3VQ4A

Fragments bound to hiv-1 integrase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
152
structure length
144
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
total genus 48
structure length 144
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vq4A00
1RNHA 4CK1A 4OPKA 4FJXA 1ASWA 1DTQA 4OLBA 1L3UA 4JS4A 3SQ1A 5CZ1A 2ZE2A 4LH5A 4DFKA 3MXIA 4L8RB 4DQQA 4OLAA 3OY9A 2Y1IA 1C0TA 3QO9A 4KKOA 5T7BA 1JKHA 4Q0BA 4JLHA 4EP4A 1VK0A 3KJVA 4XIUA 1WSIA 4CHOA 1ZBFA 4H4OA 3M8RA 2EHGA 3LWMA 3BGRA 3E01A 4IBNA 3T3FA 2DFFA 4FW2A 3QLHA 1X9WA 1VRTA 4CGFA 3NF8A 4CE9A 1J9AA 3AVCA 1IKXA 1B9DA 3LP0A 4W5OA 3KD5E 4PY5A 1WSJA 1T8EA 3AVKA 3ZSQA 1EETA 2YNIA 4I9LA 4RW4A 4J2EA 4FJHA 5K14A 1VSEA 1XI1A 4CHNA 3OYJA 2DFEA 3IS9A 3V1QA 3ZT4A 3NE6A 2D5RA 3AVAA 3CYMA 3NF6A 4KFBA 3VQAA 3DOKA 4E89A 3O3GA 4CECA 4FJ7A 4QCLA 1RTIA 4DSKA 1UWBA 4CIFA 3PX6A 4CEEA 2XO7A 3DLKA 4KI6A 1WN7A 2HB5A 1A5WA 2KQ2A 4Z0UA 1ZYQA 4LSLA 1VSLA 1RILA 2ZQBA 4CJ4A 2G8VA 1D9DA 3V9ZA 3RMBA 4CHQA 1Y97A 4OKKA 1RTHA 2W42A 1U47A 3EY1A 4CJFA 3KLIA 5KGWA 3DI6A 3HP9A 1BIZA 4CFCA 3SV3A 3TAEA 3QIPA 4OGCA 5KTQA 1QSYA 3ZSWA 3L3UA 3IAYA 4FJKA 4BE1A 3V81A 4DU3A 1VSJA 1RDAA 4J2BA 4CJ5A 4CHPA 4B08A 3NH1A 2X78A 4NCBA 3V9UA 1S9GA 5FDLA 3V4IA 4I2QA 2DFHA 2B6AA 1RBVA 3AA5X 3ZSZA 4ZTFA 2G8WA 2FC0A 3U3YA 2YNHA 1TAUA 1XWLA 1WSHA 4M3ZA 1WSFA 2IC3A 4O5BA 4N5SA 4WE1A 3SQ2A 1LV5A 1NK5A 3O3FA 2HVHA 4KHNA 3TR8A 3LWLA 2ITGA 3K5NA 1ITGA 4DQIA 1IKWA 1B92A 4C8NA 3JSMA 3LZIA 1TK8A 4AILC 3OYCA 4YFUA 2IGIA 2XY5A 4BDPA 4KTZA 5SZTA 2D0BA 4ELUA 1KFSA 1T7PA 1VSKA 3CG7A 4MQ3A 4BACA 4PWDA 3LPTA 1ASUA 4FZXC 1XHXA 4CEZA 2G8KA 4DSLA 1HYSA 4DTPA 4RW6A 4CHYA 4FLXA 4CJRA 4CEBA 1VSFA 1S1VA 3M8QA 1IKYA 1S1TA 2YV0X 3K57A 4HHTA 4HTUA 1NK4A 3RR7A 3ZSYA 4B9TA 4G1QA 4DTJA 3AVMA 3K59A 1QSLA 4ZTJA 4KAZA 2HHSA 2X6SA 4BWJA 1BGXT 4CGIA 1DTTA 2Z1GA 3JYTA 1VSHA 5HRPA 2A1SA 3ZT3A 3NDKA 2B5JA 4LSNA 3NGZA 3OS1A 4FLVA 4AHTA 3SPZA 4N56A 4FW1A 1W0HA 3ZSXA 2IOCA 3PV8A 3PUFA 1SUQA 2KTQA 4DSJA 2D0CA 1I3AA 2F8SA 3AO5A 3OJUA 3KK3A 3OVNA 1RBRA 4E7JA 4AHVA 3PO4A 4FCYA 1X9SA 4CJ3A 3HK2A 1D5AA 3WNEA 3VQBA 2ETJA 3WNHA 3RTVA 4DTNA 3QERA 4KV8A 4TSXA 4FJ9A 5I42A 1REVA 4NCAA 1ZBIA 4CIEA 3HPOA 1TL1A 3OYEA 3V9XA 1WLJA 5HRRA 4DTOA 2HMIA 3VQ5A 2JGUA 1NK9A 4MFBA 2Z1IA 3V1OA 3ALYA 4HUGA 3OS0A 1IO2A 4B9SA 2HNYA 5C42A 4CJPA 3DMJA 3KIOA 3LP2A 3S3MA 3DRRA 3NBPA 4B9MA 2Y1JA 3OYMA 3AVFA 4Z4FA 3LP1A 1LWEA 3P83D 1YTAA 4Z4GA 1RT3A 3VQ7A 3L2RA 1BQMA 3VQ9A 4DTUA 4FK2A 1TK0A 5JS1A 3CFRA 1BL3A 3QEXA 1GOAA 2OPPA 4I2PA 1NOZA 4DLGA 1WSEA 3CM6A 1L3VA 3WNGA 4FJ8A 3AO2A 1FKPA 2P51A 5KI6A 4CF0A 5HBMA 3OS2A 4Z4IA 3HJFA 1RT6A 3MXMA 1S1WA 1RTDA 4DG1A 3RRHA 3HSTB 1A5VA 4CF8A 1FK9A 2RKIA 1I39A 4AH9A 1TKDA 1JLEA 1QSSA 1FXXA 2ATQA 1R0AA 5JS2A 4B9NA 1S5JA 4IDKA 2G8FA 4DFMA 4KTQA 2KZMA 1EX4A 1JL1A 4OPJA 3D0PA 3AVLA 2IS3A 2FBXA 2P1JA 4CFDA 1SV5A 3V9SA 4FM2A 2DY4A 4JRQA 3UIQA 3K5LA 1KVBA 4N47A 2XY8A 4CK3A 3VA0A 2JLEA 3SUOA 4CEAA 1KSPA 4EZ9A 5EU7A 4O0JA 3HYFA 1RBUA 1LW2A 1RTJA 4GMJB 4K8XA 1SKRA 4B9UA 2QK9A 4C8LA 3FFIA 1TVRA 3HM9A 4IKFA 4FLUA 4BE0A 1LWCA 4CJWA 4DF4A 3TAQA 2KFZA 1U4BA 1ZBLA 3SUQA 1JL2A 3SCXA 4I7FA 4CCHA 3QEVA 1LW0A 2FBVA 1C1BA 3NH0A 3RRGA 3SNNA 3A2FA 4E1MA 3HP6A 4HUFA 1NJZA 2KFNA 4BDYA 4RW9A 3WNFA 4RW8A 2OA8A 3HVTA 3PY8A 2FBYA 3OYIA 4W5NA 4O55A 1S1XA 4CJQA 4E3SA 3SUPA 1U48A 3I0RA 2Z1HA 3ZT0A 3HT3A 3LANA 4O4GA 3HXMA 1NK8A 4FXDA 3VQ4A 4CJUA 1C1AA 2X74A 1RBSA 4NYFA 4O44A 3T19A 4CGDA 4FLWA 3IG1A 3THVA 1WSGA 5C24A 3NH2A 4DSFA 1C6VA 3MXJA 4B9VA 4DTSA 4DSEA 2I5JA 4Q5VA 3OYAA 1XC9A 1VSDA 2YNGA 3AVIA 4HCCA 4W5TA 1G15A 3ASMA 3DLGA 4N41A 4OVLA 2HHWA 3O3HA 4KRFA 1O1WA 3PO5A 1RT2A 2QXFA 4E7HA 3KD1E 5FRMA 1TKZA 1TAQA 1KLMA 1EXQA 3DRPA 4BWMA 2VG6A 3TABA 2HNDA 2O4GA 3K58A 4DTMA 3AVBA 4CJVA 3KLGA 2VG7A 4FJ5A 3ZT2A 3AV9A 1Q8IA 2HNZA 3NGIA 4B8AB 3PX0A 2Z1JA 4KPYA 4M3TA 2HHUA 2LSNA 3RR8A 3L3VA 4GVMA 1HYVA 1N5YA 4ELTA 1KFDA 1HQEA 4F2RA 4HCBA 5CY4A 3OYGA 3VQCA 4CJTA 1HMVA 4KTWA 3MECA 2YHAA 4NCGA 3TAGA 2F8TA 3ZCMA 1QHTA 3OJSA 1HNVA 1C1CA 5CYQA 1QS4A 3ZT1A 4CF2A 3VA3A 1NKEA 3RMDA 1HPZA 3OYHA 3MEEA 4LY7A 4BE2A 1ZBHA 3AVHA 3OYDA 2QKKA 4O0IA 4FJIA 2G8IA 2E4LA 4CGGA 4CIGA 2VG5A 1SL0A 3NGYA 4FJGA 3RMCA 1KRPA 3ITHA 3B6PA 1EKEA 4KHUA 2WOMA 4CEQA 5KRTA 4FJMA 3NF7A 1C0UA 4AHSA 1U45A 4QAGA 1C0MA 1JLAA 3AVGA 2OZMA 5J2NA 4DU4A 1RT4A 4EZ6A 2O4IA 2OPSA 1KCFA 1ASVA 3KK1A 1YTUA 1BIUA 2BDPA 1X1PA 3D45A 2E6MA 1FKOA 3L2VA 1NJWA 5DK5A 5HLFA 5I3UA 4M3UA 4DFPA 3CFOA 4FJJA 2BANA 1LAWA 1HYZA 2BGGA 3SYZA 2D0AA 4B3OA 1L5UA 3KLEA 2HHTA 1RT5A 1WNSA 4CEDA 3K5MA 1U49A 2IDOA 1NK6A 4KB1A 1RT1A 2WONA 3SPYA 3VQQA 3QEPA 1SKSA 4KHSA 1GOCA 3C95A 4CFAA 3F73A 3TAMA 1L3SA 1IG9A 3DRSA 4OKJA 3ULDA 3MAQA 4HUEA 2OPQA 3P5JA 2X6NA 4IFVA 1JLGA 2HVIA 1IKVA 1HQUA 1VSMA 4FM0A 4EP5A 1CXQA 5J2PA 3SUNA 2Q3SA 3VQ8A 4FLZA 2G8UA 3AA2A 4DMNA 3K2PA 4FVMA 1K6YA 5HROA 2PZSA 4M3RA 2FBTA 1JLQA 3QIOA 2VWJA 3PX4A 4FZYA 4I9QA 4N76A 4DWIA 3SJJA 3H08A 3QINA 4DSIA 1YVUA 4DS5A 3LALA 3M8SA 1NKCA 1Z25A 2OYQA 5J1EA 3C6TA 4CJLA 3S3OA 1NK0A 1S6QA 4OJRA 4FLYA 1W9HA 4FK0A 4KHYA 5J2MA 2YNFA 3KTQA 1QTMA 3QNNA 1S9EA 1TKXA 4M42A 2R7YA 3HVRA 4PQUA 3LDSA 3QEIA 4F3TA 1A5XA 4UQGA 1NKBA 4J2DA 2VWKA 1ZBUA 4C8KA 4DLEA 1BCOA 3KKRA 3ZSVA 1CLQA 3S9HA 4NYNA 2XY6A 1SKWA 4E0DA 1WAJA 2HHVA 5DMRA 2HHQA 3LPUA 1KTQA 1BHLA 3MEGA 3DLRA 2P5OA 2YKMA 3VQ6A 1KVAA 3KLFA 1X9MA 4Z4CA 1Q9YA 1NJXA 4AHUA 3SQ0A 3SI6A 3LZJA 1TV6A 3QESA 1L3TA 1UOCA 3OYNA 4Z4HA 1JLFA 4DQPA 3O4QA 3NF9A 4Y1DA 4ICLA 4FLTA 1UA0A 4IG0A 3AO4A 1JLBA 1WAFA 3HO1A 1TL3A 3OYLA 4CGJA 4CEOA 4CHZA 3EYZA 3AA4A 1VRUA 3P1GA 2NUBA 1CXUA 3DLHA 1S6PA 1VSIA 5CYMA 3VQDA 4CF1A 5KRSA 4DS4A 3G0ZA 2PYJA 4B9LA 3TI0A 3B6OA 1Z26A 4F3OA 4GW6A 1B9FA 4H8KA 3V1RA 5HP1A 3HL8A 5CZ2A 4HVJA 1J5OA 4PA1A 3ZSRA 1NOYA 2XHBA 1KLNA 4M3WA 3LP3A 4CEFA 3LAKA 5J2QA 1EP4A 1N6QA 4FK4A 3AVNA 3VQPA 4ELVA 2XY7A 4ID1A 3TWHA 2DTUA 3QETA 4PUOA 4E7IA 4IG3A 3DLBA 4CK2A 4ZHRA 1HJRA 1QQCA 3AA3A 3L8BA 1BISA 1TK5A 4C8OA 2XRIA 4OKEA 1SL2A 5E41A 4IFYA 3RWUA 2F96A 4RW7A 1GOBA 1BQNA 4B8CA 3SZ2A 1J53A 4LH4A 3BDPA 4H4MA 3CFPA 4KREA 2HW3A 3OYBA 4E7KA 3HPHA 4E19A 4Z4EA 3LAMA 3NCIA 4KI4A 4JS5A 3AVJA 3VN5A 4CESA 5KGXA 3KKSA 2GV9A 3SQ4A 4DF8A 4J2AA 4CJKA 4YNQA 1KVCA 2GUIA 1LAVA 2YKNA 4DFJA 4F8RA 3KLHA 1T03A 4K8ZA 4CFBA 3OYFA 4M3YA 1J54A 1NJYA 3SV4A 4QOZB 1YT3A 3I0SA 2P5GA 3L2UA 2ZD1A 4BDZA 1RBTA 1MU2A 3HPGA 1RCHA 1F21A 3NAEA 4AHRA 1LWFA 1D9FA 3NFAA 1RDDA 3C6UA 3F9KA 3O4NA 3K5OA 4DTRA 1JXBA 3L2WA 2GBZA 3KK2A 3CM5A 3EZ5A 3T1AA 1NK7A 4FM1A 1CZBA 3ISNC 4CGHA 4R5PA 2KW4A 3V6DA 3ZSOA 4KHWA 4KO0A 2RN2A 1XHZA 4OGEA 4DU1A 4CERA 4RG8A 2OZSA 3TAPA 3I8DA 3DLEA 5FROA 5SWMA 1Q9XA 1JXEA 3L2QA 1CZ9A 2B4JA 1RDBA 1IH7A 1JLCA 4F4KA 1U04A 1S1UA 1TKTA 2OPRA 4DQSA 3IRXA 4W5QA 3U6FA 3C94A 3QEWA 2PYLA 4C8MA 3DOLA 4ID5A 1RDCA 4E7LA 1T05A 3S3NA 1UA1A 3VQEA 4M45A 1D8YA 3AO1A 4DQRA 4FYDA 3DM2A 3DYAA 4KB0A 1BCMA 5FRNA 2AJQA 2IAJA 3G10A 5C25A 2PY5A 1RT7A 2RF2A 4Y1CA 3RMAA 3TARA 4FJNA 4JRPA 2YHBA 2RPIA 1HNIA 2BE2A 5HRSA 1QE1A 3V9WA 1BI4B 4E1NA 1DLOA 2KZZA 3TANA 2G8HA 3OYKA 4AHCA 4W5RA 3QNOA 2HHXA 3MEDA 4M41A 1SL1A 3CQ8A 4KHQA 2A1RA 4LD0A 3AO3A 4F2SA 4M3XA 4CF9A 2QKBA 4CJEA 5D3GA 3NHGA 1BI4A 4DTXA 5HRNA 4CJSA 3M8PA 1HRHA 1UAXA 3U3GA 4FZZA 2E6LA 4FJLA 3TAFA 1TGOA 2EX3A
chains in the Genus database with same CATH superfamily
4CZEA 2FSJA 4B1VA 4CZJA 3R1XA 3LDQA 3SQ1A 2ZE2A 3MXIA 3IFRA 4L8RB 4DQQA 3QO9A 5AQIA 1JKHA 3M5RA 2NLXA 4JK7A 5E84A 2P9KB 4FW2A 4MDAA 4HWIA 3NF8A 1S72N 3C7NB 1J9AA 3PIPL 1IKXA 1B9DA 3AVKA 2HMPA 3MDQA 2Q1NA 5K14A 3WT0A 1VSEA 3O9SA 4JKBA 3IS9A 4FWKA 2D5RA 4KFBA 4CECA 4FJ7A 4BRQA 4DSKA 4CEEA 4YOUA 4LSLA 5C12A 2ZQBA 3JXUA 2W42A 1Y97A 1RTHA 1U47A 5M1KA 4CJFA 1BIZA 3HP9A 3TAEA 4OGCA 3CJAA 5M1QA 3L3UA 3TTDA 4GKKK 2NRZA 2JWLA 1VQLN 3V4IA 4I2QA 3JS6A 3AA5X 3ZETA 3ZSZA 3SK3A 2YNHA 1WSHA 4O5BA 2O8DA 1LV5A 3O3FA 2ITGA 5EX5A 1YJ9N 4BDPA 2IGIA 2A41A 1G99A 2D0BA 4PWDA 1W97L 2UXDK 2ASPA 4CEZA 2G8KA 1HYSA 3CQXA 4CEBA 1S1VA 3HTVA 3M8QA 2YV0X 5JICA 4JKFA 4G1QA 2FF3B 3K59A 2HHSA 1N33K 4B1ZA 4CGIA 5HRPA 2UU9K 3BZCA 2B5JA 2O8EA 1Z6RA 3OS1A 4FLVA 3FZFA 3WXIA 2E8AA 2IOCA 4WFBL 2D0CA 3OVNA 3E9LA 4DTNA 3VQBA 4FJ9A 1Q86O 1ZBIA 4CIEA 4H0OA 1ZXOA 5AQKA 3OYEA 4DTOA 1WLJA 3FLCO 4Z94A 3V1OA 3ALYA 4HUGA 3OS0A 1IO2A 4BRPA 3OYMA 5AZIB 4Z4FA 1LWEA 1NGJA 4X62K 3C6AA 3VQ7A 4I6MA 4LF7K 3AAQA 3CFRA 4DLGA 3WUHA 4IO8A 3CM6A 5ADXH 4FJ8A 1QHAA 3AO2A 3OS2A 5HBMA 4Z4IA 1RT6A 3MXMA 1RTDA 1O13A 4CF8A 1TKDA 2RKIA 1YITN 5DM7L 5JS2A 3H46O 4FO0A 1NLVA 1JL1A 3P38A 4XH5A 4OO1J 4JI2K 4N47A 2HF3A 4CK3A 3SUOA 5LMUK 3HYFA 4GMJB 4GVEA 3NVKA 3T1HK 3FFIA 4BR0A 4FLUA 3EKSA 4FWRA 4JI6K 4I7FA 2YX6A 3CCEN 3NH0A 3HP6A 2I7PA 4E1MA 4FWNA 4HUFA 2KFNA 3H6EA 3O5BA 1N8RO 3WNFA 3MCPA 4O55A 4E3SA 3RSEB 2Z1HA 2NRVA 4NYFA 1NWKA 1WSGA 5C24A 4DSFA 5E26A 4DSEA 2I5JA 1VQNN 1G15A 3DLGA 4N41A 