4GVEA

Tacaribe nucleoprotein structure
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
207
structure length
197
Chain Sequence
DIGSEFEGQELIVRAAVSELDPSNTIWLDIEGPPTDPVELALYQPAKKQYIHCFRKPHDEKGFKNGSRHSHGILMKDIEDAVPGVLSYVIGLLPPNMVITTQGSDDIRKLLDIHGRKDLKLIDVKFTSDQARQFEHQVWDKFGHLCKQHNGVIISKPSPDEPHCALLDCIMFHSAMSGELPKEEPIPLLPKEFLFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nucleoprotein
publication title Structures of Arenaviral Nucleoproteins with Triphosphate dsRNA Reveal a Unique Mechanism of Immune Suppression.
pubmed doi rcsb
source organism Tacaribe virus
molecule tags Viral protein
total genus 57
structure length 197
sequence length 207
ec nomenclature
pdb deposition date 2012-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.410 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4gveA00
3Q7BA 4GVEA 3R3LA 4GV3A 4GV6A 3MX5A 3MX2A 3MWPA 3MWTA 3Q7CA 4FVUA 4G9ZA 4GV9A
chains in the Genus database with same CATH superfamily
1BHLA 3D7EO 2HBMA 3HP6A 1W97L 3AY9A 3K59A 1JCGA 4BR7A 1D9FA 4IO8A 4KHWA 1UOCA 4LF6K 3QEPA 3O5BA 1T44A 2AA4A 2O8FA 4DR2K 4DQPA 4CD1A 3ULEA 3FZKA 3OS1A 4F2RA 5LY3A 1U47A 4RW6A 2NRWA 4DV5K 2FSJA 5AQWA 3MX2A 3A5LC 3FFKB 4JKBA 2A5XA 1QSLA 4M7YA 3LDLA 3ZSZA 4CI6A 1TL1A 3K9KA 5LMUK 4CZFA 1BI4B 3R3LA 4B8AB 4FWMA 3KD5E 3MXMA 3LDQA 2VGMA 1JLFA 4C8NA 3CC7N 4CJSA 3PX6A 1K8KB 3F2KA 3NVKA 5D3GA 4JK8A 1BDGA 4F2SA 4DTOA 1RFQA 4BC4A 1KCFA 3VA0A 3LANA 3V1OA 2OA8A 4LF4K 4CVNE 1L3SA 1X3NA 3I0SA 1QSYA 4PA1A 2OCEA 4CJFA 5BN9A 5GAHP 1V4TA 5AQGA 4CHOA 1YAGA 1SV5A 3QMLA 4QS7A 1KAZA 4DV4K 5AQQA 3DXMB 3L3VA 1C0UA 3AGKA 1HNXK 4RTFD 1VAZA 4B1XB 4CEFA 1VSLA 2O8DA 1WSIA 5KQ8A 1IKXA 3HXMA 1XMQK 4Z4EA 3K0SA 1VQ5N 3I8DA 2P9PA 1W9HA 5FPNA 3JAMO 3F9KA 1VHXA 3CJAA 4JI7K 2OTLN 4W5RA 1RBVA 1S5JA 3HI0A 4B1UB 4B9SA 3HM9A 4Y0WA 4FLVA 3DLKA 4JKHA 1A5VA 3AVBA 3AAPA 1OVQA 3MEEA 5C24A 3AVAA 4A62A 3TANA 3NGZA 4EIAA 2I7PA 3W3DA 1HYSA 2Q1NA 4L3QA 1HNVA 4KO0A 2YNHA 3VERA 2Y1JA 3EZ5A 2VWKA 3RSEB 2P9KA 3TWHA 5LJWA 5ADXA 3O3FA 1YVUA 1WLJA 2A41A 1BISA 3ZCMA 1IV0A 3C6TA 4BWMA 4PY5A 4DQ8A 3IS9A 4FJ9A 4H03B 3SCXA 5CHIA 4B9NA 1JLAA 4JV5K 3ENOA 4CBUA 4CFDA 1RDUA 1G99A 4B9QA 2FSNA 1S1WA 4CJLA 1NBWA 5FPDA 5FLXO 1VRUA 3R1XA 4F4KA 1QZ5A 3LDSA 1HR0K 1HPMA 4K8ZA 4LF5K 1JCFA 2F9TA 3OBWA 1NU0A 4DLEA 4FJIA 1JJ2M 3VPZA 2GELA 1MU2A 4MDBA 3THWA 3CMEN 4H0PA 3OBYA 3HOTA 5BN8A 5KTQA 2ZJRL 3CYMA 2ZE2A 2EHGA 4IOAL 4BRHA 3F5TA 5LJVA 3LAMA 1JLCA 4FM2A 4PQUA 5AQIA 2HBKA 5C15A 3V9ZA 1YT3A 1NK7A 4DR3K 3AAQA 3O08A 5T7BA 2HNDA 4DLGA 3PIPL 2EX3A 3OJUA 4CIEA 3ZT4A 3CF5L 4FK4A 1NNEA 2QM1A 2FLOA 1JCEA 1N5YA 3ZETA 4K25A 5FRNA 1OH6A 1XC3A 5I9EB 2ZJQL 4BACA 3CD6N 1N8RO 1KVCA 3CC4N 1NK8A 2Q31A 3TSQA 4QS8A 2CH6A 5AQZA 4CGDA 1XC9A 2JWLA 1SL0A 1HQUA 3CMAN 3RMCA 5AQNA 3LP2A 3ZT1A 5GINA 3RR7A 1HYZA 4J2EA 3SJHA 4DV6K 3M8PA 1ASUA 4JKEA 2B4JA 3LM9A 2IS3A 4M3RA 4CJ5A 3TTDA 2Z1GA 4DG1A 3SBGA 1CLQA 4DCHA 4CGFA 4JRPA 4IZ9A 3IRXA 2BDPA 3VEWA 3GG4A 3GL1A 4LH5A 3OYKA 5AQLA 3E1YA 3V9SA 1VQNN 1GLAG 4DV2K 2CGJA 1RDWX 1FKOA 1RTJA 2AJQA 4LF7K 4XH5A 4JLHA 1E4GT 1TKTA 4DSFA 1JLQA 4OPJA 1HYVA 3UKRA 4C8OA 4CEBA 2W6KA 4CJQA 3RRHA 4BG8A 3LPTA 3MEDA 1UAXA 4CJWA 4DFPA 4FJ7A 1RDDA 1J54A 2QWPA 2YV0X 3H08A 2P51A 3W0LA 1R0AA 3EEQA 4BY9C 5CY4A 3M3ZA 3U4LA 4YHHK 4H0XB 2BTFA 4KFBA 3WNGA 2Z1HA 5K14A 3T1YK 3MX5A 4CF0A 1RT5A 3OYCA 2OTJN 3FZMA 2DTUA 4IKFA 4I9LA 3VQ5A 1B9DA 1IKVA 3IMXA 4YOUA 4W5NA 4CGHA 2WBNA 1RT2A 1YI2N 1RDCA 4G1QA 4BDPA 5HL7L 4HUGA 2E8AA 3THYB 4QS9A 4BGBA 5LMNK 2RE2A 4CHQA 5AZIB 2FF6A 4GMJB 4PWDA 3O9TA 4CEAA 1NGJA 4A2BA 4DTXA 4IOCL 3G10A 1DEJA 1T03A 4BG9A 4DS5A 2H3GX 3U3YA 3CFRA 2CGLA 4DUZK 4PKHA 4DS4A 5GIPA 3PY8A 4JI5K 2NNWA 4DWIA 1R59O 2HHUA 4TSXA 4CHZA 4M45A 2JLEA 4FWQA 4CEOA 4C8MA 2ASMA 3FLCO 3L2VA 3MXIA 4NO7A 2KFNA 3CHWA 1IG8A 4DB3A 4Z4HA 1GLLO 4CIGA 2WFBA 1S9EA 4AHUA 4M3XA 1U2VB 3Q7CA 4LSNA 3VEVA 3S3MA 3CC2N 3KZBA 2G8UA 3C94A 2XO7A 3SUQA 1Q82O 1JLGA 4DTJA 3L3UA 1M90O 2P1JA 4B1WB 4J2DA 4WFBL 2IGIA 4ELVA 1KFSA 4DF4A 3ZX2A 1TUUA 2OPRA 3LAKA 3DM2A 2O8FB 3CPWM 2YI1A 1RBRA 4BDYA 4PUOA 3B8AX 4WFAL 3NF9A 4ICLA 4IFVA 2BE2A 3A0IX 4K41A 5AQPA 4CE9A 1Q86O 3OW2M 4YY3K 4AM6A 3SUOA 4CEEA 1M1KO 1N33K 2E6LA 1RT1A 3G25A 1GLBG 4CF9A 4H4OA 1RDBA 1X9SA 1D4XA 3EL2A 4GW6A 4YOWA 3ZYYX 1I94K 1S9GA 2W6LA 4NYFA 5GAEP 3SUPA 1KLNA 4IEIA 3EN9A 3D0PA 3M8QA 3QEWA 3VQ8A 4CZHA 4GVMA 4FW2A 1YHQN 1XQSC 4JK7A 4V19S 3F73A 1SUQA 1C0FA 1XHXA 2FXUA 1WAFA 2HB5A 3V6DA 4K42A 1WB9A 3LPUA 2A3ZA 2ITGA 2NLXA 3NGYA 3HOSA 1REVA 4LFAK 1I39A 1RBUA 4NCGA 3T1AA 4C1NI 3THVA 5H1SQ 4KI6A 4YDUC 2KTQA 4EP4A 2PAVA 3P83D 3TR8A 4E7HA 4ISFA 5DK5A 2HHWA 2OPSA 3WQTA 2ZGZA 4W5QA 1SL1A 1ATRA 3VF4A 3NH1A 3RVCA 4WFNL 4OPKA 1V4SA 2Y1IA 4AHVA 5C0YA 4FK2A 3I56N 1WBDA 3ZSQA 3VN5A 2ZQBA 2YHYA 5I42A 3ULDA 4JI3K 4NXNK 3T19A 3R9PA 4CHNA 4DQQA 4WQ4C 4FLUA 4KRFA 4KB0A 1RBTA 4BRNA 3EE9A 5AQMA 1HJRA 1BA1A 3LWLA 4HCBA 3CERA 5C25A 4JS5A 4RWTA 3V1QA 2QWQA 3KWIA 4OGEA 2FF3B 3AA5X 1VSFA 3VA3A 5EY4A 4CHYA 3QBWA 4H8KA 1VQMN 1NGFA 4CGIA 1X9MA 2OANA 3TAGA 3KLFA 4E1MA 5IWAK 4AH9A 2P9NA 1WNSA 4X64K 3AVMA 3C6AA 4FO0A 1TGOA 5M1NA 2P9KB 4BR5A 3B6OA 5C10A 3SZ2A 4LC9B 3ITHA 3L4IA 2UUAK 3LL3A 4FYDA 2KZZA 2E6MA 2UU9K 3EKSA 4CFAA 1YJWN 1TK5A 2NRHA 4DKWA 3NE6A 2QK9A 3QO9A 4I6MA 2W42A 4GV9A 4CFCA 1LV5A 4FJMA 1HLUA 1U48A 3VQAA 3HBTA 2IDOA 1Q9YA 5AQYA 5HBMA 1TYQA 5CYQA 1HX1A 3MDQA 4JKGA 1A5WA 3VEOA 3TAMA 5BREA 1VSHA 3D2EB 4CFBA 3THWB 3T69A 3HSCA 2O8BA 4FJLA 2O8EB 2XY8A 5IT9O 2HF3A 3BGRA 3D6RA 1KRPA 4AQYK 3TSUA 5HRPA 4LFCK 1ZBHA 1YUWA 3SBTA 4DTRA 2P5GA 2OZSA 4GKJK 4XH4A 1KXPA 1EX4A 4H0VB 1GLDG 2QWLA 3NDKA 2XY5A 2QWRA 4CD3A 2IVOA 3OYBA 1EKEA 4DTPA 1BUPA 3AVJA 4CK2A 1S6QA 4AM7A 1QE1A 1IJJA 1W0HA 3PO4A 2RPIA 3CJ7A 5JMVA 1NJZA 1IH7A 5GIOA 5HRSA 1P90A 2VQEK 1D8YA 3KWGA 2O8CA 4LF9K 4OKKA 5LL6Z 4GVEA 3AO3A 4OO1J 3D2FB 3LDPA 4IDKA 1GLJO 4JHDA 3UKUA 2V7ZA 4FVUA 1Q18A 2QWOA 3L2RA 2FBVA 4JD2B 3LWMA 1VSIA 2GWJA 2P9IA 4BQLA 1LWCA 3ZSYA 4ZTJA 3WNHA 3FFIA 3BY5A 4B1VA 4BQZA 4JKFA 4BE0A 4KHYA 2QI2A 3WUHA 2E2QA 3DMJA 1S1TA 3VEXA 1NK4A 3O9SA 4OGCA 3SI6A 2G8VA 4JKCA 4CK1A 3P31A 3V4IA 3QETA 1VQ7N 1ZC6A 5MLCQ 3DXKB 1T3VA 4FWSA 1SKWA 3O80A 5J1EA 2RF2A 5HP1A 3MN6A 5F1XA 3O3HA 3K5MA 2X6NA 4DU3A 4MFBA 3ZEUA 3E9OA 3NH0A 1QHAA 3JXUA 4DU4A 1OKJA 1C0MA 3GOIA 4H0YB 3OTOK 4RW9A 2RHKA 3MECA 1NG9A 2P9SB 2FBXA 3KKRA 2FBYA 1T6CA 3MN5A 2GTDA 3CQXA 3KKSA 4ELTA 1F21A 3BZCA 3C0BA 2VGNA 1U6ZA 1O13A 2D5RA 3Q7BA 2KW4A 1NJIO 1DT9A 3SQ1A 4DSLA 4O4GA 