4CE9A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ce9A00
1ZBLA 4Q0BA 2KW4A 2AJQA 1S6QA 4MQ3A 4M45A 1TAQA 4FJMA 3VQQA 2P5OA 4N41A 3QO9A 3SYZA 1XI1A 2YNIA 3LP0A 4KFBA 2IDOA 3MXIA 3NGIA 1O1WA 4K8ZA 3DRPA 4AHRA 1D8YA 1S1XA 4W5NA 4CHOA 4PWDA 3RMCA 2OZSA 4K8XA 1HYZA 3HVTA 3LP3A 3AVCA 3NF9A 3OS1A 3ZSWA 4EP5A 3KK3A 5CZ1A 4CERA 4DF4A 1HPZA 3OYBA 4KKOA 1C6VA 1WSEA 1S9EA 3ITHA 3C6UA 3SQ1A 5J2PA 3NH0A 4ELUA 1ZBHA 4FZZA 3K59A 3NAEA 2D0BA 3O3HA 3TAQA 1HMVA 2D5RA 3K58A 3LZIA 4B9LA 4FJ5A 1JL1A 4BDPA 3IG1A 4FXDA 1C1BA 4CK3A 3P83D 4J2AA 4KI4A 3HJFA 4I2QA 2D0CA 3QLHA 3VQ9A 4OPJA 1HNIA 2YHAA 4QAGA 2EX3A 1L3UA 4F3TA 5J2MA 4RG8A 3G10A 4FJHA 1SKSA 3AO5A 3ZSVA 3KLIA 5CY4A 5HRNA 3HSTB 1TL1A 4E1MA 1XHXA 3DLGA 1KVBA 3KKSA 4DQIA 4CHNA 4CCHA 3K2PA 1CZBA 1QE1A 2OPPA 3NCIA 1JLGA 3CYMA 4O4GA 4FLVA 5HLFA 2G8KA 4AHSA 5HROA 1WAFA 4KHUA 3D45A 1QSYA 3OYNA 1DTQA 1HQUA 3F73A 3PX6A 1S1WA 2R7YA 4CFDA 1NJWA 1BCOA 1NKCA 1RILA 4FJ8A 1RT3A 4DSIA 1IKVA 2FBXA 1U04A 4FCYA 3DOLA 3HXMA 1L5UA 4DQPA 4OKJA 2GUIA 4O0JA 3AVFA 4CGJA 3KLFA 1J5OA 2BGGA 3D0PA 2GV9A 4JS5A 4CJ4A 4B8AB 3ZSXA 3KK1A 4DLEA 2HHTA 3S3MA 3KJVA 2FC0A 3K5NA 4CJLA 5CYMA 5C25A 1VSJA 4QCLA 2KQ2A 1SL0A 1JXBA 3ASMA 1D9FA 4AHTA 1JLAA 4BDYA 4FJXA 1BI4A 1IO2A 4F8RA 1VSHA 1HYSA 1R0AA 1Z26A 1N6QA 4PY5A 1K6YA 4CFBA 5SWMA 3ZSOA 1WSIA 1RBSA 4H4OA 4E19A 4N56A 3KK2A 3AA5X 4CJFA 1SKWA 3LP1A 4ID5A 1BQNA 1NJZA 4H8KA 3HK2A 3SQ2A 4B8CA 1I3AA 3MAQA 3QETA 4CESA 1CZ9A 4KHQA 1B92A 2HNZA 2Z1IA 1L3VA 4N76A 4M3XA 2ITGA 3AVAA 3AVLA 4M42A 3AVMA 3VQCA 3HYFA 2VWJA 1QQCA 3K5MA 1NK6A 3SI6A 3S3OA 3CQ8A 1C0TA 4OKKA 3S9HA 3TARA 4DS5A 3PUFA 3VQAA 4IKFA 3TAFA 3OYDA 2Y1IA 4M3RA 4M3YA 2DFFA 4HUFA 1TAUA 3DI6A 4CFAA 1RCHA 1VSFA 2QK9A 3K57A 4IDKA 4LH4A 3DLEA 4JS4A 5E41A 2BE2A 4H4MA 4CK1A 1S1TA 1ASWA 3RRGA 1TK5A 4IG3A 3HO1A 2EHGA 4O44A 4B9NA 3SPYA 5JS1A 4C8LA 4DQRA 3B6PA 2NUBA 3RWUA 4B9VA 1GOAA 1C1AA 4ID1A 3U3YA 3ZT1A 2QKKA 4CEQA 2PY5A 1A5VA 4JLHA 4DU4A 4CIFA 3AO4A 1NJYA 1C0MA 4FJGA 5SZTA 4CIEA 1CXQA 1BI4B 3VN5A 3THVA 2A1RA 4DSJA 3OS0A 1NK8A 5I42A 2B6AA 2ETJA 3G0ZA 3QNNA 2WONA 4DTMA 4FJ7A 3HP9A 1ASVA 1BQMA 1RDAA 3VQEA 2O4IA 1VRUA 3TWHA 3AV9A 3T19A 1B9DA 1FKOA 4FJIA 1EETA 1VSLA 3NFAA 2W42A 1YTUA 3AVHA 4KV8A 1KFDA 2IGIA 2IOCA 1VK0A 2X74A 4CGHA 2X78A 2RPIA 1WN7A 2XY7A 4GMJB 1QSSA 4E7HA 4PA1A 1VSEA 3A2FA 3PO4A 3SUQA 3AO2A 1RTIA 3NF6A 4CHQA 4CF8A 4W5QA 1IG9A 4E0DA 3O4NA 1REVA 4F3OA 3OYCA 3C94A 1J9AA 1JXEA 2I5JA 2B4JA 3ZSZA 5JS2A 3ZSYA 1KFSA 2YNGA 4DU3A 1SUQA 4Y1CA 3LAKA 4J2BA 4FK0A 4DG1A 2VWKA 1LWEA 4IFYA 1S1UA 4DSEA 2G8FA 3V81A 4DU1A 4CEDA 4BWJA 4CJQA 4RW9A 4OGCA 1HRHA 1EX4A 4FM0A 4Z4EA 1A5XA 4HCCA 4BE2A 3V9XA 1KVAA 1RT6A 4FLUA 1RT1A 3VQPA 4FZXC 1FKPA 4DF8A 1N5YA 3KTQA 3L2UA 4DTXA 3MXJA 4C8OA 1RT7A 4AHCA 3DRRA 3RTVA 1QS4A 3ALYA 4AH9A 4CJWA 3CFPA 4EZ6A 3QIOA 5K14A 3KLGA 1G15A 3VQDA 2OPSA 1FK9A 3BGRA 3OYLA 4BE0A 1UA1A 2JGUA 1D5AA 5D3GA 3FFIA 2PYJA 5J2NA 1UA0A 1F21A 2O4GA 1Y97A 1IKYA 3I0RA 2G8UA 3HP6A 4KTWA 1NK7A 3VQBA 4CJ5A 3LANA 2G8IA 3AVJA 1Q9YA 3F9KA 1YTAA 1LW2A 3AVBA 1WNSA 4RW8A 4L8RB 2HHXA 3WNFA 1ASUA 1S9GA 1RTHA 3M8PA 5HRRA 3HT3A 1JLQA 3OYMA 1TV6A 1X9MA 3QEIA 1XHZA 4E1NA 2GBZA 1VSIA 4DTNA 3V9WA 4DS4A 3LWLA 3RRHA 1WSHA 3SQ4A 1U47A 2F96A 2X6NA 1BCMA 1FXXA 3AVKA 4CJVA 3SV4A 4UQGA 3LAMA 4FLWA 1RT2A 2E6LA 4LY7A 3DYAA 4W5RA 3OYGA 4C8KA 2DFEA 3AA2A 3OYAA 2QKBA 1T05A 3VQ7A 4CEFA 3PX0A 1GOCA 4HVJA 2IS3A 4DSKA 3L2QA 2P51A 4CJTA 3DLRA 3K5OA 3VA0A 1TGOA 1BHLA 3OYKA 4CK2A 4CGDA 1VSMA 3V9ZA 3V9SA 2HHQA 2BDPA 3NBPA 1RDDA 1JLEA 1RDCA 2KTQA 4G1QA 3L3VA 4C8NA 4CF1A 4FLYA 4FK4A 1ITGA 4CFCA 1U4BA 4KHNA 4KREA 4E3SA 4I2PA 4CGFA 1IKXA 4KTQA 1TKXA 1W0HA 3QNOA 4F2RA 2DFHA 3T1AA 3KIOA 4OKEA 3KLEA 4HTUA 4AHUA 5FDLA 4FLZA 3TAPA 4ZTJA 4CEZA 1TK0A 2HB5A 5FROA 1SV5A 1BIUA 1DTTA 1SL2A 4O55A 2ZQBA 3OYIA 3E01A 4C8MA 2DTUA 1JLCA 2E6MA 3OY9A 1Z25A 2VG5A 4NYFA 3QEPA 3SUOA 1NK9A 3CM5A 4B08A 2XHBA 1RT4A 3OJUA 5KRSA 1U45A 1NKBA 1ZBFA 2OPQA 4HHTA 4DTJA 2ZD1A 4CJPA 2VG6A 1LAVA 5CZ2A 3WNGA 1NK0A 3ZT0A 4QOZB 1C1CA 3MEEA 3AA3A 3BDPA 4E7LA 4NYNA 4FW2A 4OPKA 4FM2A 3SQ0A 4FZYA 1BIZA 3IRXA 1RDBA 4KTZA 1TVRA 4YFUA 4CIGA 5I3UA 1LWCA 3OYJA 2FBVA 3O3GA 4DSFA 3ULDA 3LZJA 1NOYA 3HPHA 4OLAA 3AVIA 3L3UA 4FK2A 3VQ4A 4XIUA 5HP1A 4FLTA 3AO1A 3IAYA 3MEDA 3HPOA 3L2VA 1I39A 3SPZA 3KD5E 4HCBA 2YNHA 4GW6A 4KB1A 2HHSA 3L2WA 4PQUA 2IAJA 3MEGA 4BDZA 1U49A 2KZZA 4O5BA 2LSNA 5HRSA 4YNQA 1RNHA 2BANA 4TSXA 3PX4A 2HW3A 3CM6A 4Z4CA 3V6DA 2G8WA 1SKRA 4J2EA 4DTPA 1HJRA 4IBNA 4Z4HA 4WE1A 4F2SA 3AA4A 1DLOA 1JLFA 4CE9A 4ELTA 4DTOA 3IS9A 1WSFA 1RBRA 1RBVA 2OPRA 4FVMA 4FW1A 1LAWA 1X9WA 3QEVA 3ISNC 2Y1JA 3NDKA 1NK5A 3OVNA 3NGZA 1TL3A 3M8SA 2YKMA 1WSGA 3C95A 4LSLA 2RKIA 3PV8A 4F4KA 4ZTFA 3RR7A 1KTQA 1LW0A 3SUNA 3LPUA 1L3TA 1TKTA 3C6TA 4DFKA 1BISA 4FJLA 4CJUA 2KZMA 3NH2A 2E4LA 2QXFA 4N47A 1NKEA 3VQ8A 4PUOA 3OYEA 1TKDA 2IC3A 5KI6A 1RTDA 1JL2A 4OJRA 3LWMA 4N5SA 4W5TA 3SV3A 4I9QA 2X6SA 4DQQA 3TI0A 2DY4A 4OGEA 2ZE2A 3EY1A 1QTMA 3VQ6A 1ZYQA 3ZT2A 1QSLA 3ZCMA 1HQEA 3LP2A 4GVMA 4OVLA 3MECA 3NF7A 4DQSA 3V4IA 4DFJA 3QESA 4IFVA 3ZT3A 2OYQA 2HVIA 4CJEA 1Q8IA 1Q9XA 4EZ9A 1VSKA 4BWMA 3NHGA 4OLBA 4E7IA 4AILC 4DWIA 2Z1GA 3HM9A 5FRNA 3WNEA 1S6PA 5KGXA 5KTQA 3DM2A 4O0IA 2Z1JA 3OJSA 3KKRA 3QEWA 5CYQA 1RTJA 4KAZA 5KRTA 1S1VA 3V9UA 1T8EA 3DLHA 2P5GA 3L2RA 2KFNA 1TKZA 1YT3A 3B6OA 1WLJA 1YVUA 4NCBA 3HL8A 3LALA 3RR8A 1JLBA 1BL3A 1IH7A 3DMJA 4LH5A 1KVCA 4DMNA 2RN2A 3KD1E 2FBTA 4CGGA 3VA3A 4Z0UA 4DFPA 5J2QA 4Q5VA 4FLXA 3SZ2A 2WOMA 1A5WA 3L8BA 3KLHA 3HVRA 2XY5A 3DLKA 3CFRA 1RBTA 5C24A 4IG0A 1T7PA 3TAEA 4R5PA 4CEAA 4CHZA 4CF9A 3QIPA 4BACA 4DTRA 3H08A 3TABA 1L3SA 1QHTA 4B9UA 4FYDA 2PZSA 4CHYA 1BGXT 3TAMA 1NK4A 1J53A 1GOBA 3OS2A 4BE1A 3U6FA 3RMBA 4JRQA 3MXMA 1LV5A 4J2DA 3V1QA 4HUGA 2OA8A 5DMRA 5DK5A 4CJRA 3UIQA 4M3WA 4MFBA 1SL1A 2YV0X 4CEEA 2XY6A 1KRPA 3PO5A 3AVNA 3DRSA 4CHPA 1NJXA 1KCFA 4CGIA 5C42A 2D0AA 4CJKA 3EYZA 4ICLA 4KO0A 1KLNA 3WNHA 3AO3A 3DOKA 1X9SA 2KFZA 1S5JA 3QEXA 3NF8A 2RF2A 3ZSRA 3I8DA 2G8HA 2XY8A 3K5LA 4CF0A 3PY8A 3O4QA 2HHWA 2ATQA 3SUPA 4ZHRA 2P1JA 4CECA 4I9LA 3QINA 5T7BA 3P5JA 1IKWA 1UOCA 3JSMA 4B9MA 4RW6A 4B9SA 4DTSA 4NCGA 2OZMA 4E7KA 2A1SA 3V1OA 4KI6A 3TR8A 2HVHA 1EXQA 4DLGA 2YHBA 4M3TA 2FBYA 3CG7A 4FJ9A 3HPGA 4KHSA 4E7JA 2JLEA 4Z4IA 3NH1A 5FRMA 1C0UA 4M3UA 4M3ZA 1HNVA 3LDSA 1J54A 4B9TA 2Q3SA 2B5JA 3OYHA 1JKHA 1B9FA 1WSJA 4LD0A 4W5OA 5EU7A 3M8QA 2HHUA 1UAXA 3RMAA 3S3NA 4RW7A 2F8TA 3V1RA 3NGYA 4AHVA 1RT5A 1VSDA 1KSPA 2G8VA 3U3GA 2PYLA 3TAGA 1CXUA 4Z4GA 2HNYA 1MU2A 1TK8A 4NCAA 4FJJA 4KB0A 2XO7A 4LSNA 1EKEA 1XWLA 4FJKA 4KHWA 3QERA 4Y1DA 4I7FA 5J1EA 3T3FA 2HMIA 4KPYA 4CF2A 4CEBA 2XRIA 3SNNA 4DSLA 1XC9A 3DLBA 5KGWA 1CLQA 4CJ3A 1EP4A 2Z1HA 1HYVA 1X1PA 1UWBA 4RW4A 1WAJA 3SCXA 4DFMA 1ZBIA 2HHVA 2VG7A 4ELVA 4HUEA 4KRFA 4Z4FA 4FJNA 1NOZA 1VRTA 4B3OA 1LWFA 3ZT4A 3ZSQA 3VQ5A 4JRPA 2HNDA 3O3FA 3NE6A 1W9HA 4EP4A 3LPTA 1T03A 3P1GA 3EZ5A 5HRPA 2F8SA 3SJJA 3JYTA 1ZBUA 3CFOA 4DTUA 5HBMA 1RBUA 2YNFA 4M41A 3I0SA 3M8RA 4CEOA 2YKNA 4FM1A 3RMDA 3TANA 4E89A 3AVGA 1D9DA 4CJSA 3OYFA 1KLMA 4KHYA 1U48A
chains in the Genus database with same CATH superfamily
3JXUA 1ZBLA 4M45A 1NMNA 1Z05A 3LDPA 1XI1A 5AFUA 3LP0A 4B1XB 3U9ZA 4K8ZA 4AHRA 4CHOA 2KLAA 2VGNA 2NRHA 3ZSWA 4DF4A 3LM2A 1HPZA 1C6VA 1WSEA 1S9EA 2NNWA 3C6UA 3OBWA 5J2PA 4FJ5A 1HMVA 1S3XA 4FVUA 4BDPA 2EWSA 3IG1A 4FXDA 4CK3A 4J2AA 3HJFA 4JI1K 4OPJA 5JICA 4QAGA 2UUBK 4DR7K 4F3TA 1DT9A 3WXIA 3ZSVA 4CZFA 4H0VB 4A57A 4E1MA 3DLGA 2HF4A 3SK3A 4CHNA 3ID6A 1CZBA 1XQSC 4JKFA 1JLGA 3W0LA 4BGBA 2G8KA 1XNQK 1WAFA 3H46O 3OYNA 1DTQA 1HQUA 1S1WA 2R7YA 3OA9A 2GWKA 3W3DA 5AQKA 4FJ8A 2FBXA 4FCYA 4BR2A 1NGGA 3HXMA 2GUIA 3E66A 4O0JA 3AVFA 4CGJA 3KLFA 1J5OA 2BGGA 1QQMA 4B8AB 3KK1A 5AQSA 4NLBA 4DLEA 3KJVA 1NGEA 4BRFA 3K5NA 5C25A 2KQ2A 1D9FA 1JLAA 4FJXA 4LFBK 1VQKN 4OPHA 1SZ2A 2I7NA 1Z26A 5F2RA 2QXLA 1RBSA 3KK2A 3LP1A 5BN8A 1BQNA 3VESA 3FR0A 5C0YA 2JWKA 3MAQA 1B92A 3DLLL 4M42A 1OH5A 2VWJA 3CJ9A 2VQEK 3SI6A 3CETA 3TARA 3PUFA 3VQAA 4IKFA 3TAFA 4BRNA 3OYDA 4A61A 4CFAA 4DUYK 3K57A 2IIRA 4DV7K 2WBNA 4CK1A 1S1TA 1TK5A 4BVPA 3HO1A 4YDUA 2EHGA 4O44A 4B9NA 4DQRA 3B6PA 1VHXA 2A5XA 4CD3A 2QI2A 4ID1A 1VQ9N 2QKKA 3M5RA 4AM7A 4BRPA 1R59O 4BG8A 4A5AA 3I55N 1NJYA 2NRVA 4BR5A 1K73O 4FJGA 3VN5A 2HBMA 2E2OA 3HP9A 5LMNK 3O80A 2O4IA 1VRUA 3M6GA 3AV9A 1FKOA 4FJIA 1YTUA 4B1ZA 2OCEA 2NRTA 2IOCA 3VETA 2XY7A 1WN7A 4GMJB 3A2FA 3R3LA 4IOAL 5JS2A 1KFSA 2YNGA 3WUHA 4BR0A 4DU3A 4J2BA 2VWKA 3G71N 1NGCA 4XH4A 4BWJA 1EX4A 3J7AP 1A5XA 4HCCA 1RT6A 4FLUA 1RT1A 1FKPA 3L2UA 4DTXA 3MXJA 4C8OA 4H0XB 3DRRA 3ALYA 1HKGA 1G15A 3VQDA 1NG9A 1FK9A 4BE0A 3OYLA 1BO5O 4LF6K 4CZEA 2JGUA 3THXA 1LOTB 1YF5L 1HPMA 4IO9L 5J2NA 1F21A 1DKGD 1UA0A 1Y97A 4GV9A 3VQBA 3AVJA 4ISEA 4L8RB 4XEIA 1ASUA 1Q81O 1RTHA 3M8PA 5AQQA 3QDKA 3O1WA 4QS9A 3QEIA 4E1NA 2GBZA 1VSIA 3BEXA 2X6NA 