1VSDA

Asv integrase core domain with mg(ii) cofactor and hepes ligand, high mg concentration form
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
146
structure length
145
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title The catalytic domain of avian sarcoma virus integrase: conformation of the active-site residues in the presence of divalent cations.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Endoribonuclease
total genus 52
structure length 145
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vsdA00
2BE2A 2GV9A 2PYJA 3EZ5A 1CZ9A 4O44A 4CESA 3MEGA 4CJVA 1LWFA 1VSMA 3AO3A 2HNZA 3QO9A 4BWJA 4KHYA 4CFCA 2JLEA 4Y1CA 5HRNA 1CZBA 3L2RA 3C95A 3NE6A 1JLAA 4DSEA 4CJRA 1A5XA 4Z4IA 3EYZA 3SV3A 1EP4A 2DFEA 3D45A 4FJLA 3WNFA 3U3GA 4PQUA 3V9XA 4M3YA 5CY4A 4DG1A 3NH0A 4CHNA 4B9SA 4RW9A 2PY5A 2D5RA 4ZHRA 3G0ZA 2G8FA 3V9UA 1S1VA 5J2MA 2YKMA 1XC9A 3UIQA 1RBTA 4B08A 3AA3A 1WAFA 4MQ3A 1TGOA 3AVIA 2HNDA 4CEOA 3CFRA 4J2AA 4CJ4A 3ZCMA 2DY4A 5JS1A 1RDDA 3OYJA 3K57A 1W9HA 1RBUA 4KB0A 4OGEA 3RRGA 3ALYA 3SZ2A 2HHWA 4KKOA 3RMBA 1X1PA 2ZQBA 4CHZA 3OYFA 3LWLA 2XHBA 1TKZA 3S3MA 3RWUA 1L3VA 4K8ZA 2HNYA 4NYFA 4B8AB 3U6FA 4AHUA 2Z1JA 2OPRA 1I3AA 1C0UA 5CZ1A 3L2UA 3MXMA 2QK9A 5C42A 3DLBA 1YTAA 4Z4EA 4C8MA 4HUFA 5KTQA 2XY6A 3SJJA 3O3GA 1VSDA 3LALA 2AJQA 2YNHA 4JRPA 3CM6A 4CF0A 3V6DA 1IH7A 4O0JA 3TAPA 1GOCA 3ZT2A 4E7IA 4CJ5A 4PUOA 3RRHA 1KLNA 1IKYA 4N56A 1VSEA 4F2RA 3ZT1A 2OPPA 3P5JA 2D0AA 3F9KA 4Q5VA 1U45A 1ZBFA 3SQ2A 4E7LA 3L2QA 3CG7A 4CJKA 5HP1A 3AA4A 4CE9A 4AILC 3PX6A 3KD1E 3OYLA 1F21A 2FBVA 4IFVA 4OVLA 1U4BA 1U48A 4HCBA 3O3HA 4DTRA 1HYZA 1HRHA 4N47A 4Z4FA 3O4QA 1LW0A 3QIPA 3AO5A 4DU1A 4BE0A 2ZD1A 4ZTFA 4FLVA 4O55A 1TAUA 3VQQA 1ZBUA 1RT7A 3HVTA 3HPOA 3TAEA 4DTXA 4I9LA 3QEIA 1DTQA 2FBTA 4I7FA 4CEDA 4RW4A 4F3OA 1LWEA 2QKBA 4KI4A 3LP0A 4EP5A 3A2FA 3AVMA 3LPTA 3SNNA 2A1RA 4FJ5A 1XI1A 2NUBA 2D0CA 3OJUA 1HYSA 4Z4GA 1Q9XA 3AO2A 2G8HA 1CXUA 3L8BA 2WONA 3DRPA 1IG9A 3HO1A 5FRNA 1S6PA 1RCHA 1RT2A 4AHRA 3OYKA 1TK5A 2YNIA 3JYTA 1JLFA 2RN2A 2KTQA 1UOCA 3L2WA 5HBMA 3DOLA 3M8QA 1LAWA 3PY8A 3P83D 1QE1A 4OKKA 3KD5E 1RTJA 4KPYA 3DMJA 3U3YA 3V1RA 4GMJB 2KW4A 4CJ3A 4DSFA 4ICLA 4JLHA 4DTNA 4OPKA 2FBXA 5DMRA 2WOMA 1B92A 3NHGA 3OYEA 3RMDA 5HRRA 3V9ZA 3WNEA 4CJSA 3O3FA 1WSHA 4FLYA 3P1GA 3KLEA 4R5PA 3K58A 4BDYA 1SKWA 1CLQA 1S1UA 4ZTJA 1A5WA 4CF8A 1FXXA 4DSJA 4Z4CA 4FJMA 1NKBA 4DFPA 1WN7A 3CFOA 3QEVA 4H4OA 3AVLA 4M42A 2F96A 4M3RA 3KLIA 3VQBA 4GW6A 2VG6A 3TR8A 4CIGA 2X6SA 3OJSA 2HVIA 2KQ2A 4FK0A 2G8IA 4LSLA 3QETA 3NDKA 3OYCA 4DFKA 2Z1GA 4KV8A 4DQPA 3QEXA 1VSHA 4FJJA 4KI6A 1YT3A 3T1AA 4J2DA 4RG8A 1KVAA 3K5MA 1C1BA 3IAYA 4KREA 1WSJA 3ASMA 3CYMA 3OYMA 4EZ6A 1JLCA 4MFBA 4E89A 3SV4A 1BL3A 3VN5A 1WSGA 3DI6A 4G1QA 3AVFA 3C6UA 4CJPA 2FBYA 1NKEA 4HHTA 2P51A 3WNHA 4DFJA 3PV8A 1K6YA 3T3FA 4CEQA 1NK4A 4KHWA 1BGXT 1NK8A 3KKRA 4KO0A 3QESA 1ZBLA 1FK9A 3KKSA 5KI6A 1NOYA 1IO2A 3AA2A 3L3VA 1WLJA 3MXJA 1VSIA 2X74A 3NF7A 3ZSYA 3PO4A 1TK8A 3V4IA 1NJZA 1B9DA 2BANA 4DTSA 4LH5A 1RDBA 1JL2A 3NH2A 4FLUA 3VQ6A 3ZSXA 4Y1DA 1GOAA 1S9EA 2E6LA 3HYFA 1Y97A 2VG7A 1U49A 2F8SA 4DMNA 2X78A 4ELTA 1ZBIA 2KZZA 3AVNA 4AH9A 5HRSA 1HPZA 2ETJA 4W5TA 5T7BA 4FLZA 1J9AA 3M8PA 4RW6A 3KLFA 4DLEA 2OPQA 5KGXA 1VK0A 4CECA 4L8RB 2OZSA 1BCOA 1X9MA 3B6OA 4DSLA 1WSEA 3LDSA 3OYHA 4QOZB 4CEEA 4CGDA 3AVHA 4FM2A 3PX0A 3OYIA 3B6PA 4CIEA 4AHSA 4O0IA 1XWLA 1XHZA 3HPGA 3DLHA 1C1AA 1DTTA 3QLHA 3VQ5A 3LPUA 1EX4A 3HXMA 3HJFA 3OYGA 1NJWA 3BGRA 2G8VA 4DQRA 3ZT0A 3CM5A 4DLGA 1S5JA 1GOBA 2LSNA 1I39A 2Z1IA 3LAMA 1NOZA 4CHOA 1D8YA 1QSLA 4NCBA 3LAKA 2KFZA 2DTUA 4N5SA 3SCXA 1LWCA 4EZ9A 4FXDA 3QEWA 3MEEA 1QSYA 4OLAA 2G8KA 3TAMA 3KLGA 2ATQA 1C0TA 4XIUA 2G8UA 4N76A 3NBPA 3PUFA 1RT5A 3E01A 4E7KA 1R0AA 4Z0UA 1HJRA 3HP9A 4J2BA 5HROA 3LZJA 1EXQA 1EKEA 3SPYA 4M45A 3OS0A 1J54A 3V1OA 1WSFA 3MAQA 1DLOA 4FW1A 4KTQA 2HHXA 3ZT3A 4FJ7A 1IKWA 1RTIA 3K5LA 4DTMA 4H4MA 4LY7A 3NF8A 4KHNA 4AHVA 4M3UA 4FLWA 3QNNA 1L3UA 2BGGA 1VSFA 4FJGA 1T8EA 4CEFA 1KCFA 1JL1A 4IFYA 3OY9A 3D0PA 4IKFA 1HYVA 3DOKA 1UAXA 1KFSA 1D9FA 4DQQA 2Y1IA 4FZZA 5D3GA 4FVMA 3KLHA 1RBVA 5CZ2A 4ID1A 5KGWA 4BE1A 1J5OA 4FLXA 4IG0A 5K14A 4C8OA 3NF6A 4FCYA 1VSLA 1B9FA 2JGUA 3MEDA 3FFIA 3AA5X 2A1SA 4JS4A 4E19A 3OS1A 4I9QA 4CJWA 3OS2A 4C8LA 4YFUA 1NK6A 1BISA 3TI0A 4M41A 4CFAA 4PA1A 3TANA 3HL8A 1IKXA 1REVA 2OA8A 4B9TA 3CQ8A 4DTPA 4KHSA 4KTZA 1XHXA 2GUIA 1TKXA 1S9GA 5JS2A 1RT3A 3AO1A 4ELVA 2KFNA 5FROA 4UQGA 1RBRA 3ULDA 3DRRA 3RMCA 3SUPA 4GVMA 3SQ0A 3SI6A 2VWJA 2FC0A 4C8KA 4DSIA 1N5YA 3OVNA 1LAVA 4W5QA 2XRIA 3S3NA 4Q0BA 4CEBA 1JXEA 4F3TA 2B6AA 2O4IA 3EY1A 3QEPA 1VRTA 3M8SA 1L3TA 3OYNA 4CEAA 1TL3A 4FJXA 4BWMA 1W0HA 4E7HA 1L5UA 3LP1A 4OGCA 1S1XA 4I2PA 4HVJA 4DQSA 3SPZA 4FJNA 3C94A 3NCIA 5C24A 5FDLA 3ZSWA 4B9NA 1HNVA 4CIFA 1Z25A 3IRXA 3S9HA 3VQAA 1JLQA 4O4GA 4E1MA 4E0DA 4KB1A 2P1JA 3HSTB 4I2QA 4LSNA 4E1NA 1ASWA 4OKEA 3SQ4A 1RT6A 3VQCA 4KAZA 4FJ8A 1VRUA 3IG1A 4NYNA 3PX4A 4RW8A 3VA0A 5I42A 1T03A 2B4JA 4HUEA 3CFPA 4CJQA 5CYQA 4B9VA 1ASUA 2XO7A 2O4GA 3AVKA 3DYAA 3VQ4A 2G8WA 2E6MA 3HVRA 3LANA 5J2QA 3DM2A 3ZSRA 4KTWA 2X6NA 2Z1HA 3DLEA 1RT1A 3HPHA 1QQCA 4AHCA 1RNHA 3IS9A 4CK3A 3LWMA 2BDPA 3T19A 2OPSA 4FJHA 2HHSA 4Z4HA 4FW2A 2XY8A 5HRPA 1C1CA 4B9LA 3OYBA 1T7PA 1RTDA 4DS4A 4CJEA 1ZBHA 3HT3A 4OKJA 4EP4A 4CCHA 1S6QA 2HW3A 3I8DA 2YHBA 4CF9A 1ASVA 1J53A 3ZT4A 2IOCA 4DU4A 3TAQA 3NF9A 1YVUA 1JLBA 3I0SA 4IG3A 1LW2A 5KRSA 5SWMA 3V81A 1KTQA 3S3OA 1KVBA 1S1WA 4DFMA 3V9WA 1S1TA 4C8NA 4CFDA 4KHQA 1RDAA 1KVCA 3TABA 2IAJA 3VA3A 3BDPA 4RW7A 4CEZA 5HLFA 4FLTA 3VQPA 3HP6A 5C25A 4F2SA 3DLRA 1JKHA 4BDPA 4FJIA 4W5NA 4E3SA 3F73A 1RTHA 4KFBA 4CHYA 1Q9YA 2F8TA 4IBNA 2E4LA 1Z26A 3K59A 3TAFA 1KSPA 3VQDA 3AVCA 4E7JA 4KHUA 1HQUA 3K5NA 4YNQA 3ZSQA 1IKVA 3KTQA 3RR8A 1RILA 3HM9A 2XY7A 2HMIA 5SZTA 1NJYA 4ELUA 2IC3A 4B8CA 3KJVA 4CK1A 3RTVA 4B9UA 3KK3A 3NGZA 3TARA 1RBSA 3KIOA 1BQNA 1BCMA 4OLBA 1NK7A 4O5BA 1ZYQA 1HQEA 4W5OA 1C0MA 3QERA 3AVGA 3SUOA 4CK2A 4WE1A 4M3XA 2HHQA 2ZE2A 3VQEA 4K8XA 1TAQA 3NGYA 3NGIA 4BACA 2DFFA 3H08A 3M8RA 1D9DA 4CHPA 4J2EA 2XY5A 1TL1A 4DQIA 4CFBA 1A5VA 1RT4A 1KRPA 3QINA 4ID5A 1SKSA 2YNFA 2HHUA 4CHQA 4N41A 1EETA 4CGIA 4TSXA 3NFAA 4M3WA 4F4KA 2VWKA 2HB5A 1VSJA 1KLMA 5J1EA 1BIUA 2RKIA 2Y1JA 4AHTA 4CF2A 1TKTA 3DRSA 3O4NA 3L2VA 1Q8IA 3RMAA 2B5JA 3K5OA 1C6VA 3THVA 1NK5A 1VSKA 3VQ7A 3ISNC 3VQ9A 3ZSVA 3QNOA 1NKCA 2RPIA 4JRQA 3AVJA 1HMVA 5E41A 4DS5A 1D5AA 3PO5A 1FKPA 4LH4A 4M3ZA 4CJFA 3RR7A 3KK2A 2KZMA 3MECA 4NCGA 3TAGA 1TK0A 3DLKA 3K2PA 1T05A 4JS5A 3V9SA 2IGIA 4B3OA 4W5RA 2HHVA 4DWIA 4CJLA 4FM1A 1U04A 3VQ8A 3SYZA 2OYQA 2IDOA 3SQ1A 4PWDA 2GBZA 4CERA 4OPJA 1LV5A 4FK4A 1SL1A 2QKKA 5J2PA 2W42A 1N6QA 1SKRA 3DLGA 3I0RA 1JXBA 4FK2A 1BHLA 4CJUA 1NK0A 4CF1A 4HTUA 4F8RA 1BIZA 3QIOA 3MXIA 2HVHA 3SUQA 4FZXC 1O1WA 2RF2A 3AVAA 1BQMA 4DF4A 3L3UA 4DTJA 1HNIA 3AO4A 4B9MA 3JSMA 1SV5A 1ITGA 2Q3SA 2OZMA 4PY5A 1UWBA 2EX3A 3G10A 4CGFA 3NAEA 5I3UA 1L3SA 3AV9A 3NH1A 1SL2A 4FM0A 1CXQA 1QTMA 5FRMA 2I5JA 2PYLA 1WNSA 1BI4B 3LP2A 1WAJA 1MU2A 3AVBA 4HUGA 1FKOA 1X9SA 4IDKA 2HHTA 1TVRA 2YV0X 1UA0A 1X9WA 1NK9A 5EU7A 2P5OA 2YNGA 3ZSOA 2R7YA 4M3TA 3SUNA 4FYDA 4BE2A 2ITGA 1SL0A 3LZIA 4DTOA 1QHTA 4FJ9A 3HK2A 2QXFA 5KRTA 1QSSA 5DK5A 3WNGA 4CGHA 2PZSA 4DTUA 1JLEA 2YKNA 2EHGA 4OJRA 3OYDA 4CGGA 1NJXA 1TKDA 2VG5A 1RDCA 3TWHA 3ZSZA 3OYAA 4DU3A 4KRFA 2P5GA 1U47A 3ITHA 2D0BA 2YHAA 3C6TA 3LP3A 4NCAA 4BDZA 1TV6A 1SUQA 1WSIA 1JLGA 1UA1A 4QCLA 4DF8A 4CJTA 1QS4A 4FZYA 1KFDA 4CGJA 2IS3A 1YTUA 5J2NA 1BI4A 4QAGA 4LD0A 2DFHA 4DSKA 1G15A 4HCCA 3V1QA 4FJKA 3KK1A 5CYMA 4H8KA
chains in the Genus database with same CATH superfamily