2IVNA 2YNFA 1ILYA 3CCMN 5CYMA 3QB0A 2HHVA 3VQQA 3QNOA 2JWKA 1W2BM 3CFPA 1NJYA 1NGGA 4BR2A 5TKWA 2OPPA 2E20A 3C7NA 1X3MA 4BRDA 2PY5A 3KIOA 2DFEA 4KHQA 3U9ZA 4LF8K 4FWLA 5TKYA 4DV7K 5AQXA 4B9MA 1NMNA 2O4GA 1NK0A 1ASVA 4FWRA 1OH5A 4DTSA 2HBLA 4ILHA 3E9PA 2E5LK 3HK2A 3KTQA 4NLBA 3DLHA 2YKMA 4A5BA 3TPQA 1TKXA 3CM6A 3JYTA 2DFFA 3TAFA 1U49A 1BCOA 1RTHA 4CJEA 1IG9A 1X9WA 4A5AA 1TKDA 4GKKK 4C1NK 3QEVA 1RT3A 3AVHA 4M41A 3CCUN 1EWQA 3THXB 1YJ9N 3TABA 4YOYA 3QFUA 3J80O 5FDLA 1LAVA 4YDUA 3WXIA 1N34K 1LCUA 3OY9A 4LD0A 3U6FA 3C95A 1NGAA 4IBNA 3DOLA 4IFYA 5KI6A 2NRVA 2ITMA 2WC9A 5AZJA 3IFRA 1DGKN 4GY2B 3VTHA 4E1NA 4JNEA 1UA1A 3NHGA 3QEIA 4BR4A 3SK3A 4DU1A 1VQLN 2XY6A 3HZ6A 3VETA 1VRTA 1ZYQA 4RG8A 2YJFA 4WQ4A 1NLVA 1ZBSA 1NGBA 3TAEA 1ZXOA 1B92A 1ZBLA 3VGLA 1A5XA 3ID8A 4W5OA 3LZIA 5AQVA 3CCSN 4KKOA 3MMVA 3NMUA 1CZAN 1LW2A 2QWMA 3ASMA 1RGIA 2UXCK 3OYHA 3G4SN 3IAYA 3GE1A 3HSTB 1VQ8N 1BOTO 3NBPA 5BRDA 4U7BA 1QQOA 1TVRA 4DFMA 3H45C 2UXDK 4F3TA 4H4MA 2KKZA 3QBXA 1ZBFA 3CFOA 1QZ6A 1OH7A 1HKBA 5CZ2A 4BRLA 3VQ9A 3P39A 1K8AO 4BC2A 4G9ZA 2P9UB 3L8BA 4Z4CA 1TK0A 3DLRA 3P38A 3EKUA 3CCLN 3SAHA 1C1CA 3BEXA 3DAWA 1TKZA 1VSJA 2YHAA 1HQEA 4RW4A 4NYNA 4CEZA 4O0IA 4CJVA 3S9HA 2KFZA 4BREA 4BVOA 1TK8A 1YXQA 3M6GA 3EO3A 4J2BA 3BDPA 3K5NA 5KRTA 3DXMA 4FXDA 2X6SA 2YHBA 5HRRA 1QS4A 2DY4A 3C6UA 3QESA 2YCHA 4CECA 2E2OA 3M8RA 2HHHK 1TAUA 1JLEA 4JRQA 4XEIA 3SV4A 3L2UA 2IIRA 1EO1A 2IOCA 1RT6A 2UUCK 4Q0BA 3K9JA 2VYPA 4WQ5C 1N6QA 2ZF5O 5CE3A 2Q97A 1VK0A 3VOVA 2ETJA 4HTUA 3VEZA 4OPHA 3CJBA 4JKAA 4CF1A 3PIOL 5FRMA 1CZBA 4CJTA 2XY7A 3ZLJA 5KPZA 4IJNA 2I7NA 3OYNA 5J2NA 4KTWA 1J5EK 3RMBA 3WT0A 4DR4K 5FPMA 3HTVA 1BQMA 4M3TA 4IEEA 3G6EN 2P9NB 2F9WA 4K8XA 4CIFA 2GX9A 5KQDA 2G8FA 4Z94A 5BRHA 4ZTFA 3KLEA 5DM7L 2WONA 3O4QA 5KGWA 4CHPA 4E3SA 2ASOA 4XIUA 1JL1A 1HNIA 4FWNA 4LSLA 3BZKA 4YFUA 5KPRA 4DSKA 1JKHA 1WSFA 3K5OA 1W7AA 1WBBA 4QAGA 4I6MB 5EU7A 4HVJA 5BRFA 5CZ1A 4FJHA 1K73O 3HPOA 1NGDA 4B3SK 5EVZA 5M1FA 4DQSA 1LWFA 4IG3A 4BE2A 1RTIA 5M1PA 2PFUA 4PL7A 3QIPA 5I3UA 1TYQB 4JKGB 2F96A 4LFBK 2YHXA 5JLFA 1S1VA 1NJXA 3OVNA 1KVBA 1NGEA 3CM5A 5AR0A 1NGCA 4MDAA 4CZIA 2O8BB 3TSPA 3CIPA 4CF8A 4EZ9A 1J5OA 1KC8O 4FLTA 2VG7A 2XHBA 3A5OC 1NK6A 4MLHA 3ULEB 3O4NA 4YOVA 4BROA 4CJRA 3SMSA 2NRXA 3J8AA 1ATSA 4F3OA 4QOZB 1ZBUA 2EWSA 4B1YB 3V9XA 4BDZA 1ESVA 2YKNA 4KH4A 3WEEA 3VTIA 1QQCA 2QEXN 4A57A 3OA9A 1IKWA 5J2QA 2KQ2A 4E19A 2VWJA 1C0TA 4H5VA 2P9LA 3WXMB 4AHTA 3MN9A 4FOIA 1XHZA 2A40A 3MAQA 3CQYA 3CETA 1T05A 2UUBK 3UKUB 3AA3A 3ZT2A 1VQ6N 3CQ8A 3OYFA 2ZWHA 4CW7B 2HNZA 1LWEA 4IG0A 3L4QA 4YOXA 1S1UA 3TAQA 3HPGA 1GLEG 4FOEA 4JI2K 2PYJA 3E01A 2QW9A 1EETA 2A6AA 1KQSM 3AVFA 3SAGA 2F7TA 1Z05A 2G8IA 4IFEA 5JVGL 1L5UA 2VG5A 1Z6RA 4BR9A 3RTVA 3MXJA 3LZJA 4CK3A 2GWKA 5C2FA 4CEQA 2HHSA 3LDOA 4C23A 4AF1A 2BUPA 3JSMA 2ATQA 4CZEA 1UWBA 2PBDA 2HMPA 2CH5A 4BRMA 4DR5K 3MWPA 3WNFA 3SNNA 3FZHA 2O8DB 5AQJA 2V51B 4JK9A 4QCLA 1BU6O 5E26A 3OYAA 3AVKA 5B8HA 4OX9K 1HJOA 1DTTA 2QTDA 1G15A 2P9PB 1MA9B 2ZJPL 4FJ5A 3OYJA 1WOQA 2Q2RA 3F9MA 4BRFA 2AP1A 4NCAA 1ZBIA 3HYFA 3CCEN 5M1KA 4B8CA 4B3RK 5AQRA 4M3WA 3KK1A 3UE5A 4JYAK 3DLBA 4O0JA 2A1SA 2X74A 3KK2A 3SPZA 4NXMK 1RILA 1J6ZA 2RKIA 2E1ZA 4FWKA 3THYA 3C7NB 3GBTA 5AZIA 1BO5O 3EYZA 4B9UA 4FZYA 5EXWA 3J7AP 1KVAA 1RCHA 4FLYA 4E7IA 2YNGA 2D4WA 4C8LA 2BGGA 3VQDA 4FJJA 4H5RA 1XNQK 2KZMA 2E1YA 4CJ7A 2BANA 1NGIA 3CCRN 5BPLA 4Z0UA 5BPNA 5AQSA 1XUPO 3A5NC 3HM8A 4DF8A 3I55N 4O44A 2D0OA 3SV3A 1HPZA 4JS4A 3PSIA 5C42A 4Z4IA 3H6EA 1HRHA 3VQ7A 3V1RA 4HHTA 4FPAA 2Q0UA 2Q0RA 2GEMA 1VSKA 2A42A 2FSKA 2VWBA 4MO5A 3J81O 3FR0A 3QINA 2E2PA 4B3MK 4UQGA 4IOXA 3AVNA 2PYLA 3AGRA 5GADP 4EHTA 3R6MA 3CJCA 1B9FA 1X1PA 1MWKA 1ASWA 4GV3A 2G8KA 1QHTA 4H5WA 1WSEA 4O5FA 1SKSA 3SUNA 4WCEL 4WQ5A 1JLBA 1OH8A 3G0ZA 4CCHA 3ATUA 3ZT3A 5AQKA 1HMVA 4CGJA 3I33A 4E7LA 2ZD1A 4BRQA 1MWMA 2HF4A 3ZETB 3LM2A 3NH2A 4E89A 3KK3A 4O5BA 3BP8A 2UYTA 1Q8IA 3SLCA 3MWTA 4Y1DA 4JEPA 4X66K 4B9VA 5AQOA 2QXFA 4CEDA 3ZSRA 4L8RB 3TTCA 1TAQA 3QFPA 3OHRA 3O8MA 1WSHA 3MCAB 4BRCA 1FK9A 4O55A 4DV0K 3AA4A 5JLHA 1BIUA 2B5JA 2ZGYA 4K0KK 1N32K 4FJGA 3RMDA 3CCJN 1KSPA 5DM6L 1CXQA 4B1ZA 1GOBA 3ID6A 3QDKA 3T3FA 3KD1E 2HVHA 1S22A 4RW7A 3NF6A 3O6WA 4FPBA 4BRPA 4B08A 1WN7A 5M1OA 3PSFA 1QQMA 1HKCA 3OYGA 3NVMA 4NCBA 4I9QA 3FGUA 2LSNA 3RRGA 4I7FA 1HNZK 1CZ9A 4DQIA 2E88A 3HJFA 3L6QA 4J8FA 4DR1K 3NCIA 4XH1A 4GV6A 4O8UA 4DV3K 4IJAA 1TUYA 5F2RA 2ASPA 4R5PA 3UKRB 3TTFA 3M5RA 3QNNA 4ID1A 4FWPA 3A8YA 4A2AA 2NUBA 3PO5A 1QQNA 3LDNA 5E84A 4U67L 5AQTA 4KHNA 4KI4A 4FLWA 1TV6A 2IC3A 4LY7A 3SAFA 3N4PA 4ISEA 4CZMA 3QIOA 4B9TA 4E7JA 4IXCA 4X65K 2J4RA 2NRZA 3TAPA 3RWUA 1NKCA 1KLMA 3AO4A 3CI5A 3ZX3A 4HUEA 1QVGM 1BG3A 3H1QA 1HUXA 4MQ3A 1TL3A 3PX4A 3CG7A 4I2PA 4CERA 1FW6A 1J53A 2GBZA 1IO2A 1Q7YO 1Z26A 1NMDA 4JAXA 4CZKA 3KLIA 4YORA 4FJXA 3P1GA 1WSJA 3OJSA 2HSTA 4KH5A 4WYBA 5KGXA 4E0DA 4OPAA 3NGIA 4B3TK 4FSVA 4KV8A 4JN4A 1XNRK 4JI6K 1XI1A 2G8WA 3VQPA 4DUYK 2E2NA 1GLCG 3CCVN 3VMFB 2WUSA 4I2QA 1RNHA 4HTLA 3VGMA 4FM0A 4Z4FA 1S72N 3LP0A 2GV9A 1S6PA 2VQFK 3HL8A 2FBTA 3WXLA 3O9RA 2QWNA 4M42A 4OLAA 4KBOA 1Y97A 1VSMA 4DR6K 4Y1CA 2HVIA 1HKGA 3S3NA 2YHWA 3MK6A 3ZSVA 4BGAA 1ITGA 1C1AA 4RW8A 3QERA 1IBLK 4DFKA 1BWFO 3NF7A 4F8RA 3EZWA 2G8HA 1T8EA 4WE1A 2NRRA 3U9DA 3VQEA 3CJ9A 1NOYA 3I8BA 4EZ6A 1Q9XA 4B3OA 3D2EA 4BRIA 3OYLA 5EX5A 3T7ZA 2HMIA 3M8SA 4KB1A 4M7XA 4CJPA 5A2QO 4N41A 1FJGK 2O8EA 4DTNA 3LALA 3L2QA 4E1JA 3FZFA 3VGKA 4FM1A 3J7YP 1O1WA 2JGUA 3OYIA 5CR4A 3CJ1A 4W5TA 4CJUA 3JS6A 3WXKA 3EY1A 1LAWA 4K43A 1VQON 1U04A 4KHUA 3O9QA 4RCHA 1T6DA 1E4FT 5BR8K 1U4BA 3DRSA 4A59A 3PX0A 3ENHA 1YTAA 4CJKA 1SZ2A 5E41A 4CZGA 4FLXA 3OYEA 3HPHA 3O9UA 4Q5VA 4M63C 3KLHA 2D0PA 3VQCA 5JVHL 1VQ4N 4FCYA 1I3AA 1BI4A 4C8KA 3VQ4A 5AQFA 2P5OA 4BC3A 3WEEB 4CJ4A 4HCCA 1Z25A 1D5AA 3L0QA 4EP5A 3D2FA 5AQHA 4JI4K 5M1QA 2VG6A 5FROA 1WSGA 1K8KA 2HBJA 4M3ZA 4JD2A 3WQUA 5EOYA 2P9LB 3IUCA 1K6YA 1YTUA 5AFUH 3A2FA 4FWOA 3G71N 5SZTA 4FL9A 2W40A 1YIJN 4DFJA 3LP3A 4PKIA 3U8XA 2O4IA 3SQ2A 3MCPA 2NRTA 1U45A 4KREA 2V52B 3O4WA 2DFHA 5FPEA 4BRKA 2IVPA 3DXKA 3PUFA 4DMNA 4BRGA 3L2WA 4IDHA 1QSSA 1BCMA 3P5JA 3VENA 4FZXC 1RT7A 1SS6A 3HT3A 1EQYA 3QEXA 2I5JA 2HHQA 4OJRA 4KH6A 1K9MO 4X62K 2RN2A 4CBXA 4FJKA 1WUAA 1NKBA 3KHYA 3NF8A 2P9SA 2WTUA 1EWRA 3LP1A 3K58A 4A61A 1VSEA 1VSDA 3VQBA 3ATVA 4B9LA 1KAXA 1FKPA 1VQKN 4WF9L 3H1VX 2HW3A 4DV1K 3IDHA 3P4IA 4FK0A 4LH4A 4OKJA 5HROA 3GDQA 4N76A 1L3VA 4EAHD 3NAEA 1L3UA 5KPTA 4N47A 2X78A 3DRPA 3DYAA 4JKDA 2D1KA 3IG1A 3TU5A 1VQPN 3RSEA 