1HNIA

Structure of hiv-1 reverse transcriptase in a complex with the nonnucleoside inhibitor alpha-apa r 95845 at 2.8 angstroms resolution
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
publication title Structure of HIV-1 reverse transcriptase in a complex with the non-nucleoside inhibitor alpha-APA R 95845 at 2.8 A resolution.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 130
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hniA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hniA05
2PY5A 1S0OA 1BCMA 3LPUA 3UPFA 2GC8A 3BSNA 3D0PA 4Q5VA 4TXSA 3QYYA 4KHWA 2YHBA 5F8GA 3CYMA 2YNFA 4CHPA 5KFVA 3KLHB 2YNHA 1WSGA 4QW9A 4EEYA 4CK1A 2BRKA 4C8MA 4R8UB 3V1RA 4MK9A 4URGA 3RB3A 1KSPA 1S9FA 4BE0A 3MR2A 5SZTA 4WZMA 5K14A 3RBEA 4HUFA 1NK9A 2XHBA 4KB1A 3PW5A 3SUNA 5I3UA 4CJTA 1S1VB 2UVWA 3RBDA 4IDKA 5KGWA 4JV1A 1U45A 4OJRA 3OYMA 1ZYQA 4Q0BB 4YR3A 3AO1A 3AVNA 4H4OB 4KFBB 5J2MA 4Q8FA 4EBEA 1RT1B 1RT3B 2IBKA 1DTTB 3B6OA 1MU2B 4F2SA 4KAZA 4DQSA 1RCHA 1RILA 3KD1E 4KO0A 4M3TA 3KK2B 4IRKA 3NF6A 4JUZA 1RTDB 3EPIA 2WCXA 2ZD1A 1TK0A 1L3UA 4CGDA 2W8KA 4KHRA 4DG1A 4CGHA 3RMBA 1LAWA 3NCIA 4KTQA 1O1WA 4URSA 4IR1A 3OLBA 1SKSA 2C2EA 2XGQA 4F4ZA 3MFIA 3Q8PB 2IAJB 3O3GA 4ZP9A 3AVIA 4IFVA 2RF2A 2HHVA 1GOAA 3PV8A 4O55A 2BANB 1T03B 4DF8A 3NGYA 3CJ3A 4EYHB 5HLFB 3H5SA 4TY8A 2JLEA 3VQ8A 2YNFB 2OPSA 3KK3B 3VQEA 2D0AA 3VQSA 4I9LA 3SI6A 1S6PA 4Y34A 1KVBA 2YKMA 5DG7A 4HUEA 3AVHA 3SQ0A 2DFHA 4ED0A 3JSMA 1A5XA 2D0BA 2IJNA 3LP2A 3A2FA 3N6MA 5F8HA 1RYRA 3HP6A 4FLZA 1NKCA 1U09A 2IM2A 3L3VA 4IRDA 3QZ7A 4ZTFA 4WYWA 1RT2B 4FLXA 3PX4A 3ZT2A 4QPXA 4FLYA 4CJ3A 2D0CA 4PA1A 4FVMA 2HNYA 3PUFA 1YT3A 4CEDA 4FK0A 2AGQA 4DG1B 3DLKA 1SUQA 1BQNB 1KHWA 3K5OA 3TAMB 2C22A 4B08A 1VSLA 3MR3A 1N48A 4K4SA 4IFVB 4G1QB 3NMAA 2D7SA 4NRUA 3HVRA 2D5RA 1K6YA 4O0IA 4OL8A 1WAFA 3MECB 4I7FA 4TY8B 3PX0A 3PJWA 3DRPA 2W9BB 1D1UA 1C2PA 3AA2A 1YVFA 2OPSB 4AH9A 1EKEA 4DL4A 4CJWA 3VQ5A 5J2PB 1D8YA 2DPIA 1S6PB 3IG1B 3CVKA 1VSHA 2YKMB 3D45A 4ZPBA 5KT2A 3VA0A 3AVJA 4FM2A 3K5MA 2BR0A 1HYSA 4ZP6A 4R5PA 2P51A 1DTQA 4CF9A 3E51A 3OL8A 1BI4A 1VRUB 4AHUA 4CGIA 4QCLA 4KHYA 1KRPA 1C1CA 5L1LA 3HT3A 1JX4A 1TQLA 4ED3A 1RDRA 1KLMA 3OYCA 3H5UA 2HMIB 3FFIA 4Y3CA 4Z4IA 2YNGB 1I3AA 5C24A 4N5SA 4ZMMA 1JLCB 2HNYB 4ECYA 3VQDA 4FK2A 1TKZA 1LWEA 1XHXA 4ZVHA 3DLKB 5L1JA 1KFSA 4RNOA 2WHOA 3NGIA 4ZP7A 5JXSA 4ECVA 4ZTJA 4FJLA 3KHGA 2WONB 2BQRA 3OYBA 3FDSA 2HNDB 5KT3A 3IRXB 4NCAA 1JLAA 4QW8A 4J9OA 2D41A 3H08A 1WSJA 5KG4A 1J5OA 3BSOA 3SYZA 1JXBA 1EP4B 2W9CA 3D5MA 3DYAB 1JLFB 4B9UA 2WK4A 1C1BA 1XWLA 4O44A 3KLIA 4KTWA 3DM2A 1N5YB 4H54A 2EC0A 4PUOA 4OLAA 2J6TA 3LZJA 4J2EA 3IS9B 5KFTA 3EZ5A 1T8EA 4R5PB 4DF4A 1TV6A 3V81A 5EWFA 4ECQA 1BI4B 4FZYA 2QKBA 4FJ7A 4CGJA 2G8FA 1ZBHA 1VSMA 4GC7A 1C1CB 1YTUA 2AWZA 4FJGA 4N76A 2AX0A 4Q45A 3NE6A 4DQRA 2IM3A 3HM9A 1TL3A 4MFBA 4WXWA 4QWCA 3L2WA 5C24B 1T3NA 2EX3A 4RW9A 1S1UA 3AVBA 2QE5A 3AO5A 3CJ0A 3QGHA 1RBRA 3C95A 5KFYA 2B6AB 1KCFA 3SZ2A 4JS4A 1S5JA 3NF9A 1JLBA 3VQ7A 3QLHA 4DU1A 1S48A 4KI4A 1XI1A 2F8EX 3TVKA 4J2BA 5L1KA 5EWEA 3NF8A 4M3WA 1VK0A 4WFYA 5CY4A 2KQ2A 4J2DA 3KHRA 2JC1A 3OYFA 4FW1A 3HSTB 1IKVB 3M9NB 2R2TA 4CFCA 4RW7A 3AO3A 4MKBA 4ECSA 3K5NA 3KK1A 3OYLA 2W9CB 4XO0A 4MKAA 5KFOA 4CF0A 4DTJA 4LSNA 4HHTA 3T3FA 4O44B 3BSCA 3LP0A 4JRQA 4FZXC 3VQCA 5KFZA 2E6MA 5D3GA 1TK5A 4CEQA 3WNGA 2FBYA 4O3PA 4CF2A 1C0MA 4JV2A 5FRNA 4MQ3A 2XY6A 2YHAA 4GVMA 1LWCA 3WNEA 4EZ6A 2OZMA 5T14A 2Y1JA 2JEGA 3H2LA 2BGGA 4TN2A 5CYMA 1IM4A 4FXDA 4YP3A 1TV6B 2ATQA 3CM5A 3G6VA 2PYJA 4HKQA 3LP1B 4GW6A 2B43A 3ZSXA 4NLRA 1LW0B 4DL2A 3ULDA 1UAXA 3JYTA 4DTUA 4B9TA 3BGRA 4IH6A 2X78A 1CZ9A 5HROB 5KFGA 4M94A 4ZVGA 5FROA 4CESA 5I42A 4CHQA 2J6SA 4J9SA 1TL3B 4MFBB 3NGZA 1QSLA 4Y2CA 1RT7B 1QQCA 4FLVA 4O3RA 1NK6A 2P5GA 3LAKA 5DGAA 2IGIA 4RW8B 4K4VA 3SPZA 3Q8SB 4I2PA 2BQUA 3CWJA 5KFKA 4DU3A 3QLHB 1WN7A 3C6UA 1QE1A 4KTZA 4NLXA 1UOCA 3FQKA 4N47A 4LH5A 4DSEA 2OPQB 3KKRA 2ATLA 3F9KA 1RA7A 1JLQB 4TSXA 2R2SA 1BCOA 1SH3A 4CFBA 3KK1B 1RTIB 4DLEA 3SQ2A 1SV5B 4LSNB 3DOKA 2KZMA 3KMSA 1WLJA 2R8GA 3RB0A 1NK8A 4CGGA 4O4GA 2DY4A 5KFNA 5CYQB 1RDDA 3VQBA 4W5TA 5C42A 2XI3A 2JGUA 4IG3A 1LWCB 5FDLA 1WNEA 4M3YA 3OS2A 3KLVA 2VG5B 1X9SA 1BQMA 2HNZA 1TK8A 5KFXA 2OA8A 2GBZA 3U3GA 1S97A 5KG7A 4DFKA 3ISNC 3CJ5A 4ECRA 5HP1B 4IH5A 4O3QA 4AHVA 1KVCA 2UVRA 4O3SA 1NKBA 3QINA 3AVGA 1QSYA 5EDWA 4C8OA 2V4RA 3S3NA 2AX1A 1T7PA 4LH4A 2B4JA 4B8CA 3GIJA 3S3MA 2VG6A 3MEDA 4B9NA 3CM6A 3T1AA 3SFUA 4KV8A 2IC3A 1BIZA 3WNHA 2BE2B 2ASJA 3M8QA 3C6UB 1QE1B 3V6DB 4WFXA 3KJVA 4Z4EA 4RG8A 3TI0A 2GUIA 4J9PA 4KHNA 4WZQA 4YFUA 1QSSA 1S1TA 3Q8QB 4CJ5A 4DS4A 4J9KA 3F73A 1FKPA 4Y1DA 4MK8A 4K4WA 4CERA 3H4BA 4DSKA 2FBXA 4FJNA 3H5YA 4KI6A 2IJFA 3NGDA 3RWUA 4B3OA 4CIGA 4CFDA 1TKTA 2FLPA 1S6QA 4IG3B 1ZBFA 4Y1CA 3OYIA 1HPZB 4NLVA 5FDLB 1BQMB 2BDPA 3HVAA 3G10A 4NLUA 3HPGA 4O4RA 3ZT1A 1X9WA 4IR9A 4FJMA 5L1IA 4H4MA 1TVRA 3NDKA 3ZSOA 1NHVA 4NYZA 1RT5B 3GIMA 2ASLA 3DMJA 1IO2A 2G8IA 3K57A 1OS5A 4RW4B 3MTKA 3IAYA 2RKIA 4CHZA 5KFBA 1X9MA 4J9MA 4GC6A 4DSFA 4NLGA 3P83D 2VG6B 3MEDB 