1HNIA

Structure of hiv-1 reverse transcriptase in a complex with the nonnucleoside inhibitor alpha-apa r 95845 at 2.8 angstroms resolution
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
558
structure length
558
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
publication title Structure of HIV-1 reverse transcriptase in a complex with the non-nucleoside inhibitor alpha-APA R 95845 at 2.8 A resolution.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 130
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hniA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hniA05
2IGIA 3KLFA 3V4IA 2W9CB 2HMIB 3KJVA 3BSOA 4GVMA 2YNGB 1Z4UA 3CIZA 3KTQA 3QZ8A 5KFIA 4E89A 2IM0A 2O5DA 1MMLA 3MECA 3QEVA 4JV0A 4RW8A 3C6UB 2I1RA 3QINA 5KFHA 2ASLA 4DQIA 2F96A 2RDJA 1KSPA 3UQSA 4E7IA 3QGIA 4DS4A 2HNYA 3RB6A 4IDKB 5FDLB 3UIQA 4Z4FA 3TARA 4CJSA 2FBXA 4W5NA 3M9MB 4LSLA 4K4WA 2O4GA 1J5OB 1WSEA 5L1KA 1ZBLA 5CY4A 1HQUB 2QV6A 1N4LA 3SV3A 1IKWA 1KVAA 1LW2B 3K57A 1KRPA 5HBMB 4I7FA 3OY9A 1NK4A 3D5MA 4ZVGA 5DQIA 3NF9A 2KTQA 1HNVA 3ZCMA 3V9ZA 1A5WA 3NAIA 1QSSA 3OJSA 5KFTA 4NLRA 3RRGA 3G0ZA 5KFLA 4E1NA 1QS4A 4O44A 4TYAA 5F8LA 4Q43A 3NE6A 3CO9A 1MU2B 4KV8A 1REVA 2KZMA 4FM2A 3VN5A 2VG7B 3ZSQA 3KHGA 5KG7A 4Z4IA 2IJNA 2UVRA 4N76A 2OPPA 3ICLA 1NK9A 1G15A 4LSNB 4IR1A 4FJMA 2O4IA 3CJ0A 2OZSA 2HNDB 3L3UA 3QETA 2BR0A 2R8GA 2YNIB 4YR3A 2X6NA 3LZIA 3CFRA 1FK9B 4ZTFA 4PY5A 1TVRA 4BWJA 3VQBA 2B6AB 3RBDA 2AGPA 1KLMA 4CFDA 4LQ3A 4KRFA 1RT2A 3TQ1A 3G86A 1RYSA 4IR9A 3QNNA 4C8KA 4OKJA 3HP6A 3ULDA 4CEQA 1SH0A 1HPZB 3VQ8A 4QPXA 2WHOA 2W9BB 4QW9A 3C6TB 4ZHRB 1GX5A 4DL5A 5E41A 3K58A 3KKSA 2BQRA 1IKYB 4CEAA 4KO0A 5J2NB 4OPJA 3BSAA 4N47A 5F8JA 1LWEA 3O3FA 3RB3A 3G6XA 2C2EA 2R8HA 2VA3A 4FBUA 4KFBA 1UWBB 5J2PA 1T05A 1N6QB 3D45A 4M94A 5KFAA 1C1AA 4NCGA 3H5YA 3OYMA 4QWAA 3UDLA 1C0MA 3V9UA 2ZD1B 4ZPDA 4I2PA 3KD5E 5L1JA 4RW6B 3GV7B 4EBCA 2BRKA 3P5JA 1DLOB 3RMBA 3Q8SB 1S6PB 3QGHA 3VQCA 4CFBA 4J2DA 4JV2A 4OKKA 2FJVA 4CGIA 4G1QB 4PUOA 1RTDB 2W42A 3KK3A 4O4RA 3FSIA 1Q8IA 4RG8A 1S1TA 1S6QB 5JUMA 1TK5A 3HVAA 3S3NA 2HHUA 1JLQA 1HYSA 3NH1A 4I9LA 5SZTA 5DLGA 3AV9A 2D3UA 5I3UA 4FJIA 2ILZA 3V6DA 4TYBA 4G3IA 4H4OB 4ECWA 1NJZA 1RTHA 4MQ3A 1X9SA 4RZRA 4CFCA 4LD0A 1TL3B 3QESA 5KFJA 1NKEA 4ECXA 3PV8A 4E7LA 3U6FA 2D41A 4DSLA 1ZETA 1QAIA 3MEGB 4BACA 4Q0BB 3EY1A 3P83D 4IKAA 4CJRA 3MXMA 1Z26A 4HYKA 3AVBA 3AVJA 3CM6A 1SL0A 4ECRA 1TL1B 2GIRA 3AVFA 1JLBB 1EKEA 3K59A 1RYRA 4IFVB 3DRRA 3KOAA 4FLWA 2ZQBA 1IG9A 4E19A 4BE1A 1IKVB 4GC7A 3T3FA 1N5YB 4DL4A 1RBVA 1JLAA 2G8IA 5D3GB 1RT1A 4X2BA 3BJYA 2F8EX 3CDUA 4CEBA 5KT2A 4CEZA 4NLVA 3JYTB 3ZSZA 4NRTA 4ECYA 3VQPA 3V6JA 4ID1A 1CZ9A 4TLRA 3CVKA 1D8YA 3ZSWA 1TK8A 3S9HA 3L2UA 4CGHA 5F8IA 1RTJB 4FS1A 3CFOA 1I3AA 4M95A 1S1UA 2VA2A 1WSJA 4FJXA 3BQ0A 5DQGA 2RKIB 3AVLA 2PY5A 3NBPB 3NGIA 4BE0A 4W5OA 3SUNA 1VRUA 1TKZB 1L3TA 3PW5A 4NYFA 2IM2A 5C42B 1S0OA 2GC8A 2UVWA 3Q8PB 4EP4A 4O3QA 4OPKA 4IG0B 1DTQA 3KK1B 3OYKA 4RUAA 4RNNA 3V6HA 3PR5B 2YKMB 4CJ5A 4ELUA 4M41A 1L5UA 1W9HA 1RT4A 2FVPA 3PZPA 3FQKA 3IAYA 3MF5A 1EETB 5KT7A 4O4GB 3NMAA 1S1VB 3PJWA 3NAEA 1C0TB 4HUEA 2P51A 4CEEA 1VSEA 1NK6A 1RT6A 3QIOA 4O5BA 2BANB 4EO6A 2GBZA 2ZE2A 4ED8A 3QO9A 3NF6A 4C8OA 3HT3A 4I2QB 1NHUA 4W5TA 2WB4A 4CJ3A 3SJJA 3LAMA 3K5MA 5HRPA 2IOCA 4JS5A 4LH5A 4DFKA 2WONB 1VSFA 3DLRA 4CEOA 3SI6A 4MKBA 4Y2AA 3I5AA 3H4BA 3AVNA 4J2AA 4EEYA 2ZKUA 2FLNA 4HVJA 4Z4CA 3IRXB 2ATLA 3SI8A 2V4RA 2DFFA 1HMVB 4OLBA 3DOLB 4WFXA 2DTUA 4IH5A 3OLAA 3TVKA 4F50A 3M8PB 1TV6A 1C0UA 4TY9A 4C8NA 4KHNA 3LPUA 4R8UB 3OLBA 4K4XA 1SV5A 1XI1A 4F8RA 1D0EA 1X1PA 4HTUA 1TKXB 1WNSA 4CF2A 4M3WA 4FCYA 3AA5X 4CJFA 1JLEA 3KMQA 1I6JA 1JL1A 2P5GA 4KPYA 3M8QB 1C1CA 1LWCB 2I5JB 4K4SA 4YR0A 3H2LA 4KTZA 4M3TA 1BCMA 2OPQB 1RT3B 4PWDA 4ED6A 3ISNC 2AJQA 4YNQA 1K1QA 3I8DA 3KLEB 4IOBA 4M42A 5KT6A 5KGWA 3MXJA 4FJNA 3B6PA 1RBRA 5FROA 4IQXA 4K50A 4CHOA 3U3YA 4CIGA 4DMNA 2HNZA 1NK0A 4B8AB 3SQ2A 3AVCA 1W0HA 5KFZA 3SQ1A 4K4UA 1KHWA 5C5JA 1KHVA 3O4NA 1J9AA 1QAJA 2G8FA 4KREA 3VA0A 1FXXA 5KT3A 4F3TA 1J53A 4U7CA 2Z1HA 3FFIA 3N6LA 5KFQA 3QZ7A 3DRSB 1T03B 1QSYA 2P5OA 4IH7A 2BRLA 1DTTA 1YTAA 5J2QA 4J9OA 3HJFA 5KFMA 2Y1IA 2HVHA 4ICLA 2BGGA 5CYMB 4QAGA 3BR9A 5HLFA 4N41A 4WE1B 3N6MA 1VK0A 3QNOA 4XPEA 3KK2A 5KFNA 3VQ5A 4CF9A 4FLYA 2HWIA 4FBTA 4Y2CA 4O0IA 3OYGA 4DG1B 3DYAA 3FDSA 2AU0A 1EP4A 3C95A 3BGRB 4RW9A 1HNIB 3NF8A 4CJQA 3WNFA 3I5BA 5L1LA 1WAJA 1T8EA 1TKTA 2RF2A 1NK8A 1WSIA 4C8MA 4BDZA 5F9NA 4J2BA 3NGYA 4B9LA 2JEGA 1SUQB 4ID5A 5KG6A 2ETJA 3DOKB 4TY8B 1RAJA 4RNMA 3OYBA 3ZT1A 3NAHA 3KLHB 3LAKA 1LWFA 4FJGA 1XR7A 1UOCA 3WNEA 4HCCA 4IG3A 2ATQA 1WNEA 3O3GA 1JLCA 3E01A 2W7PA 1WSGA 3GIJA 5J1EB 4MIBA 2D7SA 1ZBHA 4PQUB 1S1XA 2XO7A 3RR8A 3L8BA 3DLEA 1BIUA 4DTJA 4LH4A 3UPFA 5HROA 3RWUA 5CYQA 1JKHB 1SV5B 4DU3A 1RDAA 4RUCA 1KVBA 1BQMA 2GV9A 2W9CA 2HMIA 4HKQA 4Z4HA 5DGAA 2XY6A 2G8VA 3KJVB 1XHZA 3V9SA 3ZT4A 3O3HA 4OJRA 3PJXA 3ZSOA 4N56A 4IBNA 3L2QA 3OL6A 2WOMA 1KTQA 3MR5A 4QCLA 4RW8B 1ITGA 3EPIA 2J6TA 5DK5A 4KHRA 1RT7A 2G8HA 2HNYB 3S3OA 3V81A 3PHEA 2XWYA 1J5OA 4H8KA 