3AV9A 3VQ6A 3ZX0A 3SQ0A 3DWLA 4OVLA 3VEYA 1BGXT 3AO2A 4Z4GA 1X9JA 4N5SA 3OS0A 1BQNA 4BWJA 1CXUA 4CZLA 5ELZA 4OLBA 3V81A 2F4VK 2D0CA 5J2PA 3J7ZO 2A1RA 1GOAA 3ENBA 3K2PA 2XRIA 3ZT0A 4CF2A 4MO4A 1Y64A 4GNIA 1YJNN 3BUZB 4FVMA 4IO9L 2WOMA 4AHRA 3A5MC 1L3TA 1BA0A 3AARA 1IBKK 3THXA 4R79A 4BRAA 1VQ9N 4FZZA 4KTQA 1LOTB 2YJEA 4ID5A 1QVFM 3MN7A 3QLHA 4H5NA 4CZJA 4DR7K 4YNQA 3HVTA 4BVPA 4FLZA 2V7YA 4FJ8A 3AVIA 3OS2A 5HOOA 3N4QA 3RR8A 4FW1A 3CCQN 3HP9A 3I0RA 3AVLA 1D9DA 3ISNC 4DQRA 4EFHA 3SJJA 1DTQA 1RTDA 2Q36A 2ZM6K 2OPQA 1NK5A 2DPNA 4ZHRA 3WXJA 3V9UA 4H0OA 2R7YA 3UIQA 3DLGA 2OZMA 1XWLA 2D0BA 5HLFA 2QKKA 3KVGA 5GAGP 3SYZA 1NM1A 2Z1IA 4J2AA 2QKBA 1J9AA 3E9LA 1YVNA 1NOZA 3AO5A 2YX6A 5BR9A 3NFAA 2F8TA 4KPYA 2W41A 1NGHA 1JXBA 5JS2A 2VCPA 1YF5L 3OYDA 3SMPA 3DI6A 2IAJA 4DSJA 5DMRA 1KD1O 3EE8A 3ZSXA 4EHUA 3PLAA 4KTZA 2O8CB 1RDAA 3AVGA 1N36K 3OYMA 1GLFO 4JHDB 3M1FA 1OVYA 3UB5A 1Q81O 3DLLL 4UY8O 2GUIA 5AJ3K 3FZLA 1C6VA 2P9IB 5BPMA 4N56A 3CPEA 1WAJA 1BIZA 1IKYA 3DOKA 3O1BA 4H5TA 2BH1A 4F9OA 1JL2A 2P9UA 1SL2A 2YNIA 3PV8A 1E3MA 3HO1A 3HVRA 2HHTA 2B6AA 3T1HK 4PL8A 3KLGA 1SQKA 1EXQA 1ATNA 4AHCA 3O3GA 3S3OA 2GUPA 3AA2A 4KHSA 3H46O 3SQ4A 3ZSOA 3BF3A 4NLCA 3K5LA 4HUFA 2CGKA 1HNWK 3ZEUB 4IWVA 1GOCA 4HWIA 4M3UA 5AFUA 4AILC 2Z1JA 3B6PA 3TI0A 1EP4A 3H3OB 4H0TB 4MLEA 5AQUA 2OYQA 1NK9A 3FE1A 2QXLA 1IBMK 1MDUB 5JS1A 4ILGB 3WNEA 5ADXH 2HHXA 1SAZA 1NKEA 3H3NO 3AVCA 3ZSWA 1UA0A 4KAZA 1S3XA 5C12A 4O8KA 1P8ZA 3AO1A 1S1XA 1H1VA 3R8EA 4DTUA 1C1BA 1RT4A 2HNYA 1KTQA 2KLAA 2PZSA 3VF6A 1SKRA 3DLEA 4DTMA 1DKGD 4CGGA 3IKMA 5KRSA 3QICA 1KFDA 2NZTA 4AHSA 3D45A 2D0AA 3SPYA 3DRRA 3VESA 3E66A 3KK7A 1NJWA 3MEGA 2UXBK 1RBSA 4BR0A 3O1WA 1LW0A 3BF1A 3S41A 3CXCM 4PKGA 3VF2A 4E7KA 4BC5A 1YITN 4DSEA 4JI1K 1KAYA 3ALYA 4OKEA 2E4LA 4M3YA 1T7PA 3TARA 1FXXA 4KHPK 4YOTA 2HOEA 4ILJA 1DLOA 5JICA 1C0GA 2FC0A 5C2DA 4BE1A 4NB4A 4DHYA 5J2MA 2F8SA 3C65A 4ISGA 4FJNA 1QTMA 1BL3A 1JXEA 3DJCA 5SWMA 3HRGA 2QA4N 5F0XA 4CESA 1XMOK 3RMAA 3K57A 2Q3SA 4DSIA 2KHOA 1U2VA 5AZJB 4PHTX 3C6HA 4JI8K 4CJ3A 4JI0K 3U3GA 4CBWA 1NWKA 5HRNA 3KJVA 3V9WA 4ELUA
chains in the Genus database with same CATH topology
3D7EO 2YCHA 4IEIA 2HBMA 3VMFB 3CCVN 2E2OA 3EN9A 2WUSA 1W97L 3AY9A 4HTLA 3VGMA 1JCGA 4BR7A 4IO8A 1S72N 4CZHA 4XEIA 1XQSC 4JK7A 1YHQN 3O5BA 1T44A 2AA4A 2IIRA 3WXLA 3O9RA 2QWNA 1EO1A 1C0FA 4KBOA 2FXUA 4CD1A 3ULEA 3FZKA 1HKGA 4K42A 3K9JA 2VYPA 4WQ5C 2YHWA 2ZF5O 5CE3A 3MK6A 2A3ZA 2Q97A 4BGAA 5LY3A 3VOVA 2NLXA 2NRWA 3HOSA 2FSJA 5AQWA 1BWFO 3VEZA 4OPHA 3MX2A 3A5LC 3CJBA 3EZWA 3FFKB 2A5XA 4JKAA 4JKBA 3PIOL 4M7YA 2NRRA 3U9DA 5KPZA 3LDLA 4IJNA 2I7NA 3CJ9A 4CI6A 4C1NI 3I8BA 3K9KA 5H1SQ 4CZFA 3R3LA 4YDUC 3D2EA 4BRIA 2PAVA 4FWMA 5EX5A 3T7ZA 4ISFA 4M7XA 3LDQA 2VGMA 3WQTA 3WT0A 2ZGZA 3CC7N 4E1JA 5FPMA 3FZFA 1ATRA 3VF4A 3HTVA 3RVCA 3VGKA 4WFNL 1K8KB 3F2KA 3NVKA 1V4SA 4IEEA 4JK8A 5CR4A 3G6EN 2P9NB 3CJ1A 5C0YA 1BDGA 2F9WA 3JS6A 2GX9A 3WXKA 5KQDA 4Z94A 5BRHA 4K43A 3I56N 1RFQA 1VQON 4BC4A 2YHYA 3O9QA 4RCHA 1T6DA 1E4FT 5DM7L 2ASOA 4A59A 3R9PA 3ENHA 4WQ4C 4FWNA 1X3NA 1SZ2A 4CZGA 5KPRA 4BRNA 3O9UA 4M63C 3EE9A 5BN9A 5AQMA 2D0PA 1BA1A 5GAHP 1V4TA 4I6MB 3CERA 5AQGA 5JVHL 1VQ4N 5BRFA 1YAGA 4RWTA 3QMLA 4QS7A 1K73O 1NGDA 5AQFA 2QWQA 3KWIA 5EVZA 5M1FA 2FF3B 1KAZA 4BC3A 3WEEB 5M1PA 5EY4A 2PFUA 5AQQA 3DXMB 3L0QA 3D2FA 4PL7A 3QBWA 5AQHA 1VQMN 1NGFA 3AGKA 5M1QA 1TYQB 2OANA 4JKGB 1K8KA 4RTFD 1VAZA 2HBJA 2YHXA 4JD2A 3WQUA 4B1XB 5JLFA 5EOYA 2P9NA 2P9LB 3IUCA 3C6AA 4FO0A 1NGEA 5AR0A 5M1NA 1NGCA 2P9KB 4BR5A 4MDAA 5AFUH 4CZIA 5C10A 4FWOA 4LC9B 3TSPA 3CIPA 3G71N 3L4IA 3LL3A 5KQ8A 4FL9A 2W40A 3EKSA 1YIJN 1VQ5N 1KC8O 1YJWN 4PKIA 2P9PA 5FPNA 2NRHA 3U8XA 4DKWA 3A5OC 3CJAA 3MCPA 4MLHA 2OTLN 3ULEB 2NRTA 4YOVA 2V52B 4BROA 3O4WA 3HI0A 5FPEA 4BRKA 4B1UB 2IVPA 4I6MA 3SMSA 2NRXA 4GV9A 3DXKA 3J8AA 1ATSA 4Y0WA 4BRGA 4B1YB 2EWSA 4JKHA 1ESVA 3AAPA 4KH4A 3WEEA 1HLUA 4IDHA 3VTIA 2QEXN 3VENA 1SS6A 4A62A 4A57A 3HBTA 1EQYA 5AQYA 3OA9A 1TYQA 4EIAA 1HX1A 2I7PA 3MDQA 4JKGA 2Q1NA 3W3DA 3VEOA 4L3QA 3VERA 4H5VA 4KH6A 5BREA 2P9LA 3D2EB 3WXMB 1K9MO 3MN9A 3RSEB 4FOIA 4CBXA 2P9KA 3T69A 5LJWA 1WUAA 2A40A 3HSCA 5ADXA 3CQYA 3CETA 2A41A 3KHYA 3UKUB 2P9SA 2HF3A 4A61A 3D6RA 3TSUA 1VQ6N 3ATVA 4DQ8A 1KAXA 1YUWA 3SBTA 1VQKN 2ZWHA 4XH4A 4H03B 4WF9L 3L4QA 3H1VX 1KXPA 5CHIA 4YOXA 2QWLA 1GLDG 4H0VB 3ENOA 1GLEG 2QWRA 4CBUA 2IVOA 4FOEA 4CD3A 1RDUA 3IDHA 1G99A 2QW9A 2A6AA 4B9QA 2FSNA 3P4IA 1BUPA 3GDQA 4AM7A 1NBWA 4EAHD 1KQSM 1IJJA 5FPDA 3SAGA 2F7TA 3R1XA 1Z05A 4IFEA 3CJ7A 5JMVA 1QZ5A 5KPTA 5JVGL 1HPMA 1JCFA 2F9TA 1Z6RA 3OBWA 4BR9A 4JKDA 1JJ2M 5GIOA 1P90A 2D1KA 2GELA 3VPZA 3TU5A 1VQPN 4MDBA 3KWGA 3RSEA 3ZX0A 3CMEN 4GVEA 4H0PA 2GWKA 3OBYA 3DWLA 5BN8A 5C2FA 3HOTA 3VEYA 3D2FB 3LDPA 4OO1J 1GLJO 2ZJRL 4JHDA 1X9JA 3LDOA 3UKUA 2V7ZA 4C23A 4FVUA 1Q18A 4AF1A 4BRHA 3F5TA 5LJVA 4IOAL 2BUPA 4CZEA 2QWOA 2PBDA 2HMPA 2CH5A 4JD2B 4CZLA 4BRMA 5ELZA 3MWPA 2GWJA 2P9IA 2HBKA 5AQIA 4BQLA 3FZHA 5C15A 5AQJA 3J7ZO 3AAQA 3O08A 2V51B 4JK9A 1BU6O 4B1VA 4BQZA 4JKFA 3ENBA 5E26A 2QI2A 3WUHA 2E2QA 5B8HA 3PIPL 1HJOA 1Y64A 4MO4A 3VEXA 2QTDA 3O9SA 2P9PB 1MA9B 4GNIA 2ZJPL 3CF5L 2QM1A 2FLOA 1JCEA 1WOQA 3BUZB 4JKCA 2Q2RA 4IO9L 1YJNN 3A5MC 4K25A 3F9MA 1BA0A 3AARA 2AP1A 3ZETA 4BRFA 1XC3A 3P31A 5I9EB 3CCEN 2ZJQL 1ZC6A 4R79A 3CD6N 5M1KA 4BRAA 5AQRA 3DXKB 1T3VA 4FWSA 5MLCQ 3CC4N 1N8RO 2Q31A 3UE5A 1VQ9N 3O80A 1LOTB 4QS8A 2CH6A 3TSQA 5AQZA 2YJEA 2JWLA 1QVFM 3MN6A 3MN7A 5F1XA 1J6ZA 4H5NA 4CZJA 3CMAN 2E1ZA 4FWKA 5AQNA 3ZEUA 4BVPA 3C7NB 3E9OA 2V7YA 3GBTA 5GINA 5AZIA 1BO5O 1QHAA 3JXUA 1OKJA 5HOOA 3GOIA 3SJHA 3N4QA 5EXWA 4H0YB 3CCQN 4JKEA 4EFHA 2RHKA 2D4WA 3LM9A 4H5RA 2Q36A 2P9SB 3TTDA 2E1YA 3SBGA 1T6CA 3MN5A 2GTDA 3CQXA 4CJ7A 2DPNA 3C0BA 2VGNA 3WXJA 1U6ZA 1O13A 4H0OA 4DCHA 1NGIA 3Q7BA 3CCRN 5BPLA 4IZ9A 5BPNA 5AQSA 1XUPO 3A5NC 3VEWA 3GG4A 3HM8A 1NJIO 3KVGA 3GL1A 5GAGP 3I55N 1DT9A 2D0OA 1NM1A 2IVNA 1ILYA 5AQLA 3E1YA 1VQNN 1GLAG 1YVNA 3E9LA 3H6EA 3QB0A 3CCMN 2JWKA 2CGJA 2YX6A 1W2BM 1RDWX 5BR9A 1NGGA 4BR2A 4FPAA 5TKWA 2W41A 4XH5A 2Q0UA 2Q0RA 1NGHA 2GEMA 2VCPA 2E20A 3C7NA 1YF5L 1X3MA 2A42A 3SMPA 4BRDA 2FSKA 1E4GT 2VWBA 3U9ZA 4MO5A 1KD1O 3FR0A 3EE8A 4FWLA 4EHUA 3PLAA 2E2PA 3UKRA 4IOXA 5TKYA 5AQXA 3AGRA 1GLFO 4JHDB 5GADP 3M1FA 1OVYA 4FWRA 3UB5A 4BG8A 4EHTA 3R6MA 1Q81O 2HBLA 4ILHA 3CJCA 3E9PA 3DLLL 4UY8O 3FZLA 5BPMA 2P9IB 3CPEA 1MWKA 4NLBA 4GV3A 4A5BA 2QWPA 3TPQA 4H5WA 4O5FA 3O1BA 4H5TA 3W0LA 4WCEL 2BH1A 4WQ5A 4BY9C 4F9OA 3M3ZA 3U4LA 2P9UA 3ATUA 4A5AA 4H0XB 2BTFA 