4GVEA

Tacaribe nucleoprotein structure
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
207
structure length
197
Chain Sequence
DIGSEFEGQELIVRAAVSELDPSNTIWLDIEGPPTDPVELALYQPAKKQYIHCFRKPHDEKGFKNGSRHSHGILMKDIEDAVPGVLSYVIGLLPPNMVITTQGSDDIRKLLDIHGRKDLKLIDVKFTSDQARQFEHQVWDKFGHLCKQHNGVIISKPSPDEPHCALLDCIMFHSAMSGELPKEEPIPLLPKEFLFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of Arenaviral Nucleoproteins with Triphosphate dsRNA Reveal a Unique Mechanism of Immune Suppression.
pubmed doi rcsb
source organism Tacaribe virus
molecule tags Viral protein
molecule keywords Nucleoprotein
total genus 57
structure length 197
sequence length 207
ec nomenclature
pdb deposition date 2012-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.410 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4gveA00
3R3LA 3Q7BA 4GVEA 3MX5A 3MWPA 3MWTA 4GV3A 4GV9A 3Q7CA 4GV6A 3MX2A 4FVUA 4G9ZA
chains in the Genus database with same CATH superfamily
3MCAB 3NGYA 1ILYA 3QEWA 3HK2A 4W5OA 3LALA 4HVJA 4M3XA 4JI7K 4DS4A 3QERA 4K0KK 3AVBA 2VG7A 4JI3K 4IWVA 4C1NK 4BRFA 1RT7A 4JKFA 5TKWA 2QWNA 1K8KB 3AV9A 4NYFA 1E3MA 2B4JA 4DFJA 3G25A 2F4VK 4FJGA 4I2QA 3LP1A 5EX5A 1UWBA 4PKGA 3VGKA 3P4IA 2E2NA 5AQRA 3DYAA 3PSIA 3U9DA 4BRMA 3WQTA 4UQGA 2IOCA 4JHDB 1TL1A 1HX1A 1BCOA 1C0GA 1DLOA 4FZYA 4AM6A 4RW8A 3RMAA 4H5NA 1FKOA 5AQYA 4RG8A 3DM2A 4JI2K 5F2RA 3NVMA 3WQUA 3HPGA 5M1FA 4FJ8A 4DV7K 3OYJA 2RF2A 1DT9A 1ATNA 4HCBA 1W2BM 3H45C 4DFPA 1ATSA 4CD3A 4CGIA 2W41A 5KI6A 1NGGA 3AVAA 3C7NB 2A5XA 5HRNA 1G15A 4DFKA 1TGOA 4B1XB 4BRAA 4CHPA 4WF9L 3DJCA 4G9ZA 5HROA 2W6KA 2VG5A 4FJLA 4JN4A 2WFBA 4C8MA 1S5JA 3CM5A 3F9MA 4IOCL 4CJFA 5AQWA 1GLFO 1NGEA 3K9KA 3CJ7A 4CJTA 4WFAL 2P5GA 2E6MA 4JHDA 3OYFA 4FJIA 1HYZA 2E6LA 4DWIA 3I0SA 3DRPA 2JLEA 2FBXA 4FPAA 1U6ZA 3CQYA 1LWCA 3NF8A 5AQKA 3WXLA 1FKPA 2O8BA 4UY8O 4BQZA 3SNNA 4HTUA 5FDLA 4ILJA 2HHVA 4DU1A 2OTJN 1WLJA 3ZT0A 2KKZA 4H8KA 4H0OA 1KSPA 4Z4EA 3V1RA 3HPHA 3J81O 1NJYA 3AO1A 1LV5A 2YJFA 1SZ2A 5FRNA 3EYZA 4JS5A 3LDOA 4I9QA 2G8IA 3SQ0A 3CCRN 1RGIA 2O8FA 3JYTA 3AVJA 1NMDA 3V9ZA 4BGBA 4B3RK 1DTTA 2P9UA 3HSTB 5C2FA 3WXJA 1VQNN 4R79A 3SBGA 3JS6A 3A0IX 1TUYA 4N47A 3OHRA 3D2EA 3H3OB 3NF7A 4FPBA 1MWMA 1NKEA 1WB9A 2WOMA 4BACA 1RBSA 3BGRA 3ZX0A 1NGHA 3ISNC 2VG6A 1JLFA 1NK8A 1SL0A 4CIGA 2YNFA 3L2VA 5CHIA 2PFUA 2PAVA 3NH2A 2HSTA 1ESVA 4CJPA 3L3UA 4QS9A 3SAHA 3OS1A 3OTOK 1NJIO 3QO9A 3TAQA 3RMBA 3K9JA 3OY9A 3RTVA 2NNWA 1CZAN 3IS9A 4YOXA 4LF8K 2NRZA 3SUQA 3VEZA 4I6MA 3LM9A 3D6RA 3CCQN 3RVCA 4CF2A 1EETA 4DQQA 1QTMA 3IKMA 5EU7A 3WXIA 4RW6A 3W3DA 1Q7YO 4MO5A 2Q0RA 3LP2A 5CZ2A 2GEMA 3PV8A 2G8FA 1J53A 4NYNA 2G8KA 5AQMA 3AARA 4IG3A 4IKFA 4BRIA 2IGIA 2GBZA 4ZTFA 3O4WA 4F3TA 2P9PA 5JVGL 3MX5A 1C1AA 4BRQA 3DLHA 2E20A 3FGUA 4FXDA 2DFHA 5BRHA 1XHZA 3I0RA 4XH4A 2X6NA 3L4QA 4Z4HA 4GW6A 5AQTA 1C0TA 2ITGA 1T03A 3ZETA 2W40A 4DLGA 4H5RA 1KAYA 1ZBSA 1X3NA 3FZKA 4K43A 2YX6A 4E1JA 3G71N 5GAEP 2G8WA 5I42A 4KHNA 1WOQA 5BRDA 1QSYA 5HL7L 1T8EA 1KAZA 3SJHA 4AHRA 2F96A 2YKMA 4CHYA 3HI0A 3HJFA 4NCAA 4MDBA 3RRGA 5K14A 3EZWA 5CZ1A 4JYAK 4LC9B 4B9VA 1QSSA 3OYNA 3VQQA 4CHNA 5IWAK 4ISGA 1RTDA 1RFQA 1RBVA 4KPYA 5C12A 3ZT2A 3M3ZA 2B6AA 4YHHK 4A5BA 3NGIA 4DV0K 1R59O 1VSMA 2VCPA 4CZHA 5H1SQ 3OYMA 4FZXC 4O5BA 4EHTA 5C42A 3S3MA 2YI1A 2QI2A 3HXMA 3AGRA 1TKDA 1Q18A 4HHTA 4CBXA 3ULEA 4B8CA 2GWJA 2UUAK 1L3UA 3CMAN 1RT2A 4CBWA 1K8KA 2BGGA 1RNHA 1ZBLA 4LD0A 1CXUA 3IFRA 1QQNA 3CQ8A 4W5QA 4MDAA 3KWIA 3EEQA 3SPYA 4MQ3A 1D9FA 2OANA 3J8AA 3KJVA 4FZZA 3VQ7A 3THVA 4EZ6A 3AVIA 3AVNA 3CFOA 3Q7CA 1TL3A 4O0JA 3R3LA 5JS2A 3TTCA 2QWQA 4OX9K 1NGIA 3QMLA 2UYTA 5DM6L 2R7YA 3V9XA 3I33A 1QQMA 3H1QA 4RW9A 4DV4K 2IC3A 1VSHA 4IDHA 4M3RA 1SS6A 3K59A 3CCMN 2VWBA 4CZIA 4X62K 3VTHA 4O0IA 1LOTB 1KXPA 3OS0A 1Q81O 2P9PB 3E1YA 3OBYA 4YOTA 3KD1E 3HL8A 3HBTA 4KTZA 4OLBA 2HNYA 4MLEA 4FOIA 4EAHD 3DLLL 2UXDK 3O08A 1MA9B 3K0SA 3SQ2A 5KGXA 5C25A 2D4WA 3QLHA 3NE6A 4LFAK 3VOVA 4JKGA 1ZC6A 3MEDA 2CGLA 4F2RA 4JI5K 4QS8A 5BRFA 4CJUA 3CJAA 4I9LA 3DMJA 4ILHA 3CJCA 3C65A 1QHTA 5M1PA 4B9MA 3QEVA 4N76A 3T1YK 5LL6Z 2HHSA 2P9UB 3AVHA 4DS5A 3VQ5A 3THWA 2J4RA 4DUYK 1FJGK 2QWOA 2W6LA 2QEXN 4AM7A 4C8LA 1S1UA 1WSEA 1RCHA 4DQSA 3T1HK 4H5TA 1GOAA 1VSDA 2EHGA 2FC0A 2JWLA 1YVNA 5LMNK 1TK0A 4FLZA 3ZSWA 1TVRA 3SMSA 3TI0A 2HHUA 1VHXA 3VQ9A 1U49A 4NLBA 4WQ4A 3L2RA 2GV9A 2P9NA 3MAQA 2VYPA 2LSNA 3RMCA 2KLAA 5AZJA 3PX0A 3U6FA 4CECA 1O13A 3O3HA 2NRVA 1LWEA 4H0PA 4CJEA 2G8VA 1VRTA 5I3UA 3TAGA 1NOYA 3VQDA 4KI4A 3E9PA 2O8CA 2DTUA 4BRNA 3GE1A 3Q7BA 3CD6N 2HF4A 4FCYA 4B8AB 3G10A 2YNHA 3VQ4A 4FWSA 1KQSM 4PL8A 4E19A 3O1WA 4Q0BA 4FM1A 4FJ5A 4CEOA 4IEEA 4XH5A 3P5JA 3D0PA 1VQMN 4OKEA 1VQ7N 4KAZA 3HYFA 5LJVA 2Q31A 3OW2M 3CM6A 1WBDA 1K6YA 1I39A 3ZT1A 4B08A 4JK7A 4FLXA 4WCEL 2XY6A 4MLHA 2GUPA 3L6QA 4DR3K 2HNDA 2QWLA 3CCSN 3THYA 4Y0WA 3WNFA 1IBMK 1JL1A 1DKGD 2XHBA 2HF3A 4FJ9A 3WNHA 5HRRA 1Q9XA 1QHAA 4KHQA 3QB0A 3ZSQA 3VGMA 3MCPA 1HJOA 3ZLJA 3RRHA 4H5VA 3LDSA 3OYKA 5AQHA 2BDPA 3L4IA 3FR0A 4FYDA 3WXKA 4A61A 3SPZA 4WQ5C 4J2EA 4JI4K 3CPWM 4CEBA 1V4TA 2YKNA 3AA3A 3C7NA 1RTHA 2NRHA 5AQIA 4K25A 3PIOL 3OYGA 4FW2A 3TANA 4KHYA 3CYMA 2E1ZA 5F0XA 4KBOA 3KLEA 5KTQA 1N8RO 2D0AA 4OGEA 4KFBA 4JK9A 3NFAA 5FPEA 3S3OA 4I6MB 4KREA 3O9TA 1KLNA 3HRGA 3P83D 1JLGA 1U2VA 1OKJA 2ITMA 4BDPA 4FVUA 4DMNA 4CJKA 3L2WA 1ZBHA 4HCCA 1X1PA 3SI6A 2PBDA 4KI6A 3E9LA 4BC2A 2IAJA 3KK2A 3KZBA 2BE2A 2V51B 3CQXA 3NDKA 4LSNA 1L3SA 3G0ZA 3U9ZA 4E0DA 2F8TA 3NMUA 3VENA 3M8QA 3CFRA 4CJLA 2QKKA 1EWRA 3VERA 3HM9A 4K8XA 1XI1A 2EX3A 2HMPA 4CD1A 1HLUA 3PY8A 3CI5A 1YJ9N 1S1TA 3MN9A 3PUFA 4OPJA 1VQKN 3DXKB 1YTUA 4CZKA 5J2MA 4JRPA 1WSIA 4LF7K 1HPZA 4E1MA 1UA1A 3H08A 5E26A 3KKSA 2E88A 4CJRA 5JICA 3U8XA 4DR1K 3CCLN 3AVFA 5ELZA 1BQMA 1NMNA 4CJ7A 3VEVA 5EVZA 1WSGA 5DM7L 1WSHA 4KTWA 3LDQA 1K73O 3J7AP 3DI6A 5AQSA 1QQCA 4Z4FA 5AQQA 4LSLA 3KIOA 4CFCA 4H03B 3J7ZO 1VQ5N 2KHOA 4IFEA 2HBMA 3L2QA 1RT1A 5BR8K 5C15A 4JV5K 2OA8A 1HNIA 4XIUA 3LZIA 4BR9A 3DWLA 1OH5A 1BG3A 2ATQA 1RDDA 1JLEA 4BQLA 1HKBA 1RBRA 1QZ5A 1NNEA 3N4PA 2IDOA 2FSNA 5C10A 2CH5A 5M1OA 4XH1A 1C1CA 1YITN 1NGBA 1GLBG 4FWOA 5TKYA 1SUQA 3SLCA 3BDPA 4FLVA 1N32K 4FLTA 3P39A 5JS1A 2O8EB 1TYQA 1VSJA 2HVIA 4NLCA 4AF1A 3UKUB 1NJZA 4BG8A 4AHUA 4IXCA 2D0CA 5EY4A 1QQOA 4E7HA 3AA4A 4DTMA 1VK0A 4W5NA 1BDGA 5AQUA 3I8BA 3UB5A 3K5MA 1K9MO 2A3ZA 3CJ9A 1NKCA 4RWTA 2YHWA 4BRLA 3QNNA 1U04A 2JGUA 2NRTA 5C0YA 3NCIA 1A5VA 4E7JA 4CGDA 5BREA 2GX9A 3VMFB 4DB3A 4EIAA 4JD2A 5BN9A 1ZYQA 3HZ6A 1JCGA 1BOTO 5BPLA 4B3SK 