3T1AA

Crystal structure of hiv-1 reverse transcriptase (k103n mutant) in complex with inhibitor m05
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
558
structure length
554
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse Transcriptase
publication title Design and synthesis of conformationally constrained inhibitors of non-nucleoside reverse transcriptase.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
total genus 155
structure length 554
sequence length 558
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3t1aA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t1aA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t1aA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t1aA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3t1aA05
4HCBA 3DLRA 3C94A 2KZZA 4CJRA 2IAJA 3TWHA 2HHTA 4JLHA 2F8SA 3KHHA 3VQ8A 5KRSA 4CFBA 1BQMB 2FLPA 3QO9B 1N48A 1SKRA 3SPZA 1YT3A 1DTQB 4ELVA 4LH4A 4GC6A 1HRHA 3ZSWA 4ECUA 3KLVA 4EZ6A 1JLGA 4OGCA 2J6TA 2ZQBA 3NBPB 1SUQA 4ZTJA 3L3UA 2WCXA 3I8DA 5KFIA 1ZBIA 4WFXA 5F9NA 1D9FA 4FJMA 4TY9A 3K5OA 1SL1A 3QINA 4HTUA 3MEEA 4H4MA 3BQ1A 4YMEA 4OKEA 1JLAB 3WNEA 3KK2B 4URQU 4R8UA 3OL8A 3AVHA 3AVBA 3EZUA 2IC3B 1T7PA 2YNGB 1RBTA 3QEPA 3O3GA 3CJ4A 4I2QA 5KG5A 4G1QA 4B3OA 4CF0A 5C25A 2IJNA 3M8RA 4KAZA 5KFPA 3H40A 4DS5A 5K14B 4O4GA 1S9GB 1S6PA 4K4ZA 4CF2A 2AJQA 4DFMA 4BDZA 4FJNA 3HYFA 3Q8QB 3V4IB 2AGQA 4FM0A 1IG9A 1KVBA 4QAGA 2R8HA 1C1CB 1RT2B 1VSDA 4RG8A 3MR3A 5SWMA 5C5JA 2W9CA 4NLRA 4DSIA 3E01B 4MKAA 1WSFA 4DU1A 1C1AA 2UVVA 2EX3A 5HLFB 3RR7A 2FJVA 2OPPA 2WK4A 4IH7A 4RNNA 1KTQA 4Q5VA 5KFNA 1NK0A 1Y97A 4CF8A 4KKOB 4B9NA 1C6VA 4BE1A 3HJFA 3SQ1A 4F4WA 1TV6A 3FDSA 4K4TA 1L3VA 4ZVHA 3LP0A 4MFBB 3TQ1A 4HHTA 2D0CA 5EUHA 4CHPA 2Z1GA 4M3YA 1T03A 4JS4A 5F8MA 3UIQA 4KSEB 1KVAA 4KTZA 1X9WA 2G8FA 4CIGA 4LSNB 3FSIA 4NYZA 1HYSB 3PUFA 2GC8A 1VSIA 3N6NA 3H08A 3CVKA 3ZSYA 2HHQA 1JXLA 4Y34A 4F8RA 4N5SA 4K4SA 2RKIB 2QV6A 3H4DA 1L3UA 2A1SA 4EO8A 4J9LA 1BQNB 3ISNC 4KB0A 4DMNA 4RW4B 4CJSA 1RT1A 4PY5A 2IGIA 4QWCA 3LAMA 3TAGA 4KTWA 1RTDB 2WONA 4Q8FA 2CJQA 3NL0A 5J1EB 2C28A 4KB1A 1FKPB 2ALZA 2OPSA 4IKAA 2GUIA 4RNMA 3LP3A 3ULDA 2BQ3A 3QIDA 4LQ3A 2W8KA 3CJ0A 4W5OA 2HNYB 4I2PA 3AO3A 3GV7B 3OLBA 4JV1A 4FJ8A 1KHWA 1C0UA 3GIKA 2FVSA 3NDKA 4IH5A 1NJYA 4WXWA 4YQWA 2RPIA 1UA0A 4TN2A 3ICLA 1DLOB 4OVLA 2FVPA 2BDPA 1LWCA 4M42A 3ZSXA 2OPQB 4ED3A 4CHNA 3C6UA 1HPZA 1HMVA 3CIZA 3KTQA 2HHXA 3RMAA 4M41A 4CHYA 3DYAA 4Q8EA 4NLWA 4Y1DA 5JS1A 4FJ5A 4RW8B 2OYQA 3HP6A 3QEVA 2X74A 2XY8A 2D3ZA 5I3UA 1RBVA 4Q43A 1EP4A 1Q9XA 4F2RA 1RT3B 3MF5A 3OS2A 5CYQA 4RW9A 4NLXA 1YTAA 2WHOA 4EEYA 4IR1A 2R2SA 3HM9A 3UQSA 2QKKA 2WTFA 3SFGA 1CZ9A 2E6MA 3JYTA 3CG7A 4ED0A 4K8ZA 4ECXA 4CECA 4KI6A 3QLHA 5DLFA 1KCFA 4CF1A 3CDUA 1RDBA 1RTHB 3FQKA 3HP9A 1SUQB 2R8GA 1ZBFA 2IDOA 5HP1B 3BR9A 4GW6A 3NF7A 1TP7A 4ID1A 1CSJA 4BWMA 3H5SA 4W5QA 3PX0A 3MEEB 4H4MB 4F4KA 3RAQA 3NGZA 3CQ8A 5C42A 4CGDA 4CF9A 3IGVA 1S9EB 2P5GA 5EWEA 4DTOA 4KI4A 2HWHA 2F8TA 2W9AA 2ILZA 3VQBA 1NHUA 4G1QB 3DLEB 1EKEA 5C25B 4CJ5A 5HRSA 5F8LA 4DTMA 1LW2A 1BIUA 3KLEA 4DU3A 4O4GB 1S6PB 4FJIA 4EZ9A 1J5OA 2C22A 4PUOB 4DTUA 3CO9A 3M8PA 5T14A 3OY9A 5KGWA 5F8NA 3SYZA 3ZT2A 1A5WA 3PO5A 1NK5A 5F8IA 2HW3A 1W0HA 3LP2A 1JLAA 4J9KA 3KK2A 3BREA 3SUPA 3DRPA 3QESA 4CGJA 1BCMA 4FS2A 4KHWA 3NKYA 3BJYA 4CIEA 1QUVA 3FFIA 2J6UA 5KG6A 3NCIA 1REVB 2VA3A 3KHRA 4Z4GA 3M9OB 4IR9A 3AA3A 4KAIA 4CEOA 4YFUA 2C2DA 5EU7A 5KRTA 5K14A 1IKXA 3I0RA 4K4UA 3V9XA 4DU4A 4LQ9A 3MXIA 3AA2A 4EP4A 3DLGA 4FZYA 4IFVB 3V4IA 3BQ0A 4E89A 4ECTA 3LP0B 4NRTA 3AVNA 3AA5X 4K4YA 1S1TB 1T03B 1VSEA 4CEAA 2BANB 4ELTA 1D0EA 4OLAA 4NLVA 3D28A 5KT4A 1U45A 3IS9A 2D0AA 4CEBA 4NCAA 3NF9A 4KRFA 1IKYA 2AGPA 4OPKA 5EWFA 2ASLA 4LSLB 3BDPA 4FJHA 1CXQA 4CJEA 3QIOA 4L8RB 2X6SA 3LZIA 4XPCA 2PYLA 2G8IA 2J6SA 3HVAA 4XIUA 4Q45A 4DLGA 4BACA 4QWBA 1XR6A 4KREA 1SKWA 2WONB 4KHYA 1WSGA 3QEXA 2CKWA 2F8EX 2WOMA 2XHBA 1BI4B 1C0MA 4E1NA 1TKDA 4K4XA 1TK5A 4ED2A 2OPSB 4MFBA 2VWKA 3QEWA 1LW0A 4ZP6A 4J9MA 2ATLA 4FJJA 4ED6A 1HYSA 3TAPA 3HSTB 3AO1A 3OYLA 4E0DA 2IM0A 4ZP7A 4WFYA 2W7PA 3OYNA 2RKIA 4I2PB 5KI6A 2ILYA 4DSFA 3QNOA 3PX6A 1BQNA 2XRIA 4RW4A 2BRKA 1NJWA 1CZBA 1T05B 4K50A 4F3OA 3GYNA 4DTSA 3L2RA 3OHAA 3WNGA 1UAXA 1LWEA 4I9LA 1LWCB 3LANA 1FKPA 5KFVA 1HMVB 4RUAA 3WNFA 4RU9A 1S97A 3FRZA 3OYAA 3PJXA 4M3XA 1RT4B 3DYAB 1S49A 4DF4A 1FKOB 3SNNA 2HVIA 4PWDA 5KG3A 4ZPBA 4JS5A 4FVMA 3RWUA 3VQCA 1RA6A 3PW2A 5I3UB 5JS2A 4NYNA 2GIRA 2Y1JA 4ZPDA 1N5YA 5KFHA 4ZHRB 4U6PA 1RILA 4E7LA 4KE5A 5FROA 2JLEA 1JLCB 3SQ4A 1JLBA 5KT6A 4Y1CA 1TVRA 3WNHA 2RDIA 2P5OA 1SKSA 2HWIA 3QLHB 4FJLA 5JXSA 3K2PA 3D0PA 4H8KA 1Z26A 3IGNA 3MR5A 4U7CA 1VK0A 2KQ2A 1WSHA 2YNHB 2UUWA 1B9FA 3QIPA 3AVCA 1WNSA 4O3NA 3ZT4A 1UWBB 5KFGA 4ED7A 1Z25A 4HVJA 2ASJA 5SZTA 5KG0A 1Z4UA 4IFYA 5DLGA 4CEEA 3KK3A 1S1VB 3OS0A 3VQSA 3UDLA 3K5NA 1U04A 1RYSA 2JC0A 1KFDA 2JEGA 1EXQA 5KFEA 1C1BB 3SV4A 1HARA 3KLGA 3IAYA 3HK2A 4XPEA 1BL3A 5L1JA 1ASVA 1FXXA 4ZVFA 1ZTTA 1LW2B 4GVMA 3KLEB 1RTHA 2D0BA 1J5OB 4IG0A 5KT7A 4WXOA 4MH8A 1SL0A 3SQ2A 3M8PB 5HP1A 3QGIA 1X9MA 1I39A 3V81A 