1HR0K

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1hr0K00
4B3TK 5LMUK 5LL6Z 4AQYK 4LFCK 4JI1K 4GKJK 4K0KK 4X64K 2UXCK 4X65K 4DV7K 4LF7K 3J80O 4JV5K 4LF5K 4LFAK 4LF4K 4B3SK 4YHHK 4YY3K 1HNXK 4JI2K 4DV2K 5IT9O 1IBLK 1N33K 4OX9K 2UUCK 4DUYK 4NXNK 4JI3K 2UU9K 4DR6K 1FJGK 4V19S 5A2QO 1HNWK 1HR0K 4GKKK 4X62K 4JI8K 4LF9K 4DV1K 4DV6K 2ZM6K 2UXBK 4JI6K 3JAMO 1XNRK 4X66K 4B3RK 4JI0K 1J5EK 5FLXO 4DR4K 1IBMK 5AJ3K 2HHHK 2UUAK 1I94K 4NXMK 2VQFK 3J81O 5BR8K 2VQEK 1XMQK 4JI7K 1XNQK 1N34K 4LF8K 3OTOK 4JYAK 2UUBK 4DR3K 1N36K 1HNZK 5LMNK 4DR7K 3J7YP 4B3MK 4KHPK 1N32K 4CVNE 4LFBK 4DV4K 4CW7B 3T1HK 4DV3K 2E5LK 4DR1K 2F4VK 4DV0K 5IWAK 3J7AP 2UXDK 4LF6K 1XMOK 4DUZK 1IBKK 4JI5K 3T1YK 4JI4K 4DR5K 4DV5K 4DR2K
chains in the Genus database with same CATH superfamily
1ESVA 4IFEA 3O4QA 3LALA 2O4GA 3NGYA 1T6CA 2NRZA 3W3DA 3AVCA 2X6SA 1E3MA 3EZWA 4CFDA 4CFBA 2GX9A 1JCEA 4BR2A 3ZX2A 4X65K 4UQGA 3SK3A 2IS3A 4BG8A 5J2NA 4OKKA 4FVUA 2YV0X 4FJ7A 1RCHA 1UAXA 4B3SK 4KBOA 5M1KA 4IWVA 3MN6A 1GOAA 4A57A 2NRRA 5JICA 4FWSA 4RW7A 1ZBLA 3OYGA 2KTQA 3KD5E 4NXNK 3R3LA 1FKOA 4M3TA 2OA8A 1FJGK 5F1XA 1HR0K 3LWMA 1CZ9A 4OO1J 1JKHA 2GEMA 2O8DB 3SAFA 4N76A 4EZ6A 4BRHA 3LP3A 2VGNA 3ZT3A 5B8HA 5KRTA 3LM9A 4X66K 2VGMA 3WXJA 2YNGA 3K0SA 4ELUA 4FK4A 4CF0A 4DFPA 3ZT0A 4JKGB 2I5JA 4F2SA 4KHNA 1W2BM 4KTWA 2YNFA 2PYJA 5AZJA 1DTQA 3UB5A 3AA5X 4DS5A 3KLHA 3IKMA 2HB5A 5AZIB 4O5FA 3ZEUB 1N36K 1KFDA 4RCHA 1NK8A 4CK3A 4E1JA 3ZETA 4KHPK 1S9GA 4CIFA 1HMVA 1S22A 2HF3A 4BRDA 3EEQA 4HUGA 4CW7B 4YOYA 3TSQA 2HMPA 3NMUA 4BDPA 2WOMA 3UIQA 3MX2A 4AHCA 3IUCA 1RT6A 1L3SA 3CFRA 3CQXA 3KJVA 3DI6A 4RTFD 3VF6A 3AO5A 1SL1A 3HJFA 3HPHA 4DTJA 5CR4A 4BR9A 3TAQA 4Q0BA 4B1ZA 3CCJN 4B9UA 4A62A 3SYZA 1YF5L 4XH1A 5LL6Z 4CZFA 5AQNA 4B08A 3CMEN 4BY9C 3PSFA 1W9HA 2QWPA 3M1FA 4CJTA 3GE1A 1HYVA 3DLLL 1IO2A 4CJ4A 1KAXA 3HI0A 3HP6A 3L3VA 1C1AA 1LAVA 3SAGA 4M3WA 2QKBA 2IC3A 2YNIA 5J2PA 4DTXA 1HKBA 3MN7A 5FPNA 3DJCA 3U4LA 1EWQA 3T19A 3WEEA 4N41A 2IVPA 3VA3A 4JI3K 5FROA 4DR6K 2ZGYA 4BRLA 4Z4HA 3ZLJA 1W97L 3HSCA 3VERA 4BVOA 4CEFA 4HTUA 3PSIA 1QQCA 1RT1A 2HMIA 3TAEA 4F4KA 2FF6A 3SPYA 3ZSQA 1RILA 5AQPA 3GBTA 2OPQA 3V9XA 4CEQA 5BRFA 3D2EB 1HPMA 3U3YA 3RSEA 1GLEG 4PL8A 4DQRA 1RFQA 3ENHA 4DQPA 4CHYA 4PA1A 4G9ZA 1NGFA 3MWPA 4DG1A 3PO5A 4JS4A 2G8IA 3MCAB 3FFIA 3S3OA 1RT5A 2Q3SA 5J1EA 3SJHA 5HL7L 2KW4A 5AR0A 5CYQA 4CEBA 5AQXA 4B9MA 2AA4A 3CPEA 5I42A 3TANA 3V9WA 4ILGB 4YDUC 4LF6K 1NMDA 3O5BA 4F2RA 3VF4A 4FCYA 1XMOK 3C7NA 4H0TB 4W5OA 2FSKA 2OPSA 2P1JA 1SZ2A 3SUOA 4MLHA 4CFCA 3VQBA 1D9DA 1ZBSA 3O1BA 2X6NA 3V6DA 1BA0A 2AJQA 3KIOA 2YHWA 5CYMA 4W5QA 3DXKA 2O8BB 3I8BA 1SL0A 4KRFA 3NVKA 5HRNA 4IO9L 5HRSA 4BC3A 5ELZA 2Q31A 3G0ZA 4KO0A 4WFAL 4CK1A 4CF9A 4KB1A 4CJKA 2BTFA 3DLKA 3P5JA 1VAZA 3MWTA 4Z0UA 1HNXK 4WFNL 3TSPA 3GL1A 1P8ZA 1X1PA 4FO0A 3KD1E 1JXBA 2YHBA 2FBVA 3VQ5A 3O9QA 2E4LA 4ILHA 1C0UA 3U9ZA 1E4FT 4FLUA 3G10A 3V1QA 3HXMA 1DLOA 4JI8K 3IDHA 3DRRA 1LAWA 4E7JA 3C65A 3NE6A 1XNRK 4JD2A 2WTUA 3TPQA 1LWCA 4CJQA 3ZSRA 3BF1A 2KFNA 4AHTA 1JCFA 1ATNA 1A5VA 3KVGA 1QVFM 1S1UA 1Z25A 4A2AA 2OTJN 2VQEK 1BI4A 2PAVA 1VRUA 2G8UA 4DLGA 3J7ZO 1N34K 3HOTA 4BE0A 5AQKA 4YOTA 4CJPA 1L3UA 1HQEA 3MEGA 