1UAXA 3VETA 3OYLA 1DTQA 1NWKA 2QW9A 5SZTA 3WT0A 4JI8K 1HNVA 3W0LA 2ZJRL 1ZXOA 3OYHA 4CEFA 4H0XB 2P9LB 3MEGA 4C8NA 4DQ8A 4B1WB 4CF1A 2NZTA 3K57A 1BIUA 4GNIA 2IVPA 2QTDA 4B9UA 4JKAA 1JLCA 1WSJA 4DSEA 4CJWA 4H0VB 5J2PA 1NOZA 4HWIA 3O9UA 2G8HA 2PYLA 3BF3A 3M5RA 4BRPA 4FJMA 4O44A 4DSFA 3TARA 2RKIA 5FPMA 3T7ZA 1RTIA 1X9JA 5MLCQ 1BHLA 4F3OA 2IS3A 1Y97A 1TAQA 5E41A 4WFBL 3K5OA 3MK6A 4PY5A 1XHXA 4L3QA 5KRSA 4CF8A 3PSFA 3PLAA 2AP1A 1ASUA 4JI0K 2HBJA 3E66A 3D45A 3M8SA 3WNEA 3K2PA 4CZJA 2F9WA 3LANA 4KH4A 2VWJA 3RR7A 2RE2A 2O8DA 4X66K 4WE1A 2OCEA 3WEEA 3DRRA 4A5AA 3DLKA 4DKWA 2E2PA 3E01A 3VQBA 3MXJA 2O8EA 1RDUA 3ZSVA 1Q86O 5BPMA 2O8DB 2OZSA 3BF1A 2DFFA 1BI4B 2P5OA 1HNXK 5JMVA 4BR5A 5AQJA 2IVOA 5J1EA 1NGAA 2E1YA 4BVPA 1XQSC 4ZTJA 3VQ8A 1RT6A 1JCFA 4NXNK 4WFNL 2FBVA 4HUEA 1GOCA 3KK3A 3SK3A 4TSXA 1KRPA 3THXA 1IKWA 1W0HA 4IZ9A 2F7TA 4GVMA 2NRWA 2VWKA 3RR8A 4LF9K 4BR4A 2VQEK 5AQPA 5BR9A 1WBBA 4Y1CA 3LPTA 5KPRA 3V1QA 4A57A 4FJNA 3HTVA 3AAPA 1SL1A 4AHCA 3SZ2A 4CF0A 1T44A 4JRQA 3ZSZA 4DU4A 3G4SN 4CEDA 5FPNA 4XEIA 3FLCO 1J5EK 3SUPA 4M45A 4IOXA 3ENBA 5KRTA 1BWFO 1T05A 4GV3A 3TTFA 5JLFA 2Q3SA 3C95A 3UIQA 1QVGM 1HYSA 3AVKA 4DV1K 1YJNN 4O55A 4ELTA 3EE8A 4WQ4C 3R6MA 3C94A 2Q97A 2YJEA 4U7BA 1BGXT 2GWKA 3ASMA 1NKBA 4M3YA 3DXMB 3MXMA 1HJRA 3QNOA 4JAXA 4B9SA 4OLAA 2QKBA 1I3AA 5HRSA 1VQ8N 3IMXA 3SAGA 3IAYA 2BUPA 2HVHA 4DTPA 4CBUA 3SQ1A 2P9SB 2QM1A 5AQXA 3O9SA 3HP6A 4B1UB 2XY5A 1BCMA 1SKSA 1RBTA 3FFKB 1XWLA 3ZYYX 3ULDA 3HM8A 1EWQA 3KLFA 3SYZA 2BANA 3VF2A 1B9FA 3V81A 1U47A 3KWGA 4OKKA 1Q8IA 1ZBFA 4FM2A 1P90A 1NGDA 2DFEA 3KD5E 1YXQA 4FL9A 4BR0A 3BEXA 1JLBA 1C6VA 3AA2A 4YOWA 2UUBK 1GLJO 3TSQA 2Q1NA 4CE9A 3PIPL 3BP8A 1GLDG 1XC3A 4CFDA 3K5LA 3D2FB 3QEPA 4JI6K 3VEYA 3DOKA 1JJ2M 2O8CB 1HRHA 3LZJA 3S3NA 4J2DA 4A2BA 3ZEUA 4CJQA 4CZFA 4GKJK 1HNZK 3VEWA 1S1WA 1KCFA 3HOSA 1RDWX 4ZHRA 5A2QO 1Z6RA 4JEPA 2E8AA 2UU9K 1ASWA 2Z1JA 4BE1A 1KVBA 1IJJA 1GLLO 4IBNA 3A8YA 1J6ZA 1RDBA 4M7YA 4CJ4A 4FJ7A 2FBYA 1VSFA 2XO7A 2GTDA 3SQ4A 3ZEUB 4JKCA 4BRGA 4DQPA 2D1KA 2P9IA 3EKUA 4M3TA 2QA4N 4O8UA 4DV6K 3O8MA 2Q0UA 4E7KA 3MX2A 3A5MC 3SAFA 4ISFA 3FE1A 3VN5A 4DR4K 1D9DA 2YV0X 2HMIA 4B9TA 3ULEB 1N6QA 3VEXA 4X64K 1ZBIA 2KZMA 2YNIA 3OYCA 4X65K 1NK5A 4U67L 2F9TA 2GELA 1B92A 5KPTA 1ASVA 2Z1GA 3QEXA 4M41A 4I7FA 3F73A 3L0QA 2Q2RA 1S6PA 1BU6O 3TABA 5B8HA 4B3OA 1XNQK 2DY4A 3A5NC 4PQUA 4DSJA 1TKZA 1L3TA 4C8OA 1BO5O 2V7ZA 3O4NA 1W97L 3ZCMA 4BRHA 3CCVN 2KQ2A 3ENHA 5GINA 5KGWA 4DTOA 5GAGP 4CK2A 2O4GA 3TTDA 3MN5A 1C0UA 4KRFA 2G8UA 3O6WA 4KKOA 4DSKA 3V6DA 4BC5A 2WTUA 4F4KA 3B8AX 3P38A 1RBUA 3NH1A 4LY7A 4CEEA 1YIJN 4IJAA 1D5AA 3MN7A 1OH7A 3MXIA 4CCHA 1YJWN 1IG8A 4CZLA 2V52B 2AJQA 4NO7A 2OPRA 2Z1HA 5IT9O 5M1NA 3LM2A 2ETJA 1Z26A 3R1XA 4CJVA 3VQEA 3O9QA 5HBMA 3HOTA 5DK5A 1BQNA 3LDNA 4KO0A 1V4SA 3MDQA 5SWMA 3P1GA 4J2AA 4DR7K 1JCEA 2UUCK 4LF4K 3KKRA 4DTJA 3GBTA 3O9RA 4OGCA 1YHQN 3C6TA 3ATUA 1JLQA 3HVTA 3FZLA 5M1QA 2YHXA 4GVEA 1IH7A 3L2UA 3VQPA 4DV5K 1B9DA 4BDZA 2QXFA 2HW3A 3QBXA 2P9IB 3FZFA 2A42A 1IO2A 4IFVA 4IFYA 4DR2K 1Z25A 2QXLA 3WNGA 4BR7A 3PO4A 2O8BB 5F1XA 3AGKA 2ZJPL 4B9QA 3H6EA 4I2PA 2FSKA 1HQEA 3KLGA 4FW1A 1SKWA 4L8RB 1S22A 4FO0A 3AO4A 2CH6A 2V7YA 3VQ6A 4FLWA 5EXWA 1XNRK 3FZHA 5CE3A 4PKHA 4KHPK 2KFZA 3RSEA 1NU0A 5AQZA 4OJRA 5EOYA 1CXQA 4DSIA 3OA9A 3VF6A 1IKVA 3THYB 4RW4A 4AHVA 3P31A 4BRKA 5HRPA 1A5XA 4Z4GA 2RN2A 3M1FA 3ZT3A 3E9OA 4DF4A 3NH0A 1HYVA 4A2AA 4IO9L 2YHAA 4IEIA 3B6PA 4JD2B 3T19A 3C6AA 1YUWA 5FPDA 5HLFA 4BC4A 1XMOK 1SQKA 2HB5A 4PL7A 4K41A 3LPUA 5GAHP 3IUCA 1BA0A 1HQUA 4HTLA 1D8YA 4J8FA 2E4LA 3OBWA 1TK5A 1LAVA 1YTAA 3SUOA 4FJXA 1QSLA 2P9KA 5GIOA 1LAWA 4MFBA 1LW2A 4DLEA 1VQLN 2PY5A 4AHTA 4GY2B 1EXQA 3EZ5A 2Y1IA 4CERA 4C23A 5CYMA 3JAMO 2UXBK 5AQFA 1L5UA 3KLHA 2ZD1A 3O4QA 1U48A 4ID1A 3ZSRA 4AILC 2Y1JA 3CPEA 2QK9A 5I9EB 2XY7A 5J2NA 4CGFA 1DEJA 3MN6A 3SV4A 4QAGA 1A5WA 1F21A 1P8ZA 1LW0A 2P9LA 3DRSA 3FZMA 1WAFA 2XRIA 3T1AA 4FWMA 1S9GA 1KAXA 1KFDA 4DV2K 4NXMK 1S1XA 5LMUK 2A40A 4CHQA 1S72N 3IDHA 3N4QA 4JS4A 1ITGA 2PZSA 3ZSYA 4JNEA 2NRRA 2KFNA 3DLGA 5AQGA 3OYAA 3UKUA 3M8RA 2P9KB 1R0AA 2HOEA 4AQYK 3ZSXA 4C8KA 2D0BA 4DF8A 1JLAA 4FWNA 3NAEA 1VAZA 4YOUA 3UE5A 4JKDA 3HSCA 3NF9A 1S1VA 4E1NA 3H1VX 3C6HA 1DGKN 3R9PA 3CC2N 1NK7A 1BUPA 2NRXA 4O5FA 4CEZA 4LFCK 3ZETB 5AZIA 3V9UA 3CETA 4OVLA 2HHWA 3BY5A 4DUZK 2HBLA 4DTXA 4FWPA 2ZQBA 2FSJA 3PX6A 2P51A 3THWB 1QE1A 1KVCA 1HUXA 1SL2A 3M6GA 4YORA 5LY3A 4DQRA 3DAWA 2HBKA 1RILA 3V4IA 1EO1A 1OH8A 4DG1A 1NG9A 3TU5A 5HP1A 4RCHA 3MWPA 5AQLA 3ALYA 3BUZB 2OPSA 4KHSA 4H5WA 4CGHA 1RT5A 3V1OA 4QS7A 3CHWA 2I7NA 2CGJA 3LWLA 3O1BA 5GIPA 5T7BA 2JWKA 3AAQA 2D0PA 1OH6A 3VEOA 4YY3K 4DTRA 1EP4A 4FJKA 2E5LK 1LCUA 2VGNA 3THXB 1REVA 4JKGB 2IVNA 4LH4A 3BZKA 4IO8A 3MEEA 2X74A 4H0TB 3TAMA 3ZX2A 1VSLA 3MWTA 1HKGA 2E2OA 3C6UA 2WUSA 1RT4A 4JI1K 1QZ6A 2H3GX 3NVKA 3WEEB 1NGFA 2B5JA 4BVOA 3LDPA 4BE2A 3QIOA 2KZZA 3LL3A 1ZBUA 3HVRA 1NLVA 3VF4A 1HMVA 5CYQA 1YT3A 3LAMA 3TPQA 3VA0A 2D0OA 3SMPA 3OYBA 3ENOA 4Q5VA 1NBWA 4FJJA 4JK8A 3GL1A 3HP9A 4CGGA 2A1RA 4BG9A 3UKRB 1VSKA 1GOBA 4YNQA 3CCUN 4YDUA 2OZMA 1BL3A 1U2VB 2ZGYA 3LP3A 3VQAA 4ID5A 1Q9YA 1G99A 3AO5A 3IG1A 1HKCA 4RTFD 4N5SA 3PX4A 4DCHA 5E84A 5AQVA 4CK1A 4H0YB 2ASOA 1CZ9A 3AY9A 4LF5K 5KPZA 2OPQA 4BWMA 3U3YA 2Q36A 3EL2A 4KH5A 4BWJA 3OVNA 3QFUA 4PKIA 4IOAL 4OPKA 1XC9A 3IRXA 3VPZA 3QFPA 1T6CA 4AHSA 2ZGZA 5FLXO 2A1SA 4A59A 2HHQA 4BREA 2OTLN 1RDAA 3H46O 4ICLA 1E4GT 4CJ3A 2HNZA 3I56N 4EHUA 2QWPA 1YVUA 4ELVA 3I8DA 4B1ZA 2ZF5O 3HO1A 3V9WA 2AA4A 1C1BA 1KC8O 5AJ3K 1FK9A 1GLEG 2NUBA 3KK1A 1IV0A 5AR0A 4M3UA 2CGKA 1VQ6N 4CK3A 1SAZA 4N56A 3JSMA 2IIRA 1NGCA 2YCHA 4DFMA 3NBPA 3OYDA 3GDQA 1OVYA 3RMDA 3ZX3A 4H4MA 1NK9A 2HHXA 4F2SA 5AFUA 4GKKK 3AVLA 4FOEA 2A41A 1N33K 4YDUC 3VGLA 2PYJA 1YF5L 2Z1IA 3O80A 1XMQK 4PHTX 2ZJQL 1U4BA 3NGZA 1EKEA 1E4FT 4OPHA 3GOIA 1VSEA 3CF5L 3VTIA 1MWKA 2VGMA 4FWKA 1J54A 4CHOA 5CY4A 5GADP 4ISEA 4FWRA 1S6QA 3MECA 4KH6A 1WNSA 2ASPA 1WN7A 3QESA 4DU3A 3GG4A 4QCLA 1VSIA 3T3FA 1JXBA 3I55N 3CMEN 3EKSA 3LP0A 3RSEB 4DSLA 2OYQA 1VQ9N 4A62A 3K58A 4CZGA 4ELUA 3V9SA 3BZCA 1YAGA 3TAEA 3CCEN 3LDLA 1VQ4N 3VQCA 3SUNA 1LWFA 3NF6A 2FXUA 1HPMA 4HUGA 1OVQA 3FFIA 2A6AA 2P9SA 3LWMA 5AQNA 3KHYA 3KK7A 4R5PA 4M63C 4BROA 1CLQA 3DLRA 4LFBK 2YHBA 3CC4N 4DV3K 4B3MK 2HHHK 1WUAA 3F9KA 5C2DA 3SCXA 2BH1A 4DHYA 1JXEA 3DXKA 1N36K 3F5TA 4DQIA 2I7PA 3ZT4A 4CHZA 4DR6K 4FJHA 3O3FA 3DOLA 4W5TA 4JLHA 3ID8A 4IDKA 2XY8A 4WQ5A 1NGJA 3QETA 1H1VA 1HR0K 2QWMA 4YFUA 3KTQA 4PWDA 4QOZB 4EFHA 4B9LA 3EE9A 4B1YB 