3WNGA

Cyclic hexapeptide pkidnp in complex with hiv-1 integrase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
138
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title Hexapeptide mimetics of LEDGF in complex with HIV-1 integrase
rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/peptide
total genus 49
structure length 138
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3wngA00
2QKBA 1L3VA 2EX3A 5J2QA 4KTQA 1XWLA 3DLGA 4EP4A 4DF4A 4PWDA 2DFHA 4FJIA 1TAUA 2DFFA 4Q5VA 1R0AA 3NF6A 4KTWA 1T7PA 3ZT0A 4HHTA 1T05A 2F96A 1S1TA 3AVFA 3RRHA 3HVTA 5KTQA 4N47A 4E3SA 1J9AA 2FC0A 4FYDA 3SQ0A 1VRTA 4AHUA 4OPJA 2YKMA 3DI6A 3WNFA 2KZMA 3K2PA 3TAMA 5KRTA 1UA0A 3NGIA 4H8KA 4C8KA 3AVCA 2I5JA 3BGRA 1X9MA 1BISA 1JLQA 3MEDA 1NKCA 1J53A 1IKYA 1REVA 2BANA 1WSFA 2HNZA 1LAVA 5K14A 3CFOA 3OJUA 3DOLA 4FLXA 5DMRA 1C1BA 5FRMA 4KAZA 3SJJA 3ZSYA 4DFPA 1G15A 1GOAA 4G1QA 2HHQA 3LP1A 3THVA 2B6AA 1NK7A 2ITGA 4IFYA 3VQ5A 1RDBA 3OYAA 1KLNA 2PYJA 1XHXA 1YVUA 4NYNA 2YNFA 1KVBA 3NF9A 3IAYA 3TABA 2FBXA 4E1NA 3NAEA 3TAQA 4NCGA 5KGWA 4B9MA 3HM9A 1JLAA 1HNIA 3VQ7A 4FJ9A 1TK8A 2IGIA 3QERA 5CYMA 1IO2A 2YHBA 1A5WA 4B08A 1L3UA 4DSJA 4KHQA 4Z4FA 2BE2A 4GW6A 4DTOA 1U04A 4CESA 3L2UA 3SQ1A 1KSPA 4PUOA 2X6NA 1RT5A 4CHQA 2PY5A 3ALYA 3SPZA 4Z4EA 3O3HA 3NH1A 1O1WA 4C8NA 3PX4A 1C0UA 1C1AA 4M3UA 3ZT2A 5J2PA 4DTXA 5CY4A 3SZ2A 3ZT3A 3NH0A 3TAPA 4DG1A 3M8RA 3OVNA 1LWCA 2VG6A 4BWMA 4AHCA 2KQ2A 3KK3A 2A1RA 1SKSA 4CJ4A 2VG7A 4E1MA 5C42A 4E7IA 3EY1A 4KFBA 2F8TA 3ZSWA 5FDLA 4DFKA 1BI4B 2YNIA 3QNNA 3ZSVA 3VQDA 3AA5X 4FXDA 1BGXT 2KW4A 3QINA 3C95A 3WNEA 3PO5A 5J2MA 3VQ9A 1YT3A 4KHWA 4M3YA 3HVRA 1ZBFA 4BDYA 1WSEA 4HUGA 3DLKA 4M41A 3NF7A 4LH5A 4CJEA 4DTSA 4B9SA 2HVHA 1NK4A 2KFNA 1NK9A 4DQIA 1Y97A 5HBMA 1LWEA 1RDCA 1TKTA 4CJLA 3NE6A 1VK0A 3HPGA 3P5JA 3OJSA 3HSTB 3PO4A 3T19A 3RMDA 4DU4A 5JS1A 4CF9A 1ZBHA 4W5RA 4DMNA 1TAQA 2BGGA 1NKEA 2DTUA 4Z0UA 1ZBIA 4JS4A 4CJTA 3QO9A 4FLWA 4NCBA 2P5GA 2O4GA 1X9SA 3VQ8A 4DTRA 4DFJA 4B9VA 4E89A 4OGCA 3HP6A 3RMCA 5I42A 2XY8A 4FW2A 4CEZA 2FBTA 3I0RA 4CCHA 4CHZA 3V9ZA 4CGDA 4FK4A 4DQRA 4DF8A 3K59A 4B8AB 1NK0A 4IKFA 3E01A 1RT4A 2KZZA 2HHWA 3OS1A 1VSMA 2P51A 3L2QA 3HXMA 2D5RA 3LDSA 2HMIA 3ZT4A 4FJMA 5HP1A 4OPKA 3LZJA 3NF8A 4FK0A 2G8FA 3LALA 2GV9A 3SV3A 4KHUA 4E7LA 4TSXA 1U48A 1WLJA 3KK1A 2KFZA 2VG5A 1CLQA 3LANA 3TANA 3NFAA 4DU3A 3HPHA 1NJWA 1TK5A 1U49A 4BACA 3QEVA 3QEIA 4MFBA 3TR8A 4ID5A 3JYTA 3AA4A 3ASMA 4CHNA 3KTQA 4JRQA 1KVAA 3L3VA 3L2WA 4O55A 4PA1A 2IC3A 3O4NA 4W5TA 4FLUA 4W5OA 3CG7A 3LP3A 3CM6A 3DRPA 2XY7A 4CF8A 1BIUA 3AO4A 4CJVA 3AVIA 1NK6A 3TI0A 2BDPA 1BIZA 4IFVA 3V1OA 3KD1E 4F3OA 3P1GA 5E41A 4AHTA 4CFBA 1Q9XA 4O44A 1B9DA 4H4OA 3ZSRA 2FBVA 4QCLA 1WSGA 4KI6A 2ZD1A 3D0PA 3AV9A 4CIEA 1RBSA 2B4JA 3O4QA 1XC9A 1TVRA 1HNVA 3HK2A 3WNGA 3OYIA 4I9QA 2O4IA 2Z1HA 4M42A 3LAMA 4YNQA 4F4KA 3PUFA 1FKOA 1RBRA 3KKRA 4OGEA 3OYHA 3PV8A 1ZYQA 5HLFA 4KV8A 1RTDA 3ZSOA 2HB5A 4ELTA 4FZYA 4M3ZA 3O3FA 2HHTA 1A5VA 5FROA 1EKEA 3ZSXA 1NOZA 4HCCA 3NBPA 1TGOA 2G8IA 3QIPA 4BWJA 3OYCA 4JRPA 3I8DA 3KLHA 1KTQA 1BHLA 1C1CA 3OYNA 4M3XA 1ITGA 3MECA 1UWBA 1ZBUA 3MEGA 4Y1DA 1HRHA 4CHPA 3HP9A 3VQEA 1HQEA 3RR8A 3AO5A 3D45A 2KTQA 1B9FA 1TKZA 3RR7A 4FJ5A 1RT3A 3ITHA 2W42A 3AVMA 3VQAA 3SNNA 4J2BA 4LSLA 4ID1A 4LY7A 5C24A 2Y1JA 5CZ2A 4CK3A 2WONA 2WOMA 4DTNA 4CF2A 3CYMA 4FJGA 2DY4A 1SL2A 3NDKA 3RTVA 1LAWA 2RF2A 1QHTA 1QE1A 1S1XA 2RN2A 4KTZA 4DS4A 4CHOA 1KFSA 4DLGA 3F73A 1X1PA 4AH9A 4EZ9A 3VQBA 3DM2A 3KK2A 5D3GA 3AO2A 3F9KA 1WAFA 3AVBA 4CEDA 3V6DA 1JLBA 1VSFA 5DK5A 1EP4A 1QQCA 2G8UA 1S5JA 3OS0A 1WAJA 3DLEA 2P5OA 4FJ8A 1FKPA 2IAJA 3QEWA 2Y1IA 2GUIA 4DLEA 4E0DA 4C8MA 1FXXA 4M3RA 4CHYA 4DTPA 3ZSQA 4LD0A 1C0TA 1FK9A 4E19A 1SUQA 3OYLA 4K8XA 3HJFA 2GBZA 4RG8A 3SQ2A 4E7JA 4F2RA 2HW3A 3OYKA 1EX4A 1JLFA 4RW4A 1SV5A 3HYFA 1RTHA 4LH4A 3KLFA 3V4IA 4FJXA 3IG1A 3P83D 3B6PA 1JL2A 2PZSA 4BE0A 4FLYA 4K8ZA 3AO3A 1TL3A 3KJVA 1S1UA 1SKRA 4NCAA 3OY9A 3AA3A 2OPPA 3KKSA 3LP0A 4FM0A 3OYJA 1WSIA 2XRIA 1KVCA 4EP5A 4J2EA 3LP2A 1RTIA 4OKEA 1VRUA 4WE1A 3L2RA 2IDOA 1NJZA 4Z4HA 2QK9A 3C6UA 1ZBLA 3EYZA 4KHYA 4DWIA 4B9NA 3H08A 4QOZB 5JS2A 4FW1A 4FJKA 3L8BA 1IKVA 2IOCA 2YNGA 4N5SA 4XIUA 4JLHA 4CIFA 4RW7A 5J2NA 4RW8A 1D9FA 4FJNA 3K58A 1QSYA 1U45A 2Z1JA 3S3NA 2PYLA 4W5NA 1JKHA 1C6VA 2HHXA 5KI6A 3RWUA 4CJRA 3QESA 4Q0BA 3V81A 4CJUA 4KREA 1JLCA 4MQ3A 1RT1A 1VSJA 1IKXA 1HYZA 4BE1A 4ICLA 5FRNA 1XI1A 2YNHA 4B9LA 3JSMA 3KLIA 3OYMA 2E6MA 1X9WA 2OZSA 3V9WA 5I3UA 1IG9A 3CFRA 2OA8A 1CXUA 5CZ1A 1KFDA 3HT3A 4CJKA 3U6FA 4B9UA 3VQ6A 4CGHA 4CGJA 4O0IA 1J54A 3A2FA 1JLEA 3OYGA 4CEBA 4BDZA 4HCBA 5HRRA 4CE9A 4OLBA 4FK2A 1NK5A 1NJXA 1HYSA 4FM2A 1J5OA 4F2SA 1LW2A 4DSEA 2G8WA 1RTJA 4I2PA 4ZTFA 4F3TA 3KLEA 4RW9A 1B92A 1D5AA 2JLEA 2YKNA 2ETJA 2G8VA 4H4MA 4AHSA 4Z4CA 4R5PA 4CF0A 3K5OA 4CEEA 4I9LA 2XHBA 4N41A 5C25A 3DLHA 4CEFA 3S3MA 4FZXC 3T1AA 3V9XA 4CEAA 1VSIA 2OPRA 1S6PA 4CECA 4CK1A 4KI4A 4O5BA 2QKKA 3CM5A 3MXIA 3PY8A 2LSNA 3RMAA 2NUBA 3KLGA 4CFDA 3SUPA 4CGGA 4FJHA 2B5JA 3LPUA 1SL0A 3U3GA 1NK8A 1LWFA 1BQMA 3NCIA 4OJRA 1IKWA 1L3SA 4FJLA 5HRNA 2JGUA 4CFAA 1S9GA 5T7BA 4FLZA 4N56A 4JS5A 3SCXA 1RBUA 2OYQA 2YV0X 1CZ9A 4FVMA 1WSJA 3RMBA 1I3AA 1XHZA 1WNSA 5HRSA 3AVGA 3OS2A 2RPIA 4AHVA 1T8EA 3U3YA 1JLGA 1GOBA 1EETA 1IH7A 3QEPA 1BCOA 3HO1A 4CF1A 4Z4GA 3DOKA 3OYFA 3K5MA 2E6LA 1D8YA 3AVAA 4CJPA 1DTTA 4AHRA 3NHGA 1UAXA 1MU2A 3I0SA 4CK2A 2FBYA 3DMJA 1Q9YA 2HNDA 4B9TA 1S6QA 1VSEA 3FFIA 3KIOA 4J2AA 4I2QA 1RILA 3WNHA 1BI4A 2Z1GA 3DRSA 1GOCA 4IDKA 4E7KA 3QNOA 2EHGA 4DSLA 1S1WA 2HNYA 3AVKA 3ZCMA 4CJ3A 4ELVA 3S3OA 4PQUA 3ULDA 3TAGA 1EXQA 4CEOA 1ASVA 5CYQA 4BE2A 3B6OA 3DLBA 1TL1A 1RBTA 3OYBA 4E7HA 4FLTA 3TAEA 1RT7A 1UA1A 5KGXA 3VA0A 4ELUA 4DSIA 4FZZA 2HHUA 3AO1A 2Q3SA 4IG3A 3MAQA 4HUEA 5SZTA 1L3TA 3NH2A 3QIOA 2VWJA 4LSNA 1TV6A 4IBNA 3QEXA 4OKJA 4B3OA 5KRSA 3KD5E 1T03A 4CJQA 1YTUA 3CQ8A 3TWHA 3S9HA 1N5YA 3OYDA 4O4GA 4B8CA 2F8SA 4M3TA 4DTJA 3BDPA 1JXBA 3RRGA 1K6YA 2X6SA 4Y1CA 1KRPA 1C0MA 1LW0A 3VQQA 1QS4A 1L5UA 4DQPA 4DSKA 1ASWA 3HL8A 3C94A 3V1QA 4CJ5A 4DU1A 4GVMA 2XY6A 3AVLA 4KO0A 3DYAA 4NYFA 4HVJA 2IS3A 1RCHA 3LAKA 3SI6A 2G8HA 4O0JA 1VSHA 3VN5A 4CJWA 3NGZA 1DLOA 4DQSA 3SUNA 2OZMA 3PX0A 3M8SA 1U4BA 4KKOA 4YFUA 4N76A 5J1EA 2AJQA 2A1SA 3VQPA 3L2VA 2R7YA 4DTMA 4KHNA 1BL3A 3PX6A 4Z4IA 1CZBA 4CFCA 3QETA 5HRPA 3C6TA 1N6QA 2OPSA 5EU7A 4HTUA 4DSFA 1SL1A 3UIQA 1WN7A 3OYEA 1HJRA 2ZQBA 3ISNC 3CFPA 4F8RA 3MXMA 2ZE2A 4C8OA 2ATQA 3V9UA 1CXQA 3L3UA 4OVLA 3MXJA 4KPYA 2G8KA 2VWKA 4OLAA 3SV4A 4CGFA 1JXEA 4ZHRA 2HHSA 3DRRA 3LPTA 4M45A 2QXFA 2Z1IA 4RW6A 4AILC 1D9DA 2RKIA 1HPZA 3MEEA 3NGYA 1RNHA 1QSSA 3LZIA 3EZ5A 3SUOA 3TARA 1KCFA 3K57A 4L8RB 1F21A 4CEQA 2XY5A 3G0ZA 4DFMA 4C8LA 3QLHA 2P1JA 1HQUA 1QSLA 1VSLA 1HYVA 1RT2A 2HHVA 4DTUA 4KRFA 3K5LA 3LWLA 4GMJB 4HUFA 3V9SA 4J2DA 3AVNA 3ZSZA 1VSKA 1HMVA 3DLRA 3IS9A 4CERA 3SPYA 1RT6A 3TAFA 1Z26A 2X74A 3VQCA 1U47A 1Z25A 2OPQA 1TKXA 3IRXA 3LWMA 2D0BA 3K5NA 3SUQA 1NOYA 4EZ6A 4FJ7A 4CJFA 3ZT1A 1NKBA 2XO7A 1LV5A 3HPOA 4ZTJA 4KHSA 2HVIA 4UQGA 4KB0A 3SYZA 4CIGA 3G10A 1NJYA 1YTAA 1TKDA 1I39A 1VSDA 1W0HA 1QTMA 4IG0A 1DTQA 4CGIA 4OKKA 1S1VA 4FJJA 1RDAA 2YHAA 4I7FA 3AVHA 1KLMA 1WSHA 3O3GA 4DQQA 2E4LA 3M8PA 4FLVA 2D0AA 4KB1A 4M3WA 3M8QA 3SQ4A 1W9HA 3AA2A 3T3FA 1BCMA 4BDPA 4PY5A 5HROA 1Q8IA 1ASUA 4FM1A 1UOCA 3VA3A 4CJSA 1BQNA 1SKWA 1TK0A 2D0CA 1RBVA 4FCYA 1A5XA 1JL1A 2DFEA 4QAGA 5SWMA 2X78A 3V1RA 3VQ4A 4DS5A 1RDDA 1S9EA 4W5QA 3AVJA
chains in the Genus database with same CATH superfamily
2QKBA 2GX9A 4WQ4C 5J2QA 5C2DA 4R79A 4DF4A 3LDOA 2DFHA 2FSNA 4Q5VA 2W6LA 1T7PA 3A5MC 3ZT0A 4HHTA 1SAZA 4FWNA 3O9SA 4N47A 4EAHD 1J9AA 1OKJA 2FC0A 2O8BA 3BZKA 2FSKA 3SBTA 3TAMA 1K8KA 4H8KA 5AQSA 3AVCA 4C8KA 2FF3B 2I5JA 3BGRA 3MMVA 4BC5A 4MLHA 1J53A 1REVA 3MCPA 2A40A 3CJAA 1JJ2M 1GLCG 1LAVA 4FLXA 3DOLA 3FZLA 5M1NA 1NGBA 1G15A 2B6AA 1OVYA 1NK7A 4IFYA 1RDBA 3OYAA 1KLNA 4LF7K 5AQWA 4B1YB 3NAEA 3P39A 4LF4K 2OANA 4NCGA 3C6AA 5F1XA 4B9MA 3P4IA 1TK8A 1VQ7N 2VGNA 1IO2A 4KH4A 5BRDA 1YF5L 4Z4FA 4ISEA 4GW6A 1U04A 3SQ1A 1RT5A 3CCVN 1IV0A 3SPZA 4Z4EA 4CVNE 3Q7CA 4BR9A 3PX4A 4M3UA 3R1XA 3ZT3A 3OVNA 1LWCA 4BWMA 3KK3A 2VG7A 4E7IA 3VERA 4KFBA 2F8TA 3ZSWA 2V52B 3QNNA 2Q31A 1E4GT 4DR3K 3C95A 5BR9A 1P90A 5J2MA 1N36K 5CR4A 4KHWA 1HKCA 3HVRA 4BRQA 1NK4A 4CW7B 4PKIA 3TTDA 4I6MB 3HPGA 3CQXA 3PO4A 3T19A 3RMDA 4FL9A 1IBMK 4FLWA 2P5GA 2O4GA 2CH6A 4DTRA 3CJCA 3U8XA 4B9VA 3CPEA 3WXKA 3HP6A 4IFEA 3GL1A 3O1BA 4CCHA 1FJGK 3LDNA 4FK4A 2YJFA 3K59A 4IKFA 4DR2K 2HHWA 3CMEN 2D5RA 3MX5A 4JI2K 3ZT4A 3VEWA 5AQTA 4FK0A 3N4PA 2G8FA 4DUYK 1XNRK 1LCUA 3SV3A 4E7LA 1QVGM 4IEIA 2FSJA 4RWTA 2VQFK 3LM2A 4MFBA 4WFBL 3DJCA 4ID5A 3UKUA 4ILGB 3L2WA 4FWMA 4W5TA 3HM8A 3CM6A 2XY7A 4CF8A 1NK6A 1OVQA 4NB4A 4CFBA 1Q9XA 4FWLA 1B9DA 1XQSC 5HOOA 3O4QA 1XC9A 4WQ5C 3HK2A 4CBWA 4GKKK 4M42A 4YNQA 3PUFA 1RBRA 3KKRA 3OYHA 3PV8A 2JWLA 2PAVA 1GLDG 4J8FA 3M6GA 4M3ZA 