1N36K

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 24
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1n36K00
2UUCK 5IT9O 2UUAK 4JI8K 4JI5K 3J7AP 1XMOK 4X62K 4LFCK 3OTOK 4B3SK 4JI3K 2F4VK 4X64K 1HNWK 4LFAK 4LF4K 4JI1K 4NXNK 4DR2K 4B3MK 1IBLK 4DR3K 5A2QO 4B3TK 4NXMK 4DR4K 4K0KK 5AJ3K 4DV2K 4AQYK 4YHHK 1N34K 4LF8K 2UXBK 1FJGK 4JI7K 4CVNE 2UUBK 4CW7B 4JI4K 2E5LK 1N33K 1IBKK 1HR0K 3J7YP 5LMNK 1IBMK 5LMUK 2UXCK 4DR7K 4X65K 4KHPK 2VQEK 4DV0K 4DR6K 4LF9K 4DR5K 2UU9K 4JI0K 4DUZK 4GKKK 3T1YK 4OX9K 5LL6Z 4DR1K 4JYAK 2UXDK 5IWAK 3T1HK 3J81O 4DV3K 4GKJK 1HNZK 1XMQK 3JAMO 5FLXO 1HNXK 1XNQK 4DV4K 1I94K 1N36K 2HHHK 4DV5K 1J5EK 4X66K 1XNRK 4JI2K 3J80O 4JI6K 4DUYK 1N32K 4LF6K 4JV5K 4DV6K 4LFBK 4DV1K 5BR8K 4DV7K 4LF5K 4V19S 2ZM6K 4LF7K 4B3RK 4YY3K 2VQFK
chains in the Genus database with same CATH superfamily
1LV5A 4GMJB 3ZSRA 4LC9B 3QIPA 3KLGA 3HOSA 2ASMA 2G8UA 5BN8A 4C1NI 4M42A 4E7LA 4YOUA 5CZ2A 2QWOA 1ZC6A 3BEXA 4KTWA 5M1OA 3DLBA 4OGEA 5A2QO 2HNYA 3DAWA 1NLVA 4I7FA 3CMEN 3O9SA 2DTUA 5AZIA 1NGEA 4DV2K 1NKCA 1QZ5A 5HL7L 4RCHA 3VQ8A 4CZLA 1RDDA 5AQOA 1TK0A 1NG9A 2UYTA 5M1KA 2QXLA 4CVNE 1DKGD 3HXMA 2XY7A 2ZGZA 4O8KA 3AVAA 1N8RO 3SUPA 5K14A 2ASPA 4BE1A 3AY9A 2NRWA 1B9DA 2WONA 3L0QA 3QFPA 3OJSA 4WFNL 3LALA 1IBMK 4FJXA 1EQYA 2P9LB 3A5LC 3WEEB 4JKGB 2VG6A 1NK5A 3SUNA 3L3VA 3DLGA 1VSFA 1WB9A 3QEVA 3ZSOA 5LL6Z 2KZZA 3SBGA 3R8EA 3E9LA 5KI6A 1MU2A 3AVKA 4A61A 2E20A 5FLXO 2OZSA 4CE9A 5E41A 4FW1A 4O8UA 2KZMA 1KCFA 3D6RA 2Q1NA 3ZX2A 3V6DA 2HSTA 3J80O 2ZJQL 4DSFA 1RTHA 1X9MA 3GOIA 5HRRA 1RDBA 4E89A 1J9AA 4DV7K 5E84A 4H5RA 2H3GX 5J1EA 1W97L 3QMLA 4K25A 3EN9A 3A5NC 3AVFA 1S1XA 4FYDA 4YY3K 3O4NA 3LDNA 3KVGA 1A5VA 1RTDA 4DTUA 3I0RA 2QXFA 2HBLA 4N76A 4PL8A 4FK4A 3EKUA 1J6ZA 1D5AA 4H4MA 4KO0A 4CK3A 4DQQA 4R79A 2AP1A 4IO9L 2A42A 5H1SQ 3NGIA 1YVUA 4FWKA 1ZBLA 4MLEA 5CYQA 3WNHA 5KQDA 4YDUA 1Q82O 1J54A 1NM1A 4WQ5C 4N5SA 4M7YA 2HBMA 2VGMA 2PFUA 2B6AA 4DFMA 1TKDA 3LDSA 1NK6A 4CIFA 5F0XA 1Z25A 2NRXA 1JCEA 1IBKK 4EZ6A 3J7YP 4KFBA 3SAFA 3K58A 5LMNK 2G8VA 1S22A 1WSIA 3QFUA 1ILYA 1HPMA 1BIUA 5BPNA 5SWMA 2VQEK 3KK1A 4JHDB 2YI1A 2F9WA 2CH5A 4J2BA 4DS5A 5BPLA 2X6NA 4E19A 3VGMA 4DU3A 3VTHA 3OVNA 4FLXA 1EP4A 1QQMA 4DTNA 2IIRA 4CGHA 3MN6A 1NK4A 1HNXK 5C42A 3OS0A 1Y64A 1NGBA 3SV3A 2FBTA 1W7AA 1RTIA 2Z1IA 3MXIA 1YIJN 3J8AA 1SL0A 3TR8A 2Q31A 3C6AA 4LFBK 3CPEA 4Z94A 3C6HA 3WXKA 1VQ4N 4CIEA 4QS7A 5C15A 2PZSA 4IFYA 4CEOA 4OGCA 3AO4A 4KH6A 3ZLJA 3T69A 4H0YB 3RMCA 2OPSA 5I42A 1RNHA 1KTQA 3H1QA 5JVHL 2UUCK 4G1QA 5IT9O 3M6GA 1SS6A 2E2QA 4DG1A 2FXUA 1KLNA 3CYMA 3IUCA 3RRHA 2D0OA 1YT3A 1JLQA 1WSEA 3MCAB 3CD6N 1VQON 3KLIA 3RR8A 4FJ8A 5JS2A 1HJOA 3PIPL 1Z6RA 3CM5A 4OJRA 4IFVA 1YI2N 5J2PA 3FZHA 4NXMK 2KLAA 4L3QA 4CI6A 3HJFA 4YOXA 5ELZA 5AQXA 1XHXA 3MXMA 4LH5A 1K8KB 4GV3A 4YHHK 2P9NA 3VERA 4BC2A 3ZT4A 1VSJA 2UXBK 1LWCA 4B9QA 5KQ8A 4CZMA 4FM2A 5HROA 4DTJA 3MEDA 4JKBA 3SV4A 5HOOA 4IXCA 1HUXA 3F5TA 4WE1A 1XUPO 3RSEA 1NMDA 1RCHA 1QVGM 3ISNC 3QINA 4B9MA 4CZFA 1MWMA 3OYGA 1H1VA 3CJ7A 2X74A 2UXCK 2VWKA 5AQPA 3HYFA 4F2SA 2NNWA 5AQQA 4JHDA 4NB4A 2P9UA 4OLAA 1SZ2A 4KHNA 1VSEA 3J81O 4CFDA 4PWDA 4DFJA 2GEMA 3V9SA 1U04A 3MXJA 1C1AA 3OBYA 3PSFA 4E3SA 3WNGA 4BRIA 4BE0A 4M7XA 1C0UA 1IV0A 3ALYA 3V9ZA 1HYSA 3KLFA 3P38A 3LWLA 2E6LA 2HVIA 1S1UA 3CQYA 2FF3B 4O44A 1C1CA 1RT3A 2HMIA 1F21A 3UKUB 4BRDA 3I8BA 3ENBA 3LDQA 4BVPA 5CZ1A 4WYBA 3FLCO 3VQ5A 4B8CA 3HZ6A 2W41A 4CZGA 4FK2A 4BGBA 5EX5A 3EE9A 4H0VB 4RW4A 5AQNA 4A2BA 3CCMN 3U3YA 1ASWA 4HHTA 3TAMA 4JI8K 4JI5K 1IKVA 3EEQA 1L5UA 3EO3A 4LFCK 1SL2A 1OH5A 4BDPA 1DTTA 4JI1K 1C0GA 1GOBA 5FRNA 4CIGA 3K5OA 4DR3K 1ATNA 3NDKA 3T19A 4DR4K 1SKSA 1CLQA 4BWJA 4DCHA 4Z4HA 1T6DA 3SUOA 3O3GA 4GW6A 2D0AA 2P9PA 2YKMA 2HHVA 2RKIA 1NK9A 1JLBA 1BI4A 4GV6A 4H03B 5DMRA 4HUFA 5AQJA 4FCYA 1E3MA 4CHQA 2OANA 2HHWA 2WUSA 1QTMA 4DS4A 5M1QA 3L2WA 3DI6A 4HCBA 1ATRA 2YJEA 3FFIA 2PYJA 2JWLA 3U4LA 3DM2A 3M8QA 3PUFA 3ZEUA 1VQ5N 4X65K 4DR7K 1UA0A 1WBBA 2P9UB 1TL3A 3ZETA 1J53A 2IDOA 4U67L 1FKPA 4FJKA 2P9SB 4O0IA 3V1OA 1JLGA 2A1SA 4DV3K 3RMDA 1Q86O 4KH5A 4RWTA 3SQ4A 3LDLA 1EKEA 1YJ9N 1HMVA 4HTUA 4DSIA 5BRHA 3DXKB 3M8SA 2P9IB 4JRQA 3HL8A 3MEEA 1TK8A 5GINA 1WAFA 1YTAA 2Q2RA 4KKOA 1R0AA 2BANA 5SZTA 4DLEA 1VQPN 2YHXA 1R59O 4XEIA 2YNIA 4HVJA 4BR7A 4CF2A 3H3NO 3CC4N 4O55A 4ELUA 4Q0BA 3TTCA 3DLKA 4W5TA 1GLBG 1RILA 4KREA 4X62K 3OYCA 1KAYA 2KHOA 1EO1A 1S6PA 2X6SA 4JK7A 3B6OA 2D4WA 3G10A 4KV8A 3CJAA 4B3MK 4OKEA 1UOCA 4O5BA 4XH5A 3K5NA 3IMXA 1QE1A 3TAEA 3M3ZA 4A5BA 3VTIA 1YJWN 2HBKA 3M1FA 1OKJA 4BRGA 1DT9A 2W6LA 3NGZA 3OBWA 1K9MO 1BOTO 1T6CA 3O80A 4CJEA 4RW8A 1VHXA 1BCOA 2GTDA 4ISFA 2CH6A 1WLJA 2GBZA 1A5WA 1IKXA 5CE3A 4AHCA 5BPMA 3FZFA 3SLCA 3IAYA 1S6QA 3ZT0A 4JKDA 4N41A 1X9SA 2Q97A 1HYZA 1VSLA 4B9LA 4J2AA 2DFHA 4BRMA 4OKJA 4JD2B 3QEXA 4FJ9A 3DJCA 3FZMA 3F2KA 2OTJN 3W0LA 4EP5A 4JS5A 2UU9K 4B1YB 4B8AB 3H6EA 1O13A 