4GVEA

Tacaribe nucleoprotein structure
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
207
structure length
197
Chain Sequence
b'DIGSEFEGQELIVRAAVSELDPSNTIWLDIEGPPTDPVELALYQPAKKQYIHCFRKPHDEKGFKNGSRHSHGILMKDIEDAVPGVLSYVIGLLPPNMVITTQGSDDIRKLLDIHGRKDLKLIDVKFTSDQARQFEHQVWDKFGHLCKQHNGVIISKPSPDEPHCALLDCIMFHSAMSGELPKEEPIPLLPKEFLFFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nucleoprotein
publication title Structures of Arenaviral Nucleoproteins with Triphosphate dsRNA Reveal a Unique Mechanism of Immune Suppression.
pubmed doi rcsb
source organism Tacaribe virus
molecule tags Viral protein
total genus 57
structure length 197
sequence length 207
ec nomenclature
pdb deposition date 2012-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.410 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4gveA00
4GV3A 3Q7BA 3Q7CA 4FVUA 4GV6A 4GVEA 3MWTA 3MX5A 3MWPA 4GV9A 3R3LA 3MX2A 4G9ZA
chains in the Genus database with same CATH superfamily
4K8ZA 1TVRA 3LDSA 3OYLA 3E01A 5M1NA 1NK9A 3J7AP 2KTQA 3LAKA 5FPMA 2NLXA 3OYIA 4CEQA 3HO1A 4Z4CA 5E84A 5F1XA 3DLKA 4FWLA 4C1NI 2O8DB 3OYCA 1YIJN 4YOXA 1U2VB 2BANA 3LWMA 3BEXA 3THYB 4YHHK 3NVMA 4WQ5A 2A40A 2VCPA 3A2FA 1RCHA 1IBLK 3J8AA 3TAPA 3IKMA 4IZ9A 3HPGA 5FROA 2A3ZA 4IOXA 5HRNA 3FZFA 5AQUA 3VGKA 4F2RA 4CIFA 3T1AA 3LDOA 5ELZA 1WUAA 4JV5K 3R3LA 5AQKA 4FJ5A 4FXDA 3M8PA 3Q7CA 2NUBA 2HHWA 4CJ5A 4CZJA 4B8AB 3VQBA 2B5JA 5AQGA 4JHDA 4CJVA 4KBOA 4NCAA 1EWRA 4CZFA 3PO5A 3OY9A 3UKRB 3A5NC 4WF9L 2UU9K 4FWRA 1GLEG 3TI0A 4FLYA 3UKUB 4CJQA 3H46O 3CFPA 1VQON 2QWRA 2E2NA 4O44A 2WOMA 2OPQA 3AO4A 4B1UB 3B6PA 4MLEA 4M3TA 2YHAA 4C8LA 5FRMA 2F4VK 3C6HA 5EY4A 2YX6A 4JKBA 4BE0A 4FJMA 1NJXA 4H8KA 4LF9K 3EN9A 1SZ2A 3DM2A 1NWKA 3G71N 1SL0A 3QBWA 4RW7A 3F5TA 4DR5K 3PX0A 4DUZK 2O8DA 4IDKA 1C0FA 1Q82O 4E7LA 1U2VA 3WXJA 3THYA 3CJCA 5HROA 3C0BA 3SV4A 4KPYA 1VSLA 2HF3A 3NE6A 4B3SK 1RGIA 3L6QA 4E7JA 3T1HK 4BRKA 5AQTA 5C2DA 1BISA 5AQRA 5GIPA 4MQ3A 3HSTB 4DF8A 4DTXA 4DS4A 2KFZA 3OYEA 1CLQA 2AP1A 4E1JA 3LPUA 1S1XA 4EP4A 1OVYA 4KHNA 3HXMA 3RRHA 4FJGA 3A8YA 3CMEN 1MU2A 3L8BA 4H5NA 2JLEA 3AO2A 3GG4A 3O3HA 1IBKK 3ZCMA 4EFHA 4E0DA 4CHZA 2KHOA 1N5YA 4F3TA 1VRUA 1XC3A 1ATNA 1BHLA 2BE2A 1EXQA 3EL2A 3OW2M 5CYQA 1XI1A 5FDLA 4KFBA 2OTLN 3MN6A 5AQZA 3VQ5A 5AQOA 4FLZA 4OKEA 3O4WA 5AQLA 3L3UA 4OPHA 3UKUA 2IIRA 4JK7A 3SLCA 4ELVA 3ENBA 1RDUA 1U49A 1S72N 2FBTA 3P31A 3PSIA 2KLAA 1Y64A 4Z4GA 4UY8O 2E4LA 1KTQA 5AZJA 2YNIA 1YHQN 1BU6O 1VSHA 3K9JA 3AV9A 1JLQA 4H0OA 3C65A 3LDLA 4B9NA 2YNHA 3F2KA 4BRIA 3CHWA 4AILC 3AVIA 4H0XB 4CJLA 4M3YA 3K2PA 4ILHA 3WNHA 4Z4IA 3VF2A 4NXMK 5I3UA 1BI4B 3FZLA 4LH5A 4GVMA 5J2QA 1RFQA 4CZKA 1WSGA 4ILGB 4UQGA 1KQSM 1R59O 3FLCO 1JL2A 1NKCA 2HF4A 2OPRA 2QWNA 4CFDA 1C1CA 3I33A 4JKEA 4IFVA 4JRQA 2O8EB 4DR7K 1O1WA 4FK2A 1IKYA 1JXBA 1KFSA 4HHTA 5KTQA 2PBDA 4ID5A 4X62K 1YTUA 4DQRA 2HMIA 5JLFA 1XMQK 1U6ZA 3G10A 3WUHA 4NYFA 4DQSA 1VSFA 1GLCG 1T8EA 3MWTA 1NJWA 1ATSA 3ZEUB 4CBXA 3HVRA 2V7YA 5A2QO 1SAZA 5M1PA 2DFFA 1NU0A 2IC3A 4JI8K 1S6PA 2QWPA 3CCUN 4FWNA 1YF5L 2D0AA 1TKZA 1VQNN 3AVHA 1HNWK 4DR4K 4ZTJA 4CFCA 4HVJA 2O8FB 4CF2A 1X9MA 2P9IA 4DB3A 1J54A 4JKFA 1KAXA 3DRPA 5KQ8A 3G0ZA 3VOVA 3MECA 4M3WA 4DSKA 4YY3K 4OPJA 5SWMA 2HNDA 5CR4A 4GV6A 3NF9A 3HPHA 4KHYA 4OVLA 4ZHRA 3VQ7A 1Q8IA 5FPDA 4E7IA 3HSCA 5HP1A 4KI4A 3KLGA 3BGRA 3NFAA 5TKWA 1IH7A 4OKJA 4R5PA 1YJWN 1OH8A 3RMAA 4KH4A 3QMLA 3LP1A 1I94K 4IEIA 2NRWA 4B1YB 1GLBG 3HBTA 1MWKA 1VQ8N 3TAFA 4FJIA 3A5OC 1VQLN 2Q97A 4FM0A 3MWPA 4Z0UA 3VQEA 3U3YA 3L2QA 3E1YA 2D0PA 3ID8A 2VGNA 5EU7A 4A5BA 2XHBA 3ZX2A 5M1FA 2KZMA 4CW7B 4JI7K 3O08A 4NCGA 3CPEA 1BWFO 4BGBA 3S3NA 4FJKA 1O13A 4FO0A 4KTQA 2FBXA 4X64K 2A6AA 1NMDA 2A5XA 1RT2A 1QQCA 5M1KA 4MFBA 3WXLA 3QNNA 3BZKA 4DTPA 3TWHA 3HJFA 1WN7A 4CK2A 1NGJA 4M7YA 2F9WA 3NMUA 4ILJA 5AQMA 1BA1A 3QEWA 2FXUA 3THXA 3CCQN 1NOYA 2O8CB 3QO9A 2HSTA 2IVPA 3O8MA 4RW4A 3O9RA 4N47A 3CM6A 2OPSA 1TKDA 4C8MA 4NXNK 3HL8A 1ZC6A 4K8XA 2QWLA 5HRSA 4B3OA 4JN4A 1S22A 1VSEA 3NH0A 3DLLL 3O3GA 4OX9K 3AVAA 4A61A 3VESA 5F2RA 4B9LA 1J9AA 2O4GA 4KHUA 4CJWA 3ZX0A 4AHRA 4X65K 3LWLA 2NRXA 4CBWA 1T44A 4JKGA 3RWUA 2Q0UA 3AVGA 5AQJA 3ZT3A 2O8BB 3GBTA 1HYVA 4FLXA 3SPZA 5C15A 4KAZA 4A5AA 4CFAA 5I42A 5AFUH 1YJ9N 1C0GA 1BL3A 1HYSA 4AF1A 2NRRA 4FJXA 3CJBA 3CCSN 1TUYA 3OYJA 1KXPA 3D45A 2QM1A 1QQOA 3ULEA 1RT6A 3KTQA 4IO9L 3ZETA 3OYMA 2HHHK 4ISGA 1S1WA 3IG1A 4IG3A 2VQEK 2E1ZA 5BPMA 4F9OA 1NKEA 3MN7A 3U4LA 4GKKK 1CZ9A 2A1SA 3QFPA 4Y1CA 1HJRA 4H5WA 1QSSA 2DFHA 1LCUA 4DV2K 4E1MA 2GELA 3RSEB 2XY8A 2I7NA 1RBRA 3OTOK 4DUYK 4GY2B 1TAQA 3TPQA 3O1BA 4QOZB 2VWKA 3CYMA 5M1QA 3RR7A 1CXUA 3L2VA 4CGFA 4ISFA 1YVUA 3ZYYX 1IG8A 1S1UA 3CXCM 4FYDA 4CJ7A 3JYTA 3PSFA 1VRTA 3CJ1A 4FJ8A 4BRHA 3SAFA 3PV8A 1XC9A 2JGUA 4M41A 3AARA 4BRPA 1VSKA 1LAWA 2ZM6K 1TL1A 2D0OA 3QINA 3LANA 4IOAL 4PWDA 4PKIA 3DXKB 4H0YB 2X6NA 3DI6A 3GE1A 2O8BA 3E66A 5GAHP 3VQDA 2NRTA 3VQPA 1GLFO 1FJGK 2ASMA 4JKAA 5BR8K 2GTDA 1IG9A 1W9HA 3ULDA 1OH5A 1BA0A 2QKKA 1Q18A 5AQXA 3QERA 3OBWA 1QZ6A 4W5RA 4HCBA 5HL7L 2KZZA 1JLAA 1KLMA 5FPNA 3GOIA 1YT3A 1NGIA 1VQMN 2IVNA 4RW8A 4O8KA 3V1OA 1NJYA 4CESA 3AAQA 4B9TA 1G99A 3DLEA 1N36K 5KI6A 3CMAN 4KRFA 2G8UA 4CEBA 4CZEA 1WOQA 4O55A 1TKTA 3F73A 1DGKN 4AH9A 4CHOA 4B3TK 5KPTA 4BDPA 4JD2B 3AVMA 4RW6A 3TSUA 4E3SA 2A1RA 1C6VA 1WNSA 4J2EA 4XEIA 3U6FA 5CYMA 3O4NA 3HRGA 1MA9B 4M3RA 2HB5A 1Q81O 3H1QA 3L4QA 2E88A 4YOWA 2I5JA 2V51B 3H45C 1NBWA 3I8BA 2Y1IA 4I9QA 4PL7A 3NAEA 3VN5A 2EHGA 4DQ8A 4WFNL 1KVAA 4JHDB 3FGUA 1XNQK 1HJOA 1L5UA 1U45A 1GOBA 3ZT0A 2P9LA 3SZ2A 4M45A 4DG1A 1NGAA 2QWOA 1ILYA 1EO1A 3ZSVA 3DXKA 1HKCA 5BREA 3D0PA 5GINA 1HQEA 2YNGA 4FVMA 4B1XB 1GLAG 4IDHA 3I0RA 4MDBA 4CF1A 3PUFA 3B8AX 3SYZA 5D3GA 2HHTA 4LY7A 3MDQA 3HP6A 1NJIO 3O9SA 4LSLA 5GADP 3QETA 5IWAK 4C8OA 1RT5A 5M1OA 2P9UA 1S1TA 4B08A 1YVNA 3HI0A 4IFYA 3QIPA 1RBUA 1SUQA 4CJ4A 4LFBK 3H1VX 4FJ9A 3DWLA 3VQ4A 5BR9A 3HTVA 3KLEA 3RMCA 3SBTA 5FLXO 5B8HA 3SJHA 4O0IA 1Z6RA 4MLHA 3NGYA 2QXLA 1IBMK 2E20A 2Q31A 3LZJA 4RG8A 4BQLA 5C2FA 1T6DA 3TAEA 1KSPA 3TANA 1HLUA 4JD2A 3WXKA 4NLCA 4YNQA 4Z4HA 3L2RA 2QTDA 1KAYA 4AHUA 4CJPA 4C8KA 2OTJN 3DLGA 3R1XA 3V9UA 4HTUA 3P38A 5LMNK 5J2NA 2P1JA 4EZ9A 1HPZA 1FXXA 1ATRA 3O3FA 3LM9A 3TABA 3CC7N 2FF3B 2ASOA 3L4IA 1P8ZA 1VQ4N 3FZKA 2QEXN 3F9MA 5T7BA 3BUZB 1V4SA 2HHSA 4EAHD 4DV7K 4BR7A 1SL1A 3C7NA 4IWVA 3PY8A 3CETA 1KC8O 1BOTO 3QFUA 2YHYA 1Q9XA 3FZMA 1JL1A 2VQFK 4DTSA 1NGCA 4BDYA 1WAFA 4XH4A 3SPYA 1D8YA 3VEZA 3RMBA 4K42A 5C24A 3VEOA 2P5OA 4B9UA 4DFPA 