1T3VA 2FF6A 4NCBA 4KB1A 2QWRA 1VQON 3ID6A 3AO2A 3RWUA 4Z94A 3PO5A 4Z0UA 4DTSA 3SV3A 1BIZA 1J9AA 3AA5X 5KQ8A 3EY1A 3J7YP 4FK0A 5FRMA 3A2FA 1O1WA 1RDCA 1XUPO 3LAKA 1UA0A 3CFPA 3TAFA 3L3VA 4V19S 1QS4A 4F8RA 1JKHA 4N41A 1KTQA 2RHKA 4CFBA 4KHWA 5C24A 3WUHA 3QEIA 2BTFA 3ITHA 3HT3A 3AVMA 3J80O 5ADXH 1C0FA 1GLCG 2FLOA 4B1VA 5FROA 3CJBA 3S41A 1WAJA 1L3VA 1MU2A 5AFUH 1IBLK 3A5LC 1M1KO 2O8FB 5HOOA 1D4XA 1EQYA 1Y64A 4CESA 5BN8A 3OYIA 1TK8A 4WYBA 4DTUA 1M90O 1I94K 3QBWA 4BC3A 5CR4A 4YOYA 4CGJA 4E3SA 4O4GA 1X9WA 1UOCA 4NB4A 3OS2A 3TR8A 4EP5A 4EZ9A 3KLIA 2ZM6K 4JKHA 3KVGA 4OKJA 4FLYA 4M3WA 4DR5K 3D7EO 1T7PA 4FSVA 3UKRA 1NK0A 1KLMA 2KW4A 2ZWHA 4JKEA 3QICA 2RPIA 3R8EA 4B9NA 4BE0A 1TV6A 4BGAA 4Y1DA 1WSFA 3S9HA 5BPNA 4GV6A 4CJ5A 2WC9A 2I5JA 3C0BA 4BDYA 1Z05A 3DLBA 2WONA 1FW6A 1RT3A 3O5BA 2KTQA 1VQPN 2EWSA 1JL2A 4IG0A 4CW7B 4CZMA 4RW7A 3CJ1A 3TSPA 2F8SA 1NJWA 2E2QA 1QVFM 1CZBA 1EX4A 4F9OA 4CVNE 4BY9C 3VESA 4CZEA 1BISA 3AO3A 1TYQB 4C1NI 4H4OA 2YNGA 3QINA 4IJNA 4M42A 4AH9A 4FM0A 4OO1J 4Z4CA 4M3ZA 4CFAA 1W9HA 3MMVA 4EP4A 3A5OC 4FLUA 3CXCM 4J2BA 4GMJB 1FXXA 1KVAA 4BR2A 3HPOA 5JLHA 1KD1O 1IG9A 3M8PA 1RTJA 1K8AO 3OYEA 3EN9A 2FF3B 4YOVA 1BI4A 1S9EA 2WBNA 1IBKK 4E89A 4Z4IA 5M1KA 5J2QA 1NJXA 4G1QA 3OJUA 4E7IA 1TAUA 4FK2A 3SJJA 1C0MA 5ADXA 2HHTA 1BA1A 3AVGA 4BRCA 4KTQA 3F2KA 4E7LA 4CJSA 5D3GA 4PA1A 3CIPA 2ZE2A 4CF9A 3D2FA 4CEQA 1ATRA 1IKYA 3B6OA 5JVHL 3TAPA 3U4LA 5AZJB 3CERA 3DLEA 4HUFA 4O8KA 1KFSA 1N34K 2P9NB 3CC7N 2X6SA 5AQOA 1X3MA 1N5YA 3QIPA 4MO4A 3DXMA 2UXCK 4BRDA 4NCGA 3CCJN 1SKRA 4CEAA 4B3TK 3K5NA 2VQFK 1J5OA 1MDUB 2DPNA 2GUIA 4FWQA 1TKXA 1NK6A 2P1JA 5KQDA 3SBTA 4JKBA 4ILGB 4FWLA 1NM1A 4FVMA 4GV9A 4K42A 4M7XA 5LJWA 3T69A 4CI6A 3NHGA 3CG7A 3H3NO 1IKXA 2YHYA 3JXUA 2X78A 1TUUA 4FK4A 1S3XA 1SV5A 1HNWK 4K8ZA 4W5RA 1X9SA 4CIFA 4OPAA 3U3GA 4KV8A 4LF6K 4DTNA 4KB0A 5AZIB 1GLAG 2OPPA 1YI2N 1NK4A 4PUOA 5DMRA 3AVCA 3WXMB 1X9MA 1TKTA 1U45A 3TWHA 3O3GA 1VRUA 2NLXA 3D2EB 1W7AA 4CIEA 3OJSA 1Q82O 3QDKA 4LH5A 3L8BA 3ATVA 2O4IA 3G6EN 2FBTA 3TSUA 3ZSOA 4KHUA 2ASMA 3VA3A 2W42A 1T6DA 3EO3A 2D5RA
chains in the Genus database with same CATH topology
3BEXA 3MCAB 4YOWA 1ILYA 1GLJO 3TSQA 2Q1NA 2Q36A 3EL2A 4BRNA 4KH5A 3PIPL 3BP8A 3QFUA 3GE1A 1GLDG 1XC3A 4PKIA 4IOAL 3Q7BA 3D2FB 3CD6N 2HF4A 3VEYA 1JJ2M 3VPZA 1KQSM 4FWSA 4A2BA 3ZEUA 4PL8A 4IWVA 3QFPA 4C1NK 3O1WA 4BRFA 1T6CA 4JKFA 4CZFA 3VEWA 5TKWA 2ZGZA 2QWNA 1K8KB 4A59A 4IEEA 4XH5A 3HOSA 4BREA 1RDWX 3G25A 2OTLN 3H46O 1E4GT 5EX5A 1VQMN 4PKGA 1VQ7N 3VGKA 1Z6RA 2E2NA 3P4IA 4JEPA 2E8AA 5AQRA 3U9DA 3WQTA 4BRMA 4EHUA 3I56N 2QWPA 4JHDB 5LJVA 2Q31A 2ZF5O 4B1ZA 3OW2M 2AA4A 1HX1A 1IJJA 1C0GA 1KC8O 4AM6A 1GLLO 1GLEG 4H5NA 3A8YA 1J6ZA 4JK7A 4WCEL 4M7YA 5AR0A 5AQYA 2CGKA 4MLHA 1VQ6N 2GUPA 1SAZA 2GTDA 5F2RA 3L6QA 3NVMA 2QWLA 3WQUA 5M1FA 3CCSN 3ZEUB 4JKCA 4Y0WA 4BRGA 2IIRA 1DKGD 1NGCA 2HF3A 2YCHA 2D1KA 2P9IA 1DT9A 1ATNA 3GDQA 3EKUA 1W2BM 3H45C 1QHAA 1ATSA 4O8UA 1OVYA 2QA4N 4CD3A 3QB0A 3VGMA 2W41A 3MCPA 1HJOA 2Q0UA 3O8MA 3ZX3A 1NGGA 3C7NB 3MX2A 4H5VA 2A5XA 5AFUA 5AQHA 3A5MC 4FOEA 3L4IA 4B1XB 3SAFA 2A41A 4ISFA 3FE1A 3FR0A 4YDUC 3VGLA 1YF5L 3DJCA 3WXKA 3O80A 4A61A 4WF9L 4WQ5C 4PHTX 4G9ZA 2ZJQL 4JN4A 2WFBA 3CPWM 3ULEB 3VEXA 1V4TA 1E4FT 4OPHA 3F9MA 3GOIA 4IOCL 3C7NA 5AQWA 2NRHA 5AQIA 1GLFO 3CF5L 4U67L 2F9TA 3VTIA 1MWKA 2GELA 1NGEA 2VGMA 3CJ7A 3K9KA 4FWKA 4K25A 5KPTA 4WFAL 4JHDA 3PIOL 2E1ZA 5GADP 3L0QA 5F0XA 4KBOA 4ISEA 1N8RO 4FWRA 2Q2RA 1BU6O 4JK9A 5B8HA 5FPEA 4I6MB 5KPZA 4KH6A 2ASPA 3O9TA 4FPAA 1U6ZA 3CQYA 3A5NC 3GG4A 3HRGA 5AQKA 1U2VA 1OKJA 2ITMA 1BO5O 2V7ZA 3WXLA 3I55N 4FVUA 3CMEN 1W97L 4BRHA 3CCVN 4UY8O 4BQZA 3EKSA 3RSEB 3ENHA 5GINA 1VQ9N 4ILJA 4A62A 2OTJN 2KKZA 2PBDA 4H0OA 4CZGA 3E9LA 4BC2A 5GAGP 3KZBA 1YAGA 3TTDA 2V51B 3CQXA 3MN5A 3CCEN 3LDLA 1VQ4N 2YJFA 3O6WA 3U9ZA 1SZ2A 4BC5A 3NMUA 3VENA 2FXUA 1HPMA 3LDOA 3B8AX 3P38A 3VERA 3CCRN 1RGIA 1YIJN 4IJAA 2A6AA 2P9SA 1NMDA 3MN7A 5AQNA 3KHYA 2HMPA 4BGBA 1YJWN 4CD1A 1IG8A 3KK7A 2P9UA 2V52B 1HLUA 4M63C 4CZLA 5C2FA 3WXJA 4BROA 1VQNN 4R79A 3SBGA 3JS6A 4NO7A 3CI5A 3A0IX 1TUYA 1YJ9N 3OHRA 5M1NA 3MN9A 3D2EA 3LM2A 1VQKN 3DXKB 3H3OB 4CZKA 4FPBA 3CC4N 3R1XA 5E26A 1MWMA 1WUAA 2E88A 5C2DA 5JICA 3O9QA 2BH1A 3U8XA 3ZX0A 4DHYA 3HOTA 3DXKA 1NGHA 5ELZA 3F5TA 3CCLN 3LDNA 4CJ7A 2I7PA 3VEVA 1V4SA 3MDQA 5EVZA 1JCEA 5CHIA 2PFUA 2PAVA 2HSTA 5DM7L 3GBTA 3O9RA 1ESVA 1YHQN 3ATUA 3FZLA 3ID8A 3LDQA 5M1QA 1K73O 4WQ5A 1NGJA 4QS9A 1H1VA 2YHXA 3SAHA 2QWMA 1NJIO 4GVEA 5AQSA 4EFHA 3EE9A 4B1YB 1T3VA 2FF6A 3K9JA 2NNWA 1CZAN 2QWRA 3QBXA 5AQQA 2P9IB 3J7ZO 3FZFA 2A42A 4H03B 4YOXA 1VQ5N 2KHOA 2QXLA 4BR7A 2NRZA 1VQON 3ID6A 5F1XA 4IFEA 2HBMA 3AGKA 4Z94A 2ZJPL 3VEZA 4B9QA 5C15A 3H6EA 4I6MA 3LM9A 3D6RA 3CCQN 3RVCA 3DWLA 4BR9A 5KQ8A 2FSKA 3IKMA 1BG3A 1S22A 4FO0A 1XUPO 1HKBA 2CH6A 2V7YA 3WXIA 1QZ5A 4BQLA 5EXWA 3N4PA 3FZHA 3W3DA 5CE3A 2FSNA 5C10A 2CH5A 4PKHA 4MO5A 2Q0RA 4XH1A 5M1OA 3RSEA 5AQZA 1Q7YO 1YITN 1NGBA 5EOYA 2RHKA 2GEMA 1GLBG 3OA9A 3VF6A 4FWOA 5TKYA 5AQMA 3P31A 3SLCA 4BRKA 3WUHA 3AARA 4BRIA 2BTFA 3O4WA 3P39A 3M1FA 5ADXH 1C0FA 1TYQA 2P9PA 3E9OA 1GLCG 2FLOA 5JVGL 4B1VA 3CJBA 4NLCA 3S41A 3MX5A 4BRQA 2E20A 4AF1A 5AFUH 3UKUB 3FGUA 4A2AA 4BG8A 3A5LC 4IO9L 1M1KO 4IXCA 5BRHA 4IEIA 5EY4A 4JD2B 1QQOA 4XH4A 5HOOA 3L4QA 5AQTA 3C6AA 1D4XA 1EQYA 1YUWA 1Y64A 2W40A 3ZETA 1BDGA 5AQUA 4BC4A 5FPDA 5BN8A 3I8BA 3UB5A 1K9MO 2A3ZA 3CJ9A 4H5RA 1KAYA 1SQKA 1ZBSA 4RWTA 4WYBA 4PL7A 2YHWA 1M90O 3QBWA 4BC3A 4K41A 4BRLA 1X3NA 3FZKA 5GAHP 3IUCA 1BA0A 2NRTA 4HTLA 4K43A 2YX6A 5C0YA 4J8FA 4E1JA 5BREA 5CR4A 3OBWA 4YOYA 3G71N 2GX9A 3VMFB 5GAEP 4DB3A 4NB4A 1WOQA 4EIAA 4JD2A 3KVGA 4JKHA 5BN9A 2P9KA 5BRDA 5GIOA 3D7EO 5HL7L 4FSVA 3HZ6A 1KAZA 3UKRA 3SJHA 1JCGA 1BOTO 2ZWHA 5BPLA 3HI0A 4JKEA 3QICA 3VETA 1VQLN 3R8EA 4BGAA 4MDBA 1NWKA 2QW9A 4GY2B 3EZWA 5BPNA 4LC9B 3WT0A 4C23A 3W0LA 2ZJRL 4GV6A 1ZXOA 5AQFA 4ISGA 4H0XB 2P9LB 2WC9A 1RFQA 3C0BA 4DQ8A 4B1WB 5C12A 3M3ZA 4A5BA 2NZTA 1Z05A 4GNIA 2IVPA 2QTDA 3CPEA 1R59O 3O5BA 2VCPA 4JKAA 1VQPN 2EWSA 4CZHA 5H1SQ 5I9EB 4CZMA 4EHTA 2YI1A 3CJ1A 3TSPA 1DEJA 2QI2A 3MN6A 3AGRA 1Q18A 2E2QA 4CBXA 1QVFM 4H0VB 3ULEA 1P8ZA 2GWJA 4HWIA 3O9UA 2P9LA 3FZMA 3CMAN 4F9OA 4BY9C 4CBWA 1K8KA 3VESA 4CZEA 3BF3A 3M5RA 1TYQB 4FWMA 4BRPA 3IFRA 1QQNA 1KAXA 5FPMA 4C1NI 3T7ZA 4MDAA 3KWIA 1X9JA 5MLCQ 2A40A 4IJNA 4OO1J 1S72N 3IDHA 3N4QA 4JNEA 2NRRA 2OANA 3J8AA 3MMVA 4WFBL 5AQGA 3MK6A 3A5OC 3UKUA 3Q7CA 2P9KB 4L3QA 3CXCM 2HOEA 3R3LA 3TTCA 2QWQA 4BR2A 3PLAA 5JLHA 2AP1A 1NGIA 