3ZETB 3CPWM 4EAHD 4BC5A 4K8XA 4BRCA 4BQZA 3VEXA 3LAMA 4FLUA 3OA9A 2BDPA 3CCSN 4BRAA 1Q8IA 4EP4A 3SI6A 5HRSA 1KFDA 4OLBA 2B5JA 5HLFA 1ASUA 3SK3A 4FPAA 3DRPA 4FOEA 1HKBA 4IOCL 3SQ1A 2HHUA 3DXKA 4CJ3A 4LF6K 4E7HA 5AQGA 2O8EB 3C65A 3OS1A 4FJLA 2IVPA 1HRHA 3P1GA 1X9JA 2Z1GA 4F4KA 4CGJA 4JAXA 1RT1A 1KQSM 1ZYQA 2E2PA 3E9OA 2RF2A 2Y1JA 4DSJA 5GIOA 3WXMB 1U4BA 4IDKA 1GLDG 2ETJA 2PAVA 1V4TA 4FWOA 1W2BM 1WAJA 1HNVA 3H46O 3UB5A 1SKWA 4JLHA 1EETA 3QICA 4DR2K 5BR9A 3OYNA 3HPOA 2GELA 3H1VX 4JKGA 4WFAL 5AQIA 3D2EA 1BL3A 4HUGA 3TWHA 3NFAA 3G0ZA 2G8KA 4KB1A 4PQUA 1BWFO 4CBWA 4AQYK 4CD1A 3KLEA 2O8DA 4PKIA 4OPAA 5EVZA 1VQKN 4ISGA 4CHYA 1Z05A 3FGUA 2W42A 1X1PA 4CHNA 4PL7A 3HSCA 4FZXC 1C0MA 1GLLO 5AZIB 2J4RA 4KI6A 1RBRA 3S3NA 4NCAA 3CHWA 4ISEA 4BRFA 3LANA 5FPDA 3AAPA 3RMBA 5AR0A 5EOYA 4DV0K 3WQTA 4MLHA 5TKYA 1KXPA 3KTQA 1VQ6N 4JI0K 4GKKK 4WFBL 3AO5A 3DLEA 4M3YA 2I5JA 3FFKB 3EYZA 4DR1K 1WOQA 3K9JA 3T1HK 3D2FB 3TPQA 3RMAA 2VG5A 1RBSA 3JAMO 1WBDA 4WQ4C 4FJJA 4H0OA 4BR9A 2RPIA 3QEWA 4CZJA 4FLWA 1FW6A 3KKSA 4BQLA 1IKWA 1VSDA 2NRTA 3DXMB 3VQ4A 3O3HA 1ZBFA 3CG7A 1TAUA 1NJXA 4IG3A 4CJPA 3O9RA 4BR2A 3K57A 1VSMA 1VQ8N 2Q0RA 1C0TA 4JKAA 4UQGA 1TL1A 4DTRA 3V9XA 2P9NB 3WXIA 1CZBA 5M1PA 5JS1A 5BRDA 3ZSVA 4BRHA 3ID6A 2V7ZA 3CCLN 1JXBA 4C8OA 4JI3K 2E4LA 4TSXA 3MWTA 3C7NB 3S9HA 2AA4A 1NGCA 4FWMA 1HNWK 1U49A 2FSNA 4NXNK 5GIPA 4AILC 3P39A 3BZCA 2OZMA 4AHRA 2XY6A 1ESVA 3EY1A 1VRTA 3L2UA 3AVHA 5JICA 1OH6A 1LOTB 3OHRA 4NO7A 2QEXN 1NBWA 4LY7A 3KHYA 3NH2A 1FJGK 1YJNN 5FPMA 5F1XA 1O1WA 5C25A 3THXB 4FL9A 2VCPA 1D4XA 2FF6A 4LD0A 3HM8A 4C8NA 4G9ZA 2YHAA 1CXQA 4CK2A 2A41A 4IWVA 3TI0A 4YORA 4CHZA 3LP3A 2EWSA 3TAFA 3A5MC 1K8AO 3Q7BA 4Z4EA 1E4FT 2HF3A 4N47A 3K0SA 4KHPK 2GV9A 3KK7A 3AO3A 2YHBA 2IOCA 2VYPA 2E6MA 1YITN 3CCQN 2OA8A 3BY5A 4BY9C 1JLCA 4M63C 4CJRA 5IWAK 4XH1A 4Y1CA 1JJ2M 3FR0A 3DWLA 3KWGA 4H5WA 4O4GA 4E7KA 2XY5A 2FBXA 5I9EB 3O08A 1S3XA 1ZBHA 1XNRK 2E1ZA 1RFQA 2FLOA 3MN7A 4B9TA 2NZTA 3KZBA 4CJFA 5FRMA 3SAGA 3QO9A 3DXMA 1GLEG 4V19S 3DLRA 5AZJB 1BI4B 4QS9A 4JS4A 4PKHA 5DM7L 3CFPA 5JVGL 4WQ5A 2WOMA 1XC9A 1S9GA 1VQMN 3KKRA 4CGIA 3TARA 2P9PB 2KFZA 1BO5O 1DEJA 1S5JA 1VK0A 4DWIA 4DTSA 3CCVN 2HNDA 3OW2M 4CJKA 2V51B 3ZX3A 2GUIA 5ADXH 3VGKA 3K2PA 3SQ2A 2R7YA 1QZ6A 4CF0A 3AA2A 1NMNA 4A57A 5J2QA 1LAWA 3V4IA 1JLEA 4K0KK 3LM9A 2PBDA 1NK8A 3ZX0A 2QWLA 1MA9B 3VA3A 4EZ9A 3SJHA 1SL1A 4QCLA 5AQTA 4LF8K 3THXA 3PO4A 3C6TA 4BRNA 4CEDA 1ATSA 3AA5X 4BR5A 1KSPA 4DQ8A 4BREA 4BRLA 1UA1A 3I55N 4AHVA 5AQYA 2E5LK 3VF4A 4RTFD 1KVAA 2NUBA 4YOVA 3EZWA 1ZBIA 4ILHA 1P8ZA 3AVMA 3UKRB 3LPTA 3LM2A 4H0PA 1YTUA 3IRXA 1NGDA 4A59A 4CZKA 5FROA 4KB0A 3PX4A 3T1YK 3ZT1A 3DLHA 4OX9K 2NRVA 1NGAA 4DQPA 2ATQA 3C0BA 4BDZA 2ZJPL 1HQEA 3IFRA 2JWKA 4EIAA 1LWFA 3IDHA 4FJHA 1YVNA 3P31A 4IDHA 1IKYA 4KHWA 3OYMA 1BQNA 4H0XB 1JCFA 3M5RA 2RN2A 3QIOA 4CZHA 3GBTA 3O1WA 4CF1A 4CF8A 2ZE2A 4FM0A 4BC3A 4R5PA 4DV1K 4H4OA 4O5FA 4C8KA 2YHWA 2O8BA 1RGIA 1T03A 3KJVA 3LZIA 3VQ7A 4FOIA 1W0HA 3MN5A 4CHOA 5KRTA 4BRQA 4FM1A 4Z0UA 2P5OA 4FWQA 3JSMA 1QSYA 3NCIA 4DF4A 4CEFA 4MO5A 3ZSXA 3V9WA 4LF4K 4JK8A 3AGRA 4IJNA 4I9QA 2ZJRL 1BU6O 3ZSYA 2HHSA 2IGIA 2F8SA 3KLHA 5DK5A 4IG0A 2QA4N 1NOZA 4HTLA 3LP0A 4AHSA 4XIUA 1U45A 3F73A 2BH1A 1OH8A 3THYA 3KIOA 4JI7K 3CC2N 3QB0A 3ENHA 2IVOA 4E1NA 1TK5A 2GX9A 1A5XA 3D7EO 3MN9A 3NAEA 1N33K 2PY5A 3WUHA 2D1KA 2YV0X 3E01A 1HR0K 1HKGA 3CCEN 3OYEA 2JGUA 2NLXA 3Q7CA 4J8FA 5CHIA 5GAHP 4DTMA 3HSTB 2V52B 5JLFA 5LY3A 5DM6L 4NCGA 1N5YA 4W5RA 3CMAN 2BTFA 3THWB 3PY8A 4Z4GA 3DLLL 3SJJA 1WNSA 4GVEA 3D45A 4B1VA 2QM1A 4BRKA 3PV8A 3FZKA 1TUUA 3KK3A 3L3UA 4X66K 3MX5A 1DLOA 1RDWX 4JI2K 4IJAA 3PIOL 4AM7A 5ADXA 1Y97A 3SAHA 4DSKA 2OTLN 4LF5K 2QK9A 2VWBA 3PO5A 3R6MA 2QWPA 3C94A 3PX6A 4B3RK 5C2FA 2O8DB 3HK2A 2VQFK 2A5XA 3L8BA 1C1BA 2FSKA 2YX6A 2RHKA 2NRHA 3HP9A 3VENA 1TAQA 3AO1A 5HBMA 4RW9A 4FJIA 4PUOA 3UKUA 4DQRA 2IC3A 5AQRA 3VQ9A 3VEYA 4OPHA 1KLMA 3ULEA 2HW3A 5CYMA 2W40A 1U6ZA 2Z1JA 2ZD1A 3LAKA 4JNEA 3TSPA 4CEEA 3TTFA 3OYLA 1N34K 3O5BA 3AVBA 1RDUA 2QWNA 3SZ2A 1HX1A 4IBNA 4EFHA 4KPYA 2P51A 4FJGA 1EWQA 4MFBA 1QSSA 3SMPA 3OYIA 4YOTA 2G8HA 3NH0A 1TUYA 4F3OA 3K5LA 2ZQBA 1QQCA 1LWEA 3P5JA 3LWMA 5J2NA 3ZCMA 3U6FA 4KHYA 3GG4A 5AQSA 5AFUA 2QW9A 4M41A 3HO1A 1BGXT 4ID5A 2OYQA 1B9FA 3E66A 4JEPA 4M3WA 4KTQA 2GWKA 3PSIA 4HWIA 5BN9A 3UKRA 3WQUA 5KRSA 4BR4A 4B9VA 1RBTA 1CZ9A 2QKBA 3JYTA 4KH4A 1D8YA 3VQ6A 3NBPA 5AQZA 4Z4IA 2ZWHA 4MDBA 3M8RA 4GKJK 1HYVA 3MX2A 2O8FA 2ASOA 1DGKN 2ZF5O 4YNQA 2B4JA 1VSHA 1L3VA 1J5EK 3NH1A 4I2PA 4CJ4A 5KPTA 3CERA 1TYQA 3K59A 1G15A 3O9UA 4GNIA 1IG8A 3CETA 1FXXA 3R1XA 4JRPA 1BG3A 2KQ2A 2KW4A 1CXUA 2F9TA 3D2EB 3WNEA 2WFBA 4K42A 4FLZA 3QERA 3EE8A 1VQNN 3ZT2A 4M3ZA 3AARA 1REVA 1RT2A 5EY4A 1KC8O 3RR7A 3G25A 3J7AP 3N4PA 4GY2B 5KGWA 4DSEA 1XMOK 1YUWA 1GLJO 2E1YA 4FLTA 3RWUA 2AJQA 3F9KA 2YNFA 3B8AX 4I6MA 4FWLA 1JXEA 4CEZA 4B3TK 4MO4A 4F2RA 4B9NA 1YXQA 