1HNIA

Structure of hiv-1 reverse transcriptase in a complex with the nonnucleoside inhibitor alpha-apa r 95845 at 2.8 angstroms resolution
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
publication title Structure of HIV-1 reverse transcriptase in a complex with the non-nucleoside inhibitor alpha-APA R 95845 at 2.8 A resolution.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 130
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hniA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hniA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hniA05
1C6VA 4K8ZA 1DTTB 1TKXA 3DRRA 5C42A 3QIPB 4KPYA 2Y1JA 3E51A 2P51A 4I7FA 4ZHRB 2AGQA 1JLAA 3V81A 3UIQA 1RTHB 4NCGA 1HYZA 1LWCA 3QIOA 4KKOA 4HUFA 5KFSA 3OYLA 3HO1A 1BL3A 4QWBA 4Q0BA 3CG7A 4YR3A 1LW2B 4CEOA 1L3SA 2KFNA 3SPYA 2HNDB 3UR0A 4CJRA 1NOZA 4KB0A 4IG0B 5HBMA 2WRMA 4FVMA 4O3SA 1KCFA 3Q8QB 2AGPA 4FW2A 4K4WA 4FM1A 1S97A 1HNIB 3VQ9A 4WZMA 4CIFA 1DTTA 4ZVGA 4NYZA 2QKKA 2DTUA 4IH6A 3H5SA 2W9AA 4MKAA 3QIPA 1L5UA 1EX4A 3C94A 4ZHRA 2D7SA 4RW4B 3H98A 4Y1DA 3AO5A 2G8FA 3EZ5A 1RTHA 4NLPA 3DLBA 2HHQA 4ZVFA 1QE1B 4MH8A 1WSGA 1RDRA 1S6QA 3ULDA 1RNHA 1SH3A 4DG1B 2OPRB 2YNFB 3OHBA 2C2EA 2QE5A 3PJXA 2PYLA 2HWHA 4ED6A 1S0OA 3OLBA 3CQ8A 3PZPA 1LW2A 5SWMA 3H4DA 1TK5A 2RF2B 2HNDA 3TAPA 4J9PA 2HHTA 1VRTA 4IG0A 3MXMA 1WSIA 3H08A 3THVA 4NYNA 4MQ3A 4OL8A 4CIGA 1IKWB 4FJXA 1HNIA 4M41A 3I5AA 4CJWA 1U45A 1UOCA 5JS2A 4Z4IA 2IAJB 3HPGA 3P1GA 3AVBA 5KFYA 1NKBA 1IM4A 4O0IA 5J2PB 1U04A 2IJNA 3CJ3A 4FJ7A 1ZBUA 4RW4A 2VA3A 5KFWA 4CEEA 3H5YA 4Z4GA 2IM2A 1QE1A 3K57A 1JLQB 4DG1A 4TN2A 2YNFA 4FLWA 1RBUA 2BRLA 4M45A 1K6YA 1TKTB 3CFOA 4KHWA 1XI1A 3ZT3A 3H4BA 2RF2A 4ZVEA 2JGUA 3B6PA 4FLVA 4IKAA 4ZPDA 3ZT1A 4OPKA 5HRRA 3VA3A 2NUBA 1KHVA 2HNYB 4FS2A 2F8EX 2O5DA 1IKWA 4KB1A 3NH0A 1GOBA 4CGGA 3SJJA 4HHTA 4YQWA 5DQIA 4EO8A 3SYZA 3LANA 5J2PA 1T94A 4QOZB 1S48A 4HVJA 4CGJA 3O3GA 3DLGB 4RU9A 2FLNA 4DMNA 3F9KA 4J9RA 3EPIA 1MU2B 1JLQA 3G6YA 4WXWA 2HHWA 5C24B 3S3OA 1TKTA 3PHEA 4QWAA 3O3FA 2RKIB 3HJFA 2XGQA 1LWEB 5KFFA 3SI8A 1TV6B 4JUZA 2HNYA 3VQ6A 3PX0A 3AA2A 3PY8A 2KZMA 4TLRA 4IR1A 3QGHA 4TQRA 4OJRA 4E3SA 4RNOA 1RT2B 4BDYA 3BSOA 2X78A 3KLFB 1G15A 2YNIB 1JLGB 3V6DB 3CDEA 3VQQA 1BHLA 2D3ZA 3QZ7A 3DLGA 3SV4A 3TVKA 1MU2A 1RT7B 4ECWA 4LQ9A 4ED7A 2KQ2A 3V9WA 2FJVA 4TSXA 4H4MB 1UWBB 5C24A 2FVSA 2IM1A 1RA6A 3AVAA 3Q8RB 2RKIA 1WSHA 3OJUA 3DLEB 1LWEA 4M42A 4GW6A 4OPJA 1TV6A 4CGHA 5HRNA 5KGXA 2XY5A 5DLFA 3KKSA 1IG9A 1U48A 4CJEA 1S9FA 3P5JA 4AHUA 1REVB 3LAMA 4MKBA 1RT2A 1HRHA 4W5RA 1KVCA 1KFSA 1I39A 3EYZA 4FJHA 3L3VA 3KLFA 3MR2A 2YNIA 1JLGA 3V6DA 4XIUA 2HVHA 2GIQA 4W5OA 2XHBA 4F2RA 4OLBA 1RT7A 4IRDA 4H4MA 1UWBA 3VQCA 2WOMB 3RBDA 1KSPA 3DLEA 3CM5A 3LWMA 3GIMA 3UDLA 4Q5VA 1GOAA 4K4TA 3MEGB 4EO6A 4EYIB 4M3ZA 2QKBA 2HHUA 3L2VA 2GBZA 4I9LA 1SH2A 3K58A 1REVA 3OVNA 3HVAA 2R8IA 2JEJA 4NLXA 4EBDA 1VSHA 4M3XA 4AHSA 4B9UA 4NLDA 5KFVA 4FZXC 2B43A 3H5UA 4BDZA 2XC9A 1S1WA 4IRKA 2FJXA 1K1QA 3I5BA 2WOMA 1KVBA 2OPQB 4DF8A 4Q8EA 1WLJA 3WNGA 2AX0A 1XR5A 1I3AA 2AQ4A 5KFBA 4CJKA 3GV8B 4FZZA 3MEGA 1KHWA 4AH9A 4DL4A 3LZIA 3ASMA 3WNFA 3KTQA 3AVGA 3NL0A 3OYDA 2UVVA 4HTUA 2XCPA 4K4ZA 1GOCA 4CEQA 2EX3A 3PW4A 2IC3B 3QEXA 4FK4A 4I9QA 4DFJA 5T14A 4LSNB 2X6NA 1W0HA 4CJTA 1RCHA 2OPQA 4NLGA 4DSJA 2WK4A 3I0RB 3D5MA 4DQSA 5JXSA 3BGRB 4FJ5A 3KKRA 3DRSB 3ISNC 5DMRA 1XHXA 3FQLA 4CCHA 3M9MB 5F8JA 4W5TA 3V9SA 5HP1A 4KBIA 2G8UA 3HHKA 1Q8IA 1S9GB 4EZ9A 5KG1A 1WAJA 4J9MA 3MF5A 2C28A 1TL3B 2P5OA 3LP3A 3LP1B 1N48A 4K50A 2BQUA 4BACA 4J2BA 2G8IA 4NCBA 3NAHA 2IC3A 3IRXB 4NLWA 1KLMB 4LSNA 2IOCA 3OS1A 4R5PB 4GC7A 3O3HA 4KTQA 4B9TA 4FJIA 2D5RA 4HUEA 1S0MA 3KK2B 4DF4A 3I0RA 3BGRA 5DG9A 3DRSA 1KRPA 1T8EA 1JXEA 4DFMA 3AVIA 1NK8A 1S9EB 4E7HA 4QWCA 4KREA 4N56A 2KFZA 4ZVHA 1ZTWA 4YNQA 1S9GA 4QAGA 1TL3A 2AWZA 3KLHB 4RZRA 4FJNA 3LP1A 4DLEA 4M3UA 4F4ZA 1YT3A 3AV9A 2HHVA 4FJLA 3NHGA 3IRXA 1VK0A 2E9ZA 3H59A 2ASDA 2F8SA 1NNDA 1KLMA 2WHOA 3ZSVA 4U7CA 1GX6A 4R5PA 2UVWA 1ZYQA 4DL2A 3OLAA 2GC8A 3D28A 3KK2A 3PW5A 1BCOA 3DLRA 4J9KA 3ZSRA 3C6TA 3RTVA 4CJFA 3U3YA 2BQRA 1S9EA 3OYGA 1RT4B 2R2RA 3RMCA 5HROB 4JS4A 3OL8A 3K5LA 2JEFA 4CJVA 3ZSXA 3RMAA 1IKYB 4J2EA 2P5GA 3P83D 4ECVA 1RA7A 3HPOA 1EP4B 4IG3B 3OYCA 1N6QB 4F2SA 3OL9A 4UQGA 3BREA 1TAQA 3T19A 2DPJA 3SI6A 3OYIA 1Q9XA 3NE6A 4CHOA 3MEDB 1RT4A 5EUHA 4WYLA 2KZZA 4ID5B 2IM0A 2D41A 2ASLA 1QUVA 5HROA 3D45A 1K1SA 5L9XA 1L3TA 4CGIA 4TXSA 5HLFB 1FXXA 3VQPA 1IKYA 4CEFA 4QCLA 3WNEA 3G10A 4RNHA 3KMQA 5KFGA 1S6QB 4JS5A 4K4UA 1EXQA 4CFAA 1EP4A 4IG3A 2RDJA 3CJ4A 4PQUB 1HPZB 1N6QA 1X9WA 4RNNA 2E4LA 1VRUB 4ECXA 2W8KA 4CEZA 3M8QB 3MEDA 1VRTB 4ID5A 2BR0A 3VN5A 1BGXT 3GYNA 3CIZA 2RPIA 4I2PB 3OS0A 3TAFA 1W25A 5I3UB 3VQ8A 3AVNA 4DTJA 4DTMA 1S6PB 4O3NA 5CYQB 5HLFA 3AA4A 4ED0A 1JXLA 4HKQA 5KT7A 3PX6A 4YR2A 1WAFA 4BWMA 2W8LA 3OYMA 3K2PA 3V9XA 4M95A 4NLSA 3NDKA 4PQUA 2J6TA 1HPZA 1QSSA 1J9AA 4Q43A 1VRUA 4ZPAA 4DSKA 1CXQA 3QZ8A 4E7IA 3ZT2A 3PUFA 4CF9A 3RRHA 3DLHA 3M8QA 4IQXA 3OYBA 3VQSA 4FLZA 4CHYA 1RDDA 5EWEA 3N6LA 4IFVB 4AHVA 3HPHA 3QO9B 4FLYA 3V6HA 5K14B 4KHYA 