3NAIA 1WAJA 4O4RA 1RBRA 1NK8A 4WE1B 5HROA 5EWGA 4TY8B 4H54A 4GC7A 1TK8A 2HB5A 1RDAA 3LP2B 3DRRA 2PYJA 2HHWA 4IDKA 3DRPB 5CY4A 3KLIB 4KB7A 4W5TA 1S0NA 1HNIB 1S9EA 4DFKA 1J53A 3BGRA 4E19A 1WAFA 3O4NA 3FFIB 3V9WA 5DQIA 2HMIA 1S0OA 4QPXA 3P5JA 3CFPA 3KLHB 4AHUA 3PV8A 3DLEA 3KLFB 3H59A 1CLQA 1L3SA 3OYMA 1IKXB 3I0RB 3T3FA 4C8LA 3TAFA 2ZE2B 3OL9A 4PUOA 2IM1A 3DLGB 1HYZA 2B6AA 3NGDA 4TQRA 3NGYA 2G8KA 5DG8A 4I7FA 1IKWA 4N41A 2E4LA 3MR2A 3K58A 1S9FA 5HRPA 1J54A 2E9TA 3IS9B 4TSXA 2JEIA 2XWYA 1IKYB 1REVA 5C24B 4HKQA 3H5YA 1U4BA 1SV5B 3MEDA 3P1GA 1MMLA 3ZSQA 4F2SA 2G8HA 3B6PA 1LAWA 3H5XA 5KFBA 4YR0A 1RA7A 4FXDA 1R0AB 4HUEA 2W9BA 5T7BA 4ZPCA 2WOMB 4ZVGA 5FRNA 4ECSA 4IFVA 2ATQA 3ZSZA 4CJLA 4XO0A 4OLBA 3ZT1A 4J9OA 1A5XA 3EY1A 1S6QA 1LW0B 4ECWA 1S1TA 3JSMB 2BANA 4DS4A 4DG1B 4C8KA 4CHZA 4EP5A 3RMCA 4CHQA 4R5PB 4FJ9A 1U48A 3HO1A 2X6NA 1D9DA 4LSLA 3T5LA 3OYKA 4NCBA 4WFZA 4O3PA 3ALYA 3GIMA 1JLEA 1D8YA 4CJWA 1L5UA 3AVGA 5FDLA 5KFQA 2FVQA 3PR4A 4DQPA 4DSLA 1N6QA 4DQRA 1K6YA 5KFMA 1QS4A 4NZ0A 1BI4A 1XI1A 1LWEB 1Q8IA 2XCPA 3GIJA 3GILA 3NF6A 2ETJA 3GIIA 4C8MA 4IG3A 4M3WA 3SI8A 3OYFA 1NOYA 4HCCA 4RNOA 4DQQA 4PWDB 1SH2A 2KFNA 3LALA 4J2AA 1TKZB 1NNDA 3MR6A 2WRMA 3U3YA 3N6LA 1MU2A 1GOCA 1N5YB 1T05A 4URGA 2Z1HA 2RN2A 4CGFA 3QGHA 4CFCA 3DLKB 2ZKUA 2G8UA 2R8KA 1JLBB 4DTXA 2DTUA 3ZT3A 3BSAA 3CWJA 3SUOA 1TVRB 3E51A 3H5UA 5KFZA 4B9MA 3HVTA 1TL3B 1RT4A 5J2PB 4RW6A 3IRXB 4ED1A 1VSKA 1FKOA 3LPUA 3BSCA 4M45A 3NH2A 2FVCA 3CJ2A 4BE2A 3QIPB 3HXMA 1GOAA 2DFEA 4ECVA 5HBMA 1ZETA 4DL7A 5L1IA 3H4BA 4Z4IA 1TL1A 4ZHRA 3VQ5A 5KGXA 4IFYB 3KK3B 4ECQA 1WLJA 1C2PA 4PQUA 5KG4A 4Z4FA 1NKEA 3IG1B 3L2VA 1JLCA 1KLMB 4NLOA 2R2TA 1FK9B 3KLGB 3AO4A 1F21A 3ZSOA 3EPGA 3NGIA 2XGQA 5F8JA 3L2QA 3KD5E 1N4LA 4EO6A 4IG0B 1U49A 3RBDA 4MIAA 2FC0A 4NLYA 3VQ9A 2YNHA 3V81B 3MTKA 3CM6A 3OYCA 1RNHA 5HROB 4QOZB 1UWBA 1SH3A 4AHSA 4QWAA 1XWLA 3NF8A 3I5AA 3SUNA 1HQUB 3DRRB 3AVJA 4IDKB 4FK2A 3RAXA 4K4VA 2OH2A 1QSYA 1S1VA 4YR2A 4F4ZA 2A1RA 4RNFA 3BGRB 5I42B 2G8WA 4M3ZA 1VSMA 2AGOA 1IKVA 2HMIB 1C1BA 4CGIA 1RDCA 3RR8A 3Q8SB 1HNVA 5KT5A 3T5KA 4M3TA 3AV9A 2IMWP 1B92A 4DSEA 4E3SA 1ASWA 2W42A 4DL5A 1J9AA 4NLTA 3HL8A 3S3NA 4WZMA 2O4GA 2B6AB 1KFSA 1RT7A 5KFAA 4WE1A 4TY8A 4I7FB 4UQGA 3PR5B 2OPRA 1IKWB 5DG9A 3VN5A 3KLIA 3MEGA 3RB3A 1D1UA 1HNIA 2VG7B 4CJFA 5DQGA 1KSPA 1VSLA 2B43A 2BR0A 1B9DA 3KLHA 4AHCA 1LAVA 3MFIA 1NKCA 3MEDB 3D45A 3OL7A 3TR8A 2O4IA 1S1UA 3KLFA 1HQEA 2E9RX 1U47A 2FJWA 3V1OA 3NAHA 3KD1E 4QWDA 4FLUA 3OYJA 3HVRA 4TYAA 2ZE2A 3KHGA 2W9BB 4FBUA 3NMAA 3QETA 2B5JA 2FJXA 4NLQA 3O3HA 2DY4A 1S48A 2P51A 1K1SA 3HHKA 5D3GA 1RT5A 1I6JA 1S6QB 1XR7A 3THVA 3SI6A 4FLWA 3D5MA 4J9QA 4G3IA 2JGUA 1S5JA 4LY7A 1RDDA 1ASUA 3L3VA 5C24A 2FLNA 3HPHA 1SV5A 3MFHA 4FJKA 3OHBA 4KHSA 4Z4CA 4I9QA 3OSPA 1JLEB 4ECZA 5FDLB 2KTQA 3SFUA 1R0AA 4E7IA 1N6QB 3UPFA 4J9PA 3CDEA 3I5BA 2XC9A 3SQ0A 1LV5A 1QAIA 4J2BA 4CJUA 3HT3A 2AX0A 5KFJA 5HRRA 1RCHA 2XGPA 1JXBA 1S4FA 3QYYA 2XI3A 5KFKA 3JSMA 1TKXA 4IG3B 3HKWA 4DG1A 4TQSA 4PA1A 1WSIA 3UR0A 4FW1A 3G6XA 4R5PA 3A2FA 4NLGA 3PO4A 1WN7A 2NUBA 2JEFA 2OZMA 3V6DB 5KFRA 3AO2A 3QZ7A 5KFDA 4B9LA 4ID5A 3PW0A 1MU2B 2C2RA 5L1LA 2XCAA 4F4YA 3ZSVA 4N47A 2C2EA 3GV5B 2IJFA 4FLZA 3DMJB 1WNEA 4Q0BA 1VRTB 4CK2A 4FK4A 3N6MA 2E6LA 1NK6A 2HVHA 4YNQA 3NE6A 5KT2A 4AHRA 3KOAA 2YHAA 4CERA 3HVTB 4KHUA 4QW9A 4RW6B 2Y1IA 3DOKB 3NH1A 3T5HA 3TANA 1HYVA 5KFLA 1O1WA 4B8AB 1YVUA 1S10A 3QEIA 3LWLA 5HBMB 1TKZA 3SCXA 4KTQA 2ASDA 4X2BA 4URSA 4OPJA 1TL1B 1ZBHA 3OLAA 1KRPA 4CGHA 1UA1A 4CE9A 5KG2A 3DLKA 4PQUB 3RRGA 5J2MA 1W25A 1TGOA 1HJRA 1NHVA 3S3OA 2IBKA 4J2EA 1K1QA 4M3RA 4TXSA 4FS1A 4J9NA 3PW7A 4JUZA 3AVMA 2FBTA 5DGAA 3LPTA 1TL3A 4BDYA 1JL2A 5J2PA 3IRXA 4H4OB 1IO2A 3LZJA 4KO0A 4BDPA 4CCHA 4K4WA 4FJ7A 4R0EA 2DFFA 3LP1A 3MXMA 1QSSA 3AVKA 3PJWA 4Z4HA 4JRQA 4DQSA 4DTJA 4MK9A 2E9ZA 4WYLA 2YNIA 3M9MB 3SJJA 2YKMB 2P1JA 3DOLA 2R2UA 1NK9A 4BWJA 4HYKA 1X1PA 3RMDA 2QK9A 3IG1A 3U6FA 1IKVB 5J2NB 3H98A 1KLMA 1YVFA 2XO7A 4EYIB 1FK9A 1RYRA 5KFFA 1RTIA 1KLNA 4IRCA 1HNVB 4EYHB 4DL6A 1A5VA 5DG7A 4TYBA 2VG6A 4ICLA 4QCLA 1JIHA 4M94A 4E7HA 4CJKA 4MK8A 4NLSA 4N56A 1GX5A 2JC1A 3OL6A 1YTUA 4CJPA 4DF8A 1RT7B 3MECA 3EZ5A 2VWJA 3KJVA 5DMRA 2HHSA 1HQUA 2OPRB 3FQLA 3C95A 3MEGB 1QHTA 3OYBA 1D5AA 4M95A 1VSHA 1ZBUA 5I42A 1U09A 3AA4A 1IH7A 1T3NA 1BGXT 3DRSB 1ITGA 4CJQA 5KFXA 1S1WA 2AWZA 1NK7A 3NFAA 1S1UB 3EPIA 2KW4A 1HQEB 3GV8B 4CEQA 1QTMA 1JX4A 3OVNA 2XY5A 4O3QA 1KVCA 4EBDA 2F96A 3VQDA 2I5JA 3DM2A 3PY8A 2AQ4A 3TAEA 3I5CA 1TQLA 5KFYA 4DWIA 4CFAA 4KHQA 2B5JB 4B9SA 1VSFA 4Y3CA 2YKNB 3BSNA 1EX4A 3PX4A 5D3GB 1RT5B 4IKFA 4O5BA 1RBSA 4FJGA 3C6TA 4RNHA 4YP3A 4B08A 3QNNA 1BIZA 4CIFA 4NLPA 5EDWA 2EC0A 2VG7A 3V1QA 1VRUB 4W5NA 3OSNA 1Q9YA 4B9VA 4KFBB 3S3MA 3SPYA 4RW7B 4DLEA 4O55A 2HNDB 4NYFA 4AHTA 1EETA 1LWFA 1W9HA 3DI6A 2GIQA 2PY5A 4DSJA 1IM4A 4ZVEA 4EBEA 1JLFA 3K5MA 3OYIA 3ITHA 5DK5A 3B6OA 4O0IA 4BE0A 3T19A 3AVFA 3KNAA 1JKHB 3OYHA 2IM3A 1NK4A 5CYMB 2JEJA 3DDKA 4MKBA 1ZYQA 1TKXB 3ZCMA 5KTQA 4KV8A 3BSOA 1X9SA 2XY7A 3V6HA 2RF2A 3HPOA 3VQEA 1WSJA 4J9SA 5KFWA 1JLQA 3OYGA 4KPYA 2D5RA 4KHMA 4Z4EA 4ID5B 2IS3A 1RT6A 