1HNIA

Structure of hiv-1 reverse transcriptase in a complex with the nonnucleoside inhibitor alpha-apa r 95845 at 2.8 angstroms resolution
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 reverse transcriptase in a complex with the non-nucleoside inhibitor alpha-APA R 95845 at 2.8 A resolution.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
total genus 130
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hniA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hniA05
4CHQA 5KFSA 2OPPA 5CY4A 3V4IB 4FBTA 1TKTA 3GV7B 4URQU 1JL1A 2P1JA 1LW0A 4QAGA 1ZYQA 4Q8FA 4MIBA 2FJXA 2JEJA 4FS2A 3LPTA 5F8IA 4DL3A 4KREA 3HP9A 4CEQA 1N6QB 2GIRA 4K4XA 3G6YA 3DLEB 3OS0A 3BSCA 2QKKA 1JLCB 2AWZA 4ZP6A 2VG7A 4E3SA 3RBDA 4KHYA 1JKHB 1CZ9A 1RTDA 1W25A 2W9BB 4ED8A 4CERA 3MR3A 4O3QA 4M3XA 3QESA 5KG1A 2JLEA 3MAQA 3CFOA 2LSNA 3TANA 4RW8B 5SWMA 1R0AA 3E51A 4J2AA 2C2EA 4H4MA 4ECZA 2BGGA 1T03B 4CJRA 4CJSA 2OPQB 1T94A 3OL8A 3VQ6A 1NK5A 3NGIA 1MU2B 1VSEA 3BSOA 4KHWA 4DTSA 4PQUA 4IRKA 2FC0A 1C1CB 3RR8A 4GMJB 2C2DA 4QW9A 3KLEB 4DL4A 3KK3B 1S1XB 4CHOA 2HWHA 4CIGA 2YNHA 5KG4A 3AVLA 2ZD1B 4FYDA 4ELVA 3HPGA 1N6QA 4DMNA 3Q8RB 3NF6A 1D9DA 1TAUA 5KT7A 2J6TA 4TQRA 4M45A 1Q8IA 3NL0A 3VQ8A 2XHBA 1HQUB 5DK5A 4IG3B 1HRHA 4Y3CA 3C6TA 4FZYA 2PYJA 5HRNA 1SH2A 4K4TA 1S6PA 4Y1CA 4H8KA 4DFMA 1X1PA 3NAEA 2W9CA 4CCHA 4G1QB 3QEXA 4CGGA 1C1BA 1RBVA 3CDUA 1NKCA 4WFXA 1TL1B 4DF8A 1IO2A 3THVA 4R5PB 3LP1A 1JL2A 1U04A 3NHGA 4F2RA 1RDRA 3O3HA 3KLHB 4URGA 4Y2CA 3KLFA 4KO0A 4KI6A 1KHVA 3BQ1A 4Z4GA 2FBVA 1JLGB 3SYZA 1WSFA 2OZMA 1HYSA 5KFRA 3TWHA 4KBIA 3G6VA 1XHXA 3H98A 1WN7A 2XWYA 2QE5A 3CJ4A 3DM2A 3V6JA 4F3OA 4AHCA 3IRXA 4C8OA 1GOAA 4FJMA 4NCAA 3DRPB 4E1NA 1S5JA 4IKAA 1QQCA 5J2QA 3OYJA 3ISNC 3EYZA 3QNNA 2IAJA 4HUGA 3PVXA 4M3WA 1VSJA 1HQUA 2VG6B 1LWEA 4CEAA 1JXLA 4CJ4A 3QERA 4IFYA 3PZPA 1S6QB 2XI3A 5HRPA 2HHWA 4B9UA 1BL3A 3KD5E 1T03A 3MXJA 3LANA 5J2NA 1S1UB 1XR6A 4QCLA 4RW7A 3D0PA 1T05A 4XIUA 4FVMA 4OKJA 4R8UA 4AH9A 2HMIB 2D5RA 4ED1A 3M8QB 3P83D 4CJEA 1X9WA 4IDKB 3BQ2A 1HQEB 4IFYB 1NK7A 2QXFA 5L1IA 5DGAA 4FLZA 4ECXA 1A5WA 1CXUA 3VQDA 4W5RA 3VN5A 1TKTB 3U3YA 3KLIB 1BQMA 4TXSA 3M9MB 4ECVA 2D7SA 2KW4A 3UIQA 4ED6A 3KJVA 4QPXA 3ZSZA 5KGWA 3L2QA 3TAPA 2VWKA 2YHAA 3LZIA 3KLGA 4DSEA 3CJ3A 3QO9B 4CFCA 3AA4A 3K5NA 3LP3A 5KRTA 4DU1A 4KHNA 3ITHA 4OPKA 2JC1A 4TY9A 2E4LA 2O5DA 4TYAA 3GQCA 2HAIA 4KB1A 3QEVA 2E9RX 4M42A 2OYQA 4CESA 4RW6B 3MEEB 1K6YA 2YNIA 3LP2A 2X6SA 5KRSA 3OYIA 4O4GA 2XGQA 1SH3A 3SUQA 3HVAA 2IM1A 3TI0A 1U4BA 2W9AA 1B9DA 3MXIA 3VQ4A 4EZ9A 1TKXB 1S97A 2YKMB 4MKAA 4WYLA 3SUOA 3Q8PB 5HRRA 1BI4A 4M94A 1QSYA 4O44B 2IC3A 2BRLA 2DFEA 4E89A 5D3GB 1FKPB 2QV6A 4E7JA 2FVSA 1OS5A 4WFYA 4RNMA 3LPUA 3AO5A 3NAHA 3KK1B 1S1TB 1S1VB 3UQSA 4FZXC 1RT1A 1L3UA 5L1KA 1IKVA 4ZPBA 2YNFA 3CG7A 5K14A 3IRXB 5DGBA 3I8DA 4JRPA 1TKDA 3VQ5A 5C24B 4ELTA 3TVKA 3BR9A 1J54A 4HTUA 1IKXB 3O3FA 3DI6B 3DLBA 2Z1IA 3UR0A 2JEIA 2WB4A 2UUTA 2QKBA 4Y1DA 2D0BA 5D3GA 4NRUA 4RG8A 4B8CA 2XCAA 3OSPA 1DTTA 4PY5A 2E9TA 3NE6A 1S1WB 4C8NA 3T5HA 4KHSA 3DLKB 3QLHB 4CHZA 1B9FA 1W9HA 3LP1B 1YVFA 4XO0A 2ZE2A 2EHGA 3OYNA 5HLFB 1FKOA 4DL7A 2BDPA 2WOMA 2GUIA 4ZPCA 4TQSA 4YR0A 4DL6A 3NMAA 4JUZA 1RT6B 4DQPA 4DQIA 1S9EB 4W5QA 2X6NA 4J9LA 3IG1A 4CJ3A 2OA8A 3GV8B 4KHQA 4TSXA 4Q5VA 3OYAA 3AA2A 4CFBA 5DQIA 3ITHB 4C8KA 1ZBLA 3NGDA 2HW3A 4E7IA 3GV5B 3HO1A 1RDAA 2V0NA 3T5LA 4ECYA 4YMEA 1WSGA 1NKBA 3GILA 5L1JA 4EYHB 2E6MA 2XY5A 3VQBA 1L3VA 4DTOA 1SV5B 2RDIA 3AO3A 3S3OA 3DMJB 3PW4A 4FK0A 2XRIA 1WAFA 3KLEA 1U48A 2RF2A 5JS2A 4FLYA 5JUMA 1LW2A 5KI6A 4B8AB 5DQGA 1S1TA 4NLPA 3OLAA 4CEOA 4N41A 3ZSYA 4F8RA 4F4YA 4DEZA 4EYIB 2DPJA 3IN5A 3Q8SB 4NYFA 1VRTB 2UVVA 2FJVA 3K5LA 4CJKA 1REVB 1RT7A 3V6DB 3CJ2A 3GIMA 1UA1A 2D0AA 3FDSA 1RA6A 4J9MA 4O4RA 2IJFA 3DLGB 4PUOB 1R0AB 4EBEA 3OYLA 4QOZB 5HROB 2FLLA 5KFAA 4K4WA 2BQ3A 2P51A 1JIHA 2Y1IA 4W5NA 2B6AA 3VQPA 1LW2B 2VG7B 4KAZA 1BQNB 3CIZA 3RMDA 3O4QA 1EETA 2YNGB 4CHPA 3MF5A 2R8KA 2IBKA 3BSNA 4FLVA 1W0HA 2G8HA 3E01A 3I0SA 5HP1A 3O4NA 5CYQA 4AHRA 4M3TA 1RT4A 1SL0A 2JEGA 1BCOA 1RBUA 4ED2A 3KIOA 1S4FA 4CJTA 4FM2A 4CEBA 4URSA 3NH1A 1O1WA 3KHLA 4FBUA 1KVCA 4F4XA 1TKZB 2BE2A 1QAIA 3MTKA 4MK7A 3RB3A 2VWJA 1S9EA 3KLIA 3NBPB 4DTNA 4DTJA 4HCBA 1RT6A 4I7FA 3RWUA 3FQKA 4LH5A 4IBNA 4ED0A 4KTQA 4ECTA 3HXMA 2ZE2B 3OVNA 4N76A 4GC7A 3QIPB 5KFDA 2OPSB 3V81B 2OH2A 4LSLB 4JV1A 4K4SA 2ASDA 1NNDA 4RW7B 4HKQA 2C22A 1S1UA 4KHMA 3E01B 3I0SB 1EX4A 1FKPA 4ZHRB 3BGRB 1RTIA 2I5JB 3FQLA 3AVKA 3GIIA 4DS5A 1RNHA 3EZ5A 4I9QA 3OHBA 3M9NB 4ZTJA 2IGIA 4WYWA 3V9UA 4GC6A 5KT2A 1JLQA 3PY8A 2ILZA 3MFIA 2FVPA 1QS4A 1RDBA 4DLEA 1DTQB 1QHTA 3V1OA 3TARA 5EWGA 5KFOA 5J1EB 3H08A 1JXBA 1NHUA 3SUPA 3SUNA 4ZHRA 3WNFA 3WNGA 1TP7A 4WFZA 5HROA 3HK2A 2AX0A 3HPHA 3AVCA 2HNDB 2JGUA 3AO4A 3SFGA 5KFGA 3DDKA 4HCCA 1NHVA 4WZMA 4FXDA 4KE5A 3DOLB 4DF4A 3KLHA 1TAQA 2X74A 4DU4A 4F3TA 2A1RA 1NK6A 2OZSA 4I2QA 5KG3A 4EO8A 3PR5B 4HUFA 4R5PA 1SKWA 2XC9A 2DFFA 3KMQA 4NZ0A 3DOKA 3OYCA 3KK2B 2F8SA 3HJFA 4DTRA 3GIKA 2HNYA 1RT4B 4E1MA 3HKWA 1WLJA 4Z4IA 2RKIA 1CLQA 2IM2A 