3T1AA

Crystal structure of hiv-1 reverse transcriptase (k103n mutant) in complex with inhibitor m05
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
558
structure length
554
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse Transcriptase
publication title Design and synthesis of conformationally constrained inhibitors of non-nucleoside reverse transcriptase.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
total genus 155
structure length 554
sequence length 558
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3t1aA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t1aA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t1aA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t1aA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3t1aA05
1JL2A 2ASDA 1HQEB 3AVMA 4M41A 1QSYA 1XR6A 4O3PA 2OYQA 3LP1B 4DG1A 1S0MA 4B3OB 3UPFA 3PVXA 5KFYA 4CGIA 3MAQA 4HUFA 4WFZA 4GC7A 5L1LA 1Y97A 4M45A 4W5RA 4F3OA 3SFUA 1C0UB 3ZSRA 4I2PB 5J1EA 3NHGA 1Z4UA 4IG0B 3HL8A 3T1AA 3LZIA 5K14B 1S1WA 2DFEA 2Z1GA 1JX4A 2VWKA 3H59A 3D5MA 4HCCA 3M9MB 3KOAA 4KFBB 5DQHA 4O0IA 3NF6A 4MK8A 4Z4CA 1WSJA 4F8RA 1QTMA 3MEGB 4DFKA 2IMWP 4KB1A 4FK2A 1IKWB 1IKVA 3JSMA 3VQ4A 4CHZA 1TV6A 4KPYA 4RW4A 2G8KA 3MFHA 5F8HA 4IDKB 1YVFA 2KFNA 3V6HA 5KI6A 1J5OA 4C8KA 1CXUA 4YNQA 3NGYA 3KHHA 4YQWA 4Q43A 4BWJA 3G6YA 1T3NA 1TAUA 1N5YB 3V6JA 1N48A 4ED8A 4ECTA 4K4ZA 1RA6A 1RT2A 1RAJA 2XI3A 2OPQA 1S49A 3SI6A 3V9SA 4M3RA 5KT7A 3C6UB 2IJNA 3OYBA 4FJGA 2KZMA 1UWBB 1N6QA 3ITHB 1L3UA 2RF2A 1NKBA 5CYQB 3VQSA 3C94A 5HRNA 2G8FA 1HRHA 4ID5B 1FK9B 1LW2A 1S9GA 3KTQA 1S6PA 2V4RA 4CJWA 1ZBUA 3M8SA 4B9TA 4F4YA 1C1CA 3OYCA 3NBPA 5C24B 2JGUA 2WRMA 2BE2A 2GC8A 4KE5A 3DI6A 3DYAB 3TAPA 3AVIA 4CGFA 4CJUA 1OS5A 4QWEA 4IRDA 3QEXA 2D0CA 4AHRA 2IA6A 3JYTB 4J9RA 1XHXA 2I5JB 2GV9A 1DTTA 4CFBA 4FM1A 2HNYB 4DWIA 3RTVA 4WXOA 3AO3A 4DFMA 2HHVA 4MFBB 3IGNA 4F2RA 4IKAA 1R0AB 5JUMA 4F50A 3AVLA 1RILA 1BI4A 3SYZA 3O3GA 2RKIA 2OPPA 4BE0A 5CY4A 2YNHA 4MK7A 2OPSB 4ZVHA 2D5RA 1RT7A 3O4NA 2VG5B 1WSIA 4J9MA 2Y1IA 4RW6A 2HHXA 1W9HA 4M3WA 1SKSA 3PW7A 4Z4FA 1J53A 3NF7A 4J9KA 3HSTB 3ALYA 2XHBA 4FLXA 4NLSA 3AVKA 3S9HA 4Q0BB 3AO1A 3AO5A 4RW8B 5KFRA 4DFJA 5KFEA 2RN2A 3TABA 3MR5A 1GOCA 2WOMA 4IRCA 1YT3A 2GIQA 1D9FA 3M9NB 1S9EB 3KHLA 3LP2A 4M95A 5L1IA 4DF8A 4RUCA 1RBRA 1KTQA 1N4LA 4FJHA 3SQ2A 4ZHRA 1RDAA 3SCXA 5KFFA 4CFAA 3QIDA 3AVNA 4CHNA 4NLVA 3LWLA 2A1RA 4FLVA 4FW1A 3T19A 4LSLA 3UQSA 2AX0A 3C6TA 4CESA 1WAFA 5L1JA 4JS4A 1HQUA 1TP7A 5KFMA 4DL2A 4PWDA 3IG1A 3KK3B 3HJFA 3DRPB 3CVKA 4NLRA 1RT1A 4RNHA 3I5AA 4RG8A 1WAJA 3KLIB 2UUTA 1KRPA 3EPIA 4KAIA 4B9VA 1EETB 3OHAA 3QEPA 4Z4HA 1JL1A 1SL0A 2JC0A 2HW3A 2QE5A 1LW0B 1S1XA 3SZ2A 3V6DA 2W9BB 1GX5A 2BANB 3PR5B 4KTZA 1TKZA 2B5JA 4R5PA 3GYNA 3PW2A 5KFIA 5KT6A 4HVJA 4BE2A 4XPCA 2D0AA 4M3TA 3RB4A 1WNSA 4NLQA 4DEZA 4ECVA 4N47A 5CYMB 4R0EA 1X9MA 1IKXA 3OYHA 1GX6A 2DFFA 3M8PB 4IFVB 4QAGA 4JLHA 4QWDA 3HP9A 4B9LA 3AO4A 2R2UA 4KRFA 4B8AB 3QEVA 4CIGA 4NLWA 2Q3SA 2HNZB 4RW9B 4JV0A 3GIIA 4RU9A 2IAJB 2D3ZA 4OLAA 3EZUA 2D0BA 1YVUA 4EBEA 4CF0A 4ED1A 4CEAA 1JLBA 3PO4A 3MR3A 3ZSZA 2D7SA 1D0EA 4ZTJA 4E3SA 3PW0A 4NCBA 3DOKB 1RT5A 3EY1A 3AA2A 3Q8RB 3HP6A 4J9LA 2HVHA 2B43A 3OS2A 5CZ1A 5KGXA 1C2PA 3TAGA 1TQLA 4ZP9A 1ZTTA 3NF9A 4K8XA 4DSJA 4WFYA 1BHLA 2OPRB 1W25A 4FM0A 3CM6A 4NCGB 3ISNC 2ILYA 3QGGA 4BWMA 5J2QB 3RB3A 1WSHA 2WB4A 3I8DA 2YHAA 4CEOA 1RTHB 4DL3A 4JV2A 1IKYA 4EYIB 1RTJA 1LWCA 1U49A 5HROA 1KLMB 1RYRA 1VSIA 2XGQA 1RBUA 1HYZA 3L3UA 4FJXA 1NK4A 2G8WA 4MIAA 2JC1A 4QW9A 1HARA 3GIKA 1B9DA 3OYNA 3OVNA 4NLYA 2IC3B 3OL7A 4HYKA 4KAZA 1QS4A 1S1UB 4RNFA 3B6PA 1NHUA 3OYJA 4DTRA 1UA1A 1JLCB 2IS3A 3VQ5A 4NLXA 3V4IA 1EP4B 1RDCA 1ZBFA 4B9NA 3T3FA 4Z4GA 3KMQA 4KKOB 2OZSA 4IH5A 4J9SA 1JKHB 4KTQA 3FSIA 3H2LA 1VSMA 4Y2AA 4DTMA 3I0RB 3AVBA 4O44A 4K4UA 1X1PA 1K6YA 3MXIA 2FJXA 3HKWA 4CJQA 4O55A 1NNDA 1LWEB 4ICLA 2E9ZA 3TANA 5KFZA 2QXFA 5KFBA 4IR1A 3Q8QB 1B92A 3IS9A 4CGHA 2AX1A 2R8GA 2HNDA 3F9KA 3EZ5A 2WCXA 4ECZA 4DF4A 2XY7A 1SKWA 4FZZA 2X6SA 1VK0A 1VSHA 5KFJA 1L5UA 4ELTA 3U6FA 4ZPDA 1HYSA 2BRKA 4E0DA 4O4GB 1VSFA 4PY5A 3MTKA 2FBVA 3IRXB 3LP1A 3KLHA 3ZSOA 4B3OA 5J2MB 3UDLA 4ECWA 1T05B 4WZMA 4ED2A 3DLKB 3QERA 1C0UA 3TQ1A 2AGOA 5EUHA 4TLRA 4DL7A 4OPKA 1SH0A 1ZTWA 3CJ2A 3HVAA 1LWFB 4MK9A 3MR2A 4IG0A 3BJYA 1C1BB 4OGCA 4N76A 3U3YA 3AA3A 5K14A 3L2RA 1WSFA 2LSNA 1S1VB 3VN5A 1RBTA 3H08A 3KD1E 2RDIA 4BE1A 4KFBA 5F8MA 4DU1A 3FFIB 3MEGA 3TWHA 3HXMA 4FZYA 3EPGA 3M8QB 4Z4EA 4L8RB 4NZ0A 1CSJA 3PW4A 2WTFA 3VQ9A 3AA4A 3SPYA 5F8GA 2NUBA 3K57A 4H4OB 4ECRA 3NF8A 4U6PA 4CF2A 1S10A 3SFGA 1JLAB 1N5YA 2ASJA 2W8LA 1W0HA 1ASUA 3PUFA 1ITGA 5KFPA 4M94A 1JXBA 3S3NA 3KIOA 3CYMA 1SH2A 2UUWA 4MKBA 5F8NA 3KLGB 2HAIA 3SJJA 2ETJA 3ULDA 1X9SA 3C6UA 3V1OA 5FROA 4TYAA 1UWBA 1ZETA 3ITHA 5F9NA 3D45A 5CYQA 3FDSA 4ID5A 1FK9A 1BQNB 4GW6A 3QEWA 3GIMA 4MQ3A 2R2SA 5DG8A 3VQAA 2KW4A 4QOZB 5C24A 3CJ4A 3DYAA 1UOCA 1KSPA 3VQ7A 1DLOB 3CDEA 4DQQA 4ZVFA 1T03B 1GOAA 4CJ3A 3OYAA 1TL1B 2ZE2A 3JYTA 4K4TA 1BIUA 3PJWA 3RR7A 3SPZA 3G86A 3LZJA 4FLWA 4TXSA 2HNYA 3MR6A 4CEZA 2Y1JA 3I0SB 4AHCA 