5F9LA 2FBYA 4K8XA 2OA8A 1ZTWA 1NJZA 2HNZA 4RUCA 2YNFB 1TAQA 4Q0BB 2ZD1B 3AVIA 4IOBA 3MXJA 3V6JA 5E41A 3RMBA 3TAMB 3Q8PB 2RDJA 4FLXA 2OZSA 4Y2CA 2D41A 2XI2A 3S9HA 4FLVA 3SV3A 4E1MA 5J2QA 2KZMA 3O3FA 4J9RA 5DGBA 2Z1IA 3V6DA 1RAJA 5JUMA 3DLBA 4DL3A 3KKSA 3K57A 1QE1B 3V9ZA 3ASMA 2BQRA 1BCOA 1DTTB 3HVWA 3DMJA 5J2MB 5L1KA 4WZQA 5KG1A 1VRTA 4FLYA 3L2WA 3QGGA 4TLRA 1TAUA 5KFTA 4CEZA 2YHBA 2BQUA 3I0SA 3PW4A 3O4QA 3DOKA 3U3GA 3PHEA 3AO5A 4B9TA 1TKTA 4CEFA 4LH5A 2VG5B 4KO0B 3PW5A 5KFCA 2ITGA 4CK3A 3LP1B 4O44A 3G10A 4FK0A 2XY6A 1RTJB 4OL8A 2Q3SA 2YNIB 4C8NA 3NH0A 1XC9A 1S1XA 3DOLB 3SUQA 1NOZA 3TAQA 3OJUA 4F50A 4JV2A 5CZ1A 3KMQA 1RTIB 4YR3A 4NLUA 3PZPA 4N76A 4FM1A 4OKJA 2VG6B 4ICLB 3G6VA 5CZ2A 4CJTA 3RB0A 2X78A 4HUFA 1QSLA 3LAKA 1OS5A 4ZTFA 4DL2A 2I1RA 4H4OA 4FZZA 4OJRA 5L9XA 2IAJB 2W8LA 3LWMA 2DFHA 3KK1A 4ZPAA 1CXUA 3TVKA 4ECRA 3EYZA 1T8EA 1C0TA 3MECB 3RB4A 4CJVA 3KJVB 2BE2A 2R8IA 2BGGA 1JLGB 2YKMA 3P83D 2QE5A 1XR5A 4NCGA 3CJ3A 4FCYA 3M8QA 4CJ3A 4M3UA 3G0ZA 3TI0A 5F8GA 4ELUA 5J2NA 3TARA 4HUGA 3SZ2A 3RB6A 3OYDA 3KIOA 1S1WB 4Z0UA 4GMJB 4R8UB 5DQHA 2FBVA 3LDSA 2IA6A 2R8JA 4DTNA 1L3TA 2I5JB 3DM2B 1G15A 4FYDA 5KFOA 4IRKA 3DLHA 4I2QB 4MIBA 4B3OB 3M8SA 4NRUA 1JL1A 1BQMA 3QO9A 3G86A 4IH6A 1DTQA 3RBEA 4CEDA 4CK1A 3HPGA 3OJSA 1T94A 3C6TB 2UVWA 3KMSA 4B8CA 4DQIA 5HRNA 3NBPA 3PVXA 4EBCA 4O0JA 1I3AA 3VA0A 3DRSA 3RTVA 2O5DA 3BQ2A 4E7JA 1UOCA 1EETB 1LWFB 2W9CB 4NLDA 3DI6B 3K59A 4FJXA 2IC3A 2FLLA 3F73A 2YNGA 1BISA 2B4JA 1BHLA 2WB4A 5KG7A 1JLFB 4ED8A 3ITHB 4FW2A 2OPPB 2YKNA 1N56A 2Z1JA 5FRMA 1S9GA 1QQCA 3V1RA 4KV8B 4OGEA 2DPJA 3CM5A 1VRUA 2R7YA 3CFRA 2RF2B 1TV6B 3AVLA 2HAIA 1JLQB 4KFBA 3CYMA 4LD0A 4OKKA 1C1CA 4JRPA 1RT2A 4RW7A 2HNDA 4E7KA 1RT6B 4CFDA 4IRDA 3E01A 4AILC 3NAEA 3CJ5A 4DTRA 5HLFA 2G8VA 2PZSA 3VQ7A 3K5LA 2HNZB 2IM2A 1TK0A 4C8OA 4MK7A 4CESA 1JKHA 2R2RA 1SH0A 4O3OA 1RT1B 5CYMA 4F4XA 3RRHA 4KKOA 4DTPA 3H2LA 2W7OA 3VQQA 4WYWA 4DFPA 5KT3A 2FBXA 4CHOA 5J2QB 3TABA 1S0MA 4B9UA 3NHGA 4FM2A 4F3TA 2EHGA 4QWEA 1XHXA 4MQ3A 4FBTA 4CJ4A 4ZMMA 3AVAA 2IOCA 1VSJA 4LSNA 3VQ6A 4DL4A 4J2DA 3VQAA 3T5JA 3OYEA 2HHUA 2V4QA 3QZ8A 2YNFA 3ZT0A 2D7SA 2ZD1A 1RBUA 1C0UB 4DEZA 4RZRA 2V4RA 4QW8A 4IQXA 3TAMA 2YV0X 3I0SB 3L2UA 4Q44A 1RTDA 4ZP9A 3VA3A 5KFSA 2GV9A 3ISND 4FZXC 1TKTB 5J1EA 4O3SA 4KHRA 3C6UB 4O44B 1HPZB 1KHVA 4CGGA 2UVUA 1QE1A 1NKBA 3G6YA 2V0NA 1XHZA 1NJXA 1ZBLA 1S1XB 2V9WA 1DTTA 2VA2A 3V9UA 3GQCA 4IBNA 4DSKA 2HNYA 1WSEA 3M9NB 1SL2A 1EP4B 2QKBA 4O3RA 1GX6A 2DPIA 3MAQA 3VQ4A 5CYQB 2HHVA 3VQPA 4KHNA 4RW9B 2AX1A 5F8HA 3F9KA 1DLOA 4KBIA 4ZP8A 4AH9A 3T1AA 2VG5A 3KK1B 2KFZA 4ECYA 3CFOA 2OPQA 3JYTB 3OS1A 3ZSRA 1C0TB 2GBZA 3V6KA 4Y2AA 1RTJA 3Q8RB 3KHLA 2BE2B 2UVRA 1GOBA 3QERA 1RDRA 2BRLA 4JV0A 3IN5A 4AHVA 1QAJA 2QXFA 3V9SA 4RW8A 4NCGB 5KFUA 3M8QB 1JXEA 4DFJA 2UUTA 4FLTA 2FVRA 2AU0A 2LSNA 3L8BA 2D3UA 3CDWA 5C42B 1RT3A 4W5RA 3KKRA
chains in the Genus database with same CATH superfamily
3THWB 1FJGK 3VTIA 4CJRA 2IAJA 3QB0A 3TWHA 3TSQA 2EEYA 3KHHA 2EKYA 3MM7A 3LM9A 2QX0A 2FLPA 3QRPA 1YVNA 2NRZA 4ELVA 4LH4A 1KC8O 1LKZA 1HRHA 3B8HA 1SUQA 3CIMA 3N4QA 2VQFK 4IZ9A 1HWIA 1ZBIA 1UVJA 1SL1A 1D9AA 3T1HJ 3MEEA 4ZA1A 4YMEA 4BRMA 1JLAB 2G13A 4TNOA 4FPBA 1PIEA 3GFZA 4DV4F 3OL8A 3EZUA 4B1XB 4FKYA 2JRSA 4QBUA 2BJ1A 2AF6A 2H9ZA 1Y00A 3G6EN 1N5TA 3BPDA 2G1HA 1PBUA 1PJ7A 3R3LA 4O4GA 4ILHA 3H7HB 2P9SA 4LFBK 2ZF5O 3DXSX 3JSBA 3Q8QB 2AGQA 4D3HA 1KVBA 2R8HA 2POKA 4CO5A 2JSXA 4DQ8A 3MR3A 1N88A 4NLRA 4MKAA 1WSFA 1HHQA 4U7BA 3A4TA 1TUVA 3SBTA 3MR7A 2WK4A 3W2VA 1WBDA 1TUUA 1FVSA 2D3O1 1PO6A 1GK8A 3D3BJ 1RP5A 2KXFA 1GNKA 1C6VA 1GXUA 5BN9A 2BE7D 4F4WA 4K4TA 1RAFB 4ZVHA 1ZM2A 2KI2A 2D0CA 2Z1GA 1KVAA 4NYZA 1HYSB 2QMUB 1VSIA 2NSBA 2LXIA 1IBLK 2JVOA 4KHPF 4Y34A 1XMOJ 4F8RA 4DPYA 4N5SA 4K4SA 2PIIA 1BQNB 4CJSA 3EM1A 3CD7A 3RBZA 4LF5F 3FZHA 2PBDA 2EG1A 2A1BA 3LPEA 2ATCB 2DHHA 1E6YA 1FKAF 1KD1O 4DV3F 4CZJA 2OPSA 2KB2A 3S41A 4RNMA 3C16A 2RB7A 3LP3A 3QATA 4L3NA 3E8OA 3IP0A 1JNZB 2J9DE 3VF4A 1Q86T 3I56N 3E9OA 4CLTA 4UY85 3GIKA 1HR0K 2FVSA 2W6LA 3NDKA 3CD6S 1VQYA 2DHAA 4JHDB 3CJ1A 4DX5A 3E66A 2RPIA 2FVPA 3MMAA 2Q43A 1N36F 1IBKJ 1YDLA 5AQGA 3O2IA 3CC7S 4Q8EA 4NLWA 3M2RB 5JS1A 4OYXA 4RW8B 4AL7A 2HWTA 2DY1A 3O1BA 2XY8A 4BRAA 4NA3A 3DXKA 4Q43A 1EP4A 1NSKL 4M5GA 4YOXA 1WG5A 5CYQA 3W64A 2WHOA 4OJ1A 4EEYA 4FN5A 2QKKA 1H74A 2E6MA 4JD2A 4PXCA 2W4DA 4K8ZA 3OW2R 1EX8A 1IR1A 2HPUA 4DPXA 2F5GA 3FQKA 3HP9A 1T95A 1U02A 3ELHA 2IDOA 2HBJA 3BR9A 2ZJRQ 1BO5O 1NZ8A 5AE2A 3CJSA 4W5QA 5HL7L 2V50A 4H4MB 5T7LA 3IKMA 1DQ8A 2NXUA 5C2DA 4YB6A 3UKRA 4ZJLA 5E3PA 2UUCF 1S9EB 2JWLA 2GEMA 4DTOA 3BV8A 1WG1A 2ILZA 1NHUA 5I3QA 2QN6B 3DLEB 1EKEA 2RE2A 1OVYA 2VJUA 5E7OB 4GO5X 1S6PB 5T41A 2Y1LB 3EE8A 3F0NA 3M30B 4JP8A 4Z7CA 1VQPS 2HGLA 1LFPA 3O3LA 5T14A 4KY3A 4BC5A 3PO5A 5F8IA 3BREA 3SUPA 3TJAA 2NRVA 3QESA 1BU6O 3IAM9 1BCMA 4KHWA 3CEDA 3BJYA 1O6XA 3Q8UA 4H03B 2J6UA 1REVB 3A8EA 2XZWA 5IWAJ 1VHIA 3KHRA 2GIFA 4ZLPA 1LWXA 3M9OB 3U27A 4M5DB 2C2DA 3CCEN 3VEXA 3FZKA 3FEYB 3JTPA 3AA2A 2W2MP 3DLGA 1B70B 1RHQB 1NLVA 4IFVB 2DYAA 1O8BA 3OBIA 3ZZTA 3JQJA 3I33A 1SQKA 4JI5F 3LP0B 2WSEC 4NRTA 