1VSDA

Asv integrase core domain with mg(ii) cofactor and hepes ligand, high mg concentration form
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
146
structure length
145
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endoribonuclease
molecule keywords INTEGRASE
publication title The catalytic domain of avian sarcoma virus integrase: conformation of the active-site residues in the presence of divalent cations.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
total genus 52
structure length 145
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vsdA00
2JLEA 4CIFA 4I7FA 3LDSA 3TAGA 1BHLA 3DM2A 4CK1A 5C42A 2HHSA 4DSLA 2G8KA 4CGDA 3HSTB 1RT4A 4KPYA 1EETA 4AH9A 1HQUA 4LY7A 1IKVA 3LPUA 3E01A 1KFDA 3MXJA 1TK5A 4Q0BA 2Z1GA 3DLGA 1UOCA 4CF1A 4DWIA 1T03A 2G8VA 1JLAA 3PX0A 1S1UA 3DRRA 4BE1A 5HP1A 4B08A 4F2RA 3QINA 3FFIA 2QKBA 2X6NA 1WSJA 2VG6A 1KLMA 3O4NA 5FDLA 2IOCA 5HRNA 2VG7A 4Q5VA 3OYMA 1SKRA 1JKHA 2O4GA 1D8YA 4C8KA 3M8PA 3SQ4A 3K5LA 2IC3A 3B6OA 3L3VA 2PYJA 4DQPA 4E1MA 2HNYA 3AVJA 3F9KA 4AHCA 3SNNA 2OPRA 3KJVA 1ITGA 1LWFA 3WNEA 1TGOA 4DFMA 3HYFA 4DFJA 3SI6A 4CJWA 4KV8A 1JLGA 3WNGA 2DTUA 1D9DA 2PYLA 4F3OA 3S3NA 3V9ZA 5FRMA 3ASMA 4CHOA 3MXMA 3K59A 1TL3A 4N41A 4ICLA 1ZBLA 3KTQA 4DTSA 4J2DA 1RTIA 2A1RA 4YFUA 4B9LA 4CERA 4RW9A 4FM0A 4B3OA 4FYDA 3VQ5A 1EXQA 4O5BA 3AVCA 4C8NA 3ZT1A 3SV3A 3OYGA 4AHRA 4ZHRA 4M3XA 4W5TA 4CFBA 4E7HA 4CJTA 4CHPA 1ZBHA 2F8TA 3AVMA 4O0JA 2BE2A 3MXIA 4M3ZA 1LAWA 3QEPA 5SZTA 3RMDA 4Z4HA 4NYFA 4JRPA 3TWHA 4AHSA 1MU2A 3OYCA 3I0RA 2PZSA 1VSMA 3KLIA 4DTUA 4F3TA 2OZMA 4DTNA 3SUNA 4RW6A 4B9VA 3KD1E 1IH7A 2EX3A 4CHYA 2OYQA 4O44A 2QKKA 1JLBA 2D0BA 5C25A 2BDPA 4CEZA 4CECA 1TK0A 4KB0A 1SL1A 3ZSYA 4L8RB 1W9HA 1RT7A 3BGRA 2ITGA 3AA4A 4KTZA 4HTUA 1X9WA 2RF2A 4HUEA 1JLQA 3HT3A 4F8RA 4IKFA 1XHXA 3K5OA 4CJUA 1BQMA 5KTQA 1X9SA 4E19A 5FRNA 1KFSA 3DLHA 3DLKA 4KHYA 1KSPA 3TARA 3DMJA 3DYAA 3U6FA 1NJZA 4KB1A 3UIQA 3RMCA 4KO0A 3JSMA 4KHWA 4CHNA 1ASVA 4DTMA 1LV5A 3VQ9A 1CZBA 3HP6A 5CYQA 3LANA 1FXXA 4BWMA 3ZSXA 1HNVA 5JS2A 5KGXA 4M3WA 3K2PA 5EU7A 5J2PA 1A5VA 1LWEA 4FZXC 4CGJA 1NK7A 1QSSA 2YHBA 2BGGA 2HHTA 1YTAA 2HHXA 3SQ0A 4I2QA 4B9UA 3AO1A 4FW1A 5FROA 4CK3A 4OKEA 4CJFA 1EX4A 1KVBA 4OJRA 3VQCA 3SV4A 4C8OA 4HCCA 1U4BA 4EP4A 2Y1JA 4PUOA 1CLQA 3KD5E 1VSLA 2DFHA 3HXMA 3NF8A 4B8AB 1I39A 4DSIA 2WOMA 4ID1A 1WSFA 4RW8A 5KGWA 4CJVA 2OPQA 4ELUA 2IDOA 1IKXA 1C1AA 1HNIA 1J5OA 1NK4A 3VQ8A 4IFVA 4AILC 3DLBA 4Z4FA 1B92A 1RT5A 3A2FA 3KKRA 4KHNA 2OPPA 3TAQA 4CF9A 3SYZA 4ELTA 1JXEA 3L2VA 4G1QA 3AVHA 4OGCA 4JRQA 2Z1JA 4NCBA 3HK2A 4KHUA 3OYJA 2YKMA 4CIGA 1KVAA 4DTJA 4FJ8A 2ATQA 4CCHA 3OYEA 3OS2A 1S1XA 1JLFA 1A5WA 3ZCMA 3ZSZA 4FLTA 4KAZA 3M8SA 2XY6A 3SQ2A 2KFNA 1BIZA 1N6QA 1O1WA 4CEOA 3VQ7A 1B9DA 4C8MA 2G8FA 3S3MA 1LAVA 4FXDA 3O3GA 1YTUA 1Z25A 4GMJB 1NOZA 4R5PA 3K5NA 3DRPA 1HYZA 4PA1A 4GVMA 3LP2A 2E6LA 3LZJA 3L3UA 4N56A 4HUFA 1D5AA 3V6DA 1U45A 1N5YA 1HJRA 2E6MA 2EHGA 4FVMA 3WNFA 1L3VA 4B9TA 4OLAA 2HHWA 1ZBIA 4DU1A 4F2SA 4FLZA 4I2PA 4CGIA 4AHVA 3AVBA 5CY4A 1NJWA 4W5RA 4CIEA 1YVUA 1KCFA 4DQIA 4EZ6A 2DFEA 2JGUA 3V4IA 4FJLA 1B9FA 1TKXA 3RRHA 2P5OA 1XC9A 2X78A 4HUGA 4CJSA 4E3SA 1QSLA 1EKEA 2YNHA 1D9FA 1TAQA 1UAXA 3AVKA 3NHGA 2FBTA 3QERA 3KLGA 4Z4EA 4B9SA 3OY9A 1K6YA 3DI6A 4WE1A 4CEFA 1RBTA 1W0HA 3NGIA 2VWJA 3F73A 2NUBA 5J2MA 3RMAA 2HW3A 4HHTA 3QESA 1VSDA 1RBVA 4RW7A 1NKEA 2F96A 1RCHA 4LSNA 4O55A 4KRFA 1BISA 4CJLA 1RBUA 1BI4A 3NH1A 4DS4A 4DTOA 3SZ2A 3OYIA 3LALA 3DLRA 4HCBA 4M3YA 4ELVA 1WAFA 3TR8A 3RWUA 4FJJA 4FJXA 1WAJA 4CJRA 1BL3A 2B5JA 3SCXA 5CZ1A 4DS5A 3RMBA 2WONA 2Y1IA 3THVA 4NCAA 4PQUA 2VG5A 5T7BA 1NK0A 4CHZA 3V9XA 1TK8A 1ASWA 4FJHA 4JS4A 2IGIA 3DLEA 4B8CA 3KK3A 1SV5A 4GW6A 4OKKA 3QO9A 4FLVA 1L5UA 3V81A 2P5GA 1A5XA 1U04A 3ZSOA 4J2EA 3V1OA 3K57A 3ZT0A 3IG1A 4BACA 3VQBA 3LWLA 1Y97A 4OGEA 4YNQA 1JL2A 3CFPA 1VSKA 3CFRA 3LPTA 4CF0A 3U3YA 4FLWA 1BCMA 4CFCA 3NBPA 3CQ8A 3OYNA 2IAJA 1RBRA 3ALYA 4O4GA 3AVAA 1Q8IA 4N47A 2GUIA 1DTTA 2B4JA 2P51A 4C8LA 3MEGA 1IO2A 3VQ4A 2ZQBA 3NCIA 3MAQA 4F4KA 3KLHA 4LH5A 1HMVA 2VWKA 3NDKA 1NK9A 1SL2A 3T19A 2G8UA 4DU3A 1JL1A 2YKNA 1XWLA 4FM1A 4ID5A 1WSEA 2P1JA 1L3SA 3V9WA 4CEQA 4ZTJA 4FJ5A 1RTHA 4DF4A 1TL1A 2KZZA 2RPIA 4K8XA 2HHQA 4DMNA 4CJPA 3G0ZA 4K8ZA 1X9MA 3C95A 1RDAA 3VQAA 4W5QA 4CJ3A 5CYMA 3AO5A 1WSIA 5C24A 3K5MA 3PV8A 1UA1A 4CGHA 3KLEA 3DOLA 1J9AA 3P83D 3VQQA 4CESA 4NYNA 2R7YA 3QEWA 4N76A 4OLBA 1U49A 1TV6A 1CZ9A 3NF9A 3LP0A 2Z1IA 4QCLA 1VRUA 3L2RA 3PX4A 2A1SA 2D5RA 3CG7A 3LP3A 4MFBA 1ZBUA 4BE0A 1LW2A 2OZSA 4Z4CA 4IG0A 4Z0UA 3S3OA 4ZTFA 1HYSA 1KRPA 3SPZA 1F21A 4KI4A 3V1QA 3NGZA 4CF2A 5D3GA 4PWDA 2G8HA 1SUQA 3VQPA 2GV9A 3SUOA 3L8BA 3IAYA 3L2QA 3ZSVA 3OYBA 4FLUA 5I42A 1BGXT 3KK2A 3NAEA 3AA2A 2QXFA 3QEXA 1RT2A 1VSEA 4CJKA 4FJ7A 1CXQA 4CEDA 2OA8A 1L3TA 3OYFA 2HVHA 4DLGA 2XY8A 3AO4A 1KVCA 4KI6A 5HLFA 4LH4A 3HPHA 1U48A 3HO1A 4BE2A 4FW2A 3ZT3A 3PO5A 4E0DA 2KQ2A 1Q9XA 4M42A 1XHZA 4KKOA 3SUPA 4TSXA 3OYAA 4M41A 1S1VA 2OPSA 3HJFA 3ZT4A 3QEIA 1YT3A 3AVGA 4CF8A 3B6PA 1EP4A 1KTQA 3LP1A 4RG8A 3T3FA 1WSGA 2ETJA 2Q3SA 1NK8A 4J2BA 4OPKA 1U47A 1TVRA 1UA0A 1VSJA 4LD0A 1QTMA 5JS1A 1KLNA 3O3FA 2HMIA 1IG9A 1FKOA 1RTJA 2HB5A 3CFOA 4Y1DA 3D0PA 3NH0A 1C1BA 4DTXA 1BCOA 3VA3A 1XI1A 4DF8A 1TKTA 1ASUA 3EY1A 4DG1A 3OJSA 3C94A 2IS3A 1HPZA 4CFAA 3PO4A 4Z4IA 3S9HA 3OS0A 2YNIA 3MECA 4KREA 4KHQA 1Z26A 3HVRA 4QOZB 1RT1A 3C6UA 1DTQA 4E7KA 4FM2A 4IG3A 1S9EA 2FBXA 3OJUA 3TABA 4FJIA 4CJ5A 2KZMA 4FJNA 1C6VA 2XRIA 3RR8A 1VRTA 3OYLA 1G15A 1CXUA 3QIPA 1BIUA 2XHBA 3PY8A 4H4OA 4FK4A 4CFDA 3NFAA 3PX6A 2X6SA 3O3HA 3TAEA 1S1WA 5HRSA 4NCGA 4FJKA 1DLOA 3M8RA 1Q9YA 2KFZA 1JLEA 1C0MA 2G8WA 2B6AA 3RR7A 1X1PA 3EZ5A 3QLHA 3TAMA 4W5OA 1SKWA 5HRPA 1J54A 3C6TA 1VSIA 1RILA 4DLEA 4FJGA 4JLHA 3NE6A 2AJQA 4CGFA 2O4IA 2YHAA 4CEAA 4LSLA 4FCYA 3SUQA 4CJ4A 4DTRA 1RTDA 3OVNA 5CZ2A 3CM5A 2KW4A 2ZE2A 5SWMA 4FLYA 3AA5X 2XY7A 1RT3A 1S1TA 4AHTA 5E41A 1HQEA 3OYDA 1NJXA 2FBYA 3H08A 1GOCA 1GOAA 2BANA 4EZ9A 4FJMA 3HL8A 1QE1A 1QHTA 3ITHA 1IKYA 4N5SA 3TANA 5HRRA 4I9LA 3BDPA 4DQRA 1C0UA 4JS5A 5K14A 3V9SA 4PY5A 1FK9A 3ZSQA 4CEBA 3HM9A 4DFPA 3QETA 4FK0A 4OVLA 4OKJA 3VQDA 3M8QA 2HVIA 4BDPA 1S6PA 1IKWA 3U3GA 3ZSWA 3L2UA 1LWCA 2HNZA 1BI4B 1ZBFA 1RT6A 2G8IA 2HHVA 4XIUA 4FZZA 1RBSA 3V9UA 3AVNA 2YNFA 4DTPA 5HBMA 1HRHA 3WNHA 3L2WA 4E7JA 3KIOA 1LW0A 4EP5A 1NK5A 2D0CA 4H4MA 4CEEA 3SJJA 3NF7A 5I3UA 4DSEA 3TI0A 4MQ3A 3O4QA 3VA0A 2W42A 4CJQA 1S5JA 1I3AA 1ZYQA 2RKIA 4HVJA 2XY5A 1S9GA 2I5JA 3IRXA 2HNDA 3NGYA 1NK6A 1VSFA 1WLJA 4J2AA 3I8DA 2GBZA 2D0AA 4M3RA 5HROA 2YNGA 2DY4A 3TAPA 4I9QA 3ISNC 4BWJA 4CJEA 1T7PA 4BDYA 1QS4A 1VK0A 2X74A 3HP9A 4B9MA 4O0IA 3AO2A 3P1GA 4M45A 5KRSA 4E1NA 1SL0A 2HHUA 4CK2A 3D45A 3DRSA 3LAKA 3LAMA 4IBNA 3MEDA 3VQ6A 1QQCA 5J2NA 2LSNA 1JLCA 1UWBA 3HVTA 4E7IA 4B9NA 4M3TA 4RW4A 3ZSRA 2F8SA 1RDCA 1J53A 3I0SA 4CGGA 1NJYA 1T05A 4DQQA 5J2QA 3ZT2A 4KTWA 3MEEA 5DMRA 4AHUA 3NF6A 3HPOA 3KKSA 4FLXA 4DQSA 5KI6A 3SPYA 4CE9A 3AVIA 4E89A 3RTVA 4OPJA 1HYVA 3T1AA 2KTQA 3K58A 1QSYA 1C0TA 3CYMA 3CM6A 1L3UA 3LWMA 1T8EA 2FC0A 1JXBA 3QNOA 3P5JA 3JYTA 1WNSA 2Z1HA 3AO3A 3QNNA 1S6QA 4IFYA 4M3UA 5DK5A 4DFKA 1R0AA 4DSJA 4FK2A 4UQGA 1TKDA 3AA3A 1SKSA 3RRGA 4H8KA 2DFFA 4KTQA 4BDZA 1GOBA 3LZIA 4FJ9A 3VQEA 5J1EA 3KLFA 3SQ1A 1C1CA 1VSHA 1NOYA 2E4LA 2ZD1A 5KRTA 1REVA 4FZYA 4W5NA 3G10A 1TKZA 3AVFA 2RN2A 1WSHA 4KHSA 4DSKA 4E7LA 3TAFA 3OYKA 1NKBA 1TAUA 4DSFA 3PUFA 1RDDA 3KK1A 1FKPA 3QIOA 4Y1CA 3VN5A 4CHQA 3OS1A 3EYZA 3ULDA 1WN7A 3DOKA 1BQNA 3AV9A 3AVLA 1NKCA 4IDKA 4KFBA 4Z4GA 1RDBA 3NH2A 4QAGA 2XO7A 2PY5A 1RNHA 2FBVA 2YV0X 3QEVA 2QK9A 3V1RA 3OYHA 3HPGA 3IS9A 4DU4A
chains in the Genus database with same CATH superfamily