4YOWA 2PYJA 2FSKA 4O44A 3MEGA 4NXNK 1LWFA 3AO3A 3MN7A 3QO9A 4CFCA 3BF3A 4Y1CA 5HRNA 1CZBA 5ELZA 4YORA 3MX2A 4CJRA 3UE5A 1OVYA 3U3GA 4PQUA 3V9XA 3ZX0A 3NH0A 3HZ6A 4CHNA 3G0ZA 3V9UA 1S1VA 2PBDA 3CFRA 4OPAA 3ZCMA 1IBMK 5BPMA 1RBUA 3Q7CA 3RRGA 3ALYA 2YHYA 4KKOA 4CHZA 3WUHA 4NYFA 4JI4K 1ZBSA 3PIPL 2Z1JA 1C0UA 1U2VB 2WBNA 5CZ1A 3U4LA 3MXMA 4C8MA 5H1SQ 3MCPA 3O3GA 1HJOA 4JRPA 2F9TA 3CM6A 4RCHA 3L0QA 3V6DA 2Q1NA 3ZT2A 4CJ5A 3RRHA 1KLNA 1JCGA 4N56A 1IBLK 3ZT1A 4H5TA 2D0AA 3F9KA 3W0LA 1U45A 3N4QA 2NRZA 3L2QA 1WB9A 2BUPA 3KD1E 4AILC 1YJWN 4BQLA 4LC9B 2FBVA 4HCBA 2E88A 1WBBA 4BQZA 4DTRA 1HYZA 5AQXA 2OTLN 4JV5K 3O4QA 3QIPA 3H6EA 1Q18A 4DU1A 2ZD1A 4ZTFA 4FLVA 3WQTA 1TAUA 3TAEA 1NGGA 3VEXA 4CEDA 1Z05A 2W6LA 3LP0A 3A2FA 1XI1A 2NUBA 3OJUA 1QQOA 4Z4GA 2G8HA 4IJNA 4AHRA 5MLCQ 2NRTA 1TK5A 2RN2A 3ATUA 1UOCA 4DV7K 5HBMA 3DOLA 4OKKA 1QE1A 3IFRA 4IOCL 2KW4A 4GV6A 3I8BA 4ICLA 4JKGB 3WXMB 5KPRA 4OPKA 3GG4A 3NHGA 3OYEA 3O3FA 4FLYA 4C1NI 1A5WA 4CF8A 1FXXA 4Z4CA 3N4PA 1NKBA 2E2PA 1VQLN 3CPEA 4FWOA 3CFOA 5EOYA 2HSTA 3T7ZA 4GV9A 4GW6A 2VG6A 3NVMA 1QZ5A 4FK0A 3BEXA 2G8IA 3OYCA 5AZIB 2Z1GA 4FJJA 3T1AA 3JAMO 3QDKA 1KVAA 2Q0RA 1WSJA 4EZ6A 3OYMA 1JLCA 4MFBA 3SV4A 3VN5A 5F2RA 2IVOA 2OANA 3AVFA 3HI0A 1K6YA 2PFUA 1BGXT 3QESA 3CJAA 3M3ZA 2GELA 1NOYA 4K43A 1XNQK 3O9QA 1HKBA 2X74A 3ZSYA 1YVNA 4OO1J 4JD2B 1NJZA 4EAHD 3VQ6A 3A8YA 3HYFA 2X78A 1ATNA 4W5TA 5T7BA 4FLZA 1J9AA 5ADXH 3CC2N 1BCOA 1X9MA 4DSLA 3NMUA 3AGRA 1OH8A 3OYHA 4U67L 2UUBK 3B6PA 1DTTA 4FWKA 3QLHA 3VQ5A 3DAWA 4X66K 3OYGA 1XMQK 3HJFA 3R1XA 4BR0A 2G8VA 4NLBA 4BR2A 1S5JA 2DTUA 1QSLA 4NCBA 3LAKA 4BC5A 1LWCA 4FXDA 1VQPN 4LFBK 3TAMA 4JI5K 1C0TA 2QM1A 3PUFA 1NGEA 3EO3A 3CCLN 3C65A 3RSEB 1EXQA 3SPYA 1MDUB 2FXUA 1J54A 4FW1A 4KTQA 2HHXA 4B3MK 4RTFD 1IKWA 3K5LA 4V19S 5C2FA 3VENA 2IVNA 3I56N 3QNNA 3BZKA 3OY9A 4IKFA 1HYVA 4DUZK 4DQQA 2ASOA 4IFEA 3KLHA 1VQ8N 4BE1A 4FLXA 2NRHA 3FLCO 3NF6A 4JS4A 4CJWA 1NK6A 1OVQA 3TI0A 4YY3K 5GAGP 4PA1A 3GE1A 3TANA 4B9TA 3U9DA 3VEYA 3BF1A 3CJ7A 4M7XA 4EHUA 4C1NK 2KFNA 3O9RA 1WUAA 3G25A 3ULDA 3RMCA 3SI6A 3G71N 4C8KA 2ZJRL 4CEBA 2WC9A 3EY1A 3EKUA 3QEPA 4FJXA 1S1XA 3E9LA 3THWB 4H0XB 3Q7BA 1T6DA 4DR3K 2YJFA 1HNVA 2P9KB 1Z25A 3IRXA 4CIFA 1ZXOA 3E66A 1OH5A 3OBYA 4E1NA 3SQ4A 1RT6A 3VQCA 4IO9L 4RW8A 3VA0A 3CCUN 5I42A 4CJQA 2XO7A 2O4GA 3AVKA 3GDQA 3VQ4A 4BR4A 4RWTA 4BREA 1BA1A 1HX1A 3VEWA 1WBDA 3SLCA 2Z1HA 4CK3A 4J8FA 2QWMA 4A61A 5HRPA 3O80A 4JI3K 2KLAA 4CJEA 1NGBA 4OKJA 4EP4A 1S6QA 3I8DA 3VEVA 2YHBA 3F2KA 1ASVA 1JLBA 4FSVA 3ULEA 1GLFO 1HNXK 1S1TA 4RW7A 4FLTA 3VQPA 3DLRA 1JKHA 4BDPA 3F73A 3K59A 2JWLA 3AVCA 3LDOA 1HQUA 3GBTA 2D0PA 1RILA 3HM9A 3H3NO 3J8AA 2ZWHA 4B9UA 3NGZA 3TTCA 2D0OA 4OLBA 3C7NA 2OTJN 1HQEA 3AARA 3U9ZA 3SUOA 3O9TA 2HHQA 1IBKK 4BACA 1Q7YO 3ZEUA 4CHPA 2XY5A 4J2EA 4JHDB 4BR5A 1A5VA 1WOQA 3EZWA 3QINA 4PKHA 3J7AP 5C12A 1EETA 4M3WA 2VWKA 5EY4A 2RKIA 3A5NC 4DR2K 1NU0A 3O4NA 3DJCA 3THVA 1Q82O 3MMVA 3QNOA 1NKCA 5IWAK 1HKCA 3KK2A 2O8CB 3MWTA 1K8KB 3V9SA 2IGIA 4B3OA 1NGHA 2GX9A 3KWGA 2OYQA 1NG9A 2UUAK 4MO4A 4CZHA 4PWDA 4CERA 4OPJA 4FK4A 2O8EB 2QKKA 1N6QA 2VYPA 4KH5A 1SKRA 3I0RA 3B8AX 2E8AA 4FK2A 3DXMA 1NK0A 3MXIA 1X3MA 1O1WA 3UKRA 1GLLO 1BQMA 4DF4A 3L3UA 4DTJA 4BROA 1K8AO 3AO4A 4B9MA 3JSMA 5LL6Z 1ITGA 2Q3SA 4H5RA 1L3SA 5E26A 3AV9A 3NH1A 4YOVA 1QTMA 5FRMA 4KH4A 2I5JA 1BI4B 2WUSA 4Y0WA 4G9ZA 1WAJA 1MU2A 4LF5K 1X3NA 2JWKA 1FKOA 1X9SA 4IDKA 2YHWA 2YV0X 1X9WA 2YNGA 4M3TA 3U8XA 4FJ9A 2QXFA 5DK5A 4PKIA 2PZSA 2YKNA 2EHGA 2FSJA 3OYDA 2VG5A 2A3ZA 2F9WA 2O8DA 2D0BA 4BDZA 4ILJA 1SUQA 1WSIA 3ZETB 4FOEA 4CGJA 2IS3A 4X65K 3IKMA 4FJKA 4HCCA 5CYMA 4BC4A 4DCHA 3J7YP 3WXLA 2J4RA 3THYB 4CJVA 1BWFO 5BN8A 3CCVN 4BVPA 2JLEA 5AZJA 2A5XA 3C95A 3NE6A 4Z4IA 4IWVA 5AFUA 4A2AA 2HHHK 4B9SA 3CC4N 1BU6O 2D5RA 1GLBG 3UIQA 1RBTA 1WAFA 1T3VA 4DR1K 5JS1A 1RDDA 4JK9A 3VF4A 4OGEA 3MDQA 1RFQA 1J6ZA 3QBXA 3RMBA 2ZQBA 4K8ZA 4GY2B 3OYFA 2XHBA 2O8BA 1TKZA 5LMNK 3MN9A 2E1YA 2V7ZA 3U6FA 3SBTA 4YOYA 3HOSA 5C42A 4FWQA 5GIOA 3DLBA 1DT9A 5KTQA 2A40A 5AQLA 3TPQA 3SAGA 3LALA 2AJQA 2YNHA 1IH7A 4O0JA 3TAPA 4B1WB 4E7IA 4LFAK 2QW9A 1SAZA 2ZGYA 1C0FA 2OPPA 4BRHA 3SQ2A 4E7LA 4OX9K 3CG7A 5HP1A 3TSUA 4BC2A 3CQXA 2E2NA 4BRCA 5BRFA 4N47A 4Z4FA 4DR6K 1R59O 3FE1A 3G6EN 1RT7A 2QWOA 4I9LA 1DTQA 3WEEB 1U2VA 4EP5A 3D2EB 3LPTA 2A1RA 1N33K 3O1BA 4FJ5A 2HF4A 2QWNA 1HYSA 1Q9XA 4H0PA 2ZGZA 2WONA 1Q81O 5FRNA 4FWLA 4H0TB 1RT2A 3OYKA 4MLEA 3PIOL 3M8QA 3KD5E 3P83D 4H0OA 4GMJB 4CJ3A 4DTNA 2FBXA 4K25A 1B92A 3ENHA 4FOIA 3WNEA 4CJSA 5AQZA 3K58A 1SKWA 1S1UA 4ZTJA 3CC7N 1YJ9N 3QEVA 4H4OA 5AQHA 4CIGA 4M3RA 4BR9A 3VQBA 1HNZK 3TR8A 3OJSA 1DKGD 1EQYA 3LDNA 2KQ2A 2HVIA 4B1YB 4KI6A 4DV0K 4DQPA 1YT3A 4JNEA 4RG8A 5CHIA 3TU5A 3IAYA 3CYMA 2QXLA 3OBWA 3FZHA 5AQPA 4E89A 4DV2K 2P9LB 2P51A 4DFJA 2UUCK 4ISGA 3T3FA 1NK4A 2E20A 4X62K 1NK8A 3NVKA 1KXPA 1ZBLA 3MN5A 5CE3A 1IO2A 3L3VA 3MXJA 3VESA 4DTSA 4LH5A 1NMNA 3ZSXA 2HBMA 4PL8A 2AP1A 5C2DA 3DLLL 2KZZA 5TKWA 4DR7K 5M1FA 2ETJA 4DLEA 1HLUA 2NRRA 2OPQA 4LF7K 3GOIA 3SMPA 1CZAN 3BP8A 4CEEA 3PX0A 1LCUA 4WQ4A 5AQMA 4O0IA 4F9OA 3DLHA 1IG8A 2Q36A 2ZM6K 4B3RK 4A2BA 3LPUA 1MWKA 3DXKB 4JAXA 4C23A 5BPLA 2V52B 2VCPA 1NGIA 1E3MA 2VQFK 4JD2A 2ASMA 2LSNA 1VQKN 3LAMA 1OH7A 4EZ9A 1NGJA 3QEWA 1QSYA 4OLAA 3CQYA 3KLGA 2G8UA 4XIUA 1RDUA 3NBPA 4H5VA 4N76A 3E01A 3QBWA 1NMDA 4E7KA 5BRDA 3J7ZO 4J2BA 4CBXA 2UXDK 4XH1A 3VTHA 4M45A 1HKGA 3MAQA 4FJ7A 2Q31A 1RTIA 4DTMA 4LY7A 3NF8A 4KHNA 4FLWA 1VSFA 4FJGA 1W97L 3OA9A 3THXB 3D0PA 1JL1A 2IIRA 1BDGA 2Y1IA 4FZZA 5D3GA 4ID1A 1J5OA 5K14A 3WXKA 3PSIA 3UKUB 4EIAA 5GINA 4FCYA 1VSLA 3MX5A 2JGUA 3VPZA 4CZEA 4E19A 4C8LA 1ZC6A 3RSEA 1IKXA 1REVA 2OA8A 3MWPA 3CQ8A 2GUIA 1S9GA 1GLAG 4BRAA 1RT3A 3AO1A 2KKZA 4UY8O 5BREA 4UQGA 1ATSA 3DRRA 3AGKA 4GKKK 1N5YA 3OVNA 4W5QA 3S3NA 2UXBK 2B6AA 2O4IA 3FZFA 4XEIA 4WYBA 3M8SA 1L3TA 3OYNA 2FLOA 4BWMA 3LP1A 4DV6K 4I2PA 1TUUA 4DQSA 3H46O 1Q86O 3CCRN 4BC3A 1JLQA 4O4GA 4KB1A 3HSTB 4I2QA 4LSNA 2BGGA 4QS8A 3QB0A 4KAZA 1VRUA 5EVZA 2CGKA 3PSFA 3ID6A 1BOTO 3VGLA 3CFPA 1BO5O 2ASPA 2QA4N 4B9VA 4DR5K 2CGJA 4IOAL 2QWPA 3LANA 1I94K 5J2QA 4QS9A 1XC3A 3ZSRA 2X6NA 3DLEA 1QQCA 1RNHA 2BDPA 1M90O 3CIPA 4M63C 3VTIA 4FVUA 3O9UA 2P9KA 4DU4A 3TAQA 3NF9A 3S3OA 1NK7A 1LW2A 2E2OA 1KTQA 1S1WA 1X9JA 4C8NA 3FZLA 4CFDA 4KHQA 1S22A 3TABA 1VHXA 2IAJA 2YX6A 5HLFA 4W5NA 4F2SA 4FJIA 2Q0UA 3CJ1A 4KFBA 1Q9YA 1Z26A 3VQDA 4E7JA 2YJEA 2HOEA 4FL9A 1HPMA 1BUPA 3WXJA 2E1ZA 4ELUA 1W7AA 2D4WA 1RBSA 3HRGA 3KIOA 3D6RA 1BQNA 3WQUA 4H0YB 4YOXA 4DV1K 4W5OA 2ITMA 4CK2A 2ZE2A 4K8XA 1TAQA 3NGYA 3NGIA 1RT4A 3J81O 4ID5A 2W6KA 2YNFA 2BTFA 3D2FA 4CGIA 2V51B 5AQWA 3NFAA 3L4QA 4MO5A 1KLMA 1BIUA 3VGKA 3L2VA 5LJVA 3RMAA 3O9SA 2B5JA 1C6VA 3HM8A 2P9PA 1VSKA 4FWNA 3ISNC 4JKHA 5LY3A 3P31A 3AVJA 1FKPA 3TAGA 1TK0A 3DLKA 1QQNA 3R3LA 5F1XA 3EEQA 4CJLA 4FM1A 3SYZA 3SQ1A 1XNRK 4O8KA 5KPZA 1XUPO 1LV5A 5J2PA 4JKEA 1N8RO 3K9JA 1DGKN 4CF1A 2HVHA 4FZXC 2P9NA 3SAFA 4BRNA 2P9SA 3CJBA 3LDLA 1YIJN 3SBGA 1SV5A 1KAYA 3A5OC 3MCAB 3S41A 1KC8O 2OZMA 1UWBA 2EX3A 4CGFA 4FM0A 1SQKA 4JI2K 2O8CA 3BY5A 1P90A 2PYLA 1WNSA 4CZFA 4YOUA 4GV3A 4JKBA 4HUGA 3H45C 2HHTA 1TVRA 2W41A 1NK9A 2O8EA 2GUPA 3M5RA 3OHRA 3ZSOA 2R7YA 3SUNA 3O4WA 3LZIA 4DTOA 2P9IB 1QHTA 3J80O 1VQNN 3WNGA 3GL1A 3QMLA 4CGHA 4GKJK 4OJRA 1E4FT 4CGGA 1TKDA 1RDCA 4DU3A 2CH6A 1UA1A 1KFDA 5J2NA 1BI4A 4EFHA 3V1QA 3F5TA 2GV9A 3EZ5A 3O8MA 3LM9A 4CESA 5AQNA 2D1KA 3VERA 4B1VA 2HNZA 1T44A 1TUYA 3L2RA 5ADXA 1JLAA 1A5XA 3EYZA 3SV3A 1OH6A 4FJLA 5HOOA 1C0GA 4M3YA 4CI6A 4DG1A 2G8FA 2P9UA 3FR0A 2YKMA 2F4VK 3ENOA 2NLXA 4WQ5C 4B08A 3CJ9A 1TGOA 4WFAL 4CJ4A 2VWBA 4KHPK 4KB0A 4BRMA 1X1PA 5JICA 3LWLA 3CF5L 1NGFA 4B8AB 5JLFA 2OPRA 1I3AA 2QK9A 4ILGB 1N34K 2XY6A 1VSDA 3VF2A 4IZ9A 1GOCA 4ISFA 3CXCM 4I6MB 4CJKA 3AA4A 3PX6A 1U4BA 4OVLA 3VGMA 1QZ6A 3K9KA 3CJCA 3AO5A 5JVGL 4BE0A 3VF6A 4O55A 3VQQA 1YXQA 2FF3B 4DTXA 2FBTA 1HUXA 4RW4A 4BR7A 4F3OA 1LWEA 4LF4K 3M1FA 3CERA 2D0CA 4R79A 4B9QA 4O8UA 1S6PA 1TYQB 1RCHA 3I33A 4BRLA 3L2WA 4KPYA 1RTJA 5AQIA 3DMJA 3U3YA 3V1RA 1HNWK 5EXWA 4DSFA 3W3DA 3RMDA 5DMRA 2WOMA 1T6CA 4A59A 5HRRA 4FPBA 1BA0A 3KLEA 1GLEG 2NRVA 1IV0A 5FLXO 1CLQA 2Q97A 4QS7A 3WEEA 4B1ZA 4DSJA 4FJMA 4DFPA 1WN7A 4BRFA 3AVLA 4M42A 4AM6A 3T69A 2F96A 3KLIA 4IO8A 2OCEA 4LSLA 3SMSA 4DFKA 1NWKA 3R8EA 3QEXA 1MA9B 1VSHA 3CCQN 3K5MA 3ASMA 4JN4A 3EN9A 1YHQN 1VQON 3HSCA 1EWRA 1WSGA 3C6UA 3ULEB 2FBYA 1NKEA 4HHTA 3FGUA 4JI6K 3E9OA 3LDPA 4WQ5A 4CEQA 5AQJA 1G99A 3ZLJA 1K9MO 1FK9A 3KKSA 5KI6A 5BR9A 4JI1K 3AA2A 4CZJA 3VMFB 1VSIA 5LJWA 1TK8A 2QTDA 3P38A 3V4IA 1B9DA 1RDBA 4IXCA 5AQTA 4FLUA 4Y1DA 4FWRA 1QVGM 1Y97A 2VG7A 2F8SA 1ZBIA 3I55N 4AH9A 2W40A 3M8PA 4RW6A 3KLFA 1VK0A 4CECA 1WSEA 3LDSA 2P9LA 3H3OB 3QICA 4GNIA 3AVHA 4FM2A 4CIEA 1V4SA 2PAVA 3HPGA 1C1AA 3R6MA 1EX4A 1NJWA 4DQRA 1S72N 4FWSA 4DLGA 4A5AA 2IVPA 5AJ3K 1NOZA 4CHOA 1D8YA 2KFZA 4DR4K 3SCXA 3EL2A 1VAZA 3MEEA 2G8KA 5AQOA 5HROA 3LZJA 4H5NA 1EKEA 4WQ4C 2BH1A 4IEEA 3ZX2A 3OS0A 4LFCK 1EO1A 1DLOA 3K0SA 3T1HK 4H4MA 4AHVA 4M3UA 3CD6N 1T8EA 4CEFA 2E2QA 2NRWA 3P4IA 5DM6L 3DOKA 4FVMA 3HBTA 5KGWA 4X64K 4IG0A 4C8OA 1B9FA 4K41A 3MEDA 3FFIA 2A1SA 4K0KK 3OS1A 3OS2A 1BISA 2QI2A 4CFAA 2RE2A 4DTPA 4KTZA 1XHXA 3E9PA 5JS2A 4ELVA 3TSQA 5BRHA 1N32K 3LDQA 2ZF5O 5C10A 1RBRA 3JXUA 3SQ0A 3THXA 2FC0A 4Q0BA 1LAVA 1EWQA 4F3TA 4XH5A 1VRTA 4CZLA 4OGCA 4HVJA 4DV4K 3SPZA 1VQ4N 4FJNA 2O8FB 4BRPA 5FDLA 3LM2A 2YI1A 3S9HA 3VQAA 3LL3A 3CCMN 1Y64A 3IG1A 3ZYYX 3KWIA 3PX4A 2VGMA 4JKGA 4BG9A 1D4XA 1T03A 3IMXA 5CYQA 2G8WA 1J5EK 3H1VX 3DM2A 4DUYK 4KTWA 3LWMA 1RT1A 4AHCA 2HHSA 4FJHA 4Z4HA 4FW2A 1C1CA 3OYBA 5AZIA 1RTDA 4DS4A 5M1QA 3HT3A 4CCHA 3KZBA 3WXIA 4L3QA 4YHHK 5KRSA 4JKCA 5SWMA 4CBUA 2O8BB 3V9WA 5AQFA 1RDAA 4B3TK 1KVCA 3VA3A 4CEZA 2FF6A 4E3SA 4CHYA 5TKYA 2F8TA 3TTDA 2E4LA 1KSPA 5KQ8A 3K5NA 4YNQA 3VEZA 3KTQA 2XY7A 5SZTA 1NJYA 2IC3A 4B8CA 3RTVA 4CK1A 3KK3A 5GAHP 4H0VB 1BCMA 5AQVA 1RDWX 4O5BA 4B1UB 1ZYQA 3QERA 4DKWA 3IDHA 4WE1A 2ZJQL 5B8HA 1VQ9N 1D9DA 4YOTA 4CFBA 4N41A 4TSXA 4JI8K 1QVFM 4F4KA 1E4GT 4BVOA 3AAPA 4CF2A 3DRSA 1Q8IA 3K5OA 5AQQA 5BPNA 3D7EO 1NK5A 3ZSVA 3VQ7A 3VQ9A 1KD1O 2RPIA 4JRQA 4DS5A 4NXMK 1XMOK 4M3ZA 3RR7A 4IOXA 3MECA 4NCGA 2ZJPL 4H03B 1T05A 4JS5A 5JMVA 2HHVA 