1HR0K

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1hr0K00
4JV5K 4LF9K 4DV3K 5LL6Z 4K0KK 4DR7K 4LFCK 4DR5K 2UUAK 4B3TK 3J7AP 1N34K 4B3MK 4LF7K 1XNQK 2F4VK 4JYAK 3OTOK 3T1HK 4DR3K 4DR2K 5IWAK 2UXBK 4JI3K 3J7YP 4B3RK 4KHPK 4NXNK 2HHHK 5BR8K 4CVNE 4DR1K 4JI0K 4YY3K 1HR0K 4NXMK 4YHHK 4LF5K 4OX9K 1FJGK 4DV6K 2UU9K 1IBKK 4AQYK 4JI6K 4X65K 4JI4K 4JI1K 4GKJK 1I94K 4DR6K 4DUZK 5FLXO 2VQFK 1XMOK 5LMNK 4V19S 1HNZK 3J81O 4GKKK 1J5EK 5IT9O 4DV1K 1XMQK 4LFBK 2E5LK 5LMUK 3T1YK 3JAMO 4LF6K 4X64K 4JI7K 4JI2K 1IBLK 2ZM6K 4DV2K 4LFAK 4X66K 1N32K 2UUCK 1HNWK 1HNXK 4DV4K 4DV0K 4JI8K 4DR4K 4LF8K 2VQEK 2UUBK 1XNRK 4DUYK 4CW7B 4LF4K 4B3SK 2UXDK 1N33K 4X62K 5A2QO 3J80O 1N36K 1IBMK 4JI5K 4DV5K 4DV7K 5AJ3K 2UXCK
chains in the Genus database with same CATH superfamily
4CBUA 3SK3A 3F73A 3V9UA 4C8OA 4BRGA 2RKIA 3C6AA 4E1NA 1QQNA 1WSEA 2G8WA 1UA0A 4PQUA 3MMVA 3MEEA 2O8BA 4B1XB 2XY7A 1HLUA 4CZIA 2WUSA 1RTJA 3NF8A 2YNIA 3N4PA 3K5LA 4CJUA 4JYAK 1TAUA 3ALYA 4QS7A 4FJ8A 3QINA 3FFKB 3HSCA 1QVFM 3C7NA 3KLHA 1NK9A 1VQ4N 1WUAA 5EVZA 2BTFA 3OVNA 5LJVA 1RTDA 1GLBG 3VQBA 1H1VA 2B6AA 2ITGA 4IFYA 1Z26A 2UU9K 3ZETA 4DSFA 2YHXA 3THWA 4XEIA 4JI4K 2W42A 3ULEA 3D7EO 1YVUA 2IDOA 5JLHA 4WFNL 4CJ3A 2CGJA 4DR6K 2G8UA 1HUXA 1RT5A 3DLLL 1L5UA 3UIQA 4O0IA 3KKSA 4CHZA 4UQGA 3TABA 4CK3A 2I5JA 4C1NK 3QERA 1QQCA 2EHGA 2IAJA 2NUBA 3CG7A 4BQLA 2O8FB 5AFUA 2QI2A 4M3RA 4Z94A 4JEPA 4BDYA 3CFPA 3K9JA 1IG9A 4DQQA 3RMAA 1QS4A 2IOCA 3RSEA 3CC4N 4DQPA 2FXUA 1Q81O 3BF1A 3UB5A 4CJPA 1EQYA 2GWJA 1JLQA 3AVJA 4PKHA 4DU4A 1D9FA 4FJLA 1EO1A 5GAEP 2UXDK 1OVYA 3SUQA 2FBXA 2CGKA 4F9OA 3L2VA 4JKEA 4JK9A 3VQDA 1QSYA 5B8HA 3PV8A 1BIZA 3CI5A 4DTJA 2VGMA 1NGCA 1NJIO 2RN2A 5EU7A 1OH6A 1C1AA 2NRWA 2YHAA 2WONA 3QEPA 4FLXA 4CCHA 4B3MK 1VSDA 4DR3K 3SYZA 3L2UA 4KKOA 4FWKA 5F1XA 1RDDA 3ENBA 4CZEA 3AVKA 2A40A 2P9PB 1BA0A 2IIRA 4NYNA 1YT3A 5KRTA 1T03A 1IO2A 5AQRA 2DY4A 4H0OA 4CJWA 4H0VB 4PKGA 4AQYK 1VQ6N 3EE8A 2GV9A 4CJSA 2FF6A 3VEYA 2OYQA 4GKJK 5KTQA 1T6DA 1GOCA 1VRUA 2ZQBA 4OKKA 3GBTA 3TARA 3VOVA 2XY8A 1YAGA 4BG9A 4FWNA 4XH5A 3T1YK 4LSLA 4IZ9A 1MA9B 4CHYA 3LL3A 4BG8A 4YOUA 3AO4A 4IWVA 2DPNA 3KHYA 2JWLA 1ESVA 4H0TB 3CM6A 3D45A 3DXMB 2Q3SA 3CCVN 1VSIA 4DS5A 1FKOA 4JI8K 4HCBA 4DG1A 1RDBA 1IG8A 1V4SA 3UKUB 3K58A 2KZZA 3NFAA 3QIOA 4R79A 2NRTA 4FJNA 1KCFA 4NB4A 4MDBA 3CPWM 4BRIA 3C95A 1SL1A 3ZSXA 1DGKN 2O8FA 4CEQA 3CCSN 5GAGP 1L3TA 5D3GA 3M8PA 1Q9YA 4IEIA 4OKJA 3V4IA 4LF9K 3VQEA 4B9QA 3QLHA 2W41A 2PZSA 1HKBA 3DLHA 4OKEA 4BWJA 2GBZA 3W3DA 3T69A 4EAHD 1FXXA 4JHDB 3VF4A 3KK2A 1TUYA 1LWCA 4OVLA 4EP4A 3RMBA 1T7PA 1NGFA 3WNEA 4I2PA 1KSPA 4BR0A 5AQVA 4A61A 2W6KA 5IWAK 3M8QA 3AO3A 1UOCA 3VETA 4JN4A 3T1AA 1DTQA 3P5JA 3TAEA 2QK9A 3O9TA 1RFQA 3R9PA 3O9RA 4OX9K 2G8KA 4N47A 4DF4A 4NCAA 2O8DB 2KKZA 4CEEA 2YNGA 4FYDA 1I94K 3QFUA 3F9KA 3R6MA 1WOQA 4I2QA 5I9EB 5LMNK 4OGCA 4DSLA 4LC9B 3S3OA 1X1PA 3EKUA 3WT0A 3PX4A 1NJXA 3GE1A 3SUNA 1XQSC 1ZBSA 3TI0A 3VQAA 4PHTX 1E4GT 4MQ3A 3EO3A 4AHVA 2OZSA 4BR4A 3ZYYX 4QAGA 2ZD1A 1GLCG 4ILHA 5DM7L 2F9WA 3SV4A 3EEQA 1ZYQA 4HTLA 3PY8A 4N5SA 1GLFO 4H03B 3P4IA 1NGIA 2UUBK 1JCEA 4KHWA 3OYHA 3RR7A 2YNFA 4KI6A 2HVHA 3V81A 4FZXC 4AM6A 3O08A 5KPRA 4E7LA 3J80O 3VPZA 4CFCA 1BHLA 1BCOA 4WQ4A 1VSHA 3CCQN 4MLHA 3GL1A 1XI1A 3L3UA 3DXMA 3SJJA 4DB3A 4CJ5A 5GADP 2QWLA 4FLTA 3FLCO 1N6QA 3J7AP 5AQHA 1W2BM 3U6FA 2E6MA 3G6EN 3O4WA 5FDLA 2Q0RA 1BG3A 1VQ5N 3T1HK 3ZT1A 3NH0A 1EETA 2HHHK 2PYJA 2QKBA 4IDKA 4BRNA 2OPSA 3ZCMA 4FW2A 1L3SA 5JS2A 4BRCA 3O1BA 2ZJPL 3NVKA 3CJ7A 1A5XA 5BN9A 4BRHA 4KAZA 4DTXA 4B9NA 4BVPA 4JHDA 1DTTA 4K41A 5F2RA 5C2FA 3NH2A 3L0QA 1TGOA 3H46O 4CFAA 4DHYA 3HP6A 1NGEA 4DQIA 4CE9A 3SUPA 3A5MC 3O6WA 1WAFA 5J2NA 3BUZB 1WSHA 1B9FA 1EX4A 4FWQA 4DTSA 5K14A 3SPYA 1YJ9N 1K9MO 1WSGA 2FBVA 1S1XA 1GLDG 3CJBA 1OH8A 4H5WA 1GLJO 1NGBA 3THYA 5EOYA 1VAZA 3VN5A 3VQCA 2HF3A 2E1YA 4CHPA 4K43A 3KWGA 2V52B 1IKVA 4C8KA 3K0SA 5AQLA 2Z1GA 4E0DA 4FK4A 3ZT0A 2OTLN 4OLAA 2O8DA 2AP1A 4W5RA 3I56N 1S6PA 4DR4K 4BRDA 3KZBA 1N8RO 4FJIA 1I3AA 4CJVA 3TWHA 1SKSA 2YHBA 1YUWA 1HQUA 4IG3A 4CF1A 4BC5A 5GIPA 1HKCA 4FJJA 1K6YA 3L4QA 5T7BA 1TVRA 4DS4A 4QS8A 2Q97A 1NGGA 5H1SQ 3AVCA 4QS9A 3G10A 4E19A 1ZBFA 3QEWA 1M1KO 3VF6A 3S41A 4BC3A 4DSJA 1RBVA 4IFVA 4W5TA 4CJEA 1VSKA 2YHWA 4N76A 1HX1A 2ETJA 1VQKN 2E20A 2F96A 3HO1A 3PSIA 4FJMA 1IKWA 3J8AA 2O4IA 2BE2A 1BCMA 4JNEA 3OW2M 1RBUA 1W97L 2IVOA 4PA1A 5AQQA 4LH5A 5C2DA 5DM6L 4Y1CA 4DCHA 3D2EA 3CETA 2GUPA 3EL2A 4BC2A 1P8ZA 1WN7A 3DOKA 4CGHA 2RF2A 2YX6A 1BO5O 4YOTA 1KC8O 3AAQA 3ZETB 4DV6K 1DLOA 3LDPA 2HBJA 1U47A 3AVAA 4JI6K 3DMJA 4HUFA 4KREA 3UKRB 1K8AO 3DRRA 1KTQA 3O3FA 3MN6A 3VQ6A 1EWRA 4YNQA 1BI4A 1HPZA 4CF2A 1T44A 3AA2A 3U9DA 2XO7A 4DV1K 2BDPA 4NYFA 3CQXA 4JK7A 3WEEA 1XC3A 2E5LK 3AVFA 1A5VA 1HYSA 2D0PA 3VMFB 3SQ1A 4M42A 2A1SA 3G25A 2KW4A 3DI6A 1ASWA 2VWBA 4GW6A 4MO4A 3D2FB 4HHTA 4IOAL 2P9KB 2GWKA 3K5OA 3OYMA 