5AQKA 3I33A 4C1NK 4BRQA 1MWMA 4PL8A 2HF4A 3MX5A 3ZETB 3LM2A 3CCUN 1SQKA 2OTJN 1ATNA 3FZMA 1YJ9N 3BP8A 4YOYA 3QFUA 3IMXA 2UYTA 4YOUA 3SLCA 3MWTA 4YDUA 3WXIA 2WBNA 2GUPA 1LCUA 4JEPA 1YI2N 3H46O 5AQOA 1NGAA 5HL7L 3BF3A 3TTCA 4NLCA 2E8AA 3QFPA 3OHRA 2CGKA 4QS9A 3ZEUB 4BGBA 3O8MA 2NRVA 2ITMA 2RE2A 2WC9A 4IWVA 3MCAB 4BRCA 4HWIA 5AZJA 5AZIB 2FF6A 3IFRA 1DGKN 5JLHA 3O9TA 4GY2B 3VTHA 1NGJA 5AFUA 2ZGYA 4A2BA 4JNEA 4IOCL 4BR4A 3SK3A 1DEJA 3CCJN 4BG9A 1VQLN 2H3GX 5DM6L 3H3OB 4H0TB 4MLEA 5AQUA 4B1ZA 3HZ6A 3ID6A 3QDKA 3VETA 3FE1A 1S22A 2QXLA 1MDUB 3O6WA 2CGLA 4FPBA 2YJFA 4WQ4A 4ILGB 4BRPA 4PKHA 5M1OA 1NLVA 5ADXH 1QQMA 1HKCA 1NGBA 1SAZA 1ZBSA 5GIPA 1ZXOA 3NVMA 2NNWA 3VGLA 3FGUA 1R59O 3H3NO 3ID8A 1S3XA 5C12A 4O8KA 1P8ZA 5AQVA 3CCSN 1H1VA 3MMVA 2E88A 3R8EA 3NMUA 1CZAN 4FWQA 2KLAA 2QWMA 3L6QA 4J8FA 1RGIA 3VF6A 3G4SN 2ASMA 4XH1A 3FLCO 3GE1A 1VQ8N 4GV6A 4O8UA 1BOTO 4NO7A 3CHWA 1DKGD 1TUYA 1IG8A 4IJAA 3IKMA 4DB3A 5F2RA 2ASPA 5BRDA 3QICA 3UKRB 4U7BA 1QQOA 1GLLO 3TTFA 2NZTA 2WFBA 3M5RA 3H45C 2KKZA 4FWPA 3A8YA 4A2AA 3VESA 3E66A 3KK7A 3QBXA 1QQNA 3LDNA 1U2VB 5E84A 3Q7CA 1QZ6A 3CC2N 3VEVA 4U67L 5AQTA 4BR0A 3O1WA 3BF1A 1HKBA 3KZBA 3S41A 3CXCM 4PKGA 3VF2A 4BRLA 1Q82O 1M90O 3SAFA 3N4PA 4ISEA 4BC5A 3P39A 1YITN 4CZMA 1K8AO 4B1WB 4WFBL 1KAYA 4BC2A 4G9ZA 2P9UB 4IXCA 2J4RA 2NRZA 4YOTA 2HOEA 4ILJA 3P38A 3EKUA 3ZX2A 3CCLN 3SAHA 1TUUA 3BEXA 3CI5A 3DAWA 3ZX3A 5JICA 1C0GA 3CPWM 2YI1A 5C2DA 4NB4A 1QVGM 1BG3A 3H1QA 1HUXA 4DHYA 3B8AX 4WFAL 3C65A 4ISGA 1Q7YO 4CZKA 1NMDA 4JAXA 3A0IX 4K41A 5AQPA 1Q86O 3DJCA 4YORA 3OW2M 3HRGA 4BREA 4BVOA 2QA4N 5F0XA 2HSTA 4AM6A 1M1KO 1YXQA 3M6GA 3EO3A 4KH5A 4WYBA 3G25A 1GLBG 2KHOA 1U2VA 4OPAA 5AZJB 4FSVA 3DXMA 4JN4A 4PHTX 3C6HA 1D4XA 3EL2A 4CBWA 2E2NA 1NWKA 4YOWA 3ZYYX 1GLCG 5GAEP 1VQ7N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q7B A;  4GVE A;  3R3L A;  4GV3 A;  4GV6 A;  3MX5 A;  3MX2 A;  3MWP A;  3MWT A;  3Q7C A;  4FVU A;  4G9Z A;  4GV9 A; 
#chains in the Genus database with same CATH topology
 1BHL A;  3D7E O;  2HBM A;  3HP6 A;  1W97 L;  3AY9 A;  3K59 A;  1JCG A;  4BR7 A;  1D9F A;  4IO8 A;  4KHW A;  1UOC A;  4LF6 K;  3QEP A;  3O5B A;  1T44 A;  2AA4 A;  2O8F A;  4DR2 K;  4DQP A;  4CD1 A;  3ULE A;  3FZK A;  3OS1 A;  4F2R A;  5LY3 A;  1U47 A;  4RW6 A;  2NRW A;  4DV5 K;  2FSJ A;  5AQW A;  3MX2 A;  3A5L C;  3FFK B;  4JKB A;  2A5X A;  1QSL A;  4M7Y A;  3LDL A;  3ZSZ A;  4CI6 A;  1TL1 A;  3K9K A;  5LMU K;  4CZF A;  1BI4 B;  3R3L A;  4B8A B;  4FWM A;  3KD5 E;  3MXM A;  3LDQ A;  2VGM A;  1JLF A;  4C8N A;  3CC7 N;  4CJS A;  3PX6 A;  1K8K B;  3F2K A;  3NVK A;  5D3G A;  4JK8 A;  1BDG A;  4F2S A;  4DTO A;  1RFQ A;  4BC4 A;  1KCF A;  3VA0 A;  3LAN A;  3V1O A;  2OA8 A;  4LF4 K;  4CVN E;  1L3S A;  1X3N A;  3I0S A;  1QSY A;  4PA1 A;  2OCE A;  4CJF A;  5BN9 A;  5GAH P;  1V4T A;  5AQG A;  4CHO A;  1YAG A;  1SV5 A;  3QML A;  4QS7 A;  1KAZ A;  4DV4 K;  5AQQ A;  3DXM B;  3L3V A;  1C0U A;  3AGK A;  1HNX K;  4RTF D;  1VAZ A;  4B1X B;  4CEF A;  1VSL A;  2O8D A;  1WSI A;  5KQ8 A;  1IKX A;  3HXM A;  1XMQ K;  4Z4E A;  3K0S A;  1VQ5 N;  3I8D A;  2P9P A;  1W9H A;  5FPN A;  3JAM O;  3F9K A;  1VHX A;  3CJA A;  4JI7 K;  2OTL N;  4W5R A;  1RBV A;  1S5J A;  3HI0 A;  4B1U B;  4B9S A;  3HM9 A;  4Y0W A;  4FLV A;  3DLK A;  4JKH A;  1A5V A;  3AVB A;  3AAP A;  1OVQ A;  3MEE A;  5C24 A;  3AVA A;  4A62 A;  3TAN A;  3NGZ A;  4EIA A;  2I7P A;  3W3D A;  1HYS A;  2Q1N A;  4L3Q A;  1HNV A;  4KO0 A;  2YNH A;  3VER A;  2Y1J A;  3EZ5 A;  2VWK A;  3RSE B;  2P9K A;  3TWH A;  5LJW A;  5ADX A;  3O3F A;  1YVU A;  1WLJ A;  2A41 A;  1BIS A;  3ZCM A;  1IV0 A;  3C6T A;  4BWM A;  4PY5 A;  4DQ8 A;  3IS9 A;  4FJ9 A;  4H03 B;  3SCX A;  5CHI A;  4B9N A;  1JLA A;  4JV5 K;  3ENO A;  4CBU A;  4CFD A;  1RDU A;  1G99 A;  4B9Q A;  2FSN A;  1S1W A;  4CJL A;  1NBW A;  5FPD A;  5FLX O;  1VRU A;  3R1X A;  4F4K A;  1QZ5 A;  3LDS A;  1HR0 K;  1HPM A;  4K8Z A;  4LF5 K;  1JCF A;  2F9T A;  3OBW A;  1NU0 A;  4DLE A;  4FJI A;  1JJ2 M;  3VPZ A;  2GEL A;  1MU2 A;  4MDB A;  3THW A;  3CME N;  4H0P A;  3OBY A;  3HOT A;  5BN8 A;  5KTQ A;  2ZJR L;  3CYM A;  2ZE2 A;  2EHG A;  4IOA L;  4BRH A;  3F5T A;  5LJV A;  3LAM A;  1JLC A;  4FM2 A;  4PQU A;  5AQI A;  2HBK A;  5C15 A;  3V9Z A;  1YT3 A;  1NK7 A;  4DR3 K;  3AAQ A;  3O08 A;  5T7B A;  2HND A;  4DLG A;  3PIP L;  2EX3 A;  3OJU A;  4CIE A;  3ZT4 A;  3CF5 L;  4FK4 A;  1NNE A;  2QM1 A;  2FLO A;  1JCE A;  1N5Y A;  3ZET A;  4K25 A;  5FRN A;  1OH6 A;  1XC3 A;  5I9E B;  2ZJQ L;  4BAC A;  3CD6 N;  1N8R O;  1KVC A;  3CC4 N;  1NK8 A;  2Q31 A;  3TSQ A;  4QS8 A;  2CH6 A;  5AQZ A;  4CGD A;  1XC9 A;  2JWL A;  1SL0 A;  1HQU A;  3CMA N;  3RMC A;  5AQN A;  3LP2 A;  3ZT1 A;  5GIN A;  3RR7 A;  1HYZ A;  4J2E A;  3SJH A;  4DV6 K;  3M8P A;  1ASU A;  4JKE A;  2B4J A;  3LM9 A;  2IS3 A;  4M3R A;  4CJ5 A;  3TTD A;  2Z1G A;  4DG1 A;  3SBG A;  1CLQ A;  4DCH A;  4CGF A;  4JRP A;  4IZ9 A;  3IRX A;  2BDP A;  3VEW A;  3GG4 A;  3GL1 A;  4LH5 A;  3OYK A;  5AQL A;  3E1Y A;  3V9S A;  1VQN N;  1GLA G;  4DV2 K;  2CGJ A;  1RDW X;  1FKO A;  1RTJ A;  2AJQ A;  4LF7 K;  4XH5 A;  4JLH A;  1E4G T;  1TKT A;  4DSF A;  1JLQ A;  4OPJ A;  1HYV A;  3UKR A;  4C8O A;  4CEB A;  2W6K A;  4CJQ A;  3RRH A;  4BG8 A;  3LPT A;  3MED A;  1UAX A;  4CJW A;  4DFP A;  4FJ7 A;  1RDD A;  1J54 A;  2QWP A;  2YV0 X;  3H08 A;  2P51 A;  3W0L A;  1R0A A;  3EEQ A;  4BY9 C;  5CY4 A;  3M3Z A;  3U4L A;  4YHH K;  4H0X B;  2BTF A;  4KFB A;  3WNG A;  2Z1H A;  5K14 A;  3T1Y K;  3MX5 A;  4CF0 A;  1RT5 A;  3OYC A;  2OTJ N;  3FZM A;  2DTU A;  4IKF A;  4I9L A;  3VQ5 A;  1B9D A;  1IKV A;  3IMX A;  4YOU A;  4W5N A;  4CGH A;  2WBN A;  1RT2 A;  1YI2 N;  1RDC A;  4G1Q A;  4BDP A;  5HL7 L;  4HUG A;  2E8A A;  3THY B;  4QS9 A;  4BGB A;  5LMN K;  2RE2 A;  4CHQ A;  5AZI B;  2FF6 A;  4GMJ B;  4PWD A;  3O9T A;  4CEA A;  1NGJ A;  4A2B A;  4DTX A;  4IOC L;  3G10 A;  1DEJ A;  1T03 A;  4BG9 A;  4DS5 A;  2H3G X;  3U3Y A;  3CFR A;  2CGL A;  4DUZ K;  4PKH A;  4DS4 A;  5GIP A;  3PY8 A;  4JI5 K;  2NNW A;  4DWI A;  1R59 O;  2HHU A;  4TSX A;  4CHZ A;  4M45 A;  2JLE A;  4FWQ A;  4CEO A;  4C8M A;  2ASM A;  3FLC O;  3L2V A;  3MXI A;  4NO7 A;  2KFN A;  3CHW A;  1IG8 A;  4DB3 A;  4Z4H A;  1GLL O;  4CIG A;  2WFB A;  1S9E A;  4AHU A;  4M3X A;  1U2V B;  3Q7C A;  4LSN A;  3VEV A;  3S3M A;  3CC2 N;  3KZB A;  2G8U A;  3C94 A;  2XO7 A;  3SUQ A;  1Q82 O;  1JLG A;  4DTJ A;  3L3U A;  1M90 O;  2P1J