4RW7A 4OPJA 4W5QA 3ULEB 3NF8A 4BACA 4CJTA 5JMVA 4B1ZA 3L2QA 4OO1J 3OYDA 2NRRA 1QHTA 4YOWA 3CJ9A 4WF9L 3CXCM 1IG9A 4B9UA 2YJFA 3J7ZO 1I39A 1QQNA 1TYQB 2LSNA 2P9KA 3SCXA 2O8EA 2A3ZA 1K8KA 3AGKA 1X3MA 3L4QA 1HQUA 1JLAA 4K8ZA 2VG7A 1MDUB 2RE2A 4W5NA 4BG9A 4NYNA 3K9KA 1D9FA 3O1BA 5AQHA 4DUZK 4DU1A 1OVYA 3A5OC 1KVBA 4IZ9A 1BIZA 2WC9A 3VPZA 3PX0A 1Q81O 4DFKA 3EL2A 3U9DA 4CF9A 1NK0A 4LSNA 4CJLA 5MLCQ 3LDOA 1NGJA 3A2FA 3NMUA 4BGAA 1NGGA 3C7NA 2QTDA 4CFAA 4DUYK 1N32K 3O9QA 4DV6K 2BUPA 3AVCA 4H5TA 2ZGYA 4ZTJA 1VRUA 2G8FA 1JKHA 4FO0A 3TU5A 1NJYA 3VESA 3U9ZA 4CK1A 4FJ5A 4FJ7A 2A1RA 3GL1A 3SQ0A 3HP6A 2KFNA 3V9UA 3CM6A 1QS4A 2D0PA 1YF5L 1WSJA 1YAGA 1NGHA 4CFBA 1BA0A 3MWPA 3O6WA 4KHQA 4MQ3A 3SMSA 3HOTA 2ITMA 3VA0A 2HBJA 4OKKA 2DY4A 1QSLA 2CGKA 2O4IA 4YOYA 5AFUH 2F96A 2CGJA 3MEGA 3VN5A 4CJWA 4AHTA 4CESA 2CGLA 3ULDA 3HVTA 1GLAG 3AVJA 5AQFA 1J5OA 1BA1A 4DU4A 3ATUA 3RRGA 4CZEA 4CEBA 3AVNA 3QDKA 4DF8A 4JN4A 3CC7N 3DOLA 3MCPA 2DPNA 2OPPA 3MK6A 5AQWA 5M1FA 1P90A 4E1MA 1JLFA 3LP1A 1KFSA 5AQUA 4GV9A 4BG8A 2Q3SA 4JKHA 1EXQA 2O4GA 4EHTA 3QBWA 4H8KA 1NJIO 4BR0A 4EHUA 4F8RA 3DRSA 1WN7A 3VEWA 2UXDK 5AQKA 3VQDA 3OYJA 4CERA 3K5MA 3CQ8A 4BE2A 3O8MA 4IO8A 3CCRN 1NKBA 1LAVA 1Z26A 3QEPA 4CGGA 1BISA 4B9SA 3C6UA 1LCUA 4CJSA 1U2VA 3R3LA 4M3XA 3ASMA 3VEVA 3RVCA 4BC4A 4C8LA 3WXLA 3ZT3A 3ZEUB 4FZZA 3HM9A 4K43A 5FPEA 4DFPA 1RDCA 3SUQA 1GLFO 1UWBA 3MDQA 5AQLA 3VF2A 3VQCA 3VMFB 2WBNA 4FWNA 4JK9A 4JKFA 4M45A 3THVA 5C0YA 1KAXA 1RBUA 1BUPA 3SBTA 3V1RA 2D0CA 1SKRA 1ASVA 3U3GA 1EX4A 3BZKA 2F4VK 3VEZA 3OTOK 4B3SK 1FK9A 4U7BA 1C6VA 1LW2A 4ZHRA 4X64K 3T3FA 2BGGA 2Q36A 3R9PA 3W3DA 4I6MB 2O8CA 3S41A 2HMPA 4NLCA 1NGIA 4J2DA 2D0BA 4BROA 1IH7A 2I7PA 5JLHA 3CFOA 5LJWA 2X78A 1QQOA 4C23A 4CJUA 2OPQA 2NRZA 1XC3A 1TKXA 3LP2A 3I56N 4FPBA 4QOZB 2QI2A 4WQ4A 4JKCA 3TAPA 4FWSA 5GAEP 4JD2A 3OY9A 4ID1A 1HKCA 3HBTA 4JI4K 1C0FA 3VQAA 1T44A 3CJCA 3OJUA 3VGLA 1WSFA 3A8YA 4ILJA 1NKEA 4DQSA 4N56A 5LMUK 3DOKA 4H5NA 4OPKA 1QHAA 1KAZA 1SQKA 1TGOA 3OS2A 1X9WA 1HNIA 4DR6K 4DHYA 3ZSQA 2A40A 3A0IX 4CZIA 3OYKA 5FDLA 4JYAK 3BGRA 4CHPA 1L3TA 1BQMA 3PLAA 3LZJA 3CIPA 2YHYA 3THWA 3CF5L 3ATVA 2G8WA 3VQPA 4XH4A 4NLBA 2E2OA 3HI0A 3NF9A 2QWMA 5F2RA 4AHUA 2HF4A 2O8CB 1XNQK 3JXUA 2IVNA 2HHTA 1K73O 2HHHK 4BDYA 5D3GA 4PHTX 4PY5A 5C10A 1U48A 4OVLA 1NK7A 2DFFA 1T3VA 3QESA 3NF6A 4IKFA 4JV5K 5CR4A 3MECA 5BREA 1KVCA 3AVGA 5KPZA 1BDGA 3VETA 4DTOA 3QEIA 4FLVA 4C8MA 5HP1A 3ENOA 4FSVA 2P1JA 1IJJA 3BDPA 1XQSC 2ITGA 5M1NA 4FWRA 2PYLA 2QWRA 3AO2A 4CGDA 4FZYA 1SV5A 4JKEA 4DSLA 4CFCA 3IKMA 3NGYA 3VQBA 4CJVA 4FW2A 3QNOA 3LDPA 3VF6A 3WXJA 4CEAA 5GADP 2IS3A 3P4IA 4I9LA 3FZLA 3CJ1A 4B1WB 1Q7YO 4A5AA 2BE2A 3CCUN 3ID8A 3I0SA 1TV6A 3TSUA 4YFUA 1QVFM 3OYHA 4AF1A 3O4QA 3WEEA 4KTZA 3G6EN 2FSJA 3IS9A 2FBVA 4LH4A 2UUBK 1GLCG 3BF1A 3BP8A 4H0TB 4CW7B 2O8FB 3NF7A 1ZXOA 3EKSA 3DMJA 3QLHA 2XY8A 1ZBSA 4W5OA 3NE6A 2O8BB 1S1VA 5AQMA 4DTXA 3THYB 5CY4A 4ELTA 3QNNA 3QETA 3KWIA 2IAJA 4B1XB 4CGFA 4HUEA 3SNNA 4Y0WA 3ITHA 4LF9K 4DR5K 2Q0UA 2P9KB 3S3OA 5E26A 4ZTFA 3MMVA 1ITGA 4QS8A 3TTDA 3N4QA 1HNZK 1NGFA 1VQ7N 3GDQA 5KGXA 1NNEA 2D5RA 2G8IA 3TAGA 1T7PA 1EWRA 4CEQA 4DV4K 2KTQA 2HHXA 1WSHA 5HRPA 4DV5K 4B08A 4DKWA 1T05A 3BF3A 4KI4A 2JLEA 1Q18A 4PKGA 4IOAL 3O3FA 4CECA 3VOVA 3HVRA 4JI6K 1V4SA 2YKNA 3M8PA 4IFEA 3WT0A 1WSGA 5BR8K 3TANA 4FVUA 1SUQA 1KRPA 3TAQA 2HOEA 3CCJN 2V7YA 1Q9YA 4AH9A 1VSIA 1GOCA 1T8EA 4L8RB 4ELVA 4MDAA 4M3TA 1S9EA 3V81A 4DMNA 2VWJA 4K41A 2UUAK 3JS6A 2QKKA 2VGNA 3I33A 3VQEA 3E9PA 4CJ5A 1S72N 3LL3A 4IOXA 4FVMA 4M3RA 3ZYYX 3BUZB 3QBXA 1OVQA 1RBVA 3HTVA 4M3UA 2Z1HA 5KPRA 3DRRA 1B92A 4KAZA 1ZBUA 1SAZA 3H3OB 3G4SN 1MWKA 4Y1DA 3D0PA 4C1NK 3S3MA 1U2VB 3AV9A 3TABA 3H08A 4CBUA 3AAQA 1Q9XA 3ZSWA 1U47A 2P5GA 2F7TA 5B8HA 1NJWA 3F9MA 3V1QA 3SYZA 4J2EA 3H45C 2YNHA 3VQQA 1JCGA 4CD3A 1RT7A 4Z4CA 2EX3A 4CBXA 1YHQN 4LSLA 3NVMA 3CJBA 4FJMA 4UY8O 3OYBA 1L3SA 3MAQA 3AVLA 2KKZA 3I8DA 5C2DA 1G99A 3OYAA 3WNFA 1GOAA 2XHBA 4HCCA 2E8AA 1NOYA 3SPYA 1HLUA 2HB5A 2XRIA 2DFEA 3L6QA 1XMQK 3O9TA 3VEOA 3RSEB 4B1UB 4E7IA 3FE1A 1RT5A 1E4GT 4E0DA 3HPGA 3HPHA 1NJZA 1HPZA 4WCEL 4BVOA 4KHUA 2HHQA 4F9OA 4O0JA 4KHSA 1RDAA 1UAXA 4LF7K 1BCMA 3CI5A 4DQIA 1VSKA 4RW6A 2E88A 1XHZA 4CJ7A 2GWJA 1JL2A 5LJVA 3SPZA 3ZSZA 4NYFA 1XWLA 4AM6A 4QAGA 4DLGA 4RG8A 3AA3A 5HRNA 3C95A 5C24A 5AZJA 2P9IA 3GE1A 4CJQA 3DYAA 4IEEA 1L3UA 3AVIA 3UE5A 4LFAK 1JL1A 3LPUA 4ILGB 5I3UA 1IBLK 1VQ9N 3O4WA 2HVHA 2HNZA 1TVRA 3B6PA 2EHGA 3UIQA 4KRFA 4IEIA 4DTPA 5AJ3K 1HJRA 1FKOA 3IG1A 5FPNA 2W6KA 3AA4A 5C12A 2F8TA 3EZ5A 3E1YA 3T7ZA 3U8XA 5BRFA 1RTJA 1TKZA 3NVKA 1VQLN 3CQXA 3HT3A 4Z4FA 5AQVA 2GUPA 1RT4A 3D2FA 1NU0A 2OCEA 4A62A 1K6YA 5EXWA 2OPRA 4H5VA 3P83D 1KD1O 4FXDA 4FLYA 3L2VA 4FK0A 2XO7A 2P9LA 1TKTA 4FJNA 4DB3A 4FWPA 3HRGA 4PA1A 1XI1A 4KBOA 3KK2A 3G71N 2FC0A 3NHGA 3KD5E 2QWQA 2I7NA 4I2QA 2E2NA 1LW0A 4ICLA 3RTVA 4BWMA 4CCHA 1RT6A 5KTQA 1D9DA 1I94K 1N36K 1M1KO 4NCBA 3L4IA 5J2MA 2YNGA 1I3AA 4GVMA 1S1TA 3KD1E 1W9HA 1IO2A 3OYFA 1CZAN 2YCHA 1OH7A 3T1AA 4A2AA 1BHLA 4E1JA 4BRPA 4YDUC 4Q5VA 3TSQA 1NWKA 2FBYA 5EU7A 1WUAA 2A6AA 5GAGP 1S1WA 1X3NA 1N6QA 1DTQA 2P9SA 4E7JA 2ZM6K 3L2RA 2Y1IA 4F3TA 5TKWA 3CFRA 1M90O 2WTUA 5T7BA 4B3OA 1VAZA