3NF8A 4GMJB 5ADXH 4RCHA 1OKJA 4OGEA 5HRPA 4IJNA 4JI0K 3M8QA 4LF6K 5C0YA 2FLOA 1ZBIA 4M42A 3SCXA 2R7YA 3B6OA 5GIOA 2HHUA 1NJZA 5AZJB 1L3TA 1K9MO 1RILA 2ZE2A 2OA8A 3LDQA 3AVFA 4BRDA 4MO5A 3LDNA 4V19S 2JWLA 4DR2K 4KHSA 2RF2A 3E9PA 2YCHA 2JWKA 5AQQA 4Q0BA 1K8KB 1ZBLA 4CBUA 4N76A 4C1NK 2Y1JA 1HYZA 5KGWA 3OS0A 3QB0A 4WFBL 4CGIA 1WSHA 3SMSA 5JICA 4BE2A 3CQXA 1JCEA 3AO3A 3CC4N 3V4IA 3VERA 4E89A 2W40A 3CJ9A 4BR5A 4CJUA 3V9XA 3D2EA 1C0TA 4ELTA 1DTQA 3OS1A 1SL2A 3CG7A 3VMFB 1WAJA 4GW6A 5HLFA 3PLAA 5AQIA 4Y0WA 3C95A 4Z94A 4CJTA 3CIPA 4N56A 2ZWHA 3OYKA 2XY5A 4DFMA 4RWTA 1N34K 4O4GA 3H08A 1DLOA 3LP2A 2P9KA 1RBSA 1N8RO 2ZGZA 5MLCQ 3VEYA 1OH7A 5J1EA 1NGDA 1NGFA 4B9SA 4H0PA 2E2QA 3CQYA 3AA5X 3V9WA 3CM5A 2P9IB 2WC9A 4OPKA 1BO5O 1LW0A 4CJ3A 4IBNA 4FJNA 1ASVA 4EHUA 1TKXA 5JLHA 2BTFA 1CZAN 2WFBA 3WQTA 4JLHA 1X3NA 4F8RA 4DV5K 1X9WA 3AA2A 1RT3A 5E26A 4H0VB 2ETJA 1NGBA 4N5SA 3M6GA 3WEEA 2E1YA 3VQAA 3C6AA 3VETA 4CF8A 1VSIA 3RR8A 2UUAK 1K8KA 1GOAA 4CERA 2WTUA 1T03A 2KKZA 1RT1A 1G15A 4Y1DA 1FKOA 5C12A 4FWPA 1YJNN 3OYDA 2F96A 3KZBA 1U04A 2KW4A 2PZSA 1VQ6N 4H03B 1KAZA 3BDPA 1K6YA 2UXCK 1CXQA 3E9OA 3TU5A 1QVGM 3EKSA 4DWIA 3J7ZO 5C10A 3G4SN 1LAVA 3AO1A 2Q2RA 3KHYA 3RTVA 3NGIA 4I6MB 4DCHA 1VAZA 2P9NB 1JLBA 4AHVA 4PKGA 4BQZA 3D7EO 3QLHA 4DTOA 4K43A 2RE2A 3THXB 3QEIA 4W5OA 2QKBA 3S41A 1LWCA 3TSQA 4A2BA 1VK0A 5AZIB 1WBDA 2ZJRL 4BVPA 2UXDK 4BRAA 4BR9A 4YOTA 3ZX3A 5AJ3K 4FJHA 2PYLA 3CCMN 3AO5A 2IDOA 4BWMA 3K5NA 4FM2A 1YTAA 1FKPA 1NM1A 3LP0A 3R8EA 3PIPL 4WYBA 1DEJA 1UA0A 3DYAA 1ZXOA 5KRSA 4JKGB 1RTHA 2XRIA 3PX4A 2I7PA 5K14A 3ATUA 3U9ZA 3VQQA 5J2PA 1ZYQA 3IS9A 2HBJA 4KO0A 4F4KA 4JYAK 2G8HA 4DTMA 1RDWX 3SUNA 3MN9A 4DU1A 2LSNA 3O80A 1E3MA 1S1VA 4MO4A 3M8SA 3M5RA 2QI2A 3MEDA 2VG6A 1WSIA 3K58A 1JJ2M 4YDUC 4K41A 4OLBA 1EX4A 3T7ZA 1OH6A 4KB0A 3ULEB 4HCCA 3M1FA 4B9QA 3V9ZA 1VQKN 3ZETB 1S9EA 2G8FA 4PY5A 3DOLA 2E6MA 3OYAA 3KLHA 1KD1O 3V1QA 3HVTA 1C0UA 3FZHA 2YHWA 3C6UA 3JAMO 4FJ7A 5C25A 4G9ZA 3U3GA 2W6KA 1X9JA 4I6MA 2P9NA 5AQYA 3K5MA 1GLDG 2BH1A 4AHCA 3BF1A 2P51A 3A5MC 3N4PA 1X9SA 4DSJA 1NK7A 1HX1A 4M63C 5EXWA 4QCLA 3UB5A 3KJVA 1BQMA 1NNEA 4J2DA 2E6LA 4M3ZA 3G6EN 5EVZA 2W41A 4XH5A 4NLBA 5AZIA 1BUPA 2G8WA 4H5RA 2ZF5O 1J6ZA 1HQUA 1SQKA 1BGXT 1WSJA 3TTDA 4H4MA 1ZBFA 1EKEA 4DTUA 3SK3A 4EHTA 1XMOK 1LWFA 4FSVA 1MWMA 3NGZA 4FL9A 2XY7A 2VGMA 1ZBUA 3TTCA 3C94A 1KRPA 1IO2A 4FJJA 1NKBA 3TSPA 3ZSQA 3LL3A 4CD1A 4E1NA 4LF4K 4B1WB 3M8RA 2ATQA 1C1BA 3HOTA 2EX3A 1GOCA 4H0TB 3AVKA 4I2PA 4DV3K 1U47A 3ZLJA 3MMVA 3NH1A 4JS5A 2UUBK 4O8UA 3I0SA 1XUPO 3NCIA 2PY5A 4CD3A 4PHTX 1K8AO 3J7YP 4HUEA 1TK8A 1N32K 3F9KA 3OA9A 3P39A 3CD6N 2X6SA 3H3NO 2GX9A 4FK4A 4LFAK 4HTLA 1KVBA 4J8FA 3KLFA 3TAMA 3MCAB 4JI1K 3T69A 2RKIA 4R79A 1WBBA 1BIUA 4KI6A 4E7HA 3IFRA 4JI2K 3HZ6A 1BDGA 3QESA 5BN8A 2E2PA 3NF7A 3ALYA 3VTHA 4CEEA 4BRQA 2GWKA 1A5WA 2D5RA 3SMPA 4Z4EA 3MXMA 3LDPA 1BIZA 4A2AA 4FOEA 4B1ZA 2E5LK 3MAQA 3N4QA 3HYFA 3THWA 2YI1A 4CEOA 3DLBA 2NRZA 1W7AA 3CFRA 3SAHA 1IKVA 2P9LB 2CGJA 2CGLA 3WXMB 4DV1K 2Z1GA 3CJAA 4KH5A 3CFOA 2Z1HA 5CZ1A 3JSMA 5HOOA 1RDAA 4NYNA 1Q86O 4KHPK 4JAXA 4DQQA 5JS2A 2YHBA 1NGEA 1VHXA 4CJKA 1VQ9N 4LH4A 1KCFA 2P9UB 2Q1NA 3CQ8A 1JCFA 4JK9A 1JLGA 1JLCA 4FWMA 2QXFA 3KD5E 2D4WA 4BG9A 4DLGA 4W5QA 3J80O 1KLNA 1YUWA 1ITGA 3ZSZA 2HVHA 3DMJA 5BRHA 1T05A 1RT7A 5DK5A 1QTMA 4FW2A 3AY9A 5EX5A 4IOCL 4OKKA 2OCEA 1RTDA 1HPMA 2ITGA 3OYFA 4FZYA 1D5AA 2XY6A 1HUXA 1QS4A 2P9SA 1HMVA 2HBKA 4GVEA 1NLVA 4CJRA 4JKCA 2FBVA 4XH1A 2FSJA 4BRGA 3CC2N 1IV0A 2BDPA 4QS7A 3CI5A 2BUPA 4YOVA 4PUOA 3CPWM 4LF8K 1DTTA 2PAVA 3EYZA 2HHVA 3UE5A 5LY3A 2X74A 2YJEA 1HR0K 4BACA 4DFKA 4E7KA 3QEVA 3C7NB 4DMNA 2YKMA 3DLHA 1TYQA 1BCMA 3KD1E 2HVIA 2F8TA 1W2BM 3VQCA 4U67L 2QA4N 3O5BA 2FC0A 4GV3A 1Z05A 2D0CA 3NVKA 3WXIA 1TGOA 1JKHA 2FF6A 3HK2A 3WNGA 1NK8A 1CZBA 2OPPA 3U9DA 4FPAA 4EZ6A 3K9KA 3DAWA 4B3MK 4DU3A 2B4JA 3PIOL 1QQMA 4GNIA 3TAGA 2OYQA 1YXQA 3LAMA 3VF4A 3WNFA 3TR8A 1RT4A 4XIUA 1FW6A 4CEFA 4DFJA 1N33K 2A42A 1LOTB 3DOKA 3SQ1A 4CK1A 3ZSYA 4WQ4C 2GBZA 4FM1A 2DFEA 3OHRA 4L3QA 4HWIA 4FVUA 3U8XA 5AFUA 3ID6A 3S3MA 4M7XA 1VSJA 3VEXA 4A62A 4Z4FA 2HW3A 5BN9A 4H5TA 3VEWA 3VQ9A 2CH6A 5DM7L 4TSXA 3D2EB 3WNEA 5E41A 3OJSA 1DKGD 2HBLA 3KKRA 4CGDA 4C8NA 1YAGA 3AVCA 3O4QA 2GUIA 1WLJA 2WUSA 4W5TA 3QEXA 1HNXK 3DXMA 1W0HA 4M3UA 1XWLA 1E4FT 3OYNA 4I9LA 4YFUA 4BR4A 2PYJA 2P9KB 3VQ6A 1YITN 4Q5VA 3NH2A 3K0SA 3L0QA 2YHXA 4BDZA 2GWJA 2OZMA 4FWKA 3OYGA 2Q3SA 5KPZA 1RTJA 4BRCA 3ZT2A 2NNWA 1M1KO 5TKYA 2UXBK 2NRVA 4H5VA 3BP8A 4DTNA 3KKSA 3BY5A 1XHXA 2KFNA 3L2UA 4WCEL 2ZD1A 4DU4A 1K73O 2J4RA 3K59A 1FK9A 4BREA 5AQSA 3LM2A 4CHQA 3WEEB 1TAUA 1LW2A 2VYPA 5DM6L 3T1YK 3V81A 4JK8A 4PL8A 1SKWA 4I7FA 3CCJN 1WSEA 4IEEA 4AM7A 4QS9A 2YNFA 3MXIA 4MDAA 3D2FB 2RN2A 3ASMA 1N6QA 1GLLO 4ID1A 3OS2A 4KHQA 5KRTA 3JXUA 1D4XA 4ZTFA 1NK6A 1QSLA 1GLJO 3QBXA 3KK1A 4BWJA 3CCLN 1JLEA 1Q9YA 1QSYA 1B92A 2YV0X 2Z1IA 3HPOA 4B9VA 3CCVN 4WQ5C 2CH5A 5AQVA 3NHGA 5JVGL 4DSFA 1KFDA 1ZBSA 4CGGA 4J2BA 1SS6A 1B9DA 1VQPN 3KK2A 4F2SA 2IOCA 4BG8A 3EO3A 4FLTA 3K5OA 3D6RA 3LPTA 4BRFA 3TAQA 3OVNA 3O9TA 4FOIA 1SKRA 4B9MA 4CHPA 1I3AA 4DSLA 4FWOA 4O0JA 3EE9A 2WBNA 5BPNA 1DT9A 5CY4A 4CJSA 2HHQA 2HHXA 1UOCA 4PA1A 5BRDA 1BCOA 3P1GA 3L2WA 3UKRA 3RVCA 1MDUB 2D0BA 2B6AA 4JKDA 4CZMA 1S6QA 4CHYA 2FSKA 2NRHA 3VPZA 2D1KA 3EEQA 3FR0A 3T3FA 3ZSOA 1B9FA 4JEPA 1NG9A 2H3GX 2QWMA 1HRHA 3AGKA 3OYBA 4LF7K 4BGAA 2RPIA 1T3VA 4IFEA 4BVOA 1UWBA 3D2FA 4NB4A 4YDUA 3O6WA 2CGKA 3VGLA 2OANA 3UIQA 4HUFA 1JCGA 4AHSA 4NCBA 2E8AA 1HNVA 4FZXC 1A5XA 1RTIA 3HP9A 1QHTA 4DTJA 1SV5A 1Y97A 4FWQA 1S3XA 5JVHL 4BC4A 4DR6K 1D9DA 4DR1K 1BG3A 3IRXA 5HRRA 1I39A 3VQ8A 1XHZA 1E4GT 3OBYA 2F9TA 3AVLA 1D9FA 3AAPA 1R0AA 3MEGA 2OZSA 3MK6A 3IMXA 4BR0A 1EQYA 2UYTA 2GV9A 1RNHA 3P83D 1RDCA 1X3MA 2G8VA 1KVCA 2X78A 2Z1JA 4LF5K 4CIEA 2V52B 4A59A 3ENOA 3P5JA 3SQ2A 4C23A 2HNYA 3ZT4A 5AR0A 3LP3A 3MEEA 4IO8A 1Q7YO 4EIAA 3WT0A 3THVA 4RW9A 1XQSC 3NBPA 2IS3A 5JMVA 1HNZK 1VSDA 3VENA 2KQ2A 2HOEA 2IAJA 5LL6Z 5F0XA 2VG7A 3O1WA 3RMDA 1QHAA 4BC2A 3KK7A 2VG5A 2G8KA 1QZ5A 2W42A 2O4IA 2IVOA 3SI6A 1P90A 5ADXA 4YOYA 5CZ2A 3V1RA 2YJFA 2ZJQL 3VA0A 4H4OA 2PFUA 1NGGA 3AA4A 3VTIA 2NZTA 4DLEA 4JI5K 3R6MA 4YORA 4AM6A 4CECA 3C6TA 3EZWA 1J53A 3ZSXA 4KB1A 4DTRA 4BE1A 2F8SA 3ZT1A 4YOUA 3EY1A 1EP4A 3E9LA 3SBGA 4CGHA 3QNOA 1L3UA 1ESVA 3J81O 3EE8A 4FLVA 5AQNA 2P9PB 4AHTA 1IKWA 1BI4A 4OO1J 4CEDA 3PX6A 3PO4A 3AVBA 4CHNA 3OYHA 1HKGA 3RRGA 3DLRA 3CCRN 3P4IA 1YI2N 5FRNA 4FWSA 1EWQA 3ZSRA 2DTUA 2ZJPL 1LWEA 2ASPA 3IUCA 2DY4A 