4OVLA 4CJ7A 1RT2A 5FRMA 1KLMA 1EXQA 4BWMA 3TABA 5LL6Z 3K58A 4DTMA 3KLGA 1NMDA 3UKUB 1NBWA 3RR8A 2P9NA 3L3VA 1N32K 2A40A 1N5YA 4F2RA 4HCBA 4QS9A 5CY4A 3BF1A 3O9UA 2YHAA 4NCGA 2F8TA 1C1CA 4JKAA 3ZT1A 3VEZA 1J6ZA 2OTLN 2QKKA 1EWQA 3FR0A 5F0XA 3MWPA 3NGYA 1KRPA 1EKEA 2P9IA 4FJMA 4B3MK 4C1NK 4GV6A 5AQGA 2P9SA 2NRTA 2OZMA 4EZ6A 3KK1A 1YTUA 3ZYYX 2E6MA 1EQYA 1WBDA 1OH7A 2BANA 1RT5A 4CEDA 4KB1A 4OPAA 2IDOA 1NGBA 4A5BA 4BR9A 4CFAA 3F73A 1K9MO 1KQSM 5AQRA 4HUEA 5AQWA 2BUPA 4IFVA 1JLGA 4A59A 2HVIA 1CXQA 1XMQK 3VQ8A 3PIOL 1DKGD 4FVMA 1E3MA 3B8AX 4BRIA 4O5FA 1QQOA 1HNWK 3QIOA 5FPEA 4I9QA 4N76A 5BR9A 4MO5A 3QINA 4DWIA 1YVUA 2CGJA 4DS5A 3LALA 3ID8A 1NKCA 5J1EA 3C6TA 4DR1K 1NK0A 4QS7A 5J2MA 1QTMA 4DUZK 3QNNA 1S9EA 1TKXA 2R7YA 3GE1A 3LDSA 5EXWA 4B9QA 4U67L 1NKBA 2VWKA 4LFBK 4DLEA 3ZSVA 1CLQA 2YHYA 5DMRA 1YXQA 4IOXA 2QWOA 5AFUH 4JHDA 4BRHA 5AQXA 1Q9YA 1NJXA 3WEEB 3SQ0A 1IJJA 1EWRA 1NGHA 1JLFA 3O4QA 1MWMA 4Y1DA 2UUCK 4FLTA 1UA0A 1WAFA 1C0GA 3BUZB 3I56N 3ZEUA 2ZJPL 2NUBA 4ISEA 1S6PA 3CPEA 5C2DA 4DR7K 1XUPO 3CIPA 1Z26A 3O08A 3VPZA 3CF5L 1B9FA 5HP1A 3BZKA 4RWTA 4M3WA 4CEFA 1N6QA 4FK4A 5MLCQ 4ID1A 4DV5K 4E7IA 4IG3A 3DLBA 4A62A 4CK2A 1QQCA 1BISA 1SL2A 5E41A 4IFYA 1GOBA 3VEVA 3KWIA 3SZ2A 1HUXA 4BVOA 1J53A 4CI6A 2D0PA 4E7KA 3LAMA 3NCIA 2HOEA 4PKIA 4CESA 4BRFA 1ZBSA 1VQ4N 3MN9A 5BR8K 1KVCA 4K8ZA 3OYFA 3SV4A 4IEIA 5EY4A 2QWNA 4AHRA 4LF9K 3QFUA 3F9KA 4PY5A 1D4XA 1JXBA 4YDUC 3L2WA 3KK2A 3EZ5A 4PL8A 1CZBA 4FM1A 2YHXA 4CGHA 1J5EK 1NGAA 3P39A 4KO0A 3LL3A 3TAPA 1Q9XA 3UKUA 1IH7A 1JLCA 2OPRA 1S1UA 3ZETB 4W5QA 1EO1A 3UKRB 3CCJN 4BC3A 4E7LA 5AJ3K 1RDCA 3I8BA 3VEYA 3S3NA 2A3ZA 5LJWA 5AQJA 4FYDA 1NGIA 4KB0A 2QTDA 2IAJA 3RMAA 3O1BA 1NGEA 2BE2A 4E1NA 1OKJA 2HHXA 3D2EA 3MEDA 4M41A 1SL1A 2A1RA 4LD0A 3AO3A 1NGCA 4BC5A 1BI4A 3H1VX 3KZBA 2QWRA 1HRHA 3J7ZO 2GTDA 2EX3A 5BRFA 1RNHA 4CK1A 4OPKA 1DTQA 1L3UA 1WB9A 3G71N 3H3NO 4DFKA 1IBKK 4B3RK 4DCHA 1C0TA 5T7BA 4Q0BA 5AQSA 1ZBFA 4H4OA 2NZTA 3RSEA 3M8RA 3G6EN 4BY9C 3T3FA 2DFFA 1X9WA 3KHYA 1VQ6N 4CGFA 3LM9A 3LP0A 4W5OA 1DT9A 3NVMA 4GY2B 1NNEA 4RW4A 4DB3A 2DFEA 4IEEA 3V1QA 3DOKA 3O3GA 4QCLA 1KAXA 1RTIA 3ID6A 2WBNA 2XO7A 4KI6A 3VESA 1A5WA 1VSLA 1RILA 4DKWA 3CJ7A 3G4SN 1D9DA 4DV2K 3IUCA 4OKKA 2DPNA 3CJBA 4JD2A 3ULEB 3I33A 3KLIA 3D6RA 4CFCA 3THXA 4H5NA 4DU3A 1VSJA 3CPWM 4CJ5A 4B08A 3NH1A 1S9GA 3W3DA 4NO7A 4K43A 2FC0A 4YDUA 1XWLA 3GDQA 2O8CB 3SQ2A 3U9DA 1NK5A 4WF9L 3LWLA 3K5NA 1VQ9N 1ITGA 1MWKA 1B92A 3LZIA 3J81O 3OYCA 4YFUA 3D2FB 3SMSA 4MQ3A 1QZ6A 1ASUA 3IMXA 4DSLA 4CHYA 3FE1A 3A5NC 1NK4A 3K57A 5AQUA 1V4SA 2OANA 5AZIA 4KAZA 2X6SA 4BWJA 3DXMA 3MWTA 1DTTA 2Z1GA 4EHUA 3JYTA 2GWJA 3FZMA 2A1SA 3ZT3A 3T7ZA 1N36K 3NGZA 3K0SA 4CZGA 4AHTA 3SPZA 4N56A 5EOYA 3PV8A 2Q97A 4DV4K 2KTQA 2F8SA 3AO5A 3KK3A 3CC4N 3CJCA 2NNWA 3PO4A 2P9KA 4BRKA 3HK2A 3HI0A 1M1KO 3QERA 4TSXA 3PSIA 2A6AA 4DQ8A 1TL1A 5HRRA 2JGUA 5AFUA 4B9SA 2HNYA 1BU6O 3LM2A 4CJPA 5C42A 3DMJA 3KIOA 2QXLA 3LP2A 3S3MA 4B9MA 3FZHA 3AVFA 5BPMA 4Z4GA 3SLCA 3VQ9A 2Q2RA 3QEXA 1GOAA 5CR4A 4BRNA 2RHKA 3TSQA 4DR3K 3HJFA 3EN9A 5CE3A 3E9OA 1S1WA 4DG1A 3LDPA 1FK9A 4AH9A 4DR5K 4KBOA 2E2PA 4B9NA 2KZMA 3AVLA 5CHIA 2IS3A 2O8DB 3VF4A 4YHHK 5C2FA 1YI2N 1HR0K 3UIQA 2DY4A 1ATSA 4AQYK 2JLEA 4CEAA 3LDOA 4O0JA 4ILGB 4K8XA 4B9UA 2QK9A 2VQFK 1TVRA 1WUAA 4CBWA 1XMOK 4DF4A 1ZBLA 3SUQA 3VTHA 3AGRA 3SCXA 5BREA 3A5LC 2KHOA 3DLLL 1NJZA 4RW8A 3OYIA 3N4PA 1NGFA 2HF4A 2HSTA 1U48A 3HXMA 3LANA 4O4GA 1RBSA 5GAEP 4IJAA 4B9VA 4NB4A 3H45C 3TTFA 2VCPA 4JEPA 3ASMA 1SZ2A 2HHWA 4KRFA 4IOCL 3PO5A 3MK6A 4BGAA 3KD1E 3HZ6A 1TKZA 2CGLA 1YJWN 3DRPA 2O4GA 4G9ZA 3AVBA 4BRMA 2VG7A 4FJ5A 3C0BA 3AV9A 3ZT2A 3SAFA 4KPYA 4M3TA 4GVMA 2O8EB 1HYVA 4DR6K 4CJTA 3ZCMA 2Q0RA 4B1UB 2FF6A 3VA3A 3RMDA 3OYHA 3MEEA 4C23A 4LY7A 1ZBHA 4O0IA 5LJVA 1QQMA 4CGGA 2VG5A 1ZC6A 3CCMN 5GADP 3ITHA 4KHUA 5KRTA 3CMEN 3DWLA 3HOSA 4AHSA 2RE2A 3TTCA 1JCEA 1H1VA 1KCFA 2OPSA 3OHRA 1NJWA 4I6MB 5TKWA 5I3UA 4DFPA 4FJJA 1HYZA 2BGGA 3SYZA 2D0AA 1YUWA 3KLEA 2HHTA 3K9JA 3A0IX 2QWPA 1U49A 3K5MA 4H03B 3CHWA 4JI4K 3QEPA 2O8BA 1YF5L 1Y64A 1GLBG 3TAMA 4L3QA 2GELA 3MAQA 4ILJA 3QDKA 1VSMA 1QVGM 3SUNA 2Q3SA 5GAHP 3M6GA 4EIAA 3AA2A 2CGKA 5M1PA 1T6DA 2VWJA 3PX4A 4DSIA 3SJJA 4KH4A 4CJLA 4OJRA 1W9HA 3SMPA 2YNFA 3KTQA 4CZMA 4M42A 4UQGA 4J2DA 4FSVA 3K9KA 1BCOA 5AQMA 2HHVA 2V7ZA 2HHQA 3LPUA 2P5OA 4X65K 4Z4CA 2FSKA 3RVCA 3LZJA 1K73O 2CH6A 3L4IA 4DQPA 3NF9A 4YY3K 4V19S 2QM1A 2O8CA 4CEOA 1KD1O 5AQPA 3CMAN 3DLHA 2PYJA 1VSIA 5CYMA 1U2VA 1HLUA 3VQDA 5KRSA 4UY8O 4BVPA 4F3OA 4H8KA 3V1RA 3HL8A 3S41A 2XHBA 4U7BA 5J2QA 3W0LA 4ELVA 4MO4A 2XY7A 2DTUA 5BPLA 3CJ1A 1VQ7N 3AA3A 3WXKA 4FOIA 1TK5A 4C8OA 5TKYA 3EZWA 4B8CA 4JHDB 3MX2A 3BDPA 3CFPA 4CVNE 3ULEA 4Z4EA 5JMVA 3TU5A 3VN5A 1U6ZA 3HOTA 3A8YA 2GV9A 4YNQA 2YKNA 4F8RA 4M3YA 1J54A 4BG9A 1MU2A 1RCHA 3MN5A 1OVQA 2YJEA 4BREA 4RCHA 3EEQA 1RDDA 3GL1A 3O4NA 3CM5A 1HKCA 1NK7A 4JI8K 3ZSOA 1XHZA 4CERA 3QICA 4YOWA 5FROA 2P9NB 1JXEA 1CZ9A 2B4JA 4PKHA 1RDBA 1U04A 4K0KK 1RGIA 4AM7A 3C94A 4K25A 3U8XA 2PYLA 4ID5A 1T05A 1UA1A 1D8YA 1X3NA 4DQRA 3DM2A 1BCMA 2AJQA 2GX9A 5C25A 2PY5A 1RT7A 4JAXA 1XC3A 4FJNA 1TYQB 3M1FA 1VQ5N 5HRSA 4BG8A 2KZZA 3TANA 3SBGA 2PFUA 3J8AA 3IKMA 4FWOA 4M3XA 2QKBA 5D3GA 3NHGA 5HRNA 4CJSA 4AM6A 3EE9A 3U3GA 4QS8A 4FJLA 3QBWA 4CD3A 1R59O 5AQLA 3WQTA 4FJXA 1ASWA 4JS4A 4A5AA 4JD2B 3OY9A 2Y1IA 1HJOA 2ITMA 4YOYA 4JLHA 2QWMA 4LC9B 2VWBA 4BRGA 4CZKA 4WQ5C 3LWMA 4IBNA 3QLHA 1VRTA 3VEOA 2VYPA 2YI1A 3E1YA 2E88A 3D2EB 3WXLA 5AQHA 3ZSQA 4I9LA 4J2EA 2ASOA 4ILHA 1P90A 1XI1A 4CHNA 3OYJA 1IV0A 3ZT4A 4BRLA 5KQ8A 1BUPA 3NF6A 3CYMA 3THWA 3ZX3A 4CIFA 5IWAK 4BRAA 1WN7A 2HB5A 4Z0UA 3NMUA 3AY9A 2G8VA 2P9LA 3FZKA 3EY1A 4FPAA 3SV3A 4DR4K 3QIPA 1QSYA 4LF4K 3ZSWA 3R8EA 5M1OA 4BE1A 3V81A 1P8ZA 4CHPA 4NCBA 1BG3A 3OA9A 5FDLA 4EFHA 2B6AA 1RBVA 2G8WA 4LF8K 1TAUA 4M3ZA 2HVHA 2IC3A 3TSPA 4WE1A 1Q18A 3TR8A 2ASMA 3CQYA 3L6QA 3ATUA 3ZX0A 4DQIA 4C8NA 1TK8A 4AILC 4KTZA 5SZTA 3AAPA 4LF5K 4LF6K 3CG7A 4BACA 2D1KA 3LPTA 5BPNA 4FZXC 3F5TA 1YJNN 1VQ8N 2NRWA 1GLLO 4RW6A 4FLXA 4CJRA 2W40A 1IKYA 1S1TA 3RR7A 3WQUA 4B9TA 4WQ4A 3AVMA 4DTJA 4NXMK 1QSLA 4ZTJA 4GKJK 4JKGB 2H3GX 2W6KA 1BGXT 1VSHA 2IVOA 4WFNL 4LSNA 2FXUA 1FJGK 3ZSXA 1LCUA 3PUFA 4DSJA 1VAZA 2UYTA 4AHVA 1VQPN 1X9SA 2O8FA 4CJ3A 1QZ5A 3WNEA 3RTVA 4X64K 4KV8A 4CZLA 4NCAA 3HPOA 5JLHA 3A5OC 3V9XA 2E2NA 3VQ5A 1NK9A 3CCUN 2Z1IA 3CCSN 1JCFA 4M7YA 2Y1JA 4M63C 1NGDA 2QI2A 1RT3A 4CBUA 4NLBA 3J7AP 1BA0A 3AARA 4FK2A 5JS1A 2OPPA 1NOZA 1TUYA 3WNGA 1T6CA 2V52B 1DGKN 1FKPA 4CF0A 2P9PA 3THXB 2ZM6K 3RRHA 3HSTB 2Q0UA 4BRCA 4JKHA 1QSSA 1KC8O 3FZLA 4J8FA 4DFMA 4KTQA 4OPJA 4MLEA 3O8MA 1GLCG 5KQDA 4YOVA 1SV5A 5DM6L 4JRQA 3K5LA 1KVBA 4MDBA 2HBMA 2BH1A 4EZ9A 3QBXA 4JI0K 1LW2A 5KPZA 1SKRA 4IKFA 1LWCA 4CJWA 4NXNK 3DXKA 3TAQA 1JL2A 3E9PA 4CZFA 4CCHA 1LW0A 2FBVA 5BN9A 3RRGA 3SNNA 3FFKB 4IZ9A 4B1XB 4BDYA 4RW9A 1BDGA 3HVTA 5GAGP 2FBYA 4CD1A 5FPDA 2IVPA 3PY8A 1S1XA 5BN8A 4W5NA 4CJQA 4H0YB 1W7AA 3SUPA 4C1NI 3I0RA 3TPQA 1NK8A 4FXDA 2AA4A 3VQ4A 4CJUA 1C1AA 2X74A 4O44A 4CGDA 4FLWA 3THVA 3VGKA 3NH2A 1JCGA 3H1QA 4DTSA 2QWQA 3A5MC 4IOAL 4Q5VA 1K8KA 3OYAA 1SAZA 2YNGA 3AVIA 4HCCA 4W5TA 3HBTA 1O1WA 3VMFB 5FPNA 2QXFA 4E7HA 1ILYA 4H5VA 2D0OA 2F9WA 3ENBA 3CI5A 2QW9A 1Q8IA 3NGIA 3PX0A 4B8AB 2Z1JA 4R79A 3SAGA 4ELTA 1KFDA 1HQEA 2FSNA 4KTWA 4F9OA 3VGMA 4BR4A 2ZGYA 4DV6K 3TAGA 1QHTA 1Q82O 5CYQA 4CF2A 4BC2A 4JI3K 1NKEA 1E4GT 4DV3K 1HPZA 3I55N 2AP1A 1IBMK 3AVHA 3OYDA 2E5LK 2VGMA 4FJIA 2E4LA 3EE8A 4CIGA 3B6PA 2WOMA 1C0UA 3HSCA 4FWQA 4QAGA 5GINA 1JLAA 4OX9K 4DU4A 1RT4A 1ASVA 1BIUA 3OBWA 1X1PA 2BDPA 3L2VA 2VGNA 1XNRK 1LAWA 3VETA 3O80A 4B3OA 3BY5A 3T69A 1BA1A 1NK6A 1M90O 4BQZA 1RT1A 4A2AA 3SPYA 2E1YA 1SKSA 1GOCA 3C95A 3JAMO 1IG9A 4O8UA 4NLCA 3DRSA 4OKJA 3ULDA 2OPQA 2J4RA 3P5JA 2X6NA 1IKVA 4FM0A 4EP5A 3J80O 2G8UA 3O1WA 4FWMA 1HKBA 3O9QA 4JKDA 1K6YA 4XH1A 4WFAL 2PZSA 2FBTA 5C0YA 4FZYA 3KVGA 4IFEA 4PKGA 3H08A 3M8SA 2OYQA 1Z25A 2WUSA 4FL9A 1S6QA 1OH6A 4KHYA 4KHPK 1HNZK 4PQUA 4F3TA 3GG4A 3VEWA 5GIPA 1ZBUA 4C8KA 3KKRA 3SJHA 1SKWA 1WAJA 1BHLA 3MEGA 2YKMA 3VQ6A 1KVAA 3KLFA 1ESVA 3OBYA 2QA4N 1TV6A 3QESA 1L3TA 4AF1A 4ICLA 4RTFD 3AO4A 3HO1A 3EYZA 4CGJA 3CC7N 1NMNA 3AA4A 5JVHL 3KWGA 3P1GA 2UXBK 3C65A 1CXUA 4CF1A 5AZJB 3CXCM 3B6OA 4GW6A 3ZX2A 1Q81O 4HVJA 1J5OA 3LP3A 1N34K 3LAKA 3WXMB 3AVNA 3THYA 3TWHA 2PBDA 4CZIA 3T1YK 4IDHA 4ZHRA 4JKEA 2XRIA 4OKEA 3LDNA 2F96A 4FOEA 4LH4A 4H4MA 4BR2A 4ISFA 3OYBA 4E19A 5C10A 3F9MA 1ATRA 3L0QA 5KGXA 3SQ4A 3EKUA 1Z05A 4DFJA 2GUIA 4QOZB 4IXCA 3KLHA 1HPMA 3ZLJA 1NJYA 3VF6A 1OH8A 3SAHA 2F4VK 1YT3A 3CETA 3I0SA 2P5GA 3L2UA 1RBTA 3HPGA 4JV5K 3E66A 1F21A 3NAEA 1LWFA 3C6UA 3ATVA 3K5OA 3CERA 4DTRA 3VOVA 3ISNC 4R5PA 4DV0K 3V6DA 3R9PA 5GIOA 4KHWA 2RN2A 4BR5A 4DU1A 3CCQN 4RG8A 3OW2M 4FWSA 3I8DA 5SWMA 4H5WA 3L2QA 4H0TB 4F4KA 1DEJA 3EL2A 3U6FA 2E2OA 3QEWA 2HBJA 4C8MA 3CJ9A 2P9UB 3DOLA 4HTLA 3VQEA 1YHQN 