chains in the Genus database with same CATH topology
2UUCK 5IT9O 2UUAK 4JI8K 4JI5K 3J7AP 1XMOK 4X62K 4LFCK 3OTOK 4B3SK 4JI3K 2F4VK 4X64K 1HNWK 4LFAK 4LF4K 4JI1K 4NXNK 4DR2K 4B3MK 1IBLK 4DR3K 5A2QO 4B3TK 4NXMK 4DR4K 4K0KK 5AJ3K 4DV2K 4AQYK 4YHHK 1N34K 4LF8K 2UXBK 1FJGK 4JI7K 4CVNE 2UUBK 4CW7B 4JI4K 2E5LK 1N33K 1IBKK 1HR0K 3J7YP 5LMNK 1IBMK 5LMUK 2UXCK 4DR7K 4X65K 4KHPK 2VQEK 4DV0K 4DR6K 4LF9K 4DR5K 2UU9K 4JI0K 4DUZK 4GKKK 3T1YK 4OX9K 5LL6Z 4DR1K 4JYAK 2UXDK 5IWAK 3T1HK 3J81O 4DV3K 4GKJK 1HNZK 1XMQK 3JAMO 5FLXO 1HNXK 1XNQK 4DV4K 1I94K 1N36K 2HHHK 4DV5K 1J5EK 4X66K 1XNRK 4JI2K 3J80O 4JI6K 4DUYK 1N32K 4LF6K 4JV5K 4DV6K 4LFBK 4DV1K 5BR8K 4DV7K 4LF5K 4V19S 2ZM6K 4LF7K 4B3RK 4YY3K 2VQFK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC K;  5IT9 O;  2UUA K;  4JI8 K;  4JI5 K;  3J7A P;  1XMO K;  4X62 K;  4LFC K;  3OTO K;  4B3S K;  4JI3 K;  2F4V K;  4X64 K;  1HNW K;  4LFA K;  4LF4 K;  4JI1 K;  4NXN K;  4DR2 K;  4B3M K;  1IBL K;  4DR3 K;  5A2Q O;  4B3T K;  4NXM K;  4DR4 K;  4K0K K;  5AJ3 K;  4DV2 K;  4AQY K;  4YHH K;  1N34 K;  4LF8 K;  2UXB K;  1FJG K;  4JI7 K;  4CVN E;  2UUB K;  4CW7 B;  4JI4 K;  2E5L K;  1N33 K;  1IBK K;  1HR0 K;  3J7Y P;  5LMN K;  1IBM K;  5LMU K;  2UXC K;  4DR7 K;  4X65 K;  4KHP K;  2VQE K;  4DV0 K;  4DR6 K;  4LF9 K;  4DR5 K;  2UU9 K;  4JI0 K;  4DUZ K;  4GKK K;  3T1Y K;  4OX9 K;  5LL6 Z;  4DR1 K;  4JYA K;  2UXD K;  5IWA K;  3T1H K;  3J81 O;  4DV3 K;  4GKJ K;  1HNZ K;  1XMQ K;  3JAM O;  5FLX O;  1HNX K;  1XNQ K;  4DV4 K;  1I94 K;  1N36 K;  2HHH K;  4DV5 K;  1J5E K;  4X66 K;  1XNR K;  4JI2 K;  3J80 O;  4JI6 K;  4DUY K;  1N32 K;  4LF6 K;  4JV5 K;  4DV6 K;  4LFB K;  4DV1 K;  5BR8 K;  4DV7 K;  4LF5 K;  4V19 S;  2ZM6 K;  4LF7 K;  4B3R K;  4YY3 K;  2VQF K; 
#chains in the Genus database with same CATH topology
 1LV5 A;  4GMJ B;  3ZSR A;  4LC9 B;  3QIP A;  3KLG A;  3HOS A;  2ASM A;  2G8U A;  5BN8 A;  4C1N I;  4M42 A;  4E7L A;  4YOU A;  5CZ2 A;  2QWO A;  1ZC6 A;  3BEX A;  4KTW A;  5M1O A;  3DLB A;  4OGE A;  5A2Q O;  2HNY A;  3DAW A;  1NLV A;  4I7F A;  3CME N;  3O9S A;  2DTU A;  5AZI A;  1NGE A;  4DV2 K;  1NKC A;  1QZ5 A;  5HL7 L;  4RCH A;  3VQ8 A;  4CZL A;  1RDD A;  5AQO A;  1TK0 A;  1NG9 A;  2UYT A;  5M1K A;  2QXL A;  4CVN E;  1DKG D;  3HXM A;  2XY7 A;  2ZGZ A;  4O8K A;  3AVA A;  1N8R O;  3SUP A;  5K14 A;  2ASP A;  4BE1 A;  3AY9 A;  2NRW A;  1B9D A;  2WON A;  3L0Q A;  3QFP A;  3OJS A;  4WFN L;  3LAL A;  1IBM K;  4FJX A;  1EQY A;  2P9L B;  3A5L C;  3WEE B;  4JKG B;  2VG6 A;  1NK5 A;  3SUN A;  3L3V A;  3DLG A;  1VSF A;  1WB9 A;  3QEV A;  3ZSO A;  5LL6 Z;  2KZZ A;  3SBG A;  3R8E A;  3E9L A;  5KI6 A;  1MU2 A;  3AVK A;  4A61 A;  2E20 A;  5FLX O;  2OZS A;  4CE9 A;  5E41 A;  4FW1 A;  4O8U A;  2KZM A;  1KCF A;  3D6R A;  2Q1N A;  3ZX2 A;  3V6D A;  2HST A;  3J80 O;  2ZJQ L;  4DSF A;  1RTH A;  1X9M A;  3GOI A;  5HRR A;  1RDB A;  4E89 A;  1J9A A;  4DV7 K;  5E84 A;  4H5R A;  2H3G X;  5J1E A;  1W97 L;  3QML A;  4K25 A;  3EN9 A;  3A5N C;  3AVF A;  1S1X A;  4FYD A;  4YY3 K;  3O4N A;  3LDN A;  3KVG A;  1A5V A;  1RTD A;  4DTU A;  3I0R A;  2QXF A;  2HBL A;  4N76 A;  4PL8 A;  4FK4 A;  3EKU A;  1J6Z A;  1D5A A;  4H4M A;  4KO0 A;  4CK3 A;  4DQQ A;  4R79 A;  2AP1 A;  4IO9 L;  2A42 A;  5H1S Q;  3NGI A;  1YVU A;  4FWK A;  1ZBL A;  4MLE A;  5CYQ A;  3WNH A;  5KQD A;  4YDU A;  1Q82 O;  1J54 A;  1NM1 A;  4WQ5 C;  4N5S A;  4M7Y A;  2HBM A;  2VGM A;  2PFU A;  2B6A A;  4DFM A;  1TKD A;  3LDS A;  1NK6 A;  4CIF A;  5F0X A;  1Z25 A;  2NRX A;  1JCE A;  1IBK K;  4EZ6 A;  3J7Y P;  4KFB A;  3SAF A;  3K58 A;  5LMN K;  2G8V A;  1S22 A;  1WSI A;  3QFU A;  1ILY A;  1HPM A;  1BIU A;  5BPN A;  5SWM A;  2VQE K;  3KK1 A;  4JHD B;  2YI1 A;  2F9W A;  2CH5 A;  4J2B A;  4DS5 A;  5BPL A;  2X6N A;  4E19 A;  3VGM A;  4DU3 A;  3VTH A;  3OVN A;  4FLX A;  1EP4 A;  1QQM A;  4DTN A;  2IIR A;  4CGH A;  3MN6 A;  1NK4 A;  1HNX K;  5C42 A;  3OS0 A;  1Y64 A;  1NGB A;  3SV3 A;  2FBT A;  1W7A A;  1RTI A;  2Z1I A;  3MXI A;  1YIJ N;  3J8A A;  1SL0 A;  3TR8 A;  2Q31 A;  3C6A A;  4LFB K;  3CPE A;  4Z94 A;  3C6H A;  3WXK A;  1VQ4 N;  4CIE A;  4QS7 A;  5C15 A;  2PZS A;  4IFY A;  4CEO A;  4OGC A;  3AO4 A;  4KH6 A;  3ZLJ A;  3T69 A;  4H0Y B;  3RMC A;  2OPS A;  5I42 A;  1RNH A;  1KTQ A;  3H1Q A;  5JVH L;  2UUC K;  4G1Q A;  5IT9 O;  3M6G A;  1SS6 A;  2E2Q A;  4DG1 A;  2FXU A;  1KLN A;  3CYM A;  3IUC A;  3RRH A;  2D0O A;  1YT3 A;  1JLQ A;  1WSE A;  3MCA B;  3CD6 N;  1VQO N;  3KLI A;  3RR8 A;  4FJ8 A;  5JS2 A;  1HJO A;  