3VQ4A

Fragments bound to hiv-1 integrase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
152
structure length
144
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 48
structure length 144
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vq4A00
1RT4A 3OYFA 4MQ3A 3DLKA 1Q8IA 1RDCA 2G8FA 3LP2A 1I3AA 2QXFA 1RT2A 1KVBA 2OPSA 1BI4B 1L3UA 1LAWA 1S9EA 2P5GA 4J2DA 3I8DA 3TAEA 1U48A 4DSKA 1X9WA 4GW6A 4CFDA 3NF7A 4LY7A 1SKWA 3AVIA 3C95A 4PA1A 3HO1A 3TAPA 5HRPA 4KHNA 5KRTA 2Z1GA 1UAXA 5C25A 2IOCA 1RBRA 2F96A 2YHAA 3MECA 1BCMA 1C1CA 4JRQA 4KHWA 1HQUA 4CEBA 1XHZA 1J9AA 3KJVA 4H4MA 4DTMA 4CF2A 5HLFA 4OKEA 1FK9A 4F4KA 3DRRA 3F9KA 2R7YA 2HHSA 3VN5A 3HM9A 4DQQA 1LW2A 4CGHA 3DRSA 4NCGA 3ZSQA 4FJGA 3JYTA 2G8HA 3T3FA 4EZ9A 1CLQA 1VSFA 2XY6A 3ZT4A 2IGIA 1LW0A 1LAVA 2KTQA 3L2WA 4OLBA 4DSIA 4CEDA 1TKDA 3RR7A 2EX3A 3OYBA 5CZ2A 3HT3A 4O5BA 3SZ2A 3QEWA 1RT6A 3K59A 1RDAA 3V1RA 3NF8A 5SWMA 3KLEA 4N5SA 1ZYQA 3OYHA 5FDLA 3QIOA 3M8PA 2G8VA 1D5AA 1TKXA 3K57A 4FLZA 3VA3A 2D0BA 1TKTA 3OS0A 1KLMA 1U45A 1Y97A 2KZMA 3KTQA 1F21A 4IFYA 3T19A 3O3GA 3QEXA 1NJWA 3G10A 4CJFA 3HPOA 4I2QA 4BDYA 4B9MA 1NOYA 1JLGA 3AVLA 3HJFA 3THVA 4FJMA 3AA3A 1SL0A 1IH7A 4F8RA 2B5JA 3AVBA 4HHTA 2DFEA 3NGIA 3EY1A 4E89A 4OPJA 3L8BA 3KK1A 4DS4A 2KFZA 1EETA 3QEVA 1S1XA 4CEEA 2FC0A 4CF8A 4CFBA 4Z4HA 3TANA 4CJ3A 4F2RA 4ID1A 3VQ7A 3S3OA 4H8KA 2ZE2A 2XY7A 4B9UA 4K8XA 2YNIA 2JLEA 4E7LA 3D0PA 1BIZA 5J2QA 3CM5A 4M45A 1EP4A 3S3NA 1L5UA 2XHBA 1WSJA 1KTQA 2PYJA 3AVFA 4CEZA 1FKPA 1LWCA 3DYAA 4DFJA 1CXUA 4ID5A 4CHZA 3KK3A 2G8WA 1JKHA 3ZT1A 3NH1A 2HB5A 4FK0A 3OYNA 5JS1A 4FK2A 1S6QA 4DWIA 3L3VA 1HRHA 2ZD1A 4DTPA 4CJ4A 1HNVA 2RKIA 1RNHA 3LAMA 3KLFA 4KB1A 1JXBA 1BGXT 4NYFA 4AHCA 2E6LA 4B08A 4YNQA 3LPTA 4CJSA 1U04A 1XHXA 3HXMA 3QNOA 3MXIA 2BGGA 4TSXA 4ELTA 1IKYA 1SV5A 4AHVA 5KRSA 1Z25A 3LDSA 1SL1A 1T8EA 4O44A 1NK0A 4F3OA 1B9DA 1RT1A 2HW3A 4FK4A 1BQNA 1KLNA 3O3FA 4FJKA 2ATQA 3K5OA 1D8YA 4Y1CA 4M3RA 4CEQA 4E19A 3C94A 1NK5A 1X9MA 4LSLA 4DG1A 1NK6A 2BDPA 3RRHA 1NJZA 4CJQA 3LZIA 2DFFA 4IG3A 2RN2A 3DI6A 4FM0A 4OKKA 4J2BA 4KREA 2HNZA 3AVHA 4M3ZA 4CJTA 4CK2A 3ZT0A 1BCOA 3B6PA 3QETA 2OPRA 1UOCA 4G1QA 4W5TA 1TK5A 4EZ6A 3LP3A 3LAKA 3KIOA 1BIUA 3OVNA 1A5WA 3VQAA 1RT5A 3KKRA 1VK0A 3AV9A 1VSEA 2D0AA 4DQPA 4LH5A 4KRFA 3V9WA 2OYQA 2Z1JA 4H4OA 2VG7A 4AH9A 4CJUA 1BQMA 4FJNA 4KHQA 3JSMA 4FLTA 4AHRA 3UIQA 4FJ8A 4FVMA 2O4GA 4CIEA 1BI4A 1WAJA 4CF9A 4O0JA 2E4LA 4FJJA 3AA2A 4CIFA 4O4GA 5CY4A 2VWJA 1VRUA 3HL8A 4EP4A 3I0SA 5HP1A 2KQ2A 2D5RA 2B4JA 4IBNA 4FLUA 1XC9A 2P1JA 1Q9XA 5T7BA 4HUEA 4E7JA 4CK1A 3MEGA 4OGEA 3U3GA 4DU3A 3HVTA 2XRIA 2WOMA 4KB0A 4KO0A 5C42A 1TK0A 4DQIA 2P51A 4ELUA 4CGIA 4PUOA 4QOZB 2PYLA 4ELVA 2A1RA 4DSJA 1RTDA 2HHTA 1QTMA 3SI6A 1K6YA 4PY5A 2GUIA 4DS5A 3ISNC 1TGOA 4CEOA 1U49A 4ZHRA 4FW1A 4CJLA 4RW9A 1NKCA 4OGCA 2XO7A 3QNNA 4DTXA 1VRTA 1UA1A 1N6QA 3KD5E 1JLQA 3QERA 2YV0X 3TWHA 2W42A 2ETJA 4DU1A 4KAZA 5FRMA 3HYFA 3CFPA 1IO2A 4FLYA 5EU7A 4Z4IA 3OYMA 1TVRA 3NBPA 3PO4A 3AO3A 3VQPA 3OYLA 3BDPA 3L2RA 1S5JA 4B9NA 1RBVA 2HNDA 4KHYA 4QCLA 3NE6A 3ULDA 1A5XA 3ASMA 1S1UA 1FKOA 4CJ5A 1VSMA 4FCYA 3DOKA 3RWUA 3ZSWA 3NH0A 2HHQA 2VWKA 4HTUA 1UWBA 2Z1IA 4CF0A 3RR8A 1G15A 3LP0A 1N5YA 4C8MA 4CGFA 4J2EA 2VG5A 3O4QA 3SV3A 1ZBHA 1T05A 3KLHA 3MAQA 3SQ2A 1TL1A 3LZJA 3DLHA 1HPZA 2FBVA 2PY5A 3AVGA 1JLFA 1NK7A 3LP1A 1NK4A 2IC3A 3L2VA 3V9SA 2FBXA 2QKKA 3ZSXA 5JS2A 1BHLA 3DLBA 2F8SA 1XI1A 3V4IA 2XY8A 2KW4A 1C6VA 4Z4EA 3VQCA 4IG0A 4CHYA 3OYJA 3EZ5A 1T03A 2A1SA 5KGWA 3K2PA 1QE1A 1EXQA 4N56A 5KI6A 1KCFA 4DFMA 3V6DA 1NKBA 3K5LA 5D3GA 3V9UA 4FYDA 1C0TA 1RBTA 3SPYA 2X6NA 3RMBA 3RTVA 2VG6A 4B9VA 5C24A 3OYEA 4B9TA 2G8IA 1NOZA 3DM2A 4KTZA 1NKEA 1I39A 3CFRA 3RMDA 1J53A 1HNIA 3WNFA 2PZSA 4JRPA 4JS4A 1Q9YA 4OKJA 1J5OA 3RMAA 4YFUA 4DTSA 2GV9A 3KD1E 3VA0A 3DLEA 4W5RA 1D9FA 1J54A 3OYAA 3KK2A 3TAQA 5I3UA 4KTQA 1BISA 3SJJA 1JLBA 5HROA 3ZSVA 2NUBA 5J2PA 3NFAA 4BE1A 4FJIA 5E41A 1VSLA 2YKNA 2JGUA 4DSEA 3RMCA 2G8UA 3SQ4A 1R0AA 1DTQA 3HPHA 4OVLA 4I9LA 3NAEA 4FJXA 1FXXA 4CIGA 5CYMA 4E1NA 3V9XA 2RPIA 3EYZA 1JXEA 4CJWA 1X9SA 4W5NA 3OJUA 1S1WA 2X74A 4KV8A 3IRXA 4AILC 4KHUA 4B8CA 3U3YA 2X78A 4LH4A 2DY4A 4O0IA 1JLAA 4ZTFA 3AVMA 3NF6A 3VQBA 3HSTB 4KI6A 2YKMA 1KFSA 1RILA 2I5JA 1WNSA 4I9QA 4CJKA 4BWJA 4BE0A 5J2NA 4FLWA 4HUFA 4CJRA 3ZSZA 3DMJA 4PWDA 1GOBA 4RW4A 1WSHA 2X6SA 4BE2A 2DFHA 2YNHA 1WSGA 1ZBUA 3AO2A 4IDKA 3ZSRA 1HYVA 4KTWA 4B8AB 4UQGA 4FJ9A 4CF1A 2HHXA 4C8LA 4CHOA 1RTIA 4DMNA 1CZBA 1W9HA 1T7PA 4KHSA 1C0UA 1VSIA 3OS1A 4J2AA 5DK5A 3QIPA 1QS4A 3OY9A 4IKFA 4CECA 4DQRA 3ZSYA 5KTQA 4DF4A 1KVCA 4EP5A 3OYDA 1RDDA 2QKBA 3NGYA 4Q5VA 4DLGA 4DSFA 3S9HA 3MXJA 5HRRA 1ZBLA 4FZZA 4M3TA 2ITGA 4CE9A 4HUGA 1VSKA 1SUQA 4M3UA 3M8SA 4E7HA 3P83D 3MEEA 2G8KA 4I7FA 2Q3SA 3E01A 4OPKA 2IS3A 3VQ4A 3M8QA 4CGGA 3SQ0A 4M3XA 1XWLA 3NDKA 1LWEA 3HVRA 3V9ZA 4BDPA 4N41A 1GOAA 3QINA 2OPQA 2AJQA 1QSLA 1NK8A 3OYIA 4B3OA 5CZ1A 1VSJA 3LPUA 5J1EA 3WNGA 3S3MA 4FZYA 1S1VA 3L3UA 1LV5A 3ALYA 1HQEA 1Z26A 3CYMA 3AA4A 1RDBA 1C1AA 1VSHA 2RF2A 5HBMA 4RW6A 4CHQA 3PY8A 4NYNA 4DTUA 3KKSA 4BDZA 4N76A 3T1AA 1RBSA 2FBTA 3U6FA 3CQ8A 3D45A 3QESA 3DRPA 2IDOA 1C0MA 4E1MA 4HCCA 2HHVA 1WLJA 3BGRA 3KLGA 1IKVA 3K5MA 1CZ9A 3VQ6A 3SV4A 1NK9A 1HYZA 1SL2A 1QQCA 1RT3A 5J2MA 3AVJA 3SYZA 3C6UA 2IAJA 2HMIA 1YTAA 1ASUA 4CJVA 4E3SA 3SUNA 1S9GA 3DOLA 1ZBIA 3C6TA 3ITHA 2WONA 5FROA 3OJSA 3AO1A 2HHWA 3IS9A 3FFIA 3I0RA 3ZT3A 4M41A 3SUQA 1U4BA 3VQEA 3IAYA 4OLAA 4CJEA 4KFBA 5SZTA 3PO5A 1C1BA 4CESA 4DU4A 3TAFA 4CEAA 4M42A 2YNGA 4FM1A 3LALA 1NJYA 1TKZA 4E0DA 3TI0A 3QO9A 3VQ8A 1W0HA 3AO4A 4CGJA 2D0CA 4E7KA 4DTOA 3QLHA 1TAQA 1NJXA 3NCIA 2OA8A 2GBZA 4K8ZA 4HVJA 2ZQBA 4AHUA 1A5VA 4CERA 4E7IA 5K14A 4BWMA 1BL3A 1KVAA 4FLVA 3NGZA 3PV8A 4ICLA 4CEFA 4DQSA 1SKRA 2KFNA 3DLGA 4L8RB 4B9LA 3AO5A 4NCAA 3CM6A 3P1GA 3CG7A 4FM2A 3PX6A 2Y1IA 4DF8A 1MU2A 1S6PA 3VQQA 4CGDA 4KI4A 1L3TA 3HP6A 1ZBFA 3MXMA 3V1OA 5DMRA 4FJ7A 3VQ5A 2HNYA 3TAMA 1YVUA 3AVKA 4CFCA 1DLOA 4N47A 5I42A 4C8KA 1TV6A 4LSNA 4OJRA 3V1QA 1TAUA 3OYCA 4W5QA 5KGXA 3G0ZA 3OYKA 3HK2A 2OZMA 3M8RA 3A2FA 4O55A 3AVCA 3IG1A 3HP9A 3OYGA 1D9DA 5HRNA 3WNHA 3QEIA 1O1WA 4DTJA 3LANA 1HYSA 3NH2A 1REVA 1HJRA 1ASWA 2HVIA 1VSDA 2YHBA 1B9FA 4DFPA 3NHGA 4NCBA 2F8TA 3OS2A 4QAGA 3PUFA 4M3YA 4CHNA 4WE1A 3ZSOA 1RT7A 2OZSA 1QHTA 3RRGA 4F2SA 1RCHA 3SUOA 1IG9A 1LWFA 4JLHA 3SUPA 3SNNA 4KKOA 3L2UA 2YNFA 4FJHA 2BANA 4IFVA 3TR8A 3TARA 3B6OA 3H08A 1QSYA 2E6MA 4CJPA 2QK9A 4MFBA 4XIUA 1TL3A 4B9SA 4Z0UA 2EHGA 3LWMA 3HPGA 4DLEA 1U47A 4W5OA 4FXDA 3TAGA 4CHPA 1KFDA 3K58A 5FRNA 3V81A 3AVAA 4I2PA 4M3WA 1JLCA 1ASVA 1L3VA 3O4NA 4HCBA 1WAFA 3MEDA 2FBYA 1RTHA 1RBUA 4FZXC 4C8OA 1WSEA 1KSPA 3L2QA 1L3SA 4CFAA 3SCXA 3F73A 1ITGA 4AHTA 4GMJB 3PX0A 1RTJA 3WNEA 5CYQA 4CCHA 2HHUA 3ZCMA 4FW2A 1DTTA 1JL1A 3O3HA 3VQ9A 5HRSA 1SKSA 4Z4CA 3QEPA 4Y1DA 1TK8A 1WSIA 3DLRA 4CK3A 1B92A 3P5JA 4FLXA 4Z4FA 4ZTJA 3SQ1A 2DTUA 4LD0A 3LWLA 2LSNA 3VQDA 4JS5A 3TABA 2Y1JA 4Q0BA 1EKEA 4AHSA 4R5PA 3ZT2A 3K5NA 1WN7A 1IKWA 3PX4A 4F3TA 2P5OA 1S1TA 2Z1HA 4BACA 2XY5A 3SPZA 1YTUA 1JL2A 1GOCA 2O4IA 3CFOA 1CXQA 1JLEA 1IKXA 2BE2A 1KRPA 1EX4A 4Z4GA 3AVNA 1HMVA 4KPYA 1YT3A 3AA5X 4FJ5A 2OPPA 4RW8A 4DTNA 2B6AA 4DSLA 2KZZA 1X1PA 4GVMA 4RG8A 2HVHA 4PQUA 4DFKA 4DTRA 4FJLA 3KLIA 1UA0A 3NF9A 4RW7A 4C8NA 1QSSA 1WSFA
chains in the Genus database with same CATH superfamily
3CPWM 3DLKA 4BRQA 1G99A 3MDQA 1I3AA 4LF5K 3TSQA 4CFDA 3NF7A 3THYB 4PA1A 3CCLN 3A0IX 3TAPA 4H03B 3HO1A 2UYTA 1QVFM 1DKGD 4EHUA 2Z1GA 1UAXA 3E9LA 3VETA 2F96A 4LF7K 1DGKN 1J9AA 5AZJB 4IEIA 4H4MA 5AZIA 2A41A 5BRDA 3SAFA 3J7YP 4CVNE 2GWKA 3F9KA 2R7YA 1RGIA 1MWMA 4H5VA 4DQQA 4DR7K 1LW2A 4NCGA 3ZSQA 4FJGA 3QMLA 3ATVA 3ZT4A 4EIAA 1J6ZA 4O8KA 5CR4A 4JK8A 2VGMA 3L2WA 2EX3A 5AQZA 5CZ2A 2FXUA 3SZ2A 3QEWA 3K59A 1ZXOA 4N5SA 4CZLA 1D5AA 1TKXA 3K57A 1KLMA 5H1SQ 3O3GA 2QWLA 3AAQA 3HPOA 1NM1A 4BDYA 1NOYA 2Q2RA 3THVA 1SL0A 1HLUA 1IH7A 2B5JA 4HHTA 4E89A 2KFZA 1EETA 4Z4HA 4CJ3A 3OW2M 3S3OA 2ZE2A 1VQPN 4JD2B 5AQHA 4K8XA 5C0YA 2YNIA 4IJNA 3CM5A 4M45A 2DPNA 3O5BA 3AVFA 4PL7A 1NLVA 3DYAA 5M1QA 1CXUA 3M6GA 2HB5A 4FWKA 2ZD1A 1HNVA 2RKIA 3C6AA 1BGXT 4B08A 1XHXA 2BGGA 2QW9A 1IKYA 3WEEA 1SV5A 4OPHA 1Z25A 4BC4A 2E5LK 1B9DA 1RT1A 4C1NI 3O3FA 2ATQA 1D8YA 4Y1CA 1NK5A 1X9MA 1S3XA 3SBGA 3LZIA 2RN2A 3VEXA 4FM0A 3UKUB 3FZHA 4J2BA 2I7PA 3KHYA 4CJTA 3HI0A 3ZT0A 3QETA 2OPRA 1WBBA 1TK5A 4EZ6A 3LAKA 4KH5A 4BR0A 1QQMA 2D1KA 4DV0K 5BPMA 4BRMA 1VSEA 2ZM6K 4KRFA 4LH5A 2Z1JA 4AH9A 2O8CB 4FLTA 3VF4A 4FJ8A 3ID8A 2O4GA 1BI4A 4CF9A 4O0JA 2E4LA 4CIFA 2O8EB 1X3NA 2KQ2A 4L3QA 5AQLA 4FLUA 1XC9A 4IBNA 4WQ5A 3KZBA 5T7BA 4HUEA 3N4QA 5E26A 4CK1A 1VQNN 1GLBG 2UXDK 2VCPA 2VYPA 4LF9K 1Q81O 1YXQA 3HVTA 2XRIA 2V52B 5C42A 1V4SA 5AQGA 4PUOA 5F1XA 2NRZA 4NLBA 5F2RA 3HTVA 4YY3K 2GUIA 4CEOA 4GKJK 4FW1A 4IOCL 3AGKA 4DTXA 4BY9C 2QEXN 1JLQA 3QERA 4LFAK 1BG3A 4KAZA 2W6LA 3OYMA 3PO4A 3OYLA 3SAHA 