3VQ4A

Fragments bound to hiv-1 integrase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
152
structure length
144
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 48
structure length 144
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vq4A00
3O4QA 3QEVA 3I0RA 1NOZA 3NF7A 3OS2A 2IGIA 3MXMA 4CFBA 3S9HA 3LPUA 1TGOA 3D0PA 4CF0A 1VSHA 1A5WA 3VQBA 3WNGA 4KTZA 4KHUA 3L3UA 4IG0A 2HHTA 4CEQA 3LDSA 4ZTJA 2FBVA 3NDKA 1X9MA 2QKKA 1RT3A 3ZSVA 4FW1A 1J53A 3SQ2A 5J2MA 3SV3A 2ETJA 1EX4A 1I39A 1TKZA 4AH9A 3L2QA 4B9TA 1D8YA 1S1WA 1U45A 2OZSA 1GOAA 1RBRA 2YKMA 1HYSA 1S5JA 1SKSA 3PX6A 1HQUA 2Z1JA 5JS2A 2LSNA 1DTTA 4RW4A 1YTAA 3OYKA 3K5MA 5J2NA 5SZTA 4LSLA 4B08A 2OYQA 4FXDA 1A5XA 3OYMA 1D9FA 1HQEA 5DK5A 1DTQA 2RF2A 3VQ6A 3VQ9A 5J2PA 1KRPA 4DSLA 5KTQA 1I3AA 3AA3A 2PZSA 4CHYA 2BDPA 5HROA 3WNHA 5KRSA 4Z0UA 2PY5A 3MEDA 2KFNA 3D45A 1S6PA 4CK3A 1G15A 1NJZA 1F21A 2Y1IA 3IG1A 4HUEA 4CHPA 3MECA 1REVA 4DTXA 4Z4IA 4CERA 2HHUA 4FJJA 1YT3A 3L2RA 3C95A 2FBTA 1RBUA 5HRNA 3EY1A 1UA1A 4L8RB 4WE1A 2W42A 3ZT0A 3HXMA 4PY5A 3LAKA 4CJPA 3HVTA 3UIQA 4RW7A 1QHTA 3O3HA 4CJKA 2KTQA 3IAYA 4FLTA 3TARA 2NUBA 3KLEA 1LAWA 3AVGA 2OPSA 4Q5VA 1JKHA 2X74A 4JLHA 4MFBA 3SZ2A 1IKVA 4CK1A 3ZT4A 3TAPA 1KFSA 4DG1A 3IS9A 4DTSA 3TAQA 1L5UA 1RDBA 4BE2A 1TV6A 4KTWA 2G8VA 4CK2A 3KD1E 4KPYA 4CFDA 2ZE2A 4BDYA 1TVRA 3SUQA 2D0BA 1C0MA 4CJFA 4DS5A 3NHGA 1B9FA 1WSEA 4EP4A 4W5TA 4DQQA 1U47A 1VSJA 3AVHA 4DU3A 4BWJA 2ZD1A 3JSMA 4CF2A 3AVCA 1Z26A 3OYFA 3FFIA 3SJJA 1S1TA 1TKTA 2XHBA 4BE1A 4KO0A 1XHZA 3AVIA 3DRRA 2EX3A 3CFPA 4Z4EA 1JLEA 1BIZA 1WLJA 2KQ2A 3LP2A 3OYHA 1LW2A 4DTPA 1LV5A 1JLBA 1VSFA 4JRPA 4DLEA 1IH7A 3F73A 3AVKA 3SPZA 3U3YA 4CIFA 2A1SA 5D3GA 4I9LA 2VWKA 3TWHA 2DFEA 2ATQA 3V4IA 2BGGA 3AVAA 4CEOA 3KK1A 3C6TA 1WNSA 3NAEA 3ZCMA 4M3RA 4B9LA 2KZMA 1BQMA 4E7HA 4N47A 1KVAA 4FM2A 3VQDA 1L3VA 1WSGA 2P51A 4HCBA 4CJEA 4DF4A 1EETA 4K8ZA 4HUFA 4CCHA 3L3VA 1KVCA 4B9VA 4OKEA 3CFOA 2G8WA 3NH2A 3M8PA 3DLGA 2OPQA 5I42A 1NKEA 4B9UA 3AV9A 4DQRA 4C8OA 4N76A 1LW0A 4CJSA 2FBYA 3BDPA 3SQ4A 1U4BA 4CEFA 2HMIA 1SL1A 4IG3A 1BI4B 3DYAA 3VN5A 1UOCA 4KKOA 1TL1A 3QERA 4J2EA 1KCFA 1VRUA 4CGDA 5CZ2A 4AHRA 2OPRA 4HUGA 4DFJA 4F2RA 1J54A 3MEEA 2Q3SA 1HNIA 4ELVA 3ZSXA 4NCAA 2XRIA 4CIEA 3K5NA 3LP3A 3SQ1A 4M3TA 1K6YA 3SPYA 3TAGA 3KD5E 4M42A 3SUNA 4RW9A 1L3TA 1VRTA 3C6UA 4N41A 4QOZB 3QNOA 4C8LA 4Z4HA 4OPKA 3THVA 2F96A 2GV9A 1XC9A 1RBVA 3VQCA 1ZBIA 4KRFA 2HHXA 4DSIA 4O5BA 1N6QA 4OPJA 4XIUA 2X6NA 4ZTFA 2D0CA 5HP1A 3QEIA 3NH1A 2XY5A 4ZHRA 2PYLA 3RWUA 4LH5A 4CF9A 1S6QA 1QQCA 3WNFA 4KV8A 3RRHA 2HNYA 4NCGA 1Q9YA 4PWDA 3V6DA 2QXFA 2O4IA 1Q8IA 5CY4A 4KI6A 4FZYA 1RTHA 3U3GA 3LZIA 4W5NA 4J2AA 4E7JA 3V9ZA 3RTVA 3HVRA 3OS0A 3OYAA 3JYTA 3DRSA 4CJ4A 3LP0A 1B92A 3SQ0A 4BWMA 5C25A 2VWJA 1NJWA 1RT6A 2G8UA 2VG7A 3KTQA 3KLIA 4OKJA 5J1EA 1RT5A 3SYZA 4BDZA 3M8QA 4M45A 1RILA 3AVJA 1ASVA 1GOBA 4LY7A 1QSYA 3V1QA 4DLGA 3AA5X 3VQ5A 4KHQA 1RT1A 4AHTA 4CJWA 3PY8A 1T03A 3DLBA 1C0UA 1HPZA 5HRSA 4FJIA 3HPHA 4CFCA 2AJQA 4NYNA 3RMAA 5SWMA 3K5LA 4GMJB 2E4LA 4QAGA 3EYZA 2KFZA 4AHSA 4CEZA 4F3TA 3NGIA 1EP4A 1FXXA 2R7YA 3HYFA 2HVHA 1NK6A 1UAXA 3OYNA 1WAFA 1NK7A 1RNHA 5DMRA 1RTIA 4CHNA 4J2BA 3KLFA 4QCLA 3L2WA 3L2VA 3NF9A 3P1GA 1QTMA 2YKNA 3KKSA 4C8MA 4E1MA 3HT3A 3C94A 2G8HA 1T05A 3ZSWA 4CJRA 1Z25A 4CFAA 2QK9A 1Y97A 3HJFA 1ITGA 3CM5A 3MEGA 3O3GA 3OYLA 1JLGA 1S1XA 5FRMA 3OS1A 3ZSRA 1BIUA 4AHCA 5KRTA 4KB0A 2XY8A 1HYVA 3AA4A 4CF1A 3TANA 2PYJA 4Y1DA 3TAMA 4DMNA 1TK8A 4Y1CA 5J2QA 3V9SA 1RDDA 4CIGA 3NGYA 1D5AA 4OGEA 4FLZA 1NK8A 4E89A 4DSKA 4ELUA 3OYGA 1CZ9A 3P5JA 4E7KA 1QSLA 1WSHA 3T19A 4CJUA 4KI4A 4K8XA 4FM1A 3QNNA 1SKWA 5CYQA 3I0SA 4EZ6A 1CXQA 1LWFA 5C24A 3VQ8A 3VQEA 1EXQA 4CEEA 1TAUA 4RW8A 1T8EA 3DI6A 4CGFA 1C6VA 3NF8A 2JLEA 3ALYA 3U6FA 3OYCA 4DS4A 1L3UA 3OVNA 3V1RA 4OLAA 1QSSA 1XWLA 2Z1HA 3ISNC 1RT7A 4B9NA 4W5RA 3HM9A 4DWIA 1SV5A 2WOMA 4CJ3A 1BGXT 2FBXA 5CZ1A 4DTJA 1J5OA 3DLHA 3PO4A 1C1CA 1WSJA 2I5JA 4DTNA 2X6SA 4DQIA 3HO1A 2P5OA 4FCYA 5HRPA 4ELTA 1WSFA 3PX0A 2P1JA 2YNGA 1FKPA 3DLKA 4M3ZA 1X1PA 3KLHA 3AO2A 4PA1A 3OY9A 3SNNA 1DLOA 3ZSYA 4HCCA 1VSMA 3QEWA 4O55A 1IKXA 1CXUA 1VSKA 3NCIA 3K57A 3PX4A 2F8SA 2XO7A 4CEAA 3LAMA 4H4OA 4E7LA 1RBSA 1KFDA 2FC0A 4RG8A 4CGJA 2DFFA 2G8FA 1FK9A 4FJKA 2G8IA 4FJHA 3B6OA 3RMBA 3QO9A 4Z4GA 2HW3A 2Z1IA 4PUOA 4BACA 4KREA 1O1WA 1BHLA 2HHSA 4JS5A 5T7BA 4FJXA 4AHVA 3NBPA 2B5JA 1NJXA 4E1NA 3CG7A 4FJGA 1RDAA 3M8SA 3RMCA 4EP5A 1WN7A 3VQQA 2F8TA 2B6AA 3ULDA 4HTUA 1BL3A 4CF8A 1QE1A 1EKEA 1XI1A 2HB5A 3AVLA 1JXEA 4DTMA 3V81A 1JL1A 1SL0A 2WONA 2YNFA 4OJRA 4KHSA 4FJMA 4CJVA 4DFKA 1KVBA 3OYIA 3RMDA 4CGGA 1TL3A 3LANA 4HVJA 4RW6A 3KKRA 3T1AA 3CFRA 1RCHA 1XHXA 4W5OA 1C1BA 5KGXA 3L2UA 2OPPA 3DLRA 4FLYA 5C42A 4DTOA 4H4MA 3SV4A 2IOCA 4FJNA 1X9WA 2IAJA 4KHWA 4E19A 2HHVA 5JS1A 1NK5A 1A5VA 4CE9A 1ZBUA 1BCOA 3VA0A 4E7IA 5I3UA 1ASWA 3G0ZA 4I2QA 4UQGA 4I7FA 4MQ3A 1ASUA 4N5SA 4KHYA 1U49A 3PUFA 2VG5A 3AO5A 4I2PA 3TABA 4FK0A 2JGUA 2RPIA 2IS3A 3CQ8A 4DFMA 4O4GA 1L3SA 1VSLA 4FK4A 4O0IA 3SI6A 4B9SA 2HNZA 2YHAA 4O44A 4IBNA 4FVMA 3HP9A 3ZT1A 4W5QA 4BE0A 3G10A 1YTUA 3CYMA 2RN2A 3LPTA 3E01A 1U04A 4H8KA 1NK0A 1HMVA 3ZSQA 4B8AB 3VQAA 4DSJA 5E41A 5KI6A 3O3FA 3HL8A 1JXBA 1RBTA 1NKCA 1RT2A 1BQNA 5K14A 3DRPA 3QIPA 3ZT2A 3K59A 4F3OA 3VQ4A 1BI4A 2EHGA 3S3NA 1VSDA 2D0AA 4N56A 1IKYA 2X78A 3HPOA 3V9WA 4EZ9A 2DTUA 3KIOA 3P83D 4CGIA 2OA8A 1SKRA 1BCMA 3QIOA 4LD0A 2DFHA 4YNQA 1S1UA 1UA0A 3K2PA 1FKOA 4CJTA 3OYJA 4GVMA 3MAQA 4JRQA 3S3MA 2RKIA 3HPGA 3ZT3A 2DY4A 1TKDA 1S1VA 1HNVA 1U48A 4KAZA 3CM6A 4FJ5A 4DSFA 4DTRA 1WAJA 3MXIA 3NF6A 1SUQA 4LH4A 4O0JA 1CZBA 3LZJA 1NKBA 2ZQBA 1NK9A 4FK2A 3HK2A 1JLFA 4PQUA 4CHQA 3O4NA 4DQPA 4YFUA 3OJSA 4CHOA 4B8CA 3DOLA 1YVUA 2VG6A 1TKXA 3AO3A 3NGZA 3QETA 4ID1A 3PV8A 2KW4A 4DTUA 1IKWA 3SCXA 3AO1A 3A2FA 2A1RA 3AVNA 3HP6A 1NOYA 1S9GA 1KSPA 4IFVA 4FM0A 1IG9A 3F9KA 1N5YA 3QESA 3RR8A 1TK0A 5HLFA 3AO4A 3S3OA 1RDCA 4JS4A 4C8KA 1LAVA 2BANA 1LWCA 1SL2A 4TSXA 3H08A 4FJ9A 4M3XA 4FYDA 3PO5A 4OLBA 4M3YA 4DFPA 1D9DA 1W9HA 2O4GA 3AVMA 2D5RA 3NFAA 3OYDA 3V1OA 1CLQA 1W0HA 1TAQA 4CEBA 1ZYQA 3AVBA 1ZBHA 3VQ7A 4CJLA 3QEXA 1J9AA 2IDOA 4DU1A 1Q9XA 1RTJA 4R5PA 1JLQA 1RT4A 4FLWA 3MXJA 4CJQA 4FW2A 4IKFA 1UWBA 1MU2A 2HVIA 3V9XA 1ZBFA 1HYZA 3ZSZA 4CJ5A 4CEDA 3NH0A 3M8RA 2ITGA 1X9SA 1KLNA 4B3OA 2YV0X 1BISA 1RTDA 3KJVA 3TAFA 3EZ5A 1R0AA 4NCBA 1HRHA 4KFBA 3LALA 4E3SA 3TI0A 2P5GA 3SUOA 1LWEA 1NK4A 2G8KA 3T3FA 4FZZA 1C0TA 4OGCA 2E6MA 4F4KA 2IC3A 1ZBLA 4M3UA 3HSTB 3OJUA 5HRRA 3DMJA 4I9QA 2XY7A 3LWLA 3LWMA 2OZMA 3WNEA 4F2SA 2KZZA 3K5OA 4BDPA 4IDKA 1C1AA 1B9DA 4FJ7A 4ICLA 3OYEA 3VA3A 2YHBA 3QLHA 4Q0BA 4DU4A 3KK2A 1IO2A 4OKKA 3VQPA 3NE6A 2GUIA 4AHUA 4KB1A 3RR7A 3TAEA 2QKBA 3I8DA 4DSEA 5CYMA 4B9MA 1WSIA 4C8NA 4FLUA 1KLMA 4FZXC 2E6LA 1TK5A 2HHQA 3SUPA 3LP1A 4AILC 4CGHA 4KTQA 4M3WA 3K58A 3BGRA 4Z4FA 3KLGA 4LSNA 1VSEA 1S9EA 4IFYA 4M41A 3DOKA 5HBMA 2HHWA 4DF8A 4Z4CA 3AA2A 3DLEA 1VSIA 4G1QA 1QS4A 4E0DA 3RRGA 4FLXA 1HJRA 1JLCA 5KGWA 3L8BA 1KTQA 2Y1JA 2YNIA 4NYFA 4F8RA 4GW6A 3IRXA 3ZSOA 4HHTA 3TR8A 3B6PA 1T7PA 4CHZA 3KK3A 4CESA 4FJ8A 1GOCA 1VK0A 2YNHA 3AVFA 5EU7A 3OYBA 4J2DA 5FRNA 2B4JA 4ID5A 4KHNA 4CECA 3QEPA 5FROA 3DM2A 2Z1GA 1JLAA 2XY6A 4FJLA 4OVLA 5FDLA 3ASMA 1JL2A 2HNDA 3ITHA 4DQSA 2BE2A 1NJYA 4FLVA 3V9UA 3QINA 2GBZA
chains in the Genus database with same CATH superfamily
3O4QA 3BF1A 3QEVA 3R9PA 4ILJA 3NF7A 3D2FA 2BH1A 4CF0A 3WEEB 4L3QA 4JI1K 3VQBA 3WNGA 3VGMA 3BF3A 3L3UA 2HHTA 4YOTA 1ZC6A 4CEQA 2QKKA 3OBWA 2O8EA 1J53A 1V4TA 1D8YA 2OZSA 1S5JA 3PX6A 1XNQK 1HQUA 2Q1NA 3AGRA 1DTTA 1YTAA 3K5MA 2OYQA 4C1NI 1DTQA 5GAEP 4WQ5A 5J2PA 4FPBA 2P9UB 4BR2A 2GWJA 1OH6A 2PZSA 5HROA 4IZ9A 2PY5A 3MEDA 4XEIA 1OVQA 2KFNA 4CI6A 4LF7K 2WUSA 4GKKK 3FZMA 1F21A 5IT9O 3ID6A 1D4XA 4JKFA 4CHPA 4Z4IA 2YJFA 1X9JA 1YT3A 2FBTA 4JV5K 1RBUA 1UA1A 1R59O 3ZT0A 2O8FA 3C6AA 1QHTA 5CE3A 1ESVA 1LAWA 3AVGA 3J8AA 4J8FA 2X74A 3ENBA 1RDBA 1TV6A 3KD1E 3SUQA 4CJFA 4DS5A 3NVMA 2Q36A 4YDUC 3JSMA 3AVCA 1Z26A 1GLDG 3TU5A 3OYFA 1S1TA 4BE1A 1ZXOA 1NGIA 2VCPA 3FZLA 1TYQB 1JLEA 2KQ2A 3QFPA 5CHIA 1LW2A 3E66A 3PSIA 3AVKA 4DR7K 2A1SA 1NJIO 2VWKA 3SLCA 2ATQA 4CEOA 3ATUA 1WBBA 2QWLA 4B9LA 1N34K 3SMPA 2P51A 2FXUA 4HUFA 2VGMA 4B1WB 3L3VA 4B9VA 4OKEA 3CFOA 4B9UA 5LMNK 2OPQA 5F2RA 1LW0A 1U4BA 1SL1A 4IG3A 3DYAA 1TL1A 1MWMA 4LC9B 3LDLA 3EE8A 4CGDA 4F2RA 2OPRA 1J54A 3MEEA 3R3LA 3ZSXA 4NCAA 3ZX3A 3GG4A 3LP3A 2FSJA 4N41A 3JS6A 3QNOA 1XC9A 1N6QA 2RHKA 2D0CA 2QWPA 3RSEA 1NGJA 1S6QA 2QA4N 1BA0A 1QQCA 2V7YA 1Q9YA 4BR7A 3V6DA 5CY4A 4DV1K 3KHYA 3V9ZA 3FZKA 3JYTA 4IOXA 4BDZA 4M45A 3AVJA 1ASVA 1GOBA 1QSYA 3AA5X 2A41A 3P38A 3PY8A 4CJWA 1HPZA 5HRSA 4FJIA 3VMFB 3F5TA 4NYNA 4B1VA 5SWMA 4H0VB 4QAGA 3M3ZA 3SBTA 3NGIA 2YHXA 1UAXA 3IDHA 1NK7A 3TTCA 5DMRA 1RTIA 4MO4A 3U9ZA 3KLFA 4QCLA 5JVGL 1YUWA 2G8HA 3HT3A 4E1MA 1IBMK 3C94A 1T05A 1Z25A 4CFAA 1ITGA 4BVPA 2NNWA 1GLFO 4CZEA 