4FL9A 4JKAA 3VGLA 4QCLA 5JLFA 2W40A 4JKGB 3VEVA 3K5NA 3AO2A 4H5NA 4JRQA 3TAQA 4B9TA 3ZT3A 5J2QA 2Z1JA 1JJ2M 3ENHA 1U4BA 2Q36A 4NCBA 3EKSA 4DTUA 3I8BA 2X6SA 4CZGA 3ATVA 3BZKA 4O8UA 4GMJB 5LJWA 2UXCK 1Z05A 3M8RA 1QHTA 3TTFA 5MLCQ 3D6RA 4HUGA 3EZWA 4Z4EA 1TV6A 3C0BA 1K73O 1ZBHA 1GOBA 4FWOA 4BGBA 2A6AA 5AQUA 1U2VA 1IKYA 4WCEL 3MXMA 1T3VA 1ZBLA 4KB1A 3F5TA 5AQPA 1NK0A 4EP5A 3SMPA 2UXBK 1TKXA 4WE1A 4DU3A 1TL1A 3ISNC 3CCJN 4KHSA 3GOIA 4FK0A 3SZ2A 4BRLA 2YCHA 1XWLA 1CXUA 2OPRA 5GIOA 1O1WA 2VYPA 1CXQA 1FJGK 5JMVA 4KI4A 1SV5A 5M1KA 5HLFA 1NK4A 3VEWA 1LAWA 3ZSWA 4DQ8A 2P9NB 4KTQA 2VG6A 5AQIA 5AQFA 4RWTA 1RT2A 5AQSA 2YV0X 3TR8A 3A5OC 3MECA 4FVUA 4B9SA 3Q7BA 3OYIA 1X9JA 4AHSA 3SCXA 4CF0A 4PY5A 1XHXA 2VGNA 4FO0A 1EWQA 4NLBA 3QBXA 4BREA 1SL0A 1VK0A 2P9IB 3VQ5A 2D1KA 3NBPA 3ENOA 2KFNA 4RTFD 3UKRA 4O55A 1SS6A 4CFBA 1BIUA 4PL7A 4M3ZA 3VENA 3QMLA 3CM5A 3TAFA 4Q0BA 3LANA 4G9ZA 3VQPA 4FJXA 2F7TA 4FJ5A 3I8DA 4JKDA 4L3QA 1WB9A 1VSLA 3ZLJA 3R1XA 4H0YB 2J4RA 4JV5K 4XH4A 2KQ2A 3AVIA 3BY5A 3D2FA 2P9KA 4ISGA 2GEMA 4JKBA 5EX5A 4DTMA 3L3VA 5C10A 4CD1A 4Z4IA 1LWEA 1ILYA 4JKGA 4M3UA 1V4TA 2JWKA 3HPGA 5HRRA 3L6QA 1RTIA 3I0RA 5HROA 1RT4A 4KTZA 3ZEUB 4DMNA 5HRPA 2O8CB 1X3NA 2CH5A 5HL7L 3LWMA 2VWKA 5AQGA 3T7ZA 2NLXA 4B3RK 1K8KB 4CEOA 5BR8K 1BGXT 3K5MA 4NCGA 3I33A 5FPEA 2XY6A 3E9LA 4A59A 1X3MA 3LWLA 3V9XA 4GV6A 4BE0A 3ZSQA 2E8AA 3CERA 2PAVA 1YVNA 2Q0UA 1S3XA 4B1WB 1VQON 1WBDA 5DK5A 3SBTA 1NKEA 2QKKA 2HHWA 4H5TA 4JI1K 1O13A 2ASOA 2HB5A 1C1CA 4C8MA 1S72N 3LDSA 2BH1A 3O9QA 1KAZA 4CF8A 4E1MA 2VCPA 1VQ7N 1HNZK 3H08A 1QSSA 4KO0A 4IXCA 5AQJA 2JLEA 3SUOA 3HOTA 3LDOA 4E1JA 3VEXA 3SQ2A 1A5WA 1Q9XA 1YI2N 3EE9A 1G15A 1JLAA 2FLOA 3LP2A 4EZ9A 3HSTB 4K42A 4JI7K 4BE1A 4G1QA 4JI2K 4A5AA 3NF7A 2ZM6K 4DQRA 5AQTA 3SBGA 2A5XA 5ADXA 4H5RA 2YJFA 2P9NA 4DV4K 5SZTA 2IS3A 4N56A 3E66A 3MWTA 4IKFA 2FBTA 2GUIA 2HHSA 3L2WA 5EXWA 4C1NI 5E26A 1QHAA 1S1UA 3HM8A 5C25A 3I55N 4Z4HA 4X62K 2A3ZA 1TK8A 4BDPA 2HNYA 3PLAA 1Q8IA 2P9IA 3J7ZO 4FXDA 3IRXA 2QWRA 4E7KA 1SKRA 2HW3A 2D5RA 4UY8O 1JLCA 3OY9A 4YOYA 2ITMA 1U49A 1QZ6A 1Q86O 4GV3A 4OJRA 4ELTA 4JD2B 2XRIA 4IG0A 4JKCA 2HSTA 2IGIA 4AHRA 3H6EA 3EZ5A 4A57A 4FJHA 4R5PA 3CCLN 4KHPK 1UWBA 3E1YA 4KPYA 3H3NO 4M3WA 3SQ0A 4NXMK 2KHOA 3QB0A 3CQ8A 3O4QA 4DQSA 4M7YA 4IJNA 2F9TA 3KWIA 4B9MA 3DOLA 1RDAA 3DXKB 4AM7A 4RW4A 1RNHA 2QWPA 3DLKA 4MDAA 3ZEUA 4MLEA 2PFUA 1ATSA 2O8CA 2O4GA 1LOTB 3SPZA 1BU6O 3C65A 3OYAA 1XMOK 3OS1A 4CD3A 3CQYA 3SAFA 1K8KA 3VA0A 4CZJA 5CE3A 3THYB 1NMDA 2X78A 1RILA 2Y1IA 4Z4CA 4OPJA 1TK0A 3AGKA 4JKFA 1U48A 3QETA 4GV9A 3S9HA 4LF6K 4ICLA 4BR5A 3OJUA 1TYQB 4I7FA 4KTWA 4MO5A 3DLEA 3HRGA 1IBLK 3IUCA 4M3YA 3N4QA 2UUCK 3D0PA 1HNWK 1TKTA 1YJNN 3CCEN 3MN5A 4RW6A 1TUUA 2HVIA 5KRSA 2XY5A 3NF6A 5AQMA 2OANA 1ASUA 4AHCA 3CC2N 4FCYA 5KGWA 3B8AX 5AQYA 3HVRA 4BDZA 2AJQA 4FLYA 1RTHA 4DV5K 3JSMA 4PL8A 3VESA 3CCRN 5J2MA 1N5YA 4BY9C 1C0UA 1ASVA 1NOYA 2HHQA 3GDQA 3HPHA 2W6LA 3MCPA 4DV3K 5LL6Z 3LPUA 1RDUA 1D4XA 1J54A 5BPLA 3P1GA 1NM1A 2G8IA 2HHUA 3AV9A 4DR5K 4CJKA 3IDHA 3LDQA 3HM9A 4DLEA 2GELA 3Q7CA 2DFHA 4I9QA 5F0XA 5CYQA 2OPQA 3MN7A 1NKBA 2ZF5O 2F4VK 4KRFA 5KI6A 1VSEA 4IO9L 3THXA 2HMIA 3B6PA 2H3GX 3U8XA 3D2EB 2WC9A 1JXBA 2Z1IA 3H1VX 4DTPA 1U04A 3OS2A 3U3YA 1Z6RA 2B5JA 2ATQA 5FROA 4B1VA 3JYTA 1RT7A 1RBTA 4B9UA 1IBKK 5KQ8A 4U67L 3KVGA 4JD2A 1UA1A 3CF5L 2NRRA 1RGIA 1YHQN 3OYJA 1CZ9A 1BI4B 5FLXO 3TSQA 4DFJA 3LP0A 1JCFA 1HNVA 2PBDA 4W5NA 3ID8A 2F8TA 1C0FA 1VHXA 3WEEB 3CXCM 3RRGA 4JKHA 1JLEA 1KAXA 4J2AA 3VQ8A 3QO9A 4CZKA 3AY9A 4ID5A 1NGJA 3O3HA 3DXKA 5I3UA 4KHNA 4CESA 1RDCA 3R3LA 1RCHA 3IFRA 3OA9A 4O5BA 1SAZA 2YI1A 1TK5A 3QEXA 4EZ6A 2FSNA 4EHUA 5I42A 3VTIA 3S3NA 2Z1HA 3PIPL 1VRTA 1FK9A 3SNNA 2PYLA 2HMPA 3O5BA 1YTAA 2P5OA 4CEAA 1KLMA 3DAWA 4CGFA 2VWJA 1KVAA 1MDUB 1HPMA 4Y0WA 3DRSA 1TYQA 5CR4A 3GG4A 3NAEA 3QNOA 3QEIA 5JVHL 3CMEN 5HOOA 5C0YA 2E88A 4LFCK 1TKDA 4YOWA 3CC7N 4F8RA 3VA3A 1Q7YO 4IEEA 5JICA 3L2RA 5M1PA 3OYKA 1WSFA 3SLCA 3HBTA 2F8SA 3CCUN 1RT3A 1HNIA 1U2VB 4M7XA 3LDLA 4HCCA 3DJCA 4U7BA 3RRHA 3A8YA 4DFPA 1NG9A 4CZMA 5AFUH 4L8RB 3H3OB 1W9HA 1GLAG 4NXNK 1KVBA 5M1FA 1W7AA 3MEGA 5BR9A 4CJ4A 4DSEA 4FPBA 2HBLA 3P31A 3V9WA 3TTDA 4C8LA 3ITHA 4HVJA 3OYNA 4AF1A 3UE5A 4FZZA 2BANA 4B8AB 3CD6N 4J8FA 1NGAA 4O8KA 1GLEG 4YOVA 1S22A 4IDHA 2RHKA 3F9MA 1S1WA 4DUZK 1NGDA 4GVEA 2NNWA 1WBBA 4CEDA 1HRHA 3NF9A 3VQQA 2FBYA 4YDUA 2P5GA 1J5EK 3WXLA 2HNZA 3MXIA 3OYEA 1GLLO 3A5LC 4KBOA 4OPHA 1FKPA 3AVLA 3OBWA 4HWIA 4BE2A 1B92A 4AH9A 1EP4A 4HTUA 4YORA 2Q31A 1HJRA 1NWKA 2GX9A 5M1NA 4JK8A 5TKWA 1XHZA 5HP1A 1LCUA 4X66K 4E7JA 3CHWA 3SV3A 2NRXA 4ELUA 3HTVA 5BREA 4GY2B 3LAKA 3U3GA 4JAXA 1XNRK 2QWMA 1HKGA 4LF4K 3U4LA 2G8HA 1MU2A 1XUPO 3O1WA 3ZX3A 5A2QO 2R7YA 4ZHRA 1D8YA 4K8ZA 3V9ZA 4FWPA 1VSMA 1S1TA 4DV7K 4K25A 5AJ3K 4O5FA 4FPAA 4JLHA 4IJAA 2DTUA 4GNIA 1D9DA 3ZX2A 4W5OA 2E2OA 2ZJRL 3C6TA 2E2QA 1IKXA 4DTNA 