4NLOA 4ZVFA 4NYNA 5KGXA 2KFNA 3ZSOA 3VQ9A 1VSKA 2FLPA 4YP3A 1WSHA 4M3RA 1TK0A 1Z25A 3C6UB 5F8MA 4WXWA 1SL1A 2R8GA 4RNHA 4CGDA 3PO4A 3RBEA 3CYMA 3T5JA 4YNQA 2GBZA 1C0UB 4BWJA 3HP6A 2PY5A 2J6SA 4XPEA 2C2RA 2B43A 3AA3A 2OPPB 3S9HA 3DRSB 4QW8A 3DLKA 5DMRA 2F8TA 1IKYB 3L3UA 1TV6B 3OYFA 4IDKA 3QZ8A 1HMVB 3IGVA 4CGFA 1JLEA 1HARA 4NLXA 5HLFA 5CZ1A 3VQCA 4QWAA 3FFIA 5KFZA 4R8UB 1WSEA 4Q0BB 2HNZA 4MFBA 3RMCA 4FM1A 3HL8A 4YR3A 5L1LA 3CJ5A 4OKEA 4PWDA 1RT3A 2P5OA 4CJFA 5F9NA 2FBTA 1IKVB 4J9OA 2ETJA 3BDPA 5HBMA 3M8RA 5EDWA 5I42B 3PO5A 1SKSA 1RT1B 1UWBA 1C6VA 3NGYA 4B9MA 3D5MA 1J9AA 3EY1A 3TR8A 3MEDB 2AJQA 4MH8A 3N6MA 2WONB 2C28A 5J2QB 4DG1A 4RZRA 4DLGA 2R2UA 4E7LA 1T3NA 4C8LA 5KT5A 2OPSA 4HHTA 3CJ0A 4E0DA 3CDEA 4LY7A 3DYAA 4BDZA 4Q0BA 4QWEA 3MFHA 1LWFB 3PW0A 3SFUA 1T7PA 2WCXA 4DWIA 1D8YA 1YVUA 1TV6A 2ITGA 3O3GA 4DL5A 1HPZB 2WOMB 4TYBA 3EZUA 1RT5A 4J9NA 3KMSA 4H4OA 1FKOB 5J2MB 1TK8A 4KI4A 2ILYA 2YHBA 3NBPA 5KG7A 2E9ZA 4ZPDA 4CK1A 5KTQA 1CSJA 4ZVHA 2VG5B 4IRCA 3CFRA 1ZBHA 5KG6A 5DG7A 3V6HA 5HP1B 3T5KA 4CJ5A 2BRKA 1EKEA 2B5JB 5KFJA 3SQ1A 2I1RA 2YNHB 4DU3A 1BIUA 3DLRA 3FRZA 4NLDA 1VSHA 1FK9A 2V9WA 2W7PA 4DG1B 1BISA 1BQNA 2VA3A 4CHYA 1NK9A 3QGGA 3TAQA 1JX4A 4BE1A 1S0NA 2EX3A 3S3NA 2F96A 1IKXA 1S1XA 3AV9A 1TQLA 2DFHA 5K14B 1YTUA 5KFCA 2R8JA 4MIAA 1A5VA 3NDKA 2BANB 4TY8B 1JLAB 5I3UB 3EPIA 1HJRA 2GV9A 1QE1A 1XI1A 1C2PA 3V6DA 3D45A 1MU2A 3VA0A 1BCMA 4DTXA 3TABA 2FJWA 3QEWA 1QSLA 4CK2A 4BDYA 1NJYA 2D0CA 1C0MA 4O3NA 3H5SA 3OLBA 4PQUB 4XPCA 5C42A 1JXEA 2XY6A 3LP2B 2IM0A 1IKYA 1REVA 3H4DA 1TKXA 4ED7A 1VSMA 2B4JA 1S9GB 4L8RB 4O55A 3T3FA 5KFNA 1QE1B 4FW2A 1RTJA 4B3OA 4KB0A 3SQ2A 3DRRB 1RBRA 2A1SA 1JLAA 5I3UA 4NLUA 1QUVA 5JS1A 4E7HA 4ELUA 5KFIA 4NYZA 4RU9A 5KFLA 4J9PA 4ECQA 4ZP8A 4JV2A 3AVHA 4MK9A 2RDJA 1RT2A 3CVKA 4ED3A 1Q9XA 3UPFA 4CJVA 1S49A 2BR0A 3QINA 1D5AA 1J53A 4M41A 3VQQA 3PX4A 1HNIA 4BDPA 1XHZA 3L8BA 3L2RA 4DQQA 1JLCA 4BE0A 3QEIA 2FBXA 3P1GA 5HRSA 3LP0B 3DM2B 3DLEA 4KHUA 4CF1A 4CJQA 4B9SA 4B9LA 4NRTA 3ASMA 4KHRA 4HUEA 2HNYB 3CM5A 1KRPA 1G15A 3HSTB 3VQAA 3BJYA 1RBTA 3NH0A 3V9ZA 4LSNA 1IM4A 4ECRA 4ZVGA 2VG5A 3KJVB 1RYRA 5F8NA 4DTPA 4CJUA 3OL9A 1RTHB 1ITGA 1UAXA 4KAIA 2AQ4A 4Q43A 4IH5A 2Z1GA 2HVIA 4QWCA 4M95A 2E6LA 3K58A 3V6KA 4K50A 1DLOB 1UA0A 2G8WA 4J9RA 2OPRA 2FLNA 2Z1JA 4KTWA 4M3YA 1RT5B 1NK8A 2ALZA 1T05B 1I6JA 2ATLA 4CFAA 2IDOA 4DFPA 3LWLA 3G0ZA 4Q44A 4H54A 3SCXA 4J2EA 2ASJA 2PZSA 4CIEA 2O4GA 3A2FA 3U6FA 3NGZA 4IG0A 2XY8A 4Z0UA 1SH0A 4O0JA 5J2NB 1JLQB 2AGOA 4NCGA 3JYTB 3B6OA 3MR6A 4K4VA 3H5UA 2YKNB 2W42A 2HHUA 2YKNA 4J9KA 3AVBA 2IC3B 1IG9A 4J9QA 3L2VA 1UWBB 5T7BA 2KZZA 4ECWA 1LAVA 4OL8A 4FJXA 3SJJA 3KHGA 2HHQA 3OSNA 3KHRA 4CJLA 2I5JA 3NCIA 1VRUB 3MEDA 5KFHA 4FW1A 1RT3B 4IR1A 4N5SA 4HVJA 3MXMA 1HYSB 2D3UA 3MEEA 1T8EA 4AHSA 4DFJA 3F73A 4RW9B 3JSMB 2V4RA 2XO7A 3L3VA 3RRGA 1U45A 1HNVB 1DLOA 3AVIA 4K4ZA 3TAEA 3K5OA 3PJWA 3CQ8A 3VQEA 3HHKA 4I2PA 2F8EX 4I7FB 3NF9A 4CF9A 1FXXA 4KO0B 1TKZA 4NLRA 3H5XA 4QWDA 1NK0A 3H40A 4O4GB 2HWIA 1HMVA 3TAMA 4YQWA 2UVUA 1JKHA 3QEPA 5KFBA 2R8HA 1RA7A 1ASWA 1TVRB 3DRSA 4F50A 4K8XA 2BQRA 4ZVEA 3LP0A 2RPIA 1EXQA 4LSNB 2G8VA 2ZKUA 4IQXA 4OKKA 4KFBA 1J5OA 1S6PB 1BQMB 3RB0A 2R2TA 4AHUA 1RTJB 4B3OB 3H5YA 3S3MA 1Z4UA 4E19A 2KFZA 4OVLA 3KK3A 3PW7A 1WSJA 1VSIA 4UQGA 3ZCMA 2IS3A 2YV0X 3QIOA 1XC9A 3TAMB 4QWBA 4FJJA 3KK2A 2R8IA 4ZP9A 3OYEA 4KRFA 2ZD1A 3RB6A 3OYGA 4IFVA 1QSSA 4IOBA 2UUWA 4EEYA 3ZT3A 1ASUA 4IH6A 5C25B 4FJIA 3OJSA 1TL3A 4JRQA 4C8MA 5FROA 3M8QA 4CGIA 5C42B 1KFSA 3AO1A 3QYYA 4RW9A 3JSMA 3BSAA 1S6QA 1VK0A 3ZSQA 2AU0A 1KLMB 3SI8A 4KB7A 4KV8B 2JC0A 4I9LA 4KTZA 1JLEB 1RTDB 2W8KA 2Z1HA 1TL3B 3KKRA 4KSEB 4FLUA 4RUCA 4OJRA 1SUQA 1FK9B 1S1VA 1EP4A 1SL2A 2VG6A 1SV5A 1ZETA 4RW4B 1S0MA 1N5YB 5EUHA 3D28A 2RN2A 4WXOA 3MEGB 3IS9A 1ZBIA 2R2RA 1KHWA 4AHVA 3PX0A 3K59A 3UDLA 3KNAA 3ZSXA 3TAGA 3HVTB 4RNFA 4CF8A 4FJ7A 4NLVA 1Y97A 4PA1A 3BGRA 3AVFA 3KLVA 4CEEA 1D1UA 1UOCA 2HVHA 4EP4A 2IM3A 3OYDA 3QIPA 4Y2AA 5FRMA 2IMWP 5CYMA 3IG1B 4CJWA 3AA5X 3IAYA 3ZT0A 1L3TA 4CHNA 4LQ3A 5KFKA 3I0RB 4OPJA 1B92A 5KFWA 1TGOA 1KFDA 1BGXT 4LD0A 1KTQA 4MQ3A 1C0TA 3SPZA 1TK5A 4ID1A 1ZBUA 5DLGA 4I2QB 1XR5A 2DY4A 2WONA 5C5JA 3HVTA 4Y34A 1RT2B 5CYMB 4KPYA 3KHHA 1GX6A 3DI6A 3G6XA 3ZSRA 5J2MA 1ASVA 1XR7A 1HNIB 1C1AA 3IS9B 1Q9YA 4LQ9A 4EBCA 4W5TA 4KKOB 1L3SA 1K1QA 1S10A 2GIQA 3DLHA 3SZ2A 4ZP7A 1NJZA 3IGNA 2D3ZA 4YFUA 3KTQA 2B6AB 5DG8A 4ZPAA 2AGQA 1NOZA 2NUBA 1U49A 1RTIB 3DRRA 3DYAB 3QGHA 1C1CA 4FJKA 3JYTA 4JV0A 1F21A 3KK1A 5J2PA 4CGJA 4O44A 3HYFA 3WNEA 3BREA 2XGPA 4NLGA 5DQHA 1S9GA 1KLMA 5KFEA 1GOBA 4OLBA 3NF8A 4IH7A 2IOCA 5HBMB 1KSPA 3ZT2A 5KT4A 1XWLA 4O0IA 4IRDA 1WAJA 1MMLA 3RTVA 2W9BA 3CWJA 3NH2A 3ULDA 4CGHA 3T1AA 3K2PA 3ISND 2FVRA 4LSLA 1X9MA 4J2BA 1C0UA 1S9FA 5EWEA 1NJXA 4B9VA 1NJWA 1LAWA 3M8SA 3U3GA 3I0RA 3H2LA 5DLFA 3V9SA 3I5AA 4R0EA 4OGCA 4B9TA 2WRMA 3I5CA 3V1QA 4YR2A 2RF2B 1J5OB 4DFKA 1RYSA 5F8JA 4BE2A 4CEZA 1I3AA 3MECB 3OJUA 3RRHA 3CM6A 1SKRA 4KFBB 2WHOA 1LW0B 4BWMA 4E7KA 3Q8QB 4G3IA 4IKFA 4Q45A 3N6LA 3DOKB 4FLXA 4FLWA 2RKIB 5T14A 2HHVA 