3T1AA

Crystal structure of hiv-1 reverse transcriptase (k103n mutant) in complex with inhibitor m05
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
558
structure length
554
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design and synthesis of conformationally constrained inhibitors of non-nucleoside reverse transcriptase.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse Transcriptase
total genus 155
structure length 554
sequence length 558
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3t1aA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t1aA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t1aA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t1aA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3t1aA05
3H08A 2WB4A 4CEOA 3IGNA 4EP5A 4DU1A 3PJXA 3OSNA 2J6UA 2AQ4A 4H8KA 3K2PA 3MEGA 1EETA 2YNFA 4URQU 4M94A 1I39A 4E19A 3GYNA 1TL3A 1A5XA 2YKMA 4LD0A 1TL1B 5DQIA 3SYZA 4CJ5A 4L8RB 4ELUA 2OZMA 2B6AA 1K1SA 2WRMA 4Y1CA 4FJ5A 4AHRA 3PJWA 1ZBHA 1VRTB 4BE0A 3PW5A 1HQEB 2FJXA 3K5LA 4AILC 1A5VA 2FBVA 3NF7A 2HAIA 4ED0A 4W5TA 1D9FA 1JLFB 1NNDA 4RW7A 5KG7A 4YP3A 4ZPDA 3PO5A 4RZRA 1S6QA 2IMWP 4KHUA 2BE2B 4EO8A 4FJJA 2V0NA 4Q8EA 2GUIA 3NH0A 2I5JA 1SL2A 4PA1A 4WXWA 1HRHA 4FVMA 1KTQA 4WZQA 3ZSZA 3CG7A 5SWMA 4CHOA 2KFZA 1L3VA 5E41A 1ZYQA 2B4JA 3ICLA 2BRLA 3H5XA 3NAIA 3HO1A 2VG7B 3OL9A 1QE1B 4ED7A 1C6VA 4OKEA 5KGXA 4N56A 1WSIA 2FVSA 1RBSA 3T5JA 3LALA 3CFRA 4NLQA 3ZSOA 3SV4A 4F8RA 4B9NA 5KFGA 1C1CB 2C2RA 3AVFA 1HMVA 3SFUA 4BACA 3KK1A 3HSTB 2W7OA 4M3RA 4PY5A 1X1PA 3GV7B 4IFYA 2R2RA 2KFNA 2X74A 3AA3A 3V9WA 2OPQB 4OPJA 4UQGA 3H5SA 4CGHA 3MXMA 3NH1A 4O0JA 5HBMA 3OYMA 4Z4GA 4KHYA 4DL2A 4DQRA 1JLGA 3C6UB 3RMBA 4NLDA 1QTMA 1BL3A 4CJEA 5CZ1A 1RT4A 5EU7A 4W5QA 1S1WB 3KLIA 4MK8A 2VA2A 4CJ3A 1TQLA 4TSXA 1BHLA 1U48A 3HVTB 4KB0A 4IBNA 4LSNB 1S9GB 3AVJA 1I6JA 1KVCA 3KK3A 1JL2A 4EYHB 1HNVA 4CFCA 3AO2A 4ZPAA 4TY9A 2V9WA 4RNNA 4NLTA 2VG5A 3IS9A 3QIPB 4KB7A 3VQQA 1QSSA 4J9QA 1Y97A 1A5WA 1RDCA 3DRSA 2AGQA 2KW4A 5J2QA 4HKQA 1SH0A 2Z1IA 3M8PA 4E1MA 4KB1A 4WE1A 5HRSA 4DF4A 4RW7B 2IJFA 2ZQBA 4CGIA 1C1BB 3HJFA 1S6QB 2ZD1B 4FBUA 2HNDA 1TVRB 2BANA 5DGAA 1RTIB 5F8MA 4ELTA 2W9AA 1OS5A 2UVRA 1RCHA 2QE5A 4CJKA 3ZSVA 3O3HA 1S9FA 3QEPA 4MIAA 3ZCMA 1TAUA 4KHWA 4CECA 4H4OA 3ZT0A 2O4GA 4F4ZA 4ID5B 4OLBA 3MR2A 1SKSA 2UVUA 2IGIA 2OPRB 2G8KA 3NH2A 4M3YA 4WFZA 2O5DA 3SQ2A 4DTXA 1BGXT 3HT3A 3TABA 4K50A 4RW6B 4M45A 4AHUA 4GW6A 2KZZA 4LQ3A 4O55A 3LWMA 3LP1A 2YHAA 1DTQA 4MFBB 4CIFA 3RRHA 4DS5A 3BQ1A 3L2QA 1IKVB 1S9EA 4K4WA 4QPXA 3QGHA 2R8GA 4IR9A 3KK2A 3KTQA 3RAQA 3I0SA 1RT7A 3QEWA 4I2PB 5CYQA 4QWAA 4F4WA 1NK9A 2LSNA 4ECZA 4K4UA 2FLPA 3O3FA 3MR3A 3WNHA 1RT2A 2WTFA 1DTTB 1L5UA 4FS2A 3QO9A 1U4BA 4LSNA 5D3GA 3EYZA 2IM3A 1BQNA 3AO5A 3KK3B 3VA3A 2BQ3A 4NCAA 3TAMA 5J1EA 3VQAA 1RAJA 4CERA 3K59A 4R8UA 1CZBA 4I2QB 4LSLB 2QXFA 4NRTA 1R0AB 4J9NA 4O44A 3Q8SB 3WNEA 1NOYA 4DQPA 3PR4A 2OPSA 5HROA 2D0BA 3SZ2A 1KCFA 3PO4A 2XRIA 3S3MA 3G6VA 4E1NA 1WAJA 3T5HA 3BSNA 4K4ZA 4CF1A 4CEFA 5KFQA 5KFWA 3TAFA 1RILA 4Q44A 2F8EX 4DFJA 2FC0A 2BDPA 1L3UA 1NHVA 4DQQA 4FJ8A 1TL1A 1RDDA 3SUOA 5KFRA 5HRNA 3OYEA 4FJ9A 2PYLA 1BIUA 3QESA 2C2EA 1TGOA 4FBTA 5HP1B 3HP6A 2UUTA 2X6NA 4I7FA 4JUZA 2AJQA 2FJVA 3OYJA 1HQEA 1HPZB 1C1CA 2Y1JA 1KLMA 4EP4A 4FXDA 4CF0A 4HVJA 2EHGA 4Y2AA 1G15A 3DOLA 4DTMA 1NK0A 5KFPA 1K6YA 1DTQB 3RR8A 3PW2A 1L3TA 3AO3A 2IAJB 1JLGB 4B8AB 5FRMA 4KFBA 5J2PB 1VRUB 1C0TA 2GIQA 1S6PA 4IR1A 3HYFA 2NUBA 2ASLA 3H5UA 4QW8A 3FQLA 3HP9A 3M9MB 4FZZA 1ZBLA 3SJJA 1QAIA 4EO6A 5F8IA 4F50A 5F9LA 3VA0A 3VQSA 5C25B 2JEFA 4TYAA 5J2NA 4E7IA 1D5AA 2YKMB 4CEAA 4IDKB 3HVAA 1T7PA 4C8KA 2RKIB 4FJHA 4CEEA 1IKYA 1S1TA 3MECB 3M8QA 2ITGA 4Q0BA 1ZETA 4PUOB 4O4RA 3H4DA 3QEXA 4IG0B 2J6SA 1QSYA 3NGIA 3AO4A 3LP3A 2KTQA 1VRTA 4NLXA 2B43A 4DLGA 2P5GA 3EPGA 3LP0B 1KVAA 3NFAA 1LWCA 3F9KA 1MMLA 4ZVFA 3V81B 3V9ZA 3LP2B 1SL0A 1J9AA 3CIZA 4TYBA 4YQWA 3CFPA 4CHNA 3NKYA 1GOCA 5CY4A 3BGRA 5L1IA 1WSEA 1S0MA 4DL4A 2OZSA 2E6MA 4KREA 2BQUA 5FROA 4DL6A 1EP4B 3MF5A 4KRFA 1EETB 3KLFA 3HPGA 4M3TA 3HXMA 4ED8A 4HUEA 3PR5B 1Q9YA 4Z4EA 2W7PA 3G10A 2HHVA 1TKXA 2JC0A 4KHMA 5CYMB 4ZP8A 3BJYA 4CJQA 3KLHB 4M41A 2XI2A 2OH2A 5KFTA 1Z26A 4KV8A 3QIPA 3DRPA 4CK1A 3QERA 3C6TB 4NYNA 2IM1A 1D0EA 1SKWA 4DEZA 3PY8A 1HMVB 2E6LA 4G3IA 4CHZA 4F4YA 4KHSA 4E3SA 1KRPA 1T03B 3S3NA 1LWEA 5F8HA 4JS4A 3L2RA 1C1BA 3VQPA 4K4TA 3DOLB 1TP7A 4CGJA 3KHGA 3L2VA 1KFDA 1RTHA 3OYAA 3D28A 5KFNA 4JRQA 3HKWA 4RNOA 3TAGA 5J2PA 3OYIA 1TVRA 2BANB 4G1QA 3NAEA 3TWHA 4DS4A 4W5OA 1XC9A 4XPCA 3LWLA 4JV2A 5CYQB 1VSIA 3KKRA 1JLCB 4BWJA 1S1VB 3LAKA 3NE6A 3H2LA 3AVCA 4K4VA 3DLEA 3EZ5A 4DTJA 1TL3B 2W8LA 3OJSA 3DYAB 1LAVA 1QHTA 3WNGA 4FLWA 1NHUA 5HRPA 3ITHA 1HYZA 3ZSRA 3I0RA 2WK4A 4LQ9A 1VSDA 4CFAA 1HQUA 1KFSA 5K14A 3I5BA 5J2MA 4IQXA 2A1RA 3G0ZA 3SQ0A 1RTJA 1VSKA 1IH7A 4CF9A 4IH5A 4DSJA 5DMRA 3ZSYA 3VQBA 3DLHA 5HBMB 4ZTFA 1TKDA 3KLGA 4JLHA 4FM0A 5CZ2A 2QKBA 3BGRB 3QLHB 1ASUA 1REVB 4I2PA 2HNDB 5KG5A 1TAQA 3HPHA 4CGGA 4NLRA 3GILA 2JGUA 1TK8A 4IKAA 4FK4A 3VQ4A 2E9RX 4IG3A 3NGYA 5FDLB 4EYIB 3K5NA 5DG8A 