A;  4B1W B;  4J2D A;  4WFB L;  2IGI A;  4ELV A;  1KFS A;  4DF4 A;  3ZX2 A;  1TUU A;  2OPR A;  3LAK A;  3DM2 A;  2O8F B;  3CPW M;  2YI1 A;  1RBR A;  4BDY A;  4PUO A;  3B8A X;  4WFA L;  3NF9 A;  4ICL A;  4IFV A;  2BE2 A;  3A0I X;  4K41 A;  5AQP A;  4CE9 A;  1Q86 O;  3OW2 M;  4YY3 K;  4AM6 A;  3SUO A;  4CEE A;  1M1K O;  1N33 K;  2E6L A;  1RT1 A;  3G25 A;  1GLB G;  4CF9 A;  4H4O A;  1RDB A;  1X9S A;  1D4X A;  3EL2 A;  4GW6 A;  4YOW A;  3ZYY X;  1I94 K;  1S9G A;  2W6L A;  4NYF A;  5GAE P;  3SUP A;  1KLN A;  4IEI A;  3EN9 A;  3D0P A;  3M8Q A;  3QEW A;  3VQ8 A;  4CZH A;  4GVM A;  4FW2 A;  1YHQ N;  1XQS C;  4JK7 A;  4V19 S;  3F73 A;  1SUQ A;  1C0F A;  1XHX A;  2FXU A;  1WAF A;  2HB5 A;  3V6D A;  4K42 A;  1WB9 A;  3LPU A;  2A3Z A;  2ITG A;  2NLX A;  3NGY A;  3HOS A;  1REV A;  4LFA K;  1I39 A;  1RBU A;  4NCG A;  3T1A A;  4C1N I;  3THV A;  5H1S Q;  4KI6 A;  4YDU C;  2KTQ A;  4EP4 A;  2PAV A;  3P83 D;  3TR8 A;  4E7H A;  4ISF A;  5DK5 A;  2HHW A;  2OPS A;  3WQT A;  2ZGZ A;  4W5Q A;  1SL1 A;  1ATR A;  3VF4 A;  3NH1 A;  3RVC A;  4WFN L;  4OPK A;  1V4S A;  2Y1I A;  4AHV A;  5C0Y A;  4FK2 A;  3I56 N;  1WBD A;  3ZSQ A;  3VN5 A;  2ZQB A;  2YHY A;  5I42 A;  3ULD A;  4JI3 K;  4NXN K;  3T19 A;  3R9P A;  4CHN A;  4DQQ A;  4WQ4 C;  4FLU A;  4KRF A;  4KB0 A;  1RBT A;  4BRN A;  3EE9 A;  5AQM A;  1HJR A;  1BA1 A;  3LWL A;  4HCB A;  3CER A;  5C25 A;  4JS5 A;  4RWT A;  3V1Q A;  2QWQ A;  3KWI A;  4OGE A;  2FF3 B;  3AA5 X;  1VSF A;  3VA3 A;  5EY4 A;  4CHY A;  3QBW A;  4H8K A;  1VQM N;  1NGF A;  4CGI A;  1X9M A;  2OAN A;  3TAG A;  3KLF A;  4E1M A;  5IWA K;  4AH9 A;  2P9N A;  1WNS A;  4X64 K;  3AVM A;  3C6A A;  4FO0 A;  1TGO A;  5M1N A;  2P9K B;  4BR5 A;  3B6O A;  5C10 A;  3SZ2 A;  4LC9 B;  3ITH A;  3L4I A;  2UUA K;  3LL3 A;  4FYD A;  2KZZ A;  2E6M A;  2UU9 K;  3EKS A;  4CFA A;  1YJW N;  1TK5 A;  2NRH A;  4DKW A;  3NE6 A;  2QK9 A;  3QO9 A;  4I6M A;  2W42 A;  4GV9 A;  4CFC A;  1LV5 A;  4FJM A;  1HLU A;  1U48 A;  3VQA A;  3HBT A;  2IDO A;  1Q9Y A;  5AQY A;  5HBM A;  1TYQ A;  5CYQ A;  1HX1 A;  3MDQ A;  4JKG A;  1A5W A;  3VEO A;  3TAM A;  5BRE A;  1VSH A;  3D2E B;  4CFB A;  3THW B;  3T69 A;  3HSC A;  2O8B A;  4FJL A;  2O8E B;  2XY8 A;  5IT9 O;  2HF3 A;  3BGR A;  3D6R A;  1KRP A;  4AQY K;  3TSU A;  5HRP A;  4LFC K;  1ZBH A;  1YUW A;  3SBT A;  4DTR A;  2P5G A;  2OZS A;  4GKJ K;  4XH4 A;  1KXP A;  1EX4 A;  4H0V B;  1GLD G;  2QWL A;  3NDK A;  2XY5 A;  2QWR A;  4CD3 A;  2IVO A;  3OYB A;  1EKE A;  4DTP A;  1BUP A;  3AVJ A;  4CK2 A;  1S6Q A;  4AM7 A;  1QE1 A;  1IJJ A;  1W0H A;  3PO4 A;  2RPI A;  3CJ7 A;  5JMV A;  1NJZ A;  1IH7 A;  5GIO A;  5HRS A;  1P90 A;  2VQE K;  1D8Y A;  3KWG A;  2O8C A;  4LF9 K;  4OKK A;  5LL6 Z;  4GVE A;  3AO3 A;  4OO1 J;  3D2F B;  3LDP A;  4IDK A;  1GLJ O;  4JHD A;  3UKU A;  2V7Z A;  4FVU A;  1Q18 A;  2QWO A;  3L2R A;  2FBV A;  4JD2 B;  3LWM A;  1VSI A;  2GWJ A;  2P9I A;  4BQL A;  1LWC A;  3ZSY A;  4ZTJ A;  3WNH A;  3FFI A;  3BY5 A;  4B1V A;  4BQZ A;  4JKF A;  4BE0 A;  4KHY A;  2QI2 A;  3WUH A;  2E2Q A;  3DMJ A;  1S1T A;  3VEX A;  1NK4 A;  3O9S A;  4OGC A;  3SI6 A;  2G8V A;  4JKC A;  4CK1 A;  3P31 A;  3V4I A;  3QET A;  1VQ7 N;  1ZC6 A;  5MLC Q;  3DXK B;  1T3V A;  4FWS A;  1SKW A;  3O80 A;  5J1E A;  2RF2 A;  5HP1 A;  3MN6 A;  5F1X A;  3O3H A;  3K5M A;  2X6N A;  4DU3 A;  4MFB A;  3ZEU A;  3E9O A;  3NH0 A;  1QHA A;  3JXU A;  4DU4 A;  1OKJ A;  1C0M A;  3GOI A;  4H0Y B;  3OTO K;  4RW9 A;  2RHK A;  3MEC A;  1NG9 A;  2P9S B;  2FBX A;  3KKR A;  2FBY A;  1T6C A;  3MN5 A;  2GTD A;  3CQX A;  3KKS A;  4ELT A;  1F21 A;  3BZC A;  3C0B A;  2VGN A;  1U6Z A;  1O13 A;  2D5R A;  3Q7B A;  2KW4 A;  1NJI O;  1DT9 A;  3SQ1 A;  4DSL A;  4O4G A;  2IVN A;  2YNF A;  1ILY A;  3CCM N;  5CYM A;  3QB0 A;  2HHV A;  3VQQ A;  3QNO A;  2JWK A;  1W2B M;  3CFP A;  1NJY A;  1NGG A;  4BR2 A;  5TKW A;  2OPP A;  2E20 A;  3C7N A;  1X3M A;  4BRD A;  2PY5 A;  3KIO A;  2DFE A;  4KHQ A;  3U9Z A;  4LF8 K;  4FWL A;  5TKY A;  4DV7 K;  5AQX A;  4B9M A;  1NMN A;  2O4G A;  1NK0 A;  1ASV A;  4FWR A;  1OH5 A;  4DTS A;  2HBL A;  4ILH A;  3E9P A;  2E5L K;  3HK2 A;  3KTQ A;  4NLB A;  3DLH A;  2YKM A;  4A5B A;  3TPQ A;  1TKX A;  3CM6 A;  3JYT A;  2DFF A;  3TAF A;  1U49 A;  1BCO A;  1RTH A;  4CJE A;  1IG9 A;  1X9W A;  4A5A A;  1TKD A;  4GKK K;  4C1N K;  3QEV A;  1RT3 A;  3AVH A;  4M41 A;  3CCU N;  1EWQ A;  3THX B;  1YJ9 N;  3TAB A;  4YOY A;  3QFU A;  3J80 O;  5FDL A;  1LAV A;  4YDU A;  3WXI A;  1N34 K;  1LCU A;  3OY9 A;  4LD0 A;  3U6F A;  3C95 A;  1NGA A;  4IBN A;  3DOL A;  4IFY A;  5KI6 A;  2NRV A;  2ITM A;  2WC9 A;  5AZJ A;  3IFR A;  1DGK N;  4GY2 B;  3VTH A;  4E1N A;  4JNE A;  1UA1 A;  3NHG A;  3QEI A;  4BR4 A;  3SK3 A;  4DU1 A;  1VQL N;  2XY6 A;  3HZ6 A;  3VET A;  1VRT A;  1ZYQ A;  4RG8 A;  2YJF A;  4WQ4 A;  1NLV A;  1ZBS A;  1NGB A;  3TAE A;  1ZXO A;  1B92 A;  1ZBL A;  3VGL A;  1A5X A;  3ID8 A;  4W5O A;  3LZI A;  5AQV A;  3CCS N;  4KKO A;  3MMV A;  3NMU A;  1CZA N;  1LW2 A;  2QWM A;  3ASM A;  1RGI A;  2UXC K;  3OYH A;  3G4S N;  3IAY A;  3GE1 A;  3HST B;  1VQ8 N;  1BOT O;  3NBP A;  5BRD A;  4U7B A;  1QQO A;  1TVR A;  4DFM A;  3H45 C;  2UXD K;  4F3T A;  4H4M A;  2KKZ A;  3QBX A;  1ZBF A;  3CFO A;  1QZ6 A;  1OH7 A;  1HKB A;  5CZ2 A;  4BRL A;  3VQ9 A;  3P39 A;  1K8A O;  4BC2 A;  4G9Z A;  2P9U B;  3L8B A;  4Z4C A;  1TK0 A;  3DLR A;  3P38 A;  3EKU A;  3CCL N;  3SAH A;  1C1C A;  3BEX A;  3DAW A;  1TKZ A;  1VSJ A;  2YHA A;  1HQE A;  4RW4 A;  4NYN A;  4CEZ A;  4O0I A;  4CJV A;  3S9H A;  2KFZ A;  4BRE A;  4BVO A;  1TK8 A;  1YXQ A;  3M6G A;  3EO3 A;  4J2B A;  3BDP A;  3K5N A;  5KRT A;  3DXM A;  4FXD A;  2X6S A;  2YHB A;  5HRR A;  1QS4 A;  2DY4 A;  3C6U A;  3QES A;  2YCH A;  4CEC A;  2E2O A;  3M8R A;  2HHH K;  1TAU A;  1JLE A;  4JRQ A;  4XEI A;  3SV4 A;  3L2U A;  2IIR A;  1EO1 A;  2IOC A;  1RT6 A;  2UUC K;  4Q0B A;  3K9J A;  2VYP A;  4WQ5 C;  1N6Q A;  2ZF5 O;  5CE3 A;  2Q97 A;  1VK0 A;  3VOV A;  2ETJ A;  4HTU A;  3VEZ A;  4OPH A;  3CJB A;  4JKA A;  4CF1 A;  3PIO L;  5FRM A;  1CZB A;  4CJT A;  2XY7 A;  3ZLJ A;  5KPZ A;  4IJN A;  2I7N A;  3OYN A;  5J2N A;  4KTW A;  1J5E K;  3RMB A;  3WT0 A;  4DR4 K;  5FPM A;  3HTV A;  1BQM A;  4M3T A;  4IEE A;  3G6E N;  2P9N B;  2F9W A;  4K8X A;  4CIF A;  2GX9 A;  5KQD A;  2G8F A;  4Z94 A;  5BRH A;  4ZTF A;  3KLE A;  5DM7 L;  2WON A;  3O4Q A;  5KGW A;  4CHP A;  4E3S A;  2ASO A;  4XIU A;  