1N36K

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 24
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1n36K00
4OX9K 4B3RK 2HHHK 5IT9O 4B3TK 3JAMO 4CVNE 4DR2K 4X65K 2VQEK 1IBLK 2UUAK 4JI3K 4DV6K 4K0KK 1J5EK 4LF6K 4X66K 4AQYK 4DV2K 4DV3K 1XNQK 3T1HK 5AJ3K 3J7YP 3J81O 1N33K 4LF9K 4DV5K 4DR5K 4LF7K 1HNZK 1HNXK 5IWAK 4LFBK 4YY3K 3J7AP 3T1YK 4JI0K 4KHPK 1N36K 1FJGK 4CW7B 4NXNK 4JV5K 2UUBK 2F4VK 2UUCK 4B3SK 4LF5K 4YHHK 4V19S 5LMUK 4LFCK 2E5LK 4DR4K 1IBMK 4DV1K 4DR6K 4JI5K 1N34K 4JI8K 5A2QO 4JI4K 4DV0K 3J80O 2UXCK 5BR8K 5LMNK 4DUYK 4B3MK 3OTOK 4NXMK 2VQFK 4JI6K 4LF4K 4LFAK 1XMOK 4DV4K 4DR3K 1XMQK 4JI1K 4DUZK 4DV7K 2UXBK 4GKJK 4JI2K 4JI7K 4X64K 4DR1K 2UU9K 5FLXO 4GKKK 5LL6Z 1HR0K 4DR7K 2ZM6K 1N32K 4LF8K 4X62K 1I94K 2UXDK 1IBKK 4JYAK 1HNWK 1XNRK
chains in the Genus database with same CATH superfamily
2V7ZA 1EKEA 2HF4A 1KFSA 4Z4IA 1WNSA 3OVNA 4BR2A 5C42A 5IT9O 1GLFO 4K41A 1JCEA 2B5JA 1RTHA 1ATNA 1OH6A 1S9GA 1SKRA 1C1AA 4E1NA 3EN9A 3M8PA 2YHWA 4PHTX 1BOTO 4IDKA 4YOTA 3T7ZA 3UKRB 4FWQA 4B1UB 4ZHRA 4DCHA 4GW6A 2O4IA 3SCXA 3EO3A 5AZJB 1BWFO 4FWLA 1RTJA 3IAYA 4CJUA 2NRZA 1NWKA 2W40A 3THYA 3LPTA 4NO7A 4BVOA 4OKEA 3AO1A 2XY5A 4DSFA 3FFKB 1TL1A 4CFBA 2F8TA 4M3ZA 4B9SA 5JMVA 3KZBA 1NGAA 4CEQA 1NMNA 2D0PA 1Z25A 4H0YB 3TARA 4IG3A 4JKHA 3OBWA 4B3SK 2Q3SA 4YOUA 3ATUA 3AV9A 1M90O 4FWSA 3ZX3A 1IBMK 2ASMA 3VEOA 4W5QA 2HSTA 3O4WA 4FL9A 3MN5A 3VA3A 3PO4A 5BN9A 2Q0UA 3F2KA 1KVBA 3OYGA 4Z4HA 3NH0A 1X1PA 4B9TA 3TTFA 3UKRA 4A5AA 4DTNA 3CFRA 3CCJN 4NCGA 4DV7K 3ALYA 2XY6A 3ZETB 5AZJA 3CQYA 4FYDA 3KLFA 3HM8A 3NGZA 3O80A 3DOLA 4IFVA 3SQ4A 1YITN 4A62A 3U9DA 1TGOA 2D0OA 1DTQA 3LDLA 4NYFA 1I94K 4KV8A 5LJVA 2QWQA 3AVLA 1XNRK 1OVYA 1NGHA 5H1SQ 4Z4CA 5DK5A 1YF5L 4DKWA 4XEIA 1MWKA 4R5PA 3S3NA 4CVNE 3LDOA 3WNFA 2NRHA 2A1SA 3DLEA 3BF3A 3MK6A 5FRMA 3M3ZA 4BRCA 3N4PA 3QLHA 3MEEA 1NNEA 4C1NK 2ZD1A 1ASVA 2P5GA 3ULEB 2KW4A 1DLOA 1IG8A 5CHIA 3SBGA 2OZMA 3AGKA 2JWKA 1W9HA 2NLXA 1QSLA 4DV5K 2FSKA 3ZETA 2VWJA 1JXBA 1OH7A 1CZBA 4WE1A 4CJ7A 4AF1A 2YNHA 1RCHA 5BREA 5F0XA 3AAPA 1S72N 2YHXA 4DS4A 3I8BA 2XRIA 5C10A 3HM9A 4M7XA 4AILC 3DI6A 3PIOL 2I7PA 3SBTA 3NF6A 1VSLA 2GBZA 2GX9A 3SMPA 4H0TB 4JAXA 2P9LB 3C0BA 3DLRA 3NH1A 1NGGA 4F8RA 3R9PA 4CZEA 2QXFA 3V9ZA 2O8FB 5TKYA 1WAJA 2YKMA 3UKUB 1LWCA 4CK2A 3K5OA 2HVIA 4YORA 3A5OC 1NOYA 5ADXA 1XMQK 1U47A 1DGKN 3A5NC 5AR0A 3VESA 1RBRA 2D5RA 3AO3A 2I7NA 5GINA 1EQYA 2I5JA 3FGUA 5TKWA 2P9UB 1B9DA 4LSNA 5LY3A 2ETJA 4X62K 4BG8A 1C0TA 5HOOA 3CQ8A 3NHGA 3PX4A 1GLLO 3RTVA 4DLGA 3SQ2A 3ID6A 4H0XB 4BDYA 1U2VB 2CH6A 4KTWA 1GLDG 3AA4A 5AQIA 5AFUH 1X3MA 5AQYA 2QWRA 3VENA 4FWPA 2UUAK 4K43A 1RT4A 2KFZA 2P9LA 3E66A 1A5VA 3PSIA 1C0MA 3PO5A 1X9JA 3R8EA 2HBKA 3V1RA 3FR0A 3PIPL 3C6AA 3UKUA 2QKBA 3RR7A 2AJQA 3UIQA 3AARA 3DMJA 2E88A 4CCHA 3G71N 4KREA 1TL3A 3QEPA 4FVUA 1QHTA 5BR9A 4DHYA 4BC4A 2KLAA 4E1JA 5IWAK 1YJ9N 1XUPO 3BUZB 5I42A 4YOVA 4FJIA 3FE1A 3T1YK 5AQOA 4BRMA 4N5SA 3B6PA 3CMEN 3OJSA 3CIPA 2P9UA 1NK8A 1Z6RA 4W5RA 5KGWA 4JV5K 1EWRA 3PX6A 4DQPA 4H5TA 1KSPA 5JLFA 3HPHA 1EP4A 2OYQA 1Q86O 3VQPA 1VHXA 4BDZA 1GOAA 3CF5L 1J5OA 1HLUA 2WC9A 4KRFA 1Z26A 2HW3A 3SNNA 3ENHA 4IO8A 3KLGA 1YIJN 4RW7A 4FJ5A 4PKIA 3ZLJA 3DRSA 4DV0K 1ZBLA 3K58A 4CD1A 4DTJA 2OANA 5KRSA 3RMBA 4FLYA 1UAXA 2GTDA 4KH4A 4DR3K 2IVPA 3K5LA 5BPLA 4DSIA 3ZSOA 3CC7N 4FXDA 1QSSA 1R59O 2P9IB 1HR0K 3EL2A 2D0BA 3TANA 4W5NA 3QNOA 3WXLA 1N32K 2RHKA 4FM0A 3HP9A 2UXDK 4QCLA 1NGDA 1REVA 4CJKA 4RW8A 4O8KA 1K73O 4B9NA 4FJGA 2YKNA 3DWLA 4AHCA 1YJWN 4B3OA 1NGIA 4BGAA 4B3RK 1VRTA 1NK0A 4BG9A 4B3TK 2PYLA 1IH7A 1FW6A 1RBVA 4HTLA 1RDAA 3KIOA 4X65K 2FBVA 3AVAA 1IBLK 1VSHA 4CJPA 3G25A 2NNWA 1O1WA 1NJIO 1NU0A 1TK5A 2P5OA 4CZJA 2XO7A 2IC3A 3I0RA 3D2EB 3VEVA 4N76A 4H5VA 4DV2K 4PY5A 4C8KA 5KQ8A 4CBWA 4FJ7A 4DMNA 4CHNA 3L4QA 2E6MA 3AVJA 2RE2A 1KLMA 4AHSA 1HQEA 1NKEA 3HXMA 5HRRA 2P9IA 2PAVA 5FPNA 1MA9B 1QQMA 3RRHA 4NLCA 3VQ7A 3WQTA 3RR8A 4M3TA 3T1AA 4NXNK 4FJ8A 3VOVA 3P5JA 2UUCK 3OJUA 4CEEA 2G8UA 2V7YA 3LP0A 3ATVA 3LALA 5DM6L 4IDHA 1EO1A 4KB1A 2AA4A 5M1PA 1I39A 2KQ2A 2BUPA 4E0DA 3B8AX 3R3LA 4CE9A 3OYNA 3E9LA 3G10A 3RVCA 4DUYK 3O9QA 3M1FA 3BF1A 4NXMK 4AH9A 3DOKA 4LFAK 4CHYA 5KTQA 3HVRA 4CZMA 2W6LA 2YJFA 3RSEB 1RT6A 3K57A 4ILHA 2OZSA 4K8XA 3P39A 4NLBA 3WXIA 1W2BM 4CJ4A 2UU9K 3EE9A 4YDUA 4ELUA 3SQ1A 1JKHA 3HL8A 4JD2B 1TKTA 4FLTA 3V9WA 4IOAL 1X9MA 3GDQA 1HNWK 2X74A 3D7EO 1P8ZA 1NKCA 3TI0A 1NGEA 3DJCA 4BVPA 4BRNA 4GVMA 3CM5A 3OS1A 2HHHK 2BANA 3M8RA 3H45C 4U7BA 2HVHA 3JXUA 3VETA 3TAEA 4AM7A 1FXXA 3PX0A 3VTHA 3J8AA 4B9LA 1ZBHA 3LAKA 3VGMA 4MFBA 3K2PA 1U6ZA 2O4GA 3CJ7A 2HOEA 3TSPA 4A2AA 4KH5A 3RSEA 4CFDA 4B1XB 3ZCMA 3NF7A 1HNZK 3CCMN 3O9SA 4E7JA 3M5RA 2F9WA 1E4FT 3VF2A 3SPZA 4OPKA 3P31A 2YX6A 4DS5A 4ISFA 2VG5A 4F9OA 3CD6N 1U04A 4JI0K 4JHDB 4JRPA 4JD2A 3ZSZA 2ZWHA 2FSJA 1QHAA 3O8MA 4DTMA 2RN2A 4JK9A 1BQNA 3CCUN 4KHSA 1ESVA 4EP5A 3LAMA 