NLCA 2OANA 2QKKA 3MCPA 4ISGA 4O8UA 2KHOA 2I7PA 3FZFA 4CF2A 1HNVA 4GKJK 2KZZA 1K9MO 4M3UA 3TAQA 4JRQA 3WT0A 2YKNA 3A5MC 3K9JA 2ATQA 3LL3A 3V9XA 3GDQA 1VQON 3OYMA 1CXQA 4IDHA 1FJGK 3DMJA 2HW3A 3TSQA 4A2AA 4E0DA 2PZSA 2OZMA 2O8FA 5C0YA 1KCFA 4DV7K 4B8CA 3VTHA 1IKVA 1HUXA 4A2BA 2YJFA 1B9DA 3FR0A 3SPYA 2QM1A 4CJKA 4JI3K 5JVHL 4JS5A 4DUZK 4FZXC 1CLQA 2A40A 1IBLK 3JYTA 3CJCA 5M1KA 2G8WA 5HOOA 4CGJA 3TSUA 3PX0A 3OW2M 4HHTA 3OYNA 4KHYA 3OYCA 4CJQA 1LW2A 1GOCA 4H5TA 4ELVA 4CHPA 1VQPN 5I9EB 4O44A
chains in the Genus database with same CATH topology
3LDSA 1JLCA 1VSMA 3VQ5A 3BGRA 2EX3A 1S9EA 2BE2A 5KI6A 3V9WA 3QEXA 4F3OA 4CERA 1UOCA 4N76A 3SQ4A 4E7JA 3AA5X 1TGOA 4HUEA 2VWJA 1RTHA 1QSYA 1WSHA 2E6MA 3OY9A 3OYEA 3IRXA 3NFAA 5DMRA 2KW4A 3AVHA 3KIOA 3ZT1A 5DK5A 2ZD1A 1VSDA 4E1NA 4W5RA 3S9HA 4B9NA 4CGGA 3QEVA 4B9MA 2DY4A 1LWCA 5EU7A 1I3AA 1UWBA 1VSFA 1HYVA 4CEZA 3RR7A 1L3UA 3ZSWA 4KHNA 2B6AA 5I3UA 1QTMA 3KKRA 4FM0A 4W5TA 4AHUA 2HVIA 4FLTA 5FROA 3LAMA 5C24A 2DFFA 4B3OA 1BI4A 4CJ5A 3NHGA 4ZHRA 2GBZA 3O3GA 2JLEA 1WSGA 3ZSQA 4Z4FA 4CHNA 3K5NA 2HHTA 4RW8A 2KZMA 4LSNA 4GW6A 1NKEA 3HL8A 4G1QA 1WLJA 3NH0A 1L3SA 3TAGA 4FJIA 4FJ9A 4DLGA 1RBSA 4FZYA 4FXDA 2HHXA 1KRPA 1YVUA 4O0IA 3DRRA 2AJQA 4J2EA 3AVBA 4NYFA 1S9GA 1TKTA 4CHZA 4FLZA 4OPJA 3IS9A 4Q5VA 1S6PA 3OYHA 5KRTA 3RRGA 4PY5A 2ITGA 1WSFA 2VG7A 1A5XA 4DTOA 1QS4A 5T7BA 2XY6A 2YNFA 2B4JA 4CFBA 4DTPA 3QEIA 4CEBA 4FJNA 2QXFA 1C1AA 2OPSA 4OKEA 2PYJA 4KTQA 4FJKA 2KQ2A 4KB0A 1XWLA 3TAMA 4L8RB 1NK6A 2Z1HA 3QIOA 5I42A 1HNIA 2R7YA 4CGHA 1BIUA 1RT4A 1EETA 1RT6A 3OVNA 4CF8A 4CEOA 4JS4A 4FJMA 4OPKA 1W9HA 1RT1A 1TL1A 4M3RA 1NK5A 1RBRA 4QOZB 3MXIA 4DSIA 3ZSVA 4CK2A 4B9SA 1HRHA 4DQRA 1NKBA 4H4OA 2ETJA 3ZT0A 4BDPA 1BCMA 2FBTA 2BDPA 1KSPA 3PX4A 2P5GA 1QQCA 3DOKA 4LSLA 1KTQA 1CZ9A 4CEDA 3EY1A 4DU4A 1D9FA 4JRPA 4FJ5A 2HHWA 1J53A 1MU2A 3RRHA 1C6VA 1FKOA 4RW7A 4N56A 4DFKA 4FJ7A 3WNGA 1XHXA 1SV5A 3MECA 4B9LA 4FJXA 3OYDA 2OA8A 4C8KA 3IAYA 4M3TA 1ZBIA 4CJEA 3T3FA 3AVNA 3OYAA 3QIPA 1NJYA 1KVBA 4Y1CA 4F3TA 4O5BA 4DQPA 3M8RA 3SI6A 1J9AA 3HSTB 3S3NA 2ZQBA 4RW6A 3S3MA 4CEQA 1LAVA 3LZJA 4XIUA 3KLEA 1JLQA 2F8TA 4C8MA 1RT5A 4HUFA 5C42A 2DFHA 3LP0A 3CM5A 3SUPA 1RT7A 4FJHA 2KFZA 3NF9A 3DLKA 3I0RA 4Z0UA 2G8FA 1RILA 3DLEA 5E41A 4DU1A 4EZ9A 4M3ZA 1SKRA 4FK4A 4DTNA 1C1BA 1ZBLA 4DSEA 1WSIA 2GV9A 3DM2A 3HK2A 3ALYA 3VQBA 3VQCA 2WONA 1X1PA 4YNQA 3TARA 3DLHA 3HPOA 4KI4A 2HHUA 2EHGA 3K5OA 4DQSA 4CJLA 1TKZA 1VRTA 4KFBA 1X9MA 1Q8IA 3LPUA 3ULDA 4B9UA 1JKHA 2WOMA 2FC0A 3AO4A 5HROA 1JLEA 4E7IA 4AHRA 2HB5A 2O4IA 1SL1A 5KTQA 4AHVA 4DF4A 5HBMA 3C6UA 4E19A 5FRNA 1WSEA 3RR8A 3CFPA 4M41A 3NAEA 1RTIA 4FYDA 3KK1A 2LSNA 4NYNA 1EKEA 3I0SA 4H4MA 5CZ2A 3L2UA 1TKXA 1C0UA 2HNYA 2OPRA 1IKYA 4LH5A 1WAFA 4LY7A 3NCIA 3F73A 1VSLA 1XC9A 1RDAA 3QETA 1HYSA 5CY4A 1KVAA 1YTAA 3K58A 4KTZA 4CK1A 3LANA 1YTUA 1TK5A 4CJ4A 3CG7A 2HVHA 2F96A 3V6DA 3MEDA 3TAEA 1D8YA 1CZBA 1NKCA 3LAKA 3QO9A 2IS3A 3P5JA 4EP5A 1GOBA 1VK0A 4QCLA 3NBPA 3B6OA 3RMDA 3P1GA 3SJJA 3SCXA 5HP1A 2IC3A 2HHQA 4FJLA 3DLRA 1NJWA 3CYMA 1N5YA 2ZE2A 1XI1A 4NCAA 1JXBA 4EZ6A 3HPHA 4DS4A 1NK4A 3M8SA 5HLFA 1NK7A 5FRMA 4WE1A 2OYQA 3SQ1A 4CF9A 4ID1A 3U6FA 4N41A 3K57A 4FLUA 4DSKA 1RDBA 4RW4A 3LP2A 4ELUA 1HQUA 2D0CA 3ASMA 1NK8A 3K5MA 1WNSA 3L8BA 4PUOA 3ZT2A 3DRSA 4CEAA 3O4NA 1X9WA 2QK9A 1SKSA 3IG1A 2D0BA 4CHOA 3AVMA 1B92A 4CK3A 1I39A 3AVLA 2VWKA 4OKKA 4M45A 3TAPA 1FK9A 2YHAA 3VQDA 2Y1JA 4DQIA 3H08A 1TVRA 3M8QA 2FBVA 1EP4A 2YHBA 1JLBA 4CIFA 3L2VA 1KVCA 2IAJA 4BWJA 3HJFA 1RT3A 1NK9A 4HVJA 3EYZA 1JXEA 4CJSA 4KREA 1RDDA 4CJVA 3TWHA 4F2RA 3AO1A 3G10A 3NDKA 4I9QA 4FLWA 3AVKA 4HCBA 3LP3A 3OYGA 3KK3A 2Q3SA 1SUQA 4OLBA 3LPTA 2X6SA 4ICLA 3SPZA 1BHLA 3KJVA 3RMBA 3UIQA 3KLHA 4CF1A 3NGZA 3A2FA 2W42A 4DTXA 1RBVA 4LH4A 3ZT4A 1RCHA 1HJRA 4DG1A 4PWDA 4E7HA 1N6QA 4E1MA 3AO5A 4CFAA 1O1WA 1D5AA 1TL3A 1IKWA 1GOAA 3HPGA 4B8AB 1J5OA 4CHQA 5KRSA 2X6NA 4FVMA 5FDLA 4N5SA 5D3GA 1KLMA 3HYFA 1S1UA 3CQ8A 4DSFA 4Z4EA 3TAFA 1EX4A 1LWFA 5K14A 3SUQA 3CFRA 1Z25A 4OKJA 4OLAA 3V9UA 3V4IA 4FCYA 4E3SA 3HP9A 3NF7A 3SV4A 1JL2A 3SUOA 3SZ2A 1LV5A 4M3XA 3TR8A 1DTQA 1K6YA 3PX6A 1U49A 2Z1JA 4ID5A 2A1SA 2G8VA 3KKSA 4ELTA 3KLGA 3S3OA 2YNHA 2XRIA 3E01A 1C0TA 3ZSOA 2E4LA 3V9SA 3QEPA 2XO7A 1KLNA 1D9DA 1WAJA 4FW1A 4C8NA 4DMNA 3QEWA 5J2QA 4I2QA 3NF8A 4BE1A 5J2NA 4DQQA 4BACA 1JLAA 4CE9A 1T05A 4FK2A 4KHWA 1F21A 4BE0A 4CFDA 1L5UA 4B9VA 1S1WA 5KGXA 4E7KA 2B5JA 2NUBA 4IG0A 4OGCA 5JS2A 4CGIA 2G8IA 3AA2A 4J2BA 2FBYA 4CGDA 3LWMA 4FK0A 4DU3A 2YNIA 1IKXA 1DLOA 4KRFA 4CHYA 1VRUA 3D45A 4BE2A 4GVMA 1Z26A 3CM6A 5CZ1A 2PY5A 4C8OA 3MXJA 4AH9A 3KD1E 2I5JA 3LALA 3MEEA 3QNNA 4AILC 4W5OA 4MQ3A 3L3VA 3SV3A 4CIGA 3WNHA 1TK0A 3O3FA 1RT2A 1LWEA 1T8EA 4FJGA 3OYBA 4BDZA 1B9FA 1VSKA 2HHVA 3C95A 3THVA 1C0MA 1KFDA 3VQ6A 4BDYA 3U3GA 3BDPA 2P1JA 1TKDA 4Z4IA 4LD0A 4HCCA 4E7LA 2XHBA 2Z1GA 4AHSA 1BL3A 2BANA 4QAGA 3AVAA 1VSJA 5HRRA 1R0AA 1A5VA 1QHTA 2OPQA 3AA4A 3SQ0A 1L3VA 2PYLA 3KK2A 4CCHA 3QESA 1BIZA 4JLHA 4CJFA 1RBTA 4KTWA 2KFNA 3ITHA 4DTSA 1RBUA 5HRSA 1IG9A 2G8UA 4AHTA 4IKFA 2XY7A 5SZTA 1NOZA 4R5PA 3RMCA 1UA1A 3DI6A 4F8RA 4CIEA 4OJRA 5SWMA 3VA0A 1CXUA 3VQ7A 4CEEA 1TAQA 2E6LA 3AO2A 3DLBA 1HMVA 2P51A 3QERA 1HPZA 4Z4HA 1BQMA 2HNDA 3AVGA 3VQAA 4AHCA 3L2WA 1ITGA 3RMAA 4M3WA 3ZSZA 4CESA 4HTUA 4MFBA 1U45A 1ZBHA 3HO1A 4KO0A 1BI4B 4CF0A 3VA3A 4F2SA 3PUFA 1VSHA 1IH7A 3NE6A 3OYFA 4DSLA 3C6TA 4K8XA 4CJPA 3U3YA 4FZZA 2F8SA 3K59A 3FFIA 4Z4GA 3O4QA 3OYIA 4ZTFA 1SL2A 2RF2A 3D0PA 3PO5A 4B9TA 4H8KA 2QKBA 3HP6A 1BCOA 1BGXT 1ASWA 2O4GA 3DYAA 1TV6A 1EXQA 2X74A 3VQ9A 1X9SA 3VQ8A 4FLXA 1KFSA 3HVRA 3OS2A 4FW2A 4IFVA 3VQPA 3RTVA 1REVA 3OJUA 1QSSA 2RN2A 2YNGA 1FKPA 2OPPA 3SQ2A 1A5WA 3DLGA 2D5RA 4KHSA 3OS0A 1DTTA 1L3TA 3LWLA 4ZTJA 4CJWA 3SYZA 3AA3A 3QLHA 3KLFA 1NJXA 1ZBUA 4CEFA 4Y1DA 3V1QA 3HM9A 3NGIA 3KD5E 3T1AA 1T7PA 4K8ZA 1HYZA 3ISNC 3HT3A 3AVIA 3SUNA 4KI6A 2BGGA 3OYLA 1T03A 1NK0A 4C8LA 4W5NA 1UAXA 3OS1A 1U04A 2RKIA 3AVJA 4OGEA 4E89A 4NCBA 2YKMA 3AVCA 3EZ5A 3SNNA 3TABA 3K2PA 3V1RA 1SL0A 3LZIA 3AVFA 5HRPA 4W5QA 3ZSXA 4DTRA 4CJTA 3OYJA 3VN5A 3V81A 1RTDA 1JLGA 4UQGA 4TSXA 3B6PA 2FBXA 2Z1IA 3ZSYA 5KGWA 3K5LA 1C1CA 4J2AA 3LP1A 2GUIA 5J2MA 5CYMA 1J54A 1RTJA 2YV0X 4OVLA 4J2DA 4F4KA 2JGUA 4N47A 3WNFA 4Q0BA 3OJSA 