4FWRA 4GRSA 3G25A 4K4YA 3B54A 5JVHQ 2E2QA 4ED4A 4O8KA 4X4SA 4OLAA 4JI2K 2VD3A 1WF0A 1YITS 4KRFA 3DU6A 4J91A 2VCPA 3MM8A 2KLAA 2LQ8A 2VFRA 1C0FA 3QIOA 4L8RB 3LZIA 3AD7C 3PACA 2G8IA 1FWLA 2J6SA 1PCAA 2LXUA 1CLFA 3NRBA 4QWBA 4PHTX 3CSKA 2IYIA 2WONB 4C0HA 1WSGA 2M52A 1Q16B 2RJZA 2AJ1A 4GVBB 3W65A 1I3OB 1R7IA 3T9NA 3T41A 4E1NA 2OAUA 1TKDA 3ZTPA 1VQ4S 4ED2A 2VWKA 1Q82O 2ZH5A 3WUHA 4FJJA 1I94K 5JJBA 4OHXA 3TAPA 2OIHA 3ZO7A 3MUMP 3TZYA 3OYLA 4E0DA 3LA0A 4CZEA 1FFSB 2V94A 4ZP7A 4WFYA 2FLOA 2MQLA 1S6UA 3P4UB 2B51A 1VJQA 3W3SA 2V2KA 4IOXA 1JJ2M 4L72B 5ETQA 1U2VA 5BPLA 3WIVA 5K8MA 1OYDA 4K7QA 5B0CA 3FBCA 2X3DA 4RUAA 1FJ7A 3T1HF 4M3XA 2J0QD 2C1EB 2N7CA 1QAXA 2MSSA 5KG3A 3I96A 4ZPBA 2D3OR 2LEAA 2YBVA 3DAWA 1RA6A 3PW2A 5JS2A 5HK4A 2J9DA 4IO1A 1NDCA 4OX9J 5KFHA 1HI1A 1RILA 3W2WA 2MXYA 4KE5A 5AQHA 2FF3B 1MW7A 2J0XA 1T9YA 3GBTA 1TVRA 4J90A 2CJ9A 3WNHA 2LA6A 2DH9A 2P5OA 2AYGA 2AZ3A 4FJLA 4FF3A 2Y0SD 4BQZA 3K2PA 3IGNA 4U7CA 5HVFA 1WSHA 2YNHB 1B9FA 1WNSA 1YRUA 2VDIA 3OFEA 3DWLA 5SZTA 2E1MC 4ZVSB 1Z4UA 5KG0A 4BRHA 2Q0RA 1VS3A 4CEEA 5BPNA 1GTHA 3VQSA 3UDLA 1HBNB 1RYSA 4I6AA 2XMMA 2PSZA 5KFEA 4CWBA 2UXDJ 4LT6A 4HDHA 4ZCMA 1BL3A 3L7UA 5L1JA 1FXXA 2C2ZB 6AT1B 2E1YA 2P2CB 1OPIA 1RTHA 1J5OB 1T6DA 4IG0A 5KT7A 3M8PB 5HP1A 5H9FJ 3C46A 2F9TA 4CP5A 3KUEA 3NAIA 3MOJB 1U1OA 1NK8A 5LMNK 2CGJA 5A8KB 1TK8A 3UDVA 1VJWA 1XMOF 3J7Z5 1YI2N 2E1RA 2HHWA 2CQHA 5AQRA 3KG4A 2QTWA 2F1FA 4ILRA 4W5TA 1HNIB 1HL6A 4K5SA 4DFKA 3BGRA 4DX7A 3SXLA 3O4NA 2XG8A 3V9WA 5DQIA 3MPWA 2KDOA 3FCHA 3PM9A 4X4OA 3MEKA 2QA4N 2E44A 1ZBSA 2V8HA 4U8YA 5CCMA 4U7UK 3CGIA 3OYMA 1IKXB 3I0RB 4C8LA 3FBFA 2ZE2B 3I82A 4JI0J 4Y2MA 2B6AA 1Q8BA 2FC9A 3NGYA 4XH1A 1KVJA 1Y3JA 1IKWA 2DISA 4CO0A 1HWUA 2AJ4A 2J9CA 3MR2A 1H72C 3K58A 4NYPA 3Q22A 1J54A 1FE0A 4PG8A 4TSXA 3NS5A 4TU8A 5C24B 4HKQA 2OCEA 1SV5B 3FFKB 4PPDA 1T9XA 1JJHA 1DQ9A 1HWKA 4KH6A 4F2SA 2P5VA 1IBKF 4PEOA 3B6PA 2G8HA 2ZBIA 3H5XA 1LAWA 1HNXK 4HUEA 4F4AA 3I9V9 2WOMB 4ECSA 2CVEA 2IVPA 3ZSZA 4CJLA 2FZKB 2A3JA 1FT8A 3ZT1A 2VWBA 4F3QA 1LW0B 3JSMB 4DG1B 3RMCA 4CHQA 2WBRA 2YKOA 1SB6A 1NPPA 2X6NA 1NDKA 3SQGA 3UCZP 3EDRB 1JLEA 2E5HA 5M1OA 5FDLA 2FVQA 3PR4A 5IT9O 4WTOB 5IC6B 3TEHB 1QS4A 1BI4A 4MDBA 5JVHL 1Q8IA 3HX9A 3EEQA 1GMUA 1FERA 3KKFA 1YJWS 4JKGA 3EUNA 5B0GA 4L76A 4X66J 4OX7A 4C8MA 1YBTA 4M3WA 4NX9A 2EI5A 5DZ7A 4E98A 3MAAB 2MKSA 1BG3A 1S77D 1TELA 4ZN3A 2OANA 2ZZNA 2ADCA 2CG4A 2F9WA 1VAZA 3N6LA 1GOCA 4L6V3 5C12A 4BS2A 1UKUA 2KJVA 4CGFA 3G2XA 4DV4K 2CJYB 4USIA 4C6AA 2HQFA 1JLBB 2R8KA 1H7XA 4CZFA 3VEVA 2O67A 1BA0A 2KH9A 3D0IE 5KFZA 2DNPA 3M8ZA 2RRAA 4ED1A 3C66A 5A6PA 2Z2LA 2QWPA 4KBOA 4M45A 1F60B 4B1VA 2HQ3A 2NPIA 3BF4A 4ID8A 1NRKA 3KK7A 1ZETA 4DL7A 5IWAF 3H4BA 5CQGA 2RQ4A 4M5NA 4CD1A 3D54A 3CD5A 3VQ5A 4IFYB 3KK3B 1C2PA 3C15A 1E4GT 4QIEA 1NKEA 1VQ8S 4FYXB 2DNRA 2G9OA 3CC2N 5I9EB 1YJTA 1Q7LB 4NLOA 2ZUGA 3LDNA 4S0MA 3RVCA 3SAHA 3OQ2A 2YQ0A 4HI1A 2RAQA 3FMBA 3GTYX 3D7EO 3KD5E 4EO6A 4MIAA 3R8YA 3VQ9A 3M3ZA 3MMBB 5GAGI 3MTKA 3OYCA 3IR5B 2PN6A 1UWBA 4AHSA 4L3QA 1QVGR 2MSTA 4CBUA 3VTHA 3WHIA 3WZ0A 4FK2A 4K4VA 1X5OA 1QSYA 1HBUA 5I42B 3R5JB 4M3ZA 1VSMA 2HBRB 4A47A 2P9CA 2HMIB 1C1BA 1KEKA 5BXIA 4JYAJ 3CMES 4KHPK 3Q8SB 2VPYB 2PFDA 3MCMA 3P4IA 2P9PA 4DSEA 4E3SA 1ASWA 2W42A 2IRXA 3OR2B 2Z0GA 2O4GA 4BHQA 2DGXA 2KYXA 4LF5K 5BYQA 1QM9A 3THXB 3LGNA 5KFAA 3NWRA 4I7FB 2CNOB 2RDDA 4NPOA 1VQ9S 2OPRA 4RLEA 4DV3K 5CA5A 4BREA 2VG7B 5A2QO 5L38A 4AHCA 4IDHA 2DHGA 3OL7A 3TR8A 3EVWA 2E9RX 3KLFA 2DNMA 3EX7B 5K20B 1Q8KA 3GIRA 4FLUA 2XZTB 3OYJA 4TYAA 4KH5A 1JQGA 4DKWA 3BR8A 1CJVB 1ULRA 2U2FA 2B5JA 3D2EB 3O3HA 4DMZA 3G71S 1RBAA 3PDNA 2HIQA 9RUBA 3TP2A 1N36K 5LT5A 3L3CA 4O0NA 1AFIA 2JGUA 3G6ES 4OX9F 3KUGA 2CPIA 5AXLA 2OFHX 1QTNB 2FHJD 3OSPA 4ECZA 3PNIA 3HM8A 2O8DA 1WKJA 4C9DA 2FF6A 4E7IA 4I64A 3SQ0A 1WF2A 2OP5A 3OVAA 2V8PA 3HT3A 3M32A 2AX0A 3FJ2A 2O8EB 3HULA 3C3LA 1HLWA 2V4JA 2A5XA 2IY5B 2XI3A 4ZK7M 1TKXA 4PA1A 4WIQA 3UR0A 3W5XA 3G6XA 1WC3A 4R5PA 4CVNE 5HMZA 3L4IA 4NLGA 5M1NA 3AQPA 3CCWA 2HURA 3V5RA 2JEFA 3UO0A 3V6DB 5KFRA 3AO2A 5ETTA 1JWWA 2F4FA 2UXDF 3PW0A 4I67A 2P9GA 4P2XA 2MGZA 1S7HA 3LOUA 2XCAA 3VAGA 5IXUA 2UUCK 4FLZA 1TFWA 2CGLA 1WNEA 1VRTB 3N6MA 2E6LA 4PABA 4YNQA 2R7XA 2YWGA 1NEEA 4H4KC 5KT2A 3A0IX 4AHRA 5LL6d 2I2YA 1RWUA 5MAOA 4QW9A 3TVZA 3T6BA 1S57A 4B1ZA 2BEFA 1ZH5A 2EWHA 3LDPA 2W6KA 3T5HA 1U1RA 3TANA 1YVUA 1K73O 1T9UA 3KDNA 3PG9A 1KVIA 3J80O 2KVIA 3OLAA 1KRPA 1WEZA 3BYRA 3CXCR 2VFVA 4I6MA 1Z2ZA 2X51A 1M5KC 1V5IB 3RRGA 5ETMA 5J2MA 4OHYA 2P9IB 2NR0A 3S3OA 4JI0F 5TKYA 5LM7E 1CEZA 3BGUA 4M3RA 1H38A 3SLCA 1VI7A 4JUZA 1ZA2B 3DNCA 4OZLA 4BDYA 1JL2A 1PG5B 3I56S 1RDUA 4LIRA 2QYGA 3ET6B 4CCHA 4BC9A 4DZ6A 4JRQA 4DQSA 4KGXB 4JI5K 2YKMB 2HK2A 3MM5B 3EGWB 2DR5A 4OYBA 4BWJA 4HYKA 2LDYA 3IG1A 4G9ZA 1NNEA 2QMWA 3H98A 3VCDA 2XO7A 4EYIB 1FK9A 1WC1A 3DOMB 4ILLA 1FX4A 4ICLA 4QCLA 1JIHA 4M94A 3TUZC 4E7HA 2IJRA 3H25A 4MK8A 3NXZA 4TLQA 2MQPA 1RT7B 3R5DA 2RSQA 2WB1D 1NJIT 1HQUA 3C95A 3MEGB 3CETA 3Q2TC 4UF4A 1D5AA 4M95A 1WC5A 1U09A 1BGXT 4P73A 5FD1A 1ZPWX 5KFXA 3R1LA 2PMHA 2KW4A 3EPIA 1FTRA 3BN7A 4CEQA 1QTMA 4OJGA 1C0GA 2BA9A 