3WNGA

Cyclic hexapeptide pkidnp in complex with hiv-1 integrase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
138
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title Hexapeptide mimetics of LEDGF in complex with HIV-1 integrase
rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/peptide
total genus 49
structure length 138
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3wngA00
3DLEA 1TVRA 3HVTA 3OYMA 3SUNA 1NKBA 4MQ3A 1J5OA 1DLOA 1A5WA 4W5NA 1FXXA 4RG8A 3AVFA 3VQCA 4LSNA 1HRHA 1MU2A 4CFCA 1RILA 4CJ5A 1KVBA 4E1MA 1SKRA 3DRPA 3QIOA 1BCMA 3O3GA 2PYLA 4W5OA 1T05A 1BHLA 2JLEA 1B9FA 4DQRA 1R0AA 3SQ2A 3NH2A 1LWCA 4RW6A 1X9SA 3PX6A 3SCXA 3S9HA 1ZBHA 3K5MA 1JL2A 5HRPA 1NK4A 4PQUA 1RBSA 2P1JA 1WN7A 5K14A 3TAMA 4TSXA 2OZSA 1HMVA 1RBVA 5FROA 1CXQA 4CJQA 2BGGA 2XO7A 1RT6A 1QSYA 4LY7A 3MEEA 3SQ1A 2HVIA 4AHUA 2FBYA 1HYSA 4DSEA 4FJ7A 3M8SA 2FC0A 4E0DA 4Z4IA 3QEXA 2P5GA 3HK2A 2OPPA 4CHZA 3S3MA 3NGYA 2X6NA 4DFPA 4BWMA 4DU3A 4KFBA 3VQ9A 4FJJA 3OYKA 3L2VA 3L3VA 2VG6A 1QTMA 2VG5A 4C8NA 4W5TA 1NJXA 4FJHA 1TKXA 4CEBA 3L8BA 4F3OA 3SUQA 4BDZA 3ZSYA 3KIOA 3T19A 4FK0A 4HCCA 3V4IA 3NH0A 3TAPA 3I0SA 3OS0A 1WSHA 2WONA 4CEOA 1NOZA 1HPZA 4OKEA 3ZSQA 3HP6A 3KK1A 3RMCA 1NKCA 3BDPA 4M3YA 1JLEA 1LAVA 4Q5VA 4M3WA 4CFBA 4KRFA 1TKTA 1JKHA 2A1SA 2HNZA 3DYAA 4IFYA 4CF9A 5I42A 4N56A 4DMNA 3M8QA 2PZSA 4CHOA 3IS9A 1RDBA 5CYMA 3ZSRA 4CJLA 1Z26A 1NJZA 2B6AA 2HMIA 5CZ1A 4KTZA 1X1PA 3NFAA 1ASVA 3ZT4A 2DY4A 4AHTA 4KHWA 3AVNA 1JLCA 1JXBA 4CJKA 1FKOA 4FJKA 4KAZA 2KFZA 4CJUA 2HNYA 3AO1A 4K8ZA 3AV9A 3QLHA 1JXEA 2GV9A 4F2SA 4FJLA 3CG7A 1S1WA 2G8KA 4RW7A 4KHNA 4DQPA 2HVHA 1RT5A 1WSFA 1I39A 4PUOA 2EHGA 3O4QA 3DOLA 3MXJA 2VWJA 4BE0A 3VQPA 2HNDA 3TAEA 4CCHA 2QKBA 1BIZA 1RDCA 4BWJA 2KW4A 2I5JA 4M45A 4FM2A 4RW8A 3K57A 1CLQA 3RWUA 4CJ4A 1RTDA 4BACA 1D5AA 4IBNA 3TAQA 4JRPA 1SV5A 4DLGA 3T1AA 3V9SA 1UOCA 3OYJA 3AA4A 4OPKA 3SQ4A 4DLEA 1L3UA 4AILC 1LWEA 3PX4A 1N6QA 2OPSA 4KHUA 2BE2A 2YV0X 1KFDA 3NGZA 4UQGA 4B9NA 4CF1A 4EP4A 2ZE2A 1TL3A 1JLGA 1WSEA 1QSSA 5T7BA 2G8FA 4M3ZA 4ELVA 4I2PA 3SYZA 2VG7A 4G1QA 1XWLA 4LH5A 4CF8A 1WNSA 3KLFA 5HRRA 5I3UA 4B3OA 4KO0A 3RMDA 3QEWA 1BI4A 2E6MA 5FDLA 3NGIA 4N41A 3UIQA 4F8RA 3NHGA 5SZTA 1Q9YA 1RDAA 3VQBA 1GOAA 2A1RA 1BIUA 3AVBA 2G8UA 1YTAA 4OVLA 2G8HA 1T8EA 5HLFA 4E7IA 1KCFA 3AVMA 1NK9A 2WOMA 1ITGA 3LP3A 4OGCA 4KHSA 1TAQA 2HHQA 3AVLA 1RCHA 3SI6A 4B9LA 3KJVA 4CJSA 3FFIA 5CZ2A 3DRRA 3OYEA 4EZ6A 3RMAA 3ULDA 2D0BA 4J2EA 1W0HA 1HNIA 1C0MA 4KB1A 3VQQA 4IFVA 4KTQA 1QQCA 1EXQA 4FLWA 3QESA 1UWBA 4ELTA 1KTQA 4DG1A 3AVAA 3WNHA 4OKKA 3KK3A 1NK8A 4DTOA 1NK6A 1VSDA 5C24A 4OGEA 3OYBA 4GVMA 2GUIA 1C0UA 3KLEA 4EZ9A 1HYVA 3HPOA 1VRTA 3HT3A 3TI0A 4ZHRA 1BGXT 3MEDA 1S6PA 1Q9XA 1EX4A 3ZSWA 4CJWA 3O3FA 2ZQBA 4B8AB 4DTRA 2G8VA 4B9TA 4FLUA 4C8OA 3C6UA 3OY9A 1HJRA 2LSNA 3I0RA 3VQ6A 1IH7A 2JGUA 3HL8A 2Z1JA 1BISA 4RW4A 3OYCA 1A5XA 1C1CA 2Q3SA 3VA0A 1YVUA 4PY5A 1DTTA 1J54A 1REVA 2HHUA 2EX3A 3M8RA 2D0CA 3VQ4A 4CFAA 3EZ5A 2XY8A 4I9QA 4E7KA 3ZT1A 1VSEA 2G8WA 3AVJA 2FBTA 3DI6A 3MEGA 5E41A 3PV8A 1XC9A 2ITGA 2D0AA 3KLHA 4CHYA 1QHTA 1L3TA 1C1AA 1VK0A 1XHXA 1FKPA 3OYLA 4HTUA 1QE1A 1Y97A 1LWFA 4DFMA 4XIUA 4JS5A 4GW6A 3SZ2A 3HXMA 4F2RA 2IAJA 1SL2A 5JS2A 4W5QA 3AVIA 3L2WA 2XRIA 2YNIA 3RR7A 1TAUA 1DTQA 3C94A 4ID1A 3DLKA 4CEAA 2P5OA 4C8KA 1JL1A 3ITHA 3NF6A 4QAGA 5CY4A 1TK5A 4M41A 1TKDA 2KFNA 3LZJA 4Z0UA 5HRSA 4E7HA 3SV4A 3A2FA 1TK8A 4Z4GA 1ZBLA 2ATQA 4OLBA 4OPJA 4FZZA 1JLBA 1K6YA 1RDDA 4DTPA 1Z25A 2FBXA 4CIGA 4ELUA 4FLXA 2X78A 4HHTA 3DRSA 1NJYA 1S9EA 1WSGA 3KKRA 3P5JA 2Z1IA 3PY8A 3AA2A 4AH9A 3LDSA 4OJRA 4CGDA 3HVRA 4NYFA 3EYZA 2BANA 1TL1A 5J2PA 1XI1A 1SKSA 1S5JA 1RBRA 3TR8A 4CEFA 4CGGA 4N76A 2HHTA 4FJ8A 3CFPA 3AO2A 3TWHA 4E19A 5EU7A 4FLVA 5J2MA 2VWKA 3U6FA 4QCLA 2IC3A 1S1VA 3DLRA 4O44A 1D8YA 3OYGA 3KTQA 3PO5A 4KTWA 4DQIA 3KKSA 4FJ9A 4N47A 2NUBA 4CIFA 4M42A 3CM5A 4O0IA 4BDYA 4DFKA 4DF8A 3AA3A 1D9FA 3DLBA 1KLMA 4M3RA 3ZT0A 3IAYA 4Q0BA 1U04A 1BL3A 4CJVA 2Y1IA 5KGXA 2YNFA 4O0JA 3LANA 3NBPA 4Y1CA 4YNQA 4N5SA 4HCBA 4F3TA 2QXFA 5HRNA 4DSIA 1WSJA 4KHYA 3VQ7A 3K5LA 3BGRA 3TAFA 1T03A 1D9DA 2IDOA 4HUEA 2E6LA 3V6DA 5C25A 3KK2A 4H4OA 1WSIA 4CGFA 3NAEA 3QEVA 3THVA 1NOYA 1KSPA 4NCGA 2O4GA 3TARA 1VSMA 3NF8A 4CHNA 5CYQA 4DTSA 2OZMA 5KRTA 3OS2A 1RT3A 3CYMA 3O4NA 3ZSOA 4DU4A 2Y1JA 2KZZA 2X74A 3C95A 4EP5A 3PO4A 1KVAA 4CJPA 3DLHA 4BE2A 3HPGA 4O5BA 5DMRA 4FCYA 2DFHA 4DSFA 3HSTB 4DTXA 4HUFA 4AHVA 3V9WA 1NJWA 1YT3A 1LAWA 3PUFA 4GMJB 4DTUA 3AA5X 1VSLA 4IKFA 2FBVA 4HVJA 3HYFA 3WNGA 2RKIA 2D5RA 1GOBA 2YNGA 3NCIA 4DTMA 4DTNA 4FK2A 3RRHA 3QEIA 1TKZA 1F21A 1IG9A 3D0PA 2XY6A 4LSLA 4M3TA 1JLQA 3ASMA 4CF0A 5KTQA 4CEDA 5KI6A 3LPTA 2DFFA 1RTIA 4H4MA 3VQDA 4KPYA 2E4LA 3HM9A 2GBZA 3C6TA 3RMBA 1EETA 4FW2A 1J9AA 1TGOA 4RW9A 3I8DA 3S3NA 1NK0A 3LP2A 4CECA 4PA1A 1RTJA 4CJTA 4DTJA 4CHQA 3T3FA 3KLIA 1ZYQA 4FVMA 4FM0A 3U3YA 3RRGA 3F9KA 4WE1A 3VQ5A 3F73A 1VSKA 1KRPA 3QEPA 1RNHA 1W9HA 4KV8A 1ASWA 3WNFA 3ZCMA 2R7YA 4KB0A 3QINA 3MXIA 3P83D 4FYDA 3QERA 2DFEA 3NF9A 3U3GA 3G0ZA 4CEZA 4L8RB 4CJFA 4Z4HA 4FLZA 1I3AA 4J2DA 3LWLA 4PWDA 3VN5A 4B8CA 3V9UA 4H8KA 3SV3A 1JLFA 2HB5A 3VQ8A 3QIPA 1BQMA 3SPZA 1VSJA 4AHSA 1NK5A 2IGIA 4B08A 1Q8IA 4CERA 2BDPA 3B6PA 3L2RA 3L3UA 1NKEA 2XY7A 1ZBIA 4C8LA 3V9ZA 3E01A 4NCAA 3SQ0A 4FJGA 3DM2A 1BI4B 4ZTFA 3AVCA 4CEEA 1B92A 3G10A 1TK0A 2G8IA 3OS1A 4BE1A 1LV5A 4R5PA 3CFRA 2OPQA 4O55A 3NDKA 2X6SA 4J2BA 3DOKA 4DF4A 4I9LA 1RT2A 3LP0A 3S3OA 4NCBA 1VRUA 2Z1GA 3K5NA 4CEQA 1RBTA 4E7LA 1IKVA 3MAQA 1EKEA 2W42A 4J2AA 3OYAA 1L3SA 3OYDA 2PYJA 2RN2A 3ISNC 4DS5A 1L5UA 3K58A 3M8PA 4FJIA 3OVNA 3K5OA 4CK1A 4C8MA 4KI6A 1RT1A 1U49A 4DS4A 4FJXA 1TV6A 4IG0A 3V1QA 2YKNA 5HP1A 3QNNA 4IDKA 4KREA 4JS4A 1NK7A 4CJ3A 4CGHA 4AHRA 1G15A 3SNNA 4FW1A 1T7PA 3AVKA 1QS4A 3AO4A 2DTUA 4CJRA 3D45A 4O4GA 3L2QA 3K59A 3TAGA 4QOZB 4DU1A 3P1GA 4YFUA 1SUQA 4W5RA 4IG3A 1X9MA 2HHXA 1IKXA 4B9UA 1O1WA 2F8TA 3ZT2A 1C0TA 1LW2A 3LAMA 2HHVA 1VSFA 3KLGA 4FK4A 1B9DA 4BDPA 1HNVA 4LD0A 1A5VA 4OKJA 3LP1A 3V1OA 4B9MA 1EP4A 1WLJA 1ZBUA 3JSMA 2P51A 1UA0A 1ZBFA 3RTVA 3SUPA 1FK9A 4DQSA 4B9VA 1C6VA 1CXUA 1RT7A 4HUGA 4KI4A 3HJFA 4Z4CA 2AJQA 4FJNA 3LALA 3QO9A 4ID5A 4CESA 1KVCA 5FRNA 1IO2A 2B5JA 4ICLA 5HBMA 4CGJA 3LPUA 1U48A 3KD5E 4K8XA 3JYTA 4OLAA 1U45A 4FJMA 5D3GA 4Y1DA 1LW0A 3AVHA 2OPRA 2OA8A 1N5YA 4ZTJA 1S9GA 2OYQA 3WNEA 4DSLA 4MFBA 1S1XA 5DK5A 1ASUA 3NF7A 4CJEA 1KFSA 3V1RA 2QK9A 2KTQA 4FM1A 3DLGA 4CF2A 2RPIA 1IKWA 4I2QA 3VQEA 3SUOA 1HQUA 5C42A 1BCOA 4JLHA 4E89A 3HPHA 4CE9A 5J2QA 5JS1A 3OJSA 4E3SA 4CHPA 3KD1E 3NE6A 4CK3A 2IS3A 3IG1A 4M3XA 3O3HA 3LAKA 1YTUA 3VA3A 3SJJA 1RBUA 1S1TA 2YHBA 2HW3A 5KRSA 3ALYA 1SL1A 3TABA 2F8SA 3AO3A 1SKWA 1UA1A 3B6OA 1C1BA 1XHZA 4FZYA 3ZSVA 3MXMA 1VSHA 4DSKA 4DQQA 1BQNA 2PY5A 1GOCA 3LWMA 2QKKA 4Z4FA 3ZSXA 3CM6A 1RT4A 3V81A 3SPYA 2F96A 1UAXA 3NH1A 3QNOA 4B9SA 4KHQA 3OYHA 3TANA 1U4BA 1U47A 4AHCA 1HYZA 2YHAA 5J2NA 4FXDA 1JLAA 4KKOA 5J1EA 3K2PA 1QSLA 2O4IA 4FJ5A 3OJUA 3DMJA 2XHBA 2KZMA 3OYNA 3HO1A 1HQEA 2B4JA 2ETJA 4CFDA 1WAJA 3RR8A 2ZD1A 4DWIA 4DFJA 4DSJA 3AVGA 3OYIA 3HP9A 4E1NA 5SWMA 3QETA 1CZBA 4LH4A 2HHWA 3LZIA 4I7FA 3H08A 4CK2A 2RF2A 4FZXC 3CQ8A 1L3VA 1RTHA 2KQ2A 3EY1A 1VSIA 1X9WA 4E7JA 2IOCA 4M3UA 4CIEA 5FRMA 2Z1HA 1J53A 3ZSZA 4JRQA 3V9XA 1SL0A 4FLYA 2XY5A 4NYNA 4CGIA 3L2UA 1S1UA 1WAFA 3VQAA 3PX0A 1KLNA 4Z4EA 3IRXA 2YNHA 3CFOA 5KGWA 2YKMA 2HHSA 3ZT3A 1IKYA 5HROA 4F4KA 1CZ9A 4FLTA 3OYFA 3MECA 3AO5A 1S6QA
chains in the Genus database with same CATH superfamily
1NKBA 1DLOA 1BDGA 1ZC6A 4LSNA 3VQCA 4E1MA 4DR6K 3JAMO 2P9SB 4W5OA 4CBWA 1B9FA 1JL2A 4H5WA 4OPHA 5HRPA 1WN7A 4EHUA 3EE9A 5K14A 3LDNA 3O9RA 4YDUA 2FSKA 4C23A 3MEEA 3HM8A 1DEJA 3DJCA 4E0DA 3JXUA 3S3MA 4DFPA 3OYKA 5BR9A 4C8NA 1NJXA 4DV4K 4DUYK 3V4IA 3L4IA 3I0SA 2QWLA 2WONA 3AARA 4CEOA 3BDPA 1LAVA 3BF1A 4Q5VA 4JN4A 1TKTA 4IFYA 3DYAA 4WFNL 4DMNA 4BRNA 1VQ4N 3CXCM 3BUZB 4JNEA 3Q7CA 1C0FA 1RDBA 5CYMA 5H1SQ 2HOEA 4LFAK 4KTZA 5CHIA 4BC3A 3SJHA 3R6MA 1JLCA 2KFZA 2W6KA 5LMUK 3AO1A 4K8ZA 3AV9A 4FJLA 2Q0RA 1S1WA 4DQPA 1GLLO 5KPRA 4PUOA 4B1ZA 3O4QA 3DOLA 4BE0A 4CCHA 2QKBA 3VQPA 4BVOA 4RW8A 4CJ4A 3SAGA 4BACA 4IBNA 4JRPA 1SV5A 4DLGA 2YJEA 3V9SA 3CI5A 1UOCA 3SBTA 4DLEA 3PX4A 1LWEA 4KHUA 2OPSA 2YV0X 3VEXA 3VEYA 4UQGA 2A42A 1V4TA 2ZE2A 1JLGA 1WSEA 3TU5A 4ELVA 3SYZA 2GUPA 2VG7A 1XWLA 3FZHA 5I3UA 1TUYA 1BI4A 3NHGA 5SZTA 1HNWK 3VQBA 2A1RA 2QW9A 1ESVA 1W97L 4C1NK 1YTAA 4E7IA 3AVLA 3GE1A 4CJSA 3DLLL 3DRRA 2D0BA 1C0MA 3VQQA 3MK6A 5FPMA 3R1XA 3H1QA 3ZLJA 2RHKA 1NK8A 3C0BA 4OGEA 4GVMA 1HYVA 5EY4A 3TI0A 1VRTA 1EX4A 3ZSWA 4CJWA 4B8AB 4A61A 4FLUA 2NRVA 3CD6N 3OY9A 2LSNA 1IH7A 3HL8A 4PKIA 1XC3A 2VGNA 2HSTA 2Q3SA 2HHUA 3M8RA 3VQ4A 2XY8A 4NO7A 4KHPK 4JKGB 2FBTA 1YVNA 1XC9A 4EIAA 4XH1A 1FKPA 1D4XA 3K9JA 4B1UB 3L2WA 2YNIA 3VTIA 4C8KA 3HOTA 3E9PA 3VOVA 1NJIO 2KFNA 4Z4GA 3C6HA 1NG9A 5AFUH 3O5BA 1Z25A 4A2AA 4CD3A 4FLXA 2ASPA 5C10A 