5LY3A 4RCHA 4FZYA 3S41A 1NOZA 3NBPA 1HKBA 2FXUA 4BWJA 4BR5A 3I8DA 1NGDA 3QMLA 3KLHA 1KTQA 5AQUA 2Q36A 3MECA 1ZBUA 3J7YP 4CHPA 2NRXA 2NRVA 1O13A 5AJ3K 3RR8A 3AO5A 2D0PA 2KTQA 3CCRN 2NRHA 4FJ5A 3O9RA 4DB3A 4LSLA 5C24A 2Y1JA 4CK3A 2WOMA 4CF2A 1HPMA 1Q82O 3RTVA 3F2KA 4DLGA 3F73A 4AH9A 4LF9K 4JEPA 3AO2A 4CEDA 2E2PA 3SAHA 2P5OA 2O8FA 2IAJA 1HKGA 3K9JA 2GUIA 4JAXA 3SJHA 4JI4K 1HLUA 2GTDA 4M3RA 4CHYA 3ZSQA 1C0TA 2ZJPL 4LFCK 3HJFA 3IDHA 2FF6A 4E7JA 3GOIA 3KLFA 1SV5A 4DCHA 4FJXA 3P83D 2HMPA 4BE0A 4FLYA 4K8ZA 2HBLA 2V7ZA 3EE9A 3KJVA 4NCAA 3HRGA 3OY9A 2UXDK 3O8MA 2OPPA 4FM0A 3OYJA 4IWVA 1KVCA 2QA4N 2QWNA 2VQEK 1NJZA 4Z4HA 3BEXA 4DWIA 3H08A 3CCQN 3CJ7A 4QOZB 3O9TA 4KH5A 2QWMA 2E8AA 4JLHA 3FR0A 4FJNA 4OO1J 3K58A 2ZWHA 3I33A 2PYLA 3DLLL 3IUCA 1JKHA 1Q7YO 1ATNA 3QESA 1QZ5A 3O9QA 1JLCA 3N4QA 5FRNA 2YNHA 2E6MA 3CC7N 3V9WA 4JN4A 2OZSA 3CFRA 5AZJB 5CZ1A 3U6FA 2NRTA 3OYGA 1JLEA 4FO0A 1HYSA 4FM2A 1NMNA 1LW2A 2G8WA 4I2PA 4ZTFA 4F3TA 4RW9A 1B92A 4H03B 2YKNA 2G8VA 4H4MA 5FPMA 4DR1K 3EN9A 4CF0A 2HSTA 4I9LA 3S3MA 5F2RA 4IO8A 1VSIA 4KI4A 4B3RK 4JKBA 4JKAA 3MXIA 3PY8A 4DR5K 2OTLN 3KLGA 4CFDA 3SUPA 4UY8O 1NK8A 4OJRA 4PL8A 5T7BA 1RBUA 5AQIA 1CZ9A 2UYTA 4DV5K 3AVGA 3OS2A 4DV3K 1EETA 4OPAA 2IVNA 1BCOA 3K5MA 1X9JA 1SQKA 4FPBA 3AVAA 1ZC6A 3CI5A 4B3SK 3I0SA 1GLBG 1NGCA 3DMJA 1Q9YA 4B9TA 3FFIA 3SAGA 1VQ5N 3WNHA 1BI4A 2Z1GA 3DRSA 3G4SN 4E7KA 2EHGA 2GWKA 5CHIA 3E9OA 3S3OA 3ULDA 3TAGA 1ASVA 4ILJA 2HF4A 3B6OA 3DLBA 1W97L 3OYBA 5AQRA 4DSIA 4FZZA 3VA0A 2HHUA 4HUEA 2Q3SA 3MAQA 5SZTA 1L3TA 5ADXH 3QIOA 4IZ9A 3CXCM 4GY2B 1W7AA 1HUXA 3QEXA 3BF3A 3U9DA 1BU6O 1T03A 3KD5E 3CQ8A 4O4GA 5C10A 3I56N 3BDPA 1K6YA 3GE1A 1JCEA 3AGKA 1ASWA 1N8RO 4JI3K 2XY6A 4HVJA 4NYFA 5AQOA 3LAKA 3WQUA 3QFUA 5H1SQ 5KQDA 3PX0A 4NO7A 3T1HK 4JI6K 4X65K 4JHDA 4BRAA 4N76A 2AJQA 2A1SA 2R7YA 1DEJA 4DTMA 4KHNA 1BL3A 4KBOA 4XH4A 2V51B 1WN7A 2I7NA 1HJRA 3ISNC 2CGJA 4C8OA 3L3UA 4BGAA 4KPYA 2VWKA 4LF6K 4EHTA 3VESA 4ZHRA 1E4FT 4AILC 2P9LA 2Z1IA 1QSSA 3EZ5A 2P9IA 3SUOA 4BRGA 1KCFA 3K57A 1K8AO 2XY5A 2VWBA 3A5NC 1K73O 4DFMA 4C8LA 4K0KK 3QLHA 2P1JA 1RT2A 4KRFA 3CJ9A 3V9SA 3AVNA 3DLRA 3SPYA 1Z26A 1Z25A 2OPQA 1TKXA 3K5NA 4DR6K 5C12A 3ZT1A 1NKBA 3DXMB 1LV5A 4ZTJA 3GBTA 2HVIA 2HBMA 1XUPO 1NM1A 3OW2M 4YDUC 4WQ4A 1I39A 1T6CA 4FJJA 3D2EA 3WEEA 4WFAL 2YHAA 2QI2A 4L3QA 1KLMA 5DM6L 4DQQA 4BDPA 2QTDA 2QWRA 4JI1K 4CJSA 3VA3A 1TK0A 4C1NK 4FCYA 3H45C 2X78A 3AVJA 4H0PA 1XWLA 5C2FA 4A61A 1GLEG 1NWKA 1HX1A 2F96A 3AVFA 1NGAA 4FOIA 1BUPA 4E3SA 4FYDA 1VRTA 4AHUA 3DI6A 3JS6A 3K2PA 5KRTA 1XC3A 2UUBK 1JLQA 4BR4A 1NKCA 4V19S 2IVOA 4U67L 2CGLA 5JLFA 3CFOA 1C1BA 2I7PA 4DFPA 1GOAA 3LP1A 3J80O 1R59O 1P8ZA 4BGBA 2RE2A 4K43A 2PYJA 1YVUA 4NYNA 3IAYA 5EX5A 5M1OA 3SK3A 4BRLA 2HBKA 2IGIA 4DTOA 3FFKB 3L2UA 1NGFA 3OTOK 3GDQA 3O3HA 1O1WA 4IXCA 3VEVA 1C0UA 5C0YA 4DTXA 5CY4A 3SZ2A 3NH0A 1SZ2A 4ILHA 3TAPA 3H1QA 1TYQA 3EL2A 3EY1A 3I8BA 5FDLA 1OH5A 4PKGA 3ZSVA 4FXDA 3THXB 3EO3A 2P9NB 3F5TA 1YT3A 3VQ9A 4M3YA 1M90O 1ZBFA 2CH5A 4LH5A 4M41A 4B9SA 2KFNA 1DKGD 4DQIA 1LWEA 1RDCA 4F9OA 1W2BM 3NE6A 4QS9A 1TUUA 1KXPA 3P5JA 3OJSA 3VF2A 4DU4A 5E26A 4CF9A 1ZBHA 3MN9A 4H5TA 5FPNA 3OA9A 1X9SA 3VQ8A 4K41A 3WQTA 5I42A 3ZX3A 1VQMN 4CHZA 4G9ZA 4FWSA 4CGDA 3TPQA 1NK0A 5EXWA 3E01A 1RT4A 3BP8A 4ISFA 5AQGA 3L2QA 4FJMA 5AQNA 5LL6Z 3MN7A 4GNIA 3LZJA 2HOEA 4KHUA 1U48A 4TSXA 2D1KA 3KK1A 1CLQA 1GLAG 5GAGP 3NFAA 3HPHA 3QBWA 1NJWA 4JKFA 3QEIA 3W3DA 1S72N 4WQ5A 3JYTA 2E2OA 1WBBA 3AA4A 3ASMA 4GV3A 4CHNA 4O55A 2A3ZA 3DRPA 2O8EB 3VENA 3AO4A 4CJVA 2BDPA 3V1OA 4F3OA 3P1GA 3ZSRA 2FBVA 4QCLA 4IOCL 1WSGA 4KI6A 2ZD1A 3B8AX 3AV9A 4O8UA 2B4JA 3L4IA 4IJNA 1U6ZA 3OYIA 2O4IA 2Z1HA 3VGMA 4F4KA 1RFQA 1FKOA 1ZYQA 3LDPA 4PKHA 2WFBA 4BVPA 5HLFA 4KV8A 1KQSM 4H5VA 4HCCA 5JICA 1TGOA 2G8IA 1HNWK 3DXKB 4DV4K 1BHLA 3O4WA 1UWBA 4Y1DA 1HRHA 2AP1A 4B1VA 3D45A 1B9FA 1TKZA 3RR7A 1RT3A 3HBTA 1GLJO 4BC2A 4ID1A 5CZ2A 2WONA 1OH8A 3CYMA 1SL2A 1IJJA 1LAWA 3THXA 5KQ8A 2QEXN 1RDWX 3QICA 5D3GA 2GELA 3F9KA 3AVBA 3UE5A 2PBDA 2NRRA 3O5BA 1EP4A 1MWKA 1QQCA 3CCUN 2G8UA 3OS0A 5I9EB 1G99A 3ZETB 2Y1IA 3D7EO 4DLEA 3LL3A 5BRFA 4DTPA 1FK9A 1SUQA 3OYLA 4CJ7A 3UB5A 2O8DB 3G71N 4F2RA 2VGMA 1BDGA 3HYFA 2WTUA 1BG3A 3B6PA 1JL2A 4X66K 2PZSA 3AO3A 1TL3A 4WFNL 5JMVA 3AA3A 3E9LA 4BRDA 1WSIA 4JKGA 5AQYA 3CCSN 1VQ9N 2UUAK 2IDOA 2E1YA 3K0SA 4IO9L 4B9NA 4Z94A 5JS2A 4FW1A 3H3OB 3L8BA 2IOCA 4N5SA 3D2FA 4CIFA 4RW7A 4B1WB 2Z1JA 3S3NA 4W5NA 4B9QA 4AF1A 5KI6A 3FZMA 3C0BA 4GKJK 3EZWA 3V81A 2O8EA 4B1UB 1VSJA 1HYZA 2UUCK 4ICLA 2JWKA 1X9WA 3AY9A 4B3TK 5I3UA 1IG9A 1KFDA 3OBWA 3VQ6A 3A2FA 4BDZA 3KWGA 1MWMA 5HRRA 4CE9A 4OLBA 1NJXA 2F9TA 4F2SA 4DSEA 1QVFM 1RTJA 3KLEA 1NGJA 1JCGA 4AHSA 3K5OA 4CEEA 4N41A 1U2VB 4PHTX 4CEFA 4CZLA 3T1AA 5C15A 5ELZA 3V9XA 4CEAA 2OPRA 1ZBIA 2O8CB 1BOTO 4O5BA 2QKKA 3CM5A 4DV2K 2LSNA 5AFUH 4LFBK 4CZHA 4CGGA 4FJHA 4O8KA 1SL0A 3U3GA 3VMFB 4H0XB 2JGUA 4FLZA 3SCXA 2OYQA 1N33K 3WXJA 1XHZA 1WNSA 5HRSA 2RPIA 1VQ8N 1JLGA 2BH1A 2BTFA 3HO1A 2ASMA 4AHRA 3J7ZO 3BF1A 3HTVA 3VF6A 4H0YB 3ZETA 2PFUA 4BG8A 4DV7K 2WBNA 2OCEA 4PL7A 3QNOA 4DSLA 1S1WA 4ELVA 3ZCMA 1EXQA 2QW9A 1S22A 5EY4A 4YOWA 4FLTA 4ELUA 5KGXA 4I6MA 3QB0A 4A5AA 5KRSA 3L6QA 1E3MA 2P9KB 3S9HA 3OYDA 3RSEB 3CMAN 3TTFA 1JXBA 2CGKA 3RRGA 5ADXA 3VQQA 1LW0A 2P9UB 4DQPA 3MX2A 4IDHA 4GVMA 4KO0A 5M1QA 3NGZA 5AQKA 1DLOA 3M8SA 1U4BA 5J1EA 1Q86O 3MK6A 3CIPA 3HOTA 2F4VK 2VYPA 1CZBA 4CFCA 3QETA 5HRPA 3C6TA 1N6QA 2OPSA 5EU7A 3PIOL 4DSFA 2ZM6K 5GAHP 3CC2N 2HF3A 2VCPA 3G25A 3F9MA 3MXJA 4OLAA 5M1KA 4YOVA 4CGFA 3SV4A 2HHSA 2AA4A 3AAQA 4M45A 4BC4A 1K9MO 1D9DA 5LJVA 1HPZA 3NGYA 1YJNN 4DV1K 1F21A 4YDUA 4CZEA 1HQUA 1QSLA 1VSLA 3FLCO 3THWB 5M1PA 3LWLA 4GMJB 3HZ6A 1HMVA 2NRZA 3CD6N 2O8CA 3J7AP 1EO1A 4BQZA 4KB0A 1NOYA 2D0BA 2NLXA 4ISGA 4U7BA 3MN5A 2XO7A 2NNWA 4CZMA 4BY9C 4CIGA 3G10A 4CGIA 4BRIA 1S1VA 4JKEA 4AQYK 1RDAA 2ZF5O 1NNEA 1WSHA 3M8PA 4M3WA 1EWRA 3M8QA 4EIAA 3T3FA 1ZBSA 1SKWA 1VQKN 3W0LA 3VQ4A 1RDDA 3EYZA 1XMOK 2EX3A 3HSCA 4PWDA 4EP4A 1TAUA 3RRHA 5KTQA 1Z6RA 4FWPA 4MDAA 5BR8K 2YKMA 3WNFA 1KAXA 2HHHK 3VPZA 1Z05A 1UA0A 3NGIA 1BO5O 4JI7K 1YVNA 4O5FA 2P9KA 5AQJA 3H1VX 5FRMA 3OJUA 1Q81O 5DMRA 3RSEA 4A2BA 4KAZA 3SJJA 3ZSYA 2HHQA 4G1QA 3THVA 3E9PA 2ITGA 2W40A 1QQNA 3VQ5A 1T3VA 3NF9A 1YIJN 5AQMA 2FBXA 4WCEL 5KGWA 1HNIA 4KH6A 5CYMA 2YHBA 1A5WA 4DSJA 5KPZA 4CD3A 4DR7K 1KSPA 4PUOA 4YOUA 1GLFO 2X6NA 2PY5A 5LJWA 1YJ9N 5M1FA 1IBLK 4AM6A 5AZIB 3NH1A 4C8NA 1NG9A 3ZYYX 1BA1A 3ZT2A 2KHOA 1YUWA 5J2PA 3ID8A 5FLXO 4DG1A 3KK7A 2KQ2A 2A1RA 1J6ZA 1SKSA 1ZXOA 4CJ4A 5C42A 2ZJRL 2WC9A 4A62A 3THWA 2YNIA 2A41A 3VQDA 2KW4A 5AQQA 5AZJA 4B1XB 3PO5A 1BA0A 1C0FA 3THYB 1WSEA 4CJEA 3NF7A 2HVHA 2FLOA 1Y97A 5HBMA 1TKTA 4BRHA 4CJLA 1VK0A 1I94K 3HSTB 3WT0A 3ATUA 5JS1A 4BQLA 1KD1O 2BGGA 5JVGL 4Z0UA 4JS4A 4CJTA 3H6EA 1YITN 3LDLA 5AQXA 4MLEA 2XY8A 1SS6A 4CEZA 2FBTA 4NLBA 2ITMA 4DF8A 1QQMA 2KZZA 3OS1A 1VSMA 2P51A 2H3GX 3LDSA 4H0VB 1NGGA 1NGIA 5HP1A 3NF8A 3LALA 2GV9A 4JKDA 1RGIA 3AGRA 2W6KA 3LDQA 3IFRA 4BACA 3QEVA 3IKMA 1IG8A 3KTQA 4DQ8A 1MDUB 3RVCA 1KVAA 3L3VA 2GEMA 2E88A 3O4NA 4Y0WA 4FLUA 4W5OA 3CG7A 3LP3A 3AVIA 3ID6A 1BIZA 4IFVA 3KD1E 4AHTA 3FE1A 3H46O 4O44A 4B1ZA 3D0PA 1RBSA 4JK7A 1TVRA 4H5WA 4JNEA 4I9QA 3LAMA 4OGEA 4BRMA 4ELTA 2HHTA 1A5VA 1EKEA 3ZSXA 3KWIA 3KZBA 3MWTA 4MO4A 1GLLO 3ZX2A 3OYCA 3HOSA 3PSFA 5AZIA 4K25A 4BG9A 4M7XA 1NU0A 3OYNA 4M3XA 1ITGA 2E1ZA 3HP9A 3VQEA 1HQEA 4XH1A 1YJWN 1FW6A 5A2QO 3FZKA 3NVMA 3ITHA 3SNNA 4CD1A 4DTNA 4FJGA 4FSVA 3NDKA 1QHTA 1QE1A 1S1XA 4KTZA 4DS4A 1KFSA 5AQZA 1X1PA 4EZ9A 3TSPA 3THYA 3TTCA 3KK2A 3G6EN 2E2QA 1VSFA 1JLBA 1K8KB 4BR2A 4FJ8A 3DLEA 4HTLA 4K42A 1FKPA 4C23A 4E19A 4K8XA 4RG8A 1NBWA 2HW3A 1YAGA 1LOTB 1J5EK 1EX4A 1RTHA 4LH4A 1KC8O 3IG1A 3EKSA 3DXMA 1S1UA 1SKRA 1DGKN 3LP0A 3KKSA 3VETA 2XRIA 3VEXA 4J2EA 1RTIA 1QZ6A 4OKEA 3QFPA 4A2AA 3C6UA 3R8EA 2ZJQL 1T44A 3EEQA 3A8YA 3R6MA 3TSUA 2YNGA 4XIUA 4FPAA 1D9FA 5J2NA 2YCHA 4RW8A 3VGKA 2HHXA 3FZFA 3ENBA 4CJUA 4MQ3A 1RDUA 1RT1A 1IKXA 4BC3A 1XI1A 4H0TB 3OYMA 4GVEA 2OA8A 1CXUA 1C0GA 4CJKA 4CGJA 1VQNN 4FK2A 1NK5A 1J5OA 1NMDA 1Y64A 4BRCA 3M5RA 4M7YA 1EQYA 1ESVA 4Z4CA 4DHYA 4R5PA 4MDBA 3DLHA 3CETA 2F9WA 3CCEN 3VOVA 4CECA 4CK1A 5BPMA 3JAMO 1HNZK 3O08A 2B5JA 2EWSA 1LWFA 1BQMA 3O80A 3NCIA 1L3SA 4LF5K 5JLHA 4CFAA 1S9GA 5AFUA 4N56A 3DWLA 4JS5A 2A42A 2YV0X 4CZGA 3CC4N 3O6WA 3R3LA 4AHVA 1T8EA 3U3YA 1GOBA 2W41A 5BPLA 3CCMN 3QEPA 4CF1A 4Z4GA 4X62K 2E6LA 3UKUB 4CJPA 1UAXA 3CF5L 5AQHA 2UXCK 1MU2A 2NZTA 2E20A 3ZLJA 5EOYA 4FWQA 4I2QA 3QDKA 4FWKA 3R9PA 4JKCA 4IOXA 4PQUA 2P9NA 2QWLA 1ATRA 4BE2A 3E1YA 1TL1A 1RBTA 1UA1A 4JD2B 3AO1A 3K9KA 3T69A 4LFAK 2VWJA 4LSNA 1TV6A 4BR0A 4IBNA 2GUPA 2A5XA 1YTUA 2F8SA 4M3TA 4DTJA 1L5UA 4DSKA 3HL8A 2ZGZA 3AVLA 3SI6A 4JK8A 3SMSA 4O0JA 4CJWA 3SUNA 4DV6K 2QWPA 4FVUA 3VQPA 4Z4IA 4C1NI 3O9UA 4HTUA 3H3NO 3VTIA 1SL1A 5BN9A 2ZQBA 4F8RA 2ZE2A 2QM1A 1CXQA 2G8KA 1X3NA 1JXEA 3DRRA 4RW6A 2RKIA 