4DWIA 1U04A 2IDOA 3CCJN 2GBZA 3WT0A 5FPNA 1SL1A 2W42A 3PLAA 2HBKA 3EKSA 3C6AA 1BHLA 4CJUA 4F8RA 1BIZA 3QIOA 2RF2A 4JI7K 1NLVA 1HNIA 4IEIA 5F0XA 3G10A 3NAEA 3ID8A 1SL2A 2A6AA 1H1VA 5AQUA 1UA0A 5EU7A 2EWSA 2P5OA 2QWQA 4BE2A 2ITGA 1SL0A 3O6WA 2H3GX 2GWJA 4DTUA 1JLEA 4FPAA 4BRKA 4BRGA 1NJXA 1YITN 3TWHA 4KRFA 4BGBA 1U47A 2P5GA 3LP3A 4A5BA 1TV6A 1IJJA 3BZCA 4CZIA 4CVNE 4DF8A 5M1KA 1QS4A 4FZYA 3THWA 1YTUA 5EX5A 2DFHA 4DSKA 3DWLA 1G15A 4H8KA 2BE2A 3A5MC 3RVCA 1CZ9A 2GEMA 4O5FA 4K42A 1VSMA 2GTDA 2P9IA 4BWJA 4KHYA 3UB5A 4PL7A 1RGIA 4DSEA 3H1QA 1EP4A 1YF5L 2DFEA 1KAXA 3D45A 3WNFA 4YDUC 4PHTX 5CY4A 4RW9A 2PY5A 4ZHRA 1JJ2M 3ZX3A 5J2MA 1XC9A 3AA3A 3KK7A 4MQ3A 3AVIA 2HNDA 4BRQA 4CEOA 4J2AA 2DY4A 3SK3A 3OYJA 3G4SN 3K57A 2CH5A 1W9HA 4BY9C 4U7BA 5JLHA 3SZ2A 2HHWA 4MDAA 3RWUA 1QHAA 5FPEA 3S3MA 1L3VA 2HNYA 3BUZB 1NNEA 4AHUA 4MLHA 3L2UA 4CD3A 1YTAA 4Z4EA 4HUFA 3SJJA 5IT9O 4AQYK 4CF0A 4PUOA 1IKYA 4CW7B 4F2RA 1VSEA 3P5JA 4Q5VA 1ZBFA 4BG8A 4CE9A 3KHYA 2WTUA 3OYLA 1F21A 4IFVA 1U48A 3O3HA 1HRHA 3CETA 1LW0A 4JHDA 1ATRA 1ZBUA 3HVTA 3HPOA 1GLCG 3QEIA 1QQMA 4I7FA 4E1JA 2QKBA 2RHKA 4KI4A 3SNNA 3AVMA 1NGAA 3AO2A 1CXUA 3L8BA 3HO1A 3DRPA 1IG9A 4KH6A 3C6HA 2F7TA 2YNIA 3JYTA 1JLFA 2KHOA 3VEOA 2KTQA 4I6MA 1LAWA 3PY8A 4DV3K 5A2QO 4GVEA 3OTOK 1K8KA 4JLHA 1SZ2A 3QFPA 3L4IA 2AA4A 5BN9A 3V9ZA 5M1PA 1WSHA 3P1GA 4BDYA 4R5PA 4JK8A 2UXCK 2UU9K 2QWRA 2NRXA 1N36K 2X6SA 2QWLA 4BRDA 4CBWA 1TYQA 3NDKA 3QETA 4KV8A 3CMAN 4J2DA 1C1BA 4KREA 5AQYA 4YDUA 3MN6A 1BL3A 1BG3A 3DI6A 4G1QA 3HTVA 4CJPA 3WNHA 4LF6K 1NM1A 3PV8A 5CR4A 1NJIO 1VQ6N 4KHWA 1ESVA 3CPWM 3KKRA 4KO0A 5LMUK 1WLJA 3NF7A 3PO4A 5FPMA 3VETA 3TSPA 2HMPA 2BANA 5AQSA 1JL2A 3NH2A 1GOAA 1S9EA 2E6LA 1W2BM 2FSNA 1VQ5N 1U49A 4DMNA 1DEJA 4NO7A 4ELTA 3AVNA 5HRSA 1HPZA 2NNWA 2CGLA 3ZETA 5KGXA 3P39A 4L8RB 2OZSA 1YI2N 3B6OA 5AFUH 5I9EB 4QOZB 4CGDA 3OYIA 1P8ZA 4AHSA 1XWLA 1XHZA 3D2FB 3HXMA 5BR8K 4DV5K 3BGRA 3AY9A 3THYA 4ISEA 5AQKA 3ZT0A 3CM5A 2GWKA 1GOBA 1M1KO 4JKAA 1I39A 2Z1IA 4HWIA 2P9PB 2HF3A 5HL7L 3L6QA 4N5SA 2ATQA 1RT5A 1R0AA 4MDBA 4Z0UA 4CJ7A 1HJRA 3HP9A 3O5BA 4M7YA 3V1OA 1WSFA 3O1WA 1YUWA 3ZT3A 4WF9L 4DQ8A 2V7YA 4FWMA 4Z94A 4NB4A 1L3UA 1KCFA 4IFYA 5AQRA 3FZMA 1UAXA 4CD1A 2P9NB 1KFSA 1D9FA 2P9SB 2DPNA 1RBVA 5CZ2A 4JYAK 2I7PA 3AA5X 4ILHA 4I9QA 2HBLA 4YFUA 4M41A 5E84A 2YHXA 4WFBL 3HL8A 4WFNL 3CMEN 4KHSA 3CCEN 1TKXA 3A0IX 1KQSM 4BGAA 3M6GA 5FROA 1OKJA 4DB3A 3SUPA 1JCEA 4GVMA 4JI0K 2VWJA 1FJGK 4JKFA 4DSIA 2XRIA 1JXEA 3ATVA 1YAGA 1HR0K 3CI5A 5JVHL 4CEAA 3D2EA 1TL3A 1W0HA 4E7HA 1L5UA 3EE8A 3CCSN 3C94A 3NCIA 5C24A 1XQSC 4B3SK 1NGCA 3ZSWA 4B9NA 4E1MA 4E0DA 2P1JA 1ASWA 4JK7A 4OKEA 4PKGA 4FJ8A 4NYNA 5AR0A 2NZTA 2B4JA 4HUEA 4OPHA 1JCFA 1ASUA 2UYTA 5GAEP 3DYAA 2E6MA 3HVRA 4LF8K 5DM7L 3HPHA 3IS9A 3T19A 2OPSA 4H5WA 3QFUA 4LF9K 2XY8A 5C0YA 4B9LA 4DHYA 4CZMA 2P9UB 2O8FA 1T7PA 3C7NB 3CHWA 1ZBHA 2HW3A 2VGNA 3F9MA 4CF9A 1J53A 3ZT4A 2IOCA 4JKDA 5M1OA 1YVUA 3I0SA 4IG3A 3V81A 4XH4A 3ZEUB 1KVBA 1Z6RA 4DFMA 3R9PA 4AF1A 4AM7A 3BDPA 3HP6A 5C25A 1RTHA 4IBNA 5FPDA 2VQEK 3TAFA 4CZGA 4FO0A 4KHUA 2HBJA 3AAQA 3ZSQA 1IKVA 3RR8A 3C0BA 2HMIA 3VOVA 2YCHA 3OW2M 3TTFA 3KJVA 3TARA 4IDHA 4A57A 3MK6A 3T1YK 1C0MA 2I7NA 3AVGA 4M3XA 3VQEA 3JS6A 2DFFA 3H08A 3M8RA 2WFBA 1TL1A 4DQIA 2E5LK 1KRPA 1O13A 1SKSA 2HHUA 4CHQA 3SAHA 3DXKA 2Q2RA 3DXMB 3A5LC 2HB5A 1VSJA 5KQDA 1GLDG 5J1EA 4JEPA 1V4TA 4AHTA 2Y1JA 1TKTA 3UKRB 4KBOA 1YJNN 5GADP 5E41A 1HMVA 1KAZA 3EE9A 1D5AA 4IJAA 3PO5A 4FWPA 4LH4A 4CJFA 2KZMA 3K2PA 4W5RA 2QEXN 2A42A 3VQ8A 1LOTB 1SS6A 1NGDA 1NBWA 4NLCA 3DLGA 1JXBA 4HTUA 1GLJO 3SUQA 1ILYA 5M1NA 5C15A 3AVAA 4EHTA 2O8DB 3UKUA 1VQ7N 4PY5A 5I3UA 4A62A 1VQMN 1CXQA 4CZKA 3LP2A 3AVBA 4BRIA 3IUCA 3E1YA 5AQGA 1MWMA 5KPTA 3FFKB 4FYDA 2A41A 1K73O 3HK2A 3ENBA 4WCEL 5KRTA 1QSSA 5AZJB 3O08A 3HOTA 3KVGA 3ZSZA 3OYAA 1U6ZA 3ITHA 1S3XA 2YHAA 3C6TA 4NCAA 1FW6A 1JLGA 4QCLA 3SJHA 4CJTA 3FZKA 5GIPA 4QAGA 4LD0A 4HTLA 4B1XB 3KK1A
chains in the Genus database with same CATH topology
2BE2A 2GV9A 2PYJA 3EZ5A 1CZ9A 4O44A 4CESA 3MEGA 4CJVA 1LWFA 1VSMA 3AO3A 2HNZA 3QO9A 4BWJA 4KHYA 4CFCA 2JLEA 4Y1CA 5HRNA 1CZBA 3L2RA 3C95A 3NE6A 1JLAA 4DSEA 4CJRA 1A5XA 4Z4IA 3EYZA 3SV3A 1EP4A 2DFEA 3D45A 4FJLA 3WNFA 3U3GA 4PQUA 3V9XA 4M3YA 5CY4A 4DG1A 3NH0A 4CHNA 4B9SA 4RW9A 2PY5A 2D5RA 4ZHRA 3G0ZA 2G8FA 3V9UA 1S1VA 5J2MA 2YKMA 1XC9A 3UIQA 1RBTA 4B08A 3AA3A 1WAFA 4MQ3A 1TGOA 3AVIA 2HNDA 4CEOA 3CFRA 4J2AA 4CJ4A 3ZCMA 2DY4A 5JS1A 1RDDA 3OYJA 3K57A 1W9HA 1RBUA 4KB0A 4OGEA 3RRGA 3ALYA 3SZ2A 2HHWA 4KKOA 3RMBA 1X1PA 2ZQBA 4CHZA 3OYFA 3LWLA 2XHBA 1TKZA 3S3MA 3RWUA 1L3VA 4K8ZA 2HNYA 4NYFA 4B8AB 3U6FA 4AHUA 2Z1JA 2OPRA 1I3AA 1C0UA 5CZ1A 3L2UA 3MXMA 2QK9A 5C42A 3DLBA 1YTAA 4Z4EA 4C8MA 4HUFA 5KTQA 2XY6A 3SJJA 3O3GA 1VSDA 3LALA 2AJQA 2YNHA 4JRPA 3CM6A 4CF0A 3V6DA 1IH7A 4O0JA 3TAPA 1GOCA 3ZT2A 4E7IA 4CJ5A 4PUOA 3RRHA 1KLNA 1IKYA 4N56A 1VSEA 4F2RA 3ZT1A 2OPPA 3P5JA 2D0AA 3F9KA 4Q5VA 1U45A 1ZBFA 3SQ2A 4E7LA 3L2QA 3CG7A 4CJKA 5HP1A 3AA4A 4CE9A 4AILC 3PX6A 3KD1E 3OYLA 1F21A 2FBVA 4IFVA 4OVLA 1U4BA 1U48A 4HCBA 3O3HA 4DTRA 1HYZA 1HRHA 4N47A 4Z4FA 3O4QA 1LW0A 3QIPA 3AO5A 4DU1A 4BE0A 2ZD1A 4ZTFA 4FLVA 4O55A 1TAUA 3VQQA 1ZBUA 1RT7A 3HVTA 3HPOA 3TAEA 4DTXA 4I9LA 3QEIA 1DTQA 2FBTA 4I7FA 4CEDA 4RW4A 4F3OA 1LWEA 2QKBA 4KI4A 3LP0A 4EP5A 3A2FA 3AVMA 3LPTA 3SNNA 2A1RA 4FJ5A 1XI1A 2NUBA 2D0CA 3OJUA 1HYSA 4Z4GA 1Q9XA 3AO2A 2G8HA 1CXUA 3L8BA 2WONA 3DRPA 1IG9A 3HO1A 5FRNA 1S6PA 1RCHA 1RT2A 4AHRA 3OYKA 1TK5A 2YNIA 3JYTA 1JLFA 2RN2A 2KTQA 1UOCA 3L2WA 5HBMA 3DOLA 3M8QA 1LAWA 3PY8A 3P83D 1QE1A 4OKKA 3KD5E 1RTJA 4KPYA 3DMJA 3U3YA 3V1RA 4GMJB 2KW4A 4CJ3A 4DSFA 4ICLA 4JLHA 4DTNA 4OPKA 2FBXA 5DMRA 2WOMA 1B92A 3NHGA 3OYEA 3RMDA 5HRRA 3V9ZA 3WNEA 4CJSA 3O3FA 1WSHA 4FLYA 3P1GA 3KLEA 4R5PA 3K58A 4BDYA 1SKWA 1CLQA 1S1UA 4ZTJA 1A5WA 4CF8A 1FXXA 4DSJA 4Z4CA 4FJMA 1NKBA 4DFPA 1WN7A 3CFOA 3QEVA 4H4OA 3AVLA 4M42A 2F96A 4M3RA 3KLIA 3VQBA 4GW6A 2VG6A 3TR8A 4CIGA 2X6SA 3OJSA 2HVIA 2KQ2A 4FK0A 2G8IA 4LSLA 3QETA 3NDKA 3OYCA 4DFKA 2Z1GA 4KV8A 4DQPA 3QEXA 1VSHA 4FJJA 4KI6A 1YT3A 3T1AA 4J2DA 4RG8A 1KVAA 3K5MA 1C1BA 3IAYA 4KREA 1WSJA 3ASMA 3CYMA 3OYMA 4EZ6A 1JLCA 4MFBA 4E89A 3SV4A 1BL3A 3VN5A 1WSGA 3DI6A 4G1QA 3AVFA 3C6UA 4CJPA 2FBYA 1NKEA 4HHTA 2P51A 3WNHA 4DFJA 3PV8A 1K6YA 3T3FA 4CEQA 1NK4A 4KHWA 1BGXT 1NK8A 3KKRA 4KO0A 3QESA 1ZBLA 1FK9A 3KKSA 5KI6A 1NOYA 1IO2A 3AA2A 3L3VA 1WLJA 3MXJA 1VSIA 2X74A 3NF7A 3ZSYA 3PO4A 1TK8A 3V4IA 1NJZA 1B9DA 2BANA 4DTSA 4LH5A 1RDBA 1JL2A 3NH2A 4FLUA 3VQ6A 3ZSXA 4Y1DA 1GOAA 1S9EA 2E6LA 3HYFA 1Y97A 2VG7A 1U49A 2F8SA 4DMNA 2X78A 4ELTA 1ZBIA 2KZZA 3AVNA 4AH9A 5HRSA 1HPZA 2ETJA 4W5TA 5T7BA 4FLZA 1J9AA 3M8PA 4RW6A 3KLFA 4DLEA 2OPQA 5KGXA 1VK0A 4CECA 4L8RB 2OZSA 1BCOA 1X9MA 3B6OA 4DSLA 1WSEA 3LDSA 3OYHA 4QOZB 4CEEA 4CGDA 3AVHA 4FM2A 3PX0A 3OYIA 3B6PA 4CIEA 4AHSA 4O0IA 1XWLA 1XHZA 3HPGA 3DLHA 1C1AA 1DTTA 3QLHA 3VQ5A 3LPUA 1EX4A 3HXMA 3HJFA 3OYGA 1NJWA 3BGRA 2G8VA 4DQRA 3ZT0A 3CM5A 4DLGA 1S5JA 1GOBA 2LSNA 1I39A 2Z1IA 3LAMA 1NOZA 4CHOA 1D8YA 1QSLA 4NCBA 3LAKA 2KFZA 2DTUA 4N5SA 3SCXA 1LWCA 4EZ9A 4FXDA 3QEWA 3MEEA 1QSYA 4OLAA 2G8KA 3TAMA 3KLGA 2ATQA 1C0TA 4XIUA 2G8UA 4N76A 3NBPA 3PUFA 1RT5A 3E01A 4E7KA 1R0AA 4Z0UA 1HJRA 3HP9A 4J2BA 5HROA 3LZJA 1EXQA 1EKEA 3SPYA 4M45A 3OS0A 1J54A 3V1OA 1WSFA 3MAQA 1DLOA 4FW1A 4KTQA 2HHXA 3ZT3A 4FJ7A 1IKWA 1RTIA 3K5LA 4DTMA 4H4MA 4LY7A 3NF8A 4KHNA 4AHVA 4M3UA 4FLWA 3QNNA 1L3UA 2BGGA 1VSFA 4FJGA 1T8EA 4CEFA 1KCFA 1JL1A 4IFYA 3OY9A 3D0PA 4IKFA 1HYVA 3DOKA 1UAXA 1KFSA 1D9FA 4DQQA 2Y1IA 4FZZA 5D3GA 4FVMA 3KLHA 1RBVA 5CZ2A 4ID1A 5KGWA 4BE1A 1J5OA 4FLXA 4IG0A 5K14A 4C8OA 3NF6A 4FCYA 1VSLA 1B9FA 2JGUA 3MEDA 3FFIA 3AA5X 2A1SA 4JS4A 4E19A 3OS1A 4I9QA 4CJWA 3OS2A 4C8LA 4YFUA 1NK6A 1BISA 3TI0A 4M41A 4CFAA 4PA1A 3TANA 3HL8A 1IKXA 1REVA 2OA8A 4B9TA 3CQ8A 4DTPA 4KHSA 4KTZA 1XHXA 2GUIA 1TKXA 1S9GA 5JS2A 1RT3A 3AO1A 4ELVA 2KFNA 5FROA 4UQGA 1RBRA 3ULDA 3DRRA 3RMCA 3SUPA 4GVMA 3SQ0A 3SI6A 2VWJA 2FC0A 4C8KA 4DSIA 1N5YA 3OVNA 1LAVA 4W5QA 2XRIA 3S3NA 4Q0BA 4CEBA 1JXEA 4F3TA 2B6AA 2O4IA 3EY1A 3QEPA 1VRTA 3M8SA 1L3TA 3OYNA 4CEAA 1TL3A 4FJXA 4BWMA 1W0HA 4E7HA 1L5UA 3LP1A 4OGCA 1S1XA 4I2PA 4HVJA 4DQSA 3SPZA 4FJNA 3C94A 3NCIA 5C24A 5FDLA 3ZSWA 4B9NA 1HNVA 4CIFA 1Z25A 3IRXA 3S9HA 3VQAA 1JLQA 4O4GA 4E1MA 4E0DA 4KB1A 2P1JA 3HSTB 4I2QA 4LSNA 4E1NA 1ASWA 4OKEA 3SQ4A 1RT6A 3VQCA 4KAZA 4FJ8A 1VRUA 3IG1A 4NYNA 3PX4A 4RW8A 3VA0A 5I42A 1T03A 2B4JA 4HUEA 3CFPA 4CJQA 5CYQA 4B9VA 1ASUA 2XO7A 2O4GA 3AVKA 3DYAA 3VQ4A 2G8WA 2E6MA 3HVRA 3LANA 5J2QA 3DM2A 3ZSRA 4KTWA 2X6NA 2Z1HA 3DLEA 1RT1A 3HPHA 1QQCA 4AHCA 1RNHA 3IS9A 4CK3A 3LWMA 2BDPA 3T19A 2OPSA 4FJHA 2HHSA 4Z4HA 4FW2A 2XY8A 5HRPA 1C1CA 4B9LA 3OYBA 1T7PA 1RTDA 4DS4A 4CJEA 1ZBHA 3HT3A 4OKJA 4EP4A 4CCHA 1S6QA 2HW3A 3I8DA 2YHBA 4CF9A 1ASVA 1J53A 3ZT4A 2IOCA 4DU4A 3TAQA 3NF9A 1YVUA 1JLBA 3I0SA 4IG3A 1LW2A 5KRSA 5SWMA 3V81A 1KTQA 3S3OA 1KVBA 1S1WA 4DFMA 