2VQEK 4Y0WA 1MA9B 4JI1K 4BR7A 3G10A 4Y1CA 3TARA 2GWKA 2YHBA 1RDWX 1HNIA 3H3OB 3V9WA 5A2QO 1KXPA 3MMVA 4O8KA 2G8HA 4AHCA 1JJ2M 3QNOA 1LOTB 4DV7K 1TYQA 3CQ8A 4KHQA 4F2SA 4CJEA 2UUBK 4DTXA 5C15A 3M8PA 1V4TA 4FZZA 2E6LA 3TAFA 3LDLA 2YCHA 1VQMN 4PHTX 2NRXA 4OLBA 3VF2A 1HNXK 5CZ1A 3CCRN 4LH5A 4OLAA 3O9TA 1Q7YO 4KKOA 5B8HA 3UE5A 3OTOK 4EP4A 5H1SQ 1VK0A 3KJVA 2P9UA 1WSIA 4XIUA 1KAYA 4CHOA 3CD6N 2EHGA 2P9IB 3BGRA 3E01A 1OH5A 5FPMA 2HBKA 1IBLK 4CE9A 1C0FA 3AVCA 4A2BA 3HM8A 3KD5E 1WSJA 2PAVA 1T8EA 1EETA 2YNIA 3WXJA 4FJHA 3NE6A 4WYBA 3C7NA 4DV1K 3VEXA 3AVAA 3VQAA 4E89A 1UWBA 3PX6A 3DLKA 2CH5A 2KQ2A 2W41A 1ZYQA 2D4WA 4CJ4A 3DJCA 3V9ZA 3RMBA 4CHQA 3THWB 5KGWA 5JVGL 3DI6A 5AQTA 5KTQA 3IAYA 1YAGA 4FJKA 3QMLA 1RDAA 3G25A 5ADXA 3U4LA 1VQKN 4J2BA 3GBTA 2X78A 3V9UA 4GV3A 1T44A 2DFHA 4ZTFA 3U3YA 4JI7K 4CBXA 5KPRA 1WSFA 4KH6A 4N5SA 4KHNA 4FVUA 5M1NA 2HBLA 2UUAK 1IKWA 3JSMA 2XY5A 3PSFA 3CCVN 4ELUA 1KFSA 1T7PA 1VSKA 1TUUA 3DXKB 1XHXA 2NRHA 5AQVA 4JKGA 4DTPA 4YOXA 1VSFA 4HHTA 4HTUA 5M1FA 3WEEA 4B3TK 3ZSYA 1HX1A 3R3LA 3MCAB 4IJNA 2GEMA 1S3XA 2KLAA 5HOOA 4GNIA 3NDKA 5FLXO 4K42A 5ELZA 4JYAK 4XEIA 1W0HA 2GUPA 3O9RA 1SUQA 4H0XB 1I3AA 3OJUA 1NG9A 4ISGA 1RBRA 4E7JA 4FCYA 4H0VB 2NRRA 3CC2N 4H0PA 1D5AA 2ETJA 3WNHA 5I42A 1REVA 5BRDA 2WTUA 1HKGA 2HMIA 2WC9A 1NU0A 4CZHA 1E4FT 4MFBA 1GLDG 3N4QA 5LY3A 3P4IA 4LFCK 3ENHA 3DRRA 3F2KA 3NBPA 3LP1A 3P83D 1YTAA 3C6HA 4E1JA 5IT9O 3L2RA 4BRDA 1BQMA 4DTUA 1TK0A 1BL3A 3DAWA 2P9LB 4I2PA 1WSEA 1L3VA 4B3SK 2QEXN 4A57A 2P51A 5KI6A 1K8AO 3UKRA 1VHXA 2IIRA 1A5VA 1I39A 1JLEA 2HHHK 1FXXA 2ATQA 1R0AA 1S5JA 4IDKA 2G8FA 1EX4A 3D0PA 2ZGZA 2FBXA 2P1JA 4CFDA 1SS6A 3V9SA 4FM2A 2F7TA 3VA0A 2XY8A 1KSPA 1WOQA 4YORA 5EU7A 1RBUA 4BQLA 1RTJA 3THYB 4C8LA 3HM9A 4B1WB 4BE0A 3VTIA 2KFZA 4H5TA 1U4BA 4B1YB 3QEVA 1C1BA 4BC4A 4WQ4C 3A2FA 2BTFA 4H5RA 5F2RA 2V51B 3QB0A 5HL7L 5LMNK 2OA8A 3GOIA 2ZF5O 4FPBA 3HT3A 3ZT0A 4IO9L 1XQSC 1ATNA 3T19A 3IG1A 1KAZA 5KPTA 1C6VA 3MXJA 4FWPA 3Q7CA 1XC9A 1VSDA 1T3VA 3O3HA 2O8FB 3VERA 4JK8A 4JNEA 1TAQA 3EO3A 1I94K 2VG6A 2HNDA 4CJVA 3P31A 1YVNA 5AR0A 2HNZA 2HHUA 1BWFO 2LSNA 2V7YA 5I9EB 1YIJN 3OYGA 3VQCA 1HMVA 1BO5O 3MECA 3SBTA 3OJSA 1HNVA 2WFBA 4KH5A 1QS4A 4M7XA 1OVYA 4BE2A 5AZJA 2Q36A 2G8IA 4CW7B 2UXCK 1SL0A 4FJGA 1QVFM 2YJFA 3RMCA 4CEQA 2ZJQL 3NF7A 1U45A 1C0MA 5EVZA 3AVGA 5J2NA 3L4QA 2O4IA 4WQ5A 1IG8A 3D45A 3O4WA 1FKOA 4M3UA 5DK5A 5AQOA 5HLFA 4BGBA 3CFOA 4BROA 1MDUB 5AQZA 1L5UA 1RDUA 2E2QA 1WNSA 3IDHA 4FWLA 2WONA 3VQQA 4KHSA 1GLFO 1L3SA 1FW6A 1CZAN 3MN7A 2E20A 4DUYK 1WBBA 1HQUA 2W6LA 1BOTO 5J2PA 2ZJRL 3VGLA 4FLZA 1U2VB 4DMNA 1X3MA 2ZWHA 3K2PA 3FGUA 5HROA 4M3RA 1JLQA 3QFPA 4XH4A 3ENOA 3HRGA 3S3OA 4FLYA 1QQNA 4FK0A 1GLEG 3HVRA 2JWKA 3QEIA 1A5XA 2OCEA 3S9HA 4NYNA 2XY6A 4E0DA 1KTQA 4DR2K 4GV9A 3DLRA 2KKZA 1X9MA 2O8BB 3ZEUB 4MLHA 4AHUA 2P9PB 3SI6A 1UOCA 3OYNA 3VENA 4Z4HA 2IVNA 4IG0A 3MN6A 4JI5K 1JLBA 1TL3A 3OYLA 4CHZA 1VRUA 1NJIO 3M3ZA 3R6MA 4WCEL 4DS4A 3G0ZA 4B9LA 3TI0A 4EHTA 5AQNA 2OTJN 5CZ2A 4PA1A 3ZSRA 1NOYA 1KLNA 1RFQA 2QWLA 1EP4A 3VQPA 3QETA 4PUOA 3O6WA 5AQYA 3L8BA 1HJRA 1X9JA 4LFAK 3RWUA 4RW7A 5BRHA 1BQNA 1S22A 1GLJO 1NM1A 3D7EO 5F1XA 4KREA 2HW3A 3U9ZA 3HPHA 1W2BM 4KI4A 4JS5A 3AVJA 4DHYA 4IWVA 3KKSA 2F9TA 4DF8A 4J2AA 4CJKA 1LAVA 1T03A 4JN4A 4CFBA 1GLAG 2P9SB 1SQKA 3KK7A 4EAHD 4BDZA 2ZD1A 1D9FA 3NFAA 2GBZA 3D2FA 3T1AA 3Q7BA 2KW4A 5JLFA 2FLOA 4OGEA 5AQQA 4A61A 2OZSA 4JK9A 3DLEA 3BF3A 2YHWA 3AGKA 3TSUA 4DQSA 1TKTA 3IRXA 2E1ZA 4OPHA 2A5XA 3BP8A 1NGGA 3DXMB 4K41A 4YOTA 4M45A 4PL7A 3AO1A 3DYAA 2I7NA 5FRNA 2Q31A 3PLAA 2RF2A 1XNQK 4JRPA 2RPIA 2EWSA 1QE1A 1BI4B 2A42A 1DLOA 3MX5A 3UB5A 3OYKA 4W5RA 3J7YP 4X66K 3CCLN 4CF9A 5AQFA 4JKCA 1K8KB 1VQON 1UAXA 3BEXA 1TGOA 4FW1A
chains in the Genus database with same CATH topology
1RNHA 4CK1A 4OPKA 4FJXA 1ASWA 1DTQA 4OLBA 1L3UA 4JS4A 3SQ1A 5CZ1A 2ZE2A 4LH5A 4DFKA 3MXIA 4L8RB 4DQQA 4OLAA 3OY9A 2Y1IA 1C0TA 3QO9A 4KKOA 5T7BA 1JKHA 4Q0BA 4JLHA 4EP4A 1VK0A 3KJVA 4XIUA 1WSIA 4CHOA 1ZBFA 4H4OA 3M8RA 2EHGA 3LWMA 3BGRA 3E01A 4IBNA 3T3FA 2DFFA 4FW2A 3QLHA 1X9WA 1VRTA 4CGFA 3NF8A 4CE9A 1J9AA 3AVCA 1IKXA 1B9DA 3LP0A 4W5OA 3KD5E 4PY5A 1WSJA 1T8EA 3AVKA 3ZSQA 1EETA 2YNIA 4I9LA 4RW4A 4J2EA 4FJHA 5K14A 1VSEA 1XI1A 4CHNA 3OYJA 2DFEA 3IS9A 3V1QA 3ZT4A 3NE6A 2D5RA 3AVAA 3CYMA 3NF6A 4KFBA 3VQAA 3DOKA 4E89A 3O3GA 4CECA 4FJ7A 4QCLA 1RTIA 4DSKA 1UWBA 4CIFA 3PX6A 4CEEA 2XO7A 3DLKA 4KI6A 1WN7A 2HB5A 1A5WA 2KQ2A 4Z0UA 1ZYQA 4LSLA 1VSLA 1RILA 2ZQBA 4CJ4A 2G8VA 1D9DA 3V9ZA 3RMBA 4CHQA 1Y97A 4OKKA 1RTHA 2W42A 1U47A 3EY1A 4CJFA 3KLIA 5KGWA 3DI6A 3HP9A 1BIZA 4CFCA 3SV3A 3TAEA 3QIPA 4OGCA 5KTQA 1QSYA 3ZSWA 3L3UA 3IAYA 4FJKA 4BE1A 3V81A 4DU3A 1VSJA 1RDAA 4J2BA 4CJ5A 4CHPA 4B08A 3NH1A 2X78A 4NCBA 3V9UA 1S9GA 5FDLA 3V4IA 4I2QA 2DFHA 2B6AA 1RBVA 3AA5X 3ZSZA 4ZTFA 2G8WA 2FC0A 3U3YA 2YNHA 1TAUA 1XWLA 1WSHA 4M3ZA 1WSFA 2IC3A 4O5BA 4N5SA 4WE1A 3SQ2A 1LV5A 1NK5A 3O3FA 2HVHA 4KHNA 3TR8A 3LWLA 2ITGA 3K5NA 1ITGA 4DQIA 1IKWA 1B92A 4C8NA 3JSMA 3LZIA 1TK8A 4AILC 3OYCA 4YFUA 2IGIA 2XY5A 4BDPA 4KTZA 5SZTA 2D0BA 4ELUA 1KFSA 1T7PA 1VSKA 3CG7A 4MQ3A 4BACA 4PWDA 3LPTA 1ASUA 4FZXC 1XHXA 4CEZA 2G8KA 4DSLA 1HYSA 4DTPA 4RW6A 4CHYA 4FLXA 4CJRA 4CEBA 1VSFA 1S1VA 3M8QA 1IKYA 1S1TA 2YV0X 3K57A 4HHTA 4HTUA 1NK4A 3RR7A 3ZSYA 4B9TA 4G1QA 4DTJA 3AVMA 3K59A 1QSLA 4ZTJA 4KAZA 2HHSA 2X6SA 4BWJA 1BGXT 4CGIA 1DTTA 2Z1GA 3JYTA 1VSHA 5HRPA 2A1SA 3ZT3A 3NDKA 2B5JA 4LSNA 3NGZA 3OS1A 4FLVA 4AHTA 3SPZA 4N56A 4FW1A 1W0HA 3ZSXA 2IOCA 3PV8A 3PUFA 1SUQA 2KTQA 4DSJA 2D0CA 1I3AA 2F8SA 3AO5A 3OJUA 3KK3A 3OVNA 1RBRA 4E7JA 4AHVA 3PO4A 4FCYA 1X9SA 4CJ3A 3HK2A 1D5AA 3WNEA 3VQBA 2ETJA 3WNHA 3RTVA 4DTNA 3QERA 4KV8A 4TSXA 4FJ9A 5I42A 1REVA 4NCAA 1ZBIA 4CIEA 3HPOA 1TL1A 3OYEA 3V9XA 1WLJA 5HRRA 4DTOA 2HMIA 3VQ5A 2JGUA 1NK9A 4MFBA 2Z1IA 3V1OA 3ALYA 4HUGA 3OS0A 1IO2A 4B9SA 2HNYA 5C42A 4CJPA 3DMJA 3KIOA 3LP2A 3S3MA 3DRRA 3NBPA 4B9MA 2Y1JA 3OYMA 3AVFA 4Z4FA 3LP1A 1LWEA 3P83D 1YTAA 4Z4GA 1RT3A 3VQ7A 3L2RA 1BQMA 3VQ9A 4DTUA 4FK2A 1TK0A 5JS1A 3CFRA 1BL3A 3QEXA 1GOAA 2OPPA 4I2PA 1NOZA 4DLGA 1WSEA 3CM6A 1L3VA 3WNGA 4FJ8A 3AO2A 1FKPA 2P51A 5KI6A 4CF0A 5HBMA 3OS2A 4Z4IA 3HJFA 1RT6A 3MXMA 1S1WA 1RTDA 4DG1A 3RRHA 3HSTB 1A5VA 4CF8A 1FK9A 2RKIA 1I39A 4AH9A 1TKDA 1JLEA 1QSSA 1FXXA 2ATQA 1R0AA 5JS2A 4B9NA 1S5JA 4IDKA 2G8FA 4DFMA 4KTQA 2KZMA 1EX4A 1JL1A 4OPJA 3D0PA 3AVLA 2IS3A 2FBXA 2P1JA 4CFDA 1SV5A 3V9SA 4FM2A 2DY4A 4JRQA 3UIQA 3K5LA 1KVBA 4N47A 2XY8A 4CK3A 3VA0A 2JLEA 3SUOA 4CEAA 1KSPA 4EZ9A 5EU7A 4O0JA 3HYFA 1RBUA 1LW2A 1RTJA 4GMJB 4K8XA 1SKRA 4B9UA 2QK9A 4C8LA 3FFIA 1TVRA 3HM9A 4IKFA 4FLUA 4BE0A 1LWCA 4CJWA 4DF4A 3TAQA 2KFZA 1U4BA 1ZBLA 3SUQA 1JL2A 3SCXA 4I7FA 4CCHA 3QEVA 1LW0A 2FBVA 1C1BA 3NH0A 3RRGA 3SNNA 3A2FA 4E1MA 3HP6A 4HUFA 1NJZA 2KFNA 4BDYA 4RW9A 3WNFA 4RW8A 2OA8A 3HVTA 3PY8A 2FBYA 3OYIA 4W5NA 4O55A 1S1XA 4CJQA 4E3SA 3SUPA 1U48A 3I0RA 2Z1HA 3ZT0A 3HT3A 3LANA 4O4GA 3HXMA 1NK8A 4FXDA 3VQ4A 4CJUA 1C1AA 2X74A 1RBSA 4NYFA 4O44A 3T19A 4CGDA 4FLWA 3IG1A 3THVA 1WSGA 5C24A 3NH2A 4DSFA 1C6VA 3MXJA 4B9VA 4DTSA 4DSEA 2I5JA 4Q5VA 3OYAA 1XC9A 1VSDA 2YNGA 3AVIA 4HCCA 4W5TA 1G15A 3ASMA 3DLGA 4N41A 4OVLA 2HHWA 3O3HA 4KRFA 1O1WA 3PO5A 1RT2A 2QXFA 4E7HA 3KD1E 5FRMA 1TKZA 1TAQA 1KLMA 1EXQA 3DRPA 4BWMA 2VG6A 3TABA 2HNDA 2O4GA 3K58A 4DTMA 3AVBA 4CJVA 3KLGA 2VG7A 4FJ5A 3ZT2A 3AV9A 1Q8IA 2HNZA 3NGIA 4B8AB 3PX0A 2Z1JA 4KPYA 4M3TA 2HHUA 2LSNA 3RR8A 3L3VA 4GVMA 1HYVA 1N5YA 4ELTA 1KFDA 1HQEA 4F2RA 4HCBA 5CY4A 3OYGA 3VQCA 4CJTA 1HMVA 4KTWA 3MECA 2YHAA 4NCGA 3TAGA 2F8TA 3ZCMA 1QHTA 3OJSA 1HNVA 1C1CA 5CYQA 1QS4A 3ZT1A 4CF2A 3VA3A 1NKEA 3RMDA 1HPZA 3OYHA 3MEEA 4LY7A 4BE2A 1ZBHA 3AVHA 3OYDA 2QKKA 4O0IA 4FJIA 2G8IA 2E4LA 4CGGA 4CIGA 2VG5A 1SL0A 3NGYA 4FJGA 3RMCA 1KRPA 3ITHA 3B6PA 1EKEA 4KHUA 2WOMA 4CEQA 5KRTA 4FJMA 3NF7A 1C0UA 4AHSA 1U45A 4QAGA 1C0MA 1JLAA 3AVGA 2OZMA 5J2NA 4DU4A 1RT4A 4EZ6A 2O4IA 2OPSA 1KCFA 1ASVA 3KK1A 1YTUA 1BIUA 2BDPA 1X1PA 3D45A 2E6MA 1FKOA 3L2VA 1NJWA 5DK5A 5HLFA 5I3UA 4M3UA 4DFPA 3CFOA 4FJJA 2BANA 1LAWA 1HYZA 2BGGA 3SYZA 2D0AA 4B3OA 1L5UA 3KLEA 2HHTA 1RT5A 1WNSA 4CEDA 3K5MA 1U49A 2IDOA 1NK6A 4KB1A 1RT1A 2WONA 3SPYA 3VQQA 3QEPA 1SKSA 4KHSA 1GOCA 3C95A 4CFAA 3F73A 3TAMA 1L3SA 1IG9A 3DRSA 4OKJA 3ULDA 3MAQA 4HUEA 2OPQA 3P5JA 2X6NA 4IFVA 1JLGA 2HVIA 1IKVA 1HQUA 1VSMA 4FM0A 4EP5A 1CXQA 5J2PA 3SUNA 2Q3SA 3VQ8A 4FLZA 2G8UA 3AA2A 4DMNA 3K2PA 4FVMA 1K6YA 5HROA 2PZSA 4M3RA 2FBTA 1JLQA 3QIOA 2VWJA 3PX4A 4FZYA 4I9QA 4N76A 4DWIA 3SJJA 3H08A 3QINA 4DSIA 1YVUA 4DS5A 3LALA 3M8SA 1NKCA 1Z25A 2OYQA 5J1EA 3C6TA 4CJLA 3S3OA 1NK0A 1S6QA 4OJRA 4FLYA 1W9HA 4FK0A 4KHYA 5J2MA 2YNFA 3KTQA 1QTMA 3QNNA 1S9EA 1TKXA 4M42A 2R7YA 3HVRA 4PQUA 3LDSA 3QEIA 4F3TA 1A5XA 4UQGA 1NKBA 4J2DA 2VWKA 1ZBUA 4C8KA 4DLEA 1BCOA 3KKRA 3ZSVA 1CLQA 3S9HA 4NYNA 2XY6A 1SKWA 4E0DA 1WAJA 2HHVA 5DMRA 2HHQA 3LPUA 1KTQA 1BHLA 3MEGA 3DLRA 2P5OA 2YKMA 3VQ6A 