4CE9A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ce9A00
4CF0A 1TKZA 3NF7A 3PUFA 5C42A 3OYDA 3I0SA 4B9NA 2HHSA 4H8KA 3IAYA 4WE1A 2G8WA 3HJFA 1S1WA 3VQEA 4KV8A 4DSFA 3HVTA 3C6TA 3NHGA 2YNGA 4E7LA 1QTMA 4CFBA 1X1PA 1RBSA 4L8RB 4E7IA 2VWKA 1YTAA 1RTIA 2F8SA 3L2UA 1YVUA 2EHGA 3ALYA 3AVIA 3MEEA 1NKBA 3LPUA 1D9FA 1KFSA 4CHYA 1IH7A 5CZ1A 4JRPA 4GMJB 3VQDA 2G8FA 4CHQA 4DQIA 4M3RA 4B9SA 3ZSXA 4B08A 3ZSQA 3HXMA 4ELUA 4KPYA 3AO3A 1DLOA 1EP4A 3KLIA 1EKEA 3AVAA 1IG9A 3QESA 3M8QA 1HYZA 1JLGA 1JXEA 3B6PA 4NCAA 3THVA 2VG6A 4E7HA 4M42A 4J2AA 2RF2A 4FVMA 4KFBA 4HUEA 4Z4EA 3V81A 4W5NA 1ITGA 1LW2A 1VSIA 4CJUA 1X9WA 1RDAA 4KB0A 2KFNA 4GVMA 4H4OA 1VSEA 3VQAA 1QQCA 3L2WA 2YHAA 1SV5A 4DS5A 1KVCA 4CJVA 4C8MA 4DLEA 3TAEA 1DTTA 3O4QA 4KO0A 3VA0A 1ASVA 4KHUA 2IS3A 5HBMA 3T3FA 4FXDA 2JLEA 4CJKA 3M8PA 4I2PA 3AVGA 3TAPA 1YT3A 1RTDA 1VSJA 4MFBA 1MU2A 4IFYA 4B9VA 4I2QA 4Z4GA 4FJNA 1SL1A 1VSHA 3VQ4A 2A1SA 1NK4A 3G10A 4DTMA 4KAZA 4OPKA 1HNVA 4NYNA 3OYGA 1NJYA 4FJHA 4CERA 4E0DA 4O44A 3SQ1A 1KCFA 3AO1A 4CIEA 4B9TA 4FZZA 3QNNA 1JLCA 3CM6A 3AVLA 4FM2A 2XRIA 3M8SA 3TARA 1U45A 2W42A 4CJLA 3V9WA 1IKXA 3AVFA 1C0TA 4FZXC 1W9HA 4N47A 4AHRA 3ZSWA 4LH5A 4W5QA 4DQQA 4YFUA 4F2RA 3AVNA 4LSNA 3O3GA 3SI6A 1U49A 4FJ9A 4HCCA 1WAJA 2Y1JA 1BQMA 1U04A 4CJFA 3KLFA 3KK1A 3K5NA 5HLFA 4PUOA 1RBRA 1N5YA 3ITHA 4BACA 4NYFA 4DSEA 4F4KA 4FK4A 4OPJA 2I5JA 4BE0A 3OS2A 1HQEA 2ETJA 1C0UA 3HK2A 3L2VA 1TL3A 1CZ9A 3ZT4A 3K58A 3NF8A 2B6AA 1NK7A 1UWBA 3ZT2A 3OS1A 3KK2A 2YNFA 1RTHA 3NF9A 3V6DA 4E1NA 4CF1A 2F8TA 3LWMA 1RDCA 1XWLA 3OVNA 3OJUA 1BCOA 5HRRA 5KRSA 1HNIA 3QO9A 4CCHA 5C24A 3T19A 2D0CA 1U48A 3SNNA 1U47A 4CEEA 1RT7A 2E4LA 3ZCMA 2YHBA 3RR7A 4CIGA 5KTQA 3AA2A 3OYNA 1ASUA 3DOKA 3IS9A 3P5JA 4DU1A 4R5PA 2X74A 1QHTA 4KHSA 1WNSA 2DFHA 1J9AA 2ITGA 2FBXA 1RDDA 2FBYA 1B9DA 4Y1CA 4EZ6A 3QEWA 3V9UA 1HYVA 3LALA 4IFVA 3VQCA 4ID5A 1IO2A 1BI4A 3L2RA 1JLFA 1TVRA 3RMBA 3OYLA 1NOYA 2KQ2A 3HPOA 4B3OA 2JGUA 3MECA 3ASMA 3SZ2A 1RT5A 2GBZA 4FZYA 2DFFA 2XY8A 1ZBIA 1K6YA 3C6UA 3IG1A 1VK0A 3D45A 4M3YA 1QE1A 3EZ5A 4AILC 3RMAA 1RCHA 1N6QA 3AVMA 2PYLA 4QAGA 4RW7A 2IOCA 4BWJA 3V9SA 1J5OA 4FJLA 2D5RA 5FRMA 3O4NA 3TWHA 3L2QA 4FM1A 3CQ8A 4DTRA 3AVCA 3CYMA 1GOCA 4F8RA 2R7YA 4HTUA 1FXXA 3HYFA 3ISNC 4FK2A 3DRRA 3AA4A 2XO7A 4AHCA 5FROA 3K59A 4I7FA 4LSLA 2XY7A 3K5OA 4FLZA 3SCXA 4J2DA 3SUPA 4Z4IA 3HL8A 3AVHA 4AHSA 4LD0A 3MEDA 1EX4A 1C1AA 3AA3A 3ZSOA 1RT4A 3MEGA 2ZD1A 4CK1A 4EP4A 4CHOA 3TAGA 4KI4A 3RMCA 3OY9A 4DF4A 2P51A 3U6FA 2GV9A 2HW3A 4JS5A 2BGGA 1IKWA 4KREA 1X9MA 3K5MA 4ID1A 2QK9A 4PWDA 4CK2A 4O0JA 3AV9A 4KKOA 4J2EA 4FYDA 4IDKA 4FJJA 1TK5A 2IDOA 4RW4A 1Q8IA 1VSLA 4DLGA 3VA3A 1R0AA 4W5RA 1CXUA 1TGOA 3OYBA 4CJEA 3ZT1A 3BDPA 4KTWA 3JYTA 3A2FA 4OKJA 3RRHA 4DFMA 3AO2A 1NK6A 1S6PA 2Z1JA 5CYMA 1WSGA 3VQ9A 2E6LA 3HVRA 1T05A 3CFRA 3SJJA 5KI6A 3K5LA 4JRQA 2P5GA 3HPHA 4KTQA 2KTQA 3MXJA 3S3MA 2G8VA 1XHZA 4CHZA 5FDLA 3LPTA 2IGIA 3ZSYA 3QLHA 4AHTA 5J2QA 2ATQA 2E6MA 3QINA 4HHTA 5J2PA 3MXMA 1NJWA 4AHUA 3RTVA 2Y1IA 5CZ2A 3PY8A 4CEFA 3F73A 4CGDA 3SV3A 3SPZA 3DOLA 4IG3A 3VQPA 4UQGA 1Z25A 1W0HA 5CY4A 3DRPA 3OJSA 4BE1A 1QSSA 1O1WA 1A5WA 4BDPA 3LZIA 2OPSA 1RT2A 1NK8A 2OYQA 1TAQA 4DSLA 4QCLA 2AJQA 2HVHA 2ZQBA 3QIPA 4Z0UA 3LZJA 4LY7A 4DTJA 1RBTA 1WSFA 3HM9A 2GUIA 4G1QA 3ZSRA 1QS4A 1VSKA 3VQ8A 4B9LA 3TI0A 3KLGA 2KZZA 1ZYQA 3U3GA 2PZSA 4K8ZA 4CF2A 3LP1A 3NAEA 4ELVA 2P1JA 3C95A 3HSTB 3SQ4A 3SUQA 1L3TA 3AO4A 3AA5X 4TSXA 2B4JA 5HRSA 4FJMA 1LWEA 5SWMA 3ULDA 2BDPA 4C8NA 1RBUA 3QEPA 2QKBA 1WSJA 3F9KA 4MQ3A 4M3XA 2XY6A 3CFOA 1GOBA 1LWCA 5DMRA 4CGJA 3V9XA 4FJGA 1QSYA 1S1XA 2OZSA 1NK9A 1KFDA 3NH2A 2A1RA 4J2BA 1YTUA 2HVIA 3DYAA 3VQ5A 1B92A 1VSMA 2OPRA 1UA0A 3KD1E 2DY4A 2DTUA 3ZSVA 5E41A 4DTSA 1ZBHA 4CFCA 5CYQA 1A5XA 4CEOA 3RWUA 3SPYA 4DFKA 1LAWA 1RT3A 4CEDA 4O0IA 4DQRA 4DTOA 1NJXA 1D9DA 4B9MA 4ZTJA 3OYFA 3U3YA 4C8OA 5KGWA 4RW9A 2FBVA 3NH0A 4F2SA 3NFAA 4FLXA 4FJ8A 4ICLA 1BIUA 1S5JA 4DF8A 1I3AA 3VQ7A 1LAVA 4CHPA 5HRPA 1CXQA 4CJRA 2Z1IA 2YKNA 4E1MA 1RTJA 4FJ5A 3VQBA 1J54A 1JKHA 4O4GA 1BCMA 1JLBA 1C6VA 2BE2A 2D0BA 3PV8A 1BQNA 1RILA 2KW4A 4ZTFA 1IKVA 3DI6A 1Y97A 3TAFA 4N5SA 3DLBA 4FJ7A 1U4BA 1B9FA 1NOZA 1S1TA 1HJRA 1RDBA 2D0AA 4DTXA 3QEXA 1KTQA 4IG0A 2P5OA 2Z1HA 3AVJA 4EP5A 4M3ZA 3L8BA 4KRFA 1LV5A 1JLAA 3P83D 3V4IA 3SUNA 2G8KA 4I9QA 4Q5VA 4DS4A 3HPGA 3QIOA 1KLMA 3ZT3A 4FLYA 1D5AA 1BGXT 2HHXA 2NUBA 3CFPA 4ZHRA 4KHQA 1VSDA 4HUGA 3HP9A 3O3FA 3KK3A 4FK0A 4RW6A 1WAFA 3KKSA 5T7BA 4DMNA 4LH4A 5FRNA 4C8LA 1Z26A 3NBPA 5HP1A 4CFAA 1L3SA 3DRSA 1BI4B 1G15A 4DU3A 3OS0A 3KIOA 2IC3A 5J2MA 1JL2A 2XY5A 3UIQA 4IKFA 2X6NA 4CF9A 4DSKA 4DQSA 3I0RA 1SKSA 3SYZA 2VWJA 1RNHA 2HHTA 4M41A 1WN7A 3I8DA 1JLQA 4BWMA 1CLQA 4HVJA 3PO4A 4HCBA 3RMDA 4KI6A 3DLEA 4AH9A 4CESA 3NH1A 4FM0A 1WLJA 5J1EA 3LDSA 1TV6A 3OYJA 4CK3A 4XIUA 1TK8A 4BDYA 1TAUA 2B5JA 3JSMA 4DFJA 1S6QA 3DM2A 4OKKA 4NCGA 3T1AA 4CJTA 2F96A 3IRXA 1Q9XA 4NCBA 4DTNA 1IKYA 2HNDA 1HQUA 3V1QA 3SQ2A 2OZMA 4DU4A 1UOCA 1FKPA 1FK9A 3NE6A 4I9LA 3CG7A 1S9GA 2HHQA 3KLEA 4CEAA 1L5UA 2O4IA 3AVBA 1JXBA 1TKTA 4BDZA 4RW8A 4W5OA 3OYEA 1S1VA 1KSPA 3DLRA 4FW1A 1EXQA 4E3SA 4B9UA 4B8AB 2HHWA 4O5BA 4GW6A 1KRPA 4CJ4A 4BE2A 4M3UA 1KLNA 3ZSZA 3RR8A 5HROA 4FJKA 3K2PA 3NF6A 1EETA 3LWLA 4FLTA 3HP6A 4DQPA 1SKWA 5DK5A 1TK0A 4PA1A 3LP0A 5SZTA 3S3OA 4DWIA 5K14A 3TABA 1UAXA 5KRTA 3QEVA 1VRUA 1T7PA 3O3HA 2X78A 3BGRA 1SKRA 4F3OA 1XI1A 4OKEA 1LWFA 4FLUA 4M3TA 4M45A 3EY1A 4KHYA 1UA1A 3SUOA 4CJWA 3MAQA 3PO5A 3DLGA 3MXIA 1XHXA 3D0PA 4M3WA 3LAMA 1S1UA 3OYMA 2IAJA 3S9HA 1L3UA 3ZT0A 3V9ZA 4KHNA 5I42A 2PYJA 4AHVA 1Q9YA 2X6SA 4CGGA 4CIFA 1RT6A 1DTQA 3QEIA 4N56A 1BL3A 2OA8A 1NK5A 2OPQA 3WNEA 1NKCA 3KTQA 2PY5A 5HRNA 3OYKA 3H08A 1GOAA 2Q3SA 4CECA 1C1BA 3VQQA 4H4MA 3OYCA 3S3NA 3OYHA 2RN2A 5JS2A 5EU7A 1C1CA 1FKOA 1HPZA 3KKRA 1ZBLA 3DLHA 1NJZA 4Z4FA 4Z4HA 1JLEA 1BIZA 4IBNA 2QXFA 2WONA 3K57A 1T8EA 2Z1GA 1REVA 3CM5A 1BHLA 1X9SA 3V1OA 4KHWA 1SUQA 4Y1DA 1JL1A 3WNGA 4E19A 4JS4A 3NGYA 3TAMA 3P1GA 1I39A 1L3VA 1A5VA 3NDKA 4DFPA 4OVLA 3M8RA 4E7JA 1NKEA 3L3VA 4HUFA 4KB1A 3KJVA 4DTUA 2WOMA 4OGCA 3SQ0A 4DSJA 2LSNA 4RG8A 2OPPA 3OYIA 2KFZA 2BANA 4K8XA 1XC9A 4CJ3A 1QSLA 3V1RA 3E01A 3LANA 4W5TA 4OJRA 4CHNA 3LP3A 2HHUA 1ZBUA 3RRGA 1KVAA 4CE9A 3NGZA 2YV0X 3OYAA 4PY5A 3L3UA 1J53A 4ELTA 2YNHA 4FW2A 2RPIA 1RT1A 4CGFA 2XHBA 2EX3A 4CJSA 1HRHA 3PX0A 4CJQA 3NCIA 3PX4A 4QOZB 4C8KA 1WSHA 2G8UA 3QETA 2QKKA 3VQ6A 1ASWA 4DSIA 2FBTA 4Z4CA 1F21A 2G8HA 2O4GA 3FFIA 4CGHA 1HMVA 4FLVA 5D3GA 3TAQA 1KVBA 4YNQA 5C25A 3AO5A 3AVKA 1VRTA 2HB5A 1SL2A 4FJXA 1VSFA 1ZBFA 3LAKA 3KLHA 1WSIA 4E89A 1SL0A 1CZBA 4CGIA 4JLHA 3DLKA 2YKMA 4PQUA 3WNFA 2DFEA 3HT3A 4DG1A 1D8YA 3SV4A 1TL1A 4DTPA 3NGIA 4FJIA 4CEBA 4N76A 2G8IA 5JS1A 3G0ZA 4FLWA 3PX6A 4CJPA 2YNIA 3VN5A 5I3UA 4EZ9A 4CEQA 1NK0A 4CFDA 1C0MA 4OGEA 4FCYA 1TKXA 1BISA 3QERA 3HO1A 4Q0BA 3QNOA 2HHVA 4OLBA 2KZMA 5KGXA 3C94A 3WNHA 1T03A 4CJ5A 3KD5E 1TKDA 5J2NA 4CEZA 2ZE2A 3TR8A 4CF8A 3B6OA 2HNZA 2HMIA 4F3TA 2FC0A 3DMJA 4OLAA 1RBVA 2VG7A 1WSEA 4N41A 3TANA 4O55A 2RKIA 1LW0A 1S9EA 3LP2A 3EYZA 2HNYA 4B8CA 4E7KA 1HYSA 2VG5A 4KTZA
chains in the Genus database with same CATH superfamily
1YUWA 4CZJA 3IAYA 3THYB 1S1WA 3VQEA 4KV8A 4JI8K 3WXKA 3HVTA 3NHGA 3E9LA 4CFBA 2WBNA 1YTAA 1RTIA 3CJBA 5BPLA 3L2UA 1YVUA 3EZWA 1IH7A 5CZ1A 3QBXA 5BN9A 3PSFA 4B9SA 3HXMA 4ELUA 3AVAA 1HYZA 1JLGA 4NCAA 4YOVA 4E7HA 4Z4EA 2RF2A 4FVMA 4HUEA 4W5NA 5AQNA 1FW6A 4H5TA 2OANA 4H4OA 4B1YB 1IG8A 2QW9A 2QWLA 1KVCA 1QZ5A 3TSPA 1BG3A 4KHUA 4CJKA 5M1NA 1RTDA 1VSJA 1YF5L 4B9VA 2O8BA 3SK3A 1NGCA 3CC4N 1VSHA 5AQRA 3G10A 3FZFA 1HNVA 4NYNA 5JVGL 2I7NA 4EHTA 3AO1A 2VCPA 1JLCA 4M7YA 5AQMA 3M8SA 4BR4A 2W42A 3Q7CA 3ZSWA 4W5QA 1QVFM 4LSNA 1U49A 2Y1JA 1BQMA 3J7ZO 3KK1A 3K5NA 5HLFA 4IO9L 4BACA 3ZYYX 3EL2A 1VQON 3OS2A 1HQEA 1C0UA 3DXKA 3FR0A 5I9EB 3L2VA 1T6CA 4JEPA 3GG4A 1KC8O 5GAGP 2B6AA 4BR9A 2W40A 4JYAK 3QMLA 2E20A 3OVNA 1GLFO 3G6EN 4JN4A 3T19A 2D0CA 1QQNA 1NGJA 1U47A 3P4IA 3ZCMA 3RR7A 5KTQA 3LM2A 2IVPA 3DOKA 1E4GT 4KHSA 1J9AA 4IXCA 2HBJA 1B9DA 3VENA 1HYVA 4ID5A 1BI4A 2QWMA 5LL6Z 1JLFA 1TVRA 4CZHA 4Y0WA 5KPZA 3UKRA 3CCEN 1VK0A 3EZ5A 1N6QA 2PYLA 4QAGA 1DEJA 4FJLA 3HSCA 4JHDA 5AQJA 2ASMA 3CQ8A 4DTRA 3THYA 2R7YA 4FK2A 3DRRA 4J2DA 3WQUA 3CQXA 3SUPA 4AHSA 4EP4A 3MEGA 4KI4A 1YIJN 3VTIA 4DF4A 2GV9A 4JS5A 3VESA 1IKWA 1T3VA 2P9SB 3G25A 4KREA 1K8KA 3MWPA 3H45C 4PWDA 3N4QA 2HF3A 4KKOA 3CERA 1VQNN 1TK5A 3K9JA 4WQ5C 1TGOA 3VEZA 4IJNA 1SS6A 3E9PA 4BRKA 5C15A 3AO2A 2Z1JA 1WSGA 3CETA 3VQ9A 2E6LA 4JV5K 4ISEA 3HPHA 4DR5K 4JKFA 5C2FA 3ZSYA 2W6LA 3VF2A 2E6MA 3QINA 5LMUK 4IJAA 3O1WA 1GLCG 3F73A 5AQFA 4CGDA 4B3TK 4I6MB 5GIPA 1W0HA 4BE1A 1QSSA 1O1WA 3FE1A 4H0VB 4H5WA 3LZIA 1NK8A 2OYQA 4O5FA 4QCLA 2I7PA 3LZJA 5AQWA 1WSFA 2VQFK 4GKKK 2GUIA 3DLLL 3ZSRA 5EX5A 2J4RA 3NVMA 3TI0A 3KLGA 4BVOA 2RE2A 1OVQA 1WUAA 4CF2A 5DM7L 3LP1A 4PHTX 1GLJO 4A5BA 