1N36K

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 24
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1n36K00
1N36K 2E5LK 4LFAK 4OX9K 4CW7B 5BR8K 4DV2K 4JI0K 5FLXO 1HNXK 4DR2K 1J5EK 4DV4K 4LFBK 2HHHK 4DV7K 4X62K 2UXCK 1HNZK 1IBMK 4AQYK 4JI8K 4X65K 4LF9K 4DR1K 4CVNE 4LF8K 2UU9K 3JAMO 3J81O 3OTOK 4JI7K 1N32K 1N34K 1XNRK 3T1YK 4JI3K 4YY3K 4DV6K 3T1HK 3J7AP 5IWAK 4DV5K 4DR6K 4DR7K 2UXDK 1HR0K 4NXNK 1IBKK 2F4VK 4B3TK 4DV3K 4B3MK 4YHHK 4DUYK 1XMQK 2VQEK 4X64K 5A2QO 4KHPK 4DUZK 4DR4K 3J80O 4DR5K 4GKKK 1XMOK 2UUBK 2UUAK 1XNQK 5LMUK 2UXBK 1I94K 4V19S 2UUCK 3J7YP 4JI5K 5LMNK 4JV5K 4LFCK 4JI4K 4X66K 4JI6K 1IBLK 4JI2K 4B3SK 4LF4K 4LF6K 4DV0K 1N33K 4DR3K 4B3RK 4JYAK 5AJ3K 2VQFK 4K0KK 4GKJK 1HNWK 5IT9O 4JI1K 5LL6Z 4NXMK 4DV1K 2ZM6K 4LF7K 4LF5K 1FJGK
chains in the Genus database with same CATH superfamily
1N36K 3K5OA 2YKMA 4BC5A 3KKSA 1HPMA 3C95A 1N5YA 3FZLA 4LFBK 2WC9A 3PIOL 4DSLA 2JGUA 4N5SA 5BR9A 1NMNA 5CYQA 4AHTA 4GY2B 4JI8K 1HRHA 1OVQA 3OBYA 2OCEA 4E1MA 4DR1K 2D0CA 1EKEA 2JWLA 3TWHA 1Q7YO 4FJMA 3OHRA 3NGIA 1Q18A 4FCYA 3TAEA 1YF5L 4F2SA 4KHQA 2QEXN 4J2EA 2Z1HA 1JLFA 1KFSA 1N8RO 1C0GA 3NH1A 4DV6K 2LSNA 1FK9A 4CZHA 4CJEA 1Y64A 1Q9YA 5LJVA 3G6EN 4YOVA 1NGCA 5GIOA 1VQMN 4CEDA 3CCLN 1EP4A 3MXJA 4Y1CA 4CJ3A 1HMVA 4YHHK 2OPPA 1QQNA 2YNGA 1NK6A 4B1UB 1XMOK 4OPJA 3ZSVA 1NGIA 3LPTA 5JMVA 2NRXA 3CQYA 2Q36A 3AA3A 3O5BA 2PZSA 4H4MA 5BPMA 2W40A 1HQEA 3AVGA 4CF2A 4HVJA 4FJGA 3FZKA 4IOAL 4JV5K 4DFMA 1S6QA 1O1WA 4BC2A 3WT0A 1VQ4N 3A5NC 1B92A 3O3FA 1VQNN 1S1WA 2D4WA 1BI4A 5BRHA 1HPZA 3ZSYA 4E7IA 5KI6A 4CGJA 3NDKA 3LPUA 4CHOA 1LOTB 2CGKA 4F9OA 3DXKB 3R3LA 4CZLA 1UWBA 2NNWA 3AO4A 3DRRA 1A5VA 4YORA 3VQ9A 1RT6A 3CC7N 4DHYA 4CK3A 3LWLA 4EAHD 1M90O 3M8SA 4IOCL 1BDGA 1M1KO 4KREA 4G9ZA 3THWB 4M3TA 1NWKA 4M3RA 3WEEB 4H03B 4PQUA 3V6DA 3UB5A 3SUQA 3D7EO 4DU1A 2Q1NA 4DQ8A 3ZEUB 3LDNA 5KRSA 3JXUA 3SMSA 1Y97A 1ZXOA 1CXQA 1EWRA 5AQPA 4H0TB 4KH5A 3QNOA 4E7LA 3D2EB 1LAVA 3K58A 3QESA 3L8BA 3H08A 4EHUA 2A5XA 1TUYA 4FJLA 3U9DA 2P9KA 3DAWA 1EQYA 1SV5A 3IG1A 4A5AA 4CF9A 4CZFA 5C25A 1T3VA 3B6PA 4CBUA 1GLDG 3ZSZA 1VRTA 4KB1A 2D1KA 2VG5A 3RMDA 4YY3K 4M3WA 3HK2A 3SQ1A 3ZEUA 4O4GA 3WNEA 5LJWA 3LDPA 2D0AA 1J53A 2G8WA 3L2WA 4W5OA 4KTWA 4B3TK 4BRKA 5HRPA 2KZZA 3QEXA 5GAGP 3ZT0A 5DM7L 1QS4A 2AP1A 3HPHA 4JRPA 1SUQA 3AO5A 1KRPA 3VGMA 2F9WA 4CECA 2NUBA 1SQKA 4CJWA 1YJ9N 4JKEA 2HNZA 3GE1A 3PUFA 3K5MA 3ATVA 2YHBA 2P9LB 4C8MA 3HVRA 2OPRA 4EZ9A 3HJFA 3O1BA 1W7AA 3SPZA 4JI6K 4PKIA 3C7NB 1UOCA 3L6QA 3CG7A 2QXFA 1VQ6N 4B9MA 4ILHA 5EX5A 2KLAA 2FBTA 3HM8A 3OA9A 3NE6A 4DR3K 2HMPA 4JD2A 4H0YB 3AVMA 3Q7CA 5KQDA 1ZBIA 2P9NB 5KGWA 3TTFA 1S3XA 3LL3A 4NLBA 3KIOA 5M1KA 1S22A 4OX9K 4LFAK 4DV2K 4BRPA 5AQSA 1NGAA 3UKRA 3NH2A 1R0AA 4MDBA 1TV6A 3VEZA 3CMAN 4M42A 1U45A 3FZHA 3VA0A 3FE1A 5AZIA 3JS6A 1RBSA 2DFFA 3L2RA 2H3GX 5C2FA 2R7YA 4RW7A 4L3QA 3HM9A 2YNFA 2D5RA 3TARA 2UU9K 3KLEA 3MN7A 4LH4A 2W6KA 5ADXA 1ITGA 2OTLN 3AVLA 4OLAA 4FW1A 4FOEA 4F2RA 2HNYA 4RW4A 3QERA 4IZ9A 4G1QA 3AA2A 4Z4FA 3NMUA 2HVIA 4DR6K 2ZF5O 4CZJA 1XC3A 2E4LA 4MLHA 5D3GA 2HBMA 4BRMA 4DTPA 1JJ2M 1RDUA 2QWRA 3O6WA 3U3YA 1T03A 3SCXA 2RF2A 1DTTA 3ISNC 1SAZA 2E6MA 3EEQA 3NH0A 4HTUA 3CC2N 2E8AA 3SV3A 4MLEA 5EU7A 3CFPA 2O4GA 4K8ZA 5H1SQ 1TKXA 3NGYA 1RBRA 3CCQN 3AY9A 4ELVA 5AZJA 1LAWA 1NJYA 1ZBSA 4IG3A 3MEGA 4BROA 3ENOA 1HKGA 4NLCA 4KH4A 2P9UA 3IFRA 3QB0A 2A1RA 2OTJN 3VQ6A 3CJ9A 3EKSA 5J2MA 2W42A 2O8EA 5EXWA 3OYFA 2HMIA 4IJNA 3KWGA 5AZJB 3ZCMA 2GELA 4H4OA 3SUPA 5HROA 1YI2N 4O55A 4K0KK 2IOCA 5AQTA 4H0OA 4ZTJA 1YJWN 3C0BA 4DSJA 4AF1A 4DQSA 1FKPA 3O3HA 2A41A 2E2QA 3VQ8A 1TKZA 2E5LK 1S1VA 4DQPA 3SJJA 2P5GA 4Z4CA 2HHTA 4FM0A 1IH7A 4HTLA 4IO8A 1JCFA 4CFBA 1E4FT 1HNXK 2ETJA 4EZ6A 2JLEA 4FM1A 1NMDA 4ISFA 3WNFA 1QQCA 3RR8A 3O80A 4H0VB 3FZMA 1WNSA 3U4LA 2ZJPL 4Y0WA 4GW6A 4DSFA 2F8SA 2RKIA 1LW0A 1XNRK 1YIJN 3V1QA 4B08A 1W9HA 3VGKA 2DPNA 1NJIO 1KD1O 3T69A 2P9PB 1WB9A 5GIPA 1TK0A 2OZMA 3BZKA 3HSTB 3S41A 3FFKB 4O0JA 1BG3A 2E2PA 3CCMN 1D9DA 4WCEL 1X3NA 3I55N 5DK5A 3DWLA 2I7PA 2X74A 5HRRA 5FRMA 4DS4A 3IDHA 1BQNA 3BUZB 3FFIA 4CZMA 5C10A 2QWOA 3BP8A 4YOTA 1HYVA 4CZKA 5JS2A 3L0QA 4JRQA 5M1PA 1T8EA 1WUAA 1L3SA 5GAEP 3UKRB 5B8HA 4CERA 1GLBG 4CFCA 4ID5A 1G15A 1YUWA 3QICA 4MO5A 5AQYA 4DFKA 3AARA 2Q0UA 1RNHA 3OW2M 3EZ5A 2B5JA 1JLBA 4IFVA 3NF7A 2IVOA 5AQXA 3LP0A 2FC0A 5GINA 1QQMA 1L3TA 3PIPL 4O0IA 1D4XA 2GV9A 4DR2K 1EXQA 4F4KA 1JXBA 1HNZK 1Q9XA 4W5NA 4FJKA 1NGEA 4AQYK 4O8KA 1L3VA 4BWJA 2ITGA 1C1BA 3ZSWA 3DJCA 1T6CA 2KW4A 4YOXA 1QSLA 3KLIA 3OVNA 1KAYA 2PYJA 4KPYA 2QK9A 3CJBA 4MDAA 3KLGA 1BIUA 4JI7K 3K9JA 1JKHA 1NK7A 1WSHA 1YVUA 4CEAA 5HLFA 4N76A 1ZYQA 1LWFA 1W2BM 5J2PA 4FWMA 4BQLA 4ID1A 1IBKK 5FPMA 1U47A 2G8IA 3KWIA 5J2NA 4CEFA 4YOWA 4DFJA 3SQ0A 3OS0A 1L3UA 1D8YA 4AHSA 2F96A 4EP5A 4LSNA 2OA8A 1QZ6A 1WN7A 1JLEA 4GNIA 3TU5A 4J2DA 1WSJA 3RMAA 4B3OA 4XH5A 4DKWA 1RTJA 2VWKA 