3QMLA 1KD1O 2HBJA 3E66A 2UYTA 4FWNA 5DM6L 1VAZA 4YOUA 3I33A 3UE5A 4JKDA 3HSCA 1K8AO 1QQMA 3H1QA 3EN9A 2FF3B 3C6HA 3H1VX 1DGKN 2F9WA 4KH4A 3R9PA 4CZJA 4IDHA 4YOVA 3CC2N 2RE2A 1BUPA 2WBNA 2NRXA 1SS6A 4O5FA 5M1KA 3ZETB 3CCMN 3WEEA 5AZIA 3CETA 2VWBA 4CZIA 3VTHA 2HBLA 4A5AA 4FWPA 4DKWA 2E2PA 2FSJA 5ADXA 1LOTB 1KXPA 1BA1A 4BRCA 1HUXA 1Q81O 2P9PB 1RDUA 3E1YA 3F2KA 3M6GA 3OBYA 1Q86O 3CIPA 4YORA 5BPMA 5LY3A 4YOTA 3HBTA 3BF1A 3DAWA 3D2FA 2HBKA 4MLEA 4FOIA 4EAHD 3DLLL 1EO1A 1ATRA 4BR0A 4BR5A 5AQJA 5JMVA 2IVOA 5JVHL 1NGAA 2E1YA 3O08A 3TU5A 1XQSC 3U4LA 1MA9B 4BVPA 4RCHA 5AZJB 2D4WA 1JCFA 3CERA 3MWPA 3VOVA 4JKGA 5AQLA 4O8KA 1ZC6A 3BUZB 4WFNL 2CGLA 4H5WA 2P9NB 3CC7N 5AQOA 1X3MA 4QS7A 3CHWA 4MO4A 4QS8A 3SK3A 5BRFA 2I7NA 2CGJA 3DXMA 3O1BA 4BRDA 4IZ9A 3CJAA 5GIPA 2F7TA 2NRWA 4ILHA 3CJCA 2JWKA 3C65A 4BR4A 3AAQA 2D0PA 5AQPA 3CCJN 5BR9A 5M1PA 5KPRA 3VEOA 4A57A 3HTVA 3AAPA 1MDUB 2DPNA 4FWQA 1LCUA 2VGNA 2P9UB 1T44A 2J4RA 4JKGB 2IVNA 5KQDA 3SBTA 4IO8A 4BRAA 4JKBA 4H0TB 3G4SN 4ILGB 2QWOA 4FWLA 1NM1A 3MWTA 3ZX2A 1HKGA 4K42A 5FPNA 2E2OA 4AM7A 2QEXN 4XEIA 4GV9A 3FLCO 4M7XA 2WUSA 5LJWA 1QZ6A 2H3GX 4IOXA 3ENBA 3NVKA 1BWFO 3T69A 3WEEB 3TTFA 3H3NO 4CI6A 5JLFA 1NGFA 4GV3A 4BVOA 3LDPA 4H5TA 1QVGM 2YHYA 3JXUA 1YJNN 1TUUA 3LL3A 3EE8A 2JWLA 4WQ4C 1YVNA 3R6MA 1S3XA 2Q97A 2YJEA 1NLVA 4U7BA 2GWKA 3SMSA 3VF4A 3DXMB 4NLBA 4OPAA 4WQ4A 3TPQA 2P9NA 2D0OA 3SMPA 4JAXA 3ENOA 1NBWA 2VYPA 4JK8A 3GL1A 5AZIB 1GLAG 1VQ8N 3IMXA 3SAGA 2BUPA 1YI2N 4CBUA 4BG9A 2P9SB 2QM1A 3UKRB 5AQXA 3O9SA 2KLAA 5AZJA 3WXMB 4B1UB 3CCUN 1O13A 4YDUA 1U2VB 2ZGYA 3FFKB 1G99A 3ZYYX 2NRVA 2NLXA 3D2EB 3HM8A 4H0PA 1HKCA 1Q82O 3QDKA 3VF2A 3ATVA 4RTFD 3G6EN 3EO3A 3TSUA 3KWGA 4DCHA 5E84A 1P90A 1NGDA 2ASMA 5AQVA 1YXQA 4FL9A 1T6DA 4H0YB 2ASOA 3AY9A 3E9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R3L A;  3Q7B A;  4GVE A;  3MX5 A;  3MWP A;  3MWT A;  4GV3 A;  4GV9 A;  3Q7C A;  4GV6 A;  3MX2 A;  4FVU A;  4G9Z A; 
#chains in the Genus database with same CATH topology
 3MCA B;  3NGY A;  1ILY A;  3QEW A;  3HK2 A;  4W5O A;  3LAL A;  4HVJ A;  4M3X A;  4JI7 K;  4DS4 A;  3QER A;  4K0K K;  3AVB A;  2VG7 A;  4JI3 K;  4IWV A;  4C1N K;  4BRF A;  1RT7 A;  4JKF A;  5TKW A;  2QWN A;  1K8K B;  3AV9 A;  4NYF A;  1E3M A;  2B4J A;  4DFJ A;  3G25 A;  2F4V K;  4FJG A;  4I2Q A;  3LP1 A;  5EX5 A;  1UWB A;  4PKG A;  3VGK A;  3P4I A;  2E2N A;  5AQR A;  3DYA A;  3PSI A;  3U9D A;  4BRM A;  3WQT A;  4UQG A;  2IOC A;  4JHD B;  1TL1 A;  1HX1 A;  1BCO A;  1C0G A;  1DLO A;  4FZY A;  4AM6 A;  4RW8 A;  3RMA A;  4H5N A;  1FKO A;  5AQY A;  4RG8 A;  3DM2 A;  4JI2 K;  5F2R A;  3NVM A;  3WQU A;  3HPG A;  5M1F A;  4FJ8 A;  4DV7 K;  3OYJ A;  2RF2 A;  1DT9 A;  1ATN A;  4HCB A;  1W2B M;  3H45 C;  4DFP A;  1ATS A;  4CD3 A;  4CGI A;  2W41 A;  5KI6 A;  1NGG A;  3AVA A;  3C7N B;  2A5X A;  5HRN A;  1G15 A;  4DFK A;  1TGO A;  4B1X B;  4BRA A;  4CHP A;  4WF9 L;  3DJC A;  4G9Z A;  5HRO A;  2W6K A;  2VG5 A;  4FJL A;  4JN4 A;  2WFB A;  4C8M A;  1S5J A;  3CM5 A;  3F9M A;  4IOC L;  4CJF A;  5AQW A;  1GLF O;  1NGE A;  3K9K A;  3CJ7 A;  4CJT A;  4WFA L;  2P5G A;  2E6M A;  4JHD A;  3OYF A;  4FJI A;  1HYZ A;  2E6L A;  4DWI A;  3I0S A;  3DRP A;  2JLE A;  2FBX A;  4FPA A;  1U6Z A;  3CQY A;  1LWC A;  3NF8 A;  5AQK A;  3WXL A;  1FKP A;  2O8B A;  4UY8 O;  4BQZ A;  3SNN A;  4HTU A;  5FDL A;  4ILJ A;  2HHV A;  4DU1 A;  2OTJ N;  1WLJ A;  3ZT0 A;  2KKZ A;  4H8K A;  4H0O A;  1KSP A;  4Z4E A;  3V1R A;  3HPH A;  3J81 O;  1NJY A;  3AO1 A;  1LV5 A;  2YJF A;  1SZ2 A;  5FRN A;  3EYZ A;  4JS5 A;  3LDO A;  4I9Q A;  2G8I A;  3SQ0 A;  3CCR N;  1RGI A;  2O8F A;  3JYT A;  3AVJ A;  1NMD A;  3V9Z A;  4BGB A;  4B3R K;  1DTT A;  2P9U A;  3HST B;  5C2F A;  3WXJ A;  1VQN N;  4R79 A;  3SBG A;  3JS6 A;  3A0I X;  1TUY A;  4N47 A;  3OHR A;  3D2E A;  3H3O B;  3NF7 A;  4FPB A;  1MWM A;  1NKE A;  1WB9 A;  2WOM A;  4BAC A;  1RBS A;  3BGR A;  3ZX0 A;  1NGH A;  3ISN C;  2VG6 A;  1JLF A;  1NK8 A;  1SL0 A;  4CIG A;  2YNF A;  3L2V A;  5CHI A;  2PFU A;  2PAV A;  3NH2 A;  2HST A;  1ESV A;  4CJP A;  3L3U A;  4QS9 A;  3SAH A;  3OS1 A;  3OTO K;  1NJI O;  3QO9 A;  3TAQ A;  3RMB A;  3K9J A;  3OY9 A;  3RTV A;  2NNW A;  1CZA N;  3IS9 A;  4YOX A;  4LF8 K;  2NRZ A;  3SUQ A;  3VEZ A;  4I6M A;  3LM9 A;  3D6R A;  3CCQ N;  3RVC A;  4CF2 A;  1EET A;  4DQQ A;  1QTM A;  3IKM A;  5EU7 A;  3WXI A;  4RW6 A;  3W3D A;  1Q7Y O;  4MO5 A;  2Q0R A;  3LP2 A;  5CZ2 A;  2GEM A;  3PV8 A;  2G8F A;  1J53 A;  4NYN A;  2G8K A;  5AQM A;  3AAR A;  4IG3 A;  4IKF A;  4BRI A;  2IGI A;  2GBZ A;  4ZTF A;  3O4W A;  4F3T A;  2P9P A;  5JVG L;  3MX5 A;  1C1A A;  4BRQ A;  3DLH A;  2E20 A;  3FGU A;  4FXD A;  2DFH A;  5BRH A;  1XHZ A;  3I0R A;  4XH4 A;  2X6N A;  3L4Q A;  4Z4H A;  4GW6 A;  5AQT A;  1C0T A;  2ITG A;  1T03 A;  3ZET A;  2W40 A;  4DLG A;  4H5R A;  1KAY A;  1ZBS A;  1X3N A;  3FZK A;  4K43 A;  2YX6 A;  4E1J A;  3G71 N;  5GAE P;  2G8W A;  5I42 A;  4KHN A;  1WOQ A;  5BRD A;  1QSY A;  5HL7 L;  1T8E A;  1KAZ A;  3SJH A;  4AHR A;  2F96 A;  2YKM A;  4CHY A;  3HI0 A;  3HJF A;  4NCA A;  4MDB A;  3RRG A;  5K14 A;  3EZW A;  5CZ1 A;  4JYA K;  4LC9 B;  4B9V A;  1QSS A;  3OYN A;  3VQQ A;  4CHN A;  5IWA K;  4ISG A;  1RTD A;  1RFQ A;  1RBV A;  4KPY A;  5C12 A;  3ZT2 A;  3M3Z A;  2B6A A;  4YHH K;  4A5B A;  3NGI A;  4DV0 K;  1R59 O;  1VSM A;  2VCP A;  4CZH A;  5H1S Q;  3OYM A;  4FZX C;  4O5B A;  4EHT A;  5C42 A;  3S3M A;  2YI1 A;  2QI2 A;  3HXM A;  3AGR A;  1TKD A;  1Q18 A;  4HHT A;  4CBX A;  3ULE A;  4B8C A;  2GWJ A;  2UUA K;  1L3U A;  3CMA N;  1RT2 A;  4CBW A;  1K8K A;  2BGG A;  1RNH A;  1ZBL A;  4LD0 A;  1CXU A;  3IFR A;  1QQN A;  3CQ8 A;  4W5Q A;  4MDA A;  3KWI A;  3EEQ A;  3SPY A;  4MQ3 A;  1D9F A;  2OAN A;  3J8A A;  3KJV A;  4FZZ A;  3VQ7 A;  3THV A;  4EZ6 A;  3AVI A;  3AVN A;  3CFO A;  3Q7C A;  1TL3 A;  4O0J A;  3R3L A;  5JS2 A;  3TTC A;  2QWQ A;  4OX9 K;  1NGI A;  3QML A;  2UYT A;  5DM6 L;  2R7Y A;  3V9X A;  3I33 A;  1QQM A;  3H1Q A;  4RW9 A;  4DV4 K;  2IC3 A;  1VSH A;  4IDH A;  4M3R A;  1SS6 A;  3K59 A;  3CCM N;  2VWB A;  4CZI A;  4X62 K;  3VTH A;  4O0I A;  1LOT B;  1KXP A;  3OS0 A;  1Q81 O;  2P9P B;  3E1Y A;  3OBY A;  4YOT A;  3KD1 E;  3HL8 A;  3HBT A;  4KTZ A;  4OLB A;  2HNY A;  4MLE A;  4FOI A;  4EAH D;  3DLL L;  2UXD K;  3O08 A;  1MA9 B;  3K0S A;  3SQ2 A;  5KGX A;  5C25 A;  2D4W A;  3QLH A;  3NE6 A;  4LFA K;  3VOV A;  4JKG A;  1ZC6 A;  3MED A;  2CGL A;  