3OS1A 5KRTA 3TANA 4CF1A 4Y1DA 3TAMA 3WEEA 4CIGA 4NO7A 1NK8A 3CJBA 1RDWX 4ELUA 4K25A 3L4IA 3P5JA 4E7KA 5AZIB 2E5LK 4KI4A 4FM1A 4DKWA 4CBUA 1EXQA 3VENA 1TAUA 1WUAA 5ADXH 4CGFA 1C6VA 3NF8A 3U6FA 3ALYA 1YXQA 4DS4A 4OLAA 3OVNA 1QSSA 4JHDB 3CPEA 2WOMA 3LL3A 1J5OA 2P9UA 2ZF5O 1C1CA 1XUPO 2I5JA 2X6SA 4DQIA 3CCQN 3VOVA 4ELTA 3THXA 2YNGA 5LY3A 4DV5K 1FKPA 2H3GX 1NMDA 3AO2A 4HCCA 1CXUA 1VSKA 2F8SA 5GAGP 2FC0A 4RG8A 4CGJA 4FJKA 3FR0A 2HW3A 5AQYA 4BACA 3FLCO 2KLAA 2W40A 5T7BA 3CERA 4FJXA 3CC7N 5AFUH 4AHVA 4FJGA 3CG7A 1RDAA 3RMCA 3AY9A 3D2EA 2B6AA 1QE1A 1XI1A 3U4LA 3V81A 1T3VA 4DCHA 4ILGB 4BR9A 4WQ4A 4CJVA 1KVBA 1I94K 4DV7K 2FSKA 3LANA 1BDGA 5C42A 3SV4A 2IOCA 3ATVA 4MO5A 1X9WA 1LCUA 4CE9A 3VA0A 3EN9A 2A5XA 1NK5A 3WQUA 1ASWA 4K41A 1U49A 2VG5A 3AO5A 3VGKA 5AJ3K 2IS3A 4JK9A 5AQMA 2YHAA 3DXMB 3ZT1A 2RN2A 1NK0A 1W2BM 3VQAA 4DSJA 5E41A 3O3FA 4BGAA 3ZT2A 3WXJA 3K59A 1WBDA 4WFAL 4BC2A 1VSDA 2D0AA 2X78A 4CGIA 2OA8A 3K2PA 4BQZA 3ZT3A 4EHUA 1U48A 4KAZA 4DTRA 1WAJA 3MXIA 3NF6A 4JKAA 4O0JA 2VQFK 1CZBA 3U9DA 1NK9A 4BG8A 3O4NA 4YFUA 2VG6A 3AO3A 1QQMA 5FPNA 2O8CB 3PV8A 1IKWA 2P9PB 3O80A 3AVNA 1BA1A 3AAPA 4H0PA 4FM0A 3T1HK 2HSTA 2D1KA 3S3OA 4JS4A 4XH4A 4C8KA 2P9LB 1LAVA 4O8KA 1SL2A 3H08A 4E1JA 2O4GA 5M1PA 3MN7A 5JLFA 4C1NK 3C0BA 3AVBA 3O9SA 1RGIA 4R5PA 1RT4A 1WB9A 1BUPA 4FW2A 1ZBFA 1HYZA 3ZSZA 4CJ5A 4FWMA 1KLNA 1GLAG 4B3OA 2YV0X 1BISA 1R0AA 3U8XA 3VTHA 4U67L 3LALA 4E3SA 1JCEA 1QZ6A 1ZBLA 4I9QA 1S72N 2KZZA 3D6RA 3WNEA 3K5OA 5HL7L 5FPDA 4IDKA 2A6AA 4ICLA 3OYEA 2YHBA 3VEOA 1HLUA 3FZHA 1IO2A 5JLHA 2F4VK 5AQSA 1X3MA 3I8DA 4DSEA 4B9MA 4C8NA 4FLUA 1QQOA 2QM1A 4MLHA 1KLMA 2QW9A 4FOEA 4AILC 4JHDA 3FE1A 3ENOA 4ISEA 1YF5L 4Z4CA 3DLEA 1VSIA 5C12A 2IIRA 1XMQK 5DM6L 2UUCK 1SQKA 3A5MC 3IRXA 3ZSOA 4HHTA 4CHZA 4CESA 4FJ8A 2YNHA 2NLXA 2V52B 1NWKA 3DM2A 2Z1GA 1JLAA 4QS7A 4FJLA 2BE2A 5AQHA 3PX0A 3I0RA 1K8AO 2FLOA 3OS2A 2PAVA 2QWMA 4CFBA 2A40A 1P8ZA 1TGOA 3D0PA 1VSHA 1A5WA 2HBMA 4KTZA 3SMSA 4M7YA 2NZTA 1T6CA 3LDSA 1X9MA 3ZYYX 4BRFA 1G99A 1VQON 3E1YA 1HYSA 4RW4A 4FXDA 5SZTA 4LSLA 1HQEA 3GDQA 3MWTA 1XNRK 1BWFO 3CQYA 3AA3A 3HSCA 2P9KB 2D4WA 4Y0WA 5KRSA 2ZJRL 2ITMA 1JJ2M 3T69A 4CK3A 1OKJA 3DXMA 2Y1IA 2IVNA 3DXKB 4DR1K 4CERA 4FJJA 4A5BA 3L2RA 4B1XB 3K9KA 3ZX0A 4R79A 4CJPA 3HVTA 3IAYA 2P9IB 2NUBA 4Q5VA 1JKHA 4JLHA 4MFBA 3SZ2A 1IKVA 1Q7YO 3TAQA 3WT0A 4KTWA 1J5EK 4CK2A 4KPYA 4BDYA 4W5TA 4DQQA 3I33A 3AVHA 3ZX2A 2QWQA 1OH5A 2ZD1A 4CF2A 3FFIA 4C23A 4H5RA 2O8CA 4CJ7A 3LP2A 3IUCA 3OYHA 1LV5A 4JYAK 4V19S 4JRPA 3F73A 4CIFA 2PFUA 5EY4A 5D3GA 3TWHA 2DFEA 3V4IA 3C6TA 5BN8A 2P9LA 3NAEA 4M3RA 1QZ5A 3MCPA 1U2VB 4FM2A 1N33K 2O8DB 4DF4A 4CCHA 4DB3A 1KVCA 4AQYK 3P39A 2G8WA 3NH2A 1NKEA 4N76A 3R1XA 4U7BA 3SQ4A 3EO3A 1BI4B 4KKOA 3N4QA 1KCFA 1VRUA 4AHRA 4YORA 3K5NA 3H6EA 1K6YA 1O13A 5AQXA 4RW9A 1L3TA 1VRTA 1ZBIA 4OPKA 4PKIA 1RBVA 3VQCA 1HPMA 2HHXA 4YOUA 4O5BA 3J7YP 4XIUA 4ZTFA 3MN9A 5HP1A 3QEIA 3NH1A 3G71N 1VQ8N 4GV3A 2A3ZA 2HBKA 4CF9A 4NB4A 2UUBK 4KH4A 1C0FA 4NCGA 4PWDA 4BVOA 4KI6A 4J2AA 4Z94A 3RTVA 1NJWA 4CJ4A 3LP0A 3SQ0A 3MK6A 4IEEA 2VWJA 1RT6A 3KTQA 4KBOA 5AQTA 1MA9B 3SYZA 3M8QA 4A5AA 1EO1A 3VEVA 4DLGA 2HBJA 3VQ5A 4KHQA 4AHTA 2UU9K 4BRAA 1IG8A 3M6GA 1NNEA 3B8AX 2AJQA 1TUYA 1HNZK 4AM6A 3K5LA 2EWSA 1FXXA 2R7YA 1WAFA 1QVGM 4DUYK 3HOTA 1QTMA 4KH6A 1Y64A 3CM5A 3MEGA 4BRIA 3O3GA 1SZ2A 1BIUA 3KK7A 4KB0A 2XY8A 3T1YK 3NGYA 1D5AA 5JMVA 4FLZA 2NRTA 4JEPA 5BREA 3CJAA 3QNNA 3O9TA 5BR8K 1IV0A 1VQ6N 1LWFA 2O8BA 4CZJA 1T8EA 3DI6A 5AQLA 2JLEA 3OYCA 2IVOA 2Z1HA 4B9NA 3HM9A 4DWIA 4WQ4C 1SV5A 4CJ3A 1BGXT 2FBXA 4DTJA 3DLHA 1Q82O 3SK3A 4A2BA 3HO1A 5HOOA 1U6ZA 1X1PA 3KLHA 4PA1A 3QEWA 1BU6O 4O55A 3NCIA 4BRNA 4GNIA 2GWKA 1XC3A 1FK9A 4FJHA 2YCHA 4PL8A 1VQ9N 4HWIA 1BHLA 4JS5A 1BO5O 1NJXA 4CZHA 4BRMA 3M8SA 2F8TA 4IOAL 3ULDA 4HTUA 3VF6A 1E4FT 1EKEA 3AVLA 3HRGA 1JXEA 3FGUA 4DTMA 1JL1A 4GY2B 2YNFA 1GLJO 3G25A 4DFKA 5IWAK 4CGGA 1TL3A 4FWLA 3KKRA 4CW7B 4M3ZA 4FLYA 4W5OA 1C1BA 2OPPA 1VQ5N 4LF9K 1YHQN 4FL9A 4H0TB 2HHVA 1A5VA 5H1SQ 5M1KA 4LF4K 5FPMA 3JAMO 5AQWA 4MQ3A 3UE5A 2Q0UA 3PUFA 4I2PA 3LDOA 1NM1A 2RPIA 4BR0A 3CQ8A 4NLCA 5JVHL 4DFMA 1VQ7N 4BREA 1VSLA 3CCLN 1U2VA 4O0IA 4O44A 4IBNA 4W5QA 1YTUA 3LPTA 3E01A 1MDUB 3F2KA 1U04A 3O8MA 4I6MB 4B8AB 2UUAK 3SJHA 4WCEL 3SAGA 3VPZA 3HL8A 1JXBA 4CZLA 4JD2B 3KWGA 3DRPA 3QIPA 1NGFA 5AQQA 5M1NA 1BI4A 2NRHA 5GADP 2DTUA 3GBTA 5BN9A 3QIOA 4LD0A 2DFHA 4YNQA 1S1UA 3UKRA 1FKOA 3TSPA 5C0YA 3WXIA 2RKIA 3CQXA 1M90O 2ZGYA 4DR6K 1SUQA 4FK2A 4LFAK 5KPRA 1NGBA 3O9QA 4CHOA 4B8CA 3DOLA 2FSNA 3BZCA 4ID1A 2KW4A 4BR4A 4DTUA 3AO1A 3A2FA 3AGKA 1S9GA 3RR8A 4H0OA 3AO4A 4CZKA 1RDCA 1HR0K 4BRQA 5EVZA 3CI5A 4M63C 4TSXA 2Q97A 4M3XA 4FYDA 4BGBA 3PO5A 4IXCA 1W9HA 3ULEB 1EQYA 4DV0K 3V1OA 2VQEK 2QI2A 5LJWA 1W0HA 1TAQA 4CEBA 4WYBA 1J9AA 1Q9XA 4DU1A 4FLWA 3ZEUB 4CJQA 1UWBA 5BRDA 3NH0A 3D7EO 3M8RA 2FF6A 1RTDA 3TAFA 2HMPA 4JKEA 3J7AP 4NCBA 4KFBA 3J80O 4JI3K 4DV4K 4CBWA 1NK4A 2IC3A 4IO8A 1Q81O 3NMUA 3VF2A 1B9DA 4FJ7A 3O9RA 4Q0BA 3KK2A 3VQPA 1OH7A 4K42A 3RR7A 5CYMA 3OHRA 2YI1A 2E6LA 3CETA 3O1WA 2HHQA 2D0PA 4CGHA 4A62A 4KTQA 4Z4FA 4A61A 3EE9A 1TYQA 3SAHA 3CMEN 2GX9A 2HHWA 4DF8A 3E9PA 2WBNA 4G1QA 3RRGA 1OVYA 4CZGA 1HJRA 3L8BA 4CVNE 4A2AA 4GW6A 3AVFA 4J2DA 4BY9C 4ID5A 4KHNA 3QEPA 5FROA 2KHOA 2XY6A 4FWSA 3ASMA 2HNDA 1CZAN 4FOIA 3G6EN 4LFBK 3V9UA 3QINA 4BRCA 1NLVA 5KQ8A 1BOTO 3L6QA 1NOZA 3MXMA 3VEYA 3S9HA 3LPUA 4OX9K 3MDQA 1KAYA 4KHUA 4IG0A 1TUUA 4BRPA 1S3XA 4ZTJA 1KAXA 1RT3A 4OPHA 3ZSVA 5C2DA 2ETJA 3PIOL 1I39A 3L2QA 4B9TA 2HVHA 1S1WA 1GOAA 1RBRA 2VGNA 2Z1JA 5JS2A 2LSNA 1A5XA 1D9FA 5DK5A 2RF2A 2NRZA 3VQ6A 3VQ9A 1I3AA 5B8HA 2HF4A 4FPAA 4CHYA 1NGHA 3WNHA 4Z0UA 3VETA 1HNWK 1IBKK 1KD1O 3D45A 1S6PA 1G15A 2NRRA 3E9LA 1FW6A 3IG1A 4HUEA 3MECA 4BG9A 3BUZB 4MDBA 2QTDA 3C95A 4BRDA 1C0GA 1K8KB 5HRNA 3EY1A 3CCMN 2CGKA 4L8RB 3LDQA 4FWQA 3HXMA 4PY5A 4H5TA 3LAKA 4GKJK 1GLEG 2KTQA 3O3HA 4YY3K 4FLTA 4H03B 1NBWA 3CCVN 3KLEA 2OPSA 3TTFA 4YOXA 3M1FA 4CK1A 4DG1A 4DTSA 4BE2A 3OW2M 2G8VA 2GELA 3C6HA 1TVRA 4B1ZA 2D0BA 1C0MA 1WSEA 1U47A 2QWRA 1VSJA 5TKYA 5JICA 4DU3A 3O9UA 4BWJA 4EHTA 4NXMK 3CC4N 3DRRA 2ZJPL 5GIOA 1BIZA 1WLJA 4DTPA 4DLEA 3SPZA 2ASPA 4A59A 4I9LA 5AZIA 2BGGA 3KK1A 3EKUA 1WNSA 4JK7A 4YHHK 1BQMA 4E7HA 3MN5A 3VQDA 3ULEA 1WSGA 3R6MA 3MN6A 4FO0A 4OO1J 2P9NB 2GTDA 3AV9A 4CJSA 2FBYA 2ZJQL 2HF3A 4CEFA 2HMIA 5AQRA 3VN5A 5AZJB 3QERA 4J2EA 3EEQA 4WQ5C 4HUGA 4DFJA 2Q0RA 1NMNA 5KQDA 2Q3SA 2XRIA 2BTFA 4JI6K 3SQ1A 4M42A 3SPYA 3KD5E 1YJ9N 3MWPA 3C6UA 4QOZB 4EAHD 4Z4HA 3IKMA 2CH6A 4EIAA 3THVA 2E2OA 3A5NC 4DSIA 4OPJA 4BRLA 2X6NA 3CPWM 5AQJA 3O4WA 2XY5A 5ELZA 3WNFA 4KV8A 4BQLA 4JKDA 2O4IA 3NVKA 1Q8IA 4IDHA 3TPQA 1RTHA 3LZIA 4XH1A 4E7JA 3OYAA 4DSLA 2HHSA 3DRSA 2G8UA 3QFUA 4BWMA 1HKGA 3KLIA 5J1EA 5C15A 1RT5A 3R8EA 3H3NO 3CIPA 3V1QA 1RT1A 5E26A 2O8FB 1C0UA 4CFCA 1NG9A 4GMJB 2E4LA 3EYZA 4K43A 2KFZA 4F3TA 4CEZA 1EP4A 5AQGA 3HYFA 1NK6A 3HBTA 1RNHA 3HZ6A 4CHNA 4IOCL 3UB5A 3L2WA 1K73O 2YHYA 3C7NB 3Q7CA 4JK8A 3KKSA 1VQKN 1KXPA 2QK9A 1Y97A 5BPNA 1S1XA 5FRMA 3ZSRA 4B1UB 4AHCA 4H0XB 3AA4A 1HYVA 2E2PA 4DMNA 1E3MA 1TK8A 4UY8O 3MX5A 1RDDA 3CF5L 4OGEA 4DSKA 1NGEA 4E89A 3OYGA 1CZ9A 1QSLA 1WSHA 3T19A 3QMLA 4K8XA 1SKWA 5CYQA 4QS9A 4EZ6A 1CXQA 5C24A 3VQEA 2NRXA 2E1YA 3DAWA 3ZETB 4RW8A 1L3UA 3UKUB 1YJWN 1XWLA 3ISNC 4W5RA 5AQUA 5CZ1A 3PO4A 1BG3A 4KH5A 4DTNA 1KC8O 2P9PA 2W41A 2P5OA 4FCYA 5HRPA 1HX1A 1WSFA 1OH8A 2P1JA 2D0OA 4CZIA 1XMOK 2OANA 3ZSYA 3P4IA 4YOVA 1IKXA 3PX4A 1K8KA 2XO7A 3LAMA 1KFDA 2G8IA 3RMBA 3QO9A 4KREA 1O1WA 4BC4A 1KQSM 4DR4K 1WN7A 5LJVA 5M1OA 4CF8A 4DR2K 1RFQA 2HB5A 1W97L 4JN4A 4LFCK 4KHSA 3RMDA 1H1VA 4QS8A 4HVJA 4RW6A 4PL7A 1YITN 1RCHA 1XHXA 3QICA 3L2UA 3DLRA 4H4MA 3F9MA 2VWBA 4KHWA 1ZBUA 5I3UA 4I2QA 3G0ZA 4I7FA 1ASUA 3TABA 4G9ZA 2JGUA 4O4GA 4FK4A 4CZFA 3SI6A 4B9SA 4FVMA 4BE0A 3G10A 3JXUA 3CYMA 4H8KA 4B3SK 3ZSQA 5KI6A 1NKCA 5K14A 4F3OA 4FWPA 5AZJA 4N56A 1IKYA 1SKRA 1BCMA 3MX2A 4CJTA 4CD3A 3DWLA 3MAQA 4JRQA 5BPMA 4JI2K 1K9MO 1TKDA 1S1VA 1HNVA 3CM6A 4DSFA 2E2NA 1NKBA 3LZJA 4LH4A 2ZQBA 3HK2A 4IJNA 1JLFA 4WFNL 4CHQA 4X64K 3SAFA 3OJSA 1NU0A 3H45C 3THYB 3CD6N 1SAZA 3E9OA 2A1RA 1NOYA 4IFVA 4NLBA 3THXB 1N5YA 4ISFA 4H5VA 4JKCA 1LWCA 2YJEA 4AM7A 4BRHA 3VEXA 1ATNA 3I55N 2D5RA 1CLQA 5FLXO 5M1QA 1Z05A 3QEXA 1HJOA 4JKHA 1RTJA 1JLQA 2HVIA 1MU2A 2P9KA 3V9XA 2P9SB 3KJVA 3W0LA 3D2EB 1HRHA 3TTDA 3C7NA 3DXKA 2P5GA 1LWEA 1C0TA 4OGCA 2E6MA 3J7ZO 5F1XA 5BRHA 4M3UA 1QVFM 3OJUA 5HRRA 2UXCK 2WC9A 3DMJA 5AQKA 3O1BA 5KPZA 3LWMA 5AR0A 2P9IA 2F9WA 4B3RK 4BDPA 3N4PA 3QLHA 2E8AA 4DUZK 3NE6A 2RE2A 1WOQA 2GUIA 2QKBA 4FVUA 4CZMA 1WSIA 3ZETA 3LDPA 3UKUA 3LP1A 4FWRA 3K58A 3BGRA 4DV3K 3CCUN 3KLGA 1VSEA 4DV6K 4M41A 3DOKA 3AA2A 4X65K 5GINA 4E0DA 4FLXA 4LF5K 2QXLA 3CC2N 1JLCA 3WXLA 2Y1JA 4XH5A 4F8RA 5BRFA 3QDKA 1T7PA 5FPEA 5EU7A 4RTFD 2B4JA 2NRWA 4CECA 1ILYA 1X3NA 2O8DA 2Q2RA 4OVLA 5FDLA 4DQSA 1JL2A 3ITHA 1N32K 