2YKNB 3AA3A 1ZBIA 5J2QA 4NCBA 2IC3B 1SH2A 4B9MA 3OYNA 3OS1A 2LSNA 5KT7A 3M8QB 3OL9A 1FK9B 1EETB 3DOLA 1S1WA 3I8DA 3TAGA 1RT4B 1TKXA 4DSIA 3LALA 2VG7A 4OGEA 4CHYA 3V9UA 3VQAA 4TQRA 1IKWA 4CGFA 3OYJA 4F4YA 2BRLA 3G86A 4Z4FA 3MFHA 3PX6A 3DRSA 3LZIA 4DSJA 4J2AA 5DQIA 1LWFA 4RU9A 2YNHB 4M3UA 1IKXA 2HHWA 1GOCA 3GV7B 4NLWA 2Q3SA 1T05A 1S1XA 2AGPA 2R8IA 4B3OB 1NK0A 1SH0A 3LP3A 1J54A 5K14B 1S6QB 5I3UB 4BE2A 4ED7A 1JXLA 3SUOA 1FKOA 4B9VA 3BQ0A 4ID5A 4IDKB 4J9QA 3PVXA 3CFPA 4H4MB 4H8KA 3S9HA 1NJXA 1TVRB 4BDYA 4FM0A 4CJLA 3PO4A 3PY8A 5J2MB 1A5VA 3H4DA 3UR0A 3SNNA 3ASMA 4FLTA 4EZ9A 1HQEA 4DWIA 3T5LA 1I39A 4KO0B 2RKIB 3NH2A 5KG1A 3E01A 5HRNA 2IA6A 4PWDA 1C6VA 2RDJA 3TR8A 1CXQA 3U3YA 4UQGA 4E3SA 3M8RA 3QNOA 1ZTTA 2ZD1B 3AA4A 1JKHA 4ELTA 3KHHA 4F50A 3N6NA 3QETA 4O3NA 2HW3A 2W7PA 1S1WB 2GV9A 1UA1A 2RF2B 3LWLA 4Z4CA 4EP5A 1IKWB 3I0SA 4IBNA 4FJJA 1LWFB 1HNIA 1NJYA 3LAMA 3NAHA 4K4TA 2F8TA 2B5JA 1HQUA 3QESA 1B9FA 1RTHA 2FJVA 4I2QA 3CDEA 4DTOA 4Z4GA 4W5NA 4IFYA 4W5RA 3JSMB 3ITHA 5KG5A 3AVCA 4ELUA 2C2RA 2D3UA 3LP2B 4I9QA 4TY9A 3O3HA 3UIQA 3MR6A 4ID5B 3KLFA 5F9LA 3C6TA 5CZ2A 1D0EA 3OYDA 5KG3A 4OKKA 4CHNA 4TQSA 4OLBA 4IKAA 3HPOA 1TAUA 1NHUA 4EYIB 4CEAA 1SKWA 3BJYA 3KLGA 3SQ1A 1KVAA 4FJ9A 3KD5E 2X6NA 4IH7A 2IOCA 4BE1A 4B8AB 4DLGA 4FZZA 4DL7A 3ZT3A 3DDKA 4AHTA 3CDWA 2OYQA 4QWBA 5KRTA 1ZETA 1SUQB 4J9LA 3AV9A 3BQ1A 2FVCA 4IG0A 2JEFA 1ZBUA 1SL1A 2HB5A 3PZPA 3ZCMA 2FVQA 2C2DA 1B92A 4NLSA 5KFJA 3CJ2A 3MXMA 3NBPA 3AVKA 3V6KA 3I0SB 3L2UA 4Y2AA 3QO9A 4NYFA 4I7FB 3TANA 2V9WA 3DRPB 2VA3A 1HNIB 1WSHA 2WB4A 1RDBA 4FJKA 3DRRA 3CDUA 3QEVA 1HQUB 4KKOA 1RTHB 4E7LA 5JS1A 1R0AA 3MXIA 2I1RA 4RW6A 1HYSB 2O4IA 1CLQA 4CJVA 1DTQB 1JLEA 5KI6A 4M95A 2FJXA 3C6TB 5DG9A 1JL1A 2KTQA 1WSIA 4NLPA 1KFDA 5EWGA 3TAPA 3PHEA 5C5JA 2OPRA 3BSAA 4FK4A 3SCXA 3LWMA 5KFQA 4DQQA 4CIFA 3AO4A 1KLMB 1Q9XA 5J1EA 4CECA 3FFIB 4FS2A 3QIDA 3OHAA 2HVHA 1C0UA 5KFDA 3AO2A 3HJFA 5C25A 2WTFA 4FJ8A 5J2NA 2RPIA 5F8JA 3ICLA 2A1RA 3M8PA 1TKZB 1LWEB 4FM1A 3IN5A 2E9RX 1RAJA 1RBTA 4OKEA 1NKEA 3QEPA 4IG0B 1ZTWA 3TAEA 1Q8IA 4DQPA 4ECZA 1JLAB 3ZSWA 3NL0A 1TL1A 3V6JA 1L3TA 2F8SA 3OVNA 1HYZA 3OYKA 1J5OB 3V1QA 3T5KA 3GQCA 2WOMA 4CJUA 1F21A 3AVMA 4WE1A 3ZT0A 1C1BB 4ICLA 3KLIB 3BDPA 3H98A 3DM2B 3MF5A 3K5LA 3RRGA 1EXQA 4PUOB 3QIPA 1RTJA 4DTRA 3ZSVA 4CJFA 4AHSA 2W7OA 1WNSA 3RAQA 1REVA 4WYLA 1S0NA 1U4BA 5KT5A 1JLEB 3V81B 3G6XA 2W8LA 4W5QA 3GV8B 2IM1A 1KTQA 2KZZA 4E7JA 4EBDA 4KE5A 2V0NA 2AGOA 1KLNA 3PR5B 5KFAA 2G8HA 3PW7A 3NAIA 2AQ4A 4HCBA 5J1EB 4BDZA 2ILYA 3TQ1A 2XY7A 2JEJA 3HVWA 3MR5A 4G3IA 2Z1HA 4K8ZA 4RW9B 1S1UB 3DLGA 4CEOA 1C0TA 1UA0A 1T94A 4CEFA 2YV0X 3OL6A 4LQ9A 1ASUA 5KG2A 1RBUA 4DTXA 4M41A 4FJ5A 1RT6A 4M3RA 3QIOA 1QS4A 4CFAA 3V9XA 4E7KA 3SUPA 1JLBB 4CIEA 1N6QA 3MEEA 5SWMA 3IGVA 2ZE2A 4KHSA 3AVFA 3PW4A 4CEBA 2C28A 2I5JA 3I5BA 1D9FA 1RBVA 5KFHA 5T7BA 4O5BA 3L3UA 3D28A 4DMNA 4TLRA 2FBTA 4RW7B 4FLWA 2ZKUA 1QTMA 1CZBA 1QUVA 4R0EA 4URQU 1HYVA 1SKRA 2XY8A 3LP0B 4YNQA 4NZ0A 4F4XA 1HARA 3ZSYA 5KFLA 3HXMA 5D3GB 1DLOA 1J9AA 2R2UA 2X6SA 5KFPA 2IM0A 2AU0A 4DL5A 3SI8A 2ILZA 1REVB 4EO6A 3THVA 5CYMB 2O4GA 3KLHA 2E4LA 3SJJA 3AA5X 4EO8A 4QWAA 4R8UA 5KT6A 3MXJA 2Y1IA 3JYTB 2HWHA 5F9NA 1CXUA 3BGRB 4CJKA 2E9TA 4N56A 4B9SA 4ECTA 4M3XA 1LW2A 5F8IA 3QERA 5I42B 4CK3A 1L3SA 1RDCA 4ECXA 2HHUA 4K4ZA 3DLGB 4Q0BA 2XWYA 4IRCA 2R8HA 1C0TB 5HRPA 3HP9A 5KFIA 4DL6A 4KFBA 4CF1A 1VSKA 1VSIA 4U6PA 4I2PB 2ETJA 5DGBA 1RT1A 1N4LA 1DTTA 1RBSA 5HRRA 1BGXT 3QEWA 4F8RA 4FYDA 1XR6A 2FJWA 4K4XA 4M42A 3MEEB 3RAXA 3DLRA 3VN5A 4Q43A 3FQLA 1NOZA 3HYFA 5EUHA 3OY9A 3V4IA 3N6LA 4NYNA 4JV0A 1RTDA 4FBTA 4NLDA 3HPHA 4OPJA 3I5AA 3G6YA 4F4KA 3NAEA 2VWKA 4YMEA 3OL7A 1W0HA 2XRIA 4KPYA 4KHQA 3DOKB 3KNAA 3DLHA 3SUQA 4O4GB 1DLOB 4JS5A 5DLFA 3GIIA 1RNHA 2BANA 5C42B 3VQ6A 4E19A 1T03A 5E41A 5HLFA 1S4FA 2XGPA 1NJZA 1SL0A 2IMWP 2HNZB 3CQ8A 3KK3A 1TKDA 3CG7A 4NCGA 4WFZA 4EBCA 2FC0A 1HRHA 4QWDA 3L2QA 1HMVA 1C1AA 3HL8A 4FLUA 3GV5B 2R7YA 1LW2B 3ISND 5KFWA 3KIOA 4FJIA 2R2RA 2ITGA 3OJUA 5KGXA 1NK7A 2XC9A 3HHKA 1RYSA 3ZSRA 4HUGA 4BACA 3LDSA 4HYKA 3LANA 3MEGA 4YQWA 4KRFA 4KV8B 3DLEA 4O0JA 2KW4A 1A5WA 1U04A 3V1OA 1RT2A 2FBVA 4DTMA 3KJVB 4IOBA 4DTSA 3OSNA 5EU7A 3V4IB 1S1TB 1GX6A 3QGGA 1S10A 1FKPB 1W25A 3RMAA 2BQ3A 2ZQBA 4DTPA 1BQNA 3KOAA 3NFAA 1Q9YA 4DQIA 2HHTA 3TAMA 1I6JA 5L9XA 2UVUA 3PO5A 2QV6A 2YNIA 3QNNA 4NLYA 4PQUA 4J9NA 4G1QA 4E1MA 2JC0A 1XR7A 2OH2A 5JS2A 1NNDA 2FVPA 1TKTB 3MECA 2AJQA 1JIHA 5KG6A 2W9BA 4DEZA 4LY7A 4RNMA 1NK5A 5KFEA 4FJHA 2V4QA 4YR2A 4NCGB 3QZ8A 5J2PA 3IG1A 3CJ4A 1HMVB 3RB4A 1VRTA 4B9LA 2J6UA 3DMJB 5F8MA 4E0DA 1GX5A 2RN2A 1W9HA 1K1QA 1YVUA 4ZPCA 1VRUA 5CZ1A 5DMRA 4AHCA 3GIKA 4LD0A 1JLGA 4ED1A 1L3VA 4WXOA 4E7HA 5FRMA 3L2RA 1JXEA 2R8JA 1TGOA 2XCAA 1U47A 3MEGB 3DLEB 5J2QB 4U7CA 5DK5A 1CSJA 3RMCA 4RZRA 2E6LA 2XCPA 4KAIA 2G8WA 3CO9A 3Q8RB 2HMIA 1Z25A 3K59A 5F8NA 2ASDA 2YNGA 2PYLA 1RDAA 3DOLB 3TAFA 1JLCA 4CF8A 2IDOA 4ZPDA 1TKXB 3GILA 4C8KA 4CJ4A 2VG7B 3OSPA 3KMQA 2XY5A 2W9AA 4ID1A 5F8LA 4NLQA 3I0RA 4MIBA 4CJQA 1S9EA 4JRPA 4FJXA 3DRSB 3HK2A 1IKYA 2YNIB 2WONA 