4F2R A;  4JI5 K;  4QS8 A;  5BRF A;  4CJU A;  3CJA A;  4I9L A;  3DMJ A;  4ILH A;  3CJC A;  3C65 A;  1QHT A;  5M1P A;  4B9M A;  3QEV A;  4N76 A;  3T1Y K;  5LL6 Z;  2HHS A;  2P9U B;  3AVH A;  4DS5 A;  3VQ5 A;  3THW A;  2J4R A;  4DUY K;  1FJG K;  2QWO A;  2W6L A;  2QEX N;  4AM7 A;  4C8L A;  1S1U A;  1WSE A;  1RCH A;  4DQS A;  3T1H K;  4H5T A;  1GOA A;  1VSD A;  2EHG A;  2FC0 A;  2JWL A;  1YVN A;  5LMN K;  1TK0 A;  4FLZ A;  3ZSW A;  1TVR A;  3SMS A;  3TI0 A;  2HHU A;  1VHX A;  3VQ9 A;  1U49 A;  4NLB A;  4WQ4 A;  3L2R A;  2GV9 A;  2P9N A;  3MAQ A;  2VYP A;  2LSN A;  3RMC A;  2KLA A;  5AZJ A;  3PX0 A;  3U6F A;  4CEC A;  1O13 A;  3O3H A;  2NRV A;  1LWE A;  4H0P A;  4CJE A;  2G8V A;  1VRT A;  5I3U A;  3TAG A;  1NOY A;  3VQD A;  4KI4 A;  3E9P A;  2O8C A;  2DTU A;  4BRN A;  3GE1 A;  3Q7B A;  3CD6 N;  2HF4 A;  4FCY A;  4B8A B;  3G10 A;  2YNH A;  3VQ4 A;  4FWS A;  1KQS M;  4PL8 A;  4E19 A;  3O1W A;  4Q0B A;  4FM1 A;  4FJ5 A;  4CEO A;  4IEE A;  4XH5 A;  3P5J A;  3D0P A;  1VQM N;  4OKE A;  1VQ7 N;  4KAZ A;  3HYF A;  5LJV A;  2Q31 A;  3OW2 M;  3CM6 A;  1WBD A;  1K6Y A;  1I39 A;  3ZT1 A;  4B08 A;  4JK7 A;  4FLX A;  4WCE L;  2XY6 A;  4MLH A;  2GUP A;  3L6Q A;  4DR3 K;  2HND A;  2QWL A;  3CCS N;  3THY A;  4Y0W A;  3WNF A;  1IBM K;  1JL1 A;  1DKG D;  2XHB A;  2HF3 A;  4FJ9 A;  3WNH A;  5HRR A;  1Q9X A;  1QHA A;  4KHQ A;  3QB0 A;  3ZSQ A;  3VGM A;  3MCP A;  1HJO A;  3ZLJ A;  3RRH A;  4H5V A;  3LDS A;  3OYK A;  5AQH A;  2BDP A;  3L4I A;  3FR0 A;  4FYD A;  3WXK A;  4A61 A;  3SPZ A;  4WQ5 C;  4J2E A;  4JI4 K;  3CPW M;  4CEB A;  1V4T A;  2YKN A;  3AA3 A;  3C7N A;  1RTH A;  2NRH A;  5AQI A;  4K25 A;  3PIO L;  3OYG A;  4FW2 A;  3TAN A;  4KHY A;  3CYM A;  2E1Z A;  5F0X A;  4KBO A;  3KLE A;  5KTQ A;  1N8R O;  2D0A A;  4OGE A;  4KFB A;  4JK9 A;  3NFA A;  5FPE A;  3S3O A;  4I6M B;  4KRE A;  3O9T A;  1KLN A;  3HRG A;  3P83 D;  1JLG A;  1U2V A;  1OKJ A;  2ITM A;  4BDP A;  4FVU A;  4DMN A;  4CJK A;  3L2W A;  1ZBH A;  4HCC A;  1X1P A;  3SI6 A;  2PBD A;  4KI6 A;  3E9L A;  4BC2 A;  2IAJ A;  3KK2 A;  3KZB A;  2BE2 A;  2V51 B;  3CQX A;  3NDK A;  4LSN A;  1L3S A;  3G0Z A;  3U9Z A;  4E0D A;  2F8T A;  3NMU A;  3VEN A;  3M8Q A;  3CFR A;  4CJL A;  2QKK A;  1EWR A;  3VER A;  3HM9 A;  4K8X A;  1XI1 A;  2EX3 A;  2HMP A;  4CD1 A;  1HLU A;  3PY8 A;  3CI5 A;  1YJ9 N;  1S1T A;  3MN9 A;  3PUF A;  4OPJ A;  1VQK N;  3DXK B;  1YTU A;  4CZK A;  5J2M A;  4JRP A;  1WSI A;  4LF7 K;  1HPZ A;  4E1M A;  1UA1 A;  3H08 A;  5E26 A;  3KKS A;  2E88 A;  4CJR A;  5JIC A;  3U8X A;  4DR1 K;  3CCL N;  3AVF A;  5ELZ A;  1BQM A;  1NMN A;  4CJ7 A;  3VEV A;  5EVZ A;  1WSG A;  5DM7 L;  1WSH A;  4KTW A;  3LDQ A;  1K73 O;  3J7A P;  3DI6 A;  5AQS A;  1QQC A;  4Z4F A;  5AQQ A;  4LSL A;  3KIO A;  4CFC A;  4H03 B;  3J7Z O;  1VQ5 N;  2KHO A;  4IFE A;  2HBM A;  3L2Q A;  1RT1 A;  5BR8 K;  5C15 A;  4JV5 K;  2OA8 A;  1HNI A;  4XIU A;  3LZI A;  4BR9 A;  3DWL A;  1OH5 A;  1BG3 A;  2ATQ A;  1RDD A;  1JLE A;  4BQL A;  1HKB A;  1RBR A;  1QZ5 A;  1NNE A;  3N4P A;  2IDO A;  2FSN A;  5C10 A;  2CH5 A;  5M1O A;  4XH1 A;  1C1C A;  1YIT N;  1NGB A;  1GLB G;  4FWO A;  5TKY A;  1SUQ A;  3SLC A;  3BDP A;  4FLV A;  1N32 K;  4FLT A;  3P39 A;  5JS1 A;  2O8E B;  1TYQ A;  1VSJ A;  2HVI A;  4NLC A;  4AF1 A;  3UKU B;  1NJZ A;  4BG8 A;  4AHU A;  4IXC A;  2D0C A;  5EY4 A;  1QQO A;  4E7H A;  3AA4 A;  4DTM A;  1VK0 A;  4W5N A;  1BDG A;  5AQU A;  3I8B A;  3UB5 A;  3K5M A;  1K9M O;  2A3Z A;  3CJ9 A;  1NKC A;  4RWT A;  2YHW A;  4BRL A;  3QNN A;  1U04 A;  2JGU A;  2NRT A;  5C0Y A;  3NCI A;  1A5V A;  4E7J A;  4CGD A;  5BRE A;  2GX9 A;  3VMF B;  4DB3 A;  4EIA A;  4JD2 A;  5BN9 A;  1ZYQ A;  3HZ6 A;  1JCG A;  1BOT O;  5BPL A;  4B3S K;  1UAX A;  3VET A;  3OYL A;  1DTQ A;  1NWK A;  2QW9 A;  5SZT A;  3WT0 A;  4JI8 K;  1HNV A;  3W0L A;  2ZJR L;  1ZXO A;  3OYH A;  4CEF A;  4H0X B;  2P9L B;  3MEG A;  4C8N A;  4DQ8 A;  4B1W B;  4CF1 A;  2NZT A;  3K57 A;  1BIU A;  4GNI A;  2IVP A;  2QTD A;  4B9U A;  4JKA A;  1JLC A;  1WSJ A;  4DSE A;  4CJW A;  4H0V B;  5J2P A;  1NOZ A;  4HWI A;  3O9U A;  2G8H A;  2PYL A;  3BF3 A;  3M5R A;  4BRP A;  4FJM A;  4O44 A;  4DSF A;  3TAR A;  2RKI A;  5FPM A;  3T7Z A;  1RTI A;  1X9J A;  5MLC Q;  1BHL A;  4F3O A;  2IS3 A;  1Y97 A;  1TAQ A;  5E41 A;  4WFB L;  3K5O A;  3MK6 A;  4PY5 A;  1XHX A;  4L3Q A;  5KRS A;  4CF8 A;  3PSF A;  3PLA A;  2AP1 A;  1ASU A;  4JI0 K;  2HBJ A;  3E66 A;  3D45 A;  3M8S A;  3WNE A;  3K2P A;  4CZJ A;  2F9W A;  3LAN A;  4KH4 A;  2VWJ A;  3RR7 A;  2RE2 A;  2O8D A;  4X66 K;  4WE1 A;  2OCE A;  3WEE A;  3DRR A;  4A5A A;  3DLK A;  4DKW A;  2E2P A;  3E01 A;  3VQB A;  3MXJ A;  2O8E A;  1RDU A;  3ZSV A;  1Q86 O;  5BPM A;  2O8D B;  2OZS A;  3BF1 A;  2DFF A;  1BI4 B;  2P5O A;  1HNX K;  5JMV A;  4BR5 A;  5AQJ A;  2IVO A;  5J1E A;  1NGA A;  2E1Y A;  4BVP A;  1XQS C;  4ZTJ A;  3VQ8 A;  1RT6 A;  1JCF A;  4NXN K;  4WFN L;  2FBV A;  4HUE A;  1GOC A;  3KK3 A;  3SK3 A;  4TSX A;  1KRP A;  3THX A;  1IKW A;  1W0H A;  4IZ9 A;  2F7T A;  4GVM A;  2NRW A;  2VWK A;  3RR8 A;  4LF9 K;  4BR4 A;  2VQE K;  5AQP A;  5BR9 A;  1WBB A;  4Y1C A;  3LPT A;  5KPR A;  3V1Q A;  4A57 A;  4FJN A;  3HTV A;  3AAP A;  1SL1 A;  4AHC A;  3SZ2 A;  4CF0 A;  1T44 A;  4JRQ A;  3ZSZ A;  4DU4 A;  3G4S N;  4CED A;  5FPN A;  4XEI A;  3FLC O;  1J5E K;  3SUP A;  4M45 A;  4IOX A;  3ENB A;  5KRT A;  1BWF O;  1T05 A;  4GV3 A;  3TTF A;  5JLF A;  2Q3S A;  3C95 A;  3UIQ A;  1QVG M;  1HYS A;  3AVK A;  4DV1 K;  1YJN N;  4O55 A;  4ELT A;  3EE8 A;  4WQ4 C;  3R6M A;  3C94 A;  2Q97 A;  2YJE A;  4U7B A;  1BGX T;  2GWK A;  3ASM A;  1NKB A;  4M3Y A;  3DXM B;  3MXM A;  1HJR A;  3QNO A;  4JAX A;  4B9S A;  4OLA A;  2QKB A;  1I3A A;  5HRS A;  1VQ8 N;  3IMX A;  3SAG A;  3IAY A;  2BUP A;  2HVH A;  4DTP A;  4CBU A;  3SQ1 A;  2P9S B;  2QM1 A;  5AQX A;  3O9S A;  3HP6 A;  4B1U B;  2XY5 A;  1BCM A;  1SKS A;  1RBT A;  3FFK B;  1XWL A;  3ZYY X;  3ULD A;  3HM8 A;  1EWQ A;  3KLF A;  3SYZ A;  2BAN A;  3VF2 A;  1B9F A;  3V81 A;  1U47 A;  3KWG A;  4OKK A;  1Q8I A;  1ZBF A;  4FM2 A;  1P90 A;  1NGD A;  2DFE A;  3KD5 E;  1YXQ A;  4FL9 A;  4BR0 A;  3BEX A;  1JLB A;  1C6V A;  3AA2 A;  4YOW A;  2UUB K;  1GLJ O;  3TSQ A;  2Q1N A;  4CE9 A;  3PIP L;  3BP8 A;  1GLD G;  1XC3 A;  4CFD A;  3K5L A;  3D2F B;  3QEP A;  4JI6 K;  3VEY A;  3DOK A;  1JJ2 M;  2O8C B;  1HRH A;  3LZJ A;  3S3N A;  4J2D A;  4A2B A;  3ZEU A;  4CJQ A;  4CZF A;  4GKJ K;  1HNZ K;  3VEW A;  1S1W A;  1KCF A;  3HOS A;  1RDW X;  4ZHR A;  5A2Q O;  1Z6R A;  4JEP A;  2E8A A;  2UU9 K;  1ASW A;  2Z1J A;  4BE1 A;  1KVB A;  1IJJ A;  1GLL O;  4IBN A;  3A8Y A;  1J6Z A;  1RDB A;  4M7Y A;  4CJ4 A;  4FJ7 A;  2FBY A;  1VSF A;  2XO7 A;  2GTD A;  3SQ4 A;  3ZEU B;  4JKC A;  4BRG A;  4DQP A;  2D1K A;  2P9I A;  3EKU A;  4M3T A;  2QA4 N;  4O8U A;  4DV6 K;  3O8M A;  2Q0U A;  4E7K A;  3MX2 A;  3A5M C;  3SAF A;  4ISF A;  3FE1 A;  3VN5 A;  4DR4 K;  1D9D A;  2YV0 X;  2HMI A;  4B9T A;  3ULE B;  1N6Q A;  3VEX A;  4X64 K;  1ZBI A;  2KZM A;  2YNI A;  3OYC A;  4X65 K;  1NK5 A;  4U67 L;  2F9T A;  2GEL A;  1B92 A;  5KPT A;  1ASV A;  2Z1G A;  3QEX A;  4M41 A;  4I7F A;  3F73 A;  3L0Q A;  2Q2R A;  1S6P A;  1BU6 O;  3TAB A;  5B8H A;  4B3O A;  1XNQ K;  2DY4 A;  3A5N C;  4PQU A;  4DSJ A;  1TKZ A;  1L3T A;  4C8O A;  1BO5 O;  2V7Z A;  3O4N A;  1W97 L;  3ZCM A;  4BRH A;  3CCV N;  2KQ2 A;  3ENH A;  5GIN A;  5KGW A;  4DTO A;  5GAG P;  4CK2 A;  2O4G A;  3TTD A;  3MN5 A;  1C0U A;  4KRF A;  2G8U A;  3O6W A;  4KKO A;  4DSK A;  3V6D A;  4BC5 A;  2WTU A;  4F4K A;  3B8A X;  3P38 A;  1RBU A;  3NH1 A;  4LY7 A;  4CEE A;  1YIJ N;  4IJA A;  1D5A A;  3MN7 A;  1OH7 A;  3MXI A;  4CCH A;  1YJW N;  1IG8 A;  4CZL A;  2V52 B;  2AJQ A;  4NO7 A;  2OPR A;  2Z1H A;  5IT9 O;  5M1N A;  3LM2 A;  2ETJ A;  1Z26 A;  3R1X A;  4CJV A;  3VQE A;  3O9Q A;  5HBM A;  3HOT A;  5DK5 A;  1BQN A;  3LDN A;  4KO0 A;  1V4S A;  3MDQ A;  5SWM A;  3P1G A;  4J2A A;  4DR7 K;  1JCE A;  2UUC K;  4LF4 K;  3KKR A;  4DTJ A;  3GBT A;  3O9R A;  4OGC A;  1YHQ N;  3C6T A;  3ATU A;  1JLQ A;  3HVT A;  3FZL A;  5M1Q A;  2YHX A;  4GVE A;  1IH7 A;  3L2U A;  3VQP A;  4DV5 K;  1B9D A;  4BDZ A;  2QXF A;  2HW3 A;  3QBX A;  2P9I B;  3FZF A;  2A42 A;  1IO2 A;  4IFV A;  4IFY A;  4DR2 K;  1Z25 A;  2QXL A;  3WNG A;  4BR7 A;  3PO4 A;  2O8B B;  5F1X A;  3AGK A;  2ZJP L;  4B9Q A;  3H6E A;  4I2P A;  2FSK A;  1HQE A;  3KLG A;  4FW1 A;  1SKW A;  4L8R B;  1S22 A;  4FO0 A;  3AO4 A;  2CH6 A;  2V7Y A;  3VQ6 A;  4FLW A;  5EXW A;  1XNR K;  3FZH A;  5CE3 A;  4PKH A;  4KHP K;  2KFZ A;  3RSE A;  1NU0 A;  5AQZ A;  4OJR A;  5EOY A;  1CXQ A;  4DSI A;  3OA9 A;  3VF6 A;  1IKV A;  3THY B;  4RW4 A;  4AHV A;  3P31 A;  4BRK A;  5HRP A;  1A5X A;  4Z4G A;  2RN2 A;  3M1F A;  3ZT3 A;  3E9O A;  4DF4 A;  3NH0 A;  1HYV A;  4A2A A;  4IO9 L;  2YHA A;  4IEI A;  3B6P A;  4JD2 B;  3T19 A;  3C6A A;  1YUW A;  5FPD A;  5HLF A;  4BC4 A;  1XMO K;  1SQK A;  2HB5 A;  4PL7 A;  4K41 A;  3LPU A;  5GAH P;  3IUC A;  1BA0 A;  1HQU A;  4HTL A;  1D8Y A;  4J8F A;  2E4L A;  3OBW A;  1TK5 A;  1LAV A;  1YTA A;  3SUO A;  4FJX A;  1QSL A;  2P9K A;  5GIO A;  1LAW A;  4MFB A;  1LW2 A;  4DLE A;  1VQL N;  2PY5 A;  4AHT A;  4GY2 B;  1EXQ A;  3EZ5 A;  2Y1I A;  4CER A;  4C23 A;  5CYM A;  3JAM O;  2UXB K;  5AQF A;  1L5U A;  3KLH A;  2ZD1 A;  3O4Q A;  1U48 A;  4ID1 A;  3ZSR A;  4AIL C;  2Y1J A;  3CPE A;  2QK9 A;  5I9E B;  2XY7 A;  5J2N A;  4CGF A;  1DEJ A;  3MN6 A;  3SV4 A;  4QAG A;  1A5W A;  1F21 A;  1P8Z A;  1LW0 A;  2P9L A;  3DRS A;  3FZM A;  1WAF A;  2XRI A;  3T1A A;  4FWM A;  1S9G A;  1KAX A;  1KFD A;  4DV2 K;  4NXM K;  1S1X A;  5LMU K;  2A40 A;  4CHQ A;  1S72 N;  3IDH A;  3N4Q A;  4JS4 A;  1ITG A;  2PZS A;  3ZSY A;  4JNE A;  2NRR A;  2KFN A;  3DLG A;  5AQG A;  3OYA A;  3UKU A;  3M8R A;  2P9K B;  1R0A A;  2HOE A;  4AQY K;  3ZSX A;  4C8K A;  2D0B A;  4DF8 A;  1JLA A;  4FWN A;  3NAE A;  1VAZ A;  4YOU A;  3UE5 A;  4JKD A;  3HSC A;  3NF9 A;  1S1V A;  4E1N A;  3H1V X;  3C6H A;  1DGK N;  3R9P A;  3CC2 N;  1NK7 A;  1BUP A;  2NRX A;  4O5F A;  4CEZ A;  4LFC K;  3ZET B;  5AZI A;  3V9U A;  3CET A;  4OVL A;  2HHW A;  3BY5 A;  4DUZ K;  2HBL A;  4DTX A;  4FWP A;  2ZQB A;  2FSJ A;  3PX6 A;  2P51 A;  3THW B;  1QE1 A;  1KVC A;  1HUX A;  1SL2 A;  3M6G A;  4YOR A;  5LY3 A;  4DQR A;  3DAW A;  2HBK A;  1RIL A;  3V4I A;  1EO1 A;  1OH8 A;  4DG1 A;  1NG9 A;  3TU5 A;  5HP1 A;  4RCH A;  3MWP A;  5AQL A;  3ALY A;  3BUZ B;  2OPS A;  4KHS A;  4H5W A;  4CGH A;  1RT5 A;  3V1O A;  4QS7 A;  3CHW A;  2I7N A;  2CGJ A;  3LWL A;  3O1B A;  5GIP A;  5T7B A;  2JWK A;  3AAQ A;  2D0P A;  1OH6 A;  3VEO A;  4YY3 K;  4DTR A;  1EP4 A;  4FJK A;  2E5L K;  1LCU A;  2VGN A;  3THX B;  1REV A;  4JKG B;  2IVN A;  4LH4 A;  3BZK A;  4IO8 A;  3MEE A;  2X74 A;  4H0T B;  3TAM A;  3ZX2 A;  1VSL A;  3MWT A;  1HKG A;  2E2O A;  3C6U A;  2WUS A;  1RT4 A;  4JI1 K;  1QZ6 A;  2H3G X;  3NVK A;  3WEE B;  1NGF A;  2B5J A;  4BVO A;  3LDP A;  4BE2 A;  3QIO A;  2KZZ A;  3LL3 A;  1ZBU A;  3HVR A;  1NLV A;  3VF4 A;  1HMV A;  5CYQ A;  1YT3 A;  3LAM A;  3TPQ A;  3VA0 A;  2D0O A;  3SMP A;  3OYB A;  3ENO A;  4Q5V A;  1NBW A;  4FJJ A;  4JK8 A;  3GL1 A;  3HP9 A;  4CGG A;  2A1R A;  4BG9 A;  3UKR B;  1VSK A;  1GOB A;  4YNQ A;  3CCU N;  4YDU A;  2OZM A;  1BL3 A;  1U2V B;  2ZGY A;  3LP3 A;  3VQA A;  4ID5 A;  1Q9Y A;  1G99 A;  3AO5 A;  3IG1 A;  1HKC A;  4RTF D;  4N5S A;  3PX4 A;  4DCH A;  5E84 A;  5AQV A;  4CK1 A;  4H0Y B;  2ASO A;  1CZ9 A;  3AY9 A;  4LF5 K;  5KPZ A;  2OPQ A;  4BWM A;  3U3Y A;  2Q36 A;  3EL2 A;  4KH5 A;  4BWJ A;  3OVN A;  3QFU A;  4PKI A;  4IOA L;  4OPK A;  1XC9 A;  3IRX A;  3VPZ A;  3QFP A;  1T6C A;  4AHS A;  2ZGZ A;  5FLX O;  2A1S A;  4A59 A;  2HHQ A;  4BRE A;  2OTL N;  1RDA A;  3H46 O;  4ICL A;  1E4G T;  4CJ3 A;  2HNZ A;  3I56 N;  4EHU A;  2QWP A;  1YVU A;  4ELV A;  3I8D A;  4B1Z A;  2ZF5 O;  3HO1 A;  3V9W A;  2AA4 A;  1C1B A;  1KC8 O;  5AJ3 K;  1FK9 A;  1GLE G;  2NUB A;  3KK1 A;  1IV0 A;  5AR0 A;  4M3U A;  2CGK A;  1VQ6 N;  4CK3 A;  1SAZ A;  4N56 A;  3JSM A;  2IIR A;  1NGC A;  2YCH A;  4DFM A;  3NBP A;  3OYD A;  3GDQ A;  1OVY A;  3RMD A;  3ZX3 A;  4H4M A;  1NK9 A;  2HHX A;  4F2S A;  5AFU A;  4GKK K;  3AVL A;  4FOE A;  2A41 A;  1N33 K;  4YDU C;  3VGL A;  2PYJ A;  1YF5 L;  2Z1I A;  3O80 A;  1XMQ K;  4PHT X;  2ZJQ L;  1U4B A;  3NGZ A;  1EKE A;  1E4F T;  4OPH A;  3GOI A;  1VSE A;  3CF5 L;  3VTI A;  1MWK A;  2VGM A;  4FWK A;  1J54 A;  4CHO A;  5CY4 A;  5GAD P;  4ISE A;  4FWR A;  1S6Q A;  3MEC A;  4KH6 A;  1WNS A;  2ASP A;  1WN7 A;  3QES A;  4DU3 A;  3GG4 A;  4QCL A;  1VSI A;  3T3F A;  1JXB A;  3I55 N;  3CME N;  3EKS A;  3LP0 A;  3RSE B;  4DSL A;  2OYQ A;  1VQ9 N;  4A62 A;  3K58 A;  4CZG A;  4ELU A;  3V9S A;  3BZC A;  1YAG A;  3TAE A;  3CCE N;  3LDL A;  1VQ4 N;  3VQC A;  3SUN A;  1LWF A;  3NF6 A;  2FXU A;  1HPM A;  4HUG