3ID6A 3CPWM 1QTMA 1LW2A 2YHXA 3VEXA 4C8LA 4FXDA 4DFJA 2P9IB 3OYFA 1YJNN 4DV4K 5KPTA 4LSLA 4JRPA 1VSDA 4AHVA 3V4IA 3NGZA 3G25A 3P83D 3ZT2A 3TSUA 3CC7N 4PWDA 3SUPA 2HOEA 1VQ9N 2W40A 1GLCG 5HP1A 1D4XA 1EQYA 1X9WA 2KHOA 3DLRA 3AA2A 3ULEA 1UWBA 4FZXC 3K57A 2KZZA 1EWRA 4OJRA 3PX0A 4CZEA 1B9FA 2P9KB 3NH2A 3OYJA 3CCRN 3CCEN 4LF7K 2B6AA 3DLHA 4DS4A 2NRWA 4HTLA 1K8KA 3I0RA 4JHDA 4CIGA 1N6QA 2GUIA 4WYBA 3CI5A 4IOXA 3ENOA 4CHPA 2RF2A 2ASMA 2Z1HA 3P4IA 4CK2A 1VSEA 1RDWX 1DKGD 2JWKA 4FOIA 3T3FA 3CJ7A 2P9NB 4LSNA 1CLQA 4BE1A 3IAYA 2H3GX 4J2EA 1XHZA 3PV8A 4MDBA 2UXBK 3O3GA 4JI6K 5GAHP 2A1RA 4FW1A 1JL2A 4KHSA 1OVYA 2HBKA 3EN9A 1P90A 3RVCA 2NUBA 4Z4CA 3ID8A 3I33A 1X9JA 1WB9A 3O80A 4GVMA 3WUHA 1YI2N 2FBYA 3VQQA 3QERA 4JI7K 3AVHA 1XNQK 2HHTA 4LF8K 1IJJA 1TL1A 3V81A 3L2RA 1DT9A 1HNZK 4C8OA 2P9SA 4PKGA 2IIRA 1QS4A 4ISEA 4Z4IA 4PKIA 2QWRA 3G71N 1VSJA 3B6PA 1TK5A 1NGAA 1TAQA 4ELVA 3H1VX 3MN9A 3VETA 5AQZA 2DPNA 4B1YB 1HQUA 3NCIA 3CERA 4EZ9A 4F8RA 2HHSA 4O0IA 2XRIA 3WXKA 4YOVA 4BE2A 4CESA 4H5WA 2KQ2A 3CF5L 3PO4A 4FL9A 1QZ5A 3KTQA 4BR7A 2NRTA 2HHXA 3SUNA 3N4PA 3QEVA 3OYMA 4K41A 3LPTA 4FVMA 3CCSN 3AO4A 4BQLA 2F8SA 1IG8A 4K0KK 4FPAA 2DFEA 1VQLN 3KWGA 2ZD1A 4M63C 3KKRA 4IFVA 4CJSA 4GV9A 3JYTA 3SCXA 3ULDA 5EOYA 1BA1A 1HX1A 2G8FA 4B8AB 1XC9A 5AQJA 1QE1A 5JLFA 2F96A 3FLCO 2QTDA 1KLMA 2WFBA 4OPAA 5C15A 1HNVA 3F2KA 3WQTA 1N33K 5AZJB 1W0HA 1RGIA 4WQ5A 3AARA 4H4OA 4IO8A 4A5BA 1NGIA 3SLCA 4DTPA 1ZBHA 1Y97A 1CZBA 1MA9B 1DEJA 4LH4A 4CFAA 1LW0A 3OYLA 4DSFA 1SKSA 4PUOA 3VOVA 3UKUA 4DFMA 5FRNA 4XEIA 3ZETB 3EZ5A 3S3MA 3LAKA 4I7FA 2Z1IA 3HPOA 5HLFA 4M3YA 5FLXO 1HYSA 3VF2A 3W0LA 1VSMA 3DRSA 2IGIA 3V1RA 5F0XA 4FJ8A 2QWOA 4W5RA 4EP5A 4PY5A 3CJCA 4HHTA 3SQ1A 5JMVA 1NJWA 2CH5A 3V9UA 1U6ZA 3OYNA 2PBDA 3Q7CA 4H0PA 3G6EN 4FYDA 1YITN 1VQ5N 4NCAA 2E88A 3ZSOA 4CVNE 5BPLA 3ENBA 4LFBK 4CEDA 4H5TA 3WQUA 4EFHA 4R5PA 4FLYA 4WFBL 4PKHA 1BDGA 4PHTX 2NRHA 5AQVA 4MQ3A 3OY9A 1ITGA 3PUFA 4QS9A 1TL3A 3OS1A 3OYKA 1REVA 5LJVA 3KLIA 4WQ4A 4JKAA 1U45A 1W7AA 4B3TK 4Y1CA 1RDBA 1S1XA 3UKRA 3L2UA 3WEEB 4JI1K 1U04A 3S41A 4GV6A 4IDKA 3SAHA 1RT2A 1FXXA 3THXA 2YJEA 1XWLA 2XO7A 1OH7A 2DY4A 2E1ZA 3QLHA 4CGHA 3RRHA 1DTTA 3VMFB 4BRIA 3CG7A 2ZGZA 4CGFA 4FLWA 2J4RA 2RE2A 2Q1NA 4CBXA 4KH5A 4YHHK 5GIPA 4HUEA 1YXQA 3M8PA 1T05A 2YKNA 1M90O 1TVRA 3O9RA 4LC9B 1VSKA 2QK9A 4O5BA 2UUCK 3IRXA 4QAGA 4HCBA 2UU9K 3SV4A 4Z4EA 5KGWA 4IJAA 4DLEA 4RG8A 1T03A 3C6UA 4NYNA 5BPMA 1B9DA 3JAMO 4NB4A 2OPPA 4DCHA 1QQMA 4HCCA 3AVIA 3R6MA 3SI6A 1KFSA 2GTDA 1ATSA 3QESA 3FE1A 4I9QA 1WLJA 3A0IX 2BUPA 4K8ZA 5AQOA 2GWJA 2D0BA 2ETJA 1WNSA 5BR8K 1C6VA 3ATVA 1NK9A 4KPYA 2BANA 5AQFA 1FW6A 2P9PB 3SQ0A 4GNIA 1JLCA 3EE9A 3RTVA 3CQYA 4KH4A 4CJUA 5BPNA 4CI6A 1N32K 4B3OA 3FGUA 4BGBA 3L4QA 2V7YA 1DGKN 2FF3B 3DXKB 3WXIA 4ELTA 3DXMA 3MCPA 4FJMA 3OW2M 2E5LK 1GLDG 3QB0A 4BR4A 3O6WA 2KKZA 4CJFA 3L2WA 5M1PA 3J7AP 5ADXA 3K59A 4KREA 5C42A 3QEXA 4FWPA 5FPMA 4E7KA 4M7YA 1Q9YA 4FM1A 1NBWA 1R0AA 4MFBA 4CJWA 4B8CA 1ZYQA 1RBVA 3AA4A 5EY4A 1QZ6A 3HM9A 1C1BA 3F9MA 3VQEA 4OKEA 3CFPA 4GY2B 4OVLA 3EE8A 4AH9A 5C25A 3C94A 1GLFO 4C23A 3PX6A 4BRQA 3DAWA 1TKDA 4B1UB 1S1WA 1XHXA 1J6ZA 2EX3A 1HJRA 2ATQA 3O9UA 4JD2B 1QVGM 