2BUPA 3LZIA 2O8FB 4CEQA 4YOXA 3G0ZA 5GAEP 3BUZB 1HYVA 5GINA 4DTUA 3WUHA 1IBKK 4J2DA 3ZSZA 4CERA 3IS9A 1U47A 3VQCA 3IRXA 3BZCA 3LWMA 1OH6A 4CJFA 3KHYA 4DR4K 4BVOA 1OH7A 3HPOA 4KHSA 3SYZA 2GWJA 1NJYA 1VSDA 1W0HA 4IG0A 1DTQA 4OKKA 3PSIA 3AVHA 4I7FA 1V4SA 2HBJA 3BY5A 4CI6A 4PY5A 5HROA 1ASUA 3DXKA 5DM7L 5SWMA 4QAGA 3V1RA 4DS5A 4LC9B 1YI2N 3VF4A 4YOTA 1L3VA 3DLGA 4FJIA 2DFFA 1R0AA 3NF6A 4KTWA 3AAPA 1T05A 1S1TA 3HVTA 4XH5A 2UXBK 3SQ0A 2KZMA 4OPJA 5BRHA 4JKHA 4JD2A 5BN8A 1X9MA 1BISA 3MEDA 5GADP 1CZAN 1IKYA 2BANA 3O1WA 4EFHA 1WSFA 1ATSA 2HNZA 5K14A 3A5OC 3UKRB 4NLCA 3VEOA 2O8DA 4YOYA 4BREA 1XHXA 3TSQA 2YNFA 1KVBA 4YORA 3TABA 3C65A 5CE3A 4E1NA 2KKZA 3TAQA 4CBUA 3IMXA 3HM9A 1JLAA 5E84A 3VQ7A 4FJ9A 3QERA 2QWQA 4B08A 1L3UA 3SAFA 4KHQA 2BE2A 4CESA 3WXIA 4CHQA 3ALYA 5EVZA 1WUAA 1NGHA 1C1AA 1QHAA 1HNXK 3M8RA 2VG6A 4AHCA 3P38A 4E1MA 4A5BA 3E66A 4DFKA 1BI4B 3AA5X 2D0OA 4JI8K 4A59A 1BGXT 3QINA 3WNEA 2KLAA 4GV6A 3AARA 3J8AA 3L0QA 4WF9L 4BDYA 4HUGA 3DLKA 3QBXA 4DTSA 2A6AA 2ZGYA 4BR7A 1XMQK 1NK9A 2ASOA 3T7ZA 1V4TA 3EE8A 4CZJA 1YXQA 5LMNK 1ILYA 1VQ6N 3U4LA 4W5RA 4BRNA 1TAQA 4DMNA 1U2VA 1NKEA 2DTUA 5AQVA 3QO9A 4NCBA 2QWOA 4QS7A 1Q18A 4DFJA 4E89A 4OGCA 3RMCA 4FW2A 3I0RA 4B3MK 4JI0K 4JHDB 5GIOA 3V9ZA 1NLVA 3CCJN 4DQRA 4B8AB 3WXLA 3HXMA 2HMIA 1EWQA 4OPKA 1WLJA 2KFZA 2VG5A 3LANA 1D4XA 3TANA 4DU3A 1TK5A 1U49A 3TR8A 3VTHA 2F7TA 2P9LB 4IEEA 4JRQA 2P9IB 3CQYA 3ZEUB 4PA1A 2IC3A 1BIUA 3UKRA 4DKWA 3OBYA 3TI0A 1YHQN 2Q1NA 5E41A 4H4OA 3CHWA 2RHKA 4CIEA 3JXUA 1HNVA 3WNGA 4CZKA 3I55N 3VEYA 1RTDA 3D2EB 2HB5A 3WEEB 3ZSOA 5KPRA 3O3FA 5LMUK 2ASPA 5FROA 2YHYA 2P9UA 4GV9A 3QIPA 4AM7A 4JRPA 1VAZA 1C1CA 3MEGA 4NXNK 4KHPK 1VQLN 1VQ4N 4J2BA 2W42A 3AVMA 3VQAA 4LY7A 1M1KO 5MLCQ 1BWFO 2DY4A 1QQOA 2RF2A 4RTFD 2RN2A 4XEIA 4CHOA 1T6DA 3VQBA 3DM2A 4FOEA 2Q97A 1WAFA 3V6DA 5DK5A 3VEZA 1S5JA 1WAJA 4JV5K 2QXLA 1KAZA 1S3XA 4E1JA 3QEWA 5TKYA 4E0DA 4C8MA 4MO5A 1FXXA 5AR0A 4LD0A 2GBZA 3SQ2A 4LF8K 3EKUA 2E2NA 3OYKA 1JLFA 4RW4A 3OHRA 3V4IA 2P9SB 3CJ1A 3MDQA 2DPNA 1MA9B 2YHWA 3NVKA 4EP5A 3LP2A 3WXMB 1VRUA 4WE1A 1JCFA 3CJBA 3L2RA 2QK9A 3ZX0A 1ZBLA 5IWAK 4KHYA 1VQPN 4BROA 2YX6A 3L4QA 1X3MA 5TKWA 4OPHA 3P31A 4FJKA 1IKVA 2D4WA 1QSYA 4NXMK 1U45A 2NRWA 3ZEUA 1C6VA 3RWUA 2YJEA 4CJRA 1HR0K 4Q0BA 4FWOA 1TYQB 5JVHL 4KREA 3MN6A 4BE1A 3C7NB 4B9LA 3JSMA 3KLIA 3FGUA 4B9UA 1NGEA 3HT3A 4CGHA 4O0IA 1J54A 4CEBA 4H0OA 3NMUA 4HCBA 3LM9A 4H5RA 4H5NA 3PIPL 2J4RA 2JLEA 1D5AA 2ETJA 2P9PB 5FPDA 2XHBA 5C25A 3FZHA 4FZXC 3DAWA 1S6PA 4A57A 3RMAA 2NUBA 3LPUA 3GG4A 4JI5K 1H1VA 1IKWA 3U9ZA 5HRNA 4FJLA 1HJOA 4FVMA 1WSJA 3RMBA 1I3AA 3ULEB 2YI1A 4FWRA 1IH7A 4EHUA 5F0XA 3PLAA 3DOKA 3OYFA 1D8YA 4X64K 4JYAK 4IJAA 1DTTA 3TU5A 3NHGA 4CK2A 2FBYA 4J2AA 2HNDA 1S6QA 1VSEA 3KIOA 1RILA 1GOCA 4IDKA 3J81O 3AVKA 2HNYA 4CJ3A 1VQON 4YHHK 4CEOA 5FPEA 2O8BB 5CYQA 2Q0UA 3CCLN 3Q7BA 2OTJN 2P9SA 4E7HA 4KTQA 3TAEA 1RT7A 3KVGA 3A0IX 3SBGA 4IG3A 3NH2A 3CPWM 4BRFA 4OKJA 4B3OA 4BRKA 4CJQA 1N5YA 3TWHA 4B8CA 3M1FA 3ENOA 3A5LC 2X6SA 4Y1CA 3ENHA 1KRPA 1C0MA 5AQLA 1QS4A 5AQFA 3V1QA 3C94A 1TUYA 3MWPA 4CJ5A 4WYBA 4YY3K 4DU1A 1N32K 3DYAA 2IS3A 1RCHA 5AQPA 4HWIA 2G8HA 3VN5A 1VSHA 2OZMA 4DQSA 5HL7L 4KKOA 4DV0K 4YFUA 5BPNA 3L2VA 3MCAB 3PX6A 1KAYA 3SLCA 3T1YK 3M3ZA 3C6HA 3C7NA 3UIQA 3OYEA 2YHXA 1N34K 3MXMA 2ATQA 3V9UA 4OVLA 3VGLA 2Q2RA 4M63C 4BRPA 4CZFA 3LPTA 3CERA 2QXFA 3MEEA 5B8HA 1RNHA 4OX9K 3TARA 4IOAL 4L8RB 1WBDA 1NJIO 5BREA 3HI0A 2P9PA 5IT9O 2HHVA 3SMPA 3K5LA 4HUFA 2E5LK 1VSKA 3D6RA 4CZIA 1RT6A 3TAFA 2X74A 4JK9A 4EZ6A 4FJ7A 3SUQA 1WOQA 1DT9A 2Q0RA 2IVPA 4UQGA 4CBXA 1QTMA 1YTAA 2V7YA 1TKDA 4QS8A 4JKGB 5KPTA 3O3GA 2WUSA 2E4LA 4FLVA 4KB1A 2D0AA 3SQ4A 1W9HA 3AA2A 1BCMA 1Q8IA 5GIPA 4FM1A 3ULEA 1UOCA 2IIRA 2UU9K 1BQNA 1XNQK 3ATVA 2D0CA 1RBVA 1A5XA 3D2FB 1JL1A 2DFEA 1WB9A 1VHXA 1S9EA 4W5QA 4DUZK 3CFPA
chains in the Genus database with same CATH topology
2QKBA 1L3VA 2EX3A 5J2QA 4KTQA 1XWLA 3DLGA 4EP4A 4DF4A 4PWDA 2DFHA 4FJIA 1TAUA 2DFFA 4Q5VA 1R0AA 3NF6A 4KTWA 1T7PA 3ZT0A 4HHTA 1T05A 2F96A 1S1TA 3AVFA 3RRHA 3HVTA 5KTQA 4N47A 4E3SA 1J9AA 2FC0A 4FYDA 3SQ0A 1VRTA 4AHUA 4OPJA 2YKMA 3DI6A 3WNFA 2KZMA 3K2PA 3TAMA 5KRTA 1UA0A 3NGIA 4H8KA 4C8KA 3AVCA 2I5JA 3BGRA 1X9MA 1BISA 1JLQA 3MEDA 1NKCA 1J53A 1IKYA 1REVA 2BANA 1WSFA 2HNZA 1LAVA 5K14A 3CFOA 3OJUA 3DOLA 4FLXA 5DMRA 1C1BA 5FRMA 4KAZA 3SJJA 3ZSYA 4DFPA 1G15A 1GOAA 4G1QA 2HHQA 3LP1A 3THVA 2B6AA 1NK7A 2ITGA 4IFYA 3VQ5A 1RDBA 3OYAA 1KLNA 2PYJA 1XHXA 1YVUA 4NYNA 2YNFA 1KVBA 3NF9A 3IAYA 3TABA 2FBXA 4E1NA 3NAEA 3TAQA 4NCGA 5KGWA 4B9MA 3HM9A 1JLAA 1HNIA 3VQ7A 4FJ9A 1TK8A 2IGIA 3QERA 5CYMA 1IO2A 2YHBA 1A5WA 4B08A 1L3UA 4DSJA 4KHQA 4Z4FA 2BE2A 4GW6A 4DTOA 1U04A 4CESA 3L2UA 3SQ1A 1KSPA 4PUOA 2X6NA 1RT5A 4CHQA 2PY5A 3ALYA 3SPZA 4Z4EA 3O3HA 3NH1A 1O1WA 4C8NA 3PX4A 1C0UA 1C1AA 4M3UA 3ZT2A 5J2PA 4DTXA 5CY4A 3SZ2A 3ZT3A 3NH0A 3TAPA 4DG1A 3M8RA 3OVNA 1LWCA 2VG6A 4BWMA 4AHCA 2KQ2A 3KK3A 2A1RA 1SKSA 4CJ4A 2VG7A 4E1MA 5C42A 4E7IA 3EY1A 4KFBA 2F8TA 3ZSWA 5FDLA 4DFKA 1BI4B 2YNIA 3QNNA 3ZSVA 3VQDA 3AA5X 4FXDA 1BGXT 2KW4A 3QINA 3C95A 3WNEA 3PO5A 5J2MA 3VQ9A 1YT3A 4KHWA 4M3YA 3HVRA 1ZBFA 4BDYA 1WSEA 4HUGA 3DLKA 4M41A 3NF7A 4LH5A 4CJEA 4DTSA 4B9SA 2HVHA 1NK4A 2KFNA 1NK9A 4DQIA 1Y97A 5HBMA 1LWEA 1RDCA 1TKTA 4CJLA 3NE6A 1VK0A 3HPGA 3P5JA 3OJSA 3HSTB 3PO4A 3T19A 3RMDA 4DU4A 5JS1A 4CF9A 1ZBHA 4W5RA 4DMNA 1TAQA 2BGGA 1NKEA 2DTUA 4Z0UA 1ZBIA 4JS4A 4CJTA 3QO9A 4FLWA 4NCBA 2P5GA 2O4GA 1X9SA 3VQ8A 4DTRA 4DFJA 4B9VA 4E89A 4OGCA 3HP6A 3RMCA 5I42A 2XY8A 4FW2A 4CEZA 2FBTA 3I0RA 4CCHA 4CHZA 3V9ZA 4CGDA 4FK4A 4DQRA 4DF8A 3K59A 4B8AB 1NK0A 4IKFA 3E01A 1RT4A 2KZZA 2HHWA 3OS1A 1VSMA 2P51A 3L2QA 3HXMA 2D5RA 3LDSA 2HMIA 3ZT4A 4FJMA 5HP1A 4OPKA 3LZJA 3NF8A 4FK0A 2G8FA 3LALA 2GV9A 3SV3A 4KHUA 4E7LA 4TSXA 1U48A 1WLJA 3KK1A 2KFZA 2VG5A 1CLQA 3LANA 3TANA 3NFAA 4DU3A 3HPHA 1NJWA 1TK5A 1U49A 4BACA 3QEVA 3QEIA 4MFBA 3TR8A 4ID5A 3JYTA 3AA4A 3ASMA 4CHNA 3KTQA 4JRQA 1KVAA 3L3VA 3L2WA 4O55A 4PA1A 2IC3A 3O4NA 4W5TA 4FLUA 4W5OA 3CG7A 3LP3A 3CM6A 3DRPA 2XY7A 4CF8A 1BIUA 3AO4A 4CJVA 3AVIA 1NK6A 3TI0A 2BDPA 1BIZA 4IFVA 3V1OA 3KD1E 4F3OA 3P1GA 5E41A 4AHTA 4CFBA 1Q9XA 4O44A 1B9DA 4H4OA 3ZSRA 2FBVA 4QCLA 1WSGA 4KI6A 2ZD1A 3D0PA 3AV9A 4CIEA 1RBSA 2B4JA 3O4QA 1XC9A 1TVRA 1HNVA 3HK2A 3WNGA 3OYIA 4I9QA 2O4IA 2Z1HA 4M42A 3LAMA 4YNQA 4F4KA 3PUFA 1FKOA 1RBRA 3KKRA 4OGEA 3OYHA 3PV8A 1ZYQA 5HLFA 4KV8A 1RTDA 3ZSOA 2HB5A 4ELTA 4FZYA 4M3ZA 3O3FA 2HHTA 1A5VA 5FROA 1EKEA 3ZSXA 1NOZA 4HCCA 3NBPA 1TGOA 2G8IA 3QIPA 4BWJA 3OYCA 4JRPA 3I8DA 3KLHA 1KTQA 1BHLA 1C1CA 3OYNA 4M3XA 1ITGA 3MECA 1UWBA 1ZBUA 3MEGA 4Y1DA 1HRHA 4CHPA 3HP9A 3VQEA 1HQEA 3RR8A 3AO5A 3D45A 2KTQA 1B9FA 1TKZA 3RR7A 4FJ5A 1RT3A 3ITHA 2W42A 3AVMA 3VQAA 3SNNA 4J2BA 4LSLA 4ID1A 4LY7A 5C24A 2Y1JA 5CZ2A 4CK3A 2WONA 2WOMA 4DTNA 4CF2A 3CYMA 4FJGA 2DY4A 1SL2A 3NDKA 3RTVA 1LAWA 2RF2A 1QHTA 1QE1A 1S1XA 2RN2A 4KTZA 4DS4A 4CHOA 1KFSA 4DLGA 3F73A 1X1PA 4AH9A 4EZ9A 3VQBA 3DM2A 3KK2A 5D3GA 3AO2A 3F9KA 1WAFA 3AVBA 4CEDA 3V6DA 1JLBA 1VSFA 5DK5A 1EP4A 1QQCA 2G8UA 1S5JA 3OS0A 1WAJA 3DLEA 2P5OA 4FJ8A 1FKPA 2IAJA 3QEWA 2Y1IA 2GUIA 4DLEA 4E0DA 4C8MA 1FXXA 4M3RA 4CHYA 4DTPA 3ZSQA 4LD0A 1C0TA 1FK9A 4E19A 1SUQA 3OYLA 4K8XA 3HJFA 2GBZA 4RG8A 3SQ2A 4E7JA 4F2RA 2HW3A 3OYKA 1EX4A 1JLFA 4RW4A 1SV5A 3HYFA 1RTHA 4LH4A 3KLFA 3V4IA 4FJXA 3IG1A 3P83D 3B6PA 1JL2A 2PZSA 4BE0A 4FLYA 4K8ZA 3AO3A 1TL3A 3KJVA 1S1UA 1SKRA 4NCAA 3OY9A 3AA3A 2OPPA 3KKSA 3LP0A 4FM0A 3OYJA 1WSIA 2XRIA 1KVCA 4EP5A 4J2EA 3LP2A 1RTIA 4OKEA 1VRUA 4WE1A 3L2RA 2IDOA 1NJZA 4Z4HA 2QK9A 3C6UA 1ZBLA 3EYZA 4KHYA 4DWIA 4B9NA 3H08A 4QOZB 5JS2A 4FW1A 4FJKA 3L8BA 1IKVA 2IOCA 2YNGA 4N5SA 4XIUA 4JLHA 4CIFA 4RW7A 5J2NA 4RW8A 1D9FA 4FJNA 3K58A 1QSYA 1U45A 2Z1JA 3S3NA 2PYLA 4W5NA 1JKHA 1C6VA 2HHXA 5KI6A 3RWUA 4CJRA 3QESA 4Q0BA 3V81A 4CJUA 4KREA 1JLCA 4MQ3A 1RT1A 1VSJA 1IKXA 1HYZA 4BE1A 4ICLA 5FRNA 1XI1A 2YNHA 4B9LA 3JSMA 3KLIA 3OYMA 2E6MA 1X9WA 2OZSA 3V9WA 5I3UA 1IG9A 3CFRA 2OA8A 1CXUA 5CZ1A 1KFDA 3HT3A 4CJKA 3U6FA 4B9UA 3VQ6A 4CGHA 4CGJA 4O0IA 1J54A 3A2FA 1JLEA 3OYGA 4CEBA 4BDZA 4HCBA 5HRRA 4CE9A 4OLBA 4FK2A 1NK5A 1NJXA 1HYSA 4FM2A 1J5OA 4F2SA 1LW2A 4DSEA 2G8WA 1RTJA 4I2PA 4ZTFA 4F3TA 3KLEA 4RW9A 1B92A 1D5AA 2JLEA 2YKNA 2ETJA 2G8VA 4H4MA 4AHSA 4Z4CA 4R5PA 4CF0A 3K5OA 4CEEA 4I9LA 2XHBA 4N41A 5C25A 3DLHA 4CEFA 3S3MA 4FZXC 3T1AA 3V9XA 4CEAA 1VSIA 2OPRA 1S6PA 4CECA 4CK1A 4KI4A 4O5BA 2QKKA 3CM5A 3MXIA 3PY8A 2LSNA 3RMAA 2NUBA 3KLGA 4CFDA 3SUPA 4CGGA 4FJHA 2B5JA 3LPUA 1SL0A 3U3GA 1NK8A 1LWFA 1BQMA 3NCIA 4OJRA 1IKWA 1L3SA 4FJLA 5HRNA 2JGUA 4CFAA 1S9GA 5T7BA 4FLZA 4N56A 4JS5A 3SCXA 1RBUA 2OYQA 2YV0X 1CZ9A 4FVMA 1WSJA 3RMBA 1I3AA 1XHZA 1WNSA 5HRSA 3AVGA 3OS2A 2RPIA 4AHVA 1T8EA 3U3YA 1JLGA 1GOBA 1EETA 1IH7A 3QEPA 1BCOA 3HO1A 4CF1A 4Z4GA 3DOKA 3OYFA 3K5MA 2E6LA 1D8YA 3AVAA 4CJPA 1DTTA 4AHRA 3NHGA 1UAXA 1MU2A 3I0SA 4CK2A 2FBYA 3DMJA 1Q9YA 2HNDA 4B9TA 