5LMUK 1QSYA 2BE2A 3KD1E 4J2AA 1ZXOA 3QESA 4ELTA 4H0VB 4B1ZA 1L3UA 4DWIA 2HHSA 3I56N 4E7LA 4JI8K 1UOCA 3S3MA 3UB5A 1TVRA 3SI6A 1XWLA 2KZZA 3EYZA 5J2QA 3EE8A 1U4BA 2OPSA 4U67L 1SL1A 4N41A 3A8YA 2FLOA 3A2FA 3P4IA 5GAGP 3TAGA 1L3TA 1JLEA 4JN4A 4FCYA 3GOIA 2VGNA 5T7BA 4DU3A 5HRPA 1RDWX 3G4SN 3KD5E 5J1EA 3O4QA 5FLXO 4GKKK 2E1YA 4YOXA 2PFUA 4RCHA 4CK3A 1ZYQA 3DRPA 3VQCA 2NRRA 3BEXA 3DLLL 4CF9A 4Y0WA 3SAGA 1Y97A 4EP4A 3OYBA 4H5NA 5AQNA 3A0IX 3NF8A 3L6QA 4JHDA 4C8MA 3MXMA 4YDUC 3D6RA 1HPMA 2G8FA 4MDBA 1NM1A 3L4IA 2F7TA 3AVMA 1RTIA 5BPNA 4DFMA 3VQBA 4CEFA 1HKCA 2P9NB 3K5NA 4DLEA 1S1XA 1NJWA 1J5EK 4LF6K 4X66K 3WNGA 4CJVA 3V1OA 4YOYA 4DTXA 4CGIA 3OYCA 1UA0A 3A5MC 4M3RA 1IKWA 4BRIA 4I2PA 4JRQA 3F9KA 2PZSA 4KHQA 2D0AA 1QZ5A 2P9KA 2VYPA 3DXMB 3CMAN 3U3YA 3WNHA 5C12A 3CFPA 3BDPA 4AHUA 3SPYA 1TV6A 4YFUA 1OVQA 4QS8A 4Y1CA 4BC5A 4B9UA 2IAJA 1SQKA 4IFEA 3OYFA 1VQ5N 5E26A 3KK2A 1S6PA 3ZT1A 4KHWA 4A5BA 4GV6A 1QQNA 5D3GA 3L0QA 4B9QA 4Z4EA 1WLJA 3RWUA 4I9LA 3I8DA 4DU4A 2HF3A 2FF3B 3TU5A 4H8KA 2E6LA 2P9NA 5HRSA 3CCLN 1B9FA 2E4LA 2HHUA 4F3TA 4FJKA 4JI6K 3ZX2A 3OBYA 4BE1A 1BQMA 3F5TA 1E4GT 4HUGA 4UY8O 5GAHP 1KTQA 3WUHA 1XI1A 1VSDA 3T3FA 4JS5A 1UA1A 3KKSA 3DXMA 3KTQA 3OYKA 3CERA 4FK4A 2RPIA 4JK8A 3SQ0A 3CFOA 3E9OA 4IEIA 3QDKA 3LP2A 2QW9A 4G9ZA 2OTLN 1BIUA 1RT2A 3O6WA 3CCEN 4BACA 1GLAG 3LDSA 3HI0A 3SV4A 1CZAN 3VQAA 1VQPN 4CHOA 3KWGA 4CGFA 5KPZA 4DSEA 3CCRN 5AQTA 5AQVA 5M1KA 1OKJA 2NRTA 3KK3A 1FK9A 1YVNA 2Z1GA 4F4KA 5F2RA 1VQ4N 4BRFA 4BRLA 5HRNA 3LM9A 3VEYA 2OCEA 5FROA 5F1XA 4OJRA 3HVTA 3F73A 2YHYA 5AZIB 3VEWA 1RBUA 4IBNA 3ENBA 4Z4GA 4AM6A 1E3MA 3SAHA 4M7YA 3ZEUB 3WXKA 2XHBA 1SZ2A 1N36K 1VQ7N 3LWLA 3CI5A 3CJ1A 3QB0A 1WUAA 3LM2A 4LF5K 3OYEA 2Q2RA 3U3GA 1RT7A 2QI2A 3KJVA 3VN5A 1ASWA 2O8EB 3CC4N 5KI6A 4OPHA 2FBYA 5EY4A 4F2SA 4WYBA 4HTUA 3SLCA 3TTCA 2HNYA 3QIPA 2PY5A 3QETA 1VSMA 4M3UA 4FOIA 4HWIA 4PQUA 3VF4A 3AVIA 5CE3A 4W5OA 1LAWA 1GLBG 4E89A 2G8KA 4H5RA 5AFUA 3FLCO 2XY7A 4M42A 3DLHA 2FF6A 5AZIA 5SWMA 1TKZA 2P51A 2DFHA 1R0AA 1A5WA 4OGCA 2QWPA 3SZ2A 1CXQA 3QERA 1VK0A 3OHRA 1C6VA 3AVBA 4CESA 4CJ3A 3ZEUA 2DFFA 2DPNA 4H0OA 3EZWA 2O8BA 3CYMA 3O1WA 4FWNA 1X3NA 3L2RA 4DF4A 4GV9A 1RGIA 1KVAA 4BR5A 4YNQA 1KAXA 3H6EA 2KHOA 1V4TA 4BR4A 1GLCG 2O8EA 3QINA 3ZSXA 1BA0A 2HMIA 4R79A 1T05A 1W7AA 4EZ6A 3DAWA 1KAZA 1W97L 3SUQA 3R6MA 3AA3A 3MN7A 3J7YP 3NFAA 2BH1A 4FWMA 4CGDA 4LFBK 1YAGA 2G8HA 1JCGA 2A5XA 3NVMA 5HBMA 3AA2A 1BI4B 2HB5A 4BRKA 1RNHA 1FJGK 1KRPA 2ZE2A 4CW7B 3AO2A 3P38A 3IFRA 1NK9A 2W41A 3FFIA 3I33A 4FVMA 4IJNA 3SV3A 1YI2N 2P1JA 4KHNA 4YHHK 4L8RB 1ZBIA 2E5LK 5EXWA 2HHQA 3HPOA 5GAEP 2Y1IA 3ZSYA 3KK1A 5J2PA 3HOSA 1RILA 4JI5K 1BIZA 3W0LA 3O9UA 3S9HA 1BDGA 2UXCK 3HSTB 4C8NA 3SAFA 1ZBSA 1Z05A 3BGRA 3L2QA 2Y1JA 1WSGA 1WBDA 2ASPA 3L2WA 1JLGA 3OW2M 3WEEA 4DF8A 3PUFA 1QTMA 2ATQA 3QBWA 4J2BA 1N5YA 2GUIA 4A59A 5GIOA 1MDUB 5GADP 5M1NA 4H4MA 4F3OA 4QOZB 4EIAA 4A61A 1BI4A 4JKAA 4MDAA 3B6OA 4K25A 2V51B 4ISGA 3WXJA 3GG4A 3HP6A 3SMSA 3NH2A 2CGKA 3CM6A 3QEVA 5GIPA 4A2BA 3PV8A 2VG7A 5JVGL 4RTFD 4O4GA 3CJAA 1XHZA 4CEOA 4IOCL 4PKGA 4KPYA 4DU1A 4CZFA 1NMDA 4DTSA 5E84A 1V4SA 4DFPA 1LCUA 2ZGYA 2Z1IA 4DR5K 3O3HA 2KTQA 3L8BA 2X6SA 5E41A 3TSUA 3K0SA 2HBMA 3J7AP 2RKIA 1YUWA 1KQSM 3O1BA 1JLFA 4Q0BA 1Q9XA 2IDOA 2Z1HA 1YXQA 2G8IA 2F9TA 1Q82O 3C6TA 5JVHL 1T7PA 3O08A 3LWMA 5C2DA 1TUUA 3MECA 3VQ6A 3JYTA 4JS4A 1C1BA 3SK3A 4B9MA 4CIEA 4OLBA 5I9EB 3EY1A 1DT9A 1VQKN 1IKXA 3G0ZA 1DKGD 3VQ9A 2GEMA 3WT0A 3LZIA 4O0IA 2A6AA 1N8RO 2HHXA 1VQLN 3O4NA 4FWRA 1S1UA 5LL6Z 3OYMA 1YTUA 3S3OA 2BTFA 2QM1A 3OA9A 4ZTJA 4CF8A 3HT3A 3MDQA 4FJNA 3NGIA 3IDHA 1BA1A 1NGFA 5KPRA 3DLGA 4CIFA 4FJJA 3AVFA 4CJSA 1K9MO 3TTDA 5AQFA 2VQEK 4HVJA 5B8HA 3SUPA 4ID5A 4IG0A 4EFHA 4KHUA 3DLBA 4AHRA 3KLIA 4FJHA 4HUFA 1T6CA 2WOMA 2ZJQL 3QNNA 5FDLA 2E8AA 4CJTA 3O9TA 4PKHA 3ZYYX 3VQDA 2WTUA 2E20A 4DSKA 2QA4N 1NGBA 4CGHA 3QFPA 4ID1A 3GL1A 2YHBA 4B9VA 3K9KA 3NGYA 2WFBA 5AQWA 1KFDA 3EZ5A 3OS2A 3TAMA 4BDPA 1RDCA 4FO0A 4CD3A 5BRFA 2F4VK 2HHTA 2YI1A 1J9AA 4XH1A 2BDPA 4FK0A 3ITHA 4CJEA 1IV0A 4CBXA 2A3ZA 5C24A 5DMRA 1HJOA 4BRPA 4CJ5A 2B4JA 5A2QO 1VQ8N 1Q8IA 4ILGB 4J2DA 3J80O 4PWDA 5KGXA 5BR8K 3OY9A 4B1VA 3IUCA 3NCIA 2VQFK 4FJMA 1XHXA 4PUOA 4FJXA 3AO4A 4WFNL 3OYAA 4JI1K 4CZLA 2W6KA 1VAZA 2ZJRL 2A41A 2Q0RA 4X64K 3AVGA 4CEZA 2WUSA 4CBUA 1NK6A 4CZGA 3NDKA 5EX5A 3RMAA 1S6QA 4OPAA 2ZM6K 3VEZA 2R7YA 3VF6A 1RBTA 4EAHD 3KHYA 4ELVA 3H1QA 3NMUA 4J8FA 2PYJA 1EX4A 4JYAK 1HYSA 4FZXC 3P1GA 1S5JA 3UE5A 5FPEA 2G8WA 4BRHA 3D0PA 3K5MA 3CXCM 2QEXN 1IG9A 3H46O 2P9KB 2AP1A 4E7IA 4FWKA 4BC2A 1ILYA 1GOBA 3C6HA 3CCQN 3MCPA 1XC3A 3TAPA 4DB3A 4FZYA 3CCSN 4L3QA 3QICA 3KLEA 4PL7A 4AQYK 1Q9YA 1WSEA 3QO9A 1Y64A 4BRAA 4E3SA 3CG7A 3M8QA 3FZLA 4Z94A 3MWPA 4DV3K 4GNIA 5AJ3K 3J81O 3KKRA 4DQQA 1KC8O 3D2FB 4O8UA 3W3DA 4BR9A 3RMCA 4LF9K 4BQLA 4JKDA 2JGUA 5C2FA 3T69A 5FRNA 5AQMA 1BL3A 2X6NA 3K9JA 1C0UA 1BHLA 