1C0FA 3BGRA 1NGGA 3EYZA 4FK0A 3Q7BA 4LF4K 3J8AA 3LZJA 1JLFA 4ILJA 2VCPA 1Q9XA 4B9VA 4GVEA 1BI4B 3U8XA 3DLBA 3QFPA 3K5OA 3QEPA 5HOOA 4CEAA 3FZMA 2HHQA 2E1YA 3E66A 1BUPA 1HKGA 4CEZA 4K8XA 4FM2A 3HZ6A 3O3FA 1J9AA 4FLTA 4BWMA 1S6QA 3CYMA 1JLGA 4CZKA 3OHRA 4FWKA 4JK9A 1IKWA 1YVNA 2HSTA 1YVUA 4DR4K 2JGUA 2A1SA 3K5MA 4OKJA 1IV0A 4JKDA 3PX4A 2D0OA 1ZBFA 1T44A 1BCOA 3MN5A 4OGEA 1SAZA 3OTOK 1KLNA 3VEYA 1VQON 1ZC6A 3O4NA 4JLHA 5AQUA 3CCVN 4B9NA 4R79A 2O8EB 1YUWA 3DM2A 2VWJA 4CD1A 4DR7K 1EX4A 4PQUA 3L6QA 2VG7A 1WSFA 3TARA 5DMRA 3ULEB 1NK7A 2RHKA 3NF7A 1NJZA 4IOCL 3P1GA 4JN4A 4DR1K 4FJ5A 3CHWA 3T1AA 3LDOA 3LANA 4YORA 3THWA 2FXUA 3QMLA 3ZSYA 3AO1A 1K8KB 3T1YK 4JHDB 3DYAA 4RW9A 5EXWA 4IXCA 3T7ZA 4KHWA 3LAMA 2RPIA 1TKTA 4E19A 3SPZA 1NKEA 3VQAA 4JRQA 5AQGA 1QQNA 4CBWA 2XY6A 1RT4A 1BG3A 4O55A 4X64K 3H1QA 1XI1A 3CM5A 3HPGA 1RNHA 3KK2A 4FWNA 4WCEL 2CGJA 1NKCA 3IFRA 3WNEA 1MWKA 1VSIA 3LM2A 4YY3K 1J53A 5ADXH 4F3TA 1GLLO 3MEEA 3GDQA 3H46O 2YHYA 1WOQA 5GADP 1EO1A 4TSXA 2HW3A 4KB0A 2OYQA 1HNWK 3DMJA 4PL7A 1NGCA 4DV6K 3OYCA 4FWOA 3MMVA 4KKOA 1EETA 4IEIA 4IEEA 4FWQA 2HBLA 3M8QA 4WQ5C 4N47A 3WXMB 3ZT1A 1O13A 4NXMK 1JXEA 3M3ZA 1UA0A 2VQFK 2PYLA 4RW8A 3MXIA 3QEWA 2HNDA 3AVJA 4A2BA 3AGKA 1IKYA 4UY8O 3CC4N 4KAZA 3O1WA 1QSSA 4FJIA 5AQLA 3NVMA 1JLBA 3UE5A 1YHQN 3HK2A 4HUFA 3KK3A 2F7TA 4M41A 4Y1DA 4CZHA 4DSIA 3U6FA 2OANA 3JXUA 4YFUA 1TK0A 3NF6A 3RR8A 1ASUA 2X78A 2QWLA 3EO3A 1O1WA 3VQCA 2OCEA 2HBMA 1KRPA 1RBSA 1C1CA 3B6OA 2HNZA 1RTIA 4BROA 2IVOA 3OYIA 3KLFA 3LDSA 3U9DA 2G8VA 3BZCA 4KI6A 3FZFA 2VG6A 1VQ6N 3AVLA 4FZYA 5AFUA 3MXMA 4M45A 5GAGP 3UKUB 4EP4A 4BDYA 4CZIA 4I9LA 4DV7K 3V1OA 2LSNA 3LDNA 3LP0A 4WQ4C 3VEWA 5EVZA 4JV5K 1N5YA 4LF5K 3NAEA 2GWKA 3L0QA 1RTJA 3EKSA 4CERA 3WNGA 4JAXA 2HHVA 4OGCA 4K43A 2YNHA 3BEXA 1YIJN 3AVAA 4DTUA 3AY9A 5A2QO 4CF8A 2V51B 5CE3A 3NF8A 1JJ2M 3KK7A 3A5LC 3NH1A 3M6GA 4AM7A 4J2BA 3BUZB 4ZTJA 4C8NA 1BO5O 1NWKA 1TK8A 1HKCA 1NU0A 2EWSA 2IAJA 2IOCA 3HTVA 4CBUA 3BY5A 1BCMA 1ZBIA 5KGXA 3E01A 3FFKB 4CE9A 3QO9A 3E9LA 3M8SA 2QWQA 1GLBG 2OZSA 4NCBA 3VA0A 2X74A 1SV5A 3I8DA 1YTAA 4FJNA 4CGIA 4H5VA 1CZAN 4BR0A 3SNNA 4ICLA 3UKRB 1NK5A 2QWMA 4CZLA 4BRKA 2QA4N 4FJLA 2E2NA 4MO5A 3THXB 2IDOA 3H3OB 4H0VB 1Q81O 3PIOL 2D4WA 3KKSA 3HYFA 4DHYA 3ZT4A 4XH5A 5IWAK 1SQKA 2FC0A 4E7LA 3H6EA 3VN5A 3QFUA 1RTHA 3OVNA 2XHBA 5C10A 4OPKA 2Q97A 3B8AX 4DQSA 1G99A 4ZHRA 3F5TA 3TU5A 3KLEA 2CGKA 1E4GT 5AQWA 3WNFA 4XH4A 2WONA 5KPRA 1K9MO 1BQMA 3MECA 3NGIA 4FJKA 4NCGA 3VEZA 3GOIA 2KZMA 4ISFA 5FPEA 3ZX0A 1CXQA 2Y1IA 3THYA 1QQOA 5KI6A 2Z1JA 3AVKA 2A3ZA 4YOUA 3BZKA 4KTQA 1VQ8N 4XIUA 4OX9K 3OJSA 2D0PA 5E84A 2BDPA 3MEDA 4DU1A 5AQTA 3TAFA 4I2PA 5BRHA 4BR5A 1VQMN 1K8AO 4JKBA 4DU3A 2DFHA 4O8UA 3QNNA 3C6HA 4DMNA 3SZ2A 1HNIA 4CEOA 1UA1A 4CECA 1B92A 2E6LA 5AFUH 4BC2A 4CZJA 1QHAA 4JI0K 3DXMB 3JS6A 3BDPA 2B5JA 5JS2A 2UUAK 2CH6A 1RDDA 3K2PA 2GELA 4DTRA 3EKUA 1OH8A 3M8RA 4M42A 4JKEA 4A59A 1KAYA 1IKXA 5I9EB 3FR0A 1EXQA 1KVAA 3O8MA 4J2AA 1MWMA 5FPDA 2DTUA 3WNHA 3P31A 2A40A 1N8RO 3S3NA 4DSEA 1X3MA 2A42A 3CCMN 2XY7A 1HLUA 3T1HK 2P9IA 3LDPA 3DLEA 2PY5A 3E1YA 4DV0K 4CGDA 4FJXA 3G4SN 4DTOA 1YAGA 3NFAA 3TR8A 4ID1A 2WUSA 3NHGA 1S3XA 5BN9A 5I3UA 