3MF5A 2YNGA 3OYEA 1NKEA 1TKXB 1HMVB 4CHOA 2E9RX 3RAXA 2IGIA 2VA3A 1R0AA 2FVQA 4RW7B 1UAXA 4FCYA 5KFOA 3QGIA 4O3RA 4CEDA 2KTQA 2W9AA 4CJ4A 2QV6A 2OPSA 2X78A 2QKKA 2ASLA 3MXMA 3QINA 3NL0A 4LSNB 3Q8PB 4UQGA 3VQ8A 1KVCA 4AILC 3KK2B 2WONA 4CK1A 3V9UA 3KJVB 3E51A 5DGBA 2BDPA 4FJMA 4Q0BA 3G10A 3OYGA 3HVTB 3QO9B 4WE1B 2R8HA 2FVRA 1S9EA 3OLBA 5F8IA 4FVMA 4TSXA 1EKEA 2KFZA 4EBCA 4CHQA 1FXXA 3G6XA 3VQPA 3LANA 2ZQBA 4Q8FA 1L3VA 4K4VA 4E7LA 4TYBA 1BL3A 1D8YA 4EP4A 1HNVB 5KG0A 3F73A 5DK5A 4XIUA 3H5XA 2XY5A 3KK3A 4IRKA 3BGRB 4JUZA 4KI6A 4NCAA 3KLIA 5E41A 2BQRA 3HVWA 4J9OA 3V1RA 5EU7A 4CCHA 3KLVA 2GIRA 2KZZA 3OL6A 3NH0A 5DMRA 1NK6A 4DLEA 1SKRA 2W9BA 2BANA 3AA5X 3PR4A 2XCAA 4J9PA 4KREA 4JRQA 3L3VA 2VA2A 4YMEA 4F2SA 5KGWA 5KG5A 3DRRA 3CJ3A 3C95A 3H98A 4NLGA 1Z26A 3LP0B 4Z4IA 2HVIA 3E01B 3DOLB 1G15A 3HM9A 3M8PA 4IFVA 2QK9A 4I2QB 3L2VA 4PUOB 3RBDA 4K4SA 3RMDA 5CZ2A 3QLHB 2OZMA 1NOZA 3VQCA 2HNZA 1D5AA 4CJVA 2IAJA 4TY8B 2B6AB 1HYVA 4URSA 1IM4A 3N6MA 3WNHA 4CFCA 4W5TA 1BISA 2D41A 1XC9A 4DSKA 4NLPA 4EZ9A 3AVCA 4DU4A 3HYFA 1KCFA 4LY7A 1NK8A 4N41A 5KFVA 2C2RA 2AJQA 1XWLA 4NRTA 3VQQA 1QSSA 3TAFA 2F8SA 4DG1B 3B6OA 3G6VA 4ZP7A 3QIOA 3KLFA 2BRLA 1IH7A 4NRUA 4MKAA 3TR8A 1S9FA 2DPIA 1CXQA 2OPRA 3T5LA 2FBTA 4NCGA 3PX4A 3QNOA 2F8TA 4CJSA 5HRPA 4BDZA 3V6KA 3LDSA 3DLEA 2UVVA 4GC6A 2IBKA 1T8EA 2ATQA 4E89A 1TV6B 4TY9A 5KFUA 4PQUB 2FLLA 1D1UA 3TI0A 3NGIA 1NK9A 4J2AA 3VA0A 1J5OB 4RZRA 2AGPA 4KB0A 2CKWA 1U45A 3RB6A 4CJTA 4M3ZA 1VRTA 1RT4B 3P5JA 5J2NB 2OA8A 2IC3A 3MEEB 3NH2A 1S1UA 1XHZA 2OPQB 3PY8A 5KG1A 1JLCA 2X74A 2E6MA 1U09A 4IG3B 5DLGA 5KRSA 4DTJA 1EP4A 5HLFB 1N6QB 3CDUA 4WXWA 3DRSB 5FDLA 2EHGA 5KFTA 1SL1A 1S9GB 1MU2B 4FW2A 2JEGA 1JKHA 4E7IA 2YNFA 3L2QA 3I0RA 1C0TB 1FKOB 2BE2B 3DI6B 4CERA 3PO5A 4FJ7A 4ED7A 1LWEA 5F8LA 3KK1B 4KHQA 4ZP8A 1N56A 4M3YA 1RTDB 4OKKA 2VG6B 4RNOA 4CEQA 1DTTB 2O4IA 1QUVA 3NGZA 3EYZA 2HHSA 1ASWA 1TKDA 2WHOA 3HO1A 1ZYQA 5JS1A 3DDKA 1IO2A 2C28A 3TAEA 1NOYA 1WSEA 5DGAA 1RT6B 3AVHA 4O4GA 4EBDA 4DSEA 2YNHB 3IRXA 5KFWA 1RT7B 1KFSA 2HWHA 5J2MA 5KFCA 4RW6B 5J2PB 3MECB 4KO0B 3DLKA 4FYDA 2ILZA 5T14A 4FBTA 5DG7A 4Z0UA 4LH4A 4ZVGA 2J6SA 1CZ9A 1C1BA 4NLTA 4OKJA 3LPUA 2Z1JA 3K58A 2HHUA 1S1VA 4CJRA 4CGGA 4IH7A 4CJLA 2RDJA 3SV4A 2YKNA 2YKMA 2WOMB 5HBMB 1VSKA 2FJWA 3IAYA 2UVWA 1S6QB 3M8QA 3KHGA 4CHYA 4CGJA 4N5SA 2E6LA 3SUPA 2R2TA 5EWFA 1BCMA 5D3GA 4ZVEA 4CE9A 3H4DA 3OL9A 1REVB 4B08A 3TAMA 4IH6A 4GMJB 1JLAA 4PWDB 3HK2A 2IM2A 3DLGB 4J2BA 4K4YA 2CJQA 2PY5A 3M9OB 3KLGA 3RB0A 3AVAA 1I6JA 3AVGA 4DQSA 2FVSA 1HPZB 3ZSXA 3QESA 1S1XB 1RBVA 2HHWA 3OJSA 4ED6A 1CZBA 1QAIA 1BQMA 1JLFB 1VRUB 4CF8A 2R8IA 4RUAA 4DQRA 4CJ5A 1RA7A 1K1SA 1DLOA 5DG9A 2DPJA 1T03A 2G8HA 2AU0A 2I1RA 3MEDB 4I9QA 5KG2A 4DS4A 1VSEA 1Z25A 4B9SA 4J9NA 4TQRA 1NJZA 3N6LA 1TKXA 1HMVA 1S0OA 4KV8B 3AV9A 2V9WA 4C8OA 1HQEA 4C8LA 4KHWA 1RYSA 2IOCA 4RW7A 4Y1DA 1JLEB 3NAEA 2V4QA 4FK0A 1JLQB 1RT5B 1X9WA 4B9MA 2BQUA 4DS5A 4ED0A 3ZT0A 3K59A 4EYHB 2AQ4A 3BREA 4BACA 4I2PA 4H4MB 2PYLA 4IFYB 4LSNA 3P83D 1FKPB 3KK2A 4O3SA 3VA3A 4EP5A 4QPXA 2XGPA 1XR7A 5C25B 2XI2A 5KG4A 3ZCMA 2G8IA 5I3UB 2XY8A 3L2WA 4BDPA 4QW8A 3H4BA 4B8CA 2R7YA 1NK5A 4OGEA 3HVTA 4Q5VA 5DQGA 2XWYA 1TK0A 3QO9A 1HNIB 4NLDA 2D3UA 3GV7B 1IKWA 4WE1A 2AGQA 2YV0X 4EZ6A 2C2DA 1SH3A 4IDKA 4Q44A 2VG7B 5KFLA 3VQBA 3D0PA 1LAVA 1I39A 1RTJB 3NMAA 2KQ2A 1LWCB 1JLGB 4E7KA 2W8KA 2R8JA 2BR0A 4HKQA 3QZ8A 5HP1B 3NGDA 3A2FA 4G1QB 4ECSA 1YTAA 4X2BA 3ZSVA 4AHVA 3SQ4A 3O3FA 3ICLA 3BGRA 3ZSWA 3V1QA 2DY4A 3UR0A 4E19A 5KG7A 4M3UA 4F4ZA 1S1TB 2ZD1B 3T5KA 2AWZA 2BQ3A 4KTWA 4ECYA 3L2UA 4FLZA 2FVCA 4K4WA 4G3IA 2HMIB 2C2EA 3S3MA 3H5YA 1ZBHA 3RBEA 1TAQA 4IOBA 2P5OA 1DTQB 4CEEA 4R8UB 3ASMA 1QE1B 3PHEA 2I5JA 4O44B 1JXLA 2F96A 3E01A 3DOLA 2GUIA 4CGDA 3QIPB 2VWJA 3I5CA 2O5DA 1RBSA 3QLHA 1RTIB 4FJ9A 3T5HA 4MFBA 3OS0A 4K4XA 3CJ0A 3IS9B 1S5JA 4LQ3A 3QNNA 2HNDB 1O1WA 1EX4A 3H5SA 1EXQA 2B6AA 3RWUA 4DSLA 1RT3B 5I42B 4ZP6A 4H54A 1HYSB 2A1SA 2XY6A 4DU3A 4KHUA 1A5VA 2VG5A 3KLEB 2HHQA 3L8BA 4IKFA 2YHBA 3NAHA 4ZPCA 2W7PA 3RRGA 3KLHB 3V81B 3OYMA 4DQPA 2IM0A 1WN7A 4LQ9A 2Z1HA 3ISND 4W5OA 4KHNA 3BSNA 5SZTA 1TL3B 2HHTA 1T7PA 3KD5E 4FLTA 4RNMA 2HWIA 2IM3A 4RW8A 4OL8A 1WNEA 3HPOA 5KFSA 4B9UA 4J9QA 4OPJA 4AHTA 3CFRA 1RCHA 4NLUA 4O5BA 3DMJB 1L3TA 3FRZA 4QWCA 1Q8IA 4IQXA 3MFIA 1LAWA 3CWJA 3K5MA 4CK2A 1S48A 3ZT1A 4WYLA 1L3SA 4GVMA 5DQIA 4FJIA 5KFXA 3NAIA 4E7JA 1TKTB 1J54A 1ASVA 2DTUA 2FJVA 2OH2A 3CM5A 1QQCA 4PQUA 5FRMA 3LAMA 1C6VA 2YNIB 3GQCA 3OYKA 5C42B 4DTNA 3TARA 3DRPA 4ID1A 1JIHA 1RDBA 1RNHA 3NFAA 1ZBLA 4Q8EA 5F9LA 5JXSA 1EETA 2IM1A 1TK5A 1XR5A 5L1KA 1RT4A 3LALA 5J2NA 4YR3A 2Z1IA 1LW0A 3DM2B 3V9XA 3MEEA 4AHSA 1S97A 2QKBA 3ZT2A 2PZSA 3IGVA 4IBNA 1HJRA 3V9ZA 3Q8SB 4IG3A 2J6TA 4TQSA 5HLFA 3BQ0A 2X6NA 2ITGA 3LPTA 2XO7A 3QETA 4PA1A 3DRSA 1TVRB 3WNFA 5KT4A 4C8MA 4E1NA 3NH1A 5CYMA 2FLNA 4FZXC 1MU2A 2O4GA 4HUEA 4OKEA 4CHPA 1CLQA 5F8JA 3K5OA 5C5JA 1C0TA 1FKOA 3FQLA 3LAKA 1A5WA 4DSIA 1SUQB 4CJPA 5KFAA 2G8VA 3O4QA 4RW9A 1TK8A 4DFPA 4ELUA 3SV3A 2ZE2B 3KK1A 2XC9A 1BCOA 1RTDA 3PJXA 2VG6A 4J2DA 3CFPA 4I7FB 4EO8A 2YNGB 3KKSA 4YR2A 3DOKA 2W9CB 3OSPA 