2A41A 3AVJA 3I55N 2IGIA 2O8EA 1F21A 1ZBHA 1L3VA 3VF6A 5BRFA 3VGMA 2ZQBA 3SQ0A 3TTFA 5DMRA 4O5FA 1NK0A 4LFCK 4W5NA 3H3OB 1QE1A 1Z25A 1EETA 4J2AA 4ISEA 5KPRA 4DSEA 4M3XA 1RDBA 3FFIA 4LD0A 4CCHA 3L3VA 2HBMA 4JRPA 3O9UA 2AA4A 3ZEUA 4DV4K 5C42A 3VEVA 1BQNA 4JI3K 1C1AA 2VWJA 3CF5L 4K0KK 2XO7A 3DJCA 4GV9A 4EP5A 4CIGA 3THWB 2ITMA 2P5GA 3V6DA 4BC3A 4LC9B 3MX5A 1JXEA 4B3RK 2QK9A 4CZGA 3SV3A 1UAXA 2QW9A 2GEMA 2G8IA 2O8FA 3QICA 4DF4A 2UUCK 1X1PA 2VWBA 5EOYA 3DRRA 5J2MA 1IJJA 3KIOA 1U4BA 4OGCA 3M3ZA 3I8DA 3T19A 1QQNA 2FSNA 3S3OA 4FCYA 4JKHA 4JNEA 1VQ7N 4FK0A 4CEZA 5IT9O 1TK0A 4CJEA 4OPAA 4FJLA 4CE9A 4GKJK 1NK4A 5BPLA 3QIOA 3O9QA 4IKFA 4CK3A 4CVNE 2P9PA 4K25A 5AQFA 3SAGA 2EWSA 3WQUA 3NF6A 5GAGP 1J5EK 3TARA 4JI4K 4CF0A 3CCEN 1J5OA 4CGJA 4CEAA 3LZIA 1NMNA 4DQPA 4BRMA 1ASUA 4B8CA 2HMPA 5H1SQ 1RBVA 1RBTA 1WSFA 3V9SA 2P9SB 3SQ4A 5CE3A 4L8RB 3OJUA 3CJ7A 4KTZA 4FLWA 4PQUA 4FLUA 5LJVA 1H1VA 2RHKA 1TV6A 3AA3A 4DV0K 1OVQA 3ENHA 3AVNA 3SJJA 2AJQA 2HNZA 4A57A 3ISNC 4N41A 4G1QA 3IDHA 4BRLA 4IJAA 3BZCA 1VSMA 4I2QA 3QDKA 4KTWA 3MCPA 4NO7A 4DQIA 2YKNA 4BC5A 5I9EB 4AQYK 3K5LA 1JLFA 2Q36A 1L3SA 3AGRA 3ZSWA 4O5BA 1XNRK 2O8CA 4B1VA 3KWIA 4F3OA 1TYQB 2FBYA 3SNNA 1RDDA 3GDQA 3BF3A 5AQPA 3KLIA 3MN5A 5KQDA 3QEPA 4IXCA 5FPEA 2GUPA 3A0IX 3SUQA 4FPBA 3W0LA 1Z26A 4DR3K 3LALA 2DPNA 3H6EA 3MX2A 5LJWA 1REVA 3MXJA 5KGXA 4CJFA 1NOZA 2Q0RA 3KWGA 5AQWA 4CI6A 1C0MA 3JS6A 3KK3A 1NK5A 3CERA 1TUUA 3FFKB 2BGGA 4RTFD 1U48A 4KKOA 4IG0A 4WQ4A 3G25A 4CF9A 4QAGA 4KV8A 1IKXA 1S9GA 4KH6A 3VA3A 3W3DA 4BROA 3IAYA 4U7BA 2F7TA 3HT3A 2E2OA 4CZLA 3K57A 1A5VA 5JS1A 3Q7BA 4QS8A 3EZ5A 4BRNA 5HBMA 2W6LA 4CZIA 2WONA 4WFAL 4KREA 1HNIA 3HM8A 3HM9A 1LV5A 1SKSA 3RSEA 3DXMB 4FW1A 4ICLA 1TL3A 4DKWA 1T6CA 5LMUK 1NGHA 5AQHA 4WE1A 3SUPA 1M90O 3I56N 4OLAA 2V7ZA 3R9PA 2ZGYA 3GL1A 4E19A 4DV6K 4JI6K 4HUGA 4DSIA 4FZZA 1S5JA 1HKBA 4DS5A 3DRSA 4OJRA 3A5LC 3ATVA 4JS4A 3ITHA 4X66K 5SZTA 4DHYA 4BY9C 4BR2A 4KHWA 2QWQA 1WB9A 1UA1A 3S9HA 5CHIA 3EKUA 1T7PA 3HOSA 1ASWA 1W97L 1V4TA 4CZHA 3NDKA 4ELUA 1TK5A 4PKHA 3SUOA 1QVFM 5GAEP 1VQ5N 3FE1A 3KVGA 4LSNA 4CFBA
chains in the Genus database with same CATH topology
1RDWX 5M1QA 3MN9A 4BG8A 3EO3A 3O80A 3D6RA 4ISFA 4BRFA 3ZYYX 4FOIA 3O9TA 4MO4A 3M5RA 1IG8A 2QI2A 1JJ2M 3CXCM 4YDUC 4K41A 4CJ7A 5M1NA 3CJ1A 3T7ZA 4FWOA 4BRHA 3EE9A 3SAFA 2WBNA 5FPMA 5BPNA 1DT9A 2NLXA 3AARA 5E84A 3ULEB 4BRPA 3M1FA 4B9QA 5F1XA 1VQKN 3ZETB 4FWLA 4C1NI 5BRDA 2D0OA 1YIJN 3UKRA 1U2VB 3RVCA 1MDUB 4YOXA 4JKDA 3BEXA 4IOAL 1KD1O 4CZMA 3NVMA 4WQ5A 2A40A 2VCPA 2FSKA 3FZHA 4PKIA 2YHWA 3DXKB 4H0YB 2NRHA 3GE1A 3J8AA 3VPZA 2D1KA 4G9ZA 3FR0A 3E66A 3IKMA 4IZ9A 1X9JA 4JEPA 5GAHP 4I6MA 2NRTA 1GLFO 2H3GX 2P9NA 2ASMA 5AQYA 4JKAA 2GTDA 2A3ZA 2QWMA 1GLDG 3AGKA 2BH1A 1BA0A 4IOXA 1Q18A 3FZFA 3BF1A 3OBWA 1QZ6A 5AQXA 3A5MC 3N4PA 4BGAA 5HL7L 1T3VA 4IFEA 5AQUA 3VGKA 4BVOA 1HX1A 4M63C 3GOIA 5EXWA 5FPNA 3D2FA 3LDOA 5ELZA 1WUAA 4NB4A 3R3LA 1NGIA 3UB5A 1VQMN 4YDUA 3G6EN 2IVNA 2CGKA 2W41A 3O6WA 4NLBA 1BUPA 4O8KA 4XH5A 3Q7CA 5AQKA 4H5RA 2ZF5O 1J6ZA 3VGLA 3AAQA 1SQKA 2OANA 1G99A 4CZJA 3TTDA 1JCGA 5AQGA 2E8AA 4JHDA 3CMAN 4KBOA 3SK3A 4EHTA 4CZEA 4FSVA 4CZFA 1MWMA 1WOQA 4FL9A 2VGMA 1DGKN 4FWQA 3TTCA 3UKRB 1S3XA 5JVHL 4BC4A 1BG3A 1E4GT 3A5NC 3OBYA 5KPTA 4WF9L 3TSPA 4FWRA 1GLEG 3LL3A 4JD2B 2F9TA 3UKUB 3AAPA 4CD1A 3TSUA 3MK6A 3H46O 3IMXA 4B1WB 4BR0A 1EQYA 2UYTA 1VQON 2QWRA 2E2NA 4XEIA 4B1UB 3HRGA 1X3MA 3HOTA 1MA9B 4MLEA 4H0TB 2V52B 1Q81O 3H1QA 4A59A 3ENOA 3L4QA 3MMVA 2E88A 4YOWA 4C23A 2V51B 3C6HA 3H45C 5EY4A 1NBWA 2YX6A 3I8BA 4JKBA 4O8UA 5AR0A 1XUPO 4PL7A 4IO8A 1Q7YO 3EN9A 4CD3A 4DQ8A 3WT0A 4EIAA 4PHTX 4WFNL 1SZ2A 1K8AO 1NWKA 3G71N 1XQSC 3QBWA 3OA9A 3P39A 4JHDB 3F5TA 5JMVA 3FGUA 3H3NO 3VENA 2GX9A 3CD6N 1C0FA 2HOEA 4HTLA 1Q82O 1HJOA 1U2VA 4J8FA 3WXJA 3CJCA 3C0BA 2P9LA 5F0XA 3O1WA 1NGAA 2HF3A 2QWOA 3MCAB 3T69A 1ILYA 1EO1A 1QHAA 4BC2A 3DXKA 1HKCA 3KK7A 1RGIA 5BREA 4R79A 5GINA 3L6QA 1QZ5A 4B1XB 4BRKA 5AQTA 5C2DA 3IFRA 2IVOA 1GLAG 5AQRA 5GIPA 4IDHA 4MDBA 1P90A 3HZ6A 1BDGA 5ADXA 4YOYA 2AP1A 3B8AX 4E1JA 2YJFA 5BN8A 2ZJQL 2E2PA 5EVZA 3MDQA 2PFUA 1OVYA 3VTHA 3O9SA 4BRQA 5GADP 1NGGA 1NJIO 2GWKA 2NZTA 3VTIA 3A8YA 3CMEN 3R6MA 3SMPA 4YORA 5M1OA 4H5NA 2P9UA 4AM6A 1YVNA 3EZWA 3HI0A 3LDPA 3H1VX 3GG4A 4EFHA 3DWLA 4A2AA 5BR9A 4FOEA 4YOUA 3HTVA 3SBTA 3E9LA 3SBGA 4B1ZA 1ESVA 3EE8A 2KHOA 5AQNA 3SJHA 5B8HA 2P9PB 1XC3A 3N4QA 1ATNA 1Z6RA 4OO1J 3EL2A 3OW2M 4MLHA 2QXLA 1HKGA 2YI1A 3CCRN 2OTLN 3MN6A 3P4IA 2NRZA 2E20A 5AQOA 5AQZA 1YI2N 3SAHA 2Q31A 2P9LB 3O4WA 4FWSA 5AQLA 2CGJA 2CGLA 4BQLA 3WXMB 1T6DA 5C2FA 2ZJPL 2ASPA 3IUCA 3CJAA 1HLUA 2A41A 4JD2A 4OPHA 3UKUA 3I55N 4KH5A 3WXKA 2IIRA 5HOOA 4JK7A 4NLCA 3SLCA 1Q86O 3ENBA 1RDUA 2QTDA 1S72N 4JAXA 1KAYA 3VF6A 5BRFA 3P31A 3VGMA 2OTJN 3TTFA 2KLAA 4O5FA 3R1XA 3H3OB 1Y64A 1NGEA 3P38A 1VQ9N 4UY8O 5AZJA 1YHQN 1ATRA 4ISEA 2P9UB 1BU6O 3K9JA 5KPRA 2Q1NA 3LM9A 3CC7N 2FF3B 3LDLA 3C65A 1JCFA 2ASOA 3L4IA 4H0OA 1P8ZA 4JK9A 1VQ4N 3FZKA 4FWMA 2HBMA 2QEXN 2D4WA 2AA4A 3F2KA 3F9MA 3O9UA 3ZEUA 3CHWA 4BG9A 4BRIA 3BUZB 1V4SA 3VEVA 4EAHD 4BR7A 4H0XB 3CF5L 4ILHA 1YUWA 3C7NA 3DJCA 4GV9A 3VF2A 3FZLA 4IWVA 2ITMA 3CETA 5BRHA 1RFQA 4CZKA 1KC8O 1BOTO 4LC9B 3MX5A 3QFUA 2YHYA 4BC3A 3FZMA 4ILGB 1NGCA 1KQSM 3AY9A 1R59O 4XH4A 3FLCO 4CZGA 5EX5A 4IOCL 3VEZA 2HF4A 2QWNA 4K42A 2QW9A 2GEMA 3VEOA 1HPMA 3QICA 2VWBA 5ADXH 1HUXA 2P9SA 5EOYA 2HBKA 3I33A 1NLVA 4GVEA 1IJJA 4JKEA 4RCHA 4JKCA 3M3ZA 1OKJA 4XH1A 4IJNA 2FSJA 1QQNA 2PBDA 4BRGA 3CC2N 5C0YA 2FLOA 2FSNA 5GIOA 4QS7A 4JKHA 4JNEA 3CI5A 2BUPA 5AZJB 5JLFA 1VQ7N 1U6ZA 1K9MO 3WUHA 4YOVA 3CPWM 3LDQA 4OPAA 2PAVA 4MO5A 3LDNA 4BRDA 1GLCG 3UE5A 5BPLA 3MWTA 3O9QA 1ATSA 3ZEUB 4CBXA 2JWLA 2V7YA 5LY3A 5AZIA 2P9PA 1SAZA 2YJEA 4K25A 5AQFA 5M1PA 3E9PA 2EWSA 2YCHA 3WQUA 3SAGA 5GAGP 2JWKA 3CCEN 3C7NB 5AQQA 1K8KB 1TYQA 4CBUA 2QWPA 3CCUN 4FWNA 1YF5L 4C1NK 1W2BM 1VQNN 3QB0A 4U67L 4WFBL 2QA4N 3O5BA 3SMSA 5JICA 4GV3A 1Z05A 4BRMA 3CQXA 1JCEA 3NVKA 3CC4N 2HMPA 3WXIA 5H1SQ 2P9IA 4DB3A 2FF6A 3VERA 4JKFA 1KAXA 5KQ8A 2W40A 2P9SB 3VOVA 3CJ9A 5CE3A 4BR5A 3D2EA 3CJ7A 5LJVA 1H1VA 2RHKA 3U9DA 5CR4A 4GV6A 4FPAA 3VMFB 3ENHA 3K9KA 3DAWA 3PLAA 5AQIA 4Y0WA 4Z94A 3PIOL 1QQMA 4GNIA 3CIPA 1YXQA 4A57A 2ZWHA 5FPDA 3HSCA 3VF4A 3IDHA 1YJWN 4BRLA 4RWTA 4IJAA 5TKWA 3QDKA 4KH4A 3MCPA 3QMLA 4NO7A 4BC5A 5I9EB 2Q36A 3AGRA 4IEIA 2NRWA 4B1YB 1GLBG 2P9KA 3HBTA 1N8RO 1MWKA 2A42A 1VQ8N 1LOTB 2ZGZA 4B1VA 3KWIA 3A5OC 1TYQB 5MLCQ 4WQ4C 4FVUA 3OHRA 4L3QA 4HWIA 2Q97A 3GDQA 3VEYA 1VQLN 