3T1AA

Crystal structure of hiv-1 reverse transcriptase (k103n mutant) in complex with inhibitor m05
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
558
structure length
554
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Reverse Transcriptase
publication title Design and synthesis of conformationally constrained inhibitors of non-nucleoside reverse transcriptase.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 155
structure length 554
sequence length 558
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3t1aA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t1aA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t1aA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t1aA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3t1aA05
4K4YA 3IRXB 2W7PA 3HJFA 4CF2A 4DL5A 4C8NA 1HPZB 2OPSB 2YNFB 1RDDA 5KFDA 4ED2A 3V6KA 3NHGA 3RAQA 3QETA 1RT2A 3MF5A 4BACA 1KRPA 2BDPA 3GQCA 3CWJA 4H54A 1QS4A 3H40A 1Q9XA 4MK8A 4TYAA 2ALZA 3T3FA 2WOMA 2XI2A 1B92A 1HQUB 2WONA 3QESA 4CK1A 3OVNA 1X1PA 3OYNA 1RBUA 1TKTB 3SUNA 4B9UA 5C25A 1RT3A 2VWJA 2VG6B 3TARA 2R2TA 1KHVA 4FM1A 2NUBA 2D41A 2HHVA 4DTUA 3CDWA 4ED7A 3PJWA 1XI1A 1UOCA 4CHYA 1HQEB 2ETJA 1TKXB 3KLIA 3ASMA 4KV8A 4CHPA 1WSHA 1X9MA 3GV7B 4CECA 4FK2A 3OS2A 5KFQA 5F9NA 4CHNA 3T19A 3MR6A 3M8PA 2YNIA 3SUOA 2FVRA 1BI4B 1LAVA 5D3GA 1CZBA 1KFSA 4TY9A 4DQPA 2HHTA 1KLMA 1S9EA 4O4GB 1X9SA 4W5OA 4DLGA 1RDRA 3MR5A 3VQ5A 2F8TA 4DL2A 4R8UA 3IS9B 2F8EX 3L2WA 4J9LA 4FJKA 3LDSA 4F3TA 1JKHB 1JLAB 4DL6A 2KTQA 3LPUA 1RTDB 3SJJA 1TVRB 4FJ8A 1Y97A 3V9XA 3KJVB 1IKYA 4ID5A 3RMBA 4R0EA 3O4NA 3RRGA 4AILC 1JLQA 3KLGB 4ELTA 4EZ9A 3OYMA 4J2EA 4FLUA 2HB5A 2YKNB 1S9GB 4I7FA 4KHMA 5HBMB 3DRPB 3NGYA 1N5YA 5T7BA 4IFVB 3A2FA 3VQAA 1VRUA 2YNGA 1T7PA 4HKQA 3QO9B 2AQ4A 4RW6A 4Y34A 4JRQA 2QXFA 1N6QB 1RT6A 2D0AA 3D45A 5DQIA 4CF1A 4WE1A 4ECSA 2F8SA 2WHOA 3I0SA 1IKXB 1RBTA 4DS5A 5CYQB 3K5OA 4TY8A 4E89A 4CEBA 1S4FA 3V4IB 4ED0A 2YKMA 3HXMA 3UQSA 2VA2A 3KOAA 1KVAA 4QWCA 1BQMB 5HROA 2XI3A 3RBEA 4O44B 1LWEB 4J9RA 2RN2A 2VWKA 3MECA 4FZYA 3NL0A 4FK4A 5J2MB 4BE0A 1SUQB 3L2QA 1HNIA 4Z4HA 3IGVA 1JLCA 4Z4CA 4F8RA 1KFDA 2ILZA 2AX0A 4FJJA 5KFYA 4NLQA 2OPQA 4RW4B 4ZVHA 5CYMA 3TI0A 4EEYA 3OHAA 4Q45A 4URSA 3H08A 3AVFA 4CGFA 4K4XA 3PJXA 4BWMA 4LSNB 2RDIA 1VSFA 2XY7A 2HHUA 1S1TA 4FZXC 5J1EA 3K5MA 1RDAA 1XC9A 1UA0A 1REVA 1B9FA 5HP1A 1XHXA 4LH4A 2BQ3A 2HWHA 4OJRA 3RMCA 4MH8A 4CEEA 4PQUA 2G8HA 3ZSQA 1VSDA 5I3UB 2W9BA 4RU9A 1RT5B 2QV6A 4CJ3A 1ZTTA 2Y1JA 1IH7A 4ECYA 4CIEA 3OLAA 2R8HA 1J9AA 2D3UA 3OYEA 4DF4A 3VA0A 3G86A 1BCOA 3OYFA 3DLKA 3M8QB 4QPXA 1F21A 4CJ4A 4MKBA 1C0TB 2RF2A 4Y1CA 3QLHB 2GIQA 4KAIA 3LWMA 4CGGA 4FJMA 3E01B 1I6JA 3I8DA 4Q0BB 4CK3A 3DI6B 2HNZA 4IDKA 3T5HA 5HRNA 5JUMA 3ITHA 2D0BA 2OPRB 4CHZA 3KKSA 3O3HA 3HP6A 4M95A 4DQQA 3VQ8A 4CEDA 3HO1A 2ZD1A 3PW0A 2P5OA 3QNOA 4IG0B 2BQRA 2I1RA 4CFBA 1I39A 4AHRA 1U47A 1YVFA 2C2EA 1WN7A 3K5LA 1U49A 4CGIA 4BE2A 3KK2B 3KLVA 2HMIB 3GIIA 3PR5B 4FBUA 3Q8QB 4DTRA 5EWEA 4ICLA 2XGQA 4E7JA 4GC7A 4M3TA 2C22A 1Q8IA 2E9TA 4KHRA 1JLEA 5KGWA 4KHSA 1FXXA 2A1RA 4NYZA 3C94A 1RT4B 1T03B 4F4WA 4B9TA 4CJKA 3GILA 5L1JA 3DLRA 5KG3A 2J6SA 4DG1B 3VQ7A 3I5CA 2YV0X 1IKVB 3T5LA 1C0MA 1CXQA 3DLEA 4B9LA 3QGGA 1KLNA 1N4LA 2AGQA 2A1SA 4QAGA 1SH0A 4JV2A 3V9UA 4TLRA 4JRPA 1FKPB 4QWBA 1RYRA 4NCGB 1S6PA 3PV8A 4GW6A 3AVCA 3DRRB 4IFYB 3MXJA 4FLVA 3GV5B 1S10A 4OKEA 4MK9A 4CEAA 5J2QA 4DSLA 3I0RA 2HNYB 3I5BA 3MEEB 1CSJA 3EPIA 5JXSA 2X6NA 1NHVA 1FK9B 4M3WA 4E0DA 5DMRA 2YNHA 4CF0A 4CJUA 4KE5A 4Z4IA 2ASJA 1QQCA 2X6SA 4DTSA 4ECZA 4DSJA 4IRDA 3M8RA 1VRTB 3AVMA 4E7LA 5KG4A 3BSAA 1I3AA 4F2RA 3PW5A 1SH3A 1T8EA 3U3YA 5C42A 4GC6A 3OL6A 2R7YA 3TABA 1ZBHA 2G8WA 3NH1A 3M9OB 4F4YA 4I2QA 4TXSA 2AGPA 3PO5A 4ECTA 3C6UB 2AGOA 4H4MB 1TV6A 4F4XA 3NF8A 2UVUA 1T05B 4DSEA 1N48A 4F3OA 3H98A 4LY7A 3OY9A 3KLEB 5KFVA 3M9NB 4OLAA 2YHAA 3MEGA 3SV3A 3AO3A 2P5GA 5KGXA 4AHVA 4NLPA 3LWLA 1KHWA 4KO0B 1EETB 4C8OA 3PY8A 3NAIA 4F4KA 1RTJB 2E4LA 4FM2A 2XHBA 1NHUA 4DFJA 4CEZA 3K2PA 4LD0A 4RW7B 4NLOA 2G8VA 3IRXA 1A5VA 2IOCA 4H4OB 1L5UA 5DQHA 1HPZA 2OPSA 2YNFA 4B9MA 4OGCA 2FVQA 1CXUA 4K4SA 1EXQA 3FQLA 3V6DB 4MKAA 5F8MA 3UIQA 1D9FA 2EX3A 4KI6A 3V6JA 4OVLA 5KFHA 3C6TB 3KTQA 3LAKA 4NLWA 4E1MA 2V4RA 4M3YA 4ZP9A 4J2BA 1S9FA 1DLOB 4HTUA 4HUFA 1ZETA 2JC1A 3VQ9A 3K57A 1HQUA 3ZSRA 1SL2A 1UWBB 2B43A 2OYQA 1TKTA 5KFAA 3AO5A 2VG6A 3PX0A 2HNDB 3ISNC 4DL7A 1ASUA 5I42B 4C8LA 2R8IA 3KLHB 1Z26A 3DM2B 1HQEA 1TKXA 5KT5A 5KI6A 2WTFA 4O3RA 5KRSA 3NCIA 4R5PB 5KFMA 3QYYA 5KFWA 1BIZA 1LWFB 1QUVA 4K4WA 1BI4A 3CFOA 2DPIA 3WNEA 2XCPA 4NLYA 4URQU 1JL1A 2I5JB 4RNNA 4FLZA 2R8JA 4ELVA 1HRHA 1GX6A 3SI8A 3CIZA 4O4GA 1WSJA 3CG7A 5KFGA 4KI4A 4YP3A 4CF9A 3NE6A 2FBYA 2FLPA 3IS9A 4CK2A 1QAIA 4YR3A 4NCBA 1JLBB 5F8NA 1RTHB 3LANA 1JKHA 1JLAA 3Q8RB 3CM6A 2Y1IA 5KG7A 3JYTB 4NRTA 2UVVA 4M41A 3FSIA 1RTDA 3CJ2A 1TVRA 3KJVA 3G0ZA 3V1RA 4J9QA 4O3PA 3V9ZA 3SQ0A 3VQ4A 3OSNA 3KLGA 1JX4A 2IJFA 4OLBA 4N56A 3AO1A 4CGHA 2YKNA 1S9GA 1U09A 3LP0B 4M42A 4B8AB 5HBMA 3DRPA 3DLGB 4IFVA 4URGA 5DLGA 2XY8A 1O1WA 3QO9A 1Z25A 2Z1HA 1N6QA 2C2RA 3QEXA 