1SV5B 3U3GA 4ECUA 3BSCA 5KG6A 4WYWA 4NYNA 1RT6A 3SUNA 2G8UA 4W5NA 4WFXA 3KHRA 2UVRA 3SNNA 3GV8B 1UA0A 1F21A 3IN5A 3K2PA 5EWEA 4C8NA 4XO0A 1BGXT 3SUQA 4FM2A 4XPEA 5J1EB 4CEFA 5J2PA 3MECA 4KO0A 4CJEA 2DFHA 1QAJA 4KHMA 4QWAA 1S4FA 2WONB 1S1WB 3BQ2A 3FQKA 1NJWA 1NKCA 4O3NA 4CF9A 4CK3A 3SI8A 5J2QA 3AVJA 2XRIA 5KFQA 4KHRA 4URGA 1RTHA 3HT3A 5HBMA 4YP3A 4O4RA 3NDKA 3ZSQA 1IKVB 3KMSA 3JSMB 4DSFA 4JV1A 3BSOA 1WLJA 4RW4B 2B4JA 3NKYA 1JXEA 1NJYA 1S6QA 1NHVA 4QWBA 4WZQA 1KLMA 4DL6A 5HRSA 1K1QA 3HPGA 2JEJA 3PX0A 1B9FA 3OSNA 3GILA 3QEIA 1REVA 5KFGA 4N56A 1KVBA 5DLFA 1RT2B 3NCIA 2JLEA 4JS5A 1QSLA 3DLGA 4FK4A 4E7HA 3OS1A 4NLOA 1D9DA 2P5GA 3O3HA 2RF2B 3I5BA 4EO6A 2FBYA 1S0NA 1NK0A 3K5NA 4KKOA 3DLRA 4F3TA 1HPZA 1LW2B 1S6PB 1C1CB 3NBPB 3AO2A 1IG9A 1JLFA 4NYZA 1VRUA 2W42A 2EC0A 3SQ1A 3CDWA 3OL8A 3DRRB 4URQU 3BR9A 3TVKA 3NE6A 3CFOA 2XCPA 4E1MA 3MEDA 1KLNA 4ECQA 3ZT3A 4FLYA 1WSGA 3QGHA 4IR9A 3QZ7A 3VQ6A 1U48A 1KVAA 4FJNA 2HB5A 4DTXA 1BI4B 1LV5A 1Q9YA 4KV8A 2RKIB 2OPPB 2R8KA 1JLEA 3CO9A 3OYIA 4KHYA 3PX6A 1JLQA 2ALZA 3QYYA 4CJKA 5KT3A 4CEBA 4ECXA 1T05A 5JS2A 4FLUA 2ATLA 4H4MA 2E9TA 4IFYA 1LWFA 3H5UA 3GV5B 2JEFA 1U4BA 1FKPA 4ELVA 3KLFB 3RMCA 4M3XA 4ED3A 5C25A 4F4WA 2UVUA 5I3UA 2EX3A 3PV8A 3OYLA 3T5JA 4DTUA 2P1JA 4HCBA 4F4XA 1ZBIA 3FFIA 1VSJA 2RPIA 1HNIA 3LP2B 4DL5A 4DTPA 3CG7A 3OY9A 5KFDA 4I9LA 1C1AA 4CECA 5L9XA 4ZHRB 4K8ZA 4KSEB 1QHTA 2VG7A 4CJFA 3DLHA 3DLEB 2W7OA 2FBXA 3BDPA 4DL4A 2R2RA 3ZSYA 4LSLB 4H4OA 3C6TB 4Y1CA 1JLGA 4KBIA 1HQUB 1RDDA 3IG1B 4Y34A 5HP1A 5KRTA 4G1QA 1RT1B 3RRHA 1NK7A 4QCLA 3RAQA 4CIEA 3UIQA 1VRTB 1U04A 4FBUA 3H40A 2GBZA 3WNEA 1S1TA 1RDRA 2ZD1A 3CQ8A 1U47A 3V6DB 1J9AA 5T7BA 1BQNA 4O3OA 1TKZB 2B5JB 4R5PB 4ZPAA 2HMIA 5KTQA 4AH9A 2C22A 5KG3A 3OJUA 3BQ1A 3G0ZA 5FDLB 3HPHA 3OYDA 1DTQA 1IKXB 3SQ0A 4R8UA 4YFUA 1QE1A 1TL1A 5KT5A 2YNFB 1TGOA 4DLGA 3RMAA 4ZMMA 3QIPA 4Y2CA 1I3AA 4KI4A 3I0SA 1RTIA 3ZT4A 1Q9XA 4EEYA 4Q45A 3LWMA 4BDYA 2IDOA 1JLBB 3OLAA 3KNAA 3THVA 1KFDA 1RT3A 5I42A 1YTUA 1SL2A 4OVLA 5SWMA 3OHBA 3K5LA 2BGGA 2E4LA 4OJRA 3PW5A 5KT2A 4FJ8A 3KLEA 2J6UA 4DTSA 3S3OA 2FLPA 4FS2A 3V81A 3KJVA 3HVRA 5EDWA 3P1GA 4F4KA 3HHKA 3CIZA 2IJFA 4KB7A 4CF1A 4O3QA 1TL3A 4MIBA 5KFHA 4CFDA 4FJ5A 4KHSA 4ZPBA 4FJLA 2JEIA 3CJ5A 3RR8A 3DMJA 3AVFA 3V9WA 4TN2A 4DMNA 2YKNB 4CIFA 2YKMB 3RMBA 4U7CA 1BIZA 1IKYB 4Y3CA 4RNNA 5KFNA 1TKTA 5HROB 2WK4A 1HNVA 2YNIA 1VSLA 3M8RA 4HTUA 3OYFA 5C42A 4DQIA 1NJXA 1KHWA 5FRNA 3KKRA 5D3GB 5EWGA 4YR0A 2F8EX 3TAMB 4ZTFA 4K50A 2FVPA 3PZPA 5HRRA 3SUOA 3DM2A 3WNGA 4FXDA 3V4IB 4AHUA 1GOBA 4LH5A 1T94A 4M42A 4OLBA 3GIJA 2P51A 1KHVA 4LD0A 4J2EA 1TVRA 2V0NA 3TAQA 2ZKUA 3LP0A 2PYJA 4FJKA 3LP3A 2FC0A 4H8KA 3VQEA 4W5QA 1BQMB 3MXJA 4HHTA 1MMLA 1XI1A 4O0JA 4FS1A 1C0MA 4NYFA 5KFKA 4I2QA 3VQDA 4PUOA 4ICLB 3D28A 4JRPA 4FJJA 1SUQA 4DTOA 4TY8A 4HUGA 1A5XA 4I7FA 1VSDA 3N6NA 4MH8A 2W9CA 1SV5A 3DLBA 3BSAA
chains in the Genus database with same CATH superfamily
4U7UK 2VU5A 2P9IA 3EXYA 4PEOA 2UU9J 1XR6A 2OTLN 2OYQA 2RVJA 1S0MA 4B3OB 1KC8O 3VF0B 4HUFA 1NM1A 4F3OA 1C0UB 2P9LB 4PWWA 4I2PB 5J1EA 1DZ5A 4RO0A 3LZIA 1OMSA 1T9YA 4NB4A 4HCCA 1I51B 5B08A 1NGJA 3V2UC 4F8RA 1QTMA 4ZIVA 1RUSA 3BDEA 4FK2A 1IKWB 2QTWA 5T7LA 3QQCD 4KPYA 1CC8A 2G8KA 4KYZA 4DR1F 4OZJA 2FTRA 3NGYA 1GLAG 3UR3C 5IT4A 3FEYB 3V6JA 1N48A 3THXA 4JI6K 1VK3A 2R7WA 2HZVA 2ZVIA 1RT2A 2OPQA 4OZ2A 2MJUA 5M1PA 4FJGA 2O3DA 1N6QA 3ITHB 4WQ5A 2RF2A 3D1HA 3J81j 5CYQB 4X66K 4WP8A 1JJ2M 5HRNA 1HRHA 2ZBRA 2V2VA 1Y0HA 2GX8A 1YI2N 2V4RA 4CJWA 4F4YA 2V8VA 4ILRA 2JGUA 2WRMA 2BE2A 1HBNA 3ENOA 2VB6A 3CCVS 4IRDA 2FXUA 4N77A 2XZWA 1DHMA 4OX8A 2GV9A 3H45C 3CJ1A 1J27A 1Q82O 2HNYB 4DWIA 3RTVA 2AF6A 4WXOA 3IR5B 1RHMB 3E1YA 2HHVA 4X65J 3CDBA 4F2RA 1FVSA 1BI4A 4UF4A 3MOZA 4GV3A 4MK7A 1SBRA 3U7JA 3WX8A 3O4NA 4JOUA 3S7RA 1GT8A 2GMJA 1UVJA 3GOIA 3CMAN 1PCAA 5F3ZA 1Q81T 1XQSC 2ASYA 3KHYA 4FLXA 4CH0S 4NLSA 4Q0BB 3AO1A 3I6PA 3AO5A 2C3PA 5KFRA 4DV5J 2GHWA 5KFEA 3U4LA 3DXMB 1GOCA 4PG6A 3KK7A 3CJBA 4Y2MA 3M9NB 3KKFA 2O1PA 1VQ9N 3LP2A 4QYZJ 1RFQA 1B99A 4KC5A 1FHTA 4YOWA 2E5GA 1N4LA 3WXJA 2IRXA 4ZHRA 3J8AA 3SCXA 1X3NA 5KFFA 2ZOMA 3QIDA 3LWLA 2QMUB 3T19A 4WWSA 1WAFA 4XDCA 4JS4A 1TP7A 2FDNA 3IG1A 3KK3B 3O80A 3CVKA 4RG8A 2ZUGA 3I55S 4J8FA 1UVMA 4KAIA 3H42A 3HOTA 1KQGB 2MPUA 1LW0B 2IIHA 3IR6B 2L9DA 1HWIA 2RUSA 4Y6IA 3PR5B 3HZ6A 3GYNA 4L76A 5KFIA 4HVJA 2GJFA 4XPCA 3H8YA 2D0AA 4DEZA 1F9EB 4N47A 1BXNA 4R0EA 4CLUA 1Q5VA 3IDHA 4IOCQ 1GX6A 2FJEB 2HK3A 2DHHA 4B9LA 3QJPA 4B8AB 4I56A 3QEVA 2OMOA 4CIGA 1Q8BA 3HHLD 4M5GA 1VISA 4RU9A 2IAJB 4BQZA 4OLAA 4AYBD 3WXKA 2CGJA 3D6FB 2BKNA 4ED1A 4M63C 1JLBA 3KUGA 2X1FA 2D7SA 4DUYF 5HJXA 2FGOA 5A0YA 1FNXH 1PG5B 2KRRA 4HHUA 4RKUC 2MKCA 1HR0J 1FA0A 2F1FA 3AA2A 3TJAA 1OYDA 1XIQA 1HNXF 3HP6A 5LY3A 4MKYA 4U67L 2IVMA 4CP5A 5L9NA 1ZPWX 1TQLA 4DR5K 4F0MA 2GQCA 2ZJRL 1RTZA 5E3AA 4DSJA 3VV2B 2H5EA 3D6TB 1BHLA 3BYRA 4E98A 3UDCA 3Q24A 3CM6A 1B0TA 1XNQJ 5BRDA 4F4AA 1SJ1A 4B9QA 3R1XA 3TVZA 2HBLA 2WB4A 3MDFA 3C16A 4LF9J 3I8DA 2G1HA 4P75A 1IKYA 4EYIB 1LWCA 3Q86A 2BABA 3QJLA 2H54B 3HOSA 2VQEJ 3T7ZA 2QZ8A 4G1IA 1VSIA 4A4JA 4U7BA 2XGQA 1HKCA 1S12A 