3PW0A 3NBPA 5KT5A 4J9RA 4CJ4A 1NK7A 3MFIA 4CJRA 2DFEA 3FDSA 3SPZA 5KFSA 1RBTA 3OVNA 4FCYA 5DGBA 4WE1B 3RB4A 2OPQA 3H59A 1U04A 1SV5A 4CHYA 1NOZA 2BE2A 4B9MA 4WYWA 4Y3CA 3S3OA 3CWJA 1WSHA 5I3UA 1RTHB 3Q8PB 4DSKA 4OGCA 3L2WA 4RUAA 3SI8A 3TAQA 3Q8QB 2VWKA 1C0MA 4CEDA 2HHWA 5KFDA 3V1RA 2BRKA 1S1XB 3AVHA 3ZSWA 5F8LA 4Y2CA 1QE1A 1EKEA 3DLEB 1S5JA 1FKOB 4CJWA 3LZJA 1JKHA 2A1SA 2X78A 4HCBA 1X9WA 2R2UA 2ASDA 2G8UA 1XHXA 3QGIA 3AV9A 3GIJA 2JEIA 4J9LA 3EY1A 2XY5A 1C1AA 2AGOA 5DK5A 1WNSA 4IG0A 3P83D 4U6PA 4WFXA 4NLOA 4ELVA 1WSJA 4RU9A 4DFPA 4J2AA 3M8PB 3K5OA 3B6PA 4K4XA 1BIZA 4AHCA 2FLNA 1N6QA 1F21A 1RT3A 3SUPA 5KG6A 3IN5A 2PY5A 2HNZA 4C8NA 2OA8A 4RG8A 5I42B 5KFCA 4ECWA 3QLHA 1REVA 3L2UA 1D9DA 3RMDA 5C24B 3SQ4A 4DG1A 2YNFB 4O4GA 4ECVA 4RNFA 4RW8A 3V6DB 4CESA 4KHRA 3DLRA 4ZTJA 1S9GA 5J2NB 3OYHA 4CJUA 1TKXB 4FLUA 3KD5E 2YNHA 3ULDA 4URGA 4NLUA 1L3SA 2D0AA 1D8YA 3MEEA 4CF8A 4X2BA 3KNAA 2ETJA 4CJLA 2VG5B 4FZYA 3M8QB 3N6MA 2HMIB 3PW4A 4Z0UA 1FK9B 3BSCA 3V9UA 2OYQA 4JRPA 3AO1A 2R7YA 2C22A 3LPUA 4M3UA 1QSLA 3V81A 4RNMA 4GC7A 1BCMA 3OYBA 4FYDA 4J9KA 2FVRA 2RDJA 3ALYA 1IKWA 4KE5A 4DU4A 4MFBA 4Z4HA 1VSMA 4TQRA 2XGQA 3SFGA 3ISNC 3NCIA 3KK2B 2ILYA 3I0SB 4AH9A 3T3FA 1BQMA 3C95A 2G8WA 4F4XA 2DPJA 2CJQA 4GMJB 5KRSA 3QETA 4CHQA 2WONB 1RT2B 1NKBA 1DTTA 3T19A 3QEIA 2E4LA 1LWFA 4ZP7A 3KLHA 1I3AA 4NYZA 4FK0A 4I7FB 1YTAA 4FW2A 3DRPB 1RYSA 2OPRA 1RT5A 2JEJA 3PX0A 1GOAA 3CJ4A 1HPZA 1HNIB 3T1AA 3TAPA 2QV6A 4NCGB 4O44B 4IH6A 4HYKA 1JLBB 3LP1B 4DL5A 4B9LA 3LP2A 3E51A 1LW2A 4ECRA 1NJZA 4CJVA 4B9TA 5KT7A 4O0IA 3OYDA 4TN2A 4G1QB 3CJ5A 4B9VA 3THVA 5C5JA 1YTUA 4ECUA 4ICLB 3ZSQA 4KAZA 3RMAA 2EC0A 4JV0A 5JXSA 1X9SA 1TV6B 5FDLA 1VSFA 3AA2A 1HYSA 3QGGA 4I9QA 2DTUA 3RR7A 3BSOA 4KTWA 1QUVA 3OJUA 4Z4IA 5J1EB 3NBPB 1O1WA 4DSIA 3CM5A 3NAHA 5HP1A 3V6KA 1D1UA 3PX4A 2WHOA 1UOCA 4PUOA 1RDAA 4FS1A 3BREA 3PW7A 3AA5X 4HCCA 4NCBA 3L8BA 5KFVA 3G6XA 4DQSA 4O3PA 3O3GA 4PWDB 2WOMB 4OKJA 2ZKUA 3RMCA 5T14A 1T03A 1RA6A 4EBDA 4IRKA 3ASMA 3RB6A 4PQUB 3KLEB 1WNEA 3FSIA 3IRXA 2V4RA 2J6TA 3QINA 1VRUA 3VN5A 4TXSA 1S6PB 3VQ5A 4IRCA 1RT6A 4QOZB 1N5YB 1LW0A 3UR0A 4ZVHA 2HHTA 1TKTB 3HPOA 4ZMMA 3OYCA 3AVNA 1ZBFA 1S1VA 3M9NB 1VSJA 1QS4A 1C0UB 3JSMB 3DLGB 3AVAA 4OJRA 3MXJA 4CIGA 1JKHB 3KD1E 4ZVGA 1IKXA 4XIUA 5F9NA 2RKIA 4BWMA 4N47A 5L1KA 1SH3A 3CDEA 4K8XA 1KSPA 1S1UA 3C6TA 3CYMA 4Q0BB 5KG0A 4FLVA 1J53A 2UUWA 2XY6A 1LAWA 3TQ1A 1HNIA 2P5OA 4M42A 5FRNA 2XY7A 3I5AA 2KZMA 3LP0A 4KHNA 1WLJA 2D7SA 1LWCB 3ZSXA 1UWBB 3E01B 4TQSA 3SQ1A 1RTDA 4YR2A 4J2EA 3DOKA 2YKNA 4CGDA 3H98A 3T5LA 3D45A 2YV0X 4RW9A 4XPEA 3RB3A 4U7CA 4CJFA 5KFZA 1IO2A 3DI6A 2EX3A 2P1JA 5KT4A 3GV5B 3BR9A 3DRRB 3KKSA 4OGEA 3UPFA 2D3ZA 3HHKA 4O4GB 1KHVA 4ICLA 4DF8A 3KLVA 4YMEA 4Q45A 3NL0A 3QO9B 1Q9XA 1T05A 1VK0A 4NLSA 2FVQA 5KFBA 3MFHA 3OYGA 3TVKA 2YNHB 3V4IB 1J5OB 4WYLA 1S1TB 3MXIA 5HRRA 4NLWA 4ECTA 4R5PA 3P1GA 4BDYA 4KV8B 2YNIB 3KJVB 3OHBA 1WSGA 1W25A 3SCXA 4JV1A 3K57A 4TLRA 4Y1DA 1BI4A 1WN7A 1XWLA 4KI6A 3KMSA 2W9BB 1JIHA 4K4YA 2DFHA 2FBYA 2XO7A 1RT1B 2WOMA 2OPSB 2PYJA 5DG7A 4QCLA 2DY4A 1JXEA 4BDZA 2C28A 2AX0A 4EEYA 2FVPA 1SKRA 2IDOA 2JEGA 1RT3B 4KBIA 4MH8A 2IA6A 2G8VA 2AWZA 4AHSA 3IG1A 2F8SA 4F2RA 2C2DA 3HVWA 2HHUA 4J2DA 1UA0A 3C94A 3KLFB 1LW0B 3SUNA 3V6DA 1NK4A 3GIMA 1S1XA 2ILZA 1TKTA 2ALZA 4BDPA 4N41A 3GV8B 5KI6A 1XI1A 3MEDA 4F4KA 3DYAA 2QK9A 4OL8A 4HTUA 2RF2A 5EWFA 4HUFA 1KLNA 3I0RB 2AX1A 2W42A 3GQCA 4WZMA 4F3TA 2D3UA 1SUQB 1RTJB 4E7KA 4FJKA 2UVVA 1RT5B 4NLPA 2PZSA 3V9SA 1T94A 4DLEA 3H5YA 4FJ7A 3VQ8A 2Z1HA 1C2PA 4CK3A 4DTUA 2IM2A 5KRTA 1UWBA 3E01A 1T3NA 3OL8A 2XCAA 1NJXA 4FJGA 1IKWB 2B5JA 3PX6A 2Z1GA 4R0EA 4DSEA 1IG9A 5DQHA 5I3UB 1U49A 3M9OB 2HNZB 3V9XA 2GC8A 3PZPA 1YVUA 3DLBA 2VG6B 4QW9A 4DTOA 4KO0B 1J54A 4BE2A 1JLCA 3KMQA 3FFIA 3AVGA 3AA4A 1JLQB 2WONA 3KHHA 4ECQA 3NGZA 4DTSA 5HLFA 1TK5A 2CKWA 4M3WA 3DM2A 3RTVA 4FM2A 4CF2A 2BQRA 3QNOA 3V4IA 2HHQA 5K14B 3OSPA 4DSLA 2B6AB 1RNHA 2R8JA 3IS9B 2GBZA 3RB0A 4GVMA 4DL7A 2BGGA 3OL6A 1UAXA 4CEQA 2IOCA 1JL1A 1YT3A 3PHEA 1S49A 3V1OA 3U6FA 2OPPB 1S0OA 4RW4B 3OYKA 4MKBA 1N6QB 2XC9A 1IM4A 4QWBA 1QQCA 2R8IA 5KFOA 3LANA 4EZ9A 2YNGB 4EBEA 4O3QA 4FM1A 4HUGA 5EWGA 4ZHRA 1U09A 3B6OA 2G8FA 2HWIA 3CFOA 3WNFA 1CZ9A 3H4BA 4RUCA 1JLEB 3SPYA 2R2SA 4QWDA 1LWFB 2RPIA 1S0NA 4KI4A 1FXXA 2RF2B 1IKXB 1CSJA 4CK2A 1CLQA 2HMIA 3KHRA 4B3OA 4CEBA 1GX5A 2W9CA 4OPKA 3NHGA 3OYLA 4WFYA 1DLOB 3O4QA 2FLLA 1JXBA 1RYRA 3TAEA 5KG4A 3T5KA 1RA7A 3NF6A 5T7BA 4YR0A 4MK9A 4TY8B 5L9XA 2HNYB 1FKPB 4PQUA 3CVKA 2I5JB 3ZT1A 3L3VA 5KFUA 3NGDA 5F8GA 1VSLA 2G8IA 4AHVA 4W5RA 4NLVA 1S10A 2V4QA 4FJMA 5C42A 2HB5A 4KTQA 3O4NA 3BSAA 3H40A 5C24A 1XR7A 4B9SA 1ZBIA 1VSEA 4RW8B 2KQ2A 3EZUA 5DLGA 4B8CA 1CXUA 5HLFB 4FJLA 1TKZB 3OLAA 1K1QA 5EDWA 2YHBA 1T05B 3TANA 5KFAA 4FLTA 3DM2B 4Y34A 5JUMA 3MEEB 2AU0A 1HQUB 1BQNB 3NDKA 3PVXA 4KTZA 2ATLA 3LZIA 1S1UB 5L1JA 3S9HA 4I9LA 2O4IA 2RDIA 4IFVA 1U47A 3CDWA 4R8UB 4XO0A 1Z25A 4OLAA 2JLEA 3KK1B 4Z4FA 5JS2A 1ASVA 3U3YA 3JYTA 4ZP9A 4KKOB 4NRUA 4J9PA 1RT1A 3VQEA 1SL1A 2XY8A 3IGVA 3DOKB 3UDLA 3KLGB 1RBUA 3DLKB 3VQCA 3KLEA 2IC3B 4KHQA 1S48A 3QYYA 5I42A 