3VQ5A 4KHPK 1D4XA 1BUPA 3MWTA 2E2PA 4C1NI 4OGEA 1K8KB 1NGCA 5J2NA 2YV0X 1RBSA 5M1FA 2YHAA 4HUEA 1RT5A 3IG1A 2FXUA 4CK1A 3LP3A 1DEJA 2IS3A 4GVEA 3SYZA 4LH5A 4DV1K 1BGXT 4FW2A 3MN6A 4FWOA 3V9XA 4BWJA 4OO1J 4M3WA 4LY7A 2NRVA 4M3YA 3WXMB 1SAZA 4BRDA 4E1MA 3IKMA 4CJRA 1BG3A 2ITMA 3QIOA 4WQ4C 5JICA 4WQ5C 4BY9C 4DTRA 2LSNA 2IOCA 5CYMA 3U4LA 4GY2B 4JI7K 3HOTA 3JS6A 2QWLA 3OYDA 4DR1K 4BROA 2JWLA 3P83D 4FPAA 3D2FA 3OYLA 4C8OA 4O55A 1BCMA 1U49A 1QVFM 1I3AA 3QMLA 3AAQA 3ZSRA 3SJJA 4LF8K 5AQXA 2Q31A 4LSLA 2EX3A 1IBKK 4FJLA 1T8EA 4EZ9A 4ICLA 3EKSA 2NUBA 3Q7CA 4CI6A 3PSFA 3SUOA 3L3UA 3MX5A 5AQJA 2PBDA 4M45A 4AHTA 1K8KA 3MMVA 3JAMO 1GLEG 4O5BA 1NKBA 2H3GX 3LDPA 3IMXA 5DM7L 1KD1O 4LC9B 1EETA 1KCFA 2KZMA 2F96A 4DQSA 3HSCA 4CIGA 4DV6K 2FBTA 4K0KK 4CERA 1T03A 2QWNA 2ASOA 2CGJA 4I9QA 4OVLA 4O5FA 2A40A 1ASUA 3C95A 3FZKA 1HYZA 3T1HK 4FK2A 4FLVA 1LWFA 3HK2A 1WB9A 3AVCA 1VSIA 5CZ1A 4RG8A 3L3VA 3ID8A 1HNXK 4OLAA 4GMJB 2KKZA 4CJWA 1QE1A 3K59A 4EHUA 5J2MA 2A42A 1HX1A 1JL1A 3C7NB 5FPMA 3U8XA 4JKEA 1KVCA 1J54A 3LDQA 4DR4K 1IKVA 1HKGA 2CGLA 3ZSQA 3G6EN 4QS9A 1S1WA 1RT1A 4N56A 4IOXA 4NYNA 3QFUA 3VQ4A 4N47A 3VGKA 1NJYA 4KFBA 1L3VA 1T3VA 3QBXA 4WCEL 4B3MK 4CEBA 2O8BB 1K8AO 1TK8A 4H03B 3S41A 5CR4A 1OH8A 4OKJA 1SL0A 4Z4FA 1NJZA 3FZFA 4MLHA 4BC3A 2GUPA 3LZJA 4CZIA 4I6MB 3THWB 1MU2A 5MLCQ 2E1ZA 3O3GA 5K14A 3V4IA 1JLQA 4O0JA 1N6QA 1HNIA 5AQPA 1FKOA 1HPZA 2HNDA 3C7NA 4IJAA 4DR2K 4KTZA 1WOQA 4KTQA 3HO1A 3CETA 1D9FA 3AA5X 3CJCA 5C15A 3H1VX 1HUXA 5AQUA 4RW9A 1OH5A 3M6GA 1Q7YO 4LH4A 3I0SA 3ZSVA 4FM2A 1LAVA 1FKPA 4FLXA 2OTJN 1TAQA 5FPDA 1D8YA 4KI6A 1VSFA 2P9PB 3AVHA 3DYAA 4JNEA 2G8VA 1U48A 1J6ZA 1D9DA 3KK7A 2EHGA 1VQ9N 1SS6A 1SUQA 3L2UA 3CPEA 3MXJA 3JSMA 3L2VA 1N33K 2IVOA 2GELA 4CJQA 5HP1A 4JEPA 4LF7K 4K42A 5KQDA 4RW6A 4YY3K 1Q18A 2QWOA 2OPPA 4BGBA 3ZT3A 3E1YA 4IXCA 4B08A 4JKGB 1ZC6A 2B6AA 4I6MA 2UUBK 4UQGA 3THWA 2ZF5O 4YOWA 3CHWA 3QEIA 2D0CA 2QK9A 4FW1A 4F2RA 1RFQA 4MLEA 3WEEB 3D45A 2W42A 3ULEA 2VWKA 3MCAB 2IVNA 3AGRA 4CFCA 4Z0UA 1WSIA 3VMFB 2VWBA 1X9WA 1EWQA 5M1OA 3VQ8A 4KO0A 3N4QA 2VCPA 1LOTB 2FC0A 5AQSA 4AHVA 2YNGA 4FOEA 1NLVA 3OYHA 3C94A 4QS7A 5BN8A 3VPZA 3NVKA 4CEDA 1RDBA 4FZZA 3V9SA 1D5AA 4MO5A 3THVA 1G15A 4CHPA 2Q97A 1VQ6N 2UXBK 2P9PA 4GKJK 4H5WA 3DXKB 4Q5VA 2HBJA 1WAFA 1YT3A 3EKUA 2KFNA 3DM2A 5BRDA 2ZQBA 1KLNA 4KAZA 4GV3A 2O8DB 1YTAA 4O44A 5JS2A 2HHWA 3F9MA 1GOCA 4DSLA 3TSQA 1VQMN 2CH5A 4E19A 4CF2A 1TKDA 1NGJA 2O8FA 4K8ZA 4RWTA 1JLCA 3HZ6A 1BISA 4JKGA 1RTDA 5ADXH 4W5TA 1TK0A 1EXQA 3AVKA 4CJFA 4JKFA 1S22A 4CGGA 4I7FA 1WSFA 4I2QA 1BO5O 2HBLA 1WBBA 4CJLA 4TSXA 4BR7A 1SL2A 2QKKA 4IWVA 3TAFA 1MWMA 3LDNA 4CEAA 4BQZA 3MN9A 3V81A 2QTDA 1SV5A 1HYVA 2FBXA 3BZCA 4WF9L 3R1XA 1XNQK 1U2VA 3GE1A 3Q7BA 3AY9A 3WQUA 3BY5A 3H3OB 3CC2N 4IO9L 4FM1A 2Q1NA 3BZKA 1VQNN 3DXKA 3TWHA 4DSJA 1ITGA 3PY8A 5KRTA 4XH4A 2E2QA 4J2EA 1LW2A 1J53A 2O8DA 2GV9A 4JK7A 2O8CB 4CZKA 4B8AB 1NG9A 3ASMA 2HMPA 4ZTFA 1XC9A 3BP8A 3O5BA 5M1QA 2OA8A 3H08A 2NRWA 3MEGA 1TUYA 4DTUA 3I55N 1N34K 1X9SA 3C65A 5SZTA 1S9EA 4B1YB 2X78A 1T6DA 3V1QA 3QEXA 1YHQN 4CECA 4BRQA 5AQKA 2BGGA 4LF4K 1XMOK 1IJJA 1KAYA 3IS9A 4HCCA 4NCBA 1JLAA 4XIUA 1VRUA 4BR0A 4DUZK 2DY4A 4JI2K 2Q36A 4PA1A 2IIRA 1G99A 3ZT0A 2DFEA 2P9SB 2XY8A 4B8CA 2WONA 3ZX0A 4FPBA 5CYQA 1F21A 3OYJA 1WSHA 1VSEA 4FLUA 4FLWA 4XH5A 1NK5A 2QWMA 3TPQA 4H4OA 2YNIA 1L3SA 4OX9K 4OKKA 4PL8A 2UYTA 2OPQA 3CPWM 3VERA 2O8CA 3ZT2A 3LP1A 2E2OA 3OYIA 1DTTA 4KH6A 1IKYA 4C23A 3LL3A 2Z1JA 3IRXA 3NBPA 1C1CA 5JLHA 4JKCA 3V9UA 2GWJA 1YJNN 5AQRA 4IKFA 4M3XA 5C0YA 1CXUA 4JKBA 2YNFA 5BPMA 2NRXA 1CZ9A 4DQIA 1LWEA 1U45A 1JJ2M 4IEEA 3H3NO 1HKBA 3OS0A 3MXIA 1JL2A 3TAQA 5CY4A 2P9SA 4CF0A 3ULDA 1NJXA 4DTPA 4FLZA 3M8SA 1XQSC 5CZ2A 3TABA 2V52B 3GBTA 4WFAL 3D2EA 3NAEA 1K6YA 2YJEA 3FZMA 1JLBA 5ELZA 3MAQA 4DFJA 2J4RA 5LJWA 1SKSA 3HTVA 4E7KA 1NK7A 4DR6K 2GWKA 3A5LC 3O9RA 2WBNA 3ZSWA 1ZBUA 1TYQB 3MX2A 1YVUA 3AO5A 2A1RA 4JI4K 1TAUA 5AQLA 4CFAA 3THXB 1WN7A 4DFKA 3CJ9A 4B1WB 4CZHA 3ISNC 3MEDA 1KXPA 4DV4K 5HROA 3VGLA 2QXLA 4BWMA 2EWSA 5HL7L 4HCBA 2JLEA 4DTOA 3E9PA 1T44A 1UWBA 1S1TA 4DR7K 1L5UA 4WQ4A 4BE0A 4WQ5A 3O3FA 1VSJA 1RT3A 2DTUA 4G1QA 3U6FA 1JCFA 4FJ9A 4FSVA 4MQ3A 4DQ8A 5AQZA 4KBOA 3PLAA 2ZGZA 1W0HA 3KWIA 4LD0A 4DQRA 3C6UA 3HBTA 1QQOA 4BREA 3AVNA 1TKXA 3VQEA 2NZTA 1HMVA 1CLQA 3WNEA 1LV5A 5AQGA 1QZ6A 1HJRA 2VGMA 3ZT4A 4KI4A 1LW0A 4ISEA 2F8SA 3V6DA 3U9ZA 4JI3K 3CCVN 3SJHA 2ZJPL 4KHYA 4JLHA 1S1VA 3KVGA 1NOZA 5C25A 1BU6O 4IFYA 1TYQA 2D1KA 4WFBL 4IZ9A 1HQUA 1VSKA 1HNVA 3HPGA 1QQCA 3FZHA 4BRGA 3THXA 4ILJA 2FSNA 1NBWA 5AQHA 1P90A 1O13A 3VA0A 1S3XA 4OPJA 3NE6A 4CHZA 5JS1A 3VEXA 1GLJO 3DLKA 4KKOA 4BE2A 5EVZA 1M1KO 2OPRA 4EHTA 5BRHA 3HJFA 1NK4A 1QS4A 1A5XA 4A57A 5I3UA 3RMDA 1SKWA 1BCOA 4M63C 3HYFA 5HLFA 1HRHA 2RF2A 4KB0A 4E7HA 1Q81O 5AQQA 3VQQA 3DRRA 1ATRA 4V19S 1C0GA 1VQON 4LFCK 1RDDA 3HRGA 1H1VA 4M41A 3J7ZO 4H0PA 1C0FA 3TR8A 2HHVA 4DG1A 4NCAA 4QAGA 5EU7A 2D4WA 3ENOA 4NB4A 2VG6A 4CGJA 2E2NA 5LMNK 3VTIA 3QEWA 1QVGM 1RDUA 3OTOK 3E01A 3LPUA 3RRGA 3KLHA 1ATSA 3THYB 2HNZA 3SUNA 4C8LA 3EEQA 4CF1A 1JXEA 3CJBA 5KPTA 2ITGA 1WSJA 1B92A 3NF9A 3CQXA 3T19A 4Y1DA 4CHQA 1ZBFA 2IGIA 4HHTA 1IO2A 4RW4A 2YCHA 5EOYA 4MO4A 3LANA