1T3NA 4AHVA 4DFPA 4LSLB 1QHTA 3I0RB 1RT5A 2W7OA 1RA6A 2RPIA 4DLGA 1U4BA 1LW2A 4ED3A 4CF8A 4FLZA 4KI6A 1IKWB 2G8UA 5HP1A 1RILA 1FKOB 5KFCA 3H59A 2D5RA 2HAIA 3G10A 3LP2B 4I7FB 3AO4A 3TABA 4F4ZA 3CDEA 5EWFA 1U45A 4U6PA 3OYEA 4FZZA 1KVCA 3TI0A 4NLWA 4RU9A 4O44B 1RBSA 3HVWA 1MU2A 1HARA 4RW7B 4O3OA 5DGBA 1BCOA 3WNGA 1JLGA 1IKXB 2W8LA 3H40A 4KV8B 1REVB 4WYWA 2CJQA 4WZQA 4DFJA 3SYZA 5KG4A 4CK3A 4KKOB 5CZ1A 4CJVA 2OPPB 4BWMA 3ZT2A 1NKBA 3AVHA 2HHTA 3EYZA 4EYIB 3DRPA 1ZBIA 5DG7A 1B92A 3MR2A 3HK2A 3KLGA 2FBTA 4ZMMA 4KHMA 1N48A 2G8WA 3NGDA 4DS5A 1NKCA 2B6AA 3NH0A 1IM4A 3CDWA 3HYFA 3VQSA 1ASVA 3ZSYA 1T94A 3AVKA 1KLMB 4B9SA 1TGOA 1JXEA 3VQAA 3QEPA 3QEWA 4XIUA 4DTSA 4RNHA 2W9BA 4ZHRA 4B9TA 1ZBUA 2UVUA 3VQ6A 2QXFA 5KRSA 1IKYA 1IO2A 4F3OA 5F8GA 4FJJA 5J2NA 2KFNA 5KFOA 5KG5A 4CHYA 4KO0B 2YNHA 2DPIA 3T5JA 1JLFA 2XCPA 3AVAA 3MAQA 5DG9A 1ZTWA 4DTPA 2KW4A 4GW6A 1L3VA 5F8NA 3PVXA 1LWEB 4E1MA 3DLBA 1UWBA 2YHBA 3AO5A 4QWCA 1N6QA 3AVIA 3L2VA 3MEDA 5F8MA 5J2PB 4K4ZA 4FW1A 1T05B 1RDDA 4O55A 4Y3CA 3ZSXA 4B9UA 4CHQA 2ZD1A 4NCGB 5SWMA 3SUQA 4M45A 4I2PB 4RW6A 2F8SA 1RCHA 1S1WA 5KFDA 5L1IA 1HQEB 4CGDA 4CECA 1S6PA 1C2PA 4ELTA 4JRQA 3KHHA 3LP0B 4J9MA 4B8CA 1SH2A 3SPZA 4DU4A 5KFYA 5CZ2A 5K14A 1HJRA 2IM3A 3RMCA 4ED1A 2OPSA 3KHRA 1RTDA 2GIQA 4PUOB 3LP1B 3KK3B 2A1SA 2PYJA 4AILC 2VG6A 3PW0A 1D1UA 2PYLA 3K5NA 1TAQA 1S1TB 1JL2A 2OPRA 4XPCA 3DM2A 5I42B 1VRTB 2XI2A 2OH2A 2EC0A 4M3ZA 4CEFA 4R5PB 4IFYB 1HYSB 1K1SA 1S9GA 1NJYA 4ZVEA 5KFXA 5I3UB 4NLYA 2BE2A 4WFZA 3FQLA 1VSDA 3OHBA 4FYDA 1CSJA 3KIOA 4GMJB 4I9QA 1RTHB 3I0SB 1TL3A 4NYZA 2R2RA 2R7YA 3H08A 4J9QA 3AO3A 3T5HA 4KHSA 2ITGA 4EBDA 2V4QA 3ALYA 3K5OA 3NH2A 4Q0BA 5KFVA 4FLTA 4JLHA 3T19A 3RAQA 1TL1A 4DTNA 4CHZA 1F21A 3PY8A 1UA0A 1EXQA 4ECQA 3CWJA 1XC9A 4KI4A 3RMDA 3DRRB 1IKVA 4J2EA 1C1BB 1N5YA 1JXBA 3DI6A 1WLJA 3TAGA 3M8SA 1JLAB 4B3OB 3GIKA 4PA1A 4ECVA 1RT1B 5KI6A 4O3PA 2YKNA 2XGQA 1U09A 4DTXA 4UQGA 5KG2A 3ZSRA 4J9LA 3PR4A 2HHWA 3RB0A 4ZPAA 3GQCA 1QE1A 2YV0X 1XHXA 4B9NA 2HB5A 4F4XA 4EP5A 2RDIA 4DQRA 4FZYA 1S9EB 4FK0A 3AVGA 3QYYA 3LWLA 1VSKA 1RTJA 4JS4A 4WXOA 3GV5B 1JXLA 1CXUA 1A5VA 4Q45A 4DSJA 3V6KA 2RKIA 1U47A 3NBPA 4DSIA 1S1UB 3AVMA 2VWKA 2C22A 2ASJA 2IAJA 2AX0A 1GOAA 3SNNA 1UA1A 3ZT0A 3DLGB 1DTQB 3HO1A 4IRDA 4O0JA 2QE5A 3RR7A 4O3NA 1BI4A 4AH9A 2YNFB 4TSXA 3DLKA 2FC0A 3CJ5A 3HVRA 3BSNA 1C0TA 2R2TA 1R0AA 3H5XA 1L3UA 4MH8A 3THVA 5KFBA 4FK4A 5C24A 3M9OB 3RBEA 1NK7A 1RT6B 4CERA 1WN7A 3MFIA 1D9FA 4TN2A 3QIPB 5KG3A 4L8RB 3AA3A 2ZE2B 4FJ9A 4KB7A 4OGCA 1CLQA 1UAXA 3QO9B 4AHRA 3LPTA 4DL3A 2Q3SA 4ECUA 2QKKA 2KQ2A 4FJLA 4MFBA 3GV8B 3AO1A 2WONA 3IGNA 1ZTTA 1S48A 4KE5A 3IRXA 2HHVA 1VSLA 3DOLA 2D0AA 5KRTA 4URSA 2Z1JA 1NJXA 2FBVA 4FW2A 1YTUA 1S10A 3OS2A 3ITHB 1TV6B 1C0UB 5C25B 1LV5A 3PW2A 4NLDA 3OYFA 3QIDA 2QKBA 1XWLA 3KD1E 3CJ4A 4MK8A 4H54A 5JXSA 4CE9A 4CGFA 1JLEB 1YVUA 1LWCA 4B9VA 1SKWA 2I5JA 4NYNA 2JC0A 1C1CB 3IG1B 3HHKA 5EWEA 2HHXA 3AO2A 3K5LA 3KLEA 4PWDB 4QWEA 4MK9A 4IRKA 4FJ8A 1VSHA 3NL0A 4CFAA 2AGQA 4FVMA 4HCBA 4KHQA 2FVRA 3TAMA 2JEIA 5L9XA 3KLIA 1SH3A 3GYNA 2HNZB 2XHBA 2ASDA 2LSNA 4KAIA 4CJUA 5KT4A 3FRZA 2FJXA 1NHVA 3NCIA 4K4YA 2BDPA 3HKWA 5KTQA 2J6SA 4AHUA 4CJLA 4CK1A 3FFIB 2RN2A 1QSLA 4TQSA 1RNHA 3IS9A 5HRSA 3DMJB 1U04A 3JSMA 1DTTB 4EO8A 3E51A 5J2QB 4YMEA 4K8ZA 3UR0A 4LY7A 1VSMA 5EWGA 4DTOA 4H4MB 2IC3A 1FKPB 3V9XA 1LAWA 3OYIA 5FRMA 3HP9A 3KK2B 1B9FA 3HSTB 4QOZB 4KB1A 4NCAA 3BGRA 3PX4A 2R2SA 1HNIA 4RW4A 3DYAB 3RTVA 4URGA 1EP4B 1YVFA 4ZP8A 3V1RA 3OYCA 3TWHA 1QTMA 5KFPA 1HRHA 2RF2B 5HRNA 1SUQA 3VQDA 2B5JA 4WZMA 3HVTA 3KHLA 1RTIA 4ID5B 3BREA 3MXIA 5F8HA 2Z1IA 1LW0A 5T7BA 5DQHA 3QLHA 4Q44A 3V1OA 4KB0A 4BDYA 1KFSA 2HHSA 3MEEB 4IKFA 3VQQA 1BQNB 5EUHA 2VG5A 4MK7A 2JEJA 1HYVA 1LWFB 5J2MB 2R2UA 4IH6A 4KTWA 3DDKA 1S0NA 2IS3A 2B43A 5DMRA 4NZ0A 4QWDA 4WXWA 4ED0A 1S1XB 4CHPA 2UUTA 4ECSA 2E6MA 4TQRA 4EYHB 2F8TA 3MFHA 3LWMA 4ED2A 5HROB 3KLFB 4E7HA 1JKHA 2YNGA 3V4IB 1ZYQA 4KHWA 1NOYA 3WNHA 1VSJA 3D28A 3OYHA 2R8JA 2R8IA 5EDWA 4ECTA 2FLPA 3VQ9A 1BQMB 1W25A 2X74A 2JC1A 3F73A 3C6UA 1BL3A 1BISA 3N6NA 3MECB 4CIFA 3SUOA 4IDKA 5FDLA 3NF7A 4E0DA 2OYQA 4CJPA 2WOMB 4QWBA 1RDCA 4Z4GA 1A5XA 4YQWA 4GC6A 2CKWA 4Y1CA 3OS1A 1HQUA 4OVLA 1RT7B 1N56A 3MR3A 5KT5A 3VQEA 3V81B 4FZXC 1TQLA 5HBMA 3I0RA 3G6VA 2IA6A 4KSEB 3SUPA 1RT5B 1TP7A 1FKOA 1HNVB 3LANA 2E9ZA 2XY5A 4CJTA 5HP1B 3LP2A 3PW4A 4EZ6A 2BQ3A 2E9RX 2FVSA 2OA8A 1BGXT 4J9PA 1TAUA 4E7JA 4CGGA 5KFSA 2VG7A 3PX0A 4RW7A 3PUFA 4MIAA 4DQQA 3RAXA 1IKXA 2JLEA 3OYNA 4LSNA 1ZBFA 1JLGB 3G6YA 4DL7A 2HNDA 2IJFA 4NLGA 4Q5VA 4KKOA 4DL2A 2YNIA 4E3SA 3OVNA 4YP3A 4FLVA 1FK9A 2XGPA 3BQ2A 1TVRB 3OL8A 4J9RA 3RMAA 3NGZA 3DRPB 3KMSA 4FXDA 1RBTA 4ZTJA 1LAVA 3CG7A 4DF8A 3KLGB 3TAFA 1YT3A 2HW3A 4Y1DA 3H5SA 2D3ZA 4ELVA 3VQ4A 1NJWA 1RT2B 4F2SA 3TAPA 3OS0A 1HPZA 4DTRA 3C6TA 4CESA 1KLNA 2R8KA 2AWZA 2AQ4A 5KFKA 3MR6A 1Y97A 1RDBA 2DPJA 4DLEA 3QERA 4HHTA 4CF0A 4FM1A 1BIZA 4KBIA 2YNHB 4Q8EA 4M3RA 4FM0A 4M3XA 1JLFB 4URQU 4CIEA 4C8LA 4KFBB 3V9WA 4CF1A 4MKAA 4M3UA 2IDOA 4NRUA 5HRRA 2IM1A 2VWJA 2ALZA 2FBYA 4FJ5A 3MEDB 3CFPA 3PX6A 4B9MA 4FS2A 