3AVKA 1RT2A 4JK9A 3DYAA 4LY7A 4C8KA 3VEZA 2VCPA 3PX0A 2IS3A 3VA0A 3CCUN 1BHLA 2RE2A 4CK2A 1RDDA 2KTQA 5M1KA 3MX2A 4G1QA 3WQUA 4CF1A 5GAEP 4I2PA 1TKXA 3THXB 5C10A 4KAZA 3KLEA 4PKIA 4ZTJA 5FDLA 2GX9A 4CEZA 2HB5A 1VQNN 3VTIA 1DTTA 1WUAA 1SL2A 4O55A 5TKWA 3OYIA 1IBKK 3OY9A 4GVEA 3QEPA 4KBOA 2UXCK 2QWMA 4U67L 2O8BA 1LAVA 2P9SB 4WFBL 4JKAA 1C1CA 3N4PA 3NMUA 5EXWA 4CZIA 3OYJA 3O3GA 3EE9A 4CZGA 4H0YB 3ULDA 1NOYA 4FK2A 3VQ4A 3AO1A 3MEDA 3PLAA 3CQXA 3TSPA 3KD5E 2YNHA 4GV6A 2IAJA 3MEGA 3R8EA 2KZZA 4JNEA 3MX5A 4Z4CA 3V6DA 3J7YP 4DTPA 2QEXN 4K42A 3MN9A 1KXPA 1JLFA 4B1VA 2ZJQL 4DTOA 3TTCA 1RBVA 4FW1A 3ISNC 3NDKA 1TL3A 3C95A 1WSGA 2RKIA 3PV8A 3TSUA 3SUNA 3C6TA 4FJLA 3NH2A 1TKDA 1JL2A 4OJRA 4I9QA 4W5TA 4H03B 3EY1A 3VQ6A 3VF4A 4YOUA 1IBMK 1QSLA 3MECA 4IFVA 1HKBA 3ZX2A 1W2BM 4EZ9A 5AZJA 2OTJN 4DWIA 3VEYA 4YORA 1S6PA 5IT9O 3QEWA 2FSNA 5KRTA 1T8EA 5KPRA 1RFQA 2KFNA 1TKZA 1YT3A 1WLJA 2QWLA 2ZGYA 1BL3A 4NXMK 4LH5A 2Q31A 2Q0RA 4FWOA 1JCGA 3CFRA 2UXBK 3TAEA 4R5PA 2ZJRL 4CEAA 4CHZA 1L3SA 3QIPA 5FPEA 1HR0K 2WFBA 4FPAA 4B9UA 1BGXT 3TAMA 1GOBA 1LV5A 2AP1A 3V1QA 2OA8A 4IEIA 5DK5A 3UIQA 1T3VA 3MMVA 4MFBA 1MDUB 4JKBA 4CEEA 2XY6A 1KRPA 2D0PA 1NJXA 5C42A 2WUSA 3AO3A 2KFZA 2P9KB 5AZJB 3QEXA 3R6MA 2RF2A 3ZSRA 3I8DA 2G8HA 2HHWA 4CF0A 5M1NA 1ATSA 1LCUA 3SBGA 2HMPA 5JLFA 2P1JA 4CECA 3QINA 3CCQN 3GOIA 3JSMA 4B9MA 4RW6A 1SQKA 2V51B 2HVHA 4BRCA 1EXQA 4DLGA 2ASMA 4M3TA 5LMUK 4E7JA 3CF5L 4Z4IA 4PKHA 2QWPA 4HWIA 5FRMA 1Z6RA 3LDSA 2B5JA 1NWKA 1WSJA 4JI4K 2H3GX 3Q7CA 3M8QA 1D4XA 5A2QO 3S3NA 1ZBSA 4JHDB 1RT5A 3VERA 1KSPA 3FGUA 3G25A 4Z4GA 2NZTA 2XO7A 1EKEA 4GNIA 4Y0WA 3WXKA 5KGWA 1K8KA 4A5BA 1ZBIA 1RGIA 3SCXA 2HHVA 3UKRB 4A2BA 5ADXH 1LWFA 4IXCA 3ZSQA 2HNDA 1W9HA 4EP4A 3LPTA 3EZ5A 3ID8A 5EY4A 3SJJA 3JYTA 1ZBUA 4DTUA 4ISFA 2HBJA 2HF3A 1XNRK 4M41A 1HNWK 2PAVA 3RSEB 4WFNL 3M8RA 2D0OA 2YKNA 3RVCA 3RMDA 1D9DA 2W6KA 4JK7A 1KLMA 1X9WA 3D7EO 3JAMO 1U48A 2AJQA 4CZKA 3VQQA 4NB4A 4N41A 3QO9A 4O8UA 4JK8A 2YNIA 2IDOA 3MXIA 1S1XA 5BRDA 3RMCA 4BQZA 5BR8K 3LP3A 3OS1A 3AVCA 4DR1K 4CERA 4JV5K 4FWSA 1QVFM 3BP8A 5LJVA 4FZZA 4CW7B 2D0BA 3NAEA 3K58A 3LZIA 1U6ZA 4QS7A 1VQMN 5GAHP 2F9WA 3MDQA 1C1BA 4B3RK 3VQ9A 4IOXA 1HNIA 1L3UA 5AQWA 4RG8A 4FJHA 1SKSA 4BR4A 3EKUA 3KLIA 5CY4A 1WOQA 5HRNA 1TL1A 1KVBA 4CCHA 3I8BA 3K2PA 5LL6Z 3NCIA 1QE1A 2AA4A 3H3OB 1ZXOA 4IZ9A 1HX1A 5HROA 1QSYA 4FWPA 3WXJA 3F73A 3A5MC 1NJWA 3IDHA 3THWB 1U04A 3DOLA 4WCEL 2HBKA 3E9OA 4EHUA 4JS5A 4JKHA 3ZSXA 2P9LA 2FC0A 5CYMA 1VSJA 1JXBA 1EWQA 4IDHA 3ASMA 4KH6A 5FPNA 1GLLO 2QW9A 1BI4A 1IO2A 3OHRA 3ZEUA 4BRMA 3ZX0A 1YVNA 4FWNA 1N6QA 1EWRA 4PY5A 1K6YA 3CJBA 3CJAA 3ZSOA 4CFBA 3O8MA 1WSIA 3AA5X 4LF4K 1NJZA 3DAWA 4B8CA 3QETA 1CZ9A 3HTVA 2HNZA 4I6MB 3AVAA 4CZLA 4LF5K 3VQCA 3HYFA 3UKUB 1NK6A 3K5MA 5AQPA 4DS5A 3DJCA 1TAUA 3UE5A 3DI6A 1RCHA 1BA1A 3DLEA 4H0OA 3O9UA 4BC3A 4LF7K 2P9UB 4MO5A 5JS1A 2NUBA 4DHYA 4FWLA 4RTFD 2P9LB 1C1AA 3KWIA 4AQYK 3VENA 3B8AX 3ZT1A 4CEQA 1A5VA 4JLHA 1Q86O 4DU4A 1OVYA 4CIFA 4BG9A 1C0MA 1Q82O 3J7ZO 5SZTA 1BI4B 4DSJA 3THVA 3ZEUB 3OS0A 1BOTO 5I42A 2ETJA 2WONA 3SMSA 4FOEA 4H5NA 4IJAA 3LL3A 3SBTA 4C23A 3IMXA 3BF3A 1RDAA 3VQEA 4F9OA 2YI1A 3H3NO 2IGIA 2X78A 2RPIA 3SJHA 3CCMN 3SUQA 3AO2A 4NLCA 1RTIA 4CHQA 4W5QA 4CF8A 3OYCA 1Y64A 2I5JA 2B4JA 5AQJA 3LAKA 4FK0A 4DG1A 3SAFA 1S1UA 4DSEA 2G8FA 3MWPA 4CEDA 4CJQA 2W41A 1HRHA 3I33A 1TUUA 2VQFK 4BE2A 3V9XA 1KVAA 4FZXC 1YXQA 3CFPA 4AH9A 4B1WB 1VQLN 3BGRA 3PSFA 4CZMA 1UA1A 3FFIA 3AGRA 4DV3K 1WBBA 5C15A 1J6ZA 3F9KA 1S9GA 2QWQA 5HRRA 3HT3A 3OYMA 1TV6A 3WEEA 4IO8A 4DTNA 5BPNA 1HNXK 3LWLA 1NGFA 4G9ZA 3U8XA 3SV4A 1T6CA 3R9PA 1NGAA 4KH5A 2DFEA 1GLAG 3QMLA 4DSKA 2P51A 3K5OA 1TGOA 1VSMA 3V9ZA 3V9SA 2D4WA 1JLEA 1RDCA 1NLVA 3EL2A 4FLYA 4YHHK 2E88A 1IKXA 5GADP 1Q7YO 4KTQA 3QNOA 2CGLA 4DR5K 3T1AA 3EZWA 1TK0A 5H1SQ 3CC7N 4C8MA 1NGHA 1Z25A 2VG5A 4NYFA 3WEEB 3CM5A 3F5TA 1ZBFA 4HHTA 3DWLA 4BC2A 5CZ2A 3WNGA 2A42A 3CCEN 3BDPA 3T69A 5AQTA 3ENOA 4NYNA 4WFAL 4OPKA 4E7LA 1YJWN 3FZKA 4LF8K 5GIPA 1LWCA 3E9PA 4JAXA 3LZJA 4OLAA 3MCAB 3AVIA 5HP1A 4FLTA 1NGIA 2HHSA 4PQUA 4IWVA 4O5BA 4YNQA 4X62K 2BANA 2Q1NA 3CM6A 1HJRA 4L3QA 4IBNA 4WE1A 3PIOL 1N34K 4F2SA 2YX6A 4BY9C 3IS9A 3TSQA 1E4FT 5HOOA 3QEVA 4FSVA 1NK5A 4BRDA 1N32K 3NGZA 4LSLA 3LM9A 3P4IA 4DUZK 4ZTFA 4DR4K 4DFKA 4CJUA 2QXFA 4WQ4C 3SMPA 3OYEA 5KI6A 5LY3A 3LWMA 3A0IX 4N5SA 4DQQA 2ZE2A 3CCLN 4DR3K 2PFUA 1WB9A 4FPBA 3ATUA 3LP2A 3MK6A 5EX5A 4GVMA 4ILGB 2GWJA 3VPZA 2OYQA 5E84A 4CJEA 4LF9K 4BWMA 3NHGA 3IFRA 2W40A 3WNEA 4K0KK 1T44A 2FF6A 4O0IA 1ZC6A 1RTJA 4B9QA 1S1VA 3V9UA 1VQ4N 3B6OA 3RR8A 4BRQA 3P38A 5GAGP 2W6LA 4DMNA 3N4QA 1YAGA 2P9SA 4DFPA 5J2QA 2WOMA 3VF6A 1A5WA 2XY5A 3KWGA 3GDQA 4YDUC 4BACA 2ITMA 1QHTA 1NK4A 2OANA 4J2DA 4JRQA 4CBUA 3A5LC 4BR7A 2YV0X 4FOIA 3PO5A 1HKCA 1KCFA 3EYZA 4CJKA 4J8FA 4ICLA 5DM6L 1OH8A 3DOKA 3VGMA 2O8EB 2XY8A 3K5LA 2ATQA 3SUPA 4ZHRA 5ADXA 3TU5A 3BZCA 1UOCA 2A1SA 4KI6A 4JEPA 4H0PA 1QHAA 3HPGA 2JLEA 3VEVA 4M3ZA 2Q3SA 4BRAA 3OYHA 1JKHA 4W5OA 3EKSA 2HHUA 3CMAN 4DKWA 4AHVA 3CPEA 1VSDA 2G8VA 2PBDA 3U3GA 5AQIA 1MU2A 4LSNA 3U4LA 4H5WA 4KHWA 4Y1DA 3T3FA 4B3MK 2XRIA 2NRXA 3AAPA 3DLBA 1GLDG 2FSKA 4CJ3A 1UWBA 2A40A 1WAJA 4FWMA 2VG7A 4ELVA 4KRFA 4Z4FA 1T6DA 4B3OA 1EQYA 3H45C 3P1GA 2HBLA 5HRPA 4JKDA 3O08A 1Q18A 3HRGA 2FXUA 1IG8A 1BWFO 3AY9A 1N36K 1IJJA 4CJSA 1P90A 4IFEA 5ELZA 4KHYA 2KW4A 4MQ3A 1YHQN 1TAQA 4FJMA 2P5OA 4JKEA 4WQ5A 4K43A 1O1WA 2P9KA 4OPAA 1D8YA 2UYTA 4PWDA 2OZSA 1QQOA 5CZ1A 2NRWA 2VYPA 2JWLA 3ITHA 3HM8A 3SQ1A 3K59A 3TAQA 3O3HA 2D5RA 2VGMA 3CCSN 3DXKB 4I2QA 4H5VA 1MWKA 4EIAA 2EX3A 2Q2RA 5J2MA 3G10A 2F7TA 3AO5A 4LFCK 4JYAK 4JHDA 4FWRA 3KKSA 4DQIA 2ZF5O 1N33K 3BUZB 4O4GA 4KHUA 3D45A 3TTDA 5FLXO 3DXMA 3H1QA 2A3ZA 4CFDA 4EHTA 1BCOA 1NKCA 4DSIA 4X64K 1BDGA 1IKVA 4DQPA 1L5UA 2Q0UA 3CXCM 2GV9A 4CJ4A 5C2FA 3UKRA 2YJFA 4CJLA 3HBTA 3P39A 5AQFA 4B3SK 4AHTA 4BDYA 1QVGM 4CBXA 1N8RO 4F8RA 3FFKB 5SWMA 2CGKA 4H4OA 4E19A 4N56A 4ID5A 3RSEA 3ZYYX 3PIPL 4YOVA 2BUPA 4CESA 1J5EK 3MCPA 1L3VA 4RCHA 2Z1IA 3ENHA 4N76A 4BRIA 1C0TA 1C0FA 4CBWA 4M3RA 4M3YA 4HUFA 4FWQA 1VSFA 2E2NA 4LH4A 4JS4A 3DXMB 3HZ6A 2BE2A 4H4MA 2HHHK 3G6EN 1ASWA 3RRGA 3LDLA 5B8HA 4K25A 3SPYA 4C8LA 3RWUA 2I7PA 1XMOK 3U3YA 2PY5A 3GL1A 3AO4A 4H5RA 2A1RA 4WYBA 5AJ3K 2B6AA 4IEEA 5AQLA 3BZKA 4C1NI 2NRRA 3CCVN 5KQ8A 4DTMA 1VQON 5GIOA 1XC3A 1NBWA 1BQMA 1B9DA 1ATNA 1VSLA 3NFAA 2W42A 1YJ9N 1KFDA 1I94K 1QSSA 2IVNA 1YITN 4Z94A 3THWA 3PO4A 1VSEA 3CHWA 4YY3K 4BREA 4E0DA 1REVA 3C94A 1J9AA 3ZSZA 4H5TA 3ZSYA 3C6HA 4B1YB 1SUQA 4Y1CA 1LWEA 4BGAA 3V81A 4CJ7A 3FE1A 4RW9A 4OGCA 4Z4EA 1K9MO 1GLJO 2CGJA 1ESVA 3VQPA 4DF8A 1N5YA 3KTQA 2E1YA 4A62A 3K9KA 4AHCA 3RTVA 1QS4A 1GLBG 3QIOA 2UUAK 4LC9B 3GBTA 2ZGZA 4I6MA 2V7YA 4B1UB 3UKUA 4M7YA 2O4GA 1IKYA 2G8UA 3HP6A 1NK7A 3LANA 3WQTA 1Q9YA 4BR9A 1YTAA 1LW2A 3AVBA 1WNSA 4H0TB 3WNFA 1VQPN 2CH6A 3SAGA 5AQHA 3PSIA 4DS4A 2P9UA 4JI8K 3RRHA 1WSHA 2F96A 1BCMA 1FXXA 4CJVA 2E1ZA 3LAMA 1OKJA 4JI3K 4XH1A 2E6LA 4V19S 3AA2A 3U9DA 3OYAA 4IOCL 3CERA 2QKBA 1T05A 3VQ7A 1GOCA 3OBYA 4HVJA 3L2QA 4CJTA 3DLRA 3OYKA 4CGDA 4CVNE 3NBPA 4CFCA 3VOVA 4CGFA 3CJCA 4FL9A 1P8ZA 5CR4A 1HUXA 4F2RA 2DFHA 4HTUA 4FLZA 3TAPA 1S72N 1NK8A 4AF1A 1L3TA 3VMFB 3L6QA 5FROA 1SV5A 1BIUA 3WT0A 1QZ6A 4AM6A 2P9PA 1GLEG 3E01A 1JLCA 2E6MA 1E4GT 4PL8A 3SUOA 1NK9A 4ISGA 2XHBA 4GV3A 1RT4A 5KRSA 4WF9L 3O9QA 1U45A 4DTJA 2IVPA 4CJPA 2VG6A 4KHPK 3MEEA 3AA3A 1BU6O 4FM2A 4FW2A 1BIZA 3IRXA 4KTZA 3QBXA 4CIGA 5I3UA 1M90O 3HPHA 3QBWA 3L3UA 3IAYA 5M1FA 4XIUA 1VAZA 1I39A 4DR2K 4GW6A 3K9JA 4BDZA 1U49A 5HRSA 2LSNA 3CJ7A 4TSXA 4J2EA 1OVQA 3BF1A 2OTLN 4R79A 3CCJN 4CE9A 1KC8O 1WSFA 2OPRA 3VEOA 3E9LA 4JD2A 1LAWA 2E20A 3CC2N 2P9PB 5KPZA 3M8SA 3C6AA 4F4KA 4EFHA 1KTQA 1TKTA 3F2KA 1BISA 1G99A 2E4LA 4N47A 3VQ8A 2IC3A 1RTDA 2X6SA 1MWMA 3G4SN 4OGEA 4DV5K 5EOYA 3ZCMA 3M3ZA 5JVHL 1CZAN 4OVLA 3QESA 3ZT3A 1Q8IA 5EVZA 1Q9XA 4AILC 2Z1GA 5F0XA 3HM9A 2FLOA 5FRNA 4BC4A 3OJSA 5CYQA 1WBDA 1C0GA 2YHYA 1NU0A 3DLHA 2P5GA 3LDOA 3H6EA 3HL8A 1JLBA 3DMJA 1IH7A 3KD1E 1KVCA 4JD2B 3CC4N 2WC9A 4CD1A 1S22A 5AQNA 4Z0UA 5BR9A 2QWOA 2E5LK 3J8AA 4FLXA 3K0SA 4M63C 3HVRA 3DLKA 5M1QA 2J4RA 4M7XA 1T7PA 4UY8O 5AZIA 3H08A 3TABA 2PZSA 4CHYA 1J53A 4BE1A 5GINA 5DMRA 4CJRA 4GKKK 1KAXA 3AVNA 3DRSA 4CGIA 4KO0A 1KLNA 1U2VA 3WNHA 1S5JA 4WQ4A 2V7ZA 4MDBA 3KVGA 3O4QA 3HI0A 3D2FA 5T7BA 3P5JA 1IKWA 1TYQA 4KH4A 1HJOA 3R1XA 3V1OA 3FZFA 4YOYA 5HL7L 2YHBA 2FBYA 3CG7A 1RDUA 4KHSA 2QWRA 3HOTA 4JKGA 1C0UA 4M3UA 1J54A 1B9FA 4LD0A 5EU7A 1NNEA 1UAXA 3RMAA 1NGBA 5AQYA 4RW7A 1XUPO 3V1RA 3NGYA 1KAYA 3O6WA 5AZIB 1SS6A 1VQ8N 3TAGA 2QM1A 1CXUA 1HLUA 2ZWHA 1TK8A 4NCAA 5I9EB 2HMIA 3CJ1A 4I7FA 1VQ5N 2ZM6K 1W7AA 4CEBA 2QTDA 1XC9A 1U2VB 2Z1HA 4JKCA 1HYVA 1X1PA 4JN4A 4RW4A 1NOZA 1VRTA 3D2FB 1TYQB 3O3FA 3NE6A 4BRGA 2F8SA 3F9MA 5HBMA 2YNFA 4XH5A 1OH7A 5AQVA 4JKGB 3I0SA 1GLFO 4CEOA 4FM1A 3TANA 3AVGA 4CZJA 