1U09A 3VQ7A 3B6PA 3PUFA 4JLHA 4G1QA 3QNOA 3NF7A 3C95A 2JEFA 2W9CB 5KFQA 3ZT1A 4DQRA 2KTQA 3OS2A 3GYNA 2J6UA 3AO2A 4NLYA 3QZ7A 4EO6A 2HMIA 1S1WA 1WNEA 5F8HA 1LV5A 1BHLA 4TN2A 2W8LA 1N56A 4NLTA 4KV8A 4OLAA 3ALYA 4DSLA 2BANA 5KG0A 3AVMA 1Z26A 3OYHA 3QLHA 1ZBFA 3OL7A 4DSFA 5KT3A 2HNDA 3ZT4A 5F8GA 1S48A 2GC8A 1ZTTA 1LWEB 4DS4A 3SNNA 1VRUA 5DG9A 4DSKA 3DLGA 2G8FA 1RDDA 2PYLA 2HB5A 5KFMA 2WTFA 3N6NA 3SQ0A 3LAKA 4RUAA 3PR4A 4AHTA 4M3UA 5J2PB 3DRPA 4ID5A 3LALA 5EU7A 2IAJB 4IG0B 4FM0A 4X2BA 3RMAA 5E41A 3SV3A 1WSIA 5I42A 3VA3A 3PHEA 5KT6A 3RAXA 5KFYA 3OY9A 4CEDA 1N4LA 2OPQA 4MK8A 3I5BA 2AGPA 1IKWB 1X9SA 1K1SA 2FVQA 3V1RA 4F4WA 4Z4EA 2G8UA 2BE2B 4NLWA 3P5JA 4FJ5A 5F8LA 4ICLB 2QK9A 3KLFB 3G10A 4EZ6A 5KG2A 3K5MA 4DSIA 5KFTA 1JLGA 3C6UA 2UVWA 4CE9A 4FK2A 2DTUA 3PV8A 4U7CA 4OGEA 4DL2A 2BQUA 5EWFA 1TL1A 4ICLA 1VSDA 5KG5A 3MR5A 4I2PB 1HPZA 1CXQA 2ASLA 1RTHA 4B08A 3PW2A 1NKEA 5KFVA 3WNHA 3M8PB 3KD1E 3BQ0A 4FK4A 1KVBA 5KFUA 5KFFA 2R7YA 3C6TB 1N5YA 1D0EA 2YNGA 1NOYA 1IKWA 3PX6A 2YNFB 1RILA 4N47A 2V4QA 3ZSWA 5CZ2A 2HHXA 2CKWA 4O3SA 3PW5A 1LWCB 4J9SA 1U47A 1EP4B 1HQEA 5CYQB 2D41A 4JS4A 3AVNA 1CZBA 3EPGA 3GIJA 2HNZB 1YT3A 5KFXA 1RDCA 4PUOA 2Q3SA 3RAQA 4DQSA 5FDLA 3HVRA 2Y1JA 2FBYA 4J2DA 4CFDA 3FSIA 1S0OA 3OS1A 3QETA 3QIDA 2ATQA 3AVGA 4MFBB 1KCFA 3LAMA 5F9LA 1GX5A 4U6PA 2HHSA 3SQ4A 4RNNA 4CIFA 3F9KA 3V9XA 3FFIB 5C25A 2IJNA 1DTQA 4FLTA 3ZSVA 4CJPA 4F4KA 4DSJA 3QGIA 3OYMA 2KQ2A 1QAJA 4RW6A 4Z4FA 2EC0A 1GOCA 3PJXA 4DTUA 3H4BA 4ZTFA 4MKBA 3SI6A 3MR2A 2YNIB 3V81A 4B9NA 1RT7B 4EBDA 2FVCA 3AVJA 2G8KA 2XI2A 3VQSA 1TVRA 3KLGB 1LWCA 4CF2A 2KZMA 1RAJA 2XY7A 2P5GA 2WK4A 3LZJA 3HVWA 3OYKA 2X78A 4AILC 2W7OA 4F4ZA 4ECUA 4DTMA 3V4IA 4GVMA 3DMJA 3QO9A 3CFPA 3MECA 3KKSA 2AX1A 1VSLA 4FJ8A 3H59A 3NKYA 2B5JA 3OHAA 3LWMA 3V9WA 1YTAA 3DOLA 4WZQA 1KLNA 3SV4A 4FJNA 1D9FA 3M8PA 4O3RA 3KOAA 4ECSA 2XCPA 4BACA 1RCHA 1JLFB 4CECA 5SZTA 4F2SA 4H4OB 4RNOA 1LWFA 1DTTB 2ZQBA 3AVAA 4WE1B 4K4UA 1HNVA 4CF0A 3CDWA 4CK3A 2VA2A 4LH4A 3OL6A 4NCBA 2O4IA 3RMBA 1QTMA 1JLBB 4N56A 5FRNA 1NK4A 3RR7A 1ZTWA 3CO9A 3M9OB 4O3OA 3MEGA 4GW6A 4HYKA 2CJQA 4FS1A 5J1EA 1KVAA 4IG3A 3NAIA 2UVRA 4RW4A 4K4YA 1BI4B 1RBSA 4ID5B 5L9XA 3HT3A 1SUQB 4TY8A 3G86A 1EETB 4K8ZA 1HYZA 3SPYA 4EP5A 4O5BA 4ZMMA 4M3ZA 3HPOA 3T19A 4Q8EA 2R2SA 4NCGB 3NFAA 5KFPA 4IR9A 4Z4CA 2YKMA 1JLBA 5C24A 4TLRA 4FCYA 4FZZA 2OPRB 4KKOA 1A5XA 4CEFA 3LDSA 3TAFA 5JXSA 4FJLA 1I39A 5FDLB 1BIZA 4FJ9A 4WE1A 1C0TB 4JS5A 4NLQA 2G8IA 3K57A 4Z4HA 4PWDB 1JLFA 3RB4A 1VRTA 3TQ1A 4FJGA 4W5OA 2DPIA 1WNSA 3L2WA 3L2UA 2IA6A 4H4MB 3HM9A 2HHTA 4NLSA 1N48A 1HYVA 3OYBA 3ICLA 1VSFA 4RW8A 4FJHA 1IH7A 1C1BB 1L5UA 4O3PA 3C94A 4IFVB
chains in the Genus database with same CATH superfamily
1Q86T 4CHQA 2OPPA 3H45C 3VTHA 3TW0A 3F5TA 2P9KA 3V4IB 5DM7Q 4FBTA 3GV7B 2P1JA 5AQMA 3DHXA 1LW0A 1YJWS 1B3TA 1RAOA 2XS5A 4DL3A 3K89A 3T1YK 3IMQJ 1VQ6N 3VF4A 4KREA 1OY8A 4JI4F 1RLDA 4DV0J 3OS0A 3DXMB 2QKKA 1JLCB 4ZP6A 4H0TB 3O80A 3C0BA 4KHYA 2BACA 4CERA 3MR3A 4FYVB 4O3QA 3AOAA 1UVJA 4WJBA 3TA1A 2JLEA 5KG1A 5CA5A 1KVIA 2HQCA 3Q2TC 1QAYA 1QZ5A 2G2YA 2DKOB 4B9QA 2AZ1A 2UZAA 1D3WA 3OR1A 5I4MA 4ILLA 2OPQB 1VQKS 3R3LA 1VQ7N 1E6YB 2MZRA 1MU2B 1BE4A 1RGVA 2GGPB 4NA3A 1H6KX 1MMNA 3O5TB 2WVEA 3VAHA 1YBAA 3JAMO 1VK3A 2F7TA 4DR5J 4QW9A 4DL4A 2IRYA 4CIGA 3IWLA 2ZOGA 2WTUA 4FYDA 4LF2A 1O13A 3JSYA 4J91A 5BR8F 2J6TA 4WTYA 2F8HA 4LF8F 3NMRA 5BYSA 3VQ8A 2CQBA 3B54A 1X60A 1YJ9S 4LF7K 4RR5A 1QZ6A 4JI5K 2VH7A 1H7XA 2PYJA 1EHWA 1ZBSA 2AA4A 4H8KA 4QZVB 1RWMB 2XBPA 4MDBA 4OJ1A 4HHHA 1O8BA 2LU2A 2V2ZA 4GKJF 4G1QB 3CDUA 3KG4A 1WSRA 1N8RT 4OI2A 1Y5NB 2C2KB 3THVA 3LP1A 5ITHA 3TP2A 2RJZA 4QQBA 4M5IA 4F2RA 4OX6A 1RDRA 2V8PA 1KQFB 4Y2CA 3E3XA 1ZA1B 4DV2K 4C9DA 2GMLA 4P6QA 3BQ1A 5GAEI 2DT9A 2EC2A 3A13A 2FBVA 4DV2F 5GADI 3MPDA 2P9NB 3TWHA 5AZJA 1UW9A 2G0CA 4FF1A 3O6QA 1MROA 1XHXA 1ULRA 1YK9A 2QE5A 4ZITA 3GP9A 3DM2A 2BEFA 3V6JA 1YBTA 4AHCA 1U1NA 2DNOA 2N4CA 2B4OA 1HR0J 2WBNA 1HBMA 1S5JA 3ULEB 3VPZA 3EYZA 3QNNA 1VQNN 1RHKB 2W24A 3GFHA 4HUGA 2HIYA 1Q81O 4CEAA 2BJ1A 2QWLA 3QERA 2DHHA 4IFYA 4WFAL 3EGVA 5IQQA 3ZNJ1 5HRPA 5T7LA 3LA0A 1DRZA 1T03A 3FBEA 2E5HA 2QXLA 4DL0C 5AFUA 2D5RA 2VODA 3LOUA 3Q2SC 4X64J 3THWA 2A3ZA 2J0QD 2H51B 4H5TA 3DFEA 4LT6A 1LXNA 2A3JA 4NXMJ 4DB3A 1NWKA 4OHYA 3EWGA 4TVAB 2WVDA 4FLZA 3VQDA 2C2NA 4A57A 3KLIB 2MQNA 2CJAA 4TXSA 3M9MB 2KRBA 4ZIWA 2D7SA 2KW4A 3W5XA 4ED6A 4QPXA 4CYUA 5IFMA 2OTLN 3OFEA 3D2FA 4GKJJ 3AA9A 3C46A 2YHAA 3KLGA 5BN9A 3CJ3A 3QO9B 3CCSS 1T9XA 1B0VA 4CFCA 4YDUA 2YKQA 3LP3A 4OYBA 5K8PA 1FRMA 2JC1A 3PG9A 4TYAA 5A0YA 2VPZB 2VJUA 1GAOA 4DPWA 2F9WA 2E9RX 1V3RA 3VCDA 2CNLB 2YX6A 4EWTA 5JLHA 5IM0B 2E7WA 1RHQB 2ROPA 3CW2C 3SUQA 4PG8A 4C48A 3SQOP 4DR3F 1B9DA 3KKFA 2XSFA 1Q81T 4EZ9A 2P9IA 2ZGYA 1AZSB 3U7JA 5HRRA 2XS2A 2RUGA 3SQGB 1VQ4S 1OH7A 4O44B 2IC3A 4E89A 5D3GB 5ETTA 4E7JA 3D1OA 1AYEA 4WFYA 4RNMA 1NM2A 4WQ4C 4GNIA 3KK1B 1S1TB 1S1VB 1SXLA 4FWLA 3VGMA 1K73O 3HZEA 3C6HA 5M1KA 2A6MA 5K14A 1TKDA 5C24B 3J7YP 4ELTA 3VZHA 2DGTA 1E4GT 1J27A 1WF1A 3DI6B 3DLBA 2Z1IA 5GADP 2QKBA 3W1YC 