2E6LA 2WCXA 4NLTA 3TANA 1DLOA 4HUGA 4Y34A 4BE2A 1HQEA 4NCBA 4G1QA 3I5CA 5KFUA 1S1WB 1X9WA 3LP0A 4K4VA 1CXQA 2IMWP 4DWIA 4CJWA 4DSKA 3SZ2A 3QEIA 5JS1A 3CJ2A 3ASMA 3PO4A 1S6QA 5K14B 1SL1A 1SKRA 3OYDA 2GUIA 3L3VA 3H98A 2OPSB 3F9KA 3LP1A 4AHCA 1EX4A 4Z0UA 3NFAA 3O4QA 2VG6B 2W9AA 1JLQB 3OYLA 5I42A 1VRTA 5KFEA 2OPRB 4R5PA 3DM2B 1QUVA 4H4OA 3V6DB 4IFYA 3SPYA 3HXMA 1L3SA 3H4DA 3SFGA 4NLPA 4FJHA 1O1WA 1S9GB 2XY8A 4O3SA 1TKDA 4J9KA 2BE2B 3ISND 4OGEA 3I0SA 2C28A 2C2DA 3BDPA 3MEGA 3Q8RB 4FLUA 4NLUA 5KFFA 1JLBA 3OHAA 3GIMA 2BQUA 3PW7A 3AA4A 2XRIA 4IFVA 4FJ7A 4KAZA 2ILYA 4ZP9A 2UVVA 2WTFA 3OL9A 1NK5A 2PZSA 3T5LA 3KLVA 3P1GA 5D3GA 3LZJA 4Z4EA 1C1BA 2QK9A 4YFUA 4B08A 4R0EA 1S9FA 1OS5A 2HWHA 3JYTA 1Z25A 1NNDA 1CZBA 4B3OA 3DI6B 1SL2A 2YHAA 5T14A 1NOZA 3RB4A 2YKNB 4CEDA 3CM5A 3NDKA 1S4FA 4LQ9A 2NUBA 4DSFA 4DTUA 4W5QA 2J6UA 3PO5A 1QE1B 2FVQA 4NLXA 5KG0A 1XR6A 3S3MA 4CHNA 1RDRA 1S9EA 2FVCA 1KFDA 4KHUA 2HVIA 3HM9A 4NLSA 3SCXA 4KTQA 5DG8A 4BDPA 3EPGA 3DLHA 2X78A 2FLLA 4DEZA 3ZT3A 1TKZA 2DFEA 1Q9XA 4NLQA 5C42A 1VRUB 2KZZA 5DLFA 3SFUA 4O3RA 4IG0A 3KK1A 3A2FA 2Z1GA 3U3GA 1GX6A 3NKYA 2YKMA 2XI3A 4N5SA 1ASWA 4AHTA 2XCAA 2IAJB 3DLGA 4DL6A 3D0PA 2P1JA 1RA7A 3H5UA 1U48A 3OYAA 1RT4B 1EETA 4W5RA 3VQ7A 4O4GA 1J54A 3QGGA 1S1VA 2D0BA 3SQ0A 4KHYA 2BANA 2YNFA 4M3YA 3AA2A 4FLXA 5KFRA 1BI4B 1S0MA 1X9MA 1Q9YA 3VA3A 3DLKB 1JIHA 4DQPA 1JX4A 1R0AB 2X6SA 3QEXA 4I2QA 5C24B 4F4KA 3QIPA 3BQ1A 4DTMA 2AX1A 4ECZA 3HPGA 2WRMA 3RRHA 4YR2A 3HPHA 2UUWA 1D5AA 3HL8A 3HPOA 3OSPA 3NHGA 4DQSA 4MFBB 1B9DA 4HUFA 3TR8A 4XO0A 3CYMA 1I39A 1HMVA 3L2WA 4K4TA 3M8PA 4ZP6A 1XR5A 2AGOA 4R8UA 1RBUA 3M8RA 4JUZA 4FJKA 4EBEA 1TKXA 3ITHA 5KGXA 1QQCA 1S49A 2IBKA 3LDSA 5C25A 5F9LA 4J9SA 2A1RA 3B6OA 3KKRA 2XY7A 1S5JA 3TAEA 4CJ4A 4CGJA 3M8QA 1C6VA 1GOBA 5FRNA 4CK2A 2OPQA 2HHQA 1RT3A 4K8XA 1D9DA 3IG1A 2OZMA 4F4YA 4ZPBA 4WYLA 4ZVFA 4J9NA 4FK2A 4DF4A 4ED7A 2B4JA 4CJEA 4Q8FA 1U49A 2G8KA 4WFYA 2DY4A 4ZP7A 2KFZA 2Y1JA 3EZ5A 3OSNA 1GOCA 4IRCA 4DU1A 4ZPCA 2WK4A 2FJWA 3TAMB 3KLIB 4RNOA 4OL8A 3GIIA 4F2RA 1IH7A 4CJKA 3OL7A 4OLAA 3DRSA 1T03A 5EU7A 3ZSVA 5JS2A 5KFWA 1T7PA 1SKSA 3CJ3A 3TAQA 1K6YA 2D0CA 5KFGA 3KNAA 5CYMA 1VSIA 1TK0A 3EZUA 3K2PA 3DMJA 4E7KA 4WE1A 4ICLB 4ZVHA 5HLFB 3IS9B 3Q8QB 1BHLA 2JGUA 4EZ9A 3JSMB 2V0NA 4NLOA 4DFMA 3OJUA 4F4WA 3M9NB 4H4MA 3IGVA 4DG1A 1FKPA 2C2RA 2DFHA 3LP3A 2W8KA 3LALA 2IC3B 1HYZA 3IN5A 4RW9B 2EHGA 5KG1A 4JV1A 2E9TA 1TKTB 4QW8A 1KCFA 4RW4B 4JRPA 2V9WA 1ASUA 3CQ8A 3DOKA 3BSCA 4TY8A 3V1QA 3SV4A 2EX3A 3KLHA 2E4LA 2B5JB 3HVTB 3T1AA 3MTKA 1RTIB 1WAFA 1S97A 4IG3B 5J1EA 1WSHA 3C94A 1LW0B 3MEEA 4PQUA 3QLHB 4CCHA 1JLCB 3L2RA 3E01B 1BQNA 3GILA 4DSEA 3SQ4A 4TXSA 5J2MA 4OKEA 3OYJA 2VG5B 4RNFA 3DLEB 2XC9A 4AHSA 3T5KA 5CYQB 1WSFA 2JEFA
chains in the Genus database with same CATH superfamily
4L6V3 4KR0B 4HDHA 4RBVA 2IGIA 5HMYA 3V4IA 3VQTA 4I67A 3KJVA 2C3OA 2YNGB 1Q0NA 1Z4UA 3KTQA 3VGLA 4E89A 1R89A 2IM0A 2O5DA 1R8BA 1V6HA 1XMQK 4JV0A 1SCJB 3R9LA 1JWWA 2I1RA 3VVUA 2QLBB 2ASLA 4E7IA 4X4NA 3J80U 3RB6A 4LRFA 2PD1A 5A8WB 1Q5YA 3R3TA 3NG8A 3UIQA 4DHVA 2N7CA 3TARA 2QT7A 2FBXA 5LMNK 4YDDB 2W2OP 2MQLA 1J5OB 5CY4A 1HQUB 2QV6A 3LOUA 1N4LA 1UVNA 4CBWA 3M2RB 1IKWA 3UE5A 4YOTA 3C15A 4NWBA 3K57A 2F40A 3IM9A 3OY9A 3NF9A 5DQIA 1FEHA 3NAIA 4AQYK 2B7CB 3CCUN 1UW4A 4FP9A 3G0ZA 1BWFO 1ZAXA 5IQ6A 2ZH7A 1ELOA 3R5CA 1MU2B 4KV8A 1REVA 2KZMA 5LY3A 4FM2A 2GELA 5KG7A 3PCOB 2ASYA 1NG9A 3VGMA 4RO0A 2OPPA 3N28A 3T1HF 4TVAB 1SIZA 3CJ0A 2OZSA 3QETA 3HSDA 4P2FA 4YR3A 1TL7A 1TVRA 2DH8A 2ZOMA 4V19J 4OZNA 2B6AB 3HF5A 1JJ2M 3A8EA 3RBDA 3ZTQA 2QYGA 4CFDA 3QSIA 1RYSA 2P9NA 4IR9A 3QNNA 3HP6A 2BABA 5K8NA 3MUVP 3WZ0A 2L41A 1APSA 1GLEG 3KWMA 5BREA 3FCVA 4GV9A 4KO0A 1IUJA 2PA8D 1Y9OA 5LMUF 1DZ5A 1WF0A 3BSAA 4N47A 2UXBF 3WXMB 5H1SV 3AY0A 1I5OB 4BRKA 2CQ0A 4C48A 2A42A 4I6WA 2G4BA 4LFAF 2NRWA 3HM8A 4B3TK 1VQ6N 1N6QB 1MROA 4UTGA 1YBUA 1X7VA 3H5YA 4I56A 1OY8A 2AEJA 1X60A 3MPUB 4OPHA 3KUGA 4I2PA 4WBFA 4OZ3A 5CZVA 3PKMA 2VOOA 2UU9J 1O51A 1T9VA 3U02A 2GO9A 4CFBA 1YX2A 3EEQA 3ULHA 4OKKA 2VFVA 4GNIA 4PUOA 1ROFA 3CMAN 2O3DA 4F9OA 4IXCA 5BR8F 3DLLQ 1Q8IA 2E1RA 1FXDA 5C2DA 2CG8A 3RSEB 5JUMA 4BRNA 1TK5A 4LF8J 4KJIA 3DDIA 4M5DB 2EFGA 2COLA 3NH1A 4I9LA 3IA0A 2E2QA 2LYVA 5AE2A 4CLSA 5I3UA 1WHXA 3CJKA 3V6DA 4TYBA 4G3IA 5F2RA 4CD1A 4F0MA 2Y3YA 1X9SA 3EICA 3QESA 3T9ZA 4JI1F 2G13A 3PV8A 4QIFA 1XERA 4AL7A 3EZWA 2D41A 3EXYA 1VBYA 1U8SA 4IKAA 4CJRA 3MXMA 1Z26A 2F8MA 3I9V9 3W65A 2GIRA 1N36J 1N32J 3OVSA 3AVFA 2RQMA 3K59A 1Q81T 1RYRA 2HSEB 4KH6A 5F0XA 5IC4B 3DRRA 4ZCIA 7FDRA 1IG9A 4E19A 4WQ4C 1DT9A 4DV2F 1PKUA 5AQOA 3QFHA 4HLBA 2X3GA 5HI7A 4X2BA 3MM9B 1ZA2B 1XNQJ 2H4YB 4FWOA 4DB3A 4NLVA 3JYTB 4O23A 4NRTA 3OTOJ 1XMOF 4JYAF 3Q89A 3P8BB 4WTOB 3MPYA 3JSYA 3VQPA 3H2UB 1CZ9A 2PGCA 2FSKA 1M0SA 3OVBA 3PYGA 3X1LB 3S9HA 2Z2ZA 5F8IA 3VERA 2UXCK 1S1UA 5H9FK 3WEEB 1ILYA 1VFJA 4RWXA 3OUYA 2HMPA 3PW5A 4NYFA 2GQ2A 4FZVA 2BE9B 2BJ3A 2GC8A 4X4RA 4O3QA 4OPKA 2K7KA 4KPCA 3WHIA 2QM1A 2W2QP 2YKMB 1LNQA 4ELUA 2DGXA 2GS8A 2N3OA 4Q7AA 4M41A 2J0QD 1KWMA 1GLDG 2W4CA 3FQKA 5IWAK 2VFSA 