3WNGA

Cyclic hexapeptide pkidnp in complex with hiv-1 integrase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
138
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hexapeptide mimetics of LEDGF in complex with HIV-1 integrase
rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/peptide
molecule keywords Gag-Pol polyprotein
total genus 49
structure length 138
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3wngA00
1Q9YA 4FZZA 2RKIA 3S3MA 1VK0A 1C1AA 1WSHA 3OYCA 4OLAA 3ALYA 3AVGA 1Q9XA 3PUFA 3HP6A 3RMDA 2DTUA 4CK2A 3QNOA 3SQ0A 1HRHA 3NE6A 1NK0A 4ZHRA 2YHBA 2ITGA 3AA5X 3I0RA 1JXEA 3AVBA 3WNHA 4CJUA 2G8KA 3OYBA 3TAPA 4CJRA 1WAJA 2OPPA 3V1OA 4FJGA 2BE2A 2E6LA 3D45A 4CEZA 4CF2A 3VA0A 4M42A 2DY4A 3OVNA 4DTMA 4ZTJA 3ASMA 4E7LA 1SL0A 2BGGA 3V9UA 4RW8A 3TAGA 1RILA 3NH1A 3QETA 4E3SA 2IS3A 2ZQBA 4I9QA 1S6PA 4CEFA 4OJRA 1BCMA 4ELTA 4CFAA 4MFBA 4DTNA 3TWHA 3CM5A 1A5WA 2P51A 3M8RA 4Q0BA 3SYZA 1A5XA 2IC3A 4KPYA 5C24A 4C8LA 1HJRA 3HSTB 2HVIA 4N56A 1R0AA 2F8SA 1C0TA 4CF0A 1VSDA 1UOCA 2Z1IA 3AVJA 3AVLA 4RW6A 3TANA 3B6OA 5KRTA 4HUGA 1SUQA 1Z25A 2RN2A 1UA0A 2HB5A 3FFIA 4CF8A 3EZ5A 4C8MA 3ISNC 4AH9A 3K5MA 4DFMA 4CJWA 3TABA 2VWJA 1BGXT 3KLHA 3RRHA 1ASWA 3DYAA 3VQBA 2FBVA 1LAWA 3AVAA 4CEBA 1RT5A 4AILC 1D5AA 3KD5E 3MECA 1IKXA 4FM0A 3QLHA 4Z0UA 1VSJA 4CIEA 1J53A 4CK1A 2PYJA 4Q5VA 4C8KA 3QEVA 4LH4A 2D0CA 4FZYA 1ASUA 3QEIA 1NK9A 2P1JA 3AVHA 4FW2A 2HVHA 3BGRA 4AHTA 3DLBA 1Q8IA 1VSLA 4LH5A 4CIGA 3SZ2A 4FVMA 2OPSA 4OPJA 3TR8A 1HYVA 5J2NA 3AO4A 3AA2A 4C8NA 2E4LA 4PY5A 2VWKA 1U45A 1KVBA 1BI4B 4FLUA 2KZMA 1KRPA 1O1WA 4I9LA 5DK5A 4N47A 3S3NA 4F4KA 4BE0A 2IOCA 3NF9A 1HPZA 3JYTA 3VQAA 2HW3A 4GW6A 1Y97A 3KK3A 1CXUA 5KRSA 2G8HA 4Y1CA 4FJ9A 4CHQA 3ZSWA 2ATQA 4CEOA 1RT6A 2WONA 4W5RA 3CFPA 1BIZA 4DTXA 3H08A 2X6NA 2OYQA 1LW2A 1EKEA 1SKSA 1SL1A 4CESA 4KTQA 4N76A 2O4IA 2OZMA 2GV9A 4M3TA 2OZSA 1RBSA 1C0MA 5FRMA 4DFJA 4ID1A 3HPOA 2BDPA 3DLRA 3IG1A 3NH0A 3CFRA 4DWIA 2OA8A 4E0DA 1TKZA 1FKOA 2X6SA 4XIUA 4YNQA 3OYJA 3SUPA 4UQGA 4DSIA 4Z4CA 3NH2A 3O3FA 3OYFA 3OYIA 2Y1JA 2WOMA 1L3UA 1NK6A 2I5JA 4M45A 3HJFA 1QSSA 4OGEA 4I7FA 4Z4EA 3ITHA 2HNDA 3L3VA 1B9FA 1HQUA 2RPIA 3NGIA 4OVLA 1IKYA 5T7BA 1SV5A 3TAFA 1RNHA 3AO3A 5DMRA 2Y1IA 1JLQA 5CYMA 3K57A 3VQ6A 4DSLA 1RBTA 3L2WA 1I39A 3LANA 1EETA 1GOCA 3I8DA 3AVCA 3A2FA 4CJ4A 3LZJA 3S9HA 2KFNA 2QKKA 2PZSA 4M3RA 1RDAA 1EXQA 3VQQA 3S3OA 3OYMA 4EP4A 1DLOA 4KV8A 3C94A 1T8EA 1VSEA 3SUNA 1NK5A 3VQ4A 2KTQA 3RTVA 2XY8A 1U47A 1NKEA 4FJNA 4DMNA 3T3FA 1S6QA 1RT3A 3V4IA 1HNIA 1BIUA 5SZTA 3SPZA 5CZ2A 3DMJA 4AHUA 1KLMA 1MU2A 5HRNA 1U49A 4FK4A 1NKBA 3VQPA 4AHVA 4NYFA 3QEWA 4KRFA 2KZZA 1S1WA 3VQ8A 4IG3A 3ZSOA 5KGXA 4HCBA 1IH7A 2FBTA 1L3TA 5J2QA 3QINA 4DQRA 2PY5A 4L8RB 2AJQA 2KQ2A 3TAEA 5CZ1A 5FDLA 1RDBA 2Q3SA 2YHAA 1ZBLA 1RBUA 3ULDA 2XY7A 3T1AA 3HPHA 3KLEA 3P83D 1TAUA 3SQ4A 4JS5A 1JLFA 3ZSQA 1UWBA 3DRRA 1BQMA 3MXJA 4QCLA 3DLKA 3PV8A 3ZSXA 2A1RA 1HMVA 4DF4A 3VN5A 3KK2A 4QAGA 4DF8A 4EZ6A 1RCHA 3V9WA 3OYAA 1NJYA 2XY6A 4ICLA 1CXQA 1JLBA 2HNZA 4CHYA 1X9SA 4FJXA 4KO0A 3DRPA 2B5JA 4CHPA 2Z1JA 5D3GA 2LSNA 3OJSA 4CEAA 1HYZA 4O55A 4CFBA 3CFOA 3ZSRA 2HHUA 3RMCA 2D0BA 2ETJA 3KIOA 3QESA 4GMJB 3WNFA 1WAFA 2HNYA 1ZBIA 1LW0A 2B4JA 4F2SA 4M3YA 1ZBHA 2Z1GA 4TSXA 4E89A 1TK8A 1S1TA 3SPYA 4KHUA 3DLGA 3I0SA 2KW4A 1L3SA 4CF1A 1TVRA 1TK0A 3NCIA 1WSEA 3NDKA 1LWEA 5CYQA 3KKRA 4RW4A 3KJVA 1LWCA 1KSPA 4J2BA 3AVMA 3DI6A 4BWJA 2OPRA 2X78A 1QHTA 4AHCA 4FLXA 4IBNA 4CECA 4B9TA 2G8UA 3NF8A 2VG7A 4OKEA 4J2AA 3OYHA 3AVNA 3L2QA 2Z1HA 4E7IA 4FJ8A 4PWDA 4H4OA 4DTSA 4I2PA 3SQ1A 4Z4HA 1JLGA 4J2DA 4FLWA 4DFKA 4KHQA 4E19A 3KLGA 3PX4A 3V9SA 3ZT3A 1XWLA 4CEEA 5J1EA 4B9VA 3TAMA 3AA4A 4IFVA 3QEPA 3DRSA 4M41A 4HUEA 1L3VA 3HYFA 1RTHA 3C6UA 3MXMA 3V9XA 4KI6A 4DTJA 3VQ5A 3HP9A 3ZSZA 4E1MA 1VSKA 1JKHA 3IS9A 1TGOA 3P1GA 1TKXA 2X74A 1IO2A 2QXFA 3ZT0A 5HBMA 4CIFA 4YFUA 1GOBA 5I42A 1XHXA 4M3XA 4DSJA 4CJSA 4CGHA 4B9SA 3LPUA 4K8XA 3K59A 3LPTA 4B8AB 2ZE2A 4DQSA 3CM6A 1FK9A 2ZD1A 3LAKA 1T03A 1TL3A 3OYEA 3U3YA 3D0PA 4ELUA 2DFEA 3QO9A 4IG0A 3KD1E 4O0IA 4DSKA 2DFFA 4FJMA 3LAMA 1HQEA 4CJVA 5HRPA 3AO2A 3MEGA 3LALA 2E6MA 1U04A 5KTQA 3SV4A 3OJUA 3KLFA 3L8BA 4DTPA 3IRXA 3LWMA 1D8YA 4DSEA 2IAJA 1F21A 1RT7A 3SUQA 1VSHA 3NHGA 4FJKA 4G1QA 3AO1A 3DOKA 3LP3A 3MEDA 4CJFA 3L2VA 1XC9A 4FJ5A 2YNGA 1S5JA 4CF9A 2EX3A 5HRRA 4FJJA 1WSIA 4BWMA 5HROA 3F73A 4CERA 3PX0A 4KFBA 2PYLA 4Z4GA 3LP1A 2XY5A 4FLZA 3HT3A 1LV5A 2O4GA 4O44A 3RMBA 3AA3A 1HNVA 1B92A 2F96A 2D5RA 3THVA 3SQ2A 2W42A 4KREA 4FYDA 4O5BA 5CY4A 3CG7A 3ZT2A 1KFDA 1RT1A 3DM2A 3MAQA 1VSIA 2HHQA 3V1RA 4KTZA 4C8OA 4DU3A 4PQUA 2G8VA 1X9MA 2FBYA 4CJEA 4BDZA 4FK0A 1VRUA 3CYMA 4F2RA 4IFYA 2G8WA 4KHWA 4W5OA 4EP5A 2DFHA 5C42A 2XRIA 4DU1A 3RMAA 1KVAA 4BDPA 4J2EA 5FROA 1J9AA 3LDSA 1I3AA 3CQ8A 4DTUA 5K14A 3QNNA 3HK2A 2YV0X 1TV6A 3ZSVA 4CJLA 3VA3A 4LSLA 1XHZA 1BL3A 4DQPA 4W5TA 3AO5A 4B8CA 4F8RA 3G10A 3KK1A 4KKOA 1C6VA 1UAXA 3HPGA 4BACA 3M8QA 4M3WA 3DLEA 1HYSA 4DTRA 1FKPA 4CEDA 1S9EA 1IG9A 4EZ9A 3WNGA 2YNFA 3L3UA 1J5OA 3VQEA 2VG6A 3K2PA 1WLJA 3ZT4A 4H8KA 3OYKA 4BE2A 2YNHA 3WNEA 2XO7A 3HO1A 3K5OA 1JXBA 4RG8A 3OS0A 3DLHA 1RT4A 3O3HA 4PA1A 1JLAA 1RDDA 1WNSA 3SUOA 2OPQA 1QTMA 1TL1A 1SKWA 1BISA 3ZSYA 4CJTA 4PUOA 5E41A 3BDPA 1S1VA 4N41A 4DQQA 1N6QA 3SJJA 1LAVA 4CHNA 4NCAA 3OYLA 3O4NA 3HM9A 1NOYA 3OY9A 4BE1A 4CCHA 3UIQA 4M3UA 1IKVA 4DS4A 3NF6A 4CEQA 3EY1A 2GBZA 4DQIA 2VG5A 1BQNA 4LY7A 1EP4A 4KB1A 1NOZA 4FLYA 3E01A 2YKMA 1JLCA 1REVA 3OYDA 3EYZA 1KFSA 3IAYA 4FK2A 4B3OA 4DU4A 3K58A 1LWFA 1S9GA 4ZTFA 4O0JA 5HP1A 3HXMA 3TI0A 1NKCA 3AV9A 4FJHA 2HMIA 5KGWA 4HVJA 3MXIA 4M3ZA 2BANA 2G8FA 3JSMA 2HHSA 4KB0A 4CJQA 1GOAA 4FCYA 3V1QA 4ID5A 4K8ZA 4CJ3A 3QIPA 3TARA 1YT3A 1BCOA 4OKJA 5HLFA 4B9MA 1W9HA 4RW9A 1NK8A 1UA1A 1J54A 2QKBA 2R7YA 3ZT1A 1X1PA 1DTTA 1B9DA 5I3UA 4E7JA 4H4MA 3QERA 2QK9A 1RDCA 4O4GA 3AVFA 2GUIA 4B9UA 1S1UA 2NUBA 3HVRA 3G0ZA 4OGCA 3VQDA 2HHTA 4F3TA 4FM2A 3U6FA 1CLQA 3DOLA 4DLEA 1D9DA 2F8TA 1U48A 4FLVA 3NGYA 1XI1A 3MEEA 3F9KA 4AHRA 4IKFA 1TK5A 1KTQA 1FXXA 3LP2A 3ZCMA 4CFDA 3K5NA 3O4QA 4DTOA 1N5YA 3PO4A 3PO5A 3M8PA 1NJWA 4FJIA 1BHLA 4FZXC 3P5JA 4CGJA 3SNNA 2HHWA 4FW1A 1JL1A 2B6AA 3RR7A 4CGFA 1SKRA 4QOZB 4B08A 3KLIA 2JGUA 1RTIA 4DSFA 1IKWA 4FM1A 4CHOA 4WE1A 3V81A 4CJPA 4DFPA 3OS1A 2JLEA 3NBPA 2RF2A 3TAQA 4R5PA 1NK7A 1D9FA 4BDYA 3M8SA 4OPKA 5J2PA 1KVCA 4CGIA 3LZIA 5FRNA 1CZBA 1A5VA 5KI6A 4RW7A 4HHTA 4LD0A 2HHXA 1X9WA 4F3OA 2G8IA 5HRSA 1ASVA 1T05A 4GVMA 3L2UA 2P5GA 1S1XA 1VSMA 4CFCA 4B9LA 1K6YA 3C6TA 4KAZA 3OS2A 2IGIA 3VQCA 1BI4A 5SWMA 3VQ9A 1RBVA 4LSNA 4KHSA 3AVKA 1YTUA 4DLGA 1QSYA 3NAEA 1Z26A 4Y1DA 1SL2A 4DS5A 4OLBA 3PX6A 2EHGA 3RRGA 1WSGA 1TAQA 5J2MA 1KLNA 1QQCA 2FC0A 1NK4A 3C95A 1TKDA 4CJ5A 3HVTA 4E1NA 4JRQA 4B9NA 3LWLA 4CK3A 1RBRA 1KCFA 3QIOA 1JL2A 1T7PA 4CJKA 4NCBA 4KTWA 4W5NA 5JS2A 4CGDA 1C0UA 1VSFA 3LP0A 3B6PA 2XHBA 3RR8A 4NCGA 4Z4FA 3T19A 3RWUA 1RTJA 3NF7A 4CE9A 4FJ7A 4KHYA 2D0AA 3AVIA 2A1SA 3V9ZA 1QS4A 1RT2A 2HHVA 2P5OA 4FJLA 3NFAA 3SI6A 4FLTA 4ELVA 4HUFA 1RTDA 2IDOA 4IDKA 4FXDA 4OKKA 3O3GA 4CHZA 3K5LA 1W0HA 1YVUA 4E7HA 4KHNA 3HL8A 5C25A 4W5QA 1WSJA 4NYNA 3OYNA 3SV3A 1U4BA 3KTQA 3SCXA 4JS4A 4CGGA 4E7KA 1ITGA 1NJXA 1QE1A 3PY8A 4DG1A 1WSFA 4Z4IA 1CZ9A 4HCCA 3L2RA 1L5UA 1ZBFA 2YNIA 1JLEA 4I2QA 3NGZA 1NJZA 4HTUA 1C1CA 1YTAA 4JLHA 3U3GA 5JS1A 1ZYQA 4JRPA 1EX4A 5EU7A 1TKTA 3VQ7A 3OYGA 1ZBUA 3V6DA 4AHSA 4MQ3A 1C1BA 1DTQA 1G15A 2YKNA 2FBXA 4N5SA 3QEXA 4KI4A 1VRTA 2KFZA 1QSLA 1WN7A 3KKSA
chains in the Genus database with same CATH superfamily
1Q9YA 3S3MA 4OLAA 4YHHK 3NE6A 2NRRA 1NK0A 2YHBA 1OVYA 5E26A 4CBXA 2GTDA 3AA5X 1GLJO 4CJUA 2Q1NA 1WAJA 2BE2A 3D45A 4CBUA 3CI5A 2VCPA 4KH6A 3OVNA 5AFUH 5GADP 3WUHA 2E2PA 1BWFO 3NH1A 3CPWM 3QETA 2HF4A 1S6PA 3HSCA 4CFAA 3KK7A 3EE8A 2QWOA 4KPYA 1XUPO 1R0AA 4JI8K 4B1VA 3CIPA 5AQNA 2IVOA 4HUGA 4LF7K 1SUQA 1Z25A 2RN2A 4IFEA 3K0SA 2UUAK 2HB5A 3EZ5A 3ISNC 2V51B 1ATSA 3TABA 5M1PA 5DM6L 3DYAA 3VQBA 3AVAA 4CJ7A 2RHKA 1RT5A 3KD5E 4DV4K 2P9IB 3QLHA 4Z0UA 4YOYA 4CIEA 2PYJA 4YORA 3T7ZA 3J7YP 4LH4A 2P1JA 5F1XA 2HVHA 3BGRA 3MX5A 1RGIA 3J7ZO 1GLLO 4M7XA 3L0QA 3TR8A 4OPJA 2A42A 4BC4A 1KRPA 5DK5A 3O5BA 4O5FA 2NRZA 3NF9A 1HPZA 2ASMA 2FF3B 3BUZB 4I6MB 2G8HA 4C23A 3VTIA 4CHQA 3PIOL 3H3NO 4GY2B 2X6NA 3MN9A 4ILHA 1LW2A 1SKSA 3VMFB 2GV9A 4M3TA 1RBSA 2BDPA 4E0DA 3OYJA 1FKOA 3EEQA 2A41A 4UQGA 4DSIA 2WFBA 3OYFA 5AQJA 3HJFA 2Y1JA 2I5JA 2WC9A 1NWKA 5IT9O 2HNDA 1NMDA 3NGIA 3WXIA 1IKYA 5T7BA 3TTDA 5AQOA 3ZX3A 3EO3A 2A6AA 3H45C 2Y1IA 3VQ6A 3RVCA 1I39A 3LANA 4PHTX 5BRHA 3S9HA 2PZSA 4FOEA 3C94A 3O4WA 1VSEA 3WT0A 1NK5A 2KTQA 4FJNA 1S6QA 4O8UA 5HRNA 3F2KA 3QEWA 1S1WA 4HCBA 1L3TA 5CZ1A 3L6QA 3CCRN 4CBWA 3RSEB 5GAEP 3T1AA 4CVNE 1TAUA 4JS5A 3THYB 3I8BA 1BQMA 4QCLA 2E2OA 2D0PA 1H1VA 1HX1A 3VN5A 1HLUA 1K8KA 1RCHA 4YOVA 4MO4A 1CXQA 4KO0A 1JCGA 4CHPA 2Z1JA 4O55A 3CFOA 2D0BA 3QESA 1V4TA 3WNFA 1ZBIA 1LW0A 2B4JA 3UKRB 