1JL1 A;  1HNI A;  4FWN A;  4LSL A;  3BZK A;  4YFU A;  5KPR A;  4DSK A;  1JKH A;  1WSF A;  3K5O A;  1W7A A;  1WBB A;  4QAG A;  4I6M B;  5EU7 A;  4HVJ A;  5BRF A;  5CZ1 A;  4FJH A;  1K73 O;  3HPO A;  1NGD A;  4B3S K;  5EVZ A;  5M1F A;  4DQS A;  1LWF A;  4IG3 A;  4BE2 A;  1RTI A;  5M1P A;  2PFU A;  4PL7 A;  3QIP A;  5I3U A;  1TYQ B;  4JKG B;  2F96 A;  4LFB K;  2YHX A;  5JLF A;  1S1V A;  1NJX A;  3OVN A;  1KVB A;  1NGE A;  3CM5 A;  5AR0 A;  1NGC A;  4MDA A;  4CZI A;  2O8B B;  3TSP A;  3CIP A;  4CF8 A;  4EZ9 A;  1J5O A;  1KC8 O;  4FLT A;  2VG7 A;  2XHB A;  3A5O C;  1NK6 A;  4MLH A;  3ULE B;  3O4N A;  4YOV A;  4BRO A;  4CJR A;  3SMS A;  2NRX A;  3J8A A;  1ATS A;  4F3O A;  4QOZ B;  1ZBU A;  2EWS A;  4B1Y B;  3V9X A;  4BDZ A;  1ESV A;  2YKN A;  4KH4 A;  3WEE A;  3VTI A;  1QQC A;  2QEX N;  4A57 A;  3OA9 A;  1IKW A;  5J2Q A;  2KQ2 A;  4E19 A;  2VWJ A;  1C0T A;  4H5V A;  2P9L A;  3WXM B;  4AHT A;  3MN9 A;  4FOI A;  1XHZ A;  2A40 A;  3MAQ A;  3CQY A;  3CET A;  1T05 A;  2UUB K;  3UKU B;  3AA3 A;  3ZT2 A;  1VQ6 N;  3CQ8 A;  3OYF A;  2ZWH A;  4CW7 B;  2HNZ A;  1LWE A;  4IG0 A;  3L4Q A;  4YOX A;  1S1U A;  3TAQ A;  3HPG A;  1GLE G;  4FOE A;  4JI2 K;  2PYJ A;  3E01 A;  2QW9 A;  1EET A;  2A6A A;  1KQS M;  3AVF A;  3SAG A;  2F7T A;  1Z05 A;  2G8I A;  4IFE A;  5JVG L;  1L5U A;  2VG5 A;  1Z6R A;  4BR9 A;  3RTV A;  3MXJ A;  3LZJ A;  4CK3 A;  2GWK A;  5C2F A;  4CEQ A;  2HHS A;  3LDO A;  4C23 A;  4AF1 A;  2BUP A;  3JSM A;  2ATQ A;  4CZE A;  1UWB A;  2PBD A;  2HMP A;  2CH5 A;  4BRM A;  4DR5 K;  3MWP A;  3WNF A;  3SNN A;  3FZH A;  2O8D B;  5AQJ A;  2V51 B;  4JK9 A;  4QCL A;  1BU6 O;  5E26 A;  3OYA A;  3AVK A;  5B8H A;  4OX9 K;  1HJO A;  1DTT A;  2QTD A;  1G15 A;  2P9P B;  1MA9 B;  2ZJP L;  4FJ5 A;  3OYJ A;  1WOQ A;  2Q2R A;  3F9M A;  4BRF A;  2AP1 A;  4NCA A;  1ZBI A;  3HYF A;  3CCE N;  5M1K A;  4B8C A;  4B3R K;  5AQR A;  4M3W A;  3KK1 A;  3UE5 A;  4JYA K;  3DLB A;  4O0J A;  2A1S A;  2X74 A;  3KK2 A;  3SPZ A;  4NXM K;  1RIL A;  1J6Z A;  2RKI A;  2E1Z A;  4FWK A;  3THY A;  3C7N B;  3GBT A;  5AZI A;  1BO5 O;  3EYZ A;  4B9U A;  4FZY A;  5EXW A;  3J7A P;  1KVA A;  1RCH A;  4FLY A;  4E7I A;  2YNG A;  2D4W A;  4C8L A;  2BGG A;  3VQD A;  4FJJ A;  4H5R A;  1XNQ K;  2KZM A;  2E1Y A;  4CJ7 A;  2BAN A;  1NGI A;  3CCR N;  5BPL A;  4Z0U A;  5BPN A;  5AQS A;  1XUP O;  3A5N C;  3HM8 A;  4DF8 A;  3I55 N;  4O44 A;  2D0O A;  3SV3 A;  1HPZ A;  4JS4 A;  3PSI A;  5C42 A;  4Z4I A;  3H6E A;  1HRH A;  3VQ7 A;  3V1R A;  4HHT A;  4FPA A;  2Q0U A;  2Q0R A;  2GEM A;  1VSK A;  2A42 A;  2FSK A;  2VWB A;  4MO5 A;  3J81 O;  3FR0 A;  3QIN A;  2E2P A;  4B3M K;  4UQG A;  4IOX A;  3AVN A;  2PYL A;  3AGR A;  5GAD P;  4EHT A;  3R6M A;  3CJC A;  1B9F A;  1X1P A;  1MWK A;  1ASW A;  4GV3 A;  2G8K A;  1QHT A;  4H5W A;  1WSE A;  4O5F A;  1SKS A;  3SUN A;  4WCE L;  4WQ5 A;  1JLB A;  1OH8 A;  3G0Z A;  4CCH A;  3ATU A;  3ZT3 A;  5AQK A;  1HMV A;  4CGJ A;  3I33 A;  4E7L A;  2ZD1 A;  4BRQ A;  1MWM A;  2HF4 A;  3ZET B;  3LM2 A;  3NH2 A;  4E89 A;  3KK3 A;  4O5B A;  3BP8 A;  2UYT A;  1Q8I A;  3SLC A;  3MWT A;  4Y1D A;  4JEP A;  4X66 K;  4B9V A;  5AQO A;  2QXF A;  4CED A;  3ZSR A;  4L8R B;  3TTC A;  1TAQ A;  3QFP A;  3OHR A;  3O8M A;  1WSH A;  3MCA B;  4BRC A;  1FK9 A;  4O55 A;  4DV0 K;  3AA4 A;  5JLH A;  1BIU A;  2B5J A;  2ZGY A;  4K0K K;  1N32 K;  4FJG A;  3RMD A;  3CCJ N;  1KSP A;  5DM6 L;  1CXQ A;  4B1Z A;  1GOB A;  3ID6 A;  3QDK A;  3T3F A;  3KD1 E;  2HVH A;  1S22 A;  4RW7 A;  3NF6 A;  3O6W A;  4FPB A;  4BRP A;  4B08 A;  1WN7 A;  5M1O A;  3PSF A;  1QQM A;  1HKC A;  3OYG A;  3NVM A;  4NCB A;  4I9Q A;  3FGU A;  2LSN A;  3RRG A;  4I7F A;  1HNZ K;  1CZ9 A;  4DQI A;  2E88 A;  3HJF A;  3L6Q A;  4J8F A;  4DR1 K;  3NCI A;  4XH1 A;  4GV6 A;  4O8U A;  4DV3 K;  4IJA A;  1TUY A;  5F2R A;  2ASP A;  4R5P A;  3UKR B;  3TTF A;  3M5R A;  3QNN A;  4ID1 A;  4FWP A;  3A8Y A;  4A2A A;  2NUB A;  3PO5 A;  1QQN A;  3LDN A;  5E84 A;  4U67 L;  5AQT A;  4KHN A;  4KI4 A;  4FLW A;  1TV6 A;  2IC3 A;  4LY7 A;  3SAF A;  3N4P A;  4ISE A;  4CZM A;  3QIO A;  4B9T A;  4E7J A;  4IXC A;  4X65 K;  2J4R A;  2NRZ A;  3TAP A;  3RWU A;  1NKC A;  1KLM A;  3AO4 A;  3CI5 A;  3ZX3 A;  4HUE A;  1QVG M;  1BG3 A;  3H1Q A;  1HUX A;  4MQ3 A;  1TL3 A;  3PX4 A;  3CG7 A;  4I2P A;  4CER A;  1FW6 A;  1J53 A;  2GBZ A;  1IO2 A;  1Q7Y O;  1Z26 A;  1NMD A;  4JAX A;  4CZK A;  3KLI A;  4YOR A;  4FJX A;  3P1G A;  1WSJ A;  3OJS A;  2HST A;  4KH5 A;  4WYB A;  5KGX A;  4E0D A;  4OPA A;  3NGI A;  4B3T K;  4FSV A;  4KV8 A;  4JN4 A;  1XNR K;  4JI6 K;  1XI1 A;  2G8W A;  3VQP A;  4DUY K;  2E2N A;  1GLC G;  3CCV N;  3VMF B;  2WUS A;  4I2Q A;  1RNH A;  4HTL A;  3VGM A;  4FM0 A;  4Z4F A;  1S72 N;  3LP0 A;  2GV9 A;  1S6P A;  2VQF K;  3HL8 A;  2FBT A;  3WXL A;  3O9R A;  2QWN A;  4M42 A;  4OLA A;  4KBO A;  1Y97 A;  1VSM A;  4DR6 K;  4Y1C A;  2HVI A;  1HKG A;  3S3N A;  2YHW A;  3MK6 A;  3ZSV A;  4BGA A;  1ITG A;  1C1A A;  4RW8 A;  3QER A;  1IBL K;  4DFK A;  1BWF O;  3NF7 A;  4F8R A;  3EZW A;  2G8H A;  1T8E A;  4WE1 A;  2NRR A;  3U9D A;  3VQE A;  3CJ9 A;  1NOY A;  3I8B A;  4EZ6 A;  1Q9X A;  4B3O A;  3D2E A;  4BRI A;  3OYL A;  5EX5 A;  3T7Z A;  2HMI A;  3M8S A;  4KB1 A;  4M7X A;  4CJP A;  5A2Q O;  4N41 A;  1FJG K;  2O8E A;  4DTN A;  3LAL A;  3L2Q A;  4E1J A;  3FZF A;  3VGK A;  4FM1 A;  3J7Y P;  1O1W A;  2JGU A;  3OYI A;  5CR4 A;  3CJ1 A;  4W5T A;  4CJU A;  3JS6 A;  3WXK A;  3EY1 A;  1LAW A;  4K43 A;  1VQO N;  1U04 A;  4KHU A;  3O9Q A;  4RCH A;  1T6D A;  1E4F T;  5BR8 K;  1U4B A;  3DRS A;  4A59 A;  3PX0 A;  3ENH A;  1YTA A;  4CJK A;  1SZ2 A;  5E41 A;  4CZG A;  4FLX A;  3OYE A;  3HPH A;  3O9U A;  4Q5V A;  4M63 C;  3KLH A;  2D0P A;  3VQC A;  5JVH L;  1VQ4 N;  4FCY A;  1I3A A;  1BI4 A;  4C8K A;  3VQ4 A;  5AQF A;  2P5O A;  4BC3 A;  3WEE B;  4CJ4 A;  4HCC A;  1Z25 A;  1D5A A;  3L0Q A;  4EP5 A;  3D2F A;  5AQH A;  4JI4 K;  5M1Q A;  2VG6 A;  5FRO A;  1WSG A;  1K8K A;  2HBJ A;  4M3Z A;  4JD2 A;  3WQU A;  5EOY A;  2P9L B;  3IUC A;  1K6Y A;  1YTU A;  5AFU H;  3A2F A;  4FWO A;  3G71 N;  5SZT A;  4FL9 A;  2W40 A;  1YIJ N;  4DFJ A;  3LP3 A;  4PKI A;  3U8X A;  2O4I A;  3SQ2 A;  3MCP A;  2NRT A;  1U45 A;  4KRE A;  2V52 B;  3O4W A;  2DFH A;  5FPE A;  4BRK A;  2IVP A;  3DXK A;  3PUF A;  4DMN A;  4BRG A;  3L2W A;  4IDH A;  1QSS A;  1BCM A;  3P5J A;  3VEN A;  4FZX C;  1RT7 A;  1SS6 A;  3HT3 A;  1EQY A;  