3IAYA 3G25A 4HL9A 1I94F 6AT1B 4O4GB 1OJ4A 3NMAA 3HBTA 3M6WA 4HUEA 2B9YA 3M8WA 2GBZA 1RCOB 4RJVA 2YQ1A 2ZH1A 4ED8A 3VF4A 3JTOA 4PEOA 1H72C 4C8OA 3TVZA 5ETRA 1WWHA 2WB4A 4CJ3A 2HURA 3K5MA 4NA1A 2WB1D 2YHXA 2ATCB 3I5AA 4P71A 4DUZF 1RISA 3GR0A 1KC8O 4OLBA 4H4KA 1WHVA 2BOAA 2ZITA 2DTJA 4L74A 2EFVA 2HG4A 4F50A 3M8PB 4DU7A 1C0UA 1RWVB 4USIA 4EHTA 4K4XA 1D0EA 2HGLA 4HTUA 4B1YB 2VYPA 4CF2A 3QT5A 3ZETA 4FCYA 3DLJA 1SVDA 5SUHA 4U8VA 3G87A 1YJRA 4BG8A 3BB5A 4IOAQ 2I5JB 1J5EJ 4YR0A 5L38A 3BZCA 1BCMA 4PHTX 4PWDA 5GAHP 4IOBA 4FPIA 1RJJA 1HLUA 3MXJA 2F8HA 3B6PA 1RBRA 1F3VA 4L3NA 3T7ZA 1YTYA 4ISFA 3CJAA 4K50A 2RH3A 2FHJD 1TFWA 4CHOA 3BP8A 3U3YA 1NK0A 1WBBA 2YBVA 2FUG9 1KHWA 2XMWA 1J9AA 3M2UA 4KREA 2LDYA 3CJ9A 2HSTA 2IFXA 3QZ7A 3W2WB 1RKIA 1T03B 2J7WA 4YOXA 4DR5F 4WJBA 3IC1A 1XMQJ 1CC7A 2HVHA 2QEXS 5CYMB 4X4TA 3TTFA 1QAYA 2OKQA 3KK2A 4DI6A 5HN0A 2ZOGA 4DR2F 4DG1B 4C6AA 3FDSA 3SDEA 1M5HA 3VAFA 2DIUA 3VR1A 3AH6A 3WNFA 1WAJA 3F56A 2RF2A 4KGVB 4BDZA 3AAQA 1NGDA 4J2BA 2VWBA 1SUQB 4ID5A 3VEWA 4AQYJ 3DXKB 2PFUA 4P6QA 5BPNA 4NI2A 2QLXA 4BRPA 1LWFA 5CXTA 3MWBA 4CZLA 4LR8A 1WNEA 3MMJA 3O3GA 3E01A 2RAQA 2W7PA 1ZBHA 4PQUB 4LFCF 4ENOA 3GCXP 5DDQC 2E5IA 3IMQJ 3SIPB 3UPFA 4F36A 1NDCA 1RBAA 4FWKA 5MLCQ 4X64K 1SV5B 2OSQA 1KAXA 3AD9C 4WCEL 3R7BB 1HWIA 1BQMA 2XLIA 1HI1A 2XSFA 5DGAA 1B70B 2ASPA 3KJVB 2YH1A 1FXLA 3O3HA 1VQ7S 4IBNA 2EBEA 2XS5A 2DCUB 2HF4A 3EPIA 2O8DA 1WG1A 5E5NA 5DK5A 3TZXA 2ZWHA 4KHRA 3W9IA 1UFLA 2G8HA 3O1WA 1HQ2A 2GHPA 2IBOA 3PHEA 3CTRA 2A1BA 4BQLA 4AYBD 3RW7A 3TUJC 2MLZA 2MEWA 4JI0J 3G6ES 2NYHA 3AOCA 4PG4A 1IKWB 2G8UA 3EVOA 3GR1A 5KFCA 3AAWB 4UUWA 2YTCA 2ZH2A 4L3KA 3G10A 1ZOTA 5FPDA 2E1PA 4PXEA 4JKEA 1FF2A 5TKWA 3PYFA 5CABA 3TI0A 2HQCA 1B64A 4NLWA 3F9MA 2P9CA 4OIXA 4RU9A 2GQQA 4OFZA 1S6UA 5A8KA 4O3OA 2V8PA 2W8LA 1U26A 4KV8B 1REVB 4WZQA 1RDWX 1RLCL 4CK3A 1VQ4S 3EVWA 4CJVA 2OPPB 4BWMA 4B17A 4JKFA 2DO4A 4IQMA 5CD4A 2HHTA 3N4PA 3VEOA 3SJHA 2LQBA 3QAUA 2PA3A 1YJNS 2C2KB 2AV5A 2DR6A 4O8KA 1N48A 3QB0A 3NH0A 1IM4A 3CDWA 3HYFA 1XNRJ 3J7ZO 4B9SA 1YITS 1JXEA 3BH6B 3UNYA 3ILLA 3VQAA 3QEPA 4DTSA 4NLBA 2W6KA 5IS2A 1WEXA 2P9NB 2W9BA 2ZWPA 3OVAA 5AQXA 5KRSA 3U9ZA 2MKSA 1C0GA 4KO0B 3ETMA 4F3MA 5LSRA 5DG9A 1U1PA 1ZTWA 4PZVA 2KW4A 1L3VA 4GW6A 1MWYA 3OT9A 1UEKA 2NRTA 3BN4A 3DLBA 1XC3A 4BGAA 3L2VA 3UKRA 2N4CA 4K4ZA 2V5HG 1Q95G 2O8BA 1WUUA 1MROB 4KH5A 4B9UA 2QEXN 1NGBA 1AA1B 2ZD1A 5SWMA 3W5XA 3A12A 4PR6A 4NX9A 4I2PB 2CJXB 1RXOB 1S6PA 1C2PA 3KHHA 3GG1A 2CQBA 3ID6A 1P6TA 4OX8A 5K14A 2JH3A 1YJVA 3FZBA 1X4AA 1RTDA 3A13A 4PUOB 3WC0A 3LP1B 4R79A 3CC4S 3NEKA 2ZJQQ 2ZBPA 4CTAB 2VG6A 2VF3A 1TELA 3CDAA 1DQAA 1JMTA 2OPRA 3DM2A 4M3ZA 4QS9A 1G3OA 5H9FJ 1S9GA 1NJYA 4CH0S 5I3UB 2CGJA 4NLYA 5AJ3F 2CZVC 4CBUA 3CB4A 1MG7A 1CSJA 1U2VA 3KIOA 1SJ3P 2XYGB 3I0SB 3O80A 1Y3KA 3H1QA 2R4FA 4PG6A 3T5HA 4KHSA 4D3HA 4XEIA 5EGYA 1QVFM 4Q0BA 5KFVA 2NXNA 1OY9A 4DTNA 2IA0A 4CHZA 1F21A 5IWAJ 1UEVA 3VAKA 3CWJA 1GAOA 4KI4A 1HD0A 2GO8A 3RMDA 3DRRB 3CCJS 5K5MA 3DHXA 4J2EA 4BRGA 1NGAA 1Q53A 3GWCA 3ZFVA 3R6GB 1F2GA 3DI6A 1WLJA 4QYZJ 1W2IA 3M8SA 2DR5A 4WWSA 2R7UA 3GIKA 4DR6F 4ECVA 4O3PA 2XGQA 1U09A 1HWLA 4A8QA 4MYTA 3CQXA 2HFZA 1NPKA 3RB0A 3G6EN 3DFEA 3GQCA 5EX3A 1Q86T 3A3OB 4BY9C 4EP5A 3H42A 2WBMA 5AQPA 1IV0A 3I6PA 3B82A 4FK0A 1X4EA 1F3FA 3SAHA 1Y3JA 4ZITA 1RTJA 4JS4A 3GV5B 4BR4A 4RBTA 3L3CA 3PIPL 1HHSA 4Q45A 4DSJA 4UY85 4DSIA 1S1UB 1AT1B 3BYRA 2PC6A 1BE4A 3HD1A 2CQ4A 2XNRA 2O8CB 1KXPA 3R8YA 3OUYB 2BA9A 3MOZA 8AT1B 1Q82T 2XS2A 1O5JA 2IAJA 3SNNA 3ZT0A 2CPEA 4JB8B 1VQ4N 2KL8A 3HO1A 1VQOS 4BVOA 1LXNA 1YJNN 4AH9A 2CZ4A 3E66A 1VQPS 3J8AA 2FC0A 3HVRA 1C0TA 2RS8A 1R0AA 4YOWA 2P9IB 3THVA 4IOXA 1NB7A 4FK4A 2B9WA 1WN7A 3MFIA 3ILIA 1D9FA 5LMNF 3G71S 5DM6L 1IJFB 2Q0UA 2X1BA 4BS2A 3AA3A 4ERDA 1UAXA 4DL3A 2M7SA 2QKKA 3BF3A 2M3DA 4MFBA 3GV8B 1Q81O 3AO1A 4CNZA 1ZH5A 2JWLA 2MKIA 3E9LA 1DGKN 1IJEB 2IRYA 2Q97A 4BBYA 1UJ6A 1H38A 4GMKA 4A8WA 5AZJA 3NOCA 3ETOA 1TZ0A 4OZ5A 1LWXA 5KRTA 1WKKA 2KRBA 4URSA 5E3RA 4OHXA 1YTUA 1S10A 2JZ5A 1C0UB 2QWRA 3CPWM 1GMVA 2ZUAA 4ZVTB 1LV5A 1GXLA 4NLDA 4NXMK 2F9DA 2W2NP 3CCSS 1TU0B 3KD1E 4JI6K 2GIFA 4A5AA 3R1HA 1IBKK 2W1BA 1H2UX 4OHVA 2GJFA 2JC0A 4P73A 4ANDA 5BRHA 3CC4N 4PWDB 1FKAF 4IRKA 4A48A 3C7NA 2W2PP 4FVMA 4EMDA 4HCBA 1VBXA 1SC3B 1HNZJ 2H5JB 4ZJLA 3TAMA 2QN6B 2FY1A 3GYNA 2VDIA 2BJ9A 4JKCA 1NH7A 1BDGA 3RBZA 1RFQA 2DJWA 3M2UB 4LF7F 4F3QA 2QC3A 3ONQA 4USTA 4QZVB 5A8RA 1RLDA 2RN2A 3D6MB 5M1KA 1UL3A 2B9XA 3JSMA 5C0YA 4BCAA 2VQEK 4LY7A 5EWGA 4DTOA 2VQFJ 1HL6A 2CNKB 4OI1A 1LAWA 3CCJN 3KK2B 2NRHA 2OELA 4A8XA 5A2QO 3WXJA 2R2SA 2KXHA 4RW4A 3T1YF 3RTVA 3OW2M 1YVFA 4ZP8A 2XLKA 3V1RA 1MN9A 2G2ZA 2CQHA 5KFPA 1GNKA 3FZHA 2RF2B 3UW1A 3NNAA 1RADB 1WSRA 3CXCR 4WZMA 5ETMA 3IR5B 3EWGA 4ID5B 2VFRA 4RBUA 2Z1IA 3R5AA 5DQHA 3TA1A 1YUWA 4YDUA 2GW8A 2HHSA 2VBYA 2JEJA 1LWFB 4JK8A 3EXCX 5EX0A 2DRBA 5GAHI 1LK5A 1S0NA 2B43A 1JCFA 2CH6A 1LOUA 4QWDA 4ED0A 5L8RC 4CHPA 5DDPC 2UUTA 2KM8C 3EGWB 1HD1A 3UDCA 4TQRA 5LJ3Y 1FD8A 3LWMA 3EDQB 4E7HA 1JKHA 2IVOA 1NOYA 1RBLA 1IG8A 3D28A 1VS3A 2FJDB 3CJQA 3VQ9A 1BQMB 4LRBA 3AGRA 