3V9WA 1S1TA 4C8NA 4CFDA 4KHQA 1RDAA 1KVCA 3TABA 2IAJA 3VA3A 3BDPA 4RW7A 4CEZA 5HLFA 4FLTA 3VQPA 3HP6A 5C25A 4F2SA 3DLRA 1JKHA 4BDPA 4FJIA 4W5NA 4E3SA 3F73A 1RTHA 4KFBA 4CHYA 1Q9YA 2F8TA 4IBNA 2E4LA 1Z26A 3K59A 3TAFA 1KSPA 3VQDA 3AVCA 4E7JA 4KHUA 1HQUA 3K5NA 4YNQA 3ZSQA 1IKVA 3KTQA 3RR8A 1RILA 3HM9A 2XY7A 2HMIA 5SZTA 1NJYA 4ELUA 2IC3A 4B8CA 3KJVA 4CK1A 3RTVA 4B9UA 3KK3A 3NGZA 3TARA 1RBSA 3KIOA 1BQNA 1BCMA 4OLBA 1NK7A 4O5BA 1ZYQA 1HQEA 4W5OA 1C0MA 3QERA 3AVGA 3SUOA 4CK2A 4WE1A 4M3XA 2HHQA 2ZE2A 3VQEA 4K8XA 1TAQA 3NGYA 3NGIA 4BACA 2DFFA 3H08A 3M8RA 1D9DA 4CHPA 4J2EA 2XY5A 1TL1A 4DQIA 4CFBA 1A5VA 1RT4A 1KRPA 3QINA 4ID5A 1SKSA 2YNFA 2HHUA 4CHQA 4N41A 1EETA 4CGIA 4TSXA 3NFAA 4M3WA 4F4KA 2VWKA 2HB5A 1VSJA 1KLMA 5J1EA 1BIUA 2RKIA 2Y1JA 4AHTA 4CF2A 1TKTA 3DRSA 3O4NA 3L2VA 1Q8IA 3RMAA 2B5JA 3K5OA 1C6VA 3THVA 1NK5A 1VSKA 3VQ7A 3ISNC 3VQ9A 3ZSVA 3QNOA 1NKCA 2RPIA 4JRQA 3AVJA 1HMVA 5E41A 4DS5A 1D5AA 3PO5A 1FKPA 4LH4A 4M3ZA 4CJFA 3RR7A 3KK2A 2KZMA 3MECA 4NCGA 3TAGA 1TK0A 3DLKA 3K2PA 1T05A 4JS5A 3V9SA 2IGIA 4B3OA 4W5RA 2HHVA 4DWIA 4CJLA 4FM1A 1U04A 3VQ8A 3SYZA 2OYQA 2IDOA 3SQ1A 4PWDA 2GBZA 4CERA 4OPJA 1LV5A 4FK4A 1SL1A 2QKKA 5J2PA 2W42A 1N6QA 1SKRA 3DLGA 3I0RA 1JXBA 4FK2A 1BHLA 4CJUA 1NK0A 4CF1A 4HTUA 4F8RA 1BIZA 3QIOA 3MXIA 2HVHA 3SUQA 4FZXC 1O1WA 2RF2A 3AVAA 1BQMA 4DF4A 3L3UA 4DTJA 1HNIA 3AO4A 4B9MA 3JSMA 1SV5A 1ITGA 2Q3SA 2OZMA 4PY5A 1UWBA 2EX3A 3G10A 4CGFA 3NAEA 5I3UA 1L3SA 3AV9A 3NH1A 1SL2A 4FM0A 1CXQA 1QTMA 5FRMA 2I5JA 2PYLA 1WNSA 1BI4B 3LP2A 1WAJA 1MU2A 3AVBA 4HUGA 1FKOA 1X9SA 4IDKA 2HHTA 1TVRA 2YV0X 1UA0A 1X9WA 1NK9A 5EU7A 2P5OA 2YNGA 3ZSOA 2R7YA 4M3TA 3SUNA 4FYDA 4BE2A 2ITGA 1SL0A 3LZIA 4DTOA 1QHTA 4FJ9A 3HK2A 2QXFA 5KRTA 1QSSA 5DK5A 3WNGA 4CGHA 2PZSA 4DTUA 1JLEA 2YKNA 2EHGA 4OJRA 3OYDA 4CGGA 1NJXA 1TKDA 2VG5A 1RDCA 3TWHA 3ZSZA 3OYAA 4DU3A 4KRFA 2P5GA 1U47A 3ITHA 2D0BA 2YHAA 3C6TA 3LP3A 4NCAA 4BDZA 1TV6A 1SUQA 1WSIA 1JLGA 1UA1A 4QCLA 4DF8A 4CJTA 1QS4A 4FZYA 1KFDA 4CGJA 2IS3A 1YTUA 5J2NA 1BI4A 4QAGA 4LD0A 2DFHA 4DSKA 1G15A 4HCCA 3V1QA 4FJKA 3KK1A 5CYMA 4H8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BE2 A;  2GV9 A;  2PYJ A;  3EZ5 A;  1CZ9 A;  4O44 A;  4CES A;  3MEG A;  4CJV A;  1LWF A;  1VSM A;  3AO3 A;  2HNZ A;  3QO9 A;  4BWJ A;  4KHY A;  4CFC A;  2JLE A;  4Y1C A;  5HRN A;  1CZB A;  3L2R A;  3C95 A;  3NE6 A;  1JLA A;  4DSE A;  4CJR A;  1A5X A;  4Z4I A;  3EYZ A;  3SV3 A;  1EP4 A;  2DFE A;  3D45 A;  4FJL A;  3WNF A;  3U3G A;  4PQU A;  3V9X A;  4M3Y A;  5CY4 A;  4DG1 A;  3NH0 A;  4CHN A;  4B9S A;  4RW9 A;  2PY5 A;  2D5R A;  4ZHR A;  3G0Z A;  2G8F A;  3V9U A;  1S1V A;  5J2M A;  2YKM A;  1XC9 A;  3UIQ A;  1RBT A;  4B08 A;  3AA3 A;  1WAF A;  4MQ3 A;  1TGO A;  3AVI A;  2HND A;  4CEO A;  3CFR A;  4J2A A;  4CJ4 A;  3ZCM A;  2DY4 A;  5JS1 A;  1RDD A;  3OYJ A;  3K57 A;  1W9H A;  1RBU A;  4KB0 A;  4OGE A;  3RRG A;  3ALY A;  3SZ2 A;  2HHW A;  4KKO A;  3RMB A;  1X1P A;  2ZQB A;  4CHZ A;  3OYF A;  3LWL A;  2XHB A;  1TKZ A;  3S3M A;  3RWU A;  1L3V A;  4K8Z A;  2HNY A;  4NYF A;  4B8A B;  3U6F A;  4AHU A;  2Z1J A;  2OPR A;  1I3A A;  1C0U A;  5CZ1 A;  3L2U A;  3MXM A;  2QK9 A;  5C42 A;  3DLB A;  1YTA A;  4Z4E A;  4C8M A;  4HUF A;  5KTQ A;  2XY6 A;  3SJJ A;  3O3G A;  1VSD A;  3LAL A;  2AJQ A;  2YNH A;  4JRP A;  3CM6 A;  4CF0 A;  3V6D A;  1IH7 A;  4O0J A;  3TAP A;  1GOC A;  3ZT2 A;  4E7I A;  4CJ5 A;  4PUO A;  3RRH A;  1KLN A;  1IKY A;  4N56 A;  1VSE A;  4F2R A;  3ZT1 A;  2OPP A;  3P5J A;  2D0A A;  3F9K A;  4Q5V A;  1U45 A;  1ZBF A;  3SQ2 A;  4E7L A;  3L2Q A;  3CG7 A;  4CJK A;  5HP1 A;  3AA4 A;  4CE9 A;  4AIL C;  3PX6 A;  3KD1 E;  3OYL A;  1F21 A;  2FBV A;  4IFV A;  4OVL A;  1U4B A;  1U48 A;  4HCB A;  3O3H A;  4DTR A;  1HYZ A;  1HRH A;  4N47 A;  4Z4F A;  3O4Q A;  1LW0 A;  3QIP A;  3AO5 A;  4DU1 A;  4BE0 A;  2ZD1 A;  4ZTF A;  4FLV A;  4O55 A;  1TAU A;  3VQQ A;  1ZBU A;  1RT7 A;  3HVT A;  3HPO A;  3TAE A;  4DTX A;  4I9L A;  3QEI A;  1DTQ A;  2FBT A;  4I7F A;  4CED A;  4RW4 A;  4F3O A;  1LWE A;  2QKB A;  4KI4 A;  3LP0 A;  4EP5 A;  3A2F A;  3AVM A;  3LPT A;  3SNN A;  2A1R A;  4FJ5 A;  1XI1 A;  2NUB A;  2D0C A;  3OJU A;  1HYS A;  4Z4G A;  1Q9X A;  3AO2 A;  2G8H A;  1CXU A;  3L8B A;  2WON A;  3DRP A;  1IG9 A;  3HO1 A;  5FRN A;  1S6P A;  1RCH A;  1RT2 A;  4AHR A;  3OYK A;  1TK5 A;  2YNI A;  3JYT A;  1JLF A;  2RN2 A;  2KTQ A;  1UOC A;  3L2W A;  5HBM A;  3DOL A;  3M8Q A;  1LAW A;  3PY8 A;  3P83 D;  1QE1 A;  4OKK A;  3KD5 E;  1RTJ A;  4KPY A;  3DMJ A;  3U3Y A;  3V1R A;  4GMJ B;  2KW4 A;  4CJ3 A;  4DSF A;  4ICL A;  4JLH A;  4DTN A;  4OPK A;  2FBX A;  5DMR A;  2WOM A;  1B92 A;  3NHG A;  3OYE A;  3RMD A;  5HRR A;  3V9Z A;  3WNE A;  4CJS A;  3O3F A;  1WSH A;  4FLY A;  3P1G A;  3KLE A;  4R5P A;  3K58 A;  4BDY A;  1SKW A;  1CLQ A;  1S1U A;  4ZTJ A;  1A5W A;  4CF8 A;  1FXX A;  4DSJ A;  4Z4C A;  4FJM A;  1NKB A;  4DFP A;  1WN7 A;  3CFO A;  3QEV A;  4H4O A;  3AVL A;  4M42 A;  2F96 A;  4M3R A;  3KLI A;  3VQB A;  4GW6 A;  2VG6 A;  3TR8 A;  4CIG A;  2X6S A;  3OJS A;  2HVI A;  2KQ2 A;  4FK0 A;  2G8I A;  4LSL A;  3QET A;  3NDK A;  3OYC A;  4DFK A;  2Z1G A;  4KV8 A;  4DQP A;  3QEX A;  1VSH A;  4FJJ A;  4KI6 A;  1YT3 A;  3T1A A;  4J2D A;  4RG8 A;  1KVA A;  3K5M A;  1C1B A;  3IAY A;  4KRE A;  1WSJ A;  3ASM A;  3CYM A;  3OYM A;  4EZ6 A;  1JLC A;  4MFB A;  4E89 A;  3SV4 A;  1BL3 A;  3VN5 A;  1WSG A;  3DI6 A;  4G1Q A;  3AVF A;  3C6U A;  4CJP A;  2FBY A;  1NKE A;  4HHT A;  2P51 A;  3WNH A;  4DFJ A;  3PV8 A;  1K6Y A;  3T3F A;  4CEQ A;  1NK4 A;  4KHW A;  1BGX T;  1NK8 A;  3KKR A;  4KO0 A;  3QES A;  1ZBL A;  1FK9 A;  3KKS A;  5KI6 A;  1NOY A;  1IO2 A;  3AA2 A;  3L3V A;  1WLJ A;  3MXJ A;  1VSI A;  2X74 A;  3NF7 A;  3ZSY A;  3PO4 A;  1TK8 A;  3V4I A;  1NJZ A;  1B9D A;  2BAN A;  4DTS A;  4LH5 A;  1RDB A;  1JL2 A;  3NH2 A;  4FLU A;  3VQ6 A;  3ZSX A;  4Y1D A;  1GOA A;  1S9E A;  2E6L A;  3HYF A;  1Y97 A;  2VG7 A;  1U49 A;  2F8S A;  4DMN A;  2X78 A;  4ELT A;  1ZBI A;  2KZZ A;  3AVN A;  4AH9 A;  5HRS A;  1HPZ A;  2ETJ A;  4W5T A;  5T7B A;  4FLZ A;  1J9A A;  3M8P A;  4RW6 A;  3KLF A;  4DLE A;  2OPQ A;  5KGX A;  1VK0 A;  4CEC A;  4L8R B;  2OZS A;  1BCO A;  1X9M A;  3B6O A;  4DSL A;  1WSE A;  3LDS A;  3OYH A;  4QOZ B;  4CEE A;  4CGD A;  3AVH A;  4FM2 A;  3PX0 A;  3OYI A;  3B6P A;  4CIE A;  4AHS A;  4O0I A;  1XWL A;  1XHZ A;  3HPG A;  3DLH A;  1C1A A;  1DTT A;  3QLH A;  3VQ5 A;  3LPU A;  1EX4 A;  3HXM A;  3HJF A;  3OYG A;  1NJW A;  3BGR A;  2G8V A;  4DQR A;  3ZT0 A;  3CM5 A;  4DLG A;  1S5J A;  1GOB A;  2LSN A;  1I39 A;  2Z1I A;  3LAM A;  1NOZ A;  4CHO A;  1D8Y A;  1QSL A;  4NCB A;  3LAK A;  2KFZ A;  2DTU A;  4N5S A;  3SCX A;  1LWC A;  4EZ9 A;  4FXD A;  3QEW A;  3MEE A;  1QSY A;  4OLA A;  2G8K A;  3TAM A;  3KLG A;  2ATQ A;  1C0T A;  4XIU A;  2G8U A;  4N76 A;  3NBP A;  3PUF A;  1RT5 A;  3E01 A;  4E7K A;  1R0A A;  4Z0U A;  1HJR A;  3HP9 A;  4J2B A;  5HRO A;  3LZJ A;  1EXQ A;  1EKE A;  3SPY A;  4M45 A;  3OS0 A;  1J54 A;  3V1O A;  1WSF A;  3MAQ A;  1DLO A;  4FW1 A;  4KTQ A;  2HHX A;  3ZT3 A;  4FJ7 A;  1IKW A;  1RTI A;  3K5L A;  4DTM A;  4H4M A;  4LY7 A;  3NF8 A;  4KHN A;  4AHV A;  4M3U A;  4FLW A;  3QNN A;  1L3U A;  2BGG A;  1VSF A;  4FJG A;  1T8E A;  4CEF A;  1KCF A;  1JL1 A;  4IFY A;  3OY9 A;  3D0P A;  4IKF A;  1HYV A;  3DOK A;  1UAX A;  1KFS A;  1D9F A;  4DQQ A;  2Y1I A;  4FZZ A;  5D3G A;  4FVM A;  3KLH A;  1RBV A;  5CZ2 A;  4ID1 A;  5KGW A;  4BE1 A;  1J5O A;  4FLX A;  4IG0 A;  5K14 A;  4C8O A;  3NF6 A;  4FCY A;  1VSL A;  1B9F A;  2JGU A;  3MED A;  3FFI A;  3AA5 X;  2A1S A;  4JS4 A;  4E19 A;  3OS1 A;  4I9Q A;  4CJW A;  3OS2 A;  4C8L A;  4YFU A;  1NK6 A;  1BIS A;  3TI0 A;  4M41 A;  4CFA A;  4PA1 A;  3TAN A;  3HL8 A;  1IKX A;  1REV A;  2OA8 A;  4B9T A;  3CQ8 A;  4DTP A;  4KHS A;  4KTZ A;  1XHX A;  2GUI A;  1TKX A;  1S9G A;  5JS2 A;  1RT3 A;  3AO1 A;  4ELV A;  2KFN A;  5FRO A;  4UQG A;  1RBR A;  3ULD A;  3DRR A;  3RMC A;  3SUP A;  4GVM A;  3SQ0 A;  3SI6 A;  2VWJ A;  2FC0 A;  4C8K A;  4DSI A;  1N5Y A;  3OVN A;  1LAV A;  4W5Q A;  2XRI A;  3S3N A;  4Q0B A;  4CEB A;  1JXE A;  4F3T A;  2B6A A;  2O4I A;  3EY1 A;  3QEP A;  1VRT A;  3M8S A;  1L3T A;  3OYN A;  4CEA A;  1TL3 A;  4FJX A;  4BWM A;  1W0H A;  4E7H A;  1L5U A;  3LP1 A;  4OGC A;  1S1X A;  4I2P A;  4HVJ A;  4DQS A;  3SPZ A;  4FJN A;  3C94 A;  3NCI A;  5C24 A;  5FDL A;  3ZSW A;  4B9N A;  1HNV A;  4CIF A;  1Z25 A;  3IRX A;  3S9H A;  3VQA A;  1JLQ A;  4O4G A;  4E1M A;  4E0D A;  4KB1 A;  2P1J A;  3HST B;  4I2Q A;  4LSN A;  4E1N A;  1ASW A;  4OKE A;  3SQ4 A;  1RT6 A;  3VQC A;  4KAZ A;  4FJ8 A;  1VRU A;  3IG1 A;  4NYN A;  3PX4 A;  4RW8 A;  3VA0 A;  5I42 A;  1T03 A;  2B4J A;  4HUE A;  3CFP A;  4CJQ A;  5CYQ A;  4B9V A;  1ASU A;  2XO7 A;  2O4G A;  3AVK A;  3DYA A;  3VQ4 A;  2G8W A;  2E6M A;  3HVR A;  3LAN A;  5J2Q A;  3DM2 A;  3ZSR A;  4KTW A;  2X6N A;  2Z1H A;  3DLE A;  1RT1 A;  3HPH A;  1QQC A;  4AHC A;  1RNH A;  3IS9 A;  4CK3 A;  3LWM A;  2BDP A;  3T19 A;  2OPS A;  4FJH A;  2HHS A;  4Z4H A;  4FW2 A;  2XY8 A;  5HRP A;  1C1C A;  4B9L A;  3OYB A;  1T7P A;  1RTD A;  4DS4 A;  4CJE A;  1ZBH A;  3HT3 A;  4OKJ A;  4EP4 A;  4CCH A;  1S6Q A;  2HW3 A;  3I8D A;  2YHB A;  4CF9 A;  1ASV A;  1J53 A;  3ZT4 A;  2IOC A;  4DU4 A;  3TAQ A;  3NF9 A;  1YVU A;  1JLB A;  3I0S A;  4IG3 A;  1LW2 A;  5KRS A;  5SWM A;  3V81 A;  1KTQ A;  3S3O A;  1KVB A;  1S1W A;  4DFM A;  3V9W A;  1S1T A;  4C8N A;  4CFD A;  4KHQ A;  1RDA A;  1KVC A;  3TAB A;  2IAJ A;  3VA3 A;  3BDP A;  4RW7 A;  4CEZ A;  5HLF A;  4FLT A;  3VQP A;  3HP6 A;  5C25 A;  4F2S A;  3DLR A;  1JKH A;  4BDP A;  4FJI A;  4W5N A;  4E3S A;  3F73 A;  1RTH A;  4KFB A;  4CHY A;  1Q9Y A;  2F8T A;  4IBN A;  2E4L A;  1Z26 A;  3K59 A;  3TAF A;  1KSP A;  3VQD A;  3AVC A;  4E7J A;  4KHU A;  1HQU A;  3K5N A;  4YNQ A;  3ZSQ A;  1IKV A;  3KTQ A;  3RR8 A;  1RIL A;  3HM9 A;  2XY7 A;  2HMI A;  5SZT A;  1NJY A;  4ELU A;  2IC3 A;  4B8C A;  3KJV A;  4CK1 A;  3RTV A;  4B9U A;  3KK3 A;  3NGZ A;  3TAR A;  1RBS A;  3KIO A;  1BQN A;  1BCM A;  4OLB A;  1NK7 A;  4O5B A;  1ZYQ A;  1HQE A;  4W5O A;  1C0M A;  3QER A;  3AVG A;  3SUO A;  4CK2 A;  4WE1 A;  4M3X A;  2HHQ A;  2ZE2 A;  3VQE A;  4K8X A;  1TAQ A;  3NGY A;  3NGI A;  4BAC A;  2DFF A;  3H08 A;  3M8R A;  1D9D A;  4CHP A;  4J2E A;  2XY5 A;  1TL1 A;  4DQI A;  4CFB A;  1A5V A;  1RT4 A;  1KRP A;  3QIN A;  4ID5 A;  1SKS A;  2YNF A;  2HHU A;  4CHQ A;  4N41 A;  1EET A;  4CGI A;  4TSX A;  3NFA A;  4M3W A;  4F4K A;  2VWK A;  2HB5 A;  1VSJ A;  1KLM A;  5J1E A;  1BIU A;  2RKI A;  2Y1J A;  4AHT A;  4CF2 A;  1TKT A;  3DRS A;  3O4N A;  3L2V A;  1Q8I A;  3RMA A;  2B5J A;  3K5O A;  1C6V A;  3THV A;  1NK5 A;  1VSK A;  3VQ7 A;  3ISN C;  3VQ9 A;  3ZSV A;  3QNO A;  1NKC A;  2RPI A;  4JRQ A;  3AVJ A;  1HMV A;  5E41 A;  4DS5 A;  1D5A A;  3PO5 A;  1FKP A;  4LH4 A;  4M3Z A;  4CJF A;  3RR7 A;  3KK2 A;  2KZM A;  3MEC A;  4NCG A;  3TAG A;  1TK0 A;  3DLK A;  3K2P A;  1T05 A;  4JS5 A;  3V9S A;  2IGI A;  4B3O A;  4W5R A;  2HHV A;  4DWI A;  4CJL A;  4FM1 A;  1U04 A;  3VQ8 A;  3SYZ A;  2OYQ A;  2IDO A;  3SQ1 A;  4PWD A;  2GBZ A;  4CER A;  4OPJ A;  1LV5 A;  4FK4 A;  1SL1 A;  2QKK A;  5J2P A;  2W42 A;  1N6Q A;  1SKR A;  3DLG A;  3I0R A;  1JXB A;  4FK2 A;  1BHL A;  4CJU A;  1NK0 A;  4CF1 A;  4HTU A;  4F8R A;  1BIZ A;  3QIO A;  3MXI A;  2HVH A;  3SUQ A;  4FZX C;  1O1W A;  2RF2 A;  3AVA A;  1BQM A;  4DF4 A;  3L3U A;  4DTJ A;  1HNI A;  3AO4 A;  4B9M A;  3JSM A;  1SV5 A;  1ITG A;  2Q3S A;  2OZM A;  4PY5 A;  1UWB A;  2EX3 A;  3G10 A;  4CGF A;  3NAE A;  5I3U A;  1L3S A;  3AV9 A;  3NH1 A;  1SL2 A;  4FM0 A;  1CXQ A;  1QTM A;  5FRM A;  2I5J A;  2PYL A;  1WNS A;  1BI4 B;  3LP2 A;  1WAJ A;  1MU2 A;  3AVB A;  4HUG A;  1FKO A;  1X9S A;  4IDK A;  2HHT A;  1TVR A;  2YV0 X;  1UA0 A;  1X9W A;  1NK9 A;  5EU7 A;  2P5O A;  2YNG A;  3ZSO A;  2R7Y A;  4M3T A;  3SUN A;  4FYD A;  4BE2 A;  2ITG A;  1SL0 A;  3LZI A;  4DTO A;  1QHT A;  4FJ9 A;  3HK2 A;  2QXF A;  5KRT A;  1QSS A;  5DK5 A;  3WNG A;  4CGH A;  2PZS A;  4DTU A;  1JLE A;  2YKN A;  2EHG A;  4OJR A;  3OYD A;  4CGG A;  1NJX A;  1TKD A;  2VG5 A;  1RDC A;  3TWH A;  3ZSZ A;  3OYA A;  4DU3 A;  4KRF A;  2P5G A;  1U47 A;  3ITH A;  2D0B A;  2YHA A;  3C6T A;  3LP3 A;  4NCA A;  4BDZ A;  1TV6 A;  1SUQ A;  1WSI A;  1JLG A;  1UA1 A;  4QCL A;  4DF8 A;  4CJT A;  1QS4 A;  4FZY A;  1KFD A;  4CGJ A;  2IS3 A;  1YTU A;  5J2N A;  1BI4 A;  4QAG A;  4LD0 A;  2DFH A;  4DSK A;  1G15 A;  4HCC A;  3V1Q A;  4FJK A;  3KK1 A;  5CYM A;  4H8K A; 
#chains in the Genus database with same CATH topology
 4YOW A;  2PYJ A;  2FSK A;  4O44 A;  3MEG A;  4NXN K;  1LWF A;  3AO3 A;  3MN7 A;  3QO9 A;  4CFC A;  3BF3 A;  4Y1C A;  5HRN A;  1CZB A;  5ELZ A;  4YOR A;  3MX2 A;  4CJR A;  3UE5 A;  1OVY A;  3U3G A;  4PQU A;  3V9X A;  3ZX0 A;  3NH0 A;  3HZ6 A;  4CHN A;  3G0Z A;  3V9U A;  1S1V A;  2PBD A;  3CFR A;  4OPA A;  3ZCM A;  1IBM K;  5BPM A;  1RBU A;  3Q7C A;  3RRG A;  3ALY A;  2YHY A;  4KKO A;  4CHZ A;  3WUH A;  4NYF A;  4JI4 K;  1ZBS A;  3PIP L;  2Z1J A;  1C0U A;  1U2V B;  2WBN A;  5CZ1 A;  3U4L A;  3MXM A;  4C8M A;  5H1S Q;  3MCP A;  3O3G A;  1HJO A;  4JRP A;  2F9T A;  3CM6 A;  4RCH A;  3L0Q A;  3V6D A;  2Q1N A;  3ZT2 A;  4CJ5 A;  3RRH A;  1KLN A;  1JCG A;  4N56 A;  1IBL K;  3ZT1 A;  4H5T A;  2D0A A;  3F9K A;  3W0L A;  1U45 A;  3N4Q A;  2NRZ A;  3L2Q A;  1WB9 A;  2BUP A;  3KD1 E;  4AIL C;  1YJW N;  4BQL A;  4LC9 B;  2FBV A;  4HCB A;  2E88 A;  1WBB A;  4BQZ A;  4DTR A;  1HYZ A;  5AQX A;  2OTL N;  4JV5 K;  3O4Q A;  3QIP A;  3H6E A;  1Q18 A;  4DU1 A;  2ZD1 A;  4ZTF A;  4FLV A;  3WQT A;  1TAU A;  3TAE A;  1NGG A;  3VEX A;  4CED A;  1Z05 A;  2W6L A;  3LP0 A;  3A2F A;  1XI1 A;  2NUB A;  3OJU A;  1QQO A;  4Z4G A;  2G8H A;  4IJN A;  4AHR A;  5MLC Q;  2NRT A;  1TK5 A;  2RN2 A;  3ATU A;  1UOC A;  4DV7 K;  5HBM A;  3DOL A;  4OKK A;  1QE1 A;  3IFR A;  4IOC L;  2KW4 A;  4GV6 A;  3I8B A;  4ICL A;  4JKG B;  3WXM B;  5KPR A;  4OPK A;  3GG4 A;  3NHG A;  3OYE A;  3O3F A;  4FLY A;  4C1N I;  1A5W A;  4CF8 A;  1FXX A;  4Z4C A;  3N4P A;  1NKB A;  2E2P A;  1VQL N;  3CPE A;  4FWO A;  3CFO A;  5EOY A;  2HST A;  3T7Z A;  4GV9 A;  4GW6 A;  2VG6 A;  3NVM A;  1QZ5 A;  4FK0 A;  3BEX A;  2G8I A;  3OYC A;  5AZI B;  2Z1G A;  4FJJ A;  3T1A A;  3JAM O;  3QDK A;  1KVA A;  2Q0R A;  1WSJ A;  4EZ6 A;  3OYM A;  1JLC A;  4MFB A;  3SV4 A;  3VN5 A;  5F2R A;  2IVO A;  2OAN A;  3AVF A;  3HI0 A;  1K6Y A;  2PFU A;  1BGX T;  3QES A;  3CJA A;  3M3Z A;  2GEL A;  1NOY A;  4K43 A;  1XNQ K;  3O9Q A;  1HKB A;  2X74 A;  3ZSY A;  1YVN A;  4OO1 J;  4JD2 B;  1NJZ A;  4EAH D;  3VQ6 A;  3A8Y A;  3HYF A;  2X78 A;  1ATN A;  4W5T A;  5T7B A;  4FLZ A;  1J9A A;  5ADX H;  3CC2 N;  1BCO A;  1X9M A;  4DSL A;  3NMU A;  3AGR A;  1OH8 A;  3OYH A;  4U67 L;  2UUB K;  3B6P A;  1DTT A;  4FWK A;  3QLH A;  3VQ5 A;  3DAW A;  4X66 K;  3OYG A;  1XMQ K;  3HJF A;  3R1X A;  4BR0 A;  2G8V A;  4NLB A;  4BR2 A;  1S5J A;  2DTU A;  1QSL A;  4NCB A;  3LAK A;  4BC5 A;  1LWC A;  4FXD A;  1VQP N;  4LFB K;  3TAM A;  4JI5 K;  1C0T A;  2QM1 A;  3PUF A;  1NGE A;  3EO3 A;  3CCL N;  3C65 A;  3RSE B;  1EXQ A;  3SPY A;  1MDU B;  2FXU A;  1J54 A;  4FW1 A;  4KTQ A;  2HHX A;  4B3M K;  4RTF D;  1IKW A;  3K5L A;  4V19 S;  5C2F A;  3VEN A;  2IVN A;  3I56 N;  3QNN A;  3BZK A;  3OY9 A;  4IKF A;  1HYV A;  4DUZ K;  4DQQ A;  2ASO A;  4IFE A;  3KLH A;  1VQ8 N;  4BE1 A;  4FLX A;  2NRH A;  3FLC O;  3NF6 A;  4JS4 A;  4CJW A;  1NK6 A;  1OVQ A;  3TI0 A;  4YY3 K;  5GAG P;  4PA1 A;  3GE1 A;  3TAN A;  4B9T A;  3U9D A;  3VEY A;  3BF1 A;  3CJ7 A;  4M7X A;  4EHU A;  4C1N K;  2KFN A;  3O9R A;  1WUA A;  3G25 A;  3ULD A;  3RMC A;  3SI6 A;  3G71 N;  4C8K A;  2ZJR L;  4CEB A;  2WC9 A;  3EY1 A;  3EKU A;  3QEP A;  4FJX A;  1S1X A;  3E9L A;  3THW B;  4H0X B;  3Q7B A;  1T6D A;  4DR3 K;  2YJF A;  1HNV A;  2P9K B;  1Z25 A;  3IRX A;  4CIF A;  1ZXO A;  3E66 A;  1OH5 A;  3OBY A;  4E1N A;  3SQ4 A;  1RT6 A;  3VQC A;  4IO9 L;  4RW8 A;  3VA0 A;  3CCU N;  5I42 A;  4CJQ A;  2XO7 A;  2O4G A;  3AVK A;  3GDQ A;  3VQ4 A;  4BR4 A;  4RWT A;  4BRE A;  1BA1 A;  1HX1 A;  3VEW A;  1WBD A;  3SLC A;  2Z1H A;  4CK3 A;  4J8F A;  2QWM A;  4A61 A;  5HRP A;  3O80 A;  4JI3 K;  2KLA A;  4CJE A;  1NGB A;  4OKJ A;  4EP4 A;  1S6Q A;  3I8D A;  3VEV A;  2YHB A;  3F2K A;  1ASV A;  1JLB A;  4FSV A;  3ULE A;  1GLF O;  1HNX K;  1S1T A;  4RW7 A;  4FLT A;  3VQP A;  3DLR A;  1JKH A;  4BDP A;  3F73 A;  3K59 A;  2JWL A;  3AVC A;  3LDO A;  1HQU A;  3GBT A;  2D0P A;  1RIL A;  3HM9 A;  3H3N O;  3J8A A;  2ZWH A;  4B9U A;  3NGZ A;  3TTC A;  2D0O A;  4OLB A;  3C7N A;  2OTJ N;  1HQE A;  3AAR A;  3U9Z A;  3SUO A;  3O9T A;  2HHQ A;  1IBK K;  4BAC A;  1Q7Y O;  3ZEU A;  4CHP A;  2XY5 A;  4J2E A;  4JHD B;  4BR5 A;  1A5V A;  1WOQ A;  3EZW A;  3QIN A;  4PKH A;  3J7A P;  5C12 A;  1EET A;  4M3W A;  2VWK A;  5EY4 A;  2RKI A;  3A5N C;  4DR2 K;  1NU0 A;  3O4N A;  3DJC A;  3THV A;  1Q82 O;  3MMV A;  3QNO A;  1NKC A;  5IWA K;  1HKC A;  3KK2 A;  2O8C B;  3MWT A;  1K8K B;  3V9S A;  2IGI A;  4B3O A;  1NGH A;  2GX9 A;  3KWG A;  2OYQ A;  1NG9 A;  2UUA K;  4MO4 A;  4CZH A;  4PWD A;  4CER A;  4OPJ A;  4FK4 A;  2O8E B;  2QKK A;  1N6Q A;  2VYP A;  4KH5 A;  1SKR A;  3I0R A;  3B8A X;  2E8A A;  4FK2 A;  3DXM A;  1NK0 A;  3MXI A;  1X3M A;  1O1W A;  3UKR A;  1GLL O;  1BQM A;  4DF4 A;  3L3U A;  4DTJ A;  4BRO A;  1K8A O;  3AO4 A;  4B9M A;  3JSM A;  5LL6 Z;  1ITG A;  2Q3S A;  4H5R A;  1L3S A;  5E26 A;  3AV9 A;  3NH1 A;  4YOV A;  1QTM A;  5FRM A;  4KH4 A;  2I5J A;  1BI4 B;  2WUS A;  4Y0W A;  4G9Z A;  1WAJ A;  1MU2 A;  4LF5 K;  1X3N A;  