3BQ1A 3N6MA 3AV9A 4EO6A 3OYCA 1Z4UA 1IKXA 5CYQA 2QK9A 1RDBA 1JXLA 4Z0UA 3V4IA 4E19A 4RNHA 3K58A 3MR2A 3VQCA 3VQQA 3AVIA 4F50A 5KTQA 2PYJA 4KHNA 3KK3B 1BQMA 4O3NA 4O44A 4PY5A 4Z4EA 1LWEA 2XGPA 5J2MA 1SUQA 1MMLA 2UUTA 1SH2A 4B9NA 4I9LA 3VQ6A 3ZSOA 2G8FA 3QEIA 4DTXA 4CFCA 1RBRA 4TYBA 3SPZA 4RW4A 5SZTA 5EWFA 4IRCA 4DTJA 1CLQA 1S1VB 4FCYA 5F9LA 1ZTWA 4LSNA 2IM0A 3RTVA 3VA3A 4FLXA 3HPOA 3H4DA 2PY5A 4M3RA 1TL1B 4CJ5A 1LW2B 4HCCA 1S48A 3CQ8A 3PW2A 5I3UA 1RT5A 4G3IA 3FDSA 1NJXA 4KSEB 1QSLA 1IM4A 3NH0A 2HHWA 4DLEA 3M8SA 1S97A 4E7IA 3DMJB 3MXMA 3U3GA 4CJEA 4ZPBA 3GV8B 3M8QA 1C0TA 2C28A 2FVSA 2E6MA 3HK2A 2AWZA 5J2NB 5KFSA 3QLHA 3MFIA 5DLFA 4NYFA 2Q3SA 2IC3B 2B5JB 3MAQA 3E01A 2RKIB 4Q0BA 4B3OB 3DI6A 5KFCA 1NNDA 3AO2A 2OPRA 2RDJA 4IKFA 4BE1A 1D1UA 3TANA 3PO4A 4K4ZA 1D0EA 3CDEA 1TL3B 4CJPA 5J2PB 4DF8A 4IBNA 1QSSA 1BCMA 1S0NA 1QTMA 4IG0A 1RT7B 5KFKA 4DSFA 2BE2B 2HHSA 1OS5A 1LV5A 1RAJA 1TGOA 3QEPA 4ED3A 5JS2A 3CDUA 3LP2B 3KK2A 4ZPDA 2HMIA 3SI6A 3RB0A 4Z4FA 3H4BA 3OYJA 4FM0A 1N56A 3PHEA 1JLGB 2UVWA 3BJYA 4I2PB 3ALYA 4KAZA 4CERA 5K14B 3F73A 4XPEA 1RT4A 1S1UB 1T03A 2IGIA 5KFZA 1RTIB 3KLFB 3RWUA 2R2SA 4DG1A 5L1KA 2FLLA 4IKAA 1IKVA 4E3SA 3SPYA 3OYHA 3PZPA 3DOLB 1R0AB 3E51A 3WNFA 3ZSXA 4MIAA 5DGAA 5CZ2A 1EP4B 4G1QB 1L3UA 4CHQA 1FKPA 3SNNA 4FLWA 3NMAA 4NCGA 2AU0A 4PA1A 1TKZB 5KFFA 4YFUA 1RILA 3MTKA 3DRRA 1GX5A 1J5OB 4IFYA 3IG1B 4N41A 2BRKA 3V9WA 5KFBA 3OJSA 2HNYA 4IG3B 4Q44A 3MEEA 1C0UB 3QZ8A 2V4QA 4K8ZA 1FK9A 3ZT3A 3HHKA 4K8XA 2O4GA 1RBSA 4CIGA 4RW8B 5SWMA 1HNVB 4NCAA 1SL1A 2B6AB 5F8LA 4NLVA 2ATLA 1EKEA 2KZZA 3HVRA 5KT2A 2UVRA 1VRTA 2AX1A 1JIHA 3PW4A 2JLEA 1KCFA 3HKWA 4LQ9A 2E9RX 2IJNA 3QERA 4CESA 4NLSA 2Z1JA 2XO7A 1NKEA 3LAMA 4FXDA 3C6UA 4CJRA 4H4MA 1RBVA 4J9OA 2VG5B 1T05A 1ASVA 2W8KA 3ZT0A 5KFUA 3NBPB 4KHUA 4J9PA 4ECXA 2V9WA 5KFIA 4Y1DA 3KLEA 5HRRA 3FFIB 2ILYA 3QEWA 3O3GA 4KB0A 2V0NA 2W8LA 3L2RA 3KMSA 1TKDA 1LWCB 4KTZA 2CKWA 4KREA 4KO0A 1EETA 5KFRA 4O0JA 1NK6A 1RTJA 4NLRA 3K59A 3WNGA 4IRKA 4FJGA 3RB3A 1MU2B 4RW7A 2FJXA 3L8BA 4FYDA 3H5YA 4YNQA 1UA1A 4WXWA 3OL9A 1BISA 2XWYA 4H4OA 4JS4A 3VQBA 4DQIA 2X78A 4FBTA 4MQ3A 1YTUA 3TR8A 3HVAA 2HHQA 4YMEA 2VG7B 3SQ1A 3EZUA 1S1XB 2WB4A 3V6DA 4WXOA 5F8HA 2WRMA 3OHBA 4NLXA 2UUWA 4Q8FA 3C6TA 1ZBUA 4XIUA 4CE9A 4HHTA 2OPPB 4XO0A 1JXBA 3AVHA 1S6QB 3KHLA 1DLOA 1C6VA 1HMVB 1BHLA 1UWBA 3CJ5A 2HNDA 3THVA 3OYGA 2OH2A 4K4VA 4NLUA 4RNMA 3NGZA 5DG8A 5I42A 1SKSA 3KLHA 1LW0B 1W9HA 3DM2A 1C1CB 4DFPA 3KIOA 3MEDB 1RT1B 1VK0A 1BIUA 4R5PA 4HUEA 2D7SA 3HVWA 4OKJA 4ECWA 4AHCA 1LWFA 3LPTA 1DTQB 4ZHRB 4IOBA 2QKKA 5KT7A 2I5JA 1WSIA 3OYLA 4Y3CA 3LZIA 3TAPA 3SUQA 4E1NA 1NOYA 4IH5A 3OYIA 3S3MA 5HLFB 3ZT4A 2G8KA 1JLBA 1RTHA 3TAMB 4TQRA 4KBIA 3JYTA 1XR5A 5FRNA 3PVXA 2W9CB 3RAXA 1Q9YA 2GUIA 4BDPA 3B6PA 1C1BB 4FZZA 1GOCA 3NAHA 2E6LA 3DDKA 1SKRA 1QHTA 1FKOB 4OPJA 3QIPB 3UDLA 4DTMA 2ZE2B 2OA8A 4MIBA 5JS1A 3N6LA 5F8JA 3NGDA 5KT4A 3LP0A 4CGJA 4DU4A 2FJVA 3DLGA 3MFHA 4X2BA 4AHUA 2FBTA 1EX4A 1XHZA 4N47A 4WZMA 2BGGA 4KTQA 2JEFA 1K6YA 2WCXA 3BREA 3LZJA 2IS3A 3RMDA 2QE5A 4M3UA 4LSLB 4Q5VA 2Z1GA 4J2DA 4DWIA 1IKWB 4CJSA 1WAFA 2FBVA 3D28A 3L2UA 4QWDA 3HYFA 3VQPA 1HARA 3ISND 3BGRB 3KK3A 2DFFA 5E41A 4ECQA 4K4TA 4CF8A 1BQNB 4PUOB 4K50A 2YHBA 3NF6A 4O55A 3ZT1A 1VSMA 4MFBB 3SCXA 4PWDB 3DLBA 2JEIA 1QSYA 3I5AA 4DTNA 2IAJB 4B9SA 4NRUA 3DYAB 3RMAA 3OS0A 2GBZA 1KSPA 4FS2A 3ZT2A 4EBCA 1IG9A 4ZTJA 1TAQA 4ELUA 3NH2A 2IMWP 5FROA 1ASWA 5KFEA 1S1VA 4LQ3A 1S1WB 2XY5A 1L3SA 1S0MA 4FJ5A 2BANB 3AA2A 4TSXA 4AHSA 1VSEA 3AVNA 1KVCA 4FK0A 1TQLA 4OPKA 1KTQA 1TL1A 4FJNA 4TQSA 2HVHA 1LW2A 4JV1A 3CFPA 1U45A 4EBEA 4EP5A 1RNHA 3DRSB 3HVTB 1YTAA 1K1QA 1SV5B 4KHYA 3SUPA 4E7KA 2Z1IA 3UPFA 3OYAA 3DMJA 4KB7A 3HL8A 5C24B 3CM5A 3OJUA 4DTPA 1GOBA 4O3OA 4LH5A 4J9MA 4DU3A 3NFAA 3H5XA 1C1AA 1J53A 2PYLA 3P5JA 2JGUA 5J2NA 4FJ9A 1HYSB 2IC3A 2B5JA 2FVCA 2ITGA 1RDCA 3AVJA 3MXIA 2RKIA 4ECVA 4B3OA 4KHWA 2DFEA 4ED6A 3GIMA 2BQUA 4ECUA 3BR9A 3FRZA 1TL3A 5KFNA 3BDPA 4C8MA 2HW3A 1RA6A 5J2PA 2C2DA 4M3ZA 3QINA 3JSMB 4YQWA 1RT7A 3NF7A 2BE2A 2R2RA 3KNAA 1WSFA 5HRSA 4W5QA 3AA4A 1BL3A 5FDLB 4BDZA 1VSLA 3LP2A 4KPYA 1DTTB 1WNSA 3CJ3A 4XPCA 3OYDA 4JLHA 2E9ZA 1JLGA 3H2LA 1S0OA 3S9HA 4H8KA 2LSNA 4CEFA 4I2PA 3KK1B 3DOKB 3V1OA 4QWAA 3RB6A 3HPGA 1QE1B 4KFBB 5K14A 2R2UA 1NK4A 1S1UA 1NK8A 1RTIA 5KG0A 3KLFA 2XY6A 4DEZA 1NOZA 5EU7A 4TN2A 4KKOB 2W42A 1JLFB 2EHGA 2D5RA 1WSEA 5DQGA 4RZRA 2GC8A 4CJFA 3Q8SB 1HJRA 3LP1B 3DOLA 1R0AA 4BWJA 4N76A 3NDKA 1NK0A 2KW4A 1EP4A 4G1QA 4B08A 3BQ0A 1XR7A 2BRLA 4M45A 2JEJA 5KG6A 4M3XA 4CFDA 4FS1A 1TKZA 2IM1A 4IH7A 3V1QA 3V81B 1J5OA 3AO4A 3IG1A 4RW9B 3M9MB 5DG9A 4O0IA 5KFLA 3EPGA 2GV9A 4EYIB 4IG3A 2J6TA 1U48A 1C0UA 2BR0A 4FJLA 4E7HA 3P83D 3TAFA 3OLBA 3TQ1A 2ZQBA 1RT2B 4RW8A 4DFMA 1W0HA 4W5RA 1HNVA 4C8KA 4Z4GA 5EWGA 3OYBA 2B6AA 2WOMB 4ZVFA 1RYSA 2DY4A 1C2PA 5L1IA 3Q8PB 3CJ0A 4F2SA 4OKKA 1HYVA 2WONB 2ASLA 3DLHA 3SV4A 1ZBFA 3AVGA 2IA6A 4U7CA 3AA5X 5C25B 1RT3B 5KFTA 2FLNA 1U4BA 4DL4A 3WNHA 5L1LA 1VSJA 1ZYQA 4CJTA 3KLIB 5KG1A 2O4IA 4ECRA 4KV8B 4FJHA 1TK5A 2ZKUA 2VG5A 3CYMA 1CZ9A 3LALA 3NBPA 4ZP6A 3RB4A 3M8PB 2YNIB 1NK7A 1VSIA 