1S6QA 1VSEA 3FFIA 3KIOA 4J2AA 4I2QA 1RILA 3WNHA 1BI4A 2Z1GA 3DRSA 1GOCA 4IDKA 4E7KA 3QNOA 2EHGA 4DSLA 1S1WA 2HNYA 3AVKA 3ZCMA 4CJ3A 4ELVA 3S3OA 4PQUA 3ULDA 3TAGA 1EXQA 4CEOA 1ASVA 5CYQA 4BE2A 3B6OA 3DLBA 1TL1A 1RBTA 3OYBA 4E7HA 4FLTA 3TAEA 1RT7A 1UA1A 5KGXA 3VA0A 4ELUA 4DSIA 4FZZA 2HHUA 3AO1A 2Q3SA 4IG3A 3MAQA 4HUEA 5SZTA 1L3TA 3NH2A 3QIOA 2VWJA 4LSNA 1TV6A 4IBNA 3QEXA 4OKJA 4B3OA 5KRSA 3KD5E 1T03A 4CJQA 1YTUA 3CQ8A 3TWHA 3S9HA 1N5YA 3OYDA 4O4GA 4B8CA 2F8SA 4M3TA 4DTJA 3BDPA 1JXBA 3RRGA 1K6YA 2X6SA 4Y1CA 1KRPA 1C0MA 1LW0A 3VQQA 1QS4A 1L5UA 4DQPA 4DSKA 1ASWA 3HL8A 3C94A 3V1QA 4CJ5A 4DU1A 4GVMA 2XY6A 3AVLA 4KO0A 3DYAA 4NYFA 4HVJA 2IS3A 1RCHA 3LAKA 3SI6A 2G8HA 4O0JA 1VSHA 3VN5A 4CJWA 3NGZA 1DLOA 4DQSA 3SUNA 2OZMA 3PX0A 3M8SA 1U4BA 4KKOA 4YFUA 4N76A 5J1EA 2AJQA 2A1SA 3VQPA 3L2VA 2R7YA 4DTMA 4KHNA 1BL3A 3PX6A 4Z4IA 1CZBA 4CFCA 3QETA 5HRPA 3C6TA 1N6QA 2OPSA 5EU7A 4HTUA 4DSFA 1SL1A 3UIQA 1WN7A 3OYEA 1HJRA 2ZQBA 3ISNC 3CFPA 4F8RA 3MXMA 2ZE2A 4C8OA 2ATQA 3V9UA 1CXQA 3L3UA 4OVLA 3MXJA 4KPYA 2G8KA 2VWKA 4OLAA 3SV4A 4CGFA 1JXEA 4ZHRA 2HHSA 3DRRA 3LPTA 4M45A 2QXFA 2Z1IA 4RW6A 4AILC 1D9DA 2RKIA 1HPZA 3MEEA 3NGYA 1RNHA 1QSSA 3LZIA 3EZ5A 3SUOA 3TARA 1KCFA 3K57A 4L8RB 1F21A 4CEQA 2XY5A 3G0ZA 4DFMA 4C8LA 3QLHA 2P1JA 1HQUA 1QSLA 1VSLA 1HYVA 1RT2A 2HHVA 4DTUA 4KRFA 3K5LA 3LWLA 4GMJB 4HUFA 3V9SA 4J2DA 3AVNA 3ZSZA 1VSKA 1HMVA 3DLRA 3IS9A 4CERA 3SPYA 1RT6A 3TAFA 1Z26A 2X74A 3VQCA 1U47A 1Z25A 2OPQA 1TKXA 3IRXA 3LWMA 2D0BA 3K5NA 3SUQA 1NOYA 4EZ6A 4FJ7A 4CJFA 3ZT1A 1NKBA 2XO7A 1LV5A 3HPOA 4ZTJA 4KHSA 2HVIA 4UQGA 4KB0A 3SYZA 4CIGA 3G10A 1NJYA 1YTAA 1TKDA 1I39A 1VSDA 1W0HA 1QTMA 4IG0A 1DTQA 4CGIA 4OKKA 1S1VA 4FJJA 1RDAA 2YHAA 4I7FA 3AVHA 1KLMA 1WSHA 3O3GA 4DQQA 2E4LA 3M8PA 4FLVA 2D0AA 4KB1A 4M3WA 3M8QA 3SQ4A 1W9HA 3AA2A 3T3FA 1BCMA 4BDPA 4PY5A 5HROA 1Q8IA 1ASUA 4FM1A 1UOCA 3VA3A 4CJSA 1BQNA 1SKWA 1TK0A 2D0CA 1RBVA 4FCYA 1A5XA 1JL1A 2DFEA 4QAGA 5SWMA 2X78A 3V1RA 3VQ4A 4DS5A 1RDDA 1S9EA 4W5QA 3AVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKB A;  1L3V A;  2EX3 A;  5J2Q A;  4KTQ A;  1XWL A;  3DLG A;  4EP4 A;  4DF4 A;  4PWD A;  2DFH A;  4FJI A;  1TAU A;  2DFF A;  4Q5V A;  1R0A A;  3NF6 A;  4KTW A;  1T7P A;  3ZT0 A;  4HHT A;  1T05 A;  2F96 A;  1S1T A;  3AVF A;  3RRH A;  3HVT A;  5KTQ A;  4N47 A;  4E3S A;  1J9A A;  2FC0 A;  4FYD A;  3SQ0 A;  1VRT A;  4AHU A;  4OPJ A;  2YKM A;  3DI6 A;  3WNF A;  2KZM A;  3K2P A;  3TAM A;  5KRT A;  1UA0 A;  3NGI A;  4H8K A;  4C8K A;  3AVC A;  2I5J A;  3BGR A;  1X9M A;  1BIS A;  1JLQ A;  3MED A;  1NKC A;  1J53 A;  1IKY A;  1REV A;  2BAN A;  1WSF A;  2HNZ A;  1LAV A;  5K14 A;  3CFO A;  3OJU A;  3DOL A;  4FLX A;  5DMR A;  1C1B A;  5FRM A;  4KAZ A;  3SJJ A;  3ZSY A;  4DFP A;  1G15 A;  1GOA A;  4G1Q A;  2HHQ A;  3LP1 A;  3THV A;  2B6A A;  1NK7 A;  2ITG A;  4IFY A;  3VQ5 A;  1RDB A;  3OYA A;  1KLN A;  2PYJ A;  1XHX A;  1YVU A;  4NYN A;  2YNF A;  1KVB A;  3NF9 A;  3IAY A;  3TAB A;  2FBX A;  4E1N A;  3NAE A;  3TAQ A;  4NCG A;  5KGW A;  4B9M A;  3HM9 A;  1JLA A;  1HNI A;  3VQ7 A;  4FJ9 A;  1TK8 A;  2IGI A;  3QER A;  5CYM A;  1IO2 A;  2YHB A;  1A5W A;  4B08 A;  1L3U A;  4DSJ A;  4KHQ A;  4Z4F A;  2BE2 A;  4GW6 A;  4DTO A;  1U04 A;  4CES A;  3L2U A;  3SQ1 A;  1KSP A;  4PUO A;  2X6N A;  1RT5 A;  4CHQ A;  2PY5 A;  3ALY A;  3SPZ A;  4Z4E A;  3O3H A;  3NH1 A;  1O1W A;  4C8N A;  3PX4 A;  1C0U A;  1C1A A;  4M3U A;  3ZT2 A;  5J2P A;  4DTX A;  5CY4 A;  3SZ2 A;  3ZT3 A;  3NH0 A;  3TAP A;  4DG1 A;  3M8R A;  3OVN A;  1LWC A;  2VG6 A;  4BWM A;  4AHC A;  2KQ2 A;  3KK3 A;  2A1R A;  1SKS A;  4CJ4 A;  2VG7 A;  4E1M A;  5C42 A;  4E7I A;  3EY1 A;  4KFB A;  2F8T A;  3ZSW A;  5FDL A;  4DFK A;  1BI4 B;  2YNI A;  3QNN A;  3ZSV A;  3VQD A;  3AA5 X;  4FXD A;  1BGX T;  2KW4 A;  3QIN A;  3C95 A;  3WNE A;  3PO5 A;  5J2M A;  3VQ9 A;  1YT3 A;  4KHW A;  4M3Y A;  3HVR A;  1ZBF A;  4BDY A;  1WSE A;  4HUG A;  3DLK A;  4M41 A;  3NF7 A;  4LH5 A;  4CJE A;  4DTS A;  4B9S A;  2HVH A;  1NK4 A;  2KFN A;  1NK9 A;  4DQI A;  1Y97 A;  5HBM A;  1LWE A;  1RDC A;  1TKT A;  4CJL A;  3NE6 A;  1VK0 A;  3HPG A;  3P5J A;  3OJS A;  3HST B;  3PO4 A;  3T19 A;  3RMD A;  4DU4 A;  5JS1 A;  4CF9 A;  1ZBH A;  4W5R A;  4DMN A;  1TAQ A;  2BGG A;  1NKE A;  2DTU A;  4Z0U A;  1ZBI A;  4JS4 A;  4CJT A;  3QO9 A;  4FLW A;  4NCB A;  2P5G A;  2O4G A;  1X9S A;  3VQ8 A;  4DTR A;  4DFJ A;  4B9V A;  4E89 A;  4OGC A;  3HP6 A;  3RMC A;  5I42 A;  2XY8 A;  4FW2 A;  4CEZ A;  2FBT A;  3I0R A;  4CCH A;  4CHZ A;  3V9Z A;  4CGD A;  4FK4 A;  4DQR A;  4DF8 A;  3K59 A;  4B8A B;  1NK0 A;  4IKF A;  3E01 A;  1RT4 A;  2KZZ A;  2HHW A;  3OS1 A;  1VSM A;  2P51 A;  3L2Q A;  3HXM A;  2D5R A;  3LDS A;  2HMI A;  3ZT4 A;  4FJM A;  5HP1 A;  4OPK A;  3LZJ A;  3NF8 A;  4FK0 A;  2G8F A;  3LAL A;  2GV9 A;  3SV3 A;  4KHU A;  4E7L A;  4TSX A;  1U48 A;  1WLJ A;  3KK1 A;  2KFZ A;  2VG5 A;  1CLQ A;  3LAN A;  3TAN A;  3NFA A;  4DU3 A;  3HPH A;  1NJW A;  1TK5 A;  1U49 A;  4BAC A;  3QEV A;  3QEI A;  4MFB A;  3TR8 A;  4ID5 A;  3JYT A;  3AA4 A;  3ASM A;  4CHN A;  3KTQ A;  4JRQ A;  1KVA A;  3L3V A;  3L2W A;  4O55 A;  4PA1 A;  2IC3 A;  3O4N A;  4W5T A;  4FLU A;  4W5O A;  3CG7 A;  3LP3 A;  3CM6 A;  3DRP A;  2XY7 A;  4CF8 A;  1BIU A;  3AO4 A;  4CJV A;  3AVI A;  1NK6 A;  3TI0 A;  2BDP A;  1BIZ A;  4IFV A;  3V1O A;  3KD1 E;  4F3O A;  3P1G A;  5E41 A;  4AHT A;  4CFB A;  1Q9X A;  4O44 A;  1B9D A;  4H4O A;  3ZSR A;  2FBV A;  4QCL A;  1WSG A;  4KI6 A;  2ZD1 A;  3D0P A;  3AV9 A;  4CIE A;  1RBS A;  2B4J A;  3O4Q A;  1XC9 A;  1TVR A;  1HNV A;  3HK2 A;  3WNG A;  3OYI A;  4I9Q A;  2O4I A;  2Z1H A;  4M42 A;  3LAM A;  4YNQ A;  4F4K A;  3PUF A;  1FKO A;  1RBR A;  3KKR A;  4OGE A;  3OYH A;  3PV8 A;  1ZYQ A;  5HLF A;  4KV8 A;  1RTD A;  3ZSO A;  2HB5 A;  4ELT A;  4FZY A;  4M3Z A;  3O3F A;  2HHT A;  1A5V A;  5FRO A;  1EKE A;  3ZSX A;  1NOZ A;  4HCC A;  3NBP A;  1TGO A;  2G8I A;  3QIP A;  4BWJ A;  3OYC A;  4JRP A;  3I8D A;  3KLH A;  1KTQ A;  1BHL A;  1C1C A;  3OYN A;  4M3X A;  1ITG A;  3MEC A;  1UWB A;  1ZBU A;  3MEG A;  4Y1D A;  1HRH A;  4CHP A;  3HP9 A;  3VQE A;  1HQE A;  3RR8 A;  3AO5 A;  3D45 A;  2KTQ A;  1B9F A;  1TKZ A;  3RR7 A;  4FJ5 A;  1RT3 A;  3ITH A;  2W42 A;  3AVM A;  3VQA A;  3SNN A;  4J2B A;  4LSL A;  4ID1 A;  4LY7 A;  5C24 A;  2Y1J A;  5CZ2 A;  4CK3 A;  2WON A;  2WOM A;  4DTN A;  4CF2 A;  3CYM A;  4FJG A;  2DY4 A;  1SL2 A;  3NDK A;  3RTV A;  1LAW A;  2RF2 A;  1QHT A;  1QE1 A;  1S1X A;  2RN2 A;  4KTZ A;  4DS4 A;  4CHO A;  1KFS A;  4DLG A;  3F73 A;  1X1P A;  4AH9 A;  4EZ9 A;  3VQB A;  3DM2 A;  3KK2 A;  5D3G A;  3AO2 A;  3F9K A;  1WAF A;  3AVB A;  4CED A;  3V6D A;  1JLB A;  1VSF A;  5DK5 A;  1EP4 A;  1QQC A;  2G8U A;  1S5J A;  3OS0 A;  1WAJ A;  3DLE A;  2P5O A;  4FJ8 A;  1FKP A;  2IAJ A;  3QEW A;  2Y1I A;  2GUI A;  4DLE A;  4E0D A;  4C8M A;  1FXX A;  4M3R A;  4CHY A;  4DTP A;  3ZSQ A;  4LD0 A;  1C0T A;  1FK9 A;  4E19 A;  1SUQ A;  3OYL A;  4K8X A;  3HJF A;  2GBZ A;  4RG8 A;  3SQ2 A;  4E7J A;  4F2R A;  2HW3 A;  3OYK A;  1EX4 A;  1JLF A;  4RW4 A;  1SV5 A;  3HYF A;  1RTH A;  4LH4 A;  3KLF A;  3V4I A;  4FJX A;  3IG1 A;  3P83 D;  3B6P A;  1JL2 A;  2PZS A;  4BE0 A;  4FLY A;  4K8Z A;  3AO3 A;  1TL3 A;  3KJV A;  1S1U A;  1SKR A;  4NCA A;  3OY9 A;  3AA3 A;  2OPP A;  3KKS A;  3LP0 A;  4FM0 A;  3OYJ A;  1WSI A;  2XRI A;  1KVC A;  4EP5 A;  4J2E A;  3LP2 A;  1RTI A;  4OKE A;  1VRU A;  4WE1 A;  3L2R A;  2IDO A;  1NJZ A;  4Z4H A;  2QK9 A;  3C6U A;  1ZBL A;  3EYZ A;  4KHY A;  4DWI A;  4B9N A;  3H08 A;  4QOZ B;  5JS2 A;  4FW1 A;  4FJK A;  3L8B A;  1IKV A;  2IOC A;  2YNG A;  4N5S A;  4XIU A;  4JLH A;  4CIF A;  4RW7 A;  5J2N A;  4RW8 A;  1D9F A;  4FJN A;  3K58 A;  1QSY A;  1U45 A;  2Z1J A;  3S3N A;  2PYL A;  4W5N A;  1JKH A;  1C6V A;  2HHX A;  5KI6 A;  3RWU A;  4CJR A;  3QES A;  4Q0B A;  3V81 A;  4CJU A;  4KRE A;  1JLC A;  4MQ3 A;  1RT1 A;  1VSJ A;  1IKX A;  1HYZ A;  4BE1 A;  4ICL A;  5FRN A;  1XI1 A;  2YNH A;  4B9L A;  3JSM A;  3KLI A;  3OYM A;  2E6M A;  1X9W A;  2OZS A;  3V9W A;  5I3U A;  1IG9 A;  3CFR A;  2OA8 A;  1CXU A;  5CZ1 A;  1KFD A;  3HT3 A;  4CJK A;  3U6F A;  4B9U A;  3VQ6 A;  4CGH A;  4CGJ A;  4O0I A;  1J54 A;  3A2F A;  1JLE A;  3OYG A;  4CEB A;  4BDZ A;  4HCB A;  5HRR A;  4CE9 A;  4OLB A;  4FK2 A;  1NK5 A;  1NJX A;  1HYS A;  4FM2 A;  1J5O A;  4F2S A;  1LW2 A;  4DSE A;  2G8W A;  1RTJ A;  4I2P A;  4ZTF A;  4F3T A;  3KLE A;  4RW9 A;  1B92 A;  1D5A A;  2JLE A;  2YKN A;  2ETJ A;  2G8V A;  4H4M A;  4AHS A;  4Z4C A;  4R5P A;  4CF0 A;  3K5O A;  4CEE A;  4I9L A;  2XHB A;  4N41 A;  5C25 A;  3DLH A;  4CEF A;  3S3M A;  4FZX C;  3T1A A;  3V9X A;  4CEA A;  1VSI A;  2OPR A;  1S6P A;  4CEC A;  4CK1 A;  4KI4 A;  4O5B A;  2QKK A;  3CM5 A;  3MXI A;  3PY8 A;  2LSN A;  3RMA A;  2NUB A;  3KLG