3AVKA 4LY7A 1S1WA 4Q5VA 3TARA 4IOBA 2F96A 4DG1B 4ID1A 4HHTA 5EUHA 2X6SA 4M3XA 1Q8IA 2AGPA 1XR5A 2P51A 4YR3A 3KHLA 4M3ZA 4O3OA 3MEDB 5KFHA 4URSA 3EPIA 5KFKA 1HNVB 1Z4UA 4E89A 3ZT2A 2VWJA 3BQ2A 2ASJA 4H4OB 2XCPA 2E9ZA 2R8KA 1NJYA 3CO9A 3LAMA 4ECYA 3CJ0A 4H54A 5KFIA 3PV8A 3Q8RB 3DRSB 4PWDA 2D5RA 2W9BA 3V6JA 4N76A 4LH4A 1JLFA 3OL7A 4NCGA 4EBCA 2DFFA 4CGFA 4FJNA 3MTKA 4B08A 3ZT4A 2HW3A 1RTDB 2HHSA 2RN2A 2ZD1A 4OKKA 1IKVA 1S9EB 4NLGA 4DU3A 4F2SA 1RT6B 5KTQA 4J2BA 3OY9A 2VG6A 3CDUA 5EWEA 3MEGB 5KG3A 4OVLA 5DG9A 3NF9A 4ED2A 3BQ0A 1FKOA 1TKZA 4MK7A 3V1QA 4J9OA 5KGWA 2VA3A 5D3GB 3VQ7A 3FQKA 4BE1A 1N48A 1ZTTA 3UIQA 3QEVA 5KFJA 3ISND 1SH2A 3QZ7A 3TAMB 3N6NA 2Z1JA 4M95A 3L3UA 1W9HA 3AVIA 1JXLA 4IFVB 1B9DA 3CQ8A 1BI4B 3KOAA 4FZXC 2F8TA 3OLBA 3I5CA 4QWEA 2XHBA 4W5NA 4DTNA 5F8NA 1NK8A 1X9MA 4DSFA 5HROB 1BCOA 3NF8A 1U45A 3RAXA 1KVBA 2YKNB 2B5JB 1ITGA 4ED1A 3DLKA 4DL3A 4EZ6A 1N56A 4O5BA 5DQGA 2IC3A 3MR5A 1JLAA 3DI6B 4DTRA 5KFXA 3K58A 1RTIA 4Q43A 1NJWA 4DQIA 4LH5A 4QWCA 4KAIA 3AVBA 4DFKA 3D0PA 1S4FA 1EXQA 3U3GA 3LPTA 1HYSB 4GC6A 4ECSA 5JS1A 3VQDA 2WCXA 1MU2A 3DDKA 4O3NA 3SI6A 4ID5A 2HVIA 1FK9A 5KFYA 3QZ8A 3F73A 3RRGA 3MAQA 4FJXA 4FW1A 1QAJA 2Q3SA 1R0AA 5J2QB 1DLOA 3I8DA 4C8LA 2ZE2A 2DPIA 2D41A 1KLMB 1EX4A 4RW4A 4ECXA 4C8OA 2R2TA 2HHXA 5KFLA 1LWEB 4JS5A 1WAFA 3OHAA 3G6YA 1ZBUA 2HNYA 4F3OA 3VQ6A 3G86A 3SV3A 3IRXB 3HM9A 2IBKA 1RT4B 4KFBB 2YNGA 1VSHA 1BQMB 3KLIB 3GIKA 3N6LA 2ATQA 3UQSA 4FLZA 4K4SA 1HARA 3HVRA 1BISA 1W0HA 2IS3A 5KFFA 5KT3A 3DMJB 2VG7A 4QAGA 3DLGA 4FK2A 1XHZA 3OYNA 4CJPA 4ED6A 3TI0A 4IDKA 3ITHB 1TK0A 3SUQA 4KPYA 2Y1IA 2FBTA 1B92A 2W9CB 5KFEA 4IH7A 4H4MA 3AVMA 4ZPCA 3RBDA 4CIEA 2R8HA 1SUQA 2YNIA 3KJVA 3RWUA 3K5MA 1RBVA 4FLYA 3SNNA 2E9TA 3JYTB 3RBEA 1JLBA 3OS2A 1GOBA 2OPPA 1XR6A 4IKFA 4YNQA 1GX6A 4CEZA 4KSEB 1LW2B 3C6UA 4DMNA 2IAJA 3QIDA 3TR8A 4N5SA 4RNHA 1JX4A 4RW9B 1RBRA 5DLFA 1B9FA 3IG1B 1RT7B 1ASWA 4ED3A 5KT2A 3CJ2A 1RDRA 1JLAB 4B9UA 3DRRA 5C42B 4KO0A 4NLYA 3OS1A 4WXOA 1EP4A 1S97A 1JLQA 3HVTA 3D5MA 2XI3A 4E0DA 2I1RA 2FJWA 1NKEA 1TV6A 5KG1A 4IG3B 3PUFA 5CYMA 3M8SA 2D0CA 1J5OA 4NZ0A 2UVWA 4DFMA 2GV9A 1NK6A 1IKYB 1KHWA 4DWIA 4R5PB 2G8HA 3BDPA 1MU2B 1HJRA 3P5JA 2QKKA 4C8MA 4B3OB 4MIBA 4YFUA 2JC1A 5L1LA 2FVCA 4CFDA 3OYFA 2GIRA 4DTPA 2ZE2B 5KG2A 1N4LA 3HL8A 3AVLA 3GIIA 2IJNA 4E7LA 4TY8A 1SV5B 5SZTA 4K8ZA 3KIOA 4CCHA 1FKPA 4E7JA 4CFBA 2W8KA 3A2FA 3IAYA 2HVHA 4J9SA 2XWYA 2XGPA 1C0TB 2IM0A 1N5YA 1YVFA 2FBXA 1UA1A 1RDBA 4ZHRB 5KFMA 3FRZA 1ZTWA 1HYVA 3FFIB 3LDSA 1C0UA 3JSMA 4CHPA 4MKAA 3DMJA 4FLXA 3CJ3A 4AHTA 1JLEA 4FJIA 1NKCA 5C25A 1T8EA 4CE9A 3NMAA 4E7HA 5KT6A 4MQ3A 4J9MA 3MR6A 3MECA 1NK5A 5J2MB 4H4MB 3M8RA 4ZVEA 4I2QA 4LSLA 3VQ9A 4CJTA 4IFYB 5F8JA 4RW6A 2BR0A 3CM6A 1CXQA 2HWHA 3V6HA 3QNNA 4IRDA 4KKOA 3QIOA 4O3SA 3ZT3A 4Z4CA 3OS0A 4Q8FA 4NYFA 4ZPBA 1LV5A 4CJSA 4O3RA 1WSFA 3HK2A 4ZP6A
chains in the Genus database with same CATH superfamily
1F9EB 4AXJA 4K2XA 3IGNA 1R59O 1ZOTA 1T3OA 4I0WA 4U9RA 2AQ4A 2C3PA 3MEGA 2NXJA 4HTLA 1EETA 4URQU 3VGKA 5AQPA 4V19S 4E19A 1RFQA 4OX9J 1A5XA 1PCAA 4LD0A 1TL1B 5F0UA 4NO7A 3W9IA 3HHLD 1CJVB 4ZCMA 4O5FA 2RS8A 1T02A 3JTNA 2B6AA 1MDUB 2XULA 2EKYA 2R7TA 4DR6F 1TUUA 3N5FA 2OEJA 2A3ZA 2ITMA 4AILC 2FBVA 4X4RA 2HAIA 1LEOA 1DGKN 3SBTA 1WKJA 2IBOA 3UFCX 3PO5A 1FFWB 1S6QA 4FJJA 4U67L 2ZBRA 1FI4A 4FWSA 2D0PA 1HRHA 4TVAB 4B1YB 1FFGB 4C6AA 4WZQA 5BYQA 3CG7A 1N52B 4ETXA 5E41A 1ZYQA 3UB5A 3ICLA 3UD4P 4OKEA 1M1KO 3BN4A 3MDQA 1YZ7A 5KGXA 3CJCA 1WSIA 2GNKA 4NLQA 4F8RA 4B9NA 4PHTX 3KK1A 3T41A 3HSTB 4PY5A 2R2RA 4C1NK 4TU8A 3UKRB 3UR3C 2OPQB 3TA2A 4OPJA 2W2PP 4UQGA 3K9KA 4TU9A 4A8XA 4DL2A 1JLGA 4DR3F 1QTMA 5EOYA 5LJVA 1HD1A 5G4DA 2XS5A 3HULA 1HBMB 3KLIA 5CD4A 4LF5J 3OR2B 1TQLA 4L74A 3CE8A 2B56A 4KB0A 2VH7A 4IBNA 3BF3A 4C1NI 4LF5K 4IWVA 2ZM6F 2RAQA 1I6JA 2QSWA 1PG5B 3SBMA 2P9PA 3AO2A 2V9WA 4RNNA 4NLTA 4I68A 2VICA 5T7LA 3VQQA 1VJWA 1Y97A 2AIRB 1BA0A 2F9JA 1SH0A 4YEAA 2UUCK 4F3QA 1YF5L 4RW7B 2P9LA 1XBWA 3TO8A 4OHYA 1N32J 4CGIA 2QWOA 2VHGA 2UXBF 4ZVTB 2EFPA 1CBKA 1UW4A 1WOSA 2ZDOA 5F8MA 4ELTA 2J76E 2W9AA 2AP1A 2KKZA 3W65A 1SC4B 3QRRA 2C2ZB 2H54B 3QEPA 5BR8F 2IRUA 4MIAA 3ULHA 4C11A 1HR0J 3HFZB 4CIOA 2JOQA 3LF0A 2IY5B 4KHWA 4H4OA 1S7IA 2V8HA 3ZT0A 2AYMA 2O4GA 2QA1A 1EQ0A 1Q18A 3MR2A 1RWOB 2OPRB 1K73T 4Z7YA 3NH2A 1Y5IB 4LF6J 1Z2LA 4R25A 2QI2A 3TABA 4K50A 4AHUA 3D1QA 3OXLA 1FVQA 3WXLA 1DTQA 1AROP 3L4BC 2HURA 4JI8F 2R8GA 4IR9A 3IR6B 1RT7A 3QEWA 3AQOA 4DMZA 4A4JA 5CYJA 4QWAA 4ECZA 2LSNA 3TJAA 3WNHA 1RE1B 1TUGB 3CJ8A 1L5UA 1UFWA 2HEKA 3QO9A 4EMDA 2MQPA 3EYZA 4OZ0A 1VS3A 2ZGZA 1OWXA 3KK3B 4ZJLA 1B3TA 4WQ4C 3VA3A 3W2WB 2EK1A 2IMOA 5KQ8A 2XLIA 2V8VA 4DR1J 3M2RA 2A18A 2QXFA 1FWKA 3S7RA 5CE3A 4NRTA 4FWKA 4J9NA 3MX5A 3Q8SB 3PCOB 7FD1A 4DQPA 1QUPA 5HROA 3SZ2A 2AHOB 1RK8A 3PO4A 1KOOA 3CCJN 2XSJB 2O8BA 1C0FA 3WQTA 2XMKA 3M32A 4ATNA 5KFWA 3QT8A 4C0HA 1WF2A 1F1BB 4DFJA 5HQMA 4X66F 2VC0A 5DDOC 5B08A 2L9DA 5AXLA 4BCAA 3A5NC 2RUSA 1FESA 4X4UA 4MTPA 1UPMB 2QWPA 4A2BA 4YS2A 2PYLA 2C2EA 2UP1A 5HP1B 3HP6A 4X4NA 3SQGB 1JXVA 2X6NA 4I7FA 4ZITA 1HQEA 2Y1JA 1C1CA 4WU3A 3F0NA 3DU5A 4CVNE 