1N36K

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1n36K00
4DV5K 4NXNK 2UUCK 4JI1K 4DV3K 4LFCK 4NXMK 5LL6Z 3J81O 4LF9K 4DV2K 4LFBK 4DUYK 4JI8K 3T1YK 5LMUK 1N32K 4B3MK 4JI6K 4JI3K 4B3RK 5IWAK 4X64K 4DR4K 1HR0K 4DV1K 1IBMK 1XMOK 2UXCK 2VQFK 1J5EK 4DV0K 4LF5K 4YHHK 5AJ3K 4JI7K 5IT9O 4CVNE 4JYAK 1XNQK 2E5LK 3OTOK 4B3SK 4X66K 1HNWK 4JI0K 4AQYK 4K0KK 2F4VK 1IBKK 1XNRK 1IBLK 2UUBK 4KHPK 2VQEK 4B3TK 3J7YP 4JI4K 4DR1K 4OX9K 1HNXK 2UXDK 4LFAK 4DR2K 1I94K 5FLXO 4YY3K 4DV4K 5LMNK 4DV6K 4DV7K 4DR5K 3T1HK 1N34K 3J80O 1N36K 2UU9K 4X62K 4V19S 4GKJK 4DR3K 4LF8K 2HHHK 2UUAK 2ZM6K 4GKKK 4JV5K 1N33K 4DR7K 3JAMO 4LF4K 4DUZK 4LF6K 4JI2K 5BR8K 3J7AP 4LF7K 5A2QO 4X65K 1HNZK 4CW7B 4DR6K 4JI5K 1FJGK 1XMQK 2UXBK
chains in the Genus database with same CATH superfamily
3TSUA 4M63C 3VA0A 3M5RA 4C8KA 4E7LA 5BPMA 1GOBA 5ELZA 1QQCA 1OH6A 4JKFA 5FRMA 3O80A 4FK0A 2E2OA 2DFEA 3K0SA 4YOUA 2GEMA 4FJKA 1ZC6A 3CD6N 1ZBLA 1DKGD 2V51B 1OKJA 2RPIA 3DYAA 4JKDA 4CGJA 2D0OA 4X64K 4CF1A 3CERA 1TK8A 1QE1A 3LAMA 3NVMA 4CGFA 3TU5A 4BR9A 1WB9A 1NK6A 4CJVA 5M1PA 4J2BA 3GOIA 3THYA 2O8DA 3NFAA 1RTDA 2W6KA 3KLHA 1HX1A 4AHUA 2GBZA 4JI7K 4RW4A 3PIPL 5HRSA 3H45C 4DTJA 4C23A 2PY5A 4IOXA 3WXLA 2YNHA 3L3UA 4DFJA 1CXUA 1K6YA 4JI0K 4F3OA 1VQ8N 1QSYA 1S1XA 3VERA 3CJCA 1BISA 3DLEA 1WN7A 3OW2M 1M1KO 3TAEA 4CJSA 3EE8A 1NJIO 4DR1K 1J53A 1DTTA 3LPTA 3CXCM 4CEEA 3KLFA 4LFAK 5D3GA 3ZT4A 4M3TA 4JHDA 5AQGA 2XHBA 4DV4K 1T6DA 3DLRA 1NGGA 3UB5A 4F3TA 2YNGA 4CJRA 5C10A 3CJ7A 1BO5O 3PX6A 5BPNA 4DSKA 3MWTA 5EU7A 3V9UA 5AQTA 1N6QA 4CIFA 4W5TA 3OA9A 1MU2A 3AGKA 3WXJA 3CMEN 1TVRA 1WUAA 1DLOA 4AHCA 4LF6K 3RRHA 1HYSA 4HVJA 1T05A 2YKNA 1HJOA 2IIRA 4ID5A 1T3VA 3ASMA 4A59A 4KB1A 4FL9A 3BZCA 4JEPA 1JCGA 3HO1A 3SV3A 4Z94A 1SL1A 5C0YA 3JYTA 4E0DA 1YAGA 5J2PA 1C6VA 5AZJA 1BWFO 4LFCK 4NXMK 1W9HA 3FLCO 3HM9A 1IO2A 2I7NA 3SBGA 3QEXA 3NF6A 4Z0UA 1VQKN 3WQTA 3CMAN 5FRNA 4B8AB 4A61A 1VAZA 3AO3A 1J54A 3NF9A 3DJCA 3C6AA 2V52B 2YHBA 3LP1A 3HPGA 4F4KA 4DS5A 1W7AA 3K2PA 4KTQA 1NJWA 2D5RA 5M1QA 3JS6A 4YHHK 1D9FA 5AJ3K 1XWLA 4JKCA 3H1QA 3DI6A 1LW2A 5GINA 3KD1E 1JLBA 3P83D 2P9IA 3ID8A 4CJ4A 1ASUA 4EIAA 3ZSWA 4FJNA 4X66K 4H0YB 1TL1A 2OTJN 1TAUA 4CZLA 4RW9A 3O6WA 5AQUA 5JMVA 1LV5A 2RKIA 2WUSA 1Q9XA 3QEIA 4JD2A 3TTCA 4CBXA 4F9OA 4FLTA 5LY3A 1UAXA 1NG9A 2Z1GA 2O8CA 3CF5L 4O55A 1YITN 3PSFA 3K58A 4M3ZA 1JXBA 1S6PA 4B1XB 1XC9A 2Z1JA 5KGXA 3P4IA 4PHTX 3K9JA 3CCEN 1BA0A 4DTPA 4B9MA 2EX3A 3CCSN 4KH4A 2PYJA 1RT4A 1NK7A 3C6UA 3VGLA 3PX0A 2GUIA 5CYMA 4E3SA 1LWEA 4CF9A 3FFKB 1C0FA 3LZJA 1NKBA 3CI5A 4DSFA 2Q0UA 1BOTO 4DTMA 1TYQB 4IG3A 4X65K 4FWRA 4CJPA 3I33A 5FROA 1H1VA 3UE5A 2HHSA 2BANA 3ZX0A 4BR4A 3HBTA 3RSEA 3RR7A 3UIQA 1GLEG 3FGUA 4B9QA 3V81A 2HB5A 1QZ6A 1GLBG 1TK0A 2P9LB 3T1YK 4F2RA 2E2NA 3QNOA 3G25A 4M42A 2O8BA 2A3ZA 3ENHA 3T1AA 3VENA 4IZ9A 2I7PA 3F2KA 2OTLN 3M8QA 5AQMA 4YFUA 2QWRA 2VQFK 3HT3A 3MDQA 3VQ7A 5KPTA 2NRVA 4C1NK 3EL2A 1BL3A 3NGIA 1NK5A 1D8YA 1TAQA 3OTOK 4B3SK 3ZSYA 3WEEB 1HNWK 1A5XA 3AVFA 2GWKA 3K9KA 2NZTA 4N5SA 1XNRK 1ATSA 2OPRA 4ZTFA 4GNIA 3BZKA 4AM7A 1Y97A 3HSTB 2Q2RA 3HTVA 4EP4A 1X3MA 1ZBUA 3FZMA 2J4RA 1C1CA 1RT6A 2R7YA 3VQCA 4WFBL 3AVIA 1K8KB 1D9DA 1DTQA 3JXUA 1E4FT 3QBXA 4CHNA 1Q9YA 3OYJA 2BGGA 3CFPA 4BC4A 2IGIA 3O1BA 2GWJA 4CJEA 2P9UB 1U04A 4BREA 3MWPA 2QM1A 3TI0A 4LSNA 4BRLA 1S9EA 4GW6A 1SZ2A 2VGNA 1JLGA 4RW6A 1RILA 4K43A 3C65A 1Q82O 1RDCA 3GDQA 1B9FA 5M1FA 3I55N 5GIPA 3M8SA 4H0PA 4HUEA 4OGCA 2FSJA 4ZTJA 2UXBK 2ASMA 2ASOA 3TARA 1Z25A 4Y1CA 2UUCK 1Y64A 2QKBA 1SL2A 3L2QA 3O8MA 1NGHA 1VSEA 3SJHA 1RDUA 2BE2A 2AA4A 3M1FA 3CG7A 3MEDA 1G99A 5JLHA 1HPZA 2D0CA 3SJJA 4UY8O 1NGFA 3L2RA 3LM9A 5CHIA 3OJUA 1W0HA 5JLFA 5LJWA 1C0GA 2IS3A 3KK1A 4EZ6A 4CGDA 2NRRA 1JJ2M 3WNEA 2HVIA 3FE1A 3MAQA 3O5BA 4CBWA 4DQSA 5HP1A 4B1ZA 3VEOA 2I5JA 4NO7A 4GV6A 1QVFM 5MLCQ 3L2VA 3ZSZA 5KQDA 4MO4A 2G8HA 1J6ZA 1U47A 4W5QA 1U6ZA 4JYAK 3PUFA 2NRXA 3NE6A 2F96A 4ELTA 3AAPA 3EEQA 3L6QA 1U45A 3VQAA 4OO1J 3KK7A 3V1QA 3LDOA 1BIUA 5AQPA 4FM1A 3THWB 4JKEA 3OHRA 4FJLA 4OX9K 1NGJA 1JCFA 2YCHA 1TYQA 1IG9A 3J8AA 5AQWA 3QFUA 3CCRN 1DGKN 2IAJA 3R3LA 3SYZA 1RBSA 1N36K 4OPKA 4M3RA 4Z4FA 2HHTA 1JL1A 1RT5A 2LSNA 3HZ6A 4HHTA 3CYMA 4H5TA 2P9LA 1JLFA 4CEZA 4DTUA 3WXKA 1BCMA 2IVOA 4KO0A 5AQYA 2QWQA 3IAYA 1S5JA 4YOXA 1CLQA 4JI2K 3SNNA 3AO4A 3HVTA 3VF2A 2HHVA 1SS6A 2HMPA 2ATQA 2BTFA 4YOYA 2OPSA 3ZT0A 5TKYA 4DF8A 1U48A 3THYB 2O8DB 1QHTA 4ICLA 3IDHA 4H8KA 3KTQA 1LWFA 4IBNA 3VN5A 3LWLA 3ZETB 4L8RB 2NRWA 2G8KA 1R59O 2HNZA 2QA4N 3WEEA 4LF9K 4DV2K 2NNWA 4PY5A 1YF5L 4AHTA 2D0PA 3C6HA 5IWAK 3L3VA 2P5GA 2KHOA 3CPEA 3QO9A 4JHDB 3CQ8A 3TAGA 1YVNA 1HUXA 4BE1A 4CK3A 3C0BA 1JL2A 3NH0A 1CXQA 2QKKA 1ATRA 3DAWA 4NCAA 3L4QA 4CHQA 3TTFA 2BH1A 1BI4B 1KFSA 3DLBA 5J2NA 3I8BA 3RMDA 4WE1A 3EO3A 4BRKA 4FJMA 1ESVA 4H0VB 2ZGYA 2P9UA 4WYBA 2ITMA 3OYFA 4PWDA 4FPBA 4H5VA 4FWQA 4DFPA 1IBLK 5HL7L 3BEXA 4KHPK 