3OYHA 1IKXB 4PQUB 4ED6A 3ZT4A 2HNDA 1T05B 1S1XB 3IRXA 2XO7A 4XIUA 1ASVA 1VSDA 4CJEA 1UWBA 4N41A 3ZSZA 4NLOA 2VWJA 3OHBA 4CCHA 1N56A 4HVJA 3FRZA 1EP4A 3MAQA 3BR9A 3DYAA 1FKOB 1JLFA 4C8NA 4CJRA 4ED2A 4Q44A 4OKJA 4RNFA 2QK9A 2W42A 1G15A 3O4NA 1N5YA 1VRTB 2NUBA 2HHSA 1VSEA 3P1GA 3CFRA 1JL2A 3IS9A 3OYGA 1HQEB 3CFOA 4K50A 1HNVA 5HBMA 4C8LA 1L5UA 4E89A 4OPKA 3E01B 1JLGB 4E7IA 2HVIA 4PWDB 3SV4A 3TABA 3AVAA 4KB7A 4FCYA 4L8RB 1HJRA 3GYNA 1JKHB 3OS0A 2FVSA 5DG8A 4OVLA 3ZSQA 3SV3A 1J53A 1MMLA 5KFMA 2JEIA 2DFEA 3KKSA 3NH0A 4KBIA 1NK4A 2HHQA 4W5OA 2B6AA 3RR7A 4MK7A 3I0RB 4EP4A 1S9EB 3V9WA 1FXXA 1TP7A 1XR5A 2IS3A 2P5OA 1IKYB 3NKYA 3RB6A 2Z1JA 3QGIA 1S9GA 2B5JB 1S49A 3S3OA 3FSIA 3VQPA 2DPJA 2G8UA 1UWBB 5KFCA 1S0MA 3OJSA 4I2QB 5KTQA 2DTUA 1IKVA 4IFYB 3H5XA 4XPCA 3ITHB 3M9OB 3EYZA 2QKKA 4KHUA 3M9MB 3KLFB 3BREA 1YTAA 4NRTA 3VQ9A 3EPGA 4MIAA 1WAJA 3SPYA 1QHTA 4IQXA 4ECWA 2UUTA 4JLHA 4F3OA 4Q8EA 4ZVEA 2GIRA 3KLGB 4MH8A 1KHVA 1HNVB 5HBMB 2D3ZA 2OZSA 4LQ3A 4CJSA 3V9SA 3RR8A 2ALZA 3DI6A 3LP1A 4F2RA 4YR0A 3VA3A 4RUAA 4DFJA 1LW0A 2Z1GA 3RTVA 3TAQA 1VSJA 5HROA 4FW2A 1LV5A 4TYBA 2FLLA 4DFPA 3L8BA 2CJQA 3VQ4A 1RT7A 3VQQA 1Z26A 2G8KA 4CK2A 4OGCA 3OLAA 4IKFA 4RW8A 3V6HA 3NBPB 2KFZA 3B6PA 1SL2A 3QO9B 3IGNA 2X74A 2CKWA 3O4QA 3BQ2A 1U49A 1QAJA 2UUWA 5KFSA 3KLEA 5KG0A 2F96A 1S9GB 2VA2A 4CHOA 3DRRB 5KFRA 4TYAA 4AILC 4KKOB 1XHZA 2OPQA 4Z0UA 1JLQA 1R0AB 5KRSA 3ALYA 1BIUA 3EY1A 4RW6B 4FS1A 1IG9A 1RTIA 1K1SA 4FBUA 1SV5A 3EZUA 3UQSA 4M45A 3OYAA 4RNNA 3P5JA 4CE9A 5CYQA 1VSFA 3QEXA 2OPRB 4ZHRA 4BWMA 3TWHA 4RUCA 4F3TA 2VG5A 3T19A 3HO1A 5HRSA 2HAIA 4LSLA 3L2VA 3DI6B 1TAQA 3HVTA 1C0UB 3I5CA 3KHLA 1NOYA 5C25B 2OPPA 1D9DA 5J2NB 2FLNA 3LPTA 4F4WA 3UDLA 4KB0A 3M8PB 4DS5A 1Z4UA 5HP1A 4ZP8A 4K8XA 1QAIA 3V9ZA 1NJWA 3AVLA 5KFUA 2Z1IA 1Y97A 3G0ZA 1U48A 5KFFA 3SQ4A 3QEIA 1LAVA 1TL1B 1D5AA 2GIQA 4K4YA 4QOZB 3U6FA 2QXFA 2A1SA 1ASWA 3T5JA 4DTNA 2PZSA 2BE2A 2WOMB 4Z4HA 4ZPAA 3M8SA 3V6DA 3NF7A 4WE1B 3KLEB 2E9ZA 3OYEA 4ICLB 5KT4A 2XI2A 3H59A 4QWEA 4AHRA 3SFGA 3QIPB 1RTJB 4DFMA 1EX4A 2HHXA 4O3OA 3T5HA 4PY5A 3CIZA 3PJXA 1B9DA 4ZVFA 2O5DA 4K4UA 2HWIA 4KREA 4ELVA 1IH7A 1BISA 2DFFA 1WSFA 3H40A 4ECUA 4ZHRB 1WSEA 1HPZA 4E1NA 3TARA 4DL3A 1GOBA 4BDPA 1S1VA 3HKWA 2WRMA 4LSLB 2UVVA 5JUMA 1BL3A 4J9RA 3HVTB 2R8KA 1X1PA 2OPPB 4DSLA 4RNHA 3K2PA 4H4OA 4BWJA 1ZBLA 1RT6B 1RT5A 4GMJB 4X2BA 3DLBA 4NLTA 2RDIA 1RT3A 3PW0A 5DQHA 4HCCA 1MU2A 3NHGA 4RW4A 4M3ZA 2G8VA 1N6QB 3RRHA 2ZE2B 4CEEA 2I5JB 2KFNA 3KK2A 3RMDA 3K58A 4QAGA 1XC9A 4KHMA 2YKNA 5DQGA 2EHGA 4CJPA 5DLGA 3WNFA 3O3FA 3NH1A 4HTUA 2P1JA 4KSEB 4CEZA 1RA6A 3PR4A 3KTQA 3PW2A 1FK9A 1EETA 4ED8A 4XPEA 2IAJA 3C94A 2FVRA 4DU4A 1ITGA 1RT4A 1BHLA
chains in the Genus database with same CATH superfamily
1UEUA 3A5OC 4X66K 1S0OA 3CCRS 1GXTA 3UPFA 3NP5A 4PWUA 1HNXK 5LMNK 4TXSA 3QYYA 4DR5J 5HL7L 4WKRA 4CO5A 1FVSA 4B3RF 3CYMA 3HHLC 4Q7AA 2BH1A 1RWMB 5KFVA 4IDHA 1A9NB 1X8DA 2HZCA 2XBPA 5CCMA 4QW9A 5AQLA 2DEJA 4C8MA 2Q2RA 1CJKB 3VF0B 4R8UB 4RCHA 1IV0A 1JJ2R 1HIYA 3UKUA 1U7LA 1B3TA 1KSPA 4MTPA 4BE0A 1PJ6A 1NK9A 2XHBA 1YZ6A 5I3UA 2HGNA 2RU3A 4CJTA 1TMJA 1A7GE 4Q0BB 1WKLA 1XNQJ 3AVNA 4KFBB 1RAEB 4F36A 1RT1B 4B02A 3FZLA 1DTTB 2VICA 4F2SA 4DQSA 1RCHA 1RILA 1CC8A 4PG5A 1IBMJ 1N5SA 2GJFA 3KK2B 4I56A 3FNNA 4B3MK 1HI1A 2QTWA 5AR0A 2YKAA 3Q8VA 1TK0A 2V8DA 4CGDA 3OPKA 4KHRA 2FZKB 1SC4B 3RMBA 3NCIA 3VZHA 4IR1A 1SKSA 1H2VZ 4JI6J 3O9RA 4P75A 4OX7A 5IM0B 4IFVA 4LF8J 2HHVA 7FDRA 2CNNB 3PV8A 2A40A 1F2GA 3CC2N 4DF8A 4EYHB 3H5SA 5GMKa 3TU5A 3G9CA 4LMZA 1PIEA 2GJ2A 1E4FT 3HMJG 3VQSA 5HMWA 3QBWA 1IBLF 1S6PA 3ZZ0A 4FDFA 4K42A 1T9UA 2YKMA 1KVBA 5H9EK 4G6VB 3WDOA 1CS4B 3RZAA 2LLZA 3AVHA 3M6GA 1U2CA 2DFHA 2D0BA 4B3SJ 2K06A 4OI4A 4LF4F 3DRXA 3EJMA 5A6PA 2CJYB 3BF1A 1Q8LA 5DRKA 1NKCA 4BROA 4JI3F 2IM2A 4CLZA 3L3VA 5CE3A 3D66A 2VBYA 4P2SA 4ANDA 2OJ3A 3P6YC 1LK7A 4FPRA 3QB0A 4FLXA 3PX4A 3ZT2A 4DR4F 3V5RA 1ZAVA 3O44A 4KH0B 2D0CA 3CSKA 1TTHB 1FD8A 2FHMA 3F2KA 1Y00A 3W2WA 4BR4A 2F1FA 3MTJA 2P6SA 1BQNB 2ZOMA 3CMEN 5ETSA 5BYRA 1R0BG 3ATVA 3MR3A 1DY3A 3ENBA 2G2OA 5A8RA 1N48A 4XH4A 4IFVB 1HWLA 2JVRA 3NMAA 2D7SA 4KGZB 2D5RA 3DLLQ 3UE5A 2XQCA 1G4CA 2EFPA 3EGWB 4BRGA 1WAFA 1QLNA 3FKBA 2W9BB 4DUYK 4W98A 4A5BA 4CJWA 3TQEA 3VQ5A 1HWJA 1S6PB 3IG1B 1Z6RA 3CVKA 2YKMB 2GMLA 3FVYA 4ZCMA 3VA0A 2OEJA 3ULEA 2O8CA 2BR0A 3W3SA 3GTYX 3V4MA 4ZP6A 4CF9A 3OL8A 5K8OA 3LF0A 2YI1A 2MDAA 3MURP 1JCEA 3QMLA 4AHUA 2V63A 1VAZA 4WCEL 2QLFB 2V52B 3EX7B 4UY85 1TELA 4DX7A 3IP0A 3I6PA 4DPWA 4NASA 2YNGB 4OLOA 3L95X 2N3LA 4AFFA 3A3PB 5IV4A 4FVCA 3SBTA 5C2FA 1CC7A 4YOUA 5LSRA 4LFAF 3UDEA 5L1JA 1KFSA 3AJ2A 2ZJRQ 4RNOA 2WHOA 2X1FA 3NGIA 2Z2MA 4ZP7A 4ECVA 4FJLA 3KHGA 5A8RB 3T1HF 2HNDB 4NCAA 2F40A 2D41A 5EX3A 1YJNN 3VAMA 2MY7A 1X4AA 3PFEA 3GJTB 3SYZA 3MWTA 1JXBA 1BMQB 2ZH9A 2BM1A 1RAFB 5F0XA 3VGTA 3SDEB 3DYAB 4JI5J 2O67A 4B9UA 3ZLJA 5ADXH 2WK4A 4OI6A 4O44A 4KTWA 3DM2A 3BPSP 5FPNA 4PUOA 2I6WA 2VKZG 4Q2LA 4L3QA 3LZJA 4EK2A 4J2EA 2ZUAA 1K8KB 4OX9K 5KFTA 3BUZB 1FD2A 5D4NA 3I96A 4YB5A 4BLGA 1KAYA 4ECQA 1DAXA 1NDCA 4HH0A 2G8FA 1ZBHA 3FEXB 