1KVCA 4EBDA 3VQDA 4DCOB 2AQ4A 4P75A 2YH0A 4X66F 1SAZA 5KFYA 3UN3A 1JJ4A 4DWIA 3ZTSA 2EFPA 2QA4G 1UTAA 2DR8A 5D3GB 1RT5B 4A46A 4MMOA 2MKKA 1FXLA 3C6TA 5A76A 1JCGA 4QIWD 4BC3A 4CLYA 4CIFA 4NLPA 4A62A 2UXBJ 2R3VA 5EDWA 4F36A 2EC0A 3T1HK 1Q9YA 2VL1A 4P6QA 5MLCQ 5I4MA 3I6PA 1RE1B 4E1JA 4DLEA 4AHTA 1LWFA 2YX4A 4C8YA 1ZZNA 1IM4A 1H0HB 1NU4A 3KJNB 1JLFA 2Q3PA 2W25A 1ELOA 5DK5A 3T19A 2HK3A 3KNAA 1GLDG 3MPYA 3CCSN 2JEJA 4CO4A 2MKCA 1ZYQA 3F9MA 4U67Q 4Z37A 1X9SA 2Z2YB 4CO3A 2XO6A 3T69A 3V6HA 4CZCA 4DX8H 1VYAA 1FE4A 4RBUA 4J9SA 3THYB 4M1KA 3N0VA 1BLUA 3GMGA 4BG9A 1RHUB 2H51B 1N0UA 3GP9A 4KHMA 4Z4EA 3M2UA 1RT6A 1C4CA 3HRGA 5AZJA 1GLEG 4I68A 2RILA 2AV5A 3UN2A 2HNZA 4RUCA 3THTA 1ATSA 2B8QA 3NNCA 1AZSB 3MHYA 5E41A 1NPKA 3IR7B 4QYZJ 3Q8PB 2RDJA 4FLXA 2YI1A 4KGVB 2D41A 1UFLA 4DV5J 1QJHA 3S9HA 4FLVA 4E1MA 4J9RA 2Z1IA 1WELA 4DL3A 3QT5A 3O9TA 1NG9A 3FBEA 2XQCA 4JYAF 3ASMA 1XMOK 2B56A 2GVZA 1F5CA 2MQ8A 1G99A 1QDUB 4PRFA 3DMJA 3SCJE 4FLYA 1O51A 5JVGQ 1HLUA 5IM0A 1N5VA 2QWNA 2KRRA 4TLRA 2B9XA 1TAUA 4FWNA 2IRYA 1U2FA 1T6CA 2YHBA 4PZVA 2JVRA 4NEYA 1M1GA 4HACB 1GEHA 2EFNA 3PHEA 3ZZ0A 4BY9C 1TKTA 2VG5B 3MMJA 5KFCA 3K2YA 2ITGA 4N7TA 3LP1B 3G8QA 3G10A 1FO1A 1RTJB 4DR4J 3VAJA 3ULEB 4ZIVA 2CQ1A 3OPKA 3AY0A 1E6VA 3DOLB 3QT8A 1N8RO 4Y00A 5CZ1A 4JI7J 3KMQA 2K1RA 4AM6A 2QIFA 2FDNA 4NO7A 4FM1A 3M6GA 3G6VA 4CJTA 1VQNN 1IBKK 4PXBA 3MTJA 2I1RA 3Q7BA 4OLOA 2MLYA 3CPWM 4ZPAA 2D69A 1CXUA 2XWXA 3TVKA 4ECRA 1PYOB 2QA1A 2ZVIA 1S3XA 4JV5J 2R8IA 2BGGA 2DBBA 4FF4A 3PHTA 4WU3A 3CCVN 2J7WA 3P83D 3CJ3A 4M3UA 5FLXO 1SJRA 5F8GA 3ATVA 2DB1A 4DDFA 3TARA 1VLYA 2L9WA 3NS6A 1BUXA 4FYWB 3IMXA 5DQHA 3DM2B 1MNEA 2ZC3A 4B3OB 1BQMA 3ILLA 2BOAA 1DTQA 3RBEA 4CEDA 3F56A 3HPGA 3EKSA 3KMSA 4DQIA 3DJCA 4K2JA 4PPZA 4O0JA 5HO4A 3WDOA 3VA0A 4ZS6A 3DRSA 1WOQA 3WQUA 1QVFR 3H46O 1V3ZA 4NZ6A 3CW2C 3F73A 1BISA 1YTYA 3P39A 2Q1LA 1VQLN 3O9SA 2OPPB 1MWQA 4P71A 5HAOA 2OMLA 2R7UA 4H0OA 1PGZA 1N34J 1S9GA 2W2QP 2LKZA 2BYCA 5HQ8A 4YOTA 1OJ4A 2HF4A 3EL2A 1TV6B 3AVLA 2HAIA 3QJJA 4IUFA 4LD0A 4QR2A 2Z2ZA 4OKKA 5C2GA 1C1CA 1FF2A 4JRPA 4RW7A 1BWFO 1OPZA 5HQMA 3CCUN 3UDCA 2IMOA 1Q7YO 4IRDA 5IWAK 5A0YA 4JI4J 4V19J 5HLFA 4R0JA 3K5LA 3SMSA 5AQKA 2IM2A 3MUVP 2FJEB 1OY6A 1VC5A 3R2CJ 3OHRA 4UT4A 2DXDA 1Q18A 1FEHA 1YZ6A 4DTPA 3FR0A 3VQQA 4DFPA 4NXMJ 2H3EB 1FI4A 2QMXA 1OY9A 2NQPA 2DH7A 4P2MA 4LF6J 4QWEA 3CCLN 3FE1A 3QFHA 3FBBA 1VSJA 2O8FB 4F7VA 4LSNA 3VQ6A 2D1CA 1S6OA 1V4SA 4C97A 1GMWD 5HJXA 2HHUA 3QZ8A 2YNFA 2CPZA 5AE1A 1EQ0A 2QSFA 2ZD1A 1K9MT 2P9UA 4RZRA 3HHLC 2V4RA 2Q79A 1K8KB 2CXEA 3FEXB 3TAMA 4OV6A 3AH6A 2YV0X 4C23A 2NUHA 3I0SB 1PSDA 2VQEJ 3L2UA 1F3FA 2BJ7A 4QYRA 4ZP9A 3VA3A 5KFSA 4PCQA 1S59A 5AQFA 4LF9J 4AYBD 4O3SA 3A5OC 4KHRA 3L4BC 4AM7A 2P9KA 3R9PA 1JJ2R 4WKYA 4O44B 2AEMA 1KQSM 3WT0A 1QE1A 3PYGA 4NA1A 1XHZA 2B4PA 3FMWA 4OZ3A 2V9WA 1DTTA 3LH2S 1Q81T 2BJDA 4PXEA 4IBNA 2COLA 2F8HA 1X9JA 3M9NB 1M1KO 2DGSA 4H0PA 4O3RA 1UEUA 3HOTA 5D4LA 4A59A 5LOQA 3C6AA 4RU2A 4NYOA 1QAYA 2HHVA 3QQCD 5F8HA 3ZZOA 5SUHA 5AQIA 2BACA 2UXBF 3CFOA 2V7ZA 3A3OB 4USMA 1YJNN 3D0HE 3EZWA 2Z4PA 4Y2AA 4UUXA 3KHLA 2BE2B 2R7QA 3CO0P 3SBGA 5JVGL 2QXFA 4AD6A 5KFUA 3M8QB 3DGPB 1KOOA 4MIWA 2Y1RI 4DFJA 2FVRA 4OX9K 3G8SA 4LF7J 3AY9A 1RWMB 2MQOA 3CE8A 3MPVA 1NSQA 5C42B 1RT3A 2ZEJA 4O8UA 2V51B 3GOIA 3DLRA 3C94A 2CQIA 3HSZA 3QO9B 2XMJA 1N48A 3SPZA 1YT3A 1UCNA 3LL3A 2GAHC 2CFXA 5LSLA 3C8YA 3ZSWA 1JLGA 2ZQBA 4NASA 3NBPB 2ASPA 4NMLA 1VC6A 2ZH7A 3L3UA 3I8DA 1D9FA 4FJMA 3K5OA 5HVGA 1MLAA 4HTUA 1YJUA 1VQ7N 3GU0A 4R8UA 2B0GA 4ED5A 4HR2A 4NEZA 3AVHA 3AVBA 2UXDK 2IC3B 1T7PA 2YNGB 1LCUA 1RBTA 3QEPA 3BBCA 4DV5F 4G1QA 3NY0A 3UD5A 2MZJA 4CF0A 2FGOA 2IJNA 3M8RA 3NG8A 3TNVA 2DEIA 4USKA 1NXIA 4KAZA 5H9FK 2KL8A 3POTA 5K14B 5EN1A 1Y0HA 1HWLA 4K4ZA 3D3CJ 4BR4A 2C42A 2AJQA 1WHVA 4DFMA 2QJ3A 4FJNA 3B82A 3V4IB 3MWTA 3G82B 2ZHAA 1RT2B 3UNGC 3JAMO 5SWMA 3K8WA 5C5JA 4DSIA 3IDHA 3E01B 2VU5A 2C3YA 1VQ6N 2XB2D 4U7UD 1CQNA 1GLBG 2FJVA 1VDHA 1ZAWA 3ILJA 4IH7A 2UUBJ 2FZCB 4JI0K 4Q5VA 4A8SA 1MWYA 1XC3A 3DXBA 4DR7J 5KFNA 1ZZFA 1NK0A 4DR4F 4BE1A 3HJFA 3WXLA 3ADAC 3FDSA 3EE3A 1T9WA 2YKPA 3FZ2A 2BOPA 1FVQA 3TQ1A 4CHPA 3QFUA 4JI7F 4GKKJ 4JS4A 4KSEB 2KO1A 1ZA1B 1BMQB 2LQ9A 1HI0P 1RCOB 3ZTQA 4KR0B 2I0XA 2GC8A 3JQMA 3CCJS 3H08A 3MD1A 3FNNA 4TU7A 2L41A 2QV6A 1L3UA 4EO8A 4J9LA 3CJAA 1AROP 2D0PA 1QUPA 4KB0A 2XMKA 4RW4B 4PY5A 1Y5NB 3R5AA 4QWCA 2ZH6A 2ZDPA 3LAMA 4KTWA 1RWNB 1UVNA 3J7AN 1OQ3A 1CBKA 4JV5F 3NL0A 2VKZG 5HVHA 2IIRA 3BGOP 4FWSA 5KQDA 2HRYA 3O80A 4IKAA 1IVZA 2GUIA 3SBMA 5E3AA 3ULDA 7AT1B 2XYGB 1HKCA 4LQ3A 4Y2KA 2W8KA 3CJ0A 1VHFA 4MDAA 1CJTB 3OLBA 4FJ8A 3MDFA 1C0UA 4UY8O 2HF3A 4OI1A 4LUBA 3A3NB 1XNQJ 1UVLA 2WUSA 3MMVA 2CG8A 4TU9A 4YQWA 1WI6A 1UA0A 3UD3P 4OVLA 3GYXB 4BC4A 1QQMA 1WJ9A 2UYTA 4DOZA 4DR5J 4Q7AA 3ZSXA 4X66K 4ED3A 1KKHA 3ENQA 5GAEU 3MDQA 3CIZA 3QRRA 1HJOA 2X1FA 3RMAA 1LEOA 2FPHX 4M41A 3DYAA 3GSDA 4FJ5A 3TWZA 1NB2A 2OYQA 3PRDA 1AT1B 3AJ1A 1EKSA 3HP6A 3DKDA 1SBRA 3KUHA 2D3ZA 2VFSA 5ETPA 1YKWA 3TU5A 1ATRA 2IIHA 3LDOA 4RW9A 4NLXA 1N34F 2E5IA 4IR1A 4LRCA 1DBDA 1CZ9A 3JYTA 4RBTA 3CG7A 2CDRB 4ED0A 3P38A 3CMAN 1RDBA 