3CCQN 1S5JA 4B9NA 1RBVA 2P9IA 3FFKB 3EEQA 1A5XA 3VERA 2CH5A 4CJ5A 3DOKA 3RWUA 3ZSWA 1WOQA 4YDUC 1N5YA 2IIRA 3BY5A 4CGFA 3VEYA 3LZJA 4LF4K 4M7XA 4GNIA 4LF6K 3VGKA 4I6MA 3L2VA 2QKKA 5C15A 3DLBA 2F8SA 1K9MO 4BG8A 1C6VA 4IG0A 1NGIA 2P9UB 4DB3A 5AQVA 5KI6A 1JCEA 1U6ZA 5JLHA 4DV7K 4FYDA 2P9PA 2X6NA 3EN9A 2VG6A 3OYEA 4B9TA 3C7NB 3NVMA 3DM2A 4KTZA 5ADXH 3W0LA 1K73O 1J53A 1HNIA 3WNFA 5BRFA 2KLAA 2GV9A 1VQLN 2CGLA 1TYQA 3OYAA 2A6AA 3SJJA 2P9PB 5HROA 3O9TA 3NFAA 4BE1A 3CJ9A 4DSEA 1NGAA 1DTQA 3NAEA 4E1NA 1IV0A 1ZC6A 2RPIA 3WXKA 3CC2N 2X74A 4BQLA 5C10A 3CIPA 3P39A 2X78A 3J81O 5AQYA 4ZTFA 1TYQB 2NZTA 2W6KA 3AVMA 1XNRK 2RHKA 3M5RA 4KI6A 1J5EK 4I9QA 1WNSA 1T44A 4BWJA 4PWDA 4RW4A 2AA4A 2DFHA 1ZBUA 2IVPA 2AP1A 3MWTA 4C8LA 3O1BA 1HNXK 3QFUA 4CHOA 2A42A 3CJBA 1CZBA 3O9SA 4KHSA 1C0UA 5AQJA 4JI4K 1K8KA 5AQUA 5KTQA 4X66K 5GIPA 4DLGA 3S9HA 4HUGA 4M3UA 1YF5L 4YORA 3M8SA 4A57A 3A5LC 3E01A 4XH5A 3SQ0A 4PL8A 5LMNK 3HVRA 2OPQA 2AJQA 4LFBK 5CZ1A 3CCEN 4GV6A 4FZYA 2IVOA 1JCFA 5LJWA 1LV5A 3ALYA 4DV5K 2A3ZA 3ID6A 4UY8O 4C1NK 1VSHA 4FSVA 2RF2A 3KKSA 4IOXA 3D45A 3DRPA 3QBWA 5BN8A 3SAGA 3BGRA 1IKVA 1CZ9A 1MA9B 3VQ6A 4FWQA 3SV4A 5J2MA 3AVJA 3EL2A 1ASUA 5KQ8A 4E3SA 4LFCK 4NXMK 1S9GA 1ZBIA 4BVPA 5FROA 1SQKA 3IS9A 3FFIA 3CETA 3ZT3A 4M41A 5BN9A 2FSKA 4G9ZA 3CJAA 5BR8K 3SMSA 4CESA 2ZJPL 4DU4A 3TAFA 3CJ1A 3M1FA 3C6HA 4CEAA 3THWA 4M42A 3LALA 4BGBA 4JI7K 3QO9A 3P4IA 3VQ8A 4E7KA 3R3LA 1NJXA 3NCIA 4NXNK 4K0KK 1Q82O 4E7IA 3WXIA 4B1YB 3NGZA 3PV8A 5M1OA 4B9LA 3EZWA 2VQEK 4H5TA 4FM2A 3VF6A 3CCUN 2HHHK 3VQQA 1HX1A 4KI4A 3Q7CA 4FJ7A 3DXKB 4FO0A 4X62K 1TV6A 4OJRA 3BF3A 1N33K 3WQTA 3G0ZA 3MN7A 3HP9A 3S41A 5HRNA 3WNHA 2GTDA 4DV4K 2QTDA 3LANA 1NGGA 4DFPA 4CBXA 3NHGA 3JS6A 2P9LB 4Z94A 4F2SA 3R9PA 1RCHA 5AQSA 3SUOA 4JLHA 4BVOA 4FJHA 4IFVA 3TR8A 1EWQA 3B6OA 1QSYA 1OVYA 1P8ZA 3TPQA 1GLDG 1OKJA 4B1WB 1U47A 3CPEA 4FXDA 3TAGA 3A5MC 4I2PA 4M3WA 1RBUA 1KSPA 2HHUA 5CYQA 3MN9A 3ZCMA 3QICA 1SKSA 5HRSA 4Y1DA 3DLRA 1B92A 3P5JA 3J80O 4GVEA 4FLXA 2LSNA 3VTHA 2YHYA 1EKEA 4GV3A 1IKWA 5TKYA 2P5OA 2FF3B 2Z1HA 4BACA 2XY5A 1JLEA 4O8UA 2ZWHA 1EX4A 3AVNA 1HMVA 5TKWA 3R6MA 2F9WA 2OPPA 3OHRA 4HWIA 2KZZA 1E4FT 4K43A 2FSJA 3E9PA 4GVMA 4RG8A 4ILHA 4PQUA 2HVHA 3KLIA 3FZMA 3FE1A 3VQAA 3U8XA 2PFUA 5AQRA 1KD1O 2G8FA 2OPSA 3CERA 3FZLA 5LY3A 4DSKA 3TAEA 1VQKN 1X9WA 2HBKA 4DR6K 1U2VA 3C95A 3EKUA 5MLCQ 3ULEB 1NGEA 4CZIA 1LCUA 1C1CA 4FWSA 1HQUA 4CEBA 3D6RA 4DTMA 4CF2A 3FLCO 5HLFA 3RVCA 4V19S 1FK9A 4X65K 4F4KA 5AQMA 2HHSA 4CGHA 4WFAL 3JYTA 4EZ9A 4H5WA 5GIOA 2XY6A 3LDOA 2IGIA 1LAVA 2E1YA 2KTQA 5BPLA 4CEDA 4BG9A 3PLAA 4JN4A 1RT6A 1RDAA 1NU0A 3KLEA 3M8PA 2G8VA 3GE1A 1TKTA 1U45A 1Y97A 4NLCA 3VEZA 3KTQA 2KZMA 3JAMO 3T19A 4CJFA 4I2QA 4IZ9A 5GAHP 1VQ8N 5M1FA 3AA3A 3CF5L 1NGCA 1QQNA 3H45C 3NGIA 4ISEA 1Q86O 1S1XA 4CFBA 3VQ7A 1K8AO 4B9UA 2JLEA 3HRGA 3D0PA 4E7LA 5J2QA 2PZSA 2W41A 3S3NA 2XHBA 1JJ2M 1YUWA 4RTFD 2PYJA 2FSNA 1FKPA 4B1XB 4DFJA 2G8WA 5KPZA 3ZT1A 3NH1A 5JS1A 4FK2A 1S6QA 4DWIA 1JCGA 1HRHA 4CJ4A 2OTLN 3IMXA 1RNHA 3LAMA 1JXBA 2HBMA 1GLEG 3LPTA 3HXMA 1NJIO 1VQ9N 3NVKA 3LDSA 1T8EA 1NK0A 4QS8A 1DT9A 3UB5A 4FJKA 4A59A 4M3RA 3C94A 2BDPA 3LM9A 4IG3A 1E4GT 2JWKA 4OKKA 3E66A 4KREA 2E88A 2HNZA 3WT0A 3AVHA 1NGFA 1TUUA 3VEWA 2QWNA 1UOCA 4BRFA 4JNEA 3CCRN 5AQWA 1GLFO 4AF1A 4DQPA 2NNWA 1ATRA 1VQ5N 2EWSA 4CIEA 4B3SK 3AA2A 4O4GA 5AQIA 3HL8A 3THYA 3I0SA 5FLXO 4MO4A 5GAEP 2D5RA 2B4JA 1Q9XA 2P1JA 3MCAB 1EWRA 3B8AX 3U3GA 2ZJQL 3CC7N 5AZJA 1X9JA 4KO0A 1TK0A 4RCHA 5I9EB 4QOZB 2PYLA 3MK6A 2D0OA 4DS5A 1TGOA 4CJLA 2XO7A 3QNNA 3NMUA 3CFPA 1IO2A 4FLYA 3QFPA 1T3VA 3VQPA 5DM7L 3BDPA 5C2FA 3SK3A 3L2RA 2E2NA 2HNDA 3ULDA 4FWPA 3ASMA 1S1UA 4FCYA 2A5XA 4IEEA 2V7ZA 2HHQA 1UWBA 4CF0A 1G15A 1BWFO 4C8MA 4J2EA 3O4QA 3SV3A 1C0GA 3KLHA 1TL1A 3C65A 4IOAL 1OH5A 1XQSC 1NK4A 2BUPA 3G4SN 4JD2A 3V9SA 5JS2A 3O8MA 1XI1A 3V4IA 2XY8A 2KW4A 5EY4A 3VQCA 4Z4EA 1Z6RA 3EZ5A 4JI5K 2A1SA 4N56A 5JMVA 1KCFA 2D0PA 4BROA 3VGLA 1C0TA 1RBTA 3RMBA 2G8IA 5C24A 2QM1A 3SJHA 3H3NO 1NOZA 3OBWA 2D4WA 1IBMK 2QWRA 3ZX0A 3HOTA 1J5OA 3A5OC 3VA0A 5BPNA 1BO5O 4WQ4C 4DCHA 1C0FA 5E41A 2JGUA 3VMFB 4EAHD 3HPHA 5FPNA 4OVLA 4NO7A 5CYMA 3EYZA 1JXEA 3OJUA 3UKUA 2WTUA 4AILC 4KHUA 2DY4A 4H0XB 5IWAK 3IFRA 4CW7B 1IBKK 3VQBA 3VESA 4BE0A 1NNEA 3D2EB 1EO1A 1WSHA 2O8CA 4BRHA 1WSGA 4A61A 4UQGA 3ZSRA 4FJ9A 2HHXA 4CF1A 5BRHA 2O8EA 3ZEUB 4LF8K 1N8RO 5C12A 3OS1A 3QIPA 1QS4A 4JHDA 3MWPA 3WQUA 4CECA 4DF4A 3OYDA 3TTCA 4Q5VA 4DSFA 3HM8A 1YITN 3VEOA 1T6CA 2ITGA 4E7HA 3P83D 1NG9A 2G8KA 1OVQA 4FPBA 4JHDB 2YJEA 2IS3A 4YDUA 2WBNA 1LWEA 1GOAA 4YOXA 3C0BA 1QSLA 1W97L 3LDNA 1VSJA 2HF4A 3S3MA 1XC3A 1HQEA 1Z26A 5FPEA 3CHWA 4B1UB 4RW6A 4NYNA 2P9NB 2YJFA 3DAWA 4N76A 1RBSA 2FBTA 3U6FA 3CQ8A 3O9RA 3QESA 3P38A 1ESVA 2IDOA 1C0MA 3PIPL 4HCCA 3KLGA 1XMQK 2OTJN 2NRHA 1HYZA 1N32K 1RT3A 2HMIA 1YTAA 3SUNA 2QWMA 5M1PA 1M1KO 3LDPA 3VQEA 2P9UA 2JWLA 4KFBA 3IKMA 3AAPA 2YNGA 4MDAA 1W0HA 3EE9A 3GG4A 4DTOA 3C7NA 3QLHA 4JKBA 4HVJA 4AHUA 5K14A 1BL3A 3UKRB 4FLVA 4ICLA 4JAXA 4CEFA 1YI2N 1HKGA 1SKRA 3DLGA 4NCAA 5JVGL 4YOTA 3CG7A 2A40A 4PHTX 2Y1IA 4DR2K 3ENHA 5EOYA 4CFCA 1DLOA 4LSNA 3V1QA 1TAUA 2BTFA 3M8RA 4O55A 3IG1A 2WUSA 4DUZK 3VTIA 1HYSA 1REVA 1VSDA 3DXMB 4NCBA 4WFBL 4CHNA 4WE1A 3SMPA 3ZSOA 3H1QA 4GV9A 3IDHA 5AQQA 3SNNA 3L2UA 5IT9O 3TARA 4GY2B 2ZGYA 4XH1A 1QHAA 2KKZA 4CI6A 4MFBA 1TL3A 3IUCA 3HPGA 4DLEA 2UUBK 4W5OA 3CQYA 4FL9A 1KC8O 4JI3K 3I55N 2FBYA 1RTHA 4C8OA 1WSEA 1L3SA 2WFBA 4AHTA 4GMJB 4CCHA 1DEJA 4FW2A 1DTTA 3VQ9A 4ILJA 1TK8A 4CK3A 4FOEA 3LWLA 2Y1JA 4Q0BA 3M3ZA 1WN7A 1VAZA 3TTDA 5E84A 2E1ZA 1JL2A 1GOCA 4ISGA 5ELZA 2O4IA 1VHXA 4FWRA 4LC9B 4DR5K 4KPYA 4RW8A 4DSLA 3H3OB 1UA0A 4CHQA 3PX6A 3UE5A 3OYFA 4MQ3A 2YHXA 1RDCA 2Q0UA 4JKGB 2QXFA 3MMVA 1S9EA 1FW6A 2P5GA 3I8DA 1U48A 2H3GX 2P9KB 4GW6A 3LM2A 1GLAG 5KRTA 5C25A 4JKEA 2V51B 1RFQA 5HOOA 2YHAA 4A5BA 3MECA 1BCMA 4KHWA 3SBTA 1O13A 1XHZA 3CJCA 3KJVA 3H46O 1NBWA 3U4LA 1YHQN 3CCMN 3VN5A 4BGAA 1CLQA 3CD6N 1VSFA 4M63C 4IJAA 1LW0A 1XMOK 4A5AA 4WYBA 3PIOL 3P31A 4DSIA 1W2BM 3RR7A 3DXKA 5SWMA 1ZYQA 3QIOA 4H5RA 4FLZA 2D0BA 4IFYA 1NJWA 2P9LA 1JLGA 3AVLA 4YHHK 4FJMA 4F8RA 4DR4K 2DFEA 4DS4A 3L8BA 2FC0A 4CF8A 3TANA 3G71N 2XY7A 1BA1A 1BIZA 1EP4A 1L5UA 4E1JA 1WSJA 1KTQA 4CEZA 5CHIA 1LWCA 4ID5A 3KK3A 3E1YA 1JKHA 3HOSA 4FK0A 4BQZA 3K9KA 3J7ZO 3D2FB 3G25A 4DQ8A 1WB9A 1YJ9N 3KLFA 1YVNA 4KB1A 4BR7A 1SS6A 4AHCA 2E6LA 2I7NA 1U04A 3QNOA 5KRSA 3CCSN 3U9DA 1SL1A 1LOTB 4O44A 4JI8K 4LSLA 4DG1A 1QZ5A 1NWKA 3RRHA 1NJZA 4CJQA 2DFFA 4MLEA 3DI6A 4YOUA 4BRNA 4EFHA 2Q1NA 4BRPA 4BR4A 1N34K 1SAZA 1BCOA 3B6PA 4G1QA 4W5TA 1ZBSA 3BZCA 3H1VX 3LP3A 1A5WA 1RT5A 5M1NA 3KKRA 1BUPA 2QI2A 3AV9A 4H4OA 2VG7A 4FJNA 3JSMA 4ILGB 4FVMA 1VQ4N 3F2KA 3WUHA 4QS7A 3CMAN 4B1VA 2Q97A 4EP4A 4XEIA 4CZFA 3ZX3A 4E7JA 3ULEA 1RDUA 2WOMA 5FPDA 2HOEA 4MLHA 4DQIA 4CGIA 1QVGM 4ELVA 3O08A 4IO9L 3G6EN 4DSJA 5JLFA 1QTMA 3SI6A 4PY5A 3ISNC 3MN6A 4WFNL 1VRTA 5M1KA 1UA1A 3KD5E 2YV0X 2W42A 3O1WA 3CXCM 5FRMA 3HYFA 3R8EA 5CE3A 4CD1A 4BRGA 3NBPA 4JV5K 3ZX2A 4KHYA 1FKOA 4AM6A 4M7YA 2VWKA 1HUXA 3RR8A 1BA0A 3LP0A 4FWOA 1ZBHA 2VG5A 5EX5A 4CZKA 1T05A 4YOVA 3SQ2A 3DLHA 4JI6K 4CBUA 2J4RA 4JKDA 3AVGA 3LP1A 2E2OA 2FBXA 5F0XA 3CC4N 3OYJA 5KGWA 3K2PA 1QE1A 1EXQA 1WBDA 3V6DA 2NRWA 5AQOA 3K5LA 3AARA 3V9UA 5D3GA 4KH6A 4H0OA 3CFRA 2F4VK 2NRXA 3RMAA 3DLEA 2YHWA 4W5RA 3E9OA 2ASOA 4MO5A 1M90O 5AQNA 3TAQA 1BISA 4FJXA 2NUBA 5J2PA 1VSLA 2YKNA 4H0VB 1GLCG 3RMCA 5GADP 2ZF5O 1R0AA 1OH8A 3ENBA 4I9LA 3QDKA 4CIGA 3V9XA 5AQFA 4CJ7A 2GELA 1S1WA 4KV8A 3IRXA 1SZ2A 3O9UA 2OCEA 4J8FA 4B8CA 3U3YA 3GDQA 1JLAA 2YCHA 4KHPK 3I56N 1FJGK 3HSTB 2YKMA 1S72N 1KFSA 2I5JA 4CJKA 3T1YK 5J2NA 4FLWA 4HUFA 3ZSZA 3DMJA 4DHYA 3R1XA 2QWPA 1YJWN 3AO2A 3CCVN 1HYVA 4KTWA 4JKCA 4DMNA 1W9HA 1T7PA 4J2AA 3OY9A 2QKBA 5AJ3K 3MXJA 3I33A 4FZZA 1VSKA 3TSUA 3MEEA 1Z05A 2Q3SA 2ZGZA 4CGGA 2ASPA 4M3XA 4N41A 4BDPA 5AFUA 1KQSM 1HNZK 4B3OA 1NK8A 3OYIA 3LPUA 3MX5A 5J1EA 3VF2A 1S1VA 3L4QA 3AY9A 3CYMA 3RSEB 3PSIA 3T1AA 4E1MA 2HHVA 2O8FB 4PKGA 1WLJA 3K5MA 3AGRA 3O80A 1NK9A 2IAJA 4GKKK 3ITHA 3OJSA 3AO1A 2HHWA 4H0PA 4WQ4A 3SUQA 3IAYA 4OLAA 4CJEA 4H5NA 5SZTA 1C1BA 1NMNA 4XH4A 1NJYA 1TKZA 4E0DA 5KQDA 4AQYK 4FVUA 5AZIB 1NGJA 4K8ZA 1A5VA 3T1HK 4B3TK 3WXLA 1KVAA 4DQSA 2KFNA 3CM6A 3P1GA 2IVNA 3HP6A 3VQ5A 4R79A 2HNYA 3TAMA 5I42A 3JXUA 3OYKA 4AM7A 4BREA 3HK2A 2OZMA 1IG8A 3A2FA 3OYGA 3VOVA 3ZETA 4EHTA 3TSPA 1O1WA 4DTJA 4QS9A 1HJRA 2HVIA 3ZYYX 1KAYA 2P9SA 3D2EA 3PUFA 4M3YA 1V4TA 1RT7A 3RRGA 3ZETB 1IG9A 3SUPA 3ZEUA 5LMUK 5DM6L 3H08A 2E6MA 4CJPA 2P9SB 4F9OA 3HBTA 3DLLL 3DWLA 3LWMA 3BF1A 4CHPA 5FRNA 3K58A 1VQ7N 4B9QA 1JLCA 3O4NA 2VQFK 1YJNN 3MEDA 3SCXA 3F73A 3BP8A 3WNEA 2QA4N 2WC9A 3H6EA 3O3HA 1JL1A 4B3RK 4K42A 1EQYA 2CGJA 3WEEB 4Z4FA 3QB0A 2DTUA 4LD0A 3Q7BA 3TABA 2V7YA 1QQOA 2YX6A 4R5PA 3I8BA 2ZJRL 2P9NA 1S1TA 3SPZA 3CFOA 1CXQA 4B1ZA 1IKXA 3KVGA 5KPRA 3OBYA 3AA5X 1BOTO 