3O1WA 1DKGD 2HVHA 2V7ZA 3IRXA 3DRPA 4DS5A 5M1OA 4O5BA 4CZGA 3CHWA 1WSFA 4E7JA 1JLQA 4JS5A 1VQKN 1GLJO 3VQEA 4DTRA 1C0FA 4FK2A 1GOAA 2QWLA 4FVUA 4X66K 3BZCA 2RN2A 3THVA 3VTHA 3S3MA 4GV6A 3CQ8A 4LF4K 1Q86O 3AVAA 3T1AA 3O3GA 4CEQA 4GV9A 3SQ4A 3CYMA 4CIEA 1WAFA 2RHKA 3OS2A 4IJAA 4NCGA 3OYIA 1HNWK 3TTDA 5CR4A 1K8KA 3VQCA 2FBVA 4RTFD 4FLVA 4DU4A 4F3TA 2VGMA 4LY7A 4CJ4A 4O5FA 5FROA 3KD5E 1BCOA 4LF5K 4NYNA 4DMNA 1KAZA 2ZGYA 3MWTA 3B8AX 3O4QA 5JLHA 1Q82O 2PBDA 3SI6A 2FSNA 4YOYA 2HF4A 3PO4A 4OKKA 4KHYA 3CD6N 2BGGA 3UIQA 3ZX0A 2YI1A 3K57A 4KHNA 1YTAA 1G99A 4QAGA 2KFNA 4CK2A 1RTIA 4WQ4C 2ZD1A 2P9SA 4PA1A 1U2VA 3SJHA 3F5TA 1VSDA 1D9FA 4E3SA 4BVPA 1BI4B 1RFQA 2IIRA 3MWPA 1JL1A 3A8YA 3CIPA 3VEVA 4BRIA 4Y1DA 2HHXA 1Z26A 2X6NA 1HNIA 3BDPA 1ATNA 4CK1A 4Z4EA 3O9TA 4DR4K 5C24A 3V1OA 5AQZA 1S1UA 3OS1A 2UUAK 4C23A 3HXMA 3ULEB 4NCAA 2PFUA 3BEXA 2OZSA 5LMUK 1GOBA 3QETA 3VGLA 3M3ZA 4V19S 1QHAA 1GLCG 5CZ2A 1IKXA 4FVMA 1C0TA 1X1PA 2IVNA 5E26A 3UKUA 2HSTA 4CD3A 1BGXT 3GL1A 2KHOA 4ILGB 4LF6K 3A5LC 1VSFA 4DU3A 4CI6A 5C42A 2O4IA 1UA0A 3HOSA 4K43A 4B1XB 2P9IB 2B6AA 2Z1GA 1EO1A 3KHYA 4KO0A 2E1YA 3RSEA 2ZM6K 3C7NA 1EWQA 4AILC 4LF7K 1ILYA 3VEOA 1BO5O 3ZSQA 4ISGA 4C8LA 3I0SA 3PY8A 3P5JA 4DTNA 1HUXA 4YFUA 4BE2A 1XQSC 4KKOA 4I6MA 3OYMA 3WEEA 4DTMA 2P9NA 4B9TA 3SUNA 2WBNA 1J5OA 2XO7A 2V51B 1NGGA 4FJIA 2QWQA 2E2NA 4BRNA 3TAGA 5F1XA 4LF9K 2FF3B 4CVNE 1FW6A 2YHXA 4W5RA 2HOEA 3D2EA 3J81O 1REVA 2V52B 3Q7BA 3QNNA 1K6YA 3AVNA 3OTOK 1S72N 1BA1A 2EX3A 4I6MB 1IKWA 3SZ2A 3PX6A 4M3UA 4DLEA 3EZWA 3TPQA 3MECA 4CJPA 2UXDK 2IAJA 1XUPO 4CBWA 3TAQA 1NOYA 4CHZA 4DTOA 4BGAA 1SKWA 1U6ZA 3E9PA 4FWRA 4EHTA 4HWIA 4DUYK 4JKCA 4ELUA 4W5QA 3CFRA 5A2QO 1E4GT 1VQ5N 3LZIA 3CMEN 3VN5A 2YCHA 4OPAA 4EFHA 4KTQA 1XNQK 4CHQA 2GUIA 1RT7A 2IC3A 2FSKA 3O08A 1ASVA 1VSLA 1N6QA 3ALYA 4A57A 4ICLA 1QQOA 1VQPN 3J7YP 4IO9L 4JI4K 4RWTA 1H1VA 3D6RA 1DEJA 3AVCA 1D5AA 4JN4A 1YHQN 3VQQA 1VQ8N 4FJ7A 4C1NK 5I3UA 4QS8A 2G8KA 1QHTA 1X3MA 4JYAK 1OVYA 4F8RA 3L3UA 1JLCA 4JHDA 2GWKA 4FWQA 3HL8A 3B6OA 2ATQA 1GLEG 3AA4A 3WNGA 4DG1A 4FSVA 5GAHP 3OYNA 4DQQA 3TAPA 1BQMA 3AGKA 3RRGA 3CJCA 1FJGK 4B1WB 3VEWA 4OGCA 2XHBA 4H8KA 4JKDA 3TTCA 2NRZA 1C1CA 3AVKA 2O8DA 2NRVA 2P9SB 5ELZA 2BTFA 4EIAA 3ASMA 3CJAA 4I9QA 3SAGA 1VSJA 1UAXA 4JHDB 4CF1A 2YHWA 4PL8A 3K5NA 2D0OA 5SWMA 4HUGA 4M41A 1KVBA 3GBTA 5HP1A 1LCUA 3K9KA 4BACA 1RCHA 2GBZA 2KZMA 1DGKN 3ENHA 1C1AA 1NKBA 2G8VA 1XC9A 2O8EB 4CJLA 4C8OA 1YVNA 4CJUA 3VESA 4R5PA 1S5JA 3RTVA 3P39A 4BRAA 3EE9A 3DLEA 1T44A 3U9ZA 3CM6A 1BWFO 2G8FA 1NK8A 5BRDA 4CFAA 2YJEA 2FLOA 3AVIA 3VETA 3ZX2A 3TAFA 4WF9L 4JKFA 3OYAA 5J2QA 4DUZK 2HHQA 3O9UA 3L2VA 1KTQA 1Q8IA 4DSEA 3JYTA 1CZBA 3K0SA 4PY5A 1BOTO 4CGIA 3E1YA 2I5JA 3OBWA 1SL1A 4I2QA 5CY4A 4EP4A 3OYHA 2ITMA 3OYGA 3CM5A 4B1VA 5FPDA 4Z0UA 4JI5K 3HPGA 3W3DA 1GLAG 2NRWA 1CLQA 3O4NA 3K2PA 4DB3A 3N4PA 3IMXA 1NJZA 2CGLA 3TANA 1SKRA 2O8CA 1U48A 3KK2A 4KTZA 3LP3A 1WBDA 2QWMA 3ZYYX 3HO1A 4PWDA 4JI1K 5AQGA 2ZQBA 1NJWA 4FPAA 1RBTA 3E01A 2VYPA 3FZFA 4Q0BA 1S9EA 4U7BA 4FM2A 2W41A 1TAUA 4AHRA 1WSEA 3VPZA 2G8HA 4CF0A 4BRCA 1Z05A 3ULDA 3LANA 4XH1A 4BRQA 3THWA 2O8CB 4FOIA 5KRTA 4BVOA 5BN9A 2UXCK 5JICA 5TKWA 4AHVA 3QO9A 3U8XA 4B9NA 3DLLL 3OYLA 3VEYA 4BDZA 3VF2A 1XHXA 1E3MA 3SBGA 4BR5A 1RT3A 1NM1A 1LWEA 2ASPA 3CI5A 3P83D 3K59A 3AO2A 2BH1A 1C0UA 3FGUA 4FLUA 4B9LA 1QSSA 1A5XA 3AVHA 3TAMA 5GADP 1P8ZA 4B8CA 3VTIA 3T1HK 1IG8A 1TAQA 4M7XA 2F4VK 3LDOA 4CEOA 1FXXA 3AO1A 3F9MA 2Z1JA 1NGBA 3OYEA 1OH7A 3C6HA 5C2DA 2QTDA 3DI6A 4CJVA 4E89A 1K9MO 4H5NA 1SZ2A 3RVCA 3PX4A 1J9AA 4H0XB 1CZAN 1NK4A 5AQHA 4CCHA 4FJXA 4FXDA 1JCEA 1TYQA 1ZBUA 1OH8A 4U67L 2FF6A 3THXB 3MDQA 4JS4A 3HI0A 5FPEA 4HCCA 3EO3A 2PY5A 4BR9A 3H45C 2VG7A 5M1FA 4AM7A 5JLFA 5FPNA 3SAFA 3RWUA 3SNNA 3R1XA 4BWMA 1R59O 2O8DB 3U6FA 5HBMA 4KH6A 1QVFM 4FYDA 4PHTX 1N33K 2FXUA 3QEVA 2YKNA 1YAGA 4MO4A 1TKDA 3VERA 4GV3A 3PO5A 3G4SN 4GKJK 3ENBA 4BC3A 4OKEA 3IS9A 3KVGA 4NXMK 1IV0A 3QFPA 1ASWA 4JAXA 4FJJA 3KK7A 3DLGA 1RILA 1U49A 5AQKA 3SMPA 3M1FA 3TR8A 5BR8K 3O9SA 4BDYA 5CE3A 1ZBFA 4LD0A 5FLXO 1NKEA 4DV4K 1VSKA 1X9MA 4CESA 3TI0A 5HRNA 2A42A 2OANA 3DMJA 4FO0A 5EOYA 3EN9A 1K8KB 1NGJA 2XY6A 4RCHA 5CYMA 3SV4A 1RTHA 3D0PA 4A5BA 4BG8A 3MEEA 1W0HA 3MCAB 3P4IA 4KB0A 4AHCA 4IDKA 1BUPA 2IDOA 3JAMO 4BE1A 3IKMA 1LW2A 4IG0A 4FWNA 3ZX3A 2HBLA 1IJJA 3DLRA 2YNHA 3NFAA 3O4WA 4DFPA 1BCMA 3KKRA 5C0YA 5TKYA 3CPWM 4FLXA 3T3FA 1HKCA 4JLHA 3NCIA 4QOZB 5EY4A 3VEXA 2Y1IA 4WQ4A 4HUEA 4IBNA 1WOQA 4IFEA 4CGFA 4RW8A 4CZIA 1S6PA 3KK1A 5FDLA 1MA9B 3D45A 1NK9A 3AV9A 3LDLA 3V9UA 4A62A 3G10A 4FL9A 4N47A 1HJOA 1KXPA 4IWVA 5KPRA 1VQLN 3AVFA 1C6VA 2ZE2A 3J8AA 1RBVA 5E84A 3ZETA 4CD1A 2P9UB 3DLKA 3MX5A 2NRHA 3DXMB 1Z6RA 2Q0RA 4B3SK 1QTMA 3P1GA 3V9SA 2CH5A 2NRRA 1T6DA 1U2VB 3DOLA 2KKZA 4BR4A 3M5RA 3ULEA 1YJNN 2E6LA 2AJQA 1SKSA 1S1XA 1MWKA 1W97L 1MWMA 5F2RA 3TSUA 3ZETB 4FK4A 3V4IA 4M3YA 2HBKA 1HYZA 