1KVAA 3KLFA 1X9MA 4Z4CA 1Q9YA 1NJXA 4AHUA 3SQ0A 3SI6A 3LZJA 1TV6A 3QESA 1L3TA 1UOCA 3OYNA 4Z4HA 1JLFA 4DQPA 3O4QA 3NF9A 4Y1DA 4ICLA 4FLTA 1UA0A 4IG0A 3AO4A 1JLBA 1WAFA 3HO1A 1TL3A 3OYLA 4CGJA 4CEOA 4CHZA 3EYZA 3AA4A 1VRUA 3P1GA 2NUBA 1CXUA 3DLHA 1S6PA 1VSIA 5CYMA 3VQDA 4CF1A 5KRSA 4DS4A 3G0ZA 2PYJA 4B9LA 3TI0A 3B6OA 1Z26A 4F3OA 4GW6A 1B9FA 4H8KA 3V1RA 5HP1A 3HL8A 5CZ2A 4HVJA 1J5OA 4PA1A 3ZSRA 1NOYA 2XHBA 1KLNA 4M3WA 3LP3A 4CEFA 3LAKA 5J2QA 1EP4A 1N6QA 4FK4A 3AVNA 3VQPA 4ELVA 2XY7A 4ID1A 3TWHA 2DTUA 3QETA 4PUOA 4E7IA 4IG3A 3DLBA 4CK2A 4ZHRA 1HJRA 1QQCA 3AA3A 3L8BA 1BISA 1TK5A 4C8OA 2XRIA 4OKEA 1SL2A 5E41A 4IFYA 3RWUA 2F96A 4RW7A 1GOBA 1BQNA 4B8CA 3SZ2A 1J53A 4LH4A 3BDPA 4H4MA 3CFPA 4KREA 2HW3A 3OYBA 4E7KA 3HPHA 4E19A 4Z4EA 3LAMA 3NCIA 4KI4A 4JS5A 3AVJA 3VN5A 4CESA 5KGXA 3KKSA 2GV9A 3SQ4A 4DF8A 4J2AA 4CJKA 4YNQA 1KVCA 2GUIA 1LAVA 2YKNA 4DFJA 4F8RA 3KLHA 1T03A 4K8ZA 4CFBA 3OYFA 4M3YA 1J54A 1NJYA 3SV4A 4QOZB 1YT3A 3I0SA 2P5GA 3L2UA 2ZD1A 4BDZA 1RBTA 1MU2A 3HPGA 1RCHA 1F21A 3NAEA 4AHRA 1LWFA 1D9FA 3NFAA 1RDDA 3C6UA 3F9KA 3O4NA 3K5OA 4DTRA 1JXBA 3L2WA 2GBZA 3KK2A 3CM5A 3EZ5A 3T1AA 1NK7A 4FM1A 1CZBA 3ISNC 4CGHA 4R5PA 2KW4A 3V6DA 3ZSOA 4KHWA 4KO0A 2RN2A 1XHZA 4OGEA 4DU1A 4CERA 4RG8A 2OZSA 3TAPA 3I8DA 3DLEA 5FROA 5SWMA 1Q9XA 1JXEA 3L2QA 1CZ9A 2B4JA 1RDBA 1IH7A 1JLCA 4F4KA 1U04A 1S1UA 1TKTA 2OPRA 4DQSA 3IRXA 4W5QA 3U6FA 3C94A 3QEWA 2PYLA 4C8MA 3DOLA 4ID5A 1RDCA 4E7LA 1T05A 3S3NA 1UA1A 3VQEA 4M45A 1D8YA 3AO1A 4DQRA 4FYDA 3DM2A 3DYAA 4KB0A 1BCMA 5FRNA 2AJQA 2IAJA 3G10A 5C25A 2PY5A 1RT7A 2RF2A 4Y1CA 3RMAA 3TARA 4FJNA 4JRPA 2YHBA 2RPIA 1HNIA 2BE2A 5HRSA 1QE1A 3V9WA 1BI4B 4E1NA 1DLOA 2KZZA 3TANA 2G8HA 3OYKA 4AHCA 4W5RA 3QNOA 2HHXA 3MEDA 4M41A 1SL1A 3CQ8A 4KHQA 2A1RA 4LD0A 3AO3A 4F2SA 4M3XA 4CF9A 2QKBA 4CJEA 5D3GA 3NHGA 1BI4A 4DTXA 5HRNA 4CJSA 3M8PA 1HRHA 1UAXA 3U3GA 4FZZA 2E6LA 4FJLA 3TAFA 1TGOA 2EX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RNH A;  4CK1 A;  4OPK A;  4FJX A;  1ASW A;  1DTQ A;  4OLB A;  1L3U A;  4JS4 A;  3SQ1 A;  5CZ1 A;  2ZE2 A;  4LH5 A;  4DFK A;  3MXI A;  4L8R B;  4DQQ A;  4OLA A;  3OY9 A;  2Y1I A;  1C0T A;  3QO9 A;  4KKO A;  5T7B A;  1JKH A;  4Q0B A;  4JLH A;  4EP4 A;  1VK0 A;  3KJV A;  4XIU A;  1WSI A;  4CHO A;  1ZBF A;  4H4O A;  3M8R A;  2EHG A;  3LWM A;  3BGR A;  3E01 A;  4IBN A;  3T3F A;  2DFF A;  4FW2 A;  3QLH A;  1X9W A;  1VRT A;  4CGF A;  3NF8 A;  4CE9 A;  1J9A A;  3AVC A;  1IKX A;  1B9D A;  3LP0 A;  4W5O A;  3KD5 E;  4PY5 A;  1WSJ A;  1T8E A;  3AVK A;  3ZSQ A;  1EET A;  2YNI A;  4I9L A;  4RW4 A;  4J2E A;  4FJH A;  5K14 A;  1VSE A;  1XI1 A;  4CHN A;  3OYJ A;  2DFE A;  3IS9 A;  3V1Q A;  3ZT4 A;  3NE6 A;  2D5R A;  3AVA A;  3CYM A;  3NF6 A;  4KFB A;  3VQA A;  3DOK A;  4E89 A;  3O3G A;  4CEC A;  4FJ7 A;  4QCL A;  1RTI A;  4DSK A;  1UWB A;  4CIF A;  3PX6 A;  4CEE A;  2XO7 A;  3DLK A;  4KI6 A;  1WN7 A;  2HB5 A;  1A5W A;  2KQ2 A;  4Z0U A;  1ZYQ A;  4LSL A;  1VSL A;  1RIL A;  2ZQB A;  4CJ4 A;  2G8V A;  1D9D A;  3V9Z A;  3RMB A;  4CHQ A;  1Y97 A;  4OKK A;  1RTH A;  2W42 A;  1U47 A;  3EY1 A;  4CJF A;  3KLI A;  5KGW A;  3DI6 A;  3HP9 A;  1BIZ A;  4CFC A;  3SV3 A;  3TAE A;  3QIP A;  4OGC A;  5KTQ A;  1QSY A;  3ZSW A;  3L3U A;  3IAY A;  4FJK A;  4BE1 A;  3V81 A;  4DU3 A;  1VSJ A;  1RDA A;  4J2B A;  4CJ5 A;  4CHP A;  4B08 A;  3NH1 A;  2X78 A;  4NCB A;  3V9U A;  1S9G A;  5FDL A;  3V4I A;  4I2Q A;  2DFH A;  2B6A A;  1RBV A;  3AA5 X;  3ZSZ A;  4ZTF A;  2G8W A;  2FC0 A;  3U3Y A;  2YNH A;  1TAU A;  1XWL A;  1WSH A;  4M3Z A;  1WSF A;  2IC3 A;  4O5B A;  4N5S A;  4WE1 A;  3SQ2 A;  1LV5 A;  1NK5 A;  3O3F A;  2HVH A;  4KHN A;  3TR8 A;  3LWL A;  2ITG A;  3K5N A;  1ITG A;  4DQI A;  1IKW A;  1B92 A;  4C8N A;  3JSM A;  3LZI A;  1TK8 A;  4AIL C;  3OYC A;  4YFU A;  2IGI A;  2XY5 A;  4BDP A;  4KTZ A;  5SZT A;  2D0B A;  4ELU A;  1KFS A;  1T7P A;  1VSK A;  3CG7 A;  4MQ3 A;  4BAC A;  4PWD A;  3LPT A;  1ASU A;  4FZX C;  1XHX A;  4CEZ A;  2G8K A;  4DSL A;  1HYS A;  4DTP A;  4RW6 A;  4CHY A;  4FLX A;  4CJR A;  4CEB A;  1VSF A;  1S1V A;  3M8Q A;  1IKY A;  1S1T A;  2YV0 X;  3K57 A;  4HHT A;  4HTU A;  1NK4 A;  3RR7 A;  3ZSY A;  4B9T A;  4G1Q A;  4DTJ A;  3AVM A;  3K59 A;  1QSL A;  4ZTJ A;  4KAZ A;  2HHS A;  2X6S A;  4BWJ A;  1BGX T;  4CGI A;  1DTT A;  2Z1G A;  3JYT A;  1VSH A;  5HRP A;  2A1S A;  3ZT3 A;  3NDK A;  2B5J A;  4LSN A;  3NGZ A;  3OS1 A;  4FLV A;  4AHT A;  3SPZ A;  4N56 A;  4FW1 A;  1W0H A;  3ZSX A;  2IOC A;  3PV8 A;  3PUF A;  1SUQ A;  2KTQ A;  4DSJ A;  2D0C A;  1I3A A;  2F8S A;  3AO5 A;  3OJU A;  3KK3 A;  3OVN A;  1RBR A;  4E7J A;  4AHV A;  3PO4 A;  4FCY A;  1X9S A;  4CJ3 A;  3HK2 A;  1D5A A;  3WNE A;  3VQB A;  2ETJ A;  3WNH A;  3RTV A;  4DTN A;  3QER A;  4KV8 A;  4TSX A;  4FJ9 A;  5I42 A;  1REV A;  4NCA A;  1ZBI A;  4CIE A;  3HPO A;  1TL1 A;  3OYE A;  3V9X A;  1WLJ A;  5HRR A;  4DTO A;  2HMI A;  3VQ5 A;  2JGU A;  1NK9 A;  4MFB A;  2Z1I A;  3V1O A;  3ALY A;  4HUG A;  3OS0 A;  1IO2 A;  4B9S A;  2HNY A;  5C42 A;  4CJP A;  3DMJ A;  3KIO A;  3LP2 A;  3S3M A;  3DRR A;  3NBP A;  4B9M A;  2Y1J A;  3OYM A;  3AVF A;  4Z4F A;  3LP1 A;  1LWE A;  3P83 D;  1YTA A;  4Z4G A;  1RT3 A;  3VQ7 A;  3L2R A;  1BQM A;  3VQ9 A;  4DTU A;  4FK2 A;  1TK0 A;  5JS1 A;  3CFR A;  1BL3 A;  3QEX A;  1GOA A;  2OPP A;  4I2P A;  1NOZ A;  4DLG A;  1WSE A;  3CM6 A;  1L3V A;  3WNG A;  4FJ8 A;  3AO2 A;  1FKP A;  2P51 A;  5KI6 A;  4CF0 A;  5HBM A;  3OS2 A;  4Z4I A;  3HJF A;  1RT6 A;  3MXM A;  1S1W A;  1RTD A;  4DG1 A;  3RRH A;  3HST B;  1A5V A;  4CF8 A;  1FK9 A;  2RKI A;  1I39 A;  4AH9 A;  1TKD A;  1JLE A;  1QSS A;  1FXX A;  2ATQ A;  1R0A A;  5JS2 A;  4B9N A;  1S5J A;  4IDK A;  2G8F A;  4DFM A;  4KTQ A;  2KZM A;  1EX4 A;  1JL1 A;  4OPJ A;  3D0P A;  3AVL A;  2IS3 A;  2FBX A;  2P1J A;  4CFD A;  1SV5 A;  3V9S A;  4FM2 A;  2DY4 A;  4JRQ A;  3UIQ A;  3K5L A;  1KVB A;  4N47 A;  2XY8 A;  4CK3 A;  3VA0 A;  2JLE A;  3SUO A;  4CEA A;  1KSP A;  4EZ9 A;  5EU7 A;  4O0J A;  3HYF A;  1RBU A;  1LW2 A;  1RTJ A;  4GMJ B;  4K8X A;  1SKR A;  4B9U A;  2QK9 A;  4C8L A;  3FFI A;  1TVR A;  3HM9 A;  4IKF A;  4FLU A;  4BE0 A;  1LWC A;  4CJW A;  4DF4 A;  3TAQ A;  2KFZ A;  1U4B A;  1ZBL A;  3SUQ A;  1JL2 A;  3SCX A;  4I7F A;  4CCH A;  3QEV A;  1LW0 A;  2FBV A;  1C1B A;  3NH0 A;  3RRG A;  3SNN A;  3A2F A;  4E1M A;  3HP6 A;  4HUF A;  1NJZ A;  2KFN A;  4BDY A;  4RW9 A;  3WNF A;  4RW8 A;  2OA8 A;  3HVT A;  3PY8 A;  2FBY A;  3OYI A;  4W5N A;  4O55 A;  1S1X A;  4CJQ A;  4E3S A;  3SUP A;  1U48 A;  3I0R A;  2Z1H A;  3ZT0 A;  3HT3 A;  3LAN A;  4O4G A;  3HXM A;  1NK8 A;  4FXD A;  3VQ4 A;  4CJU A;  1C1A A;  2X74 A;  1RBS A;  4NYF A;  4O44 A;  3T19 A;  4CGD A;  4FLW A;  3IG1 A;  3THV A;  1WSG A;  5C24 A;  3NH2 A;  4DSF A;  1C6V A;  3MXJ A;  4B9V A;  4DTS A;  4DSE A;  2I5J A;  4Q5V A;  3OYA A;  1XC9 A;  1VSD A;  2YNG A;  3AVI A;  4HCC A;  4W5T A;  1G15 A;  3ASM A;  3DLG A;  4N41 A;  4OVL A;  2HHW A;  3O3H A;  4KRF A;  1O1W A;  3PO5 A;  1RT2 A;  2QXF A;  4E7H A;  3KD1 E;  5FRM A;  1TKZ A;  1TAQ A;  1KLM A;  1EXQ A;  3DRP A;  4BWM A;  2VG6 A;  3TAB A;  2HND A;  2O4G A;  3K58 A;  4DTM A;  3AVB A;  4CJV A;  3KLG A;  2VG7 A;  4FJ5 A;  3ZT2 A;  3AV9 A;  1Q8I A;  2HNZ A;  3NGI A;  4B8A B;  3PX0 A;  2Z1J A;  4KPY A;  4M3T A;  2HHU A;  2LSN A;  3RR8 A;  3L3V A;  4GVM A;  1HYV A;  1N5Y A;  4ELT A;  1KFD A;  1HQE A;  4F2R A;  4HCB A;  5CY4 A;  3OYG A;  3VQC A;  4CJT A;  1HMV A;  4KTW A;  3MEC A;  2YHA A;  4NCG A;  3TAG A;  2F8T A;  3ZCM A;  1QHT A;  3OJS A;  1HNV A;  1C1C A;  5CYQ A;  1QS4 A;  3ZT1 A;  4CF2 A;  3VA3 A;  1NKE A;  3RMD A;  1HPZ A;  3OYH A;  3MEE A;  4LY7 A;  4BE2 A;  1ZBH A;  3AVH A;  3OYD A;  2QKK A;  4O0I A;  4FJI A;  2G8I A;  2E4L A;  4CGG A;  4CIG A;  2VG5 A;  1SL0 A;  3NGY A;  4FJG A;  3RMC A;  1KRP A;  3ITH A;  3B6P A;  1EKE A;  4KHU A;  2WOM A;  4CEQ A;  5KRT A;  4FJM A;  3NF7 A;  1C0U A;  4AHS A;  1U45 A;  4QAG A;  1C0M A;  1JLA A;  3AVG A;  2OZM A;  5J2N A;  4DU4 A;  1RT4 A;  4EZ6 A;  2O4I A;  2OPS A;  1KCF A;  1ASV A;  3KK1 A;  1YTU A;  1BIU A;  2BDP A;  1X1P A;  3D45 A;  2E6M A;  1FKO A;  3L2V A;  1NJW A;  5DK5 A;  5HLF A;  5I3U A;  4M3U A;  4DFP A;  3CFO A;  4FJJ A;  2BAN A;  1LAW A;  1HYZ A;  2BGG A;  3SYZ A;  2D0A A;  4B3O A;  1L5U A;  3KLE A;  2HHT A;  1RT5 A;  1WNS A;  4CED A;  3K5M A;  1U49 A;  2IDO A;  1NK6 A;  4KB1 A;  1RT1 A;  2WON A;  3SPY A;  3VQQ A;  3QEP A;  1SKS A;  4KHS A;  1GOC A;  3C95 A;  4CFA A;  3F73 A;  3TAM A;  1L3S A;  1IG9 A;  3DRS A;  4OKJ A;  3ULD A;  3MAQ A;  4HUE A;  2OPQ A;  3P5J A;  2X6N A;  4IFV A;  1JLG A;  2HVI A;  1IKV A;  1HQU A;  1VSM A;  4FM0 A;  4EP5 A;  1CXQ A;  5J2P A;  3SUN A;  2Q3S A;  3VQ8 A;  4FLZ A;  2G8U A;  3AA2 A;  4DMN A;  3K2P A;  4FVM A;  1K6Y