4B3MK 2FLOA 4BRCA 4RW7A 3T69A 4C8NA 1QSSA 1WSFA 1RT4A 1YIJN 1Q8IA 1RDWX 4PKHA 3LP2A 1RT2A 1KVBA 1BI4B 1L3UA 1LAWA 2CH6A 3FZFA 4J2DA 1ATNA 4JKFA 4LY7A 4NB4A 3AVIA 1SKWA 1GLJO 5HRPA 4KHNA 3EE8A 2NRTA 2IOCA 1RBRA 4IDHA 4JRQA 4OKEA 1OH6A 1MWKA 3O6WA 3DRRA 3UKRA 3HM9A 3CQXA 3DRSA 4BRIA 2G8HA 4K41A 3T3FA 1HR0K 4BC2A 3O9QA 4OLBA 3F5TA 3N4PA 2UU9K 1TKDA 4WQ5C 3OYBA 2PBDA 3HT3A 4HTLA 4O5BA 4OX9K 2GEMA 2YI1A 2HMPA 3NF8A 3V1RA 3OYHA 5FDLA 4BR5A 3VA3A 5C2DA 2P9IB 2UXCK 4JI1K 3OS0A 1X3MA 3L0QA 5BR9A 4PKIA 1W7AA 1BU6O 1F21A 3QEXA 3G10A 5AQPA 1KAXA 3DXMA 4DUYK 4B9MA 4BRDA 3HJFA 3A5NC 3AVBA 3EY1A 4OPJA 3KK1A 3QEVA 4F2RA 4CEEA 4ID1A 4I6MB 4H8KA 2E2PA 1YAGA 4FWLA 4CHZA 5FPMA 3OYNA 4WF9L 1NGHA 2F9TA 2NLXA 4A62A 1E3MA 3L3VA 4DTPA 2E2QA 4NYFA 4YNQA 4CJSA 1T6DA 3MXIA 4CZGA 2VGNA 4TSXA 4ELTA 1RTDA 3VPZA 4AHVA 4U7BA 4FWNA 3CCJN 2HW3A 4F3OA 4FK4A 1BQNA 1KLNA 1D4XA 3K5OA 4CEQA 4E19A 3KWGA 1NK6A 4DV1K 1VQON 4K25A 3EO3A 4M3ZA 4CK2A 2E8AA 3KIOA 1BIUA 3OVNA 3CJ7A 1VK0A 2D0AA 3FGUA 3V9WA 2OYQA 4CJUA 4KHQA 1BQMA 2HBLA 4JKGA 4AHRA 3UIQA 1WAJA 4FJJA 5CY4A 2VWJA 1VRUA 2P9KA 3MCPA 5JVHL 5HP1A 3FZKA 5AFUH 5LJVA 1K8KB 3MEGA 4ISFA 4OGEA 1WUAA 4DU3A 4KB0A 4IFEA 2P51A 4ELUA 2BH1A 2A1RA 3BEXA 2HHTA 4KBOA 4YOYA 1VQ6N 1K6YA 2ASMA 4RWTA 1U49A 4ZHRA 1NKCA 4RW9A 4OGCA 4IO8A 4CZMA 1N6QA 3TWHA 2ETJA 4DU1A 1BDGA 4IXCA 3MX2A 4JYAK 5EU7A 4Z4IA 1ATSA 1TVRA 3T7ZA 3WXJA 5B8HA 3AO3A 1I94K 4QCLA 3NE6A 1VSMA 2KHOA 3NH0A 1KXPA 3EKSA 5LL6Z 4HTUA 2Z1IA 1VQMN 1NGDA 3MAQA 2UXBK 1HPZA 2FBVA 2PY5A 3CMEN 1JLFA 1NK7A 2IC3A 3PSFA 4A2AA 3SLCA 5BREA 3VEVA 5GINA 3ZSXA 1ILYA 1BHLA 1HNWK 2E20A 2GWJA 4CHYA 1T03A 5AR0A 3GL1A 3QBXA 4WCEL 2HSTA 4X64K 3THWB 4DFMA 1NKBA 3F9MA 3SPYA 4B9VA 3RTVA 3D2FA 2FF6A 1NKEA 1I39A 4BC3A 3RMDA 4JRPA 1HKCA 4JS4A 1Q9YA 4OKJA 4YFUA 4DTSA 2ITMA 3KD1E 2QWQA 1D9FA 4BRLA 1J54A 3KK2A 5I3UA 1MDUB 4KTQA 4DV3K 1JLBA 4FJIA 3ZSVA 1P90A 4CZHA 5AQKA 2G8UA 3SQ4A 2O8BA 1FXXA 3A8YA 4JI0K 1X9SA 4W5NA 2Q31A 1KAZA 4CJWA 4H0TB 4BR9A 4LH4A 3KK7A 4O0IA 4JKHA 2PAVA 3NF6A 3GBTA 1NMDA 1RILA 2O8BB 2NRRA 1IJJA 2Q36A 2VWBA 4CJRA 2W40A 3ZLJA 1GOBA 2X6SA 4BE2A 2YNHA 3O4WA 3TTFA 4JI2K 3TU5A 4IDKA 4B8AB 3ATUA 4JEPA 1RTIA 2QXLA 1VSIA 3FR0A 5DK5A 4IKFA 4CZEA 3D7EO 2UUCK 4DQRA 3ZSYA 1KVCA 4EP5A 1RDDA 3NGYA 5HRRA 1ZBLA 4M3TA 4CE9A 1R59O 1SUQA 4I7FA 3VENA 4OPKA 3VQ4A 3M8QA 1XWLA 3NDKA 3V9ZA 3QINA 1HPMA 3WNGA 2GUPA 4FWMA 3J7AP 3L3UA 4OO1J 2F7TA 4DR1K 2Q0RA 3AA4A 1RDBA 1C1AA 3PY8A 5HBMA 4DTUA 4BDZA 5GAGP 4U67L 4A2BA 5A2QO 3W3DA 3ENOA 3HZ6A 1CZAN 4C23A 4MDBA 1S22A 4BRAA 2UUAK 1OH7A 1SL2A 1HKBA 1QQCA 2HBJA 4KH4A 3SYZA 3C6UA 4CJVA 1XUPO 3KWIA 3DOLA 3C6TA 2WONA 2NRVA 1XNQK 3HSCA 3WXMB 3I0RA 4BC5A 4JK7A 1U4BA 1U2VB 3PO5A 3VGMA 5AQTA 2QWOA 3LL3A 4FM1A 3DJCA 3TI0A 3AO4A 4CGJA 2D0CA 4CZJA 4BR2A 4CBWA 3L4IA 1TAQA 1Y64A 2GBZA 2OA8A 2ZQBA 4IWVA 4CERA 4BWMA 1HJOA 4L8RB 3AO5A 3LDLA 4O5FA 4DF8A 1MU2A 1S6PA 1N36K 4CGDA 1L3TA 1ZBFA 3MXMA 3V1OA 5DMRA 1Q18A 4C8KA 1YVUA 3AVKA 4N47A 4FPAA 3OA9A 5ADXA 3OYCA 4W5QA 1NGBA 5KGXA 4DR3K 3AVCA 1H1VA 1D9DA 3J8AA 3QEIA 4Y0WA 3NH2A 1ASWA 2YHBA 3GOIA 1B9FA 5KPTA 4YOWA 3BZKA 2F8TA 3OS2A 4QAGA 4DKWA 2OANA 3BUZB 3L6QA 2OZSA 1QHTA 3K0SA 1LWFA 1QZ6A 4JKAA 4KKOA 2YNFA 2BANA 2O8DA 2QK9A 3K9JA 4XIUA 4B9SA 4Z0UA 2EHGA 4H0YB 5JICA 2RE2A 1KFDA 3V81A 3AVAA 1L3VA 1ASVA 4HCBA 1WAFA 2O8DB 1GLLO 3THXA 4JK9A 2GX9A 4FZXC 3L2QA 4CFAA 1ITGA 3PX0A 1RTJA 3U9ZA 4FOIA 3OTOK 5AQXA 4Z4CA 3MN5A 3QEPA 1TUYA 1WSIA 4CD3A 1Q7YO 5HL7L 4ZTJA 3SQ1A 3THXB 3LDQA 3VQDA 4JS5A 2HF3A 3RSEA 4AHSA 3ZT2A 3K5NA 3PX4A 4F3TA 2CGKA 3CI5A 1YTUA 1IBLK 5EVZA 4BRKA 1KRPA 2BE2A 4Z4GA 4DV6K 2O8FA 5EXWA 1YT3A 4FJ5A 4DTNA 2B6AA 1X1PA 4OPAA 4DFKA 4DTRA 4FJLA 3NF9A 4DV2K
chains in the Genus database with same CATH topology
1RT4A 3OYFA 4MQ3A 3DLKA 1Q8IA 1RDCA 2G8FA 3LP2A 1I3AA 2QXFA 1RT2A 1KVBA 2OPSA 1BI4B 1L3UA 1LAWA 1S9EA 2P5GA 4J2DA 3I8DA 3TAEA 1U48A 4DSKA 1X9WA 4GW6A 4CFDA 3NF7A 4LY7A 1SKWA 3AVIA 3C95A 4PA1A 3HO1A 3TAPA 5HRPA 4KHNA 5KRTA 2Z1GA 1UAXA 5C25A 2IOCA 1RBRA 2F96A 2YHAA 3MECA 1BCMA 1C1CA 4JRQA 4KHWA 1HQUA 4CEBA 1XHZA 1J9AA 3KJVA 4H4MA 4DTMA 4CF2A 5HLFA 4OKEA 1FK9A 4F4KA 3DRRA 3F9KA 2R7YA 2HHSA 3VN5A 3HM9A 4DQQA 1LW2A 4CGHA 3DRSA 4NCGA 3ZSQA 4FJGA 3JYTA 2G8HA 3T3FA 4EZ9A 1CLQA 1VSFA 2XY6A 3ZT4A 2IGIA 1LW0A 1LAVA 2KTQA 3L2WA 4OLBA 4DSIA 4CEDA 1TKDA 3RR7A 2EX3A 3OYBA 5CZ2A 3HT3A 4O5BA 3SZ2A 3QEWA 1RT6A 3K59A 1RDAA 3V1RA 3NF8A 5SWMA 3KLEA 4N5SA 1ZYQA 3OYHA 5FDLA 3QIOA 3M8PA 2G8VA 1D5AA 1TKXA 3K57A 4FLZA 3VA3A 2D0BA 1TKTA 3OS0A 1KLMA 1U45A 1Y97A 2KZMA 3KTQA 1F21A 4IFYA 3T19A 3O3GA 3QEXA 1NJWA 3G10A 4CJFA 3HPOA 4I2QA 4BDYA 4B9MA 1NOYA 1JLGA 3AVLA 3HJFA 3THVA 4FJMA 3AA3A 1SL0A 1IH7A 4F8RA 2B5JA 3AVBA 4HHTA 2DFEA 3NGIA 3EY1A 4E89A 4OPJA 3L8BA 3KK1A 4DS4A 2KFZA 1EETA 3QEVA 1S1XA 4CEEA 2FC0A 4CF8A 4CFBA 4Z4HA 3TANA 4CJ3A 4F2RA 4ID1A 3VQ7A 3S3OA 4H8KA 2ZE2A 2XY7A 4B9UA 4K8XA 2YNIA 2JLEA 4E7LA 3D0PA 1BIZA 5J2QA 3CM5A 4M45A 1EP4A 3S3NA 1L5UA 2XHBA 1WSJA 1KTQA 2PYJA 3AVFA 4CEZA 1FKPA 1LWCA 3DYAA 4DFJA 1CXUA 4ID5A 4CHZA 3KK3A 2G8WA 1JKHA 3ZT1A 3NH1A 2HB5A 4FK0A 3OYNA 5JS1A 4FK2A 1S6QA 4DWIA 3L3VA 1HRHA 2ZD1A 4DTPA 4CJ4A 1HNVA 2RKIA 1RNHA 3LAMA 3KLFA 4KB1A 1JXBA 1BGXT 4NYFA 4AHCA 2E6LA 4B08A 4YNQA 3LPTA 4CJSA 1U04A 1XHXA 3HXMA 3QNOA 3MXIA 2BGGA 4TSXA 4ELTA 1IKYA 1SV5A 4AHVA 5KRSA 1Z25A 3LDSA 1SL1A 1T8EA 4O44A 1NK0A 4F3OA 1B9DA 1RT1A 2HW3A 4FK4A 1BQNA 1KLNA 3O3FA 4FJKA 2ATQA 3K5OA 1D8YA 4Y1CA 4M3RA 4CEQA 4E19A 3C94A 1NK5A 1X9MA 4LSLA 4DG1A 1NK6A 2BDPA 3RRHA 1NJZA 4CJQA 3LZIA 2DFFA 4IG3A 2RN2A 3DI6A 4FM0A 4OKKA 4J2BA 4KREA 2HNZA 3AVHA 4M3ZA 4CJTA 4CK2A 3ZT0A 1BCOA 3B6PA 3QETA 2OPRA 1UOCA 4G1QA 4W5TA 1TK5A 4EZ6A 3LP3A 3LAKA 3KIOA 1BIUA 3OVNA 1A5WA 3VQAA 1RT5A 3KKRA 1VK0A 3AV9A 1VSEA 2D0AA 4DQPA 4LH5A 4KRFA 3V9WA 2OYQA 2Z1JA 4H4OA 2VG7A 4AH9A 4CJUA 1BQMA 4FJNA 4KHQA 3JSMA 4FLTA 4AHRA 3UIQA 4FJ8A 4FVMA 2O4GA 4CIEA 1BI4A 1WAJA 4CF9A 4O0JA 2E4LA 4FJJA 3AA2A 4CIFA 4O4GA 5CY4A 2VWJA 1VRUA 3HL8A 4EP4A 3I0SA 5HP1A 2KQ2A 2D5RA 2B4JA 4IBNA 4FLUA 1XC9A 2P1JA 1Q9XA 5T7BA 4HUEA 4E7JA 4CK1A 3MEGA 4OGEA 3U3GA 4DU3A 3HVTA 2XRIA 2WOMA 4KB0A 4KO0A 5C42A 1TK0A 4DQIA 2P51A 4ELUA 4CGIA 4PUOA 4QOZB 2PYLA 4ELVA 2A1RA 4DSJA 1RTDA 2HHTA 1QTMA 3SI6A 1K6YA 4PY5A 2GUIA 4DS5A 3ISNC 1TGOA 4CEOA 1U49A 4ZHRA 4FW1A 4CJLA 4RW9A 1NKCA 4OGCA 2XO7A 3QNNA 4DTXA 1VRTA 1UA1A 1N6QA 3KD5E 1JLQA 3QERA 2YV0X 3TWHA 2W42A 2ETJA 4DU1A 4KAZA 5FRMA 3HYFA 3CFPA 1IO2A 4FLYA 5EU7A 4Z4IA 3OYMA 1TVRA 3NBPA 3PO4A 3AO3A 3VQPA 3OYLA 3BDPA 3L2RA 1S5JA 4B9NA 1RBVA 2HNDA 4KHYA 4QCLA 3NE6A 3ULDA 1A5XA 3ASMA 1S1UA 1FKOA 4CJ5A 1VSMA 4FCYA 3DOKA 3RWUA 3ZSWA 3NH0A 2HHQA 2VWKA 4HTUA 1UWBA 2Z1IA 4CF0A 3RR8A 1G15A 3LP0A 1N5YA 4C8MA 4CGFA 4J2EA 2VG5A 3O4QA 3SV3A 1ZBHA 1T05A 3KLHA 3MAQA 3SQ2A 1TL1A 3LZJA 3DLHA 1HPZA 2FBVA 2PY5A 3AVGA 1JLFA 1NK7A 3LP1A 1NK4A 2IC3A 3L2VA 3V9SA 2FBXA 2QKKA 3ZSXA 5JS2A 1BHLA 3DLBA 2F8SA 1XI1A 3V4IA 2XY8A 2KW4A 1C6VA 4Z4EA 3VQCA 4IG0A 4CHYA 3OYJA 3EZ5A 1T03A 2A1SA 5KGWA 3K2PA 1QE1A 1EXQA 4N56A 5KI6A 1KCFA 4DFMA 3V6DA 1NKBA 3K5LA 5D3GA 3V9UA 4FYDA 1C0TA 1RBTA 3SPYA 2X6NA 3RMBA 3RTVA 2VG6A 4B9VA 5C24A 3OYEA 4B9TA 2G8IA 1NOZA 3DM2A 4KTZA 1NKEA 1I39A 3CFRA 3RMDA 1J53A 1HNIA 3WNFA 2PZSA 4JRPA 4JS4A 1Q9YA 4OKJA 1J5OA 3RMAA 4YFUA 4DTSA 2GV9A 3KD1E 3VA0A 3DLEA 4W5RA 1D9FA 1J54A 3OYAA 3KK2A 3TAQA 5I3UA 4KTQA 1BISA 3SJJA 1JLBA 5HROA 3ZSVA 2NUBA 5J2PA 3NFAA 4BE1A 4FJIA 5E41A 1VSLA 2YKNA 2JGUA 4DSEA 3RMCA 2G8UA 3SQ4A 1R0AA 1DTQA 3HPHA 4OVLA 4I9LA 3NAEA 4FJXA 1FXXA 4CIGA 5CYMA 4E1NA 3V9XA 2RPIA 3EYZA 1JXEA 4CJWA 1X9SA 4W5NA 3OJUA 1S1WA 2X74A 4KV8A 3IRXA 4AILC 4KHUA 4B8CA 3U3YA 2X78A 4LH4A 2DY4A 4O0IA 1JLAA 4ZTFA 3AVMA 3NF6A 3VQBA 3HSTB 4KI6A 2YKMA 1KFSA 1RILA 2I5JA 1WNSA 4I9QA 4CJKA 4BWJA 4BE0A 5J2NA 4FLWA 4HUFA 4CJRA 3ZSZA 3DMJA 4PWDA 1GOBA 4RW4A 1WSHA 2X6SA 4BE2A 2DFHA 2YNHA 1WSGA 1ZBUA 3AO2A 4IDKA 3ZSRA 1HYVA 4KTWA 4B8AB 4UQGA 4FJ9A 4CF1A 2HHXA 4C8LA 4CHOA 1RTIA 4DMNA 1CZBA 1W9HA 1T7PA 4KHSA 1C0UA 1VSIA 3OS1A 4J2AA 5DK5A 3QIPA 1QS4A 3OY9A 4IKFA 4CECA 4DQRA 3ZSYA 5KTQA 4DF4A 1KVCA 4EP5A 3OYDA 1RDDA 2QKBA 3NGYA 4Q5VA 4DLGA 4DSFA 3S9HA 3MXJA 5HRRA 1ZBLA 4FZZA 4M3TA 2ITGA 4CE9A 4HUGA 1VSKA 1SUQA 4M3UA 3M8SA 4E7HA 3P83D 3MEEA 2G8KA 4I7FA 2Q3SA 3E01A 4OPKA 2IS3A 3VQ4A 3M8QA 4CGGA 3SQ0A 4M3XA 1XWLA 3NDKA 1LWEA 3HVRA 3V9ZA 4BDPA 4N41A 1GOAA 3QINA 2OPQA 2AJQA 1QSLA 1NK8A 3OYIA 4B3OA 5CZ1A 1VSJA 3LPUA 5J1EA 3WNGA 3S3MA 4FZYA 1S1VA 3L3UA 1LV5A 3ALYA 1HQEA 1Z26A 3CYMA 3AA4A 1RDBA 1C1AA 1VSHA 2RF2A 5HBMA 4RW6A 4CHQA 3PY8A 4NYNA 4DTUA 3KKSA 4BDZA 4N76A 3T1AA 1RBSA 2FBTA 3U6FA 3CQ8A 3D45A 3QESA 3DRPA 2IDOA 1C0MA 4E1MA 4HCCA 2HHVA 1WLJA 3BGRA 3KLGA 1IKVA 3K5MA 1CZ9A 3VQ6A 3SV4A 1NK9A 1HYZA 1SL2A 1QQCA 1RT3A 5J2MA 3AVJA 3SYZA 3C6UA 2IAJA 2HMIA 1YTAA 1ASUA 4CJVA 4E3SA 3SUNA 1S9GA 3DOLA 1ZBIA 3C6TA 3ITHA 2WONA 5FROA 