4CLFA 1N52B 4DV0F 4FJXA 4V19S 5CD4A 2JC1A 3FNNA 1B9DA 3WUHA 1QD1A 5FD1A 1S1UB 1UCNA 2MYFA 3PIPL 1QVGM 1NHUA 4WIQA 3SEOA 4MO5A 3OYJA 3ETOA 1NH7A 1UA1A 2HVEA 3VQ5A 4A5BA 4W4MA 3HSCA 4H0TB 4OI1A 4B9NA 5AZJB 3T3FA 1IWAA 2I7NA 4CO0A 4IH5A 4A5AA 4DB3A 2OANA 1VSMA 4Y2AA 4DTMA 2V8DA 2Q3PA 2M70A 3DXBA 4CJQA 3FK4A 1NNDA 3IAM9 1NSKL 2E9ZA 4ICLA 5L8RC 5LMUJ 4IR1A 2PT0A 5AQKA 3Q8QB 4CZEA 4M5HA 3WC2A 3MM9B 3OUYA 2WCXA 2NXUA 4FZZA 4DV5F 2CIMA 1LNQA 1R8PA 1VSHA 1T9WA 1L5UA 4ELTA 4BC9A 3GMGA 4P52A 4E0DA 1K0TA 5BYSA 4O4GB 3W9HA 4C8ZA 3IRXB 3E9LA 3LP1A 1BO5O 1FRJA 3MM5A 4WKRA 5J2MB 1Y64A 4ECWA 3QERA 3M32B 1M1KO 1TL5A 3HVAA 3MR2A 4MK9A 4I0WA 4IG0A 3U3YA 3C46A 5JVHL 3TJ9A 1VQ6N 5K14A 1S3XA 3L2RA 3MPWA 5M2UA 3LDPA 3KD1E 2HGMA 2RDIA 4OX9K 4YHHF 5A8RB 5F8MA 4DU1A 2DYAA 4QPTA 3TWHA 3HXMA 2F4FA 4F25A 4CZMA 4FZYA 4JI7J 1VQMS 2R7SA 5F2RA 3MMJA 4M5KA 4J91A 4P74A 2XMKA 4A8KA 2HQ3A 3AA4A 5F8GA 3J80Y 2GA7A 3NF8A 4ED4A 2ASJA 1W0HA 2UXCJ 1JXBA 3ZEUB 3KLGB 1URRA 3SJJA 3ULDA 1Q79A 3V1OA 5FROA 4TYAA 5M1FA 3D45A 4DV1J 1M5VC 1TUVA 1TL7B 4ID5A 3NMUA 3GIMA 4MQ3A 2R2SA 4RX6A 5C24A 5AQRA 5CE3A 3CMQA 1UOCA 2WBNA 3VQ7A 3CDEA 4RTFD 4DQQA 4YB1P 3BUZB 1GOAA 4CJ3A 3M2RA 3IAS9 1BIUA 4K4TA 3PJWA 3RR7A 2R7OA 3CI5A 4AQYJ 1CEZA 1H73A 3CCRS 3H46O 4J5OA 2VBZA 3W2VA 4LBHA 3ZETB 4CHOA 2C2OB 2E7XA 2IGIA 2VA3A 2ZDOA 3ZC4A 1AXQA 1KQSM 1RHKB 3UO0A 3JAMU 4CEDA 2OELA 4LF9F 2FB0A 1CJVB 2OPSA 3E9PA 1TTHB 1FWPA 1EAYC 3BGUA 3NL0A 3OR1A 3NWRA 4BRHA 1P1TA 3V9UA 3EE3A 1TFWA 2NNWA 3LPEA 3H7HB 5DGBA 4CYUA 4BC3A 2GVDA 1TL4A 4ZVUB 3NWGA 5MAOA 4IOAQ 1P6TA 2FVRA 4FVMA 1EKEA 3GPAA 1BMQB 4CHQA 3G6XA 3R9PA 2PSZA 2G9OA 2R9LA 2BA9A 4RUHA 4K4VA 4ZCLA 4H5NA 1VC6A 2DGOA 3OTCA 2KH9A 4OPAA 4LFBJ 4YOYA 2OUGA 3M6WA 5DK5A 3CCZA 3BGRB 1BDGA 1ZH5A 4KI6A 4NCAA 3KLIA 3BPSP 2F40A 5E41A 3A5LC 4JAXA 4J9OA 3D2FA 3V1RA 3ENQA 1FE4A 4WP9A 3CE8A 3KLVA 1YZ7A 1Y3KA 5DMRA 1NK6A 1VJWA 5BRFA 2W9BA 4J9PA 4ZPVR 4JRQA 3L3VA 2VA2A 1S6OA 1X5SA 2KG0A 2M8DB 3DRRA 2B56A 2ERRA 1RHUB 4RJVA 5CYJA 2VC1A 2FC9A 5HSPA 4U8VA 3E01B 3SAHA 1Q0NA 3M8PA 3HI0A 2NCKL 2QMWA 4K4SA 2R7TA 1U24A 5GADI 2P9SA 2KM8B 4CJVA 1SC1B 4JYAJ 4B3TJ 3BGFA 2B6AB 5E2QA 3CPWR 1IM4A 1EQMA 2PEBA 4CFCA 2XS5A 2RU9A 4W5TA 5LJVA 4DSKA 4NLPA 4GVEA 1CZAN 3VGVA 3ZTQA 2BJ3A 3AVCA 3PSFA 4DU4A 4YB5A 4LY7A 1XMQK 1BUPA 2P9IB 3Q8UA 3U1NA 2C2RA 2AJQA 1XWLA 2PFFB 3SJHA 4EIAA 3TAFA 2F8SA 3B6OA 4DR4F 1JXVA 4EK2A 1S72S 1GLLO 2CJAA 3TR8A 2VFRA 2HHHF 4FYXB 2O8CB 2O8EB 1VIOA 2JJ4D 2UXCF 3TX0A 5GMKa 2HOEA 4KH0B 2CQBA 2X1AA 3JS9A 2AP6A 1RWOB 4E8UA 3TUZC 4CLLA 3ZZRA 3DOMA 4TY9A 4DPOA 4PQUB 1D1UA 3TI0A 2COLA 4MLHA 4J2AA 3HD2A 3VA0A 1M5KC 5GVQA 2DR8A 3GJRB 1X0FA 1AFIA 2P9KB 1ZM3A 3RB6A 1BG3A 1VRTA 3P5JA 5J2NB 2OA8A 3BZKA 1IJJA 2Q66A 4CTAA 2ZBCA 2OPQB 2UUAJ 2W24A 3M4XA 1BWEA 1JLCA 4LF7F 2LU1A 2EFQA 5KRSA 3GE1A 1EP4A 5HLFB 1N6QB 3P49B 3CDUA 2G2OA 4WXWA 2EWSA 1WJ9A 2EHGA 5K20B 3CJTA 1SL1A 4LFAK 1S0VA 1JJCB 3J80U 3ZTRA 2YNFA 2M0GB 3I0RA 2F63A 4AL5A 2BE2B 4YORA 1HBNB 3PO5A 3ATVA 1LWEA 2BJDA 5F1XA 4B1UB 1GLCG 4KHQA 1RTDB 4OKKA 1U1MA 2O4IA 1PKUA 3NGZA 2GQQA 5H9EK 4CVNE 1LK7A 3HO1A 2F4VK 1W2IA 2AJ1A 3DDKA 4C3MA 2FHJD 4MYTA 2O01C 3KWGA 4KHPK 1CS4A 4USIA 4EBDA 4RWTA 2WUSA 4FL9A 3EZOA 4DR1K 2VOOA 3OD2A 4HL9A 5J2PB 2HGLA 4FYDA 4LFBF 2J6SA 1C1BA 4B17A 4OKJA 3LPUA 4NMXA 1RBLA 4U8YA 4CGGA 4IH7A 4BR9A 5IC4B 2RDJA 1N36F 2YKMA 3OT9A 5HBMB 1VSKA 3MN5A 2IJRA 3RUBL 3R2CJ 1UPPA 2RD5C 1TMMA 3RZAA 2E6LA 2ZOGA 2R2TA 1EARA 1BCMA 2BOPA 4FPIA 2GHVC 1REVB 4M63A 4QJVA 3H6EA 4CT8A 1WG1A 4B1YB 1IM6A 2CYYA 1G2EA 1V6HA 3MCNA 1GXTA 3SQOP 5B7WA 2XNQA 4Z2XA 1FJGJ 4WK1A 1RAHB 4ANCA 1Q16B 3RB0A 5ETVA 2OFGX 1HPZB 9ATCB 3MN9A 3MPYA 3US5A 1VK8A 1CZBA 3CCES 4B1VA 1NDLA 1QAIA 1BQMA 4CF8A 1JJ4A 4DR7F 1OWXA 1W2BR 3P31A 1WC6A 2XG8A 1RA7A 2QT7A 4P71A 5DG9A 2B4VA 2BKPA 1LOTB 1RAFB 1FXLA 1T03A 4H0OA 2AU0A 3O6WA 4I9QA 4DS4A 5DM7Q 2WBMA 5AQMA 4TQRA 3NOCA 1YJ9S 1CJUA 1U1LA 3ID8A 3MDQA 2D9PA 3CJQA 3AAWB 2OD6A 1HQEA 1RYSA 2V4QA 1RWKB 5B0CA 2MTLA 4FK0A 1JLQB 1X9WA 1HI1A 1D8ZA 3DNCA 3UKRB 5DDPC 4H4MB 4LIWA 3P83D 1SQEA 3GJTB 3TUPA 2BE9B 3FCWA 3VA3A 3PRDA 1XR7A 2QL7B 4QW8A 2DRAA 3H4BA 1NK5A 1WELA 4ILLA 3J7YP 3HVTA 5CHIA 4NLDA 2W6LA 2AGQA 3ZYYX 2PMZD 1FRKA 2C2DA 5BR8K 1SH3A 4LF6J 4HT5A 4EWTA 2CPXA 5KFLA 3VQBA 3D0PA 1LAVA 2MKSA 4DPWA 4UOGA 5AE1A 2ZEJA 3UFCX 1U1QA 1VQYA 1I39A 4OV6A 1W97L 3HLUA 4OHXA 1LWCB 1GLDG 4E7KA 2BR0A 4OX7A 3G4SS 3NGDA 3CTRA 4ECSA 4HVZA 1UJ4A 4LF5J 4X4VA 5EOYA 1UWAA 2Y1LB 2M88A 4M3UA 4F4ZA 1NCLA 4IOXA 2NRVA 1EWQA 2ZD1B 3UB5A 1KN6A 3I9ZA 2BQ3A 4ECYA 3EJMA 3C14B 3K9KA 3HFZB 5FIIA 3OV7A 5K8OA 4L72B 1N5VA 4R8UB 2PIIA 1QE1B 2J0SD 2YXLA 1FWLA 1NDCA 2HSEB 2IVNA 5AQZA 5GAEP 2MHEA 4CGDA 3QICA 3LOUA 1V4SA 1U1NA 4IO9Q 3GONA 4FJ9A 3CJ0A 5E3QA 2V2QA 3QNNA 1EX4A 3RWUA 1RT3B 1E6YA 4I6MA 3VPZA 3HHLC 3QSIA 2N3OA 5AQIA 4DV6J 4H54A 2WVEA 2J8SA 3OPKA 2L08A 4KHUA 3KLEB 1VBXA 3RRKA 2CQ2A 2XMAA 4GKKJ 4GMKA 3HULA 4K59A 4DQPA 5AQNA 4LQ9A 4WF9Q 1FRHA 5SZTA 1TL3B 4KQZA 3EVWA 4RNMA 4FLTA 2UUCF 4DV0K 2CGLA 4B9UA 1HBOA 4PPDA 4O5BA 2CPZA 1Q8IA 1FJGF 1N88A 3OVSA 1RU1A 4IQXA 1RGIA 2KHDA 8AT1B 