1Q9YA 4KHUA 2VG6A 1S1VA 3DRPA 1QE1A 4I9LA 4DTJA 3V1OA 4KV8A 1U48A 3PO4A 4KB1A 1IO2A 3NF6A 4O55A 3MAQA 4HUGA 2HHSA 4CJRA 1NJZA 4EP4A 4DTUA 3RWUA 4RW9A 4KKOA 3L2QA 1Q9XA 3OYKA 4FJJA 3AV9A 4DWIA 3VQEA 1U47A 3I8DA 1YT3A 3F9KA 4B08A 3G0ZA 4DFMA 4FM2A 2OZSA 2RPIA 2Y1IA 1JL1A 1S6QA 4DTMA 1ZYQA 4YFUA 4DF8A 1FXXA 4KHQA 4FJ8A 5J1EA 4CGFA 2VG5A 2QKKA 3WNEA 4DLEA 4M3YA 1TK8A 3L2RA 3PV8A 1BQNA 2XY8A 4CF2A 1U4BA 1HNVA 3M8PA 4O4GA 2KZZA 4M3UA 3TAQA 4JRQA 4DS5A 1BISA 1WSJA 4I2PA 2XY5A 2YKNA 2HMIA 4BWMA 3VQQA 3NH2A 2P5OA 2ATQA 4CJ3A 4O0JA 3TANA 3MXMA 5J2PA 4DSJA 1ZBFA 1SKWA 4KPYA 3V9XA 3HXMA 1S1TA 3KLIA 4IG3A 3ZCMA 3T19A 3OYMA 1RDCA 4RG8A 1CXQA 2DTUA 4FLYA 3DMJA 3C94A 3PY8A 3QINA 2HW3A 2D0AA 3NGYA 4GMJB 3JSMA 4FLVA 1ASVA 2G8HA 1WN7A 4CECA 4E0DA 4FM1A 2PZSA 2OZMA 2A1RA 1HQEA 5CYQA 1KCFA 4B8CA 2DFEA 3HVTA 5JS1A 5HRNA 2G8KA 1IKVA 1ASUA 3VQ4A 3TI0A 3MEGA 4PA1A 4Z4CA 3O3HA 1NOYA 3SPYA 4M42A 1B9DA 2IGIA 2IDOA 1S1XA 4CJKA 1VSEA 3NH1A 1LAWA 3DOLA 4IFYA 4JS5A 4CFCA 1UA0A 4FZXC 1W0HA 1CLQA 3V9ZA 2IOCA 3AO3A 3JYTA 4PQUA 2G8WA 4I7FA 4CGJA 1TAUA 1QSLA 3PX0A 5C25A 4HHTA 1JLFA 3L3UA 3OYNA 4KHYA 3ZSRA 1XHZA 1S5JA 4NCGA 3OYCA 2HNZA 4CJQA 3P83D 4IBNA 4CJUA 1Y97A 1G15A 1LW2A 1GOCA 1RNHA 1VSIA 2X78A 4IDKA 4DFPA 3CFOA 4DFJA 4CHPA 3KTQA 4ELVA 3QNOA 2KTQA 4KAZA 3ZT3A 1LW0A 4O44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDS A;  1JLC A;  1VSM A;  3VQ5 A;  3BGR A;  2EX3 A;  1S9E A;  2BE2 A;  5KI6 A;  3V9W A;  3QEX A;  4F3O A;  4CER A;  1UOC A;  4N76 A;  3SQ4 A;  4E7J A;  3AA5 X;  1TGO A;  4HUE A;  2VWJ A;  1RTH A;  1QSY A;  1WSH A;  2E6M A;  3OY9 A;  3OYE A;  3IRX A;  3NFA A;  5DMR A;  2KW4 A;  3AVH A;  3KIO A;  3ZT1 A;  5DK5 A;  2ZD1 A;  1VSD A;  4E1N A;  4W5R A;  3S9H A;  4B9N A;  4CGG A;  3QEV A;  4B9M A;  2DY4 A;  1LWC A;  5EU7 A;  1I3A A;  1UWB A;  1VSF A;  1HYV A;  4CEZ A;  3RR7 A;  1L3U A;  3ZSW A;  4KHN A;  2B6A A;  5I3U A;  1QTM A;  3KKR A;  4FM0 A;  4W5T A;  4AHU A;  2HVI A;  4FLT A;  5FRO A;  3LAM A;  5C24 A;  2DFF A;  4B3O A;  1BI4 A;  4CJ5 A;  3NHG A;  4ZHR A;  2GBZ A;  3O3G A;  2JLE A;  1WSG A;  3ZSQ A;  4Z4F A;  4CHN A;  3K5N A;  2HHT A;  4RW8 A;  2KZM A;  4LSN A;  4GW6 A;  1NKE A;  3HL8 A;  4G1Q A;  1WLJ A;  3NH0 A;  1L3S A;  3TAG A;  4FJI A;  4FJ9 A;  4DLG A;  1RBS A;  4FZY A;  4FXD A;  2HHX A;  1KRP A;  1YVU A;  4O0I A;  3DRR A;  2AJQ A;  4J2E A;  3AVB A;  4NYF A;  1S9G A;  1TKT A;  4CHZ A;  4FLZ A;  4OPJ A;  3IS9 A;  4Q5V A;  1S6P A;  3OYH A;  5KRT A;  3RRG A;  4PY5 A;  2ITG A;  1WSF A;  2VG7 A;  1A5X A;  4DTO A;  1QS4 A;  5T7B A;  2XY6 A;  2YNF A;  2B4J A;  4CFB A;  4DTP A;  3QEI A;  4CEB A;  4FJN A;  2QXF A;  1C1A A;  2OPS A;  4OKE A;  2PYJ A;  4KTQ A;  4FJK A;  2KQ2 A;  4KB0 A;  1XWL A;  3TAM A;  4L8R B;  1NK6 A;  2Z1H A;  3QIO A;  5I42 A;  1HNI A;  2R7Y A;  4CGH A;  1BIU A;  1RT4 A;  1EET A;  1RT6 A;  3OVN A;  4CF8 A;  4CEO A;  4JS4 A;  4FJM A;  4OPK A;  1W9H A;  1RT1 A;  1TL1 A;  4M3R A;  1NK5 A;  1RBR A;  4QOZ B;  3MXI A;  4DSI A;  3ZSV A;  4CK2 A;  4B9S A;  1HRH A;  4DQR A;  1NKB A;  4H4O A;  2ETJ A;  3ZT0 A;  4BDP A;  1BCM A;  2FBT A;  2BDP A;  1KSP A;  3PX4 A;  2P5G A;  1QQC A;  3DOK A;  4LSL A;  1KTQ A;  1CZ9 A;  4CED A;  3EY1 A;  4DU4 A;  1D9F A;  4JRP A;  4FJ5 A;  2HHW A;  1J53 A;  1MU2 A;  3RRH A;  1C6V A;  1FKO A;  4RW7 A;  4N56 A;  4DFK A;  4FJ7 A;  3WNG A;  1XHX A;  1SV5 A;  3MEC A;  4B9L A;  4FJX A;  3OYD A;  2OA8 A;  4C8K A;  3IAY A;  4M3T A;  1ZBI A;  4CJE A;  3T3F A;  3AVN A;  3OYA A;  3QIP A;  1NJY A;  1KVB A;  4Y1C A;  4F3T A;  4O5B A;  4DQP A;  3M8R A;  3SI6 A;  1J9A A;  3HST B;  3S3N A;  2ZQB A;  4RW6 A;  3S3M A;  4CEQ A;  1LAV A;  3LZJ A;  4XIU A;  3KLE A;  1JLQ A;  2F8T A;  4C8M A;  1RT5 A;  4HUF A;  5C42 A;  2DFH A;  3LP0 A;  3CM5 A;  3SUP A;  1RT7 A;  4FJH A;  2KFZ A;  3NF9 A;  3DLK A;  3I0R A;  4Z0U A;  2G8F A;  1RIL A;  3DLE A;  5E41 A;  4DU1 A;  4EZ9 A;  4M3Z A;  1SKR A;  4FK4 A;  4DTN A;  1C1B A;  1ZBL A;  4DSE A;  1WSI A;  2GV9 A;  3DM2 A;  3HK2 A;  3ALY A;  3VQB A;  3VQC A;  2WON A;  1X1P A;  4YNQ A;  3TAR A;  3DLH A;  3HPO A;  4KI4 A;  2HHU A;  2EHG A;  3K5O A;  4DQS A;  4CJL A;  1TKZ A;  1VRT A;  4KFB A;  1X9M A;  1Q8I A;  3LPU A;  3ULD A;  4B9U A;  1JKH A;  2WOM A;  2FC0 A;  3AO4 A;  5HRO A;  1JLE A;  4E7I A;  4AHR A;  2HB5 A;  2O4I A;  1SL1 A;  5KTQ A;  4AHV A;  4DF4 A;  5HBM A;  3C6U A;  4E19 A;  5FRN A;  1WSE A;  3RR8 A;  3CFP A;  4M41 A;  3NAE A;  1RTI A;  4FYD A;  3KK1 A;  2LSN A;  4NYN A;  1EKE A;  3I0S A;  4H4M A;  5CZ2 A;  3L2U A;  1TKX A;  1C0U A;  2HNY A;  2OPR A;  1IKY A;  4LH5 A;  1WAF A;  4LY7 A;  3NCI A;  3F73 A;  1VSL A;  1XC9 A;  1RDA A;  3QET A;  1HYS A;  5CY4 A;  1KVA A;  1YTA A;  3K58 A;  4KTZ A;  4CK1 A;  3LAN A;  1YTU A;  1TK5 A;  4CJ4 A;  3CG7 A;  2HVH A;  2F96 A;  3V6D A;  3MED A;  3TAE A;  1D8Y A;  1CZB A;  1NKC A;  3LAK A;  3QO9 A;  2IS3 A;  3P5J A;  4EP5 A;  1GOB A;  1VK0 A;  4QCL A;  3NBP A;  3B6O A;  3RMD A;  3P1G A;  3SJJ A;  3SCX A;  5HP1 A;  2IC3 A;  2HHQ A;  4FJL A;  3DLR A;  1NJW A;  3CYM A;  1N5Y A;  2ZE2 A;  1XI1 A;  4NCA A;  1JXB A;  4EZ6 A;  3HPH A;  4DS4 A;  1NK4 A;  3M8S A;  5HLF A;  1NK7 A;  5FRM A;  4WE1 A;  2OYQ A;  3SQ1 A;  4CF9 A;  4ID1 A;  3U6F A;  4N41 A;  3K57 A;  4FLU A;  4DSK A;  1RDB A;  4RW4 A;  3LP2 A;  4ELU A;  1HQU A;  2D0C A;  3ASM A;  1NK8 A;  3K5M A;  1WNS A;  3L8B A;  4PUO A;  3ZT2 A;  3DRS A;  4CEA A;  3O4N A;  1X9W A;  2QK9 A;  1SKS A;  3IG1 A;  2D0B A;  4CHO A;  3AVM A;  1B92 A;  4CK3 A;  1I39 A;  3AVL A;  2VWK A;  4OKK A;  4M45 A;  3TAP A;  1FK9 A;  2YHA A;  3VQD A;  2Y1J A;  4DQI A;  3H08 A;  1TVR A;  3M8Q A;  2FBV A;  1EP4 A;  2YHB A;  1JLB A;  4CIF A;  3L2V A;  1KVC A;  2IAJ A;  4BWJ A;  3HJF A;  1RT3 A;  1NK9 A;  4HVJ A;  3EYZ A;  1JXE A;  4CJS A;  4KRE A;  1RDD A;  4CJV A;  3TWH A;  4F2R A;  3AO1 A;  3G10 A;  3NDK A;  4I9Q A;  4FLW A;  3AVK A;  4HCB A;  3LP3 A;  3OYG A;  3KK3 A;  2Q3S A;  1SUQ A;  4OLB A;  3LPT A;  2X6S A;  4ICL A;  3SPZ A;  1BHL A;  3KJV A;  3RMB A;  3UIQ A;  3KLH A;  4CF1 A;  3NGZ A;  3A2F A;  2W42 A;  4DTX A;  1RBV A;  4LH4 A;  3ZT4 A;  1RCH A;  1HJR A;  4DG1 A;  4PWD A;  4E7H A;  1N6Q A;  