3OJSA 3AO1A 2HHWA 3IS9A 3FFIA 3I0RA 3ZT3A 4M41A 3SUQA 1U4BA 3VQEA 3IAYA 4OLAA 4CJEA 4KFBA 5SZTA 3PO5A 1C1BA 4CESA 4DU4A 3TAFA 4CEAA 4M42A 2YNGA 4FM1A 3LALA 1NJYA 1TKZA 4E0DA 3TI0A 3QO9A 3VQ8A 1W0HA 3AO4A 4CGJA 2D0CA 4E7KA 4DTOA 3QLHA 1TAQA 1NJXA 3NCIA 2OA8A 2GBZA 4K8ZA 4HVJA 2ZQBA 4AHUA 1A5VA 4CERA 4E7IA 5K14A 4BWMA 1BL3A 1KVAA 4FLVA 3NGZA 3PV8A 4ICLA 4CEFA 4DQSA 1SKRA 2KFNA 3DLGA 4L8RB 4B9LA 3AO5A 4NCAA 3CM6A 3P1GA 3CG7A 4FM2A 3PX6A 2Y1IA 4DF8A 1MU2A 1S6PA 3VQQA 4CGDA 4KI4A 1L3TA 3HP6A 1ZBFA 3MXMA 3V1OA 5DMRA 4FJ7A 3VQ5A 2HNYA 3TAMA 1YVUA 3AVKA 4CFCA 1DLOA 4N47A 5I42A 4C8KA 1TV6A 4LSNA 4OJRA 3V1QA 1TAUA 3OYCA 4W5QA 5KGXA 3G0ZA 3OYKA 3HK2A 2OZMA 3M8RA 3A2FA 4O55A 3AVCA 3IG1A 3HP9A 3OYGA 1D9DA 5HRNA 3WNHA 3QEIA 1O1WA 4DTJA 3LANA 1HYSA 3NH2A 1REVA 1HJRA 1ASWA 2HVIA 1VSDA 2YHBA 1B9FA 4DFPA 3NHGA 4NCBA 2F8TA 3OS2A 4QAGA 3PUFA 4M3YA 4CHNA 4WE1A 3ZSOA 1RT7A 2OZSA 1QHTA 3RRGA 4F2SA 1RCHA 3SUOA 1IG9A 1LWFA 4JLHA 3SUPA 3SNNA 4KKOA 3L2UA 2YNFA 4FJHA 2BANA 4IFVA 3TR8A 3TARA 3B6OA 3H08A 1QSYA 2E6MA 4CJPA 2QK9A 4MFBA 4XIUA 1TL3A 4B9SA 4Z0UA 2EHGA 3LWMA 3HPGA 4DLEA 1U47A 4W5OA 4FXDA 3TAGA 4CHPA 1KFDA 3K58A 5FRNA 3V81A 3AVAA 4I2PA 4M3WA 1JLCA 1ASVA 1L3VA 3O4NA 4HCBA 1WAFA 3MEDA 2FBYA 1RTHA 1RBUA 4FZXC 4C8OA 1WSEA 1KSPA 3L2QA 1L3SA 4CFAA 3SCXA 3F73A 1ITGA 4AHTA 4GMJB 3PX0A 1RTJA 3WNEA 5CYQA 4CCHA 2HHUA 3ZCMA 4FW2A 1DTTA 1JL1A 3O3HA 3VQ9A 5HRSA 1SKSA 4Z4CA 3QEPA 4Y1DA 1TK8A 1WSIA 3DLRA 4CK3A 1B92A 3P5JA 4FLXA 4Z4FA 4ZTJA 3SQ1A 2DTUA 4LD0A 3LWLA 2LSNA 3VQDA 4JS5A 3TABA 2Y1JA 4Q0BA 1EKEA 4AHSA 4R5PA 3ZT2A 3K5NA 1WN7A 1IKWA 3PX4A 4F3TA 2P5OA 1S1TA 2Z1HA 4BACA 2XY5A 3SPZA 1YTUA 1JL2A 1GOCA 2O4IA 3CFOA 1CXQA 1JLEA 1IKXA 2BE2A 1KRPA 1EX4A 4Z4GA 3AVNA 1HMVA 4KPYA 1YT3A 3AA5X 4FJ5A 2OPPA 4RW8A 4DTNA 2B6AA 4DSLA 2KZZA 1X1PA 4GVMA 4RG8A 2HVHA 4PQUA 4DFKA 4DTRA 4FJLA 3KLIA 1UA0A 3NF9A 4RW7A 4C8NA 1QSSA 1WSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RT4 A;  3OYF A;  4MQ3 A;  3DLK A;  1Q8I A;  1RDC A;  2G8F A;  3LP2 A;  1I3A A;  2QXF A;  1RT2 A;  1KVB A;  2OPS A;  1BI4 B;  1L3U A;  1LAW A;  1S9E A;  2P5G A;  4J2D A;  3I8D A;  3TAE A;  1U48 A;  4DSK A;  1X9W A;  4GW6 A;  4CFD A;  3NF7 A;  4LY7 A;  1SKW A;  3AVI A;  3C95 A;  4PA1 A;  3HO1 A;  3TAP A;  5HRP A;  4KHN A;  5KRT A;  2Z1G A;  1UAX A;  5C25 A;  2IOC A;  1RBR A;  2F96 A;  2YHA A;  3MEC A;  1BCM A;  1C1C A;  4JRQ A;  4KHW A;  1HQU A;  4CEB A;  1XHZ A;  1J9A A;  3KJV A;  4H4M A;  4DTM A;  4CF2 A;  5HLF A;  4OKE A;  1FK9 A;  4F4K A;  3DRR A;  3F9K A;  2R7Y A;  2HHS A;  3VN5 A;  3HM9 A;  4DQQ A;  1LW2 A;  4CGH A;  3DRS A;  4NCG A;  3ZSQ A;  4FJG A;  3JYT A;  2G8H A;  3T3F A;  4EZ9 A;  1CLQ A;  1VSF A;  2XY6 A;  3ZT4 A;  2IGI A;  1LW0 A;  1LAV A;  2KTQ A;  3L2W A;  4OLB A;  4DSI A;  4CED A;  1TKD A;  3RR7 A;  2EX3 A;  3OYB A;  5CZ2 A;  3HT3 A;  4O5B A;  3SZ2 A;  3QEW A;  1RT6 A;  3K59 A;  1RDA A;  3V1R A;  3NF8 A;  5SWM A;  3KLE A;  4N5S A;  1ZYQ A;  3OYH A;  5FDL A;  3QIO A;  3M8P A;  2G8V A;  1D5A A;  1TKX A;  3K57 A;  4FLZ A;  3VA3 A;  2D0B A;  1TKT A;  3OS0 A;  1KLM A;  1U45 A;  1Y97 A;  2KZM A;  3KTQ A;  1F21 A;  4IFY A;  3T19 A;  3O3G A;  3QEX A;  1NJW A;  3G10 A;  4CJF A;  3HPO A;  4I2Q A;  4BDY A;  4B9M A;  1NOY A;  1JLG A;  3AVL A;  3HJF A;  3THV A;  4FJM A;  3AA3 A;  1SL0 A;  1IH7 A;  4F8R A;  2B5J A;  3AVB A;  4HHT A;  2DFE A;  3NGI A;  3EY1 A;  4E89 A;  4OPJ A;  3L8B A;  3KK1 A;  4DS4 A;  2KFZ A;  1EET A;  3QEV A;  1S1X A;  4CEE A;  2FC0 A;  4CF8 A;  4CFB A;  4Z4H A;  3TAN A;  4CJ3 A;  4F2R A;  4ID1 A;  3VQ7 A;  3S3O A;  4H8K A;  2ZE2 A;  2XY7 A;  4B9U A;  4K8X A;  2YNI A;  2JLE A;  4E7L A;  3D0P A;  1BIZ A;  5J2Q A;  3CM5 A;  4M45 A;  1EP4 A;  3S3N A;  1L5U A;  2XHB A;  1WSJ A;  1KTQ A;  2PYJ A;  3AVF A;  4CEZ A;  1FKP A;  1LWC A;  3DYA A;  4DFJ A;  1CXU A;  4ID5 A;  4CHZ A;  3KK3 A;  2G8W A;  1JKH A;  3ZT1 A;  3NH1 A;  2HB5 A;  4FK0 A;  3OYN A;  5JS1 A;  4FK2 A;  1S6Q A;  4DWI A;  3L3V A;  1HRH A;  2ZD1 A;  4DTP A;  4CJ4 A;  1HNV A;  2RKI A;  1RNH A;  3LAM A;  3KLF A;  4KB1 A;  1JXB A;  1BGX T;  4NYF A;  4AHC A;  2E6L A;  4B08 A;  4YNQ A;  3LPT A;  4CJS A;  1U04 A;  1XHX A;  3HXM A;  3QNO A;  3MXI A;  2BGG A;  4TSX A;  4ELT A;  1IKY A;  1SV5 A;  4AHV A;  5KRS A;  1Z25 A;  3LDS A;  1SL1 A;  1T8E A;  4O44 A;  1NK0 A;  4F3O A;  1B9D A;  1RT1 A;  2HW3 A;  4FK4 A;  1BQN A;  1KLN A;  3O3F A;  4FJK A;  2ATQ A;  3K5O A;  1D8Y A;  4Y1C A;  4M3R A;  4CEQ A;  4E19 A;  3C94 A;  1NK5 A;  1X9M A;  4LSL A;  4DG1 A;  1NK6 A;  2BDP A;  3RRH A;  1NJZ A;  4CJQ A;  3LZI A;  2DFF A;  4IG3 A;  2RN2 A;  3DI6 A;  4FM0 A;  4OKK A;  4J2B A;  4KRE A;  2HNZ A;  3AVH A;  4M3Z A;  4CJT A;  4CK2 A;  3ZT0 A;  1BCO A;  3B6P A;  3QET A;  2OPR A;  1UOC A;  4G1Q A;  4W5T A;  1TK5 A;  4EZ6 A;  3LP3 A;  3LAK A;  3KIO A;  1BIU A;  3OVN A;  1A5W A;  3VQA A;  1RT5 A;  3KKR A;  1VK0 A;  3AV9 A;  1VSE A;  2D0A A;  4DQP A;  4LH5 A;  4KRF A;  3V9W A;  2OYQ A;  2Z1J A;  4H4O A;  2VG7 A;  4AH9 A;  4CJU A;  1BQM A;  4FJN A;  4KHQ A;  3JSM A;  4FLT A;  4AHR A;  3UIQ A;  4FJ8 A;  4FVM A;  2O4G A;  4CIE A;  1BI4 A;  1WAJ A;  4CF9 A;  4O0J A;  2E4L A;  4FJJ A;  3AA2 A;  4CIF A;  4O4G A;  5CY4 A;  2VWJ A;  1VRU A;  3HL8 A;  4EP4 A;  3I0S A;  5HP1 A;  2KQ2 A;  2D5R A;  2B4J A;  4IBN A;  4FLU A;  1XC9 A;  2P1J A;  1Q9X A;  5T7B A;  4HUE A;  4E7J A;  4CK1 A;  3MEG A;  4OGE A;  3U3G A;  4DU3 A;  3HVT A;  2XRI A;  2WOM A;  4KB0 A;  4KO0 A;  5C42 A;  1TK0 A;  4DQI A;  2P51 A;  4ELU A;  4CGI A;  4PUO A;  4QOZ B;  2PYL A;  4ELV A;  2A1R A;  4DSJ A;  1RTD A;  2HHT A;  1QTM A;  3SI6 A;  1K6Y A;  4PY5 A;  2GUI A;  4DS5 A;  3ISN C;  1TGO A;  4CEO A;  1U49 A;  4ZHR A;  4FW1 A;  4CJL A;  4RW9 A;  1NKC A;  4OGC A;  2XO7 A;  3QNN A;  4DTX A;  1VRT A;  1UA1 A;  1N6Q A;  3KD5 E;  1JLQ A;  3QER A;  2YV0 X;  3TWH A;  2W42 A;  2ETJ A;  4DU1 A;  4KAZ A;  5FRM A;  3HYF A;  3CFP A;  1IO2 A;  4FLY A;  5EU7 A;  4Z4I A;  3OYM A;  1TVR A;  3NBP A;  3PO4 A;  3AO3 A;  3VQP A;  3OYL A;  3BDP A;  3L2R A;  1S5J A;  4B9N A;  1RBV A;  2HND A;  4KHY A;  4QCL A;  3NE6 A;  3ULD A;  1A5X A;  3ASM A;  1S1U A;  1FKO A;  4CJ5 A;  1VSM A;  4FCY A;  3DOK A;  3RWU A;  3ZSW A;  3NH0 A;  2HHQ A;  2VWK A;  4HTU A;  1UWB A;  2Z1I A;  4CF0 A;  3RR8 A;  1G15 A;  3LP0 A;  1N5Y A;  4C8M A;  4CGF A;  4J2E A;  2VG5 A;  3O4Q A;  3SV3 A;  1ZBH A;  1T05 A;  3KLH A;  3MAQ A;  3SQ2 A;  1TL1 A;  3LZJ A;  3DLH A;  1HPZ A;  2FBV A;  2PY5 A;  3AVG A;  1JLF A;  1NK7 A;  3LP1 A;  1NK4 A;  2IC3 A;  3L2V A;  3V9S A;  2FBX A;  2QKK A;  3ZSX A;  5JS2 A;  1BHL A;  3DLB A;  2F8S A;  1XI1 A;  3V4I A;  2XY8 A;  2KW4 A;  1C6V A;  4Z4E A;  3VQC A;  4IG0 A;  4CHY A;  3OYJ A;  3EZ5 A;  1T03 A;  2A1S A;  5KGW A;  3K2P A;  1QE1 A;  1EXQ A;  4N56 A;  5KI6 A;  1KCF A;  4DFM A;  3V6D A;  1NKB A;  3K5L A;  5D3G A;  3V9U A;  4FYD A;  1C0T A;  1RBT A;  3SPY A;  2X6N A;  3RMB A;  3RTV A;  2VG6 A;  4B9V A;  5C24 A;  3OYE A;  4B9T A;  2G8I A;  1NOZ A;  3DM2 A;  4KTZ A;  1NKE A;  1I39 A;  3CFR A;  3RMD A;  1J53 A;  1HNI A;  3WNF A;  2PZS A;  4JRP A;  4JS4 A;  1Q9Y A;  4OKJ A;  1J5O A;  3RMA A;  4YFU A;  4DTS A;  2GV9 A;  3KD1 E;  3VA0 A;  3DLE A;  4W5R A;  1D9F A;  1J54 A;  3OYA A;  3KK2 A;  3TAQ A;  5I3U A;  4KTQ A;  1BIS A;  3SJJ A;  1JLB A;  5HRO A;  3ZSV A;  2NUB A;  5J2P A;  3NFA A;  4BE1 A;  4FJI A;  5E41 A;  1VSL A;  2YKN A;  2JGU A;  4DSE A;  3RMC A;  2G8U A;  3SQ4 A;  1R0A A;  1DTQ A;  3HPH A;  4OVL A;  4I9L A;  3NAE A;  4FJX A;  1FXX A;  4CIG A;  5CYM A;  4E1N A;  3V9X A;  2RPI A;  3EYZ A;  1JXE A;  4CJW A;  1X9S A;  4W5N A;  3OJU A;  1S1W A;  2X74 A;  4KV8 A;  3IRX A;  4AIL C;  4KHU A;  4B8C A;  3U3Y A;  2X78 A;  4LH4 A;  2DY4 A;  4O0I A;  1JLA A;  4ZTF A;  3AVM A;  3NF6 A;  3VQB A;  3HST B;  4KI6 A;  2YKM A;  1KFS A;  1RIL A;  2I5J A;  1WNS A;  4I9Q A;  4CJK A;  4BWJ A;  4BE0 A;  5J2N A;  4FLW A;  4HUF A;  4CJR A;  3ZSZ A;  3DMJ A;  4PWD A;  1GOB A;  4RW4 A;  1WSH A;  2X6S A;  4BE2 A;  2DFH A;  2YNH A;  1WSG A;  1ZBU A;  3AO2 A;  4IDK A;  3ZSR A;  1HYV A;  4KTW A;  4B8A B;  4UQG A;  4FJ9 A;  4CF1 A;  2HHX A;  4C8L A;  4CHO A;  1RTI A;  4DMN A;  1CZB A;  1W9H A;  1T7P A;  4KHS A;  1C0U A;  1VSI A;  3OS1 A;  4J2A A;  5DK5 A;  3QIP A;  1QS4 A;  3OY9 A;  4IKF A;  4CEC A;  4DQR A;  3ZSY A;  5KTQ A;  4DF4 A;  1KVC A;  4EP5 A;  3OYD A;  1RDD A;  2QKB A;  3NGY A;  4Q5V A;  4DLG A;  4DSF A;  3S9H A;  3MXJ A;  5HRR A;  1ZBL A;  4FZZ A;  4M3T A;  2ITG A;  4CE9 A;  4HUG A;  1VSK A;  1SUQ A;  4M3U A;  3M8S A;  4E7H A;  3P83 D;  3MEE A;  2G8K A;  4I7F A;  2Q3S A;  3E01 A;  4OPK A;  2IS3 A;  3VQ4 A;  3M8Q A;  4CGG A;  3SQ0 A;  4M3X A;  1XWL A;  3NDK A;  1LWE A;  3HVR A;  3V9Z A;  4BDP A;  4N41 A;  1GOA A;  3QIN A;  2OPQ A;  2AJQ A;  1QSL A;  1NK8 A;  3OYI A;  4B3O A;  5CZ1 A;  1VSJ A;  3LPU A;  5J1E A;  3WNG A;  3S3M A;  4FZY A;  1S1V A;  3L3U A;  1LV5 A;  3ALY A;  1HQE A;  1Z26 A;  3CYM A;  3AA4 A;  1RDB A;  1C1A A;  1VSH A;  2RF2 A;  5HBM A;  4RW6 A;  4CHQ A;  3PY8 A;  4NYN A;  4DTU A;  3KKS A;  4BDZ A;  4N76 A;  3T1A A;  1RBS A;  2FBT A;  3U6F A;  3CQ8 A;  3D45 A;  3QES A;  3DRP A;  2IDO A;  1C0M A;  4E1M A;  4HCC A;  2HHV A;  1WLJ A;  3BGR A;  3KLG A;  1IKV A;  3K5M A;  1CZ9 A;  3VQ6 A;  3SV4 A;  1NK9 A;  1HYZ A;  1SL2 A;  1QQC A;  1RT3 A;  5J2M A;  3AVJ A;  3SYZ A;  3C6U A;  2IAJ A;  2HMI A;  1YTA A;  1ASU A;  4CJV A;  4E3S A;  3SUN A;  1S9G A;  3DOL A;  1ZBI A;  3C6T A;  3ITH A;  2WON A;  5FRO A;  3OJS A;  3AO1 A;  2HHW A;  3IS9 A;  3FFI A;  3I0R A;  3ZT3 A;  4M41 A;  3SUQ A;  1U4B A;  3VQE A;  3IAY A;  4OLA A;  4CJE A;  4KFB A;  5SZT A;  3PO5 A;  1C1B A;  4CES A;  4DU4 A;  3TAF A;  4CEA A;  4M42 A;  2YNG A;  4FM1 A;  3LAL A;  1NJY A;  1TKZ A;  4E0D A;  3TI0 A;  3QO9 A;  3VQ8 A;  1W0H A;  3AO4 A;  4CGJ A;  2D0C A;  4E7K A;  4DTO A;  3QLH A;  1TAQ A;  1NJX A;  3NCI A;  2OA8 A;  2GBZ A;  4K8Z A;  4HVJ A;  2ZQB A;  4AHU A;  1A5V A;  4CER A;  4E7I A;  5K14 A;  4BWM A;  1BL3 A;  1KVA A;  4FLV A;  3NGZ A;  3PV8 A;  4ICL A;  4CEF A;  4DQS A;  1SKR A;  2KFN A;  3DLG A;  4L8R B;  4B9L A;  3AO5 A;  4NCA A;  3CM6 A;  3P1G A;  3CG7 A;  4FM2 A;  3PX6 A;  2Y1I A;  4DF8 A;  1MU2 A;  1S6P A;  3VQQ A;  4CGD A;  4KI4 A;  1L3T A;  3HP6 A;  1ZBF A;  3MXM A;  3V1O A;  5DMR A;  4FJ7 A;  3VQ5 A;  2HNY A;  3TAM A;  1YVU A;  3AVK A;  4CFC A;  1DLO A;  4N47 A;  5I42 A;  4C8K A;  1TV6 A;  4LSN A;  4OJR A;  3V1Q A;  1TAU A;  3OYC A;  4W5Q A;  5KGX A;  3G0Z A;  3OYK A;  3HK2 A;  2OZM A;  3M8R A;  3A2F A;  4O55 A;  3AVC A;  3IG1 A;  3HP9 A;  3OYG A;  1D9D A;  5HRN A;  3WNH A;  3QEI A;  1O1W A;  4DTJ A;  3LAN A;  1HYS A;  3NH2 A;  1REV A;  1HJR A;  1ASW A;  2HVI A;  1VSD A;  2YHB A;  1B9F A;  4DFP A;  3NHG A;  4NCB A;  2F8T A;  3OS2 A;  4QAG A;  3PUF A;  4M3Y A;  4CHN A;  4WE1 A;  3ZSO A;  1RT7 A;  2OZS A;  1QHT A;  3RRG A;  4F2S A;  1RCH A;  3SUO A;  1IG9 A;  1LWF A;  4JLH A;  3SUP A;  3SNN A;  4KKO A;  3L2U A;  2YNF A;  4FJH A;  2BAN A;  4IFV A;  3TR8 A;  3TAR A;  3B6O A;  3H08 A;  1QSY A;  2E6M A;  4CJP A;  2QK9 A;  4MFB A;  4XIU A;  1TL3 A;  4B9S A;  4Z0U A;  2EHG A;  3LWM A;  3HPG A;  4DLE A;  1U47 A;  4W5O A;  4FXD A;  3TAG A;  4CHP A;  1KFD A;  3K58 A;  5FRN A;  3V81 A;  3AVA A;  4I2P A;  4M3W A;  1JLC A;  1ASV A;  1L3V A;  3O4N A;  4HCB A;  1WAF A;  3MED A;  2FBY A;  1RTH A;  1RBU A;  4FZX C;  4C8O A;  1WSE A;  1KSP A;  3L2Q A;  1L3S A;  4CFA A;  3SCX A;  3F73 A;  1ITG A;  4AHT A;  4GMJ B;  3PX0 A;  1RTJ A;  3WNE A;  5CYQ A;  4CCH A;  2HHU A;  3ZCM A;  4FW2 A;  1DTT A;  1JL1 A;  3O3H A;  3VQ9 A;  5HRS A;  1SKS A;  4Z4C A;  3QEP A;  4Y1D A;  1TK8 A;  1WSI A;  3DLR A;  4CK3 A;  1B92 A;  3P5J A;  4FLX A;  4Z4F A;  4ZTJ A;  3SQ1 A;  2DTU A;  4LD0 A;  3LWL A;  2LSN A;  3VQD A;  4JS5 A;  3TAB A;  2Y1J A;  4Q0B A;  1EKE A;  4AHS A;  4R5P A;  3ZT2 A;  3K5N A;  1WN7 A;  1IKW A;  3PX4 A;  4F3T A;  2P5O A;  1S1T A;  2Z1H A;  4BAC A;  2XY5 A;  3SPZ A;  1YTU A;  1JL2 A;  1GOC A;  2O4I A;  3CFO A;  1CXQ A;  1JLE A;  1IKX A;  2BE2 A;  1KRP A;  1EX4 A;  4Z4G A;  3AVN A;  1HMV A;  4KPY A;  1YT3 A;  3AA5 X;  4FJ5 A;  2OPP A;  4RW8 A;  4DTN A;  2B6A A;  4DSL A;  2KZZ A;  1X1P A;  4GVM A;  4RG8 A;  2HVH A;  4PQU A;  4DFK A;  4DTR A;  4FJL A;  3KLI A;  1UA0 A;  3NF9 A;  4RW7 A;  4C8N A;  1QSS A;  1WSF A; 
#chains in the Genus database with same CATH topology
 3CPW M;  3DLK A;  4BRQ A;  1G99 A;  3MDQ A;  1I3A A;  4LF5 K;  3TSQ A;  4CFD A;  3NF7 A;  3THY B;  4PA1 A;  3CCL N;  3A0I X;  3TAP A;  4H03 B;  3HO1 A;  2UYT A;  1QVF M;  1DKG D;  4EHU A;  2Z1G A;  1UAX A;  3E9L A;  3VET A;  2F96 A;  4LF7 K;  1DGK N;  1J9A A;  5AZJ B;  4IEI A;  4H4M A;  5AZI A;  2A41 A;  5BRD A;  3SAF A;  3J7Y P;  4CVN E;  2GWK A;  3F9K A;  2R7Y A;  1RGI A;  1MWM A;  4H5V A;  4DQQ A;  4DR7 K;  1LW2 A;  4NCG A;  3ZSQ A;  4FJG A;  3QML A;  3ATV A;  3ZT4 A;  4EIA A;  1J6Z A;  4O8K A;  5CR4 A;  4JK8 A;  2VGM A;  3L2W A;  2EX3 A;  5AQZ A;  5CZ2 A;  2FXU A;  3SZ2 A;  3QEW A;  3K59 A;  1ZXO A;  4N5S A;  4CZL A;  1D5A A;  1TKX A;  3K57 A;  1KLM A;  5H1S Q;  3O3G A;  2QWL A;  3AAQ A;  3HPO A;  1NM1 A;  4BDY A;  1NOY A;  2Q2R A;  3THV A;  1SL0 A;  1HLU A;  1IH7 A;  2B5J A;  4HHT A;  4E89 A;  2KFZ A;  1EET A;  4Z4H A;  4CJ3 A;  3OW2 M;  3S3O A;  2ZE2 A;  1VQP N;  4JD2 B;  5AQH A;  4K8X A;  5C0Y A;  2YNI A;  4IJN A;  3CM5 A;  4M45 A;  2DPN A;  3O5B A;  3AVF A;  4PL7 A;  1NLV A;  3DYA A;  5M1Q A;  1CXU A;  3M6G A;  2HB5 A;  4FWK A;  2ZD1 A;  1HNV A;  2RKI A;  3C6A A;  1BGX T;  4B08 A;  1XHX A;  2BGG A;  2QW9 A;  1IKY A;  3WEE A;  1SV5 A;  4OPH A;  1Z25 A;  4BC4 A;  2E5L K;  1B9D A;  1RT1 A;  4C1N I;  3O3F A;  2ATQ A;  1D8Y A;  4Y1C A;  1NK5 A;  1X9M A;  1S3X A;  3SBG A;  3LZI A;  2RN2 A;  3VEX A;  4FM0 A;  3UKU B;  3FZH A;  4J2B A;  2I7P A;  3KHY A;  4CJT A;  3HI0 A;  3ZT0 A;  3QET A;  2OPR A;  1WBB A;  1TK5 A;  4EZ6 A;  3LAK A;  4KH5 A;  4BR0 A;  1QQM A;  2D1K A;  4DV0 K;  5BPM A;  4BRM A;  1VSE A;  2ZM6 K;  4KRF A;  4LH5 A;  2Z1J A;  4AH9 A;  2O8C B;  4FLT A;  3VF4 A;  4FJ8 A;  3ID8 A;  2O4G A;  1BI4 A;  4CF9 A;  4O0J A;  2E4L A;  4CIF A;  2O8E B;  1X3N A;  2KQ2 A;  4L3Q A;  5AQL A;  4FLU A;  1XC9 A;  4IBN A;  4WQ5 A;  3KZB A;  5T7B A;  4HUE A;  3N4Q A;  5E26 A;  4CK1 A;  1VQN N;  1GLB G;  2UXD K;  2VCP A;  2VYP A;  4LF9 K;  1Q81 O;  1YXQ A;  3HVT A;  2XRI A;  2V52 B;  5C42 A;  1V4S A;  5AQG A;  4PUO A;  5F1X A;  2NRZ A;  4NLB A;  5F2R A;  3HTV A;  4YY3 K;  2GUI A;  4CEO A;  4GKJ K;  4FW1 A;  4IOC L;  3AGK A;  4DTX A;  4BY9 C;  2QEX N;  1JLQ A;  3QER A;  4LFA K;  1BG3 A;  4KAZ A;  2W6L A;  3OYM A;  3PO4 A;  3OYL A;  3SAH A;  3CCQ N;  1S5J A;  4B9N A;  1RBV A;  2P9I A;  3FFK B;  3EEQ A;  1A5X A;  3VER A;  2CH5 A;  4CJ5 A;  3DOK A;  3RWU A;  3ZSW A;  1WOQ A;  4YDU C;  1N5Y A;  2IIR A;  3BY5 A;  4CGF A;  3VEY A;  3LZJ A;  4LF4 K;  4M7X A;  4GNI A;  4LF6 K;  3VGK A;  4I6M A;  3L2V A;  2QKK A;  5C15 A;  3DLB A;  2F8S A;  1K9M O;  4BG8 A;  1C6V A;  4IG0 A;  1NGI A;  2P9U B;  4DB3 A;  5AQV A;  5KI6 A;  1JCE A;  1U6Z A;  5JLH A;  4DV7 K;  4FYD A;  2P9P A;  2X6N A;  3EN9 A;  2VG6 A;  3OYE A;  4B9T A;  3C7N B;  3NVM A;  3DM2 A;  4KTZ A;  5ADX H;  3W0L A;  1K73 O;  1J53 A;  1HNI A;  3WNF A;  5BRF A;  2KLA A;  2GV9 A;  1VQL N;  2CGL A;  1TYQ A;  3OYA A;  2A6A A;  3SJJ A;  2P9P B;  5HRO A;  3O9T A;  3NFA A;  4BE1 A;  3CJ9 A;  4DSE A;  1NGA A;  1DTQ A;  3NAE A;  4E1N A;  1IV0 A;  1ZC6 A;  2RPI A;  3WXK A;  3CC2 N;  2X74 A;  4BQL A;  5C10 A;  3CIP A;  3P39 A;  2X78 A;  3J81 O;  5AQY A;  4ZTF A;  1TYQ B;  2NZT A;  2W6K A;  3AVM A;  1XNR K;  2RHK A;  3M5R A;  4KI6 A;  1J5E K;  4I9Q A;  1WNS A;  1T44 A;  4BWJ A;  4PWD A;  4RW4 A;  2AA4 A;  2DFH A;  1ZBU A;  2IVP A;  2AP1 A;  3MWT A;  4C8L A;  3O1B A;  1HNX K;  3QFU A;  4CHO A;  2A42 A;  3CJB A;  1CZB A;  3O9S A;  4KHS A;  1C0U A;  5AQJ A;  4JI4 K;  1K8K A;  5AQU A;  5KTQ A;  4X66 K;  5GIP A;  4DLG A;  3S9H A;  4HUG A;  4M3U A;  1YF5 L;  4YOR A;  3M8S A;  4A57 A;  3A5L C;  3E01 A;  4XH5 A;  3SQ0 A;  4PL8 A;  5LMN K;  3HVR A;  2OPQ A;  2AJQ A;  4LFB K;  5CZ1 A;  3CCE N;  4GV6 A;  4FZY A;  2IVO A;  1JCF A;  5LJW A;  1LV5 A;  3ALY A;  4DV5 K;  2A3Z A;  3ID6 A;  4UY8 O;  4C1N K;  1VSH A;  4FSV A;  2RF2 A;  3KKS A;  4IOX A;  3D45 A;  3DRP A;  3QBW A;  5BN8 A;  3SAG A;  3BGR A;  1IKV A;  1CZ9 A;  1MA9 B;  3VQ6 A;  4FWQ A;  3SV4 A;  5J2M A;  3AVJ A;  3EL2 A;  1ASU A;  5KQ8 A;  4E3S A;  4LFC K;  4NXM K;  1S9G A;  1ZBI A;  4BVP A;  5FRO A;  1SQK A;  3IS9 A;  3FFI A;  3CET A;  3ZT3 A;  4M41 A;  5BN9 A;  2FSK A;  4G9Z A;  3CJA A;  5BR8 K;  3SMS A;  4CES A;  2ZJP L;  4DU4 A;  3TAF A;  3CJ1 A;  3M1F A;  3C6H A;  4CEA A;  3THW A;  4M42 A;  3LAL A;  4BGB A;  4JI7 K;  3QO9 A;  3P4I A;  3VQ8 A;  4E7K A;  3R3L A;  1NJX A;  3NCI A;  4NXN K;  4K0K K;  1Q82 O;  4E7I A;  3WXI A;  4B1Y B;  3NGZ A;  3PV8 A;  5M1O A;  4B9L A;  3EZW A;  2VQE K;  4H5T A;  4FM2 A;  3VF6 A;  3CCU N;  2HHH K;  3VQQ A;  1HX1 A;  4KI4 A;  3Q7C A;  4FJ7 A;  3DXK B;  4FO0 A;  4X62 K;  1TV6 A;  4OJR A;  3BF3 A;  1N33 K;  3WQT A;  3G0Z A;  3MN7 A;  3HP9 A;  3S41 A;  5HRN A;  3WNH A;  2GTD A;  4DV4 K;  2QTD A;  3LAN A;  1NGG A;  4DFP A;  4CBX A;  3NHG A;  3JS6 A;  2P9L B;  4Z94 A;  4F2S A;  3R9P A;  1RCH A;  5AQS A;  3SUO A;  4JLH A;  4BVO A;  4FJH A;  4IFV A;  3TR8 A;  1EWQ A;  3B6O A;  1QSY A;  1OVY A;  1P8Z A;  3TPQ A;  1GLD G;  1OKJ A;  4B1W B;  1U47 A;  3CPE A;  4FXD A;  3TAG A;  3A5M C;  4I2P A;  4M3W A;  1RBU A;  1KSP A;  2HHU