3C6UA 4MJKA 2UZAA 5MLCV 2E5JA 2Q36A 2V68A 2A41A 4F7VA 4IDKA 5FDLA 1VQPN 3TNVA 4E0DA 4ZVQB 1K0VA 5E3CA 4BLGA 2O8DB 1YG0A 1X4DA 3DOMB 1NGEA 3G71N 3MPVA 2HYIB 3T6BA 3VQEA 4NOHA 5B08A 2HFUA 4FWQA 2CQDA 4WU3A 5KAKA 3U4LA 2QWOA 4KSEB 1UVIA 3L09A 4X4OA 5JJBA 2QG9B 2FJBB 2XY5A 4CT8A 4CJTA 4EZ6A 2QXLA 2IIHA 2AIRB 2UXCF 3CGIA 1TAUA 1TTHB 4CGGA 3M6GA 4AL6A 3W60A 2QA1A 1YI2S 3N0VA 5A8KB 2CPFA 1PJ5A 4LSNA 4GKJK 3W63A 2FD2A 4OYAA 3UCUP 4E3SA 4YP3A 1GLJO 3KJNB 1V9OA 3TR5A 3CCSN 2X1AA 5CA5A 1VAZA 3WQPA 5A76A 3D66A 1P1TA 5H9EJ 2LXFA 3RMAA 3NGZA 1RBTA 5HANA 2HHHK 3L7OA 3DXMB 4IDHA 1SAZA 1FRMA 5E3AA 1DRZA 1RT2B 3F0NA 5AQGA 3TAPA 1HPZA 2QWLA 4CESA 5HJXA 3K9JA 5KFKA 1DKGD 1RDBA 2DPJA 5D78A 4DLEA 3FE1A 5ETVA 4FM1A 2YX1A 3KUHA 3WX4A 4M3XA 3G9CA 4DV5K 1VRQC 4URQU 4FOIA 1WHWA 1NH8A 4CP5A 3V9WA 4K0KK 2QMWA 3U1MA 2FBYA 3CFPA 2V6AA 1AW0A 3R3LA 1MA9B 2O8BB 3BBCA 3A8JA 2OSRA 4NYPA 3EN9A 4DR4J 3VVTA 2OJ3A 2XWXA 4BE2A 3J81Y 1IBMK 2EVZA 4G1QA 1LEOA 2K2PA 5KFUA 3VGSA 3QWUA 3BYPA 1X9WA 4K4VA 3QEIA 3FCHA 3PO4A 5K14B 1SKRA 1WC4A 3H98A 3F9KA 3GJRB 4YEAA 2JFDA 3BO2A 1HNXK 1WTFA 3R9PA 3ENHA 3O4QA 2VG6B 5I42A 1VRTA 2VBZA 3UVJB 5KFEA 2OPRB 2DR8A 4R5PA 3DM2B 4PYAA 1IVZA 3DJCA 4ID8A 3HXMA 2VH7A 5AT1B 3UR3C 1S9GB 1T9XA 1QVGM 4O3SA 4J9KA 4DX7A 3H6EA 2DO0A 4OHYA 2C28A 2CVEA 1U2VB 4JI8F 3MM6A 2M5YA 4ZKAA 4DV3J 3MMVA 4EAHD 4YOEA 1GTEA 2XRIA 4IFVA 4R0JA 1RHRB 2CQIA 4PXDA 2BACA 1K9MT 2NPFA 4OYOA 3DU6A 4M5LA 2V7ZA 4B1WB 4Y28C 4HHUA 4WIIA 3I9ZA 1T9UA 2VPYB 4OPAA 4M63C 3J7YP 1ITPA 2GQCA 2QK9A 4B08A 3IR7B 2XYPB 3B8AX 2E8AA 1OS5A 4JI2F 3SSRA 1FHTA 1YDLA 2AT1B 1N33K 4ZLJA 1E4FT 3DI6B 5J1PA 4OV6A 2AJ2A 2YHAA 4DR3F 2M9KA 4A8SA 2NCKL 2YQ0A 3RB4A 4I4BA 3TJ9A 2FHOB 3NDKA 2CRLA 3EO3A 3RW6A 4MO4A 1HBUB 1Q5VA 2J6UA 3MD1A 5FLXU 2ZJRL 1S9EA 4C3LA 4KHUA 5AFUA 3HM9A 3IFRA 3DGPB 5DG8A 1YKWA 2UUBJ 3DLHA 1URNA 5E3QA 1Q9XA 1B7FA 2QA4S 5C42A 5JMNA 4WP9A 5DLFA 3O4WA 3JSRA 1YI2N 1HBOB 4C11A 3OV7A 2Z1GA 4X64F 4WCEQ 3U3GA 1GX6A 3UKUA 2EWHA 4BQZA 1ASWA 4AHTA 4JI6J 2IAJB 3DLGA 2LQ5A 4DL6A 1IBKJ 1RA7A 3QFUA 1WB9A 4OI3A 4CO2A 4W5RA 4B3RK 3NGUA 4KHYA 1DEJA 4OO1J 2GHVC 4WFBL 4DV1K 1X9MA 2MY8A 2AZ3A 1R0AB 2ZDOA 4PWUA 2GV1A 3ZTPA 2ZH8A 2Z4PA 4DTMA 2MQQA 3AQOA 3JB9k 2ABYA 3MEKA 3HPGA 3RRHA 2UUWA 3KXDA 4JV5F 5B0GA 2HS3A 2G1DA 3GIRA 5D6GA 3G8QA 2E20A 3OSPA 2GX8A 3OBIA 2R7TA 3NHGA 1OPZA 4DQSA 4MFBB 2DHXA 2VGMA 3Q2SC 4P7VA 1HR0J 4DV4K 2V7YA 4TU9A 2Y8YA 4ZLLA 1JJHA 4K4TA 2FIUA 1FXRA 5AZJB 4A8OA 2DK2A 2RIJA 3QATA 2OMOA 2DGVA 3QAEA 2PMHA 4FJKA 2AF6A 1S49A 2IBKA 4H5VA 1PIEA 4UZBA 3O9TA 3H20A 3C6HA 3KKRA 1DQ8A 3TAEA 2AYBA 4CO5A 3M8QA 4IO9L 4H4KC 5B0BA 3LDLA 1FCAA 4HH0A 2HIQA 4WQ5A 1NDKA 2R7SA 2EFOA 3IG1A 4GKKF 4KH4A 4UT4A 2W2MP 4QS8A 4J9NA 4CH7A 1WBDA 3CMES 4DF4A 5IV4A 5AQSA 1Q82O 4Y2MA 3EZ5A 3GJQB 2FSJA 1GOCA 5M1QA 4ZPCA 3TAMB 3MDFA 4KHPK 4K2JA 4RNOA 4OL8A 3GIIA 1P8GA 4QR1A 1YRUA 2ZM6K 5EU7A 3WQTA 4FN5A 5JICA 4K43A 2OEMA 3TZYA 4ITSA 3MZIA 3IBCB 5KFGA 3TO8A 3DMJA 5A8RB 4LF6J 4ICLB 5HLFB 1NLVA 2NLWA 3JSMB 2V0NA 1RAIB 3OJUA 4Y6IA 4H4MA 1UJ5A 5F3ZA 4FVUA 3VTHA 3HSGA 2NZTA 2Q79A 1KEKA 4NYOA 1FRLA 2CQGA 1A6LA 1VC0A 2VL1A 4RW4B 4V19S 1T6CA 3ENVA 1KDNA 2QA4G 3DOKA 2HQDA 2E4LA 1NGIA 4W98A 4ED5A 4WFAL 3T1AA 1S97A 1WG4A 1HW9A 2F9TA 3CCVS 3MEEA 1Z1ZA 3CCQN 4HACB 3SQ4A 3BH7B 4AFFA 5J2MA 4OKEA 1U25A 3DLEB 4NB4A 4AHSA 1RQ0A 3T5KA 1BWVA 5CYQB 2JEFA 3QT7A 1UZHA 3FK4A 5C10A 4M8LA 3O8MA 3KLFA 3MX5A 4CO0A 2W9CB 2HMIB 3N9UC 2W7AA 1E6VB 3BSOA 3CIZA 3GLJA 4IWVA 2K3KA 1MMLA 3K17A 3CD0A 2UU9F 2XS7A 2QSWA 4RW8A 4OZ2A 3C6UB 2J0WA 4GVBA 1KSPA 1BO5O 3D9BA 3D2EA 4IDKB 5FDLB 3M1FA 4X66K 5IT9Y 4CJSA 3HHLB 1KBRA 4LSLA 2CFXA 1RWPB 4FKYA 4I6MB 2CNLB 4LF4J 3HI0A 2H65B 3SXLA 3TEHB 4OV1A 2NQPA 1LW2B 2P6TA 1KRPA 3OFEA 3NOGA 4DCOB 4I7FA 3D5MA 3ZCMA 1UP1A 4DV5J 1W7AA 3A8YA 3NGKA 1QSSA 3EJMA 3OJSA 5KFTA 1Y5LB 3RRGA 2NXUA 3PIPQ 2V8HA 4WTYA 1H0HB 1NSAA 4JI7K 4O0NA 3ZZTA 1LK7A 3FZ2A 3N79A 1F2HA 4G65A 4JBCA 4N76A 3TQEA 2MGZB 1WOOA 1G15A 4LSNB 4IR1A 4JK7A 3A5OC 3FLCO 5AQWA 3L3UA 4JKAA 3ULEA 1RE1B 2BR0A 3LZIA 3CFRA 4ZTFA 2PDAA 3WXKA 4PY5A 1R6VA 3VQBA 2I8EA 4V19X 5DM6Q 3TQ1A 1FESA 3CMEN 1S79A 3D0GE 4OKJA 3ULDA 4HTLA 1SH0A 1HPZB 2WHOA 1NJIT 3IWNC 5BYQA 4JD2B 2BQRA 1IKYB 2V52B 4CO1A 3R2DJ 2VUGA 3JAMY 4FNIA 3AOAA 2QTDA 4OPJA 2K8GA 4ER8A 1LWEA 2VBXA 3JTPA 3G6XA 1BG3A 4B3MJ 1BMQB 3H8YA 2VA3A 3FEYB 2F65A 4KFBA 5F41A 1UWBB 1T05A 4P75A 2E1CA 3VTIA 3D45A 4KGMA 1C1AA 4NCGA 4OZJA 3OYMA 4QWAA 2EPIA 3UDLA 3V9UA 4DDFA 4ZPDA 3SK3A 4XH5A 5D15A 1TYQA 2UUAJ 2EG2A 2RE1A 4JHDA 4RW6B 1RB0A 3GV7B 3JQMA 3BPDA 2BVZA 4L3QA 3Q8SB 3W9JA 3VQCA 1N33J 4EIAA 4JV2A 4QU6A 3WX8A 4G1QB 2VOPA 1B99A 2HK3A 1PC4A 3FSIA 2VPXB 1FD2A 1D09B 2Z57B 3R27A 4NZ6A 3HVAA 3S3NA 3OPKA 1YIJS 1S0VA 1EWRA 4DPUA 3SSSA 4DX5A 2MPUA 3M30A 3CCVN 2ILZA 5AQFA 3FC9A 2HF3A 4FOEA 4L76A 1XEZA 4CIOA 4UQTA 4CLPA 1NJZA 1JJ2R 1RTHA 1NSQA 4MQ3A 2G2YA 2HQGA 3LO3A 4CT9A 4LD0A 1TL3B 4KYZA 3WXLA 4ECXA 2DGQA 2GMJA 1BC6A 1CJKB 2ZC3A 2MKCA 4LR9A 4JKBA 4DSLA 2KT2A 3M32B 4BACA 3P83D 3MM6B 3AVBA 3CCMS 3AVJA 4M5KA 1FNMA 4O5FA 5F0UA 2ACMA 3RBXA 