chains in the Genus database with same CATH topology
4OX9K 4B3RK 2HHHK 5IT9O 4B3TK 3JAMO 4CVNE 4DR2K 4X65K 2VQEK 1IBLK 2UUAK 4JI3K 4DV6K 4K0KK 1J5EK 4LF6K 4X66K 4AQYK 4DV2K 4DV3K 1XNQK 3T1HK 5AJ3K 3J7YP 3J81O 1N33K 4LF9K 4DV5K 4DR5K 4LF7K 1HNZK 1HNXK 5IWAK 4LFBK 4YY3K 3J7AP 3T1YK 4JI0K 4KHPK 1N36K 1FJGK 4CW7B 4NXNK 4JV5K 2UUBK 2F4VK 2UUCK 4B3SK 4LF5K 4YHHK 4V19S 5LMUK 4LFCK 2E5LK 4DR4K 1IBMK 4DV1K 4DR6K 4JI5K 1N34K 4JI8K 5A2QO 4JI4K 4DV0K 3J80O 2UXCK 5BR8K 5LMNK 4DUYK 4B3MK 3OTOK 4NXMK 2VQFK 4JI6K 4LF4K 4LFAK 1XMOK 4DV4K 4DR3K 1XMQK 4JI1K 4DUZK 4DV7K 2UXBK 4GKJK 4JI2K 4JI7K 4X64K 4DR1K 2UU9K 5FLXO 4GKKK 5LL6Z 1HR0K 4DR7K 2ZM6K 1N32K 4LF8K 4X62K 1I94K 2UXDK 1IBKK 4JYAK 1HNWK 1XNRK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 K;  4B3R K;  2HHH K;  5IT9 O;  4B3T K;  3JAM O;  4CVN E;  4DR2 K;  4X65 K;  2VQE K;  1IBL K;  2UUA K;  4JI3 K;  4DV6 K;  4K0K K;  1J5E K;  4LF6 K;  4X66 K;  4AQY K;  4DV2 K;  4DV3 K;  1XNQ K;  3T1H K;  5AJ3 K;  3J7Y P;  3J81 O;  1N33 K;  4LF9 K;  4DV5 K;  4DR5 K;  4LF7 K;  1HNZ K;  1HNX K;  5IWA K;  4LFB K;  4YY3 K;  3J7A P;  3T1Y K;  4JI0 K;  4KHP K;  1N36 K;  1FJG K;  4CW7 B;  4NXN K;  4JV5 K;  2UUB K;  2F4V K;  2UUC K;  4B3S K;  4LF5 K;  4YHH K;  4V19 S;  5LMU K;  4LFC K;  2E5L K;  4DR4 K;  1IBM K;  4DV1 K;  4DR6 K;  4JI5 K;  1N34 K;  4JI8 K;  5A2Q O;  4JI4 K;  4DV0 K;  3J80 O;  2UXC K;  5BR8 K;  5LMN K;  4DUY K;  4B3M K;  3OTO K;  4NXM K;  2VQF K;  4JI6 K;  4LF4 K;  4LFA K;  1XMO K;  4DV4 K;  4DR3 K;  1XMQ K;  4JI1 K;  4DUZ K;  4DV7 K;  2UXB K;  4GKJ K;  4JI2 K;  4JI7 K;  4X64 K;  4DR1 K;  2UU9 K;  5FLX O;  4GKK K;  5LL6 Z;  1HR0 K;  4DR7 K;  2ZM6 K;  1N32 K;  4LF8 K;  4X62 K;  1I94 K;  2UXD K;  1IBK K;  4JYA K;  1HNW K;  1XNR K; 
#chains in the Genus database with same CATH topology
 2V7Z A;  1EKE A;  2HF4 A;  1KFS A;  4Z4I A;  1WNS A;  3OVN A;  4BR2 A;  5C42 A;  5IT9 O;  1GLF O;  4K41 A;  1JCE A;  2B5J A;  1RTH A;  1ATN A;  1OH6 A;  1S9G A;  1SKR A;  1C1A A;  4E1N A;  3EN9 A;  3M8P A;  2YHW A;  4PHT X;  1BOT O;  4IDK A;  4YOT A;  3T7Z A;  3UKR B;  4FWQ A;  4B1U B;  4ZHR A;  4DCH A;  4GW6 A;  2O4I A;  3SCX A;  3EO3 A;  5AZJ B;  1BWF O;  4FWL A;  1RTJ A;  3IAY A;  4CJU A;  2NRZ A;  1NWK A;  2W40 A;  3THY A;  3LPT A;  4NO7 A;  4BVO A;  4OKE A;  3AO1 A;  2XY5 A;  4DSF A;  3FFK B;  1TL1 A;  4CFB A;  2F8T A;  4M3Z A;  4B9S A;  5JMV A;  3KZB A;  1NGA A;  4CEQ A;  1NMN A;  2D0P A;  1Z25 A;  4H0Y B;  3TAR A;  4IG3 A;  4JKH A;  3OBW A;  4B3S K;  2Q3S A;  4YOU A;  3ATU A;  3AV9 A;  1M90 O;  4FWS A;  3ZX3 A;  1IBM K;  2ASM A;  3VEO A;  4W5Q A;  2HST A;  3O4W A;  4FL9 A;  3MN5 A;  3VA3 A;  3PO4 A;  5BN9 A;  2Q0U A;  3F2K A;  1KVB A;  3OYG A;  4Z4H A;  3NH0 A;  1X1P A;  4B9T A;  3TTF A;  3UKR A;  4A5A A;  4DTN A;  3CFR A;  3CCJ N;  4NCG A;  4DV7 K;  3ALY A;  2XY6 A;  3ZET B;  5AZJ A;  3CQY A;  4FYD A;  3KLF A;  3HM8 A;  3NGZ A;  3O80 A;  3DOL A;  4IFV A;  3SQ4 A;  1YIT N;  4A62 A;  3U9D A;  1TGO A;  2D0O A;  1DTQ A;  3LDL A;  4NYF A;  1I94 K;  4KV8 A;  5LJV A;  2QWQ A;  3AVL A;  1XNR K;  1OVY A;  1NGH A;  5H1S Q;  4Z4C A;  5DK5 A;  1YF5 L;  4DKW A;  4XEI A;  1MWK A;  4R5P A;  3S3N A;  4CVN E;  3LDO A;  3WNF A;  2NRH A;  2A1S A;  3DLE A;  3BF3 A;  3MK6 A;  5FRM A;  3M3Z A;  4BRC A;  3N4P A;  3QLH A;  3MEE A;  1NNE A;  4C1N K;  2ZD1 A;  1ASV A;  2P5G A;  3ULE B;  2KW4 A;  1DLO A;  1IG8 A;  5CHI A;  3SBG A;  2OZM A;  3AGK A;  2JWK A;  1W9H A;  2NLX A;  1QSL A;  4DV5 K;  2FSK A;  3ZET A;  2VWJ A;  1JXB A;  1OH7 A;  1CZB A;  4WE1 A;  4CJ7 A;  4AF1 A;  2YNH A;  1RCH A;  5BRE A;  5F0X A;  3AAP A;  1S72 N;  2YHX A;  4DS4 A;  3I8B A;  2XRI A;  5C10 A;  3HM9 A;  4M7X A;  4AIL C;  3DI6 A;  3PIO L;  2I7P A;  3SBT A;  3NF6 A;  1VSL A;  2GBZ A;  2GX9 A;  3SMP A;  4H0T B;  4JAX A;  2P9L B;  3C0B A;  3DLR A;  3NH1 A;  1NGG A;  4F8R A;  3R9P A;  4CZE A;  2QXF A;  3V9Z A;  2O8F B;  5TKY A;  1WAJ A;  2YKM A;  3UKU B;  1LWC A;  4CK2 A;  3K5O A;  2HVI A;  4YOR A;  3A5O C;  1NOY A;  5ADX A;  1XMQ K;  1U47 A;  1DGK N;  3A5N C;  5AR0 A;  3VES A;  1RBR A;  2D5R A;  3AO3 A;  2I7N A;  5GIN A;  1EQY A;  2I5J A;  3FGU A;  5TKW A;  2P9U B;  1B9D A;  4LSN A;  5LY3 A;  2ETJ A;  4X62 K;  4BG8 A;  1C0T A;  5HOO A;  3CQ8 A;  3NHG A;  3PX4 A;  1GLL O;  3RTV A;  4DLG A;  3SQ2 A;  3ID6 A;  4H0X B;  4BDY A;  1U2V B;  2CH6 A;  4KTW A;  1GLD G;  3AA4 A;  5AQI A;  5AFU H;  1X3M A;  5AQY A;  2QWR A;  3VEN A;  4FWP A;  2UUA K;  4K43 A;  1RT4 A;  2KFZ A;  2P9L A;  3E66 A;  