4IXCA 4NB4A 4I7FA 4IEEA 1VHXA 2AP1A 4CGDA 4PL7A 1EETA 4AH9A 3N4PA 4LY7A 2W41A 3DLGA 3T69A 3CI5A 4DWIA 3LDNA 1JLAA 1S1UA 5AFUA 2I7PA 5ELZA 2QKBA 1WSJA 3O4NA 4Q5VA 2VG7A 1HNWK 2P9KB 4C8KA 3K5LA 5AR0A 4DQPA 4E1MA 3AVJA 4IOXA 1KAYA 2OPRA 4ILHA 3WNEA 1TGOA 3FZLA 2HBLA 4DFMA 3HYFA 4DFJA 4CJWA 4KV8A 4BR2A 2AA4A 3K59A 3MXMA 1TL3A 1YUWA 1QQOA 4DTSA 4K0KK 4MDBA 3E9OA 2OTLN 4O5BA 1P8ZA 5BPMA 3DXKA 4W5TA 4CFBA 4CJTA 4CHPA 2F8TA 4JKGA 1S22A 3LM2A 3RMDA 2FXUA 3R3LA 4IZ9A 3TWHA 3ID6A 4BRDA 2OZMA 4DTNA 4B9VA 3CF5L 2P9SA 1KD1O 1V4TA 2QKKA 1JLBA 2D0BA 2HF4A 2BDPA 4CEZA 5BPLA 3CHWA 3ZSYA 3O08A 2O8BA 1J6ZA 4LF9K 4JI7K 2UYTA 5TKYA 3DYAA 3QMLA 3U6FA 1NJZA 4KB1A 3UIQA 3IMXA 4CHNA 4DTMA 5CYQA 4M3WA 1HNVA 3CCJN 4FZXC 3MCAB 4X66K 1YTAA 5LL6Z 4B3RK 4FW1A 1KVBA 4HCCA 4O8KA 4EP4A 1CLQA 1N36K 2O8EB 1SAZA 2DFHA 4CZJA 1NMNA 5FPNA 2IDOA 3VQ8A 4IFVA 3QICA 1ZXOA 2OPPA 1JXEA 4G1QA 4OGCA 1HUXA 3HK2A 2QEXN 4JKAA 5BN8A 3ID8A 3OYEA 1NGHA 4FLTA 1A5WA 3SQ2A 4CEOA 3VF4A 4C8MA 3CCRN 1SS6A 3O3GA 3I55N 1NOZA 4R5PA 3QFPA 1NGIA 3LP2A 3L3UA 4N56A 2EHGA 4OLAA 1YJWN 4FL9A 1VQNN 4LFCK 4I2PA 3KK7A 5FPDA 1ILYA 1NJWA 4EZ6A 1KCFA 2D0PA 2DFEA 2JGUA 3RRHA 1XC9A 2X78A 2KLAA 1EQYA 3F5TA 3SAFA 1KAZA 1RGIA 1TAQA 2PFUA 1UAXA 3KLGA 4BQLA 3TSQA 3OY9A 1K6YA 4WE1A 1RBTA 1W0HA 3AAQA 3NGIA 2VWJA 3RMAA 2HW3A 3QESA 1JCEA 1VSDA 4RW7A 1NKEA 4LSNA 1BISA 2A42A 5BPNA 1BI4A 4CW7B 4DTOA 3CCQN 4M3YA 1FJGK 1WAJA 2B5JA 5CZ1A 2VG5A 3OBYA 4JS4A 1SV5A 4IJAA 1NGAA 4J2EA 2E8AA 1A5XA 2VGNA 3ZSOA 3QFUA 3IG1A 2CH5A 4OGEA 1VQ7N 3I56N 4WQ4A 4BVPA 3CFRA 4CF0A 3E1YA 1BDGA 4AQYK 3CQ8A 2QWLA 3EE8A 3AVAA 5TKWA 2B4JA 4KBOA 3WXLA 4AF1A 5JICA 4F4KA 2QWPA 1HMVA 4DU3A 1JL1A 2YI1A 3SBGA 4ZTJA 1ATSA 4FJ5A 1TYQB 3TU5A 1RDAA 3VQAA 4FWRA 3K5MA 3AO5A 1WSIA 2E1ZA 3D2EA 3GL1A 3EN9A 4CESA 3OA9A 1U49A 1CZ9A 3LP0A 1VRUA 2E2NA 3L2RA 4FSVA 4MFBA 3VTIA 3S3OA 1KRPA 1F21A 5M1PA 3VMFB 4PWDA 4H0TB 2G8HA 1SUQA 3L2QA 2O8DA 3THXB 3NAEA 1T6DA 2V52B 4CJKA 1CXQA 4CEDA 2OA8A 1L3TA 5KPRA 4H0PA 5C15A 4NXNK 2ZJQL 4KI6A 5HLFA 3HPHA 4K42A 1U48A 4CZGA 1XHZA 4CZFA 5C12A 2A40A 3C6AA 4DUZK 4I6MB 5M1QA 4CF8A 3B6PA 1BA1A 1EP4A 4RG8A 1NK8A 2E2OA 1NLVA 1J5EK 1TVRA 5E26A 1UA0A 1VSJA 4BRHA 1IBKK 2EWSA 1QTMA 2V7ZA 2HMIA 1IG9A 1FKOA 3CCEN 3D0PA 3ULEB 3NH0A 4DTXA 2P9KA 1TKTA 2O8FB 3WUHA 3VEWA 3PO4A 4KHQA 3C6UA 4FM2A 4DR7K 3FFKB 3CETA 4IG3A 4FJIA 4CJ5A 3LDPA 2XRIA 1P90A 1RDWX 1OKJA 2YJEA 4FWKA 2E2PA 2YCHA 3CCVN 1I94K 3QLHA 4W5OA 3VETA 1RILA 4JAXA 4FJGA 4LF8K 2AJQA 4QS9A 3M3ZA 1RTDA 1JCGA 1GLBG 2KW4A 4CZMA 1WBBA 3AA5X 2XY7A 1RT3A 2BANA 2YHWA 3HL8A 3ITHA 4JI2K 4N5SA 4DV1K 4FWNA 4JS5A 4CEBA 2W6KA 3HM9A 3THWB 1IKWA 2F4VK 3PIOL 2ZGYA 4FWQA 1RT6A 2YNFA 5ADXA 1HRHA 3L2WA 3G4SN 1NK5A 3J7ZO 2D0CA 4H4MA 4NXMK 3TI0A 3VA0A 1KQSM 2E88A 1S5JA 3QDKA 1ZYQA 5AQYA 4HVJA 2O8EA 5AFUH 1VSFA 2CGKA 1C0GA 3TAPA 2P9PB 1BUPA 1VK0A 4O0IA 3AO2A 4CD3A 2WFBA 5KRSA 2GWJA 1NMDA 1BWFO 4IBNA 3MEDA 1UWBA 3HVTA 1HLUA 4RW4A 2F8SA 5J2QA 4AHUA 4DQSA 1K8AO 3RTVA 3TTCA 5CR4A 1QSYA 1NJIO 1L3UA 1QVGM 4DR5K 3QBWA 4B1ZA 2ASOA 3CJ1A 3O5BA 3P5JA 2WTUA 4M3UA 4RTFD 4FK2A 3ZETB 1TKDA 1X3NA 4IJNA 3PIPL 4IFEA 4FJ9A 1MWKA 1HR0K 1NGJA 5GINA 1C1CA 1VSHA 2ZD1A 5EVZA 3VOVA 3VEZA 1WSHA 2QTDA 4KHSA 4DSKA 4EAHD 1RDDA 1GLCG 3IUCA 5FPMA 3HZ6A 3QIOA 4M7XA 2GWKA 5HL7L 4JI4K 3FR0A 4A59A 3AVLA 3THYB 4IDKA 1IBMK 1RDBA 2PY5A 3L4QA 3CCSN 4H5VA 3IS9A 3TTDA 4DU4A 2H3GX 1IG8A 1BHLA 3KWIA 5C42A 5AJ3K 2W40A 1RFQA 1RT4A 3LPUA 3E01A 1KFDA 3MXJA 3T1HK 4JYAK 4U67L 3DRRA 3U8XA 4G9ZA 1ZBSA 3FFIA 1EO1A 5FDLA 2IOCA 1SKRA 1JKHA 1Q86O 3B6OA 3KJVA 1LWFA 1OVYA 1XMQK 4B3MK 1VQLN 4HWIA 3P4IA 3SI6A 1XNQK 3EL2A 3EEQA 4F3OA 5FRMA 3V9ZA 2W6LA 4CHOA 1RDUA 1Q7YO 4N41A 4JKCA 4BVOA 4YFUA 1TYQA 2A1RA 4FM0A 4C8NA 3ZT1A 3SV3A 3CXCM 5C0YA 4AHRA 4E7HA 3MN6A 1ZBHA 4FOIA 4O0JA 1LAWA 5SZTA 5M1FA 2Q1NA 4AHSA 1ESVA 3OYCA 1VSMA 3SUNA 4RW6A 3CMAN 3O9UA 3KD1E 1IH7A 2EX3A 3UE5A 4CHYA 4O44A 5C25A 4KB0A 1SL1A 2ITGA 3AA4A 4HTUA 1X9WA 1JLQA 4DCHA 3VERA 3THXA 4IKFA 1XHXA 3K5OA 4CJUA 3DLKA 4KHYA 2KKZA 3TARA 3DMJA 1HKGA 4YY3K 3RMCA 1HJOA 3C0BA 4BWMA 1FXXA 5JS2A 5EU7A 5J2PA 1LWEA 1S3XA 1X3MA 4CGJA 4I6MA 1QSSA 2YHBA 3UKUB 3SQ0A 4I2QA 5FROA 1EX4A 4K41A 2NNWA 1XNRK 3NF8A 5BRHA 4ID1A 1WSFA 4RW8A 5KGWA 1HNIA 5KQ8A 2YX6A 4AILC 3DLBA 4YDUC 3ULEA 3Q7CA 2NRXA 4XH1A 3TAQA 3SYZA 2CH6A 3L6QA 2O8FA 2UUAK 2Z1JA 4CIGA 5JVHL 4A2BA 1XQSC 3HTVA 2GEMA 1S1XA 3ZSZA 4GKJK 4IOCL 1B9DA 2FSKA 4GY2B 1LAVA 4FXDA 4CBUA 1VAZA 4BRAA 1HYZA 4PA1A 4B3TK 2E6LA 4FVMA 3WNFA 2HHWA 4DU1A 4F2SA 5AQNA 4AHVA 3AVBA 4OPHA 1YVUA 4CZEA 3V4IA 3CPEA 1B9FA 4FJLA 1TKXA 3MN9A 3VESA 4CJSA 1EWQA 4E3SA 3BZCA 4MO5A 1YVNA 3CMEN 4Z4EA 2JWKA 3DI6A 3D2FB 5AQJA 2I7NA 3F73A 5J2MA 1EWRA 4B9QA 4HTLA 3THWA 4WFNL 1NM1A 4ISEA 2ASPA 1VQ6N 4DS4A 3SZ2A 3OYIA 3LALA 4M63C 3R9PA 4ELVA 4FJJA 1NGBA 4K25A 2QWNA 5AQZA 4FJXA 3GDQA 4QS7A 3THVA 2WONA 2Y1IA 1TK8A 2IGIA 4B8CA 4GW6A 4OKKA 3MN7A 4WQ5A 1U04A 1JCFA 2HBJA 3BF3A 3K57A 2OANA 4BACA 4YORA 4YNQA 1VQ9N 5AQXA 1VSKA 4O5FA 4WCEL 3LPTA 1BCMA 1NU0A 2P9PA 4JI6K 3OYNA 1RBRA 4C8LA 1IO2A 4AM7A 5EY4A 3NCIA 3MAQA 2VWKA 3NDKA 2G8UA 1XWLA 1N8RO 1WSEA 3V9WA 4CEQA 1OVQA 1RTHA 3CJCA 2KZZA 4DMNA 3G0ZA 5BRFA 3R1XA 3CCLN 3SBTA 1GLEG 5C24A 5A2QO 3SAGA 3LDOA 3DOLA 4DR2K 3TTFA 3VQQA 2ZF5O 4H03B 3P83D 1DGKN 1NGEA 1M1KO 1TV6A 3OTOK 2HBMA 3D7EO 3ZETA 4GV9A 2UXBK 4OO1J 3PX4A 2A1SA 3LP3A 4BE0A 4Z4CA 3CC4N 1HKCA 4DV5K 3TPQA 3FZMA 1BOTO 3DLLL 5LY3A 3NGZA 2YHYA 3IAYA 3E9LA 4M7YA 5I42A 2RHKA 3KK2A 3QEXA 4FJ7A 1BO5O 3VEVA 3OYFA 3THYA 2HVHA 2XY8A 2HSTA 5IT9O 5ADXH 2FSNA 4KKOA 3CC7N 4TSXA 3OYAA 1S1VA 2OPSA 5AQWA 3HJFA 4V19S 2KHOA 1OH6A 2RE2A 5AQVA 1KTQA 5E84A 3C65A 3LP1A 5C10A 3T3FA 1NWKA 3SAHA 4BQZA 3J8AA 2HHHK 1KLNA 3BUZB 3M6GA 1RTJA 2HB5A 3VENA 4B1WB 1Q18A 3CFOA 4Y1DA 2P9UB 3FZFA 1BCOA 4EHTA 4PL8A 4DF8A 2A3ZA 3T1YK 3C7NB 4EHUA 4BRCA 4WYBA 1MDUB 3EY1A 1TUYA 3FZHA 5JMVA 3P38A 4QOZB 4AM6A 4BRPA 1DTQA 2VQEK 3TABA 3OJUA 4BRQA 2KZMA 4FJNA 1C6VA 2OTJN 3DJCA 4JI0K 1VRTA 3QIPA 2XHBA 2HBKA 1OH5A 4H4OA 3PY8A 4CFDA 3WEEB 2X6SA 3O3HA 4IO9L 4NCGA 1O13A 1Q9YA 2KFZA 2G8WA 3H3NO 2UXDK 1J54A 3C6TA 3NE6A 3O9TA 3IDHA 4L3QA 2VGMA 2ZM6K 1TUUA 4CGFA 2O4IA 2YHAA 3K9KA 3OVNA 2NRZA 1IJJA 1KXPA 1YJNN 4AHTA 2FBYA 1QE1A 5HRRA 3BDPA 4YOTA 2QWRA 2D1KA 5K14A 3V9SA 1W97L 1XUPO 4BY9C 2HVIA 5FPEA 1LWCA 4KHPK 4FZZA 3V9UA 4JD2B 4DTPA 2JWLA 3WNHA 3H46O 1YHQN 2HF3A 3NF7A 5I3UA 3UKUA 2QM1A 4FO0A 1Z6RA 1E4FT 1S9GA 1T6CA 2GBZA 2D0AA 5BREA 2DY4A 2O8CB 4B1XB 4I9QA 3ISNC 4BWJA 4BRGA 1QS4A 4BDYA 4M45A 2Q2RA 1Y64A 5FLXO 5J2NA 4JHDB 4A61A 4E7IA 4B9NA 1RDCA 4BC3A 4KTWA 3MEEA 3NF6A 4RCHA 2NRRA 3SPYA 4JNEA 3AVIA 3AY9A 4B1YB 3U9DA 1HYVA 3T1AA 3CYMA 3U9ZA 2FC0A 3KVGA 2E5LK 4E1JA 1S6QA 4IFYA 5DK5A 4DFKA 1R0AA 4DSJA 4UQGA 3AA3A 3TSPA 5DM7L 1SKSA 3RRGA 2DFFA 4BDZA 3LZIA 4DHYA 5J1EA 3SQ1A 1NOYA 2BUPA 1NBWA 2RN2A 4H5TA 4NO7A 4X64K 4RWTA 4IOAL 4DV0K 3UKRB 1TAUA 3OYKA 4FOEA 3PUFA 3KZBA 3NMUA 3VF2A 3DXMB 3ZX3A 3LDLA 3D2FA 3EYZA 3ULDA 3DOKA 3AV9A 4KFBA 3VEOA 4Z4GA 3NH2A 1D4XA 3QEVA 2QK9A 3V1RA 3OYHA 5GAEP 3TAGA 4CIFA 2HHSA 3DM2A 4CK1A 4DSLA 2G8KA 1YIJN 4KPYA 1K9MO 3JS6A 5AZIB 1IKVA 1TK5A 4Q0BA 5F2RA 2G8VA 4BE1A 4B08A 4F2RA 3QINA 2NLXA 4CI6A 5M1NA 2ZJRL 3OYMA 1KLMA 4F9OA 1D8YA 3L3VA 4BRMA 3P39A 4H0VB 3HRGA 3WXMB 4DKWA 1VQPN 2D0OA 4DB3A 5DM6L 2J4RA 4CD1A 3VGMA 2HMPA 2PYLA 3S3NA 1HNXK 1QZ6A 4ICLA 2FF3B 1RTIA 4RW9A 4FYDA 3D6RA 3U4LA 3AVCA 3OYGA 2YJFA 3A5MC 3AVMA 2BE2A 3MXIA 3LL3A 3M5RA 3WXKA 4M3ZA 4JRPA 1MU2A 2PZSA 4F3TA 4DTUA 3O80A 1TK0A 1W9HA 1QQMA 2RF2A 3MN5A 2V51B 3GE1A 3HT3A 3WT0A 1X9SA 5FRNA 1BQMA 3P31A 3VGLA 2DPNA 4LC9B 4U7BA 3JSMA 1LV5A 3VQ9A 3VEYA 3ZSXA 3J80O 1XMOK 1E3MA 3K2PA 2GTDA 3EE9A 3AGKA 1A5VA 5CE3A 4WFAL 4H0YB 3W0LA 5JLHA 2HHTA 4GV3A 4DR1K 4B9UA 3AO1A 1M90O 4CK3A 3PSFA 4OKEA 4CJFA 1Z05A 4C8OA 3VQCA 2Q0UA 1U4BA 2Y1JA 4FVUA 1VSLA 2VYPA 3HXMA 3W3DA 4CJVA 4ELUA 1IKXA 1C1AA 1J5OA 1NK4A 4Z4FA 4O8UA 3KKRA 2P9UA 3A2FA 4FPBA 4H5NA 1Q82O 4BGBA 1KC8O 3C7NA 5M1OA 2WUSA 4JRQA 4NCBA 3BZKA 4KHUA 3OYJA 2YKMA 4FJ8A 2ATQA 4CCHA 3ZCMA 4BRKA 3M8SA 1BIZA 1O1WA 1YTUA 4MLEA 4GMJB 3K5NA 3BF1A 3WXIA 3H45C 3LZJA 1YAGA 3WEEA 3J81O 1D5AA 3QBXA 1U45A 1HJRA 2E6MA 4B9TA 4FLZA 3FGUA 5AZJB 3WQTA 4EIAA 4LFBK 4FWPA 4DV2K 1W2BM 3L4IA 2QW9A 1QSLA 2YNHA 3AVKA 3NHGA 4B9SA 4WQ4C 1NGFA 4HHTA 4PKIA 1RBVA 2D4WA 2F96A 4CJLA 1RBUA 5AQMA 4DR4K 3DLRA 4JD2A 2ZGZA 3TR8A 4CJRA 4H5WA 4DV3K 4LFAK 4BR5A 1BL3A 3SCXA 4NCAA 2BTFA 4PQUA 5T7BA 4CHZA 3O9RA 3DLEA 4FLVA 3KK3A 1L5UA 3QO9A 2HHXA 3V81A 3V1OA 3ZT0A 3VQBA 4JN4A 3LWLA 4YOXA 4DQ8A 1DKGD 2O8CA 4FLWA 1BA0A 4CFCA 3NBPA 3CQXA 2F9TA 2IAJA 3PSIA 4O4GA 2WC9A 2GUIA 1DTTA 3ENHA 3MEGA 1R59O 3VQ4A 2UUBK 3KWGA 4LH5A 4A2AA 4JHDA 1NK9A 3T19A 1L3SA 2P1JA 4DF4A 1TL1A 2RPIA 5AQPA 4CJPA 3C95A 3AAPA 3PV8A 1OH7A 4ILGB 3KLEA 2QXLA 1J9AA 3CJ9A 4NYNA 3QEWA 1H1VA 3TSUA 3NF9A 3CCMN 2Z1IA 1QVFM 2D5RA 1ZBUA 1OH8A 4IG0A 4Z0UA 4DV6K 4ZTFA 4PKGA 4BC5A 1HYSA 3SPZA 5C2FA 5D3GA 4CF2A 4ILJA 3VQPA 2GV9A 3SUOA 4LF4K 3UKRA 3ZSVA 3OYBA 2NRHA 2FLOA 3ATUA 1BGXT 3DXMA 3AA2A 1RT2A 1YI2N 5AQHA 1GLDG 4LF5K 4DLGA 3KHYA 3AO4A 3MMVA 4FW2A 3ZT3A 3PO5A 2KQ2A 4BREA 5B8HA 3SUPA 2V7YA 4CJ7A 4M41A 1VQON 2QWQA 3ZT4A 4BR4A 5AQFA 3AVGA 3ENBA 5AZIA 1N32K 4JKHA 1WSGA 2Q3SA 4J2BA 1U47A 3J7YP 3FE1A 3MX2A 4LD0A 3K9JA 3CERA 3E66A 1C1BA 4YOUA 3G25A 5BR9A 1HNZK 4OX9K 1ASUA 4DG1A 3C94A 2IS3A 2NRVA 3S9HA 2YNIA 4KREA 2GUPA 5HOOA 4BG8A 1RT1A 4Y0WA 4JK8A 3I8BA 1HPMA 2FBXA 3ATVA 1WOQA 3RR8A 1VQ5N 4OPAA 1CXUA 1BIUA 4JKDA 3NFAA 3MX5A 3PX6A 2VQFK 3TAEA 4FJKA 3M8RA 1SQKA 3H1QA 1VQMN 1C0MA 4PKHA 3RR7A 1X1PA 3TAMA 1K8KA 4BRNA 4CEAA 3SUQA 2ZJPL 4CJ4A 2IVOA 4YOWA 3A5LC 2ZE2A 5SWMA 2QWOA 1S1TA 4BRLA 4FJMA 1QHTA 1IKYA 4I9LA 4IO8A 5KQDA 4DQRA 3SJHA 5GIPA 4JI1K 4PY5A 4WFBL 5AQGA 4FK0A 4DFPA 3NVKA 4OVLA 3VQDA 3M8QA 3U3GA 1HX1A 2HNZA 1E4GT 1ZBFA 2G8IA 4XIUA 3AVNA 1NNEA 3OHRA 2E1YA 4E7JA 4EP5A 4CEEA 4DR6K 4DSEA 3O4QA 4BROA 3CCUN 3VGKA 2W42A 2UU9K 4CJQA 2XY5A 2I5JA 1NK6A 2HNDA 4GVEA 3I8DA 2YNGA 4ISFA 1T44A 1GLFO 1T7PA 2NRWA 4B9MA 3S41A 4JI5K 4KH5A 5I9EB 1WBDA 5BRDA 1SL0A 2HHUA 1K73O 1QQCA 2LSNA 3BY5A 4M3TA 4CBXA 1XC3A 3ZSRA 1J53A 1T05A 3ZT2A 5DMRA 