1VQON 3BF1A 3K5LA 4HHTA 1QVGM 4AHUA 4B9VA 3VQ4A 2UYTA 4C8NA 4AH9A 3ZSXA 4JI0K 1S9GA 3W0LA 4FWPA 5M1QA 3VQPA 1NG9A 5JVHL 4IKFA 2P9IA 3GOIA 4E7HA 2QI2A 5JS1A 2O8BA 2RE2A 1U4BA 4OGEA 1RDCA 1JLAA 4CJTA 4N56A 1V4TA 1TK8A 2D0PA 3HPOA 4H5TA 5BPLA 4BG9A 3NF8A 3HTVA 3NGZA 4J2AA 2CGJA 2XY7A 4FWLA 5AFUA 5AQIA 3ID8A 1N32K 3WXLA 3KJVA 1WSGA 4DTSA 3VMFB 3QMLA 1TYQB 4CHPA 3A0IX 1HKBA 3THXA 3THYB 3NF9A 3I8BA 3SK3A 5KQ8A 5F0XA 3CC4N 2BANA 2BDPA 3DM2A 2KFZA 4K25A 3OYJA 4DV3K 3ZT1A 4BC4A 1B9FA 1BHLA 3GG4A 5KTQA 3LDSA 4KHPK 4YNQA 4NB4A 3NF6A 4H0PA 3H3NO 1ESVA 3RR7A 3E66A 3LM2A 4FJ8A 1BIZA 3C6UA 1O13A 2OPSA 2P9LA 4AM6A 1NK0A 2HB5A 1NGDA 5AZIB 1UA1A 2UUCK 4FZYA 5CZ1A 4DTXA 3LAMA 1RT4A 3M8RA 4CJRA 3ZT2A 3HP9A 4FLTA 2ZGZA 4YOUA 3CFOA 4FJHA 5LY3A 3UKUB 5C12A 3S3OA 1K8AO 4ELTA 4HCBA 2FBYA 3O9RA 2WTUA 5ADXH 3M6GA 3A2FA 5AFUH 4H5RA 4LC9B 3OJSA 1HX1A 3CXCM 3AAQA 2Q3SA 4BRDA 3OY9A 3QIPA 4WQ5C 3KZBA 4KHWA 4NYFA 4DCHA 1NU0A 3CJ1A 1XWLA 4XH4A 4K8XA 2XRIA 2EHGA 2NRTA 5C15A 4E0DA 1SL0A 2WONA 2QM1A 3E9LA 5BRFA 3CCRN 2HNDA 4L8RB 3VQ7A 4DV7K 4X62K 2XY5A 3UE5A 3WXKA 1IBMK 3VQBA 4FJ9A 1SS6A 1WLJA 4TSXA 2VWBA 2G8UA 1Q81O 5AQLA 5M1NA 3R9PA 1WBBA 3VENA 2QXLA 4FLZA 3HSCA 3OYCA 1JLGA 3VF6A 4FLYA 1VQ7N 2YNIA 1HR0K 5BREA 4ZHRA 4M45A 3S9HA 4E1JA 2F7TA 4ILJA 2JWKA 2P51A 4B8AB 1KQSM 4B3MK 3AVJA 1XMQK 2VQEK 1IG9A 5T7BA 1VHXA 5JVGL 1TUUA 4BR0A 4N41A 1TKTA 1OKJA 3H46O 2IVPA 2P5OA 4DR5K 2VCPA 3LALA 4IDHA 3HP6A 4R79A 3WQUA 5AQUA 4DSIA 1F21A 1GLLO 4FZZA 5FRNA 1VAZA 3QFUA 2AA4A 4DLGA 3D2FB 1WAJA 3AA5X 1IBLK 4BRHA 3QLHA 2J4RA 3ZSRA 3L4QA 3EE8A 3OYBA 4DV0K 4ISEA 4B3RK 4FZXC 1B9DA 4FJ5A 3ITHA 4HUFA 1ZBHA 5IT9O 3HBTA 1VK0A 1KC8O 2P9PA 1CZ9A 4FWOA 4BY9C 3C6AA 3VOVA 2VG6A 3A5MC 4DTJA 3DOKA 4CW7B 3KD1E 4B1YB 3PX0A 4F3OA 4DF8A 3SPYA 3BY5A 1RDBA 1U04A 2PYLA 1NNEA 1TL1A 3PLAA 1HLUA 4OPHA 1IO2A 4RG8A 3SYZA 5SZTA 3WNHA 3RRHA 3QEWA 4JKGA 3G25A 5AQRA 1RDAA 3VF4A 4PUOA 4CEBA 3KLFA 4OLBA 3LM9A 4M7YA 1N34K 2O8BB 2RPIA 2GX9A 1KLNA 2QKBA 4CIGA 2WUSA 2QA4N 3V9WA 3WXIA 1I39A 4W5TA 4O44A 4DV5K 4GVMA 4BR7A 3T19A 4PL7A 3AGRA 5AQFA 5AR0A 5HOOA 3VQAA 4FWKA 3SQ2A 4IXCA 2FSJA 4WFNL 4BR2A 4NO7A 4IEEA 4BQZA 3S3NA 3LAKA 3R8EA 5KGXA 2HW3A 4X64K 3CCVN 1YXQA 3CCSN 2ASOA 3RMCA 3KTQA 4M63C 3MN5A 4YDUA 2WFBA 2Q97A 3I0RA 3LP2A 4XEIA 3NBPA 3NVKA 3NVMA 3CJ7A 4Z4IA 4J8FA 4KRFA 3M8QA 4QCLA 3LWMA 2E1ZA 1EETA 1VSHA 4CGHA 4CJKA 3VA3A 3MK6A 3O8MA 2P9KB 4XIUA 5I42A 3JSMA 4OO1J 4BRGA 4I2PA 4CFDA 2P1JA 3KLHA 2DFHA 1RBUA 3SAHA 5DMRA 1YT3A 1X9WA 3CPEA 4FWSA 3WUHA 3RSEB 2YJFA 1OH6A 2VGNA 5AQMA 1NOZA 4OKJA 3MN6A 3R6MA 2HHSA 1X9JA 4IFYA 3G0ZA 4BRLA 3AO3A 5KPTA 3ZT4A 4K41A 1KSPA 2BUPA 4K42A 4JNEA 4JK8A 4CHYA 4MQ3A 4CJFA 1OH5A 3A5OC 1NLVA 2ASMA 1NBWA 2HF3A 5CHIA 4X65K 2HHUA 4KBOA 1NGHA 3TSPA 4LF8K 1CXUA 1NKCA 3WXMB 1S1TA 5AQVA 1RT2A 5HRSA 4J2BA 3V9XA 3DLBA 3MCPA 4B9UA 4B9QA 3ID6A 3ZT3A 3PSIA 4WYBA 1ASUA 2E2OA 3HVTA 5MLCQ 3J7AP 5IWAK 3CETA 4DR7K 2O8FA 2VWJA 4WFAL 2Q2RA 3J7ZO 1I3AA 3ZLJA 3C65A 4KI4A 4BRFA 4BDPA 3SBTA 3D2FA 2ZJQL 3OYKA 1C0MA 4DQRA 3P31A 2A1SA 2A3ZA 1TGOA 3IUCA 2QKKA 1Z25A 3I56N 1X9SA 2KQ2A 1T7PA 2YHAA 2D0BA 2HHWA 3L4IA 4I9LA 2DY4A 4OJRA 4M3XA 5I9EB 4B9SA 4JD2B 3MXMA 2FBXA 4YDUC 3OJUA 1NJXA 1HYSA 1VSIA 2ZJRL 1NK5A 3VQ5A 2F9TA 1IKYA 4DF4A 3O9QA 4JI2K 2HBJA 3E9OA 4CBXA 2CH6A 3MEDA 4C1NI 3AVBA 4E19A 2Y1JA 2V7YA 5AQJA 3NAEA 5AQWA 1GLFO 4CIFA 3DYAA 2VQFK 4A2BA 5DM6L 1DT9A 4FPBA 5LL6Z 1BU6O 4JEPA 3QBXA 1JCGA 4JKBA 2E88A 4LSLA 1YITN 2GUPA 2DFEA 1V4SA 3N4QA 3H1QA 4LH5A 2ZWHA 3CCEN 3I33A 4NCBA 3M8PA 1J5EK 3MAQA 3PSFA 1ZBLA 1K73O 4KI6A 3LDQA 3CCJN 2B4JA 4JK9A 1XI1A 4CGGA 3L2QA 2NZTA 3CQXA 2WOMA 4CF8A 5HL7L 2HHVA 5AQQA 1JXEA 5K14A 2GWJA 1GOCA 1QE1A 4FW2A 2OPQA 2OYQA 4WFBL 4UQGA 4JI3K 3I8DA 3IAYA 2PAVA 4H5VA 2YV0X 4JKHA 5KPZA 3F9KA 1JL2A 3L2UA 3NHGA 1EX4A 4FK0A 1FKOA 3V81A 4IOXA 2W6LA 4JKGB 4BE0A 1L5UA 4KHSA 5AQNA 1KAXA 3TABA 4CZEA 2GEMA 2YX6A 4MFBA 3ATUA 4RW9A 3J80O 1VSMA 1SL2A 1BL3A 3MXIA 2UUBK 1IKVA 3WXJA 3ZSOA 4DSKA 1ATSA 3U3GA 4OPKA 4Z94A 3THYA 1VRUA 3H6EA 4IEIA 1T05A 3DXKA 3QINA 5BPNA 2UXBK 4KAZA 1YTUA 2KTQA 5LMNK 4CJ5A 4LFCK 2DTUA 4KHUA 1NGFA 3BF3A 3TSQA 4GVEA 3DXMA 4DWIA 3H3OB 4QS9A 2X6SA 3QBWA 1TL3A 3QIOA 1QZ5A 4Z4HA 2YHYA 4H5WA 3HYFA 2GTDA 4KV8A 5AJ3K 4CJ7A 4BREA 1RT5A 3F73A 4UY8O 2IGIA 4DV1K 3V9ZA 1ZC6A 3EY1A 3F2KA 1LWCA 1A5WA 3VQDA 4CEZA 3G71N 2QWNA 1RDWX 3L3VA 3C6TA 3SUOA 1J6ZA 1HNVA 3BGRA 3MX2A 3MMVA 4PKGA 4ZTFA 2HHHK 2A40A 4CEEA 1RT1A 3V1RA 3HRGA 4BGBA 4WQ5A 2F8TA 1BA0A 1RTDA 2O8FB 3HT3A 3RMBA 1MU2A 3CCUN 4GMJB 4OVLA 3LP1A 4M3ZA 3WQTA 4DTUA 2EWSA 1KVCA 1DTQA 4A2AA 4CE9A 2Z1IA 3QEIA 1WSIA 4FLWA 3T1YK 4CJSA 2Q31A 3DLHA 4E7KA 4KFBA 1HQUA 2QWPA 3C94A 3FLCO 4NXNK 4Z4GA 3LZJA 1P90A 4DQIA 1XHZA 1BISA 3QDKA 2I7NA 4CJQA 4CHNA 3QEPA 1J54A 3HZ6A 2IS3A 5EVZA 2A6AA 1TVRA 4GKKK 3EYZA 5BN8A 3CF5L 2X78A 4RW6A 4QS7A 4FJNA 3HOTA 2XY8A 4A59A 3CERA 5AQOA 3OYDA 5E41A 3SLCA 1I94K 4PKHA 1RGIA 4C8KA 1TK5A 1QSYA 1KLMA 1MDUB 3MN9A 1HJRA 3KK3A 3EL2A 4JKAA 4O8UA 4E1NA 2NLXA 3P38A 4B1ZA 3FR0A 4I7FA 3EKUA 1RDDA 4A61A 1LV5A 2BE2A 5J1EA 1VQ9N 1VSEA 3AAPA 3GDQA 1ATRA 3PV8A 2E20A 3DRSA 1DLOA 1KVAA 4WE1A 4Q5VA 2QW9A 4CGDA 1KCFA 1KFDA 3T7ZA 4JK7A 3H1VX