3S41A 3VOVA 3OBYA 4MQ3A 2XY6A 1N36K 4CGJA 4GV9A 5AQKA 1YTUA 3NH2A 2FSKA 1B92A 1VSMA 2OPRA 2DY4A 3ZSVA 3NMUA 1ZBHA 3OA9A 4B1VA 3DXMB 1A5XA 4CZKA 4O8KA 4DFKA 4DTOA 4BQLA 4B9MA 2V51B 4JI1K 4RW9A 2FBVA 4F2SA 1BIUA 1I3AA 4CHPA 2Z1IA 4ILHA 1W7AA 4FJ5A 3K9KA 3VQBA 3QB0A 2P9UB 2YI1A 4O4GA 3C6HA 4BRAA 1OH6A 4ZTFA 3VEXA 1U4BA 1B9FA 3WXIA 3QEXA 4DTXA 1XQSC 1NGBA 3AVJA 4EP5A 3L8BA 2O8FB 1YAGA 2NRXA 3KVGA 4MLHA 4DS4A 1GLLO 2NUBA 4KHQA 2FF3B 5E26A 4NXMK 3HP9A 3H46O 3KK3A 2WFBA 3WXLA 5FRNA 2V7YA 2O8EB 4DV2K 2P9SA 4DU3A 3UIQA 2XY5A 2O8CB 4IKFA 4DSKA 4DQSA 1RNHA 1WN7A 2V7ZA 1JLQA 3THXB 4KI6A 4UY8O 5J1EA 3LDSA 5AQSA 5AQOA 5BR9A 1KAZA 2GELA 4DFJA 4DTNA 1IKYA 2HNDA 3VMFB 4DHYA 4DU4A 1FKPA 3NE6A 5FLXO 3MX5A 4BDZA 4RW8A 3TPQA 1KSPA 4FW1A 1EXQA 3SLCA 4E3SA 2HHWA 4GW6A 1XUPO 5BN8A 4M3UA 4BE2A 4BVPA 3ZSZA 4EFHA 3LWLA 4DQPA 4ISGA 1T7PA 1VRUA 1BDGA 1MA9B 4JKEA 1SKRA 3HZ6A 4M3TA 4KHYA 1UA1A 3SUOA 3MN9A 5AQVA 3DLGA 3D0PA 3LAMA 1L3UA 3IFRA 4KHNA 2X6SA 2PAVA 1RT6A 4KBOA 2CH6A 3CCJN 2OA8A 4DR1K 2V52B 3WNEA 4BRQA 3O08A 5HRNA 3VEOA 4CECA 5BREA 2RN2A 1FKOA 2QWQA 1NGIA 1BIZA 2WONA 5LJWA 1T8EA 4PKGA 1REVA 4JKAA 3SAGA 1X9SA 3E9OA 4KHWA 3HRGA 4MO5A 4E19A 4JS4A 2A6AA 3U9DA 1K9MO 2E2NA 1A5VA 4DFPA 1L3VA 3M8RA 4DTUA 4OGCA 1HKGA 3EE8A 4DSJA 1JCGA 1BO5O 4BRGA 4W5TA 2P9UA 2GUPA 1Z6RA 3AY9A 4CE9A 5AJ3K 2YV0X 2FLOA 3OYAA 4FW2A 4CGFA 2EX3A 1NGGA 2F4VK 4JI4K 1WSHA 2G8UA 5ADXA 2QKKA 4PKHA 5AQXA 2FBTA 1SAZA 2G8HA 3I56N 4CGHA 3TAQA 4LFAK 4DV5K 2P9PA 4JD2B 1OKJA 4YOTA 2HB5A 3LAKA 1WSIA 3O9UA 4ISFA 2O8EA 2NLXA 2YKMA 4JI5K 3O9SA 3ULEA 3J81O 1D8YA 3NGIA 4CEBA 4YOYA 4N76A 3G0ZA 5LJVA 3PX6A 5AZJB 2YNIA 1NK0A 2E88A 1C0MA 4OGEA 4CFDA 3HO1A 4OPHA 4Q0BA 2KZMA 3ATUA 5J2NA 5LY3A 3B6OA 3DMJA 1RBVA 2VG7A 1WSEA 4FWLA 4N41A 1VHXA 1HLUA 1T44A 3EYZA 1YXQA 3LDLA 3G4SN 4CF0A 3NF7A 4H8KA 3PIPL 4WE1A 3HJFA 3C6TA 2YNGA 3L4IA 1ATRA 2GTDA 4L8RB 4HTLA 3PLAA 4IFEA 4CHYA 4CHQA 3W0LA 1G99A 4B08A 2GWKA 3AO3A 1EKEA 1IG9A 3QESA 3N4PA 2VG6A 4LF5K 4J2AA 4M42A 4KFBA 3BZCA 4FWNA 4CJUA 1P90A 1ILYA 4GVMA 3VQAA 5BRDA 1Q18A 4JKGB 3AGRA 4DS5A 1S3XA 4CJVA 3TAEA 2D4WA 3VA0A 4LF9K 4I2PA 3BUZB 4DR2K 5A2QO 3R1XA 4KH4A 3TAPA 2QWOA 3D2FB 4MFBA 1WOQA 4IFYA 4I2QA 1ZC6A 3TTCA 4FJNA 1SL1A 3OTOK 4ILJA 4DTMA 4KAZA 1TYQB 4YHHK 3UB5A 3OYGA 3SBGA 4E0DA 4O44A 2CH5A 3SQ1A 4FZZA 4BRDA 2XRIA 3TARA 4WQ5A 1NGFA 3AVFA 2F7TA 4N47A 3C7NA 4GNIA 4YOUA 4AHRA 4YFUA 3SI6A 4HCCA 4CJFA 1U04A 3KLFA 1RBRA 5AQPA 2IIRA 4DSEA 4F4KA 2Q97A 3ZETB 4BE0A 1JCEA 4BGBA 1CZ9A 1QQMA 3L0QA 3CQYA 1NK7A 3D2EB 2YNFA 4EHUA 1RTHA 2F8TA 1RDCA 3OJUA 3ID6A 3BZKA 4JD2A 5HRRA 4WYBA 3O1BA 3ENOA 3SMPA 4KHPK 4CEEA 1RT7A 1VQ8N 2E4LA 1QZ6A 4B3MK 3IS9A 3P5JA 4DU1A 1IBLK 4OPAA 2X74A 2DFHA 2FBXA 2ITGA 1RDDA 3QEWA 3V9UA 2Q36A 4DV0K 3L2RA 2KQ2A 4BY9C 3C6UA 3QFUA 3KZBA 3D45A 1QE1A 2OTJN 4JKHA 5AZIB 1RCHA 3AVMA 4RW7A 2UUCK 2IOCA 3H1VX 3V9SA 3CCMN 3C65A 1U2VB 2Q31A 3CYMA 4F8RA 3HYFA 2YX6A 5FROA 3K59A 4LSLA 4IDHA 4FLZA 2XY7A 1N34K 4Z4IA 3AVHA 1VQ4N 3AA3A 1RT4A 4FVUA 2P51A 2BTFA 3FGUA 5TKYA 2QK9A 3VERA 1XMOK 3R3LA 4J2EA 1ESVA 4FYDA 2IDOA 3HOTA 1Q8IA 4DLGA 4CBWA 4AQYK 1JJ2M 4W5RA 5IT9O 4JKGA 5AFUA 3OYBA 1C0FA 1VQMN 4KTWA 1GLEG 3JYTA 2VYPA 3HVRA 1T05A 3CFRA 3SJJA 3D2FA 2P5GA 1S72N 2BUPA 1QVGM 4KTQA 3S3MA 2G8VA 5J2PA 2ZGYA 4AM6A 1NJWA 3PY8A 5CZ2A 2A3ZA 1FJGK 2W41A 5ELZA 3SPZA 5C2DA 3DOLA 3VQPA 1Z25A 2GX9A 4H0OA 2OPSA 2PFUA 1TAQA 5C0YA 2HVHA 4Z0UA 4A62A 2NZTA 4BR5A 4DTJA 1RBTA 3HM9A 4A2BA 1VSKA 1HNWK 2WTUA 3FZHA 2KZZA 1ZYQA 3U3GA 2PZSA 3ZETA 3C95A 1WB9A 1MWKA 2ITMA 2B4JA 4FJMA 1LWEA 4H0TB 4C8NA 3D6RA 1WSJA 1IBKK 3V9XA 2A5XA 1QSYA 3A5OC 2GWJA 3GE1A 4JAXA 3DYAA 3VQ5A 5E41A 4CFCA 4CEDA 3U3YA 5EXWA 3MN7A 4DF8A 1S5JA 1HNZK 1LAVA 4LFBK 2UXCK 2CGLA 4E1MA 4JNEA 1LOTB 3L6QA 4WFNL 1BCMA 3PV8A 4CJ7A 5ADXH 1IKVA 3TAFA 3DLBA 1DKGD 4FJ7A 1RDBA 2YHXA 4IG0A 1LV5A 1JLAA 3ZEUA 4V19S 4Q5VA 2E2PA 3HPGA 1KLMA 4FLYA 3BF1A 2ASPA 3UKUB 3O3FA 4FK0A 4IOAL 1WAFA 4O8UA 5T7BA 4WFBL 4DMNA 4CZMA 5KQ8A 4GKJK 1W97L 5HP1A 4C8LA 1G15A 3ZX3A 3BP8A 3OS0A 2IC3A 5DM6L 5J2MA 2X6NA 4A59A 4YDUC 4OX9K 3H1QA 3I8DA 1CLQA 3PO4A 5JICA 4HCBA 3RMDA 3NH1A 1QHAA 4IOXA 4K42A 4BDYA 1TAUA 3GOIA 3MN6A 1S6QA 3DM2A 4A5AA 4CJTA 3IRXA 2ZGZA 1NNEA 2OCEA 3IMXA 1EO1A 1NJIO 1HQUA 3SQ2A 4I9LA 4YOXA 3QFPA 2HHHK 1L5UA 4K25A 1V4SA 3JS6A 4W5OA 3OYEA 4B9UA 2P9KB 2KLAA 4YORA 3MCAB 4FJKA 2HF4A 2KHOA 5HROA 3NF6A 2QWRA 3ATVA 1EETA 3CJAA 1SKWA 2ZM6K 1TK0A 1LCUA 4GVEA 3LDOA 5K14A 3FZKA 3TABA 1UAXA 5KRTA 2CGKA 2X78A 3BGRA 3O3HA 4F3OA 4OKEA 1O13A 4M45A 2QA4N 3MN5A 4M3WA 3OYMA 3S9HA 3WXMB 5GINA 4DV4K 4BC4A 5AQHA 1RGIA 1NK5A 3KTQA 3S3NA 3A5LC 3FLCO 3OYHA 5EU7A 1C1CA 1HPZA 1NJZA 4IBNA 4L3QA 3SJHA 3K57A 4H0YB 3V1OA 4X64K 5GAHP 1SQKA 4Y1DA 4JI6K 1JL1A 3KWIA 3NGYA 2GEMA 5M1QA 4NLBA 1NKEA 4NB4A 4JI2K 3KJVA 3F9MA 2ZJQL 5KQDA 2E5LK 4FWKA 4RG8A 3WEEB 2BANA 4FL9A 3O6WA 1QSLA 4CJ3A 3E01A 3LANA 4OJRA 1QQOA 2WC9A 3RRGA 1KVAA 3I33A 4BROA 3NGZA 2E1YA 1HX1A 3L3UA 1J53A 2YNHA 3VF6A 3THWB 1RT1A 2F9TA 1HRHA 4BQZA 3PX0A 5E84A 4DSIA 1F21A 4JKDA 4A57A 5JLHA 4FLVA 4FWOA 1KVBA 5C25A 1E4FT 4WCEL 3UKUA 3FFKB 3CC7N 1VRTA 4DB3A 1SL2A 1ZBFA 4E89A 3PIOL 1EWQA 1CZBA 3DLKA 5AR0A 4B1ZA 2P9LB 3J7AP 4DG1A 2F9WA 4DTPA 5EY4A 4FPAA 4FLWA 1EWRA 4FO0A 2EWSA 2W6KA 3QERA 1BISA 4OLBA 5KGXA 1T03A 4CJ5A 1TKDA 5JLFA 1M90O 3TR8A 1HKBA 4LFCK 4H0XB 1NGDA 3MX2A 4X65K 4QS7A 1HYSA 2P9IB 4JI3K 3OYDA 3PUFA 2HHSA 1BWFO 4E7LA 2VWKA 2F8SA 4CI6A 2FSNA 3AGKA 3MEEA 1D9FA 2VWBA 3AVIA 4J8FA 3LPUA 1KFSA 3CJ1A 4GMJB 4BGAA 4DQIA 4M3RA 4I6MA 4KPYA 1JCFA 1KAYA 1X3MA 1EP4A 3KLIA 4DR3K 1JXEA 3B6PA 1HJOA 4CD3A 4BR2A 3V81A 3EEQA 1LW2A 1RDAA 2WUSA 1K73O 2YHAA 1DTTA 4KO0A 4NO7A 4PL7A 3T3FA 2Q0UA 2NRRA 3AVGA 5M1KA 4C1NI 4H5VA 3C6AA 2A1SA 1NK4A 4KH6A 4OPKA 4FJHA 4CERA 3FZMA 1X3NA 1KCFA 4CIEA 3DXMA 3CM6A 1U6ZA 3U8XA 4FWPA 3R9PA 2NRZA 1C0TA 1W9HA 4LH5A 3CF5L 3ENBA 4DQQA 2UUAK 3T7ZA 4B1UB 4FJ9A 3CPEA 4PUOA 3ITHA 1BA0A 4NYFA 3LDQA 4OPJA 2I5JA 1VQ7N 3HK2A 3T1YK 3A5MC 3OS1A 3KK2A 5HL7L 3NF9A 3MCPA 3T1HK 4E1NA 4JI0K 2O8FA 3CCUN 5KRSA 1HNIA 4IEEA 4AM7A 4CCHA 4DV1K 3EO3A 1U48A 3F5TA 2YHBA 4JI7K 4CIGA 2P9LA 3BY5A 3OYNA 1ASUA 1QHTA 3RVCA 1WNSA 1E3MA 1GLDG 5IWAK 3LALA 4IFVA 1IO2A 2E1ZA 3OYLA 4B3OA 3HPOA 1GLAG 4GV3A 2JGUA 3MECA 2O8CA 1RT5A 2GBZA 4FZYA 1RDWX 2DFFA 2JWLA 4BC2A 4DKWA 2CGJA 3THXA 4GY2B 3ZX2A 3M6GA 2D5RA 5FRMA 2P9IA 3L2QA 3H3OB 4FM1A 2A42A 1GOCA 4U67L 4HTUA 1FXXA 3AA4A 2XO7A 4I7FA 3K5OA 3HL8A 3RSEB 4LD0A 3ZSOA 2O8DB 2YCHA 4CHOA 3OY9A 2HSTA 2BGGA 1N8RO 3M1FA 3J7YP 3CD6N 2QTDA 3AV9A 3WUHA 4PL8A 1HUXA 2QWNA 4RW4A 1ZBSA 1VSLA 2UXBK 2OTLN 3ZT1A 3BDPA 3A2FA 4OKJA 4DFMA 1S6PA 5CYMA 4WQ4C 3K5LA 2KTQA 2ZJRL 3MXJA 4CHZA 3LPTA 2IGIA 2ATQA 4HHTA 3KWGA 4AHUA 3RTVA 2Y1IA 3IKMA 3SV3A 4IG3A 4YDUA 5AQGA 5CY4A 3E66A 1A5WA 4BDPA 2AJQA 5AQYA 3QIPA 2D0PA 1J6ZA 4H5NA 4JK7A 4G1QA 1WBDA 4B9LA 1KD1O 4QS8A 2HMPA 3CI5A 1BU6O 2P1JA 3SQ4A 3SUQA 4XH4A 1L3TA 1VAZA 4TSXA 5HRSA 5SWMA 2ZJPL 3O80A 2IVNA 4CZFA 2O8BB 4B3SK 4BC3A 3CFOA 4DR4K 4EIAA 1LWCA 5DMRA 4JKCA 5FPMA 4DV6K 3C0BA 2HVIA 1S1XA 3CCVN 5CR4A 2OZSA 4J2BA 4JK9A 1UA0A 4DV7K 3KD1E 4DTSA 1K8AO 1N33K 3RWUA 3E1YA 1D9DA 4O0IA 4DQRA 4ZTJA 3OYFA 3NFAA 4FLXA 3ZX0A 4FJ8A 4ICLA 3VQ7A 5HRPA 3MWTA 3TU5A 1RTJA 1RDUA 3CMEN 1NGEA 1J54A 1JKHA 5GAEP 5AZJA 2BE2A 3A0IX 3D7EO 1BQNA 3DXKB 2KW4A 4DUZK 3VF4A 3DI6A 1Y97A 1VQ6N 1Q81O 4N5SA 4LC9B 1NOZA 1HJRA 2D0AA 4BR7A 2P5OA 2Z1HA 4M3ZA 4KRFA 5FPNA 3V4IA 1CZAN 1IJJA 2G8KA 4I9QA 3AARA 2P9NB 3EKUA 5F1XA 3OW2M 3ZT3A 1BGXT 3FZLA 3CFPA 4ZHRA 1VSDA 3R6MA 4BREA 4RW6A 3KKSA 2AP1A 1Z26A 3NBPA 5BRHA 1L3SA 3DRSA 1BI4B 1J5EK 4C1NK 4CF9A 1S22A 3UKRB 1SKSA 3SYZA 2VWJA 4NXNK 4M41A 5HOOA 3Q7BA 4HVJA 5CHIA 4AH9A 4BRPA 4FM0A 1XMQK 3VGLA 5TKWA 4CW7B 5GIOA 2H3GX 2VGMA 1TV6A 3OYJA 1GLBG 4XIUA 1TK8A 1OH5A 2B5JA 3JSMA 1Q9XA 4CVNE 3ZLJA 3T69A 2UXDK 3V1QA 3M5RA 1YJWN 2OZMA 2HBKA 3CG7A 2JWKA 3KLEA 4CEAA 1JXBA 1TKTA 4EAHD 1S1VA 4B8AB 1BOTO 4O5BA 1KRPA 1KLNA 3K2PA 1K8KB 1NMDA 1TYQA 3HP6A 4DQ8A 4PA1A 5SZTA 4DWIA 4K43A 1HKCA 4LF4K 4MO4A 4X62K 4ILGB 5B8HA 1XI1A 4FLUA 3EY1A 5EVZA 1S1UA 3ZT0A 3J8AA 4AHVA 1Q9YA 4CGGA 3QEIA 1DTQA 2UU9K 1BL3A 2OPQA 1NKCA 2PY5A 3SBTA 1C1BA 4H4MA 3P31A 5JS2A 1ZBLA 1BUPA 3M3ZA 4CBXA 4AF1A 3D2EA 2IVOA 2Z1GA 1BHLA 2FXUA 4BRNA 4BRHA 3MK6A 3WNGA 3TAMA 3P1GA 2PYJA 3NDKA 4KB1A 2LSNA 5AQIA 4RTFD 4K8XA 3V1RA 5JMVA 3O9QA 1ZBUA 3CCQN 4K0KK 4ELTA 3CC2N 3ENHA 2XHBA 1Y64A 4X66K 2PBDA 1VQLN 1RFQA 4FWRA 3QETA 5AZIA 3VQ6A 3QICA 1ASWA 3AAQA 1MWMA 3LM9A 1U2VA 2P9NA 1HMVA 5D3GA 4CBUA 3DAWA 4E1JA 4YNQA 4BRLA 3CJ9A 1I94K 3AVKA 3KLHA 2YHWA 3SAHA 1KXPA 4PQUA 3WNFA 4LF7K 1VQ9N 3HT3A 4H03B 5MLCQ 3PSIA 4FJIA 4FSVA 1HNXK 5JS1A 4CJPA 4DUYK 5I3UA 4CEQA 3DWLA 2YJFA 1TKXA 4FCYA 2HHVA 3C94A 3KD5E 1IV0A 4MDAA 2RHKA 4QS9A 2HMIA 4OLAA 4G9ZA 3TANA 4O55A 2RKIA 5H1SQ 1S9EA 2Q0RA 3LP2A 4E7KA 2VG5A 4KTZA 1TKZA 