5KI6A 5GADP 2F7TA 4E89A 4B3SK 3L0QA 4MO4A 3LWMA 1T8EA 1JXBA 3JYTA 1VQ8N 2Z1HA 4JKBA 3AO3A 1Q81O 5EXWA 3QNNA 3O6WA 2FF6A 5AZJA 1DEJA 4H5RA 4K43A 5AQRA 3HM8A 3KLFA 1SZ2A 2E4LA 5IWAK 3H3OB 5JLFA 3JXUA 3CPWM 4FZYA 1HKBA 1TKZA 3G10A 4KH4A 3EO3A 3RSEB 3ENOA 2GELA 4E7LA 3TAFA 1NKBA 4DSFA 5LJVA 1FKPA 4Y1CA 1IV0A 4CHQA 1WN7A 4C1NK 1BQNA 1GLAG 3SMPA 2YHXA 1BG3A 3EZWA 1RNHA 2FBVA 3HPGA 3N4QA 2JLEA 2QA4N 3LDSA 1YXQA 5M1KA 3HSTB 3HI0A 1HQUA 3O4WA 4IEIA 2Z1GA 1UOCA 2HOEA 3GG4A 4CF1A 1T03A 3LDQA 3VPZA 3PX0A 5HP1A 2VWBA 3VTHA 2X6NA 2CGLA 2VG6A 5HRNA 5LMNK 2O4GA 3M8PA 4NLCA 3SQ4A 2IC3A 2PYJA 2HNYA 4AHCA 3F9KA 2Q97A 4CVNE 3SNNA 1ITGA 1JJ2M 3DWLA 1JLGA 3WNGA 2DTUA 1D9DA 3J7AP 3ASMA 4A5AA 4QS8A 1ZBLA 3KTQA 4J2DA 2P9IB 3FZKA 4B9LA 4CERA 2UUCK 1FW6A 3VQ5A 1EXQA 4B3OA 1YF5L 1ATRA 4ZHRA 4M3XA 2P9LB 3IFRA 3MWTA 3QEPA 4FWMA 4Z4HA 4NYFA 3I0RA 3KLIA 1V4SA 5BN9A 2OYQA 4L8RB 4CECA 3WQUA 1RT7A 3BGRA 1CZAN 4KTZA 5GIOA 3O1BA 4HUEA 4JKEA 5MLCQ 4BR9A 5AQTA 4F8RA 2PAVA 4BRFA 5KTQA 1U2VB 4E19A 4MLHA 1KFSA 3DLHA 3H1VX 1KSPA 4FPAA 3HOSA 3G6EN 3AGRA 2QI2A 3VEXA 1N33K 4KO0A 4KHWA 1ASVA 3HP6A 1CZBA 3LANA 5KGXA 1DT9A 3FLCO 3OW2M 3CIPA 1NK7A 2BGGA 4J8FA 4OJRA 3SV4A 4PUOA 3KD5E 2FSJA 1I39A 3SLCA 2F9WA 2WOMA 1BU6O 4B8AB 4BRIA 4YOVA 4DSIA 2OPQA 2VCPA 4GV6A 4X62K 1B92A 1RT5A 4KHNA 2A5XA 4CF9A 4ELTA 3A5NC 4CZIA 2IVPA 3L2VA 2QWMA 3AVHA 3EKSA 1KVAA 4DTJA 3OS2A 4KAZA 1JLFA 3CQYA 2XY6A 2KFNA 1N6QA 3VQ7A 2G8FA 5CHIA 3S3MA 1Z25A 5AQUA 3ZEUB 3DRPA 5AQLA 3V6DA 4GVMA 4BGAA 4HUFA 1N5YA 1L3VA 2BH1A 1ZBIA 2E20A 4YDUA 4CGIA 4XH5A 5CY4A 4W5RA 4DV7K 5LJWA 4CIEA 3I33A 4DQIA 3HSCA 2P5OA 4Z94A 3EKUA 4HUGA 1EKEA 1D9FA 3GBTA 3JAMO 4WQ5C 3LM9A 3QERA 2FBTA 3CJ7A 3DAWA 2A41A 2P9NB 4CEFA 4PHTX 2NUBA 3RVCA 5AQOA 1WB9A 4MDAA 1RCHA 4O55A 4KRFA 2NZTA 3NH1A 5EX5A 1NGCA 4NLBA 1QHAA 4HCBA 3A8YA 1WAFA 3RWUA 4YHHK 4DS5A 5H1SQ 3RMBA 3O9SA 4LF7K 1G99A 1NK0A 3V9XA 1ASWA 4FJHA 1ZC6A 2P5GA 1K8KB 4BR7A 1Y97A 1JL2A 3CFPA 2ITMA 3U3YA 1T3VA 3G71N 1GLLO 4UY8O 3ALYA 3T7ZA 1Q8IA 4N47A 2P51A 2ZQBA 3O9QA 4BG9A 3KLHA 3O1WA 1SL2A 3M1FA 2YKNA 4FM1A 4CZHA 4JI8K 4ID5A 5F1XA 3HOTA 3WXJA 2CGJA 4C23A 4K8XA 2HHQA 3CJAA 4K8ZA 3UB5A 3MDQA 1X9MA 5GAHP 4W5QA 2ZWHA 3DXKB 4CJ3A 5CYMA 4BC4A 1UA1A 4FWLA 4CGHA 4JKGB 4B1UB 3BEXA 2R7YA 4OLBA 4N76A 4XEIA 4QCLA 4R79A 3CG7A 2OZSA 1LW2A 2P9SB 4A57A 3H6EA 4KI4A 4CZKA 3V1QA 1MA9B 3L8BA 3HBTA 3RSEA 4BC2A 3A0IX 2O8BB 4FLUA 2OCEA 2E2QA 2QXFA 4LF6K 1VSEA 4IWVA 1S72N 3CD6N 1KVCA 1VQ4N 4LH4A 3HO1A 4BE2A 4M42A 4E0DA 4KH6A 4JKFA 4WF9L 1Q9XA 4A5BA 5AQKA 3QEIA 5BR8K 1YT3A 3F9MA 2ETJA 1VQKN 1GLJO 4OPKA 4X65K 3GOIA 4BR0A 3O3FA 5JS1A 4H0XB 3MK6A 4IDHA 4B1VA 3VA3A 1XI1A 3ZYYX 2PBDA 1QZ5A 5C2DA 3OJSA 4CFAA 1HPZA 4C1NI 4Z4IA 3VF6A 3OS0A 3MECA 1NG9A 1Z26A 3HVRA 4E7KA 1S9EA 2P9IA 5AQQA 5KPTA 3OYLA 4GKKK 4FWOA 1G15A 2NRTA 4FWSA 4FK4A 4DV4K 3AARA 1S1WA 5HRSA 1LOTB 1DLOA 1JLEA 2P9LA 2B6AA 3PLAA 3EZ5A 1SKWA 4JV5K 5HRPA 4DLEA 1VSIA 4JLHA 3F2KA 2UXCK 4FCYA 4LSLA 3CJBA 1NGGA 4DTRA 5CZ2A 3CM5A 4FLYA 1W7AA 3ZLJA 4JK9A 5E41A 3OYDA 1HQEA 1NJXA 4ISGA 3H08A 1GOCA 4JEPA 1GOAA 4EZ9A 3TANA 1WUAA 4A62A 4CBWA 4DUYK 1U2VA 1C0UA 1MWMA 1FK9A 3ZSQA 3E9PA 3QETA 3QB0A 3MWPA 4OKJA 4H0OA 4BDPA 1S6PA 3ZSWA 3L2UA 5AQIA 1BI4B 3SK3A 2HHVA 5GAGP 1RBSA 5HBMA 3KIOA 1LW0A 3CC2N 3SJJA 5JVGL 5LMUK 3O8MA 4MQ3A 1KAXA 1I3AA 3NVMA 2WBNA 2RKIA 3IRXA 3NGYA 4XH4A 4DR3K 1WLJA 4J2AA 5HROA 4M3RA 5KPZA 4JI3K 1LCUA 4GNIA 4CJEA 1IBLK 2X74A 3HP9A 1NGDA 3P1GA 2ASMA 4JK7A 4E1NA 4CK2A 3D45A 3DRSA 3LAKA 3LAMA 3VQ6A 3R6MA 2Q0RA 2Q31A 3SMSA 1JLCA 3Q7BA 3R8EA 4CGGA 1NJYA 3I0SA 5EOYA 5F0XA 4DQQA 4FLXA 3HPOA 3KKSA 4CZLA 4CE9A 1U6ZA 2A6AA 3BP8A 3ZX0A 1YJ9N 4OPJA 3ZEUA 2KTQA 3K58A 1C0TA 3CM6A 3K0SA 3QNOA 1ATNA 1WNSA 1YITN 3D2EB 3IKMA 1C0FA 4H8KA 4KTQA 1GOBA 3B8AX 3VQEA 5KRTA 1REVA 4W5NA 3AVFA 3ZX2A 4YOYA 3C6HA 2O8DB 5AQSA 3KK1A 3OBWA 3MCPA 2P9NA 3VN5A 1X9JA 1QQNA 3OS1A 2IIRA 4EFHA 2Q36A 1NKCA 2GX9A 4QAGA 2XO7A 2YV0X 3A5OC 1N34K 2IVNA
chains in the Genus database with same CATH topology
2JLEA 4CIFA 4I7FA 3LDSA 3TAGA 1BHLA 3DM2A 4CK1A 5C42A 2HHSA 4DSLA 2G8KA 4CGDA 3HSTB 1RT4A 4KPYA 1EETA 4AH9A 1HQUA 4LY7A 1IKVA 3LPUA 3E01A 1KFDA 3MXJA 1TK5A 4Q0BA 2Z1GA 3DLGA 1UOCA 4CF1A 4DWIA 1T03A 2G8VA 1JLAA 3PX0A 1S1UA 3DRRA 4BE1A 5HP1A 4B08A 4F2RA 3QINA 3FFIA 2QKBA 2X6NA 1WSJA 2VG6A 1KLMA 3O4NA 5FDLA 2IOCA 5HRNA 2VG7A 4Q5VA 3OYMA 1SKRA 1JKHA 2O4GA 1D8YA 4C8KA 3M8PA 3SQ4A 3K5LA 2IC3A 3B6OA 3L3VA 2PYJA 4DQPA 4E1MA 2HNYA 3AVJA 3F9KA 4AHCA 3SNNA 2OPRA 3KJVA 1ITGA 1LWFA 3WNEA 1TGOA 4DFMA 3HYFA 4DFJA 3SI6A 4CJWA 4KV8A 1JLGA 3WNGA 2DTUA 1D9DA 2PYLA 4F3OA 3S3NA 3V9ZA 5FRMA 3ASMA 4CHOA 3MXMA 3K59A 1TL3A 4N41A 4ICLA 1ZBLA 3KTQA 4DTSA 4J2DA 1RTIA 2A1RA 4YFUA 4B9LA 4CERA 4RW9A 4FM0A 4B3OA 4FYDA 3VQ5A 1EXQA 4O5BA 3AVCA 4C8NA 3ZT1A 3SV3A 3OYGA 4AHRA 4ZHRA 4M3XA 4W5TA 4CFBA 4E7HA 4CJTA 4CHPA 1ZBHA 2F8TA 3AVMA 4O0JA 2BE2A 3MXIA 4M3ZA 1LAWA 3QEPA 5SZTA 3RMDA 4Z4HA 4NYFA 4JRPA 3TWHA 4AHSA 1MU2A 3OYCA 3I0RA 2PZSA 1VSMA 3KLIA 4DTUA 4F3TA 2OZMA 4DTNA 3SUNA 4RW6A 4B9VA 3KD1E 1IH7A 2EX3A 4CHYA 2OYQA 4O44A 2QKKA 1JLBA 2D0BA 5C25A 2BDPA 4CEZA 4CECA 1TK0A 4KB0A 1SL1A 3ZSYA 4L8RB 1W9HA 1RT7A 3BGRA 2ITGA 3AA4A 4KTZA 4HTUA 1X9WA 2RF2A 4HUEA 1JLQA 3HT3A 4F8RA 4IKFA 1XHXA 3K5OA 4CJUA 1BQMA 5KTQA 1X9SA 4E19A 5FRNA 1KFSA 3DLHA 3DLKA 4KHYA 1KSPA 3TARA 3DMJA 3DYAA 3U6FA 1NJZA 4KB1A 3UIQA 3RMCA 4KO0A 3JSMA 4KHWA 4CHNA 1ASVA 4DTMA 1LV5A 3VQ9A 1CZBA 3HP6A 5CYQA 3LANA 1FXXA 4BWMA 3ZSXA 1HNVA 5JS2A 5KGXA 4M3WA 3K2PA 5EU7A 5J2PA 1A5VA 1LWEA 4FZXC 4CGJA 1NK7A 1QSSA 2YHBA 2BGGA 2HHTA 1YTAA 2HHXA 3SQ0A 4I2QA 4B9UA 3AO1A 4FW1A 5FROA 4CK3A 4OKEA 4CJFA 1EX4A 1KVBA 4OJRA 3VQCA 3SV4A 4C8OA 4HCCA 1U4BA 4EP4A 2Y1JA 4PUOA 1CLQA 3KD5E 1VSLA 2DFHA 3HXMA 3NF8A 4B8AB 1I39A 4DSIA 2WOMA 4ID1A 1WSFA 4RW8A 5KGWA 4CJVA 2OPQA 4ELUA 2IDOA 1IKXA 1C1AA 1HNIA 1J5OA 1NK4A 3VQ8A 4IFVA 4AILC 3DLBA 4Z4FA 1B92A 1RT5A 3A2FA 3KKRA 4KHNA 2OPPA 3TAQA 4CF9A 3SYZA 4ELTA 1JXEA 3L2VA 4G1QA 3AVHA 4OGCA 4JRQA 2Z1JA 4NCBA 3HK2A 4KHUA 3OYJA 2YKMA 4CIGA 1KVAA 4DTJA 4FJ8A 2ATQA 4CCHA 3OYEA 3OS2A 1S1XA 1JLFA 1A5WA 3ZCMA 3ZSZA 4FLTA 4KAZA 3M8SA 2XY6A 3SQ2A 2KFNA 1BIZA 1N6QA 1O1WA 4CEOA 3VQ7A 1B9DA 4C8MA 2G8FA 3S3MA 1LAVA 4FXDA 3O3GA 1YTUA 1Z25A 4GMJB 1NOZA 4R5PA 3K5NA 3DRPA 1HYZA 4PA1A 4GVMA 3LP2A 2E6LA 3LZJA 3L3UA 4N56A 4HUFA 1D5AA 3V6DA 1U45A 1N5YA 1HJRA 2E6MA 2EHGA 4FVMA 3WNFA 1L3VA 4B9TA 4OLAA 2HHWA 1ZBIA 4DU1A 4F2SA 4FLZA 4I2PA 4CGIA 4AHVA 3AVBA 5CY4A 1NJWA 4W5RA 4CIEA 1YVUA 1KCFA 4DQIA 4EZ6A 2DFEA 2JGUA 3V4IA 4FJLA 1B9FA 1TKXA 3RRHA 2P5OA 1XC9A 2X78A 4HUGA 4CJSA 4E3SA 1QSLA 1EKEA 2YNHA 1D9FA 1TAQA 1UAXA 3AVKA 3NHGA 2FBTA 3QERA 3KLGA 4Z4EA 4B9SA 3OY9A 1K6YA 3DI6A 4WE1A 4CEFA 1RBTA 1W0HA 3NGIA 2VWJA 3F73A 2NUBA 5J2MA 3RMAA 2HW3A 4HHTA 3QESA 1VSDA 1RBVA 4RW7A 1NKEA 2F96A 1RCHA 4LSNA 4O55A 4KRFA 1BISA 4CJLA 1RBUA 1BI4A 3NH1A 4DS4A 4DTOA 3SZ2A 3OYIA 3LALA 3DLRA 4HCBA 4M3YA 4ELVA 1WAFA 3TR8A 3RWUA 4FJJA 4FJXA 1WAJA 4CJRA 1BL3A 2B5JA 3SCXA 5CZ1A 4DS5A 3RMBA 2WONA 2Y1IA 3THVA 4NCAA 4PQUA 2VG5A 5T7BA 1NK0A 4CHZA 3V9XA 1TK8A 1ASWA 4FJHA 4JS4A 2IGIA 3DLEA 4B8CA 3KK3A 1SV5A 4GW6A 4OKKA 3QO9A 4FLVA 1L5UA 3V81A 2P5GA 1A5XA 1U04A 3ZSOA 4J2EA 3V1OA 3K57A 3ZT0A 3IG1A 4BACA 3VQBA 3LWLA 1Y97A 4OGEA 4YNQA 1JL2A 3CFPA 1VSKA 3CFRA 3LPTA 4CF0A 3U3YA 4FLWA 1BCMA 4CFCA 3NBPA 3CQ8A 3OYNA 2IAJA 1RBRA 3ALYA 4O4GA 3AVAA 1Q8IA 4N47A 2GUIA 1DTTA 2B4JA 2P51A 4C8LA 3MEGA 1IO2A 3VQ4A 2ZQBA 3NCIA 3MAQA 4F4KA 3KLHA 4LH5A 1HMVA 2VWKA 3NDKA 1NK9A 1SL2A 3T19A 2G8UA 4DU3A 1JL1A 2YKNA 1XWLA 4FM1A 4ID5A 1WSEA 2P1JA 1L3SA 3V9WA 4CEQA 4ZTJA 4FJ5A 1RTHA 4DF4A 1TL1A 2KZZA 2RPIA 4K8XA 2HHQA 4DMNA 4CJPA 3G0ZA 4K8ZA 1X9MA 3C95A 1RDAA 3VQAA 4W5QA 4CJ3A 5CYMA 3AO5A 1WSIA 5C24A 3K5MA 3PV8A 1UA1A 4CGHA 3KLEA 3DOLA 1J9AA 3P83D 3VQQA 4CESA 4NYNA 2R7YA 3QEWA 4N76A 4OLBA 1U49A 1TV6A 1CZ9A 3NF9A 3LP0A 2Z1IA 4QCLA 1VRUA 3L2RA 3PX4A 2A1SA 2D5RA 3CG7A 3LP3A 4MFBA 1ZBUA 4BE0A 1LW2A 2OZSA 4Z4CA 4IG0A 4Z0UA 3S3OA 4ZTFA 1HYSA 1KRPA 3SPZA 1F21A 4KI4A 3V1QA 3NGZA 4CF2A 5D3GA 4PWDA 2G8HA 1SUQA 3VQPA 2GV9A 3SUOA 3L8BA 3IAYA 3L2QA 3ZSVA 3OYBA 4FLUA 5I42A 1BGXT 3KK2A 3NAEA 3AA2A 2QXFA 3QEXA 1RT2A 1VSEA 4CJKA 4FJ7A 1CXQA 4CEDA 2OA8A 1L3TA 3OYFA 2HVHA 4DLGA 2XY8A 3AO4A 1KVCA 4KI6A 5HLFA 4LH4A 3HPHA 1U48A 3HO1A 4BE2A 4FW2A 3ZT3A 3PO5A 4E0DA 2KQ2A 1Q9XA 4M42A 1XHZA 4KKOA 3SUPA 4TSXA 3OYAA 4M41A 1S1VA 2OPSA 3HJFA 3ZT4A 3QEIA 1YT3A 3AVGA 4CF8A 3B6PA 1EP4A 1KTQA 3LP1A 4RG8A 3T3FA 1WSGA 2ETJA 2Q3SA 1NK8A 4J2BA 4OPKA 1U47A 1TVRA 1UA0A 1VSJA 4LD0A 1QTMA 5JS1A 1KLNA 3O3FA 2HMIA 1IG9A 1FKOA 1RTJA 2HB5A 3CFOA 4Y1DA 3D0PA 3NH0A 1C1BA 4DTXA 1BCOA 3VA3A 1XI1A 4DF8A 1TKTA 1ASUA 3EY1A 4DG1A 3OJSA 3C94A 2IS3A 1HPZA 4CFAA 3PO4A 4Z4IA 3S9HA 3OS0A 2YNIA 3MECA 4KREA 4KHQA 1Z26A 3HVRA 4QOZB 1RT1A 3C6UA 1DTQA 4E7KA 4FM2A 4IG3A 1S9EA 2FBXA 3OJUA 3TABA 4FJIA 4CJ5A 2KZMA 4FJNA 1C6VA 2XRIA 3RR8A 1VRTA 