chains in the Genus database with same CATH topology
1N36K 2E5LK 4LFAK 4OX9K 4CW7B 5BR8K 4DV2K 4JI0K 5FLXO 1HNXK 4DR2K 1J5EK 4DV4K 4LFBK 2HHHK 4DV7K 4X62K 2UXCK 1HNZK 1IBMK 4AQYK 4JI8K 4X65K 4LF9K 4DR1K 4CVNE 4LF8K 2UU9K 3JAMO 3J81O 3OTOK 4JI7K 1N32K 1N34K 1XNRK 3T1YK 4JI3K 4YY3K 4DV6K 3T1HK 3J7AP 5IWAK 4DV5K 4DR6K 4DR7K 2UXDK 1HR0K 4NXNK 1IBKK 2F4VK 4B3TK 4DV3K 4B3MK 4YHHK 4DUYK 1XMQK 2VQEK 4X64K 5A2QO 4KHPK 4DUZK 4DR4K 3J80O 4DR5K 4GKKK 1XMOK 2UUBK 2UUAK 1XNQK 5LMUK 2UXBK 1I94K 4V19S 2UUCK 3J7YP 4JI5K 5LMNK 4JV5K 4LFCK 4JI4K 4X66K 4JI6K 1IBLK 4JI2K 4B3SK 4LF4K 4LF6K 4DV0K 1N33K 4DR3K 4B3RK 4JYAK 5AJ3K 2VQFK 4K0KK 4GKJK 1HNWK 5IT9O 4JI1K 5LL6Z 4NXMK 4DV1K 2ZM6K 4LF7K 4LF5K 1FJGK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 K;  2E5L K;  4LFA K;  4OX9 K;  4CW7 B;  5BR8 K;  4DV2 K;  4JI0 K;  5FLX O;  1HNX K;  4DR2 K;  1J5E K;  4DV4 K;  4LFB K;  2HHH K;  4DV7 K;  4X62 K;  2UXC K;  1HNZ K;  1IBM K;  4AQY K;  4JI8 K;  4X65 K;  4LF9 K;  4DR1 K;  4CVN E;  4LF8 K;  2UU9 K;  3JAM O;  3J81 O;  3OTO K;  4JI7 K;  1N32 K;  1N34 K;  1XNR K;  3T1Y K;  4JI3 K;  4YY3 K;  4DV6 K;  3T1H K;  3J7A P;  5IWA K;  4DV5 K;  4DR6 K;  4DR7 K;  2UXD K;  1HR0 K;  4NXN K;  1IBK K;  2F4V K;  4B3T K;  4DV3 K;  4B3M K;  4YHH K;  4DUY K;  1XMQ K;  2VQE K;  4X64 K;  5A2Q O;  4KHP K;  4DUZ K;  4DR4 K;  3J80 O;  4DR5 K;  4GKK K;  1XMO K;  2UUB K;  2UUA K;  1XNQ K;  5LMU K;  2UXB K;  1I94 K;  4V19 S;  2UUC K;  3J7Y P;  4JI5 K;  5LMN K;  4JV5 K;  4LFC K;  4JI4 K;  4X66 K;  4JI6 K;  1IBL K;  4JI2 K;  4B3S K;  4LF4 K;  4LF6 K;  4DV0 K;  1N33 K;  4DR3 K;  4B3R K;  4JYA K;  5AJ3 K;  2VQF K;  4K0K K;  4GKJ K;  1HNW K;  5IT9 O;  4JI1 K;  5LL6 Z;  4NXM K;  4DV1 K;  2ZM6 K;  4LF7 K;  4LF5 K;  1FJG K; 
#chains in the Genus database with same CATH topology
 1N36 K;  3K5O A;  2YKM A;  4BC5 A;  3KKS A;  1HPM A;  3C95 A;  1N5Y A;  3FZL A;  4LFB K;  2WC9 A;  3PIO L;  4DSL A;  2JGU A;  4N5S A;  5BR9 A;  1NMN A;  5CYQ A;  4AHT A;  4GY2 B;  4JI8 K;  1HRH A;  1OVQ A;  3OBY A;  2OCE A;  4E1M A;  4DR1 K;  2D0C A;  1EKE A;  2JWL A;  3TWH A;  1Q7Y O;  4FJM A;  3OHR A;  3NGI A;  1Q18 A;  4FCY A;  3TAE A;  1YF5 L;  4F2S A;  4KHQ A;  2QEX N;  4J2E A;  2Z1H A;  1JLF A;  1KFS A;  1N8R O;  1C0G A;  3NH1 A;  4DV6 K;  2LSN A;  1FK9 A;  4CZH A;  4CJE A;  1Y64 A;  1Q9Y A;  5LJV A;  3G6E N;  4YOV A;  1NGC A;  5GIO A;  1VQM N;  4CED A;  3CCL N;  1EP4 A;  3MXJ A;  4Y1C A;  4CJ3 A;  1HMV A;  4YHH K;  2OPP A;  1QQN A;  2YNG A;  1NK6 A;  4B1U B;  1XMO K;  4OPJ A;  3ZSV A;  1NGI A;  3LPT A;  5JMV A;  2NRX A;  3CQY A;  2Q36 A;  3AA3 A;  3O5B A;  2PZS A;  4H4M A;  5BPM A;  2W40 A;  1HQE A;  3AVG A;  4CF2 A;  4HVJ A;  4FJG A;  3FZK A;  4IOA L;  4JV5 K;  4DFM A;  1S6Q A;  1O1W A;  4BC2 A;  3WT0 A;  1VQ4 N;  3A5N C;  1B92 A;  3O3F A;  1VQN N;  1S1W A;  2D4W A;  1BI4 A;  5BRH A;  1HPZ A;  3ZSY A;  4E7I A;  5KI6 A;  4CGJ A;  3NDK A;  3LPU A;  4CHO A;  1LOT B;  2CGK A;  4F9O A;  3DXK B;  3R3L A;  4CZL A;  1UWB A;  2NNW A;  3AO4 A;  3DRR A;  1A5V A;  4YOR A;  3VQ9 A;  1RT6 A;  3CC7 N;  4DHY A;  4CK3 A;  3LWL A;  4EAH D;  1M90 O;  3M8S A;  4IOC L;  1BDG A;  1M1K O;  4KRE A;  4G9Z A;  3THW B;  4M3T A;  1NWK A;  4M3R A;  3WEE B;  4H03 B;  4PQU A;  3V6D A;  3UB5 A;  3SUQ A;  3D7E O;  4DU1 A;  2Q1N A;  4DQ8 A;  3ZEU B;  3LDN A;  5KRS A;  3JXU A;  3SMS A;  1Y97 A;  1ZXO A;  1CXQ A;  1EWR A;  5AQP A;  4H0T B;  4KH5 A;  3QNO A;  4E7L A;  3D2E B;  1LAV A;  3K58 A;  3QES A;  3L8B A;  3H08 A;  4EHU A;  2A5X A;  1TUY A;  4FJL A;  3U9D A;  2P9K A;  3DAW A;  1EQY A;  1SV5 A;  3IG1 A;  4A5A A;  4CF9 A;  4CZF A;  5C25 A;  1T3V A;  3B6P A;  4CBU A;  1GLD G;  3ZSZ A;  1VRT A;  4KB1 A;  2D1K A;  2VG5 A;  3RMD A;  4YY3 K;  4M3W A;  3HK2 A;  3SQ1 A;  3ZEU A;  4O4G A;  3WNE A;  5LJW A;  3LDP A;  2D0A A;  1J53 A;  2G8W A;  3L2W A;  4W5O A;  4KTW A;  4B3T K;  4BRK A;  5HRP A;  2KZZ A;  3QEX A;  5GAG P;  3ZT0 A;  5DM7 L;  1QS4 A;  2AP1 A;  3HPH A;  4JRP A;  1SUQ A;  3AO5 A;  1KRP A;  3VGM A;  2F9W A;  4CEC A;  2NUB A;  1SQK A;  4CJW A;  1YJ9 N;  4JKE A;  2HNZ A;  3GE1 A;  3PUF A;  3K5M A;  3ATV A;  2YHB A;  2P9L B;  4C8M A;  3HVR A;  2OPR A;  4EZ9 A;  3HJF A;  3O1B A;  1W7A A;  3SPZ A;  4JI6 K;  4PKI A;  3C7N B;  1UOC A;  3L6Q A;  3CG7 A;  2QXF A;  1VQ6 N;  4B9M A;  4ILH A;  5EX5 A;  2KLA A;  2FBT A;  3HM8 A;  3OA9 A;  3NE6 A;  4DR3 K;  2HMP A;  4JD2 A;  4H0Y B;  3AVM A;  3Q7C A;  5KQD A;  1ZBI A;  2P9N B;  5KGW A;  3TTF A;  1S3X A;  3LL3 A;  4NLB A;  