3DRSA 1NJYA 1S9EA 3KKRA 3P5JA 4A62A 3LDSA 3E9OA 1G99A 3VEVA 1GLJO 4EHTA 5BPLA 3EYZA 1WBBA 2KLAA 5J2PA 1S22A 4XEIA 1RBRA 3TR8A 3VMFB 4N76A 4WQ4C 3CFPA 5F2RA 5EU7A 3KWGA 4PKGA 1D8YA 3OYGA 4FJ9A 4KTWA 4DQIA 3IFRA 4CIFA 3L6QA 3WXLA 3U9DA 2IVPA 3OTOK 4Q0BA 4F9OA 5EVZA 1VQ7N 2YNFA 4O0JA 3LANA 3NBPA 3U8XA 1WSJA 4KH4A 4KHYA 3K5LA 3BGRA 1D9DA 3KK2A 4H4OA 2D0PA 1WSIA 4FWKA 4U7BA 4WF9L 3LM2A 1VQ5N 2E1ZA 4DTSA 2KZZA 4IZ9A 3C95A 3PO4A 3HPGA 5DMRA 2D4WA 1BU6O 4DSFA 4DTXA 4HUFA 4AHVA 3PUFA 1VSLA 3J81O 4BRCA 3HYFA 3WNGA 1GOBA 3NCIA 3C7NB 5AQJA 4FK2A 1TKZA 1F21A 5AQQA 4LSLA 1LOTB 3OW2M 2DFFA 1RTIA 2VQFK 1EETA 4FW2A 4JEPA 3O4WA 5BREA 1V4SA 2FLOA 4JKGA 5E84A 4BQZA 3S3NA 4PA1A 2O8DB 4FM0A 3U3YA 4BRLA 3F73A 1X3MA 1N36K 5AZJB 4KV8A 3ZCMA 2HBLA 3K0SA 4FYDA 3A5MC 3G0ZA 2VGMA 4FLZA 3CJ9A 4PWDA 5DM6L 1EQYA 5IT9O 4AHSA 5KPTA 3E1YA 3L2RA 3CQYA 4FJGA 3DM2A 3FLCO 5JICA 3GDQA 2HMPA 1BOTO 4DHYA 3FZLA 3ATVA 4K42A 3NDKA 1X3NA 3U9ZA 3LP0A 3K5NA 5BRDA 1SS6A 1RBTA 1IKVA 4LF5K 4J2AA 1L3SA 3OYDA 2PYJA 3ISNC 4DS5A 4H0OA 2ZJRL 3K58A 4XH4A 3HSCA 3ZX2A 4FJIA 3OVNA 3ZETB 3VEZA 5CR4A 1S3XA 4H03B 2ZGZA 5C0YA 4BR7A 3QNNA 3DXKA 1MWKA 3VTHA 3R8EA 3SNNA 1T7PA 3WXMB 3H6EA 1GLDG 3I8BA 4LF6K 3K59A 2HBJA 3EE8A 4FWNA 3CHWA 4IG3A 2HHXA 4B9UA 3PIPL 2F8TA 3GG4A 2OCEA 4A57A 2WBNA 4CZEA 1A5VA 5M1NA 4M7YA 4WQ5A 1C6VA 3HJFA 2AJQA 3CCJN 1KVCA 4BQLA 5HBMA 4CGJA 1U48A 3KD5E 4K8XA 1C0GA 4B3MK 1M1KO 4DSLA 5ADXH 1N5YA 3GL1A 1KFSA 1VQLN 3MN5A 2QK9A 1KAYA 3N4PA 5EOYA 1NWKA 5AQPA 4O5FA 1HQUA 5C42A 1BCOA 2VCPA 4E89A 3HPHA 3ZEUB 5J2QA 1VQNN 5AZJA 3NE6A 3CCSN 2F7TA 2DPNA 3LAKA 1GLAG 5LY3A 3VERA 2A6AA 1RGIA 3TABA 4ISFA 2V51B 2O8EB 1C1BA 4A59A 5BRFA 4DQQA 4G9ZA 2QKKA 3ZSXA 1IBLK 1RT4A 4B9SA 1UAXA 3NH1A 2NRTA 3TANA 1U4BA 4AHCA 4BGAA 3I55N 1JLAA 1QSLA 2KZMA 3DMJA 2P9LA 2B4JA 2ETJA 1WAJA 3P31A 3O9TA 4DSJA 4YDUC 3HP9A 3UKUA 4E1NA 3QETA 1SQKA 2HHWA 1H1VA 3H08A 3VEOA 4FZXC 1OH5A 3CQ8A 1L3VA 1VSIA 3CPEA 2IOCA 4M3UA 3ZETA 1SL0A 4FLYA 1NGGA 4NYNA 4UY8O 2IVOA 3IRXA 4AF1A 2YKMA 4DV5K 1IKYA 4F4KA 5MLCQ 3MWTA 2ASOA 3DAWA 3OYFA 2BTFA 2ZF5O 5BPMA 1TVRA 3OYMA 3SUNA 1J5OA 1DGKN 4RG8A 1YIJN 4CJ5A 1KVBA 4BGBA 1NMNA 3UE5A 1BCMA 3O3GA 1BHLA 2JLEA 2NRRA 3QB0A 4DQRA 3SQ2A 3PX6A 1NK4A 1RBSA 1YI2N 4AQYK 2EWSA 4TSXA 2OZSA 4JK9A 1HMVA 5FROA 2XO7A 1QSYA 3SQ1A 4AHUA 2FBYA 1HYSA 4DSEA 4MO4A 4Z4IA 2OPPA 4CHZA 4KFBA 3VQ9A 4FJJA 2AP1A 3F2KA 5AFUA 2VG5A 1KC8O 3L8BA 4LFBK 2A41A 3ZSYA 4FK0A 1WSHA 2F8SA 4M3YA 1P90A 3HP6A 1NKCA 1XMOK 5AR0A 3ZEUA 4H5TA 5AZIB 2A1SA 3FGUA 4JHDB 5I42A 4N56A 2PZSA 3ZSRA 2HMIA 5CZ1A 2O8EA 2DY4A 1FKOA 4BY9C 3CG7A 5AQUA 5EX5A 4WCEL 2YHYA 2G8KA 2HVHA 1RT5A 1K73O 1E4GT 2GWJA 3MXJA 3K9KA 2VWJA 1KAZA 4CZGA 4HTLA 3QBWA 1MA9B 3K57A 1WUAA 1CLQA 3VETA 2ASMA 3HZ6A 1NU0A 3T1AA 4AILC 1N6QA 1KFDA 4X66K 4DR1K 4EP4A 1TL3A 4FWMA 1IV0A 5T7BA 1QZ5A 2YHWA 4FL9A 4CZHA 3MX5A 3KLFA 4B3OA 4KO0A 5CE3A 3BF3A 3P4IA 4IFEA 4IOAL 5LJVA 4N41A 3NGIA 1J5EK 2UUCK 3UIQA 1Q9YA 1RDAA 4DV1K 1XUPO 1BIUA 2GWKA 2G8UA 1ILYA 5AQKA 3O1BA 2G8HA 1KCFA 3AVMA 2WOMA 4LC9B 4B9LA 3RMAA 4JD2B 3ULDA 3TPQA 3FZMA 4KB1A 4PHTX 1VAZA 2H3GX 4FLWA 5KPZA 1KTQA 1W7AA 2OTJN 5AQHA 5C24A 2JWLA 5B8HA 2AA4A 3ZX0A 3MEDA 4ZHRA 1S6PA 4DB3A 4IWVA 3H46O 1YHQN 4YORA 2JGUA 4JHDA 3OYCA 4XH5A 4H0XB 3VA0A 1YVUA 3N4QA 1DTTA 4H0PA 2D0CA 5F0XA 4I9QA 5LL6Z 4CW7B 4E7KA 3ZT1A 4EAHD 2G8WA 4A5BA 3TSQA 3PV8A 2Q31A 3CJ7A 3KLHA 4CI6A 1QHTA 1L3TA 1C1AA 1VK0A 4HTUA 3O8MA 2BH1A 3SZ2A 2IAJA 3AVIA 1CZAN 4BRKA 3CJCA 1TAUA 2ITMA 4ID1A 4CEAA 2P5OA 4BRQA 3VEWA 1SZ2A 1TKDA 4Z0UA 5A2QO 3SV4A 3A2FA 4BR9A 2ATQA 5GIOA 4FZZA 3SMPA 4DV6K 1K6YA 4DTPA 4HHTA 4JKCA 4JKFA 3NVKA 4CJ7A 3PSFA 1K8KB 1IJJA 3ENOA 4CGDA 3WUHA 5AQGA 1TL1A 3M5RA 1ATRA 1S5JA 4CGGA 3AO2A 4E19A 4FLVA 4FSVA 4FWLA 3DLRA 4O44A 3PO5A 4BRPA 3KKSA 4M42A 5ADXA 3CM5A 4DFKA 4DF8A 3IAYA 4IEEA 5M1QA 1EO1A 2Y1IA 4Y1CA 3MMVA 2QXFA 3QFPA 3TAFA 3V6DA 3VESA 5C25A 4IOXA 3QEVA 1NOYA 1KSPA 3CERA 4KBOA 3GOIA 5CYQA 2OZMA 3WT0A 3ZSOA 2E5LK 3ULEB 2O8BB 2HBMA 5AQOA 3V9WA 1YT3A 3AA5X 4IKFA 2FBVA 3A8YA 4GKJK 3AY9A 2VWBA 3LL3A 4YOXA 4DTMA 3QBXA 3QEIA 2UU9K 4YOUA 2XY6A 2A3ZA 2P9SA 3P38A 3ASMA 4WFAL 3BY5A 4DR5K 3FZFA 5KI6A 4BRHA 2E4LA 3HM9A 2GBZA 3C6TA 1J9AA 5AQNA 2FF6A 3CC7N 1NK0A 4CECA 5AJ3K 5ELZA 4CHQA 4BRFA 1K8AO 2VQEK 2Q0UA 2FF3B 4FVMA 4A5AA 1ZYQA 3RRGA 1GLCG 1VSKA 2WFBA 5FPDA 2BUPA 2O8FB 1RNHA 2E1YA 4KB0A 4NLBA 2NNWA 3NF9A 3U3GA 4Z4HA 1I3AA 3E9LA 3V9UA 2UUAK 1VSJA 4CERA 3B6PA 3B8AX 4B3SK 3L3UA 3VPZA 4C8LA 2YCHA 3E01A 3SQ0A 1U2VB 1B92A 1HKCA 3QDKA 1TK0A 4BG8A 4R5PA 2OPQA 2X6SA 4OO1J 4J2BA 4DF4A 1JCFA 2QWMA 1VRUA 3J7AP 1N33K 2ZJPL 1L5UA 1YF5L 5AQWA 3KK7A 5BN8A 2HF3A 4FOEA 4C8MA 4AM6A 4B3TK 4RWTA 2F9WA 4BC4A 4FJXA 3CC4N 2W41A 3V1QA 5JLFA 5EXWA 5HP1A 2P9UB 4KREA 4BG9A 3ATUA 2FXUA 3D7EO 4CGHA 4AHRA 1G15A 1Q18A 1QS4A 2QEXN 2DTUA 1S72N 3L2QA 3TAGA 4QOZB 2O8BA 4YFUA 4ILHA 4GKKK 3LAMA 1B9DA 4BDPA 4BROA 3V1OA 1EP4A 1EWQA 3MCPA 3JSMA 2P51A 1ZBFA 3SUPA 4DQSA 1T6DA 1CXUA 3ZYYX 4PKHA 5FRNA 1IO2A 1VQPN 4X65K 4Y1DA 4ZTJA 2OYQA 4CJEA 2KTQA 4CF2A 3QICA 4JKEA 2O8FA 2IS3A 3IG1A 1VQ9N 3O3HA 5C12A 4CZLA 2HW3A 2HF4A 2V7YA 3SLCA 3MXMA 1VSHA 4DSKA 1BQNA 3VGKA 1GOCA 2NZTA 3LWMA 4Z4FA 3V81A 3SPYA 4KHQA 4CZIA 1WB9A 1HYZA 4FXDA 1U2VA 5AQZA 2O8CB 4FJ5A 3OJUA 2XHBA 4CFDA 4DFJA 4CD1A 1DT9A 3AVGA 3TSPA 1CZBA 3THYB 4CK2A 2RF2A 4HWIA 4B1VA 2KQ2A 5AQSA 3UB5A 1X9WA 4KH5A 4CIEA 3HOSA 2Z1HA 3ZSZA 1NGBA 3PX0A 3VQAA 3EL2A 1KLNA 3CFOA 5KGWA 1Q7YO 1GLEG 2HHSA 1NGIA 3ZT3A 2ZWHA 2P9UA 4FLTA 4MO5A 3FE1A 3L0QA 4FWPA 1S6QA 2WTUA 1ATNA 1P8ZA 1RDUA 4W5NA 3CCLN 1XNRK 4IJNA 1RILA 1HKGA 3DXMB 3DRPA 3QIOA 4NLCA 4DV0K 3KWIA 4BRMA 3O9UA 4IXCA 1T05A 3NH2A 4RW6A 3T7ZA 3S9HA 1ZBHA 1IBMK 4U67L 3CJ1A 4FWRA 4PQUA 2P1JA 3A5OC 4JI3K 3TAMA 2QA4N 2CH5A 4CJQA 1CXQA 3I56N 1VHXA 2HVIA 4FJ7A 3M8SA 3AAPA 2P5GA 3HK2A 2UXDK 3NGYA 2X6NA 5M1OA 3L2VA 1T3VA 4W5TA 4DQ8A 4F3OA 3KIOA 1O13A 3BEXA 4HCCA 4GNIA 3TAPA 1N8RO 3OS0A 1VQMN 3ZSQA 3KK1A 1JLEA 4M3WA 4CFBA 1YJWN 1JKHA 3F9MA 2HNZA 4CF9A 3TTFA 3C7NA 1HUXA 4CJLA 1NJZA 2B6AA 2UUBK 1X1PA 5TKYA 2IIRA 2WC9A 1ASVA 4KHWA 4JI7K 1JXBA 1YITN 4FJKA 4CJUA 5GAHP 2HNYA 1TYQB 3QLHA 1JXEA 4F2SA 3EKSA 4RW7A 1WSFA 2EHGA 4FPAA 5JVGL 2HNDA 4OPAA 1SAZA 1BIZA 2O8DA 1KAXA 3TSUA 1NGEA 3TTDA 1HLUA 1D5AA 3TAQA 5C2DA 4H0VB 3KZBA 3O9QA 3NGZA 4CF1A 3O08A 2G8FA 4BR4A 5BRHA 4G1QA 1QVGM 4LH5A 4CF8A 4QS9A 3QEWA 3CJAA 2P9IB 3O1WA 4Y0WA 4F8RA 1GOAA 3AVBA 3DXMA 2E20A 1TUUA 4OVLA 1NGDA 1QZ6A 5HLFA 3WEEB 2E8AA 1NK9A 4OGCA 4H0YB 3LP3A 2V52B 1NBWA 4GV3A 2CGKA 1RCHA 3SI6A 1I94K 3KJVA 3OYEA 4EZ6A 3H3NO 4J2EA 1W0HA 1WOQA 1QQCA 1EXQA 2ZM6K 4ELTA 1Y64A 3AVAA 3KK3A 4OKKA 1NK6A 4DTOA 4EZ9A 3OYBA 1C0UA 3O6WA 3HPOA 2RE2A 3HT3A 4QS7A 4DTRA 4B9TA 4DV3K 4C8OA 3CJBA 1HJRA 4JI1K 3I0RA 3VQ6A 2Z1JA 1BISA 2P9KB 4BR5A 5BN9A 4PY5A 1REVA 3ID8A 3MX2A 5FPNA 3EZ5A 1VSEA 3AVJA 3DI6A 3MEGA 2HHHK 3J7ZO 3IUCA 2OTLN 4CHYA 1XHXA 3OYLA 1QE1A 2UXCK 4DFMA 4XIUA 4JS5A 2E2QA 5M1KA 4W5QA 1OH7A 4EFHA 4H5NA 3WXIA 1JL1A 3ITHA 3NF6A 4RCHA 1TK5A 4M41A 2QXLA 1QVFM 4NB4A 3RSEB 3D2FB 3L4QA 1Q86O 2KKZA 1ZBLA 4I6MB 2V7ZA 4OLBA 4OPJA 3M6GA 1JLBA 4ELUA 4CIGA 1QHAA 2X78A 1NGJA 3EEQA 3AA2A 4AH9A 3CCEN 2Q97A 4Z94A 1BUPA 3HVRA 3H3OB 5AQRA 4PL8A 1Q82O 1XI1A 3U6FA 3VGLA 2VWKA 2P9IA 1S1VA 2YX6A 2UXBK 2VYPA 4M3RA 4BRAA 3WQUA 1U04A 1BL3A 4HCBA 4N5SA 4F3TA 3J7YP 2QM1A 3VQ7A 4FO0A 1T03A 2IDOA 3CETA 2E6LA 2O4GA 3TARA 1VSMA 5GINA 5KRTA 1RT3A 3CYMA 2JWKA 2Y1JA 2X74A 1YJNN 4EP5A 3DLHA 4FCYA 2DFHA 3HSTB 3PLAA 2HBKA 3C6AA 4DTUA 3J80O 3FZKA 5JLHA 2D5RA 5AQIA 1VQON 1FJGK 3RRHA 5BPNA 3H1VX 1HJOA 3HRGA 4CF0A 2P9KA 1HX1A 3LPTA 4H4MA 3VQDA 3FFKB 3I8DA 3NMUA 4B1YB 3LP2A 3VF2A 1RTJA 4WYBA 5AQTA 4CVNE 5AQMA 3KLIA 1E3MA 3F9KA 4WE1A 3PIOL 1KRPA 1KQSM 1W9HA 1ASWA 1VQ6N 3QINA 3LDPA 3MXIA 4QS8A 4YOTA 4FWQA 4CEZA 2I7NA 4RTFD 1RFQA 4J2DA 3VN5A 5AZIA 4B8CA 4I6MA 3CQXA 1JLFA 2HB5A 1BQMA 3R3LA 4BREA 3O80A 5GADP 5TKWA 1NK5A 4DCHA 2IGIA 4B08A 2BDPA 2YI1A 1NKEA 2XY7A 1OVQA 3V9ZA 4CBXA 1BI4B 3CCUN 2NRXA 4CEEA 3G10A 3OS1A 2QWQA 4GV9A 3J8AA 2NLXA 4O55A 3CFRA 5LJWA 4CBUA 1E4FT 4I9LA 3EN9A 3S3OA 4NCBA 2YHXA 3VF4A 4CEQA 4E7LA 3IMXA 1EKEA 4H0TB 2W42A 4FWOA 3OYAA 2Q36A 3M8PA 3A5LC 1JCGA 1VQ8N 2D1KA 3K5OA 4CK1A 1HNZK 1RT1A 3TTCA 1U49A 1TV6A 4IG0A 2Q1NA 3M1FA 2YKNA 4OX9K 4IDKA 4JS4A 1OVYA 4CJ3A 1NK7A 5AQLA 4PL7A 4C1NI 4FW1A 4JK8A 4JI0K 3AGKA 4CJRA 3OHRA 1Z6RA 4O4GA 4JYAK 1N32K 4E1JA 4B1XB 4W5RA 1SUQA 4ILGB 4WFBL 1IKXA 2OANA 3E66A 3ZT2A 4GVEA 2HHVA 5LMNK 4FK4A 3RVCA 4B3RK 3LP1A 4B9MA 1ZBUA 4B9VA 1FK9A 5F1XA 4HUGA 1RT7A 1NM1A 4Z4CA 4FJNA 3MN9A 3LALA 4CESA 5HL7L 2P9NB 4BC2A 2UYTA 3LPUA 4OLAA 3JYTA 4A2BA 3CCMN 3DWLA 4IDHA 4FJMA 3G25A 1LW0A 3AVHA 2OPRA 3FR0A 4JD2A 2OA8A 3WNEA 3CMAN 4MFBA 5DK5A 3NF7A 3DLGA 3CCQN 1T6CA 4GY2B 4YHHK 1GLFO 5JS1A 4E3SA 4CHPA 1MDUB 4CK3A 4FOIA 3SJJA 4MDBA 1RBUA 1S1TA 5IWAK 5KRSA 3ALYA 1SKWA 1UA1A 1XHZA 3ZSVA 4JKHA 1QQNA 1YUWA 2PY5A 4MLHA 4MLEA 3CMEN 4DR7K 3CM6A 2F96A 3QNOA 1KD1O 4V19S 1U47A 2YHAA 3T1YK 5J2NA 4KKOA 5J1EA 3K2PA 1T44A 2J4RA 3HO1A 4DWIA 4JKAA 3WXKA 4JAXA 4LH4A 3Q7BA 4I7FA 2A5XA 3LDLA 2NRZA 2NRWA 3I33A 1N34K 1VQKN 4FWSA 3V9XA 4JRQA 2XY5A 2QWRA 4CGIA 4CZFA 3L2UA 1S1UA 1WAFA 5E26A 4JI5K 4LF9K 5HROA 1J6ZA 1IG9A 3MECA 4KPYA 3DLEA 3HVTA 1K8KA 4MQ3A 1A5WA 1FXXA 3AVFA 1HRHA 1MU2A 4CFCA 1SKRA 1NNEA 4WQ5C 2PYLA 1R0AA 1M90O 5AQFA 1LWCA 1X9SA 3SCXA 3K5MA 5FPEA 3CF5L 4IO9L 1IBKK 2D0OA 2QTDA 5C15A 1RBVA 4LF4K 2BGGA 1RT6A 4LY7A 3EZWA 3ID6A 2FC0A 3QEXA 2P9NA 4BWMA 4DU3A 3L3VA 2VG6A 1QTMA 4FJHA 1TKXA 4CEBA 4K25A 3U4LA 3SUQA 4BDZA 3T19A 4YOWA 3NH0A 1NOZA 1HPZA 4OKEA 3ULEA 3RMCA 4KRFA 4BRDA 4FVUA 3M8QA 4LF8K 3THWB 4CHOA 3IS9A 1Z26A 4K43A 4JI6K 3SBGA 4DR4K 4X62K 3NFAA 3ZT4A 4AHTA 1LCUA 3AVNA 4CJKA 2KHOA 3F5TA 4JK7A 4KAZA 1U6ZA 4AM7A 4KHNA 2GV9A 1I39A 4B1WB 1IG8A 3TAEA 1X9JA 3MDQA 2CGJA 1RDCA 4BWJA 2KW4A 5HOOA 2I5JA 3D2EB 4M45A 4FM2A 2P9PB 3WXJA 3RWUA 1RTDA 4JI2K 3SMSA 1NGFA 3OYJA 1L3UA 3AA4A 1HPMA 4OPKA 3SQ4A 2HHTA 2BE2A 3DXKB 4B9NA 1ZXOA 3SAHA 1WBDA 3VF6A 1QSSA 4M3ZA 1FW6A 4BRGA 2I7PA 4I2PA 3EO3A 4CZMA 1WNSA 1EWRA 1MWMA 5HRRA 5GIPA 3RMDA 3CC2N 2E6MA 5FDLA 2E88A 5M1PA 4YY3K 4LFCK 2ZJQL 1T8EA 1HNXK 4KHSA 1ITGA 3ZX3A 1TAQA 3HI0A 3ENBA 1OH6A 2HHQA 1ZBSA 1KXPA 3OA9A 3FFIA 2W40A 5CZ2A 3LDOA 1JCEA 1HNIA 1YAGA 4IFVA 4KTQA 4ISEA 3QESA 1UWBA 4CZKA 4DG1A 3WNHA 1VSDA 2GUIA 3KLEA 1BGXT 1NGCA 1Q9XA 3O3FA 2ZQBA 2G8VA 4ILJA 1HKBA 3C6UA 2YJFA 3NVMA 1NMDA 5DM7L 5JMVA 3W3DA 3O9SA 4RW4A 1A5XA 1C1CA 1NGAA 1Z05A 2QWPA 3THWA 1J54A 4B9QA 2EX3A 4CFAA 3T1HK 1HR0K 2QI2A 5E41A 2ITGA 2D0AA 2P9LB 1Y97A 1LWFA 3BZCA 3EKUA 4GW6A 3HXMA 4F2RA 1SL2A 5JS2A 3UKUB 4GV6A 2XRIA 3RR7A 1DTQA 4YOYA 3C94A 3DLKA 3SK3A 3UKRB 1XQSC 4QAGA 5CY4A 4JKBA 2GX9A 3LZJA 3D2EA 5HRSA 4E7HA 2P9PA 3SAFA 1TK8A 5KQ8A 3G71N 3PSIA 3H45C 3T69A 1RDDA 2PFUA 2FBXA 3KHYA 1K9MO 3JS6A 5GAEP 1WSGA 1BO5O 2QWOA 2Z1IA 3PY8A 3IDHA 4OJRA 3S41A 3OBWA 4NYFA 2BANA 4M7XA 4H5VA 1SKSA 4CEFA 2ZGYA 4FJ8A 3MN7A 3TWHA 5J2MA 3HBTA 4QCLA 2IC3A 3KTQA 3AGRA 2O8CA 2NRHA 4N47A 2NUBA 3CPWM 3ENHA 4O0IA 4BDYA 3AA3A 1D9FA 3DLBA 1KLMA 4FPBA 3ZT0A 4CJVA 4KI6A 3GBTA 5KGXA 4YNQA 3THYA 3MCAB 4DSIA 5HRNA 4BR2A 3R9PA 5AQXA 4DUZK 4HUEA 4X64K 4CGFA 3NAEA 3THVA 1OKJA 4NCGA 3NF8A 4CHNA 2CGLA 3OS2A 3O4NA 4DU4A 5I9EB 1KVAA 4IEIA 4O8UA 4CJPA 4BE2A 3BP8A 4O5BA 1NJWA 2WUSA 1LAWA 4GMJB 4YOVA 4HVJA 3KVGA 2RKIA 2YNGA 4JI8K 4DTNA 4DR3K 4NXNK 5M1FA 3D0PA 3VGMA 4M3TA 1JLQA 5KQDA 5KTQA 4WQ4A 4CEDA 1XNQK 3D6RA 3RMBA 1TGOA 3QMLA 4RW9A 3P39A 3C65A 3MWPA 4CJTA 4DTJA 2A40A 3T3FA 4JI4K 4BVPA 1Q81O 3VQ5A 4MDAA 2E2NA 4CZJA 3QEPA 3WNFA 2R7YA 2GEMA 3UKRA 3P83D 3CCRN 3QERA 2DFEA 4L8RB 2GELA 4CJFA 4JKDA 5C2FA 3LWLA 4H8KA 3SV3A 3VQ8A 3QIPA 3SPZA 2QWNA 2E2PA 1Q8IA 5FLXO 1RDWX 1ZBIA 4NCAA 4ZTFA 3AVCA 4K41A 2G8IA 4BE1A 1LV5A 1TYQA 1BG3A 3DOKA 1RT2A 4DR2K 1NGHA 2Q2RA 2Z1GA 4NXMK 3MAQA 4ISGA 2RN2A 3AAQA 4L3QA 3THXB 2F4VK 1QQMA 3G4SN 3IKMA 1BA0A 4DS4A 4O8KA 5AQYA 5GAGP 4LF7K 3LM9A 1OH8A 5AQVA 4JV5K 4K0KK 3CIPA 3AVKA 3AO4A 3D45A 3HTVA 4DU1A 3P1GA 1X9MA 1O1WA 4M63C 1C0TA 1LW2A 1VSFA 3KLGA 1HNVA 3CCVN 4LD0A 4OKJA 1WLJA 1UA0A 3RTVA 1DKGD 3WEEA 4KI4A 3WQTA 3QO9A 4ID5A 3OBYA 2B5JA 4ICLA 1U45A 1XMQK 5D3GA 1S9GA 4IJAA 4R79A 1S1XA 1ASUA 4DKWA 2PAVA 3V1RA 4FM1A 2RPIA 4J8FA 1IKWA 4I2QA 3VENA 4H5RA 3VQEA 3SUOA 4JLHA 4CE9A 3OJSA 1R59O 3KD1E 2IVNA 1W2BM 4M3XA 1BA1A 1YTUA 3VA3A 2E2OA 2YHBA 1SL1A 3AO3A 3B6OA 4DV7K 4FZYA 3LDQA 3A5NC 2GTDA 1BWFO 3QFUA 3A0IX 1YXQA 3OYHA 1GLBG 3MN6A 2O4IA 3OYNA 5JVHL 1HQEA 4KH6A 4BRIA 3RR8A 2ZD1A 2CH6A 3OYIA 5SWMA 1NLVA 4DV2K 1ATSA 3LZIA 3BZKA 1RTHA 3EY1A 3G6EN 4E7JA 5BR8K 5FRMA 1J53A 3RSEA 3THXA 2F9TA 3D2FA 1YJ9N 3M3ZA 2PBDA 4IO8A 1JJ2M 4Z4EA 1QQOA 2YNHA 4BR0A 2FSJA 2FSNA 2W6LA 4IOCL 1CZ9A 4BC5A 3W0LA 3AO5A
chains in the Genus database with same CATH topology
3DLEA 1TVRA 3HVTA 3OYMA 3SUNA 1NKBA 4MQ3A 1J5OA 1DLOA 1A5WA 4W5NA 1FXXA 4RG8A 3AVFA 3VQCA 4LSNA 1HRHA 1MU2A 4CFCA 1RILA 4CJ5A 1KVBA 4E1MA 1SKRA 3DRPA 3QIOA 1BCMA 3O3GA 2PYLA 4W5OA 1T05A 1BHLA 2JLEA 1B9FA 4DQRA 1R0AA 3SQ2A 3NH2A 1LWCA 4RW6A 1X9SA 3PX6A 3SCXA 3S9HA 1ZBHA 3K5MA 1JL2A 5HRPA 1NK4A 4PQUA 1RBSA 2P1JA 1WN7A 5K14A 3TAMA 4TSXA 2OZSA 1HMVA 1RBVA 5FROA 1CXQA 4CJQA 2BGGA 2XO7A 1RT6A 1QSYA 4LY7A 3MEEA 3SQ1A 2HVIA 4AHUA 2FBYA 1HYSA 4DSEA 4FJ7A 3M8SA 2FC0A 4E0DA 4Z4IA 3QEXA 2P5GA 3HK2A 2OPPA 4CHZA 3S3MA 3NGYA 2X6NA 4DFPA 4BWMA 4DU3A 4KFBA 3VQ9A 4FJJA 3OYKA 3L2VA 3L3VA 2VG6A 1QTMA 2VG5A 4C8NA 4W5TA 1NJXA 4FJHA 1TKXA 4CEBA 3L8BA 4F3OA 3SUQA 4BDZA 3ZSYA 3KIOA 3T19A 4FK0A 4HCCA 3V4IA 3NH0A 3TAPA 3I0SA 3OS0A 1WSHA 2WONA 4CEOA 1NOZA 1HPZA 4OKEA 3ZSQA 3HP6A 3KK1A 3RMCA 1NKCA 3BDPA 4M3YA 1JLEA 1LAVA 4Q5VA 4M3WA 4CFBA 4KRFA 1TKTA 1JKHA 2A1SA 2HNZA 3DYAA 4IFYA 4CF9A 5I42A 4N56A 4DMNA 3M8QA 2PZSA 4CHOA 3IS9A 1RDBA 5CYMA 3ZSRA 4CJLA 1Z26A 1NJZA 2B6AA 2HMIA 5CZ1A 4KTZA 1X1PA 3NFAA 1ASVA 3ZT4A 2DY4A 4AHTA 4KHWA 3AVNA 1JLCA 1JXBA 4CJKA 1FKOA 4FJKA 4KAZA 2KFZA 4CJUA 2HNYA 3AO1A 4K8ZA 3AV9A 3QLHA 1JXEA 2GV9A 4F2SA 4FJLA 3CG7A 1S1WA 2G8KA 4RW7A 4KHNA 4DQPA 2HVHA 1RT5A 1WSFA 1I39A 4PUOA 2EHGA 3O4QA 3DOLA 3MXJA 2VWJA 4BE0A 3VQPA 2HNDA 3TAEA 4CCHA 2QKBA 1BIZA 1RDCA 4BWJA 2KW4A 2I5JA 4M45A 4FM2A 4RW8A 3K57A 1CLQA 3RWUA 4CJ4A 1RTDA 4BACA 1D5AA 4IBNA 3TAQA 4JRPA 1SV5A 4DLGA 3T1AA 3V9SA 1UOCA 3OYJA 3AA4A 4OPKA 3SQ4A 4DLEA 1L3UA 4AILC 1LWEA 3PX4A 1N6QA 2OPSA 4KHUA 2BE2A 2YV0X 1KFDA 3NGZA 4UQGA 4B9NA 4CF1A 4EP4A 2ZE2A 1TL3A 1JLGA 1WSEA 1QSSA 5T7BA 2G8FA 4M3ZA 4ELVA 4I2PA 3SYZA 2VG7A 4G1QA 1XWLA 4LH5A 4CF8A 1WNSA 3KLFA 5HRRA 5I3UA 4B3OA 4KO0A 3RMDA 3QEWA 1BI4A 2E6MA 5FDLA 3NGIA 4N41A 3UIQA 4F8RA 3NHGA 5SZTA 1Q9YA 1RDAA 3VQBA 1GOAA 2A1RA 1BIUA 3AVBA 2G8UA 1YTAA 4OVLA 2G8HA 1T8EA 5HLFA 4E7IA 1KCFA 3AVMA 1NK9A 2WOMA 1ITGA 3LP3A 4OGCA 4KHSA 1TAQA 2HHQA 3AVLA 1RCHA 3SI6A 4B9LA 3KJVA 4CJSA 3FFIA 5CZ2A 3DRRA 3OYEA 4EZ6A 3RMAA 3ULDA 2D0BA 4J2EA 1W0HA 1HNIA 1C0MA 4KB1A 3VQQA 4IFVA 4KTQA 1QQCA 1EXQA 4FLWA 3QESA 1UWBA 4ELTA 1KTQA 4DG1A 3AVAA 3WNHA 4OKKA 3KK3A 1NK8A 4DTOA 1NK6A 1VSDA 5C24A 4OGEA 3OYBA 4GVMA 2GUIA 1C0UA 3KLEA 4EZ9A 1HYVA 3HPOA 1VRTA 3HT3A 3TI0A 4ZHRA 1BGXT 3MEDA 1S6PA 1Q9XA 1EX4A 3ZSWA 4CJWA 3O3FA 2ZQBA 4B8AB 4DTRA 2G8VA 4B9TA 4FLUA 4C8OA 3C6UA 3OY9A 1HJRA 2LSNA 3I0RA 3VQ6A 1IH7A 2JGUA 3HL8A 2Z1JA 1BISA 4RW4A 3OYCA 1A5XA 1C1CA 2Q3SA 3VA0A 1YVUA 4PY5A 1DTTA 1J54A 1REVA 2HHUA 2EX3A 3M8RA 2D0CA 3VQ4A 4CFAA 3EZ5A 2XY8A 4I9QA 4E7KA 3ZT1A 1VSEA 2G8WA 3AVJA 2FBTA 3DI6A 3MEGA 5E41A 3PV8A 1XC9A 2ITGA 2D0AA 3KLHA 4CHYA 1QHTA 1L3TA 1C1AA 1VK0A 1XHXA 1FKPA 3OYLA 4HTUA 1QE1A 1Y97A 1LWFA 4DFMA 4XIUA 4JS5A 4GW6A 3SZ2A 3HXMA 4F2RA 2IAJA 1SL2A 5JS2A 4W5QA 3AVIA 3L2WA 2XRIA 2YNIA 3RR7A 1TAUA 1DTQA 3C94A 4ID1A 3DLKA 4CEAA 2P5OA 4C8KA 1JL1A 3ITHA 3NF6A 4QAGA 5CY4A 1TK5A 4M41A 1TKDA 2KFNA 3LZJA 4Z0UA 5HRSA 4E7HA 3SV4A 3A2FA 1TK8A 4Z4GA 1ZBLA 2ATQA 4OLBA 4OPJA 4FZZA 1JLBA 1K6YA 1RDDA 4DTPA 1Z25A 2FBXA 4CIGA 4ELUA 4FLXA 2X78A 4HHTA 3DRSA 1NJYA 1S9EA 1WSGA 3KKRA 3P5JA 2Z1IA 3PY8A 3AA2A 4AH9A 3LDSA 4OJRA 4CGDA 3HVRA 4NYFA 3EYZA 2BANA 1TL1A 5J2PA 1XI1A 1SKSA 1S5JA 1RBRA 3TR8A 4CEFA 4CGGA 4N76A 2HHTA 4FJ8A 3CFPA 3AO2A 3TWHA 4E19A 5EU7A 4FLVA 5J2MA 2VWKA 3U6FA 4QCLA 2IC3A 1S1VA 3DLRA 4O44A 1D8YA 3OYGA 3KTQA 3PO5A 4KTWA 4DQIA 3KKSA 4FJ9A 4N47A 2NUBA 4CIFA 4M42A 3CM5A 4O0IA 4BDYA 4DFKA 4DF8A 3AA3A 1D9FA 3DLBA 1KLMA 4M3RA 3ZT0A 3IAYA 4Q0BA 1U04A 1BL3A 4CJVA 2Y1IA 5KGXA 2YNFA 4O0JA 3LANA 3NBPA 4Y1CA 4YNQA 4N5SA 4HCBA 4F3TA 2QXFA 5HRNA 4DSIA 1WSJA 4KHYA 3VQ7A 3K5LA 3BGRA 3TAFA 1T03A 1D9DA 2IDOA 4HUEA 2E6LA 3V6DA 5C25A 3KK2A 4H4OA 1WSIA 4CGFA 3NAEA 3QEVA 3THVA 1NOYA 1KSPA 4NCGA 2O4GA 3TARA 1VSMA 3NF8A 4CHNA 5CYQA 4DTSA 2OZMA 5KRTA 3OS2A 1RT3A 3CYMA 3O4NA 3ZSOA 4DU4A 2Y1JA 2KZZA 2X74A 3C95A 4EP5A 3PO4A 1KVAA 4CJPA 3DLHA 4BE2A 3HPGA 4O5BA 5DMRA 4FCYA 2DFHA 4DSFA 3HSTB 4DTXA 4HUFA 4AHVA 3V9WA 1NJWA 1YT3A 1LAWA 3PUFA 4GMJB 4DTUA 3AA5X 1VSLA 4IKFA 2FBVA 4HVJA 3HYFA 3WNGA 2RKIA 2D5RA 1GOBA 2YNGA 3NCIA 4DTMA 4DTNA 4FK2A 3RRHA 3QEIA 1TKZA 1F21A 1IG9A 3D0PA 2XY6A 4LSLA 4M3TA 1JLQA 3ASMA 4CF0A 5KTQA 4CEDA 5KI6A 3LPTA 2DFFA 1RTIA 4H4MA 3VQDA 4KPYA 2E4LA 3HM9A 2GBZA 3C6TA 3RMBA 1EETA 4FW2A 1J9AA 1TGOA 4RW9A 3I8DA 3S3NA 1NK0A 3LP2A 4CECA 4PA1A 1RTJA 4CJTA 4DTJA 4CHQA 3T3FA 3KLIA 1ZYQA 4FVMA 4FM0A 3U3YA 3RRGA 3F9KA 4WE1A 3VQ5A 3F73A 1VSKA 1KRPA 3QEPA 1RNHA 1W9HA 4KV8A 1ASWA 3WNFA 3ZCMA 2R7YA 4KB0A 3QINA 3MXIA 3P83D 4FYDA 3QERA 2DFEA 3NF9A 3U3GA 3G0ZA 4CEZA 4L8RB 4CJFA 4Z4HA 4FLZA 1I3AA 4J2DA 3LWLA 4PWDA 3VN5A 4B8CA 3V9UA 4H8KA 3SV3A 1JLFA 2HB5A 3VQ8A 3QIPA 1BQMA 3SPZA 1VSJA 4AHSA 1NK5A 2IGIA 4B08A 1Q8IA 4CERA 2BDPA 3B6PA 3L2RA 3L3UA 1NKEA 2XY7A 1ZBIA 4C8LA 3V9ZA 3E01A 4NCAA 3SQ0A 4FJGA 3DM2A 1BI4B 4ZTFA 3AVCA 4CEEA 1B92A 3G10A 1TK0A 2G8IA 3OS1A 4BE1A 1LV5A 4R5PA 3CFRA 2OPQA 4O55A 3NDKA 2X6SA 4J2BA 3DOKA 