4E1M A;  3AO5 A;  4CFA A;  1O1W A;  1D5A A;  1TL3 A;  1IKW A;  1GOA A;  3HPG A;  4B8A B;  1J5O A;  4CHQ A;  5KRS A;  2X6N A;  4FVM A;  5FDL A;  4N5S A;  5D3G A;  1KLM A;  3HYF A;  1S1U A;  3CQ8 A;  4DSF A;  4Z4E A;  3TAF A;  1EX4 A;  1LWF A;  5K14 A;  3SUQ A;  3CFR A;  1Z25 A;  4OKJ A;  4OLA A;  3V9U A;  3V4I A;  4FCY A;  4E3S A;  3HP9 A;  3NF7 A;  3SV4 A;  1JL2 A;  3SUO A;  3SZ2 A;  1LV5 A;  4M3X A;  3TR8 A;  1DTQ A;  1K6Y A;  3PX6 A;  1U49 A;  2Z1J A;  4ID5 A;  2A1S A;  2G8V A;  3KKS A;  4ELT A;  3KLG A;  3S3O A;  2YNH A;  2XRI A;  3E01 A;  1C0T A;  3ZSO A;  2E4L A;  3V9S A;  3QEP A;  2XO7 A;  1KLN A;  1D9D A;  1WAJ A;  4FW1 A;  4C8N A;  4DMN A;  3QEW A;  5J2Q A;  4I2Q A;  3NF8 A;  4BE1 A;  5J2N A;  4DQQ A;  4BAC A;  1JLA A;  4CE9 A;  1T05 A;  4FK2 A;  4KHW A;  1F21 A;  4BE0 A;  4CFD A;  1L5U A;  4B9V A;  1S1W A;  5KGX A;  4E7K A;  2B5J A;  2NUB A;  4IG0 A;  4OGC A;  5JS2 A;  4CGI A;  2G8I A;  3AA2 A;  4J2B A;  2FBY A;  4CGD A;  3LWM A;  4FK0 A;  4DU3 A;  2YNI A;  1IKX A;  1DLO A;  4KRF A;  4CHY A;  1VRU A;  3D45 A;  4BE2 A;  4GVM A;  1Z26 A;  3CM6 A;  5CZ1 A;  2PY5 A;  4C8O A;  3MXJ A;  4AH9 A;  3KD1 E;  2I5J A;  3LAL A;  3MEE A;  3QNN A;  4AIL C;  4W5O A;  4MQ3 A;  3L3V A;  3SV3 A;  4CIG A;  3WNH A;  1TK0 A;  3O3F A;  1RT2 A;  1LWE A;  1T8E A;  4FJG A;  3OYB A;  4BDZ A;  1B9F A;  1VSK A;  2HHV A;  3C95 A;  3THV A;  1C0M A;  1KFD A;  3VQ6 A;  4BDY A;  3U3G A;  3BDP A;  2P1J A;  1TKD A;  4Z4I A;  4LD0 A;  4HCC A;  4E7L A;  2XHB A;  2Z1G A;  4AHS A;  1BL3 A;  2BAN A;  4QAG A;  3AVA A;  1VSJ A;  5HRR A;  1R0A A;  1A5V A;  1QHT A;  2OPQ A;  3AA4 A;  3SQ0 A;  1L3V A;  2PYL A;  3KK2 A;  4CCH A;  3QES A;  1BIZ A;  4JLH A;  4CJF A;  1RBT A;  4KTW A;  2KFN A;  3ITH A;  4DTS A;  1RBU A;  5HRS A;  1IG9 A;  2G8U A;  4AHT A;  4IKF A;  2XY7 A;  5SZT A;  1NOZ A;  4R5P A;  3RMC A;  1UA1 A;  3DI6 A;  4F8R A;  4CIE A;  4OJR A;  5SWM A;  3VA0 A;  1CXU A;  3VQ7 A;  4CEE A;  1TAQ A;  2E6L A;  3AO2 A;  3DLB A;  1HMV A;  2P51 A;  3QER A;  1HPZ A;  4Z4H A;  1BQM A;  2HND A;  3AVG A;  3VQA A;  4AHC A;  3L2W A;  1ITG A;  3RMA A;  4M3W A;  3ZSZ A;  4CES A;  4HTU A;  4MFB A;  1U45 A;  1ZBH A;  3HO1 A;  4KO0 A;  1BI4 B;  4CF0 A;  3VA3 A;  4F2S A;  3PUF A;  1VSH A;  1IH7 A;  3NE6 A;  3OYF A;  4DSL A;  3C6T A;  4K8X A;  4CJP A;  3U3Y A;  4FZZ A;  2F8S A;  3K59 A;  3FFI A;  4Z4G A;  3O4Q A;  3OYI A;  4ZTF A;  1SL2 A;  2RF2 A;  3D0P A;  3PO5 A;  4B9T A;  4H8K A;  2QKB A;  3HP6 A;  1BCO A;  1BGX T;  1ASW A;  2O4G A;  3DYA A;  1TV6 A;  1EXQ A;  2X74 A;  3VQ9 A;  1X9S A;  3VQ8 A;  4FLX A;  1KFS A;  3HVR A;  3OS2 A;  4FW2 A;  4IFV A;  3VQP A;  3RTV A;  1REV A;  3OJU A;  1QSS A;  2RN2 A;  2YNG A;  1FKP A;  2OPP A;  3SQ2 A;  1A5W A;  3DLG A;  2D5R A;  4KHS A;  3OS0 A;  1DTT A;  1L3T A;  3LWL A;  4ZTJ A;  4CJW A;  3SYZ A;  3AA3 A;  3QLH A;  3KLF A;  1NJX A;  1ZBU A;  4CEF A;  4Y1D A;  3V1Q A;  3HM9 A;  3NGI A;  3KD5 E;  3T1A A;  1T7P A;  4K8Z A;  1HYZ A;  3ISN C;  3HT3 A;  3AVI A;  3SUN A;  4KI6 A;  2BGG A;  3OYL A;  1T03 A;  1NK0 A;  4C8L A;  4W5N A;  1UAX A;  3OS1 A;  1U04 A;  2RKI A;  3AVJ A;  4OGE A;  4E89 A;  4NCB A;  2YKM A;  3AVC A;  3EZ5 A;  3SNN A;  3TAB A;  3K2P A;  3V1R A;  1SL0 A;  3LZI A;  3AVF A;  5HRP A;  4W5Q A;  3ZSX A;  4DTR A;  4CJT A;  3OYJ A;  3VN5 A;  3V81 A;  1RTD A;  1JLG A;  4UQG A;  4TSX A;  3B6P A;  2FBX A;  2Z1I A;  3ZSY A;  5KGW A;  3K5L A;  1C1C A;  4J2A A;  3LP1 A;  2GUI A;  5J2M A;  5CYM A;  1J54 A;  1RTJ A;  2YV0 X;  4OVL A;  4J2D A;  4F4K A;  2JGU A;  4N47 A;  3WNF A;  4Q0B A;  3OJS A;  1Q9Y A;  4KHU A;  2VG6 A;  1S1V A;  3DRP A;  1QE1 A;  4I9L A;  4DTJ A;  3V1O A;  4KV8 A;  1U48 A;  3PO4 A;  4KB1 A;  1IO2 A;  3NF6 A;  4O55 A;  3MAQ A;  4HUG A;  2HHS A;  4CJR A;  1NJZ A;  4EP4 A;  4DTU A;  3RWU A;  4RW9 A;  4KKO A;  3L2Q A;  1Q9X A;  3OYK A;  4FJJ A;  3AV9 A;  4DWI A;  3VQE A;  1U47 A;  3I8D A;  1YT3 A;  3F9K A;  4B08 A;  3G0Z A;  4DFM A;  4FM2 A;  2OZS A;  2RPI A;  2Y1I A;  1JL1 A;  1S6Q A;  4DTM A;  1ZYQ A;  4YFU A;  4DF8 A;  1FXX A;  4KHQ A;  4FJ8 A;  5J1E A;  4CGF A;  2VG5 A;  2QKK A;  3WNE A;  4DLE A;  4M3Y A;  1TK8 A;  3L2R A;  3PV8 A;  1BQN A;  2XY8 A;  4CF2 A;  1U4B A;  1HNV A;  3M8P A;  4O4G A;  2KZZ A;  4M3U A;  3TAQ A;  4JRQ A;  4DS5 A;  1BIS A;  1WSJ A;  4I2P A;  2XY5 A;  2YKN A;  2HMI A;  4BWM A;  3VQQ A;  3NH2 A;  2P5O A;  2ATQ A;  4CJ3 A;  4O0J A;  3TAN A;  3MXM A;  5J2P A;  4DSJ A;  1ZBF A;  1SKW A;  4KPY A;  3V9X A;  3HXM A;  1S1T A;  3KLI A;  4IG3 A;  3ZCM A;  3T19 A;  3OYM A;  1RDC A;  4RG8 A;  1CXQ A;  2DTU A;  4FLY A;  3DMJ A;  3C94 A;  3PY8 A;  3QIN A;  2HW3 A;  2D0A A;  3NGY A;  4GMJ B;  3JSM A;  4FLV A;  1ASV A;  2G8H A;  1WN7 A;  4CEC A;  4E0D A;  4FM1 A;  2PZS A;  2OZM A;  2A1R A;  1HQE A;  5CYQ A;  1KCF A;  4B8C A;  2DFE A;  3HVT A;  5JS1 A;  5HRN A;  2G8K A;  1IKV A;  1ASU A;  3VQ4 A;  3TI0 A;  3MEG A;  4PA1 A;  4Z4C A;  3O3H A;  1NOY A;  3SPY A;  4M42 A;  1B9D A;  2IGI A;  2IDO A;  1S1X A;  4CJK A;  1VSE A;  3NH1 A;  1LAW A;  3DOL A;  4IFY A;  4JS5 A;  4CFC A;  1UA0 A;  4FZX C;  1W0H A;  1CLQ A;  3V9Z A;  2IOC A;  3AO3 A;  3JYT A;  4PQU A;  2G8W A;  4I7F A;  4CGJ A;  1TAU A;  1QSL A;  3PX0 A;  5C25 A;  4HHT A;  1JLF A;  3L3U A;  3OYN A;  4KHY A;  3ZSR A;  1XHZ A;  1S5J A;  4NCG A;  3OYC A;  2HNZ A;  4CJQ A;  3P83 D;  4IBN A;  4CJU A;  1Y97 A;  1G15 A;  1LW2 A;  1GOC A;  1RNH A;  1VSI A;  2X78 A;  4IDK A;  4DFP A;  3CFO A;  4DFJ A;  4CHP A;  3KTQ A;  4ELV A;  3QNO A;  2KTQ A;  4KAZ A;  3ZT3 A;  1LW0 A;  4O44 A; 
#chains in the Genus database with same CATH topology