4CNYA 4IJNA 2LQ5A 3TSPA 1VQLN 3KYLA 1YJNS 3AJ2A 4DZ6A 3CWJA 2GCFA 1FX2A 1AA1B 1S48A 1TUWA 2W4DA 2KFYA 3CF5L 3RSEB 5KFXA 1KVIA 1J54A 2VF3A 3CM5A 1FWKA 1C6VA 1SPBP 2YNIB 2V63A 3GQCA 3DLLL 5LSOA 1SQFA 1VR6A 3TQEA 1YQHA 2ZBPA 4H0YB 2RB7A 3UDEA 3THWB 1HHTP 1IBKJ 2IM1A 5L1KA 1RABB 3CCWA 5F0UA 3VETA 4C2MA 2FHOB 2DNNA 3CPEA 2QKBA 3G82A 2PZSA 4IBNA 4DV5K 3J81Y 1WOSA 1MROA 5E3CA 2X6NA 2NYHA 1WBBA 2XO7A 3QETA 3DRSA 4RCHA 5KT4A 2JRSA 5CYMA 1YJWN 4QYZK 4HUEA 4OKEA 4WIIA 3SXLA 1ZM9A 1FO1A 5BXIA 1S77D 2E1ZA 4A8QA 3VGKA 2HQFA 1A5WA 1ILYA 1JQGA 1R8AA 4ELUA 2P6TA 2ZGYA 1BCOA 3MWBA 2VG6A 3T1YJ 2NRTA 4A47A 2MEWA 3W0LA 4CO2A 1U0HA 4ETXA 2VQFJ 1CJTA 2W2QP 3I4PA 1I94J 2W9CB 1GEHA 4DPXA 4P72A 3UI3A 5KG6A 4YHHK 1RT6A 3DU5A 5CD4H 3SUNA 1FFWB 3MN6A 2G8UA 1H7XA 4W5NA 3FBEA 2E66A 5IQQA 2UVRA 4WFXA 2P6SA 4H5RA 1N0UA 3JSRA 1T3VA 3EVOA 2DGQA 4C1NK 2RIJA 2QA1A 3MECA 3NXZA 4DV4J 3DGPA 4B02A 4KHMA 1S4FA 2Z0GA 1S1WB 2PN6A 2P2CB 3TUIC 1NJWA 1NKCA 3L7UA 3W63A 2R42A 4OMFG 3SI8A 1VC5A 5KFQA 1T9VA 4NI2B 2OSRA 4FPRA 5U47A 3ZSQA 2VGMA 3BH7B 3BSOA 4RW4B 5IWAJ 2B4JA 3NKYA 1KAZA 5DETA 2A1BA 1NHVA 4DL6A 2OCEA 3CD6N 2QFIA 4ZVRB 4C3KA 5HRSA 1Q8KA 3BYPA 1HR0K 2JEJA 2XS7A 2IDLA 3CJ7A 4OYPA 1UVNA 1N54B 5KFGA 4FNHA 1KVBA 4J90A 2JLEA 4ZN3A 3FZBA 1PAUB 1J5EJ 1AZSA 2CWXA 3D2FB 2HF3A 3GTYX 2KN4A 4KKOA 3DLRA 1LW2B 1NMEB 3AD9C 2JDJA 1B7YB 4DDFA 3A8EA 1RWPB 2N3LA 2EC0A 3SQ1A 4LF9K 3VOVA 3POTA 3B8AX 3CPWM 3DRRB 4GKKF 4DUZJ 4M7XA 3KWMA 1VQNN 2GIFA 2B51A 2IRYA 4CBUA 4JI8F 4IO1A 1IR2A 2XSJA 1U48A 2YWWA 1V4TA 2ZH7A 1VQ7N 3VF2A 4V1Ak 1LV5A 1Q9YA 2RKIB 2OPPB 2HRUA 3OHRA 4QZVB 2ZUAA 1BA0A 1VAZA 2DNOA 3QYYA 2YJEA 4CJKA 5KT3A 1NGIA 3O9UA 2NREA 4CEBA 4ECXA 3ZXWA 4YDXA 4F0KA 5FPDA 3MMBA 3C7NA 4X4NA 1SS6A 2E9TA 3H5UA 1FKPA 5HMWA 5HK4A 1OQ3A 3G96A 4IDHA 4NA3A 2UVUA 1RISA 4K0KJ 4BRQA 3PM9A 1PBAA 4HCBA 1HI0P 3JTNA 4F4XA 1EO1A 1VSJA 1HNIA 2D0OA 3CMES 5AQSA 4UZCA 2WZ1A 4I9LA 2F9DA 3NEKA 5F0WA 1C1AA 3MAHA 4CJFA 4DX5A 4BBYA 3EUNA 4DL4A 2OTJS 4LSLB 4H4OA 1FX4A 4Y1CA 1GLBG 4KBIA 1CQMA 1RDDA 5HP1A 1RT1B 2CNNB 3RRHA 3CD0A 5L39A 3RAQA 4HLBA 1Y3JA 1VRTB 1YGYA 2GBZA 1BLUA 2DH8A 3ULHA 1EZZB 2NRXA 1NLVA 4A2BA 1RDRA 1IJFB 1WSVA 3OTDA 4O3OA 3R9LA 4KBOA 2HMIA 1OVYA 5EX0A 2L9NA 3BQ1A 4OLOA 3S01A 2MQQA 3VAFA 1X9JA 1ZAVA 1IKXB 4JHDA 4JI7K 1TL1A 2YNFB 3VAKA 2DT9A 4PRFA 2LP4A 4DR4K 4DV4F 1UAWA 1QJHA 3RGIA 5LXRA 4DOZA 4PHTX 4Q45A 1WC5A 4HACA 2IDOA 2HHHK 3J81U 1XUPO 3FLCO 2UXCK 3OR2A 1YTUA 1SL2A 3M8WA 1OY6A 1Z2LA 5KT2A 4AFFA 4AT1B 3I96A 4FJ8A 4DTSA 4DV1K 4I6YA 1OY9A 4FN5A 4FF4A 2FLPA 4GNIA 3N5FA 2ZH4A 2CPEA 3P1GA 4KH1B 3WZ0A 3CSKA 1K44A 4KB7A 1FRXA 4PZVA 1QZ5A 2A42A 2CVIA 4OJHA 1LCUA 4CFDA 3W3DA 2WC9A 3OVAA 1TUGB 4PG8A 2RUGA 3R5CA 4ZPBA 3RR8A 3V9WA 3W61A 2L41A 3GBTA 1S4EA 3D3CJ 4CIFA 2YKMB 3RMBA 4U7CA 1BIZA 2A6AA 2AMCB 3PXGa 4RR5A 3AA9A 3NGRA 1IBMJ 2WK4A 2X3DA 3L0QA 4DXLA 3K89A 2QA4G 3FZFA 5C42A 3SQGA 1VOMA 1NBWA 2CDQA 2V7YA 2Q1NA 5FLXY 4K50A 4ZLJA 4GV9A 1R8CA 4KGZB 2KT5A 3V4IB 5HO4A 1RBOB 2AIRB 4LH5A 1T94A 4CH7A 2YWGA 4B3SJ 1X8DA 3GIJA 4NE9C 2P51A 2MHNA 2VHGA 4J2EA 1Q82T 1TVRA 5CXTA 3LP0A 2BH1A 1MG7A 5AZIB 1BQMB 3BP8A 2VPXB 1XI1A 2B7CB 4PG5A 4I2QA 1X4AA 1JMTA 2HPUA 4K25A 3N5BA 2K3IA 1SC3B 1P27B 4LFBK 1O51A 3NG8A 3ZLJA 1G4CA 2ZGZA 1T6CA 3FEZA 2E5LJ 3Q0AA 1VQKS 3BBBA 3DLBA 3QAEA 2E20A 1HQEB 3AVMA 4QR1A 3UPFA 3PVXA 5L1LA 1ZM4A 3NHGA 3HL8A 1HBUA 1WEXA 2GZOA 3CCMN 4LF8J 1YLXA 5ETTA 2Z1GA 1JX4A 2VWKA 5FJ4A 3Q8YA 1J6ZA 3SSQA 3LM2A 4MK8A 2CPJA 3MEGB 3H25A 3TA0A 3FKBA 4KB1A 4JYAK 4B3TK 1IKVA 3QMLA 4KH5A 3T1HJ 2QXLA 5DM6L 1BC6A 3V6HA 1VQ8N 5KI6A 1CXUA 2BBEA 4OZ3A 3W65A 3CC7S 4DR7K 4Q43A 4BWJA 1WC0A 4ED8A 1N34F 3HHLA 2CA9A 4LFCF 8ATCB 3SI6A 5KT7A 3ELHA 2KZMA 3UN2A 2GMHA 3Q7CA 1UWBB 2YVSA 1LFWA 1Z05A 3AA8A 5HQLA 1S9GA 3KTQA 4QU6A 1S6PA 3PFOA 2HEKA 1ZBUA 3M8SA 1C1CA 2O8FA 3NBPA 1RWUA 4LRAA 3MXHP 6AT1B 2OHDA 3DYAB 4CGFA 4CJUA 5C0YA 5GMDA 2J0QD 4AHRA 5C2FA 1H2TZ 1X4CA 2DITA 3JYTB 4J9RA 3HKZD 4QQBA 1S7HA 3EO3A 3AGKA 5TKYA 3LO3A 3T6JA 3LDQA 3ISZA 4FM1A 4GVBB 1Q53A 2V52B 4DFMA 4WFNL 4BRAA 2KT2A 4L6V3 4IKAA 4UT4A 3GYGA 4F50A 3SYZA 1T11A 3O3GA 1ELOA 2I0XA 1E6YB 1M0SA 2W41A 4H5TA 3QRPA 3WBZA 4BRFA 3U02A 5HMYA 1BUXA 4NA1A 2MQ8A 3D1QA 3GG0A 3RW7A 1WSIA 4J9MA 1K9MO 4BQLA 4M3WA 3GFXA 2DTJA 1UJ5A 4LBPA 1YUWA 3PW7A 4EI2A 1WC1A 3CCLS 4ZOSA 3EKSA 3H3NO 4P2MA 2PA3A 3S9HA 1RZMA 4I6AA 4FPBA 4CRJA 2UXBF 4DFJA 4IWVA 2RN2A 4U67Q 2DIUA 4IRCA 1YT3A 1HBOB 2GIQA 4X66J 1D9FA 1FI4A 1S9EB 4IQMA 3R8EA 3HMJG 2CZ9A 1VQOS 4DF8A 3R27A 4NZ6A 3R8YA 4ZK7M 2HIQA 4QR2A 2BUPA 2ZJRQ 4WTOB 2BYCA 4WJBA 3SQ2A 1PIEA 1RDAA 2CQCA 3ILOA 3AVNA 4CHNA 2QA4N 3CD7A 3MM8A 1FFSB 1RE1B 4A57A 3TUJC 4Z37A 2ADCA 3UQSA 3A3NB 5KFMA 3DWLA 4PWDA 1WB9A 2KVQE 3CETA 5G0RB 1HNZF 4RNHA 3SMZA 4BC5A 1DQ9A 1WAJA 1O6XA 2UUTA 1K8AO 1TR0A 4B9VA 2MKYA 3OTOF 1JL1A 4P9SA 3L7OA 3GL1A 4B1WB 2HW3A 1S1XA 2MKHA 1DKGD 4F9OA 1IBLF 3SZ2A 3I31A 3G9CA 2E5LF 3PYFA 1HL6A 1Q78A 1TKZA 4KPCA 3CCUN 1Y5IB 3FCHA 1PJ7A 3N28A 3I56N 4BE2A 4M3TA 3RB4A 1KEKA 4NLQA 1WNSA 4ECVA 5CYMB 5AQTA 3PIPQ 3OYHA 4IFVB 5BYRA 5FLXU 4JLHA 4KRFA 2EVZA 1R0BG 4NLWA 2H48B 