1A5V A;  3PSI A;  1C0M A;  3PO5 A;  1X9J A;  3R8E A;  2HBK A;  3V1R A;  3FR0 A;  3PIP L;  3C6A A;  3UKU A;  2QKB A;  3RR7 A;  2AJQ A;  3UIQ A;  3AAR A;  3DMJ A;  2E88 A;  4CCH A;  3G71 N;  4KRE A;  1TL3 A;  3QEP A;  4FVU A;  1QHT A;  5BR9 A;  4DHY A;  4BC4 A;  2KLA A;  4E1J A;  5IWA K;  1YJ9 N;  1XUP O;  3BUZ B;  5I42 A;  4YOV A;  4FJI A;  3FE1 A;  3T1Y K;  5AQO A;  4BRM A;  4N5S A;  3B6P A;  3CME N;  3OJS A;  3CIP A;  2P9U A;  1NK8 A;  1Z6R A;  4W5R A;  5KGW A;  4JV5 K;  1EWR A;  3PX6 A;  4DQP A;  4H5T A;  1KSP A;  5JLF A;  3HPH A;  1EP4 A;  2OYQ A;  1Q86 O;  3VQP A;  1VHX A;  4BDZ A;  1GOA A;  3CF5 L;  1J5O A;  1HLU A;  2WC9 A;  4KRF A;  1Z26 A;  2HW3 A;  3SNN A;  3ENH A;  4IO8 A;  3KLG A;  1YIJ N;  4RW7 A;  4FJ5 A;  4PKI A;  3ZLJ A;  3DRS A;  4DV0 K;  1ZBL A;  3K58 A;  4CD1 A;  4DTJ A;  2OAN A;  5KRS A;  3RMB A;  4FLY A;  1UAX A;  2GTD A;  4KH4 A;  4DR3 K;  2IVP A;  3K5L A;  5BPL A;  4DSI A;  3ZSO A;  3CC7 N;  4FXD A;  1QSS A;  1R59 O;  2P9I B;  1HR0 K;  3EL2 A;  2D0B A;  3TAN A;  4W5N A;  3QNO A;  3WXL A;  1N32 K;  2RHK A;  4FM0 A;  3HP9 A;  2UXD K;  4QCL A;  1NGD A;  1REV A;  4CJK A;  4RW8 A;  4O8K A;  1K73 O;  4B9N A;  4FJG A;  2YKN A;  3DWL A;  4AHC A;  1YJW N;  4B3O A;  1NGI A;  4BGA A;  4B3R K;  1VRT A;  1NK0 A;  4BG9 A;  4B3T K;  2PYL A;  1IH7 A;  1FW6 A;  1RBV A;  4HTL A;  1RDA A;  3KIO A;  4X65 K;  2FBV A;  3AVA A;  1IBL K;  1VSH A;  4CJP A;  3G25 A;  2NNW A;  1O1W A;  1NJI O;  1NU0 A;  1TK5 A;  2P5O A;  4CZJ A;  2XO7 A;  2IC3 A;  3I0R A;  3D2E B;  3VEV A;  4N76 A;  4H5V A;  4DV2 K;  4PY5 A;  4C8K A;  5KQ8 A;  4CBW A;  4FJ7 A;  4DMN A;  4CHN A;  3L4Q A;  2E6M A;  3AVJ A;  2RE2 A;  1KLM A;  4AHS A;  1HQE A;  1NKE A;  3HXM A;  5HRR A;  2P9I A;  2PAV A;  5FPN A;  1MA9 B;  1QQM A;  3RRH A;  4NLC A;  3VQ7 A;  3WQT A;  3RR8 A;  4M3T A;  3T1A A;  4NXN K;  4FJ8 A;  3VOV A;  3P5J A;  2UUC K;  3OJU A;  4CEE A;  2G8U A;  2V7Y A;  3LP0 A;  3ATV A;  3LAL A;  5DM6 L;  4IDH A;  1EO1 A;  4KB1 A;  2AA4 A;  5M1P A;  1I39 A;  2KQ2 A;  2BUP A;  4E0D A;  3B8A X;  3R3L A;  4CE9 A;  3OYN A;  3E9L A;  3G10 A;  3RVC A;  4DUY K;  3O9Q A;  3M1F A;  3BF1 A;  4NXM K;  4AH9 A;  3DOK A;  4LFA K;  4CHY A;  5KTQ A;  3HVR A;  4CZM A;  2W6L A;  2YJF A;  3RSE B;  1RT6 A;  3K57 A;  4ILH A;  2OZS A;  4K8X A;  3P39 A;  4NLB A;  3WXI A;  1W2B M;  4CJ4 A;  2UU9 K;  3EE9 A;  4YDU A;  4ELU A;  3SQ1 A;  1JKH A;  3HL8 A;  4JD2 B;  1TKT A;  4FLT A;  3V9W A;  4IOA L;  1X9M A;  3GDQ A;  1HNW K;  2X74 A;  3D7E O;  1P8Z A;  1NKC A;  3TI0 A;  1NGE A;  3DJC A;  4BVP A;  4BRN A;  4GVM A;  3CM5 A;  3OS1 A;  2HHH K;  2BAN A;  3M8R A;  3H45 C;  4U7B A;  2HVH A;  3JXU A;  3VET A;  3TAE A;  4AM7 A;  1FXX A;  3PX0 A;  3VTH A;  3J8A A;  4B9L A;  1ZBH A;  3LAK A;  3VGM A;  4MFB A;  3K2P A;  1U6Z A;  2O4G A;  3CJ7 A;  2HOE A;  3TSP A;  4A2A A;  4KH5 A;  3RSE A;  4CFD A;  4B1X B;  3ZCM A;  3NF7 A;  1HNZ K;  3CCM N;  3O9S A;  4E7J A;  3M5R A;  2F9W A;  1E4F T;  3VF2 A;  3SPZ A;  4OPK A;  3P31 A;  2YX6 A;  4DS5 A;  4ISF A;  2VG5 A;  4F9O A;  3CD6 N;  1U04 A;  4JI0 K;  4JHD B;  4JRP A;  4JD2 A;  3ZSZ A;  2ZWH A;  2FSJ A;  1QHA A;  3O8M A;  4DTM A;  2RN2 A;  4JK9 A;  1BQN A;  3CCU N;  4KHS A;  1ESV A;  4EP5 A;  3LAM A;  5LMU K;  1QSY A;  2BE2 A;  3KD1 E;  4J2A A;  1ZXO A;  3QES A;  4ELT A;  4H0V B;  4B1Z A;  1L3U A;  4DWI A;  2HHS A;  3I56 N;  4E7L A;  4JI8 K;  1UOC A;  3S3M A;  3UB5 A;  1TVR A;  3SI6 A;  1XWL A;  2KZZ A;  3EYZ A;  5J2Q A;  3EE8 A;  1U4B A;  2OPS A;  4U67 L;  1SL1 A;  4N41 A;  3A8Y A;  2FLO A;  3A2F A;  3P4I A;  5GAG P;  3TAG A;  1L3T A;  1JLE A;  4JN4 A;  4FCY A;  3GOI A;  2VGN A;  5T7B A;  4DU3 A;  5HRP A;  1RDW X;  3G4S N;  3KD5 E;  5J1E A;  3O4Q A;  5FLX O;  4GKK K;  2E1Y A;  4YOX A;  2PFU A;  4RCH A;  4CK3 A;  1ZYQ A;  3DRP A;  3VQC A;  2NRR A;  3BEX A;  3DLL L;  4CF9 A;  4Y0W A;  3SAG A;  1Y97 A;  4EP4 A;  3OYB A;  4H5N A;  5AQN A;  3A0I X;  3NF8 A;  3L6Q A;  4JHD A;  4C8M A;  3MXM A;  4YDU C;  3D6R A;  1HPM A;  2G8F A;  4MDB A;  1NM1 A;  3L4I A;  2F7T A;  3AVM A;  1RTI A;  5BPN A;  4DFM A;  3VQB A;  4CEF A;  1HKC A;  2P9N B;  3K5N A;  4DLE A;  1S1X A;  1NJW A;  1J5E K;  4LF6 K;  4X66 K;  3WNG A;  4CJV A;  3V1O A;  4YOY A;  4DTX A;  4CGI A;  3OYC A;  1UA0 A;  3A5M C;  4M3R A;  1IKW A;  4BRI A;  4I2P A;  4JRQ A;  3F9K A;  2PZS A;  4KHQ A;  2D0A A;  1QZ5 A;  2P9K A;  2VYP A;  3DXM B;  3CMA N;  3U3Y A;  3WNH A;  5C12 A;  3CFP A;  3BDP A;  4AHU A;  3SPY A;  1TV6 A;  4YFU A;  1OVQ A;  4QS8 A;  4Y1C A;  4BC5 A;  4B9U A;  2IAJ A;  1SQK A;  4IFE A;  3OYF A;  1VQ5 N;  5E26 A;  3KK2 A;  1S6P A;  3ZT1 A;  4KHW A;  4A5B A;  4GV6 A;  1QQN A;  5D3G A;  3L0Q A;  4B9Q A;  4Z4E A;  1WLJ A;  3RWU A;  4I9L A;  3I8D A;  4DU4 A;  2HF3 A;  2FF3 B;  3TU5 A;  4H8K A;  2E6L A;  2P9N A;  5HRS A;  