3MWPA 3U8XA 1NGDA 3BF3A 5AQPA 1NGFA 5AFUA 3E1YA 3ID6A 3MN5A 4H0PA 5KQDA 2D0PA 3ID8A 4M7XA 2E2QA 3CQYA 4IXCA 5FPEA 2GUPA 2VGNA 3A0IX 3VEXA 4A62A 4A5BA 5BN9A 4FPBA 3W0LA 4H5TA 2P9IB 2WC9A 3VEWA 3ZX2A 1BO5O 5M1FA 2CH6A 5DM7L 3O08A 2DPNA 3H6EA 3CPEA 3D2EB 1BWFO 4BGBA 3MX2A 4EHUA 5JLHA 1O13A 4FO0A 5LJWA 1DKGD 2BTFA 2HBLA 1CZAN 2WFBA 2A6AA 1NMDA 3WQTA 2A5XA 1X3NA 1YAGA 2Q0RA 3KWGA 5AQWA 4CI6A 3JS6A 5M1KA 5E26A 3CERA 1TUUA 3WXLA 2WUSA 3FFKB 4H0VB 3TPQA 4RTFD 1NGBA 3DXMA 3M6GA 3WEEA 2E1YA 3C6AA 3VETA 1NGJA 4M7YA 1E4FT 2F9WA 4BR4A 1K8KA 4ILJA 3NMUA 5AQMA 2P9KB 1BA1A 4WQ4A 1YITN 3G25A 2FXUA 3CCQN 2KKZA 2HSTA 3L0QA 2YHXA 2GWJA 2IVPA 3O8MA 4FWKA 4KH6A 5KPZA 3O9RA 3W3DA 4BRCA 4BROA 5C12A 4FWPA 1ZC6A 2NNWA 1YJNN 2QWLA 4U7BA 3KZBA 1VQ6N 4H03B 1KAZA 4JN4A 1S22A 2F7TA 3DLLL 1M1KO 2E2OA 5TKYA 2NRVA 4A61A 4H5VA 5F2RA 3VESA 4CZLA 3BP8A 3E9OA 3TU5A 1QVGM 3EKSA 3Q7BA 4QS8A 3ZX0A 4BRNA 4WCEL 3J7ZO 5C10A 4CZIA 3G4SN 2NRXA 4CBWA 4WFAL 1K73O 1T44A 2J4RA 4JKGA 2Q2RA 3HM8A 4BREA 3KHYA 2Q0UA 5AQJA 5AQSA 3LM2A 4I6MB 3RSEA 3DXMB 3WEEB 4DCHA 1VAZA 2P9NB 1T6CA 2VYPA 1NGHA 3GBTA 4DKWA 5AQHA 4PKGA 5DM6L 4JK8A 4PL8A 3CCJN 5C15A 1M90O 4A5AA 4BQZA 3D7EO 3I56N 2V7ZA 4IEEA 5AFUH 4AM7A 1YJ9N 1C0GA 4QS9A 4K43A 2RE2A 4AF1A 3R9PA 2ZGYA 2NRRA 3GL1A 4MDAA 3D2FB 3CJBA 3CCSN 3S41A 1TUYA 3TSQA 1KXPA 4A2BA 5AZIB 2QM1A 1GLLO 1HKBA 2ZJRL 4BVPA 1QQOA 4BRAA 4BR9A 3A5LC 1D4XA 3JXUA 4YOTA 3ATVA 3ULEA 3ZX3A 4IO9L 1GLJO 3QBXA 3ZETA 3CCLN 3CCMN 4ISGA 4DHYA 2E1ZA 5BPMA 4BY9C 4BR2A 4F9OA 1NM1A 2QWQA 3R8EA 3PIPL 3MN7A 3U4LA 4WYBA 1DEJA 5CHIA 3EKUA 3HOSA 4WQ5C 3CCVN 2CH5A 3QFPA 1W97L 5AQVA 1ZXOA 1V4TA 4CZHA 5JVGL 4H5WA 4JKGB 1ZBSA 1LCUA 2I7PA 3ATUA 3U9ZA 4PKHA 2GELA 3RSEB 1QVFM 2I7NA 2HBJA 5GAEP 1SS6A 1VQ5N 4GY2B 3FE1A 3O1BA 3KVGA 1VQPN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GV3 A;  3Q7B A;  3Q7C A;  4FVU A;  4GV6 A;  4GVE A;  3MWT A;  3MX5 A;  3MWP A;  4GV9 A;  3R3L A;  3MX2 A;  4G9Z A; 
#chains in the Genus database with same CATH topology
 4K8Z A;  1TVR A;  3LDS A;  3OYL A;  3E01 A;  5M1N A;  1NK9 A;  3J7A P;  2KTQ A;  3LAK A;  5FPM A;  2NLX A;  3OYI A;  4CEQ A;  3HO1 A;  4Z4C A;  5E84 A;  5F1X A;  3DLK A;  4FWL A;  4C1N I;  2O8D B;  3OYC A;  1YIJ N;  4YOX A;  1U2V B;  2BAN A;  3LWM A;  3BEX A;  3THY B;  4YHH K;  3NVM A;  4WQ5 A;  2A40 A;  2VCP A;  3A2F A;  1RCH A;  1IBL K;  3J8A A;  3TAP A;  3IKM A;  4IZ9 A;  3HPG A;  5FRO A;  2A3Z A;  4IOX A;  5HRN A;  3FZF A;  5AQU A;  3VGK A;  4F2R A;  4CIF A;  3T1A A;  3LDO A;  5ELZ A;  1WUA A;  4JV5 K;  3R3L A;  5AQK A;  4FJ5 A;  4FXD A;  3M8P A;  3Q7C A;  2NUB A;  2HHW A;  4CJ5 A;  4CZJ A;  4B8A B;  3VQB A;  2B5J A;  5AQG A;  4JHD A;  4CJV A;  4KBO A;  4NCA A;  1EWR A;  4CZF A;  3PO5 A;  3OY9 A;  3UKR B;  3A5N C;  4WF9 L;  2UU9 K;  4FWR A;  1GLE G;  3TI0 A;  4FLY A;  3UKU B;  4CJQ A;  3H46 O;  3CFP A;  1VQO N;  2QWR A;  2E2N A;  4O44 A;  2WOM A;  2OPQ A;  3AO4 A;  4B1U B;  3B6P A;  4MLE A;  4M3T A;  2YHA A;  4C8L A;  5FRM A;  2F4V K;  3C6H A;  5EY4 A;  2YX6 A;  4JKB A;  4BE0 A;  4FJM A;  1NJX A;  4H8K A;  4LF9 K;  3EN9 A;  1SZ2 A;  3DM2 A;  1NWK A;  3G71 N;  1SL0 A;  3QBW A;  4RW7 A;  3F5T A;  4DR5 K;  3PX0 A;  4DUZ K;  2O8D A;  4IDK A;  1C0F A;  1Q82 O;  4E7L A;  1U2V A;  3WXJ A;  3THY A;  3CJC A;  5HRO A;  3C0B A;  3SV4 A;  4KPY A;  1VSL A;  2HF3 A;  3NE6 A;  4B3S K;  1RGI A;  3L6Q A;  4E7J A;  3T1H K;  4BRK A;  5AQT A;  5C2D A;  1BIS A;  5AQR A;  5GIP A;  4MQ3 A;  3HST B;  4DF8 A;  4DTX A;  4DS4 A;  2KFZ A;  3OYE A;  1CLQ A;  2AP1 A;  4E1J A;  3LPU A;  1S1X A;  4EP4 A;  1OVY A;  4KHN A;  3HXM A;  3RRH A;  4FJG A;  3A8Y A;  3CME N;  1MU2 A;  3L8B A;  4H5N A;  2JLE A;  3AO2 A;  3GG4 A;  3O3H A;  1IBK K;  3ZCM A;  4EFH A;  4E0D A;  4CHZ A;  2KHO A;  1N5Y A;  4F3T A;  1VRU A;  1XC3 A;  1ATN A;  1BHL A;  2BE2 A;  1EXQ A;  3EL2 A;  3OW2 M;  5CYQ A;  1XI1 A;  5FDL A;  4KFB A;  2OTL N;  3MN6 A;  5AQZ A;  3VQ5 A;  5AQO A;  4FLZ A;  4OKE A;  3O4W A;  5AQL A;  3L3U A;  4OPH A;  3UKU A;  2IIR A;  4JK7 A;  3SLC A;  4ELV A;  3ENB A;  1RDU A;  1U49 A;  1S72 N;  2FBT A;  3P31 A;  3PSI A;  2KLA A;  1Y64 A;  4Z4G A;  4UY8 O;  2E4L A;  1KTQ A;  5AZJ A;  2YNI A;  1YHQ N;  1BU6 O;  1VSH A;  3K9J A;  3AV9 A;  1JLQ A;  4H0O A;  3C65 A;  3LDL A;  4B9N A;  2YNH A;  3F2K A;  4BRI A;  3CHW A;  4AIL C;  3AVI A;  4H0X B;  4CJL A;  4M3Y A;  3K2P A;  4ILH A;  3WNH A;  4Z4I A;  3VF2 A;  4NXM K;  5I3U A;  1BI4 B;  3FZL A;  4LH5 A;  4GVM A;  5J2Q A;  1RFQ A;  4CZK A;  1WSG A;  4ILG B;  4UQG A;  1KQS M;  1R59 O;  3FLC O;  1JL2 A;  1NKC A;  2HF4 A;  2OPR A;  2QWN A;  4CFD A;  1C1C A;  3I33 A;  4JKE A;  4IFV A;  4JRQ A;  2O8E B;  4DR7 K;  1O1W A;  4FK2 A;  1IKY A;  1JXB A;  1KFS A;  4HHT A;  5KTQ A;  2PBD A;  4ID5 A;  4X62 K;  1YTU A;  4DQR A;  2HMI A;  5JLF A;  1XMQ K;  1U6Z A;  3G10 A;  3WUH A;  4NYF A;  4DQS A;  1VSF A;  1GLC G;  1T8E A;  3MWT A;  1NJW A;  1ATS A;  3ZEU B;  4CBX A;  3HVR A;  2V7Y A;  5A2Q O;  1SAZ A;  5M1P A;  2DFF A;  1NU0 A;  2IC3 A;  4JI8 K;  1S6P A;  2QWP A;  3CCU N;  4FWN A;  1YF5 L;  2D0A A;  1TKZ A;  1VQN N;  3AVH A;  1HNW K;  4DR4 K;  4ZTJ A;  4CFC A;  4HVJ A;  2O8F B;  4CF2 A;  1X9M A;  2P9I A;  4DB3 A;  1J54 A;  4JKF A;  1KAX A;  3DRP A;  5KQ8 A;  3G0Z A;  3VOV A;  3MEC A;  4M3W A;  4DSK A;  4YY3 K;  4OPJ A;  5SWM A;  2HND A;  5CR4 A;  4GV6 A;  3NF9 A;  3HPH A;  4KHY A;  4OVL A;  4ZHR A;  3VQ7 A;  1Q8I A;  5FPD A;  4E7I A;  3HSC A;  5HP1 A;  4KI4 A;  3KLG A;  3BGR A;  3NFA A;  5TKW A;  1IH7 A;  4OKJ A;  4R5P A;  1YJW N;  1OH8 A;  3RMA A;  4KH4 A;  3QML A;  3LP1 A;  1I94 K;  4IEI A;  2NRW A;  4B1Y B;  1GLB G;  3HBT A;  1MWK A;  1VQ8 N;  3TAF A;  4FJI A;  3A5O C;  1VQL N;  2Q97 A;  4FM0 A;  3MWP A;  4Z0U A;  3VQE A;  3U3Y A;  3L2Q A;  3E1Y A;  2D0P A;  3ID8 A;  2VGN A;  5EU7 A;  4A5B A;  2XHB A;  3ZX2 A;  5M1F A;  2KZM A;  4CW7 B;  4JI7 K;  3O08 A;  4NCG A;  3CPE A;  1BWF O;  4BGB A;  3S3N A;  4FJK A;  1O13 A;  4FO0 A;  4KTQ A;  2FBX A;  4X64 K;  2A6A A;  1NMD A;  2A5X A;  1RT2 A;  1QQC A;  5M1K A;  4MFB A;  3WXL A;  3QNN A;  3BZK A;  4DTP A;  3TWH A;  3HJF A;  1WN7 A;  4CK2 A;  1NGJ A;  4M7Y A;  2F9W A;  3NMU A;  4ILJ A;  5AQM A;  1BA1 A;  3QEW A;  2FXU A;  3THX A;  3CCQ N;  1NOY A;  2O8C B;  3QO9 A;  2HST A;  2IVP A;  3O8M A;  4RW4 A;  3O9R A;  4N47 A;  3CM6 A;  2OPS A;  1TKD A;  4C8M A;  4NXN K;  3HL8 A;  1ZC6 A;  4K8X A;  2QWL A;  5HRS A;  4B3O