3OYLA 1G15A 1CXUA 3QIPA 1BIUA 2XHBA 3PY8A 4H4OA 4FK4A 4CFDA 3NFAA 3PX6A 2X6SA 3O3HA 3TAEA 1S1WA 5HRSA 4NCGA 4FJKA 1DLOA 3M8RA 1Q9YA 2KFZA 1JLEA 1C0MA 2G8WA 2B6AA 3RR7A 1X1PA 3EZ5A 3QLHA 3TAMA 4W5OA 1SKWA 5HRPA 1J54A 3C6TA 1VSIA 1RILA 4DLEA 4FJGA 4JLHA 3NE6A 2AJQA 4CGFA 2O4IA 2YHAA 4CEAA 4LSLA 4FCYA 3SUQA 4CJ4A 4DTRA 1RTDA 3OVNA 5CZ2A 3CM5A 2KW4A 2ZE2A 5SWMA 4FLYA 3AA5X 2XY7A 1RT3A 1S1TA 4AHTA 5E41A 1HQEA 3OYDA 1NJXA 2FBYA 3H08A 1GOCA 1GOAA 2BANA 4EZ9A 4FJMA 3HL8A 1QE1A 1QHTA 3ITHA 1IKYA 4N5SA 3TANA 5HRRA 4I9LA 3BDPA 4DQRA 1C0UA 4JS5A 5K14A 3V9SA 4PY5A 1FK9A 3ZSQA 4CEBA 3HM9A 4DFPA 3QETA 4FK0A 4OVLA 4OKJA 3VQDA 3M8QA 2HVIA 4BDPA 1S6PA 1IKWA 3U3GA 3ZSWA 3L2UA 1LWCA 2HNZA 1BI4B 1ZBFA 1RT6A 2G8IA 2HHVA 4XIUA 4FZZA 1RBSA 3V9UA 3AVNA 2YNFA 4DTPA 5HBMA 1HRHA 3WNHA 3L2WA 4E7JA 3KIOA 1LW0A 4EP5A 1NK5A 2D0CA 4H4MA 4CEEA 3SJJA 3NF7A 5I3UA 4DSEA 3TI0A 4MQ3A 3O4QA 3VA0A 2W42A 4CJQA 1S5JA 1I3AA 1ZYQA 2RKIA 4HVJA 2XY5A 1S9GA 2I5JA 3IRXA 2HNDA 3NGYA 1NK6A 1VSFA 1WLJA 4J2AA 3I8DA 2GBZA 2D0AA 4M3RA 5HROA 2YNGA 2DY4A 3TAPA 4I9QA 3ISNC 4BWJA 4CJEA 1T7PA 4BDYA 1QS4A 1VK0A 2X74A 3HP9A 4B9MA 4O0IA 3AO2A 3P1GA 4M45A 5KRSA 4E1NA 1SL0A 2HHUA 4CK2A 3D45A 3DRSA 3LAKA 3LAMA 4IBNA 3MEDA 3VQ6A 1QQCA 5J2NA 2LSNA 1JLCA 1UWBA 3HVTA 4E7IA 4B9NA 4M3TA 4RW4A 3ZSRA 2F8SA 1RDCA 1J53A 3I0SA 4CGGA 1NJYA 1T05A 4DQQA 5J2QA 3ZT2A 4KTWA 3MEEA 5DMRA 4AHUA 3NF6A 3HPOA 3KKSA 4FLXA 4DQSA 5KI6A 3SPYA 4CE9A 3AVIA 4E89A 3RTVA 4OPJA 1HYVA 3T1AA 2KTQA 3K58A 1QSYA 1C0TA 3CYMA 3CM6A 1L3UA 3LWMA 1T8EA 2FC0A 1JXBA 3QNOA 3P5JA 3JYTA 1WNSA 2Z1HA 3AO3A 3QNNA 1S6QA 4IFYA 4M3UA 5DK5A 4DFKA 1R0AA 4DSJA 4FK2A 4UQGA 1TKDA 3AA3A 1SKSA 3RRGA 4H8KA 2DFFA 4KTQA 4BDZA 1GOBA 3LZIA 4FJ9A 3VQEA 5J1EA 3KLFA 3SQ1A 1C1CA 1VSHA 1NOYA 2E4LA 2ZD1A 5KRTA 1REVA 4FZYA 4W5NA 3G10A 1TKZA 3AVFA 2RN2A 1WSHA 4KHSA 4DSKA 4E7LA 3TAFA 3OYKA 1NKBA 1TAUA 4DSFA 3PUFA 1RDDA 3KK1A 1FKPA 3QIOA 4Y1CA 3VN5A 4CHQA 3OS1A 3EYZA 3ULDA 1WN7A 3DOKA 1BQNA 3AV9A 3AVLA 1NKCA 4IDKA 4KFBA 4Z4GA 1RDBA 3NH2A 4QAGA 2XO7A 2PY5A 1RNHA 2FBVA 2YV0X 3QEVA 2QK9A 3V1RA 3OYHA 3HPGA 3IS9A 4DU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JLE A;  4CIF A;  4I7F A;  3LDS A;  3TAG A;  1BHL A;  3DM2 A;  4CK1 A;  5C42 A;  2HHS A;  4DSL A;  2G8K A;  4CGD A;  3HST B;  1RT4 A;  4KPY A;  1EET A;  4AH9 A;  1HQU A;  4LY7 A;  1IKV A;  3LPU A;  3E01 A;  1KFD A;  3MXJ A;  1TK5 A;  4Q0B A;  2Z1G A;  3DLG A;  1UOC A;  4CF1 A;  4DWI A;  1T03 A;  2G8V A;  1JLA A;  3PX0 A;  1S1U A;  3DRR A;  4BE1 A;  5HP1 A;  4B08 A;  4F2R A;  3QIN A;  3FFI A;  2QKB A;  2X6N A;  1WSJ A;  2VG6 A;  1KLM A;  3O4N A;  5FDL A;  2IOC A;  5HRN A;  2VG7 A;  4Q5V A;  3OYM A;  1SKR A;  1JKH A;  2O4G A;  1D8Y A;  4C8K A;  3M8P A;  3SQ4 A;  3K5L A;  2IC3 A;  3B6O A;  3L3V A;  2PYJ A;  4DQP A;  4E1M A;  2HNY A;  3AVJ A;  3F9K A;  4AHC A;  3SNN A;  2OPR A;  3KJV A;  1ITG A;  1LWF A;  3WNE A;  1TGO A;  4DFM A;  3HYF A;  4DFJ A;  3SI6 A;  4CJW A;  4KV8 A;  1JLG A;  3WNG A;  2DTU A;  1D9D A;  2PYL A;  4F3O A;  3S3N A;  3V9Z A;  5FRM A;  3ASM A;  4CHO A;  3MXM A;  3K59 A;  1TL3 A;  4N41 A;  4ICL A;  1ZBL A;  3KTQ A;  4DTS A;  4J2D A;  1RTI A;  2A1R A;  4YFU A;  4B9L A;  4CER A;  4RW9 A;  4FM0 A;  4B3O A;  4FYD A;  3VQ5 A;  1EXQ A;  4O5B A;  3AVC A;  4C8N A;  3ZT1 A;  3SV3 A;  3OYG A;  4AHR A;  4ZHR A;  4M3X A;  4W5T A;  4CFB A;  4E7H A;  4CJT A;  4CHP A;  1ZBH A;  2F8T A;  3AVM A;  4O0J A;  2BE2 A;  3MXI A;  4M3Z A;  1LAW A;  3QEP A;  5SZT A;  3RMD A;  4Z4H A;  4NYF A;  4JRP A;  3TWH A;  4AHS A;  1MU2 A;  3OYC A;  3I0R A;  2PZS A;  1VSM A;  3KLI A;  4DTU A;  4F3T A;  2OZM A;  4DTN A;  3SUN A;  4RW6 A;  4B9V A;  3KD1 E;  1IH7 A;  2EX3 A;  4CHY A;  2OYQ A;  4O44 A;  2QKK A;  1JLB A;  2D0B A;  5C25 A;  2BDP A;  4CEZ A;  4CEC A;  1TK0 A;  4KB0 A;  1SL1 A;  3ZSY A;  4L8R B;  1W9H A;  1RT7 A;  3BGR A;  2ITG A;  3AA4 A;  4KTZ A;  4HTU A;  1X9W A;  2RF2 A;  4HUE A;  1JLQ A;  3HT3 A;  4F8R A;  4IKF A;  1XHX A;  3K5O A;  4CJU A;  1BQM A;  5KTQ A;  1X9S A;  4E19 A;  5FRN A;  1KFS A;  3DLH A;  3DLK A;  4KHY A;  1KSP A;  3TAR A;  3DMJ A;  3DYA A;  3U6F A;  1NJZ A;  4KB1 A;  3UIQ A;  3RMC A;  4KO0 A;  3JSM A;  4KHW A;  4CHN A;  1ASV A;  4DTM A;  1LV5 A;  3VQ9 A;  1CZB A;  3HP6 A;  5CYQ A;  3LAN A;  1FXX A;  4BWM A;  3ZSX A;  1HNV A;  5JS2 A;  5KGX A;  4M3W A;  3K2P A;  5EU7 A;  5J2P A;  1A5V A;  1LWE A;  4FZX C;  4CGJ A;  1NK7 A;  1QSS A;  2YHB A;  2BGG A;  2HHT A;  1YTA A;  2HHX A;  3SQ0 A;  4I2Q A;  4B9U A;  3AO1 A;  4FW1 A;  5FRO A;  4CK3 A;  4OKE A;  4CJF A;  1EX4 A;  1KVB A;  4OJR A;  3VQC A;  3SV4 A;  4C8O A;  4HCC A;  1U4B A;  4EP4 A;  2Y1J A;  4PUO A;  1CLQ A;  3KD5 E;  1VSL A;  2DFH A;  3HXM A;  3NF8 A;  4B8A B;  1I39 A;  4DSI A;  2WOM A;  4ID1 A;  1WSF A;  4RW8 A;  5KGW A;  4CJV A;  2OPQ A;  4ELU A;  2IDO A;  1IKX A;  1C1A A;  1HNI A;  1J5O A;  1NK4 A;  3VQ8 A;  4IFV A;  4AIL C;  3DLB A;  4Z4F A;  1B92 A;  1RT5 A;  3A2F A;  3KKR A;  4KHN A;  2OPP A;  3TAQ A;  4CF9 A;  3SYZ A;  4ELT A;  1JXE A;  3L2V A;  4G1Q A;  3AVH A;  4OGC A;  4JRQ A;  2Z1J A;  4NCB A;  3HK2 A;  4KHU A;  3OYJ A;  2YKM A;  4CIG A;  1KVA A;  4DTJ A;  4FJ8 A;  2ATQ A;  4CCH A;  3OYE A;  3OS2 A;  1S1X A;  1JLF A;  1A5W A;  3ZCM A;  3ZSZ A;  4FLT A;  4KAZ A;  3M8S A;  2XY6 A;  3SQ2 A;  2KFN A;  1BIZ A;  1N6Q A;  1O1W A;  4CEO A;  3VQ7 A;  1B9D A;  4C8M A;  2G8F A;  3S3M A;  1LAV A;  4FXD A;  3O3G A;  1YTU A;  1Z25 A;  4GMJ B;  1NOZ A;  4R5P A;  3K5N A;  3DRP A;  1HYZ A;  4PA1 A;  4GVM A;  3LP2 A;  2E6L A;  3LZJ A;  3L3U A;  4N56 A;  4HUF A;  1D5A A;  3V6D A;  1U45 A;  1N5Y A;  1HJR A;  2E6M A;  2EHG A;  4FVM A;  3WNF A;  1L3V A;  4B9T A;  4OLA A;  2HHW A;  1ZBI A;  4DU1 A;  4F2S A;  4FLZ A;  4I2P A;  4CGI A;  4AHV A;  3AVB A;  5CY4 A;  1NJW A;  4W5R A;  4CIE A;  1YVU A;  1KCF A;  4DQI A;  4EZ6 A;  2DFE A;  2JGU A;  3V4I A;  4FJL A;  1B9F A;  1TKX A;  3RRH A;  2P5O A;  1XC9 A;  2X78 A;  4HUG A;  4CJS A;  4E3S A;  1QSL A;  1EKE A;  2YNH A;  1D9F A;  1TAQ A;  1UAX A;  3AVK A;  3NHG A;  2FBT A;  3QER A;  3KLG A;  4Z4E A;  4B9S A;  3OY9 A;  1K6Y A;  3DI6 A;  4WE1 A;  4CEF A;  1RBT A;  1W0H A;  3NGI A;  2VWJ A;  3F73 A;  2NUB A;  5J2M A;  3RMA A;  2HW3 A;  4HHT A;  3QES A;  1VSD A;  1RBV A;  4RW7 A;  1NKE A;  2F96 A;  1RCH A;  4LSN A;  4O55 A;  4KRF A;  1BIS A;  4CJL A;  1RBU A;  1BI4 A;  3NH1 A;  4DS4 A;  4DTO A;  3SZ2 A;  3OYI A;  3LAL A;  3DLR A;  4HCB A;  4M3Y A;  4ELV A;  1WAF A;  3TR8 A;  3RWU A;  4FJJ A;  4FJX A;  1WAJ A;  4CJR A;  1BL3 A;  2B5J A;  3SCX A;  5CZ1 A;  4DS5 A;  3RMB A;  2WON A;  2Y1I A;  3THV A;  4NCA A;  4PQU A;  2VG5 A;  5T7B A;  1NK0 A;  4CHZ A;  3V9X A;  1TK8 A;  1ASW A;  4FJH A;  4JS4 A;  2IGI A;  3DLE A;  4B8C A;  3KK3 A;  1SV5 A;  4GW6 A;  4OKK A;  3QO9 A;  4FLV A;  1L5U A;  3V81 A;  2P5G A;  1A5X A;  1U04 A;  3ZSO A;  4J2E A;  3V1O A;  3K57 A;  3ZT0 A;  3IG1 A;  4BAC A;  3VQB A;  3LWL A;  1Y97 A;  4OGE A;  4YNQ A;  1JL2 A;  3CFP A;  1VSK A;  3CFR A;  3LPT A;  4CF0 A;  3U3Y A;  4FLW A;  1BCM A;  4CFC A;  3NBP A;  3CQ8 A;  3OYN A;  2IAJ A;  1RBR A;  3ALY A;  4O4G A;  3AVA A;  1Q8I A;  4N47 A;  2GUI A;  1DTT A;  2B4J A;  2P51 A;  4C8L A;  3MEG A;  1IO2 A;  3VQ4 A;  2ZQB A;  3NCI A;  3MAQ A;  4F4K A;  3KLH A;  4LH5 A;  1HMV A;  2VWK A;  3NDK A;  1NK9 A;  1SL2 A;  3T19 A;  2G8U A;  4DU3 A;  1JL1 A;  2YKN A;  1XWL A;  4FM1 A;  4ID5 A;  1WSE A;  2P1J A;  1L3S A;  3V9W A;  4CEQ A;  4ZTJ A;  4FJ5 A;  1RTH A;  4DF4 A;  1TL1 A;  2KZZ A;  2RPI A;  4K8X A;  2HHQ A;  4DMN A;  4CJP A;  3G0Z A;  4K8Z A;  1X9M A;  3C95 A;  1RDA A;  3VQA A;  4W5Q A;  4CJ3 A;  5CYM A;  3AO5 A;  1WSI A;  5C24 A;  3K5M A;  3PV8 A;  1UA1 A;  4CGH A;  3KLE A;  3DOL A;  1J9A A;  3P83 D;  3VQQ A;  4CES A;  4NYN A;  2R7Y A;  3QEW A;  4N76 A;  4OLB A;  1U49 A;  1TV6 A;  1CZ9 A;  3NF9 A;  3LP0 A;  2Z1I A;  4QCL A;  1VRU A;  3L2R A;  3PX4 A;  2A1S A;  2D5R A;  3CG7 A;  3LP3 A;  4MFB A;  1ZBU A;  4BE0 A;  1LW2 A;  2OZS A;  4Z4C A;  4IG0 A;  4Z0U A;  3S3O A;  4ZTF A;  1HYS A;  1KRP A;  3SPZ A;  1F21 A;  4KI4 A;  3V1Q A;  3NGZ A;  4CF2 A;  5D3G A;  4PWD A;  2G8H A;  1SUQ A;  3VQP A;  2GV9 A;  3SUO A;  3L8B A;  3IAY A;  3L2Q A;  3ZSV A;  3OYB A;  4FLU A;  5I42 A;  1BGX T;  3KK2 A;  3NAE A;  3AA2 A;  2QXF A;  3QEX A;  1RT2 A;  1VSE A;  4CJK A;  4FJ7 A;  1CXQ A;  4CED A;  2OA8 A;  1L3T A;  3OYF A;  2HVH A;  4DLG A;  2XY8 A;  3AO4 A;  1KVC A;  4KI6 A;  5HLF A;  4LH4 A;  3HPH A;  1U48 A;  3HO1 A;  4BE2 A;  4FW2 A;  3ZT3 A;  3PO5 A;  4E0D A;  2KQ2 A;  1Q9X A;  4M42 A;  1XHZ A;  4KKO A;  3SUP A;  4TSX A;  3OYA A;  4M41 A;  1S1V A;  2OPS A;  3HJF A;  3ZT4 A;  3QEI A;  1YT3 A;  3AVG A;  4CF8 A;  3B6P A;  1EP4 A;  1KTQ A;  3LP1 A;  4RG8 A;  3T3F A;  1WSG A;  2ETJ A;  2Q3S A;  1NK8 A;  4J2B A;  4OPK