1IBKK 4JI5K 5JVGL 4L8RB 4AHRA 2YJFA 3D2FA 4BRCA 2P5OA 3ZSWA 3CFOA 1C0MA 4GMJB 2GBZA 4EIAA 1U4BA 2D1KA 3QEIA 3DLGA 2P9LA 1NGJA 1HUXA 4MDAA 1L5UA 4JNEA 1WSJA 4O0JA 1TKZA 4C1NI 1OH5A 4JK8A 1WN7A 2E2PA 2WBNA 4MO4A 4E89A 3SMPA 5T7BA 5AQSA 4EHUA 3ALYA 1WSIA 3QBWA 1JLAA 4JK7A 4BRMA 4DV2K 2G8HA 5TKYA 4NYFA 1U47A 3K5LA 1GOBA 2F9TA 3QDKA 1H1VA 4V19S 2QM1A 1TGOA 3BF3A 3ISNC 3CQ8A 3A2FA 4BRPA 2O8CA 5GAEP 5AQYA 4H4MA 4KHYA 2VWBA 5AQHA 3VGMA 2NZTA 2E2QA 4LD0A 4FLVA 4NO7A 1RBTA 4DB3A 2Q0UA 5E26A 5BREA 2JLEA 3CJ9A 5SWMA 3RSEB 5AJ3K 2HHHK 1BGXT 4ID5A 1KVCA 3AVMA 3PY8A 3A5MC 3OYHA 3J81O 3L2VA 2W6KA 4DQ8A 3CM6A 1XMQK 4BC4A 1YTUA 3AVFA 4L3QA 4M3XA 3FZKA 3WXLA 4CZMA 1U48A 1YT3A 2OZMA 4NLCA 4DR3K 2P9UA 3K9JA 4I6MA 3E9OA 3VQ8A 1QHTA 2PZSA 2NNWA 2JWLA 3I0SA 2ZJRL 1LCUA 2GUPA 3O4WA 4BGAA 3JSMA 3MX5A 3I56N 4RWTA 3L4IA 1VK0A 1WSHA 2P5GA 1JL1A 4M3ZA 3C7NB 4DUZK 3VQ7A 4B9SA 4GV3A 3L2QA 1Q86O 2QXLA 2EHGA 2BE2A 3CJBA 1LOTB 4DQIA 4Z4FA 2RKIA 2ITGA 4FM0A 1NKBA 1JLQA 5M1OA 4C8MA 3TTCA 1NK4A 1ILYA 1KD1O 1VQNN 1S1TA 3J80O 3MAQA 3H45C 3EY1A 3SBGA 3KHYA 1NLVA 3SQ2A 1TYQA 4E7IA 3O08A 3FZLA 4LY7A 3SJJA 3QIPA 3C95A 5J2MA 1NM1A 4QCLA 2W42A 4H5NA 2V7ZA 3BP8A 2VG5A 1QSLA 1SL2A 5DM7L 2D5RA 4AHSA 3A5NC 1I3AA 3S9HA 3HOSA 5CHIA 1IG9A 4BDZA 4BC5A 4RW6A 3ZSZA 4H8KA 3H08A 3VPZA 2ZQBA 3SMSA 4JKCA 1U2VA 4CJ7A 4U67L 4B3RK 3AVGA 3CETA 3HL8A 1BU6O 1RT3A 1EP4A 4CZGA 1I94K 4G1QA 1S1VA 1M1KO 4IDHA 3D6RA 4OPHA 4A61A 3ITHA 3MK6A 5TKWA 3WT0A 3QETA 4WF9L 2FLOA 3LDLA 5C2FA 3CCUN 1XQSC 5H1SQ 3RMBA 4JYAK 3OJUA 3NBPA 2P51A 3VQ4A 5BN8A 1OVQA 3O9TA 5JVHL 4K25A 1KAZA 1NJXA 4OPJA 4CJEA 1KCFA 1V4TA 3D0PA 1NOYA 1WAJA 4BRNA 4EHTA 3DOLA 1X9SA 2O8FA 5C2DA 4K42A 3TTFA 4H0YB 3RMCA 3AGRA 1A5XA 3KZBA 2B4JA 2YX6A 2V52B 1T7PA 1TUUA 4FW2A 3AV9A 4IFYA 3LZIA 4E3SA 4IBNA 2FBXA 4CJVA 2QXFA 1G15A 3HM8A 1LV5A 1JLEA 4ZTFA 4Z94A 1VSFA 2NLXA 5F2RA 1VQPN 2O4IA 1D9FA 5C24A 4YNQA 5AQMA 4B9LA 1SKRA 3LWLA 5FDLA 3VQPA 5K14A 4LFAK 3LP1A 5AQQA 3TAPA 4IG0A 4KHQA 3KLGA 2KLAA 4DF4A 4CJ5A 2NRVA 4FZZA 3LP2A 3NF9A 1Q7YO 1Y64A 1XUPO 3L3UA 4H0XB 4GKKK 3A5OC 2GV9A 1MDUB 3K5NA 4LF9K 1HPZA 4CHNA 4LH5A 3MXJA 2Q36A 5KTQA 2F8TA 5C12A 3QIOA 3T69A 1S9EA 3TAGA 3HO1A 3SV3A 2ZE2A 1T3VA 2CGLA 4B1XB 3PLAA 2FSNA 5KQDA 1J5OA 1LWEA 1UOCA 4NLBA 4I2QA 2YKMA 3HSTB 4DSKA 3KK1A 3M5RA 3D7EO 1NNEA 2O8DA 2P9PA 2P9SB 4KI4A 3J7YP 1Q18A 3HVRA 3VEOA 4JS5A 1RDAA 4DU4A 4FOEA 4CJLA 3CMAN 4DV3K 1WUAA 4AM6A 3AA3A 2HBJA 1BHLA 4JKGA 4FJGA 1NGEA 3ASMA 2AP1A 4BQZA 1L3VA 3V9ZA 4HVJA 2UXDK 3MDQA 3THYB 4BRFA 2W41A 1VHXA 3LDQA 4O8KA 2D0AA 4DR5K 4DV5K 1OH6A 5AZIA 3ZEUA 1SS6A 2QEXN 1S5JA 4KH6A 5LMUK 4AF1A 1RT7A 5CZ2A 4DWIA 3RMDA 4M7XA 4BWJA 4AQYK 4LFCK 2NRXA 5AQIA 4IZ9A 3VTIA 4C8KA 5HROA 4CIEA 1VSHA 2W6LA 1TV6A 2ZJQL 4J8FA 1GLJO 1SKWA 3R9PA 3OYDA 4KV8A 1Z05A 2WC9A 2E8AA 4YOXA 5SZTA 1WBDA 4FWLA 3VQ6A 4JI2K 4N56A 4FWMA 2A5XA 1D8YA 1D5AA 5IT9O 4CF1A 3AAQA 3ZCMA 1NJYA 1LWFA 4DUYK 1L3TA 4OLBA 1KC8O 3AVBA 1NG9A 3EL2A 1RBUA 3VQDA 2BH1A 3DWLA 4DTNA 1BOTO 4X62K 4U7BA 4DV1K 1C0TA 5D3GA 3QINA 3TTDA 2A6AA 3VTHA 3VGLA 3E9PA 3P38A 4B1WB 1NK6A 4JKHA 4CF2A 4AHUA 1SUQA 1GOCA 3SQ4A 3THVA 3OA9A 1BWFO 4FJHA 1KVBA 1KSPA 1IH7A 4E7HA 2HVHA 