A;  4JN4 A;  1S22 A;  1VSE A;  3NH0 A;  3DLL L;  3O3G A;  4OX9 K;  3AVA A;  4A61 A;  3VES A;  5F2R A;  4B9L A;  1J9A A;  2O4G A;  4KHU A;  4CJW A;  3ZX0 A;  4AHR A;  4X65 K;  3LWL A;  2NRX A;  4CBW A;  1T44 A;  4JKG A;  3RWU A;  2Q0U A;  3AVG A;  5AQJ A;  3ZT3 A;  2O8B B;  3GBT A;  1HYV A;  4FLX A;  3SPZ A;  5C15 A;  4KAZ A;  4A5A A;  4CFA A;  5I42 A;  5AFU H;  1YJ9 N;  1C0G A;  1BL3 A;  1HYS A;  4AF1 A;  2NRR A;  4FJX A;  3CJB A;  3CCS N;  1TUY A;  3OYJ A;  1KXP A;  3D45 A;  2QM1 A;  1QQO A;  3ULE A;  1RT6 A;  3KTQ A;  4IO9 L;  3ZET A;  3OYM A;  2HHH K;  4ISG A;  1S1W A;  3IG1 A;  4IG3 A;  2VQE K;  2E1Z A;  5BPM A;  4F9O A;  1NKE A;  3MN7 A;  3U4L A;  4GKK K;  1CZ9 A;  2A1S A;  3QFP A;  4Y1C A;  1HJR A;  4H5W A;  1QSS A;  2DFH A;  1LCU A;  4DV2 K;  4E1M A;  2GEL A;  3RSE B;  2XY8 A;  2I7N A;  1RBR A;  3OTO K;  4DUY K;  4GY2 B;  1TAQ A;  3TPQ A;  3O1B A;  4QOZ B;  2VWK A;  3CYM A;  5M1Q A;  3RR7 A;  1CXU A;  3L2V A;  4CGF A;  4ISF A;  1YVU A;  3ZYY X;  1IG8 A;  1S1U A;  3CXC M;  4FYD A;  4CJ7 A;  3JYT A;  3PSF A;  1VRT A;  3CJ1 A;  4FJ8 A;  4BRH A;  3SAF A;  3PV8 A;  1XC9 A;  2JGU A;  4M41 A;  3AAR A;  4BRP A;  1VSK A;  1LAW A;  2ZM6 K;  1TL1 A;  2D0O A;  3QIN A;  3LAN A;  4IOA L;  4PWD A;  4PKI A;  3DXK B;  4H0Y B;  2X6N A;  3DI6 A;  3GE1 A;  2O8B A;  3E66 A;  5GAH P;  3VQD A;  2NRT A;  3VQP A;  1GLF O;  1FJG K;  2ASM A;  4JKA A;  5BR8 K;  2GTD A;  1IG9 A;  1W9H A;  3ULD A;  1OH5 A;  1BA0 A;  2QKK A;  1Q18 A;  5AQX A;  3QER A;  3OBW A;  1QZ6 A;  4W5R A;  4HCB A;  5HL7 L;  2KZZ A;  1JLA A;  1KLM A;  5FPN A;  3GOI A;  1YT3 A;  1NGI A;  1VQM N;  2IVN A;  4RW8 A;  4O8K A;  3V1O A;  1NJY A;  4CES A;  3AAQ A;  4B9T A;  1G99 A;  3DLE A;  1N36 K;  5KI6 A;  3CMA N;  4KRF A;  2G8U A;  4CEB A;  4CZE A;  1WOQ A;  4O55 A;  1TKT A;  3F73 A;  1DGK N;  4AH9 A;  4CHO A;  4B3T K;  5KPT A;  4BDP A;  4JD2 B;  3AVM A;  4RW6 A;  3TSU A;  4E3S A;  2A1R A;  1C6V A;  1WNS A;  4J2E A;  4XEI A;  3U6F A;  5CYM A;  3O4N A;  3HRG A;  1MA9 B;  4M3R A;  2HB5 A;  1Q81 O;  3H1Q A;  3L4Q A;  2E88 A;  4YOW A;  2I5J A;  2V51 B;  3H45 C;  1NBW A;  3I8B A;  2Y1I A;  4I9Q A;  4PL7 A;  3NAE A;  3VN5 A;  2EHG A;  4DQ8 A;  4WFN L;  1KVA A;  4JHD B;  3FGU A;  1XNQ K;  1HJO A;  1L5U A;  1U45 A;  1GOB A;  3ZT0 A;  2P9L A;  3SZ2 A;  4M45 A;  4DG1 A;  1NGA A;  2QWO A;  1ILY A;  1EO1 A;  3ZSV A;  3DXK A;  1HKC A;  5BRE A;  3D0P A;  5GIN A;  1HQE A;  2YNG A;  4FVM A;  4B1X B;  1GLA G;  4IDH A;  3I0R A;  4MDB A;  4CF1 A;  3PUF A;  3B8A X;  3SYZ A;  5D3G A;  2HHT A;  4LY7 A;  3MDQ A;  3HP6 A;  1NJI O;  3O9S A;  4LSL A;  5GAD P;  3QET A;  5IWA K;  4C8O A;  1RT5 A;  5M1O A;  2P9U A;  1S1T A;  4B08 A;  1YVN A;  3HI0 A;  4IFY A;  3QIP A;  1RBU A;  1SUQ A;  4CJ4 A;  4LFB K;  3H1V X;  4FJ9 A;  3DWL A;  3VQ4 A;  5BR9 A;  3HTV A;  3KLE A;  3RMC A;  3SBT A;  5FLX O;  5B8H A;  3SJH A;  4O0I A;  1Z6R A;  4MLH A;  3NGY A;  2QXL A;  1IBM K;  2E20 A;  2Q31 A;  3LZJ A;  4RG8 A;  4BQL A;  5C2F A;  1T6D A;  3TAE A;  1KSP A;  3TAN A;  1HLU A;  4JD2 A;  3WXK A;  4NLC A;  4YNQ A;  4Z4H A;  3L2R A;  2QTD A;  1KAY A;  4AHU A;  4CJP A;  4C8K A;  2OTJ N;  3DLG A;  3R1X A;  3V9U A;  4HTU A;  3P38 A;  5LMN K;  5J2N A;  2P1J A;  4EZ9 A;  1HPZ A;  1FXX A;  1ATR A;  3O3F A;  3LM9 A;  3TAB A;  3CC7 N;  2FF3 B;  2ASO A;  3L4I A;  1P8Z A;  1VQ4 N;  3FZK A;  2QEX N;  3F9M A;  5T7B A;  3BUZ B;  1V4S A;  2HHS A;  4EAH D;  4DV7 K;  4BR7 A;  1SL1 A;  3C7N A;  4IWV A;  3PY8 A;  3CET A;  1KC8 O;  1BOT O;  3QFU A;  2YHY A;  1Q9X A;  3FZM A;  1JL1 A;  2VQF K;  4DTS A;  1NGC A;  4BDY A;  1WAF A;  4XH4 A;  3SPY A;  1D8Y A;  3VEZ A;  3RMB A;  4K42 A;  5C24 A;  3VEO A;  2P5O A;  4B9U A;  4DFP A;  3NF8 A;  4GMJ B;  5ADX H;  4RCH A;  1OKJ A;  4OGE A;  5HRP A;  4IJN A;  4JI0 K;  3M8Q A;  4LF6 K;  5C0Y A;  2FLO A;  1ZBI A;  4M42 A;  3SCX A;  2R7Y A;  3B6O A;  5GIO A;  2HHU A;  1NJZ A;  5AZJ B;  1L3T A;  1K9M O;  1RIL A;  2ZE2 A;  2OA8 A;  3LDQ A;  3AVF A;  4BRD A;  4MO5 A;  3LDN A;  4V19 S;  2JWL A;  4DR2 K;  4KHS A;  2RF2 A;  3E9P A;  2YCH A;  2JWK A;  5AQQ A;  4Q0B A;  1K8K B;  1ZBL A;  4CBU A;  4N76 A;  4C1N K;  2Y1J A;  1HYZ A;  5KGW A;  3OS0 A;  3QB0 A;  4WFB L;  4CGI A;  1WSH A;  3SMS A;  5JIC A;  4BE2 A;  3CQX A;  1JCE A;  3AO3 A;  3CC4 N;  3V4I A;  3VER A;  4E89 A;  2W40 A;  3CJ9 A;  4BR5 A;  4CJU A;  3V9X A;  3D2E A;  1C0T A;  4ELT A;  1DTQ A;  3OS1 A;  1SL2 A;  3CG7 A;  3VMF B;  1WAJ A;  4GW6 A;  5HLF A;  3PLA A;  5AQI A;  4Y0W A;  3C95 A;  4Z94 A;  4CJT A;  3CIP A;  4N56 A;  2ZWH A;  3OYK A;  2XY5 A;  4DFM A;  4RWT A;  1N34 K;  4O4G A;  3H08 A;  1DLO A;  3LP2 A;  2P9K A;  1RBS A;  1N8R O;  2ZGZ A;  5MLC Q;  3VEY A;  1OH7 A;  5J1E A;  1NGD A;  1NGF A;  4B9S A;  4H0P A;  2E2Q A;  3CQY A;  3AA5 X;  3V9W A;  3CM5 A;  2P9I B;  2WC9 A;  4OPK A;  1BO5 O;  1LW0 A;  4CJ3 A;  4IBN A;  4FJN A;  1ASV A;  4EHU A;  1TKX A;  5JLH A;  2BTF A;  1CZA N;  2WFB A;  3WQT A;  4JLH A;  1X3N A;  4F8R A;  4DV5 K;  1X9W A;  3AA2 A;  1RT3 A;  5E26 A;  4H0V B;  2ETJ A;  1NGB A;  4N5S A;  3M6G A;  3WEE A;  2E1Y A;  3VQA A;  3C6A A;  3VET A;  4CF8 A;  1VSI A;  3RR8 A;  2UUA K;  1K8K A;  1GOA A;  4CER A;  2WTU A;  1T03 A;  2KKZ A;  1RT1 A;  1G15 A;  4Y1D A;  1FKO A;  5C12 A;  4FWP A;  1YJN N;  3OYD A;  2F96 A;  3KZB A;  1U04 A;  2KW4 A;  2PZS A;  1VQ6 N;  4H03 B;  1KAZ A;  3BDP A;  1K6Y A;  2UXC K;  1CXQ A;  3E9O A;  3TU5 A;  1QVG M;  3EKS A;  4DWI A;  3J7Z O;  5C10 A;  3G4S N;  1LAV A;  3AO1 A;  2Q2R A;  3KHY A;  3RTV A;  3NGI A;  4I6M B;  4DCH A;  1VAZ A;  2P9N B;  1JLB A;  4AHV A;  4PKG A;  4BQZ A;  3D7E O;  3QLH A;  4DTO A;  4K43 A;  2RE2 A;  3THX B;  3QEI A;  4W5O A;  2QKB A;  3S41 A;  1LWC A;  3TSQ A;  4A2B A;  1VK0 A;  5AZI B;  1WBD A;  2ZJR L;  4BVP A;  2UXD K;  4BRA A;  4BR9 A;  4YOT A;  3ZX3 A;  5AJ3 K;  4FJH A;  2PYL A;  3CCM N;  3AO5 A;  2IDO A;  4BWM A;  3K5N A;  4FM2 A;  1YTA A;  1FKP A;  1NM1 A;  3LP0 A;  3R8E A;  3PIP L;  4WYB A;  1DEJ A;  1UA0 A;  3DYA A;  1ZXO A;  5KRS A;  4JKG B;  1RTH A;  2XRI A;  3PX4 A;  2I7P A;  5K14 A;  3ATU A;  3U9Z A;  3VQQ A;  5J2P A;  1ZYQ A;  3IS9 A;  2HBJ A;  4KO0 A;  4F4K A;  4JYA K;  2G8H A;  4DTM A;  1RDW X;  3SUN A;  3MN9 A;  4DU1 A;  2LSN A;  3O80 A;  1E3M A;  1S1V A;  4MO4 A;  3M8S A;  3M5R A;  2QI2 A;  3MED A;  2VG6 A;  1WSI A;  3K58 A;  1JJ2 M;  4YDU C;  4K41 A;  4OLB A;  1EX4 A;  3T7Z A;  1OH6 A;  