A;  1U47 A;  1TVR A;  1UA0 A;  1VSJ A;  4LD0 A;  1QTM A;  5JS1 A;  1KLN A;  3O3F A;  2HMI A;  1IG9 A;  1FKO A;  1RTJ A;  2HB5 A;  3CFO A;  4Y1D A;  3D0P A;  3NH0 A;  1C1B A;  4DTX A;  1BCO A;  3VA3 A;  1XI1 A;  4DF8 A;  1TKT A;  1ASU A;  3EY1 A;  4DG1 A;  3OJS A;  3C94 A;  2IS3 A;  1HPZ A;  4CFA A;  3PO4 A;  4Z4I A;  3S9H A;  3OS0 A;  2YNI A;  3MEC A;  4KRE A;  4KHQ A;  1Z26 A;  3HVR A;  4QOZ B;  1RT1 A;  3C6U A;  1DTQ A;  4E7K A;  4FM2 A;  4IG3 A;  1S9E A;  2FBX A;  3OJU A;  3TAB A;  4FJI A;  4CJ5 A;  2KZM A;  4FJN A;  1C6V A;  2XRI A;  3RR8 A;  1VRT A;  3OYL A;  1G15 A;  1CXU A;  3QIP A;  1BIU A;  2XHB A;  3PY8 A;  4H4O A;  4FK4 A;  4CFD A;  3NFA A;  3PX6 A;  2X6S A;  3O3H A;  3TAE A;  1S1W A;  5HRS A;  4NCG A;  4FJK A;  1DLO A;  3M8R A;  1Q9Y A;  2KFZ A;  1JLE A;  1C0M A;  2G8W A;  2B6A A;  3RR7 A;  1X1P A;  3EZ5 A;  3QLH A;  3TAM A;  4W5O A;  1SKW A;  5HRP A;  1J54 A;  3C6T A;  1VSI A;  1RIL A;  4DLE A;  4FJG A;  4JLH A;  3NE6 A;  2AJQ A;  4CGF A;  2O4I A;  2YHA A;  4CEA A;  4LSL A;  4FCY A;  3SUQ A;  4CJ4 A;  4DTR A;  1RTD A;  3OVN A;  5CZ2 A;  3CM5 A;  2KW4 A;  2ZE2 A;  5SWM A;  4FLY A;  3AA5 X;  2XY7 A;  1RT3 A;  1S1T A;  4AHT A;  5E41 A;  1HQE A;  3OYD A;  1NJX A;  2FBY A;  3H08 A;  1GOC A;  1GOA A;  2BAN A;  4EZ9 A;  4FJM A;  3HL8 A;  1QE1 A;  1QHT A;  3ITH A;  1IKY A;  4N5S A;  3TAN A;  5HRR A;  4I9L A;  3BDP A;  4DQR A;  1C0U A;  4JS5 A;  5K14 A;  3V9S A;  4PY5 A;  1FK9 A;  3ZSQ A;  4CEB A;  3HM9 A;  4DFP A;  3QET A;  4FK0 A;  4OVL A;  4OKJ A;  3VQD A;  3M8Q A;  2HVI A;  4BDP A;  1S6P A;  1IKW A;  3U3G A;  3ZSW A;  3L2U A;  1LWC A;  2HNZ A;  1BI4 B;  1ZBF A;  1RT6 A;  2G8I A;  2HHV A;  4XIU A;  4FZZ A;  1RBS A;  3V9U A;  3AVN A;  2YNF A;  4DTP A;  5HBM A;  1HRH A;  3WNH A;  3L2W A;  4E7J A;  3KIO A;  1LW0 A;  4EP5 A;  1NK5 A;  2D0C A;  4H4M A;  4CEE A;  3SJJ A;  3NF7 A;  5I3U A;  4DSE A;  3TI0 A;  4MQ3 A;  3O4Q A;  3VA0 A;  2W42 A;  4CJQ A;  1S5J A;  1I3A A;  1ZYQ A;  2RKI A;  4HVJ A;  2XY5 A;  1S9G A;  2I5J A;  3IRX A;  2HND A;  3NGY A;  1NK6 A;  1VSF A;  1WLJ A;  4J2A A;  3I8D A;  2GBZ A;  2D0A A;  4M3R A;  5HRO A;  2YNG A;  2DY4 A;  3TAP A;  4I9Q A;  3ISN C;  4BWJ A;  4CJE A;  1T7P A;  4BDY A;  1QS4 A;  1VK0 A;  2X74 A;  3HP9 A;  4B9M A;  4O0I A;  3AO2 A;  3P1G A;  4M45 A;  5KRS A;  4E1N A;  1SL0 A;  2HHU A;  4CK2 A;  3D45 A;  3DRS A;  3LAK A;  3LAM A;  4IBN A;  3MED A;  3VQ6 A;  1QQC A;  5J2N A;  2LSN A;  1JLC A;  1UWB A;  3HVT A;  4E7I A;  4B9N A;  4M3T A;  4RW4 A;  3ZSR A;  2F8S A;  1RDC A;  1J53 A;  3I0S A;  4CGG A;  1NJY A;  1T05 A;  4DQQ A;  5J2Q A;  3ZT2 A;  4KTW A;  3MEE A;  5DMR A;  4AHU A;  3NF6 A;  3HPO A;  3KKS A;  4FLX A;  4DQS A;  5KI6 A;  3SPY A;  4CE9 A;  3AVI A;  4E89 A;  3RTV A;  4OPJ A;  1HYV A;  3T1A A;  2KTQ A;  3K58 A;  1QSY A;  1C0T A;  3CYM A;  3CM6 A;  1L3U A;  3LWM A;  1T8E A;  2FC0 A;  1JXB A;  3QNO A;  3P5J A;  3JYT A;  1WNS A;  2Z1H A;  3AO3 A;  3QNN A;  1S6Q A;  4IFY A;  4M3U A;  5DK5 A;  4DFK A;  1R0A A;  4DSJ A;  4FK2 A;  4UQG A;  1TKD A;  3AA3 A;  1SKS A;  3RRG A;  4H8K A;  2DFF A;  4KTQ A;  4BDZ A;  1GOB A;  3LZI A;  4FJ9 A;  3VQE A;  5J1E A;  3KLF A;  3SQ1 A;  1C1C A;  1VSH A;  1NOY A;  2E4L A;  2ZD1 A;  5KRT A;  1REV A;  4FZY A;  4W5N A;  3G10 A;  1TKZ A;  3AVF A;  2RN2 A;  1WSH A;  4KHS A;  4DSK A;  4E7L A;  3TAF A;  3OYK A;  1NKB A;  1TAU A;  4DSF A;  3PUF A;  1RDD A;  3KK1 A;  1FKP A;  3QIO A;  4Y1C A;  3VN5 A;  4CHQ A;  3OS1 A;  3EYZ A;  3ULD A;  1WN7 A;  3DOK A;  1BQN A;  3AV9 A;  3AVL A;  1NKC A;  4IDK A;  4KFB A;  4Z4G A;  1RDB A;  3NH2 A;  4QAG A;  2XO7 A;  2PY5 A;  1RNH A;  2FBV A;  2YV0 X;  3QEV A;  2QK9 A;  3V1R A;  3OYH A;  3HPG A;  3IS9 A;  4DU4 A; 
#chains in the Genus database with same CATH topology
 4IXC A;  4NB4 A;  4I7F A;  4IEE A;  1VHX A;  2AP1 A;  4CGD A;  4PL7 A;  1EET A;  4AH9 A;  3N4P A;  4LY7 A;  2W41 A;  3DLG A;  3T69 A;  3CI5 A;  4DWI A;  3LDN A;  1JLA A;  1S1U A;  5AFU A;  2I7P A;  5ELZ A;  2QKB A;  1WSJ A;  3O4N A;  4Q5V A;  2VG7 A;  1HNW K;  2P9K B;  4C8K A;  3K5L A;  5AR0 A;  4DQP A;  4E1M A;  3AVJ A;  4IOX A;  1KAY A;  2OPR A;  4ILH A;  3WNE A;  1TGO A;  3FZL A;  2HBL A;  4DFM A;  3HYF A;  4DFJ A;  4CJW A;  4KV8 A;  4BR2 A;  2AA4 A;  3K59 A;  3MXM A;  1TL3 A;  1YUW A;  1QQO A;  4DTS A;  4K0K K;  4MDB A;  3E9O A;  2OTL N;  4O5B A;  1P8Z A;  5BPM A;  3DXK A;  4W5T A;  4CFB A;  4CJT A;  4CHP A;  2F8T A;  4JKG A;  1S22 A;  3LM2 A;  3RMD A;  2FXU A;  3R3L A;  4IZ9 A;  3TWH A;  3ID6 A;  4BRD A;  2OZM A;  4DTN A;  4B9V A;  3CF5 L;  2P9S A;  1KD1 O;  1V4T A;  2QKK A;  1JLB A;  2D0B A;  2HF4 A;  2BDP A;  4CEZ A;  5BPL A;  3CHW A;  3ZSY A;  3O08 A;  2O8B A;  1J6Z A;  4LF9 K;  4JI7 K;  2UYT A;  5TKY A;  3DYA A;  3QML A;  3U6F A;  1NJZ A;  4KB1 A;  3UIQ A;  3IMX A;  4CHN A;  4DTM A;  5CYQ A;  4M3W A;  1HNV A;  3CCJ N;  4FZX C;  3MCA B;  4X66 K;  1YTA A;  5LL6 Z;  4B3R K;  4FW1 A;  1KVB A;  4HCC A;  4O8K A;  4EP4 A;  1CLQ A;  1N36 K;  2O8E B;  1SAZ A;  2DFH A;  4CZJ A;  1NMN A;  5FPN A;  2IDO A;  3VQ8 A;  4IFV A;  3QIC A;  1ZXO A;  2OPP A;  1JXE A;  4G1Q A;  4OGC A;  1HUX A;  3HK2 A;  2QEX N;  4JKA A;  5BN8 A;  3ID8 A;  3OYE A;  1NGH A;  4FLT A;  1A5W A;  3SQ2 A;  4CEO A;  3VF4 A;  4C8M A;  3CCR N;  1SS6 A;  3O3G A;  3I55 N;  1NOZ A;  4R5P A;  3QFP A;  1NGI A;  3LP2 A;  3L3U A;  4N56 A;  2EHG A;  4OLA A;  1YJW N;  4FL9 A;  1VQN N;  4LFC K;  4I2P A;  3KK7 A;  5FPD A;  1ILY A;  1NJW A;  4EZ6 A;  1KCF A;  2D0P A;  2DFE A;  2JGU A;  3RRH A;  1XC9 A;  2X78 A;  2KLA A;  1EQY A;  3F5T A;  3SAF A;  1KAZ A;  1RGI A;  1TAQ A;  2PFU A;  1UAX A;  3KLG A;  4BQL A;  3TSQ A;  3OY9 A;  1K6Y A;  4WE1 A;  1RBT A;  1W0H A;  3AAQ A;  3NGI A;  2VWJ A;  3RMA A;  2HW3 A;  3QES A;  1JCE A;  1VSD A;  4RW7 A;  1NKE A;  4LSN A;  1BIS A;  2A42 A;  5BPN A;  1BI4 A;  4CW7 B;  4DTO A;  3CCQ N;  4M3Y A;  1FJG K;  1WAJ A;  2B5J A;  5CZ1 A;  2VG5 A;  3OBY A;  4JS4 A;  1SV5 A;  4IJA A;  1NGA A;  4J2E A;  2E8A A;  1A5X A;  2VGN A;  3ZSO A;  3QFU A;  3IG1 A;  2CH5 A;  4OGE A;  1VQ7 N;  3I56 N;  4WQ4 A;  4BVP A;  3CFR A;  4CF0 A;  3E1Y A;  1BDG A;  4AQY K;  3CQ8 A;  2QWL A;  3EE8 A;  3AVA A;  5TKW A;  2B4J A;  4KBO A;  3WXL A;  4AF1 A;  5JIC A;  4F4K A;  2QWP A;  1HMV A;  4DU3 A;  1JL1 A;  2YI1 A;  3SBG A;  4ZTJ A;  1ATS A;  4FJ5 A;  1TYQ B;  3TU5 A;  1RDA A;  3VQA A;  4FWR A;  3K5M A;  3AO5 A;  1WSI A;  2E1Z A;  3D2E A;  3GL1 A;  3EN9 A;  4CES A;  3OA9 A;  1U49 A;  1CZ9 A;  3LP0 A;  1VRU A;  2E2N A;  3L2R A;  4FSV A;  4MFB A;  3VTI A;  3S3O A;  1KRP A;  1F21 A;  5M1P A;  3VMF B;  4PWD A;  4H0T B;  2G8H A;  1SUQ A;  3L2Q A;  2O8D A;  3THX B;  3NAE A;  1T6D A;  2V52 B;  4CJK A;  1CXQ A;  4CED A;  2OA8 A;  1L3T A;  5KPR A;  4H0P A;  5C15 A;  4NXN K;  2ZJQ L;  4KI6 A;  5HLF A;  3HPH A;  4K42 A;  1U48 A;  4CZG A;  1XHZ A;  4CZF A;  5C12 A;  2A40 A;  3C6A A;  4DUZ K;  4I6M B;  5M1Q A;  4CF8 A;  3B6P A;  1BA1 A;  1EP4 A;  4RG8 A;  1NK8 A;  2E2O A;  1NLV A;  1J5E K;  1TVR A;  5E26 A;  1UA0 A;  1VSJ A;  4BRH A;  1IBK K;  2EWS A;  1QTM A;  2V7Z A;  2HMI A;  1IG9 A;  1FKO A;  3CCE N;  3D0P A;  3ULE B;  3NH0 A;  4DTX A;  2P9K A;  1TKT A;  2O8F B;  3WUH A;  3VEW A;  3PO4 A;  4KHQ A;  3C6U A;  4FM2 A;  4DR7 K;  3FFK B;  3CET A;  4IG3 A;  4FJI A;  4CJ5 A;  3LDP A;  2XRI A;  1P90 A;  1RDW X;  1OKJ A;  2YJE A;  4FWK A;  2E2P A;  2YCH A;  3CCV N;  1I94 K;  3QLH A;  4W5O A;  3VET A;  1RIL A;  4JAX A;  4FJG A;  4LF8 K;  2AJQ A;  4QS9 A;  3M3Z A;  1RTD A;  1JCG A;  1GLB G;  2KW4 A;  4CZM A;  1WBB A;  3AA5 X;  2XY7 A;  1RT3 A;  2BAN A;  2YHW A;  3HL8 A;  3ITH A;  4JI2 K;  4N5S A;  4DV1 K;  4FWN A;  4JS5 A;  4CEB A;  2W6K A;  3HM9 A;  3THW B;  1IKW A;  2F4V K;  3PIO L;  2ZGY A;  4FWQ A;  1RT6 A;  2YNF A;  5ADX A;  1HRH A;  3L2W A;  3G4S N;  1NK5 A;  3J7Z O;  2D0C A;  4H4M A;  4NXM K;  3TI0 A;  3VA0 A;  1KQS M;  2E88 A;  1S5J A;  3QDK A;  1ZYQ A;  5AQY A;  4HVJ A;  2O8E A;  5AFU H;  1VSF A;  2CGK A;  1C0G A;  3TAP A;  2P9P B;  1BUP A;  1VK0 A;  4O0I A;  3AO2 A;  4CD3 A;  2WFB A;  5KRS A;  2GWJ A;  1NMD A;  1BWF O;  4IBN A;  3MED A;  1UWB A;  3HVT A;  1HLU A;  4RW4 A;  2F8S A;  5J2Q A;  4AHU A;  4DQS A;  1K8A O;  3RTV A;  3TTC A;  5CR4 A;  1QSY A;  1NJI O;  1L3U A;  1QVG M;  4DR5 K;  3QBW A;  4B1Z A;  2ASO A;  3CJ1 A;  3O5B A;  3P5J A;  2WTU A;  4M3U A;  4RTF D;  4FK2 A;  3ZET B;  1TKD A;  1X3N A;  4IJN A;  3PIP L;  4IFE A;  4FJ9 A;  1MWK A;  1HR0 K;  1NGJ A;  5GIN A;  1C1C A;  1VSH A;  2ZD1 A;  5EVZ A;  3VOV A;  3VEZ A;  1WSH A;  2QTD A;  4KHS A;  4DSK A;  4EAH D;  1RDD A;  1GLC G;  3IUC A;  5FPM A;  3HZ6 A;  3QIO A;  4M7X A;  2GWK A;  5HL7 L;  4JI4 K;  3FR0 A;  4A59 A;  3AVL A;  3THY B;  4IDK A;  1IBM K;  1RDB A;  2PY5 A;  3L4Q A;  3CCS N;  4H5V A;  3IS9 