1JCFA 4Q0BA 1S6QA 5LJWA 3CCRN 3SYZA 4KFBA 3NGIA 3DRPA 4W5NA 4K8XA 5C12A 2O8EA 1HYZA 3VGKA 3HVTA 3NF9A 5AQZA 3CI5A 5F1XA 4EP5A 3KK3A 3OYBA 1YIJN 4BROA 4KKOA 4ELUA 1ZBHA 3NH0A 2ASPA 5BN9A 4B9LA 1JL1A 5BPMA 4KI4A 3P83D 5AQGA 3O9TA 3VTHA 2D0CA 3QLHA 1FJGK 3NVMA 2YHAA 1NGDA 3ZLJA 3HSTB 4GY2B 1XHXA 4EAHD 1X3NA 2OPPA 1KD1O 3CYMA 3MN5A 4E1JA 4FLVA 5HLFA 2V52B 4AHSA 3PX6A 3KK7A 1BUPA 1RILA 3MWTA 1RT3A 5AR0A 5AFUH 5BREA 4OKJA 1W97L 3AARA 1QZ5A 3D0PA 2HHTA 3C65A 3S3MA 3AAQA 4QCLA 1SL0A 2GELA 3H1VX 2P9IA 1JJ2M 1VSHA 1HYSA 1R0AA 1YJNN 3QFPA 1SKWA 4CJFA 2NLXA 3IUCA 3HK2A 4H8KA 3SQ2A 4MLEA 1I3AA 2NRZA 2VWBA 5JVGL 4KHQA 3P31A 4M3XA 4JI2K 4OO1J 2ITGA 4PKGA 3AVLA 4DV2K 3AVMA 3EEQA 3MN7A 3O5BA 1QQCA 1V4SA 3S3OA 3CQ8A 4OKKA 3S9HA 1XMQK 1V4TA 4JI0K 1KQSM 2HOEA 2Y1IA 2DFFA 2UU9K 2UXDK 2QK9A 3LDNA 4PHTX 4IDKA 4YOXA 5E41A 3UB5A 1ILYA 2A6AA 4O8KA 4IG3A 1NM1A 1K8AO 3S41A 4B9VA 4DB3A 4JI6K 1GOAA 5AQRA 2FF3B 3DXKA 1VQ6N 2P9IB 4CIEA 1CXQA 4X65K 3G0ZA 3QNNA 4FJ7A 1ASVA 3TWHA 3T19A 1EETA 3CD6N 3AVHA 4KV8A 4O5FA 3CPWM 1VK0A 2X74A 4CGHA 2A41A 4E7HA 1X3MA 4FO0A 4PA1A 2GUPA 3NF6A 4ILJA 1IG9A 3T1YK 3O4NA 3THYA 4F3OA 1JXEA 3FZLA 3BY5A 4IFYA 4DU1A 2O8BB 4FM0A 5CE3A 3ENBA 4HTLA 1RT7A 4CJWA 3A8YA 4EZ6A 4LFAK 5K14A 3KLGA 5MLCQ 2OPSA 1D5AA 5D3GA 2PYJA 3SAHA 3L4IA 4JI7K 3I0RA 4KTWA 4CJ5A 2G8IA 1TUYA 4CI6A 4RW8A 2HHXA 3Q7BA 1JLQA 4DV6K 1X9MA 1XHZA 3L4QA 3V9WA 3SQ4A 1U47A 3THYB 4UQGA 4FLWA 4BC5A 4W5RA 3OYGA 3JS6A 4OX9K 4CEFA 1DGKN 2CH5A 4BRKA 2HHQA 2BDPA 3L3VA 4C8NA 4FK4A 1ITGA 2UUCK 1U4BA 4KHNA 4KREA 2YHWA 5IWAK 4E3SA 2YCHA 1W0HA 2QA4N 5AQMA 3LDQA 3KIOA 4OKEA 4AHUA 1O13A 4X66K 4YOWA 2DPNA 4NO7A 2YJEA 2ZQBA 5AQOA 4DV0K 3L0QA 2DTUA 1MA9B 4A59A 5KQDA 4B08A 4WQ5C 3OJUA 1NKBA 1X9JA 2FSJA 2OPQA 2ZD1A 4QOZB 1NK0A 2E8AA 3ZT0A 1RDWX 3SQ0A 4FZYA 2GEMA 1RDBA 1TVRA 1DEJA 4YFUA 3NVKA 2FBVA 4DSFA 3ULEA 3OW2M 3HPOA 3L2VA 5FPMA 5M1OA 3SPZA 3A5OC 3SLCA 4HCBA 4KB1A 2D1KA 3L2WA 5M1PA 1RNHA 4IJNA 4BQLA 4ILHA 3PX4A 1HNZK 2G8WA 2HW3A 1SKRA 3VEXA 2GTDA 5AQUA 4Z4HA 2O8FA 1DLOA 3AA4A 4ELTA 1RBRA 4FVMA 2Y1JA 3OVNA 5KPTA 2YKMA 3CQYA 3CMEN 2O8DA 5C2DA 5JLHA 3RR7A 1LW0A 3LPUA 4MDAA 3FZHA 2KZMA 3HOSA 1NKEA 4PUOA 3T7ZA 3SV3A 3TI0A 2RHKA 2DY4A 1QTMA 1ZYQA 3KHYA 3VF2A 3ZT2A 3VEWA 3MN6A 1HQEA 1YUWA 4BRLA 3J81O 3NF7A 4DQSA 3V4IA 4DFJA 3KZBA 3CIPA 3ULEB 2HVIA 3D2EA 3E1YA 2BTFA 5DM7L 1VSKA 4OLBA 1KAZA 3ZETA 4E7IA 5KGXA 3FZMA 5KTQA 3DM2A 3I56N 2Z1JA 3KKRA 4MO4A 4NXNK 5FPDA 3QB0A 5BPLA 1K8KB 4B3TK 3L2RA 2O8FB 4NCBA 4DV4K 1YVUA 1QQNA 3FLCO 3QFUA 3EN9A 3LALA 2YHXA 1EO1A 2RN2A 2KHOA 5JMVA 2FBTA 4CGGA 3VA3A 1BA0A 3ZX3A 1YI2N 4FWKA 4Q5VA 3SZ2A 1E3MA 2O8DB 3L8BA 3WXLA 3C7NA 3KLHA 2ZJPL 1RBTA 5C24A 3J80O 4IG0A 3O9SA 2O8CA 3M1FA 4CF9A 3QICA 4FYDA 4DTRA 5TKYA 4RWTA 1JCEA 5CHIA 2BH1A 3U6FA 3OS2A 1BG3A 4JI5K 3RMBA 3MXMA 3TTFA 4HUGA 3T1HK 1IV0A 4M3WA 2E2PA 3EO3A 1SL1A 3GE1A 4CHPA 2F4VK 2D0AA 4BRHA 3OTOK 3D2EB 1X9SA 2HSTA 3NF8A 3ZETB 4BVOA 3PY8A 3D6RA 4U7BA 4I9LA 3O9RA 2P9NA 4B9SA 4DTSA 4NCGA 2OZMA 4CZHA 4E7KA 4DR6K 3TR8A 1OH6A 1M1KO 3O1BA 4FJ9A 3VGLA 1IBLK 2QWNA 3NH1A 4QS8A 3WXMB 1HNVA 4B9TA 3O4WA 4YOTA 4PL7A 3EE8A 4DV1K 3AGKA 2Q97A 3C7NB 3HSCA 2IVOA 2F8TA 5E26A 2O8CB 2PYLA 1NJIO 2HNYA 4FJJA 4KB0A 2ASOA 1XWLA 4FJKA 3QERA 5J1EA 4KPYA 4C1NK 4CF2A 3C0BA 4MLHA 4K41A 3SNNA 4DSLA 1CLQA 1EP4A 2Q36A 2E2QA 5BRFA 1GLCG 4DFMA 4DCHA 1FW6A 4GKJK 4HUEA 3GG4A 4FJNA 2WTUA 2F9TA 3ZT4A 1VQ7N 3VQ5A 3IKMA 4JRPA 4A2AA 1NMDA 1NGJA 2P9NB 3ATVA 1T03A 3CFOA 1RBUA 3TPQA 5AQXA 1SAZA 4E89A 5BRHA 1ATRA 4DQ8A 3OYFA 1H1VA 2KKZA 3A5NC
chains in the Genus database with same CATH topology
1ZBLA 4Q0BA 2KW4A 2AJQA 1S6QA 4MQ3A 4M45A 1TAQA 4FJMA 3VQQA 2P5OA 4N41A 3QO9A 3SYZA 1XI1A 2YNIA 3LP0A 4KFBA 2IDOA 3MXIA 3NGIA 1O1WA 4K8ZA 3DRPA 4AHRA 1D8YA 1S1XA 4W5NA 4CHOA 4PWDA 3RMCA 2OZSA 4K8XA 1HYZA 3HVTA 3LP3A 3AVCA 3NF9A 3OS1A 3ZSWA 4EP5A 3KK3A 5CZ1A 4CERA 4DF4A 1HPZA 3OYBA 4KKOA 1C6VA 1WSEA 1S9EA 3ITHA 3C6UA 3SQ1A 5J2PA 3NH0A 4ELUA 1ZBHA 4FZZA 3K59A 3NAEA 2D0BA 3O3HA 3TAQA 1HMVA 2D5RA 3K58A 3LZIA 4B9LA 4FJ5A 1JL1A 4BDPA 3IG1A 4FXDA 1C1BA 4CK3A 3P83D 4J2AA 4KI4A 3HJFA 4I2QA 2D0CA 3QLHA 3VQ9A 4OPJA 1HNIA 2YHAA 4QAGA 2EX3A 1L3UA 4F3TA 5J2MA 4RG8A 3G10A 4FJHA 1SKSA 3AO5A 3ZSVA 3KLIA 5CY4A 5HRNA 3HSTB 1TL1A 4E1MA 1XHXA 3DLGA 1KVBA 3KKSA 4DQIA 4CHNA 4CCHA 3K2PA 1CZBA 1QE1A 2OPPA 3NCIA 1JLGA 3CYMA 4O4GA 4FLVA 5HLFA 2G8KA 4AHSA 5HROA 1WAFA 4KHUA 3D45A 1QSYA 3OYNA 1DTQA 1HQUA 3F73A 3PX6A 1S1WA 2R7YA 4CFDA 1NJWA 1BCOA 1NKCA 1RILA 4FJ8A 1RT3A 4DSIA 1IKVA 2FBXA 1U04A 4FCYA 3DOLA 3HXMA 1L5UA 4DQPA 4OKJA 2GUIA 4O0JA 3AVFA 4CGJA 3KLFA 1J5OA 2BGGA 3D0PA 2GV9A 4JS5A 4CJ4A 4B8AB 3ZSXA 3KK1A 4DLEA 2HHTA 3S3MA 3KJVA 2FC0A 3K5NA 4CJLA 5CYMA 5C25A 1VSJA 4QCLA 2KQ2A 1SL0A 1JXBA 3ASMA 1D9FA 4AHTA 1JLAA 4BDYA 4FJXA 1BI4A 1IO2A 4F8RA 1VSHA 1HYSA 1R0AA 1Z26A 1N6QA 4PY5A 1K6YA 4CFBA 5SWMA 3ZSOA 1WSIA 1RBSA 4H4OA 4E19A 4N56A 3KK2A 3AA5X 4CJFA 1SKWA 3LP1A 4ID5A 1BQNA 1NJZA 4H8KA 3HK2A 3SQ2A 4B8CA 1I3AA 3MAQA 3QETA 4CESA 1CZ9A 4KHQA 1B92A 2HNZA 2Z1IA 1L3VA 4N76A 4M3XA 2ITGA 3AVAA 3AVLA 4M42A 3AVMA 3VQCA 3HYFA 2VWJA 1QQCA 3K5MA 1NK6A 3SI6A 3S3OA 3CQ8A 1C0TA 4OKKA 3S9HA 3TARA 4DS5A 3PUFA 3VQAA 4IKFA 3TAFA 3OYDA 2Y1IA 4M3RA 4M3YA 2DFFA 4HUFA 1TAUA 3DI6A 4CFAA 1RCHA 1VSFA 2QK9A 3K57A 4IDKA 4LH4A 3DLEA 4JS4A 5E41A 2BE2A 4H4MA 4CK1A 1S1TA 1ASWA 3RRGA 1TK5A 4IG3A 3HO1A 2EHGA 4O44A 4B9NA 3SPYA 5JS1A 4C8LA 4DQRA 3B6PA 2NUBA 3RWUA 4B9VA 1GOAA 1C1AA 4ID1A 3U3YA 3ZT1A 2QKKA 4CEQA 2PY5A 1A5VA 4JLHA 4DU4A 4CIFA 3AO4A 1NJYA 1C0MA 4FJGA 5SZTA 4CIEA 1CXQA 1BI4B 3VN5A 3THVA 2A1RA 4DSJA 3OS0A 1NK8A 5I42A 2B6AA 2ETJA 3G0ZA 3QNNA 2WONA 4DTMA 4FJ7A 3HP9A 1ASVA 1BQMA 1RDAA 3VQEA 2O4IA 1VRUA 3TWHA 3AV9A 3T19A 1B9DA 1FKOA 4FJIA 1EETA 1VSLA 3NFAA 2W42A 1YTUA 3AVHA 4KV8A 1KFDA 2IGIA 2IOCA 1VK0A 2X74A 4CGHA 2X78A 2RPIA 1WN7A 2XY7A 4GMJB 1QSSA 4E7HA 4PA1A 1VSEA 3A2FA 3PO4A 3SUQA 3AO2A 1RTIA 3NF6A 4CHQA 4CF8A 4W5QA 1IG9A 4E0DA 3O4NA 1REVA 4F3OA 3OYCA 3C94A 1J9AA 1JXEA 2I5JA 2B4JA 3ZSZA 5JS2A 3ZSYA 1KFSA 2YNGA 4DU3A 1SUQA 4Y1CA 3LAKA 4J2BA 4FK0A 4DG1A 2VWKA 1LWEA 4IFYA 1S1UA 4DSEA 2G8FA 3V81A 4DU1A 4CEDA 4BWJA 4CJQA 4RW9A 4OGCA 1HRHA 1EX4A 4FM0A 4Z4EA 1A5XA 4HCCA 4BE2A 3V9XA 1KVAA 1RT6A 4FLUA 1RT1A 3VQPA 4FZXC 1FKPA 4DF8A 1N5YA 3KTQA 3L2UA 4DTXA 3MXJA 4C8OA 1RT7A 4AHCA 3DRRA 3RTVA 1QS4A 3ALYA 4AH9A 4CJWA 3CFPA 4EZ6A 3QIOA 5K14A 3KLGA 1G15A 3VQDA 2OPSA 1FK9A 3BGRA 3OYLA 4BE0A 1UA1A 2JGUA 1D5AA 5D3GA 3FFIA 2PYJA 5J2NA 1UA0A 1F21A 2O4GA 1Y97A 1IKYA 3I0RA 2G8UA 3HP6A 4KTWA 1NK7A 3VQBA 4CJ5A 3LANA 2G8IA 3AVJA 1Q9YA 3F9KA 1YTAA 1LW2A 3AVBA 1WNSA 4RW8A 4L8RB 2HHXA 3WNFA 1ASUA 1S9GA 1RTHA 3M8PA 5HRRA 3HT3A 1JLQA 3OYMA 1TV6A 1X9MA 3QEIA 1XHZA 4E1NA 2GBZA 1VSIA 4DTNA 3V9WA 4DS4A 3LWLA 3RRHA 1WSHA 3SQ4A 1U47A 2F96A 2X6NA 1BCMA 1FXXA 3AVKA 4CJVA 3SV4A 4UQGA 3LAMA 4FLWA 1RT2A 2E6LA 4LY7A 3DYAA 4W5RA 3OYGA 4C8KA 2DFEA 3AA2A 3OYAA 2QKBA 1T05A 3VQ7A 4CEFA 3PX0A 1GOCA 4HVJA 2IS3A 4DSKA 3L2QA 2P51A 4CJTA 3DLRA 3K5OA 3VA0A 1TGOA 1BHLA 3OYKA 4CK2A 4CGDA 1VSMA 3V9ZA 3V9SA 2HHQA 2BDPA 3NBPA 1RDDA 1JLEA 1RDCA 2KTQA 4G1QA 3L3VA 4C8NA 4CF1A 4FLYA 4FK4A 1ITGA 4CFCA 1U4BA 4KHNA 4KREA 4E3SA 4I2PA 4CGFA 1IKXA 4KTQA 1TKXA 1W0HA 3QNOA 4F2RA 2DFHA 3T1AA 3KIOA 4OKEA 3KLEA 4HTUA 4AHUA 5FDLA 4FLZA 3TAPA 4ZTJA 4CEZA 1TK0A 2HB5A 5FROA 1SV5A 1BIUA 1DTTA 1SL2A 4O55A 2ZQBA 3OYIA 3E01A 4C8MA 2DTUA 1JLCA 2E6MA 3OY9A 1Z25A 2VG5A 4NYFA 3QEPA 3SUOA 1NK9A 3CM5A 4B08A 2XHBA 1RT4A 3OJUA 5KRSA 1U45A 1NKBA 1ZBFA 2OPQA 4HHTA 4DTJA 2ZD1A 4CJPA 2VG6A 1LAVA 5CZ2A 3WNGA 1NK0A 3ZT0A 4QOZB 1C1CA 3MEEA 3AA3A 3BDPA 4E7LA 4NYNA 4FW2A 4OPKA 4FM2A 3SQ0A 4FZYA 1BIZA 3IRXA 1RDBA 4KTZA 1TVRA 4YFUA 4CIGA 5I3UA 1LWCA 3OYJA 2FBVA 3O3GA 4DSFA 3ULDA 3LZJA 1NOYA 3HPHA 4OLAA 3AVIA 3L3UA 4FK2A 3VQ4A 4XIUA 5HP1A 4FLTA 3AO1A 3IAYA 3MEDA 3HPOA 3L2VA 1I39A 3SPZA 3KD5E 4HCBA 2YNHA 4GW6A 4KB1A 2HHSA 3L2WA 4PQUA 2IAJA 3MEGA 4BDZA 1U49A 2KZZA 4O5BA 2LSNA 5HRSA 4YNQA 1RNHA 2BANA 4TSXA 3PX4A 2HW3A 3CM6A 4Z4CA 3V6DA 2G8WA 1SKRA 4J2EA 4DTPA 1HJRA 4IBNA 4Z4HA 4WE1A 4F2SA 3AA4A 1DLOA 1JLFA 4CE9A 4ELTA 4DTOA 3IS9A 1WSFA 1RBRA 1RBVA 2OPRA 4FVMA 4FW1A 1LAWA 1X9WA 3QEVA 3ISNC 2Y1JA 3NDKA 1NK5A 3OVNA 3NGZA 1TL3A 3M8SA 2YKMA 1WSGA 3C95A 4LSLA 2RKIA 3PV8A 4F4KA 4ZTFA 3RR7A 1KTQA 1LW0A 3SUNA 3LPUA 1L3TA 1TKTA 3C6TA 4DFKA 1BISA 4FJLA 4CJUA 2KZMA 3NH2A 2E4LA 2QXFA 4N47A 1NKEA 3VQ8A 4PUOA 3OYEA 1TKDA 2IC3A 5KI6A 1RTDA 1JL2A 4OJRA 3LWMA 4N5SA 4W5TA 3SV3A 4I9QA 2X6SA 4DQQA 3TI0A 2DY4A 4OGEA 2ZE2A 3EY1A 1QTMA 3VQ6A 1ZYQA 3ZT2A 1QSLA 3ZCMA 1HQEA 3LP2A 4GVMA 4OVLA 3MECA 3NF7A 4DQSA 3V4IA 4DFJA 3QESA 4IFVA 3ZT3A 2OYQA 2HVIA 4CJEA 1Q8IA 1Q9XA 4EZ9A 1VSKA 4BWMA 3NHGA 4OLBA 4E7IA 4AILC 4DWIA 2Z1GA 3HM9A 5FRNA 3WNEA 1S6PA 5KGXA 5KTQA 3DM2A 4O0IA 2Z1JA 3OJSA 3KKRA 3QEWA 5CYQA 1RTJA 4KAZA 5KRTA 1S1VA 