3NHGA 5CZ2A 3ZCMA 2A40A 4FLXA 3RTVA 1YVUA 3U6FA 4CD3A 5LMNK 2RHKA 3T1HK 2XY6A 3O9SA 4H0TB 1UWBA 4Z4GA 3KVGA 4HTUA 2P9KA 3BGRA 4ZHRA 2JLEA 3N4QA 4GVEA 4CGGA 4V19S 2A42A 3AGRA 3CQYA 1ILYA 1IKYA 3S9HA 3MXMA 4BY9C 4DTRA 4JKGA 2KW4A 4CHPA 4CF2A 4Y0WA 1KVCA 5KI6A 3V9SA 1YTUA 5E84A 2QK9A 1KTQA 4WFAL 3QBWA 4JKHA 3UKRB 3CC7N 3J7AP 3CCUN 5FPMA 5SZTA 2NRTA 1X9MA 2YHYA 1NKEA 4LH5A 2ASPA 3RWUA 4E1NA 2OZSA 3OBYA 2P9IB 3CCJN 2XY8A 4RCHA 3C94A 3KLGA 3TR8A 3U4LA 3MK6A 4B9NA 4WQ5C 3A0IX 1RDWX 3K5OA 5C42A 5HROA 4KHQA 3MEEA 3OS1A 2GTDA 5I42A 4Y1DA 3QETA 1E4GT 3VF6A 4FWOA 3I8DA 3ZSXA 3CJ9A 3O9QA 3ZSVA 3KK2A 1JKHA 3SPYA 2O8CB 2ZGZA 1OH5A 3HOTA 4F2SA 3OYHA 1VQNN 4Z4HA 4BE0A 3HK2A 1LOTB 4FW1A 2O8EB 4Q5VA 1JXEA 1MWKA 2E20A 2Q3SA 2ZWHA 1P90A 2ZJQL 3CCMN 2QI2A 3KKRA 3ZT2A 1QHAA 1YJWN 1NK0A 2QW9A 4BROA 3G6EN 4OGEA 1FK9A 3MN6A 4DF4A 3SUOA 4CFBA 3QFPA 4JAXA 5HRRA 4HUGA 5F1XA 3ZETA 2GELA 3RMBA 3RSEB 5E26A 1HJRA 4CE9A 4FJJA 2QWMA 1VQLN 1VRUA 4CIGA 1RT1A 4KHUA 2VCPA 3QICA 4DR3K 3KD5E 3O08A 1IJJA 4G1QA 2O8BB 4A5BA 4GKKK 3V4IA 1NOZA 4LF4K 4CEBA 5AQLA 3KWIA 3NF7A 3NAEA 1ZXOA 3V9ZA 5BR9A 3NBPA 3KLIA 1RBRA 3RVCA 3WT0A 2HBJA 4I6MA 1IKXA 1MA9B 1KVAA 3AVAA 1XHXA 3E66A 4F8RA 1XUPO 3ZSRA 1RDBA 1BI4A 1XMQK 3L4IA 3BF3A 4BG9A 2ZQBA 4E7JA 4ELUA 2RE2A 4C8OA 1NGIA 4PA1A 4M7YA 4CHZA 3MECA 3CPWM 1SKRA 3H08A 3AY9A 1Z05A 3LDPA 3MMVA 2P1JA 2OZMA 4CECA 3NDKA 1NMDA 4KH5A 4BRCA 3ULEB 2QXLA 4LF5K 4IJAA 3ID6A 3CFRA 5M1OA 1NJZA 2GUPA 4WQ5A 2EHGA 5AQSA 3H46O 4JK9A 2F8SA 4DTNA 4DG1A 1QQMA 3SUNA 3TAQA 4I9LA 4MDBA 3MCAB 3UKRA 3S3MA 2UUBK 5F2RA 4B3TK 4JI4K 4FZXC 3DLGA 1L3UA 3K57A 1BUPA 1YI2N 3VTHA 3NCIA 3AVLA 2Q1NA 4N41A 3NMUA 2Y1IA 2FXUA 4IEIA 3G0ZA 4X62K 4ISGA 3UKUA 5AQKA 5BREA 1GOCA 3OVNA 4NLBA 1WNSA 1VQ9N 1GOAA 4JV5K 4ILHA 4BDYA 2WFBA 3JAMO 4HCCA 3DRRA 1EO1A 3ENBA 2E88A 2E1ZA 3SQ1A 3VEYA 3OYCA 5HOOA 4H0OA 3K5LA 3R9PA 5JS2A 4KHSA 3QERA 2AJQA 3A5MC 2FSKA 4IO8A 3D45A 1RT3A 4FM2A 4FJ7A 3OBWA 3THXA 3SMSA 2CGJA 4H5WA 2O8EA 2OYQA 1ZBHA 1S1VA 3ZSOA 4AM6A 5AQOA 3HI0A 1VQ7N 1QVGM 5LL6Z 3DWLA 1SKWA 4H0XB 2YI1A 3HJFA 4B9LA 4JS5A 2YNIA 3VF4A 1RBVA 3AVKA 2HF4A 2V7YA 4KPYA 4FOEA 4FJXA 4IOAL 3V1OA 4DV1K 2B6AA 3VESA 4CFDA 4FO0A 1XMOK 4ELVA 1IKWA 4FVMA 2KLAA 3RMCA 2VWBA 3AV9A 3AVMA 1SL0A 4K8ZA 1HRHA 3U8XA 3GL1A 3WNFA 4AHVA 5E41A 1L5UA 4QS9A 4DSJA 1TGOA 4FLYA 4W5OA 2P9NA 5BRHA 1VSJA 4CK1A 1VRTA 4J2DA 1S6QA 3J7ZO 1M90O 4IO9L 1YJ9N 2ZJPL 3DOLA 3OY9A 3BP8A 1B9DA 1NMNA 2XO7A 1WSEA 4BRFA 3VGKA 3JSMA 3AO1A 2B4JA 1KAZA 2ZD1A 4DWIA 3W3DA 4DR2K 3DXMB 4DLGA 3HRGA 5SWMA 1J5OA 3OYEA 3E9OA 3TSQA 1XHZA 4BACA 3P31A 4BQZA 1QSSA 5FPNA 4JK7A 1FKOA 3P5JA 4FPAA 1OH7A 4RW7A 3I0SA 2W40A 4KH6A 3Q7BA 3OYGA 1HNVA 2P9SA 1IV0A 4CEFA 1JLCA 3V1RA 5GAGP 4BQLA 3TAMA 5AQIA 3ULEA 4CF8A 1MWMA 4E1MA 3MEGA 3S3NA 1DT9A 4OKKA 2OPPA 3W0LA 4BVOA 5AQJA 2HBKA 3KJVA 2NUBA 4LC9B 1RNHA 4JLHA 3D2FA 4OVLA 1Q18A 5AZIA 1ZBIA 3P39A 4MLHA 2HHQA 3VQDA 1VSLA 2CH5A 3FZLA 3T19A 4FWSA 4JI8K 2A5XA 5LMUK 3OS0A 4O0JA 1C0MA 5B8HA 4LH4A 4DQQA 1L3SA 3IRXA 4YOVA 3WUHA 1TUUA 1RT2A 5I9EB 3ZLJA 2O4IA 1KC8O 3FZHA 3F9MA 1BCOA 1HR0K 5AQHA 4PQUA 2D1KA 2YHAA 4QS8A 3ISNC 4BR7A 1D4XA 4YNQA 2P9KB 4UQGA 2PAVA 4BDZA 4FWKA 2QTDA 3SMPA 5T7BA 3H6EA 3MCPA 3MN9A 2EWSA 4JKGB 1REVA 3R6MA 4CK2A 2Y1JA 3P1GA 3TSPA 4QCLA 1TKZA 3CETA 3D2EA 4M3XA 4E7HA 4K8XA 3KKSA 2F4VK 3THVA 4R79A 1KAXA 2NRHA 5C25A 4DQRA 2QEXN 1I39A 4O5FA 3IKMA 4CZGA 3SCXA 2FF3B 3HP6A 2JGUA 3LL3A 1HYVA 1VSKA 3LAKA 3VEWA 3EY1A 4IXCA 4FJ8A 1N34K 1XC3A 2YJFA 1S72N 2DFFA 3OJSA 4XH1A 3MXIA 2GV9A 4BR2A 4DLEA 1ASWA 2IDOA 4NB4A 2HHUA 4KHWA 5CZ1A 2KKZA 4ISFA 3QIPA 1VSDA 3SUPA 1Q7YO 1CZBA 4B1YB 4CEOA 5KRTA 3KWGA 1EETA 4CW7B 2Q31A 1EP4A 1TKDA 1G15A 4G9ZA 1FJGK 5FPEA 4YDUA 4DV5K 3CCVN 3DOKA 1TL3A 3LP0A 1K9MO 1BG3A 4BE2A 4IWVA 4B9UA 1B92A 4O5BA 4M41A 3CM5A 5BRFA 5AQVA 2V7ZA 3TABA 3V9WA 4KREA 4GY2B 4M3UA 4FSVA 4B3RK 1RTJA 3EN9A 2IVPA 4DR4K 4DU1A 3DXMA 3AO2A 3ZT1A 3ZYYX 1NWKA 3A2FA 3H1VX 2HVHA 3T69A 1YHQN 4A5AA 3QEVA 2PFUA 4RWTA 4Z4IA 3E01A 2FSNA 1S1WA 4I2PA 4FWLA 3WNGA 1RFQA 4O8KA 5GIOA 1QS4A 1NM1A 3K5NA 1SUQA 2E5LK 4BRIA 3DXKA 4U67L 1L3VA 4KAZA 2VGMA 3DMJA 3ZX2A 3T3FA 4W5NA 3BF1A 3FFIA 3L8BA 3NH1A 3J7YP 4I6MB 4ID1A 4DQPA 2KFNA 3AVGA 1HLUA 1T03A 4DV7K 2A1SA 3KK3A 1X3NA 1CZ9A 4Z4CA 4YOWA 4QS7A 3PY8A 4J2EA 1NNEA 2VWJA 1YIJN 4DQ8A 4J2AA 4GKJK 1ZBSA 4EHUA 4DFMA 1GLLO 2QWNA 4FZZA 1HMVA 4M3YA 1HQUA 4HWIA 4KTWA 4A2AA 2YHXA 3AA5X 4ILGB 3CCQN 3O4NA 1EXQA 3MXJA 5FPDA 4BDPA 3VMFB 4QOZB 3PSIA 1RT7A 3V9XA 1VSIA 2YV0X 4IJNA 1OH8A 4XIUA 5C15A 3DLLL 3PLAA 5ADXH 3R1XA 2F7TA 3BY5A 4CESA 3F73A 4DS4A 4JI5K 4FM0A 4FVUA 4IDHA 3DLKA 1WSIA 4RG8A 1WSHA 2A1RA 1CZAN 4XH4A 4FWMA 4CJ7A 3IMXA 1TK5A 3VPZA 2G8UA 5DK5A 1HQEA 5CYQA 3WNHA 1T8EA 4W5RA 4XH5A 5AQXA 5HRNA 4B3MK 2BDPA 3EE9A 2NRZA 2D0AA 3C6TA 5JS1A 1ZBFA 4WF9L 1K73O 3CJAA 4EP5A 1U4BA 4CFAA 3VQ5A 4IG0A 1SKSA 3HM8A 