4CF0A 5CCMA 2EK6A 2EHGA 4JI0J 3HX9A 3D9BA 2GGPB 5LJ3Y 2WSFC 4DTMA 5KFPA 2UUAJ 4NPOA 3AO3A 2IAJB 3VAGA 5AJ3K 2CJBA 5B0BA 4KFBA 3PEJA 4G65A 5J2PB 1VBKA 4ISGA 1VRUB 4IR1A 5FIIA 3HP9A 4NEYA 1ZBLA 3Q0AA 1IBLK 1XERA 4JHDB 1FDNA 1JK9B 3VA0A 3ZZUA 3DXKB 2EXUA 1D5AA 2CQDA 5L8RC 2FDNA 4IDKB 3NVMA 3TR5A 1UTAA 2RKIB 4FJHA 4CEEA 3MUVP 5DO2A 1PJ6A 4XAKA 4CW7B 4C0OC 4O4RA 1QSYA 3UCZP 3AO4A 3LP3A 2KTQA 3VGVA 2FSKA 3H2UB 2B43A 3P31A 3LP0B 4ZK7M 1KVAA 2HQGA 2UU9J 3NFAA 1LWCA 3MURP 3RSEA 1O8BA 2HQIA 3G71S 4CDIA 4IJAA 2MLYA 3GB0A 5LXRA 3WDOA 1Y11A 3IR7B 4E8UA 2E6MA 3UN2A 4DL6A 2YKAA 2D74B 1GLJO 2KVIA 1NBWA 3UE2A 3HPGA 3LTOA 4HUEA 3PR5B 3LDPA 3AFGA 3CCEN 3OTCA 2LQ5A 3VEZA 2HHVA 1TKXA 2JC0A 4KHMA 1IG8A 4ZP8A 1YTYA 3BJYA 1YI2N 3P39A 5KFTA 4ANDA 4YN3B 2W2MP 3T1HK 3QIPA 1GLFO 5HK4A 3C6TB 1PIEA 1YJWN 3PY8A 2G1HA 4DX5A 2ZJQL 4KHSA 1KRPA 2NLXA 4F7VA 4JS4A 4A48A 1C1BA 3L2RA 4OX9K 3VQPA 2GW8A 2XG8A 4RNOA 2PFFB 5E2QA 1OVQA 3VQTA 1GT8A 4L72B 1FXRA 2ZH2A 2QLBB 4EAHD 1SVDA 4XPCA 2MHEA 4JV2A 5CYQB 3H2LA 4K4VA 3DLEA 3BO4A 3OJSA 1F0XA 3TW0A 1B70B 1EKSA 3ZSRA 3I0RA 3AAPA 2WK4A 1ZPWX 4CFAA 3R2CJ 1X5TA 5J2MA 1VRQC 4IQXA 2A1RA 3SQ0A 3D2FB 5LY3A 3KHYA 4CF9A 2XQCA 2GZOA 4NB4A 3MX2A 2BACA 4HHJA 4OI4A 3ZSYA 3VQBA 2C3MA 5LSLA 1U1PA 1TKDA 2MXYA 1EO1A 1CPZA 2BKOA 3ILOA 4USVA 3QLHB 1REVB 4KGZB 4H4KA 5H1SV 2XSFA 3PSFA 2FHKA 1TAQA 1B7YB 3R6MA 1FE4A 2DNKA 4JKDA 4FK4A 3TYTA 4DR2F 2FY1A 6AT1B 1VIOA 4EYIB 5M2PA 2DO0A 1NCLA 5DG8A 2P9PB 1UCNA 3F9MA 3TPQA 1HWIA 4J9RA 4EIAA 2DFEA 5C2DA 5KFSA 4IEIA 3LL3A 4BC5A 4DHYA 3KG0A 2DXEA 2LP4A 4WE1B 1X5PA 1WEXA 4B1XB 4CHYA 2BE2A 3MPVA 4WYWA 3B8HA 3GFHA 4Y3CA 2P9KA 4WFBL 4QS9A 4K59A 1RTHB 4DSKA 3CULA 3WHIA 1NLVA 3AY0A 3SI8A 1VC6A 4RLEA 2VWKA 1C0MA 3PIOQ 4CEDA 1WOOA 2QLWA 3ZSWA 1X0FA 1QE1A 5EHHA 1RCXB 1EKEA 4DV4F 2E5HA 1JKHA 2DJWA 1Y7PA 2R2UA 4P2XA 2ASDA 2R7VA 1U1RA 2JEIA 5DS7A 1VHIA 4NA3A 4P71A 3EY1A 2E44A 2XY5A 2Q36A 3BS9A 4H0YB 2FF6A 3EGWB 1C1AA 2AGOA 2VODA 5IOLA 1WNSA 4IG0A 3VF4A 4U6PA 1WSJA 4RU9A 4FPRA 3D4JA 1WHVA 1XMQJ 1KP6A 4FYXB 4JI7J 3ZTRA 4K4XA 2FLNA 1N6QA 5H1SQ 4WKRA 3KJNB 2MZQA 3IN5A 3QNWB 4C8NA 1X0PA 4RO0A 4MKVA 2F4VF 4X4TA 1RU2A 3UO0A 3W62A 3T1YF 2GA7A 4DG1A 2YNFB 4DV4K 2MDAA 3PRDA 4RW8A 4DUZJ 3DLRA 2VFVA 3TQEA 4A8OA 3ENOA 4BLGA 2QA4G 1DT9A 4P2FA 3RGIA 4DR2J 1D8YA 3B8AX 4CF8A 1YAGA 3KNAA 3NGKA 4CJLA 2VG5B 5ADXH 1H2UX 2HMIB 1FK9B 2ALYB 4HVZA 4EI2A 3BF4A 3BKTA 2DGQA 4JI0F 1RWXB 4M3UA 4RNMA 2O8CA 1T95A 4DV2F 2FVRA 3K17A 2RDJA 2CPZA 1WG1A 3VV2B 4TQRA 2I8EA 1N33K 2W01A 1RI7A 4DR3K 3KFWX 1H3DA 2NSCA 4BR5A 2MQ8A 3M3ZA 8AT1B 5KRSA 1NGDA 3QETA 4CHQA 2DNLA 2WONB 3AOBA 1T0TV 1WKKA 1LWFA 1KKHA 4EK2A 1Y3KA 1N5QA 4FW2A 1RYSA 2OPRA 1RT5A 2RQMA 1X4FA 2KB2A 2GTDA 1HNIB 1SQKA 3TAPA 2IVOA 2QV6A 2BUNA 4NCGB 4HYKA 1NWKA 1Q5VA 4JKGA 4LF9F 4OHZA 1N8RO 3MM7A 3R27A 1LW2A 4ECRA 1T6CA 1NJZA 3RW7A 2HHHK 2WB1D 1BWFO 5GINA 4DPYA 1QLNA 1U2FA 3OYDA 4F04B 1Q16B 2GS8A 2B9EA 2E7XA 1EHWA 3PIOL 4KGMA 2P8IA 5H9EJ 1Y00A 2CNKB 2Q1LA 2WW8A 2CQ0A 3RR7A 3K8WA 1TMJA 3CM5A 5HP1A 3V6KA 1D1UA 3SQGA 3S8SA 4FS1A 3BREA 4QBUA 2XMVA 4HCCA 5GADP 3GG1A 1RGIA 4WK3A 3IFEA 3O3GA 1YZ6A 2WOMB 2ZKUA 1BA1A 1RA6A 2BABA 2K2PA 1HKAA 3D0IE 2AP6A 2LQBA 4J5OA 2E5LK 2VQFF 2QWLA 4U95A 4YHHF 3T7ZA 4FYYB 3VN5A 1NGHA 1N5YB 1XMOF 1GQEA 4F0KA 2HHTA 1R8HA 4JI7K 3M9NB 3QFPA 3JSMB 3VGTA 3I55N 2VQEJ 3OVBA 2LU1A 1M5OC 4CIGA 4ZVGA 2A40A 2FZGB 1IKXA 4XIUA 4IOCQ 4B1ZA 1NGIA 1SH3A 4K8XA 1S1UA 3C6TA 4Q0BB 2UXBJ 4AT1B 5ETNA 4FLVA 1FEHA 2Q31A 3TQ1A 2DY1A 3GBTA 4PWWA 3I5AA 3LP0A 1LWCB 3U7JA 3E01B 5HO4A 3NS6A 2O8DB 1JJHA 3D45A 3CD7A 4CJ7A 5HN0A 2GO8A 1WC6A 4XPEA 1TUVA 1VQ5N 3FEXB 3VF2A 5IZHA 4CLKA 1GAOA 1NDPA 5CZVA 2V51B 4O4GB 2N4CA 4L73A 4I4BA 4N8OA 4JV5F 5IT9U 2ZBPA 1WELA 3TVKA 3CNQP 2Z2YB 1QQOA 2YNHB 4P74A 1S1TB 4LF9J 3MXIA 4ECTA 1MN7A 4R5PA 3P1GA 1T44A 4JI5F 1P90A 2CG4A 3Q8UA 4JKCA 3MAAA 3OHBA 4BR2A 1Q5YA 2HBYB 4DXLA 3EGZA 2FBYA 2PYJA 2OPSB 2RVJA 3DOMA 1J5EF 4QCLA 1R0CB 4UY8T 4DCHA 5D0RA 2IDOA 4NEZA 4LRBA 4KBIA 2G8VA 3H6EA 4F2RA 4DV0J 1EJ7L 1KBRA 4F4AA 3C94A 3KLFB 4LF4F 3CCZA 4KH6A 4DV3J 1S1XA 1TKTA 4BDPA 4N41A 2ZH7A 5A6WA 3DYAA 1N36J 4HTUA 1UPPA 5EWFA 4HUFA 3I0RB 2M3DA 3TSQA 2AX1A 3QFHA 2ZZTA 3FC9A 4F3TA 1SUQB 3G6EN 2UVVA 4WWSA 1IR0A 3C19A 4QPTA 4LFAJ 3C16B 2D3O1 2O8EB 4DLEA 4MDAA 3FEYB 3OQ2A 3VQ8A 4HHHA 1OQ3A 3Q2SC 1V9OA 1EX8A 2AF6A 3ENHA 2CUYA 2Z1HA 2IM2A 1HBUB 1AUDA 2DISA 3IO1A 2ZJPL 5KRTA 2XO6A 2BJ3A 2RH3A 3TWZA 2A1BA 1IKWB 1MWZA 4JK9A 2LEAA 3Q24A 1YBUA 5DQHA 2E1YA 2ASMA 1S57A 2DD8S 1UVKA 4CLSA 5ETPA 3RUBL 2GC8A 4KGVB 1JJCB 4ANEA 3ZZ0A 4QZVB 1J54A 1K9MO 3AA4A 3K0JA 1XNRF 2CH6A 5D78A 9ATCB 4M3WA 5C7PA 5JLFA 3MM6A 1PILA 2QGFB 1VBXA 4P2MA 4CF2A 1Q8LA 2Y0BB 2BQRA 2NPIA 3KG1A 5IT0A 5E7OB 1H38A 5DM7Q 2R8JA 3THWA 2BZ2A 2GBZA 2GV1A 4DU8A 5LOQA 4DL7A 3RZAA 3OL6A 4LF7F 1JL1A 2OPPB 4RW4B 1X8DA 1QQMA 3D6HB 3CW2C 3SJHA 1N6QB 4V19J 2I0XA 3G6ES 3KWMA 3Q8VA 1YBAA 2HAFA 2Y0SD 4NMLA 4DDFA 3W7BA 1WC5A 2GVDA 1J2VA 3PYDA 1DEJA 2WVCA 2K8GA 3B6OA 1WDTA 2G8FA 3MMBB 2DNNA 4USWA 3C66A 3WNFA 4K0KK 3H4BA 3SPYA 1OY8A 1E6YA 2WBMA 3L6QA 1FXXA 4FPIA 3SCJE 