2WFBA 5D78A 3B8HA 4L75A 2ZNYA 4AD6A 4EBEA 4LJMA 3MR3A 2HURA 2AA4A 2DB1A 1U0HB 4P10A 4ES2A 1KAYA 4JKCA 2YX4A 3W66A 1FJGK 4DV3F 3G6ES 3Q8RB 4OYBA 4J9LA 2HVHA 5KPRA 2B43A 1RHQB 1YITS 3OS2A 2HS3A 4JI4F 1C2PA 3KJNB 3PEJA 4ZP9A 1X4FA 1ZTTA 2NRZA 1VRQC 2VDHA 2CQ3A 3VESA 3UKUA 4WFYA 3FBFA 3VHQA 1W25A 3JB9k 5CA5A 3J7A1 3MCPA 4JKEA 1ZOTA 5T41A 1YHQS 2N7YA 4FO0A 2EKYA 4DL3A 4JV2A 4M7YA 2WVCA 4DUTA 5JVHQ 1U49A 5HROA 1LK5A 4FWOA 4CZFA 2U2FA 1RBUA 1X4EA 3P45B 2VKZG 4MIAA 4QS7A 2HQGA 3OVNA 3M6GA 4KAZA 1QS4A 5EN1A 1SKUB 2ZKTA 3J7ZO 1IV0A 2UXDF 2A6MA 4DTRA 1UEKA 4RBUA 3K2YA 4I64A 3DAWA 1RDCA 5C7PA 3SBGA 3NCQA 4RL1A 2OI2A 4KKOB 2OZSA 3AJDA 3CCSN 2YQ1A 3M05A 4KTQA 1QTNB 3H2LA 2DR6A 4DR5J 1UZDA 5AQFA 1X1PA 1K6YA 3MXIA 1BU6O 2VUGA 2VIHA 4DV7J 1CC7A 4L73A 1F6TA 2CWKA 4JP8A 3C19A 2W2PP 3AHPA 3CT9A 3QMQA 3HDSA 4CGHA 2R8GA 1P9QC 4BREA 4ERDA 2HNDA 5KAKA 4H03B 2XY7A 4WKYA 4LF5K 1VK0A 5KFJA 1XC3A 4ZPDA 1HYSA 4PYDA 4X4PA 2HRTA 1WOPA 1VSFA 4PY5A 5I4MA 1V5VA 3KLHA 4B3OA 3QFPA 4WZMA 3DLKB 4Q2MA 3EE8A 1C0UA 4DL7A 5AQLA 4OPKA 4UY8O 3N79A 2QEXN 3AFGA 3C6HA 5AE2A 3TVYA 1WSFA 2LSNA 1S1VB 3OW2M 5K5MA 2ZWHA 1RBTA 2QL5B 4BE1A 3W2WB 1MA9B 2FHKA 4PCQA 3EPGA 2KM8C 2CFXA 1U0SA 3THYB 1HI8A 1CSJA 4LT6A 3R1LA 2MKJA 4DV6K 3HRGA 5K8MA 3SPYA 2NUBA 2QLXA 4H4OB 4U6PA 3MAAA 4KR0B 3W60A 4GKKK 4ED5A 2XMMA 1ITGA 4ZVPB 5KFPA 4M94A 7FDRA 4Q2LA 1GXUA 1YXQA 1Z1ZA 3S3NA 3KIOA 4JI8K 1KWMA 2ETJA 1X9SA 1KVKA 3ITHA 5F9NA 5CYQA 3D6HB 3TWZA 4GW6A 1WTBA 5DG8A 4QOZB 4CBWA 1GMUA 3CQYA 3CJ4A 1KSPA 3O1BA 3DU6A 1WC4A 4CZGA 3ADAC 2P8IA 1TL1B 1S22A 3N4QA 2NYIA 1JJ2R 3LZJA 4CT9A 4CO1A 2HNYA 2YHWA 3M6VA 3EN9A 4OX9J 3O9TA 4R79A 1NKEA 4LMZA 2E2NA 1IBKK 2FVQA 2V2KA 4BRLA 4EAHD 3TO8A 2B0GA 5KFOA 3QGIA 3OR2B 2W9AA 4CJ4A 4O0NA 5ETSA 3CJKA 2JVOA 4FF3A 2QKKA 2BM1A 3MXMA 2R7XA 3Q8PB 3VQ8A 1KVCA 4AILC 3KK2B 1U2RA 3SIPB 3E51A 3M1VB 2JH3A 4NASA 5AXMA 4FJMA 4Q0BA 2AT1B 2A40A 2BJ1A 1EKSA 1WEYA 4K42A 2PD1A 3DXMA 2JSXA 4YOXA 4WE1B 4TSXA 1W7WA 1DQ8A 1FXXA 3LANA 1KONA 1FDBA 3J80O 4F04B 2VQFK 4E7LA 2A0FB 3VEOA 5AFUA 2CG8A 2HFOA 3BGLA 2CQ1A 4TYBA 1Q4RA 3MR7A 3R7NB 1BL3A 1D8YA 3O08A 4JKHA 4EP4A 4LC9B 3R7BB 5A8KB 3F73A 1HX1A 3VGSA 3CUNA 2JL9A 3HBTA 2ABYA 3R7SB 4DV7F 4XH1A 3R6GB 3SQGB 3KK3A 4B3MF 4BLGA 2G2ZA 4DV4K 1IQZA 4HHJA 1FTCA 4X62J 3DKDA 1OH5A 4CCHA 2Q0UA 3OL6A 2VFTA 2FHJA 1NMNA 4JI1F 4ZPTR 1SKRA 5HATA 2XCAA 4YN3B 1NGFA 1N5QA 3OFFA 5KGWA 3H98A 4NLGA 3LP0B 4Z4IA 5D0HA 2ALYB 1K0VA 2QN6B 2MZJA 1W7AA 2E1YA 4I2QB 3L2VA 3RMDA 2V4JB 2K7KA 3S1TA 2QO3A 3VQCA 1D5AA 2IAJA 4KY3A 4CD1A 4MKVA 4FP9A 1HYVA 4URSA 2M9KA 2GQ2A 2ZZTA 5IV3A 4BRMA 3Q89A 3CCVN 4EZ9A 4KH4A 3J7YU 2HG4A 2IPOB 4X4UA 1B3TA 3VQQA 1ULRA 2CH5A 2PI5A 3NVKA 1H6KX 2F7TA 4BC4A 1MNEA 3G6VA 4ZP7A 2YKPA 3QIOA 4QS9A 2DNKA 3AODA 4DU8A 1HBUB 2XQCA 4DUZK 3NMRA 1MMDA 2KLAA 3HZGA 2E2PA 2FBTA 4FWPA 3QATA 2F8TA 2ZOFA 4CJSA 3MURP 4BDZA 3SSSA 1WACA 2GS8A 3LDSA 3DLEA 2DGXA 3NGTA 2VPZB 3F2KA 1HPMA 4ZIWA 2MQOA 2J7WA 1NK9A 2BZ2A 2X51A 2GTDA 1HW8A 3PCOB 2CKWA 1U45A 1RWVB 4LF1A 2CQGA 1R6YA 1RT4B 4NPOA 1TUYA 4DL0C 5GAEU 2PBDA 1S1UA 4Y28C 2HS0A 5KG1A 2W40A 1U09A 4BG8A 2CQIA 5AQQA 1VQPS 1XMQJ 3BZCA 4K0KK 1IWGA 5FDLA 4LVOP 1I3OB 5AZJA 2C42A 5EGYA 2CNOB 1S9GB 1MU2B 4FW2A 1ZA1B 4IEEA 3FBCA 3AJ1A 2JHEA 3I55N 1DURA 1C0TB 1FKOB 1QVGR 4JEPA 3L95X 2XLIA 1UW9A 5F8LA 3BN7A 1C4AA 2RRNA 4ZP8A 3UW1A 2QLBB 4CEQA 3MM9A 4ENOA 2YJFA 3D66A 2CH6A 2B9YA 4LRFA 2J7KA 1ASWA 2C2NA 5D77A 4CLTA 2GJIA 2C28A 3TAEA 1NOYA 2W4CA 1HKAA 4FXWA 4O4GA 3LGNA 4DSEA 3IRXA 3OXLA 3H1QA 2ZBIA 4XDDA 3K7RA 4L3NA 2HWHA 5J2MA 4JI5F 1X0PA 1X3MA 1B0PA 4KGKA 3M32A 5T14A 4Z0UA 5ETPA 2FC8A 1CZ9A 2Z1JA 3K58A 4X4OA 4IJAA 4DR6J 4CJRA 1WWHA 5ETMA 1LFPA 4LFCK 5ADXA 4X62F 5A8RA 2FJWA 2M5YA 2DR7A 4U96A 1HNWJ 4LFAJ 2D1CA 3IAYA 3VVTA 4PG4A 3PHTA 1S6QB 2QMXA 1KD1O 2ITMA 3KHGA 2WVDA 3BBFA 4CGJA 4TVAB 4JI2J 1I5OB 3ENVA 3CERA 5EWFA 1X60A 4YB6A 3TAMA 4TNOA 4DI6A 1BOTO 4A61A 4PWDB 2IM2A 5H9EJ 3D2EB 4FWQA 4OPHA 2AW0A 2DJWA 2DK2A 1U1OA 3ZEUA 2PY5A 2MSSA 3KLGA 5IQ6A 2CRLA 1YX2A 3ATUA 3O8WA 1S1XB 1ATSA 1RBVA 4DR2F 3OJSA 5E0OA 1TL7A 1FNOA 2JLGA 4ED6A 1JLFB 1VRUB 2M7SA 3Q2SC 3SAFA 1CLFA 4DR1J 2R8IA 2LQJA 4CJ5A 4UOFA 2KYXA 3DGVA 1F5AA 3GG1A 3OFHA 3H2UB 3K8WA 1IBMK 3R5AA 1IUJA 4HR2A 3ZETA 4EGLA 3N6LA 5K8NA 1PSDA 2V5HG 4KV8B 2UXBK 2IOCA 2K8GA 4TKTA 3S8SA 1VQ5S 2UYTA 2XTJP 2H3GX 1RHJB 2CQPA 4AUKA 1CJVA 3TU5A 4ED0A 1OO0B 4B3SK 1VIXA 4OV1A 1Q7LB 4XAKA 2RS2A 1GMVA 3U9ZA 4IFYB 2K2PA 2BXJA 1FF2A 2HLTA 2K3KA 2B9WA 4WTYA 4QPXA 2XGPA 4BVOA 2XI2A 5KG4A 5G4DA 5I3UB 1NO8A 4UUXA 2XY8A 3UKUB 1HNZK 4A8WA 4B8CA 2R7YA 4Q5VA 2XWYA 4CLSA 2VV5A 1RJJA 4JKGA 2D3UA 4FDFA 3DJCA 1DY3A 1TYQA 3OTOK 4OFZA 4ANEA 4F02A 2YHXA 4FWRA 4Q44A 1IBLK 1V5IB 2E5LK 3ZZOA 4IEIA 1QHAA 4ETZA 3PLAA 3M8ZA 4AL6A 2R8JA 4GVLA 3ILIA 2CJBA 2DNHA 2JNJA 3A2FA 3R97A 4X2BA 2POKA 3SQ4A 2E44A 3ICLA 3BGRA 2DY4A 2DH9A 3CF5Q 1YF5L 1VQMN 2HZCA 3UR0A 5KG7A 3C2PA 4BRNA 1S1TB 3G8SA 2UZAA 2AWZA 3H90A 4KTWA 2VOPA 4FLZA 1WDTA 3PJ9A 2FVCA 5JMVA 3H5YA 3MPDA 1ZBHA 1XNRF 1TUUA 3HSZA 2P5OA 1KR4A 2B3TB 1DTQB 3CULA 4DV3K 3W9JA 3ASMA 1B64A 3WQTA 5E33A 3T1HK 