4CE9A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ce9A00
2HVIA 1C0MA 4FJNA 3HYFA 1NK9A 3AV9A 3KKRA 4CIFA 4E7IA 3L2QA 4Z4CA 1NKBA 3MXJA 1JKHA 2YNHA 3LALA 2P51A 3OYBA 4CCHA 3TAPA 1NJZA 1FKPA 4BDYA 2PY5A 4DG1A 4E1MA 2KTQA 1S1XA 4W5RA 4NCGA 4BE0A 3V9WA 1C1CA 2IS3A 4CHQA 3BDPA 2HVHA 1HNIA 1S6PA 4FZXC 2BANA 4M3UA 1IKVA 4CEAA 3LDSA 4O5BA 3PO4A 3AVHA 4EP4A 3T19A 1WAJA 5I42A 4KAZA 4KV8A 1BCOA 1TGOA 3AO2A 3U3GA 1IKWA 4DQRA 4DQIA 4F8RA 3S9HA 3V4IA 2IAJA 3HL8A 3OY9A 1NK6A 1VSIA 1KLNA 3O3FA 4BDZA 3HK2A 2F8SA 3QNOA 1F21A 1VSMA 3VQEA 2KFNA 1IO2A 1EKEA 2RPIA 3ZT3A 3OYLA 4CF1A 3KK1A 3VQDA 1Y97A 1WSJA 2X6NA 4CJ4A 4LSNA 3WNFA 3PX6A 4F4KA 1QSYA 1U04A 1EETA 2O4GA 3ZSQA 1HYZA 1TKZA 4DS4A 1S1WA 4N5SA 4PWDA 3T3FA 1EP4A 4I2PA 1ASVA 1HYVA 4OLAA 5CZ2A 4CHZA 4UQGA 2A1SA 4K8ZA 3DLRA 4CEEA 4M3TA 3RR7A 4IFYA 3MECA 3L2WA 4DQSA 4CF8A 1ASWA 4PY5A 3QEPA 2D5RA 4OVLA 4CJVA 3PY8A 4M3XA 3B6OA 3TR8A 1TK0A 4CFBA 3AO1A 4RW9A 3MXIA 3DLEA 4LY7A 4MQ3A 1HQEA 2XY8A 3SPYA 4DWIA 1LWFA 2DFEA 3CM6A 1LW0A 1VRUA 2OPQA 4DFMA 3QEIA 1KVAA 4FM2A 3KLFA 1HRHA 1WSEA 4CFAA 4KHNA 1O1WA 1ZBIA 4LSLA 4CJ3A 4F2SA 2HB5A 2LSNA 3NDKA 1NKCA 4KI4A 4HUEA 4TSXA 3RMBA 1ZBUA 3CFPA 4Z4IA 1MU2A 2XY6A 4JLHA 5J2MA 4RW4A 3ZSOA 2ZD1A 2Z1IA 3O3HA 3CG7A 3AO3A 4I7FA 4I9LA 3C6TA 2P5OA 3NFAA 4DSLA 4KTZA 3KJVA 4CF2A 3VA0A 3DOLA 3SPZA 2F8TA 3SCXA 2QK9A 3M8SA 2YHAA 3P5JA 4F3TA 4IFVA 3LZJA 3SV3A 3VQBA 2AJQA 3HPOA 4ZTJA 4Z4FA 3S3OA 5DMRA 1L5UA 3KTQA 4B8AB 1D5AA 5KGXA 2Y1IA 4CIGA 2QKBA 4E3SA 3ZT0A 4KI6A 3NH1A 1BCMA 4FLZA 3WNGA 2YV0X 4N41A 4JRPA 1J5OA 3VN5A 3ITHA 1CXUA 2FBYA 4HVJA 4AHSA 1JLEA 3RR8A 4DQQA 4IG3A 2DY4A 4BE1A 4CIEA 1N5YA 2Q3SA 3VQAA 4FJHA 4FW2A 4B8CA 3NF8A 2DTUA 4BWMA 4OPJA 3NH2A 4CK1A 4GW6A 3M8PA 3EZ5A 3VA3A 3V6DA 1ASUA 5CY4A 4B9TA 3QINA 2G8WA 1UA0A 3CM5A 3LPUA 1KTQA 4C8NA 4DU4A 1GOCA 3NF9A 4B9LA 5HLFA 4LH4A 3K5OA 1BI4A 3THVA 4YFUA 2F96A 2B5JA 1NJYA 5HRNA 2PYLA 3QNNA 4B9VA 4J2DA 4NCAA 1ZYQA 1X9MA 1TAQA 3TABA 2EHGA 3V1OA 3VQ7A 4CJQA 4W5OA 3QERA 4AHRA 1CLQA 4DTUA 1RTJA 3HP9A 1VSJA 1TL3A 1VSEA 1NK8A 1KRPA 4FJMA 1C1BA 3MXMA 4Z4HA 4KHQA 3KLHA 2IOCA 1L3VA 3D0PA 1HJRA 1RT2A 1WSIA 3KLIA 4CF9A 1U47A 1WN7A 4KB0A 4FJ7A 2HHSA 3NH0A 3OVNA 4C8OA 3QLHA 4E19A 4BE2A 4Z4EA 1S9EA 1X1PA 1R0AA 1JXEA 3I0SA 4DSEA 4DSKA 1SKSA 3LP1A 4E7LA 1ZBLA 3NCIA 4RG8A 1TKXA 2OA8A 4RW7A 4O0IA 4B9SA 4FYDA 1IH7A 3JSMA 1REVA 4PQUA 3MEEA 4G1QA 2BE2A 1TL1A 4DSIA 3LZIA 2HNYA 1ZBHA 4IG0A 4CGIA 1G15A 3CYMA 1BI4B 1RDCA 1KVCA 3HVTA 5HRSA 3SUPA 4CJUA 1RT3A 1LAVA 3NHGA 3DLBA 3I0RA 1WLJA 4K8XA 1TVRA 4KFBA 2OPRA 4DTJA 4FJIA 2RF2A 4CHPA 4N76A 4CEZA 1D8YA 3LANA 1J54A 4CECA 3AVLA 3PUFA 4J2BA 2X78A 2OZSA 2HMIA 1NK0A 4KREA 3OYJA 5EU7A 4B08A 4R5PA 2XY7A 1RDAA 3K5NA 3TANA 2KQ2A 3IS9A 3LP2A 2Y1JA 2X6SA 4CK2A 3AVIA 3QESA 4KHWA 5C24A 3RRHA 4HCCA 3OYEA 3AVAA 2ETJA 3U3YA 1BIZA 3QIOA 5CZ1A 3SQ0A 1GOBA 4FVMA 5I3UA 3QO9A 4Y1DA 4DS5A 3HJFA 3LAKA 4M3RA 2HHXA 2PZSA 1WNSA 4CF0A 2O4IA 1UAXA 4FJJA 2PYJA 3M8QA 4HTUA 2ITGA 3V9XA 2NUBA 4O44A 4FXDA 1WAFA 5CYQA 1U48A 4J2AA 2G8IA 3KLEA 4B3OA 2ATQA 4CESA 4O55A 1EXQA 2RN2A 3DLGA 3L2VA 4DTSA 3QEVA 4FZZA 2YNFA 3VQ8A 1TAUA 3LP3A 1NK7A 2KZZA 3NAEA 4FK4A 4DTXA 4RW8A 2W42A 4I2QA 4JS4A 1S5JA 4OKKA 5JS2A 3H08A 3OYNA 3OJSA 3O4NA 3LWLA 3TAGA 1QHTA 3L8BA 1QSLA 4CERA 1T8EA 3O3GA 4GVMA 4E7JA 2P5GA 1A5XA 1S9GA 3SV4A 1KVBA 2OPPA 3ZSWA 1RT7A 3C94A 4FJGA 4DFJA 1NJXA 4KB1A 1NK5A 4FK2A 2A1RA 4AHVA 4J2EA 3V1RA 3ISNC 4C8MA 1JL2A 1JXBA 3AO5A 1QE1A 1S1TA 3VQQA 1FKOA 1LW2A 1HPZA 3RMAA 4CJRA 4EZ9A 3SYZA 1EX4A 1ITGA 3QIPA 3K57A 2HHQA 3WNEA 2YKNA 2ZE2A 2XY5A 3HPHA 1JL1A 2HNDA 4E89A 3AVBA 1SL2A 4FJLA 4PUOA 1VK0A 3L3VA 5KI6A 5C42A 1KLMA 4HUGA 3HXMA 1LV5A 2KFZA 4DTRA 1KFDA 4O4GA 4CEOA 2WONA 5KRSA 3ZT4A 4CEDA 1FK9A 3M8RA 3KK3A 3MAQA 3RRGA 1SV5A 4ID1A 3PX4A 1UWBA 1J53A 3WNHA 1TV6A 3SQ2A 1W9HA 1YT3A 1UOCA 1XI1A 2IC3A 1IKXA 2JGUA 5SZTA 5J2NA 4E7KA 1TKDA 4F2RA 1RTHA 1Z26A 4FLVA 4DF4A 1DTTA 4CFDA 1RDBA 2YNIA 4DTPA 1SL0A 3NF7A 4CHNA 1U45A 3IAYA 1BHLA 4JRQA 3SUQA 2HW3A 3TAFA 3KD1E 4KRFA 1Q8IA 3P1GA 4WE1A 3KLGA 3U6FA 1SKWA 3A2FA 3AO4A 3K5LA 4M3YA 3MEDA 2P1JA 2HNZA 4O0JA 1U49A 3ZT1A 4CJLA 5DK5A 4BACA 3AA5X 3DLHA 2D0BA 4N47A 1BIUA 5FDLA 4HHTA 1A5VA 1YVUA 4OKJA 3VQ5A 4XIUA 4ELUA 1L3TA 1ZBFA 2YNGA 4CGDA 1HYSA 2HHTA 1B92A 1JLAA 1Q9XA 1BQMA 3DMJA 3SUNA 4FZYA 1QQCA 2BDPA 4CGJA 4B9UA 3DRRA 3C6UA 4CHOA 1U4BA 1J9AA 4CJSA 3HP6A 1SKRA 4CJ5A 4AILC 1KFSA 4Q0BA 1TK8A 4H4OA 3ZT2A 2HHUA 5J2PA 3S3NA 1S6QA 2HHVA 2VG7A 2ZQBA 1X9SA 1L3UA 1TKTA 2XRIA 4DU3A 4BDPA 5KGWA 5C25A 3OYDA 3ULDA 4DTMA 3SNNA 4OGEA 4CFCA 4DQPA 1RILA 4N56A 1JLBA 3VQCA 2FC0A 3PO5A 4IDKA 4DU1A 3NGYA 4NYNA 4NCBA 2XHBA 1RT5A 2G8KA 3ZCMA 4JS5A 1RDDA 3NGZA 1DTQA 3AVGA 1VSLA 4BWJA 1A5WA 4CJFA 1BL3A 4AH9A 3K58A 4EZ6A 4OGCA 4NYFA 1UA1A 3OS2A 4FW1A 1SL1A 4E7HA 3RMDA 3DRPA 1VSHA 2JLEA 3LPTA 3AA3A 3V1QA 1LAWA 2VG6A 1TK5A 4Z0UA 1JLFA 1Q9YA 3AVNA 1RBRA 3OS0A 1WSGA 1YTAA 4LH5A 5HRPA 5HP1A 4FLWA 3OYMA 4FLYA 2OYQA 3I8DA 1RTDA 1T05A 2GUIA 3BGRA 3OYKA 4RW6A 1D9DA 1B9FA 3EYZA 1VSFA 3LP0A 3KKSA 3EY1A 1CZBA 2VWJA 1HMVA 4Y1CA 4QCLA 3F9KA 1RBSA 5JS1A 3VQ6A 3DM2A 1RTIA 3TAEA 3D45A 3VQPA 4CGGA 1HNVA 4Q5VA 3E01A 3OYIA 4M3WA 3HSTB 3V81A 4B9MA 4Z4GA 3CFRA 5E41A 1VSDA 4OKEA 4FM1A 4AHCA 4DFPA 3DI6A 4ID5A 2Z1GA 4AHUA 2G8FA 2E4LA 3UIQA 4IKFA 4OLBA 4OJRA 4QAGA 4FLTA 1YTUA 4HUFA 2I5JA 1HQUA 3OYAA 3VQ9A 1VSKA 4DTOA 3HO1A 3V9UA 3TI0A 3NE6A 5FRMA 1WSHA 2OPSA 4DSJA 5FROA 3KIOA 3CFOA 4CGFA 4OPKA 4LD0A 4W5QA 4DLEA 4C8LA 2E6MA 3TAQA 4KHSA 5KRTA 1QS4A 3G0ZA 1RT4A 1X9WA 1T03A 2DFFA 4CJWA 4M41A 3AVCA 1CXQA 4QOZB 3ZSVA 1NOYA 1KCFA 1C0TA 4EP5A 1WSFA 2B6AA 1BGXT 3ASMA 2Z1JA 4M45A 2G8UA 5J1EA 2X74A 4B9NA 2YHBA 3PX0A 3MEGA 3L3UA 3NBPA 4ELTA 4FJ5A 1FXXA 2EX3A 4CGHA 1K6YA 3T1AA 3P83D 3VQ4A 3FFIA 3PV8A 4CE9A 1NKEA 3SI6A 1D9FA 4E1NA 3OJUA 1SUQA 2HHWA 4FJXA 1NK4A 3ZSYA 4HCBA 3NF6A 3HVRA 1RT1A 4M3ZA 1BISA 3AVJA 1IKYA 3AVMA 5KTQA 2FBTA 4H8KA 1T7PA 3SQ4A 3SQ1A 1XWLA 3SUOA 4FJ8A 4CEFA 1I3AA 3DYAA 4MFBA 4CEQA 3LWMA 2FBVA 1JLQA 1KSPA 1RNHA 3QETA 3G10A 3ALYA 3RTVA 4KO0A 3KK2A 4DSFA 3TAMA 3AA2A 3DLKA 3QEWA 1C0UA 3OYHA 4E0DA 4FLUA 5HROA 3V9SA 3F73A 1VRTA 3K5MA 2D0AA 3K2PA 3CQ8A 5K14A 3L2UA 4KTQA 4AHTA 1Z25A 3AA4A 2GBZA 4ZHRA 3DRSA 3AVKA 3OYFA 2DFHA 4DFKA 1LWCA 1NOZA 5HRRA 4KKOA 3OYGA 1XC9A 3AVFA 1RT6A 3SJJA 1S1VA 1RBUA 1QTMA 4FK0A 4DMNA 4KHYA 5SWMA 4H4MA 2RKIA 4C8KA 3ZSZA 4CJPA 1I39A 1S1UA 3L2RA 4CK3A 2QXFA 3ZSRA 1L3SA 3TWHA 4FLXA 3TARA 4ELVA 4ICLA 3HT3A 3NGIA 2BGGA 2KW4A 2GV9A 4FJKA 2E6LA 2OZMA 4W5NA 2VG5A 3IRXA 4CEBA 3RMCA 4F3OA 4PA1A 2VWKA 3S3MA 1RBVA 1N6QA 3IG1A 2G8VA 4M42A 4KPYA 1W0HA 2D0CA 3QEXA 3K59A 3C95A 1IG9A 3KD5E 1DLOA 3ZSXA 1JLGA 1XHXA 2QKKA 2XO7A 4KHUA 1LWEA 4FCYA 3DOKA 4YNQA 4DF8A 1GOAA 2B4JA 1CZ9A 3HM9A 1QSSA 4W5TA 4FJ9A 3HPGA 1B9DA 1C1AA 5HBMA 2KZMA 4DLGA 4KTWA 5T7BA 4IBNA 2R7YA 3RWUA 4FM0A 4CJKA 1RCHA 1XHZA 1NJWA 3B6PA 4ZTFA 2IGIA 1BQNA 2WOMA 4DTNA 4L8RB 3SZ2A 1RBTA 2FBXA 5CYMA 3O4QA 4GMJB 2Z1HA 3JYTA 4CHYA 3OS1A 3OYCA 4I9QA 4CJTA 4CJEA 5J2QA 1C6VA 2G8HA 5D3GA 2IDOA 2YKMA 1JLCA 3V9ZA 5FRNA 3LAMA
chains in the Genus database with same CATH superfamily
3KWIA 1GLAG 3HYFA 4NB4A 4IZ9A 4CIFA 4B1VA 3L2QA 1BO5O 2KHOA 2NRWA 5AQPA 1NM1A 3HTVA 3UKRB 2HF3A 4BRHA 3G71N 3TAPA 2PY5A 3MX5A 2FSKA 2Q97A 2KTQA 4BE0A 4K0KK 1S6PA 2BANA 4M3UA 4CEAA 3MN7A 5A2QO 4EP4A 2WUSA 3IFRA 4KAZA 4DV7K 1BCOA 1TGOA 3EN9A 5AZIB 5DM6L 4F8RA 3S9HA 4BRQA 4RWTA 2IAJA 1NK6A 1KLNA 4BDZA 4J8FA 3ULEA 3ZLJA 1OH8A 1IO2A 1EKEA 2RPIA 3OYLA 2AP1A 3VQDA 4LSNA 1HR0K 3WNFA 2NRVA 3MN6A 1QSYA 2O4GA 4UQGA 4CEEA 3C7NA 3QEPA 4PY5A 1N8RO 5LY3A 4CFBA 3CERA 4MQ3A 4DQIA 2OPQA 3QEIA 1QHAA 4FM2A 4LF7K 1ZBIA 1O1WA 1U6ZA 4LSLA 4CBWA 4YOVA 1NKCA 1N32K 3RMBA 4JLHA 3LL3A 5AQLA 3AO3A 3BY5A 2GTDA 3DXMA 4DSLA 4F3TA 3LZJA 4YDUA 4Z4FA 5HOOA 1S3XA 1D5AA 4CZKA 5KGXA 2WTUA 4Y0WA 3RSEA 1KAXA 3L4IA 4BGBA 4E3SA 4CZIA 2UXBK 4KI6A 4FLZA 5GAHP 2YV0X 3TSPA 4N41A 4JD2A 4O8KA 1NU0A 4JI8K 1JLEA 4KHPK 4DQQA 4IG3A 4CIEA 1N5YA 3VQAA 4FW2A 3CETA 2DTUA 4BWMA 4OPJA 5MLCQ 3VF6A 3EZ5A 4WFNL 3VA3A 5CY4A 2D0OA 3AGKA 4YOXA 2G8WA 4XH5A 1LOTB 3BEXA 1GOCA 3QMLA 1BUPA 3MCAB 3K5OA 3WEEB 4CZFA 4KREA 2B5JA 2PYLA 5HRNA 1K9MO 3QNNA 4J2DA 4NCAA 3V1OA 4W5OA 3EO3A 2I7NA 3HP9A 1N36K 3M5RA 4FJMA 2UU9K 3MXMA 4NO7A 3KLHA 4CBXA 1RT2A 4KB0A 4JYAK 4Z4EA 3OVNA 3QLHA 4DV0K 1N34K 1K8KB 3FZKA 2RHKA 4BGAA 2VCPA 1EWRA 2ZWHA 3NCIA 4FYDA 2OA8A 2YHYA 4EHTA 3JSMA 5IWAK 4A61A 3GL1A 3CCQN 3CYMA 1BI4B 3IDHA 3WQTA 1KVCA 3CJ1A 1YAGA 1NGDA 3SUPA 4K8XA 1TVRA 4WYBA 4FJIA 4CHPA 1IBLK 1J54A 3FZLA 3AVLA 3PUFA 3WXMB 3THWB 5GAEP 3EE8A 2V51B 4R5PA 3IS9A 3LP2A 1NGAA 4MLEA 5JLHA 3QESA 5C24A 2ETJA 3MCPA 4CZEA 5DM7L 1GOBA 2KLAA 4Y1DA 4DV2K 2E1ZA 4M3RA 4CF0A 2PYJA 4FXDA 2NUBA 4MO5A 1YHQN 1EXQA 2YNFA 2KZZA 5I9EB 2VGNA 4EIAA 2O8DB 1S5JA 4OKKA 3OYNA 1MA9B 3ID6A 1QHTA 4E7JA 1XMOK 