3IM9A 2IIRA 3K9KA 4Q45A 2IM3A 2GQ2A 2IVPA 2LU2A 1R59O 4QWCA 4WXWA 1U8WA 4ZITA 2R4FA 3D1QA 3SMZA 5DS7A 3FZBA 3QGHA 2RILA 2DO0A 3NNCA 1CVJA 5KFYA 4R79A 2QT7A 3GSDA 3SZ2A 4DV6K 4X66F 1OPZA 4KI4A 3TP2A 4P74A 1HNXF 5LMNF 3Q83A 4J2BA 3OVAA 3HFZB 4H03B 4F26A 4LF9K 4HHHA 4CFCA 4AQYK 4MKBA 4ECSA 4XO0A 2B4VA 4BRHA 3QFHA 1IM6A 4O44B 2FY8A 3BSCA 4OJ3A 2IBOA 2KYZA 3AGKA 5KFZA 2E6MA 2FIUA 3P8BB 1GH8A 5AXNA 2ZNYA 4EZ6A 4JKFA 1WF2A 2Y1JA 3H2LA 2BGGA 3CM5A 3MMJA 5C12A 2WFBA 4HKQA 4CZLA 2CQHA 3ZSXA 4NLRA 2Q6CA 1N32J 3ULDA 1FDAA 4DTUA 1RK8A 4B9TA 2NNWA 2X78A 4CLLA 1CZ9A 1JJ2M 5KFGA 4B3MF 4ZVGA 4CESA 5I42A 4J9SA 4MJKA 2NZTA 3H1VX 3AJDA 2HBMA 4JP8A 5GMEA 2VD3A 4WTYA 3Q8SB 3AOCA 1LFPA 5LM7E 1T9WA 3O9UA 3PCOB 1WN7A 4PL8A 3C6UA 1UOCA 3FQKA 3NCQA 1RAAB 4DSEA 3EUNA 2HBJA 3U1MA 1B70B 2FD2A 3M3ZA 2O8FA 2YJFA 1S0VA 1ATNA 4DLEA 2NZ4A 3DOKA 1WF1A 3Q24A 2UXCJ 1NK8A 5AT1B 4OYZA 2DY4A 2MZ1A 1HPMA 3VV2B 5BREA 2LQ5A 2DNHA 4UW2A 1Y3KA 2LXFA 2A6MA 2HNZA 4N8OA 2DPNA 2OA8A 3BH6B 3U3GA 5L9NA 3W3DA 3R5DA 1W97L 3ISNC 5D8HB 3CJ5A 4LRDA 2K7JA 2IMOA 4B9QA 3AD9C 4ECRA 5D6GA 1VC6A 4C8OA 3HKZD 4OJHA 2AZ1A 4RR5A 3ATUA 6FD1A 1Q95G 2XMAA 1VQ9S 4ZPTR 1N5VA 3GIJA 2KM8B 1SQEA 2YQ3A 3CM6A 2W7AA 1ILYA 1U6FA 5EN1A 4DV4J 1XTZA 2LU1A 3R5BA 2BE2B 2ASJA 2DYAA 3C6UB 4WFXA 5LXRA 3MX5A 5BRDA 1PKUA 3JQMA 3GOIA 4DUYF 1MN9A 2VONA 2F4VK 2ZJQL 4LF5K 3F73A 4PYAA 5HMYA 4MK8A 4K4WA 3ZXWA 1BUPA 4I6AA 4MDAA 3H4BA 1I5OB 2R9LA 2VC0A 4DSKA 3HRGA 2H4WB 4OHXA 1J5EJ 4KH4A 2DXEA 1B0TA 2HBLA 1IQTA 3Q7BA 3G6ES 4M5HA 2ROPA 3OR2A 2NXEA 2WVDA 1JNZB 4Y1CA 3OYIA 1HPZB 1EARA 4NLVA 3RG6A 4NA2A 1AB8A 4O4RA 2DHAA 2WVFA 3ZSOA 1NHVA 2O01C 1RT5B 3GIMA 2ZH4A 1IO2A 1YZ7A 3F9MA 4DPUA 3J7A1 3SCJE 3B4DA 3ISZA 4Y2IA 2ZH2A 4WTOB 1X9MA 1YF5L 2VFVA 4J9MA 4GC6A 1CJVB 3P83D 1B7YB 3AA3A 1NPPA 3BN4A 4B9MA 3B78A 1VQ7S 3OYNA 2K1RA 2CGJA 1SKUB 4JI8K 1TUUA 1FE4A 1S1WA 3I8DA 3N4PA 2M2BA 2EFVA 2VG7A 4OGEA 4ZPVR 3DHWC 2ZFHA 5LT5A 3OYJA 3VENA 2MKHA 3G86A 1YJ7A 1VIOA 3DRSA 3BKFA 1RHKB 5DQIA 2ZEJA 2YNHB 1IKXA 2ASMA 1GOCA 4OX9F 2CFXA 4NLWA 4WF9L 2VQEJ 1YJWS 1D8ZA 4IO9Q 4XTTA 4OHVA 4ZJOA 1PAUB 4CM0A 1Q53A 1Y64A 3D6HB 2AT1B 2MGZB 4CQ1A 4J9QA 4Y00A 3PVXA 3HBTA 4H8KA 1NJXA 2F5GA 2QC3A 2CPEA 3CJQA 1RHRB 2M0GB 3H4DA 3GP9A 3UR0A 2ZGYA 5RUBA 1FDDA 2EI5A 3R1XA 4DWIA 4M1KA 4KO0B 3PYFA 3GR1A 5HRNA 4DV6F 3PIOL 2COLA 3ADAC 2HGLA 1XMOJ 3TR8A 1PO6A 3QNOA 2E7VA 5E0OA 2IVMA 2ZD1B 4UTGA 4CLPA 4TLQA 2K1RB 4DR6K 4ELTA 4LF9F 3R6MA 4ZLNA 3U8XA 4F50A 4AQYF 4XK8C 1T44A 2KLAA 4DR2J 1S1WB 2GV9A 2CVEA 4DV0K 2I7NA 3A8YA 4M8LA 3AT1B 2QWOA 3LWLA 1QTNB 3I0SA 1KC8T 4USMA 2XB2D 2BKPA 3TTCA 3NAHA 5AQOA 5C10A 2O8BA 2CZ4A 4I2QA 4Z4GA 4IFYA 4JI7K 1FDBA 4R25A 5KG5A 2E66A 4TY9A 2BA9A 4PPDA 5CZ2A 1D0EA 1RLCL 3OYDA 5KG3A 2V4JB 4LSZB 4TQSA 3ILIA 4OLBA 4JD2B 2XLJA 3ENVA 2H51B 1SKWA 3GL1A 4YDUC 2V51B 1SB6A 4CJ7A 2NRHA 3FEZA 5DO2A 3ZT3A 4AHTA 4QWBA 2CQ4A 5KRTA 4WFNQ 3J81j 4KBOA 4J9LA 3AV9A 3BQ1A 2CNKB 4IG0A 2JEFA 3KXDA 3OHRA 3PZPA 1PGZA 1X3NA 2ZJPL 1B92A 2ZUGA 3NBPA 5D0HA 3MXHP 5E3AA 3I0SB 3A4TA 3V6KA 1FX4A 5DDOC 2PGCA 1GLCG 2P5VA 4J9VA 4PKIA 3JAMY 4ZN3A 1ELOA 2DR6A 3SEOA 1VR6A 3CDUA 4KKOA 2CQBA 2FJBB 1R0AA 1WUUA 2MZSA 2D74B 5AQRA 2I1RA 1VK8A 2O4IA 1CLQA 1WDTA 2DCUB 5LL6d 1R0CB 1T95A 3D7SB 1GLDG 5DG9A 5AJ3J 3DDNA 2MYFA 1WHWA 1JK9B 3ID6A 2HBKA 4FYWB 4FK4A 1WBBA 3ZZTA 4DQQA 4CIFA 4AL6A 1CPZA 2D3O1 4BVPA 4CBUA 2J7WA 2HVHA 3U9DA 2Z57B 2BM0A 5C25A 1NPKA 3L4QA 4FJ8A 4TU7A 4FWLA 1VLOA 2E8AA 2RPIA 5F8JA 2A1RA 3CULA 3AODA 2BOAA 2OEMA 1GLFO 1UFWA 2OHDA 2MQNA 4OZ0A 1RBTA 3VALA 2F4VF 4LF5F 4IG0B 3CJAA 4DOZA 2XMWA 3TAEA 1Q8IA 3CJ1A 1JLAB 3EXYA 3NL0A 4KR0B 4JI1J 4USIA 3OYKA 1HYZA 2KM8C 3BBCA 3EGNA 3OBYA 2HHHK 4CJUA 1F21A 4U7UD 3VTHA 2DT9A 2A2CA 3H98A 3G8TA 1URRA 2MHNA 2RUGA 4AXJA 4KT0C 4GRSA 3ZZZA 5L39A 1S7IA 4YY3J 4W5QA 4A8YA 4I6MA 2HVZA 2VPWB 3QT7A 3U7JA 3VR1A 2QLJB 3UR3C 1KXPA 2IVFB 3DNCA 4KE5A 5LL6Z 1KLNA 3H8YA 3PR5B 5CABA 3IAM9 2LP4A 4PWWA 2XY7A 2AYEA 4OZ2A 2CYYA 4G3IA 4RW9B 4A8KA 3CQYA 4A48A 2J9DE 4JI8F 1C0TA 4CEFA 5ETPA 3OL6A 4M3RA 3QIOA 2OELA 1QS4A 2E5GA 2CPHA 3BB5A 5IXUA 4GKJK 1T3VA 1N6QA 4DPOA 4CVNE 2RSQA 3A3NB 4CEBA 1D9FA 2BW2A 4KGMA 4O5BA 4WWSA 3EICA 1HWUA 3QRQA 3L3UA 3D28A 2XULA 4ZVOB 3VETA 4FLWA 1QUVA 3IR7B 1LCUA 1XMQJ 2VHGA 1T9TA 1R8BA 3T7ZA 4OMFG 1HARA 3SJHA 3HXMA 1DLOA 1J9AA 1NZAA 3D68A 2XSJA 2AJ0A 3LO3A 3PFOA 4IOXA 3DN9A 3A5MC 1YHQS 4USVA 1ZM3A 3TEHB 2R7VA 3WX8A 1NB7A 4MLHA 1OH6A 2A18A 3PYDA 2E4LA 4QS8A 3SJJA 4I6MB 4WFBQ 3M2RA 2AIRB 4QWAA 4W90B 2E5JA 1UEVA 5KT6A 3DGVA 2HWHA 5F9NA 1CXUA 2FGOA 3BGRB 2ZWOA 4N56A 2E9TA 3HOTA 4H0YB 2C3UA 2D0PA 4B9SA 2IA0A 1LW2A 4TVAB 5G0RA 2B4PA 3K17A 4H0TB 1L3SA 4DR6F 1RDCA 4ECXA 4K4ZA 2B4UA 5HMZA 1JCGA 1C0TB 2FHJA 3HSZA 4DL6A 4PKDB 1VSKA 1VQON 3MN5A 2PAVA 1N4LA 1RBSA 1BGXT 4F8RA 2FJWA 2B3TB 4K4XA 3JB9k 3DLRA 3VN5A 2ZM6K 1P1LA 2QA4S 4JKGA 3FQLA 5EUHA 1Q86O 1YJ9N 3V4IA 3N6LA 4GMKA 4NLDA 3G6YA 4F4KA 2X51A 2ITMA 4YMEA 5A2QU 3G25A 2DCLA 1VFJA 3CI5A 1IVZA 4JI7F 2XHCA 1XERA 4FKXA 5FLXY 1DLOB 5DLFA 1N5TA 3WX4A 5E41A 3GFHA 1S4FA 5AQFA 3JS9A 