3FFIA 5D3GB 4CJLA 4AH9A 2KFZA 4DTOA 4GMJB 3L3VA 3L2VA 1ITGA 3V6HA 1LWCA 1KLMB 1S9EB 5F8GA 3G10A 3L3UA 2WK4A 2G8IA 4DU1A 2XRIA 3AVKA 4DFKA 4J2AA 3H5SA 4R8UB 3GYNA 4FVMA 2DFHA 4EZ6A 5KFPA 1MU2A 1D5AA 1G15A 4ZP8A 1UAXA 4DL3A 1T3NA 4FW2A 1IO2A 2B4JA 1IKYB 3CVKA 4ID5B 3UR0A 3OL8A 1JLQB 4FJXA 3QIDA 4HCBA 2VG7A 4CJVA 1S1XA 3N6NA 3V9SA 1LAWA 1NKBA 4NZ0A 1TP7A 4DSKA 4FJ7A 4I7FB 4MK7A 4ZPAA 4W5TA 4EP4A 3BQ2A 1N5YB 2OPPA 4WFXA 1VRUB 2YNGB 2IBKA 2HHXA 2DTUA 4RW6B 5C5JA 1S6QA 1RT6B 4KHQA 1HMVA 4O4RA 4WE1B 4CEOA 3I0SB 3S3OA 4JV0A 3EY1A 3NGIA 3G6YA 4J9SA 4WFYA 2O5DA 4TY8B 1WSGA 1ZBLA 4CJWA 4FLYA 4KTWA 2YKMB 3T5KA 3TAEA 1LW0A 4K4UA 2R8KA 4O5BA 2QKBA 1C1CA 5HROB 3PR4A 4CCHA 4DS4A 3HSTB 3MEDA 1L3VA 1RT1A 3F9KA 2KFNA 3MECB 3VQDA 2JEGA 3TWHA 3RR8A 3SYZA 1HNIB 2OZSA 2R8GA 4Q43A 2P1JA 4QCLA 1DTQA 4DSIA 1JLCB 5DG7A 3HPHA 4ZHRA 3LP3A 2HAIA 3KHHA 1XWLA 2D0CA 4B8CA 1NKCA 2OPQB 1NJWA 5CYMB 4IQXA 4U6PA 3AVLA 3OS1A 4JUZA 5HLFA 4OGEA 2CJQA 2HVIA 3EZ5A 1RA7A 1S1TB 3VQSA 5J1EB 1YT3A 3TAMA 1RCHA 2W7OA 1REVB 5HP1B 1W25A 5HRPA 4GVMA 4PQUB 2KZMA 2IM3A 2AJQA 1TK8A 3SQ2A 3FQKA 2W9BB 2W9CA 1NJZA 4RUAA 4NLDA 4WZQA 3HM9A 4ED8A 1C1BA 2X74A 2DPJA 2KQ2A 3CFRA 3G6VA 1FKOA 3H59A 3QIPA 2ZE2A 5F8IA 3SZ2A 1NK9A 5KG2A 4ID1A 3DLKB 5FRMA 4JS5A 2IDOA 2RF2B 4ZVEA 4ED1A 3H5UA 4CIFA 3HP9A 3QNNA 3QGIA 4LSLA 3B6OA 3IAYA 2EC0A 2HNZB 1IKWA 4IDKB 1K1SA 4O3SA 3ITHB 1XR6A 1L3TA 4KRFA 3QZ7A 2VA3A 2OZMA 3SFGA 3ZSZA 3QIOA 2J6UA 3PW7A 3BSCA 3KKRA 2ZD1B 4QWEA 3BGRA 3KD1E 4UQGA 4IH6A 4M94A 1BQNA 4PUOA 4ZVGA 4RUCA 4MFBA 3OYKA 4NLTA 4F4ZA 4PWDA 4EYHB 5CZ1A 5KRTA 4ZMMA 4RNOA 5T14A 1U04A 2ATQA 1VSKA 2IAJA 4J9KA 3DYAA 3GIKA 3ZSWA 3S3NA 2HWIA 3ICLA 4ICLB 5KT3A 4HUGA 2GIRA 4RG8A 1JLEB 1D8YA 3RBDA 4FW1A 4WYWA 3IN5A 5EDWA 3U6FA 4YR2A 1TAUA 3GIJA 2FC0A 1A5XA 1S1WA 5DK5A 3OL7A 2BANA 4CEQA 3T1AA 3PX6A 3PX4A 5CY4A 3CO9A 4HVJA 4ZTFA 3TAGA 2P51A 3DRSA 3DLEB 5KFOA 3HVTA 4NYNA 3IGNA 4KB1A 3KMQA 3QEVA 1WAJA 3PUFA 1SV5A 3D0PA 1KVBA 3KD5E 3AVAA 2FBXA 1NK5A 4IR1A 3AVBA 3RRHA 5C24A 2W9AA 1S6PB 3O3FA 4DQRA 3VN5A 2ASDA 3CJ4A 4HYKA 4Y2CA 4ZP7A 4CJQA 1HYSA 5J2QB 3OSPA 3I0RB 3BSNA 1TK0A 3D5MA 2G8UA 3MR3A 4OL8A 1BGXT 4CFAA 2PZSA 4W5NA 4RNFA 2IM2A 3HT3A 3NF9A 3T5JA 4FJIA 4ZPCA 2YNHB 3JSMA 4N5SA 4NLGA 1D9DA 3SFUA 5KFXA 4BDYA 4FLTA 1QAJA 3BSOA 4QOZB 1J54A 3O4QA 4B9VA 5FDLA 3VQEA 3NKYA 3TVKA 1DTTA 3ZSVA 4YR0A 3G6XA 1S49A 4AHTA 3SQ4A 3C95A 4CHOA 3KK1A 3DOKA 1QE1A 1T94A 1WLJA 4KFBA 4Q8EA 5C42B 2F96A 4WYLA 1B9DA 1JXEA 4IR9A 1GOAA 3KHGA 1JL2A 3P1GA 4I2QB 5KG5A 1WNEA 3AA3A 3ZCMA 4DMNA 3ZSYA 4KKOA 5KT6A 3EYZA 1JLFA 1TV6B 1S5JA 3TAQA 2FJWA 4EO8A 1SL0A 2JC0A 5EUHA 2FVPA 3LP1A 3QGHA 1HYZA 2XC9A 1A5WA 3KHRA 1X9WA 3RR7A 1ZBIA 3MEGB 1NJYA 3NAEA 5KFJA 3ULDA 4EBDA 4O3QA 4QW9A 4Y2AA 5L9XA 2D3ZA 4J9NA 4L8RB 3V81A 1VSHA 4CGDA 2RPIA 4DQSA 3K5NA 1SKWA 4RW9A 4I9QA 4WFZA 2XCAA 1YVUA 4QW8A 5DGBA
chains in the Genus database with same CATH superfamily
3EL2A 2ZDOA 3QT7A 3F2KA 2W7PA 3HJFA 2DGVA 4DL5A 1G1XA 1GK8A 2A0FB 2D0OA 4YOTA 2QWOA 3H2UB 3THYA 4JN4A 3MF5A 2LYVA 2QSWA 4BACA 2BDPA 3GQCA 4H54A 3H40A 1ZS6A 3G71N 2ALZA 3Q23A 9ATCB 3J7AN 1CC8A 4EFHA 5CAAA 4NMXA 3A1YG 3SCKE 4B9UA 1X1PA 1UJ5A 5C25A 2IYGA 2VG6B 1SJQA 3FBBA 2HSTA 1F5AA 3CDWA 4ED7A 4BHQA 2ZF5O 2KYXA 3EVOA 4CZGA 1XI1A 5B0EA 2ZJRL 4CHYA 1WEXA 1B0TA 3D1QA 2EC2A 4KV8A 2VFTA 4CECA 2G2OA 3HI0A 4MO5A 5F9NA 3T19A 1IXKA 1FJ7A 4DCOB 4CLZA 3M8PA 4BRMA 4M5NA 3M3ZA 2LQ8A 1CZBA 5C2FA 4NXNJ 5IV3A 1GLDG 1EQ0A 1KLMA 4CP5A 2YWEA 1RDRA 1Q0NA 1U1KA 3ZETB 3CE8A 3MI7X 4DL6A 2HHPA 3HRGA 3SAHA 2IBOA 4FJ8A 4Z2XA 3RMBA 1YITS 3LTOA 3OYMA 2ZGYA 2J7WA 1K9MT 4DR2J 4GO7X 2GMHA 4OYIA 3LO3A 1KONA 2DHXA 5HBMB 3MAAB 5C2DA 4IFVB 3A2FA 1VRUA 3GSDA 4RW6A 3DGPA 1CZAN 1N6QB 2D0AA 3D45A 3D9BA 3NGSA 4DS5A 5C2CA 5DJBA 2NZTA 1NLKL 3K5OA 2V2ZA 1N0VC 2FC8A 3KJQB 3V4IB 2YKMA 5FD1A 1YXQA 1NPPA 3KOAA 5CHCB 3SAFA 1BQMB 2ZH4A 3UKRA 3TSUA 2OUGA 3O3LA 5J2MB 2O8CB 1ATNA 4BRLA 3L2QA 1HNIA 2GJIA 1V3RA 2AX0A 1HKBA 2PEHA 3ILLA 2RDDA 2YPZA 4DZDA 4JKHA 2KFYA 4RL1A 3CC7N 2CNKB 4CGFA 1RU2A 4BWMA 1KOOA 2CJKA 3KJNB 4FOIA 2ZNZA 1S1TA 2DXDA 5FPMA 1REVA 1NEEA 1XHXA 2BQ3A 2CJAA 3RMCA 1UJ4A 1UVIA 4CEEA 4ANEA 2C2KB 1FD8A 2W9BA 4RU9A 4DU8A 1ZTTA 4ZIVA 3AQOA 3UKUB 3VF4A 3GFZA 5CZVA 3FBFA 1RKIA 1TUUA 4OO1J 1MWKA 3DLKA 3M8QB 4QPXA 1C0TB 2LFVA 1AT1B 4Y1CA 4O8KA 1YSJA 1G2EA 3ILJA 1G7CB 3QRRA 2OP5A 5D15A 4FJMA 3E01B 2PA8D 4CK3A 1O13A 2GQ2A 4I68A 5JUMA 2OPRB 4CHZA 3KKSA 1WWHA 4FWKA 3CDBA 1U6BA 4CEDA 1W2IA 2ZD1A 3PW0A 2P5OA 1VQ7N 1Q78A 3QNOA 4IG0B 2P9NA 2VJUA 4ZDNA 2C2EA 3SIPB 2O3DA 5ETRA 1RBAA 2HRUA 2LA6A 5D6GA 1JCEA 1TZ0A 1OQ3A 3PR5B 2HBLA 3W9HA 3Q8QB 1NB7A 2O8DB 2GHPA 3OD2A 4KHRA 2FGCA 2E9TA 5KGWA 4NYZA 3CHWA 3R2DJ 1T03B 5HAOA 4F4WA 3NP5A 4B9TA 4CJKA 3B6BA 1M5VC 2OCEA 4ZJQA 5L1JA 5KG3A 3U1MA 2DRBA 4DUZJ 1J5EK 1PG5B 3MM8B 2VHGA 3IBWA 1IKVB 2JWKA 2JX2A 5ETMA 1C0MA 3ZEUB 3DLEA 4A5AA 4CYUA 1CEZA 1LCUA 2A1SA 3FLCO 1SH0A 4FWLA 1HHTP 3WXIA 4NEYA 2DPNA 2EI5A 1RYRA 3H20A 3W2WA 1J5EF 4GW6A 2EK1A 4CO1A 3BEXA 4IFYB 4OKEA 3SBGA 2AYMA 3L7PA 1JCGA 5HMWA 2HFZA 1GXUA 3MM7B 1WHXA 1X4GA 3I5BA 3MEEB 