4CE9A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ce9A00
1VSFA 4KB1A 1C1CA 2KTQA 4M3ZA 4C8OA 3DI6A 1X9MA 1EKEA 2YNFA 4CCHA 3VQEA 4DFMA 4J2DA 2HHVA 3DYAA 4FJIA 1VSKA 4K8ZA 3DRPA 1D5AA 3OYEA 3KLIA 5SWMA 3O3GA 4DSFA 3VQ5A 3AVHA 2XY5A 3QEPA 1RTHA 1A5XA 2HW3A 4IFVA 2PZSA 1NK6A 1YT3A 4OPJA 3V9SA 4BDPA 2HHXA 1BQMA 1Q8IA 1X9WA 1TAUA 2D0CA 4FJNA 3NF7A 1RBSA 3O3HA 1KVCA 3ZSZA 3SQ2A 3KK1A 5KI6A 1RNHA 1NJZA 4DSLA 5I3UA 1CLQA 4GVMA 2F8SA 1ZBIA 2FBVA 5D3GA 4W5RA 4E7IA 4LD0A 4CFBA 1WNSA 1SV5A 4LH5A 3OYAA 3VQAA 3V81A 1LW2A 3NH1A 1IH7A 4MQ3A 5CYMA 5FROA 1YTAA 4DF4A 1VSJA 4DQIA 1JL1A 1HPZA 1VSMA 4FK4A 3CM5A 2KFZA 1HQUA 1BISA 4OVLA 4KTQA 4BDYA 1RBTA 2OPQA 3G10A 1NOYA 3V9XA 3SQ1A 4M41A 2DTUA 3L8BA 1HQEA 1RDDA 2RN2A 1IKXA 4DTUA 1BI4A 3QNOA 3OYNA 4BACA 3SI6A 4M3UA 4W5QA 4CJ4A 1BCOA 1F21A 3T19A 1LAWA 3OYHA 4Z4HA 3TAGA 4CJWA 4Q5VA 4EP4A 4OPKA 3HPHA 4CK3A 3U3YA 1U4BA 4B9MA 4F2SA 4E7JA 1CXUA 1NK9A 2E6LA 3MECA 3AVFA 1S5JA 3LZIA 4BE1A 4IG3A 3OYBA 3OYCA 1NKEA 5HRSA 1S9EA 1IKYA 3BGRA 1JL2A 4GW6A 1QSSA 4KAZA 3C6UA 2YV0X 4CK2A 3OYFA 1TV6A 4TSXA 1KLMA 1XWLA 1KVBA 4CEDA 1DTTA 2PYJA 1WSIA 4FJJA 1C0MA 1EXQA 3AVAA 4CHPA 3NDKA 4DS5A 4FJ8A 1X9SA 2ETJA 4JRPA 3NH2A 4CGFA 1JLQA 1JKHA 2P5GA 1A5VA 4PQUA 1SL2A 4B9SA 2VG7A 3SV4A 3TAEA 3SPZA 1NK8A 4CGGA 1JLCA 2G8UA 3ZSQA 2BANA 3HVTA 4Y1CA 1O1WA 1IKVA 2WONA 2Z1GA 1NK5A 3KLFA 5HRPA 4CIGA 1RTDA 3AVCA 3DMJA 3K5LA 1UAXA 1TVRA 4KHYA 4RW9A 3DRRA 3TARA 1IG9A 3RMAA 3D45A 4W5OA 4IG0A 2IOCA 1BIUA 4DQQA 4B3OA 1ASVA 2B4JA 1VSDA 2RF2A 4CEQA 3OS2A 1A5WA 3UIQA 3HYFA 2X6NA 1ZBFA 3M8RA 3HJFA 3LANA 3LP2A 4KRFA 3SUNA 1N5YA 1B9FA 2YNHA 3P1GA 5FRMA 2KQ2A 3AA3A 3LAKA 4ZTJA 2I5JA 4NYNA 4B9TA 2G8VA 4KTWA 1VRTA 4N41A 3AA4A 4FW1A 4DQRA 3M8QA 4QOZB 1HYSA 1BI4B 1HYVA 2YKNA 4DU3A 3QEVA 4DTMA 2OPPA 3U3GA 4WE1A 4RW6A 1JLBA 4FM0A 4YNQA 3HSTB 2BDPA 3RMBA 4FJLA 4CFDA 2P1JA 3TAFA 4CEBA 3E01A 3AVLA 3L2WA 3AO3A 4N5SA 2Q3SA 4CJSA 4DF8A 3ZT1A 4CGJA 3I8DA 1EETA 1TK0A 3B6OA 4PY5A 4FK0A 3K2PA 1Z26A 2VG6A 1D8YA 1J54A 1DTQA 3AVKA 3I0SA 5C24A 4FJHA 5JS1A 3KLEA 3AA5X 1RT2A 4FLZA 4DTJA 1RBUA 1X1PA 2E6MA 4N47A 4DFJA 2G8KA 2QKKA 3LAMA 3OJSA 2VWJA 4M3WA 2ITGA 3L2QA 1QSLA 3HT3A 2LSNA 2IGIA 1GOCA 3KIOA 4O4GA 2G8FA 4CECA 4DSJA 4IKFA 3CYMA 3HVRA 4Z4CA 4KI6A 4NYFA 3OYGA 2IS3A 2OPRA 3VN5A 4W5TA 3O3FA 1U49A 4FLXA 4E1MA 2HMIA 1HRHA 3OYJA 1BL3A 3NAEA 3T3FA 4KHWA 3ZCMA 3K59A 3KKRA 4J2AA 4O0IA 2FBTA 2RPIA 4BWJA 4QCLA 3IRXA 5KGXA 4KREA 2HVHA 3OS1A 3QIPA 1EP4A 2F8TA 5J2NA 1RDAA 1ZBHA 3DLEA 4FZXC 3KKSA 4AILC 3QINA 1I3AA 1FKPA 3NGZA 3S3NA 4CESA 4FM1A 1WAFA 2OZMA 2ZQBA 3QO9A 1KFSA 2F96A 4CJEA 3AO4A 3DLRA 4CJKA 3M8SA 4Z4EA 2FBYA 4CF2A 2D0AA 1BGXT 3ZSVA 1W9HA 4CF9A 3JYTA 4FLTA 3TANA 3L2RA 4RW4A 1S1VA 2HHSA 4HTUA 4CEAA 3JSMA 1U45A 2O4IA 2B6AA 4F3TA 4E89A 1CZBA 1REVA 1RBRA 3L2VA 2HHUA 5HLFA 3ZSWA 1CZ9A 3O4NA 1LWCA 4CIEA 3MEGA 3TWHA 2P51A 4CHZA 1ZBLA 1QQCA 2HVIA 2ZE2A 1JLEA 3RMCA 4KPYA 1ASWA 4FJKA 3PO5A 4KI4A 4CE9A 4YFUA 1XC9A 4FJ7A 1RTIA 3SYZA 4CF0A 3AVNA 4CF8A 1RBVA 1LV5A 1J5OA 2X78A 3MXJA 4ELUA 3B6PA 2EX3A 1J53A 5HP1A 2QKBA 3LZJA 4PA1A 3KLGA 1TKTA 3SUPA 4F2RA 3RWUA 3LP3A 1W0HA 3AO5A 5CYQA 4CEOA 4CJ3A 4B08A 3K58A 3SCXA 3MXMA 1CXQA 3CFRA 4HCCA 3SUQA 3K5OA 1G15A 3ULDA 5J2PA 1Q9YA 1WAJA 1QTMA 4J2BA 1BIZA 2FBXA 3AVJA 3EY1A 3QNNA 1QE1A 3DOLA 4C8KA 4PWDA 2ATQA 5CZ2A 3ITHA 4FLUA 3RRHA 3QESA 5DMRA 4Z0UA 3H08A 4KV8A 4OKKA 3KK2A 1NK0A 4DQPA 2O4GA 4DTOA 3RR8A 3ZT4A 1ASUA 5HRNA 3SNNA 4ELVA 3VQCA 4ZTFA 3QERA 2BGGA 3C95A 1WSHA 1XI1A 2GUIA 5HBMA 1S1TA 1NKCA 5C42A 1B92A 1C0TA 3S3MA 4H4MA 3SUOA 3WNFA 1S6QA 4CK1A 1NJWA 4B9VA 3NH0A 3FFIA 1RDCA 4O5BA 3RR7A 4G1QA 2HHTA 5J2QA 4DSKA 1HYZA 4KHUA 1JXBA 4CJ5A 1XHXA 1KRPA 3ISNC 1BCMA 3HP9A 1J9AA 1FK9A 3HL8A 3SQ4A 4HCBA 1VSEA 3CFPA 4GMJB 4CJUA 1S9GA 3IAYA 3QEWA 5K14A 4FYDA 1LAVA 1WLJA 3MAQA 4OKJA 3CQ8A 4E3SA 2P5OA 2OYQA 2DY4A 4BDZA 4DG1A 5E41A 4DQSA 1QSYA 4HHTA 1T03A 5T7BA 2Z1JA 4ZHRA 3A2FA 3P5JA 4NCBA 1GOBA 2OA8A 3OJUA 3SPYA 1SUQA 4NCAA 1KLNA 3OYIA 3THVA 2WOMA 2HHQA 5KTQA 4OLAA 2OPSA 4E7LA 1YVUA 3PO4A 3RRGA 1T05A 4Z4IA 4AHTA 3V1QA 4IFYA 1WSJA 2D0BA 4H4OA 3ZT0A 3VQDA 3TR8A 2XO7A 2YNGA 4CJFA 3QEIA 3DRSA 3NBPA 3VQPA 2GV9A 1YTUA 3TI0A 4Q0BA 2JGUA 3VQ8A 1VSHA 4L8RB 4KHSA 3BDPA 4CJRA 4ID1A 4C8MA 4FJ5A 2YHAA 4AHUA 4UQGA 4R5PA 4OKEA 2KZMA 2XRIA 3CG7A 2XY6A 1IO2A 4BWMA 2E4LA 3TAQA 3SJJA 2KFNA 4W5NA 3WNGA 1L3UA 3S9HA 3F9KA 1FXXA 2Z1IA 3AVIA 3DM2A 3ZT2A 3DLKA 4E7HA 3AO2A 4OJRA 3OY9A 4KTZA 4QAGA 5KGWA 1KVAA 4CGHA 3KD5E 1RTJA 1HNIA 1DLOA 4E0DA 4Z4GA 3PY8A 3V9ZA 3KK3A 3V1OA 1QHTA 3KD1E 5EU7A 2YNIA 4B9NA 4CEZA 1JLFA 1Q9XA 3HPOA 2ZD1A 3LP1A 1ZBUA 3U6FA 4NCGA 2XY7A 3QLHA 3L2UA 2Y1IA 3QIOA 3K57A 2AJQA 1NOZA 3ALYA 3OYLA 4C8NA 4DWIA 4H8KA 1S6PA 1IKWA 4JRQA 4DFPA 4JS5A 3PUFA 2HNYA 3NFAA 1NJXA 3SQ0A 3V9WA 2YKMA 4ICLA 5C25A 1FKOA 5JS2A 3LWMA 4DTRA 5I42A 4OGCA 4Z4FA 3AO1A 3V4IA 3K5NA 3OYKA 3P83D 4I9LA 4CEFA 4CGDA 4O44A 2HNDA 4DTNA 3LPTA 2D5RA 3DLGA 3NGYA 3MXIA 1QS4A 1S1XA 1TL3A 1EX4A 1RT6A 4DU1A 3QETA 3DLBA 3CFOA 1SKWA 2VG5A 4CF1A 4DFKA 4I9QA 1XHZA 5KRSA 3OS0A 4DLEA 1SKSA 2HB5A 4ELTA 5KRTA 2Z1HA 1K6YA 1VSLA 4IBNA 1C1AA 3ZSOA 1TKDA 3C6TA 4M45A 4FJXA 3NF8A 1D9FA 1BHLA 4E19A 1GOAA 1TK8A 3VQBA 4BE0A 2DFEA 4O0JA 4EP5A 4CIFA 2QK9A 1C6VA 4M42A 4M3YA 2DFFA 3KLHA 1U04A 1WN7A 4AHCA 4B9LA 4DLGA 2KZZA 3CM6A 4M3TA 1RT3A 2DFHA 3EZ5A 3D0PA 5DK5A 4E1NA 1WSEA 4LY7A 2QXFA 3KTQA 5FRNA 2JLEA 1Z25A 3NCIA 3MEEA 1RILA 4I2PA 3SZ2A 3WNHA 3NF9A 4ID5A 4O55A 2VWKA 5FDLA 3HP6A 3NGIA 3V9UA 3I0RA 3PX6A 1KSPA 1RDBA 2Y1JA 2PY5A 1U47A 2RKIA 4DMNA 4HUGA 4EZ6A 4DTSA 4JS4A 1SL1A 3K5MA 1D9DA 4IDKA 5CY4A 4MFBA 4CJPA 2IAJA 2IC3A 3T1AA 2W42A 3V6DA 4F3OA 4CEEA 3VQ7A 4FZZA 4CJTA 4C8LA 5J1EA 1KFDA 2G8WA 4OGEA 4EZ9A 1NKBA 1TKZA 2X6SA 4CFCA 1I39A 4HVJA 3HPGA 4M3XA 4AH9A 1UA1A 4I7FA 1RT4A 3ZT3A 4DSIA 1TAQA 4B8AB 3AA2A 3RMDA 3RTVA 1T7PA 4F4KA 4F8RA 2HHWA 4HUFA 3WNEA 3M8PA 2R7YA 2XHBA 3IS9A 4FCYA 1LWFA 3NHGA 4DTPA 4FZYA 1JLGA 1ITGA 3MEDA 1HNVA 4CGIA 4FK2A 2YHBA 1LW0A 1JXEA 2IDOA 1S1UA 1N6QA 2NUBA 2X74A 1VRUA 3LPUA 2EHGA 4AHRA 4CJVA 3PX4A 1T8EA 1UOCA 4KKOA 4FJMA 4AHSA 1HJRA 1LWEA 1VSIA 1NJYA 4CHQA 4RG8A 3O4QA 3HM9A 3PV8A 1L5UA 1NK7A 3VQ9A 1C1BA 1R0AA 1B9DA 4N56A 3VQQA 4B8CA 3KJVA 4DU4A 5CZ1A 1MU2A 1KTQA 4J2EA 1L3TA 4LH4A 3AVMA 3L3VA 4M3RA 3TAMA 3ZSYA 1WSGA 3S3OA 3OYDA 1L3SA 3C94A 3F73A 3OVNA 4N76A 1VK0A 1U48A 1TL1A 1RT1A 4Y1DA 4FLVA 4FLYA 1UWBA 3OYMA 2HNZA 5J2MA 2A1RA 4KO0A 1ZYQA 4DTXA 4E7KA 3NF6A 3ZSRA 3HXMA 1HMVA 3VA0A 4DS4A 4FXDA 3LWLA 3VA3A 4XIUA 2B5JA 4KFBA 4CHNA 4PUOA 3PX0A 4CFAA 4FVMA 4CJLA 1L3VA 2KW4A 3L3UA 1RT5A 3G0ZA 3LP0A 4JLHA 1SL0A 5HROA 1RCHA 1Y97A 2PYLA 4FJGA 1TKXA 1BQNA 4CHYA 4HUEA 1UA0A 3EYZA 3DLHA 1TK5A 1TGOA 4RW8A 2OZSA 4BE2A 2A1SA 4RW7A 3TABA 2G8IA 5SZTA 1WSFA 4CHOA 3NE6A 1RT7A 4I2QA 3ASMA 3V1RA 3ZSXA 2BE2A 3HO1A 3AVGA 1S1WA 1NK4A 1C0UA 2FC0A 1KCFA 4LSLA 4KB0A 2G8HA 1SKRA 4LSNA 3AV9A 4AHVA 3LALA 4CERA 4FM2A 4FJ9A 4OLBA 3HK2A 4DSEA 5HRRA 3LDSA 3AVBA 3VQ6A 3VQ4A 3SV3A 3DOKA 2GBZA 2XY8A 4CJQA 3TAPA 4K8XA 4KHNA 4KHQA 3IG1A 1JLAA 3QEXA 4B9UA 4FLWA 4FW2A
chains in the Genus database with same CATH superfamily
1VSFA 4JV5K 3DI6A 1EKEA 4LF4K 4CCHA 4J2DA 1RDWX 5SWMA 4DSFA 3VQ5A 1A5XA 1NK6A 2F4VK 3FZLA 4BDPA 2HHXA 1X9WA 2E88A 3R8EA 3QFUA 2NLXA 1CLQA 4GVMA 2E2OA 5D3GA 5GINA 3R3LA 4W5RA 4LC9B 4LH5A 3ENHA 3CM5A 2KFZA 4KTQA 1NOYA 3SQ1A 1W2BM 5DM6L 3CXCM 3OYNA 4BACA 2AA4A 4W5QA 4CJ4A 3G25A 5AZIB 4CJWA 4F2SA 3U3YA 3CJ9A 1CXUA 2KLAA 3M6GA 1EQYA 3MECA 3CCQN 1S5JA 3VERA 3HRGA 3OYBA 4CZHA 2QA4N 3CCVN 2GX9A 4A61A 4OPAA 1IKYA 4GW6A 1JL2A 2IVPA 1NLVA 2YV0X 3OA9A 4RWTA 1N36K 4FWPA 4CEDA 2PYJA 1C0MA 4FJ8A 4CHPA 3SAGA 5BRDA 1X9SA 4JRPA 3NH2A 5ADXA 4OX9K 3CD6N 3O1WA 1V4TA 2VG7A 3SPZA 3THYA 1JLCA 2UUCK 2Z1GA 4YOUA 3HTVA 5HRPA 4CIGA 3DMJA 1TVRA 4KHYA 1XUPO 3RMAA 2P9UA 1QVFM 1BIUA 4FOIA 1BA0A 1ASVA 1QQOA 5AQHA 3SUNA 3H1QA 1B9FA 3F9MA 5FRMA 3LAKA 2I5JA 4NYNA 3M8QA 3B8AX 4DU3A 3U3GA 4WE1A 3ULEA 3RMBA 4CFDA 4CEBA 3E01A 3ATVA 3Q7CA 4H5TA 3E1YA 1TK0A 5CR4A 1J54A 5C24A 3AA5X 4FLZA 3OW2M 1X1PA 2G8KA 4ILGB 3LAMA 4YDUC 3VF6A 3OJSA 2VWJA 2G8FA 4FJ5A 3HT3A 2IGIA 1GOCA 4JAXA 3HVRA 4Z4CA 4KI6A 4EHUA 2IS3A 4W5TA 3VN5A 3O3FA 4BY9C 4YDUA 3SBGA 1HRHA 1EWQA 2YJFA 4B1ZA 3K59A 4J2AA 4O0IA 4BWJA 4QCLA 3CERA 1VAZA 4KREA 3OS1A 3QIPA 3VOVA 1RDAA 1ZBHA 3O1BA 1OKJA 1P90A 3QINA 4DUZK 3ZETB 4CESA 4FM1A 3DXKA 3WQTA 5BN8A 4DR5K 4H5NA 1KC8O 3AO4A 2FSNA 5AQVA 1BGXT 1NJIO 4CEAA 5AQMA 3L2VA 2HHUA 5HLFA 1ZXOA 1NGCA 3O4NA 1LWCA 3MEGA 3D2FA 1QQCA 4CZEA 2CGLA 1M1KO 1HNXK 3PO5A 4FJKA 1R59O 3K9JA 4MDAA 4FK2A 3AVNA 2X78A 3SJHA 3LZJA 5AFUA 4F2RA 1W0HA 5EOYA 4JKGB 4B08A 1CXQA 4WQ5A 3VMFB 3WEEA 1G15A 3SAFA 5J2PA 1WAJA 3WXIA 2FBXA 3DOLA 3RRHA 5DMRA 4KV8A 2YCHA 4DTOA 3RR8A 3UE5A 3SNNA 2IVNA 3VQCA 4ZTFA 2BGGA 2GUIA 1NKCA 4QS8A 2ZJRL 3F5TA 4DV1K 3UKUA 1RDCA 2A5XA 