3PIP L;  1Z6R A;  3CM5 A;  4OJR A;  4IFV A;  1YI2 N;  5J2P A;  3FZH A;  4NXM K;  2KLA A;  4L3Q A;  4CI6 A;  3HJF A;  4YOX A;  5ELZ A;  5AQX A;  1XHX A;  3MXM A;  4LH5 A;  1K8K B;  4GV3 A;  4YHH K;  2P9N A;  3VER A;  4BC2 A;  3ZT4 A;  1VSJ A;  2UXB K;  1LWC A;  4B9Q A;  5KQ8 A;  4CZM A;  4FM2 A;  5HRO A;  4DTJ A;  3MED A;  4JKB A;  3SV4 A;  5HOO A;  4IXC A;  1HUX A;  3F5T A;  4WE1 A;  1XUP O;  3RSE A;  1NMD A;  1RCH A;  1QVG M;  3ISN C;  3QIN A;  4B9M A;  4CZF A;  1MWM A;  3OYG A;  1H1V A;  3CJ7 A;  2X74 A;  2UXC K;  2VWK A;  5AQP A;  3HYF A;  4F2S A;  2NNW A;  5AQQ A;  4JHD A;  4NB4 A;  2P9U A;  4OLA A;  1SZ2 A;  4KHN A;  1VSE A;  3J81 O;  4CFD A;  4PWD A;  4DFJ A;  2GEM A;  3V9S A;  1U04 A;  3MXJ A;  1C1A A;  3OBY A;  3PSF A;  4E3S A;  3WNG A;  4BRI A;  4BE0 A;  4M7X A;  1C0U A;  1IV0 A;  3ALY A;  3V9Z A;  1HYS A;  3KLF A;  3P38 A;  3LWL A;  2E6L A;  2HVI A;  1S1U A;  3CQY A;  2FF3 B;  4O44 A;  1C1C A;  1RT3 A;  2HMI A;  1F21 A;  3UKU B;  4BRD A;  3I8B A;  3ENB A;  3LDQ A;  4BVP A;  5CZ1 A;  4WYB A;  3FLC O;  3VQ5 A;  4B8C A;  3HZ6 A;  2W41 A;  4CZG A;  4FK2 A;  4BGB A;  5EX5 A;  3EE9 A;  4H0V B;  4RW4 A;  5AQN A;  4A2B A;  3CCM N;  3U3Y A;  1ASW A;  4HHT A;  3TAM A;  4JI8 K;  4JI5 K;  1IKV A;  3EEQ A;  1L5U A;  3EO3 A;  4LFC K;  1SL2 A;  1OH5 A;  4BDP A;  1DTT A;  4JI1 K;  1C0G A;  1GOB A;  5FRN A;  4CIG A;  3K5O A;  4DR3 K;  1ATN A;  3NDK A;  3T19 A;  4DR4 K;  1SKS A;  1CLQ A;  4BWJ A;  4DCH A;  4Z4H A;  1T6D A;  3SUO A;  3O3G A;  4GW6 A;  2D0A A;  2P9P A;  2YKM A;  2HHV A;  2RKI A;  1NK9 A;  1JLB A;  1BI4 A;  4GV6 A;  4H03 B;  5DMR A;  4HUF A;  5AQJ A;  4FCY A;  1E3M A;  4CHQ A;  2OAN A;  2HHW A;  2WUS A;  1QTM A;  4DS4 A;  5M1Q A;  3L2W A;  3DI6 A;  4HCB A;  1ATR A;  2YJE A;  3FFI A;  2PYJ A;  2JWL A;  3U4L A;  3DM2 A;  3M8Q A;  3PUF A;  3ZEU A;  1VQ5 N;  4X65 K;  4DR7 K;  1UA0 A;  1WBB A;  2P9U B;  1TL3 A;  3ZET A;  1J53 A;  2IDO A;  4U67 L;  1FKP A;  4FJK A;  2P9S B;  4O0I A;  3V1O A;  1JLG A;  2A1S A;  4DV3 K;  3RMD A;  1Q86 O;  4KH5 A;  4RWT A;  3SQ4 A;  3LDL A;  1EKE A;  1YJ9 N;  1HMV A;  4HTU A;  4DSI A;  5BRH A;  3DXK B;  3M8S A;  2P9I B;  4JRQ A;  3HL8 A;  3MEE A;  1TK8 A;  5GIN A;  1WAF A;  1YTA A;  2Q2R A;  4KKO A;  1R0A A;  2BAN A;  5SZT A;  4DLE A;  1VQP N;  2YHX A;  1R59 O;  4XEI A;  2YNI A;  4HVJ A;  4BR7 A;  4CF2 A;  3H3N O;  3CC4 N;  4O55 A;  4ELU A;  4Q0B A;  3TTC A;  3DLK A;  4W5T A;  1GLB G;  1RIL A;  4KRE A;  4X62 K;  3OYC A;  1KAY A;  2KHO A;  1EO1 A;  1S6P A;  2X6S A;  4JK7 A;  3B6O A;  2D4W A;  3G10 A;  4KV8 A;  3CJA A;  4B3M K;  4OKE A;  1UOC A;  4O5B A;  4XH5 A;  3K5N A;  3IMX A;  1QE1 A;  3TAE A;  3M3Z A;  4A5B A;  3VTI A;  1YJW N;  2HBK A;  3M1F A;  1OKJ A;  4BRG A;  1DT9 A;  2W6L A;  3NGZ A;  3OBW A;  1K9M O;  1BOT O;  1T6C A;  3O80 A;  4CJE A;  4RW8 A;  1VHX A;  1BCO A;  2GTD A;  4ISF A;  2CH6 A;  1WLJ A;  2GBZ A;  1A5W A;  1IKX A;  5CE3 A;  4AHC A;  5BPM A;  3FZF A;  3SLC A;  3IAY A;  1S6Q A;  3ZT0 A;  4JKD A;  4N41 A;  1X9S A;  2Q97 A;  1HYZ A;  1VSL A;  4B9L A;  4J2A A;  2DFH A;  4BRM A;  4OKJ A;  4JD2 B;  3QEX A;  4FJ9 A;  3DJC A;  3FZM A;  3F2K A;  2OTJ N;  3W0L A;  4EP5 A;  4JS5 A;  2UU9 K;  4B1Y B;  4B8A B;  3H6E A;  1O13 A;  3ZET B;  3CPW M;  4EAH D;  4BC5 A;  4K8X A;  4BRC A;  4BQZ A;  3VEX A;  3LAM A;  4FLU A;  3OA9 A;  2BDP A;  3CCS N;  4BRA A;  1Q8I A;  4EP4 A;  3SI6 A;  5HRS A;  1KFD A;  4OLB A;  2B5J A;  5HLF A;  1ASU A;  3SK3 A;  4FPA A;  3DRP A;  4FOE A;  1HKB A;  4IOC L;  3SQ1 A;  2HHU A;  3DXK A;  4CJ3 A;  4LF6 K;  4E7H A;  5AQG A;  2O8E B;  3C65 A;  3OS1 A;  4FJL A;  2IVP A;  1HRH A;  3P1G A;  1X9J A;  2Z1G A;  4F4K A;  4CGJ A;  4JAX A;  1RT1 A;  1KQS M;  1ZYQ A;  2E2P A;  3E9O A;  2RF2 A;  2Y1J A;  4DSJ A;  5GIO A;  3WXM B;  1U4B A;  4IDK A;  1GLD G;  2ETJ A;  2PAV A;  1V4T A;  4FWO A;  1W2B M;  1WAJ A;  1HNV A;  3H46 O;  3UB5 A;  1SKW A;  4JLH A;  1EET A;  3QIC A;  4DR2 K;  5BR9 A;  3OYN A;  3HPO A;  2GEL A;  3H1V X;  4JKG A;  4WFA L;  5AQI A;  3D2E A;  1BL3 A;  4HUG A;  3TWH A;  3NFA A;  3G0Z A;  2G8K A;  4KB1 A;  4PQU A;  1BWF O;  4CBW A;  4AQY K;  4CD1 A;  3KLE A;  2O8D A;  4PKI A;  4OPA A;  5EVZ A;  1VQK N;  4ISG A;  4CHY A;  1Z05 A;  3FGU A;  2W42 A;  1X1P A;  4CHN A;  4PL7 A;  3HSC A;  4FZX C;  1C0M A;  1GLL O;  5AZI B;  2J4R A;  4KI6 A;  1RBR A;  3S3N A;  4NCA A;  3CHW A;  4ISE A;  4BRF A;  3LAN A;  5FPD A;  3AAP A;  3RMB A;  5AR0 A;  5EOY A;  4DV0 K;  3WQT A;  4MLH A;  5TKY A;  1KXP A;  3KTQ A;  1VQ6 N;  4JI0 K;  4GKK K;  4WFB L;  3AO5 A;  3DLE A;  4M3Y A;  2I5J A;  3FFK B;  3EYZ A;  4DR1 K;  1WOQ A;  3K9J A;  3T1H K;  3D2F B;  3TPQ A;  3RMA A;  2VG5 A;  1RBS A;  3JAM O;  1WBD A;  4WQ4 C;  4FJJ A;  4H0O A;  4BR9 A;  2RPI A;  3QEW A;  4CZJ A;  4FLW A;  1FW6 A;  3KKS A;  4BQL A;  