2JWK A;  1FKO A;  1X9S A;  4IDK A;  2YHW A;  2YV0 X;  1X9W A;  2YNG A;  4M3T A;  3U8X A;  4FJ9 A;  2QXF A;  5DK5 A;  4PKI A;  2PZS A;  2YKN A;  2EHG A;  2FSJ A;  3OYD A;  2VG5 A;  2A3Z A;  2F9W A;  2O8D A;  2D0B A;  4BDZ A;  4ILJ A;  1SUQ A;  1WSI A;  3ZET B;  4FOE A;  4CGJ A;  2IS3 A;  4X65 K;  3IKM A;  4FJK A;  4HCC A;  5CYM A;  4BC4 A;  4DCH A;  3J7Y P;  3WXL A;  2J4R A;  3THY B;  4CJV A;  1BWF O;  5BN8 A;  3CCV N;  4BVP A;  2JLE A;  5AZJ A;  2A5X A;  3C95 A;  3NE6 A;  4Z4I A;  4IWV A;  5AFU A;  4A2A A;  2HHH K;  4B9S A;  3CC4 N;  1BU6 O;  2D5R A;  1GLB G;  3UIQ A;  1RBT A;  1WAF A;  1T3V A;  4DR1 K;  5JS1 A;  1RDD A;  4JK9 A;  3VF4 A;  4OGE A;  3MDQ A;  1RFQ A;  1J6Z A;  3QBX A;  3RMB A;  2ZQB A;  4K8Z A;  4GY2 B;  3OYF A;  2XHB A;  2O8B A;  1TKZ A;  5LMN K;  3MN9 A;  2E1Y A;  2V7Z A;  3U6F A;  3SBT A;  4YOY A;  3HOS A;  5C42 A;  4FWQ A;  5GIO A;  3DLB A;  1DT9 A;  5KTQ A;  2A40 A;  5AQL A;  3TPQ A;  3SAG A;  3LAL A;  2AJQ A;  2YNH A;  1IH7 A;  4O0J A;  3TAP A;  4B1W B;  4E7I A;  4LFA K;  2QW9 A;  1SAZ A;  2ZGY A;  1C0F A;  2OPP A;  4BRH A;  3SQ2 A;  4E7L A;  4OX9 K;  3CG7 A;  5HP1 A;  3TSU A;  4BC2 A;  3CQX A;  2E2N A;  4BRC A;  5BRF A;  4N47 A;  4Z4F A;  4DR6 K;  1R59 O;  3FE1 A;  3G6E N;  1RT7 A;  2QWO A;  4I9L A;  1DTQ A;  3WEE B;  1U2V A;  4EP5 A;  3D2E B;  3LPT A;  2A1R A;  1N33 K;  3O1B A;  4FJ5 A;  2HF4 A;  2QWN A;  1HYS A;  1Q9X A;  4H0P A;  2ZGZ A;  2WON A;  1Q81 O;  5FRN A;  4FWL A;  4H0T B;  1RT2 A;  3OYK A;  4MLE A;  3PIO L;  3M8Q A;  3KD5 E;  3P83 D;  4H0O A;  4GMJ B;  4CJ3 A;  4DTN A;  2FBX A;  4K25 A;  1B92 A;  3ENH A;  4FOI A;  3WNE A;  4CJS A;  5AQZ A;  3K58 A;  1SKW A;  1S1U A;  4ZTJ A;  3CC7 N;  1YJ9 N;  3QEV A;  4H4O A;  5AQH A;  4CIG A;  4M3R A;  4BR9 A;  3VQB A;  1HNZ K;  3TR8 A;  3OJS A;  1DKG D;  1EQY A;  3LDN A;  2KQ2 A;  2HVI A;  4B1Y B;  4KI6 A;  4DV0 K;  4DQP A;  1YT3 A;  4JNE A;  4RG8 A;  5CHI A;  3TU5 A;  3IAY A;  3CYM A;  2QXL A;  3OBW A;  3FZH A;  5AQP A;  4E89 A;  4DV2 K;  2P9L B;  2P51 A;  4DFJ A;  2UUC K;  4ISG A;  3T3F A;  1NK4 A;  2E20 A;  4X62 K;  1NK8 A;  3NVK A;  1KXP A;  1ZBL A;  3MN5 A;  5CE3 A;  1IO2 A;  3L3V A;  3MXJ A;  3VES A;  4DTS A;  4LH5 A;  1NMN A;  3ZSX A;  2HBM A;  4PL8 A;  2AP1 A;  5C2D A;  3DLL L;  2KZZ A;  5TKW A;  4DR7 K;  5M1F A;  2ETJ A;  4DLE A;  1HLU A;  2NRR A;  2OPQ A;  4LF7 K;  3GOI A;  3SMP A;  1CZA N;  3BP8 A;  4CEE A;  3PX0 A;  1LCU A;  4WQ4 A;  5AQM A;  4O0I A;  4F9O A;  3DLH A;  1IG8 A;  2Q36 A;  2ZM6 K;  4B3R K;  4A2B A;  3LPU A;  1MWK A;  3DXK B;  4JAX A;  4C23 A;  5BPL A;  2V52 B;  2VCP A;  1NGI A;  1E3M A;  2VQF K;  4JD2 A;  2ASM A;  2LSN A;  1VQK N;  3LAM A;  1OH7 A;  4EZ9 A;  1NGJ A;  3QEW A;  1QSY A;  4OLA A;  3CQY A;  3KLG A;  2G8U A;  4XIU A;  1RDU A;  3NBP A;  4H5V A;  4N76 A;  3E01 A;  3QBW A;  1NMD A;  4E7K A;  5BRD A;  3J7Z O;  4J2B A;  4CBX A;  2UXD K;  4XH1 A;  3VTH A;  4M45 A;  1HKG A;  3MAQ A;  4FJ7 A;  2Q31 A;  1RTI A;  4DTM A;  4LY7 A;  3NF8 A;  4KHN A;  4FLW A;  1VSF A;  4FJG A;  1W97 L;  3OA9 A;  3THX B;  3D0P A;  1JL1 A;  2IIR A;  1BDG A;  2Y1I A;  4FZZ A;  5D3G A;  4ID1 A;  1J5O A;  5K14 A;  3WXK A;  3PSI A;  3UKU B;  4EIA A;  5GIN A;  4FCY A;  1VSL A;  3MX5 A;  2JGU A;  3VPZ A;  4CZE A;  4E19 A;  4C8L A;  1ZC6 A;  3RSE A;  1IKX A;  1REV A;  2OA8 A;  3MWP A;  3CQ8 A;  2GUI A;  1S9G A;  1GLA G;  4BRA A;  1RT3 A;  3AO1 A;  2KKZ A;  4UY8 O;  5BRE A;  4UQG A;  1ATS A;  3DRR A;  3AGK A;  4GKK K;  1N5Y A;  3OVN A;  4W5Q A;  3S3N A;  2UXB K;  2B6A A;  2O4I A;  3FZF A;  4XEI A;  4WYB A;  3M8S A;  1L3T A;  3OYN A;  2FLO A;  4BWM A;  3LP1 A;  4DV6 K;  4I2P A;  1TUU A;  4DQS A;  3H46 O;  1Q86 O;  3CCR N;  4BC3 A;  1JLQ A;  4O4G A;  4KB1 A;  3HST B;  4I2Q A;  4LSN A;  2BGG A;  4QS8 A;  3QB0 A;  4KAZ A;  1VRU A;  5EVZ A;  2CGK A;  3PSF A;  3ID6 A;  1BOT O;  3VGL A;  3CFP A;  1BO5 O;  2ASP A;  2QA4 N;  4B9V A;  4DR5 K;  2CGJ A;  4IOA L;  2QWP A;  3LAN A;  1I94 K;  5J2Q A;  4QS9 A;  1XC3 A;  3ZSR A;  2X6N A;  3DLE A;  1QQC A;  1RNH A;  2BDP A;  1M90 O;  3CIP A;  4M63 C;  3VTI A;  4FVU A;  3O9U A;  2P9K A;  4DU4 A;  3TAQ A;  3NF9 A;  3S3O A;  1NK7 A;  1LW2 A;  2E2O A;  1KTQ A;  1S1W A;  1X9J A;  4C8N A;  3FZL A;  4CFD A;  4KHQ A;  1S22 A;  3TAB A;  1VHX A;  2IAJ A;  2YX6 A;  5HLF A;  4W5N A;  4F2S A;  4FJI A;  2Q0U A;  3CJ1 A;  4KFB A;  1Q9Y A;  1Z26 A;  3VQD A;  4E7J A;  2YJE A;  2HOE A;  4FL9 A;  1HPM A;  1BUP A;  3WXJ A;  2E1Z A;  4ELU A;  1W7A A;  2D4W A;  1RBS A;  3HRG A;  3KIO A;  3D6R A;  1BQN A;  3WQU A;  4H0Y B;  4YOX A;  4DV1 K;  4W5O A;  2ITM A;  4CK2 A;  2ZE2 A;  4K8X A;  1TAQ A;  3NGY A;  3NGI A;  1RT4 A;  3J81 O;  4ID5 A;  2W6K A;  2YNF A;  2BTF A;  3D2F A;  4CGI A;  2V51 B;  5AQW A;  3NFA A;  3L4Q A;  4MO5 A;  1KLM A;  1BIU A;  3VGK A;  3L2V A;  5LJV A;  3RMA A;  3O9S A;  2B5J A;  1C6V A;  3HM8 A;  2P9P A;  1VSK A;  4FWN A;  3ISN C;  4JKH A;  5LY3 A;  3P31 A;  3AVJ A;  1FKP A;  3TAG A;  1TK0 A;  3DLK A;  1QQN A;  3R3L A;  5F1X A;  3EEQ A;  4CJL A;  4FM1 A;  3SYZ A;  3SQ1 A;  1XNR K;  4O8K A;  5KPZ A;  1XUP O;  1LV5 A;  5J2P A;  4JKE A;  1N8R O;  3K9J A;  1DGK N;  4CF1 A;  2HVH A;  4FZX C;  2P9N A;  3SAF A;  4BRN A;  2P9S A;  3CJB A;  3LDL A;  1YIJ N;  3SBG A;  1SV5 A;  1KAY A;  3A5O C;  3MCA B;  3S41 A;  1KC8 O;  2OZM A;  1UWB A;  2EX3 A;  4CGF A;  4FM0 A;  1SQK A;  4JI2 K;  2O8C A;  3BY5 A;  1P90 A;  2PYL A;  1WNS A;  4CZF A;  4YOU A;  4GV3 A;  4JKB A;  4HUG A;  3H45 C;  2HHT A;  1TVR A;  2W41 A;  1NK9 A;  2O8E A;  2GUP A;  3M5R A;  3OHR A;  3ZSO A;  2R7Y A;  3SUN A;  3O4W A;  3LZI A;  4DTO A;  2P9I B;  1QHT A;  3J80 O;  1VQN N;  3WNG A;  3GL1 A;  3QML A;  4CGH A;  4GKJ K;  4OJR A;  1E4F T;  4CGG A;  1TKD A;  1RDC A;  4DU3 A;  2CH6 A;  1UA1 A;  1KFD A;  5J2N A;  1BI4 A;  4EFH A;  3V1Q A;  3F5T A;  2GV9 A;  3EZ5 A;  3O8M A;  3LM9 A;  4CES A;  5AQN A;  2D1K A;  3VER A;  4B1V A;  2HNZ A;  1T44 A;  1TUY A;  3L2R A;  5ADX A;  1JLA A;  1A5X A;  3EYZ A;  3SV3 A;  1OH6 A;  4FJL A;  5HOO A;  1C0G A;  4M3Y A;  4CI6 A;  4DG1 A;  2G8F A;  2P9U A;  3FR0 A;  2YKM A;  2F4V K;  3ENO A;  2NLX A;  4WQ5 C;  4B08 A;  3CJ9 A;  1TGO A;  4WFA L;  4CJ4 A;  2VWB A;  4KHP K;  4KB0 A;  4BRM A;  1X1P A;  5JIC A;  3LWL A;  3CF5 L;  1NGF A;  4B8A B;  5JLF A;  2OPR A;  1I3A A;  2QK9 A;  4ILG B;  1N34 K;  2XY6 A;  1VSD A;  3VF2 A;  4IZ9 A;  1GOC A;  4ISF A;  3CXC M;  4I6M B;  4CJK A;  3AA4 A;  3PX6 A;  1U4B A;  4OVL A;  3VGM A;  1QZ6 A;  3K9K A;  3CJC A;  3AO5 A;  5JVG L;  4BE0 A;  3VF6 A;  4O55 A;  3VQQ A;  1YXQ A;  2FF3 B;  4DTX A;  2FBT A;  1HUX A;  4RW4 A;  4BR7 A;  4F3O A;  1LWE A;  4LF4 K;  3M1F A;  3CER A;  2D0C A;  4R79 A;  4B9Q A;  4O8U A;  1S6P A;  1TYQ B;  1RCH A;  3I33 A;  4BRL A;  3L2W A;  4KPY A;  1RTJ A;  5AQI A;  3DMJ A;  3U3Y A;  3V1R A;  1HNW K;  5EXW A;  4DSF A;  3W3D A;  3RMD A;  5DMR A;  2WOM A;  1T6C A;  4A59 A;  5HRR A;  4FPB A;  1BA0 A;  3KLE A;  1GLE G;  2NRV A;  1IV0 A;  5FLX O;  1CLQ A;  2Q97 A;  4QS7 A;  3WEE A;  4B1Z A;  4DSJ A;  4FJM A;  4DFP A;  1WN7 A;  4BRF A;  3AVL A;  4M42 A;  4AM6 A;  3T69 A;  2F96 A;  3KLI A;  4IO8 A;  2OCE A;  4LSL A;  3SMS A;  4DFK A;  1NWK A;  3R8E A;  3QEX A;  1MA9 B;  1VSH A;  3CCQ N;  3K5M A;  3ASM A;  4JN4 A;  3EN9 A;  1YHQ N;  1VQO N;  3HSC A;  1EWR A;  1WSG A;  3C6U A;  3ULE B;  2FBY A;  1NKE A;  4HHT A;  3FGU A;  4JI6 K;  3E9O A;  3LDP A;  4WQ5 A;  4CEQ A;  5AQJ A;  1G99 A;  3ZLJ A;  1K9M O;  1FK9 A;  3KKS A;  5KI6 A;  5BR9 A;  4JI1 K;  3AA2 A;  4CZJ A;  3VMF B;  1VSI A;  5LJW A;  1TK8 A;  2QTD A;  3P38 A;  3V4I A;  1B9D A;  1RDB A;  4IXC A;  5AQT A;  4FLU A;  4Y1D A;  4FWR A;  1QVG M;  1Y97 A;  2VG7 A;  2F8S A;  1ZBI A;  3I55 N;  4AH9 A;  2W40 A;  3M8P A;  4RW6 A;  3KLF A;  1VK0 A;  4CEC A;  1WSE A;  3LDS A;  2P9L A;  3H3O B;  3QIC A;  4GNI A;  3AVH A;  4FM2 A;  4CIE A;  1V4S A;  2PAV A;  3HPG A;  1C1A A;  3R6M A;  1EX4 A;  1NJW A;  4DQR A;  1S72 N;  4FWS A;  4DLG A;  4A5A A;  2IVP A;  5AJ3 K;  1NOZ A;  4CHO A;  1D8Y A;  2KFZ A;  4DR4 K;  3SCX A;  3EL2 A;  1VAZ A;  3MEE A;  2G8K A;  5AQO A;  5HRO A;  3LZJ A;  4H5N A;  1EKE A;  4WQ4 C;  2BH1 A;  4IEE A;  3ZX2 A;  3OS0 A;  4LFC K;  1EO1 A;  1DLO A;  3K0S A;  3T1H K;  4H4M A;  4AHV A;  4M3U A;  3CD6 N;  1T8E A;  4CEF A;  2E2Q A;  2NRW A;  3P4I A;  5DM6 L;  3DOK A;  4FVM A;  3HBT A;  5KGW A;  4X64 K;  4IG0 A;  4C8O A;  1B9F A;  4K41 A;  3MED A;  3FFI A;  2A1S A;  4K0K K;  3OS1 A;  3OS2 A;  1BIS A;  2QI2 A;  4CFA A;  2RE2 A;  4DTP A;  4KTZ A;  1XHX A;  3E9P A;  5JS2 A;  4ELV A;  3TSQ A;  5BRH A;  1N32 K;  3LDQ A;  2ZF5 O;  5C10 A;  1RBR A;  3JXU A;  3SQ0 A;  3THX A;  2FC0 A;  4Q0B A;  1LAV A;  1EWQ A;  4F3T A;  4XH5 A;  1VRT A;  4CZL A;  4OGC A;  4HVJ A;  4DV4 K;  3SPZ A;  1VQ4 N;  4FJN