1S9GA 4FWPA 4AILC 3EYZA 3CC4N 3U9ZA 2QWOA 3ZEUA 1FW6A 3CCLN 3UKUB 3SPZA 3ZT3A 5J1EA 4DCHA 2DTUA 2OANA 5JICA 3OYKA 4KRFA 2G8WA 5KRSA 2RN2A 3HSCA 4PL8A 4O4GA 1QZ5A 4OPAA 4CJQA 4FJHA 3AVJA 3T7ZA 3O4WA 3VETA 3KHYA 4O44A 1EX4A 3DM2A 3PO4A 2KTQA 2UXDK 1T6CA 1L3TA 3THXB 4M7XA 4JK8A 2G8VA 1NJXA 1ITGA 1NK9A 1KD1O 1KAYA 2GX9A 3HL8A 3O9UA 3M6GA 3ZSQA 2A41A 4CJ5A 1XI1A 3QMLA 3ALYA 4LF8K 4JRQA 1NKCA 4CJUA 2UUAK 3QNNA 3CM6A 5AR0A 2ETJA 1RCHA 3VTIA 4PL7A 4DUZK 4FLZA 2HBLA 3TTDA 3SQ0A 4DTOA 4DKWA 1KLMA 1YT3A 3SV4A 3EKUA 4KI4A 3K5MA 1WBDA 4LF7K 1WBBA 3U9DA 3TAFA 1RGIA 3AA2A 1J9AA 1KSPA 5C12A 4PUOA 2E2PA 3CQXA 4DR6K 1LAVA 4DU3A 3ATVA 2P9NB 3E1YA 4KV8A 5C24A 1IG8A 4NXNK 2Q97A 5EOYA 3PX4A 2ZF5O 1I3AA 4LD0A 1Q8IA 3A5LC 3M3ZA 4IEEA 5AQZA 4XEIA 2KZMA 2YNFA 3K59A 4CZMA 4IKFA 5BRDA 2FBXA 1LCUA 3OYBA 4DFKA 3VQ9A 4CCHA 1OVYA 4CZFA 2FLOA 4DTXA 1VQPN 2D4WA 1ATNA 4WQ4A 2ZE2A 4OJRA 5C2DA 4OPHA 5EY4A 3SQ2A 2XY7A 4FJ5A 4FK4A 3OS2A 4BRDA 2VG6A 2P9SB 3R8EA 3LANA 1HKBA 3HYFA 4AQYK 3DLHA 1QQOA 3P38A 4K41A 2E6MA 3LWMA 4TSXA 2E1YA 1BDGA 1VQON 2PZSA 3B6PA 3LZIA 3QIOA 4MLEA 5HLFA 4GV3A 3TANA 3DRSA 4PKIA 1HNXK 5AFUA 3V6DA 2Q36A 5I3UA 3EZ5A 3D2FB 1W97L 5AZIB 4KKOA 1X9SA 1BQMA 2IOCA 3ITHA 2X6NA 3BDPA 2A6AA 2P5OA 3SAGA 4LY7A 3KLEA 2F8TA 1LAWA 1JLQA 3HVRA 4EZ9A 5J2QA 1VSFA 1RTHA 3WXMB 1U2VA 4QAGA 2WOMA 4DR7K 4DHYA 5EVZA 4YOTA 4CERA 3MN7A 1GLAG 3LDQA 3QEPA 4JKBA 1BQNA 1EWRA 4BRPA 4WFNL 1GLDG 2E4LA 1NGDA 4CZIA 4H4MA 5A2QO 5AQFA 2E6LA 4BRQA 2YHWA 4HCBA 5GAHP 4CJWA 3OYLA 4IFVA 2F9TA 4KHYA 4J8FA 2F9WA 1C1BA 5CR4A 5JVHL 4CJFA 3AA4A 4DV3K 2QXFA 3D2EB 3VQEA 3ZX3A 2HNDA 2O4GA 4FLVA 3NGYA 1YJNN 4DU4A 3SQ4A 1KLNA 5KQ8A 4CFCA 4BG8A 3VOVA 4CZEA 2YJEA 2QWLA 4DQIA 3OYIA 5DM7L 1RTIA 4N47A 3RMAA 1GLCG 3IFRA 1ZYQA 4GV9A 1BGXT 4IFYA 4FLWA 3D7EO 2E2QA 1RDDA 2O8FA 4A2BA 4CBUA 1WAFA 4OKEA 2VWKA 1WOQA 4FJ9A 1J5EK 5J2MA 3AVCA 1YTAA 2HNYA 3SZ2A 4BC5A 4KFBA 3G10A 4CIEA 3O3FA 4CVNE 4CJTA 1BIZA 4E7IA 3NH2A 3M8RA 2JWKA 4CZHA 5AQRA 1T44A 1TV6A 4RW8A 1RDAA 3EZWA 5FDLA 3VQQA 3LDNA 4H5RA 5CE3A 3MN5A 3NVKA 5JVGL 3D0PA 1EWQA 4MFBA 4B8CA 4BC3A 4FLUA 3VEVA 1HKGA 1N5YA 3BUZB 2WONA 1SQKA 1UOCA 4YY3K 4E1JA 4HUFA 4DV6K 1TKTA 4A57A 4CF0A 3FZKA 3F5TA 4FOIA 3LDSA 2DY4A 1NGEA 3N4PA 1N8RO 2HF3A 5M1NA 3FR0A 1T7PA 1HPMA 3LALA 2XY5A 3KIOA 1JLEA 4CGIA 1X1PA 4ISEA 1Q81O 4R5PA 3SAFA 1X9WA 2ZM6K 2W6LA 3OYMA 1N33K 4FYDA 3GG4A 1QTMA 2VYPA 4FXDA 1S1TA 3QDKA 5F0XA 2D0BA 3VEXA 3IG1A 4CJKA 3OYNA 3O4QA 4C8MA 3S41A 1NGAA 4YDUC 2B5JA 2DFHA 3OYAA 4AHRA 2FF6A 3U3YA 4EFHA 4BGAA 3S3OA 1LW0A 1A5WA 2CH6A 4OLAA 4BRGA 3DXKB 4O0IA 4JI1K 1IKVA 5GAEP 3H3OB 3O9RA 1KFDA 5DMRA 4A62A 3SI6A 1VQ4N 4BR5A 3O9TA 4E89A 4NCBA 4KTZA 3RRGA 3HOSA 4B1UB 4ILJA 4JI6K 4JI3K 2OPQA 2X6SA 2UYTA 1OVQA 2CGKA 2Z1IA 4B9TA 2RF2A 1VQMN 2HBMA 1R0AA 4KHNA 3SK3A 4E19A 3QESA 2P9PB 1NBWA 3C7NB 3WXIA 2DPNA 1D5AA 3GBTA 3L2WA 3EKSA 2W41A 4IFEA 2FC0A 1KXPA 3HP9A 4CJLA 1VSHA 2Q0RA 5AFUH 1NLVA 4DB3A 3KZBA 5ADXA 1QSLA 1V4SA 4OKJA 3AVHA 3ENOA 2OA8A 3CHWA 4B08A 4JN4A 4M3WA 1EKEA 2G8FA 3LP3A 3FZFA 4B9SA 4C1NI 2E8AA 4WCEL 5H1SQ 3CJ1A 3A8YA 1HYZA 1YUWA 2H3GX 2KZZA 4DTSA 2WBNA 4BRAA 3VQ8A 4FK2A 1I94K 4OPJA 4FWNA 1KCFA 4L3QA 4H03B 3O3GA 5DM6L 1FKPA 3VA3A 3QLHA 2PYLA 3B8AX 2FBTA 5EX5A 3A5NC 4PKGA 1WSGA 1F21A 2HSTA 1YXQA 3B6OA 1EQYA 3Q7CA 1C1AA 1Z6RA 1RBTA 4CD1A 2WC9A 3HPOA 3L2UA 4JNEA 4E7KA 1GLFO 1GLJO 5BR8K 2VG5A 1QQNA 5KGWA 3TPQA 4BRNA 1Z26A 1HNZK 4CJ3A 3ZEUB 1K8AO 3MX2A 3NGZA 1BA1A 1KVBA 3DRPA 3L0QA 2QWPA 4B1VA 4LSLA 4I9QA 4N76A 2AP1A 4GVMA 4CHOA 4LFBK 1RBUA 4BWMA 3VQ6A 5EXWA 3PV8A 1S22A 4BVPA 2HOEA 3MX5A 1WAJA 2W42A 1MDUB 1P8ZA 2PBDA 4NYFA 5HRPA 1WLJA 2NLXA 3G71N 3HXMA 3VGMA 3G4SN 3QB0A 5BN9A 5BPLA 3I56N 4C8LA 1NK8A 3LP2A 2KFZA 3E9LA 4JS4A 3NF8A 1S1UA 5IT9O 1E3MA 4B9VA 4IOCL 2X78A 1O1WA 3IUCA 1XNQK 2YX6A 3AAQA 5M1KA 1XQSC 1UA0A 1NU0A 3HPHA 1LWCA 3TWHA 4JKAA 4BRHA 4Q0BA 4AHSA 4BWJA 4FCYA 2XRIA 4NYNA 3VQBA 1BU6O 1SV5A 2KQ2A 3D6RA 4H5NA 4CGHA 1NGBA 5FLXO 4BGBA 3CFOA 2BUPA 4DR5K 4DMNA 3CJBA 4Z4EA 3J80O 4CEDA 4NLCA 1VHXA 3CIPA 4U7BA 2UU9K 4BR0A 1X9JA 3F9KA 4K42A 3SUQA 4BRMA 2HHHK 5KPZA 5AQQA 3IS9A 5KPRA 4O8UA 1JLAA 3WQUA 2FBVA 4FJGA 4MQ3A 4YORA 2HMIA 3U3GA 5K14A 1W2BM 2G8IA 1IH7A 1NJYA 2P9PA 1KQSM 5KTQA 2X74A 3C7NA 3AO5A 2Z1HA 4KBOA 3LDLA 1HNIA 2P51A 3QINA 4FZYA 3VQPA 1ASVA 4HTLA 5TKWA 4CI6A 4BC2A 4KI6A 4MDAA 3J81O 1K8KA 4JRPA 4DUYK 1Q86O 4B3OA 4C8NA 1VQ5N 4AH9A 1N32K 1O13A 3PIOL 1BHLA 5CY4A 3M8PA 4CEQA 3I0RA 1KRPA 2YKMA 1NK4A 4IDKA 4WQ4C 4CHYA 1IBMK 4M45A 3SAHA 2UXCK 2IC3A 4DV0K 1UA1A 1DEJA 1WSJA 3E9PA 5LJVA 2JWLA 3LM2A 5AZJB 3ULDA 4DSLA 1U2VB 4EHTA 1VSMA 1SAZA 3AVNA 4FW2A 4EAHD 4B1WB 4DSEA 4K0KK 1C0TA 1IBKK 2VG7A 4NCGA 5HBMA 2HW3A 3AVBA 1FXXA 2CGLA 2HHXA 4CEAA 1A5VA 2VQEK 1VK0A 3O3HA 1JCEA 4OLBA 3TAPA 1VQ6N 4RTFD 1C0UA 4DSIA 3RR8A 3AA3A 5C2FA 1WSFA 5GADP 3AARA 1U49A 3QEWA 1TKXA 2WTUA 3CC2N 2ITGA 3GE1A 4H4OA 3VEZA 1NOYA 3C95A 1S3XA 1V4TA 2HHWA 1HKCA 2ZJRL 4I2QA 2FBYA 2IVNA 4AF1A 2OCEA 4CZJA 4GMJB 4MO5A 4KB0A 3PO5A 3SLCA 2O8FB 1NGCA 4FJIA 3LPUA 4PKHA 4JD2B 3THWA 4K25A 4CZKA 4I7FA 4N56A 3OYDA 3VQ4A 3A5OC 3ATUA 5AQNA 3H3NO 1TUYA 3O1WA 3SBTA 5BN8A