1IKW A;  1VSD A;  2NRT A;  3DXM B;  3VQ4 A;  3O3H A;  1ZBF A;  3CG7 A;  1TAU A;  1NJX A;  4IG3 A;  4CJP A;  3O9R A;  4BR2 A;  3K57 A;  1VSM A;  1VQ8 N;  2Q0R A;  1C0T A;  4JKA A;  4UQG A;  1TL1 A;  4DTR A;  3V9X A;  2P9N B;  3WXI A;  1CZB A;  5M1P A;  5JS1 A;  5BRD A;  3ZSV A;  4BRH A;  3ID6 A;  2V7Z A;  3CCL N;  1JXB A;  4C8O A;  4JI3 K;  2E4L A;  4TSX A;  3MWT A;  3C7N B;  3S9H A;  2AA4 A;  1NGC A;  4FWM A;  1HNW K;  1U49 A;  2FSN A;  4NXN K;  5GIP A;  4AIL C;  3P39 A;  3BZC A;  2OZM A;  4AHR A;  2XY6 A;  1ESV A;  3EY1 A;  1VRT A;  3L2U A;  3AVH A;  5JIC A;  1OH6 A;  1LOT B;  3OHR A;  4NO7 A;  2QEX N;  1NBW A;  4LY7 A;  3KHY A;  3NH2 A;  1FJG K;  1YJN N;  5FPM A;  5F1X A;  1O1W A;  5C25 A;  3THX B;  4FL9 A;  2VCP A;  1D4X A;  2FF6 A;  4LD0 A;  3HM8 A;  4C8N A;  4G9Z A;  2YHA A;  1CXQ A;  4CK2 A;  2A41 A;  4IWV A;  3TI0 A;  4YOR A;  4CHZ A;  3LP3 A;  2EWS A;  3TAF A;  3A5M C;  1K8A O;  3Q7B A;  4Z4E A;  1E4F T;  2HF3 A;  4N47 A;  3K0S A;  4KHP K;  2GV9 A;  3KK7 A;  3AO3 A;  2YHB A;  2IOC A;  2VYP A;  2E6M A;  1YIT N;  3CCQ N;  2OA8 A;  3BY5 A;  4BY9 C;  1JLC A;  4M63 C;  4CJR A;  5IWA K;  4XH1 A;  4Y1C A;  1JJ2 M;  3FR0 A;  3DWL A;  3KWG A;  4H5W A;  4O4G A;  4E7K A;  2XY5 A;  2FBX A;  5I9E B;  3O08 A;  1S3X A;  1ZBH A;  1XNR K;  2E1Z A;  1RFQ A;  2FLO A;  3MN7 A;  4B9T A;  2NZT A;  3KZB A;  4CJF A;  5FRM A;  3SAG A;  3QO9 A;  3DXM A;  1GLE G;  4V19 S;  3DLR A;  5AZJ B;  1BI4 B;  4QS9 A;  4JS4 A;  4PKH A;  5DM7 L;  3CFP A;  5JVG L;  4WQ5 A;  2WOM A;  1XC9 A;  1S9G A;  1VQM N;  3KKR A;  4CGI A;  3TAR A;  2P9P B;  2KFZ A;  1BO5 O;  1DEJ A;  1S5J A;  1VK0 A;  4DWI A;  4DTS A;  3CCV N;  2HND A;  3OW2 M;  4CJK A;  2V51 B;  3ZX3 A;  2GUI A;  5ADX H;  3VGK A;  3K2P A;  3SQ2 A;  2R7Y A;  1QZ6 A;  4CF0 A;  3AA2 A;  1NMN A;  4A57 A;  5J2Q A;  1LAW A;  3V4I A;  1JLE A;  4K0K K;  3LM9 A;  2PBD A;  1NK8 A;  3ZX0 A;  2QWL A;  1MA9 B;  3VA3 A;  4EZ9 A;  3SJH A;  1SL1 A;  4QCL A;  5AQT A;  4LF8 K;  3THX A;  3PO4 A;  3C6T A;  4BRN A;  4CED A;  1ATS A;  3AA5 X;  4BR5 A;  1KSP A;  4DQ8 A;  4BRE A;  4BRL A;  1UA1 A;  3I55 N;  4AHV A;  5AQY A;  2E5L K;  3VF4 A;  4RTF D;  1KVA A;  2NUB A;  4YOV A;  3EZW A;  1ZBI A;  4ILH A;  1P8Z A;  3AVM A;  3UKR B;  3LPT A;  3LM2 A;  4H0P A;  1YTU A;  3IRX A;  1NGD A;  4A59 A;  4CZK A;  5FRO A;  4KB0 A;  3PX4 A;  3T1Y K;  3ZT1 A;  3DLH A;  4OX9 K;  2NRV A;  1NGA A;  4DQP A;  2ATQ A;  3C0B A;  4BDZ A;  2ZJP L;  1HQE A;  3IFR A;  2JWK A;  4EIA A;  1LWF A;  3IDH A;  4FJH A;  1YVN A;  3P31 A;  4IDH A;  1IKY A;  4KHW A;  3OYM A;  1BQN A;  4H0X B;  1JCF A;  3M5R A;  2RN2 A;  3QIO A;  4CZH A;  3GBT A;  3O1W A;  4CF1 A;  4CF8 A;  2ZE2 A;  4FM0 A;  4BC3 A;  4R5P A;  4DV1 K;  4H4O A;  4O5F A;  4C8K A;  2YHW A;  2O8B A;  1RGI A;  1T03 A;  3KJV A;  3LZI A;  3VQ7 A;  4FOI A;  1W0H A;  3MN5 A;  4CHO A;  5KRT A;  4BRQ A;  4FM1 A;  4Z0U A;  2P5O A;  4FWQ A;  3JSM A;  1QSY A;  3NCI A;  4DF4 A;  4CEF A;  4MO5 A;  3ZSX A;  3V9W A;  4LF4 K;  4JK8 A;  3AGR A;  4IJN A;  4I9Q A;  2ZJR L;  1BU6 O;  3ZSY A;  2HHS A;  2IGI A;  2F8S A;  3KLH A;  5DK5 A;  4IG0 A;  2QA4 N;  1NOZ A;  4HTL A;  3LP0 A;  4AHS A;  4XIU A;  1U45 A;  3F73 A;  2BH1 A;  1OH8 A;  3THY A;  3KIO A;  4JI7 K;  3CC2 N;  3QB0 A;  3ENH A;  2IVO A;  4E1N A;  1TK5 A;  2GX9 A;  1A5X A;  3D7E O;  3MN9 A;  3NAE A;  1N33 K;  2PY5 A;  3WUH A;  2D1K A;  2YV0 X;  3E01 A;  1HR0 K;  1HKG A;  3CCE N;  3OYE A;  2JGU A;  2NLX A;  3Q7C A;  4J8F A;  5CHI A;  5GAH P;  4DTM A;  3HST B;  2V52 B;  5JLF A;  5LY3 A;  5DM6 L;  4NCG A;  1N5Y A;  4W5R A;  3CMA N;  2BTF A;  3THW B;  3PY8 A;  4Z4G A;  3DLL L;  3SJJ A;  1WNS A;  4GVE A;  3D45 A;  4B1V A;  2QM1 A;  4BRK A;  3PV8 A;  3FZK A;  1TUU A;  3KK3 A;  3L3U A;  4X66 K;  3MX5 A;  1DLO A;  1RDW X;  4JI2 K;  4IJA A;  3PIO L;  4AM7 A;  5ADX A;  1Y97 A;  3SAH A;  4DSK A;  2OTL N;  4LF5 K;  2QK9 A;  2VWB A;  3PO5 A;  3R6M A;  2QWP A;  3C94 A;  3PX6 A;  4B3R K;  5C2F A;  2O8D B;  3HK2 A;  2VQF K;  2A5X A;  3L8B A;  1C1B A;  2FSK A;  2YX6 A;  2RHK A;  2NRH A;  3HP9 A;  3VEN A;  1TAQ A;  3AO1 A;  5HBM A;  4RW9 A;  4FJI A;  4PUO A;  3UKU A;  4DQR A;  2IC3 A;  5AQR A;  3VQ9 A;  3VEY A;  4OPH A;  1KLM A;  3ULE A;  2HW3 A;  5CYM A;  2W40 A;  1U6Z A;  2Z1J A;  2ZD1 A;  3LAK A;  4JNE A;  3TSP A;  4CEE A;  3TTF A;  3OYL A;  1N34 K;  3O5B A;  3AVB A;  1RDU A;  2QWN A;  3SZ2 A;  1HX1 A;  4IBN A;  4EFH A;  4KPY A;  2P51 A;  4FJG A;  1EWQ A;  4MFB A;  1QSS A;  3SMP A;  3OYI A;  4YOT A;  2G8H A;  3NH0 A;  1TUY A;  4F3O A;  3K5L A;  2ZQB A;  1QQC A;  1LWE A;  3P5J A;  3LWM A;  5J2N A;  3ZCM A;  3U6F A;  4KHY A;  3GG4 A;  5AQS A;  5AFU A;  2QW9 A;  4M41 A;  3HO1 A;  1BGX T;  4ID5 A;  2OYQ A;  1B9F A;  3E66 A;  4JEP A;  4M3W A;  4KTQ A;  2GWK A;  3PSI A;  4HWI A;  5BN9 A;  3UKR