1NJYA 4B3MK 4FLVA 1ZBSA 2GBZA 3W3DA 1HUXA 3PIPL 4RWTA 3OTOK 4BRKA 2IGIA 1VQ4N 3TSQA 4FWKA 4LF8K 4X62K 2I7PA 2FBVA 3NDKA 3ZLJA 4FW1A 1Z6RA 3SQ2A 5J2MA 3SV3A 5AQFA 1EX4A 4AH9A 1TKZA 1YJNN 3O08A 1U45A 2YKMA 1SKSA 3L4QA 1FJGK 3OYKA 4DR3K 5J2NA 2CH5A 3GL1A 4B08A 3OYMA 5AQNA 5I9EB 2AP1A 3KVGA 4MDAA 5KTQA 4CD1A 3HOSA 4ISGA 2BDPA 4HTLA 1NJZA 1V4SA 4JKGB 1MWKA 1REVA 4DTXA 2HHUA 3A5OC 5C10A 2YHWA 2UXDK 1VHXA 3MCAB 4WE1A 2W42A 3ID8A 2UXBK 3UIQA 3CCEN 4RW7A 2DPNA 4CJKA 4KHPK 3BP8A 3TARA 3TAPA 3LDNA 3ZT4A 1KFSA 3TSUA 3IS9A 1L5UA 1GLCG 3BZKA 4CFDA 2ZE2A 1HKCA 2JWLA 3NHGA 1B9FA 4EP4A 4JI5K 3SBGA 5BPLA 3O5BA 5BR9A 3EL2A 3SJJA 2V51B 4DR5K 2XHBA 1TKTA 4KO0A 4YOYA 1XHZA 3AVIA 3CFPA 2EX3A 3OA9A 4Z4EA 4X66K 1EWQA 3L0QA 3THYA 1KRPA 1JLBA 1VSFA 1IH7A 3U3YA 5MLCQ 2Q31A 3AVAA 3WXMB 3BY5A 2GEMA 4B9QA 5LL6Z 3T7ZA 3ZCMA 2KZMA 4N47A 1KVAA 1L3VA 2QWNA 3HI0A 5AQPA 1N8RO 4HCBA 3THWB 4CJEA 1EETA 1EWRA 4K8ZA 4AF1A 3K9JA 3M8PA 3DLGA 5I42A 4C8OA 4DQRA 4YOWA 2UYTA 3BDPA 1HKBA 3KZBA 4DHYA 1UOCA 1DEJA 2P9SA 3ENHA 5CZ2A 4YDUA 4LF6K 1HNIA 2F7TA 4ELVA 3H1QA 3AARA 4JI0K 4CIEA 4M3TA 3J81O 1GLBG 3TAGA 3SUNA 3CCRN 2V7ZA 4C8LA 2WFBA 2F96A 2GV9A 4KRFA 2E1ZA 1RDUA 4JI7K 4BC3A 5LMUK 2CGLA 4DQ8A 4FWOA 4ZHRA 2PYLA 1JCGA 3RWUA 4LH5A 4JKBA 3RRHA 2HNYA 2QXFA 1KAZA 2JWKA 4FZYA 4BR5A 3U3GA 4W5NA 2ZM6K 1M1KO 3HVRA 1NGGA 3H3OB 3OS0A 1B92A 5C25A 2VG7A 4OKJA 3H1VX 3CJ9A 1RILA 3CJCA 4LY7A 4H5NA 4FZZA 4ILHA 1T03A 3DLBA 4O5FA 3HPHA 3MMVA 3HTVA 4H5WA 3PSFA 3RMAA 3I8BA 4JNEA 4AHSA 4PKGA 4B3TK 3HM8A 4K0KK 3OYNA 1DGKN 4J2BA 3L2VA 3NF9A 3P1GA 2YKNA 4C8MA 4I6MA 2YX6A 1VAZA 3ZSWA 4BRGA 4CJRA 3LM2A 3HJFA 3VEZA 3OYLA 4JD2A 1JLGA 3VEWA 4PKHA 1W7AA 4WF9L 2PYJA 5AQIA 4Y1CA 5J2QA 3V9SA 5M1FA 4CJUA 4JAXA 3I0SA 3OBYA 3VQ8A 4CEEA 4CBXA 1VQPN 3V1RA 2OTJN 1DKGD 3BEXA 5GAHP 1RT7A 2HBLA 4MLEA 2QEXN 3DJCA 1WSJA 3DLLL 3VF4A 3WQTA 4RCHA 3VTIA 2ZWHA 3RVCA 2CGJA 3DLKA 4EFHA 3OY9A 2OCEA 3SNNA 4JKGA 1DLOA 2HOEA 1VSMA 1Q86O 1NGDA 1XQSC 3K57A 4A57A 3I56N 4OPAA 3CJ7A 3A8YA 4H4OA 1NGAA 1RBSA 3VERA 4CEAA 4E7LA 2G8FA 2DFFA 1VQMN 3B6OA 5DM7L 3EZWA 4Z4GA 2Z1IA 4PUOA 1VQLN 3ZEUA 2PBDA 5A2QO 3D2FB 3NBPA 2B5JA 1JCFA 2VYPA 4E1NA 4EP5A 3VQQA 1J6ZA 1BL3A 2ASMA 2I7NA 1SL0A 2WONA 5CR4A 4BROA 4OJRA 2O8EB 4FJMA 5KPTA 3OYIA 3T1AA 2A42A 3CFRA 4DTOA 4IJAA 5KGXA 5TKWA 4FJNA 3GOIA 2IAJA 4E19A 3CCSN 5JS1A 3IMXA 4E7IA 1BCOA 2FF3B 4UQGA 5ADXA 4N5SA 4KHYA 3C65A 4FK0A 4DV2K 1GLLO 5AQVA 3QB0A 1L3SA 1YVNA 2IVPA 4BC5A 2HNZA 2J4RA 3HP9A 3THWA 2W6LA 3CJ1A 4FWNA 1HMVA 2WTUA 3CXCM 1RBTA 1RT2A 2E88A 1BQNA 3VESA 3P31A 3VQ4A 3S3NA 2EHGA 1IJJA 2OTLN 3V9WA 4EZ9A 3HPOA 3IFRA 5AQOA 3KIOA 3P83D 1YI2N 3VGLA 2ASOA 2E20A 1UA0A 4IEIA 1LOTB 3OYJA 2GUPA 5EX5A 4GVMA 3S3MA 3HPGA 2DY4A 5AQZA 2O8BB 3FZFA 5AFUA 1HNXK 2KKZA 4FJ5A 4PQUA 4DQPA 1YVUA 1TKXA 3WXKA 3NGZA 3QETA 3SCXA 4GV6A 4IWVA 3PLAA 1KSPA 3HP6A 4FSVA 4O8UA 4PHTX 1IG9A 3F9KA 3QESA 1TK0A 5HLFA 3CMAN 2BANA 3EKSA 3LM9A 1VQNN 4F9OA 4FJ9A 1Q18A 3K0SA 4OLBA 4M3YA 4DFPA 1D9DA 2NRVA 3QBXA 3AVMA 3OYDA 3NFAA 4NXNK 2AA4A 2F9TA 3KWIA 1ZYQA 1ZBHA 3VQ7A 4CJLA 3CCJN 2IDOA 3MXJA 4IKFA 1ATRA 5EOYA 1X9SA 4CEDA 4WFBL 2ITGA 5EXWA 3EZ5A 1S22A 1T44A 3TI0A 3A5LC 2ZGZA 3H46O 3SUOA 2G8KA 3T3FA 3AAQA 4IFEA 4F4KA 5GIPA 3HSTB 4B1YB 2XY7A 1E4GT 3LWLA 2OZMA 4F2SA 3RSEB 1YIJN 1C1AA 3VA3A 4M7XA 1QQNA 1P90A 4GVEA 5E84A 4DU4A 4OKKA 5F0XA 4JI4K 4AHUA 4KB1A 3GE1A 3TAEA 2BUPA 3FFKB 5C2FA 1N36K 4FZXC 1YAGA 1IBLK 1TK5A 3SUPA 4JI8K 1QHAA 4M3WA 4LSNA 1S9EA 3G4SN 4IFYA 1DT9A 3M5RA 5HBMA 4IO9L 3QBWA 1QS4A 2E2QA 5KGWA 1KTQA 4H0YB 2YNIA 4NYFA 1SS6A 1T6DA 3TR8A 3UKRB 3B6PA 3S41A 3KK3A 1GOCA 1VK0A 4GV9A 3OYBA 5FRNA 3O6WA 2HHHK 2QWOA 3Q7BA 3A0IX 3WUHA 3CHWA 1ATSA 1NGCA 2P9NA 2W6KA
chains in the Genus database with same CATH topology
3O4QA 3QEVA 3I0RA 1NOZA 3NF7A 3OS2A 2IGIA 3MXMA 4CFBA 3S9HA 3LPUA 1TGOA 3D0PA 4CF0A 1VSHA 1A5WA 3VQBA 3WNGA 4KTZA 4KHUA 3L3UA 4IG0A 2HHTA 4CEQA 3LDSA 4ZTJA 2FBVA 3NDKA 1X9MA 2QKKA 1RT3A 3ZSVA 4FW1A 1J53A 3SQ2A 5J2MA 3SV3A 2ETJA 1EX4A 1I39A 1TKZA 4AH9A 3L2QA 4B9TA 1D8YA 1S1WA 1U45A 2OZSA 1GOAA 1RBRA 2YKMA 1HYSA 1S5JA 1SKSA 3PX6A 1HQUA 2Z1JA 5JS2A 2LSNA 1DTTA 4RW4A 1YTAA 3OYKA 3K5MA 5J2NA 5SZTA 4LSLA 4B08A 2OYQA 4FXDA 1A5XA 3OYMA 1D9FA 1HQEA 5DK5A 1DTQA 2RF2A 3VQ6A 3VQ9A 5J2PA 1KRPA 4DSLA 5KTQA 1I3AA 3AA3A 2PZSA 4CHYA 2BDPA 5HROA 3WNHA 5KRSA 4Z0UA 2PY5A 3MEDA 2KFNA 3D45A 1S6PA 4CK3A 1G15A 1NJZA 1F21A 2Y1IA 3IG1A 4HUEA 4CHPA 3MECA 1REVA 4DTXA 4Z4IA 4CERA 2HHUA 4FJJA 1YT3A 3L2RA 3C95A 2FBTA 1RBUA 5HRNA 3EY1A 1UA1A 4L8RB 4WE1A 2W42A 3ZT0A 3HXMA 4PY5A 3LAKA 4CJPA 3HVTA 3UIQA 4RW7A 1QHTA 3O3HA 4CJKA 2KTQA 3IAYA 4FLTA 3TARA 2NUBA 3KLEA 1LAWA 3AVGA 2OPSA 4Q5VA 1JKHA 2X74A 4JLHA 4MFBA 3SZ2A 1IKVA 4CK1A 3ZT4A 3TAPA 1KFSA 4DG1A 3IS9A 4DTSA 3TAQA 1L5UA 1RDBA 4BE2A 1TV6A 4KTWA 2G8VA 4CK2A 3KD1E 4KPYA 4CFDA 2ZE2A 4BDYA 1TVRA 3SUQA 2D0BA 1C0MA 4CJFA 4DS5A 3NHGA 1B9FA 1WSEA 4EP4A 4W5TA 4DQQA 1U47A 1VSJA 3AVHA 4DU3A 4BWJA 2ZD1A 3JSMA 4CF2A 3AVCA 1Z26A 3OYFA 3FFIA 3SJJA 1S1TA 1TKTA 2XHBA 4BE1A 4KO0A 1XHZA 3AVIA 3DRRA 2EX3A 3CFPA 4Z4EA 1JLEA 1BIZA 1WLJA 2KQ2A 3LP2A 3OYHA 1LW2A 4DTPA 1LV5A 1JLBA 1VSFA 4JRPA 4DLEA 1IH7A 3F73A 3AVKA 3SPZA 3U3YA 4CIFA 2A1SA 5D3GA 4I9LA 2VWKA 3TWHA 2DFEA 2ATQA 3V4IA 2BGGA 3AVAA 4CEOA 3KK1A 3C6TA 1WNSA 3NAEA 3ZCMA 4M3RA 4B9LA 2KZMA 1BQMA 4E7HA 4N47A 1KVAA 4FM2A 3VQDA 1L3VA 1WSGA 2P51A 4HCBA 4CJEA 4DF4A 1EETA 4K8ZA 4HUFA 4CCHA 3L3VA 1KVCA 4B9VA 4OKEA 3CFOA 2G8WA 3NH2A 3M8PA 3DLGA 2OPQA 5I42A 1NKEA 4B9UA 3AV9A 4DQRA 4C8OA 4N76A 1LW0A 4CJSA 2FBYA 3BDPA 3SQ4A 1U4BA 4CEFA 2HMIA 1SL1A 4IG3A 1BI4B 3DYAA 3VN5A 1UOCA 4KKOA 1TL1A 3QERA 4J2EA 1KCFA 1VRUA 4CGDA 5CZ2A 4AHRA 2OPRA 4HUGA 4DFJA 4F2RA 1J54A 3MEEA 2Q3SA 1HNIA 4ELVA 3ZSXA 4NCAA 2XRIA 4CIEA 3K5NA 3LP3A 3SQ1A 4M3TA 1K6YA 3SPYA 3TAGA 3KD5E 4M42A 3SUNA 4RW9A 1L3TA 1VRTA 3C6UA 4N41A 4QOZB 3QNOA 4C8LA 4Z4HA 4OPKA 3THVA 2F96A 2GV9A 1XC9A 1RBVA 3VQCA 1ZBIA 4KRFA 2HHXA 4DSIA 4O5BA 1N6QA 4OPJA 4XIUA 2X6NA 4ZTFA 2D0CA 5HP1A 3QEIA 3NH1A 2XY5A 4ZHRA 2PYLA 3RWUA 4LH5A 4CF9A 1S6QA 1QQCA 3WNFA 4KV8A 3RRHA 2HNYA 4NCGA 1Q9YA 4PWDA 3V6DA 2QXFA 2O4IA 1Q8IA 5CY4A 4KI6A 4FZYA 1RTHA 3U3GA 3LZIA 4W5NA 4J2AA 4E7JA 3V9ZA 3RTVA 3HVRA 3OS0A 3OYAA 3JYTA 3DRSA 4CJ4A 3LP0A 1B92A 3SQ0A 4BWMA 5C25A 2VWJA 1NJWA 1RT6A 2G8UA 2VG7A 3KTQA 3KLIA 4OKJA 5J1EA 1RT5A 3SYZA 4BDZA 3M8QA 4M45A 1RILA 3AVJA 1ASVA 1GOBA 4LY7A 1QSYA 3V1QA 4DLGA 3AA5X 3VQ5A 4KHQA 1RT1A 4AHTA 4CJWA 3PY8A 1T03A 3DLBA 1C0UA 1HPZA 5HRSA 4FJIA 3HPHA 4CFCA 2AJQA 4NYNA 3RMAA 5SWMA 3K5LA 4GMJB 2E4LA 4QAGA 3EYZA 2KFZA 4AHSA 4CEZA 4F3TA 3NGIA 1EP4A 1FXXA 2R7YA 3HYFA 2HVHA 1NK6A 1UAXA 3OYNA 1WAFA 1NK7A 1RNHA 5DMRA 1RTIA 4CHNA 4J2BA 3KLFA 4QCLA 3L2WA 3L2VA 3NF9A 3P1GA 1QTMA 2YKNA 3KKSA 4C8MA 4E1MA 3HT3A 3C94A 2G8HA 1T05A 3ZSWA 4CJRA 1Z25A 4CFAA 2QK9A 1Y97A 3HJFA 1ITGA 3CM5A 3MEGA 3O3GA 3OYLA 1JLGA 1S1XA 5FRMA 3OS1A 3ZSRA 1BIUA 4AHCA 5KRTA 4KB0A 2XY8A 1HYVA 3AA4A 4CF1A 3TANA 2PYJA 4Y1DA 3TAMA 4DMNA 1TK8A 4Y1CA 5J2QA 3V9SA 1RDDA 4CIGA 3NGYA 1D5AA 4OGEA 4FLZA 1NK8A 4E89A 4DSKA 4ELUA 3OYGA 1CZ9A 3P5JA 4E7KA 1QSLA 1WSHA 3T19A 4CJUA 4KI4A 4K8XA 4FM1A 3QNNA 1SKWA 5CYQA 3I0SA 4EZ6A 1CXQA 1LWFA 5C24A 3VQ8A 3VQEA 1EXQA 4CEEA 1TAUA 4RW8A 1T8EA 3DI6A 4CGFA 1C6VA 3NF8A 2JLEA 3ALYA 3U6FA 3OYCA 4DS4A 1L3UA 3OVNA 3V1RA 4OLAA 1QSSA 1XWLA 2Z1HA 3ISNC 1RT7A 4B9NA 4W5RA 3HM9A 4DWIA 1SV5A 2WOMA 4CJ3A 1BGXT 2FBXA 5CZ1A 4DTJA 1J5OA 3DLHA 3PO4A 1C1CA 1WSJA 2I5JA 4DTNA 2X6SA 4DQIA 3HO1A 2P5OA 4FCYA 5HRPA 4ELTA 1WSFA 3PX0A 2P1JA 2YNGA 1FKPA 3DLKA 4M3ZA 1X1PA 3KLHA 3AO2A 4PA1A 3OY9A 3SNNA 1DLOA 3ZSYA 4HCCA 1VSMA 3QEWA 4O55A 1IKXA 1CXUA 1VSKA 3NCIA 3K57A 3PX4A 2F8SA 2XO7A 4CEAA 3LAMA 4H4OA 4E7LA 1RBSA 1KFDA 2FC0A 4RG8A 4CGJA 2DFFA 2G8FA 1FK9A 4FJKA 2G8IA 4FJHA 3B6OA 3RMBA 3QO9A 4Z4GA 2HW3A 2Z1IA 4PUOA 4BACA 4KREA 1O1WA 1BHLA 2HHSA 4JS5A 5T7BA 4FJXA 4AHVA 3NBPA 2B5JA 1NJXA 4E1NA 3CG7A 4FJGA 1RDAA 3M8SA 3RMCA 4EP5A 1WN7A 3VQQA 2F8TA 2B6AA 3ULDA 4HTUA 1BL3A 4CF8A 1QE1A 1EKEA 1XI1A 2HB5A 3AVLA 1JXEA 4DTMA 3V81A 1JL1A 1SL0A 2WONA 2YNFA 4OJRA 4KHSA 4FJMA 4CJVA 4DFKA 1KVBA 3OYIA 3RMDA 4CGGA 1TL3A 3LANA 4HVJA 4RW6A 3KKRA 3T1AA 3CFRA 1RCHA 1XHXA 4W5OA 1C1BA 5KGXA 3L2UA 2OPPA 3DLRA 4FLYA 5C42A 4DTOA 4H4MA 3SV4A 2IOCA 4FJNA 1X9WA 2IAJA 4KHWA 4E19A 2HHVA 5JS1A 1NK5A 1A5VA 4CE9A 1ZBUA 1BCOA 3VA0A 4E7IA 5I3UA 1ASWA 3G0ZA 4I2QA 4UQGA 4I7FA 4MQ3A 1ASUA 4N5SA 4KHYA 1U49A 3PUFA 2VG5A 3AO5A 4I2PA 3TABA 4FK0A 2JGUA 2RPIA 2IS3A 3CQ8A 4DFMA 4O4GA 1L3SA 1VSLA 4FK4A 4O0IA 3SI6A 4B9SA 2HNZA 2YHAA 4O44A 4IBNA 4FVMA 3HP9A 3ZT1A 4W5QA 4BE0A 3G10A 1YTUA 3CYMA 2RN2A 3LPTA 3E01A 1U04A 4H8KA 1NK0A 1HMVA 3ZSQA 4B8AB 3VQAA 4DSJA 5E41A 5KI6A 3O3FA 3HL8A 1JXBA 1RBTA 1NKCA 1RT2A 1BQNA 5K14A 3DRPA 3QIPA 3ZT2A 3K59A 4F3OA 3VQ4A 1BI4A 2EHGA 3S3NA 1VSDA 2D0AA 4N56A 1IKYA 2X78A 3HPOA 3V9WA 4EZ9A 2DTUA 3KIOA 3P83D 