3M9NB 5KFOA 4DU1A 2W9BB 1RT3B 4I2PA 2A1SA 2YNHB 3QNNA 1DTQB 5I3UA 5EDWA 4E7JA 2Y1IA 3QNOA 1S6PA 5CYQA 3I8DA 3KLGB 1JL2A 4O55A 4DSLA 4KRFA 1BQNB 1LW0B 2C22A 3FQKA 1JLFB 3OYAA 2DFEA 2OYQA 3ALYA 4URSA 2GV9A 4CJSA 3RB0A 4MIAA 2WONB 5KRSA 3RB3A 2UUWA 4NLQA 4B8CA 3M8SA 2WB4A 2HW3A 5KFTA 4DTSA 5FDLB 3AVJA 3CM6A 3NFAA 2FBTA 2VA2A 5J2NB 3N6NA 1Z4UA 4IFVA 3QO9A 5K14A 4OLAA 5J2QB 2W9BA 4HCCA 1RT3A 2YNHA 2FLPA 3CYMA 4F3TA 1DTQA 3KHGA 3AVFA 4J9OA 3L2RA 3KLGA 1A5XA 1L3UA 3HVTB 1BQNA 1LW0A 3ISND 4CK1A 1JLEB 1JLFA 4CK2A 4OVLA 4ECYA 4DFPA 1D8YA 4ZP6A 5KFCA 5KT2A 3RMBA 5KT5A 2WONA 3KOAA 3TAMB 3MECB 4B9LA 5FRNA 5FDLA 3OSPA 3SQ4A 4FJMA 5L1LA 5EWGA 3K5MA 3QEIA 2W9CB 1BCMA 5J2NA 1C1CB 2R8GA 5HRSA 1ZTTA 3CVKA 4WFYA 5J2QA 2BDPA 3OL7A 3T5KA 4BE2A 1IO2A 2XCAA 2HB5A 3PO4A 4IDKB 3OY9A 2G8WA 3HVTA 1JLEA 1C2PA 4FLUA 4NLVA 2VG5B 3KD5E 4QW8A 4DL3A 3AVHA 1X9MA 1RTDB 3TAMA 3MECA 1A5VA 3ZSYA 4F4KA 4FYDA 1T7PA 2HHXA 3PW7A 4K4XA 5F8GA 5KFHA 2W9CA 2DFHA 1C1CA 3PR4A 3SQ0A 3RWUA 3QLHB 5KFLA 2ATQA 1NJXA 3DOLB 3GQCA 3HP6A 1J54A 1S1TB 4TY9A 2KW4A 4QWDA 4O5BA 4F4XA 3HP9A 4KSEB 3HXMA 4IDKA 1VSIA 4EZ6A 4BE0A 2FVCA 1JIHA 3QEPA 1NK4A 2W42A 4DSEA 1TK8A 1HJRA 5KFMA 3DM2B 1HARA 4KI6A 2VG5A 1CSJA 2BQ3A 1S1WB 3KJVB 3G6XA 1VSLA 4CK3A 3GV7B 1RTDA 3KD1E 4FLXA 3PJWA 2FBVA 2IJFA 5DK5A 4FXDA 4LY7A 4FK2A 5DG7A 3VQ5A 3TI0A 2JC0A 2AGOA 1U09A 1LWFB 3V6JA 1QS4A 5J1EB 2Q3SA 3GIJA 1BQMB 3QLHA 4CJLA 4CJ3A 3DOLA 2ATLA 1BI4B 5KI6A 1S1TA 4KV8B 2XI2A 3ZT4A 4CFCA 4DTXA 4FW1A 2IGIA 4NRTA 2PZSA 1N5YB 3K5NA 4O4RA 1NJWA 5J2MB 3FSIA 4PUOB 3RAXA 3DM2A 1RDAA 3CJ2A 4ECQA 4J9NA 3A2FA 3SUOA 3KJVA 3SUNA 1SL2A 1WSFA 1CZBA 4FZYA 1HYVA 4IH5A 4NLYA 5SZTA 1RYSA 2QK9A 3C6UB 1LWFA 4NLRA 1TK0A 2YV0X 5J1EA 3MR5A 2D0CA 4B9MA 1NK7A 1BQMA 5HP1B 3GIKA 1JX4A 2AJQA 4WXOA 2R7YA 2ITGA 1BI4A 2E6MA 4KV8A 4EP5A 4CJ4A 4CHZA 4W5QA 4I2QB 1N5YA 1C1BB 1BISA 3MTKA 2ILYA 4X2BA 5J2MA 4PUOA 3V1QA 3ICLA 1HQEA 2YHAA 4DSFA 3NGYA 1LAVA 3MR6A 4PY5A 3KLIB 2DY4A 2XY7A 4CJQA 1DLOB 1RT6B 2QV6A 3MR3A 5KFKA 3ZSWA 2BE2B 3RB4A 3KK1B 2FC0A 3C6UA 3H40A 3PR5B 1NJZA 4F3OA 3ZSQA 2B6AB 2Z1IA 4Y2AA 3PV8A 4H4OB 4C8KA 2KTQA 4R0EA 2AU0A 5D3GB 3JSMB 1J53A 4I2QA 4CJ5A 1RTIB 1C1BA 3OYKA 2W7PA 4RW7B 4OKJA 4H54A 2OH2A 4TY8B 1RILA 2OPSB 4JLHA 3MXJA 4CFDA 2GIRA 5KG7A 3OL6A 4DL6A 2HAIA 4RW9B 3KLIA 4KO0B 3GIIA 3IGNA 1S49A 1ZBHA 3LP0B 1DLOA 3HVRA 1RTJB 4DTUA 1RT6A 4PA1A 1YVFA 1D9DA 3NAIA 2IA6A 4E7KA 1WNSA 4DLGA 4CF0A 4RUAA 2CKWA 1RDCA 2BE2A 3KK1A 3S3MA 4F4WA 3C6TB 5EU7A 4JV2A 4WYWA 3DMJB 5KFUA 1TKDA 2B6AA 1UA1A 4ECSA 2D0AA 4CEAA 4ZMMA 4H4OA 1S0NA 1LV5A 3S3NA 5D3GA 5KRTA 3JSMA 4BDPA 1BIZA 3CWJA 4O44B 1L3VA 4G3IA 3QINA 1NK0A 1RTIA 3RR8A 4O3RA 4RW7A 2J6UA 4TY8A 5DQGA 1C1AA 5F9LA 4OKEA 2OPSA 1U47A 3QYYA 3AO3A 1Q9YA 4RW9A 4KO0A 4N5SA 3D0PA 3QERA 4CECA 3LP0A 1RTJA 3AO2A 3NH1A 4E1MA 3MFHA 2WCXA 1CXUA 4Q8FA 4XPEA 4DS4A 5DGAA 1D5AA 1Z26A 4M3YA 4Y34A 3DMJA 1A5WA 2B4JA 2VWJA 5L1KA 2D0BA 3T1AA 4NYFA 3VQBA 5C5JA 4JV0A 4FM2A 2FLLA 4XO0A 3I0SB 2V4RA 4EBEA 3T3FA 1EKEA 3DRPB 4O44A 4PWDB 4FJ9A 3VQ4A 4JRPA 3BQ1A 3DI6B 2XY8A 4RUCA 2BRKA 1KFDA 1NHVA 5KT4A 3KLEB 3ZCMA 4CE9A 3EPGA 3WNHA 4DTPA 1RT5A 2R2SA 4KHRA 3TANA 4EYHB 4E1NA 3SUPA 3VQDA 1NK5A 5FRMA 2G8HA 4AHCA 1S5JA 3V1OA 3H5XA 2E9RX 3CJ0A 1XC9A 2D3UA 3NBPB 1QTMA 4C8OA 4KE5A 4N41A 2X6SA 4FS1A 3GILA 1TKZB 5DGBA 1B9FA 4M94A 4J9SA 1RBTA 3PW2A 5JS1A 1U4BA 3I0SA 1JL1A 1QSYA 2HNZB 3V9UA 3AA5X 1NKEA 3DRPA 4PWDA 4ECZA 1CLQA 1YTUA 2WTFA 4IR9A 4DU3A 1C0UB 3DI6A 5KFNA 4LQ3A 4FCYA 2XWYA 2BANB 3KLEA 4FJGA 4U6PA 4FJKA 3HM9A 1Y97A 2YHBA 4FLTA 5EWFA 1NK9A 4W5NA 2ETJA 5F8IA 3C95A 4CF1A 4R8UB 3KLVA 1N4LA 3NF9A 2Z1HA 1S4FA 3LWLA 4M3TA 3NKYA 3E01B 4E89A 4XPCA 4K4YA 5DLGA 4CJPA 3NBPA 2R8JA 5KFDA 3OYEA 2PY5A 4E19A 3T5LA 1TKZA 3IAYA 5CY4A 3VA0A 1T3NA 3SUQA 5F8MA 4ZP8A 1RBVA 1W9HA 1HMVB 2HNZA 3GV5B 4B9VA 4EEYA 3SCXA 4RNFA 2R8KA 1RAJA 3AVLA 3KMSA 1YTAA 3L3UA 4CHNA 3NGZA 4J2AA 1C0UA 3PW0A 3QEVA 2FJWA 2BANA 2C2DA 4CERA 5L1IA 4ED2A 5KFPA 1OS5A 3F73A 1LAWA 2IMWP 4L8RB 4R8UA 1FKOB 3TAGA 3LPUA 5DG8A 5KG4A 1TP7A 3KHHA 4ELTA 4MFBB 2V0NA 4DL5A 3DLKB 4URQU 3E01A 2V9WA 4KHQA 4CHQA 5KFJA 3NH2A 3TARA 1NK6A 3BR9A 4FM0A 1U49A 2HWIA 3FFIB 2UVRA 1HQUB 2ASJA 1NOYA 1GX5A 1HMVA 3BDPA 4Z4FA 5KG5A 3HYFA 4CGDA 4O0JA 4C8NA 4MIBA 4CJUA 1HNVB 4KTZA 2OZSA 1TVRB 3G6VA 3BQ2A 4CHPA 5KFRA 5KGWA 2R2UA 1IKXB 3OHAA 1F21A 4KTWA 4E7LA 3CDUA 1RYRA 4K8XA 4ID1A 5KTQA 4RW8B 3AVMA 1FKOA 1ZBLA 2LSNA 3UPFA 4IBNA 4MFBA 2XO7A 2G8VA 3DLKA 2IS3A 2UUTA 1I6JA 2A1RA 3CFRA 4BWJA 2O4GA 4CESA 4RW6B 4Y3CA 3FFIA 1HQUA 3L8BA 2OPRA 5CZ1A 4MK7A 1SH0A 2VG6B 3LAKA 4TQSA 3TR8A 2I1RA 2FVQA 1HNVA 3PX4A 1TVRA 2DPIA 3ITHB 1IKXA 1MMLA 4TYAA 1S1XB 5F8LA 5KFEA 3ZSOA 5CYMB 2CJQA 4RW8A 1WSJA 2AX1A 4B9SA 1ITGA 2IAJA 4CEBA 4CFBA 4FJ8A 3NAEA 3T5JA 4JV1A 4WFXA 3K59A 1X1PA 2OPPB 4N47A 4RW6A 1XR7A 5KG0A 4WFZA 5KFIA 3FRZA 5I42B 2V4QA 3IS9B 2RDIA 2VG6A 3Q8SB 4DFKA 4NLOA 1UAXA 4ZP9A 5KG6A 4H8KA 4ED8A 1XWLA 2YKNB 2JEIA 1VSJA 3ITHA 3M9OB 1ZETA 3AVCA 2R2TA 5KFZA 1D0EA 1S1XA 5CYMA 2E9TA 1SV5B 4O3OA 4DQQA 4F4YA 2VG7B 3KHLA 3ZSZA 