4KH4A 4BR9A 2HHHK 1VQ6N 1HYZA 4KHUA 4IEEA 3ISNC 3HP9A 1BOTO 4HCBA 4BRCA 4BRFA 3QEWA 5K14A 2PFUA 4FYDA 1LAVA 4E3SA 3VEVA 4BDZA 4LFCK 4DQSA 1T03A 3C7NB 2O8DA 3A2FA 4MLEA 2OA8A 3SPYA 4NCAA 3OYIA 4IEIA 1HX1A 2WOMA 4BRDA 1T44A 1VHXA 5FLXO 4OLAA 3VEOA 3PO4A 4Z4IA 4BC3A 2XO7A 2YNGA 4CJFA 4DR2K 3NBPA 3CJBA 2GV9A 3TI0A 1J6ZA 3O9SA 2JGUA 3VQ8A 4BC4A 4Q0BA 4AHUA 1GLJO 4R5PA 4UQGA 2D4WA 2UYTA 4BWMA 2KFNA 3AGRA 4BC5A 1YI2N 3OY9A 4OJRA 4QAGA 1RTJA 3FZKA 3EKUA 1DLOA 3DXMB 5KPTA 2ZJPL 5FPDA 4BR2A 3HPOA 3FZHA 5BN9A 2QWQA 3ALYA 4H8KA 3GBTA 4JS5A 3NFAA 1GLDG 3SQ0A 3V9WA 5I42A 4GVEA 3JAMO 1BO5O 1E3MA 5LJVA 2HBMA 3I56N 3MXIA 3ZEUA 3QETA 2WUSA 3CFOA 2VG5A 4BVOA 4I9QA 3NF8A 1BHLA 1GOAA 4PL7A 1TK8A 3VQBA 4EP5A 4CIFA 4CI6A 3CIPA 2KZZA 3THXB 1U04A 2JWLA 4B9LA 2P9NB 4H0XB 5MLCQ 4M3TA 2DFHA 4A57A 2E2PA 5DK5A 2VYPA 2I7PA 4IJAA 1MA9B 1C0GA 1N34K 4DV2K 2FLOA 2JLEA 3O08A 2EWSA 4NLCA 4I2PA 4ID5A 3V9UA 3I0RA 1ESVA 1RDBA 5AQOA 2YHYA 2PY5A 2UUBK 4IDKA 5AZJA 4MFBA 1I94K 1K9MO 4CEEA 4HWIA 2QEXN 4OGEA 2X6SA 3O9UA 4CFCA 1Q82O 2WFBA 3J81O 4AH9A 4I7FA 3ZT3A 4ISGA 1TAQA 4B8AB 1YITN 4FOEA 4HUFA 3EKSA 2XHBA 1LWFA 4LF6K 4XH5A 1KAXA 3MEDA 4DV5K 3G6EN 1JXEA 2YHWA 2NUBA 3JS6A 1UOCA 4FJMA 2WTUA 4C1NK 5LMUK 3PV8A 1NK7A 5AQFA 3ZSYA 3TAMA 2UXBK 1G99A 3OVNA 2UXDK 1J5EK 1D4XA 3I8BA 1RDUA 1RT1A 4Y1DA 4FLVA 1UWBA 1ZYQA 2QXLA 3HXMA 3VA0A 3MCAB 4BRNA 4O8KA 4PUOA 3LDNA 4FVMA 4CJLA 3L3UA 3LP0A 3FZMA 4JLHA 3CF5L 3ZX2A 2FF3B 3EYZA 1TGOA 3H46O 4QS7A 2A1SA 3F2KA 5BRFA 3VESA 2HBLA 4CHOA 1NM1A 2WBNA 1VQ4N 3ASMA 4FO0A 2BE2A 1DKGD 1HPMA 5AQJA 4AHVA 4CERA 4FJ9A 2W6KA 3CJ7A 3QEXA 1JLAA 3U9ZA 4FLWA 1QSSA 4KB1A 3GOIA 2KTQA 4M3ZA 3HOSA 1X9MA 4LF5K 3DYAA 4GV9A 3DAWA 4KHPK 2O8BA 1YJWN 4JK9A 1XNRK 3QEPA 4DR4K 1SAZA 2PZSA 3GL1A 5M1OA 4ILJA 1YT3A 4M7XA 2NRTA 1Q8IA 1TAUA 3EN9A 3CJ1A 4JK7A 2D0CA 3LM9A 3NF7A 4FJNA 1RBSA 3SQ2A 4WCEL 1NJZA 5BR8K 4DSLA 2D0PA 2F8SA 5C2DA 3MWPA 4DR6K 5BRHA 4CFBA 4BG9A 3VQAA 4R79A 1JL1A 1HPZA 1BISA 3C7NA 4OVLA 1RBTA 3V9XA 3L8BA 2DPNA 1IKXA 1GLEG 3VGLA 1BI4A 1NBWA 3SI6A 5DM7L 3DJCA 1F21A 2GEMA 3OYHA 1LAWA 4Q5VA 4KRFA 4OPKA 3DWLA 1W97L 3AVFA 1TUYA 3MN7A 3CC4N 2O8EA 5ELZA 1TYQA 2V7ZA 4UY8O 3D2EA 3PLAA 3G71N 3E9LA 1WOQA 2QW9A 2ITMA 4CBWA 4KBOA 4FPBA 4J8FA 3OYFA 4TSXA 4V19S 1VQLN 1WSIA 1EXQA 4CGFA 1VQON 3BP8A 4B1YB 4PQUA 4B9SA 1NK8A 4CGGA 4IOCL 2G8UA 3HVTA 1U6ZA 1O1WA 4X62K 4H5WA 3H45C 3AVCA 3BEXA 3K5LA 3PSFA 4JI2K 2QWPA 4NB4A 3LDLA 5AQSA 3UIQA 4YOWA 3HJFA 1ZBFA 4IFEA 2HSTA 1N5YA 1Y64A 2KQ2A 4B9TA 5LMNK 4FW1A 1HYSA 4FM0A 1JLBA 3O6WA 4B3MK 2P9LB 3HSTB 3WXJA 2P1JA 2FSJA 4A5AA 4N5SA 4CJSA 4AM6A 3I8DA 4CGJA 1BU6O 3B6OA 3K2PA 1Z26A 3I0SA 2A6AA 4GNIA 3KLEA 1RBUA 4JKDA 4N47A 3THXA 2QKKA 2ITGA 3L2QA 2LSNA 4O4GA 2E2NA 2HF3A 1X3NA 4NYFA 3OYGA 1U49A 3K9KA 4FLXA 4E1MA 3VTIA 4A5BA 5HOOA 3CPEA 3O5BA 3T3FA 4KHWA 1KAZA 2FBTA 4CJ7A 2QWNA 3IRXA 5KGXA 4LF8K 4WYBA 5J2NA 3DLEA 4FZXC 1KD1O 3KKSA 4AILC 3NGZA 1FKPA 3P39A 2H3GX 3DLRA 4CJKA 3S41A 3JYTA 3IUCA 4FLTA 3FR0A 5IT9O 4RW4A 4HTUA 1NG9A 3JSMA 1U45A 2O8FA 1TUUA 1CZBA 1REVA 2P9IB 3WXKA 3C65A 3TWHA 2ZWHA 1ZBLA 4WFBL 1K8KB 3WQUA 4O8UA 1JLEA 3EL2A 2JWKA 3CMEN 4YFUA 5E26A 4FJ7A 1RTIA 3SYZA 1RBVA 5AQYA 2W40A 1IV0A 2EX3A 4XH4A 1Z6RA 1TKTA 3KLGA 3SUPA 3LP3A 2BUPA 4HCCA 3MXMA 4KH5A 3ULDA 4B3SK 1HNWK 3ZX0A 1QTMA 3LL3A 1ATSA 4I6MB 1BIZA 3AVJA 4A2AA 3QNNA 2ASMA 2ATQA 5CZ2A 3N4PA 3H08A 4DQPA 2O4GA 2HMPA 3Q7BA 3WXLA 1ASUA 1GLBG 1VQMN 2IVOA 1O13A 1WSHA 4DKWA 5C15A 1OH6A 4CK1A 1NJWA 3EE9A 4O5BA 3RR7A 1XMQK 5LL6Z 5JLHA 1YHQN 1JXBA 1QHAA 3SMPA 4EAHD 5BREA 5M1QA 5AQIA 3HL8A 3SQ4A 1V4SA 1VSEA 4GMJB 3IAYA 1WLJA 4CZJA 3MAQA 2P5OA 1IBMK 4B3TK 4DR1K 1QSYA 5T7BA 3RSEA 4ZHRA 3SBTA 3P5JA 3QMLA 5AJ3K 4AQYK 5KTQA 4IJNA 2OPSA 5EX5A 3ZX3A 3RRGA 4IFYA 3VETA 2P9SB 4BQLA 4JEPA 1YTUA 4JI0K 4L8RB 1VSHA 3BDPA 4C8MA 2E1ZA 2FXUA 5AQQA 1IBKK 4OKEA 4BR0A 2XY6A 3TAQA 4W5NA 3WNGA 4DV0K 3F9KA 1FXXA 4JHDB 3VEXA 3ZT2A 2ZF5O 4CBXA 5HL7L 2P9KB 2OANA 4LFBK 2V7YA 1QHTA 4FWSA 2F9TA 3CQXA 4JKCA 3LP1A 3K0SA 3U6FA 3L2UA 2Y1IA 2AJQA 4K0KK 3OYLA 2HF4A 4C8NA 4CZFA 1NJXA 2BH1A 4C23A 5C25A 1FKOA 3LWMA 3SMSA 4DV4K 1YAGA 1YIJN 3K5NA 4PKGA 2GWKA 1NWKA 2KKZA 2HNDA 4CGDA 4JKFA 2D5RA 3DLGA 3NGYA 1T6DA 5F2RA 1S1XA 1RT6A 4DU1A 1DEJA 4CF1A 3VEWA 5KRSA 3OS0A 2Z1HA 1VSLA 4IBNA 4E19A 4FVUA 3J80O 1U2VB 3HSCA 4WQ5C 5AQUA 1WN7A 4AHCA 3ZYYX 4DR7K 3D0PA 3IDHA 3QFPA 2YHXA 1VQ7N 1YUWA 1NMDA 2D0OA 3KTQA 1MWMA 3H3OB 3MEEA 5GAHP 3WNHA 3BF3A 3HP6A 5TKWA 3PX6A 2RKIA 4DMNA 1E4GT 4DTSA 1SL1A 4JYAK 4BC2A 5JLFA 2O8CB 3I33A 4CJPA 3A5MC 4CZLA 3T1AA 5KQDA 4F3OA 1HLUA 4C8LA 4EZ9A 1TKZA 1I39A 2VGMA 4DV3K 4HVJA 4M3XA 1T7PA 5EXWA 3R6MA 3TTCA 4YORA 3EEQA 4CVNE 3MN5A 1JLGA 1ITGA 4BR4A 1LW0A 2IDOA 1S1UA 4JI3K 2EHGA 4KKOA 4AHSA 1LWEA 1VSIA 1NJYA 3HM9A 3CCEN 1B9DA 4EIAA 4B8CA 3KJVA 2P9PB 1JJ2M 1L3TA 3AVMA 3L3VA 1WSGA 3VPZA 3OYDA 3C94A 4CD3A 3F73A 5C12A 3SAHA 3J7AP 4IWVA 1Q7YO 2HNZA 4FPAA 4KO0A 4E7KA 4DS4A 3W3DA 4XIUA 4JI6K 3MMVA 4CHNA 5BPNA 3J7ZO 1L3VA 1NU0A 3G0ZA 1FW6A 1RCHA 1Y97A 4B3RK 2NRXA 3QICA 2G8IA 2IIRA 1WSFA 5BR9A 3NE6A 1RT7A 2CH5A 2W41A 4H0TB 4KB0A 1KCFA 5AZIA 2G8HA 1NMNA 5HRRA 4JKEA 1SZ2A 4K25A 5H1SQ 3VGKA 4BRKA 4A62A 5C10A 2GBZA 2QTDA 4KHNA 3UKRB 4K8XA 4KHQA 3IG1A 2ASPA 4BG8A 3KWGA 2I7NA 4FJIA 1VSKA 3OYEA 3KLIA 3O3GA 3ATUA 4DB3A 4IFVA 4OPJA 3V9SA 3THWB 1BQMA 2CGKA 4BR7A 3O3HA 1KVCA 3ZSZA 1VQ9N 1ZBIA 2FBVA 4BRGA 3OBWA 2ZM6K 1X9JA 3CC2N 1WNSA 3OYAA 1LW2A 2Q31A 4MQ3A 5CYMA 1YTAA 4DF4A 1VSJA 4DQIA 4FK4A 1HQUA 1KQSM 4BDYA 4BVPA 4M41A 1HQEA 1RDDA 4GV3A 4DTUA 2WC9A 4M3UA 4FWLA 1BCOA 3T19A 4Z4HA 4B9MA 1U4BA 3HPHA 3AAPA 3CQYA 1N8RO 3W0LA 3LZIA 1HUXA 3C0BA 4YOXA 1ILYA 3HM8A 1QQNA 4KAZA 1TV6A 3OBYA 3OTOK 1XWLA 1KVBA 1DTTA 4WQ4A 3NDKA 4DS5A 2ETJA 5BPLA 1JKHA 4H0YB 3IKMA 4BRPA 1A5VA 4L3QA 3TAEA 1BUPA 4Y1CA 1IKVA 1NK5A 4JN4A 4H0VB 3KLFA 1UAXA 3ZETA 5JVGL 4RW9A 3DRRA 1NGGA 1IG9A 4IXCA 4W5OA 3L6QA 2B4JA 3OS2A 2RF2A 4CEQA 1A5WA 3HYFA 3LANA 3LP2A 4MO5A 4CZIA 3MK6A 2YNHA 4ZTJA 2G8VA 4KTWA 1VRTA 5M1KA 3AA4A 3QEVA 4CZKA 4FWNA 4DTMA 3U8XA 3CI5A 4HTLA 3J8AA 4DF8A 3AO3A 3ZT1A 4PY5A 1EETA 4FK0A 1BG3A 4OPHA 3D6RA 1D8YA 2VG6A 3A5LC 1U2VA 3SK3A 4FJHA 5JS1A 4DTJA 2F9WA 4DFJA 2E6MA 4M3WA 3P31A 3KHYA 4JKGA 4ILHA 4IKFA 4CECA 2QWLA 2OPRA 4JNEA 3NAEA 3CJCA 3ZCMA 3KKRA 3THYB 2RPIA 4WF9L 3CCLN 2HVHA 5AQLA 4YOVA 2O8CA 3LM2A 3S3NA 1BWFO 1WAFA 3VTHA 2P9UB 2ZQBA 2OZMA 1H1VA 4CZGA 3M8SA 4CF2A 2D0AA 3ZSVA 4PHTX 4CF9A 3TANA 1HKCA 1S1VA 1VQKN 3U4LA 2O4IA 2B6AA 5AQWA 3ZSWA 1CZ9A 3ULEB 5KQ8A 2HBJA 4CIEA 1JCEA 2ZE2A 3GDQA 5LJWA 4LFAK 4KPYA 3BF1A 1T6CA 4CE9A 4RCHA 3I55N 4JI4K 1HR0K 4CF8A 2P9PA 5HP1A 1J53A 3RWUA 3AO5A 5CYQA 4CJ3A 5BPMA 4G9ZA 3SCXA 3O80A 5M1FA 2PAVA 3K5OA 1E4FT 4PKIA 4J2BA 2Q1NA 4PWDA 1S72N 1QE1A 1HKBA 4FLUA 3DLLL 4PKHA 1NK0A 3T69A 3CCMN 4BRIA 1JCGA 3ZT4A 4ELVA 4H0OA 3QERA 3C95A 2BTFA 1XI1A 1S1TA 5C42A 3TU5A 3S3MA 4U67L 3SUOA 3NH0A 3FFIA 3DXMA 3P38A 1HJOA 2HHTA 5J2QA 4DSKA 4CJ5A 1J9AA 3QDKA 3CFPA 1S9GA 5AQTA 4K41A 2OYQA 4BRHA 2ZGYA 4DG1A 1MWKA 5FPEA 4MLHA 3TSQA 3EZWA 3BY5A 4U7BA 3CC7N 4NCBA 1SUQA 3AY9A 1KLNA 4NXNK 3THVA 1Z05A 1X3MA 2YI1A 3WUHA 2ZJQL 3A5NC 4E7LA 1T05A 4K43A 1WSJA 3WEEB 5GIOA 3VQDA 3TR8A 3THWA 3ID6A 2UUAK 3KK7A 4FL9A 3TPQA 4ID1A 5ADXH 2P9NA 4XEIA 4DCHA 1IO2A 2E4LA 3MCPA 3E9PA 1T3VA 1L3UA 3S9HA 2Z1IA 2YJEA 2GWJA 3DLKA 4E7HA 4KTZA 3KD5E 5KGWA 1KVAA 4CGHA 1HNIA 1VQPN 3UKUB 3PY8A 3V9ZA 3KK3A 4M63C 5EU7A 3E9OA 4CEZA 1S22A 2ZD1A 1S3XA 3QLHA 4WFAL 4JD2B 3QIOA 3K57A 3ENBA 4DWIA 4JRQA 1IKWA 2OTJN 3PUFA 2HNYA 2GUPA 1SS6A 2NNWA 2YKMA 4ICLA 5JS2A 4OGCA 3P83D 2Q2RA 4I9LA 4CEFA 4DTNA 3LPTA 5JMVA 3DLBA 1QQMA 4B9QA 5KPRA 2HB5A 5KRTA 1K6YA 3PIOL 1C1AA 5AQZA 3ZSOA 3C6TA 2GTDA 4A59A 3WT0A 5A2QO 4OO1J 4FWQA 5I9EB 4BE0A 5GADP 3T1YK 3D7EO 4H5VA 2DFFA 3KLHA 3VF4A 4DLGA 3CM6A 2V51B 1RT3A 3EZ5A 3WXMB 2QXFA 2YX6A 3PIPL 3L0QA 4BRAA 1Z25A 3LDPA 3NCIA 2AP1A 3NF9A 4O55A 5FDLA 3HOTA 1KSPA 3BZCA 4B1XB 1D9DA 4QS9A 5CY4A 2QI2A 2IC3A 3UB5A 3V6DA 4JK8A 4CJTA 1KAYA 1KFDA 4ISEA 5J1EA 2RHKA 3H6EA 1NKBA 2Q0RA 3HPGA 5CHIA 2CGJA 1UA1A 1RT4A 1NGJA 3RMDA 2HHWA 2Q36A 1W7AA 4RTFD 2R7YA 4DTPA 3ZEUB 1FJGK 4CGIA 1HNVA 3EE8A 4IO8A 2NRHA 1C0FA 1N6QA 4CJVA 3M5RA 3PX4A 5AFUH 1HJRA 3CHWA 3O4QA 1L5UA 2VWBA 1C1BA 1R0AA 4DU4A 2VCPA 5CZ1A 4J2EA 4KH6A 3VEZA 2NZTA 5AR0A 4JKBA 3NVKA 4H0PA 3GG4A 3AGKA 4FWKA 2J4RA 1VK0A 1U48A 1TL1A 3FZFA 4FLYA 3OYMA 3LDQA 5J2MA 2A1RA 5GIPA 3C6HA 3PSIA 3QBXA 4DTXA 2PBDA 1YJ9N 4FXDA 1BDGA 3VA3A 4BROA 3GE1A 3VF2A 3R1XA 4F9OA 2KW4A 5M1PA 4FJGA 1TKXA 4CHYA 1UA0A 5AZJB 3O9TA 1TK5A 4H03B 4RW8A 1YXQA 1OH7A 4BE2A 4RW7A 3TABA 2HOEA 3MX2A 4I2QA 3V1RA 3HO1A 1S1WA 1NK4A 1CZAN 4LSLA 1SKRA 1HNZK 3QBWA 3HK2A 3LALA 2QM1A 5AQRA 4FWRA 1NGBA 3SV3A 2NRWA 1OVYA 4CJQA 1LCUA 4B9UA 4FW2A 1P8ZA 1C1CA 2NRVA 4C8OA 5F1XA 2VQFK 2YNFA 3SLCA 3VQEA 4DFMA 2HHVA 4K8ZA 3BZKA 3DRPA 1D5AA 3MN9A 