1U0HA 1CSJA 3EPIA 2X6NA 1DQ8A 1O8BA 4OPAA 2XMUA 2NXNA 1ATSA 4KE5A 2ASJA 4DTSA 2X6SA 1XQIA 4DUYJ 3O2IA 4NXNF 2OD6A 3ET6B 1VRTB 2H54B 4E7LA 5KG4A 1UVJA 3NNAA 3G6EN 1I3AA 4A57A 4OI2A 2MLZA 4F2RA 4JKFA 4YB7A 2HLUA 4RWXA 2IVFB 2FPHX 3K89A 3U3YA 4GC6A 4ZN1A 3NH1A 1RWNB 3PO5A 3C6UB 2AGOA 2IA0A 3NF8A 2UVUA 3D2FA 1T05B 4DSEA 1D9AA 2CPDA 1N48A 1YJRA 2N4CA 4K43A 2RD5C 3LDPA 4OLAA 5SUHA 2CDQA 1RCXB 3MEGA 3AO3A 2P5GA 2K1RB 4AHVA 1VQ6S 4NLPA 3FGVA 4B3TJ 4KO0B 1EETB 3IR7B 3PY8A 1RTJB 4FM2A 1NHUA 2XZDB 1XNQJ 4H03B 1DEJA 3UVJA 1VR6A 3TX0A 2OJ3A 4JOUA 2Z57B 3SSQA 4NWBA 1A5VA 2YVSA 3T6JA 1JCFA 5DQHA 1HPZA 4BRCA 2EFNA 2OI2A 2YNFA 4OI6A 4ZCMA 2PAVA 3CXCM 3QJJA 2B4OA 2GA7A 2N7YA 2KJWA 4USHA 1NXIA 3CCLS 4N77A 3UIQA 2PFDA 3N01A 2EX3A 3V6JA 1SJRA 3KTQA 2L08A 2MZSA 3D2EB 4J2BA 5E33A 5C2GA 1RCOB 2F65A 3ZSRA 2YI1A 2B7CB 2Q79A 4IJAA 2QL5B 1ASUA 4C8LA 2R8IA 4GO5X 1Q16B 2ACYA 1OVQA 1K73O 1NGHA 1H7XA 4AE5A 5LSLA 4P2MA 4DR6J 1KD1O 4LF9K 4R5PB 2XMAA 1U0SA 3CD5A 3N79A 1BIZA 3I55S 2Y0BB 2MDAA 5CABA 1O0PA 1N36J 1SXLA 2I5JB 2CPJA 2Y0SD 3N28A 3QWPA 1FA0A 4LF9F 2LKZA 1GAOA 2AEFA 4CF9A 2FLPA 4QS7A 4Z7YA 3IS9A 4NCBA 1JLBB 2OEMA 5F8NA 4WFBQ 3LANA 2BJ8A 1JKHA 1JLAA 3Q8RB 2C3PA 4GV6A 4NRTA 4B3MK 2VBYA 3CJ2A 1TVRA 1SKUB 2QFIA 2ASOA 2DNNA 5HSPA 4O3PA 3HM8A 5HVFA 4ZKAA 3VEVA 4N56A 3BZQA 1U09A 4PYDA 2WBMA 4M42A 2PFUA 4B8AB 4JP8A 4B3MF 4PQAA 2OLWA 4UY85 4URGA 3QPIA 3QO9A 3BZCA 1WI8A 3K2YA 4DR7K 1H2UX 2C2RA 3K7RA 1RAIB 2DO0A 1Z4UA 1LEOA 1NSKL 3ZZRA 4H5RA 1FJGK 1JXLA 4E19A 3P5TL 2HYIB 2FIUA 3K58A 3VQQA 3AVIA 4DR7F 3ENVA 4DUZF 4KHPJ 1LWEA 2EWSA 4Z4EA 1Y5NB 3IR6B 2Z2ZA 2L3MA 1MMLA 3T9NA 1FJGF 4ZVSB 4Y00A 1F3VA 2RMLA 4OHWA 3ZSOA 2X3GA 2Q31A 4DTXA 2DVIA 3SCIE 2NZCA 1NGDA 1EWRA 2EG1A 4DTJA 3ULEA 4L75A 1X4FA 2GFFA 3I56S 2OSQA 4LVNP 3QT6A 3VAJA 2PSZA 4M3RA 3FMBA 5AXKA 4CJ5A 5MAOA 1S48A 2P9CA 1VQNN 3PW2A 1WOOA 5I3UA 4NZ6A 1RU1A 2E5LK 5B0GA 5ETOA 3IR5B 4KSEB 1QTNB 4DUYF 2F8MA 4E7IA 4CLKA 4MDAA 2FF6A 4ZPBA 4WQ5A 1V6HA 2C28A 1HX1A 1K8AO 4C4WA 2MKYA 1YJUA 3MFIA 4CD1A 2Q3SA 2QFJA 4B3OB 5ETKA 5BRFA 2CH6A 4JK8A 3AO2A 2RDJA 4IKFA 2HZAA 4BE1A 1RBOB 2P9SB 3PO4A 3MHYA 3C66A 4A8QA 1QTMA 1MNEA 1RT7B 5KFKA 4DSFA 1OS5A 1Y00A 1TGOA 5LJVA 4QIWD 2AJ1A 1REGX 4BY9C 3OYJA 1N56A 1JLGB 2NZ4A 4XH4A 3NWGA 1H1VA 3D6RA 1ZM4A 3OR1A 1XNQF 3AFGA 1RT4A 2IGIA 3CCMS 1Y4ZB 4ZVTB 4CI0B 2O01C 1R59O 3O1WA 2EFOA 4DG1A 1OPZA 2GWJA 5L1KA 1CPZA 4E3SA 3IRWP 3W8GA 2Q6CA 2AYGA 5CZ2A 1EP4B 1UFKA 3AY9A 2XEXA 3KUHA 3NMAA 4NCGA 2AU0A 2IJRA 4IYQA 5KOXA 3SLCA 4YFUA 3MTKA 4N41A 2AZ3A 5GMEA 2W4PA 3OXLA 1YJWS 3THXA 1EQMA 3V9WA 2GVZB 3OJSA 2HNYA 5EX3A 1CJUA 1C0UB 3QZ8A 1FK9A 1UP1A 3E3XA 4I6WA 4K8XA 1MMNA 1RBSA 4CIGA 4YOYA 3EDRB 5SWMA 1HNVB 3LL3A 1VC0A 4BVPA 4A8FA 4NLVA 2DJWA 2E2PA 2NQPA 1Q4RA 3P31A 4LVOP 2RU9A 3HKWA 4DBQA 4E8UA 5GADP 5HQ8A 3PACA 1KBRA 2G2YA 2XO7A 4EHUA 5LY3A 4LBHA 2O8FA 3ETOA 2RRNA 3CF5Q 3CJ7A 2BJDA 2CPEA 2W8KA 3IFRA 2ZH1A 4J9PA 4ECXA 1E6YA 4C11A 3TR5A 2ZBQA 3QEWA 3H3OB 4C3LA 1TKDA 1QQMA 1WOSA 3J81U 2CKWA 4KREA 2A5XA 5KFRA 4O0JA 2V69A 3GZ7A 1YK9A 3WNGA 3RB3A 4RW7A 3TSPA 4BS2A 3L8BA 2HK2A 4B1WB 4DV1K 1D4XA 3H5YA 4YNQA 5DETA 3OL9A 1BISA 4EAHD 4H4OA 1FX4A 2JDJA 3SMSA 4FBTA 2VOOA 2XWXA 4KHPF 3UE2A 4YMEA 1YLXA 3AXMA 2O8BA 5F8HA 2ZJQL 2WRMA 3OHBA 1I94K 2LLZA 2MQQA 2ZGZA 3C6TA 3X1LB 4XIUA 2EXUA 2PI5A 1KN6A 1MSWD 4W90B 3U9ZA 1S6QB 3CXCR 1DLOA 1YUWA 1BHLA 1F9EB 1UWBA 2YH0A 3CCUS 2HNDA 1I94F 3OYGA 5IM0A 3QT8A 4K4VA 4RNMA 3SCJE 2OTJS 4W4MA 3ENBA 4FXVA 3M6XA 1SKSA 5BYSA 1LW0B 3DM2A 3FEZA 3FCVA 4JD2A 3MMBB 1MG7A 1RT1B 3T69A 1FT8A 2IMOA 5D0HA 2W6KA 2MHEA 5EVZA 3I32A 2KB2A 3W3SA 1QQNA 3HFKA 1H7WA 2EPIA 2QKKA 3OYLA 4A8MP 1NOYA 2KI2A 4IH5A 2M3DA 2MPUA 3MCOA 3MWTA 4UT4A 1RSCA 3JB9k 4GRSA 3CUNA 3H6EA 3H2VE 3ELHA 1X60A 1BXNA 2DGQA 1F2HA 1XR5A 4CZMA 2RE2A 3O80A 4OZNA 3HBTA 1OY9A 2JNJA 1T11A 3CQYA 2JZ5A 2VFVA 3PYFA 1GOCA 2G1DA 3DDKA 1HWLA 1FKOB 2BBEA 3QIPB 3CJ8A 2F9WA 5JS1A 5F8JA 5CCLA 4FN5A 3NGDA 3LP0A 1NPKA 3QNWB 4A8YA 2A3JA 3DLGA 1F1BB 3C8YA 4AHUA 3H1QA 5EHHA 5AFUA 1K9MO 4IZ9A 2BGGA 3FSYA 1BWFO 4I6MB 2V6AA 1Q7LB 1NU4A 2IS3A 4M3UA 2QE5A 4LSLB 2Z1GA 1W2BM 4CJSA 3D6TB 3R5GA 2GO8A 1M90O 2BKNA 4CF8A 4PUOB 4RU2A 4K50A 4O55A 2JFKA 4PG5A 4MFBB 4M1KA 2HBKA 4HTLA 1UW9A 4PWDB 1N5TA 3I5AA 5A6PA 4DTNA 2G4BA 1PILA 4NRUA 3RMAA 2DGOA 1NGEA 3ZT2A 3I9ZA 1IG9A 4G6VB 3TX8A 3LW5C 3NH2A 2IMWP 2PBDA 2CQDA 3OBIA 4L76A 3MXHP 5BN8A 1Q8LA 1S1VA 1S1WB 2LXIA 5JICA 3QSIA 5D4NA 4AHSA 3CPWM 2A6MA 1NMEB 2M5YA 3MN7A 3MOZA 1TQLA 2IYIA 3VWSA 1TL1A 4FJNA 3CFPA 1RHUB 1RNHA 3DRSB 2VICA 2V8GA 3WEEA 1YTAA 4KHYA 3GTYX 3SUPA 3BYRA 4FNHA 2ZWOA 2E5JA 4CZKA 2Z1IA 1QAXA 4KB7A 1RHMB 5C24B 3HL8A 4OZ5A 1GOBA 3MMCA 5KQ8A 5AQQA 4DU3A 1TYQB 5J2NA 2V4JA 4HR2A 1HYSB 2FVCA 3TPQA 4KHWA 3TJ8A 2JLGA 2BQUA 1WHWA 5AQTA 3J8AA 3BR9A 3R8EA 5J2PA 1RWOB 4ES3A 3QINA 2C3YA 2ABYA 4YQWA 3TVYA 5G0RB 3NF7A 4LF1A 2XMKA 2BE2A 1FDNA 3KYLA 3AA4A 2FSKA 2CA9A 1S3XA 3HI9A 3OYDA 4JLHA 1HNXK 2I6WA 3A12A 3H2LA 1V9OA 2XSFA 3QBWA 1WEYA 4QWAA 3RB6A 4X4SA 2R2UA 5AQLA 2E2NA 2VFRA 1NK4A 4Y0WA 4ES2A 2ZJPL 1T3VA 1NK8A 1BLUA 5KG0A 3POTA 7AT1B 3KLFA 