3KIO A;  5M1K A;  1S22 A;  4OX9 K;  4LFA K;  4DV2 K;  4BRP A;  5AQS A;  1NGA A;  3UKR A;  3NH2 A;  1R0A A;  4MDB A;  1TV6 A;  3VEZ A;  3CMA N;  4M42 A;  1U45 A;  3FZH A;  3VA0 A;  3FE1 A;  5AZI A;  3JS6 A;  1RBS A;  2DFF A;  3L2R A;  2H3G X;  5C2F A;  2R7Y A;  4RW7 A;  4L3Q A;  3HM9 A;  2YNF A;  2D5R A;  3TAR A;  2UU9 K;  3KLE A;  3MN7 A;  4LH4 A;  2W6K A;  5ADX A;  1ITG A;  2OTL N;  3AVL A;  4OLA A;  4FW1 A;  4FOE A;  4F2R A;  2HNY A;  4RW4 A;  3QER A;  4IZ9 A;  4G1Q A;  3AA2 A;  4Z4F A;  3NMU A;  2HVI A;  4DR6 K;  2ZF5 O;  4CZJ A;  1XC3 A;  2E4L A;  4MLH A;  5D3G A;  2HBM A;  4BRM A;  4DTP A;  1JJ2 M;  1RDU A;  2QWR A;  3O6W A;  3U3Y A;  1T03 A;  3SCX A;  2RF2 A;  1DTT A;  3ISN C;  1SAZ A;  2E6M A;  3EEQ A;  3NH0 A;  4HTU A;  3CC2 N;  2E8A A;  3SV3 A;  4MLE A;  5EU7 A;  3CFP A;  2O4G A;  4K8Z A;  5H1S Q;  1TKX A;  3NGY A;  1RBR A;  3CCQ N;  3AY9 A;  4ELV A;  5AZJ A;  1LAW A;  1NJY A;  1ZBS A;  4IG3 A;  3MEG A;  4BRO A;  3ENO A;  1HKG A;  4NLC A;  4KH4 A;  2P9U A;  3IFR A;  3QB0 A;  2A1R A;  2OTJ N;  3VQ6 A;  3CJ9 A;  3EKS A;  5J2M A;  2W42 A;  2O8E A;  5EXW A;  3OYF A;  2HMI A;  4IJN A;  3KWG A;  5AZJ B;  3ZCM A;  2GEL A;  4H4O A;  3SUP A;  5HRO A;  1YI2 N;  4O55 A;  4K0K K;  2IOC A;  5AQT A;  4H0O A;  4ZTJ A;  1YJW N;  3C0B A;  4DSJ A;  4AF1 A;  4DQS A;  1FKP A;  3O3H A;  2A41 A;  2E2Q A;  3VQ8 A;  1TKZ A;  2E5L K;  1S1V A;  4DQP A;  3SJJ A;  2P5G A;  4Z4C A;  2HHT A;  4FM0 A;  1IH7 A;  4HTL A;  4IO8 A;  1JCF A;  4CFB A;  1E4F T;  1HNX K;  2ETJ A;  4EZ6 A;  2JLE A;  4FM1 A;  1NMD A;  4ISF A;  3WNF A;  1QQC A;  3RR8 A;  3O80 A;  4H0V B;  3FZM A;  1WNS A;  3U4L A;  2ZJP L;  4Y0W A;  4GW6 A;  4DSF A;  2F8S A;  2RKI A;  1LW0 A;  1XNR K;  1YIJ N;  3V1Q A;  4B08 A;  1W9H A;  3VGK A;  2DPN A;  1NJI O;  1KD1 O;  3T69 A;  2P9P B;  1WB9 A;  5GIP A;  1TK0 A;  2OZM A;  3BZK A;  3HST B;  3S41 A;  3FFK B;  4O0J A;  1BG3 A;  2E2P A;  3CCM N;  1D9D A;  4WCE L;  1X3N A;  3I55 N;  5DK5 A;  3DWL A;  2I7P A;  2X74 A;  5HRR A;  5FRM A;  4DS4 A;  3IDH A;  1BQN A;  3BUZ B;  3FFI A;  4CZM A;  5C10 A;  2QWO A;  3BP8 A;  4YOT A;  1HYV A;  4CZK A;  5JS2 A;  3L0Q A;  4JRQ A;  5M1P A;  1T8E A;  1WUA A;  1L3S A;  5GAE P;  3UKR B;  5B8H A;  4CER A;  1GLB G;  4CFC A;  4ID5 A;  1G15 A;  1YUW A;  3QIC A;  4MO5 A;  5AQY A;  4DFK A;  3AAR A;  2Q0U A;  1RNH A;  3OW2 M;  3EZ5 A;  2B5J A;  1JLB A;  4IFV A;  3NF7 A;  2IVO A;  5AQX A;  3LP0 A;  2FC0 A;  5GIN A;  1QQM A;  1L3T A;  3PIP L;  4O0I A;  1D4X A;  2GV9 A;  4DR2 K;  1EXQ A;  4F4K A;  1JXB A;  1HNZ K;  1Q9X A;  4W5N A;  4FJK A;  1NGE A;  4AQY K;  4O8K A;  1L3V A;  4BWJ A;  2ITG A;  1C1B A;  3ZSW A;  3DJC A;  1T6C A;  2KW4 A;  4YOX A;  1QSL A;  3KLI A;  3OVN A;  1KAY A;  2PYJ A;  4KPY A;  2QK9 A;  3CJB A;  4MDA A;  3KLG A;  1BIU A;  4JI7 K;  3K9J A;  1JKH A;  1NK7 A;  1WSH A;  1YVU A;  4CEA A;  5HLF A;  4N76 A;  1ZYQ A;  1LWF A;  1W2B M;  5J2P A;  4FWM A;  4BQL A;  4ID1 A;  1IBK K;  5FPM A;  1U47 A;  2G8I A;  3KWI A;  5J2N A;  4CEF A;  4YOW A;  4DFJ A;  3SQ0 A;  3OS0 A;  1L3U A;  1D8Y A;  4AHS A;  2F96 A;  4EP5 A;  4LSN A;  2OA8 A;  1QZ6 A;  1WN7 A;  1JLE A;  4GNI A;  3TU5 A;  4J2D A;  1WSJ A;  3RMA A;  4B3O A;  4XH5 A;  4DKW A;  1RTJ A;  2VWK A;  3O1W A;  1DKG D;  2HVH A;  2V7Z A;  3IRX A;  3DRP A;  4DS5 A;  5M1O A;  4O5B A;  4CZG A;  3CHW A;  1WSF A;  4E7J A;  1JLQ A;  4JS5 A;  1VQK N;  1GLJ O;  3VQE A;  4DTR A;  1C0F A;  4FK2 A;  1GOA A;  2QWL A;  4FVU A;  4X66 K;  3BZC A;  2RN2 A;  3THV A;  3VTH A;  3S3M A;  4GV6 A;  3CQ8 A;  4LF4 K;  1Q86 O;  3AVA A;  3T1A A;  3O3G A;  4CEQ A;  4GV9 A;  3SQ4 A;  3CYM A;  4CIE A;  1WAF A;  2RHK A;  3OS2 A;  4IJA A;  4NCG A;  3OYI A;  1HNW K;  3TTD A;  5CR4 A;  1K8K A;  3VQC A;  2FBV A;  4RTF D;  4FLV A;  4DU4 A;  4F3T A;  2VGM A;  4LY7 A;  4CJ4 A;  4O5F A;  5FRO A;  3KD5 E;  1BCO A;  4LF5 K;  4NYN A;  4DMN A;  1KAZ A;  2ZGY A;  3MWT A;  3B8A X;  3O4Q A;  5JLH A;  1Q82 O;  2PBD A;  3SI6 A;  2FSN A;  4YOY A;  2HF4 A;  3PO4 A;  4OKK A;  4KHY A;  3CD6 N;  2BGG A;  3UIQ A;  3ZX0 A;  2YI1 A;  3K57 A;  4KHN A;  1YTA A;  1G99 A;  4QAG A;  2KFN A;  4CK2 A;  1RTI A;  4WQ4 C;  2ZD1 A;  2P9S A;  4PA1 A;  1U2V A;  3SJH A;  3F5T A;  1VSD A;  1D9F A;  4E3S A;  4BVP A;  1BI4 B;  1RFQ A;  2IIR A;  3MWP A;  1JL1 A;  3A8Y A;  3CIP A;  3VEV A;  4BRI A;  4Y1D A;  2HHX A;  1Z26 A;  2X6N A;  1HNI A;  3BDP A;  1ATN A;  4CK1 A;  4Z4E A;  3O9T A;  4DR4 K;  5C24 A;  3V1O A;  5AQZ A;  1S1U A;  3OS1 A;  2UUA K;  4C23 A;  3HXM A;  3ULE B;  4NCA A;  2PFU A;  3BEX A;  2OZS A;  5LMU K;  1GOB A;  3QET A;  3VGL A;  3M3Z A;  4V19 S;  1QHA A;  1GLC G;  5CZ2 A;  1IKX A;  4FVM A;  1C0T A;  1X1P A;  2IVN A;  5E26 A;  3UKU A;  2HST A;  4CD3 A;  1BGX T;  3GL1 A;  2KHO A;  4ILG B;  4LF6 K;  3A5L C;  1VSF A;  4DU3 A;  4CI6 A;  