1A5XA 3SV4A 2OPPA 3CMAN 1NJXA 1NK5A 2A1RA 4AHVA 2Q36A 4O5FA 3AO5A 5BPNA 1QE1A 4YHHK 3VQQA 1IBKK 3RMAA 3SYZA 1EWQA 2D4WA 2P9IB 4XH1A 1G99A 2J4RA 1XUPO 1VK0A 3L3VA 1KLMA 2KFZA 4DTRA 1KFDA 4O4GA 5FPDA 4CEDA 3M8RA 5AQMA 4BRLA 3KK3A 5BPMA 3SJHA 3PX4A 1Q86O 1W97L 5M1OA 1IKXA 2JGUA 1RTHA 1RDBA 1SL0A 3NF7A 4DV6K 1XMQK 3IAYA 1Q8IA 1SKWA 1K8KA 4AF1A 4O0JA 4C1NK 3NMUA 1DEJA 4IEIA 5KQDA 4N47A 1BIUA 5FDLA 1A5VA 4XIUA 4ELUA 2YNGA 1JLAA 4CGJA 3HP6A 2F7TA 1K8AO 3D7EO 2QTDA 1S6QA 2HHVA 2ZQBA 5H1SQ 2XRIA 4DU3A 5KGWA 4ISEA 4DTMA 2HOEA 2WFBA 4CFCA 4N56A 3VQCA 2FC0A 3PO5A 3O1BA 1GLLO 2CGJA 4NCBA 4NYNA 5F1XA 3JS6A 1HKGA 4CZMA 1RDDA 1VSLA 2DPNA 4BWJA 5BR9A 1A5WA 4EZ6A 4OGCA 1UA1A 2IIRA 2O8FA 4BR7A 1SL1A 4E7HA 2JLEA 1NGFA 3V1QA 1WB9A 4LF6K 4B1ZA 3A5LC 5HP1A 5HRPA 4LH5A 2H3GX 3OYMA 3I8DA 5IT9O 1B9FA 2ZM6K 1VSFA 3WUHA 1TUUA 2E2OA 4QS7A 1RDUA 4CGGA 3CCUN 1HNVA 2UXCK 3THXA 3V81A 4CJ7A 4OKEA 3VTIA 4FM1A 2HBLA 3DI6A 2Z1GA 4IKFA 2AA4A 3L6QA 4HUFA 1VSKA 3V9UA 1E4FT 5BREA 3KIOA 3I33A 4NLBA 4W5QA 3J7YP 3E9LA 3KHYA 1XQSC 2P9NB 1RT4A 1X9WA 1T03A 3LM9A 1CXQA 1NOYA 2QEXN 4EP5A 5J1EA 2X74A 5BPLA 3GG4A 2P9UB 4ELTA 3VEXA 3TSUA 3SI6A 1D9FA 3ZYYX 5M1FA 2A6AA 4JKGB 1RT1A 3CI5A 4M3ZA 3E66A 1IKYA 3ZX0A 3SQ4A 1XWLA 3LDLA 1I3AA 3C6HA 4BQLA 5E26A 2FBVA 1RNHA 4H03B 4DSFA 2E20A 3TAMA 3DLKA 3QEWA 1T6CA 3V9SA 1VQ9N 4PKIA 3K2PA 2ITMA 5C12A 3H45C 2OCEA 5BN8A 3OYFA 2DFHA 3F5TA 1LWCA 5HRRA 4YOWA 4KKOA 3OYGA 1IBMK 3AVFA 4DR7K 2V7YA 1QTMA 5SWMA 4C8KA 1S1UA 4CK3A 4JKFA 2A41A 3TTFA 1L3SA 4ICLA 2QWMA 1NMDA 3NGIA 4OX9K 4FJKA 4A2BA 4W5NA 3IRXA 2E2NA 4F3OA 1N6QA 3IG1A 4BR2A 3QEXA 3C95A 1JLGA 4JI6K 1XHXA 4H0TB 1JCFA 2QKKA 2XO7A 2FF3B 4FCYA 3DOKA 4DF8A 1GOAA 4W5TA 4MLHA 3VERA 1VQ7N 5EXWA 5AFUA 2WOMA 4L8RB 4I9QA 4CHYA 1C6VA 2G8HA 4DU1A 5FRNA 3ZETB 3WXIA 5GIPA 1C0MA 5AQFA 4FJNA 2GX9A 1NK9A 1KAZA 4IJAA 1NKBA 3LALA 2P51A 4JKDA 4O8UA 4DV1K 5KQ8A 1NJZA 4A2AA 1X3MA 1ILYA 2HVHA 3RVCA 4BROA 2P9UA 1IKVA 1NBWA 4BVPA 3LDSA 3ENHA 5AQJA 1WAJA 3HOTA 3AO2A 3HBTA 4JI7K 1HJOA 3CJAA 2D1KA 1NGBA 3QNOA 2KFNA 3ZT3A 4CD3A 4CF1A 1Y97A 1WSJA 4CJ4A 3CC2N 5BRHA 3UKUB 4FVUA 5AQXA 3PX6A 4F4KA 1U04A 2IVNA 4DS4A 1S1WA 3T3FA 1ASVA 1HYVA 4EFHA 4K8ZA 3K9JA 2QA4N 3CF5L 3ZX3A 2D5RA 3UB5A 5ADXA 3VEWA 4JKBA 4H5WA 4JK8A 2JWLA 3A5OC 1TK0A 3CJ7A 3AO1A 3MXIA 3DLEA 2XY8A 4JK7A 2DFEA 1JCEA 1WSEA 3BUZB 4KHNA 4F2SA 2NRHA 2HB5A 2LSNA 4TSXA 4IO9L 1ZBUA 4Z4IA 1MU2A 4JKAA 2XY6A 3ID8A 1DGKN 2ZD1A 2QW9A 4H5TA 1OH6A 1M90O 1VQ6N 3NFAA 3VA0A 3DOLA 3SCXA 2QK9A 1MWMA 3C7NB 5KPTA 2NRRA 1FW6A 3SV3A 3VQBA 1HLUA 3HPOA 1L5UA 4CIGA 2QKBA 1TYQA 1BCMA 3J8AA 5EVZA 4JRPA 3VN5A 4BRDA 4HVJA 3RR8A 3DWLA 5CHIA 2DY4A 2Q3SA 3TTCA 4JNEA 4B8CA 3NF8A 4DR6K 3BZCA 4GW6A 1GLCG 2W40A 3QINA 5BRFA 4QS8A 3CM5A 3LPUA 3T7ZA 3PIOL 4CVNE 4WQ4A 4YFUA 1NJYA 4B9VA 4KH6A 1X9MA 4CJQA 3RSEB 1U2VA 1KRPA 1C1BA 4JD2B 4Z4HA 4KHQA 2IOCA 1L3VA 3D0PA 3KLIA 3NH0A 4C8OA 2KKZA 1X1PA 3U4LA 1IG8A 3UKUA 5KPZA 4X64K 1T3VA 4RTFD 1BDGA 2O8BA 4B9SA 4RW7A 1IH7A 4PQUA 4OPAA 1SAZA 3WT0A 1WBDA 4DSIA 3LZIA 1ZBHA 1VHXA 4H5RA 1YXQA 4DB3A 4FOIA 1FJGK 1RT3A 1LAVA 4B1XB 3I0RA 4DTJA 1ZC6A 1D8YA 4JV5K 3LANA 3GOIA 4J2BA 4V19S 3DLLL 2KQ2A 4KHWA 5AQOA 1Z6RA 3AVIA 4H0YB 4CK2A 3AVAA 4JEPA 4GKKK 3VEOA 1YVNA 2QWPA 2Q1NA 3HJFA 2HHXA 1YJWN 2PZSA 4CI6A 4FJJA 4WQ5C 2O8CA 1J5EK 4O44A 4H0XB 4B9QA 3O5BA 4O55A 3OTOK 4IFEA 3QEVA 2IVPA 4JI1K 3VQ8A 4DCHA 1TAUA 4FK4A 1VQMN 4DTXA 4I2QA 4M63C 4JS4A 5JS2A 3OJSA 3O4NA 1QSLA 4CERA 2UXDK 3O3GA 1KVBA 4FJGA 4KB1A 4DFJA 4Z94A 4FK2A 4J2EA 3CIPA 3U9DA 4BR4A 4E1JA 1HPZA 3AY9A 4IXCA 4EZ9A 3QIPA 3HOSA 2YKNA 2XY5A 1JL1A 4E89A 3AVBA 1X3NA 4FJLA 1LV5A 3ZEUA 1X9JA 4BC3A 3BF1A 2WONA 3NVMA 1FK9A 2P9LB 3RRGA 5AQSA 1UWBA 1J53A 1TV6A 3SQ2A 3P39A 1XI1A 2IC3A 2E2PA 2VWBA 1VQNN 1Z26A 4DF4A 4B3MK 5AQRA 4DTPA 3L4QA 3F2KA 1BHLA 3SUQA 3TAFA 4WE1A 3K0SA 3KLGA 3U6FA 4M3YA 3MEDA 1U49A 2QXLA 1BA0A 3DLHA 1VQKN 2D0BA 4JI2K 4A62A 1YVUA 4KH4A 3TSQA 2ZJPL 1HYSA 1ZBFA 5AZJB 4CGDA 5AQNA 4GV6A 2W6KA 3DMJA 2BDPA 1ATSA 4BVOA 1J9AA 1SKRA 2QWRA 1KFSA 4H4OA 1X9SA 4BR5A 4BDPA 3ULDA 3SAHA 4DQPA 1RILA 5LMUK 2G8KA 3BF3A 2VGMA 4NXNK 4CJFA 3K58A 4NYFA 3H1VX 3LPTA 3BP8A 1KAYA 3AARA 1NMNA 2VG6A 1WOQA 1JLFA 4C1NI 1Q9YA 5M1QA 1GLJO 4FLWA 3LDPA 1BOTO 4H0OA 1T05A 1JJ2M 4DR2K 3EYZA 1YF5L 3KKSA 4IWVA 3EY1A 4Y1CA 3F9KA 1RBSA 1RTIA 3VQPA 3O9UA 3N4PA 1EQYA 4M3WA 5TKYA 4B9MA 4Z4GA 1W2BM 2VQEK 4DFPA 2FXUA 4ID5A 2O8FB 3UIQA 4OLBA 4I6MB 1HQUA 2A5XA 4FWRA 1KXPA 3VQ9A 4OPHA 2P9LA 4DSJA 3CFOA 4KH5A 3IKMA 3TAQA 2YHXA 3FFKB 2A40A 3ZSVA 4YOTA 2B6AA 3CCSN 2G8UA 2Z1JA 3THXB 2YHBA 3SBTA 3MEGA 4U7BA 3L3UA 3NBPA 4H5VA 2D0PA 1HNZK 3T1AA 3FE1A 3VQ4A 3FFIA 3T1YK 3ATUA 4HCBA 3ZSYA 5AZJA 3EL2A 2FBTA 4H8KA 1T7PA 3LWMA 3G10A 4KO0A 5LL6Z 4E0DA 5M1KA 3F73A 3K5MA 3EKSA 4BRIA 4FWPA 3AVKA 3D2EB 3SJJA 1S1VA 4FK0A 5AQYA 4DMNA 2CH5A 4H4MA 2RKIA 1V4SA 3DXKA 3R8EA 3FLCO 5M1NA 5AQIA 4K42A 3NVKA 4FLXA 4JHDB 4ELVA 1HNXK 2GV9A 2OZMA 4PA1A 2VWKA 2Q0UA 3S3MA 4M42A 3OBYA 4KPYA 3O9QA 1W0HA 5AQQA 1C0FA 1IV0A 4WCEL 4CD1A 1KC8O 4XEIA 4KHUA 3LDNA 5AJ3K 1CZ9A 4FWMA 3HPGA 2KZMA 5HBMA 4DLGA 2FSNA 5TKWA 2F9WA 3O6WA 4BRAA 1D4XA 4I6MA 3B6PA 1NJWA 1BQNA 1RBTA 4FL9A 3O4QA 3J7ZO 5J2QA 2YJEA 4CJEA 3DJCA 3V9ZA 3LAMA 3EZWA 2VYPA 2Q2RA 4BG8A 4E7IA 5C15A 1JKHA 4DV5K 3OYBA 4LFBK 4CCHA 1WBBA 3F9MA 1FKPA 4IO8A 3CCLN 4DG1A 3V9WA 4NCGA 3CJCA 1C1CA 3BDPA 4FZXC 4O5BA 5AQZA 4DQRA 1IKWA 3V4IA 3HL8A 3OY9A 1VSIA 3O3FA 3SMPA 2F8SA 3AGRA 3VQEA 1HKBA 3KK1A 3MK6A 3B8AX 3QFUA 4L3QA 3ENOA 5C2FA 4LC9B 3ZSQA 1HYZA 1TKZA 5ADXH 4OLAA 1EP4A 1ESVA 4CHZA 3DLRA 4M3TA 4U67L 3RR7A 4IDHA 4IFYA 3MECA 4DR1K 3L2WA 4DQSA 4JI3K 3AAQA 4OVLA 4CJVA 4M3XA 4DR5K 3D2EA 4JN4A 3TR8A 4DWIA 1LWFA 4DFMA 1GLFO 3QB0A 4CJ3A 4JHDA 4HUEA 3CFPA 3VPZA 3LDOA 1QQNA 3FZFA 4RW4A 1HUXA 1RFQA 1I94K 2Z1IA 3O3HA 3CG7A 4I9LA 3C6TA 4KTZA 2HBMA 5AR0A 3M8SA 2YHAA 3P5JA 4IFVA 3QBXA 4ZTJA 3S3OA 5DMRA 2CGLA 1BU6O 3Q7BA 1Q81O 2W6LA 3UE5A 1NGIA 4BY9C 2ZGZA 1CXUA 4AHSA 3O1WA 3CC4N 2A3ZA 5ELZA 4XH4A 4CW7B 4QS9A 4CK1A 3V6DA 4B9TA 1UA0A 1KTQA 4DU4A 3NF9A 5HLFA 1HNWK 1CZAN 2ASMA 2F96A 5LJWA 5E84A 1ZYQA 1TAQA 1ATNA 1NJIO 3VQ7A 1TYQB 4AHRA 4DTUA 1RTJA 1NK8A 1VSEA 1P8ZA 1WSIA 1T6DA 4CZGA 1WN7A 2ASPA 3VEYA 1EO1A 1S9EA 3MN5A 1R0AA 4DSEA 4DSKA 1SKSA 3LP1A 1ZBLA 4RCHA 4B1UB 4RG8A 4BRKA 1TKXA 3FZMA 4A59A 2GWJA 3JAMO 4G1QA 3U8XA 2HNYA 4CGIA 3PSIA 3O9SA 4CJUA 3TTDA 3DLBA 1WLJA 4N76A 3E1YA 1U2VB 2FSJA 4CECA 1GLBG 1ATRA 1P90A 2HMIA 1NK0A 2PFUA 2HMPA 5CR4A 3P4IA 3TANA 3K5NA 4BREA 2Y1JA 3RRHA 4HCCA 3OYEA 3U3YA 2HF4A 4AQYK 2QWQA 2O8BB 1BIZA 3QIOA 3FR0A 1DT9A 3QO9A 4DS5A 3QFPA 3M8QA 4HTUA 2ITGA 1WAFA 5CYQA 4J2AA 2G8IA 3HZ6A 3KLEA 3M1FA 4B3OA 4DV4K 1GLEG 2RN2A 1YIJN 4DTSA 1NNEA 4FZZA 3LP3A 3QICA 4MDAA 1VQ8N 4RW8A 2YI1A 1SZ2A 4IEEA 3QDKA 3TU5A 3L8BA 1T8EA 1S9GA 2Q0RA 1RT7A 3VGLA 4GNIA 3V1RA 3ISNC 1VQLN 1YI2N 2GWKA 1S1TA 1LW2A 4B3RK 4CJRA 1EX4A 1ITGA 3ZX2A 2O8CB 3HPHA 5EX5A 2NZTA 2HNDA 4PUOA 5KI6A 4HUGA 3HXMA 2QWNA 3EKUA 4OO1J 4GY2B 1YUWA 4CEOA 3ZT4A 2NRTA 1SV5A 4ID1A 3CCRN 3WNHA 1W9HA 1YT3A 1UOCA 1HPMA 4CZHA 5SZTA 5J2NA 1TKDA 4F2RA 2YNIA 3H3OB 4CHNA 2JWKA 2HW3A 3KD1E 4KRFA 2ZJRL 3S41A 3K5LA 2P1JA 1KD1O 1Q18A 3ZT1A 3VF4A 4FWKA 4AM7A 4OKJA 5F2RA 3WXKA 2RE2A 1H1VA 1L3TA 2HHTA 1B92A 3ZEUB 4ISGA 3C6AA 1XC3A 4GVEA 1JCGA 1QQCA 2OTLN 4B9UA 3DRRA 1U4BA 2P9SB 4FOEA 4CJSA 4CJ5A 2BTFA 3EE9A 1V4TA 3ZT2A 5LJVA 5J2PA 1HX1A 3S3NA 3BZKA 1M1KO 1SS6A 5C25A 5C2DA 4IDKA 1RT5A 3ZCMA 4JS5A 3NGZA 1XNRK 4FO0A 2BUPA 4AH9A 3L0QA 4BC4A 3OS2A 4ILHA 2O8EB 3DRPA 1VSHA 1OVQA 3CPEA 4GV9A 3D2FA 1LAWA 3THYA 1VQON 1TK5A 5JVGL 3O80A 5GAGP 1WSGA 5BN9A 4FLYA 4MDBA 3VETA 4YDUC 1RTDA 1D9DA 3BGRA 4DUYK 4RW6A 2YHWA 5KPRA 2VWJA 3VQ6A 3DM2A 5AQGA 3D45A 4BRPA 3CFRA 5E41A 1VSDA 2ZJQL 3CXCM 4AHCA 4AHUA 2G8FA 4ILJA 2UUAK 5FLXO 2ASOA 4FLTA 1KQSM 3A5NC 3NE6A 3KZBA 5FROA 4OPKA 1NG9A 5FPMA 4LD0A 4DLEA 4C8LA 2P9KA 2E6MA 4KHSA 5KRTA 1QS4A 2QWOA 1OVYA 3AVCA 3MN9A 1R59O 1MWKA 4QOZB 3M6GA 2E2QA 1BGXT 3ASMA 4EAHD 3PX0A 4YOUA 5AQVA 1N33K 4FJ5A 4FPBA 1FXXA 3QBWA 4CGHA 3P83D 4LF4K 4DV3K 3ATVA 4E1NA 2HHWA 4FJXA 3HM8A 3NF6A 1E3MA 2QI2A 2GEMA 4FWNA 3AVMA 3SQ1A 3VF2A 3SUOA 1Q82O 4CEFA 4FJ8A 5C0YA 4CEQA 4UY8O 2P9SA 3ALYA 3KK2A 3PSFA 3OYHA 4FLUA 1J6ZA 4FWOA 5HROA 4F9OA 1YITN 1VRTA 3A0IX 3CCJN 4KTQA 4ISFA 4AHTA 4IJNA 1Z25A 3AA4A 1ZXOA 4CBUA 2NRXA 1RBUA 4DKWA 4CZJA 1S22A 4KHYA 2O8EA 4M7YA 3L2RA 1VQ5N 3ZSRA 4B3SK 3G6EN 3TARA 2NLXA 1SQKA 4WQ5A 2KW4A 4DR3K 2E6LA 3RMCA 4CEBA 1VQPN 2G8VA 3VEZA 5BRDA 3J81O 4FWQA 3LDQA 2NRZA 1IG9A 4BR0A 1O13A 3ZSXA 3UKRA 5GIOA 1YJ9N 4MO4A 4YNQA 2OANA 3VOVA 4JKEA 2B4JA 3MWTA 4WF9L 3HM9A 4FJ9A 4JI4K 1QZ6A 1C1AA 4KTWA 5T7BA 2NNWA 4IBNA 4PKHA 5AZIA 2R7YA 3RWUA 2GUPA 3DXKB 4FM0A 1XHZA 2IGIA 4DTNA 4G9ZA 3SZ2A 4IOCL 3JYTA 4GMJB 2Z1HA 4BRFA 3OS1A 3OYCA 5EOYA 5D3GA 4DQ8A 2YKMA 2HVIA 3OW2M 1NGEA 2BH1A 3AV9A 3KKRA 