A;  3TTD A;  4DU4 A;  2H3G X;  1IG8 A;  1BHL A;  3KWI A;  5C42 A;  5AJ3 K;  2W40 A;  1RFQ A;  1RT4 A;  3LPU A;  3E01 A;  1KFD A;  3MXJ A;  3T1H K;  4JYA K;  4U67 L;  3DRR A;  3U8X A;  4G9Z A;  1ZBS A;  3FFI A;  1EO1 A;  5FDL A;  2IOC A;  1SKR A;  1JKH A;  1Q86 O;  3B6O A;  3KJV A;  1LWF A;  1OVY A;  1XMQ K;  4B3M K;  1VQL N;  4HWI A;  3P4I A;  3SI6 A;  1XNQ K;  3EL2 A;  3EEQ A;  4F3O A;  5FRM A;  3V9Z A;  2W6L A;  4CHO A;  1RDU A;  1Q7Y O;  4N41 A;  4JKC A;  4BVO A;  4YFU A;  1TYQ A;  2A1R A;  4FM0 A;  4C8N A;  3ZT1 A;  3SV3 A;  3CXC M;  5C0Y A;  4AHR A;  4E7H A;  3MN6 A;  1ZBH A;  4FOI A;  4O0J A;  1LAW A;  5SZT A;  5M1F A;  2Q1N A;  4AHS A;  1ESV A;  3OYC A;  1VSM A;  3SUN A;  4RW6 A;  3CMA N;  3O9U A;  3KD1 E;  1IH7 A;  2EX3 A;  3UE5 A;  4CHY A;  4O44 A;  5C25 A;  4KB0 A;  1SL1 A;  2ITG A;  3AA4 A;  4HTU A;  1X9W A;  1JLQ A;  4DCH A;  3VER A;  3THX A;  4IKF A;  1XHX A;  3K5O A;  4CJU A;  3DLK A;  4KHY A;  2KKZ A;  3TAR A;  3DMJ A;  1HKG A;  4YY3 K;  3RMC A;  1HJO A;  3C0B A;  4BWM A;  1FXX A;  5JS2 A;  5EU7 A;  5J2P A;  1LWE A;  1S3X A;  1X3M A;  4CGJ A;  4I6M A;  1QSS A;  2YHB A;  3UKU B;  3SQ0 A;  4I2Q A;  5FRO A;  1EX4 A;  4K41 A;  2NNW A;  1XNR K;  3NF8 A;  5BRH A;  4ID1 A;  1WSF A;  4RW8 A;  5KGW A;  1HNI A;  5KQ8 A;  2YX6 A;  4AIL C;  3DLB A;  4YDU C;  3ULE A;  3Q7C A;  2NRX A;  4XH1 A;  3TAQ A;  3SYZ A;  2CH6 A;  3L6Q A;  2O8F A;  2UUA K;  2Z1J A;  4CIG A;  5JVH L;  4A2B A;  1XQS C;  3HTV A;  2GEM A;  1S1X A;  3ZSZ A;  4GKJ K;  4IOC L;  1B9D A;  2FSK A;  4GY2 B;  1LAV A;  4FXD A;  4CBU A;  1VAZ A;  4BRA A;  1HYZ A;  4PA1 A;  4B3T K;  2E6L A;  4FVM A;  3WNF A;  2HHW A;  4DU1 A;  4F2S A;  5AQN A;  4AHV A;  3AVB A;  4OPH A;  1YVU A;  4CZE A;  3V4I A;  3CPE A;  1B9F A;  4FJL A;  1TKX A;  3MN9 A;  3VES A;  4CJS A;  1EWQ A;  4E3S A;  3BZC A;  4MO5 A;  1YVN A;  3CME N;  4Z4E A;  2JWK A;  3DI6 A;  3D2F B;  5AQJ A;  2I7N A;  3F73 A;  5J2M A;  1EWR A;  4B9Q A;  4HTL A;  3THW A;  4WFN L;  1NM1 A;  4ISE A;  2ASP A;  1VQ6 N;  4DS4 A;  3SZ2 A;  3OYI A;  3LAL A;  4M63 C;  3R9P A;  4ELV A;  4FJJ A;  1NGB A;  4K25 A;  2QWN A;  5AQZ A;  4FJX A;  3GDQ A;  4QS7 A;  3THV A;  2WON A;  2Y1I A;  1TK8 A;  2IGI A;  4B8C A;  4GW6 A;  4OKK A;  3MN7 A;  4WQ5 A;  1U04 A;  1JCF A;  2HBJ A;  3BF3 A;  3K57 A;  2OAN A;  4BAC A;  4YOR A;  4YNQ A;  1VQ9 N;  5AQX A;  1VSK A;  4O5F A;  4WCE L;  3LPT A;  1BCM A;  1NU0 A;  2P9P A;  4JI6 K;  3OYN A;  1RBR A;  4C8L A;  1IO2 A;  4AM7 A;  5EY4 A;  3NCI A;  3MAQ A;  2VWK A;  3NDK A;  2G8U A;  1XWL A;  1N8R O;  1WSE A;  3V9W A;  4CEQ A;  1OVQ A;  1RTH A;  3CJC A;  2KZZ A;  4DMN A;  3G0Z A;  5BRF A;  3R1X A;  3CCL N;  3SBT A;  1GLE G;  5C24 A;  5A2Q O;  3SAG A;  3LDO A;  3DOL A;  4DR2 K;  3TTF A;  3VQQ A;  2ZF5 O;  4H03 B;  3P83 D;  1DGK N;  1NGE A;  1M1K O;  1TV6 A;  3OTO K;  2HBM A;  3D7E O;  3ZET A;  4GV9 A;  2UXB K;  4OO1 J;  3PX4 A;  2A1S A;  3LP3 A;  4BE0 A;  4Z4C A;  3CC4 N;  1HKC A;  4DV5 K;  3TPQ A;  3FZM A;  1BOT O;  3DLL L;  5LY3 A;  3NGZ A;  2YHY A;  3IAY A;  3E9L A;  4M7Y A;  5I42 A;  2RHK A;  3KK2 A;  3QEX A;  4FJ7 A;  1BO5 O;  3VEV A;  3OYF A;  3THY A;  2HVH A;  2XY8 A;  2HST A;  5IT9 O;  5ADX H;  2FSN A;  4KKO A;  3CC7 N;  4TSX A;  3OYA A;  1S1V A;  2OPS A;  5AQW A;  3HJF A;  4V19 S;  2KHO A;  1OH6 A;  2RE2 A;  5AQV A;  1KTQ A;  5E84 A;  3C65 A;  3LP1 A;  5C10 A;  3T3F A;  1NWK A;  3SAH A;  4BQZ A;  3J8A A;  2HHH K;  1KLN A;  3BUZ B;  3M6G A;  1RTJ A;  2HB5 A;  3VEN A;  4B1W B;  1Q18 A;  3CFO A;  4Y1D A;  2P9U B;  3FZF A;  1BCO A;  4EHT A;  4PL8 A;  4DF8 A;  2A3Z A;  3T1Y K;  3C7N B;  4EHU A;  4BRC A;  4WYB A;  1MDU B;  3EY1 A;  1TUY A;  3FZH A;  5JMV A;  3P38 A;  4QOZ B;  4AM6 A;  4BRP A;  1DTQ A;  2VQE K;  3TAB A;  3OJU A;  4BRQ A;  2KZM A;  4FJN A;  1C6V A;  2OTJ N;  3DJC A;  4JI0 K;  1VRT A;  3QIP A;  2XHB A;  2HBK A;  1OH5 A;  4H4O A;  3PY8 A;  4CFD A;  3WEE B;  2X6S A;  3O3H A;  4IO9 L;  4NCG A;  1O13 A;  1Q9Y A;  2KFZ A;  2G8W A;  3H3N O;  2UXD K;  1J54 A;  3C6T A;  3NE6 A;  3O9T A;  3IDH A;  4L3Q A;  2VGM A;  2ZM6 K;  1TUU A;  4CGF A;  2O4I A;  2YHA A;  3K9K A;  3OVN A;  2NRZ A;  1IJJ A;  1KXP A;  1YJN N;  4AHT A;  2FBY A;  1QE1 A;  5HRR A;  3BDP A;  4YOT A;  2QWR A;  2D1K A;  5K14 A;  3V9S A;  1W97 L;  1XUP O;  4BY9 C;  2HVI A;  5FPE A;  1LWC A;  4KHP K;  4FZZ A;  3V9U A;  4JD2 B;  4DTP A;  2JWL A;  3WNH A;  3H46 O;  1YHQ N;  2HF3 A;  3NF7 A;  5I3U A;  3UKU A;  2QM1 A;  4FO0 A;  1Z6R A;  1E4F T;  1S9G A;  1T6C A;  2GBZ A;  2D0A A;  5BRE A;  2DY4 A;  2O8C B;  4B1X B;  4I9Q A;  3ISN C;  4BWJ A;  4BRG A;  1QS4 A;  4BDY A;  4M45 A;  2Q2R A;  1Y64 A;  5FLX O;  5J2N A;  4JHD B;  4A61 A;  4E7I A;  4B9N A;  1RDC A;  4BC3 A;  4KTW A;  3MEE A;  3NF6 A;  4RCH A;  2NRR A;  3SPY A;  4JNE A;  3AVI A;  3AY9 A;  4B1Y B;  3U9D A;  1HYV A;  3T1A A;  3CYM A;  3U9Z A;  2FC0 A;  3KVG A;  2E5L K;  4E1J A;  1S6Q A;  4IFY A;  5DK5 A;  4DFK A;  1R0A A;  4DSJ A;  4UQG A;  3AA3 A;  3TSP A;  5DM7 L;  1SKS A;  3RRG A;  2DFF A;  4BDZ A;  3LZI A;  4DHY A;  5J1E A;  3SQ1 A;  1NOY A;  2BUP A;  1NBW A;  2RN2 A;  4H5T A;  4NO7 A;  4X64 K;  4RWT A;  4IOA L;  4DV0 K;  3UKR B;  1TAU A;  3OYK A;  4FOE A;  3PUF A;  3KZB A;  3NMU A;  3VF2 A;  3DXM B;  3ZX3 A;  3LDL A;  3D2F A;  3EYZ A;  3ULD A;  3DOK A;  3AV9 A;  4KFB A;  3VEO A;  4Z4G A;  3NH2 A;  1D4X A;  3QEV A;  2QK9 A;  3V1R A;  3OYH A;  5GAE P;  3TAG A;  4CIF A;  2HHS A;  3DM2 A;  4CK1 A;  4DSL A;  2G8K A;  1YIJ N;  4KPY A;  1K9M O;  3JS6 A;  5AZI B;  1IKV A;  1TK5 A;  4Q0B A;  5F2R A;  2G8V A;  4BE1 A;  4B08 A;  4F2R A;  3QIN A;  2NLX A;  4CI6 A;  5M1N A;  2ZJR L;  3OYM A;  1KLM A;  4F9O A;  1D8Y A;  3L3V A;  4BRM A;  3P39 A;  4H0V B;  3HRG A;  3WXM B;  4DKW A;  1VQP N;  2D0O A;  4DB3 A;  5DM6 L;  2J4R A;  4CD1 A;  3VGM A;  2HMP A;  2PYL A;  3S3N A;  1HNX K;  1QZ6 A;  4ICL A;  2FF3 B;  1RTI A;  4RW9 A;  4FYD A;  3D6R A;  3U4L A;  3AVC A;  3OYG A;  2YJF A;  3A5M C;  3AVM A;  2BE2 A;  3MXI A;  3LL3 A;  3M5R A;  3WXK A;  4M3Z A;  4JRP A;  1MU2 A;  2PZS A;  4F3T A;  4DTU A;  3O80 A;  1TK0 A;  1W9H A;  1QQM A;  2RF2 A;  3MN5 A;  2V51 B;  3GE1 A;  3HT3 A;  3WT0 A;  1X9S A;  5FRN A;  1BQM A;  3P31 A;  3VGL A;  2DPN A;  4LC9 B;  4U7B A;  3JSM A;  1LV5 A;  3VQ9 A;  3VEY A;  3ZSX A;  3J80 O;  1XMO K;  1E3M A;  3K2P A;  2GTD A;  3EE9 A;  3AGK A;  1A5V A;  5CE3 A;  4WFA L;  4H0Y B;  3W0L A;  5JLH A;  2HHT A;  4GV3 A;  4DR1 K;  4B9U A;  3AO1 A;  1M90 O;  4CK3 A;  3PSF A;  4OKE A;  4CJF A;  1Z05 A;  4C8O A;  3VQC A;  2Q0U A;  1U4B A;  2Y1J A;  4FVU A;  1VSL A;  2VYP A;  3HXM A;  3W3D A;  4CJV A;  4ELU A;  1IKX A;  1C1A A;  1J5O A;  1NK4 A;  4Z4F A;  4O8U A;  3KKR A;  2P9U A;  3A2F A;  4FPB A;  4H5N A;  1Q82 O;  4BGB A;  1KC8 O;  3C7N A;  5M1O A;  2WUS A;  4JRQ A;  4NCB A;  3BZK A;  4KHU A;  3OYJ A;  2YKM A;  4FJ8 A;  2ATQ A;  4CCH A;  3ZCM A;  4BRK A;  3M8S A;  1BIZ A;  1O1W A;  1YTU A;  4MLE A;  4GMJ B;  3K5N A;  3BF1 A;  3WXI A;  3H45 C;  3LZJ A;  1YAG A;  3WEE A;  3J81 O;  1D5A A;  3QBX A;  1U45 A;  1HJR A;  2E6M A;  4B9T A;  4FLZ A;  3FGU A;  5AZJ B;  3WQT A;  4EIA A;  4LFB K;  4FWP A;  4DV2 K;  1W2B M;  3L4I A;  2QW9 A;  1QSL A;  2YNH A;  3AVK A;  3NHG A;  4B9S A;  4WQ4 C;  1NGF A;  4HHT A;  4PKI A;  1RBV A;  2D4W A;  2F96 A;  4CJL A;  1RBU A;  5AQM A;  4DR4 K;  3DLR A;  4JD2 A;  2ZGZ A;  3TR8 A;  4CJR A;  4H5W A;  4DV3 K;  4LFA K;  4BR5 A;  1BL3 A;  3SCX A;  4NCA A;  2BTF A;  4PQU A;  5T7B A;  4CHZ A;  3O9R A;  3DLE A;  4FLV A;  3KK3 A;  1L5U A;  3QO9 A;  2HHX A;  3V81 A;  3V1O A;  3ZT0 A;  3VQB A;  4JN4 A;  3LWL A;  4YOX A;  4DQ8 A;  1DKG D;  2O8C A;  4FLW A;  1BA0 A;  4CFC A;  3NBP A;  3CQX A;  2F9T A;  2IAJ A;  3PSI A;  4O4G A;  2WC9 A;  2GUI A;  1DTT A;  3ENH A;  3MEG A;  1R59 O;  3VQ4 A;  2UUB K;  3KWG A;  4LH5 A;  4A2A A;  4JHD A;  1NK9 A;  3T19 A;  1L3S A;  2P1J A;  4DF4 A;  1TL1 A;  2RPI A;  5AQP A;  4CJP A;  3C95 A;  3AAP A;  3PV8 A;  1OH7 A;  4ILG B;  3KLE A;  2QXL A;  1J9A A;  3CJ9 A;  4NYN A;  3QEW A;  1H1V A;  3TSU A;  3NF9 A;  3CCM N;  2Z1I A;  1QVF M;  2D5R A;  1ZBU A;  1OH8 A;  4IG0 A;  4Z0U A;  4DV6 K;  4ZTF A;  4PKG A;  4BC5 A;  1HYS A;  3SPZ A;  5C2F A;  5D3G A;  4CF2 A;  4ILJ A;  3VQP A;  2GV9 A;  3SUO A;  4LF4 K;  3UKR A;  3ZSV A;  3OYB A;  2NRH A;  2FLO A;  3ATU A;  1BGX T;  3DXM A;  3AA2 A;  1RT2 A;  1YI2 N;  5AQH A;  1GLD G;  4LF5 K;  4DLG A;  3KHY A;  3AO4 A;  3MMV A;  4FW2 A;  3ZT3 A;  3PO5 A;  2KQ2 A;  4BRE A;  5B8H A;  3SUP A;  2V7Y A;  4CJ7 A;  4M41 A;  1VQO N;  2QWQ A;  3ZT4 A;  4BR4 A;  5AQF A;  3AVG A;  3ENB A;  5AZI A;  1N32 K;  4JKH A;  1WSG A;  2Q3S A;  4J2B A;  1U47 A;  3J7Y P;  3FE1 A;  3MX2 A;  4LD0 A;  3K9J A;  3CER A;  3E66 A;  1C1B A;  4YOU A;  3G25 A;  5BR9 A;  1HNZ K;  