A;  5HRO A;  2PZS A;  4M3R A;  2FBT A;  1JLQ A;  3QIO A;  2VWJ A;  3PX4 A;  4FZY A;  4I9Q A;  4N76 A;  4DWI A;  3SJJ A;  3H08 A;  3QIN A;  4DSI A;  1YVU A;  4DS5 A;  3LAL A;  3M8S A;  1NKC A;  1Z25 A;  2OYQ A;  5J1E A;  3C6T A;  4CJL A;  3S3O A;  1NK0 A;  1S6Q A;  4OJR A;  4FLY A;  1W9H A;  4FK0 A;  4KHY A;  5J2M A;  2YNF A;  3KTQ A;  1QTM A;  3QNN A;  1S9E A;  1TKX A;  4M42 A;  2R7Y A;  3HVR A;  4PQU A;  3LDS A;  3QEI A;  4F3T A;  1A5X A;  4UQG A;  1NKB A;  4J2D A;  2VWK A;  1ZBU A;  4C8K A;  4DLE A;  1BCO A;  3KKR A;  3ZSV A;  1CLQ A;  3S9H A;  4NYN A;  2XY6 A;  1SKW A;  4E0D A;  1WAJ A;  2HHV A;  5DMR A;  2HHQ A;  3LPU A;  1KTQ A;  1BHL A;  3MEG A;  3DLR A;  2P5O A;  2YKM A;  3VQ6 A;  1KVA A;  3KLF A;  1X9M A;  4Z4C A;  1Q9Y A;  1NJX A;  4AHU A;  3SQ0 A;  3SI6 A;  3LZJ A;  1TV6 A;  3QES A;  1L3T A;  1UOC A;  3OYN A;  4Z4H A;  1JLF A;  4DQP A;  3O4Q A;  3NF9 A;  4Y1D A;  4ICL A;  4FLT A;  1UA0 A;  4IG0 A;  3AO4 A;  1JLB A;  1WAF A;  3HO1 A;  1TL3 A;  3OYL A;  4CGJ A;  4CEO A;  4CHZ A;  3EYZ A;  3AA4 A;  1VRU A;  3P1G A;  2NUB A;  1CXU A;  3DLH A;  1S6P A;  1VSI A;  5CYM A;  3VQD A;  4CF1 A;  5KRS A;  4DS4 A;  3G0Z A;  2PYJ A;  4B9L A;  3TI0 A;  3B6O A;  1Z26 A;  4F3O A;  4GW6 A;  1B9F A;  4H8K A;  3V1R A;  5HP1 A;  3HL8 A;  5CZ2 A;  4HVJ A;  1J5O A;  4PA1 A;  3ZSR A;  1NOY A;  2XHB A;  1KLN A;  4M3W A;  3LP3 A;  4CEF A;  3LAK A;  5J2Q A;  1EP4 A;  1N6Q A;  4FK4 A;  3AVN A;  3VQP A;  4ELV A;  2XY7 A;  4ID1 A;  3TWH A;  2DTU A;  3QET A;  4PUO A;  4E7I A;  4IG3 A;  3DLB A;  4CK2 A;  4ZHR A;  1HJR A;  1QQC A;  3AA3 A;  3L8B A;  1BIS A;  1TK5 A;  4C8O A;  2XRI A;  4OKE A;  1SL2 A;  5E41 A;  4IFY A;  3RWU A;  2F96 A;  4RW7 A;  1GOB A;  1BQN A;  4B8C A;  3SZ2 A;  1J53 A;  4LH4 A;  3BDP A;  4H4M A;  3CFP A;  4KRE A;  2HW3 A;  3OYB A;  4E7K A;  3HPH A;  4E19 A;  4Z4E A;  3LAM A;  3NCI A;  4KI4 A;  4JS5 A;  3AVJ A;  3VN5 A;  4CES A;  5KGX A;  3KKS A;  2GV9 A;  3SQ4 A;  4DF8 A;  4J2A A;  4CJK A;  4YNQ A;  1KVC A;  2GUI A;  1LAV A;  2YKN A;  4DFJ A;  4F8R A;  3KLH A;  1T03 A;  4K8Z A;  4CFB A;  3OYF A;  4M3Y A;  1J54 A;  1NJY A;  3SV4 A;  4QOZ B;  1YT3 A;  3I0S A;  2P5G A;  3L2U A;  2ZD1 A;  4BDZ A;  1RBT A;  1MU2 A;  3HPG A;  1RCH A;  1F21 A;  3NAE A;  4AHR A;  1LWF A;  1D9F A;  3NFA A;  1RDD A;  3C6U A;  3F9K A;  3O4N A;  3K5O A;  4DTR A;  1JXB A;  3L2W A;  2GBZ A;  3KK2 A;  3CM5 A;  3EZ5 A;  3T1A A;  1NK7 A;  4FM1 A;  1CZB A;  3ISN C;  4CGH A;  4R5P A;  2KW4 A;  3V6D A;  3ZSO A;  4KHW A;  4KO0 A;  2RN2 A;  1XHZ A;  4OGE A;  4DU1 A;  4CER A;  4RG8 A;  2OZS A;  3TAP A;  3I8D A;  3DLE A;  5FRO A;  5SWM A;  1Q9X A;  1JXE A;  3L2Q A;  1CZ9 A;  2B4J A;  1RDB A;  1IH7 A;  1JLC A;  4F4K A;  1U04 A;  1S1U A;  1TKT A;  2OPR A;  4DQS A;  3IRX A;  4W5Q A;  3U6F A;  3C94 A;  3QEW A;  2PYL A;  4C8M A;  3DOL A;  4ID5 A;  1RDC A;  4E7L A;  1T05 A;  3S3N A;  1UA1 A;  3VQE A;  4M45 A;  1D8Y A;  3AO1 A;  4DQR A;  4FYD A;  3DM2 A;  3DYA A;  4KB0 A;  1BCM A;  5FRN A;  2AJQ A;  2IAJ A;  3G10 A;  5C25 A;  2PY5 A;  1RT7 A;  2RF2 A;  4Y1C A;  3RMA A;  3TAR A;  4FJN A;  4JRP A;  2YHB A;  2RPI A;  1HNI A;  2BE2 A;  5HRS A;  1QE1 A;  3V9W A;  1BI4 B;  4E1N A;  1DLO A;  2KZZ A;  3TAN A;  2G8H A;  3OYK A;  4AHC A;  4W5R A;  3QNO A;  2HHX A;  3MED A;  4M41 A;  1SL1 A;  3CQ8 A;  4KHQ A;  2A1R A;  4LD0 A;  3AO3 A;  4F2S A;  4M3X A;  4CF9 A;  2QKB A;  4CJE A;  5D3G A;  3NHG A;  1BI4 A;  4DTX A;  5HRN A;  4CJS A;  3M8P A;  1HRH A;  1UAX A;  3U3G A;  4FZZ A;  2E6L A;  4FJL A;  3TAF A;  1TGO A;  2EX3 A; 
#chains in the Genus database with same CATH topology
 4CZE A;  2FSJ A;  4B1V A;  4CZJ A;  3R1X A;  3LDQ A;  3SQ1 A;  2ZE2 A;  3MXI A;  3IFR A;  4L8R B;  4DQQ A;  3QO9 A;  5AQI A;  1JKH A;  3M5R A;  2NLX A;  4JK7 A;  5E84 A;  2P9K B;  4FW2 A;  4MDA A;  4HWI A;  3NF8 A;  1S72 N;  3C7N B;  1J9A A;  3PIP L;  1IKX A;  1B9D A;  3AVK A;  2HMP A;  3MDQ A;  2Q1N A;  5K14 A;  3WT0 A;  1VSE A;  3O9S A;  4JKB A;  3IS9 A;  4FWK A;  2D5R A;  4KFB A;  4CEC A;  4FJ7 A;  4BRQ A;  4DSK A;  4CEE A;  4YOU A;  4LSL A;  5C12 A;  2ZQB A;  3JXU A;  2W42 A;  1Y97 A;  1RTH A;  1U47 A;  5M1K A;  4CJF A;  1BIZ A;  3HP9 A;  3TAE A;  4OGC A;  3CJA A;  5M1Q A;  3L3U A;  3TTD A;  4GKK K;  2NRZ A;  2JWL A;  1VQL N;  3V4I A;  4I2Q A;  3JS6 A;  3AA5 X;  3ZET A;  3ZSZ A;  3SK3 A;  2YNH A;  1WSH A;  4O5B A;  2O8D A;  1LV5 A;  3O3F A;  2ITG A;  5EX5 A;  1YJ9 N;  4BDP A;  2IGI A;  2A41 A;  1G99 A;  2D0B A;  4PWD A;  1W97 L;  2UXD K;  2ASP A;  4CEZ A;  2G8K A;  1HYS A;  3CQX A;  4CEB A;  1S1V A;  3HTV A;  3M8Q A;  2YV0 X;  5JIC A;  4JKF A;  4G1Q A;  2FF3 B;  3K59 A;  2HHS A;  1N33 K;  4B1Z A;  4CGI A;  5HRP A;  2UU9 K;  3BZC A;  2B5J A;  2O8E A;  1Z6R A;  3OS1 A;  4FLV A;  3FZF A;  3WXI A;  2E8A A;  2IOC A;  4WFB L;  2D0C A;  3OVN A;  3E9L A;  4DTN A;  3VQB A;  4FJ9 A;  1Q86 O;  1ZBI A;  4CIE A;  4H0O A;  1ZXO A;  5AQK A;  3OYE A;  4DTO A;  1WLJ A;  3FLC O;  4Z94 A;  3V1O A;  3ALY A;  4HUG A;  3OS0 A;  1IO2 A;  4BRP A;  3OYM A;  5AZI B;  4Z4F A;  1LWE A;  1NGJ A;  4X62 K;  3C6A A;  3VQ7 A;  4I6M A;  4LF7 K;  3AAQ A;  3CFR A;  4DLG A;  3WUH A;  4IO8 A;  3CM6 A;  5ADX H;  4FJ8 A;  1QHA A;  3AO2 A;  3OS2 A;  5HBM A;  4Z4I A;  1RT6 A;  3MXM A;  1RTD A;  1O13 A;  4CF8 A;  1TKD A;  2RKI A;  1YIT N;  5DM7 L;  5JS2 A;  3H46 O;  4FO0 A;  1NLV A;  1JL1 A;  3P38 A;  4XH5 A;  4OO1 J;  4JI2 K;  4N47 A;  2HF3 A;  4CK3 A;  3SUO A;  5LMU K;  3HYF A;  4GMJ B;  4GVE A;  3NVK A;  3T1H K;  3FFI A;  4BR0 A;  4FLU A;  3EKS A;  4FWR A;  4JI6 K;  4I7F A;  2YX6 A;  3CCE N;  3NH0 A;  3HP6 A;  2I7P A;  4E1M A;  4FWN A;  4HUF A;  2KFN A;  3H6E A;  3O5B A;  1N8R O;  3WNF A;  3MCP A;  4O55 A;  4E3S A;  3RSE B;  2Z1H A;  2NRV A;  4NYF A;  1NWK A;  1WSG A;  5C24 A;  4DSF A;  5E26 A;  4DSE A;  2I5J A;  1VQN N;  1G15 A;  3DLG A;  4N41 A;  4OVL A;  4CJ7 A;  1RT2 A;  5FRM A;  1KLM A;  1EXQ A;  4BWM A;  3TAB A;  5LL6 Z;  3K58 A;  4DTM A;  3KLG A;  1NMD A;  3UKU B;  1NBW A;  3RR8 A;  2P9N A;  3L3V A;  1N32 K;  2A40 A;  1N5Y A;  4F2R A;  4HCB A;  4QS9 A;  5CY4 A;  3BF1 A;  3O9U A;  2YHA A;  4NCG A;  2F8T A;  1C1C A;  4JKA A;  3ZT1 A;  3VEZ A;  1J6Z A;  2OTL N;  2QKK A;  1EWQ A;  3FR0 A;  5F0X A;  3MWP A;  3NGY A;  1KRP A;  1EKE A;  2P9I A;  4FJM A;  4B3M K;  4C1N K;  4GV6 A;  5AQG A;  2P9S A;  2NRT A;  2OZM A;  4EZ6 A;  3KK1 A;  1YTU A;  3ZYY X;  2E6M A;  1EQY A;  1WBD A;  1OH7 A;  2BAN A;  1RT5 A;  4CED A;  4KB1 A;  4OPA A;  2IDO A;  1NGB A;  4A5B A;  4BR9 A;  4CFA A;  3F73 A;  1K9M O;  1KQS M;  5AQR A;  4HUE A;  5AQW A;  2BUP A;  4IFV A;  1JLG A;  4A59 A;  2HVI A;  1CXQ A;  1XMQ K;  3VQ8 A;  3PIO L;  1DKG D;  4FVM A;  1E3M A;  3B8A X;  4BRI A;  4O5F A;  1QQO A;  1HNW K;  3QIO A;  5FPE A;  4I9Q A;  4N76 A;  5BR9 A;  4MO5 A;  3QIN A;  4DWI A;  1YVU A;  2CGJ A;  4DS5 A;  3LAL A;  3ID8 A;  1NKC A;  5J1E A;  3C6T A;  4DR1 K;  1NK0 A;  4QS7 A;  5J2M A;  1QTM A;  4DUZ K;  3QNN A;  1S9E A;  1TKX A;  2R7Y A;  3GE1 A;  3LDS A;  5EXW A;  4B9Q A;  4U67 L;  1NKB A;  2VWK A;  4LFB K;  4DLE A;  3ZSV A;  1CLQ A;  2YHY A;  5DMR A;  1YXQ A;  4IOX A;  2QWO A;  5AFU H;  4JHD A;  4BRH A;  5AQX A;  1Q9Y A;  1NJX A;  3WEE B;  3SQ0 A;  1IJJ A;  1EWR A;  1NGH A;  1JLF A;  3O4Q A;  1MWM A;  4Y1D A;  2UUC K;  4FLT A;  1UA0 A;  1WAF A;  1C0G A;  3BUZ B;  3I56 N;  3ZEU A;  2ZJP L;  2NUB A;  4ISE A;  1S6P A;  3CPE A;  5C2D A;  4DR7 K;  1XUP O;  3CIP A;  1Z26 A;  3O08 A;  3VPZ A;  3CF5 L;  1B9F A;  5HP1 A;  3BZK A;  4RWT A;  4M3W A;  4CEF A;  1N6Q A;  4FK4 A;  5MLC Q;  4ID1 A;  4DV5 K;  4E7I A;  4IG3 A;  3DLB A;  4A62 A;  4CK2 A;  1QQC A;  1BIS A;  1SL2 A;  5E41 A;  4IFY A;  1GOB A;  3VEV A;  3KWI A;  3SZ2 A;  1HUX A;  4BVO A;  1J53 A;  4CI6 A;  2D0P A;  4E7K A;  3LAM A;  3NCI A;  2HOE A;  4PKI A;  4CES A;  4BRF A;  1ZBS A;  1VQ4 N;  3MN9 A;  5BR8 K;  1KVC A;  4K8Z A;  3OYF A;  3SV4 A;  4IEI A;  5EY4 A;  2QWN A;  4AHR A;  4LF9 K;  3QFU A;  3F9K A;  4PY5 A;  1D4X A;  1JXB A;  4YDU C;  3L2W A;  3KK2 A;  3EZ5 A;  4PL8 A;  1CZB A;  4FM1 A;  2YHX A;  4CGH A;  1J5E K;  1NGA A;  3P39 A;  4KO0 A;  3LL3 A;  3TAP A;  1Q9X A;  3UKU A;  1IH7 A;  1JLC A;  2OPR A;  1S1U A;  3ZET B;  4W5Q A;  1EO1 A;  3UKR B;  3CCJ N;  4BC3 A;  4E7L A;  5AJ3 K;  1RDC A;  3I8B A;  3VEY A;  3S3N A;  2A3Z A;  5LJW A;  5AQJ A;  4FYD A;  1NGI A;  4KB0 A;  2QTD A;  2IAJ A;  3RMA A;  3O1B A;  1NGE A;  2BE2 A;  4E1N A;  1OKJ A;  2HHX A;  3D2E A;  3MED A;  4M41 A;  1SL1 A;  2A1R A;  4LD0 A;  3AO3 A;  1NGC A;  4BC5 A;  1BI4 A;  3H1V X;  3KZB A;  2QWR A;  1HRH A;  3J7Z O;  2GTD A;  2EX3 A;  5BRF A;  1RNH A;  4CK1 A;  4OPK A;  1DTQ A;  1L3U A;  1WB9 A;  3G71 N;  3H3N O;  4DFK A;  1IBK K;  4B3R K;  4DCH A;  1C0T A;  