4AM6A 4Z4CA 4NLCA 3MXJA 4X62K 2UUBK 2YNHA 3VESA 4BDYA 4E1MA 2E1YA 1S1XA 4W5RA 2IS3A 4CHQA 5JVHL 1HNIA 1NGHA 2UYTA 2CH6A 5LMNK 4JAXA 3PO4A 3AVHA 3T19A 5I42A 4KV8A 3U3GA 1Q7YO 2HBKA 3HK2A 1F21A 1VSMA 4WFBL 4H5NA 4DHYA 4PHTX 3LWLA 3VTHA 2X6NA 3SMSA 4H0PA 1EETA 3WQUA 4N5SA 4PWDA 4I2PA 3EEQA 1BA1A 5CZ2A 2A1SA 4IOXA 3R9PA 4JI5K 3C65A 4CF8A 1ASWA 4B1YB 3PY8A 3B6OA 4RW9A 4X66K 4LY7A 1HQEA 3SPYA 3CM6A 1LW0A 1VRUA 1KVAA 3KLFA 4IOAL 1HRHA 3IUCA 4CFAA 5CE3A 4KI4A 2P9PB 2V7ZA 3NDKA 3O08A 4A5BA 4BR9A 1QQOA 4K41A 4LF8K 2YJFA 5J2MA 2PAVA 3ZSOA 4BG9A 2WC9A 1TUYA 4I7FA 3LM2A 1T44A 2P5OA 3I55N 3AAPA 3KJVA 3SPZA 4CF2A 2F8TA 3R1XA 3CCMN 4JKCA 2AJQA 3HRGA 4YORA 3WEEA 3KTQA 4B8AB 2UUCK 5BR8K 2Y1IA 4GV3A 2W41A 3ZT0A 3GDQA 3NH1A 3WNGA 4R79A 1J5OA 3ITHA 2FBYA 3D6RA 4BC2A 5FPNA 4BE1A 4FJHA 1VQ4N 3I56N 3NH2A 2YX6A 3M8PA 1ASUA 4C8NA 5AFUH 1S72N 4B9LA 2EWSA 4LH4A 3W0LA 1BI4A 3THVA 4CZLA 3TABA 3MDQA 2EHGA 3QERA 1CLQA 1DKGD 1TL3A 1VSJA 2F9TA 1QVFM 3OA9A 3THWA 1ZBSA 2YCHA 1HJRA 4CF9A 1U47A 2HHSA 4FJ7A 3HSCA 5AQWA 4E19A 4BE2A 3U9ZA 1JXEA 3I0SA 4PL8A 4E7LA 1NLVA 2FLOA 4O0IA 3K9KA 4A5AA 3PIPL 1REVA 3MEEA 2BE2A 1TL1A 4IG0A 1G15A 3VEVA 1RDCA 3HVTA 5HRSA 4PKGA 3NHGA 4LF9K 3OBWA 3VGMA 4KFBA 2OPRA 2O8DA 5C10A 2RF2A 4CEZA 1VAZA 2X78A 4GKJK 5JICA 2OZSA 3O8MA 1RGIA 2F4VK 3O9RA 3OYJA 5EU7A 4B08A 2XY7A 2P9PA 1RDAA 2X6SA 3CJBA 4BC5A 3W3DA 5CZ1A 3M3ZA 1QZ5A 3O4WA 3SQ0A 4FVMA 5I3UA 3LAKA 4C23A 1WNSA 2O4IA 1UAXA 3V9XA 2P9IA 3CPWM 4FPAA 1U48A 2ATQA 4CESA 3L2VA 4JKHA 3DLGA 1NK7A 3NAEA 2W42A 4ILGB 3H08A 2V52B 3PLAA 3DAWA 3TAGA 2IVOA 4GVMA 2P5GA 3ZSWA 3C94A 4C8MA 1JL2A 1JXBA 4FSVA 1FKOA 2E8AA 3CJ9A 3K57A 2HHQA 3WNEA 4LFAK 1MDUB 2ZGYA 2ZE2A 1SL2A 1NGJA 1OH5A 5GINA 3SK3A 5C42A 3C0BA 1OKJA 3IMXA 3CMEN 3E9OA 5KRSA 3P31A 3MAQA 4BRGA 1HKCA 3G4SN 1NGGA 3HI0A 4E7KA 4FLVA 1DTTA 4CFDA 5FPEA 3CCVN 3H6EA 1U45A 4B3TK 4JRQA 3P1GA 3A2FA 3AO4A 2HNZA 4CJLA 5DK5A 4BACA 3AA5X 2PBDA 1OH7A 3T69A 4HHTA 3VQ5A 1Q9XA 1BQMA 3SUNA 4FZYA 4M7XA 3C6UA 4CHOA 1WUAA 3H46O 3MWPA 4FWSA 3JXUA 1RDWX 4BRMA 4K43A 4AILC 1TK8A 4Q0BA 2HHUA 1NWKA 2VG7A 1L3UA 1TKTA 1W7AA 5JMVA 3OYDA 3H1QA 3SNNA 4OGEA 4DUZK 5HL7L 1JLBA 1BWFO 3G25A 1C0GA 3NGYA 2XHBA 1DTQA 3AVGA 4HTLA 1BL3A 3R6MA 4FW1A 3O9TA 4A57A 3RMDA 4BRCA 4B1WB 4NXMK 3CQYA 5AQHA 3AA3A 3H3NO 5GADP 3KWGA 1XNQK 4Z0UA 3AVNA 1RBRA 3OS0A 1YTAA 4LF5K 4BQZA 2OYQA 5AQUA 5F0XA 2HSTA 4X65K 2GUIA 3OYKA 3VGKA 4K25A 3CD6N 2P9NA 3LP0A 3Q7CA 1CZBA 1HMVA 4QCLA 3SAGA 5JS1A 3TAEA 3J7AP 2GELA 4Q5VA 3E01A 3OYIA 3HSTB 3CCEN 2E4LA 4BRNA 2E88A 1Y64A 3N4QA 3J80O 4OJRA 4QAGA 1YTUA 4JKGA 3D2FB 3THYB 2I5JA 4JI0K 4FWLA 3OYAA 4H0VB 4DTOA 3HO1A 3TI0A 4YY3K 5FRMA 3A5MC 1WSHA 2OPSA 2QM1A 4CGFA 3G0ZA 3TPQA 2DFFA 4WQ4C 2QWLA 4CJWA 3SAFA 4M41A 2CGKA 1KCFA 1C0TA 1WSFA 4M45A 2Q31A 4B9NA 3GBTA 3KVGA 2EX3A 4YOYA 1K6YA 4WFAL 3PV8A 2I7PA 3SLCA 4CE9A 1NKEA 3CHWA 2HHHK 3FZHA 3OJUA 1SUQA 5M1PA 2ZF5O 1NK4A 3T1HK 3HVRA 2WBNA 1BISA 3ULEB 3AVJA 5KTQA 3DYAA 1IJJA 4MFBA 1KSPA 1JLQA 3QETA 3RTVA 3OHRA 2FF6A 3VMFB 2P9KB 3AA2A 1C0UA 3P38A 1Z05A 3KK7A 2D0AA 3VENA 3CQ8A 4LFCK 5K14A 3L2UA 1YJNN 5EY4A 3WXLA 3CQXA 2GBZA 4ZHRA 3DRSA 4DFKA 1XC9A 1NOZA 1QQMA 3FGUA 1RT6A 2A42A 2HBJA 3I8BA 3ZSZA 4CJPA 1I39A 2QXFA 4KBOA 3TWHA 3SBGA 3HT3A 2VQFK 3CC7N 2BGGA 2OTJN 4EHUA 1E4GT 2VG5A 3ZETA 1RBVA 5AQTA 3MMVA 1K73O 2D0CA 3DXMB 3E9PA 4DR4K 3K59A 3KD5E 1DLOA 2E5LK 3GE1A 4JK9A 5B8HA 1LWEA 3MX2A 1BG3A 1QSSA 3A8YA 1QVGM 5AQKA 1B9DA 4HWIA 3ENBA 1LCUA 4CJKA 1RCHA 4ZTFA 3R3LA 2FBXA 1NGCA 5CYMA 5JLFA 1GLDG 4CJTA 4PL7A 2IDOA 1JLCA 3WXJA
chains in the Genus database with same CATH topology
2HVIA 1C0MA 4FJNA 3HYFA 1NK9A 3AV9A 3KKRA 4CIFA 4E7IA 3L2QA 4Z4CA 1NKBA 3MXJA 1JKHA 2YNHA 3LALA 2P51A 3OYBA 4CCHA 3TAPA 1NJZA 1FKPA 4BDYA 2PY5A 4DG1A 4E1MA 2KTQA 1S1XA 4W5RA 4NCGA 4BE0A 3V9WA 1C1CA 2IS3A 4CHQA 3BDPA 2HVHA 1HNIA 1S6PA 4FZXC 2BANA 4M3UA 1IKVA 4CEAA 3LDSA 4O5BA 3PO4A 3AVHA 4EP4A 3T19A 1WAJA 5I42A 4KAZA 4KV8A 1BCOA 1TGOA 3AO2A 3U3GA 1IKWA 4DQRA 4DQIA 4F8RA 3S9HA 3V4IA 2IAJA 3HL8A 3OY9A 1NK6A 1VSIA 1KLNA 3O3FA 4BDZA 3HK2A 2F8SA 3QNOA 1F21A 1VSMA 3VQEA 2KFNA 1IO2A 1EKEA 2RPIA 3ZT3A 3OYLA 4CF1A 3KK1A 3VQDA 1Y97A 1WSJA 2X6NA 4CJ4A 4LSNA 3WNFA 3PX6A 4F4KA 1QSYA 1U04A 1EETA 2O4GA 3ZSQA 1HYZA 1TKZA 4DS4A 1S1WA 4N5SA 4PWDA 3T3FA 1EP4A 4I2PA 1ASVA 1HYVA 4OLAA 5CZ2A 4CHZA 4UQGA 2A1SA 4K8ZA 3DLRA 4CEEA 4M3TA 3RR7A 4IFYA 3MECA 3L2WA 4DQSA 4CF8A 1ASWA 4PY5A 3QEPA 2D5RA 4OVLA 4CJVA 3PY8A 4M3XA 3B6OA 3TR8A 1TK0A 4CFBA 3AO1A 4RW9A 3MXIA 3DLEA 4LY7A 4MQ3A 1HQEA 2XY8A 3SPYA 4DWIA 1LWFA 2DFEA 3CM6A 1LW0A 1VRUA 2OPQA 4DFMA 3QEIA 1KVAA 4FM2A 3KLFA 1HRHA 1WSEA 4CFAA 4KHNA 1O1WA 1ZBIA 4LSLA 4CJ3A 4F2SA 2HB5A 2LSNA 3NDKA 1NKCA 4KI4A 4HUEA 4TSXA 3RMBA 1ZBUA 3CFPA 4Z4IA 1MU2A 2XY6A 4JLHA 5J2MA 4RW4A 3ZSOA 2ZD1A 2Z1IA 3O3HA 3CG7A 3AO3A 4I7FA 4I9LA 3C6TA 2P5OA 3NFAA 4DSLA 4KTZA 3KJVA 4CF2A 3VA0A 3DOLA 3SPZA 2F8TA 3SCXA 2QK9A 3M8SA 2YHAA 3P5JA 4F3TA 4IFVA 3LZJA 3SV3A 3VQBA 2AJQA 3HPOA 4ZTJA 4Z4FA 3S3OA 5DMRA 1L5UA 3KTQA 4B8AB 1D5AA 5KGXA 2Y1IA 4CIGA 2QKBA 4E3SA 3ZT0A 4KI6A 3NH1A 1BCMA 4FLZA 3WNGA 2YV0X 4N41A 4JRPA 1J5OA 3VN5A 3ITHA 1CXUA 2FBYA 4HVJA 4AHSA 1JLEA 3RR8A 4DQQA 4IG3A 2DY4A 4BE1A 4CIEA 1N5YA 2Q3SA 3VQAA 4FJHA 4FW2A 4B8CA 3NF8A 2DTUA 4BWMA 4OPJA 3NH2A 4CK1A 4GW6A 3M8PA 3EZ5A 3VA3A 3V6DA 1ASUA 5CY4A 4B9TA 3QINA 2G8WA 1UA0A 3CM5A 3LPUA 1KTQA 4C8NA 4DU4A 1GOCA 3NF9A 4B9LA 5HLFA 4LH4A 3K5OA 1BI4A 3THVA 4YFUA 2F96A 2B5JA 1NJYA 5HRNA 2PYLA 3QNNA 4B9VA 4J2DA 4NCAA 1ZYQA 1X9MA 1TAQA 3TABA 2EHGA 3V1OA 3VQ7A 4CJQA 4W5OA 3QERA 4AHRA 1CLQA 4DTUA 1RTJA 3HP9A 1VSJA 1TL3A 1VSEA 1NK8A 1KRPA 4FJMA 1C1BA 3MXMA 4Z4HA 4KHQA 3KLHA 2IOCA 1L3VA 3D0PA 1HJRA 1RT2A 1WSIA 3KLIA 4CF9A 1U47A 1WN7A 4KB0A 4FJ7A 2HHSA 3NH0A 3OVNA 4C8OA 3QLHA 4E19A 4BE2A 4Z4EA 1S9EA 1X1PA 1R0AA 1JXEA 3I0SA 4DSEA 4DSKA 1SKSA 3LP1A 4E7LA 1ZBLA 3NCIA 4RG8A 1TKXA 2OA8A 4RW7A 4O0IA 4B9SA 4FYDA 1IH7A 3JSMA 1REVA 4PQUA 3MEEA 4G1QA 2BE2A 1TL1A 4DSIA 3LZIA 2HNYA 1ZBHA 4IG0A 4CGIA 1G15A 3CYMA 1BI4B 1RDCA 1KVCA 3HVTA 5HRSA 3SUPA 4CJUA 1RT3A 1LAVA 3NHGA 3DLBA 3I0RA 1WLJA 4K8XA 1TVRA 4KFBA 2OPRA 4DTJA 4FJIA 2RF2A 4CHPA 4N76A 4CEZA 1D8YA 3LANA 1J54A 4CECA 3AVLA 3PUFA 4J2BA 2X78A 2OZSA 2HMIA 1NK0A 4KREA 3OYJA 5EU7A 4B08A 4R5PA 2XY7A 1RDAA 3K5NA 3TANA 2KQ2A 3IS9A 3LP2A 2Y1JA 2X6SA 4CK2A 3AVIA 3QESA 4KHWA 5C24A 3RRHA 4HCCA 3OYEA 3AVAA 2ETJA 3U3YA 1BIZA 3QIOA 5CZ1A 3SQ0A 1GOBA 4FVMA 5I3UA 3QO9A 4Y1DA 4DS5A 3HJFA 3LAKA 4M3RA 2HHXA 2PZSA 1WNSA 4CF0A 2O4IA 1UAXA 4FJJA 2PYJA 3M8QA 4HTUA 2ITGA 3V9XA 2NUBA 4O44A 4FXDA 1WAFA 5CYQA 1U48A 4J2AA 2G8IA 3KLEA 4B3OA 2ATQA 4CESA 4O55A 1EXQA 2RN2A 3DLGA 3L2VA 4DTSA 3QEVA 4FZZA 2YNFA 3VQ8A 1TAUA 3LP3A 1NK7A 2KZZA 3NAEA 4FK4A 4DTXA 4RW8A 2W42A 4I2QA 4JS4A 1S5JA 4OKKA 5JS2A 3H08A 3OYNA 3OJSA 3O4NA 3LWLA 3TAGA 1QHTA 3L8BA 1QSLA 4CERA 1T8EA 3O3GA 4GVMA 4E7JA 2P5GA 1A5XA 1S9GA 3SV4A 1KVBA 2OPPA 3ZSWA 1RT7A 3C94A 4FJGA 4DFJA 1NJXA 4KB1A 1NK5A 4FK2A 2A1RA 4AHVA 4J2EA 3V1RA 3ISNC 4C8MA 1JL2A 1JXBA 3AO5A 1QE1A 1S1TA 3VQQA 1FKOA 1LW2A 1HPZA 3RMAA 4CJRA 4EZ9A 3SYZA 1EX4A 1ITGA 3QIPA 3K57A 2HHQA 3WNEA 2YKNA 2ZE2A 2XY5A 3HPHA 1JL1A 2HNDA 4E89A 3AVBA 1SL2A 4FJLA 4PUOA 1VK0A 3L3VA 5KI6A 5C42A 1KLMA 4HUGA 3HXMA 1LV5A 2KFZA 4DTRA 1KFDA 4O4GA 4CEOA 2WONA 5KRSA 3ZT4A 4CEDA 1FK9A 3M8RA 3KK3A 3MAQA 3RRGA 1SV5A 4ID1A 3PX4A 1UWBA 1J53A 3WNHA 1TV6A 3SQ2A 1W9HA 1YT3A 1UOCA 1XI1A 2IC3A 1IKXA 2JGUA 5SZTA 5J2NA 4E7KA 1TKDA 4F2RA 1RTHA 1Z26A 4FLVA 4DF4A 1DTTA 4CFDA 1RDBA 2YNIA 4DTPA 1SL0A 3NF7A 4CHNA 1U45A 3IAYA 1BHLA 4JRQA 3SUQA 2HW3A 3TAFA 3KD1E 4KRFA 1Q8IA 3P1GA 4WE1A 3KLGA 3U6FA 1SKWA 3A2FA 3AO4A 3K5LA 4M3YA 3MEDA 2P1JA 2HNZA 4O0JA 1U49A 3ZT1A 4CJLA 5DK5A 4BACA 3AA5X 3DLHA 2D0BA 4N47A 1BIUA 5FDLA 4HHTA 1A5VA 1YVUA 4OKJA 3VQ5A 4XIUA 4ELUA 1L3TA 1ZBFA 2YNGA 4CGDA 1HYSA 2HHTA 1B92A 1JLAA 1Q9XA 1BQMA 3DMJA 3SUNA 4FZYA 1QQCA 2BDPA 4CGJA 4B9UA 3DRRA 3C6UA 4CHOA 1U4BA 1J9AA 4CJSA 3HP6A 1SKRA 4CJ5A 4AILC 1KFSA 4Q0BA 1TK8A 4H4OA 3ZT2A 2HHUA 5J2PA 3S3NA 1S6QA 2HHVA 2VG7A 2ZQBA 1X9SA 1L3UA 1TKTA 2XRIA 4DU3A 4BDPA 5KGWA 5C25A 3OYDA 3ULDA 4DTMA 3SNNA 4OGEA 4CFCA 4DQPA 1RILA 4N56A 1JLBA 3VQCA 2FC0A 3PO5A 4IDKA 4DU1A 3NGYA 4NYNA 4NCBA 2XHBA 1RT5A 2G8KA 3ZCMA 4JS5A 1RDDA 3NGZA 1DTQA 3AVGA 1VSLA 4BWJA 1A5WA 4CJFA 1BL3A 4AH9A 3K58A 4EZ6A 4OGCA 4NYFA 1UA1A 3OS2A 4FW1A 1SL1A 4E7HA 3RMDA 3DRPA 1VSHA 2JLEA 3LPTA 3AA3A 3V1QA 1LAWA 2VG6A 1TK5A 4Z0UA 1JLFA 1Q9YA 3AVNA 1RBRA 3OS0A 1WSGA 1YTAA 4LH5A 5HRPA 5HP1A 4FLWA 3OYMA 4FLYA 2OYQA 3I8DA 1RTDA 1T05A 2GUIA 3BGRA 3OYKA 4RW6A 1D9DA 1B9FA 3EYZA 1VSFA 3LP0A 3KKSA 3EY1A 1CZBA 2VWJA 1HMVA 4Y1CA 4QCLA 3F9KA 1RBSA 5JS1A 3VQ6A 3DM2A 1RTIA 3TAEA 3D45A 3VQPA 4CGGA 1HNVA 4Q5VA 3E01A 3OYIA 4M3WA 3HSTB 3V81A 4B9MA 4Z4GA 3CFRA 5E41A 1VSDA 4OKEA 4FM1A 4AHCA 4DFPA 3DI6A 4ID5A 2Z1GA 4AHUA 2G8FA 