3CCL N;  1B9F A;  2E4L A;  2HHU A;  4F3T A;  4FJK A;  4JI6 K;  3ZX2 A;  3OBY A;  4BE1 A;  1BQM A;  3F5T A;  1E4G T;  4HUG A;  4UY8 O;  5GAH P;  1KTQ A;  3WUH A;  1XI1 A;  1VSD A;  3T3F A;  4JS5 A;  1UA1 A;  3KKS A;  3DXM A;  3KTQ A;  3OYK A;  3CER A;  4FK4 A;  2RPI A;  4JK8 A;  3SQ0 A;  3CFO A;  3E9O A;  4IEI A;  3QDK A;  3LP2 A;  2QW9 A;  4G9Z A;  2OTL N;  1BIU A;  1RT2 A;  3O6W A;  3CCE N;  4BAC A;  1GLA G;  3LDS A;  3HI0 A;  3SV4 A;  1CZA N;  3VQA A;  1VQP N;  4CHO A;  3KWG A;  4CGF A;  5KPZ A;  4DSE A;  3CCR N;  5AQT A;  5AQV A;  5M1K A;  1OKJ A;  2NRT A;  3KK3 A;  1FK9 A;  1YVN A;  2Z1G A;  4F4K A;  5F2R A;  1VQ4 N;  4BRF A;  4BRL A;  5HRN A;  3LM9 A;  3VEY A;  2OCE A;  5FRO A;  5F1X A;  4OJR A;  3HVT A;  3F73 A;  2YHY A;  5AZI B;  3VEW A;  1RBU A;  4IBN A;  3ENB A;  4Z4G A;  4AM6 A;  1E3M A;  3SAH A;  4M7Y A;  3ZEU B;  3WXK A;  2XHB A;  1SZ2 A;  1N36 K;  1VQ7 N;  3LWL A;  3CI5 A;  3CJ1 A;  3QB0 A;  1WUA A;  3LM2 A;  4LF5 K;  3OYE A;  2Q2R A;  3U3G A;  1RT7 A;  2QI2 A;  3KJV A;  3VN5 A;  1ASW A;  2O8E B;  3CC4 N;  5KI6 A;  4OPH A;  2FBY A;  5EY4 A;  4F2S A;  4WYB A;  4HTU A;  3SLC A;  3TTC A;  2HNY A;  3QIP A;  2PY5 A;  3QET A;  1VSM A;  4M3U A;  4FOI A;  4HWI A;  4PQU A;  3VF4 A;  3AVI A;  5CE3 A;  4W5O A;  1LAW A;  1GLB G;  4E89 A;  2G8K A;  4H5R A;  5AFU A;  3FLC O;  2XY7 A;  4M42 A;  3DLH A;  2FF6 A;  5AZI A;  5SWM A;  1TKZ A;  2P51 A;  2DFH A;  1R0A A;  1A5W A;  4OGC A;  2QWP A;  3SZ2 A;  1CXQ A;  3QER A;  1VK0 A;  3OHR A;  1C6V A;  3AVB A;  4CES A;  4CJ3 A;  3ZEU A;  2DFF A;  2DPN A;  4H0O A;  3EZW A;  2O8B A;  3CYM A;  3O1W A;  4FWN A;  1X3N A;  3L2R A;  4DF4 A;  4GV9 A;  1RGI A;  1KVA A;  4BR5 A;  4YNQ A;  1KAX A;  3H6E A;  2KHO A;  1V4T A;  4BR4 A;  1GLC G;  2O8E A;  3QIN A;  3ZSX A;  1BA0 A;  2HMI A;  4R79 A;  1T05 A;  1W7A A;  4EZ6 A;  3DAW A;  1KAZ A;  1W97 L;  3SUQ A;  3R6M A;  3AA3 A;  3MN7 A;  3J7Y P;  3NFA A;  2BH1 A;  4FWM A;  4CGD A;  4LFB K;  1YAG A;  2G8H A;  1JCG A;  2A5X A;  3NVM A;  5HBM A;  3AA2 A;  1BI4 B;  2HB5 A;  4BRK A;  1RNH A;  1FJG K;  1KRP A;  2ZE2 A;  4CW7 B;  3AO2 A;  3P38 A;  3IFR A;  1NK9 A;  2W41 A;  3FFI A;  3I33 A;  4FVM A;  4IJN A;  3SV3 A;  1YI2 N;  2P1J A;  4KHN A;  4YHH K;  4L8R B;  1ZBI A;  2E5L K;  5EXW A;  2HHQ A;  3HPO A;  5GAE P;  2Y1I A;  3ZSY A;  3KK1 A;  5J2P A;  3HOS A;  1RIL A;  4JI5 K;  1BIZ A;  3W0L A;  3O9U A;  3S9H A;  1BDG A;  2UXC K;  3HST B;  4C8N A;  3SAF A;  1ZBS A;  1Z05 A;  3BGR A;  3L2Q A;  2Y1J A;  1WSG A;  1WBD A;  2ASP A;  3L2W A;  1JLG A;  3OW2 M;  3WEE A;  4DF8 A;  3PUF A;  1QTM A;  2ATQ A;  3QBW A;  4J2B A;  1N5Y A;  2GUI A;  4A59 A;  5GIO A;  1MDU B;  5GAD P;  5M1N A;  4H4M A;  4F3O A;  4QOZ B;  4EIA A;  4A61 A;  1BI4 A;  4JKA A;  4MDA A;  3B6O A;  4K25 A;  2V51 B;  4ISG A;  3WXJ A;  3GG4 A;  3HP6 A;  3SMS A;  3NH2 A;  2CGK A;  3CM6 A;  3QEV A;  5GIP A;  4A2B A;  3PV8 A;  2VG7 A;  5JVG L;  4RTF D;  4O4G A;  3CJA A;  1XHZ A;  4CEO A;  4IOC L;  4PKG A;  4KPY A;  4DU1 A;  4CZF A;  1NMD A;  4DTS A;  5E84 A;  1V4S A;  4DFP A;  1LCU A;  2ZGY A;  2Z1I A;  4DR5 K;  3O3H A;  2KTQ A;  3L8B A;  2X6S A;  5E41 A;  3TSU A;  3K0S A;  2HBM A;  3J7A P;  2RKI A;  1YUW A;  1KQS M;  3O1B A;  1JLF A;  4Q0B A;  1Q9X A;  2IDO A;  2Z1H A;  1YXQ A;  2G8I A;  2F9T A;  1Q82 O;  3C6T A;  5JVH L;  1T7P A;  3O08 A;  3LWM A;  5C2D A;  1TUU A;  3MEC A;  3VQ6 A;  3JYT A;  4JS4 A;  1C1B A;  3SK3 A;  4B9M A;  4CIE A;  4OLB A;  5I9E B;  3EY1 A;  1DT9 A;  1VQK N;  1IKX A;  3G0Z A;  1DKG D;  3VQ9 A;  2GEM A;  3WT0 A;  3LZI A;  4O0I A;  2A6A A;  1N8R O;  2HHX A;  1VQL N;  3O4N A;  4FWR A;  1S1U A;  5LL6 Z;  3OYM A;  1YTU A;  3S3O A;  2BTF A;  2QM1 A;  3OA9 A;  4ZTJ A;  4CF8 A;  3HT3 A;  3MDQ A;  4FJN A;  3NGI A;  3IDH A;  1BA1 A;  1NGF A;  5KPR A;  3DLG A;  4CIF A;  4FJJ A;  3AVF A;  4CJS A;  1K9M O;  3TTD A;  5AQF A;  2VQE K;  4HVJ A;  5B8H A;  3SUP A;  4ID5 A;  4IG0 A;  4EFH A;  4KHU A;  3DLB A;  4AHR A;  3KLI A;  4FJH A;  4HUF A;  1T6C A;  2WOM A;  2ZJQ L;  3QNN A;  5FDL A;  2E8A A;  4CJT A;  3O9T A;  4PKH A;  3ZYY X;  3VQD A;  2WTU A;  2E20 A;  4DSK A;  2QA4 N;  1NGB A;  4CGH A;  3QFP A;  4ID1 A;  3GL1 A;  2YHB A;  4B9V A;  3K9K A;  3NGY A;  2WFB A;  5AQW A;  1KFD A;  3EZ5 A;  3OS2 A;  3TAM A;  4BDP A;  1RDC A;  4FO0 A;  4CD3 A;  5BRF A;  2F4V K;  2HHT A;  2YI1 A;  1J9A A;  4XH1 A;  2BDP A;  4FK0 A;  3ITH A;  4CJE A;  1IV0 A;  4CBX A;  2A3Z A;  5C24 A;  5DMR A;  1HJO A;  4BRP A;  4CJ5 A;  2B4J A;  5A2Q O;  1VQ8 N;  1Q8I A;  4ILG B;  4J2D A;  3J80 O;  4PWD A;  5KGX A;  5BR8 K;  3OY9 A;  4B1V A;  3IUC A;  3NCI A;  2VQF K;  4FJM A;  1XHX A;  4PUO A;  4FJX A;  3AO4 A;  4WFN L;  3OYA A;  4JI1 K;  4CZL A;  2W6K A;  1VAZ A;  2ZJR L;  2A41 A;  2Q0R A;  4X64 K;  3AVG A;  4CEZ A;  2WUS A;  4CBU A;  1NK6 