chains in the Genus database with same CATH topology
4DV5K 4NXNK 2UUCK 4JI1K 4DV3K 4LFCK 4NXMK 5LL6Z 3J81O 4LF9K 4DV2K 4LFBK 4DUYK 4JI8K 3T1YK 5LMUK 1N32K 4B3MK 4JI6K 4JI3K 4B3RK 5IWAK 4X64K 4DR4K 1HR0K 4DV1K 1IBMK 1XMOK 2UXCK 2VQFK 1J5EK 4DV0K 4LF5K 4YHHK 5AJ3K 4JI7K 5IT9O 4CVNE 4JYAK 1XNQK 2E5LK 3OTOK 4B3SK 4X66K 1HNWK 4JI0K 4AQYK 4K0KK 2F4VK 1IBKK 1XNRK 1IBLK 2UUBK 4KHPK 2VQEK 4B3TK 3J7YP 4JI4K 4DR1K 4OX9K 1HNXK 2UXDK 4LFAK 4DR2K 1I94K 5FLXO 4YY3K 4DV4K 5LMNK 4DV6K 4DV7K 4DR5K 3T1HK 1N34K 3J80O 1N36K 2UU9K 4X62K 4V19S 4GKJK 4DR3K 4LF8K 2HHHK 2UUAK 2ZM6K 4GKKK 4JV5K 1N33K 4DR7K 3JAMO 4LF4K 4DUZK 4LF6K 4JI2K 5BR8K 3J7AP 4LF7K 5A2QO 4X65K 1HNZK 4CW7B 4DR6K 4JI5K 1FJGK 1XMQK 2UXBK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 K;  4NXN K;  2UUC K;  4JI1 K;  4DV3 K;  4LFC K;  4NXM K;  5LL6 Z;  3J81 O;  4LF9 K;  4DV2 K;  4LFB K;  4DUY K;  4JI8 K;  3T1Y K;  5LMU K;  1N32 K;  4B3M K;  4JI6 K;  4JI3 K;  4B3R K;  5IWA K;  4X64 K;  4DR4 K;  1HR0 K;  4DV1 K;  1IBM K;  1XMO K;  2UXC K;  2VQF K;  1J5E K;  4DV0 K;  4LF5 K;  4YHH K;  5AJ3 K;  4JI7 K;  5IT9 O;  4CVN E;  4JYA K;  1XNQ K;  2E5L K;  3OTO K;  4B3S K;  4X66 K;  1HNW K;  4JI0 K;  4AQY K;  4K0K K;  2F4V K;  1IBK K;  1XNR K;  1IBL K;  2UUB K;  4KHP K;  2VQE K;  4B3T K;  3J7Y P;  4JI4 K;  4DR1 K;  4OX9 K;  1HNX K;  2UXD K;  4LFA K;  4DR2 K;  1I94 K;  5FLX O;  4YY3 K;  4DV4 K;  5LMN K;  4DV6 K;  4DV7 K;  4DR5 K;  3T1H K;  1N34 K;  3J80 O;  1N36 K;  2UU9 K;  4X62 K;  4V19 S;  4GKJ K;  4DR3 K;  4LF8 K;  2HHH K;  2UUA K;  2ZM6 K;  4GKK K;  4JV5 K;  1N33 K;  4DR7 K;  3JAM O;  4LF4 K;  4DUZ K;  4LF6 K;  4JI2 K;  5BR8 K;  3J7A P;  4LF7 K;  5A2Q O;  4X65 K;  1HNZ K;  4CW7 B;  4DR6 K;  4JI5 K;  1FJG K;  1XMQ K;  2UXB K; 
#chains in the Genus database with same CATH topology
 3TSU A;  4M63 C;  3VA0 A;  3M5R A;  4C8K A;  4E7L A;  5BPM A;  1GOB A;  5ELZ A;  1QQC A;  1OH6 A;  4JKF A;  5FRM A;  3O80 A;  4FK0 A;  2E2O A;  2DFE A;  3K0S A;  4YOU A;  2GEM A;  4FJK A;  1ZC6 A;  3CD6 N;  1ZBL A;  1DKG D;  2V51 B;  1OKJ A;  2RPI A;  3DYA A;  4JKD A;  4CGJ A;  2D0O A;  4X64 K;  4CF1 A;  3CER A;  1TK8 A;  1QE1 A;  3LAM A;  3NVM A;  4CGF A;  3TU5 A;  4BR9 A;  1WB9 A;  1NK6 A;  4CJV A;  5M1P A;  4J2B A;  3GOI A;  3THY A;  2O8D A;  3NFA A;  1RTD A;  2W6K A;  3KLH A;  1HX1 A;  4AHU A;  2GBZ A;  4JI7 K;  4RW4 A;  3PIP L;  5HRS A;  3H45 C;  4DTJ A;  4C23 A;  2PY5 A;  4IOX A;  3WXL A;  2YNH A;  3L3U A;  4DFJ A;  1CXU A;  1K6Y A;  4JI0 K;  4F3O A;  1VQ8 N;  1QSY A;  1S1X A;  3VER A;  3CJC A;  1BIS A;  3DLE A;  1WN7 A;  3OW2 M;  1M1K O;  3TAE A;  4CJS A;  3EE8 A;  1NJI O;  4DR1 K;  1J53 A;  1DTT A;  3LPT A;  3CXC M;  4CEE A;  3KLF A;  4LFA K;  5D3G A;  3ZT4 A;  4M3T A;  4JHD A;  5AQG A;  2XHB A;  4DV4 K;  1T6D A;  3DLR A;  1NGG A;  3UB5 A;  4F3T A;  2YNG A;  4CJR A;  5C10 A;  3CJ7 A;  1BO5 O;  3PX6 A;  5BPN A;  4DSK A;  3MWT A;  5EU7 A;  3V9U A;  5AQT A;  1N6Q A;  4CIF A;  4W5T A;  3OA9 A;  1MU2 A;  3AGK A;  3WXJ A;  3CME N;  1TVR A;  1WUA A;  1DLO A;  4AHC A;  4LF6 K;  3RRH A;  1HYS A;  4HVJ A;  1T05 A;  2YKN A;  1HJO A;  2IIR A;  4ID5 A;  1T3V A;  3ASM A;  4A59 A;  4KB1 A;  4FL9 A;  3BZC A;  4JEP A;  1JCG A;  3HO1 A;  3SV3 A;  4Z94 A;  1SL1 A;  5C0Y A;  3JYT A;  4E0D A;  1YAG A;  5J2P A;  1C6V A;  5AZJ A;  1BWF O;  4LFC K;  4NXM K;  1W9H A;  3FLC O;  3HM9 A;  1IO2 A;  2I7N A;  3SBG A;  3QEX A;  3NF6 A;  4Z0U A;  1VQK N;  3WQT A;  3CMA N;  5FRN A;  4B8A B;  4A61 A;  1VAZ A;  3AO3 A;  1J54 A;  3NF9 A;  3DJC A;  3C6A A;  2V52 B;  2YHB A;  3LP1 A;  3HPG A;  4F4K A;  4DS5 A;  1W7A A;  3K2P A;  4KTQ A;  1NJW A;  2D5R A;  5M1Q A;  3JS6 A;  4YHH K;  1D9F A;  5AJ3 K;  1XWL A;  4JKC A;  3H1Q A;  3DI6 A;  1LW2 A;  5GIN A;  3KD1 E;  1JLB A;  3P83 D;  2P9I A;  3ID8 A;  4CJ4 A;  1ASU A;  4EIA A;  3ZSW A;  4FJN A;  4X66 K;  4H0Y B;  1TL1 A;  2OTJ N;  1TAU A;  4CZL A;  4RW9 A;  3O6W A;  5AQU A;  5JMV A;  1LV5 A;  2RKI A;  2WUS A;  1Q9X A;  3QEI A;  4JD2 A;  3TTC A;  4CBX A;  4F9O A;  4FLT A;  5LY3 A;  1UAX A;  1NG9 A;  2Z1G A;  2O8C A;  3CF5 L;  4O55 A;  1YIT N;  3PSF A;  3K58 A;  4M3Z A;  1JXB A;  1S6P A;  4B1X B;  1XC9 A;  2Z1J A;  5KGX A;  3P4I A;  4PHT X;  3K9J A;  3CCE N;  1BA0 A;  4DTP A;  4B9M A;  2EX3 A;  3CCS N;  4KH4 A;  2PYJ A;  1RT4 A;  1NK7 A;  3C6U A;  3VGL A;  3PX0 A;  2GUI A;  5CYM A;  4E3S A;  1LWE A;  4CF9 A;  3FFK B;  1C0F A;  3LZJ A;  1NKB A;  3CI5 A;  4DSF A;  2Q0U A;  1BOT O;  4DTM A;  1TYQ B;  4IG3 A;  4X65 K;  4FWR A;  4CJP A;  3I33 A;  5FRO A;  1H1V