A;  4CFD A;  3SUP A;  4CGG A;  4FJH A;  2B5J A;  3LPU A;  1SL0 A;  3U3G A;  1NK8 A;  1LWF A;  1BQM A;  3NCI A;  4OJR A;  1IKW A;  1L3S A;  4FJL A;  5HRN A;  2JGU A;  4CFA A;  1S9G A;  5T7B A;  4FLZ A;  4N56 A;  4JS5 A;  3SCX A;  1RBU A;  2OYQ A;  2YV0 X;  1CZ9 A;  4FVM A;  1WSJ A;  3RMB A;  1I3A A;  1XHZ A;  1WNS A;  5HRS A;  3AVG A;  3OS2 A;  2RPI A;  4AHV A;  1T8E A;  3U3Y A;  1JLG A;  1GOB A;  1EET A;  1IH7 A;  3QEP A;  1BCO A;  3HO1 A;  4CF1 A;  4Z4G A;  3DOK A;  3OYF A;  3K5M A;  2E6L A;  1D8Y A;  3AVA A;  4CJP A;  1DTT A;  4AHR A;  3NHG A;  1UAX A;  1MU2 A;  3I0S A;  4CK2 A;  2FBY A;  3DMJ A;  1Q9Y A;  2HND A;  4B9T A;  1S6Q A;  1VSE A;  3FFI A;  3KIO A;  4J2A A;  4I2Q A;  1RIL A;  3WNH A;  1BI4 A;  2Z1G A;  3DRS A;  1GOC A;  4IDK A;  4E7K A;  3QNO A;  2EHG A;  4DSL A;  1S1W A;  2HNY A;  3AVK A;  3ZCM A;  4CJ3 A;  4ELV A;  3S3O A;  4PQU A;  3ULD A;  3TAG A;  1EXQ A;  4CEO A;  1ASV A;  5CYQ A;  4BE2 A;  3B6O A;  3DLB A;  1TL1 A;  1RBT A;  3OYB A;  4E7H A;  4FLT A;  3TAE A;  1RT7 A;  1UA1 A;  5KGX A;  3VA0 A;  4ELU A;  4DSI A;  4FZZ A;  2HHU A;  3AO1 A;  2Q3S A;  4IG3 A;  3MAQ A;  4HUE A;  5SZT A;  1L3T A;  3NH2 A;  3QIO A;  2VWJ A;  4LSN A;  1TV6 A;  4IBN A;  3QEX A;  4OKJ A;  4B3O A;  5KRS A;  3KD5 E;  1T03 A;  4CJQ A;  1YTU A;  3CQ8 A;  3TWH A;  3S9H A;  1N5Y A;  3OYD A;  4O4G A;  4B8C A;  2F8S A;  4M3T A;  4DTJ A;  3BDP A;  1JXB A;  3RRG A;  1K6Y A;  2X6S A;  4Y1C A;  1KRP A;  1C0M A;  1LW0 A;  3VQQ A;  1QS4 A;  1L5U A;  4DQP A;  4DSK A;  1ASW A;  3HL8 A;  3C94 A;  3V1Q A;  4CJ5 A;  4DU1 A;  4GVM A;  2XY6 A;  3AVL A;  4KO0 A;  3DYA A;  4NYF A;  4HVJ A;  2IS3 A;  1RCH A;  3LAK A;  3SI6 A;  2G8H A;  4O0J A;  1VSH A;  3VN5 A;  4CJW A;  3NGZ A;  1DLO A;  4DQS A;  3SUN A;  2OZM A;  3PX0 A;  3M8S A;  1U4B A;  4KKO A;  4YFU A;  4N76 A;  5J1E A;  2AJQ A;  2A1S A;  3VQP A;  3L2V A;  2R7Y A;  4DTM A;  4KHN A;  1BL3 A;  3PX6 A;  4Z4I A;  1CZB A;  4CFC A;  3QET A;  5HRP A;  3C6T A;  1N6Q A;  2OPS A;  5EU7 A;  4HTU A;  4DSF A;  1SL1 A;  3UIQ A;  1WN7 A;  3OYE A;  1HJR A;  2ZQB A;  3ISN C;  3CFP A;  4F8R A;  3MXM A;  2ZE2 A;  4C8O A;  2ATQ A;  3V9U A;  1CXQ A;  3L3U A;  4OVL A;  3MXJ A;  4KPY A;  2G8K A;  2VWK A;  4OLA A;  3SV4 A;  4CGF A;  1JXE A;  4ZHR A;  2HHS A;  3DRR A;  3LPT A;  4M45 A;  2QXF A;  2Z1I A;  4RW6 A;  4AIL C;  1D9D A;  2RKI A;  1HPZ A;  3MEE A;  3NGY A;  1RNH A;  1QSS A;  3LZI A;  3EZ5 A;  3SUO A;  3TAR A;  1KCF A;  3K57 A;  4L8R B;  1F21 A;  4CEQ A;  2XY5 A;  3G0Z A;  4DFM A;  4C8L A;  3QLH A;  2P1J A;  1HQU A;  1QSL A;  1VSL A;  1HYV A;  1RT2 A;  2HHV A;  4DTU A;  4KRF A;  3K5L A;  3LWL A;  4GMJ B;  4HUF A;  3V9S A;  4J2D A;  3AVN A;  3ZSZ A;  1VSK A;  1HMV A;  3DLR A;  3IS9 A;  4CER A;  3SPY A;  1RT6 A;  3TAF A;  1Z26 A;  2X74 A;  3VQC A;  1U47 A;  1Z25 A;  2OPQ A;  1TKX A;  3IRX A;  3LWM A;  2D0B A;  3K5N A;  3SUQ A;  1NOY A;  4EZ6 A;  4FJ7 A;  4CJF A;  3ZT1 A;  1NKB A;  2XO7 A;  1LV5 A;  3HPO A;  4ZTJ A;  4KHS A;  2HVI A;  4UQG A;  4KB0 A;  3SYZ A;  4CIG A;  3G10 A;  1NJY A;  1YTA A;  1TKD A;  1I39 A;  1VSD A;  1W0H A;  1QTM A;  4IG0 A;  1DTQ A;  4CGI A;  4OKK A;  1S1V A;  4FJJ A;  1RDA A;  2YHA A;  4I7F A;  3AVH A;  1KLM A;  1WSH A;  3O3G A;  4DQQ A;  2E4L A;  3M8P A;  4FLV A;  2D0A A;  4KB1 A;  4M3W A;  3M8Q A;  3SQ4 A;  1W9H A;  3AA2 A;  3T3F A;  1BCM A;  4BDP A;  4PY5 A;  5HRO A;  1Q8I A;  1ASU A;  4FM1 A;  1UOC A;  3VA3 A;  4CJS A;  1BQN A;  1SKW A;  1TK0 A;  2D0C A;  1RBV A;  4FCY A;  1A5X A;  1JL1 A;  2DFE A;  4QAG A;  5SWM A;  2X78 A;  3V1R A;  3VQ4 A;  4DS5 A;  1RDD A;  1S9E A;  4W5Q A;  3AVJ A; 
#chains in the Genus database with same CATH topology
 2QKB A;  2GX9 A;  4WQ4 C;  5J2Q A;  5C2D A;  4R79 A;  4DF4 A;  3LDO A;  2DFH A;  2FSN A;  4Q5V A;  2W6L A;  1T7P A;  3A5M C;  3ZT0 A;  4HHT A;  1SAZ A;  4FWN A;  3O9S A;  4N47 A;  4EAH D;  1J9A A;  1OKJ A;  2FC0 A;  2O8B A;  3BZK A;  2FSK A;  3SBT A;  3TAM A;  1K8K A;  4H8K A;  5AQS A;  3AVC A;  4C8K A;  2FF3 B;  2I5J A;  3BGR A;  3MMV A;  4BC5 A;  4MLH A;  1J53 A;  1REV A;  3MCP A;  2A40 A;  3CJA A;  1JJ2 M;  1GLC G;  1LAV A;  4FLX A;  3DOL A;  3FZL A;  5M1N A;  1NGB A;  1G15 A;  2B6A A;  1OVY A;  1NK7 A;  4IFY A;  1RDB A;  3OYA A;  1KLN A;  4LF7 K;  5AQW A;  4B1Y B;  3NAE A;  3P39 A;  4LF4 K;  2OAN A;  4NCG A;  3C6A A;  5F1X A;  4B9M A;  3P4I A;  1TK8 A;  1VQ7 N;  2VGN A;  1IO2 A;  4KH4 A;  5BRD A;  1YF5 L;  4Z4F A;  4ISE A;  4GW6 A;  1U04 A;  3SQ1 A;  1RT5 A;  3CCV N;  1IV0 A;  3SPZ A;  4Z4E A;  4CVN E;  3Q7C A;  4BR9 A;  3PX4 A;  4M3U A;  3R1X A;  3ZT3 A;  3OVN A;  1LWC A;  4BWM A;  3KK3 A;  2VG7 A;  4E7I A;  3VER A;  4KFB A;  2F8T A;  3ZSW A;  2V52 B;  3QNN A;  2Q31 A;  1E4G T;  4DR3 K;  3C95 A;  5BR9 A;  1P90 A;  5J2M A;  1N36 K;  5CR4 A;  4KHW A;  1HKC A;  3HVR A;  4BRQ A;  1NK4 A;  4CW7 B;  4PKI A;  3TTD A;  4I6M B;  3HPG A;  3CQX A;  3PO4 A;  3T19 A;  3RMD A;  4FL9 A;  1IBM K;  4FLW A;  2P5G A;  2O4G A;  2CH6 A;  4DTR A;  3CJC A;  3U8X A;  4B9V A;  3CPE A;  3WXK A;  3HP6 A;  4IFE A;  3GL1 A;  3O1B A;  4CCH A;  1FJG K;  3LDN A;  4FK4 A;  2YJF A;  3K59 A;  4IKF A;  4DR2 K;  2HHW A;  3CME N;  2D5R A;  3MX5 A;  4JI2 K;  3ZT4 A;  3VEW A;  5AQT A;  4FK0 A;  3N4P A;  2G8F A;  4DUY K;  1XNR K;  1LCU A;  3SV3 A;  4E7L A;  1QVG M;  4IEI A;  2FSJ A;  4RWT A;  2VQF K;  3LM2 A;  4MFB A;  4WFB L;  3DJC A;  4ID5 A;  3UKU A;  4ILG B;  3L2W A;  4FWM A;  4W5T A;  3HM8 A;  3CM6 A;  2XY7 A;  4CF8 A;  1NK6 A;  1OVQ A;  4NB4 A;  4CFB A;  1Q9X A;  4FWL A;  1B9D A;  1XQS C;  5HOO A;  3O4Q A;  1XC9 A;  4WQ5 C;  3HK2 A;  4CBW A;  4GKK K;  4M42 A;  4YNQ A;  3PUF A;  1RBR A;  3KKR A;  3OYH A;  3PV8 A;  2JWL A;  2PAV A;  1GLD G;  4J8F A;  3M6G A;  4M3Z A;  5LY3 A;  4RCH A;  4FZY A;  3S41 A;  1NOZ A;  3NBP A;  1HKB A;  2FXU A;  4BWJ A;  4BR5 A;  3I8D A;  1NGD A;  3QML A;  3KLH A;  1KTQ A;  5AQU A;  2Q36 A;  3MEC A;  1ZBU A;  3J7Y P;  4CHP A;  2NRX A;  2NRV A;  1O13 A;  5AJ3 K;  3RR8 A;  3AO5 A;  2D0P A;  2KTQ A;  3CCR N;  2NRH A;  4FJ5 A;  3O9R A;  4DB3 A;  4LSL A;  5C24 A;  2Y1J A;  4CK3 A;  2WOM A;  4CF2 A;  1HPM A;  1Q82 O;  3RTV A;  3F2K A;  4DLG A;  3F73 A;  4AH9 A;  4LF9 K;  4JEP A;  3AO2 A;  4CED A;  2E2P A;  3SAH A;  2P5O A;  2O8F A;  2IAJ A;  1HKG A;  3K9J A;  2GUI A;  4JAX A;  3SJH A;  4JI4 K;  1HLU A;  2GTD A;  4M3R A;  4CHY A;  3ZSQ A;  1C0T A;  2ZJP L;  4LFC K;  3HJF A;  3IDH A;  2FF6 A;  4E7J A;  3GOI A;  3KLF A;  1SV5 A;  4DCH A;  4FJX A;  3P83 D;  2HMP A;  4BE0 A;  4FLY A;  4K8Z A;  2HBL A;  2V7Z A;  3EE9 A;  3KJV A;  4NCA A;  3HRG A;  3OY9 A;  2UXD K;  3O8M A;  2OPP A;  4FM0 A;  3OYJ A;  4IWV A;  1KVC A;  2QA4 N;  2QWN A;  2VQE K;  1NJZ A;  4Z4H A;  3BEX A;  4DWI A;  3H08 A;  3CCQ N;  3CJ7 A;  4QOZ B;  3O9T A;  4KH5 A;  2QWM A;  2E8A A;  4JLH A;  3FR0 A;  4FJN A;  4OO1 J;  3K58 A;  2ZWH A;  3I33 A;  2PYL A;  3DLL L;  3IUC A;  1JKH A;  1Q7Y O;  1ATN A;  3QES A;  1QZ5 A;  3O9Q A;  1JLC A;  3N4Q A;  5FRN A;  2YNH A;  2E6M A;  3CC7 N;  3V9W A;  4JN4 A;  2OZS A;  3CFR A;  5AZJ B;  5CZ1 A;  3U6F A;  2NRT A;  3OYG A;  1JLE A;  4FO0 A;  1HYS A;  4FM2 A;  1NMN A;  1LW2 A;  2G8W A;  4I2P A;  4ZTF A;  4F3T A;  4RW9 A;  1B92 A;  4H03 B;  2YKN A;  2G8V A;  4H4M A;  5FPM A;  4DR1 K;  3EN9 A;  4CF0 A;  2HST A;  4I9L A;  3S3M A;  5F2R A;  4IO8 A;  1VSI A;  4KI4 A;  4B3R K;  4JKB A;  4JKA A;  3MXI A;  3PY8 A;  4DR5 K;  2OTL N;  3KLG A;  4CFD A;  3SUP A;  4UY8 O;  1NK8 A;  4OJR A;  4PL8 A;  5T7B A;  1RBU A;  5AQI A;  1CZ9 A;  2UYT A;  4DV5 K;  3AVG A;  3OS2 A;  4DV3 K;  1EET A;  4OPA A;  2IVN A;  1BCO A;  3K5M A;  1X9J A;  1SQK A;  4FPB A;  3AVA A;  1ZC6 A;  3CI5 A;  4B3S K;  3I0S A;  1GLB G;  1NGC A;  3DMJ A;  1Q9Y A;  4B9T A;  3FFI A;  3SAG A;  1VQ5 N;  3WNH A;  1BI4 A;  2Z1G A;  3DRS A;  3G4S N;  4E7K A;  2EHG A;  2GWK A;  5CHI A;  3E9O A;  3S3O A;  3ULD A;  3TAG A;  1ASV A;  4ILJ A;  2HF4 A;  3B6O A;  3DLB A;  1W97 L;  3OYB A;  5AQR A;  4DSI A;  4FZZ A;  3VA0 A;  2HHU A;  4HUE A;  2Q3S A;  3MAQ A;  5SZT A;  1L3T A;  5ADX H;  3QIO A;  4IZ9 A;  3CXC M;  4GY2 B;  1W7A A;  1HUX A;  3QEX A;  3BF3 A;  3U9D A;  1BU6 O;  1T03 A;  3KD5 E;  3CQ8 A;  4O4G A;  5C10 A;  3I56 N;  3BDP A;  1K6Y A;  3GE1 A;  1JCE A;  3AGK A;  1ASW A;  1N8R O;  4JI3 K;  2XY6 A;  4HVJ A;  4NYF A;  5AQO A;  3LAK A;  3WQU A;  3QFU A;  5H1S Q;  5KQD A;  3PX0 A;  4NO7 A;  3T1H K;  4JI6 K;  4X65 K;  4JHD A;  4BRA A;  4N76 A;  2AJQ A;  2A1S A;  2R7Y A;  1DEJ A;  4DTM A;  4KHN A;  1BL3 A;  4KBO A;  4XH4 A;  2V51 B;  1WN7 A;  2I7N A;  1HJR A;  3ISN C;  2CGJ A;  4C8O A;  3L3U A;  4BGA A;  4KPY A;  2VWK A;  4LF6 K;  4EHT A;  3VES A;  4ZHR A;  1E4F T;  4AIL C;  2P9L A;  2Z1I A;  1QSS A;  3EZ5 A;  2P9I A;  3SUO A;  4BRG A;  1KCF