3V9UA 1T8EA 3DLHA 2P5GA 3L2RA 2KFNA 1TKZA 1YT3A 3B6OA 1WLJA 1YVUA 4NCBA 3HL8A 3LALA 3RR8A 1JLBA 1BL3A 1IH7A 3DMJA 4LH5A 1KVCA 4DMNA 2RN2A 3KD1E 2FBTA 4CGGA 3VA3A 4Z0UA 4DFPA 5J2QA 4Q5VA 4FLXA 3SZ2A 2WOMA 1A5WA 3L8BA 3KLHA 3HVRA 2XY5A 3DLKA 3CFRA 1RBTA 5C24A 4IG0A 1T7PA 3TAEA 4R5PA 4CEAA 4CHZA 4CF9A 3QIPA 4BACA 4DTRA 3H08A 3TABA 1L3SA 1QHTA 4B9UA 4FYDA 2PZSA 4CHYA 1BGXT 3TAMA 1NK4A 1J53A 1GOBA 3OS2A 4BE1A 3U6FA 3RMBA 4JRQA 3MXMA 1LV5A 4J2DA 3V1QA 4HUGA 2OA8A 5DMRA 5DK5A 4CJRA 3UIQA 4M3WA 4MFBA 1SL1A 2YV0X 4CEEA 2XY6A 1KRPA 3PO5A 3AVNA 3DRSA 4CHPA 1NJXA 1KCFA 4CGIA 5C42A 2D0AA 4CJKA 3EYZA 4ICLA 4KO0A 1KLNA 3WNHA 3AO3A 3DOKA 1X9SA 2KFZA 1S5JA 3QEXA 3NF8A 2RF2A 3ZSRA 3I8DA 2G8HA 2XY8A 3K5LA 4CF0A 3PY8A 3O4QA 2HHWA 2ATQA 3SUPA 4ZHRA 2P1JA 4CECA 4I9LA 3QINA 5T7BA 3P5JA 1IKWA 1UOCA 3JSMA 4B9MA 4RW6A 4B9SA 4DTSA 4NCGA 2OZMA 4E7KA 2A1SA 3V1OA 4KI6A 3TR8A 2HVHA 1EXQA 4DLGA 2YHBA 4M3TA 2FBYA 3CG7A 4FJ9A 3HPGA 4KHSA 4E7JA 2JLEA 4Z4IA 3NH1A 5FRMA 1C0UA 4M3UA 4M3ZA 1HNVA 3LDSA 1J54A 4B9TA 2Q3SA 2B5JA 3OYHA 1JKHA 1B9FA 1WSJA 4LD0A 4W5OA 5EU7A 3M8QA 2HHUA 1UAXA 3RMAA 3S3NA 4RW7A 2F8TA 3V1RA 3NGYA 4AHVA 1RT5A 1VSDA 1KSPA 2G8VA 3U3GA 2PYLA 3TAGA 1CXUA 4Z4GA 2HNYA 1MU2A 1TK8A 4NCAA 4FJJA 4KB0A 2XO7A 4LSNA 1EKEA 1XWLA 4FJKA 4KHWA 3QERA 4Y1DA 4I7FA 5J1EA 3T3FA 2HMIA 4KPYA 4CF2A 4CEBA 2XRIA 3SNNA 4DSLA 1XC9A 3DLBA 5KGWA 1CLQA 4CJ3A 1EP4A 2Z1HA 1HYVA 1X1PA 1UWBA 4RW4A 1WAJA 3SCXA 4DFMA 1ZBIA 2HHVA 2VG7A 4ELVA 4HUEA 4KRFA 4Z4FA 4FJNA 1NOZA 1VRTA 4B3OA 1LWFA 3ZT4A 3ZSQA 3VQ5A 4JRPA 2HNDA 3O3FA 3NE6A 1W9HA 4EP4A 3LPTA 1T03A 3P1GA 3EZ5A 5HRPA 2F8SA 3SJJA 3JYTA 1ZBUA 3CFOA 4DTUA 5HBMA 1RBUA 2YNFA 4M41A 3I0SA 3M8RA 4CEOA 2YKNA 4FM1A 3RMDA 3TANA 4E89A 3AVGA 1D9DA 4CJSA 3OYFA 1KLMA 4KHYA 1U48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBL A;  4Q0B A;  2KW4 A;  2AJQ A;  1S6Q A;  4MQ3 A;  4M45 A;  1TAQ A;  4FJM A;  3VQQ A;  2P5O A;  4N41 A;  3QO9 A;  3SYZ A;  1XI1 A;  2YNI A;  3LP0 A;  4KFB A;  2IDO A;  3MXI A;  3NGI A;  1O1W A;  4K8Z A;  3DRP A;  4AHR A;  1D8Y A;  1S1X A;  4W5N A;  4CHO A;  4PWD A;  3RMC A;  2OZS A;  4K8X A;  1HYZ A;  3HVT A;  3LP3 A;  3AVC A;  3NF9 A;  3OS1 A;  3ZSW A;  4EP5 A;  3KK3 A;  5CZ1 A;  4CER A;  4DF4 A;  1HPZ A;  3OYB A;  4KKO A;  1C6V A;  1WSE A;  1S9E A;  3ITH A;  3C6U A;  3SQ1 A;  5J2P A;  3NH0 A;  4ELU A;  1ZBH A;  4FZZ A;  3K59 A;  3NAE A;  2D0B A;  3O3H A;  3TAQ A;  1HMV A;  2D5R A;  3K58 A;  3LZI A;  4B9L A;  4FJ5 A;  1JL1 A;  4BDP A;  3IG1 A;  4FXD A;  1C1B A;  4CK3 A;  3P83 D;  4J2A A;  4KI4 A;  3HJF A;  4I2Q A;  2D0C A;  3QLH A;  3VQ9 A;  4OPJ A;  1HNI A;  2YHA A;  4QAG A;  2EX3 A;  1L3U A;  4F3T A;  5J2M A;  4RG8 A;  3G10 A;  4FJH A;  1SKS A;  3AO5 A;  3ZSV A;  3KLI A;  5CY4 A;  5HRN A;  3HST B;  1TL1 A;  4E1M A;  1XHX A;  3DLG A;  1KVB A;  3KKS A;  4DQI A;  4CHN A;  4CCH A;  3K2P A;  1CZB A;  1QE1 A;  2OPP A;  3NCI A;  1JLG A;  3CYM A;  4O4G A;  4FLV A;  5HLF A;  2G8K A;  4AHS A;  5HRO A;  1WAF A;  4KHU A;  3D45 A;  1QSY A;  3OYN A;  1DTQ A;  1HQU A;  3F73 A;  3PX6 A;  1S1W A;  2R7Y A;  4CFD A;  1NJW A;  1BCO A;  1NKC A;  1RIL A;  4FJ8 A;  1RT3 A;  4DSI A;  1IKV A;  2FBX A;  1U04 A;  4FCY A;  3DOL A;  3HXM A;  1L5U A;  4DQP A;  4OKJ A;  2GUI A;  4O0J A;  3AVF A;  4CGJ A;  3KLF A;  1J5O A;  2BGG A;  3D0P A;  2GV9 A;  4JS5 A;  4CJ4 A;  4B8A B;  3ZSX A;  3KK1 A;  4DLE A;  2HHT A;  3S3M A;  3KJV A;  2FC0 A;  3K5N A;  4CJL A;  5CYM A;  5C25 A;  1VSJ A;  4QCL A;  2KQ2 A;  1SL0 A;  1JXB A;  3ASM A;  1D9F A;  4AHT A;  1JLA A;  4BDY A;  4FJX A;  1BI4 A;  1IO2 A;  4F8R A;  1VSH A;  1HYS A;  1R0A A;  1Z26 A;  1N6Q A;  4PY5 A;  1K6Y A;  4CFB A;  5SWM A;  3ZSO A;  1WSI A;  1RBS A;  4H4O A;  4E19 A;  4N56 A;  3KK2 A;  3AA5 X;  4CJF A;  1SKW A;  3LP1 A;  4ID5 A;  1BQN A;  1NJZ A;  4H8K A;  3HK2 A;  3SQ2 A;  4B8C A;  1I3A A;  3MAQ A;  3QET A;  4CES A;  1CZ9 A;  4KHQ A;  1B92 A;  2HNZ A;  2Z1I A;  1L3V A;  4N76 A;  4M3X A;  2ITG A;  3AVA A;  3AVL A;  4M42 A;  3AVM A;  3VQC A;  3HYF A;  2VWJ A;  1QQC A;  3K5M A;  1NK6 A;  3SI6 A;  3S3O A;  3CQ8 A;  1C0T A;  4OKK A;  3S9H A;  3TAR A;  4DS5 A;  3PUF A;  3VQA A;  4IKF A;  3TAF A;  3OYD A;  2Y1I A;  4M3R A;  4M3Y A;  2DFF A;  4HUF A;  1TAU A;  3DI6 A;  4CFA A;  1RCH A;  1VSF A;  2QK9 A;  3K57 A;  4IDK A;  4LH4 A;  3DLE A;  4JS4 A;  5E41 A;  2BE2 A;  4H4M A;  4CK1 A;  1S1T A;  1ASW A;  3RRG A;  1TK5 A;  4IG3 A;  3HO1 A;  2EHG A;  4O44 A;  4B9N A;  3SPY A;  5JS1 A;  4C8L A;  4DQR A;  3B6P A;  2NUB A;  3RWU A;  4B9V A;  1GOA A;  1C1A A;  4ID1 A;  3U3Y A;  3ZT1 A;  2QKK A;  4CEQ A;  2PY5 A;  1A5V A;  4JLH A;  4DU4 A;  4CIF A;  3AO4 A;  1NJY A;  1C0M A;  4FJG A;  5SZT A;  4CIE A;  1CXQ A;  1BI4 B;  3VN5 A;  3THV A;  2A1R A;  4DSJ A;  3OS0 A;  1NK8 A;  5I42 A;  2B6A A;  2ETJ A;  3G0Z A;  3QNN A;  2WON A;  4DTM A;  4FJ7 A;  3HP9 A;  1ASV A;  1BQM A;  1RDA A;  3VQE A;  2O4I A;  1VRU A;  3TWH A;  3AV9 A;  3T19 A;  1B9D A;  1FKO A;  4FJI A;  1EET A;  1VSL A;  3NFA A;  2W42 A;  1YTU A;  3AVH A;  4KV8 A;  1KFD A;  2IGI A;  2IOC A;  1VK0 A;  2X74 A;  4CGH A;  2X78 A;  2RPI A;  1WN7 A;  2XY7 A;  4GMJ B;  1QSS A;  4E7H A;  4PA1 A;  1VSE A;  3A2F A;  3PO4 A;  3SUQ A;  3AO2 A;  1RTI A;  3NF6 A;  4CHQ A;  4CF8 A;  4W5Q A;  1IG9 A;  4E0D A;  3O4N A;  1REV A;  4F3O A;  3OYC A;  3C94 A;  1J9A A;  1JXE A;  2I5J A;  2B4J A;  3ZSZ A;  5JS2 A;  3ZSY A;  1KFS A;  2YNG A;  4DU3 A;  1SUQ A;  4Y1C A;  3LAK A;  4J2B A;  4FK0 A;  4DG1 A;  2VWK A;  1LWE A;  4IFY A;  1S1U A;  4DSE A;  2G8F A;  3V81 A;  4DU1 A;  4CED A;  4BWJ A;  4CJQ A;  4RW9 A;  4OGC A;  1HRH A;  1EX4 A;  4FM0 A;  4Z4E A;  1A5X A;  4HCC A;  4BE2 A;  3V9X A;  1KVA A;  1RT6 A;  4FLU A;  1RT1 A;  3VQP A;  4FZX C;  1FKP A;  4DF8 A;  1N5Y A;  3KTQ A;  3L2U A;  4DTX A;  3MXJ A;  4C8O A;  1RT7 A;  4AHC A;  3DRR A;  3RTV A;  1QS4 A;  3ALY A;  4AH9 A;  4CJW A;  3CFP A;  4EZ6 A;  3QIO A;  5K14 A;  3KLG A;  1G15 A;  3VQD A;  2OPS A;  1FK9 A;  3BGR A;  3OYL A;  4BE0 A;  1UA1 A;  2JGU A;  1D5A A;  5D3G A;  3FFI A;  2PYJ A;  5J2N A;  1UA0 A;  1F21 A;  2O4G A;  1Y97 A;  1IKY A;  3I0R A;  2G8U A;  3HP6 A;  4KTW A;  1NK7 A;  3VQB A;  4CJ5 A;  3LAN A;  2G8I A;  3AVJ A;  1Q9Y A;  3F9K A;  1YTA A;  1LW2 A;  3AVB A;  1WNS A;  4RW8 A;  4L8R B;  2HHX A;  3WNF A;  1ASU A;  1S9G A;  1RTH A;  3M8P A;  5HRR A;  3HT3 A;  1JLQ A;  3OYM A;  1TV6 A;  1X9M A;  3QEI A;  1XHZ A;  4E1N A;  2GBZ A;  1VSI A;  4DTN A;  3V9W A;  4DS4 A;  3LWL A;  3RRH A;  1WSH A;  3SQ4 A;  1U47 A;  2F96 A;  2X6N A;  1BCM A;  1FXX A;  3AVK A;  4CJV A;  3SV4 A;  4UQG A;  3LAM A;  4FLW A;  1RT2 A;  2E6L A;  4LY7 A;  3DYA A;  4W5R A;  3OYG A;  4C8K A;  2DFE A;  3AA2 A;  3OYA A;  2QKB A;  1T05 A;  3VQ7 A;  4CEF A;  3PX0 A;  1GOC A;  4HVJ A;  2IS3 A;  4DSK A;  3L2Q A;  2P51 A;  4CJT A;  3DLR A;  3K5O A;  3VA0 A;  1TGO A;  1BHL A;  3OYK A;  4CK2 A;  4CGD A;  1VSM A;  3V9Z A;  3V9S A;  2HHQ A;  2BDP A;  3NBP A;  1RDD A;  1JLE A;  1RDC A;  2KTQ A;  4G1Q A;  3L3V A;  4C8N A;  4CF1 A;  4FLY A;  4FK4 A;  1ITG A;  4CFC A;  1U4B A;  4KHN A;  4KRE A;  4E3S A;  4I2P A;  4CGF A;  1IKX A;  4KTQ A;  1TKX A;  1W0H A;  3QNO A;  4F2R A;  2DFH A;  3T1A A;  3KIO A;  4OKE A;  3KLE A;  4HTU A;  4AHU A;  5FDL A;  4FLZ A;  3TAP A;  4ZTJ A;  4CEZ A;  1TK0 A;  2HB5 A;  5FRO A;  1SV5 A;  1BIU A;  1DTT A;  1SL2 A;  4O55 A;  2ZQB A;  3OYI A;  3E01 A;  4C8M A;  2DTU A;  1JLC A;  2E6M A;  3OY9 A;  1Z25 A;  2VG5 A;  4NYF A;  3QEP A;  3SUO A;  1NK9 A;  3CM5 A;  4B08 A;  2XHB A;  1RT4 A;  3OJU A;  5KRS A;  1U45 A;  1NKB A;  1ZBF A;  2OPQ A;  4HHT A;  4DTJ A;  2ZD1 A;  4CJP A;  2VG6 A;  1LAV A;  5CZ2 A;  3WNG A;  1NK0 A;  3ZT0 A;  4QOZ B;  1C1C A;  3MEE A;  3AA3 A;  3BDP A;  4E7L A;  4NYN A;  4FW2 A;  4OPK A;  4FM2 A;  3SQ0 A;  4FZY A;  1BIZ A;  3IRX A;  1RDB A;  4KTZ A;  1TVR A;  4YFU A;  4CIG A;  5I3U A;  1LWC A;  3OYJ A;  2FBV A;  3O3G A;  4DSF A;  3ULD A;  3LZJ A;  1NOY A;  3HPH A;  4OLA A;  3AVI A;  3L3U A;  4FK2 A;  3VQ4 A;  4XIU A;  5HP1 A;  4FLT A;  3AO1 A;  3IAY A;  3MED A;  3HPO A;  3L2V A;  1I39 A;  3SPZ A;  3KD5 E;  4HCB A;  2YNH A;  4GW6 A;  4KB1 A;  2HHS A;  3L2W A;  4PQU A;  2IAJ A;  3MEG A;  4BDZ A;  1U49 A;  2KZZ A;  4O5B A;  2LSN A;  5HRS A;  4YNQ A;  1RNH A;  2BAN A;  4TSX A;  3PX4 A;  2HW3 A;  3CM6 A;  4Z4C A;  3V6D A;  2G8W A;  1SKR A;  4J2E A;  4DTP A;  1HJR A;  4IBN A;  4Z4H A;  4WE1 A;  4F2S A;  3AA4 A;  1DLO A;  1JLF A;  4CE9 A;  4ELT A;  4DTO A;  3IS9 A;  1WSF A;  1RBR A;  1RBV A;  2OPR A;  4FVM A;  4FW1 A;  1LAW A;  1X9W A;  3QEV A;  3ISN C;  2Y1J A;  3NDK A;  1NK5 A;  3OVN A;  3NGZ A;  1TL3 A;  3M8S A;  2YKM A;  1WSG A;  3C95 A;  4LSL A;  2RKI A;  3PV8 A;  4F4K A;  4ZTF A;  3RR7 A;  