A;  5CYQ A;  3MN9 A;  3ZCM A;  3QIC A;  1SKS A;  5HRS A;  4Y1D A;  3DLR A;  1B92 A;  3P5J A;  3J80 O;  4GVE A;  4FLX A;  2LSN A;  3VTH A;  2YHY A;  1EKE A;  4GV3 A;  1IKW A;  5TKY A;  2P5O A;  2FF3 B;  2Z1H A;  4BAC A;  2XY5 A;  1JLE A;  4O8U A;  2ZWH A;  1EX4 A;  3AVN A;  1HMV A;  5TKW A;  3R6M A;  2F9W A;  2OPP A;  3OHR A;  4HWI A;  2KZZ A;  1E4F T;  4K43 A;  2FSJ A;  3E9P A;  4GVM A;  4RG8 A;  4ILH A;  4PQU A;  2HVH A;  3KLI A;  3FZM A;  3FE1 A;  3VQA A;  3U8X A;  2PFU A;  5AQR A;  1KD1 O;  2G8F A;  2OPS A;  3CER A;  3FZL A;  5LY3 A;  4DSK A;  3TAE A;  1VQK N;  1X9W A;  2HBK A;  4DR6 K;  1U2V A;  3C95 A;  3EKU A;  5MLC Q;  3ULE B;  1NGE A;  4CZI A;  1LCU A;  1C1C A;  4FWS A;  1HQU A;  4CEB A;  3D6R A;  4DTM A;  4CF2 A;  3FLC O;  5HLF A;  3RVC A;  4V19 S;  1FK9 A;  4X65 K;  4F4K A;  5AQM A;  2HHS A;  4CGH A;  4WFA L;  3JYT A;  4EZ9 A;  4H5W A;  5GIO A;  2XY6 A;  3LDO A;  2IGI A;  1LAV A;  2E1Y A;  2KTQ A;  5BPL A;  4CED A;  4BG9 A;  3PLA A;  4JN4 A;  1RT6 A;  1RDA A;  1NU0 A;  3KLE A;  3M8P A;  2G8V A;  3GE1 A;  1TKT A;  1U45 A;  1Y97 A;  4NLC A;  3VEZ A;  3KTQ A;  2KZM A;  3JAM O;  3T19 A;  4CJF A;  4I2Q A;  4IZ9 A;  5GAH P;  1VQ8 N;  5M1F A;  3AA3 A;  3CF5 L;  1NGC A;  1QQN A;  3H45 C;  3NGI A;  4ISE A;  1Q86 O;  1S1X A;  4CFB A;  3VQ7 A;  1K8A O;  4B9U A;  2JLE A;  3HRG A;  3D0P A;  4E7L A;  5J2Q A;  2PZS A;  2W41 A;  3S3N A;  2XHB A;  1JJ2 M;  1YUW A;  4RTF D;  2PYJ A;  2FSN A;  1FKP A;  4B1X B;  4DFJ A;  2G8W A;  5KPZ A;  3ZT1 A;  3NH1 A;  5JS1 A;  4FK2 A;  1S6Q A;  4DWI A;  1JCG A;  1HRH A;  4CJ4 A;  2OTL N;  3IMX A;  1RNH A;  3LAM A;  1JXB A;  2HBM A;  1GLE G;  3LPT A;  3HXM A;  1NJI O;  1VQ9 N;  3NVK A;  3LDS A;  1T8E A;  1NK0 A;  4QS8 A;  1DT9 A;  3UB5 A;  4FJK A;  4A59 A;  4M3R A;  3C94 A;  2BDP A;  3LM9 A;  4IG3 A;  1E4G T;  2JWK A;  4OKK A;  3E66 A;  4KRE A;  2E88 A;  2HNZ A;  3WT0 A;  3AVH A;  1NGF A;  1TUU A;  3VEW A;  2QWN A;  1UOC A;  4BRF A;  4JNE A;  3CCR N;  5AQW A;  1GLF O;  4AF1 A;  4DQP A;  2NNW A;  1ATR A;  1VQ5 N;  2EWS A;  4CIE A;  4B3S K;  3AA2 A;  4O4G A;  5AQI A;  3HL8 A;  3THY A;  3I0S A;  5FLX O;  4MO4 A;  5GAE P;  2D5R A;  2B4J A;  1Q9X A;  2P1J A;  3MCA B;  1EWR A;  3B8A X;  3U3G A;  2ZJQ L;  3CC7 N;  5AZJ A;  1X9J A;  4KO0 A;  1TK0 A;  4RCH A;  5I9E B;  4QOZ B;  2PYL A;  3MK6 A;  2D0O A;  4DS5 A;  1TGO A;  4CJL A;  2XO7 A;  3QNN A;  3NMU A;  3CFP A;  1IO2 A;  4FLY A;  3QFP A;  1T3V A;  3VQP A;  5DM7 L;  3BDP A;  5C2F A;  3SK3 A;  3L2R A;  2E2N A;  2HND A;  3ULD A;  4FWP A;  3ASM A;  1S1U A;  4FCY A;  2A5X A;  4IEE A;  2V7Z A;  2HHQ A;  1UWB A;  4CF0 A;  1G15 A;  1BWF O;  4C8M A;  4J2E A;  3O4Q A;  3SV3 A;  1C0G A;  3KLH A;  1TL1 A;  3C65 A;  4IOA L;  1OH5 A;  1XQS C;  1NK4 A;  2BUP A;  3G4S N;  4JD2 A;  3V9S A;  5JS2 A;  3O8M A;  1XI1 A;  3V4I A;  2XY8 A;  2KW4 A;  5EY4 A;  3VQC A;  4Z4E A;  1Z6R A;  3EZ5 A;  4JI5 K;  2A1S A;  4N56 A;  5JMV A;  1KCF A;  2D0P A;  4BRO A;  3VGL A;  1C0T A;  1RBT A;  3RMB A;  2G8I A;  5C24 A;  2QM1 A;  3SJH A;  3H3N O;  1NOZ A;  3OBW A;  2D4W A;  1IBM K;  2QWR A;  3ZX0 A;  3HOT A;  1J5O A;  3A5O C;  3VA0 A;  5BPN A;  1BO5 O;  4WQ4 C;  4DCH A;  1C0F A;  5E41 A;  2JGU A;  3VMF B;  4EAH D;  3HPH A;  5FPN A;  4OVL A;  4NO7 A;  5CYM A;  3EYZ A;  1JXE A;  3OJU A;  3UKU A;  2WTU A;  4AIL C;  4KHU A;  2DY4 A;  4H0X B;  5IWA K;  3IFR A;  4CW7 B;  1IBK K;  3VQB A;  3VES A;  4BE0 A;  1NNE A;  3D2E B;  1EO1 A;  1WSH A;  2O8C A;  4BRH A;  1WSG A;  4A61 A;  4UQG A;  3ZSR A;  4FJ9 A;  2HHX A;  4CF1 A;  5BRH A;  2O8E A;  3ZEU B;  4LF8 K;  1N8R O;  5C12 A;  3OS1 A;  3QIP A;  1QS4 A;  4JHD A;  3MWP A;  3WQU A;  4CEC A;  4DF4 A;  3OYD A;  3TTC A;  4Q5V A;  4DSF A;  3HM8 A;  1YIT N;  3VEO A;  1T6C A;  2ITG A;  4E7H A;  3P83 D;  1NG9 A;  2G8K A;  1OVQ A;  4FPB A;  4JHD B;  2YJE A;  2IS3 A;  4YDU A;  2WBN A;  1LWE A;  1GOA A;  4YOX A;  3C0B A;  1QSL A;  1W97 L;  3LDN A;  1VSJ A;  2HF4 A;  3S3M A;  1XC3 A;  1HQE A;  1Z26 A;  5FPE A;  3CHW A;  4B1U B;  4RW6 A;  4NYN A;  2P9N B;  2YJF A;  3DAW A;  4N76 A;  1RBS A;  2FBT A;  3U6F A;  3CQ8 A;  3O9R A;  3QES A;  3P38 A;  1ESV A;  2IDO A;  1C0M A;  3PIP L;  4HCC A;  3KLG A;  1XMQ K;  2OTJ N;  2NRH A;  1HYZ A;  1N32 K;  1RT3 A;  2HMI A;  1YTA A;  3SUN A;  2QWM A;  5M1P A;  1M1K O;  3LDP A;  3VQE A;  2P9U A;  2JWL A;  4KFB A;  3IKM A;  3AAP A;  2YNG A;  4MDA A;  1W0H A;  3EE9 A;  3GG4 A;  4DTO A;  3C7N A;  3QLH A;  4JKB A;  4HVJ A;  4AHU A;  5K14 A;  1BL3 A;  3UKR B;  4FLV A;  4ICL A;  4JAX A;  4CEF A;  1YI2 N;  1HKG A;  1SKR A;  3DLG A;  4NCA A;  5JVG L;  4YOT A;  3CG7 A;  2A40 A;  4PHT X;  2Y1I A;  4DR2 K;  3ENH A;  5EOY A;  4CFC A;  1DLO A;  4LSN A;  3V1Q A;  1TAU A;  2BTF A;  3M8R A;  4O55 A;  3IG1 A;  2WUS A;  4DUZ K;  3VTI A;  1HYS A;  1REV A;  1VSD A;  3DXM B;  4NCB A;  4WFB L;  4CHN A;  4WE1 A;  3SMP A;  3ZSO A;  3H1Q A;  4GV9 A;  3IDH A;  5AQQ A;  3SNN A;  3L2U A;  5IT9 O;  3TAR A;  4GY2 B;  2ZGY A;  4XH1 A;  1QHA A;  2KKZ A;  4CI6 A;  4MFB A;  1TL3 A;  3IUC A;  3HPG A;  4DLE A;  2UUB K;  4W5O A;  3CQY A;  4FL9 A;  1KC8 O;  4JI3 K;  3I55 N;  2FBY A;  1RTH A;  4C8O A;  1WSE A;  1L3S A;  2WFB A;  4AHT A;  4GMJ B;  4CCH A;  1DEJ A;  4FW2 A;  1DTT A;  3VQ9 A;  4ILJ A;  1TK8 A;  4CK3 A;  4FOE A;  3LWL A;  2Y1J A;  4Q0B A;  3M3Z A;  1WN7 A;  1VAZ A;  3TTD A;  5E84 A;  2E1Z A;  1JL2 A;  1GOC A;  4ISG A;  5ELZ A;  2O4I A;  1VHX A;  4FWR A;  4LC9 B;  4DR5 K;  4KPY A;  4RW8 A;  4DSL A;  3H3O B;  1UA0 A;  4CHQ A;  3PX6 A;  3UE5 A;  3OYF A;  4MQ3 A;  2YHX A;  1RDC A;  2Q0U A;  4JKG B;  2QXF A;  3MMV A;  1S9E A;  1FW6 A;  2P5G A;  3I8D A;  1U48 A;  2H3G X;  2P9K B;  4GW6 A;  3LM2 A;  1GLA G;  5KRT A;  5C25 A;  4JKE A;  2V51 B;  1RFQ A;  5HOO A;  2YHA A;  4A5B A;  3MEC A;  1BCM A;  4KHW A;  3SBT A;  1O13 A;  1XHZ A;  3CJC A;  3KJV A;  3H46 O;  1NBW A;  3U4L A;  1YHQ N;  3CCM N;  3VN5 A;  4BGA A;  1CLQ A;  3CD6 N;  1VSF A;  4M63 C;  4IJA A;  1LW0 A;  1XMO K;  4A5A A;  4WYB A;  3PIO L;  3P31 A;  4DSI A;  1W2B M;  3RR7 A;  3DXK A;  5SWM A;  1ZYQ A;  3QIO A;  4H5R A;  4FLZ A;  2D0B A;  4IFY A;  1NJW A;  2P9L A;  1JLG A;  3AVL A;  4YHH K;  4FJM A;  4F8R A;  4DR4 K;  2DFE A;  4DS4 A;  3L8B A;  2FC0 A;  4CF8 A;  3TAN A;  3G71 N;  2XY7 A;  1BA1 A;  1BIZ A;  1EP4 A;  1L5U A;  4E1J A;  1WSJ A;  1KTQ A;  4CEZ A;  5CHI A;  1LWC A;  4ID5 A;  3KK3 A;  3E1Y A;  1JKH A;  3HOS A;  4FK0 A;  4BQZ A;  3K9K A;  3J7Z O;  3D2F B;  3G25 A;  4DQ8 A;  1WB9 A;  1YJ9 N;  3KLF A;  1YVN A;  4KB1 A;  4BR7 A;  1SS6 A;  4AHC A;  2E6L A;  2I7N A;  1U04 A;  3QNO A;  5KRS A;  3CCS N;  3U9D A;  1SL1 A;  1LOT B;  4O44 A;  4JI8 K;  4LSL A;  4DG1 A;  1QZ5 A;  1NWK A;  3RRH A;  1NJZ A;  4CJQ A;  2DFF A;  4MLE A;  3DI6 A;  4YOU A;  4BRN A;  4EFH A;  2Q1N A;  4BRP A;  4BR4 A;  1N34 K;  1SAZ A;  1BCO A;  3B6P A;  4G1Q A;  4W5T A;  1ZBS A;  3BZC A;  3H1V X;  3LP3 A;  1A5W A;  1RT5 A;  5M1N A;  3KKR A;  1BUP A;  2QI2 A;  3AV9 A;  4H4O A;  2VG7 A;  4FJN A;  3JSM A;  4ILG B;  4FVM A;  1VQ4 N;  3F2K A;  3WUH A;  4QS7 A;  3CMA N;  4B1V A;  2Q97 A;  4EP4 A;  4XEI A;  4CZF A;  3ZX3 A;  4E7J A;  3ULE A;  1RDU A;  2WOM A;  5FPD A;  2HOE A;  4MLH A;  4DQI A;  4CGI A;  1QVG M;  4ELV A;  3O08 A;  4IO9 L;  3G6E N;  4DSJ A;  5JLF A;  1QTM A;  3SI6 A;  4PY5 A;  3ISN C;  3MN6 A;  4WFN L;  1VRT A;  5M1K A;  1UA1 A;  3KD5 E;  2YV0 X;  2W42 A;  3O1W A;  3CXC M;  5FRM A;  3HYF A;  3R8E A;  5CE3 A;  4CD1 A;  4BRG A;  3NBP A;  4JV5 K;  3ZX2 A;  4KHY A;  1FKO A;  4AM6 A;  4M7Y A;  2VWK A;  1HUX A;  3RR8 A;  1BA0 A;  3LP0 A;  4FWO A;  1ZBH A;  2VG5 A;  5EX5 A;  4CZK A;  1T05 A;  4YOV A;  3SQ2 A;  3DLH A;  4JI6 K;  4CBU A;  2J4R A;  4JKD A;  3AVG A;  3LP1 A;  2E2O A;  2FBX A;  5F0X A;  3CC4 N;  3OYJ A;  5KGW A;  3K2P A;  1QE1 A;  1EXQ A;  1WBD A;  3V6D A;  2NRW A;  5AQO A;  3K5L A;  3AAR A;  3V9U A;  5D3G A;  4KH6 A;  4H0O A;  3CFR A;  2F4V K;  2NRX A;  3RMA A;  3DLE A;  2YHW A;  4W5R A;  3E9O A;  2ASO A;  4MO5 A;  1M90 O;  5AQN A;  3TAQ A;  1BIS A;  4FJX A;  2NUB A;  5J2P A;  1VSL A;  2YKN A;  4H0V B;  1GLC G;  3RMC A;  5GAD P;  2ZF5 O;  1R0A A;  1OH8 A;  3ENB A;  4I9L A;  3QDK A;  4CIG A;  3V9X A;  5AQF A;  4CJ7 A;  2GEL A;  1S1W A;  4KV8 A;  3IRX A;  1SZ2 A;  3O9U A;  2OCE A;  4J8F A;  4B8C A;  3U3Y A;  3GDQ A;  1JLA A;  2YCH A;  4KHP K;  3I56 N;  1FJG K;  3HST B;  2YKM A;  1S72 N;  1KFS A;  2I5J A;  4CJK A;  3T1Y K;  5J2N A;  4FLW A;  4HUF A;  3ZSZ A;  3DMJ A;  4DHY A;  3R1X A;  2QWP A;  1YJW N;  3AO2 A;  3CCV N;  1HYV A;  4KTW A;  4JKC A;  4DMN A;  1W9H A;  1T7P A;  4J2A A;  3OY9 A;  2QKB A;  5AJ3 K;  3MXJ A;  3I33 A;  4FZZ A;  1VSK A;  3TSU A;  3MEE A;  1Z05 A;  2Q3S A;  2ZGZ A;  4CGG A;  2ASP A;  4M3X A;  