1L3UA 3SJHA 1RBSA 4KH6A 1VQPN 2ZWHA 3HL8A 3ZSRA 3CMAN 4BRKA 3AA4A 2DFEA 3I0SA 5E84A 1NNEA 1HQEA 3DM2A 2LSNA 2Q2RA 3LP1A 4ZTJA 3HPOA 1N34K 5AZJB 4DSKA 4H8KA 4CZLA 3EN9A 3OJSA 4B8CA 4LH4A 4CJFA 5SWMA 3LM9A 3J7YP 5AR0A 4CVNE 4JI0K 3VQ7A 2I7NA 4NO7A 1HR0K 3QFPA 1RDWX 3MX5A 1YTUA 5HRNA 2HOEA 1KLNA 1C0TA 4FJ9A 2JGUA 2NRVA 4YOXA 4FWMA 4LY7A 5AQOA 4W5QA 3MAQA 1J6ZA 3NCIA 4B9VA 4BR9A 3KLIA 3BDPA 2X6NA 4CIGA 1WSJA 4AHUA 5BRFA 5GINA 1TL3A 1SUQA 1QZ5A 2QXFA 5C42A 2Y1JA 5IT9O 4BC4A 3KLFA 1DEJA 1P90A 1VQLN 3A5NC 4C8NA 3EYZA 1ATRA 3HOSA 1NBWA 2I7PA 2D0AA 3VTHA 1X9MA 4DV2K 4LFAK 4BRPA 3TU5A 1HNXK 2RPIA 3WXMB 4A62A 2QA4N 4CGDA 2VQEK 4ELVA 3DYAA 4FWRA 3LZIA 2ZE2A 4FK2A 1ZBIA 3MWPA 4BROA 4FJGA 2QEXN 3HK2A 1S9GA 5DMRA 1SZ2A 2OA8A 2D0CA 1NK6A 1N33K 5ELZA 3DLGA 4DTOA 5C24A 1VQMN 2UYTA 5CYMA 4JI5K 3FE1A 1SQKA 3NGYA 3VEOA 3QIPA 4WQ4C 3ZSYA 4M3XA 3OBYA 2QM1A 4GVMA 4AILC 3OYFA 4RW9A 3HT3A 3KIOA 3SAGA 4DF8A 3MX2A 1YJWN 3RR8A 3L2QA 4H4OA 4RW8A 3M6GA 2ZJQL 1QSLA 5KGXA 4Z4GA 3T19A 1NOZA 5AQKA 4KFBA 4ILGB 5HRSA 4H0XB 4BQZA 4LF7K 1VQ9N 5CY4A 3ASMA 4CHQA 4CGGA 3AGRA 3E9OA 4B1ZA 3PO5A 1R59O 3PSFA 3AAPA 4LD0A 4YY3K 3DRPA 3MN9A 4FSVA 5AZIB 3AO1A 1S9EA 2FF3B 2A42A 3V6DA 2A1RA 2A41A 3OHRA 4A5BA 3VGMA 5GAHP 3AA3A 3LM2A 5JVGL 1OH7A 1C6VA 3KK1A 4DFKA 5AZJA 4CEFA 3V1RA 2YKNA 4I9LA 4E89A 5EY4A 4CJTA 4BACA 4F2RA 3WXKA 3TANA 4CGJA 2OZMA 3K2PA 5C15A 3J81O 2FSJA 4PUOA 3E9PA 1XMQK 1QQMA 2FSKA 2HHTA 5J1EA 4FLUA 1J53A 3AO5A 3JAMO 3KLEA 1IJJA 3THVA 1YXQA 5LY3A 3RWUA 4WQ5A 3KK7A 3PUFA 3CJCA 3WXIA 1N32K 4J2DA 3NDKA 1GOAA 3ZT2A 4PWDA 4CK2A 2O8EB 2G8VA 3AVBA 2GTDA 1Y97A 3L4IA 3ZX0A 4XIUA 3QDKA 2HF4A 2QW9A 2OTJN 3CFRA 3CIPA 2P1JA 4DUYK 4B3SK 3WNGA 3WQTA 1S5JA 1CLQA 2B4JA 3JXUA 3VQ4A 1REVA 4CIEA 4BGAA 3FGUA 1G99A 2WFBA 3KLGA 3VF2A 2EX3A 3DWLA 4C23A 2EWSA 3VEZA 3DLBA 3C6UA 1BDGA 1JL1A 1BQMA 2UUAK 1R0AA 2IVNA 1NU0A 3T3FA 4IO8A 3M3ZA 3TSPA 3OTOK 3THXB 1T6CA 1VSFA 4N41A 2X74A 4E3SA 3FZHA 4FOEA 3MXJA 2IC3A 4DU1A 1JLBA 1BOTO 4YDUC 5M1OA 1EXQA 3BGRA 1BQNA 2E1ZA 1JXEA 3RVCA 5CZ2A 1YITN 1NGHA 3E01A 4BWMA 1KXPA 4QOZB 4X65K 1BWFO 4ID1A 5BPNA 3U9ZA 4F3OA 3BF3A 4CERA 2PY5A 3HP9A 3IAYA 3RMDA 1LWFA 5E41A 3HJFA 2ZGZA 1YF5L 4V19S 5AQNA 4F2SA 2E2NA 2KLAA 1X9SA 4I6MB 1FW6A 3NHGA 3KTQA 2QWNA 5AZIA 5BN8A 3CCMN 4F4KA 2V7ZA 4FOIA 3VERA 4BRFA 4Z4FA 3G4SN 1HJOA 1QE1A 1M90O 2CGLA 5KPZA 1E3MA 4PKIA 3QICA 3FZMA 3QNNA 3H45C 3WQUA 3P38A 4OPKA 4FZYA 3FZKA 1D5AA 3CJ1A 3LPTA 1NK7A 3NGIA 5KPTA 4KHQA 1RT1A 1WNSA 3IG1A 4M41A 4DWIA 1C1BA 4FLZA 2KZMA 3O80A 5KQDA 3AA5X 4WFBL 1QTMA 4EFHA 1XC9A 3HXMA 5JS1A 4CF9A 2O8EA 4E7IA 4IFEA 5TKYA 3SQ4A 1LW0A 1NJZA 4B9LA 3OYDA 2OPPA 4O0JA 4YFUA 1ZXOA 1IV0A 4B3TK 3SI6A 2BGGA 2QWOA 3TPQA 2BUPA 1ATNA 1OKJA 1ZBUA 2IVPA 5BRHA 1HMVA 4JI3K 1CZBA 3TSUA 1KVCA 1NK8A 1UAXA 3BP8A 4KV8A 1Q18A 4LF5K 3VQ9A 2P9PA 2VG7A 1NMNA 1JLGA 3O4NA 1TAQA 4CK1A 4WFAL 1J5OA 1NKCA 2WBNA 4FW1A 3DLRA 4TSXA 3KD1E 2WTUA 3NE6A 4FWLA 2KFZA 2P9UB 1U6ZA 4JS4A 3OS0A 4JRPA 3L8BA 1JLFA 4BRQA 3TAGA 4J2BA 3WNFA 4FM0A 3AVGA 3QBWA 2YKMA 2P9LB 1HYVA 4CBWA 2AA4A 3OYLA 4KHUA 3OYBA 1MWMA 1VQNN 3TTCA 1C0MA 1DT9A 2D0OA 4CHNA 2QTDA 5LMUK 3MEDA 1BA1A 4IOXA 3F2KA 3IMXA 4X64K 4EIAA 2NRZA 3CFOA 3S3MA 1SL2A 3KD5E 2E4LA 4CZFA 1RBRA 4DV0K 1QQOA 1WSIA 2Q1NA 4FWSA 2ZGYA 4Z0UA 4CGIA 3R8EA 2YHYA 4H4MA 5FRNA 4I6MA 3UKUA 3SMSA 5BPMA 4AHTA 2DFFA 4JS5A 3CJ9A 1W0HA 1SKWA 1N36K 4B3OA 3M5RA 3FFIA 3BEXA 1JL2A 2P9SB 4OPAA 3P39A 4HUEA 1S6QA 4B1UB 3ATUA 3LAMA 4M63C 1RT6A 1J9AA 1JKHA 3A2FA 2YJEA 2FC0A 2G8FA 3BZCA 1TKZA 3OYGA 3O9SA 3CJAA 3PO4A 3K59A 3AARA 4EHTA 3ULDA 4RW7A 1XNQK 4O44A 5J2PA 2E2PA 2NRHA 3KKRA 4DR2K 3NMUA 4KH5A 4BVOA 4FJ7A 2ASMA 1OVQA 1BL3A 1QVGM 1WAJA 1ITGA 2CH6A 3ID6A 4OLBA 1KFDA 3TAMA 3IS9A 4DSIA 5FRMA 1EKEA 4J2EA 4F3TA 3PX0A 4B1YB 4WYBA 4CJLA 1C0GA 1Y64A 1ZC6A 1U45A 3M8SA 1VSJA 4NLCA 3TAPA 1HYZA 4B08A 3RTVA 3RMCA 1X9WA 3AVHA 1Z25A 4WQ5C 4ZTFA 3JS6A 2VQFK 1LV5A 2E6LA 4CJQA 2QXLA 4KB0A 1B9DA 4BRMA 1BUPA 2YNHA 3LP3A 3AVNA 1YIJN 4Y1DA 3WXJA 4CEBA 4ISFA 3FZFA 5HBMA 4CFDA 4CJRA 1T8EA 1BISA 2RE2A 2P9UA 3IKMA 3P83D 3CPEA 3H1QA 3ZSVA 3V9SA 5M1QA 1IH7A 2P9LA 3HVTA 4DLGA 1KQSM 2VG5A 3HZ6A 4DTRA 3OYCA 1T05A 4RG8A 2O8BB 4FVMA 4IOCL 4FLWA 2OCEA 2WOMA 1IBMK 4LSNA 5AQWA 4BRAA 4BR2A 4A2AA 3K9KA 4M45A 5FPDA 1LAVA 4FLVA 3LZJA 3EY1A 3A0IX 1LW2A 3B6OA 4CIFA 3C7NB 4K0KK 4DR7K 4H5VA 2KTQA 3QESA 3MDQA 5BRDA 1DKGD 2QWQA 3WNHA 4KH4A 3THWB 2D0BA 1WLJA 3ULEB 4H0PA 2HBKA 3C6HA 3NH1A 3LALA 5AQXA 3G0ZA 2P9SA 2XHBA 5CHIA 4CBXA 4DFMA 4ISEA 3V1OA 3HI0A 3HYFA 3C94A 4DR1K 4E7HA 1E4FT 4RCHA 4CHOA 4BR7A 3PX6A 4YHHK 1KFSA 2HHXA 5ADXH 1I39A 2P51A 3NGZA 4KHYA 5FPNA 4OO1J 2NZTA 4A2BA 4CECA 4WF9L 2HNDA 2V7YA 3CYMA 3MK6A 4DKWA 3NVMA 3FR0A 3FZLA 3RSEB 4CI6A 4FM2A 2V51B 4CJ7A 3G71N 5FPMA 3AVMA 1KAYA 1L3VA 3M1FA 4CZHA 1NJWA 4GKKK 3ZSZA 4IBNA 3PIOL 1OH5A 3SAHA 1CZAN 4MFBA 2ASPA 4O4GA 4LFBK 4ILJA 1KRPA 1KD1O 3K57A 3LDNA 3WUHA 5C12A 3O3GA 5CZ1A 3VGKA 1F21A 1JCGA 3W0LA 4FM1A 3V1QA 1S1VA 1VQ8N 1NK5A 4LF8K 4FJKA 2HHVA 1NJYA 5AQZA 2HBMA 1MWKA 4CEZA 4K8XA 3O9UA 4OGEA 3QEVA 4CW7B 3ZT4A 1NLVA 3MCAB 4M3TA 2D4WA 4XH1A 1Q82O 3KK3A 3O8MA 3KJVA 4Q5VA 3ZSOA