4CGIA 2OA8A 1SKRA 1BCMA 3QIOA 4LD0A 2DFHA 4YNQA 1S1UA 1UA0A 3K2PA 1FKOA 4CJTA 3OYJA 4GVMA 3MAQA 4JRQA 3S3MA 2RKIA 3HPGA 3ZT3A 2DY4A 1TKDA 1S1VA 1HNVA 1U48A 4KAZA 3CM6A 4FJ5A 4DSFA 4DTRA 1WAJA 3MXIA 3NF6A 1SUQA 4LH4A 4O0JA 1CZBA 3LZJA 1NKBA 2ZQBA 1NK9A 4FK2A 3HK2A 1JLFA 4PQUA 4CHQA 3O4NA 4DQPA 4YFUA 3OJSA 4CHOA 4B8CA 3DOLA 1YVUA 2VG6A 1TKXA 3AO3A 3NGZA 3QETA 4ID1A 3PV8A 2KW4A 4DTUA 1IKWA 3SCXA 3AO1A 3A2FA 2A1RA 3AVNA 3HP6A 1NOYA 1S9GA 1KSPA 4IFVA 4FM0A 1IG9A 3F9KA 1N5YA 3QESA 3RR8A 1TK0A 5HLFA 3AO4A 3S3OA 1RDCA 4JS4A 4C8KA 1LAVA 2BANA 1LWCA 1SL2A 4TSXA 3H08A 4FJ9A 4M3XA 4FYDA 3PO5A 4OLBA 4M3YA 4DFPA 1D9DA 1W9HA 2O4GA 3AVMA 2D5RA 3NFAA 3OYDA 3V1OA 1CLQA 1W0HA 1TAQA 4CEBA 1ZYQA 3AVBA 1ZBHA 3VQ7A 4CJLA 3QEXA 1J9AA 2IDOA 4DU1A 1Q9XA 1RTJA 4R5PA 1JLQA 1RT4A 4FLWA 3MXJA 4CJQA 4FW2A 4IKFA 1UWBA 1MU2A 2HVIA 3V9XA 1ZBFA 1HYZA 3ZSZA 4CJ5A 4CEDA 3NH0A 3M8RA 2ITGA 1X9SA 1KLNA 4B3OA 2YV0X 1BISA 1RTDA 3KJVA 3TAFA 3EZ5A 1R0AA 4NCBA 1HRHA 4KFBA 3LALA 4E3SA 3TI0A 2P5GA 3SUOA 1LWEA 1NK4A 2G8KA 3T3FA 4FZZA 1C0TA 4OGCA 2E6MA 4F4KA 2IC3A 1ZBLA 4M3UA 3HSTB 3OJUA 5HRRA 3DMJA 4I9QA 2XY7A 3LWLA 3LWMA 2OZMA 3WNEA 4F2SA 2KZZA 3K5OA 4BDPA 4IDKA 1C1AA 1B9DA 4FJ7A 4ICLA 3OYEA 3VA3A 2YHBA 3QLHA 4Q0BA 4DU4A 3KK2A 1IO2A 4OKKA 3VQPA 3NE6A 2GUIA 4AHUA 4KB1A 3RR7A 3TAEA 2QKBA 3I8DA 4DSEA 5CYMA 4B9MA 1WSIA 4C8NA 4FLUA 1KLMA 4FZXC 2E6LA 1TK5A 2HHQA 3SUPA 3LP1A 4AILC 4CGHA 4KTQA 4M3WA 3K58A 3BGRA 4Z4FA 3KLGA 4LSNA 1VSEA 1S9EA 4IFYA 4M41A 3DOKA 5HBMA 2HHWA 4DF8A 4Z4CA 3AA2A 3DLEA 1VSIA 4G1QA 1QS4A 4E0DA 3RRGA 4FLXA 1HJRA 1JLCA 5KGWA 3L8BA 1KTQA 2Y1JA 2YNIA 4NYFA 4F8RA 4GW6A 3IRXA 3ZSOA 4HHTA 3TR8A 3B6PA 1T7PA 4CHZA 3KK3A 4CESA 4FJ8A 1GOCA 1VK0A 2YNHA 3AVFA 5EU7A 3OYBA 4J2DA 5FRNA 2B4JA 4ID5A 4KHNA 4CECA 3QEPA 5FROA 3DM2A 2Z1GA 1JLAA 2XY6A 4FJLA 4OVLA 5FDLA 3ASMA 1JL2A 2HNDA 3ITHA 4DQSA 2BE2A 1NJYA 4FLVA 3V9UA 3QINA 2GBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O4Q A;  3QEV A;  3I0R A;  1NOZ A;  3NF7 A;  3OS2 A;  2IGI A;  3MXM A;  4CFB A;  3S9H A;  3LPU A;  1TGO A;  3D0P A;  4CF0 A;  1VSH A;  1A5W A;  3VQB A;  3WNG A;  4KTZ A;  4KHU A;  3L3U A;  4IG0 A;  2HHT A;  4CEQ A;  3LDS A;  4ZTJ A;  2FBV A;  3NDK A;  1X9M A;  2QKK A;  1RT3 A;  3ZSV A;  4FW1 A;  1J53 A;  3SQ2 A;  5J2M A;  3SV3 A;  2ETJ A;  1EX4 A;  1I39 A;  1TKZ A;  4AH9 A;  3L2Q A;  4B9T A;  1D8Y A;  1S1W A;  1U45 A;  2OZS A;  1GOA A;  1RBR A;  2YKM A;  1HYS A;  1S5J A;  1SKS A;  3PX6 A;  1HQU A;  2Z1J A;  5JS2 A;  2LSN A;  1DTT A;  4RW4 A;  1YTA A;  3OYK A;  3K5M A;  5J2N A;  5SZT A;  4LSL A;  4B08 A;  2OYQ A;  4FXD A;  1A5X A;  3OYM A;  1D9F A;  1HQE A;  5DK5 A;  1DTQ A;  2RF2 A;  3VQ6 A;  3VQ9 A;  5J2P A;  1KRP A;  4DSL A;  5KTQ A;  1I3A A;  3AA3 A;  2PZS A;  4CHY A;  2BDP A;  5HRO A;  3WNH A;  5KRS A;  4Z0U A;  2PY5 A;  3MED A;  2KFN A;  3D45 A;  1S6P A;  4CK3 A;  1G15 A;  1NJZ A;  1F21 A;  2Y1I A;  3IG1 A;  4HUE A;  4CHP A;  3MEC A;  1REV A;  4DTX A;  4Z4I A;  4CER A;  2HHU A;  4FJJ A;  1YT3 A;  3L2R A;  3C95 A;  2FBT A;  1RBU A;  5HRN A;  3EY1 A;  1UA1 A;  4L8R B;  4WE1 A;  2W42 A;  3ZT0 A;  3HXM A;  4PY5 A;  3LAK A;  4CJP A;  3HVT A;  3UIQ A;  4RW7 A;  1QHT A;  3O3H A;  4CJK A;  2KTQ A;  3IAY A;  4FLT A;  3TAR A;  2NUB A;  3KLE A;  1LAW A;  3AVG A;  2OPS A;  4Q5V A;  1JKH A;  2X74 A;  4JLH A;  4MFB A;  3SZ2 A;  1IKV A;  4CK1 A;  3ZT4 A;  3TAP A;  1KFS A;  4DG1 A;  3IS9 A;  4DTS A;  3TAQ A;  1L5U A;  1RDB A;  4BE2 A;  1TV6 A;  4KTW A;  2G8V A;  4CK2 A;  3KD1 E;  4KPY A;  4CFD A;  2ZE2 A;  4BDY A;  1TVR A;  3SUQ A;  2D0B A;  1C0M A;  4CJF A;  4DS5 A;  3NHG A;  1B9F A;  1WSE A;  4EP4 A;  4W5T A;  4DQQ A;  1U47 A;  1VSJ A;  3AVH A;  4DU3 A;  4BWJ A;  2ZD1 A;  3JSM A;  4CF2 A;  3AVC A;  1Z26 A;  3OYF A;  3FFI A;  3SJJ A;  1S1T A;  1TKT A;  2XHB A;  4BE1 A;  4KO0 A;  1XHZ A;  3AVI A;  3DRR A;  2EX3 A;  3CFP A;  4Z4E A;  1JLE A;  1BIZ A;  1WLJ A;  2KQ2 A;  3LP2 A;  3OYH A;  1LW2 A;  4DTP A;  1LV5 A;  1JLB A;  1VSF A;  4JRP A;  4DLE A;  1IH7 A;  3F73 A;  3AVK A;  3SPZ A;  3U3Y A;  4CIF A;  2A1S A;  5D3G A;  4I9L A;  2VWK A;  3TWH A;  2DFE A;  2ATQ A;  3V4I A;  2BGG A;  3AVA A;  4CEO A;  3KK1 A;  3C6T A;  1WNS A;  3NAE A;  3ZCM A;  4M3R A;  4B9L A;  2KZM A;  1BQM A;  4E7H A;  4N47 A;  1KVA A;  4FM2 A;  3VQD A;  1L3V A;  1WSG A;  2P51 A;  4HCB A;  4CJE A;  4DF4 A;  1EET A;  4K8Z A;  4HUF A;  4CCH A;  3L3V A;  1KVC A;  4B9V A;  4OKE A;  3CFO A;  2G8W A;  3NH2 A;  3M8P A;  3DLG A;  2OPQ A;  5I42 A;  1NKE A;  4B9U A;  3AV9 A;  4DQR A;  4C8O A;  4N76 A;  1LW0 A;  4CJS A;  2FBY A;  3BDP A;  3SQ4 A;  1U4B A;  4CEF A;  2HMI A;  1SL1 A;  4IG3 A;  1BI4 B;  3DYA A;  3VN5 A;  1UOC A;  4KKO A;  1TL1 A;  3QER A;  4J2E A;  1KCF A;  1VRU A;  4CGD A;  5CZ2 A;  4AHR A;  2OPR A;  4HUG A;  4DFJ A;  4F2R A;  1J54 A;  3MEE A;  2Q3S A;  1HNI A;  4ELV A;  3ZSX A;  4NCA A;  2XRI A;  4CIE A;  3K5N A;  3LP3 A;  3SQ1 A;  4M3T A;  1K6Y A;  3SPY A;  3TAG A;  3KD5 E;  4M42 A;  3SUN A;  4RW9 A;  1L3T A;  1VRT A;  3C6U A;  4N41 A;  4QOZ B;  3QNO A;  4C8L A;  4Z4H A;  4OPK A;  3THV A;  2F96 A;  2GV9 A;  1XC9 A;  1RBV A;  3VQC A;  1ZBI A;  4KRF A;  2HHX A;  4DSI A;  4O5B A;  1N6Q A;  4OPJ A;  4XIU A;  2X6N A;  4ZTF A;  2D0C A;  5HP1 A;  3QEI A;  3NH1 A;  2XY5 A;  4ZHR A;  2PYL A;  3RWU A;  4LH5 A;  4CF9 A;  1S6Q A;  1QQC A;  3WNF A;  4KV8 A;  3RRH A;  2HNY A;  4NCG A;  1Q9Y A;  4PWD A;  3V6D A;  2QXF A;  2O4I A;  1Q8I A;  5CY4 A;  4KI6 A;  4FZY A;  1RTH A;  3U3G A;  3LZI A;  4W5N A;  4J2A A;  4E7J A;  3V9Z A;  3RTV A;  3HVR A;  3OS0 A;  3OYA A;  3JYT A;  3DRS A;  4CJ4 A;  3LP0 A;  1B92 A;  3SQ0 A;  4BWM A;  5C25 A;  2VWJ A;  1NJW A;  1RT6 A;  2G8U A;  2VG7 A;  3KTQ A;  3KLI A;  4OKJ A;  5J1E A;  1RT5 A;  3SYZ A;  4BDZ A;  3M8Q A;  4M45 A;  1RIL A;  3AVJ A;  1ASV A;  1GOB A;  4LY7 A;  1QSY A;  3V1Q A;  4DLG A;  3AA5 X;  3VQ5 A;  4KHQ A;  1RT1 A;  4AHT A;  4CJW A;  3PY8 A;  1T03 A;  3DLB A;  1C0U A;  1HPZ A;  5HRS A;  4FJI A;  3HPH A;  4CFC A;  2AJQ A;  4NYN A;  3RMA A;  5SWM A;  3K5L A;  4GMJ B;  2E4L A;  4QAG A;  3EYZ A;  2KFZ A;  4AHS A;  4CEZ A;  4F3T A;  3NGI A;  1EP4 A;  1FXX A;  2R7Y A;  3HYF A;  2HVH A;  1NK6 A;  1UAX A;  3OYN A;  1WAF A;  1NK7 A;  1RNH A;  5DMR A;  1RTI A;  4CHN A;  4J2B A;  3KLF A;  4QCL A;  3L2W A;  3L2V A;  3NF9 A;  3P1G A;  1QTM A;  2YKN A;  3KKS A;  4C8M A;  4E1M A;  3HT3 A;  3C94 A;  2G8H A;  1T05 A;  3ZSW A;  4CJR A;  1Z25 A;  4CFA A;  2QK9 A;  1Y97 A;  3HJF A;  1ITG A;  3CM5 A;  3MEG A;  3O3G A;  3OYL A;  1JLG A;  1S1X A;  5FRM A;  3OS1 A;  3ZSR A;  1BIU A;  4AHC A;  5KRT A;  4KB0 A;  2XY8 A;  1HYV A;  3AA4 A;  4CF1 A;  3TAN A;  2PYJ A;  4Y1D A;  3TAM A;  4DMN A;  1TK8 A;  4Y1C A;  5J2Q A;  3V9S A;  1RDD A;  4CIG A;  3NGY A;  1D5A A;  4OGE A;  4FLZ A;  1NK8 A;  4E89 A;  4DSK A;  4ELU A;  3OYG A;  1CZ9 A;  3P5J A;  4E7K A;  1QSL A;  1WSH A;  3T19 A;  4CJU A;  4KI4 A;  4K8X A;  4FM1 A;  3QNN A;  1SKW A;  5CYQ A;  3I0S A;  4EZ6 A;  1CXQ A;  1LWF A;  5C24 A;  3VQ8 A;  3VQE A;  1EXQ A;  4CEE A;  1TAU A;  4RW8 A;  1T8E A;  3DI6 A;  4CGF A;  1C6V A;  3NF8 A;  2JLE A;  3ALY A;  3U6F A;  3OYC A;  4DS4 A;  1L3U A;  3OVN A;  3V1R A;  4OLA A;  1QSS A;  1XWL A;  2Z1H A;  3ISN C;  1RT7 A;  4B9N A;  4W5R A;  3HM9 A;  4DWI A;  1SV5 A;  2WOM A;  4CJ3 A;  1BGX T;  2FBX A;  5CZ1 A;  4DTJ A;  1J5O A;  3DLH A;  3PO4 A;  1C1C A;  1WSJ A;  2I5J A;  4DTN A;  2X6S A;  4DQI A;  3HO1 A;  2P5O A;  4FCY A;  5HRP A;  4ELT A;  1WSF A;  3PX0 A;  2P1J A;  2YNG A;  1FKP A;  3DLK A;  4M3Z A;  1X1P A;  3KLH A;  3AO2 A;  4PA1 A;  3OY9 A;  3SNN A;  1DLO A;  3ZSY A;  4HCC A;  1VSM A;  3QEW A;  4O55 A;  1IKX A;  1CXU A;  1VSK A;  3NCI A;  3K57 A;  3PX4 A;  2F8S A;  2XO7 A;  4CEA A;  3LAM A;  4H4O A;  4E7L A;  1RBS A;  1KFD A;  2FC0 A;  4RG8 A;  4CGJ A;  2DFF A;  2G8F A;  1FK9 A;  4FJK A;  2G8I A;  4FJH A;  3B6O A;  3RMB A;  3QO9 A;  4Z4G A;  2HW3 A;  2Z1I A;  4PUO A;  4BAC A;  4KRE A;  1O1W A;  1BHL A;  2HHS A;  4JS5 A;  5T7B A;  4FJX A;  4AHV A;  3NBP A;  2B5J A;  1NJX A;  4E1N A;  3CG7 A;  4FJG A;  1RDA A;  3M8S A;  3RMC A;  4EP5 A;  1WN7 A;  3VQQ A;  2F8T A;  2B6A A;  3ULD A;  4HTU A;  1BL3 A;  4CF8 A;  1QE1 A;  1EKE A;  1XI1 A;  2HB5 A;  3AVL A;  1JXE A;  4DTM A;  3V81 A;  1JL1 A;  1SL0 A;  2WON A;  2YNF A;  4OJR A;  4KHS A;  4FJM A;  4CJV A;  4DFK A;  1KVB A;  3OYI A;  3RMD A;  4CGG A;  1TL3 A;  3LAN A;  4HVJ A;  4RW6 A;  3KKR A;  3T1A A;  3CFR A;  1RCH A;  1XHX A;  4W5O A;  1C1B A;  5KGX A;  3L2U A;  2OPP A;  3DLR A;  4FLY A;  5C42 A;  4DTO A;  4H4M A;  3SV4 A;  2IOC A;  4FJN A;  1X9W A;  2IAJ A;  4KHW A;  4E19 A;  2HHV A;  5JS1 A;  1NK5 A;  1A5V A;  4CE9 A;  1ZBU A;  1BCO A;  3VA0 A;  4E7I A;  5I3U A;  1ASW A;  3G0Z A;  4I2Q A;  4UQG