1ZBIA 4F8RA 1VSDA 2GUIA 1S1VB 1RBSA 4G1QB 3QGIA 4HUGA 4E0DA 2OPPA 3TABA 1T03B 3IN5A 5I42A 4IFYB 3CJ5A 3AO1A 2ZD1B 5KFQA 5KT6A 5E41A 2JLEA 5KFXA 1ASWA 3IS9A 4DQIA 1SKSA 2F8TA 4DTRA 4QWEA 3U3GA 4IOBA 2YKNA 5KG2A 3MAQA 4KAIA 4FBUA 3BSCA 4DQPA 4ZTJA 4EBCA 2UVUA 3N6MA 4TYBA 2ZQBA 1IKVB 1SV5A 2VG7A 3QESA 3G0ZA 1KTQA 4AHRA 3SFGA 1JXBA 1S1VA 2B5JB 4G1QA 1N56A 5HRPA 4IH7A 3LDSA 4K4VA 4FK0A 1QAJA 4O3PA 4LD0A 3L2QA 1VSFA 1T03A 2OZMA 3AVKA 4IFYA 4J9QA 3DDKA 2ZD1A 1X9SA 4DS5A 4GVMA 4KAZA 4KFBB 1TL1B 5JUMA 1SKRA 1NJYA 2OA8A 4DQRA 3SV3A 2G8KA 2R8HA 4O3QA 3PVXA 4N76A 4Z4EA 1T05B 2Z1JA 3I5CA 4FJJA 1VSMA 4DSIA 4YR0A 5C25B 3EZUA 1TGOA 4KHUA 2ZE2B 3NF6A 1WNEA 2P1JA 1HQEB 4ELVA 2FBXA 4BE1A 1IKVA 2XI3A 4KHMA 4CF2A 3OYJA 2C2RA 3OYHA 4RG8A 4ECTA 3RB6A 3HKWA 3OJSA 3NGIA 3V1RA 4LH5A 2HHSA 1SUQB 1WN7A 4MK8A 4Z0UA 2B5JA 2FVRA 4ZPCA 3RBEA 3SFUA 4Q45A 3KIOA 3IG1B 2BGGA 3LPTA 3UQSA 5CZ2A 3V4IB 2ILZA 4Q44A 4LH4A 4QPXA 3KK3B 4NZ0A 3OS2A 2J6SA 4KFBA 4ELUA 1TL1A 4LSLB 3NGDA 4CF8A 3TWHA 3TQ1A 3NF8A 3CDWA 3IGVA 4ZTFA 4DWIA 4IRCA 1UA0A 1C0TB 4YMEA 1QSLA 1T05A 1S1UB 3LP2B 1RDBA 5C25A 4KI4A 4AHTA 4OGEA 3DYAB 2I5JB 2ZE2A 3KHRA 4M3RA 4JRQA 1S10A 3FDSA 3RR7A 4KB7A 1ASUA 2IM3A 2VWKA 5F8HA 1NKCA 3BQ0A 1C0MA 4J9LA 4RNMA 5L1JA 4ED1A 3VQAA 3S9HA 1D9FA 1B9DA 1SUQA 3O4QA 1XHZA 1QQCA 1RBRA 1O1WA 5F8NA 1VSEA 4F50A 3IG1A 3HL8A 3RAQA 1HYSB 2ZKUA 3V4IA 4KHNA 3QEWA 4WE1B 3KK3A 2F96A 3L2UA 3PO5A 4LSLA 4DTNA 4ZPBA 2PYJA 3HT3A 2HMIB 1C0TA 1S1UA 3VQ7A 3CFPA 3LP2A 3DYAA 2I5JA 5F9NA 4ED3A 4B9NA 3OSNA 1JKHB 4GMJB 3V6KA 4O4GB 3H2LA 4EP4A 1JLCB 3MFIA 1CZ9A 2ALZA 4OGCA 3LZJA 4CIEA 1FK9B 3KNAA 4ICLB 3MEEB 2FBYA 2W7OA 1SL1A 3SZ2A 3HVWA 3AO4A 4B08A 1SKWA 1RT1B 4HYKA 2EC0A 4M3WA 3SNNA 3O4NA 1HYSA 3LALA 3T5HA 3BJYA 2E6LA 3NMAA 3M8PB 1J5OB 4AILC 4IKFA 4WE1A 4ECUA 3VQEA 4NCAA 4MK9A 2Z1GA 2DFFA 4Y1CA 1Z25A 2HMIA 5FROA 3EY1A 3QGGA 4C8MA 1IH7A 4FBTA 3QIDA 1R0AB 3CO9A 2XGPA 1JKHA 4O4GA 4CGFA 1JLCA 3SQ1A 3DOKB 3OYNA 3OYFA 3M8RA 4YP3A 2YKMB 3SPZA 3MXIA 1ZBFA 4Z4HA 1FK9A 1RT5B 4ICLA 3MEEA 1XR6A 3ZT0A 1KLNA 1RT1A 1TAUA 4QW9A 4OKKA 3L2WA 3K5OA 4B3OB 1D1UA 4B8AB 4DU4A 4URGA 2JC1A 2YNGB 3M8PA 1J5OA 2IBKA 1NHUA 3HK2A 4KHSA 1YVUA 2FVPA 4DEZA 1FKPB 4Z4CA 1BIUA 1SL0A 4WZQA 2X74A 1R0AA 3BSNA 1B92A 4YFUA 2QXFA 3JYTB 3NF7A 3DOKA 1EETB 4CEDA 2YKMA 4GC6A 1JLBB 3QETA 4DL7A 1WSEA 2O4IA 3RMDA 3NCIA 3KLHA 5KT3A 3Q8PB 1TKXB 3DRRB 5C42B 5KG3A 1QAIA 1KVAA 4K4SA 4ZP7A 4NLTA 2IDOA 4C8LA 4I7FB 1JLAB 3V81B 4B3OA 5DQHA 4ECRA 4NCGB 3B6OA 3G86A 3V9ZA 2YNGA 1LWCB 4Y2CA 3TAQA 2JEGA 4KKOB 5KFAA 2XY6A 3TAEA 3RRGA 4NLUA 1TQLA 1VSKA 3AA3A 4DTOA 3HSTB 4Q0BB 1FKPA 4HCBA 4J2DA 2RN2A 5T7BA 2HVIA 1QHTA 3SQ2A 3U6FA 2XRIA 3BSAA 4NRUA 5HBMB 1ASVA 3JYTA 2EHGA 1EETA 1JLBA
chains in the Genus database with same CATH superfamily
4FNIA 3I33A 2RIJA 5E5NA 5C42A 2XSFA 2LEAA 2E7VA 2CDQA 2YPYA 4LVNP 2VYPA 1RTHB 4B02A 3D4JA 3QIOA 2BJ3A 4HUFA 3QSIA 3HO1A 4YEAA 5K20B 3L3CA 4QWBA 1WELA 4IWVA 1SIZA 2PA3A 4AXIA 4CJRA 1NOZA 3MPUB 3MPYA 3UO0A 3EWGA 1Y3JA 2G2YA 5DZ7A 2D69A 2MPUA 3WQUA 4FYWB 3FR0A 2HKEA 3MM5B 1ZZNA 1DTTA 4ZVGA 2PMWA 2DTUA 4IH6A 1HD1A 1XN9A 4DR6K 2O8EB 3F5TA 2MKYA 2MMYA 3QIPA 3BO4A 4GVBB 3AHPA 3R6GB 1EX4A 1YTYA 4WFNQ 5BREA 4Y1DA 2G8FA 3EZ5A 1QE1B 4MH8A 1RDRA 5HANA 1FD8A 2VFTA 1NSQA 2PYLA 4ZIWA 3CQ8A 5SWMA 4OZJA 3ZC4A 1YI2S 4BR2A 2FHOB 2F8MA 2HNDA 2DHXA 1VRTA 3MXMA 5AQKA 3H08A 2BA9A 1N5QA 1A0OB 4OL8A 4JI0K 1W2BR 3I5AA 1U45A 2GMLA 5E7OB 4Z4IA 2IAJB 4F3QA 3VCDA 4FL9A 5EGYA 3QATA 1IM4A 1FFGB 1V3SA 4LF8K 2ACYA 3MTJA 2DXEA 6FDRA 5KFWA 4DPUA 4Z4GA 4RPFA 2IM2A 1JJHA 4OV1A 2XG8A 2O8FB 2DGUA 2LU2A 4BGAA 2D0OA 2BRLA 4A5BA 4EFHA 1XK8A 2G4BA 3H4BA 4ER8A 1R0BG 4EFAC 2QEXN 4IKAA 1CG2A 1RKIA 5HRRA 2KXFA 3SSRA 5L9NA 1KHVA 4X4PA 2F8EX 2O5DA 4LF4K 3ATVA 3NH0A 4CGGA 2HHHF 2H3EB 2J5AA 4FWLA 4DV4K 4HHTA 1HBUA 4WU2A 1LWXA 5DQIA 3BF1A 3UD4P 3JSRA 1AUDA 1RISA 2DTJA 4O0NA 4OV6A 4ZCKA 4WQ5C 3F9KA 3IM8A 1JLQA 3G6YA 4PEOA 4WXWA 2R7QA 3TUIC 2HHWA 5C24B 3S3OA 1FA0A 3PSIA 3O8MA 4M5NA 1LWEB 1GLLO 1W7WA 3AOCA 3CCTA 5GMEA 4C48A 3LL3A 3FZHA 4A59A 1ZOTA 4LF9F 3PY8A 2KZMA 4TLRA 4RR5A 4OJRA 3O44A 5HQ8A 4RNOA 2HQCA 4BDYA 1RWNB 2X78A 3V6DB 3VQQA 1NH8A 2VQEK 2YX4A 2DD8S 4I64A 4CP5A 3SV4A 1MU2A 4LQ9A 2QRRA 2KQ2A 4TSXA 1DURA 1UWBB 3LDNA 2FVSA 2IM1A 3AB4B 1F3VA 3Q8RB 3OJUA 2U2FA 3WBZA 4DCPB 2ROEA 3K8VA 5BXIA 5ETRA 5CCMA 1IG9A 4HTIA 1S9FA 4X64K 1REVB 2XS7A 2L9NA 4JI7K 3L3VA 3KLFA 3MR2A 2GHVC 2HVHA 2GIQA 1XEZA 4W5OA 1CLFA 1LOUA 2Q6BA 2DO0A 3ZETB 3NNHA 1CJTA 3D1OA 5F0WA 2BKNA 4V19S 3MM7A 5FJ4A 2E2PA 3CM5A 4FWPA 4Q5VA 2A3ZA 4M3ZA 4LFCK 5LMNK 4I9LA 1MROB 3P8BB 2UXDF 2R8IA 1D9AA 4WWSA 3NOGA 4QOTA 2K8GA 2DNRA 4M3XA 4KIAA 1HI8A 2R7UA 5DM7L 2V8HA 2B43A 5AQPA 3H5UA 4BDZA 4DR4K 4OI6A 4FVCA 2GJFA 2G13A 1U2CA 4M5MA 2G9OA 2NQPA 4X66F 2IRUA 2OPQB 3W65A 1MN9A 3WNGA 1OYDA 3O5BA 1TTHB 5GAEU 2AQ4A 2K3IA 4CJKA 4FZZA 3MEGA 4AH9A 3ASMA 4FDFA 4HDGA 2FZKB 2E5HA 3AVGA 5D0HA 3OYDA 5AQLA 4HTUA 1KONA 4M5JA 1KDNA 2O8BB 3GP9A 5IT9Y 1GOCA 2VU5A 4P72A 4X4UA 4YY3K 4AL7A 3VAMA 4LF8J 4H5VA 3IAS9 3M2RA 5TKWA 2C2OB 3UB5A 