4B9NA 5C42A 3I0SA 3LDPA 3H6EA 2G8WA 3TSUA 3HI0A 4DSFA 4DR6K 1QTMA 1X1PA 3JXUA 1RBSA 4E7IA 2NRHA 2EHGA 3ALYA 1NKBA 4HWIA 3VQDA 4JRPA 2G8FA 3P38A 1DT9A 5FPEA 3ZSXA 3ZSQA 3K0SA 1DLOA 3VTHA 3M8QA 3THVA 4A2AA 4FOIA 5F2RA 1ITGA 1VSIA 1X9WA 2HBMA 4KB0A 2KFNA 5BRFA 1VSEA 2QEXN 1QQCA 3L2WA 1ATSA 1SV5A 4DLEA 4C8MA 1HR0K 3O4QA 1ASVA 2IS3A 5HBMA 4FXDA 2JLEA 1YHQN 3M8PA 4MDBA 1YT3A 1MU2A 4Z4GA 3VQ4A 2ZF5O 2QWPA 5KPRA 1NJYA 3CMAN 4DCHA 4B9TA 2UYTA 3QNNA 4FM2A 3AVLA 1U45A 4FWSA 3VEVA 4CJLA 3V9WA 1IKXA 5JVHL 4FZXC 4BRIA 3HOSA 4F2RA 3AVNA 3O3GA 1WAJA 2Q1NA 4WQ4A 4DV3K 1YVNA 1N5YA 4FK4A 2ETJA 3AAPA 1TL3A 3ZT4A 3K58A 3NF8A 1UWBA 3ZT2A 4FPBA 3V6DA 4CF1A 3HM8A 4XH5A 3LWMA 1XWLA 1BCOA 4BRMA 3QO9A 5C24A 4WF9L 3SNNA 2E8AA 4H5RA 3ID8A 1NU0A 3AA2A 2AA4A 4R5PA 1OH8A 1R59O 2FBYA 4Y1CA 4EZ6A 2NNWA 4M7XA 3VQCA 4PKIA 3RMBA 1NOYA 2DPNA 3ASMA 3SZ2A 2XY8A 3O9RA 1K6YA 1ZBIA 3IG1A 5CE3A 4M3YA 4AILC 3RMAA 1XC3A 4BWJA 1J5OA 3O4NA 3TWHA 4BR0A 4XEIA 3AVCA 3W3DA 3TTDA 2P9PB 2D0OA 2Q2RA 1N32K 1IBMK 3BF3A 1TUUA 5FPDA 3ISNC 1V4TA 1D4XA 4AHCA 5M1FA 4CZIA 3SCXA 3GL1A 3R8EA 3CCLN 3ULEB 3MEDA 1EX4A 1C1AA 4CK1A 2ZD1A 4GV6A 2ZWHA 3TAGA 2P9KA 3I8BA 3RMCA 4JK8A 3U6FA 1W2BM 1XNRK 2HW3A 2HBLA 4B9QA 1X9MA 3K5MA 4ID1A 4M63C 4CK2A 4O0JA 3VEYA 4B3RK 4LF6K 3O4WA 2QI2A 4IDKA 4BRCA 5BPNA 3J80O 4FJJA 1R0AA 3VA3A 4KH5A 1CXUA 1OH7A 4CJEA 5AFUH 2NRTA 3NVKA 3GBTA 4A61A 4FOEA 2E2QA 3RRHA 1NK6A 3JAMO 5KI6A 4JRQA 3MMVA 3VGMA 5AQQA 3G71N 1XHZA 5FDLA 1P8ZA 3QLHA 4AHTA 2NRVA 5J2QA 3MXMA 3HTVA 4YOWA 1EQYA 4CEFA 3BEXA 2HOEA 4UQGA 3DRPA 3OJSA 4OO1J 2FF6A 4DSLA 1RT2A 4IEIA 4Z94A 3VETA 1KQSM 2D1KA 2ZQBA 4LY7A 1Q86O 1QS4A 1XNQK 3VQ8A 3WEEA 3WXJA 2VQEK 1NG9A 4K8ZA 3U4LA 3NAEA 4ELVA 2BH1A 3HSTB 3AO4A 3AA5X 4FWQA 3ULDA 1TUYA 2BDPA 1RBUA 3THWA 3QEPA 2QKBA 5AQLA 3F9KA 1NGHA 4IO8A 4M3XA 1GOBA 3SAFA 4YY3K 3VEWA 4FJGA 3O8MA 5F0XA 4CZGA 1NK9A 1KFDA 3EN9A 2A1RA 1NLVA 4WFAL 2DTUA 1OVYA 3A8YA 5CYQA 4CEOA 3P39A 3MDQA 3SPYA 1LAWA 1RT3A 1NJXA 1VQKN 3CXCM 4C8OA 5M1OA 3C7NB 4IZ9A 5KGWA 1VQPN 3NH0A 3TTFA 5LMNK 4BG9A 1CXQA 4CJRA 2YKNA 5AQZA 3QBWA 4F9OA 1ZXOA 1JLBA 3U9ZA 1C6VA 2D0BA 3VPZA 4C23A 4CZEA 1RILA 3CIPA 3O9TA 1T6DA 1YI2N 4CD1A 1MDUB 1S1TA 3CHWA 1YITN 1KTQA 2A40A 1ATNA 5EOYA 3P83D 3UE5A 3SUNA 3QIOA 4RWTA 2UUBK 2HHXA 3KHYA 1D5AA 4FWMA 4HUGA 4B1WB 2QXLA 3CJ7A 3L4QA 5C10A 4LH4A 5C12A 3WQTA 3H3NO 4CFAA 3EKSA 1DGKN 3KIOA 1JL2A 1NGAA 1BA1A 3LL3A 3I0RA 2HHTA 3GDQA 4BWMA 1NM1A 3DLEA 4CESA 1WLJA 1NMNA 4CK3A 4H0PA 1NBWA 3CPWM 3T1AA 4OKKA 4NCGA 2F96A 3CJCA 4NCBA 3OBWA 3KK7A 1Z05A 1UOCA 5AQUA 1FK9A 2HHQA 3I55N 1S9GA 4MLEA 2O4IA 3AVBA 2KKZA 4RCHA 3DLRA 1C0GA 4U7BA 5AQTA 1NWKA 3WT0A 1SZ2A 4CJ4A 3RR8A 4FLTA 1VQ5N 4DR7K 5DK5A 3LP0A 3S3OA 2FSJA 3QEVA 4IWVA 4IOCL 1LWFA 3F2KA 4CJWA 3MAQA 4JKBA 3PO5A 3MXIA 1XHXA 2IAJA 3V9ZA 5I42A 5BR8K 4CIFA 2E2OA 3HBTA 4N56A 5GADP 3OYKA 3H08A 1GOAA 2Q3SA 4XH1A 3VQQA 3OYCA 3DLHA 4Z4FA 3KKRA 4Z4HA 1JLEA 2QXFA 2ASOA 3CM5A 1SUQA 3EE9A 4K41A 3CCRN 1I39A 1KAXA 2NRWA 4OVLA 4E7JA 3L3VA 4HUFA 4B1XB 2WOMA 3B8AX 3SQ0A 3CCSN 3OYIA 3QDKA 2OPPA 3TSQA 2KFZA 2YJEA 1XC9A 1YJ9N 4BRFA 3A5NC 4CHNA 3LP3A 4LF8K 2HHUA 1X9JA 1WBBA 4PY5A 2RPIA 4CJSA 1YJNN 4CJQA 3SMSA 3NCIA 3PX4A 4C8KA 4QOZB 4NLCA 4BG8A 4Z4CA 2O4GA 3FFIA 2YHYA 3O5BA 1HPMA 1Q82O 3IUCA 3AO5A 3IDHA 3LDNA 4FJXA 1VSFA 3DJCA 1Q7YO 1SL0A 4CGIA 4JLHA 1H1VA 4R79A 4CZLA 2DFEA 3RSEA 3SV4A 1TL1A 2O8DA 3VGKA 4BC5A 2G8IA 1M1KO 2QM1A 3VN5A 4EZ9A 3QNOA 2A41A 2VGNA 3WNHA 5KPTA 4CEZA 2ZE2A 4CF8A 2HNZA 5M1PA 4F3TA 2FC0A 3ZEUB 3OHRA 1LW0A 5BPMA 2HNYA 4B8CA 4JHDB
chains in the Genus database with same CATH topology
4CF0A 1TKZA 3NF7A 3PUFA 5C42A 3OYDA 3I0SA 4B9NA 2HHSA 4H8KA 3IAYA 4WE1A 2G8WA 3HJFA 1S1WA 3VQEA 4KV8A 4DSFA 3HVTA 3C6TA 3NHGA 2YNGA 4E7LA 1QTMA 4CFBA 1X1PA 1RBSA 4L8RB 4E7IA 2VWKA 1YTAA 1RTIA 2F8SA 3L2UA 1YVUA 2EHGA 3ALYA 3AVIA 3MEEA 1NKBA 3LPUA 1D9FA 1KFSA 4CHYA 1IH7A 5CZ1A 4JRPA 4GMJB 3VQDA 2G8FA 4CHQA 4DQIA 4M3RA 4B9SA 3ZSXA 4B08A 3ZSQA 3HXMA 4ELUA 4KPYA 3AO3A 1DLOA 1EP4A 3KLIA 1EKEA 3AVAA 1IG9A 3QESA 3M8QA 1HYZA 1JLGA 1JXEA 3B6PA 4NCAA 3THVA 2VG6A 4E7HA 4M42A 4J2AA 2RF2A 4FVMA 4KFBA 4HUEA 4Z4EA 3V81A 4W5NA 1ITGA 1LW2A 1VSIA 4CJUA 1X9WA 1RDAA 4KB0A 2KFNA 4GVMA 4H4OA 1VSEA 3VQAA 1QQCA 3L2WA 2YHAA 1SV5A 4DS5A 1KVCA 4CJVA 4C8MA 4DLEA 3TAEA 1DTTA 3O4QA 4KO0A 3VA0A 1ASVA 4KHUA 2IS3A 5HBMA 3T3FA 4FXDA 2JLEA 4CJKA 3M8PA 4I2PA 3AVGA 3TAPA 1YT3A 1RTDA 1VSJA 4MFBA 1MU2A 4IFYA 4B9VA 4I2QA 4Z4GA 4FJNA 1SL1A 1VSHA 3VQ4A 2A1SA 1NK4A 3G10A 4DTMA 4KAZA 4OPKA 1HNVA 4NYNA 3OYGA 1NJYA 4FJHA 4CERA 4E0DA 4O44A 3SQ1A 1KCFA 3AO1A 4CIEA 4B9TA 4FZZA 3QNNA 1JLCA 3CM6A 3AVLA 4FM2A 2XRIA 3M8SA 3TARA 1U45A 2W42A 4CJLA 3V9WA 1IKXA 3AVFA 1C0TA 4FZXC 1W9HA 4N47A 4AHRA 3ZSWA 4LH5A 4W5QA 4DQQA 4YFUA 4F2RA 3AVNA 4LSNA 3O3GA 3SI6A 1U49A 4FJ9A 4HCCA 1WAJA 2Y1JA 1BQMA 1U04A 4CJFA 3KLFA 3KK1A 3K5NA 5HLFA 4PUOA 1RBRA 1N5YA 3ITHA 4BACA 4NYFA 4DSEA 4F4KA 4FK4A 4OPJA 2I5JA 4BE0A 3OS2A 1HQEA 2ETJA 1C0UA 3HK2A 3L2VA 1TL3A 1CZ9A 3ZT4A 3K58A 3NF8A 2B6AA 1NK7A 1UWBA 3ZT2A 3OS1A 3KK2A 2YNFA 1RTHA 3NF9A 3V6DA 4E1NA 4CF1A 2F8TA 3LWMA 1RDCA 1XWLA 3OVNA 3OJUA 1BCOA 5HRRA 5KRSA 1HNIA 3QO9A 4CCHA 5C24A 3T19A 2D0CA 1U48A 3SNNA 1U47A 4CEEA 1RT7A 2E4LA 3ZCMA 2YHBA 3RR7A 4CIGA 5KTQA 3AA2A 3OYNA 1ASUA 3DOKA 3IS9A 3P5JA 4DU1A 4R5PA 2X74A 1QHTA 4KHSA 1WNSA 2DFHA 1J9AA 2ITGA 2FBXA 1RDDA 2FBYA 1B9DA 4Y1CA 4EZ6A 3QEWA 3V9UA 1HYVA 3LALA 4IFVA 3VQCA 4ID5A 1IO2A 1BI4A 3L2RA 1JLFA 1TVRA 3RMBA 3OYLA 1NOYA 2KQ2A 3HPOA 4B3OA 2JGUA 3MECA 3ASMA 3SZ2A 1RT5A 2GBZA 4FZYA 2DFFA 2XY8A 1ZBIA 1K6YA 3C6UA 3IG1A 1VK0A 3D45A 4M3YA 1QE1A 3EZ5A 4AILC 3RMAA 1RCHA 1N6QA 3AVMA 2PYLA 4QAGA 4RW7A 2IOCA 4BWJA 3V9SA 1J5OA 4FJLA 2D5RA 5FRMA 3O4NA 3TWHA 3L2QA 4FM1A 3CQ8A 4DTRA 3AVCA 3CYMA 1GOCA 4F8RA 2R7YA 4HTUA 1FXXA 3HYFA 3ISNC 4FK2A 3DRRA 3AA4A 2XO7A 4AHCA 5FROA 3K59A 4I7FA 4LSLA 2XY7A 3K5OA 4FLZA 3SCXA 4J2DA 3SUPA 4Z4IA 3HL8A 3AVHA 4AHSA 4LD0A 3MEDA 1EX4A 1C1AA 3AA3A 3ZSOA 1RT4A 3MEGA 2ZD1A 4CK1A 4EP4A 4CHOA 3TAGA 4KI4A 3RMCA 3OY9A 4DF4A 2P51A 3U6FA 2GV9A 2HW3A 4JS5A 2BGGA 1IKWA 4KREA 1X9MA 3K5MA 4ID1A 2QK9A 4PWDA 4CK2A 4O0JA 3AV9A 4KKOA 4J2EA 4FYDA 4IDKA 4FJJA 1TK5A 2IDOA 4RW4A 1Q8IA 1VSLA 4DLGA 3VA3A 1R0AA 4W5RA 1CXUA 1TGOA 3OYBA 4CJEA 3ZT1A 3BDPA 4KTWA 3JYTA 3A2FA 4OKJA 3RRHA 4DFMA 3AO2A 1NK6A 1S6PA 2Z1JA 5CYMA 1WSGA 3VQ9A 2E6LA 3HVRA 1T05A 3CFRA 3SJJA 5KI6A 3K5LA 4JRQA 2P5GA 3HPHA 4KTQA 2KTQA 3MXJA 3S3MA 2G8VA 1XHZA 4CHZA 5FDLA 3LPTA 2IGIA 3ZSYA 3QLHA 4AHTA 5J2QA 2ATQA 2E6MA 3QINA 4HHTA 5J2PA 3MXMA 1NJWA 4AHUA 3RTVA 2Y1IA 5CZ2A 3PY8A 4CEFA 3F73A 4CGDA 3SV3A 3SPZA 3DOLA 4IG3A 3VQPA 4UQGA 1Z25A 1W0HA 5CY4A 3DRPA 3OJSA 4BE1A 1QSSA 1O1WA 1A5WA 4BDPA 3LZIA 2OPSA 1RT2A 1NK8A 2OYQA 1TAQA 4DSLA 4QCLA 2AJQA 2HVHA 2ZQBA 3QIPA 4Z0UA 3LZJA 4LY7A 4DTJA 1RBTA 1WSFA 3HM9A 2GUIA 4G1QA 3ZSRA 1QS4A 1VSKA 3VQ8A 4B9LA 3TI0A 3KLGA 2KZZA 1ZYQA 3U3GA 2PZSA 4K8ZA 4CF2A 3LP1A 3NAEA 4ELVA 2P1JA 3C95A 3HSTB 3SQ4A 3SUQA 1L3TA 3AO4A 3AA5X 4TSXA 2B4JA 5HRSA 4FJMA 1LWEA 5SWMA 3ULDA 2BDPA 4C8NA 1RBUA 3QEPA 2QKBA 1WSJA 3F9KA 4MQ3A 4M3XA 2XY6A 3CFOA 1GOBA 1LWCA 5DMRA 4CGJA 3V9XA 4FJGA 1QSYA 1S1XA 2OZSA 1NK9A 1KFDA 3NH2A 2A1RA 4J2BA 1YTUA 2HVIA 3DYAA 3VQ5A 1B92A 1VSMA 2OPRA 1UA0A 3KD1E 2DY4A 2DTUA 3ZSVA 5E41A 4DTSA 1ZBHA 4CFCA 5CYQA 1A5XA 4CEOA 3RWUA 3SPYA 4DFKA 1LAWA 1RT3A 4CEDA 4O0IA 4DQRA 4DTOA 1NJXA 1D9DA 4B9MA 4ZTJA 3OYFA 3U3YA 4C8OA 5KGWA 4RW9A 2FBVA 3NH0A 4F2SA 3NFAA 4FLXA 4FJ8A 4ICLA 1BIUA 1S5JA 4DF8A 1I3AA 3VQ7A 1LAVA 4CHPA 5HRPA 1CXQA 4CJRA 2Z1IA 2YKNA 4E1MA 1RTJA 4FJ5A 3VQBA 1J54A 1JKHA 4O4GA 1BCMA 1JLBA 1C6VA 2BE2A 2D0BA 3PV8A 1BQNA 1RILA 2KW4A 4ZTFA 1IKVA 3DI6A 1Y97A 3TAFA 4N5SA 3DLBA 4FJ7A 1U4BA 1B9FA 1NOZA 1S1TA 1HJRA 1RDBA 2D0AA 4DTXA 3QEXA 1KTQA 4IG0A 2P5OA 2Z1HA 3AVJA 4EP5A 4M3ZA 3L8BA 4KRFA 1LV5A 1JLAA 3P83D 3V4IA 3SUNA 2G8KA 4I9QA 4Q5VA 4DS4A 3HPGA 3QIOA 1KLMA 3ZT3A 4FLYA 1D5AA 1BGXT 2HHXA 2NUBA 3CFPA 4ZHRA 4KHQA 1VSDA 4HUGA 3HP9A 3O3FA 3KK3A 4FK0A 4RW6A 1WAFA 3KKSA 5T7BA 4DMNA 4LH4A 5FRNA 4C8LA 1Z26A 3NBPA 5HP1A 4CFAA 1L3SA 3DRSA 1BI4B 1G15A 4DU3A 3OS0A 3KIOA 2IC3A 5J2MA 1JL2A 2XY5A 3UIQA 4IKFA 2X6NA 4CF9A 4DSKA 4DQSA 3I0RA 1SKSA 3SYZA 2VWJA 1RNHA 2HHTA 4M41A 1WN7A 3I8DA 1JLQA 4BWMA 1CLQA 4HVJA 3PO4A 4HCBA 3RMDA 4KI6A 3DLEA 4AH9A 4CESA 3NH1A 4FM0A 1WLJA 5J1EA 3LDSA 1TV6A 3OYJA 4CK3A 4XIUA 1TK8A 4BDYA 1TAUA 2B5JA 3JSMA 4DFJA 1S6QA 3DM2A 4OKKA 4NCGA 3T1AA 4CJTA 2F96A 3IRXA 1Q9XA 4NCBA 4DTNA 1IKYA 2HNDA 1HQUA 3V1QA 3SQ2A 2OZMA 4DU4A 1UOCA 1FKPA 1FK9A 3NE6A 4I9LA 3CG7A 1S9GA 2HHQA 3KLEA 4CEAA 1L5UA 2O4IA 3AVBA 1JXBA 1TKTA 4BDZA 4RW8A 4W5OA 3OYEA 1S1VA 1KSPA 3DLRA 4FW1A 1EXQA 4E3SA 4B9UA 4B8AB 2HHWA 4O5BA 4GW6A 1KRPA 4CJ4A 4BE2A 4M3UA 1KLNA 3ZSZA 3RR8A 5HROA 4FJKA 3K2PA 3NF6A 1EETA 3LWLA 4FLTA 3HP6A 4DQPA 1SKWA 5DK5A 1TK0A 4PA1A 3LP0A 5SZTA 