2YKPA 4IFVB 3I82A 4D3GA 2VQEF 3KOAA 2QJ3A 2ZQBA 3O08A 4BE1A 3MCAB 1Q4RA 2F1FA 1VIXA 3T3FA 1N5YB 4USWA 2G8IA 2FB0A 2O8EA 3M6UA 3GYGA 4OHWA 2GMLA 2Y0BB 1NHKL 3ENOA 3O1BA 2F8EX 3CDUA 4CQ1A 4CEBA 1T0TV 4ECYA 3B6BA 5DO2A 2O67A 2M52A 1AYEA 4LF9F 2BJ1A 2RMLA 1BA0A 1CJVA 3CVKA 1BD6A 4AXIA 2C3UA 2DGTA 2ZWOA 4CI0B 2CPXA 4CGHA 4ES2A 2V51B 2LEPA 3CFOA 3HFKA 1E4GT 1C4AA 2VA2A 2QX0A 3BQ0A 2RKIB 2PY5A 3NBPB 2KVIA 4IO8A 4BRQA 1RTZA 2E1MC 4W5OA 1VRUA 1OH6A 5C42B 1R0CB 4MDAA 2UVWA 2OHDA 3Q8PB 1ZM3A 4C11B 2QWPA 1R31A 5CYJA 5BN9A 4PABA 3T1HK 2V4JB 1F5AA 4X4UA 1W9HA 1RT4A 2FVPA 4LJMA 2X3DA 3PJWA 3CJ8A 2P9UA 1WC5A 4CEEA 1VSEA 1S72S 1RT6A 4O5BA 3J7A1 4EO6A 5FIIA 1V5IB 2ZE2A 4IO1A 2YVSA 1M1HA 2OEKA 1VIOA 4W5TA 1URRA 2OP5A 3Q8UA 2ROGA 1Y11A 2DD8S 3J7YI 3LAMA 1NGHA 4H0VB 3ZYYX 1VBKA 4H0OA 2IOCA 2WONB 1M90T 1K9MO 3DLRA 4CEOA 3RVCA 3ZZYA 3AVNA 4FDFA 5LMUK 4NEYA 4EEYA 2FLNA 4HVJA 3IRXB 3Q2TC 3NLCA 3ZZRA 3MM5A 1T9TA 1J27A 3TVKA 3MN6A 3D2WA 4LFAK 2K1RA 4TY9A 3IRWP 1M5OC 3LPUA 3R5BA 5G0RB 5JVGL 5DETA 3L6QA 3Q24A 1XI1A 2I7NA 4M3WA 3HJVA 2VJUA 2WSCC 1GFWB 1FJGK 2YX7A 3KMQA 4CNYA 2HFSA 3IFEA 1JL1A 4KPYA 3M8QB 1LWCB 3HHLD 4K4SA 4KTZA 4ED6A 2Z58B 4H0PA 4YNQA 1AROP 3KLEB 4M42A 2KB2A 5KT6A 4ZA1A 3UD5A 4KBOA 3IXQA 1YIJN 3GFYA 1GT8A 4CIGA 4DMNA 2CQ2A 3SQ2A 3AVCA 1ULRA 3SQ1A 4K4UA 1KHVA 3O4NA 2RILA 5AQQA 1QAJA 1OMSA 2G8FA 3J80O 4A57A 1Y10A 1R43A 4OX7A 1RAAB 4U7CA 1FRKA 2HBZB 3GPAA 2QRRA 4USUA 2NZ4A 2CPIA 4OMFG 2C2NA 2RRNA 1YTAA 1H1VA 1T3VA 4K0KF 1SZ2A 5THWA 3D6TB 3KG0A 3QNOA 4AT1B 4XPEA 5KFNA 3VQ5A 4Y2CA 3D0HE 4O0IA 4X66J 3T9NA 3OYGA 2V69A 3I5BA 3TW0A 1T8EA 2CPDA 1TKTA 2BJEA 4M5NA 4M5GA 4C8MA 3TRGA 3NGYA 1FWLA 4C1NK 4NXNK 3WIUA 2ETJA 2VFUA 3DOKB 4RNMA 1HNXF 2WVFA 2BM0A 1HNWF 2XO6A 4IEIA 3KVGA 3LAKA 5E33A 4FJGA 1XR7A 4DV6J 3WNEA 4IG3A 3ADAC 1D9AA 4JI7J 2PN6A 1DFDA 4JI5F 1BIUA 4DTJA 4LH4A 1K8KA 1U2CA 2BKPA 1TR0A 1ZM4A 5AE3A 4RR5A 4DU3A 1RDAA 4RUCA 1KVBA 2GV9A 5EY4A 3L4BC 3UDEA 3PNIA 1QQOA 4HKQA 2CJAA 4Z4HA 2HVZA 2BOPA 1XHZA 2OGUA 3ZT4A 5D0EA 1PJ7A 3ZSOA 3H25A 3L2QA 3OL6A 1N5VA 3T6JA 3UWTA 4QCLA 4RW8B 1CJUA 1ITGA 1I94K 1S72N 3NVKA 4GVBB 3O44A 1VHIA 3V81A 1RWWB 1VQ5S 4H03B 2XWYA 1LOTB 2HGNA 1J5OA 1T3NA 4AHVA 4LSLB 3CCZA 2E7XA 3MURP 1HI8A 3M2RA 2W7OA 3UFCX 2HFNA 2RPIA 4DLGA 3D4JA 1DHMA 2ZHAA 4ED3A 3FGUA 4CF8A 4FLZA 2WC9A 2CQ1A 1NWKA 1RILA 1FKOB 3H59A 2QL5B 2FHJA 2HAIA 4I7FB 3AO4A 5CH7B 3NWGA 1TFYA 2GEMA 5GAGP 2B9EA 4QR2A 1R27B 4DUZK 1JXVA 2YCHA 4FZZA 2FC9A 1KVCA 1X3MA 2JWKA 3BBBA 1MU2A 1HARA 4RW7B 4X4QA 4U67L 3WNGA 1KD1T 2V2KA 3GFHA 5CZXA 4WYWA 2BXJA 1S22A 2KG1A 4DFJA 3SYZA 3UO0A 3G2XA 4U8YA 1MNEA 4G9ZA 2VB6A 4BC4A 1TL5A 1ZBIA 1RWNB 5DG7A 3ULEB 1B92A 4B3RF 2P9SA 2HZVA 1RDUA 3M6VA 3HK2A 1Z05A 4WFBQ 3HSJA 1VQKS 4ZMMA 3H3NO 2H5IB 4DS5A 1CBKA 2B6AA 3X3UA 3A5NC 1TGOA 2BJDA 2V2ZA 1T44A 4RNHA 3GE9A 4ATNA 3QICA 2QXFA 1IO2A 4F3OA 1V4TA 2KFNA 5KFOA 4CHYA 4YDXA 4DXLA 2XCPA 2OCEA 1WOSA 4DV4F 1LWEB 5F3TA 1MDUB 2EFNA 2YHBA 1YBAA 2OTLS 1N6QA 1U24A 5F8MA 2C2OB 3WC2A 3GMGA 3O6WA 4BHQA 4FW1A 1T05B 4DR5K 1RDDA 4Y3CA 2GVZA 4NCGB 1X5TA 5FJ4A 2HFOA 1U1LA 4A59A 4NLCA 2F8SA 1A0OB 1TYQB 3HT0A 1S1WA 5KFDA 5L1IA 4CGDA 4JHDB 2ZDPA 4GRSA 4DPTA 4IO9Q 2RUGA 3ZZOA 4UY8O 4DR2K 5KFYA 2GVDA 3HOTA 1U1RA 4YOUA 2OPSA 3KHRA 2GIQA 4DUYK 1EKRA 1KTVA 2V50A 5E7OB 4HTIA 1TAQA 4F04B 4M5DA 2RRAA 4OX9K 2IMOA 4K5SA 5L9NA 2EK6A 4CEFA 1KVKA 4FNHA 2HBKA 2ZJPL 4IFYB 1AUSL 1JNRB 2UUCF 2EW9A 1AXQA 1EB0A 3M8YA 5AQNA 3PRBA 2QI2A 5ETNA 3S7RA 2QW9A 4LFCK 1RTHB 3J7AP 3PACA 1RACB 4NA2A 1FDDA 5U47A 4DCHA 3IP0A 2ZM6F 2W24A 3AO3A 5ETLA 1L3KA 2AZ1A 2CJYB 1Y00A 2XNQA 3K5OA 2NRXA 2XMVA 3V4MA 3T19A 3RAQA 1N34J 5LL6Z 1F5BA 4X4VA 4RCHA 5BYRA 1XC9A 4CO4A 5C2GA 4K5RA 1XQIA 3SLCA 1NMDA 3CD6N 4KQZA 4ANEA 2DH9A 4FVCA 1WC6A 4B3OB 1KC8T 1VQ5N 1F1BB 4WYBA 5KI6A 1ZA1B 4ZVUB 4DTXA 2MDAA 2HHWA 2VV5A 1SB6A 5CD4H 5LMUJ 3SSQA 2HB5A 3O9RA 4FZYA 4WFAQ 3CCLS 4M7XA 2UXBJ 2L08A 1CJVB 1VLYA 1U1NA 2CH5A 3M6XA 4LMZA 3LWLA 4X84A 1JXLA 1XBWA 2YI1A 1QD1A 5IQQA 2HRUA 1VK8A 3VF6A 1GOAA 2XZWA 1UA1A 3DDNA 2MQNA 5K8PA 2J9DE 4YS2A 2VQFF 5I3PA 1UTAA 3CEDA 3RR7A 2F4VF 2OUGA 1GMWD 5BR8J 3DLKA 1NDPA 3BN7A 1VQKN 3CJ5A 3BSNA 1QVFR 2P9UB 1ZAWA 3RBEA 1NK7A 1RT6B 4LF2A 2XMJA 2UXDK 2DNLA 1PGZA 2ZE2B 4FJ9A 2GJIA 1FJ7A 4KB7A 1CLQA 4AHRA 5AQIA 1X5SA 1HKBA 1CG2A 1LXJA 1WI8A 4FJLA 5E0OA 4OZ0A 2A6AA 3FBFA 3C8YA 3IGNA 4NA3A 4JI1J 2QLFB 3O1LA 4QR0A 1FRIA 2FPHX 1YXQA 3EGVA 3LDNA 1NMNA 2IRXA 5IT9O 3PKYA 4OLPA 2OTLN 2LKZA 4OLOA 3ITHB 2K1RB 4K59A 1UJ4A 1OO0B 4I6AA 5JLFA 2IVYA 4DV2J 1EWQA 3G96A 3W66A 2EK1A 1R8CA 3CJ4A 4WP3A 2HQFA 4H54A 4TU8A 2DEJA 4CE9A 4CGFA 3MAAB 2I5JA 4QS7A 1XMOJ 3DU5A 4JYAJ 4A62A 1T9YA 5EWEA 2B3TB 1H7WA 2CA9A 4QWEA 4MK9A 4FJ8A 1KVJA 3TX8A 4Z7YA 2AGQA 4AM7A 3C2PA 5CE3A 2FVRA 4WQ5C 1SH3A 3K2YA 2CWXA 4RUBA 5AJ3K 3FRZA 1NHVA 2X1FA 3NCIA 4K4YA 1XIQA 4YHHK 3HKWA 5KTQA 5AQTA 4X4SA 2CG4A 4CK1A 4CYUA 3ZZ0A 3NS7B 3IS9A 3UE2A 1C0FA 3LTOA 4EO8A 4FWNA 1NSPA 4YMEA 3HX9A 2ZC4A 3RU0A 2HZCA 2BJ7A 3FJ2A 1I94J 2NYIA 2X51A 4J37A 3V9XA 2WW8A 3JAMO 3NMRA 1M90O 3VEYA 1PYOB 4A2AA 4ZVRB 