4DF4A 4I9LA 1RT2A 3LP0A 3S3OA 4NCBA 1VRUA 2Z1GA 3K5NA 4CEQA 1RBTA 4E7LA 1IKVA 3MAQA 1EKEA 2W42A 4J2AA 3OYAA 1L3SA 3OYDA 2PYJA 2RN2A 3ISNC 4DS5A 1L5UA 3K58A 3M8PA 4FJIA 3OVNA 3K5OA 4CK1A 4C8MA 4KI6A 1RT1A 1U49A 4DS4A 4FJXA 1TV6A 4IG0A 3V1QA 2YKNA 5HP1A 3QNNA 4IDKA 4KREA 4JS4A 1NK7A 4CJ3A 4CGHA 4AHRA 1G15A 3SNNA 4FW1A 1T7PA 3AVKA 1QS4A 3AO4A 2DTUA 4CJRA 3D45A 4O4GA 3L2QA 3K59A 3TAGA 4QOZB 4DU1A 3P1GA 4YFUA 1SUQA 4W5RA 4IG3A 1X9MA 2HHXA 1IKXA 4B9UA 1O1WA 2F8TA 3ZT2A 1C0TA 1LW2A 3LAMA 2HHVA 1VSFA 3KLGA 4FK4A 1B9DA 4BDPA 1HNVA 4LD0A 1A5VA 4OKJA 3LP1A 3V1OA 4B9MA 1EP4A 1WLJA 1ZBUA 3JSMA 2P51A 1UA0A 1ZBFA 3RTVA 3SUPA 1FK9A 4DQSA 4B9VA 1C6VA 1CXUA 1RT7A 4HUGA 4KI4A 3HJFA 4Z4CA 2AJQA 4FJNA 3LALA 3QO9A 4ID5A 4CESA 1KVCA 5FRNA 1IO2A 2B5JA 4ICLA 5HBMA 4CGJA 3LPUA 1U48A 3KD5E 4K8XA 3JYTA 4OLAA 1U45A 4FJMA 5D3GA 4Y1DA 1LW0A 3AVHA 2OPRA 2OA8A 1N5YA 4ZTJA 1S9GA 2OYQA 3WNEA 4DSLA 4MFBA 1S1XA 5DK5A 1ASUA 3NF7A 4CJEA 1KFSA 3V1RA 2QK9A 2KTQA 4FM1A 3DLGA 4CF2A 2RPIA 1IKWA 4I2QA 3VQEA 3SUOA 1HQUA 5C42A 1BCOA 4JLHA 4E89A 3HPHA 4CE9A 5J2QA 5JS1A 3OJSA 4E3SA 4CHPA 3KD1E 3NE6A 4CK3A 2IS3A 3IG1A 4M3XA 3O3HA 3LAKA 1YTUA 3VA3A 3SJJA 1RBUA 1S1TA 2YHBA 2HW3A 5KRSA 3ALYA 1SL1A 3TABA 2F8SA 3AO3A 1SKWA 1UA1A 3B6OA 1C1BA 1XHZA 4FZYA 3ZSVA 3MXMA 1VSHA 4DSKA 4DQQA 1BQNA 2PY5A 1GOCA 3LWMA 2QKKA 4Z4FA 3ZSXA 3CM6A 1RT4A 3V81A 3SPYA 2F96A 1UAXA 3NH1A 3QNOA 4B9SA 4KHQA 3OYHA 3TANA 1U4BA 1U47A 4AHCA 1HYZA 2YHAA 5J2NA 4FXDA 1JLAA 4KKOA 5J1EA 3K2PA 1QSLA 2O4IA 4FJ5A 3OJUA 3DMJA 2XHBA 2KZMA 3OYNA 3HO1A 1HQEA 2B4JA 2ETJA 4CFDA 1WAJA 3RR8A 2ZD1A 4DWIA 4DFJA 4DSJA 3AVGA 3OYIA 3HP9A 4E1NA 5SWMA 3QETA 1CZBA 4LH4A 2HHWA 3LZIA 4I7FA 3H08A 4CK2A 2RF2A 4FZXC 3CQ8A 1L3VA 1RTHA 2KQ2A 3EY1A 1VSIA 1X9WA 4E7JA 2IOCA 4M3UA 4CIEA 5FRMA 2Z1HA 1J53A 3ZSZA 4JRQA 3V9XA 1SL0A 4FLYA 2XY5A 4NYNA 4CGIA 3L2UA 1S1UA 1WAFA 3VQAA 3PX0A 1KLNA 4Z4EA 3IRXA 2YNHA 3CFOA 5KGWA 2YKMA 2HHSA 3ZT3A 1IKYA 5HROA 4F4KA 1CZ9A 4FLTA 3OYFA 3MECA 3AO5A 1S6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLE A;  1TVR A;  3HVT A;  3OYM A;  3SUN A;  1NKB A;  4MQ3 A;  1J5O A;  1DLO A;  1A5W A;  4W5N A;  1FXX A;  4RG8 A;  3AVF A;  3VQC A;  4LSN A;  1HRH A;  1MU2 A;  4CFC A;  1RIL A;  4CJ5 A;  1KVB A;  4E1M A;  1SKR A;  3DRP A;  3QIO A;  1BCM A;  3O3G A;  2PYL A;  4W5O A;  1T05 A;  1BHL A;  2JLE A;  1B9F A;  4DQR A;  1R0A A;  3SQ2 A;  3NH2 A;  1LWC A;  4RW6 A;  1X9S A;  3PX6 A;  3SCX A;  3S9H A;  1ZBH A;  3K5M A;  1JL2 A;  5HRP A;  1NK4 A;  4PQU A;  1RBS A;  2P1J A;  1WN7 A;  5K14 A;  3TAM A;  4TSX A;  2OZS A;  1HMV A;  1RBV A;  5FRO A;  1CXQ A;  4CJQ A;  2BGG A;  2XO7 A;  1RT6 A;  1QSY A;  4LY7 A;  3MEE A;  3SQ1 A;  2HVI A;  4AHU A;  2FBY A;  1HYS A;  4DSE A;  4FJ7 A;  3M8S A;  2FC0 A;  4E0D A;  4Z4I A;  3QEX A;  2P5G A;  3HK2 A;  2OPP A;  4CHZ A;  3S3M A;  3NGY A;  2X6N A;  4DFP A;  4BWM A;  4DU3 A;  4KFB A;  3VQ9 A;  4FJJ A;  3OYK A;  3L2V A;  3L3V A;  2VG6 A;  1QTM A;  2VG5 A;  4C8N A;  4W5T A;  1NJX A;  4FJH A;  1TKX A;  4CEB A;  3L8B A;  4F3O A;  3SUQ A;  4BDZ A;  3ZSY A;  3KIO A;  3T19 A;  4FK0 A;  4HCC A;  3V4I A;  3NH0 A;  3TAP A;  3I0S A;  3OS0 A;  1WSH A;  2WON A;  4CEO A;  1NOZ A;  1HPZ A;  4OKE A;  3ZSQ A;  3HP6 A;  3KK1 A;  3RMC A;  1NKC A;  3BDP A;  4M3Y A;  1JLE A;  1LAV A;  4Q5V A;  4M3W A;  4CFB A;  4KRF A;  1TKT A;  1JKH A;  2A1S A;  2HNZ A;  3DYA A;  4IFY A;  4CF9 A;  5I42 A;  4N56 A;  4DMN A;  3M8Q A;  2PZS A;  4CHO A;  3IS9 A;  1RDB A;  5CYM A;  3ZSR A;  4CJL A;  1Z26 A;  1NJZ A;  2B6A A;  2HMI A;  5CZ1 A;  4KTZ A;  1X1P A;  3NFA A;  1ASV A;  3ZT4 A;  2DY4 A;  4AHT A;  4KHW A;  3AVN A;  1JLC A;  1JXB A;  4CJK A;  1FKO A;  4FJK A;  4KAZ A;  2KFZ A;  4CJU A;  2HNY A;  3AO1 A;  4K8Z A;  3AV9 A;  3QLH A;  1JXE A;  2GV9 A;  4F2S A;  4FJL A;  3CG7 A;  1S1W A;  2G8K A;  4RW7 A;  4KHN A;  4DQP A;  2HVH A;  1RT5 A;  1WSF A;  1I39 A;  4PUO A;  2EHG A;  3O4Q A;  3DOL A;  3MXJ A;  2VWJ A;  4BE0 A;  3VQP A;  2HND A;  3TAE A;  4CCH A;  2QKB A;  1BIZ A;  1RDC A;  4BWJ A;  2KW4 A;  2I5J A;  4M45 A;  4FM2 A;  4RW8 A;  3K57 A;  1CLQ A;  3RWU A;  4CJ4 A;  1RTD A;  4BAC A;  1D5A A;  4IBN A;  3TAQ A;  4JRP A;  1SV5 A;  4DLG A;  3T1A A;  3V9S A;  1UOC A;  3OYJ A;  3AA4 A;  4OPK A;  3SQ4 A;  4DLE A;  1L3U A;  4AIL C;  1LWE A;  3PX4 A;  1N6Q A;  2OPS A;  4KHU A;  2BE2 A;  2YV0 X;  1KFD A;  3NGZ A;  4UQG A;  4B9N A;  4CF1 A;  4EP4 A;  2ZE2 A;  1TL3 A;  1JLG A;  1WSE A;  1QSS A;  5T7B A;  2G8F A;  4M3Z A;  4ELV A;  4I2P A;  3SYZ A;  2VG7 A;  4G1Q A;  1XWL A;  4LH5 A;  4CF8 A;  1WNS A;  3KLF A;  5HRR A;  5I3U A;  4B3O A;  4KO0 A;  3RMD A;  3QEW A;  1BI4 A;  2E6M A;  5FDL A;  3NGI A;  4N41 A;  3UIQ A;  4F8R A;  3NHG A;  5SZT A;  1Q9Y A;  1RDA A;  3VQB A;  1GOA A;  2A1R A;  1BIU A;  3AVB A;  2G8U A;  1YTA A;  4OVL A;  2G8H A;  1T8E A;  5HLF A;  4E7I A;  1KCF A;  3AVM A;  1NK9 A;  2WOM A;  1ITG A;  3LP3 A;  4OGC A;  4KHS A;  1TAQ A;  2HHQ A;  3AVL A;  1RCH A;  3SI6 A;  4B9L A;  3KJV A;  4CJS A;  3FFI A;  5CZ2 A;  3DRR A;  3OYE A;  4EZ6 A;  3RMA A;  3ULD A;  2D0B A;  4J2E A;  1W0H A;  1HNI A;  1C0M A;  4KB1 A;  3VQQ A;  4IFV A;  4KTQ A;  1QQC A;  1EXQ A;  4FLW A;  3QES A;  1UWB A;  4ELT A;  1KTQ A;  4DG1 A;  3AVA A;  3WNH A;  4OKK A;  3KK3 A;  1NK8 A;  4DTO A;  1NK6 A;  1VSD A;  5C24 A;  4OGE A;  3OYB A;  4GVM A;  2GUI A;  1C0U A;  3KLE A;  4EZ9 A;  1HYV A;  3HPO A;  1VRT A;  3HT3 A;  3TI0 A;  4ZHR A;  1BGX T;  3MED A;  1S6P A;  1Q9X A;  1EX4 A;  3ZSW A;  4CJW A;  3O3F A;  2ZQB A;  4B8A B;  4DTR A;  2G8V A;  4B9T A;  4FLU A;  4C8O A;  3C6U A;  3OY9 A;  1HJR A;  2LSN A;  3I0R A;  3VQ6 A;  1IH7 A;  2JGU A;  3HL8 A;  2Z1J A;  1BIS A;  4RW4 A;  3OYC A;  1A5X A;  1C1C A;  2Q3S A;  3VA0 A;  1YVU A;  4PY5 A;  1DTT A;  1J54 A;  1REV A;  2HHU A;  2EX3 A;  3M8R A;  2D0C A;  3VQ4 A;  4CFA A;  3EZ5 A;  2XY8 A;  4I9Q A;  4E7K A;  3ZT1 A;  1VSE A;  2G8W A;  3AVJ A;  2FBT A;  3DI6 A;  3MEG A;  5E41 A;  3PV8 A;  1XC9 A;  2ITG A;  2D0A A;  3KLH A;  4CHY A;  1QHT A;  1L3T A;  1C1A A;  1VK0 A;  1XHX A;  1FKP A;  3OYL A;  4HTU A;  1QE1 A;  1Y97 A;  1LWF A;  4DFM A;  4XIU A;  4JS5 A;  4GW6 A;  3SZ2 A;  3HXM A;  4F2R A;  2IAJ A;  1SL2 A;  5JS2 A;  4W5Q A;  3AVI A;  3L2W A;  2XRI A;  2YNI A;  3RR7 A;  1TAU A;  1DTQ A;  3C94 A;  4ID1 A;  3DLK A;  4CEA A;  2P5O A;  4C8K A;  1JL1 A;  3ITH A;  3NF6 A;  4QAG A;  5CY4 A;  1TK5 A;  4M41 A;  1TKD A;  2KFN A;  3LZJ A;  4Z0U A;  5HRS A;  4E7H A;  3SV4 A;  3A2F A;  1TK8 A;  4Z4G A;  1ZBL A;  2ATQ A;  4OLB A;  4OPJ A;  4FZZ A;  1JLB A;  1K6Y A;  1RDD A;  4DTP A;  1Z25 A;  2FBX A;  4CIG A;  4ELU A;  4FLX A;  2X78 A;  4HHT A;  3DRS A;  1NJY A;  1S9E A;  1WSG A;  3KKR A;  3P5J A;  2Z1I A;  3PY8 A;  3AA2 A;  4AH9 A;  3LDS A;  4OJR A;  4CGD A;  3HVR A;  4NYF A;  3EYZ A;  2BAN A;  1TL1 A;  5J2P A;  1XI1 A;  1SKS A;  1S5J A;  1RBR A;  3TR8 A;  4CEF A;  4CGG A;  4N76 A;  2HHT A;  4FJ8 A;  3CFP A;  3AO2 A;  3TWH A;  4E19 A;  5EU7 A;  4FLV A;  5J2M A;  2VWK A;  3U6F A;  4QCL A;  2IC3 A;  1S1V A;  3DLR A;  4O44 A;  1D8Y A;  3OYG A;  3KTQ A;  3PO5 A;  4KTW A;  4DQI A;  3KKS A;  4FJ9 A;  4N47 A;  2NUB A;  4CIF A;  4M42 A;  3CM5 A;  4O0I A;  4BDY A;  4DFK A;  4DF8 A;  3AA3 A;  1D9F A;  3DLB A;  1KLM A;  4M3R A;  3ZT0 A;  3IAY A;  4Q0B A;  1U04 A;  1BL3 A;  4CJV A;  2Y1I A;  5KGX A;  2YNF A;  4O0J A;  3LAN A;  3NBP A;  4Y1C A;  4YNQ A;  4N5S A;  4HCB A;  4F3T A;  2QXF A;  5HRN A;  4DSI A;  1WSJ A;  4KHY A;  3VQ7 A;  3K5L A;  3BGR A;  3TAF A;  1T03 A;  1D9D A;  2IDO A;  4HUE A;  2E6L A;  3V6D A;  5C25 A;  3KK2 A;  4H4O A;  1WSI A;  4CGF A;  3NAE A;  3QEV A;  3THV A;  1NOY A;  1KSP A;  4NCG A;  2O4G A;  3TAR A;  1VSM A;  3NF8 A;  4CHN A;  5CYQ A;  4DTS A;  2OZM A;  5KRT A;  3OS2 A;  1RT3 A;  3CYM A;  3O4N A;  3ZSO A;  4DU4 A;  2Y1J A;  2KZZ A;  2X74 A;  3C95 A;  4EP5 A;  3PO4 A;  1KVA A;  4CJP A;  3DLH A;  4BE2 A;  3HPG A;  4O5B A;  5DMR A;  4FCY A;  2DFH A;  4DSF A;  3HST B;  4DTX A;  4HUF A;  4AHV A;  3V9W A;  1NJW A;  1YT3 A;  1LAW A;  3PUF A;  4GMJ B;  4DTU A;  3AA5 X;  1VSL A;  4IKF A;  2FBV A;  4HVJ A;  3HYF A;  3WNG A;  2RKI A;  2D5R A;  1GOB A;  2YNG A;  3NCI A;  4DTM A;  4DTN A;  4FK2 A;  3RRH A;  3QEI A;  1TKZ A;  1F21 A;  1IG9 A;  3D0P A;  2XY6 A;  4LSL A;  4M3T A;  1JLQ A;  3ASM A;  4CF0 A;  5KTQ A;  4CED A;  5KI6 A;  3LPT A;  2DFF A;  1RTI A;  4H4M A;  3VQD A;  4KPY A;  2E4L A;  3HM9 A;  2GBZ A;  3C6T A;  3RMB A;  1EET A;  4FW2 A;  1J9A A;  1TGO A;  4RW9 A;  3I8D A;  3S3N A;  1NK0 A;  3LP2 A;  4CEC A;  4PA1 A;  1RTJ A;  4CJT A;  4DTJ A;  4CHQ A;  3T3F A;  3KLI A;  1ZYQ A;  4FVM A;  4FM0 A;  3U3Y A;  3RRG A;  3F9K A;  4WE1 A;  3VQ5 A;  3F73 A;  1VSK A;  1KRP A;  3QEP A;  1RNH A;  1W9H A;  4KV8 A;  1ASW A;  3WNF A;  3ZCM A;  2R7Y