5T7B A;  4Q0B A;  5AQS A;  1ZBF A;  4H4O A;  2NZT A;  3RSE A;  3M8R A;  3G6E N;  4BY9 C;  3T3F A;  2DFF A;  1X9W A;  3KHY A;  1VQ6 N;  4CGF A;  3LM9 A;  3LP0 A;  4W5O A;  1DT9 A;  3NVM A;  4GY2 B;  1NNE A;  4RW4 A;  4DB3 A;  2DFE A;  4IEE A;  3V1Q A;  3DOK A;  3O3G A;  4QCL A;  1KAX A;  1RTI A;  3ID6 A;  2WBN A;  2XO7 A;  4KI6 A;  3VES A;  1A5W A;  1VSL A;  1RIL A;  4DKW A;  3CJ7 A;  3G4S N;  1D9D A;  4DV2 K;  3IUC A;  4OKK A;  2DPN A;  3CJB A;  4JD2 A;  3ULE B;  3I33 A;  3KLI A;  3D6R A;  4CFC A;  3THX A;  4H5N A;  4DU3 A;  1VSJ A;  3CPW M;  4CJ5 A;  4B08 A;  3NH1 A;  1S9G A;  3W3D A;  4NO7 A;  4K43 A;  2FC0 A;  4YDU A;  1XWL A;  3GDQ A;  2O8C B;  3SQ2 A;  3U9D A;  1NK5 A;  4WF9 L;  3LWL A;  3K5N A;  1VQ9 N;  1ITG A;  1MWK A;  1B92 A;  3LZI A;  3J81 O;  3OYC A;  4YFU A;  3D2F B;  3SMS A;  4MQ3 A;  1QZ6 A;  1ASU A;  3IMX A;  4DSL A;  4CHY A;  3FE1 A;  3A5N C;  1NK4 A;  3K57 A;  5AQU A;  1V4S A;  2OAN A;  5AZI A;  4KAZ A;  2X6S A;  4BWJ A;  3DXM A;  3MWT A;  1DTT A;  2Z1G A;  4EHU A;  3JYT A;  2GWJ A;  3FZM A;  2A1S A;  3ZT3 A;  3T7Z A;  1N36 K;  3NGZ A;  3K0S A;  4CZG A;  4AHT A;  3SPZ A;  4N56 A;  5EOY A;  3PV8 A;  2Q97 A;  4DV4 K;  2KTQ A;  2F8S A;  3AO5 A;  3KK3 A;  3CC4 N;  3CJC A;  2NNW A;  3PO4 A;  2P9K A;  4BRK A;  3HK2 A;  3HI0 A;  1M1K O;  3QER A;  4TSX A;  3PSI A;  2A6A A;  4DQ8 A;  1TL1 A;  5HRR A;  2JGU A;  5AFU A;  4B9S A;  2HNY A;  1BU6 O;  3LM2 A;  4CJP A;  5C42 A;  3DMJ A;  3KIO A;  2QXL A;  3LP2 A;  3S3M A;  4B9M A;  3FZH A;  3AVF A;  5BPM A;  4Z4G A;  3SLC A;  3VQ9 A;  2Q2R A;  3QEX A;  1GOA A;  5CR4 A;  4BRN A;  2RHK A;  3TSQ A;  4DR3 K;  3HJF A;  3EN9 A;  5CE3 A;  3E9O A;  1S1W A;  4DG1 A;  3LDP A;  1FK9 A;  4AH9 A;  4DR5 K;  4KBO A;  2E2P A;  4B9N A;  2KZM A;  3AVL A;  5CHI A;  2IS3 A;  2O8D B;  3VF4 A;  4YHH K;  5C2F A;  1YI2 N;  1HR0 K;  3UIQ A;  2DY4 A;  1ATS A;  4AQY K;  2JLE A;  4CEA A;  3LDO A;  4O0J A;  4ILG B;  4K8X A;  4B9U A;  2QK9 A;  2VQF K;  1TVR A;  1WUA A;  4CBW A;  1XMO K;  4DF4 A;  1ZBL A;  3SUQ A;  3VTH A;  3AGR A;  3SCX A;  5BRE A;  3A5L C;  2KHO A;  3DLL L;  1NJZ A;  4RW8 A;  3OYI A;  3N4P A;  1NGF A;  2HF4 A;  2HST A;  1U48 A;  3HXM A;  3LAN A;  4O4G A;  1RBS A;  5GAE P;  4IJA A;  4B9V A;  4NB4 A;  3H45 C;  3TTF A;  2VCP A;  4JEP A;  3ASM A;  1SZ2 A;  2HHW A;  4KRF A;  4IOC L;  3PO5 A;  3MK6 A;  4BGA A;  3KD1 E;  3HZ6 A;  1TKZ A;  2CGL A;  1YJW N;  3DRP A;  2O4G A;  4G9Z A;  3AVB A;  4BRM A;  2VG7 A;  4FJ5 A;  3C0B A;  3AV9 A;  3ZT2 A;  3SAF A;  4KPY A;  4M3T A;  4GVM A;  2O8E B;  1HYV A;  4DR6 K;  4CJT A;  3ZCM A;  2Q0R A;  4B1U B;  2FF6 A;  3VA3 A;  3RMD A;  3OYH A;  3MEE A;  4C23 A;  4LY7 A;  1ZBH A;  4O0I A;  5LJV A;  1QQM A;  4CGG A;  2VG5 A;  1ZC6 A;  3CCM N;  5GAD P;  3ITH A;  4KHU A;  5KRT A;  3CME N;  3DWL A;  3HOS A;  4AHS A;  2RE2 A;  3TTC A;  1JCE A;  1H1V A;  1KCF A;  2OPS A;  3OHR A;  1NJW A;  4I6M B;  5TKW A;  5I3U A;  4DFP A;  4FJJ A;  1HYZ A;  2BGG A;  3SYZ A;  2D0A A;  1YUW A;  3KLE A;  2HHT A;  3K9J A;  3A0I X;  2QWP A;  1U49 A;  3K5M A;  4H03 B;  3CHW A;  4JI4 K;  3QEP A;  2O8B A;  1YF5 L;  1Y64 A;  1GLB G;  3TAM A;  4L3Q A;  2GEL A;  3MAQ A;  4ILJ A;  3QDK A;  1VSM A;  1QVG M;  3SUN A;  2Q3S A;  5GAH P;  3M6G A;  4EIA A;  3AA2 A;  2CGK A;  5M1P A;  1T6D A;  2VWJ A;  3PX4 A;  4DSI A;  3SJJ A;  4KH4 A;  4CJL A;  4OJR A;  1W9H A;  3SMP A;  2YNF A;  3KTQ A;  4CZM A;  4M42 A;  4UQG A;  4J2D A;  4FSV A;  3K9K A;  1BCO A;  5AQM A;  2HHV A;  2V7Z A;  2HHQ A;  3LPU A;  2P5O A;  4X65 K;  4Z4C A;  2FSK A;  3RVC A;  3LZJ A;  1K73 O;  2CH6 A;  3L4I A;  4DQP A;  3NF9 A;  4YY3 K;  4V19 S;  2QM1 A;  2O8C A;  4CEO A;  1KD1 O;  5AQP A;  3CMA N;  3DLH A;  2PYJ A;  1VSI A;  5CYM A;  1U2V A;  1HLU A;  3VQD A;  5KRS A;  4UY8 O;  4BVP A;  4F3O A;  4H8K A;  3V1R A;  3HL8 A;  3S41 A;  2XHB A;  4U7B A;  5J2Q A;  3W0L A;  4ELV A;  4MO4 A;  2XY7 A;  2DTU A;  5BPL A;  3CJ1 A;  1VQ7 N;  3AA3 A;  3WXK A;  4FOI A;  1TK5 A;  4C8O A;  5TKY A;  3EZW A;  4B8C A;  4JHD B;  3MX2 A;  3BDP A;  3CFP A;  4CVN E;  3ULE A;  4Z4E A;  5JMV A;  3TU5 A;  3VN5 A;  1U6Z A;  3HOT A;  3A8Y A;  2GV9 A;  4YNQ A;  2YKN A;  4F8R A;  4M3Y A;  1J54 A;  4BG9 A;  1MU2 A;  1RCH A;  3MN5 A;  1OVQ A;  2YJE A;  4BRE A;  4RCH A;  3EEQ A;  1RDD A;  3GL1 A;  3O4N A;  3CM5 A;  1HKC A;  1NK7 A;  4JI8 K;  3ZSO A;  1XHZ A;  4CER A;  3QIC A;  4YOW A;  5FRO A;  2P9N B;  1JXE A;  1CZ9 A;  2B4J A;  4PKH A;  1RDB A;  1U04 A;  4K0K K;  1RGI A;  4AM7 A;  3C94 A;  4K25 A;  3U8X A;  2PYL A;  4ID5 A;  1T05 A;  1UA1 A;  1D8Y A;  1X3N A;  4DQR A;  3DM2 A;  1BCM A;  2AJQ A;  2GX9 A;  5C25 A;  2PY5 A;  1RT7 A;  4JAX A;  1XC3 A;  4FJN A;  1TYQ B;  3M1F A;  1VQ5 N;  5HRS A;  4BG8 A;  2KZZ A;  3TAN A;  3SBG A;  2PFU A;  3J8A A;  3IKM A;  4FWO A;  4M3X A;  2QKB A;  5D3G A;  3NHG A;  5HRN A;  4CJS A;  4AM6 A;  3EE9 A;  3U3G A;  4QS8 A;  4FJL A;  3QBW A;  4CD3 A;  1R59 O;  5AQL A;  3WQT A;  4FJX A;  1ASW A;  4JS4 A;  4A5A A;  4JD2 B;  3OY9 A;  2Y1I A;  1HJO A;  2ITM A;  4YOY A;  4JLH A;  2QWM A;  4LC9 B;  2VWB A;  4BRG A;  4CZK A;  4WQ5 C;  3LWM A;  4IBN A;  3QLH A;  1VRT A;  3VEO A;  2VYP A;  2YI1 A;  3E1Y A;  2E88 A;  3D2E B;  3WXL A;  5AQH A;  3ZSQ A;  4I9L A;  4J2E A;  2ASO A;  4ILH A;  1P90 A;  1XI1 A;  4CHN A;  3OYJ A;  1IV0 A;  3ZT4 A;  4BRL A;  5KQ8 A;  1BUP A;  3NF6 A;  3CYM A;  3THW A;  3ZX3 A;  4CIF A;  5IWA K;  4BRA A;  1WN7 A;  2HB5 A;  4Z0U A;  3NMU A;  3AY9 A;  2G8V A;  2P9L A;  3FZK A;  3EY1 A;  4FPA A;  3SV3 A;  4DR4 K;  3QIP A;  1QSY A;  4LF4 K;  3ZSW A;  3R8E A;  5M1O A;  4BE1 A;  3V81 A;  1P8Z A;  4CHP A;  4NCB A;  1BG3 A;  3OA9 A;  5FDL A;  4EFH A;  2B6A A;  1RBV A;  2G8W A;  4LF8 K;  1TAU A;  4M3Z A;  2HVH A;  2IC3 A;  3TSP A;  4WE1 A;  1Q18 A;  3TR8 A;  2ASM A;  3CQY A;  3L6Q A;  3ATU A;  3ZX0 A;  4DQI A;  4C8N A;  1TK8 A;  4AIL C;  4KTZ A;  5SZT A;  3AAP A;  4LF5 K;  4LF6 K;  3CG7 A;  4BAC A;  2D1K A;  3LPT A;  5BPN A;  4FZX C;  3F5T A;  1YJN N;  1VQ8 N;  2NRW A;  1GLL O;  4RW6 A;  4FLX A;  4CJR A;  2W40 A;  1IKY A;  1S1T A;  3RR7 A;  3WQU A;  4B9T A;  4WQ4 A;  3AVM A;  4DTJ A;  4NXM K;  1QSL A;  4ZTJ A;  4GKJ K;  4JKG B;  2H3G X;  2W6K A;  1BGX T;  1VSH A;  2IVO A;  4WFN L;  4LSN A;  2FXU A;  1FJG K;  3ZSX A;  1LCU A;  3PUF A;  4DSJ A;  1VAZ A;  2UYT A;  4AHV A;  1VQP N;  1X9S A;  2O8F A;  4CJ3 A;  1QZ5 A;  3WNE A;  3RTV A;  4X64 K;  4KV8 A;  4CZL A;  4NCA A;  3HPO A;  5JLH A;  3A5O C;  3V9X A;  2E2N A;  3VQ5 A;  1NK9 A;  3CCU N;  2Z1I A;  3CCS N;  1JCF A;  4M7Y A;  2Y1J A;  4M63 C;  1NGD A;  2QI2 A;  1RT3 A;  4CBU A;  4NLB A;  3J7A P;  1BA0 A;  3AAR A;  4FK2 A;  5JS1 A;  2OPP A;  1NOZ A;  1TUY A;  3WNG A;  1T6C A;  2V52 B;  1DGK N;  1FKP A;  4CF0 A;  2P9P A;  3THX B;  2ZM6 K;  3RRH A;  3HST B;  2Q0U A;  4BRC A;  4JKH A;  1QSS A;  1KC8 O;  3FZL A;  4J8F A;  4DFM A;  4KTQ A;  4OPJ A;  4MLE A;  3O8M A;  1GLC G;  5KQD A;  4YOV A;  1SV5 A;  5DM6 L;  4JRQ A;  3K5L A;  1KVB A;  4MDB A;  2HBM A;  2BH1 A;  4EZ9 A;  3QBX A;  4JI0 K;  1LW2 A;  5KPZ A;  1SKR A;  4IKF A;  1LWC A;  4CJW A;  4NXN K;  3DXK A;  3TAQ A;  1JL2 A;  3E9P A;  4CZF A;  4CCH A;  1LW0 A;  2FBV A;  5BN9 A;  3RRG A;  3SNN A;  3FFK B;  4IZ9 A;  4B1X B;  4BDY A;  4RW9 A;  1BDG A;  3HVT A;  5GAG P;  2FBY A;  4CD1 A;  5FPD A;  2IVP A;  3PY8 A;  1S1X A;  5BN8 A;  4W5N A;  4CJQ A;  4H0Y B;  1W7A A;  3SUP A;  4C1N I;  3I0R A;  3TPQ A;  1NK8 A;  4FXD A;  2AA4 A;  3VQ4 A;  4CJU A;  1C1A A;  2X74 A;  4O44 A;  4CGD A;  4FLW A;  3THV A;  3VGK A;  3NH2 A;  1JCG A;  3H1Q A;  4DTS A;  2QWQ A;  3A5M C;  4IOA L;  4Q5V A;  1K8K A;  3OYA A;  1SAZ A;  2YNG A;  3AVI A;  4HCC A;  4W5T A;  3HBT A;  1O1W A;  3VMF B;  5FPN A;  2QXF A;  4E7H A;  1ILY A;  4H5V A;  2D0O A;  2F9W A;  3ENB A;  3CI5 A;  2QW9 A;  1Q8I A;  3NGI A;  3PX0 A;  4B8A B;  2Z1J A;  4R79 A;  3SAG A;  4ELT A;  1KFD A;  1HQE A;  2FSN A;  4KTW A;  4F9O A;  3VGM A;  4BR4 A;  2ZGY A;  4DV6 K;  3TAG A;  1QHT A;  1Q82 O;  5CYQ A;  4CF2 A;  4BC2 A;  4JI3 K;  1NKE A;  1E4G T;  4DV3 K;  1HPZ A;  3I55 N;  2AP1 A;  1IBM K;  3AVH A;  3OYD A;  2E5L K;  2VGM A;  4FJI A;  2E4L A;  3EE8 A;  4CIG A;  3B6P A;  2WOM A;  1C0U A;  3HSC A;  4FWQ A;  4QAG A;  5GIN A;  1JLA A;  4OX9 K;  4DU4 A;  1RT4 A;  1ASV A;  1BIU A;  3OBW A;  1X1P A;  2BDP A;  3L2V A;  2VGN A;  1XNR K;  1LAW A;  3VET A;  3O80 A;  4B3O A;  3BY5 A;  3T69 A;  1BA1 A;  1NK6 A;  1M90 O;  4BQZ A;  1RT1 A;  4A2A A;  3SPY A;  2E1Y A;  1SKS A;  1GOC A;  3C95 A;  3JAM O;  1IG9 A;  4O8U A;  4NLC A;  3DRS A;  4OKJ A;  3ULD A;  2OPQ A;  2J4R A;  3P5J A;  2X6N A;  1IKV A;  4FM0 A;  4EP5 A;  3J80 O;  2G8U A;  3O1W A;  4FWM A;  1HKB A;  3O9Q A;  4JKD A;  1K6Y A;  4XH1 A;  4WFA L;  2PZS A;  2FBT