2D0BA 4NRUA 4B8CA 4DQ8A 1IQZA 3JXUA 3T1HF 4C8NA 4HI1A 2RILA 1HNXK 2MLZA 4DR6F 3QMLA 1YVFA 2ZE2A 3OYNA 5MLCQ 5HLFB 4JI8J 2W2OP 3PIPL 2VICA 1GEHA 3DXKA 3UD4P 1KAZA 2D0PA 4IFEA 4DX6A 4YR0A 5C7PA 2FGOA 1VBYA 2HFZA 1REGX 1RT6B 3OUYB 3QFPA 3EICA 4W5QA 1WOQA 4CJ3A 4Q5VA 5DQIA 3G2XA 5MAOA 4AM7A 3BN7A 4G1PA 5LXYA 2ZM6J 2PEBA 4DHYA 2CGKA 1RDAA 2V0NA 1P90A 1WSGA 3O6WA 1WC3A 2VBYA 2EFOA 5L1JA 2XY5A 1L3VA 3H20A 1IQTA 8RUCA 3BKFA 1SV5B 4IOAL 3PKYA 5HVHA 2AEMA 3IWXA 2HQGA 3B4DA 2B7CB 5JS2A 1URRA 5AQFA 4OI6A 4CEOA 1EIYB 2YCHA 4DEZA 4BRMA 4EYIB 2DPJA 1FWPA 5ADXA 4YOYA 2FJVA 1REVB 3V6DB 4DV7F 3K9KA 4J9MA 2EI5A 4NB4A 4L76A 2IJFA 4RX6A 4PUOB 1N5QA 4EBEA 1TL4A 1WUAA 3IM8A 2MGZA 5A6PA 2RD5C 5D0RA 2BZ2A 1WKJA 2X3GA 2Y1IA 2HHHJ 4W5NA 2OI2A 2B6AA 4CNZA 3ID8A 1LW2B 2E8AA 3CCWA 5GAHP 2DNLA 3FZLA 1WBDA 1F5BA 2CZVC 1BQNB 3CIZA 3HI9A 3O4QA 3RBXA 2YNGB 1BWVA 4B1VA 2DH7A 3MM8A 4ZVQB 3EVMA 5BXIA 4QYZJ 1U2VA 2IBKA 3BSNA 4FLVA 4WFNL 3BYPA 4AHRA 1RT4A 2IBOA 2Y8YA 4CP5A 5K8MA 1SL0A 3MXHP 2JEGA 3CPWR 3KIOA 3NS5A 4CJTA 5AZJB 4I4BA 4CEBA 3NH1A 1O1WA 1T0TV 4DR4K 4LVOP 5B0FA 3I4PA 2EG1A 4ZPWR 2QA4G 2CVEA 4OYIA 2PAVA 1QAIA 2P9LB 3RB3A 2EBGA 4X62F 3AAPA 3WQPA 3EN9A 2UXDF 3KNGA 5A2QY 2M2BA 4JI2K 3ENOA 4IBNA 3CMQA 3D66A 1SC3B 4Z7YA 3HXMA 2ZE2B 4CZMA 5EOYA 5AQRA 2OPSB 3V81B 4LSLB 3DRXA 4FOIA 2ASDA 4AE5A 1W7AA 2JSXA 2BTFA 4KHMA 3PIOL 5AXLA 4C97A 3E8OA 4ZHRB 3MM7B 2CYYA 1HW8A 5A2QU 4I9QA 4OX8A 4M5LA 3OHBA 4WYWA 2I7PA 3QJJA 4RO0A 5KT2A 4I6MA 2JHEA 2ILZA 4KGMA 4AL6A 1QS4A 1RDBA 1OH8A 1VHXA 1DTQB 1QHTA 4PQAA 3WUHA 2ACYA 5KFOA 4ITSA 5DZ7A 3CJBA 3SUPA 4ZHRA 1QQMA 3WNGA 4C2MA 2R7WA 5LMNJ 4A8KA 1VQPS 3PFEA 1VIXA 3AO4A 2B0GA 3W62A 1WC0A 5KFGA 4WK3A 8ATCB 1NO8A 1Q7LB 4PXCA 4ENOA 4JKDA 4OZ5A 2QYGA 3C6AA 2YX1A 1YITS 4DU4A 2A1RA 1LWXA 2BOAA 4B3MF 1NK6A 3R2DJ 2BBEA 4I2QA 4X4VA 2PGCA 2OZSA 4EO8A 4JKGA 1NGAA 2XC9A 2DFFA 2J9EA 3DOKA 1NB7A 3VEVA 3Q86A 4FYXB 4CM2A 4PG4A 3KWMA 3O3LA 2HNYA 4E1MA 5AJ3J 2XYGB 1T3VA 4FWOA 3SLCA 2RKIA 3IUCA 4ZVRB 4C11A 4NLOA 4M5JA 4NYNA 1VSKA 3DLLQ 2FLPA 1NLVA 3LM9A 2KG1A 3C6UB 4RNHA 4CGDA 3RBEA 1RE1B 1NGHA 3ZTSA 3A4TA 4BWJA 1C0UB 3VTIA 5DM6Q 4OIXA 3HP6A 4FO0A 1Y3JA 4AL7A 2C2RA 1FESA 4QW8A 4CH7A 2HSEB 3L3UA 3OYFA 1HMVB 3IGVA 1HW9A 1PO6A 5HLFA 3VQCA 1GLLO 5KFZA 5GAEP 5B7WA 1WC1A 2RHSB 3R5GA 2ERRA 1K73T 3KG1A 1HNWJ 2LMIA 3O1WA 5BPMA 3I56N 5F9NA 5JMNA 4N8NA 2JZ5A 3MEKA 1V4TA 4J9OA 5HBMA 3M8RA 5JLFA 3FEXB 3PO5A 2A10A 4DV7K 3QWPA 2Q2RA 3DLJA 5M1OA 4PABA 3MEDB 1K44A 4MH8A 2WONB 4K5SA 4WYBA 1QDUB 3SAGA 1SIWB 2PE8A 3PNIA 3MMAB 3FKBA 3GYXB 1XBWA 4U67Q 3IC1A 2J0XA 3H6EA 4J9VA 2HFNA 3PW0A 3GFYA 1GXLA 5AQXA 3HFZB 2YWFA 1D8YA 1YVUA 1I3OB 1HPZB 2WOMB 1RT5A 3KMSA 5J2MB 4F04B 4BLGA 4H0PA 3FZFA 2YHBA 5KG7A 1HLWA 2AW0A 2VG5B 2CGLA 3A8IA 2L08A 4P2SA 3V6HA 5HP1B 4WP8A 2QFJA 4CJ5A 2BRKA 5A8KA 4CO4A 4D3HA 2E7XA 5CR4A 3ZYYX 1FK9A 1XQIA 2HRYA 1UL3A 4DG1B 4YB6A 5GAEU 1NK9A 4BRLA 2R7OA 1JX4A 1S0NA 5E33A 3D6RA 1DGKN 4DR2F 3S3NA 3UNGC 4WP9A 3SEOA 1S1XA 3AV9A 4ZLNA 4HT5A 1YTUA 5KFCA 5FPMA 3OVSA 3MN5A 3OBIA 5SUHA 3NDKA 1S59A 1JLAB 1HJRA 2K7JA 4X4SA 1XI1A 4BGBA 3VA0A 2DNGA 2FJWA 3QEWA 3ETMA 3CC2S 4OZLA 1R43A 1NJYA 3EGNA 3OLBA 5C42A 4ALZA 1ZOTA 4GO5X 1Y11A 2KG0A 3HHEA 3IR6B 3I32A 2GVZA 4FW2A 4B3OA 3SQ2A 2A1SA 3HD1A 4NPOA 1KAYA 5KFLA 5F3TA 3N5BA 3CVKA 4ED3A 4NEYA 1YJNN 2O8DB 3UPFA 2NZTA 4CJVA 5D0GA 2BABA 3IO1A 4B02A 1CZAN 3QINA 1D5AA 1S72S 3L8BA 5ETOA 5AZIA 4BE0A 5HRSA 3DLEA 4B9SA 3JS9A 4NRTA 3CMES 4KHRA 3VVUA 3K0SA 3VQAA 1YTYA 4LSNA 4DCOB 3CF5L 3KJVB 2C3OA 3OL9A 3J80Y 1R89A 2HVIA 4DR5F 3AAQA 4DR7J 1DLOB 4K50A 1XIQA 2O8FA 4KTWA 1WKKA 1RT5B 2GX9A 5E2QA 3MDFA 1Z2ZA 3N01A 4DFPA 3LWLA 3VAKA 4HWIA 2CGJA 1FF2A 4R0JA 4X62K 4CIEA 4FF3A 3R5CA 1SC6A 3N4QA 1PCAA 1NUEA 3J80U 1FERA 2MHNA 2FF6A 5C2FA 3FFKB 1JLQB 4NCGA 3JYTB 3MR6A 5D15A 2YKNB 2W42A 4CM0A 4Y0WA 3CCVS 1VFJA 2IC3B 1VQ8N 1IBKJ 3ZFVA 4CZEA 4AQYK 1IBMK 3SJJA 4OZJA 4CVNE 2UV8G 4N5SA 3MXMA 4U7BA 3P5BP 1U1LA 1U24A 3MN7A 4RW9B 3L3VA 1U45A 1FJCA 5TKYA 3C7NA 4K4ZA 3CQ8A 3VQEA 1UVNA 2N82B 1DURA 4YDUC 3TYTA 1NGBA 1Q79A 4DR1F 4KO0B 3OPKA 1KNZA 4JV5J 3H40A 5HMXA 2OJ3A 3W63A 2V8DA 1TVRB 4KH1B 2BQRA 3LP0A 3KXDA 2RPIA 4OI1A 4HT7A 1GTHA 5K20B 4OKKA 4KFBA 2IVNA 1NSAA 1BQMB 1UPPA 2R2TA 2ZVIA 4DV2J 3FGUA 4E19A 3ADAC 1RZMA 4KH6A 1YJTA 3PW7A 2AF6A 1PILA 4QWBA 3LH2S 3KK2A 3AODA 3ILLA 4V1Ak 5CD4H 3OYEA 4KRFA 2RH3A 4BC9A 3VGUA 2D0OA 4BC3A 1M5PC 2B4UA 2UUWA 3BF1A 3ZT3A 3GOIA 4FJIA 1KD1T 1T44A 3DRYA 5FROA 3M8QA 2AHOB 3DOMA 4DR1J 3AO1A 3JSMA 2CPZA 4DUYF 1KLMB 2AU0A 3B8AX 4A5AA 4BROA 4FWNA 2H48B 3HJVA 2JC0A 4USVA 3C15A 1FJGF 4E8UA 5DRKA 2PMZD 3BPDA 5B0EA 2M70A 2W8KA 4RUCA 2BA9A 1FK9B 1S1VA 2VG6A 1S0MA 1N5YB 5EUHA 2X1GA 1T9VA 3BF4A 2U2FA 3PRVA 3HHDA 2R2RA 3W9IA 2N3LA 2A40A 2E1YA 3VGSA 3JQMA 3HVTB 5A76A 2IDEA 4LRCA 3UVJA 1VOMA 3C16B 3LL3A 3BGRA 3AVFA 4I6YA 2HVHA 1DAXA 3MM9A 1RSCA 2YQ3A 2NLXA 5B0GA 4FPIA 2MZ1A 4JKFA 3IAYA 4IOCL 3ZT0A 4UUXA 4LQ3A 3R8YA 3V5RA 1PBAA 1B92A 5KFWA 1TGOA 3WHIA 1HWKA 3BZQA 1R8BA 5K8OA 1I1GA 4GVBA 3ZO7A 2DGWA 4GY2B 1K47A 4ID1A 2DNNA 