A;  4CZG A;  3NDK A;  5EX5 A;  3RMA A;  1S6Q A;  4OPA A;  2ZM6 K;  3VEZ A;  2R7Y A;  3VF6 A;  1RBT A;  4EAH D;  3KHY A;  4ELV A;  3H1Q A;  3NMU A;  4J8F A;  2PYJ A;  1EX4 A;  4JYA K;  1HYS A;  4FZX C;  3P1G A;  1S5J A;  3UE5 A;  5FPE A;  2G8W A;  4BRH A;  3D0P A;  3K5M A;  3CXC M;  2QEX N;  1IG9 A;  3H46 O;  2P9K B;  2AP1 A;  4E7I A;  4FWK A;  4BC2 A;  1ILY A;  1GOB A;  3C6H A;  3CCQ N;  3MCP A;  1XC3 A;  3TAP A;  4DB3 A;  4FZY A;  3CCS N;  4L3Q A;  3QIC A;  3KLE A;  4PL7 A;  4AQY K;  1Q9Y A;  1WSE A;  3QO9 A;  1Y64 A;  4BRA A;  4E3S A;  3CG7 A;  3M8Q A;  3FZL A;  4Z94 A;  3MWP A;  4DV3 K;  4GNI A;  5AJ3 K;  3J81 O;  3KKR A;  4DQQ A;  1KC8 O;  3D2F B;  4O8U A;  3W3D A;  4BR9 A;  3RMC A;  4LF9 K;  4BQL A;  4JKD A;  2JGU A;  5C2F A;  3T69 A;  5FRN A;  5AQM A;  1BL3 A;  2X6N A;  3K9J A;  1C0U A;  1BHL A;  3VQ5 A;  4KHP K;  1D4X A;  1BUP A;  3MWT A;  2E2P A;  4C1N I;  4OGE A;  1K8K B;  1NGC A;  5J2N A;  2YV0 X;  1RBS A;  5M1F A;  2YHA A;  4HUE A;  1RT5 A;  3IG1 A;  2FXU A;  4CK1 A;  3LP3 A;  1DEJ A;  2IS3 A;  4GVE A;  3SYZ A;  4LH5 A;  4DV1 K;  1BGX T;  4FW2 A;  3MN6 A;  4FWO A;  3V9X A;  4BWJ A;  4OO1 J;  4M3W A;  4LY7 A;  2NRV A;  4M3Y A;  3WXM B;  1SAZ A;  4BRD A;  4E1M A;  3IKM A;  4CJR A;  1BG3 A;  2ITM A;  3QIO A;  4WQ4 C;  5JIC A;  4WQ5 C;  4BY9 C;  4DTR A;  2LSN A;  2IOC A;  5CYM A;  3U4L A;  4GY2 B;  4JI7 K;  3HOT A;  3JS6 A;  2QWL A;  3OYD A;  4DR1 K;  4BRO A;  2JWL A;  3P83 D;  4FPA A;  3D2F A;  3OYL A;  4C8O A;  4O55 A;  1BCM A;  1U49 A;  1QVF M;  1I3A A;  3QML A;  3AAQ A;  3ZSR A;  3SJJ A;  4LF8 K;  5AQX A;  2Q31 A;  4LSL A;  2EX3 A;  1IBK K;  4FJL A;  1T8E A;  4EZ9 A;  4ICL A;  3EKS A;  2NUB A;  3Q7C A;  4CI6 A;  3PSF A;  3SUO A;  3L3U A;  3MX5 A;  5AQJ A;  2PBD A;  4M45 A;  4AHT A;  1K8K A;  3MMV A;  3JAM O;  1GLE G;  4O5B A;  1NKB A;  2H3G X;  3LDP A;  3IMX A;  5DM7 L;  1KD1 O;  4LC9 B;  1EET A;  1KCF A;  2KZM A;  2F96 A;  4DQS A;  3HSC A;  4CIG A;  4DV6 K;  2FBT A;  4K0K K;  4CER A;  1T03 A;  2QWN A;  2ASO A;  2CGJ A;  4I9Q A;  4OVL A;  4O5F A;  2A40 A;  1ASU A;  3C95 A;  3FZK A;  1HYZ A;  3T1H K;  4FK2 A;  4FLV A;  1LWF A;  3HK2 A;  1WB9 A;  3AVC A;  1VSI A;  5CZ1 A;  4RG8 A;  3L3V A;  3ID8 A;  1HNX K;  4OLA A;  4GMJ B;  2KKZ A;  4CJW A;  1QE1 A;  3K59 A;  4EHU A;  5J2M A;  2A42 A;  1HX1 A;  1JL1 A;  3C7N B;  5FPM A;  3U8X A;  4JKE A;  1KVC A;  1J54 A;  3LDQ A;  4DR4 K;  1IKV A;  1HKG A;  2CGL A;  3ZSQ A;  3G6E N;  4QS9 A;  1S1W A;  1RT1 A;  4N56 A;  4IOX A;  4NYN A;  3QFU A;  3VQ4 A;  4N47 A;  3VGK A;  1NJY A;  4KFB A;  1L3V A;  1T3V A;  3QBX A;  4WCE L;  4B3M K;  4CEB A;  2O8B B;  1K8A O;  1TK8 A;  4H03 B;  3S41 A;  5CR4 A;  1OH8 A;  4OKJ A;  1SL0 A;  4Z4F A;  1NJZ A;  3FZF A;  4MLH A;  4BC3 A;  2GUP A;  3LZJ A;  4CZI A;  4I6M B;  3THW B;  1MU2 A;  5MLC Q;  2E1Z A;  3O3G A;  5K14 A;  3V4I A;  1JLQ A;  4O0J A;  1N6Q A;  1HNI A;  5AQP A;  1FKO A;  1HPZ A;  2HND A;  3C7N A;  4IJA A;  4DR2 K;  4KTZ A;  1WOQ A;  4KTQ A;  3HO1 A;  3CET A;  1D9F A;  3AA5 X;  3CJC A;  5C15 A;  3H1V X;  1HUX A;  5AQU A;  4RW9 A;  1OH5 A;  3M6G A;  1Q7Y O;  4LH4 A;  3I0S A;  3ZSV A;  4FM2 A;  1LAV A;  1FKP A;  4FLX A;  2OTJ N;  1TAQ A;  5FPD A;  1D8Y A;  4KI6 A;  1VSF A;  2P9P B;  3AVH A;  3DYA A;  4JNE A;  2G8V A;  1U48 A;  1J6Z A;  1D9D A;  3KK7 A;  2EHG A;  1VQ9 N;  1SS6 A;  1SUQ A;  3L2U A;  3CPE A;  3MXJ A;  3JSM A;  3L2V A;  1N33 K;  2IVO A;  2GEL A;  4CJQ A;  5HP1 A;  4JEP A;  4LF7 K;  4K42 A;  5KQD A;  4RW6 A;  4YY3 K;  1Q18 A;  2QWO A;  2OPP A;  4BGB A;  3ZT3 A;  3E1Y A;  4IXC A;  4B08 A;  4JKG B;  1ZC6 A;  2B6A A;  4I6M A;  2UUB K;  4UQG A;  3THW A;  2ZF5 O;  4YOW A;  3CHW A;  3QEI A;  2D0C A;  2QK9 A;  4FW1 A;  4F2R A;  1RFQ A;  4MLE A;  3WEE B;  3D45 A;  2W42 A;  3ULE A;  2VWK A;  3MCA B;  2IVN A;  3AGR A;  4CFC A;  4Z0U A;  1WSI A;  3VMF B;  2VWB A;  1X9W A;  1EWQ A;  5M1O A;  3VQ8 A;  4KO0 A;  3N4Q A;  2VCP A;  1LOT B;  2FC0 A;  5AQS A;  4AHV A;  2YNG A;  4FOE A;  1NLV A;  3OYH A;  3C94 A;  4QS7 A;  5BN8 A;  3VPZ A;  3NVK A;  4CED A;  1RDB A;  4FZZ A;  3V9S A;  1D5A A;  4MO5 A;  3THV A;  1G15 A;  4CHP A;  2Q97 A;  1VQ6 N;  2UXB K;  2P9P A;  4GKJ K;  4H5W A;  3DXK B;  4Q5V A;  2HBJ A;  1WAF A;  1YT3 A;  3EKU A;  2KFN A;  3DM2 A;  5BRD A;  2ZQB A;  1KLN A;  4KAZ A;  4GV3 A;  2O8D B;  1YTA A;  4O44 A;  5JS2 A;  2HHW A;  3F9M A;  1GOC A;  4DSL A;  3TSQ A;  1VQM N;  2CH5 A;  4E19 A;  4CF2 A;  1TKD A;  1NGJ A;  2O8F A;  4K8Z A;  4RWT A;  1JLC A;  3HZ6 A;  1BIS A;  4JKG A;  1RTD A;  5ADX H;  4W5T A;  1TK0 A;  1EXQ A;  3AVK A;  4CJF A;  4JKF A;  1S22 A;  4CGG A;  4I7F A;  1WSF A;  4I2Q A;  1BO5 O;  2HBL A;  1WBB A;  4CJL A;  4TSX A;  4BR7 A;  1SL2 A;  2QKK A;  4IWV A;  3TAF A;  1MWM A;  3LDN A;  4CEA A;  4BQZ A;  3MN9 A;  3V81 A;  2QTD A;  1SV5 