3QEX A;  2I5J A;  2HHQ A;  4OJR A;  4KH6 A;  1K9M O;  4X62 K;  2RN2 A;  4CBX A;  4FJK A;  1WUA A;  1NKB A;  3KHY A;  3NF8 A;  2P9S A;  2WTU A;  1EWR A;  3LP1 A;  3K58 A;  4A61 A;  1VSE A;  1VSD A;  3VQB A;  3ATV A;  4B9L A;  1KAX A;  1FKP A;  1VQK N;  4WF9 L;  3H1V X;  2HW3 A;  4DV1 K;  3IDH A;  3P4I A;  4FK0 A;  4LH4 A;  4OKJ A;  5HRO A;  3GDQ A;  4N76 A;  1L3V A;  4EAH D;  3NAE A;  1L3U A;  5KPT A;  4N47 A;  2X78 A;  3DRP A;  3DYA A;  4JKD A;  2D1K A;  3IG1 A;  3TU5 A;  1VQP N;  3RSE A;  3AV9 A;  3VQ6 A;  3ZX0 A;  3SQ0 A;  3DWL A;  4OVL A;  3VEY A;  1BGX T;  3AO2 A;  4Z4G A;  1X9J A;  4N5S A;  3OS0 A;  1BQN A;  4BWJ A;  1CXU A;  4CZL A;  5ELZ A;  4OLB A;  3V81 A;  2F4V K;  2D0C A;  5J2P A;  3J7Z O;  2A1R A;  1GOA A;  3ENB A;  3K2P A;  2XRI A;  3ZT0 A;  4CF2 A;  4MO4 A;  1Y64 A;  4GNI A;  1YJN N;  3BUZ B;  4FVM A;  4IO9 L;  2WOM A;  4AHR A;  3A5M C;  1L3T A;  1BA0 A;  3AAR A;  1IBK K;  3THX A;  4R79 A;  4BRA A;  1VQ9 N;  4FZZ A;  4KTQ A;  1LOT B;  2YJE A;  4ID5 A;  1QVF M;  3MN7 A;  3QLH A;  4H5N A;  4CZJ A;  4DR7 K;  4YNQ A;  3HVT A;  4BVP A;  4FLZ A;  2V7Y A;  4FJ8 A;  3AVI A;  3OS2 A;  5HOO A;  3N4Q A;  3RR8 A;  4FW1 A;  3CCQ N;  3HP9 A;  3I0R A;  3AVL A;  1D9D A;  3ISN C;  4DQR A;  4EFH A;  3SJJ A;  1DTQ A;  1RTD A;  2Q36 A;  2ZM6 K;  2OPQ A;  1NK5 A;  2DPN A;  4ZHR A;  3WXJ A;  3V9U A;  4H0O A;  2R7Y A;  3UIQ A;  3DLG A;  2OZM A;  1XWL A;  2D0B A;  5HLF A;  2QKK A;  3KVG A;  5GAG P;  3SYZ A;  1NM1 A;  2Z1I A;  4J2A A;  2QKB A;  1J9A A;  3E9L A;  1YVN A;  1NOZ A;  3AO5 A;  2YX6 A;  5BR9 A;  3NFA A;  2F8T A;  4KPY A;  2W41 A;  1NGH A;  1JXB A;  5JS2 A;  2VCP A;  1YF5 L;  3OYD A;  3SMP A;  3DI6 A;  2IAJ A;  4DSJ A;  5DMR A;  1KD1 O;  3EE8 A;  3ZSX A;  4EHU A;  3PLA A;  4KTZ A;  2O8C B;  1RDA A;  3AVG A;  1N36 K;  3OYM A;  1GLF O;  4JHD B;  3M1F A;  1OVY A;  3UB5 A;  1Q81 O;  3DLL L;  4UY8 O;  2GUI A;  5AJ3 K;  3FZL A;  1C6V A;  2P9I B;  5BPM A;  4N56 A;  3CPE A;  1WAJ A;  1BIZ A;  1IKY A;  3DOK A;  3O1B A;  4H5T A;  2BH1 A;  4F9O A;  1JL2 A;  2P9U A;  1SL2 A;  2YNI A;  3PV8 A;  1E3M A;  3HO1 A;  3HVR A;  2HHT A;  2B6A A;  3T1H K;  4PL8 A;  3KLG A;  1SQK A;  1EXQ A;  1ATN A;  4AHC A;  3O3G A;  3S3O A;  2GUP A;  3AA2 A;  4KHS A;  3H46 O;  3SQ4 A;  3ZSO A;  3BF3 A;  4NLC A;  3K5L A;  4HUF A;  2CGK A;  1HNW K;  3ZEU B;  4IWV A;  1GOC A;  4HWI A;  4M3U A;  5AFU A;  4AIL C;  2Z1J A;  3B6P A;  3TI0 A;  1EP4 A;  3H3O B;  4H0T B;  4MLE A;  5AQU A;  2OYQ A;  1NK9 A;  3FE1 A;  2QXL A;  1IBM K;  1MDU B;  5JS1 A;  4ILG B;  3WNE A;  5ADX H;  2HHX A;  1SAZ A;  1NKE A;  3H3N O;  3AVC A;  3ZSW A;  1UA0 A;  4KAZ A;  1S3X A;  5C12 A;  4O8K A;  1P8Z A;  3AO1 A;  1S1X A;  1H1V A;  3R8E A;  4DTU A;  1C1B A;  1RT4 A;  2HNY A;  1KTQ A;  2KLA A;  2PZS A;  3VF6 A;  1SKR A;  3DLE A;  4DTM A;  1DKG D;  4CGG A;  3IKM A;  5KRS A;  3QIC A;  1KFD A;  2NZT A;  4AHS A;  3D45 A;  2D0A A;  3SPY A;  3DRR A;  3VES A;  3E66 A;  3KK7 A;  1NJW A;  3MEG A;  2UXB K;  1RBS A;  4BR0 A;  3O1W A;  1LW0 A;  3BF1 A;  3S41 A;  3CXC M;  4PKG A;  3VF2 A;  4E7K A;  4BC5 A;  1YIT N;  4DSE A;  4JI1 K;  1KAY A;  3ALY A;  4OKE A;  2E4L A;  4M3Y A;  1T7P A;  3TAR A;  1FXX A;  4KHP K;  4YOT A;  2HOE A;  4ILJ A;  1DLO A;  5JIC A;  1C0G A;  2FC0 A;  5C2D A;  4BE1 A;  4NB4 A;  4DHY A;  5J2M A;  2F8S A;  3C65 A;  4ISG A;  4FJN A;  1QTM A;  1BL3 A;  1JXE A;  3DJC A;  5SWM A;  3HRG A;  2QA4 N;  5F0X A;  4CES A;  1XMO K;  3RMA A;  3K57 A;  2Q3S A;  4DSI A;  2KHO A;  1U2V A;  5AZJ B;  4PHT X;  3C6H A;  4JI8 K;  4CJ3 A;  4JI0 K;  3U3G A;  4CBW A;  1NWK A;  5HRN A;  3KJV A;  3V9W A;  4ELU A; 
#chains in the Genus database with same CATH homology
 3D7E O;  2YCH A;  4IEI A;  2HBM A;  3VMF B;  3CCV N;  2E2O A;  3EN9 A;  2WUS A;  1W97 L;  3AY9 A;  4HTL A;  3VGM A;  1JCG A;  4BR7 A;  4IO8 A;  1S72 N;  4CZH A;  4XEI A;  1XQS C;  4JK7 A;  1YHQ N;  3O5B A;  1T44 A;  2AA4 A;  2IIR A;  3WXL A;  3O9R A;  2QWN A;  1EO1 A;  1C0F A;  4KBO A;  2FXU A;  4CD1 A;  3ULE A;  3FZK A;  1HKG A;  4K42 A;  3K9J A;  2VYP A;  4WQ5 C;  2YHW A;  2ZF5 O;  5CE3 A;  3MK6 A;  2A3Z A;  2Q97 A;  4BGA A;  5LY3 A;  3VOV A;  2NLX A;  2NRW A;  3HOS A;  2FSJ A;  5AQW A;  1BWF O;  3VEZ A;  4OPH A;  3MX2 A;  3A5L C;  3CJB A;  3EZW A;  3FFK B;  2A5X A;  4JKA A;  4JKB A;  3PIO L;  4M7Y A;  2NRR A;  3U9D A;  5KPZ A;  3LDL A;  4IJN A;  2I7N A;  3CJ9 A;  4CI6 A;  4C1N I;  3I8B A;  3K9K A;  5H1S Q;  4CZF A;  3R3L A;  4YDU C;  3D2E A;  4BRI A;  2PAV A;  4FWM A;  5EX5 A;  3T7Z A;  4ISF A;  4M7X A;  3LDQ A;  2VGM A;  3WQT A;  3WT0 A;  2ZGZ A;  3CC7 N;  4E1J A;  5FPM A;  3FZF A;  1ATR A;  3VF4 A;  3HTV A;  3RVC A;  3VGK A;  4WFN L;  1K8K B;  3F2K A;  3NVK A;  1V4S A;  4IEE A;  4JK8 A;  5CR4 A;  3G6E N;  2P9N B;  3CJ1 A;  5C0Y A;  1BDG A;  2F9W A;  3JS6 A;  2GX9 A;  3WXK A;  5KQD A;  4Z94 A;  5BRH A;  4K43 A;  3I56 N;  1RFQ A;  1VQO N;  4BC4 A;  2YHY A;  3O9Q A;  4RCH A;  1T6D A;  1E4F T;  5DM7 L;  2ASO A;  4A59 A;  3R9P A;  3ENH A;  4WQ4 C;  4FWN A;  1X3N A;  1SZ2 A;  4CZG A;  5KPR A;  4BRN A;  3O9U A;  4M63 C;  3EE9 A;  5BN9 A;  5AQM A;  2D0P A;  1BA1 A;  5GAH P;  1V4T A;  4I6M B;  3CER A;  5AQG A;  5JVH L;  1VQ4 N;  5BRF A;  1YAG A;  4RWT A;  3QML A;  4QS7 A;  1K73 O;  1NGD A;  5AQF A;  2QWQ A;  3KWI A;  5EVZ A;  5M1F A;  2FF3 B;  1KAZ A;  4BC3 A;  3WEE B;  5M1P A;  5EY4 A;  2PFU A;  5AQQ A;  3DXM B;  3L0Q A;  3D2F A;  4PL7 A;  3QBW A;  5AQH A;  1VQM N;  1NGF A;  3AGK A;  5M1Q A;  1TYQ B;  2OAN A;  4JKG B;  1K8K A;  4RTF D;  1VAZ A;  2HBJ A;  2YHX A;  4JD2 A;  3WQU A;  4B1X B;  5JLF A;  5EOY A;  2P9N A;  2P9L B;  3IUC A;  3C6A A;  4FO0 A;  1NGE A;  5AR0 A;  5M1N A;  1NGC A;  2P9K B;  4BR5 A;  4MDA A;  5AFU H;  4CZI A;  5C10 A;  4FWO A;  4LC9 B;  3TSP A;  3CIP A;  3G71 N;  3L4I A;  3LL3 A;  5KQ8 A;  4FL9 A;  2W40 A;  3EKS A;  1YIJ N;  1VQ5 N;  1KC8 O;  1YJW N;  4PKI A;  2P9P A;  5FPN A;  2NRH A;  3U8X A;  4DKW A;  3A5O C;  3CJA A;  3MCP A;  4MLH A;  2OTL N;  3ULE B;  2NRT A;  4YOV A;  2V52 B;  4BRO A;  3O4W A;  3HI0 A;  5FPE A;  4BRK A;  4B1U B;  2IVP A;  4I6M A;  3SMS A;  2NRX A;  4GV9 A;  3DXK A;  3J8A A;  1ATS A;  4Y0W A;  4BRG A;  4B1Y B;  2EWS A;  4JKH A;  1ESV A;  3AAP A;  4KH4 A;  3WEE A;  1HLU A;  4IDH A;  3VTI A;  2QEX N;  3VEN A;  1SS6 A;  4A62 A;  4A57 A;  3HBT A;  1EQY A;  5AQY A;  3OA9 A;  1TYQ A;  4EIA A;  1HX1 A;  2I7P A;  3MDQ A;  4JKG