3QBXA 1V4SA 4RW4A 5MLCQ 4FSVA 4AILC 4B9TA 4BG9A 5JS1A 3D2FB 2XY8A 2HHWA 2UUBK 2E2OA 1ATRA 4Q5VA 5LMNK 2O8EA 1I39A 2P9LB 5J2QA 3CCQN 2A41A 2QKKA 3HVTA 2YI1A 3AO3A 4E1MA 1FKPA 1ASWA 1BL3A 1FK9A 4FLXA 4F3OA 1HJOA 1VQKN 3D2EA 2Q0RA 1NGBA 1KXPA 3LPUA 4MLEA 4BRGA 2ASOA 2BGGA 2RN2A 1NOZA 2HF4A 3RWUA 4FJJA 3SBTA 1C0GA 4E0DA 5DM6L 1XC3A 5KRSA 4DFKA 2QI2A 1GLAG 4IJNA 1X3NA 1U49A 3GG4A 1CXUA 3FZHA 2I7NA 5M1NA 5EU7A 2VYPA 1S72N 1IKVA 3IS9A 2O8CB 3CD6N 3ATUA 5BRDA 2HHUA 5JLHA 3RRGA 5KPZA 1VRTA 2PFUA 3C0BA 3ZSVA 2ZWHA 1TKXA 2F9WA 2ASPA 4OLAA 1VQ4N 3C6AA 1HRHA 5CY4A 3CJ1A 4BVPA 3OS0A 2UYTA 3A8YA 1IBLK 3CCLN 4CHQA 3R1XA 2E20A 3AVNA 1X9MA 1NGDA 3DRPA 4B9QA 3DOKA 4KHUA 1Q82O 1RDCA 3ZSXA 2OTLN 4CJRA 2O8BA 4H5RA 2P9UB 1KQSM 3QICA 4I6MB 3TI0A 1EKEA 3RR7A 4Z4GA 3K9KA 1RDUA 4BRAA 1T8EA 1ZXOA 2DFFA 4ISGA 1J5EK 3CC2N 4WE1A 4EAHD 4QS8A 3OBWA 4QOZB 3HP9A 2IVNA 3HT3A 3OS2A 4DQQA 4BACA 1BQNA 4CGJA 4A5AA 1JCGA 3SUQA 4DF8A 1WSEA 1NJIO 4DTSA 1VQ7N 1BISA 5HRPA 4YDUA 4FLZA 3VEVA 3KWIA 3OYEA 4W5NA 1VSLA 3F9KA 2ZJPL 3O3HA 1A5WA 1TAUA 5GINA 4B3MK 3CJAA 1RBRA 2Z1GA 1WSGA 4IOAL 3AAPA 2HNYA 4DSLA 2E6MA 1OKJA 1RTDA 2G8KA 2ZF5O 4DTMA 4O4GA 4C1NK 3VENA 3V9SA 3CXCM 2I7PA 3K58A 5DK5A 3TAMA 1ZBUA 4KTZA 3QNOA 4CD3A 4JI4K 4FWRA 1TYQB 3RMAA 4DR2K 5AQRA 1S6PA 5EX5A 3LL3A 4GKJK 4E1NA 5CZ1A 3HRGA 2XY5A 1YJWN 3VQ9A 3ZX3A 4B1VA 5LJWA 2YHAA 2UXCK 2FSJA 1U2VB 5E41A 4CHZA 4N5SA 4CCHA 4CJ3A 3OYAA 5LY3A 5M1FA 4DSJA 2G8WA 4W5TA 4CHOA 3NDKA 2FBTA 5GIOA 2OPRA 1NGHA 4J2DA 5C0YA 3ZYYX 3VESA 4FK2A 1K6YA 1NMNA 4CGGA 4H03B 1F21A 3NH0A 3IG1A 1T6DA 1Z26A 3N4QA 2P9KA 5FRMA 3TWHA 1NK0A 2ZM6K 3R8EA 3F73A 4M3UA 2Q2RA 3CIPA 1Q8IA 4JEPA 4F9OA 5HRRA 1KTQA 1BIZA 5HBMA 2QWNA 1IBMK 2YCHA 1BIUA 4CEEA 4BREA 4IG3A 3L8BA 1YJ9N 1J54A 2O8FB 3TABA 1K73O 1MU2A 2HVIA 2ITMA 2D0CA 5BR9A 3AO2A 4FPBA 1WAFA 4O44A 1QSYA 4H0OA 5M1QA 4HWIA 3OYBA 2P9NA 2VWKA 3O9SA 4QS7A 3PIPL 1Z6RA 1TUYA 4IKFA 3C6TA 2KFZA 1R59O 3IMXA 2R7YA 3VGKA 2Y1JA 4KFBA 4M3RA 3I55N 2F4VK 3D45A 3THWB 1WBBA 4YOWA 4JKFA 3HBTA 1HYZA 3U3GA 3H3NO 4DKWA 4FJ9A 4GW6A 5KQ8A 4Y0WA 2QW9A 1ASVA 3P39A 3OBYA
chains in the Genus database with same CATH topology
4B3TK 5LMUK 5LL6Z 4AQYK 4LFCK 4JI1K 4GKJK 4K0KK 4X64K 2UXCK 4X65K 4DV7K 4LF7K 3J80O 4JV5K 4LF5K 4LFAK 4LF4K 4B3SK 4YHHK 4YY3K 1HNXK 4JI2K 4DV2K 5IT9O 1IBLK 1N33K 4OX9K 2UUCK 4DUYK 4NXNK 4JI3K 2UU9K 4DR6K 1FJGK 4V19S 5A2QO 1HNWK 1HR0K 4GKKK 4X62K 4JI8K 4LF9K 4DV1K 4DV6K 2ZM6K 2UXBK 4JI6K 3JAMO 1XNRK 4X66K 4B3RK 4JI0K 1J5EK 5FLXO 4DR4K 1IBMK 5AJ3K 2HHHK 2UUAK 1I94K 4NXMK 2VQFK 3J81O 5BR8K 2VQEK 1XMQK 4JI7K 1XNQK 1N34K 4LF8K 3OTOK 4JYAK 2UUBK 4DR3K 1N36K 1HNZK 5LMNK 4DR7K 3J7YP 4B3MK 4KHPK 1N32K 4CVNE 4LFBK 4DV4K 4CW7B 3T1HK 4DV3K 2E5LK 4DR1K 2F4VK 4DV0K 5IWAK 3J7AP 2UXDK 4LF6K 1XMOK 4DUZK 1IBKK 4JI5K 3T1YK 4JI4K 4DR5K 4DV5K 4DR2K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T K;  5LMU K;  5LL6 Z;  4AQY K;  4LFC K;  4JI1 K;  4GKJ K;  4K0K K;  4X64 K;  2UXC K;  4X65 K;  4DV7 K;  4LF7 K;  3J80 O;  4JV5 K;  4LF5 K;  4LFA K;  4LF4 K;  4B3S K;  4YHH K;  4YY3 K;  1HNX K;  4JI2 K;  4DV2 K;  5IT9 O;  1IBL K;  1N33 K;  4OX9 K;  2UUC K;  4DUY K;  4NXN K;  4JI3 