chains in the Genus database with same CATH topology
4JV5K 4LF9K 4DV3K 5LL6Z 4K0KK 4DR7K 4LFCK 4DR5K 2UUAK 4B3TK 3J7AP 1N34K 4B3MK 4LF7K 1XNQK 2F4VK 4JYAK 3OTOK 3T1HK 4DR3K 4DR2K 5IWAK 2UXBK 4JI3K 3J7YP 4B3RK 4KHPK 4NXNK 2HHHK 5BR8K 4CVNE 4DR1K 4JI0K 4YY3K 1HR0K 4NXMK 4YHHK 4LF5K 4OX9K 1FJGK 4DV6K 2UU9K 1IBKK 4AQYK 4JI6K 4X65K 4JI4K 4JI1K 4GKJK 1I94K 4DR6K 4DUZK 5FLXO 2VQFK 1XMOK 5LMNK 4V19S 1HNZK 3J81O 4GKKK 1J5EK 5IT9O 4DV1K 1XMQK 4LFBK 2E5LK 5LMUK 3T1YK 3JAMO 4LF6K 4X64K 4JI7K 4JI2K 1IBLK 2ZM6K 4DV2K 4LFAK 4X66K 1N32K 2UUCK 1HNWK 1HNXK 4DV4K 4DV0K 4JI8K 4DR4K 4LF8K 2VQEK 2UUBK 1XNRK 4DUYK 4CW7B 4LF4K 4B3SK 2UXDK 1N33K 4X62K 5A2QO 3J80O 1N36K 1IBMK 4JI5K 4DV5K 4DV7K 5AJ3K 2UXCK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 K;  4LF9 K;  4DV3 K;  5LL6 Z;  4K0K K;  4DR7 K;  4LFC K;  4DR5 K;  2UUA K;  4B3T K;  3J7A P;  1N34 K;  4B3M K;  4LF7 K;  1XNQ K;  2F4V K;  4JYA K;  3OTO K;  3T1H K;  4DR3 K;  4DR2 K;  5IWA K;  2UXB K;  4JI3 K;  3J7Y P;  4B3R K;  4KHP K;  4NXN K;  2HHH K;  5BR8 K;  4CVN E;  4DR1 K;  4JI0 K;  4YY3 K;  1HR0 K;  4NXM K;  4YHH K;  4LF5 K;  4OX9 K;  1FJG K;  4DV6 K;  2UU9 K;  1IBK K;  4AQY K;  4JI6 K;  4X65 K;  4JI4 K;  4JI1 K;  4GKJ K;  1I94 K;  4DR6 K;  4DUZ K;  5FLX O;  2VQF K;  1XMO K;  5LMN K;  4V19 S;  1HNZ K;  3J81 O;  4GKK K;  1J5E K;  5IT9 O;  4DV1 K;  1XMQ K;  4LFB K;  2E5L K;  5LMU K;  3T1Y K;  3JAM O;  4LF6 K;  4X64 K;  4JI7 K;  4JI2 K;  1IBL K;  2ZM6 K;  4DV2 K;  4LFA K;  4X66 K;  1N32 K;  2UUC K;  1HNW K;  1HNX K;  4DV4 K;  4DV0 K;  4JI8 K;  4DR4 K;  4LF8 K;  2VQE K;  2UUB K;  1XNR K;  4DUY K;  4CW7 B;  4LF4 K;  4B3S K;  2UXD K;  1N33 K;  4X62 K;  5A2Q O;  3J80 O;  1N36 K;  1IBM K;  4JI5 K;  4DV5 K;  4DV7 K;  5AJ3 K;  2UXC K; 
#chains in the Genus database with same CATH topology
 4CBU A;  3SK3 A;  3F73 A;  3V9U A;  4C8O A;  4BRG A;  2RKI A;  3C6A A;  4E1N A;  1QQN A;  1WSE A;  2G8W A;  1UA0 A;  4PQU A;  3MMV A;  3MEE A;  2O8B A;  4B1X B;  2XY7 A;  1HLU A;  4CZI A;  2WUS A;  1RTJ A;  3NF8 A;  2YNI A;  3N4P A;  3K5L A;  4CJU A;  4JYA K;  1TAU A;  3ALY A;  4QS7 A;  4FJ8 A;  3QIN A;  3FFK B;  3HSC A;  1QVF M;  3C7N A;  3KLH A;  1NK9 A;  1VQ4 N;  1WUA A;  5EVZ A;  2BTF A;  3OVN A;  5LJV A;  1RTD A;  1GLB G;  3VQB A;  1H1V A;  2B6A A;  2ITG A;  4IFY A;  1Z26 A;  2UU9 K;  3ZET A;  4DSF A;  2YHX A;  3THW A;  4XEI A;  4JI4 K;  2W42 A;  3ULE A;  3D7E O;  1YVU A;  2IDO A;  5JLH A;  4WFN L;  4CJ3 A;  2CGJ A;  4DR6 K;  2G8U A;  1HUX A;  1RT5 A;  3DLL L;  1L5U A;  3UIQ A;  4O0I A;  3KKS A;  4CHZ A;  4UQG A;  3TAB A;  4CK3 A;  2I5J A;  4C1N K;  3QER A;  1QQC A;  2EHG A;  2IAJ A;  2NUB A;  3CG7 A;  4BQL A;  2O8F B;  5AFU A;  2QI2 A;  4M3R A;  4Z94 A;  4JEP A;  4BDY A;  3CFP A;  3K9J A;  1IG9 A;  4DQQ A;  3RMA A;  1QS4 A;  2IOC A;  3RSE A;  3CC4 N;  4DQP A;  2FXU A;  1Q81 O;  3BF1 A;  3UB5 A;  4CJP A;  1EQY A;  2GWJ A;  1JLQ A;  3AVJ A;  4PKH A;  4DU4 A;  1D9F A;  4FJL A;  1EO1 A;  5GAE P;  2UXD K;  1OVY A;  3SUQ A;  2FBX A;  2CGK A;  4F9O A;  3L2V A;  4JKE A;  4JK9 A;  3VQD A;  1QSY A;  5B8H A;  3PV8 A;  1BIZ A;  3CI5 A;  4DTJ A;  2VGM A;  1NGC A;  1NJI O;  2RN2 A;  5EU7 A;  1OH6 A;  1C1A A;  2NRW A;  2YHA A;  2WON A;  3QEP A;  4FLX A;  4CCH A;  4B3M K;  1VSD A;  4DR3 K;  3SYZ A;  3L2U A;  4KKO A;  4FWK A;  5F1X A;  1RDD A;  3ENB A;  4CZE A;  3AVK A;  2A40 A;  2P9P B;  1BA0 A;  2IIR A;  4NYN A;  1YT3 A;  5KRT A;  1T03 A;  1IO2 A;  5AQR A;  2DY4 A;  4H0O A;  4CJW A;  4H0V B;  4PKG A;  4AQY K;  1VQ6 N;  3EE8 A;  2GV9 A;  4CJS A;  2FF6 A;  3VEY A;  2OYQ A;  4GKJ K;  5KTQ A;  1T6D A;  1GOC A;  1VRU A;  2ZQB A;  4OKK A;  3GBT A;  3TAR A;  3VOV A;  2XY8 A;  1YAG A;  4BG9 A;  4FWN A;  4XH5 A;  3T1Y K;  4LSL A;  4IZ9 A;  1MA9 B;  4CHY A;  3LL3 A;  4BG8 A;  4YOU A;  3AO4 A;  4IWV A;  2DPN A;  3KHY A;  2JWL A;  1ESV A;  4H0T B;  3CM6 A;  3D45 A;  3DXM B;  2Q3S A;  3CCV N;  1VSI A;  4DS5 A;  1FKO A;  4JI8 K;  4HCB A;  4DG1 A;  1RDB A;  1IG8 A;  1V4S A;  3UKU B;  3K58 A;  2KZZ A;  3NFA A;  3QIO A;  4R79 A;  2NRT A;  4FJN A;  1KCF A;  4NB4 A;  4MDB A;  3CPW M;  4BRI A;  3C95 A;  1SL1 A;  3ZSX A;  1DGK N;  2O8F A;  4CEQ A;  3CCS N;  5GAG P;  1L3T A;  5D3G A;  3M8P A;  1Q9Y A;  4IEI A;  4OKJ A;  3V4I A;  4LF9 K;  3VQE A;  4B9Q A;  3QLH A;  2W41 A;  2PZS A;  1HKB A;  3DLH A;  4OKE A;  4BWJ A;  2GBZ A;  3W3D A;  3T69 A;  4EAH D;  1FXX A;  4JHD B;  3VF4 A;  3KK2 A;  1TUY A;  1LWC A;  4OVL A;  4EP4 A;  3RMB A;  1T7P A;  1NGF A;  3WNE A;  4I2P A;  1KSP A;  4BR0 A;  5AQV A;  4A61 