3S3OA 4DWIA 5K14A 3TABA 1UAXA 5KRTA 3QEVA 1VRUA 1T7PA 3O3HA 2X78A 3BGRA 1SKRA 4F3OA 1XI1A 4OKEA 1LWFA 4FLUA 4M3TA 4M45A 3EY1A 4KHYA 1UA1A 3SUOA 4CJWA 3MAQA 3PO5A 3DLGA 3MXIA 1XHXA 3D0PA 4M3WA 3LAMA 1S1UA 3OYMA 2IAJA 3S9HA 1L3UA 3ZT0A 3V9ZA 4KHNA 5I42A 2PYJA 4AHVA 1Q9YA 2X6SA 4CGGA 4CIFA 1RT6A 1DTQA 3QEIA 4N56A 1BL3A 2OA8A 1NK5A 2OPQA 3WNEA 1NKCA 3KTQA 2PY5A 5HRNA 3OYKA 3H08A 1GOAA 2Q3SA 4CECA 1C1BA 3VQQA 4H4MA 3OYCA 3S3NA 3OYHA 2RN2A 5JS2A 5EU7A 1C1CA 1FKOA 1HPZA 3KKRA 1ZBLA 3DLHA 1NJZA 4Z4FA 4Z4HA 1JLEA 1BIZA 4IBNA 2QXFA 2WONA 3K57A 1T8EA 2Z1GA 1REVA 3CM5A 1BHLA 1X9SA 3V1OA 4KHWA 1SUQA 4Y1DA 1JL1A 3WNGA 4E19A 4JS4A 3NGYA 3TAMA 3P1GA 1I39A 1L3VA 1A5VA 3NDKA 4DFPA 4OVLA 3M8RA 4E7JA 1NKEA 3L3VA 4HUFA 4KB1A 3KJVA 4DTUA 2WOMA 4OGCA 3SQ0A 4DSJA 2LSNA 4RG8A 2OPPA 3OYIA 2KFZA 2BANA 4K8XA 1XC9A 4CJ3A 1QSLA 3V1RA 3E01A 3LANA 4W5TA 4OJRA 4CHNA 3LP3A 2HHUA 1ZBUA 3RRGA 1KVAA 4CE9A 3NGZA 2YV0X 3OYAA 4PY5A 3L3UA 1J53A 4ELTA 2YNHA 4FW2A 2RPIA 1RT1A 4CGFA 2XHBA 2EX3A 4CJSA 1HRHA 3PX0A 4CJQA 3NCIA 3PX4A 4QOZB 4C8KA 1WSHA 2G8UA 3QETA 2QKKA 3VQ6A 1ASWA 4DSIA 2FBTA 4Z4CA 1F21A 2G8HA 2O4GA 3FFIA 4CGHA 1HMVA 4FLVA 5D3GA 3TAQA 1KVBA 4YNQA 5C25A 3AO5A 3AVKA 1VRTA 2HB5A 1SL2A 4FJXA 1VSFA 1ZBFA 3LAKA 3KLHA 1WSIA 4E89A 1SL0A 1CZBA 4CGIA 4JLHA 3DLKA 2YKMA 4PQUA 3WNFA 2DFEA 3HT3A 4DG1A 1D8YA 3SV4A 1TL1A 4DTPA 3NGIA 4FJIA 4CEBA 4N76A 2G8IA 5JS1A 3G0ZA 4FLWA 3PX6A 4CJPA 2YNIA 3VN5A 5I3UA 4EZ9A 4CEQA 1NK0A 4CFDA 1C0MA 4OGEA 4FCYA 1TKXA 1BISA 3QERA 3HO1A 4Q0BA 3QNOA 2HHVA 4OLBA 2KZMA 5KGXA 3C94A 3WNHA 1T03A 4CJ5A 3KD5E 1TKDA 5J2NA 4CEZA 2ZE2A 3TR8A 4CF8A 3B6OA 2HNZA 2HMIA 4F3TA 2FC0A 3DMJA 4OLAA 1RBVA 2VG7A 1WSEA 4N41A 3TANA 4O55A 2RKIA 1LW0A 1S9EA 3LP2A 3EYZA 2HNYA 4B8CA 4E7KA 1HYSA 2VG5A 4KTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CF0 A;  1TKZ A;  3NF7 A;  3PUF A;  5C42 A;  3OYD A;  3I0S A;  4B9N A;  2HHS A;  4H8K A;  3IAY A;  4WE1 A;  2G8W A;  3HJF A;  1S1W A;  3VQE A;  4KV8 A;  4DSF A;  3HVT A;  3C6T A;  3NHG A;  2YNG A;  4E7L A;  1QTM A;  4CFB A;  1X1P A;  1RBS A;  4L8R B;  4E7I A;  2VWK A;  1YTA A;  1RTI A;  2F8S A;  3L2U A;  1YVU A;  2EHG A;  3ALY A;  3AVI A;  3MEE A;  1NKB A;  3LPU A;  1D9F A;  1KFS A;  4CHY A;  1IH7 A;  5CZ1 A;  4JRP A;  4GMJ B;  3VQD A;  2G8F A;  4CHQ A;  4DQI A;  4M3R A;  4B9S A;  3ZSX A;  4B08 A;  3ZSQ A;  3HXM A;  4ELU A;  4KPY A;  3AO3 A;  1DLO A;  1EP4 A;  3KLI A;  1EKE A;  3AVA A;  1IG9 A;  3QES A;  3M8Q A;  1HYZ A;  1JLG A;  1JXE A;  3B6P A;  4NCA A;  3THV A;  2VG6 A;  4E7H A;  4M42 A;  4J2A A;  2RF2 A;  4FVM A;  4KFB A;  4HUE A;  4Z4E A;  3V81 A;  4W5N A;  1ITG A;  1LW2 A;  1VSI A;  4CJU A;  1X9W A;  1RDA A;  4KB0 A;  2KFN A;  4GVM A;  4H4O A;  1VSE A;  3VQA A;  1QQC A;  3L2W A;  2YHA A;  1SV5 A;  4DS5 A;  1KVC A;  4CJV A;  4C8M A;  4DLE A;  3TAE A;  1DTT A;  3O4Q A;  4KO0 A;  3VA0 A;  1ASV A;  4KHU A;  2IS3 A;  5HBM A;  3T3F A;  4FXD A;  2JLE A;  4CJK A;  3M8P A;  4I2P A;  3AVG A;  3TAP A;  1YT3 A;  1RTD A;  1VSJ A;  4MFB A;  1MU2 A;  4IFY A;  4B9V A;  4I2Q A;  4Z4G A;  4FJN A;  1SL1 A;  1VSH A;  3VQ4 A;  2A1S A;  1NK4 A;  3G10 A;  4DTM A;  4KAZ A;  4OPK A;  1HNV A;  4NYN A;  3OYG A;  1NJY A;  4FJH A;  4CER A;  4E0D A;  4O44 A;  3SQ1 A;  1KCF A;  3AO1 A;  4CIE A;  4B9T A;  4FZZ A;  3QNN A;  1JLC A;  3CM6 A;  3AVL A;  4FM2 A;  2XRI A;  3M8S A;  3TAR A;  1U45 A;  2W42 A;  4CJL A;  3V9W A;  1IKX A;  3AVF A;  1C0T A;  4FZX C;  1W9H A;  4N47 A;  4AHR A;  3ZSW A;  4LH5 A;  4W5Q A;  4DQQ A;  4YFU A;  4F2R A;  3AVN A;  4LSN A;  3O3G A;  3SI6 A;  1U49 A;  4FJ9 A;  4HCC A;  1WAJ A;  2Y1J A;  1BQM A;  1U04 A;  4CJF A;  3KLF A;  3KK1 A;  3K5N A;  5HLF A;  4PUO A;  1RBR A;  1N5Y A;  3ITH A;  4BAC A;  4NYF A;  4DSE A;  4F4K A;  4FK4 A;  4OPJ A;  2I5J A;  4BE0 A;  3OS2 A;  1HQE A;  2ETJ A;  1C0U A;  3HK2 A;  3L2V A;  1TL3 A;  1CZ9 A;  3ZT4 A;  3K58 A;  3NF8 A;  2B6A A;  1NK7 A;  1UWB A;  3ZT2 A;  3OS1 A;  3KK2 A;  2YNF A;  1RTH A;  3NF9 A;  3V6D A;  4E1N A;  4CF1 A;  2F8T A;  3LWM A;  1RDC A;  1XWL A;  3OVN A;  3OJU A;  1BCO A;  5HRR A;  5KRS A;  1HNI A;  3QO9 A;  4CCH A;  5C24 A;  3T19 A;  2D0C A;  1U48 A;  3SNN A;  1U47 A;  4CEE A;  1RT7 A;  2E4L A;  3ZCM A;  2YHB A;  3RR7 A;  4CIG A;  5KTQ A;  3AA2 A;  3OYN A;  1ASU A;  3DOK A;  3IS9 A;  3P5J A;  4DU1 A;  4R5P A;  2X74 A;  1QHT A;  4KHS A;  1WNS A;  2DFH A;  1J9A A;  2ITG A;  2FBX A;  1RDD A;  2FBY A;  1B9D A;  4Y1C A;  4EZ6 A;  3QEW A;  3V9U A;  1HYV A;  3LAL A;  4IFV A;  3VQC A;  4ID5 A;  1IO2 A;  1BI4 A;  3L2R A;  1JLF A;  1TVR A;  3RMB A;  3OYL A;  1NOY A;  2KQ2 A;  3HPO A;  4B3O A;  2JGU A;  3MEC A;  3ASM A;  3SZ2 A;  1RT5 A;  2GBZ A;  4FZY A;  2DFF A;  2XY8 A;  1ZBI A;  1K6Y A;  3C6U A;  3IG1 A;  1VK0 A;  3D45 A;  4M3Y A;  1QE1 A;  3EZ5 A;  4AIL C;  3RMA A;  1RCH A;  1N6Q A;  3AVM A;  2PYL A;  4QAG A;  4RW7 A;  2IOC A;  4BWJ A;  3V9S A;  1J5O A;  4FJL A;  2D5R A;  5FRM A;  3O4N A;  3TWH A;  3L2Q A;  4FM1 A;  3CQ8 A;  4DTR A;  3AVC A;  3CYM A;  1GOC A;  4F8R A;  2R7Y A;  4HTU A;  1FXX A;  3HYF A;  3ISN C;  4FK2 A;  3DRR A;  3AA4 A;  2XO7 A;  4AHC A;  5FRO A;  3K59 A;  4I7F A;  4LSL A;  2XY7 A;  3K5O A;  4FLZ A;  3SCX A;  4J2D A;  3SUP A;  4Z4I A;  3HL8 A;  3AVH A;  4AHS A;  4LD0 A;  3MED A;  1EX4 A;  1C1A A;  3AA3 A;  3ZSO A;  1RT4 A;  3MEG A;  2ZD1 A;  4CK1 A;  4EP4 A;  4CHO A;  3TAG A;  4KI4 A;  3RMC A;  3OY9 A;  4DF4 A;  2P51 A;  3U6F A;  2GV9 A;  2HW3 A;  4JS5 A;  2BGG A;  1IKW A;  4KRE A;  1X9M A;  3K5M A;  4ID1 A;  2QK9 A;  4PWD A;  4CK2 A;  4O0J A;  3AV9 A;  4KKO A;  4J2E A;  4FYD A;  4IDK A;  4FJJ A;  1TK5 A;  2IDO A;  4RW4 A;  1Q8I A;  1VSL A;  4DLG A;  3VA3 A;  1R0A A;  4W5R A;  1CXU A;  1TGO A;  3OYB A;  4CJE A;  3ZT1 A;  3BDP A;  4KTW A;  3JYT A;  3A2F A;  4OKJ A;  3RRH A;  4DFM A;  3AO2 A;  1NK6 A;  1S6P A;  2Z1J A;  5CYM A;  1WSG A;  3VQ9 A;  2E6L A;  3HVR A;  1T05 A;  3CFR A;  3SJJ A;  5KI6 A;  3K5L A;  4JRQ A;  2P5G A;  3HPH A;  4KTQ A;  2KTQ A;  3MXJ A;  3S3M A;  2G8V A;  1XHZ A;  4CHZ A;  5FDL A;  3LPT A;  2IGI A;  3ZSY A;  3QLH A;  4AHT A;  5J2Q A;  2ATQ A;  2E6M A;  3QIN A;  4HHT A;  5J2P A;  3MXM A;  1NJW A;  4AHU A;  3RTV A;  2Y1I A;  5CZ2 A;  3PY8 A;  4CEF A;  3F73 A;  4CGD A;  3SV3 A;  3SPZ A;  3DOL A;  4IG3 A;  3VQP A;  4UQG A;  1Z25 A;  1W0H A;  5CY4 A;  3DRP A;  3OJS A;  4BE1 A;  1QSS A;  1O1W A;  1A5W A;  4BDP A;  3LZI A;  2OPS A;  1RT2 A;  1NK8 A;  2OYQ A;  1TAQ A;  4DSL A;  4QCL A;  2AJQ A;  2HVH A;  2ZQB A;  3QIP A;  4Z0U A;  3LZJ A;  4LY7 A;  4DTJ A;  1RBT A;  1WSF A;  3HM9 A;  2GUI A;  4G1Q A;  3ZSR A;  1QS4 A;  1VSK A;  3VQ8 A;  4B9L A;  3TI0 A;  3KLG A;  2KZZ A;  1ZYQ A;  3U3G A;  2PZS A;  4K8Z A;  4CF2 A;  3LP1 A;  3NAE A;  4ELV A;  2P1J A;  3C95 A;  3HST B;  3SQ4 A;  3SUQ A;  1L3T A;  3AO4 A;  3AA5 X;  4TSX A;  2B4J A;  5HRS A;  4FJM A;  1LWE A;  5SWM A;  3ULD A;  2BDP A;  4C8N A;  1RBU A;  3QEP A;  2QKB A;  1WSJ A;  3F9K A;  4MQ3 A;  4M3X A;  2XY6 A;  3CFO A;  1GOB A;  1LWC A;  5DMR A;  4CGJ A;  3V9X A;  4FJG A;  1QSY A;  1S1X A;  2OZS A;  1NK9 A;  1KFD A;  3NH2 A;  2A1R A;  4J2B A;  1YTU A;  2HVI A;  3DYA A;  3VQ5 A;  1B92 A;  1VSM A;  2OPR A;  1UA0 A;  3KD1 E;  2DY4 A;  2DTU A;  3ZSV A;  5E41 A;  4DTS A;  1ZBH A;  4CFC A;  5CYQ A;  1A5X A;  4CEO A;  3RWU A;  3SPY A;  4DFK A;  1LAW A;  1RT3 A;  4CED A;  4O0I A;  4DQR A;  4DTO A;  1NJX A;  1D9D A;  4B9M A;  4ZTJ A;  3OYF A;  3U3Y A;  4C8O A;  5KGW A;  4RW9 A;  2FBV A;  3NH0 A;  4F2S A;  3NFA A;  4FLX A;  4FJ8 A;  4ICL A;  1BIU A;  1S5J A;  4DF8 A;  1I3A A;  3VQ7 A;  1LAV A;  4CHP A;  5HRP A;  1CXQ A;  4CJR A;  2Z1I A;  2YKN A;  4E1M A;  1RTJ A;  4FJ5 A;  3VQB A;  1J54 A;  1JKH A;  4O4G A;  1BCM A;  1JLB A;  1C6V A;  2BE2 A;  2D0B A;  3PV8 A;  1BQN A;  1RIL A;  2KW4 A;  4ZTF A;  1IKV A;  3DI6 A;  1Y97 A;  3TAF A;  4N5S A;  3DLB A;  4FJ7 A;  1U4B A;  1B9F A;  1NOZ A;  1S1T A;  1HJR A;  1RDB A;  2D0A A;  4DTX A;  3QEX A;  1KTQ A;  4IG0 A;  2P5O A;  2Z1H A;  3AVJ A;  4EP5 A;  4M3Z A;  3L8B A;  4KRF A;  1LV5 A;  1JLA A;  3P83 D;  3V4I A;  3SUN A;  2G8K A;  4I9Q A;  4Q5V A;  4DS4 A;  3HPG A;  3QIO A;  1KLM A;  3ZT3 A;  4FLY A;  1D5A A;  1BGX T;  2HHX A;  2NUB A;  3CFP A;  4ZHR A;  4KHQ A;  1VSD A;  4HUG A;  3HP9 A;  3O3F A;  3KK3 A;  4FK0 A;  4RW6 A;  1WAF A;  3KKS A;  5T7B A;  4DMN A;  4LH4 A;  5FRN A;  4C8L A;  1Z26 A;  3NBP A;  5HP1 A;  4CFA A;  1L3S A;  3DRS A;  1BI4 B;  1G15 A;  4DU3 A;  3OS0 A;  3KIO A;  2IC3 A;  5J2M A;  1JL2 A;  2XY5 A;  3UIQ A;  4IKF A;  2X6N A;  4CF9 A;  4DSK A;  4DQS A;  3I0R A;  1SKS A;  3SYZ A;  2VWJ A;  1RNH A;  2HHT A;  4M41 A;  1WN7 A;  3I8D A;  1JLQ A;  4BWM A;  1CLQ A;  4HVJ A;  3PO4 A;  4HCB A;  3RMD A;  4KI6 A;  3DLE A;  