A;  4I7F A;  4MQ3 A;  1ASU A;  4N5S A;  4KHY A;  1U49 A;  3PUF A;  2VG5 A;  3AO5 A;  4I2P A;  3TAB A;  4FK0 A;  2JGU A;  2RPI A;  2IS3 A;  3CQ8 A;  4DFM A;  4O4G A;  1L3S A;  1VSL A;  4FK4 A;  4O0I A;  3SI6 A;  4B9S A;  2HNZ A;  2YHA A;  4O44 A;  4IBN A;  4FVM A;  3HP9 A;  3ZT1 A;  4W5Q A;  4BE0 A;  3G10 A;  1YTU A;  3CYM A;  2RN2 A;  3LPT A;  3E01 A;  1U04 A;  4H8K A;  1NK0 A;  1HMV A;  3ZSQ A;  4B8A B;  3VQA A;  4DSJ A;  5E41 A;  5KI6 A;  3O3F A;  3HL8 A;  1JXB A;  1RBT A;  1NKC A;  1RT2 A;  1BQN A;  5K14 A;  3DRP A;  3QIP A;  3ZT2 A;  3K59 A;  4F3O A;  3VQ4 A;  1BI4 A;  2EHG A;  3S3N A;  1VSD A;  2D0A A;  4N56 A;  1IKY A;  2X78 A;  3HPO A;  3V9W A;  4EZ9 A;  2DTU A;  3KIO A;  3P83 D;  4CGI A;  2OA8 A;  1SKR A;  1BCM A;  3QIO A;  4LD0 A;  2DFH A;  4YNQ A;  1S1U A;  1UA0 A;  3K2P A;  1FKO A;  4CJT A;  3OYJ A;  4GVM A;  3MAQ A;  4JRQ A;  3S3M A;  2RKI A;  3HPG A;  3ZT3 A;  2DY4 A;  1TKD A;  1S1V A;  1HNV A;  1U48 A;  4KAZ A;  3CM6 A;  4FJ5 A;  4DSF A;  4DTR A;  1WAJ A;  3MXI A;  3NF6 A;  1SUQ A;  4LH4 A;  4O0J A;  1CZB A;  3LZJ A;  1NKB A;  2ZQB A;  1NK9 A;  4FK2 A;  3HK2 A;  1JLF A;  4PQU A;  4CHQ A;  3O4N A;  4DQP A;  4YFU A;  3OJS A;  4CHO A;  4B8C A;  3DOL A;  1YVU A;  2VG6 A;  1TKX A;  3AO3 A;  3NGZ A;  3QET A;  4ID1 A;  3PV8 A;  2KW4 A;  4DTU A;  1IKW A;  3SCX A;  3AO1 A;  3A2F A;  2A1R A;  3AVN A;  3HP6 A;  1NOY A;  1S9G A;  1KSP A;  4IFV A;  4FM0 A;  1IG9 A;  3F9K A;  1N5Y A;  3QES A;  3RR8 A;  1TK0 A;  5HLF A;  3AO4 A;  3S3O A;  1RDC A;  4JS4 A;  4C8K A;  1LAV A;  2BAN A;  1LWC A;  1SL2 A;  4TSX A;  3H08 A;  4FJ9 A;  4M3X A;  4FYD A;  3PO5 A;  4OLB A;  4M3Y A;  4DFP A;  1D9D A;  1W9H A;  2O4G A;  3AVM A;  2D5R A;  3NFA A;  3OYD A;  3V1O A;  1CLQ A;  1W0H A;  1TAQ A;  4CEB A;  1ZYQ A;  3AVB A;  1ZBH A;  3VQ7 A;  4CJL A;  3QEX A;  1J9A A;  2IDO A;  4DU1 A;  1Q9X A;  1RTJ A;  4R5P A;  1JLQ A;  1RT4 A;  4FLW A;  3MXJ A;  4CJQ A;  4FW2 A;  4IKF A;  1UWB A;  1MU2 A;  2HVI A;  3V9X A;  1ZBF A;  1HYZ A;  3ZSZ A;  4CJ5 A;  4CED A;  3NH0 A;  3M8R A;  2ITG A;  1X9S A;  1KLN A;  4B3O A;  2YV0 X;  1BIS A;  1RTD A;  3KJV A;  3TAF A;  3EZ5 A;  1R0A A;  4NCB A;  1HRH A;  4KFB A;  3LAL A;  4E3S A;  3TI0 A;  2P5G A;  3SUO A;  1LWE A;  1NK4 A;  2G8K A;  3T3F A;  4FZZ A;  1C0T A;  4OGC A;  2E6M A;  4F4K A;  2IC3 A;  1ZBL A;  4M3U A;  3HST B;  3OJU A;  5HRR A;  3DMJ A;  4I9Q A;  2XY7 A;  3LWL A;  3LWM A;  2OZM A;  3WNE A;  4F2S A;  2KZZ A;  3K5O A;  4BDP A;  4IDK A;  1C1A A;  1B9D A;  4FJ7 A;  4ICL A;  3OYE A;  3VA3 A;  2YHB A;  3QLH A;  4Q0B A;  4DU4 A;  3KK2 A;  1IO2 A;  4OKK A;  3VQP A;  3NE6 A;  2GUI A;  4AHU A;  4KB1 A;  3RR7 A;  3TAE A;  2QKB A;  3I8D A;  4DSE A;  5CYM A;  4B9M A;  1WSI A;  4C8N A;  4FLU A;  1KLM A;  4FZX C;  2E6L A;  1TK5 A;  2HHQ A;  3SUP A;  3LP1 A;  4AIL C;  4CGH A;  4KTQ A;  4M3W A;  3K58 A;  3BGR A;  4Z4F A;  3KLG A;  4LSN A;  1VSE A;  1S9E A;  4IFY A;  4M41 A;  3DOK A;  5HBM A;  2HHW A;  4DF8 A;  4Z4C A;  3AA2 A;  3DLE A;  1VSI A;  4G1Q A;  1QS4 A;  4E0D A;  3RRG A;  4FLX A;  1HJR A;  1JLC A;  5KGW A;  3L8B A;  1KTQ A;  2Y1J A;  2YNI A;  4NYF A;  4F8R A;  4GW6 A;  3IRX A;  3ZSO A;  4HHT A;  3TR8 A;  3B6P A;  1T7P A;  4CHZ A;  3KK3 A;  4CES A;  4FJ8 A;  1GOC A;  1VK0 A;  2YNH A;  3AVF A;  5EU7 A;  3OYB A;  4J2D A;  5FRN A;  2B4J A;  4ID5 A;  4KHN A;  4CEC A;  3QEP A;  5FRO A;  3DM2 A;  2Z1G A;  1JLA A;  2XY6 A;  4FJL A;  4OVL A;  5FDL A;  3ASM A;  1JL2 A;  2HND A;  3ITH A;  4DQS A;  2BE2 A;  1NJY A;  4FLV A;  3V9U A;  3QIN A;  2GBZ A; 
#chains in the Genus database with same CATH topology
 3O4Q A;  3BF1 A;  3QEV A;  3R9P A;  4ILJ A;  3NF7 A;  3D2F A;  2BH1 A;  4CF0 A;  3WEE B;  4L3Q A;  4JI1 K;  3VQB A;  3WNG A;  3VGM A;  3BF3 A;  3L3U A;  2HHT A;  4YOT A;  1ZC6 A;  4CEQ A;  2QKK A;  3OBW A;  2O8E A;  1J53 A;  1V4T A;  1D8Y A;  2OZS A;  1S5J A;  3PX6 A;  1XNQ K;  1HQU A;  2Q1N A;  3AGR A;  1DTT A;  1YTA A;  3K5M A;  2OYQ A;  4C1N I;  1DTQ A;  5GAE P;  4WQ5 A;  5J2P A;  4FPB A;  2P9U B;  4BR2 A;  2GWJ A;  1OH6 A;  2PZS A;  5HRO A;  4IZ9 A;  2PY5 A;  3MED A;  4XEI A;  1OVQ A;  2KFN A;  4CI6 A;  4LF7 K;  2WUS A;  4GKK K;  3FZM A;  1F21 A;  5IT9 O;  3ID6 A;  1D4X A;  4JKF A;  4CHP A;  4Z4I A;  2YJF A;  1X9J A;  1YT3 A;  2FBT A;  4JV5 K;  1RBU A;  1UA1 A;  1R59 O;  3ZT0 A;  2O8F A;  3C6A A;  1QHT A;  5CE3 A;  1ESV A;  1LAW A;  3AVG A;  3J8A A;  4J8F A;  2X74 A;  3ENB A;  1RDB A;  1TV6 A;  3KD1 E;  3SUQ A;  4CJF A;  4DS5 A;  3NVM A;  2Q36 A;  4YDU C;  3JSM A;  3AVC A;  1Z26 A;  1GLD G;  3TU5 A;  3OYF A;  1S1T A;  4BE1 A;  1ZXO A;  1NGI A;  2VCP A;  3FZL A;  1TYQ B;  1JLE A;  2KQ2 A;  3QFP A;  5CHI A;  1LW2 A;  3E66 A;  3PSI A;  3AVK A;  4DR7 K;  2A1S A;  1NJI O;  2VWK A;  3SLC A;  2ATQ A;  4CEO A;  3ATU A;  1WBB A;  2QWL A;  4B9L A;  1N34 K;  3SMP A;  2P51 A;  2FXU A;  4HUF A;  2VGM A;  4B1W B;  3L3V A;  4B9V A;  4OKE A;  3CFO A;  4B9U A;  5LMN K;  2OPQ A;  5F2R A;  1LW0 A;  1U4B A;  1SL1 A;  4IG3 A;  3DYA A;  1TL1 A;  1MWM A;  4LC9 B;  3LDL A;  3EE8 A;  4CGD A;  4F2R A;  2OPR A;  1J54 A;  3MEE A;  3R3L A;  3ZSX A;  4NCA A;  3ZX3 A;  3GG4 A;  3LP3 A;  2FSJ A;  4N41 A;  3JS6 A;  3QNO A;  1XC9 A;  1N6Q A;  2RHK A;  2D0C A;  2QWP A;  3RSE A;  1NGJ A;  1S6Q A;  2QA4 N;  1BA0 A;  1QQC A;  2V7Y A;  1Q9Y A;  4BR7 A;  3V6D A;  5CY4 A;  4DV1 K;  3KHY A;  3V9Z A;  3FZK A;  3JYT A;  4IOX A;  4BDZ A;  4M45 A;  3AVJ A;  1ASV A;  1GOB A;  1QSY A;  3AA5 X;  2A41 A;  3P38 A;  3PY8 A;  4CJW A;  1HPZ A;  5HRS A;  4FJI A;  3VMF B;  3F5T A;  4NYN A;  4B1V A;  5SWM A;  4H0V B;  4QAG A;  3M3Z A;  3SBT A;  3NGI A;  2YHX A;  1UAX A;  3IDH A;  1NK7 A;  3TTC A;  5DMR A;  1RTI A;  4MO4 A;  3U9Z A;  3KLF A;  4QCL A;  5JVG L;  1YUW A;  2G8H A;  3HT3 A;  4E1M A;  1IBM K;  3C94 A;  1T05 A;  1Z25 A;  4CFA A;  1ITG A;  4BVP A;  2NNW A;  1GLF O;  4CZE A;  3OS1 A;  5KRT A;  3TAN A;  4CF1 A;  4Y1D A;  3TAM A;  3WEE A;  4CIG A;  4NO7 A;  1NK8 A;  3CJB A;  1RDW X;  4ELU A;  4K25 A;  3L4I A;  3P5J A;  4E7K A;  5AZI B;  2E5L K;  4KI4 A;  4FM1 A;  4DKW A;  4CBU A;  1EXQ A;  3VEN A;  1TAU A;  1WUA A;  5ADX H;  4CGF A;  1C6V A;  3NF8 A;  3U6F A;  3ALY A;  1YXQ A;  4DS4 A;  4OLA A;  3OVN A;  1QSS A;  4JHD B;  3CPE A;  2WOM A;  3LL3 A;  1J5O A;  2P9U A;  2ZF5 O;  1C1C A;  1XUP O;  2I5J A;  2X6S A;  4DQI A;  3CCQ N;  3VOV A;  4ELT A;  3THX A;  2YNG A;  5LY3 A;  4DV5 K;  1FKP A;  2H3G X;  1NMD A;  3AO2 A;  4HCC A;  1CXU A;  1VSK A;  2F8S A;  5GAG P;  2FC0 A;  4RG8 A;  4CGJ A;  4FJK A;  3FR0 A;  2HW3 A;  5AQY A;  4BAC A;  3FLC O;  2KLA A;  2W40 A;  5T7B A;  3CER A;  4FJX A;  3CC7 N;  5AFU H;  4AHV A;  4FJG A;  3CG7 A;  1RDA A;  3RMC A;  3AY9 A;  3D2E A;  2B6A A;  1QE1 A;  1XI1 A;  3U4L A;  3V81 A;  1T3V A;  4DCH A;  4ILG B;  4BR9 A;  4WQ4 A;  4CJV A;  1KVB A;  1I94 K;  4DV7 K;  2FSK A;  3LAN A;  1BDG A;  5C42 A;  3SV4 A;  2IOC A;  3ATV A;  4MO5 A;  1X9W A;  1LCU A;  4CE9 A;  3VA0 A;  3EN9 A;  2A5X A;  1NK5 A;  3WQU A;  1ASW A;  4K41 A;  1U49 A;  2VG5 A;  3AO5 A;  3VGK A;  5AJ3 K;  2IS3 A;  4JK9 A;  5AQM A;  2YHA A;  3DXM B;  3ZT1 A;  2RN2 A;  1NK0 A;  1W2B M;  3VQA A;  4DSJ A;  5E41 A;  3O3F A;  4BGA A;  3ZT2 A;  3WXJ A;  3K59 A;  1WBD A;  4WFA L;  4BC2 A;  1VSD A;  2D0A A;  2X78 A;  4CGI A;  2OA8 A;  3K2P A;  4BQZ A;  3ZT3 A;  4EHU A;  1U48 A;  4KAZ A;  4DTR A;  1WAJ A;  3MXI A;  3NF6 A;  4JKA A;  4O0J A;  2VQF K;  1CZB A;  3U9D A;  1NK9 A;  4BG8 A;  3O4N A;  4YFU A;  2VG6 A;  3AO3 A;  1QQM A;  5FPN A;  2O8C B;  3PV8 A;  1IKW A;  2P9P B;  3O80 A;  3AVN A;  1BA1 A;  3AAP A;  4H0P A;  4FM0 A;  3T1H K;  2HST A;  2D1K A;  3S3O A;  4JS4 A;  4XH4 A;  4C8K A;  2P9L B;  1LAV A;  4O8K A;  1SL2 A;  3H08 A;  4E1J A;  2O4G A;  5M1P A;  3MN7 A;  5JLF A;  4C1N K;  3C0B A;  3AVB A;  3O9S A;  1RGI A;  4R5P A;  1RT4 A;  1WB9 A;  1BUP A;  4FW2 A;  1ZBF A;  1HYZ A;  3ZSZ A;  4CJ5 A;  4FWM A;  1KLN A;  1GLA G;  4B3O A;  2YV0 X;  1BIS A;  1R0A A;  3U8X A;  3VTH A;  4U67 L;  3LAL A;  4E3S A;  1JCE A;  1QZ6 A;  1ZBL A;  4I9Q A;  1S72 N;  2KZZ A;  3D6R A;  3WNE A;  3K5O A;  5HL7 L;  5FPD A;  4IDK A;  2A6A A;  4ICL A;  3OYE A;  2YHB A;  3VEO A;  1HLU A;  3FZH A;  1IO2 A;  5JLH A;  2F4V K;  5AQS A;  1X3M A;  3I8D A;  4DSE A;  4B9M A;  4C8N A;  4FLU A;  1QQO A;  2QM1 A;  4MLH A;  1KLM A;  2QW9 A;  4FOE A;  4AIL C;  4JHD A;  3FE1 A;  3ENO A;  4ISE A;  1YF5 L;  4Z4C A;  3DLE A;  1VSI A;  5C12 A;  2IIR A;  1XMQ K;  5DM6 L;  2UUC K;  1SQK A;  3A5M C;  3IRX A;  3ZSO A;  4HHT A;  4CHZ A;  4CES A;  4FJ8 A;  2YNH A;  2NLX A;  2V52 B;  1NWK A;  3DM2 A;  2Z1G A;  1JLA A;  4QS7 A;  4FJL A;  2BE2 A;  5AQH A;  3PX0 A;  3I0R A;  1K8A O;  2FLO A;  3OS2 A;  2PAV A;  2QWM A;  4CFB A;  2A40 A;  1P8Z