2XGPA 1NJZA 1ZC6A 4BRNA 3CQ8A 3JAMO 1O8BA 3CPWR 1HRHA 4U95A 1HR0J 1C1AA 3J80Y 4K0KK 3GV5B 1N36K 1OPIA 1SVDA 1LW2B 2R7YA 3OTDA 5B7WA 1S79A 1YIJN 5KOXA 2F8HA 1VC5A 5E5NA 3DXSX 1RYSA 3HHKA 3ZSRA 1S59A 2P2CB 4OZ1A 2XYGB 5FLXU 5K5MA 1WB9A 4HYKA 3LANA 4KV8B 4Y28C 1A5WA 1U04A 3V1OA 1RT2A 4C0BA 1K73T 3KJVB 4FWRA 2WSCC 4JKGB 4WQ4A 1TR0A 4RTFD 4LF6K 3V4IB 2CQ0A 4ZKAA 1W25A 4RBTA 2E1PA 5GAHI 4CIOA 1Q9YA 3P5BP 2J0QD 3PO5A 4CTAB 2YNIA 2CJKA 4NLYA 3MAHA 4OI3A 2HSEB 3AHPA 2G13A 4E1MA 4UZCA 1XR7A 2OH2A 1NMNA 2F4FA 3CTRA 3E66A 3AQPA 2W1BA 4BBYA 2MY8A 5KFEA 2FHOB 4YR2A 3L09A 3I4PA 2KO1A 4B1UB 2EG1A 1KS2A 4JB8B 3CJ4A 1VQ5N 3VAGA 1VRTA 4B9LA 3HFKA 1EKRA 4OYPA 2C3YA 4C3KA 1RISA 1W9HA 2NYIA 4LFBK 3CT9A 3LW5C 1VRUA 1K9MO 4AHCA 5H1SQ 3C7NA 1JLGA 2OI2A 4WXOA 3MUVP 3ELHA 3L2RA 3UVJA 3BN7A 2R8JA 2XCAA 1SXLA 3RMCA 1CSJA 2E6LA 3D6FB 3QWUA 2XCPA 1VQNS 2HMIA 3TVYA 2CIMA 1X0FA 1RAIB 2PYLA 5ITHA 1RDAA 2HHHF 2IDOA 3GILA 3ENQA 5LJ3Y 4FF2A 5B0GA 2XY5A 4QOTA 1IR0A 5D78A 4NLQA 3I0RA 4J8FA 1X5PA 4JRPA 1OO0B 2XO6A 1S77D 2YNIB 2WONA 3OYHA 1BY9A 1F1BB 2EFOA 3ZT4A 4HT5A 1MROA 1M1HA 2MEWA 4CH0S 4N41A 1UZDA 3CCEN 2VWJA 3ULHA 1C4AA 4CCHA 1N56A 2WC9A 2E88A 5G4DA 1VQ8S 3PEHA 3FK4A 1EP4A 2JDJA 3MOJB 4NEYA 4C8NA 4IOAL 2QK9A 4Q44A 4I6WA 2WW8A 3O4NA 1N5YA 3W9IA 1VRTB 1P9QC 2NS1B 2NUBA 2E1AA 2ZBQA 2B51A 5MAOA 1V5VA 1JL2A 2YVSA 1T6CA 3MN6A 2MLZA 2L08A 5MLCQ 2OMOA 4YOTA 1HNVA 4IOCL 3JXOA 3WZ0A 5JJBA 4OPKA 4YN3B 4GKJF 1JLGB 3TJAA 1EWRA 4PWDB 2G2ZA 3N01A 3TPQA 4FCYA 1SJ1A 3VOVA 4RUBA 3PG9A 3IWLA 4A8WA 3SAGA 2V8HA 2XZDB 2GWKA 1TYQB 1MN7A 9ATCB 3ZSQA 1VK3A 1M90T 1XNQK 4CLWA 3NVMA 2JEIA 1YRTA 3KKSA 3Q2TC 1S57A 4KBIA 3T41A 4MIWA 2B6AA 3RR7A 3I0RB 2RB7A 1HKBA 4BC4A 1NRKA 4JK9A 5B8HA 1AUDA 3NKYA 3RB6A 2W6KA 3KZBA 1ZZFA 1P90A 1FESA 3MHYA 3FSIA 1RACB 2DPJA 2BKNA 2CPFA 4BR2A 4JKHA 3I9ZA 3VERA 3R8YA 3M9OB 1WEYA 4B3TK 5T7LA 1B7FA 4WU3A 2QKKA 3R27A 3D7EO 4DV2J 3H2VE 4LF8K 4NRTA 5FLXO 4ILLA 3LGMA 2RHSB 4ECWA 2CDQA 4Z7YA 2OD4A 2G0JA 1WC1A 2J5AA 4Q8EA 1HNZK 2HHPA 3KLGB 1KHVA 1HNVB 3MPUB 3GJQB 4FXWA 4X64J 1QVGR 2QI2A 1I3OB 2W2OP 1LW0A 3J80O 2ZM6F 1YX2A 1JWWA 3U1NA 3CC7N 3UCZP 2HVDA 3MCOA 3SXLA 5C2CA 1VBXA 5HROA 1VSJA 2FLLA 4DFPA 3MK6A 3EGZA 1WOSA 1FNXH 3VQQA 2GWJA 2I7PA 2GAGC 2FDNA 4CT9A 1V3RA 4IKFA 3IXQA 1SL2A 3HHNB 4PKGA 2Q3PA 2CKWA 1HW9A 2J0XA 1SAZA 3BM7A 1G99A 4CHOA 4X62J 3OT9A 2A6OA 4AILC 3LM9A 1XHZA 1FWKA 1Q7YT 2P9NA 1JLQA 5KRSA 3EY1A 2UV8G 5T7LB 3CCJS 4KHPK 4K0KF 2IYGA 2NYHA 4DX8H 1TMMA 2YX4A 1N36F 4YDXA 1DQ9A 2B9XA 2Z58B 2JWKA 3TZYA 5CYQA 4QIEA 3CXCR 2OPRB 1NJIO 2RU9A 4YOWA 5K8NA 4ZHRA 4C3MA 4BWMA 3I56S 4YHHJ 2VG5A 4Z7CA 3T19A 4NXNF 4LSLA 1QUPA 3L2VA 3NXZA 2RMLA 1RKJA 1Q82T 4A62A 1ZA1B 1QAIA 5KFUA 3ZFVA 2Z0GA 1LAVA 4GO7X 2F3JA 3HCXA 2WB1D 2KXHA 3AXKA 3G4SS 2F9JA 4M5DA 1X4DA 2PZSA 2WOMB 2VASA 1Q8KA 4ZPAA 3V6DA 1IN0A 2OTLS 2W2MP 3QFWA 2PC6A 1CJTA 3H59A 1QAYA 1NMEB 2E1MC 4AHRA 3SFGA 1RTJB 3VVUA 3WXIA 1KNZA 4P2XA 1P8GA 1J27A 2HHXA 2NXCA 2C3MA 5AXMA 4O3OA 3CIZA 5GAEP 2QL9B 4YS2A 1B9DA 4DR7J 4RLEA 4LFBF 2QEXN 4K4UA 2H5IB 3WIVA 4CZCA 4ECUA 4ZHRB 5AE3A 4JI5K 2MB0B 5AQMA 3E2EA 3S6EA 2WRMA 3GMGA 4BC2A 4LSLB 2UVVA 5JUMA 1EX8A 2R8KA 4RNHA 4M5LA 2RDIA 3THXB 1MU2A 7FD1A 1WC4A 3NHGA 4M3ZA 2G8VA 3RRHA 1K8AT 1NUEA 5EX0A 2KFNA 2YWKA 1VQLN 4DR1J 4QAGA 4KHMA 3LM2A 3A13A 3O1BA 5DQGA 2VFSA 4CJPA 2O8EA 3O3FA 4KSEB 4MO5A 1RA6A 3PW2A 3D54A 3FMWA 4ED8A 2HZAA 4XPEA 1R8CA 1BHLA 2RAQA 3M7VA 1DQ8A 1N34J 2ZWPA 3NY0A 1Y5IB 2XNQA 3LPUA 3BSNA 3D0PA 4Q5VA 1SCJB 3EVMA 4KHWA 4DUZJ 3DCAA 2HRTA 3SSQA 4CHPA 2N7CA 3EDRB 4DR5F 2BVZA 4EEYA 3MAAB 4CK1A 2FSJA 5B0DA 1KAZA 2QWPA 4KGKA 2KL8A 3V1RA 2CQIA 5B09A 3K2YA 4MK9A 2AYGA 5DDRC 4NO7A 3RB3A 2VU5A 2HK2A 5BYSA 4YUDA 3RBEA 3SCKE 4ISEA 1BD6A 4OJRA 2DHGA 1K9MT 4L73A 3N0VA 3G87A 1RHUB 1XNQF 2ZGZA 1JXVA 3B6OA 2OFHX 1MU2B 2C3PA 2ZVIA 3KUGA 4L76A 4IRKA 3VEOA 1R3NA 4I4BA 1RTDB 3C15B 2FXUA 2WCXA 1C0FA 2IVYA 2V67A 4KTQA 1JCFA 3TRGA 4URSA 3TO8A 2XGQA 4F4ZA 1MDUB 3O3GA 2V2VA 1BA0A 4PG6A 5CZVA 3I55S 3CCRN 3MN7A 2RF2A 2YJEA 4RL1A 1OYDA 4LF8F 2BANB 3EZWA 1T03B 3CJ3A 1OY6A 4ITSA 3CD5A 5HLFB 3VQ8A 4B1YB 3KK3B 3VQEA 1HD1A 3F41A 1GTEA 1HNZF 3M30B 4Y34A 2MKKA 1BUXA 2OFGX 3M1VA 5DG7A 3HHEA 2W24A 3MM7A 1FDNA 1E6VA 2HAFA 4F02A 3LP2A 4C3LA 2UXCK 1S5ZA 2PFFB 3ENAA 5F8HA 1RYRA 2G2YA 4FLZA 1U09A 5ETTA 2HSTA 4IRDA 2DNNA 1NHKL 2C2ZB 3IMXA 3GONA 3EN9A 4ISFA 3W5YA 3E8OA 1VDHA 4QPXA 2ASOA 2M70A 4CJ3A 4ENOA 2O8DA 2V69A 3PUFA 1YT3A 4CEDA 1QVGM 1ROFA 2GHPA 3RAMA 4USUA 4DL0C 2J9EA 3QBCA 1Z2LA 4HTLA 3HSCA 3TAMB 2C22A 4QS7A 1VSLA 1ZM4A 5L38A 5A0YB 3K8VA 5HQMA 4KHPF 4G1QB 5JVGL 3HVRA 1NDLA 1K6YA 1HUXA 2YPZA 1FRJA 3MECB 3A3OB 3DRPA 2XHWA 1D1UA 1C2PA 3AA2A 1YVFA 4JKEA 4AH9A 2APOA 1VGYA 4HT7A 3A8KA 3MDQA 5J2PB 1D8YA 2K7KA 1YBAA 2DRBA 4PR6A 4S0MA 4YEAA 3D45A 4ZPBA 5KT2A 3AVJA 3K5MA 5GAEU 1HYSA 2HBQB 4AM7A 4RWWA 2P51A 2B9WA 3CCWA 3E51A 2QJ3A 1BI4A 1GT8A 3SBGA 3W64A 1UVIA 1J5EK 4WJBA 2ZKTA 4DN0A 4CGIA 1KRPA 1Q79A 4JKCA 1GTHA 2HFNA 5M1FA 3HT3A 2PFUA 1E4GT 1JX4A 1TQLA 1RDRA 1KLMA 3RGIA 2H54B 1I3AA 4UOHA 1FXDA 