A;  3UE5 A;  2HHS A;  2BAN A;  3ZX0 A;  4BR4 A;  3HBT A;  3RSE A;  3RR7 A;  3UIQ A;  1GLE G;  3FGU A;  4B9Q A;  3V81 A;  2HB5 A;  1QZ6 A;  1GLB G;  1TK0 A;  2P9L B;  3T1Y K;  4F2R A;  2E2N A;  3QNO A;  3G25 A;  4M42 A;  2O8B A;  2A3Z A;  3ENH A;  3T1A A;  3VEN A;  4IZ9 A;  2I7P A;  3F2K A;  2OTL N;  3M8Q A;  5AQM A;  4YFU A;  2QWR A;  2VQF K;  3HT3 A;  3MDQ A;  3VQ7 A;  5KPT A;  2NRV A;  4C1N K;  3EL2 A;  1BL3 A;  3NGI A;  1NK5 A;  1D8Y A;  1TAQ A;  3OTO K;  4B3S K;  3ZSY A;  3WEE B;  1HNW K;  1A5X A;  3AVF A;  2GWK A;  3K9K A;  2NZT A;  4N5S A;  1XNR K;  1ATS A;  2OPR A;  4ZTF A;  4GNI A;  3BZK A;  4AM7 A;  1Y97 A;  3HST B;  2Q2R A;  3HTV A;  4EP4 A;  1X3M A;  1ZBU A;  3FZM A;  2J4R A;  1C1C A;  1RT6 A;  2R7Y A;  3VQC A;  4WFB L;  3AVI A;  1K8K B;  1D9D A;  1DTQ A;  3JXU A;  1E4F T;  3QBX A;  4CHN A;  1Q9Y A;  3OYJ A;  2BGG A;  3CFP A;  4BC4 A;  2IGI A;  3O1B A;  2GWJ A;  4CJE A;  2P9U B;  1U04 A;  4BRE A;  3MWP A;  2QM1 A;  3TI0 A;  4LSN A;  4BRL A;  1S9E A;  4GW6 A;  1SZ2 A;  2VGN A;  1JLG A;  4RW6 A;  1RIL A;  4K43 A;  3C65 A;  1Q82 O;  1RDC A;  3GDQ A;  1B9F A;  5M1F A;  3I55 N;  5GIP A;  3M8S A;  4H0P A;  4HUE A;  4OGC A;  2FSJ A;  4ZTJ A;  2UXB K;  2ASM A;  2ASO A;  3TAR A;  1Z25 A;  4Y1C A;  2UUC K;  1Y64 A;  2QKB A;  1SL2 A;  3L2Q A;  3O8M A;  1NGH A;  1VSE A;  3SJH A;  1RDU A;  2BE2 A;  2AA4 A;  3M1F A;  3CG7 A;  3MED A;  1G99 A;  5JLH A;  1HPZ A;  2D0C A;  3SJJ A;  4UY8 O;  1NGF A;  3L2R A;  3LM9 A;  5CHI A;  3OJU A;  1W0H A;  5JLF A;  5LJW A;  1C0G A;  2IS3 A;  3KK1 A;  4EZ6 A;  4CGD A;  2NRR A;  1JJ2 M;  3WNE A;  2HVI A;  3FE1 A;  3MAQ A;  3O5B A;  4CBW A;  4DQS A;  5HP1 A;  4B1Z A;  3VEO A;  2I5J A;  4NO7 A;  4GV6 A;  1QVF M;  5MLC Q;  3L2V A;  3ZSZ A;  5KQD A;  4MO4 A;  2G8H A;  1J6Z A;  1U47 A;  4W5Q A;  1U6Z A;  4JYA K;  3PUF A;  2NRX A;  3NE6 A;  2F96 A;  4ELT A;  3AAP A;  3EEQ A;  3L6Q A;  1U45 A;  3VQA A;  4OO1 J;  3KK7 A;  3V1Q A;  3LDO A;  1BIU A;  5AQP A;  4FM1 A;  3THW B;  4JKE A;  3OHR A;  4FJL A;  4OX9 K;  1NGJ A;  1JCF A;  2YCH A;  1TYQ A;  1IG9 A;  3J8A A;  5AQW A;  3QFU A;  3CCR N;  1DGK N;  2IAJ A;  3R3L A;  3SYZ A;  1RBS A;  1N36 K;  4OPK A;  4M3R A;  4Z4F A;  2HHT A;  1JL1 A;  1RT5 A;  2LSN A;  3HZ6 A;  4HHT A;  3CYM A;  4H5T A;  2P9L A;  1JLF A;  4CEZ A;  4DTU A;  3WXK A;  1BCM A;  2IVO A;  4KO0 A;  5AQY A;  2QWQ A;  3IAY A;  1S5J A;  4YOX A;  1CLQ A;  4JI2 K;  3SNN A;  3AO4 A;  3HVT A;  3VF2 A;  2HHV A;  1SS6 A;  2HMP A;  2ATQ A;  2BTF A;  4YOY A;  2OPS A;  3ZT0 A;  5TKY A;  4DF8 A;  1U48 A;  3THY B;  2O8D B;  1QHT A;  4ICL A;  3IDH A;  4H8K A;  3KTQ A;  1LWF A;  4IBN A;  3VN5 A;  3LWL A;  3ZET B;  4L8R B;  2NRW A;  2G8K A;  1R59 O;  2HNZ A;  2QA4 N;  3WEE A;  4LF9 K;  4DV2 K;  2NNW A;  4PY5 A;  1YF5 L;  4AHT A;  2D0P A;  3C6H A;  5IWA K;  3L3V A;  2P5G A;  2KHO A;  3CPE A;  3QO9 A;  4JHD B;  3CQ8 A;  3TAG A;  1YVN A;  1HUX A;  4BE1 A;  4CK3 A;  3C0B A;  1JL2 A;  3NH0 A;  1CXQ A;  2QKK A;  1ATR A;  3DAW A;  4NCA A;  3L4Q A;  4CHQ A;  3TTF A;  2BH1 A;  1BI4 B;  1KFS A;  3DLB A;  5J2N A;  3I8B A;  3RMD A;  4WE1 A;  3EO3 A;  4BRK A;  4FJM A;  1ESV A;  4H0V B;  2ZGY A;  2P9U A;  4WYB A;  2ITM A;  3OYF A;  4PWD A;  4FPB A;  4H5V A;  4FWQ A;  4DFP A;  1IBL K;  5HL7 L;  3BEX A;  4KHP K;  3NHG A;  5CZ2 A;  3ZCM A;  2A40 A;  4FLX A;  3RTV A;  1YVU A;  3U6F A;  4CD3 A;  5LMN K;  2RHK A;  3T1H K;  2XY6 A;  3O9S A;  4H0T B;  1UWB A;  4Z4G A;  3KVG A;  4HTU A;  2P9K A;  3BGR A;  4ZHR A;  2JLE A;  3N4Q A;  4GVE A;  4CGG A;  4V19 S;  2A42 A;  3AGR A;  3CQY A;  1ILY A;  1IKY A;  3S9H A;  3MXM A;  4BY9 C;  4DTR A;  4JKG A;  2KW4 A;  4CHP A;  4CF2 A;  4Y0W A;  1KVC A;  5KI6 A;  3V9S A;  1YTU A;  5E84 A;  2QK9 A;  1KTQ A;  4WFA L;  3QBW A;  4JKH A;  3UKR B;  3CC7 N;  3J7A P;  3CCU N;  5FPM A;  5SZT A;  2NRT A;  1X9M A;  2YHY A;  1NKE A;  4LH5 A;  2ASP A;  3RWU A;  4E1N A;  2OZS A;  3OBY A;  2P9I B;  3CCJ N;  2XY8 A;  4RCH A;  3C94 A;  3KLG A;  3TR8 A;  3U4L A;  3MK6 A;  4B9N A;  4WQ5 C;  3A0I X;  1RDW X;  3K5O A;  5C42 A;  5HRO A;  4KHQ A;  3MEE A;  3OS1 A;  2GTD A;  5I42 A;  4Y1D A;  3QET A;  1E4G T;  3VF6 A;  4FWO A;  3I8D A;  3ZSX A;  3CJ9 A;  3O9Q A;  3ZSV A;  3KK2 A;  1JKH A;  3SPY A;  2O8C B;  2ZGZ A;  1OH5 A;  3HOT A;  4F2S A;  3OYH A;  1VQN N;  4Z4H A;  4BE0 A;  3HK2 A;  1LOT B;  4FW1 A;  2O8E B;  4Q5V A;  1JXE A;  1MWK A;  2E20 A;  2Q3S A;  2ZWH A;  1P90 A;  2ZJQ L;  3CCM N;  2QI2 A;  3KKR A;  3ZT2 A;  1QHA A;  1YJW N;  1NK0 A;  2QW9 A;  4BRO A;  3G6E N;  4OGE A;  1FK9 A;  3MN6 A;  4DF4 A;  3SUO A;  4CFB A;  3QFP A;  4JAX A;  5HRR A;  4HUG A;  5F1X A;  3ZET A;  2GEL A;  3RMB A;  3RSE B;  5E26 A;  1HJR A;  4CE9 A;  4FJJ A;  2QWM A;  1VQL N;  1VRU A;  4CIG A;  1RT1 A;  4KHU A;  2VCP A;  3QIC A;  4DR3 K;  3KD5 