3H2UB 1SUQB 1ZBFA 4JI4F 4ID1A 1HBOB 1CSJA 4AF1A 4K0KJ 3MEEB 4UQTA 4F4KA 2NNWA 4KT0C 2XULA 3IGVA 3THWA 3IFEA 5LY3A 5EWEA 2AT1B 1RLDA 2HWHA 2F8TA 1NGCA 1X5PA 1N52B 2XHWA 4NXMF 1XIQA 5GAHU 4GV6A 3RU0A 4C48A 1VLOA 5F8LA 3I31A 3P96A 4LF6F 1BIUA 4DU3A 4O4GB 4OHZA 1KR4A 2P9SB 5CZXA 4PUOB 4G6VB 5E33A 1M0SA 3D1OA 3OY9A 3EO3A 3AHPA 3ZZYA 3ZT2A 1DURA 2ZWHA 2HW3A 2HBLA 1JLAA 1VRQC 3DRPA 1U6BA 2VH7A 2GAGC 5K8PA 3EVMA 1RAAB 1N54B 4CIEA 3ILIA 4JYAK 1EAYC 3FFIA 5KG6A 1SIZA 2VQEF 3ZYYX 4CM2A 4LF9F 4KAIA 5EU7A 5DDQC 2D9PA 4K4UA 4DU4A 1WDTA 1D8ZA 1SVDA 1BOTO 2AEJA 1TUWA 3CJCA 4M7YA 4USTA 2IDLA 3TTFA 1UJ6A 3BQ0A 4E89A 4WP3A 2MQNA 3AA5X 2GWJA 2CVIA 3VVUA 3ZNUA 2BANB 4L74A 2N82B 1VSEA 4ELTA 4ILJA 5AQSA 3MN5A 4NLVA 3D28A 5KT4A 1TL7B 3PSIA 3IS9A 4NCAA 2D0AA 2OTJN 3NF9A 2DNOA 4DPTA 4K43A 4BVPA 5EWFA 4LSLB 1T0TV 3C6HA 2KHDA 1U7LA 2GQCA 2X6SA 4PKHA 4XPCA 2RUSA 4KH0B 3GZ7A 2AYBA 1XR6A 4B1WB 4KHYA 3ENWA 1GXTA 3QEXA 2F8EX 2C3PA 1KC8T 1E6YB 2DRDA 3QFPA 2XMAA 4L3KA 4DI6A 2OPSB 3EXYA 4FXVA 4LF7F 1OVQA 2C3MA 5DM7L 2P6SA 3FZFA 4ANDA 1HYSA 2DO4A 3HZEA 3H8YA 3CD6N 2AMCB 2IM0A 4H5TA 2RHKA 1QQOA 3R2DJ 3ZXWA 5KI6A 3UCUP 3LW5C 4DN0A 3QNOA 3AGKA 3NLCA 1BQNA 1YX2A 1CZBA 3VOVA 4BC7A 4F3OA 4K50A 3GYNA 2KXNB 4OYPA 3OHAA 2N4DA 3HSGA 3MMAB 3CC7N 4I9LA 2EK1A 1DARA 1XMBA 1WORA 3HJVA 5KFVA 2Q36A 1WHXA 3O1LA 2AJFE 4RU9A 3FRZA 4EAHD 1S49A 4B9QA 3GG4A 2EFVA 3CJKA 4PWDA 4JS5A 4FVMA 3CNQP 3C19A 5G0RA 3G8TA 2Y1JA 4ZPDA 1N5YA 3OTBA 4JHDA 4ZHRB 1F0XA 4H5VA 3W8GA 4E7LA 2RU3A 1KAZA 3BO3A 4M63A 4NWBA 1JLCB 3NGTA 2LQ5A 4JD2B 4OYWA 3MPDA 1KAXA 2FJAB 1Q4RA 4Y1CA 4ZCIA 3DGVA 2JOQA 1UWAA 2DNNA 2PFFB 5JXSA 3TA2A 1S79A 3D0PA 4B1UB 2KQ2A 3QIPA 3MM9A 4O3NA 1YUWA 4A2BA 3MN7A 4IO9Q 2ASJA 1RB0A 4Z2XA 3UKRB 5DLGA 4FWLA 3OS0A 1XMQJ 4DR7F 5DDOC 2HYIB 4F25A 3VENA 1KFDA 2JC0A 2JEGA 2YWFA 2HZVA 1EXQA 1VQPN 2ZH2A 3SV4A 1R6YA 2MKYA 1K0TA 3IAYA 3HK2A 2MZRA 3ZTRA 1ASVA 3IBWA 4ZVFA 4LVOP 1ZTTA 1KD1T 5HQLA 4GVMA 1NM1A 4WFBL 2WBMA 2QEXN 4GKKF 2D9OA 3SQ2A 3D2WA 3QGIA 2DNZA 3V81A 1RHKB 1I39A 2BV3A 1RBRA 5HROA 5EWGA 4TY8B 4H54A 1KXPA 2JH3A 4ISEA 2PYJA 3KLIB 4OZ1A 1U1LA 1T11A 1S9EA 3EXCX 3RAMA 5LXYA 1WAFA 1QQNA 2L08A 4QPXA 1MN7A 3CFPA 5EX3A 3PV8A 1D3WA 2C3OA 3MI7X 3DLEA 2J4RA 3CCVS 1GXLA 1L3SA 1OH6A 3WIUA 3QWPA 5DM6L 2H3GX 1SPBP 2HBYB 4UW2A 2IM1A 3DLGB 2JLGA 1HYZA 3LGHA 2Z2MA 4PG6A 3EGNA 2PE8A 4N77A 4TQRA 2RD5C 1U6FA 4A8XA 3EMTA 3B6BA 2YJFA 5HRPA 1XNQF 1NDLA 2XWYA 1REVA 3T9ZA 1U4BA 3MM8B 3MEDA 3PTWA 3P1GA 3VMFB 4DR5F 1RGIA 1FESA 1VQ4N 1RA7A 5GMEA 5L8RC 4QR0A 4OPHA 1VK3A 5T7BA 5TKWA 4ZPCA 1VBYA 5FRNA 4ZVGA 2FSJA 4IFVA 2ATQA 4XO0A 1YZ7A 3CPEA 4OLBA 1A5XA 2APOA 2EC2A 2ZOMA 2UXBK 1U8SA 1S6QA 2OGUA 4OI0A 4CHZA 4EP5A 4JI8J 4FJ9A 4OLPA 2Z56B 1D9DA 3T5LA 2VKRA 3NWGA 1L5UA 2BW2A 5KFQA 5JMNA 1H1VA 1J2VA 3K9JA 1N6QA 4DX6A 3R7SB 3K9KA 4FWOA 1DJ0A 1XI1A 2DNKA 4CZMA 2HBMA 1WACA 3NF6A 2E7XA 1T9VA 4K0KF 4DV7J 3I87A 4AT1B 2HFUA 1K44A 4RR5A 1NOYA 4DQQA 4C0OC 4DV1J 2R9LA 2K3IA 1G6BA 1NNDA 3A13A 2WRMA 4C1NI 1MU2A 3R6GB 2Z1HA 1V3RA 3MN9A 3QGHA 3DLKB 3W2WB 3CCLS 3GJQB 4OZ2A 3AA8A 4QYZK 4CT9A 2HKEA 3QSYB 3X1LB 3D2FA 2D4WA 2DTUA 1Z1ZA 5DRKA 3CWJA 2ZUAA 4ZOSA 1TVRB 3E51A 3H5UA 5AXKA 3ISZA 4K8RA 2A6AA 3HVTA 4RUBA 1VQMS 2ZDOA 1TL3B 5E3RA 3DN9A 5J2PB 4RW6A 3HHEA 3CF5L 3LGMA 3LPUA 4KGMA 2QLXA 2PA8D 4WFNL 4DCPB 3CJ2A 3MCSA 4BE2A 3HXMA 1GOAA 1W2BM 3B78A 1RAEB 1F2GA 2FHOB 5L1IA 4WP9A 4Z4IA 3FZBA 2IBOA 5KGXA 1WLJA 4LMZA 4PQUA 3GJTB 4WQ4A 2V52B 3L2VA 5H1SQ 1KLMB 2M8DB 1KNZA 4CDIA 1VBZA 1F21A 1NPRA 1NCLA 5CR4A 3H20A 4IG0B 1U49A 1HI8A 3RBDA 2FC0A 4NLYA 4QU6A 1M5SA 1ZXOA 4DR4K 3S7RA 2YNHA 2VICA 4KH4A 1YLXA 4QWAA 3W9IA 3I5AA 3AVJA 4FL9A 4H5NA 3A5NC 4TKTA 3CPWR 4WBFA 2A1RA 4RNFA 3BGRB 1IKVA 4H5RA 4CGIA 3VR1A 1HNVA 4NXNJ 1RWOB 4J5OA 3T5KA 1KBRA 2IMWP 5F3TA 1B92A 2DGOA 1J9AA 3HL8A 2BBEA 4IQMA 5AQMA 4IO9L 2B6AB 4R79A 3HSDA 4ZLNA 3TZXA 4JV5K 1J27A 2GFFA 1FJCA 3PR5B 4HI2A 4OI3A 1IKWB 4FZVA 3RB3A 2KJWA 1OSCA 1HNIA 3A5MC 4Y0FA 3TZZA 4CJFA 3NNAA 3HFKA 2VOPA 1AUDA 2KKHA 1LAVA 3D45A 1V3SA 2O4IA 1S1UA 2YX1A 2O8BA 3V1OA 2XSJB 3NAHA 3KD1E 4QWDA 5IZHA 4IO8A 2MLXA 2ZE2A 4MT1A 1EQMA 2Z57B 2CQ4A 1SI9A 2DGQA 3HD1A 1RTZA 3OTOJ 4OV1A 4NI2A 3OVBA 3ENBA 1U0HA 2OJ3A 3UE5A 3THVA 3SI6A 4MYUA 3ZZRA 2GUPA 1DQAA 4P9SA 1S5JA 2KM8C 2EKNA 1ASUA 1NMEB 5C24A 3L3VA 3J7YU 3HPHA 2L9DA 1SV5A 5F2RA 4KHSA 2E88A 3SQGB 4Z4CA 2QC3A 1JLEB 4LR7A 1RI7A 5FDLB 2KTQA 2QFIA 3LQVA 1IM6A 3Q89A 1LV5A 1QAIA 2MPUA 1R0BG 4J2BA 2HBKA 2WVBA 1YRXA 4B02A 1N34K 3IFRA 5AQNA 4D3GA 2FUG9 1S4FA 3QYYA 2BKOA 4ZLJA 4JKGB 2JFDA 3JSMA 1MWMA 3SSRA 4IOCL 4DG1A 4TQSA 4AL6A 4JKEA 4JK9A 4YOYA 3A2FA 1CZAN 1IN0A 1XMQF 2NUBA 2JJ4D 5CHIA 1VQ5S 1Y7PA 3QZ7A 4MO5A 4JI4K 2DEJA 4ID5A 2NYHA 5L1LA 4F4YA 1JNRB 3PIPQ 5CXTA 1RUSA 5A8WA 3ETMA 1X5TA 5A6WA 4Q0BA 3N9UC 4CK2A 2ZFHA 2GQQA 1NK6A 4C11B 1YRTA 2E1AA 1IBCB 5C7PA 4NXMK 4BCAA 2DGTA 4LF6K 4RL1A 3DOKB 3MAAA 3NH1A 4XDCA 1M90O 1O1WA 4B8AB 5AQJA 1B0PA 2HG4A 3QEIA 3LWLA 4F0MA 1VQ8N 3SCXA 1RAHB 4KTQA 1DFDA 2VPZB 2CRLA 1I5OB 2IHR1 4FP9A 5KG2A 3GCXP 3C15B 1PC4A 4BBYA 1K1QA 2GQ2A 2VQEK 3U02A 1XTZA 1SJ3P 4LF9K 4V19S 