K;  2UU9 K;  4DR6 K;  1FJG K;  4V19 S;  5A2Q O;  1HNW K;  1HR0 K;  4GKK K;  4X62 K;  4JI8 K;  4LF9 K;  4DV1 K;  4DV6 K;  2ZM6 K;  2UXB K;  4JI6 K;  3JAM O;  1XNR K;  4X66 K;  4B3R K;  4JI0 K;  1J5E K;  5FLX O;  4DR4 K;  1IBM K;  5AJ3 K;  2HHH K;  2UUA K;  1I94 K;  4NXM K;  2VQF K;  3J81 O;  5BR8 K;  2VQE K;  1XMQ K;  4JI7 K;  1XNQ K;  1N34 K;  4LF8 K;  3OTO K;  4JYA K;  2UUB K;  4DR3 K;  1N36 K;  1HNZ K;  5LMN K;  4DR7 K;  3J7Y P;  4B3M K;  4KHP K;  1N32 K;  4CVN E;  4LFB K;  4DV4 K;  4CW7 B;  3T1H K;  4DV3 K;  2E5L K;  4DR1 K;  2F4V K;  4DV0 K;  5IWA K;  3J7A P;  2UXD K;  4LF6 K;  1XMO K;  4DUZ K;  1IBK K;  4JI5 K;  3T1Y K;  4JI4 K;  4DR5 K;  4DV5 K;  4DR2 K; 
#chains in the Genus database with same CATH topology
 1ESV A;  4IFE A;  3O4Q A;  3LAL A;  2O4G A;  3NGY A;  1T6C A;  2NRZ A;  3W3D A;  3AVC A;  2X6S A;  1E3M A;  3EZW A;  4CFD A;  4CFB A;  2GX9 A;  1JCE A;  4BR2 A;  3ZX2 A;  4X65 K;  4UQG A;  3SK3 A;  2IS3 A;  4BG8 A;  5J2N A;  4OKK A;  4FVU A;  2YV0 X;  4FJ7 A;  1RCH A;  1UAX A;  4B3S K;  4KBO A;  5M1K A;  4IWV A;  3MN6 A;  1GOA A;  4A57 A;  2NRR A;  5JIC A;  4FWS A;  4RW7 A;  1ZBL A;  3OYG A;  2KTQ A;  3KD5 E;  4NXN K;  3R3L A;  1FKO A;  4M3T A;  2OA8 A;  1FJG K;  5F1X A;  1HR0 K;  3LWM A;  1CZ9 A;  4OO1 J;  1JKH A;  2GEM A;  2O8D B;  3SAF A;  4N76 A;  4EZ6 A;  4BRH A;  3LP3 A;  2VGN A;  3ZT3 A;  5B8H A;  5KRT A;  3LM9 A;  4X66 K;  2VGM A;  3WXJ A;  2YNG A;  3K0S A;  4ELU A;  4FK4 A;  4CF0 A;  4DFP A;  3ZT0 A;  4JKG B;  2I5J A;  4F2S A;  4KHN A;  1W2B M;  4KTW A;  2YNF A;  2PYJ A;  5AZJ A;  1DTQ A;  3UB5 A;  3AA5 X;  4DS5 A;  3KLH A;  3IKM A;  2HB5 A;  5AZI B;  4O5F A;  3ZEU B;  1N36 K;  1KFD A;  4RCH A;  1NK8 A;  4CK3 A;  4E1J A;  3ZET A;  4KHP K;  1S9G A;  4CIF A;  1HMV A;  1S22 A;  2HF3 A;  4BRD A;  3EEQ A;  4HUG A;  4CW7 B;  4YOY A;  3TSQ A;  2HMP A;  3NMU A;  4BDP A;  2WOM A;  3UIQ A;  3MX2 A;  4AHC A;  3IUC A;  1RT6 A;  1L3S A;  3CFR A;  3CQX A;  3KJV A;  3DI6 A;  4RTF D;  3VF6 A;  3AO5 A;  1SL1 A;  3HJF A;  3HPH A;  4DTJ A;  5CR4 A;  4BR9 A;  3TAQ A;  4Q0B A;  4B1Z A;  3CCJ N;  4B9U A;  4A62 A;  3SYZ A;  1YF5 L;  4XH1 A;  5LL6 Z;  4CZF A;  5AQN A;  4B08 A;  3CME N;  4BY9 C;  3PSF A;  1W9H A;  2QWP A;  3M1F A;  4CJT A;  3GE1 A;  1HYV A;  3DLL L;  1IO2 A;  4CJ4 A;  1KAX A;  3HI0 A;  3HP6 A;  3L3V A;  1C1A A;  1LAV A;  3SAG A;  4M3W A;  2QKB A;  2IC3 A;  2YNI A;  5J2P A;  4DTX A;  1HKB A;  3MN7 A;  5FPN A;  3DJC A;  3U4L A;  1EWQ A;  3T19 A;  3WEE A;  4N41 A;  2IVP A;  3VA3 A;  4JI3 K;  5FRO A;  4DR6 K;  2ZGY A;  4BRL A;  4Z4H A;  3ZLJ A;  1W97 L;  3HSC A;  3VER A;  4BVO A;  4CEF A;  4HTU A;  3PSI A;  1QQC A;  1RT1 A;  2HMI A;  3TAE A;  4F4K A;  2FF6 A;  3SPY A;  3ZSQ A;  1RIL A;  5AQP A;  3GBT A;  2OPQ A;  3V9X A;  4CEQ A;  5BRF A;  3D2E B;  1HPM A;  3U3Y A;  3RSE A;  1GLE G;  4PL8 A;  4DQR A;  1RFQ A;  3ENH A;  4DQP A;  4CHY A;  4PA1 A;  4G9Z A;  1NGF A;  3MWP A;  4DG1 A;  3PO5 A;  4JS4 A;  2G8I A;  3MCA B;  3FFI A;  3S3O A;  1RT5 A;  2Q3S A;  5J1E A;  3SJH A;  5HL7 L;  2KW4 A;  5AR0 A;  5CYQ A;  4CEB A;  5AQX A;  4B9M A;  2AA4 A;  3CPE A;  5I42 A;  3TAN