2FSKA 4JI8K 3AVHA 2XY5A 3MDQA 1RTHA 4LF7K 2HW3A 1NGDA 5IWAK 4DHYA 4MDBA 3T1HK 3KK1A 5KI6A 1RNHA 5I3UA 1GLLO 4PL8A 5B8HA 4E7IA 4LD0A 1SV5A 3V81A 4DUYK 3NH1A 1IH7A 5FROA 3VGMA 4DV6K 1VSMA 2OPQA 4NLBA 3G10A 2VQEK 3H3NO 2DTUA 2RN2A 2CH6A 1XQSC 3QNOA 2P9LA 3TAGA 4BRQA 4EP4A 4CK3A 4E7JA 2NRZA 1NK9A 2E6LA 4BE1A 2V52B 4IG3A 4X64K 3OYCA 3FFKB 1NKEA 4YHHK 5HRSA 1S9EA 3BGRA 3QB0A 1IBLK 3C6UA 4CK2A 1KLMA 3O8MA 1M90O 3ID8A 4FJJA 1GLCG 3AVAA 3CCSN 2O8BB 2Q0UA 1Q18A 1K8AO 1JLQA 4EFHA 2P5GA 2QWOA 3FLCO 3FGUA 4C1NI 2NRRA 4K42A 1SL2A 3SV4A 4NXMK 1VQ8N 3TTFA 3ZSQA 5JVHL 2BANA 2Q97A 2WONA 1RGIA 3VENA 2A40A 2VGNA 1RTDA 4JD2A 3MN6A 3H1VX 3TARA 3D45A 4IG0A 4BGAA 2IOCA 4DQQA 4B3OA 1VSDA 4CZMA 2X6NA 3M8RA 3OHRA 3CPWM 3N4QA 1WBBA 1SQKA 2A41A 3P1GA 3AA3A 1DGKN 3CCRN 5EY4A 4N41A 4DQRA 4QOZB 5C2FA 1BI4B 1HYVA 2YKNA 1QVGM 2OPPA 2P9IA 4RW6A 4YY3K 4YNQA 2BDPA 1DT9A 4FJLA 1K8KA 2F7TA 3TAFA 4H5RA 3L2WA 3AVLA 3R9PA 2Q3SA 2O8EB 1TYQB 5E84A 4M7YA 1DTQA 3AVKA 3D2EB 1RT2A 5LY3A 5FPMA 2UXCK 1LOTB 4GKJK 1QSLA 3KIOA 4DSJA 3CYMA 4IZ9A 3M1FA 5AQPA 4I6MA 4X66K 2HMIA 3OYJA 1BL3A 2OTLN 1MDUB 3FE1A 4BREA 1EP4A 2F8TA 1GLAG 1I3AA 1OVQA 3QO9A 1KFSA 2F96A 4CJEA 4B1UB 4Z4EA 3TTDA 2FBYA 2RE2A 1XMOK 1W9HA 3L2RA 4WFNL 2HHSA 3VEYA 4F3TA 4E89A 3KZBA 1ATNA 1RBRA 4CBUA 2P51A 4CHZA 2HVIA 3HZ6A 3RMCA 1ASWA 4Y0WA 4KI4A 1XC9A 4CF0A 1LV5A 2FF6A 1J5OA 4GV6A 1NGHA 3MXJA 4ELUA 4FSVA 3B6PA 2QKBA 2QWRA 4PA1A 4CD1A 1NGEA 5EVZA 4CEOA 3K58A 3CFRA 3EO3A 3SUQA 2P9SA 1OH8A 1Q9YA 4BQZA 1NGAA 4DR3K 4WQ4C 3EY1A 4C8KA 3QESA 3ITHA 1VQNN 1EWRA 4Z0UA 4OKKA 3KK2A 1BA1A 4GY2B 3KWIA 5HRNA 4YOYA 4EHTA 4JHDA 5HBMA 3O4WA 1B92A 1C0TA 4FWOA 4H4MA 3WNFA 1S6QA 3MX5A 2P9KA 4B9VA 1XNQK 1ATRA 4G1QA 2ZGZA 1XHXA 4BGBA 4JKAA 4JI5K 4X65K 1KRPA 1BCMA 1FK9A 5AQNA 2E5LK 4CJUA 4YOTA 2QWMA 4GKKK 2O8FB 4OKJA 3CQ8A 1Q86O 2DY4A 3A8YA 3KVGA 5E41A 4HHTA 4LF9K 2Z1JA 4O5FA 1GOBA 3OJUA 1GLFO 2HHQA 3O9RA 3TSUA 1YVUA 2GELA 3G4SN 4AHTA 3V1QA 2D0BA 3BUZB 3L4QA 4H4OA 3ZT0A 3QEIA 3DRSA 4XH1A 4DQ8A 3MWTA 3VQPA 4NO7A 4Z94A 2E1YA 1JCFA 3AAQA 4KHSA 4CJRA 3CCUN 4ISFA 2YHAA 2ASOA 2KZMA 2XRIA 3CG7A 5C0YA 4CW7B 3SJJA 3J7YP 3AVIA 3L4IA 3DM2A 4AF1A 3CETA 3AO2A 2E20A 4BRMA 5TKYA 4E0DA 4Z4GA 3V1OA 1YF5L 3KD1E 4B9NA 2YNIA 1JLFA 5KPZA 1Q9XA 1ZBUA 4NCGA 2XY7A 1NOZA 1OH5A 1S6PA 3RVCA 4DFPA 4IOXA 5AQKA 1N32K 4Z4FA 4DTRA 3AO1A 4E1JA 3V4IA 3OYKA 3RSEB 3LDOA 4O44A 1XC3A 4DV7K 4BR5A 1QS4A 1KXPA 1TL3A 1EX4A 5AQXA 1SKWA 3A5OC 4DFKA 1XHZA 1NGFA 4DLEA 1SKSA 4ELTA 2D1KA 1TKDA 4M45A 4FJXA 1D9FA 5GAGP 4IDHA 1VQ5N 1NGIA 2DFEA 4O0JA 2QK9A 3NVMA 1C6VA 4M42A 4M3YA 3JXUA 1Q81O 2KHOA 4BRLA 4E1NA 1WSEA 4LY7A 3P4IA 1K73O 2A3ZA 4MO4A 5FRNA 1YVNA 1RILA 3CMAN 3SZ2A 3NGIA 2VWKA 5JICA 2Y1JA 3C6AA 1U47A 1ZBSA 4HUGA 4EZ6A 4JS4A 1QZ6A 3K5MA 4B1VA 2IAJA 2W42A 1RFQA 3VQ7A 4FZZA 3TSPA 3DXKB 2G8WA 3A0IX 3O9QA 3ZLJA 4DSIA 4AM7A 3AA2A 3RTVA 4F4KA 1NNEA 4B1WB 4F8RA 3WNEA 3M8PA 4FCYA 3IS9A 5GAEP 3NHGA 1ZC6A 4FZYA 3D2FB 3UKRA 3T7ZA 2YHBA 3AARA 2X74A 1VRUA 3LPUA 1T8EA 4AHRA 1EO1A 1YJNN 4CHQA 4RG8A 3VQ9A 4N56A 3VQQA 1HKGA 1MU2A 5CE3A 1KTQA 3ENOA 4LH4A 3S3OA 1L3SA 4M3RA 4N76A 1QZ5A 2OCEA 2W6LA 4IO9L 2A42A 1WBDA 4IOAL 4JI7K 1WUAA 3IFRA 3NF6A 3ZSRA 1HMVA 4FWMA 3HI0A 1IG8A 3LWLA 1IJJA 2B5JA 2E2QA 4KFBA 3PX0A 4CFAA 3IMXA 1SL0A 1RT5A 3U9DA 5HROA 2PYLA 1N33K 1WB9A 3CJAA 1BQNA 4HUEA 5FPNA 3DLHA 2OZSA 3M3ZA 5SZTA 4A2BA 2HBKA 2UU9K 4JI1K 3ZSXA 3AVGA 1C0UA 2FC0A 3HBTA 4JKHA 4LSNA 5F0XA 3AV9A 4FM2A 3NMUA 4OLBA 4DSEA 3LDSA 3AVBA 2E8AA 5AQGA 3VQ6A 3CCJN 3VQ4A 3DOKA 3E66A 2XY8A 3TAPA 5M1NA 2O8DB
chains in the Genus database with same CATH topology
1VSFA 4KB1A 1C1CA 2KTQA 4M3ZA 4C8OA 3DI6A 1X9MA 1EKEA 2YNFA 4CCHA 3VQEA 4DFMA 4J2DA 2HHVA 3DYAA 4FJIA 1VSKA 4K8ZA 3DRPA 1D5AA 3OYEA 3KLIA 5SWMA 3O3GA 4DSFA 3VQ5A 3AVHA 2XY5A 3QEPA 1RTHA 1A5XA 2HW3A 4IFVA 2PZSA 1NK6A 1YT3A 4OPJA 3V9SA 4BDPA 2HHXA 1BQMA 1Q8IA 1X9WA 1TAUA 2D0CA 4FJNA 3NF7A 1RBSA 3O3HA 1KVCA 3ZSZA 3SQ2A 3KK1A 5KI6A 1RNHA 1NJZA 4DSLA 5I3UA 1CLQA 4GVMA 2F8SA 1ZBIA 2FBVA 5D3GA 4W5RA 4E7IA 4LD0A 4CFBA 1WNSA 1SV5A 4LH5A 3OYAA 3VQAA 3V81A 1LW2A 3NH1A 1IH7A 4MQ3A 5CYMA 5FROA 1YTAA 4DF4A 1VSJA 4DQIA 1JL1A 1HPZA 1VSMA 4FK4A 3CM5A 2KFZA 1HQUA 1BISA 4OVLA 4KTQA 4BDYA 1RBTA 2OPQA 3G10A 1NOYA 3V9XA 3SQ1A 4M41A 2DTUA 3L8BA 1HQEA 1RDDA 2RN2A 1IKXA 4DTUA 1BI4A 3QNOA 3OYNA 4BACA 3SI6A 4M3UA 4W5QA 4CJ4A 1BCOA 1F21A 3T19A 1LAWA 3OYHA 4Z4HA 3TAGA 4CJWA 4Q5VA 4EP4A 4OPKA 3HPHA 4CK3A 3U3YA 1U4BA 4B9MA 4F2SA 4E7JA 1CXUA 1NK9A 2E6LA 3MECA 3AVFA 1S5JA 3LZIA 4BE1A 4IG3A 3OYBA 3OYCA 1NKEA 5HRSA 1S9EA 1IKYA 3BGRA 1JL2A 4GW6A 1QSSA 4KAZA 3C6UA 2YV0X 4CK2A 3OYFA 1TV6A 4TSXA 1KLMA 1XWLA 1KVBA 4CEDA 1DTTA 2PYJA 1WSIA 4FJJA 1C0MA 1EXQA 3AVAA 4CHPA 3NDKA 4DS5A 4FJ8A 1X9SA 2ETJA 4JRPA 3NH2A 4CGFA 1JLQA 1JKHA 2P5GA 1A5VA 4PQUA 1SL2A 4B9SA 2VG7A 3SV4A 3TAEA 3SPZA 1NK8A 4CGGA 1JLCA 2G8UA 3ZSQA 2BANA 3HVTA 4Y1CA 1O1WA 1IKVA 2WONA 2Z1GA 1NK5A 3KLFA 5HRPA 4CIGA 1RTDA 3AVCA 3DMJA 3K5LA 1UAXA 1TVRA 4KHYA 4RW9A 3DRRA 3TARA 1IG9A 3RMAA 3D45A 4W5OA 4IG0A 2IOCA 1BIUA 4DQQA 4B3OA 1ASVA 2B4JA 1VSDA 2RF2A 4CEQA 3OS2A 1A5WA 3UIQA 3HYFA 2X6NA 1ZBFA 3M8RA 3HJFA 3LANA 3LP2A 4KRFA 3SUNA 1N5YA 1B9FA 2YNHA 3P1GA 5FRMA 2KQ2A 3AA3A 3LAKA 4ZTJA 2I5JA 4NYNA 4B9TA 2G8VA 4KTWA 1VRTA 4N41A 3AA4A 4FW1A 4DQRA 3M8QA 4QOZB 1HYSA 1BI4B 1HYVA 2YKNA 4DU3A 3QEVA 4DTMA 2OPPA 3U3GA 4WE1A 4RW6A 1JLBA 4FM0A 4YNQA 3HSTB 2BDPA 3RMBA 4FJLA 4CFDA 2P1JA 3TAFA 4CEBA 3E01A 3AVLA 3L2WA 3AO3A 4N5SA 2Q3SA 4CJSA 4DF8A 3ZT1A 4CGJA 3I8DA 1EETA 1TK0A 3B6OA 4PY5A 4FK0A 3K2PA 1Z26A 2VG6A 1D8YA 1J54A 1DTQA 3AVKA 3I0SA 5C24A 4FJHA 5JS1A 3KLEA 3AA5X 1RT2A 4FLZA 4DTJA 1RBUA 1X1PA 2E6MA 4N47A 4DFJA 2G8KA 2QKKA 3LAMA 3OJSA 2VWJA 4M3WA 2ITGA 3L2QA 1QSLA 3HT3A 2LSNA 2IGIA 1GOCA 3KIOA 4O4GA 2G8FA 4CECA 4DSJA 4IKFA 3CYMA 3HVRA 4Z4CA 4KI6A 4NYFA 3OYGA 2IS3A 2OPRA 3VN5A 4W5TA 3O3FA 1U49A 4FLXA 4E1MA 2HMIA 1HRHA 3OYJA 1BL3A 3NAEA 3T3FA 4KHWA 3ZCMA 3K59A 3KKRA 4J2AA 4O0IA 2FBTA 2RPIA 4BWJA 4QCLA 3IRXA 5KGXA 4KREA 2HVHA 3OS1A 3QIPA 1EP4A 2F8TA 5J2NA 1RDAA 1ZBHA 3DLEA 4FZXC 3KKSA 4AILC 3QINA 1I3AA 1FKPA 3NGZA 3S3NA 4CESA 4FM1A 1WAFA 2OZMA 2ZQBA 3QO9A 1KFSA 2F96A 4CJEA 3AO4A 3DLRA 4CJKA 3M8SA 4Z4EA 2FBYA 4CF2A 2D0AA 1BGXT 3ZSVA 1W9HA 4CF9A 3JYTA 4FLTA 3TANA 3L2RA 4RW4A 1S1VA 2HHSA 4HTUA 4CEAA 3JSMA 1U45A 2O4IA 2B6AA 4F3TA 4E89A 1CZBA 1REVA 1RBRA 3L2VA 2HHUA 5HLFA 3ZSWA 1CZ9A 3O4NA 1LWCA 4CIEA 3MEGA 3TWHA 2P51A 4CHZA 1ZBLA 1QQCA 2HVIA 2ZE2A 1JLEA 3RMCA 4KPYA 1ASWA 4FJKA 3PO5A 4KI4A 4CE9A 4YFUA 1XC9A 4FJ7A 1RTIA 3SYZA 4CF0A 3AVNA 4CF8A 1RBVA 1LV5A 1J5OA 2X78A 3MXJA 4ELUA 3B6PA 2EX3A 1J53A 5HP1A 2QKBA 3LZJA 4PA1A 3KLGA 1TKTA 3SUPA 4F2RA 3RWUA 3LP3A 1W0HA 3AO5A 5CYQA 4CEOA 4CJ3A 4B08A 3K58A 3SCXA 3MXMA 1CXQA 3CFRA 4HCCA 3SUQA 3K5OA 1G15A 3ULDA 5J2PA 1Q9YA 1WAJA 1QTMA 4J2BA 1BIZA 2FBXA 3AVJA 3EY1A 3QNNA 1QE1A 3DOLA 4C8KA 4PWDA 2ATQA 5CZ2A 3ITHA 4FLUA 3RRHA 3QESA 5DMRA 4Z0UA 3H08A 4KV8A 4OKKA 3KK2A 1NK0A 4DQPA 2O4GA 4DTOA 3RR8A 3ZT4A 1ASUA 5HRNA 3SNNA 4ELVA 3VQCA 4ZTFA 3QERA 2BGGA 3C95A 1WSHA 1XI1A 2GUIA 5HBMA 1S1TA 1NKCA 5C42A 1B92A 1C0TA 3S3MA 4H4MA 3SUOA 3WNFA 1S6QA 4CK1A 1NJWA 4B9VA 3NH0A 3FFIA 1RDCA 4O5BA 3RR7A 4G1QA 2HHTA 5J2QA 4DSKA 1HYZA 4KHUA 1JXBA 4CJ5A 1XHXA 1KRPA 3ISNC 1BCMA 3HP9A 1J9AA 1FK9A 3HL8A 3SQ4A 4HCBA 1VSEA 3CFPA 4GMJB 4CJUA 1S9GA 3IAYA 3QEWA 5K14A 4FYDA 1LAVA 1WLJA 3MAQA 4OKJA 3CQ8A 4E3SA 2P5OA 2OYQA 2DY4A 4BDZA 4DG1A 5E41A 4DQSA 1QSYA 4HHTA 1T03A 5T7BA 2Z1JA 4ZHRA 3A2FA 3P5JA 4NCBA 1GOBA 2OA8A 3OJUA 3SPYA 1SUQA 4NCAA 1KLNA 3OYIA 3THVA 2WOMA 2HHQA 5KTQA 4OLAA 2OPSA 4E7LA 1YVUA 3PO4A 3RRGA 1T05A 4Z4IA 4AHTA 3V1QA 4IFYA 1WSJA 2D0BA 4H4OA 3ZT0A 3VQDA 3TR8A 2XO7A 2YNGA 4CJFA 3QEIA 3DRSA 3NBPA 3VQPA 2GV9A 1YTUA 3TI0A 4Q0BA 2JGUA 3VQ8A 1VSHA 4L8RB 4KHSA 3BDPA 4CJRA 4ID1A 4C8MA 4FJ5A 2YHAA 4AHUA 4UQGA 4R5PA 4OKEA 2KZMA 2XRIA 3CG7A 2XY6A 1IO2A 4BWMA 2E4LA 3TAQA 3SJJA 2KFNA 4W5NA 3WNGA 1L3UA 3S9HA 3F9KA 1FXXA 2Z1IA 3AVIA 3DM2A 3ZT2A 3DLKA 4E7HA 3AO2A 4OJRA 3OY9A 4KTZA 4QAGA 5KGWA 1KVAA 4CGHA 3KD5E 1RTJA 1HNIA 1DLOA 4E0DA 4Z4GA 3PY8A 3V9ZA 3KK3A 3V1OA 1QHTA 3KD1E 5EU7A 2YNIA 4B9NA 4CEZA 1JLFA 1Q9XA 3HPOA 2ZD1A 3LP1A 1ZBUA 3U6FA 4NCGA 2XY7A 3QLHA 3L2UA 2Y1IA 3QIOA 3K57A 2AJQA 1NOZA 3ALYA 3OYLA 4C8NA 4DWIA 4H8KA 1S6PA 1IKWA 4JRQA 4DFPA 4JS5A 3PUFA 2HNYA 3NFAA 1NJXA 3SQ0A 3V9WA 2YKMA 4ICLA 5C25A 1FKOA 5JS2A 3LWMA 4DTRA 5I42A 4OGCA 4Z4FA 3AO1A 3V4IA 3K5NA 3OYKA 3P83D 4I9LA 4CEFA 4CGDA 4O44A 2HNDA 4DTNA 3LPTA 2D5RA 3DLGA 3NGYA 3MXIA 1QS4A 1S1XA 1TL3A 1EX4A 1RT6A 4DU1A 3QETA 3DLBA 3CFOA 1SKWA 2VG5A 4CF1A 4DFKA 4I9QA 1XHZA 5KRSA 3OS0A 4DLEA 1SKSA 2HB5A 4ELTA 5KRTA 2Z1HA 1K6YA 1VSLA 4IBNA 1C1AA 3ZSOA 1TKDA 3C6TA 4M45A 4FJXA 3NF8A 1D9FA 1BHLA 4E19A 1GOAA 1TK8A 3VQBA 4BE0A 2DFEA 4O0JA 4EP5A 4CIFA 2QK9A 1C6VA 4M42A 4M3YA 2DFFA 3KLHA 1U04A 