 3LDS A;  1JLC A;  3VQ5 A;  3DXM B;  1NGD A;  3G71 N;  1TGO A;  4JK8 A;  5AR0 A;  3C7N B;  4HUE A;  3UKR A;  3P38 A;  3NVK A;  2KW4 A;  3ZT1 A;  3S9H A;  2ZD1 A;  4K0K K;  4FPA A;  4WFN L;  1VSF A;  1HYV A;  1K8K A;  3ZSW A;  3ULE B;  4W5T A;  5FRO A;  5C24 A;  4B3O A;  1BI4 A;  3NHG A;  2E8A A;  4C1N K;  4ZHR A;  3J81 O;  2JLE A;  4MDB A;  3L0Q A;  4CHN A;  3D2F B;  1NGB A;  3FZL A;  4K43 A;  4DLG A;  4YOY A;  4O0I A;  1LCU A;  3AVB A;  3EKS A;  1S9G A;  1TKT A;  4NYF A;  4DQ8 A;  5AQG A;  4OPJ A;  3IS9 A;  4Q5V A;  3OYH A;  2VG7 A;  4H0V B;  5T7B A;  4CFB A;  3QEI A;  2FSJ A;  2QXF A;  2PYJ A;  4IO8 A;  4R79 A;  4FJK A;  1W7A A;  2KQ2 A;  4KB0 A;  5I42 A;  3O5B A;  1NMD A;  5C2D A;  4JD2 A;  4CF8 A;  3CF5 L;  3CC7 N;  4M3R A;  2D1K A;  1NK5 A;  2V52 B;  3ZSV A;  2P9I A;  3NVM A;  4CK2 A;  4LC9 B;  4H4O A;  2W6L A;  2FBT A;  1QQC A;  2ZWH A;  4KH6 A;  3LDN A;  1KTQ A;  3EY1 A;  4FJ5 A;  4JRP A;  1YVN A;  1KAX A;  3CQY A;  4H0Y B;  4RW7 A;  4DFK A;  2O8F B;  1YAG A;  4GV9 A;  1SV5 A;  4B9L A;  4FL9 A;  5BR8 K;  1ZBI A;  4F3T A;  4IO9 L;  4DQP A;  2HST A;  4X65 K;  1J9A A;  5KQD A;  3M8R A;  2ZQB A;  3S3M A;  3KVG A;  3KLE A;  3PIO L;  2DFH A;  3LP0 A;  2O8D A;  3Q7B A;  1S22 A;  4UY8 O;  3R1X A;  3HOS A;  4CZE A;  3ALY A;  3VQB A;  3EL2 A;  3TAR A;  3DLH A;  2P9L A;  4BG9 A;  3K5O A;  2E1Z A;  4CJL A;  1GLL O;  1X9M A;  3LPU A;  5HRO A;  4BRP A;  1E4G T;  3RSE A;  5HBM A;  3C6U A;  3CET A;  1XUP O;  1WSE A;  3CER A;  4Y0W A;  4M41 A;  4BG8 A;  3E1Y A;  5BRH A;  2LSN A;  4NYN A;  5KQ8 A;  3VEV A;  3L2U A;  1VQ8 N;  1VQL N;  4LY7 A;  2V51 B;  1WAF A;  5BRF A;  3LDQ A;  3NCI A;  1HYS A;  3QET A;  1YTA A;  2P9P B;  1NG9 A;  2EWS A;  1CZB A;  3O08 A;  3CCS N;  3EZW A;  3J7Y P;  2GEM A;  4DUY K;  2ZGZ A;  4EP5 A;  2P9N B;  1GOB A;  1HNW K;  3NBP A;  4DV2 K;  1NGJ A;  4BC4 A;  3RMD A;  3T1H K;  4JI2 K;  4RTF D;  3SJJ A;  5HP1 A;  4B1Z A;  1EQY A;  2YHX A;  3AGR A;  5GAH P;  5AQU A;  3I56 N;  1NK4 A;  2P9S B;  2GWJ A;  2OYQ A;  1YHQ N;  3SQ1 A;  4GV3 A;  4IJN A;  3U6F A;  4BRQ A;  1CZA N;  3QFU A;  1HQU A;  2D0C A;  3ASM A;  4O8K A;  3VET A;  3QIC A;  1WNS A;  3L8B A;  3DRS A;  2QK9 A;  1X9W A;  2UU9 K;  3O4W A;  4FSV A;  3PLA A;  4M45 A;  2VWK A;  2Y1J A;  2YHA A;  3BZC A;  2FBV A;  4CIF A;  1KVC A;  4JHD B;  3HJF A;  1RT3 A;  1NK9 A;  4BRL A;  4KH5 A;  4CJS A;  1RDD A;  4F2R A;  3AO1 A;  4A59 A;  4HCB A;  5H1S Q;  4BRG A;  3RMB A;  1HJO A;  3NGZ A;  2W42 A;  4DTX A;  3ZEU A;  1RCH A;  1HJR A;  4GVE A;  1FW6 A;  5JVG L;  2GTD A;  2UXB K;  4CFA A;  3AO5 A;  3GE1 A;  4BRD A;  5LMU K;  1J5O A;  5KRS A;  4M7X A;  2O8C B;  3O1W A;  4FVM A;  4Z4E A;  4FO0 A;  4IOC L;  2JWK A;  5K14 A;  2F4V K;  3L4I A;  3V9U A;  4FWL A;  4DV0 K;  1N33 K;  3SZ2 A;  3MWP A;  1NU0 A;  4CI6 A;  1U49 A;  2A1S A;  2HBK A;  4AM7 A;  3S3O A;  3V9S A;  5BRE A;  2UUC K;  2XO7 A;  4BR7 A;  1WAJ A;  3NF8 A;  2J4R A;  1X3N A;  1JLA A;  3WXI A;  1T05 A;  4KHW A;  1F21 A;  4DCH A;  2NUB A;  5JS2 A;  2G8I A;  4JI7 K;  3AA2 A;  4JKC A;  2BTF A;  5CZ1 A;  3MXJ A;  1DEJ A;  3KD1 E;  3LAL A;  3QNN A;  4AIL C;  4W5O A;  3U9Z A;  4MQ3 A;  3QFP A;  3SV3 A;  1T8E A;  2ITM A;  4BR2 A;  3DAW A;  3THV A;  5AQF A;  1C0M A;  1M90 O;  4AM6 A;  2P1J A;  3MK6 A;  4JV5 K;  4LD0 A;  2XHB A;  2Z1G A;  2BH1 A;  1A5V A;  4MLH A;  3SQ0 A;  2YHW A;  4CJF A;  3UKU A;  2HHH K;  5HRS A;  3D2E A;  1IG9 A;  4M63 C;  4PL7 A;  4BRH A;  2HBJ A;  4OJR A;  1BUP A;  3VQ7 A;  1TAQ A;  3DLB A;  1HMV A;  1Q86 O;  4LF4 K;  2A41 A;  3H46 O;  3EEQ A;  1HPZ A;  3VQA A;  4LF5 K;  3ATU A;  1ATR A;  1ZBH A;  2O8B A;  3EO3 A;  4CF0 A;  1HR0 K;  2UYT A;  4MDA A;  3OYF A;  3CJ7 A;  4Z4G A;  3O4Q A;  4ZTF A;  2FSN A;  2YCH A;  3N4P A;  3DYA A;  3CC4 N;  3SAF A;  1WBD A;  2WFB A;  4FW2 A;  3T1Y K;  1P8Z A;  3VQP A;  1GLJ O;  2FXU A;  3ZX2 A;  3CJ1 A;  1QSS A;  3SQ2 A;  2OPP A;  2D5R A;  4ISE A;  3CPE A;  1L3T A;  3SAG A;  3LWL A;  4CZF A;  3UE5 A;  3AA3 A;  3KLF A;  1Q81 O;  1ZBU A;  3V1Q A;  2OCE A;  2BGG A;  5AQZ A;  3HT3 A;  1T03 A;  4XH1 A;  5CE3 A;  4BQZ A;  1U04 A;  4E89 A;  4OGE A;  5GAG P;  3DWL A;  2YKM A;  3EZ5 A;  1S3X A;  3TAB A;  5HRP A;  2NLX A;  3U8X A;  4BC2 A;  1W97 L;  3VGK A;  1ZC6 A;  1JLG A;  3B6P A;  2Z1I A;  4Z94 A;  5LY3 A;  5E26 A;  2GUI A;  4X62 K;  5J2M A;  5CYM A;  4N47 A;  4KHU A;  3DRP A;  1QE1 A;  4DTJ A;  4CZK A;  4B1W B;  4CJR A;  1NJZ A;  4EP4 A;  3WXJ A;  4H5W A;  3PSI A;  4KKO A;  4FJJ A;  3OYK A;  4DWI A;  1YT3 A;  3L6Q A;  3G0Z A;  2FF6 A;  3EE8 A;  4JI8 K;  4YFU A;  1FXX A;  3WQU A;  2VG5 A;  3WXK A;  1TK8 A;  3L2R A;  1ZBS A;  4X64 K;  2NRV A;  4JNE A;  3M8P A;  1OH5 A;  4PKI A;  2OTL N;  4DS5 A;  2QI2 A;  5JIC A;  2HMI A;  2P9L B;  3VQQ A;  1Y64 A;  2P5O A;  4O0J A;  3TAN A;  1ZBF A;  3TTD A;  5GIN A;  3KLI A;  2HF4 A;  4IG3 A;  4DHY A;  5BN8 A;  3T19 A;  3P4I A;  4RG8 A;  4FLY A;  1KD1 O;  3PY8 A;  3QIN A;  4CD1 A;  2D0A A;  4FLV A;  1T6C A;  4BRE A;  4CEC A;  4IXC A;  2A1R A;  1HQE A;  4ILJ A;  5DM7 L;  3VGL A;  2G8K A;  3VQ4 A;  3VF2 A;  3MEG A;  4PA1 A;  4Z4C A;  1NOY A;  2IDO A;  4PKH A;  3H1V X;  3NH1 A;  3IDH A;  4IFY A;  1RDU A;  1IG8 A;  1UA0 A;  1KC8 O;  1W0H A;  3V9Z A;  3AO3 A;  4PQU A;  4IFE A;  3O9R A;  1BA1 A;  2E2Q A;  4I7F A;  1TAU A;  1JLF A;  2A6A A;  3L3U A;  4CBW A;  4IBN A;  1RNH A;  4DFJ A;  1EO1 A;  4G9Z A;  2H3G X;  1VSM A;  1S9E A;  5KI6 A;  3V9W A;  4F3O A;  3SQ4 A;  4E7J A;  3AA5 X;  5ELZ A;  2IVN A;  3E66 A;  4RWT A;  1QSY A;  1WSH A;  3OY9 A;  2Q2R A;  5DMR A;  1NWK A;  4DV4 K;  1M1K O;  3FFK B;  2V7Z A;  1L3U A;  4BRC A;  2VCP A;  4K25 A;  4BGB A;  3O1B A;  1NGF A;  4BGA A;  3LAM A;  2Q0U A;  1IJJ A;  4CJ5 A;  3K0S A;  2GBZ A;  4GKK K;  5MLC Q;  3WUH A;  3SK3 A;  1V4S A;  1YXQ A;  3HI0 A;  3HRG A;  4FJI A;  1YVU A;  2E5L K;  4YOU A;  3RRG A;  5KRT A;  4PY5 A;  2B4J A;  4JYA K;  3LDL A;  4CEB A;  4OKE A;  5AQH A;  5KPR A;  4L3Q A;  4BRM A;  1NK6 A;  1QQN A;  3QIO A;  5C12 A;  2R7Y A;  4CGH A;  1BIU A;  4JS4 A;  4CEO A;  1W9H A;  1Q18 A;  1TL1 A;  1MDU B;  1RBR A;  1T6D A;  1TYQ A;  2QTD A;  3MXI A;  4B9S A;  1HRH A;  5AZI A;  2ETJ A;  3CCU N;  4BDP A;  5AQJ A;  3PX4 A;  3DOK A;  4I6M A;  4LSL A;  1CZ9 A;  3HM8 A;  1D9F A;  2Q0R A;  3CQX A;  3CMA N;  3O9Q A;  1FKO A;  3N4Q A;  4C8K A;  3WXL A;  3T3F A;  3AAQ A;  3ZEU B;  3JXU A;  4RW6 A;  3S3N A;  3VF6 A;  5EX5 A;  4C8M A;  5LMN K;  3ULE A;  4HUF A;  4BRA A;  4B1V A;  3CM5 A;  4BRF A;  2G8F A;  4DU1 A;  3M6G A;  2VQF K;  1YIT N;  4FK4 A;  1C1B A;  3HK2 A;  1WSI A;  4YNQ A;  3C6A A;  4AF1 A;  1TKZ A;  4KFB A;  4IWV A;  1Q8I A;  4V19 S;  4YOV A;  2WOM A;  1QZ6 A;  4JKD A;  4E7I A;  