A;  3V9W A;  4ILG B;  4YDU C;  4LF6 K;  1NMD A;  3O5B A;  4F2R A;  3VF4 A;  4FCY A;  1XMO K;  3C7N A;  4H0T B;  4W5O A;  2FSK A;  2OPS A;  2P1J A;  1SZ2 A;  3SUO A;  4MLH A;  4CFC A;  3VQB A;  1D9D A;  1ZBS A;  3O1B A;  2X6N A;  3V6D A;  1BA0 A;  2AJQ A;  3KIO A;  2YHW A;  5CYM A;  4W5Q A;  3DXK A;  2O8B B;  3I8B A;  1SL0 A;  4KRF A;  3NVK A;  5HRN A;  4IO9 L;  5HRS A;  4BC3 A;  5ELZ A;  2Q31 A;  3G0Z A;  4KO0 A;  4WFA L;  4CK1 A;  4CF9 A;  4KB1 A;  4CJK A;  2BTF A;  3DLK A;  3P5J A;  1VAZ A;  3MWT A;  4Z0U A;  1HNX K;  4WFN L;  3TSP A;  3GL1 A;  1P8Z A;  1X1P A;  4FO0 A;  3KD1 E;  1JXB A;  2YHB A;  2FBV A;  3VQ5 A;  3O9Q A;  2E4L A;  4ILH A;  1C0U A;  3U9Z A;  1E4F T;  4FLU A;  3G10 A;  3V1Q A;  3HXM A;  1DLO A;  4JI8 K;  3IDH A;  3DRR A;  1LAW A;  4E7J A;  3C65 A;  3NE6 A;  1XNR K;  4JD2 A;  2WTU A;  3TPQ A;  1LWC A;  4CJQ A;  3ZSR A;  3BF1 A;  2KFN A;  4AHT A;  1JCF A;  1ATN A;  1A5V A;  3KVG A;  1QVF M;  1S1U A;  1Z25 A;  4A2A A;  2OTJ N;  2VQE K;  1BI4 A;  2PAV A;  1VRU A;  2G8U A;  4DLG A;  3J7Z O;  1N34 K;  3HOT A;  4BE0 A;  5AQK A;  4YOT A;  4CJP A;  1L3U A;  1HQE A;  3MEG A;  3ID6 A;  3CPW M;  1QTM A;  1LW2 A;  2YHX A;  3VEX A;  4C8L A;  4FXD A;  4DFJ A;  2P9I B;  3OYF A;  1YJN N;  4DV4 K;  5KPT A;  4LSL A;  4JRP A;  1VSD A;  4AHV A;  3V4I A;  3NGZ A;  3G25 A;  3P83 D;  3ZT2 A;  3TSU A;  3CC7 N;  4PWD A;  3SUP A;  2HOE A;  1VQ9 N;  2W40 A;  1GLC G;  5HP1 A;  1D4X A;  1EQY A;  1X9W A;  2KHO A;  3DLR A;  3AA2 A;  3ULE A;  1UWB A;  4FZX C;  3K57 A;  2KZZ A;  1EWR A;  4OJR A;  3PX0 A;  4CZE A;  1B9F A;  2P9K B;  3NH2 A;  3OYJ A;  3CCR N;  3CCE N;  4LF7 K;  2B6A A;  3DLH A;  4DS4 A;  2NRW A;  4HTL A;  1K8K A;  3I0R A;  4JHD A;  4CIG A;  1N6Q A;  2GUI A;  4WYB A;  3CI5 A;  4IOX A;  3ENO A;  4CHP A;  2RF2 A;  2ASM A;  2Z1H A;  3P4I A;  4CK2 A;  1VSE A;  1RDW X;  1DKG D;  2JWK A;  4FOI A;  3T3F A;  3CJ7 A;  2P9N B;  4LSN A;  1CLQ A;  4BE1 A;  3IAY A;  2H3G X;  4J2E A;  1XHZ A;  3PV8 A;  4MDB A;  2UXB K;  3O3G A;  4JI6 K;  5GAH P;  2A1R A;  4FW1 A;  1JL2 A;  4KHS A;  1OVY A;  2HBK A;  3EN9 A;  1P90 A;  3RVC A;  2NUB A;  4Z4C A;  3ID8 A;  3I33 A;  1X9J A;  1WB9 A;  3O80 A;  4GVM A;  3WUH A;  1YI2 N;  2FBY A;  3VQQ A;  3QER A;  4JI7 K;  3AVH A;  1XNQ K;  2HHT A;  4LF8 K;  1IJJ A;  1TL1 A;  3V81 A;  3L2R A;  1DT9 A;  1HNZ K;  4C8O A;  2P9S A;  4PKG A;  2IIR A;  1QS4 A;  4ISE A;  4Z4I A;  4PKI A;  2QWR A;  3G71 N;  1VSJ A;  3B6P A;  1TK5 A;  1NGA A;  1TAQ A;  4ELV A;  3H1V X;  3MN9 A;  3VET A;  5AQZ A;  2DPN A;  4B1Y B;  1HQU A;  3NCI A;  3CER A;  4EZ9 A;  4F8R A;  2HHS A;  4O0I A;  2XRI A;  3WXK A;  4YOV A;  4BE2 A;  4CES A;  4H5W A;  2KQ2 A;  3CF5 L;  3PO4 A;  4FL9 A;  1QZ5 A;  3KTQ A;  4BR7 A;  2NRT A;  2HHX A;  3SUN A;  3N4P A;  3QEV A;  3OYM A;  4K41 A;  3LPT A;  4FVM A;  3CCS N;  3AO4 A;  4BQL A;  2F8S A;  1IG8 A;  4K0K K;  4FPA A;  2DFE A;  1VQL N;  3KWG A;  2ZD1 A;  4M63 C;  3KKR A;  4IFV A;  4CJS A;  4GV9 A;  3JYT A;  3SCX A;  3ULD A;  5EOY A;  1BA1 A;  1HX1 A;  2G8F A;  4B8A B;  1XC9 A;  5AQJ A;  1QE1 A;  5JLF A;  2F96 A;  3FLC O;  2QTD A;  1KLM A;  2WFB A;  4OPA A;  