1WN7A 4AHCA 4B9LA 4DLGA 2KZZA 3CM6A 4M3TA 1RT3A 2DFHA 3EZ5A 3D0PA 5DK5A 4E1NA 1WSEA 4LY7A 2QXFA 3KTQA 5FRNA 2JLEA 1Z25A 3NCIA 3MEEA 1RILA 4I2PA 3SZ2A 3WNHA 3NF9A 4ID5A 4O55A 2VWKA 5FDLA 3HP6A 3NGIA 3V9UA 3I0RA 3PX6A 1KSPA 1RDBA 2Y1JA 2PY5A 1U47A 2RKIA 4DMNA 4HUGA 4EZ6A 4DTSA 4JS4A 1SL1A 3K5MA 1D9DA 4IDKA 5CY4A 4MFBA 4CJPA 2IAJA 2IC3A 3T1AA 2W42A 3V6DA 4F3OA 4CEEA 3VQ7A 4FZZA 4CJTA 4C8LA 5J1EA 1KFDA 2G8WA 4OGEA 4EZ9A 1NKBA 1TKZA 2X6SA 4CFCA 1I39A 4HVJA 3HPGA 4M3XA 4AH9A 1UA1A 4I7FA 1RT4A 3ZT3A 4DSIA 1TAQA 4B8AB 3AA2A 3RMDA 3RTVA 1T7PA 4F4KA 4F8RA 2HHWA 4HUFA 3WNEA 3M8PA 2R7YA 2XHBA 3IS9A 4FCYA 1LWFA 3NHGA 4DTPA 4FZYA 1JLGA 1ITGA 3MEDA 1HNVA 4CGIA 4FK2A 2YHBA 1LW0A 1JXEA 2IDOA 1S1UA 1N6QA 2NUBA 2X74A 1VRUA 3LPUA 2EHGA 4AHRA 4CJVA 3PX4A 1T8EA 1UOCA 4KKOA 4FJMA 4AHSA 1HJRA 1LWEA 1VSIA 1NJYA 4CHQA 4RG8A 3O4QA 3HM9A 3PV8A 1L5UA 1NK7A 3VQ9A 1C1BA 1R0AA 1B9DA 4N56A 3VQQA 4B8CA 3KJVA 4DU4A 5CZ1A 1MU2A 1KTQA 4J2EA 1L3TA 4LH4A 3AVMA 3L3VA 4M3RA 3TAMA 3ZSYA 1WSGA 3S3OA 3OYDA 1L3SA 3C94A 3F73A 3OVNA 4N76A 1VK0A 1U48A 1TL1A 1RT1A 4Y1DA 4FLVA 4FLYA 1UWBA 3OYMA 2HNZA 5J2MA 2A1RA 4KO0A 1ZYQA 4DTXA 4E7KA 3NF6A 3ZSRA 3HXMA 1HMVA 3VA0A 4DS4A 4FXDA 3LWLA 3VA3A 4XIUA 2B5JA 4KFBA 4CHNA 4PUOA 3PX0A 4CFAA 4FVMA 4CJLA 1L3VA 2KW4A 3L3UA 1RT5A 3G0ZA 3LP0A 4JLHA 1SL0A 5HROA 1RCHA 1Y97A 2PYLA 4FJGA 1TKXA 1BQNA 4CHYA 4HUEA 1UA0A 3EYZA 3DLHA 1TK5A 1TGOA 4RW8A 2OZSA 4BE2A 2A1SA 4RW7A 3TABA 2G8IA 5SZTA 1WSFA 4CHOA 3NE6A 1RT7A 4I2QA 3ASMA 3V1RA 3ZSXA 2BE2A 3HO1A 3AVGA 1S1WA 1NK4A 1C0UA 2FC0A 1KCFA 4LSLA 4KB0A 2G8HA 1SKRA 4LSNA 3AV9A 4AHVA 3LALA 4CERA 4FM2A 4FJ9A 4OLBA 3HK2A 4DSEA 5HRRA 3LDSA 3AVBA 3VQ6A 3VQ4A 3SV3A 3DOKA 2GBZA 2XY8A 4CJQA 3TAPA 4K8XA 4KHNA 4KHQA 3IG1A 1JLAA 3QEXA 4B9UA 4FLWA 4FW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VSF A;  4KB1 A;  1C1C A;  2KTQ A;  4M3Z A;  4C8O A;  3DI6 A;  1X9M A;  1EKE A;  2YNF A;  4CCH A;  3VQE A;  4DFM A;  4J2D A;  2HHV A;  3DYA A;  4FJI A;  1VSK A;  4K8Z A;  3DRP A;  1D5A A;  3OYE A;  3KLI A;  5SWM A;  3O3G A;  4DSF A;  3VQ5 A;  3AVH A;  2XY5 A;  3QEP A;  1RTH A;  1A5X A;  2HW3 A;  4IFV A;  2PZS A;  1NK6 A;  1YT3 A;  4OPJ A;  3V9S A;  4BDP A;  2HHX A;  1BQM A;  1Q8I A;  1X9W A;  1TAU A;  2D0C A;  4FJN A;  3NF7 A;  1RBS A;  3O3H A;  1KVC A;  3ZSZ A;  3SQ2 A;  3KK1 A;  5KI6 A;  1RNH A;  1NJZ A;  4DSL A;  5I3U A;  1CLQ A;  4GVM A;  2F8S A;  1ZBI A;  2FBV A;  5D3G A;  4W5R A;  4E7I A;  4LD0 A;  4CFB A;  1WNS A;  1SV5 A;  4LH5 A;  3OYA A;  3VQA A;  3V81 A;  1LW2 A;  3NH1 A;  1IH7 A;  4MQ3 A;  5CYM A;  5FRO A;  1YTA A;  4DF4 A;  1VSJ A;  4DQI A;  1JL1 A;  1HPZ A;  1VSM A;  4FK4 A;  3CM5 A;  2KFZ A;  1HQU A;  1BIS A;  4OVL A;  4KTQ A;  4BDY A;  1RBT A;  2OPQ A;  3G10 A;  1NOY A;  3V9X A;  3SQ1 A;  4M41 A;  2DTU A;  3L8B A;  1HQE A;  1RDD A;  2RN2 A;  1IKX A;  4DTU A;  1BI4 A;  3QNO A;  3OYN A;  4BAC A;  3SI6 A;  4M3U A;  4W5Q A;  4CJ4 A;  1BCO A;  1F21 A;  3T19 A;  1LAW A;  3OYH A;  4Z4H A;  3TAG A;  4CJW A;  4Q5V A;  4EP4 A;  4OPK A;  3HPH A;  4CK3 A;  3U3Y A;  1U4B A;  4B9M A;  4F2S A;  4E7J A;  1CXU A;  1NK9 A;  2E6L A;  3MEC A;  3AVF A;  1S5J A;  3LZI A;  4BE1 A;  4IG3 A;  3OYB A;  3OYC A;  1NKE A;  5HRS A;  1S9E A;  1IKY A;  3BGR A;  1JL2 A;  4GW6 A;  1QSS A;  4KAZ A;  3C6U A;  2YV0 X;  4CK2 A;  3OYF A;  1TV6 A;  4TSX A;  1KLM A;  1XWL A;  1KVB A;  4CED A;  1DTT A;  2PYJ A;  1WSI A;  4FJJ A;  1C0M A;  1EXQ A;  3AVA A;  4CHP A;  3NDK A;  4DS5 A;  4FJ8 A;  1X9S A;  2ETJ A;  4JRP A;  3NH2 A;  4CGF A;  1JLQ A;  1JKH A;  2P5G A;  1A5V A;  4PQU A;  1SL2 A;  4B9S A;  2VG7 A;  3SV4 A;  3TAE A;  3SPZ A;  1NK8 A;  4CGG A;  1JLC A;  2G8U A;  3ZSQ A;  2BAN A;  3HVT A;  4Y1C A;  1O1W A;  1IKV A;  2WON A;  2Z1G A;  1NK5 A;  3KLF A;  5HRP A;  4CIG A;  1RTD A;  3AVC A;  3DMJ A;  3K5L A;  1UAX A;  1TVR A;  4KHY A;  4RW9 A;  3DRR A;  3TAR A;  1IG9 A;  3RMA A;  3D45 A;  4W5O A;  4IG0 A;  2IOC A;  1BIU A;  4DQQ A;  4B3O A;  1ASV A;  2B4J A;  1VSD A;  2RF2 A;  4CEQ A;  3OS2 A;  1A5W A;  3UIQ A;  3HYF A;  2X6N A;  1ZBF A;  3M8R A;  3HJF A;  3LAN A;  3LP2 A;  4KRF A;  3SUN A;  1N5Y A;  1B9F A;  2YNH A;  3P1G A;  5FRM A;  2KQ2 A;  3AA3 A;  3LAK A;  4ZTJ A;  2I5J A;  4NYN A;  4B9T A;  2G8V A;  4KTW A;  1VRT A;  4N41 A;  3AA4 A;  4FW1 A;  4DQR A;  3M8Q A;  4QOZ B;  1HYS A;  1BI4 B;  1HYV A;  2YKN A;  4DU3 A;  3QEV A;  4DTM A;  2OPP A;  3U3G A;  4WE1 A;  4RW6 A;  1JLB A;  4FM0 A;  4YNQ A;  3HST B;  2BDP A;  3RMB A;  4FJL A;  4CFD A;  2P1J A;  3TAF A;  4CEB A;  3E01 A;  3AVL A;  3L2W A;  3AO3 A;  4N5S A;  2Q3S A;  4CJS A;  4DF8 A;  3ZT1 A;  4CGJ A;  3I8D A;  1EET A;  1TK0 A;  3B6O A;  4PY5 A;  4FK0 A;  3K2P A;  1Z26 A;  2VG6 A;  1D8Y A;  1J54 A;  1DTQ A;  3AVK A;  3I0S A;  5C24 A;  4FJH A;  5JS1 A;  3KLE A;  3AA5 X;  1RT2 A;  4FLZ A;  4DTJ A;  1RBU A;  1X1P A;  2E6M A;  4N47 A;  4DFJ A;  2G8K A;  2QKK A;  3LAM A;  3OJS A;  2VWJ A;  4M3W A;  2ITG A;  3L2Q A;  1QSL A;  3HT3 A;  2LSN A;  2IGI A;  1GOC A;  3KIO A;  4O4G A;  2G8F A;  4CEC A;  4DSJ A;  4IKF A;  3CYM A;  3HVR A;  4Z4C A;  4KI6 A;  4NYF A;  3OYG A;  2IS3 A;  2OPR A;  3VN5 A;  4W5T A;  3O3F A;  1U49 A;  4FLX A;  4E1M A;  2HMI A;  1HRH A;  3OYJ A;  1BL3 A;  3NAE A;  3T3F A;  4KHW A;  3ZCM A;  3K59 A;  3KKR A;  4J2A A;  4O0I A;  2FBT A;  2RPI A;  4BWJ A;  4QCL A;  3IRX A;  5KGX A;  4KRE A;  2HVH A;  3OS1 A;  3QIP A;  1EP4 A;  2F8T A;  5J2N A;  1RDA A;  1ZBH A;  3DLE A;  4FZX C;  3KKS A;  4AIL C;  3QIN A;  1I3A A;  1FKP A;  3NGZ A;  3S3N A;  4CES A;  4FM1 A;  1WAF A;  2OZM A;  2ZQB A;  3QO9 A;  1KFS A;  2F96 A;  4CJE A;  3AO4 A;  3DLR A;  4CJK A;  3M8S A;  4Z4E A;  2FBY A;  4CF2 A;  2D0A A;  1BGX T;  3ZSV A;  1W9H A;  4CF9 A;  3JYT A;  4FLT A;  3TAN A;  3L2R A;  4RW4 A;  1S1V A;  2HHS A;  4HTU A;  4CEA A;  3JSM A;  1U45 A;  2O4I A;  2B6A A;  4F3T A;  4E89 A;  1CZB A;  1REV A;  1RBR A;  3L2V A;  2HHU A;  5HLF A;  3ZSW A;  1CZ9 A;  3O4N A;  1LWC A;  4CIE A;  3MEG A;  3TWH A;  2P51 A;  4CHZ A;  1ZBL A;  1QQC A;  2HVI A;  2ZE2 A;  1JLE A;  3RMC A;  4KPY A;  1ASW A;  4FJK A;  3PO5 A;  4KI4 A;  4CE9 A;  4YFU A;  1XC9 A;  4FJ7 A;  1RTI A;  3SYZ A;  4CF0 A;  3AVN A;  4CF8 A;  1RBV A;  1LV5 A;  1J5O A;  2X78 A;  3MXJ A;  4ELU A;  3B6P A;  2EX3 A;  1J53 A;  5HP1 A;  2QKB A;  3LZJ A;  4PA1 A;  3KLG A;  1TKT A;  3SUP A;  4F2R A;  3RWU A;  3LP3 A;  1W0H A;  3AO5 A;  5CYQ A;  4CEO A;  4CJ3 A;  4B08 A;  3K58 A;  3SCX A;  3MXM A;  1CXQ A;  3CFR A;  4HCC A;  3SUQ A;  3K5O A;  1G15 A;  3ULD A;  5J2P A;  1Q9Y A;  1WAJ A;  1QTM A;  4J2B A;  1BIZ A;  2FBX A;  3AVJ A;  3EY1 A;  3QNN A;  1QE1 A;  3DOL A;  4C8K A;  4PWD A;  2ATQ A;  5CZ2 A;  3ITH A;  4FLU A;  3RRH A;  3QES A;  5DMR A;  4Z0U A;  3H08 A;  4KV8 A;  4OKK A;  3KK2 A;  1NK0 A;  4DQP A;  2O4G A;  4DTO A;  3RR8 A;  3ZT4 A;  1ASU A;  5HRN A;  3SNN A;  4ELV A;  3VQC A;  4ZTF A;  3QER A;  2BGG A;  3C95 A;  1WSH A;  1XI1 A;  2GUI A;  5HBM A;  1S1T A;  1NKC A;  5C42 A;  1B92 A;  1C0T A;  3S3M A;  4H4M A;  3SUO A;  3WNF A;  1S6Q A;  4CK1 A;  1NJW A;  4B9V A;  3NH0 A;  3FFI A;  1RDC A;  4O5B A;  3RR7 A;  4G1Q A;  2HHT A;  5J2Q A;  4DSK A;  1HYZ A;  4KHU A;  1JXB A;  4CJ5 A;  1XHX A;  1KRP A;  3ISN C;  1BCM A;  3HP9 A;  1J9A A;  1FK9 A;  3HL8 A;  3SQ4 A;  4HCB A;  1VSE A;  3CFP A;  4GMJ B;  4CJU A;  1S9G A;  3IAY A;  3QEW A;  5K14 A;  4FYD A;  1LAV A;  1WLJ A;  3MAQ A;  4OKJ A;  3CQ8 A;  4E3S A;  2P5O A;  2OYQ A;  2DY4 A;  4BDZ A;  4DG1 A;  5E41 A;  4DQS A;  1QSY A;  4HHT A;  1T03 A;  5T7B A;  2Z1J A;  4ZHR A;  3A2F A;  3P5J A;  4NCB A;  1GOB A;  2OA8 A;  3OJU A;  3SPY A;  1SUQ A;  4NCA A;  1KLN A;  3OYI A;  3THV A;  2WOM A;  2HHQ A;  5KTQ A;  4OLA A;  2OPS A;  4E7L A;  1YVU A;  3PO4 A;  3RRG A;  1T05 A;  4Z4I A;  4AHT A;  3V1Q A;  4IFY A;  1WSJ A;  2D0B A;  4H4O A;  3ZT0 A;  3VQD A;  3TR8 A;  2XO7 A;  2YNG A;  4CJF A;  3QEI A;  3DRS A;  3NBP A;  3VQP A;  2GV9 A;  1YTU A;  3TI0 A;  4Q0B A;  2JGU A;  3VQ8 A;  1VSH A;  4L8R B;  4KHS A;  3BDP A;  4CJR A;  4ID1 A;  4C8M A;  4FJ5 A;  2YHA A;  4AHU A;  4UQG A;  4R5P A;  4OKE A;  2KZM A;  2XRI A;  3CG7 A;  2XY6 A;  1IO2 A;  4BWM A;  2E4L A;  3TAQ A;  3SJJ A;  2KFN A;  4W5N A;  3WNG A;  1L3U A;  3S9H A;  3F9K A;  1FXX A;  2Z1I A;  3AVI A;  3DM2 A;  3ZT2 A;  3DLK A;  4E7H A;  3AO2 A;  4OJR A;  3OY9 A;  4KTZ A;  4QAG A;  5KGW A;  1KVA A;  4CGH A;  3KD5 E;  1RTJ A;  1HNI A;  1DLO A;  4E0D A;  4Z4G A;  3PY8 A;  3V9Z A;  3KK3 A;  3V1O A;  1QHT A;  3KD1 E;  5EU7 A;  2YNI A;  4B9N A;  4CEZ A;  1JLF A;  1Q9X A;  3HPO A;  2ZD1 A;  3LP1 A;  1ZBU A;  3U6F A;  4NCG A;  2XY7 A;  3QLH A;  3L2U A;  2Y1I A;  3QIO A;  3K57 A;  2AJQ A;  1NOZ A;  3ALY A;  3OYL A;  4C8N A;  4DWI A;  4H8K A;  1S6P A;  