5E5NA 1FESA 4DEZA 1HNXF 2CPXA 2UUCK 2W42A 2EHGA 2AW0A 3C14A 4WIIA 2CQPA 2F1FA 2GC8A 4CJFA 5D4LA 2B9XA 4JB8B 3LP1B 3KG1A 3GMGA 1R0AA 4N76A 4XH1A 1NK0A 4KY3A 3CC4N 4RBUA 3MAHA 4PG6A 2N7CA 2UUCF 1JXVA 2H65B 1LXJA 2AP6A 3J81Y 1TKZA 1FJEB 3DXMA 2XYGB 1K0VA 3V81B 4FYVB 4X66J 2HLTA 5C10A 2Z4PA 2XBPA 1WTFA 1G3OA 1R8HA 4IG3A 2VL1A 3RYLA 4DX6A 2HQDA 3TQ1A 2VCPA 3THYB 3GYGA 1ZBSA 5B0BA 4DFMA 3I4PA 4C8KA 2EKNA 5E3AA 3OYBA 2B6AA 2Q1NA 5ELZA 2DY4A 1I3OB 3VAKA 4F2SA 2HZCA 4KBOA 1ZA1B 4USIA 2FZCB 4P72A 2ASLA 4PG4A 4U7CA 5C25B 3QB0A 2A2CA 2QZ8A 1DAXA 2MZTA 1VSJA 4LRAA 5BYQA 4CJTA 1NMNA 4C2MA 5KG1A 3M6GA 4KV8B 4QYZJ 1U8WA 2FUG9 1NSAA 1FXLA 3HZEA 4TLQA 4ZP6A 4CWBA 4HT5A 3RB4A 3M8PB 2WUSA 3PEHA 4JKAA 4HH1A 4O8UA 3HZGA 4AH9A 4X4VA 2KFZA 3L2VA 1FO1A 1BO5O 1X5TA 1KLMB 5F8GA 1LK5A 1VJWA 3B82A 4JYAJ 4J2AA 4FVMA 5KFPA 1NCLA 1MU2A 4X62J 2QX0A 3M8YA 4DL3A 4FW2A 3WXMB 3SQGA 4X4TA 3MD3A 1XNRJ 4FJXA 2HQGA 2VG7A 5HVGA 1Y5IB 2YWWA 1S1XA 1FTRA 3V9SA 4NZ0A 4DSKA 1FEEA 2NRXA 4X4UA 3BQ2A 4IXCA 4EI2A 1VRUB 1YI2N 2HHXA 2IBKA 4CBUA 4RW6B 3RAMA 3DGPB 1YVNA 3RGIA 1H98A 3G6YA 2O5DA 5EXWA 3R9LA 3O5BA 2YKMB 3K9KA 3AOAA 5FPNA 2MSTA 3G4SS 4K4UA 4O5BA 4CCHA 5B0DA 1AFIA 1NWKA 3UKRB 4DV2J 2VYPA 3MWBA 2X1FA 3VQDA 2JEGA 3TWHA 4GKKJ 4LF2A 3SYZA 3Q0AA 1I1GA 2Z58B 1HNIB 2R8GA 2E1AA 2DNZA 1DTQA 4P2SA 1NGGA 3RZAA 3HPHA 4ZHRA 2A41A 4B8CA 1DARA 1RAEB 1FDAA 5HMYA 3OS1A 5BPMA 5HLFA 3V2UC 2WC9A 1Q18A 4L72B 1S1TB 1FCAA 5LMNJ 3TAMA 1RCHA 4M5GA 1REVB 2WB1D 2FDNA 1W25A 1CQMA 3VENA 2XS5A 2KZMA 2AJQA 1TK8A 2W9BB 1NJZA 4RUAA 4ED8A 1B70B 2X74A 2DPJA 1X4EA 4X4RA 2E1MC 1Z6RA 4FVCA 2ZE2A 2ZBRA 2RHKA 5IQ6A 2DH7A 3LGNA 3PFOA 2QSFA 3D0GE 3DLKB 5FRMA 4PXDA 2HAFA 5BR8J 2NYIA 2JL9A 3ZTRA 4AXJA 3C7NA 3GE9A 5IXUA 4F25A 4ZITA 1BU6O 1YHQS 1GLFO 3QGIA 2QMXA 3VGMA 4FZVA 3WHIA 3AHPA 3DU6A 1T0TV 3PXGa 3NGKA 2OZMA 3SFGA 3QIOA 2J6UA 4KH0B 3PW7A 1R7IA 2DXFA 5AJ3J 2ZD1B 3P3DA 1F0XA 2IFXA 4IH6A 1R0CB 1HR0J 3HMJG 2E88A 5HQLA 2P9NB 3OUYA 1W2BR 3HHLA 3OYKA 1H3DA 2XHCA 5CZ1A 3SJHA 1VSKA 1DZ5A 1S79A 1MA9B 4IOXA 2IAJA 3GIKA 1YZ7A 3N5FA 4GVBA 5AR0A 1W7WA 2GIRA 2VWBA 4RG8A 3AA8A 4H4KC 1D8YA 1U8SA 2J0QD 5EDWA 5H1SV 5IT9O 5DK5A 1KVIA 4P9SA 2BANA 2BMBA 2RS8A 3AOCA 2BYCA 5CY4A 3CO9A 3AB4B 1OY6A 2CUYA 1YBUA 2HBYB 2J7UA 3DLEB 2K3IA 4NYNA 1RUSA 3UN3A 4KB1A 3QEVA 4CYUB 3O6QA 2QA2A 3CPWR 1PJ7A 3KD5E 2FBXA 3GIRA 4IR1A 1WACA 3AVBA 2HHHJ 2CFXA 2NXJA 3W2WB 4C9DA 3O3FA 4DQRA 4JI1J 2XS7A 3VN5A 2ASDA 1S72N 4YHHK 4HYKA 3CI5A 4Y2CA 4LBPA 5ADXH 2D3OR 4PWWA 1Y3KA 3A0IX 3CMES 3MR3A 4OL8A 4AYBD 1BGXT 4FF2A 4YHHF 1MROA 3NF9A 3T5JA 2GMLA 4ZPCA 4CLFA 3JSMA 3JQKA 4NLGA 3SFUA 4YB6A 5KFXA 3ENQA 1QAJA 4QOZB 4OV1A 4X62K 2CQ4A 4EK2A 1BG3A 4DR5J 1N5SA 3BKUA 8RUCA 1TR0A 3C95A 2EBEA 5B7WA 1GLLO 4CHOA 3KK1A 4P71A 1BD6A 2J76E 2YKQA 1N34J 1T95A 2F4VJ 1RXOB 4C0HA 1E4GT 2YQ0A 4X62F 3KHGA 3CQXA 4YY3K 3QICA 3CJRA 4JEPA 3ZCMA 2L41A 3ZSYA 3P39A 1RAHB 4JBCA 3D2FB 4EO8A 3ENOA 1OMSA 3PYDA 1SIWB 2DEIA 1X9WA 4YY3F 4OZLA 3MEGB 3VGTA 2H3GX 3NAEA 3M5RA 3ULDA 1NG9A 4N7TA 4Y2AA 1VQ9N 5L9XA 2CDRB 4CLPA 3MDQA 4TU8A 1UEKA 4DV2K 3DGVA 3UVJB 1SKWA 4RW9A 4KPCA 1AUSL 1YVUA 3UN2A 3BGLA 1HJOA 2IRYA 1AUDA 5I4MA 4CLSA 5CD4H 4C8NA 1HPZB 2MQLA 2YNFB 1RDDA 3TA2A 4ED2A 4DV2F 2AMCB 3QAUA 2DYAA 4WFNL 1HD0A 2QWNA 5M1PA 1P1LA 1UTAA 1OSDA 1KRPA 4DJBA 5LL6d 2DCLA 2OSRA 3VGKA 3R27A 3ATVA 1OJ4A 1GXLA 3SCLE 2WBNA 5DS7A 4ZVPB 4PWUA 3O1LA 2QC3A 5ETVA 2H48B 5F3TA 1KHVA 3TJ9A 1HLWA 4QZVB 2HHVA 4DTUA 1AFJA 5LMNF 4WYBA 2E44A 2UV8A 1UOCA 2ETJA 3ASMA 2I0XA 4CHPA 4M5HA 3GV7B 4FK2A 5KFQA 5HN0A 2C2ZB 4AL7A 4DX8H 5E2QA 3SUOA 2FVRA 1KQFB 1KFSA 3CULA 1QAYA 3A3PB 3K9JA 5AJ3K 1RZMA 1EARA 5BR8F 1A7GE 1TUYA 2F8TA 4DL2A 4R8UA 2QM1A 4JI6K 3IS9B 4MO4A 2F8EX 4Q7AA 3VZHA 2JSXA 4IWVA 4FJKA 1R6VA 1JKHB 1JLAB 4DPYA 2YWKA 3D66A 3NS6A 3W64A 2WSEC 3OV7A 1TVRB 5HI7A 2V2VA 5AJ3F 3FZFA 1PBAA 4CI6A 4ID5A 3CEDA 3NG8A 3M8WA 1R3NA 4JI6F 1A9NB 3KDNA 2KT3A 4J2EA 2P9KA 1WC4A 2ADCA 4I7FA 4KHMA 4DR1J 3FZ2A 3B8AX 4PAAA 3VQAA 3Q7BA 2GUPA 3AARA 4HKQA 2DR5A 3QO9B 3MCPA 4JRQA 1HLUA 1SJ3P 3CJKA 4WE1A 4ECSA 3JS9A 2HFSA 3EO3A 3ZX2A 2HG4A 4FPRA 5J1NA 4IO9L 1N5VA 1S4FA 4JKBA 4CLLA 1VQKN 1KVAA 4QWCA 3RBEA 1WC0A 1LWEB 2RN2A 3MECA 5DDPC 4A8XA 4BE0A 3AY0A 2EBGA 3RW6A 2DNYA 3MPYA 2PMWA 3ZZPA 4MKVA 4DL0C 3U27A 1JLCA 1KFDA 3I96A 1QVGM 4BGBA 5KFYA 4NB4A 3H42A 2DXEA 4ZVHA 5CYMA 3TI0A 3OHAA 4CLWA 2IDLA 4Q45A 3H08A 3AVFA 2DGUA 5B08A 1WDTA 3ULEB 2HURA 2RDIA 1S57A 2BA9A 2XY7A 3HD1A 5J1EA 4K5RA 4M5KA 1TFWA 2KVQE 3K5MA 1N0UA 4DR5K 4LH4A 4OJRA 4MH8A 4PL7A 1VSDA 5I3UB 1P9YA 2QV6A 4CJ3A 3IMXA 5IT4A 4CIEA 3NLCA 3OLAA 1NBEB 1N34K 2R8HA 2KYZA 3Q8VA 1J9AA 2DB1A 4JI3J 1WI6A 3BF3A 3MPVA 2A40A 1X8DA 3RRKA 1BCOA 3JSYA 4DR5F 3R7SB 4DU7A 1F21A 1M1HA 2Y1LB 2Y3YA 4V1Ak 2BW7A 3LWMA 2YTCA 1N34F 3M2VA 4FNIA 4CGGA 3I8DA 2R7SA 4FYYB 1YJ9N 4X4PA 3W62A 4MLHA 2D0BA 4KH4A 5IZHA 4M95A 4DQQA 3MM6A 3CJCA 2ZOFA 5BR9A 4BC2A 2BQRA 3VVTA 4CFBA 2CJXB 1U47A 3R6MA 4AHRA 3FCHA 3Q86A 1YVFA 3K5LA 5AXLA 2HK3A 4CGIA 2HBQB 2BACA 3BGUA 1BWEA 3CC7S 4WQ4A 1AYEA 4FBUA 4DTRA 5EWEA 3HSDA 4ICLA 2XGQA 2QWRA 2RUSA 1BC6A 4KHSA 1FXXA 2VC0A 1GEHA 3OR1B 1RT4B 4KJIA 4EGLA 4Y2MA 3PEJA 2Q1LA 4DG1B 3VQ7A 1XMQJ 2V8HA 2NS1B 2E1CA 2P9GA 3FUYA 1IBMJ 1HBUA 4B9LA 5CQGA 2OAUA 1YRXA 4H5NA 3CJ9A 4JV2A 2J8SA 2HBJA 4JRPA 3S7RA 1X4DA 5H9FJ 2HBRB 4NCGB 4K2JA 4J7CA 2FQQB 1XTZA 4ZCIA 1KOHA 3MN5A 2DNLA 4RWWA 1OO0B 4FLVA 5B09A 3GV5B 1Q53A 2M4MA 4MK9A 3THXB 3U4LA 5J2QA 2ERRA 3I0RA 2HNYB 1CJUB 5B0AA 2CADA 4WU3A 5LT5A 2EFQA 1NHVA 2C2MB 1FK9B 3MCSA 2GX9A 5D78A 3NGRA 5DMRA 2VDHA 5A8RA 2YNHA 4CF0A 2K06A 4I56A 2FTRA 3UB5A 2F63A 4CJ7A 4ECZA 4CH7A 1KS2A 1B0VA 4RUHA 5EN1A 5AQZA 2B4UA 4XK8C 3PW5A 3FZBA 3R7BB 1T8EA 3J7A1 3OL6A 3TABA 1ZBHA 1DBDA 4AT1B 3A8IA 4F4YA 3NS7B 4M5JA 4UF4A 4TXSA 2KVIA 2AGPA 2O8FB 4RCHA 4DR1K 3PTWA 1FNOA 2GJ2A 3NGTA 2CZVC 1HNWJ 4OYBA 1QDUB 4QOTA 3H98A 1E6YB 4C11B 4LY7A 2DEJA 3PSFA 1Y10A 2YHAA 1WOPA 3BY5A 4DR1F 1WOQA 4N8NA 1FD2A 3BN4A 2Z2YB 3AD9C 3PIOL 1X4HA 2XHBA 4RW7B 4ETZA 1MWYA 4NLOA 2B8QA 3IRXA 4H4OB 1L5UA 3M05A 4Q2MA 4CD3A 3ZZOA 2OPSA 3WQPA 1WC6A 1EXQA 2O8BB 4KI6A 3G6ES 4BR7A 5KFHA 3C6TB 3EXCX 2VASA 2X3DA 4YB1P 4NPOA 2BE7D 3VR1A 1S9FA 1WORA 4C98A 1DLOB 4HTUA 4HUFA 1ZETA 2JC1A 1HQUA 1UWBB 4RJVA 5GAHU 1TKTA 2B8PA 2HNDB 2WW8A 4DL7A 5IM0B 3UD4P 1BWVA 2NNWA 4HL9A 5K8MA 4OQJA 4YS2A 2AIRB 1IR1A 4M8LA 4JI3K 2AZ1A 3TUIC 3DM2B 1VQMS 3V4MA 4JD2B 4LFAK 4ZIWA 5KT5A 4ES1A 5KI6A 2QYCA 4O3RA 1H72C 1Y11A 2Q0UA 1ULRA 1WF1A 5CH7B 3QYYA 3TYTA 4LF4K 2U2FA 3VQTA 4K4WA 4JI3F 1BI4A 3TW0A 2J0SD 2L9WA 1TELA 2XCPA 3WNEA 4LFAF 4RNNA 1NM2A 3SI8A 3CIZA 4O4GA 1WSJA 3CG7A 5HL7Q 4KI4A 4NA1A 4OV6A 3NE6A 2PGCA 3WUHA 1WBBA 1O5JA 4LF4F 4CK2A 1SQFA 2RRBA 2Y1IA 1GQEA 1NDKA 1N32J 1X5PA 5DM7L 3KJVA 2CZ9A 3V9ZA 3OSNA 3KLGA 1JX4A 1EX8A 4B17A 3JSBA 2VB6A 3TRGA 2R42A 3D3BJ 4CGHA 1S9GA 1UW4A 3LP0B 1FRXA 2V5HG 2YH1A 3OTCA 3DRPA 3LPEA 3DLGB 1B64A 2XY8A 1EKSA 3WQTA 4BQLA 1YITN 5K5MA 1VQON 3X3UA 3BQ1A 3N6MA 3ZZTA 3AV9A 4IOCQ 1NHKL 1S7IA 2LA4A 5CYQA 3DKDA 1YKWA 2VFSA 2FSJA 3VPZA 1FNXH 1EKRA 3MMAA 1VBYA 1V5VA 3OXFA 3MR2A 4LFBJ 2HF3A 3VQCA 5H9FK 1V4SA 3CCQN 1APSA 4KHNA 4RWTA 2GS8A 2U1AA 1M5PC 3AJDA 4O44A 1XMOK 1PAEX 4PXBA 4KGVB 1SUQA 2EK6A 3OVSA 2UV8G 4X84A 4B9NA 2GQCA 3P96A 3VQ6A 5K8OA 5IWAK 3CCWA 2H4WB 3QEIA 3GONA 1OSCA 1IJJA 4DV5J 4CFCA 4BGAA 4LRFA 1XMOF 3SPZA 4RW4A 5SZTA 4IRCA 3RSEA 2OIHA 2D1CA 2XZWA 3IP0A 1CLQA 1NLVA 2IVYA 1S1VB 2RHQB 1SC4B 3BH7B 5IWAF 4FLXA 1QVGR 3H4DA 3GJSB 2V2QA 5HQMA 3IWXA 3WC2A 3WXLA 4V19X 1TL1B 3F41A 4B1ZA 4HCCA 4BR9A 2HBZB 1X9JA 3CQ8A 4J9VA 3PIPQ 3WEEB 5HVHA 4G3IA 3WXJA 3FDSA 1U1PA 4KH5A 1NJXA 5M2RA 3UO0A 1IM4A 4ZN3A 3BEGB 1ESVA 3SSSA 5LSRA 4UOGA 3IM9A 2LDYA 2B4PA 3MMCB 1OYDA 2H3EB 2VODA 1B3TA 2JFDA 4JI2K 1WC5A 5DLFA 5J2NB 3QLHA 2V4JB 4EHTA 4NYFA 2ZITA 3MAQA 3DAWA 4TNOA 2ZJPQ 3DI6A 4V19S 1YIJS 3D6HB 3CCTA 1MDUB 3TANA 4FXWA 1RQ0A 2BEFA 4CJPA 4JI2F 4DV0K 4U67L 1BDGA 5J2PB 2WVEA 4DF8A 4IBNA 1BCMA 1S0NA 2IRUA 1UEUA 2I8EA 5GAHI 3Q7CA 2BE2B 4A8KA 2HHSA 4WQ4C 3IWNC 3QEPA 2DGWA 3PKYA 5K20B 5JS2A 2CXEA 3J7YP 4ZPDA 5A0YA 4JI4J 3SI6A 4DV0F 3PG9A 5HJXA 1SB6A 4KAZA 4CERA 3AAQA 3G87A 4AFFA 3F73A 2JWNA 3RBZA 1VQNS 3POTB 3KLFB 3NGUA 3TZXA 1RWUA 3ZX3A 1S6OA 3RWUA 5A8KA 1NDCA 2CPZA 3C14B 3OW2M 1HIYA 3E9LA 1R0AB 4YB5A 2J9DA 4MIAA 3EUNA 2BUNA 5DGAA 4WKYA 4DV6J 1CG2A 2FJBB 1WD6A 1FRJA 4JI0K 3BGOP 4NOHA 1FKPA 2WVDA 2ASPA 3KFWX 4HACA 5LXRA 3PJ9A 1TKZB 1FI4A 2LQ5A 4CZFA 3DXMB 1RK8A 1RILA 3L6QA 2AT1B 4NA2A 1T9TA 3DC2A 4JI0F 2FLOA 3W5XA 5KFBA 1RFQA 2OMOA 4IG3B 4LSZB 4UOFA 4P10A 3VVUA 1FDDA 5M1QA 3TNVA 4UTGA 3HHKA 2HIQA 2ALYB 5GAGP 1G99A 1TU0B 1SL1A 2B6AB 1Q79A 4MIWA 3HVRA 2AX1A 2EFPA 1SC6A 1JIHA 3ZXWA 1UAWA 2E5HA 4ILGB 2JLEA 3GG0A 3TVZA 2E9RX 3QERA 1HA1A 5KPTA 4NLSA 4DZ6A 4UQTA 5LOQA 1NKEA 2YBVA 3EGNA 4H4MA 1D3WA 1RBVA 2FJEB 3O8WA 3QQCD 2XQCA 4DR4K 3ZT0A 1RAOA 4KHUA 2V9WA 1SCJB 4Y1DA 3ZZZA 1KAZA 4X64J 4JHDA 1JJHA 2W25A 2VPYB 5E84A 2V0NA 3VTHA 3L2RA 5ETNA 5AQWA 2RIJA 1ZA2B 4DR4F 4NYPA 4NLRA 4IRKA 1MU2B 2FJXA 4OPHA 5GAEU 3M6WA 1HW9A 1VQ6N 4JS4A 3EVWA 4CZLA 3SQGB 5AQPA 4DQIA 1T6DA 3EE8A 1YTUA 1Z1ZA 2VG7B 3SQ1A 1VBKA 1S1XB 3OTOJ 2WB4A 4RLEA 1YTYA 3TSQA 4NLXA 3QDKA 3EGVA 5JMVA 3HF5A 4XO0A 5LJ5Y 2H51B 1YJ7A 2DH9A 2ZKTA 5ETSA 2OH2A 4MLEA 5GINA 5DG8A 4A8WA 1MMDA 1RWPB 4DFPA 1WSRA 1N8RT 4LC9B 1VK0A 4JI5K 1XERA 4JKEA 1BIUA 2KN4A 1FX2A 2OELA 3G9CA 1CLFA 2WFBA 4OKJA 1BUPA 1LWFA 4Y65A 1DTQB 3FBEA 4ZHRB 4WK1A 3I31A 4IOBA 1WSIA 2IVPA 4LREA 4JI5F 4KGXB 3TAPA 2QT7A 2RNEA 4PZVA 4JNEA 3S3MA 5HLFB 3ZT4A 1OY8A 2ZH9A 3O9UA 4B1YB 1S6UA 4GY2B 1RTHA 5GIOA 3I33A 2CJYB 3TAMB 1VQYA 2D74B 4JI4K 3FZLA 5FRNA 3BPDA 1UEVA 3PVXA 4P7TA 2VIHA 3IUCA 4J8FA 3B6PA 3I82A 4FZZA 3NAHA 2ZE2B 1VJQA 3D0HE 4JI4F 4YOUA 1K8KA 2R7OA 2CQ2A 3LUYA 1EX4A 1XHZA 4WZMA 1ZM2A 4E1JA 1RLCL 3C7NB 1K47A 1K6YA 2WCXA 3LZJA 5A6WA 4PCQA 4Q5VA 4J2DA 3SSRA 5DO2A 2ZM6J 3MUTP 3L2UA 3MX2A 3H0PA 2UXCJ 3KK3A 2DFFA 3GJRB 3UNYA 3G25A 3FCWA 2G0CA 2A1BA 2O67A 4CLUA 2OGUA 3HFVA 3QWUA 4TU7A 3OUYB 1VSMA 2AJFE 3HHLB 3E1YA 3ETMA 5JLHA 3THWA 3DLBA 2JEIA 2MQMA 2QXLA 2IAJB 4B9SA 2WVCA 1X5SA 3EKUA 1YGYA 3T1YK 1KSPA 4GVBB 1T9XA 5IQQA 1PJ6A 3AB2B 1IR0A 3BPSP 1ASWA 2FB0A 4JV5J 5AFUH 4DCJB 1X5OA 2BJEA 1HBMA 1GNKA 2BANB 2XB2D 