2FJAB 1LOUA 4ED5A 5JMVA 5AQGA 4WTYA 1TMMA 4AXIA 4RU2A 1R31A 2FLLA 2GUPA 5GAHP 3AOCA 2C42A 3TAEA 5T7BA 2FUG9 1S72S 1S0VA 1Q7YO 1CS4B 2ABYA 3EVOA 1R8CA 3CCES 5L9XA 2HNYB 4PQUA 3EICA 2I5JB 5KFUA 3NGDA 4AHVA 4KY3A 4W5RA 3BBBA 4KTQA 3O4NA 3H40A 4LBPA 4KC5A 2F7TA 4BGBA 4ZN1A 4RW8B 3QQCD 1ZS6A 3TNVA 3EZUA 3AA9A 4K0KF 4M8LA 5HLFB 4FJLA 2P9GA 1R8BA 2RQCA 2YJFA 2YWEA 3LW5C 3DM2B 5JUMA 1S6OA 3RW6A 5JMNA 2GQQA 3NDKA 3PVXA 3G25A 1QAXA 4DR3J 5AXNA 2AV5A 5IS2A 3TZYA 2A41A 3GYGA 3CDWA 1Z25A 2XZWA 2JLEA 3V4MA 1WD6A 2XMAA 3VVTA 3WIUA 3N9UC 4B3SJ 4ZP9A 2CXEA 2Q6BA 2CQ1A 1RT1A 3VQEA 1SL1A 4LF6K 1NJIO 2QSFA 2VJVA 2MKJA 1FTRA 2WSCC 4YOUA 4KHQA 3AVKA 2C2OB 3GJSB 3W2VA 1S1WA 3SDEA 4IOBA 3Q89A 5H9FK 2F96A 4DG1B 3OR1A 1WSVA 3ZTPA 1S72N 1YJ7A 4Z2XA 1Q8IA 2V6AA 2AGPA 3AA8A 2V68A 2E20A 4YR3A 3KHLA 1KC8O 1LK7A 3MEDB 1S76D 4M63C 5M1NA 1BG3A 2RHSB 2AT1B 3LPEA 2CDQA 3AOAA 4NYOA 4L76A 2UXCK 4Q2MA 4D3HA 1KQFB 1SJQA 3V6JA 4WQ5A 2VDIA 4NCGA 4FJNA 2O8CB 2QWRA 2Q0UA 3MM7B 3O9TA 2BJ1A 3SAFA 2RN2A 4JYAK 2ZOGA 1S9EB 4DU3A 4F2SA 4FWOA 3KKFA 4DOZA 2AJ0A 2AJ1A 3SEOA 4J2BA 3CDUA 5EWEA 4ZJOA 3MEGB 4LFBF 2EBEA 4OVLA 2Z2MA 2YHYA 1WEZA 4U7UK 3FUYA 3M8WA 4CI6A 3OV7A 1U1KA 1RWPB 1RCOB 1TKZA 1G1XA 2HLUA 3FQKA 3GJTB 1FJCA 1ZTTA 2H65B 3KUHA 5K20B 2Z1JA 1YJUA 3HHDA 2Y1LB 3CQ8A 4LR8A 1WI6A 1NEEA 3OLBA 1B0TA 2XHBA 2G9OA 1U1MA 1XMQF 4DTNA 2L48A 2OTLN 4OYZA 4DSFA 4C3LA 4IOXA 4CLZA 1RABB 2WC9A 1YRTA 3DLKA 3D6RA 3SQOP 2UUBF 2F4VJ 2NRWA 4DTRA 2NLWA 4JAXA 4DQIA 1M5HA 4QWCA 1OY9A 4KAIA 1X3NA 1VIXA 3AVBA 4DFKA 1S4FA 1N5VA 1YKWA 2IVFB 3U3GA 2JFDA 1HNXJ 2LXIA 4WF9L 4P2SA 4FWLA 6FDRA 2YBVA 5JS1A 4E98A 5D15A 2GJIA 2WCXA 1VQPN 2HVIA 5KFYA 3RRGA 3D2EA 3US5A 4BREA 2Q3SA 1I51B 1VQ4S 1I3OB 4C8LA 3I8DA 2VPZB 4GY2B 2HHXA 1SXLA 1HBUA 3NS5A 2LQ9A 1LCUA 4GV9A 2QMXA 4EWTA 5LSOA 4DUZK 1OSCA 5T41A 3ATVA 1ZBUA 1QVFM 3G86A 3SV3A 4GVEA 1RT4B 1VSHA 1BQMB 3KG4A 3KLIB 2H1YA 2ATQA 2CQ2A 2HQFA 3UQSA 4FLZA 2OKQA 4FWQA 2E29A 1FE0A 2WFBA 4CZJA 4C3MA 4FK2A 3HRGA 3HHLC 3OYNA 5B0EA 5BYRA 3HBTA 3U27A 3TI0A 1IBCB 2SXLA 1OH6A 1CZAN 4KPYA 2Y1IA 4CO3A 2W9CB 4H4MA 4ZPCA 2R8HA 1CG2A 1SUQA 3BEGB 2YNIA 4MO5A 3RG6A 3RWUA 2VQFK 3G82B 4Y2IA 1RBVA 4FLYA 3JYTB 1JLBA 1GOBA 2OPPA 5D0HA 1GLDG 3RAMA 3CDAA 2PMWA 2WW4A 5K8MA 4LFBK 4DMNA 3TR8A 2ZHBA 4JI1J 2YWGA 5B0CA 4B3TJ 1JLAB 3PTWA 1BY9A 4B9UA 3WBZA 5C42B 4NLYA 1EP4A 1S97A 4PPDA 4ER8A 4C98A 1TELA 3Q22A 3CCLS 3C14B 4NL5A 2C2KB 4JI2K 5THWA 1IJJA 1TV6A 5CYMA 4QIEA 4NZ0A 1NK6A 1IKYB 2MSSA 1TFWA 3SSSA 3BDPA 3O8MA 2XHWA 4C97A 2DRBA 2KHCA 3WEEA 2V50A 2F40A 2XLJA 1H7XA 4CFDA 3OYFA 2RB7A 5D4OA 1HPMA 4ISEA 4PXEA 3FEZA 3AVLA 3KIOA 2E88A 1FRIA 5AZIB 2QEXN 3VGUA 4E7JA 3GPAA 5GMEA 4CFBA 2ACYA 4OYMA 2VASA 4UUWA 5HMWA 1VQPS 3GFYA 1C4AA 1ZTWA 2W4PA 1JCEA 2RU9A 4MKAA 3DMJA 4FLXA 4AHTA 5C25A 1NPKA 4ILRA 3TSUA 3OPKA 2WAQD 1S12A 2VL1A 2EFNA 3GG4A 5E3PA 1G7CB 5BPMA 4BRGA 1D09B 4I2QA 4LSLA 3MK6A 1ATSA 3VQ9A 4CJTA 1RLCL 3ZZYA 5F8JA 3TOQA 4OI2A 2HWHA 2CPJA 2P9IB 1F9FA 3QIOA 1J5EK 3ZT3A 4Z4CA 2NUHA 4Q8FA 1NRKA 3CB4A 2HFOA 1FD8A 3VGLA 4A8MP 4CEOA 3MM5A 4ZA1A 4EP5A 1R27B 1PJ7A 2YWKA 3PJXA 3OTBA 3OSNA 2J6UA 3K2PA 3VZIA 1FD2A 3GR1A 2MGZB 2YNFA 2MKKA 1I39A 3GYNA 3ZC4A 2MQNA 4DV7K 3AARA 3BB5A 3HT0A 5DQIA 3T1YK 5LJWA 2O8FA 1E6YB 2MB0B 1K1SA 2FY8A 2DCLA 3PJWA 1ZBHA 5GVQA 5IM0A 3N79A 3N4WA 2R4FA 2FJXA 4H5VA 1GTEA 2Z8QA 4PQAA 1WUAA 4DN0A 2X7IA 1D9FA 3BR8A 4RW7A 2ROGA 3AJ2A 5KG7A 1F3VA 1CS4A 1S6UA 2GUIA 4RBTA 1VAZA 4X4PA 3VENA 5D0GA 1P1LA 3ZSZA 1Z1ZA 3M6WA 1HLWA 3RRKA 1YITN 2J8AA 2VG7B 1JWWA 4NXMF 5GAEP 2B0GA 1AB8A 4N56A 2FVSA 1RBSA 5LL6d 3T5JA 3ZSOA 5IWAJ 3CCUS 1HMVA 4JI2J 3J81O 3GV7B 4IFYA 1HHQA 1NGCA 3NGUA 1NUEA 2KFNA 2DIUA 5J1NA 4DR4F 4CGHA 5HBMA 3OYMA 4E2FB 2EFQA 2V5HG 2HOEA 4KHYA 4Z4GA 3RMBA 4A59A 2W6KA 2MEWA 4DUYK 1BE4A 4BC9A 3AAWB 4JI6F 4ENOA 1FJEB 4BR0A 2P9NA 4MK8A 2VA2A 2DR9A 3OTDA 3HVTB 4V19X 2OUGA 4LFAK 3R8EA 2YWHA 2KM8B 3KDNA 1YJVA 3KK3A 1ATRA 3IC1A 3I56N 1JL2A 1HNVA 1SB6A 4ZPAA 4YY3K 4R79A 2QMWA 4KB7A 4CQ1A 4J9QA 2UYTA 4P6QA 1RDCA 2AGQA 4ILJA 5J2QA 4HKQA 4M5LA 3W8GA 3THTA 3M8PA 4E1MA 3UNGC 3OTOK 4DV0F 3ILJA 5K8OA 2OSQA 1C1BB 2HS3A 3HJFA 2XLKA 3OBYA 1WACA 5I3QA 1U0HA 3TX8A 2W41A 1WOPA 4YB5A 4JD2A 1V3SA 3QSIA 1VLOA 2BBEA 2UVRA 2QE5A 4CJKA 4MKYA 3ZEUA 1S9FA 1KOHA 4M7XA 1H1VA 1EQMA 1Q79A 2HHPA 5GAHI 4DPXA 1RADB 4UY85 1BLUA 1U6ZA 2ZBQA 3IRWP 2IGIA 3IDHA 2G8KA 3EDQB 3MCOA 3IMQJ 4M3YA 2V2KA 4WFZA 3EE9A 3CCWA 2C1EB 3W5YA 3HM8A 2EWHA 3SMSA 2MSTA 1Q7YT 4O55A 2FHOB 3QJPA 4O0NA 4CIFA 1HD0A 2FB0A 3RRHA 2BOAA 4DS5A 3BQ1A 3L2QA 1C0GA 2GEMA 4QPXA 3QGHA 1RHRB 2XMUA 1DQ8A 5D8HB 3FGUA 3W3SA 2HLTA 1HNZK 4F4WA 4DI6A 4JB8B 4CM0A 3PRBA 2WTFA 1DTTB 2JX2A 2YH1A 4JI3K 1BQNA 4P73A 2BQ3A 2DNRA 3K59A 1FJGF 2E1CA 3TX0A 3CJSA 1P9QC 1G2EA 3MEKA 1R0AB 4DV5J 1FA0A 2OPSA 2ZFHA 3FZMA 2XRIA 5E33A 2XYGB 3FCWA 2OD4A 2OFGX 1XMOK 3T5HA 1V3ZA 3B6BA 4CZHA 1N5SA 4CF1A 3DWLA 1IBMF 3C6AA 4Q44A 2F8EX 1UMJA 4BR9A 5DZ7A 1TL1A 2W1BA 1MMDA 3DKDA 5HRNA 3O3LA 2ZH1A 1U2VB 3OHRA 1N36K 5F2RA 1HPZB 2P9UA 3J80O 2E66A 3CCMN 4FXDA 2POKA 2RSQA 3RVCA 1Z2ZA 5KPRA 3DLLQ 1G15A 2CQIA 2YY3A 2X51A 