4N41 A;  4BDP A;  5AFU A;  1KQS M;  1HNZ K;  4B3O A;  1NK8 A;  3OYI A;  3LPU A;  3MX5 A;  5J1E A;  3VF2 A;  1S1V A;  3L4Q A;  3AY9 A;  3CYM A;  3RSE B;  3PSI A;  3T1A A;  4E1M A;  2HHV A;  2O8F B;  4PKG A;  1WLJ A;  3K5M A;  3AGR A;  3O80 A;  1NK9 A;  2IAJ A;  4GKK K;  3ITH A;  3OJS A;  3AO1 A;  2HHW A;  4H0P A;  4WQ4 A;  3SUQ A;  3IAY A;  4OLA A;  4CJE A;  4H5N A;  5SZT A;  1C1B A;  1NMN A;  4XH4 A;  1NJY A;  1TKZ A;  4E0D A;  5KQD A;  4AQY K;  4FVU A;  5AZI B;  1NGJ A;  4K8Z A;  1A5V A;  3T1H K;  4B3T K;  3WXL A;  1KVA A;  4DQS A;  2KFN A;  3CM6 A;  3P1G A;  2IVN A;  3HP6 A;  3VQ5 A;  4R79 A;  2HNY A;  3TAM A;  5I42 A;  3JXU A;  3OYK A;  4AM7 A;  4BRE A;  3HK2 A;  2OZM A;  1IG8 A;  3A2F A;  3OYG A;  3VOV A;  3ZET A;  4EHT A;  3TSP A;  1O1W A;  4DTJ A;  4QS9 A;  1HJR A;  2HVI A;  3ZYY X;  1KAY A;  2P9S A;  3D2E A;  3PUF A;  4M3Y A;  1V4T A;  1RT7 A;  3RRG A;  3ZET B;  1IG9 A;  3SUP A;  3ZEU A;  5LMU K;  5DM6 L;  3H08 A;  2E6M A;  4CJP A;  2P9S B;  4F9O A;  3HBT A;  3DLL L;  3DWL A;  3LWM A;  3BF1 A;  4CHP A;  5FRN A;  3K58 A;  1VQ7 N;  4B9Q A;  1JLC A;  3O4N A;  2VQF K;  1YJN N;  3MED A;  3SCX A;  3F73 A;  3BP8 A;  3WNE A;  2QA4 N;  2WC9 A;  3H6E A;  3O3H A;  1JL1 A;  4B3R K;  4K42 A;  1EQY A;  2CGJ A;  3WEE B;  4Z4F A;  3QB0 A;  2DTU A;  4LD0 A;  3Q7B A;  3TAB A;  2V7Y A;  1QQO A;  2YX6 A;  4R5P A;  3I8B A;  2ZJR L;  2P9N A;  1S1T A;  3SPZ A;  3CFO A;  1CXQ A;  4B1Z A;  1IKX A;  3KVG A;  5KPR A;  3OBY A;  3AA5 X;  1BOT O;  4B3M K;  2FLO A;  4BRC A;  4RW7 A;  3T69 A;  4C8N A;  1QSS A;  1WSF A;  1RT4 A;  1YIJ N;  1Q8I A;  1RDW X;  4PKH A;  3LP2 A;  1RT2 A;  1KVB A;  1BI4 B;  1L3U A;  1LAW A;  2CH6 A;  3FZF A;  4J2D A;  1ATN A;  4JKF A;  4LY7 A;  4NB4 A;  3AVI A;  1SKW A;  1GLJ O;  5HRP A;  4KHN A;  3EE8 A;  2NRT A;  2IOC A;  1RBR A;  4IDH A;  4JRQ A;  4OKE A;  1OH6 A;  1MWK A;  3O6W A;  3DRR A;  3UKR A;  3HM9 A;  3CQX A;  3DRS A;  4BRI A;  2G8H A;  4K41 A;  3T3F A;  1HR0 K;  4BC2 A;  3O9Q A;  4OLB A;  3F5T A;  3N4P A;  2UU9 K;  1TKD A;  4WQ5 C;  3OYB A;  2PBD A;  3HT3 A;  4HTL A;  4O5B A;  4OX9 K;  2GEM A;  2YI1 A;  2HMP A;  3NF8 A;  3V1R A;  3OYH A;  5FDL A;  4BR5 A;  3VA3 A;  5C2D A;  2P9I B;  2UXC K;  4JI1 K;  3OS0 A;  1X3M A;  3L0Q A;  5BR9 A;  4PKI A;  1W7A A;  1BU6 O;  1F21 A;  3QEX A;  3G10 A;  5AQP A;  1KAX A;  3DXM A;  4DUY K;  4B9M A;  4BRD A;  3HJF A;  3A5N C;  3AVB A;  3EY1 A;  4OPJ A;  3KK1 A;  3QEV A;  4F2R A;  4CEE A;  4ID1 A;  4I6M B;  4H8K A;  2E2P A;  1YAG A;  4FWL A;  4CHZ A;  5FPM A;  3OYN A;  4WF9 L;  1NGH A;  2F9T A;  2NLX A;  4A62 A;  1E3M A;  3L3V A;  4DTP A;  2E2Q A;  4NYF A;  4YNQ A;  4CJS A;  1T6D A;  3MXI A;  4CZG A;  2VGN A;  4TSX A;  4ELT A;  1RTD A;  3VPZ A;  4AHV A;  4U7B A;  4FWN A;  3CCJ N;  2HW3 A;  4F3O A;  4FK4 A;  1BQN A;  1KLN A;  1D4X A;  3K5O A;  4CEQ A;  4E19 A;  3KWG A;  1NK6 A;  4DV1 K;  1VQO N;  4K25 A;  3EO3 A;  4M3Z A;  4CK2 A;  2E8A A;  3KIO A;  1BIU A;  3OVN A;  3CJ7 A;  1VK0 A;  2D0A A;  3FGU A;  3V9W A;  2OYQ A;  4CJU A;  4KHQ A;  1BQM A;  2HBL A;  4JKG A;  4AHR A;  3UIQ A;  1WAJ A;  4FJJ A;  5CY4 A;  2VWJ A;  1VRU A;  2P9K A;  3MCP A;  5JVH L;  5HP1 A;  3FZK A;  5AFU H;  5LJV A;  1K8K B;  3MEG A;  4ISF A;  4OGE A;  1WUA A;  4DU3 A;  4KB0 A;  4IFE A;  2P51 A;  4ELU A;  2BH1 A;  2A1R A;  3BEX A;  2HHT A;  4KBO A;  4YOY A;  1VQ6 N;  1K6Y A;  2ASM A;  4RWT A;  1U49 A;  4ZHR A;  1NKC A;  4RW9 A;  4OGC A;  4IO8 A;  4CZM A;  1N6Q A;  3TWH A;  2ETJ A;  4DU1 A;  1BDG A;  4IXC A;  3MX2 A;  4JYA K;  5EU7 A;  4Z4I A;  1ATS A;  1TVR A;  3T7Z A;  3WXJ A;  5B8H A;  3AO3 A;  1I94 K;  4QCL A;  3NE6 A;  1VSM A;  2KHO A;  3NH0 A;  1KXP A;  3EKS A;  5LL6 Z;  4HTU A;  2Z1I A;  1VQM N;  1NGD A;  3MAQ A;  2UXB K;  1HPZ A;  2FBV A;  2PY5 A;  3CME N;  1JLF A;  1NK7 A;  2IC3 A;  3PSF A;  4A2A A;  3SLC A;  5BRE A;  3VEV A;  5GIN A;  3ZSX A;  1ILY A;  1BHL A;  1HNW K;  2E20 A;  2GWJ A;  4CHY A;  1T03 A;  5AR0 A;  3GL1 A;  3QBX A;  4WCE L;  2HST A;  4X64 K;  3THW B;  4DFM A;  1NKB A;  3F9M A;  3SPY A;  4B9V A;  3RTV A;  3D2F A;  2FF6 A;  1NKE A;  1I39 A;  4BC3 A;  3RMD A;  4JRP A;  1HKC A;  4JS4 A;  1Q9Y A;  4OKJ A;  4YFU A;  4DTS A;  2ITM A;  3KD1 E;  2QWQ A;  1D9F A;  4BRL A;  1J54 A;  3KK2 A;  5I3U A;  1MDU B;  4KTQ A;  4DV3 K;  1JLB A;  4FJI A;  3ZSV A;  1P90 A;  4CZH A;  5AQK A;  2G8U A;  3SQ4 A;  2O8B A;  1FXX A;  3A8Y A;  4JI0 K;  1X9S A;  4W5N A;  2Q31 A;  1KAZ A;  4CJW A;  4H0T B;  4BR9 A;  4LH4 A;  3KK7 A;  4O0I A;  4JKH A;  2PAV A;  3NF6 A;  3GBT A;  1NMD A;  1RIL A;  2O8B B;  2NRR A;  1IJJ A;  2Q36 A;  2VWB A;  4CJR A;  2W40 A;  3ZLJ A;  1GOB A;  2X6S A;  4BE2 A;  2YNH A;  3O4W A;  3TTF A;  4JI2 K;  3TU5 A;  4IDK A;  4B8A B;  3ATU A;  4JEP A;  1RTI A;  2QXL A;  1VSI A;  3FR0 A;  5DK5 A;  4IKF A;  4CZE A;  3D7E O;  2UUC K;  4DQR A;  3ZSY A;  1KVC A;  4EP5 A;  1RDD A;  3NGY A;  5HRR A;  1ZBL A;  4M3T A;  4CE9 A;  1R59 O;  1SUQ A;  4I7F A;  3VEN A;  4OPK A;  3VQ4 A;  3M8Q A;  1XWL A;  3NDK A;  3V9Z A;  3QIN A;  1HPM A;  3WNG A;  2GUP A;  4FWM A;  3J7A P;  3L3U A;  4OO1 J;  2F7T A;  4DR1 K;  2Q0R A;  3AA4 A;  1RDB A;  1C1A A;  3PY8 A;  5HBM A;  4DTU A;  4BDZ A;  5GAG P;  4U67 L;  4A2B A;  5A2Q O;  3W3D A;  3ENO A;  3HZ6 A;  1CZA N;  4C23 A;  4MDB A;  1S22 A;  4BRA A;  2UUA K;  1OH7 A;  1SL2 A;  1HKB A;  1QQC A;  2HBJ A;  4KH4 A;  3SYZ A;  3C6U A;  4CJV A;  1XUP O;  3KWI A;  3DOL A;  3C6T A;  2WON A;  2NRV A;  1XNQ K;  3HSC A;  3WXM B;  3I0R A;  4BC5 A;  4JK7 A;  1U4B A;  1U2V B;  3PO5 A;  3VGM A;  5AQT A;  2QWO A;  3LL3 A;  4FM1 A;  3DJC A;  3TI0 A;  3AO4 A;  4CGJ A;  2D0C A;  4CZJ A;  4BR2 A;  4CBW A;  3L4I A;  1TAQ A;  1Y64 A;  2GBZ A;  2OA8 A;  2ZQB A;  4IWV A;  4CER A;  4BWM A;  1HJO A;  4L8R B;  3AO5 A;  3LDL A;  4O5F A;  4DF8 A;  1MU2 A;  1S6P A;  1N36 K;  4CGD A;  1L3T A;  1ZBF A;  3MXM A;  3V1O A;  5DMR A;  1Q18 A;  4C8K A;  1YVU A;  3AVK A;  4N47 A;  4FPA A;  3OA9 A;  5ADX A;  3OYC A;  4W5Q A;  1NGB A;  5KGX A;  4DR3 K;  3AVC A;  1H1V A;  1D9D A;  3J8A A;  3QEI A;  4Y0W A;  3NH2 A;  1ASW A;  2YHB A;  3GOI A;  1B9F A;  5KPT A;  4YOW A;  3BZK A;  2F8T A;  3OS2 A;  4QAG A;  4DKW A;  2OAN A;  3BUZ B;  3L6Q A;  2OZS A;  1QHT A;  3K0S A;  1LWF A;  1QZ6 A;  4JKA A;  4KKO A;  2YNF A;  2BAN A;  2O8D A;  2QK9 A;  3K9J A;  4XIU A;  4B9S A;  4Z0U A;  2EHG A;  4H0Y B;  5JIC A;  2RE2 A;  1KFD A;  3V81 A;  3AVA A;  1L3V A;  1ASV A;  4HCB A;  1WAF A;  2O8D B;  1GLL O;  3THX A;  4JK9 A;  2GX9 A;  4FZX C;  3L2Q A;  4CFA A;  1ITG A;  3PX0 A;  1RTJ A;  3U9Z A;  4FOI A;  3OTO K;  5AQX A;  4Z4C A;  3MN5 A;  3QEP A;  1TUY A;  1WSI A;  4CD3 A;  1Q7Y O;  5HL7 L;  4ZTJ A;  3SQ1 A;  3THX B;  3LDQ A;  3VQD A;  4JS5 A;  2HF3 A;  3RSE A;  4AHS A;  3ZT2 A;  3K5N A;  3PX4 A;  4F3T A;  2CGK A;  3CI5 A;  1YTU A;  1IBL K;  5EVZ A;  4BRK A;  1KRP A;  2BE2 A;  4Z4G A;  4DV6 K;  2O8F A;  5EXW A;  1YT3 A;  4FJ5 A;  4DTN A;  2B6A A;  1X1P A;  4OPA A;  4DFK A;  4DTR A;  4FJL A;  3NF9 A;  4DV2 K; 
#chains in the Genus database with same CATH homology
 1RT4 A;  3OYF A;  4MQ3 A;  3DLK A;  1Q8I A;  1RDC A;  2G8F A;  3LP2 A;  1I3A A;  2QXF A;  1RT2 A;  1KVB A;  2OPS A;  1BI4 B;  1L3U A;  1LAW A;  1S9E A;  2P5G A;  4J2D A;  3I8D A;  3TAE A;  1U48 A;  4DSK A;  1X9W A;  4GW6 A;  4CFD A;  3NF7 A;  4LY7 A;  1SKW A;  3AVI A;  3C95 A;  4PA1 A;  3HO1 A;  3TAP A;  5HRP A;  4KHN A;  5KRT A;  2Z1G A;  1UAX A;  5C25 A;  2IOC A;  1RBR A;  2F96 A;  2YHA A;  3MEC A;  1BCM A;  1C1C A;  4JRQ A;  4KHW A;  1HQU A;  4CEB A;  1XHZ A;  1J9A A;  3KJV A;  4H4M A;  4DTM A;  4CF2 A;  5HLF A;  4OKE A;  1FK9 A;  4F4K A;  3DRR A;  3F9K A;  2R7Y A;  2HHS A;  3VN5 A;  3HM9 A;  4DQQ A;  1LW2 A;  4CGH A;  3DRS A;  4NCG A;  3ZSQ A;  4FJG A;  3JYT A;  2G8H A;  3T3F A;  4EZ9 A;  1CLQ A;  1VSF A;  2XY6 A;  3ZT4 A;  2IGI A;  1LW0 A;  1LAV A;  2KTQ A;  3L2W A;  4OLB A;  4DSI A;  4CED A;  1TKD A;  3RR7 A;  2EX3 A;  3OYB A;  5CZ2 A;  3HT3 A;  4O5B A;  3SZ2 A;  3QEW A;  1RT6 A;  3K59 A;  1RDA A;  3V1R A;  3NF8 A;  5SWM A;  3KLE A;  4N5S A;  1ZYQ A;  3OYH A;  5FDL A;  3QIO A;  3M8P A;  2G8V A;  1D5A A;  1TKX A;  3K57 A;  4FLZ A;  3VA3 A;  2D0B A;  1TKT A;  3OS0 A;  1KLM A;  1U45 A;  1Y97 A;  2KZM A;  3KTQ A;  1F21 A;  4IFY A;  3T19 A;  3O3G A;  3QEX A;  1NJW A;  3G10 A;  4CJF A;  3HPO A;  4I2Q A;  4BDY A;  4B9M A;  1NOY A;  1JLG A;  3AVL A;  3HJF A;  3THV A;  4FJM A;  3AA3 A;  1SL0 A;  1IH7 A;  4F8R A;  2B5J A;  3AVB A;  4HHT A;  2DFE A;  3NGI A;  3EY1 A;  4E89 A;  4OPJ A;  3L8B A;  3KK1 A;  4DS4 A;  2KFZ A;  1EET A;  3QEV A;  1S1X A;  4CEE A;  2FC0 A;  4CF8 A;  4CFB A;  4Z4H A;  3TAN A;  4CJ3 A;  4F2R A;  4ID1 A;  3VQ7 A;  3S3O A;  4H8K A;  2ZE2 A;  2XY7 A;  4B9U A;  