2HB5 A;  1BG3 A;  3CIP A;  4E19 A;  5LJV A;  5FRN A;  4QS7 A;  1RTI A;  4LF6 K;  1EKE A;  5CZ2 A;  4PHT X;  4CVN E;  1IKY A;  1XC9 A;  2GX9 A;  3F73 A;  1RDA A;  3E9O A;  5CY4 A;  5C10 A;  4CK1 A;  3LAN A;  1KXP A;  3H1Q A;  4MO4 A;  3CG7 A;  2HVH A;  4CJ7 A;  3TAE A;  4NO7 A;  4KH4 A;  2QWR A;  5GAE P;  2P9U B;  3SCX A;  3H3N O;  3DLR A;  2P9U A;  3UKU B;  1JXB A;  4EZ6 A;  3M8S A;  3VEY A;  5AQT A;  4EFH A;  4CF9 A;  3WQT A;  3VF4 A;  4BRO A;  3CCE N;  4FOI A;  4RW4 A;  3LP2 A;  4ELU A;  1NK8 A;  3K5M A;  3E9P A;  4CEA A;  3M3Z A;  3IG1 A;  2D0B A;  5F0X A;  1B92 A;  4CK3 A;  2O8D B;  4OKK A;  3H08 A;  2ZJP L;  3TPQ A;  1JLB A;  3JAM O;  3IMX A;  4HVJ A;  3EYZ A;  1X3M A;  4CJV A;  3TWH A;  1WUA A;  1J5E K;  3LP3 A;  1QQO A;  1K8A O;  4ICL A;  1NJI O;  3CJA A;  3JS6 A;  1RBV A;  4LH4 A;  1HKG A;  2FSK A;  2HOE A;  3LM9 A;  1IV0 A;  4H5N A;  3HPG A;  1SZ2 A;  4OPA A;  1VQ7 N;  4FWR A;  4N5S A;  5D3G A;  1S1U A;  1EX4 A;  3AAR A;  3SUQ A;  4OKJ A;  1U2V B;  3M5R A;  4CBX A;  4OLA A;  4E3S A;  5GAD P;  3SV4 A;  1JL2 A;  1DTQ A;  4FPB A;  3KLG A;  5CR4 A;  2XRI A;  2E4L A;  5BN9 A;  1IBM K;  4I2Q A;  4JKG B;  4BAC A;  1HX1 A;  3HTV A;  4CFD A;  3BUZ B;  5KGX A;  4E7K A;  4I6M B;  4CGD A;  3LWM A;  4BE2 A;  4GVM A;  3CM6 A;  2NRZ A;  5AZJ B;  3MEE A;  5BR9 A;  4FJG A;  3O3F A;  1DKG D;  1LWE A;  1RT2 A;  5TKW A;  1R59 O;  3CCR N;  1B9F A;  1BOT O;  4Z4I A;  3J7Z O;  3Q7C A;  2BAN A;  5HRR A;  1R0A A;  2OPQ A;  3AA4 A;  2WC9 A;  2KFN A;  4KTW A;  3H3O B;  4DR1 K;  1RBU A;  4DV5 K;  2G8U A;  4IKF A;  4AHT A;  3E9L A;  5SZT A;  1NOZ A;  4R5P A;  3RMC A;  3ZX3 A;  4CIE A;  5BPM A;  2UUB K;  1CXU A;  5AQM A;  3AO2 A;  3RSE B;  3AVG A;  4AHC A;  3L2W A;  3RMA A;  4M3W A;  3ZSZ A;  4CES A;  1U45 A;  4KO0 A;  3MMV A;  3G25 A;  1NBW A;  5CHI A;  3NE6 A;  4DSL A;  3C6T A;  4K8X A;  4H0T B;  4A57 A;  3U3Y A;  3K59 A;  3PO5 A;  3OYI A;  4B9T A;  1BGX T;  4H5V A;  1EXQ A;  2X74 A;  3VQ8 A;  3HVR A;  1NNE A;  3OS2 A;  5AQX A;  4IFV A;  1EWR A;  2RN2 A;  1FKP A;  3DLG A;  3OS0 A;  4CJW A;  1NJX A;  4CEF A;  4Y1D A;  3HM9 A;  3NGI A;  1T7P A;  4K8Z A;  4B9Q A;  2CH6 A;  2GEL A;  1UAX A;  4NCB A;  3AVC A;  2BUP A;  3AVF A;  1LOT B;  3FZM A;  3I55 N;  3OYJ A;  4NXM K;  4NLB A;  3K5L A;  3LP1 A;  4XEI A;  4O5F A;  1H1V A;  4BR9 A;  3DXM A;  1J54 A;  1ESV A;  1KAY A;  3WNF A;  1Q9Y A;  2ZJQ L;  1GLA G;  3V1O A;  4KV8 A;  3PO4 A;  1IO2 A;  4O55 A;  5AQP A;  4CZH A;  3FZH A;  5AQI A;  1ATS A;  4RW9 A;  3OBY A;  2YI1 A;  3L2Q A;  1VQK N;  1K8K B;  3SLC A;  3ATV A;  3HSC A;  3RVC A;  3F9K A;  4B08 A;  3I8D A;  5HL7 L;  1YJ9 N;  3SBG A;  1NGC A;  4DF8 A;  4KHQ A;  4FJ8 A;  4CGF A;  4FWK A;  4M3Y A;  4C23 A;  1VQN N;  2XY8 A;  2IVP A;  4A5B A;  4O4G A;  2XY5 A;  2F9W A;  1OH8 A;  2WUS A;  4BWM A;  1DT9 A;  5IT9 O;  1SKW A;  2ASO A;  3HXM A;  5FLX O;  3ZCM A;  4FVU A;  1RDC A;  2O8E B;  1OH7 A;  3OBW A;  5JLF A;  3C94 A;  3D7E O;  3NGY A;  4GMJ B;  3JSM A;  3F2K A;  2G8H A;  4OO1 J;  1WN7 A;  1ATN A;  4FM1 A;  1QVF M;  2DFE A;  5HRN A;  1YJN N;  3TI0 A;  3FE1 A;  3O3H A;  5FPD A;  3CPW M;  1VSE A;  4FOE A;  5ADX A;  1LAW A;  1DGK N;  2UXD K;  1TYQ B;  1GLB G;  2IOC A;  1I94 K;  4DR7 K;  1QSL A;  1XHZ A;  3GBT A;  1S5J A;  4B1U B;  2HNZ A;  3P83 D;  4LFA K;  4AQY K;  1Y97 A;  1G15 A;  1NLV A;  4NCA A;  2X78 A;  4IDK A;  3CFO A;  5BPN A;  3QNO A;  1E4F T;  3ZX0 A;  2F7T A;  4IG0 A;  1LW0 A;  3BZK A;  4KBO A;  2BE2 A;  4DB3 A;  5EVZ A;  1SQK A;  4CZL A;  3OYE A;  3NFA A;  4B9N A;  4PKG A;  5DK5 A;  4W5R A;  2HBL A;  4B9M A;  4CGG A;  2W41 A;  4FWP A;  4CEZ A;  4U7B A;  3RR7 A;  1OVQ A;  4KHN A;  5I3U A;  1QTM A;  3GOI A;  3THY A;  4MO5 A;  3KKR A;  4AHU A;  2HVI A;  4FLT A;  3C6H A;  2DFF A;  3PIP L;  3H6E A;  3O3G A;  3C65 A;  1WSG A;  3ZSQ A;  4Z4F A;  3K5N A;  4RW8 A;  4GW6 A;  3HL8 A;  1WLJ A;  2YHY A;  3NH0 A;  4JI1 K;  3TAG A;  2P9I B;  1RBS A;  3CXC M;  5AFU A;  4FZY A;  3WEE B;  2RE2 A;  1KRP A;  2HHX A;  1U6Z A;  3B8A X;  1XQS C;  4CHZ A;  1MWM A;  3BF3 A;  2ITG A;  1A5X A;  4DTO A;  3I33 A;  2XY6 A;  1C1A A;  2OPS A;  4GY2 B;  4PL8 A;  4KTQ A;  3FGU A;  3THW B;  2YJE A;  3SMS A;  1YI2 N;  2HMP A;  2Z1H A;  3VEN A;  1HNI A;  1VHX A;  2P9P A;  1RT4 A;  3OVN A;  1EET A;  4FJM A;  1NGG A;  1RFQ A;  4QOZ B;  4DSI A;  3R8E A;  4DQR A;  1NKB A;  1SS6 A;  1HNX K;  4XH4 A;  1IBK K;  3P39 A;  4A62 A;  2P5G A;  1VQ9 N;  4BR5 A;  3THX B;  3CD6 N;  2HHW A;  1MU2 A;  3F5T A;  4FJ7 A;  3KZB A;  4JKF A;  1XHX A;  3AGK A;  4FJX A;  2OA8 A;  5AQW A;  3H45 C;  2ZF5 O;  3IAY A;  4CJE A;  1NJY A;  3QIP A;  4Y1C A;  3HST B;  3C7N A;  4CEQ A;  1LAV A;  5C2F A;  2QWM A;  1JLQ A;  2F8T A;  1RT5 A;  1T44 A;  2AA4 A;  3PSF A;  5C42 A;  5LL6 Z;  4M7Y A;  3SUP A;  5KPZ A;  1RT7 A;  4OPH A;  4BR0 A;  3DLK A;  3I0R A;  3WXM B;  4M3Z A;  1T3V A;  3DLE A;  3BP8 A;  1SKR A;  3S41 A;  4DTN A;  3DM2 A;  4JEP A;  2KFZ A;  3HPO A;  3CI5 A;  2CGJ A;  3ULD A;  3MN7 A;  4LF8 K;  4MLE A;  3AO4 A;  4EHU A;  5FPM A;  1JLE A;  1JCG A;  4AHR A;  2O4I A;  1SL1 A;  4DV6 K;  5KTQ A;  3VMF B;  3ENB A;  4AHV A;  4DF4 A;  4WQ4 A;  3W0L A;  2Q31 A;  4WCE L;  3I0S A;  1TKX A;  1C0U A;  3M1F A;  4LH5 A;  1KVA A;  3K58 A;  4KTZ A;  3T69 A;  1RDW X;  2NRR A;  2WTU A;  1YTU A;  2Q97 A;  4JK9 A;  4CJ4 A;  1J6Z A;  3V6D A;  3MED A;  4B3S K;  5AQN A;  1NKC A;  2QWQ A;  4KHP K;  2A3Z A;  3IKM A;  3P5J A;  4QCL A;  1VAZ A;  5AJ3 K;  3B6O A;  3P1G A;  2IC3 A;  2HHQ A;  4FJL A;  1NJW A;  3LDO A;  3CYM A;  1N5Y A;  3HPH A;  4WE1 A;  3J80 O;  4ID1 A;  4N41 A;  5A2Q O;  3K57 A;  4FLU A;  3THW A;  4DSK A;  1RDB A;  2HF3 A;  2A5X A;  4JKA A;  4PUO A;  4BRI A;  1SAZ A;  1SKS A;  4CHO A;  1I39 A;  3TAP A;  4B1X B;  4EIA A;  4DQI A;  1YF5 L;  1TVR A;  3QDK A;  3M8Q A;  3J7A P;  2IAJ A;  1V4T A;  1JXE A;  1MA9 B;  4KRE A;  3G10 A;  4I9Q A;  4FLW A;  3AVK A;  4DV1 K;  3MCA B;  3OYG A;  3A5O C;  3LPT A;  1BHL A;  3SBT A;  3WEE A;  3UIQ A;  3UKR B;  3A2F A;  4PWD A;  4DG1 A;  4YDU C;  4E1M A;  3F9M A;  3TTC A;  1O1W A;  1TUY A;  1GOA A;  4CHQ A;  5JMV A;  2X6N A;  2KKZ A;  3HYF A;  1GLD G;  4DSF