2E4LA 3UIQA 4IKFA 4OLBA 4OJRA 4QAGA 4FLTA 1YTUA 4HUFA 2I5JA 1HQUA 3OYAA 3VQ9A 1VSKA 4DTOA 3HO1A 3V9UA 3TI0A 3NE6A 5FRMA 1WSHA 2OPSA 4DSJA 5FROA 3KIOA 3CFOA 4CGFA 4OPKA 4LD0A 4W5QA 4DLEA 4C8LA 2E6MA 3TAQA 4KHSA 5KRTA 1QS4A 3G0ZA 1RT4A 1X9WA 1T03A 2DFFA 4CJWA 4M41A 3AVCA 1CXQA 4QOZB 3ZSVA 1NOYA 1KCFA 1C0TA 4EP5A 1WSFA 2B6AA 1BGXT 3ASMA 2Z1JA 4M45A 2G8UA 5J1EA 2X74A 4B9NA 2YHBA 3PX0A 3MEGA 3L3UA 3NBPA 4ELTA 4FJ5A 1FXXA 2EX3A 4CGHA 1K6YA 3T1AA 3P83D 3VQ4A 3FFIA 3PV8A 4CE9A 1NKEA 3SI6A 1D9FA 4E1NA 3OJUA 1SUQA 2HHWA 4FJXA 1NK4A 3ZSYA 4HCBA 3NF6A 3HVRA 1RT1A 4M3ZA 1BISA 3AVJA 1IKYA 3AVMA 5KTQA 2FBTA 4H8KA 1T7PA 3SQ4A 3SQ1A 1XWLA 3SUOA 4FJ8A 4CEFA 1I3AA 3DYAA 4MFBA 4CEQA 3LWMA 2FBVA 1JLQA 1KSPA 1RNHA 3QETA 3G10A 3ALYA 3RTVA 4KO0A 3KK2A 4DSFA 3TAMA 3AA2A 3DLKA 3QEWA 1C0UA 3OYHA 4E0DA 4FLUA 5HROA 3V9SA 3F73A 1VRTA 3K5MA 2D0AA 3K2PA 3CQ8A 5K14A 3L2UA 4KTQA 4AHTA 1Z25A 3AA4A 2GBZA 4ZHRA 3DRSA 3AVKA 3OYFA 2DFHA 4DFKA 1LWCA 1NOZA 5HRRA 4KKOA 3OYGA 1XC9A 3AVFA 1RT6A 3SJJA 1S1VA 1RBUA 1QTMA 4FK0A 4DMNA 4KHYA 5SWMA 4H4MA 2RKIA 4C8KA 3ZSZA 4CJPA 1I39A 1S1UA 3L2RA 4CK3A 2QXFA 3ZSRA 1L3SA 3TWHA 4FLXA 3TARA 4ELVA 4ICLA 3HT3A 3NGIA 2BGGA 2KW4A 2GV9A 4FJKA 2E6LA 2OZMA 4W5NA 2VG5A 3IRXA 4CEBA 3RMCA 4F3OA 4PA1A 2VWKA 3S3MA 1RBVA 1N6QA 3IG1A 2G8VA 4M42A 4KPYA 1W0HA 2D0CA 3QEXA 3K59A 3C95A 1IG9A 3KD5E 1DLOA 3ZSXA 1JLGA 1XHXA 2QKKA 2XO7A 4KHUA 1LWEA 4FCYA 3DOKA 4YNQA 4DF8A 1GOAA 2B4JA 1CZ9A 3HM9A 1QSSA 4W5TA 4FJ9A 3HPGA 1B9DA 1C1AA 5HBMA 2KZMA 4DLGA 4KTWA 5T7BA 4IBNA 2R7YA 3RWUA 4FM0A 4CJKA 1RCHA 1XHZA 1NJWA 3B6PA 4ZTFA 2IGIA 1BQNA 2WOMA 4DTNA 4L8RB 3SZ2A 1RBTA 2FBXA 5CYMA 3O4QA 4GMJB 2Z1HA 3JYTA 4CHYA 3OS1A 3OYCA 4I9QA 4CJTA 4CJEA 5J2QA 1C6VA 2G8HA 5D3GA 2IDOA 2YKMA 1JLCA 3V9ZA 5FRNA 3LAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVI A;  1C0M A;  4FJN A;  3HYF A;  1NK9 A;  3AV9 A;  3KKR A;  4CIF A;  4E7I A;  3L2Q A;  4Z4C A;  1NKB A;  3MXJ A;  1JKH A;  2YNH A;  3LAL A;  2P51 A;  3OYB A;  4CCH A;  3TAP A;  1NJZ A;  1FKP A;  4BDY A;  2PY5 A;  4DG1 A;  4E1M A;  2KTQ A;  1S1X A;  4W5R A;  4NCG A;  4BE0 A;  3V9W A;  1C1C A;  2IS3 A;  4CHQ A;  3BDP A;  2HVH A;  1HNI A;  1S6P A;  4FZX C;  2BAN A;  4M3U A;  1IKV A;  4CEA A;  3LDS A;  4O5B A;  3PO4 A;  3AVH A;  4EP4 A;  3T19 A;  1WAJ A;  5I42 A;  4KAZ A;  4KV8 A;  1BCO A;  1TGO A;  3AO2 A;  3U3G A;  1IKW A;  4DQR A;  4DQI A;  4F8R A;  3S9H A;  3V4I A;  2IAJ A;  3HL8 A;  3OY9 A;  1NK6 A;  1VSI A;  1KLN A;  3O3F A;  4BDZ A;  3HK2 A;  2F8S A;  3QNO A;  1F21 A;  1VSM A;  3VQE A;  2KFN A;  1IO2 A;  1EKE A;  2RPI A;  3ZT3 A;  3OYL A;  4CF1 A;  3KK1 A;  3VQD A;  1Y97 A;  1WSJ A;  2X6N A;  4CJ4 A;  4LSN A;  3WNF A;  3PX6 A;  4F4K A;  1QSY A;  1U04 A;  1EET A;  2O4G A;  3ZSQ A;  1HYZ A;  1TKZ A;  4DS4 A;  1S1W A;  4N5S A;  4PWD A;  3T3F A;  1EP4 A;  4I2P A;  1ASV A;  1HYV A;  4OLA A;  5CZ2 A;  4CHZ A;  4UQG A;  2A1S A;  4K8Z A;  3DLR A;  4CEE A;  4M3T A;  3RR7 A;  4IFY A;  3MEC A;  3L2W A;  4DQS A;  4CF8 A;  1ASW A;  4PY5 A;  3QEP A;  2D5R A;  4OVL A;  4CJV A;  3PY8 A;  4M3X A;  3B6O A;  3TR8 A;  1TK0 A;  4CFB A;  3AO1 A;  4RW9 A;  3MXI A;  3DLE A;  4LY7 A;  4MQ3 A;  1HQE A;  2XY8 A;  3SPY A;  4DWI A;  1LWF A;  2DFE A;  3CM6 A;  1LW0 A;  1VRU A;  2OPQ A;  4DFM A;  3QEI A;  1KVA A;  4FM2 A;  3KLF A;  1HRH A;  1WSE A;  4CFA A;  4KHN A;  1O1W A;  1ZBI A;  4LSL A;  4CJ3 A;  4F2S A;  2HB5 A;  2LSN A;  3NDK A;  1NKC A;  4KI4 A;  4HUE A;  4TSX A;  3RMB A;  1ZBU A;  3CFP A;  4Z4I A;  1MU2 A;  2XY6 A;  4JLH A;  5J2M A;  4RW4 A;  3ZSO A;  2ZD1 A;  2Z1I A;  3O3H A;  3CG7 A;  3AO3 A;  4I7F A;  4I9L A;  3C6T A;  2P5O A;  3NFA A;  4DSL A;  4KTZ A;  3KJV A;  4CF2 A;  3VA0 A;  3DOL A;  3SPZ A;  2F8T A;  3SCX A;  2QK9 A;  3M8S A;  2YHA A;  3P5J A;  4F3T A;  4IFV A;  3LZJ A;  3SV3 A;  3VQB A;  2AJQ A;  3HPO A;  4ZTJ A;  4Z4F A;  3S3O A;  5DMR A;  1L5U A;  3KTQ A;  4B8A B;  1D5A A;  5KGX A;  2Y1I A;  4CIG A;  2QKB A;  4E3S A;  3ZT0 A;  4KI6 A;  3NH1 A;  1BCM A;  4FLZ A;  3WNG A;  2YV0 X;  4N41 A;  4JRP A;  1J5O A;  3VN5 A;  3ITH A;  1CXU A;  2FBY A;  4HVJ A;  4AHS A;  1JLE A;  3RR8 A;  4DQQ A;  4IG3 A;  2DY4 A;  4BE1 A;  4CIE A;  1N5Y A;  2Q3S A;  3VQA A;  4FJH A;  4FW2 A;  4B8C A;  3NF8 A;  2DTU A;  4BWM A;  4OPJ A;  3NH2 A;  4CK1 A;  4GW6 A;  3M8P A;  3EZ5 A;  3VA3 A;  3V6D A;  1ASU A;  5CY4 A;  4B9T A;  3QIN A;  2G8W A;  1UA0 A;  3CM5 A;  3LPU A;  1KTQ A;  4C8N A;  4DU4 A;  1GOC A;  3NF9 A;  4B9L A;  5HLF A;  4LH4 A;  3K5O A;  1BI4 A;  3THV A;  4YFU A;  2F96 A;  2B5J A;  1NJY A;  5HRN A;  2PYL A;  3QNN A;  4B9V A;  4J2D A;  4NCA A;  1ZYQ A;  1X9M A;  1TAQ A;  3TAB A;  2EHG A;  3V1O A;  3VQ7 A;  4CJQ A;  4W5O A;  3QER A;  4AHR A;  1CLQ A;  4DTU A;  1RTJ A;  3HP9 A;  1VSJ A;  1TL3 A;  1VSE A;  1NK8 A;  1KRP A;  4FJM A;  1C1B A;  3MXM A;  4Z4H A;  4KHQ A;  3KLH A;  2IOC A;  1L3V A;  3D0P A;  1HJR A;  1RT2 A;  1WSI A;  3KLI A;  4CF9 A;  1U47 A;  1WN7 A;  4KB0 A;  4FJ7 A;  2HHS A;  3NH0 A;  3OVN A;  4C8O A;  3QLH A;  4E19 A;  4BE2 A;  4Z4E A;  1S9E A;  1X1P A;  1R0A A;  1JXE A;  3I0S A;  4DSE A;  4DSK A;  1SKS A;  3LP1 A;  4E7L A;  1ZBL A;  3NCI A;  4RG8 A;  1TKX A;  2OA8 A;  4RW7 A;  4O0I A;  4B9S A;  4FYD A;  1IH7 A;  3JSM A;  1REV A;  4PQU A;  3MEE A;  4G1Q A;  2BE2 A;  1TL1 A;  4DSI A;  3LZI A;  2HNY A;  1ZBH A;  4IG0 A;  4CGI A;  1G15 A;  3CYM A;  1BI4 B;  1RDC A;  1KVC A;  3HVT A;  5HRS A;  3SUP A;  4CJU A;  1RT3 A;  1LAV A;  3NHG A;  3DLB A;  3I0R A;  1WLJ A;  4K8X A;  1TVR A;  4KFB A;  2OPR A;  4DTJ A;  4FJI A;  2RF2 A;  4CHP A;  4N76 A;  4CEZ A;  1D8Y A;  3LAN A;  1J54 A;  4CEC A;  3AVL A;  3PUF A;  4J2B A;  2X78 A;  2OZS A;  2HMI A;  1NK0 A;  4KRE A;  3OYJ A;  5EU7 A;  4B08 A;  4R5P A;  2XY7 A;  1RDA A;  3K5N A;  3TAN A;  2KQ2 A;  3IS9 A;  3LP2 A;  2Y1J A;  2X6S A;  4CK2 A;  3AVI A;  3QES A;  4KHW A;  5C24 A;  3RRH A;  4HCC A;  3OYE A;  3AVA A;  2ETJ A;  3U3Y A;  1BIZ A;  3QIO A;  5CZ1 A;  3SQ0 A;  1GOB A;  4FVM A;  5I3U A;  3QO9 A;  4Y1D A;  4DS5 A;  3HJF A;  3LAK A;  4M3R A;  2HHX A;  2PZS A;  1WNS A;  4CF0 A;  2O4I A;  1UAX A;  4FJJ A;  2PYJ A;  3M8Q A;  4HTU A;  2ITG A;  3V9X A;  2NUB A;  4O44 A;  4FXD A;  1WAF A;  5CYQ A;  1U48 A;  4J2A A;  2G8I A;  3KLE A;  4B3O A;  2ATQ A;  4CES A;  4O55 A;  1EXQ A;  2RN2 A;  3DLG A;  3L2V A;  4DTS A;  3QEV A;  4FZZ A;  2YNF A;  3VQ8 A;  1TAU A;  3LP3 A;  1NK7 A;  2KZZ A;  3NAE A;  4FK4 A;  4DTX A;  4RW8 A;  2W42 A;  4I2Q A;  4JS4 A;  1S5J A;  4OKK A;  5JS2 A;  3H08 A;  3OYN A;  3OJS A;  3O4N A;  3LWL A;  3TAG A;  1QHT A;  3L8B A;  1QSL A;  4CER A;  1T8E A;  3O3G A;  4GVM A;  4E7J A;  2P5G A;  1A5X A;  1S9G A;  3SV4 A;  1KVB A;  2OPP A;  3ZSW A;  1RT7 A;  3C94 A;  4FJG A;  4DFJ A;  1NJX A;  4KB1 A;  1NK5 A;  4FK2 A;  2A1R A;  4AHV A;  4J2E A;  3V1R A;  3ISN C;  4C8M A;  1JL2 A;  1JXB A;  3AO5 A;  1QE1 A;  1S1T A;  3VQQ A;  1FKO A;  1LW2 A;  1HPZ A;  3RMA A;  4CJR A;  4EZ9 A;  3SYZ A;  1EX4 A;  1ITG A;  3QIP A;  3K57 A;  2HHQ A;  3WNE A;  2YKN A;  2ZE2 A;  2XY5 A;  3HPH A;  1JL1 A;  2HND A;  4E89 A;  3AVB A;  1SL2 A;  4FJL A;  4PUO A;  1VK0 A;  3L3V A;  5KI6 A;  5C42 A;  1KLM A;  4HUG A;  3HXM A;  1LV5 A;  2KFZ A;  4DTR A;  1KFD A;  4O4G A;  4CEO A;  2WON A;  5KRS A;  3ZT4 A;  4CED A;  1FK9 A;  3M8R A;  3KK3 A;  3MAQ A;  3RRG A;  1SV5 A;  4ID1 A;  3PX4 A;  1UWB A;  1J53 A;  3WNH A;  1TV6 A;  3SQ2 A;  1W9H A;  1YT3 A;  1UOC A;  1XI1 A;  2IC3 A;  1IKX A;  2JGU A;  5SZT A;  5J2N A;  4E7K A;  1TKD A;  4F2R A;  1RTH A;  1Z26 A;  4FLV A;  4DF4 A;  1DTT A;  4CFD A;  1RDB A;  2YNI A;  4DTP A;  1SL0 A;  3NF7 A;  4CHN A;  1U45 A;  3IAY A;  1BHL A;  4JRQ A;  3SUQ A;  2HW3 A;  3TAF A;  3KD1 E;  4KRF A;  1Q8I A;  3P1G A;  4WE1 A;  3KLG A;  3U6F A;  1SKW A;  3A2F A;  3AO4 A;  3K5L A;  4M3Y A;  3MED A;  2P1J A;  2HNZ A;  4O0J A;  1U49 A;  3ZT1 A;  4CJL A;  5DK5 A;  4BAC A;  3AA5 X;  3DLH A;  2D0B A;  4N47 A;  1BIU A;  5FDL A;  4HHT A;  1A5V A;  1YVU A;  4OKJ A;  3VQ5 A;  4XIU A;  4ELU A;  1L3T A;  1ZBF A;  2YNG A;  4CGD A;  1HYS A;  2HHT A;  1B92 A;  1JLA A;  1Q9X A;  1BQM A;  3DMJ A;  3SUN A;  4FZY A;  1QQC A;  2BDP A;  4CGJ A;  4B9U A;  3DRR A;  3C6U A;  4CHO A;  1U4B A;  1J9A A;  4CJS A;  3HP6 A;  1SKR A;  4CJ5 A;  4AIL C;  1KFS A;  4Q0B A;  1TK8 A;  4H4O A;  3ZT2 A;  2HHU A;  5J2P A;  3S3N A;  1S6Q A;  2HHV A;  2VG7 A;  2ZQB A;  1X9S A;  1L3U A;  1TKT A;  2XRI A;  4DU3 A;  4BDP A;  5KGW A;  5C25 A;  3OYD A;  3ULD A;  4DTM A;  3SNN A;  4OGE A;  4CFC A;  4DQP A;  1RIL A;  4N56 A;  1JLB A;  3VQC A;  2FC0 A;  3PO5 A;  4IDK A;  4DU1 A;  3NGY A;  4NYN A;  4NCB A;  2XHB A;  1RT5 A;  2G8K A;  3ZCM A;  4JS5 A;  1RDD A;  3NGZ A;  1DTQ A;  3AVG A;  1VSL A;  4BWJ A;  1A5W A;  