4AH9 A;  4CES A;  3NH1 A;  4FM0 A;  1WLJ A;  5J1E A;  3LDS A;  1TV6 A;  3OYJ A;  4CK3 A;  4XIU A;  1TK8 A;  4BDY A;  1TAU A;  2B5J A;  3JSM A;  4DFJ A;  1S6Q A;  3DM2 A;  4OKK A;  4NCG A;  3T1A A;  4CJT A;  2F96 A;  3IRX A;  1Q9X A;  4NCB A;  4DTN A;  1IKY A;  2HND A;  1HQU A;  3V1Q A;  3SQ2 A;  2OZM A;  4DU4 A;  1UOC A;  1FKP A;  1FK9 A;  3NE6 A;  4I9L A;  3CG7 A;  1S9G A;  2HHQ A;  3KLE A;  4CEA A;  1L5U A;  2O4I A;  3AVB A;  1JXB A;  1TKT A;  4BDZ A;  4RW8 A;  4W5O A;  3OYE A;  1S1V A;  1KSP A;  3DLR A;  4FW1 A;  1EXQ A;  4E3S A;  4B9U A;  4B8A B;  2HHW A;  4O5B A;  4GW6 A;  1KRP A;  4CJ4 A;  4BE2 A;  4M3U A;  1KLN A;  3ZSZ A;  3RR8 A;  5HRO A;  4FJK A;  3K2P A;  3NF6 A;  1EET A;  3LWL A;  4FLT A;  3HP6 A;  4DQP A;  1SKW A;  5DK5 A;  1TK0 A;  4PA1 A;  3LP0 A;  5SZT A;  3S3O A;  4DWI A;  5K14 A;  3TAB A;  1UAX A;  5KRT A;  3QEV A;  1VRU A;  1T7P A;  3O3H A;  2X78 A;  3BGR A;  1SKR A;  4F3O A;  1XI1 A;  4OKE A;  1LWF A;  4FLU A;  4M3T A;  4M45 A;  3EY1 A;  4KHY A;  1UA1 A;  3SUO A;  4CJW A;  3MAQ A;  3PO5 A;  3DLG A;  3MXI A;  1XHX A;  3D0P A;  4M3W A;  3LAM A;  1S1U A;  3OYM A;  2IAJ A;  3S9H A;  1L3U A;  3ZT0 A;  3V9Z A;  4KHN A;  5I42 A;  2PYJ A;  4AHV A;  1Q9Y A;  2X6S A;  4CGG A;  4CIF A;  1RT6 A;  1DTQ A;  3QEI A;  4N56 A;  1BL3 A;  2OA8 A;  1NK5 A;  2OPQ A;  3WNE A;  1NKC A;  3KTQ A;  2PY5 A;  5HRN A;  3OYK A;  3H08 A;  1GOA A;  2Q3S A;  4CEC A;  1C1B A;  3VQQ A;  4H4M A;  3OYC A;  3S3N A;  3OYH A;  2RN2 A;  5JS2 A;  5EU7 A;  1C1C A;  1FKO A;  1HPZ A;  3KKR A;  1ZBL A;  3DLH A;  1NJZ A;  4Z4F A;  4Z4H A;  1JLE A;  1BIZ A;  4IBN A;  2QXF A;  2WON A;  3K57 A;  1T8E A;  2Z1G A;  1REV A;  3CM5 A;  1BHL A;  1X9S A;  3V1O A;  4KHW A;  1SUQ A;  4Y1D A;  1JL1 A;  3WNG A;  4E19 A;  4JS4 A;  3NGY A;  3TAM A;  3P1G A;  1I39 A;  1L3V A;  1A5V A;  3NDK A;  4DFP A;  4OVL A;  3M8R A;  4E7J A;  1NKE A;  3L3V A;  4HUF A;  4KB1 A;  3KJV A;  4DTU A;  2WOM A;  4OGC A;  3SQ0 A;  4DSJ A;  2LSN A;  4RG8 A;  2OPP A;  3OYI A;  2KFZ A;  2BAN A;  4K8X A;  1XC9 A;  4CJ3 A;  1QSL A;  3V1R A;  3E01 A;  3LAN A;  4W5T A;  4OJR A;  4CHN A;  3LP3 A;  2HHU A;  1ZBU A;  3RRG A;  1KVA A;  4CE9 A;  3NGZ A;  2YV0 X;  3OYA A;  4PY5 A;  3L3U A;  1J53 A;  4ELT A;  2YNH A;  4FW2 A;  2RPI A;  1RT1 A;  4CGF A;  2XHB A;  2EX3 A;  4CJS A;  1HRH A;  3PX0 A;  4CJQ A;  3NCI A;  3PX4 A;  4QOZ B;  4C8K A;  1WSH A;  2G8U A;  3QET A;  2QKK A;  3VQ6 A;  1ASW A;  4DSI A;  2FBT A;  4Z4C A;  1F21 A;  2G8H A;  2O4G A;  3FFI A;  4CGH A;  1HMV A;  4FLV A;  5D3G A;  3TAQ A;  1KVB A;  4YNQ A;  5C25 A;  3AO5 A;  3AVK A;  1VRT A;  2HB5 A;  1SL2 A;  4FJX A;  1VSF A;  1ZBF A;  3LAK A;  3KLH A;  1WSI A;  4E89 A;  1SL0 A;  1CZB A;  4CGI A;  4JLH A;  3DLK A;  2YKM A;  4PQU A;  3WNF A;  2DFE A;  3HT3 A;  4DG1 A;  1D8Y A;  3SV4 A;  1TL1 A;  4DTP A;  3NGI A;  4FJI A;  4CEB A;  4N76 A;  2G8I A;  5JS1 A;  3G0Z A;  4FLW A;  3PX6 A;  4CJP A;  2YNI A;  3VN5 A;  5I3U A;  4EZ9 A;  4CEQ A;  1NK0 A;  4CFD A;  1C0M A;  4OGE A;  4FCY A;  1TKX A;  1BIS A;  3QER A;  3HO1 A;  4Q0B A;  3QNO A;  2HHV A;  4OLB A;  2KZM A;  5KGX A;  3C94 A;  3WNH A;  1T03 A;  4CJ5 A;  3KD5 E;  1TKD A;  5J2N A;  4CEZ A;  2ZE2 A;  3TR8 A;  4CF8 A;  3B6O A;  2HNZ A;  2HMI A;  4F3T A;  2FC0 A;  3DMJ A;  4OLA A;  1RBV A;  2VG7 A;  1WSE A;  4N41 A;  3TAN A;  4O55 A;  2RKI A;  1LW0 A;  1S9E A;  3LP2 A;  3EYZ A;  2HNY A;  4B8C A;  4E7K A;  1HYS A;  2VG5 A;  4KTZ A; 
#chains in the Genus database with same CATH topology
 1YUW A;  4CZJ A;  3IAY A;  3THY B;  1S1W A;  3VQE A;  4KV8 A;  4JI8 K;  3WXK A;  3HVT A;  3NHG A;  3E9L A;  4CFB A;  2WBN A;  1YTA A;  1RTI A;  3CJB A;  5BPL A;  3L2U A;  1YVU A;  3EZW A;  1IH7 A;  5CZ1 A;  3QBX A;  5BN9 A;  3PSF A;  4B9S A;  3HXM A;  4ELU A;  3AVA A;  1HYZ A;  1JLG A;  4NCA A;  4YOV A;  4E7H A;  4Z4E A;  2RF2 A;  4FVM A;  4HUE A;  4W5N A;  5AQN A;  1FW6 A;  4H5T A;  2OAN A;  4H4O A;  4B1Y B;  1IG8 A;  2QW9 A;  2QWL A;  1KVC A;  1QZ5 A;  3TSP A;  1BG3 A;  4KHU A;  4CJK A;  5M1N A;  1RTD A;  1VSJ A;  1YF5 L;  4B9V A;  2O8B A;  3SK3 A;  1NGC A;  3CC4 N;  1VSH A;  5AQR A;  3G10 A;  3FZF A;  1HNV A;  4NYN A;  5JVG L;  2I7N A;  4EHT A;  3AO1 A;  2VCP A;  1JLC A;  4M7Y A;  5AQM A;  3M8S A;  4BR4 A;  2W42 A;  3Q7C A;  3ZSW A;  4W5Q A;  1QVF M;  4LSN A;  1U49 A;  2Y1J A;  1BQM A;  3J7Z O;  3KK1 A;  3K5N A;  5HLF A;  4IO9 L;  4BAC A;  3ZYY X;  3EL2 A;  1VQO N;  3OS2 A;  1HQE A;  1C0U A;  3DXK A;  3FR0 A;  5I9E B;  3L2V A;  1T6C A;  4JEP A;  3GG4 A;  1KC8 O;  5GAG P;  2B6A A;  4BR9 A;  2W40 A;  4JYA K;  3QML A;  2E20 A;  3OVN A;  1GLF O;  3G6E N;  4JN4 A;  3T19 A;  2D0C A;  1QQN A;  1NGJ A;  1U47 A;  3P4I A;  3ZCM A;  3RR7 A;  5KTQ A;  3LM2 A;  2IVP A;  3DOK A;  1E4G T;  4KHS A;  1J9A A;  4IXC A;  2HBJ A;  1B9D A;  3VEN A;  1HYV A;  4ID5 A;  1BI4 A;  2QWM A;  5LL6 Z;  1JLF A;  1TVR A;  4CZH A;  4Y0W A;  5KPZ A;  3UKR A;  3CCE N;  1VK0 A;  3EZ5 A;  1N6Q A;  2PYL A;  4QAG A;  1DEJ A;  4FJL A;  3HSC A;  4JHD A;  5AQJ A;  2ASM A;  3CQ8 A;  4DTR A;  3THY A;  2R7Y A;  4FK2 A;  3DRR A;  4J2D A;  3WQU A;  3CQX A;  3SUP A;  4AHS A;  4EP4 A;  3MEG A;  4KI4 A;  1YIJ N;  3VTI A;  4DF4 A;  2GV9 A;  4JS5 A;  3VES A;  1IKW A;  1T3V A;  2P9S B;  3G25 A;  4KRE A;  1K8K A;  3MWP A;  3H45 C;  4PWD A;  3N4Q A;  2HF3 A;  4KKO A;  3CER A;  1VQN N;  1TK5 A;  3K9J A;  4WQ5 C;  1TGO A;  3VEZ A;  4IJN A;  1SS6 A;  3E9P A;  4BRK A;  5C15 A;  3AO2 A;  2Z1J A;  1WSG A;  3CET A;  3VQ9 A;  2E6L A;  4JV5 K;  4ISE A;  3HPH A;  4DR5 K;  4JKF A;  5C2F A;  3ZSY A;  2W6L A;  3VF2 A;  2E6M A;  3QIN A;  5LMU K;  4IJA A;  3O1W A;  1GLC G;  3F73 A;  5AQF A;  4CGD A;  4B3T K;  4I6M B;  5GIP A;  1W0H A;  4BE1 A;  1QSS A;  1O1W A;  3FE1 A;  4H0V B;  4H5W A;  3LZI A;  1NK8 A;  2OYQ A;  4O5F A;  4QCL A;  2I7P A;  3LZJ A;  5AQW A;  1WSF A;  2VQF K;  4GKK K;  2GUI A;  3DLL L;  3ZSR A;  5EX5 A;  2J4R A;  3NVM A;  3TI0 A;  3KLG A;  4BVO A;  2RE2 A;  1OVQ A;  1WUA A;  4CF2 A;  5DM7 L;  3LP1 A;  4PHT X;  1GLJ O;  4A5B A;  3S41 A;  3VOV A;  3OBY A;  4MQ3 A;  2XY6 A;  1N36 K;  4CGJ A;  4GV9 A;  5AQK A;  1YTU A;  3NH2 A;  2FSK A;  1B92 A;  1VSM A;  2OPR A;  2DY4 A;  3ZSV A;  3NMU A;  1ZBH A;  3OA9 A;  4B1V A;  3DXM B;  1A5X A;  4CZK A;  4O8K A;  4DFK A;  4DTO A;  4BQL A;  4B9M A;  2V51 B;  4JI1 K;  4RW9 A;  2FBV A;  4F2S A;  1BIU A;  1I3A A;  4CHP A;  2Z1I A;  4ILH A;  1W7A A;  4FJ5 A;  3K9K A;  3VQB A;  3QB0 A;  2P9U B;  2YI1 A;  4O4G A;  3C6H A;  4BRA A;  1OH6 A;  4ZTF A;  3VEX A;  1U4B A;  1B9F A;  3WXI A;  3QEX A;  4DTX A;  1XQS C;  1NGB A;  3AVJ A;  4EP5 A;  3L8B A;  2O8F B;  1YAG A;  2NRX A;  3KVG A;  4MLH A;  4DS4 A;  1GLL O;  2NUB A;  4KHQ A;  2FF3 B;  5E26 A;  4NXM K;  3HP9 A;  3H46 O;  3KK3 A;  2WFB A;  3WXL A;  5FRN A;  2V7Y A;  2O8E B;  4DV2 K;  2P9S A;  4DU3 A;  3UIQ A;  2XY5 A;  2O8C B;  4IKF A;  4DSK A;  4DQS A;  1RNH A;  1WN7 A;  2V7Z A;  1JLQ A;  3THX B;  4KI6 A;  4UY8 O;  5J1E A;  3LDS A;  5AQS A;  5AQO A;  5BR9 A;  1KAZ A;  2GEL A;  4DFJ A;  4DTN A;  1IKY A;  2HND A;  3VMF B;  4DHY A;  4DU4 A;  1FKP A;  3NE6 A;  5FLX O;  3MX5 A;  4BDZ A;  4RW8 A;  3TPQ A;  1KSP A;  4FW1 A;  1EXQ A;  3SLC A;  4E3S A;  2HHW A;  4GW6 A;  1XUP O;  5BN8 A;  4M3U A;  4BE2 A;  4BVP A;  3ZSZ A;  4EFH A;  3LWL A;  4DQP A;  4ISG A;  1T7P A;  1VRU A;  1BDG A;  1MA9 B;  4JKE A;  1SKR A;  3HZ6 A;  4M3T A;  4KHY A;  1UA1 A;  3SUO A;  3MN9 A;  5AQV A;  3DLG A;  3D0P A;  3LAM A;  1L3U A;  3IFR A;  4KHN A;  2X6S A;  2PAV A;  1RT6 A;  4KBO A;  2CH6 A;  3CCJ N;  2OA8 A;  4DR1 K;  2V52 B;  3WNE A;  4BRQ A;  3O08 A;  5HRN A;  3VEO A;  4CEC A;  5BRE A;  2RN2 A;  1FKO A;  2QWQ A;  1NGI A;  1BIZ A;  2WON A;  5LJW A;  1T8E A;  4PKG A;  1REV A;  4JKA A;  3SAG A;  1X9S A;  3E9O A;  4KHW A;  3HRG A;  4MO5 A;  4E19 A;  4JS4 A;  2A6A A;  3U9D A;  1K9M O;  2E2N A;  1A5V A;  4DFP A;  1L3V A;  3M8R A;  4DTU A;  4OGC A;  1HKG A;  3EE8 A;  4DSJ A;  1JCG A;  1BO5 O;  4BRG A;  4W5T A;  2P9U A;  2GUP A;  1Z6R A;  3AY9 A;  4CE9 A;  5AJ3 K;  2YV0 X;  2FLO A;  3OYA A;  4FW2 A;  4CGF A;  2EX3 A;  1NGG A;  2F4V K;  4JI4 K;  1WSH A;  2G8U A;  5ADX A;  2QKK A;  4PKH A;  5AQX A;  2FBT A;  1SAZ A;  2G8H A;  3I56 N;  4CGH A;  3TAQ A;  4LFA K;  4DV5 K;  2P9P A;  4JD2 B;  1OKJ A;  4YOT A;  2HB5 A;  3LAK A;  1WSI A;  3O9U A;  4ISF A;  2O8E A;  2NLX A;  2YKM A;  4JI5 K;  3O9S A;  3ULE A;  3J81 O;  1D8Y A;  3NGI A;  4CEB A;  4YOY A;  4N76 A;  3G0Z A;  5LJV A;  3PX6 A;  5AZJ B;  2YNI A;  1NK0 A;  2E88 A;  1C0M A;  4OGE A;  4CFD A;  3HO1 A;  4OPH A;  4Q0B A;  2KZM A;  3ATU A;  5J2N A;  5LY3 A;  3B6O A;  3DMJ A;  1RBV A;  2VG7 A;  1WSE A;  4FWL A;  4N41 A;  1VHX A;  1HLU A;  1T44 A;  3EYZ A;  1YXQ A;  3LDL A;  3G4S N;  4CF0 A;  3NF7 A;  4H8K A;  3PIP L;  4WE1 A;  3HJF A;  3C6T A;  2YNG A;  3L4I A;  1ATR A;  2GTD A;  4L8R B;  4HTL A;  3PLA A;  4IFE A;  4CHY A;  4CHQ A;  3W0L A;  1G99 A;  4B08 A;  2GWK A;  3AO3 A;  1EKE A;  1IG9 A;  3QES A;  3N4P A;  2VG6 A;  4LF5 K;  4J2A A;  4M42 A;  4KFB A;  3BZC A;  4FWN A;  4CJU A;  1P90 A;  1ILY A;  4GVM A;  3VQA A;  5BRD A;  1Q18 A;  4JKG B;  3AGR A;  4DS5 A;  1S3X A;  4CJV A;  3TAE A;  2D4W A;  3VA0 A;  4LF9 K;  4I2P A;  3BUZ B;  4DR2 K;  5A2Q O;  3R1X A;  4KH4 A;  3TAP A;  2QWO A;  3D2F B;  4MFB A;  1WOQ A;  4IFY A;  4I2Q A;  1ZC6 A;  3TTC A;  4FJN A;  1SL1 A;  3OTO K;  4ILJ A;  4DTM A;  4KAZ A;  1TYQ B;  4YHH K;  3UB5 A;  3OYG A;  3SBG A;  4E0D A;  4O44 A;  2CH5 A;  3SQ1 A;  4FZZ A;  4BRD A;  2XRI A;  3TAR A;  4WQ5 A;  1NGF A;  3AVF A;  2F7T A;  4N47 A;  3C7N A;  4GNI A;  4YOU A;  4AHR A;  4YFU A;  3SI6 A;  4HCC A;  4CJF A;  1U04 A;  3KLF A;  1RBR A;  5AQP A;  2IIR A;  4DSE A;  4F4K A;  2Q97 A;  3ZET B;  4BE0 A;  1JCE A;  4BGB A;  1CZ9 A;  1QQM A;  3L0Q A;  3CQY A;  1NK7 A;  3D2E B;  2YNF A;  4EHU A;  1RTH A;  2F8T A;  1RDC A;  3OJU A;  3ID6 A;  3BZK A;  4JD2 A;  5HRR A;  4WYB A;  3O1B A;  3ENO A;  3SMP A;  4KHP K;  4CEE A;  1RT7 A;  1VQ8 N;  2E4L A;  1QZ6 A;  4B3M K;  3IS9 A;  3P5J A;  4DU1 A;  1IBL K;  4OPA A;  2X74 A;  2DFH A;  2FBX A;  2ITG A;  1RDD A;  3QEW A;  3V9U A;  2Q36 A;  4DV0 K;  3L2R A;  2KQ2 A;  4BY9 C;  3C6U A;  3QFU A;  3KZB A;  3D45 A;  1QE1 A;  2OTJ N;  4JKH A;  5AZI B;  1RCH A;  3AVM A;  4RW7 A;  2UUC K;  2IOC A;  3H1V X;  3V9S A;  3CCM N;  3C65 A;  1U2V B;  2Q31 A;  3CYM A;  4F8R A;  3HYF A;  2YX6 A;  5FRO A;  3K59 A;  4LSL A;  4IDH A;  4FLZ A;  2XY7 A;  1N34 K;  4Z4I A;  3AVH A;  1VQ4 N;  3AA3 A;  1RT4 A;  4FVU A;  2P51 A;  2BTF A;  3FGU A;  5TKY A;  2QK9 A;  3VER A;  1XMO K;  3R3L A;  4J2E A;  1ESV A;  4FYD A;  2IDO A;  3HOT A;  1Q8I A;  4DLG A;  4CBW A;  4AQY K;  1JJ2 M;  4W5R A;  5IT9 O;  4JKG A;  5AFU A;  3OYB A;  1C0F A;  1VQM N;  4KTW A;  1GLE G;  3JYT A;  2VYP A;  3HVR A;  1T05 A;  3CFR A;  3SJJ A;  3D2F A;  2P5G A;  1S72 N;  2BUP A;  1QVG M;  4KTQ A;  3S3M A;  2G8V A;  5J2P A;  2ZGY A;  4AM6 A;  1NJW A;  3PY8 A;  5CZ2 A;  2A3Z A;  1FJG K;  2W41 A;  5ELZ A;  3SPZ A;  5C2D A;  3DOL A;  3VQP A;  1Z25 A;  2GX9 A;  4H0O A;  2OPS A;  2PFU A;  1TAQ A;  5C0Y A;  2HVH A;  4Z0U A;  4A62 A;  2NZT A;  4BR5 A;  4DTJ A;  1RBT A;  3HM9 A;  4A2B A;  1VSK A;  1HNW K;  2WTU A;  3FZH A;  2KZZ A;  1ZYQ A;  3U3G A;  2PZS A;  3ZET A;  3C95 A;  1WB9 A;  1MWK A;  2ITM A;  2B4J A;  4FJM A;  1LWE A;  4H0T B;  4C8N A;  3D6R A;  1WSJ A;  1IBK K;  3V9X A;  2A5X A;  1QSY A;  3A5O C;  2GWJ A;  3GE1 A;  4JAX A;  3DYA A;  3VQ5 A;  5E41 A;  4CFC A;  4CED A;  3U3Y A;  5EXW A;  3MN7 A;  4DF8 A;  1S5J A;  1HNZ K;  1LAV A;  4LFB K;  2UXC K;  2CGL A;  4E1M A;  4JNE A;  1LOT B;  3L6Q A;  4WFN L;  1BCM A;  3PV8 A;  4CJ7 A;  5ADX H;  1IKV A;  3TAF A;  3DLB A;  1DKG D;  4FJ7 A;  1RDB A;  2YHX A;  4IG0 A;  1LV5 A;  1JLA A;  3ZEU A;  4V19 S;  4Q5V A;  2E2P A;  3HPG A;  1KLM A;  4FLY A;  3BF1 A;  2ASP A;  3UKU B;  3O3F A;  4FK0 A;  4IOA L;  1WAF A;  4O8U A;  5T7B A;  4WFB L;  4DMN A;  4CZM A;  5KQ8 A;  4GKJ K;  1W97 L;  5HP1 A;  4C8L A;  1G15 A;  3ZX3 A;  3BP8 A;  3OS0 A;  2IC3 A;  5DM6 L;  5J2M A;  2X6N A;  4A59 A;  4YDU C;  4OX9 K;  3H1Q A;  3I8D A;  1CLQ A;  3PO4 A;  5JIC A;  4HCB A;  3RMD A;  3NH1 A;  1QHA A;  4IOX A;  4K42 A;  4BDY A;  1TAU A;  3GOI A;  3MN6 A;  1S6Q A;  3DM2 A;  4A5A A;  4CJT A;  3IRX A;  2ZGZ A;  1NNE A;  2OCE A;  3IMX A;  1EO1 A;  1NJI O;  1HQU A;  3SQ2 A;  4I9L A;  4YOX A;  3QFP A;  2HHH K;  1L5U A;  4K25 A;  1V4S A;  3JS6 A;  4W5O A;  3OYE A;  4B9U A;  2P9K B;  2KLA A;  4YOR A;  3MCA B;  4FJK A;  2HF4 A;  2KHO A;  5HRO A;  3NF6 A;  2QWR A;  3ATV A;  1EET A;  3CJA A;  1SKW A;  2ZM6 K;  1TK0 A;  1LCU A;  4GVE A;  3LDO A;  5K14 A;  3FZK A;  3TAB A;  1UAX A;  5KRT A;  2CGK A;  2X78 A;  3BGR A;  3O3H A;  4F3O A;  4OKE A;  1O13 A;  4M45 A;  2QA4 N;  3MN5 A;  4M3W A;  3OYM A;  3S9H A;  3WXM B;  5GIN A;  4DV4 K;  4BC4 A;  5AQH A;  1RGI A;  1NK5 A;  3KTQ A;  3S3N A;  3A5L C;  3FLC O;  3OYH A;  5EU7 A;  1C1C A;  1HPZ A;  1NJZ A;  4IBN A;  4L3Q A;  3SJH A;  3K57 A;  4H0Y B;  3V1O A;  4X64 K;  5GAH P;  1SQK A;  4Y1D A;  4JI6 K;  1JL1 A;  3KWI A;  3NGY A;  2GEM A;  5M1Q A;  4NLB A;  1NKE A;  4NB4 A;  4JI2 K;  3KJV A;  3F9M A;  2ZJQ L;  5KQD A;  2E5L K;  4FWK A;  4RG8 A;  3WEE B;  2BAN A;  4FL9 A;  3O6W A;  1QSL A;  4CJ3 A;  3E01 A;  3LAN A;  4OJR A;  1QQO A;  2WC9 A;  3RRG A;  1KVA A;  3I33 A;  4BRO A;  3NGZ A;  2E1Y A;  1HX1 A;  3L3U A;  1J53 A;  2YNH A;  3VF6 A;  3THW B;  1RT1 A;  2F9T A;  1HRH A;  4BQZ A;  3PX0 A;  5E84 A;  4DSI A;  1F21 A;  4JKD A;  4A57 A;  5JLH A;  4FLV A;  4FWO A;  1KVB A;  5C25 A;  1E4F T;  4WCE L;  3UKU A;  3FFK B;  3CC7 N;  1VRT A;  4DB3 A;  1SL2 A;  1ZBF A;  4E89 A;  3PIO L;  1EWQ A;  1CZB A;  3DLK A;  5AR0 A;  4B1Z A;  2P9L B;  3J7A P;  4DG1 A;  2F9W A;  4DTP A;  5EY4 A;  4FPA A;  4FLW A;  1EWR A;  4FO0 A;  2EWS A;  2W6K A;  3QER A;  1BIS A;  4OLB A;  5KGX A;  1T03 A;  4CJ5 A;  1TKD A;  5JLF A;  1M90 O;  3TR8 A;  1HKB A;  4LFC K;  4H0X B;  1NGD A;  3MX2 A;  4X65 K;  4QS7 A;  1HYS A;  2P9I B;  4JI3 K;  3OYD A;  3PUF A;  2HHS A;  1BWF O;  4E7L A;  2VWK A;  2F8S A;  4CI6 A;  2FSN A;  3AGK A;  3MEE A;  1D9F A;  2VWB A;  3AVI A;  4J8F A;  3LPU A;  1KFS A;  3CJ1 A;  4GMJ B;  4BGA A;  4DQI A;  4M3R A;  4I6M A;  4KPY A;  1JCF A;  1KAY A;  1X3M A;  1EP4 A;  3KLI A;  4DR3 K;  1JXE A;  3B6P A;  1HJO A;  4CD3 A;  4BR2 A;  3V81 A;  3EEQ A;  1LW2 A;  1RDA A;  2WUS A;  1K73 O;  2YHA A;  1DTT A;  4KO0 A;  4NO7 A;  4PL7 A;  3T3F A;  2Q0U A;  2NRR A;  3AVG A;  5M1K A;  4C1N I;  4H5V A;  3C6A A;  2A1S A;  1NK4 A;  4KH6 A;  4OPK A;  4FJH A;  4CER A;  3FZM A;  1X3N A;  1KCF A;  4CIE A;  3DXM A;  3CM6 A;  1U6Z A;  3U8X A;  4FWP A;  3R9P A;  2NRZ A;  1C0T A;  1W9H A;  4LH5 A;  3CF5 L;  3ENB A;  4DQQ A;  2UUA K;  3T7Z A;  4B1U B;  4FJ9 A;  3CPE A;  4PUO A;  3ITH A;  1BA0 A;  4NYF A;  3LDQ A;  4OPJ A;  2I5J A;  1VQ7 N;  3HK2 A;  3T1Y K;  3A5M C;  3OS1 A;  3KK2 A;  5HL7 L;  3NF9 A;  3MCP A;  3T1H K;  4E1N A;  4JI0 K;  2O8F A;  3CCU N;  5KRS A;  1HNI A;  4IEE A;  4AM7 A;  4CCH A;  4DV1 K;  3EO3 A;  1U48 A;  3F5T A;  2YHB A;  4JI7 K;  4CIG A;  2P9L A;  3BY5 A;  3OYN A;  1ASU A;  1QHT A;  3RVC A;  1WNS A;  1E3M A;  1GLD G;  5IWA K;  3LAL A;  4IFV A;  1IO2 A;  2E1Z A;  3OYL A;  4B3O A;  3HPO A;  1GLA G;  4GV3 A;  2JGU A;  3MEC A;  2O8C A;  1RT5 A;  2GBZ A;  4FZY A;  1RDW X;  2DFF A;  2JWL A;  4BC2 A;  4DKW A;  2CGJ A;  3THX A;  4GY2 B;  3ZX2 A;  3M6G A;  2D5R A;  5FRM A;  2P9I A;  3L2Q A;  3H3O B;  4FM1 A;  2A42 A;  1GOC A;  4U67 L;  4HTU A;  1FXX A;  3AA4 A;  2XO7 A;  4I7F A;  3K5O A;  3HL8 A;  3RSE B;  4LD0 A;  3ZSO A;  2O8D B;  2YCH A;  4CHO A;  3OY9 A;  2HST A;  2BGG A;  1N8R O;  3M1F A;  3J7Y P;  3CD6 N;  2QTD A;  3AV9 A;  3WUH A;  4PL8 A;  1HUX A;  2QWN A;  4RW4 A;  1ZBS A;  1VSL A;  2UXB K;  2OTL N;  3ZT1 A;  3BDP A;  3A2F A;  4OKJ A;  4DFM A;  1S6P A;  5CYM A;  4WQ4 C;  3K5L A;  2KTQ A;  2ZJR L;  3MXJ A;  4CHZ A;  3LPT A;  2IGI A;  2ATQ A;  4HHT A;  3KWG A;  4AHU A;  3RTV A;  2Y1I A;  3IKM A;  3SV3 A;  4IG3 A;  4YDU A;  5AQG A;  5CY4 A;  3E66 A;  1A5W A;  4BDP A;  2AJQ A;  5AQY A;  3QIP A;  2D0P A;  1J6Z A;  4H5N A;  4JK7 A;  4G1Q A;  1WBD A;  4B9L A;  1KD1 O;  4QS8 A;  2HMP A;  3CI5 A;  1BU6 O;  2P1J A;  3SQ4 A;  3SUQ A;  4XH4 A;  1L3T A;  1VAZ A;  4TSX A;  5HRS A;  5SWM A;  2ZJP L;  3O80 A;  2IVN A;  4CZF A;  2O8B B;  4B3S K;  4BC3 A;  3CFO A;  4DR4 K;  4EIA A;  1LWC A;  5DMR A;  4JKC A;  5FPM A;  4DV6 K;  3C0B A;  2HVI A;  1S1X A;  3CCV N;  5CR4 A;  2OZS A;  4J2B A;  4JK9 A;  1UA0 A;  4DV7 K;  3KD1 E;  4DTS A;  1K8A O;  1N33 K;  3RWU A;  3E1Y A;  1D9D A;  4O0I A;  4DQR A;  4ZTJ A;  3OYF A;  3NFA A;  4FLX A;  3ZX0 A;  4FJ8 A;  4ICL A;  3VQ7 A;  5HRP A;  3MWT A;  3TU5 A;  1RTJ A;  1RDU A;  3CME N;  1NGE A;  1J54 A;  1JKH A;  5GAE P;  5AZJ A;  2BE2 A;  3A0I X;  3D7E O;  1BQN A;  3DXK B;  2KW4 A;  4DUZ K;  3VF4 A;  3DI6 A;  1Y97 A;  1VQ6 N;  1Q81 O;  4N5S A;  4LC9 B;  1NOZ A;  1HJR A;  2D0A A;  4BR7 A;  2P5O A;  2Z1H A;  4M3Z A;  4KRF A;  5FPN A;  3V4I A;  1CZA N;  1IJJ A;  2G8K A;  4I9Q A;  3AAR A;  2P9N B;  3EKU A;  5F1X A;  3OW2 M;  3ZT3 A;  1BGX T;  3FZL A;  3CFP A;  4ZHR A;  1VSD A;  3R6M A;  4BRE A;  4RW6 A;  3KKS A;  2AP1 A;  1Z26 A;  3NBP A;  5BRH A;  1L3S A;  3DRS A;  1BI4 B;  1J5E K;  4C1N K;  4CF9 A;  1S22 A;  3UKR B;  1SKS A;  3SYZ A;  2VWJ A;  4NXN K;  4M41 A;  5HOO A;  3Q7B A;  4HVJ A;  5CHI A;  4AH9 A;  4BRP A;  4FM0 A;  1XMQ K;  3VGL A;  5TKW A;  4CW7 B;  5GIO A;  2H3G X;  2VGM A;  1TV6 A;  3OYJ A;  1GLB G;  4XIU A;  1TK8 A;  1OH5 A;  2B5J A;  3JSM A;  1Q9X A;  4CVN E;  3ZLJ A;  3T69 A;  2UXD K;  3V1Q A;  3M5R A;  1YJW N;  2OZM A;  2HBK A;  3CG7 A;  2JWK A;  3KLE A;  4CEA A;  1JXB A;  1TKT A;  4EAH D;  1S1V A;  4B8A B;  1BOT O;  4O5B A;  1KRP A;  1KLN A;  3K2P A;  1K8K B;  1NMD A;  1TYQ A;  3HP6 A;  4DQ8 A;  4PA1 A;  5SZT A;  4DWI A;  4K43 A;  1HKC A;  4LF4 K;  4MO4 A;  4X62 K;  4ILG B;  5B8H A;  1XI1 A;  4FLU A;  3EY1 A;  5EVZ A;  1S1U A;  3ZT0 A;  3J8A A;  4AHV A;  1Q9Y A;  4CGG A;  3QEI A;  1DTQ A;  2UU9 K;  1BL3 A;  2OPQ A;  1NKC A;  2PY5 A;  3SBT A;  1C1B A;  4H4M A;  3P31 A;  5JS2 A;  1ZBL A;  1BUP A;  3M3Z A;  4CBX A;  4AF1 A;  3D2E A;  2IVO A;  2Z1G A;  1BHL A;  2FXU A;  4BRN A;  4BRH A;  3MK6 A;  3WNG A;  3TAM A;  3P1G A;  2PYJ A;  3NDK A;  4KB1 A;  2LSN A;  5AQI A;  4RTF D;  4K8X A;  3V1R A;  5JMV A;  3O9Q A;  1ZBU A;  3CCQ N;  4K0K K;  4ELT A;  3CC2 N;  3ENH A;  2XHB A;  1Y64 A;  4X66 K;  2PBD A;  1VQL N;  1RFQ A;  4FWR A;  3QET A;  5AZI A;  3VQ6 A;  3QIC A;  1ASW A;  3AAQ A;  1MWM A;  3LM9 A;  1U2V A;  2P9N A;  1HMV A;  5D3G A;  4CBU A;  3DAW A;  4E1J A;  4YNQ A;  4BRL A;  3CJ9 A;  1I94 K;  3AVK A;  3KLH A;  2YHW A;  3SAH A;  1KXP A;  4PQU A;  3WNF A;  4LF7 K;  1VQ9 N;  3HT3 A;  4H03 B;  5MLC Q;  3PSI A;  4FJI A;  4FSV A;  1HNX K;  5JS1 A;  4CJP A;  4DUY K;  5I3U A;  4CEQ A;  3DWL A;  2YJF A;  1TKX A;  4FCY A;  2HHV A;  3C94 A;  3KD5 E;  1IV0 A;  4MDA A;  2RHK A;  4QS9 A;  2HMI A;  4OLA A;  4G9Z A;  3TAN A;  4O55 A;  2RKI A;  5H1S Q;  1S9E A;  2Q0R A;  3LP2 A;  4E7K A;  2VG5 A;  4KTZ A;  1TKZ A;  4B9N A;  5C42 A;  3I0S A;  3LDP A;  3H6E A;  2G8W A;  3TSU A;  3HI0 A;  4DSF A;  4DR6 K;  1QTM A;  1X1P A;  3JXU A;  1RBS A;  4E7I A;  2NRH A;  2EHG A;  3ALY A;  1NKB A;  4HWI A;  3VQD A;  4JRP A;  2G8F A;  3P38 A;  1DT9 A;  5FPE A;  3ZSX A;  3ZSQ A;  3K0S A;  1DLO A;  3VTH A;  3M8Q A;  3THV A;  4A2A A;  4FOI A;  5F2R A;  1ITG A;  1VSI A;  1X9W A;  2HBM A;  4KB0 A;  2KFN A;  5BRF A;  1VSE A;  2QEX N;  1QQC A;  3L2W A;  1ATS A;  1SV5 A;  4DLE A;  4C8M A;  1HR0 K;  3O4Q A;  1ASV A;  2IS3 A;  5HBM A;  4FXD A;  2JLE A;  1YHQ N;  3M8P A;  4MDB A;  1YT3 A;  1MU2 A;  4Z4G A;  3VQ4 A;  2ZF5 O;  2QWP A;  5KPR A;  1NJY A;  3CMA N;  4DCH A;  4B9T A;  2UYT A;  3QNN A;  4FM2 A;  3AVL A;  1U45 A;  4FWS A;  3VEV A;  4CJL A;  3V9W A;  1IKX A;  5JVH L;  4FZX C;  4BRI A;  3HOS A;  4F2R A;  3AVN A;  3O3G A;  1WAJ A;  2Q1N A;  4WQ4 A;  4DV3 K;  1YVN A;  1N5Y A;  4FK4 A;  2ETJ A;  3AAP A;  1TL3 A;  3ZT4 A;  3K58 A;  3NF8 A;  1UWB A;  3ZT2 A;  4FPB A;  3V6D A;  4CF1 A;  3HM8 A;  4XH5 A;  3LWM A;  1XWL A;  1BCO A;  4BRM A;  3QO9 A;  5C24 A;  4WF9 L;  3SNN A;  2E8A A;  4H5R A;  3ID8 A;  1NU0 A;  3AA2 A;  2AA4 A;  4R5P A;  1OH8 A;  1R59 O;  2FBY A;  4Y1C A;  4EZ6 A;  2NNW A;  4M7X A;  3VQC A;  4PKI A;  3RMB A;  1NOY A;  2DPN A;  3ASM A;  3SZ2 A;  2XY8 A;  3O9R A;  1K6Y A;  1ZBI A;  3IG1 A;  5CE3 A;  4M3Y A;  4AIL C;  3RMA A;  1XC3 A;  4BWJ A;  1J5O A;  3O4N A;  3TWH A;  4BR0 A;  4XEI A;  3AVC A;  3W3D A;  3TTD A;  2P9P B;  2D0O A;  2Q2R A;  1N32 K;  1IBM K;  3BF3 A;  1TUU A;  5FPD A;  3ISN C;  1V4T A;  1D4X A;  4AHC A;  5M1F A;  4CZI A;  3SCX A;  3GL1 A;  3R8E A;  3CCL N;  3ULE B;  3MED A;  1EX4 A;  1C1A A;  4CK1 A;  2ZD1 A;  4GV6 A;  2ZWH A;  3TAG A;  2P9K A;  3I8B A;  3RMC A;  4JK8 A;  3U6F A;  1W2B M;  1XNR K;  2HW3 A;  2HBL A;  4B9Q A;  1X9M A;  3K5M A;  4ID1 A;  4M63 C;  4CK2 A;  4O0J A;  3VEY A;  4B3R K;  4LF6 K;  3O4W A;  2QI2 A;  4IDK A;  4BRC A;  5BPN A;  3J80 O;  4FJJ A;  1R0A A;  3VA3 A;  4KH5 A;  1CXU A;  1OH7 A;  4CJE A;  5AFU H;  2NRT A;  3NVK A;  3GBT A;  4A61 A;  4FOE A;  2E2Q A;  3RRH A;  1NK6 A;  3JAM O;  5KI6 A;  4JRQ A;  3MMV A;  3VGM A;  5AQQ A;  3G71 N;  1XHZ A;  5FDL A;  1P8Z A;  3QLH A;  4AHT A;  2NRV A;  5J2Q A;  3MXM A;  3HTV A;  4YOW A;  1EQY A;  4CEF A;  3BEX A;  2HOE A;  4UQG A;  3DRP A;  3OJS A;  4OO1 J;  2FF6 A;  4DSL A;  1RT2 A;  4IEI A;  4Z94 A;  3VET A;  1KQS M;  2D1K A;  2ZQB A;  4LY7 A;  1Q86 O;  1QS4 A;  1XNQ K;  3VQ8 A;  3WEE A;  3WXJ A;  2VQE K;  1NG9 A;  4K8Z A;  3U4L A;  3NAE A;  4ELV A;  2BH1 A;  3HST B;  3AO4 A;  3AA5 X;  4FWQ A;  3ULD A;  1TUY A;  2BDP A;  1RBU A;  3THW A;  3QEP A;  2QKB A;  5AQL A;  3F9K A;  1NGH A;  4IO8 A;  4M3X A;  1GOB A;  3SAF A;  4YY3 K;  3VEW A;  4FJG A;  3O8M A;  5F0X A;  4CZG A;  1NK9 A;  1KFD A;  3EN9 A;  2A1R A;  1NLV A;  4WFA L;  2DTU A;  1OVY A;  3A8Y A;  5CYQ A;  4CEO A;  3P39 A;  3MDQ A;  3SPY A;  1LAW A;  1RT3 A;  1NJX A;  1VQK N;  3CXC M;  4C8O A;  5M1O A;  3C7N B;  4IZ9 A;  5KGW A;  1VQP N;  3NH0 A;  3TTF A;  5LMN K;  4BG9 A;  1CXQ A;  4CJR A;  2YKN A;  5AQZ A;  3QBW A;  4F9O A;  1ZXO A;  1JLB A;  3U9Z A;  1C6V A;  2D0B A;  3VPZ A;  4C23 A;  4CZE A;  1RIL A;  3CIP A;  3O9T A;  1T6D A;  1YI2 N;  4CD1 A;  1MDU B;  1S1T A;  3CHW A;  1YIT N;  1KTQ A;  2A40 A;  1ATN A;  5EOY A;  3P83 D;  3UE5 A;  3SUN A;  3QIO A;  4RWT A;  2UUB K;  2HHX A;  3KHY A;  1D5A A;  4FWM A;  4HUG A;  4B1W B;  2QXL A;  3CJ7 A;  3L4Q A;  5C10 A;  4LH4 A;  5C12 A;  3WQT A;  3H3N O;  4CFA A;  3EKS A;  1DGK N;  3KIO A;  1JL2 A;  1NGA A;  1BA1 A;  3LL3 A;  3I0R A;  2HHT A;  3GDQ A;  4BWM A;  1NM1 A;  3DLE A;  4CES A;  1WLJ A;  1NMN A;  4CK3 A;  4H0P A;  1NBW A;  3CPW M;  3T1A A;  4OKK A;  4NCG A;  2F96 A;  3CJC A;  4NCB A;  3OBW A;  3KK7 A;  1Z05 A;  1UOC A;  5AQU A;  1FK9 A;  2HHQ A;  3I55 N;  1S9G A;  4MLE A;  2O4I A;  3AVB A;  2KKZ A;  4RCH A;  3DLR A;  1C0G A;  4U7B A;  5AQT A;  1NWK A;  3WT0 A;  1SZ2 A;  4CJ4 A;  3RR8 A;  4FLT A;  1VQ5 N;  4DR7 K;  5DK5 A;  3LP0 A;  3S3O A;  2FSJ A;  3QEV A;  4IWV A;  4IOC L;  1LWF A;  3F2K A;  4CJW A;  3MAQ A;  4JKB A;  3PO5 A;  3MXI A;  1XHX A;  2IAJ A;  3V9Z A;  5I42 A;  5BR8 K;  4CIF A;  2E2O A;  3HBT A;  4N56 A;  5GAD P;  3OYK A;  3H08 A;  1GOA A;  2Q3S A;  4XH1 A;  3VQQ A;  3OYC A;  3DLH A;  4Z4F A;  3KKR A;  4Z4H A;  1JLE A;  2QXF A;  2ASO A;  3CM5 A;  1SUQ A;  3EE9 A;  4K41 A;  3CCR N;  1I39 A;  1KAX A;  2NRW A;  4OVL A;  4E7J A;  3L3V A;  4HUF A;  4B1X B;  2WOM A;  3B8A X;  3SQ0 A;  3CCS N;  3OYI A;  3QDK A;  2OPP A;  3TSQ A;  2KFZ A;  2YJE A;  1XC9 A;  1YJ9 N;  4BRF A;  3A5N C;  4CHN A;  3LP3 A;  4LF8 K;  2HHU A;  1X9J A;  1WBB A;  4PY5 A;  2RPI A;  4CJS A;  1YJN N;  4CJQ A;  3SMS A;  3NCI A;  3PX4 A;  4C8K A;  4QOZ B;  4NLC A;  4BG8 A;  4Z4C A;  2O4G A;  3FFI A;  2YHY A;  3O5B A;  1HPM A;  1Q82 O;  3IUC A;  3AO5 A;  3IDH A;  3LDN A;  4FJX A;  1VSF A;  3DJC A;  1Q7Y O;  1SL0 A;  4CGI A;  4JLH A;  1H1V A;  4R79 A;  4CZL A;  2DFE A;  3RSE A;  3SV4 A;  1TL1 A;  2O8D A;  3VGK A;  4BC5 A;  2G8I A;  1M1K O;  2QM1 A;  3VN5 A;  4EZ9 A;  3QNO A;  2A41 A;  2VGN A;  3WNH A;  5KPT A;  4CEZ A;  2ZE2 A;  4CF8 A;  2HNZ A;  5M1P A;  4F3T A;  2FC0 A;  3ZEU B;  3OHR A;  1LW0 A;  5BPM A;  2HNY A;  4B8C A;  4JHD B; 
#chains in the Genus database with same CATH homology
 4CF0 A;  1TKZ A;  3NF7 A;  3PUF A;  5C42 A;  3OYD A;  3I0S A;  4B9N A;  2HHS A;  4H8K A;  3IAY A;  4WE1 A;  2G8W A;  3HJF A;  1S1W A;  3VQE A;  4KV8 A;  4DSF A;  3HVT A;  3C6T A;  3NHG A;  2YNG A;  4E7L A;  1QTM A;  4CFB A;  1X1P A;  1RBS A;  4L8R B;  4E7I A;  2VWK A;  1YTA A;  1RTI A;  2F8S A;  3L2U A;  1YVU A;  2EHG A;  3ALY A;  3AVI A;  3MEE A;  1NKB A;  3LPU A;  1D9F A;  1KFS A;  4CHY A;  1IH7 A;  5CZ1 A;  4JRP A;  4GMJ B;  3VQD A;  2G8F A;  4CHQ A;  4DQI A;  4M3R A;  4B9S A;  3ZSX A;  4B08 A;  3ZSQ A;  3HXM A;  4ELU A;  4KPY A;  3AO3 A;  1DLO A;  1EP4 A;  3KLI A;  1EKE A;  3AVA A;  1IG9 A;  3QES A;  3M8Q A;  1HYZ A;  1JLG A;  1JXE A;  3B6P A;  4NCA A;  3THV A;  2VG6 A;  4E7H A;  4M42 A;  4J2A A;  2RF2 A;  4FVM A;  4KFB A;  4HUE A;  4Z4E A;  3V81 A;  4W5N A;  1ITG A;  1LW2 A;  1VSI A;  4CJU A;  1X9W A;  1RDA A;  4KB0 A;  2KFN A;  4GVM A;  4H4O A;  1VSE A;  3VQA A;  1QQC A;  3L2W A;  2YHA A;  1SV5 A;  4DS5 A;  1KVC A;  4CJV A;  4C8M A;  4DLE A;  3TAE A;  1DTT A;  3O4Q A;  4KO0 A;  3VA0 A;  1ASV A;  4KHU A;  2IS3 A;  5HBM A;  3T3F A;  4FXD A;  2JLE A;  4CJK A;  3M8P A;  4I2P A;  3AVG A;  3TAP A;  1YT3 A;  1RTD A;  1VSJ A;  4MFB A;  1MU2 A;  4IFY A;  4B9V A;  4I2Q A;  4Z4G A;  4FJN A;  1SL1 A;  1VSH A;  3VQ4 A;  2A1S A;  1NK4 A;  3G10 A;  4DTM A;  4KAZ A;  4OPK A;  1HNV A;  4NYN A;  3OYG A;  1NJY A;  4FJH A;  4CER A;  4E0D A;  4O44 A;  3SQ1 A;  1KCF A;  3AO1 A;  4CIE A;  4B9T A;  4FZZ A;  3QNN A;  1JLC A;  3CM6 A;  3AVL A;  4FM2 A;  2XRI A;  3M8S A;  3TAR A;  1U45 A;  2W42 A;  4CJL A;  3V9W A;  1IKX A;  3AVF A;  1C0T A;  4FZX C;  1W9H A;  4N47 A;  4AHR A;  3ZSW A;  4LH5 A;  4W5Q A;  4DQQ A;  4YFU A;  