A;  3EKU A;  4DR6 K;  3KWG A;  1LWF A;  3V4I A;  4FCY A;  3HP9 A;  3NF7 A;  1LV5 A;  3TR8 A;  3VEZ A;  2AP1 A;  2Z1J A;  4ID5 A;  1BWF O;  5M1P A;  3LDP A;  4BY9 C;  3KKS A;  1HNZ K;  3E01 A;  3ZSO A;  3KWI A;  1KAZ A;  1D9D A;  4C8N A;  3QEW A;  2E2N A;  1YUW A;  1XNQ K;  4DQQ A;  1XNR K;  3LM2 A;  4FK2 A;  1QZ5 A;  4WYB A;  3OA9 A;  5F1X A;  4BE0 A;  1BU6 O;  4CGI A;  2FBY A;  4FK0 A;  4DU3 A;  2YNI A;  4DV3 K;  4KRF A;  4GV6 A;  1VRU A;  5EXW A;  1Z26 A;  4B3R K;  4AH9 A;  2I5J A;  4GNI A;  4YDU A;  1D4X A;  4IEE A;  4CIG A;  1NGI A;  3QBW A;  1HPM A;  2NRX A;  4QS8 A;  4YOR A;  3VQ6 A;  3U3G A;  3BDP A;  2IVO A;  2QWP A;  3SJH A;  4E7L A;  4HCC A;  1BL3 A;  3EN9 A;  4QAG A;  1VSJ A;  3W3D A;  3QML A;  2PYL A;  3KK2 A;  4CCH A;  3QES A;  1BIZ A;  1RBT A;  3GL1 A;  4H5R A;  4DTS A;  4FWQ A;  3FLC O;  2PAV A;  2XY7 A;  1NGH A;  1NGA A;  5GIP A;  1UA1 A;  5SWM A;  4JAX A;  4CEE A;  4YOX A;  3O80 A;  4BC5 A;  4Z4H A;  4A5A A;  3HO1 A;  3THY B;  5AQR A;  3VA3 A;  1U2V A;  3PUF A;  4EHT A;  3CME N;  1VSH A;  3UB5 A;  1Z6R A;  4CJP A;  2F8S A;  3VEO A;  1SL2 A;  4H8K A;  1VQM N;  1ASW A;  1TV6 A;  2VGM A;  5AQY A;  4FLX A;  3OJU A;  4JI5 K;  3P31 A;  4FWO A;  1DTT A;  4JKE A;  2DPN A;  4JI4 K;  2HBM A;  4J8F A;  2QEX N;  1NGE A;  3T1A A;  3O9U A;  4JD2 B;  3SUN A;  3AVI A;  4W5N A;  3OYL A;  1NK0 A;  3OS1 A;  2JWL A;  4FWS A;  3O6W A;  3OTO K;  3V1R A;  2P9K B;  3LZI A;  2NNW A;  4W5Q A;  3ZSX A;  4CJT A;  3VN5 A;  1RTD A;  5KPT A;  4UQG A;  3DLL L;  3TSP A;  3ZSY A;  4QS9 A;  2P9N A;  4BVP A;  3ZET A;  1OH6 A;  1OKJ A;  3L4Q A;  4DR2 K;  4F4K A;  2JGU A;  4Q0B A;  4WQ5 C;  3OJS A;  2VG6 A;  1S1V A;  3D2E B;  4I9L A;  1U48 A;  4JI6 K;  2HHS A;  1Q7Y O;  4DTU A;  5AQK A;  4B1Y B;  4JK7 A;  4FWM A;  3VQE A;  3VGM A;  1U47 A;  2IIR A;  1VQ5 N;  4FM2 A;  2OZS A;  2Y1I A;  1S6Q A;  4DTM A;  1ZYQ A;  3VER A;  5J1E A;  3WNE A;  4DLE A;  3SMP A;  3PV8 A;  1O13 A;  1BQN A;  4JHD A;  1U4B A;  3O8M A;  1Z05 A;  1BIS A;  1WSJ A;  4I2P A;  3NH2 A;  4WQ4 C;  3QB0 A;  4CJ3 A;  3MXM A;  5J2P A;  4DSJ A;  4KPY A;  4IEI A;  1S1T A;  4H0P A;  3ID8 A;  2WBN A;  2V7Y A;  2DTU A;  3THX A;  1ASV A;  4JKG A;  4JI0 K;  3MX2 A;  4HTL A;  4WF9 L;  1GLC G;  5CYQ A;  5AQQ A;  3HVT A;  5JS1 A;  3MWT A;  1ASU A;  3AAP A;  4M42 A;  1NMN A;  3EE9 A;  2IGI A;  1S1X A;  4H0O A;  3DOL A;  4CFC A;  1JJ2 M;  4CBU A;  5AZJ A;  3AY9 A;  3TU5 A;  3MN6 A;  3CJB A;  4K41 A;  4OX9 K;  5C25 A;  4BR4 A;  3ZSR A;  4NCG A;  3BEX A;  1ILY A;  4CJU A;  1VSI A;  4DFP A;  3KTQ A;  1GLE G;  1C0G A;  3MN5 A;  2P9S A;  4BRN A;  2KTQ A;  4KAZ A;  3ZT3 A;  3WNH A;  3BGR A;  2EX3 A;  3CHW A;  1BA0 A;  4WFA L;  3QEX A;  4CER A;  1UOC A;  2FF3 B;  4N76 A;  3A8Y A;  1N32 K;  2VWJ A;  1RTH A;  1S72 N;  3CCV N;  2E6M A;  4CZM A;  1JCE A;  3QBX A;  3IRX A;  4K42 A;  3AVH A;  3KIO A;  2Q1N A;  1VSD A;  4E1N A;  2DY4 A;  3QEV A;  3NMU A;  1LWC A;  5EU7 A;  1I3A A;  1UWB A;  4CZJ A;  3GG4 A;  3G6E N;  3KHY A;  3ID6 A;  2B6A A;  3A0I X;  4YHH K;  3DJC A;  4FM0 A;  3TTF A;  2CGK A;  2HHT A;  2KZM A;  2GWK A;  4LSN A;  1NKE A;  3MN9 A;  1BO5 O;  4G1Q A;  1L3S A;  3BY5 A;  4LFC K;  4F9O A;  1X9J A;  4FJ9 A;  4FXD A;  1BDG A;  5BPL A;  2VWB A;  3MDQ A;  3DRR A;  2AJQ A;  4J2E A;  4FLZ A;  1S6P A;  4NXN K;  1WSF A;  2ASP A;  1QS4 A;  5EY4 A;  2D0P A;  2YNF A;  4CZI A;  4DTP A;  4FJN A;  4E1J A;  4BC3 A;  4YY3 K;  1WB9 A;  1XWL A;  3TAM A;  4L8R B;  4HWI A;  3R3L A;  3ZYY X;  1RT6 A;  4OPK A;  1RT1 A;  2ZJR L;  4LF9 K;  2QWO A;  5M1N A;  3VEW A;  3ZT0 A;  1BCM A;  2BDP A;  1KSP A;  3VES A;  4CED A;  4DU4 A;  3CCL N;  1XMO K;  1J53 A;  3RRH A;  5LJW A;  1C6V A;  4N56 A;  4JKH A;  4U67 L;  3WNG A;  3MEC A;  3OYD A;  4M3T A;  3BF1 A;  3R6M A;  3AVN A;  3OYA A;  1KVB A;  4O5B A;  1P90 A;  3SI6 A;  2GUP A;  3G4S N;  3LZJ A;  4XIU A;  1QQM A;  4LFB K;  1YIJ N;  4FJH A;  3NF9 A;  3IUC A;  4Z0U A;  3VPZ A;  2YX6 A;  2E88 A;  5M1F A;  1RIL A;  3VEX A;  5E41 A;  3CCQ N;  4EZ9 A;  1ZBL A;  4DSE A;  2GV9 A;  2E2O A;  3VQC A;  2WON A;  1X1P A;  2HHU A;  2ASM A;  4KI4 A;  2EHG A;  2UUA K;  4DQS A;  3VTI A;  1VRT A;  4B9U A;  1JKH A;  2FC0 A;  1HKC A;  2F9T A;  3CFP A;  4YOW A;  3NAE A;  4FYD A;  3KK1 A;  3O9T A;  3U4L A;  4H4M A;  5C15 A;  1VQ6 N;  4IOX A;  2HNY A;  2OPR A;  3RR8 A;  1XC3 A;  1EWQ A;  1VSL A;  3FZK A;  5AFU H;  5FPE A;  1YJW N;  4CD3 A;  1E3M A;  3I8B A;  4BQL A;  1TK5 A;  2F96 A;  1D8Y A;  2VGN A;  3LAK A;  3QO9 A;  2VYP A;  2IS3 A;  3VOV A;  1VK0 A;  3SAH A;  4DR4 K;  2A42 A;  3HBT A;  2W6K A;  3HOT A;  2ZE2 A;  1XI1 A;  4DS4 A;  2OTJ N;  2E2P A;  4BRK A;  5HLF A;  1NK7 A;  5FRM A;  3T7Z A;  4WFB L;  4WQ5 A;  2QWL A;  3ZT2 A;  5E84 A;  5ADX H;  1QHA A;  2CH5 A;  1N34 K;  3O4N A;  5IWA K;  2P9K A;  5M1Q A;  3AVM A;  1GLF O;  3AVL A;  4JKB A;  2NRW A;  4B3M K;  1FK9 A;  3VQD A;  3DXK B;  5AQV A;  1KQS M;  3O9S A;  2NZT A;  1EP4 A;  2YHB A;  3D6R A;  3L2V A;  4BWJ A;  1HLU A;  4H0X B;  2NRT A;  3NDK A;  3KK3 A;  1WBB A;  2Q3S A;  1SUQ A;  4OLB A;  1OVY A;  2X6S A;  3U9D A;  5GIO A;  5B8H A;  3KJV A;  3SPZ A;  3HZ6 A;  4CF1 A;  3KLH A;  3CJ9 A;  2PFU A;  3ZT4 A;  4X66 K;  4E7H A;  1N6Q A;  1WOQ A;  2E20 A;  1D5A A;  4JN4 A;  5JLH A;  1TL3 A;  1IKW A;  3C0B A;  4B8A B;  3K9K A;  3R9P A;  5FDL A;  4FWN A;  1KLM A;  3CQ8 A;  3TAF A;  2VQE K;  3CFR A;  1Z25 A;  4ISF A;  3ENH A;  3SUO A;  4M3X A;  2UXC K;  1K6Y A;  3PX6 A;  2D0O A;  1G99 A;  2G8V A;  3CCM N;  2QWN A;  4ELT A;  2YNH A;  1KLN A;  1C0T A;  5AQO A;  1HKB A;  3QEP A;  4FW1 A;  4DMN A;  5J2Q A;  4BE1 A;  5J2N A;  1XMQ K;  4CE9 A;  1VQ4 N;  2CGL A;  2D4W A;  1L5U A;  2PBD A;  1S1W A;  1N36 K;  4B9V A;  2B5J A;  4OGC A;  1MWK A;  4J2B A;  1IKX A;  1DLO A;  2E1Y A;  4CHY A;  3D45 A;  1K73 O;  5TKY A;  2PY5 A;  4C8O A;  3CCJ N;  3CC2 N;  3L3V A;  2QA4 N;  1TK0 A;  3OHR A;  4CW7 B;  3J8A A;  3OYB A;  5F2R A;  4BDZ A;  1TUU A;  1VSK A;  2HHV A;  3C95 A;  1NM1 A;  1KFD A;  4BDY A;  2ZM6 K;  4DR3 K;  1TKD A;  5AZI B;  2O8B B;  4AHS A;  3AVA A;  1QHT A;  4YOT A;  1L3V A;  1ZXO A;  4JLH A;  4ILG B;  3ITH A;  2W40 A;  5FPN A;  