5DLGA 2V51B 4P75A 2ZH1A 2F5GA 5C5JA 3J81O 4JN4A 2B56A 1UFWA 1RCXB 4CBXA 2H9ZA 4LRFA 5LM7E 3KG0A 4W5TA 2E5LJ 4KKOB 1S10A 4OV1A 3SZ2A 1H73A 4BRGA 2AYMA 2D3ZA 5FLXU 2QL5B 3KTQA 2OFHX 2C3YA 2AGQA 2NUBA 3TEGA 3QGHA 1F21A 3KK1A 2NRRA 5J2PA 3BREA 5DQHA 1U1KA 3CCMN 1S9GA 2ZBPA 3K17A 3LUYA 5HQLA 5KFEA 4OLBA 4CWBA 1PIEA 2Q79A 3LGMA 2D9OA 1IR2A 2O8FB 2CADA 5L9NA 4IRDA 5HJYA 2RE2A 1U1OA 1YIJS 4H0XB 2A18A 2P6TA 4PCQA 4CGHA 2D4WA 1ZM9A 3K2PA 3ISND 4X66J 2P9UA 4USKA 2FF3B 5FPDA 1W97L 3H8YA 4ZVSB 4BREA 3HDSA 2V94A 3SK3A 4FXVA 3NG8A 1R8PA 3V1QA 3U8XA 2RF2B 5F8JA 2F3JA 3M32A 4CEZA 1U25A 3EKSA 1SQFA 2HMPA 2JLGA 3Q83A 3OJUA 2H54B 3CM6A 2FDNA 3V2UC 4K42A 4RWXA 3WXLA 4Y2IA 3AHPA 3N6LA 2RKIB 4BR0A 1SB6A 1RWKB 4KQZA 2DIUA 4YOXA 1FTCA 1AW0A 5T41A 2WSFC 4DPYA 4DV5F 2BVZA 2JEFA 1R6VA 3VEXA 5KFQA 1UVLA 2KTQA 4PEOA 2M8HA 3OS2A 2J6UA 4NXMF 2XMUA 5E3RA 3SBMA 1S1WA 1Q18A 4LR9A 3O4WA 3L9ZA 2YHYA 4TN2A 3CC4N 2PA3A 3ALYA 1AB8A 2V8GA 5KG0A 1X9JA 1EWQA 1S48A 3KJQB 1WC5A 3IAM9 3MM6B 2G9OA 1FRHA 3SNNA 4JI3K 4DSKA 4I64A 1RDDA 5BRHA 3O1LA 2HB5A 5KFMA 2WTFA 2ZJRQ 3W3SA 4JKHA 3A8JA 4LRAA 3D0GE 4CLFA 4RUAA 4AHTA 4WFNQ 1FJGK 2LDYA 4R25A 4HDGA 2HHHK 5I42A 1SAZA 3VA3A 3PHEA 3RAXA 1N4LA 2OPQA 1JJ4A 4X84A 1T9TA 3V1RA 1S12A 2G8UA 2BE2B 3GYGA 3R9PA 5F8LA 3UE2A 4CD3A 3KLFB 3HT0A 3G10A 1HLUA 2YH0A 4DSIA 3GG4A 1H0HB 1G99A 4LF6F 2MQLA 3H42A 4CE9A 4X65J 3QRQA 3J7Z5 4U7CA 3Q8YA 4DL2A 4H0YB 1TL7A 4OX7A 4UT4A 5LY3A 3TZXA 4DV6F 4KYZA 3GG1A 2J7KA 5HQ8A 5KFVA 3BQ0A 3KDNA 2KI2A 4G1IA 4XK8C 1KVBA 2V50A 3HSDA 5JVHL 3HD2A 3LW5C 4GVLA 3AOCA 2IYGA 2V4QA 2QWRA 4ILGB 5CZ2A 1UPMB 1O6XA 2HAFA 3S1TA 3UD3P 3LGHA 2J8SA 1RWXB 1VC5A 1CZBA 3G8TA 2HNZB 2N3OA 1HUXA 1YT3A 4LVNP 5KFXA 1RDCA 4GKKJ 2CWKA 4DQSA 3MI7X 2Y1JA 4HI2A 4A2AA 1FI4A 4AT1B 4CO2A 2OMLA 3QETA 4CH0S 5JVGL 2Q97A 3ILIA 2HHSA 1GX5A 1S79A 4QIFA 2DXEA 3IBWA 1WSVA 2F4VJ 5LMNK 1X31C 4OX9J 2WBRA 1QAJA 2O8EA 2XYPB 4ZTFA 3SI6A 4PZVA 4OJHA 1X4BA 5ETRA 2PA8D 4MLEA 2CJKA 3BP8A 3CETA 1TVRA 3KLGB 1DFDA 3CJ8A 4CF2A 3MOZA 2FSNA 4W4MA 3J8AA 2GQ2A 3D2FB 3OYKA 3ET6A 2LCWA 4AILC 2Q6BA 3ZTOA 4F3QA 3QO9A 2VQFJ 2Y3YA 3TUJC 4ANCA 4MKYA 4JAXA 4NWBA 3OHAA 3V9WA 4JI7J 2SXLA 4JI5F 3DOLA 3PRBA 2I7NA 4LBIA 5A2QO 1Y0HA 2XZDB 1SPBP 3KOAA 3MCPA 3U02A 5LOQA 1IG8A 1JLFB 3A1YG 4F2SA 4USUA 5LSOA 4RNOA 4AFFA 4IO9Q 4HH0A 4CF0A 5C0YA 3CDWA 2XZWA 4X4RA 3OL6A 4NCBA 3IR7B 1RHJB 2KLAA 5FRNA 1NK4A 5AQKA 4UY8T 1CJVB 3QDKA 3P38A 1UZHA 3CO9A 4YHHF 2Z0GA 4O3OA 4IOCQ 4B3TF 4JYAK 3CXCR 3T9NA 3P8BB 3WEEB 3BO4A 1T95A 4B17A 3R2CJ 3NAIA 2UVRA 4K4YA 1VS3A 2CNKB 4TU9A 3NP5A 5L9XA 3OTOF 4FF4A 4CZLA 1RAEB 1X4FA 4K8ZA 1E3MA 3SPYA 3E2EA 4O5BA 4KT0C 4NA2A 1LOTB 4FWMA 4CLKA 2R2SA 3ZZZA 4NCGB 2Z57B 1FFWB 3NNAA 4YY3J 1FRXA 2CA9A 2K8GA 2V2QA 2YKMA 4TLRA 5C24A 3ZTPA 2BJ3A 4WFBL 2OPRB 3LO3A 3AB4B 5FDLB 1QJHA 4L6V3 3DGVA 1C0TB 1HWUA 3D3BJ 3L4IA 4F9OA 5GAGI 1VRTA 5A8WB 1R31A 4W5OA 1JJ2M 2DNRA 1N48A 2K1RB 2QTWA 4FJHA 1C1BB 2F9TA 1CPZA 2OEMA 2DK2A 5D4LA 2HQ3A 5CE3A 2W41A 1ZYQA 1NBWA 3ELHA 4MIBA 5GMEA 1XNRJ 4LMZA 2A2CA 5BYRA 5AZIB 1RWWB 1QVFM 4WWSA 3HP9A 2K06A 2NREA 3WIUA 2ZWOA 4DPXA 5BRDA 1F9EB 1RWPB 1N6QB 4ER8A 1HHTP 3UN2A 1NGFA 4K4XA 1CG2A 3G6YA 3DLEB 3BSCA 2GV1A 4DUYJ 1Q8LA 4P52A 1B7YB 5GMDA 2VG7A 4LUBA 1CZ9A 1V5VA 1IXKA 2W9BB 5BRFA 2FJAB 3RJMB 4M3XA 3QESA 3PFOA 4U8VA 2DYAA 2WBMA 1WBBA 4FWQA 3MM5B 3CFOA 2BJ8A 1LFWA 5SWMA 1IR1A 3QJLA 5B09A 2CPJA 3PYDA 3TSUA 2HBYB 1GTEA 3AOBA 1EO1A 3NGIA 2PC6A 4KHWA 4KHPF 3ZC4A 1FRJA 2D3O1 4GV6A 2QWOA 4MMOA 4FKYA 5E3AA 2Y0SD 2E2PA 1X4HA 3U27A 4CHOA 2HWHA 2YNHA 2ZD1B 3WEEA 1NSPA 2BE9B 3HPGA 2VBXA 2J7WA 3NF6A 1YF5L 4A4JA 3B82A 1RJJA 5KT7A 4JI3F 4TQRA 1H98A 4K0KK 1Q8IA 3NL0A 2XHBA 3CJSA 3RSEB 3JTOA 2QWNA 1BUXA 2F1FA 4K4TA 1S6PA 1VK8A 4P72A 1TR0A 1X1PA 5GAGU 1J5EK 1GLJO 4CCHA 2DXFA 3QEXA 4CGGA 4QOTA 1RBVA 5KQDA 1NKCA 4WFXA 1TL1B 2DEJA 6AT1B 4R5PB 2DITA 1U04A 2HS4A 3O3HA 2ZJRL 3KLHB 2HQFA 2KYXA 3MAHA 4URGA 4KO0A 3MCMA 4OHZA 2YPYA 3SYZA 2OZMA 5KFRA 3G6VA 2CUYA 3IDHA 1F3VA 2AKWB 2DGUA 2GVDB 3WT0A 1YZ7A 4F3OA 1M5KC 1EQYA 3GIRA 3SDEB 1YI2S 2ZHOA 3G82B 4J7CA 3W2VB 4BG9A 2X51A 1QQCA 3ZZ0A 5MLCV 3OYJA 2W4CA 4HVZA 3PVXA 2O8DA 4PHTX 1VSJA 1V5IB 3TEHB 2DGQA 2QL9B 3ISZA 1I51B 3N4WA 2L9WA 4P7TA 2XI3A 2HHWA 1B0PA 1H1VA 4I1TA 1RAIB 4CO1A 1YJ7A 3NXZA 2IJRA 4DR3J 2G4BA 1S1UB 1XR6A 1AFIA 1IBKK 3GTYX 3D0PA 4U7UK 1I94J 1CLFA 1R8HA 4MTPA 4R8UA 2HMIB 1AT1B 5AXKA 3F44A 3KZBA 2ADCA 3P49B 3P83D 4G9ZA 4I6WA 3BQ2A 4ED5A 4JI1F 4LR8A 2FZKB 1BWFO 1GLAG 2E7VA 3W5YA 4IO8A 5FLXO 1DJ0A 3K8VA 2QXFA 3UW1A 3AXKA 4JI6F 4B1YB 3AJDA 5ADXH 1TKTB 1UVIA 4OX9F 4ECVA 5GVQA 5ETSA 2XLJA 4BC2A 2F8MA 3CULA 3ZSZA 2O8BB 3ENVA 3R5JB 4G65A 2MKIA 5J1NA 4LFCF 1CBKA 2J0WA 2FIUA 2F63A 3DHWC 3W7BA 3AA4A 3PSIA 3K5NA 1SJFA 2H4WB 4KHNA 1Q78A 2Q1LA 4OPKA 2O5DA 3GQCA 3FZKA 1QTNB 1OKJA 1TZ0A 2VD3A 1YRXA 3CD6N 4JI7F 2KHDA 3F9MA 3IM9A 1VR6A 3W8PA 2B8PA 3AQOA 2IM1A 3TI0A 2CDQA 4A59A 2W9AA 3VEOA 4ATNA 3F41A 3I8BA 1TKXB 1S97A 2YKMB 1GLFO 4C3MA 4WYLA 1BI4A 2OGUA 2BRLA 4DR1K 5LT5A 3WBZA 2MDAA 3S6EA 4LF5J 4ZVPB 2VPYB 2B9EA 2OIHA 