A;  5C0Y A;  4FZY A;  3KVG A;  4IFE A;  4PKG A;  3H08 A;  3M8S A;  2OYQ A;  1Z25 A;  2WUS A;  4FL9 A;  1S6Q A;  1OH6 A;  4KHY A;  4KHP K;  1HNZ K;  4PQU A;  4F3T A;  3GG4 A;  3VEW A;  5GIP A;  1ZBU A;  4C8K A;  3KKR A;  3SJH A;  1SKW A;  1WAJ A;  1BHL A;  3MEG A;  2YKM A;  3VQ6 A;  1KVA A;  3KLF A;  1ESV A;  3OBY A;  2QA4 N;  1TV6 A;  3QES A;  1L3T A;  4AF1 A;  4ICL A;  4RTF D;  3AO4 A;  3HO1 A;  3EYZ A;  4CGJ A;  3CC7 N;  1NMN A;  3AA4 A;  5JVH L;  3KWG A;  3P1G A;  2UXB K;  3C65 A;  1CXU A;  4CF1 A;  5AZJ B;  3CXC M;  3B6O A;  4GW6 A;  3ZX2 A;  1Q81 O;  4HVJ A;  1J5O A;  3LP3 A;  1N34 K;  3LAK A;  3WXM B;  3AVN A;  3THY A;  3TWH A;  2PBD A;  4CZI A;  3T1Y K;  4IDH A;  4ZHR A;  4JKE A;  2XRI A;  4OKE A;  3LDN A;  2F96 A;  4FOE A;  4LH4 A;  4H4M A;  4BR2 A;  4ISF A;  3OYB A;  4E19 A;  5C10 A;  3F9M A;  1ATR A;  3L0Q A;  5KGX A;  3SQ4 A;  3EKU A;  1Z05 A;  4DFJ A;  2GUI A;  4QOZ B;  4IXC A;  3KLH A;  1HPM A;  3ZLJ A;  1NJY A;  3VF6 A;  1OH8 A;  3SAH A;  2F4V K;  1YT3 A;  3CET A;  3I0S A;  2P5G A;  3L2U A;  1RBT A;  3HPG A;  4JV5 K;  3E66 A;  1F21 A;  3NAE A;  1LWF A;  3C6U A;  3ATV A;  3K5O A;  3CER A;  4DTR A;  3VOV A;  3ISN C;  4R5P A;  4DV0 K;  3V6D A;  3R9P A;  5GIO A;  4KHW A;  2RN2 A;  4BR5 A;  4DU1 A;  3CCQ N;  4RG8 A;  3OW2 M;  4FWS A;  3I8D A;  5SWM A;  4H5W A;  3L2Q A;  4H0T B;  4F4K A;  1DEJ A;  3EL2 A;  3U6F A;  2E2O A;  3QEW A;  2HBJ A;  4C8M A;  3CJ9 A;  2P9U B;  3DOL A;  4HTL A;  3VQE A;  1YHQ N;  2VQE K;  4Y0W A;  1MA9 B;  4JI1 K;  4BR7 A;  3G10 A;  4Y1C A;  3TAR A;  2GWK A;  2YHB A;  1RDW X;  1HNI A;  3H3O B;  3V9W A;  5A2Q O;  1KXP A;  3MMV A;  4O8K A;  2G8H A;  4AHC A;  1JJ2 M;  3QNO A;  1LOT B;  4DV7 K;  1TYQ A;  3CQ8 A;  4KHQ A;  4F2S A;  4CJE A;  2UUB K;  4DTX A;  5C15 A;  3M8P A;  1V4T A;  4FZZ A;  2E6L A;  3TAF A;  3LDL A;  2YCH A;  1VQM N;  4PHT X;  2NRX A;  4OLB A;  3VF2 A;  1HNX K;  5CZ1 A;  3CCR N;  4LH5 A;  4OLA A;  3O9T A;  1Q7Y O;  4KKO A;  5B8H A;  3UE5 A;  3OTO K;  4EP4 A;  5H1S Q;  1VK0 A;  3KJV A;  2P9U A;  1WSI A;  4XIU A;  1KAY A;  4CHO A;  3CD6 N;  2EHG A;  2P9I B;  3BGR A;  3E01 A;  1OH5 A;  5FPM A;  2HBK A;  1IBL K;  4CE9 A;  1C0F A;  3AVC A;  4A2B A;  3HM8 A;  3KD5 E;  1WSJ A;  2PAV A;  1T8E A;  1EET A;  2YNI A;  3WXJ A;  4FJH A;  3NE6 A;  4WYB A;  3C7N A;  4DV1 K;  3VEX A;  3AVA A;  3VQA A;  4E89 A;  1UWB A;  3PX6 A;  3DLK A;  2CH5 A;  2KQ2 A;  2W41 A;  1ZYQ A;  2D4W A;  4CJ4 A;  3DJC A;  3V9Z A;  3RMB A;  4CHQ A;  3THW B;  5KGW A;  5JVG L;  3DI6 A;  5AQT A;  5KTQ A;  3IAY A;  1YAG A;  4FJK A;  3QML A;  1RDA A;  3G25 A;  5ADX A;  3U4L A;  1VQK N;  4J2B A;  3GBT A;  2X78 A;  3V9U A;  4GV3 A;  1T44 A;  2DFH A;  4ZTF A;  3U3Y A;  4JI7 K;  4CBX A;  5KPR A;  1WSF A;  4KH6 A;  4N5S A;  4KHN A;  4FVU A;  5M1N A;  2HBL A;  2UUA K;  1IKW A;  3JSM A;  2XY5 A;  3PSF A;  3CCV N;  4ELU A;  1KFS A;  1T7P A;  1VSK A;  1TUU A;  3DXK B;  1XHX A;  2NRH A;  5AQV A;  4JKG A;  4DTP A;  4YOX A;  1VSF A;  4HHT A;  4HTU A;  5M1F A;  3WEE A;  4B3T K;  3ZSY A;  1HX1 A;  3R3L A;  3MCA B;  4IJN A;  2GEM A;  1S3X A;  2KLA A;  5HOO A;  4GNI A;  3NDK A;  5FLX O;  4K42 A;  5ELZ A;  4JYA K;  4XEI A;  1W0H A;  2GUP A;  3O9R A;  1SUQ A;  4H0X B;  1I3A A;  3OJU A;  1NG9 A;  4ISG A;  1RBR A;  4E7J A;  4FCY A;  4H0V B;  2NRR A;  3CC2 N;  4H0P A;  1D5A A;  2ETJ A;  3WNH A;  5I42 A;  1REV A;  5BRD A;  2WTU A;  1HKG A;  2HMI A;  2WC9 A;  1NU0 A;  4CZH A;  1E4F T;  4MFB A;  1GLD G;  3N4Q A;  5LY3 A;  3P4I A;  4LFC K;  3ENH A;  3DRR A;  3F2K A;  3NBP A;  3LP1 A;  3P83 D;  1YTA A;  3C6H A;  4E1J A;  5IT9 O;  3L2R A;  4BRD A;  1BQM A;  4DTU A;  1TK0 A;  1BL3 A;  3DAW A;  2P9L B;  4I2P A;  1WSE A;  1L3V A;  4B3S K;  2QEX N;  4A57 A;  2P51 A;  5KI6 A;  1K8A O;  3UKR A;  1VHX A;  2IIR A;  1A5V A;  1I39 A;  1JLE A;  2HHH K;  1FXX A;  2ATQ A;  1R0A A;  1S5J A;  4IDK A;  2G8F A;  1EX4 A;  3D0P A;  2ZGZ A;  2FBX A;  2P1J A;  4CFD A;  1SS6 A;  3V9S A;  4FM2 A;  2F7T A;  3VA0 A;  2XY8 A;  1KSP A;  1WOQ A;  4YOR A;  5EU7 A;  1RBU A;  4BQL A;  1RTJ A;  3THY B;  4C8L A;  3HM9 A;  4B1W B;  4BE0 A;  3VTI A;  2KFZ A;  4H5T A;  1U4B A;  4B1Y B;  3QEV A;  1C1B A;  4BC4 A;  4WQ4 C;  3A2F A;  2BTF A;  4H5R A;  5F2R A;  2V51 B;  3QB0 A;  5HL7 L;  5LMN K;  2OA8 A;  3GOI A;  2ZF5 O;  4FPB A;  3HT3 A;  3ZT0 A;  4IO9 L;  1XQS C;  1ATN A;  3T19 A;  3IG1 A;  1KAZ A;  5KPT A;  1C6V A;  3MXJ A;  4FWP A;  3Q7C A;  1XC9 A;  1VSD A;  1T3V A;  3O3H A;  2O8F B;  3VER A;  4JK8 A;  4JNE A;  1TAQ A;  3EO3 A;  1I94 K;  2VG6 A;  2HND A;  4CJV A;  3P31 A;  1YVN A;  5AR0 A;  2HNZ A;  2HHU A;  1BWF O;  2LSN A;  2V7Y A;  5I9E B;  1YIJ N;  3OYG A;  3VQC A;  1HMV A;  1BO5 O;  3MEC A;  3SBT A;  3OJS A;  1HNV A;  2WFB A;  4KH5 A;  1QS4 A;  4M7X A;  1OVY A;  4BE2 A;  5AZJ A;  2Q36 A;  2G8I A;  4CW7 B;  2UXC K;  1SL0 A;  4FJG A;  1QVF M;  2YJF A;  3RMC A;  4CEQ A;  2ZJQ L;  3NF7 A;  1U45 A;  1C0M A;  5EVZ A;  3AVG A;  5J2N A;  3L4Q A;  2O4I A;  4WQ5 A;  1IG8 A;  3D45 A;  3O4W A;  1FKO A;  4M3U A;  5DK5 A;  5AQO A;  5HLF A;  4BGB A;  3CFO A;  4BRO A;  1MDU B;  5AQZ A;  1L5U A;  1RDU A;  2E2Q A;  1WNS A;  3IDH A;  4FWL A;  2WON A;  3VQQ A;  4KHS A;  1GLF O;  1L3S A;  1FW6 A;  1CZA N;  3MN7 A;  2E20 A;  4DUY K;  1WBB A;  1HQU A;  2W6L A;  1BOT O;  5J2P A;  2ZJR L;  3VGL A;  4FLZ A;  1U2V B;  4DMN A;  1X3M A;  2ZWH A;  3K2P A;  3FGU A;  5HRO A;  4M3R A;  1JLQ A;  3QFP A;  4XH4 A;  3ENO A;  3HRG A;  3S3O A;  4FLY A;  1QQN A;  4FK0 A;  1GLE G;  3HVR A;  2JWK A;  3QEI A;  1A5X A;  2OCE A;  3S9H A;  4NYN A;  2XY6 A;  4E0D A;  1KTQ A;  4DR2 K;  4GV9 A;  3DLR A;  2KKZ A;  1X9M A;  2O8B B;  3ZEU B;  4MLH A;  4AHU A;  2P9P B;  3SI6 A;  1UOC A;  3OYN A;  3VEN A;  4Z4H A;  2IVN A;  4IG0 A;  3MN6 A;  4JI5 K;  1JLB A;  1TL3 A;  3OYL A;  4CHZ A;  1VRU A;  1NJI O;  3M3Z A;  3R6M A;  4WCE L;  4DS4 A;  3G0Z A;  4B9L A;  3TI0 A;  4EHT A;  5AQN A;  2OTJ N;  5CZ2 A;  4PA1 A;  3ZSR A;  1NOY A;  1KLN A;  1RFQ A;  2QWL A;  1EP4 A;  3VQP A;  3QET A;  4PUO A;  3O6W A;  5AQY A;  3L8B A;  1HJR A;  1X9J A;  4LFA K;  3RWU A;  4RW7 A;  5BRH A;  1BQN A;  1S22 A;  1GLJ O;  1NM1 A;  3D7E O;  5F1X A;  4KRE A;  2HW3 A;  3U9Z A;  3HPH A;  1W2B M;  4KI4 A;  4JS5 A;  3AVJ A;  4DHY A;  4IWV A;  3KKS A;  2F9T A;  4DF8 A;  4J2A A;  4CJK A;  1LAV A;  1T03 A;  4JN4 A;  4CFB A;  1GLA G;  2P9S B;  1SQK A;  3KK7 A;  4EAH D;  4BDZ A;  2ZD1 A;  1D9F A;  3NFA A;  2GBZ A;  3D2F A;  3T1A A;  3Q7B A;  2KW4 A;  5JLF A;  2FLO A;  4OGE A;  5AQQ A;  4A61 A;  2OZS A;  4JK9 A;  3DLE A;  3BF3 A;  2YHW A;  3AGK A;  3TSU A;  4DQS A;  1TKT A;  3IRX A;  2E1Z A;  4OPH A;  2A5X A;  3BP8 A;  1NGG A;  3DXM B;  4K41 A;  4YOT A;  4M45 A;  4PL7 A;  3AO1 A;  3DYA A;  2I7N A;  5FRN A;  2Q31 A;  3PLA A;  2RF2 A;  1XNQ K;  4JRP A;  2RPI A;  2EWS A;  1QE1 A;  1BI4 B;  2A42 A;  1DLO A;  3MX5 A;  3UB5 A;  3OYK A;  4W5R A;  3J7Y P;  4X66 K;  3CCL N;  4CF9 A;  5AQF A;  4JKC A;  1K8K B;  1VQO N;  1UAX A;  3BEX A;  1TGO A;  4FW1 A; 
#chains in the Genus database with same CATH homology
 1RNH A;  4CK1 A;  4OPK A;  4FJX A;  1ASW A;  1DTQ A;  4OLB A;  1L3U A;  4JS4 A;  3SQ1 A;  5CZ1 A;  2ZE2 A;  4LH5 A;  4DFK A;  3MXI A;  4L8R B;  4DQQ A;  4OLA A;  3OY9 A;  2Y1I A;  1C0T A;  3QO9 A;  4KKO A;  5T7B A;  1JKH A;  4Q0B A;  4JLH A;  4EP4 A;  1VK0 A;  3KJV A;  4XIU A;  1WSI A;  4CHO A;  1ZBF A;  4H4O A;  3M8R A;  2EHG A;  3LWM A;  3BGR A;  3E01 A;  4IBN A;  3T3F A;  2DFF A;  4FW2 A;  3QLH A;  1X9W A;  1VRT A;  4CGF A;  3NF8 A;  4CE9 A;  1J9A A;  3AVC A;  1IKX A;  1B9D A;  3LP0 A;  4W5O A;  3KD5 E;  4PY5 A;  1WSJ A;  1T8E A;  3AVK A;  3ZSQ A;  1EET A;  2YNI A;  4I9L A;  4RW4 A;  4J2E A;  4FJH A;  5K14 A;  1VSE A;  1XI1 A;  4CHN A;  3OYJ A;  2DFE A;  3IS9 A;  3V1Q A;  3ZT4 A;  3NE6 A;  2D5R A;  3AVA A;  3CYM A;  3NF6 A;  4KFB A;  3VQA A;  3DOK A;  4E89 A;  3O3G A;  4CEC A;  4FJ7 A;  4QCL A;  1RTI A;  4DSK A;  1UWB A;  4CIF A;  3PX6 A;  4CEE A;  2XO7 A;  3DLK A;  4KI6 A;  1WN7 A;  2HB5 A;  1A5W A;  2KQ2 A;  4Z0U A;  1ZYQ A;  4LSL A;  1VSL A;  1RIL A;  2ZQB A;  4CJ4 A;  2G8V A;  1D9D A;  3V9Z A;  3RMB A;  4CHQ A;  1Y97 A;  4OKK A;  1RTH A;  2W42 A;  1U47 A;  3EY1 A;  4CJF A;  3KLI A;  5KGW A;  3DI6 A;  3HP9 A;  1BIZ A;  4CFC A;  3SV3 A;  3TAE A;  3QIP A;  4OGC A;  5KTQ A;  1QSY A;  3ZSW A;  3L3U A;  3IAY A;  4FJK A;  4BE1 A;  3V81 A;  4DU3 A;  1VSJ A;  1RDA A;  4J2B A;  4CJ5 A;  4CHP A;  4B08 A;  3NH1 A;  2X78 A;  4NCB A;  3V9U A;  1S9G A;  5FDL A;  3V4I A;  4I2Q A;  2DFH A;  2B6A A;  1RBV A;  3AA5 X;  3ZSZ A;  4ZTF A;  2G8W A;  2FC0 A;  3U3Y A;  2YNH A;  1TAU A;  1XWL A;  1WSH A;  4M3Z A;  1WSF A;  2IC3 A;  4O5B A;  4N5S A;  4WE1 A;  3SQ2 A;  1LV5 A;  1NK5 A;  3O3F A;  