2OLWA 1JLCB 3FZMA 4NMXA 2O8DB 5ETMA 3FZHA 1OQ3A 1YLXA 3MM5B 4FK2A 1G3OA 1VQ4S 2DNZA 1XHXA 4ZVHA 2RE2A 4LFCK 4JOUA 5IWAJ 4NZ6A 4ZTJA 3CF5Q 1S6OA 3M8WA 3IRXB 2E2NA 5KG4A 5AQYA 2RQMA 4DCHA 3MCNA 2I0XA 3VF4A 4OJGA 1AROP 3CJKA 2ZC3A 3E3XA 1C1BA 1XWLA 5IFMA 4JI5F 3KLIA 5D4LA 1M5VC 1UCNA 2W6LA 4H54A 1FX2A 2DNOA 4OLAA 1WD6A 1KQSR 4WCEQ 4DQ8A 3IS9B 3EZ5A 3VCDA 1V6HA 3LUYA 2AJ2A 5HVHA 1TV6A 1BI4B 4FZYA 4ES3A 1W2BR 4FJ7A 2ZH8A 1MWKA 4EAHD 3GU0A 4DXLA 2BJEA 2AWZA 3MD1A 5AXLA 1FO1A 2AX0A 1S99A 3HM9A 1TL3A 2C2OB 1F5AA 3N4QA 2QE5A 3AO5A 2CA9A 1RHJB 1NGCA 5HSPA 3NF9A 3OTCA 5DM7L 2EFNA 4DU7A 3TVKA 1XMOK 4WFAQ 5A8KA 5EWEA 4M3WA 3GFXA 1KVJA 2Q6BA 3IM8A 5CY4A 1LXJA 2J7UA 2DGQA 3QJLA 3QT5A 3HSTB 4RW7A 3K5NA 4A61A 5H1SV 5DM6Q 1N52B 1WDDA 5M2RA 3CJKB 4HHTA 3T3FA 3J7YP 3VQCA 4WPAA 4CEQA 2YWWA 3ETMA 4JV2A 5FRNA 3ZZPA 2DGSA 2XY6A 2OZMA 2XMVA 3KHYA 1YG0A 4TN2A 5CYMA 1IM4A 1Q78A 4FXDA 1TV6B 2QWQA 3CJSA 4ZCIA 2B43A 4HH1A 4MO4A 1DEJA 3OV7A 4H5RA 2XYHB 3TA1A 3H45C 5BPLA 2ZH7A 2CZ9A 2VFRA 1VQYA 1F6TA 4M94A 2J6SA 1F3FA 2G0CA 3PRBA 3T1YJ 4DN9A 1TL3B 3WUHA 1GMWA 1XBWA 4FLVA 4IYQA 2V2KA 3J7ZT 4PYDA 1NK6A 4PQAA 5DGAA 2FSNA 3THWA 4K4VA 3R5JB 2E1CA 3VESA 2CPZA 4A4JA 1NO8A 4DU3A 4JBCA 2XLKA 2PMZD 4QPTA 4IZ9A 4NLXA 2E7WA 1U8SA 4N47A 2KXNB 5A8KB 4TU9A 4LH5A 3TUIC 1BHNA 2WBRA 2ATLA 1RA7A 5MLCV 2R2SA 1BCOA 2ASPA 1APSA 4ZCLA 5KQ8A 4BHQA 3SQ2A 5F41A 2IPOB 5CD4H 2GVZB 2H48B 4X65J 3KMSA 2AD9A 2N3OA 4O4GA 1GFWB 2LKZA 2UXCF 1OIAA 3VQBA 2JGUA 3C14B 5FDLA 3D4JA 3KLVA 1BQMA 4LRAA 5F0WA 1H72C 2DISA 3R3TA 3ZTSA 4GVLA 1Q7LB 5HP1B 4NXMJ 4ALZA 3ZETA 1VIXA 3MM9B 5EX5A 3BZKA 5EDWA 4LUBA 3WHIA 1X4CA 2RJZA 3JQKA 3RRKA 4HR2A 4LH4A 1WACA 3OA9A 3S3MA 2VG6A 4AUKA 4B9NA 3QAUA 2PMHA 2LCWA 2DK2A 3RSEB 4A47A 1M5SA 1RU2A 1S6UA 4J9PA 3DJCA 5DZ6A 1QSSA 1S1TA 4CH1A 4DS4A 3UN5A 1FKPA 4GKKK 3R5AA 4CERA 4RJVA 5LSOA 3MPYA 1OJ4A 2ZBPA 1ACMB 3B6BA 1Z05A 3H5YA 3GJSB 5E3PA 3VTIA 4KI6A 2QL7B 2MJNA 1J5EF 1NGFA 1UTAA 2ZHOA 3KK7A 1VYAA 2FLPA 1S6QA 3WXJA 5FDLB 3MWBA 4NWBA 4UT4A 3PIPQ 1BQMB 2WTUA 3ZT1A 2QFIA 2HIQA 4FJMA 1O51A 5L1IA 1ESVA 2OKQA 3OUYB 2Q43A 3W5XA 4NYZA 5HVFA 5JMVA 3DMJA 4A8MP 2G8IA 1B99A 4FWQA 4YY3K 1BDGA 1UL3A 2RKIA 1VQ9N 4AM6A 4LFCF 4HACB 3P5TL 4HHUA 1F3VA 3LPYA 2QLBB 2VG6B 1UVLA 4C8YA 4ED5A 1NG9A 5J2QA 4BRPA 1SH2A 2ZJQQ 2OCEA 4CLSA 2LSNA 2PA8D 5DJBA 5KT7A 3OL9A 2HFUA 3QRRA 3SK3A 1EETB 3DOLA 2M8DB 4DSIA 4W92B 3VF2A 3VQAA 3J7AP 3LZIA 4BVOA 1QZ6A 2NQPA 1LWFA 1NSPA 4RU9A 1IBLJ 4M3UA 3EWGA 3WBZA 3G6EN 1S1XA 4WP3A 2R8IA 2XTJP 4ETXA 3M6VA 3DLLL 1YDLA 1HW8A 4P7VA 5K14B 1S6QB 1S72S 2Q97A 1F5CA 1MWQA 3J7YU 3DXMB 1XMQK 3DHXA 2QX0A 2ZBRA 4JYAK 4B9VA 1XQSC 4IDKB 1N54B 2CADA 2A42A 3IUCA 3M8YA 5M1KA 3S9HA 1E6YB 1RWKB 1HWIA 1XEZA 3HI0A 5J2MB 4F3MA 5EHHA 3ZTRA 3SNNA 3ASMA 3PLAA 3CDBA 5ADZA 3T5LA 4CD3A 1I39A 2RKIB 3E01A 1HBOB 3UB5A 1SZ2A 2KFYA 4ETZA 2XEXA 1C6VA 1QJHA 1CXQA 3U3YA 1VQ7N 3M8RA 1W2BM 1K44A 1XMOF 3AA4A 5M2PA 1FRXA 1IUJA 3PTWA 2U2FA 3KHHA 3N6NA 4K7QA 3QETA 2JSXA 2HW3A 4Z94A 1AXQA 4DR2F 1X4BA 4QIVA 1UFLA 1I1GA 1WC0A 2MQQA 3R5CA 2ZJRL 5AFUH 2M7SA 4NI2A 1LWFB 1NH8A 1HNIA 2I9SA 5K8MA 5IT0A 2AEFA 3LAMA 1YJWN 4K4TA 3M32B 2F8TA 3LDOA 2B5JA 2HZVA 1RJJA 2WW4A 3QESA 1RTHA 8RUCA 1MWYA 4O23A 4DTOA 4FNHA 4EHUA 4PXEA 3JSMB 5K9FA 1F5BA 2C2RA 1RCXB 5B0EA 3TOQA 3O3HA 3CDAA 3KLFA 5F9LA 3C6TA 4DCOB 2MSSA 2VV5A 4IKAA 2HPUA 3HPOA 1NHUA 4EYIB 1HBUA 2GELA 4QIGA 3SQ1A 3IA0A 2X6NA 4IH7A 2NRWA 4OI1A 1PJ7A 2IOCA 4USKA 1B4SA 4HHJA 2HFSA 4DLGA 4ER8A 4FZZA 3W5ZA 1HR0K 1WHVA 4M7YA 5F0UA 2OYQA 1UPPA 2DY9A 3WXKA 4X4UA 1SUQB 1HBMB 2V5HG 2FVCA 3D1OA 2F7TA 1ZBUA 3HD1A 3Q8UA 2VB6A 2C2DA 5E3CA 3L4IA 4YOYA 3AVKA 2AV5A 3QO9A 4DPYA 3M2VA 4I7FB 1T9VA 2V68A 2V9WA 4NI2B 2VA3A 1HNIB 1RWNB 2RT3A 1G2EA 4CO3A 3DRRA 3NGUA 4L6V3 3QEVA 1RTHB 3O3LA 5ETRA 1MG7A 3SLCA 2DNKA 2GVDA 5AQSA 1MMDA 3TUZC 3W2VA 4RW6A 1DTQB 1RGVA 2V50A 3DAWA 5KI6A 3C6TB 1HX1A 5CYJA 4O0NA 2JWNA 4MKVA 3I33A 1WSIA 4NLPA 1KFDA 3TAPA 3DC2A 3PHEA 5C5JA 2DGXA 3LWMA 5EXWA 5KFQA 2V94A 3D1HA 3FFIB 2QTDA 2HQIA 3OHAA 1C0UA 5KFDA 1N8RT 3HJFA 2WTFA 2RQCA 1WOOA 3PM9A 2RRBA 3ICLA 2ZJPQ 1TKZB 5AQJA 1LWEB 3R6GB 3P96A 1R89A 1RAJA 5IQ6A 5LMNJ 1NKEA 4PG8A 3D2EB 1OSDA 1ZTWA 4GKKF 3AH6A 4DQPA 4ECZA 2VYPA 4USWA 3OVNA 1J5OB 4JI1F 3T5KA 3OFGA 2ZZNA 3AVMA 4WE1A 4UF4A 3MOZA 3I8BA 4CYUA 3K5LA 2ZH5A 3RRGA 3DWLA 3C19A 4FWSA 3QIPA 1XC3A 2W7OA 2YKQA 4ZVQB 1REVA 3IR5B 4WYLA 1S0NA 4C11A 5KT5A 3V81B 1X7VA 2IM1A 4YY3F 1KBRA 4EBDA 1QQMA 1EAYC 2HRYA 2G8HA 5LJVA 3NAIA 4M5IA 3BGOP 8ATCB 2DIUA 2V8GA 2JEJA 2NUHA 3HVWA 3SSSA 1N88A 3MR5A 1S1UB 3J81U 3GYGA 3HOSA 4LQ9A 4FJ5A 1RT6A 4J7CA 4M5MA 4CFAA 3RW6A 4OQJA 3SUPA 1JLBB 1NNEA 2K3KA 3PSFA 1CG2A 3VGUA 2C28A 5AE1A 5KFHA 1I94K 8AT1B 3LL3A 2QA2A 4PAAA 2FF3B 2ZHBA 4DB3A 1VS3A 2ZKUA 1QTMA 1OVYA 1CZBA 2KG1A 2CPYA 3CCTA 3JSBA 1NGIA 2BZ2A 5BPMA 1SBRA 1FRIA 3H7HB 4URQU 3CCSS 3BKUA 4J37A 2MQLA 2BUPA 2XY8A 3LP0B 1XMQF 3M2UB 3Q23A 3MCAB 1BU6O 3ZSYA 4OZ5A 4JYAF 5D3GB 1AA1B 3UN3A 4Z2XA 1UZHA 2IVOA 4V19S 1KTVA 1JJHA 2IM0A 4V19J 3KWGA 2QWRA 1REVB 4C11B 3L7UA 2O4GA 2HFOA 4RPFA 