1IKW A;  4JRQ A;  4DFP A;  4JS5 A;  3PUF A;  2HNY A;  3NFA A;  1NJX A;  3SQ0 A;  3V9W A;  2YKM A;  4ICL A;  5C25 A;  1FKO A;  5JS2 A;  3LWM A;  4DTR A;  5I42 A;  4OGC A;  4Z4F A;  3AO1 A;  3V4I A;  3K5N A;  3OYK A;  3P83 D;  4I9L A;  4CEF A;  4CGD A;  4O44 A;  2HND A;  4DTN A;  3LPT A;  2D5R A;  3DLG A;  3NGY A;  3MXI A;  1QS4 A;  1S1X A;  1TL3 A;  1EX4 A;  1RT6 A;  4DU1 A;  3QET A;  3DLB A;  3CFO A;  1SKW A;  2VG5 A;  4CF1 A;  4DFK A;  4I9Q A;  1XHZ A;  5KRS A;  3OS0 A;  4DLE A;  1SKS A;  2HB5 A;  4ELT A;  5KRT A;  2Z1H A;  1K6Y A;  1VSL A;  4IBN A;  1C1A A;  3ZSO A;  1TKD A;  3C6T A;  4M45 A;  4FJX A;  3NF8 A;  1D9F A;  1BHL A;  4E19 A;  1GOA A;  1TK8 A;  3VQB A;  4BE0 A;  2DFE A;  4O0J A;  4EP5 A;  4CIF A;  2QK9 A;  1C6V A;  4M42 A;  4M3Y A;  2DFF A;  3KLH A;  1U04 A;  1WN7 A;  4AHC A;  4B9L A;  4DLG A;  2KZZ A;  3CM6 A;  4M3T A;  1RT3 A;  2DFH A;  3EZ5 A;  3D0P A;  5DK5 A;  4E1N A;  1WSE A;  4LY7 A;  2QXF A;  3KTQ A;  5FRN A;  2JLE A;  1Z25 A;  3NCI A;  3MEE A;  1RIL A;  4I2P A;  3SZ2 A;  3WNH A;  3NF9 A;  4ID5 A;  4O55 A;  2VWK A;  5FDL A;  3HP6 A;  3NGI A;  3V9U A;  3I0R A;  3PX6 A;  1KSP A;  1RDB A;  2Y1J A;  2PY5 A;  1U47 A;  2RKI A;  4DMN A;  4HUG A;  4EZ6 A;  4DTS A;  4JS4 A;  1SL1 A;  3K5M A;  1D9D A;  4IDK A;  5CY4 A;  4MFB A;  4CJP A;  2IAJ A;  2IC3 A;  3T1A A;  2W42 A;  3V6D A;  4F3O A;  4CEE A;  3VQ7 A;  4FZZ A;  4CJT A;  4C8L A;  5J1E A;  1KFD A;  2G8W A;  4OGE A;  4EZ9 A;  1NKB A;  1TKZ A;  2X6S A;  4CFC A;  1I39 A;  4HVJ A;  3HPG A;  4M3X A;  4AH9 A;  1UA1 A;  4I7F A;  1RT4 A;  3ZT3 A;  4DSI A;  1TAQ A;  4B8A B;  3AA2 A;  3RMD A;  3RTV A;  1T7P A;  4F4K A;  4F8R A;  2HHW A;  4HUF A;  3WNE A;  3M8P A;  2R7Y A;  2XHB A;  3IS9 A;  4FCY A;  1LWF A;  3NHG A;  4DTP A;  4FZY A;  1JLG A;  1ITG A;  3MED A;  1HNV A;  4CGI A;  4FK2 A;  2YHB A;  1LW0 A;  1JXE A;  2IDO A;  1S1U A;  1N6Q A;  2NUB A;  2X74 A;  1VRU A;  3LPU A;  2EHG A;  4AHR A;  4CJV A;  3PX4 A;  1T8E A;  1UOC A;  4KKO A;  4FJM A;  4AHS A;  1HJR A;  1LWE A;  1VSI A;  1NJY A;  4CHQ A;  4RG8 A;  3O4Q A;  3HM9 A;  3PV8 A;  1L5U A;  1NK7 A;  3VQ9 A;  1C1B A;  1R0A A;  1B9D A;  4N56 A;  3VQQ A;  4B8C A;  3KJV A;  4DU4 A;  5CZ1 A;  1MU2 A;  1KTQ A;  4J2E A;  1L3T A;  4LH4 A;  3AVM A;  3L3V A;  4M3R A;  3TAM A;  3ZSY A;  1WSG A;  3S3O A;  3OYD A;  1L3S A;  3C94 A;  3F73 A;  3OVN A;  4N76 A;  1VK0 A;  1U48 A;  1TL1 A;  1RT1 A;  4Y1D A;  4FLV A;  4FLY A;  1UWB A;  3OYM A;  2HNZ A;  5J2M A;  2A1R A;  4KO0 A;  1ZYQ A;  4DTX A;  4E7K A;  3NF6 A;  3ZSR A;  3HXM A;  1HMV A;  3VA0 A;  4DS4 A;  4FXD A;  3LWL A;  3VA3 A;  4XIU A;  2B5J A;  4KFB A;  4CHN A;  4PUO A;  3PX0 A;  4CFA A;  4FVM A;  4CJL A;  1L3V A;  2KW4 A;  3L3U A;  1RT5 A;  3G0Z A;  3LP0 A;  4JLH A;  1SL0 A;  5HRO A;  1RCH A;  1Y97 A;  2PYL A;  4FJG A;  1TKX A;  1BQN A;  4CHY A;  4HUE A;  1UA0 A;  3EYZ A;  3DLH A;  1TK5 A;  1TGO A;  4RW8 A;  2OZS A;  4BE2 A;  2A1S A;  4RW7 A;  3TAB A;  2G8I A;  5SZT A;  1WSF A;  4CHO A;  3NE6 A;  1RT7 A;  4I2Q A;  3ASM A;  3V1R A;  3ZSX A;  2BE2 A;  3HO1 A;  3AVG A;  1S1W A;  1NK4 A;  1C0U A;  2FC0 A;  1KCF A;  4LSL A;  4KB0 A;  2G8H A;  1SKR A;  4LSN A;  3AV9 A;  4AHV A;  3LAL A;  4CER A;  4FM2 A;  4FJ9 A;  4OLB A;  3HK2 A;  4DSE A;  5HRR A;  3LDS A;  3AVB A;  3VQ6 A;  3VQ4 A;  3SV3 A;  3DOK A;  2GBZ A;  2XY8 A;  4CJQ A;  3TAP A;  4K8X A;  4KHN A;  4KHQ A;  3IG1 A;  1JLA A;  3QEX A;  4B9U A;  4FLW A;  4FW2 A; 
#chains in the Genus database with same CATH topology
 1VSF A;  4JV5 K;  3DI6 A;  1EKE A;  4LF4 K;  4CCH A;  4J2D A;  1RDW X;  5SWM A;  4DSF A;  3VQ5 A;  1A5X A;  1NK6 A;  2F4V K;  3FZL A;  4BDP A;  2HHX A;  1X9W A;  2E88 A;  3R8E A;  3QFU A;  2NLX A;  1CLQ A;  4GVM A;  2E2O A;  5D3G A;  5GIN A;  3R3L A;  4W5R A;  4LC9 B;  4LH5 A;  3ENH A;  3CM5 A;  2KFZ A;  4KTQ A;  1NOY A;  3SQ1 A;  1W2B M;  5DM6 L;  3CXC M;  3OYN A;  4BAC A;  2AA4 A;  4W5Q A;  4CJ4 A;  3G25 A;  5AZI B;  4CJW A;  4F2S A;  3U3Y A;  3CJ9 A;  1CXU A;  2KLA A;  3M6G A;  1EQY A;  3MEC A;  3CCQ N;  1S5J A;  3VER A;  3HRG A;  3OYB A;  4CZH A;  2QA4 N;  3CCV N;  2GX9 A;  4A61 A;  4OPA A;  1IKY A;  4GW6 A;  1JL2 A;  2IVP A;  1NLV A;  2YV0 X;  3OA9 A;  4RWT A;  1N36 K;  4FWP A;  4CED A;  2PYJ A;  1C0M A;  4FJ8 A;  4CHP A;  3SAG A;  5BRD A;  1X9S A;  4JRP A;  3NH2 A;  5ADX A;  4OX9 K;  3CD6 N;  3O1W A;  1V4T A;  2VG7 A;  3SPZ A;  3THY A;  1JLC A;  2UUC K;  2Z1G A;  4YOU A;  3HTV A;  5HRP A;  4CIG A;  3DMJ A;  1TVR A;  4KHY A;  1XUP O;  3RMA A;  2P9U A;  1QVF M;  1BIU A;  4FOI A;  1BA0 A;  1ASV A;  1QQO A;  5AQH A;  3SUN A;  3H1Q A;  1B9F A;  3F9M A;  5FRM A;  3LAK A;  2I5J A;  4NYN A;  3M8Q A;  3B8A X;  4DU3 A;  3U3G A;  4WE1 A;  3ULE A;  3RMB A;  4CFD A;  4CEB A;  3E01 A;  3ATV A;  3Q7C A;  4H5T A;  3E1Y A;  1TK0 A;  5CR4 A;  1J54 A;  5C24 A;  3AA5 X;  4FLZ A;  3OW2 M;  1X1P A;  2G8K A;  4ILG B;  3LAM A;  4YDU C;  3VF6 A;  3OJS A;  2VWJ A;  2G8F A;  4FJ5 A;  3HT3 A;  2IGI A;  1GOC A;  4JAX A;  3HVR A;  4Z4C A;  4KI6 A;  4EHU A;  2IS3 A;  4W5T A;  3VN5 A;  3O3F A;  4BY9 C;  4YDU A;  3SBG A;  1HRH A;  1EWQ A;  2YJF A;  4B1Z A;  3K59 A;  4J2A A;  4O0I A;  4BWJ A;  4QCL A;  3CER A;  1VAZ A;  4KRE A;  3OS1 A;  3QIP A;  3VOV A;  1RDA A;  1ZBH A;  3O1B A;  1OKJ A;  1P90 A;  3QIN A;  4DUZ K;  3ZET B;  4CES A;  4FM1 A;  3DXK A;  3WQT A;  5BN8 A;  4DR5 K;  4H5N A;  1KC8 O;  3AO4 A;  2FSN A;  5AQV A;  1BGX T;  1NJI O;  4CEA A;  5AQM A;  3L2V A;  2HHU A;  5HLF A;  1ZXO A;  1NGC A;  3O4N A;  1LWC A;  3MEG A;  3D2F A;  1QQC A;  4CZE A;  2CGL A;  1M1K O;  1HNX K;  3PO5 A;  4FJK A;  1R59 O;  3K9J A;  4MDA A;  4FK2 A;  3AVN A;  2X78 A;  3SJH A;  3LZJ A;  5AFU A;  4F2R A;  1W0H A;  5EOY A;  4JKG B;  4B08 A;  1CXQ A;  4WQ5 A;  3VMF B;  3WEE A;  1G15 A;  3SAF A;  5J2P A;  1WAJ A;  3WXI A;  2FBX A;  3DOL A;  3RRH A;  5DMR A;  4KV8 A;  2YCH A;  4DTO A;  3RR8 A;  3UE5 A;  3SNN A;  2IVN A;  3VQC A;  4ZTF A;  2BGG A;  2GUI A;  1NKC A;  4QS8 A;  2ZJR L;  3F5T A;  4DV1 K;  3UKU A;  1RDC A;  2A5X A;  4KH4 A;  4BR9 A;  2HHH K;  1VQ6 N;  1HYZ A;  4KHU A;  4IEE A;  3ISN C;  3HP9 A;  1BOT O;  4HCB A;  4BRC A;  4BRF A;  3QEW A;  5K14 A;  2PFU A;  4FYD A;  1LAV A;  4E3S A;  3VEV A;  4BDZ A;  4LFC K;  4DQS A;  1T03 A;  3C7N B;  2O8D A;  3A2F A;  4MLE A;  2OA8 A;  3SPY A;  4NCA A;  3OYI A;  4IEI A;  1HX1 A;  2WOM A;  4BRD A;  1T44 A;  1VHX A;  5FLX O;  4OLA A;  3VEO A;  3PO4 A;  4Z4I A;  4BC3 A;  2XO7 A;  2YNG A;  4CJF A;  4DR2 K;  3NBP A;  3CJB A;  2GV9 A;  3TI0 A;  1J6Z A;  3O9S A;  2JGU A;  3VQ8 A;  4BC4 A;  4Q0B A;  4AHU A;  1GLJ O;  4R5P A;  4UQG A;  2D4W A;  2UYT A;  4BWM A;  2KFN A;  3AGR A;  4BC5 A;  1YI2 N;  3OY9 A;  4OJR A;  4QAG A;  1RTJ A;  3FZK A;  3EKU A;  1DLO A;  3DXM B;  5KPT A;  2ZJP L;  5FPD A;  4BR2 A;  3HPO A;  3FZH A;  5BN9 A;  2QWQ A;  3ALY A;  4H8K A;  3GBT A;  4JS5 A;  3NFA A;  1GLD G;  3SQ0 A;  3V9W A;  5I42 A;  4GVE A;  3JAM O;  1BO5 O;  1E3M A;  5LJV A;  2HBM A;  3I56 N;  3MXI A;  3ZEU A;  3QET A;  2WUS A;  3CFO A;  2VG5 A;  4BVO A;  4I9Q A;  3NF8 A;  1BHL A;  1GOA A;  4PL7 A;  1TK8 A;  3VQB A;  4EP5 A;  4CIF A;  4CI6 A;  3CIP A;  2KZZ A;  3THX B;  1U04 A;  2JWL A;  4B9L A;  2P9N B;  4H0X B;  5MLC Q;  4M3T A;  2DFH A;  4A57 A;  2E2P A;  5DK5 A;  2VYP A;  2I7P A;  4IJA A;  1MA9 B;  1C0G A;  1N34 K;  4DV2 K;  2FLO A;  2JLE A;  3O08 A;  2EWS A;  4NLC A;  4I2P A;  4ID5 A;  3V9U A;  3I0R A;  1ESV A;  1RDB A;  5AQO A;  2YHY A;  2PY5 A;  2UUB K;  4IDK A;  5AZJ A;  4MFB A;  1I94 K;  1K9M O;  4CEE A;  4HWI A;  2QEX N;  4OGE A;  2X6S A;  3O9U A;  4CFC A;  1Q82 O;  2WFB A;  3J81 O;  4AH9 A;  4I7F A;  3ZT3 A;  4ISG A;  1TAQ A;  4B8A B;  1YIT N;  4FOE A;  4HUF A;  3EKS A;  2XHB A;  1LWF A;  4LF6 K;  4XH5 A;  1KAX A;  3MED A;  4DV5 K;  3G6E N;  1JXE A;  2YHW A;  2NUB A;  3JS6 A;  1UOC A;  4FJM A;  2WTU A;  4C1N K;  5LMU K;  3PV8 A;  1NK7 A;  5AQF A;  3ZSY A;  3TAM A;  2UXB K;  1G99 A;  3OVN A;  2UXD K;  1J5E K;  1D4X A;  3I8B A;  1RDU A;  1RT1 A;  4Y1D A;  4FLV A;  1UWB A;  1ZYQ A;  2QXL A;  3HXM A;  3VA0 A;  3MCA B;  4BRN A;  4O8K A;  4PUO A;  3LDN A;  4FVM A;  4CJL A;  3L3U A;  3LP0 A;  3FZM A;  4JLH A;  3CF5 L;  3ZX2 A;  2FF3 B;  3EYZ A;  1TGO A;  3H46 O;  4QS7 A;  2A1S A;  3F2K A;  5BRF A;  3VES A;  2HBL A;  4CHO A;  1NM1 A;  2WBN A;  1VQ4 N;  3ASM A;  4FO0 A;  2BE2 A;  1DKG D;  1HPM A;  5AQJ A;  4AHV A;  4CER A;  4FJ9 A;  2W6K A;  3CJ7 A;  3QEX A;  1JLA A;  3U9Z A;  4FLW A;  1QSS A;  4KB1 A;  3GOI A;  2KTQ A;  4M3Z A;  3HOS A;  1X9M A;  4LF5 K;  3DYA A;  4GV9 A;  3DAW A;  4KHP K;  2O8B A;  1YJW N;  4JK9 A;  1XNR K;  3QEP A;  4DR4 K;  1SAZ A;  2PZS A;  3GL1 A;  5M1O A;  4ILJ A;  1YT3 A;  4M7X A;  2NRT