4JKGA 5A76A 1Y0HA 3T1YF 3MCMA 1VDHA 3R2CJ 2HVHA 1LW2A 1U45A 3BR8A 4EP5A 4LRBA 4WP3A 5CCMA 5CHIA 5MLCV 3FZKA 3QJLA 2HQIA 1K1QA 4CRJA 1KQSM 4WF9Q 4E7KA 4DUTA 3I56N 5GAEI 2RJZA 3UPFA 4O23A 2Y8WA 4K7QA 2UUBK 3W3DA 3CM5A 4J9MA 4ZVRB 3H5XA 1E6VA 1J53A 4IDHA 4YOXA 3P5JA 1FKAF 2E66A 2IC3A 5GMKa 1RDCA 4UZBA 3LDOA 3MXIA 5IT9U 2RKIA 3JXUA 2UUBF 3KWMA 3OFEA 5HOOA 3IDHA 1TL3A 1MROB 4OJ1A 1FRKA 3BDPA 3TWZA 4AF1A 4X4OA 1ELOA 3NOCA 3JSMB 3IBFB 3PSIA 3US5A 3VEYA 3KNAA 2GZOA 1BL3A 1P6TA 1VSLA 4KPYA 1WNSA 4DCPB 3L09A 4OMFG 5M1KA 4XPCA 2ZWPA 1VYAA 1S0OA 2ATCB 2FXUA 4I2PA 1RTZA 3KK1B 3I6PA 3M8ZA 5IC6B 5K14A 4HDHA 3GYXB 3TU5A 1S1UA 5AQSA 5BPLA 2QWLA 1VGYA 1RTIA 1FRIA 3KG0A 2MB0B 2DNQA 1VQ4N 1Q1KA 2FC9A 5EU7A 1U7LA 4B3SJ 1NGIA 2D5RA 4RZRA 3N4PA 3Q8SB 3BB5A 3MTJA 4BWJA 2EEYA 3NDKA 4EU0A 3L9ZA 2KW4A 3C15A 4G1QA 2BRLA 3P4IA 1Y3JA 2JEJA 3U02A 3OW2R 2KM8C 5AQGA 5AQKA 4CFDA 3JTOA 4ZLPA 2JJ4D 1HHSA 3V1QA 1J5OA 5M1OA 2WSFC 4ED5A 3AO4A 3IG1A 1UPPA 4RW9B 3KVGA 4CDIA 4EYIB 5FIIA 4CIOA 1U48A 2VPWB 1YJTA 3F5TA 2GTDA 4YORA 3A3NB 4E7HA 3TAFA 1H74A 2DIUA 4RW8A 4W5RA 1SVDA 4Z4GA 2LQ9A 4B3RK 3P4UB 1V3SA 3O4WA 2GIFA 3M32A 3DLHA 4NI2A 3N5BA 5KFTA 1ZH5A 2M0GB 1CBKA 4MT1A 1U4BA 4B3RF 4E2FB 4DL4A 4DN9A 1LWXA 3WNHA 5L1LA 4EFAC 1BHNA 5AQRA 2O4IA 3CC4S 4ECRA 4BBYA 2W41A 4FJHA 2ZKUA 1JJ2M 2GX8A 2QYGA 1HI1A 3LALA 2A3ZA 3EZOA 3FFIA 4PG8A 4DTOA 3FK4A 2ZM6K 3V6HA 3L3UA 2G8IA 2XRIA 2V7ZA 3LDQA 2V94A 4OYXA 3CW2C 4R8UB 4EZ6A 4HVZA 1R8AA 3LM9A 4IO9Q 2A42A 3DOMA 3ZTOA 2ZM6F 3MPWA 4WKRA 2I38A 2B4JA 4HH0A 5BPNA 1MN9A 4ID5B 4K0KJ 5IC4B 1IN0A 2HGLA 3CJTA 2P9KB 1AXQA 2AJ4A 4JV5K 4I7FB 3CCEN 4OYZA 2QIFA 4B1VA 2OPPA 3GFXA 4WFXA 3PYGA 5C5JA 1HMVA 3CJKB 4WE1B 4CEOA 1XIQA 5F1XA 2KRRA 3NGIA 2FD2A 1U24A 4JV5F 4WFYA 4GKJJ 4LF5J 1T9VA 4OX9J 1Q7YT 4KTWA 4C0BA 3TAEA 2QW9A 4WPAA 4CNYA 2QTWA 2QKBA 1C1CA 3LQVA 4OI3A 1R43A 2G13A 3PR4A 4DS4A 3C6HA 3HSTB 3F9KA 3MECB 4CNZA 3CCUN 3B54A 3J7AP 2HSEB 2K3KA 4FYWB 4P7VA 4IUFA 4Q43A 2NRWA 1JLCB 1ROFA 5AQXA 2HAIA 1XWLA 1YAGA 3O6WA 1SS6A 2Z0GA 1OPIA 1F9FA 3GCWP 4LUBA 5CYMB 4JUZA 3E8OA 4OGEA 4D3HA 4H0VB 2JHEA 5LL6Z 5J1EB 3BBFA 1YT3A 2W7OA 3EXYA 4RR5A 2IM3A 4KT0C 4Z7CA 2HEKA 4ZVUB 5BRHA 1U25A 2UXDJ 3HM9A 1C1BA 1YI2S 2OO4A 3O5TB 3QFWA 5JVGL 3SZ2A 4MDBA 2RUGA 5JMNA 1U6ZA 2QWPA 2HGMA 2W40A 3VESA 2HS3A 3M2VB 2GO9A 1FVSA 4ZPWR 4QPTA 2BTFA 3IAYA 2EC0A 1NPRA 1IKWA 4NXNK 1H6KX 5IT9Y 5ETPA 4MYUA 1O51A 3QZ7A 4KRFA 2VA3A 1OQ6A 3ZLJA 5DDRC 3MM6B 4C3KA 2OMLA 4RO0A 4A8SA 4QWEA 1SJFA 3BGRA 2J0WA 3KD1E 4DV3J 2P9EA 1BQNA 4ZVGA 4BREA 3GFHA 1NO8A 2XTJP 2CPIA 4NLTA 4F4ZA 5KRTA 2CVIA 5D77A 4U96A 2V67A 4IEEA 4J9KA 3DYAA 3S3NA 2HWIA 3ICLA 3EGZA 4ICLB 1VC5A 4CVNE 4HUGA 3MR7A 4HI2A 3W66A 3RBDA 1KR4A 3IN5A 1C0FA 3U6FA 4YR2A 3A5NC 3VF2A 4DR2K 1VS3A 4USTA 1XBWA 3GIJA 3GLJA 2W2MP 5F3ZA 1VK8A 4KIAA 1FW6A 4ILRA 4Z37A 3J7Z5 5LJWA 4DR2F 5KFOA 3OA9A 3HVTA 2RVJA 1HBUB 3IGNA 4A8OA 3KMQA 2DCUB 1WAJA 2AF6A 3PUFA 3CCRN 3H7HB 5FPDA 1I5OB 3AVAA 5A2QO 4OJ3A 1Q5VA 1PC4A 5AE1A 2W2QP 5AQJA 3O9SA 2Q36A 4C23A 1KQSR 5KPZA 3CJ4A 2YKPA 1U1MA 4CJQA 4JK9A 3JTNA 2HS4A 4CO5A 5J2QB 1ZPVA 4P73A 3I0RB 1TK0A 3EX7B 4ER8A 2YY3A 4CLYA 1C0GA 5LXYA 2HQCA 3AOBA 4FWNA 2B3TB 1PYTA 1JWWA 1HKAA 4U8VA 5A8RB 2YNHB 4N5SA 2MTLA 5EX5A 1BE4A 3BSOA 1YF5L 2J5AA 3O4QA 5FDLA 2E2QA 3HSCA 3L7UA 3VQEA 1PYSB 1N54B 4H5TA 3TVKA 1S49A 1T9WA 4QIEA 4AHTA 2RILA 1UL3A 2QGFB 4FF4A 3RBXA 2HMPA 3PIOQ 1T94A 4KFBA 2F96A 2D69A 5F0UA 1JXEA 2B51A 4IR9A 4FWPA 2LU2A 1JL2A 3P1GA 2M70A 2E1RA 3AA3A 1GLBG 4PKGA 4KKOA 5KT6A 1JLFA 3TAQA 1NM1A 1RHQB 5EUHA 3FVYA 2FVPA 3QGHA 1A5WA 3KHRA 4WIQA 2HPUA 1S72S 1NJYA 4GKJK 5THWA 4ZLLA 4LF5K 5KFJA 4EBDA 2E7WA 4O3QA 3R5CA 1EJ7L 4F7VA 4HLBA 2G0JA 1O6XA 4L3QA 1YBAA 1T9YA 1YQHA 1KC8T 3QATA 2RPIA 4DQSA 4CGDA 5JVHL 4I9QA 4WFZA 2PI4A 4GKJF 1IM6A 4LF5F 3IRXB 2NLWA 4CZIA 2BZ2A 3THPA 2FJAB 2G2ZA 2LU1A 2ZZTA 4G9ZA 2IVMA 2OPSB 1FNMA 4NLCA 3V6KA 3J80O 2NUUG 2MQOA 2Y8YA 5L8RC 3CWJA 1QS4A 3FFKB 4MK8A 4TYAA 3VF6A 2NYHA 4DUZK 1B92A 2DNMA 1S76D 1WKLA 1HQUB 2W1BA 3QESA 1RBUA 1TKTB 3SMZA 3SUNA 5IFMA 4WK3A 2VWJA 5C12A 3M2RA 1QD1A 3DCAA 3LGMA 3CO0P 2ROPA 3SQOP 2N3LA 3C2PA 1WHYA 4PHTX 1C4AA 3PJWA 1CC7A 3KLIA 5DM7Q 4DKWA 4P2FA 1XQSC 2IVOA 1WSHA 5GADU 2A6AA 2DO4A 3W8PA 3FGUA 3K17A 3MR6A 2MKJA 1VQ9S 2YNIA 4KGZB 2BXJA 3A5LC 2ZUAA 1BI4B 4TKTA 5D3GA 2GHWA 2VQFJ 4TY9A 4LR9A 2HHTA 1JJ2R 2DT9A 1SC3B 2KHDA 4O4GB 3ID6A 4DLGA 5FLXO 3MR5A 1FRMA 3ZTPA 2MZRA 2NLXA 4DUYK 4CZHA 2CWXA 2B7BB 3L2WA 2LEAA 4J9LA 4F3TA 3P8BB 2HRYA 3IKMA 1PJ5A 1DT9A 2ZHAA 3PDNA 4UUWA 5CYJA 3LPUA 3SJJA 3V9XA 4F04B 2EW9A 3KJVB 1IKYA 5AXNA 2M8HA 4R0EA 3RRGA 3O4NA 5EGYA 1FFWB 2CYYA 1JLQA 3KLGB 2VFUA 4ELTA 4EZ9A 2DNGA 1KAXA 1NMDA 2I7PA 4G1IA 4QJVA 1S9GB 1AZSA 2BV3A 5BN9A 3DRPB 2YNGA 5KOWA 3LPYA 2AQ4A 5GAHP 4CF1A 4BR2A 2F8SA 2WHOA 4U7UD 5CYQB 3UCGA 4TY8A 4E89A 1HBOA 1VQLN 4B3TK 1VOMA 2OEKA 3MMAB 3QFHA 3DDNA 3HXMA 3UQSA 4OYMA 4YDDB 2XI3A 4OYPA 4O44B 1XNQK 1U6FA 1NGAA 4FK4A 1SUQB 4CQ1A 4B3TF 1KDNA 3IGVA 4Z4HA 1MWQA 5ITHA 3HD2A 4ISFA 4F8RA 1N8RO 2ILZA 3PRBA 2MLYA 4WBFA 3CCZA 4FJJA 3MM5A 4NLQA 5AQNA 2E5GA 4PL8A 4RW4B 4EEYA 