4KB0 A;  3ULE B;  4HCC A;  3M1F A;  4B9Q A;  3V9Z A;  1VQK N;  3ZET B;  1S9E A;  2G8F A;  4PY5 A;  3DOL A;  2E6M A;  3OYA A;  3KLH A;  1KD1 O;  3V1Q A;  3HVT A;  1C0U A;  3FZH A;  2YHW A;  3C6U A;  3JAM O;  4FJ7 A;  5C25 A;  4G9Z A;  3U3G A;  2W6K A;  1X9J A;  4I6M A;  2P9N A;  5AQY A;  3K5M A;  1GLD G;  2BH1 A;  4AHC A;  3BF1 A;  2P51 A;  3A5M C;  3N4P A;  1X9S A;  4DSJ A;  1NK7 A;  1HX1 A;  4M63 C;  5EXW A;  4QCL A;  3UB5 A;  3KJV A;  1BQM A;  1NNE A;  4J2D A;  2E6L A;  4M3Z A;  3G6E N;  5EVZ A;  2W41 A;  4XH5 A;  4NLB A;  5AZI A;  1BUP A;  2G8W A;  4H5R A;  2ZF5 O;  1J6Z A;  1HQU A;  1SQK A;  1BGX T;  1WSJ A;  3TTD A;  4H4M A;  1ZBF A;  1EKE A;  4DTU A;  3SK3 A;  4EHT A;  1XMO K;  1LWF A;  4FSV A;  1MWM A;  3NGZ A;  4FL9 A;  2XY7 A;  2VGM A;  1ZBU A;  3TTC A;  3C94 A;  1KRP A;  1IO2 A;  4FJJ A;  1NKB A;  3TSP A;  3ZSQ A;  3LL3 A;  4CD1 A;  4E1N A;  4LF4 K;  4B1W B;  3M8R A;  2ATQ A;  1C1B A;  3HOT A;  2EX3 A;  1GOC A;  4H0T B;  3AVK A;  4I2P A;  4DV3 K;  1U47 A;  3ZLJ A;  3MMV A;  3NH1 A;  4JS5 A;  2UUB K;  4O8U A;  3I0S A;  1XUP O;  3NCI A;  2PY5 A;  4CD3 A;  4PHT X;  1K8A O;  3J7Y P;  4HUE A;  1TK8 A;  1N32 K;  3F9K A;  3OA9 A;  3P39 A;  3CD6 N;  2X6S A;  3H3N O;  2GX9 A;  4FK4 A;  4LFA K;  4HTL A;  1KVB A;  4J8F A;  3KLF A;  3TAM A;  3MCA B;  4JI1 K;  3T69 A;  2RKI A;  4R79 A;  1WBB A;  1BIU A;  4KI6 A;  4E7H A;  3IFR A;  4JI2 K;  3HZ6 A;  1BDG A;  3QES A;  5BN8 A;  2E2P A;  3NF7 A;  3ALY A;  3VTH A;  4CEE A;  4BRQ A;  2GWK A;  1A5W A;  2D5R A;  3SMP A;  4Z4E A;  3MXM A;  3LDP A;  1BIZ A;  4A2A A;  4FOE A;  4B1Z A;  2E5L K;  3MAQ A;  3N4Q A;  3HYF A;  3THW A;  2YI1 A;  4CEO A;  3DLB A;  2NRZ A;  1W7A A;  3CFR A;  3SAH A;  1IKV A;  2P9L B;  2CGJ A;  2CGL A;  3WXM B;  4DV1 K;  2Z1G A;  3CJA A;  4KH5 A;  3CFO A;  2Z1H A;  5CZ1 A;  3JSM A;  5HOO A;  1RDA A;  4NYN A;  1Q86 O;  4KHP K;  4JAX A;  4DQQ A;  5JS2 A;  2YHB A;  1NGE A;  1VHX A;  4CJK A;  1VQ9 N;  4LH4 A;  1KCF A;  2P9U B;  2Q1N A;  3CQ8 A;  1JCF A;  4JK9 A;  1JLG A;  1JLC A;  4FWM A;  2QXF A;  3KD5 E;  2D4W A;  4BG9 A;  4DLG A;  4W5Q A;  3J80 O;  1KLN A;  1YUW A;  1ITG A;  3ZSZ A;  2HVH A;  3DMJ A;  5BRH A;  1T05 A;  1RT7 A;  5DK5 A;  1QTM A;  4FW2 A;  3AY9 A;  5EX5 A;  4IOC L;  4OKK A;  2OCE A;  1RTD A;  1HPM A;  2ITG A;  3OYF A;  4FZY A;  1D5A A;  2XY6 A;  1HUX A;  1QS4 A;  2P9S A;  1HMV A;  2HBK A;  4GVE A;  1NLV A;  4CJR A;  4JKC A;  2FBV A;  4XH1 A;  2FSJ A;  4BRG A;  3CC2 N;  1IV0 A;  2BDP A;  4QS7 A;  3CI5 A;  2BUP A;  4YOV A;  4PUO A;  3CPW M;  4LF8 K;  1DTT A;  2PAV A;  3EYZ A;  2HHV A;  3UE5 A;  5LY3 A;  2X74 A;  2YJE A;  1HR0 K;  4BAC A;  4DFK A;  4E7K A;  3QEV A;  3C7N B;  4DMN A;  2YKM A;  3DLH A;  1TYQ A;  1BCM A;  3KD1 E;  2HVI A;  2F8T A;  1W2B M;  3VQC A;  4U67 L;  2QA4 N;  3O5B A;  2FC0 A;  4GV3 A;  1Z05 A;  2D0C A;  3NVK A;  3WXI A;  1TGO A;  1JKH A;  2FF6 A;  3HK2 A;  3WNG A;  1NK8 A;  1CZB A;  2OPP A;  3U9D A;  4FPA A;  4EZ6 A;  3K9K A;  3DAW A;  4B3M K;  4DU3 A;  2B4J A;  3PIO L;  1QQM A;  4GNI A;  3TAG A;  2OYQ A;  1YXQ A;  3LAM A;  3VF4 A;  3WNF A;  3TR8 A;  1RT4 A;  4XIU A;  1FW6 A;  4CEF A;  4DFJ A;  1N33 K;  2A42 A;  1LOT B;  3DOK A;  3SQ1 A;  4CK1 A;  3ZSY A;  4WQ4 C;  2GBZ A;  4FM1 A;  2DFE A;  3OHR A;  4L3Q A;  4HWI A;  4FVU A;  3U8X A;  5AFU A;  3ID6 A;  3S3M A;  4M7X A;  1VSJ A;  3VEX A;  4A62 A;  4Z4F A;  2HW3 A;  5BN9 A;  4H5T A;  3VEW A;  3VQ9 A;  2CH6 A;  5DM7 L;  4TSX A;  3D2E B;  3WNE A;  5E41 A;  3OJS A;  1DKG D;  2HBL A;  3KKR A;  4CGD A;  4C8N A;  1YAG A;  3AVC A;  3O4Q A;  2GUI A;  1WLJ A;  2WUS A;  4W5T A;  3QEX A;  1HNX K;  3DXM A;  1W0H A;  4M3U A;  1XWL A;  1E4F T;  3OYN A;  4I9L A;  4YFU A;  4BR4 A;  2PYJ A;  2P9K B;  3VQ6 A;  1YIT N;  4Q5V A;  3NH2 A;  3K0S A;  3L0Q A;  2YHX A;  4BDZ A;  2GWJ A;  2OZM A;  4FWK A;  3OYG A;  2Q3S A;  5KPZ A;  1RTJ A;  4BRC A;  3ZT2 A;  2NNW A;  1M1K O;  5TKY A;  2UXB K;  2NRV A;  4H5V A;  3BP8 A;  4DTN A;  3KKS A;  3BY5 A;  1XHX A;  2KFN A;  3L2U A;  4WCE L;  2ZD1 A;  4DU4 A;  1K73 O;  2J4R A;  3K59 A;  1FK9 A;  4BRE A;  5AQS A;  3LM2 A;  4CHQ A;  3WEE B;  1TAU A;  1LW2 A;  2VYP A;  5DM6 L;  3T1Y K;  3V81 A;  4JK8 A;  4PL8 A;  1SKW A;  4I7F A;  3CCJ N;  1WSE A;  4IEE A;  4AM7 A;  4QS9 A;  2YNF A;  3MXI A;  4MDA A;  3D2F B;  2RN2 A;  3ASM A;  1N6Q A;  1GLL O;  4ID1 A;  3OS2 A;  4KHQ A;  5KRT A;  3JXU A;  1D4X A;  4ZTF A;  1NK6 A;  1QSL A;  1GLJ O;  3QBX A;  3KK1 A;  4BWJ A;  3CCL N;  1JLE A;  1Q9Y A;  1QSY A;  1B92 A;  2YV0 X;  2Z1I A;  3HPO A;  4B9V A;  3CCV N;  4WQ5 C;  2CH5 A;  5AQV A;  3NHG A;  5JVG L;  4DSF A;  1KFD A;  1ZBS A;  4CGG A;  4J2B A;  1SS6 A;  1B9D A;  1VQP N;  3KK2 A;  4F2S A;  2IOC A;  4BG8 A;  3EO3 A;  4FLT A;  3K5O A;  3D6R A;  3LPT A;  4BRF A;  3TAQ A;  3OVN A;  3O9T A;  4FOI A;  1SKR A;  4B9M A;  4CHP A;  1I3A A;  4DSL A;  4FWO A;  4O0J A;  3EE9 A;  2WBN A;  5BPN A;  1DT9 A;  5CY4 A;  4CJS A;  2HHQ A;  2HHX A;  1UOC A;  4PA1 A;  5BRD A;  1BCO A;  3P1G A;  3L2W A;  3UKR A;  3RVC A;  1MDU B;  2D0B A;  2B6A A;  4JKD A;  4CZM A;  1S6Q A;  4CHY A;  2FSK A;  2NRH A;  3VPZ A;  2D1K A;  3EEQ A;  3FR0 A;  3T3F A;  3ZSO A;  1B9F A;  4JEP A;  1NG9 A;  2H3G X;  2QWM A;  1HRH A;  3AGK A;  3OYB A;  4LF7 K;  4BGA A;  2RPI A;  1T3V A;  4IFE A;  4BVO A;  1UWB A;  3D2F A;  4NB4 A;  4YDU A;  3O6W A;  2CGK A;  3VGL A;  2OAN A;  3UIQ A;  4HUF A;  1JCG A;  4AHS A;  4NCB A;  2E8A A;  1HNV A;  4FZX C;  1A5X A;  1RTI A;  3HP9 A;  1QHT A;  4DTJ A;  1SV5 A;  1Y97 A;  4FWQ A;  1S3X A;  5JVH L;  4BC4 A;  4DR6 K;  1D9D A;  4DR1 K;  1BG3 A;  3IRX A;  5HRR A;  1I39 A;  3VQ8 A;  1XHZ A;  1E4G T;  3OBY A;  2F9T A;  3AVL A;  1D9F A;  3AAP A;  1R0A A;  3MEG A;  2OZS A;  3MK6 A;  3IMX A;  4BR0 A;  1EQY A;  2UYT A;  2GV9 A;  1RNH A;  3P83 D;  1RDC A;  1X3M A;  2G8V A;  1KVC A;  2X78 A;  2Z1J A;  4LF5 K;  4CIE A;  2V52 B;  4A59 A;  3ENO A;  3P5J A;  3SQ2 A;  4C23 A;  2HNY A;  3ZT4 A;  5AR0 A;  3LP3 A;  3MEE A;  4IO8 A;  1Q7Y O;  4EIA A;  3WT0 A;  3THV A;  4RW9 A;  1XQS C;  3NBP A;  2IS3 A;  5JMV A;  1HNZ K;  1VSD A;  3VEN A;  2KQ2 A;  2HOE A;  2IAJ A;  5LL6 Z;  5F0X A;  2VG7 A;  3O1W A;  3RMD A;  1QHA A;  4BC2 A;  3KK7 A;  2VG5 A;  2G8K A;  1QZ5 A;  2W42 A;  2O4I A;  2IVO A;  3SI6 A;  1P90 A;  5ADX A;  4YOY A;  5CZ2 A;  3V1R A;  2YJF A;  2ZJQ L;  3VA0 A;  4H4O A;  2PFU A;  1NGG A;  3AA4 A;  3VTI A;  2NZT A;  