4EAH D;  4C1N I;  4H03 B;  2KLA A;  3DI6 A;  4IZ9 A;  4F8R A;  3VA0 A;  1RGI A;  2E6L A;  2P51 A;  2NRH A;  5AQS A;  3QER A;  3A5N C;  4B3T K;  1BQM A;  2HND A;  2QW9 A;  1ITG A;  4HTU A;  4MFB A;  4NB4 A;  1BI4 B;  4BVO A;  4F2S A;  5AQL A;  1IH7 A;  4RCH A;  2RHK A;  1N8R O;  4CZG A;  4FZZ A;  4DKW A;  5DM6 L;  3FFI A;  2RF2 A;  3D0P A;  2QKB A;  3HP6 A;  1BCO A;  2O4G A;  3VQ9 A;  1Q82 O;  1X9S A;  1KFS A;  2I7N A;  3A5L C;  5EOY A;  3RTV A;  3ZLJ A;  1REV A;  2QXL A;  2O8E A;  2YNG A;  1A5W A;  3ENO A;  4KHS A;  2O8C A;  3KK7 A;  4ZTJ A;  3SYZ A;  3QLH A;  3KD5 E;  4KI6 A;  1HYZ A;  3ISN C;  4C8L A;  2RKI A;  3AVJ A;  3SNN A;  1SL0 A;  3K2P A;  4DTR A;  4DR5 K;  3V81 A;  3DXK A;  4LF7 K;  4TSX A;  2FBX A;  2FLO A;  5KGW A;  1C0F A;  1C1C A;  4IJA A;  5BRD A;  4J2A A;  1RTJ A;  3ZET B;  2YV0 X;  4OVL A;  1W2B M;  4J2D A;  5M1O A;  2Q36 A;  4KB1 A;  3MX5 A;  3NF6 A;  1JCF A;  4ILH A;  4A61 A;  3MAQ A;  4HUG A;  3IFR A;  3D2F A;  3RWU A;  2ZGY A;  1Q9X A;  3AV9 A;  4IOA L;  4DFM A;  2RPI A;  1QVG M;  4XH5 A;  1JL1 A;  4NLC A;  2OAN A;  2QKK A;  3MCP A;  4ISG A;  4O8U A;  2KHO A;  2I7P A;  3FZF A;  4CF2 A;  1HNV A;  4GKJ K;  2KZZ A;  1K9M O;  4M3U A;  3TAQ A;  4JRQ A;  3WT0 A;  2YKN A;  3A5M C;  3K9J A;  2ATQ A;  3LL3 A;  3V9X A;  3GDQ A;  1VQO N;  3OYM A;  1CXQ A;  4IDH A;  1FJG K;  3DMJ A;  2HW3 A;  3TSQ A;  4A2A A;  4E0D A;  2PZS A;  2OZM A;  2O8F A;  5C0Y A;  1KCF A;  4DV7 K;  4B8C A;  3VTH A;  1IKV A;  1HUX A;  4A2B A;  2YJF A;  1B9D A;  3FR0 A;  3SPY A;  2QM1 A;  4CJK A;  4JI3 K;  5JVH L;  4JS5 A;  4DUZ K;  4FZX C;  1CLQ A;  2A40 A;  1IBL K;  3JYT A;  3CJC A;  5M1K A;  2G8W A;  5HOO A;  4CGJ A;  3TSU A;  3PX0 A;  3OW2 M;  4HHT A;  3OYN A;  4KHY A;  3OYC A;  4CJQ A;  1LW2 A;  1GOC A;  4H5T A;  4ELV A;  4CHP A;  1VQP N;  5I9E B;  4O44 A; 
#chains in the Genus database with same CATH homology
 3LDS A;  1JLC A;  1VSM A;  3VQ5 A;  3BGR A;  2EX3 A;  1S9E A;  2BE2 A;  5KI6 A;  3V9W A;  3QEX A;  4F3O A;  4CER A;  1UOC A;  4N76 A;  3SQ4 A;  4E7J A;  3AA5 X;  1TGO A;  4HUE A;  2VWJ A;  1RTH A;  1QSY A;  1WSH A;  2E6M A;  3OY9 A;  3OYE A;  3IRX A;  3NFA A;  5DMR A;  2KW4 A;  3AVH A;  3KIO A;  3ZT1 A;  5DK5 A;  2ZD1 A;  1VSD A;  4E1N A;  4W5R A;  3S9H A;  4B9N A;  4CGG A;  3QEV A;  4B9M A;  2DY4 A;  1LWC A;  5EU7 A;  1I3A A;  1UWB A;  1VSF A;  1HYV A;  4CEZ A;  3RR7 A;  1L3U A;  3ZSW A;  4KHN A;  2B6A A;  5I3U A;  1QTM A;  3KKR A;  4FM0 A;  4W5T A;  4AHU A;  2HVI A;  4FLT A;  5FRO A;  3LAM A;  5C24 A;  2DFF A;  4B3O A;  1BI4 A;  4CJ5 A;  3NHG A;  4ZHR A;  2GBZ A;  3O3G A;  2JLE A;  1WSG A;  3ZSQ A;  4Z4F A;  4CHN A;  3K5N A;  2HHT A;  4RW8 A;  2KZM A;  4LSN A;  4GW6 A;  1NKE A;  3HL8 A;  4G1Q A;  1WLJ A;  3NH0 A;  1L3S A;  3TAG A;  4FJI A;  4FJ9 A;  4DLG A;  1RBS A;  4FZY A;  4FXD A;  2HHX A;  1KRP A;  1YVU A;  4O0I A;  3DRR A;  2AJQ A;  4J2E A;  3AVB A;  4NYF A;  1S9G A;  1TKT A;  4CHZ A;  4FLZ A;  4OPJ A;  3IS9 A;  4Q5V A;  1S6P A;  3OYH A;  5KRT A;  3RRG A;  4PY5 A;  2ITG A;  1WSF A;  2VG7 A;  1A5X A;  4DTO A;  1QS4 A;  5T7B A;  2XY6 A;  2YNF A;  2B4J A;  4CFB A;  4DTP A;  3QEI A;  4CEB A;  4FJN A;  2QXF A;  1C1A A;  2OPS A;  4OKE A;  2PYJ A;  4KTQ A;  4FJK A;  2KQ2 A;  4KB0 A;  1XWL A;  3TAM A;  4L8R B;  1NK6 A;  2Z1H A;  3QIO A;  5I42 A;  1HNI A;  2R7Y A;  4CGH A;  1BIU A;  1RT4 A;  1EET A;  1RT6 A;  3OVN A;  4CF8 A;  4CEO A;  4JS4 A;  4FJM A;  4OPK A;  1W9H A;  1RT1 A;  1TL1 A;  4M3R A;  1NK5 A;  1RBR A;  4QOZ B;  3MXI A;  4DSI A;  3ZSV A;  4CK2 A;  4B9S A;  1HRH A;  4DQR A;  1NKB A;  4H4O A;  2ETJ A;  3ZT0 A;  4BDP A;  1BCM A;  2FBT A;  2BDP A;  1KSP A;  3PX4 A;  2P5G A;  1QQC A;  3DOK A;  4LSL A;  1KTQ A;  1CZ9 A;  4CED A;  3EY1 A;  4DU4 A;  1D9F A;  4JRP A;  4FJ5 A;  2HHW A;  1J53 A;  1MU2 A;  3RRH A;  1C6V A;  1FKO A;  4RW7 A;  4N56 A;  4DFK A;  4FJ7 A;  3WNG A;  1XHX A;  1SV5 A;  3MEC A;  4B9L A;  4FJX A;  3OYD A;  2OA8 A;  4C8K A;  3IAY A;  4M3T A;  1ZBI A;  4CJE A;  3T3F A;  3AVN A;  3OYA A;  3QIP A;  1NJY A;  1KVB A;  4Y1C A;  4F3T A;  4O5B A;  4DQP A;  3M8R A;  3SI6 A;  1J9A A;  3HST B;  3S3N A;  2ZQB A;  4RW6 A;  3S3M A;  4CEQ A;  1LAV A;  3LZJ A;  4XIU A;  3KLE A;  1JLQ A;  2F8T A;  4C8M A;  1RT5 A;  4HUF A;  5C42 A;  2DFH A;  3LP0 A;  3CM5 A;  3SUP A;  1RT7 A;  4FJH A;  2KFZ A;  3NF9 A;  3DLK A;  3I0R A;  4Z0U A;  2G8F A;  1RIL A;  3DLE A;  5E41 A;  4DU1 A;  4EZ9 A;  4M3Z A;  1SKR A;  4FK4 A;  4DTN A;  1C1B A;  1ZBL A;  4DSE A;  1WSI A;  2GV9 A;  3DM2 A;  3HK2 A;  3ALY A;  3VQB A;  3VQC A;  2WON A;  1X1P A;  4YNQ A;  3TAR A;  3DLH A;  3HPO A;  4KI4 A;  2HHU A;  2EHG A;  3K5O A;  4DQS A;  4CJL A;  1TKZ A;  1VRT A;  4KFB A;  1X9M A;  1Q8I A;  3LPU A;  3ULD A;  4B9U A;  1JKH A;  2WOM A;  2FC0 A;  3AO4 A;  5HRO A;  1JLE A;  4E7I A;  4AHR A;  2HB5 A;  2O4I A;  1SL1 A;  5KTQ A;  4AHV A;  4DF4 A;  5HBM A;  3C6U A;  4E19 A;  5FRN A;  1WSE A;  3RR8 A;  3CFP A;  4M41 A;  3NAE A;  1RTI A;  4FYD A;  3KK1 A;  2LSN A;  4NYN A;  1EKE A;  3I0S A;  4H4M A;  5CZ2 A;  3L2U A;  1TKX A;  1C0U A;  2HNY A;  2OPR A;  1IKY A;  4LH5 A;  1WAF A;  4LY7 A;  3NCI A;  3F73 A;  1VSL A;  1XC9 A;  1RDA A;  3QET A;  1HYS A;  5CY4 A;  1KVA A;  1YTA A;  3K58 A;  4KTZ A;  4CK1 A;  3LAN A;  1YTU A;  1TK5 A;  4CJ4 A;  3CG7 A;  2HVH A;  2F96 A;  3V6D A;  3MED A;  3TAE A;  1D8Y A;  1CZB A;  1NKC A;  3LAK A;  3QO9 A;  2IS3 A;  3P5J A;  4EP5 A;  1GOB A;  1VK0 A;  4QCL A;  3NBP A;  3B6O A;  3RMD A;  3P1G A;  3SJJ A;  3SCX A;  5HP1 A;  2IC3 A;  2HHQ A;  4FJL A;  3DLR A;  1NJW A;  3CYM A;  1N5Y A;  2ZE2 A;  1XI1 A;  4NCA A;  1JXB A;  4EZ6 A;  3HPH A;  4DS4 A;  1NK4 A;  3M8S A;  5HLF A;  1NK7 A;  5FRM A;  4WE1 A;  2OYQ A;  3SQ1 A;  4CF9 A;  4ID1 A;  3U6F A;  4N41 A;  3K57 A;  4FLU A;  4DSK A;  1RDB A;  4RW4 A;  3LP2 A;  4ELU A;  1HQU A;  2D0C A;  3ASM A;  1NK8 A;  3K5M A;  1WNS A;  3L8B A;  4PUO A;  3ZT2 A;  3DRS A;  4CEA A;  3O4N A;  1X9W A;  2QK9 A;  1SKS A;  3IG1 A;  2D0B A;  4CHO A;  3AVM A;  1B92 A;  4CK3 A;  1I39 A;  3AVL A;  2VWK A;  4OKK A;  4M45 A;  3TAP A;  1FK9 A;  2YHA A;  3VQD A;  2Y1J A;  4DQI A;  3H08 A;  1TVR A;  