1KTQ A;  1LW0 A;  3SUN A;  3LPU A;  1L3T A;  1TKT A;  3C6T A;  4DFK A;  1BIS A;  4FJL A;  4CJU A;  2KZM A;  3NH2 A;  2E4L A;  2QXF A;  4N47 A;  1NKE A;  3VQ8 A;  4PUO A;  3OYE A;  1TKD A;  2IC3 A;  5KI6 A;  1RTD A;  1JL2 A;  4OJR A;  3LWM A;  4N5S A;  4W5T A;  3SV3 A;  4I9Q A;  2X6S A;  4DQQ A;  3TI0 A;  2DY4 A;  4OGE A;  2ZE2 A;  3EY1 A;  1QTM A;  3VQ6 A;  1ZYQ A;  3ZT2 A;  1QSL A;  3ZCM A;  1HQE A;  3LP2 A;  4GVM A;  4OVL A;  3MEC A;  3NF7 A;  4DQS A;  3V4I A;  4DFJ A;  3QES A;  4IFV A;  3ZT3 A;  2OYQ A;  2HVI A;  4CJE A;  1Q8I A;  1Q9X A;  4EZ9 A;  1VSK A;  4BWM A;  3NHG A;  4OLB A;  4E7I A;  4AIL C;  4DWI A;  2Z1G A;  3HM9 A;  5FRN A;  3WNE A;  1S6P A;  5KGX A;  5KTQ A;  3DM2 A;  4O0I A;  2Z1J A;  3OJS A;  3KKR A;  3QEW A;  5CYQ A;  1RTJ A;  4KAZ A;  5KRT A;  1S1V A;  3V9U A;  1T8E A;  3DLH A;  2P5G A;  3L2R A;  2KFN A;  1TKZ A;  1YT3 A;  3B6O A;  1WLJ A;  1YVU A;  4NCB A;  3HL8 A;  3LAL A;  3RR8 A;  1JLB A;  1BL3 A;  1IH7 A;  3DMJ A;  4LH5 A;  1KVC A;  4DMN A;  2RN2 A;  3KD1 E;  2FBT A;  4CGG A;  3VA3 A;  4Z0U A;  4DFP A;  5J2Q A;  4Q5V A;  4FLX A;  3SZ2 A;  2WOM A;  1A5W A;  3L8B A;  3KLH A;  3HVR A;  2XY5 A;  3DLK A;  3CFR A;  1RBT A;  5C24 A;  4IG0 A;  1T7P A;  3TAE A;  4R5P A;  4CEA A;  4CHZ A;  4CF9 A;  3QIP A;  4BAC A;  4DTR A;  3H08 A;  3TAB A;  1L3S A;  1QHT A;  4B9U A;  4FYD A;  2PZS A;  4CHY A;  1BGX T;  3TAM A;  1NK4 A;  1J53 A;  1GOB A;  3OS2 A;  4BE1 A;  3U6F A;  3RMB A;  4JRQ A;  3MXM A;  1LV5 A;  4J2D A;  3V1Q A;  4HUG A;  2OA8 A;  5DMR A;  5DK5 A;  4CJR A;  3UIQ A;  4M3W A;  4MFB A;  1SL1 A;  2YV0 X;  4CEE A;  2XY6 A;  1KRP A;  3PO5 A;  3AVN A;  3DRS A;  4CHP A;  1NJX A;  1KCF A;  4CGI A;  5C42 A;  2D0A A;  4CJK A;  3EYZ A;  4ICL A;  4KO0 A;  1KLN A;  3WNH A;  3AO3 A;  3DOK A;  1X9S A;  2KFZ A;  1S5J A;  3QEX A;  3NF8 A;  2RF2 A;  3ZSR A;  3I8D A;  2G8H A;  2XY8 A;  3K5L A;  4CF0 A;  3PY8 A;  3O4Q A;  2HHW A;  2ATQ A;  3SUP A;  4ZHR A;  2P1J A;  4CEC A;  4I9L A;  3QIN A;  5T7B A;  3P5J A;  1IKW A;  1UOC A;  3JSM A;  4B9M A;  4RW6 A;  4B9S A;  4DTS A;  4NCG A;  2OZM A;  4E7K A;  2A1S A;  3V1O A;  4KI6 A;  3TR8 A;  2HVH A;  1EXQ A;  4DLG A;  2YHB A;  4M3T A;  2FBY A;  3CG7 A;  4FJ9 A;  3HPG A;  4KHS A;  4E7J A;  2JLE A;  4Z4I A;  3NH1 A;  5FRM A;  1C0U A;  4M3U A;  4M3Z A;  1HNV A;  3LDS A;  1J54 A;  4B9T A;  2Q3S A;  2B5J A;  3OYH A;  1JKH A;  1B9F A;  1WSJ A;  4LD0 A;  4W5O A;  5EU7 A;  3M8Q A;  2HHU A;  1UAX A;  3RMA A;  3S3N A;  4RW7 A;  2F8T A;  3V1R A;  3NGY A;  4AHV A;  1RT5 A;  1VSD A;  1KSP A;  2G8V A;  3U3G A;  2PYL A;  3TAG A;  1CXU A;  4Z4G A;  2HNY A;  1MU2 A;  1TK8 A;  4NCA A;  4FJJ A;  4KB0 A;  2XO7 A;  4LSN A;  1EKE A;  1XWL A;  4FJK A;  4KHW A;  3QER A;  4Y1D A;  4I7F A;  5J1E A;  3T3F A;  2HMI A;  4KPY A;  4CF2 A;  4CEB A;  2XRI A;  3SNN A;  4DSL A;  1XC9 A;  3DLB A;  5KGW A;  1CLQ A;  4CJ3 A;  1EP4 A;  2Z1H A;  1HYV A;  1X1P A;  1UWB A;  4RW4 A;  1WAJ A;  3SCX A;  4DFM A;  1ZBI A;  2HHV A;  2VG7 A;  4ELV A;  4HUE A;  4KRF A;  4Z4F A;  4FJN A;  1NOZ A;  1VRT A;  4B3O A;  1LWF A;  3ZT4 A;  3ZSQ A;  3VQ5 A;  4JRP A;  2HND A;  3O3F A;  3NE6 A;  1W9H A;  4EP4 A;  3LPT A;  1T03 A;  3P1G A;  3EZ5 A;  5HRP A;  2F8S A;  3SJJ A;  3JYT A;  1ZBU A;  3CFO A;  4DTU A;  5HBM A;  1RBU A;  2YNF A;  4M41 A;  3I0S A;  3M8R A;  4CEO A;  2YKN A;  4FM1 A;  3RMD A;  3TAN A;  4E89 A;  3AVG A;  1D9D A;  4CJS A;  3OYF A;  1KLM A;  4KHY A;  1U48 A; 
#chains in the Genus database with same CATH topology
 3JXU A;  1ZBL A;  4M45 A;  1NMN A;  1Z05 A;  3LDP A;  1XI1 A;  5AFU A;  3LP0 A;  4B1X B;  3U9Z A;  4K8Z A;  4AHR A;  4CHO A;  2KLA A;  2VGN A;  2NRH A;  3ZSW A;  4DF4 A;  3LM2 A;  1HPZ A;  1C6V A;  1WSE A;  1S9E A;  2NNW A;  3C6U A;  3OBW A;  5J2P A;  4FJ5 A;  1HMV A;  1S3X A;  4FVU A;  4BDP A;  2EWS A;  3IG1 A;  4FXD A;  4CK3 A;  4J2A A;  3HJF A;  4JI1 K;  4OPJ A;  5JIC A;  4QAG A;  2UUB K;  4DR7 K;  4F3T A;  1DT9 A;  3WXI A;  3ZSV A;  4CZF A;  4H0V B;  4A57 A;  4E1M A;  3DLG A;  2HF4 A;  3SK3 A;  4CHN A;  3ID6 A;  1CZB A;  1XQS C;  4JKF A;  1JLG A;  3W0L A;  4BGB A;  2G8K A;  1XNQ K;  1WAF A;  3H46 O;  3OYN A;  1DTQ A;  1HQU A;  1S1W A;  2R7Y A;  3OA9 A;  2GWK A;  3W3D A;  5AQK A;  4FJ8 A;  2FBX A;  4FCY A;  4BR2 A;  1NGG A;  3HXM A;  2GUI A;  3E66 A;  4O0J A;  3AVF A;  4CGJ A;  3KLF A;  1J5O A;  2BGG A;  1QQM A;  4B8A B;  3KK1 A;  5AQS A;  4NLB A;  4DLE A;  3KJV A;  1NGE A;  4BRF A;  3K5N A;  5C25 A;  2KQ2 A;  1D9F A;  1JLA A;  4FJX A;  4LFB K;  1VQK N;  4OPH A;  1SZ2 A;  2I7N A;  1Z26 A;  5F2R A;  2QXL A;  1RBS A;  3KK2 A;  3LP1 A;  5BN8 A;  1BQN A;  3VES A;  3FR0 A;  5C0Y A;  2JWK A;  3MAQ A;  1B92 A;  3DLL L;  4M42 A;  1OH5 A;  2VWJ A;  3CJ9 A;  2VQE K;  3SI6 A;  3CET A;  3TAR A;  3PUF A;  3VQA A;  4IKF A;  3TAF A;  4BRN A;  3OYD A;  4A61 A;  4CFA A;  4DUY K;  3K57 A;  2IIR A;  4DV7 K;  2WBN A;  4CK1 A;  1S1T A;  1TK5 A;  4BVP A;  3HO1 A;  4YDU A;  2EHG A;  4O44 A;  4B9N A;  4DQR A;  3B6P A;  1VHX A;  2A5X A;  4CD3 A;  2QI2 A;  4ID1 A;  1VQ9 N;  2QKK A;  3M5R A;  4AM7 A;  4BRP A;  1R59 O;  4BG8 A;  4A5A A;  3I55 N;  1NJY A;  2NRV A;  4BR5 A;  1K73 O;  4FJG A;  3VN5 A;  2HBM A;  2E2O A;  3HP9 A;  5LMN K;  3O80 A;  2O4I A;  1VRU A;  3M6G A;  3AV9 A;  1FKO A;  4FJI A;  1YTU A;  4B1Z A;  2OCE A;  2NRT A;  2IOC A;  3VET A;  2XY7 A;  1WN7 A;  4GMJ B;  3A2F A;  3R3L A;  4IOA L;  5JS2 A;  1KFS A;  2YNG A;  3WUH A;  4BR0 A;  4DU3 A;  4J2B A;  2VWK A;  3G71 N;  1NGC A;  4XH4 A;  4BWJ A;  1EX4 A;  3J7A P;  1A5X A;  4HCC A;  1RT6 A;  4FLU A;  1RT1 A;  1FKP A;  3L2U A;  4DTX A;  3MXJ A;  4C8O A;  4H0X B;  3DRR A;  3ALY A;  1HKG A;  1G15 A;  3VQD A;  1NG9 A;  1FK9 A;  4BE0 A;  3OYL A;  1BO5 O;  4LF6 K;  4CZE A;  2JGU A;  3THX A;  1LOT B;  1YF5 L;  1HPM A;  4IO9 L;  5J2N A;  1F21 A;  1DKG D;  1UA0 A;  1Y97 A;  4GV9 A;  3VQB A;  3AVJ A;  4ISE A;  4L8R B;  4XEI A;  1ASU A;  1Q81 O;  1RTH A;  3M8P A;  5AQQ A;  3QDK A;  3O1W A;  4QS9 A;  3QEI A;  4E1N A;  2GBZ A;  1VSI A;  3BEX A;  2X6N A;  3AVK A;  1RT2 A;  4JK9 A;  3DYA A;  4LY7 A;  4C8K A;  3VEZ A;  2VCP A;  3PX0 A;  2IS3 A;  3VA0 A;  3CCU N;  1BHL A;  2RE2 A;  4CK2 A;  1RDD A;  2KTQ A;  5M1K A;  3MX2 A;  4G1Q A;  3WQU A;  4CF1 A;  5GAE P;  4I2P A;  1TKX A;  3THX B;  5C10 A;  4KAZ A;  3KLE A;  4PKI A;  4ZTJ A;  5FDL A;  2GX9 A;  4CEZ A;  2HB5 A;  1VQN N;  3VTI A;  1DTT A;  1WUA A;  1SL2 A;  4O55 A;  5TKW A;  3OYI A;  1IBK K;  3OY9 A;  4GVE A;  3QEP A;  4KBO A;  2UXC K;  2QWM A;  4U67 L;  2O8B A;  1LAV A;  2P9S B;  4WFB L;  4JKA A;  1C1C A;  3N4P A;  3NMU A;  5EXW A;  4CZI A;  3OYJ A;  3O3G A;  3EE9 A;  4CZG A;  4H0Y B;  3ULD A;  1NOY A;  4FK2 A;  3VQ4 A;  3AO1 A;  3MED A;  3PLA A;  3CQX A;  3TSP A;  3KD5 E;  2YNH A;  4GV6 A;  2IAJ A;  3MEG A;  3R8E A;  2KZZ A;  4JNE A;  3MX5 A;  4Z4C A;  3V6D A;  3J7Y P;  4DTP A;  2QEX N;  4K42 A;  3MN9 A;  1KXP A;  1JLF A;  4B1V A;  2ZJQ L;  4DTO A;  3TTC A;  1RBV A;  4FW1 A;  3ISN C;  3NDK A;  1TL3 A;  3C95 A;  1WSG A;  2RKI A;  3PV8 A;  3TSU A;  3SUN A;  3C6T A;  4FJL A;  3NH2 A;  1TKD A;  1JL2 A;  4OJR A;  4I9Q A;  4W5T A;  4H03 B;  3EY1 A;  3VQ6 A;  3VF4 A;  4YOU A;  1IBM K;  1QSL A;  3MEC A;  4IFV A;  1HKB A;  3ZX2 A;  1W2B M;  4EZ9 A;  5AZJ A;  2OTJ N;  4DWI A;  3VEY A;  4YOR A;  1S6P A;  5IT9 O;  3QEW A;  2FSN A;  5KRT A;  1T8E A;  5KPR A;  1RFQ A;  2KFN A;  1TKZ A;  1YT3 A;  1WLJ A;  2QWL A;  2ZGY A;  1BL3 A;  4NXM K;  4LH5 A;  2Q31 A;  2Q0R A;  4FWO A;  1JCG A;  3CFR A;  2UXB K;  3TAE A;  4R5P A;  2ZJR L;  4CEA A;  4CHZ A;  1L3S A;  3QIP A;  5FPE A;  1HR0 K;  2WFB A;  4FPA A;  4B9U A;  1BGX T;  3TAM A;  1GOB A;  1LV5 A;  2AP1 A;  3V1Q A;  2OA8 A;  4IEI A;  5DK5 A;  3UIQ A;  1T3V A;  3MMV A;  4MFB A;  1MDU B;  4JKB A;  4CEE A;  2XY6 A;  1KRP A;  2D0P A;  1NJX A;  5C42 A;  2WUS A;  3AO3 A;  2KFZ A;  2P9K B;  5AZJ B;  3QEX A;  3R6M A;  2RF2 A;  3ZSR A;  3I8D A;  2G8H A;  2HHW A;  4CF0 A;  5M1N A;  1ATS A;  1LCU A;  3SBG A;  2HMP A;  5JLF A;  2P1J A;  4CEC A;  3QIN A;  3CCQ N;  3GOI A;  3JSM A;  4B9M A;  4RW6 A;  1SQK A;  2V51 B;  2HVH A;  4BRC A;  1EXQ A;  4DLG A;  2ASM A;  4M3T A;  5LMU K;  4E7J A;  3CF5 L;  4Z4I A;  4PKH A;  2QWP A;  4HWI A;  5FRM A;  1Z6R A;  3LDS A;  2B5J A;  1NWK A;  1WSJ A;  4JI4 K;  2H3G X;  3Q7C A;  3M8Q A;  1D4X A;  5A2Q O;  3S3N A;  1ZBS A;  4JHD B;  1RT5 A;  3VER A;  1KSP A;  3FGU A;  3G25 A;  4Z4G A;  2NZT A;  2XO7 A;  1EKE A;  4GNI A;  4Y0W A;  3WXK A;  5KGW A;  1K8K A;  4A5B A;  1ZBI A;  1RGI A;  3SCX A;  2HHV A;  3UKR B;  4A2B A;  5ADX H;  1LWF A;  4IXC A;  3ZSQ A;  2HND A;  1W9H A;  4EP4 A;  3LPT A;  3EZ5 A;  3ID8 A;  5EY4 A;  3SJJ A;  3JYT A;  1ZBU A;  4DTU A;  4ISF A;  2HBJ A;  2HF3 A;  1XNR K;  4M41 A;  1HNW K;  2PAV A;  3RSE B;  4WFN L;  3M8R A;  2D0O A;  2YKN A;  3RVC A;  3RMD A;  1D9D A;  2W6K A;  4JK7 A;  1KLM A;  1X9W A;  3D7E O;  3JAM O;  1U48 A;  2AJQ A;  4CZK A;  3VQQ A;  4NB4 A;  4N41 A;  3QO9 A;  4O8U A;  4JK8 A;  2YNI A;  2IDO A;  3MXI A;  1S1X A;  5BRD A;  3RMC A;  4BQZ A;  5BR8 K;  3LP3 A;  3OS1 A;  3AVC A;  4DR1 K;  4CER A;  4JV5 K;  4FWS A;  1QVF M;  3BP8 A;  5LJV A;  4FZZ A;  4CW7 B;  2D0B A;  3NAE A;  3K58 A;  3LZI A;  1U6Z A;  4QS7 A;  1VQM N;  5GAH P;  2F9W A;  3MDQ A;  1C1B A;  4B3R K;  3VQ9 A;  4IOX A;  1HNI A;  1L3U A;  5AQW A;  4RG8 A;  4FJH A;  1SKS A;  4BR4 A;  3EKU A;  3KLI A;  5CY4 A;  1WOQ A;  5HRN A;  1TL1 A;  1KVB A;  4CCH A;  3I8B A;  3K2P A;  5LL6 Z;  3NCI A;  1QE1 A;  2AA4 A;  3H3O B;  1ZXO A;  4IZ9 A;  1HX1 A;  5HRO A;  1QSY A;  4FWP A;  3WXJ A;  3F73 A;  3A5M C;  1NJW A;  3IDH A;  3THW B;  1U04 A;  3DOL A;  4WCE L;  2HBK A;  3E9O A;  4EHU A;  4JS5 A;  4JKH A;  3ZSX A;  2P9L A;  2FC0 A;  5CYM A;  1VSJ A;  1JXB A;  1EWQ A;  4IDH A;  3ASM A;  4KH6 A;  5FPN A;  1GLL O;  2QW9 A;  1BI4 A;  1IO2 A;  3OHR A;  3ZEU A;  4BRM A;  3ZX0 A;  1YVN A;  4FWN A;  1N6Q A;  1EWR A;  4PY5 A;  1K6Y A;  3CJB A;  3CJA A;  3ZSO A;  4CFB A;  3O8M A;  1WSI A;  3AA5 X;  4LF4 K;  1NJZ A;  3DAW A;  4B8C A;  3QET A;  1CZ9 A;  3HTV A;  2HNZ A;  4I6M B;  3AVA A;  4CZL A;  4LF5 K;  3VQC A;  3HYF A;  3UKU B;  1NK6 A;  3K5M A;  5AQP A;  4DS5 A;  3DJC A;  1TAU A;  3UE5 A;  3DI6 A;  1RCH A;  1BA1 A;  3DLE A;  4H0O A;  3O9U A;  4BC3 A;  4LF7 K;  2P9U B;  4MO5 A;  5JS1 A;  2NUB A;  4DHY A;  4FWL A;  4RTF D;  2P9L B;  1C1A A;  3KWI A;  4AQY K;  3VEN A;  3B8A X;  3ZT1 A;  4CEQ A;  1A5V A;  4JLH A;  1Q86 O;  4DU4 A;  1OVY A;  4CIF A;  4BG9 A;  1C0M A;  1Q82 O;  3J7Z O;  5SZT A;  1BI4 B;  4DSJ A;  3THV A;  3ZEU B;  3OS0 A;  1BOT O;  5I42 A;  2ETJ A;  2WON A;  3SMS A;  4FOE A;  4H5N A;  4IJA A;  3LL3 A;  3SBT A;  4C23 A;  3IMX A;  3BF3 A;  1RDA A;  3VQE A;  4F9O A;  2YI1 A;  3H3N O;  2IGI A;  2X78 A;  2RPI A;  3SJH A;  3CCM N;  3SUQ A;  3AO2 A;  4NLC A;  1RTI A;  4CHQ A;  4W5Q A;  4CF8 A;  3OYC A;  1Y64 A;  2I5J A;  2B4J A;  5AQJ A;  3LAK A;  4FK0 A;  4DG1 A;  3SAF A;  1S1U A;  4DSE A;  2G8F A;  3MWP A;  4CED A;  4CJQ A;  2W41 A;  1HRH A;  3I33 A;  1TUU A;  2VQF K;  4BE2 A;  3V9X A;  1KVA A;  4FZX C;  1YXQ A;  3CFP A;  4AH9 A;  4B1W B;  1VQL N;  3BGR A;  3PSF A;  4CZM A;  1UA1 A;  3FFI A;  3AGR A;  4DV3 K;  1WBB A;  5C15 A;  1J6Z A;  3F9K A;  1S9G A;  2QWQ A;  5HRR A;  3HT3 A;  3OYM A;  1TV6 A;  3WEE A;  4IO8 A;  4DTN A;  5BPN A;  1HNX K;  3LWL A;  1NGF A;  4G9Z A;  3U8X A;  3SV4 A;  1T6C A;  3R9P A;  1NGA A;  4KH5 A;  2DFE A;  1GLA G;  3QML A;  4DSK A;  2P51 A;  3K5O A;  1TGO A;  1VSM A;  3V9Z A;  3V9S A;  2D4W A;  1JLE A;  1RDC A;  1NLV A;  3EL2 A;  4FLY A;  4YHH K;  2E88 A;  1IKX A;  5GAD P;  1Q7Y O;  4KTQ A;  3QNO A;  2CGL A;  4DR5 K;  3T1A A;  3EZW A;  1TK0 A;  5H1S Q;  3CC7 N;  4C8M A;  1NGH A;  1Z25 A;  2VG5 A;  4NYF A;  3WEE B;  3CM5 A;  3F5T A;  1ZBF A;  4HHT A;  3DWL A;  4BC2 A;  5CZ2 A;  3WNG A;  2A42 A;  3CCE N;  3BDP A;  3T69 A;  5AQT A;  3ENO A;  4NYN A;  4WFA L;  4OPK A;  4E7L A;  1YJW N;  3FZK A;  4LF8 K;  5GIP A;  1LWC A;  3E9P A;  4JAX A;  3LZJ A;  4OLA A;  3MCA B;  3AVI A;  5HP1 A;  4FLT A;  1NGI A;  2HHS A;  4PQU A;  4IWV A;  4O5B A;  4YNQ A;  4X62 K;  2BAN A;  2Q1N A;  3CM6 A;  1HJR A;  4L3Q A;  4IBN A;  4WE1 A;  3PIO L;  1N34 K;  4F2S A;  2YX6 A;  4BY9 C;  3IS9 A;  3TSQ A;  1E4F T;  5HOO A;  3QEV A;  4FSV A;  1NK5 A;  4BRD A;  1N32 K;  3NGZ A;  4LSL A;  3LM9 A;  3P4I A;  4DUZ K;  4ZTF A;  4DR4 K;  4DFK A;  4CJU A;  2QXF A;  4WQ4 C;  3SMP A;  3OYE A;  5KI6 A;  5LY3 A;  3LWM A;  3A0I X;  4N5S A;  4DQQ A;  2ZE2 A;  3CCL N;  4DR3 K;  2PFU A;  1WB9 A;  4FPB A;  3ATU A;  3LP2 A;  3MK6 A;  5EX5 A;  4GVM A;  4ILG B;  2GWJ A;  3VPZ A;  2OYQ A;  5E84 A;  4CJE A;  4LF9 K;  4BWM A;  3NHG A;  3IFR A;  2W40 A;  3WNE A;  4K0K K;  1T44 A;  2FF6 A;  4O0I A;  1ZC6 A;  1RTJ A;  4B9Q A;  1S1V A;  3V9U A;  1VQ4 N;  3B6O A;  3RR8 A;  4BRQ A;  3P38 A;  5GAG P;  2W6L A;  4DMN A;  3N4Q A;  1YAG A;  2P9S A;  4DFP A;  5J2Q A;  2WOM A;  3VF6 A;  1A5W A;  2XY5 A;  3KWG A;  3GDQ A;  4YDU C;  4BAC A;  2ITM A;  1QHT A;  1NK4 A;  2OAN A;  4J2D A;  4JRQ A;  4CBU A;  3A5L C;  4BR7 A;  2YV0 X;  4FOI A;  3PO5 A;  1HKC A;  1KCF A;  3EYZ A;  4CJK A;  4J8F A;  4ICL A;  5DM6 L;  1OH8 A;  3DOK A;  3VGM A;  2O8E B;  2XY8 A;  3K5L A;  2ATQ A;  3SUP A;  4ZHR A;  5ADX A;  3TU5 A;  3BZC A;  1UOC A;  2A1S A;  4KI6 A;  4JEP A;  4H0P A;  1QHA A;  3HPG A;  2JLE A;  3VEV A;  4M3Z A;  2Q3S A;  4BRA A;  3OYH A;  1JKH A;  4W5O A;  3EKS A;  2HHU A;  3CMA N;  4DKW A;  4AHV A;  3CPE A;  1VSD A;  2G8V A;  2PBD A;  3U3G A;  5AQI A;  1MU2 A;  4LSN A;  3U4L A;  4H5W A;  4KHW A;  4Y1D A;  3T3F A;  4B3M K;  2XRI A;  2NRX A;  3AAP A;  3DLB A;  1GLD G;  2FSK A;  4CJ3 A;  1UWB A;  2A40 A;  1WAJ A;  4FWM A;  2VG7 A;  4ELV A;  4KRF A;  4Z4F A;  1T6D A;  4B3O A;  1EQY A;  3H45 C;  3P1G A;  2HBL A;  5HRP A;  4JKD A;  3O08 A;  1Q18 A;  3HRG A;  2FXU A;  1IG8 A;  1BWF O;  3AY9 A;  1N36 K;  1IJJ A;  4CJS A;  1P90 A;  4IFE A;  5ELZ A;  4KHY A;  2KW4 A;  4MQ3 A;  1YHQ N;  1TAQ A;  4FJM A;  2P5O A;  4JKE A;  4WQ5 A;  4K43 A;  1O1W A;  2P9K A;  4OPA A;  1D8Y A;  2UYT A;  4PWD A;  2OZS A;  1QQO A;  5CZ1 A;  2NRW A;  2VYP A;  2JWL A;  3ITH A;  3HM8 A;  3SQ1 A;  3K59 A;  3TAQ A;  3O3H A;  2D5R A;  2VGM A;  3CCS N;  3DXK B;  4I2Q A;  4H5V A;  1MWK A;  4EIA A;  2EX3 A;  2Q2R A;  5J2M A;  3G10 A;  2F7T A;  3AO5 A;  4LFC K;  4JYA K;  4JHD A;  4FWR A;  3KKS A;  4DQI A;  2ZF5 O;  1N33 K;  3BUZ B;  4O4G A;  4KHU A;  3D45 A;  3TTD A;  5FLX O;  3DXM A;  3H1Q A;  2A3Z A;  4CFD A;  4EHT A;  1BCO A;  1NKC A;  4DSI A;  4X64 K;  1BDG A;  1IKV A;  4DQP A;  1L5U A;  2Q0U A;  3CXC M;  2GV9 A;  4CJ4 A;  5C2F A;  3UKR A;  2YJF A;  4CJL A;  3HBT A;  3P39 A;  5AQF A;  4B3S K;  4AHT A;  4BDY A;  1QVG M;  4CBX A;  1N8R O;  4F8R A;  3FFK B;  5SWM A;  2CGK A;  4H4O A;  4E19 A;  4N56 A;  4ID5 A;  3RSE A;  3ZYY X;  3PIP L;  4YOV A;  2BUP A;  4CES A;  1J5E K;  3MCP A;  1L3V A;  4RCH A;  2Z1I A;  3ENH A;  4N76 A;  4BRI A;  1C0T A;  1C0F A;  4CBW A;  4M3R A;  4M3Y A;  4HUF A;  4FWQ A;  1VSF A;  2E2N A;  4LH4 A;  4JS4 A;  3DXM B;  3HZ6 A;  2BE2 A;  4H4M A;  2HHH K;  3G6E N;  1ASW A;  3RRG A;  3LDL A;  5B8H A;  4K25 A;  3SPY A;  4C8L A;  3RWU A;  2I7P A;  1XMO K;  3U3Y A;  2PY5 A;  3GL1 A;  3AO4 A;  4H5R A;  2A1R A;  4WYB A;  5AJ3 K;  2B6A A;  4IEE A;  5AQL A;  3BZK A;  4C1N I;  2NRR A;  3CCV N;  5KQ8 A;  4DTM A;  1VQO N;  5GIO A;  1XC3 A;  1NBW A;  1BQM A;  1B9D A;  1ATN A;  1VSL A;  3NFA A;  2W42 A;  1YJ9 N;  1KFD A;  1I94 K;  1QSS A;  2IVN A;  1YIT N;  4Z94 A;  3THW A;  3PO4 A;  1VSE A;  3CHW A;  4YY3 K;  4BRE A;  4E0D A;  1REV A;  3C94 A;  1J9A A;  3ZSZ A;  4H5T A;  3ZSY A;  3C6H A;  4B1Y B;  1SUQ A;  4Y1C A;  1LWE A;  4BGA A;  3V81 A;  4CJ7 A;  3FE1 A;  4RW9 A;  4OGC A;  4Z4E A;  1K9M O;  1GLJ O;  2CGJ A;  1ESV A;  3VQP A;  4DF8 A;  1N5Y A;  3KTQ A;  2E1Y A;  4A62 A;  3K9K A;  4AHC A;  3RTV A;  1QS4 A;  1GLB G;  3QIO A;  2UUA K;  4LC9 B;  3GBT A;  2ZGZ A;  4I6M A;  2V7Y A;  4B1U B;  3UKU A;  4M7Y A;  2O4G A;  1IKY A;  2G8U A;  3HP6 A;  1NK7 A;  3LAN A;  3WQT A;  1Q9Y A;  4BR9 A;  1YTA A;  1LW2 A;  3AVB A;  1WNS A;  4H0T B;  3WNF A;  1VQP N;  2CH6 A;  3SAG A;  5AQH A;  3PSI A;  4DS4 A;  2P9U A;  4JI8 K;  3RRH A;  1WSH A;  2F96 A;  1BCM A;  1FXX A;  4CJV A;  2E1Z A;  3LAM A;  1OKJ A;  4JI3 K;  4XH1 A;  2E6L A;  4V19 S;  3AA2 A;  3U9D A;  3OYA A;  4IOC L;  3CER A;  2QKB A;  1T05 A;  3VQ7 A;  1GOC A;  3OBY A;  4HVJ A;  3L2Q A;  4CJT A;  3DLR A;  3OYK A;  4CGD A;  4CVN E;  3NBP A;  4CFC A;  3VOV A;  4CGF A;  3CJC A;  4FL9 A;  1P8Z A;  5CR4 A;  1HUX A;  4F2R A;  2DFH A;  4HTU A;  4FLZ A;  3TAP A;  1S72 N;  1NK8 A;  4AF1 A;  1L3T A;  3VMF B;  3L6Q A;  5FRO A;  1SV5 A;  1BIU A;  3WT0 A;  1QZ6 A;  4AM6 A;  2P9P A;  1GLE G;  3E01 A;  1JLC A;  2E6M A;  1E4G T;  4PL8 A;  3SUO A;  1NK9 A;  4ISG A;  2XHB A;  4GV3 A;  1RT4 A;  5KRS A;  4WF9 L;  3O9Q A;  1U45 A;  4DTJ A;  2IVP A;  4CJP A;  2VG6 A;  4KHP K;  3MEE A;  3AA3 A;  1BU6 O;  4FM2 A;  4FW2 A;  1BIZ A;  3IRX A;  4KTZ A;  3QBX A;  4CIG A;  5I3U A;  1M90 O;  3HPH A;  3QBW A;  3L3U A;  3IAY A;  5M1F A;  4XIU A;  1VAZ A;  1I39 A;  4DR2 K;  4GW6 A;  3K9J A;  4BDZ A;  1U49 A;  5HRS A;  2LSN A;  3CJ7 A;  4TSX A;  4J2E A;  1OVQ A;  3BF1 A;  2OTL N;  4R79 A;  3CCJ N;  4CE9 A;  1KC8 O;  1WSF A;  2OPR A;  3VEO A;  3E9L A;  4JD2 A;  1LAW A;  2E20 A;  3CC2 N;  2P9P B;  5KPZ A;  3M8S A;  3C6A A;  4F4K A;  4EFH A;  1KTQ A;  1TKT A;  3F2K