A;  2O8F B;  4BRP A;  5FDL A;  3LM2 A;  2YI1 A;  3S9H A;  3VQA A;  3LL3 A;  3CCM N;  1Y64 A;  3IG1 A;  3ZYY X;  3KWI A;  3PX4 A;  2VGM A;  4JKG A;  4BG9 A;  1D4X A;  1T03 A;  3IMX A;  5CYQ A;  2G8W A;  1J5E K;  3H1V X;  3DM2 A;  4DUY K;  4KTW A;  3LWM A;  1RT1 A;  4AHC A;  2HHS A;  4FJH A;  4Z4H A;  4FW2 A;  1C1C A;  3OYB A;  5AZI A;  1RTD A;  4DS4 A;  5M1Q A;  3HT3 A;  4CCH A;  3KZB A;  3WXI A;  4L3Q A;  4YHH K;  5KRS A;  4JKC A;  5SWM A;  4CBU A;  2O8B B;  3V9W A;  5AQF A;  1RDA A;  4B3T K;  1KVC A;  3VA3 A;  4CEZ A;  2FF6 A;  4E3S A;  4CHY A;  5TKY A;  2F8T A;  3TTD A;  2E4L A;  1KSP A;  5KQ8 A;  3K5N A;  4YNQ A;  3VEZ A;  3KTQ A;  2XY7 A;  5SZT A;  1NJY A;  2IC3 A;  4B8C A;  3RTV A;  4CK1 A;  3KK3 A;  5GAH P;  4H0V B;  1BCM A;  5AQV A;  1RDW X;  4O5B A;  4B1U B;  1ZYQ A;  3QER A;  4DKW A;  3IDH A;  4WE1 A;  2ZJQ L;  5B8H A;  1VQ9 N;  1D9D A;  4YOT A;  4CFB A;  4N41 A;  4TSX A;  4JI8 K;  1QVF M;  4F4K A;  1E4G T;  4BVO A;  3AAP A;  4CF2 A;  3DRS A;  1Q8I A;  3K5O A;  5AQQ A;  5BPN A;  3D7E O;  1NK5 A;  3ZSV A;  3VQ7 A;  3VQ9 A;  1KD1 O;  2RPI A;  4JRQ A;  4DS5 A;  4NXM K;  1XMO K;  4M3Z A;  3RR7 A;  4IOX A;  3MEC A;  4NCG A;  2ZJP L;  4H03 B;  1T05 A;  4JS5 A;  5JMV A;  2HHV A;  4DWI A;  1U04 A;  2IDO A;  3CCJ N;  2GBZ A;  3WT0 A;  5FPN A;  1SL1 A;  2W42 A;  3PLA A;  2HBK A;  3EKS A;  3C6A A;  1BHL A;  4CJU A;  4F8R A;  1BIZ A;  3QIO A;  2RF2 A;  4JI7 K;  1NLV A;  1HNI A;  4IEI A;  5F0X A;  3G10 A;  3NAE A;  3ID8 A;  1SL2 A;  2A6A A;  1H1V A;  5AQU A;  1UA0 A;  5EU7 A;  2EWS A;  2P5O A;  2QWQ A;  4BE2 A;  2ITG A;  1SL0 A;  3O6W A;  2H3G X;  2GWJ A;  4DTU A;  1JLE A;  4FPA A;  4BRK A;  4BRG A;  1NJX A;  1YIT N;  3TWH A;  4KRF A;  4BGB A;  1U47 A;  2P5G A;  3LP3 A;  4A5B A;  1TV6 A;  1IJJ A;  3BZC A;  4CZI A;  4CVN E;  4DF8 A;  5M1K A;  1QS4 A;  4FZY A;  3THW A;  1YTU A;  5EX5 A;  2DFH A;  4DSK A;  3DWL A;  1G15 A;  4H8K A;  2BE2 A;  3A5M C;  3RVC A;  1CZ9 A;  2GEM A;  4O5F A;  4K42 A;  1VSM A;  2GTD A;  2P9I A;  4BWJ A;  4KHY A;  3UB5 A;  4PL7 A;  1RGI A;  4DSE A;  3H1Q A;  1EP4 A;  1YF5 L;  2DFE A;  1KAX A;  3D45 A;  3WNF A;  4YDU C;  4PHT X;  5CY4 A;  4RW9 A;  2PY5 A;  4ZHR A;  1JJ2 M;  3ZX3 A;  5J2M A;  1XC9 A;  3AA3 A;  3KK7 A;  4MQ3 A;  3AVI A;  2HND A;  4BRQ A;  4CEO A;  4J2A A;  2DY4 A;  3SK3 A;  3OYJ A;  3G4S N;  3K57 A;  2CH5 A;  1W9H A;  4BY9 C;  4U7B A;  5JLH A;  3SZ2 A;  2HHW A;  4MDA A;  3RWU A;  1QHA A;  5FPE A;  3S3M A;  1L3V A;  2HNY A;  3BUZ B;  1NNE A;  4AHU A;  4MLH A;  3L2U A;  4CD3 A;  1YTA A;  4Z4E A;  4HUF A;  3SJJ A;  5IT9 O;  4AQY K;  4CF0 A;  4PUO A;  1IKY A;  4CW7 B;  4F2R A;  1VSE A;  3P5J A;  4Q5V A;  1ZBF A;  4BG8 A;  4CE9 A;  3KHY A;  2WTU A;  3OYL A;  1F21 A;  4IFV A;  1U48 A;  3O3H A;  1HRH A;  3CET A;  1LW0 A;  4JHD A;  1ATR A;  1ZBU A;  3HVT A;  3HPO A;  1GLC G;  3QEI A;  1QQM A;  4I7F A;  4E1J A;  2QKB A;  2RHK A;  4KI4 A;  3SNN A;  3AVM A;  1NGA A;  3AO2 A;  1CXU A;  3L8B A;  3HO1 A;  3DRP A;  1IG9 A;  4KH6 A;  3C6H A;  2F7T A;  2YNI A;  3JYT A;  1JLF A;  2KHO A;  3VEO A;  2KTQ A;  4I6M A;  1LAW A;  3PY8 A;  4DV3 K;  5A2Q O;  4GVE A;  3OTO K;  1K8K A;  4JLH A;  1SZ2 A;  3QFP A;  3L4I A;  2AA4 A;  5BN9 A;  3V9Z A;  5M1P A;  1WSH A;  3P1G A;  4BDY A;  4R5P A;  4JK8 A;  2UXC K;  2UU9 K;  2QWR A;  2NRX A;  1N36 K;  2X6S A;  2QWL A;  4BRD A;  4CBW A;  1TYQ A;  3NDK A;  3QET A;  4KV8 A;  3CMA N;  4J2D A;  1C1B A;  4KRE A;  5AQY A;  4YDU A;  3MN6 A;  1BL3 A;  1BG3 A;  3DI6 A;  4G1Q A;  3HTV A;  4CJP A;  3WNH A;  4LF6 K;  1NM1 A;  3PV8 A;  5CR4 A;  1NJI O;  1VQ6 N;  4KHW A;  1ESV A;  3CPW M;  3KKR A;  4KO0 A;  5LMU K;  1WLJ A;  3NF7 A;  3PO4 A;  5FPM A;  3VET A;  3TSP A;  2HMP A;  2BAN A;  5AQS A;  1JL2 A;  3NH2 A;  1GOA A;  1S9E A;  2E6L A;  1W2B M;  2FSN A;  1VQ5 N;  1U49 A;  4DMN A;  1DEJ A;  4NO7 A;  4ELT A;  3AVN A;  5HRS A;  1HPZ A;  2NNW A;  2CGL A;  3ZET A;  5KGX A;  3P39 A;  4L8R B;  2OZS A;  1YI2 N;  3B6O A;  5AFU H;  5I9E B;  4QOZ B;  4CGD A;  3OYI A;  1P8Z A;  4AHS A;  1XWL A;  1XHZ A;  3D2F B;  3HXM A;  5BR8 K;  4DV5 K;  3BGR A;  3AY9 A;  3THY A;  4ISE A;  5AQK A;  3ZT0 A;  3CM5 A;  2GWK A;  1GOB A;  1M1K O;  4JKA A;  1I39 A;  2Z1I A;  4HWI A;  2P9P B;  2HF3 A;  5HL7 L;  3L6Q A;  4N5S A;  2ATQ A;  1RT5 A;  1R0A A;  4MDB A;  4Z0U A;  4CJ7 A;  1HJR A;  3HP9 A;  3O5B A;  4M7Y A;  3V1O A;  1WSF A;  3O1W A;  1YUW A;  3ZT3 A;  4WF9 L;  4DQ8 A;  2V7Y A;  4FWM A;  4Z94 A;  4NB4 A;  1L3U A;  1KCF A;  4IFY A;  5AQR A;  3FZM A;  1UAX A;  4CD1 A;  2P9N B;  1KFS A;  1D9F A;  2P9S B;  2DPN A;  1RBV A;  5CZ2 A;  4JYA K;  2I7P A;  3AA5 X;  4ILH A;  4I9Q A;  2HBL A;  4YFU A;  4M41 A;  5E84 A;  2YHX A;  4WFB L;  3HL8 A;  4WFN L;  3CME N;  4KHS A;  3CCE N;  1TKX A;  3A0I X;  1KQS M;  4BGA A;  3M6G A;  5FRO A;  1OKJ A;  4DB3 A;  3SUP A;  1JCE A;  4GVM A;  4JI0 K;  2VWJ A;  1FJG K;  4JKF A;  4DSI A;  2XRI A;  1JXE A;  3ATV A;  1YAG A;  1HR0 K;  3CI5 A;  5JVH L;  4CEA A;  3D2E A;  1TL3 A;  1W0H A;  4E7H A;  1L5U A;  3EE8 A;  3CCS N;  3C94 A;  3NCI A;  5C24 A;  1XQS C;  4B3S K;  1NGC A;  3ZSW A;  4B9N A;  4E1M A;  4E0D A;  2P1J A;  1ASW A;  4JK7 A;  4OKE A;  4PKG A;  4FJ8 A;  4NYN A;  5AR0 A;  2NZT A;  2B4J A;  4HUE A;  4OPH A;  1JCF A;  1ASU A;  2UYT A;  5GAE P;  3DYA A;  2E6M A;  3HVR A;  4LF8 K;  5DM7 L;  3HPH A;  3IS9 A;  3T19 A;  2OPS A;  4H5W A;  3QFU A;  4LF9 K;  2XY8 A;  5C0Y A;  4B9L A;  4DHY A;  4CZM A;  2P9U B;  2O8F A;  1T7P A;  3C7N B;  3CHW A;  1ZBH A;  2HW3 A;  2VGN A;  3F9M A;  4CF9 A;  1J53 A;  3ZT4 A;  2IOC A;  4JKD A;  5M1O A;  1YVU A;  3I0S A;  4IG3 A;  3V81 A;  4XH4 A;  3ZEU B;  1KVB A;  1Z6R A;  4DFM A;  3R9P A;  4AF1 A;  4AM7 A;  3BDP A;  3HP6 A;  5C25 A;  1RTH A;  4IBN A;  5FPD A;  2VQE K;  3TAF A;  4CZG A;  4FO0 A;  4KHU A;  2HBJ A;  3AAQ A;  3ZSQ A;  1IKV A;  3RR8 A;  3C0B A;  2HMI A;  3VOV A;  2YCH A;  3OW2 M;  3TTF A;  3KJV A;  3TAR A;  4IDH A;  4A57 A;  3MK6 A;  3T1Y K;  1C0M A;  2I7N A;  3AVG A;  4M3X A;  3VQE A;  3JS6 A;  2DFF A;  3H08 A;  3M8R A;  2WFB A;  1TL1 A;  4DQI A;  2E5L K;  1KRP A;  1O13 A;  1SKS A;  2HHU A;  4CHQ A;  3SAH A;  3DXK A;  2Q2R A;  3DXM B;  3A5L C;  2HB5 A;  1VSJ A;  5KQD A;  1GLD G;  5J1E A;  4JEP A;  1V4T A;  4AHT A;  2Y1J A;  1TKT A;  3UKR B;  4KBO A;  1YJN N;  5GAD P;  5E41 A;  1HMV A;  1KAZ A;  3EE9 A;  1D5A A;  4IJA A;  3PO5 A;  4FWP A;  4LH4 A;  4CJF A;  2KZM A;  3K2P A;  4W5R A;  2QEX N;  2A42 A;  3VQ8 A;  1LOT B;  1SS6 A;  1NGD A;  1NBW A;  4NLC A;  3DLG A;  1JXB A;  4HTU A;  1GLJ O;  3SUQ A;  1ILY A;  5M1N A;  5C15 A;  3AVA A;  4EHT A;  2O8D B;  3UKU A;  1VQ7 N;  4PY5 A;  5I3U A;  4A62 A;  1VQM N;  1CXQ A;  4CZK A;  3LP2 A;  3AVB A;  4BRI A;  3IUC A;  3E1Y A;  5AQG A;  1MWM A;  5KPT A;  3FFK B;  4FYD A;  2A41 A;  1K73 O;  3HK2 A;  3ENB A;  4WCE L;  5KRT A;  1QSS A;  5AZJ B;  3O08 A;  3HOT A;  3KVG A;  3ZSZ A;  3OYA A;  1U6Z A;  3ITH A;  1S3X A;  2YHA A;  3C6T A;  4NCA A;  1FW6 A;  1JLG A;  4QCL A;  3SJH A;  4CJT A;  3FZK A;  5GIP A;  4QAG A;  4LD0 A;  4HTL A;  4B1X B;  3KK1 A; 
#chains in the Genus database with same CATH homology
 2BE2 A;  2GV9 A;  2PYJ A;  3EZ5 A;  1CZ9 A;  4O44 A;  4CES A;  3MEG A;  4CJV A;  1LWF A;  1VSM A;  3AO3 A;  2HNZ A;  3QO9 A;  4BWJ A;  4KHY A;  4CFC A;  2JLE A;  4Y1C A;  5HRN A;  1CZB A;  3L2R A;  3C95 A;  3NE6 A;  1JLA A;  4DSE A;  4CJR A;  1A5X A;  4Z4I A;  3EYZ A;  3SV3 A;  1EP4 A;  2DFE A;  3D45 A;  4FJL A;  3WNF A;  3U3G A;  4PQU A;  3V9X A;  4M3Y A;  5CY4 A;  4DG1 A;  3NH0 A;  4CHN A;  4B9S A;  4RW9 A;  2PY5 A;  2D5R A;  4ZHR A;  3G0Z A;  2G8F A;  3V9U A;  1S1V A;  5J2M A;  2YKM A;  1XC9 A;  3UIQ A;  1RBT A;  4B08 A;  3AA3 A;  1WAF A;  4MQ3 A;  1TGO A;  3AVI A;  2HND A;  4CEO A;  3CFR A;  4J2A A;  4CJ4 A;  3ZCM A;  2DY4 A;  5JS1 A;  1RDD A;  3OYJ A;  3K57 A;  1W9H A;  1RBU A;  4KB0 A;  4OGE A;  3RRG A;  3ALY A;  3SZ2 A;  2HHW A;  4KKO A;  3RMB A;  1X1P A;  2ZQB A;  4CHZ A;  3OYF A;  3LWL A;  2XHB A;  1TKZ A;  3S3M A;  3RWU A;  1L3V A;  4K8Z A;  2HNY A;  4NYF A;  4B8A B;  3U6F A;  4AHU A;  2Z1J A;  2OPR A;  1I3A A;  1C0U A;  5CZ1 A;  3L2U A;  3MXM A;  2QK9 A;  5C42 A;  3DLB A;  1YTA A;  4Z4E A;  4C8M A;  4HUF A;  5KTQ A;  2XY6 A;  3SJJ A;  3O3G A;  1VSD A;  3LAL A;  2AJQ A;  2YNH A;  4JRP A;  3CM6 A;  4CF0 A;  3V6D A;  1IH7 A;  4O0J A;  3TAP A;  1GOC A;  3ZT2 A;  4E7I A;  4CJ5 A;  4PUO A;  3RRH A;  1KLN A;  1IKY A;  4N56 A;  1VSE A;  4F2R A;  3ZT1 A;  2OPP A;  3P5J A;  2D0A A;  3F9K A;  4Q5V A;  1U45 A;  1ZBF A;  3SQ2 A;  4E7L A;  3L2Q A;  3CG7 A;  4CJK A;  5HP1 A;  3AA4 A;  4CE9 A;  4AIL C;  3PX6 A;  3KD1 E;  3OYL A;  1F21 A;  2FBV A;  4IFV A;  4OVL A;  1U4B A;  1U48 A;  4HCB A;  3O3H A;  4DTR A;  1HYZ A;  1HRH A;  4N47 A;  4Z4F A;  3O4Q