A;  1Q8I A;  1TAU A;  3EN9 A;  3CJ1 A;  4JK7 A;  2D0C A;  3LM9 A;  3NF7 A;  4FJN A;  1RBS A;  3SQ2 A;  4WCE L;  1NJZ A;  5BR8 K;  4DSL A;  2D0P A;  2F8S A;  5C2D A;  3MWP A;  4DR6 K;  5BRH A;  4CFB A;  4BG9 A;  3VQA A;  4R79 A;  1JL1 A;  1HPZ A;  1BIS A;  3C7N A;  4OVL A;  1RBT A;  3V9X A;  3L8B A;  2DPN A;  1IKX A;  1GLE G;  3VGL A;  1BI4 A;  1NBW A;  3SI6 A;  5DM7 L;  3DJC A;  1F21 A;  2GEM A;  3OYH A;  1LAW A;  4Q5V A;  4KRF A;  4OPK A;  3DWL A;  1W97 L;  3AVF A;  1TUY A;  3MN7 A;  3CC4 N;  2O8E A;  5ELZ A;  1TYQ A;  2V7Z A;  4UY8 O;  3D2E A;  3PLA A;  3G71 N;  3E9L A;  1WOQ A;  2QW9 A;  2ITM A;  4CBW A;  4KBO A;  4FPB A;  4J8F A;  3OYF A;  4TSX A;  4V19 S;  1VQL N;  1WSI A;  1EXQ A;  4CGF A;  1VQO N;  3BP8 A;  4B1Y B;  4PQU A;  4B9S A;  1NK8 A;  4CGG A;  4IOC L;  2G8U A;  3HVT A;  1U6Z A;  1O1W A;  4X62 K;  4H5W A;  3H45 C;  3AVC A;  3BEX A;  3K5L A;  3PSF A;  4JI2 K;  2QWP A;  4NB4 A;  3LDL A;  5AQS A;  3UIQ A;  4YOW A;  3HJF A;  1ZBF A;  4IFE A;  2HST A;  1N5Y A;  1Y64 A;  2KQ2 A;  4B9T A;  5LMN K;  4FW1 A;  1HYS A;  4FM0 A;  1JLB A;  3O6W A;  4B3M K;  2P9L B;  3HST B;  3WXJ A;  2P1J A;  2FSJ A;  4A5A A;  4N5S A;  4CJS A;  4AM6 A;  3I8D A;  4CGJ A;  1BU6 O;  3B6O A;  3K2P A;  1Z26 A;  3I0S A;  2A6A A;  4GNI A;  3KLE A;  1RBU A;  4JKD A;  4N47 A;  3THX A;  2QKK A;  2ITG A;  3L2Q A;  2LSN A;  4O4G A;  2E2N A;  2HF3 A;  1X3N A;  4NYF A;  3OYG A;  1U49 A;  3K9K A;  4FLX A;  4E1M A;  3VTI A;  4A5B A;  5HOO A;  3CPE A;  3O5B A;  3T3F A;  4KHW A;  1KAZ A;  2FBT A;  4CJ7 A;  2QWN A;  3IRX A;  5KGX A;  4LF8 K;  4WYB A;  5J2N A;  3DLE A;  4FZX C;  1KD1 O;  3KKS A;  4AIL C;  3NGZ A;  1FKP A;  3P39 A;  2H3G X;  3DLR A;  4CJK A;  3S41 A;  3JYT A;  3IUC A;  4FLT A;  3FR0 A;  5IT9 O;  4RW4 A;  4HTU A;  1NG9 A;  3JSM A;  1U45 A;  2O8F A;  1TUU A;  1CZB A;  1REV A;  2P9I B;  3WXK A;  3C65 A;  3TWH A;  2ZWH A;  1ZBL A;  4WFB L;  1K8K B;  3WQU A;  4O8U A;  1JLE A;  3EL2 A;  2JWK A;  3CME N;  4YFU A;  5E26 A;  4FJ7 A;  1RTI A;  3SYZ A;  1RBV A;  5AQY A;  2W40 A;  1IV0 A;  2EX3 A;  4XH4 A;  1Z6R A;  1TKT A;  3KLG A;  3SUP A;  3LP3 A;  2BUP A;  4HCC A;  3MXM A;  4KH5 A;  3ULD A;  4B3S K;  1HNW K;  3ZX0 A;  1QTM A;  3LL3 A;  1ATS A;  4I6M B;  1BIZ A;  3AVJ A;  4A2A A;  3QNN A;  2ASM A;  2ATQ A;  5CZ2 A;  3N4P A;  3H08 A;  4DQP A;  2O4G A;  2HMP A;  3Q7B A;  3WXL A;  1ASU A;  1GLB G;  1VQM N;  2IVO A;  1O13 A;  1WSH A;  4DKW A;  5C15 A;  1OH6 A;  4CK1 A;  1NJW A;  3EE9 A;  4O5B A;  3RR7 A;  1XMQ K;  5LL6 Z;  5JLH A;  1YHQ N;  1JXB A;  1QHA A;  3SMP A;  4EAH D;  5BRE A;  5M1Q A;  5AQI A;  3HL8 A;  3SQ4 A;  1V4S A;  1VSE A;  4GMJ B;  3IAY A;  1WLJ A;  4CZJ A;  3MAQ A;  2P5O A;  1IBM K;  4B3T K;  4DR1 K;  1QSY A;  5T7B A;  3RSE A;  4ZHR A;  3SBT A;  3P5J A;  3QML A;  5AJ3 K;  4AQY K;  5KTQ A;  4IJN A;  2OPS A;  5EX5 A;  3ZX3 A;  3RRG A;  4IFY A;  3VET A;  2P9S B;  4BQL A;  4JEP A;  1YTU A;  4JI0 K;  4L8R B;  1VSH A;  3BDP A;  4C8M A;  2E1Z A;  2FXU A;  5AQQ A;  1IBK K;  4OKE A;  4BR0 A;  2XY6 A;  3TAQ A;  4W5N A;  3WNG A;  4DV0 K;  3F9K A;  1FXX A;  4JHD B;  3VEX A;  3ZT2 A;  2ZF5 O;  4CBX A;  5HL7 L;  2P9K B;  2OAN A;  4LFB K;  2V7Y A;  1QHT A;  4FWS A;  2F9T A;  3CQX A;  4JKC A;  3LP1 A;  3K0S A;  3U6F A;  3L2U A;  2Y1I A;  2AJQ A;  4K0K K;  3OYL A;  2HF4 A;  4C8N A;  4CZF A;  1NJX A;  2BH1 A;  4C23 A;  5C25 A;  1FKO A;  3LWM A;  3SMS A;  4DV4 K;  1YAG A;  1YIJ N;  3K5N A;  4PKG A;  2GWK A;  1NWK A;  2KKZ A;  2HND A;  4CGD A;  4JKF A;  2D5R A;  3DLG A;  3NGY A;  1T6D A;  5F2R A;  1S1X A;  1RT6 A;  4DU1 A;  1DEJ A;  4CF1 A;  3VEW A;  5KRS A;  3OS0 A;  2Z1H A;  1VSL A;  4IBN A;  4E19 A;  4FVU A;  3J80 O;  1U2V B;  3HSC A;  4WQ5 C;  5AQU A;  1WN7 A;  4AHC A;  3ZYY X;  4DR7 K;  3D0P A;  3IDH A;  3QFP A;  2YHX A;  1VQ7 N;  1YUW A;  1NMD A;  2D0O A;  3KTQ A;  1MWM A;  3H3O B;  3MEE A;  5GAH P;  3WNH A;  3BF3 A;  3HP6 A;  5TKW A;  3PX6 A;  2RKI A;  4DMN A;  1E4G T;  4DTS A;  1SL1 A;  4JYA K;  4BC2 A;  5JLF A;  2O8C B;  3I33 A;  4CJP A;  3A5M C;  4CZL A;  3T1A A;  5KQD A;  4F3O A;  1HLU A;  4C8L A;  4EZ9 A;  1TKZ A;  1I39 A;  2VGM A;  4DV3 K;  4HVJ A;  4M3X A;  1T7P A;  5EXW A;  3R6M A;  3TTC A;  4YOR A;  3EEQ A;  4CVN E;  3MN5 A;  1JLG A;  1ITG A;  4BR4 A;  1LW0 A;  2IDO A;  1S1U A;  4JI3 K;  2EHG A;  4KKO A;  4AHS A;  1LWE A;  1VSI A;  1NJY A;  3HM9 A;  3CCE N;  1B9D A;  4EIA A;  4B8C A;  3KJV A;  2P9P B;  1JJ2 M;  1L3T A;  3AVM A;  3L3V A;  1WSG A;  3VPZ A;  3OYD A;  3C94 A;  4CD3 A;  3F73 A;  5C12 A;  3SAH A;  3J7A P;  4IWV A;  1Q7Y O;  2HNZ A;  4FPA A;  4KO0 A;  4E7K A;  4DS4 A;  3W3D A;  4XIU A;  4JI6 K;  3MMV A;  4CHN A;  5BPN A;  3J7Z O;  1L3V A;  1NU0 A;  3G0Z A;  1FW6 A;  1RCH A;  1Y97 A;  4B3R K;  2NRX A;  3QIC A;  2G8I A;  2IIR A;  1WSF A;  5BR9 A;  3NE6 A;  1RT7 A;  2CH5 A;  2W41 A;  4H0T B;  4KB0 A;  1KCF A;  5AZI A;  2G8H A;  1NMN A;  5HRR A;  4JKE A;  1SZ2 A;  4K25 A;  5H1S Q;  3VGK A;  4BRK A;  4A62 A;  5C10 A;  2GBZ A;  2QTD A;  4KHN A;  3UKR B;  4K8X A;  4KHQ A;  3IG1 A;  2ASP A;  4BG8 A;  3KWG A;  2I7N A;  4FJI A;  1VSK A;  3OYE A;  3KLI A;  3O3G A;  3ATU A;  4DB3 A;  4IFV A;  4OPJ A;  3V9S A;  3THW B;  1BQM A;  2CGK A;  4BR7 A;  3O3H A;  1KVC A;  3ZSZ A;  1VQ9 N;  1ZBI A;  2FBV A;  4BRG A;  3OBW A;  2ZM6 K;  1X9J A;  3CC2 N;  1WNS A;  3OYA A;  1LW2 A;  2Q31 A;  4MQ3 A;  5CYM A;  1YTA A;  4DF4 A;  1VSJ A;  4DQI A;  4FK4 A;  1HQU A;  1KQS M;  4BDY A;  4BVP A;  4M41 A;  1HQE A;  1RDD A;  4GV3 A;  4DTU A;  2WC9 A;  4M3U A;  4FWL A;  1BCO A;  3T19 A;  4Z4H A;  4B9M A;  1U4B A;  3HPH A;  3AAP A;  3CQY A;  1N8R O;  3W0L A;  3LZI A;  1HUX A;  3C0B A;  4YOX A;  1ILY A;  3HM8 A;  1QQN A;  4KAZ A;  1TV6 A;  3OBY A;  3OTO K;  1XWL A;  1KVB A;  1DTT A;  4WQ4 A;  3NDK A;  4DS5 A;  2ETJ A;  5BPL A;  1JKH A;  4H0Y B;  3IKM A;  4BRP A;  1A5V A;  4L3Q A;  3TAE A;  1BUP A;  4Y1C A;  1IKV A;  1NK5 A;  4JN4 A;  4H0V B;  3KLF A;  1UAX A;  3ZET A;  5JVG L;  4RW9 A;  3DRR A;  1NGG A;  1IG9 A;  4IXC A;  4W5O A;  3L6Q A;  2B4J A;  3OS2 A;  2RF2 A;  4CEQ A;  1A5W A;  3HYF A;  3LAN A;  3LP2 A;  4MO5 A;  4CZI A;  3MK6 A;  2YNH A;  4ZTJ A;  2G8V A;  4KTW A;  1VRT A;  5M1K A;  3AA4 A;  3QEV A;  4CZK A;  4FWN A;  4DTM A;  3U8X A;  3CI5 A;  4HTL A;  3J8A A;  4DF8 A;  3AO3 A;  3ZT1 A;  4PY5 A;  1EET A;  4FK0 A;  1BG3 A;  4OPH A;  3D6R A;  1D8Y A;  2VG6 A;  3A5L C;  1U2V A;  3SK3 A;  4FJH A;  5JS1 A;  4DTJ A;  2F9W A;  4DFJ A;  2E6M A;  4M3W A;  3P31 A;  3KHY A;  4JKG A;  4ILH A;  4IKF A;  4CEC A;  2QWL A;  2OPR A;  4JNE A;  3NAE A;  3CJC A;  3ZCM A;  3KKR A;  3THY B;  2RPI A;  4WF9 L;  3CCL N;  2HVH A;  5AQL A;  4YOV A;  2O8C A;  3LM2 A;  3S3N A;  1BWF O;  1WAF A;  3VTH A;  2P9U B;  2ZQB A;  2OZM A;  1H1V A;  4CZG A;  3M8S A;  4CF2 A;  2D0A A;  3ZSV A;  4PHT X;  4CF9 A;  3TAN A;  1HKC A;  1S1V A;  1VQK N;  3U4L A;  2O4I A;  2B6A A;  5AQW A;  3ZSW A;  1CZ9 A;  3ULE B;  5KQ8 A;  2HBJ A;  4CIE A;  1JCE A;  2ZE2 A;  3GDQ A;  5LJW A;  4LFA K;  4KPY A;  3BF1 A;  1T6C A;  4CE9 A;  4RCH A;  3I55 N;  4JI4 K;  1HR0 K;  4CF8 A;  2P9P A;  5HP1 A;  1J53 A;  3RWU A;  3AO5 A;  5CYQ A;  4CJ3 A;  5BPM A;  4G9Z A;  3SCX A;  3O80 A;  5M1F A;  2PAV A;  3K5O A;  1E4F T;  4PKI A;  4J2B A;  2Q1N A;  4PWD A;  1S72 N;  1QE1 A;  1HKB A;  4FLU A;  3DLL L;  4PKH A;  1NK0 A;  3T69 A;  3CCM N;  4BRI A;  1JCG A;  3ZT4 A;  4ELV A;  4H0O A;  3QER A;  3C95 A;  2BTF A;  1XI1 A;  1S1T A;  5C42 A;  3TU5 A;  3S3M A;  4U67 L;  3SUO A;  3NH0 A;  3FFI A;  3DXM A;  3P38 A;  1HJO A;  2HHT A;  5J2Q A;  4DSK A;  4CJ5 A;  1J9A A;  3QDK A;  3CFP A;  1S9G A;  5AQT A;  4K41 A;  2OYQ A;  4BRH A;  2ZGY A;  4DG1 A;  1MWK A;  5FPE A;  4MLH A;  3TSQ A;  3EZW A;  3BY5 A;  4U7B A;  3CC7 N;  4NCB A;  1SUQ A;  3AY9 A;  1KLN A;  4NXN K;  3THV A;  1Z05 A;  1X3M A;  2YI1 A;  3WUH A;  2ZJQ L;  3A5N C;  4E7L A;  1T05 A;  4K43 A;  1WSJ A;  3WEE B;  5GIO A;  3VQD A;  3TR8 A;  3THW A;  3ID6 A;  2UUA K;  3KK7 A;  4FL9 A;  3TPQ A;  4ID1 A;  5ADX H;  2P9N A;  4XEI A;  4DCH A;  1IO2 A;  2E4L A;  3MCP A;  3E9P A;  1T3V A;  1L3U A;  3S9H A;  2Z1I A;  2YJE A;  2GWJ A;  3DLK A;  4E7H A;  4KTZ A;  3KD5 E;  5KGW A;  1KVA A;  4CGH A;  1HNI A;  1VQP N;  3UKU B;  3PY8 A;  3V9Z A;  3KK3 A;  4M63 C;  5EU7 A;  3E9O A;  4CEZ A;  1S22 A;  2ZD1 A;  1S3X A;  3QLH A;  4WFA L;  4JD2 B;  3QIO A;  3K57 A;  3ENB A;  4DWI A;  4JRQ A;  1IKW A;  2OTJ N;  3PUF A;  2HNY A;  2GUP A;  1SS6 A;  2NNW A;  2YKM A;  4ICL A;  5JS2 A;  4OGC A;  3P83 D;  2Q2R A;  4I9L A;  4CEF A;  4DTN A;  3LPT A;  5JMV A;  3DLB A;  1QQM A;  4B9Q A;  5KPR A;  2HB5 A;  5KRT A;  1K6Y A;  3PIO L;  1C1A A;  5AQZ A;  3ZSO A;  3C6T A;  2GTD A;  4A59 A;  3WT0 A;  5A2Q