2LYVA 3AVMA 5HL7Q 3NGRA 4BRIA 3CCTA 3FVYA 3HF5A 4BDPA 3RUBL 1T3OA 2JNJA 3KJQB 1K8AO 4CH7A 3PJWA 4Z4HA 1FFWB 2E9ZA 1NWKA 2YNIA 3CMEN 3SJJA 3HOSA 3F2KA 1HBUB 2BVZA 1NK9A 3MURP 4PL7A 4ERDA 2BH1A 4YB5A 1X1PA 2WSFC 3RMDA 2W2NP 2QK9A 4GV9A 2NRTA 2HAFA 1YVFA 3H1VX 5KFFA 1RTIA 3B4DA 4DL6A 2YH1A 2E5LJ 4TYBA 2VG6A 4KQZA 4CJKA 3LF0A 1VQ9N 5K8OA 1TR0A 4NLSA 1H2UX 4JI8F 4DF8A 4CJPA 1WHWA 3EZ5A 4FF1A 3N28A 3CIPA 5GAEP 3KJVA 3N4WA 5HJYA 2OPRB 2MB0B 2CQBA 2GJIA 1JB0C 5BN8A 1ZM9A 2HIYA 3O5TB 4LF7K 3TOQA 5I42A 3CDBA 1RFQA 1IH7A 1T3NA 2HZAA 3B8AX 1ITGA 4CJQA 4X4QA 1S1WA 2AWZA 3CMAS 2CZVC 1WKLA 2D74B 3G71N 2AIRB 1KQKA 3PY8A 4YB7A 5FJ4A 4DV6J 4DV7F 3I5CA 1TQLA 3SCLE 2KT5A 2B5JB 4M5JA 1VOMA 4Y3CA 2Q2RA 2YKNB 3BSNA 4GO7X 1XN9A 5D0EA 4IKFA 4RWXA 4DV1F 4B08A 3VAKA 1J6ZA 2QZ8A 2VG7A 1VRUB 1RDWX 1ZBTA 3SAFA 3OSNA 2WFBA 2PFUA 4XH4A 5FPEA 2CDQA 4EFHA 3OBWA 3SQOP 3SPYA 2ZH9A 2O8DB 1FDBA 4U9RA 1W9HA 3DI6A 2GIQA 1TTHB 4Y6IA 2V63A 1DZ5A 4DSJA 1F2HA 3DHWC 1YGYA 1FRJA 1HW9A 5DDPC 4DR6J 1CJVA 2GV1A 3EVOA 2VFUA 4OI4A 5F1XA 1MWKA 5CYJA 2UUAJ 5GAHP 1NGFA 4KYZA 1KTVA 2IM3A 3AARA 5CYMB 3DDKA 1TKXB 2B4OA 3ZCMA 3CJ9A 2DGUA 4IOAL 4ER8A 5L46A 4KV8A 2CPYA 4LRFA 2RF2A 1JJCB 5KFWA 2XYHB 2OUGA 2QL7B 5HMXA 4WWSA 3EWGA 2IS3A 3EZOA 1WC6A 2MGZB 3K0SA 2CUYA 3GJRB 1KDNA 1HR0J 1XQIA 1O5JA 1ZTWA 1TZ0A 2K7JA 2J76E 4CLPA 3NVMA 4IOBA 3V6JA 2OTJS 1SC3B 1XBWA 2ZHOA 4GKJJ 2XI2A 2L3MA 2KZMA 2OTLS 3O3FA 4GKKK 3V6DA 1RAJA 4AXJA 4LFCJ 3DLBA 2EK6A 2CZ9A 4DUZJ 3ZFVA 1WI8A 5EY4A 1BCOA 3R5BA 3ZETA 1U26A 5J2MB 4WZQA 1VRTA 3UWTA 1FRLA 1UAWA 3W7BA 4KJIA 4C1NK 4M63C 3FZLA 1R8AA 4A5BA 4CEZA 2BJ9A 3PW4A 4CT8A 2NXJA 5IV4A 3O4QA 2G2ZA 2NXNA 4CO1A 4CNZA 3U3GA 1PBAA 4FVUA 4B9TA 4LH5A 4H4KA 3PW5A 5IT4A 4ZVUB 1XK8A 3PIPL 4OL8A 3QT6A 2Q3SA 3J81U 2CPJA 4C8NA 3NH0A 1S1XA 2W7AA 4P7TA 3ZEUB 3PYDA 5B09A 3TAQA 1XNQK 2P9IA 3OUYA 4HL9A 3OTOF 3PZPA 3CTRA 4OX8A 2OD6A 4ICLB 4OKJA 5HMYA 4DR5K 2X78A 5BJRA 1QSLA 1FD2A 4DL2A 5BRFA 1S7IA 4ENOA 3EYZA 1C0TA 4Y65A 3G9CA 4H0XB 2V8DA 5LJ5Y 4GMKA 4PL8A 1YBUA 2YKMA 3MM5A 4FCYA 3TA0A 3G0ZA 3OFGA 4JEPA 4HUGA 3OYDA 4H0YB 5EXWA 4GMJB 2MJNA 2FBVA 3VV2B 2R8JA 3O9RA 4CH0S 3D1QA 1G15A 3HFVA 3R3TA 2VC0A 2IA0A 3KZBA 4I2QB 2G2YA 3M8SA 4QS9A 5F3ZA 2R7SA 3TJ9A 3NGSA 2E1CA 4CK1A 3C6TB 1Z2LA 4ZCLA 3PEJA 4B8CA 4K0KK 1K73T 1GLAG 4EBCA 2OSRA 3LDLA 1UW4A 3RTVA 2O5DA 2H4WB 1H73A 5G4DA 4EU0A 3BQ2A 2QEXS 1Q95G 2E29A 1UOCA 1LWFB 2W9CB 4NLDA 2VBXA 3A8YA 3J7AP 3K59A 4FJXA 4OYOA 1EB0A 2B4JA 4RWWA 2AEFA 5KG7A 1JLFB 3KVGA 2MYFA 5ADXH 3ZC4A 3HTVA 4GNIA 2WAQD 3PSFA 8ATCB 2N4CA 4LFAF 1HQ2A 3A5LC 4OGEA 3CM5A 2R7YA 2RE1A 3W5ZA 4ETZA 4MLEA 5HATA 3BH7B 3D6HB 2R7WA 1RT6B 4WTYA 4AILC 3NAEA 4HTJA 1BA1A 5AZJB 2CQCA 2ABYA 3EKUA 1AFJA 3AAPA 2HNZB 1RAOA 1N33J 4ZVOB 3CD0A 3U9DA 4C8OA 4ANCA 4O3OA 1RT1B 2QXLA 2BE9B 3VAFA 4F4XA 3RRHA 4KKOA 3R6MA 2XNRA 4WYWA 2M5YA 2JWKA 1GMWA 2FSKA 1NGBA 3THYA 4B9UA 3NHGA 1NAQA 4F3TA 2UU9J 2VOOA 5BR8J 1XHXA 4PWUA 4FBTA 4CJ4A 1RHMB 3AVAA 4EI2A 4BC2A 1WEXA 4DL4A 2GVZB 2E5LF 2NZCA 2QA2A 2D7SA 4F67A 3QDKA 4DEZA 4IQXA 1GAOA 2GA7A 4RTFD 1RTDA 5CE3A 3SSSA 2MZSA 2GV9A 1TKTB 5J1EA 1S4EA 2J7KA 1WWHA 1VIXA 2K06A 3C6UB 4HWIA 1HPZB 1FRMA 3N01A 1NKBA 4P10A 2V0NA 3G4SN 1NH7A 3UKUB 1W2IA 3V9UA 4DV6F 4DSKA 2HNYA 3WXJA 5L39A 3SSQA 1WSEA 3DFEA 1G2EA 2FZGB 4WQ4C 3M4XA 2LFVA 1PAUB 3LPYA 4JK8A 3MAQA 2DPIA 3JXOA 3VQ4A 4DU8A 2DH8A 3F9KA 1DLOA 2YJEA 3T1AA 2VG5A 4ECYA 2B3TB 2YCHA 3ENAA 2OPQA 2VYPA 4QS8A 1RTJA 1KP6A 3BGLA 2ZJQL 2CJKA 1TYQB 4AHVA 5LMNJ 3BGFA 4PXDA 3TR5A 1X4GA 1BC6A 2CH6A 1VQKS 5AQQA 4DR6F 1H98A 1UZHA 5FPDA 4X65J 2UUAF 2D3UA 2K7KA 3KKRA 2XS5A 4JKFA 4HCBA 4WF9Q 2XMTA 2Y9HA 3VQ8A 5KRSA 1BQMB 4JB8B 3L7OA 1SKRA 5M2PA 1DTQB 2ZGYA 4ECUA 4MAKA 3KLVA 4EZ6A 3MWPA 5B8HA 3DXMA 5AXNA 2CQDA 5JLHA 2CADA 3WC0A 2R7VA 4ZTJA 3Q0AA 5KFIA 4WFXA 4RKUC 2YX7A 1R0CB 4TY9A 3PFEA 3T1YJ 1XMQK 3D68A 3WNEA 3KK2B 2G0JA 1Z6RA 2GX9A 1RXOB 1Q0NA 1FRXA 1V6HA 1K9MO 3VGVA 2W41A 3O3GA 3CJ4A 4ITSA 5AXMA 4GKJF 5KG5A 2N7YA 4B3OA 5C25A 2HVEA 3BZKA 3IWLA 2DKOB 3IAS9 1Q79A 3H40A 4DS5A 2LEBA 4LFCF 4DUZF 1S9GB 2YQ1A 2ASMA 2OHDA 4BDZA 1NM2A 3ZZZA 2GHWA 2P9LA 5AQXA 4H0VB 1C1CB 4YOWA 4OYAA 1N8RT 1VSDA 4RG8A 4WPAA 2QLBB 1TU0B 2RHQB 1LK5A 2I9SA 1OY8A 1C1AA 2R7OA 5HLFB 3RR7A 2EG2A 1VC0A 1VQOS 2OPPA 4RNNA 2RT3A 4A8QA 1KTQA 3RRKA 1Y97A 4CF8A 2CJXB 4B9NA 2BKNA 2GVDB 3SDEB 4V1Ak 1RADB 8RUCA 4YS2A 5GMDA 2Q1NA 1TV6A 1L3VA 2R7RA 5AZIB 4EK2A 2K3KA 4BGAA 4MFBB 4HHTA 4M3YA 1T03A 4JKBA 3UIQA 4KTZA 1X9WA 2G8FA 4CIGA 4LSNB 3FSIA 1Y10A 3N6NA 3ZSYA 4BR9A 2YXLA 1JXLA 2JLFA 2LU2A 2NZTA 4DN9A 2MZQA 2RKIB 4DPOA 3H4DA 3TVYA 2A1SA 1NU0A 4DR3J 2NXEA 4PYAA 5FPMA 1HD0A 1NSPA 4HT7A 4N8NA 2RIJA 3AOBA 1R8HA 5BYSA 5HSPA 1YJ9N 3MZIA 4RCHA 2C28A 2P9KB 4KB1A 1FKPB 2O66A 3JSRA 3UD4P 3FUYA 4JI8K 3NOCA 2JX2A 2O8FA 1GLJO 1CJUA 1CC8A 2G0CA 2K2PA 3KXDA 1D4XA 2DNGA 3D6TB 2ZITA 2P9NB 3WQPA 4YUDA 3J7YP 3AT1B 1XNRJ 4W5OA 4I2PA 3AO3A 3GV7B 4JV1A 4QPTA 2Q97A 4KH1B 2A2CA 3ENOA 3NGUA 3TZWA 2ZM6J 1NJYA 4AXIA 4WXWA 5E26A 1FHTA 3EE9A 4TN2A 3ICLA 3CB4A 5HN0A 3HHLA 4DV7K 1LWCA 4M42A 2EFQA 3FLCO 4UOFA 1X0FA 4CHNA 4HVZA 1SJ4P 1HMVA 