4M3YA 2NRTA 4KHUA 1S1TA 4JEPA 3I0SA 4EHUA 2J4RA 3HZ6A 4CF1A 3VTHA 4B3RK 1WSEA 3OBYA 3JAMO 4CZFA 2X78A 4IBNA 2G8UA 3NF8A 3L2QA 2Z1HA 4E7IA 4BR5A 4H4OA 4Z4HA 1JLGA 4KHQA 3KLGA 3V9SA 1XWLA 3HOTA 2DPNA 4EHTA 1L3VA 1RTHA 4FPBA 4DTJA 4KI6A 3VQ5A 3ZSZA 4E1MA 3U9ZA 3CCQN 1QQNA 1IO2A 4CIFA 4PKGA 1GOBA 1XHXA 4DSJA 1IBMK 4CGHA 4DQSA 1X3NA 1TL3A 3DJCA 2E1ZA 2DFFA 5C15A 1HQEA 3BF1A 2E6MA 2YHWA 3SV4A 3DXMB 3IRXA 3P4IA 2VQEK 2IAJA 4MLHA 1VSHA 4G1QA 3SAHA 3DOKA 1XC9A 4H0YB 4IWVA 4CF9A 5HRRA 4OX9K 4KFBA 4DCHA 4ILJA 4FLZA 3RMBA 1HNVA 2UYTA 3THXB 2F96A 4YOWA 2D5RA 4I6MA 2W42A 4FYDA 5CY4A 3CG7A 4YDUC 1VSIA 1ZXOA 4PQUA 4C8OA 2G8VA 4GKJK 3WXJA 4BRNA 3SMPA 5C42A 4J2EA 4K43A 4H5VA 3D7EO 4LC9B 2YV0X 3ZSVA 4PKHA 3J81O 5I9EB 3VGKA 5EVZA 2O8EA 4W5TA 3KK1A 1C6VA 3EZWA 4M3WA 3M8QA 3DLEA 4DTRA 1FKPA 3CC7N 4EZ9A 1Q7YO 3WNGA 1J5OA 3CCSN 3VQEA 4X66K 3S41A 4WQ4C 3ZT4A 4H8KA 2YNHA 5CE3A 3HO1A 1EO1A 1JXBA 4RG8A 3OS0A 2PAVA 1OH5A 1TL1A 2V7YA 3PIPL 4DQQA 1N6QA 5EX5A 4CHNA 4JK8A 4JKFA 3O1WA 3O4NA 3HM9A 1NOYA 3OY9A 4JD2B 2UU9K 1IKVA 3EY1A 4DQIA 2VG5A 1EP4A 4KB1A 1NOZA 2IVNA 1REVA 3SBGA 3EYZA 1NKCA 3HXMA 4L3QA 5JLFA 4M3ZA 5C10A 3BY5A 4JI1K 1GOAA 1M90O 4K8ZA 3TARA 2UXCK 4B9MA 5HOOA 3M3ZA 1NK8A 1UA1A 1J54A 1HUXA 4DR7K 1X1PA 4E7JA 3IMXA 3QERA 2QK9A 1W2BM 2GUIA 3C65A 1S1UA 2NUBA 3G0ZA 3CERA 1WB9A 1CLQA 3U6FA 3BZKA 3DOLA 4CZGA 2QWNA 4FLVA 3NGYA 1XI1A 3HTVA 1IBKK 4IKFA 2YHYA 5M1QA 4FZXC 4CGJA 4FW1A 4CGFA 1XMOK 2UXBK 4JKGA 1RTIA 2RE2A 4CHOA 3OS1A 1KVCA 2VWBA 5FRNA 1A5VA 1DT9A 2H3GX 1X9WA 4F3OA 2G8IA 1YVNA 4GVMA 3L2UA 1S1XA 2P9PB 4B9LA 1K6YA 3CJ1A 1RBVA 4KHSA 1YTUA 4DLGA 4J8FA 3NAEA 1SL2A 3W0LA 4IJAA 4H03B 5FPDA 1NGFA 2GWJA 5J2MA 4BG9A 4MO5A 2P9KB 4E1NA 3LWLA 3QIOA 1T7PA 5GIOA 4NCBA 4CGDA 3R6MA 1JCFA 3T19A 4K41A 4CE9A 3J80O 1BUPA 2HHVA 4FJLA 4FLTA 4Z94A 4JI0K 1BOTO 4OKKA 3WQTA 3K5LA 4E7HA 3EN9A 1ATNA 2ZJRL 1WSJA 4RCHA 4XEIA 2YX6A 4FSVA 4E7KA 4DUYK 4DG1A 1YIJN 1L5UA 1VQ5N 2YNIA 1JLEA 4I2QA 1C1CA 5MLCQ 5JS1A 3A5NC 3ENBA 1VRTA 3THWA 1CZAN 2ASOA 4FZZA 2RKIA 3ALYA 1Q9XA 2D1KA 2DTUA 4FPAA 1YJ9N 4CK2A 2P9UA 1YJNN 1VQ9N 3ZETA 3N4PA 3HM8A 2ITGA 5BRDA 3AVBA 4JI7K 2OPPA 2ZF5O 2DY4A 4CF2A 4ZTJA 1SL0A 3O9TA 3V9UA 1EWRA 3DLLL 3OW2M 4LF9K 4OJRA 1BCMA 1OH8A 3G6EN 4DTNA 2W41A 2ITMA 4FWSA 1A5WA 2P51A 2IC3A 3TSQA 1HJRA 3QBXA 2O8FA 3BP8A 1BA1A 5GAGP 1O13A 1UOCA 5CR4A 3TANA 5KRTA 4F9OA 3FFIA 2E1YA 2YJFA 3K5MA 3CCLN 2VWJA 4FWKA 3KLHA 2FBVA 1VQMN 4JI6K 1D5AA 1Y64A 3ATUA 1KQSM 4JK9A 1IKXA 4H0TB 3IKMA 1VSJA 2P9LA 2YJEA 3GDQA 2D0CA 3QEIA 3AVHA 3CC2N 2WUSA 4IEEA 3SZ2A 4FVMA 2OPSA 4BRCA 5AQXA 5J2NA 1YI2N 1VQKN 3AO4A 3AA2A 4PY5A 5LY3A 1KVBA 1BI4B 4FLUA 1YAGA 4A5AA 1O1WA 2HW3A 4F4KA 4BE0A 2IOCA 4GW6A 1CXUA 4W5RA 1RT6A 5C0YA 2OYQA 2O4IA 3LDLA 4R79A 4CESA 2OZMA 4YOXA 5AQKA 1MWKA 3CFRA 4XIUA 2YHXA 4BG8A 4NB4A 4Z4CA 3A0IX 3O3FA 1K8AO 1L3UA 5KPZA 1QSSA 4OGEA 3SK3A 4Z4EA 3L3VA 1B9FA 1HQUA 2RPIA 4OVLA 3TAFA 5M1KA 2Q0UA 3H1QA 3K57A 5CYMA 2NRHA 1RBTA 4NLCA 1OKJA 2Q2RA 1N33K 3A2FA 4IZ9A 2KFNA 2O8BA 3FLCO 2QKKA 3F5TA 1RDAA 1YHQN 1EXQA 3O9UA 3VQQA 3OYMA 3S3OA 2O8CA 2W40A 1T8EA 2XY8A 1NKEA 2V7ZA 3SPZA 1BIUA 5SZTA 3DMJA 1S3XA 4QS9A 4NYFA 3ZSOA 1MDUB 5KGXA 1NGGA 1RDUA 1KAXA 2AJQA 4HWIA 4XH5A 5AQHA 1RDBA 2Q3SA 1RBUA 2CH6A 3D2EB 3G25A 3HPHA 3P83D 3TSPA 1JLFA 1UWBA 4BRHA 2P9NB 1YJWN 4DF4A 1OH7A 2ZM6K 3V9WA 4ICLA 2HNZA 2YCHA 4FJXA 1N36K 1HNZK 1NGBA 3VGMA 3LDOA 3OJSA 2PFUA 3ID8A 3RMCA 1WAFA 4C1NI 1NJIO 3AAQA 1K73O 2Z1GA 4TSXA 4U7BA 3SPYA 4QS7A 1L3SA 3FZHA 1TVRA 3NDKA 5CYQA 3C7NA 3AVMA 3DI6A 4AHCA 4FLXA 1QHTA 4B9TA 4BR2A 2VQFK 3OYHA 1NGCA 4LFCK 4PWDA 2QEXN 4FLWA 4DR1K 3LDNA 1X9JA 5LL6Z 4M41A 4HUEA 3MXMA 4BRAA 3V9XA 3HP9A 1VSKA 4YOTA 1TGOA 3P1GA 3E9OA 3ZT0A 4YFUA 5HBMA 1ESVA 5I42A 2NRXA 2CH5A 4BC5A 4B9SA 4K8XA 2A5XA 3LPTA 2ZE2A 3CETA 4JKBA 3CM6A 3CMAN 2ZD1A 4ELUA 3D0PA 2DFEA 3QO9A 4IG0A 4FJMA 3LAMA 3O9QA 4CJVA 3AO2A 3LALA 3BZCA 4MDBA 1U04A 2FLOA 3KLFA 1YXQA 3LWMA 1RT7A 1EWQA 3L2VA 2YNGA 4BR0A 3EKUA 3WEEA 3R1XA 4FJJA 4WQ5C 4Z4GA 1LV5A 4WQ5A 5BPNA 4DV1K 3LM9A 1B92A 3FZLA 5KQ8A 3SQ2A 4PL7A 3THVA 3CF5L 3ZT2A 1KFDA 1RT1A 3DM2A 2ZWHA 1QZ5A 5AJ3K 4BQZA 4IDHA 4FK0A 1VRUA 2G8WA 2XRIA 3Q7BA 4OPAA 1KVAA 4BDPA 2UUCK 5FPNA 3B8AX 1NU0A 3I55N 3VEZA 5K14A 3QNNA 3NVKA 4DV2K 2BTFA 1C0GA 2FSNA 1S72N 4A57A 4B8CA 1QVFM 4BVOA 4BACA 1S9EA 2JWLA 3ZLJA 1SAZA 2VG6A 4K42A 3OYKA 1WLJA 4JI4K 3H6EA 3WNEA 3K5OA 1RT4A 3O3HA 1JLAA 1RDDA 3A5OC 5ADXH 4PUOA 4JV5K 4NCAA 3CJ9A 2VGMA 3VPZA 2E2NA 3UIQA 3HI0A 4CEQA 2JWKA 4LY7A 3IAYA 2YKMA 1KFSA 4DU4A 3K58A 2E88A 1WBDA 2E20A 3AV9A 4FJHA 2HMIA 3LL3A 4NXMK 4HVJA 3MXIA 2BANA 4DHYA 3JSMA 2HHSA 4CJQA 2O8CB 3O1BA 4DQ8A 4K25A 4BREA 4ID5A 3QIPA 4BR9A 1YT3A 3MCPA 4RW9A 2QKBA 3ZT1A 1DTTA 5I3UA 4JKEA 4B9UA 2AA4A 4OGCA 4ISGA 3VQDA 3THXA 2OTJN 4FM2A 1N34K 1Q82O 1D9DA 2W6LA 3MEEA 4AHRA 2P9KA 1FXXA 3LP2A 3ZCMA 4CFDA 1N5YA 3PO4A 3P5JA 2HHHK 2QM1A 3DXKA 4H5WA 3SNNA 1JL1A 4QOZB 5EXWA 4B1XB 1DGKN 5HL7L 4H0XB 1WBBA 3OTOK 4GV6A 4GV9A 3TAQA 4BC3A 4BDYA 3M8SA 3VETA 4WFBL 3LZIA 1CZBA 1VSMA 4CFCA 1VQLN 4KAZA 1OVQA 2IGIA 3FZMA 1BI4A 1U2VA 3AVKA 4B3MK 3CQYA 1QSYA 3C7NB 4OLBA 2QTDA 1TAQA 1KLNA 1TKDA 3KVGA 4FOIA 4B9NA 1HKBA 2FF6A 2Q36A 4X62K 2P9UB 4KTWA 3BEXA 4W5NA 5KPTA 1C0UA 3LP0A 3B6PA 3RR8A 4NCGA 3CCEN 4EAHD 3NF7A 3WXLA 2A1SA 1QS4A 1RT2A 1OH6A 2GEMA 2E5LK 3U4LA 2IDOA 3GG4A 4FXDA 2IIRA 3O3GA 1YVUA 2A40A 2ZJPL 3HL8A 4W5QA 3SV3A 1U4BA 3KTQA 3P31A 4CGGA 1ITGA 1NJXA 3PY8A 4BRQA 3GL1A 4EFHA 4IXCA 4DV3K 1ZBFA 3NGZA 4V19S 4M7YA 1K8KB 1DKGD 4JLHA 2QWLA 5EU7A 5AQWA 3VQ7A 1ZBUA 4AHSA 4MLEA 2E8AA 4KI4A 3QEXA 2KFZA 4WFNL 3JXUA 1U47A 1VK0A 4JI5K 3KHYA 3FZFA 3HRGA 3HP6A 5EY4A 2VGNA 3QNOA 1HRHA 4ZHRA 3WNHA 3I0RA 1JXEA 2G8KA 2I7NA 3TAPA 1DEJA 3V1OA 4FJGA 2E6LA 4CEZA 3T69A 3CQXA 3VA0A 3MMVA 4JKCA 4DR6K 2NLXA 3ASMA 3CPEA 4BY9C 4GNIA 4CZHA 4BVPA 3O08A 4E3SA 2ZQBA 4AF1A 4I9QA 4NXNK 1NG9A 3G4SN 3TWHA 3CM5A 4Y0WA 3M8RA 2PBDA 3L4QA 4N56A 2F8SA 1C0TA 3MCAB 5M1NA 1VSDA 4IOCL 4RW6A 5C12A 2WBNA 1UA0A 4CD1A 4CF8A 4BGBA 4C8MA 4AH9A 4FWNA 4DFMA 5TKWA 1BGXT 3RRHA 1ASWA 1LAWA 1NNEA 3MWPA 4CEBA 1NGJA 3FFKB 4AILC 1N32K 1NM1A 5AQLA 4DV5K 1J53A 4CK1A 5AQIA 3QEVA 5AQFA 4FZYA 1NK9A 4FW2A 4AHTA 1VSLA 4LH5A 3ULEB 2GX9A 5A2QO 1W97L 3ENOA 1HYVA 4UY8O 3QFUA 1HKGA 2E4LA 3J7AP 2VWKA 3CJ7A 1J6ZA 4JHDB 2KZMA 4N47A 1ZBSA 3JYTA 3VQAA 5KRSA 4Y1CA 5M1FA 2WONA 1GLBG 2UUBK 4FWQA 3H08A 4DV6K 4KTQA 3CD6N 3C6HA 1RFQA 1C0MA 4CI6A 4DFJA 4ID1A 2HOEA 3DLRA 3NH0A 4DWIA 2X6SA 4YNQA 1HJOA 3K9KA 3AARA 3SUPA 2P9SB 3PSFA 3OYIA 1NK6A 4M45A 1IG8A 4I7FA 3ITHA 4PL8A 3AO3A 5AZJB 4K0KK 3L2WA 3FE1A 1KXPA 3I8DA 3AVCA 2YI1A 4CJ4A 2BH1A 3CMEN 1MA9B 4H0OA 5F0XA 3SUNA 4LF4K 3RTVA 4DMNA 3LM2A 5CZ2A 4GV3A 1MU2A 3CCJN 1U49A 3VQPA 4LF8K 2KZZA 3ZETB 3VQ8A 3UKUB 1XQSC 3QMLA 3W3DA 3ZEUB 5J2QA 2FXUA 3QINA 1IBLK 2PY5A 2KQ2A 3TAEA 1Z6RA 5FDLA 2YHAA 1TYQB 3ULDA 3ZSQA 4A5BA 3DLKA 3PV8A 3ZSXA 1FW6A 4B3SK 1HMVA 3KK2A 3VF6A 4EZ6A 1NJYA 2XY6A 4FVUA 4CHYA 1X9SA 1VQNN 2B5JA 1QZ6A 5D3GA 1BO5O 2O8BB 3VENA 4CEAA 3KIOA 3VF4A 1NGHA 3TU5A 5FPEA 3EKSA 3CCVN 4F2SA 5BN9A 1TK8A 1VHXA 2KW4A 3U8XA 1GLFO 3NCIA 1LWCA 4PKIA 4J2BA 3AY9A 4JKHA 4JAXA 5LMNK 4BWJA 4CECA 4JN4A 4OKEA 3AVNA 4FJ8A 3MK6A 4AM6A 4E19A 3ZT3A 2O8DB 4CEEA 4BC2A 3AA4A 3EL2A 3DRSA 3C6UA 1XC3A 4KBOA 1KC8O 1JKHA 3MN6A 3OA9A 3VEYA 4M3XA 4LFBK 4CJSA 3LPUA 5KPRA 4B8AB 2QWMA 5BPMA 3LAKA 1T03A 3KD1E 1HNXK 1NMNA 4CZJA 3MEGA 5C2FA 2OTLN 4IEIA 2F4VK 4B3TK 3DWLA 3TTCA 4JKAA 3E1YA 2FSKA 2CGLA 4A62A 5BR8K 3DAWA 3AO1A 4WF9L 3NVMA 1S5JA 2EX3A 4NLBA 1WSIA 3KWGA 3QB0A 5HROA 3PX0A 2PYLA 1I94K 3LP1A 2O4GA 4O44A 3ZX2A 3AA3A 3UE5A 2ASPA 1VQ6N 1NGAA 2QWRA 2QW9A 5BRFA 1NGEA 3V1RA 4KTZA 5AQVA 4LF6K 1X9MA 2FBYA 3A8YA 1VAZA 4FWRA 4IFYA 4A59A 1VQ8N 4W5OA 4EP5A 2DFHA 2GWKA 4DU1A 1W7AA 2KKZA 1J9AA 3LDSA 4DTUA 4GKKK 3HK2A 1TV6A 4CJLA 4RTFD 3VA3A 5AQZA 5JICA 4A61A 1BL3A 3L4IA 3T1YK 2QWQA 4F8RA 3G10A 1UAXA 3HPGA 1IG9A 5GIPA 5AQSA 3L3UA 4ISFA 3K2PA 5JVHL 4BE2A 4H5RA 4JKGB 1NGDA 5H1SQ 4PA1A 4CZIA 3SUOA 3T1HK 2OPQA 1SZ2A 3OHRA 1QVGM 1QTMA 3ZSYA 4CJTA 5E41A 1S1VA 4HTLA 3SJJA 1LAVA 3VOVA 3OYLA 2D0OA 4EIAA 4M3UA 3DXKB 4CCHA 1ILYA 4DS4A 3HBTA 2GBZA 1GLAG 3H1VX 1BQNA 2E2QA 3R3LA 1JLCA 4FK2A 1C0FA 4B3OA 1LWFA 4CD3A 4ZTFA 5HP1A 2HSTA 1KD1O 1KAZA 4KB0A 4IOAL 4FCYA 1JCEA 3VESA 5HLFA 3PSIA 4BRDA 1B9DA 4H4MA 1XNRK 4O4GA 5AQGA 3AVFA 2GELA 4CW7B 3O80A 3MDQA 2HHTA 3CC4N 3CCUN 4B1WB 3CXCM 5AZIA 1U48A 2P9LB 3F9KA 4QS8A 4FJIA 3O4QA 3P38A 3PO5A 1NJWA 1BHLA 3D6RA 3RR7A 2B6AA 4B08A 1VQ7N 1IKWA 4FM1A 2P9PA 4WE1A 3UB5A 4BRMA 4CJPA 4DFPA 3NBPA 4ISEA 4R5PA 1NK7A 1HKCA 4OPKA 3R9PA 5J2PA 4CGIA 1JJ2M 4H0VB 2HMPA 5KI6A 3UKRA 3TPQA 2Q31A 2HHXA 1HR0K 3D2FB 1ASVA 1LCUA 3PLAA 1YUWA 3C6TA 3OS2A 3AGKA 3VF2A 3O9RA 3C0BA 4DS5A 4LF5K 1P90A 4DV7K 1QQCA 2FC0A 4JYAK 3C95A 2HBJA 1D4XA 3HVTA 4JRQA 1N8RO 4G9ZA 4CJKA 5JS2A 4XH4A 1VSFA 3ZYYX 2O8DA 1RTJA 4FJ7A 4KHYA 3V9ZA 1XNQK 