A;  2W6K A;  5IWA K;  3M8Q A;  3AO3 A;  1UOC A;  3VET A;  4JN4 A;  3T1A A;  1DTQ A;  3P5J A;  3TAE A;  2QK9 A;  3O9T A;  1RFQ A;  3R9P A;  3O9R A;  4OX9 K;  2G8K A;  4N47 A;  4DF4 A;  4NCA A;  2O8D B;  2KKZ A;  4CEE A;  2YNG A;  4FYD A;  1I94 K;  3QFU A;  3F9K A;  3R6M A;  1WOQ A;  4I2Q A;  5I9E B;  5LMN K;  4OGC A;  4DSL A;  4LC9 B;  3S3O A;  1X1P A;  3EKU A;  3WT0 A;  3PX4 A;  1NJX A;  3GE1 A;  3SUN A;  1XQS C;  1ZBS A;  3TI0 A;  3VQA A;  4PHT X;  1E4G T;  4MQ3 A;  3EO3 A;  4AHV A;  2OZS A;  4BR4 A;  3ZYY X;  4QAG A;  2ZD1 A;  1GLC G;  4ILH A;  5DM7 L;  2F9W A;  3SV4 A;  3EEQ A;  1ZYQ A;  4HTL A;  3PY8 A;  4N5S A;  1GLF O;  4H03 B;  3P4I A;  1NGI A;  2UUB K;  1JCE A;  4KHW A;  3OYH A;  3RR7 A;  2YNF A;  4KI6 A;  2HVH A;  3V81 A;  4FZX C;  4AM6 A;  3O08 A;  5KPR A;  4E7L A;  3J80 O;  3VPZ A;  4CFC A;  1BHL A;  1BCO A;  4WQ4 A;  1VSH A;  3CCQ N;  4MLH A;  3GL1 A;  1XI1 A;  3L3U A;  3DXM A;  3SJJ A;  4DB3 A;  4CJ5 A;  5GAD P;  2QWL A;  4FLT A;  3FLC O;  1N6Q A;  3J7A P;  5AQH A;  1W2B M;  3U6F A;  2E6M A;  3G6E N;  3O4W A;  5FDL A;  2Q0R A;  1BG3 A;  1VQ5 N;  3T1H K;  3ZT1 A;  3NH0 A;  1EET A;  2HHH K;  2PYJ A;  2QKB A;  4IDK A;  4BRN A;  2OPS A;  3ZCM A;  4FW2 A;  1L3S A;  5JS2 A;  4BRC A;  3O1B A;  2ZJP L;  3NVK A;  3CJ7 A;  1A5X A;  5BN9 A;  4BRH A;  4KAZ A;  4DTX A;  4B9N A;  4BVP A;  4JHD A;  1DTT A;  4K41 A;  5F2R A;  5C2F A;  3NH2 A;  3L0Q A;  1TGO A;  3H46 O;  4CFA A;  4DHY A;  3HP6 A;  1NGE A;  4DQI A;  4CE9 A;  3SUP A;  3A5M C;  3O6W A;  1WAF A;  5J2N A;  3BUZ B;  1WSH A;  1B9F A;  1EX4 A;  4FWQ A;  4DTS A;  5K14 A;  3SPY A;  1YJ9 N;  1K9M O;  1WSG A;  2FBV A;  1S1X A;  1GLD G;  3CJB A;  1OH8 A;  4H5W A;  1GLJ O;  1NGB A;  3THY A;  5EOY A;  1VAZ A;  3VN5 A;  3VQC A;  2HF3 A;  2E1Y A;  4CHP A;  4K43 A;  3KWG A;  2V52 B;  1IKV A;  4C8K A;  3K0S A;  5AQL A;  2Z1G A;  4E0D A;  4FK4 A;  3ZT0 A;  2OTL N;  4OLA A;  2O8D A;  2AP1 A;  4W5R A;  3I56 N;  1S6P A;  4DR4 K;  4BRD A;  3KZB A;  1N8R O;  4FJI A;  1I3A A;  4CJV A;  3TWH A;  1SKS A;  2YHB A;  1YUW A;  1HQU A;  4IG3 A;  4CF1 A;  4BC5 A;  5GIP A;  1HKC A;  4FJJ A;  1K6Y A;  3L4Q A;  5T7B A;  1TVR A;  4DS4 A;  4QS8 A;  2Q97 A;  1NGG A;  5H1S Q;  3AVC A;  4QS9 A;  3G10 A;  4E19 A;  1ZBF A;  3QEW A;  1M1K O;  3VF6 A;  3S41 A;  4BC3 A;  4DSJ A;  1RBV A;  4IFV A;  4W5T A;  4CJE A;  1VSK A;  2YHW A;  4N76 A;  1HX1 A;  2ETJ A;  1VQK N;  2E20 A;  2F96 A;  3HO1 A;  3PSI A;  4FJM A;  1IKW A;  3J8A A;  2O4I A;  2BE2 A;  1BCM A;  4JNE A;  3OW2 M;  1RBU A;  1W97 L;  2IVO A;  4PA1 A;  5AQQ A;  4LH5 A;  5C2D A;  5DM6 L;  4Y1C A;  4DCH A;  3D2E A;  3CET A;  2GUP A;  3EL2 A;  4BC2 A;  1P8Z A;  1WN7 A;  3DOK A;  4CGH A;  2RF2 A;  2YX6 A;  1BO5 O;  4YOT A;  1KC8 O;  3AAQ A;  3ZET B;  4DV6 K;  1DLO A;  3LDP A;  2HBJ A;  1U47 A;  3AVA A;  4JI6 K;  3DMJ A;  4HUF A;  4KRE A;  3UKR B;  1K8A O;  3DRR A;  1KTQ A;  3O3F A;  3MN6 A;  3VQ6 A;  1EWR A;  4YNQ A;  1BI4 A;  1HPZ A;  4CF2 A;  1T44 A;  3AA2 A;  3U9D A;  2XO7 A;  4DV1 K;  2BDP A;  4NYF A;  3CQX A;  4JK7 A;  3WEE A;  1XC3 A;  2E5L K;  3AVF A;  1A5V A;  1HYS A;  2D0P A;  3VMF B;  3SQ1 A;  4M42 A;  2A1S A;  3G25 A;  2KW4 A;  3DI6 A;  1ASW A;  2VWB A;  4GW6 A;  4MO4 A;  3D2F B;  4HHT A;  4IOA L;  2P9K B;  2GWK A;  3K5O A;  3OYM A;  4FL9 A;  4JKA A;  3VGL A;  4QCL A;  5JLF A;  2W40 A;  4JKG B;  3VEV A;  3K5N A;  3AO2 A;  4H5N A;  4JRQ A;  3TAQ A;  4B9T A;  3ZT3 A;  5J2Q A;  2Z1J A;  1JJ2 M;  3ENH A;  1U4B A;  2Q36 A;  4NCB A;  3EKS A;  4DTU A;  3I8B A;  2X6S A;  4CZG A;  3ATV A;  3BZK A;  4O8U A;  4GMJ B;  5LJW A;  2UXC K;  1Z05 A;  3M8R A;  1QHT A;  3TTF A;  5MLC Q;  3D6R A;  4HUG A;  3EZW A;  4Z4E A;  1TV6 A;  3C0B A;  1K73 O;  1ZBH A;  1GOB A;  4FWO A;  4BGB A;  2A6A A;  5AQU A;  1U2V A;  1IKY A;  4WCE L;  3MXM A;  1T3V A;  1ZBL A;  4KB1 A;  3F5T A;  5AQP A;  1NK0 A;  4EP5 A;  3SMP A;  2UXB K;  1TKX A;  4WE1 A;  4DU3 A;  1TL1 A;  3ISN C;  3CCJ N;  4KHS A;  3GOI A;  4FK0 A;  3SZ2 A;  4BRL A;  2YCH A;  1XWL A;  1CXU A;  2OPR A;  5GIO A;  1O1W A;  2VYP A;  1CXQ A;  1FJG K;  5JMV A;  4KI4 A;  1SV5 A;  5M1K A;  5HLF A;  1NK4 A;  3VEW A;  1LAW A;  3ZSW A;  4DQ8 A;  2P9N B;  4KTQ A;  2VG6 A;  5AQI A;  5AQF A;  4RWT A;  1RT2 A;  5AQS A;  2YV0 X;  3TR8 A;  3A5O C;  3MEC A;  4FVU A;  4B9S A;  3Q7B A;  3OYI A;  1X9J A;  4AHS A;  3SCX A;  4CF0 A;  4PY5 A;  1XHX A;  2VGN A;  4FO0 A;  1EWQ A;  4NLB A;  3QBX A;  4BRE A;  1SL0 A;  1VK0 A;  2P9I B;  3VQ5 A;  2D1K A;  3NBP A;  3ENO A;  2KFN A;  4RTF D;  3UKR A;  4O55 A;  1SS6 A;  4CFB A;  1BIU A;  4PL7 A;  4M3Z A;  3VEN A;  3QML A;  3CM5 A;  3TAF A;  4Q0B A;  3LAN A;  4G9Z A;  3VQP A;  4FJX A;  2F7T A;  4FJ5 A;  3I8D A;  4JKD A;  4L3Q A;  1WB9 A;  1VSL A;  3ZLJ A;  3R1X A;  4H0Y B;  2J4R A;  4JV5 K;  4XH4 A;  2KQ2 