2VFSA 2DXDA 1NK0A 1K6YA 1DTQB 3PW2A 1ACMB 4B8AB 3MCAB 5EVZA 1M5SA 1TUYA 4ZCIA 1V4SA 3HYFA 2NUBA 3W0LA 1PAEX 3TUPA 2DBBA 3SAGA 4FZZA 1QAIA 4X62F 3CT9A 4ZS6A 3TTCA 5F8IA 4DR5J 3OVSA 4DR2K 5C25B 3JSBA 4TYAA 4E7IA 2YKMB 4LR9A 5EX3A 4CEAA 3HJVA 2LU2A 3HSGA 2KJWA 3HVAA 1SJ1A 4C8KA 4HI1A 1IKYA 1RHMB 1LNQA 4PXDA 2HWTA 3MECB 2VBYA 4RWTA 1Y4ZB 2M8HA 4O23A 3H4DA 2HBKA 4IG0B 3IM9A 1T9WA 4KGKA 1Q86O 4PAAA 3W9HA 3U9DA 2QJ3A 4DLGA 2P5GA 2WVDA 3O9SA 3OFHA 4ZVFA 4UQTA 4FOEA 4UOFA 3V81B 3V9ZA 3LP2B 1HBNB 5CABA 3BO2A 4ZPWR 3CIZA 2P9LB 4J9VA 4IOAL 4QS8A 3THYB 5CY4A 1M0SA 4XEIA 4KREA 2BQUA 1EP4B 3KJFB 3KYLA 1QM9A 2X3DA 3VTIA 5HQ8A 3HXMA 4M63A 1X4DA 4Z4EA 3CJ9A 2HFUA 3M2UB 2K7JA 4FWRA 5CYMB 1WC0A 1X4BA 3KLHB 2Q79A 4M41A 2XI2A 4QOTA 3VTHA 4Z94A 3PFEA 1HL6A 3DRPA 4DV6K 1D0EA 3QRPA 1BUPA 2NS1B 4F4YA 1RAIB 4WIIA 3QSYB 3I31A 1TYQB 1S79A 4K4TA 3DOLB 1HKBA 2F4VK 5AQFA 4CGJA 4B3MF 1RTHA 3OYAA 3D28A 3HKWA 3TAGA 5J2PA 3MZIA 3OYIA 4G1QA 2IHR1 1KWMA 4BWJA 1VSIA 1S22A 3DAWA 3JTPA 2YPYA 3AVCA 1HNXK 3G2XA 3EZ5A 3H3OB 3M5RA 3WXIA 1BO5O 1FX4A 2E1AA 3NS7B 4CH0S 1JJ2R 2CWXA 3ITHA 1HYZA 2AEJA 1HR0K 4LQ9A 3KUEA 1KQKA 2MZTA 4CLPA 1HNZJ 3G0ZA 3ELHA 3QPIA 2MTLA 1FJGK 4B3MK 2E7WA 2XMTA 4ZOSA 4X64J 1LQ9A 1YX2A 2UUCF 4MT1A 1EKRA 3MCPA 1R8PA 3DLHA 3CJQA 3F41A 4IO9Q 5GADU 4FF1A 3H3NO 2QKBA 2EBGA 2HNDB 1Q0NA 2M4MA 3UKUA 4A2AA 2HRTA 3HPHA 1IWGA 1V6HA 4NXMJ 1UAWA 5D77A 1GLCG 1IWAA 4LF5F 2J9CA 3NGYA 1OKJA 3LA0A 1NH7A 4IDHA 1ICEB 2QLJB 2PMHA 1CJTA 3PW0A 4B17A 4FVUA 2CPFA 3PM9A 5KT5A 3GWCA 4CJ4A 1OIAA 2ZVIA 1VQ8S 2PC6A 3G8SA 4FCYA 1BMQB 4CZEA 3FR0A 2CQGA 3J80Y 4H03B 1SV5A 1NOZA 4B9MA 3P6YC 3D6FB 4QR2A 3S3OA 1WSHA 1NDCA 3EM1A 3MM8A 1HI0P 1YI2S 1H7WA 5I3UA 3Q8PB 4S0MA 1ULRA 2FGCA 4OGCA 4RUAA 3FZKA 2HHWA 2BRKA 4CT8A 4ES1A 2QMUB 1I1GA 3UDEA 2FD2A 1S5JA 4CJWA 2A1SA 2X78A 1VQNS 3AV9A 4JKEA 4XDDA 3ONQA 2DGWA 2ZWHA 4ANCA 2N82B 4K25A 3OFFA 4OI0A 4DFPA 4J2AA 3M8PB 3RBXA 2PA8D 1K8AT 3CI5A 3TA0A 2V63A 3J7AP 1Q8BA 3W63A 3ZZOA 3NEKA 3SUPA 5KG6A 3CC2N 1ATNA 1U0HB 2OA8A 4RG8A 5I42B 3EMTA 5KFCA 4ECWA 3QLHA 2GWKA 3L2UA 4IO8A 4PZVA 5M2UA 3RMDA 4JI6K 1ITPA 5AQMA 1TL5A 4ECVA 4RNFA 4IXCA 4KHRA 1FKAF 5A2QY 4ZTJA 1S9GA 2DHHA 5J2NB 4CJUA 1ZM3A 2CPXA 1TKXB 2WUSA 3ULDA 2J7KA 3MD1A 4URGA 1EQYA 2D0AA 3MEEA 3MWTA 5EN1A 4X2BA 1RXOB 3U1MA 3M8QB 3T1HF 3Q23A 3PW4A 2OD6A 4PYDA 2QWNA 2JLFA 3HDSA 5HMZA 4AL6A 2RJZA 2ZJPQ 2NZCA 3VEWA 4CBWA 2LEBA 4HACB 4CYUB 2J4RA 1BCMA 1Y64A 4CRJA 5LT5A 2ASPA 4FYDA 4A8KA 1IKWA 4CH7A 4Z4HA 1VSMA 4BC3A 1S4EA 3BGFA 3NCIA 3KK2B 3H25A 3H20A 3I0SB 3X3UA 4NMXA 2Z2LA 3C95A 1HHTP 2G8WA 2VDHA 3CCQS 2VU5A 4GMJB 2C2NA 2VWBA 4FOIA 1YQHA 3BDEA 1LFWA 1AZSB 1RT2B 3J81Y 3DHWC 1KR4A 2JZ5A 4KQZA 4EHTA 2M2BA 3OA9A 2JEJA 1UWAA 1KXPA 3THWB 3DNCA 4EHUA 3CD6N 2FQQB 3PDNA 1JJ2M 3HLUA 2VPYB 4FXVA 4OI1A 3LP1B 3R8YA 4W92B 2G0IA 3MR7A 1QVGM 1BUXA 3CC4S 3HCXA 2U2FA 4B9TA 3ET6B 1HBMA 3IXQA 5B8HA 4O0IA 2RUGA 2KI2A 3EGNA 4B9VA 4A61A 3OR2A 3BYRA 1YJTA 4PG5A 5E3AA 3AAQA 4ZPVR 5BPLA 2ZWPA 1CVJA 2HBMA 2PEBA 3RMAA 5JXSA 1X9SA 1TV6B 3QGGA 2DTUA 1OPZA 2Y3YA 4KTWA 1V5IB 1X4CA 3OJUA 2B9XA 5J1EB 3NBPB 1OYEA 4DSIA 1O1WA 2YI1A 3NAHA 1RDAA 4PUOA 2ATCB 3IAS9 5E3QA 5C0YA 5K9FA 4O3PA 1U1NA 1YIJN 3J80U 4OKJA 5MLCV 2WVBA 5RUBA 1T03A 1R6VA 5LXYA 4OYPA 2DRDA 3RB6A 1T9TA 1SBRA 3KLEB 3R5JB 3BN7A 2V4RA 2JSXA 3QINA 5AQSA 4LF7J 4TXSA 2RS2A 1RT6A 4M5DA 3UR0A 4ZVHA 3HPOA 4ZMMA 4JKBA 2QWQA 1DBDA 2ZH4A 1C0UB 3MTJA 4C11B 1VQLN 2PDAA 1JKHB 2K1RA 2YPZA 4BWMA 1W2BM 5L1KA 4HR2A 1SQEA 3CJ7A 3CYMA 3P5BP 1N33J 2UUWA 2VZ9A 5FRNA 1W2IA 2J5AA 1JQGA 2XZTB 1ZPVA 1Y0HA 2P6SA 2KZMA 4KHNA 2D7SA 1TYQA 4IO9L 4DR4K 2P2CB 2P9SA 4CGDA 3H98A 4DV1F 4ILMA 1NPPA 4U7UD 3C65A 5TKWA 4RW9A 3RB3A 3G8TA 2RNEA 1J27A 3GV5B 2QTDA 1U1OA 2AYEA 3UPFA 2D3ZA 3MN5A 1R7IA 3HHKA 3A5MC 5C10A 3CQXA 1ZZNA 4XH1A 2HYIB 3THXA 3QO9B 2MZJA 1Q9XA 4K8RA 5KFBA 3OYGA 2JL9A 2FXUA 3V4IB 4ETZA 4WYLA 2XEXA 4NLWA 1NBEB 3ULEA 1WSRA 1PSDA 1YHQN 4TLRA 1BI4A 4Y1DA 3HHLA 4K4YA 2RHKA 1LKZA 1RT1B 2WOMA 5DG7A 4PKDB 3NOGA 2E5LJ 1JXEA 1SKRA 2JEGA 1RT3B 2IFXA 2ZUGA 3NGTA 1J5EJ 4AHSA 2CG8A 2QA2A 1G4CA 3HVWA 1KDNA 3X1LB 4I6MA 3CTRA 4J2DA 4LRDA 3SUNA 2CPEA 1OQ6A 2ILZA 4LF1A 3EN9A 3ID8A 4A5BA 2VQEK 4HLBA 4WBFA 3GV8B 3T9NA 3JSYA 2QK9A 1RBLA 2VQEF 1OH7A 4CD3A 4A8FA 4DU7A 1U24A 2ZM6J 1CLFA 2FTRA 2H48B 3M30A 2D3UA 1NM1A 1RTJB 5GAGI 3CCSN 2WSEC 1VOMA 2PZSA 3V9SA 3H5YA 2NRZA 2DYAA 3Q7BA 3RJMB 1F6TA 1MWYA 4WKYA 4EU0A 2N7CA 2PBDA 5AJ3J 1U02A 2ZKTA 3EGVA 3L95X 3E01A 2KT3A 2QG9B 3OL8A 3VGSA 2XCAA 1NJXA 4FJGA 2B5JA 3DDNA 3PX6A 3EO3A 1MW7A 1YG0A 3O1BA 1IG9A 4BGAA 3I87A 2YTCA 1Q78A 5I3UB 3M9OB 2HNZB 4I6YA 3TTDA 3V9XA 2LA4A 3PZPA 2NPFA 5AQQA 2PAVA 4XK8C 1BDGA 5BJRA 4OQJA 4ZPTR 4BE2A 3AVGA 2F1FA 1JLQB 2RQKA 4ECQA 4JHDA 2LLZA 3DJCA 2FSJA 2KJVA 4USTA 3D67A 2GQ2A 4ZVOB 5AE1A 5JLHA 1DQAA 3SLCA 4X84A 3DM2A 5EGYA 1MSWD 4FM2A 2P9EA 2AYBA 1F5CA 3D54A 4OJGA 1H2VZ 4LF7K 2IPOB 2NRHA 4I6AA 5K14B 4KYZA 3OSPA 2GMLA 3BP8A 3EZOA 3IS9B 4B1VA 2B3TB 4C48A 2YHWA 2QFJA 1IUJA 4RJVA 2BGGA 2DCUB 2IOCA 1YT3A 2UXDK 3PHEA 1N32F 4X64K 1S0OA 1NZAA 1ZA2B 5EY4A 2VOOA 2GCFA 2R8IA 4X66K 