4CJF A;  1BL3 A;  4AH9 A;  3K58 A;  4EZ6 A;  4OGC A;  4NYF A;  1UA1 A;  3OS2 A;  4FW1 A;  1SL1 A;  4E7H A;  3RMD A;  3DRP A;  1VSH A;  2JLE A;  3LPT A;  3AA3 A;  3V1Q A;  1LAW A;  2VG6 A;  1TK5 A;  4Z0U A;  1JLF A;  1Q9Y A;  3AVN A;  1RBR A;  3OS0 A;  1WSG A;  1YTA A;  4LH5 A;  5HRP A;  5HP1 A;  4FLW A;  3OYM A;  4FLY A;  2OYQ A;  3I8D A;  1RTD A;  1T05 A;  2GUI A;  3BGR A;  3OYK A;  4RW6 A;  1D9D A;  1B9F A;  3EYZ A;  1VSF A;  3LP0 A;  3KKS A;  3EY1 A;  1CZB A;  2VWJ A;  1HMV A;  4Y1C A;  4QCL A;  3F9K A;  1RBS A;  5JS1 A;  3VQ6 A;  3DM2 A;  1RTI A;  3TAE A;  3D45 A;  3VQP A;  4CGG A;  1HNV A;  4Q5V A;  3E01 A;  3OYI A;  4M3W A;  3HST B;  3V81 A;  4B9M A;  4Z4G A;  3CFR A;  5E41 A;  1VSD A;  4OKE A;  4FM1 A;  4AHC A;  4DFP A;  3DI6 A;  4ID5 A;  2Z1G A;  4AHU A;  2G8F A;  2E4L A;  3UIQ A;  4IKF A;  4OLB A;  4OJR A;  4QAG A;  4FLT A;  1YTU A;  4HUF A;  2I5J A;  1HQU A;  3OYA A;  3VQ9 A;  1VSK A;  4DTO A;  3HO1 A;  3V9U A;  3TI0 A;  3NE6 A;  5FRM A;  1WSH A;  2OPS A;  4DSJ A;  5FRO A;  3KIO A;  3CFO A;  4CGF A;  4OPK A;  4LD0 A;  4W5Q A;  4DLE A;  4C8L A;  2E6M A;  3TAQ A;  4KHS A;  5KRT A;  1QS4 A;  3G0Z A;  1RT4 A;  1X9W A;  1T03 A;  2DFF A;  4CJW A;  4M41 A;  3AVC A;  1CXQ A;  4QOZ B;  3ZSV A;  1NOY A;  1KCF A;  1C0T A;  4EP5 A;  1WSF A;  2B6A A;  1BGX T;  3ASM A;  2Z1J A;  4M45 A;  2G8U A;  5J1E A;  2X74 A;  4B9N A;  2YHB A;  3PX0 A;  3MEG A;  3L3U A;  3NBP A;  4ELT A;  4FJ5 A;  1FXX A;  2EX3 A;  4CGH A;  1K6Y A;  3T1A A;  3P83 D;  3VQ4 A;  3FFI A;  3PV8 A;  4CE9 A;  1NKE A;  3SI6 A;  1D9F A;  4E1N A;  3OJU A;  1SUQ A;  2HHW A;  4FJX A;  1NK4 A;  3ZSY A;  4HCB A;  3NF6 A;  3HVR A;  1RT1 A;  4M3Z A;  1BIS A;  3AVJ A;  1IKY A;  3AVM A;  5KTQ A;  2FBT A;  4H8K A;  1T7P A;  3SQ4 A;  3SQ1 A;  1XWL A;  3SUO A;  4FJ8 A;  4CEF A;  1I3A A;  3DYA A;  4MFB A;  4CEQ A;  3LWM A;  2FBV A;  1JLQ A;  1KSP A;  1RNH A;  3QET A;  3G10 A;  3ALY A;  3RTV A;  4KO0 A;  3KK2 A;  4DSF A;  3TAM A;  3AA2 A;  3DLK A;  3QEW A;  1C0U A;  3OYH A;  4E0D A;  4FLU A;  5HRO A;  3V9S A;  3F73 A;  1VRT A;  3K5M A;  2D0A A;  3K2P A;  3CQ8 A;  5K14 A;  3L2U A;  4KTQ A;  4AHT A;  1Z25 A;  3AA4 A;  2GBZ A;  4ZHR A;  3DRS A;  3AVK A;  3OYF A;  2DFH A;  4DFK A;  1LWC A;  1NOZ A;  5HRR A;  4KKO A;  3OYG A;  1XC9 A;  3AVF A;  1RT6 A;  3SJJ A;  1S1V A;  1RBU A;  1QTM A;  4FK0 A;  4DMN A;  4KHY A;  5SWM A;  4H4M A;  2RKI A;  4C8K A;  3ZSZ A;  4CJP A;  1I39 A;  1S1U A;  3L2R A;  4CK3 A;  2QXF A;  3ZSR A;  1L3S A;  3TWH A;  4FLX A;  3TAR A;  4ELV A;  4ICL A;  3HT3 A;  3NGI A;  2BGG A;  2KW4 A;  2GV9 A;  4FJK A;  2E6L A;  2OZM A;  4W5N A;  2VG5 A;  3IRX A;  4CEB A;  3RMC A;  4F3O A;  4PA1 A;  2VWK A;  3S3M A;  1RBV A;  1N6Q A;  3IG1 A;  2G8V A;  4M42 A;  4KPY A;  1W0H A;  2D0C A;  3QEX A;  3K59 A;  3C95 A;  1IG9 A;  3KD5 E;  1DLO A;  3ZSX A;  1JLG A;  1XHX A;  2QKK A;  2XO7 A;  4KHU A;  1LWE A;  4FCY A;  3DOK A;  4YNQ A;  4DF8 A;  1GOA A;  2B4J A;  1CZ9 A;  3HM9 A;  1QSS A;  4W5T A;  4FJ9 A;  3HPG A;  1B9D A;  1C1A A;  5HBM A;  2KZM A;  4DLG A;  4KTW A;  5T7B A;  4IBN A;  2R7Y A;  3RWU A;  4FM0 A;  4CJK A;  1RCH A;  1XHZ A;  1NJW A;  3B6P A;  4ZTF A;  2IGI A;  1BQN A;  2WOM A;  4DTN A;  4L8R B;  3SZ2 A;  1RBT A;  2FBX A;  5CYM A;  3O4Q A;  4GMJ B;  2Z1H A;  3JYT A;  4CHY A;  3OS1 A;  3OYC A;  4I9Q A;  4CJT A;  4CJE A;  5J2Q A;  1C6V A;  2G8H A;  5D3G A;  2IDO A;  2YKM A;  1JLC A;  3V9Z A;  5FRN A;  3LAM A; 
#chains in the Genus database with same CATH topology
 3KWI A;  1GLA G;  3HYF A;  4NB4 A;  4IZ9 A;  4CIF A;  4B1V A;  3L2Q A;  1BO5 O;  2KHO A;  2NRW A;  5AQP A;  1NM1 A;  3HTV A;  3UKR B;  2HF3 A;  4BRH A;  3G71 N;  3TAP A;  2PY5 A;  3MX5 A;  2FSK A;  2Q97 A;  2KTQ A;  4BE0 A;  4K0K K;  1S6P A;  2BAN A;  4M3U A;  4CEA A;  3MN7 A;  5A2Q O;  4EP4 A;  2WUS A;  3IFR A;  4KAZ A;  4DV7 K;  1BCO A;  1TGO A;  3EN9 A;  5AZI B;  5DM6 L;  4F8R A;  3S9H A;  4BRQ A;  4RWT A;  2IAJ A;  1NK6 A;  1KLN A;  4BDZ A;  4J8F A;  3ULE A;  3ZLJ A;  1OH8 A;  1IO2 A;  1EKE A;  2RPI A;  3OYL A;  2AP1 A;  3VQD A;  4LSN A;  1HR0 K;  3WNF A;  2NRV A;  3MN6 A;  1QSY A;  2O4G A;  4UQG A;  4CEE A;  3C7N A;  3QEP A;  4PY5 A;  1N8R O;  5LY3 A;  4CFB A;  3CER A;  4MQ3 A;  4DQI A;  2OPQ A;  3QEI A;  1QHA A;  4FM2 A;  4LF7 K;  1ZBI A;  1O1W A;  1U6Z A;  4LSL A;  4CBW A;  4YOV A;  1NKC A;  1N32 K;  3RMB A;  4JLH A;  3LL3 A;  5AQL A;  3AO3 A;  3BY5 A;  2GTD A;  3DXM A;  4DSL A;  4F3T A;  3LZJ A;  4YDU A;  4Z4F A;  5HOO A;  1S3X A;  1D5A A;  4CZK A;  5KGX A;  2WTU A;  4Y0W A;  3RSE A;  1KAX A;  3L4I A;  4BGB A;  4E3S A;  4CZI A;  2UXB K;  4KI6 A;  4FLZ A;  5GAH P;  2YV0 X;  3TSP A;  4N41 A;  4JD2 A;  4O8K A;  1NU0 A;  4JI8 K;  1JLE A;  4KHP K;  4DQQ A;  4IG3 A;  4CIE A;  1N5Y A;  3VQA A;  4FW2 A;  3CET A;  2DTU A;  4BWM A;  4OPJ A;  5MLC Q;  3VF6 A;  3EZ5 A;  4WFN L;  3VA3 A;  5CY4 A;  2D0O A;  3AGK A;  4YOX A;  2G8W A;  4XH5 A;  1LOT B;  3BEX A;  1GOC A;  3QML A;  1BUP A;  3MCA B;  3K5O A;  3WEE B;  4CZF A;  4KRE A;  2B5J A;  2PYL A;  5HRN A;  1K9M O;  3QNN A;  4J2D A;  4NCA A;  3V1O A;  4W5O A;  3EO3 A;  2I7N A;  3HP9 A;  1N36 K;  3M5R A;  4FJM A;  2UU9 K;  3MXM A;  4NO7 A;  3KLH A;  4CBX A;  1RT2 A;  4KB0 A;  4JYA K;  4Z4E A;  3OVN A;  3QLH A;  4DV0 K;  1N34 K;  1K8K B;  3FZK A;  2RHK A;  4BGA A;  2VCP A;  1EWR A;  2ZWH A;  3NCI A;  4FYD A;  2OA8 A;  2YHY A;  4EHT A;  3JSM A;  5IWA K;  4A61 A;  3GL1 A;  3CCQ N;  3CYM A;  1BI4 B;  3IDH A;  3WQT A;  1KVC A;  3CJ1 A;  1YAG A;  1NGD A;  3SUP A;  4K8X A;  1TVR A;  4WYB A;  4FJI A;  4CHP A;  1IBL K;  1J54 A;  3FZL A;  3AVL A;  3PUF A;  3WXM B;  3THW B;  5GAE P;  3EE8 A;  2V51 B;  4R5P A;  3IS9 A;  3LP2 A;  1NGA A;  4MLE A;  5JLH A;  3QES A;  5C24 A;  2ETJ A;  3MCP A;  4CZE A;  5DM7 L;  1GOB A;  2KLA A;  4Y1D A;  4DV2 K;  2E1Z A;  4M3R A;  4CF0 A;  2PYJ A;  4FXD A;  2NUB A;  4MO5 A;  1YHQ N;  1EXQ A;  2YNF A;  2KZZ A;  5I9E B;  2VGN A;  4EIA A;  2O8D B;  1S5J A;  4OKK A;  3OYN A;  1MA9 B;  3ID6 A;  1QHT A;  4E7J A;  1XMO K;  1A5X A;  3SV4 A;  2OPP A;  3CMA N;  1NJX A;  1NK5 A;  2A1R A;  4AHV A;  2Q36 A;  4O5F A;  3AO5 A;  5BPN A;  1QE1 A;  4YHH K;  3VQQ A;  1IBK K;  3RMA A;  3SYZ A;  1EWQ A;  2D4W A;  2P9I B;  4XH1 A;  1G99 A;  2J4R A;  1XUP O;  1VK0 A;  3L3V A;  1KLM A;  2KFZ A;  4DTR A;  1KFD A;  4O4G A;  5FPD A;  4CED A;  3M8R A;  5AQM A;  4BRL A;  3KK3 A;  5BPM A;  3SJH A;  3PX4 A;  1Q86 O;  1W97 L;  5M1O A;  1IKX A;  2JGU A;  1RTH A;  1RDB A;  1SL0 A;  3NF7 A;  4DV6 K;  1XMQ K;  3IAY A;  1Q8I A;  1SKW A;  1K8K A;  4AF1 A;  4O0J A;  4C1N K;  3NMU A;  1DEJ A;  4IEI A;  5KQD A;  4N47 A;  1BIU A;  5FDL A;  1A5V A;  4XIU A;  4ELU A;  2YNG A;  1JLA A;  4CGJ A;  3HP6 A;  2F7T A;  1K8A O;  3D7E O;  2QTD A;  1S6Q A;  2HHV A;  2ZQB A;  5H1S Q;  2XRI A;  4DU3 A;  5KGW A;  4ISE A;  4DTM A;  2HOE A;  2WFB A;  4CFC A;  4N56 A;  3VQC A;  2FC0 A;  3PO5 A;  3O1B A;  1GLL O;  2CGJ A;  4NCB A;  4NYN A;  5F1X A;  3JS6 A;  1HKG A;  4CZM A;  1RDD A;  1VSL A;  2DPN A;  4BWJ A;  5BR9 A;  1A5W A;  4EZ6 A;  4OGC A;  1UA1 A;  2IIR A;  2O8F A;  4BR7 A;  1SL1 A;  4E7H A;  2JLE A;  1NGF A;  3V1Q A;  1WB9 A;  4LF6 K;  4B1Z A;  3A5L C;  5HP1 A;  5HRP A;  4LH5 A;  2H3G X;  3OYM A;  3I8D A;  5IT9 O;  1B9F A;  2ZM6 K;  1VSF A;  3WUH A;  1TUU A;  2E2O A;  4QS7 A;  1RDU A;  4CGG A;  3CCU N;  1HNV A;  2UXC K;  3THX A;  3V81 A;  4CJ7 A;  4OKE A;  3VTI A;  4FM1 A;  2HBL A;  3DI6 A;  2Z1G A;  4IKF A;  2AA4 A;  3L6Q A;  4HUF A;  1VSK A;  3V9U A;  1E4F T;  5BRE A;  3KIO A;  3I33 A;  4NLB A;  4W5Q A;  3J7Y P;  3E9L A;  3KHY A;  1XQS C;  2P9N B;  1RT4 A;  1X9W A;  1T03 A;  3LM9 A;  1CXQ A;  1NOY A;  2QEX N;  4EP5 A;  5J1E A;  2X74 A;  5BPL A;  3GG4 A;  2P9U B;  4ELT A;  3VEX A;  3TSU A;  3SI6 A;  1D9F A;  3ZYY X;  5M1F A;  2A6A A;  4JKG B;  1RT1 A;  3CI5 A;  4M3Z A;  3E66 A;  1IKY A;  3ZX0 A;  3SQ4 A;  1XWL A;  3LDL A;  1I3A A;  3C6H A;  4BQL A;  5E26 A;  2FBV A;  1RNH A;  4H03 B;  4DSF A;  2E20 A;  3TAM A;  3DLK A;  3QEW A;  1T6C A;  3V9S A;  1VQ9 N;  4PKI A;  3K2P A;  2ITM A;  5C12 A;  3H45 C;  2OCE A;  5BN8 A;  3OYF A;  2DFH A;  3F5T A;  1LWC A;  5HRR A;  4YOW A;  4KKO A;  3OYG A;  1IBM K;  3AVF A;  4DR7 K;  2V7Y A;  1QTM A;  5SWM A;  4C8K A;  1S1U A;  4CK3 A;  4JKF A;  2A41 A;  3TTF A;  1L3S A;  4ICL A;  2QWM A;  1NMD A;  3NGI A;  4OX9 K;  4FJK A;  4A2B A;  4W5N A;  3IRX A;  2E2N A;  4F3O A;  1N6Q A;  3IG1 A;  4BR2 A;  3QEX A;  3C95 A;  1JLG A;  4JI6 K;  1XHX A;  4H0T B;  1JCF A;  2QKK A;  2XO7 A;  2FF3 B;  4FCY A;  3DOK A;  4DF8 A;  1GOA A;  4W5T A;  4MLH A;  3VER A;  1VQ7 N;  5EXW A;  5AFU A;  2WOM A;  4L8R B;  4I9Q A;  4CHY A;  1C6V A;  2G8H A;  4DU1 A;  5FRN A;  3ZET