4JI3K 2Q97A 1RTDA 3C6AA 4IDKA 4CHZA 3WXMB 4NYNA 3OYNA 3SCXA 4JNEA 4A2AA 4B1YB 4OO1J 4HCCA 3L2RA 1NJZA 3CJCA 4HTUA 3U3GA 1ZYQA 3OYGA 3V6DA 1U2VB 3A5MC 4JI2K 2YKNA 2FBXA 4N5SA 4IJNA 1QSLA 1WN7A 4AQYK 2QWPA 1C1AA 3MN5A 1WSHA 3OYCA 3AVGA 3PUFA 3RMDA 3SQ0A 4H0PA 1BG3A 2F9TA 3OYBA 1IV0A 4CJRA 1E3MA 3FR0A 1RDWX 4M42A 4DTMA 5LMUK 2BGGA 4E7LA 1MWMA 4RW8A 4BROA 1RILA 3TAGA 2IS3A 4FO0A 4CEFA 3VEXA 3I33A 1VQON 3NMUA 4ELTA 1T3VA 4MFBA 4C1NK 2HBMA 5DM7L 3I56N 4DR2K 5BPLA 3HOSA 3SYZA 4Q0BA 1A5XA 4BQLA 2F9WA 5C24A 4C8LA 5BR9A 3HSTB 2HVIA 4CZKA 2QXLA 1K9MO 4CF0A 1Q86O 2Z1IA 3AVJA 5LJVA 3AVLA 5AQPA 3B6OA 4B1ZA 4FL9A 1ATRA 4O8KA 4CJWA 4BRLA 5JLHA 4IO8A 3E9PA 3MECA 5F2RA 2O8FB 1TYQA 4FM0A 1BU6O 4C8KA 4Q5VA 1WUAA 1ASUA 4H5NA 3DLBA 1Q8IA 3KWIA 4CIGA 4WQ4A 2W6KA 3SAGA 4BRPA 4C8NA 1U45A 4I9LA 3S3NA 3TTFA 1Z05A 1Y97A 3KK3A 3SLCA 4FJ9A 1Q81O 3ZSWA 2ATQA 4CEOA 3CFPA 4DTXA 2CGKA 1BIZA 5JVGL 4N76A 4WFAL 1EKEA 1SL1A 3SMSA 2OZSA 5FRMA 3HPOA 3IG1A 3GOIA 2OA8A 1TKZA 4BR7A 4CZLA 5BN8A 1P8ZA 2NZTA 3NH2A 2AP1A 2WOMA 3IUCA 4YDUA 3THYA 1V4SA 2QI2A 1LOTB 2D4WA 3D2FA 1SV5A 1RNHA 2UXDK 5DMRA 3ULEA 1JLQA 4DSLA 1HNWK 1EETA 1GOCA 3LZJA 4BRFA 2OCEA 4ILGB 5AQRA 4DR4K 4M3RA 2WTUA 1G99A 4EP4A 1DLOA 4KV8A 1NBWA 2QA4N 3VQ4A 5B8HA 3T3FA 3V4IA 1RT3A 4KH4A 1HNIA 1WOQA 4AHUA 1KLMA 4FK4A 1NKBA 4AHVA 4KRFA 4IG3A 3M1FA 1IH7A 2FBTA 3WXKA 4DQRA 4L8RB 4LFAK 1VQPN 3LDPA 1ZBLA 2XY7A 3OBWA 3KLEA 3SQ4A 5AQYA 3DRRA 3MXJA 1VQ4N 5AQQA 5IWAK 2A1RA 4QAGA 4DF8A 3SAFA 3ID6A 3O8MA 3JS6A 3OYAA 1JLBA 3DRPA 2LSNA 2ZGZA 5AQUA 1HYZA 2Q0RA 4CFBA 3ZSRA 2HHUA 2ETJA 3MWTA 4GMJB 1NGIA 3ENHA 2HNYA 1TUYA 1GLCG 1QQOA 3VEWA 3VEVA 2OANA 1ZBHA 4E89A 4IO9L 3KZBA 3DLGA 2ZJQL 2FSJA 1TK0A 1IJJA 4H5TA 1LWEA 3KKRA 4RW4A 4YOUA 3KJVA 1KSPA 2OPRA 4B9QA 4U67L 2F7TA 3VERA 4B1UB 2VG7A 4J2AA 3THWB 1SS6A 4DTSA 4I2PA 4BRGA 3SQ1A 3SBTA 1TUUA 4J2DA 4DFKA 3PX4A 5J1EA 4B9VA 1T6CA 3TAMA 1ZC6A 4IFVA 5AZJA 3QEPA 4JHDA 3MX2A 3HYFA 3P39A 4KH5A 3O6WA 3IS9A 3D2EA 3QFPA 1TKXA 1QHAA 2X74A 2QXFA 3IDHA 2HBLA 4DB3A 3K59A 3FZKA 1J5EK 1FK9A 3OYEA 3U3YA 1XMQK 4WYBA 4O0IA 4DSKA 1X3MA 3CHWA 5HRPA 5KTQA 3OJUA 4DTPA 3L8BA 5ELZA 1D8YA 1BDGA 4DSEA 1F21A 3J8AA 1SQKA 3RSEA 3SUQA 3NHGA 4DUZK 4FJKA 4CZEA 4XH1A 3LP3A 4CJFA 4FJ5A 1NLVA 3MEDA 3TSUA 4WCEL 3VGLA 3CCMN 4X65K 4BWMA 5AR0A 3F73A 4CERA 1EQYA 1U6ZA 2XY5A 3HT3A 4NO7A 1T44A 5EOYA 4KREA 2BUPA 4O5BA 1T6DA 3MAQA 4FWLA 2HHQA 5GAHP 5AFUA 4CZMA 4DU3A 4AM7A 4CJEA 4BDZA 1BA0A 3CYMA 3H3OB 4F2RA 4KHWA 1R59O 1GLDG 3LDQA 4JKDA 2IVPA 3GBTA 3RMAA 3E66A 5AQMA 5FROA 1I3AA 4DKWA 3CQ8A 5TKYA 1S22A 4LSLA 1XHZA 3IFRA 3QICA 4DQPA 2NRWA 3AO5A 4KKOA 4DR3K 1HYSA 4CEDA 4E1JA 2YNFA 4IOXA 4BR4A 3O9SA 2XO7A 3DLHA 3F9MA 3Q7CA 1WNSA 3VEOA 4KHPK 1SKWA 1BISA 3M6GA 3WQUA 3BDPA 4N41A 4JK7A 4BE1A 1M1KO 3NF6A 4FWPA 5C2DA 4RWTA 2P9NA 2V52B 2KLAA 4FLYA 3E01A 5JMVA 3OYDA 4M63C 1S9GA 3BF3A 4O0JA 3TI0A 4FWMA 1YF5L 5KGWA 3K9JA 5KQDA 2G8FA 5LJWA 1FJGK 3DXMA 2ZGYA 4FWOA 3V1QA 5E84A 5FPMA 4CJ3A 1BCOA 1E4GT 4OKJA 1W9HA 4BRKA 2R7YA 2A3ZA 1RDCA 3HVRA 3AAPA 4F3TA 2P9IA 4DLEA 2F8TA 4BGAA 2HBKA 1TK5A 1KTQA 3K5NA 4DTOA 2NRVA 3M8PA 4OPHA 4JD2A 2HHWA 1SKRA 2GUPA 2HF3A 3KLIA 2JGUA 1KAYA 4DSFA 3V81A 2JLEA 3CJBA 2RF2A 1D9FA 2O8EB 4GVEA 2P9SA 5GINA 1Q18A 4RW7A 4HHTA 4LD0A 4DR5K 5FLXO 5HRSA 3ATVA 4YY3K 1T05A 5M1OA 2P5GA 3VQCA 5SWMA 4DV0K 3VQ9A 4LSNA 2NNWA 5BREA 3U9DA 1Z26A 4Y1DA 3PX6A 2EHGA 5AZIB 3QDKA 1WSGA 3RRGA 3SJHA 1E4FT 3H46O 3M5RA 1NK4A 4CJ5A 2I7PA 5CHIA 4CK3A 4X64K 3G71N 1RBRA 1KCFA 1JL2A 1YITN 3WEEB 2XHBA 4Z4FA 3RWUA 5AQTA 4A2BA 2D0AA 3AVIA 3GE1A 3FGUA 3ZX0A 3N4QA 2P5OA 3NFAA 3SI6A 3ZEUA 4ELVA 4HUFA 1HPMA 3EE9A 3CJAA 3R8EA 3AGRA 1W0HA 4MDAA 4KHNA 5C25A 4BRIA 2KHOA 5ADXA 2EWSA 4JS4A 1QE1A 3A5LC 1WSFA 4Z4IA 1CZ9A 2VYPA 3UKUA 1GLEG 2CGJA 1YTAA 1QQMA 3E9LA 1EX4A 4JRPA 1TKTA 4MQ3A 1C1BA 1DTQA 1G15A 3QBWA 3MN7A 3KKSA
chains in the Genus database with same CATH topology
1Q9YA 4FZZA 2RKIA 3S3MA 1VK0A 1C1AA 1WSHA 3OYCA 4OLAA 3ALYA 3AVGA 1Q9XA 3PUFA 3HP6A 3RMDA 2DTUA 4CK2A 3QNOA 3SQ0A 1HRHA 3NE6A 1NK0A 4ZHRA 2YHBA 2ITGA 3AA5X 3I0RA 1JXEA 3AVBA 3WNHA 4CJUA 2G8KA 3OYBA 3TAPA 4CJRA 1WAJA 2OPPA 3V1OA 4FJGA 2BE2A 2E6LA 3D45A 4CEZA 4CF2A 3VA0A 4M42A 2DY4A 3OVNA 4DTMA 4ZTJA 3ASMA 4E7LA 1SL0A 2BGGA 3V9UA 4RW8A 3TAGA 1RILA 3NH1A 3QETA 4E3SA 2IS3A 2ZQBA 4I9QA 1S6PA 4CEFA 4OJRA 1BCMA 4ELTA 4CFAA 4MFBA 4DTNA 3TWHA 3CM5A 1A5WA 2P51A 3M8RA 4Q0BA 3SYZA 1A5XA 2IC3A 4KPYA 5C24A 4C8LA 1HJRA 3HSTB 2HVIA 4N56A 1R0AA 2F8SA 1C0TA 4CF0A 1VSDA 1UOCA 2Z1IA 3AVJA 3AVLA 4RW6A 3TANA 3B6OA 5KRTA 4HUGA 1SUQA 1Z25A 2RN2A 1UA0A 2HB5A 3FFIA 4CF8A 3EZ5A 4C8MA 3ISNC 4AH9A 3K5MA 4DFMA 4CJWA 3TABA 2VWJA 1BGXT 3KLHA 3RRHA 1ASWA 3DYAA 3VQBA 2FBVA 1LAWA 3AVAA 4CEBA 1RT5A 4AILC 1D5AA 3KD5E 3MECA 1IKXA 4FM0A 3QLHA 4Z0UA 1VSJA 4CIEA 1J53A 4CK1A 2PYJA 4Q5VA 4C8KA 3QEVA 4LH4A 2D0CA 4FZYA 1ASUA 3QEIA 1NK9A 2P1JA 3AVHA 4FW2A 2HVHA 3BGRA 4AHTA 3DLBA 1Q8IA 1VSLA 4LH5A 4CIGA 3SZ2A 4FVMA 2OPSA 4OPJA 3TR8A 1HYVA 5J2NA 3AO4A 3AA2A 4C8NA 2E4LA 4PY5A 2VWKA 1U45A 1KVBA 1BI4B 4FLUA 2KZMA 1KRPA 1O1WA 4I9LA 5DK5A 4N47A 3S3NA 4F4KA 4BE0A 2IOCA 3NF9A 1HPZA 3JYTA 3VQAA 2HW3A 4GW6A 1Y97A 3KK3A 1CXUA 5KRSA 2G8HA 4Y1CA 4FJ9A 4CHQA 3ZSWA 2ATQA 4CEOA 1RT6A 2WONA 4W5RA 3CFPA 1BIZA 4DTXA 3H08A 2X6NA 2OYQA 1LW2A 1EKEA 1SKSA 1SL1A 4CESA 4KTQA 4N76A 2O4IA 2OZMA 2GV9A 4M3TA 2OZSA 1RBSA 1C0MA 5FRMA 4DFJA 4ID1A 3HPOA 2BDPA 3DLRA 3IG1A 3NH0A 3CFRA 4DWIA 2OA8A 4E0DA 1TKZA 1FKOA 2X6SA 4XIUA 4YNQA 3OYJA 3SUPA 4UQGA 4DSIA 4Z4CA 3NH2A 3O3FA 3OYFA 3OYIA 2Y1JA 2WOMA 1L3UA 1NK6A 2I5JA 4M45A 3HJFA 1QSSA 4OGEA 4I7FA 4Z4EA 3ITHA 2HNDA 3L3VA 1B9FA 1HQUA 2RPIA 3NGIA 4OVLA 1IKYA 5T7BA 1SV5A 3TAFA 1RNHA 3AO3A 5DMRA 2Y1IA 1JLQA 5CYMA 3K57A 3VQ6A 4DSLA 1RBTA 3L2WA 1I39A 3LANA 1EETA 1GOCA 3I8DA 3AVCA 3A2FA 4CJ4A 3LZJA 3S9HA 2KFNA 2QKKA 2PZSA 4M3RA 1RDAA 1EXQA 3VQQA 3S3OA 3OYMA 4EP4A 1DLOA 4KV8A 3C94A 1T8EA 1VSEA 3SUNA 1NK5A 3VQ4A 2KTQA 3RTVA 2XY8A 1U47A 1NKEA 4FJNA 4DMNA 3T3FA 1S6QA 1RT3A 3V4IA 1HNIA 1BIUA 5SZTA 3SPZA 5CZ2A 3DMJA 4AHUA 1KLMA 1MU2A 5HRNA 1U49A 4FK4A 1NKBA 3VQPA 4AHVA 4NYFA 3QEWA 4KRFA 2KZZA 1S1WA 3VQ8A 4IG3A 3ZSOA 5KGXA 4HCBA 1IH7A 2FBTA 1L3TA 5J2QA 3QINA 4DQRA 2PY5A 4L8RB 2AJQA 2KQ2A 3TAEA 5CZ1A 5FDLA 1RDBA 2Q3SA 2YHAA 1ZBLA 1RBUA 3ULDA 2XY7A 3T1AA 3HPHA 3KLEA 3P83D 1TAUA 3SQ4A 4JS5A 1JLFA 3ZSQA 1UWBA 3DRRA 1BQMA 3MXJA 4QCLA 3DLKA 3PV8A 3ZSXA 2A1RA 1HMVA 4DF4A 3VN5A 3KK2A 4QAGA 4DF8A 4EZ6A 1RCHA 3V9WA 3OYAA 1NJYA 2XY6A 4ICLA 1CXQA 1JLBA 2HNZA 4CHYA 1X9SA 4FJXA 4KO0A 3DRPA 2B5JA 4CHPA 2Z1JA 5D3GA 2LSNA 3OJSA 4CEAA 1HYZA 4O55A 4CFBA 3CFOA 3ZSRA 2HHUA 3RMCA 2D0BA 2ETJA 3KIOA 3QESA 4GMJB 3WNFA 1WAFA 2HNYA 1ZBIA 1LW0A 2B4JA 4F2SA 4M3YA 1ZBHA 2Z1GA 4TSXA 4E89A 1TK8A 1S1TA 3SPYA 4KHUA 3DLGA 3I0SA 2KW4A 1L3SA 4CF1A 1TVRA 1TK0A 3NCIA 1WSEA 3NDKA 1LWEA 5CYQA 3KKRA 4RW4A 3KJVA 1LWCA 1KSPA 4J2BA 3AVMA 3DI6A 4BWJA 2OPRA 2X78A 1QHTA 4AHCA 4FLXA 4IBNA 4CECA 4B9TA 2G8UA 3NF8A 2VG7A 4OKEA 4J2AA 3OYHA 3AVNA 3L2QA 2Z1HA 4E7IA 4FJ8A 4PWDA 4H4OA 4DTSA 4I2PA 3SQ1A 4Z4HA 1JLGA 4J2DA 4FLWA 4DFKA 4KHQA 4E19A 3KLGA 3PX4A 3V9SA 3ZT3A 1XWLA 4CEEA 5J1EA 4B9VA 3TAMA 3AA4A 4IFVA 3QEPA 3DRSA 4M41A 4HUEA 1L3VA 3HYFA 1RTHA 3C6UA 3MXMA 3V9XA 4KI6A 4DTJA 3VQ5A 3HP9A 3ZSZA 4E1MA 1VSKA 1JKHA 3IS9A 1TGOA 3P1GA 1TKXA 2X74A 1IO2A 2QXFA 3ZT0A 5HBMA 4CIFA 4YFUA 1GOBA 5I42A 1XHXA 4M3XA 4DSJA 4CJSA 4CGHA 4B9SA 3LPUA 4K8XA 3K59A 3LPTA 4B8AB 2ZE2A 4DQSA 3CM6A 1FK9A 2ZD1A 3LAKA 1T03A 1TL3A 3OYEA 3U3YA 3D0PA 4ELUA 2DFEA 3QO9A 4IG0A 3KD1E 4O0IA 4DSKA 2DFFA 4FJMA 3LAMA 1HQEA 4CJVA 5HRPA 3AO2A 3MEGA 3LALA 2E6MA 1U04A 5KTQA 3SV4A 3OJUA 3KLFA 3L8BA 4DTPA 3IRXA 3LWMA 1D8YA 4DSEA 2IAJA 1F21A 1RT7A 3SUQA 1VSHA 3NHGA 4FJKA 4G1QA 3AO1A 3DOKA 3LP3A 3MEDA 4CJFA 3L2VA 1XC9A 4FJ5A 2YNGA 1S5JA 4CF9A 2EX3A 5HRRA 4FJJA 1WSIA 4BWMA 5HROA 3F73A 4CERA 3PX0A 4KFBA 2PYLA 4Z4GA 3LP1A 2XY5A 4FLZA 3HT3A 1LV5A 2O4GA 4O44A 3RMBA 3AA3A 1HNVA 1B92A 2F96A 2D5RA 3THVA 3SQ2A 2W42A 4KREA 4FYDA 4O5BA 5CY4A 3CG7A 3ZT2A 1KFDA 1RT1A 3DM2A 3MAQA 1VSIA 2HHQA 3V1RA 4KTZA 4C8OA 4DU3A 4PQUA 2G8VA 1X9MA 2FBYA 4CJEA 4BDZA 4FK0A 1VRUA 3CYMA 4F2RA 4IFYA 2G8WA 4KHWA 4W5OA 4EP5A 2DFHA 5C42A 2XRIA 4DU1A 3RMAA 1KVAA 4BDPA 4J2EA 5FROA 1J9AA 3LDSA 1I3AA 3CQ8A 4DTUA 5K14A 3QNNA 3HK2A 2YV0X 1TV6A 3ZSVA 4CJLA 3VA3A 4LSLA 1XHZA 1BL3A 4DQPA 4W5TA 3AO5A 4B8CA 4F8RA 3G10A 3KK1A 4KKOA 1C6VA 1UAXA 3HPGA 4BACA 3M8QA 4M3WA 3DLEA 1HYSA 4DTRA 1FKPA 4CEDA 1S9EA 1IG9A 4EZ9A 3WNGA 2YNFA 3L3UA 1J5OA 3VQEA 2VG6A 3K2PA 1WLJA 3ZT4A 4H8KA 3OYKA 4BE2A 2YNHA 3WNEA 2XO7A 3HO1A 3K5OA 1JXBA 4RG8A 3OS0A 3DLHA 1RT4A 3O3HA 4PA1A 1JLAA 1RDDA 1WNSA 3SUOA 2OPQA 1QTMA 1TL1A 1SKWA 1BISA 3ZSYA 4CJTA 4PUOA 5E41A 3BDPA 1S1VA 4N41A 4DQQA 1N6QA 3SJJA 1LAVA 4CHNA 4NCAA 3OYLA 3O4NA 3HM9A 1NOYA 3OY9A 4BE1A 4CCHA 3UIQA 4M3UA 1IKVA 4DS4A 3NF6A 4CEQA 3EY1A 2GBZA 4DQIA 2VG5A 1BQNA 4LY7A 1EP4A 4KB1A 