E;  3O08 A;  1IJJ A;  4G1Q A;  2O8B B;  4A5B A;  4GKK K;  3V4I A;  1NOZ A;  4LF4 K;  4CEB A;  5AQL A;  3KWI A;  3NF7 A;  3NAE A;  1ZXO A;  3V9Z A;  5BR9 A;  3NBP A;  3KLI A;  1RBR A;  3RVC A;  3WT0 A;  2HBJ A;  4I6M A;  1IKX A;  1MA9 B;  1KVA A;  3AVA A;  1XHX A;  3E66 A;  4F8R A;  1XUP O;  3ZSR A;  1RDB A;  1BI4 A;  1XMQ K;  3L4I A;  3BF3 A;  4BG9 A;  2ZQB A;  4E7J A;  4ELU A;  2RE2 A;  4C8O A;  1NGI A;  4PA1 A;  4M7Y A;  4CHZ A;  3MEC A;  3CPW M;  1SKR A;  3H08 A;  3AY9 A;  1Z05 A;  3LDP A;  3MMV A;  2P1J A;  2OZM A;  4CEC A;  3NDK A;  1NMD A;  4KH5 A;  4BRC A;  3ULE B;  2QXL A;  4LF5 K;  4IJA A;  3ID6 A;  3CFR A;  5M1O A;  1NJZ A;  2GUP A;  4WQ5 A;  2EHG A;  5AQS A;  3H46 O;  4JK9 A;  2F8S A;  4DTN A;  4DG1 A;  1QQM A;  3SUN A;  3TAQ A;  4I9L A;  4MDB A;  3MCA B;  3UKR A;  3S3M A;  2UUB K;  5F2R A;  4B3T K;  4JI4 K;  4FZX C;  3DLG A;  1L3U A;  3K57 A;  1BUP A;  1YI2 N;  3VTH A;  3NCI A;  3AVL A;  2Q1N A;  4N41 A;  3NMU A;  2Y1I A;  2FXU A;  4IEI A;  3G0Z A;  4X62 K;  4ISG A;  3UKU A;  5AQK A;  5BRE A;  1GOC A;  3OVN A;  4NLB A;  1WNS A;  1VQ9 N;  1GOA A;  4JV5 K;  4ILH A;  4BDY A;  2WFB A;  3JAM O;  4HCC A;  3DRR A;  1EO1 A;  3ENB A;  2E88 A;  2E1Z A;  3SQ1 A;  3VEY A;  3OYC A;  5HOO A;  4H0O A;  3K5L A;  3R9P A;  5JS2 A;  4KHS A;  3QER A;  2AJQ A;  3A5M C;  2FSK A;  4IO8 A;  3D45 A;  1RT3 A;  4FM2 A;  4FJ7 A;  3OBW A;  3THX A;  3SMS A;  2CGJ A;  4H5W A;  2O8E A;  2OYQ A;  1ZBH A;  1S1V A;  3ZSO A;  4AM6 A;  5AQO A;  3HI0 A;  1VQ7 N;  1QVG M;  5LL6 Z;  3DWL A;  1SKW A;  4H0X B;  2YI1 A;  3HJF A;  4B9L A;  4JS5 A;  2YNI A;  3VF4 A;  1RBV A;  3AVK A;  2HF4 A;  2V7Y A;  4KPY A;  4FOE A;  4FJX A;  4IOA L;  3V1O A;  4DV1 K;  2B6A A;  3VES A;  4CFD A;  4FO0 A;  1XMO K;  4ELV A;  1IKW A;  4FVM A;  2KLA A;  3RMC A;  2VWB A;  3AV9 A;  3AVM A;  1SL0 A;  4K8Z A;  1HRH A;  3U8X A;  3GL1 A;  3WNF A;  4AHV A;  5E41 A;  1L5U A;  4QS9 A;  4DSJ A;  1TGO A;  4FLY A;  4W5O A;  2P9N A;  5BRH A;  1VSJ A;  4CK1 A;  1VRT A;  4J2D A;  1S6Q A;  3J7Z O;  1M90 O;  4IO9 L;  1YJ9 N;  2ZJP L;  3DOL A;  3OY9 A;  3BP8 A;  1B9D A;  1NMN A;  2XO7 A;  1WSE A;  4BRF A;  3VGK A;  3JSM A;  3AO1 A;  2B4J A;  1KAZ A;  2ZD1 A;  4DWI A;  3W3D A;  4DR2 K;  3DXM B;  4DLG A;  3HRG A;  5SWM A;  1J5O A;  3OYE A;  3E9O A;  3TSQ A;  1XHZ A;  4BAC A;  3P31 A;  4BQZ A;  1QSS A;  5FPN A;  4JK7 A;  1FKO A;  3P5J A;  4FPA A;  1OH7 A;  4RW7 A;  3I0S A;  2W40 A;  4KH6 A;  3Q7B A;  3OYG A;  1HNV A;  2P9S A;  1IV0 A;  4CEF A;  1JLC A;  3V1R A;  5GAG P;  4BQL A;  3TAM A;  5AQI A;  3ULE A;  4CF8 A;  1MWM A;  4E1M A;  3MEG A;  3S3N A;  1DT9 A;  4OKK A;  2OPP A;  3W0L A;  4BVO A;  5AQJ A;  2HBK A;  3KJV A;  2NUB A;  4LC9 B;  1RNH A;  4JLH A;  3D2F A;  4OVL A;  1Q18 A;  5AZI A;  1ZBI A;  3P39 A;  4MLH A;  2HHQ A;  3VQD A;  1VSL A;  2CH5 A;  3FZL A;  3T19 A;  4FWS A;  4JI8 K;  2A5X A;  5LMU K;  3OS0 A;  4O0J A;  1C0M A;  5B8H A;  4LH4 A;  4DQQ A;  1L3S A;  3IRX A;  4YOV A;  3WUH A;  1TUU A;  1RT2 A;  5I9E B;  3ZLJ A;  2O4I A;  1KC8 O;  3FZH A;  3F9M A;  1BCO A;  1HR0 K;  5AQH A;  4PQU A;  2D1K A;  2YHA A;  4QS8 A;  3ISN C;  4BR7 A;  1D4X A;  4YNQ A;  2P9K B;  4UQG A;  2PAV A;  4BDZ A;  4FWK A;  2QTD A;  3SMP A;  5T7B A;  3H6E A;  3MCP A;  3MN9 A;  2EWS A;  4JKG B;  1REV A;  3R6M A;  4CK2 A;  2Y1J A;  3P1G A;  3TSP A;  4QCL A;  1TKZ A;  3CET A;  3D2E A;  4M3X A;  4E7H A;  4K8X A;  3KKS A;  2F4V K;  3THV A;  4R79 A;  1KAX A;  2NRH A;  5C25 A;  4DQR A;  2QEX N;  1I39 A;  4O5F A;  3IKM A;  4CZG A;  3SCX A;  2FF3 B;  3HP6 A;  2JGU A;  3LL3 A;  1HYV A;  1VSK A;  3LAK A;  3VEW A;  3EY1 A;  4IXC A;  4FJ8 A;  1N34 K;  1XC3 A;  2YJF A;  1S72 N;  2DFF A;  3OJS A;  4XH1 A;  3MXI A;  2GV9 A;  4BR2 A;  4DLE A;  1ASW A;  2IDO A;  4NB4 A;  2HHU A;  4KHW A;  5CZ1 A;  2KKZ A;  4ISF A;  3QIP A;  1VSD A;  3SUP A;  1Q7Y O;  1CZB A;  4B1Y B;  4CEO A;  5KRT A;  3KWG A;  1EET A;  4CW7 B;  2Q31 A;  1EP4 A;  1TKD A;  1G15 A;  4G9Z A;  1FJG K;  5FPE A;  4YDU A;  4DV5 K;  3CCV N;  3DOK A;  1TL3 A;  3LP0 A;  1K9M O;  1BG3 A;  4BE2 A;  4IWV A;  4B9U A;  1B92 A;  4O5B A;  4M41 A;  3CM5 A;  5BRF A;  5AQV A;  2V7Z A;  3TAB A;  3V9W A;  4KRE A;  4GY2 B;  4M3U A;  4FSV A;  4B3R K;  1RTJ A;  3EN9 A;  2IVP A;  4DR4 K;  4DU1 A;  3DXM A;  3AO2 A;  3ZT1 A;  3ZYY X;  1NWK A;  3A2F A;  3H1V X;  2HVH A;  3T69 A;  1YHQ N;  4A5A A;  3QEV A;  2PFU A;  4RWT A;  4Z4I A;  3E01 A;  2FSN A;  1S1W A;  4I2P A;  4FWL A;  3WNG A;  1RFQ A;  4O8K A;  5GIO A;  1QS4 A;  1NM1 A;  3K5N A;  1SUQ A;  2E5L K;  4BRI A;  3DXK A;  4U67 L;  1L3V A;  4KAZ A;  2VGM A;  3DMJ A;  3ZX2 A;  3T3F A;  4W5N A;  3BF1 A;  3FFI A;  3L8B A;  3NH1 A;  3J7Y P;  4I6M B;  4ID1 A;  4DQP A;  2KFN A;  3AVG A;  1HLU A;  1T03 A;  4DV7 K;  2A1S A;  3KK3 A;  1X3N A;  1CZ9 A;  