4UOFA 2EK6A 4ZPBA 2MZQA 2YNFA 3CG7A 4O8KA 5DGBA 3I8DA 3QSYB 4DR5K 3G6ES 3TVKA 3SDEA 1J54A 4L3QA 2PBDA 1MG7A 3VEWA 3UR0A 1VGYA 2JEIA 2UUTA 1NSQA 4Y1DA 2RRAA 2YBVA 4PY5A 5E0OA 4CZKA 2HBRB 3PDNA 2FJEB 2KKZA 2FTRA 3KJFB 4KHSA 1C0GA 3QLHB 4JI5J 1B9FA 1W9HA 1FDBA 1GQEA 2XMWA 3HLUA 5AXNA 3C3LA 3ET6B 3UCGA 2EHGA 3ZXWA 3H3OB 5AR0A 3TPQA 2UUBF 4BGAA 4K2JA 3NMUA 2V68A 5B0CA 2P9SB 3TUPA 5I3PA 2E1MC 4DQIA 2XHCA 3LDQA 3GV8B 4KHQA 1IN0A 1WHWA 2HW3A 1F9HA 4JI4J 2XTJP 1HWJA 5DM6L 3T5LA 2FJDB 3VAJA 4ECYA 2QEXN 3ZETA 2D9PA 5EGYA 1BA0A 3W61A 4DTOA 3NVMA 3L0QA 3AO3A 2UUAF 4ZVUB 3US5A 4IQMA 1KDNA 1VJQA 2EXUA 2ADBA 4FK0A 4N8OA 3KLEA 2JWNA 5JUMA 5KI6A 4GVEA 1IBLF 2NUUG 4N41A 3OLAA 3CCRS 4F8RA 4OHXA 3G4SN 1FFSB 3IN5A 2RHKA 1EQ0A 1VRTB 2UVVA 1UKUA 3GIMA 4DDFA 4E2FB 1AA1B 1RA6A 4OYAA 3DLGB 1UJ5A 1R0AB 1H2VZ 2DNPA 1UW4A 3EGZA 3MM5A 4XAKA 2FY1A 2NRZA 1DBDA 1ICEB 4XH1A 4QOZB 5HROB 3DXSX 4CO3A 2BM1A 5AQNA 5AQQA 3VQPA 2HLUA 4HEA9 3D1HA 5AJ3F 4KAZA 3A3OB 1XNQK 4H5NA 3TTFA 1G7CB 2JWKA 4CHPA 2R7UA 4QR1A 4ZCLA 2AJ0A 1J6ZA 1YHQN 3EE9A 4QS8A 2M7SA 1BHNA 4CI0B 1UVMA 3I0SA 4JI6K 2QLWA 3MTJA 2NQPA 2YHWA 3WQTA 2LQJA 1EZZB 5FPNA 1S4FA 3TOQA 4GKJK 4URSA 4NLBA 3O9QA 3BKTA 1OWXA 1OIAA 3VERA 1DARA 1TKZB 2VWJA 2R7SA 2YWHA 3VGKA 4DTNA 4HCBA 4I7FA 2ZM6F 2NRVA 2J0SD 1UMJA 4LH5A 2ZZMA 4ED0A 3AAWB 4G6VB 3OVNA 4GC7A 2PO4A 5KFDA 2OH2A 4YORA 4C0BA 2B51A 4RW7B 2UXDJ 1IWAA 1S1UA 4E98A 2ZH6A 1D09B 3OHRA 4LBHA 5BYQA 3I0SB 4JI8F 5IC4B 1FKPA 4KGXB 5F3ZA 1CJTA 3AVKA 3I96A 1WOSA 3M9NB 4ZTJA 2ZZNA 2OSQA 4JKAA 2FVPA 1RB0A 1FCAA 1HBUB 5J1EB 5ETKA 4K8RA 3SUNA 5IZHA 2DHXA 4WFZA 4L3KA 1FJGJ 3HPHA 4UF4A 2QWMA 2HNDB 1X5PA 4HCCA 1NHVA 4FXDA 5H1SV 1WTBA 1F5AA 3I31A 2DHGA 4BRFA 4F3TA 3KUGA 2C42A 3EO3A 4DI6A 4HUFA 2Z2MA 4R5PA 1SKWA 1VISA 1K0VA 2VF3A 3TJ8A 2WB1D 3OYCA 3EM1A 3KK2B 1JNRB 3OR2A 5DJBA 1PYOB 3HJFA 4DTRA 2G2OA 3GIKA 5KOWA 1WLJA 1UAWA 4LF8K 3HHNB 2IM2A 1RAGB 4ZVFA 4W90B 5KGXA 2KFNA 4LRDA 3ZEUA 4I56A 3NY0A 4YP3A 4M3RA 2CQPA 5IV3A 2HQIA 4RU2A 5F8MA 2R8GA 3CCEN 3CYMA 1CJUA 3QBWA 4ILHA 4XPEA 2B43A 4CLUA 3AA3A 3VAFA 2BM0A 4TU8A 1YJWN 4ZPVR 1IKYB 1TV6B 3GWCA 4CGFA 1HARA 4NLXA 4FXWA 1VQ6S 3CD7A 4CLTA 3FFIA 3BBCA 2ZJPQ 4P2FA 2XB2D 4ZVTB 2LDIA 1UZDA 4AYBD 1PAEX 2HNZA 5F0XA 3HL8A 3BB5A 3CJ5A 3UKRB 2KT2A 4AD6A 4V19J 3VENA 4CJFA 3M7VA 1T6DA 3BDPA 1C4CA 2HSTA 2Z8QA 2R3VA 1C6VA 2YX7A 2MTLA 2EPIA 3BGLA 2VGMA 2VIHA 4NYPA 2G1DA 2ZOMA 1BLUA 3L95X 2WW8A 2R2UA 2F4VK 4E7LA 1FXLA 3OW2R 2GHPA 5HMYA 2OPSA 4HHTA 1RWUA 1VQKN 5AQLA 1XK8A 2HZCA 4I67A 3DYAA 2Q0UA 2QWPA 3G71S 3G9CA 1A7GE 1HA1A 4Q2MA 4QWEA 1VQ5N 3QFUA 1LWFB 3SFUA 1VIOA 3NGKA 2PMWA 4A46A 2ITGA 2ZDPA 4RPFA 2DRBA 1FKOB 2E1RA 2R7TA 4F7VA 3NBPA 4CK1A 5KTQA 1CSJA 2NXUA 5JVHQ 3CFRA 4XDCA 2YTCA 5KG6A 4YY3F 3GL1A 2HURA 4JI2J 2B5JB 3HHLB 3SCIE 5IT0A 1Z05A 3MM9B 4U7UD 3DLRA 2HBMA 2V9WA 2W7PA 1BISA 2E1CA 1HPMA 4CHYA 5BREA 1KC8O 2IY5B 2IHR1 2OELA 4K0KF 5D4OA 1TQLA 2A42A 2I8EA 2DFHA 2RMLA 4BRKA 4F26A 5RUBA 3EPIA 2HKEA 1QE1A 2KVIA 3CF5Q 1VDHA 3NOCA 2VGNA 4BDYA 2VL1A 2BE7D 3VOVA 4XPCA 1JXEA 4Y2MA 1IKYA 1TKXA 2B4JA 4KPCA 2ZJQL 4BR4A 2LECA 4A47A 5AE3A 3PIPQ 1QE1B 3R1HA 2CQ2A 5AQJA 4RTFD 1NEEA 5I3UA 4NLUA 1QUVA 2XM3A 2DPNA 4ELUA 4E7HA 4FSVA 4JV2A 4MK9A 2VOOA 3AH6A 1RT2A 3FJ2A 3GDQA 3GMGA 1Q9XA 2W01A 1S49A 2BR0A 1D9AA 2CJXB 1N36K 4M41A 2YHXA 3VQQA 1NU4A 1HNIA 3L2RA 2W2PP 3LDOA 2M0GB 1JLCA 3QEIA 2FBXA 2GJ2A 3I4HX 4CF1A 4CJQA 4B9LA 3W64A 5AJ3K 2HNYB 3RUBL 3CM5A 1KRPA 1FWLA 1M90T 3BJYA 3NH0A 1IM4A 4ZVGA 5IQ6A 2VG5A 4LC9B 5GAHI 1RYRA 3CCLN 2RQ4A 1QVFR 2HLTA 3CDBA 1BC6A 3B6BA 4KAIA 2AQ4A 3TJ9A 4Q43A 4FOEA 4IH5A 4QWCA 2CQ0A 3CCUS 3EL2A 3V6KA 9RUBA 1UA0A 3VR1A 4H5RA 4DUYK 2OPRA 2Z1JA 3QGPA 4M3YA 1T05B 1T9UA 1CULB 3JTNA 2WSEC 3N28A 1FDNA 2Y8WA 4ZLPA 4Y2KA 4Q44A 1U7LA 2Q43A 3OBWA 2O4GA 2VZ9A 1TL5A 2RS2A 1NH8A 3NGZA 2V7ZA 2XY8A 3QFWA 5CH7B 1RGIA 2LP4A 3B6OA 4K4VA 2HHUA 3AVBA 3P4IA 1WHVA 1NPPA 2J9CA 4LFCK 5EX0A 2GHWA 3SBTA 2KZZA 1LAVA 4FJXA 2IYIA 1FXRA 1NGJA 2AZ3A 1VRUB 3MEDA 1VQ4N 5KFHA 4FW1A 1RT3B 4X4TA 2W1BA 3TO8A 1W2BM 3MX2A 2MLXA 2DCLA 4DFJA 3F73A 2V4RA 2KM8C 1KTVA 1TTHB 3DLLL 1JWWA 3ZZYA 1DLOA 4JI0F 3K5OA 2OKQA 4K0KJ 3FMBA 3UD5A 1Y9OA 4I2PA 1WI8A 2APOA 4LFBF 2DO4A 3QT8A 2CQHA 2GCFA 2KT3A 1TKZA 4P7VA 3G25A 2JJ4D 2D3OR 3H5XA 4QBUA 4O4GB 1RISA 1G1XA 3TAMA 4CT9A 1J5EJ 4LR7A 4YQWA 2DNMA 5KFBA 3Q0AA 5AQHA 2R8HA 3SMZA 1RA7A 2J9DA 1OMSA 5IM0A 4UOCA 4K8XA 2N4DA 1FE4A 4ZVEA 2Y0BB 2IVYA 2U1AA 4B1XB 4LSNB 2G8VA 2GWJA 3D9BA 4M63C 4IQXA 1RAAB 1J5OA 1Z6RA 3MWTA 1E6VB 5E5NA 1NGIA 4B3OB 4AHUA 2NNWA 2ASOA 2I9SA 2KFZA 3KK3A 3DAWA 2VPWB 2C2ZB 3BKUA 5KAKA 3ZCMA 2R7XA 4XH5A 2HIQA 2YV0X 4JKBA 4DZDA 2ASPA 3MGJA 2BW7A 3HHLC 2ZD1A 3M2RB 3WXMB 1QSSA 1U02A 1TMMA 5AQYA 3TVZA 4DN0A 1TL3A 4JRQA 1IJFB 4IXCA 4CGIA 1N32F 2O67A 1UP1A 4J9UE 3ZX0A 4RW9A 4XTTA 3BSAA 3CJKB 3LTOA 3RGIA 3MD3A 1TYQB 2DNQA 3SI8A 3KVGA 1GLDG 4B3SJ 5C2CA 1HBUA 4KV8B 1FRLA 5D6GA 4I9LA 2H65B 4KTZA 4DR3K 2Z1HA 1TL3B 4KSEB 3S7RA 1VBZA 3IKMA 1SUQA 4ZA1A 4WKRA 4JB8B 3NVKA 2V7YA 5CXTA 3D28A 3GCXP 3MN6A 5E7OB 2OCEA 1ZBIA 1RBOB 