A;  3AVI A;  3BY5 A;  3D2F A;  2P9K A;  4ISG A;  2GEM A;  4JKB A;  5EX5 A;  4DTM A;  3L3V A;  5C10 A;  4CD1 A;  4Z4I A;  1LWE A;  1ILY A;  4JKG A;  4M3U A;  1V4T A;  2JWK A;  3HPG A;  5HRR A;  3L6Q A;  1RTI A;  3I0R A;  5HRO A;  1RT4 A;  4KTZ A;  3ZEU B;  4DMN A;  5HRP A;  2O8C B;  1X3N A;  2CH5 A;  5HL7 L;  3LWM A;  2VWK A;  5AQG A;  3T7Z A;  2NLX A;  4B3R K;  1K8K B;  4CEO A;  5BR8 K;  1BGX T;  3K5M A;  4NCG A;  3I33 A;  5FPE A;  2XY6 A;  3E9L A;  4A59 A;  1X3M A;  3LWL A;  3V9X A;  4GV6 A;  4BE0 A;  3ZSQ A;  2E8A A;  3CER A;  2PAV A;  1YVN A;  2Q0U A;  1S3X A;  4B1W B;  1VQO N;  1WBD A;  5DK5 A;  3SBT A;  1NKE A;  2QKK A;  2HHW A;  4H5T A;  4JI1 K;  1O13 A;  2ASO A;  2HB5 A;  1C1C A;  4C8M A;  1S72 N;  3LDS A;  2BH1 A;  3O9Q A;  1KAZ A;  4CF8 A;  4E1M A;  2VCP A;  1VQ7 N;  1HNZ K;  3H08 A;  1QSS A;  4KO0 A;  4IXC A;  5AQJ A;  2JLE A;  3SUO A;  3HOT A;  3LDO A;  4E1J A;  3VEX A;  3SQ2 A;  1A5W A;  1Q9X A;  1YI2 N;  3EE9 A;  1G15 A;  1JLA A;  2FLO A;  3LP2 A;  4EZ9 A;  3HST B;  4K42 A;  4JI7 K;  4BE1 A;  4G1Q A;  4JI2 K;  4A5A A;  3NF7 A;  2ZM6 K;  4DQR A;  5AQT A;  3SBG A;  2A5X A;  5ADX A;  4H5R A;  2YJF A;  2P9N A;  4DV4 K;  5SZT A;  2IS3 A;  4N56 A;  3E66 A;  3MWT A;  4IKF A;  2FBT A;  2GUI A;  2HHS A;  3L2W A;  5EXW A;  4C1N I;  5E26 A;  1QHA A;  1S1U A;  3HM8 A;  5C25 A;  3I55 N;  4Z4H A;  4X62 K;  2A3Z A;  1TK8 A;  4BDP A;  2HNY A;  3PLA A;  1Q8I A;  2P9I A;  3J7Z O;  4FXD A;  3IRX A;  2QWR A;  4E7K A;  1SKR A;  2HW3 A;  2D5R A;  4UY8 O;  1JLC A;  3OY9 A;  4YOY A;  2ITM A;  1U49 A;  1QZ6 A;  1Q86 O;  4GV3 A;  4OJR A;  4ELT A;  4JD2 B;  2XRI A;  4IG0 A;  4JKC A;  2HST A;  2IGI A;  4AHR A;  3H6E A;  3EZ5 A;  4A57 A;  4FJH A;  4R5P A;  3CCL N;  4KHP K;  1UWB A;  3E1Y A;  4KPY A;  3H3N O;  4M3W A;  3SQ0 A;  4NXM K;  2KHO A;  3QB0 A;  3CQ8 A;  3O4Q A;  4DQS A;  4M7Y A;  4IJN A;  2F9T A;  3KWI A;  4B9M A;  3DOL A;  1RDA A;  3DXK B;  4AM7 A;  4RW4 A;  1RNH A;  2QWP A;  3DLK A;  4MDA A;  3ZEU A;  4MLE A;  2PFU A;  1ATS A;  2O8C A;  2O4G A;  1LOT B;  3SPZ A;  1BU6 O;  3C65 A;  3OYA A;  1XMO K;  3OS1 A;  4CD3 A;  3CQY A;  3SAF A;  1K8K A;  3VA0 A;  4CZJ A;  5CE3 A;  3THY B;  1NMD A;  2X78 A;  1RIL A;  2Y1I A;  4Z4C A;  4OPJ A;  1TK0 A;  3AGK A;  4JKF A;  1U48 A;  3QET A;  4GV9 A;  3S9H A;  4LF6 K;  4ICL A;  4BR5 A;  3OJU A;  1TYQ B;  4I7F A;  4KTW A;  4MO5 A;  3DLE A;  3HRG A;  1IBL K;  3IUC A;  4M3Y A;  3N4Q A;  2UUC K;  3D0P A;  1HNW K;  1TKT A;  1YJN N;  3CCE N;  3MN5 A;  4RW6 A;  1TUU A;  2HVI A;  5KRS A;  2XY5 A;  3NF6 A;  5AQM A;  2OAN A;  1ASU A;  4AHC A;  3CC2 N;  4FCY A;  5KGW A;  3B8A X;  5AQY A;  3HVR A;  4BDZ A;  2AJQ A;  4FLY A;  1RTH A;  4DV5 K;  3JSM A;  4PL8 A;  3VES A;  3CCR N;  5J2M A;  1N5Y A;  4BY9 C;  1C0U A;  1ASV A;  1NOY A;  2HHQ A;  3GDQ A;  3HPH A;  2W6L A;  3MCP A;  4DV3 K;  5LL6 Z;  3LPU A;  1RDU A;  1D4X A;  1J54 A;  5BPL A;  3P1G A;  1NM1 A;  2G8I A;  2HHU A;  3AV9 A;  4DR5 K;  4CJK A;  3IDH A;  3LDQ A;  3HM9 A;  4DLE A;  2GEL A;  3Q7C A;  2DFH A;  4I9Q A;  5F0X A;  5CYQ A;  2OPQ A;  3MN7 A;  1NKB A;  2ZF5 O;  2F4V K;  4KRF A;  5KI6 A;  1VSE A;  4IO9 L;  3THX A;  2HMI A;  3B6P A;  2H3G X;  3U8X A;  3D2E B;  2WC9 A;  1JXB A;  2Z1I A;  3H1V X;  4DTP A;  1U04 A;  3OS2 A;  3U3Y A;  1Z6R A;  2B5J A;  2ATQ A;  5FRO A;  4B1V A;  3JYT A;  1RT7 A;  1RBT A;  4B9U A;  1IBK K;  5KQ8 A;  4U67 L;  3KVG A;  4JD2 A;  1UA1 A;  3CF5 L;  2NRR A;  1RGI A;  1YHQ N;  3OYJ A;  1CZ9 A;  1BI4 B;  5FLX O;  3TSQ A;  4DFJ A;  3LP0 A;  1JCF A;  1HNV A;  2PBD A;  4W5N A;  3ID8 A;  2F8T A;  1C0F A;  1VHX A;  3WEE B;  3CXC M;  3RRG A;  4JKH A;  1JLE A;  1KAX A;  4J2A A;  3VQ8 A;  3QO9 A;  4CZK A;  3AY9 A;  4ID5 A;  1NGJ A;  3O3H A;  3DXK A;  5I3U A;  4KHN A;  4CES A;  1RDC A;  3R3L A;  1RCH A;  3IFR A;  3OA9 A;  4O5B A;  1SAZ A;  2YI1 A;  1TK5 A;  3QEX A;  4EZ6 A;  2FSN A;  4EHU A;  5I42 A;  3VTI A;  3S3N A;  2Z1H A;  3PIP L;  1VRT A;  1FK9 A;  3SNN A;  2PYL A;  2HMP A;  3O5B A;  1YTA A;  2P5O A;  4CEA A;  1KLM A;  3DAW A;  4CGF A;  2VWJ A;  1KVA A;  1MDU B;  1HPM A;  4Y0W A;  3DRS A;  1TYQ A;  5CR4 A;  3GG4 A;  3NAE A;  3QNO A;  3QEI A;  5JVH L;  3CME N;  5HOO A;  5C0Y A;  2E88 A;  4LFC K;  1TKD A;  4YOW A;  3CC7 N;  4F8R A;  3VA3 A;  1Q7Y O;  4IEE A;  5JIC A;  3L2R A;  5M1P A;  3OYK A;  1WSF A;  3SLC A;  3HBT A;  2F8S A;  3CCU N;  1RT3 A;  1HNI A;  1U2V B;  4M7X A;  3LDL A;  4HCC A;  3DJC A;  4U7B A;  3RRH A;  3A8Y A;  4DFP A;  1NG9 A;  4CZM A;  5AFU H;  4L8R B;  3H3O B;  1W9H A;  1GLA G;  4NXN K;  1KVB A;  5M1F A;  1W7A A;  3MEG A;  5BR9 A;  4CJ4 A;  4DSE A;  4FPB A;  2HBL A;  3P31 A;  3V9W A;  3TTD A;  4C8L A;  3ITH A;  4HVJ A;  3OYN A;  4AF1 A;  3UE5 A;  4FZZ A;  2BAN A;  4B8A B;  3CD6 N;  4J8F A;  1NGA A;  4O8K A;  1GLE G;  