A;  1TGO A;  3D0P A;  1VSH A;  1A5W A;  2HBM A;  4KTZ A;  3SMS A;  4M7Y A;  2NZT A;  1T6C A;  3LDS A;  1X9M A;  3ZYY X;  4BRF A;  1G99 A;  1VQO N;  3E1Y A;  1HYS A;  4RW4 A;  4FXD A;  5SZT A;  4LSL A;  1HQE A;  3GDQ A;  3MWT A;  1XNR K;  1BWF O;  3CQY A;  3AA3 A;  3HSC A;  2P9K B;  2D4W A;  4Y0W A;  5KRS A;  2ZJR L;  2ITM A;  1JJ2 M;  3T69 A;  4CK3 A;  1OKJ A;  3DXM A;  2Y1I A;  2IVN A;  3DXK B;  4DR1 K;  4CER A;  4FJJ A;  4A5B A;  3L2R A;  4B1X B;  3K9K A;  3ZX0 A;  4R79 A;  4CJP A;  3HVT A;  3IAY A;  2P9I B;  2NUB A;  4Q5V A;  1JKH A;  4JLH A;  4MFB A;  3SZ2 A;  1IKV A;  1Q7Y O;  3TAQ A;  3WT0 A;  4KTW A;  1J5E K;  4CK2 A;  4KPY A;  4BDY A;  4W5T A;  4DQQ A;  3I33 A;  3AVH A;  3ZX2 A;  2QWQ A;  1OH5 A;  2ZD1 A;  4CF2 A;  3FFI A;  4C23 A;  4H5R A;  2O8C A;  4CJ7 A;  3LP2 A;  3IUC A;  3OYH A;  1LV5 A;  4JYA K;  4V19 S;  4JRP A;  3F73 A;  4CIF A;  2PFU A;  5EY4 A;  5D3G A;  3TWH A;  2DFE A;  3V4I A;  3C6T A;  5BN8 A;  2P9L A;  3NAE A;  4M3R A;  1QZ5 A;  3MCP A;  1U2V B;  4FM2 A;  1N33 K;  2O8D B;  4DF4 A;  4CCH A;  4DB3 A;  1KVC A;  4AQY K;  3P39 A;  2G8W A;  3NH2 A;  1NKE A;  4N76 A;  3R1X A;  4U7B A;  3SQ4 A;  3EO3 A;  1BI4 B;  4KKO A;  3N4Q A;  1KCF A;  1VRU A;  4AHR A;  4YOR A;  3K5N A;  3H6E A;  1K6Y A;  1O13 A;  5AQX A;  4RW9 A;  1L3T A;  1VRT A;  1ZBI A;  4OPK A;  4PKI A;  1RBV A;  3VQC A;  1HPM A;  2HHX A;  4YOU A;  4O5B A;  3J7Y P;  4XIU A;  4ZTF A;  3MN9 A;  5HP1 A;  3QEI A;  3NH1 A;  3G71 N;  1VQ8 N;  4GV3 A;  2A3Z A;  2HBK A;  4CF9 A;  4NB4 A;  2UUB K;  4KH4 A;  1C0F A;  4NCG A;  4PWD A;  4BVO A;  4KI6 A;  4J2A A;  4Z94 A;  3RTV A;  1NJW A;  4CJ4 A;  3LP0 A;  3SQ0 A;  3MK6 A;  4IEE A;  2VWJ A;  1RT6 A;  3KTQ A;  4KBO A;  5AQT A;  1MA9 B;  3SYZ A;  3M8Q A;  4A5A A;  1EO1 A;  3VEV A;  4DLG A;  2HBJ A;  3VQ5 A;  4KHQ A;  4AHT A;  2UU9 K;  4BRA A;  1IG8 A;  3M6G A;  1NNE A;  3B8A X;  2AJQ A;  1TUY A;  1HNZ K;  4AM6 A;  3K5L A;  2EWS A;  1FXX A;  2R7Y A;  1WAF A;  1QVG M;  4DUY K;  3HOT A;  1QTM A;  4KH6 A;  1Y64 A;  3CM5 A;  3MEG A;  4BRI A;  3O3G A;  1SZ2 A;  1BIU A;  3KK7 A;  4KB0 A;  2XY8 A;  3T1Y K;  3NGY A;  1D5A A;  5JMV A;  4FLZ A;  2NRT A;  4JEP A;  5BRE A;  3CJA A;  3QNN A;  3O9T A;  5BR8 K;  1IV0 A;  1VQ6 N;  1LWF A;  2O8B A;  4CZJ A;  1T8E A;  3DI6 A;  5AQL A;  2JLE A;  3OYC A;  2IVO A;  2Z1H A;  4B9N A;  3HM9 A;  4DWI A;  4WQ4 C;  1SV5 A;  4CJ3 A;  1BGX T;  2FBX A;  4DTJ A;  3DLH A;  1Q82 O;  3SK3 A;  4A2B A;  3HO1 A;  5HOO A;  1U6Z A;  1X1P A;  3KLH A;  4PA1 A;  3QEW A;  1BU6 O;  4O55 A;  3NCI A;  4BRN A;  4GNI A;  2GWK A;  1XC3 A;  1FK9 A;  4FJH A;  2YCH A;  4PL8 A;  1VQ9 N;  4HWI A;  1BHL A;  4JS5 A;  1BO5 O;  1NJX A;  4CZH A;  4BRM A;  3M8S A;  2F8T A;  4IOA L;  3ULD A;  4HTU A;  3VF6 A;  1E4F T;  1EKE A;  3AVL A;  3HRG A;  1JXE A;  3FGU A;  4DTM A;  1JL1 A;  4GY2 B;  2YNF A;  1GLJ O;  3G25 A;  4DFK A;  5IWA K;  4CGG A;  1TL3 A;  4FWL A;  3KKR A;  4CW7 B;  4M3Z A;  4FLY A;  4W5O A;  1C1B A;  2OPP A;  1VQ5 N;  4LF9 K;  1YHQ N;  4FL9 A;  4H0T B;  2HHV A;  1A5V A;  5H1S Q;  5M1K A;  4LF4 K;  5FPM A;  3JAM O;  5AQW A;  4MQ3 A;  3UE5 A;  2Q0U A;  3PUF A;  4I2P A;  3LDO A;  1NM1 A;  2RPI A;  4BR0 A;  3CQ8 A;  4NLC A;  5JVH L;  4DFM A;  1VQ7 N;  4BRE A;  1VSL A;  3CCL N;  1U2V A;  4O0I A;  4O44 A;  4IBN A;  4W5Q A;  1YTU A;  3LPT A;  3E01 A;  1MDU B;  3F2K A;  1U04 A;  3O8M A;  4I6M B;  4B8A B;  2UUA K;  3SJH A;  4WCE L;  3SAG A;  3VPZ A;  3HL8 A;  1JXB A;  4CZL A;  4JD2 B;  3KWG A;  3DRP A;  3QIP A;  1NGF A;  5AQQ A;  5M1N A;  1BI4 A;  2NRH A;  5GAD P;  2DTU A;  3GBT A;  5BN9 A;  3QIO A;  4LD0 A;  2DFH A;  4YNQ A;  1S1U A;  3UKR A;  1FKO A;  3TSP A;  5C0Y A;  3WXI A;  2RKI A;  3CQX A;  1M90 O;  2ZGY A;  4DR6 K;  1SUQ A;  4FK2 A;  4LFA K;  5KPR A;  1NGB A;  3O9Q A;  4CHO A;  4B8C A;  3DOL A;  2FSN A;  3BZC A;  4ID1 A;  2KW4 A;  4BR4 A;  4DTU A;  3AO1 A;  3A2F A;  3AGK A;  1S9G A;  3RR8 A;  4H0O A;  3AO4 A;  4CZK A;  1RDC A;  1HR0 K;  4BRQ A;  5EVZ A;  3CI5 A;  4M63 C;  4TSX A;  2Q97 A;  4M3X A;  4FYD A;  4BGB A;  3PO5 A;  4IXC A;  1W9H A;  3ULE B;  1EQY A;  4DV0 K;  3V1O A;  2VQE K;  2QI2 A;  5LJW A;  1W0H A;  1TAQ A;  4CEB A;  4WYB A;  1J9A A;  1Q9X A;  4DU1 A;  4FLW A;  3ZEU B;  4CJQ A;  1UWB A;  5BRD A;  3NH0 A;  3D7E O;  3M8R A;  2FF6 A;  1RTD A;  3TAF A;  2HMP A;  4JKE A;  3J7A P;  4NCB A;  4KFB A;  3J80 O;  4JI3 K;  4DV4 K;  4CBW A;  1NK4 A;  2IC3 A;  4IO8 A;  1Q81 O;  3NMU A;  3VF2 A;  1B9D A;  4FJ7 A;  3O9R A;  4Q0B A;  3KK2 A;  3VQP A;  1OH7 A;  4K42 A;  3RR7 A;  5CYM A;  3OHR A;  2YI1 A;  2E6L A;  3CET A;  3O1W A;  2HHQ A;  2D0P A;  4CGH A;  4A62 A;  4KTQ A;  4Z4F A;  4A61 A;  3EE9 A;  1TYQ A;  3SAH A;  3CME N;  2GX9 A;  2HHW A;  4DF8 A;  3E9P A;  2WBN A;  4G1Q A;  3RRG A;  1OVY A;  4CZG A;  1HJR A;  3L8B A;  4CVN E;  4A2A A;  4GW6 A;  3AVF A;  4J2D A;  4BY9 C;  4ID5 A;  4KHN A;  3QEP A;  5FRO A;  2KHO A;  2XY6 A;  4FWS A;  3ASM A;  2HND A;  1CZA N;  4FOI A;  3G6E N;  4LFB K;  3V9U A;  3QIN A;  4BRC A;  1NLV A;  5KQ8 A;  1BOT O;  3L6Q A;  1NOZ A;  3MXM A;  3VEY A;  3S9H A;  3LPU A;  4OX9 K;  3MDQ A;  1KAY A;  4KHU A;  4IG0 A;  1TUU A;  4BRP A;  1S3X A;  4ZTJ A;  1KAX A;  1RT3 A;  4OPH A;  3ZSV A;  5C2D A;  2ETJ A;  3PIO L;  1I39 A;  3L2Q A;  4B9T A;  2HVH A;  1S1W A;  1GOA A;  1RBR A;  2VGN A;  2Z1J A;  5JS2 A;  2LSN A;  1A5X A;  1D9F A;  5DK5 A;  2RF2 A;  2NRZ A;  3VQ6 A;  3VQ9 A;  1I3A A;  5B8H A;  2HF4 A;  4FPA A;  4CHY A;  1NGH A;  3WNH A;  4Z0U A;  3VET A;  1HNW K;  1IBK K;  1KD1 O;  3D45 A;  1S6P A;  1G15 A;  2NRR A;  3E9L A;  1FW6 A;  3IG1 A;  4HUE A;  3MEC A;  4BG9 A;  3BUZ B;  4MDB A;  2QTD A;  3C95 A;  4BRD A;  1C0G A;  1K8K B;  5HRN A;  3EY1 A;  3CCM N;  2CGK A;  4L8R B;  3LDQ A;  4FWQ A;  3HXM A;  4PY5 A;  4H5T A;  3LAK A;  4GKJ K;  1GLE G;  2KTQ A;  3O3H A;  4YY3 K;  4FLT A;  4H03 B;  1NBW A;  3CCV N;  3KLE A;  2OPS A;  3TTF A;  4YOX A;  3M1F A;  4CK1 A;  4DG1 A;  4DTS A;  4BE2 A;  3OW2 M;  2G8V A;  2GEL A;  3C6H A;  1TVR A;  4B1Z A;  2D0B A;  1C0M A;  1WSE A;  1U47 A;  2QWR A;  1VSJ A;  5TKY A;  5JIC A;  4DU3 A;  3O9U A;  4BWJ A;  4EHT A;  4NXM K;  3CC4 N;  3DRR A;  2ZJP L;  5GIO A;  1BIZ A;  1WLJ A;  4DTP A;  4DLE A;  3SPZ A;  2ASP A;  4A59 A;  4I9L A;  5AZI A;  2BGG A;  3KK1 A;  3EKU A;  1WNS A;  4JK7 A;  4YHH K;  1BQM A;  4E7H A;  3MN5 A;  3VQD A;  3ULE A;  1WSG A;  3R6M A;  3MN6 A;  4FO0 A;  4OO1 J;  2P9N B;  2GTD A;  3AV9 A;  4CJS A;  2FBY A;  2ZJQ L;  2HF3 A;  4CEF A;  2HMI A;  5AQR A;  3VN5 A;  5AZJ B;  3QER A;  4J2E A;  3EEQ A;  4WQ5 C;  4HUG A;  4DFJ A;  2Q0R A;  1NMN A;  5KQD A;  2Q3S A;  2XRI A;  2BTF A;  4JI6 K;  3SQ1 A;  4M42 A;  3SPY A;  3KD5 E;  1YJ9 N;  3MWP A;  3C6U A;  4QOZ B;  4EAH D;  4Z4H A;  3IKM A;  2CH6 A;  4EIA A;  3THV A;  2E2O A;  3A5N C;  4DSI A;  4OPJ A;  4BRL A;  2X6N A;  3CPW M;  5AQJ A;  3O4W A;  2XY5 A;  5ELZ A;  3WNF A;  4KV8 A;  4BQL A;  4JKD A;  2O4I A;  3NVK A;  1Q8I A;  4IDH A;  3TPQ A;  1RTH A;  3LZI A;  4XH1 A;  4E7J A;  3OYA A;  4DSL A;  2HHS A;  3DRS A;  2G8U A;  3QFU A;  4BWM A;  1HKG A;  3KLI A;  5J1E A;  5C15 A;  1RT5 A;  3R8E A;  3H3N O;  3CIP A;  3V1Q A;  1RT1 A;  5E26 A;  2O8F B;  1C0U A;  4CFC A;  1NG9 A;  4GMJ B;  2E4L A;  3EYZ A;  4K43 A;  2KFZ A;  4F3T A;  4CEZ A;  1EP4 A;  5AQG A;  3HYF A;  1NK6 A;  3HBT A;  1RNH A;  3HZ6 A;  4CHN A;  4IOC L;  3UB5 A;  3L2W A;  1K73 O;  2YHY A;  3C7N B;  3Q7C A;  4JK8 A;  3KKS A;  1VQK N;  1KXP A;  2QK9 A;  1Y97 A;  5BPN A;  1S1X A;  5FRM A;  3ZSR A;  4B1U B;  4AHC A;  4H0X B;  3AA4 A;  1HYV A;  2E2P A;  4DMN A;  1E3M A;  1TK8 A;  4UY8 O;  3MX5 A;  1RDD A;  3CF5 L;  4OGE A;  4DSK A;  1NGE A;  4E89 A;  3OYG A;  1CZ9 A;  1QSL A;  1WSH A;  3T19 A;  3QML A;  4K8X A;  1SKW A;  5CYQ A;  4QS9 A;  4EZ6 A;  1CXQ A;  5C24 A;  3VQE A;  2NRX A;  2E1Y A;  3DAW A;  3ZET B;  4RW8 A;  1L3U A;  3UKU B;  1YJW N;  1XWL A;  3ISN C;  4W5R A;  5AQU A;  5CZ1 A;  3PO4 A;  1BG3 A;  4KH5 A;  4DTN A;  1KC8 O;  2P9P A;  2W41 A;  2P5O A;  4FCY A;  5HRP A;  1HX1 A;  1WSF A;  1OH8 A;  2P1J A;  2D0O A;  4CZI A;  1XMO K;  2OAN A;  3ZSY A;  3P4I A;  4YOV A;  1IKX A;  3PX4 A;  1K8K A;  2XO7 A;  3LAM A;  1KFD A;  2G8I A;  3RMB A;  3QO9 A;  4KRE A;  1O1W A;  4BC4 A;  1KQS M;  4DR4 K;  1WN7 A;  5LJV A;  5M1O A;  4CF8 A;  4DR2 K;  1RFQ A;  2HB5 A;  1W97 L;  4JN4 A;  4LFC K;  4KHS A;  3RMD A;  1H1V A;  4QS8 A;  4HVJ A;  4RW6 A;  4PL7 A;  1YIT N;  1RCH A;  1XHX A;  3QIC A;  3L2U A;  3DLR A;  4H4M A;  3F9M A;  2VWB A;  4KHW A;  1ZBU A;  5I3U A;  4I2Q A;  3G0Z A;  4I7F A;  1ASU A;  3TAB A;  4G9Z A;  2JGU A;  4O4G A;  4FK4 A;  4CZF A;  3SI6 A;  4B9S A;  4FVM A;  4BE0 A;  3G10 A;  3JXU A;  3CYM A;  4H8K A;  4B3S K;  3ZSQ A;  5KI6 A;  1NKC A;  