4K8X A;  2YNI A;  2JLE A;  4E7L A;  3D0P A;  1BIZ A;  5J2Q A;  3CM5 A;  4M45 A;  1EP4 A;  3S3N A;  1L5U A;  2XHB A;  1WSJ A;  1KTQ A;  2PYJ A;  3AVF A;  4CEZ A;  1FKP A;  1LWC A;  3DYA A;  4DFJ A;  1CXU A;  4ID5 A;  4CHZ A;  3KK3 A;  2G8W A;  1JKH A;  3ZT1 A;  3NH1 A;  2HB5 A;  4FK0 A;  3OYN A;  5JS1 A;  4FK2 A;  1S6Q A;  4DWI A;  3L3V A;  1HRH A;  2ZD1 A;  4DTP A;  4CJ4 A;  1HNV A;  2RKI A;  1RNH A;  3LAM A;  3KLF A;  4KB1 A;  1JXB A;  1BGX T;  4NYF A;  4AHC A;  2E6L A;  4B08 A;  4YNQ A;  3LPT A;  4CJS A;  1U04 A;  1XHX A;  3HXM A;  3QNO A;  3MXI A;  2BGG A;  4TSX A;  4ELT A;  1IKY A;  1SV5 A;  4AHV A;  5KRS A;  1Z25 A;  3LDS A;  1SL1 A;  1T8E A;  4O44 A;  1NK0 A;  4F3O A;  1B9D A;  1RT1 A;  2HW3 A;  4FK4 A;  1BQN A;  1KLN A;  3O3F A;  4FJK A;  2ATQ A;  3K5O A;  1D8Y A;  4Y1C A;  4M3R A;  4CEQ A;  4E19 A;  3C94 A;  1NK5 A;  1X9M A;  4LSL A;  4DG1 A;  1NK6 A;  2BDP A;  3RRH A;  1NJZ A;  4CJQ A;  3LZI A;  2DFF A;  4IG3 A;  2RN2 A;  3DI6 A;  4FM0 A;  4OKK A;  4J2B A;  4KRE A;  2HNZ A;  3AVH A;  4M3Z A;  4CJT A;  4CK2 A;  3ZT0 A;  1BCO A;  3B6P A;  3QET A;  2OPR A;  1UOC A;  4G1Q A;  4W5T A;  1TK5 A;  4EZ6 A;  3LP3 A;  3LAK A;  3KIO A;  1BIU A;  3OVN A;  1A5W A;  3VQA A;  1RT5 A;  3KKR A;  1VK0 A;  3AV9 A;  1VSE A;  2D0A A;  4DQP A;  4LH5 A;  4KRF A;  3V9W A;  2OYQ A;  2Z1J A;  4H4O A;  2VG7 A;  4AH9 A;  4CJU A;  1BQM A;  4FJN A;  4KHQ A;  3JSM A;  4FLT A;  4AHR A;  3UIQ A;  4FJ8 A;  4FVM A;  2O4G A;  4CIE A;  1BI4 A;  1WAJ A;  4CF9 A;  4O0J A;  2E4L A;  4FJJ A;  3AA2 A;  4CIF A;  4O4G A;  5CY4 A;  2VWJ A;  1VRU A;  3HL8 A;  4EP4 A;  3I0S A;  5HP1 A;  2KQ2 A;  2D5R A;  2B4J A;  4IBN A;  4FLU A;  1XC9 A;  2P1J A;  1Q9X A;  5T7B A;  4HUE A;  4E7J A;  4CK1 A;  3MEG A;  4OGE A;  3U3G A;  4DU3 A;  3HVT A;  2XRI A;  2WOM A;  4KB0 A;  4KO0 A;  5C42 A;  1TK0 A;  4DQI A;  2P51 A;  4ELU A;  4CGI A;  4PUO A;  4QOZ B;  2PYL A;  4ELV A;  2A1R A;  4DSJ A;  1RTD A;  2HHT A;  1QTM A;  3SI6 A;  1K6Y A;  4PY5 A;  2GUI A;  4DS5 A;  3ISN C;  1TGO A;  4CEO A;  1U49 A;  4ZHR A;  4FW1 A;  4CJL A;  4RW9 A;  1NKC A;  4OGC A;  2XO7 A;  3QNN A;  4DTX A;  1VRT A;  1UA1 A;  1N6Q A;  3KD5 E;  1JLQ A;  3QER A;  2YV0 X;  3TWH A;  2W42 A;  2ETJ A;  4DU1 A;  4KAZ A;  5FRM A;  3HYF A;  3CFP A;  1IO2 A;  4FLY A;  5EU7 A;  4Z4I A;  3OYM A;  1TVR A;  3NBP A;  3PO4 A;  3AO3 A;  3VQP A;  3OYL A;  3BDP A;  3L2R A;  1S5J A;  4B9N A;  1RBV A;  2HND A;  4KHY A;  4QCL A;  3NE6 A;  3ULD A;  1A5X A;  3ASM A;  1S1U A;  1FKO A;  4CJ5 A;  1VSM A;  4FCY A;  3DOK A;  3RWU A;  3ZSW A;  3NH0 A;  2HHQ A;  2VWK A;  4HTU A;  1UWB A;  2Z1I A;  4CF0 A;  3RR8 A;  1G15 A;  3LP0 A;  1N5Y A;  4C8M A;  4CGF A;  4J2E A;  2VG5 A;  3O4Q A;  3SV3 A;  1ZBH A;  1T05 A;  3KLH A;  3MAQ A;  3SQ2 A;  1TL1 A;  3LZJ A;  3DLH A;  1HPZ A;  2FBV A;  2PY5 A;  3AVG A;  1JLF A;  1NK7 A;  3LP1 A;  1NK4 A;  2IC3 A;  3L2V A;  3V9S A;  2FBX A;  2QKK A;  3ZSX A;  5JS2 A;  1BHL A;  3DLB A;  2F8S A;  1XI1 A;  3V4I A;  2XY8 A;  2KW4 A;  1C6V A;  4Z4E A;  3VQC A;  4IG0 A;  4CHY A;  3OYJ A;  3EZ5 A;  1T03 A;  2A1S A;  5KGW A;  3K2P A;  1QE1 A;  1EXQ A;  4N56 A;  5KI6 A;  1KCF A;  4DFM A;  3V6D A;  1NKB A;  3K5L A;  5D3G A;  3V9U A;  4FYD A;  1C0T A;  1RBT A;  3SPY A;  2X6N A;  3RMB A;  3RTV A;  2VG6 A;  4B9V A;  5C24 A;  3OYE A;  4B9T A;  2G8I A;  1NOZ A;  3DM2 A;  4KTZ A;  1NKE A;  1I39 A;  3CFR A;  3RMD A;  1J53 A;  1HNI A;  3WNF A;  2PZS A;  4JRP A;  4JS4 A;  1Q9Y A;  4OKJ A;  1J5O A;  3RMA A;  4YFU A;  4DTS A;  2GV9 A;  3KD1 E;  3VA0 A;  3DLE A;  4W5R A;  1D9F A;  1J54 A;  3OYA A;  3KK2 A;  3TAQ A;  5I3U A;  4KTQ A;  1BIS A;  3SJJ A;  1JLB A;  5HRO A;  3ZSV A;  2NUB A;  5J2P A;  3NFA A;  4BE1 A;  4FJI A;  5E41 A;  1VSL A;  2YKN A;  2JGU A;  4DSE A;  3RMC A;  2G8U A;  3SQ4 A;  1R0A A;  1DTQ A;  3HPH A;  4OVL A;  4I9L A;  3NAE A;  4FJX A;  1FXX A;  4CIG A;  5CYM A;  4E1N A;  3V9X A;  2RPI A;  3EYZ A;  1JXE A;  4CJW A;  1X9S A;  4W5N A;  3OJU A;  1S1W A;  2X74 A;  4KV8 A;  3IRX A;  4AIL C;  4KHU A;  4B8C A;  3U3Y A;  2X78 A;  4LH4 A;  2DY4 A;  4O0I A;  1JLA A;  4ZTF A;  3AVM A;  3NF6 A;  3VQB A;  3HST B;  4KI6 A;  2YKM A;  1KFS A;  1RIL A;  2I5J A;  1WNS A;  4I9Q A;  4CJK A;  4BWJ A;  4BE0 A;  5J2N A;  4FLW A;  4HUF A;  4CJR A;  3ZSZ A;  3DMJ A;  4PWD A;  1GOB A;  4RW4 A;  1WSH A;  2X6S A;  4BE2 A;  2DFH A;  2YNH A;  1WSG A;  1ZBU A;  3AO2 A;  4IDK A;  3ZSR A;  1HYV A;  4KTW A;  4B8A B;  4UQG A;  4FJ9 A;  4CF1 A;  2HHX A;  4C8L A;  4CHO A;  1RTI A;  4DMN A;  1CZB A;  1W9H A;  1T7P A;  4KHS A;  1C0U A;  1VSI A;  3OS1 A;  4J2A A;  5DK5 A;  3QIP A;  1QS4 A;  3OY9 A;  4IKF A;  4CEC A;  4DQR A;  3ZSY A;  5KTQ A;  4DF4 A;  1KVC A;  4EP5 A;  3OYD A;  1RDD A;  2QKB A;  3NGY A;  4Q5V A;  4DLG A;  4DSF A;  3S9H A;  3MXJ A;  5HRR A;  1ZBL A;  4FZZ A;  4M3T A;  2ITG A;  4CE9 A;  4HUG A;  1VSK A;  1SUQ A;  4M3U A;  3M8S A;  4E7H A;  3P83 D;  3MEE A;  2G8K A;  4I7F A;  2Q3S A;  3E01 A;  4OPK A;  2IS3 A;  3VQ4 A;  3M8Q A;  4CGG A;  3SQ0 A;  4M3X A;  1XWL A;  3NDK A;  1LWE A;  3HVR A;  3V9Z A;  4BDP A;  4N41 A;  1GOA A;  3QIN A;  2OPQ A;  2AJQ A;  1QSL A;  1NK8 A;  3OYI A;  4B3O A;  5CZ1 A;  1VSJ A;  3LPU A;  5J1E A;  3WNG A;  3S3M A;  4FZY A;  1S1V A;  3L3U A;  1LV5 A;  3ALY A;  1HQE A;  1Z26 A;  3CYM A;  3AA4 A;  1RDB A;  1C1A A;  1VSH A;  2RF2 A;  5HBM A;  4RW6 A;  4CHQ A;  3PY8 A;  4NYN A;  4DTU A;  3KKS A;  4BDZ A;  4N76 A;  3T1A A;  1RBS A;  2FBT A;  3U6F A;  3CQ8 A;  3D45 A;  3QES A;  3DRP A;  2IDO A;  1C0M A;  4E1M A;  4HCC A;  2HHV A;  1WLJ A;  3BGR A;  3KLG A;  1IKV A;  3K5M A;  1CZ9 A;  3VQ6 A;  3SV4 A;  1NK9 A;  1HYZ A;  1SL2 A;  1QQC A;  1RT3 A;  5J2M A;  3AVJ A;  3SYZ A;  3C6U A;  2IAJ A;  2HMI A;  1YTA A;  1ASU A;  4CJV A;  4E3S A;  3SUN A;  1S9G A;  3DOL A;  1ZBI A;  3C6T A;  3ITH A;  2WON A;  5FRO A;  3OJS A;  3AO1 A;  2HHW A;  3IS9 A;  3FFI A;  3I0R A;  3ZT3 A;  4M41 A;  3SUQ A;  1U4B A;  3VQE A;  3IAY A;  4OLA A;  4CJE A;  4KFB A;  5SZT A;  3PO5 A;  1C1B A;  4CES A;  4DU4 A;  3TAF A;  4CEA A;  4M42 A;  2YNG A;  4FM1 A;  3LAL A;  1NJY A;  1TKZ A;  4E0D A;  3TI0 A;  3QO9 A;  3VQ8 A;  1W0H A;  3AO4 A;  4CGJ A;  2D0C A;  4E7K A;  4DTO A;  3QLH A;  1TAQ A;  1NJX A;  3NCI A;  2OA8 A;  2GBZ A;  4K8Z A;  4HVJ A;  2ZQB A;  4AHU A;  1A5V A;  4CER A;  4E7I A;  5K14 A;  4BWM A;  1BL3 A;  1KVA A;  4FLV A;  3NGZ A;  3PV8 A;  4ICL A;  4CEF A;  4DQS A;  1SKR A;  2KFN A;  3DLG A;  4L8R B;  4B9L A;  3AO5 A;  4NCA A;  3CM6 A;  3P1G A;  3CG7 A;  4FM2 A;  3PX6 A;  2Y1I A;  4DF8 A;  1MU2 A;  1S6P A;  3VQQ A;  4CGD A;  4KI4 A;  1L3T A;  3HP6 A;  1ZBF A;  3MXM A;  3V1O A;  5DMR A;  4FJ7 A;  3VQ5 A;  2HNY A;  3TAM A;  1YVU A;  3AVK A;  4CFC A;  1DLO A;  4N47 A;  5I42 A;  4C8K A;  1TV6 A;  4LSN A;  4OJR A;  3V1Q A;  1TAU A;  3OYC A;  4W5Q A;  5KGX A;  3G0Z A;  3OYK A;  3HK2 A;  2OZM A;  3M8R A;  3A2F A;  4O55 A;  3AVC A;  3IG1 A;  3HP9 A;  3OYG A;  1D9D A;  5HRN A;  3WNH A;  3QEI A;  1O1W A;  4DTJ A;  3LAN A;  1HYS A;  3NH2 A;  1REV A;  1HJR A;  1ASW A;  2HVI A;  1VSD A;  2YHB A;  1B9F A;  4DFP A;  3NHG A;  4NCB A;  2F8T A;  3OS2 A;  4QAG A;  3PUF A;  4M3Y A;  4CHN A;  4WE1 A;  3ZSO A;  1RT7 A;  2OZS A;  1QHT A;  3RRG A;  4F2S A;  1RCH A;  3SUO A;  1IG9 A;  1LWF A;  4JLH A;  3SUP A;  3SNN A;  4KKO A;  3L2U A;  2YNF A;  4FJH A;  2BAN A;  4IFV A;  3TR8 A;  3TAR A;  3B6O A;  3H08 A;  1QSY A;  2E6M A;  4CJP A;  2QK9 A;  4MFB A;  4XIU A;  1TL3 A;  4B9S A;  4Z0U A;  2EHG A;  3LWM A;  3HPG A;  4DLE A;  1U47 A;  4W5O A;  4FXD A;  3TAG A;  4CHP A;  1KFD A;  3K58 A;  5FRN A;  3V81 A;  3AVA A;  4I2P A;  4M3W A;  1JLC A;  1ASV A;  1L3V A;  3O4N A;  4HCB A;  1WAF A;  3MED A;  2FBY A;  1RTH A;  1RBU A;  4FZX C;  4C8O A;  1WSE A;  1KSP A;  3L2Q A;  1L3S A;  4CFA A;  3SCX A;  3F73 A;  1ITG A;  4AHT A;  4GMJ B;  3PX0 A;  1RTJ A;  3WNE A;  5CYQ A;  4CCH A;  2HHU A;  3ZCM A;  4FW2 A;  1DTT A;  1JL1 A;  3O3H A;  3VQ9 A;  5HRS A;  1SKS A;  4Z4C A;  3QEP A;  4Y1D A;  1TK8 A;  1WSI A;  3DLR A;  4CK3 A;  1B92 A;  3P5J A;  4FLX A;  4Z4F A;  4ZTJ A;  3SQ1 A;  2DTU A;  4LD0 A;  3LWL A;  2LSN A;  3VQD A;  4JS5 A;  3TAB A;  2Y1J A;  4Q0B A;  1EKE A;  4AHS A;  4R5P A;  3ZT2 A;  3K5N A;  1WN7 A;  1IKW A;  3PX4 A;  4F3T A;  2P5O A;  1S1T A;  2Z1H A;  4BAC A;  2XY5 A;  3SPZ A;  1YTU A;  1JL2 A;  1GOC A;  2O4I A;  3CFO A;  1CXQ A;  1JLE A;  1IKX A;  2BE2 A;  1KRP A;  1EX4 A;  4Z4G A;  3AVN A;  1HMV A;  4KPY A;  1YT3 A;  3AA5 X;  4FJ5 A;  2OPP A;  4RW8 A;  4DTN A;  2B6A A;  4DSL A;  2KZZ A;  1X1P A;  4GVM A;  4RG8 A;  2HVH A;  4PQU A;  4DFK A;  4DTR A;  4FJL A;  3KLI A;  1UA0 A;  3NF9 A;  4RW7 A;  4C8N A;  1QSS A;  1WSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...