A;  3WQU A;  5KRS A;  4BR4 A;  4B9V A;  1RBT A;  1CZ9 A;  2QKB A;  3JYT A;  4KH4 A;  1D8Y A;  3VQ6 A;  3NBP A;  5AQZ A;  4Z4I A;  2ZWH A;  4MDB A;  3M8R A;  4GKJ K;  1HYV A;  3MX2 A;  2O8F A;  2ASO A;  1DGK N;  2ZF5 O;  4YNQ A;  2B4J A;  1VSH A;  1L3V A;  1J5E K;  3NH1 A;  4I2P A;  4CJ4 A;  5KPT A;  3CER A;  1TYQ A;  3K59 A;  1G15 A;  3O9U A;  4GNI A;  1IG8 A;  3CET A;  1FXX A;  3R1X A;  4JRP A;  1BG3 A;  2KQ2 A;  2KW4 A;  1CXU A;  2F9T A;  3D2E B;  3WNE A;  2WFB A;  4K42 A;  4FLZ A;  3QER A;  3EE8 A;  1VQN N;  3ZT2 A;  4M3Z A;  3AAR A;  1REV A;  1RT2 A;  5EY4 A;  1KC8 O;  3RR7 A;  3G25 A;  3J7A P;  3N4P A;  4GY2 B;  5KGW A;  4DSE A;  1XMO K;  1YUW A;  1GLJ O;  2E1Y A;  4FLT A;  3RWU A;  2AJQ A;  3F9K A;  2YNF A;  3B8A X;  4I6M A;  4FWL A;  1JXE A;  4CEZ A;  4B3T K;  4MO4 A;  4F2R A;  4B9N A;  1YXQ A;  4RW7 A;  4OPJ A;  4W5Q A;  3ULE B;  3NF8 A;  4BAC A;  4CJT A;  5JMV A;  4B1Z A;  3L2Q A;  4OO1 J;  3OYD A;  2NRR A;  1QHT A;  4YOW A;  3CJ9 A;  4WF9 L;  3CXC M;  1IG9 A;  4B9U A;  2YJF A;  3J7Z O;  1I39 A;  1QQN A;  1TYQ B;  2LSN A;  2P9K A;  3SCX A;  2O8E A;  2A3Z A;  1K8K A;  3AGK A;  1X3M A;  3L4Q A;  1HQU A;  1JLA A;  4K8Z A;  2VG7 A;  1MDU B;  2RE2 A;  4W5N A;  4BG9 A;  4NYN A;  3K9K A;  1D9F A;  3O1B A;  5AQH A;  4DUZ K;  4DU1 A;  1OVY A;  3A5O C;  1KVB A;  4IZ9 A;  1BIZ A;  2WC9 A;  3VPZ A;  3PX0 A;  1Q81 O;  4DFK A;  3EL2 A;  3U9D A;  4CF9 A;  1NK0 A;  4LSN A;  4CJL A;  5MLC Q;  3LDO A;  1NGJ A;  3A2F A;  3NMU A;  4BGA A;  1NGG A;  3C7N A;  2QTD A;  4CFA A;  4DUY K;  1N32 K;  3O9Q A;  4DV6 K;  2BUP A;  3AVC A;  4H5T A;  2ZGY A;  4ZTJ A;  1VRU A;  2G8F A;  1JKH A;  4FO0 A;  3TU5 A;  1NJY A;  3VES A;  3U9Z A;  4CK1 A;  4FJ5 A;  4FJ7 A;  2A1R A;  3GL1 A;  3SQ0 A;  3HP6 A;  2KFN A;  3V9U A;  3CM6 A;  1QS4 A;  2D0P A;  1YF5 L;  1WSJ A;  1YAG A;  1NGH A;  4CFB A;  1BA0 A;  3MWP A;  3O6W A;  4KHQ A;  4MQ3 A;  3SMS A;  3HOT A;  2ITM A;  3VA0 A;  2HBJ A;  4OKK A;  2DY4 A;  1QSL A;  2CGK A;  2O4I A;  4YOY A;  5AFU H;  2F96 A;  2CGJ A;  3MEG A;  3VN5 A;  4CJW A;  4AHT A;  4CES A;  2CGL A;  3ULD A;  3HVT A;  1GLA G;  3AVJ A;  5AQF A;  1J5O A;  1BA1 A;  4DU4 A;  3ATU A;  3RRG A;  4CZE A;  4CEB A;  3AVN A;  3QDK A;  4DF8 A;  4JN4 A;  3CC7 N;  3DOL A;  3MCP A;  2DPN A;  2OPP A;  3MK6 A;  5AQW A;  5M1F A;  1P90 A;  4E1M A;  1JLF A;  3LP1 A;  1KFS A;  5AQU A;  4GV9 A;  4BG8 A;  2Q3S A;  4JKH A;  1EXQ A;  2O4G A;  4EHT A;  3QBW A;  4H8K A;  1NJI O;  4BR0 A;  4EHU A;  4F8R A;  3DRS A;  1WN7 A;  3VEW A;  2UXD K;  5AQK A;  3VQD A;  3OYJ A;  4CER A;  3K5M A;  3CQ8 A;  4BE2 A;  3O8M A;  4IO8 A;  3CCR N;  1NKB A;  1LAV A;  1Z26 A;  3QEP A;  4CGG A;  1BIS A;  4B9S A;  3C6U A;  1LCU A;  4CJS A;  1U2V A;  3R3L A;  4M3X A;  3ASM A;  3VEV A;  3RVC A;  4BC4 A;  4C8L A;  3WXL A;  3ZT3 A;  3ZEU B;  4FZZ A;  3HM9 A;  4K43 A;  5FPE A;  4DFP A;  1RDC A;  3SUQ A;  1GLF O;  1UWB A;  3MDQ A;  5AQL A;  3VF2 A;  3VQC A;  3VMF B;  2WBN A;  4FWN A;  4JK9 A;  4JKF A;  4M45 A;  3THV A;  5C0Y A;  1KAX A;  1RBU A;  1BUP A;  3SBT A;  3V1R A;  2D0C A;  1SKR A;  1ASV A;  3U3G A;  1EX4 A;  3BZK A;  2F4V K;  3VEZ A;  3OTO K;  4B3S K;  1FK9 A;  4U7B A;  1C6V A;  1LW2 A;  4ZHR A;  4X64 K;  3T3F A;  2BGG A;  2Q36 A;  3R9P A;  3W3D A;  4I6M B;  2O8C A;  3S41 A;  2HMP A;  4NLC A;  1NGI A;  4J2D A;  2D0B A;  4BRO A;  1IH7 A;  2I7P A;  5JLH A;  3CFO A;  5LJW A;  2X78 A;  1QQO A;  4C23 A;  4CJU A;  2OPQ A;  2NRZ A;  1XC3 A;  1TKX A;  3LP2 A;  3I56 N;  4FPB A;  4QOZ B;  2QI2 A;  4WQ4 A;  4JKC A;  3TAP A;  4FWS A;  5GAE P;  4JD2 A;  3OY9 A;  4ID1 A;  1HKC A;  3HBT A;  4JI4 K;  1C0F A;  3VQA A;  1T44 A;  3CJC A;  3OJU A;  3VGL A;  1WSF A;  3A8Y A;  4ILJ A;  1NKE A;  4DQS A;  4N56 A;  5LMU K;  3DOK A;  4H5N A;  4OPK A;  1QHA A;  1KAZ A;  1SQK A;  1TGO A;  3OS2 A;  1X9W A;  1HNI A;  4DR6 K;  4DHY A;  3ZSQ A;  2A40 A;  3A0I X;  4CZI A;  3OYK A;  5FDL A;  4JYA K;  3BGR A;  4CHP A;  1L3T A;  1BQM A;  3PLA A;  3LZJ A;  3CIP A;  2YHY A;  3THW A;  3CF5 L;  3ATV A;  2G8W A;  3VQP A;  4XH4 A;  4NLB A;  2E2O A;  3HI0 A;  3NF9 A;  2QWM A;  5F2R A;  4AHU A;  2HF4 A;  2O8C B;  1XNQ K;  3JXU A;  2IVN A;  2HHT A;  1K73 O;  2HHH K;  4BDY A;  5D3G A;  4PHT X;  4PY5 A;  5C10 A;  1U48 A;  4OVL A;  1NK7 A;  2DFF A;  1T3V A;  3QES A;  3NF6 A;  4IKF A;  4JV5 K;  5CR4 A;  3MEC A;  5BRE A;  1KVC A;  3AVG A;  5KPZ A;  1BDG A;  3VET A;  4DTO A;  3QEI A;  4FLV A;  4C8M A;  5HP1 A;  3ENO A;  4FSV A;  2P1J A;  1IJJ A;  3BDP A;  1XQS C;  2ITG A;  5M1N A;  4FWR A;  2PYL A;  2QWR A;  3AO2 A;  4CGD A;  4FZY A;  1SV5 A;  4JKE A;  4DSL A;  4CFC A;  3IKM A;  3NGY A;  3VQB A;  4CJV A;  4FW2 A;  3QNO A;  3LDP A;  3VF6 A;  3WXJ A;  4CEA A;  5GAD P;  2IS3 A;  3P4I A;  4I9L A;  3FZL A;  3CJ1 A;  4B1W B;  1Q7Y O;  4A5A A;  2BE2 A;  3CCU