5C42 A;  2O4I A;  1UA0 A;  3HOS A;  4K43 A;  4B1X B;  2P9I B;  2B6A A;  2Z1G A;  1EO1 A;  3KHY A;  4KO0 A;  2E1Y A;  3RSE A;  2ZM6 K;  3C7N A;  1EWQ A;  4AIL C;  4LF7 K;  1ILY A;  3VEO A;  1BO5 O;  3ZSQ A;  4ISG A;  4C8L A;  3I0S A;  3PY8 A;  3P5J A;  4DTN A;  1HUX A;  4YFU A;  4BE2 A;  1XQS C;  4KKO A;  4I6M A;  3OYM A;  3WEE A;  4DTM A;  2P9N A;  4B9T A;  3SUN A;  2WBN A;  1J5O A;  2XO7 A;  2V51 B;  1NGG A;  4FJI A;  2QWQ A;  2E2N A;  4BRN A;  3TAG A;  5F1X A;  4LF9 K;  2FF3 B;  4CVN E;  1FW6 A;  2YHX A;  4W5R A;  2HOE A;  3D2E A;  3J81 O;  1REV A;  2V52 B;  3Q7B A;  3QNN A;  1K6Y A;  3AVN A;  3OTO K;  1S72 N;  1BA1 A;  2EX3 A;  4I6M B;  1IKW A;  3SZ2 A;  3PX6 A;  4M3U A;  4DLE A;  3EZW A;  3TPQ A;  3MEC A;  4CJP A;  2UXD K;  2IAJ A;  1XUP O;  4CBW A;  3TAQ A;  1NOY A;  4CHZ A;  4DTO A;  4BGA A;  1SKW A;  1U6Z A;  3E9P A;  4FWR A;  4EHT A;  4HWI A;  4DUY K;  4JKC A;  4ELU A;  4W5Q A;  3CFR A;  5A2Q O;  1E4G T;  1VQ5 N;  3LZI A;  3CME N;  3VN5 A;  2YCH A;  4OPA A;  4EFH A;  4KTQ A;  1XNQ K;  4CHQ A;  2GUI A;  1RT7 A;  2IC3 A;  2FSK A;  3O08 A;  1ASV A;  1VSL A;  1N6Q A;  3ALY A;  4A57 A;  4ICL A;  1QQO A;  1VQP N;  3J7Y P;  4IO9 L;  4JI4 K;  4RWT A;  1H1V A;  3D6R A;  1DEJ A;  3AVC A;  1D5A A;  4JN4 A;  1YHQ N;  3VQQ A;  1VQ8 N;  4FJ7 A;  4C1N K;  5I3U A;  4QS8 A;  2G8K A;  1QHT A;  1X3M A;  4JYA K;  1OVY A;  4F8R A;  3L3U A;  1JLC A;  4JHD A;  2GWK A;  4FWQ A;  3HL8 A;  3B6O A;  2ATQ A;  1GLE G;  3AA4 A;  3WNG A;  4DG1 A;  4FSV A;  5GAH P;  3OYN A;  4DQQ A;  3TAP A;  1BQM A;  3AGK A;  3RRG A;  3CJC A;  1FJG K;  4B1W B;  3VEW A;  4OGC A;  2XHB A;  4H8K A;  4JKD A;  3TTC A;  2NRZ A;  1C1C A;  3AVK A;  2O8D A;  2NRV A;  2P9S B;  5ELZ A;  2BTF A;  4EIA A;  3ASM A;  3CJA A;  4I9Q A;  3SAG A;  1VSJ A;  1UAX A;  4JHD B;  4CF1 A;  2YHW A;  4PL8 A;  3K5N A;  2D0O A;  5SWM A;  4HUG A;  4M41 A;  1KVB A;  3GBT A;  5HP1 A;  1LCU A;  3K9K A;  4BAC A;  1RCH A;  2GBZ A;  2KZM A;  1DGK N;  3ENH A;  1C1A A;  1NKB A;  2G8V A;  1XC9 A;  2O8E B;  4CJL A;  4C8O A;  1YVN A;  4CJU A;  3VES A;  4R5P A;  1S5J A;  3RTV A;  3P39 A;  4BRA A;  3EE9 A;  3DLE A;  1T44 A;  3U9Z A;  3CM6 A;  1BWF O;  2G8F A;  1NK8 A;  5BRD A;  4CFA A;  2YJE A;  2FLO A;  3AVI A;  3VET A;  3ZX2 A;  3TAF A;  4WF9 L;  4JKF A;  3OYA A;  5J2Q A;  4DUZ K;  2HHQ A;  3O9U A;  3L2V A;  1KTQ A;  1Q8I A;  4DSE A;  3JYT A;  1CZB A;  3K0S A;  4PY5 A;  1BOT O;  4CGI A;  3E1Y A;  2I5J A;  3OBW A;  1SL1 A;  4I2Q A;  5CY4 A;  4EP4 A;  3OYH A;  2ITM A;  3OYG A;  3CM5 A;  4B1V A;  5FPD A;  4Z0U A;  4JI5 K;  3HPG A;  3W3D A;  1GLA G;  2NRW A;  1CLQ A;  3O4N A;  3K2P A;  4DB3 A;  3N4P A;  3IMX A;  1NJZ A;  2CGL A;  3TAN A;  1SKR A;  2O8C A;  1U48 A;  3KK2 A;  4KTZ A;  3LP3 A;  1WBD A;  2QWM A;  3ZYY X;  3HO1 A;  4PWD A;  4JI1 K;  5AQG A;  2ZQB A;  1NJW A;  4FPA A;  1RBT A;  3E01 A;  2VYP A;  3FZF A;  4Q0B A;  1S9E A;  4U7B A;  4FM2 A;  2W41 A;  1TAU A;  4AHR A;  1WSE A;  3VPZ A;  2G8H A;  4CF0 A;  4BRC A;  1Z05 A;  3ULD A;  3LAN A;  4XH1 A;  4BRQ A;  3THW A;  2O8C B;  4FOI A;  5KRT A;  4BVO A;  5BN9 A;  2UXC K;  5JIC A;  5TKW A;  4AHV A;  3QO9 A;  3U8X A;  4B9N A;  3DLL L;  3OYL A;  3VEY A;  4BDZ A;  3VF2 A;  1XHX A;  1E3M A;  3SBG A;  4BR5 A;  1RT3 A;  1NM1 A;  1LWE A;  2ASP A;  3CI5 A;  3P83 D;  3K59 A;  3AO2 A;  2BH1 A;  1C0U A;  3FGU A;  4FLU A;  4B9L A;  1QSS A;  1A5X A;  3AVH A;  3TAM A;  5GAD P;  1P8Z A;  4B8C A;  3VTI A;  3T1H K;  1IG8 A;  1TAQ A;  4M7X A;  2F4V K;  3LDO A;  4CEO A;  1FXX A;  3AO1 A;  3F9M A;  2Z1J A;  1NGB A;  3OYE A;  1OH7 A;  3C6H A;  5C2D A;  2QTD A;  3DI6 A;  4CJV A;  4E89 A;  1K9M O;  4H5N A;  1SZ2 A;  3RVC A;  3PX4 A;  1J9A A;  4H0X B;  1CZA N;  1NK4 A;  5AQH A;  4CCH A;  4FJX A;  4FXD A;  1JCE A;  1TYQ A;  1ZBU A;  1OH8 A;  4U67 L;  2FF6 A;  3THX B;  3MDQ A;  4JS4 A;  3HI0 A;  5FPE A;  4HCC A;  3EO3 A;  2PY5 A;  4BR9 A;  3H45 C;  2VG7 A;  5M1F A;  4AM7 A;  5JLF A;  5FPN A;  3SAF A;  3RWU A;  3SNN A;  3R1X A;  4BWM A;  1R59 O;  2O8D B;  3U6F A;  5HBM A;  4KH6 A;  1QVF M;  4FYD A;  4PHT X;  1N33 K;  2FXU A;  3QEV A;  2YKN A;  1YAG A;  4MO4 A;  1TKD A;  3VER A;  4GV3 A;  3PO5 A;  3G4S N;  4GKJ K;  3ENB A;  4BC3 A;  4OKE A;  3IS9 A;  3KVG A;  4NXM K;  1IV0 A;  3QFP A;  1ASW A;  4JAX A;  4FJJ A;  3KK7 A;  3DLG A;  1RIL A;  1U49 A;  5AQK A;  3SMP A;  3M1F A;  3TR8 A;  5BR8 K;  3O9S A;  4BDY A;  5CE3 A;  1ZBF A;  4LD0 A;  5FLX O;  1NKE A;  4DV4 K;  1VSK A;  1X9M A;  4CES A;  3TI0 A;  5HRN A;  2A42 A;  2OAN A;  3DMJ A;  4FO0 A;  5EOY A;  3EN9 A;  1K8K B;  1NGJ A;  2XY6 A;  4RCH A;  5CYM A;  3SV4 A;  1RTH A;  3D0P A;  4A5B A;  4BG8 A;  3MEE A;  1W0H A;  3MCA B;  3P4I A;  4KB0 A;  4AHC A;  4IDK A;  1BUP A;  2IDO A;  3JAM O;  4BE1 A;  3IKM A;  1LW2 A;  4IG0 A;  4FWN A;  3ZX3 A;  2HBL