4YOV A;  1S22 A;  4IDH A;  2RHK A;  3F9M A;  1S1W A;  4DUZ K;  1NGD A;  4GVE A;  2NNW A;  1WBB A;  4CED A;  1HRH A;  3NF9 A;  3VQQ A;  2FBY A;  4YDU A;  2P5G A;  1J5E K;  3WXL A;  2HNZ A;  3MXI A;  3OYE A;  1GLL O;  3A5L C;  4KBO A;  4OPH A;  1FKP A;  3AVL A;  3OBW A;  4HWI A;  4BE2 A;  1B92 A;  4AH9 A;  1EP4 A;  4HTU A;  4YOR A;  2Q31 A;  1HJR A;  1NWK A;  2GX9 A;  5M1N A;  4JK8 A;  5TKW A;  1XHZ A;  5HP1 A;  1LCU A;  4X66 K;  4E7J A;  3CHW A;  3SV3 A;  2NRX A;  4ELU A;  3HTV A;  5BRE A;  4GY2 B;  3LAK A;  3U3G A;  4JAX A;  1XNR K;  2QWM A;  1HKG A;  4LF4 K;  3U4L A;  2G8H A;  1MU2 A;  1XUP O;  3O1W A;  3ZX3 A;  5A2Q O;  2R7Y A;  4ZHR A;  1D8Y A;  4K8Z A;  3V9Z A;  4FWP A;  1VSM A;  1S1T A;  4DV7 K;  4K25 A;  5AJ3 K;  4O5F A;  4FPA A;  4JLH A;  4IJA A;  2DTU A;  4GNI A;  1D9D A;  3ZX2 A;  4W5O A;  2E2O A;  2ZJR L;  3C6T A;  2E2Q A;  1IKX A;  4DTN A;  1L3U A;  3SJH A;  1RBS A;  4KH6 A;  1VQP N;  2ZWH A;  3HL8 A;  3ZSR A;  3CMA N;  4BRK A;  3AA4 A;  2DFE A;  3I0S A;  5E84 A;  1NNE A;  1HQE A;  3DM2 A;  2LSN A;  2Q2R A;  3LP1 A;  4ZTJ A;  3HPO A;  1N34 K;  5AZJ B;  4DSK A;  4H8K A;  4CZL A;  3EN9 A;  3OJS A;  4B8C A;  4LH4 A;  4CJF A;  5SWM A;  3LM9 A;  3J7Y P;  5AR0 A;  4CVN E;  4JI0 K;  3VQ7 A;  2I7N A;  4NO7 A;  1HR0 K;  3QFP A;  1RDW X;  3MX5 A;  1YTU A;  5HRN A;  2HOE A;  1KLN A;  1C0T A;  4FJ9 A;  2JGU A;  2NRV A;  4YOX A;  4FWM A;  4LY7 A;  5AQO A;  4W5Q A;  3MAQ A;  1J6Z A;  3NCI A;  4B9V A;  4BR9 A;  3KLI A;  3BDP A;  2X6N A;  4CIG A;  1WSJ A;  4AHU A;  5BRF A;  5GIN A;  1TL3 A;  1SUQ A;  1QZ5 A;  2QXF A;  5C42 A;  2Y1J A;  5IT9 O;  4BC4 A;  3KLF A;  1DEJ A;  1P90 A;  1VQL N;  3A5N C;  4C8N A;  3EYZ A;  1ATR A;  3HOS A;  1NBW A;  2I7P A;  2D0A A;  3VTH A;  1X9M A;  4DV2 K;  4LFA K;  4BRP A;  3TU5 A;  1HNX K;  2RPI A;  3WXM B;  4A62 A;  2QA4 N;  4CGD A;  2VQE K;  4ELV A;  3DYA A;  4FWR A;  3LZI A;  2ZE2 A;  4FK2 A;  1ZBI A;  3MWP A;  4BRO A;  4FJG A;  2QEX N;  3HK2 A;  1S9G A;  5DMR A;  1SZ2 A;  2OA8 A;  2D0C A;  1NK6 A;  1N33 K;  5ELZ A;  3DLG A;  4DTO A;  5C24 A;  1VQM N;  2UYT A;  5CYM A;  4JI5 K;  3FE1 A;  1SQK A;  3NGY A;  3VEO A;  3QIP A;  4WQ4 C;  3ZSY A;  4M3X A;  3OBY A;  2QM1 A;  4GVM A;  4AIL C;  3OYF A;  4RW9 A;  3HT3 A;  3KIO A;  3SAG A;  4DF8 A;  3MX2 A;  1YJW N;  3RR8 A;  3L2Q A;  4H4O A;  4RW8 A;  3M6G A;  2ZJQ L;  1QSL A;  5KGX A;  4Z4G A;  3T19 A;  1NOZ A;  5AQK A;  4KFB A;  4ILG B;  5HRS A;  4H0X B;  4BQZ A;  4LF7 K;  1VQ9 N;  5CY4 A;  3ASM A;  4CHQ A;  4CGG A;  3AGR A;  3E9O A;  4B1Z A;  3PO5 A;  1R59 O;  3PSF A;  3AAP A;  4LD0 A;  4YY3 K;  3DRP A;  3MN9 A;  4FSV A;  5AZI B;  3AO1 A;  1S9E A;  2FF3 B;  2A42 A;  3V6D A;  2A1R A;  2A41 A;  3OHR A;  4A5B A;  3VGM A;  5GAH P;  3AA3 A;  3LM2 A;  5JVG L;  1OH7 A;  1C6V A;  3KK1 A;  4DFK A;  5AZJ A;  4CEF A;  3V1R A;  2YKN A;  4I9L A;  4E89 A;  5EY4 A;  4CJT A;  4BAC A;  4F2R A;  3WXK A;  3TAN A;  4CGJ A;  2OZM A;  3K2P A;  5C15 A;  3J81 O;  2FSJ A;  4PUO A;  3E9P A;  1XMQ K;  1QQM A;  2FSK A;  2HHT A;  5J1E A;  4FLU A;  1J53 A;  3AO5 A;  3JAM O;  3KLE A;  1IJJ A;  3THV A;  1YXQ A;  5LY3 A;  3RWU A;  4WQ5 A;  3KK7 A;  3PUF A;  3CJC A;  3WXI A;  1N32 K;  4J2D A;  3NDK A;  1GOA A;  3ZT2 A;  4PWD A;  4CK2 A;  2O8E B;  2G8V A;  3AVB A;  2GTD A;  1Y97 A;  3L4I A;  3ZX0 A;  4XIU A;  3QDK A;  2HF4 A;  2QW9 A;  2OTJ N;  3CFR A;  3CIP A;  2P1J A;  4DUY K;  4B3S K;  3WNG A;  3WQT A;  1S5J A;  1CLQ A;  2B4J A;  3JXU A;  3VQ4 A;  1REV A;  4CIE A;  4BGA A;  3FGU A;  1G99 A;  2WFB A;  3KLG A;  3VF2 A;  2EX3 A;  3DWL A;  4C23 A;  2EWS A;  3VEZ A;  3DLB A;  3C6U A;  1BDG A;  1JL1 A;  1BQM A;  2UUA K;  1R0A A;  2IVN A;  1NU0 A;  3T3F A;  4IO8 A;  3M3Z A;  3TSP A;  3OTO K;  3THX B;  1T6C A;  1VSF A;  4N41 A;  2X74 A;  4E3S A;  3FZH A;  4FOE A;  3MXJ A;  2IC3 A;  4DU1 A;  1JLB A;  1BOT O;  4YDU C;  5M1O A;  1EXQ A;  3BGR A;  1BQN A;  2E1Z A;  1JXE A;  3RVC A;  5CZ2 A;  1YIT N;  1NGH A;  3E01 A;  4BWM A;  1KXP A;  4QOZ B;  4X65 K;  1BWF O;  4ID1 A;  5BPN A;  3U9Z A;  4F3O A;  3BF3 A;  4CER A;  2PY5 A;  3HP9 A;  3IAY A;  3RMD A;  1LWF A;  5E41 A;  3HJF A;  2ZGZ A;  1YF5 L;  4V19 S;  5AQN A;  4F2S A;  2E2N A;  2KLA A;  1X9S A;  4I6M B;  1FW6 A;  3NHG A;  3KTQ A;  2QWN A;  5AZI A;  5BN8 A;  3CCM N;  4F4K A;  2V7Z A;  4FOI A;  3VER A;  4BRF A;  4Z4F A;  3G4S N;  1HJO A;  1QE1 A;  1M90 O;  2CGL A;  5KPZ A;  1E3M A;  4PKI A;  3QIC A;  3FZM A;  3QNN A;  3H45 C;  3WQU A;  3P38 A;  4OPK A;  4FZY A;  3FZK A;  1D5A A;  3CJ1 A;  3LPT A;  1NK7 A;  3NGI A;  5KPT A;  4KHQ A;  1RT1 A;  1WNS A;  3IG1 A;  4M41 A;  4DWI A;  1C1B A;  4FLZ A;  2KZM A;  3O80 A;  5KQD A;  3AA5 X;  4WFB L;  1QTM A;  4EFH A;  1XC9 A;  3HXM A;  5JS1 A;  4CF9 A;  2O8E A;  4E7I A;  4IFE A;  5TKY A;  3SQ4 A;  1LW0 A;  1NJZ A;  