3R1LA 4QOZB 4HI2A 4NCAA 3QJPA 1CJTA 1YRXA 4A61A 4URGA 1H73A 3HFVA 1NZ8A 4X62F 3CPWR 1QTMA 4BVPA 2F5GA 4DR6K 1H2TZ 1AZSB 4NZ7A 1SUQA 3VQDA 2B5JA 3EVMA 3BF1A 1FNOA 3FZMA 3PEJA 3DXKA 5T7BA 3CCLN 4F02A 4DUZJ 4IKFA 2PIIA 3MPDA 5EUHA 3LDOA 2VG5A 1HYVA 1G99A 4FO0A 1BOTO 4GO5X 3DDKA 5ADXH 1OQ6A 1NSKL 2YQ3A 2KJVA 4WXWA 3O9SA 1WF1A 4ECSA 2IVMA 2DNNA 3QJLA 3J7ZT 3PEHA 3HFZB 1WHYA 1J6ZA 1VSJA 1JB0C 3JXUA 3OYHA 1IJJA 2R8JA 4OYPA 4ECTA 2FLPA 4OI0A 2OTJS 2X74A 4ZIWA 4UOFA 1BISA 3N6NA 3MECB 2YWEA 1PC5A 3DHWC 1RAFB 4CIFA 3SUOA 3CIMA 3NF7A 3SAGA 3AD7C 4CJPA 2O8FA 2P9GA 2CKWA 1CJUB 5B0AA 4Y00A 4Y1CA 1CVJA 2MZSA 4A2BA 4H5WA 3MR3A 3V81B 2CJBA 5IC6B 5DM7Q 1TQLA 3AA9A 5HBMA 3QFPA 2IA6A 4KH0B 3SUPA 1VQMN 1HNVB 3LANA 3EX7B 3VWSA 4CLKA 3OW2R 2GX9A 4JKGB 2R7OA 3PW4A 2RU3A 2XZTB 1IN0A 3CUNA 3GL1A 1BGXT 3W3DA 5EXWA 1NM1A 4DR5J 1MN7A 3HKZD 4DV0F 3PUFA 3TA2A 4DQQA 3AQPA 5GINA 1ZBFA 1UVLA 3G6YA 2B51A 2XQCA 3M8ZA 4Q5VA 2BEFA 4EU0A 4DR2J 4JEPA 4FLVA 4UZCA 3IM8A 2XGPA 2LDIA 1FFGB 4H0TB 3GJTB 2P9SB 4ZTJA 1LAVA 5K20B 3J81U 3U9DA 4Y1DA 2RU9A 3VQ4A 1HX1A 4JI4F 3ENAA 2ZBCA 3C6TA 2DNZA 4BC9A 3SBGA 2DHAA 2LQJA 5CCMA 2R8KA 2AWZA 3HOSA 1X4HA 2PBDA 4C2MA 4ZPTR 4IFEA 2L9NA 4HHTA 4JP8A 1Q8LA 3ZTRA 4F0KA 5GAHU 4Q8EA 4FM0A 4C3KA 1VQYA 4LF7K 2BKNA 1S7HA 1VK3A 1ZC6A 1H98A 1R8HA 1KKHA 1SQKA 3IAM9 3QNWB 3OBWA 3I4PA 4P72A 5HJYA 3PX6A 4B9MA 4FS2A 4E8UA 3TANA 1DLOA 4UOHA 2GVZB 5GAGI 4YY3F 2GAGC 2ZNZA 2JX2A 4NCBA 3I5CA 3GSIA 1S1WB 1FJGF 4IEEA 4AUKA 5M1FA 4ZPVR 1LFPA 2XYHB 3PRDA 3T1YK 3K89A 3ASMA 2HRTA 2GVDB 1S6QA 3H90A 1SL1A 3OYDA 4FYWB 3L3VA 4BR7A 2OPSB 2R7XA 3LP1A 2ZF5O 4CTAA 3NFAA 1FRJA 4LIRA 4LBIA 3NXZA 3VV2B 1JLQB 1GTHA 1KD1O 4CZCA 3OYLA 3P5TL 4TKTA 5K9FA 4E1JA 4C8ZA 4H4OA 1PJ6A 2KYZA 2LQ9A 1Y64A 3SPYA 2FZKB 1L3SA 4B3SF 1VC5A 1O1WA 1RUSA 1WC3A 2MZRA 5IT0A 3CE8A 3I0SA 2APOA 2U2FA 2XULA 1JLBA 2BQUA 3AA4A 1IXKA 2RVJA 2ILYA 1QHAA 2OTJN 3PSIA 1HHTP 2YH0A 4DR1K 2WTFA 3CNQP 4CW7B 4USJC 4DX8H 1GQEA 3T5LA 3P1GA 2H1YA 3PXGa 4JN4A 3P38A 3HRGA 4FYYB 2GGPA 4HT5A 1KQSM 3MX2A 5T14A 4CEDA 3CM5A 2MHNA 5HMWA 2FYXA 4NXNF 2NUBA 1QAXA 4QIEA 4I0WA 1EQYA 3PO5A 4NLXA 4BROA 1EHWA 3S3MA 4CHNA 2VD3A 3KJFB 3LGMA 2FVCA 2Z56B 5E2QA 5B7WA 4O8UA 1S6OA 4NLSA 3SCXA 5AQMA 2LEAA 2PEHA 3ELHA 1TKZA 2DFEA 2F7VA 3KWIA 3NNHA 2KZZA 3BEGB 2OMLA 1VGYA 4PPDA 3KK1A 1U8WA 2G9OA 4PAAA 3A2FA 2O8CA 4J90A 4YB7A 1S57A 2KN4A 4U9RA 3AD8C 4B1VA 2P1JA 1QVGR 4EWTA 4CI6A 3H5UA 4ZLNA 1U48A 2HBRB 3HMJG 3VQ7A 4LF5F 1S1VA 2D0BA 2BV3A 3GBTA 1Q18A 2BANA 4M3YA 4KC5A 1Q9YA 1MWMA 2PEBA 3DLKB 4DQPA 2GMHA 2P9IA 2F9JA 4M5JA 1FW6A 3QEXA 1RSCA 2DNMA 3BQ1A 1YJUA 2KDOA 4ECZA 4C7QA 1BUXA 3HLUA 3HL8A 2OI2A 5AJ3J 3ZTSA 4IYQA 4G1PA 1H7XA 4LREA 1PBAA 3OTEA 2XMUA 3TR8A 3F41A 4XO0A 3CYMA 4KGZB 1I39A 3U1NA 1HMVA 4ETZA 2XEXA 2XHWA 3ZX3A 1K44A 3O2IA 3HZGA 3TX0A 5KOWA 5K8OA 3GZ7A 3MCOA 4R8UA 1RBUA 2V8DA 1VQ8S 1TKXA 2E5LF 3LDSA 3B6OA 4BC7A 2XY7A 4YORA 1S5JA 2PMWA 1C6VA 3VGVA 3N4QA 4CK2A 4WK1A 3HZ6A 4DR6J 3VAIA 1CULB 3SAFA 2VONA 5IFMA 2DNPA 2LLZA 2OZMA 1HBMA 1YWXA 3LM2A 4WYLA 4DBQA 4FK2A 3MWPA 5L39A 2MB0B 4CJEA 2CPHA 5HOOA 4WFYA 1WDDA 5GAEI 1IM6A 1WTBA 3SCJE 1VJQA 2WK4A 3J81j 4B02A 5D4NA 4PWWA 4JAXA 3AAPA 3OL7A 1PO6A 3FR0A 2UYTA 2MZJA 3F2KA 4BR9A 3K8WA 4JI8K 3NRBA 1CZAN 2J8AA 4DR7F 3FUYA 1VSIA 2N82B 2J5AA 4CYUB 3K2PA 4WE1A 5AFUH 2M70A 2AJ0A 3IS9B 2LU1A 2JGUA 2CWKA 4LFBK 4NLOA 3G8TA 3IGVA 3THYA 2MQMA 1X8DA 3D68A 2DFHA 3LP3A 5HK4A 3H46O 4FSVA 2JDJA 4PPZA 4RW9B 2EHGA 3FZLA 2Y1LB 2KH9A 5KG1A 2CNNB 2RE2A 4JV1A 5LMNJ 5JVHL 1KCFA 2ZH5A 2JFKA 1CJTB 4JI2K 4CRJA 1ASUA 3OR2A 3CQ8A 4DUYF 4TY8A 2XMTA 3V1QA 3SV4A 3EKSA 4LF1A 4JI3F 2G0CA 4DR3K 2EX3A 4ILLA 1SIWB 2V63A 5IT9U 4P10A 2B5JB 4X65K 1TUYA 4OX9F 2W6LA 1XTZA 4K8RA 3MTKA 2ZJPQ 1WAFA 3SMPA 3IBFB 3ZC4A 3EM1A 1WSHA 5J1EA 3C94A 1JLCB 3LPYA 3TZZA 3E2EA 3IO1A 3LPEA 4TXSA 2CNOB 3BKUA 2VG5B 1FE0A 4YB6A 5IOLA 2DY9A 1JCGA 2NS1B 4B3MF 1OQ3A 2VODA 1WSFA 1DURA 1RHMB 4CBXA 3CO0P 3CJSA 2GNKA 1VYAA 1JJ4A 3A5MC 5LXYA 4GVMA 1XMBA 1T95A 3QZ8A 1FTCA 4B1XB 4WU2A 5BJRA 3KNGA 3QEVA 2FXUA 1B3TA 3TVYA 1UETA 3MTJA 4DQIA 3MCPA 1X5OA 2F96A 1F6TA 2RDJA 4BRIA 4DV7F 4CVNE 4DS4A 2BW7A 5I9EB 2O8FB 3DOMA 4BG9A 4QIGA 3M9MB 2O4GA 1WSEA 5L1KA 3RRKA 5EOYA 2RSQA 2Q6CA 2MQOA 5HBMB 2I6WA 1ATRA 1BLUA 4JV5K 4PRFA 4LF7J 3SMSA 4FF2A 1HPMA 3TPQA 1WEYA 3DC2A 1NRKA 3U1LA 5KFLA 4E1NA 1SJFA 4O44A 4TYAA 3JAMU 5F8LA 4Q43A 3IMXA 2CPJA 4B3TJ 2DB1A 2NUUG 3GFZA 5L46A 1K0TA 3ZSQA 2A0FB 1VQ8N 4ILHA 3FEXB 5CQGA 2IJNA 2UVRA 3D7EO 1HWUA 3ICLA 2VKRA 2AJFE 1U7LA 1HW8A 4FJMA 1HKAA 1ZBSA 3K8VA 1W2BM 2DHSA 2R8GA 3T1YJ 3MUTP 2D74B 2RHQB 2IYGA 2QO3A 4ZIVA 3DXMA 2HZAA 2AGPA 3VOVA 1NPRA 2ZVIA 3EDRB 4GKKK 1IR2A 3OFFA 1RT2A 3G86A 2UXDF 4C8KA 1V5VA 4CEQA 3VQ8A 3C6TB 4X4PA 4ZHRB 1GX5A 4DL5A 5E41A 3K58A 3NMUA 3WT0A 2IDEA 4XK8C 4CEAA 5J2NB 1FEEA 3G82A 1VCTA 4ILGB 3DXBA 5B0EA 4PG5A 2GWJA 4AXJA 3ET6A 2QTWA 3N01A 1M5VC 1WELA 3O3FA 5E84A 3RB3A 4C0BA 2QWNA 5G4DA 2C2EA 2HKEA 4H5TA 1WEZA 2R8HA 5AQYA 1CQMA 3L4IA 4FBUA 1Y0HA 4FWLA 3WUHA 4OJ3A 3IWXA 5HL7L 4M94A 5KFAA 4ZK7M 3P31A 4Y2KA 3JXOA 2MZQA 