A;  1OVQ A;  3FFI A;  2A6A A;  2P9S A;  3LWM A;  5AQN A;  3KHY A;  3KK7 A;  4R5P A;  4M63 C;  4BRO A;  1CLQ A;  3DLR A;  4LFB K;  2YHB A;  3CC4 N;  4DV3 K;  4B3M K;  2HHH K;  1WUA A;  3F9K A;  5C2D A;  3SCX A;  2BH1 A;  4DHY A;  1JXE A;  3DXK A;  1N36 K;  3F5T A;  4DQI A;  2I7P A;  3ZT4 A;  4CHZ A;  4DR6 K;  4FJH A;  3O3F A;  3DOL A;  4W5T A;  4JLH A;  3ID8 A;  4IDK A;  2XY8 A;  4WQ5 A;  1NGJ A;  3QET A;  1H1V A;  1HR0 K;  2QWM A;  4YFU A;  3KTQ A;  4PWD A;  4QOZ B;  4EFH A;  4B9L A;  3EE9 A;  4B1Y B;  1T3V A;  2FF6 A;  4NCB A;  4KB1 A;  2QWR A;  1VQO N;  3ID6 A;  3AO2 A;  3RWU A;  4Z94 A;  3PO5 A;  4Z0U A;  4DTS A;  3SV3 A;  1BIZ A;  1J9A A;  3AA5 X;  5KQ8 A;  3EY1 A;  3J7Y P;  4FK0 A;  5FRM A;  3A2F A;  1O1W A;  1RDC A;  1XUP O;  3LAK A;  1UA0 A;  3CFP A;  3TAF A;  3L3V A;  4V19 S;  1QS4 A;  4F8R A;  1JKH A;  4N41 A;  1KTQ A;  2RHK A;  4CFB A;  4KHW A;  5C24 A;  3WUH A;  3QEI A;  2BTF A;  3ITH A;  3HT3 A;  3AVM A;  3J80 O;  5ADX H;  1C0F A;  1GLC G;  2FLO A;  4B1V A;  5FRO A;  3CJB A;  3S41 A;  1WAJ A;  1L3V A;  1MU2 A;  5AFU H;  1IBL K;  3A5L C;  1M1K O;  2O8F B;  5HOO A;  1D4X A;  1EQY A;  1Y64 A;  4CES A;  5BN8 A;  3OYI A;  1TK8 A;  4WYB A;  4DTU A;  1M90 O;  1I94 K;  3QBW A;  4BC3 A;  5CR4 A;  4YOY A;  4CGJ A;  4E3S A;  4O4G A;  1X9W A;  1UOC A;  4NB4 A;  3OS2 A;  3TR8 A;  4EP5 A;  4EZ9 A;  3KLI A;  2ZM6 K;  4JKH A;  3KVG A;  4OKJ A;  4FLY A;  4M3W A;  4DR5 K;  3D7E O;  1T7P A;  4FSV A;  3UKR A;  1NK0 A;  1KLM A;  2KW4 A;  2ZWH A;  4JKE A;  3QIC A;  2RPI A;  3R8E A;  4B9N A;  4BE0 A;  1TV6 A;  4BGA A;  4Y1D A;  1WSF A;  3S9H A;  5BPN A;  4GV6 A;  4CJ5 A;  2WC9 A;  2I5J A;  3C0B A;  4BDY A;  1Z05 A;  3DLB A;  2WON A;  1FW6 A;  1RT3 A;  3O5B A;  2KTQ A;  1VQP N;  2EWS A;  1JL2 A;  4IG0 A;  4CW7 B;  4CZM A;  4RW7 A;  3CJ1 A;  3TSP A;  2F8S A;  1NJW A;  2E2Q A;  1QVF M;  1CZB A;  1EX4 A;  4F9O A;  4CVN E;  4BY9 C;  3VES A;  4CZE A;  1BIS A;  3AO3 A;  1TYQ B;  4C1N I;  4H4O A;  2YNG A;  3QIN A;  4IJN A;  4M42 A;  4AH9 A;  4FM0 A;  4OO1 J;  4Z4C A;  4M3Z A;  4CFA A;  1W9H A;  3MMV A;  4EP4 A;  3A5O C;  4FLU A;  3CXC M;  4J2B A;  4GMJ B;  1FXX A;  1KVA A;  4BR2 A;  3HPO A;  5JLH A;  1KD1 O;  1IG9 A;  3M8P A;  1RTJ A;  1K8A O;  3OYE A;  3EN9 A;  2FF3 B;  4YOV A;  1BI4 A;  1S9E A;  2WBN A;  1IBK K;  4E89 A;  4Z4I A;  5M1K A;  5J2Q A;  1NJX A;  4G1Q A;  3OJU A;  4E7I A;  1TAU A;  4FK2 A;  3SJJ A;  1C0M A;  5ADX A;  2HHT A;  1BA1 A;  3AVG A;  4BRC A;  4KTQ A;  3F2K A;  4E7L A;  4CJS A;  5D3G A;  4PA1 A;  3CIP A;  2ZE2 A;  4CF9 A;  3D2F A;  4CEQ A;  1ATR A;  1IKY A;  3B6O A;  5JVH L;  3TAP A;  3U4L A;  5AZJ B;  3CER A;  3DLE A;  4HUF A;  4O8K A;  1KFS A;  1N34 K;  2P9N B;  3CC7 N;  2X6S A;  5AQO A;  1X3M A;  1N5Y A;  3QIP A;  4MO4 A;  3DXM A;  2UXC K;  4BRD A;  4NCG A;  3CCJ N;  1SKR A;  4CEA A;  4B3T K;  3K5N A;  2VQF K;  1J5O A;  1MDU B;  2DPN A;  2GUI A;  4FWQ A;  1TKX A;  1NK6 A;  2P1J A;  5KQD A;  3SBT A;  4JKB A;  4ILG B;  4FWL A;  1NM1 A;  4FVM A;  4GV9 A;  4K42 A;  4M7X A;  5LJW A;  3T69 A;  4CI6 A;  3NHG A;  3CG7 A;  3H3N O;  1IKX A;  2YHY A;  3JXU A;  2X78 A;  1TUU A;  4FK4 A;  1S3X A;  1SV5 A;  1HNW K;  4K8Z A;  4W5R A;  1X9S A;  4CIF A;  4OPA A;  3U3G A;  4KV8 A;  4LF6 K;  4DTN A;  4KB0 A;  5AZI B;  1GLA G;  2OPP A;  1YI2 N;  1NK4 A;  4PUO A;  5DMR A;  3AVC A;  3WXM B;  1X9M A;  1TKT A;  1U45 A;  3TWH A;  3O3G A;  1VRU A;  2NLX A;  3D2E B;  1W7A A;  4CIE A;  3OJS A;  1Q82 O;  3QDK A;  4LH5 A;  3L8B A;  3ATV A;  2O4I A;  3G6E N;  2FBT A;  3TSU A;  3ZSO A;  4KHU A;  2ASM A;  3VA3 A;  2W42 A;  1T6D A;  3EO3 A;  2D5R A; 
#chains in the Genus database with same CATH homology
 3BEX A;  3MCA B;  4YOW A;  1ILY A;  1GLJ O;  3TSQ A;  2Q1N A;  2Q36 A;  3EL2 A;  4BRN A;  4KH5 A;  3PIP L;  3BP8 A;  3QFU A;  3GE1 A;  1GLD G;  1XC3 A;  4PKI A;  4IOA L;  3Q7B A;  3D2F B;  3CD6 N;  2HF4 A;  3VEY A;  1JJ2 M;  3VPZ A;  1KQS M;  4FWS A;  4A2B A;  3ZEU A;  4PL8 A;  4IWV A;  3QFP A;  4C1N K;  3O1W A;  4BRF A;  1T6C A;  4JKF A;  4CZF A;  3VEW A;  5TKW A;  2ZGZ A;  2QWN A;  1K8K B;  4A59 A;  4IEE A;  4XH5 A;  3HOS A;  4BRE A;  1RDW X;  3G25 A;  2OTL N;  3H46 O;  1E4G T;  5EX5 A;  1VQM N;  4PKG A;  1VQ7 N;  3VGK A;  1Z6R A;  2E2N A;  3P4I A;  4JEP A;  2E8A A;  5AQR A;  3U9D A;  3WQT A;  4BRM A;  4EHU A;  3I56 N;  2QWP A;  4JHD B;  5LJV A;  2Q31 A;  2ZF5 O;  4B1Z A;  3OW2 M;  2AA4 A;  1HX1 A;  1IJJ A;  1C0G A;  1KC8 O;  4AM6 A;  1GLL O;  1GLE G;  4H5N A;  3A8Y A;  1J6Z A;  4JK7 A;  4WCE L;  4M7Y A;  5AR0 A;  5AQY A;  2CGK A;  4MLH A;  1VQ6 N;  2GUP A;  1SAZ A;  2GTD A;  5F2R A;  3L6Q A;  3NVM A;  2QWL A;  3WQU A;  5M1F A;  3CCS N;  3ZEU B;  4JKC A;  4Y0W A;  4BRG A;  2IIR A;  1DKG D;  1NGC A;  2HF3 A;  2YCH A;  2D1K A;  2P9I A;  1DT9 A;  1ATN A;  3GDQ A;  3EKU A;  1W2B M;  3H45 C;  1QHA A;  1ATS A;  4O8U A;  1OVY A;  2QA4 N;  4CD3 A;  3QB0 A;  3VGM A;  2W41 A;  3MCP A;  1HJO A;  2Q0U A;  3O8M A;  3ZX3 A;  1NGG A;  3C7N B;  3MX2 A;  4H5V A;  2A5X A;  5AFU A;  5AQH A;  3A5M C;  4FOE A;  3L4I A;  4B1X B;  3SAF A;  2A41 A;  4ISF A;  3FE1 A;  3FR0 A;  4YDU C;  3VGL A;  1YF5 L;  3DJC A;  3WXK A;  3O80 A;  4A61 A;  4WF9 L;  4WQ5 C;  4PHT X;  4G9Z A;  2ZJQ L;  4JN4 A;  2WFB A;  3CPW M;  3ULE B;  3VEX A;  1V4T A;  1E4F T;  4OPH A;  3F9M A;  3GOI A;  4IOC L;  3C7N A;  5AQW A;  2NRH A;  5AQI A;  1GLF O;  3CF5 L;  4U67 L;  2F9T A;  3VTI A;  1MWK A;  2GEL A;  1NGE A;  2VGM A;  3CJ7 A;  3K9K A;  4FWK A;  4K25 A;  5KPT A;  4WFA L;  4JHD A;  3PIO L;  2E1Z A;  5GAD P;  3L0Q A;  5F0X A;  4KBO A;  4ISE A;  1N8R O;  4FWR A;  2Q2R A;  1BU6 O;  4JK9 A;  5B8H A;  5FPE A;  4I6M B;  5KPZ A;  4KH6 A;  2ASP A;  3O9T A;  4FPA A;  1U6Z A;  3CQY A;  3A5N C;  3GG4 A;  3HRG A;  5AQK A;  1U2V A;  1OKJ A;  2ITM A;  1BO5 O;  2V7Z A;  3WXL A;  3I55 N;  4FVU A;  3CME N;  1W97 L;  4BRH A;  3CCV N;  4UY8 O;  4BQZ A;  3EKS A;  3RSE B;  3ENH A;  5GIN A;  1VQ9 N;  4ILJ A;  4A62 A;  2OTJ N;  2KKZ A;  2PBD A;  4H0O A;  4CZG A;  3E9L A;  4BC2 A;  5GAG P;  3KZB A;  1YAG A;  3TTD A;  2V51 B;  3CQX A;  3MN5 A;  3CCE N;  3LDL A;  1VQ4 N;  2YJF A;  3O6W A;  3U9Z A;  1SZ2 A;  4BC5 A;  3NMU A;  3VEN A;  2FXU A;  1HPM A;  3LDO A;  3B8A X;  3P38 A;  3VER A;  3CCR N;  1RGI A;  1YIJ N;  4IJA A;  2A6A A;  2P9S A;  1NMD A;  3MN7 A;  5AQN A;  3KHY A;  2HMP A;  4BGB A;  1YJW N;  4CD1 A;  1IG8 A;  3KK7 A;  2P9U