3RSEB 2ADBA 1Z2LA 4K4XA 1FERA 3PJXA 3QBCA 2UXBJ 5AQIA 4YOEA 3ATUA 2QLJB 4ZS6A 1T6CA 1HNZJ 2YHXA 4B1UB 1RDAA 1XC9A 1UA0A 5HP1A 3VGVA 2HWHA 4OLPA 1WF2A 4U67Q 1IH7A 4ECYA 1SBRA 3CF5L 3UDVA 4WP8A 2E20A 1SAZA 4DF4A 5L9NA 4DV7J 3VA0A 4DR6K 3OYFA 4CJ4A 3OFFA 1HWUA 3BKTA 1VLYA 3ZYYX 3QLHB 2ZBPA 3IAS9 4KAIA 3R97A 1VQKS 1ICEB 3GJQB 3DI6B 1N36K 3QMQA 3T5HA 3PM9A 3BYPA 5HRNA 2HWTA 3O3HA 4DR6F 3HP6A 2HVZA 3HO1A 3S8SA 2VU5A 4FWQA 1M5HA 1U1QA 2I1RA 2COLA 3CCVN 1WN7A 1N36F 2AYEA 4DPUA 3KLVA 5A0YB 3GIIA 3M2UA 2CGLA 2UU9J 4M3TA 1Q8IA 2ZFHA 5GADI 1QM9A 1FDBA 1YZ6A 1FRHA 2XNQA 3O44A 4GMKA 3O1BA 7FDRA 3VAHA 2V68A 3I9V9 3TTCA 2J6SA 1TMJA 5A8KB 1HW8A 3B8HA 3M1VA 2YV0X 2M2BA 2AHOB 3MEKA 3FZMA 4I6YA 1GXTA 3CC2N 3T5LA 1CXQA 1S7HA 4XAKA 4B1XB 3QGGA 5AQMA 2F9JA 3PKMA 4QAGA 2ZHBA 2QL7B 1H73A 1TL5A 3V9UA 2Q97A 4J37A 1FKPB 2NRRA 5AE3A 2PIIA 4ATNA 4KHPK 4HACB 2FSNA 3AVCA 2XMMA 1FE0A 3LDLA 3MXJA 2A18A 4JAXA 3MN6A 3Q8UA 4PKIA 7FD1A 1JMTA 1LK7A 2AJ2A 1QUPA 1ZAXA 4CT9A 1KXPA 2PDAA 2VQFK 4OYOA 5JXSA 3D7SB 2PO4A 2Z8QA 4BR4A 2VKZG 4E0DA 2M7SA 4Z4IA 3M30A 1QQCA 4DSJA 4ZK7M 2VQFF 1IWAA 3ZZUA 3M8RA 2FZGB 3BSAA 4I69A 2P2CB 2WVBA 5C42A 2JRSA 2R7YA 3A8EA 2F9DA 5ADXA 2G8WA 2O66A 3M9OB 1DFDA 3CTRA 1SI9A 1DURA 3BKFA 4X65J 4ECTA 4H4MB 1TV6A 4ANDA 4F4XA 1EWQA 2LXUA 3ENHA 2ZDPA 4F3OA 5KFVA 4JHDB 5AZJA 2OTLN 4K5SA 2GAGC 4XH5A 3HDSA 5KGXA 2QLFB 3DRXA 3LWLA 1U1NA 1KHWA 3KWGA 3MCNA 4C8OA 3CPEA 1S22A 4DDFA 2DTJA 3K2PA 4LD0A 5IV4A 3M4XA 3D1OA 1S0VA 2G8VA 3BBBA 3NRBA 2P5VA 1FXRA 2KKHA 2CNOB 3RU0A 1CXUA 1R8CA 4K4SA 5E0OA 1VAZA 3FQLA 3ZX0A 4MKAA 5F8MA 1D9FA 1OKJA 4OVLA 4F26A 5M1NA 5HATA 4NLWA 4E1MA 1N88A 4F36A 2RU3A 4WU2A 2W4CA 4NE9C 1ZAWA 2JLFA 4OLOA 1P90A 1GLJO 3K57A 1B7YB 3OTDA 3NMRA 1BY9A 5KFAA 3PX0A 3ISNC 1L3KA 5L46A 4FOEA 3SXLA 3IWLA 4UOCA 3QGPA 2CQ0A 2Q6BA 3TA0A 1LFWA 5HMZA 1Z26A 1HQEA 2MYFA 1TKXA 5CD4A 2MQPA 2WTFA 4LR7A 4LR8A 1Z05A 4U7UK 3DLLL 3NCIA 3BUZB 4OI4A 1QJHA 4AD6A 1LWFB 1OVYA 3CJ1A 3CFOA 4NLYA 2ZBIA 4URQU 4GVEA 1NUEA 2KHCA 1NZAA 3JXOA 1GX6A 2AJ0A 3M6UA 4H4KA 5KFGA 4W92B 1GLEG 2WBRA 5GAEP 3A8YA 1QAIA 4YR3A 2HQFA 3AD8C 3WDOA 1RTHB 4Y2IA 2UVVA 1A6LA 4J5OA 4JKDA 3FSIA 1RTDA 1VQ5N 1RBLA 4RBTA 3V1RA 2UU9K 4DI6A 3MUMP 1W26A 4XEIA 2PN6A 3O9QA 4OLBA 4ZCLA 2YKNA 1GMWA 2EG2A 5H1SQ 4L3NA 3IM8A 4M5MA 1K8KB 2ZC3A 5DLGA 2V8VA 2HKEA 1O1WA 2UU9F 3JQMA 3KWIA 5M2UA 4JI8J 3QEXA 4LJMA 3MGJA 5T7LA 1J5EJ 3OYCA 1IKXA 4KRWA 3VAGA 1VI7A 2QK9A 4HTJA 3ZC4A 4LMZA 2DITA 4Z0UA 2HGNA 4P52A 4LF7J 4RNHA 2J0XA 4F50A 5KTQA 3KK3B 3T9ZA 1HBNA 4PY5A 1HWJA 2E1ZA 4BC7A 1Q7YO 4I67A 5DM6L 4P74A 3THWB 2XULA 1SH2A 2DNKA 3CERA 1S99A 2AYBA 1E3MA 2G8FA 1WG5A 2AKWB 5CA5A 3K0JA 4TYBA 4ZLNA 1J2VA 1CJKA 5EWFA 1P27B 2GNKA 4FCYA 1ZTWA 4LSNA 1HBMB 3VA3A 1AA1B 4JKGB 2PY5A 3F56A 5T41A 1N5QA 3VEOA 1JQGA 1LW2B 2WAQD 1UVLA 2NREA 3GU0A 1RT5A 1NBWA 1QSLA 2QLXA 4C0OC 3NH0A 1VQOS 1T02A 5E26A 3ENWA 3NVMA 3M8SA 5BXIA 1S97A 4IEIA 3MXMA 4CJEA 4GV3A 2VPXB 4X65K 2GV1A 1UKUA 1E6VB 2E6MA 2X7IA 5KFSA 3G2XA 2YKAA 2W2PP 2IC3B 3WX8A 4P6QA 3CCQS 2ZJRQ 2MJNA 3UE5A 2RKIB 4Q0BA 5KFCA 2F9TA 2I9SA 1M90T 3EGWB 4BR5A 4OHYA 1D1UA 4X65F 5U47A 1D0EA 5ADZA 3CDEA 1TL3B 1YWXA 3WC0A 1LV5A 1RAJA 2FF3B 2KT5A 5F41A 3CDUA 3KK2A 2HMIA 4CH1A 4Z4FA 3H4BA 4FM0A 3PHEA 4ZA1A 2UVWA 2OD4A 3BJYA 4I2PB 3ALYA 4BRKA 3NWRA 2BX6A 1EQYA 5K14B 5B0CA 1S1UB 3GG1A 1RTIB 3UN5A 3QT5A 3SDEA 3OXGA 3SAGA 2R2SA 3QRPA 2E1YA 5RUBA 3QBXA 2VDIA 2O8EA 3PZPA 2N82B 3E51A 3WNFA 3HSJA 3C15B 4G1QB 3TUZC 2DR6A 3WXKA 3SNNA 4CT8A 4LFCJ 1BMQB 1SPBP 2R9LA 3VCDA 3C16A 4K2XA 4HEA9 2XHWA 4PPZA 5AQOA 4DCHA 3DRRA 1GX5A 1J5OB 2AD9A 3IG1B 1HWIA 2VC1A 4WFAL 4LF9J 1MLAA 2ROEA 3IA0A 2RH3A 4G1PA 4IQMA 2VQEJ 1WHVA 3BH6B 2XSJA 3L4IA 1FVQA 4K8ZA 1M1GA 4OI0A 2CJ9A 3UNGC 2MJUA 4RW8B 4U95A 1Y64A 1F9HA 4Y6IA 3AGRA 4NCAA 4USWA 4NO7A 1ITPA 4F0MA 2BUPA 2W4DA 2MY8A 2ATLA 1VIXA 1EKEA 5KT2A 2UVRA 5JJBA 3VMFB 3GBTA 1CJVA 3M32B 2QLBB 5D0RA 4B3MJ 4OZ3A 4NI2B 3PW4A 4TVAB 4A5BA 2XS2A 1U02A 1KCFA 2E7XA 4CTAA 3D6MB 1M0SA 4LQ9A 3HFZB 2IJNA 2K7JA 2MHNA 4AQYJ 2Z1JA 4BRPA 4R79A 2RHSB 1VHXA 4FXDA 1YBTA 3H90A 3LA0A 3LF0A 1FXDA 4J9OA 1NH7A 2ZH7A 1S12A 5KFUA 4JI8K 4DR7J 3VAMA 3FC9A 4AXIA 1F2GA 2F7TA 3KLEA 5HRRA 3FFIB 2LVWA 3ZO7A 2ILYA 1FJGJ 4KB0A 3KMSA 4LF7K 2X1AA 2R7WA 4HT7A 3E9PA 4KTZA 3GP9A 4JI8F 3MOJB 3K59A 2E1PA 4L3KA 2HFVA 3FJ2A 4YOVA 1HFEL 1UA1A 3BGFA 4WXWA 2WSCC 3DOMB 4LF7F 4MKYA 2BM1A 3VQBA 1CS4A 2R7QA 3WT0A 2RS2A 1KC8O 2F3JA 2V7YA 3TR8A 1ZBTA 2MKSA 3R8YA 3S1TA 2HHQA 4H0OA 3HT0A 3V6DA 2GQQA 4WP9A 1U2VA 4YDXA 2HF4A 1ZBUA 3L4BC 4CE9A 2PMHA 3BS9A 2OPPB 1XEZA 1C6VA 1HMVB 5HJYA 3TP2A 4ISGA 1H2VZ 4LF8J 2C3MA 2E5LJ 4EMDA 3DDIA 2L9NA 5I42A 1WDDA 3W7BA 3E2EA 3KLHA 1W9HA 3OBWA 1PIEA 5AQUA 1KEKA 1C1CB 2CG4A 3FKBA 4B02A 4X66K 4MYTA 2PC6A 2BVZA 2IRXA 2NXUA 3HVWA 4ECWA 2CZ4A 1UMJA 4AHCA 4CW7B 3G8TA 5JVGQ 2JH3A 1AB8A 3PRVA 1VQMN 5KT7A 1N52B 4X66F 4Y3CA 3AODA 1D8ZA 2LP4A 4UUXA 1UFLA 3JS6A 2VONA 3SUQA 4E1NA 3GPAA 3OYIA 4QR1A 3JAMO 2NUHA 2Z56B 3EE3A 2HS0A 1PYOB 2KU7A 2DISA 2CVEA 1MW7A 4TQRA 5ETLA 3JYTA 3DXSX 4JK7A 2DNOA 5E3RA 1Q9YA 4BDPA 4PPDA 2GUIA 1C1BB 3A8KA 3MCAB