A;  1BIS A;  1G99 A;  2E4L A;  4N47 A;  3VQ8 A;  2IC3 A;  1RTD A;  2X6S A;  1MWM A;  3G4S N;  4OGE A;  4DV5 K;  5EOY A;  3ZCM A;  3M3Z A;  5JVH L;  1CZA N;  4OVL A;  3QES A;  3ZT3 A;  1Q8I A;  5EVZ A;  1Q9X A;  4AIL C;  2Z1G A;  5F0X A;  3HM9 A;  2FLO A;  5FRN A;  4BC4 A;  3OJS A;  5CYQ A;  1WBD A;  1C0G A;  2YHY A;  1NU0 A;  3DLH A;  2P5G A;  3LDO A;  3H6E A;  3HL8 A;  1JLB A;  3DMJ A;  1IH7 A;  3KD1 E;  1KVC A;  4JD2 B;  3CC4 N;  2WC9 A;  4CD1 A;  1S22 A;  5AQN A;  4Z0U A;  5BR9 A;  2QWO A;  2E5L K;  3J8A A;  4FLX A;  3K0S A;  4M63 C;  3HVR A;  3DLK A;  5M1Q A;  2J4R A;  4M7X A;  1T7P A;  4UY8 O;  5AZI A;  3H08 A;  3TAB A;  2PZS A;  4CHY A;  1J53 A;  4BE1 A;  5GIN A;  5DMR A;  4CJR A;  4GKK K;  1KAX A;  3AVN A;  3DRS A;  4CGI A;  4KO0 A;  1KLN A;  1U2V A;  3WNH A;  1S5J A;  4WQ4 A;  2V7Z A;  4MDB A;  3KVG A;  3O4Q A;  3HI0 A;  3D2F A;  5T7B A;  3P5J A;  1IKW A;  1TYQ A;  4KH4 A;  1HJO A;  3R1X A;  3V1O A;  3FZF A;  4YOY A;  5HL7 L;  2YHB A;  2FBY A;  3CG7 A;  1RDU A;  4KHS A;  2QWR A;  3HOT A;  4JKG A;  1C0U A;  4M3U A;  1J54 A;  1B9F A;  4LD0 A;  5EU7 A;  1NNE A;  1UAX A;  3RMA A;  1NGB A;  5AQY A;  4RW7 A;  1XUP O;  3V1R A;  3NGY A;  1KAY A;  3O6W A;  5AZI B;  1SS6 A;  1VQ8 N;  3TAG A;  2QM1 A;  1CXU A;  1HLU A;  2ZWH A;  1TK8 A;  4NCA A;  5I9E B;  2HMI A;  3CJ1 A;  4I7F A;  1VQ5 N;  2ZM6 K;  1W7A A;  4CEB A;  2QTD A;  1XC9 A;  1U2V B;  2Z1H A;  4JKC A;  1HYV A;  1X1P A;  4JN4 A;  4RW4 A;  1NOZ A;  1VRT A;  3D2F B;  1TYQ B;  3O3F A;  3NE6 A;  4BRG A;  2F8S A;  3F9M A;  5HBM A;  2YNF A;  4XH5 A;  1OH7 A;  5AQV A;  4JKG B;  3I0S A;  1GLF O;  4CEO A;  4FM1 A;  3TAN A;  3AVG A;  4CZJ A;  1JCF A;  4Q0B A;  1S6Q A;  5LJW A;  3CCR N;  3SYZ A;  4KFB A;  3NGI A;  3DRP A;  4W5N A;  4K8X A;  5C12 A;  2O8E A;  1HYZ A;  3VGK A;  3HVT A;  3NF9 A;  5AQZ A;  3CI5 A;  5F1X A;  4EP5 A;  3KK3 A;  3OYB A;  1YIJ N;  4BRO A;  4KKO A;  4ELU A;  1ZBH A;  3NH0 A;  2ASP A;  5BN9 A;  4B9L A;  1JL1 A;  5BPM A;  4KI4 A;  3P83 D;  5AQG A;  3O9T A;  3VTH A;  2D0C A;  3QLH A;  1FJG K;  3NVM A;  2YHA A;  1NGD A;  3ZLJ A;  3HST B;  4GY2 B;  1XHX A;  4EAH D;  1X3N A;  2OPP A;  1KD1 O;  3CYM A;  3MN5 A;  4E1J A;  4FLV A;  5HLF A;  2V52 B;  4AHS A;  3PX6 A;  3KK7 A;  1BUP A;  1RIL A;  3MWT A;  1RT3 A;  5AR0 A;  5AFU H;  5BRE A;  4OKJ A;  1W97 L;  3AAR A;  1QZ5 A;  3D0P A;  2HHT A;  3C65 A;  3S3M A;  3AAQ A;  4QCL A;  1SL0 A;  2GEL A;  3H1V X;  2P9I A;  1JJ2 M;  1VSH A;  1HYS A;  1R0A A;  1YJN N;  3QFP A;  1SKW A;  4CJF A;  2NLX A;  3IUC A;  3HK2 A;  4H8K A;  3SQ2 A;  4MLE A;  1I3A A;  2NRZ A;  2VWB A;  5JVG L;  4KHQ A;  3P31 A;  4M3X A;  4JI2 K;  4OO1 J;  2ITG A;  4PKG A;  3AVL A;  4DV2 K;  3AVM A;  3EEQ A;  3MN7 A;  3O5B A;  1QQC A;  1V4S A;  3S3O A;  3CQ8 A;  4OKK A;  3S9H A;  1XMQ K;  1V4T A;  4JI0 K;  1KQS M;  2HOE A;  2Y1I A;  2DFF A;  2UU9 K;  2UXD K;  2QK9 A;  3LDN A;  4PHT X;  4IDK A;  4YOX A;  5E41 A;  3UB5 A;  1ILY A;  2A6A A;  4O8K A;  4IG3 A;  1NM1 A;  1K8A O;  3S41 A;  4B9V A;  4DB3 A;  4JI6 K;  1GOA A;  5AQR A;  2FF3 B;  3DXK A;  1VQ6 N;  2P9I B;  4CIE A;  1CXQ A;  4X65 K;  3G0Z A;  3QNN A;  4FJ7 A;  1ASV A;  3TWH A;  3T19 A;  1EET A;  3CD6 N;  3AVH A;  4KV8 A;  4O5F A;  3CPW M;  1VK0 A;  2X74 A;  4CGH A;  2A41 A;  4E7H A;  1X3M A;  4FO0 A;  4PA1 A;  2GUP A;  3NF6 A;  4ILJ A;  1IG9 A;  3T1Y K;  3O4N A;  3THY A;  4F3O A;  1JXE A;  3FZL A;  3BY5 A;  4IFY A;  4DU1 A;  2O8B B;  4FM0 A;  5CE3 A;  3ENB A;  4HTL A;  1RT7 A;  4CJW A;  3A8Y A;  4EZ6 A;  4LFA K;  5K14 A;  3KLG A;  5MLC Q;  2OPS A;  1D5A A;  5D3G A;  2PYJ A;  3SAH A;  3L4I A;  4JI7 K;  3I0R A;  4KTW A;  4CJ5 A;  2G8I A;  1TUY A;  4CI6 A;  4RW8 A;  2HHX A;  3Q7B A;  1JLQ A;  4DV6 K;  1X9M A;  1XHZ A;  3L4Q A;  3V9W A;  3SQ4 A;  1U47 A;  3THY B;  4UQG A;  4FLW A;  4BC5 A;  4W5R A;  3OYG A;  3JS6 A;  4OX9 K;  4CEF A;  1DGK N;  2CH5 A;  4BRK A;  2HHQ A;  2BDP A;  3L3V A;  4C8N A;  4FK4 A;  1ITG A;  2UUC K;  1U4B A;  4KHN A;  4KRE A;  2YHW A;  5IWA K;  4E3S A;  2YCH A;  1W0H A;  2QA4 N;  5AQM A;  3LDQ A;  3KIO A;  4OKE A;  4AHU A;  1O13 A;  4X66 K;  4YOW A;  2DPN A;  4NO7 A;  2YJE A;  2ZQB A;  5AQO A;  4DV0 K;  3L0Q A;  2DTU A;  1MA9 B;  4A59 A;  5KQD A;  4B08 A;  4WQ5 C;  3OJU A;  1NKB A;  1X9J A;  2FSJ A;  2OPQ A;  2ZD1 A;  4QOZ B;  1NK0 A;  2E8A A;  3ZT0 A;  1RDW X;  3SQ0 A;  4FZY A;  2GEM A;  1RDB A;  1TVR A;  1DEJ A;  4YFU A;  3NVK A;  2FBV A;  4DSF A;  3ULE A;  3OW2 M;  3HPO A;  3L2V A;  5FPM A;  5M1O A;  3SPZ A;  3A5O C;  3SLC A;  4HCB A;  4KB1 A;  2D1K A;  3L2W A;  5M1P A;  1RNH A;  4IJN A;  4BQL A;  4ILH A;  3PX4 A;  1HNZ K;  2G8W A;  2HW3 A;  1SKR A;  3VEX A;  2GTD A;  5AQU A;  4Z4H A;  2O8F A;  1DLO A;  3AA4 A;  4ELT A;  1RBR A;  4FVM A;  2Y1J A;  3OVN A;  5KPT A;  2YKM A;  3CQY A;  3CME N;  2O8D A;  5C2D A;  5JLH A;  3RR7 A;  1LW0 A;  3LPU A;  4MDA A;  3FZH A;  2KZM A;  3HOS A;  1NKE A;  4PUO A;  3T7Z A;  3SV3 A;  3TI0 A;  2RHK A;  2DY4 A;  1QTM A;  1ZYQ A;  3KHY A;  3VF2 A;  3ZT2 A;  3VEW A;  3MN6 A;  1HQE A;  1YUW A;  4BRL A;  3J81 O;  3NF7 A;  4DQS A;  3V4I A;  4DFJ A;  3KZB A;  3CIP A;  3ULE B;  2HVI A;  3D2E A;  3E1Y A;  2BTF A;  5DM7 L;  1VSK A;  4OLB A;  1KAZ A;  3ZET A;  4E7I A;  5KGX A;  3FZM A;  5KTQ A;  3DM2 A;  3I56 N;  2Z1J A;  3KKR A;  4MO4 A;  4NXN K;  5FPD A;  3QB0 A;  5BPL A;  1K8K B;  4B3T K;  3L2R A;  2O8F B;  4NCB A;  4DV4 K;  1YVU A;  1QQN A;  3FLC O;  3QFU A;  3EN9 A;  3LAL A;  2YHX A;  1EO1 A;  2RN2 A;  2KHO A;  5JMV A;  2FBT A;  4CGG A;  3VA3 A;  1BA0 A;  3ZX3 A;  1YI2 N;  4FWK A;  4Q5V A;  3SZ2 A;  1E3M A;  2O8D B;  3L8B A;  3WXL A;  3C7N A;  3KLH A;  2ZJP L;  1RBT A;  5C24 A;  3J80 O;  4IG0 A;  3O9S A;  2O8C A;  3M1F A;  4CF9 A;  3QIC A;  4FYD A;  4DTR A;  5TKY A;  4RWT A;  1JCE A;  5CHI A;  2BH1 A;  3U6F A;  3OS2 A;  1BG3 A;  4JI5 K;  3RMB A;  3MXM A;  3TTF A;  4HUG A;  3T1H K;  1IV0 A;  4M3W A;  2E2P A;  3EO3 A;  1SL1 A;  3GE1 A;  4CHP A;  2F4V K;  2D0A A;  4BRH A;  3OTO K;  3D2E B;  1X9S A;  2HST A;  3NF8 A;  3ZET B;  4BVO A;  3PY8 A;  3D6R A;  4U7B A;  4I9L A;  3O9R A;  2P9N A;  4B9S A;  4DTS A;  4NCG A;  2OZM A;  4CZH A;  4E7K A;  4DR6 K;  3TR8 A;  1OH6 A;  1M1K O;  3O1B A;  4FJ9 A;  3VGL A;  1IBL K;  2QWN A;  3NH1 A;  4QS8 A;  3WXM B;  1HNV A;  4B9T A;  3O4W A;  4YOT A;  4PL7 A;  3EE8 A;  4DV1 K;  3AGK A;  2Q97 A;  3C7N B;  3HSC A;  2IVO A;  2F8T A;  5E26 A;  2O8C B;  2PYL A;  1NJI O;  2HNY A;  4FJJ A;  4KB0 A;  2ASO A;  1XWL A;  4FJK A;  3QER A;  5J1E A;  4KPY A;  4C1N K;  4CF2 A;  3C0B A;  4MLH A;  4K41 A;  3SNN A;  4DSL A;  1CLQ A;  1EP4 A;  2Q36 A;  2E2Q A;  5BRF A;  1GLC G;  4DFM A;  4DCH A;  1FW6 A;  4GKJ K;  4HUE A;  3GG4 A;  4FJN A;  2WTU A;  2F9T A;  3ZT4 A;  1VQ7 N;  3VQ5 A;  3IKM A;  4JRP A;  4A2A A;  1NMD A;  1NGJ A;  2P9N B;  3ATV A;  1T03 A;  3CFO A;  1RBU A;  3TPQ A;  5AQX A;  1SAZ A;  4E89 A;  5BRH A;  1ATR A;  4DQ8 A;  3OYF A;  1H1V A;  2KKZ A;  3A5N C; 
#chains in the Genus database with same CATH homology
 1ZBL A;  4Q0B A;  2KW4 A;  2AJQ A;  1S6Q A;  4MQ3 A;  4M45 A;  1TAQ A;  4FJM A;  3VQQ A;  2P5O A;  4N41 A;  3QO9 A;  3SYZ A;  1XI1 A;  2YNI A;  3LP0 A;  4KFB A;  2IDO A;  3MXI A;  3NGI A;  1O1W A;  4K8Z A;  3DRP A;  4AHR A;  1D8Y A;  1S1X A;  4W5N A;  4CHO A;  4PWD A;  3RMC A;  2OZS A;  4K8X A;  1HYZ A;  3HVT A;  3LP3 A;  3AVC A;  3NF9 A;  3OS1 A;  3ZSW A;  4EP5 A;  3KK3 A;  5CZ1 A;  4CER A;  4DF4 A;  1HPZ A;  3OYB A;  4KKO A;  1C6V A;  1WSE A;  1S9E A;  3ITH A;  3C6U A;  3SQ1 A;  5J2P A;  3NH0 A;  4ELU A;  1ZBH A;  4FZZ A;  3K59 A;  3NAE A;  2D0B A;  3O3H A;  3TAQ A;  1HMV A;  2D5R A;  3K58 A;  3LZI A;  4B9L A;  4FJ5 A;  1JL1 A;  4BDP A;  3IG1 A;  4FXD A;  1C1B A;  4CK3 A;  3P83 D;  4J2A A;  4KI4 A;  3HJF A;  4I2Q A;  2D0C A;  3QLH A;  3VQ9 A;  4OPJ A;  1HNI A;  2YHA A;  4QAG A;  2EX3 A;  1L3U A;  4F3T A;  5J2M A;  4RG8 A;  3G10 A;  4FJH A;  1SKS A;  3AO5 A;  3ZSV A;  3KLI A;  5CY4 A;  5HRN A;  3HST B;  1TL1 A;  4E1M A;  1XHX A;  3DLG A;  1KVB A;  3KKS A;  4DQI A;  4CHN A;  4CCH A;  3K2P A;  1CZB A;  1QE1 A;  2OPP A;  3NCI A;  1JLG A;  3CYM A;  4O4G A;  4FLV A;  5HLF A;  2G8K A;  4AHS A;  5HRO A;  1WAF A;  4KHU A;  3D45 A;  1QSY A;  3OYN A;  1DTQ A;  1HQU A;  3F73 A;  3PX6 A;  1S1W A;  2R7Y A;  4CFD A;  1NJW A;  1BCO A;  1NKC A;  1RIL A;  4FJ8 A;  1RT3 A;  4DSI A;  1IKV A;  2FBX A;  1U04 A;  4FCY A;  3DOL A;  3HXM A;  1L5U A;  4DQP A;  4OKJ A;  2GUI A;  4O0J A;  3AVF A;  4CGJ A;  3KLF A;  1J5O A;  2BGG A;  3D0P A;  2GV9 A;  4JS5 A;  4CJ4 A;  4B8A B;  3ZSX A;  3KK1 A;  4DLE A;  2HHT A;  3S3M A;  3KJV A;  2FC0 A;  3K5N A;  4CJL A;  5CYM A;  5C25 A;  1VSJ A;  4QCL A;  2KQ2 A;  1SL0 A;  1JXB A;  3ASM A;  