4B9L A;  3OYD A;  2OPP A;  4O0J A;  4YFU A;  1ZXO A;  1IV0 A;  4B3T K;  3SI6 A;  2BGG A;  2QWO A;  3TPQ A;  2BUP A;  1ATN A;  1OKJ A;  1ZBU A;  2IVP A;  5BRH A;  1HMV A;  4JI3 K;  1CZB A;  3TSU A;  1KVC A;  1NK8 A;  1UAX A;  3BP8 A;  4KV8 A;  1Q18 A;  4LF5 K;  3VQ9 A;  2P9P A;  2VG7 A;  1NMN A;  1JLG A;  3O4N A;  1TAQ A;  4CK1 A;  4WFA L;  1J5O A;  1NKC A;  2WBN A;  4FW1 A;  3DLR A;  4TSX A;  3KD1 E;  2WTU A;  3NE6 A;  4FWL A;  2KFZ A;  2P9U B;  1U6Z A;  4JS4 A;  3OS0 A;  4JRP A;  3L8B A;  1JLF A;  4BRQ A;  3TAG A;  4J2B A;  3WNF A;  4FM0 A;  3AVG A;  3QBW A;  2YKM A;  2P9L B;  1HYV A;  4CBW A;  2AA4 A;  3OYL A;  4KHU A;  3OYB A;  1MWM A;  1VQN N;  3TTC A;  1C0M A;  1DT9 A;  2D0O A;  4CHN A;  2QTD A;  5LMU K;  3MED A;  1BA1 A;  4IOX A;  3F2K A;  3IMX A;  4X64 K;  4EIA A;  2NRZ A;  3CFO A;  3S3M A;  1SL2 A;  3KD5 E;  2E4L A;  4CZF A;  1RBR A;  4DV0 K;  1QQO A;  1WSI A;  2Q1N A;  4FWS A;  2ZGY A;  4Z0U A;  4CGI A;  3R8E A;  2YHY A;  4H4M A;  5FRN A;  4I6M A;  3UKU A;  3SMS A;  5BPM A;  4AHT A;  2DFF A;  4JS5 A;  3CJ9 A;  1W0H A;  1SKW A;  1N36 K;  4B3O A;  3M5R A;  3FFI A;  3BEX A;  1JL2 A;  2P9S B;  4OPA A;  3P39 A;  4HUE A;  1S6Q A;  4B1U B;  3ATU A;  3LAM A;  4M63 C;  1RT6 A;  1J9A A;  1JKH A;  3A2F A;  2YJE A;  2FC0 A;  2G8F A;  3BZC A;  1TKZ A;  3OYG A;  3O9S A;  3CJA A;  3PO4 A;  3K59 A;  3AAR A;  4EHT A;  3ULD A;  4RW7 A;  1XNQ K;  4O44 A;  5J2P A;  2E2P A;  2NRH A;  3KKR A;  4DR2 K;  3NMU A;  4KH5 A;  4BVO A;  4FJ7 A;  2ASM A;  1OVQ A;  1BL3 A;  1QVG M;  1WAJ A;  1ITG A;  2CH6 A;  3ID6 A;  4OLB A;  1KFD A;  3TAM A;  3IS9 A;  4DSI A;  5FRM A;  1EKE A;  4J2E A;  4F3T A;  3PX0 A;  4B1Y B;  4WYB A;  4CJL A;  1C0G A;  1Y64 A;  1ZC6 A;  1U45 A;  3M8S A;  1VSJ A;  4NLC A;  3TAP A;  1HYZ A;  4B08 A;  3RTV A;  3RMC A;  1X9W A;  3AVH A;  1Z25 A;  4WQ5 C;  4ZTF A;  3JS6 A;  2VQF K;  1LV5 A;  2E6L A;  4CJQ A;  2QXL A;  4KB0 A;  1B9D A;  4BRM A;  1BUP A;  2YNH A;  3LP3 A;  3AVN A;  1YIJ N;  4Y1D A;  3WXJ A;  4CEB A;  4ISF A;  3FZF A;  5HBM A;  4CFD A;  4CJR A;  1T8E A;  1BIS A;  2RE2 A;  2P9U A;  3IKM A;  3P83 D;  3CPE A;  3H1Q A;  3ZSV A;  3V9S A;  5M1Q A;  1IH7 A;  2P9L A;  3HVT A;  4DLG A;  1KQS M;  2VG5 A;  3HZ6 A;  4DTR A;  3OYC A;  1T05 A;  4RG8 A;  2O8B B;  4FVM A;  4IOC L;  4FLW A;  2OCE A;  2WOM A;  1IBM K;  4LSN A;  5AQW A;  4BRA A;  4BR2 A;  4A2A A;  3K9K A;  4M45 A;  5FPD A;  1LAV A;  4FLV A;  3LZJ A;  3EY1 A;  3A0I X;  1LW2 A;  3B6O A;  4CIF A;  3C7N B;  4K0K K;  4DR7 K;  4H5V A;  2KTQ A;  3QES A;  3MDQ A;  5BRD A;  1DKG D;  2QWQ A;  3WNH A;  4KH4 A;  3THW B;  2D0B A;  1WLJ A;  3ULE B;  4H0P A;  2HBK A;  3C6H A;  3NH1 A;  3LAL A;  5AQX A;  3G0Z A;  2P9S A;  2XHB A;  5CHI A;  4CBX A;  4DFM A;  4ISE A;  3V1O A;  3HI0 A;  3HYF A;  3C94 A;  4DR1 K;  4E7H A;  1E4F T;  4RCH A;  4CHO A;  4BR7 A;  3PX6 A;  4YHH K;  1KFS A;  2HHX A;  5ADX H;  1I39 A;  2P51 A;  3NGZ A;  4KHY A;  5FPN A;  4OO1 J;  2NZT A;  4A2B A;  4CEC A;  4WF9 L;  2HND A;  2V7Y A;  3CYM A;  3MK6 A;  4DKW A;  3NVM A;  3FR0 A;  3FZL A;  3RSE B;  4CI6 A;  4FM2 A;  2V51 B;  4CJ7 A;  3G71 N;  5FPM A;  3AVM A;  1KAY A;  1L3V A;  3M1F A;  4CZH A;  1NJW A;  4GKK K;  3ZSZ A;  4IBN A;  3PIO L;  1OH5 A;  3SAH A;  1CZA N;  4MFB A;  2ASP A;  4O4G A;  4LFB K;  4ILJ A;  1KRP A;  1KD1 O;  3K57 A;  3LDN A;  3WUH A;  5C12 A;  3O3G A;  5CZ1 A;  3VGK A;  1F21 A;  1JCG A;  3W0L A;  4FM1 A;  3V1Q A;  1S1V A;  1VQ8 N;  1NK5 A;  4LF8 K;  4FJK A;  2HHV A;  1NJY A;  5AQZ A;  2HBM A;  1MWK A;  4CEZ A;  4K8X A;  3O9U A;  4OGE A;  3QEV A;  4CW7 B;  3ZT4 A;  1NLV A;  3MCA B;  4M3T A;  2D4W A;  4XH1 A;  1Q82 O;  3KK3 A;  3O8M A;  3KJV A;  4Q5V A;  3ZSO A; 
#chains in the Genus database with same CATH homology
 4JV5 K;  4LF9 K;  4DV3 K;  5LL6 Z;  4K0K K;  4DR7 K;  4LFC K;  4DR5 K;  2UUA K;  4B3T K;  3J7A P;  1N34 K;  4B3M K;  4LF7 K;  1XNQ K;  2F4V K;  4JYA K;  3OTO K;  3T1H K;  4DR3 K;  4DR2 K;  5IWA K;  2UXB K;  4JI3 K;  3J7Y P;  4B3R K;  4KHP K;  4NXN K;  2HHH K;  5BR8 K;  4CVN E;  4DR1 K;  4JI0 K;  4YY3 K;  1HR0 K;  4NXM K;  4YHH K;  4LF5 K;  4OX9 K;  1FJG K;  4DV6 K;  2UU9 K;  1IBK K;  4AQY K;  4JI6 K;  4X65 K;  4JI4 K;  4JI1 K;  4GKJ K;  1I94 K;  4DR6 K;  4DUZ K;  5FLX O;  2VQF K;  1XMO K;  5LMN K;  4V19 S;  1HNZ K;  3J81 O;  4GKK K;  1J5E K;  5IT9 O;  4DV1 K;  1XMQ K;  4LFB K;  2E5L K;  5LMU K;  3T1Y K;  3JAM O;  4LF6 K;  4X64 K;  4JI7 K;  4JI2 K;  1IBL K;  2ZM6 K;  4DV2 K;  4LFA K;  4X66 K;  1N32 K;  2UUC K;  1HNW K;  1HNX K;  4DV4 K;  4DV0 K;  4JI8 K;  4DR4 K;  4LF8 K;  2VQE K;  2UUB K;  1XNR K;  4DUY K;  4CW7 B;  4LF4 K;  4B3S K;  2UXD K;  1N33 K;  4X62 K;  5A2Q O;  3J80 O;  1N36 K;  1IBM K;  4JI5 K;  4DV5 K;  4DV7 K;  5AJ3 K;  2UXC K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...