1Z2ZA 2KM8B 2Q66A 4QZVB 1W0HA 4CJTA 1NB2A 2XZDB 4NLCA 3EXYA 5JVHL 4DSJA 4DQSA 2VL1A 3KKRA 3DLLQ 3RSEB 1RWXB 4BGBA 2Z2ZA 3L7PA 4CCHA 5A8KA 4JHDA 3M9MB 2B9YA 1NDKA 4W5TA 4KGMA 2GUPA 5AQVA 3WX4A 1HNXK 5KG1A 4J9MA 2C28A 5BYSA 4QQBA 2HF4A 3LP3A 1CS4B 3WIUA 4OHXA 3G9CA 2BQUA 2I6WA 1VGYA 4J2BA 1S72N 1RHJB 1KQFB 3IRXB 2VUGA 2A18A 5A8RA 2FJBB 1OH5A 4A61A 4ETXA 2DVIA 2ZF5O 4FPIA 4ZVSB 4LSNA 1U0SA 4R5PB 4B9TA 1CJVA 4DF4A 3D3CJ 1YHQN 2J0SD 1HKCA 3A3OB 1JXEA 1X4AA 3UD3P 4DFMA 3OTDA 1NK8A 2BZ2A 4X4OA 2HS4A 4EK2A 1XIQA 2HFVA 3JQJA 5AXMA 4N56A 1JXVA 2KFZA 2NRWA 5G4DA 2Z0GA 4YNQA 1WTBA 1N52B 1YJVA 3F9MA 3UNYA 3KLHB 4FJNA 3FCWA 4DLEA 1FRKA 1WKLA 3HI0A 1VK0A 2ASDA 2VQEJ 2ASOA 2F8SA 3NGKA 1KLMA 2G0CA 1GX6A 2P8IA 4LT6A 2D1KA 4DL2A 2GC8A 1RQ0A 2UUAK 2VHGA 1FDAA 3C7NB 2KN4A 1T95A 2A42A 1JWWA 4KH1B 3TTDA 2R3VA 1ROFA 3D0GE 2ZGYA 3CJCA 5HROB 5B08A 1AW0A 4JS4A 4X64J 2GEMA 3K5LA 4JI7J 3HSZA 3ZSXA 1IKYB 2MQNA 4J2EA 3WX8A 2MZSA 4MIWA 3DXBA 4UUWA 4U8YA 4C11A 2OGUA 2MDAA 4F2SA 1UVMA 3VENA 4DV5K 2X7IA 4DR3F 3OTOK 1YJNS 1Q9XA 2WZ1A 2WBRA 1NGFA 5KPZA 1QJHA 5HI7A 2KZZA 2ASLA 4HWIA 2B4UA 3CMAS 1FRIA 4CM0A 3D45A 1K1SA 3AD9C 3VF0B 5LMNJ 5IWAF 5G0RA 4J91A 2IYIA 2ZJRQ 1YITN 3EZWA 3HHNB 5HLFB 3PJ9A 4H5RA 4LBIA 3MCOA 4K5SA 4YOXA 4P6QA 4OI1A 1P9YA 3WNEA 5DJBA 3DXMB 2QI2A 2BMBA 1S6QB 4IOAQ 4JS5A 2VBZA 4CNZA 1EP4A 4IG3A 3OTBA 1N6QA 1U26A 1X9WA 2JZ5A 3H8YA 2NZCA 2KKZA 1FXDA 2W8KA 4CEZA 4JYAK 4HVZA 3OD2A 2P9NA 2GQ2A 2KU7A 3AJ1A 4C2MA 3DHXA 2ERRA 1OVYA 2BR0A 2HGMA 3RBXA 1K44A 1BGXT 5BR8K 3EE8A 4I2PB 1YBAA 3IBWA 2E5LF 1YGYA 5AQUA 2VFUA 1K8KB 5CYQB 4FNHA 1FDNA 2BKPA 4I6YA 3VAIA 5KT7A 3PX6A 4YY3J 4NLSA 3RRKA 3ZYYX 4PQUA 4IQMA 5D8HB 2NZTA 1RBLA 2W4CA 4ZPAA 4DSKA 1WF2A 4WPAA 5F41A 3HZGA 4E7IA 3RRHA 3M8QA 1SCJB 2F9JA 3TRGA 4DPTA 4FLZA 1PYOB 1YJ9N 4AHVA 2EXUA 4QIVA 5KFOA 4X62J 3LM2A 1B7FA 4IO9Q 1IJEB 2N3OA 5I3UA 4E7JA 1Q0NA 2Y1IA 1HNXJ 5AE3A 2P9CA 3CEDA 3EGWB 3VMFB 4BREA 1JLFB 4URSA 1SIWB 5A2QY 1NGEA 1VQSA 5KRSA 3RB3A 1MG7A 1KC8T 4B8CA 2ZFHA 2HW3A 5FDLB 1N0UA 2R7OA 3UKUA 3R27A 2HGNA 3AVJA 1B3TA 3CM6A 3H1VX 4CIOA 3NGRA 4PKGA 1GXTA 3DOMB 1BWFO 1IUJA 1VQ9S 5K14A 4A48A 4WIQA 3TW0A 2XMMA 2YNHA 2FLPA 3D2EB 1BWVA 4F3TA 2CPHA 3GJSB 1PC5A 4WFBL 2V68A 4RWXA 4J9OA 2VGNA 4CLFA 3L2RA 3HVTB 1BQNA 3ISND 2DY9A 2ZH1A 4CK2A 1UP1A 3A5MC 4ZP6A 3RMBA 2O8CA 3TAMB 2A6OA 3ZEUA 4EI2A 3D2WA 4PG7A 1MN7A 5M2PA 2ZH9A 1YJUA 3MM8A 1FF2A 1S77D 2DR6A 3HZEA 3VGUA 1S72S 2KHDA 2NUHA 4C3MA 2ZWOA 4B1UB 4BE2A 3GSIA 2HB5A 1TUUA 2YWEA 2XEXA 4B3RK 2AJ0A 2JWKA 4FP9A 4ZA1A 2YKPA 3TSPA 3MECA 1U1LA 2A0FB 5E3PA 3EE3A 1LNQA 3PW7A 3T41A 1XMOK 5F8GA 3QWUA 5EX0A 4DV5J 1X4EA 3DU6A 3OTOJ 3EMTA 3SQ0A 1GQEA 1VBZA 1ITPA 1BUPA 4ES1A 4CLPA 3BF3A 2QWPA 2BUPA 1T9TA 5FPNA 3HXMA 1VSIA 5LXYA 4JKGB 1JIHA 3F44A 3QEPA 1HJRA 3CJBA 4TNOA 4KI6A 1CSJA 1GLBG 2BQ3A 1S1WB 3GV7B 4ZJLA 2UU9F 4FLXA 3PJWA 1AT1B 2VF3A 4FXDA 2IFXA 1GLAG 5DG7A 1M5PC 2M88A 1ZBSA 1QS4A 5B0GA 3CCRN 5MLCQ 4JYAJ 4GVLA 4JKAA 3W63A 3DOLA 5ETTA 2ATLA 5KI6A 4WIIA 1RHRB 5BR8J 3SBMA 1WHXA 2QLFB 2IGIA 1N5SA 3EUNA 4NRTA 4K43A 1YRTA 3QFHA 4O4RA 5J2MB 3RAXA 1HI0P 2Y9HA 2UZAA 2D9PA 4NOHA 1RDAA 3CJ2A 5LL6Z 1MSWD 2EBGA 5C2DA 4OHYA 1WSVA 1SL2A 1F5AA 2R9LA 2P9GA 1WSFA 4FZYA 2ZJQL 1HYVA 2ZBIA 3EE9A 4IH5A 2E1AA 5SZTA 1BA1A 3W64A 2GMHA 2QFJA 4NI2A 2Y0BB 1LWFA 1TK0A 5J1EA 4B9MA 4DV2K 2C3YA 2NXEA 2BEFA 2CDRB 2AJQA 2R7YA 2ITGA 1BI4A 1PIEA 4Z37A 3NNCA 4KV8A 1C1BB 2KXHA 3MTKA 3Q89A 4X2BA 2QMXA 3HF5A 1C0FA 4BHQA 3MR6A 4C0BA 4PY5A 3HI9A 3KLIB 2DY4A 2XY7A 5U47A 3E1YA 4CJQA 2X1FA 4AM6A 1RT6B 5FLXY 2XNQA 2BE2B 1X4DA 1UMJA 2OI2A 3N4PA 1JMTA 4F3OA 1J5EK 3VF2A 1XNRK 1RBAA 1O5JA 2DYAA 3QRQA 3PV8A 2M70A 1BA0A 8ATCB 4C0OC 2KTQA 3M2UB 4FWKA 3O9QA 1YAGA 4R0EA 1UFLA 3JSMB 3HRGA 3CNQP 1L3KA 2H5EA 2W7PA 4OKJA 2OH2A 3C66A 1G2EA 4JLHA 3MXJA 1VQLS 3JQKA 3FBEA 1QAYA 3UN2A 2DGVA 2MKHA 3IGNA 3QMQA 2P9SA 1DLOA 2YWHA 4OI0A 5IXUA 4ILGB 4PA1A 2Q43A 1RAHB 3AAPA 3VAGA 2F7VA 4CF0A 4RUAA 2V51B 4JV2A 3J7YP 3CQYA 3DMJB 5KFUA 3FBBA 4CQ1A 4H4OA 3S3NA 2DNMA 5D3GA 3UNGC 2Q3PA 4BDPA 4WYBA 3CWJA 2YXLA 3HSDA 4M1KA 1F3FA 1NK0A 4RW7A 1E6YA 2DITA 1T44A 4IOCL 4WQ5A 4OKEA 2OPSA 1RI7A 1U47A 3PRVA 2NRTA 2MY8A 4B3RJ 4P74A 1VOMA 3MFHA 2WCXA 1ZAVA 4U9RA 2WVEA 4B3SK 4DS4A 2QWNA 2AJ2A 2ZJPQ 2ZUAA 1WD6A 3DHWC 1XMOJ 4OLPA 2VWJA 4NYFA 3T1AA 1WHYA 4FM2A 5DM7Q 4XO0A 4EBEA 2GZOA 4USIA 3DRPB 4FJ9A 1VLYA 2IPOB 3MAAA 3BQ1A 3DI6B 5JMVA 2BUNA 2EFOA 2B4PA 1ZM3A 2Z58B 3FEXB 3EPGA 2I7NA 4Y6IA 1VQPN 2X1AA 3MWPA 4BQLA 1RT5A 2QL5B 3VEOA 4EYHB 4E1NA 3SUPA 3VQDA 1CZAN 3GJRB 2HQFA 2PT0A 1NK5A 2ZUGA 3SAHA 3TSUA 3V1OA 2E9RX 1UAWA 2K06A 2JVRA 4QS7A 5EN1A 2MJUA 4KE5A 2FSKA 4ILLA 2W2PP 3MMAA 4DR1J 1I94K 1OQ3A 1Y7PA 1U4BA 3CC7N 4XAKA 1RTZA 4PWDA 3GFHA 4OQJA 3R5DA 3G25A 2EG1A 1YTUA 5E3RA 4I0WA 5DZ6A 2WTFA 4IR9A 4DU3A 3PM9A 4WP3A 2AP6A 2HVDA 2XWYA 2DNYA 3HM9A 5JVHQ 1U6BA 1Y97A 1RXOB 2CXEA 4F36A 1NK9A 3J7YI 5GAEP 5F8IA 4HTLA 4R8UB 2DHGA 2Z1HA 4L3NA 3LWLA 2IVPA 4ZIVA 3THWA 3NKYA 4K4YA 2EWHA 2N3LA 3PHTA 3CMEN 3MHYA 4DV2J 3VR1A 2DK2A 3DFEA 4EEYA 3G96A 4RNFA 3AVLA 3KMSA 