1S7IA 1SQEA 2O66A 1RHMB 1G4CA 4BS2A 3TAGA 2DD8S 3FBFA 2X7IA 4RNFA 4CF8A 3O9RA 4LF9F 4CEEA 1D1UA 1JQGA 3N79A 1IWGA 3UWTA 1N36F 2OO4A 4WF9Q 5CYMA 2YPZA 4IO1A 3I9V9 3AA5X 2AV5A 2EWHA 5KFKA 2RS8A 2LLZA 4O0NA 3BN4A 4DX8H 1ATSA 1X3NA 4C6AA 4MQ3A 5LMNF 1WG5A 4JI1K 3THYB 2IVPA 2RNEA 4I2QB 1W2IA 3G96A 5D77A 2DY4A 2WONA 1NRKA 3HVTA 4ZKAA 1RT2B 3KHHA 1GX6A 3CMAS 2HK2A 3DI6A 2VV5A 3N9UC 4UUWA 3ZSRA 3AQPA 1OPZA 4Z2XA 1HNIB 1Q9YA 4ES2A 2GS8A 3TSQA 2QA2A 1B70B 2GIQA 3MR7A 2E44A 3VHQA 4YFUA 2YKPA 2B6AB 4MLHA 3SBGA 1VQ7S 3J7AP 3JYTA 4TLQA 3VAIA 4B1ZA 3RVCA 4YDDB 2YWKA 1U6ZA 4JK9A 4NLGA 1FDAA 3DDNA 4K41A 1GOBA 3ATUA 2IOCA 4AQYJ 2RRNA 1IBMJ 1KSPA 4TU7A 1HX1A 2W6LA 2E29A 3KUEA 3OR1B 3E9LA 3CWJA 2QA4N 2P9EA 2QJ3A 4LSLA 5IXUA 3T6JA 2CG8A 1YJ9N 4B9VA 1NJWA 1LAWA 3O8MA 3I0RA 5DLFA 1VQPN 4R0EA 2KM8B 3I5CA 3CIPA 4NOHA 2CH6A 1P1LA 4YR2A 2AT1B 1YWXA 4A8MP 4FWPA 1I3AA 3QRPA 4OPHA 3VAMA 4CZGA 3Q23A 1SKRA 1MN9A 2WHOA 2HEKA 4E7KA 4IKFA 4Q45A 2VKZG 2VQEJ 3DOKB 4DPOA 4FLXA 4AXIA 5F1XA 1YRTA 4GMKA 4U9RA 5H9FJ 4JI0J 1HNZF 3J7ZO 1KKHA 1U09A 3UB5A 2EFPA 4JLHA 5GIOA 4G1QA 3R9LA 2GHVC 3FEYB 3AY0A 4GRSA 1K8AT 3ONQA 1T3OA 1Q8BA 2QW9A 3GYNA 1F60B 3AO2A 1KP6A 2QLBB 4NLYA 2FUG9 2ZF5O 3TZWA 2MHEA 2KB2A 1I5OB 1N56A 2P9UB 3EX7B 1N52B 4MO5A 1VQNS 1S7HA 5AT1B 1SJ4P 1CJKB 3OYHA 3QLHA 3GJTB 5KT3A 2D74B 1SI9A 1ZTTA 1LWEB 4DS4A 3IA0A 3QMQA 2NZ4A 3UO0A 5DG9A 3DLGA 1F0XA 1S0VA 2G1HA 2P9CA 1ATRA 3MMCA 1BG3A 3Q7BA 3N6NA 1IV0A 1L3KA 5J1PA 1BA1A 2XZTB 2XMAA 3AFGA 3LALA 1QD1A 3M1VB 1PAUB 2JDJA 1F1BB 2BJ7A 1BMQB 4X2BA 3RMAA 3POTA 5E41A 3TUZC 4ETZA 3I56S 5KFYA 3OY9A 3HSGA 2BX6A 2EFGA 2MZSA 1X9SA 4P71A 1K1SA 3I87A 1VQON 2DGVA 5BR8K 5CABA 3BS9A 2P9LA 1WOPA 5C10A 1HD0A 4OLOA 1HJOA 3O5BA 4EZ6A 3K5MA 5M1QA 5AQSA 1N33K 1JLGA 3A8KA 3C6UA 4W98A 4ZCKA 1NDPA 4FK2A 2DTUA 4UOGA 1RWOB 2J5AA 4OGEA 4ZN3A 1HKCA 4QU6A 3FUYA 4MJKA 5EWFA 5EHHA 1VSDA 3M5RA 4BY9C 4I2PB 1HPZA 2ASLA 3FZHA 4FZVA 3WNHA 2C3PA 2K2PA 3OR2B 1AFJA 4FK4A 1WDTA 5KFUA 2ASYA 2F9DA 6FDRA 2R7YA 1SVDA 5BPLA 1VQSA 2WAQD 1NOYA 2H1YA 4HH1A 4KJIA 1RKJA 1BWEA 3K8WA 2HK3A 3MURP 2GUPA 2GZOA 5C12A 4H4KA 2E5LK 2UXDK 4J9SA 1EP4B 2BYCA 5CYQB 2JVRA 3GIJA 2UUCJ 3H7HB 1DQ8A 5LL6Z 1FNOA 3C15B 3RAQA 2MY7A 1NDCA 4ZK7M 4H0VB 3N0VA 2FBYA 4AL5A 4WF9L 2LVWA 3M2RA 1S0OA 1RACB 3QIDA 2N7CA 2FSKA 2V67A 4ZJLA 1DT9A 5D0HA 2DHAA 4U6PA 3WIVA 3V9XA 3C14B 1WF2A 2P6SA 3H90A 3QT7A 4CJPA 5L46A 3PSFA 4DSJA 3QGIA 2E2OA 2CQ1A 3PJXA 4FPBA 3NGSA 1EQMA 4X66K 3CC2N 4B3SF 3DGPA 3NRBA 1RTZA 2LQ5A 4OYXA 3A5OC 1RAJA 3O1BA 2XY7A 3NCQA 2CNOB 2HGMA 3HFKA 2P9NA 2W7OA 3OUYA 3F0NA 4DTMA 4WCEQ 1Y00A 3DMJA 4DUZJ 1ZH5A 3CFPA 2KHCA 2OD4A 1VSLA 4FJ8A 3H59A 2MY8A 2B5JA 1BUPA 4LF4F 7FDRA 4WZQA 1KLNA 3SV4A 1D9FA 2ZHAA 4M7YA 2XCPA 2LA4A 4R79A 4H4OB 4USIA 4UOHA 1DTTB 4K4UA 2LYVA 4CK3A 1QTMA 1JLBB 3R97A 5M2PA 2GO8A 5E3PA 1LOUA 1JJ2R 3MMAA 3TSPA 3D7EO 3CEDA 5B08A 3M9OB 3ZTRA 3TX8A 4QIVA 1H74A 2CJQA 1NCLA 1NMEB 4IG3A 4RW4A 1RHRB 2P2CB 1ESVA 4WTOB 4ID5B 1SUQB 4TY8A 1EETB 1U2FA 3OTEA 4A48A 2Q36A 2RIJA 3C66A 4EHTA 2VOPA 1S5ZA 1SJRA 4ZMMA 4M3ZA 2HBJA 4DBQA 1KEKA 4IR9A 3ENBA 3HOTA 4Z4CA 3C8YA 4HACB 4KKOA 2EBEA 1VQLS 1A5XA 4WCEL 2FY8A 4B1UB 2KXHA 1KQGB 5JXSA 4FJLA 3WXJA 1J5EF 1I39A 2XLIA 4FJ9A 4WE1A 4GVBB 2XMTA 4PPZA 1TU0B 4DU8A 3CQXA 3D6MB 5BR9A 4Z4HA 1JLFA 5HL7L 4P2XA 1ATNA 2PFUA 2DPIA 1WNSA 3L2UA 2IA6A 4H4MB 5D4NA 3OFGA 4NLCA 1RDWX 3OT9A 2LU1A 3ICLA 2MJNA 1PJ7A 3C94A 1RHUB 2LXFA 4IJNA 5DDOC 5CY4A 2KDOA 5BJRA 1JL1A 4URQU 3VETA 4QAGA 1ZXOA 2M5YA 4Q8FA 2FJXA 5GAHU 3OFHA 4FS2A 3LPTA 5F8IA 5HL7Q 1NG9A 3MOJB 2ZUGA 2I38A 4CT8A 4C3LA 3C19A 4BRDA 2GIRA 3CCQS 4X4QA 3CDAA 3UVJB 4C3KA 1WG1A 3M2VB 4F4AA 2BKPA 3RBDA 4BQLA 4X4PA 1JKHB 4OYWA 4LF5F 1XMOF 3RG6A 3MAQA 2LSNA 3TANA 2WSCC 3VQTA 1R0AA 2CH5A 4J2AA 3MAAB 2C2EA 1X0PA 1T03B 4CJRA 3DKDA 4PKHA 2CVIA 4CNYA 3OL8A 3VQ6A 1NK5A 2ATCB 4JK7A 3VESA 3BSOA 2ZGZA 1CC8A 5AQIA 1AUSL 1C1CB 3THWB 3DOMB 2COLA 3BGFA 2W25A 4GMJB 1VLYA 1S1XB 4OX9K 4C4WA 1VMBA 1N6QA 4BRIA 4OZ3A 2NYIA 2AP1A 1H72C 2DVIA 1TAUA 5JVGQ 4EK2A 4OMFG 1YITN 2V8VA 4M45A 4DCHA 1HQUB 5BPNA 4Y3CA 3C6TA 4FZYA 1N36J 4BQZA 2W4PA 3AA8A 2QN6B 4Y1CA 1LQ9A 3BM7A 3VF0B 3NAEA 2W9CA 3ILOA 2QSWA 3HCXA 3EVOA 2VQFK 4DF8A 1IO2A 1RAHB 4IDHA 2QLXA 2ZH2A 4JI7K 4A8OA 2CG4A 2LFVA 5THWA 3D3CJ 3KLFA 1KHVA 1JLGB 4DCPB 2AJ1A 4JI2F 2DNKA 4DX7A 3FBBA 1QVGM 3GFZA 1X4GA 2C3MA 3MUMP 1U2CA 2R7VA 3H98A 3A0IX 2NCKL 4Z7CA 1VJWA 1RI7A 2NLWA 3CJ4A 3G8SA 4BR5A 3UCUP 3IRXA 1U2VB 4ZS6A 1GOAA 4FJMA 3DRPB 2IIHA 4IZ9A 4JYAJ 2XNRA 5J2QA 2KN4A 1NH7A 1NLKL 3R5DA 3EXCX 2IAJA 1N0UA 2RB7A 2CPYA 2VG6B 1LWEA 1GT8A 4BR7A 1JXLA 4CJ4A 4YOTA 1S6QB 3AGKA 3ZZTA 1OQ6A 2J8AA 2XG8A 4M5NA 4B9UA 3R27A 4DR4F 3LANA 1JCGA 1LFPA 5J2NA 4LFCJ 5H1SQ 3CJCA 4YY3K 4QCLA 1Q0NA 4RW7A 5H9EK 4USWA 1U8WA 7AT1B 4XIUA 4FVMA 4OKJA 3M2UA 4CJ7A 1R0BG 2QYCA 4ED1A 5EN1A 1Q82T 1EWRA 1XTZA 4CJEA 2UUBK 1X9WA 4IDKB 4M5MA 3AY9A 1HQEB 1IVZA 4IFYB 3IP0A 4LRBA 3THPA 5L1IA 5DGAA 3VGTA 3J81Y 4ECXA 1A5WA 1QVGR 4PXBA 3N5FA 1BQMA 3NGUA 1SS6A 3TR5A 3BV8A 4F0MA 2HHHF 3UIQA 2M88A 1VQYA 4AXJA 