A;  4KB0 A;  3QIN A;  3MXI A;  3P83 D;  4FYD A;  3QER A;  2DFE A;  3NF9 A;  3U3G A;  3G0Z A;  4CEZ A;  4L8R B;  4CJF A;  4Z4H A;  4FLZ A;  1I3A A;  4J2D A;  3LWL A;  4PWD A;  3VN5 A;  4B8C A;  3V9U A;  4H8K A;  3SV3 A;  1JLF A;  2HB5 A;  3VQ8 A;  3QIP A;  1BQM A;  3SPZ A;  1VSJ A;  4AHS A;  1NK5 A;  2IGI A;  4B08 A;  1Q8I A;  4CER A;  2BDP A;  3B6P A;  3L2R A;  3L3U A;  1NKE A;  2XY7 A;  1ZBI A;  4C8L A;  3V9Z A;  3E01 A;  4NCA A;  3SQ0 A;  4FJG A;  3DM2 A;  1BI4 B;  4ZTF A;  3AVC A;  4CEE A;  1B92 A;  3G10 A;  1TK0 A;  2G8I A;  3OS1 A;  4BE1 A;  1LV5 A;  4R5P A;  3CFR A;  2OPQ A;  4O55 A;  3NDK A;  2X6S A;  4J2B A;  3DOK A;  4DF4 A;  4I9L A;  1RT2 A;  3LP0 A;  3S3O A;  4NCB A;  1VRU A;  2Z1G A;  3K5N A;  4CEQ A;  1RBT A;  4E7L A;  1IKV A;  3MAQ A;  1EKE A;  2W42 A;  4J2A A;  3OYA A;  1L3S A;  3OYD A;  2PYJ A;  2RN2 A;  3ISN C;  4DS5 A;  1L5U A;  3K58 A;  3M8P A;  4FJI A;  3OVN A;  3K5O A;  4CK1 A;  4C8M A;  4KI6 A;  1RT1 A;  1U49 A;  4DS4 A;  4FJX A;  1TV6 A;  4IG0 A;  3V1Q A;  2YKN A;  5HP1 A;  3QNN A;  4IDK A;  4KRE A;  4JS4 A;  1NK7 A;  4CJ3 A;  4CGH A;  4AHR A;  1G15 A;  3SNN A;  4FW1 A;  1T7P A;  3AVK A;  1QS4 A;  3AO4 A;  2DTU A;  4CJR A;  3D45 A;  4O4G A;  3L2Q A;  3K59 A;  3TAG A;  4QOZ B;  4DU1 A;  3P1G A;  4YFU A;  1SUQ A;  4W5R A;  4IG3 A;  1X9M A;  2HHX A;  1IKX A;  4B9U A;  1O1W A;  2F8T A;  3ZT2 A;  1C0T A;  1LW2 A;  3LAM A;  2HHV A;  1VSF A;  3KLG A;  4FK4 A;  1B9D A;  4BDP A;  1HNV A;  4LD0 A;  1A5V A;  4OKJ A;  3LP1 A;  3V1O A;  4B9M A;  1EP4 A;  1WLJ A;  1ZBU A;  3JSM A;  2P51 A;  1UA0 A;  1ZBF A;  3RTV A;  3SUP A;  1FK9 A;  4DQS A;  4B9V A;  1C6V A;  1CXU A;  1RT7 A;  4HUG A;  4KI4 A;  3HJF A;  4Z4C A;  2AJQ A;  4FJN A;  3LAL A;  3QO9 A;  4ID5 A;  4CES A;  1KVC A;  5FRN A;  1IO2 A;  2B5J A;  4ICL A;  5HBM A;  4CGJ A;  3LPU A;  1U48 A;  3KD5 E;  4K8X A;  3JYT A;  4OLA A;  1U45 A;  4FJM A;  5D3G A;  4Y1D A;  1LW0 A;  3AVH A;  2OPR A;  2OA8 A;  1N5Y A;  4ZTJ A;  1S9G A;  2OYQ A;  3WNE A;  4DSL A;  4MFB A;  1S1X A;  5DK5 A;  1ASU A;  3NF7 A;  4CJE A;  1KFS A;  3V1R A;  2QK9 A;  2KTQ A;  4FM1 A;  3DLG A;  4CF2 A;  2RPI A;  1IKW A;  4I2Q A;  3VQE A;  3SUO A;  1HQU A;  5C42 A;  1BCO A;  4JLH A;  4E89 A;  3HPH A;  4CE9 A;  5J2Q A;  5JS1 A;  3OJS A;  4E3S A;  4CHP A;  3KD1 E;  3NE6 A;  4CK3 A;  2IS3 A;  3IG1 A;  4M3X A;  3O3H A;  3LAK A;  1YTU A;  3VA3 A;  3SJJ A;  1RBU A;  1S1T A;  2YHB A;  2HW3 A;  5KRS A;  3ALY A;  1SL1 A;  3TAB A;  2F8S A;  3AO3 A;  1SKW A;  1UA1 A;  3B6O A;  1C1B A;  1XHZ A;  4FZY A;  3ZSV A;  3MXM A;  1VSH A;  4DSK A;  4DQQ A;  1BQN A;  2PY5 A;  1GOC A;  3LWM A;  2QKK A;  4Z4F A;  3ZSX A;  3CM6 A;  1RT4 A;  3V81 A;  3SPY A;  2F96 A;  1UAX A;  3NH1 A;  3QNO A;  4B9S A;  4KHQ A;  3OYH A;  3TAN A;  1U4B A;  1U47 A;  4AHC A;  1HYZ A;  2YHA A;  5J2N A;  4FXD A;  1JLA A;  4KKO A;  5J1E A;  3K2P A;  1QSL A;  2O4I A;  4FJ5 A;  3OJU A;  3DMJ A;  2XHB A;  2KZM A;  3OYN A;  3HO1 A;  1HQE A;  2B4J A;  2ETJ A;  4CFD A;  1WAJ A;  3RR8 A;  2ZD1 A;  4DWI A;  4DFJ A;  4DSJ A;  3AVG A;  3OYI A;  3HP9 A;  4E1N A;  5SWM A;  3QET A;  1CZB A;  4LH4 A;  2HHW A;  3LZI A;  4I7F A;  3H08 A;  4CK2 A;  2RF2 A;  4FZX C;  3CQ8 A;  1L3V A;  1RTH A;  2KQ2 A;  3EY1 A;  1VSI A;  1X9W A;  4E7J A;  2IOC A;  4M3U A;  4CIE A;  5FRM A;  2Z1H A;  1J53 A;  3ZSZ A;  4JRQ A;  3V9X A;  1SL0 A;  4FLY A;  2XY5 A;  4NYN A;  4CGI A;  3L2U A;  1S1U A;  1WAF A;  3VQA A;  3PX0 A;  1KLN A;  4Z4E A;  3IRX A;  2YNH A;  3CFO A;  5KGW A;  2YKM A;  2HHS A;  3ZT3 A;  1IKY A;  5HRO A;  4F4K A;  1CZ9 A;  4FLT A;  3OYF A;  3MEC A;  3AO5 A;  1S6Q A; 
#chains in the Genus database with same CATH topology
 1NKB A;  1DLO A;  1BDG A;  1ZC6 A;  4LSN A;  3VQC A;  4E1M A;  4DR6 K;  3JAM O;  2P9S B;  4W5O A;  4CBW A;  1B9F A;  1JL2 A;  4H5W A;  4OPH A;  5HRP A;  1WN7 A;  4EHU A;  3EE9 A;  5K14 A;  3LDN A;  3O9R A;  4YDU A;  2FSK A;  4C23 A;  3MEE A;  3HM8 A;  1DEJ A;  3DJC A;  4E0D A;  3JXU A;  3S3M A;  4DFP A;  3OYK A;  5BR9 A;  4C8N A;  1NJX A;  4DV4 K;  4DUY K;  3V4I A;  3L4I A;  3I0S A;  2QWL A;  2WON A;  3AAR A;  4CEO A;  3BDP A;  1LAV A;  3BF1 A;  4Q5V A;  4JN4 A;  1TKT A;  4IFY A;  3DYA A;  4WFN L;  4DMN A;  4BRN A;  1VQ4 N;  3CXC M;  3BUZ B;  4JNE A;  3Q7C A;  1C0F A;  1RDB A;  5CYM A;  5H1S Q;  2HOE A;  4LFA K;  4KTZ A;  5CHI A;  4BC3 A;  3SJH A;  3R6M A;  1JLC A;  2KFZ A;  2W6K A;  5LMU K;  3AO1 A;  4K8Z A;  3AV9 A;  4FJL A;  2Q0R A;  1S1W A;  4DQP A;  1GLL O;  5KPR A;  4PUO A;  4B1Z A;  3O4Q A;  3DOL A;  4BE0 A;  4CCH A;  2QKB A;  3VQP A;  4BVO A;  4RW8 A;  4CJ4 A;  3SAG A;  4BAC A;  4IBN A;  4JRP A;  1SV5 A;  4DLG A;  2YJE A;  3V9S A;  3CI5 A;  1UOC A;  3SBT A;  4DLE A;  3PX4 A;  1LWE A;  4KHU A;  2OPS A;  2YV0 X;  3VEX A;  3VEY A;  4UQG A;  2A42 A;  1V4T A;  2ZE2 A;  1JLG A;  1WSE A;  3TU5 A;  4ELV A;  3SYZ A;  2GUP A;  2VG7 A;  1XWL A;  3FZH A;  5I3U A;  1TUY A;  1BI4 A;  3NHG A;  5SZT A;  1HNW K;  3VQB A;  2A1R A;  2QW9 A;  1ESV A;  1W97 L;  4C1N K;  1YTA A;  4E7I A;  3AVL A;  3GE1 A;  4CJS A;  3DLL L;  3DRR A;  2D0B A;  1C0M A;  3VQQ A;  3MK6 A;  5FPM A;  3R1X A;  3H1Q A;  3ZLJ A;  2RHK A;  1NK8 A;  3C0B A;  4OGE A;  4GVM A;  1HYV A;  5EY4 A;  3TI0 A;  1VRT A;  1EX4 A;  3ZSW A;  4CJW A;  4B8A B;  4A61 A;  4FLU A;  2NRV A;  3CD6 N;  3OY9 A;  2LSN A;  1IH7 A;  3HL8 A;  4PKI A;  1XC3 A;  2VGN A;  2HST A;  2Q3S A;  2HHU A;  3M8R A;  3VQ4 A;  2XY8 A;  4NO7 A;  4KHP K;  4JKG B;  2FBT A;  1YVN A;  1XC9 A;  4EIA A;  4XH1 A;  1FKP A;  1D4X A;  3K9J A;  4B1U B;  3L2W A;  2YNI A;  3VTI A;  4C8K A;  3HOT A;  3E9P A;  3VOV A;  1NJI O;  2KFN A;  4Z4G A;  3C6H A;  1NG9 A;  5AFU H;  3O5B A;  1Z25 A;  4A2A A;  4CD3 A;  4FLX A;  2ASP A;  5C10 A;  3DRS A;  1NJY A;  1S9E A;  3KKR A;  3P5J A;  4A62 A;  3LDS A;  3E9O A;  1G99 A;  3VEV A;  1GLJ O;  4EHT A;  5BPL A;  3EYZ A;  1WBB A;  2KLA A;  5J2P A;  1S22 A;  4XEI A;  1RBR A;  3TR8 A;  3VMF B;  4N76 A;  4WQ4 C;  3CFP A;  5F2R A;  5EU7 A;  3KWG A;  4PKG A;  1D8Y A;  3OYG A;  4FJ9 A;  4KTW A;  4DQI A;  3IFR A;  4CIF A;  3L6Q A;  3WXL A;  3U9D A;  2IVP A;  3OTO K;  4Q0B A;  4F9O A;  5EVZ A;  1VQ7 N;  2YNF A;  4O0J A;  3LAN A;  3NBP A;  3U8X A;  1WSJ A;  4KH4 A;  4KHY A;  3K5L A;  3BGR A;  1D9D A;  3KK2 A;  4H4O A;  2D0P A;  1WSI A;  4FWK A;  4U7B A;  4WF9 L;  3LM2 A;  1VQ5 N;  2E1Z A;  4DTS A;  2KZZ A;  4IZ9 A;  3C95 A;  3PO4 A;  3HPG A;  5DMR A;  2D4W A;  1BU6 O;  4DSF A;  4DTX A;  4HUF A;  4AHV A;  3PUF A;  1VSL A;  3J81 O;  4BRC A;  3HYF A;  3WNG A;  1GOB A;  3NCI A;  3C7N B;  5AQJ A;  4FK2 A;  1TKZ A;  1F21 A;  5AQQ A;  4LSL A;  1LOT B;  3OW2 M;  2DFF A;  1RTI A;  2VQF K;  1EET A;  4FW2 A;  4JEP A;  3O4W A;  5BRE A;  1V4S A;  2FLO A;  4JKG A;  5E84 A;  4BQZ A;  3S3N A;  4PA1 A;  2O8D B;  4FM0 A;  3U3Y A;  4BRL A;  3F73 A;  1X3M A;  1N36 K;  5AZJ B;  4KV8 A;  3ZCM A;  2HBL A;  3K0S A;  4FYD A;  3A5M C;  3G0Z A;  2VGM A;  4FLZ A;  3CJ9 A;  4PWD A;  5DM6 L;  1EQY A;  5IT9 O;  4AHS A;  5KPT A;  3E1Y A;  3L2R A;  3CQY A;  4FJG A;  3DM2 A;  3FLC O;  5JIC A;  3GDQ A;  2HMP A;  1BOT O;  4DHY A;  3FZL A;  3ATV A;  4K42 A;  3NDK A;  1X3N A;  3U9Z A;  3LP0 A;  3K5N A;  5BRD A;  1SS6 A;  1RBT A;  1IKV A;  4LF5 K;  4J2A A;  1L3S A;  3OYD A;  2PYJ A;  3ISN C;  4DS5 A;  4H0O A;  2ZJR L;  3K58 A;  4XH4 A;  3HSC A;  3ZX2 A;  4FJI A;  3OVN A;  3ZET B;  3VEZ A;  5CR4 A;  1S3X A;  4H03 B;  2ZGZ A;  5C0Y A;  4BR7 A;  3QNN A;  3DXK A;  1MWK A;  3VTH A;  3R8E A;  3SNN A;  1T7P A;  3WXM B;  3H6E A;  1GLD G;  3I8B A;  4LF6 K;  3K59 A;  2HBJ A;  3EE8 A;  4FWN A;  3CHW A;  4IG3 A;  2HHX A;  4B9U A;  3PIP L;  2F8T A;  3GG4 A;  2OCE A;  4A57 A;  2WBN A;  4CZE A;  1A5V A;  5M1N A;  4M7Y A;  4WQ5 A;  1C6V A;  3HJF A;  2AJQ A;  3CCJ N;  1KVC A;  4BQL A;  5HBM A;  4CGJ A;  1U48 A;  3KD5 E;  4K8X A;  1C0G A;  4B3M K;  1M1K O;  4DSL A;  5ADX H;  1N5Y A;  3GL1 A;  1KFS A;  1VQL N;  3MN5 A;  2QK9 A;  1KAY A;  3N4P A;  5EOY A;  1NWK A;  5AQP A;  4O5F A;  1HQU A;  5C42 A;  1BCO A;  2VCP A;  4E89 A;  3HPH A;  3ZEU B;  5J2Q A;  1VQN N;  5AZJ A;  3NE6 A;  3CCS N;  2F7T A;  2DPN A;  3LAK A;  1GLA G;  5LY3 A;  3VER A;  2A6A A;  1RGI A;  3TAB A;  4ISF A;  2V51 B;  2O8E B;  1C1B A;  4A59 A;  5BRF A;  4DQQ A;  4G9Z A;  2QKK A;  3ZSX A;  1IBL K;  1RT4 A;  4B9S A;  1UAX A;  3NH1 A;  2NRT A;  3TAN A;  1U4B A;  4AHC A;  4BGA A;  3I55 N;  1JLA A;  1QSL A;  2KZM A;  3DMJ A;  2P9L A;  2B4J A;  2ETJ A;  1WAJ A;  3P31 A;  3O9T A;  4DSJ A;  4YDU C;  3HP9 A;  3UKU A;  4E1N A;  3QET A;  1SQK A;  2HHW A;  1H1V A;  3H08 A;  3VEO A;  4FZX C;  1OH5 A;  3CQ8 A;  1L3V A;  1VSI A;  3CPE A;  2IOC A;  4M3U A;  3ZET A;  1SL0 A;  4FLY A;  1NGG A;  4NYN A;  4UY8 O;  2IVO A;  3IRX A;  4AF1 A;  2YKM