1NOZA 4FLYA 3E01A 2YKMA 1JLCA 1REVA 3OYDA 3EYZA 1KFSA 3IAYA 4FK2A 4B3OA 4DU4A 3K58A 1LWFA 1S9GA 4ZTFA 4O0JA 5HP1A 3HXMA 3TI0A 1NKCA 3AV9A 4FJHA 2HMIA 5KGWA 4HVJA 3MXIA 4M3ZA 2BANA 2G8FA 3JSMA 2HHSA 4KB0A 4CJQA 1GOAA 4FCYA 3V1QA 4ID5A 4K8ZA 4CJ3A 3QIPA 3TARA 1YT3A 1BCOA 4OKJA 5HLFA 4B9MA 1W9HA 4RW9A 1NK8A 1UA1A 1J54A 2QKBA 2R7YA 3ZT1A 1X1PA 1DTTA 1B9DA 5I3UA 4E7JA 4H4MA 3QERA 2QK9A 1RDCA 4O4GA 3AVFA 2GUIA 4B9UA 1S1UA 2NUBA 3HVRA 3G0ZA 4OGCA 3VQDA 2HHTA 4F3TA 4FM2A 3U6FA 1CLQA 3DOLA 4DLEA 1D9DA 2F8TA 1U48A 4FLVA 3NGYA 1XI1A 3MEEA 3F9KA 4AHRA 4IKFA 1TK5A 1KTQA 1FXXA 3LP2A 3ZCMA 4CFDA 3K5NA 3O4QA 4DTOA 1N5YA 3PO4A 3PO5A 3M8PA 1NJWA 4FJIA 1BHLA 4FZXC 3P5JA 4CGJA 3SNNA 2HHWA 4FW1A 1JL1A 2B6AA 3RR7A 4CGFA 1SKRA 4QOZB 4B08A 3KLIA 2JGUA 1RTIA 4DSFA 1IKWA 4FM1A 4CHOA 4WE1A 3V81A 4CJPA 4DFPA 3OS1A 2JLEA 3NBPA 2RF2A 3TAQA 4R5PA 1NK7A 1D9FA 4BDYA 3M8SA 4OPKA 5J2PA 1KVCA 4CGIA 3LZIA 5FRNA 1CZBA 1A5VA 5KI6A 4RW7A 4HHTA 4LD0A 2HHXA 1X9WA 4F3OA 2G8IA 5HRSA 1ASVA 1T05A 4GVMA 3L2UA 2P5GA 1S1XA 1VSMA 4CFCA 4B9LA 1K6YA 3C6TA 4KAZA 3OS2A 2IGIA 3VQCA 1BI4A 5SWMA 3VQ9A 1RBVA 4LSNA 4KHSA 3AVKA 1YTUA 4DLGA 1QSYA 3NAEA 1Z26A 4Y1DA 1SL2A 4DS5A 4OLBA 3PX6A 2EHGA 3RRGA 1WSGA 1TAQA 5J2MA 1KLNA 1QQCA 2FC0A 1NK4A 3C95A 1TKDA 4CJ5A 3HVTA 4E1NA 4JRQA 4B9NA 3LWLA 4CK3A 1RBRA 1KCFA 3QIOA 1JL2A 1T7PA 4CJKA 4NCBA 4KTWA 4W5NA 5JS2A 4CGDA 1C0UA 1VSFA 3LP0A 3B6PA 2XHBA 3RR8A 4NCGA 4Z4FA 3T19A 3RWUA 1RTJA 3NF7A 4CE9A 4FJ7A 4KHYA 2D0AA 3AVIA 2A1SA 3V9ZA 1QS4A 1RT2A 2HHVA 2P5OA 4FJLA 3NFAA 3SI6A 4FLTA 4ELVA 4HUFA 1RTDA 2IDOA 4IDKA 4FXDA 4OKKA 3O3GA 4CHZA 3K5LA 1W0HA 1YVUA 4E7HA 4KHNA 3HL8A 5C25A 4W5QA 1WSJA 4NYNA 3OYNA 3SV3A 1U4BA 3KTQA 3SCXA 4JS4A 4CGGA 4E7KA 1ITGA 1NJXA 1QE1A 3PY8A 4DG1A 1WSFA 4Z4IA 1CZ9A 4HCCA 3L2RA 1L5UA 1ZBFA 2YNIA 1JLEA 4I2QA 3NGZA 1NJZA 4HTUA 1C1CA 1YTAA 4JLHA 3U3GA 5JS1A 1ZYQA 4JRPA 1EX4A 5EU7A 1TKTA 3VQ7A 3OYGA 1ZBUA 3V6DA 4AHSA 4MQ3A 1C1BA 1DTQA 1G15A 2YKNA 2FBXA 4N5SA 3QEXA 4KI4A 1VRTA 2KFZA 1QSLA 1WN7A 3KKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9Y A;  4FZZ A;  2RKI A;  3S3M A;  1VK0 A;  1C1A A;  1WSH A;  3OYC A;  4OLA A;  3ALY A;  3AVG A;  1Q9X A;  3PUF A;  3HP6 A;  3RMD A;  2DTU A;  4CK2 A;  3QNO A;  3SQ0 A;  1HRH A;  3NE6 A;  1NK0 A;  4ZHR A;  2YHB A;  2ITG A;  3AA5 X;  3I0R A;  1JXE A;  3AVB A;  3WNH A;  4CJU A;  2G8K A;  3OYB A;  3TAP A;  4CJR A;  1WAJ A;  2OPP A;  3V1O A;  4FJG A;  2BE2 A;  2E6L A;  3D45 A;  4CEZ A;  4CF2 A;  3VA0 A;  4M42 A;  2DY4 A;  3OVN A;  4DTM A;  4ZTJ A;  3ASM A;  4E7L A;  1SL0 A;  2BGG A;  3V9U A;  4RW8 A;  3TAG A;  1RIL A;  3NH1 A;  3QET A;  4E3S A;  2IS3 A;  2ZQB A;  4I9Q A;  1S6P A;  4CEF A;  4OJR A;  1BCM A;  4ELT A;  4CFA A;  4MFB A;  4DTN A;  3TWH A;  3CM5 A;  1A5W A;  2P51 A;  3M8R A;  4Q0B A;  3SYZ A;  1A5X A;  2IC3 A;  4KPY A;  5C24 A;  4C8L A;  1HJR A;  3HST B;  2HVI A;  4N56 A;  1R0A A;  2F8S A;  1C0T A;  4CF0 A;  1VSD A;  1UOC A;  2Z1I A;  3AVJ A;  3AVL A;  4RW6 A;  3TAN A;  3B6O A;  5KRT A;  4HUG A;  1SUQ A;  1Z25 A;  2RN2 A;  1UA0 A;  2HB5 A;  3FFI A;  4CF8 A;  3EZ5 A;  4C8M A;  3ISN C;  4AH9 A;  3K5M A;  4DFM A;  4CJW A;  3TAB A;  2VWJ A;  1BGX T;  3KLH A;  3RRH A;  1ASW A;  3DYA A;  3VQB A;  2FBV A;  1LAW A;  3AVA A;  4CEB A;  1RT5 A;  4AIL C;  1D5A A;  3KD5 E;  3MEC A;  1IKX A;  4FM0 A;  3QLH A;  4Z0U A;  1VSJ A;  4CIE A;  1J53 A;  4CK1 A;  2PYJ A;  4Q5V A;  4C8K A;  3QEV A;  4LH4 A;  2D0C A;  4FZY A;  1ASU A;  3QEI A;  1NK9 A;  2P1J A;  3AVH A;  4FW2 A;  2HVH A;  3BGR A;  4AHT A;  3DLB A;  1Q8I A;  1VSL A;  4LH5 A;  4CIG A;  3SZ2 A;  4FVM A;  2OPS A;  4OPJ A;  3TR8 A;  1HYV A;  5J2N A;  3AO4 A;  3AA2 A;  4C8N A;  2E4L A;  4PY5 A;  2VWK A;  1U45 A;  1KVB A;  1BI4 B;  4FLU A;  2KZM A;  1KRP A;  1O1W A;  4I9L A;  5DK5 A;  4N47 A;  3S3N A;  4F4K A;  4BE0 A;  2IOC A;  3NF9 A;  1HPZ A;  3JYT A;  3VQA A;  2HW3 A;  4GW6 A;  1Y97 A;  3KK3 A;  1CXU A;  5KRS A;  2G8H A;  4Y1C A;  4FJ9 A;  4CHQ A;  3ZSW A;  2ATQ A;  4CEO A;  1RT6 A;  2WON A;  4W5R A;  3CFP A;  1BIZ A;  4DTX A;  3H08 A;  2X6N A;  2OYQ A;  1LW2 A;  1EKE A;  1SKS A;  1SL1 A;  4CES A;  4KTQ A;  4N76 A;  2O4I A;  2OZM A;  2GV9 A;  4M3T A;  2OZS A;  1RBS A;  1C0M A;  5FRM A;  4DFJ A;  4ID1 A;  3HPO A;  2BDP A;  3DLR A;  3IG1 A;  3NH0 A;  3CFR A;  4DWI A;  2OA8 A;  4E0D A;  1TKZ A;  1FKO A;  2X6S A;  4XIU A;  4YNQ A;  3OYJ A;  3SUP A;  4UQG A;  4DSI A;  4Z4C A;  3NH2 A;  3O3F A;  3OYF A;  3OYI A;  2Y1J A;  2WOM A;  1L3U A;  1NK6 A;  2I5J A;  4M45 A;  3HJF A;  1QSS A;  4OGE A;  4I7F A;  4Z4E A;  3ITH A;  2HND A;  3L3V A;  1B9F A;  1HQU A;  2RPI A;  3NGI A;  4OVL A;  1IKY A;  5T7B A;  1SV5 A;  3TAF A;  1RNH A;  3AO3 A;  5DMR A;  2Y1I A;  1JLQ A;  5CYM A;  3K57 A;  3VQ6 A;  4DSL A;  1RBT A;  3L2W A;  1I39 A;  3LAN A;  1EET A;  1GOC A;  3I8D A;  3AVC A;  3A2F A;  4CJ4 A;  3LZJ A;  3S9H A;  2KFN A;  2QKK A;  2PZS A;  4M3R A;  1RDA A;  1EXQ A;  3VQQ A;  3S3O A;  3OYM A;  4EP4 A;  1DLO A;  4KV8 A;  3C94 A;  1T8E A;  1VSE A;  3SUN A;  1NK5 A;  3VQ4 A;  2KTQ A;  3RTV A;  2XY8 A;  1U47 A;  1NKE A;  4FJN A;  4DMN A;  3T3F A;  1S6Q A;  1RT3 A;  3V4I A;  1HNI A;  1BIU A;  5SZT A;  3SPZ A;  5CZ2 A;  3DMJ A;  4AHU A;  1KLM A;  1MU2 A;  5HRN A;  1U49 A;  4FK4 A;  1NKB A;  3VQP A;  4AHV A;  4NYF A;  3QEW A;  4KRF A;  2KZZ A;  1S1W A;  3VQ8 A;  4IG3 A;  3ZSO A;  5KGX A;  4HCB A;  1IH7 A;  2FBT A;  1L3T A;  5J2Q A;  3QIN A;  4DQR A;  2PY5 A;  4L8R B;  2AJQ A;  2KQ2 A;  3TAE A;  5CZ1 A;  5FDL A;  1RDB A;  2Q3S A;  2YHA A;  1ZBL A;  1RBU A;  3ULD A;  2XY7 A;  3T1A A;  3HPH A;  3KLE A;  3P83 D;  1TAU A;  3SQ4 A;  4JS5 A;  1JLF A;  3ZSQ A;  1UWB A;  3DRR A;  1BQM A;  3MXJ A;  4QCL A;  3DLK A;  3PV8 A;  3ZSX A;  2A1R A;  1HMV A;  4DF4 A;  3VN5 A;  3KK2 A;  4QAG A;  4DF8 A;  4EZ6 A;  1RCH A;  3V9W A;  3OYA A;  1NJY A;  2XY6 A;  4ICL A;  1CXQ A;  1JLB A;  2HNZ A;  4CHY A;  1X9S A;  4FJX A;  4KO0 A;  3DRP A;  2B5J A;  4CHP A;  2Z1J A;  5D3G A;  2LSN A;  3OJS A;  4CEA A;  1HYZ A;  4O55 A;  4CFB A;  3CFO A;  3ZSR A;  2HHU A;  3RMC A;  2D0B A;  2ETJ A;  3KIO A;  3QES A;  4GMJ B;  3WNF A;  1WAF A;  2HNY A;  1ZBI A;  1LW0 A;  2B4J A;  4F2S A;  4M3Y A;  1ZBH A;  2Z1G A;  4TSX A;  4E89 A;  1TK8 A;  1S1T A;  3SPY A;  4KHU A;  3DLG A;  3I0S A;  2KW4 A;  1L3S A;  4CF1 A;  1TVR A;  1TK0 A;  3NCI A;  1WSE A;  3NDK A;  1LWE A;  5CYQ A;  3KKR A;  4RW4 A;  3KJV A;  1LWC A;  1KSP A;  4J2B A;  3AVM A;  3DI6 A;  4BWJ A;  2OPR A;  2X78 A;  1QHT A;  4AHC A;  4FLX A;  4IBN A;  4CEC A;  4B9T A;  2G8U A;  3NF8 A;  2VG7 A;  4OKE A;  4J2A A;  3OYH A;  3AVN A;  3L2Q A;  2Z1H A;  4E7I A;  4FJ8 A;  4PWD A;  4H4O A;  4DTS A;  4I2P A;  3SQ1 A;  4Z4H A;  1JLG A;  4J2D A;  4FLW A;  4DFK A;  4KHQ A;  4E19 A;  3KLG A;  3PX4 A;  3V9S A;  3ZT3 A;  1XWL A;  4CEE A;  5J1E A;  4B9V A;  3TAM A;  3AA4 A;  4IFV A;  3QEP A;  3DRS A;  4M41 A;  4HUE A;  1L3V A;  3HYF A;  1RTH A;  3C6U A;  3MXM A;  3V9X A;  4KI6 A;  4DTJ A;  3VQ5 A;  3HP9 A;  3ZSZ A;  4E1M A;  1VSK A;  1JKH A;  3IS9 A;  1TGO A;  3P1G A;  1TKX A;  2X74 A;  1IO2 A;  2QXF A;  3ZT0 A;  5HBM A;  4CIF A;  4YFU A;  1GOB A;  5I42 A;  1XHX A;  4M3X A;  4DSJ A;  4CJS A;  4CGH A;  4B9S A;  3LPU A;  4K8X A;  3K59 A;  3LPT A;  4B8A B;  2ZE2 A;  4DQS A;  3CM6 A;  1FK9 A;  2ZD1 A;  3LAK A;  1T03 A;  1TL3 A;  3OYE A;  3U3Y A;  3D0P A;  4ELU A;  2DFE A;  3QO9 A;  4IG0 A;  3KD1 E;  4O0I A;  4DSK A;  2DFF A;  4FJM A;  3LAM A;  1HQE A;  4CJV A;  5HRP A;  3AO2 A;  3MEG A;  3LAL A;  2E6M A;  1U04 A;  5KTQ A;  3SV4 A;  3OJU A;  3KLF A;  3L8B A;  4DTP A;  3IRX A;  3LWM A;  1D8Y A;  4DSE A;  2IAJ A;  1F21 A;  1RT7 A;  3SUQ A;  1VSH A;  3NHG A;  4FJK A;  4G1Q A;  3AO1 A;  3DOK A;  3LP3 A;  3MED A;  4CJF A;  3L2V A;  1XC9 A;  4FJ5 A;  2YNG A;  1S5J A;  4CF9 A;  2EX3 A;  5HRR A;  4FJJ A;  1WSI A;  4BWM A;  5HRO A;  3F73 A;  4CER A;  3PX0 A;  4KFB A;  2PYL A;  4Z4G A;  3LP1 A;  2XY5 A;  4FLZ A;  3HT3 A;  1LV5 A;  2O4G A;  4O44 A;  3RMB A;  3AA3 A;  1HNV A;  1B92 A;  2F96 A;  2D5R A;  3THV A;  3SQ2 A;  2W42 A;  4KRE A;  4FYD A;  4O5B A;  5CY4 A;  3CG7 A;  3ZT2 A;  1KFD A;  1RT1 A;  3DM2 A;  3MAQ A;  1VSI A;  2HHQ A;  3V1R A;  4KTZ A;  4C8O A;  4DU3 A;  4PQU A;  2G8V A;  1X9M A;  2FBY A;  4CJE A;  4BDZ A;  4FK0 A;  1VRU A;  3CYM A;  4F2R A;  4IFY A;  2G8W A;  4KHW A;  4W5O A;  4EP5 A;  2DFH A;  5C42 A;  2XRI A;  4DU1 A;  3RMA A;  1KVA A;  4BDP A;  4J2E A;  5FRO A;  1J9A A;  3LDS A;  1I3A A;  3CQ8 A;  4DTU A;  5K14 A;  3QNN A;  3HK2 A;  2YV0 X;  1TV6 A;  3ZSV A;  4CJL A;  3VA3 A;  4LSL A;  1XHZ A;  1BL3 A;  4DQP A;  4W5T A;  3AO5 A;  4B8C A;  4F8R A;  3G10 A;  3KK1 A;  4KKO A;  1C6V A;  1UAX A;  3HPG A;  4BAC A;  3M8Q A;  4M3W A;  3DLE A;  1HYS A;  4DTR A;  1FKP A;  4CED A;  1S9E A;  1IG9 