3L3UA 2AJ1A 1C0UA 3TP2A 2YI1A 3QEVA 2FJWA 2KH9A 2BANA 2IY5B 4ED2A 3O6WA 3ZTPA 1LQ9A 1OS5A 3F73A 3ID6A 1WTFA 4CT8A 5L46A 4DR6F 1TP7A 4DL5A 1M5HA 1GLDG 3VESA 1FRJA 2X3GA 4KHQA 5KFJA 1WSRA 4J37A 3C19A 4FM0A 3M1FA 1NGBA 2HWIA 1HQUB 2VPZB 1J5EJ 1MWYA 4OLOA 1XNRJ 4O5FA 3GG1A 3CCJS 4Z4FA 5M1FA 5KG5A 3VGMA 3HYFA 4OYIA 5E84A 4UQTA 4C8NA 4KTZA 1KQGB 1TVRB 3WDOA 4C8YA 3P5TL 2HG4A 3AA8A 2DKOB 3ILOA 3CCMN 4JI1K 3ZZRA 4LF8F 1SVDA 4IBNA 4MFBA 2G8VA 1YDLA 3LDLA 3DLKA 3FEZA 4C6AA 4PKIA 5BN9A 1U1OA 4CESA 4Y3CA 3T9ZA 2LQ9A 3L8BA 2MQOA 2F9TA 2KM8C 3QB0A 3LGNA 2ZZMA 1YVNA 4HTJA 2PMZD 4LF4F 5AT1B 5F8LA 3TTCA 4RW8A 2FHMA 2VICA 4DV4F 1BOTO 3FZBA 4PZVA 1ITGA 1XNQK 3K2YA 2Z30B 5KOWA 2W4PA 3AAQA 4FJ8A 4WFXA 2HSTA 3BM7A 4B3SJ 5KFIA 2HQGA 4KH6A 4A8WA 3H3OB 2RDIA 2VG6A 2DGXA 3Q8SB 1SQGA 1X4HA 1UAXA 3CCZA 4ZP9A 5KG6A 5CXTA 3KWIA 1XMBA 3MCNA 2MQPA 1FERA 2LEBA 3G8TA 2E9TA 4JD2B 1SV5B 2HZCA 1RWOB 1SKUB 2DJWA 2CPYA 1VRQC 4U67L 1ZBIA 4F8RA 3CC2N 1DJ0A 2VQEF 2AD9A 1OY8A 4HUGA 4F04B 4E0DA 2MZTA 2OPPA 4FPRA 4DBQA 1T03B 1WOPA 5I42A 4USMA 3O1BA 5KFQA 5KT6A 1HNZK 3JXUA 3N5FA 4I68A 2OKQA 3EKUA 1I94J 1D09B 3AFGA 4XDDA 4KAIA 3K0JA 4X64F 4ZTJA 1UZHA 2ZQBA 3WEEB 3IRWP 4JI7F 4OX9K 2VG7A 1E6VB 3ZO7A 4P2MA 2F40A 4A57A 3ZZOA 3QESA 2RQMA 2VBWA 2MGZB 1DQAA 4H4KC 2D1CA 3NNAA 2AP1A 3R6MA 1NSAA 5HRPA 3CD7A 4IH7A 4ZN3A 4K4VA 1QAJA 4LD0A 1VSFA 3EVWA 2LYVA 4CZHA 1UZDA 3ADAC 4OI3A 4IFYA 1X9SA 2ZD1A 2CQ1A 4KAZA 5ETKA 4KFBB 2MKCA 1UEVA 3MCMA 2ROPA 1SKRA 1UTAA 3MX5A 2G8KA 4FJJA 2YQ3A 5C25B 1EX8A 1HKAA 4M5GA 4LFCF 4V19X 1TELA 5LMNF 2P1JA 4ELVA 2FUG9 2ITMA 3DU5A 1IKVA 5JJBA 1M5OC 4IO1A 4RG8A 3THXB 2UXCK 3KJFB 4I6MA 3IUCA 2HHSA 2CQ0A 1KAXA 5IT9U 4X4TA 2FVRA 3NCPA 1LK5A 2RH3A 3ZTQA 3KIOA 2EFNA 3IG1B 4WF9L 4WFBQ 4QBUA 2DY1A 4LF6J 5E2QA 2KLAA 3QT7A 4NZ0A 1MLAA 3TZYA 4ELUA 2CADA 3NF8A 3L9ZA 4DWIA 4YMEA 3EEQA 3LP2B 2XZTB 4UTGA 1RDBA 4KI4A 4AHTA 3KKFA 2I5JB 5D4OA 2YHWA 4M3RA 4HACA 5B8HA 3AARA 1NO8A 5AQYA 2IM3A 5F8HA 4DX6A 4RNMA 3TJAA 5L1JA 1SQKA 3H42A 3THYA 1B9DA 2RRAA 4YY3F 3KJQB 4JI1J 5F8NA 1YF5L 3FE1A 4F50A 1X0FA 3U4LA 1MWZA 3EO3A 4R79A 4DB3A 2ZKUA 2ZZTA 3IO1A 4KHNA 3QEWA 1BHNA 2JFDA 1F2GA 2CPXA 4RO0A 5M1QA 4ZVOB 2YKQA 2NZ4A 1RWVB 5F9NA 4X62F 2AEMA 4ED3A 2VIHA 4BRLA 5LSLA 4C7QA 4B9NA 1YQHA 3OSNA 3V6KA 1ESVA 1HNXF 3M2VA 3AY0A 1HLUA 3NRBA 4PQAA 1FVSA 4OGCA 4CIEA 1FK9B 4J9UE 2MHEA 3MEEB 3SZ2A 3HVWA 2ZBRA 4B08A 1VQ7N 1XNQJ 1S59A 1SKWA 1VJQA 3H2VE 3SNNA 3O4NA 2HYIB 3M6GA 2B7BB 1CJKB 4JKEA 1F9EB 3M8PB 5F3TA 4WE1A 4ECUA 2RILA 3ETMA 2DFFA 1YJWN 2HMIA 4DUTA 3ZXWA 5AXNA 3J80Y 5FROA 1TL7B 4FBTA 3H2UB 3R1LA 3E66A 4QS8A 1CJUA 4IXCA 1JLCA 2P9LB 4CLWA 5FPEA 4HT7A 4MDAA 3OYFA 1AFJA 2DEJA 4Z4HA 3AH6A 1HL6A 2Q79A 3IC1A 1KS2A 1RT1A 4TKTA 3R1HA 4OKKA 3K5OA 2CPIA 4DU4A 4URGA 1J5OA 3D6HB 1NHUA 1RZMA 4KHSA 1PYSB 2IHR1 1HNZJ 2UUAF 3B78A 3I32A 1BIUA 1SL0A 1IR0A 2NYIA 2X74A 1R0AA 3P31A 2ZJQQ 2DBBA 2KB2A 1B92A 2AA4A 2NXJA 3JTOA 3DOKA 3HULA 1B4SA 2HLTA 2YKMA 1VHIA 1JLBB 2AW0A 5H1SV 3RMDA 4CLZA 5KT3A 1TKXB 5HJYA 1NM1A 3MWTA 4P10A 4CZGA 1X4GA 5JLHA 1NGHA 3I8BA 3V81B 2JOQA 4LRFA 2YNGA 3MUVP 4KKOB 3I4HX 4M5DA 2JEGA 2XY6A 3RRGA 2JFKA 3TAEA 1VSKA 4DMZA 4DV5F 4PWWA 3ISZA 4KJIA 2KT3A 3OTOF 2RN2A 3U6FA 1ZM4A 3N4QA 4KH5A 5HBMB 1ASVA 3JYTA 4OYWA 1DEJA 5K8MA 1M1HA 3L7UA 2DNKA 2VPWB 4LFBJ 2UXCJ 2L3MA 5HQLA 4KPYA 3T69A 1U8WA 4I7FA 4ZHRB 3W66A 1VC0A 4NCGA 1LWCA 3B8AX 4GKJK 4F02A 3D6FB 3GSDA 4FF3A 1HX1A 1PGZA 4YR3A 2V94A 2XS5A 2KFNA 4JYAF 4V1Ak 3IR5B 3C3LA 1I1GA 3SPYA 4JI8K 2OFGX 2DGOA 4MAKA 3AB2B 1WORA 4TU7A 3BKFA 3LDQA 5BR8F 4FVMA 2CZ4A 2G0IA 3Q8QB 4K0KK 1HNIB 4OX7A 4CIFA 3H5SA 4MKAA 2GHWA 1L5UA 3AY9A 3C94A 2E1CA 3H98A 3ILJA 2E5IA 1RTHA 3DLBA 3HD2A 1WSGA 4JBCA 4IOCQ 1AYEA 4YOEA 4DG1B 2OPRB 4UZCA 2N7YA 3OHBA 2BX6A 2QE5A 1SC4B 3RU0A 1J2VA 2HWHA 3PNIA 3VF6A 3GYGA 3MUMP 4JKFA 4DPOA 1KAZA 1G4CA 2MKIA 4J9PA 1FWKA 4TLQA 1S99A 1WSIA 2IJRA 1O0PA 4NYNA 3BYPA 2C3MA 2DGSA 4CLYA 2XMKA 4CJWA 3MM5A 1UOCA 2C2MB 1JQGA 4F9OA 3P1GA 4PL8A 3AVBA 5KFYA 2O8EA 1U04A 1OY6A 4GVBA 2A5XA 2VA3A 2DNGA 1X5PA 1QE1A 3K57A 4DKWA 2FY1A 3SCJE 4M45A 1NUEA 1FJ7A 1K6YA 1TKTB 3CFOA 4KHWA 1FX2A 4L74A 4DV1K 4ZVEA 2JGUA 3B6PA 4ISEA 1KVJA 3LF0A 3VA3A 1S7HA 3UCGA 3RYLA 4KB1A 3HJVA 3ZX0A 4YQWA 3W8PA 3LANA 1T94A 2VJVA 1CPZA 2HBKA 4UY8O 4CLSA 5J1PA 2ASYA 3O3GA 4FKYA 3DLGB 2FLNA 3R5BA 2O8FA 3CCUS 2RKIB 3VTHA 3HJFA 2XGQA 2V8DA 3QMLA 2Q0UA 1TV6B 4YDXA 4ILMA 2J8SA 1XC3A 3PX0A 3AA2A 3OA9A 2OSRA 3QGHA 1T6CA 4H0YB 2QLBB 2YHXA 2QTWA 4OHZA 1IWGA 3BSOA 4OYBA 3ZZZA 4B1ZA 3TUZC 4YHHK 1JLGB 2A41A 4B3RF 1OMSA 4I4BA 3TOQA 4X65K 2CJAA 4H4MB 5GMDA 4Y0FA 5C24A 4O23A 4GKKK 1XMOF 2HLUA 4OZ3A 4M42A 1LWEA 3LUYA 4OPJA 2MKJA 4CGHA 5KGXA 4USWA 5DLFA 1I51B 1W97L 1U48A 4CJEA 2W2MP 4AHUA 1LFPA 3ZTRA 1YIJS 3LAMA 4MKBA 4EIAA 1FNMA 1KFSA 1I39A 2E8AA 4FF1A 3MMCB 2ATCB 2XLIA 3G71S 3V6DA 1WEYA 4DCOB 2W7AA 3DWLA 4OLBA 3RBZA 2OMOA 9RUBA 3CHWA 1P8GA 1UWBA 1KOOA 2GWKA 3J7AP 4GKJJ 3W61A 3RBDA 3LTOA 4DR1F 2M52A 3QRRA 1GOAA 3TJ8A 4Y2KA 2VDIA 2RS2A 1UJ5A 1VBKA 4EYIB 4JI8J 2QKBA 2YCHA 1REVA 5ETMA 1QVFM 3OVNA 2CNLB 2V63A 2VH7A 3KDOA 4PAAA 1KP6A 2GV1A 2DNHA 2LVWA 2CZVC 4K0KJ 1VSHA 4AHSA 4UOHA 1FTRA 4FZXC 2ZC4A 3ZETA 4IRKA 1RGIA 4IEIA 3SMZA 2PI5A 2FJXA 5FLXU 1J27A 1OJ4A 2AX0A 2MEWA 1HBNB 1XTZA 1XR5A 3TTFA 1BMQB 4DV2F 3MDQA 3HSCA 2N7CA 1MROA 3E9PA 3Q7CA 3KWGA 1YKWA 3NL0A 2UVVA 3UWTA 1WBBA 3VERA 3AXKA 4Y0WA 4OX6A 3ILLA 4KGKA 5GADI 4CEQA 4FO0A 3AD8C 2IC3B 3QEXA 4FK4A 2LP4A 1S4EA 1ACMB 3T1YK 3SCKE 3UN5A 1QZ6A 3ULEB 2PSZA 2C1EB 1IBLK 5THWA 4UF4A 2OPQA 4NLGA 3NEKA 2ZNZA 4NEZA 1H2UX 1J5EF 1XNRF 3BGRB 4U67Q 1RUSA 4DV1J 1XHXA 1YUWA 2GQCA 2FHJD 1QUPA 1Q8IA 3BPDA 3QFUA 2ZOMA 3MF5A 1TL3B 2O8BA 3C6HA 3LP1B 4CT9A 5EXWA 4BACA 3A3PB 2E88A 2G8IA 4A8QA 1RP5A 3NAHA 3U9ZA 1U1PA 4NLWA 3CPWM 4CM2A 5AQNA 1K8AO 4RWWA 2HAFA 3OS1A 1Z05A 4BRKA 3U02A 1H72C 3BEGB 4D3GA 4FJIA 1EJ7L 3D66A 1S0MA 1IN0A 4ILJA 3MMJA 4FYYB 5DG9A 3RSEA 2FGOA 1RJJA 4QWCA 4KREA 1HHQA 5KPTA 4ZVHA 1NHKL 1UKUA 3OR2B 1FXLA 3GFZA 1VC6A 4QAGA 5FIIA 3US5A 3TX0A 1CS4A 4F4ZA 2BH1A 3DRXA 3AV9A 2HHVA 5K8OA 4YHHJ 2QFIA 3IRXA 3NHGA 1NNDA 5EOYA 4R5PA 4B3SF 4X65J 2XNRA 1ZYQA 3NMUA 3D28A 5D0EA 4J9KA 1YZ7A 5AXLA 4GKKJ 4OO1J 3A8EA 4AFFA 1LCUA 5KQDA 1RT4B 3A5LC 1GLFO 3RMCA 2VODA 3P45B 2IVYA 3Q83A 2XYGB 3OL8A 2P6TA 4JN4A 3HX9A 2JEFA 4CJVA 5KAKA 1SPBP 5LT5A 2ZHOA 1RFQA 2P5GA 4DX5A 1RU2A 1VQKN 4YDDB 3ETOA 2J0QD 3FZMA 4JOUA 1AA1B 1VBYA 3SSQA 2F4FA 3ENOA 3M4XA 2RT3A 3OYIA 2XHCA 3X1LB 2J4RA 1I94F 3C7NA 4CHOA 3VGTA 5EUHA 4WYLA 2MY7A 1QUVA 4B3TJ 5HROA 3J81Y 4FPAA 2ZDOA 4H4KA 4CGIA 1JJCB 3LPEA 2UXDJ 1S57A 3VQPA 3OFFA 2HS0A 1IKYA 5CE3A 4QCLA 4FWOA 3EVOA 1LKZA 3KJNB 4P7TA 3FMBA 4K4UA 2B9WA 2GTDA 4CFAA 4KQZA 3CJ4A 1HPZB 4PXCA 1VQ5N 2RQCA 1VRUB 5K9FA 4ECXA 2ZWHA 1RCOB 1VRTB 3E9OA 2OHDA 5A0YB 4ZLPA 3WXLA 3GYNA 2P5VA 3WZ0A 2O1PA 5D78A 1S6PB 1NGCA 2Q6CA 2RUSA 4QYZK 5HLFA 4YN3B 4ED0A 2DGWA 1KEKA 2NRXA 5DDOC 2BBEA 1QAXA 3OYMA 4JP8A 3K2PA 3V9XA 3DXMA 2O67A 4ZVTB 2J6TA 2E2QA 1J9AA 2BXJA 2QW9A 4AYBD 4Q43A 1IBLJ 4LF6F 2C42A 1WUUA 1V4SA 3PUFA 5H9EK 4QR2A 2MZ1A 3LPYA 3MCPA 4CHYA 3L6QA 3DLJA 1RDDA 3HPHA 3QO9B 4FLYA 1YXQA 1IBKK 4KHYA 3M9NB 4HHJA 2CUYA 4I2PA 3NP5A 2YKAA 3QNNA 4N8NA 3WQPA 5EDWA 5CYQA 2OFHX 3KLGB 4DSLA 2E1PA 3IAM9 1FE0A 2C22A 3FQKA 4C97A 3OYAA 4FN5A 3BPSP 1QVFR 2GV9A 2Q1NA 4JI1F 3RB0A 5HQMA 3WQTA 2PEBA 4MIAA 2WONB 2I8EA 3PIPL 2UUWA 4NLQA 3R5AA 4OZ5A 1OPZA 2YH1A 2FF6A 4DTSA 3G87A 1T9WA 2BVZA 3KFWX 4FKXA 4ZPVR 3P39A 4LJMA 2EW9A 1FTCA 3OHRA 4AT1B 3CXCM 3NFAA 3PYDA 1NZAA 1G3OA 1HWIA 5J2NB 2POKA 1Z4UA 3G2XA 1P1TA 3FRYA 4BC9A 3M7VA 4OLAA 4USUA 3CYMA 2B4VA 3AVFA 2I9SA 4P75A 1GLJO 1L3UA 1UETA 1JLEB 1JLFA 4LMZA 3PCOB 4DFPA 1XNQF 3W7BA 5A6PA 3ENVA 4DPWA 3KOAA 4BRPA 4QIWD 1EO1A 3C14B 5FDLA 3OSPA 1UPMB 2RU9A 1TMJA 4WK1A 2Q1LA 2ZH4A 4BRHA 3WXJA 3D1QA 3CW2C 1TL4A 1X0PA 3KWMA 4RUHA 3DOMA 3JAMY 4WFYA 1SI9A 3T1HK 3D2EA 1H73A 2BDPA 1XMQK 1B99A 3T5KA 3S41A 4WTOB 4PG5A 4X4NA 4IDKB 1YG0A 2G8WA 3HVTA 4B1XB 1C2PA 2N4CA 2NPFA 1X3MA 2VG5B 1H6KX 3RG6A 3EXCX 3RW7A 1X9MA 3OVSA 4JKHA 3TAMA 1A5VA 2ADCA 4NA1A 4FYDA 1T7PA 2YWKA 4K4XA 1DAXA 1GMWD 3CPWR 1NDPA 1HNZF 1LK7A 4E1JA 5ETQA 2L48A 3EGNA 3NG8A 2FY8A 1NBEB 4DUZK 5KFLA 1VHFA 4YB7A 3CO0P 2GHPA 2LECA 3GQCA 3HP6A 1S1TB 2HHPA 2P9UB 4QWDA 5IQQA 2CJBA 4F4AA 5JMNA 2ZEJA 4Y00A 2FVCA 3SMSA 4OX9F 4DSEA 1TK8A 4EAHD 2NRRA 4PYAA 2DNOA 2OEMA 3TUJC 3CCQS 3PYGA 2V2ZA 2IJFA 5IC4B 1VBXA 2BKOA 3K89A 3TI0A 3AQOA 2JC0A 2DIVA 4J9VA 2AGOA 3W9IA 1FNXH 3RAMA 2RAQA 1RU1A 1BQMB 3FEYB 1OH7A 2R7TA 2Z8QA 5IT9O 2MB0B 3C0BA 2MTLA 4NMXA 3Q24A 2XI2A 3ZT4A 1VQKS 4YDUC 1N5YB 1Q7YT 5CABA 3FSIA 4JKGA 4X84A 4B3MK 4LFBF 3CJQA 4QYZJ 2UXCF 4ECQA 4BQZA 4EUVA 1ATNA 3A2FA 1YI2N 2R7XA 4NLYA 3R7SB 5IM0B 4AUKA 2BYCA 3C6UB 3U27A 3NXZA 2RU3A 1GXUA 2XULA 3CCES 1NK7A 5HJXA 4CZMA 4K2XA 1XUPO 5H9EJ 1Z6RA 3GIKA 2F63A 4WXOA 2E44A 4R0JA 3AGKA 1IBKJ 4W5QA 4I2QB 2VDHA 1RAIB 1BISA 5J2MA 3O1LA 4OPHA 3V1QA 3ICLA 3R3LA 1HQEA 1U24A 3UCUP 3OXFA 2EFVA 5CZVA 1RHKB 3MGJA 5I9EB 3QBWA 2DNQA 1CJVB 5KFKA 1WOOA 3RB4A 2CNOB 3H40A 3QGPA 2EKNA 3ZSQA 3H3NO 1UFWA 4Y2AA 2QTDA 2IRYA 4DR2K 2QA4S 2VC0A 2P9KB 3SXLA 1GT8A 4C8KA 2AZ1A 1NLVA 4YORA 2V52B 1T6DA 5D77A 1C1BA 2OTLS 4KGXB 4TY8B 1G6BA 1RILA 2BW2A 1VK8A 2V7YA 3R2DJ 2GIRA 5HMYA 5KG7A 3OL6A 3IMXA 3LGHA 4DL6A 3ZLJA 3KLIA 2JNJA 3UFCX 3LP0B 5GAHP 1Y4ZB 3BBFA 1AFIA 1RT6A 2CPJA 3N5BA 1YVFA 3NAIA 2IA6A 3CDAA 2BE9B 4ZN1A 4EMDA 1WNSA 2KVQE 3AOBA 5CD4H 4BC3A 1RDCA 2BE2A 4F4WA 4FXWA 3GIRA 4WYWA 3A4TA 2NYHA 5A76A 4ECSA 4USJC 2D0AA 4CEAA 4ZMMA 1S0NA 3M2UA 3D67A 3QAEA 3JSMA 1GEHA 4XEIA 2RQ4A 1M90O 5M1NA 1DHMA 3T1HJ 1L3VA 2OP5A 2GFFA 3M30B 4ZOSA 1XMQJ 5DQGA 5F9LA 1N0VC 1C4AA 5CYJA 3QYYA 2VQFK 3QAUA 3VGVA 5BR9A 1B0VA 3NH1A 2PA8D 4ZVUB 5IV3A 1GK8A 3HLUA 1RDWX 3VVTA 1IV0A 2QA1A 3QWPA 1LEOA 4M5IA 1Z26A 4Y34A 2EKYA 1VQ8S 1QHAA 2EK1A 2MHNA 3DMJA 3A12A 2APOA 2IBOA 4LF1A 2B4JA 4JV0A 2CH6A 3I0SB 4YOUA 2DGTA 1VQ4N 4DUZJ 1URRA 1FWLA 5M2RA 3CXCR 1IM6A 4A2AA 4K25A 4LREA 2HGLA 4RUCA 4KBOA 2BRKA 2V67A 1EKRA 2Y3YA 1Q18A 4LR7A 4DTPA 4KHRA 2UV8A 3TANA 2L9WA 1DBDA 2V5HG 1EQYA 2KL8A 4PR6A 2CVEA 3VHQA 1AXQA 2QWLA 1VR6A 3O3LA 2D3UA 3NBPB 1HA1A 2X6SA 3GILA 