O;  4OO1 J;  4FWQ A;  5I9E B;  4BE0 A;  5GAD P;  3T1Y K;  3D7E O;  4H5V A;  2DFF A;  3KLH A;  3VF4 A;  4DLG A;  3CM6 A;  2V51 B;  1RT3 A;  3EZ5 A;  3WXM B;  2QXF A;  2YX6 A;  3PIP L;  3L0Q A;  4BRA A;  1Z25 A;  3LDP A;  3NCI A;  2AP1 A;  3NF9 A;  4O55 A;  5FDL A;  3HOT A;  1KSP A;  3BZC A;  4B1X B;  1D9D A;  4QS9 A;  5CY4 A;  2QI2 A;  2IC3 A;  3UB5 A;  3V6D A;  4JK8 A;  4CJT A;  1KAY A;  1KFD A;  4ISE A;  5J1E A;  2RHK A;  3H6E A;  1NKB A;  2Q0R A;  3HPG A;  5CHI A;  2CGJ A;  1UA1 A;  1RT4 A;  1NGJ A;  3RMD A;  2HHW A;  2Q36 A;  1W7A A;  4RTF D;  2R7Y A;  4DTP A;  3ZEU B;  1FJG K;  4CGI A;  1HNV A;  3EE8 A;  4IO8 A;  2NRH A;  1C0F A;  1N6Q A;  4CJV A;  3M5R A;  3PX4 A;  5AFU H;  1HJR A;  3CHW A;  3O4Q A;  1L5U A;  2VWB A;  1C1B A;  1R0A A;  4DU4 A;  2VCP A;  5CZ1 A;  4J2E A;  4KH6 A;  3VEZ A;  2NZT A;  5AR0 A;  4JKB A;  3NVK A;  4H0P A;  3GG4 A;  3AGK A;  4FWK A;  2J4R A;  1VK0 A;  1U48 A;  1TL1 A;  3FZF A;  4FLY A;  3OYM A;  3LDQ A;  5J2M A;  2A1R A;  5GIP A;  3C6H A;  3PSI A;  3QBX A;  4DTX A;  2PBD A;  1YJ9 N;  4FXD A;  1BDG A;  3VA3 A;  4BRO A;  3GE1 A;  3VF2 A;  3R1X A;  4F9O A;  2KW4 A;  5M1P A;  4FJG A;  1TKX A;  4CHY A;  1UA0 A;  5AZJ B;  3O9T A;  1TK5 A;  4H03 B;  4RW8 A;  1YXQ A;  1OH7 A;  4BE2 A;  4RW7 A;  3TAB A;  2HOE A;  3MX2 A;  4I2Q A;  3V1R A;  3HO1 A;  1S1W A;  1NK4 A;  1CZA N;  4LSL A;  1SKR A;  1HNZ K;  3QBW A;  3HK2 A;  3LAL A;  2QM1 A;  5AQR A;  4FWR A;  1NGB A;  3SV3 A;  2NRW A;  1OVY A;  4CJQ A;  1LCU A;  4B9U A;  4FW2 A;  1P8Z A;  1C1C A;  2NRV A;  4C8O A;  5F1X A;  2VQF K;  2YNF A;  3SLC A;  3VQE A;  4DFM A;  2HHV A;  4K8Z A;  3BZK A;  3DRP A;  1D5A A;  3MN9 A;  2FSK A;  4JI8 K;  3AVH A;  2XY5 A;  3MDQ A;  1RTH A;  4LF7 K;  2HW3 A;  1NGD A;  5IWA K;  4DHY A;  4MDB A;  3T1H K;  3KK1 A;  5KI6 A;  1RNH A;  5I3U A;  1GLL O;  4PL8 A;  5B8H A;  4E7I A;  4LD0 A;  1SV5 A;  3V81 A;  4DUY K;  3NH1 A;  1IH7 A;  5FRO A;  3VGM A;  4DV6 K;  1VSM A;  2OPQ A;  4NLB A;  3G10 A;  2VQE K;  3H3N O;  2DTU A;  2RN2 A;  2CH6 A;  1XQS C;  3QNO A;  2P9L A;  3TAG A;  4BRQ A;  4EP4 A;  4CK3 A;  4E7J A;  2NRZ A;  1NK9 A;  2E6L A;  4BE1 A;  2V52 B;  4IG3 A;  4X64 K;  3OYC A;  3FFK B;  1NKE A;  4YHH K;  5HRS A;  1S9E A;  3BGR A;  3QB0 A;  1IBL K;  3C6U A;  4CK2 A;  1KLM A;  3O8M A;  1M90 O;  3ID8 A;  4FJJ A;  1GLC G;  3AVA A;  3CCS N;  2O8B B;  2Q0U A;  1Q18 A;  1K8A O;  1JLQ A;  4EFH A;  2P5G A;  2QWO A;  3FLC O;  3FGU A;  4C1N I;  2NRR A;  4K42 A;  1SL2 A;  3SV4 A;  4NXM K;  1VQ8 N;  3TTF A;  3ZSQ A;  5JVH L;  2BAN A;  2Q97 A;  2WON A;  1RGI A;  3VEN A;  2A40 A;  2VGN A;  1RTD A;  4JD2 A;  3MN6 A;  3H1V X;  3TAR A;  3D45 A;  4IG0 A;  4BGA A;  2IOC A;  4DQQ A;  4B3O A;  1VSD A;  4CZM A;  2X6N A;  3M8R A;  3OHR A;  3CPW M;  3N4Q A;  1WBB A;  1SQK A;  2A41 A;  3P1G A;  3AA3 A;  1DGK N;  3CCR N;  5EY4 A;  4N41 A;  4DQR A;  4QOZ B;  5C2F A;  1BI4 B;  1HYV A;  2YKN A;  1QVG M;  2OPP A;  2P9I A;  4RW6 A;  4YY3 K;  4YNQ A;  2BDP A;  1DT9 A;  4FJL A;  1K8K A;  2F7T A;  3TAF A;  4H5R A;  3L2W A;  3AVL A;  3R9P A;  2Q3S A;  2O8E B;  1TYQ B;  5E84 A;  4M7Y A;  1DTQ A;  3AVK A;  3D2E B;  1RT2 A;  5LY3 A;  5FPM A;  2UXC K;  1LOT B;  4GKJ K;  1QSL A;  3KIO A;  4DSJ A;  3CYM A;  4IZ9 A;  3M1F A;  5AQP A;  4I6M A;  4X66 K;  2HMI A;  3OYJ A;  1BL3 A;  2OTL N;  1MDU B;  3FE1 A;  4BRE A;  1EP4 A;  2F8T A;  1GLA G;  1I3A A;  1OVQ A;  3QO9 A;  1KFS A;  2F96 A;  4CJE A;  4B1U B;  4Z4E A;  3TTD A;  2FBY A;  2RE2 A;  1XMO K;  1W9H A;  3L2R A;  4WFN L;  2HHS A;  3VEY A;  4F3T A;  4E89 A;  3KZB A;  1ATN A;  1RBR A;  4CBU A;  2P51 A;  4CHZ A;  2HVI A;  3HZ6 A;  3RMC A;  1ASW A;  4Y0W A;  4KI4 A;  1XC9 A;  4CF0 A;  1LV5 A;  2FF6 A;  1J5O A;  4GV6 A;  1NGH A;  3MXJ A;  4ELU A;  4FSV A;  3B6P A;  2QKB A;  2QWR A;  4PA1 A;  4CD1 A;  1NGE A;  5EVZ A;  4CEO A;  3K58 A;  3CFR A;  3EO3 A;  3SUQ A;  2P9S A;  1OH8 A;  1Q9Y A;  4BQZ A;  1NGA A;  4DR3 K;  4WQ4 C;  3EY1 A;  4C8K A;  3QES A;  3ITH A;  1VQN N;  1EWR A;  4Z0U A;  4OKK A;  3KK2 A;  1BA1 A;  4GY2 B;  3KWI A;  5HRN A;  4YOY A;  4EHT A;  4JHD A;  5HBM A;  3O4W A;  1B92 A;  1C0T A;  4FWO A;  4H4M A;  3WNF A;  1S6Q A;  3MX5 A;  2P9K A;  4B9V A;  1XNQ K;  1ATR A;  4G1Q A;  2ZGZ A;  1XHX A;  4BGB A;  4JKA A;  4JI5 K;  4X65 K;  1KRP A;  1BCM A;  1FK9 A;  5AQN A;  2E5L K;  4CJU A;  4YOT A;  2QWM A;  4GKK K;  2O8F B;  4OKJ A;  3CQ8 A;  1Q86 O;  2DY4 A;  3A8Y A;  3KVG A;  5E41 A;  4HHT A;  4LF9 K;  2Z1J A;  4O5F A;  1GOB A;  3OJU A;  1GLF O;  2HHQ A;  3O9R A;  3TSU A;  1YVU A;  2GEL A;  3G4S N;  4AHT A;  3V1Q A;  2D0B A;  3BUZ B;  3L4Q A;  4H4O A;  3ZT0 A;  3QEI A;  3DRS A;  4XH1 A;  4DQ8 A;  3MWT A;  3VQP A;  4NO7 A;  4Z94 A;  2E1Y A;  1JCF A;  3AAQ A;  4KHS A;  4CJR A;  3CCU N;  4ISF A;  2YHA A;  2ASO A;  2KZM A;  2XRI A;  3CG7 A;  5C0Y A;  4CW7 B;  3SJJ A;  3J7Y P;  3AVI A;  3L4I A;  3DM2 A;  4AF1 A;  3CET A;  3AO2 A;  2E20 A;  4BRM A;  5TKY A;  4E0D A;  4Z4G A;  3V1O A;  1YF5 L;  3KD1 E;  4B9N A;  2YNI A;  1JLF A;  5KPZ A;  1Q9X A;  1ZBU A;  4NCG A;  2XY7 A;  1NOZ A;  1OH5 A;  1S6P A;  3RVC A;  4DFP A;  4IOX A;  5AQK A;  1N32 K;  4Z4F A;  4DTR A;  3AO1 A;  4E1J A;  3V4I A;  3OYK A;  3RSE B;  3LDO A;  4O44 A;  1XC3 A;  4DV7 K;  4BR5 A;  1QS4 A;  1KXP A;  1TL3 A;  1EX4 A;  5AQX A;  1SKW A;  3A5O C;  4DFK A;  1XHZ A;  1NGF A;  4DLE A;  1SKS A;  4ELT A;  2D1K A;  1TKD A;  4M45 A;  4FJX A;  1D9F A;  5GAG P;  4IDH A;  1VQ5 N;  1NGI A;  2DFE A;  4O0J A;  2QK9 A;  3NVM A;  1C6V A;  4M42 A;  4M3Y A;  3JXU A;  1Q81 O;  2KHO A;  4BRL A;  4E1N A;  1WSE A;  4LY7 A;  3P4I A;  1K73 O;  2A3Z A;  4MO4 A;  5FRN A;  1YVN A;  1RIL A;  3CMA N;  3SZ2 A;  3NGI A;  2VWK A;  5JIC A;  2Y1J A;  3C6A A;  1U47 A;  1ZBS A;  4HUG A;  4EZ6 A;  4JS4 A;  1QZ6 A;  3K5M A;  4B1V A;  2IAJ A;  2W42 A;  1RFQ A;  3VQ7 A;  4FZZ A;  3TSP A;  3DXK B;  2G8W A;  3A0I X;  3O9Q A;  3ZLJ A;  4DSI A;  4AM7 A;  3AA2 A;  3RTV A;  4F4K A;  1NNE A;  4B1W B;  4F8R A;  3WNE A;  3M8P A;  4FCY A;  3IS9 A;  5GAE P;  3NHG A;  1ZC6 A;  4FZY A;  3D2F B;  3UKR A;  3T7Z A;  2YHB A;  3AAR A;  2X74 A;  1VRU A;  3LPU A;  1T8E A;  4AHR A;  1EO1 A;  1YJN N;  4CHQ A;  4RG8 A;  3VQ9 A;  4N56 A;  3VQQ A;  1HKG A;  1MU2 A;  5CE3 A;  1KTQ A;  3ENO A;  4LH4 A;  3S3O A;  1L3S A;  4M3R A;  4N76 A;  1QZ5 A;  2OCE A;  2W6L A;  4IO9 L;  2A42 A;  1WBD A;  4IOA L;  4JI7 K;  1WUA A;  3IFR A;  3NF6 A;  3ZSR A;  1HMV A;  4FWM A;  3HI0 A;  1IG8 A;  3LWL A;  1IJJ A;  2B5J A;  2E2Q A;  4KFB A;  3PX0 A;  4CFA A;  3IMX A;  1SL0 A;  1RT5 A;  3U9D A;  5HRO A;  2PYL A;  1N33 K;  1WB9 A;  3CJA A;  1BQN A;  4HUE A;  5FPN A;  3DLH A;  2OZS A;  3M3Z A;  5SZT A;  4A2B A;  2HBK A;  2UU9 K;  4JI1 K;  3ZSX A;  3AVG A;  1C0U A;  2FC0 A;  3HBT A;  4JKH A;  4LSN A;  5F0X A;  3AV9 A;  4FM2 A;  3NMU A;  4OLB A;  4DSE A;  3LDS A;  3AVB A;  2E8A A;  5AQG A;  3VQ6 A;  3CCJ N;  3VQ4 A;  3DOK A;  3E66 A;  2XY8 A;  3TAP A;  5M1N A;  2O8D B; 
#chains in the Genus database with same CATH homology
 1VSF A;  4KB1 A;  1C1C A;  2KTQ A;  4M3Z A;  4C8O A;  3DI6 A;  1X9M A;  1EKE A;  2YNF A;  4CCH A;  3VQE A;  4DFM A;  4J2D A;  2HHV A;  3DYA A;  4FJI A;  1VSK A;  4K8Z A;  3DRP A;  1D5A A;  3OYE A;  3KLI A;  5SWM A;  3O3G A;  4DSF A;  3VQ5 A;  3AVH A;  2XY5 A;  3QEP A;  1RTH A;  1A5X A;  2HW3 A;  4IFV A;  2PZS A;  1NK6 A;  1YT3 A;  4OPJ A;  3V9S A;  4BDP A;  2HHX A;  1BQM A;  1Q8I A;  1X9W A;  1TAU A;  2D0C A;  4FJN A;  3NF7 A;  1RBS A;  3O3H A;  1KVC A;  3ZSZ A;  3SQ2 A;  3KK1 A;  5KI6 A;  1RNH A;  1NJZ A;  4DSL A;  5I3U A;  1CLQ A;  4GVM A;  2F8S A;  1ZBI A;  2FBV A;  5D3G A;  4W5R A;  4E7I A;  4LD0 A;  4CFB A;  1WNS A;  1SV5 A;  4LH5 A;  3OYA A;  3VQA A;  3V81 A;  1LW2 A;  3NH1 A;  1IH7 A;  4MQ3 A;  5CYM A;  5FRO A;  1YTA A;  4DF4 A;  1VSJ A;  4DQI A;  1JL1 A;  1HPZ A;  1VSM A;  4FK4 A;  3CM5 A;  2KFZ A;  1HQU A;  1BIS A;  4OVL A;  4KTQ A;  4BDY A;  1RBT A;  2OPQ A;  3G10 A;  1NOY A;  3V9X A;  3SQ1 A;  4M41 A;  2DTU A;  3L8B A;  1HQE A;  1RDD A;  2RN2 A;  1IKX A;  4DTU A;  1BI4 A;  3QNO A;  3OYN A;  4BAC A;  3SI6 A;  4M3U A;  4W5Q A;  4CJ4 A;  1BCO A;  1F21 A;  3T19 A;  1LAW A;  3OYH A;  4Z4H A;  3TAG A;  4CJW A;  4Q5V A;  4EP4 A;  4OPK A;  3HPH A;  4CK3 A;  3U3Y A;  1U4B A;  4B9M A;  4F2S A;  4E7J A;  1CXU A;  1NK9 A;  2E6L A;  3MEC A;  3AVF A;  1S5J A;  3LZI A;  4BE1 A;  4IG3 A;  3OYB A;  3OYC A;  1NKE A;  5HRS A;  1S9E A;  1IKY A;  3BGR A;  1JL2 A;  4GW6 A;  1QSS A;  4KAZ A;  3C6U A;  2YV0 X;  4CK2 A;  3OYF A;  1TV6 A;  4TSX A;  1KLM A;  1XWL A;  1KVB A;  4CED A;  1DTT A;  2PYJ A;  1WSI A;  4FJJ A;  1C0M A;  1EXQ A;  3AVA A;  4CHP A;  3NDK A;  4DS5 A;  4FJ8 A;  1X9S A;  2ETJ A;  4JRP A;  3NH2 A;  