2CVIA 1CJKA 4EO8A 2XMMA 2KG0A 4OHWA 4R8UA 1S4EA 2AHOB 4YB1P 2Y1IA 3JYTB 3KUEA 4HLBA 5E7OB 4GV3A 1S7HA 4LJMA 5F8IA 3ZX0A 1NZ8A 2HGMA 4FWMA 1TUWA 1FEEA 5HQ8A 4DV2K 1O5JA 3FZKA 2GV1A 2A3JA 3K0JA 4Q0BA 2QWNA 4X4NA 5HRPA 4KFBA 3D2FA 2K8GA 1VSIA 1XNRK 4U6PA 4I2PB 5DGBA 1RT1A 1KOHA 2MKSA 5HRRA 1DTTA 4A2BA 5HN0A 3SQOP 3FRYA 4M42A 4X64K 4DUYJ 1NOZA 3OY9A 3AQOA 3CJ7A 4JV0A 4FKYA 4BR0A 4OPJA 3I5AA 3LTOA 2VWKA 3OL7A 4M7XA 4X4TA 1UVKA 1FI4A 1X60A 1HQ2A 2J9DA 2M52A 2ZH3A 5AZIB 2VBWA 2F7VA 3DLHA 4UOGA 5ELZA 4LVNP 1DGKN 2DNQA 5C42B 1RLDA 3LGHA 4E19A 1U2FA 2E20A 2KHOA 4X62K 2VQFJ 4EUVA 2FC0A 1ZA2B 3POTB 4NLCA 3MEKA 3WC0A 4LBIA 3MI7X 3L2QA 4IO9L 1CS4A 3TJ9A 2KT5A 3HL8A 3MZIA 1HR0F 4JKBA 3ISND 5KFWA 3QFPA 3KIOA 3OXLA 3R7SB 5HANA 5LJWA 4DUTA 5KPRA 4DV1K 2VFTA 3EL2A 1NH7A 3D2FB 4YQWA 4RBVA 3PNIA 2KW4A 2HEKA 2D1CA 3JSYA 1HBNB 4YHHK 2QA4N 4DTMA 4C0HA 1MLAA 1VBKA 3AY0A 3C6AA 1ZAXA 3W66A 1GX6A 1S10A 2BQ3A 4DTPA 1BQNA 1B0VA 2VCPA 3NFAA 1U2RA 4ISGA 5L9XA 3CCUS 2P8IA 1MW7A 4J9NA 4XDDA 2QWLA 6AT1B 2MXYA 1WTFA 1KONA 4KY3A 2JC0A 3LGNA 5BR8J 1NNDA 2FVPA 3FUYA 1TKTB 1WG5A 2P9IA 2AJQA 1JIHA 3ONQA 4IUFA 2DR7A 2W9BA 4DEZA 2YKOA 1UJ6A 4RNMA 2DVIA 2M4MA 1K0VA 4LF2A 1EQ0A 3IG1A 4BQLA 1PC5A 2AZ3A 4HDGA 2MSTA 5F8MA 1GX5A 3S1TA 1K1QA 4DR7K 3MPDA 5LJ5Y 1EKSA 5IV3A 4ED1A 1L3VA 3ZTQA 5F2RA 1SJ4P 2DGTA 1U47A 4H0XB 1ZM2A 2DR8A 4LF9J 5DK5A 5ETKA 1EJ7L 4DV7K 2V34A 3PKYA 5CA5A 4OX8A 4DCJB 3Q8YA 1Z25A 3K59A 5F8NA 2ASDA 2YNGA 1YTYA 4CF8A 4ZPDA 3AA9A 1TKXB 1EIYB 1P8ZA 3WT0A 4CJ4A 1IG8A 2HK3A 3R97A 2DB1A 2XMKA 3MMVA 1S9EA 2E44A 2EVZA 2QGFB 3CQXA 4BREA 1IKYA 4CM2A 1HJOA 3O5BA 2HNDA 1T05B 4J5OA 3KVGA 3THTA 2XO7A 1VSDA 2E5LK 3ZSZA 2E7XA 1YSJA 2P9IB 4ZVSB 2HWTA 1UMJA 3MM6B 4K59A 3SDEA 3DYAA 1FKOB 3IR6B 4CJRA 3GFYA 3CJRA 5M1OA 1GAOA 4DX5A 1N34K 1RU1A 2LMIA 4Y0FA 1G15A 2FYXA 3VGMA 4FF3A 3LOUA 3P1GA 4DUZK 2GHWA 1K8KA 1HQEB 2DRDA 1RQ0A 4K50A 5HBMA 4E89A 3FZ2A 2W2NP 4KB7A 3BO2A 4L8RB 1VQNN 3SAFA 1N0VC 3GYNA 1I94F 1JKHB 3FSXA 3OS0A 5E26A 4IJAA 4USJC 4G65A 5CQGA 3WC2A 4RWTA 3SV3A 2KU7A 4UUXA 4X4OA 2VIHA 1KOOA 4G1PA 5KFMA 1UJ4A 3W0LA 4EGLA 1NK4A 1S22A 3BPDA 5CCLA 5FJ4A 4MK7A 1S9EB 2YXLA 1FXXA 1TP7A 2IS3A 1IKYB 5TKYA 4OV6A 1ZZNA 1W7AA 3DGPB 4BC7A 3I32A 4IOAQ 2G8UA 3OJSA 1KC8O 3KYLA 5IT9U 1HL6A 3H5XA 4XPCA 3ITHB 1YKWA 3M5RA 3EE8A 3ZTPA 4KHUA 2W2PP 3T6JA 3M9MB 2HG4A 4IOCQ 5THWA 5GINA 3VQ9A 2OAUA 3EPGA 4MIAA 4DV2F 3SPYA 2VGMA 2YWHA 4YDUA 3P31A 1XNRF 4ZVTB 5HBMB 2D3ZA 4LQ3A 4CJSA 2ALZA 3DI6A 3OD2A 4F2RA 4YR0A 4DFJA 4X64F 1W26A 2XSFA 1FEHA 2JOQA 2Z4PA 2LXUA 2A6AA 3RTVA 2F4VJ 4RWXA 4TYBA 2VWBA 2V9KA 3L8BA 2PA3A 3QBXA 2BJ1A 1H7XA 4OGCA 3P3DA 4GO5X 4KH6A 4U9RA 5F3ZA 4FYVB 3IKMA 3IGNA 2X74A 3O4QA 1FFGB 1U49A 2UUWA 5AQXA 4CBWA 3CE8A 5KFSA 2YTCA 3KLEA 2XZTB 3UWTA 5KFRA 4TYAA 1CQMA 2YH1A 3L7OA 4X62F 3DLJA 4F0HA 2RUSA 2AF6A 2H3GX 1K1SA 3DOMB 3EZUA 2Q79A 2E5IA 3UQSA 2Z2YB 4RNNA 1Q0NA 1VSFA 3QT6A 5E33A 4ZA1A 2A1BA 3MM8A 1NGBA 2C2KB 4DV1F 3QICA 3UD3P 3U02A 4F3TA 3A5LC 4WFBL 3DI6B 1TAQA 4YHHF 2D4WA 3KHLA 1ATRA 4IWVA 1NOYA 2YWEA 2OPPA 4JHDB 5J2NB 2FLNA 3M8PB 2BEFA 1Z4UA 4ZP8A 3VEVA 4BY9C 3TVZA 4DPTA 2IJRA 1RABB 2Z1IA 2V7YA 5KFFA 2GO9A 1NBWA 1AFIA 1PSDA 5D4OA 2E1ZA 1TL1B 1A0OB 2WVBA 2ZOFA 1TL5A 2QXFA 2A1SA 3RU0A 1OWXA 2W2QP 1VHXA 2BE2A 2GGPB 2KXFA 3M8SA 3KJFB 3NF7A 3KLEB 2E9ZA 4ICLB 3JS6A 4F9OA 2AJ1A 1Y4ZB 1K0TA 1EX4A 3CCJN 1NLVA 2UUBK 2RQKA 1HWKA 2CGKA 3T5HA 4PY5A 2LA6A 2MQOA 1WWHA 1DURA 2GUPA 2BX6A 2HLTA 4ZVFA 1FW6A 1XK8A 4ZLJA 4DR7F 1Q16B 4KREA 4ELVA 2P9UB 1IH7A 3I56N 2DFFA 3MM8B 1TUVA 1Y10A 3H40A 4JI4J 2D9PA 1WSEA 1HPZA 4Y2MA 4BDPA 5A8WB 4CO2A 3ZEUB 2WSEC 4DV7F 5CHIA 1E3MA 3EE9A 2OPPB 4DV0J 4DSLA 4NB4A 3I9V9 1RT5A 4GMJB 1X5TA 3DLBA 1RT3A 4PRFA 3VVTA 4HCCA 3GSIA 2MQMA 5J1PA 1UVJA 2ZE2B 4CEEA 2I5JB 3R6LB 2R7QA 1VBZA 1CJVA 3G4SN 1HHTP 2EHGA 3SAHA 2DNRA 4A8QA 2E5LF 4CEZA 1RWWB 2Q31A 2ZBIA 1BOTO 3PR4A 3KTQA 1FRLA 2HBRB 2IAJA 3C94A 3UCUP 2FVRA 3MCMA 1LOUA 2HKEA 1Q8BA 2C1EB 3U9ZA 2LDYA 2GC8A 1N34F 5FPMA 1RBOB 1G6BA 3GE9A 3H46O 4M63C 5F8GA 3KLHB 2YNHA 4DUZF 3O6QA 1WSGA 2BRKA 2QM1A 2Y8YA 2FZCB 4URGA 2F9TA 3MR2A 5SZTA 4WZMA 4KB1A 4QZVB 3SUNA 4PXDA 4IEEA 4FF1A 1IR2A 3OR1B 3RBDA 2F8MA 2MGZA 3BH7B 3AD7C 1ZYQA 4JV1A 5AQNA 5KGWA 3OYMA 2Y8WA 3CNQP 3H3OB 1FJCA 3W65A 3L4BC 1RT3B 2H5JB 2D3OR 4KAZA 2HBYB 4KO0A 2XS7A 4KRWA 5CH7B 2BUNA 1A6LA 3NF6A 4ANCA 4JUZA 3D2WA 2JVOA 2OP5A 3TUPA 5GIPA 2ZD1A 1L3UA 2YX6A 2W8KA 3MCSA 1LAWA 1O1WA 3OLBA 3EDQB 2JZ5A 3EM1A 3VEXA 2IAJB 4ZP9A 3C0BA 1YBTA 4CZHA 1GOAA 3CCZA 3PYGA 2PT0A 2X1GA 4TY8A 2CWKA 3E9LA 2LEAA 1RSCA 4PEOA 4I9LA 4R0JA 3D3BJ 2XZWA 4A8OA 1GLJO 1SJQA 2DHHA 4HUEA 5ADXA 3QFUA 3SQ0A 2WVCA 4UUWA 4PZVA 4ED0A 1A5XA 3TEGA 2IJNA 2ZNZA 1V5IB 4W4MA 3JXUA 3A2FA 4JK8A 1M1KT 3N6MA 2E1RA 2G1HA 2V4JA 3HP6A 2DRAA 4B1WB 2IVNA 4JD2A 1ZBTA 1WEZA 2BJDA 4BCAA 2R3VA 4EI2A 2QA1A 3OTOK 1WELA 4PA1A 2DGVA 5JVHQ 4FK0A 1TFWA 1CJUB 1NEEA 3HHLB 1K73O 4RBUA 2FC9A 4MT1A 4BGAA 3I55N 1SQGA 3VAHA 4C4WA 5HQLA 1IQZA 4K4SA 2D0OA 3KG0A 1LXNA 4K41A 3ENHA 4L3KA 2CAJA 2I38A 3BF4A 1XQIA 3EMTA 4O0IA 4OL8A 