B;  3WXI A;  5GIP A;  1C0M A;  5AQF A;  4FJN A;  2GX9 A;  1NK9 A;  1KAZ A;  4IJA A;  1NKB A;  3LAL A;  2P51 A;  4JKD A;  4O8U A;  4DV1 K;  5KQ8 A;  1NJZ A;  4A2A A;  1X3M A;  1ILY A;  2HVH A;  3RVC A;  4BRO A;  2P9U A;  1IKV A;  1NBW A;  4BVP A;  3LDS A;  3ENH A;  5AQJ A;  1WAJ A;  3HOT A;  3AO2 A;  3HBT A;  4JI7 K;  1HJO A;  3CJA A;  2D1K A;  1NGB A;  3QNO A;  2KFN A;  3ZT3 A;  4CD3 A;  4CF1 A;  1Y97 A;  1WSJ A;  4CJ4 A;  3CC2 N;  5BRH A;  3UKU B;  4FVU A;  5AQX A;  3PX6 A;  4F4K A;  1U04 A;  2IVN A;  4DS4 A;  1S1W A;  3T3F A;  1ASV A;  1HYV A;  4EFH A;  4K8Z A;  3K9J A;  2QA4 N;  3CF5 L;  3ZX3 A;  2D5R A;  3UB5 A;  5ADX A;  3VEW A;  4JKB A;  4H5W A;  4JK8 A;  2JWL A;  3A5O C;  1TK0 A;  3CJ7 A;  3AO1 A;  3MXI A;  3DLE A;  2XY8 A;  4JK7 A;  2DFE A;  1JCE A;  1WSE A;  3BUZ B;  4KHN A;  4F2S A;  2NRH A;  2HB5 A;  2LSN A;  4TSX A;  4IO9 L;  1ZBU A;  4Z4I A;  1MU2 A;  4JKA A;  2XY6 A;  3ID8 A;  1DGK N;  2ZD1 A;  2QW9 A;  4H5T A;  1OH6 A;  1M90 O;  1VQ6 N;  3NFA A;  3VA0 A;  3DOL A;  3SCX A;  2QK9 A;  1MWM A;  3C7N B;  5KPT A;  2NRR A;  1FW6 A;  3SV3 A;  3VQB A;  1HLU A;  3HPO A;  1L5U A;  4CIG A;  2QKB A;  1TYQ A;  1BCM A;  3J8A A;  5EVZ A;  4JRP A;  3VN5 A;  4BRD A;  4HVJ A;  3RR8 A;  3DWL A;  5CHI A;  2DY4 A;  2Q3S A;  3TTC A;  4JNE A;  4B8C A;  3NF8 A;  4DR6 K;  3BZC A;  4GW6 A;  1GLC G;  2W40 A;  3QIN A;  5BRF A;  4QS8 A;  3CM5 A;  3LPU A;  3T7Z A;  3PIO L;  4CVN E;  4WQ4 A;  4YFU A;  1NJY A;  4B9V A;  4KH6 A;  1X9M A;  4CJQ A;  3RSE B;  1U2V A;  1KRP A;  1C1B A;  4JD2 B;  4Z4H A;  4KHQ A;  2IOC A;  1L3V A;  3D0P A;  3KLI A;  3NH0 A;  4C8O A;  2KKZ A;  1X1P A;  3U4L A;  1IG8 A;  3UKU A;  5KPZ A;  4X64 K;  1T3V A;  4RTF D;  1BDG A;  2O8B A;  4B9S A;  4RW7 A;  1IH7 A;  4PQU A;  4OPA A;  1SAZ A;  3WT0 A;  1WBD A;  4DSI A;  3LZI A;  1ZBH A;  1VHX A;  4H5R A;  1YXQ A;  4DB3 A;  4FOI A;  1FJG K;  1RT3 A;  1LAV A;  4B1X B;  3I0R A;  4DTJ A;  1ZC6 A;  1D8Y A;  4JV5 K;  3LAN A;  3GOI A;  4J2B A;  4V19 S;  3DLL L;  2KQ2 A;  4KHW A;  5AQO A;  1Z6R A;  3AVI A;  4H0Y B;  4CK2 A;  3AVA A;  4JEP A;  4GKK K;  3VEO A;  1YVN A;  2QWP A;  2Q1N A;  3HJF A;  2HHX A;  1YJW N;  2PZS A;  4CI6 A;  4FJJ A;  4WQ5 C;  2O8C A;  1J5E K;  4O44 A;  4H0X B;  4B9Q A;  3O5B A;  4O55 A;  3OTO K;  4IFE A;  3QEV A;  2IVP A;  4JI1 K;  3VQ8 A;  4DCH A;  1TAU A;  4FK4 A;  1VQM N;  4DTX A;  4I2Q A;  4M63 C;  4JS4 A;  5JS2 A;  3OJS A;  3O4N A;  1QSL A;  4CER A;  2UXD K;  3O3G A;  1KVB A;  4FJG A;  4KB1 A;  4DFJ A;  4Z94 A;  4FK2 A;  4J2E A;  3CIP A;  3U9D A;  4BR4 A;  4E1J A;  1HPZ A;  3AY9 A;  4IXC A;  4EZ9 A;  3QIP A;  3HOS A;  2YKN A;  2XY5 A;  1JL1 A;  4E89 A;  3AVB A;  1X3N A;  4FJL A;  1LV5 A;  3ZEU A;  1X9J A;  4BC3 A;  3BF1 A;  2WON A;  3NVM A;  1FK9 A;  2P9L B;  3RRG A;  5AQS A;  1UWB A;  1J53 A;  1TV6 A;  3SQ2 A;  3P39 A;  1XI1 A;  2IC3 A;  2E2P A;  2VWB A;  1VQN N;  1Z26 A;  4DF4 A;  4B3M K;  5AQR A;  4DTP A;  3L4Q A;  3F2K A;  1BHL A;  3SUQ A;  3TAF A;  4WE1 A;  3K0S A;  3KLG A;  3U6F A;  4M3Y A;  3MED A;  1U49 A;  2QXL A;  1BA0 A;  3DLH A;  1VQK N;  2D0B A;  4JI2 K;  4A62 A;  1YVU A;  4KH4 A;  3TSQ A;  2ZJP L;  1HYS A;  1ZBF A;  5AZJ B;  4CGD A;  5AQN A;  4GV6 A;  2W6K A;  3DMJ A;  2BDP A;  1ATS A;  4BVO A;  1J9A A;  1SKR A;  2QWR A;  1KFS A;  4H4O A;  1X9S A;  4BR5 A;  4BDP A;  3ULD A;  3SAH A;  4DQP A;  1RIL A;  5LMU K;  2G8K A;  3BF3 A;  2VGM A;  4NXN K;  4CJF A;  3K58 A;  4NYF A;  3H1V X;  3LPT A;  3BP8 A;  1KAY A;  3AAR A;  1NMN A;  2VG6 A;  1WOQ A;  1JLF A;  4C1N I;  1Q9Y A;  5M1Q A;  1GLJ O;  4FLW A;  3LDP A;  1BOT O;  4H0O A;  1T05 A;  1JJ2 M;  4DR2 K;  3EYZ A;  1YF5 L;  3KKS A;  4IWV A;  3EY1 A;  4Y1C A;  3F9K A;  1RBS A;  1RTI A;  3VQP A;  3O9U A;  3N4P A;  1EQY A;  4M3W A;  5TKY A;  4B9M A;  4Z4G A;  1W2B M;  2VQE K;  4DFP A;  2FXU A;  4ID5 A;  2O8F B;  3UIQ A;  4OLB A;  4I6M B;  1HQU A;  2A5X A;  4FWR A;  1KXP A;  3VQ9 A;  4OPH A;  2P9L A;  4DSJ A;  3CFO A;  4KH5 A;  3IKM A;  3TAQ A;  2YHX A;  3FFK B;  2A40 A;  3ZSV A;  4YOT A;  2B6A A;  3CCS N;  2G8U A;  2Z1J A;  3THX B;  2YHB A;  3SBT A;  3MEG A;  4U7B A;  3L3U A;  3NBP A;  4H5V A;  2D0P A;  1HNZ K;  3T1A A;  3FE1 A;  3VQ4 A;  3FFI A;  3T1Y K;  3ATU A;  4HCB A;  3ZSY A;  5AZJ A;  3EL2 A;  2FBT A;  4H8K A;  1T7P A;  3LWM A;  3G10 A;  4KO0 A;  5LL6 Z;  4E0D A;  5M1K A;  3F73 A;  3K5M A;  3EKS A;  4BRI A;  4FWP A;  3AVK A;  3D2E B;  3SJJ A;  1S1V A;  4FK0 A;  5AQY A;  4DMN A;  2CH5 A;  4H4M A;  2RKI A;  1V4S A;  3DXK A;  3R8E A;  3FLC O;  5M1N A;  5AQI A;  4K42 A;  3NVK A;  4FLX A;  4JHD B;  4ELV A;  1HNX K;  2GV9 A;  2OZM A;  4PA1 A;  2VWK A;  2Q0U A;  3S3M A;  4M42 A;  3OBY A;  4KPY A;  3O9Q A;  1W0H A;  5AQQ A;  1C0F A;  1IV0 A;  4WCE L;  4CD1 A;  1KC8 O;  4XEI A;  4KHU A;  3LDN A;  5AJ3 K;  1CZ9 A;  4FWM A;  3HPG A;  2KZM A;  5HBM A;  4DLG A;  2FSN A;  5TKW A;  2F9W A;  3O6W A;  4BRA A;  1D4X A;  4I6M A;  3B6P A;  1NJW A;  1BQN A;  1RBT A;  4FL9 A;  3O4Q A;  3J7Z O;  5J2Q A;  2YJE A;  4CJE A;  3DJC A;  3V9Z A;  3LAM A;  3EZW A;  2VYP A;  2Q2R A;  4BG8 A;  4E7I A;  5C15 A;  1JKH A;  4DV5 K;  3OYB A;  4LFB K;  4CCH A;  1WBB A;  3F9M A;  1FKP A;  4IO8 A;  3CCL N;  4DG1 A;  3V9W A;  4NCG A;  3CJC A;  1C1C A;  3BDP A;  4FZX C;  4O5B A;  5AQZ A;  4DQR A;  1IKW A;  3V4I A;  3HL8 A;  3OY9 A;  1VSI A;  3O3F A;  3SMP A;  2F8S A;  3AGR A;  3VQE A;  1HKB A;  3KK1 A;  3MK6 A;  3B8A X;  3QFU A;  4L3Q A;  3ENO A;  5C2F A;  4LC9 B;  3ZSQ A;  1HYZ A;  1TKZ A;  5ADX H;  4OLA A;  1EP4 A;  1ESV A;  4CHZ A;  3DLR A;  4M3T A;  4U67 L;  3RR7 A;  4IDH A;  4IFY A;  3MEC A;  4DR1 K;  3L2W A;  4DQS A;  4JI3 K;  3AAQ A;  4OVL A;  4CJV A;  4M3X A;  4DR5 K;  3D2E A;  4JN4 A;  3TR8 A;  4DWI A;  1LWF A;  4DFM A;  1GLF O;  3QB0 A;  4CJ3 A;  4JHD A;  4HUE A;  3CFP A;  3VPZ A;  3LDO A;  1QQN A;  3FZF A;  4RW4 A;  1HUX A;  1RFQ A;  1I94 K;  2Z1I A;  3O3H A;  3CG7 A;  4I9L A;  3C6T A;  4KTZ A;  2HBM A;  5AR0 A;  3M8S A;  2YHA A;  3P5J A;  4IFV A;  3QBX A;  4ZTJ A;  3S3O A;  5DMR A;  2CGL A;  1BU6 O;  3Q7B A;  1Q81 O;  2W6L A;  3UE5 A;  1NGI A;  4BY9 C;  2ZGZ A;  1CXU A;  4AHS A;  3O1W A;  3CC4 N;  2A3Z A;  5ELZ A;  4XH4 A;  4CW7 B;  4QS9 A;  4CK1 A;  3V6D A;  4B9T A;  1UA0 A;  1KTQ A;  4DU4 A;  3NF9 A;  5HLF A;  1HNW K;  1CZA N;  2ASM A;  2F96 A;  5LJW A;  5E84 A;  1ZYQ A;  1TAQ A;  1ATN A;  1NJI O;  3VQ7 A;  1TYQ B;  4AHR A;  4DTU A;  1RTJ A;  1NK8 A;  1VSE A;  1P8Z A;  1WSI A;  1T6D A;  4CZG A;  1WN7 A;  2ASP A;  3VEY A;  1EO1 A;  1S9E A;  3MN5 A;  1R0A A;  4DSE A;  4DSK A;  1SKS A;  3LP1 A;  1ZBL A;  4RCH A;  4B1U B;  4RG8 A;  4BRK A;  1TKX A;  3FZM A;  4A59 A;  2GWJ A;  3JAM O;  4G1Q A;  3U8X A;  2HNY A;  4CGI A;  3PSI A;  3O9S A;  4CJU A;  3TTD A;  3DLB A;  1WLJ A;  4N76 A;  3E1Y A;  1U2V B;  2FSJ A;  4CEC A;  1GLB G;  1ATR A;  1P90 A;  2HMI A;  1NK0 A;  2PFU A;  2HMP A;  5CR4 A;  3P4I A;  3TAN A;  3K5N A;  4BRE A;  2Y1J A;  3RRH A;  4HCC A;  3OYE A;  3U3Y A;  2HF4 A;  4AQY K;  2QWQ A;  2O8B B;  1BIZ A;  3QIO A;  3FR0 A;  1DT9 A;  3QO9 A;  4DS5 A;  3QFP A;  3M8Q A;  4HTU A;  2ITG A;  1WAF A;  5CYQ A;  4J2A A;  2G8I A;  3HZ6 A;  3KLE A;  3M1F A;  4B3O A;  4DV4 K;  1GLE G;  2RN2 A;  1YIJ N;  4DTS A;  1NNE A;  4FZZ A;  3LP3 A;  3QIC A;  4MDA A;  1VQ8 N;  4RW8 A;  2YI1 A;  1SZ2 A;  4IEE A;  3QDK A;  3TU5 A;  3L8B A;  1T8E A;  1S9G A;  2Q0R A;  1RT7 A;  3VGL A;  4GNI A;  3V1R A;  3ISN C;  1VQL N;  1YI2 N;  2GWK A;  1S1T A;  1LW2 A;  4B3R K;  4CJR A;  1EX4 A;  1ITG A;  3ZX2 A;  2O8C B;  3HPH A;  5EX5 A;  2NZT A;  2HND A;  4PUO A;  5KI6 A;  4HUG A;  3HXM A;  2QWN A;  3EKU A;  4OO1 J;  4GY2 B;  1YUW A;  4CEO A;  3ZT4 A;  2NRT A;  1SV5 A;  4ID1 A;  3CCR N;  3WNH A;  1W9H A;  1YT3 A;  1UOC A;  1HPM A;  4CZH A;  5SZT A;  5J2N A;  1TKD A;  4F2R A;  2YNI A;  3H3O B;  4CHN A;  2JWK A;  2HW3 A;  3KD1 E;  4KRF A;  2ZJR L;  3S41 A;  3K5L A;  2P1J A;  1KD1 O;  1Q18 A;  3ZT1 A;  3VF4 A;  4FWK A;  4AM7 A;  4OKJ A;  5F2R A;  3WXK A;  2RE2 A;  1H1V A;  1L3T A;  2HHT A;  1B92 A;  3ZEU B;  4ISG A;  3C6A A;  1XC3 A;  4GVE A;  1JCG A;  1QQC A;  2OTL N;  4B9U A;  3DRR A;  1U4B A;  2P9S B;  4FOE A;  4CJS A;  4CJ5 A;  2BTF A;  3EE9 A;  1V4T A;  3ZT2 A;  5LJV A;  5J2P A;  1HX1 A;  3S3N A;  3BZK A;  1M1K O;  1SS6 A;  5C25 A;  5C2D A;  4IDK A;  1RT5 A;  3ZCM A;  4JS5 A;  3NGZ A;  1XNR K;  4FO0 A;  2BUP A;  4AH9 A;  3L0Q A;  4BC4 A;  3OS2 A;  4ILH A;  2O8E B;  3DRP A;  1VSH A;  1OVQ A;  3CPE A;  4GV9 A;  3D2F A;  1LAW A;  3THY A;  1VQO N;  1TK5 A;  5JVG L;  3O80 A;  5GAG P;  1WSG A;  5BN9 A;  4FLY A;  4MDB A;  3VET A;  4YDU C;  1RTD A;  1D9D A;  3BGR A;  4DUY K;  4RW6 A;  2YHW A;  5KPR A;  2VWJ A;  3VQ6 A;  3DM2 A;  5AQG A;  3D45 