1D9F A;  4AHT A;  1JLA A;  4BDY A;  4FJX A;  1BI4 A;  1IO2 A;  4F8R A;  1VSH A;  1HYS A;  1R0A A;  1Z26 A;  1N6Q A;  4PY5 A;  1K6Y A;  4CFB A;  5SWM A;  3ZSO A;  1WSI A;  1RBS A;  4H4O A;  4E19 A;  4N56 A;  3KK2 A;  3AA5 X;  4CJF A;  1SKW A;  3LP1 A;  4ID5 A;  1BQN A;  1NJZ A;  4H8K A;  3HK2 A;  3SQ2 A;  4B8C A;  1I3A A;  3MAQ A;  3QET A;  4CES A;  1CZ9 A;  4KHQ A;  1B92 A;  2HNZ A;  2Z1I A;  1L3V A;  4N76 A;  4M3X A;  2ITG A;  3AVA A;  3AVL A;  4M42 A;  3AVM A;  3VQC A;  3HYF A;  2VWJ A;  1QQC A;  3K5M A;  1NK6 A;  3SI6 A;  3S3O A;  3CQ8 A;  1C0T A;  4OKK A;  3S9H A;  3TAR A;  4DS5 A;  3PUF A;  3VQA A;  4IKF A;  3TAF A;  3OYD A;  2Y1I A;  4M3R A;  4M3Y A;  2DFF A;  4HUF A;  1TAU A;  3DI6 A;  4CFA A;  1RCH A;  1VSF A;  2QK9 A;  3K57 A;  4IDK A;  4LH4 A;  3DLE A;  4JS4 A;  5E41 A;  2BE2 A;  4H4M A;  4CK1 A;  1S1T A;  1ASW A;  3RRG A;  1TK5 A;  4IG3 A;  3HO1 A;  2EHG A;  4O44 A;  4B9N A;  3SPY A;  5JS1 A;  4C8L A;  4DQR A;  3B6P A;  2NUB A;  3RWU A;  4B9V A;  1GOA A;  1C1A A;  4ID1 A;  3U3Y A;  3ZT1 A;  2QKK A;  4CEQ A;  2PY5 A;  1A5V A;  4JLH A;  4DU4 A;  4CIF A;  3AO4 A;  1NJY A;  1C0M A;  4FJG A;  5SZT A;  4CIE A;  1CXQ A;  1BI4 B;  3VN5 A;  3THV A;  2A1R A;  4DSJ A;  3OS0 A;  1NK8 A;  5I42 A;  2B6A A;  2ETJ A;  3G0Z A;  3QNN A;  2WON A;  4DTM A;  4FJ7 A;  3HP9 A;  1ASV A;  1BQM A;  1RDA A;  3VQE A;  2O4I A;  1VRU A;  3TWH A;  3AV9 A;  3T19 A;  1B9D A;  1FKO A;  4FJI A;  1EET A;  1VSL A;  3NFA A;  2W42 A;  1YTU A;  3AVH A;  4KV8 A;  1KFD A;  2IGI A;  2IOC A;  1VK0 A;  2X74 A;  4CGH A;  2X78 A;  2RPI A;  1WN7 A;  2XY7 A;  4GMJ B;  1QSS A;  4E7H A;  4PA1 A;  1VSE A;  3A2F A;  3PO4 A;  3SUQ A;  3AO2 A;  1RTI A;  3NF6 A;  4CHQ A;  4CF8 A;  4W5Q A;  1IG9 A;  4E0D A;  3O4N A;  1REV A;  4F3O A;  3OYC A;  3C94 A;  1J9A A;  1JXE A;  2I5J A;  2B4J A;  3ZSZ A;  5JS2 A;  3ZSY A;  1KFS A;  2YNG A;  4DU3 A;  1SUQ A;  4Y1C A;  3LAK A;  4J2B A;  4FK0 A;  4DG1 A;  2VWK A;  1LWE A;  4IFY A;  1S1U A;  4DSE A;  2G8F A;  3V81 A;  4DU1 A;  4CED A;  4BWJ A;  4CJQ A;  4RW9 A;  4OGC A;  1HRH A;  1EX4 A;  4FM0 A;  4Z4E A;  1A5X A;  4HCC A;  4BE2 A;  3V9X A;  1KVA A;  1RT6 A;  4FLU A;  1RT1 A;  3VQP A;  4FZX C;  1FKP A;  4DF8 A;  1N5Y A;  3KTQ A;  3L2U A;  4DTX A;  3MXJ A;  4C8O A;  1RT7 A;  4AHC A;  3DRR A;  3RTV A;  1QS4 A;  3ALY A;  4AH9 A;  4CJW A;  3CFP A;  4EZ6 A;  3QIO A;  5K14 A;  3KLG A;  1G15 A;  3VQD A;  2OPS A;  1FK9 A;  3BGR A;  3OYL A;  4BE0 A;  1UA1 A;  2JGU A;  1D5A A;  5D3G A;  3FFI A;  2PYJ A;  5J2N A;  1UA0 A;  1F21 A;  2O4G A;  1Y97 A;  1IKY A;  3I0R A;  2G8U A;  3HP6 A;  4KTW A;  1NK7 A;  3VQB A;  4CJ5 A;  3LAN A;  2G8I A;  3AVJ A;  1Q9Y A;  3F9K A;  1YTA A;  1LW2 A;  3AVB A;  1WNS A;  4RW8 A;  4L8R B;  2HHX A;  3WNF A;  1ASU A;  1S9G A;  1RTH A;  3M8P A;  5HRR A;  3HT3 A;  1JLQ A;  3OYM A;  1TV6 A;  1X9M A;  3QEI A;  1XHZ A;  4E1N A;  2GBZ A;  1VSI A;  4DTN A;  3V9W A;  4DS4 A;  3LWL A;  3RRH A;  1WSH A;  3SQ4 A;  1U47 A;  2F96 A;  2X6N A;  1BCM A;  1FXX A;  3AVK A;  4CJV A;  3SV4 A;  4UQG A;  3LAM A;  4FLW A;  1RT2 A;  2E6L A;  4LY7 A;  3DYA A;  4W5R A;  3OYG A;  4C8K A;  2DFE A;  3AA2 A;  3OYA A;  2QKB A;  1T05 A;  3VQ7 A;  4CEF A;  3PX0 A;  1GOC A;  4HVJ A;  2IS3 A;  4DSK A;  3L2Q A;  2P51 A;  4CJT A;  3DLR A;  3K5O A;  3VA0 A;  1TGO A;  1BHL A;  3OYK A;  4CK2 A;  4CGD A;  1VSM A;  3V9Z A;  3V9S A;  2HHQ A;  2BDP A;  3NBP A;  1RDD A;  1JLE A;  1RDC A;  2KTQ A;  4G1Q A;  3L3V A;  4C8N A;  4CF1 A;  4FLY A;  4FK4 A;  1ITG A;  4CFC A;  1U4B A;  4KHN A;  4KRE A;  4E3S A;  4I2P A;  4CGF A;  1IKX A;  4KTQ A;  1TKX A;  1W0H A;  3QNO A;  4F2R A;  2DFH A;  3T1A A;  3KIO A;  4OKE A;  3KLE A;  4HTU A;  4AHU A;  5FDL A;  4FLZ A;  3TAP A;  4ZTJ A;  4CEZ A;  1TK0 A;  2HB5 A;  5FRO A;  1SV5 A;  1BIU A;  1DTT A;  1SL2 A;  4O55 A;  2ZQB A;  3OYI A;  3E01 A;  4C8M A;  2DTU A;  1JLC A;  2E6M A;  3OY9 A;  1Z25 A;  2VG5 A;  4NYF A;  3QEP A;  3SUO A;  1NK9 A;  3CM5 A;  4B08 A;  2XHB A;  1RT4 A;  3OJU A;  5KRS A;  1U45 A;  1NKB A;  1ZBF A;  2OPQ A;  4HHT A;  4DTJ A;  2ZD1 A;  4CJP A;  2VG6 A;  1LAV A;  5CZ2 A;  3WNG A;  1NK0 A;  3ZT0 A;  4QOZ B;  1C1C A;  3MEE A;  3AA3 A;  3BDP A;  4E7L A;  4NYN A;  4FW2 A;  4OPK A;  4FM2 A;  3SQ0 A;  4FZY A;  1BIZ A;  3IRX A;  1RDB A;  4KTZ A;  1TVR A;  4YFU A;  4CIG A;  5I3U A;  1LWC A;  3OYJ A;  2FBV A;  3O3G A;  4DSF A;  3ULD A;  3LZJ A;  1NOY A;  3HPH A;  4OLA A;  3AVI A;  3L3U A;  4FK2 A;  3VQ4 A;  4XIU A;  5HP1 A;  4FLT A;  3AO1 A;  3IAY A;  3MED A;  3HPO A;  3L2V A;  1I39 A;  3SPZ A;  3KD5 E;  4HCB A;  2YNH A;  4GW6 A;  4KB1 A;  2HHS A;  3L2W A;  4PQU A;  2IAJ A;  3MEG A;  4BDZ A;  1U49 A;  2KZZ A;  4O5B A;  2LSN A;  5HRS A;  4YNQ A;  1RNH A;  2BAN A;  4TSX A;  3PX4 A;  2HW3 A;  3CM6 A;  4Z4C A;  3V6D A;  2G8W A;  1SKR A;  4J2E A;  4DTP A;  1HJR A;  4IBN A;  4Z4H A;  4WE1 A;  4F2S A;  3AA4 A;  1DLO A;  1JLF A;  4CE9 A;  4ELT A;  4DTO A;  3IS9 A;  1WSF A;  1RBR A;  1RBV A;  2OPR A;  4FVM A;  4FW1 A;  1LAW A;  1X9W A;  3QEV A;  3ISN C;  2Y1J A;  3NDK A;  1NK5 A;  3OVN A;  3NGZ A;  1TL3 A;  3M8S A;  2YKM A;  1WSG A;  3C95 A;  4LSL A;  2RKI A;  3PV8 A;  4F4K A;  4ZTF A;  3RR7 A;  1KTQ A;  1LW0 A;  3SUN A;  3LPU A;  1L3T A;  1TKT A;  3C6T A;  4DFK A;  1BIS A;  4FJL A;  4CJU A;  2KZM A;  3NH2 A;  2E4L A;  2QXF A;  4N47 A;  1NKE A;  3VQ8 A;  4PUO A;  3OYE A;  1TKD A;  2IC3 A;  5KI6 A;  1RTD A;  1JL2 A;  4OJR A;  3LWM A;  4N5S A;  4W5T A;  3SV3 A;  4I9Q A;  2X6S A;  4DQQ A;  3TI0 A;  2DY4 A;  4OGE A;  2ZE2 A;  3EY1 A;  1QTM A;  3VQ6 A;  1ZYQ A;  3ZT2 A;  1QSL A;  3ZCM A;  1HQE A;  3LP2 A;  4GVM A;  4OVL A;  3MEC A;  3NF7 A;  4DQS A;  3V4I A;  4DFJ A;  3QES A;  4IFV A;  3ZT3 A;  2OYQ A;  2HVI A;  4CJE A;  1Q8I A;  1Q9X A;  4EZ9 A;  1VSK A;  4BWM A;  3NHG A;  4OLB A;  4E7I A;  4AIL C;  4DWI A;  2Z1G A;  3HM9 A;  5FRN A;  3WNE A;  1S6P A;  5KGX A;  5KTQ A;  3DM2 A;  4O0I A;  2Z1J A;  3OJS A;  3KKR A;  3QEW A;  5CYQ A;  1RTJ A;  4KAZ A;  5KRT A;  1S1V A;  3V9U A;  1T8E A;  3DLH A;  2P5G A;  3L2R A;  2KFN A;  1TKZ A;  1YT3 A;  3B6O A;  1WLJ A;  1YVU A;  4NCB A;  3HL8 A;  3LAL A;  3RR8 A;  1JLB A;  1BL3 A;  1IH7 A;  3DMJ A;  4LH5 A;  1KVC A;  4DMN A;  2RN2 A;  3KD1 E;  2FBT A;  4CGG A;  3VA3 A;  4Z0U A;  4DFP A;  5J2Q A;  4Q5V A;  4FLX A;  3SZ2 A;  2WOM A;  1A5W A;  3L8B A;  3KLH A;  3HVR A;  2XY5 A;  3DLK A;  3CFR A;  1RBT A;  5C24 A;  4IG0 A;  1T7P A;  3TAE A;  4R5P A;  4CEA A;  4CHZ A;  4CF9 A;  3QIP A;  4BAC A;  4DTR A;  3H08 A;  3TAB A;  1L3S A;  1QHT A;  4B9U A;  4FYD A;  2PZS A;  4CHY A;  1BGX T;  3TAM A;  1NK4 A;  1J53 A;  1GOB A;  3OS2 A;  4BE1 A;  3U6F A;  3RMB A;  4JRQ A;  3MXM A;  1LV5 A;  4J2D A;  3V1Q A;  4HUG A;  2OA8 A;  5DMR A;  5DK5 A;  4CJR A;  3UIQ A;  4M3W A;  4MFB A;  1SL1 A;  2YV0 X;  4CEE A;  2XY6 A;  1KRP A;  3PO5 A;  3AVN A;  3DRS A;  4CHP A;  1NJX A;  1KCF A;  4CGI A;  5C42 A;  2D0A A;  4CJK A;  3EYZ A;  4ICL A;  4KO0 A;  1KLN A;  3WNH A;  3AO3 A;  3DOK A;  1X9S A;  2KFZ A;  1S5J A;  3QEX A;  3NF8 A;  2RF2 A;  3ZSR A;  3I8D A;  2G8H A;  2XY8 A;  3K5L A;  4CF0 A;  3PY8 A;  3O4Q A;  2HHW A;  2ATQ A;  3SUP A;  4ZHR A;  2P1J A;  4CEC A;  4I9L A;  3QIN A;  5T7B A;  3P5J A;  1IKW A;  1UOC A;  3JSM A;  4B9M A;  4RW6 A;  4B9S A;  4DTS A;  4NCG A;  2OZM A;  4E7K A;  2A1S A;  3V1O A;  4KI6 A;  3TR8 A;  2HVH A;  1EXQ A;  4DLG A;  2YHB A;  4M3T A;  2FBY A;  3CG7 A;  4FJ9 A;  3HPG A;  4KHS A;  4E7J A;  2JLE A;  4Z4I A;  3NH1 A;  5FRM A;  1C0U A;  4M3U A;  4M3Z A;  1HNV A;  3LDS A;  1J54 A;  4B9T A;  2Q3S A;  2B5J A;  3OYH A;  1JKH A;  1B9F A;  1WSJ A;  4LD0 A;  4W5O A;  5EU7 A;  3M8Q A;  2HHU A;  1UAX A;  3RMA A;  3S3N A;  4RW7 A;  2F8T A;  3V1R A;  3NGY A;  4AHV A;  1RT5 A;  1VSD A;  1KSP A;  2G8V A;  3U3G A;  2PYL A;  3TAG A;  1CXU A;  4Z4G A;  2HNY A;  1MU2 A;  1TK8 A;  4NCA A;  4FJJ A;  4KB0 A;  2XO7 A;  4LSN A;  1EKE A;  1XWL A;  4FJK A;  4KHW A;  3QER A;  4Y1D A;  4I7F A;  5J1E A;  3T3F A;  2HMI A;  4KPY A;  4CF2 A;  4CEB A;  2XRI A;  3SNN A;  4DSL A;  1XC9 A;  3DLB A;  5KGW A;  1CLQ A;  4CJ3 A;  1EP4 A;  2Z1H A;  1HYV A;  1X1P A;  1UWB A;  4RW4 A;  1WAJ A;  3SCX A;  4DFM A;  1ZBI A;  2HHV A;  2VG7 A;  4ELV A;  4HUE A;  4KRF A;  4Z4F A;  4FJN A;  1NOZ A;  1VRT A;  4B3O A;  1LWF A;  3ZT4 A;  3ZSQ A;  3VQ5 A;  4JRP A;  2HND A;  3O3F A;  3NE6 A;  1W9H A;  4EP4 A;  3LPT A;  1T03 A;  3P1G A;  3EZ5 A;  5HRP A;  2F8S A;  3SJJ A;  3JYT A;  1ZBU A;  3CFO A;  4DTU A;  5HBM A;  1RBU A;  2YNF A;  4M41 A;  3I0S A;  3M8R A;  4CEO A;  2YKN A;  4FM1 A;  3RMD A;  3TAN A;  4E89 A;  3AVG A;  1D9D A;  4CJS A;  3OYF A;  1KLM A;  4KHY A;  1U48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...