4OX9 K;  1ASU A;  4DG1 A;  3C94 A;  2IS3 A;  2NRV A;  3S9H A;  2YNI A;  4KRE A;  2GUP A;  5HOO A;  4BG8 A;  1RT1 A;  4Y0W A;  4JK8 A;  3I8B A;  1HPM A;  2FBX A;  3ATV A;  1WOQ A;  3RR8 A;  1VQ5 N;  4OPA A;  1CXU A;  1BIU A;  4JKD A;  3NFA A;  3MX5 A;  3PX6 A;  2VQF K;  3TAE A;  4FJK A;  3M8R A;  1SQK A;  3H1Q A;  1VQM N;  1C0M A;  4PKH A;  3RR7 A;  1X1P A;  3TAM A;  1K8K A;  4BRN A;  4CEA A;  3SUQ A;  2ZJP L;  4CJ4 A;  2IVO A;  4YOW A;  3A5L C;  2ZE2 A;  5SWM A;  2QWO A;  1S1T A;  4BRL A;  4FJM A;  1QHT A;  1IKY A;  4I9L A;  4IO8 A;  5KQD A;  4DQR A;  3SJH A;  5GIP A;  4JI1 K;  4PY5 A;  4WFB L;  5AQG A;  4FK0 A;  4DFP A;  3NVK A;  4OVL A;  3VQD A;  3M8Q A;  3U3G A;  1HX1 A;  2HNZ A;  1E4G T;  1ZBF A;  2G8I A;  4XIU A;  3AVN A;  1NNE A;  3OHR A;  2E1Y A;  4E7J A;  4EP5 A;  4CEE A;  4DR6 K;  4DSE A;  3O4Q A;  4BRO A;  3CCU N;  3VGK A;  2W42 A;  2UU9 K;  4CJQ A;  2XY5 A;  2I5J A;  1NK6 A;  2HND A;  4GVE A;  3I8D A;  2YNG A;  4ISF A;  1T44 A;  1GLF O;  1T7P A;  2NRW A;  4B9M A;  3S41 A;  4JI5 K;  4KH5 A;  5I9E B;  1WBD A;  5BRD A;  1SL0 A;  2HHU A;  1K73 O;  1QQC A;  2LSN A;  3BY5 A;  4M3T A;  4CBX A;  1XC3 A;  3ZSR A;  1J53 A;  1T05 A;  3ZT2 A;  5DMR A;  5KI6 A;  5GAD P;  2F7T A;  4E89 A;  4B3S K;  3L0Q A;  4MO4 A;  3LWM A;  1T8E A;  1JXB A;  3JYT A;  1VQ8 N;  2Z1H A;  4JKB A;  3AO3 A;  1Q81 O;  5EXW A;  3QNN A;  3O6W A;  2FF6 A;  5AZJ A;  1DEJ A;  4H5R A;  4K43 A;  5AQR A;  3HM8 A;  3KLF A;  1SZ2 A;  2E4L A;  5IWA K;  3H3O B;  5JLF A;  3JXU A;  3CPW M;  4FZY A;  1HKB A;  1TKZ A;  3G10 A;  4KH4 A;  3EO3 A;  3RSE B;  3ENO A;  2GEL A;  4E7L A;  3TAF A;  1NKB A;  4DSF A;  5LJV A;  1FKP A;  4Y1C A;  1IV0 A;  4CHQ A;  1WN7 A;  4C1N K;  1BQN A;  1GLA G;  3SMP A;  2YHX A;  1BG3 A;  3EZW A;  1RNH A;  2FBV A;  3HPG A;  3N4Q A;  2JLE A;  2QA4 N;  3LDS A;  1YXQ A;  5M1K A;  3HST B;  3HI0 A;  1HQU A;  3O4W A;  4IEI A;  2Z1G A;  1UOC A;  2HOE A;  3GG4 A;  4CF1 A;  1T03 A;  3LDQ A;  3VPZ A;  3PX0 A;  5HP1 A;  2VWB A;  3VTH A;  2X6N A;  2CGL A;  2VG6 A;  5HRN A;  5LMN K;  2O4G A;  3M8P A;  4NLC A;  3SQ4 A;  2IC3 A;  2PYJ A;  2HNY A;  4AHC A;  3F9K A;  2Q97 A;  4CVN E;  3SNN A;  1ITG A;  1JJ2 M;  3DWL A;  1JLG A;  3WNG A;  2DTU A;  1D9D A;  3J7A P;  3ASM A;  4A5A A;  4QS8 A;  1ZBL A;  3KTQ A;  4J2D A;  2P9I B;  3FZK A;  4B9L A;  4CER A;  2UUC K;  1FW6 A;  3VQ5 A;  1EXQ A;  4B3O A;  1YF5 L;  1ATR A;  4ZHR A;  4M3X A;  2P9L B;  3IFR A;  3MWT A;  3QEP A;  4FWM A;  4Z4H A;  4NYF A;  3I0R A;  3KLI A;  1V4S A;  5BN9 A;  2OYQ A;  4L8R B;  4CEC A;  3WQU A;  1RT7 A;  3BGR A;  1CZA N;  4KTZ A;  5GIO A;  3O1B A;  4HUE A;  4JKE A;  5MLC Q;  4BR9 A;  5AQT A;  4F8R A;  2PAV A;  4BRF A;  5KTQ A;  1U2V B;  4E19 A;  4MLH A;  1KFS A;  3DLH A;  3H1V X;  1KSP A;  4FPA A;  3HOS A;  3G6E N;  3AGR A;  2QI2 A;  3VEX A;  1N33 K;  4KO0 A;  4KHW A;  1ASV A;  3HP6 A;  1CZB A;  3LAN A;  5KGX A;  1DT9 A;  3FLC O;  3OW2 M;  3CIP A;  1NK7 A;  2BGG A;  4J8F A;  4OJR A;  3SV4 A;  4PUO A;  3KD5 E;  2FSJ A;  1I39 A;  3SLC A;  2F9W A;  2WOM A;  1BU6 O;  4B8A B;  4BRI A;  4YOV A;  4DSI A;  2OPQ A;  2VCP A;  4GV6 A;  4X62 K;  1B92 A;  1RT5 A;  4KHN A;  2A5X A;  4CF9 A;  4ELT A;  3A5N C;  4CZI A;  2IVP A;  3L2V A;  2QWM A;  3AVH A;  3EKS A;  1KVA A;  4DTJ A;  3OS2 A;  4KAZ A;  1JLF A;  3CQY A;  2XY6 A;  2KFN A;  1N6Q A;  3VQ7 A;  2G8F A;  5CHI A;  3S3M A;  1Z25 A;  5AQU A;  3ZEU B;  3DRP A;  5AQL A;  3V6D A;  4GVM A;  4BGA A;  4HUF A;  1N5Y A;  1L3V A;  2BH1 A;  1ZBI A;  2E20 A;  4YDU A;  4CGI A;  4XH5 A;  5CY4 A;  4W5R A;  4DV7 K;  5LJW A;  4CIE A;  3I33 A;  4DQI A;  3HSC A;  2P5O A;  4Z94 A;  3EKU A;  4HUG A;  1EKE A;  1D9F A;  3GBT A;  3JAM O;  4WQ5 C;  3LM9 A;  3QER A;  2FBT A;  3CJ7 A;  3DAW A;  2A41 A;  2P9N B;  4CEF A;  4PHT X;  2NUB A;  3RVC A;  5AQO A;  1WB9 A;  4MDA A;  1RCH A;  4O55 A;  4KRF A;  2NZT A;  3NH1 A;  5EX5 A;  1NGC A;  4NLB A;  1QHA A;  4HCB A;  3A8Y A;  1WAF A;  3RWU A;  4YHH K;  4DS5 A;  5H1S Q;  3RMB A;  3O9S A;  4LF7 K;  1G99 A;  1NK0 A;  3V9X A;  1ASW A;  4FJH A;  1ZC6 A;  2P5G A;  1K8K B;  4BR7 A;  1Y97 A;  1JL2 A;  3CFP A;  2ITM A;  3U3Y A;  1T3V A;  3G71 N;  1GLL O;  4UY8 O;  3ALY A;  3T7Z A;  1Q8I A;  4N47 A;  2P51 A;  2ZQB A;  3O9Q A;  4BG9 A;  3KLH A;  3O1W A;  1SL2 A;  3M1F A;  2YKN A;  4FM1 A;  4CZH A;  4JI8 K;  4ID5 A;  5F1X A;  3HOT A;  3WXJ A;  2CGJ A;  4C23 A;  4K8X A;  2HHQ A;  3CJA A;  4K8Z A;  3UB5 A;  3MDQ A;  1X9M A;  5GAH P;  4W5Q A;  2ZWH A;  3DXK B;  4CJ3 A;  5CYM A;  4BC4 A;  1UA1 A;  4FWL A;  4CGH A;  4JKG B;  4B1U B;  3BEX A;  2R7Y A;  4OLB A;  4N76 A;  4XEI A;  4QCL A;  4R79 A;  3CG7 A;  2OZS A;  1LW2 A;  2P9S B;  4A57 A;  3H6E A;  4KI4 A;  4CZK A;  3V1Q A;  1MA9 B;  3L8B A;  3HBT A;  3RSE A;  4BC2 A;  3A0I X;  2O8B B;  4FLU A;  2OCE A;  2E2Q A;  2QXF A;  4LF6 K;  1VSE A;  4IWV A;  1S72 N;  3CD6 N;  1KVC A;  1VQ4 N;  4LH4 A;  3HO1 A;  4BE2 A;  4M42 A;  4E0D A;  4KH6 A;  4JKF A;  4WF9 L;  1Q9X A;  4A5B A;  5AQK A;  3QEI A;  5BR8 K;  1YT3 A;  3F9M A;  2ETJ A;  1VQK N;  1GLJ O;  4OPK A;  4X65 K;  3GOI A;  4BR0 A;  3O3F A;  5JS1 A;  4H0X B;  3MK6 A;  4IDH A;  4B1V A;  3VA3 A;  1XI1 A;  3ZYY X;  2PBD A;  1QZ5 A;  5C2D A;  3OJS A;  4CFA A;  1HPZ A;  4C1N I;  4Z4I A;  3VF6 A;  3OS0 A;  3MEC A;  1NG9 A;  1Z26 A;  3HVR A;  4E7K A;  1S9E A;  2P9I A;  5AQQ A;  5KPT A;  3OYL A;  4GKK K;  4FWO A;  1G15 A;  2NRT A;  4FWS A;  4FK4 A;  4DV4 K;  3AAR A;  1S1W A;  5HRS A;  1LOT B;  1DLO A;  1JLE A;  2P9L A;  2B6A A;  3PLA A;  3EZ5 A;  1SKW A;  4JV5 K;  5HRP A;  4DLE A;  1VSI A;  4JLH A;  3F2K A;  2UXC K;  4FCY A;  4LSL A;  3CJB A;  1NGG A;  4DTR A;  5CZ2 A;  3CM5 A;  4FLY A;  1W7A A;  3ZLJ A;  4JK9 A;  5E41 A;  3OYD A;  1HQE A;  1NJX A;  4ISG A;  3H08 A;  1GOC A;  4JEP A;  1GOA A;  4EZ9 A;  3TAN A;  1WUA A;  4A62 A;  4CBW A;  4DUY K;  1U2V A;  1C0U A;  1MWM A;  1FK9 A;  3ZSQ A;  3E9P A;  3QET A;  3QB0 A;  3MWP A;  4OKJ A;  4H0O A;  4BDP A;  1S6P A;  3ZSW A;  3L2U A;  5AQI A;  1BI4 B;  3SK3 A;  2HHV A;  5GAG P;  1RBS A;  5HBM A;  3KIO A;  1LW0 A;  3CC2 N;  3SJJ A;  5JVG L;  5LMU K;  3O8M A;  4MQ3 A;  1KAX A;  1I3A A;  3NVM A;  2WBN A;  2RKI A;  3IRX A;  3NGY A;  4XH4 A;  4DR3 K;  1WLJ A;  4J2A A;  5HRO A;  4M3R A;  5KPZ A;  4JI3 K;  1LCU A;  4GNI A;  4CJE A;  1IBL K;  2X74 A;  3HP9 A;  1NGD A;  3P1G A;  2ASM A;  4JK7 A;  4E1N A;  4CK2 A;  3D45 A;  3DRS A;  3LAK A;  3LAM A;  3VQ6 A;  3R6M A;  2Q0R A;  2Q31 A;  3SMS A;  1JLC A;  3Q7B A;  3R8E A;  4CGG A;  1NJY A;  3I0S A;  5EOY A;  5F0X A;  4DQQ A;  4FLX A;  3HPO A;  3KKS A;  4CZL A;  4CE9 A;  1U6Z A;  2A6A A;  3BP8 A;  3ZX0 A;  1YJ9 N;  4OPJ A;  3ZEU A;  2KTQ A;  3K58 A;  1C0T A;  3CM6 A;  3K0S A;  3QNO A;  1ATN A;  1WNS A;  1YIT N;  3D2E B;  3IKM A;  1C0F A;  4H8K A;  4KTQ A;  1GOB A;  3B8A X;  3VQE A;  5KRT A;  1REV A;  4W5N A;  3AVF A;  3ZX2 A;  4YOY A;  3C6H A;  2O8D B;  5AQS A;  3KK1 A;  3OBW A;  3MCP A;  2P9N A;  3VN5 A;  1X9J A;  1QQN A;  3OS1 A;  2IIR A;  4EFH A;  2Q36 A;  1NKC A;  2GX9 A;  4QAG A;  2XO7 A;  2YV0 X;  3A5O C;  1N34 K;  2IVN A; 
#chains in the Genus database with same CATH homology
 2JLE A;  4CIF A;  4I7F A;  3LDS A;  3TAG A;  1BHL A;  3DM2 A;  4CK1 A;  5C42 A;  2HHS A;  4DSL A;  2G8K A;  4CGD A;  3HST B;  1RT4 A;  4KPY A;  1EET A;  4AH9 A;  1HQU A;  4LY7 A;  1IKV A;  3LPU A;  3E01 A;  1KFD A;  3MXJ A;  1TK5 A;  4Q0B A;  2Z1G A;  3DLG A;  1UOC A;  4CF1 A;  4DWI A;  1T03 A;  2G8V A;  1JLA A;  3PX0 A;  1S1U A;  3DRR A;  4BE1 A;  5HP1 A;  4B08 A;  4F2R A;  3QIN A;  3FFI A;  2QKB A;  2X6N A;  1WSJ A;  2VG6 A;  1KLM A;  3O4N A;  5FDL A;  2IOC A;  5HRN A;  2VG7 A;  4Q5V A;  3OYM A;  1SKR A;  1JKH A;  2O4G A;  1D8Y A;  4C8K A;  3M8P A;  3SQ4 A;  3K5L A;  2IC3 A;  3B6O A;  3L3V A;  2PYJ A;  4DQP A;  4E1M A;  2HNY A;  3AVJ A;  3F9K A;  4AHC A;  3SNN A;  2OPR A;  3KJV A;  1ITG A;  1LWF A;  3WNE A;  1TGO A;  4DFM A;  3HYF A;  4DFJ A;  3SI6 A;  4CJW A;  4KV8 A;  1JLG A;  3WNG A;  2DTU A;  1D9D A;  2PYL A;  4F3O A;  3S3N A;  3V9Z A;  5FRM A;  3ASM A;  4CHO A;  3MXM A;  3K59 A;  1TL3 A;  4N41 A;  4ICL A;  1ZBL A;  3KTQ A;  4DTS A;  4J2D A;  1RTI A;  2A1R A;  4YFU A;  4B9L A;  4CER A;  4RW9 A;  4FM0 A;  4B3O A;  4FYD A;  3VQ5 A;  1EXQ A;  4O5B A;  3AVC A;  4C8N A;  3ZT1 A;  3SV3 A;  3OYG A;  4AHR A;  4ZHR A;  4M3X A;  4W5T A;  4CFB A;  4E7H A;  4CJT A;  4CHP A;  1ZBH A;  2F8T A;  3AVM A;  4O0J A;  2BE2 A;  3MXI A;  4M3Z A;  1LAW A;  3QEP A;  5SZT A;  3RMD A;  4Z4H A;  4NYF A;  4JRP A;  3TWH A;  4AHS A;  1MU2 A;  3OYC A;  3I0R A;  2PZS A;  1VSM A;  3KLI A;  4DTU A;  4F3T A;  2OZM A;  4DTN A;  3SUN A;  4RW6 A;  4B9V A;  3KD1 E;  1IH7 A;  2EX3 A;  4CHY A;  2OYQ A;  4O44 A;  2QKK A;  1JLB A;  2D0B A;  5C25 A;  2BDP A;  4CEZ A;  4CEC A;  