A;  4BRP A;  3CFR A;  5E41 A;  1VSD A;  2ZJQ L;  3CXC M;  4AHC A;  4AHU A;  2G8F A;  4ILJ A;  2UUA K;  5FLX O;  2ASO A;  4FLT A;  1KQS M;  3A5N C;  3NE6 A;  3KZB A;  5FRO A;  4OPK A;  1NG9 A;  5FPM A;  4LD0 A;  4DLE A;  4C8L A;  2P9K A;  2E6M A;  4KHS A;  5KRT A;  1QS4 A;  2QWO A;  1OVY A;  3AVC A;  3MN9 A;  1R59 O;  1MWK A;  4QOZ B;  3M6G A;  2E2Q A;  1BGX T;  3ASM A;  4EAH D;  3PX0 A;  4YOU A;  5AQV A;  1N33 K;  4FJ5 A;  4FPB A;  1FXX A;  3QBW A;  4CGH A;  3P83 D;  4LF4 K;  4DV3 K;  3ATV A;  4E1N A;  2HHW A;  4FJX A;  3HM8 A;  3NF6 A;  1E3M A;  2QI2 A;  2GEM A;  4FWN A;  3AVM A;  3SQ1 A;  3VF2 A;  3SUO A;  1Q82 O;  4CEF A;  4FJ8 A;  5C0Y A;  4CEQ A;  4UY8 O;  2P9S A;  3ALY A;  3KK2 A;  3PSF A;  3OYH A;  4FLU A;  1J6Z A;  4FWO A;  5HRO A;  4F9O A;  1YIT N;  1VRT A;  3A0I X;  3CCJ N;  4KTQ A;  4ISF A;  4AHT A;  4IJN A;  1Z25 A;  3AA4 A;  1ZXO A;  4CBU A;  2NRX A;  1RBU A;  4DKW A;  4CZJ A;  1S22 A;  4KHY A;  2O8E A;  4M7Y A;  3L2R A;  1VQ5 N;  3ZSR A;  4B3S K;  3G6E N;  3TAR A;  2NLX A;  1SQK A;  4WQ5 A;  2KW4 A;  4DR3 K;  2E6L A;  3RMC A;  4CEB A;  1VQP N;  2G8V A;  3VEZ A;  5BRD A;  3J81 O;  4FWQ A;  3LDQ A;  2NRZ A;  1IG9 A;  4BR0 A;  1O13 A;  3ZSX A;  3UKR A;  5GIO A;  1YJ9 N;  4MO4 A;  4YNQ A;  2OAN A;  3VOV A;  4JKE A;  2B4J A;  3MWT A;  4WF9 L;  3HM9 A;  4FJ9 A;  4JI4 K;  1QZ6 A;  1C1A A;  4KTW A;  5T7B A;  2NNW A;  4IBN A;  4PKH A;  5AZI A;  2R7Y A;  3RWU A;  2GUP A;  3DXK B;  4FM0 A;  1XHZ A;  2IGI A;  4DTN A;  4G9Z A;  3SZ2 A;  4IOC L;  3JYT A;  4GMJ B;  2Z1H A;  4BRF A;  3OS1 A;  3OYC A;  5EOY A;  5D3G A;  4DQ8 A;  2YKM A;  2HVI A;  3OW2 M;  1NGE A;  2BH1 A;  3AV9 A;  3KKR A;  4AM6 A;  4Z4C A;  4NLC A;  3MXJ A;  4X62 K;  2UUB K;  2YNH A;  3VES A;  4BDY A;  4E1M A;  2E1Y A;  1S1X A;  4W5R A;  2IS3 A;  4CHQ A;  5JVH L;  1HNI A;  1NGH A;  2UYT A;  2CH6 A;  5LMN K;  4JAX A;  3PO4 A;  3AVH A;  3T19 A;  5I42 A;  4KV8 A;  3U3G A;  1Q7Y O;  2HBK A;  3HK2 A;  1F21 A;  1VSM A;  4WFB L;  4H5N A;  4DHY A;  4PHT X;  3LWL A;  3VTH A;  2X6N A;  3SMS A;  4H0P A;  1EET A;  3WQU A;  4N5S A;  4PWD A;  4I2P A;  3EEQ A;  1BA1 A;  5CZ2 A;  2A1S A;  4IOX A;  3R9P A;  4JI5 K;  3C65 A;  4CF8 A;  1ASW A;  4B1Y B;  3PY8 A;  3B6O A;  4RW9 A;  4X66 K;  4LY7 A;  1HQE A;  3SPY A;  3CM6 A;  1LW0 A;  1VRU A;  1KVA A;  3KLF A;  4IOA L;  1HRH A;  3IUC A;  4CFA A;  5CE3 A;  4KI4 A;  2P9P B;  2V7Z A;  3NDK A;  3O08 A;  4A5B A;  4BR9 A;  1QQO A;  4K41 A;  4LF8 K;  2YJF A;  5J2M A;  2PAV A;  3ZSO A;  4BG9 A;  2WC9 A;  1TUY A;  4I7F A;  3LM2 A;  1T44 A;  2P5O A;  3I55 N;  3AAP A;  3KJV A;  3SPZ A;  4CF2 A;  2F8T A;  3R1X A;  3CCM N;  4JKC A;  2AJQ A;  3HRG A;  4YOR A;  3WEE A;  3KTQ A;  4B8A B;  2UUC K;  5BR8 K;  2Y1I A;  4GV3 A;  2W41 A;  3ZT0 A;  3GDQ A;  3NH1 A;  3WNG A;  4R79 A;  1J5O A;  3ITH A;  2FBY A;  3D6R A;  4BC2 A;  5FPN A;  4BE1 A;  4FJH A;  1VQ4 N;  3I56 N;  3NH2 A;  2YX6 A;  3M8P A;  1ASU A;  4C8N A;  5AFU H;  1S72 N;  4B9L A;  2EWS A;  4LH4 A;  3W0L A;  1BI4 A;  3THV A;  4CZL A;  3TAB A;  3MDQ A;  2EHG A;  3QER A;  1CLQ A;  1DKG D;  1TL3 A;  1VSJ A;  2F9T A;  1QVF M;  3OA9 A;  3THW A;  1ZBS A;  2YCH A;  1HJR A;  4CF9 A;  1U47 A;  2HHS A;  4FJ7 A;  3HSC A;  5AQW A;  4E19 A;  4BE2 A;  3U9Z A;  1JXE A;  3I0S A;  4PL8 A;  4E7L A;  1NLV A;  2FLO A;  4O0I A;  3K9K A;  4A5A A;  3PIP L;  1REV A;  3MEE A;  2BE2 A;  1TL1 A;  4IG0 A;  1G15 A;  3VEV A;  1RDC A;  3HVT A;  5HRS A;  4PKG A;  3NHG A;  4LF9 K;  3OBW A;  3VGM A;  4KFB A;  2OPR A;  2O8D A;  5C10 A;  2RF2 A;  4CEZ A;  1VAZ A;  2X78 A;  4GKJ K;  5JIC A;  2OZS A;  3O8M A;  1RGI A;  2F4V K;  3O9R A;  3OYJ A;  5EU7 A;  4B08 A;  2XY7 A;  2P9P A;  1RDA A;  2X6S A;  3CJB A;  4BC5 A;  3W3D A;  5CZ1 A;  3M3Z A;  1QZ5 A;  3O4W A;  3SQ0 A;  4FVM A;  5I3U A;  3LAK A;  4C23 A;  1WNS A;  2O4I A;  1UAX A;  3V9X A;  2P9I A;  3CPW M;  4FPA A;  1U48 A;  2ATQ A;  4CES A;  3L2V A;  4JKH A;  3DLG A;  1NK7 A;  3NAE A;  2W42 A;  4ILG B;  3H08 A;  2V52 B;  3PLA A;  3DAW A;  3TAG A;  2IVO A;  4GVM A;  2P5G A;  3ZSW A;  3C94 A;  4C8M A;  1JL2 A;  1JXB A;  4FSV A;  1FKO A;  2E8A A;  3CJ9 A;  3K57 A;  2HHQ A;  3WNE A;  4LFA K;  1MDU B;  2ZGY A;  2ZE2 A;  1SL2 A;  1NGJ A;  1OH5 A;  5GIN A;  3SK3 A;  5C42 A;  3C0B A;  1OKJ A;  3IMX A;  3CME N;  3E9O A;  5KRS A;  3P31 A;  3MAQ A;  4BRG A;  1HKC A;  3G4S N;  1NGG A;  3HI0 A;  4E7K A;  4FLV A;  1DTT A;  4CFD A;  5FPE A;  3CCV N;  3H6E A;  1U45 A;  4B3T K;  4JRQ A;  3P1G A;  3A2F A;  3AO4 A;  2HNZ A;  4CJL A;  5DK5 A;  4BAC A;  3AA5 X;  2PBD A;  1OH7 A;  3T69 A;  4HHT A;  3VQ5 A;  1Q9X A;  1BQM A;  3SUN A;  4FZY A;  4M7X A;  3C6U A;  4CHO A;  1WUA A;  3H46 O;  3MWP A;  4FWS A;  3JXU A;  1RDW X;  4BRM A;  4K43 A;  4AIL C;  1TK8 A;  4Q0B A;  2HHU A;  1NWK A;  2VG7 A;  1L3U A;  1TKT A;  1W7A A;  5JMV A;  3OYD A;  3H1Q A;  3SNN A;  4OGE A;  4DUZ K;  5HL7 L;  1JLB A;  1BWF O;  3G25 A;  1C0G A;  3NGY A;  2XHB A;  1DTQ A;  3AVG A;  4HTL A;  1BL3 A;  3R6M A;  4FW1 A;  3O9T A;  4A57 A;  3RMD A;  4BRC A;  4B1W B;  4NXM K;  3CQY A;  5AQH A;  3AA3 A;  3H3N O;  5GAD P;  3KWG A;  1XNQ K;  4Z0U A;  3AVN A;  1RBR A;  3OS0 A;  1YTA A;  4LF5 K;  4BQZ A;  2OYQ A;  5AQU A;  5F0X A;  2HST A;  4X65 K;  2GUI A;  3OYK A;  3VGK A;  4K25 A;  3CD6 N;  2P9N A;  3LP0 A;  3Q7C A;  1CZB A;  1HMV A;  4QCL A;  3SAG A;  5JS1 A;  3TAE A;  3J7A P;  2GEL A;  4Q5V A;  3E01 A;  3OYI A;  3HST B;  3CCE N;  2E4L A;  4BRN A;  2E88 A;  1Y64 A;  3N4Q A;  3J80 O;  4OJR A;  4QAG A;  1YTU A;  4JKG A;  3D2F B;  3THY B;  2I5J A;  4JI0 K;  4FWL A;  3OYA A;  4H0V B;  4DTO A;  3HO1 A;  3TI0 A;  4YY3 K;  5FRM A;  3A5M C;  1WSH A;  2OPS A;  2QM1 A;  4CGF A;  3G0Z A;  3TPQ A;  2DFF A;  4WQ4 C;  2QWL A;  4CJW A;  3SAF A;  4M41 A;  2CGK A;  1KCF A;  1C0T A;  1WSF A;  4M45 A;  2Q31 A;  4B9N A;  3GBT A;  3KVG A;  2EX3 A;  4YOY A;  1K6Y A;  4WFA L;  3PV8 A;  2I7P A;  3SLC A;  4CE9 A;  1NKE A;  3CHW A;  2HHH K;  3FZH A;  3OJU A;  1SUQ A;  5M1P A;  2ZF5 O;  1NK4 A;  3T1H K;  3HVR A;  2WBN A;  1BIS A;  3ULE B;  3AVJ A;  5KTQ A;  3DYA A;  1IJJ A;  4MFB A;  1KSP A;  1JLQ A;  3QET A;  3RTV A;  3OHR A;  2FF6 A;  3VMF B;  2P9K B;  3AA2 A;  1C0U A;  3P38 A;  1Z05 A;  3KK7 A;  2D0A A;  3VEN A;  3CQ8 A;  4LFC K;  5K14 A;  3L2U A;  1YJN N;  5EY4 A;  3WXL A;  3CQX A;  2GBZ A;  4ZHR A;  3DRS A;  4DFK A;  1XC9 A;  1NOZ A;  1QQM A;  3FGU A;  1RT6 A;  2A42 A;  2HBJ A;  3I8B A;  3ZSZ A;  4CJP A;  1I39 A;  2QXF A;  4KBO A;  3TWH A;  3SBG A;  3HT3 A;  2VQF K;  3CC7 N;  2BGG A;  2OTJ N;  4EHU A;  1E4G T;  2VG5 A;  3ZET A;  1RBV A;  5AQT A;  3MMV A;  1K73 O;  2D0C A;  3DXM B;  3E9P A;  4DR4 K;  3K59 A;  3KD5 E;  1DLO A;  2E5L K;  3GE1 A;  4JK9 A;  5B8H A;  1LWE A;  3MX2 A;  1BG3 A;  1QSS A;  3A8Y A;  1QVG M;  5AQK A;  1B9D A;  4HWI A;  3ENB A;  1LCU A;  4CJK A;  1RCH A;  4ZTF A;  3R3L A;  2FBX A;  1NGC A;  5CYM A;  5JLF A;  1GLD G;  4CJT A;  4PL7 A;  2IDO A;  1JLC A;  3WXJ A; 
#chains in the Genus database with same CATH homology
 2HVI A;  1C0M A;  4FJN A;  3HYF A;  1NK9 A;  3AV9 A;  3KKR A;  4CIF A;  4E7I A;  3L2Q A;  4Z4C A;  1NKB A;  3MXJ A;  1JKH A;  2YNH A;  3LAL A;  2P51 A;  3OYB A;  4CCH A;  3TAP A;  1NJZ A;  1FKP A;  4BDY A;  2PY5 A;  4DG1 A;  4E1M A;  2KTQ A;  1S1X A;  4W5R A;  4NCG A;  4BE0 A;  3V9W A;  1C1C A;  2IS3 A;  4CHQ A;  3BDP A;  2HVH A;  1HNI A;  1S6P A;  4FZX C;  2BAN A;  4M3U A;  1IKV A;  4CEA A;  3LDS A;  4O5B A;  3PO4 A;  3AVH A;  4EP4 A;  3T19 A;  1WAJ A;  5I42 A;  4KAZ A;  4KV8 A;  1BCO A;  1TGO A;  3AO2 A;  3U3G A;  1IKW A;  4DQR A;  4DQI A;  4F8R A;  3S9H A;  3V4I A;  2IAJ A;  3HL8 A;  3OY9 A;  1NK6 A;  1VSI A;  1KLN A;  3O3F A;  4BDZ A;  3HK2 A;  2F8S A;  3QNO A;  1F21 A;  1VSM A;  3VQE A;  2KFN A;  1IO2 A;  1EKE A;  2RPI A;  3ZT3 A;  3OYL A;  4CF1 A;  3KK1 A;  3VQD A;  1Y97 A;  1WSJ A;  2X6N A;  4CJ4 A;  4LSN A;  3WNF A;  3PX6 A;  4F4K A;  1QSY A;  1U04 A;  1EET A;  2O4G A;  3ZSQ A;  1HYZ A;  1TKZ A;  4DS4 A;  1S1W A;  4N5S A;  4PWD A;  3T3F A;  1EP4 A;  4I2P A;  1ASV A;  1HYV A;  4OLA A;  5CZ2 A;  4CHZ A;  4UQG A;  2A1S A;  4K8Z A;  3DLR A;  4CEE A;  4M3T A;  3RR7 A;  4IFY A;  3MEC A;  3L2W A;  4DQS A;  4CF8 A;  1ASW A;  4PY5 A;  3QEP A;  2D5R A;  4OVL A;  4CJV A;  3PY8 A;  4M3X A;  3B6O A;  3TR8 A;  1TK0 A;  4CFB A;  3AO1 A;  4RW9 A;  3MXI A;  3DLE A;  4LY7 A;  4MQ3 A;  1HQE A;  2XY8 A;  3SPY A;  4DWI A;  1LWF A;  2DFE A;  3CM6 A;  1LW0 A;  1VRU A;  2OPQ A;  4DFM A;  3QEI A;  1KVA A;  4FM2 A;  3KLF A;  1HRH A;  1WSE A;  4CFA A;  4KHN A;  1O1W A;  1ZBI A;  4LSL A;  4CJ3 A;  4F2S A;  2HB5 A;  2LSN A;  3NDK A;  1NKC A;  4KI4 A;  4HUE A;  4TSX A;  3RMB A;  1ZBU A;  3CFP A;  4Z4I A;  1MU2 A;  2XY6 A;  