5K14 A;  4F3O A;  4FWP A;  5AZJ A;  4N56 A;  1IKY A;  1SKR A;  1BCM A;  3MX2 A;  4CJT A;  4CD3 A;  3DWL A;  3MAQ A;  4JRQ A;  5BPM A;  4JI2 K;  1K9M O;  1TKD A;  1S1V A;  1HNV A;  3CM6 A;  4DSF A;  2E2N A;  1NKB A;  3LZJ A;  4LH4 A;  2ZQB A;  3HK2 A;  4IJN A;  1JLF A;  4WFN L;  4CHQ A;  4X64 K;  3SAF A;  3OJS A;  1NU0 A;  3H45 C;  3THY B;  3CD6 N;  1SAZ A;  3E9O A;  2A1R A;  1NOY A;  4IFV A;  4NLB A;  3THX B;  1N5Y A;  4ISF A;  4H5V A;  4JKC A;  1LWC A;  2YJE A;  4AM7 A;  4BRH A;  3VEX A;  1ATN A;  3I55 N;  2D5R A;  1CLQ A;  5FLX O;  5M1Q A;  1Z05 A;  3QEX A;  1HJO A;  4JKH A;  1RTJ A;  1JLQ A;  2HVI A;  1MU2 A;  2P9K A;  3V9X A;  2P9S B;  3KJV A;  3W0L A;  3D2E B;  1HRH A;  3TTD A;  3C7N A;  3DXK A;  2P5G A;  1LWE A;  1C0T A;  4OGC A;  2E6M A;  3J7Z O;  5F1X A;  5BRH A;  4M3U A;  1QVF M;  3OJU A;  5HRR A;  2UXC K;  2WC9 A;  3DMJ A;  5AQK A;  3O1B A;  5KPZ A;  3LWM A;  5AR0 A;  2P9I A;  2F9W A;  4B3R K;  4BDP A;  3N4P A;  3QLH A;  2E8A A;  4DUZ K;  3NE6 A;  2RE2 A;  1WOQ A;  2GUI A;  2QKB A;  4FVU A;  4CZM A;  1WSI A;  3ZET A;  3LDP A;  3UKU A;  3LP1 A;  4FWR A;  3K58 A;  3BGR A;  4DV3 K;  3CCU N;  3KLG A;  1VSE A;  4DV6 K;  4M41 A;  3DOK A;  3AA2 A;  4X65 K;  5GIN A;  4E0D A;  4FLX A;  4LF5 K;  2QXL A;  3CC2 N;  1JLC A;  3WXL A;  2Y1J A;  4XH5 A;  4F8R A;  5BRF A;  3QDK A;  1T7P A;  5FPE A;  5EU7 A;  4RTF D;  2B4J A;  2NRW A;  4CEC A;  1ILY A;  1X3N A;  2O8D A;  2Q2R A;  4OVL A;  5FDL A;  4DQS A;  1JL2 A;  3ITH A;  1N32 K;  1NJY A;  4B3M K;  4FLV A;  1ZBS A;  2GBZ A;  3W3D A;  1HUX A;  3PIP L;  4RWT A;  3OTO K;  4BRK A;  2IGI A;  1VQ4 N;  3TSQ A;  4FWK A;  4LF8 K;  4X62 K;  2I7P A;  2FBV A;  3NDK A;  3ZLJ A;  4FW1 A;  1Z6R A;  3SQ2 A;  5J2M A;  3SV3 A;  5AQF A;  1EX4 A;  4AH9 A;  1TKZ A;  1YJN N;  3O08 A;  1U45 A;  2YKM A;  1SKS A;  3L4Q A;  1FJG K;  3OYK A;  4DR3 K;  5J2N A;  2CH5 A;  3GL1 A;  4B08 A;  3OYM A;  5AQN A;  5I9E B;  2AP1 A;  3KVG A;  4MDA A;  5KTQ A;  4CD1 A;  3HOS A;  4ISG A;  2BDP A;  4HTL A;  1NJZ A;  1V4S A;  4JKG B;  1MWK A;  1REV A;  4DTX A;  2HHU A;  3A5O C;  5C10 A;  2YHW A;  2UXD K;  1VHX A;  3MCA B;  4WE1 A;  2W42 A;  3ID8 A;  2UXB K;  3UIQ A;  3CCE N;  4RW7 A;  2DPN A;  4CJK A;  4KHP K;  3BP8 A;  3TAR A;  3TAP A;  3LDN A;  3ZT4 A;  1KFS A;  3TSU A;  3IS9 A;  1L5U A;  1GLC G;  3BZK A;  4CFD A;  2ZE2 A;  1HKC A;  2JWL A;  3NHG A;  1B9F A;  4EP4 A;  4JI5 K;  3SBG A;  5BPL A;  3O5B A;  5BR9 A;  3EL2 A;  3SJJ A;  2V51 B;  4DR5 K;  2XHB A;  1TKT A;  4KO0 A;  4YOY A;  1XHZ A;  3AVI A;  3CFP A;  2EX3 A;  3OA9 A;  4Z4E A;  4X66 K;  1EWQ A;  3L0Q A;  3THY A;  1KRP A;  1JLB A;  1VSF A;  1IH7 A;  3U3Y A;  5MLC Q;  2Q31 A;  3AVA A;  3WXM B;  3BY5 A;  2GEM A;  4B9Q A;  5LL6 Z;  3T7Z A;  3ZCM A;  2KZM A;  4N47 A;  1KVA A;  1L3V A;  2QWN A;  3HI0 A;  5AQP A;  1N8R O;  4HCB A;  3THW B;  4CJE A;  1EET A;  1EWR A;  4K8Z A;  4AF1 A;  3K9J A;  3M8P A;  3DLG A;  5I42 A;  4C8O A;  4DQR A;  4YOW A;  2UYT A;  3BDP A;  1HKB A;  3KZB A;  4DHY A;  1UOC A;  1DEJ A;  2P9S A;  3ENH A;  5CZ2 A;  4YDU A;  4LF6 K;  1HNI A;  2F7T A;  4ELV A;  3H1Q A;  3AAR A;  4JI0 K;  4CIE A;  4M3T A;  3J81 O;  1GLB G;  3TAG A;  3SUN A;  3CCR N;  2V7Z A;  4C8L A;  2WFB A;  2F96 A;  2GV9 A;  4KRF A;  2E1Z A;  1RDU A;  4JI7 K;  4BC3 A;  5LMU K;  2CGL A;  4DQ8 A;  4FWO A;  4ZHR A;  2PYL A;  1JCG A;  3RWU A;  4LH5 A;  4JKB A;  3RRH A;  2HNY A;  2QXF A;  1KAZ A;  2JWK A;  4FZY A;  4BR5 A;  3U3G A;  4W5N A;  2ZM6 K;  1M1K O;  3HVR A;  1NGG A;  3H3O B;  3OS0 A;  1B92 A;  5C25 A;  2VG7 A;  4OKJ A;  3H1V X;  3CJ9 A;  1RIL A;  3CJC A;  4LY7 A;  4H5N A;  4FZZ A;  4ILH A;  1T03 A;  3DLB A;  4O5F A;  3HPH A;  3MMV A;  3HTV A;  4H5W A;  3PSF A;  3RMA A;  3I8B A;  4JNE A;  4AHS A;  4PKG A;  4B3T K;  3HM8 A;  4K0K K;  3OYN A;  1DGK N;  4J2B A;  3L2V A;  3NF9 A;  3P1G A;  2YKN A;  4C8M A;  4I6M A;  2YX6 A;  1VAZ A;  3ZSW A;  4BRG A;  4CJR A;  3LM2 A;  3HJF A;  3VEZ A;  3OYL A;  4JD2 A;  1JLG A;  3VEW A;  4PKH A;  1W7A A;  4WF9 L;  2PYJ A;  5AQI A;  4Y1C A;  5J2Q A;  3V9S A;  5M1F A;  4CJU A;  4JAX A;  3I0S A;  3OBY A;  3VQ8 A;  4CEE A;  4CBX A;  1VQP N;  3V1R A;  2OTJ N;  1DKG D;  3BEX A;  5GAH P;  1RT7 A;  2HBL A;  4MLE A;  2QEX N;  3DJC A;  1WSJ A;  3DLL L;  3VF4 A;  3WQT A;  4RCH A;  3VTI A;  2ZWH A;  3RVC A;  2CGJ A;  3DLK A;  4EFH A;  3OY9 A;  2OCE A;  3SNN A;  4JKG A;  1DLO A;  2HOE A;  1VSM A;  1Q86 O;  1NGD A;  1XQS C;  3K57 A;  4A57 A;  3I56 N;  4OPA A;  3CJ7 A;  3A8Y A;  4H4O A;  1NGA A;  1RBS A;  3VER A;  4CEA A;  4E7L A;  2G8F A;  2DFF A;  1VQM N;  3B6O A;  5DM7 L;  3EZW A;  4Z4G A;  2Z1I A;  4PUO A;  1VQL N;  3ZEU A;  2PBD A;  5A2Q O;  3D2F B;  3NBP A;  2B5J A;  1JCF A;  2VYP A;  4E1N A;  4EP5 A;  3VQQ A;  1J6Z A;  1BL3 A;  2ASM A;  2I7N A;  1SL0 A;  2WON A;  5CR4 A;  4BRO A;  4OJR A;  2O8E B;  4FJM A;  5KPT A;  3OYI A;  3T1A A;  2A42 A;  3CFR A;  4DTO A;  4IJA A;  5KGX A;  5TKW A;  4FJN A;  3GOI A;  2IAJ A;  4E19 A;  3CCS N;  5JS1 A;  3IMX A;  4E7I A;  1BCO A;  2FF3 B;  4UQG A;  5ADX A;  4N5S A;  4KHY A;  3C65 A;  4FK0 A;  4DV2 K;  1GLL O;  5AQV A;  3QB0 A;  1L3S A;  1YVN A;  2IVP A;  4BC5 A;  2HNZ A;  2J4R A;  3HP9 A;  3THW A;  2W6L A;  3CJ1 A;  4FWN A;  1HMV A;  2WTU A;  3CXC M;  1RBT A;  1RT2 A;  2E88 A;  1BQN A;  3VES A;  3P31 A;  3VQ4 A;  3S3N A;  2EHG A;  1IJJ A;  2OTL N;  3V9W A;  4EZ9 A;  3HPO A;  3IFR A;  5AQO A;  3KIO A;  3P83 D;  1YI2 N;  3VGL A;  2ASO A;  2E20 A;  1UA0 A;  4IEI A;  1LOT B;  3OYJ A;  2GUP A;  5EX5 A;  4GVM A;  3S3M A;  3HPG A;  2DY4 A;  5AQZ A;  2O8B B;  3FZF A;  5AFU A;  1HNX K;  2KKZ A;  4FJ5 A;  4PQU A;  4DQP A;  1YVU A;  1TKX A;  3WXK A;  3NGZ A;  3QET A;  3SCX A;  4GV6 A;  4IWV A;  3PLA A;  1KSP A;  3HP6 A;  4FSV A;  4O8U A;  4PHT X;  1IG9 A;  3F9K A;  3QES A;  1TK0 A;  5HLF A;  3CMA N;  2BAN A;  3EKS A;  3LM9 A;  1VQN N;  4F9O A;  4FJ9 A;  1Q18 A;  3K0S A;  4OLB A;  4M3Y A;  4DFP A;  1D9D A;  2NRV A;  3QBX A;  3AVM A;  3OYD A;  3NFA A;  4NXN K;  2AA4 A;  2F9T A;  3KWI A;  1ZYQ A;  1ZBH A;  3VQ7 A;  4CJL A;  3CCJ N;  2IDO A;  3MXJ A;  4IKF A;  1ATR A;  5EOY A;  1X9S A;  4CED A;  4WFB L;  2ITG A;  5EXW A;  3EZ5 A;  1S22 A;  1T44 A;  3TI0 A;  3A5L C;  2ZGZ A;  3H46 O;  3SUO A;  2G8K A;  3T3F A;  3AAQ A;  4IFE A;  4F4K A;  5GIP A;  3HST B;  4B1Y B;  2XY7 A;  1E4G T;  3LWL A;  2OZM A;  4F2S A;  3RSE B;  1YIJ N;  1C1A A;  3VA3 A;  4M7X A;  1QQN A;  1P90 A;  4GVE A;  5E84 A;  4DU4 A;  4OKK A;  5F0X A;  4JI4 K;  4AHU A;  4KB1 A;  3GE1 A;  3TAE A;  2BUP A;  3FFK B;  5C2F A;  1N36 K;  4FZX C;  1YAG A;  1IBL K;  1TK5 A;  3SUP A;  4JI8 K;  1QHA A;  4M3W A;  4LSN A;  1S9E A;  3G4S N;  4IFY A;  1DT9 A;  3M5R A;  5HBM A;  4IO9 L;  3QBW A;  1QS4 A;  2E2Q A;  5KGW A;  1KTQ A;  4H0Y B;  2YNI A;  4NYF A;  1SS6 A;  1T6D A;  3TR8 A;  3UKR B;  3B6P A;  3S41 A;  3KK3 A;  1GOC A;  1VK0 A;  4GV9 A;  3OYB A;  5FRN A;  3O6W A;  2HHH K;  2QWO A;  3Q7B A;  3A0I X;  3WUH A;  3CHW A;  1ATS A;  1NGC A;  2P9N A;  2W6K A; 
#chains in the Genus database with same CATH homology
 3O4Q A;  3QEV A;  3I0R A;  1NOZ A;  3NF7 A;  3OS2 A;  2IGI A;  3MXM A;  4CFB A;  3S9H A;  3LPU A;  1TGO A;  3D0P A;  4CF0 A;  1VSH A;  1A5W A;  3VQB A;  3WNG A;  4KTZ A;  4KHU A;  3L3U A;  4IG0 A;  2HHT A;  4CEQ A;  3LDS A;  4ZTJ A;  2FBV A;  3NDK A;  1X9M A;  2QKK A;  1RT3 A;  3ZSV A;  4FW1 A;  1J53 A;  3SQ2 A;  5J2M A;  3SV3 A;  2ETJ A;  1EX4 A;  1I39 A;  1TKZ A;  4AH9 A;  3L2Q A;  4B9T A;  1D8Y A;  1S1W A;  1U45 A;  2OZS A;  1GOA A;  1RBR A;  2YKM A;  1HYS A;  1S5J A;  1SKS A;  3PX6 A;  1HQU A;  2Z1J A;  5JS2 A;  2LSN A;  1DTT A;  4RW4 A;  1YTA A;  3OYK A;  3K5M A;  5J2N A;  5SZT A;  4LSL A;  4B08 A;  2OYQ A;  4FXD A;  1A5X A;  3OYM A;  1D9F A;  1HQE A;  5DK5 A;  1DTQ A;  2RF2 A;  3VQ6 A;  3VQ9 A;  5J2P A;  1KRP A;  4DSL A;  5KTQ A;  1I3A A;  3AA3 A;  2PZS A;  4CHY A;  2BDP A;  5HRO A;  3WNH A;  5KRS A;  4Z0U A;  2PY5 A;  3MED A;  2KFN A;  3D45 A;  1S6P A;  4CK3 A;  1G15 A;  1NJZ A;  1F21 A;  2Y1I A;  3IG1 A;  4HUE A;  4CHP A;  3MEC A;  1REV A;  4DTX A;  4Z4I A;  4CER A;  2HHU A;  4FJJ A;  1YT3 A;  3L2R A;  3C95 A;  2FBT A;  1RBU A;  5HRN A;  3EY1 A;  1UA1 A;  4L8R B;  4WE1 A;  2W42 A;  3ZT0 A;  3HXM A;  4PY5 A;  3LAK A;  4CJP A;  3HVT A;  3UIQ A;  4RW7 A;  1QHT A;  3O3H A;  4CJK A;  2KTQ A;  3IAY A;  4FLT A;  3TAR A;  2NUB A;  3KLE A;  1LAW A;  3AVG A;  2OPS A;  4Q5V A;  1JKH A;  2X74 A;  4JLH A;  4MFB A;  3SZ2 A;  1IKV A;  4CK1 A;  3ZT4 A;  3TAP A;  1KFS A;  4DG1 A;  3IS9 A;  4DTS A;  3TAQ A;  1L5U A;  1RDB A;  4BE2 A;  1TV6 A;  4KTW A;  2G8V A;  4CK2 A;  3KD1 E;  4KPY A;  4CFD A;  2ZE2 A;  4BDY A;  1TVR A;  3SUQ A;  2D0B A;  1C0M A;  4CJF A;  4DS5 A;  3NHG A;  1B9F A;  