A;  1IJJ A;  3DLR A;  2YNH A;  3NFA A;  3O4W A;  4DFP A;  1BCM A;  3KKR A;  5C0Y A;  5TKY A;  3CPW M;  4FLX A;  3T3F A;  1HKC A;  4JLH A;  3NCI A;  4QOZ B;  5EY4 A;  3VEX A;  2Y1I A;  4WQ4 A;  4HUE A;  4IBN A;  1WOQ A;  4IFE A;  4CGF A;  4RW8 A;  4CZI A;  1S6P A;  3KK1 A;  5FDL A;  1MA9 B;  3D45 A;  1NK9 A;  3AV9 A;  3LDL A;  3V9U A;  4A62 A;  3G10 A;  4FL9 A;  4N47 A;  1HJO A;  1KXP A;  4IWV A;  5KPR A;  1VQL N;  3AVF A;  1C6V A;  2ZE2 A;  3J8A A;  1RBV A;  5E84 A;  3ZET A;  4CD1 A;  2P9U B;  3DLK A;  3MX5 A;  2NRH A;  3DXM B;  1Z6R A;  2Q0R A;  4B3S K;  1QTM A;  3P1G A;  3V9S A;  2CH5 A;  2NRR A;  1T6D A;  1U2V B;  3DOL A;  2KKZ A;  4BR4 A;  3M5R A;  3ULE A;  1YJN N;  2E6L A;  2AJQ A;  1SKS A;  1S1X A;  1MWK A;  1W97 L;  1MWM A;  5F2R A;  3TSU A;  3ZET B;  4FK4 A;  3V4I A;  4M3Y A;  2HBK A;  1HYZ A;  1VQO N;  3BF1 A;  3K5L A;  4HHT A;  1QVG M;  4AHU A;  4B9V A;  3VQ4 A;  2UYT A;  4C8N A;  4AH9 A;  3ZSX A;  4JI0 K;  1S9G A;  3W0L A;  4FWP A;  5M1Q A;  3VQP A;  1NG9 A;  5JVH L;  4IKF A;  2P9I A;  3GOI A;  4E7H A;  2QI2 A;  5JS1 A;  2O8B A;  2RE2 A;  1U4B A;  4OGE A;  1RDC A;  1JLA A;  4CJT A;  4N56 A;  1V4T A;  1TK8 A;  2D0P A;  3HPO A;  4H5T A;  5BPL A;  4BG9 A;  3NF8 A;  3HTV A;  3NGZ A;  4J2A A;  2CGJ A;  2XY7 A;  4FWL A;  5AFU A;  5AQI A;  3ID8 A;  1N32 K;  3WXL A;  3KJV A;  1WSG A;  4DTS A;  3VMF B;  3QML A;  1TYQ B;  4CHP A;  3A0I X;  1HKB A;  3THX A;  3THY B;  3NF9 A;  3I8B A;  3SK3 A;  5KQ8 A;  5F0X A;  3CC4 N;  2BAN A;  2BDP A;  3DM2 A;  2KFZ A;  4K25 A;  3OYJ A;  4DV3 K;  3ZT1 A;  4BC4 A;  1B9F A;  1BHL A;  3GG4 A;  5KTQ A;  3LDS A;  4KHP K;  4YNQ A;  4NB4 A;  3NF6 A;  4H0P A;  3H3N O;  1ESV A;  3RR7 A;  3E66 A;  3LM2 A;  4FJ8 A;  1BIZ A;  3C6U A;  1O13 A;  2OPS A;  2P9L A;  4AM6 A;  1NK0 A;  2HB5 A;  1NGD A;  5AZI B;  1UA1 A;  2UUC K;  4FZY A;  5CZ1 A;  4DTX A;  3LAM A;  1RT4 A;  3M8R A;  4CJR A;  3ZT2 A;  3HP9 A;  4FLT A;  2ZGZ A;  4YOU A;  3CFO A;  4FJH A;  5LY3 A;  3UKU B;  5C12 A;  3S3O A;  1K8A O;  4ELT A;  4HCB A;  2FBY A;  3O9R A;  2WTU A;  5ADX H;  3M6G A;  3A2F A;  5AFU H;  4H5R A;  4LC9 B;  3OJS A;  1HX1 A;  3CXC M;  3AAQ A;  2Q3S A;  4BRD A;  3OY9 A;  3QIP A;  4WQ5 C;  3KZB A;  4KHW A;  4NYF A;  4DCH A;  1NU0 A;  3CJ1 A;  1XWL A;  4XH4 A;  4K8X A;  2XRI A;  2EHG A;  2NRT A;  5C15 A;  4E0D A;  1SL0 A;  2WON A;  2QM1 A;  3E9L A;  5BRF A;  3CCR N;  2HND A;  4L8R B;  3VQ7 A;  4DV7 K;  4X62 K;  2XY5 A;  3UE5 A;  3WXK A;  1IBM K;  3VQB A;  4FJ9 A;  1SS6 A;  1WLJ A;  4TSX A;  2VWB A;  2G8U A;  1Q81 O;  5AQL A;  5M1N A;  3R9P A;  1WBB A;  3VEN A;  2QXL A;  4FLZ A;  3HSC A;  3OYC A;  1JLG A;  3VF6 A;  4FLY A;  1VQ7 N;  2YNI A;  1HR0 K;  5BRE A;  4ZHR A;  4M45 A;  3S9H A;  4E1J A;  2F7T A;  4ILJ A;  2JWK A;  2P51 A;  4B8A B;  1KQS M;  4B3M K;  3AVJ A;  1XMQ K;  2VQE K;  1IG9 A;  5T7B A;  1VHX A;  5JVG L;  1TUU A;  4BR0 A;  4N41 A;  1TKT A;  1OKJ A;  3H46 O;  2IVP A;  2P5O A;  4DR5 K;  2VCP A;  3LAL A;  4IDH A;  3HP6 A;  4R79 A;  3WQU A;  5AQU A;  4DSI A;  1F21 A;  1GLL O;  4FZZ A;  5FRN A;  1VAZ A;  3QFU A;  2AA4 A;  4DLG A;  3D2F B;  1WAJ A;  3AA5 X;  1IBL K;  4BRH A;  3QLH A;  2J4R A;  3ZSR A;  3L4Q A;  3EE8 A;  3OYB A;  4DV0 K;  4ISE A;  4B3R K;  4FZX C;  1B9D A;  4FJ5 A;  3ITH A;  4HUF A;  1ZBH A;  5IT9 O;  3HBT A;  1VK0 A;  1KC8 O;  2P9P A;  1CZ9 A;  4FWO A;  4BY9 C;  3C6A A;  3VOV A;  2VG6 A;  3A5M C;  4DTJ A;  3DOK A;  4CW7 B;  3KD1 E;  4B1Y B;  3PX0 A;  4F3O A;  4DF8 A;  3SPY A;  3BY5 A;  1RDB A;  1U04 A;  2PYL A;  1NNE A;  1TL1 A;  3PLA A;  1HLU A;  4OPH A;  1IO2 A;  4RG8 A;  3SYZ A;  5SZT A;  3WNH A;  3RRH A;  3QEW A;  4JKG A;  3G25 A;  5AQR A;  1RDA A;  3VF4 A;  4PUO A;  4CEB A;  3KLF A;  4OLB A;  3LM9 A;  4M7Y A;  1N34 K;  2O8B B;  2RPI A;  2GX9 A;  1KLN A;  2QKB A;  4CIG A;  2WUS A;  2QA4 N;  3V9W A;  3WXI A;  1I39 A;  4W5T A;  4O44 A;  4DV5 K;  4GVM A;  4BR7 A;  3T19 A;  4PL7 A;  3AGR A;  5AQF A;  5AR0 A;  5HOO A;  3VQA A;  4FWK A;  3SQ2 A;  4IXC A;  2FSJ A;  4WFN L;  4BR2 A;  4NO7 A;  4IEE A;  4BQZ A;  3S3N A;  3LAK A;  3R8E A;  5KGX A;  2HW3 A;  4X64 K;  3CCV N;  1YXQ A;  3CCS N;  2ASO A;  3RMC A;  3KTQ A;  4M63 C;  3MN5 A;  4YDU A;  2WFB A;  2Q97 A;  3I0R A;  3LP2 A;  4XEI A;  3NBP A;  3NVK A;  3NVM A;  3CJ7 A;  4Z4I A;  4J8F A;  4KRF A;  3M8Q A;  4QCL A;  3LWM A;  2E1Z A;  1EET A;  1VSH A;  4CGH A;  4CJK A;  3VA3 A;  3MK6 A;  3O8M A;  2P9K B;  4XIU A;  5I42 A;  3JSM A;  4OO1 J;  4BRG A;  4I2P A;  4CFD A;  2P1J A;  3KLH A;  2DFH A;  1RBU A;  3SAH A;  5DMR A;  1YT3 A;  1X9W A;  3CPE A;  4FWS A;  3WUH A;  3RSE B;  2YJF A;  1OH6 A;  2VGN A;  5AQM A;  1NOZ A;  4OKJ A;  3MN6 A;  3R6M A;  2HHS A;  1X9J A;  4IFY A;  3G0Z A;  4BRL A;  3AO3 A;  5KPT A;  3ZT4 A;  4K41 A;  1KSP A;  2BUP A;  4K42 A;  4JNE A;  4JK8 A;  4CHY