4Z4C A;  4YOW A;  4QS7 A;  3PY8 A;  4J2E A;  1NNE A;  2VWJ A;  1YIJ N;  4DQ8 A;  4J2A A;  4GKJ K;  1ZBS A;  4EHU A;  4DFM A;  1GLL O;  2QWN A;  4FZZ A;  1HMV A;  4M3Y A;  1HQU A;  4HWI A;  4KTW A;  4A2A A;  2YHX A;  3AA5 X;  4ILG B;  3CCQ N;  3O4N A;  1EXQ A;  3MXJ A;  5FPD A;  4BDP A;  3VMF B;  4QOZ B;  3PSI A;  1RT7 A;  3V9X A;  1VSI A;  2YV0 X;  4IJN A;  1OH8 A;  4XIU A;  5C15 A;  3DLL L;  3PLA A;  5ADX H;  3R1X A;  2F7T A;  3BY5 A;  4CES A;  3F73 A;  4DS4 A;  4JI5 K;  4FM0 A;  4FVU A;  4IDH A;  3DLK A;  1WSI A;  4RG8 A;  1WSH A;  2A1R A;  1CZA N;  4XH4 A;  4FWM A;  4CJ7 A;  3IMX A;  1TK5 A;  3VPZ A;  2G8U A;  5DK5 A;  1HQE A;  5CYQ A;  3WNH A;  1T8E A;  4W5R A;  4XH5 A;  5AQX A;  5HRN A;  4B3M K;  2BDP A;  3EE9 A;  2NRZ A;  2D0A A;  3C6T A;  5JS1 A;  1ZBF A;  4WF9 L;  1K73 O;  3CJA A;  4EP5 A;  1U4B A;  4CFA A;  3VQ5 A;  4IG0 A;  1SKS A;  3HM8 A;  1S9G A;  4FWP A;  4AIL C;  3EYZ A;  3CC4 N;  3U9Z A;  2QWO A;  3ZEU A;  1FW6 A;  3CCL N;  3UKU B;  3SPZ A;  3ZT3 A;  5J1E A;  4DCH A;  2DTU A;  2OAN A;  5JIC A;  3OYK A;  4KRF A;  2G8W A;  5KRS A;  2RN2 A;  3HSC A;  4PL8 A;  4O4G A;  1QZ5 A;  4OPA A;  4CJQ A;  4FJH A;  3AVJ A;  3T7Z A;  3O4W A;  3VET A;  3KHY A;  4O44 A;  1EX4 A;  3DM2 A;  3PO4 A;  2KTQ A;  2UXD K;  1T6C A;  1L3T A;  3THX B;  4M7X A;  4JK8 A;  2G8V A;  1NJX A;  1ITG A;  1NK9 A;  1KD1 O;  1KAY A;  2GX9 A;  3HL8 A;  3O9U A;  3M6G A;  3ZSQ A;  2A41 A;  4CJ5 A;  1XI1 A;  3QML A;  3ALY A;  4LF8 K;  4JRQ A;  1NKC A;  4CJU A;  2UUA K;  3QNN A;  3CM6 A;  5AR0 A;  2ETJ A;  1RCH A;  3VTI A;  4PL7 A;  4DUZ K;  4FLZ A;  2HBL A;  3TTD A;  3SQ0 A;  4DTO A;  4DKW A;  1KLM A;  1YT3 A;  3SV4 A;  3EKU A;  4KI4 A;  3K5M A;  1WBD A;  4LF7 K;  1WBB A;  3U9D A;  3TAF A;  1RGI A;  3AA2 A;  1J9A A;  1KSP A;  5C12 A;  4PUO A;  2E2P A;  3CQX A;  4DR6 K;  1LAV A;  4DU3 A;  3ATV A;  2P9N B;  3E1Y A;  4KV8 A;  5C24 A;  1IG8 A;  4NXN K;  2Q97 A;  5EOY A;  3PX4 A;  2ZF5 O;  1I3A A;  4LD0 A;  1Q8I A;  3A5L C;  3M3Z A;  4IEE A;  5AQZ A;  4XEI A;  2KZM A;  2YNF A;  3K59 A;  4CZM A;  4IKF A;  5BRD A;  2FBX A;  1LCU A;  3OYB A;  4DFK A;  3VQ9 A;  4CCH A;  1OVY A;  4CZF A;  2FLO A;  4DTX A;  1VQP N;  2D4W A;  1ATN A;  4WQ4 A;  2ZE2 A;  4OJR A;  5C2D A;  4OPH A;  5EY4 A;  3SQ2 A;  2XY7 A;  4FJ5 A;  4FK4 A;  3OS2 A;  4BRD A;  2VG6 A;  2P9S B;  3R8E A;  3LAN A;  1HKB A;  3HYF A;  4AQY K;  3DLH A;  1QQO A;  3P38 A;  4K41 A;  2E6M A;  3LWM A;  4TSX A;  2E1Y A;  1BDG A;  1VQO N;  2PZS A;  3B6P A;  3LZI A;  3QIO A;  4MLE A;  5HLF A;  4GV3 A;  3TAN A;  3DRS A;  4PKI A;  1HNX K;  5AFU A;  3V6D A;  2Q36 A;  5I3U A;  3EZ5 A;  3D2F B;  1W97 L;  5AZI B;  4KKO A;  1X9S A;  1BQM A;  2IOC A;  3ITH A;  2X6N A;  3BDP A;  2A6A A;  2P5O A;  3SAG A;  4LY7 A;  3KLE A;  2F8T A;  1LAW A;  1JLQ A;  3HVR A;  4EZ9 A;  5J2Q A;  1VSF A;  1RTH A;  3WXM B;  1U2V A;  4QAG A;  2WOM A;  4DR7 K;  4DHY A;  5EVZ A;  4YOT A;  4CER A;  3MN7 A;  1GLA G;  3LDQ A;  3QEP A;  4JKB A;  1BQN A;  1EWR A;  4BRP A;  4WFN L;  1GLD G;  2E4L A;  1NGD A;  4CZI A;  4H4M A;  5A2Q O;  5AQF A;  2E6L A;  4BRQ A;  2YHW A;  4HCB A;  5GAH P;  4CJW A;  3OYL A;  4IFV A;  2F9T A;  4KHY A;  4J8F A;  2F9W A;  1C1B A;  5CR4 A;  5JVH L;  4CJF A;  3AA4 A;  4DV3 K;  2QXF A;  3D2E B;  3VQE A;  3ZX3 A;  2HND A;  2O4G A;  4FLV A;  3NGY A;  1YJN N;  4DU4 A;  3SQ4 A;  1KLN A;  5KQ8 A;  4CFC A;  4BG8 A;  3VOV A;  4CZE A;  2YJE A;  2QWL A;  4DQI A;  3OYI A;  5DM7 L;  1RTI A;  4N47 A;  3RMA A;  1GLC G;  3IFR A;  1ZYQ A;  4GV9 A;  1BGX T;  4IFY A;  4FLW A;  3D7E O;  2E2Q A;  1RDD A;  2O8F A;  4A2B A;  4CBU A;  1WAF A;  4OKE A;  2VWK A;  1WOQ A;  4FJ9 A;  1J5E K;  5J2M A;  3AVC A;  1YTA A;  2HNY A;  3SZ2 A;  4BC5 A;  4KFB A;  3G10 A;  4CIE A;  3O3F A;  4CVN E;  4CJT A;  1BIZ A;  4E7I A;  3NH2 A;  3M8R A;  2JWK A;  4CZH A;  5AQR A;  1T44 A;  1TV6 A;  4RW8 A;  1RDA A;  3EZW A;  5FDL A;  3VQQ A;  3LDN A;  4H5R A;  5CE3 A;  3MN5 A;  3NVK A;  5JVG L;  3D0P A;  1EWQ A;  4MFB A;  4B8C A;  4BC3 A;  4FLU A;  3VEV A;  1HKG A;  1N5Y A;  3BUZ B;  2WON A;  1SQK A;  1UOC A;  4YY3 K;  4E1J A;  4HUF A;  4DV6 K;  1TKT A;  4A57 A;  4CF0 A;  3FZK A;  3F5T A;  4FOI A;  3LDS A;  2DY4 A;  1NGE A;  3N4P A;  1N8R O;  2HF3 A;  5M1N A;  3FR0 A;  1T7P A;  1HPM A;  3LAL A;  2XY5 A;  3KIO A;  1JLE A;  4CGI A;  1X1P A;  4ISE A;  1Q81 O;  4R5P A;  3SAF A;  1X9W A;  2ZM6 K;  2W6L A;  3OYM A;  1N33 K;  4FYD A;  3GG4 A;  1QTM A;  2VYP A;  4FXD A;  1S1T A;  3QDK A;  5F0X A;  2D0B A;  3VEX A;  3IG1 A;  4CJK A;  3OYN A;  3O4Q A;  4C8M A;  3S41 A;  1NGA A;  4YDU C;  2B5J A;  2DFH A;  3OYA A;  4AHR A;  2FF6 A;  3U3Y A;  4EFH A;  4BGA A;  3S3O A;  1LW0 A;  1A5W A;  2CH6 A;  4OLA A;  4BRG A;  3DXK B;  4O0I A;  4JI1 K;  1IKV A;  5GAE P;  3H3O B;  3O9R A;  1KFD A;  5DMR A;  