4I1TA 4TY8B 3VAIA 3MMCB 2ZH6A 1VQMN 3V2UC 4CT8A 2DPIA 1VSHA 4QYRA 1Y3JA 2O1PA 3FFKB 4YORA 5CZXA 3C8YA 2EG2A 4R5PA 3NGKA 4GKJJ 1UP1A 2RRAA 3O4WA 4KHYA 3TZWA 1C1CA 2B9EA 5L1LA 4F0KA 2UZAA 3O6WA 3CC7S 3H5UA 4ANEA 2DGWA 4Y3CA 1EB0A 1VOMA 2P9LA 5C24A 3R3LA 1H7WA 4P73A 4ECYA 2J8SA 3N4WA 2IDEA 3H2UB 3AOBA 3VF6A 1VQKS 2FUG9 1RE1B 2UUBF 3CMAS 1LK5A 2BQRA 3D0HE 4A59A 1JLAA 2OANA 4QW8A 4J9OA 1KP6A 4KJIA 3H08A 2HVEA 3T9NA 3W8PA 1WSJA 5L46A 1GK8A 2BABA 4DCPB 3T9ZA 3C16B 3D5MA 1CULB 3VGVA 1JLFB 4IXCA 3MDFA 2DY1A 4J90A 4BC5A 4BG8A 3MN9A 2XYPB 3NCRA 1WC5A 1Y7PA 4R5PB 4DBQA 5EWFA 2AP1A 1LNQA 3HDSA 1HD0A 2RD5C 1WG1A 1VSMA 2PI5A 4GC7A 1C1CB 3G96A 2VJUA 1YTUA 1VMBA 4N76A 3MR7A 4DQRA 3PEJA 2YHXA 3F5TA 3NE6A 4U7BA 2ROEA 3L2WA 1ZM9A 4A2AA 2P9LB 5C24B 3KJQB 1X5OA 2EFGA 2EX3A 4RW9A 4KQZA 4LVOP 3AVBA 1BQXA 1VQ4N 3CJ0A 2UUCJ 1RBRA 4BRKA 3PYEA 1JNRB 3O9SA 3PSIA 4JS4A 5K20B 3QLHA 4DU1A 1XI1A 1M90O 2LEBA 5L1KA 1FA0A 1VK0A 3MCPA 1QM9A 2KQ2A 1NU0A 1H38A 4K5SA 4FW1A 1U24A 1IKVB 2R2TA 4QR2A 5B08A 3AO3A 3LA0A 4WP8A 4AE5A 3OYLA 2HQDA 4CF0A 2X7IA 3QGPA 4DTJA 2ZDOA 4UY8T 3WIUA 2WAQD 3TSUA 1WOPA 1QVFR 4JRQA 4NEZA 4OPHA 2R7XA 1TK5A 3WNGA 2FBYA 4ZVRB 1C0MA 4MQ3A 3Q86A 1YVNA 1U1QA 1UFKA 2CQCA 3ZZYA 2YHAA 5A76A 4FSVA 5T14A 5D0EA 2FY1A 3O5TB 4YP3A 2ATQA 3G6VA 2PYJA 3LP1B 1FWLA 2IY5B 4Y2KA 1YITS 1UAXA 4LF6J 2MKIA 3GLJA 2B4OA 3VAKA 2EK6A 2ZWHA 4CP5A 3BGRA 4IH6A 2EKNA 1U25A 4LIWA 2KYXA 3IBWA 1QSLA 4Y2CA 1RT7B 5DM7Q 3T1YF 3HI9A 2IFXA 4O3RA 1R6VA 3W60A 4V19X 1GQEA 4BRLA 2P5GA 2ADBA 2IGIA 3A0IX 4RW8B 3FR0A 4A57A 1SJ3P 3VEWA 3CMQA 3CWJA 3R5GA 3CC4S 2DGUA 3QLHB 2EKYA 3VAJA 3RVCA 2UV8A 1Q1KA 3KG1A 4DV3K 2CQPA 2OPQB 3KKRA 4L72B 2GX8A 2RQ4A 4LT6A 4CO4A 1RTIB 2A0FB 2BJ9A 1V4SA 1SV5B 2A5XA 1YI2N 3GFZA 2KZMA 1NU4A 2R8GA 1Q7YO 2D1KA 3U4LA 5HATA 4I69A 5KFNA 1R8AA 1RDDA 4W5TA 2XI3A 4KH1B 3NMRA 4IG3A 2EBEA 2QFJA 4M3YA 3OS2A 1X9SA 1TK8A 2GBZA 3MMAB 2ZITA 5EGYA 5KG7A 2J0SD 1WSRA 4U67L 3OTOF 3M4XA 1NGEA 4IH5A 4O3QA 3E9OA 3A8JA 5A2QY 3HM8A 4F25A 1KVCA 2UVRA 3SCIE 4O3SA 4NXMF 2ROGA 4L74A 1QSYA 5HJXA 2R7RA 2V4RA 4JV5J 4OFZA 1M5OC 3S3NA 1DFDA 2AX1A 1T7PA 5GADP 2NSBA 3K5PA 3O80A 3MEDA 1RWPB 3SFUA 1Q82O 4KV8A 4MYTA 2IC3A 2MJUA 1BIZA 3SQGB 2Q36A 3WNHA 1NB2A 2MHEA 2FHJD 3AA8A 3KJVA 3CB4A 3QJJA 4M5GA 4DU8A 4KHNA 4AXIA 3JTPA 4DMZA 4WZQA 4YFUA 2LFVA 4CJ5A 4OI0A 1KQFB 4J9KA 3BKTA 4CLKA 4BC9A 3J7YI 4CTAA 3FEYB 4Y0WA 4FJNA 1V3ZA 1J2VA 1VHFA 3RWUA 2HQFA 4B3OA 3KUHA 3L0QA 4CFDA 4P10A 4IG3B 2L48A 1ZBFA 3SIPB 2J0WA 2BDPA 3G10A 1H2TZ 2DH9A 4GNIA 3Q0AA 5I4MA 1X9JA 3NDKA 4NA3A 3MUTP 2ASLA 3K57A 4WIIA 3TJ8A 1OS5A 2YY3A 4RW4B 2NRRA 3MTKA 4CHZA 2ADCA 3IWXA 4NLGA 3MEDB 2QA4G 4HTJA 2YKNB 2E5HA 2Y1LB 1DKGD 2IC3B 4NXNK 2FJAB 4M5NA 4P52A 1FXLA 3AB4B 1VQPS 2FZGB 1U1LA 3OS1A 3ILOA 2P9SB 1K8AO 4B3TJ 1FK9B 3RJMB 1VBYA 1DT9A 3TAGA 4LR7A 2FQQB 1RT4B 3NOGA 5ETOA 1YBUA 3LALA 4CHYA 1Z1ZA 1IKWA 1UETA 2BRLA 4Z4FA 1P9YA 1YWXA 1ZS6A 3K7RA 4DSJA 2EFQA 3OW2M 2VBZA 4WYBA 3VEZA 3TUJC 1HNZJ 2UUAJ 2HHWA 2BKOA 2Q3SA 2AGPA 3CCQS 2I8EA 3UKUB 5HK4A 4B3OB 4C2MA 3OFHA 1SH0A 1NK0A 2EK1A 3IC1A 5I3UB 3IFRA 4ED7A 1JXLA 1U1KA 1KN6A 2YBVA 3BQ0A 4BG9A 2RS8A 3CFPA 1H6KX 4BDYA 2AJFE 1FERA 4CJLA 1X5SA 3PY8A 1A5VA 1MMNA 5CHCB 1V9OA 4FLTA 3U1LA 4EZ9A 4QYZK 4F67A 1U1PA 1IBKK 2OIHA 5KG1A 1FJEB 3FBEA 4BR5A 1KWMA 4F04B 2IA6A 4TKTA 4PWDA 3IDHA 4UQGA 4E3SA 4DZ6A 1ZTTA 2HS4A 3JTOA 2IYIA 4AD6A 3HZEA 3C6HA 1TYQA 3AFGA 4KHPJ 4LBPA 1SQFA 3BZCA 4Z4CA 4EP5A 1IKWB 2FGCA 1F2HA 4IBNA 2XS5A 3KWIA 2XS2A 4FJJA 4F0MA 3TA2A 1Z2ZA 1WC3A 3CF5L 4IEIA 1F9EB 2MQPA 3UO0A 4QIFA 1VRQC 1HQUA 1B9FA 1S72N 2F9DA 1CZAN 4W5NA 4YB7A 2PFDA 4ELUA 2FPHX 2Z2LA 3TX0A 3UIQA 3MR6A 1OH5A 3CCLN 1NGDA 4OKKA 3CCMS 4C1NI 4DKWA 4CHNA 3PACA 1QVFM 1DHMA 1T3OA 4DR5K 4CEAA 3KLGA 1KVAA 4F3QA 2GX9A 3VEYA 2VQFK 4CD1A 4FXVA 4P6QA 1NDPA 5GAGP 4LF1A 2VDHA 1RAHB 2J8AA 4UOFA 4DL7A 3LDLA 4CZFA 3CDWA 1YXQA 3PDNA 5A2QO 2HF4A 3W2WB 2VPYB 4DV3F 2WZ1A 4LR8A 3VZIA 2EXUA 1UVNA 5GADU 2B8PA 2HB5A 1AZSA 5TKWA 3ZCMA 2FVQA 3MXMA 1Y5LB 4JI2J 4NYFA 5ETLA 5L8RC 1IJJA 1IBMK 1WSVA 3IBFB 3WXLA 1RDBA 4FJKA 3CD6S 5AQGA 4WFAL 4ZK7M 5E2QA 4A8SA 2GA7A 3RBXA 1HQUB 2B8QA 4E7LA 1V4TA 5JS1A 4DX6A 2O8CB 3ULEB 2VKRA 5DM6L 3HF5A 1WTBA 4JI6K 3ZYYX 1JLEA 2AYMA 4UOCA 2I2YA 4M95A 2FJXA 1PBAA 2MKJA 3DXBA 5BR8K 1LOTB 1XMBA 3VGSA 2VGNA 2KTQA 5F3TA 2L9WA 1GLEG 4QQBA 2OPRA 2WBMA 3SCXA 3AO4A 4V1Ak 5J1EA 2CRLA 4MAKA 4CECA 4FS2A 2HQCA 1OSCA 2E2QA 3B4MA 1HNWJ 4KIAA 4FM1A 3KJNB 4B3SK 2E9RX 3S8SA 4OKEA 2NUUG 3AXMA 4YB6A 2CXEA 1AZSB 4QJVA 2DO4A 3V6JA 1L3TA 1X0PA 2YKPA 3V1QA 3NWGA 2W01A 3GQCA 2WOMA 1YRUA 1NGGA 4RKUC 1D4XA 4JAXA 4TU8A 2PN6A 3M05A 3K8WA 3BDPA 3DM2B 3MF5A 1PCAA 4H5NA 4PUOB 1RTJA 3BO3A 4DTRA 3ZSVA 4CJFA 2RHQB 1WNSA 3RAQA 4NA1A 2QW9A 1U4BA 3BP8A 1JLEB 1KTQA 2KZZA 4E7JA 1OQ6A 2JL9A 3Q89A 2G0IA 1KDNA 1QDUB 5SUHA 1FJGJ 2AQ4A 1NSAA 4HCBA 5J1EB 2ILYA 4MLEA 1FFWB 3MD3A 3C2PA 2KHCA 4K8ZA 2Z1HA 3DLGA 3RYLA 3IBCB 4CEOA 3NGTA 1T94A 2L9DA 3UN2A 2QLWA 4OLPA 3V9XA 4E7KA 2FTRA 3THXA 1Q81T 4K43A 2BE9B 4P72A 2NPFA 5SWMA 4KHSA 3PW4A 3I5BA 4FZVA 1RBVA