3M8Q A;  2FBV A;  1EP4 A;  2YHB A;  1JLB A;  4CIF A;  3L2V A;  1KVC A;  2IAJ A;  4BWJ A;  3HJF A;  1RT3 A;  1NK9 A;  4HVJ A;  3EYZ A;  1JXE A;  4CJS A;  4KRE A;  1RDD A;  4CJV A;  3TWH A;  4F2R A;  3AO1 A;  3G10 A;  3NDK A;  4I9Q A;  4FLW A;  3AVK A;  4HCB A;  3LP3 A;  3OYG A;  3KK3 A;  2Q3S A;  1SUQ A;  4OLB A;  3LPT A;  2X6S A;  4ICL A;  3SPZ A;  1BHL A;  3KJV A;  3RMB A;  3UIQ A;  3KLH A;  4CF1 A;  3NGZ A;  3A2F A;  2W42 A;  4DTX A;  1RBV A;  4LH4 A;  3ZT4 A;  1RCH A;  1HJR A;  4DG1 A;  4PWD A;  4E7H A;  1N6Q A;  4E1M A;  3AO5 A;  4CFA A;  1O1W A;  1D5A A;  1TL3 A;  1IKW A;  1GOA A;  3HPG A;  4B8A B;  1J5O A;  4CHQ A;  5KRS A;  2X6N A;  4FVM A;  5FDL A;  4N5S A;  5D3G A;  1KLM A;  3HYF A;  1S1U A;  3CQ8 A;  4DSF A;  4Z4E A;  3TAF A;  1EX4 A;  1LWF A;  5K14 A;  3SUQ A;  3CFR A;  1Z25 A;  4OKJ A;  4OLA A;  3V9U A;  3V4I A;  4FCY A;  4E3S A;  3HP9 A;  3NF7 A;  3SV4 A;  1JL2 A;  3SUO A;  3SZ2 A;  1LV5 A;  4M3X A;  3TR8 A;  1DTQ A;  1K6Y A;  3PX6 A;  1U49 A;  2Z1J A;  4ID5 A;  2A1S A;  2G8V A;  3KKS A;  4ELT A;  3KLG A;  3S3O A;  2YNH A;  2XRI A;  3E01 A;  1C0T A;  3ZSO A;  2E4L A;  3V9S A;  3QEP A;  2XO7 A;  1KLN A;  1D9D A;  1WAJ A;  4FW1 A;  4C8N A;  4DMN A;  3QEW A;  5J2Q A;  4I2Q A;  3NF8 A;  4BE1 A;  5J2N A;  4DQQ A;  4BAC A;  1JLA A;  4CE9 A;  1T05 A;  4FK2 A;  4KHW A;  1F21 A;  4BE0 A;  4CFD A;  1L5U A;  4B9V A;  1S1W A;  5KGX A;  4E7K A;  2B5J A;  2NUB A;  4IG0 A;  4OGC A;  5JS2 A;  4CGI A;  2G8I A;  3AA2 A;  4J2B A;  2FBY A;  4CGD A;  3LWM A;  4FK0 A;  4DU3 A;  2YNI A;  1IKX A;  1DLO A;  4KRF A;  4CHY A;  1VRU A;  3D45 A;  4BE2 A;  4GVM A;  1Z26 A;  3CM6 A;  5CZ1 A;  2PY5 A;  4C8O A;  3MXJ A;  4AH9 A;  3KD1 E;  2I5J A;  3LAL A;  3MEE A;  3QNN A;  4AIL C;  4W5O A;  4MQ3 A;  3L3V A;  3SV3 A;  4CIG A;  3WNH A;  1TK0 A;  3O3F A;  1RT2 A;  1LWE A;  1T8E A;  4FJG A;  3OYB A;  4BDZ A;  1B9F A;  1VSK A;  2HHV A;  3C95 A;  3THV A;  1C0M A;  1KFD A;  3VQ6 A;  4BDY A;  3U3G A;  3BDP A;  2P1J A;  1TKD A;  4Z4I A;  4LD0 A;  4HCC A;  4E7L A;  2XHB A;  2Z1G A;  4AHS A;  1BL3 A;  2BAN A;  4QAG A;  3AVA A;  1VSJ A;  5HRR A;  1R0A A;  1A5V A;  1QHT A;  2OPQ A;  3AA4 A;  3SQ0 A;  1L3V A;  2PYL A;  3KK2 A;  4CCH A;  3QES A;  1BIZ A;  4JLH A;  4CJF A;  1RBT A;  4KTW A;  2KFN A;  3ITH A;  4DTS A;  1RBU A;  5HRS A;  1IG9 A;  2G8U A;  4AHT A;  4IKF A;  2XY7 A;  5SZT A;  1NOZ A;  4R5P A;  3RMC A;  1UA1 A;  3DI6 A;  4F8R A;  4CIE A;  4OJR A;  5SWM A;  3VA0 A;  1CXU A;  3VQ7 A;  4CEE A;  1TAQ A;  2E6L A;  3AO2 A;  3DLB A;  1HMV A;  2P51 A;  3QER A;  1HPZ A;  4Z4H A;  1BQM A;  2HND A;  3AVG A;  3VQA A;  4AHC A;  3L2W A;  1ITG A;  3RMA A;  4M3W A;  3ZSZ A;  4CES A;  4HTU A;  4MFB A;  1U45 A;  1ZBH A;  3HO1 A;  4KO0 A;  1BI4 B;  4CF0 A;  3VA3 A;  4F2S A;  3PUF A;  1VSH A;  1IH7 A;  3NE6 A;  3OYF A;  4DSL A;  3C6T A;  4K8X A;  4CJP A;  3U3Y A;  4FZZ A;  2F8S A;  3K59 A;  3FFI A;  4Z4G A;  3O4Q A;  3OYI A;  4ZTF A;  1SL2 A;  2RF2 A;  3D0P A;  3PO5 A;  4B9T A;  4H8K A;  2QKB A;  3HP6 A;  1BCO A;  1BGX T;  1ASW A;  2O4G A;  3DYA A;  1TV6 A;  1EXQ A;  2X74 A;  3VQ9 A;  1X9S A;  3VQ8 A;  4FLX A;  1KFS A;  3HVR A;  3OS2 A;  4FW2 A;  4IFV A;  3VQP A;  3RTV A;  1REV A;  3OJU A;  1QSS A;  2RN2 A;  2YNG A;  1FKP A;  2OPP A;  3SQ2 A;  1A5W A;  3DLG A;  2D5R A;  4KHS A;  3OS0 A;  1DTT A;  1L3T A;  3LWL A;  4ZTJ A;  4CJW A;  3SYZ A;  3AA3 A;  3QLH A;  3KLF A;  1NJX A;  1ZBU A;  4CEF A;  4Y1D A;  3V1Q A;  3HM9 A;  3NGI A;  3KD5 E;  3T1A A;  1T7P A;  4K8Z A;  1HYZ A;  3ISN C;  3HT3 A;  3AVI A;  3SUN A;  4KI6 A;  2BGG A;  3OYL A;  1T03 A;  1NK0 A;  4C8L A;  4W5N A;  1UAX A;  3OS1 A;  1U04 A;  2RKI A;  3AVJ A;  4OGE A;  4E89 A;  4NCB A;  2YKM A;  3AVC A;  3EZ5 A;  3SNN A;  3TAB A;  3K2P A;  3V1R A;  1SL0 A;  3LZI A;  3AVF A;  5HRP A;  4W5Q A;  3ZSX A;  4DTR A;  4CJT A;  3OYJ A;  3VN5 A;  3V81 A;  1RTD A;  1JLG A;  4UQG A;  4TSX A;  3B6P A;  2FBX A;  2Z1I A;  3ZSY A;  5KGW A;  3K5L A;  1C1C A;  4J2A A;  3LP1 A;  2GUI A;  5J2M A;  5CYM A;  1J54 A;  1RTJ A;  2YV0 X;  4OVL A;  4J2D A;  4F4K A;  2JGU A;  4N47 A;  3WNF A;  4Q0B A;  3OJS A;  1Q9Y A;  4KHU A;  2VG6 A;  1S1V A;  3DRP A;  1QE1 A;  4I9L A;  4DTJ A;  3V1O A;  4KV8 A;  1U48 A;  3PO4 A;  4KB1 A;  1IO2 A;  3NF6 A;  4O55 A;  3MAQ A;  4HUG A;  2HHS A;  4CJR A;  1NJZ A;  4EP4 A;  4DTU A;  3RWU A;  4RW9 A;  4KKO A;  3L2Q A;  1Q9X A;  3OYK A;  4FJJ A;  3AV9 A;  4DWI A;  3VQE A;  1U47 A;  3I8D A;  1YT3 A;  3F9K A;  4B08 A;  3G0Z A;  4DFM A;  4FM2 A;  2OZS A;  2RPI A;  2Y1I A;  1JL1 A;  1S6Q A;  4DTM A;  1ZYQ A;  4YFU A;  4DF8 A;  1FXX A;  4KHQ A;  4FJ8 A;  5J1E A;  4CGF A;  2VG5 A;  2QKK A;  3WNE A;  4DLE A;  4M3Y A;  1TK8 A;  3L2R A;  3PV8 A;  1BQN A;  2XY8 A;  4CF2 A;  1U4B A;  1HNV A;  3M8P A;  4O4G A;  2KZZ A;  4M3U A;  3TAQ A;  4JRQ A;  4DS5 A;  1BIS A;  1WSJ A;  4I2P A;  2XY5 A;  2YKN A;  2HMI A;  4BWM A;  3VQQ A;  3NH2 A;  2P5O A;  2ATQ A;  4CJ3 A;  4O0J A;  3TAN A;  3MXM A;  5J2P A;  4DSJ A;  1ZBF A;  1SKW A;  4KPY A;  3V9X A;  3HXM A;  1S1T A;  3KLI A;  4IG3 A;  3ZCM A;  3T19 A;  3OYM A;  1RDC A;  4RG8 A;  1CXQ A;  2DTU A;  4FLY A;  3DMJ A;  3C94 A;  3PY8 A;  3QIN A;  2HW3 A;  2D0A A;  3NGY A;  4GMJ B;  3JSM A;  4FLV A;  1ASV A;  2G8H A;  1WN7 A;  4CEC A;  4E0D A;  4FM1 A;  2PZS A;  2OZM A;  2A1R A;  1HQE A;  5CYQ A;  1KCF A;  4B8C A;  2DFE A;  3HVT A;  5JS1 A;  5HRN A;  2G8K A;  1IKV A;  1ASU A;  3VQ4 A;  3TI0 A;  3MEG A;  4PA1 A;  4Z4C A;  3O3H A;  1NOY A;  3SPY A;  4M42 A;  1B9D A;  2IGI A;  2IDO A;  1S1X A;  4CJK A;  1VSE A;  3NH1 A;  1LAW A;  3DOL A;  4IFY A;  4JS5 A;  4CFC A;  1UA0 A;  4FZX C;  1W0H A;  1CLQ A;  3V9Z A;  2IOC A;  3AO3 A;  3JYT A;  4PQU A;  2G8W A;  4I7F A;  4CGJ A;  1TAU A;  1QSL A;  3PX0 A;  5C25 A;  4HHT A;  1JLF A;  3L3U A;  3OYN A;  4KHY A;  3ZSR A;  1XHZ A;  1S5J A;  4NCG A;  3OYC A;  2HNZ A;  4CJQ A;  3P83 D;  4IBN A;  4CJU A;  1Y97 A;  1G15 A;  1LW2 A;  1GOC A;  1RNH A;  1VSI A;  2X78 A;  4IDK A;  4DFP A;  3CFO A;  4DFJ A;  4CHP A;  3KTQ A;  4ELV A;  3QNO A;  2KTQ A;  4KAZ A;  3ZT3 A;  1LW0 A;  4O44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...