5FLXO 3KD5E 4U96A 3MN7A 2LMIA 2BRKA 1N8RT 3RUBL 1DLOB 2KO1A 2A5XA 3QPIA 2C1EB 2NXCA 5D0HA 1VDHA 4CGIA 4OI6A 2W42A 3KK3A 2HFVA 3JSBA 3OTCA 1S1TA 1FERA 3D6RA 1S6QB 3TSPA 4XAKA 1RABB 5A6WA 2E2PA 1PYTA 2HHUA 2EI5A 3LGHA 5SZTA 3UVJA 2D3UA 2MJUA 2NLXA 2R9LA 4FJIA 3R97A 4H4OB 4ECWA 2UXCJ 3THXA 3UN5A 3UN3A 2B8PA 1MMNA 1P8ZA 2ZVSA 4CFCA 3KDOA 4ZLPA 5KFJA 2QFIA 3FKBA 3NNCA 2RB7A 3U6FA 3A5LC 4YHHF 1LFWA 1ZETA 2GWKA 2EXUA 2B4OA 3EY1A 1R0BG 3EUNA 4HYKA 1TL1B 5I4MA 4W4MA 2D0OA 3M2VA 2JL9A 1JLBB 1FFSB 4IJNA 3U8XA 2ROPA 4BR0A 1YF5L 4P9SA 1ESVA 4FLWA 2VBWA 3EGNA 1VR6A 2UU9K 5F0WA 1IKVB 3QMQA 4GC7A 1NGFA 4DL4A 1Z6RA 1RBVA 1JLAA 2HBLA 5CHIA 2Y8WA 2BZ2A 3BJYA 2IDLA 1FX4A 5KT2A 2GGPB 5HO4A 3ZSZA 5ETSA 2QWQA 1EKSA 4DHYA 3DRXA 4ID1A 4TLRA 1HBUA 3C66A 1T9WA 3FBEA 1TK8A 3L2UA 2P6SA 1PAEX 4FS1A 1I3AA 1F60B 1TMJA 4M95A 3DGPA 4FJXA 5HVHA 5DQGA 3AVLA 2BTFA 3NGIA 2KHCA 4XDCA 4BE0A 2MQ8A 1TKZB 4F0HA 2IM2A 2WBNA 1HBOA 2RQ4A 4WFNQ 3MAHA 2GA7A 3KHYA 3BS9A 1GLAG 3LDQA 4EP4A 2O66A 4PKIA 3KK1B 1TUGB 1WG5A 3PR5B 1N36K 1N32K 2M2BA 3S41A 4MAKA 2R42A 3FGVA 1JJCB 2LVWA 1IBCB 5HMZA 3PZPA 3RYLA 2FDNA 5KT7A 5M1NA 1S1VB 4MMOA 1Q7YT 4K7QA 5CHCB 2BANB 3VALA 3KJQB 1Q7LB 3SQGA 5AQJA 1QM9A 1K47A 3QO9A 2VCPA 2VGNA 3K7RA 2I2YA 3OD2A 3OTOK 2NR0A 1LKZA 1WACA 4NE9C 3C14B 3NS6A 3SJJA 2LA6A 1M1GA 5HRPA 1EO1A 3SI6A 5T41A 3MM8A 3H4BA 2FY8A 4C9DA 4JI8J 4OYXA 1H2VZ 1GXTA 3O5BA 1B0TA 3SI8A 2V8VA 2V4RA 1HMVB 3DOLB 5BXIA 4IH5A 3FZFA 1TV6A 4C8NA 4KIAA 1XJWB 4R8UB 4IUFA 1ATNA 3KG4A 4F8RA 1X1PA 1TKXB 1WSVA 1NU4A 3POTA 3AA5X 4CJFA 3CHWA 2W4PA 1VLOA 4Z37A 2QFJA 1JLEA 3A3NB 1I6JA 1EZZB 2JRSA 5LJVA 1C1CA 4C97A 4DR3J 4N8NA 3ISNC 1RU1A 1SQFA 3CC2N 1A7GE 4LBHA 5IT4A 1HBMB 3I56S 2HNZA 1W0HA 3CI5A 4RX6A 2HLUA 1U2RA 2MKYA 3PSFA 5J1NA 3QRQA 1K8AT 2Z1HA 4X64J 1MSWD 3R5GA 5KFQA 4PYDA 2J0SD 3ATVA 1B0PA 4IH7A 3DCAA 2C3PA 3HJFA 3O6QA 3GJSB 5KFMA 4ICLA 1SJQA 4DL0C 2BGGA 5HLFA 4WE1B 1VK0A 2DXFA 3CSKA 5JMVA 3BF4A 2HWIA 4HHHA 1HLWA 1KONA 4JK9A 3THYB 3DYAA 3C95A 3BGRB 4HWIA 1HNIB 1PSDA 4K42A 2OANA 4CJQA 3TUIC 2C3MA 3CCTA 1J5EK 1NK8A 2H4WB 1U6ZA 4B9LA 2JEGA 4GV6A 4NPOA 3OR2B 1RWMB 5KG6A 4TY8B 4ZCLA 3OYBA 3ZT1A 4ZCKA 2MSSA 3NAHA 4LF9K 2ZFHA 3J7YU 1UOCA 4HCCA 3E8OA 2ATQA 1Y4ZB 1WSGA 4HACA 5J1EB 4MIBA 1V3SA 5KPZA 4CDIA 4QPTA 4AL5A 3DLEA 3TP2A 1X4GA 3ZZZA 2XMKA 3H45C 3AOBA 1SS6A 2AW0A 2MKJA 1X3NA 3CIPA 3RWUA 5CYQA 3C16B 2HQIA 3A1YG 1BHNA 2B8QA 3F5TA 1OWXA 2W9CA 2HMIA 1E6VA 4OI4A 1SJ4P 2XY6A 2G8VA 2DNOA 1Z2ZA 3V9SA 4OJRA 3NGSA 4DR1F 2BW2A 1R8AA 2ALYB 1KTQA 2K7JA 4GKKJ 2J6TA 2Q3PA 1N88A 1RT7A 4ALZA 3VAJA 4LIWA 4OHZA 3HHLA 5IXUA 1FDAA 3O9UA 5C2CA 2DNQA 4DFPA 1U0HB 3EKUA 3EL2A 4I6MA 3I0RB 1RT5A 1OY6A 1U4BA 1LW2A 5HP1A 4C98A 3SMZA 2XSJA 1H74A 1PBUA 2D5RA 2YHYA 4FXWA 3LP2B 2CPZA 2IVNA 2KHOA 3FMWA 3TABA 5M1PA 2MLXA 3P5BP 4M5MA 1AFIA 5EWFA 2RQCA 1VQLS 5E26A 2CAJA 2AEMA 2YWWA 4O44B 1X9JA 3EZOA 1QQNA 3HVWA 3TJAA 2RS2A 1FJCA 1RGIA 2GZOA 4CZMA 1JLGA 2PAVA 1IKXB 5AQVA 3H40A 2CJQA 1N34F 5KG4A 4TU7A 2NSBA 4KKOB 5CZ1A 4IOCL 4P7TA 3D6FB 2MGZA 1SC4B 3MK6A 3EYZA 2CZ9A 4EYIB 3DRPA 1H3DA 3A4TA 2H48B 2FBTA 4KHMA 3NGDA 4L72B 6FD1A 2Q0RA 3PHTA 3H7HB 3VQSA 1ASVA 3ZSYA 1T94A 3VPZA 5GADP 3I56N 2DR7A 4ZVPB 3F44A 3H0PA 4JI0K 4FF1A 4JD2A 1M5KC 3VF0B 3ZNUA 3O5TB 2UVUA 3FZKA 1IKYA 5AQKA 5A2QY 5F8GA 3EE9A 5KG5A 3G82B 4USMA 2DPIA 3T5JA 1DJ0A 2KU7A 4NMLA 4DTPA 2V34A 2GJ2A 2JNJA 3ET6B 3PVXA 5ETKA 4E1MA 2Z2MA 2NRRA 1UWBA 3OFHA 3AO5A 3MEDA 1CLFA 3ZSXA 4CHQA 1WKJA 3KG1A 4M45A 4RW6A 1RGVA 1S59A 4CLLA 1RCHA 4FWPA 2ZOFA 3MCMA 1HQEB 4CECA 3Q83A 5C12A 3S01A 4ELTA 4JRQA 4J9MA 3LP0B 1ZS6A 4B8CA 4EFAC 4DU4A 5CZ2A 1HJRA 1FE4A 3RMCA 4ED1A 3TA0A 5T7LB 3NY0A 1E6YA 5AXLA 3BBFA 3KK3B 2D3O1 3WQUA 3BKFA 2XHCA 1XNRK 1S1TB 4XPCA 2LCWA 4BC5A 2QA2A 2OH2A 1HNWK 4NASA 4ZVEA 2J0XA 4HEA9 1IBLF 3PDNA 2BE2A 3FQLA 4M63A 1VSDA 2ERRA 1NDLA 3OHBA 4FYDA 3THXB 4I9QA 2F9WA 1TL3A 2WW4A 4JI5K 2R7WA 3H08A 2R7YA 4J9QA 1CJKA 2V4QA 3ALYA 3M32A 3NH2A 2ZUGA 2MHEA 4FLTA 4JLHA 3OR1B 4P2XA 1VOMA 5IV3A 2W25A 3M2VB 2ASMA 2ZGZA 1EXQA 4LC9B 4LFBF 3D1OA 3C6AA 2D0PA 1CQNA 1Q16B 1YGYA 1C1BB 1N5YA 1JXBA 5JLHA 2E5HA 2M8DB 1JLAB 5JVHQ 4DPXA 4PA1A 3Q0AA 2YKNA 5KG2A 3ZSRA 3Q8VA 4WKYA 3PR4A 3CF5L 3QGPA 1M1KO 1XHXA 2PI4A 3UCGA 2M88A 1D4XA 3L0QA 2RDIA 4X65F 4DQRA 3US5A 4AF1A 3VZHA 3AVGA 3D1HA 1VJWA 1G1XA 1N8RO 1TUWA 2CPYA 3BKTA 1CXUA 3CCQS 4N8OA 1A5VA 1VQLN 3D3BJ 1BXNA 3V6KA 2HIYA 2RKIA 2VICA 1U47A 2ASOA 3NBPA 3I96A 3AVMA 1VHXA 2C22A 3CPEA 3HSCA 1QQMA 1MLAA 2AEFA 1FJEB 1UEUA 2YKAA 2AMCB 2NXEA 3SBTA 5LM7E 4ZDNA 4NXMJ 4LRCA 1EQMA 2QSFA 4IRDA 2V4JA 2JOQA 3I8BA 1KQFB 2HHPA 2J76E 2G0IA 5BPMA 4O3NA 1HWKA 4DCJB 2YNFB 4TSXA 4FKXA 4CZIA 5M1OA 5C24A 4I64A 1HUXA 3BGOP 4G6VB 4QYZK 2E2OA 4TN2A 3QIPB 5KG3A 3CJBA 2VJVA 1KNZA 3SQGB 1NNEA 4OGCA 3QO9B 2E5GA 3LPTA 4FWMA 2HPUA 2KQ2A 2WONA 4OJHA 1ZTTA 3HTVA 1PAUB 3MM8B 5HAOA 2EG1A 5M2UA 4BRHA 4E98A 4BC3A 1EAYC 3P96A 4NMXA 3IRXA 2WSFC 2HHVA 1VSLA 2P9KA 3UI3A 2D0AA 2DPNA 4K25A 3K0SA 1B4SA 1IR1A 1NJXA 4FW2A 4YN3B 2D9PA 1TV6B 5G0RA 2VQEJ 4UW2A 4CLFA 4C8YA 5C25B 2O1PA 3OYFA 5FD1A