1XBWA 2FJDB 1B9FA 4ZPTR 4M94A 4J9SA 2OD6A 4DU7A 2HNZB 1DZ5A 5GAHI 3D7EO 3DRPA 1BG3A 3VWSA 4WQ4C 3HT0A 3CJAA 4X4RA 4IJAA 2Z2LA 3DI6A 4LQ3A 1ZPVA 4FJKA 3BGUA 5FD1A 1QTNB 2HK2A 3FFKB 1HWKA 4B3MJ 2EEYA 4GMKA 4HH0A 4HL9A 3NF9A 2QSWA 1NLKL 4JKBA 3CJ7A 2MKKA 4FWSA 1BU6O 1UVLA 4KGVB 5DLGA 3C2PA 4GKJF 2F65A 3B82A 1T3NA 4ES2A 3SUQA 4ZLLA 2GQQA 1RBVA 1UVJA 1HMVB 3SCXA 4JI8F 2AMCB 1YTAA 4CHNA 5A2QO 4LF7K 2GGPB 4CERA 4C9DA 1G99A 4K0KF 1V4TA 3OUYB 4R8UA 2WBNA 3TAGA 3LPUA 5DG8A 2OMLA 5KG4A 8RUCA 3KHHA 2EI5A 3RW6A 2V0NA 4PCQA 4BRMA 2V9WA 3VGSA 4CHQA 2OAUA 3BR9A 1RB0A 3CF5L 3FFIB 1KN6A 3G82B 2WSFC 1LXNA 3SQGB 3BDPA 4DR2J 3VZIA 1ATRA 4PHTX 4O0JA 2YPZA 3CUNA 3ENHA 4MIBA 3TYTA 4CHPA 1O6XA 2MLYA 3TA1A 3W5YA 1Q53A 5KTQA 3EVMA 2EFQA 1ZBLA 2LSNA 1HLWA 4LSZB 3P5BP 2ABYA 2GCFA 2YBVA 1OPIA 2UUTA 3VAFA 3FC9A 3MWBA 4BWJA 3R8EA 4P52A 1QVGR 4DV3K 1N8RO 1TFWA 1YWXA 1HQUA 4USHA 4MK7A 1SH0A 4DV1F 1OO0B 5ETOA 3MN7A 2I1RA 2FVQA 3FSYA 1TVRA 3PX4A 3O4WA 3ITHB 5HMXA 5GAGI 1XQIA 5KFEA 5CYMB 4ANCA 4WKRA 4M7YA 2VQFJ 4BRNA 1UEKA 2RMLA 1IG8A 3NY0A 3J7A1 4CFBA 3HD1A 1VIOA 5LSRA 3T5JA 3K59A 4RKUC 4N47A 5CCLA 1H3DA 2W2QP 1RAOA 1FWPA 1S79A 4QU6A 2V4QA 1PJ5A 1IQTA 1GNKA 4DFKA 3HOSA 4NLOA 2CQCA 4H8KA 4ED8A 4WK3A 2RE2A 3OPKA 2DRAA 3TEHB 5DETA 1MMDA 1VSJA 3ENAA 1F60B 2R7VA 1ZETA 3MURP 2R2TA 1D0EA 1P1LA 2RNEA 1SXLA 3KHLA 2G1HA 3OV7A 3ZSZA 1E3MA 3I55S 4YHHF 4IEEA 1YJNN 2B9XA 3J7YU 1Y5IB 5AZIB 1VSDA 3K9JA 4G1QB 1BC6A 3QGIA 1M0SA 5BRHA 3CMAN 4X65F 1NZ8A 3MN6A 2Q31A 1PJ6A 3IN5A 4OYOA 3Q2TC 1JJ2R 3OT9A 3CJ5A 2DHHA 1FJGK 2Z4PA 2LDYA 5E41A 3FCHA 2RRBA 3PSFA 2UV8G 4GKKF 2ZM6K 2JLEA 4DQIA 3IWNC 2F8TA 2FXUA 4DTRA 4QWEA 4F25A 2F5GA 4JKDA 3MAQA 1YK9A 4ILHA 3DDIA 4A8MP 1ATSA 1NU4A 3JQMA 5BJRA 4DQPA 4EBCA 2UVUA 4GO5X 4JD2A 1SV5A 3D3BJ 1ULRA 3IFRA 3LOUA 1OKJA 4AHRA 1JXBA 1VQMS 2KDOA 4H03B 2F4VK 3L7OA 1VQ4S 3P96A 2E1YA 4FK0A 4O3PA 3L2QA 2J9EA 4YB1P 1T03A 2J7UA 2OZMA 2NNWA 3AVKA 4DR5K 1KAYA 4J9QA 3P6YC 1BY9A 5DDPC 1VS3A 1TL1B 2F8HA 1ZH5A 3KYLA 4IOXA 2OA8A 2PFUA 1QDUB 4GV6A 1WG1A 4N76A 3PVXA 4BG8A 1T05B 2KVIA 3I5CA 4B3TF 2E2OA 4YR0A 2DEIA 4KHUA 3SAGA 2FDNA 2ZE2B 3PIPQ 1WNEA 4WJBA 3QRPA 2FBXA 5FLXO 3WEEA 3FUYA 4LF7J 2H3GX 2C2RA 1E6VA 3OYHA 2LKZA 4MJKA 1VQNS 2IDEA 2LQ8A 3NGIA 2MGZA 1B7YB 1WN7A 1ILYA 4Z0UA 4ZPCA 3SFUA 4U7UK 4Q45A 1VK3A 4DR6J 4XK8C 2BGGA 1X4FA 3LPTA 3V4IB 2ILZA 2E5JA 3MZIA 2OJ3A 4QPXA 3KK3B 4KFBA 1SBRA 1VQYA 2DH8A 4LSLB 3NGDA 5CR4A 4CD1A 3IXQA 3TWHA 3TQ1A 4NXMK 3CDWA 4ZTFA 2KG1A 4IRCA 1C0TB 4YOTA 5IC6B 1KWMA 3M32B 1S1UB 4B1VA 5C25A 4PPDA 4FWRA 2MSTA 1S10A 2KJVA 1NDLA 2HFSA 3RR7A 2OTJS 2Q2RA 3MMVA 2VWKA 1Q81O 3THXA 1C0MA 4J9LA 4ED1A 3VQAA 3QT8A 1CULB 4JI0J 1HWJA 1QQCA 3JTPA 3R5GA 2FIUA 1VSEA 2KT5A 1VQ9N 3R5CA 3IG1A 1HYSB 3T1YF 1VAZA 4OHWA 3C8YA 5ITHA 1IBLF 1WWHA 4P2FA 3L2UA 4DV3J 5HATA 4ZPBA 4PABA 2NR0A 3CQXA 4AL5A 5GINA 3U1MA 1GAOA 3LP2A 4W92B 3MN9A 2I5JA 3J7ZO 4OFZA 1JKHB 4O4GB 5IQ6A 3CTRA 2MQLA 3MFIA 3MXHP 1DRZA 2O01C 5AR0A 3V2UC 5T7LB 4A4JA 1WG4A 3LZJA 2JWNA 4RBTA 3S6EA 2CFXA 4LF4J 4PPZA 1BE4A 3PIOL 3AO4A 1U2FA 4DQ8A 4DV4J 2ZDPA 2EC0A 4N8OA 1HFEL 4GV9A 3BJYA 5C7PA 4A8KA 2Y8WA 3VAKA 1WACA 3CCLN 4NCAA 4MK9A 2E66A 4OYPA 4WFNL 2HSEB 3QGGA 1IH7A 2CQHA 2HURA 1H0HB 3BKTA 2XGPA 1Y64A 4CGFA 5BPNA 3D1HA 3SQ1A 3BR8A 1FK9A 1RT5B 3IMQJ 3MEEA 1TYQB 2GX9A 1WC0A 2G2OA 1TAUA 3UCZP 1GMVA 1A7GE 2HRUA 1OWXA 3L2WA 4B3OB 4B8AB 2UUCK 1Y11A 1CJKA 1U02A 3M8PA 2IBKA 2OELA 3GDQA 4EHTA 4B1WB 1YVUA 1UVKA 1N34K 4ALZA 2ZH2A 1NB7A 3HHEA 1OQ6A 1FKPB 1NGIA 4OYZA 1SJFA 2O66A 1ZZFA 1TL7A 4BR9A 4YFUA 2H5IB 1Y5NB 1Q8KA 2P9LA 4F0HA 3W2VA 4B9QA 1S6OA 3J81U 4MDBA 2O4IA 5AXKA 4JK8A 1N5VA 3DRRB 3CD5A 4K8RA 4K4SA 2OEJA 3UW1A 4QU7A 4NL5A 2IDOA 2F4VJ 4C8LA 3EM1A 1JLAB 4Z7YA 3VOVA 5DQHA 4ECRA 2HFNA 2NPIA 3V9ZA 1UWAA 1FI4A 3ZX2A 5KFAA 2QLJB 1F0XA 3IDHA 3H45C 3HSTB 2RUGA 4Q0BB 4HR2A 3D6TB 1SJRA 4HCBA 5GVQA 3FBCA 3PACA 1BD6A 1FFSB 1HNWK 1QHTA 3ELHA 3TVZA 2XRIA 3BSAA 3VGKA 1YRUA 2R4FA 4NRUA 3CCWA 2EHGA 3DJCA 1PYTA 1VMBA 4LFCJ 2OD4A 1JLBA 1C6VA 2IIHA 3OFEA 4DV6K 1NCLA 2AT1B 1TKXA 5B0DA 2W6KA 2PFDA 2P51A 3ULHA 1JCFA 3V81A 1NPKA 3CGIA 1HYZA 4CWBA 4IYQA 2UUBK 4KKOA 4UW2A 3TVYA 3ZNUA 3KK7A 2I2YA 4DR4J 3OYLA 3JSBA 2A2DA 4YDUA 1SZ2A 1LW2B 1L3SA 1DFDA 4NXMJ 3PTWA 2Y1RI 5C2FA 5D4NA 4IG0B 5HBMA 2V69A 2WRMA 1KCFA 3CT9A 1FRHA 4FM1A 3MM6B 4K2JA 4WZMA 4NYZA 5A8WB 2W9AA 1CVJA 2XMJA 1MDUB 4ZHRA 4RW4B 4E8UA 4NLPA 2HHQA 4ZVFA 1VIXA 3MOJB 3ULDA 1RNHA 5AQFA 1SH3A 2VONA 2YNFB 2J7WA 3FLCO 1KD1O 3PJXA 4ED6A 1NEEA 3M6UA 2MQMA 1VQLN 3H4DA 2RF2B 5B0BA 3TAPA 2HHTA 1NGJA 3CD6N 1IBKF 1HI1A 5CZXA 3D68A 2JLFA 3M8WA 2BTFA 4CIGA 1F5BA 1IKWB 4DV7K 1HNIA 4M41A 5CD4A 2AIRB 2NLWA 5JS2A 2OCEA 2QT7A 5J2PB 3CJ3A 3GONA 1MWMA 1HW9A 1ZBUA 4CEEA 3H5YA 2GVDB 2NRZA 5EVZA 2A2CA 4QYRA 3HCXA 3OBIA 4DG1A 3HFKA 2VPYB 4FWNA 1RBUA 4MTPA 2JHEA 3BY5A 1RK8A 3HHDA 4UZBA 2DR7A 2KHOA 4OPKA 2DIUA 2NUBA 3K5PA 2H1YA 2HNYB 3MD3A 1PSDA 5FPDA 4H0PA 4GNIA 3GFYA 1RAAB 4CYUB 4BRCA 3A8JA 2LA4A 1HW8A 4NASA 1GOBA 1ZAWA 4CH0S 4EO8A 2CJ9A 1SS6A 4JI4K 2V34A 4ZVQB 4QOZB 3FGVA 3M5RA 1S48A 