4F2R A;  3AVN A;  4LSN A;  3O3G A;  3SI6 A;  1U49 A;  4FJ9 A;  4HCC A;  1WAJ A;  2Y1J A;  1BQM A;  1U04 A;  4CJF A;  3KLF A;  3KK1 A;  3K5N A;  5HLF A;  4PUO A;  1RBR A;  1N5Y A;  3ITH A;  4BAC A;  4NYF A;  4DSE A;  4F4K A;  4FK4 A;  4OPJ A;  2I5J A;  4BE0 A;  3OS2 A;  1HQE A;  2ETJ A;  1C0U A;  3HK2 A;  3L2V A;  1TL3 A;  1CZ9 A;  3ZT4 A;  3K58 A;  3NF8 A;  2B6A A;  1NK7 A;  1UWB A;  3ZT2 A;  3OS1 A;  3KK2 A;  2YNF A;  1RTH A;  3NF9 A;  3V6D A;  4E1N A;  4CF1 A;  2F8T A;  3LWM A;  1RDC A;  1XWL A;  3OVN A;  3OJU A;  1BCO A;  5HRR A;  5KRS A;  1HNI A;  3QO9 A;  4CCH A;  5C24 A;  3T19 A;  2D0C A;  1U48 A;  3SNN A;  1U47 A;  4CEE A;  1RT7 A;  2E4L A;  3ZCM A;  2YHB A;  3RR7 A;  4CIG A;  5KTQ A;  3AA2 A;  3OYN A;  1ASU A;  3DOK A;  3IS9 A;  3P5J A;  4DU1 A;  4R5P A;  2X74 A;  1QHT A;  4KHS A;  1WNS A;  2DFH A;  1J9A A;  2ITG A;  2FBX A;  1RDD A;  2FBY A;  1B9D A;  4Y1C A;  4EZ6 A;  3QEW A;  3V9U A;  1HYV A;  3LAL A;  4IFV A;  3VQC A;  4ID5 A;  1IO2 A;  1BI4 A;  3L2R A;  1JLF A;  1TVR A;  3RMB A;  3OYL A;  1NOY A;  2KQ2 A;  3HPO A;  4B3O A;  2JGU A;  3MEC A;  3ASM A;  3SZ2 A;  1RT5 A;  2GBZ A;  4FZY A;  2DFF A;  2XY8 A;  1ZBI A;  1K6Y A;  3C6U A;  3IG1 A;  1VK0 A;  3D45 A;  4M3Y A;  1QE1 A;  3EZ5 A;  4AIL C;  3RMA A;  1RCH A;  1N6Q A;  3AVM A;  2PYL A;  4QAG A;  4RW7 A;  2IOC A;  4BWJ A;  3V9S A;  1J5O A;  4FJL A;  2D5R A;  5FRM A;  3O4N A;  3TWH A;  3L2Q A;  4FM1 A;  3CQ8 A;  4DTR A;  3AVC A;  3CYM A;  1GOC A;  4F8R A;  2R7Y A;  4HTU A;  1FXX A;  3HYF A;  3ISN C;  4FK2 A;  3DRR A;  3AA4 A;  2XO7 A;  4AHC A;  5FRO A;  3K59 A;  4I7F A;  4LSL A;  2XY7 A;  3K5O A;  4FLZ A;  3SCX A;  4J2D A;  3SUP A;  4Z4I A;  3HL8 A;  3AVH A;  4AHS A;  4LD0 A;  3MED A;  1EX4 A;  1C1A A;  3AA3 A;  3ZSO A;  1RT4 A;  3MEG A;  2ZD1 A;  4CK1 A;  4EP4 A;  4CHO A;  3TAG A;  4KI4 A;  3RMC A;  3OY9 A;  4DF4 A;  2P51 A;  3U6F A;  2GV9 A;  2HW3 A;  4JS5 A;  2BGG A;  1IKW A;  4KRE A;  1X9M A;  3K5M A;  4ID1 A;  2QK9 A;  4PWD A;  4CK2 A;  4O0J A;  3AV9 A;  4KKO A;  4J2E A;  4FYD A;  4IDK A;  4FJJ A;  1TK5 A;  2IDO A;  4RW4 A;  1Q8I A;  1VSL A;  4DLG A;  3VA3 A;  1R0A A;  4W5R A;  1CXU A;  1TGO A;  3OYB A;  4CJE A;  3ZT1 A;  3BDP A;  4KTW A;  3JYT A;  3A2F A;  4OKJ A;  3RRH A;  4DFM A;  3AO2 A;  1NK6 A;  1S6P A;  2Z1J A;  5CYM A;  1WSG A;  3VQ9 A;  2E6L A;  3HVR A;  1T05 A;  3CFR A;  3SJJ A;  5KI6 A;  3K5L A;  4JRQ A;  2P5G A;  3HPH A;  4KTQ A;  2KTQ A;  3MXJ A;  3S3M A;  2G8V A;  1XHZ A;  4CHZ A;  5FDL A;  3LPT A;  2IGI A;  3ZSY A;  3QLH A;  4AHT A;  5J2Q A;  2ATQ A;  2E6M A;  3QIN A;  4HHT A;  5J2P A;  3MXM A;  1NJW A;  4AHU A;  3RTV A;  2Y1I A;  5CZ2 A;  3PY8 A;  4CEF A;  3F73 A;  4CGD A;  3SV3 A;  3SPZ A;  3DOL A;  4IG3 A;  3VQP A;  4UQG A;  1Z25 A;  1W0H A;  5CY4 A;  3DRP A;  3OJS A;  4BE1 A;  1QSS A;  1O1W A;  1A5W A;  4BDP A;  3LZI A;  2OPS A;  1RT2 A;  1NK8 A;  2OYQ A;  1TAQ A;  4DSL A;  4QCL A;  2AJQ A;  2HVH A;  2ZQB A;  3QIP A;  4Z0U A;  3LZJ A;  4LY7 A;  4DTJ A;  1RBT A;  1WSF A;  3HM9 A;  2GUI A;  4G1Q A;  3ZSR A;  1QS4 A;  1VSK A;  3VQ8 A;  4B9L A;  3TI0 A;  3KLG A;  2KZZ A;  1ZYQ A;  3U3G A;  2PZS A;  4K8Z A;  4CF2 A;  3LP1 A;  3NAE A;  4ELV A;  2P1J A;  3C95 A;  3HST B;  3SQ4 A;  3SUQ A;  1L3T A;  3AO4 A;  3AA5 X;  4TSX A;  2B4J A;  5HRS A;  4FJM A;  1LWE A;  5SWM A;  3ULD A;  2BDP A;  4C8N A;  1RBU A;  3QEP A;  2QKB A;  1WSJ A;  3F9K A;  4MQ3 A;  4M3X A;  2XY6 A;  3CFO A;  1GOB A;  1LWC A;  5DMR A;  4CGJ A;  3V9X A;  4FJG A;  1QSY A;  1S1X A;  2OZS A;  1NK9 A;  1KFD A;  3NH2 A;  2A1R A;  4J2B A;  1YTU A;  2HVI A;  3DYA A;  3VQ5 A;  1B92 A;  1VSM A;  2OPR A;  1UA0 A;  3KD1 E;  2DY4 A;  2DTU A;  3ZSV A;  5E41 A;  4DTS A;  1ZBH A;  4CFC A;  5CYQ A;  1A5X A;  4CEO A;  3RWU A;  3SPY A;  4DFK A;  1LAW A;  1RT3 A;  4CED A;  4O0I A;  4DQR A;  4DTO A;  1NJX A;  1D9D A;  4B9M A;  4ZTJ A;  3OYF A;  3U3Y A;  4C8O A;  5KGW A;  4RW9 A;  2FBV A;  3NH0 A;  4F2S A;  3NFA A;  4FLX A;  4FJ8 A;  4ICL A;  1BIU A;  1S5J A;  4DF8 A;  1I3A A;  3VQ7 A;  1LAV A;  4CHP A;  5HRP A;  1CXQ A;  4CJR A;  2Z1I A;  2YKN A;  4E1M A;  1RTJ A;  4FJ5 A;  3VQB A;  1J54 A;  1JKH A;  4O4G A;  1BCM A;  1JLB A;  1C6V A;  2BE2 A;  2D0B A;  3PV8 A;  1BQN A;  1RIL A;  2KW4 A;  4ZTF A;  1IKV A;  3DI6 A;  1Y97 A;  3TAF A;  4N5S A;  3DLB A;  4FJ7 A;  1U4B A;  1B9F A;  1NOZ A;  1S1T A;  1HJR A;  1RDB A;  2D0A A;  4DTX A;  3QEX A;  1KTQ A;  4IG0 A;  2P5O A;  2Z1H A;  3AVJ A;  4EP5 A;  4M3Z A;  3L8B A;  4KRF A;  1LV5 A;  1JLA A;  3P83 D;  3V4I A;  3SUN A;  2G8K A;  4I9Q A;  4Q5V A;  4DS4 A;  3HPG A;  3QIO A;  1KLM A;  3ZT3 A;  4FLY A;  1D5A A;  1BGX T;  2HHX A;  2NUB A;  3CFP A;  4ZHR A;  4KHQ A;  1VSD A;  4HUG A;  3HP9 A;  3O3F A;  3KK3 A;  4FK0 A;  4RW6 A;  1WAF A;  3KKS A;  5T7B A;  4DMN A;  4LH4 A;  5FRN A;  4C8L A;  1Z26 A;  3NBP A;  5HP1 A;  4CFA A;  1L3S A;  3DRS A;  1BI4 B;  1G15 A;  4DU3 A;  3OS0 A;  3KIO A;  2IC3 A;  5J2M A;  1JL2 A;  2XY5 A;  3UIQ A;  4IKF A;  2X6N A;  4CF9 A;  4DSK A;  4DQS A;  3I0R A;  1SKS A;  3SYZ A;  2VWJ A;  1RNH A;  2HHT A;  4M41 A;  1WN7 A;  3I8D A;  1JLQ A;  4BWM A;  1CLQ A;  4HVJ A;  3PO4 A;  4HCB A;  3RMD A;  4KI6 A;  3DLE A;  4AH9 A;  4CES A;  3NH1 A;  4FM0 A;  1WLJ A;  5J1E A;  3LDS A;  1TV6 A;  3OYJ A;  4CK3 A;  4XIU A;  1TK8 A;  4BDY A;  1TAU A;  2B5J A;  3JSM A;  4DFJ A;  1S6Q A;  3DM2 A;  4OKK A;  4NCG A;  3T1A A;  4CJT A;  2F96 A;  3IRX A;  1Q9X A;  4NCB A;  4DTN A;  1IKY A;  2HND A;  1HQU A;  3V1Q A;  3SQ2 A;  2OZM A;  4DU4 A;  1UOC A;  1FKP A;  1FK9 A;  3NE6 A;  4I9L A;  3CG7 A;  1S9G A;  2HHQ A;  3KLE A;  4CEA A;  1L5U A;  2O4I A;  3AVB A;  1JXB A;  1TKT A;  4BDZ A;  4RW8 A;  4W5O A;  3OYE A;  1S1V A;  1KSP A;  3DLR A;  4FW1 A;  1EXQ A;  4E3S A;  4B9U A;  4B8A B;  2HHW A;  4O5B A;  4GW6 A;  1KRP A;  4CJ4 A;  4BE2 A;  4M3U A;  1KLN A;  3ZSZ A;  3RR8 A;  5HRO A;  4FJK A;  3K2P A;  3NF6 A;  1EET A;  3LWL A;  4FLT A;  3HP6 A;  4DQP A;  1SKW A;  5DK5 A;  1TK0 A;  4PA1 A;  3LP0 A;  5SZT A;  3S3O A;  4DWI A;  5K14 A;  3TAB A;  1UAX A;  5KRT A;  3QEV A;  1VRU A;  1T7P A;  3O3H A;  2X78 A;  3BGR A;  1SKR A;  4F3O A;  1XI1 A;  4OKE A;  1LWF A;  4FLU A;  4M3T A;  4M45 A;  3EY1 A;  4KHY A;  1UA1 A;  3SUO A;  4CJW A;  3MAQ A;  3PO5 A;  3DLG A;  3MXI A;  1XHX A;  3D0P A;  4M3W A;  3LAM A;  1S1U A;  3OYM A;  2IAJ A;  3S9H A;  1L3U A;  3ZT0 A;  3V9Z A;  4KHN A;  5I42 A;  2PYJ A;  4AHV A;  1Q9Y A;  2X6S A;  4CGG A;  4CIF A;  1RT6 A;  1DTQ A;  3QEI A;  4N56 A;  1BL3 A;  2OA8 A;  1NK5 A;  2OPQ A;  3WNE A;  1NKC A;  3KTQ A;  2PY5 A;  5HRN A;  3OYK A;  3H08 A;  1GOA A;  2Q3S A;  4CEC A;  1C1B A;  3VQQ A;  4H4M A;  3OYC A;  3S3N A;  3OYH A;  2RN2 A;  5JS2 A;  5EU7 A;  1C1C A;  1FKO A;  1HPZ A;  3KKR A;  1ZBL A;  3DLH A;  1NJZ A;  4Z4F A;  4Z4H A;  1JLE A;  1BIZ A;  4IBN A;  2QXF A;  2WON A;  3K57 A;  1T8E A;  2Z1G A;  1REV A;  3CM5 A;  1BHL A;  1X9S A;  3V1O A;  4KHW A;  1SUQ A;  4Y1D A;  1JL1 A;  3WNG A;  4E19 A;  4JS4 A;  3NGY A;  3TAM A;  3P1G A;  1I39 A;  1L3V A;  1A5V A;  3NDK A;  4DFP A;  4OVL A;  3M8R A;  4E7J A;  1NKE A;  3L3V A;  4HUF A;  4KB1 A;  3KJV A;  4DTU A;  2WOM A;  4OGC A;  3SQ0 A;  4DSJ A;  2LSN A;  4RG8 A;  2OPP A;  3OYI A;  2KFZ A;  2BAN A;  4K8X A;  1XC9 A;  4CJ3 A;  1QSL A;  3V1R A;  3E01 A;  3LAN A;  4W5T A;  4OJR A;  4CHN A;  3LP3 A;  2HHU A;  1ZBU A;  3RRG A;  1KVA A;  4CE9 A;  3NGZ A;  2YV0 X;  3OYA A;  4PY5 A;  3L3U A;  1J53 A;  4ELT A;  2YNH A;  4FW2 A;  2RPI A;  1RT1 A;  4CGF A;  2XHB A;  2EX3 A;  4CJS A;  1HRH A;  3PX0 A;  4CJQ A;  3NCI A;  3PX4 A;  4QOZ B;  4C8K A;  1WSH A;  2G8U A;  3QET A;  2QKK A;  3VQ6 A;  1ASW A;  4DSI A;  2FBT A;  4Z4C A;  1F21 A;  2G8H A;  2O4G A;  3FFI A;  4CGH A;  1HMV A;  4FLV A;  5D3G A;  3TAQ A;  1KVB A;  4YNQ A;  5C25 A;  3AO5 A;  3AVK A;  1VRT A;  2HB5 A;  1SL2 A;  4FJX A;  1VSF A;  1ZBF A;  3LAK A;  3KLH A;  1WSI A;  4E89 A;  1SL0 A;  1CZB A;  4CGI A;  4JLH A;  3DLK A;  2YKM A;  4PQU A;  3WNF A;  2DFE A;  3HT3 A;  4DG1 A;  1D8Y A;  3SV4 A;  1TL1 A;  4DTP A;  3NGI A;  4FJI A;  4CEB A;  4N76 A;  2G8I A;  5JS1 A;  3G0Z A;  4FLW A;  3PX6 A;  4CJP A;  2YNI A;  3VN5 A;  5I3U A;  4EZ9 A;  4CEQ A;  1NK0 A;  4CFD A;  1C0M A;  4OGE A;  4FCY A;  1TKX A;  1BIS A;  3QER A;  3HO1 A;  4Q0B A;  3QNO A;  2HHV A;  4OLB A;  2KZM A;  5KGX A;  3C94 A;  3WNH A;  1T03 A;  4CJ5 A;  3KD5 E;  1TKD A;  5J2N A;  4CEZ A;  2ZE2 A;  3TR8 A;  4CF8 A;  3B6O A;  2HNZ A;  2HMI A;  4F3T A;  2FC0 A;  3DMJ A;  4OLA A;  1RBV A;  2VG7 A;  1WSE A;  4N41 A;  3TAN A;  4O55 A;  2RKI A;  1LW0 A;  1S9E A;  3LP2 A;  3EYZ A;  2HNY A;  4B8C A;  4E7K A;  1HYS A;  2VG5 A;  4KTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...