A;  1LW0 A;  3QIP A;  3AO5 A;  4DU1 A;  4BE0 A;  2ZD1 A;  4ZTF A;  4FLV A;  4O55 A;  1TAU A;  3VQQ A;  1ZBU A;  1RT7 A;  3HVT A;  3HPO A;  3TAE A;  4DTX A;  4I9L A;  3QEI A;  1DTQ A;  2FBT A;  4I7F A;  4CED A;  4RW4 A;  4F3O A;  1LWE A;  2QKB A;  4KI4 A;  3LP0 A;  4EP5 A;  3A2F A;  3AVM A;  3LPT A;  3SNN A;  2A1R A;  4FJ5 A;  1XI1 A;  2NUB A;  2D0C A;  3OJU A;  1HYS A;  4Z4G A;  1Q9X A;  3AO2 A;  2G8H A;  1CXU A;  3L8B A;  2WON A;  3DRP A;  1IG9 A;  3HO1 A;  5FRN A;  1S6P A;  1RCH A;  1RT2 A;  4AHR A;  3OYK A;  1TK5 A;  2YNI A;  3JYT A;  1JLF A;  2RN2 A;  2KTQ A;  1UOC A;  3L2W A;  5HBM A;  3DOL A;  3M8Q A;  1LAW A;  3PY8 A;  3P83 D;  1QE1 A;  4OKK A;  3KD5 E;  1RTJ A;  4KPY A;  3DMJ A;  3U3Y A;  3V1R A;  4GMJ B;  2KW4 A;  4CJ3 A;  4DSF A;  4ICL A;  4JLH A;  4DTN A;  4OPK A;  2FBX A;  5DMR A;  2WOM A;  1B92 A;  3NHG A;  3OYE A;  3RMD A;  5HRR A;  3V9Z A;  3WNE A;  4CJS A;  3O3F A;  1WSH A;  4FLY A;  3P1G A;  3KLE A;  4R5P A;  3K58 A;  4BDY A;  1SKW A;  1CLQ A;  1S1U A;  4ZTJ A;  1A5W A;  4CF8 A;  1FXX A;  4DSJ A;  4Z4C A;  4FJM A;  1NKB A;  4DFP A;  1WN7 A;  3CFO A;  3QEV A;  4H4O A;  3AVL A;  4M42 A;  2F96 A;  4M3R A;  3KLI A;  3VQB A;  4GW6 A;  2VG6 A;  3TR8 A;  4CIG A;  2X6S A;  3OJS A;  2HVI A;  2KQ2 A;  4FK0 A;  2G8I A;  4LSL A;  3QET A;  3NDK A;  3OYC A;  4DFK A;  2Z1G A;  4KV8 A;  4DQP A;  3QEX A;  1VSH A;  4FJJ A;  4KI6 A;  1YT3 A;  3T1A A;  4J2D A;  4RG8 A;  1KVA A;  3K5M A;  1C1B A;  3IAY A;  4KRE A;  1WSJ A;  3ASM A;  3CYM A;  3OYM A;  4EZ6 A;  1JLC A;  4MFB A;  4E89 A;  3SV4 A;  1BL3 A;  3VN5 A;  1WSG A;  3DI6 A;  4G1Q A;  3AVF A;  3C6U A;  4CJP A;  2FBY A;  1NKE A;  4HHT A;  2P51 A;  3WNH A;  4DFJ A;  3PV8 A;  1K6Y A;  3T3F A;  4CEQ A;  1NK4 A;  4KHW A;  1BGX T;  1NK8 A;  3KKR A;  4KO0 A;  3QES A;  1ZBL A;  1FK9 A;  3KKS A;  5KI6 A;  1NOY A;  1IO2 A;  3AA2 A;  3L3V A;  1WLJ A;  3MXJ A;  1VSI A;  2X74 A;  3NF7 A;  3ZSY A;  3PO4 A;  1TK8 A;  3V4I A;  1NJZ A;  1B9D A;  2BAN A;  4DTS A;  4LH5 A;  1RDB A;  1JL2 A;  3NH2 A;  4FLU A;  3VQ6 A;  3ZSX A;  4Y1D A;  1GOA A;  1S9E A;  2E6L A;  3HYF A;  1Y97 A;  2VG7 A;  1U49 A;  2F8S A;  4DMN A;  2X78 A;  4ELT A;  1ZBI A;  2KZZ A;  3AVN A;  4AH9 A;  5HRS A;  1HPZ A;  2ETJ A;  4W5T A;  5T7B A;  4FLZ A;  1J9A A;  3M8P A;  4RW6 A;  3KLF A;  4DLE A;  2OPQ A;  5KGX A;  1VK0 A;  4CEC A;  4L8R B;  2OZS A;  1BCO A;  1X9M A;  3B6O A;  4DSL A;  1WSE A;  3LDS A;  3OYH A;  4QOZ B;  4CEE A;  4CGD A;  3AVH A;  4FM2 A;  3PX0 A;  3OYI A;  3B6P A;  4CIE A;  4AHS A;  4O0I A;  1XWL A;  1XHZ A;  3HPG A;  3DLH A;  1C1A A;  1DTT A;  3QLH A;  3VQ5 A;  3LPU A;  1EX4 A;  3HXM A;  3HJF A;  3OYG A;  1NJW A;  3BGR A;  2G8V A;  4DQR A;  3ZT0 A;  3CM5 A;  4DLG A;  1S5J A;  1GOB A;  2LSN A;  1I39 A;  2Z1I A;  3LAM A;  1NOZ A;  4CHO A;  1D8Y A;  1QSL A;  4NCB A;  3LAK A;  2KFZ A;  2DTU A;  4N5S A;  3SCX A;  1LWC A;  4EZ9 A;  4FXD A;  3QEW A;  3MEE A;  1QSY A;  4OLA A;  2G8K A;  3TAM A;  3KLG A;  2ATQ A;  1C0T A;  4XIU A;  2G8U A;  4N76 A;  3NBP A;  3PUF A;  1RT5 A;  3E01 A;  4E7K A;  1R0A A;  4Z0U A;  1HJR A;  3HP9 A;  4J2B A;  5HRO A;  3LZJ A;  1EXQ A;  1EKE A;  3SPY A;  4M45 A;  3OS0 A;  1J54 A;  3V1O A;  1WSF A;  3MAQ A;  1DLO A;  4FW1 A;  4KTQ A;  2HHX A;  3ZT3 A;  4FJ7 A;  1IKW A;  1RTI A;  3K5L A;  4DTM A;  4H4M A;  4LY7 A;  3NF8 A;  4KHN A;  4AHV A;  4M3U A;  4FLW A;  3QNN A;  1L3U A;  2BGG A;  1VSF A;  4FJG A;  1T8E A;  4CEF A;  1KCF A;  1JL1 A;  4IFY A;  3OY9 A;  3D0P A;  4IKF A;  1HYV A;  3DOK A;  1UAX A;  1KFS A;  1D9F A;  4DQQ A;  2Y1I A;  4FZZ A;  5D3G A;  4FVM A;  3KLH A;  1RBV A;  5CZ2 A;  4ID1 A;  5KGW A;  4BE1 A;  1J5O A;  4FLX A;  4IG0 A;  5K14 A;  4C8O A;  3NF6 A;  4FCY A;  1VSL A;  1B9F A;  2JGU A;  3MED A;  3FFI A;  3AA5 X;  2A1S A;  4JS4 A;  4E19 A;  3OS1 A;  4I9Q A;  4CJW A;  3OS2 A;  4C8L A;  4YFU A;  1NK6 A;  1BIS A;  3TI0 A;  4M41 A;  4CFA A;  4PA1 A;  3TAN A;  3HL8 A;  1IKX A;  1REV A;  2OA8 A;  4B9T A;  3CQ8 A;  4DTP A;  4KHS A;  4KTZ A;  1XHX A;  2GUI A;  1TKX A;  1S9G A;  5JS2 A;  1RT3 A;  3AO1 A;  4ELV A;  2KFN A;  5FRO A;  4UQG A;  1RBR A;  3ULD A;  3DRR A;  3RMC A;  3SUP A;  4GVM A;  3SQ0 A;  3SI6 A;  2VWJ A;  2FC0 A;  4C8K A;  4DSI A;  1N5Y A;  3OVN A;  1LAV A;  4W5Q A;  2XRI A;  3S3N A;  4Q0B A;  4CEB A;  1JXE A;  4F3T A;  2B6A A;  2O4I A;  3EY1 A;  3QEP A;  1VRT A;  3M8S A;  1L3T A;  3OYN A;  4CEA A;  1TL3 A;  4FJX A;  4BWM A;  1W0H A;  4E7H A;  1L5U A;  3LP1 A;  4OGC A;  1S1X A;  4I2P A;  4HVJ A;  4DQS A;  3SPZ A;  4FJN A;  3C94 A;  3NCI A;  5C24 A;  5FDL A;  3ZSW A;  4B9N A;  1HNV A;  4CIF A;  1Z25 A;  3IRX A;  3S9H A;  3VQA A;  1JLQ A;  4O4G A;  4E1M A;  4E0D A;  4KB1 A;  2P1J A;  3HST B;  4I2Q A;  4LSN A;  4E1N A;  1ASW A;  4OKE A;  3SQ4 A;  1RT6 A;  3VQC A;  4KAZ A;  4FJ8 A;  1VRU A;  3IG1 A;  4NYN A;  3PX4 A;  4RW8 A;  3VA0 A;  5I42 A;  1T03 A;  2B4J A;  4HUE A;  3CFP A;  4CJQ A;  5CYQ A;  4B9V A;  1ASU A;  2XO7 A;  2O4G A;  3AVK A;  3DYA A;  3VQ4 A;  2G8W A;  2E6M A;  3HVR A;  3LAN A;  5J2Q A;  3DM2 A;  3ZSR A;  4KTW A;  2X6N A;  2Z1H A;  3DLE A;  1RT1 A;  3HPH A;  1QQC A;  4AHC A;  1RNH A;  3IS9 A;  4CK3 A;  3LWM A;  2BDP A;  3T19 A;  2OPS A;  4FJH A;  2HHS A;  4Z4H A;  4FW2 A;  2XY8 A;  5HRP A;  1C1C A;  4B9L A;  3OYB A;  1T7P A;  1RTD A;  4DS4 A;  4CJE A;  1ZBH A;  3HT3 A;  4OKJ A;  4EP4 A;  4CCH A;  1S6Q A;  2HW3 A;  3I8D A;  2YHB A;  4CF9 A;  1ASV A;  1J53 A;  3ZT4 A;  2IOC A;  4DU4 A;  3TAQ A;  3NF9 A;  1YVU A;  1JLB A;  3I0S A;  4IG3 A;  1LW2 A;  5KRS A;  5SWM A;  3V81 A;  1KTQ A;  3S3O A;  1KVB A;  1S1W A;  4DFM A;  3V9W A;  1S1T A;  4C8N A;  4CFD A;  4KHQ A;  1RDA A;  1KVC A;  3TAB A;  2IAJ A;  3VA3 A;  3BDP A;  4RW7 A;  4CEZ A;  5HLF A;  4FLT A;  3VQP A;  3HP6 A;  5C25 A;  4F2S A;  3DLR A;  1JKH A;  4BDP A;  4FJI A;  4W5N A;  4E3S A;  3F73 A;  1RTH A;  4KFB A;  4CHY A;  1Q9Y A;  2F8T A;  4IBN A;  2E4L A;  1Z26 A;  3K59 A;  3TAF A;  1KSP A;  3VQD A;  3AVC A;  4E7J A;  4KHU A;  1HQU A;  3K5N A;  4YNQ A;  3ZSQ A;  1IKV A;  3KTQ A;  3RR8 A;  1RIL A;  3HM9 A;  2XY7 A;  2HMI A;  5SZT A;  1NJY A;  4ELU A;  2IC3 A;  4B8C A;  3KJV A;  4CK1 A;  3RTV A;  4B9U A;  3KK3 A;  3NGZ A;  3TAR A;  1RBS A;  3KIO A;  1BQN A;  1BCM A;  4OLB A;  1NK7 A;  4O5B A;  1ZYQ A;  1HQE A;  4W5O A;  1C0M A;  3QER A;  3AVG A;  3SUO A;  4CK2 A;  4WE1 A;  4M3X A;  2HHQ A;  2ZE2 A;  3VQE A;  4K8X A;  1TAQ A;  3NGY A;  3NGI A;  4BAC A;  2DFF A;  3H08 A;  3M8R A;  1D9D A;  4CHP A;  4J2E A;  2XY5 A;  1TL1 A;  4DQI A;  4CFB A;  1A5V A;  1RT4 A;  1KRP A;  3QIN A;  4ID5 A;  1SKS A;  2YNF A;  2HHU A;  4CHQ A;  4N41 A;  1EET A;  4CGI A;  4TSX A;  3NFA A;  4M3W A;  4F4K A;  2VWK A;  2HB5 A;  1VSJ A;  1KLM A;  5J1E A;  1BIU A;  2RKI A;  2Y1J A;  4AHT A;  4CF2 A;  1TKT A;  3DRS A;  3O4N A;  3L2V A;  1Q8I A;  3RMA A;  2B5J A;  3K5O A;  1C6V A;  3THV A;  1NK5 A;  1VSK A;  3VQ7 A;  3ISN C;  3VQ9 A;  3ZSV A;  3QNO A;  1NKC A;  2RPI A;  4JRQ A;  3AVJ A;  1HMV A;  5E41 A;  4DS5 A;  1D5A A;  3PO5 A;  1FKP A;  4LH4 A;  4M3Z A;  4CJF A;  3RR7 A;  3KK2 A;  2KZM A;  3MEC A;  4NCG A;  3TAG A;  1TK0 A;  3DLK A;  3K2P A;  1T05 A;  4JS5 A;  3V9S A;  2IGI A;  4B3O A;  4W5R A;  2HHV A;  4DWI A;  4CJL A;  4FM1 A;  1U04 A;  3VQ8 A;  3SYZ A;  2OYQ A;  2IDO A;  3SQ1 A;  4PWD A;  2GBZ A;  4CER A;  4OPJ A;  1LV5 A;  4FK4 A;  1SL1 A;  2QKK A;  5J2P A;  2W42 A;  1N6Q A;  1SKR A;  3DLG A;  3I0R A;  1JXB A;  4FK2 A;  1BHL A;  4CJU A;  1NK0 A;  4CF1 A;  4HTU A;  4F8R A;  1BIZ A;  3QIO A;  3MXI A;  2HVH A;  3SUQ A;  4FZX C;  1O1W A;  2RF2 A;  3AVA A;  1BQM A;  4DF4 A;  3L3U A;  4DTJ A;  1HNI A;  3AO4 A;  4B9M A;  3JSM A;  1SV5 A;  1ITG A;  2Q3S A;  2OZM A;  4PY5 A;  1UWB A;  2EX3 A;  3G10 A;  4CGF A;  3NAE A;  5I3U A;  1L3S A;  3AV9 A;  3NH1 A;  1SL2 A;  4FM0 A;  1CXQ A;  1QTM A;  5FRM A;  2I5J A;  2PYL A;  1WNS A;  1BI4 B;  3LP2 A;  1WAJ A;  1MU2 A;  3AVB A;  4HUG A;  1FKO A;  1X9S A;  4IDK A;  2HHT A;  1TVR A;  2YV0 X;  1UA0 A;  1X9W A;  1NK9 A;  5EU7 A;  2P5O A;  2YNG A;  3ZSO A;  2R7Y A;  4M3T A;  3SUN A;  4FYD A;  4BE2 A;  2ITG A;  1SL0 A;  3LZI A;  4DTO A;  1QHT A;  4FJ9 A;  3HK2 A;  2QXF A;  5KRT A;  1QSS A;  5DK5 A;  3WNG A;  4CGH A;  2PZS A;  4DTU A;  1JLE A;  2YKN A;  2EHG A;  4OJR A;  3OYD A;  4CGG A;  1NJX A;  1TKD A;  2VG5 A;  1RDC A;  3TWH A;  3ZSZ A;  3OYA A;  4DU3 A;  4KRF A;  2P5G A;  1U47 A;  3ITH A;  2D0B A;  2YHA A;  3C6T A;  3LP3 A;  4NCA A;  4BDZ A;  1TV6 A;  1SUQ A;  1WSI A;  1JLG A;  1UA1 A;  4QCL A;  4DF8 A;  4CJT A;  1QS4 A;  4FZY A;  1KFD A;  4CGJ A;  2IS3 A;  1YTU A;  5J2N A;  1BI4 A;  4QAG A;  4LD0 A;  2DFH A;  4DSK A;  1G15 A;  4HCC A;  3V1Q A;  4FJK A;  3KK1 A;  5CYM A;  4H8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...