4CW7B 4HVJA 3GTYX 2NRHA 1GLCG 4RU9A 4DMNA 1R3NA 1WC4A 1X5OA 1IJJA 4J9RA 2YJFA 2GA7A 3FVYA 5HMWA 2UUCJ 1FFWB 3K17A 1TKTA 1R0CB 3PHEA 1N34J 1H38A 2J0WA 4TU8A 2VB6A 3F2KA 3SI8A 2UUAJ 3T1HF 2QWQA 4DXLA 3BP8A 3FK4A 4IR1A 4TQRA 2FJEB 1A9NB 2VGMA 4E3SA 1XMQF 1RT2B 2ZHBA 4XDCA 4ZCMA 3MMBB 3CCLS 2YNIB 3BGFA 3IM9A 4H0XB 3M8YA 1BHLA 2D3ZA 4RUBA 3QZ7A 3DLGA 3TVKA 1UW9A 1RT7B 4ECWA 2HQ3A 1NG9A 1RHUB 2J9DA 2FJVA 3B8HA 2DH9A 1FJCA 5HMZA 4U7BA 2RKIA 1WSHA 3DLEB 1T9XA 2C2KB 3E2EA 3I82A 1TV6A 4MT1A 5HRNA 4DUZF 3OFGA 2I7PA 4JAXA 1HNWJ 4YB5A 3KKSA 2V7ZA 4BC4A 2DNZA 1AROP 1P27B 5D15A 3TZXA 1M1KO 2B51A 2W41A 4DCHA 2XQCA 3K8WA 3CF5Q 3PKMA 4JI3K 1UEUA 3EYZA 1JLGA 3VVUA 4DV6J 3TPQA 4XIUA 2QL7B 4ZVPB 1Q7LB 4IRDA 1AZSB 1NH7A 4KYZA 4BRGA 1EQ0A 4ZDNA 2FB0A 4H4MA 4BS2A 1YZ6A 3G4SS 3NVMA 2WOMB 2UUBJ 4YS2A 4WQ4A 3UVJB 2XM3A 5HO4A 3LWMA 3H46O 4RJVA 1RADB 4K4TA 3CMQA 2HBMA 4PG8A 1YSJA 4EO6A 2HHUA 2QLXA 3AAWB 1U0HB 1SH2A 3K58A 5AFUA 2LLZA 2JX2A 3HVAA 1PC4A 4BROA 4EGLA 5K8NA 3MMCA 4NLXA 4EBDA 4B3MF 2LXIA 3R9PA 2OEKA 4IUFA 4UOGA 1RSCA 3NS6A 5KFVA 3CCJN 4QR0A 2XLJA 4YOYA 4PKHA 4MYTA 1S3XA 2P9PB 3DN9A 2VC1A 1KVBA 4DF8A 4Q8EA 3CB4A 4C8ZA 1TR0A 3EZOA 5KFBA 1RHQB 4DL4A 3LZIA 3WNFA 2GAGC 4U95A 2CZ9A 2K2PA 4K4ZA 4DV7J 5H1SQ 3W9HA 3P3DA 3KNGA 1MA9B 3BO3A 2EX3A 3PW4A 3TZWA 3J80O 2CPFA 3CCSS 2IVFB 3GG0A 2CA9A 2XMWA 3V4MA 1AB8A 3SEOA 4P73A 4NB4A 2WK4A 1Q1KA 1HBNA 3I0RB 2EFGA 1ZAXA 1RACB 3DRSB 4DR2F 3ISNC 1RGVA 1FRMA 3P4IA 5DMRA 3HMJG 2KO1A 2O8DB 4ZK7M 3F0NA 3V9SA 5HP1A 4LIWA 3ZTOA 1S9GB 4EZ9A 1WAJA 5LJ3Y 1K9MO 2P5OA 4PXDA 1YLXA 1KXPA 3N9UC 5DS7A 3GU0A 2HQDA 4H0OA 1SQEA 2IC3A 4LF2A 2BM0A 4BR7A 3JS6A 3ULEA 4ANEA 3CD6S 2IOCA 1VQ6S 2V9KA 4GC7A 3O3HA 4KTQA 2HOEA 5D4LA 2OANA 2D5RA 4HUEA 2DXFA 3KK2B 1EWRA 3BGRA 4BRDA 1KRPA 2V2KA 1T8EA 3AVIA 1DY3A 1S9EB 5BRDA 3FNNA 1ZTWA 2VCPA 1PKUA 2GVZB 1TL3A 4RZRA 3LP1A 1T9VA 5EX5A 1YT3A 4J8FA 3SCIE 5AZJB 1ZBTA 2VZ9A 2VQFF 3D9BA 4FJLA 3H0PA 2XMVA 2AF6A 1TMMA 1P90A 1NGAA 3N01A 3QFPA 2WHOA 3R8YA 2Z57B 1TFYA 3UI3A 3ZSVA 5J1NA 4CI0B 3HOTA 3HHLB 3PW5A 1BCOA 3C6TA 3RTVA 4I1TA 2A6AA 2OIHA 5K5MA 3EKSA 3OR2A 1WI8A 2RQKA 2QA4G 2YX7A 3LM9A 1BQXA 4JI3J 3RMAA 1U1NA 2FQQB 2H65B 1XERA 3M6VA 3UKRB 3P83D 3AJDA 4ECVA 1RA7A 3PLAA 1Q5YA 1OIAA 4RL1A 3K9KA 1P8ZA 4C0HA 3GCWP 3TSQA 3OYCA 4UQGA 4ZCLA 1TAQA 2DPJA 3SI6A 3A13A 2VWBA 1F2HA 5JVGL 5A6WA 3MEDB 1RT4A 2K3KA 1S12A 4ID5B 2IM0A 2D41A 2XLKA 2CGJA 1SB6A 2YKOA 3TWZA 5L9XA 4X4VA 3RGIA 3SK3A 3DAWA 5DRKA 1R8HA 1FXXA 2WSCC 4CEFA 4CLKA 2VV5A 2E1ZA 4CDIA 3S7RA 3G10A 5GADU 4OZ0A 4UUXA 1FESA 5AQJA 3LH2S 2WW4A 2VJUA 2QWMA 2QMWA 5IZHA 4MKYA 3PIOQ 4JI2K 3VN5A 4PG4A 3UN3A 4KT0C 1OY9A 2CQ4A 4LRBA 1W25A 3VQ8A 3W2WB 4LF7F 4DTJA 3NS5A 3MUTP 3AA4A 3CJKB 1U6ZA 2RS8A 1JXLA 3WXIA 4YR2A 2NXNA 5CAAA 2B8QA 1RAEB 5CQGA 4LBPA 3NDKA 4DU8A 3O2IA 4BRIA 1FX4A 1HPZA 4E98A 3POTA 4G6VB 1VRUA 2ROGA 1CXQA 2NRVA 2CH5A 2HK3A 1GLEG 3ZT2A 1KKHA 4CF9A 4IQXA 3VQSA 1C0GA 2QN6B 2YX1A 3CETA 5EWEA 3N6LA 4IFVB 5CHCB 5A0YA 3V6HA 4DU1A 3NWGA 2W9BB 2V4JB 1RT3B 2LQBA 1DTQB 3TA2A 2QO3A 5C2GA 1S6PA 1U6FA 2VFRA 2Z2YB 3G6ES 2ZBCA 1JL2A 4O55A 2ZOFA 4MLEA 1LW0B 2HVZA 4RCHA 4JI0F 2OYQA 2DFEA 3ALYA 3H7HB 3J7AN 2DT9A 4UY85 2R7SA 1EB0A 1UFKA 3A8IA 3OR1B 3I4PA 2BACA 4BR4A 4DV3F 2RVJA 4CZIA 4WCEL 2ZNYA 3N6NA 2I38A 3SMPA 1I5OB 2GS8A 3A1YG 3QO9A 3I56S 3IP0A 5L38A 5J2QB 1DQ8A 4HCCA 4BC7A 5AE2A 3KHGA 4NEYA 3IBFB 3KLGA 1BXNA 1A5XA 2R42A 4CK1A 2AHOB 4ECYA 3U7JA 3ILIA 5KFCA 5KT2A 3SIPB 5KT5A 2WONA 5DDRC 2GO9A 5FRNA 2QZ8A 3SQ4A 3ZTSA 2KRBA 1ZM9A 5L1LA 1IR2A 3K5MA 3QEIA 1I3OB 2W9CB 5J2NA 1C1CB 3K7RA 2MLXA 2CJYB 1U2VB 1XJWB 2ZWPA 3HZ6A 3MX2A 2XCAA 3OY9A 4F7VA 3PFEA 4Z2XA 3C15B 1JLEA 4YUDA 2UYTA 4BR0A 4NLVA 1WC5A 3KD5E 3L95X 5LJ5Y 4QW8A 2AEJA 4DL3A 3R6LB 1RTDB 3ZSYA 3C14A 4K5RA 5ETPA 4F4KA 2HHXA 1HPMA 4M5HA 1FJGF 4DX7A 5KFHA 2ZM6F 2ZH6A 4OYXA 2GJ2A 4AE5A 3Q8VA 4DR7K 4H0VB 3RWUA 3QLHB 2ATQA 3IR6B 5B0EA 3OBWA 1J54A 5IOLA 1U25A 1V5IB 4O5BA 4F4XA 3HP9A 4IDKA 4EZ6A 1CEZA 3BB5A 2V50A 1WKJA 1VQOS 5LJVA 3MPDA 3DM2B 5KFMA 1HARA 2VG5A 3KVGA 1HBOB 3KJVB 1WJ9A 1VSLA 2YJEA 4CK3A 1H2TZ 2F4VF 3KD1E 2K1RB 2XZWA 3IBCB 2CNKB 4FK2A 1UJ4A 4DR5F 3QT6A 4GY2B 1RLCL 3M6WA 1J6ZA 4CLUA 5JICA 2ZJPL 4JI2J 3QQCD 1S1TA 2FZCB 2P9UA 3LQVA 2UP1A 4CFCA 2CWXA 4DTXA 1PBAA 2BJDA 4FW1A 2PZSA 5C12A 2N4DA 1NJWA 4PUOB 4BC2A 3BV8A 3FZLA 3SUOA 3SUNA 1R7IA 9ATCB 2RRNA 3ET6B 1VJWA 4USTA 2XWXA 4DR4F 1OVQA 2X3DA 3B4DA 3M1VB 4OMFG 3NS7B 2LXUA 2K7JA 2W6LA 1BQMA 4OZ2A 2KFYA 1DKGD 4NXMF 2RJZA 1UCNA 1WHWA 3KDNA 3NGSA 4CJ4A 2WTUA 1UVIA 1M1GA 1N5YA 1FCAA 2WC9A 4QIEA 2GW8A 2N82B 1T9UA 4BY9C 5IS2A 3NGYA 3O8WA 1HD0A 3QSYB 2QV6A 5IM0A 3WC2A 2RHSB 4DZDA 1NM2A 1F5CA 3KK1B 3SDEB 4CBWA 2FC0A 3C6UA 1NJZA 2VD3A 5AQRA 4HHHA 2B6AB 2HBRB 4DHVA 3ZFVA 4H5NA 4X62K 4RBVA 4DV0K 2EVZA 3Q7BA 3OTCA 5HSPA 4NZ6A 1J53A 3DXKB 4I2QA 1FVQA 1RTIB 3OYKA 3ENQA 4H54A 5HVHA 2QSFA 1QY7A 2ZOGA 3SAFA 2HMPA 2HAIA 2QX0A 3GCXP 4RW9B 4KO0B 2KHCA 3GFXA 3CCUN 3GIIA 1S49A 2C2ZB 3O5TB 5HVFA 1ZBHA 2HQIA 1RTJB 3NGTA 3HVRA 1VLOA 1D9DA 1EKSA 4DLGA 4H5WA 2CKWA 1V6HA 2U1AA 1RABB