N;  3ID8 A;  3I0S A;  1TV6 A;  3TSU A;  4YFU A;  1QVF M;  3OYH A;  4AF1 A;  3O4Q A;  3WEE A;  4KTZ A;  3G6E N;  2FSJ A;  3IS9 A;  2FBV A;  4LH4 A;  2UUB K;  1GLC G;  3BF1 A;  3BP8 A;  4H0T B;  4CW7 B;  2O8F B;  3NF7 A;  1ZXO A;  3EKS A;  3DMJ A;  3QLH A;  2XY8 A;  1ZBS A;  4W5O A;  3NE6 A;  2O8B B;  1S1V A;  5AQM A;  4DTX A;  3THY B;  5CY4 A;  4ELT A;  3QNN A;  3QET A;  3KWI A;  2IAJ A;  4B1X B;  4CGF A;  4HUE A;  3SNN A;  4Y0W A;  3ITH A;  4LF9 K;  4DR5 K;  2Q0U A;  2P9K B;  3S3O A;  5E26 A;  4ZTF A;  3MMV A;  1ITG A;  4QS8 A;  3TTD A;  3N4Q A;  1HNZ K;  1NGF A;  1VQ7 N;  3GDQ A;  5KGX A;  1NNE A;  2D5R A;  2G8I A;  3TAG A;  1T7P A;  1EWR A;  4CEQ A;  4DV4 K;  2KTQ A;  2HHX A;  1WSH A;  5HRP A;  4DV5 K;  4B08 A;  4DKW A;  1T05 A;  3BF3 A;  4KI4 A;  2JLE A;  1Q18 A;  4PKG A;  4IOA L;  3O3F A;  4CEC A;  3VOV A;  3HVR A;  4JI6 K;  1V4S A;  2YKN A;  3M8P A;  4IFE A;  3WT0 A;  1WSG A;  5BR8 K;  3TAN A;  4FVU A;  1SUQ A;  1KRP A;  3TAQ A;  2HOE A;  3CCJ N;  2V7Y A;  1Q9Y A;  4AH9 A;  1VSI A;  1GOC A;  1T8E A;  4L8R B;  4ELV A;  4MDA A;  4M3T A;  1S9E A;  3V81 A;  4DMN A;  2VWJ A;  4K41 A;  2UUA K;  3JS6 A;  2QKK A;  2VGN A;  3I33 A;  3VQE A;  3E9P A;  4CJ5 A;  1S72 N;  3LL3 A;  4IOX A;  4FVM A;  4M3R A;  3ZYY X;  3BUZ B;  3QBX A;  1OVQ A;  1RBV A;  3HTV A;  4M3U A;  2Z1H A;  5KPR A;  3DRR A;  1B92 A;  4KAZ A;  1ZBU A;  1SAZ A;  3H3O B;  3G4S N;  1MWK A;  4Y1D A;  3D0P A;  4C1N K;  3S3M A;  1U2V B;  3AV9 A;  3TAB A;  3H08 A;  4CBU A;  3AAQ A;  1Q9X A;  3ZSW A;  1U47 A;  2P5G A;  2F7T A;  5B8H A;  1NJW A;  3F9M A;  3V1Q A;  3SYZ A;  4J2E A;  3H45 C;  2YNH A;  3VQQ A;  1JCG A;  4CD3 A;  1RT7 A;  4Z4C A;  2EX3 A;  4CBX A;  1YHQ N;  4LSL A;  3NVM A;  3CJB A;  4FJM A;  4UY8 O;  3OYB A;  1L3S A;  3MAQ A;  3AVL A;  2KKZ A;  3I8D A;  5C2D A;  1G99 A;  3OYA A;  3WNF A;  1GOA A;  2XHB A;  4HCC A;  2E8A A;  1NOY A;  3SPY A;  1HLU A;  2HB5 A;  2XRI A;  2DFE A;  3L6Q A;  1XMQ K;  3O9T A;  3VEO A;  3RSE B;  4B1U B;  4E7I A;  3FE1 A;  1RT5 A;  1E4G T;  4E0D A;  3HPG A;  3HPH A;  1NJZ A;  1HPZ A;  4WCE L;  4BVO A;  4KHU A;  2HHQ A;  4F9O A;  4O0J A;  4KHS A;  1RDA A;  1UAX A;  4LF7 K;  1BCM A;  3CI5 A;  4DQI A;  1VSK A;  4RW6 A;  2E88 A;  1XHZ A;  4CJ7 A;  2GWJ A;  1JL2 A;  5LJV A;  3SPZ A;  3ZSZ A;  4NYF A;  1XWL A;  4AM6 A;  4QAG A;  4DLG A;  4RG8 A;  3AA3 A;  5HRN A;  3C95 A;  5C24 A;  5AZJ A;  2P9I A;  3GE1 A;  4CJQ A;  3DYA A;  4IEE A;  1L3U A;  3AVI A;  3UE5 A;  4LFA K;  1JL1 A;  3LPU A;  4ILG B;  5I3U A;  1IBL K;  1VQ9 N;  3O4W A;  2HVH A;  2HNZ A;  1TVR A;  3B6P A;  2EHG A;  3UIQ A;  4KRF A;  4IEI A;  4DTP A;  5AJ3 K;  1HJR A;  1FKO A;  3IG1 A;  5FPN A;  2W6K A;  3AA4 A;  5C12 A;  2F8T A;  3EZ5 A;  3E1Y A;  3T7Z A;  3U8X A;  5BRF A;  1RTJ A;  1TKZ A;  3NVK A;  1VQL N;  3CQX A;  3HT3 A;  4Z4F A;  5AQV A;  2GUP A;  1RT4 A;  3D2F A;  1NU0 A;  2OCE A;  4A62 A;  1K6Y A;  5EXW A;  2OPR A;  4H5V A;  3P83 D;  1KD1 O;  4FXD A;  4FLY A;  3L2V A;  4FK0 A;  2XO7 A;  2P9L A;  1TKT A;  4FJN A;  4DB3 A;  4FWP A;  3HRG A;  4PA1 A;  1XI1 A;  4KBO A;  3KK2 A;  3G71 N;  2FC0 A;  3NHG A;  3KD5 E;  2QWQ A;  2I7N A;  4I2Q A;  2E2N A;  1LW0 A;  4ICL A;  3RTV A;  4BWM A;  4CCH A;  1RT6 A;  5KTQ A;  1D9D A;  1I94 K;  1N36 K;  1M1K O;  4NCB A;  3L4I A;  5J2M A;  2YNG A;  1I3A A;  4GVM A;  1S1T A;  3KD1 E;  1W9H A;  1IO2 A;  3OYF A;  1CZA N;  2YCH A;  1OH7 A;  3T1A A;  4A2A A;  1BHL A;  4E1J A;  4BRP A;  4YDU C;  4Q5V A;  3TSQ A;  1NWK A;  2FBY A;  5EU7 A;  1WUA A;  2A6A A;  5GAG P;  1S1W A;  1X3N A;  1N6Q A;  1DTQ A;  2P9S A;  4E7J A;  2ZM6 K;  3L2R A;  2Y1I A;  4F3T A;  5TKW A;  3CFR A;  1M90 O;  2WTU A;  5T7B A;  4B3O A;  1VAZ A; 
#chains in the Genus database with same CATH homology
 2UUC K;  5IT9 O;  2UUA K;  4JI8 K;  4JI5 K;  3J7A P;  1XMO K;  4X62 K;  4LFC K;  3OTO K;  4B3S K;  4JI3 K;  2F4V K;  4X64 K;  1HNW K;  4LFA K;  4LF4 K;  4JI1 K;  4NXN K;  4DR2 K;  4B3M K;  1IBL K;  4DR3 K;  5A2Q O;  4B3T K;  4NXM K;  4DR4 K;  4K0K K;  5AJ3 K;  4DV2 K;  4AQY K;  4YHH K;  1N34 K;  4LF8 K;  2UXB K;  1FJG K;  4JI7 K;  4CVN E;  2UUB K;  4CW7 B;  4JI4 K;  2E5L K;  1N33 K;  1IBK K;  1HR0 K;  3J7Y P;  5LMN K;  1IBM K;  5LMU K;  2UXC K;  4DR7 K;  4X65 K;  4KHP K;  2VQE K;  4DV0 K;  4DR6 K;  4LF9 K;  4DR5 K;  2UU9 K;  4JI0 K;  4DUZ K;  4GKK K;  3T1Y K;  4OX9 K;  5LL6 Z;  4DR1 K;  4JYA K;  2UXD K;  5IWA K;  3T1H K;  3J81 O;  4DV3 K;  4GKJ K;  1HNZ K;  1XMQ K;  3JAM O;  5FLX O;  1HNX K;  1XNQ K;  4DV4 K;  1I94 K;  1N36 K;  2HHH K;  4DV5 K;  1J5E K;  4X66 K;  1XNR K;  4JI2 K;  3J80 O;  4JI6 K;  4DUY K;  1N32 K;  4LF6 K;  4JV5 K;  4DV6 K;  4LFB K;  4DV1 K;  5BR8 K;  4DV7 K;  4LF5 K;  4V19 S;  2ZM6 K;  4LF7 K;  4B3R K;  4YY3 K;  2VQF K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...