A;  3K57 A;  1K8A O;  2XY5 A;  2VWB A;  3A5N C;  1K73 O;  4DFM A;  4C8L A;  4K0K K;  3QLH A;  2P1J A;  1RT2 A;  4KRF A;  3CJ9 A;  3V9S A;  3AVN A;  3DLR A;  3SPY A;  1Z26 A;  1Z25 A;  2OPQ A;  1TKX A;  3K5N A;  4DR6 K;  5C12 A;  3ZT1 A;  1NKB A;  3DXM B;  1LV5 A;  4ZTJ A;  3GBT A;  2HVI A;  2HBM A;  1XUP O;  1NM1 A;  3OW2 M;  4YDU C;  4WQ4 A;  1I39 A;  1T6C A;  4FJJ A;  3D2E A;  3WEE A;  4WFA L;  2YHA A;  2QI2 A;  4L3Q A;  1KLM A;  5DM6 L;  4DQQ A;  4BDP A;  2QTD A;  2QWR A;  4JI1 K;  4CJS A;  3VA3 A;  1TK0 A;  4C1N K;  4FCY A;  3H45 C;  2X78 A;  3AVJ A;  4H0P A;  1XWL A;  5C2F A;  4A61 A;  1GLE G;  1NWK A;  1HX1 A;  2F96 A;  3AVF A;  1NGA A;  4FOI A;  1BUP A;  4E3S A;  4FYD A;  1VRT A;  4AHU A;  3DI6 A;  3JS6 A;  3K2P A;  5KRT A;  1XC3 A;  2UUB K;  1JLQ A;  4BR4 A;  1NKC A;  4V19 S;  2IVO A;  4U67 L;  2CGL A;  5JLF A;  3CFO A;  1C1B A;  2I7P A;  4DFP A;  1GOA A;  3LP1 A;  3J80 O;  1R59 O;  1P8Z A;  4BGB A;  2RE2 A;  4K43 A;  2PYJ A;  1YVU A;  4NYN A;  3IAY A;  5EX5 A;  5M1O A;  3SK3 A;  4BRL A;  2HBK A;  2IGI A;  4DTO A;  3FFK B;  3L2U A;  1NGF A;  3OTO K;  3GDQ A;  3O3H A;  1O1W A;  4IXC A;  3VEV A;  1C0U A;  5C0Y A;  4DTX A;  5CY4 A;  3SZ2 A;  3NH0 A;  1SZ2 A;  4ILH A;  3TAP A;  3H1Q A;  1TYQ A;  3EL2 A;  3EY1 A;  3I8B A;  5FDL A;  1OH5 A;  4PKG A;  3ZSV A;  4FXD A;  3THX B;  3EO3 A;  2P9N B;  3F5T A;  1YT3 A;  3VQ9 A;  4M3Y A;  1M90 O;  1ZBF A;  2CH5 A;  4LH5 A;  4M41 A;  4B9S A;  2KFN A;  1DKG D;  4DQI A;  1LWE A;  1RDC A;  4F9O A;  1W2B M;  3NE6 A;  4QS9 A;  1TUU A;  1KXP A;  3P5J A;  3OJS A;  3VF2 A;  4DU4 A;  5E26 A;  4CF9 A;  1ZBH A;  3MN9 A;  4H5T A;  5FPN A;  3OA9 A;  1X9S A;  3VQ8 A;  4K41 A;  3WQT A;  5I42 A;  3ZX3 A;  1VQM N;  4CHZ A;  4G9Z A;  4FWS A;  4CGD A;  3TPQ A;  1NK0 A;  5EXW A;  3E01 A;  1RT4 A;  3BP8 A;  4ISF A;  5AQG A;  3L2Q A;  4FJM A;  5AQN A;  5LL6 Z;  3MN7 A;  4GNI A;  3LZJ A;  2HOE A;  4KHU A;  1U48 A;  4TSX A;  2D1K A;  3KK1 A;  1CLQ A;  1GLA G;  5GAG P;  3NFA A;  3HPH A;  3QBW A;  1NJW A;  4JKF A;  3QEI A;  3W3D A;  1S72 N;  4WQ5 A;  3JYT A;  2E2O A;  1WBB A;  3AA4 A;  3ASM A;  4GV3 A;  4CHN A;  4O55 A;  2A3Z A;  3DRP A;  2O8E B;  3VEN A;  3AO4 A;  4CJV A;  2BDP A;  3V1O A;  4F3O A;  3P1G A;  3ZSR A;  2FBV A;  4QCL A;  4IOC L;  1WSG A;  4KI6 A;  2ZD1 A;  3B8A X;  3AV9 A;  4O8U A;  2B4J A;  3L4I A;  4IJN A;  1U6Z A;  3OYI A;  2O4I A;  2Z1H A;  3VGM A;  4F4K A;  1RFQ A;  1FKO A;  1ZYQ A;  3LDP A;  4PKH A;  2WFB A;  4BVP A;  5HLF A;  4KV8 A;  1KQS M;  4H5V A;  4HCC A;  5JIC A;  1TGO A;  2G8I A;  1HNW K;  3DXK B;  4DV4 K;  1BHL A;  3O4W A;  1UWB A;  4Y1D A;  1HRH A;  2AP1 A;  4B1V A;  3D45 A;  1B9F A;  1TKZ A;  3RR7 A;  1RT3 A;  3HBT A;  1GLJ O;  4BC2 A;  4ID1 A;  5CZ2 A;  2WON A;  1OH8 A;  3CYM A;  1SL2 A;  1IJJ A;  1LAW A;  3THX A;  5KQ8 A;  2QEX N;  1RDW X;  3QIC A;  5D3G A;  2GEL A;  3F9K A;  3AVB A;  3UE5 A;  2PBD A;  2NRR A;  3O5B A;  1EP4 A;  1MWK A;  1QQC A;  3CCU N;  2G8U A;  3OS0 A;  5I9E B;  1G99 A;  3ZET B;  2Y1I A;  3D7E O;  4DLE A;  3LL3 A;  5BRF A;  4DTP A;  1FK9 A;  1SUQ A;  3OYL A;  4CJ7 A;  3UB5 A;  2O8D B;  3G71 N;  4F2R A;  2VGM A;  1BDG A;  3HYF A;  2WTU A;  1BG3 A;  3B6P A;  1JL2 A;  4X66 K;  2PZS A;  3AO3 A;  1TL3 A;  4WFN L;  5JMV A;  3AA3 A;  3E9L A;  4BRD A;  1WSI A;  4JKG A;  5AQY A;  3CCS N;  1VQ9 N;  2UUA K;  2IDO A;  2E1Y A;  3K0S A;  4IO9 L;  4B9N A;  4Z94 A;  5JS2 A;  4FW1 A;  3H3O B;  3L8B A;  2IOC A;  4N5S A;  3D2F A;  4CIF A;  4RW7 A;  4B1W B;  2Z1J A;  3S3N A;  4W5N A;  4B9Q A;  4AF1 A;  5KI6 A;  3FZM A;  3C0B A;  4GKJ K;  3EZW A;  3V81 A;  2O8E A;  4B1U B;  1VSJ A;  1HYZ A;  2UUC K;  4ICL A;  2JWK A;  1X9W A;  3AY9 A;  4B3T K;  5I3U A;  1IG9 A;  1KFD A;  3OBW A;  3VQ6 A;  3A2F A;  4BDZ A;  3KWG A;  1MWM A;  5HRR A;  4CE9 A;  4OLB A;  1NJX A;  2F9T A;  4F2S A;  4DSE A;  1QVF M;  1RTJ A;  3KLE A;  1NGJ A;  1JCG A;  4AHS A;  3K5O A;  4CEE A;  4N41 A;  1U2V B;  4PHT X;  4CEF A;  4CZL A;  3T1A A;  5C15 A;  5ELZ A;  3V9X A;  4CEA A;  2OPR A;  1ZBI A;  2O8C B;  1BOT O;  4O5B A;  2QKK A;  3CM5 A;  4DV2 K;  2LSN A;  5AFU H;  4LFB K;  4CZH A;  4CGG A;  4FJH A;  4O8K A;  1SL0 A;  3U3G A;  3VMF B;  4H0X B;  2JGU A;  4FLZ A;  3SCX A;  2OYQ A;  1N33 K;  3WXJ A;  1XHZ A;  1WNS A;  5HRS A;  2RPI A;  1VQ8 N;  1JLG A;  2BH1 A;  2BTF A;  3HO1 A;  2ASM A;  4AHR A;  3J7Z O;  3BF1 A;  3HTV A;  3VF6 A;  4H0Y B;  3ZET A;  2PFU A;  4BG8 A;  4DV7 K;  2WBN A;  2OCE A;  4PL7 A;  3QNO A;  4DSL A;  1S1W A;  4ELV A;  3ZCM A;  1EXQ A;  2QW9 A;  1S22 A;  5EY4 A;  4YOW A;  4FLT A;  4ELU A;  5KGX A;  4I6M A;  3QB0 A;  4A5A A;  5KRS A;  3L6Q A;  1E3M A;  2P9K B;  3S9H A;  3OYD A;  3RSE B;  3CMA N;  3TTF A;  1JXB A;  2CGK A;  3RRG A;  5ADX A;  3VQQ A;  1LW0 A;  2P9U B;  4DQP A;  3MX2 A;  4IDH A;  4GVM A;  4KO0 A;  5M1Q A;  3NGZ A;  5AQK A;  1DLO A;  3M8S A;  1U4B A;  5J1E A;  1Q86 O;  3MK6 A;  3CIP A;  3HOT A;  2F4V K;  2VYP A;  1CZB A;  4CFC A;  3QET A;  5HRP A;  3C6T A;  1N6Q A;  2OPS A;  5EU7 A;  3PIO L;  4DSF A;  2ZM6 K;  5GAH P;  3CC2 N;  2HF3 A;  2VCP A;  3G25 A;  3F9M A;  3MXJ A;  4OLA A;  5M1K A;  4YOV A;  4CGF A;  3SV4 A;  2HHS A;  2AA4 A;  3AAQ A;  4M45 A;  4BC4 A;  1K9M O;  1D9D A;  5LJV A;  1HPZ A;  3NGY A;  1YJN N;  4DV1 K;  1F21 A;  4YDU A;  4CZE A;  1HQU A;  1QSL A;  1VSL A;  3FLC O;  3THW B;  5M1P A;  3LWL A;  4GMJ B;  3HZ6 A;  1HMV A;  2NRZ A;  3CD6 N;  2O8C A;  3J7A P;  1EO1 A;  4BQZ A;  4KB0 A;  1NOY A;  2D0B A;  2NLX A;  4ISG A;  4U7B A;  3MN5 A;  2XO7 A;  2NNW A;  4CZM A;  4BY9 C;  4CIG A;  3G10 A;  4CGI A;  4BRI A;  1S1V A;  4JKE A;  4AQY K;  1RDA A;  2ZF5 O;  1NNE A;  1WSH A;  3M8P A;  4M3W A;  1EWR A;  3M8Q A;  4EIA A;  3T3F A;  1ZBS A;  1SKW A;  1VQK N;  3W0L A;  3VQ4 A;  1RDD A;  3EYZ A;  1XMO K;  2EX3 A;  3HSC A;  4PWD A;  4EP4 A;  1TAU A;  3RRH A;  5KTQ A;  1Z6R A;  4FWP A;  4MDA A;  5BR8 K;  2YKM A;  3WNF A;  1KAX A;  2HHH K;  3VPZ A;  1Z05 A;  1UA0 A;  3NGI A;  1BO5 O;  4JI7 K;  1YVN A;  4O5F A;  2P9K A;  5AQJ A;  3H1V X;  5FRM A;  3OJU A;  1Q81 O;  5DMR A;  3RSE A;  4A2B A;  4KAZ A;  3SJJ A;  3ZSY A;  2HHQ A;  4G1Q A;  3THV A;  3E9P A;  2ITG A;  2W40 A;  1QQN A;  3VQ5 A;  1T3V A;  3NF9 A;  1YIJ N;  5AQM A;  2FBX A;  4WCE L;  5KGW A;  1HNI A;  4KH6 A;  5CYM A;  2YHB A;  1A5W A;  4DSJ A;  5KPZ A;  4CD3 A;  4DR7 K;  1KSP A;  4PUO A;  4YOU A;  1GLF O;  2X6N A;  2PY5 A;  5LJW A;  1YJ9 N;  5M1F A;  1IBL K;  4AM6 A;  5AZI B;  3NH1 A;  4C8N A;  1NG9 A;  3ZYY X;  1BA1 A;  3ZT2 A;  2KHO A;  1YUW A;  5J2P A;  3ID8 A;  5FLX O;  4DG1 A;  3KK7 A;  2KQ2 A;  2A1R A;  1J6Z A;  1SKS A;  1ZXO A;  4CJ4 A;  5C42 A;  2ZJR L;  2WC9 A;  4A62 A;  3THW A;  2YNI A;  2A41 A;  3VQD A;  2KW4 A;  5AQQ A;  5AZJ A;  4B1X B;  3PO5 A;  1BA0 A;  1C0F A;  3THY B;  1WSE A;  4CJE A;  3NF7 A;  2HVH A;  2FLO A;  1Y97 A;  5HBM A;  1TKT A;  4BRH A;  4CJL A;  1VK0 A;  1I94 K;  3HST B;  3WT0 A;  3ATU A;  5JS1 A;  4BQL A;  1KD1 O;  2BGG A;  5JVG L;  4Z0U A;  4JS4 A;  4CJT A;  3H6E A;  1YIT N;  3LDL A;  5AQX A;  4MLE A;  2XY8 A;  1SS6 A;  4CEZ A;  2FBT A;  4NLB A;  2ITM A;  4DF8 A;  1QQM A;  2KZZ A;  3OS1 A;  1VSM A;  2P51 A;  2H3G X;  3LDS A;  4H0V B;  1NGG A;  1NGI A;  5HP1 A;  3NF8 A;  3LAL A;  2GV9 A;  4JKD A;  1RGI A;  3AGR A;  2W6K A;  3LDQ A;  3IFR A;  4BAC A;  3QEV A;  3IKM A;  1IG8 A;  3KTQ A;  4DQ8 A;  1MDU B;  3RVC A;  1KVA A;  3L3V A;  2GEM A;  2E88 A;  3O4N A;  4Y0W A;  4FLU A;  4W5O A;  3CG7 A;  3LP3 A;  3AVI A;  3ID6 A;  1BIZ A;  4IFV A;  3KD1 E;  4AHT A;  3FE1 A;  3H46 O;  4O44 A;  4B1Z A;  3D0P A;  1RBS A;  4JK7 A;  1TVR A;  4H5W A;  4JNE A;  4I9Q A;  3LAM A;  4OGE A;  4BRM A;  4ELT A;  2HHT A;  1A5V A;  1EKE A;  3ZSX A;  3KWI A;  3KZB A;  3MWT A;  4MO4 A;  1GLL O;  3ZX2 A;  3OYC A;  3HOS A;  3PSF A;  5AZI A;  4K25 A;  4BG9 A;  4M7X A;  1NU0 A;  3OYN A;  4M3X A;  1ITG A;  2E1Z A;  3HP9 A;  3VQE A;  1HQE A;  4XH1 A;  1YJW N;  1FW6 A;  5A2Q O;  3FZK A;  3NVM A;  3ITH A;  3SNN A;  4CD1 A;  4DTN A;  4FJG A;  4FSV A;  3NDK A;  1QHT A;  1QE1 A;  1S1X A;  4KTZ A;  4DS4 A;  1KFS A;  5AQZ A;  1X1P A;  4EZ9 A;  3TSP A;  3THY A;  3TTC A;  3KK2 A;  3G6E N;  2E2Q A;  1VSF A;  1JLB A;  1K8K B;  4BR2 A;  4FJ8 A;  3DLE A;  4HTL A;  4K42 A;  1FKP A;  4C23 A;  4E19 A;  4K8X A;  4RG8 A;  1NBW A;  2HW3 A;  1YAG A;  1LOT B;  1J5E K;  1EX4 A;  1RTH A;  4LH4 A;  1KC8 O;  3IG1 A;  3EKS A;  3DXM A;  1S1U A;  1SKR A;  1DGK N;  3LP0 A;  3KKS A;  3VET A;  2XRI A;  3VEX A;  4J2E A;  1RTI A;  1QZ6 A;  4OKE A;  3QFP A;  4A2A A;  3C6U A;  3R8E A;  2ZJQ L;  1T44 A;  3EEQ A;  3A8Y A;  3R6M A;  3TSU A;  2YNG A;  4XIU A;  4FPA A;  1D9F A;  5J2N A;  2YCH A;  4RW8 A;  3VGK A;  2HHX A;  3FZF A;  3ENB A;  4CJU A;  4MQ3 A;  1RDU A;  1RT1 A;  1IKX A;  