4A62 A;  3SI6 A;  1VQ4 N;  4BR5 A;  3O9T A;  4E89 A;  4NCB A;  4KTZ A;  3RRG A;  3HOS A;  4B1U B;  4ILJ A;  4JI6 K;  4JI3 K;  2OPQ A;  2X6S A;  2UYT A;  1OVQ A;  2CGK A;  2Z1I A;  4B9T A;  2RF2 A;  1VQM N;  2HBM A;  1R0A A;  4KHN A;  3SK3 A;  4E19 A;  3QES A;  2P9P B;  1NBW A;  3C7N B;  3WXI A;  2DPN A;  1D5A A;  3GBT A;  3L2W A;  3EKS A;  2W41 A;  4IFE A;  2FC0 A;  1KXP A;  3HP9 A;  4CJL A;  1VSH A;  2Q0R A;  5AFU H;  1NLV A;  4DB3 A;  3KZB A;  5ADX A;  1QSL A;  1V4S A;  4OKJ A;  3AVH A;  3ENO A;  2OA8 A;  3CHW A;  4B08 A;  4JN4 A;  4M3W A;  1EKE A;  2G8F A;  3LP3 A;  3FZF A;  4B9S A;  4C1N I;  2E8A A;  4WCE L;  5H1S Q;  3CJ1 A;  3A8Y A;  1HYZ A;  1YUW A;  2H3G X;  2KZZ A;  4DTS A;  2WBN A;  4BRA A;  3VQ8 A;  4FK2 A;  1I94 K;  4OPJ A;  4FWN A;  1KCF A;  4L3Q A;  4H03 B;  3O3G A;  5DM6 L;  1FKP A;  3VA3 A;  3QLH A;  2PYL A;  3B8A X;  2FBT A;  5EX5 A;  3A5N C;  4PKG A;  1WSG A;  1F21 A;  2HST A;  1YXQ A;  3B6O A;  1EQY A;  3Q7C A;  1C1A A;  1Z6R A;  1RBT A;  4CD1 A;  2WC9 A;  3HPO A;  3L2U A;  4JNE A;  4E7K A;  1GLF O;  1GLJ O;  5BR8 K;  2VG5 A;  1QQN A;  5KGW A;  3TPQ A;  4BRN A;  1Z26 A;  1HNZ K;  4CJ3 A;  3ZEU B;  1K8A O;  3MX2 A;  3NGZ A;  1BA1 A;  1KVB A;  3DRP A;  3L0Q A;  2QWP A;  4B1V A;  4LSL A;  4I9Q A;  4N76 A;  2AP1 A;  4GVM A;  4CHO A;  4LFB K;  1RBU A;  4BWM A;  3VQ6 A;  5EXW A;  3PV8 A;  1S22 A;  4BVP A;  2HOE A;  3MX5 A;  1WAJ A;  2W42 A;  1MDU B;  1P8Z A;  2PBD A;  4NYF A;  5HRP A;  1WLJ A;  2NLX A;  3G71 N;  3HXM A;  3VGM A;  3G4S N;  3QB0 A;  5BN9 A;  5BPL A;  3I56 N;  4C8L A;  1NK8 A;  3LP2 A;  2KFZ A;  3E9L A;  4JS4 A;  3NF8 A;  1S1U A;  5IT9 O;  1E3M A;  4B9V A;  4IOC L;  2X78 A;  1O1W A;  3IUC A;  1XNQ K;  2YX6 A;  3AAQ A;  5M1K A;  1XQS C;  1UA0 A;  1NU0 A;  3HPH A;  1LWC A;  3TWH A;  4JKA A;  4BRH A;  4Q0B A;  4AHS A;  4BWJ A;  4FCY A;  2XRI A;  4NYN A;  3VQB A;  1BU6 O;  1SV5 A;  2KQ2 A;  3D6R A;  4H5N A;  4CGH A;  1NGB A;  5FLX O;  4BGB A;  3CFO A;  2BUP A;  4DR5 K;  4DMN A;  3CJB A;  4Z4E A;  3J80 O;  4CED A;  4NLC A;  1VHX A;  3CIP A;  4U7B A;  2UU9 K;  4BR0 A;  1X9J A;  3F9K A;  4K42 A;  3SUQ A;  4BRM A;  2HHH K;  5KPZ A;  5AQQ A;  3IS9 A;  5KPR A;  4O8U A;  1JLA A;  3WQU A;  2FBV A;  4FJG A;  4MQ3 A;  4YOR A;  2HMI A;  3U3G A;  5K14 A;  1W2B M;  2G8I A;  1IH7 A;  1NJY A;  2P9P A;  1KQS M;  5KTQ A;  2X74 A;  3C7N A;  3AO5 A;  2Z1H A;  4KBO A;  3LDL A;  1HNI A;  2P51 A;  3QIN A;  4FZY A;  3VQP A;  1ASV A;  4HTL A;  5TKW A;  4CI6 A;  4BC2 A;  4KI6 A;  4MDA A;  3J81 O;  1K8K A;  4JRP A;  4DUY K;  1Q86 O;  4B3O A;  4C8N A;  1VQ5 N;  4AH9 A;  1N32 K;  1O13 A;  3PIO L;  1BHL A;  5CY4 A;  3M8P A;  4CEQ A;  3I0R A;  1KRP A;  2YKM A;  1NK4 A;  4IDK A;  4WQ4 C;  4CHY A;  1IBM K;  4M45 A;  3SAH A;  2UXC K;  2IC3 A;  4DV0 K;  1UA1 A;  1DEJ A;  1WSJ A;  3E9P A;  5LJV A;  2JWL A;  3LM2 A;  5AZJ B;  3ULD A;  4DSL A;  1U2V B;  4EHT A;  1VSM A;  1SAZ A;  3AVN A;  4FW2 A;  4EAH D;  4B1W B;  4DSE A;  4K0K K;  1C0T A;  1IBK K;  2VG7 A;  4NCG A;  5HBM A;  2HW3 A;  3AVB A;  1FXX A;  2CGL A;  2HHX A;  4CEA A;  1A5V A;  2VQE K;  1VK0 A;  3O3H A;  1JCE A;  4OLB A;  3TAP A;  1VQ6 N;  4RTF D;  1C0U A;  4DSI A;  3RR8 A;  3AA3 A;  5C2F A;  1WSF A;  5GAD P;  3AAR A;  1U49 A;  3QEW A;  1TKX A;  2WTU A;  3CC2 N;  2ITG A;  3GE1 A;  4H4O A;  3VEZ A;  1NOY A;  3C95 A;  1S3X A;  1V4T A;  2HHW A;  1HKC A;  2ZJR L;  4I2Q A;  2FBY A;  2IVN A;  4AF1 A;  2OCE A;  4CZJ A;  4GMJ B;  4MO5 A;  4KB0 A;  3PO5 A;  3SLC A;  2O8F B;  1NGC A;  4FJI A;  3LPU A;  4PKH A;  4JD2 B;  3THW A;  4K25 A;  4CZK A;  4I7F A;  4N56 A;  3OYD A;  3VQ4 A;  3A5O C;  3ATU A;  5AQN A;  3H3N O;  1TUY A;  3O1W A;  3SBT A;  5BN8 A; 
#chains in the Genus database with same CATH homology
 4DV5 K;  4NXN K;  2UUC K;  4JI1 K;  4DV3 K;  4LFC K;  4NXM K;  5LL6 Z;  3J81 O;  4LF9 K;  4DV2 K;  4LFB K;  4DUY K;  4JI8 K;  3T1Y K;  5LMU K;  1N32 K;  4B3M K;  4JI6 K;  4JI3 K;  4B3R K;  5IWA K;  4X64 K;  4DR4 K;  1HR0 K;  4DV1 K;  1IBM K;  1XMO K;  2UXC K;  2VQF K;  1J5E K;  4DV0 K;  4LF5 K;  4YHH K;  5AJ3 K;  4JI7 K;  5IT9 O;  4CVN E;  4JYA K;  1XNQ K;  2E5L K;  3OTO K;  4B3S K;  4X66 K;  1HNW K;  4JI0 K;  4AQY K;  4K0K K;  2F4V K;  1IBK K;  1XNR K;  1IBL K;  2UUB K;  4KHP K;  2VQE K;  4B3T K;  3J7Y P;  4JI4 K;  4DR1 K;  4OX9 K;  1HNX K;  2UXD K;  4LFA K;  4DR2 K;  1I94 K;  5FLX O;  4YY3 K;  4DV4 K;  5LMN K;  4DV6 K;  4DV7 K;  4DR5 K;  3T1H K;  1N34 K;  3J80 O;  1N36 K;  2UU9 K;  4X62 K;  4V19 S;  4GKJ K;  4DR3 K;  4LF8 K;  2HHH K;  2UUA K;  2ZM6 K;  4GKK K;  4JV5 K;  1N33 K;  4DR7 K;  3JAM O;  4LF4 K;  4DUZ K;  4LF6 K;  4JI2 K;  5BR8 K;  3J7A P;  4LF7 K;  5A2Q O;  4X65 K;  1HNZ K;  4CW7 B;  4DR6 K;  4JI5 K;  1FJG K;  1XMQ K;  2UXB K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...