2HVH A;  4KHN A;  3TR8 A;  3LWL A;  2ITG A;  3K5N A;  1ITG A;  4DQI A;  1IKW A;  1B92 A;  4C8N A;  3JSM A;  3LZI A;  1TK8 A;  4AIL C;  3OYC A;  4YFU A;  2IGI A;  2XY5 A;  4BDP A;  4KTZ A;  5SZT A;  2D0B A;  4ELU A;  1KFS A;  1T7P A;  1VSK A;  3CG7 A;  4MQ3 A;  4BAC A;  4PWD A;  3LPT A;  1ASU A;  4FZX C;  1XHX A;  4CEZ A;  2G8K A;  4DSL A;  1HYS A;  4DTP A;  4RW6 A;  4CHY A;  4FLX A;  4CJR A;  4CEB A;  1VSF A;  1S1V A;  3M8Q A;  1IKY A;  1S1T A;  2YV0 X;  3K57 A;  4HHT A;  4HTU A;  1NK4 A;  3RR7 A;  3ZSY A;  4B9T A;  4G1Q A;  4DTJ A;  3AVM A;  3K59 A;  1QSL A;  4ZTJ A;  4KAZ A;  2HHS A;  2X6S A;  4BWJ A;  1BGX T;  4CGI A;  1DTT A;  2Z1G A;  3JYT A;  1VSH A;  5HRP A;  2A1S A;  3ZT3 A;  3NDK A;  2B5J A;  4LSN A;  3NGZ A;  3OS1 A;  4FLV A;  4AHT A;  3SPZ A;  4N56 A;  4FW1 A;  1W0H A;  3ZSX A;  2IOC A;  3PV8 A;  3PUF A;  1SUQ A;  2KTQ A;  4DSJ A;  2D0C A;  1I3A A;  2F8S A;  3AO5 A;  3OJU A;  3KK3 A;  3OVN A;  1RBR A;  4E7J A;  4AHV A;  3PO4 A;  4FCY A;  1X9S A;  4CJ3 A;  3HK2 A;  1D5A A;  3WNE A;  3VQB A;  2ETJ A;  3WNH A;  3RTV A;  4DTN A;  3QER A;  4KV8 A;  4TSX A;  4FJ9 A;  5I42 A;  1REV A;  4NCA A;  1ZBI A;  4CIE A;  3HPO A;  1TL1 A;  3OYE A;  3V9X A;  1WLJ A;  5HRR A;  4DTO A;  2HMI A;  3VQ5 A;  2JGU A;  1NK9 A;  4MFB A;  2Z1I A;  3V1O A;  3ALY A;  4HUG A;  3OS0 A;  1IO2 A;  4B9S A;  2HNY A;  5C42 A;  4CJP A;  3DMJ A;  3KIO A;  3LP2 A;  3S3M A;  3DRR A;  3NBP A;  4B9M A;  2Y1J A;  3OYM A;  3AVF A;  4Z4F A;  3LP1 A;  1LWE A;  3P83 D;  1YTA A;  4Z4G A;  1RT3 A;  3VQ7 A;  3L2R A;  1BQM A;  3VQ9 A;  4DTU A;  4FK2 A;  1TK0 A;  5JS1 A;  3CFR A;  1BL3 A;  3QEX A;  1GOA A;  2OPP A;  4I2P A;  1NOZ A;  4DLG A;  1WSE A;  3CM6 A;  1L3V A;  3WNG A;  4FJ8 A;  3AO2 A;  1FKP A;  2P51 A;  5KI6 A;  4CF0 A;  5HBM A;  3OS2 A;  4Z4I A;  3HJF A;  1RT6 A;  3MXM A;  1S1W A;  1RTD A;  4DG1 A;  3RRH A;  3HST B;  1A5V A;  4CF8 A;  1FK9 A;  2RKI A;  1I39 A;  4AH9 A;  1TKD A;  1JLE A;  1QSS A;  1FXX A;  2ATQ A;  1R0A A;  5JS2 A;  4B9N A;  1S5J A;  4IDK A;  2G8F A;  4DFM A;  4KTQ A;  2KZM A;  1EX4 A;  1JL1 A;  4OPJ A;  3D0P A;  3AVL A;  2IS3 A;  2FBX A;  2P1J A;  4CFD A;  1SV5 A;  3V9S A;  4FM2 A;  2DY4 A;  4JRQ A;  3UIQ A;  3K5L A;  1KVB A;  4N47 A;  2XY8 A;  4CK3 A;  3VA0 A;  2JLE A;  3SUO A;  4CEA A;  1KSP A;  4EZ9 A;  5EU7 A;  4O0J A;  3HYF A;  1RBU A;  1LW2 A;  1RTJ A;  4GMJ B;  4K8X A;  1SKR A;  4B9U A;  2QK9 A;  4C8L A;  3FFI A;  1TVR A;  3HM9 A;  4IKF A;  4FLU A;  4BE0 A;  1LWC A;  4CJW A;  4DF4 A;  3TAQ A;  2KFZ A;  1U4B A;  1ZBL A;  3SUQ A;  1JL2 A;  3SCX A;  4I7F A;  4CCH A;  3QEV A;  1LW0 A;  2FBV A;  1C1B A;  3NH0 A;  3RRG A;  3SNN A;  3A2F A;  4E1M A;  3HP6 A;  4HUF A;  1NJZ A;  2KFN A;  4BDY A;  4RW9 A;  3WNF A;  4RW8 A;  2OA8 A;  3HVT A;  3PY8 A;  2FBY A;  3OYI A;  4W5N A;  4O55 A;  1S1X A;  4CJQ A;  4E3S A;  3SUP A;  1U48 A;  3I0R A;  2Z1H A;  3ZT0 A;  3HT3 A;  3LAN A;  4O4G A;  3HXM A;  1NK8 A;  4FXD A;  3VQ4 A;  4CJU A;  1C1A A;  2X74 A;  1RBS A;  4NYF A;  4O44 A;  3T19 A;  4CGD A;  4FLW A;  3IG1 A;  3THV A;  1WSG A;  5C24 A;  3NH2 A;  4DSF A;  1C6V A;  3MXJ A;  4B9V A;  4DTS A;  4DSE A;  2I5J A;  4Q5V A;  3OYA A;  1XC9 A;  1VSD A;  2YNG A;  3AVI A;  4HCC A;  4W5T A;  1G15 A;  3ASM A;  3DLG A;  4N41 A;  4OVL A;  2HHW A;  3O3H A;  4KRF A;  1O1W A;  3PO5 A;  1RT2 A;  2QXF A;  4E7H A;  3KD1 E;  5FRM A;  1TKZ A;  1TAQ A;  1KLM A;  1EXQ A;  3DRP A;  4BWM A;  2VG6 A;  3TAB A;  2HND A;  2O4G A;  3K58 A;  4DTM A;  3AVB A;  4CJV A;  3KLG A;  2VG7 A;  4FJ5 A;  3ZT2 A;  3AV9 A;  1Q8I A;  2HNZ A;  3NGI A;  4B8A B;  3PX0 A;  2Z1J A;  4KPY A;  4M3T A;  2HHU A;  2LSN A;  3RR8 A;  3L3V A;  4GVM A;  1HYV A;  1N5Y A;  4ELT A;  1KFD A;  1HQE A;  4F2R A;  4HCB A;  5CY4 A;  3OYG A;  3VQC A;  4CJT A;  1HMV A;  4KTW A;  3MEC A;  2YHA A;  4NCG A;  3TAG A;  2F8T A;  3ZCM A;  1QHT A;  3OJS A;  1HNV A;  1C1C A;  5CYQ A;  1QS4 A;  3ZT1 A;  4CF2 A;  3VA3 A;  1NKE A;  3RMD A;  1HPZ A;  3OYH A;  3MEE A;  4LY7 A;  4BE2 A;  1ZBH A;  3AVH A;  3OYD A;  2QKK A;  4O0I A;  4FJI A;  2G8I A;  2E4L A;  4CGG A;  4CIG A;  2VG5 A;  1SL0 A;  3NGY A;  4FJG A;  3RMC A;  1KRP A;  3ITH A;  3B6P A;  1EKE A;  4KHU A;  2WOM A;  4CEQ A;  5KRT A;  4FJM A;  3NF7 A;  1C0U A;  4AHS A;  1U45 A;  4QAG A;  1C0M A;  1JLA A;  3AVG A;  2OZM A;  5J2N A;  4DU4 A;  1RT4 A;  4EZ6 A;  2O4I A;  2OPS A;  1KCF A;  1ASV A;  3KK1 A;  1YTU A;  1BIU A;  2BDP A;  1X1P A;  3D45 A;  2E6M A;  1FKO A;  3L2V A;  1NJW A;  5DK5 A;  5HLF A;  5I3U A;  4M3U A;  4DFP A;  3CFO A;  4FJJ A;  2BAN A;  1LAW A;  1HYZ A;  2BGG A;  3SYZ A;  2D0A A;  4B3O A;  1L5U A;  3KLE A;  2HHT A;  1RT5 A;  1WNS A;  4CED A;  3K5M A;  1U49 A;  2IDO A;  1NK6 A;  4KB1 A;  1RT1 A;  2WON A;  3SPY A;  3VQQ A;  3QEP A;  1SKS A;  4KHS A;  1GOC A;  3C95 A;  4CFA A;  3F73 A;  3TAM A;  1L3S A;  1IG9 A;  3DRS A;  4OKJ A;  3ULD A;  3MAQ A;  4HUE A;  2OPQ A;  3P5J A;  2X6N A;  4IFV A;  1JLG A;  2HVI A;  1IKV A;  1HQU A;  1VSM A;  4FM0 A;  4EP5 A;  1CXQ A;  5J2P A;  3SUN A;  2Q3S A;  3VQ8 A;  4FLZ A;  2G8U A;  3AA2 A;  4DMN A;  3K2P A;  4FVM A;  1K6Y A;  5HRO A;  2PZS A;  4M3R A;  2FBT A;  1JLQ A;  3QIO A;  2VWJ A;  3PX4 A;  4FZY A;  4I9Q A;  4N76 A;  4DWI A;  3SJJ A;  3H08 A;  3QIN A;  4DSI A;  1YVU A;  4DS5 A;  3LAL A;  3M8S A;  1NKC A;  1Z25 A;  2OYQ A;  5J1E A;  3C6T A;  4CJL A;  3S3O A;  1NK0 A;  1S6Q A;  4OJR A;  4FLY A;  1W9H A;  4FK0 A;  4KHY A;  5J2M A;  2YNF A;  3KTQ A;  1QTM A;  3QNN A;  1S9E A;  1TKX A;  4M42 A;  2R7Y A;  3HVR A;  4PQU A;  3LDS A;  3QEI A;  4F3T A;  1A5X A;  4UQG A;  1NKB A;  4J2D A;  2VWK A;  1ZBU A;  4C8K A;  4DLE A;  1BCO A;  3KKR A;  3ZSV A;  1CLQ A;  3S9H A;  4NYN A;  2XY6 A;  1SKW A;  4E0D A;  1WAJ A;  2HHV A;  5DMR A;  2HHQ A;  3LPU A;  1KTQ A;  1BHL A;  3MEG A;  3DLR A;  2P5O A;  2YKM A;  3VQ6 A;  1KVA A;  3KLF A;  1X9M A;  4Z4C A;  1Q9Y A;  1NJX A;  4AHU A;  3SQ0 A;  3SI6 A;  3LZJ A;  1TV6 A;  3QES A;  1L3T A;  1UOC A;  3OYN A;  4Z4H A;  1JLF A;  4DQP A;  3O4Q A;  3NF9 A;  4Y1D A;  4ICL A;  4FLT A;  1UA0 A;  4IG0 A;  3AO4 A;  1JLB A;  1WAF A;  3HO1 A;  1TL3 A;  3OYL A;  4CGJ A;  4CEO A;  4CHZ A;  3EYZ A;  3AA4 A;  1VRU A;  3P1G A;  2NUB A;  1CXU A;  3DLH A;  1S6P A;  1VSI A;  5CYM A;  3VQD A;  4CF1 A;  5KRS A;  4DS4 A;  3G0Z A;  2PYJ A;  4B9L A;  3TI0 A;  3B6O A;  1Z26 A;  4F3O A;  4GW6 A;  1B9F A;  4H8K A;  3V1R A;  5HP1 A;  3HL8 A;  5CZ2 A;  4HVJ A;  1J5O A;  4PA1 A;  3ZSR A;  1NOY A;  2XHB A;  1KLN A;  4M3W A;  3LP3 A;  4CEF A;  3LAK A;  5J2Q A;  1EP4 A;  1N6Q A;  4FK4 A;  3AVN A;  3VQP A;  4ELV A;  2XY7 A;  4ID1 A;  3TWH A;  2DTU A;  3QET A;  4PUO A;  4E7I A;  4IG3 A;  3DLB A;  4CK2 A;  4ZHR A;  1HJR A;  1QQC A;  3AA3 A;  3L8B A;  1BIS A;  1TK5 A;  4C8O A;  2XRI A;  4OKE A;  1SL2 A;  5E41 A;  4IFY A;  3RWU A;  2F96 A;  4RW7 A;  1GOB A;  1BQN A;  4B8C A;  3SZ2 A;  1J53 A;  4LH4 A;  3BDP A;  4H4M A;  3CFP A;  4KRE A;  2HW3 A;  3OYB A;  4E7K A;  3HPH A;  4E19 A;  4Z4E A;  3LAM A;  3NCI A;  4KI4 A;  4JS5 A;  3AVJ A;  3VN5 A;  4CES A;  5KGX A;  3KKS A;  2GV9 A;  3SQ4 A;  4DF8 A;  4J2A A;  4CJK A;  4YNQ A;  1KVC A;  2GUI A;  1LAV A;  2YKN A;  4DFJ A;  4F8R A;  3KLH A;  1T03 A;  4K8Z A;  4CFB A;  3OYF A;  4M3Y A;  1J54 A;  1NJY A;  3SV4 A;  4QOZ B;  1YT3 A;  3I0S A;  2P5G A;  3L2U A;  2ZD1 A;  4BDZ A;  1RBT A;  1MU2 A;  3HPG A;  1RCH A;  1F21 A;  3NAE A;  4AHR A;  1LWF A;  1D9F A;  3NFA A;  1RDD A;  3C6U A;  3F9K A;  3O4N A;  3K5O A;  4DTR A;  1JXB A;  3L2W A;  2GBZ A;  3KK2 A;  3CM5 A;  3EZ5 A;  3T1A A;  1NK7 A;  4FM1 A;  1CZB A;  3ISN C;  4CGH A;  4R5P A;  2KW4 A;  3V6D A;  3ZSO A;  4KHW A;  4KO0 A;  2RN2 A;  1XHZ A;  4OGE A;  4DU1 A;  4CER A;  4RG8 A;  2OZS A;  3TAP A;  3I8D A;  3DLE A;  5FRO A;  5SWM A;  1Q9X A;  1JXE A;  3L2Q A;  1CZ9 A;  2B4J A;  1RDB A;  1IH7 A;  1JLC A;  4F4K A;  1U04 A;  1S1U A;  1TKT A;  2OPR A;  4DQS A;  3IRX A;  4W5Q A;  3U6F A;  3C94 A;  3QEW A;  2PYL A;  4C8M A;  3DOL A;  4ID5 A;  1RDC A;  4E7L A;  1T05 A;  3S3N A;  1UA1 A;  3VQE A;  4M45 A;  1D8Y A;  3AO1 A;  4DQR A;  4FYD A;  3DM2 A;  3DYA A;  4KB0 A;  1BCM A;  5FRN A;  2AJQ A;  2IAJ A;  3G10 A;  5C25 A;  2PY5 A;  1RT7 A;  2RF2 A;  4Y1C A;  3RMA A;  3TAR A;  4FJN A;  4JRP A;  2YHB A;  2RPI A;  1HNI A;  2BE2 A;  5HRS A;  1QE1 A;  3V9W A;  1BI4 B;  4E1N A;  1DLO A;  2KZZ A;  3TAN A;  2G8H A;  3OYK A;  4AHC A;  4W5R A;  3QNO A;  2HHX A;  3MED A;  4M41 A;  1SL1 A;  3CQ8 A;  4KHQ A;  2A1R A;  4LD0 A;  3AO3 A;  4F2S A;  4M3X A;  4CF9 A;  2QKB A;  4CJE A;  5D3G A;  3NHG A;  1BI4 A;  4DTX A;  5HRN A;  4CJS A;  3M8P A;  1HRH A;  1UAX A;  3U3G A;  4FZZ A;  2E6L A;  4FJL A;  3TAF A;  1TGO A;  2EX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...