1IJFB 3S6EA 3ENVA 4DV1K 3AD8C 4Y1DA 2QW9A 5HANA 5LJVA 1Q7YT 4NLCA 2HRTA 4ISGA 3UVJA 5I3UA 1W7WA 4WCEQ 1RBVA 1KONA 2RRNA 4CI6A 4F2RA 1URRA 1RT3B 3GR1A 2GX8A 1MROB 1ROFA 1QVGM 1W7AA 2NRRA 5GADI 3HM9A 3UQSA 1I51B 2W4CA 1ZM3A 4CZIA 4KI6A 3QLHA 5DLFA 3CDUA 1BXNA 1B4SA 1U0SA 3R1HA 2R8GA 2VIHA 4JKDA 3VZIA 1ACMB 3NF7A 4I6WA 1N33F 5K5MA 2DNLA 3NGZA 3CQ8A 2U1AA 2W01A 5D77A 5C42A 4CGDA 5AQZA 4CF9A 2V68A 4WK1A 3OR1B 5AQVA 2P5GA 4ZDNA 1AUSL 4KI4A 1EQYA 3NGKA 4ES2A 2LXFA 2W9AA 5GVQA 4G1QB 2DT9A 5HRSA 3R8EA 2YVSA 2DIUA 4DTMA 1LW2A 2UU9F 1F9FA 5BR8F 2NXCA 3POTB 3KLEA 4FJIA 2Y3YA 2C22A 4X4VA 4Q2LA 2IVYA 1HNWJ 5KGWA 4K25A 1NK5A 3LP2A 1JK9B 4J9KA 4Q2MA 4WF9L 1FNXH 2XM3A 4CGJA 4FS2A 3NKYA 1M1KT 1ZAXA 1QUVA 2ZOFA 3O44A 1LQ9A 1U2RA 4OHVA 2LECA 4IR9A 4CEOA 5A8RA 4YFUA 2XMUA 3HBTA 5KRTA 5K14A 5D4PA 3V9XA 4LQ9A 5EX0A 3FZMA 3MXIA 4LBIA 4FZYA 2J8AA 3V4IA 4OZJA 1UVKA 3CCJN 3L4QA 2VUGA 1EIYB 3G82A 3NOGA 4C3MA 3QSIA 4LRDA 1S1TB 2KM8B 1ILYA 3X3UA 2FC8A 3R27A 2ZH1A 4L73A 2DRBA 1A9NB 3ATUA 3MM6A 1SZ2A 1PKUA 3NMRA 1U45A 4CEBA 1WUAA 1IKYA 2AGPA 4OPKA 2HHHJ 4I4BA 2HSTA 3QAEA 3BDPA 1HKGA 4FJHA 1CXQA 3NMUA 1R3NA 2PYLA 4NOHA 5LXRA 3HVAA 2ZWPA 3P8BB 1HIYA 3OTOK 1VR6A 1SIWB 2BJ8A 4CLKA 2XMVA 5AT1B 5LMNF 3E2EA 1GMVA 5LSRA 2EW9A 5M1KA 3MD3A 2QGFB 2VV5A 5GAGU 4ZP6A 2ATLA 4X65F 3HSTB 3AO1A 1AW0A 5E3CA 2W7PA 3OYNA 2HGNA 3R1XA 2ILYA 5EVZA 3PX6A 2XRIA 4RW4A 1NJWA 3G96A 1T05B 3L2RA 4DV0J 5EX5A 3V2UC 2ZJPL 1LWEA 4BLGA 3TTDA 2RMLA 4YDDB 2DHXA 2B8PA 3WNFA 3ETOA 4YHHJ 2PI5A 1WEYA 3T1YF 2V8VA 4ZITA 1RT4B 4XDDA 3W61A 3DYAB 3S8SA 1XJWB 3VGSA 4DF4A 1FKOB 2BMBA 3DLJA 1Q53A 2CNNB 3RWUA 3TJ8A 2AA4A 4NYNA 2VZ9A 5GIOA 3K8VA 4U6PA 3A8IA 4RO0A 4YOEA 1WD6A 2QT7A 2LMIA 2EWSA 2NRXA 2RDIA 1FTCA 1S0VA 1Y64A 2A6MA 3MMCA 2G1DA 4H8KA 1Z26A 2VDHA 5AQPA 3MR5A 4LFAK 1IV0A 2UUWA 2M3DA 5KFGA 4ED7A 1T9TA 5ETLA 4HVJA 3DCAA 2ZBRA 2ASYA 3BB5A 2ZGZA 4C98A 4DCHA 1S1VB 3K5NA 4FNIA 3GCWP 1BUPA 2MZTA 4DJBA 2E8AA 3HHDA 2EBGA 5B08A 1HARA 3KLGA 2MKIA 2BKPA 2XSFA 3ID8A 2D0BA 4WCEL 4WXOA 1SL0A 5E2QA 2C2MB 3CJ7A 1RAGB 3SMZA 3SCKE 1HBOA 3UCGA 4WE1B 3K0JA 2JL9A 4LF4J 4XEIA 3DRRA 4IDKA 3DRPB 4HEA9 4PKGA 4KB7A 2CAJA 3R9LA 4DR3F 3AQOA 4M5IA 4DR2J 1S0NA 2AW0A 1J53A 4UY8T 3FFIB 2ZC4A 4J9UE 2E5LK 3KLHB 3D6MB 4AHUA 4QS7A 2V34A 3OV7A 4KGKA 1X3NA 2F7TA 4LJMA 5LJWA 1F1BB 2Y8WA 3TAFA 4PUOA 4R25A 3THPA 3C14B 4LVNP 2G8KA 4P7VA 1XNRF 4P74A 1OO0B 3QPIA 4N41A 2F4VJ 1G1XA 2WVCA 1S9FA 1IBMJ 4FSVA 3ULHA 2HZCA 2E9TA 3IS9B 2ZM6F 4BRPA 2JEIA 3H5YA 2B9EA 2LQBA 2DNHA 3CMQA 1MMLA 3C7NB 2QWRA 4DV6K 3QJPA 2QLFB 5F0UA 1P9YA 4J8FA 2V8GA 4YR0A 1R0AB 2W9BA 3WEEB 2H4YB 4AQYJ 2FB0A 5D4NA 2DR6A 3EY1A 1Y9OA 4ECWA 5BREA 1P90A 2BANA 2DD8S 3TRGA 5KPZA 1J5EJ 1HX1A 4C8KA 2PEBA 1TL7A 1U48A 2N3LA 3HO1A 3MOZA 4YY3J 4LSLA 2HQDA 3OYKA 4NCBA 4WFZA 1X60A 1D8YA 4CJWA 3AVGA 2CZ4A 4DR6K 4DQPA 4DR1J 2CPXA 1NHKL 3UNYA 2J9EA 2UUAK 3ZX0A 3NCPA 5ETNA 3RYLA 5KFMA 1FD8A 4BRDA 2GO8A 2XCPA 1RK8A 4GY2B 5D8HB 2XTJP 2ETJA 4P72A 2WSCC 3GIIA 2WW4A 4A5AA 1XUPO 4IG3A 1PYSB 2NZ4A 2CJAA 5FIIA 3PYFA 4RNOA 3CJKB 4PWDB 1SH2A 4JI3J 4J2AA 5G0RB 1TKZB 3CQYA 3MR6A 3JQKA 1X7VA 1HD1A 3U3YA 1DKGD 2VBYA 3R5GA 3O5BA 2KT3A 1N5YB 1V9OA 4CFCA 3SJHA 2ZKUA 2YWKA 2G8UA 2V2QA 1DT9A 1FXRA 2HHPA 1HKAA 1HNWF 5RUBA 4GKJK 4KPCA 4B9MA 3IWNC 3ZNJ1 2KU7A 4LFCK 3IRXB 1VSKA 4DUZK 2DR9A 3D0GE 3BSCA 5IV3A 3BBBA 2FQQB 4BRKA 3QIPB 3AXKA 3BKUA 3MM9B 4ECVA 5HBMA 3AB2B 5KQ8A 4UZCA 2RVJA 3ID6A 4X62J 1TL1A 2DXFA 3OXFA 2GGPB 4ZHRA 3FGVA 2EFGA 1KWMA 5KG4A 3W3DA 4ZVTB 3Q24A 1JLCA 3PYEA 2G2OA 2R2TA 1UFKA 4IXCA 5ELZA 5M1PA 1KOHA 4U8VA 3G4SS 2CPHA 3NGIA 1UL3A 4B3SJ 4F26A 1N4LA 5E3QA 1E3MA 3OFHA 4K2XA 3V81B 2GMHA 2VPWB 1ZC6A 2HVDA 1SQFA 1RNHA 5HROB 4USVA 4CRJA 2VBZA 5AQTA 1XWLA 4ES3A 3NF8A 2HHHF 3SUNA 4GV3A 3RAXA 2OH2A 3CCMS 4QJVA 1YHQS 1FNMA 2YX6A 1X8DA 2AGOA 3S01A 4CTAB 4B3RJ 1RDCA 1UVIA 3RR8A 1B99A 4OYZA 5KT5A 3AV9A 4UOCA 6FDRA 3Q2SC 1QVFM 4G1PA 4USJC 1UEKA 4NLTA 4WFAL 5DO2A 3NCRA 1WOPA 1DAXA 4PWWA 4TY8A 4UQGA 3UR3C 3BN4A 2X7IA 1RWVB 3KLIA 2PEHA 1D1UA 1ZM4A 2QWOA 1UJ5A 4FVCA 1IQTA 5DQGA 1KSPA 4F0KA 3U7JA 4PAAA 1B9DA 1WOOA 3GSIA 4W98A 4DV0F 3MFIA 1SS6A 2HOEA 1NKCA 3MEDB 1RSCA 1SJQA 2H1YA 5EHHA 1HQEA 1U47A 2FJWA 1IJEB 3CDAA 1AYEA 2QWQA 1OH8A 4FOIA 3HVRA 3KHGA 3NMAA 4YHHF 2FJXA 4NLQA 1S48A 1OH7A 5D6GA 2AHOB 3HHKA 3OD2A 1S6QB 1XR7A 3TX0A 3PEHA 2M7SA 4FYVB 4CLWA 3D5MA 5B0DA 3KFWX 3GG0A 4J9QA 4FWQA 2R4FA 2VF3A 3TSPA 3TUIC 3OHBA 1FWPA 3KWMA 4I9QA 2PO4A 3M2VB 3D6RA 3NCQA 3SFUA 1SQGA 4ZLLA 1N6QB 4J9PA 3CDEA 3I5BA 3W62A 2XC9A 4MKVA 5KFJA 3IR6B 5HRRA 2XGPA 1NGJA 4A4JA 1JXBA 5KFKA 2VJVA 4C4WA 3HKWA 3LO3A 2FJDB 1X4HA 1WSIA 4FW1A 2G0IA 4AE5A 2BZ2A 3J7ZT 4KC5A 2H5IB 5F0WA 3HMJG 3W9JA 5EOYA 2BUPA 3I32A 1X3MA 1WN7A 3BUZB 2OZMA 4OZNA 2ASOA 5KFDA 2OEKA 2Q66A 3DHXA 1MU2B 3MX5A 1N33K 2C2RA 2GS8A 4ETXA 4IEIA 3GV5B 2XLJA 4RWTA 2IJFA 2DJWA 3OA9A 1UW9A 3TQEA 1S12A 1VQMN 3D2FB 2O8CB 1R6VA 1N5SA 2FJBB 1MMDA 4BR0A 1TUYA 2HVHA 3NE6A 3KOAA 2YHAA 1HFEL 3HVTB 2W1BA 3M1VA 3ONQA 4LF4F 4RW6B 2UU9K 3MCOA 5BR8K 4ZKAA 3W9HA 5M2RA 4DR2F 5BRHA 5KFLA 3VGTA 2OLWA 4NL5A 2GWKA 2ASDA 4X2BA