4JLH A;  5J2M A;  4RW4 A;  3ZSO A;  2ZD1 A;  2Z1I A;  3O3H A;  3CG7 A;  3AO3 A;  4I7F A;  4I9L A;  3C6T A;  2P5O A;  3NFA A;  4DSL A;  4KTZ A;  3KJV A;  4CF2 A;  3VA0 A;  3DOL A;  3SPZ A;  2F8T A;  3SCX A;  2QK9 A;  3M8S A;  2YHA A;  3P5J A;  4F3T A;  4IFV A;  3LZJ A;  3SV3 A;  3VQB A;  2AJQ A;  3HPO A;  4ZTJ A;  4Z4F A;  3S3O A;  5DMR A;  1L5U A;  3KTQ A;  4B8A B;  1D5A A;  5KGX A;  2Y1I A;  4CIG A;  2QKB A;  4E3S A;  3ZT0 A;  4KI6 A;  3NH1 A;  1BCM A;  4FLZ A;  3WNG A;  2YV0 X;  4N41 A;  4JRP A;  1J5O A;  3VN5 A;  3ITH A;  1CXU A;  2FBY A;  4HVJ A;  4AHS A;  1JLE A;  3RR8 A;  4DQQ A;  4IG3 A;  2DY4 A;  4BE1 A;  4CIE A;  1N5Y A;  2Q3S A;  3VQA A;  4FJH A;  4FW2 A;  4B8C A;  3NF8 A;  2DTU A;  4BWM A;  4OPJ A;  3NH2 A;  4CK1 A;  4GW6 A;  3M8P A;  3EZ5 A;  3VA3 A;  3V6D A;  1ASU A;  5CY4 A;  4B9T A;  3QIN A;  2G8W A;  1UA0 A;  3CM5 A;  3LPU A;  1KTQ A;  4C8N A;  4DU4 A;  1GOC A;  3NF9 A;  4B9L A;  5HLF A;  4LH4 A;  3K5O A;  1BI4 A;  3THV A;  4YFU A;  2F96 A;  2B5J A;  1NJY A;  5HRN A;  2PYL A;  3QNN A;  4B9V A;  4J2D A;  4NCA A;  1ZYQ A;  1X9M A;  1TAQ A;  3TAB A;  2EHG A;  3V1O A;  3VQ7 A;  4CJQ A;  4W5O A;  3QER A;  4AHR A;  1CLQ A;  4DTU A;  1RTJ A;  3HP9 A;  1VSJ A;  1TL3 A;  1VSE A;  1NK8 A;  1KRP A;  4FJM A;  1C1B A;  3MXM A;  4Z4H A;  4KHQ A;  3KLH A;  2IOC A;  1L3V A;  3D0P A;  1HJR A;  1RT2 A;  1WSI A;  3KLI A;  4CF9 A;  1U47 A;  1WN7 A;  4KB0 A;  4FJ7 A;  2HHS A;  3NH0 A;  3OVN A;  4C8O A;  3QLH A;  4E19 A;  4BE2 A;  4Z4E A;  1S9E A;  1X1P A;  1R0A A;  1JXE A;  3I0S A;  4DSE A;  4DSK A;  1SKS A;  3LP1 A;  4E7L A;  1ZBL A;  3NCI A;  4RG8 A;  1TKX A;  2OA8 A;  4RW7 A;  4O0I A;  4B9S A;  4FYD A;  1IH7 A;  3JSM A;  1REV A;  4PQU A;  3MEE A;  4G1Q A;  2BE2 A;  1TL1 A;  4DSI A;  3LZI A;  2HNY A;  1ZBH A;  4IG0 A;  4CGI A;  1G15 A;  3CYM A;  1BI4 B;  1RDC A;  1KVC A;  3HVT A;  5HRS A;  3SUP A;  4CJU A;  1RT3 A;  1LAV A;  3NHG A;  3DLB A;  3I0R A;  1WLJ A;  4K8X A;  1TVR A;  4KFB A;  2OPR A;  4DTJ A;  4FJI A;  2RF2 A;  4CHP A;  4N76 A;  4CEZ A;  1D8Y A;  3LAN A;  1J54 A;  4CEC A;  3AVL A;  3PUF A;  4J2B A;  2X78 A;  2OZS A;  2HMI A;  1NK0 A;  4KRE A;  3OYJ A;  5EU7 A;  4B08 A;  4R5P A;  2XY7 A;  1RDA A;  3K5N A;  3TAN A;  2KQ2 A;  3IS9 A;  3LP2 A;  2Y1J A;  2X6S A;  4CK2 A;  3AVI A;  3QES A;  4KHW A;  5C24 A;  3RRH A;  4HCC A;  3OYE A;  3AVA A;  2ETJ A;  3U3Y A;  1BIZ A;  3QIO A;  5CZ1 A;  3SQ0 A;  1GOB A;  4FVM A;  5I3U A;  3QO9 A;  4Y1D A;  4DS5 A;  3HJF A;  3LAK A;  4M3R A;  2HHX A;  2PZS A;  1WNS A;  4CF0 A;  2O4I A;  1UAX A;  4FJJ A;  2PYJ A;  3M8Q A;  4HTU A;  2ITG A;  3V9X A;  2NUB A;  4O44 A;  4FXD A;  1WAF A;  5CYQ A;  1U48 A;  4J2A A;  2G8I A;  3KLE A;  4B3O A;  2ATQ A;  4CES A;  4O55 A;  1EXQ A;  2RN2 A;  3DLG A;  3L2V A;  4DTS A;  3QEV A;  4FZZ A;  2YNF A;  3VQ8 A;  1TAU A;  3LP3 A;  1NK7 A;  2KZZ A;  3NAE A;  4FK4 A;  4DTX A;  4RW8 A;  2W42 A;  4I2Q A;  4JS4 A;  1S5J A;  4OKK A;  5JS2 A;  3H08 A;  3OYN A;  3OJS A;  3O4N A;  3LWL A;  3TAG A;  1QHT A;  3L8B A;  1QSL A;  4CER A;  1T8E A;  3O3G A;  4GVM A;  4E7J A;  2P5G A;  1A5X A;  1S9G A;  3SV4 A;  1KVB A;  2OPP A;  3ZSW A;  1RT7 A;  3C94 A;  4FJG A;  4DFJ A;  1NJX A;  4KB1 A;  1NK5 A;  4FK2 A;  2A1R A;  4AHV A;  4J2E A;  3V1R A;  3ISN C;  4C8M A;  1JL2 A;  1JXB A;  3AO5 A;  1QE1 A;  1S1T A;  3VQQ A;  1FKO A;  1LW2 A;  1HPZ A;  3RMA A;  4CJR A;  4EZ9 A;  3SYZ A;  1EX4 A;  1ITG A;  3QIP A;  3K57 A;  2HHQ A;  3WNE A;  2YKN A;  2ZE2 A;  2XY5 A;  3HPH A;  1JL1 A;  2HND A;  4E89 A;  3AVB A;  1SL2 A;  4FJL A;  4PUO A;  1VK0 A;  3L3V A;  5KI6 A;  5C42 A;  1KLM A;  4HUG A;  3HXM A;  1LV5 A;  2KFZ A;  4DTR A;  1KFD A;  4O4G A;  4CEO A;  2WON A;  5KRS A;  3ZT4 A;  4CED A;  1FK9 A;  3M8R A;  3KK3 A;  3MAQ A;  3RRG A;  1SV5 A;  4ID1 A;  3PX4 A;  1UWB A;  1J53 A;  3WNH A;  1TV6 A;  3SQ2 A;  1W9H A;  1YT3 A;  1UOC A;  1XI1 A;  2IC3 A;  1IKX A;  2JGU A;  5SZT A;  5J2N A;  4E7K A;  1TKD A;  4F2R A;  1RTH A;  1Z26 A;  4FLV A;  4DF4 A;  1DTT A;  4CFD A;  1RDB A;  2YNI A;  4DTP A;  1SL0 A;  3NF7 A;  4CHN A;  1U45 A;  3IAY A;  1BHL A;  4JRQ A;  3SUQ A;  2HW3 A;  3TAF A;  3KD1 E;  4KRF A;  1Q8I A;  3P1G A;  4WE1 A;  3KLG A;  3U6F A;  1SKW A;  3A2F A;  3AO4 A;  3K5L A;  4M3Y A;  3MED A;  2P1J A;  2HNZ A;  4O0J A;  1U49 A;  3ZT1 A;  4CJL A;  5DK5 A;  4BAC A;  3AA5 X;  3DLH A;  2D0B A;  4N47 A;  1BIU A;  5FDL A;  4HHT A;  1A5V A;  1YVU A;  4OKJ A;  3VQ5 A;  4XIU A;  4ELU A;  1L3T A;  1ZBF A;  2YNG A;  4CGD A;  1HYS A;  2HHT A;  1B92 A;  1JLA A;  1Q9X A;  1BQM A;  3DMJ A;  3SUN A;  4FZY A;  1QQC A;  2BDP A;  4CGJ A;  4B9U A;  3DRR A;  3C6U A;  4CHO A;  1U4B A;  1J9A A;  4CJS A;  3HP6 A;  1SKR A;  4CJ5 A;  4AIL C;  1KFS A;  4Q0B A;  1TK8 A;  4H4O A;  3ZT2 A;  2HHU A;  5J2P A;  3S3N A;  1S6Q A;  2HHV A;  2VG7 A;  2ZQB A;  1X9S A;  1L3U A;  1TKT A;  2XRI A;  4DU3 A;  4BDP A;  5KGW A;  5C25 A;  3OYD A;  3ULD A;  4DTM A;  3SNN A;  4OGE A;  4CFC A;  4DQP A;  1RIL A;  4N56 A;  1JLB A;  3VQC A;  2FC0 A;  3PO5 A;  4IDK A;  4DU1 A;  3NGY A;  4NYN A;  4NCB A;  2XHB A;  1RT5 A;  2G8K A;  3ZCM A;  4JS5 A;  1RDD A;  3NGZ A;  1DTQ A;  3AVG A;  1VSL A;  4BWJ A;  1A5W A;  4CJF A;  1BL3 A;  4AH9 A;  3K58 A;  4EZ6 A;  4OGC A;  4NYF A;  1UA1 A;  3OS2 A;  4FW1 A;  1SL1 A;  4E7H A;  3RMD A;  3DRP A;  1VSH A;  2JLE A;  3LPT A;  3AA3 A;  3V1Q A;  1LAW A;  2VG6 A;  1TK5 A;  4Z0U A;  1JLF A;  1Q9Y A;  3AVN A;  1RBR A;  3OS0 A;  1WSG A;  1YTA A;  4LH5 A;  5HRP A;  5HP1 A;  4FLW A;  3OYM A;  4FLY A;  2OYQ A;  3I8D A;  1RTD A;  1T05 A;  2GUI A;  3BGR A;  3OYK A;  4RW6 A;  1D9D A;  1B9F A;  3EYZ A;  1VSF A;  3LP0 A;  3KKS A;  3EY1 A;  1CZB A;  2VWJ A;  1HMV A;  4Y1C A;  4QCL A;  3F9K A;  1RBS A;  5JS1 A;  3VQ6 A;  3DM2 A;  1RTI A;  3TAE A;  3D45 A;  3VQP A;  4CGG A;  1HNV A;  4Q5V A;  3E01 A;  3OYI A;  4M3W A;  3HST B;  3V81 A;  4B9M A;  4Z4G A;  3CFR A;  5E41 A;  1VSD A;  4OKE A;  4FM1 A;  4AHC A;  4DFP A;  3DI6 A;  4ID5 A;  2Z1G A;  4AHU A;  2G8F A;  2E4L A;  3UIQ A;  4IKF A;  4OLB A;  4OJR A;  4QAG A;  4FLT A;  1YTU A;  4HUF A;  2I5J A;  1HQU A;  3OYA A;  3VQ9 A;  1VSK A;  4DTO A;  3HO1 A;  3V9U A;  3TI0 A;  3NE6 A;  5FRM A;  1WSH A;  2OPS A;  4DSJ A;  5FRO A;  3KIO A;  3CFO A;  4CGF A;  4OPK A;  4LD0 A;  4W5Q A;  4DLE A;  4C8L A;  2E6M A;  3TAQ A;  4KHS A;  5KRT A;  1QS4 A;  3G0Z A;  1RT4 A;  1X9W A;  1T03 A;  2DFF A;  4CJW A;  4M41 A;  3AVC A;  1CXQ A;  4QOZ B;  3ZSV A;  1NOY A;  1KCF A;  1C0T A;  4EP5 A;  1WSF A;  2B6A A;  1BGX T;  3ASM A;  2Z1J A;  4M45 A;  2G8U A;  5J1E A;  2X74 A;  4B9N A;  2YHB A;  3PX0 A;  3MEG A;  3L3U A;  3NBP A;  4ELT A;  4FJ5 A;  1FXX A;  2EX3 A;  4CGH A;  1K6Y A;  3T1A A;  3P83 D;  3VQ4 A;  3FFI A;  3PV8 A;  4CE9 A;  1NKE A;  3SI6 A;  1D9F A;  4E1N A;  3OJU A;  1SUQ A;  2HHW A;  4FJX A;  1NK4 A;  3ZSY A;  4HCB A;  3NF6 A;  3HVR A;  1RT1 A;  4M3Z A;  1BIS A;  3AVJ A;  1IKY A;  3AVM A;  5KTQ A;  2FBT A;  4H8K A;  1T7P A;  3SQ4 A;  3SQ1 A;  1XWL A;  3SUO A;  4FJ8 A;  4CEF A;  1I3A A;  3DYA A;  4MFB A;  4CEQ A;  3LWM A;  2FBV A;  1JLQ A;  1KSP A;  1RNH A;  3QET A;  3G10 A;  3ALY A;  3RTV A;  4KO0 A;  3KK2 A;  4DSF A;  3TAM A;  3AA2 A;  3DLK A;  3QEW A;  1C0U A;  3OYH A;  4E0D A;  4FLU A;  5HRO A;  3V9S A;  3F73 A;  1VRT A;  3K5M A;  2D0A A;  3K2P A;  3CQ8 A;  5K14 A;  3L2U A;  4KTQ A;  4AHT A;  1Z25 A;  3AA4 A;  2GBZ A;  4ZHR A;  3DRS A;  3AVK A;  3OYF A;  2DFH A;  4DFK A;  1LWC A;  1NOZ A;  5HRR A;  4KKO A;  3OYG A;  1XC9 A;  3AVF A;  1RT6 A;  3SJJ A;  1S1V A;  1RBU A;  1QTM A;  4FK0 A;  4DMN A;  4KHY A;  5SWM A;  4H4M A;  2RKI A;  4C8K A;  3ZSZ A;  4CJP A;  1I39 A;  1S1U A;  3L2R A;  4CK3 A;  2QXF A;  3ZSR A;  1L3S A;  3TWH A;  4FLX A;  3TAR A;  4ELV A;  4ICL A;  3HT3 A;  3NGI A;  2BGG A;  2KW4 A;  2GV9 A;  4FJK A;  2E6L A;  2OZM A;  4W5N A;  2VG5 A;  3IRX A;  4CEB A;  3RMC A;  4F3O A;  4PA1 A;  2VWK A;  3S3M A;  1RBV A;  1N6Q A;  3IG1 A;  2G8V A;  4M42 A;  4KPY A;  1W0H A;  2D0C A;  3QEX A;  3K59 A;  3C95 A;  1IG9 A;  3KD5 E;  1DLO A;  3ZSX A;  1JLG A;  1XHX A;  2QKK A;  2XO7 A;  4KHU A;  1LWE A;  4FCY A;  3DOK A;  4YNQ A;  4DF8 A;  1GOA A;  2B4J A;  1CZ9 A;  3HM9 A;  1QSS A;  4W5T A;  4FJ9 A;  3HPG A;  1B9D A;  1C1A A;  5HBM A;  2KZM A;  4DLG A;  4KTW A;  5T7B A;  4IBN A;  2R7Y A;  3RWU A;  4FM0 A;  4CJK A;  1RCH A;  1XHZ A;  1NJW A;  3B6P A;  4ZTF A;  2IGI A;  1BQN A;  2WOM A;  4DTN A;  4L8R B;  3SZ2 A;  1RBT A;  2FBX A;  5CYM A;  3O4Q A;  4GMJ B;  2Z1H A;  3JYT A;  4CHY A;  3OS1 A;  3OYC A;  4I9Q A;  4CJT A;  4CJE A;  5J2Q A;  1C6V A;  2G8H A;  5D3G A;  2IDO A;  2YKM A;  1JLC A;  3V9Z A;  5FRN A;  3LAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...