4CGF A;  1JLQ A;  1JKH A;  2P5G A;  1A5V A;  4PQU A;  1SL2 A;  4B9S A;  2VG7 A;  3SV4 A;  3TAE A;  3SPZ A;  1NK8 A;  4CGG A;  1JLC A;  2G8U A;  3ZSQ A;  2BAN A;  3HVT A;  4Y1C A;  1O1W A;  1IKV A;  2WON A;  2Z1G A;  1NK5 A;  3KLF A;  5HRP A;  4CIG A;  1RTD A;  3AVC A;  3DMJ A;  3K5L A;  1UAX A;  1TVR A;  4KHY A;  4RW9 A;  3DRR A;  3TAR A;  1IG9 A;  3RMA A;  3D45 A;  4W5O A;  4IG0 A;  2IOC A;  1BIU A;  4DQQ A;  4B3O A;  1ASV A;  2B4J A;  1VSD A;  2RF2 A;  4CEQ A;  3OS2 A;  1A5W A;  3UIQ A;  3HYF A;  2X6N A;  1ZBF A;  3M8R A;  3HJF A;  3LAN A;  3LP2 A;  4KRF A;  3SUN A;  1N5Y A;  1B9F A;  2YNH A;  3P1G A;  5FRM A;  2KQ2 A;  3AA3 A;  3LAK A;  4ZTJ A;  2I5J A;  4NYN A;  4B9T A;  2G8V A;  4KTW A;  1VRT A;  4N41 A;  3AA4 A;  4FW1 A;  4DQR A;  3M8Q A;  4QOZ B;  1HYS A;  1BI4 B;  1HYV A;  2YKN A;  4DU3 A;  3QEV A;  4DTM A;  2OPP A;  3U3G A;  4WE1 A;  4RW6 A;  1JLB A;  4FM0 A;  4YNQ A;  3HST B;  2BDP A;  3RMB A;  4FJL A;  4CFD A;  2P1J A;  3TAF A;  4CEB A;  3E01 A;  3AVL A;  3L2W A;  3AO3 A;  4N5S A;  2Q3S A;  4CJS A;  4DF8 A;  3ZT1 A;  4CGJ A;  3I8D A;  1EET A;  1TK0 A;  3B6O A;  4PY5 A;  4FK0 A;  3K2P A;  1Z26 A;  2VG6 A;  1D8Y A;  1J54 A;  1DTQ A;  3AVK A;  3I0S A;  5C24 A;  4FJH A;  5JS1 A;  3KLE A;  3AA5 X;  1RT2 A;  4FLZ A;  4DTJ A;  1RBU A;  1X1P A;  2E6M A;  4N47 A;  4DFJ A;  2G8K A;  2QKK A;  3LAM A;  3OJS A;  2VWJ A;  4M3W A;  2ITG A;  3L2Q A;  1QSL A;  3HT3 A;  2LSN A;  2IGI A;  1GOC A;  3KIO A;  4O4G A;  2G8F A;  4CEC A;  4DSJ A;  4IKF A;  3CYM A;  3HVR A;  4Z4C A;  4KI6 A;  4NYF A;  3OYG A;  2IS3 A;  2OPR A;  3VN5 A;  4W5T A;  3O3F A;  1U49 A;  4FLX A;  4E1M A;  2HMI A;  1HRH A;  3OYJ A;  1BL3 A;  3NAE A;  3T3F A;  4KHW A;  3ZCM A;  3K59 A;  3KKR A;  4J2A A;  4O0I A;  2FBT A;  2RPI A;  4BWJ A;  4QCL A;  3IRX A;  5KGX A;  4KRE A;  2HVH A;  3OS1 A;  3QIP A;  1EP4 A;  2F8T A;  5J2N A;  1RDA A;  1ZBH A;  3DLE A;  4FZX C;  3KKS A;  4AIL C;  3QIN A;  1I3A A;  1FKP A;  3NGZ A;  3S3N A;  4CES A;  4FM1 A;  1WAF A;  2OZM A;  2ZQB A;  3QO9 A;  1KFS A;  2F96 A;  4CJE A;  3AO4 A;  3DLR A;  4CJK A;  3M8S A;  4Z4E A;  2FBY A;  4CF2 A;  2D0A A;  1BGX T;  3ZSV A;  1W9H A;  4CF9 A;  3JYT A;  4FLT A;  3TAN A;  3L2R A;  4RW4 A;  1S1V A;  2HHS A;  4HTU A;  4CEA A;  3JSM A;  1U45 A;  2O4I A;  2B6A A;  4F3T A;  4E89 A;  1CZB A;  1REV A;  1RBR A;  3L2V A;  2HHU A;  5HLF A;  3ZSW A;  1CZ9 A;  3O4N A;  1LWC A;  4CIE A;  3MEG A;  3TWH A;  2P51 A;  4CHZ A;  1ZBL A;  1QQC A;  2HVI A;  2ZE2 A;  1JLE A;  3RMC A;  4KPY A;  1ASW A;  4FJK A;  3PO5 A;  4KI4 A;  4CE9 A;  4YFU A;  1XC9 A;  4FJ7 A;  1RTI A;  3SYZ A;  4CF0 A;  3AVN A;  4CF8 A;  1RBV A;  1LV5 A;  1J5O A;  2X78 A;  3MXJ A;  4ELU A;  3B6P A;  2EX3 A;  1J53 A;  5HP1 A;  2QKB A;  3LZJ A;  4PA1 A;  3KLG A;  1TKT A;  3SUP A;  4F2R A;  3RWU A;  3LP3 A;  1W0H A;  3AO5 A;  5CYQ A;  4CEO A;  4CJ3 A;  4B08 A;  3K58 A;  3SCX A;  3MXM A;  1CXQ A;  3CFR A;  4HCC A;  3SUQ A;  3K5O A;  1G15 A;  3ULD A;  5J2P A;  1Q9Y A;  1WAJ A;  1QTM A;  4J2B A;  1BIZ A;  2FBX A;  3AVJ A;  3EY1 A;  3QNN A;  1QE1 A;  3DOL A;  4C8K A;  4PWD A;  2ATQ A;  5CZ2 A;  3ITH A;  4FLU A;  3RRH A;  3QES A;  5DMR A;  4Z0U A;  3H08 A;  4KV8 A;  4OKK A;  3KK2 A;  1NK0 A;  4DQP A;  2O4G A;  4DTO A;  3RR8 A;  3ZT4 A;  1ASU A;  5HRN A;  3SNN A;  4ELV A;  3VQC A;  4ZTF A;  3QER A;  2BGG A;  3C95 A;  1WSH A;  1XI1 A;  2GUI A;  5HBM A;  1S1T A;  1NKC A;  5C42 A;  1B92 A;  1C0T A;  3S3M A;  4H4M A;  3SUO A;  3WNF A;  1S6Q A;  4CK1 A;  1NJW A;  4B9V A;  3NH0 A;  3FFI A;  1RDC A;  4O5B A;  3RR7 A;  4G1Q A;  2HHT A;  5J2Q A;  4DSK A;  1HYZ A;  4KHU A;  1JXB A;  4CJ5 A;  1XHX A;  1KRP A;  3ISN C;  1BCM A;  3HP9 A;  1J9A A;  1FK9 A;  3HL8 A;  3SQ4 A;  4HCB A;  1VSE A;  3CFP A;  4GMJ B;  4CJU A;  1S9G A;  3IAY A;  3QEW A;  5K14 A;  4FYD A;  1LAV A;  1WLJ A;  3MAQ A;  4OKJ A;  3CQ8 A;  4E3S A;  2P5O A;  2OYQ A;  2DY4 A;  4BDZ A;  4DG1 A;  5E41 A;  4DQS A;  1QSY A;  4HHT A;  1T03 A;  5T7B A;  2Z1J A;  4ZHR A;  3A2F A;  3P5J A;  4NCB A;  1GOB A;  2OA8 A;  3OJU A;  3SPY A;  1SUQ A;  4NCA A;  1KLN A;  3OYI A;  3THV A;  2WOM A;  2HHQ A;  5KTQ A;  4OLA A;  2OPS A;  4E7L A;  1YVU A;  3PO4 A;  3RRG A;  1T05 A;  4Z4I A;  4AHT A;  3V1Q A;  4IFY A;  1WSJ A;  2D0B A;  4H4O A;  3ZT0 A;  3VQD A;  3TR8 A;  2XO7 A;  2YNG A;  4CJF A;  3QEI A;  3DRS A;  3NBP A;  3VQP A;  2GV9 A;  1YTU A;  3TI0 A;  4Q0B A;  2JGU A;  3VQ8 A;  1VSH A;  4L8R B;  4KHS A;  3BDP A;  4CJR A;  4ID1 A;  4C8M A;  4FJ5 A;  2YHA A;  4AHU A;  4UQG A;  4R5P A;  4OKE A;  2KZM A;  2XRI A;  3CG7 A;  2XY6 A;  1IO2 A;  4BWM A;  2E4L A;  3TAQ A;  3SJJ A;  2KFN A;  4W5N A;  3WNG A;  1L3U A;  3S9H A;  3F9K A;  1FXX A;  2Z1I A;  3AVI A;  3DM2 A;  3ZT2 A;  3DLK A;  4E7H A;  3AO2 A;  4OJR A;  3OY9 A;  4KTZ A;  4QAG A;  5KGW A;  1KVA A;  4CGH A;  3KD5 E;  1RTJ A;  1HNI A;  1DLO A;  4E0D A;  4Z4G A;  3PY8 A;  3V9Z A;  3KK3 A;  3V1O A;  1QHT A;  3KD1 E;  5EU7 A;  2YNI A;  4B9N A;  4CEZ A;  1JLF A;  1Q9X A;  3HPO A;  2ZD1 A;  3LP1 A;  1ZBU A;  3U6F A;  4NCG A;  2XY7 A;  3QLH A;  3L2U A;  2Y1I A;  3QIO A;  3K57 A;  2AJQ A;  1NOZ A;  3ALY A;  3OYL A;  4C8N A;  4DWI A;  4H8K A;  1S6P A;  1IKW A;  4JRQ A;  4DFP A;  4JS5 A;  3PUF A;  2HNY A;  3NFA A;  1NJX A;  3SQ0 A;  3V9W A;  2YKM A;  4ICL A;  5C25 A;  1FKO A;  5JS2 A;  3LWM A;  4DTR A;  5I42 A;  4OGC A;  4Z4F A;  3AO1 A;  3V4I A;  3K5N A;  3OYK A;  3P83 D;  4I9L A;  4CEF A;  4CGD A;  4O44 A;  2HND A;  4DTN A;  3LPT A;  2D5R A;  3DLG A;  3NGY A;  3MXI A;  1QS4 A;  1S1X A;  1TL3 A;  1EX4 A;  1RT6 A;  4DU1 A;  3QET A;  3DLB A;  3CFO A;  1SKW A;  2VG5 A;  4CF1 A;  4DFK A;  4I9Q A;  1XHZ A;  5KRS A;  3OS0 A;  4DLE A;  1SKS A;  2HB5 A;  4ELT A;  5KRT A;  2Z1H A;  1K6Y A;  1VSL A;  4IBN A;  1C1A A;  3ZSO A;  1TKD A;  3C6T A;  4M45 A;  4FJX A;  3NF8 A;  1D9F A;  1BHL A;  4E19 A;  1GOA A;  1TK8 A;  3VQB A;  4BE0 A;  2DFE A;  4O0J A;  4EP5 A;  4CIF A;  2QK9 A;  1C6V A;  4M42 A;  4M3Y A;  2DFF A;  3KLH A;  1U04 A;  1WN7 A;  4AHC A;  4B9L A;  4DLG A;  2KZZ A;  3CM6 A;  4M3T A;  1RT3 A;  2DFH A;  3EZ5 A;  3D0P A;  5DK5 A;  4E1N A;  1WSE A;  4LY7 A;  2QXF A;  3KTQ A;  5FRN A;  2JLE A;  1Z25 A;  3NCI A;  3MEE A;  1RIL A;  4I2P A;  3SZ2 A;  3WNH A;  3NF9 A;  4ID5 A;  4O55 A;  2VWK A;  5FDL A;  3HP6 A;  3NGI A;  3V9U A;  3I0R A;  3PX6 A;  1KSP A;  1RDB A;  2Y1J A;  2PY5 A;  1U47 A;  2RKI A;  4DMN A;  4HUG A;  4EZ6 A;  4DTS A;  4JS4 A;  1SL1 A;  3K5M A;  1D9D A;  4IDK A;  5CY4 A;  4MFB A;  4CJP A;  2IAJ A;  2IC3 A;  3T1A A;  2W42 A;  3V6D A;  4F3O A;  4CEE A;  3VQ7 A;  4FZZ A;  4CJT A;  4C8L A;  5J1E A;  1KFD A;  2G8W A;  4OGE A;  4EZ9 A;  1NKB A;  1TKZ A;  2X6S A;  4CFC A;  1I39 A;  4HVJ A;  3HPG A;  4M3X A;  4AH9 A;  1UA1 A;  4I7F A;  1RT4 A;  3ZT3 A;  4DSI A;  1TAQ A;  4B8A B;  3AA2 A;  3RMD A;  3RTV A;  1T7P A;  4F4K A;  4F8R A;  2HHW A;  4HUF A;  3WNE A;  3M8P A;  2R7Y A;  2XHB A;  3IS9 A;  4FCY A;  1LWF A;  3NHG A;  4DTP A;  4FZY A;  1JLG A;  1ITG A;  3MED A;  1HNV A;  4CGI A;  4FK2 A;  2YHB A;  1LW0 A;  1JXE A;  2IDO A;  1S1U A;  1N6Q A;  2NUB A;  2X74 A;  1VRU A;  3LPU A;  2EHG A;  4AHR A;  4CJV A;  3PX4 A;  1T8E A;  1UOC A;  4KKO A;  4FJM A;  4AHS A;  1HJR A;  1LWE A;  1VSI A;  1NJY A;  4CHQ A;  4RG8 A;  3O4Q A;  3HM9 A;  3PV8 A;  1L5U A;  1NK7 A;  3VQ9 A;  1C1B A;  1R0A A;  1B9D A;  4N56 A;  3VQQ A;  4B8C A;  3KJV A;  4DU4 A;  5CZ1 A;  1MU2 A;  1KTQ A;  4J2E A;  1L3T A;  4LH4 A;  3AVM A;  3L3V A;  4M3R A;  3TAM A;  3ZSY A;  1WSG A;  3S3O A;  3OYD A;  1L3S A;  3C94 A;  3F73 A;  3OVN A;  4N76 A;  1VK0 A;  1U48 A;  1TL1 A;  1RT1 A;  4Y1D A;  4FLV A;  4FLY A;  1UWB A;  3OYM A;  2HNZ A;  5J2M A;  2A1R A;  4KO0 A;  1ZYQ A;  4DTX A;  4E7K A;  3NF6 A;  3ZSR A;  3HXM A;  1HMV A;  3VA0 A;  4DS4 A;  4FXD A;  3LWL A;  3VA3 A;  4XIU A;  2B5J A;  4KFB A;  4CHN A;  4PUO A;  3PX0 A;  4CFA A;  4FVM A;  4CJL A;  1L3V A;  2KW4 A;  3L3U A;  1RT5 A;  3G0Z A;  3LP0 A;  4JLH A;  1SL0 A;  5HRO A;  1RCH A;  1Y97 A;  2PYL A;  4FJG A;  1TKX A;  1BQN A;  4CHY A;  4HUE A;  1UA0 A;  3EYZ A;  3DLH A;  1TK5 A;  1TGO A;  4RW8 A;  2OZS A;  4BE2 A;  2A1S A;  4RW7 A;  3TAB A;  2G8I A;  5SZT A;  1WSF A;  4CHO A;  3NE6 A;  1RT7 A;  4I2Q A;  3ASM A;  3V1R A;  3ZSX A;  2BE2 A;  3HO1 A;  3AVG A;  1S1W A;  1NK4 A;  1C0U A;  2FC0 A;  1KCF A;  4LSL A;  4KB0 A;  2G8H A;  1SKR A;  4LSN A;  3AV9 A;  4AHV A;  3LAL A;  4CER A;  4FM2 A;  4FJ9 A;  4OLB A;  3HK2 A;  4DSE A;  5HRR A;  3LDS A;  3AVB A;  3VQ6 A;  3VQ4 A;  3SV3 A;  3DOK A;  2GBZ A;  2XY8 A;  4CJQ A;  3TAP A;  4K8X A;  4KHN A;  4KHQ A;  3IG1 A;  1JLA A;  3QEX A;  4B9U A;  4FLW A;  4FW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...