A;  4MQ3 A;  4CJF A;  1OH5 A;  3A5O C;  1NLV A;  2ASM A;  1NBW A;  2HF3 A;  5CHI A;  4X65 K;  2HHU A;  4KBO A;  1NGH A;  3TSP A;  4LF8 K;  1CXU A;  1NKC A;  3WXM B;  1S1T A;  5AQV A;  1RT2 A;  5HRS A;  4J2B A;  3V9X A;  3DLB A;  3MCP A;  4B9U A;  4B9Q A;  3ID6 A;  3ZT3 A;  3PSI A;  4WYB A;  1ASU A;  2E2O A;  3HVT A;  5MLC Q;  3J7A P;  5IWA K;  3CET A;  4DR7 K;  2O8F A;  2VWJ A;  4WFA L;  2Q2R A;  3J7Z O;  1I3A A;  3ZLJ A;  3C65 A;  4KI4 A;  4BRF A;  4BDP A;  3SBT A;  3D2F A;  2ZJQ L;  3OYK A;  1C0M A;  4DQR A;  3P31 A;  2A1S A;  2A3Z A;  1TGO A;  3IUC A;  2QKK A;  1Z25 A;  3I56 N;  1X9S A;  2KQ2 A;  1T7P A;  2YHA A;  2D0B A;  2HHW A;  3L4I A;  4I9L A;  2DY4 A;  4OJR A;  4M3X A;  5I9E B;  4B9S A;  4JD2 B;  3MXM A;  2FBX A;  4YDU C;  3OJU A;  1NJX A;  1HYS A;  1VSI A;  2ZJR L;  1NK5 A;  3VQ5 A;  2F9T A;  1IKY A;  4DF4 A;  3O9Q A;  4JI2 K;  2HBJ A;  3E9O A;  4CBX A;  2CH6 A;  3MED A;  4C1N I;  3AVB A;  4E19 A;  2Y1J A;  2V7Y A;  5AQJ A;  3NAE A;  5AQW A;  1GLF O;  4CIF A;  3DYA A;  2VQF K;  4A2B A;  5DM6 L;  1DT9 A;  4FPB A;  5LL6 Z;  1BU6 O;  4JEP A;  3QBX A;  1JCG A;  4JKB A;  2E88 A;  4LSL A;  1YIT N;  2GUP A;  2DFE A;  1V4S A;  3N4Q A;  3H1Q A;  4LH5 A;  2ZWH A;  3CCE N;  3I33 A;  4NCB A;  3M8P A;  1J5E K;  3MAQ A;  3PSF A;  1ZBL A;  1K73 O;  4KI6 A;  3LDQ A;  3CCJ N;  2B4J A;  4JK9 A;  1XI1 A;  4CGG A;  3L2Q A;  2NZT A;  3CQX A;  2WOM A;  4CF8 A;  5HL7 L;  2HHV A;  5AQQ A;  1JXE A;  5K14 A;  2GWJ A;  1GOC A;  1QE1 A;  4FW2 A;  2OPQ A;  2OYQ A;  4WFB L;  4UQG A;  4JI3 K;  3I8D A;  3IAY A;  2PAV A;  4H5V A;  2YV0 X;  4JKH A;  5KPZ A;  3F9K A;  1JL2 A;  3L2U A;  3NHG A;  1EX4 A;  4FK0 A;  1FKO A;  3V81 A;  4IOX A;  2W6L A;  4JKG B;  4BE0 A;  1L5U A;  4KHS A;  5AQN A;  1KAX A;  3TAB A;  4CZE A;  2GEM A;  2YX6 A;  4MFB A;  3ATU A;  4RW9 A;  3J80 O;  1VSM A;  1SL2 A;  1BL3 A;  3MXI A;  2UUB K;  1IKV A;  3WXJ A;  3ZSO A;  4DSK A;  1ATS A;  3U3G A;  4OPK A;  4Z94 A;  3THY A;  1VRU A;  3H6E A;  4IEI A;  1T05 A;  3DXK A;  3QIN A;  5BPN A;  2UXB K;  4KAZ A;  1YTU A;  2KTQ A;  5LMN K;  4CJ5 A;  4LFC K;  2DTU A;  4KHU A;  1NGF A;  3BF3 A;  3TSQ A;  4GVE A;  3DXM A;  4DWI A;  3H3O B;  4QS9 A;  2X6S A;  3QBW A;  1TL3 A;  3QIO A;  1QZ5 A;  4Z4H A;  2YHY A;  4H5W A;  3HYF A;  2GTD A;  4KV8 A;  5AJ3 K;  4CJ7 A;  4BRE A;  1RT5 A;  3F73 A;  4UY8 O;  2IGI A;  4DV1 K;  3V9Z A;  1ZC6 A;  3EY1 A;  3F2K A;  1LWC A;  1A5W A;  3VQD A;  4CEZ A;  3G71 N;  2QWN A;  1RDW X;  3L3V A;  3C6T A;  3SUO A;  1J6Z A;  1HNV A;  3BGR A;  3MX2 A;  3MMV A;  4PKG A;  4ZTF A;  2HHH K;  2A40 A;  4CEE A;  1RT1 A;  3V1R A;  3HRG A;  4BGB A;  4WQ5 A;  2F8T A;  1BA0 A;  1RTD A;  2O8F B;  3HT3 A;  3RMB A;  1MU2 A;  3CCU N;  4GMJ B;  4OVL A;  3LP1 A;  4M3Z A;  3WQT A;  4DTU A;  2EWS A;  1KVC A;  1DTQ A;  4A2A A;  4CE9 A;  2Z1I A;  3QEI A;  1WSI A;  4FLW A;  3T1Y K;  4CJS A;  2Q31 A;  3DLH A;  4E7K A;  4KFB A;  1HQU A;  2QWP A;  3C94 A;  3FLC O;  4NXN K;  4Z4G A;  3LZJ A;  1P90 A;  4DQI A;  1XHZ A;  1BIS A;  3QDK A;  2I7N A;  4CJQ A;  4CHN A;  3QEP A;  1J54 A;  3HZ6 A;  2IS3 A;  5EVZ A;  2A6A A;  1TVR A;  4GKK K;  3EYZ A;  5BN8 A;  3CF5 L;  2X78 A;  4RW6 A;  4QS7 A;  4FJN A;  3HOT A;  2XY8 A;  4A59 A;  3CER A;  5AQO A;  3OYD A;  5E41 A;  3SLC A;  1I94 K;  4PKH A;  1RGI A;  4C8K A;  1TK5 A;  1QSY A;  1KLM A;  1MDU B;  3MN9 A;  1HJR A;  3KK3 A;  3EL2 A;  4JKA A;  4O8U A;  4E1N A;  2NLX A;  3P38 A;  4B1Z A;  3FR0 A;  4I7F A;  3EKU A;  1RDD A;  4A61 A;  1LV5 A;  2BE2 A;  5J1E A;  1VQ9 N;  1VSE A;  3AAP A;  3GDQ A;  1ATR A;  3PV8 A;  2E20 A;  3DRS A;  1DLO A;  1KVA A;  4WE1 A;  4Q5V A;  2QW9 A;  4CGD A;  1KCF A;  1KFD A;  3T7Z A;  4JK7 A;  3H1V X; 
#chains in the Genus database with same CATH homology
 1N36 K;  2E5L K;  4LFA K;  4OX9 K;  4CW7 B;  5BR8 K;  4DV2 K;  4JI0 K;  5FLX O;  1HNX K;  4DR2 K;  1J5E K;  4DV4 K;  4LFB K;  2HHH K;  4DV7 K;  4X62 K;  2UXC K;  1HNZ K;  1IBM K;  4AQY K;  4JI8 K;  4X65 K;  4LF9 K;  4DR1 K;  4CVN E;  4LF8 K;  2UU9 K;  3JAM O;  3J81 O;  3OTO K;  4JI7 K;  1N32 K;  1N34 K;  1XNR K;  3T1Y K;  4JI3 K;  4YY3 K;  4DV6 K;  3T1H K;  3J7A P;  5IWA K;  4DV5 K;  4DR6 K;  4DR7 K;  2UXD K;  1HR0 K;  4NXN K;  1IBK K;  2F4V K;  4B3T K;  4DV3 K;  4B3M K;  4YHH K;  4DUY K;  1XMQ K;  2VQE K;  4X64 K;  5A2Q O;  4KHP K;  4DUZ K;  4DR4 K;  3J80 O;  4DR5 K;  4GKK K;  1XMO K;  2UUB K;  2UUA K;  1XNQ K;  5LMU K;  2UXB K;  1I94 K;  4V19 S;  2UUC K;  3J7Y P;  4JI5 K;  5LMN K;  4JV5 K;  4LFC K;  4JI4 K;  4X66 K;  4JI6 K;  1IBL K;  4JI2 K;  4B3S K;  4LF4 K;  4LF6 K;  4DV0 K;  1N33 K;  4DR3 K;  4B3R K;  4JYA K;  5AJ3 K;  2VQF K;  4K0K K;  4GKJ K;  1HNW K;  5IT9 O;  4JI1 K;  5LL6 Z;  4NXM K;  4DV1 K;  2ZM6 K;  4LF7 K;  4LF5 K;  1FJG K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...