3FRYA 2I5JA 1JXLA 4AXJA 3E01A 2GUIA 2P9PB 3NOGA 4JI4K 2O5DA 3SAGA 3ZZYA 1RTIB 3N4PA 2AZ1A 3T5HA 3EGVA 4KRWA 1QDUB 3O8MA 2YQ3A 2HNDB 3GSIA 3H5SA 2C1EB 4TU8A 2B6AA 1RBAA 3TZXA 4DSLA 2NUUG 4OJGA 4M5DB 1NRKA 1WI8A 4YY3F 2QWOA 1HYSB 1O0PA 3SCLE 1E6VA 4EFAC 4JV5F 3NAHA 4PL7A 3WXLA 3CCRN 4OZNA 3KLHB 3V81B 4OX6A 4J9UE 1UVLA 4JI2F 2FJAB 4KHNA 2ROEA 3BSNA 4BRPA 1T7PA 4RW8A 3KZBA 4ZLNA 4EHTA 3HPOA 2NR0A 5KFSA 4OHYA 3TZYA 4FWMA 2O8CA 2O8EA 1WHYA 2FIUA 3DMJB 1DT9A 2AP1A 3FRZA 3GR0A 3IWLA 4DUYJ 1HIYA 1ZM2A 3MFIA 2MQLA 3FUYA 3K5MA 5FPEA 3ZT1A 3QJJA 4WYLA 2AYMA 1L3SA 1ATNA 4E7JA 1HNXJ 1TKTB 4Q7AA 1ASVA 2FJVA 2OH2A 4AF1A 4PQUA 1PO6A 3L6QA 3JTOA 4DTNA 1HHQA 3CCJS 1RNHA 3NFAA 1ZBLA 3VGMA 2P9KA 2YKOA 3MAAB 5F9LA 5JXSA 1TK5A 3MUVP 5J2NA 3IC1A 4OHZA 3G8TA 4YR3A 2Z1IA 3DM2B 3BR8A 4DX8H 4AHSA 3IGVA 1RCOB 3Q8SB 2YWHA 1M90O 4O8KA 2J6TA 1V9OA 5HLFA 3BQ0A 1RADB 1O5JA 2ITGA 3P3DA 3WNFA 3CIPA 4E1NA 1NGBA 4FZXC 2AV5A 4LR8A 1OH8A 4CHPA 3FQLA 4DV0J 2MY8A 4RW9A 1TK8A 1QVFM 3SV3A 4F67A 3VCDA 1RTDA 2V50A 4A8YA 1EKRA 2EI5A 3EX7B 4RPFA 2GELA 4Y65A 1E4GT 5ETLA 5EY4A 4YR2A 3DOKA 3OSPA 1SV5B 3MMCB 2PFUA 1U6ZA 2DHXA 2D4WA 1H1VA 1WSRA 5DZ6A 2XSFA 3R5GA 3W64A 5IV4A 2O8DA 4IOAL 2AYGA 3SNNA 2AJ2A 1F21A 3IN5A 3CJKB 2H4WB 3M30A 2LDIA 4LF4J 3L4QA 3SUQA 5J2PA 2RILA 2BMBA 3PIOL 3BQ2A 5H9FK 3TP2A 3ENBA 3UNGC 4CF9A 4CK3A 1OQ6A 3IWNC 5J2QA 3KFWX 5LT5A 3D9BA 4KHRA 4URGA 2HFSA 1UP1A 5HOOA 1Z6RA 1RTHA 4DSFA 3G87A 5HBMA 4O4RA 4YP3A 3JSMB 3BB5A 2VYPA 1WDDA 1JXEA 1NJYA 3BF4A 1S72N 5E7OB 1AFJA 1KLMA 2G1DA 2ZH9A 1U8WA 1BY9A 2VICA 2ZHOA 1HW9A 2PMHA 4FWNA 3OSNA 2OEKA 3GILA 3QEIA 1REVA 3IBCB 4N8NA 4USUA 5DLFA 3J81O 1WEZA 1QSLA 4AXIA 4NLOA 1H2VZ 2UUBF 2P5GA 1NDKA 5D4NA 1QZ6A 2E8AA 3I5BA 4EO6A 4YHHJ 5KPZA 1NK0A 4A8FA 1PJ5A 1HPZA 1RP5A 3D6MB 5HQMA 2J0WA 1PAEX 4Y2KA 5B0BA 4NYZA 1KNZA 3BEXA 2W42A 2AHOB 2LQ8A 3ZZ0A 2CZVC 4URQU 1N5TA 3BR9A 3MMVA 2QM1A 4BR4A 2ZVSA 1VHXA 1WSGA 3E3XA 3QGHA 3QNWB 4UTGA 1VLYA 4FJNA 2HB5A 1TU0B 4DU7A 3IXQA 2A3JA 4DTXA 3AY9A 5AXNA 3IRWP 4ZLPA 4XH4A 1FT8A 2E5IA 3CJ8A 2MLZA 4LREA 1U25A 1KP6A 1JLQA 3VGTA 3A13A 3HI9A 2C2ZB 2GO8A 2J9DE 2YH1A 2FLOA 1T05A 2B9EA 2ATLA 3UKRA 2AJ4A 4H4MA 3BBCA 3ENHA 1U4BA 5D8HB 4F3QA 2X1BA 3W5ZA 3RMCA 3M5RA 4DV7K 2EX3A 3D6RA 4OYWA 3T5JA 4B3MK 1FJCA 2PC6A 1ZBIA 3FFIA 1U2FA 3AXMA 3N0VA 1NLKL 4DL5A 4DTPA 3WC0A 3CG7A 3GYXB 1T44A 3Q83A 2KXFA 2PEHA 4BROA 4K8ZA 4JI1K 3DLEB 3VVUA 3BDPA 4FVUA 2XHCA 3M2UB 2KHCA 1U1PA 1HKGA 3C6TB 1GTEA 1HQUB 2LYVA 1SXLA 2VD3A 2ATCB 1LXJA 3NGKA 2VFUA 2FSKA 4NYPA 4DV2F 2QTDA 4UW2A 1J2VA 1U04A 1SQKA 2RHKA 3I82A 3WNEA 2V34A 2ZD1A 3V6DB 4YEAA 1J9AA 1BQNA 3TOQA 2B5JB 4R5PB 3C14A 4CLKA 2BV3A 2C22A 3OJUA 5JLFA 2ZBQA 3G0ZA 5FDLB 1DBDA 3R1HA 4R8UA 4CLZA 4C98A 4YFUA 1QE1A 2BACA 1TGOA 1PC4A 4ZMMA 4LF4F 3W1YC 1Q95G 5MLCQ 3I0SA 3CGIA 5BPLA 1Q9XA 2WVBA 2V8PA 3VEVA 3VAJA 3CCEN 3JSBA 4H0PA 5AFUH 4BY9C 4KGMA 3OLAA 3KNAA 1KFDA 4GKJF 4CO5A 1RT3A 4X4QA 2FZCB 2GX9A 3QT7A 3GJQB 3HM8A 5SWMA 1IJEB 8RUCA 2BGGA 1F2HA 1F2GA 2QYCA 3MM6B 1V3SA 3KLEA 3KJVA 3MMAB 4BRGA 1YJ9N 3HHKA 3FZHA 1SJQA 2OIHA 1TL3A 4MIBA 1WUAA 4FJ5A 3T9NA 4NLBA 3ETMA 4FJLA 4QR0A 3QFHA 2GJ2A 3AVFA 3JTPA 3ID6A 4DMNA 5B0DA 4MDBA 2HRYA 4HTIA 5GAHP 3NVMA 3RSEA 3M1FA 4C23A 1HNVA 1LWXA 1KXPA 3O44A 3UVJB 2YNIA 4R0JA 1VSLA 2JWNA 3OYFA 1NJXA 4USWA 4DR4J 5FRNA 3KKRA 3KJQB 2HBRB 3THWA 5EWGA 2CZ4A 3TAMB 4AM6A 4ZTFA 2HHHJ 3BV8A 3A4TA 1OVQA 5HRRA 3VEXA 4FXDA 2JVRA 4M42A 2YWKA 1HFEL 1KHVA 3EL2A 3G4SN 2Y8WA 2OEJA 3N9UC 2V0NA 2PYJA 2ZKUA 4FJKA 4C4WA 2VFVA 3CC4S 4ZVQB 2VDIA 4NYFA 4RWXA 3VQDA 3QRRA 2LKZA 3D28A 4JI5K 4OI6A 4TY8A 1WORA 4HUGA 2GAHC 1K9MT 5LL6Z 3WIUA 4LF7J 1ACMB 2W9CA 1ICEB 3LA0A 2ASDA 4JKAA 4X62K 5CCMA 4M41A 2RRAA 4BGAA 1QSYA 3OBIA 2KI2A 2EEYA 4DG1A 2F9TA 3MAQA 3MK6A 3W5XA 4WFNQ 1Y97A 3UN3A 1F9HA 4CLWA 3T1AA 5C10A 4MIWA 4XK8C 3ZFVA 1S1WA 2DFEA 1N33F 3D5MA 3MX2A 3KOAA 4KFBB 4YB7A 4A8SA 3QGPA 3KUHA 4DFKA 4NI2A 4JKGB 2H51B 3CW2C 2IMWP 2QSFA 1TYQB 2G13A 3THPA 2WBRA 4FSVA 1TV6A 4RW4A 5EVZA 5F8HA 2V2ZA 3WEEB 3SCJE 4DR2K 4KIAA 5D0GA 3KHHA 5FLXO 1XMOJ 4YQWA 2VL1A 1T3NA 1N5YB 2EKNA 2H5JB 2QWLA 3D54A 4ECTA 4K4ZA 3BO3A 1YJNN 2QJ3A 1RA6A 1RAJA 4IUFA 2XI3A 3RG6A 1S49A 3V9SA 3C6UB 2MQPA 3A12A 2HMPA 2CPYA 1L3UA 3R3TA 1NKBA 1N36J 1YRUA 3C94A 1FK9B 1LW2A 3R6MA 4B9TA 3TEGA 3OYCA 5EXWA 1OKJA 2D69A 2KKHA 3TAPA 3AVIA 3EXCX 1G99A 1OS5A 1NGHA 3NS7B 1NSAA 1FRLA 5ADXH 4O8UA 1XHXA 2I5JB 2Z2ZA 3AB2B 3UE2A 3VTIA 1U2VB 4CFBA 3UE5A 4WF9L 3QBXA 3IGNA 1C4CA 1R0AB 5JUMA 1ZPVA 3AVLA 3SBMA 4K7QA 5LSRA 2QL9B 1AYEA 2FF6A 2A5XA 3MTJA 2RKIA 2OPPA 3LUYA 4BE0A 2YNHA 2ZZNA 3ONQA 2XBPA 4BR2A 4LR7A 1UTAA 2CDRB 4DR7J 3AH6A 1E6VB 1GNKA 1MMNA 2VCPA 4G65A 1W9HA 4ILJA 5GINA 1LOUA 3D0GE 3P4UB 4Z4FA 1J53A 3HSTB 3ALYA 2XHBA 3EKUA 2B4OA 4NXNF 1Y00A 4H4KA 4RW8B 1SAZA 3RVCA 5KOXA 1VCTA 3MR5A 1YRTA 4LR9A 4JNEA 3KHLA 4FXVA 1PYOB 5DDRC 1S57A 1NNEA 1OJ4A 1RBRA 4NO7A 1KTQA 4ZA1A 4FJHA 4HDHA 1RWNB 5AQVA 1GLJO 4CFAA 3S41A 3J7ZT 1XNRK 2IVOA 1UMJA 4FLVA 1HWKA 3JXOA 2J9CA 4FW1A 4LSLA 2AX0A 2XEXA 4CESA 2MQMA 5GADP 1E4FT 5AQUA 3HJVA 4BC2A 3MCOA 4NLRA 1RT1A 3HSGA 3I5AA 1U02A 1RXOB 