A;  4EZ9 A;  3WNG A;  2YNF A;  3L3U A;  1J5O A;  3VQE A;  2VG6 A;  3K2P A;  1WLJ A;  3ZT4 A;  4H8K A;  3OYK A;  4BE2 A;  2YNH A;  3WNE A;  2XO7 A;  3HO1 A;  3K5O A;  1JXB A;  4RG8 A;  3OS0 A;  3DLH A;  1RT4 A;  3O3H A;  4PA1 A;  1JLA A;  1RDD A;  1WNS A;  3SUO A;  2OPQ A;  1QTM A;  1TL1 A;  1SKW A;  1BIS A;  3ZSY A;  4CJT A;  4PUO A;  5E41 A;  3BDP A;  1S1V A;  4N41 A;  4DQQ A;  1N6Q A;  3SJJ A;  1LAV A;  4CHN A;  4NCA A;  3OYL A;  3O4N A;  3HM9 A;  1NOY A;  3OY9 A;  4BE1 A;  4CCH A;  3UIQ A;  4M3U A;  1IKV A;  4DS4 A;  3NF6 A;  4CEQ A;  3EY1 A;  2GBZ A;  4DQI A;  2VG5 A;  1BQN A;  4LY7 A;  1EP4 A;  4KB1 A;  1NOZ A;  4FLY A;  3E01 A;  2YKM A;  1JLC A;  1REV A;  3OYD A;  3EYZ A;  1KFS A;  3IAY A;  4FK2 A;  4B3O A;  4DU4 A;  3K58 A;  1LWF A;  1S9G A;  4ZTF A;  4O0J A;  5HP1 A;  3HXM A;  3TI0 A;  1NKC A;  3AV9 A;  4FJH A;  2HMI A;  5KGW A;  4HVJ A;  3MXI A;  4M3Z A;  2BAN A;  2G8F A;  3JSM A;  2HHS A;  4KB0 A;  4CJQ A;  1GOA A;  4FCY A;  3V1Q A;  4ID5 A;  4K8Z A;  4CJ3 A;  3QIP A;  3TAR A;  1YT3 A;  1BCO A;  4OKJ A;  5HLF A;  4B9M A;  1W9H A;  4RW9 A;  1NK8 A;  1UA1 A;  1J54 A;  2QKB A;  2R7Y A;  3ZT1 A;  1X1P A;  1DTT A;  1B9D A;  5I3U A;  4E7J A;  4H4M A;  3QER A;  2QK9 A;  1RDC A;  4O4G A;  3AVF A;  2GUI A;  4B9U A;  1S1U A;  2NUB A;  3HVR A;  3G0Z A;  4OGC A;  3VQD A;  2HHT A;  4F3T A;  4FM2 A;  3U6F A;  1CLQ A;  3DOL A;  4DLE A;  1D9D A;  2F8T A;  1U48 A;  4FLV A;  3NGY A;  1XI1 A;  3MEE A;  3F9K A;  4AHR A;  4IKF A;  1TK5 A;  1KTQ A;  1FXX A;  3LP2 A;  3ZCM A;  4CFD A;  3K5N A;  3O4Q A;  4DTO A;  1N5Y A;  3PO4 A;  3PO5 A;  3M8P A;  1NJW A;  4FJI A;  1BHL A;  4FZX C;  3P5J A;  4CGJ A;  3SNN A;  2HHW A;  4FW1 A;  1JL1 A;  2B6A A;  3RR7 A;  4CGF A;  1SKR A;  4QOZ B;  4B08 A;  3KLI A;  2JGU A;  1RTI A;  4DSF A;  1IKW A;  4FM1 A;  4CHO A;  4WE1 A;  3V81 A;  4CJP A;  4DFP A;  3OS1 A;  2JLE A;  3NBP A;  2RF2 A;  3TAQ A;  4R5P A;  1NK7 A;  1D9F A;  4BDY A;  3M8S A;  4OPK A;  5J2P A;  1KVC A;  4CGI A;  3LZI A;  5FRN A;  1CZB A;  1A5V A;  5KI6 A;  4RW7 A;  4HHT A;  4LD0 A;  2HHX A;  1X9W A;  4F3O A;  2G8I A;  5HRS A;  1ASV A;  1T05 A;  4GVM A;  3L2U A;  2P5G A;  1S1X A;  1VSM A;  4CFC A;  4B9L A;  1K6Y A;  3C6T A;  4KAZ A;  3OS2 A;  2IGI A;  3VQC A;  1BI4 A;  5SWM A;  3VQ9 A;  1RBV A;  4LSN A;  4KHS A;  3AVK A;  1YTU A;  4DLG A;  1QSY A;  3NAE A;  1Z26 A;  4Y1D A;  1SL2 A;  4DS5 A;  4OLB A;  3PX6 A;  2EHG A;  3RRG A;  1WSG A;  1TAQ A;  5J2M A;  1KLN A;  1QQC A;  2FC0 A;  1NK4 A;  3C95 A;  1TKD A;  4CJ5 A;  3HVT A;  4E1N A;  4JRQ A;  4B9N A;  3LWL A;  4CK3 A;  1RBR A;  1KCF A;  3QIO A;  1JL2 A;  1T7P A;  4CJK A;  4NCB A;  4KTW A;  4W5N A;  5JS2 A;  4CGD A;  1C0U A;  1VSF A;  3LP0 A;  3B6P A;  2XHB A;  3RR8 A;  4NCG A;  4Z4F A;  3T19 A;  3RWU A;  1RTJ A;  3NF7 A;  4CE9 A;  4FJ7 A;  4KHY A;  2D0A A;  3AVI A;  2A1S A;  3V9Z A;  1QS4 A;  1RT2 A;  2HHV A;  2P5O A;  4FJL A;  3NFA A;  3SI6 A;  4FLT A;  4ELV A;  4HUF A;  1RTD A;  2IDO A;  4IDK A;  4FXD A;  4OKK A;  3O3G A;  4CHZ A;  3K5L A;  1W0H A;  1YVU A;  4E7H A;  4KHN A;  3HL8 A;  5C25 A;  4W5Q A;  1WSJ A;  4NYN A;  3OYN A;  3SV3 A;  1U4B A;  3KTQ A;  3SCX A;  4JS4 A;  4CGG A;  4E7K A;  1ITG A;  1NJX A;  1QE1 A;  3PY8 A;  4DG1 A;  1WSF A;  4Z4I A;  1CZ9 A;  4HCC A;  3L2R A;  1L5U A;  1ZBF A;  2YNI A;  1JLE A;  4I2Q A;  3NGZ A;  1NJZ A;  4HTU A;  1C1C A;  1YTA A;  4JLH A;  3U3G A;  5JS1 A;  1ZYQ A;  4JRP A;  1EX4 A;  5EU7 A;  1TKT A;  3VQ7 A;  3OYG A;  1ZBU A;  3V6D A;  4AHS A;  4MQ3 A;  1C1B A;  1DTQ A;  1G15 A;  2YKN A;  2FBX A;  4N5S A;  3QEX A;  4KI4 A;  1VRT A;  2KFZ A;  1QSL A;  1WN7 A;  3KKS A; 
#chains in the Genus database with same CATH topology
 1Q9Y A;  3S3M A;  4OLA A;  4YHH K;  3NE6 A;  2NRR A;  1NK0 A;  2YHB A;  1OVY A;  5E26 A;  4CBX A;  2GTD A;  3AA5 X;  1GLJ O;  4CJU A;  2Q1N A;  1WAJ A;  2BE2 A;  3D45 A;  4CBU A;  3CI5 A;  2VCP A;  4KH6 A;  3OVN A;  5AFU H;  5GAD P;  3WUH A;  2E2P A;  1BWF O;  3NH1 A;  3CPW M;  3QET A;  2HF4 A;  1S6P A;  3HSC A;  4CFA A;  3KK7 A;  3EE8 A;  2QWO A;  4KPY A;  1XUP O;  1R0A A;  4JI8 K;  4B1V A;  3CIP A;  5AQN A;  2IVO A;  4HUG A;  4LF7 K;  1SUQ A;  1Z25 A;  2RN2 A;  4IFE A;  3K0S A;  2UUA K;  2HB5 A;  3EZ5 A;  3ISN C;  2V51 B;  1ATS A;  3TAB A;  5M1P A;  5DM6 L;  3DYA A;  3VQB A;  3AVA A;  4CJ7 A;  2RHK A;  1RT5 A;  3KD5 E;  4DV4 K;  2P9I B;  3QLH A;  4Z0U A;  4YOY A;  4CIE A;  2PYJ A;  4YOR A;  3T7Z A;  3J7Y P;  4LH4 A;  2P1J A;  5F1X A;  2HVH A;  3BGR A;  3MX5 A;  1RGI A;  3J7Z O;  1GLL O;  4M7X A;  3L0Q A;  3TR8 A;  4OPJ A;  2A42 A;  4BC4 A;  1KRP A;  5DK5 A;  3O5B A;  4O5F A;  2NRZ A;  3NF9 A;  1HPZ A;  2ASM A;  2FF3 B;  3BUZ B;  4I6M B;  2G8H A;  4C23 A;  3VTI A;  4CHQ A;  3PIO L;  3H3N O;  4GY2 B;  2X6N A;  3MN9 A;  4ILH A;  1LW2 A;  1SKS A;  3VMF B;  2GV9 A;  4M3T A;  1RBS A;  2BDP A;  4E0D A;  3OYJ A;  1FKO A;  3EEQ A;  2A41 A;  4UQG A;  4DSI A;  2WFB A;  3OYF A;  5AQJ A;  3HJF A;  2Y1J A;  2I5J A;  2WC9 A;  1NWK A;  5IT9 O;  2HND A;  1NMD A;  3NGI A;  3WXI A;  1IKY A;  5T7B A;  3TTD A;  5AQO A;  3ZX3 A;  3EO3 A;  2A6A A;  3H45 C;  2Y1I A;  3VQ6 A;  3RVC A;  1I39 A;  3LAN A;  4PHT X;  5BRH A;  3S9H A;  2PZS A;  4FOE A;  3C94 A;  3O4W A;  1VSE A;  3WT0 A;  1NK5 A;  2KTQ A;  4FJN A;  1S6Q A;  4O8U A;  5HRN A;  3F2K A;  3QEW A;  1S1W A;  4HCB A;  1L3T A;  5CZ1 A;  3L6Q A;  3CCR N;  4CBW A;  3RSE B;  5GAE P;  3T1A A;  4CVN E;  1TAU A;  4JS5 A;  3THY B;  3I8B A;  1BQM A;  4QCL A;  2E2O A;  2D0P A;  1H1V A;  1HX1 A;  3VN5 A;  1HLU A;  1K8K A;  1RCH A;  4YOV A;  4MO4 A;  1CXQ A;  4KO0 A;  1JCG A;  4CHP A;  2Z1J A;  4O55 A;  3CFO A;  2D0B A;  3QES A;  1V4T A;  3WNF A;  1ZBI A;  1LW0 A;  2B4J A;  3UKR B;  4M3Y A;  2NRT A;  4KHU A;  1S1T A;  4JEP A;  3I0S A;  4EHU A;  2J4R A;  3HZ6 A;  4CF1 A;  3VTH A;  4B3R K;  1WSE A;  3OBY A;  3JAM O;  4CZF A;  2X78 A;  4IBN A;  2G8U A;  3NF8 A;  3L2Q A;  2Z1H A;  4E7I A;  4BR5 A;  4H4O A;  4Z4H A;  1JLG A;  4KHQ A;  3KLG A;  3V9S A;  1XWL A;  3HOT A;  2DPN A;  4EHT A;  1L3V A;  1RTH A;  4FPB A;  4DTJ A;  4KI6 A;  3VQ5 A;  3ZSZ A;  4E1M A;  3U9Z A;  3CCQ N;  1QQN A;  1IO2 A;  4CIF A;  4PKG A;  1GOB A;  1XHX A;  4DSJ A;  1IBM K;  4CGH A;  4DQS A;  1X3N A;  1TL3 A;  3DJC A;  2E1Z A;  2DFF A;  5C15 A;  1HQE A;  3BF1 A;  2E6M A;  2YHW A;  3SV4 A;  3DXM B;  3IRX A;  3P4I A;  2VQE K;  2IAJ A;  4MLH A;  1VSH A;  4G1Q A;  3SAH A;  3DOK A;  1XC9 A;  4H0Y B;  4IWV A;  4CF9 A;  5HRR A;  4OX9 K;  4KFB A;  4DCH A;  4ILJ A;  4FLZ A;  3RMB A;  1HNV A;  2UYT A;  3THX B;  2F96 A;  4YOW A;  2D5R A;  4I6M A;  2W42 A;  4FYD A;  5CY4 A;  3CG7 A;  4YDU C;  1VSI A;  1ZXO A;  4PQU A;  4C8O A;  2G8V A;  4GKJ K;  3WXJ A;  4BRN A;  3SMP A;  5C42 A;  4J2E A;  4K43 A;  4H5V A;  3D7E O;  4LC9 B;  2YV0 X;  3ZSV A;  4PKH A;  3J81 O;  5I9E B;  3VGK A;  5EVZ A;  2O8E A;  4W5T A;  3KK1 A;  1C6V A;  3EZW A;  4M3W A;  3M8Q A;  3DLE A;  4DTR A;  1FKP A;  3CC7 N;  4EZ9 A;  1Q7Y O;  3WNG A;  1J5O A;  3CCS N;  3VQE A;  4X66 K;  3S41 A;  4WQ4 C;  3ZT4 A;  4H8K A;  2YNH A;  5CE3 A;  3HO1 A;  1EO1 A;  1JXB A;  4RG8 A;  3OS0 A;  2PAV A;  1OH5 A;  1TL1 A;  2V7Y A;  3PIP L;  4DQQ A;  1N6Q A;  5EX5 A;  4CHN A;  4JK8 A;  4JKF A;  3O1W A;  3O4N A;  3HM9 A;  1NOY A;  3OY9 A;  4JD2 B;  2UU9 K;  1IKV A;  3EY1 A;  4DQI A;  2VG5 A;  1EP4 A;  4KB1 A;  1NOZ A;  2IVN A;  1REV A;  3SBG A;  3EYZ A;  1NKC A;  3HXM A;  4L3Q A;  5JLF A;  4M3Z A;  5C10 A;  3BY5 A;  4JI1 K;  1GOA A;  1M90 O;  4K8Z A;  3TAR A;  2UXC K;  4B9M A;  5HOO A;  3M3Z A;  1NK8 A;  1UA1 A;  1J54 A;  1HUX A;  4DR7 K;  1X1P A;  4E7J A;  3IMX A;  3QER A;  2QK9 A;  1W2B M;  2GUI A;  3C65 A;  1S1U A;  2NUB A;  3G0Z A;  3CER A;  1WB9 A;  1CLQ A;  3U6F A;  3BZK A;  3DOL A;  4CZG A;  2QWN A;  4FLV A;  3NGY A;  1XI1 A;  3HTV A;  1IBK K;  4IKF A;  2YHY A;  5M1Q A;  4FZX C;  4CGJ A;  4FW1 A;  4CGF A;  1XMO K;  2UXB K;  4JKG A;  1RTI A;  2RE2 A;  4CHO A;  3OS1 A;  1KVC A;  2VWB A;  5FRN A;  1A5V A;  1DT9 A;  2H3G X;  1X9W A;  4F3O A;  2G8I A;  1YVN A;  4GVM A;  3L2U A;  1S1X A;  2P9P B;  4B9L A;  1K6Y A;  3CJ1 A;  1RBV A;  4KHS A;  1YTU A;  4DLG A;  4J8F A;  3NAE A;  1SL2 A;  3W0L A;  4IJA A;  4H03 B;  5FPD A;  1NGF A;  2GWJ A;  5J2M A;  4BG9 A;  4MO5 A;  2P9K B;  4E1N A;  3LWL A;  3QIO A;  1T7P A;  5GIO A;  4NCB A;  4CGD A;  3R6M A;  1JCF A;  3T19 A;  4K41 A;  4CE9 A;  3J80 O;  1BUP A;  2HHV A;  4FJL A;  4FLT A;  4Z94 A;  4JI0 K;  1BOT O;  4OKK A;  3WQT A;  3K5L A;  4E7H A;  3EN9 A;  1ATN A;  2ZJR L;  1WSJ A;  4RCH A;  4XEI A;  2YX6 A;  4FSV A;  4E7K A;  4DUY K;  4DG1 A;  1YIJ N;  1L5U A;  1VQ5 N;  2YNI A;  1JLE A;  4I2Q A;  1C1C A;  5MLC Q;  5JS1 A;  3A5N C;  3ENB A;  1VRT A;  3THW A;  1CZA N;  2ASO A;  4FZZ A;  2RKI A;  3ALY