3R5GA 1FRHA 4GVLA 1UJ6A 1Y5NB 3MM8B 2FC9A 2YNGB 2A10A 4EBEA 4CBUA 4HUGA 1HBOA 4ES3A 5G0RA 4ZHRA 3O5TB 1YXQA 5CXTA 2HWIA 3HI0A 3FKBA 3IAM9 4H0PA 2JDJA 2R2SA 1HKGA 2RPIA 2ZNZA 3H90A 1CLQA 1IQZA 3KHRA 1MN9A 4B3OA 4H4KC 2COLA 4PR6A 2C2MB 4OPKA 1H98A 1EZZB 4QIVA 2UXCF 4ISFA 1VQMN 2NRVA 2UV8A 4IYQA 3T5KA 1RA7A 2CGJA 1YSJA 4P52A 1ZZFA 4RR5A 3OTOJ 1VQKS 4JK7A 2ZH3A 3ZT1A 3JQMA 1SAZA 5F8GA 4GKJF 1VSLA 1SJ3P 2L9WA 4FJMA 2V4QA 3NCPA 5C42A 3EKUA 1HFEL 4AF1A 4AL7A 2OTLS 1VSEA 3MOZA 4KR0B 3GIRA 4B8CA 2QC3A 3MMAA 2WTUA 1IQTA 1K1QA 4NXNJ 4Y34A 5DM7L 2ZBCA 3FZLA 2AU0A 1MWQA 1BQNB 2OSRA 3IM8A 1S1UB 3WEEB 3S9HA 2HHHJ 2CGLA 4I56A 2CJXB 4DL0C 1U47A 4XO0A 4Y28C 2DGSA 1KD1T 5JS2A 1KS2A 1XQIA 1YVNA 3OT9A 1O0PA 3UKRA 4KGXB 1HWUA 2CQ4A 3NVKA 2O8DA 3J7Z5 1NGFA 3PFOA 3DLKB 3CCVN 3KLEA 1PBAA 2DNOA 3QAEA 2IC3B 2V8PA 3ADAC 4Q2LA 5I42A 4Q5VA 2IVYA 3R5CA 4ID1A 5CR4A 2BJEA 4OHVA 2Q43A 2X6SA 4M3XA 2M0GB 1K8AO 1XR5A 3MN7A 5E5NA 1QHAA 3O9RA 4DV7F 4JNEA 5KFKA 3HI9A 3BQ2A 2ASJA 3GYXB 2E9ZA 3O1WA 2R8KA 3ZZTA 4ECYA 1R43A 3MAAB 4USMA 4NOHA 2D5RA 1SIZA 2E1ZA 1TL7B 2FHMA 3MPWA 4P72A 3ZT4A 1Z6RA 4OX8A 2HW3A 2HHSA 3M8YA 2DNZA 2OFHX 4FZVA 5C2FA 1CJUA 2J0WA 3NY0A 3G87A 1IKVA 4LFCK 4YHHJ 1RT6B 5HANA 5KTQA 2JH3A 2VG6A 3UE5A 5DG9A 2YX6A 1VQ8N 2HF3A 4MO4A 3POTA 3J7A1 3T1YJ 2FGOA 4OMFG 4MK7A 3VAFA 3PIPL 2BM1A 3GCWP 2VA3A 1KVKA 3DCAA 1RGVA 4CLUA 3VQ7A 3PRVA 3ISND 3QZ7A 3N6NA 2MKIA 2RHQB 3HD2A 3H2VE 3ZZRA 1JXLA 4BRLA 4IFVB 1FRJA 3CHWA 2Q6CA 4F25A 5F3TA 4PG4A 3Q2TC 2VQFJ 4CLTA 5F8NA 1RWVB 1X9MA 3R5BA 5HROB 4B1WB 3RAXA 5DDQC 4ED1A 1WF1A 1YWXA 4AD6A 1I94K 1JLAA 4DR7K 5KFXA 2V94A 4HL9A 3K58A 4FPAA 1VYAA 1KVJA 3CD5A 4HTIA 2VUGA 2OMOA 2HHHF 2GIFA 1VQSA 4LVNP 1WBDA 4N7TA 1KONA 3LDLA 3LPTA 1HYSB 3KDOA 4JI2F 3DDKA 3O2IA 2CFXA 1FK9A 3FSXA 2M7SA 1F9HA 2R9LA 4FW1A 1DQ9A 4Y65A 2FJEB 1IBKF 4DR5F 4PG6A 3PYGA 2ZE2A 2D41A 4FWPA 1KLMB 1EX4A 1Q4RA 2R2TA 4X65F 1HIYA 2PE8A 1DAXA 4JYAJ 1BWVA 4E1JA 4DV3K 2P9SB 2HNYA 4H0VB 2IIHA 2FC8A 4KFBB 1VC5A 5AQLA 3E8OA 2DNHA 4K4SA 2UXCJ 2IVNA 1IBMJ 3MMBA 3QWPA 4DR4J 5KT3A 2VG7A 1AUSL 5IQQA 1A6LA 4YY3J 4IDKA 4NLBA 3FE1A 4JI1F 2HKEA 1OYDA 3A0IX 4M5HA 2FBTA 1B92A 3AVMA 5KFEA 1VJQA 3Q8YA 3W9JA 5B0GA 1FXLA 4CO4A 1V4TA 1DFDA 2MJNA 1H72C 1NMEB 4DUZF 3UDVA 1P1TA 3IWNC 4KSEB 1WHWA 2CJ9A 4W98A 4CEZA 3C6UA 3K8VA 2J0QD 1JX4A 4RW9B 1F5AA 1D3WA 1RT7B 4ILGB 4ED3A 2BJ9A 2R7QA 1QDUB 5AZJA 3BPDA 4CH1A 3OS1A 4WXOA 1X4GA 2F63A 4HDGA 3GDQA 2X1BA 3L3CA 1JLQA 3HVTA 1HR0F 3D5MA 1HJOA 3BGUA 4UY8O 1KC8T 2F5GA 1NKEA 2V4JA 3KNGA 3TZXA 3PUFA 3NMRA 1HNXF 4B3RK 2DHSA 3VPZA 1XUPO 3CD0A 4C8MA 3EX7B 4OHXA 4B3OB 4ERDA 1FNMA 4MIBA 4JBCA 1YK9A 1RHUB 2MKCA 5L1LA 2FVCA 4OYWA 4KIAA 1YJRA 2ADBA 1IBLJ 2YCHA 1N4LA 2J0SD 3RBZA 3AD9C 3WXKA 2M70A 5BRFA 3ZTSA 4UOCA 1FKPA 3ZFVA 3M1VA 1VBYA 2W8KA 3CCUN 3FZ2A 3KUGA 4J9SA 3W2VB 1WTFA 2IM0A 3C8YA 1N5YA 3AXKA 1RDBA 4C8ZA 1K0TA 2YX1A 4I64A 4YB6A 5H9FJ 4LMZA 3LDSA 4CHPA 4AM6A 2DNPA 1E4FT 1T8EA 4F67A 1ZBSA 4AQYF 2DNQA 4HI2A 3TJ9A 3NMAA 4E7HA 1OJ4A 4P75A 2PT0A 1NGAA 3NRBA 2W4CA 4OZJA 5J2MB 1HW8A 3DLJA 1V3RA 3D7SB 2IVPA 5HOOA 4IFYB 5AE2A 1UW9A 4RW6A 2BR0A 2GAGC 3QNNA 4IRDA 4KKOA 3D66A 5ETLA 1HNWF 4RL1A 3R3LA 2OP5A 1WHXA 4GV6A 2K06A 2O01C 3BGOP 4NYFA 1LV5A 2HBJA 4CJSA 3AD7C 4O3RA 2BM0A 3HK2A 4LF2A 4PXBA 4ZP6A 1X60A 4OPAA 2MLZA 2WB4A 4J90A 1UVIA 4H8KA 2XYPB 4ZCLA 2O66A 4M94A 2NRXA 3I82A 1UVMA 1SJRA 1VI7A 2AJ2A 2XYHB 2BUPA 4CNZA 4L8RB 3AB4B 3CJKA 4X62K 4MDBA 4FJ5A 4AHRA 3D2EB 5M1PA 2A6AA 1CC7A 1VRTB 1TTHB 2FZKB 2JLGA 4BE0A 3PW5A 5KOXA 3K5LA 2BJDA 4ED0A 1JMTA 1JLFB 4P7VA 4BRPA 2QL9B 4ZPDA 2IMWP 2BE2B 4EO8A 4Q8EA 2O1PA 4W4MA 2B4UA 1SL2A 4PA1A 4WXWA 4MYTA 4JD2B 4FVMA 1U2CA 1KTQA 5SWMA 4ZLNA 2CQHA 4CHOA 2KFZA 2DH8A 1L3VA 3UVJB 1N33F 2BRLA 2CDRB 3OL9A 4YOWA 1QE1B 2G13A 4ED7A 3LQVA 4ZJQA 3ZX0A 5ETRA 1QY7A 4QR1A 2NXUA 4C0BA 3CFRA 1S77D 5A8KA 5B0AA 2DB1A 4WQ5C 1FT8A 5KFGA 2A2CA 1O6XA 3AVFA 2FZCB 3SFUA 3CPWR 4BACA 5KOWA 4PKIA 5AQNA 2W7OA 2V67A 3FVYA 3O80A 2X1GA 4UOGA 2X74A 3CCQN 3LH2S 4USJC 4CP5A 1GLBG 2VFTA 3BGLA 3H5SA 3NH1A 2B8QA 4O0JA 1HBNA 1Q8KA 1FEEA 1WUUA 1VQON 4NLDA 3JQKA 4CJEA 2J7UA 3C15B 1RT4A 1EB0A 3N4PA 2RT3A 2PFUA 4OHWA 5EU7A 5IV4A 4CJ3A 1SC6A 1GTHA 1Q86T 2LA6A 3CCSS 2MGZA 5AQHA 2NZTA 4R0JA 2DHGA 1QVGR 4LSNB 1IJEB 3AVJA 1OH5A 4JI7F 3LM2A 1KVCA 2RIJA 5AQWA 1BQXA 2PGCA 4EYHB 3K0SA 2VG5A 2P9CA 2JRSA 2DNMA 2QW9A 2L3MA 7FDRA 3DN9A 3IR5B 3FBCA 1YITS 2G2YA 4H5WA 2KW4A 2AEFA 3DHXA 1VQLS 1RU1A 4X64F 1N32K 4B02A 3M2VA 2Z1IA 3TEGA 4KB1A 4WE1A 4DF4A 1VISA 1G3OA 3RU0A 3NOCA 4DV7J 3L9ZA 1FDDA 3TUIC 2ZD1B 1CJUB 2G2ZA 2HQDA 1X31C 4GVBB 1XMOJ 1TR0A 3A12A 1TVRB 5DGAA 1RTIB 1HWKA 3ENVA 2HPUA 2KXNB 3O3HA 4WPAA 2AW0A 4MLEA 2ZJQQ 3NLCA 2K7KA 5DDRC 5LMUJ 3TTFA 4G9ZA 4OV6A 4HTJA 1KTVA 1XNRK 5L39A 5U47A 3CCJS 1NXIA 1SKSA 1MMNA 2UVUA 2HFNA 1GLEG 3JSRA 2ZH6A 3SQ2A 4DTXA 2OTJS 3O08A 2JVRA 3K2YA 5AFUH 3FRYA 3LWMA 5HI7A 2WVFA 3LUYA 3ZETA 1VQ6S 1IKVB 4K4WA 2DGXA 2WBRA 1NSPA 4USHA 1WWHA 5H9EK 3H45C 1NK9A 4KH5A 4LT6A 3MR3A 2CVEA 4FS2A 1U4BA 4YDUC 5D3GA 3Q86A 5JICA 5FD1A 2IM3A 3AO5A 1S99A 4H0TB 2O8FB 1IN0A 3B4DA 5BN9A 3VQAA 