A;  4DV5 K;  1IKY A;  4F4K A;  5MLC Q;  3MWT A;  2ASO A;  3DAW A;  3OYF A;  2BTF A;  2ZF5 O;  5BPM A;  1TVR A;  3OYM A;  3SUN A;  1J5O A;  1DGK N;  4RG8 A;  1YIJ N;  4CJ5 A;  1KVB A;  4BGB A;  1NMN A;  3UE5 A;  1BCM A;  3O3G A;  1BHL A;  2JLE A;  2NRR A;  3QB0 A;  4DQR A;  3SQ2 A;  3PX6 A;  1NK4 A;  1RBS A;  1YI2 N;  4AQY K;  2EWS A;  4TSX A;  2OZS A;  4JK9 A;  1HMV A;  5FRO A;  2XO7 A;  1QSY A;  3SQ1 A;  4AHU A;  2FBY A;  1HYS A;  4DSE A;  4MO4 A;  4Z4I A;  2OPP A;  4CHZ A;  4KFB A;  3VQ9 A;  4FJJ A;  2AP1 A;  3F2K A;  5AFU A;  2VG5 A;  1KC8 O;  3L8B A;  4LFB K;  2A41 A;  3ZSY A;  4FK0 A;  1WSH A;  2F8S A;  4M3Y A;  1P90 A;  3HP6 A;  1NKC A;  1XMO K;  5AR0 A;  3ZEU A;  4H5T A;  5AZI B;  2A1S A;  3FGU A;  4JHD B;  5I42 A;  4N56 A;  2PZS A;  3ZSR A;  2HMI A;  5CZ1 A;  2O8E A;  2DY4 A;  1FKO A;  4BY9 C;  3CG7 A;  5AQU A;  5EX5 A;  4WCE L;  2YHY A;  2G8K A;  2HVH A;  1RT5 A;  1K73 O;  1E4G T;  2GWJ A;  3MXJ A;  3K9K A;  2VWJ A;  1KAZ A;  4CZG A;  4HTL A;  3QBW A;  1MA9 B;  3K57 A;  1WUA A;  1CLQ A;  3VET A;  2ASM A;  3HZ6 A;  1NU0 A;  3T1A A;  4AIL C;  1N6Q A;  1KFD A;  4X66 K;  4DR1 K;  4EP4 A;  1TL3 A;  4FWM A;  1IV0 A;  5T7B A;  1QZ5 A;  2YHW A;  4FL9 A;  4CZH A;  3MX5 A;  3KLF A;  4B3O A;  4KO0 A;  5CE3 A;  3BF3 A;  3P4I A;  4IFE A;  4IOA L;  5LJV A;  4N41 A;  3NGI A;  1J5E K;  2UUC K;  3UIQ A;  1Q9Y A;  1RDA A;  4DV1 K;  1XUP O;  1BIU A;  2GWK A;  2G8U A;  1ILY A;  5AQK A;  3O1B A;  2G8H A;  1KCF A;  3AVM A;  2WOM A;  4LC9 B;  4B9L A;  3RMA A;  4JD2 B;  3ULD A;  3TPQ A;  3FZM A;  4KB1 A;  4PHT X;  1VAZ A;  2H3G X;  4FLW A;  5KPZ A;  1KTQ A;  1W7A A;  2OTJ N;  5AQH A;  5C24 A;  2JWL A;  5B8H A;  2AA4 A;  3ZX0 A;  3MED A;  4ZHR A;  1S6P A;  4DB3 A;  4IWV A;  3H46 O;  1YHQ N;  4YOR A;  2JGU A;  4JHD A;  3OYC A;  4XH5 A;  4H0X B;  3VA0 A;  1YVU A;  3N4Q A;  1DTT A;  4H0P A;  2D0C A;  5F0X A;  4I9Q A;  5LL6 Z;  4CW7 B;  4E7K A;  3ZT1 A;  4EAH D;  2G8W A;  4A5B A;  3TSQ A;  3PV8 A;  2Q31 A;  3CJ7 A;  3KLH A;  4CI6 A;  1QHT A;  1L3T A;  1C1A A;  1VK0 A;  4HTU A;  3O8M A;  2BH1 A;  3SZ2 A;  2IAJ A;  3AVI A;  1CZA N;  4BRK A;  3CJC A;  1TAU A;  2ITM A;  4ID1 A;  4CEA A;  2P5O A;  4BRQ A;  3VEW A;  1SZ2 A;  1TKD A;  4Z0U A;  5A2Q O;  3SV4 A;  3A2F A;  4BR9 A;  2ATQ A;  5GIO A;  4FZZ A;  3SMP A;  4DV6 K;  1K6Y A;  4DTP A;  4HHT A;  4JKC A;  4JKF A;  3NVK A;  4CJ7 A;  3PSF A;  1K8K B;  1IJJ A;  3ENO A;  4CGD A;  3WUH A;  5AQG A;  1TL1 A;  3M5R A;  1ATR A;  1S5J A;  4CGG A;  3AO2 A;  4E19 A;  4FLV A;  4FSV A;  4FWL A;  3DLR A;  4O44 A;  3PO5 A;  4BRP A;  3KKS A;  4M42 A;  5ADX A;  3CM5 A;  4DFK A;  4DF8 A;  3IAY A;  4IEE A;  5M1Q A;  1EO1 A;  2Y1I A;  4Y1C A;  3MMV A;  2QXF A;  3QFP A;  3TAF A;  3V6D A;  3VES A;  5C25 A;  4IOX A;  3QEV A;  1NOY A;  1KSP A;  3CER A;  4KBO A;  3GOI A;  5CYQ A;  2OZM A;  3WT0 A;  3ZSO A;  2E5L K;  3ULE B;  2O8B B;  2HBM A;  5AQO A;  3V9W A;  1YT3 A;  3AA5 X;  4IKF A;  2FBV A;  3A8Y A;  4GKJ K;  3AY9 A;  2VWB A;  3LL3 A;  4YOX A;  4DTM A;  3QBX A;  3QEI A;  2UU9 K;  4YOU A;  2XY6 A;  2A3Z A;  2P9S A;  3P38 A;  3ASM A;  4WFA L;  3BY5 A;  4DR5 K;  3FZF A;  5KI6 A;  4BRH A;  2E4L A;  3HM9 A;  2GBZ A;  3C6T A;  1J9A A;  5AQN A;  2FF6 A;  3CC7 N;  1NK0 A;  4CEC A;  5AJ3 K;  5ELZ A;  4CHQ A;  4BRF A;  1K8A O;  2VQE K;  2Q0U A;  2FF3 B;  4FVM A;  4A5A A;  1ZYQ A;  3RRG A;  1GLC G;  1VSK A;  2WFB A;  5FPD A;  2BUP A;  2O8F B;  1RNH A;  2E1Y A;  4KB0 A;  4NLB A;  2NNW A;  3NF9 A;  3U3G A;  4Z4H A;  1I3A A;  3E9L A;  3V9U A;  2UUA K;  1VSJ A;  4CER A;  3B6P A;  3B8A X;  4B3S K;  3L3U A;  3VPZ A;  4C8L A;  2YCH A;  3E01 A;  3SQ0 A;  1U2V B;  1B92 A;  1HKC A;  3QDK A;  1TK0 A;  4BG8 A;  4R5P A;  2OPQ A;  2X6S A;  4OO1 J;  4J2B A;  4DF4 A;  1JCF A;  2QWM A;  1VRU A;  3J7A P;  1N33 K;  2ZJP L;  1L5U A;  1YF5 L;  5AQW A;  3KK7 A;  5BN8 A;  2HF3 A;  4FOE A;  4C8M A;  4AM6 A;  4B3T K;  4RWT A;  2F9W A;  4BC4 A;  4FJX A;  3CC4 N;  2W41 A;  3V1Q A;  5JLF A;  5EXW A;  5HP1 A;  2P9U B;  4KRE A;  4BG9 A;  3ATU A;  2FXU A;  3D7E O;  4CGH A;  4AHR A;  1G15 A;  1Q18 A;  1QS4 A;  2QEX N;  2DTU A;  1S72 N;  3L2Q A;  3TAG A;  4QOZ B;  2O8B A;  4YFU A;  4ILH A;  4GKK K;  3LAM A;  1B9D A;  4BDP A;  4BRO A;  3V1O A;  1EP4 A;  1EWQ A;  3MCP A;  3JSM A;  2P51 A;  1ZBF A;  3SUP A;  4DQS A;  1T6D A;  1CXU A;  3ZYY X;  4PKH A;  5FRN A;  1IO2 A;  1VQP N;  4X65 K;  4Y1D A;  4ZTJ A;  2OYQ A;  4CJE A;  2KTQ A;  4CF2 A;  3QIC A;  4JKE A;  2O8F A;  2IS3 A;  3IG1 A;  1VQ9 N;  3O3H A;  5C12 A;  4CZL A;  2HW3 A;  2HF4 A;  2V7Y A;  3SLC A;  3MXM A;  1VSH A;  4DSK A;  1BQN A;  3VGK A;  1GOC A;  2NZT A;  3LWM A;  4Z4F A;  3V81 A;  3SPY A;  4KHQ A;  4CZI A;  1WB9 A;  1HYZ A;  4FXD A;  1U2V A;  5AQZ A;  2O8C B;  4FJ5 A;  3OJU A;  2XHB A;  4CFD A;  4DFJ A;  4CD1 A;  1DT9 A;  3AVG A;  3TSP A;  1CZB A;  3THY B;  4CK2 A;  2RF2 A;  4HWI A;  4B1V A;  2KQ2 A;  5AQS A;  3UB5 A;  1X9W A;  4KH5 A;  4CIE A;  3HOS A;  2Z1H A;  3ZSZ A;  1NGB A;  3PX0 A;  3VQA A;  3EL2 A;  1KLN A;  3CFO A;  5KGW A;  1Q7Y O;  1GLE G;  2HHS A;  1NGI A;  3ZT3 A;  2ZWH A;  2P9U A;  4FLT A;  4MO5 A;  3FE1 A;  3L0Q A;  4FWP A;  1S6Q A;  2WTU A;  1ATN A;  1P8Z A;  1RDU A;  4W5N A;  3CCL N;  1XNR K;  4IJN A;  1RIL A;  1HKG A;  3DXM B;  3DRP A;  3QIO A;  4NLC A;  4DV0 K;  3KWI A;  4BRM A;  3O9U A;  4IXC A;  1T05 A;  3NH2 A;  4RW6 A;  3T7Z A;  3S9H A;  1ZBH A;  1IBM K;  4U67 L;  3CJ1 A;  4FWR A;  4PQU A;  2P1J A;  3A5O C;  4JI3 K;  3TAM A;  2QA4 N;  2CH5 A;  4CJQ A;  1CXQ A;  3I56 N;  1VHX A;  2HVI A;  4FJ7 A;  3M8S A;  3AAP A;  2P5G A;  3HK2 A;  2UXD K;  3NGY A;  2X6N A;  5M1O A;  3L2V A;  1T3V A;  4W5T A;  4DQ8 A;  4F3O A;  3KIO A;  1O13 A;  3BEX A;  4HCC A;  4GNI A;  3TAP A;  1N8R O;  3OS0 A;  1VQM N;  3ZSQ A;  3KK1 A;  1JLE A;  4M3W A;  4CFB A;  1YJW N;  1JKH A;  3F9M A;  2HNZ A;  4CF9 A;  3TTF A;  3C7N A;  1HUX A;  4CJL A;  1NJZ A;  2B6A A;  2UUB K;  1X1P A;  5TKY A;  2IIR A;  2WC9 A;  1ASV A;  4KHW A;  4JI7 K;  1JXB A;  1YIT N;  4FJK A;  4CJU A;  5GAH P;  2HNY A;  1TYQ B;  3QLH A;  1JXE A;  4F2S A;  3EKS A;  4RW7 A;  1WSF A;  2EHG A;  4FPA A;  5JVG L;  2HND A;  4OPA A;  1SAZ A;  1BIZ A;  2O8D A;  1KAX A;  3TSU A;  1NGE A;  3TTD A;  1HLU A;  1D5A A;  3TAQ A;  5C2D A;  4H0V B;  3KZB A;  3O9Q A;  3NGZ A;  4CF1 A;  3O08 A;  2G8F A;  4BR4 A;  5BRH A;  4G1Q A;  1QVG M;  4LH5 A;  4CF8 A;  4QS9 A;  3QEW A;  3CJA A;  2P9I B;  3O1W A;  4Y0W A;  4F8R A;  1GOA A;  3AVB A;  3DXM A;  2E20 A;  1TUU A;  4OVL A;  1NGD A;  1QZ6 A;  5HLF A;  3WEE B;  2E8A A;  1NK9 A;  4OGC A;  4H0Y B;  3LP3 A;  2V52 B;  1NBW A;  4GV3 A;  2CGK A;  1RCH A;  3SI6 A;  1I94 K;  3KJV A;  3OYE A;  4EZ6 A;  3H3N O;  4J2E A;  1W0H A;  1WOQ A;  1QQC A;  1EXQ A;  2ZM6 K;  4ELT A;  1Y64 A;  3AVA A;  3KK3 A;  4OKK A;  1NK6 A;  4DTO A;  4EZ9 A;  3OYB A;  1C0U A;  3O6W A;  3HPO A;  2RE2 A;  3HT3 A;  4QS7 A;  4DTR A;  4B9T A;  4DV3 K;  4C8O A;  3CJB A;  1HJR A;  4JI1 K;  3I0R A;  3VQ6 A;  2Z1J A;  1BIS A;  2P9K B;  4BR5 A;  5BN9 A;  4PY5 A;  1REV A;  3ID8 A;  3MX2 A;  5FPN A;  3EZ5 A;  1VSE A;  3AVJ A;  3DI6 A;  3MEG A;  2HHH K;  3J7Z O;  3IUC A;  2OTL N;  4CHY A;  1XHX A;  3OYL A;  1QE1 A;  2UXC K;  4DFM A;  4XIU A;  4JS5 A;  2E2Q A;  5M1K A;  4W5Q A;  1OH7 A;  4EFH A;  4H5N A;  3WXI A;  1JL1 A;  3ITH A;  3NF6 A;  4RCH A;  1TK5 A;  4M41 A;  2QXL A;  1QVF M;  4NB4 A;  3RSE B;  3D2F B;  3L4Q A;  1Q86 O;  2KKZ A;  1ZBL A;  4I6M B;  2V7Z A;  4OLB A;  4OPJ A;  3M6G A;  1JLB A;  4ELU A;  4CIG A;  1QHA A;  2X78 A;  1NGJ A;  3EEQ A;  3AA2 A;  4AH9 A;  3CCE N;  2Q97 A;  4Z94 A;  1BUP A;  3HVR A;  3H3O B;  5AQR A;  4PL8 A;  1Q82 O;  1XI1 A;  3U6F A;  3VGL A;  2VWK A;  2P9I A;  1S1V A;  2YX6 A;  2UXB K;  2VYP A;  4M3R A;  4BRA A;  3WQU A;  1U04 A;  1BL3 A;  4HCB A;  4N5S A;  4F3T A;  3J7Y P;  2QM1 A;  3VQ7 A;  4FO0 A;  1T03 A;  2IDO A;  3CET A;  2E6L A;  2O4G A;  3TAR A;  1VSM A;  5GIN A;  5KRT A;  1RT3 A;  3CYM A;  2JWK A;  2Y1J A;  2X74 A;  1YJN N;  4EP5 A;  3DLH A;  4FCY A;  2DFH A;  3HST B;  3PLA A;  2HBK A;  3C6A A;  4DTU A;  3J80 O;  3FZK A;  5JLH A;  2D5R A;  5AQI A;  1VQO N;  1FJG K;  3RRH A;  5BPN A;  3H1V X;  1HJO A;  3HRG A;  4CF0 A;  2P9K A;  1HX1 A;  3LPT A;  4H4M A;  3VQD A;  3FFK B;  3I8D A;  3NMU A;  4B1Y B;  3LP2 A;  3VF2 A;  1RTJ A;  4WYB A;  5AQT A;  4CVN E;  5AQM A;  3KLI A;  1E3M A;  3F9K A;  4WE1 A;  3PIO L;  1KRP A;  1KQS M;  1W9H A;  1ASW A;  1VQ6 N;  3QIN A;  3LDP A;  3MXI A;  4QS8 A;  4YOT A;  4FWQ A;  4CEZ A;  2I7N A;  4RTF D;  1RFQ A;  4J2D A;  3VN5 A;  5AZI A;  4B8C A;  4I6M A;  3CQX A;  1JLF A;  2HB5 A;  1BQM A;  3R3L A;  4BRE A;  3O80 A;  5GAD P;  5TKW A;  1NK5 A;  4DCH A;  2IGI A;  4B08 A;  2BDP A;  2YI1 A;  1NKE A;  2XY7 A;  1OVQ A;  