A;  1Q9X A;  2D1K A;  2DTU A;  4FPA A;  1YJ9 N;  4CK2 A;  2P9U A;  1YJN N;  1VQ9 N;  3ZET A;  3N4P A;  3HM8 A;  2ITG A;  5BRD A;  3AVB A;  4JI7 K;  2OPP A;  2ZF5 O;  2DY4 A;  4CF2 A;  4ZTJ A;  1SL0 A;  3O9T A;  3V9U A;  1EWR A;  3DLL L;  3OW2 M;  4LF9 K;  4OJR A;  1BCM A;  1OH8 A;  3G6E N;  4DTN A;  2W41 A;  2ITM A;  4FWS A;  1A5W A;  2P51 A;  2IC3 A;  3TSQ A;  1HJR A;  3QBX A;  2O8F A;  3BP8 A;  1BA1 A;  5GAG P;  1O13 A;  1UOC A;  5CR4 A;  3TAN A;  5KRT A;  4F9O A;  3FFI A;  2E1Y A;  2YJF A;  3K5M A;  3CCL N;  2VWJ A;  4FWK A;  3KLH A;  2FBV A;  1VQM N;  4JI6 K;  1D5A A;  1Y64 A;  3ATU A;  1KQS M;  4JK9 A;  1IKX A;  4H0T B;  3IKM A;  1VSJ A;  2P9L A;  2YJE A;  3GDQ A;  2D0C A;  3QEI A;  3AVH A;  3CC2 N;  2WUS A;  4IEE A;  3SZ2 A;  4FVM A;  2OPS A;  4BRC A;  5AQX A;  5J2N A;  1YI2 N;  1VQK N;  3AO4 A;  3AA2 A;  4PY5 A;  5LY3 A;  1KVB A;  1BI4 B;  4FLU A;  1YAG A;  4A5A A;  1O1W A;  2HW3 A;  4F4K A;  4BE0 A;  2IOC A;  4GW6 A;  1CXU A;  4W5R A;  1RT6 A;  5C0Y A;  2OYQ A;  2O4I A;  3LDL A;  4R79 A;  4CES A;  2OZM A;  4YOX A;  5AQK A;  1MWK A;  3CFR A;  4XIU A;  2YHX A;  4BG8 A;  4NB4 A;  4Z4C A;  3A0I X;  3O3F A;  1K8A O;  1L3U A;  5KPZ A;  1QSS A;  4OGE A;  3SK3 A;  4Z4E A;  3L3V A;  1B9F A;  1HQU A;  2RPI A;  4OVL A;  3TAF A;  5M1K A;  2Q0U A;  3H1Q A;  3K57 A;  5CYM A;  2NRH A;  1RBT A;  4NLC A;  1OKJ A;  2Q2R A;  1N33 K;  3A2F A;  4IZ9 A;  2KFN A;  2O8B A;  3FLC O;  2QKK A;  3F5T A;  1RDA A;  1YHQ N;  1EXQ A;  3O9U A;  3VQQ A;  3OYM A;  3S3O A;  2O8C A;  2W40 A;  1T8E A;  2XY8 A;  1NKE A;  2V7Z A;  3SPZ A;  1BIU A;  5SZT A;  3DMJ A;  1S3X A;  4QS9 A;  4NYF A;  3ZSO A;  1MDU B;  5KGX A;  1NGG A;  1RDU A;  1KAX A;  2AJQ A;  4HWI A;  4XH5 A;  5AQH A;  1RDB A;  2Q3S A;  1RBU A;  2CH6 A;  3D2E B;  3G25 A;  3HPH A;  3P83 D;  3TSP A;  1JLF A;  1UWB A;  4BRH A;  2P9N B;  1YJW N;  4DF4 A;  1OH7 A;  2ZM6 K;  3V9W A;  4ICL A;  2HNZ A;  2YCH A;  4FJX A;  1N36 K;  1HNZ K;  1NGB A;  3VGM A;  3LDO A;  3OJS A;  2PFU A;  3ID8 A;  3RMC A;  1WAF A;  4C1N I;  1NJI O;  3AAQ A;  1K73 O;  2Z1G A;  4TSX A;  4U7B A;  3SPY A;  4QS7 A;  1L3S A;  3FZH A;  1TVR A;  3NDK A;  5CYQ A;  3C7N A;  3AVM A;  3DI6 A;  4AHC A;  4FLX A;  1QHT A;  4B9T A;  4BR2 A;  2VQF K;  3OYH A;  1NGC A;  4LFC K;  4PWD A;  2QEX N;  4FLW A;  4DR1 K;  3LDN A;  1X9J A;  5LL6 Z;  4M41 A;  4HUE A;  3MXM A;  4BRA A;  3V9X A;  3HP9 A;  1VSK A;  4YOT A;  1TGO A;  3P1G A;  3E9O A;  3ZT0 A;  4YFU A;  5HBM A;  1ESV A;  5I42 A;  2NRX A;  2CH5 A;  4BC5 A;  4B9S A;  4K8X A;  2A5X A;  3LPT A;  2ZE2 A;  3CET A;  4JKB A;  3CM6 A;  3CMA N;  2ZD1 A;  4ELU A;  3D0P A;  2DFE A;  3QO9 A;  4IG0 A;  4FJM A;  3LAM A;  3O9Q A;  4CJV A;  3AO2 A;  3LAL A;  3BZC A;  4MDB A;  1U04 A;  2FLO A;  3KLF A;  1YXQ A;  3LWM A;  1RT7 A;  1EWQ A;  3L2V A;  2YNG A;  4BR0 A;  3EKU A;  3WEE A;  3R1X A;  4FJJ A;  4WQ5 C;  4Z4G A;  1LV5 A;  4WQ5 A;  5BPN A;  4DV1 K;  3LM9 A;  1B92 A;  3FZL A;  5KQ8 A;  3SQ2 A;  4PL7 A;  3THV A;  3CF5 L;  3ZT2 A;  1KFD A;  1RT1 A;  3DM2 A;  2ZWH A;  1QZ5 A;  5AJ3 K;  4BQZ A;  4IDH A;  4FK0 A;  1VRU A;  2G8W A;  2XRI A;  3Q7B A;  4OPA A;  1KVA A;  4BDP A;  2UUC K;  5FPN A;  3B8A X;  1NU0 A;  3I55 N;  3VEZ A;  5K14 A;  3QNN A;  3NVK A;  4DV2 K;  2BTF A;  1C0G A;  2FSN A;  1S72 N;  4A57 A;  4B8C A;  1QVF M;  4BVO A;  4BAC A;  1S9E A;  2JWL A;  3ZLJ A;  1SAZ A;  2VG6 A;  4K42 A;  3OYK A;  1WLJ A;  4JI4 K;  3H6E A;  3WNE A;  3K5O A;  1RT4 A;  3O3H A;  1JLA A;  1RDD A;  3A5O C;  5ADX H;  4PUO A;  4JV5 K;  4NCA A;  3CJ9 A;  2VGM A;  3VPZ A;  2E2N A;  3UIQ A;  3HI0 A;  4CEQ A;  2JWK A;  4LY7 A;  3IAY A;  2YKM A;  1KFS A;  4DU4 A;  3K58 A;  2E88 A;  1WBD A;  2E20 A;  3AV9 A;  4FJH A;  2HMI A;  3LL3 A;  4NXM K;  4HVJ A;  3MXI A;  2BAN A;  4DHY A;  3JSM A;  2HHS A;  4CJQ A;  2O8C B;  3O1B A;  4DQ8 A;  4K25 A;  4BRE A;  4ID5 A;  3QIP A;  4BR9 A;  1YT3 A;  3MCP A;  4RW9 A;  2QKB A;  3ZT1 A;  1DTT A;  5I3U A;  4JKE A;  4B9U A;  2AA4 A;  4OGC A;  4ISG A;  3VQD A;  3THX A;  2OTJ N;  4FM2 A;  1N34 K;  1Q82 O;  1D9D A;  2W6L A;  3MEE A;  4AHR A;  2P9K A;  1FXX A;  3LP2 A;  3ZCM A;  4CFD A;  1N5Y A;  3PO4 A;  3P5J A;  2HHH K;  2QM1 A;  3DXK A;  4H5W A;  3SNN A;  1JL1 A;  4QOZ B;  5EXW A;  4B1X B;  1DGK N;  5HL7 L;  4H0X B;  1WBB A;  3OTO K;  4GV6 A;  4GV9 A;  3TAQ A;  4BC3 A;  4BDY A;  3M8S A;  3VET A;  4WFB L;  3LZI A;  1CZB A;  1VSM A;  4CFC A;  1VQL N;  4KAZ A;  1OVQ A;  2IGI A;  3FZM A;  1BI4 A;  1U2V A;  3AVK A;  4B3M K;  3CQY A;  1QSY A;  3C7N B;  4OLB A;  2QTD A;  1TAQ A;  1KLN A;  1TKD A;  3KVG A;  4FOI A;  4B9N A;  1HKB A;  2FF6 A;  2Q36 A;  4X62 K;  2P9U B;  4KTW A;  3BEX A;  4W5N A;  5KPT A;  1C0U A;  3LP0 A;  3B6P A;  3RR8 A;  4NCG A;  3CCE N;  4EAH D;  3NF7 A;  3WXL A;  2A1S A;  1QS4 A;  1RT2 A;  1OH6 A;  2GEM A;  2E5L K;  3U4L A;  2IDO A;  3GG4 A;  4FXD A;  2IIR A;  3O3G A;  1YVU A;  2A40 A;  2ZJP L;  3HL8 A;  4W5Q A;  3SV3 A;  1U4B A;  3KTQ A;  3P31 A;  4CGG A;  1ITG A;  1NJX A;  3PY8 A;  4BRQ A;  3GL1 A;  4EFH A;  4IXC A;  4DV3 K;  1ZBF A;  3NGZ A;  4V19 S;  4M7Y A;  1K8K B;  1DKG D;  4JLH A;  2QWL A;  5EU7 A;  5AQW A;  3VQ7 A;  1ZBU A;  4AHS A;  4MLE A;  2E8A A;  4KI4 A;  3QEX A;  2KFZ A;  4WFN L;  3JXU A;  1U47 A;  1VK0 A;  4JI5 K;  3KHY A;  3FZF A;  3HRG A;  3HP6 A;  5EY4 A;  2VGN A;  3QNO A;  1HRH A;  4ZHR A;  3WNH A;  3I0R A;  1JXE A;  2G8K A;  2I7N A;  3TAP A;  1DEJ A;  3V1O A;  4FJG A;  2E6L A;  4CEZ A;  3T69 A;  3CQX A;  3VA0 A;  3MMV A;  4JKC A;  4DR6 K;  2NLX A;  3ASM A;  3CPE A;  4BY9 C;  4GNI A;  4CZH A;  4BVP A;  3O08 A;  4E3S A;  2ZQB A;  4AF1 A;  4I9Q A;  4NXN K;  1NG9 A;  3G4S N;  3TWH A;  3CM5 A;  4Y0W A;  3M8R A;  2PBD A;  3L4Q A;  4N56 A;  2F8S A;  1C0T A;  3MCA B;  5M1N A;  1VSD A;  4IOC L;  4RW6 A;  5C12 A;  2WBN A;  1UA0 A;  4CD1 A;  4CF8 A;  4BGB A;  4C8M A;  4AH9 A;  4FWN A;  4DFM A;  5TKW A;  1BGX T;  3RRH A;  1ASW A;  1LAW A;  1NNE A;  3MWP A;  4CEB A;  1NGJ A;  3FFK B;  4AIL C;  1N32 K;  1NM1 A;  5AQL A;  4DV5 K;  1J53 A;  4CK1 A;  5AQI A;  3QEV A;  5AQF A;  4FZY A;  1NK9 A;  4FW2 A;  4AHT A;  1VSL A;  4LH5 A;  3ULE B;  2GX9 A;  5A2Q O;  1W97 L;  3ENO A;  1HYV A;  4UY8 O;  3QFU A;  1HKG A;  2E4L A;  3J7A P;  2VWK A;  3CJ7 A;  1J6Z A;  4JHD B;  2KZM A;  4N47 A;  1ZBS A;  3JYT A;  3VQA A;  5KRS A;  4Y1C A;  5M1F A;  2WON A;  1GLB G;  2UUB K;  4FWQ A;  3H08 A;  4DV6 K;  4KTQ A;  3CD6 N;  3C6H A;  1RFQ A;  1C0M A;  4CI6 A;  4DFJ A;  4ID1 A;  2HOE A;  3DLR A;  3NH0 A;  4DWI A;  2X6S A;  4YNQ A;  1HJO A;  3K9K A;  3AAR A;  3SUP A;  2P9S B;  3PSF A;  3OYI A;  1NK6 A;  4M45 A;  1IG8 A;  4I7F A;  3ITH A;  4PL8 A;  3AO3 A;  5AZJ B;  4K0K K;  3L2W A;  3FE1 A;  1KXP A;  3I8D A;  3AVC A;  2YI1 A;  4CJ4 A;  2BH1 A;  3CME N;  1MA9 B;  4H0O A;  5F0X A;  3SUN A;  4LF4 K;  3RTV A;  4DMN A;  3LM2 A;  5CZ2 A;  4GV3 A;  1MU2 A;  3CCJ N;  1U49 A;  3VQP A;  4LF8 K;  2KZZ A;  3ZET B;  3VQ8 A;  3UKU B;  1XQS C;  3QML A;  3W3D A;  3ZEU B;  5J2Q A;  2FXU A;  3QIN A;  1IBL K;  2PY5 A;  2KQ2 A;  3TAE A;  1Z6R A;  5FDL A;  2YHA A;  1TYQ B;  3ULD A;  3ZSQ A;  4A5B A;  3DLK A;  3PV8 A;  3ZSX A;  1FW6 A;  4B3S K;  1HMV A;  3KK2 A;  3VF6 A;  4EZ6 A;  1NJY A;  2XY6 A;  4FVU A;  4CHY A;  1X9S A;  1VQN N;  2B5J A;  1QZ6 A;  5D3G A;  1BO5 O;  2O8B B;  3VEN A;  4CEA A;  3KIO A;  3VF4 A;  1NGH A;  3TU5 A;  5FPE A;  3EKS A;  3CCV N;  4F2S A;  5BN9 A;  1TK8 A;  1VHX A;  2KW4 A;  3U8X A;  1GLF O;  3NCI A;  1LWC A;  4PKI A;  4J2B A;  3AY9 A;  4JKH A;  4JAX A;  5LMN K;  4BWJ A;  4CEC A;  4JN4 A;  4OKE A;  3AVN A;  4FJ8 A;  3MK6 A;  4AM6 A;  4E19 A;  3ZT3 A;  2O8D B;  4CEE A;  4BC2 A;  3AA4 A;  3EL2 A;  3DRS A;  3C6U A;  1XC3 A;  4KBO A;  1KC8 O;  1JKH A;  3MN6 A;  3OA9 A;  3VEY A;  4M3X A;  4LFB K;  4CJS A;  3LPU A;  5KPR A;  4B8A B;  2QWM A;  5BPM A;  3LAK A;  1T03 A;  3KD1 E;  1HNX K;  1NMN A;  4CZJ A;  3MEG A;  5C2F A;  2OTL N;  4IEI A;  2F4V K;  4B3T K;  3DWL A;  3TTC A;  4JKA A;  3E1Y A;  2FSK A;  2CGL A;  4A62 A;  5BR8 K;  3DAW A;  3AO1 A;  4WF9 L;  3NVM A;  1S5J A;  2EX3 A;  4NLB A;  1WSI A;  3KWG A;  3QB0 A;  5HRO A;  3PX0 A;  2PYL A;  1I94 K;  3LP1 A;  2O4G A;  4O44 A;  3ZX2 A;  3AA3 A;  3UE5 A;  2ASP A;  1VQ6 N;  1NGA A;  2QWR A;  2QW9 A;  5BRF A;  1NGE A;  3V1R A;  4KTZ A;  5AQV A;  4LF6 K;  1X9M A;  2FBY A;  3A8Y A;  1VAZ A;  4FWR A;  4IFY A;  4A59 A;  1VQ8 N;  4W5O A;  4EP5 A;  2DFH A;  2GWK A;  4DU1 A;  1W7A A;  2KKZ A;  1J9A A;  3LDS A;  4DTU A;  4GKK K;  3HK2 A;  1TV6 A;  4CJL A;  4RTF D;  3VA3 A;  5AQZ A;  5JIC A;  4A61 A;  1BL3 A;  3L4I A;  3T1Y K;  2QWQ A;  4F8R A;  3G10 A;  1UAX A;  3HPG A;  1IG9 A;  5GIP A;  5AQS A;  3L3U A;  4ISF A;  3K2P A;  5JVH L;  4BE2 A;  4H5R A;  4JKG B;  1NGD A;  5H1S Q;  4PA1 A;  