3O1LA 4DPUA 4KH4A 4I2QB 4LSLB 2HVZA 4RBVA 3I6PA 4O44A 3WNEA 2B4VA 3PR4A 3N0VA 2D0BA 4WCEQ 2ERRA 3G6VA 4Y2KA 4E1NA 4KHPJ 2HBQB 2XNRA 5CQGA 3JTOA 3BSNA 3SBGA 4K4ZA 4OZ1A 4CEFA 2ASYA 3TAFA 2OTJN 5B7WA 1RILA 3S41A 1UL3A 2RMLA 1L3UA 4QYZK 1HWJA 5I9EB 2N3LA 2C3YA 2X1FA 4H0OA 4DQQA 3ZO7A 1QVFR 2QLXA 4DCOB 1JCFA 4X65J 3SUOA 1RWNB 2Y8YA 2MQQA 3CJ1A 2UZAA 4FJ9A 2DR8A 3QFUA 4WIQA 1BIUA 3QESA 3UD5A 3CCVS 5CH7B 2FJVA 2HGMA 2B7BB 3SSQA 2VGMA 2NYIA 5IC6B 1KLMA 4EP4A 2Z56B 1NMNA 1AW0A 1NPRA 1RTZA 2ADCA 3DOLA 1H0HB 3RR8A 2LCWA 3M1VB 1L3TA 3Q83A 4CM2A 1I94F 3CCRS 3FCHA 1C0TA 1UEVA 3H5UA 4QW8A 3VAKA 2KT5A 3BH6B 3FQLA 1VK3A 2IA0A 3M9MB 4JV5J 3M1FA 4EO6A 5F9LA 3MI7X 4WFAL 2JEFA 3D0GE 3NCQA 5A8WB 5J2NA 1NDLA 4MAKA 2VIHA 4A5AA 2EWSA 3HD1A 4A62A 1T7PA 4OI3A 1S1TA 1ZH5A 1JJ4A 2X1AA 3M8QA 2VF3A 4Q0BA 3DGPA 3D0HE 3QEXA 4LFCJ 3NGIA 1VRTA 2BKPA 4NLXA 1HNWJ 1QD1A 4LBHA 5B0FA 3EPGA 2E2QA 1BU6O 3F9KA 4CO5A 1MMLA 5FPMA 1J9AA 4TYBA 4PKGA 4YQWA 3VETA 3CFPA 1BC6A 3NKYA 4QIWD 1GOCA 5L1IA 1S0MA 2PO4A 2VB6A 1EIYB 4BVOA 1URNA 1ZAVA 3A5LC 4X66J 4KRFA 1EETB 1NH8A 3H7HB 4CLLA 3KLFA 4ED8A 1FNOA 3J81j 3D6MB 5A0YA 1BWEA 1MLAA 2V9KA 2KL8A 3FSYA 4FWNA 3KJQB 4O8UA 4CJQA 4L6V3 4BRDA 4CZMA 1Q95G 2JHEA 1M1KT 4CZLA 2VOPA 4KV8A 4CK1A 3QERA 1U2VA 2IM1A 3VCDA 2GX8A 3VF6A 4DEZA 1LWXA 4E3SA 3WXMB 1ZM4A 3LDNA 3MM9B 5DM6L 3OW2M 5GAHU 3EKSA 2NR0A 1XNQK 2E2NA 2VBXA 4LF9K 5A2QO 4K5SA 1MROA 4AYBD 1KFDA 5KFNA 4JRQA 2CNNB 2KDOA 4RWXA 2BANB 2XHCA 2PI4A 5F41A 1DRZA 1HX1A 3TVZA 1XC9A 5E26A 3KKRA 2MY7A 3G71N 3NE6A 2RQ4A 4DTJA 2MPUA 2W8LA 3DYAB 2B4PA 1LAVA 1QHTA 2ZGYA 5HRPA 4DX6A 1WBBA 3CJRA 3UI3A 3E1YA 2Z57B 2DO4A 2KKHA 4WJBA 4DR6K 3TRGA 1P8GA 3G82A 1B0VA 2CYYA 3CCRN 1VSKA 1N36F 1KAYA 3TUJC 3MMJA 1U2RA 1UVNA 4OX9F 2BH1A 3M2VB 5DMRA 1AYEA 4DV2K 4ILHA 4HWIA 3N01A 4F9OA 3CC7S 4JLHA 4FM0A 3MGJA 5CZ2A 3MDFA 3BGRB 3JS6A 4I2PA 5I3PA 2U1AA 1TL4A 1IBMK 4J9UE 2HRYA 4X4OA 5KAKA 3GR0A 2JGUA 2C3UA 4AFFA 2PD1A 2HIQA 3EVMA 3VQ4A 1X3MA 3CCTA 2E9RX 4IG3A 3G4SN 4KT0C 3K5NA 2EG1A 2ZBIA 1Q82O 3C7NA 3NBPA 2MZ1A 1NAQA 1NK7A 5IQ6A 5EX0A 3MFIA 4CJRA 4QQBA 3FDSA 3VAIA 1VLYA 3EEQA 1FRLA 4PPZA 1RBTA 1W7WA 5JVHQ 2XMJA 3BZKA 5HMXA 2OPQA 1VBZA 1U04A 5DZ6A 1NGEA 5E0OA 3CCLN 2VONA 2P5VA 3PNIA 1WC1A 3FMBA 2KLAA 3R1HA 3NNHA 1RAEB 3TAQA 5KFDA 4OJ1A 2QZ8A 1S1XB 4EGLA 3AVHA 3MN9A 1VQYA 2DEIA 4CNYA 2UXBK 4Y2CA 3THXB 4RUBA 2CQBA 2FPHX 2A2DA 2QLFB 4BR7A 3U9ZA 2G8UA 1K73O 3ULEB 3OD2A 5M1OA 2D9OA 5DK5A 1K44A 1VQ9S 3WC0A 3RYLA 4WFXA 4ELVA 3NG8A 3K5OA 3GU0A 2F9DA 4OZ5A 1RT3A 1XMQK 3HOSA 2YQ1A 1Y3JA 3IP0A 2PY5A 1WI8A 4C7QA 5IFMA 4RPFA 3C0BA 1KVIA 2DHAA 5L9NA 4FYVB 4OYOA 1R89A 4BRQA 5C24B 4WYBA 1KAXA 1I94J 2BE9B 2HK3A 2UUAF 4PL8A 3V2UC 4U8YA 3CF5Q 3VMFB 4LJMA 3OUYB 1U8WA 2UU9F 4FLUA 4OLOA 1IJFB 4NA2A 1AA1B 1L3SA 4QU6A 3A8JA 3I96A 1JCGA 3E3XA 2HQCA 3SCKE 4FZYA 3N6MA 5E3CA 3FBFA 3BSCA 3V9UA 4JRPA 4YY3F 2YX4A 3A8EA 3AO1A 2R7YA 4CZFA 5F1XA 3LPUA 1QSLA 5IT9O 3V81A 2CPIA 3WXJA 2GGPA 2DR6A 4I69A 2GWJA 3QRQA 4J9KA 4KE5A 4OI6A 4GO7X 4LFBJ 3VERA 1B4SA 3ISNC 1ZM9A 1FWPA 2EG2A 3M32B 1HI8A 1UKUA 2GO9A 4AH9A 3T3FA 3FLCO 2R42A 4F4XA 3GSIA 4B3SK 2BW2A 3WIVA 1HWLA 1RZMA 1FERA 2CJYB 1NKBA 3QEIA 2E4LA 2K1RB 3L7OA 4ZP7A 3KLHA 2CZVC 1CQNA 2RE2A 1IM6A 4OYIA 2A3JA 3TZZA 4NYZA 4I7FB 5GADI 3DRPB 3QBCA 2ZJRL 3PX0A 3EL2A 3T6BA 3T1AA 5AQIA 4PEOA 4RTFD 2RRAA 4O44B 3CGIA 4DL5A 2MJUA 1VHFA 3FBEA 2KU7A 4LF6F 2XSJA 4DR1F 4CJVA 1VQNN 4G1QB 1YUWA 2P6TA 5CAAA 3GCXP 1RWUA 5HVFA 3HFVA 4DV2J 4LIRA 5C5JA 2HVDA 4JI8J 4DUTA 2LKZA 2B7CB 2KRBA 1RSCA 4OJHA 5CA5A 4DN9A 3L7UA 3LM9A 4OFZA 4JV0A 5FDLA 1D9AA 4B3SF 3O4WA 4I9QA 2G4BA 4Z4IA 3HOTA 3J7AN 1VQOS 3PX4A 3LDQA 1UOCA 1MWMA 3PW7A 4DX7A 3AA5X 4NCBA 2EPIA 3G6XA 1XNQF 5EXWA 4DQSA 4PWDB 4CZIA 2O67A 3M6VA 4NLCA 4IRKA 3ASMA 1RJJA 1ZAXA 2AD9A 3FSIA 5ETTA 1XEZA 1VRUA 5DJBA 3UNYA 3UKUB 3VQ5A 3CMQA 4IRCA 4PXCA 4QOZB 1HUXA 1LW0A 5LJ5Y 4C2MA 1FXDA 3MCNA 8ATCB 4J37A 1EWQA 2UU9K 4TLQA 3F56A 4NZ7A 1QS4A 2UUAK 5BRDA 3AVAA 4OJRA 3MXJA 3GP9A 1U0SA 2KO1A 2RKIA 3QAUA 2IJRA 5K8PA 1J6ZA 4ID8A 1IBLF 3GTYX 2HBLA 3CDEA 4B3RJ 1KSPA 2VYPA 5HSPA 1F3FA 2VPWB 1SS6A 3CXCR 1J53A 2V34A 1KQSR 1CULA 4UW2A 2XY6A 1NNEA 1LAWA 5D6GA 2BJ7A 2P5OA 4JI4F 2XY7A 4C8YA 1WLJA 4XH5A 4YUDA 1RUSA 3M7VA 3SQ1A 1RTDA 2ZITA 2GHWA 4YR2A 2K3IA 1FVSA 4EFHA 4J2EA 2YKNA 2W25A 3D1OA 4DX8H 3MAHA 3IFRA 1ZA1B 2NQPA 2MY8A 2W2QP 1SQFA 5ITHA 5KFZA 4BC2A 2KG1A 3DI6A 2P1JA 4A8YA 5KT4A 2QWMA 4YOVA 1VDHA 1PO6A 4M5GA 3J7ZO 2DHXA 4ICLA 3CSKA 1AFIA 2K3KA 1QJHA 2VCPA 1GXTA 2GMJA 3E9OA 1L3KA 1GK8A 5BREA 4BDYA 1LK5A 3CMAN 4NASA 1T9YA 1P6TA 4KV8B 2YNIB 3VAMA 1W25A 3SCXA 4JV1A 3K57A 2VKZG 1XWLA 1WN7A 3KMSA 2ZJRQ 5ADXA 3PEHA 2W9BB 1JIHA 1X9JA 5BYSA 4CD1A 3A5OC 3RSEB 6FD1A 4BDZA 2C28A 3I4PA 2GVZA 2ROPA 4G1IA 1D8ZA 1Z05A 2HRUA 9RUBA 4AUKA 2AWZA 3UW1A 3MWBA 3L0QA 1RP5A 5FPNA 1RAGB 4GKKK 4ZVSB 3CUNA 4JI3F 2AZ3A 3V6DA 3O9QA 1NK4A 3UVJA 2Y9HA 1FDAA 5AXMA 4OZ3A 5KI6A 1SJ4P 1K0VA 4OL8A 1GMWD 1URRA 1A7GE 5D0EA 2RF2A 1GFWB 2OMLA 3H1VX 2W42A 3GQCA 8RUCA 4E7KA 1ZXOA 4M5MA 4NLPA 1T94A 4I1TA 1N54B 2EC2A 4CK3A 4QYZJ 1UWBA 1T3NA 3VEXA 2P9KB 2AEMA