3V9Z A;  4CBX A;  1BI4 B;  3CCU N;  2NRX A;  4CEE A;  3G10 A;  3OS1 A;  2QWQ A;  4GV9 A;  3J8A A;  2NLX A;  4O55 A;  3CFR A;  5LJW A;  4CBU A;  1E4F T;  4I9L A;  3EN9 A;  3S3O A;  4NCB A;  2YHX A;  3VF4 A;  4CEQ A;  4E7L A;  3IMX A;  1EKE A;  4H0T B;  2W42 A;  4FWO A;  3OYA A;  2Q36 A;  3M8P A;  3A5L C;  1JCG A;  1VQ8 N;  2D1K A;  3K5O A;  4CK1 A;  1HNZ K;  1RT1 A;  3TTC A;  1U49 A;  1TV6 A;  4IG0 A;  2Q1N A;  3M1F A;  2YKN A;  4OX9 K;  4IDK A;  4JS4 A;  1OVY A;  4CJ3 A;  1NK7 A;  5AQL A;  4PL7 A;  4C1N I;  4FW1 A;  4JK8 A;  4JI0 K;  3AGK A;  4CJR A;  3OHR A;  1Z6R A;  4O4G A;  4JYA K;  1N32 K;  4E1J A;  4B1X B;  4W5R A;  1SUQ A;  4ILG B;  4WFB L;  1IKX A;  2OAN A;  3E66 A;  3ZT2 A;  4GVE A;  2HHV A;  5LMN K;  4FK4 A;  3RVC A;  4B3R K;  3LP1 A;  4B9M A;  1ZBU A;  4B9V A;  1FK9 A;  5F1X A;  4HUG A;  1RT7 A;  1NM1 A;  4Z4C A;  4FJN A;  3MN9 A;  3LAL A;  4CES A;  5HL7 L;  2P9N B;  4BC2 A;  2UYT A;  3LPU A;  4OLA A;  3JYT A;  4A2B A;  3CCM N;  3DWL A;  4IDH A;  4FJM A;  3G25 A;  1LW0 A;  3AVH A;  2OPR A;  3FR0 A;  4JD2 A;  2OA8 A;  3WNE A;  3CMA N;  4MFB A;  5DK5 A;  3NF7 A;  3DLG A;  3CCQ N;  1T6C A;  4GY2 B;  4YHH K;  1GLF O;  5JS1 A;  4E3S A;  4CHP A;  1MDU B;  4CK3 A;  4FOI A;  3SJJ A;  4MDB A;  1RBU A;  1S1T A;  5IWA K;  5KRS A;  3ALY A;  1SKW A;  1UA1 A;  1XHZ A;  3ZSV A;  4JKH A;  1QQN A;  1YUW A;  2PY5 A;  4MLH A;  4MLE A;  3CME N;  4DR7 K;  3CM6 A;  2F96 A;  3QNO A;  1KD1 O;  4V19 S;  1U47 A;  2YHA A;  3T1Y K;  5J2N A;  4KKO A;  5J1E A;  3K2P A;  1T44 A;  2J4R A;  3HO1 A;  4DWI A;  4JKA A;  3WXK A;  4JAX A;  4LH4 A;  3Q7B A;  4I7F A;  2A5X A;  3LDL A;  2NRZ A;  2NRW A;  3I33 A;  1N34 K;  1VQK N;  4FWS A;  3V9X A;  4JRQ A;  2XY5 A;  2QWR A;  4CGI A;  4CZF A;  3L2U A;  1S1U A;  1WAF A;  5E26 A;  4JI5 K;  4LF9 K;  5HRO A;  1J6Z A;  1IG9 A;  3MEC A;  4KPY A;  3DLE A;  3HVT A;  1K8K A;  4MQ3 A;  1A5W A;  1FXX A;  3AVF A;  1HRH A;  1MU2 A;  4CFC A;  1SKR A;  1NNE A;  4WQ5 C;  2PYL A;  1R0A A;  1M90 O;  5AQF A;  1LWC A;  1X9S A;  3SCX A;  3K5M A;  5FPE A;  3CF5 L;  4IO9 L;  1IBK K;  2D0O A;  2QTD A;  5C15 A;  1RBV A;  4LF4 K;  2BGG A;  1RT6 A;  4LY7 A;  3EZW A;  3ID6 A;  2FC0 A;  3QEX A;  2P9N A;  4BWM A;  4DU3 A;  3L3V A;  2VG6 A;  1QTM A;  4FJH A;  1TKX A;  4CEB A;  4K25 A;  3U4L A;  3SUQ A;  4BDZ A;  3T19 A;  4YOW A;  3NH0 A;  1NOZ A;  1HPZ A;  4OKE A;  3ULE A;  3RMC A;  4KRF A;  4BRD A;  4FVU A;  3M8Q A;  4LF8 K;  3THW B;  4CHO A;  3IS9 A;  1Z26 A;  4K43 A;  4JI6 K;  3SBG A;  4DR4 K;  4X62 K;  3NFA A;  3ZT4 A;  4AHT A;  1LCU A;  3AVN A;  4CJK A;  2KHO A;  3F5T A;  4JK7 A;  4KAZ A;  1U6Z A;  4AM7 A;  4KHN A;  2GV9 A;  1I39 A;  4B1W B;  1IG8 A;  3TAE A;  1X9J A;  3MDQ A;  2CGJ A;  1RDC A;  4BWJ A;  2KW4 A;  5HOO A;  2I5J A;  3D2E B;  4M45 A;  4FM2 A;  2P9P B;  3WXJ A;  3RWU A;  1RTD A;  4JI2 K;  3SMS A;  1NGF A;  3OYJ A;  1L3U A;  3AA4 A;  1HPM A;  4OPK A;  3SQ4 A;  2HHT A;  2BE2 A;  3DXK B;  4B9N A;  1ZXO A;  3SAH A;  1WBD A;  3VF6 A;  1QSS A;  4M3Z A;  1FW6 A;  4BRG A;  2I7P A;  4I2P A;  3EO3 A;  4CZM A;  1WNS A;  1EWR A;  1MWM A;  5HRR A;  5GIP A;  3RMD A;  3CC2 N;  2E6M A;  5FDL A;  2E88 A;  5M1P A;  4YY3 K;  4LFC K;  2ZJQ L;  1T8E A;  1HNX K;  4KHS A;  1ITG A;  3ZX3 A;  1TAQ A;  3HI0 A;  3ENB A;  1OH6 A;  2HHQ A;  1ZBS A;  1KXP A;  3OA9 A;  3FFI A;  2W40 A;  5CZ2 A;  3LDO A;  1JCE A;  1HNI A;  1YAG A;  4IFV A;  4KTQ A;  4ISE A;  3QES A;  1UWB A;  4CZK A;  4DG1 A;  3WNH A;  1VSD A;  2GUI A;  3KLE A;  1BGX T;  1NGC A;  1Q9X A;  3O3F A;  2ZQB A;  2G8V A;  4ILJ A;  1HKB A;  3C6U A;  2YJF A;  3NVM A;  1NMD A;  5DM7 L;  5JMV A;  3W3D A;  3O9S A;  4RW4 A;  1A5X A;  1C1C A;  1NGA A;  1Z05 A;  2QWP A;  3THW A;  1J54 A;  4B9Q A;  2EX3 A;  4CFA A;  3T1H K;  1HR0 K;  2QI2 A;  5E41 A;  2ITG A;  2D0A A;  2P9L B;  1Y97 A;  1LWF A;  3BZC A;  3EKU A;  4GW6 A;  3HXM A;  4F2R A;  1SL2 A;  5JS2 A;  3UKU B;  4GV6 A;  2XRI A;  3RR7 A;  1DTQ A;  4YOY A;  3C94 A;  3DLK A;  3SK3 A;  3UKR B;  1XQS C;  4QAG A;  5CY4 A;  4JKB A;  2GX9 A;  3LZJ A;  3D2E A;  5HRS A;  4E7H A;  2P9P A;  3SAF A;  1TK8 A;  5KQ8 A;  3G71 N;  3PSI A;  3H45 C;  3T69 A;  1RDD A;  2PFU A;  2FBX A;  3KHY A;  1K9M O;  3JS6 A;  5GAE P;  1WSG A;  1BO5 O;  2QWO A;  2Z1I A;  3PY8 A;  3IDH A;  4OJR A;  3S41 A;  3OBW A;  4NYF A;  2BAN A;  4M7X A;  4H5V A;  1SKS A;  4CEF A;  2ZGY A;  4FJ8 A;  3MN7 A;  3TWH A;  5J2M A;  3HBT A;  4QCL A;  2IC3 A;  3KTQ A;  3AGR A;  2O8C A;  2NRH A;  4N47 A;  2NUB A;  3CPW M;  3ENH A;  4O0I A;  4BDY A;  3AA3 A;  1D9F A;  3DLB A;  1KLM A;  4FPB A;  3ZT0 A;  4CJV A;  4KI6 A;  3GBT A;  5KGX A;  4YNQ A;  3THY A;  3MCA B;  4DSI A;  5HRN A;  4BR2 A;  3R9P A;  5AQX A;  4DUZ K;  4HUE A;  4X64 K;  4CGF A;  3NAE A;  3THV A;  1OKJ A;  4NCG A;  3NF8 A;  4CHN A;  2CGL A;  3OS2 A;  3O4N A;  4DU4 A;  5I9E B;  1KVA A;  4IEI A;  4O8U A;  4CJP A;  4BE2 A;  3BP8 A;  4O5B A;  1NJW A;  2WUS A;  1LAW A;  4GMJ B;  4YOV A;  4HVJ A;  3KVG A;  2RKI A;  2YNG A;  4JI8 K;  4DTN A;  4DR3 K;  4NXN K;  5M1F A;  3D0P A;  3VGM A;  4M3T A;  1JLQ A;  5KQD A;  5KTQ A;  4WQ4 A;  4CED A;  1XNQ K;  3D6R A;  3RMB A;  1TGO A;  3QML A;  4RW9 A;  3P39 A;  3C65 A;  3MWP A;  4CJT A;  4DTJ A;  2A40 A;  3T3F A;  4JI4 K;  4BVP A;  1Q81 O;  3VQ5 A;  4MDA A;  2E2N A;  4CZJ A;  3QEP A;  3WNF A;  2R7Y A;  2GEM A;  3UKR A;  3P83 D;  3CCR N;  3QER A;  2DFE A;  4L8R B;  2GEL A;  4CJF A;  4JKD A;  5C2F A;  3LWL A;  4H8K A;  3SV3 A;  3VQ8 A;  3QIP A;  3SPZ A;  2QWN A;  2E2P A;  1Q8I A;  5FLX O;  1RDW X;  1ZBI A;  4NCA A;  4ZTF A;  3AVC A;  4K41 A;  2G8I A;  4BE1 A;  1LV5 A;  1TYQ A;  1BG3 A;  3DOK A;  1RT2 A;  4DR2 K;  1NGH A;  2Q2R A;  2Z1G A;  4NXM K;  3MAQ A;  4ISG A;  2RN2 A;  3AAQ A;  4L3Q A;  3THX B;  2F4V K;  1QQM A;  3G4S N;  3IKM A;  1BA0 A;  4DS4 A;  4O8K A;  5AQY A;  5GAG P;  4LF7 K;  3LM9 A;  1OH8 A;  5AQV A;  4JV5 K;  4K0K K;  3CIP A;  3AVK A;  3AO4 A;  3D45 A;  3HTV A;  4DU1 A;  3P1G A;  1X9M A;  1O1W A;  4M63 C;  1C0T A;  1LW2 A;  1VSF A;  3KLG A;  1HNV A;  3CCV N;  4LD0 A;  4OKJ A;  1WLJ A;  1UA0 A;  3RTV A;  1DKG D;  3WEE A;  4KI4 A;  3WQT A;  3QO9 A;  4ID5 A;  3OBY A;  2B5J A;  4ICL A;  1U45 A;  1XMQ K;  5D3G A;  1S9G A;  4IJA A;  4R79 A;  1S1X A;  1ASU A;  4DKW A;  2PAV A;  3V1R A;  4FM1 A;  2RPI A;  4J8F A;  1IKW A;  4I2Q A;  3VEN A;  4H5R A;  3VQE A;  3SUO A;  4JLH A;  4CE9 A;  3OJS A;  1R59 O;  3KD1 E;  2IVN A;  1W2B M;  4M3X A;  1BA1 A;  1YTU A;  3VA3 A;  2E2O A;  2YHB A;  1SL1 A;  3AO3 A;  3B6O A;  4DV7 K;  4FZY A;  3LDQ A;  3A5N C;  2GTD A;  1BWF O;  3QFU A;  3A0I X;  1YXQ A;  3OYH A;  1GLB G;  3MN6 A;  2O4I A;  3OYN A;  5JVH L;  1HQE A;  4KH6 A;  4BRI A;  3RR8 A;  2ZD1 A;  2CH6 A;  3OYI A;  5SWM A;  1NLV A;  4DV2 K;  1ATS A;  3LZI A;  3BZK A;  1RTH A;  3EY1 A;  3G6E N;  4E7J A;  5BR8 K;  5FRM A;  1J53 A;  3RSE A;  3THX A;  2F9T A;  3D2F A;  1YJ9 N;  3M3Z A;  2PBD A;  4IO8 A;  1JJ2 M;  4Z4E A;  1QQO A;  2YNH A;  4BR0 A;  2FSJ A;  2FSN A;  2W6L A;  4IOC L;  1CZ9 A;  4BC5 A;  3W0L A;  3AO5 A; 
#chains in the Genus database with same CATH homology
 3DLE A;  1TVR A;  3HVT A;  3OYM A;  3SUN A;  1NKB A;  4MQ3 A;  1J5O A;  1DLO A;  1A5W A;  4W5N A;  1FXX A;  4RG8 A;  3AVF A;  3VQC A;  4LSN A;  1HRH A;  1MU2 A;  4CFC A;  1RIL A;  4CJ5 A;  1KVB A;  4E1M A;  1SKR A;  3DRP A;  3QIO A;  1BCM A;  3O3G A;  2PYL A;  4W5O A;  1T05 A;  1BHL A;  2JLE A;  1B9F A;  4DQR A;  1R0A A;  3SQ2 A;  3NH2 A;  1LWC A;  4RW6 A;  1X9S A;  3PX6 A;  3SCX A;  3S9H A;  1ZBH A;  3K5M A;  1JL2 A;  5HRP A;  1NK4 A;  4PQU A;  1RBS A;  2P1J A;  1WN7 A;  5K14 A;  3TAM A;  4TSX A;  2OZS A;  1HMV A;  1RBV A;  5FRO A;  1CXQ A;  4CJQ A;  2BGG A;  2XO7 A;  1RT6 A;  1QSY A;  4LY7 A;  3MEE A;  3SQ1 A;  2HVI A;  4AHU A;  2FBY A;  1HYS A;  4DSE A;  4FJ7 A;  3M8S A;  2FC0 A;  4E0D A;  4Z4I A;  3QEX A;  2P5G A;  3HK2 A;  2OPP A;  4CHZ A;  3S3M A;  3NGY A;  2X6N A;  4DFP A;  4BWM A;  4DU3 A;  4KFB A;  3VQ9 A;  4FJJ A;  3OYK A;  3L2V A;  3L3V A;  2VG6 A;  1QTM A;  2VG5 A;  4C8N A;  4W5T A;  1NJX A;  4FJH A;  1TKX A;  4CEB A;  3L8B A;  4F3O A;  3SUQ A;  4BDZ A;  3ZSY A;  3KIO A;  3T19 A;  4FK0 A;  4HCC A;  3V4I A;  3NH0 A;  3TAP A;  3I0S A;  3OS0 A;  1WSH A;  2WON A;  4CEO A;  1NOZ A;  1HPZ A;  4OKE A;  3ZSQ A;  3HP6 A;  3KK1 A;  3RMC A;  1NKC A;  3BDP A;  4M3Y A;  1JLE A;  1LAV A;  4Q5V A;  4M3W A;  4CFB A;  4KRF A;  1TKT A;  1JKH A;  2A1S A;  2HNZ A;  3DYA A;  4IFY A;  4CF9 A;  5I42 A;  4N56 A;  4DMN A;  3M8Q A;  2PZS A;  4CHO A;  3IS9 A;  1RDB A;  5CYM A;  3ZSR A;  4CJL A;  1Z26 A;  1NJZ A;  2B6A A;  2HMI A;  5CZ1 A;  4KTZ A;  1X1P A;  3NFA A;  1ASV A;  3ZT4 A;  2DY4 A;  4AHT A;  4KHW A;  3AVN A;  1JLC A;  1JXB A;  4CJK A;  1FKO A;  4FJK A;  4KAZ A;  