4CZI A;  3SUO A;  3T1H K;  2OPQ A;  1SZ2 A;  3OHR A;  1QVG M;  1QTM A;  3ZSY A;  4CJT A;  5E41 A;  1S1V A;  4HTL A;  3SJJ A;  1LAV A;  3VOV A;  3OYL A;  2D0O A;  4EIA A;  4M3U A;  3DXK B;  4CCH A;  1ILY A;  4DS4 A;  3HBT A;  2GBZ A;  1GLA G;  3H1V X;  1BQN A;  2E2Q A;  3R3L A;  1JLC A;  4FK2 A;  1C0F A;  4B3O A;  1LWF A;  4CD3 A;  4ZTF A;  5HP1 A;  2HST A;  1KD1 O;  1KAZ A;  4KB0 A;  4IOA L;  4FCY A;  1JCE A;  3VES A;  5HLF A;  3PSI A;  4BRD A;  1B9D A;  4H4M A;  1XNR K;  4O4G A;  5AQG A;  3AVF A;  2GEL A;  4CW7 B;  3O80 A;  3MDQ A;  2HHT A;  3CC4 N;  3CCU N;  4B1W B;  3CXC M;  5AZI A;  1U48 A;  2P9L B;  3F9K A;  4QS8 A;  4FJI A;  3O4Q A;  3P38 A;  3PO5 A;  1NJW A;  1BHL A;  3D6R A;  3RR7 A;  2B6A A;  4B08 A;  1VQ7 N;  1IKW A;  4FM1 A;  2P9P A;  4WE1 A;  3UB5 A;  4BRM A;  4CJP A;  4DFP A;  3NBP A;  4ISE A;  4R5P A;  1NK7 A;  1HKC A;  4OPK A;  3R9P A;  5J2P A;  4CGI A;  1JJ2 M;  4H0V B;  2HMP A;  5KI6 A;  3UKR A;  3TPQ A;  2Q31 A;  2HHX A;  1HR0 K;  3D2F B;  1ASV A;  1LCU A;  3PLA A;  1YUW A;  3C6T A;  3OS2 A;  3AGK A;  3VF2 A;  3O9R A;  3C0B A;  4DS5 A;  4LF5 K;  1P90 A;  4DV7 K;  1QQC A;  2FC0 A;  4JYA K;  3C95 A;  2HBJ A;  1D4X A;  3HVT A;  4JRQ A;  1N8R O;  4G9Z A;  4CJK A;  5JS2 A;  4XH4 A;  1VSF A;  3ZYY X;  2O8D A;  1RTJ A;  4FJ7 A;  4KHY A;  3V9Z A;  1XNQ K;  4JI3 K;  2Q97 A;  1RTD A;  3C6A A;  4IDK A;  4CHZ A;  3WXM B;  4NYN A;  3OYN A;  3SCX A;  4JNE A;  4A2A A;  4B1Y B;  4OO1 J;  4HCC A;  3L2R A;  1NJZ A;  3CJC A;  4HTU A;  3U3G A;  1ZYQ A;  3OYG A;  3V6D A;  1U2V B;  3A5M C;  4JI2 K;  2YKN A;  2FBX A;  4N5S A;  4IJN A;  1QSL A;  1WN7 A;  4AQY K;  2QWP A;  1C1A A;  3MN5 A;  1WSH A;  3OYC A;  3AVG A;  3PUF A;  3RMD A;  3SQ0 A;  4H0P A;  1BG3 A;  2F9T A;  3OYB A;  1IV0 A;  4CJR A;  1E3M A;  3FR0 A;  1RDW X;  4M42 A;  4DTM A;  5LMU K;  2BGG A;  4E7L A;  1MWM A;  4RW8 A;  4BRO A;  1RIL A;  3TAG A;  2IS3 A;  4FO0 A;  4CEF A;  3VEX A;  3I33 A;  1VQO N;  3NMU A;  4ELT A;  1T3V A;  4MFB A;  4C1N K;  2HBM A;  5DM7 L;  3I56 N;  4DR2 K;  5BPL A;  3HOS A;  3SYZ A;  4Q0B A;  1A5X A;  4BQL A;  2F9W A;  5C24 A;  4C8L A;  5BR9 A;  3HST B;  2HVI A;  4CZK A;  2QXL A;  1K9M O;  4CF0 A;  1Q86 O;  2Z1I A;  3AVJ A;  5LJV A;  3AVL A;  5AQP A;  3B6O A;  4B1Z A;  4FL9 A;  1ATR A;  4O8K A;  4CJW A;  4BRL A;  5JLH A;  4IO8 A;  3E9P A;  3MEC A;  5F2R A;  2O8F B;  1TYQ A;  4FM0 A;  1BU6 O;  4C8K A;  4Q5V A;  1WUA A;  1ASU A;  4H5N A;  3DLB A;  1Q8I A;  3KWI A;  4CIG A;  4WQ4 A;  2W6K A;  3SAG A;  4BRP A;  4C8N A;  1U45 A;  4I9L A;  3S3N A;  3TTF A;  1Z05 A;  1Y97 A;  3KK3 A;  3SLC A;  4FJ9 A;  1Q81 O;  3ZSW A;  2ATQ A;  4CEO A;  3CFP A;  4DTX A;  2CGK A;  1BIZ A;  5JVG L;  4N76 A;  4WFA L;  1EKE A;  1SL1 A;  3SMS A;  2OZS A;  5FRM A;  3HPO A;  3IG1 A;  3GOI A;  2OA8 A;  1TKZ A;  4BR7 A;  4CZL A;  5BN8 A;  1P8Z A;  2NZT A;  3NH2 A;  2AP1 A;  2WOM A;  3IUC A;  4YDU A;  3THY A;  1V4S A;  2QI2 A;  1LOT B;  2D4W A;  3D2F A;  1SV5 A;  1RNH A;  2UXD K;  5DMR A;  3ULE A;  1JLQ A;  4DSL A;  1HNW K;  1EET A;  1GOC A;  3LZJ A;  4BRF A;  2OCE A;  4ILG B;  5AQR A;  4DR4 K;  4M3R A;  2WTU A;  1G99 A;  4EP4 A;  1DLO A;  4KV8 A;  1NBW A;  2QA4 N;  3VQ4 A;  5B8H A;  3T3F A;  3V4I A;  1RT3 A;  4KH4 A;  1HNI A;  1WOQ A;  4AHU A;  1KLM A;  4FK4 A;  1NKB A;  4AHV A;  4KRF A;  4IG3 A;  3M1F A;  1IH7 A;  2FBT A;  3WXK A;  4DQR A;  4L8R B;  4LFA K;  1VQP N;  3LDP A;  1ZBL A;  2XY7 A;  3OBW A;  3KLE A;  3SQ4 A;  5AQY A;  3DRR A;  3MXJ A;  1VQ4 N;  5AQQ A;  5IWA K;  2A1R A;  4QAG A;  4DF8 A;  3SAF A;  3ID6 A;  3O8M A;  3JS6 A;  3OYA A;  1JLB A;  3DRP A;  2LSN A;  2ZGZ A;  5AQU A;  1HYZ A;  2Q0R A;  4CFB A;  3ZSR A;  2HHU A;  2ETJ A;  3MWT A;  4GMJ B;  1NGI A;  3ENH A;  2HNY A;  1TUY A;  1GLC G;  1QQO A;  3VEW A;  3VEV A;  2OAN A;  1ZBH A;  4E89 A;  4IO9 L;  3KZB A;  3DLG A;  2ZJQ L;  2FSJ A;  1TK0 A;  1IJJ A;  4H5T A;  1LWE A;  3KKR A;  4RW4 A;  4YOU A;  3KJV A;  1KSP A;  2OPR A;  4B9Q A;  4U67 L;  2F7T A;  3VER A;  4B1U B;  2VG7 A;  4J2A A;  3THW B;  1SS6 A;  4DTS A;  4I2P A;  4BRG A;  3SQ1 A;  3SBT A;  1TUU A;  4J2D A;  4DFK A;  3PX4 A;  5J1E A;  4B9V A;  1T6C A;  3TAM A;  1ZC6 A;  4IFV A;  5AZJ A;  3QEP A;  4JHD A;  3MX2 A;  3HYF A;  3P39 A;  4KH5 A;  3O6W A;  3IS9 A;  3D2E A;  3QFP A;  1TKX A;  1QHA A;  2X74 A;  2QXF A;  3IDH A;  2HBL A;  4DB3 A;  3K59 A;  3FZK A;  1J5E K;  1FK9 A;  3OYE A;  3U3Y A;  1XMQ K;  4WYB A;  4O0I A;  4DSK A;  1X3M A;  3CHW A;  5HRP A;  5KTQ A;  3OJU A;  4DTP A;  3L8B A;  5ELZ A;  1D8Y A;  1BDG A;  4DSE A;  1F21 A;  3J8A A;  1SQK A;  3RSE A;  3SUQ A;  3NHG A;  4DUZ K;  4FJK A;  4CZE A;  4XH1 A;  3LP3 A;  4CJF A;  4FJ5 A;  1NLV A;  3MED A;  3TSU A;  4WCE L;  3VGL A;  3CCM N;  4X65 K;  4BWM A;  5AR0 A;  3F73 A;  4CER A;  1EQY A;  1U6Z A;  2XY5 A;  3HT3 A;  4NO7 A;  1T44 A;  5EOY A;  4KRE A;  2BUP A;  4O5B A;  1T6D A;  3MAQ A;  4FWL A;  2HHQ A;  5GAH P;  5AFU A;  4CZM A;  4DU3 A;  4AM7 A;  4CJE A;  4BDZ A;  1BA0 A;  3CYM A;  3H3O B;  4F2R A;  4KHW A;  1R59 O;  1GLD G;  3LDQ A;  4JKD A;  2IVP A;  3GBT A;  3RMA A;  3E66 A;  5AQM A;  5FRO A;  1I3A A;  4DKW A;  3CQ8 A;  5TKY A;  1S22 A;  4LSL A;  1XHZ A;  3IFR A;  3QIC A;  4DQP A;  2NRW A;  3AO5 A;  4KKO A;  4DR3 K;  1HYS A;  4CED A;  4E1J A;  2YNF A;  4IOX A;  4BR4 A;  3O9S A;  2XO7 A;  3DLH A;  3F9M A;  3Q7C A;  1WNS A;  3VEO A;  4KHP K;  1SKW A;  1BIS A;  3M6G A;  3WQU A;  3BDP A;  4N41 A;  4JK7 A;  4BE1 A;  1M1K O;  3NF6 A;  4FWP A;  5C2D A;  4RWT A;  2P9N A;  2V52 B;  2KLA A;  4FLY A;  3E01 A;  5JMV A;  3OYD A;  4M63 C;  1S9G A;  3BF3 A;  4O0J A;  3TI0 A;  4FWM A;  1YF5 L;  5KGW A;  3K9J A;  5KQD A;  2G8F A;  5LJW A;  1FJG K;  3DXM A;  2ZGY A;  4FWO A;  3V1Q A;  5E84 A;  5FPM A;  4CJ3 A;  1BCO A;  1E4G T;  4OKJ A;  1W9H A;  4BRK A;  2R7Y A;  2A3Z A;  1RDC A;  3HVR A;  3AAP A;  4F3T A;  2P9I A;  4DLE A;  2F8T A;  4BGA A;  2HBK A;  1TK5 A;  1KTQ A;  3K5N A;  4DTO A;  2NRV A;  3M8P A;  4OPH A;  4JD2 A;  2HHW A;  1SKR A;  2GUP A;  2HF3 A;  3KLI A;  2JGU A;  1KAY A;  4DSF A;  3V81 A;  2JLE A;  3CJB A;  2RF2 A;  1D9F A;  2O8E B;  4GVE A;  2P9S A;  5GIN A;  1Q18 A;  4RW7 A;  4HHT A;  4LD0 A;  4DR5 K;  5FLX O;  5HRS A;  3ATV A;  4YY3 K;  1T05 A;  5M1O A;  2P5G A;  3VQC A;  5SWM A;  4DV0 K;  3VQ9 A;  4LSN A;  2NNW A;  5BRE A;  3U9D A;  1Z26 A;  4Y1D A;  3PX6 A;  2EHG A;  5AZI B;  3QDK A;  1WSG A;  3RRG A;  3SJH A;  1E4F T;  3H46 O;  3M5R A;  1NK4 A;  4CJ5 A;  2I7P A;  5CHI A;  4CK3 A;  4X64 K;  3G71 N;  1RBR A;  1KCF A;  1JL2 A;  1YIT N;  3WEE B;  2XHB A;  4Z4F A;  3RWU A;  5AQT A;  4A2B A;  2D0A A;  3AVI A;  3GE1 A;  3FGU A;  3ZX0 A;  3N4Q A;  2P5O A;  3NFA A;  3SI6 A;  3ZEU A;  4ELV A;  4HUF A;  1HPM A;  3EE9 A;  3CJA A;  3R8E A;  3AGR A;  1W0H A;  4MDA A;  4KHN A;  5C25 A;  4BRI A;  2KHO A;  5ADX A;  2EWS A;  4JS4 A;  1QE1 A;  3A5L C;  1WSF A;  4Z4I A;  1CZ9 A;  2VYP A;  3UKU A;  1GLE G;  2CGJ A;  1YTA A;  1QQM A;  3E9L A;  1EX4 A;  4JRP A;  1TKT A;  4MQ3 A;  1C1B A;  1DTQ A;  1G15 A;  3QBW A;  3MN7 A;  3KKS A; 
#chains in the Genus database with same CATH homology
 1Q9Y A;  4FZZ A;  2RKI A;  3S3M A;  1VK0 A;  1C1A A;  1WSH A;  3OYC A;  4OLA A;  3ALY A;  3AVG A;  1Q9X A;  3PUF A;  3HP6 A;  3RMD A;  2DTU A;  4CK2 A;  3QNO A;  3SQ0 A;  1HRH A;  3NE6 A;  1NK0 A;  4ZHR A;  2YHB A;  2ITG A;  3AA5 X;  3I0R A;  1JXE A;  3AVB A;  3WNH A;  4CJU A;  2G8K A;  3OYB A;  3TAP A;  4CJR A;  1WAJ A;  2OPP A;  3V1O A;  4FJG A;  2BE2 A;  2E6L A;  3D45 A;  4CEZ A;  4CF2 A;  3VA0 A;  4M42 A;  2DY4 A;  3OVN A;  4DTM A;  4ZTJ A;  3ASM A;  4E7L A;  1SL0 A;  2BGG A;  3V9U A;  4RW8 A;  3TAG A;  1RIL A;  3NH1 A;  3QET A;  4E3S A;  2IS3 A;  2ZQB A;  4I9Q A;  1S6P A;  4CEF A;  4OJR A;  1BCM A;  4ELT A;  4CFA A;  4MFB A;  4DTN A;  3TWH A;  3CM5 A;  1A5W A;  2P51 A;  3M8R A;  4Q0B A;  3SYZ A;  1A5X A;  2IC3 A;  4KPY A;  5C24 A;  4C8L A;  1HJR A;  3HST B;  2HVI A;  4N56 A;  1R0A A;  2F8S A;  1C0T A;  4CF0 A;  1VSD A;  1UOC A;  2Z1I A;  3AVJ A;  3AVL A;  4RW6 A;  3TAN A;  3B6O A;  5KRT A;  4HUG A;  1SUQ A;  1Z25 A;  2RN2 A;  1UA0 A;  2HB5 A;  3FFI A;  4CF8 A;  3EZ5 A;  4C8M A;  3ISN C;  4AH9 A;  3K5M A;  4DFM A;  4CJW A;  3TAB A;  2VWJ A;  1BGX T;  3KLH A;  3RRH A;  1ASW A;  3DYA A;  3VQB A;  2FBV A;  1LAW A;  3AVA A;  4CEB A;  1RT5 A;  4AIL C;  1D5A A;  3KD5 E;  3MEC A;  1IKX A;  4FM0 A;  3QLH A;  4Z0U A;  1VSJ A;  4CIE A;  1J53 A;  4CK1 A;  2PYJ A;  4Q5V A;  4C8K A;  3QEV A;  4LH4 A;  2D0C A;  4FZY A;  1ASU A;  3QEI A;  1NK9 A;  2P1J A;  3AVH A;  4FW2 A;  2HVH A;  3BGR A;  4AHT A;  3DLB A;  1Q8I A;  1VSL A;  4LH5 A;  4CIG A;  3SZ2 A;  4FVM A;  2OPS A;  4OPJ A;  3TR8 A;  1HYV A;  5J2N A;  3AO4 A;  3AA2 A;  4C8N A;  2E4L A;  4PY5 A;  2VWK A;  1U45 