4BC3 A;  1XI1 A;  4H0T B;  3OYM A;  4GVE A;  2OA8 A;  1CXU A;  1C0G A;  4CJK A;  4CGJ A;  1VQN N;  4FK2 A;  1NK5 A;  1J5O A;  1NMD A;  1Y64 A;  4BRC A;  3M5R A;  4M7Y A;  1EQY A;  1ESV A;  4Z4C A;  4DHY A;  4R5P A;  4MDB A;  3DLH A;  3CET A;  2F9W A;  3CCE N;  3VOV A;  4CEC A;  4CK1 A;  5BPM A;  3JAM O;  1HNZ K;  3O08 A;  2B5J A;  2EWS A;  1LWF A;  1BQM A;  3O80 A;  3NCI A;  1L3S A;  4LF5 K;  5JLH A;  4CFA A;  1S9G A;  5AFU A;  4N56 A;  3DWL A;  4JS5 A;  2A42 A;  2YV0 X;  4CZG A;  3CC4 N;  3O6W A;  3R3L A;  4AHV A;  1T8E A;  3U3Y A;  1GOB A;  2W41 A;  5BPL A;  3CCM N;  3QEP A;  4CF1 A;  4Z4G A;  4X62 K;  2E6L A;  3UKU B;  4CJP A;  1UAX A;  3CF5 L;  5AQH A;  2UXC K;  1MU2 A;  2NZT A;  2E20 A;  3ZLJ A;  5EOY A;  4FWQ A;  4I2Q A;  3QDK A;  4FWK A;  3R9P A;  4JKC A;  4IOX A;  4PQU A;  2P9N A;  2QWL A;  1ATR A;  4BE2 A;  3E1Y A;  1TL1 A;  1RBT A;  1UA1 A;  4JD2 B;  3AO1 A;  3K9K A;  3T69 A;  4LFA K;  2VWJ A;  4LSN A;  1TV6 A;  4BR0 A;  4IBN A;  2GUP A;  2A5X A;  1YTU A;  2F8S A;  4M3T A;  4DTJ A;  1L5U A;  4DSK A;  3HL8 A;  2ZGZ A;  3AVL A;  3SI6 A;  4JK8 A;  3SMS A;  4O0J A;  4CJW A;  3SUN A;  4DV6 K;  2QWP A;  4FVU A;  3VQP A;  4Z4I A;  4C1N I;  3O9U A;  4HTU A;  3H3N O;  3VTI A;  1SL1 A;  5BN9 A;  2ZQB A;  4F8R A;  2ZE2 A;  2QM1 A;  1CXQ A;  2G8K A;  1X3N A;  1JXE A;  3DRR A;  4RW6 A;  2RKI A;  2BUP A;  3LZI A;  2O8F B;  4CEQ A;  4YOX A;  3G0Z A;  5GAE P;  3BUZ B;  1HYV A;  5GIN A;  4DTU A;  3WUH A;  1IBK K;  4J2D A;  3ZSZ A;  4CER A;  3IS9 A;  1U47 A;  3VQC A;  3IRX A;  3BZC A;  3LWM A;  1OH6 A;  4CJF A;  3KHY A;  4DR4 K;  4BVO A;  1OH7 A;  3HPO A;  4KHS A;  3SYZ A;  2GWJ A;  1NJY A;  1VSD A;  1W0H A;  4IG0 A;  1DTQ A;  4OKK A;  3PSI A;  3AVH A;  4I7F A;  1V4S A;  2HBJ A;  3BY5 A;  4CI6 A;  4PY5 A;  5HRO A;  1ASU A;  3DXK A;  5DM7 L;  5SWM A;  4QAG A;  3V1R A;  4DS5 A;  4LC9 B;  1YI2 N;  3VF4 A;  4YOT A;  1L3V A;  3DLG A;  4FJI A;  2DFF A;  1R0A A;  3NF6 A;  4KTW A;  3AAP A;  1T05 A;  1S1T A;  3HVT A;  4XH5 A;  2UXB K;  3SQ0 A;  2KZM A;  4OPJ A;  5BRH A;  4JKH A;  4JD2 A;  5BN8 A;  1X9M A;  1BIS A;  3MED A;  5GAD P;  1CZA N;  1IKY A;  2BAN A;  3O1W A;  4EFH A;  1WSF A;  1ATS A;  2HNZ A;  5K14 A;  3A5O C;  3UKR B;  4NLC A;  3VEO A;  2O8D A;  4YOY A;  4BRE A;  1XHX A;  3TSQ A;  2YNF A;  1KVB A;  4YOR A;  3TAB A;  3C65 A;  5CE3 A;  4E1N A;  2KKZ A;  3TAQ A;  4CBU A;  3IMX A;  3HM9 A;  1JLA A;  5E84 A;  3VQ7 A;  4FJ9 A;  3QER A;  2QWQ A;  4B08 A;  1L3U A;  3SAF A;  4KHQ A;  2BE2 A;  4CES A;  3WXI A;  4CHQ A;  3ALY A;  5EVZ A;  1WUA A;  1NGH A;  1C1A A;  1QHA A;  1HNX K;  3M8R A;  2VG6 A;  4AHC A;  3P38 A;  4E1M A;  4A5B A;  3E66 A;  4DFK A;  1BI4 B;  3AA5 X;  2D0O A;  4JI8 K;  4A59 A;  1BGX T;  3QIN A;  3WNE A;  2KLA A;  4GV6 A;  3AAR A;  3J8A A;  3L0Q A;  4WF9 L;  4BDY A;  4HUG A;  3DLK A;  3QBX A;  4DTS A;  2A6A A;  2ZGY A;  4BR7 A;  1XMQ K;  1NK9 A;  2ASO A;  3T7Z A;  1V4T A;  3EE8 A;  4CZJ A;  1YXQ A;  5LMN K;  1ILY A;  1VQ6 N;  3U4L A;  4W5R A;  4BRN A;  1TAQ A;  4DMN A;  1U2V A;  1NKE A;  2DTU A;  5AQV A;  3QO9 A;  4NCB A;  2QWO A;  4QS7 A;  1Q18 A;  4DFJ A;  4E89 A;  4OGC A;  3RMC A;  4FW2 A;  3I0R A;  4B3M K;  4JI0 K;  4JHD B;  5GIO A;  3V9Z A;  1NLV A;  3CCJ N;  4DQR A;  4B8A B;  3WXL A;  3HXM A;  2HMI A;  1EWQ A;  4OPK A;  1WLJ A;  2KFZ A;  2VG5 A;  3LAN A;  1D4X A;  3TAN A;  4DU3 A;  1TK5 A;  1U49 A;  3TR8 A;  3VTH A;  2F7T A;  2P9L B;  4IEE A;  4JRQ A;  2P9I B;  3CQY A;  3ZEU B;  4PA1 A;  2IC3 A;  1BIU A;  3UKR A;  4DKW A;  3OBY A;  3TI0 A;  1YHQ N;  2Q1N A;  5E41 A;  4H4O A;  3CHW A;  2RHK A;  4CIE A;  3JXU A;  1HNV A;  3WNG A;  4CZK A;  3I55 N;  3VEY A;  1RTD A;  3D2E B;  2HB5 A;  3WEE B;  3ZSO A;  5KPR A;  3O3F A;  5LMU K;  2ASP A;  5FRO A;  2YHY A;  2P9U A;  4GV9 A;  3QIP A;  4AM7 A;  4JRP A;  1VAZ A;  1C1C A;  3MEG A;  4NXN K;  4KHP K;  1VQL N;  1VQ4 N;  4J2B A;  2W42 A;  3AVM A;  3VQA A;  4LY7 A;  1M1K O;  5MLC Q;  1BWF O;  2DY4 A;  1QQO A;  2RF2 A;  4RTF D;  2RN2 A;  4XEI A;  4CHO A;  1T6D A;  3VQB A;  3DM2 A;  4FOE A;  2Q97 A;  1WAF A;  3V6D A;  5DK5 A;  3VEZ A;  1S5J A;  1WAJ A;  4JV5 K;  2QXL A;  1KAZ A;  1S3X A;  4E1J A;  3QEW A;  5TKY A;  4E0D A;  4C8M A;  4MO5 A;  1FXX A;  5AR0 A;  4LD0 A;  2GBZ A;  3SQ2 A;  4LF8 K;  3EKU A;  2E2N A;  3OYK A;  1JLF A;  4RW4 A;  3OHR A;  3V4I A;  2P9S B;  3CJ1 A;  3MDQ A;  2DPN A;  1MA9 B;  2YHW A;  3NVK A;  4EP5 A;  3LP2 A;  3WXM B;  1VRU A;  4WE1 A;  1JCF A;  3CJB A;  3L2R A;  2QK9 A;  3ZX0 A;  1ZBL A;  5IWA K;  4KHY A;  1VQP N;  4BRO A;  2YX6 A;  3L4Q A;  1X3M A;  5TKW A;  4OPH A;  3P31 A;  4FJK A;  1IKV A;  2D4W A;  1QSY A;  4NXM K;  1U45 A;  2NRW A;  3ZEU A;  1C6V A;  3RWU A;  2YJE A;  4CJR A;  1HR0 K;  4Q0B A;  4FWO A;  1TYQ B;  5JVH L;  4KRE A;  3MN6 A;  4BE1 A;  3C7N B;  4B9L A;  3JSM A;  3KLI A;  3FGU A;  4B9U A;  1NGE A;  3HT3 A;  4CGH A;  4O0I A;  1J54 A;  4CEB A;  4H0O A;  3NMU A;  4HCB A;  3LM9 A;  4H5R A;  4H5N A;  3PIP L;  2J4R A;  2JLE A;  1D5A A;  2ETJ A;  2P9P B;  5FPD A;  2XHB A;  5C25 A;  3FZH A;  4FZX C;  3DAW A;  1S6P A;  4A57 A;  3RMA A;  2NUB A;  3LPU A;  3GG4 A;  4JI5 K;  1H1V A;  1IKW A;  3U9Z A;  5HRN A;  4FJL A;  1HJO A;  4FVM A;  1WSJ A;  3RMB A;  1I3A A;  3ULE B;  2YI1 A;  4FWR A;  1IH7 A;  4EHU A;  5F0X A;  3PLA A;  3DOK A;  3OYF A;  1D8Y A;  4X64 K;  4JYA K;  4IJA A;  1DTT A;  3TU5 A;  3NHG A;  4CK2 A;  2FBY A;  4J2A A;  2HND A;  1S6Q A;  1VSE A;  3KIO A;  1RIL A;  1GOC A;  4IDK A;  3J81 O;  3AVK A;  2HNY A;  4CJ3 A;  1VQO N;  4YHH K;  4CEO A;  5FPE A;  2O8B B;  5CYQ A;  2Q0U A;  3CCL N;  3Q7B A;  2OTJ N;  2P9S A;  4E7H A;  4KTQ A;  3TAE A;  1RT7 A;  3KVG A;  3A0I X;  3SBG A;  4IG3 A;  3NH2 A;  3CPW M;  4BRF A;  4OKJ A;  4B3O A;  4BRK A;  4CJQ A;  1N5Y A;  3TWH A;  4B8C A;  3M1F A;  3ENO A;  3A5L C;  2X6S A;  4Y1C A;  3ENH A;  1KRP A;  1C0M A;  5AQL A;  1QS4 A;  5AQF A;  3V1Q A;  3C94 A;  1TUY A;  3MWP A;  4CJ5 A;  4WYB A;  4YY3 K;  4DU1 A;  1N32 K;  3DYA A;  2IS3 A;  1RCH A;  5AQP A;  4HWI A;  2G8H A;  3VN5 A;  1VSH A;  2OZM A;  4DQS A;  5HL7 L;  4KKO A;  4DV0 K;  4YFU A;  5BPN A;  3L2V A;  3MCA B;  3PX6 A;  1KAY A;  3SLC A;  3T1Y K;  3M3Z A;  3C6H A;  3C7N A;  3UIQ A;  3OYE A;  2YHX A;  1N34 K;  3MXM A;  2ATQ A;  3V9U A;  4OVL A;  3VGL A;  2Q2R A;  4M63 C;  4BRP A;  4CZF A;  3LPT A;  3CER A;  2QXF A;  3MEE A;  5B8H A;  1RNH A;  4OX9 K;  3TAR A;  4IOA L;  4L8R B;  1WBD A;  1NJI O;  5BRE A;  3HI0 A;  2P9P A;  5IT9 O;  2HHV A;  3SMP A;  3K5L A;  4HUF A;  2E5L K;  1VSK A;  3D6R A;  4CZI A;  1RT6 A;  3TAF A;  2X74 A;  4JK9 A;  4EZ6 A;  4FJ7 A;  3SUQ A;  1WOQ A;  1DT9 A;  2Q0R A;  2IVP A;  4UQG A;  4CBX A;  1QTM A;  1YTA A;  2V7Y A;  1TKD A;  4QS8 A;  4JKG B;  5KPT A;  3O3G A;  2WUS A;  2E4L A;  4FLV A;  4KB1 A;  2D0A A;  3SQ4 A;  1W9H A;  3AA2 A;  1BCM A;  1Q8I A;  5GIP A;  4FM1 A;  3ULE A;  1UOC A;  2IIR A;  2UU9 K;  1BQN A;  1XNQ K;  3ATV A;  2D0C A;  1RBV A;  1A5X A;  3D2F B;  1JL1 A;  2DFE A;  1WB9 A;  1VHX A;  1S9E A;  4W5Q A;  4DUZ K;  3CFP A; 
#chains in the Genus database with same CATH homology
 2QKB A;  1L3V A;  2EX3 A;  5J2Q A;  4KTQ A;  1XWL A;  3DLG A;  4EP4 A;  4DF4 A;  4PWD A;  2DFH A;  4FJI A;  1TAU A;  2DFF A;  4Q5V A;  1R0A A;  3NF6 A;  4KTW A;  1T7P A;  3ZT0 A;  4HHT A;  1T05 A;  2F96 A;  1S1T A;  3AVF A;  3RRH A;  3HVT A;  5KTQ A;  4N47 A;  4E3S A;  1J9A A;  2FC0 A;  4FYD A;  3SQ0 A;  1VRT A;  4AHU A;  4OPJ A;  2YKM A;  3DI6 A;  3WNF A;  2KZM A;  3K2P A;  3TAM A;  5KRT A;  1UA0 A;  3NGI A;  4H8K A;  4C8K A;  3AVC A;  2I5J A;  3BGR A;  1X9M A;  1BIS A;  1JLQ A;  3MED A;  1NKC A;  1J53 A;  1IKY A;  1REV A;  2BAN A;  1WSF A;  2HNZ A;  1LAV A;  5K14 A;  3CFO A;  3OJU A;  3DOL A;  4FLX A;  5DMR A;  1C1B A;  5FRM A;  4KAZ A;  3SJJ A;  3ZSY A;  4DFP A;  1G15 A;  1GOA A;  4G1Q A;  2HHQ A;  3LP1 A;  3THV A;  2B6A A;  1NK7 A;  2ITG A;  4IFY A;  3VQ5 A;  1RDB A;  3OYA A;  1KLN A;  2PYJ A;  1XHX A;  1YVU A;  4NYN A;  2YNF A;  1KVB A;  3NF9 A;  3IAY A;  3TAB A;  2FBX A;  4E1N A;  3NAE A;  3TAQ A;  4NCG A;  5KGW A;  4B9M A;  3HM9 A;  1JLA A;  1HNI A;  3VQ7 A;  4FJ9 A;  1TK8 A;  2IGI A;  3QER A;  5CYM A;  1IO2 A;  2YHB A;  1A5W A;  4B08 A;  1L3U A;  4DSJ A;  4KHQ A;  4Z4F A;  2BE2 A;  4GW6 A;  4DTO A;  1U04 A;  4CES A;  3L2U A;  3SQ1 A;  1KSP A;  4PUO A;  2X6N A;  1RT5 A;  4CHQ A;  2PY5 A;  3ALY A;  3SPZ A;  4Z4E A;  3O3H A;  3NH1 A;  1O1W A;  4C8N A;  3PX4 A;  1C0U A;  1C1A A;  4M3U A;  3ZT2 A;  5J2P A;  4DTX A;  5CY4 A;  3SZ2 A;  3ZT3 A;  3NH0 A;  3TAP A;  4DG1 A;  3M8R A;  3OVN A;  1LWC A;  2VG6 A;  4BWM A;  4AHC A;  2KQ2 A;  3KK3 A;  2A1R A;  1SKS A;  4CJ4 A;  2VG7 A;  4E1M A;  5C42 A;  4E7I A;  3EY1 A;  4KFB A;  2F8T A;  3ZSW A;  5FDL A;  4DFK A;  