1TK0 A;  4KB0 A;  1SL1 A;  3ZSY A;  4L8R B;  1W9H A;  1RT7 A;  3BGR A;  2ITG A;  3AA4 A;  4KTZ A;  4HTU A;  1X9W A;  2RF2 A;  4HUE A;  1JLQ A;  3HT3 A;  4F8R A;  4IKF A;  1XHX A;  3K5O A;  4CJU A;  1BQM A;  5KTQ A;  1X9S A;  4E19 A;  5FRN A;  1KFS A;  3DLH A;  3DLK A;  4KHY A;  1KSP A;  3TAR A;  3DMJ A;  3DYA A;  3U6F A;  1NJZ A;  4KB1 A;  3UIQ A;  3RMC A;  4KO0 A;  3JSM A;  4KHW A;  4CHN A;  1ASV A;  4DTM A;  1LV5 A;  3VQ9 A;  1CZB A;  3HP6 A;  5CYQ A;  3LAN A;  1FXX A;  4BWM A;  3ZSX A;  1HNV A;  5JS2 A;  5KGX A;  4M3W A;  3K2P A;  5EU7 A;  5J2P A;  1A5V A;  1LWE A;  4FZX C;  4CGJ A;  1NK7 A;  1QSS A;  2YHB A;  2BGG A;  2HHT A;  1YTA A;  2HHX A;  3SQ0 A;  4I2Q A;  4B9U A;  3AO1 A;  4FW1 A;  5FRO A;  4CK3 A;  4OKE A;  4CJF A;  1EX4 A;  1KVB A;  4OJR A;  3VQC A;  3SV4 A;  4C8O A;  4HCC A;  1U4B A;  4EP4 A;  2Y1J A;  4PUO A;  1CLQ A;  3KD5 E;  1VSL A;  2DFH A;  3HXM A;  3NF8 A;  4B8A B;  1I39 A;  4DSI A;  2WOM A;  4ID1 A;  1WSF A;  4RW8 A;  5KGW A;  4CJV A;  2OPQ A;  4ELU A;  2IDO A;  1IKX A;  1C1A A;  1HNI A;  1J5O A;  1NK4 A;  3VQ8 A;  4IFV A;  4AIL C;  3DLB A;  4Z4F A;  1B92 A;  1RT5 A;  3A2F A;  3KKR A;  4KHN A;  2OPP A;  3TAQ A;  4CF9 A;  3SYZ A;  4ELT A;  1JXE A;  3L2V A;  4G1Q A;  3AVH A;  4OGC A;  4JRQ A;  2Z1J A;  4NCB A;  3HK2 A;  4KHU A;  3OYJ A;  2YKM A;  4CIG A;  1KVA A;  4DTJ A;  4FJ8 A;  2ATQ A;  4CCH A;  3OYE A;  3OS2 A;  1S1X A;  1JLF A;  1A5W A;  3ZCM A;  3ZSZ A;  4FLT A;  4KAZ A;  3M8S A;  2XY6 A;  3SQ2 A;  2KFN A;  1BIZ A;  1N6Q A;  1O1W A;  4CEO A;  3VQ7 A;  1B9D A;  4C8M A;  2G8F A;  3S3M A;  1LAV A;  4FXD A;  3O3G A;  1YTU A;  1Z25 A;  4GMJ B;  1NOZ A;  4R5P A;  3K5N A;  3DRP A;  1HYZ A;  4PA1 A;  4GVM A;  3LP2 A;  2E6L A;  3LZJ A;  3L3U A;  4N56 A;  4HUF A;  1D5A A;  3V6D A;  1U45 A;  1N5Y A;  1HJR A;  2E6M A;  2EHG A;  4FVM A;  3WNF A;  1L3V A;  4B9T A;  4OLA A;  2HHW A;  1ZBI A;  4DU1 A;  4F2S A;  4FLZ A;  4I2P A;  4CGI A;  4AHV A;  3AVB A;  5CY4 A;  1NJW A;  4W5R A;  4CIE A;  1YVU A;  1KCF A;  4DQI A;  4EZ6 A;  2DFE A;  2JGU A;  3V4I A;  4FJL A;  1B9F A;  1TKX A;  3RRH A;  2P5O A;  1XC9 A;  2X78 A;  4HUG A;  4CJS A;  4E3S A;  1QSL A;  1EKE A;  2YNH A;  1D9F A;  1TAQ A;  1UAX A;  3AVK A;  3NHG A;  2FBT A;  3QER A;  3KLG A;  4Z4E A;  4B9S A;  3OY9 A;  1K6Y A;  3DI6 A;  4WE1 A;  4CEF A;  1RBT A;  1W0H A;  3NGI A;  2VWJ A;  3F73 A;  2NUB A;  5J2M A;  3RMA A;  2HW3 A;  4HHT A;  3QES A;  1VSD A;  1RBV A;  4RW7 A;  1NKE A;  2F96 A;  1RCH A;  4LSN A;  4O55 A;  4KRF A;  1BIS A;  4CJL A;  1RBU A;  1BI4 A;  3NH1 A;  4DS4 A;  4DTO A;  3SZ2 A;  3OYI A;  3LAL A;  3DLR A;  4HCB A;  4M3Y A;  4ELV A;  1WAF A;  3TR8 A;  3RWU A;  4FJJ A;  4FJX A;  1WAJ A;  4CJR A;  1BL3 A;  2B5J A;  3SCX A;  5CZ1 A;  4DS5 A;  3RMB A;  2WON A;  2Y1I A;  3THV A;  4NCA A;  4PQU A;  2VG5 A;  5T7B A;  1NK0 A;  4CHZ A;  3V9X A;  1TK8 A;  1ASW A;  4FJH A;  4JS4 A;  2IGI A;  3DLE A;  4B8C A;  3KK3 A;  1SV5 A;  4GW6 A;  4OKK A;  3QO9 A;  4FLV A;  1L5U A;  3V81 A;  2P5G A;  1A5X A;  1U04 A;  3ZSO A;  4J2E A;  3V1O A;  3K57 A;  3ZT0 A;  3IG1 A;  4BAC A;  3VQB A;  3LWL A;  1Y97 A;  4OGE A;  4YNQ A;  1JL2 A;  3CFP A;  1VSK A;  3CFR A;  3LPT A;  4CF0 A;  3U3Y A;  4FLW A;  1BCM A;  4CFC A;  3NBP A;  3CQ8 A;  3OYN A;  2IAJ A;  1RBR A;  3ALY A;  4O4G A;  3AVA A;  1Q8I A;  4N47 A;  2GUI A;  1DTT A;  2B4J A;  2P51 A;  4C8L A;  3MEG A;  1IO2 A;  3VQ4 A;  2ZQB A;  3NCI A;  3MAQ A;  4F4K A;  3KLH A;  4LH5 A;  1HMV A;  2VWK A;  3NDK A;  1NK9 A;  1SL2 A;  3T19 A;  2G8U A;  4DU3 A;  1JL1 A;  2YKN A;  1XWL A;  4FM1 A;  4ID5 A;  1WSE A;  2P1J A;  1L3S A;  3V9W A;  4CEQ A;  4ZTJ A;  4FJ5 A;  1RTH A;  4DF4 A;  1TL1 A;  2KZZ A;  2RPI A;  4K8X A;  2HHQ A;  4DMN A;  4CJP A;  3G0Z A;  4K8Z A;  1X9M A;  3C95 A;  1RDA A;  3VQA A;  4W5Q A;  4CJ3 A;  5CYM A;  3AO5 A;  1WSI A;  5C24 A;  3K5M A;  3PV8 A;  1UA1 A;  4CGH A;  3KLE A;  3DOL A;  1J9A A;  3P83 D;  3VQQ A;  4CES A;  4NYN A;  2R7Y A;  3QEW A;  4N76 A;  4OLB A;  1U49 A;  1TV6 A;  1CZ9 A;  3NF9 A;  3LP0 A;  2Z1I A;  4QCL A;  1VRU A;  3L2R A;  3PX4 A;  2A1S A;  2D5R A;  3CG7 A;  3LP3 A;  4MFB A;  1ZBU A;  4BE0 A;  1LW2 A;  2OZS A;  4Z4C A;  4IG0 A;  4Z0U A;  3S3O A;  4ZTF A;  1HYS A;  1KRP A;  3SPZ A;  1F21 A;  4KI4 A;  3V1Q A;  3NGZ A;  4CF2 A;  5D3G A;  4PWD A;  2G8H A;  1SUQ A;  3VQP A;  2GV9 A;  3SUO A;  3L8B A;  3IAY A;  3L2Q A;  3ZSV A;  3OYB A;  4FLU A;  5I42 A;  1BGX T;  3KK2 A;  3NAE A;  3AA2 A;  2QXF A;  3QEX A;  1RT2 A;  1VSE A;  4CJK A;  4FJ7 A;  1CXQ A;  4CED A;  2OA8 A;  1L3T A;  3OYF A;  2HVH A;  4DLG A;  2XY8 A;  3AO4 A;  1KVC A;  4KI6 A;  5HLF A;  4LH4 A;  3HPH A;  1U48 A;  3HO1 A;  4BE2 A;  4FW2 A;  3ZT3 A;  3PO5 A;  4E0D A;  2KQ2 A;  1Q9X A;  4M42 A;  1XHZ A;  4KKO A;  3SUP A;  4TSX A;  3OYA A;  4M41 A;  1S1V A;  2OPS A;  3HJF A;  3ZT4 A;  3QEI A;  1YT3 A;  3AVG A;  4CF8 A;  3B6P A;  1EP4 A;  1KTQ A;  3LP1 A;  4RG8 A;  3T3F A;  1WSG A;  2ETJ A;  2Q3S A;  1NK8 A;  4J2B A;  4OPK A;  1U47 A;  1TVR A;  1UA0 A;  1VSJ A;  4LD0 A;  1QTM A;  5JS1 A;  1KLN A;  3O3F A;  2HMI A;  1IG9 A;  1FKO A;  1RTJ A;  2HB5 A;  3CFO A;  4Y1D A;  3D0P A;  3NH0 A;  1C1B A;  4DTX A;  1BCO A;  3VA3 A;  1XI1 A;  4DF8 A;  1TKT A;  1ASU A;  3EY1 A;  4DG1 A;  3OJS A;  3C94 A;  2IS3 A;  1HPZ A;  4CFA A;  3PO4 A;  4Z4I A;  3S9H A;  3OS0 A;  2YNI A;  3MEC A;  4KRE A;  4KHQ A;  1Z26 A;  3HVR A;  4QOZ B;  1RT1 A;  3C6U A;  1DTQ A;  4E7K A;  4FM2 A;  4IG3 A;  1S9E A;  2FBX A;  3OJU A;  3TAB A;  4FJI A;  4CJ5 A;  2KZM A;  4FJN A;  1C6V A;  2XRI A;  3RR8 A;  1VRT A;  3OYL A;  1G15 A;  1CXU A;  3QIP A;  1BIU A;  2XHB A;  3PY8 A;  4H4O A;  4FK4 A;  4CFD A;  3NFA A;  3PX6 A;  2X6S A;  3O3H A;  3TAE A;  1S1W A;  5HRS A;  4NCG A;  4FJK A;  1DLO A;  3M8R A;  1Q9Y A;  2KFZ A;  1JLE A;  1C0M A;  2G8W A;  2B6A A;  3RR7 A;  1X1P A;  3EZ5 A;  3QLH A;  3TAM A;  4W5O A;  1SKW A;  5HRP A;  1J54 A;  3C6T A;  1VSI A;  1RIL A;  4DLE A;  4FJG A;  4JLH A;  3NE6 A;  2AJQ A;  4CGF A;  2O4I A;  2YHA A;  4CEA A;  4LSL A;  4FCY A;  3SUQ A;  4CJ4 A;  4DTR A;  1RTD A;  3OVN A;  5CZ2 A;  3CM5 A;  2KW4 A;  2ZE2 A;  5SWM A;  4FLY A;  3AA5 X;  2XY7 A;  1RT3 A;  1S1T A;  4AHT A;  5E41 A;  1HQE A;  3OYD A;  1NJX A;  2FBY A;  3H08 A;  1GOC A;  1GOA A;  2BAN A;  4EZ9 A;  4FJM A;  3HL8 A;  1QE1 A;  1QHT A;  3ITH A;  1IKY A;  4N5S A;  3TAN A;  5HRR A;  4I9L A;  3BDP A;  4DQR A;  1C0U A;  4JS5 A;  5K14 A;  3V9S A;  4PY5 A;  1FK9 A;  3ZSQ A;  4CEB A;  3HM9 A;  4DFP A;  3QET A;  4FK0 A;  4OVL A;  4OKJ A;  3VQD A;  3M8Q A;  2HVI A;  4BDP A;  1S6P A;  1IKW A;  3U3G A;  3ZSW A;  3L2U A;  1LWC A;  2HNZ A;  1BI4 B;  1ZBF A;  1RT6 A;  2G8I A;  2HHV A;  4XIU A;  4FZZ A;  1RBS A;  3V9U A;  3AVN A;  2YNF A;  4DTP A;  5HBM A;  1HRH A;  3WNH A;  3L2W A;  4E7J A;  3KIO A;  1LW0 A;  4EP5 A;  1NK5 A;  2D0C A;  4H4M A;  4CEE A;  3SJJ A;  3NF7 A;  5I3U A;  4DSE A;  3TI0 A;  4MQ3 A;  3O4Q A;  3VA0 A;  2W42 A;  4CJQ A;  1S5J A;  1I3A A;  1ZYQ A;  2RKI A;  4HVJ A;  2XY5 A;  1S9G A;  2I5J A;  3IRX A;  2HND A;  3NGY A;  1NK6 A;  1VSF A;  1WLJ A;  4J2A A;  3I8D A;  2GBZ A;  2D0A A;  4M3R A;  5HRO A;  2YNG A;  2DY4 A;  3TAP A;  4I9Q A;  3ISN C;  4BWJ A;  4CJE A;  1T7P A;  4BDY A;  1QS4 A;  1VK0 A;  2X74 A;  3HP9 A;  4B9M A;  4O0I A;  3AO2 A;  3P1G A;  4M45 A;  5KRS A;  4E1N A;  1SL0 A;  2HHU A;  4CK2 A;  3D45 A;  3DRS A;  3LAK A;  3LAM A;  4IBN A;  3MED A;  3VQ6 A;  1QQC A;  5J2N A;  2LSN A;  1JLC A;  1UWB A;  3HVT A;  4E7I A;  4B9N A;  4M3T A;  4RW4 A;  3ZSR A;  2F8S A;  1RDC A;  1J53 A;  3I0S A;  4CGG A;  1NJY A;  1T05 A;  4DQQ A;  5J2Q A;  3ZT2 A;  4KTW A;  3MEE A;  5DMR A;  4AHU A;  3NF6 A;  3HPO A;  3KKS A;  4FLX A;  4DQS A;  5KI6 A;  3SPY A;  4CE9 A;  3AVI A;  4E89 A;  3RTV A;  4OPJ A;  1HYV A;  3T1A A;  2KTQ A;  3K58 A;  1QSY A;  1C0T A;  3CYM A;  3CM6 A;  1L3U A;  3LWM A;  1T8E A;  2FC0 A;  1JXB A;  3QNO A;  3P5J A;  3JYT A;  1WNS A;  2Z1H A;  3AO3 A;  3QNN A;  1S6Q A;  4IFY A;  4M3U A;  5DK5 A;  4DFK A;  1R0A A;  4DSJ A;  4FK2 A;  4UQG A;  1TKD A;  3AA3 A;  1SKS A;  3RRG A;  4H8K A;  2DFF A;  4KTQ A;  4BDZ A;  1GOB A;  3LZI A;  4FJ9 A;  3VQE A;  5J1E A;  3KLF A;  3SQ1 A;  1C1C A;  1VSH A;  1NOY A;  2E4L A;  2ZD1 A;  5KRT A;  1REV A;  4FZY A;  4W5N A;  3G10 A;  1TKZ A;  3AVF A;  2RN2 A;  1WSH A;  4KHS A;  4DSK A;  4E7L A;  3TAF A;  3OYK A;  1NKB A;  1TAU A;  4DSF A;  3PUF A;  1RDD A;  3KK1 A;  1FKP A;  3QIO A;  4Y1C A;  3VN5 A;  4CHQ A;  3OS1 A;  3EYZ A;  3ULD A;  1WN7 A;  3DOK A;  1BQN A;  3AV9 A;  3AVL A;  1NKC A;  4IDK A;  4KFB A;  4Z4G A;  1RDB A;  3NH2 A;  4QAG A;  2XO7 A;  2PY5 A;  1RNH A;  2FBV A;  2YV0 X;  3QEV A;  2QK9 A;  3V1R A;  3OYH A;  3HPG A;  3IS9 A;  4DU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...