4DLE A;  4JI5 K;  3R6M A;  4YOR A;  4AM6 A;  4CEC A;  3C6T A;  3EZW A;  1J53 A;  3ZSX A;  4KB1 A;  4DTR A;  4BE1 A;  2F8S A;  3ZT1 A;  4YOU A;  3EY1 A;  1EP4 A;  3E9L A;  3SBG A;  4CGH A;  3QNO A;  1L3U A;  1ESV A;  3J81 O;  3EE8 A;  4FLV A;  5AQN A;  2P9P B;  4AHT A;  1IKW A;  1BI4 A;  4OO1 J;  4CED A;  3PX6 A;  3PO4 A;  3AVB A;  4CHN A;  3OYH A;  1HKG A;  3RRG A;  3DLR A;  3CCR N;  3P4I A;  1YI2 N;  5FRN A;  4FWS A;  1EWQ A;  3ZSR A;  2DTU A;  2ZJP L;  1LWE A;  2ASP A;  3IUC A;  2DY4 A;  2A41 A;  3AVJ A;  3I55 N;  2IGI A;  2O8E A;  1F21 A;  1ZBH A;  1L3V A;  3VF6 A;  5BRF A;  3VGM A;  2ZQB A;  3SQ0 A;  3TTF A;  5DMR A;  4O5F A;  1NK0 A;  4LFC K;  4W5N A;  3H3O B;  1QE1 A;  1Z25 A;  1EET A;  4J2A A;  4ISE A;  5KPR A;  4DSE A;  4M3X A;  1RDB A;  3FFI A;  4LD0 A;  4CCH A;  3L3V A;  2HBM A;  4JRP A;  3O9U A;  2AA4 A;  3ZEU A;  4DV4 K;  5C42 A;  3VEV A;  1BQN A;  4JI3 K;  1C1A A;  2VWJ A;  3CF5 L;  4K0K K;  2XO7 A;  3DJC A;  4GV9 A;  4EP5 A;  4CIG A;  3THW B;  2ITM A;  2P5G A;  3V6D A;  4BC3 A;  4LC9 B;  3MX5 A;  1JXE A;  4B3R K;  2QK9 A;  4CZG A;  3SV3 A;  1UAX A;  2QW9 A;  2GEM A;  2G8I A;  2O8F A;  3QIC A;  4DF4 A;  2UUC K;  1X1P A;  2VWB A;  5EOY A;  3DRR A;  5J2M A;  1IJJ A;  3KIO A;  1U4B A;  4OGC A;  3M3Z A;  3I8D A;  3T19 A;  1QQN A;  2FSN A;  3S3O A;  4FCY A;  4JKH A;  4JNE A;  1VQ7 N;  4FK0 A;  4CEZ A;  5IT9 O;  1TK0 A;  4CJE A;  4OPA A;  4FJL A;  4CE9 A;  4GKJ K;  1NK4 A;  5BPL A;  3QIO A;  3O9Q A;  4IKF A;  4CK3 A;  4CVN E;  2P9P A;  4K25 A;  5AQF A;  3SAG A;  2EWS A;  3WQU A;  3NF6 A;  5GAG P;  1J5E K;  3TAR A;  4JI4 K;  4CF0 A;  3CCE N;  1J5O A;  4CGJ A;  4CEA A;  3LZI A;  1NMN A;  4DQP A;  4BRM A;  1ASU A;  4B8C A;  2HMP A;  5H1S Q;  1RBV A;  1RBT A;  1WSF A;  3V9S A;  2P9S B;  3SQ4 A;  5CE3 A;  4L8R B;  3OJU A;  3CJ7 A;  4KTZ A;  4FLW A;  4PQU A;  4FLU A;  5LJV A;  1H1V A;  2RHK A;  1TV6 A;  3AA3 A;  4DV0 K;  1OVQ A;  3ENH A;  3AVN A;  3SJJ A;  2AJQ A;  2HNZ A;  4A57 A;  3ISN C;  4N41 A;  4G1Q A;  3IDH A;  4BRL A;  4IJA A;  3BZC A;  1VSM A;  4I2Q A;  3QDK A;  4KTW A;  3MCP A;  4NO7 A;  4DQI A;  2YKN A;  4BC5 A;  5I9E B;  4AQY K;  3K5L A;  1JLF A;  2Q36 A;  1L3S A;  3AGR A;  3ZSW A;  4O5B A;  1XNR K;  2O8C A;  4B1V A;  3KWI A;  4F3O A;  1TYQ B;  2FBY A;  3SNN A;  1RDD A;  3GDQ A;  3BF3 A;  5AQP A;  3KLI A;  3MN5 A;  5KQD A;  3QEP A;  4IXC A;  5FPE A;  2GUP A;  3A0I X;  3SUQ A;  4FPB A;  3W0L A;  1Z26 A;  4DR3 K;  3LAL A;  2DPN A;  3H6E A;  3MX2 A;  5LJW A;  1REV A;  3MXJ A;  5KGX A;  4CJF A;  1NOZ A;  2Q0R A;  3KWG A;  5AQW A;  4CI6 A;  1C0M A;  3JS6 A;  3KK3 A;  1NK5 A;  3CER A;  1TUU A;  3FFK B;  2BGG A;  4RTF D;  1U48 A;  4KKO A;  4IG0 A;  4WQ4 A;  3G25 A;  4CF9 A;  4QAG A;  4KV8 A;  1IKX A;  1S9G A;  4KH6 A;  3VA3 A;  3W3D A;  4BRO A;  3IAY A;  4U7B A;  2F7T A;  3HT3 A;  2E2O A;  4CZL A;  3K57 A;  1A5V A;  5JS1 A;  3Q7B A;  4QS8 A;  3EZ5 A;  4BRN A;  5HBM A;  2W6L A;  4CZI A;  2WON A;  4WFA L;  4KRE A;  1HNI A;  3HM8 A;  3HM9 A;  1LV5 A;  1SKS A;  3RSE A;  3DXM B;  4FW1 A;  4ICL A;  1TL3 A;  4DKW A;  1T6C A;  5LMU K;  1NGH A;  5AQH A;  4WE1 A;  3SUP A;  1M90 O;  3I56 N;  4OLA A;  2V7Z A;  3R9P A;  2ZGY A;  3GL1 A;  4E19 A;  4DV6 K;  4JI6 K;  4HUG A;  4DSI A;  4FZZ A;  1S5J A;  1HKB A;  4DS5 A;  3DRS A;  4OJR A;  3A5L C;  3ATV A;  4JS4 A;  3ITH A;  4X66 K;  5SZT A;  4DHY A;  4BY9 C;  4BR2 A;  4KHW A;  2QWQ A;  1WB9 A;  1UA1 A;  3S9H A;  5CHI A;  3EKU A;  1T7P A;  3HOS A;  1ASW A;  1W97 L;  1V4T A;  4CZH A;  3NDK A;  4ELU A;  1TK5 A;  4PKH A;  3SUO A;  1QVF M;  5GAE P;  1VQ5 N;  3FE1 A;  3KVG A;  4LSN A;  4CFB A; 
#chains in the Genus database with same CATH homology
 1RDW X;  5M1Q A;  3MN9 A;  4BG8 A;  3EO3 A;  3O80 A;  3D6R A;  4ISF A;  4BRF A;  3ZYY X;  4FOI A;  3O9T A;  4MO4 A;  3M5R A;  1IG8 A;  2QI2 A;  1JJ2 M;  3CXC M;  4YDU C;  4K41 A;  4CJ7 A;  5M1N A;  3CJ1 A;  3T7Z A;  4FWO A;  4BRH A;  3EE9 A;  3SAF A;  2WBN A;  5FPM A;  5BPN A;  1DT9 A;  2NLX A;  3AAR A;  5E84 A;  3ULE B;  4BRP A;  3M1F A;  4B9Q A;  5F1X A;  1VQK N;  3ZET B;  4FWL A;  4C1N I;  5BRD A;  2D0O A;  1YIJ N;  3UKR A;  1U2V B;  3RVC A;  1MDU B;  4YOX A;  4JKD A;  3BEX A;  4IOA L;  1KD1 O;  4CZM A;  3NVM A;  4WQ5 A;  2A40 A;  2VCP A;  2FSK A;  3FZH A;  4PKI A;  2YHW A;  3DXK B;  4H0Y B;  2NRH A;  3GE1 A;  3J8A A;  3VPZ A;  2D1K A;  4G9Z A;  3FR0 A;  3E66 A;  3IKM A;  4IZ9 A;  1X9J A;  4JEP A;  5GAH P;  4I6M A;  2NRT A;  1GLF O;  2H3G X;  2P9N A;  2ASM A;  5AQY A;  4JKA A;  2GTD A;  2A3Z A;  2QWM A;  1GLD G;  3AGK A;  2BH1 A;  1BA0 A;  4IOX A;  1Q18 A;  3FZF A;  3BF1 A;  3OBW A;  1QZ6 A;  5AQX A;  3A5M C;  3N4P A;  4BGA A;  5HL7 L;  1T3V A;  4IFE A;  5AQU A;  3VGK A;  4BVO A;  1HX1 A;  4M63 C;  3GOI A;  5EXW A;  5FPN A;  3D2F A;  3LDO A;  5ELZ A;  1WUA A;  4NB4 A;  3R3L A;  1NGI A;  3UB5 A;  1VQM N;  4YDU A;  3G6E N;  2IVN A;  2CGK A;  2W41 A;  3O6W A;  4NLB A;  1BUP A;  4O8K A;  4XH5 A;  3Q7C A;  5AQK A;  4H5R A;  2ZF5 O;  1J6Z A;  3VGL A;  3AAQ A;  1SQK A;  2OAN A;  1G99 A;  4CZJ A;  3TTD A;  1JCG A;  5AQG A;  2E8A A;  4JHD A;  3CMA N;  4KBO A;  3SK3 A;  4EHT A;  4CZE A;  4FSV A;  4CZF A;  1MWM A;  1WOQ A;  4FL9 A;  2VGM A;  1DGK N;  4FWQ A;  3TTC A;  3UKR B;  1S3X A;  5JVH L;  4BC4 A;  1BG3 A;  1E4G T;  3A5N C;  3OBY A;  5KPT A;  4WF9 L;  3TSP A;  4FWR A;  1GLE G;  3LL3 A;  4JD2 B;  2F9T A;  3UKU B;  3AAP A;  4CD1 A;  3TSU A;  3MK6 A;  3H46 O;  3IMX A;  4B1W B;  4BR0 A;  1EQY A;  2UYT A;  1VQO N;  2QWR A;  2E2N A;  4XEI A;  4B1U B;  3HRG A;  1X3M A;  3HOT A;  1MA9 B;  4MLE A;  4H0T B;  2V52 B;  1Q81 O;  3H1Q A;  4A59 A;  3ENO A;  3L4Q A;  3MMV A;  2E88 A;  4YOW A;  4C23 A;  2V51 B;  3C6H A;  3H45 C;  5EY4 A;  1NBW A;  2YX6 A;  3I8B A;  4JKB A;  4O8U A;  5AR0 A;  1XUP O;  4PL7 A;  4IO8 A;  1Q7Y O;  3EN9 A;  4CD3 A;  4DQ8 A;  3WT0 A;  4EIA A;  4PHT X;  4WFN L;  1SZ2 A;  1K8A O;  1NWK A;  3G71 N;  1XQS C;  3QBW A;  3OA9 A;  3P39 A;  4JHD B;  3F5T A;  5JMV A;  3FGU A;  3H3N O;  3VEN A;  2GX9 A;  3CD6 N;  1C0F A;  2HOE A;  4HTL A;  1Q82 O;  1HJO A;  1U2V A;  4J8F A;  3WXJ A;  3CJC A;  3C0B A;  2P9L A;  5F0X A;  3O1W A;  1NGA A;  2HF3 A;  2QWO A;  3MCA B;  3T69 A;  1ILY A;  1EO1 A;  1QHA A;  4BC2 A;  3DXK A;  1HKC A;  3KK7 A;  1RGI A;  5BRE A;  4R79 A;  5GIN A;  3L6Q A;  1QZ5 A;  4B1X B;  4BRK A;  5AQT A;  5C2D A;  3IFR A;  2IVO A;  1GLA G;  5AQR A;  5GIP