3K9JA 2Z2LA 2DGVA 3OHAA 3QEPA 1YJTA 2DISA 4Z4HA 1SL0A 2JC0A 5JVGL 2DGWA 3TNVA 1GX5A 2BANB 1RK8A 2VZ9A 4DR6K 3AT1B 3PW2A 2DXEA 2G4BA 1Q1KA 5KT6A 1Y4ZB 2A2DA 3IWXA 4P2SA 4CH1A 1HNWK 4C9DA 1X9MA 1IKXA 1ROFA 2RU3A 2FF3B 2DFFA 1HA1A 3DXKA 1FERA 1LEOA 4M5NA 3HP9A 4FYWB 3AO4A 4JI2K 2Q3SA 2HNZB 2E1AA 4RW9B 3TA1A 2MJNA 1ZBSA 1F5CA 3EZUA 4CEAA 2OGUA 4WCEL 1D0EA 3U27A 2Z58B 4E3SA 3PW0A 4GO5X 3G71S 1G6BA 2RQCA 4NCBA 3DOKB 4FOEA 4UY8T 5AJ3F 1RT5A 3EY1A 2IY5B 3CHWA 2LA4A 5AQJA 1YJVA 2CQDA 2O8DB 5KGXA 4PG7A 3GIRA 1GK8A 1PC5A 2RSQA 2NXJA 1Q7YT 3NF9A 3M30B 1XMOF 3MX5A 1PILA 3VF6A 4USTA 2GGPB 4CIOA 4HI1A 4DBQA 2GHPA 2KB2A 1U26A 2OPRB 4FM0A 4NCGB 3G8QA 3I9V9 1I1GA 3IA0A 3VEYA 4M5MA 3QGGA 5J2QB 3RB3A 2G2YA 1M5PC 2YHAA 2KU7A 1RTHB 1RDUA 3ZX3A 1RTJA 4OZ0A 2MKIA 3PFEA 2V9KA 3A1YG 1KLMB 1RYRA 4CZJA 3L3UA 3TPQA 3Q8VA 2G8WA 3CNQP 2KG1A 5DS7A 4QW9A 3CMEN 1HARA 3GIKA 2UUCJ 2HBKA 5D15A 4IZ9A 4NLYA 2IC3B 1U7LA 3NNCA 4HYKA 3AARA 4GV6A 3GJSB 4RNFA 3B6PA 3P38A 1WOQA 2IS3A 3V4IA 2OTJN 2GNKA 4X4RA 1NJIO 2MDAA 1C0GA 2ZJPL 2VJVA 3KMQA 2HWTA 4PPZA 4J9SA 2PMWA 3MN7A 1DRZA 1JKHB 3FSIA 3HHEA 3SDEB 4ZITA 3AVBA 4O44A 4K4UA 5AZIA 3EMTA 5M1OA 2F8HA 3HKWA 2RE1A 3TANA 2LXFA 2QXFA 5KFBA 2OP5A 3VZHA 1NGDA 2KKZA 3IS9A 4M5JA 4LRBA 3EZ5A 4DF4A 3SCKE 2NSCA 2HBYB 3M8YA 3EDRB 3LDNA 2BRKA 3AD8C 1RLDA 2KT3A 3DDNA 5AQXA 3ZSOA 3UDLA 3VQTA 3CJ9A 1T05B 4CDIA 1IR0A 3TQ1A 1AW0A 5EUHA 4TLRA 2DNZA 1HQ2A 2HZAA 3CJ2A 4YDUC 2ZDPA 1G3OA 1HBMB 3DC2A 4N76A 4NLCA 5D6GA 2AZ3A 3CCQS 3VN5A 2Y8YA 2YX7A 2MLYA 4C11A 2DNGA 3LGHA 5BRHA 3FFIB 3MEGA 1GLFO 3B6BA 3OXGA 3M8QB 4Z4EA 2ZH3A 4L8RB 4NZ0A 1YJUA 3P5BP 2V69A 3HHNB 5DO2A 2RQMA 4ECRA 4CF2A 2W1BA 3UD4P 1FEHA 1X4BA 1JLAB 4ZVSB 3W8GA 2W8LA 1ASUA 3PUFA 5BPMA 1YBAA 5B0GA 2UV8A 4MKBA 5F8NA 4JKFA 2BOAA 2IBOA 3G25A 3E2EA 1N32F 1UWBA 1ZETA 1UW4A 3FDSA 2A2CA 1BQNB 4OLPA 2PO4A 1R7IA 3SBTA 3PKMA 3VQAA 4DUYK 4FKXA 2L48A 3A8KA 3DYAA 1SCJB 1WUUA 3H20A 2EBGA 3D0IE 1DLOB 4BRCA 3LL3A 1FVQA 4JI0J 1HNXK 4JK7A 3OYAA 2ZE2A 3JYTA 3JQKA 4FLWA 4TXSA 5HANA 2HFNA 2Y1JA 1VQ4S 3I0SB 3MF5A 2YNGA 1RACB 4GVBA 4NXMF 1TKXB 1HMVB 3RAXA 1R31A 2AKWB 2R4FA 4BS2A 3EM1A 4L3KA 4JB8B 2ZM6F 4RW7B 1UAXA 2Z2YB 3MM7B 4O3RA 3BGOP 3MWPA 2KTQA 2EFVA 5BN8A 2ACMA 1YIJS 2QV6A 3JQMA 2MZ1A 5LMNF 4OI0A 4I4BA 2X78A 5GMEA 1EIYB 4LSNB 3PYDA 3KJVB 2F4VF 1E3MA 5LJ5Y 1VQKN 2BDPA 1T6DA 3OYGA 4JI8J 4KJIA 4KHPF 4DV2K 2RRBA 1WBDA 4ZVTB 3QO9B 1F1BB 4OYZA 1ZAXA 1S9EA 1HHSA 3V4MA 5F8IA 3SMSA 2KFZA 3QBCA 3AOAA 2ZQBA 3DCAA 4MJKA 1XQIA 1REGX 3GSDA 4DHYA 4P7VA 1Y5NB 3MOJB 4FWSA 1WI6A 4NA2A 3G2XA 2B4UA 1HNVB 1MWMA 2KL8A 2DCLA 1OY8A 1AUSL 2K7JA 2XY5A 2NRRA 2KRBA 5G0RA 4IRKA 3ZTSA 4LF4K 2V94A 5EX5A 2BQRA 4DN9A 1T3OA 5EU7A 4B1XB 3ZZTA 1KDNA 2ZJQQ 2GIRA 4P2FA 2KZZA 4DR3F 3RW6A 2C3UA 4DLEA 3CC7N 4EHUA 1RAGB 3AA5X 4GKJK 1TMJA 3P5TL 4CWBA 4YMEA 3UN5A 2DKOB 5DRKA 4F2SA 2P9NB 2XYPB 3DN9A 3DHWC 3CJ3A 1Z26A 4U7UD 2HVIA 3EE9A 5FPMA 2E1PA 3DOLB 1G15A 1F9FA 4IFVA 2VPWB 2QK9A 4ZKAA 2NZTA 5CZ2A 3QLHB 1VLOA 1YG0A 1NOZA 2H3EB 3FSYA 3WDOA 4BR0A 4WFBL 4TY8B 4CNZA 5HN0A 3FEXB 3IM8A 1QQNA 7AT1B 3I32A 3WNHA 3SK3A 1BISA 2D41A 4WP3A 4WFAL 4B3RF 3HYFA 4HTLA 5IC6B 3UD5A 4BRIA 1QM9A 4N41A 2CUYA 4USJC 4NRTA 5C2DA 5KQ8A 4DG1B 2OEMA 4ILHA 3LM9A 1NHKL 4RLEA 3KLFA 2BRLA 2YPZA 2DEIA 1NSPA 4MKAA 4NRUA 3FGVA 1CXQA 1KD1T 4DCHA 2VODA 2AJFE 3K0JA 2FHMA 5HRPA 3EWGA 2Y1RI 1NZAA 3V6KA 2Q2RA 3I8BA 4FWKA 3D68A 4GC6A 1T8EA 2ATQA 3CCLN 4E89A 1TV6B 2NPFA 2FLLA 3NGIA 4C0OC 1AB8A 4RZRA 4C6AA 2AGPA 4KB0A 1A7GE 4CJTA 2F65A 5AQOA 4JI0F 2NPIA 1VQON 2G0CA 4QS8A 4UOHA 3SSRA 3OA9A 5BR8F 3MEEB 2CNKB 1XMBA 5A8WB 3PY8A 2X74A 4W90B 4IG3B 3O5BA 2VPYB 3JAMY 1M5OC 4DMZA 1XERA 1FXDA 2UU9F 3U9DA 2ROGA 5KFTA 3ENAA 4P7TA 2W2MP 2YHYA 2FSNA 3I4HX 3L2QA 1N8RT 2O8BB 1FD2A 4CERA 3FZLA 2NQPA 1GMWA 4FJ7A 4ED7A 2Q43A 3X1LB 3KK1B 3IUCA 2KDOA 5HVHA 2OD4A 3EYZA 4FWLA 2HSTA 1F0XA 3MUTP 1HWLA 1ZYQA 1N33K 4OQJA 2Z2MA 1FXRA 3F44A 4ZJQA 4WPAA 3AVHA 2YI1A 2XZTB 2YNHB 1UJ6A 3KDOA 3NGSA 4PABA 2R7VA 2I6WA 5KFCA 3WXMB 4KO0B 4LUBA 2P9EA 3DLKA 1CBKA 2QX0A 2ILZA 3U1MA 5DG7A 5IM0B 1B4SA 5EX3A 5CZVA 2HK2A 1R8BA 5BR9A 4CI0B 2HHUA 1S1VA 3G6EN 6FD1A 1K8KA 1YITN 3W2WA 2HQCA 2PFDA 4NEYA 2UVWA 3QT8A 4CD3A 1W26A 3QAUA 1PYTA 3THYA 4CHYA 4N5SA 2CJKA 2VH7A 2LFVA 3SUPA 5AQWA 3OW2R 5HL7L 4ZVEA 3LTOA 3H4DA 2EXUA 3Q7BA 2H5IB 3OTBA 4B08A 4OJ1A 3TX8A 1NU4A 1IBCB 1U8SA 2VBXA 4OHVA 3HK2A 5E84A 1YHQN 3DLGB 2N82B 4X65F 2CJQA 4CBXA 2HHPA 3IFEA 1RI7A 1RLCL 2RDDA 2LXUA 2FVSA 2E5HA 3D1OA 3P4IA 3CC2S 2HHWA 2DIVA 5IZHA 4OI4A 3MHYA 5GAHI 5BJRA 2KVIA 3JXUA 3LDLA 4A62A 5BYQA 4DQRA 4ER8A 2DPJA 3D0HE 2AD9A 2G8HA 3DXKB 3MEDB 1XJWB 5A2QY 3GDQA 1N34J 1VQSA 1VSEA 2Y0BB 1Z25A 2RHQB 4B9SA 3T6BA 4LFCJ 4J9NA 4NXNK 4L74A 4RBTA 5LM7E 1KC8T 2HBZB 4Y1DA 1JLEB 3NAEA 2D1KA 5C12A 2MGZB 2HFZA 3Q22A 2V68A 1RT5B 3O9SA 1EHWA 1SJ4P 1KVJA 2QI2A 4B9MA 1YBTA 3VEWA 2GMLA 1KTVA 1MLAA 3ZT0A 2AQ4A 3GE9A 2XZDB 1GTHA 4PL8A 1T0TV 4GO7X 2IA0A 2A18A 1MWQA 3KK2A 2HLUA 5RUBA 3CQXA 4ATNA 4BVPA 2W01A 3KNGA 2BM0A 5C25B 3ZCMA 3M1VA 3L2WA 4BDPA 1K73O 4V19X 4OGEA 5DQGA 2HQIA 4FF1A 3GV7B 5HVGA 1FW6A 4WE1A