A;  1HYV A;  2FBX A;  3BZC A;  4WF9 L;  3R1X A;  1XNQ K;  1U2V A;  3GE1 A;  3Q7B A;  3AY9 A;  3WQU A;  3BY5 A;  3H3O B;  3CC2 N;  4IO9 L;  4FM1 A;  2Q1N A;  3BZK A;  1VQN N;  3DXK A;  3TWH A;  4DSJ A;  1ITG A;  3PY8 A;  5KRT A;  4XH4 A;  2E2Q A;  4J2E A;  1LW2 A;  1J53 A;  2O8D A;  2GV9 A;  4JK7 A;  2O8C B;  4CZK A;  4B8A B;  1NG9 A;  3ASM A;  2HMP A;  4ZTF A;  1XC9 A;  3BP8 A;  3O5B A;  5M1Q A;  2OA8 A;  3H08 A;  2NRW A;  3MEG A;  1TUY A;  4DTU A;  3I55 N;  1N34 K;  1X9S A;  3C65 A;  5SZT A;  1S9E A;  4B1Y B;  2X78 A;  1T6D A;  3V1Q A;  3QEX A;  1YHQ N;  4CEC A;  4BRQ A;  5AQK A;  2BGG A;  4LF4 K;  1XMO K;  1IJJ A;  1KAY A;  3IS9 A;  4HCC A;  4NCB A;  1JLA A;  4XIU A;  1VRU A;  4BR0 A;  4DUZ K;  2DY4 A;  4JI2 K;  2Q36 A;  4PA1 A;  2IIR A;  1G99 A;  3ZT0 A;  2DFE A;  2P9S B;  2XY8 A;  4B8C A;  2WON A;  3ZX0 A;  4FPB A;  5CYQ A;  1F21 A;  3OYJ A;  1WSH A;  1VSE A;  4FLU A;  4FLW A;  4XH5 A;  1NK5 A;  2QWM A;  3TPQ A;  4H4O A;  2YNI A;  1L3S A;  4OX9 K;  4OKK A;  4PL8 A;  2UYT A;  2OPQ A;  3CPW M;  3VER A;  2O8C A;  3ZT2 A;  3LP1 A;  2E2O A;  3OYI A;  1DTT A;  4KH6 A;  1IKY A;  4C23 A;  3LL3 A;  2Z1J A;  3IRX A;  3NBP A;  1C1C A;  5JLH A;  4JKC A;  3V9U A;  2GWJ A;  1YJN N;  5AQR A;  4IKF A;  4M3X A;  5C0Y A;  1CXU A;  4JKB A;  2YNF A;  5BPM A;  2NRX A;  1CZ9 A;  4DQI A;  1LWE A;  1U45 A;  1JJ2 M;  4IEE A;  3H3N O;  1HKB A;  3OS0 A;  3MXI A;  1JL2 A;  3TAQ A;  5CY4 A;  2P9S A;  4CF0 A;  3ULD A;  1NJX A;  4DTP A;  4FLZ A;  3M8S A;  1XQS C;  5CZ2 A;  3TAB A;  2V52 B;  3GBT A;  4WFA L;  3D2E A;  3NAE A;  1K6Y A;  2YJE A;  3FZM A;  1JLB A;  5ELZ A;  3MAQ A;  4DFJ A;  2J4R A;  5LJW A;  1SKS A;  3HTV A;  4E7K A;  1NK7 A;  4DR6 K;  2GWK A;  3A5L C;  3O9R A;  2WBN A;  3ZSW A;  1ZBU A;  1TYQ B;  3MX2 A;  1YVU A;  3AO5 A;  2A1R A;  4JI4 K;  1TAU A;  5AQL A;  4CFA A;  3THX B;  1WN7 A;  4DFK A;  3CJ9 A;  4B1W B;  4CZH A;  3ISN C;  3MED A;  1KXP A;  4DV4 K;  5HRO A;  3VGL A;  2QXL A;  4BWM A;  2EWS A;  5HL7 L;  4HCB A;  2JLE A;  4DTO A;  3E9P A;  1T44 A;  1UWB A;  1S1T A;  4DR7 K;  1L5U A;  4WQ4 A;  4BE0 A;  4WQ5 A;  3O3F A;  1VSJ A;  1RT3 A;  2DTU A;  4G1Q A;  3U6F A;  1JCF A;  4FJ9 A;  4FSV A;  4MQ3 A;  4DQ8 A;  5AQZ A;  4KBO A;  3PLA A;  2ZGZ A;  1W0H A;  3KWI A;  4LD0 A;  4DQR A;  3C6U A;  3HBT A;  1QQO A;  4BRE A;  3AVN A;  1TKX A;  3VQE A;  2NZT A;  1HMV A;  1CLQ A;  3WNE A;  1LV5 A;  5AQG A;  1QZ6 A;  1HJR A;  2VGM A;  3ZT4 A;  4KI4 A;  1LW0 A;  4ISE A;  2F8S A;  3V6D A;  3U9Z A;  4JI3 K;  3CCV N;  3SJH A;  2ZJP L;  4KHY A;  4JLH A;  1S1V A;  3KVG A;  1NOZ A;  5C25 A;  1BU6 O;  4IFY A;  1TYQ A;  2D1K A;  4WFB L;  4IZ9 A;  1HQU A;  1VSK A;  1HNV A;  3HPG A;  1QQC A;  3FZH A;  4BRG A;  3THX A;  4ILJ A;  2FSN A;  1NBW A;  5AQH A;  1P90 A;  1O13 A;  3VA0 A;  1S3X A;  4OPJ A;  3NE6 A;  4CHZ A;  5JS1 A;  3VEX A;  1GLJ O;  3DLK A;  4KKO A;  4BE2 A;  5EVZ A;  1M1K O;  2OPR A;  4EHT A;  5BRH A;  3HJF A;  1NK4 A;  1QS4 A;  1A5X A;  4A57 A;  5I3U A;  3RMD A;  1SKW A;  1BCO A;  4M63 C;  3HYF A;  5HLF A;  1HRH A;  2RF2 A;  4KB0 A;  4E7H A;  1Q81 O;  5AQQ A;  3VQQ A;  3DRR A;  1ATR A;  4V19 S;  1C0G A;  1VQO N;  4LFC K;  1RDD A;  3HRG A;  1H1V A;  4M41 A;  3J7Z O;  4H0P A;  1C0F A;  3TR8 A;  2HHV A;  4DG1 A;  4NCA A;  4QAG A;  5EU7 A;  2D4W A;  3ENO A;  4NB4 A;  2VG6 A;  4CGJ A;  2E2N A;  5LMN K;  3VTI A;  3QEW A;  1QVG M;  1RDU A;  3OTO K;  3E01 A;  3LPU A;  3RRG A;  3KLH A;  1ATS A;  3THY B;  2HNZ A;  3SUN A;  4C8L A;  3EEQ A;  4CF1 A;  1JXE A;  3CJB A;  5KPT A;  2ITG A;  1WSJ A;  1B92 A;  3NF9 A;  3CQX A;  3T19 A;  4Y1D A;  4CHQ A;  1ZBF A;  2IGI A;  4HHT A;  1IO2 A;  4RW4 A;  2YCH A;  5EOY A;  4MO4 A;  3LAN A; 
#chains in the Genus database with same CATH homology
 4OX9 K;  4B3R K;  2HHH K;  5IT9 O;  4B3T K;  3JAM O;  4CVN E;  4DR2 K;  4X65 K;  2VQE K;  1IBL K;  2UUA K;  4JI3 K;  4DV6 K;  4K0K K;  1J5E K;  4LF6 K;  4X66 K;  4AQY K;  4DV2 K;  4DV3 K;  1XNQ K;  3T1H K;  5AJ3 K;  3J7Y P;  3J81 O;  1N33 K;  4LF9 K;  4DV5 K;  4DR5 K;  4LF7 K;  1HNZ K;  1HNX K;  5IWA K;  4LFB K;  4YY3 K;  3J7A P;  3T1Y K;  4JI0 K;  4KHP K;  1N36 K;  1FJG K;  4CW7 B;  4NXN K;  4JV5 K;  2UUB K;  2F4V K;  2UUC K;  4B3S K;  4LF5 K;  4YHH K;  4V19 S;  5LMU K;  4LFC K;  2E5L K;  4DR4 K;  1IBM K;  4DV1 K;  4DR6 K;  4JI5 K;  1N34 K;  4JI8 K;  5A2Q O;  4JI4 K;  4DV0 K;  3J80 O;  2UXC K;  5BR8 K;  5LMN K;  4DUY K;  4B3M K;  3OTO K;  4NXM K;  2VQF K;  4JI6 K;  4LF4 K;  4LFA K;  1XMO K;  4DV4 K;  4DR3 K;  1XMQ K;  4JI1 K;  4DUZ K;  4DV7 K;  2UXB K;  4GKJ K;  4JI2 K;  4JI7 K;  4X64 K;  4DR1 K;  2UU9 K;  5FLX O;  4GKK K;  5LL6 Z;  1HR0 K;  4DR7 K;  2ZM6 K;  1N32 K;  4LF8 K;  4X62 K;  1I94 K;  2UXD K;  1IBK K;  4JYA K;  1HNW K;  1XNR K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...