1BI4 B;  2YNI A;  3QNN A;  3ZSV A;  3VQD A;  3AA5 X;  4FXD A;  1BGX T;  2KW4 A;  3QIN A;  3C95 A;  3WNE A;  3PO5 A;  5J2M A;  3VQ9 A;  1YT3 A;  4KHW A;  4M3Y A;  3HVR A;  1ZBF A;  4BDY A;  1WSE A;  4HUG A;  3DLK A;  4M41 A;  3NF7 A;  4LH5 A;  4CJE A;  4DTS A;  4B9S A;  2HVH A;  1NK4 A;  2KFN A;  1NK9 A;  4DQI A;  1Y97 A;  5HBM A;  1LWE A;  1RDC A;  1TKT A;  4CJL A;  3NE6 A;  1VK0 A;  3HPG A;  3P5J A;  3OJS A;  3HST B;  3PO4 A;  3T19 A;  3RMD A;  4DU4 A;  5JS1 A;  4CF9 A;  1ZBH A;  4W5R A;  4DMN A;  1TAQ A;  2BGG A;  1NKE A;  2DTU A;  4Z0U A;  1ZBI A;  4JS4 A;  4CJT A;  3QO9 A;  4FLW A;  4NCB A;  2P5G A;  2O4G A;  1X9S A;  3VQ8 A;  4DTR A;  4DFJ A;  4B9V A;  4E89 A;  4OGC A;  3HP6 A;  3RMC A;  5I42 A;  2XY8 A;  4FW2 A;  4CEZ A;  2FBT A;  3I0R A;  4CCH A;  4CHZ A;  3V9Z A;  4CGD A;  4FK4 A;  4DQR A;  4DF8 A;  3K59 A;  4B8A B;  1NK0 A;  4IKF A;  3E01 A;  1RT4 A;  2KZZ A;  2HHW A;  3OS1 A;  1VSM A;  2P51 A;  3L2Q A;  3HXM A;  2D5R A;  3LDS A;  2HMI A;  3ZT4 A;  4FJM A;  5HP1 A;  4OPK A;  3LZJ A;  3NF8 A;  4FK0 A;  2G8F A;  3LAL A;  2GV9 A;  3SV3 A;  4KHU A;  4E7L A;  4TSX A;  1U48 A;  1WLJ A;  3KK1 A;  2KFZ A;  2VG5 A;  1CLQ A;  3LAN A;  3TAN A;  3NFA A;  4DU3 A;  3HPH A;  1NJW A;  1TK5 A;  1U49 A;  4BAC A;  3QEV A;  3QEI A;  4MFB A;  3TR8 A;  4ID5 A;  3JYT A;  3AA4 A;  3ASM A;  4CHN A;  3KTQ A;  4JRQ A;  1KVA A;  3L3V A;  3L2W A;  4O55 A;  4PA1 A;  2IC3 A;  3O4N A;  4W5T A;  4FLU A;  4W5O A;  3CG7 A;  3LP3 A;  3CM6 A;  3DRP A;  2XY7 A;  4CF8 A;  1BIU A;  3AO4 A;  4CJV A;  3AVI A;  1NK6 A;  3TI0 A;  2BDP A;  1BIZ A;  4IFV A;  3V1O A;  3KD1 E;  4F3O A;  3P1G A;  5E41 A;  4AHT A;  4CFB A;  1Q9X A;  4O44 A;  1B9D A;  4H4O A;  3ZSR A;  2FBV A;  4QCL A;  1WSG A;  4KI6 A;  2ZD1 A;  3D0P A;  3AV9 A;  4CIE A;  1RBS A;  2B4J A;  3O4Q A;  1XC9 A;  1TVR A;  1HNV A;  3HK2 A;  3WNG A;  3OYI A;  4I9Q A;  2O4I A;  2Z1H A;  4M42 A;  3LAM A;  4YNQ A;  4F4K A;  3PUF A;  1FKO A;  1RBR A;  3KKR A;  4OGE A;  3OYH A;  3PV8 A;  1ZYQ A;  5HLF A;  4KV8 A;  1RTD A;  3ZSO A;  2HB5 A;  4ELT A;  4FZY A;  4M3Z A;  3O3F A;  2HHT A;  1A5V A;  5FRO A;  1EKE A;  3ZSX A;  1NOZ A;  4HCC A;  3NBP A;  1TGO A;  2G8I A;  3QIP A;  4BWJ A;  3OYC A;  4JRP A;  3I8D A;  3KLH A;  1KTQ A;  1BHL A;  1C1C A;  3OYN A;  4M3X A;  1ITG A;  3MEC A;  1UWB A;  1ZBU A;  3MEG A;  4Y1D A;  1HRH A;  4CHP A;  3HP9 A;  3VQE A;  1HQE A;  3RR8 A;  3AO5 A;  3D45 A;  2KTQ A;  1B9F A;  1TKZ A;  3RR7 A;  4FJ5 A;  1RT3 A;  3ITH A;  2W42 A;  3AVM A;  3VQA A;  3SNN A;  4J2B A;  4LSL A;  4ID1 A;  4LY7 A;  5C24 A;  2Y1J A;  5CZ2 A;  4CK3 A;  2WON A;  2WOM A;  4DTN A;  4CF2 A;  3CYM A;  4FJG A;  2DY4 A;  1SL2 A;  3NDK A;  3RTV A;  1LAW A;  2RF2 A;  1QHT A;  1QE1 A;  1S1X A;  2RN2 A;  4KTZ A;  4DS4 A;  4CHO A;  1KFS A;  4DLG A;  3F73 A;  1X1P A;  4AH9 A;  4EZ9 A;  3VQB A;  3DM2 A;  3KK2 A;  5D3G A;  3AO2 A;  3F9K A;  1WAF A;  3AVB A;  4CED A;  3V6D A;  1JLB A;  1VSF A;  5DK5 A;  1EP4 A;  1QQC A;  2G8U A;  1S5J A;  3OS0 A;  1WAJ A;  3DLE A;  2P5O A;  4FJ8 A;  1FKP A;  2IAJ A;  3QEW A;  2Y1I A;  2GUI A;  4DLE A;  4E0D A;  4C8M A;  1FXX A;  4M3R A;  4CHY A;  4DTP A;  3ZSQ A;  4LD0 A;  1C0T A;  1FK9 A;  4E19 A;  1SUQ A;  3OYL A;  4K8X A;  3HJF A;  2GBZ A;  4RG8 A;  3SQ2 A;  4E7J A;  4F2R A;  2HW3 A;  3OYK A;  1EX4 A;  1JLF A;  4RW4 A;  1SV5 A;  3HYF A;  1RTH A;  4LH4 A;  3KLF A;  3V4I A;  4FJX A;  3IG1 A;  3P83 D;  3B6P A;  1JL2 A;  2PZS A;  4BE0 A;  4FLY A;  4K8Z A;  3AO3 A;  1TL3 A;  3KJV A;  1S1U A;  1SKR A;  4NCA A;  3OY9 A;  3AA3 A;  2OPP A;  3KKS A;  3LP0 A;  4FM0 A;  3OYJ A;  1WSI A;  2XRI A;  1KVC A;  4EP5 A;  4J2E A;  3LP2 A;  1RTI A;  4OKE A;  1VRU A;  4WE1 A;  3L2R A;  2IDO A;  1NJZ A;  4Z4H A;  2QK9 A;  3C6U A;  1ZBL A;  3EYZ A;  4KHY A;  4DWI A;  4B9N A;  3H08 A;  4QOZ B;  5JS2 A;  4FW1 A;  4FJK A;  3L8B A;  1IKV A;  2IOC A;  2YNG A;  4N5S A;  4XIU A;  4JLH A;  4CIF A;  4RW7 A;  5J2N A;  4RW8 A;  1D9F A;  4FJN A;  3K58 A;  1QSY A;  1U45 A;  2Z1J A;  3S3N A;  2PYL A;  4W5N A;  1JKH A;  1C6V A;  2HHX A;  5KI6 A;  3RWU A;  4CJR A;  3QES A;  4Q0B A;  3V81 A;  4CJU A;  4KRE A;  1JLC A;  4MQ3 A;  1RT1 A;  1VSJ A;  1IKX A;  1HYZ A;  4BE1 A;  4ICL A;  5FRN A;  1XI1 A;  2YNH A;  4B9L A;  3JSM A;  3KLI A;  3OYM A;  2E6M A;  1X9W A;  2OZS A;  3V9W A;  5I3U A;  1IG9 A;  3CFR A;  2OA8 A;  1CXU A;  5CZ1 A;  1KFD A;  3HT3 A;  4CJK A;  3U6F A;  4B9U A;  3VQ6 A;  4CGH A;  4CGJ A;  4O0I A;  1J54 A;  3A2F A;  1JLE A;  3OYG A;  4CEB A;  4BDZ A;  4HCB A;  5HRR A;  4CE9 A;  4OLB A;  4FK2 A;  1NK5 A;  1NJX A;  1HYS A;  4FM2 A;  1J5O A;  4F2S A;  1LW2 A;  4DSE A;  2G8W A;  1RTJ A;  4I2P A;  4ZTF A;  4F3T A;  3KLE A;  4RW9 A;  1B92 A;  1D5A A;  2JLE A;  2YKN A;  2ETJ A;  2G8V A;  4H4M A;  4AHS A;  4Z4C A;  4R5P A;  4CF0 A;  3K5O A;  4CEE A;  4I9L A;  2XHB A;  4N41 A;  5C25 A;  3DLH A;  4CEF A;  3S3M A;  4FZX C;  3T1A A;  3V9X A;  4CEA A;  1VSI A;  2OPR A;  1S6P A;  4CEC A;  4CK1 A;  4KI4 A;  4O5B A;  2QKK A;  3CM5 A;  3MXI A;  3PY8 A;  2LSN A;  3RMA A;  2NUB A;  3KLG A;  4CFD A;  3SUP A;  4CGG A;  4FJH A;  2B5J A;  3LPU A;  1SL0 A;  3U3G A;  1NK8 A;  1LWF A;  1BQM A;  3NCI A;  4OJR A;  1IKW A;  1L3S A;  4FJL A;  5HRN A;  2JGU A;  4CFA A;  1S9G A;  5T7B A;  4FLZ A;  4N56 A;  4JS5 A;  3SCX A;  1RBU A;  2OYQ A;  2YV0 X;  1CZ9 A;  4FVM A;  1WSJ A;  3RMB A;  1I3A A;  1XHZ A;  1WNS A;  5HRS A;  3AVG A;  3OS2 A;  2RPI A;  4AHV A;  1T8E A;  3U3Y A;  1JLG A;  1GOB A;  1EET A;  1IH7 A;  3QEP A;  1BCO A;  3HO1 A;  4CF1 A;  4Z4G A;  3DOK A;  3OYF A;  3K5M A;  2E6L A;  1D8Y A;  3AVA A;  4CJP A;  1DTT A;  4AHR A;  3NHG A;  1UAX A;  1MU2 A;  3I0S A;  4CK2 A;  2FBY A;  3DMJ A;  1Q9Y A;  2HND A;  4B9T A;  1S6Q A;  1VSE A;  3FFI A;  3KIO A;  4J2A A;  4I2Q A;  1RIL A;  3WNH A;  1BI4 A;  2Z1G A;  3DRS A;  1GOC A;  4IDK A;  4E7K A;  3QNO A;  2EHG A;  4DSL A;  1S1W A;  2HNY A;  3AVK A;  3ZCM A;  4CJ3 A;  4ELV A;  3S3O A;  4PQU A;  3ULD A;  3TAG A;  1EXQ A;  4CEO A;  1ASV A;  5CYQ A;  4BE2 A;  3B6O A;  3DLB A;  1TL1 A;  1RBT A;  3OYB A;  4E7H A;  4FLT A;  3TAE A;  1RT7 A;  1UA1 A;  5KGX A;  3VA0 A;  4ELU A;  4DSI A;  4FZZ A;  2HHU A;  3AO1 A;  2Q3S A;  4IG3 A;  3MAQ A;  4HUE A;  5SZT A;  1L3T A;  3NH2 A;  3QIO A;  2VWJ A;  4LSN A;  1TV6 A;  4IBN A;  3QEX A;  4OKJ A;  4B3O A;  5KRS A;  3KD5 E;  1T03 A;  4CJQ A;  1YTU A;  3CQ8 A;  3TWH A;  3S9H A;  1N5Y A;  3OYD A;  4O4G A;  4B8C A;  2F8S A;  4M3T A;  4DTJ A;  3BDP A;  1JXB A;  3RRG A;  1K6Y A;  2X6S A;  4Y1C A;  1KRP A;  1C0M A;  1LW0 A;  3VQQ A;  1QS4 A;  1L5U A;  4DQP A;  4DSK A;  1ASW A;  3HL8 A;  3C94 A;  3V1Q A;  4CJ5 A;  4DU1 A;  4GVM A;  2XY6 A;  3AVL A;  4KO0 A;  3DYA A;  4NYF A;  4HVJ A;  2IS3 A;  1RCH A;  3LAK A;  3SI6 A;  2G8H A;  4O0J A;  1VSH A;  3VN5 A;  4CJW A;  3NGZ A;  1DLO A;  4DQS A;  3SUN A;  2OZM A;  3PX0 A;  3M8S A;  1U4B A;  4KKO A;  4YFU A;  4N76 A;  5J1E A;  2AJQ A;  2A1S A;  3VQP A;  3L2V A;  2R7Y A;  4DTM A;  4KHN A;  1BL3 A;  3PX6 A;  4Z4I A;  1CZB A;  4CFC A;  3QET A;  5HRP A;  3C6T A;  1N6Q A;  2OPS A;  5EU7 A;  4HTU A;  4DSF A;  1SL1 A;  3UIQ A;  1WN7 A;  3OYE A;  1HJR A;  2ZQB A;  3ISN C;  3CFP A;  4F8R A;  3MXM A;  2ZE2 A;  4C8O A;  2ATQ A;  3V9U A;  1CXQ A;  3L3U A;  4OVL A;  3MXJ A;  4KPY A;  2G8K A;  2VWK A;  4OLA A;  3SV4 A;  4CGF A;  1JXE A;  4ZHR A;  2HHS A;  3DRR A;  3LPT A;  4M45 A;  2QXF A;  2Z1I A;  4RW6 A;  4AIL C;  1D9D A;  2RKI A;  1HPZ A;  3MEE A;  3NGY A;  1RNH A;  1QSS A;  3LZI A;  3EZ5 A;  3SUO A;  3TAR A;  1KCF A;  3K57 A;  4L8R B;  1F21 A;  4CEQ A;  2XY5 A;  3G0Z A;  4DFM A;  4C8L A;  3QLH A;  2P1J A;  1HQU A;  1QSL A;  1VSL A;  1HYV A;  1RT2 A;  2HHV A;  4DTU A;  4KRF A;  3K5L A;  3LWL A;  4GMJ B;  4HUF A;  3V9S A;  4J2D A;  3AVN A;  3ZSZ A;  1VSK A;  1HMV A;  3DLR A;  3IS9 A;  4CER A;  3SPY A;  1RT6 A;  3TAF A;  1Z26 A;  2X74 A;  3VQC A;  1U47 A;  1Z25 A;  2OPQ A;  1TKX A;  3IRX A;  3LWM A;  2D0B A;  3K5N A;  3SUQ A;  1NOY A;  4EZ6 A;  4FJ7 A;  4CJF A;  3ZT1 A;  1NKB A;  2XO7 A;  1LV5 A;  3HPO A;  4ZTJ A;  4KHS A;  2HVI A;  4UQG A;  4KB0 A;  3SYZ A;  4CIG A;  3G10 A;  1NJY A;  1YTA A;  1TKD A;  1I39 A;  1VSD A;  1W0H A;  1QTM A;  4IG0 A;  1DTQ A;  4CGI A;  4OKK A;  1S1V A;  4FJJ A;  1RDA A;  2YHA A;  4I7F A;  3AVH A;  1KLM A;  1WSH A;  3O3G A;  4DQQ A;  2E4L A;  3M8P A;  4FLV A;  2D0A A;  4KB1 A;  4M3W A;  3M8Q A;  3SQ4 A;  1W9H A;  3AA2 A;  3T3F A;  1BCM A;  4BDP A;  4PY5 A;  5HRO A;  1Q8I A;  1ASU A;  4FM1 A;  1UOC A;  3VA3 A;  4CJS A;  1BQN A;  1SKW A;  1TK0 A;  2D0C A;  1RBV A;  4FCY A;  1A5X A;  1JL1 A;  2DFE A;  4QAG A;  5SWM A;  2X78 A;  3V1R A;  3VQ4 A;  4DS5 A;  1RDD A;  1S9E A;  4W5Q A;  3AVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...