A;  1KVB A;  1BI4 B;  4FLU A;  2KZM A;  1KRP A;  1O1W A;  4I9L A;  5DK5 A;  4N47 A;  3S3N A;  4F4K A;  4BE0 A;  2IOC A;  3NF9 A;  1HPZ A;  3JYT A;  3VQA A;  2HW3 A;  4GW6 A;  1Y97 A;  3KK3 A;  1CXU A;  5KRS A;  2G8H A;  4Y1C A;  4FJ9 A;  4CHQ A;  3ZSW A;  2ATQ A;  4CEO A;  1RT6 A;  2WON A;  4W5R A;  3CFP A;  1BIZ A;  4DTX A;  3H08 A;  2X6N A;  2OYQ A;  1LW2 A;  1EKE A;  1SKS A;  1SL1 A;  4CES A;  4KTQ A;  4N76 A;  2O4I A;  2OZM A;  2GV9 A;  4M3T A;  2OZS A;  1RBS A;  1C0M A;  5FRM A;  4DFJ A;  4ID1 A;  3HPO A;  2BDP A;  3DLR A;  3IG1 A;  3NH0 A;  3CFR A;  4DWI A;  2OA8 A;  4E0D A;  1TKZ A;  1FKO A;  2X6S A;  4XIU A;  4YNQ A;  3OYJ A;  3SUP A;  4UQG A;  4DSI A;  4Z4C A;  3NH2 A;  3O3F A;  3OYF A;  3OYI A;  2Y1J A;  2WOM A;  1L3U A;  1NK6 A;  2I5J A;  4M45 A;  3HJF A;  1QSS A;  4OGE A;  4I7F A;  4Z4E A;  3ITH A;  2HND A;  3L3V A;  1B9F A;  1HQU A;  2RPI A;  3NGI A;  4OVL A;  1IKY A;  5T7B A;  1SV5 A;  3TAF A;  1RNH A;  3AO3 A;  5DMR A;  2Y1I A;  1JLQ A;  5CYM A;  3K57 A;  3VQ6 A;  4DSL A;  1RBT A;  3L2W A;  1I39 A;  3LAN A;  1EET A;  1GOC A;  3I8D A;  3AVC A;  3A2F A;  4CJ4 A;  3LZJ A;  3S9H A;  2KFN A;  2QKK A;  2PZS A;  4M3R A;  1RDA A;  1EXQ A;  3VQQ A;  3S3O A;  3OYM A;  4EP4 A;  1DLO A;  4KV8 A;  3C94 A;  1T8E A;  1VSE A;  3SUN A;  1NK5 A;  3VQ4 A;  2KTQ A;  3RTV A;  2XY8 A;  1U47 A;  1NKE A;  4FJN A;  4DMN A;  3T3F A;  1S6Q A;  1RT3 A;  3V4I A;  1HNI A;  1BIU A;  5SZT A;  3SPZ A;  5CZ2 A;  3DMJ A;  4AHU A;  1KLM A;  1MU2 A;  5HRN A;  1U49 A;  4FK4 A;  1NKB A;  3VQP A;  4AHV A;  4NYF A;  3QEW A;  4KRF A;  2KZZ A;  1S1W A;  3VQ8 A;  4IG3 A;  3ZSO A;  5KGX A;  4HCB A;  1IH7 A;  2FBT A;  1L3T A;  5J2Q A;  3QIN A;  4DQR A;  2PY5 A;  4L8R B;  2AJQ A;  2KQ2 A;  3TAE A;  5CZ1 A;  5FDL A;  1RDB A;  2Q3S A;  2YHA A;  1ZBL A;  1RBU A;  3ULD A;  2XY7 A;  3T1A A;  3HPH A;  3KLE A;  3P83 D;  1TAU A;  3SQ4 A;  4JS5 A;  1JLF A;  3ZSQ A;  1UWB A;  3DRR A;  1BQM A;  3MXJ A;  4QCL A;  3DLK A;  3PV8 A;  3ZSX A;  2A1R A;  1HMV A;  4DF4 A;  3VN5 A;  3KK2 A;  4QAG A;  4DF8 A;  4EZ6 A;  1RCH A;  3V9W A;  3OYA A;  1NJY A;  2XY6 A;  4ICL A;  1CXQ A;  1JLB A;  2HNZ A;  4CHY A;  1X9S A;  4FJX A;  4KO0 A;  3DRP A;  2B5J A;  4CHP A;  2Z1J A;  5D3G A;  2LSN A;  3OJS A;  4CEA A;  1HYZ A;  4O55 A;  4CFB A;  3CFO A;  3ZSR A;  2HHU A;  3RMC A;  2D0B A;  2ETJ A;  3KIO A;  3QES A;  4GMJ B;  3WNF A;  1WAF A;  2HNY A;  1ZBI A;  1LW0 A;  2B4J A;  4F2S A;  4M3Y A;  1ZBH A;  2Z1G A;  4TSX A;  4E89 A;  1TK8 A;  1S1T A;  3SPY A;  4KHU A;  3DLG A;  3I0S A;  2KW4 A;  1L3S A;  4CF1 A;  1TVR A;  1TK0 A;  3NCI A;  1WSE A;  3NDK A;  1LWE A;  5CYQ A;  3KKR A;  4RW4 A;  3KJV A;  1LWC A;  1KSP A;  4J2B A;  3AVM A;  3DI6 A;  4BWJ A;  2OPR A;  2X78 A;  1QHT A;  4AHC A;  4FLX A;  4IBN A;  4CEC A;  4B9T A;  2G8U A;  3NF8 A;  2VG7 A;  4OKE A;  4J2A A;  3OYH A;  3AVN A;  3L2Q A;  2Z1H A;  4E7I A;  4FJ8 A;  4PWD A;  4H4O A;  4DTS A;  4I2P A;  3SQ1 A;  4Z4H A;  1JLG A;  4J2D A;  4FLW A;  4DFK A;  4KHQ A;  4E19 A;  3KLG A;  3PX4 A;  3V9S A;  3ZT3 A;  1XWL A;  4CEE A;  5J1E A;  4B9V A;  3TAM A;  3AA4 A;  4IFV A;  3QEP A;  3DRS A;  4M41 A;  4HUE A;  1L3V A;  3HYF A;  1RTH A;  3C6U A;  3MXM A;  3V9X A;  4KI6 A;  4DTJ A;  3VQ5 A;  3HP9 A;  3ZSZ A;  4E1M A;  1VSK A;  1JKH A;  3IS9 A;  1TGO A;  3P1G A;  1TKX A;  2X74 A;  1IO2 A;  2QXF A;  3ZT0 A;  5HBM A;  4CIF A;  4YFU A;  1GOB A;  5I42 A;  1XHX A;  4M3X A;  4DSJ A;  4CJS A;  4CGH A;  4B9S A;  3LPU A;  4K8X A;  3K59 A;  3LPT A;  4B8A B;  2ZE2 A;  4DQS A;  3CM6 A;  1FK9 A;  2ZD1 A;  3LAK A;  1T03 A;  1TL3 A;  3OYE A;  3U3Y A;  3D0P A;  4ELU A;  2DFE A;  3QO9 A;  4IG0 A;  3KD1 E;  4O0I A;  4DSK A;  2DFF A;  4FJM A;  3LAM A;  1HQE A;  4CJV A;  5HRP A;  3AO2 A;  3MEG A;  3LAL A;  2E6M A;  1U04 A;  5KTQ A;  3SV4 A;  3OJU A;  3KLF A;  3L8B A;  4DTP A;  3IRX A;  3LWM A;  1D8Y A;  4DSE A;  2IAJ A;  1F21 A;  1RT7 A;  3SUQ A;  1VSH A;  3NHG A;  4FJK A;  4G1Q A;  3AO1 A;  3DOK A;  3LP3 A;  3MED A;  4CJF A;  3L2V A;  1XC9 A;  4FJ5 A;  2YNG A;  1S5J A;  4CF9 A;  2EX3 A;  5HRR A;  4FJJ A;  1WSI A;  4BWM A;  5HRO A;  3F73 A;  4CER A;  3PX0 A;  4KFB A;  2PYL A;  4Z4G A;  3LP1 A;  2XY5 A;  4FLZ A;  3HT3 A;  1LV5 A;  2O4G A;  4O44 A;  3RMB A;  3AA3 A;  1HNV A;  1B92 A;  2F96 A;  2D5R A;  3THV A;  3SQ2 A;  2W42 A;  4KRE A;  4FYD A;  4O5B A;  5CY4 A;  3CG7 A;  3ZT2 A;  1KFD A;  1RT1 A;  3DM2 A;  3MAQ A;  1VSI A;  2HHQ A;  3V1R A;  4KTZ A;  4C8O A;  4DU3 A;  4PQU A;  2G8V A;  1X9M A;  2FBY A;  4CJE A;  4BDZ A;  4FK0 A;  1VRU A;  3CYM A;  4F2R A;  4IFY A;  2G8W A;  4KHW A;  4W5O A;  4EP5 A;  2DFH A;  5C42 A;  2XRI A;  4DU1 A;  3RMA A;  1KVA A;  4BDP A;  4J2E A;  5FRO A;  1J9A A;  3LDS A;  1I3A A;  3CQ8 A;  4DTU A;  5K14 A;  3QNN A;  3HK2 A;  2YV0 X;  1TV6 A;  3ZSV A;  4CJL A;  3VA3 A;  4LSL A;  1XHZ A;  1BL3 A;  4DQP A;  4W5T A;  3AO5 A;  4B8C A;  4F8R A;  3G10 A;  3KK1 A;  4KKO A;  1C6V A;  1UAX A;  3HPG A;  4BAC A;  3M8Q A;  4M3W A;  3DLE A;  1HYS A;  4DTR A;  1FKP A;  4CED A;  1S9E A;  1IG9 A;  4EZ9 A;  3WNG A;  2YNF A;  3L3U A;  1J5O A;  3VQE A;  2VG6 A;  3K2P A;  1WLJ A;  3ZT4 A;  4H8K A;  3OYK A;  4BE2 A;  2YNH A;  3WNE A;  2XO7 A;  3HO1 A;  3K5O A;  1JXB A;  4RG8 A;  3OS0 A;  3DLH A;  1RT4 A;  3O3H A;  4PA1 A;  1JLA A;  1RDD A;  1WNS A;  3SUO A;  2OPQ A;  1QTM A;  1TL1 A;  1SKW A;  1BIS A;  3ZSY A;  4CJT A;  4PUO A;  5E41 A;  3BDP A;  1S1V A;  4N41 A;  4DQQ A;  1N6Q A;  3SJJ A;  1LAV A;  4CHN A;  4NCA A;  3OYL A;  3O4N A;  3HM9 A;  1NOY A;  3OY9 A;  4BE1 A;  4CCH A;  3UIQ A;  4M3U A;  1IKV A;  4DS4 A;  3NF6 A;  4CEQ A;  3EY1 A;  2GBZ A;  4DQI A;  2VG5 A;  1BQN A;  4LY7 A;  1EP4 A;  4KB1 A;  1NOZ A;  4FLY A;  3E01 A;  2YKM A;  1JLC A;  1REV A;  3OYD A;  3EYZ A;  1KFS A;  3IAY A;  4FK2 A;  4B3O A;  4DU4 A;  3K58 A;  1LWF A;  1S9G A;  4ZTF A;  4O0J A;  5HP1 A;  3HXM A;  3TI0 A;  1NKC A;  3AV9 A;  4FJH A;  2HMI A;  5KGW A;  4HVJ A;  3MXI A;  4M3Z A;  2BAN A;  2G8F A;  3JSM A;  2HHS A;  4KB0 A;  4CJQ A;  1GOA A;  4FCY A;  3V1Q A;  4ID5 A;  4K8Z A;  4CJ3 A;  3QIP A;  3TAR A;  1YT3 A;  1BCO A;  4OKJ A;  5HLF A;  4B9M A;  1W9H A;  4RW9 A;  1NK8 A;  1UA1 A;  1J54 A;  2QKB A;  2R7Y A;  3ZT1 A;  1X1P A;  1DTT A;  1B9D A;  5I3U A;  4E7J A;  4H4M A;  3QER A;  2QK9 A;  1RDC A;  4O4G A;  3AVF A;  2GUI A;  4B9U A;  1S1U A;  2NUB A;  3HVR A;  3G0Z A;  4OGC A;  3VQD A;  2HHT A;  4F3T A;  4FM2 A;  3U6F A;  1CLQ A;  3DOL A;  4DLE A;  1D9D A;  2F8T A;  1U48 A;  4FLV A;  3NGY A;  1XI1 A;  3MEE A;  3F9K A;  4AHR A;  4IKF A;  1TK5 A;  1KTQ A;  1FXX A;  3LP2 A;  3ZCM A;  4CFD A;  3K5N A;  3O4Q A;  4DTO A;  1N5Y A;  3PO4 A;  3PO5 A;  3M8P A;  1NJW A;  4FJI A;  1BHL A;  4FZX C;  3P5J A;  4CGJ A;  3SNN A;  2HHW A;  4FW1 A;  1JL1 A;  2B6A A;  3RR7 A;  4CGF A;  1SKR A;  4QOZ B;  4B08 A;  3KLI A;  2JGU A;  1RTI A;  4DSF A;  1IKW A;  4FM1 A;  4CHO A;  4WE1 A;  3V81 A;  4CJP A;  4DFP A;  3OS1 A;  2JLE A;  3NBP A;  2RF2 A;  3TAQ A;  4R5P A;  1NK7 A;  1D9F A;  4BDY A;  3M8S A;  4OPK A;  5J2P A;  1KVC A;  4CGI A;  3LZI A;  5FRN A;  1CZB A;  1A5V A;  5KI6 A;  4RW7 A;  4HHT A;  4LD0 A;  2HHX A;  1X9W A;  4F3O A;  2G8I A;  5HRS A;  1ASV A;  1T05 A;  4GVM A;  3L2U A;  2P5G A;  1S1X A;  1VSM A;  4CFC A;  4B9L A;  1K6Y A;  3C6T A;  4KAZ A;  3OS2 A;  2IGI A;  3VQC A;  1BI4 A;  5SWM A;  3VQ9 A;  1RBV A;  4LSN A;  4KHS A;  3AVK A;  1YTU A;  4DLG A;  1QSY A;  3NAE A;  1Z26 A;  4Y1D A;  1SL2 A;  4DS5 A;  4OLB A;  3PX6 A;  2EHG A;  3RRG A;  1WSG A;  1TAQ A;  5J2M A;  1KLN A;  1QQC A;  2FC0 A;  1NK4 A;  3C95 A;  1TKD A;  4CJ5 A;  3HVT A;  4E1N A;  4JRQ A;  4B9N A;  3LWL A;  4CK3 A;  1RBR A;  1KCF A;  3QIO A;  1JL2 A;  1T7P A;  4CJK A;  4NCB A;  4KTW A;  4W5N A;  5JS2 A;  4CGD A;  1C0U A;  1VSF A;  3LP0 A;  3B6P A;  2XHB A;  3RR8 A;  4NCG A;  4Z4F A;  3T19 A;  3RWU A;  1RTJ A;  3NF7 A;  4CE9 A;  4FJ7 A;  4KHY A;  2D0A A;  3AVI A;  2A1S A;  3V9Z A;  1QS4 A;  1RT2 A;  2HHV A;  2P5O A;  4FJL A;  3NFA A;  3SI6 A;  4FLT A;  4ELV A;  4HUF A;  1RTD A;  2IDO A;  4IDK A;  4FXD A;  4OKK A;  3O3G A;  4CHZ A;  3K5L A;  1W0H A;  1YVU A;  4E7H A;  4KHN A;  3HL8 A;  5C25 A;  4W5Q A;  1WSJ A;  4NYN A;  3OYN A;  3SV3 A;  1U4B A;  3KTQ A;  3SCX A;  4JS4 A;  4CGG A;  4E7K A;  1ITG A;  1NJX A;  1QE1 A;  3PY8 A;  4DG1 A;  1WSF A;  4Z4I A;  1CZ9 A;  4HCC A;  3L2R A;  1L5U A;  1ZBF A;  2YNI A;  1JLE A;  4I2Q A;  3NGZ A;  1NJZ A;  4HTU A;  1C1C A;  1YTA A;  4JLH A;  3U3G A;  5JS1 A;  1ZYQ A;  4JRP A;  1EX4 A;  5EU7 A;  1TKT A;  3VQ7 A;  3OYG A;  1ZBU A;  3V6D A;  4AHS A;  4MQ3 A;  1C1B A;  1DTQ A;  1G15 A;  2YKN A;  2FBX A;  4N5S A;  3QEX A;  4KI4 A;  1VRT A;  2KFZ A;  1QSL A;  1WN7 A;  3KKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...