A;  2V52 B;  1HLU A;  4M63 C;  4CZL A;  5C2F A;  3WXJ A;  4BRO A;  1VQN N;  4R79 A;  3SBG A;  3JS6 A;  4NO7 A;  3CI5 A;  3A0I X;  1TUY A;  1YJ9 N;  3OHR A;  5M1N A;  3MN9 A;  3D2E A;  3LM2 A;  1VQK N;  3DXK B;  3H3O B;  4CZK A;  4FPB A;  3CC4 N;  3R1X A;  5E26 A;  1MWM A;  1WUA A;  2E88 A;  5C2D A;  5JIC A;  3O9Q A;  2BH1 A;  3U8X A;  3ZX0 A;  4DHY A;  3HOT A;  3DXK A;  1NGH A;  5ELZ A;  3F5T A;  3CCL N;  3LDN A;  4CJ7 A;  2I7P A;  3VEV A;  1V4S A;  3MDQ A;  5EVZ A;  1JCE A;  5CHI A;  2PFU A;  2PAV A;  2HST A;  5DM7 L;  3GBT A;  3O9R A;  1ESV A;  1YHQ N;  3ATU A;  3FZL A;  3ID8 A;  3LDQ A;  5M1Q A;  1K73 O;  4WQ5 A;  1NGJ A;  4QS9 A;  1H1V A;  2YHX A;  3SAH A;  2QWM A;  1NJI O;  4GVE A;  5AQS A;  4EFH A;  3EE9 A;  4B1Y B;  1T3V A;  2FF6 A;  3K9J A;  2NNW A;  1CZA N;  2QWR A;  3QBX A;  5AQQ A;  2P9I B;  3J7Z O;  3FZF A;  2A42 A;  4H03 B;  4YOX A;  1VQ5 N;  2KHO A;  2QXL A;  4BR7 A;  2NRZ A;  1VQO N;  3ID6 A;  5F1X A;  4IFE A;  2HBM A;  3AGK A;  4Z94 A;  2ZJP L;  3VEZ A;  4B9Q A;  5C15 A;  3H6E A;  4I6M A;  3LM9 A;  3D6R A;  3CCQ N;  3RVC A;  3DWL A;  4BR9 A;  5KQ8 A;  2FSK A;  3IKM A;  1BG3 A;  1S22 A;  4FO0 A;  1XUP O;  1HKB A;  2CH6 A;  2V7Y A;  3WXI A;  1QZ5 A;  4BQL A;  5EXW A;  3N4P A;  3FZH A;  3W3D A;  5CE3 A;  2FSN A;  5C10 A;  2CH5 A;  4PKH A;  4MO5 A;  2Q0R A;  4XH1 A;  5M1O A;  3RSE A;  5AQZ A;  1Q7Y O;  1YIT N;  1NGB A;  5EOY A;  2RHK A;  2GEM A;  1GLB G;  3OA9 A;  3VF6 A;  4FWO A;  5TKY A;  5AQM A;  3P31 A;  3SLC A;  4BRK A;  3WUH A;  3AAR A;  4BRI A;  2BTF A;  3O4W A;  3P39 A;  3M1F A;  5ADX H;  1C0F A;  1TYQ A;  2P9P A;  3E9O A;  1GLC G;  2FLO A;  5JVG L;  4B1V A;  3CJB A;  4NLC A;  3S41 A;  3MX5 A;  4BRQ A;  2E20 A;  4AF1 A;  5AFU H;  3UKU B;  3FGU A;  4A2A A;  4BG8 A;  3A5L C;  4IO9 L;  1M1K O;  4IXC A;  5BRH A;  4IEI A;  5EY4 A;  4JD2 B;  1QQO A;  4XH4 A;  5HOO A;  3L4Q A;  5AQT A;  3C6A A;  1D4X A;  1EQY A;  1YUW A;  1Y64 A;  2W40 A;  3ZET A;  1BDG A;  5AQU A;  4BC4 A;  5FPD A;  5BN8 A;  3I8B A;  3UB5 A;  1K9M O;  2A3Z A;  3CJ9 A;  4H5R A;  1KAY A;  1SQK A;  1ZBS A;  4RWT A;  4WYB A;  4PL7 A;  2YHW A;  1M90 O;  3QBW A;  4BC3 A;  4K41 A;  4BRL A;  1X3N A;  3FZK A;  5GAH P;  3IUC A;  1BA0 A;  2NRT A;  4HTL A;  4K43 A;  2YX6 A;  5C0Y A;  4J8F A;  4E1J A;  5BRE A;  5CR4 A;  3OBW A;  4YOY A;  3G71 N;  2GX9 A;  3VMF B;  5GAE P;  4DB3 A;  4NB4 A;  1WOQ A;  4EIA A;  4JD2 A;  3KVG A;  4JKH A;  5BN9 A;  2P9K A;  5BRD A;  5GIO A;  3D7E O;  5HL7 L;  4FSV A;  3HZ6 A;  1KAZ A;  3UKR A;  3SJH A;  1JCG A;  1BOT O;  2ZWH A;  5BPL A;  3HI0 A;  4JKE A;  3QIC A;  3VET A;  1VQL N;  3R8E A;  4BGA A;  4MDB A;  1NWK A;  2QW9 A;  4GY2 B;  3EZW A;  5BPN A;  4LC9 B;  3WT0 A;  4C23 A;  3W0L A;  2ZJR L;  4GV6 A;  1ZXO A;  5AQF A;  4ISG A;  4H0X B;  2P9L B;  2WC9 A;  1RFQ A;  3C0B A;  4DQ8 A;  4B1W B;  5C12 A;  3M3Z A;  4A5B A;  2NZT A;  1Z05 A;  4GNI A;  2IVP A;  2QTD A;  3CPE A;  1R59 O;  3O5B A;  2VCP A;  4JKA A;  1VQP N;  2EWS A;  4CZH A;  5H1S Q;  5I9E B;  4CZM A;  4EHT A;  2YI1 A;  3CJ1 A;  3TSP A;  1DEJ A;  2QI2 A;  3MN6 A;  3AGR A;  1Q18 A;  2E2Q A;  4CBX A;  1QVF M;  4H0V B;  3ULE A;  1P8Z A;  2GWJ A;  4HWI A;  3O9U A;  2P9L A;  3FZM A;  3CMA N;  4F9O A;  4BY9 C;  4CBW A;  1K8K A;  3VES A;  4CZE A;  3BF3 A;  3M5R A;  1TYQ B;  4FWM A;  4BRP A;  3IFR A;  1QQN A;  1KAX A;  5FPM A;  4C1N I;  3T7Z A;  4MDA A;  3KWI A;  1X9J A;  5MLC Q;  2A40 A;  4IJN A;  4OO1 J;  1S72 N;  3IDH A;  3N4Q A;  4JNE A;  2NRR A;  2OAN A;  3J8A A;  3MMV A;  4WFB L;  5AQG A;  3MK6 A;  3A5O C;  3UKU A;  3Q7C A;  2P9K B;  4L3Q A;  3CXC M;  2HOE A;  3R3L A;  3TTC A;  2QWQ A;  4BR2 A;  3PLA A;  5JLH A;  2AP1 A;  1NGI A;  3QML A;  1KD1 O;  2HBJ A;  3E66 A;  2UYT A;  4FWN A;  5DM6 L;  1VAZ A;  4YOU A;  3I33 A;  3UE5 A;  4JKD A;  3HSC A;  1K8A O;  1QQM A;  3H1Q A;  3EN9 A;  2FF3 B;  3C6H A;  3H1V X;  1DGK N;  2F9W A;  4KH4 A;  3R9P A;  4CZJ A;  4IDH A;  4YOV A;  3CC2 N;  2RE2 A;  1BUP A;  2WBN A;  2NRX A;  1SS6 A;  4O5F A;  5M1K A;  3ZET B;  3CCM N;  3WEE A;  5AZI A;  3CET A;  2VWB A;  4CZI A;  3VTH A;  2HBL A;  4A5A A;  4FWP A;  4DKW A;  2E2P A;  2FSJ A;  5ADX A;  1LOT B;  1KXP A;  1BA1 A;  4BRC A;  1HUX A;  1Q81 O;  2P9P B;  1RDU A;  3E1Y A;  3F2K A;  3M6G A;  3OBY A;  1Q86 O;  3CIP A;  4YOR A;  5BPM A;  5LY3 A;  4YOT A;  3HBT A;  3BF1 A;  3DAW A;  3D2F A;  2HBK A;  4MLE A;  4FOI A;  4EAH D;  3DLL L;  1EO1 A;  1ATR A;  4BR0 A;  4BR5 A;  5AQJ A;  5JMV A;  2IVO A;  5JVH L;  1NGA A;  2E1Y A;  3O08 A;  3TU5 A;  1XQS C;  3U4L A;  1MA9 B;  4BVP A;  4RCH A;  5AZJ B;  2D4W A;  1JCF A;  3CER A;  3MWP A;  3VOV A;  4JKG A;  5AQL A;  4O8K A;  1ZC6 A;  3BUZ B;  4WFN L;  2CGL A;  4H5W A;  2P9N B;  3CC7 N;  5AQO A;  1X3M A;  4QS7 A;  3CHW A;  4MO4 A;  4QS8 A;  3SK3 A;  5BRF A;  2I7N A;  2CGJ A;  3DXM A;  3O1B A;  4BRD A;  4IZ9 A;  3CJA A;  5GIP A;  2F7T A;  2NRW A;  4ILH A;  3CJC A;  2JWK A;  3C65 A;  4BR4 A;  3AAQ A;  2D0P A;  5AQP A;  3CCJ N;  5BR9 A;  5M1P A;  5KPR A;  3VEO A;  4A57 A;  3HTV A;  3AAP A;  1MDU B;  2DPN A;  4FWQ A;  1LCU A;  2VGN A;  2P9U B;  1T44 A;  2J4R A;  4JKG B;  2IVN A;  5KQD A;  3SBT A;  4IO8 A;  4BRA A;  4JKB A;  4H0T B;  3G4S N;  4ILG B;  2QWO A;  4FWL A;  1NM1 A;  3MWT A;  3ZX2 A;  1HKG A;  4K42 A;  5FPN A;  2E2O A;  4AM7 A;  2QEX N;  4XEI A;  4GV9 A;  3FLC O;  4M7X A;  2WUS A;  5LJW A;  1QZ6 A;  2H3G X;  4IOX A;  3ENB A;  3NVK A;  1BWF O;  3T69 A;  3WEE B;  3TTF A;  3H3N O;  4CI6 A;  5JLF A;  1NGF A;  4GV3 A;  4BVO A;  3LDP A;  4H5T A;  1QVG M;  2YHY A;  3JXU A;  1YJN N;  1TUU A;  3LL3 A;  3EE8 A;  2JWL A;  4WQ4 C;  1YVN A;  3R6M A;  1S3X A;  2Q97 A;  2YJE A;  1NLV A;  4U7B A;  2GWK A;  3SMS A;  3VF4 A;  3DXM B;  4NLB A;  4OPA A;  4WQ4 A;  3TPQ A;  2P9N A;  2D0O A;  3SMP A;  4JAX A;  3ENO A;  1NBW A;  2VYP A;  4JK8 A;  3GL1 A;  5AZI B;  1GLA G;  1VQ8 N;  3IMX A;  3SAG A;  2BUP A;  1YI2 N;  4CBU A;  4BG9 A;  2P9S B;  2QM1 A;  3UKR B;  5AQX A;  3O9S A;  2KLA A;  5AZJ A;  3WXM B;  4B1U B;  3CCU N;  1O13 A;  4YDU A;  1U2V B;  2ZGY A;  3FFK B;  1G99 A;  3ZYY X;  2NRV A;  2NLX A;  3D2E B;  3HM8 A;  4H0P A;  1HKC A;  1Q82 O;  3QDK A;  3VF2 A;  3ATV A;  4RTF D;  3G6E N;  3EO3 A;  3TSU A;  3KWG A;  4DCH A;  5E84 A;  1P90 A;  1NGD A;  2ASM A;  5AQV A;  1YXQ A;  4FL9 A;  1T6D A;  4H0Y B;  2ASO A;  3AY9 A;  3E9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...