3W2WA 3CCJN 3THXB 1WEXA 3NCRA 2UXCK 3TAPA 4B3RJ 3F56A 3LZIA 1XNRK 4PRFA 4NYOA 5LMUK 4OZ0A 3ITHA 1FEHA 2RT3A 3ZZPA 4TY9A 2KU7A 3I55S 3D67A 4HR2A 4FNIA 1KAXA 4CESA 4RW6B 3BO2A 4U95A 3OFFA 2VHGA 1KWMA 3HSZA 4PG7A 4IJAA 1XUPO 3MEEB 2ZH9A 3BDEA 2YNIA 3LP2A 4CZCA 2MPUA 1FDDA 3HVAA 5E84A 3FGVA 3D54A 3MXIA 3VQ4A 2ZBRA 1X4EA 3SUOA 3Q8PB 5C2DA 4DZ6A 4M94A 1QSYA 2DFEA 4JKEA 2QV6A 3R5BA 4DJBA 1OS5A 3LPYA 3LPUA 2VUGA 1GH8A 1VQMN 3NAHA 3CC7S 1N34K 3IR5B 2Q6CA 1RT1A 3LM2A 1IKVA 1T9WA 3NWGA 3CC4S 2OD6A 3IRXB 3MMCB 3Q8UA 5DM7L 4JRPA 2YWWA 4L74A 2E5LF 1KVKA 2WB4A 1NJIT 3ZETB 5D3GA 3HOSA 3OSPA 1DTTA 1UJ4A 5LJWA 2NRWA 3Q22A 2E9TA 4Q2LA 5KPZA 1S1WB 3T5HA 2VU5A 3DLKB 1YJRA 1JJCB 3D2WA 3LP1B 4NMLA 4XO0A 1FKOA 4DL7A 2DH9A 3TX0A 2FC9A 4L3NA 3DXKB 1MWMA 2GUIA 4TQSA 3CMEN 3PRDA 2IFXA 4CTAB 3NMAA 4L73A 2OMOA 4JUZA 3NS6A 1S9EB 3FMWA 2X6NA 4J9LA 3IG1A 1IBCB 4C8ZA 2OA8A 4CFBA 2QT7A 4C8KA 3A8EA 1ZA2B 2CPIA 4E7IA 4F0HA 4EAHD 1HWIA 3RRKA 1F2GA 3HO1A 2J4RA 1EB0A 4YMEA 4JI1J 4EYHB 5JJBA 3VQBA 1N88A 4E1JA 1WD6A 3DMJB 4LBPA 2MGZB 2A6AA 3CJ7A 2V9KA 2RQKA 3PW4A 3MUTP 2XRIA 2POKA 1X5SA 2OTJN 4LF7F 4FLYA 1LW2A 2VASA 4B8AB 3M4XA 5DQGA 4NLPA 3SXLA 2BJEA 3R6MA 1QHAA 1RK8A 3K5LA 2B4PA 4CJKA 2KJVA 4JD2A 3DGPB 3CJ2A 1DZ5A 5DDQC 3FDSA 1VQ8S 1TUGB 1FVSA 3VALA 2CPHA 3P5TL 4JD2B 3MD1A 2BJ9A 1O0PA 3OYLA 2FLLA 5KFAA 5TKWA 1CJKA 2BQ3A 3IMXA 2P51A 1HNZJ 4P74A 4OV6A 4AM6A 4JYAF 4B3TK 3RMDA 1EETA 4USJC 2A6OA 3PM9A 1U0HB 4K7QA 2R8KA 4FVCA 3E01A 5HP1A 2GFFA 2IDLA 5F41A 5AE1A 1JK9B 3EZWA 2P8IA 4WKYA 1WWHA 3SSQA 3UN3A 3ZNUA 4PKIA 2MJUA 1V3ZA 2KVQE 1P1TA 1OYEA 4RWTA 4KBOA 4MK7A 3KLIA 1F3FA 3O9UA 1T11A 1RT6A 3RWUA 2VBWA 3FQKA 3B78A 4OO1J 3BGUA 4LF1A 3TZZA 3HSJA 4ECTA 3CPEA 2MQOA 3PEHA 4N76A 3ZTQA 3QIPB 4KGVB 4FYWB 3VMFB 1X4CA 2VQFF 4RUHA 1HBNA 3TZYA 1IBLJ 1GMUA 3GFXA 2PSZA 4HDHA 3Q7CA 5C2GA 3NGRA 2RE1A 4DCJB 3E01B 1EX4A 1N8RO 1RTIA 2I5JB 2H3EB 3U1NA 3FQLA 3GIIA 4DS5A 1RNHA 3EZ5A 1P9QC 2IGIA 3BF3A 3S01A 4GC6A 5L39A 4LF5K 1E4FT 3MFIA 3EMTA 4I6MB 3FSXA 2V63A 2Y9HA 5EWGA 2VFTA 1B0TA 1HI1A 2UU9K 1NHUA 4H03B 4YOUA 3FVYA 5IWAK 1TP7A 5HROA 2AX0A 2ZDOA 4MYTA 3I33A 2V2VA 3AVCA 2HQDA 2FGCA 3CJQA 3MK6A 2VC0A 3SFGA 3DDKA 1XMQK 4WZMA 2BOPA 1Y3KA 1M5VC 4ANEA 1JJHA 5BR8J 2CFXA 2X74A 3NGTA 3H3NO 3J7YU 3FK4A 5KG3A 3UI3A 3AARA 3PR5B 5HANA 2CWXA 5IV4A 1TUYA 2OANA 2NXEA 2AIRB 4HLBA 3ZLJA 1RT4B 2ZJQQ 1KVJA 3LF0A 4ETXA 2KT5A 4Z4IA 4C0HA 1RAFB 1Y5IB 4RLEA 4KIAA 5F2RA 3VQ9A 1WSHA 2WUSA 2B9YA 1TK0A 1IUJA 2JL9A 1SL1A 2YVSA 1RU1A 3PO4A 4JI4K 2UXBJ 3MCAB 4LF6K 2OP5A 4YNQA 3FE1A 1EKSA 2GBZA 4DV4J 4JKGB 2PY5A 4ED4A 4ID8A 3S9HA 3DRSB 3DLKA 1U6FA 4ZN1A 1H7WA 3T1HK 5DMRA 2F8TA 4A8QA 1S76D 3QZ8A 1JLEA 2XS7A 1T9YA 2V6AA 5CZ1A 2YY3A 1J2VA 1H2TZ 2YX4A 4KGZB 2QWQA 2BH1A 2Q3PA 2OEKA 1WSEA 4Q0BB 4MFBA 3RMCA 4ES3A 2LKZA 1FE0A 5L1LA 4OKEA 4PWDA 2UUCK 3SAHA 1LK7A 2FBTA 2B3TB 2NPIA 3OXLA 2X1AA 5EDWA 4BRCA 1UWBA 3CCMS 1X4DA 3NGYA 3LQVA 1VQ9N 4B9MA 3NCPA 3EY1A 3T9ZA 1P27B 2HBQB 2C28A 2I2YA 5J2QB 4X4UA 4DLGA 4HHUA 2XULA 2JX2A 2AP6A 2DISA 3Q8VA 2G0IA 1XNQJ 1FX4A 3CJ0A 2E1AA 4E0DA 1P8GA 2Q1NA 4LFAF 1FX2A 2DIVA 4WK1A 3MPYA 4LFAK 3MFHA 3I6PA 1RP5A 3L7PA 3T1YF 3HZGA 1CJTB 1T7PA 4JBCA 3BBFA 3KYLA 2WVBA 4JI6J 4EHUA 1SCJB 1TV6A 2I6WA 2F40A 4DL5A 4OZ1A 1GLEG 2MLYA 4TYBA 3EZUA 4PR6A 3FNNA 4CI6A 3W65A 4YUDA 2OTLS 2VDHA 4X65F 2ILYA 2E9ZA 4ZPDA 4WIQA 1DHMA 1YKWA 4ZVHA 1SJ1A 2CPEA 3MZIA 4C23A 4LF9J 3CCSN 5HJXA 2LXUA 3M30A 5AQGA 5FIIA 2R7QA 4KGKA 3CGIA 1ZBHA 4C1NK 4V19X 3ZEUB 4DMZA 4DV5J 2E2QA 5KFJA 2I1RA 2ZITA 2AD9A 4UW2A 2YNHB 4NASA 4DU3A 5I3QA 2VWBA 1QQOA 3U9DA 4NA1A 1M5SA 1S77D 2QL7B 4CDIA 1BQNA 2VA3A 3KHYA 3TQEA 4KH0B 3TAQA 1HKAA 3EE3A 2Y1RI 1VCTA 2F96A 4FWKA 1NPKA 4CZFA 1OJ4A 4EUVA 3K2YA 3QQCD 4OYPA 5K14B 2DRDA 4MIAA 1FEEA 2BANB 4NI2B 3M6WA 4TY8B 1TFWA 3ZX3A 1AZSA 4GKKF 2NZCA 4P2MA 1MU2A 3HX9A 1BCMA 4DTXA 3TABA 2XQCA 1QSLA 3FCVA 4CK2A 2CRLA 4DUZF 1HBOB 3W66A 1RADB 3W9HA 4RBTA 1C0MA 4O3NA 4DOZA 4BR2A 3H5SA 1DQ9A 4PQUB 2EFQA 4A2BA 2XY6A 1IBKF 2WC9A 2IM0A 4U8YA 2EWSA 1RWVB 2HOEA 1HBOA 3H4DA 3FBCA 3T3FA 5KFNA 1ZAWA 2GTDA 1F6TA 1RTJA 3ETOA 2BJDA 3DRRB 1RBRA 1JLAA 4YN3B 2O1PA 3CCTA 4N77A 3FR0A 1N34F 1FFGB 1ACMB 5KFIA 4NYZA 4RU9A 2IMOA 2QC3A 3AJ1A 4J9PA 3O08A 4ZP8A 2RDJA 3IWNC 2DY1A 1J53A 2DR9A 3NWRA 1XHZA 3SAFA 1M1KT 3BZCA 2Z58B 3HKZD 1N5TA 3LP0B 3DM2B 2W40A 3UKUA 4KHUA 2V2KA 3ASMA 4M7XA 4HUEA 1BDGA 1ZBTA 2BKNA 3CERA 4LF8J 1X7VA 1ZPVA 1MSWD 3V9ZA 1OQ3A 4LFBJ 1ZS6A 1YQHA 5F8NA 4DTPA 4CJUA 1HKBA 1ITGA 2F9JA 2Y1LB 2HYIB 1YAGA 3HI0A 4YDXA 1XJWB 3K58A 2E6LA 2G8WA 4J9RA 3UDVA 1UEUA 2HS3A 2FLNA 1NK8A 2ALZA 1I6JA 3CSKA 3M6GA 2ATLA 2IDOA 3G0ZA 4J2EA 2QM1A 5KPTA 3P3DA 1Q4RA 3A2FA 3U6FA 1HFEL 3IAS9 4B1WB 2FPHX 4IG0A 2R42A 4Z0UA 1SH0A 3CHWA 5JMVA 2HGLA 5CZVA 2B7BB 3CQYA 5J2NB 2AGOA 3H5UA 3LDNA 4QIWD 2YKNA 5GADU 2ASMA 3GR0A 1EARA 3T7ZA 1VHIA 3AD9C 2O3DA 4X64F 3BEXA 3KHGA 2ZEJA 3EE8A 4CJLA 2I5JA 3SSRA 1EAYC 4LJMA 2DNYA 4OI3A 1BY9A 4HVJA 4F0KA 2EK1A 1E6YA 2XO7A 3M3ZA 3RRGA 1HNVB 3AVIA 2ZFHA 3TAEA 3PJWA 2XMKA 5CAAA 2RU3A 3NF9A 2VPXB 1XMOK 3DU6A