1WSE A;  4EP4 A;  4W5T A;  4DQQ A;  1U47 A;  1VSJ A;  3AVH A;  4DU3 A;  4BWJ A;  2ZD1 A;  3JSM A;  4CF2 A;  3AVC A;  1Z26 A;  3OYF A;  3FFI A;  3SJJ A;  1S1T A;  1TKT A;  2XHB A;  4BE1 A;  4KO0 A;  1XHZ A;  3AVI A;  3DRR A;  2EX3 A;  3CFP A;  4Z4E A;  1JLE A;  1BIZ A;  1WLJ A;  2KQ2 A;  3LP2 A;  3OYH A;  1LW2 A;  4DTP A;  1LV5 A;  1JLB A;  1VSF A;  4JRP A;  4DLE A;  1IH7 A;  3F73 A;  3AVK A;  3SPZ A;  3U3Y A;  4CIF A;  2A1S A;  5D3G A;  4I9L A;  2VWK A;  3TWH A;  2DFE A;  2ATQ A;  3V4I A;  2BGG A;  3AVA A;  4CEO A;  3KK1 A;  3C6T A;  1WNS A;  3NAE A;  3ZCM A;  4M3R A;  4B9L A;  2KZM A;  1BQM A;  4E7H A;  4N47 A;  1KVA A;  4FM2 A;  3VQD A;  1L3V A;  1WSG A;  2P51 A;  4HCB A;  4CJE A;  4DF4 A;  1EET A;  4K8Z A;  4HUF A;  4CCH A;  3L3V A;  1KVC A;  4B9V A;  4OKE A;  3CFO A;  2G8W A;  3NH2 A;  3M8P A;  3DLG A;  2OPQ A;  5I42 A;  1NKE A;  4B9U A;  3AV9 A;  4DQR A;  4C8O A;  4N76 A;  1LW0 A;  4CJS A;  2FBY A;  3BDP A;  3SQ4 A;  1U4B A;  4CEF A;  2HMI A;  1SL1 A;  4IG3 A;  1BI4 B;  3DYA A;  3VN5 A;  1UOC A;  4KKO A;  1TL1 A;  3QER A;  4J2E A;  1KCF A;  1VRU A;  4CGD A;  5CZ2 A;  4AHR A;  2OPR A;  4HUG A;  4DFJ A;  4F2R A;  1J54 A;  3MEE A;  2Q3S A;  1HNI A;  4ELV A;  3ZSX A;  4NCA A;  2XRI A;  4CIE A;  3K5N A;  3LP3 A;  3SQ1 A;  4M3T A;  1K6Y A;  3SPY A;  3TAG A;  3KD5 E;  4M42 A;  3SUN A;  4RW9 A;  1L3T A;  1VRT A;  3C6U A;  4N41 A;  4QOZ B;  3QNO A;  4C8L A;  4Z4H A;  4OPK A;  3THV A;  2F96 A;  2GV9 A;  1XC9 A;  1RBV A;  3VQC A;  1ZBI A;  4KRF A;  2HHX A;  4DSI A;  4O5B A;  1N6Q A;  4OPJ A;  4XIU A;  2X6N A;  4ZTF A;  2D0C A;  5HP1 A;  3QEI A;  3NH1 A;  2XY5 A;  4ZHR A;  2PYL A;  3RWU A;  4LH5 A;  4CF9 A;  1S6Q A;  1QQC A;  3WNF A;  4KV8 A;  3RRH A;  2HNY A;  4NCG A;  1Q9Y A;  4PWD A;  3V6D A;  2QXF A;  2O4I A;  1Q8I A;  5CY4 A;  4KI6 A;  4FZY A;  1RTH A;  3U3G A;  3LZI A;  4W5N A;  4J2A A;  4E7J A;  3V9Z A;  3RTV A;  3HVR A;  3OS0 A;  3OYA A;  3JYT A;  3DRS A;  4CJ4 A;  3LP0 A;  1B92 A;  3SQ0 A;  4BWM A;  5C25 A;  2VWJ A;  1NJW A;  1RT6 A;  2G8U A;  2VG7 A;  3KTQ A;  3KLI A;  4OKJ A;  5J1E A;  1RT5 A;  3SYZ A;  4BDZ A;  3M8Q A;  4M45 A;  1RIL A;  3AVJ A;  1ASV A;  1GOB A;  4LY7 A;  1QSY A;  3V1Q A;  4DLG A;  3AA5 X;  3VQ5 A;  4KHQ A;  1RT1 A;  4AHT A;  4CJW A;  3PY8 A;  1T03 A;  3DLB A;  1C0U A;  1HPZ A;  5HRS A;  4FJI A;  3HPH A;  4CFC A;  2AJQ A;  4NYN A;  3RMA A;  5SWM A;  3K5L A;  4GMJ B;  2E4L A;  4QAG A;  3EYZ A;  2KFZ A;  4AHS A;  4CEZ A;  4F3T A;  3NGI A;  1EP4 A;  1FXX A;  2R7Y A;  3HYF A;  2HVH A;  1NK6 A;  1UAX A;  3OYN A;  1WAF A;  1NK7 A;  1RNH A;  5DMR A;  1RTI A;  4CHN A;  4J2B A;  3KLF A;  4QCL A;  3L2W A;  3L2V A;  3NF9 A;  3P1G A;  1QTM A;  2YKN A;  3KKS A;  4C8M A;  4E1M A;  3HT3 A;  3C94 A;  2G8H A;  1T05 A;  3ZSW A;  4CJR A;  1Z25 A;  4CFA A;  2QK9 A;  1Y97 A;  3HJF A;  1ITG A;  3CM5 A;  3MEG A;  3O3G A;  3OYL A;  1JLG A;  1S1X A;  5FRM A;  3OS1 A;  3ZSR A;  1BIU A;  4AHC A;  5KRT A;  4KB0 A;  2XY8 A;  1HYV A;  3AA4 A;  4CF1 A;  3TAN A;  2PYJ A;  4Y1D A;  3TAM A;  4DMN A;  1TK8 A;  4Y1C A;  5J2Q A;  3V9S A;  1RDD A;  4CIG A;  3NGY A;  1D5A A;  4OGE A;  4FLZ A;  1NK8 A;  4E89 A;  4DSK A;  4ELU A;  3OYG A;  1CZ9 A;  3P5J A;  4E7K A;  1QSL A;  1WSH A;  3T19 A;  4CJU A;  4KI4 A;  4K8X A;  4FM1 A;  3QNN A;  1SKW A;  5CYQ A;  3I0S A;  4EZ6 A;  1CXQ A;  1LWF A;  5C24 A;  3VQ8 A;  3VQE A;  1EXQ A;  4CEE A;  1TAU A;  4RW8 A;  1T8E A;  3DI6 A;  4CGF A;  1C6V A;  3NF8 A;  2JLE A;  3ALY A;  3U6F A;  3OYC A;  4DS4 A;  1L3U A;  3OVN A;  3V1R A;  4OLA A;  1QSS A;  1XWL A;  2Z1H A;  3ISN C;  1RT7 A;  4B9N A;  4W5R A;  3HM9 A;  4DWI A;  1SV5 A;  2WOM A;  4CJ3 A;  1BGX T;  2FBX A;  5CZ1 A;  4DTJ A;  1J5O A;  3DLH A;  3PO4 A;  1C1C A;  1WSJ A;  2I5J A;  4DTN A;  2X6S A;  4DQI A;  3HO1 A;  2P5O A;  4FCY A;  5HRP A;  4ELT A;  1WSF A;  3PX0 A;  2P1J A;  2YNG A;  1FKP A;  3DLK A;  4M3Z A;  1X1P A;  3KLH A;  3AO2 A;  4PA1 A;  3OY9 A;  3SNN A;  1DLO A;  3ZSY A;  4HCC A;  1VSM A;  3QEW A;  4O55 A;  1IKX A;  1CXU A;  1VSK A;  3NCI A;  3K57 A;  3PX4 A;  2F8S A;  2XO7 A;  4CEA A;  3LAM A;  4H4O A;  4E7L A;  1RBS A;  1KFD A;  2FC0 A;  4RG8 A;  4CGJ A;  2DFF A;  2G8F A;  1FK9 A;  4FJK A;  2G8I A;  4FJH A;  3B6O A;  3RMB A;  3QO9 A;  4Z4G A;  2HW3 A;  2Z1I A;  4PUO A;  4BAC A;  4KRE A;  1O1W A;  1BHL A;  2HHS A;  4JS5 A;  5T7B A;  4FJX A;  4AHV A;  3NBP A;  2B5J A;  1NJX A;  4E1N A;  3CG7 A;  4FJG A;  1RDA A;  3M8S A;  3RMC A;  4EP5 A;  1WN7 A;  3VQQ A;  2F8T A;  2B6A A;  3ULD A;  4HTU A;  1BL3 A;  4CF8 A;  1QE1 A;  1EKE A;  1XI1 A;  2HB5 A;  3AVL A;  1JXE A;  4DTM A;  3V81 A;  1JL1 A;  1SL0 A;  2WON A;  2YNF A;  4OJR A;  4KHS A;  4FJM A;  4CJV A;  4DFK A;  1KVB A;  3OYI A;  3RMD A;  4CGG A;  1TL3 A;  3LAN A;  4HVJ A;  4RW6 A;  3KKR A;  3T1A A;  3CFR A;  1RCH A;  1XHX A;  4W5O A;  1C1B A;  5KGX A;  3L2U A;  2OPP A;  3DLR A;  4FLY A;  5C42 A;  4DTO A;  4H4M A;  3SV4 A;  2IOC A;  4FJN A;  1X9W A;  2IAJ A;  4KHW A;  4E19 A;  2HHV A;  5JS1 A;  1NK5 A;  1A5V A;  4CE9 A;  1ZBU A;  1BCO A;  3VA0 A;  4E7I A;  5I3U A;  1ASW A;  3G0Z A;  4I2Q A;  4UQG A;  4I7F A;  4MQ3 A;  1ASU A;  4N5S A;  4KHY A;  1U49 A;  3PUF A;  2VG5 A;  3AO5 A;  4I2P A;  3TAB A;  4FK0 A;  2JGU A;  2RPI A;  2IS3 A;  3CQ8 A;  4DFM A;  4O4G A;  1L3S A;  1VSL A;  4FK4 A;  4O0I A;  3SI6 A;  4B9S A;  2HNZ A;  2YHA A;  4O44 A;  4IBN A;  4FVM A;  3HP9 A;  3ZT1 A;  4W5Q A;  4BE0 A;  3G10 A;  1YTU A;  3CYM A;  2RN2 A;  3LPT A;  3E01 A;  1U04 A;  4H8K A;  1NK0 A;  1HMV A;  3ZSQ A;  4B8A B;  3VQA A;  4DSJ A;  5E41 A;  5KI6 A;  3O3F A;  3HL8 A;  1JXB A;  1RBT A;  1NKC A;  1RT2 A;  1BQN A;  5K14 A;  3DRP A;  3QIP A;  3ZT2 A;  3K59 A;  4F3O A;  3VQ4 A;  1BI4 A;  2EHG A;  3S3N A;  1VSD A;  2D0A A;  4N56 A;  1IKY A;  2X78 A;  3HPO A;  3V9W A;  4EZ9 A;  2DTU A;  3KIO A;  3P83 D;  4CGI A;  2OA8 A;  1SKR A;  1BCM A;  3QIO A;  4LD0 A;  2DFH A;  4YNQ A;  1S1U A;  1UA0 A;  3K2P A;  1FKO A;  4CJT A;  3OYJ A;  4GVM A;  3MAQ A;  4JRQ A;  3S3M A;  2RKI A;  3HPG A;  3ZT3 A;  2DY4 A;  1TKD A;  1S1V A;  1HNV A;  1U48 A;  4KAZ A;  3CM6 A;  4FJ5 A;  4DSF A;  4DTR A;  1WAJ A;  3MXI A;  3NF6 A;  1SUQ A;  4LH4 A;  4O0J A;  1CZB A;  3LZJ A;  1NKB A;  2ZQB A;  1NK9 A;  4FK2 A;  3HK2 A;  1JLF A;  4PQU A;  4CHQ A;  3O4N A;  4DQP A;  4YFU A;  3OJS A;  4CHO A;  4B8C A;  3DOL A;  1YVU A;  2VG6 A;  1TKX A;  3AO3 A;  3NGZ A;  3QET A;  4ID1 A;  3PV8 A;  2KW4 A;  4DTU A;  1IKW A;  3SCX A;  3AO1 A;  3A2F A;  2A1R A;  3AVN A;  3HP6 A;  1NOY A;  1S9G A;  1KSP A;  4IFV A;  4FM0 A;  1IG9 A;  3F9K A;  1N5Y A;  3QES A;  3RR8 A;  1TK0 A;  5HLF A;  3AO4 A;  3S3O A;  1RDC A;  4JS4 A;  4C8K A;  1LAV A;  2BAN A;  1LWC A;  1SL2 A;  4TSX A;  3H08 A;  4FJ9 A;  4M3X A;  4FYD A;  3PO5 A;  4OLB A;  4M3Y A;  4DFP A;  1D9D A;  1W9H A;  2O4G A;  3AVM A;  2D5R A;  3NFA A;  3OYD A;  3V1O A;  1CLQ A;  1W0H A;  1TAQ A;  4CEB A;  1ZYQ A;  3AVB A;  1ZBH A;  3VQ7 A;  4CJL A;  3QEX A;  1J9A A;  2IDO A;  4DU1 A;  1Q9X A;  1RTJ A;  4R5P A;  1JLQ A;  1RT4 A;  4FLW A;  3MXJ A;  4CJQ A;  4FW2 A;  4IKF A;  1UWB A;  1MU2 A;  2HVI A;  3V9X A;  1ZBF A;  1HYZ A;  3ZSZ A;  4CJ5 A;  4CED A;  3NH0 A;  3M8R A;  2ITG A;  1X9S A;  1KLN A;  4B3O A;  2YV0 X;  1BIS A;  1RTD A;  3KJV A;  3TAF A;  3EZ5 A;  1R0A A;  4NCB A;  1HRH A;  4KFB A;  3LAL A;  4E3S A;  3TI0 A;  2P5G A;  3SUO A;  1LWE A;  1NK4 A;  2G8K A;  3T3F A;  4FZZ A;  1C0T A;  4OGC A;  2E6M A;  4F4K A;  2IC3 A;  1ZBL A;  4M3U A;  3HST B;  3OJU A;  5HRR A;  3DMJ A;  4I9Q A;  2XY7 A;  3LWL A;  3LWM A;  2OZM A;  3WNE A;  4F2S A;  2KZZ A;  3K5O A;  4BDP A;  4IDK A;  1C1A A;  1B9D A;  4FJ7 A;  4ICL A;  3OYE A;  3VA3 A;  2YHB A;  3QLH A;  4Q0B A;  4DU4 A;  3KK2 A;  1IO2 A;  4OKK A;  3VQP A;  3NE6 A;  2GUI A;  4AHU A;  4KB1 A;  3RR7 A;  3TAE A;  2QKB A;  3I8D A;  4DSE A;  5CYM A;  4B9M A;  1WSI A;  4C8N A;  4FLU A;  1KLM A;  4FZX C;  2E6L A;  1TK5 A;  2HHQ A;  3SUP A;  3LP1 A;  4AIL C;  4CGH A;  4KTQ A;  4M3W A;  3K58 A;  3BGR A;  4Z4F A;  3KLG A;  4LSN A;  1VSE A;  1S9E A;  4IFY A;  4M41 A;  3DOK A;  5HBM A;  2HHW A;  4DF8 A;  4Z4C A;  3AA2 A;  3DLE A;  1VSI A;  4G1Q A;  1QS4 A;  4E0D A;  3RRG A;  4FLX A;  1HJR A;  1JLC A;  5KGW A;  3L8B A;  1KTQ A;  2Y1J A;  2YNI A;  4NYF A;  4F8R A;  4GW6 A;  3IRX A;  3ZSO A;  4HHT A;  3TR8 A;  3B6P A;  1T7P A;  4CHZ A;  3KK3 A;  4CES A;  4FJ8 A;  1GOC A;  1VK0 A;  2YNH A;  3AVF A;  5EU7 A;  3OYB A;  4J2D A;  5FRN A;  2B4J A;  4ID5 A;  4KHN A;  4CEC A;  3QEP A;  5FRO A;  3DM2 A;  2Z1G A;  1JLA A;  2XY6 A;  4FJL A;  4OVL A;  5FDL A;  3ASM A;  1JL2 A;  2HND A;  3ITH A;  4DQS A;  2BE2 A;  1NJY A;  4FLV A;  3V9U A;  3QIN A;  2GBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...