A;  4IDH A;  4MDB A;  1P90 A;  3HZ6 A;  1BDG A;  5ADX A;  4YOY A;  2AP1 A;  3B8A X;  4E1J A;  2YJF A;  5BN8 A;  2ZJQ L;  2E2P A;  5EVZ A;  3MDQ A;  2PFU A;  1OVY A;  3VTH A;  3O9S A;  4BRQ A;  5GAD P;  1NGG A;  1NJI O;  2GWK A;  2NZT A;  3VTI A;  3A8Y A;  3CME N;  3R6M A;  3SMP A;  4YOR A;  5M1O A;  4H5N A;  2P9U A;  4AM6 A;  1YVN A;  3EZW A;  3HI0 A;  3LDP A;  3H1V X;  3GG4 A;  4EFH A;  3DWL A;  4A2A A;  5BR9 A;  4FOE A;  4YOU A;  3HTV A;  3SBT A;  3E9L A;  3SBG A;  4B1Z A;  1ESV A;  3EE8 A;  2KHO A;  5AQN A;  3SJH A;  5B8H A;  2P9P B;  1XC3 A;  3N4Q A;  1ATN A;  1Z6R A;  4OO1 J;  3EL2 A;  3OW2 M;  4MLH A;  2QXL A;  1HKG A;  2YI1 A;  3CCR N;  2OTL N;  3MN6 A;  3P4I A;  2NRZ A;  2E20 A;  5AQO A;  5AQZ A;  1YI2 N;  3SAH A;  2Q31 A;  2P9L B;  3O4W A;  4FWS A;  5AQL A;  2CGJ A;  2CGL A;  4BQL A;  3WXM B;  1T6D A;  5C2F A;  2ZJP L;  2ASP A;  3IUC A;  3CJA A;  1HLU A;  2A41 A;  4JD2 A;  4OPH A;  3UKU A;  3I55 N;  4KH5 A;  3WXK A;  2IIR A;  5HOO A;  4JK7 A;  4NLC A;  3SLC A;  1Q86 O;  3ENB A;  1RDU A;  2QTD A;  1S72 N;  4JAX A;  1KAY A;  3VF6 A;  5BRF A;  3P31 A;  3VGM A;  2OTJ N;  3TTF A;  2KLA A;  4O5F A;  3R1X A;  3H3O B;  1Y64 A;  1NGE A;  3P38 A;  1VQ9 N;  4UY8 O;  5AZJ A;  1YHQ N;  1ATR A;  4ISE A;  2P9U B;  1BU6 O;  3K9J A;  5KPR A;  2Q1N A;  3LM9 A;  3CC7 N;  2FF3 B;  3LDL A;  3C65 A;  1JCF A;  2ASO A;  3L4I A;  4H0O A;  1P8Z A;  4JK9 A;  1VQ4 N;  3FZK A;  4FWM A;  2HBM A;  2QEX N;  2D4W A;  2AA4 A;  3F2K A;  3F9M A;  3O9U A;  3ZEU A;  3CHW A;  4BG9 A;  4BRI A;  3BUZ B;  1V4S A;  3VEV A;  4EAH D;  4BR7 A;  4H0X B;  3CF5 L;  4ILH A;  1YUW A;  3C7N A;  3DJC A;  4GV9 A;  3VF2 A;  3FZL A;  4IWV A;  2ITM A;  3CET A;  5BRH A;  1RFQ A;  4CZK A;  1KC8 O;  1BOT O;  4LC9 B;  3MX5 A;  3QFU A;  2YHY A;  4BC3 A;  3FZM A;  4ILG B;  1NGC A;  1KQS M;  3AY9 A;  1R59 O;  4XH4 A;  3FLC O;  4CZG A;  5EX5 A;  4IOC L;  3VEZ A;  2HF4 A;  2QWN A;  4K42 A;  2QW9 A;  2GEM A;  3VEO A;  1HPM A;  3QIC A;  2VWB A;  5ADX H;  1HUX A;  2P9S A;  5EOY A;  2HBK A;  3I33 A;  1NLV A;  4GVE A;  1IJJ A;  4JKE A;  4RCH A;  4JKC A;  3M3Z A;  1OKJ A;  4XH1 A;  4IJN A;  2FSJ A;  1QQN A;  2PBD A;  4BRG A;  3CC2 N;  5C0Y A;  2FLO A;  2FSN A;  5GIO A;  4QS7 A;  4JKH A;  4JNE A;  3CI5 A;  2BUP A;  5AZJ B;  5JLF A;  1VQ7 N;  1U6Z A;  1K9M O;  3WUH A;  4YOV A;  3CPW M;  3LDQ A;  4OPA A;  2PAV A;  4MO5 A;  3LDN A;  4BRD A;  1GLC G;  3UE5 A;  5BPL A;  3MWT A;  3O9Q A;  1ATS A;  3ZEU B;  4CBX A;  2JWL A;  2V7Y A;  5LY3 A;  5AZI A;  2P9P A;  1SAZ A;  2YJE A;  4K25 A;  5AQF A;  5M1P A;  3E9P A;  2EWS A;  2YCH A;  3WQU A;  3SAG A;  5GAG P;  2JWK A;  3CCE N;  3C7N B;  5AQQ A;  1K8K B;  1TYQ A;  4CBU A;  2QWP A;  3CCU N;  4FWN A;  1YF5 L;  4C1N K;  1W2B M;  1VQN N;  3QB0 A;  4U67 L;  4WFB L;  2QA4 N;  3O5B A;  3SMS A;  5JIC A;  4GV3 A;  1Z05 A;  4BRM A;  3CQX A;  1JCE A;  3NVK A;  3CC4 N;  2HMP A;  3WXI A;  5H1S Q;  2P9I A;  4DB3 A;  2FF6 A;  3VER A;  4JKF A;  1KAX A;  5KQ8 A;  2W40 A;  2P9S B;  3VOV A;  3CJ9 A;  5CE3 A;  4BR5 A;  3D2E A;  3CJ7 A;  5LJV A;  1H1V A;  2RHK A;  3U9D A;  5CR4 A;  4GV6 A;  4FPA A;  3VMF B;  3ENH A;  3K9K A;  3DAW A;  3PLA A;  5AQI A;  4Y0W A;  4Z94 A;  3PIO L;  1QQM A;  4GNI A;  3CIP A;  1YXQ A;  4A57 A;  2ZWH A;  5FPD A;  3HSC A;  3VF4 A;  3IDH A;  1YJW N;  4BRL A;  4RWT A;  4IJA A;  5TKW A;  3QDK A;  4KH4 A;  3MCP A;  3QML A;  4NO7 A;  4BC5 A;  5I9E B;  2Q36 A;  3AGR A;  4IEI A;  2NRW A;  4B1Y B;  1GLB G;  2P9K A;  3HBT A;  1N8R O;  1MWK A;  2A42 A;  1VQ8 N;  1LOT B;  2ZGZ A;  4B1V A;  3KWI A;  3A5O C;  1TYQ B;  5MLC Q;  4WQ4 C;  4FVU A;  3OHR A;  4L3Q A;  4HWI A;  2Q97 A;  3GDQ A;  3VEY A;  1VQL N;  3MWP A;  3U8X A;  1NGD A;  3BF3 A;  5AQP A;  1NGF A;  5AFU A;  3E1Y A;  3ID6 A;  3MN5 A;  4H0P A;  5KQD A;  2D0P A;  3ID8 A;  4M7X A;  2E2Q A;  3CQY A;  4IXC A;  5FPE A;  2GUP A;  2VGN A;  3A0I X;  3VEX A;  4A62 A;  4A5B A;  5BN9 A;  4FPB A;  3W0L A;  4H5T A;  2P9I B;  2WC9 A;  3VEW A;  3ZX2 A;  1BO5 O;  5M1F A;  2CH6 A;  5DM7 L;  3O08 A;  2DPN A;  3H6E A;  3CPE A;  3D2E B;  1BWF O;  4BGB A;  3MX2 A;  4EHU A;  5JLH A;  1O13 A;  4FO0 A;  5LJW A;  1DKG D;  2BTF A;  2HBL A;  1CZA N;  2WFB A;  2A6A A;  1NMD A;  3WQT A;  2A5X A;  1X3N A;  1YAG A;  2Q0R A;  3KWG A;  5AQW A;  4CI6 A;  3JS6 A;  5M1K A;  5E26 A;  3CER A;  1TUU A;  3WXL A;  2WUS A;  3FFK B;  4H0V B;  3TPQ A;  4RTF D;  1NGB A;  3DXM A;  3M6G A;  3WEE A;  2E1Y A;  3C6A A;  3VET A;  1NGJ A;  4M7Y A;  1E4F T;  2F9W A;  4BR4 A;  1K8K A;  4ILJ A;  3NMU A;  5AQM A;  2P9K B;  1BA1 A;  4WQ4 A;  1YIT N;  3G25 A;  2FXU A;  3CCQ N;  2KKZ A;  2HST A;  3L0Q A;  2YHX A;  2GWJ A;  2IVP A;  3O8M A;  4FWK A;  4KH6 A;  5KPZ A;  3O9R A;  3W3D A;  4BRC A;  4BRO A;  5C12 A;  4FWP A;  1ZC6 A;  2NNW A;  1YJN N;  2QWL A;  4U7B A;  3KZB A;  1VQ6 N;  4H03 B;  1KAZ A;  4JN4 A;  1S22 A;  2F7T A;  3DLL L;  1M1K O;  2E2O A;  5TKY A;  2NRV A;  4A61 A;  4H5V A;  5F2R A;  3VES A;  4CZL A;  3BP8 A;  3E9O A;  3TU5 A;  1QVG M;  3EKS A;  3Q7B A;  4QS8 A;  3ZX0 A;  4BRN A;  4WCE L;  3J7Z O;  5C10 A;  4CZI A;  3G4S N;  2NRX A;  4CBW A;  4WFA L;  1K73 O;  1T44 A;  2J4R A;  4JKG A;  2Q2R A;  3HM8 A;  4BRE A;  3KHY A;  2Q0U A;  5AQJ A;  5AQS A;  3LM2 A;  4I6M B;  3RSE A;  3DXM B;  3WEE B;  4DCH A;  1VAZ A;  2P9N B;  1T6C A;  2VYP A;  1NGH A;  3GBT A;  4DKW A;  5AQH A;  4PKG A;  5DM6 L;  4JK8 A;  4PL8 A;  3CCJ N;  5C15 A;  1M90 O;  4A5A A;  4BQZ A;  3D7E O;  3I56 N;  2V7Z A;  4IEE A;  5AFU H;  4AM7 A;  1YJ9 N;  1C0G A;  4QS9 A;  4K43 A;  2RE2 A;  4AF1 A;  3R9P A;  2ZGY A;  2NRR A;  3GL1 A;  4MDA A;  3D2F B;  3CJB A;  3CCS N;  3S41 A;  1TUY A;  3TSQ A;  1KXP A;  4A2B A;  5AZI B;  2QM1 A;  1GLL O;  1HKB A;  2ZJR L;  4BVP A;  1QQO A;  4BRA A;  4BR9 A;  3A5L C;  1D4X A;  3JXU A;  4YOT A;  3ATV A;  3ULE A;  3ZX3 A;  4IO9 L;  1GLJ O;  3QBX A;  3ZET A;  3CCL N;  3CCM N;  4ISG A;  4DHY A;  2E1Z A;  5BPM A;  4BY9 C;  4BR2 A;  4F9O A;  1NM1 A;  2QWQ A;  3R8E A;  3PIP L;  3MN7 A;  3U4L A;  4WYB A;  1DEJ A;  5CHI A;  3EKU A;  3HOS A;  4WQ5 C;  3CCV N;  2CH5 A;  3QFP A;  1W97 L;  5AQV A;  1ZXO A;  1V4T A;  4CZH A;  5JVG L;  4H5W A;  4JKG B;  1ZBS A;  1LCU A;  2I7P A;  3ATU A;  3U9Z A;  4PKH A;  2GEL A;  3RSE B;  1QVF M;  2I7N A;  2HBJ A;  5GAE P;  1SS6 A;  1VQ5 N;  4GY2 B;  3FE1 A;  3O1B A;  3KVG A;  1VQP N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...