A;  2Q1N A;  3W3D A;  3VEO A;  4L3Q A;  3VER A;  4H5V A;  4KH6 A;  5BRE A;  2P9L A;  3D2E B;  3WXM B;  1K9M O;  3MN9 A;  3RSE B;  4FOI A;  4CBX A;  2P9K A;  3T69 A;  5LJW A;  1WUA A;  2A40 A;  3HSC A;  5ADX A;  3CQY A;  3CET A;  2A41 A;  3KHY A;  3UKU B;  2P9S A;  2HF3 A;  4A61 A;  3D6R A;  3TSU A;  1VQ6 N;  3ATV A;  4DQ8 A;  1KAX A;  1YUW A;  3SBT A;  1VQK N;  2ZWH A;  4XH4 A;  4H03 B;  4WF9 L;  3L4Q A;  3H1V X;  1KXP A;  5CHI A;  4YOX A;  2QWL A;  1GLD G;  4H0V B;  3ENO A;  1GLE G;  2QWR A;  4CBU A;  2IVO A;  4FOE A;  4CD3 A;  1RDU A;  3IDH A;  1G99 A;  2QW9 A;  2A6A A;  4B9Q A;  2FSN A;  3P4I A;  1BUP A;  3GDQ A;  4AM7 A;  1NBW A;  4EAH D;  1KQS M;  1IJJ A;  5FPD A;  3SAG A;  2F7T A;  3R1X A;  1Z05 A;  4IFE A;  3CJ7 A;  5JMV A;  1QZ5 A;  5KPT A;  5JVG L;  1HPM A;  1JCF A;  2F9T A;  1Z6R A;  3OBW A;  4BR9 A;  4JKD A;  1JJ2 M;  5GIO A;  1P90 A;  2D1K A;  2GEL A;  3VPZ A;  3TU5 A;  1VQP N;  4MDB A;  3KWG A;  3RSE A;  3ZX0 A;  3CME N;  4GVE A;  4H0P A;  2GWK A;  3OBY A;  3DWL A;  5BN8 A;  5C2F A;  3HOT A;  3VEY A;  3D2F B;  3LDP A;  4OO1 J;  1GLJ O;  2ZJR L;  4JHD A;  1X9J A;  3LDO A;  3UKU A;  2V7Z A;  4C23 A;  4FVU A;  1Q18 A;  4AF1 A;  4BRH A;  3F5T A;  5LJV A;  4IOA L;  2BUP A;  4CZE A;  2QWO A;  2PBD A;  2HMP A;  2CH5 A;  4JD2 B;  4CZL A;  4BRM A;  5ELZ A;  3MWP A;  2GWJ A;  2P9I A;  2HBK A;  5AQI A;  4BQL A;  3FZH A;  5C15 A;  5AQJ A;  3J7Z O;  3AAQ A;  3O08 A;  2V51 B;  4JK9 A;  1BU6 O;  4B1V A;  4BQZ A;  4JKF A;  3ENB A;  5E26 A;  2QI2 A;  3WUH A;  2E2Q A;  5B8H A;  3PIP L;  1HJO A;  1Y64 A;  4MO4 A;  3VEX A;  2QTD A;  3O9S A;  2P9P B;  1MA9 B;  4GNI A;  2ZJP L;  3CF5 L;  2QM1 A;  2FLO A;  1JCE A;  1WOQ A;  3BUZ B;  4JKC A;  2Q2R A;  4IO9 L;  1YJN N;  3A5M C;  4K25 A;  3F9M A;  1BA0 A;  3AAR A;  2AP1 A;  3ZET A;  4BRF A;  1XC3 A;  3P31 A;  5I9E B;  3CCE N;  2ZJQ L;  1ZC6 A;  4R79 A;  3CD6 N;  5M1K A;  4BRA A;  5AQR A;  3DXK B;  1T3V A;  4FWS A;  5MLC Q;  3CC4 N;  1N8R O;  2Q31 A;  3UE5 A;  1VQ9 N;  3O80 A;  1LOT B;  4QS8 A;  2CH6 A;  3TSQ A;  5AQZ A;  2YJE A;  2JWL A;  1QVF M;  3MN6 A;  3MN7 A;  5F1X A;  1J6Z A;  4H5N A;  4CZJ A;  3CMA N;  2E1Z A;  4FWK A;  5AQN A;  3ZEU A;  4BVP A;  3C7N B;  3E9O A;  2V7Y A;  3GBT A;  5GIN A;  5AZI A;  1BO5 O;  1QHA A;  3JXU A;  1OKJ A;  5HOO A;  3GOI A;  3SJH A;  3N4Q A;  5EXW A;  4H0Y B;  3CCQ N;  4JKE A;  4EFH A;  2RHK A;  2D4W A;  3LM9 A;  4H5R A;  2Q36 A;  2P9S B;  3TTD A;  2E1Y A;  3SBG A;  1T6C A;  3MN5 A;  2GTD A;  3CQX A;  4CJ7 A;  2DPN A;  3C0B A;  2VGN A;  3WXJ A;  1U6Z A;  1O13 A;  4H0O A;  4DCH A;  1NGI A;  3Q7B A;  3CCR N;  5BPL A;  4IZ9 A;  5BPN A;  5AQS A;  1XUP O;  3A5N C;  3VEW A;  3GG4 A;  3HM8 A;  1NJI O;  3KVG A;  3GL1 A;  5GAG P;  3I55 N;  1DT9 A;  2D0O A;  1NM1 A;  2IVN A;  1ILY A;  5AQL A;  3E1Y A;  1VQN N;  1GLA G;  1YVN A;  3E9L A;  3H6E A;  3QB0 A;  3CCM N;  2JWK A;  2CGJ A;  2YX6 A;  1W2B M;  1RDW X;  5BR9 A;  1NGG A;  4BR2 A;  4FPA A;  5TKW A;  2W41 A;  4XH5 A;  2Q0U A;  2Q0R A;  1NGH A;  2GEM A;  2VCP A;  2E20 A;  3C7N A;  1YF5 L;  1X3M A;  2A42 A;  3SMP A;  4BRD A;  2FSK A;  1E4G T;  2VWB A;  3U9Z A;  4MO5 A;  1KD1 O;  3FR0 A;  3EE8 A;  4FWL A;  4EHU A;  3PLA A;  2E2P A;  3UKR A;  4IOX A;  5TKY A;  5AQX A;  3AGR A;  1GLF O;  4JHD B;  5GAD P;  3M1F A;  1OVY A;  4FWR A;  3UB5 A;  4BG8 A;  4EHT A;  3R6M A;  1Q81 O;  2HBL A;  4ILH A;  3CJC A;  3E9P A;  3DLL L;  4UY8 O;  3FZL A;  5BPM A;  2P9I B;  3CPE A;  1MWK A;  4NLB A;  4GV3 A;  4A5B A;  2QWP A;  3TPQ A;  4H5W A;  4O5F A;  3O1B A;  4H5T A;  3W0L A;  4WCE L;  2BH1 A;  4WQ5 A;  4BY9 C;  4F9O A;  3M3Z A;  3U4L A;  2P9U A;  3ATU A;  4A5A A;  4H0X B;  2BTF A;  5AQK A;  3I33 A;  4C1N K;  4BRQ A;  1MWM A;  4PL8 A;  2HF4 A;  3MX5 A;  3ZET B;  3LM2 A;  3CCU N;  1SQK A;  2OTJ N;  1ATN A;  3FZM A;  1YJ9 N;  3BP8 A;  4YOY A;  3QFU A;  3IMX A;  2UYT A;  4YOU A;  3SLC A;  3MWT A;  4YDU A;  3WXI A;  2WBN A;  2GUP A;  1LCU A;  4JEP A;  1YI2 N;  3H46 O;  5AQO A;  1NGA A;  5HL7 L;  3BF3 A;  3TTC A;  4NLC A;  2E8A A;  3QFP A;  3OHR A;  2CGK A;  4QS9 A;  3ZEU B;  4BGB A;  3O8M A;  2NRV A;  2ITM A;  2RE2 A;  2WC9 A;  4IWV A;  3MCA B;  4BRC A;  4HWI A;  5AZJ A;  5AZI B;  2FF6 A;  3IFR A;  1DGK N;  5JLH A;  3O9T A;  4GY2 B;  3VTH A;  1NGJ A;  5AFU A;  2ZGY A;  4A2B A;  4JNE A;  4IOC L;  4BR4 A;  3SK3 A;  1DEJ A;  3CCJ N;  4BG9 A;  1VQL N;  2H3G X;  5DM6 L;  3H3O B;  4H0T B;  4MLE A;  5AQU A;  4B1Z A;  3HZ6 A;  3ID6 A;  3QDK A;  3VET A;  3FE1 A;  1S22 A;  2QXL A;  1MDU B;  3O6W A;  2CGL A;  4FPB A;  2YJF A;  4WQ4 A;  4ILG B;  4BRP A;  4PKH A;  5M1O A;  1NLV A;  5ADX H;  1QQM A;  1HKC A;  1NGB A;  1SAZ A;  1ZBS A;  5GIP A;  1ZXO A;  3NVM A;  2NNW A;  3VGL A;  3FGU A;  1R59 O;  3H3N O;  3ID8 A;  1S3X A;  5C12 A;  4O8K A;  1P8Z A;  5AQV A;  3CCS N;  1H1V A;  3MMV A;  2E88 A;  3R8E A;  3NMU A;  1CZA N;  4FWQ A;  2KLA A;  2QWM A;  3L6Q A;  4J8F A;  1RGI A;  3VF6 A;  3G4S N;  2ASM A;  4XH1 A;  3FLC O;  3GE1 A;  1VQ8 N;  4GV6 A;  4O8U A;  1BOT O;  4NO7 A;  3CHW A;  1DKG D;  1TUY A;  1IG8 A;  4IJA A;  3IKM A;  4DB3 A;  5F2R A;  2ASP A;  5BRD A;  3QIC A;  3UKR B;  4U7B A;  1QQO A;  1GLL O;  3TTF A;  2NZT A;  2WFB A;  3M5R A;  3H45 C;  2KKZ A;  4FWP A;  3A8Y A;  4A2A A;  3VES A;  3E66 A;  3KK7 A;  3QBX A;  1QQN A;  3LDN A;  1U2V B;  5E84 A;  3Q7C A;  1QZ6 A;  3CC2 N;  3VEV A;  4U67 L;  5AQT A;  4BR0 A;  3O1W A;  3BF1 A;  1HKB A;  3KZB A;  3S41 A;  3CXC M;  4PKG A;  3VF2 A;  4BRL A;  1Q82 O;  1M90 O;  3SAF A;  3N4P A;  4ISE A;  4BC5 A;  3P39 A;  1YIT N;  4CZM A;  1K8A O;  4B1W B;  4WFB L;  1KAY A;  4BC2 A;  4G9Z A;  2P9U B;  4IXC A;  2J4R A;  2NRZ A;  4YOT A;  2HOE A;  4ILJ A;  3P38 A;  3EKU A;  3ZX2 A;  3CCL N;  3SAH A;  1TUU A;  3BEX A;  3CI5 A;  3DAW A;  3ZX3 A;  5JIC A;  1C0G A;  3CPW M;  2YI1 A;  5C2D A;  4NB4 A;  1QVG M;  1BG3 A;  3H1Q A;  1HUX A;  4DHY A;  3B8A X;  4WFA L;  3C65 A;  4ISG A;  1Q7Y O;  4CZK A;  1NMD A;  4JAX A;  3A0I X;  4K41 A;  5AQP A;  1Q86 O;  3DJC A;  4YOR A;  3OW2 M;  3HRG A;  4BRE A;  4BVO A;  2QA4 N;  5F0X A;  2HST A;  4AM6 A;  1M1K O;  1YXQ A;  3M6G A;  3EO3 A;  4KH5 A;  4WYB A;  3G25 A;  1GLB G;  2KHO A;  1U2V A;  4OPA A;  5AZJ B;  4FSV A;  3DXM A;  4JN4 A;  4PHT X;  3C6H A;  1D4X A;  3EL2 A;  4CBW A;  2E2N A;  1NWK A;  4YOW A;  3ZYY X;  1GLC G;  5GAE P;  1VQ7 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...