2KFZ A;  4CJU A;  2HNY A;  3AO1 A;  4K8Z A;  3AV9 A;  3QLH A;  1JXE A;  2GV9 A;  4F2S A;  4FJL A;  3CG7 A;  1S1W A;  2G8K A;  4RW7 A;  4KHN A;  4DQP A;  2HVH A;  1RT5 A;  1WSF A;  1I39 A;  4PUO A;  2EHG A;  3O4Q A;  3DOL A;  3MXJ A;  2VWJ A;  4BE0 A;  3VQP A;  2HND A;  3TAE A;  4CCH A;  2QKB A;  1BIZ A;  1RDC A;  4BWJ A;  2KW4 A;  2I5J A;  4M45 A;  4FM2 A;  4RW8 A;  3K57 A;  1CLQ A;  3RWU A;  4CJ4 A;  1RTD A;  4BAC A;  1D5A A;  4IBN A;  3TAQ A;  4JRP A;  1SV5 A;  4DLG A;  3T1A A;  3V9S A;  1UOC A;  3OYJ A;  3AA4 A;  4OPK A;  3SQ4 A;  4DLE A;  1L3U A;  4AIL C;  1LWE A;  3PX4 A;  1N6Q A;  2OPS A;  4KHU A;  2BE2 A;  2YV0 X;  1KFD A;  3NGZ A;  4UQG A;  4B9N A;  4CF1 A;  4EP4 A;  2ZE2 A;  1TL3 A;  1JLG A;  1WSE A;  1QSS A;  5T7B A;  2G8F A;  4M3Z A;  4ELV A;  4I2P A;  3SYZ A;  2VG7 A;  4G1Q A;  1XWL A;  4LH5 A;  4CF8 A;  1WNS A;  3KLF A;  5HRR A;  5I3U A;  4B3O A;  4KO0 A;  3RMD A;  3QEW A;  1BI4 A;  2E6M A;  5FDL A;  3NGI A;  4N41 A;  3UIQ A;  4F8R A;  3NHG A;  5SZT A;  1Q9Y A;  1RDA A;  3VQB A;  1GOA A;  2A1R A;  1BIU A;  3AVB A;  2G8U A;  1YTA A;  4OVL A;  2G8H A;  1T8E A;  5HLF A;  4E7I A;  1KCF A;  3AVM A;  1NK9 A;  2WOM A;  1ITG A;  3LP3 A;  4OGC A;  4KHS A;  1TAQ A;  2HHQ A;  3AVL A;  1RCH A;  3SI6 A;  4B9L A;  3KJV A;  4CJS A;  3FFI A;  5CZ2 A;  3DRR A;  3OYE A;  4EZ6 A;  3RMA A;  3ULD A;  2D0B A;  4J2E A;  1W0H A;  1HNI A;  1C0M A;  4KB1 A;  3VQQ A;  4IFV A;  4KTQ A;  1QQC A;  1EXQ A;  4FLW A;  3QES A;  1UWB A;  4ELT A;  1KTQ A;  4DG1 A;  3AVA A;  3WNH A;  4OKK A;  3KK3 A;  1NK8 A;  4DTO A;  1NK6 A;  1VSD A;  5C24 A;  4OGE A;  3OYB A;  4GVM A;  2GUI A;  1C0U A;  3KLE A;  4EZ9 A;  1HYV A;  3HPO A;  1VRT A;  3HT3 A;  3TI0 A;  4ZHR A;  1BGX T;  3MED A;  1S6P A;  1Q9X A;  1EX4 A;  3ZSW A;  4CJW A;  3O3F A;  2ZQB A;  4B8A B;  4DTR A;  2G8V A;  4B9T A;  4FLU A;  4C8O A;  3C6U A;  3OY9 A;  1HJR A;  2LSN A;  3I0R A;  3VQ6 A;  1IH7 A;  2JGU A;  3HL8 A;  2Z1J A;  1BIS A;  4RW4 A;  3OYC A;  1A5X A;  1C1C A;  2Q3S A;  3VA0 A;  1YVU A;  4PY5 A;  1DTT A;  1J54 A;  1REV A;  2HHU A;  2EX3 A;  3M8R A;  2D0C A;  3VQ4 A;  4CFA A;  3EZ5 A;  2XY8 A;  4I9Q A;  4E7K A;  3ZT1 A;  1VSE A;  2G8W A;  3AVJ A;  2FBT A;  3DI6 A;  3MEG A;  5E41 A;  3PV8 A;  1XC9 A;  2ITG A;  2D0A A;  3KLH A;  4CHY A;  1QHT A;  1L3T A;  1C1A A;  1VK0 A;  1XHX A;  1FKP A;  3OYL A;  4HTU A;  1QE1 A;  1Y97 A;  1LWF A;  4DFM A;  4XIU A;  4JS5 A;  4GW6 A;  3SZ2 A;  3HXM A;  4F2R A;  2IAJ A;  1SL2 A;  5JS2 A;  4W5Q A;  3AVI A;  3L2W A;  2XRI A;  2YNI A;  3RR7 A;  1TAU A;  1DTQ A;  3C94 A;  4ID1 A;  3DLK A;  4CEA A;  2P5O A;  4C8K A;  1JL1 A;  3ITH A;  3NF6 A;  4QAG A;  5CY4 A;  1TK5 A;  4M41 A;  1TKD A;  2KFN A;  3LZJ A;  4Z0U A;  5HRS A;  4E7H A;  3SV4 A;  3A2F A;  1TK8 A;  4Z4G A;  1ZBL A;  2ATQ A;  4OLB A;  4OPJ A;  4FZZ A;  1JLB A;  1K6Y A;  1RDD A;  4DTP A;  1Z25 A;  2FBX A;  4CIG A;  4ELU A;  4FLX A;  2X78 A;  4HHT A;  3DRS A;  1NJY A;  1S9E A;  1WSG A;  3KKR A;  3P5J A;  2Z1I A;  3PY8 A;  3AA2 A;  4AH9 A;  3LDS A;  4OJR A;  4CGD A;  3HVR A;  4NYF A;  3EYZ A;  2BAN A;  1TL1 A;  5J2P A;  1XI1 A;  1SKS A;  1S5J A;  1RBR A;  3TR8 A;  4CEF A;  4CGG A;  4N76 A;  2HHT A;  4FJ8 A;  3CFP A;  3AO2 A;  3TWH A;  4E19 A;  5EU7 A;  4FLV A;  5J2M A;  2VWK A;  3U6F A;  4QCL A;  2IC3 A;  1S1V A;  3DLR A;  4O44 A;  1D8Y A;  3OYG A;  3KTQ A;  3PO5 A;  4KTW A;  4DQI A;  3KKS A;  4FJ9 A;  4N47 A;  2NUB A;  4CIF A;  4M42 A;  3CM5 A;  4O0I A;  4BDY A;  4DFK A;  4DF8 A;  3AA3 A;  1D9F A;  3DLB A;  1KLM A;  4M3R A;  3ZT0 A;  3IAY A;  4Q0B A;  1U04 A;  1BL3 A;  4CJV A;  2Y1I A;  5KGX A;  2YNF A;  4O0J A;  3LAN A;  3NBP A;  4Y1C A;  4YNQ A;  4N5S A;  4HCB A;  4F3T A;  2QXF A;  5HRN A;  4DSI A;  1WSJ A;  4KHY A;  3VQ7 A;  3K5L A;  3BGR A;  3TAF A;  1T03 A;  1D9D A;  2IDO A;  4HUE A;  2E6L A;  3V6D A;  5C25 A;  3KK2 A;  4H4O A;  1WSI A;  4CGF A;  3NAE A;  3QEV A;  3THV A;  1NOY A;  1KSP A;  4NCG A;  2O4G A;  3TAR A;  1VSM A;  3NF8 A;  4CHN A;  5CYQ A;  4DTS A;  2OZM A;  5KRT A;  3OS2 A;  1RT3 A;  3CYM A;  3O4N A;  3ZSO A;  4DU4 A;  2Y1J A;  2KZZ A;  2X74 A;  3C95 A;  4EP5 A;  3PO4 A;  1KVA A;  4CJP A;  3DLH A;  4BE2 A;  3HPG A;  4O5B A;  5DMR A;  4FCY A;  2DFH A;  4DSF A;  3HST B;  4DTX A;  4HUF A;  4AHV A;  3V9W A;  1NJW A;  1YT3 A;  1LAW A;  3PUF A;  4GMJ B;  4DTU A;  3AA5 X;  1VSL A;  4IKF A;  2FBV A;  4HVJ A;  3HYF A;  3WNG A;  2RKI A;  2D5R A;  1GOB A;  2YNG A;  3NCI A;  4DTM A;  4DTN A;  4FK2 A;  3RRH A;  3QEI A;  1TKZ A;  1F21 A;  1IG9 A;  3D0P A;  2XY6 A;  4LSL A;  4M3T A;  1JLQ A;  3ASM A;  4CF0 A;  5KTQ A;  4CED A;  5KI6 A;  3LPT A;  2DFF A;  1RTI A;  4H4M A;  3VQD A;  4KPY A;  2E4L A;  3HM9 A;  2GBZ A;  3C6T A;  3RMB A;  1EET A;  4FW2 A;  1J9A A;  1TGO A;  4RW9 A;  3I8D A;  3S3N A;  1NK0 A;  3LP2 A;  4CEC A;  4PA1 A;  1RTJ A;  4CJT A;  4DTJ A;  4CHQ A;  3T3F A;  3KLI A;  1ZYQ A;  4FVM A;  4FM0 A;  3U3Y A;  3RRG A;  3F9K A;  4WE1 A;  3VQ5 A;  3F73 A;  1VSK A;  1KRP A;  3QEP A;  1RNH A;  1W9H A;  4KV8 A;  1ASW A;  3WNF A;  3ZCM A;  2R7Y A;  4KB0 A;  3QIN A;  3MXI A;  3P83 D;  4FYD A;  3QER A;  2DFE A;  3NF9 A;  3U3G A;  3G0Z A;  4CEZ A;  4L8R B;  4CJF A;  4Z4H A;  4FLZ A;  1I3A A;  4J2D A;  3LWL A;  4PWD A;  3VN5 A;  4B8C A;  3V9U A;  4H8K A;  3SV3 A;  1JLF A;  2HB5 A;  3VQ8 A;  3QIP A;  1BQM A;  3SPZ A;  1VSJ A;  4AHS A;  1NK5 A;  2IGI A;  4B08 A;  1Q8I A;  4CER A;  2BDP A;  3B6P A;  3L2R A;  3L3U A;  1NKE A;  2XY7 A;  1ZBI A;  4C8L A;  3V9Z A;  3E01 A;  4NCA A;  3SQ0 A;  4FJG A;  3DM2 A;  1BI4 B;  4ZTF A;  3AVC A;  4CEE A;  1B92 A;  3G10 A;  1TK0 A;  2G8I A;  3OS1 A;  4BE1 A;  1LV5 A;  4R5P A;  3CFR A;  2OPQ A;  4O55 A;  3NDK A;  2X6S A;  4J2B A;  3DOK A;  4DF4 A;  4I9L A;  1RT2 A;  3LP0 A;  3S3O A;  4NCB A;  1VRU A;  2Z1G A;  3K5N A;  4CEQ A;  1RBT A;  4E7L A;  1IKV A;  3MAQ A;  1EKE A;  2W42 A;  4J2A A;  3OYA A;  1L3S A;  3OYD A;  2PYJ A;  2RN2 A;  3ISN C;  4DS5 A;  1L5U A;  3K58 A;  3M8P A;  4FJI A;  3OVN A;  3K5O A;  4CK1 A;  4C8M A;  4KI6 A;  1RT1 A;  1U49 A;  4DS4 A;  4FJX A;  1TV6 A;  4IG0 A;  3V1Q A;  2YKN A;  5HP1 A;  3QNN A;  4IDK A;  4KRE A;  4JS4 A;  1NK7 A;  4CJ3 A;  4CGH A;  4AHR A;  1G15 A;  3SNN A;  4FW1 A;  1T7P A;  3AVK A;  1QS4 A;  3AO4 A;  2DTU A;  4CJR A;  3D45 A;  4O4G A;  3L2Q A;  3K59 A;  3TAG A;  4QOZ B;  4DU1 A;  3P1G A;  4YFU A;  1SUQ A;  4W5R A;  4IG3 A;  1X9M A;  2HHX A;  1IKX A;  4B9U A;  1O1W A;  2F8T A;  3ZT2 A;  1C0T A;  1LW2 A;  3LAM A;  2HHV A;  1VSF A;  3KLG A;  4FK4 A;  1B9D A;  4BDP A;  1HNV A;  4LD0 A;  1A5V A;  4OKJ A;  3LP1 A;  3V1O A;  4B9M A;  1EP4 A;  1WLJ A;  1ZBU A;  3JSM A;  2P51 A;  1UA0 A;  1ZBF A;  3RTV A;  3SUP A;  1FK9 A;  4DQS A;  4B9V A;  1C6V A;  1CXU A;  1RT7 A;  4HUG A;  4KI4 A;  3HJF A;  4Z4C A;  2AJQ A;  4FJN A;  3LAL A;  3QO9 A;  4ID5 A;  4CES A;  1KVC A;  5FRN A;  1IO2 A;  2B5J A;  4ICL A;  5HBM A;  4CGJ A;  3LPU A;  1U48 A;  3KD5 E;  4K8X A;  3JYT A;  4OLA A;  1U45 A;  4FJM A;  5D3G A;  4Y1D A;  1LW0 A;  3AVH A;  2OPR A;  2OA8 A;  1N5Y A;  4ZTJ A;  1S9G A;  2OYQ A;  3WNE A;  4DSL A;  4MFB A;  1S1X A;  5DK5 A;  1ASU A;  3NF7 A;  4CJE A;  1KFS A;  3V1R A;  2QK9 A;  2KTQ A;  4FM1 A;  3DLG A;  4CF2 A;  2RPI A;  1IKW A;  4I2Q A;  3VQE A;  3SUO A;  1HQU A;  5C42 A;  1BCO A;  4JLH A;  4E89 A;  3HPH A;  4CE9 A;  5J2Q A;  5JS1 A;  3OJS A;  4E3S A;  4CHP A;  3KD1 E;  3NE6 A;  4CK3 A;  2IS3 A;  3IG1 A;  4M3X A;  3O3H A;  3LAK A;  1YTU A;  3VA3 A;  3SJJ A;  1RBU A;  1S1T A;  2YHB A;  2HW3 A;  5KRS A;  3ALY A;  1SL1 A;  3TAB A;  2F8S A;  3AO3 A;  1SKW A;  1UA1 A;  3B6O A;  1C1B A;  1XHZ A;  4FZY A;  3ZSV A;  3MXM A;  1VSH A;  4DSK A;  4DQQ A;  1BQN A;  2PY5 A;  1GOC A;  3LWM A;  2QKK A;  4Z4F A;  3ZSX A;  3CM6 A;  1RT4 A;  3V81 A;  3SPY A;  2F96 A;  1UAX A;  3NH1 A;  3QNO A;  4B9S A;  4KHQ A;  3OYH A;  3TAN A;  1U4B A;  1U47 A;  4AHC A;  1HYZ A;  2YHA A;  5J2N A;  4FXD A;  1JLA A;  4KKO A;  5J1E A;  3K2P A;  1QSL A;  2O4I A;  4FJ5 A;  3OJU A;  3DMJ A;  2XHB A;  2KZM A;  3OYN A;  3HO1 A;  1HQE A;  2B4J A;  2ETJ A;  4CFD A;  1WAJ A;  3RR8 A;  2ZD1 A;  4DWI A;  4DFJ A;  4DSJ A;  3AVG A;  3OYI A;  3HP9 A;  4E1N A;  5SWM A;  3QET A;  1CZB A;  4LH4 A;  2HHW A;  3LZI A;  4I7F A;  3H08 A;  4CK2 A;  2RF2 A;  4FZX C;  3CQ8 A;  1L3V A;  1RTH A;  2KQ2 A;  3EY1 A;  1VSI A;  1X9W A;  4E7J A;  2IOC A;  4M3U A;  4CIE A;  5FRM A;  2Z1H A;  1J53 A;  3ZSZ A;  4JRQ A;  3V9X A;  1SL0 A;  4FLY A;  2XY5 A;  4NYN A;  4CGI A;  3L2U A;  1S1U A;  1WAF A;  3VQA A;  3PX0 A;  1KLN A;  4Z4E A;  3IRX A;  2YNH A;  3CFO A;  5KGW A;  2YKM A;  2HHS A;  3ZT3 A;  1IKY A;  5HRO A;  4F4K A;  1CZ9 A;  4FLT A;  3OYF A;  3MEC A;  3AO5 A;  1S6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...