5C15 A;  1HNV A;  3F2K A;  3WQT A;  1N33 K;  5AZJ B;  1W0H A;  1RGI A;  4WQ5 A;  3AAR A;  4H4O A;  4IO8 A;  4A5B A;  1NGI A;  3SLC A;  4DTP A;  1ZBH A;  1Y97 A;  1CZB A;  1MA9 B;  1DEJ A;  4LH4 A;  4CFA A;  1LW0 A;  3OYL A;  4DSF A;  1SKS A;  4PUO A;  3VOV A;  3UKU A;  4DFM A;  5FRN A;  4XEI A;  3ZET B;  3EZ5 A;  3S3M A;  3LAK A;  4I7F A;  2Z1I A;  3HPO A;  5HLF A;  4M3Y A;  5FLX O;  1HYS A;  3VF2 A;  3W0L A;  1VSM A;  3DRS A;  2IGI A;  3V1R A;  5F0X A;  4FJ8 A;  2QWO A;  4W5R A;  4EP5 A;  4PY5 A;  3CJC A;  4HHT A;  3SQ1 A;  5JMV A;  1NJW A;  2CH5 A;  3V9U A;  1U6Z A;  3OYN A;  2PBD A;  3Q7C A;  4H0P A;  3G6E N;  4FYD A;  1YIT N;  1VQ5 N;  4NCA A;  2E88 A;  3ZSO A;  4CVN E;  5BPL A;  3ENB A;  4LFB K;  4CED A;  4H5T A;  3WQU A;  4EFH A;  4R5P A;  4FLY A;  4WFB L;  4PKH A;  1BDG A;  4PHT X;  2NRH A;  5AQV A;  4MQ3 A;  3OY9 A;  1ITG A;  3PUF A;  4QS9 A;  1TL3 A;  3OS1 A;  3OYK A;  1REV A;  5LJV A;  3KLI A;  4WQ4 A;  4JKA A;  1U45 A;  1W7A A;  4B3T K;  4Y1C A;  1RDB A;  1S1X A;  3UKR A;  3L2U A;  3WEE B;  4JI1 K;  1U04 A;  3S41 A;  4GV6 A;  4IDK A;  3SAH A;  1RT2 A;  1FXX A;  3THX A;  2YJE A;  1XWL A;  2XO7 A;  1OH7 A;  2DY4 A;  2E1Z A;  3QLH A;  4CGH A;  3RRH A;  1DTT A;  3VMF B;  4BRI A;  3CG7 A;  2ZGZ A;  4CGF A;  4FLW A;  2J4R A;  2RE2 A;  2Q1N A;  4CBX A;  4KH5 A;  4YHH K;  5GIP A;  4HUE A;  1YXQ A;  3M8P A;  1T05 A;  2YKN A;  1M90 O;  1TVR A;  3O9R A;  4LC9 B;  1VSK A;  2QK9 A;  4O5B A;  2UUC K;  3IRX A;  4QAG A;  4HCB A;  2UU9 K;  3SV4 A;  4Z4E A;  5KGW A;  4IJA A;  4DLE A;  4RG8 A;  1T03 A;  3C6U A;  4NYN A;  5BPM A;  1B9D A;  3JAM O;  4NB4 A;  2OPP A;  4DCH A;  1QQM A;  4HCC A;  3AVI A;  3R6M A;  3SI6 A;  1KFS A;  2GTD A;  1ATS A;  3QES A;  3FE1 A;  4I9Q A;  1WLJ A;  3A0I X;  2BUP A;  4K8Z A;  5AQO A;  2GWJ A;  2D0B A;  2ETJ A;  1WNS A;  5BR8 K;  1C6V A;  3ATV A;  1NK9 A;  4KPY A;  2BAN A;  5AQF A;  1FW6 A;  2P9P B;  3SQ0 A;  4GNI A;  1JLC A;  3EE9 A;  3RTV A;  3CQY A;  4KH4 A;  4CJU A;  5BPN A;  4CI6 A;  1N32 K;  4B3O A;  3FGU A;  4BGB A;  3L4Q A;  2V7Y A;  1DGK N;  2FF3 B;  3DXK B;  3WXI A;  4ELT A;  3DXM A;  3MCP A;  4FJM A;  3OW2 M;  2E5L K;  1GLD G;  3QB0 A;  4BR4 A;  3O6W A;  2KKZ A;  4CJF A;  3L2W A;  5M1P A;  3J7A P;  5ADX A;  3K59 A;  4KRE A;  5C42 A;  3QEX A;  4FWP A;  5FPM A;  4E7K A;  4M7Y A;  1Q9Y A;  4FM1 A;  1NBW A;  1R0A A;  4MFB A;  4CJW A;  4B8C A;  1ZYQ A;  1RBV A;  3AA4 A;  5EY4 A;  1QZ6 A;  3HM9 A;  1C1B A;  3F9M A;  3VQE A;  4OKE A;  3CFP A;  4GY2 B;  4OVL A;  3EE8 A;  4AH9 A;  5C25 A;  3C94 A;  1GLF O;  4C23 A;  3PX6 A;  4BRQ A;  3DAW A;  1TKD A;  4B1U B;  1S1W A;  1XHX A;  1J6Z A;  2EX3 A;  1HJR A;  2ATQ A;  3O9U A;  4JD2 B;  1QVG M;  1C0F A;  3BGR A;  1NGG A;  3EYZ A;  4FK0 A;  3Q7B A;  4LF4 K;  3J8A A;  3LZJ A;  1JLF A;  4ILJ A;  2VCP A;  1Q9X A;  4B9V A;  4GVE A;  1BI4 B;  3U8X A;  3DLB A;  3QFP A;  3K5O A;  3QEP A;  5HOO A;  4CEA A;  3FZM A;  2HHQ A;  2E1Y A;  3E66 A;  1BUP A;  1HKG A;  4CEZ A;  4K8X A;  4FM2 A;  3HZ6 A;  3O3F A;  1J9A A;  4FLT A;  4BWM A;  1S6Q A;  3CYM A;  1JLG A;  4CZK A;  3OHR A;  4FWK A;  4JK9 A;  1IKW A;  1YVN A;  2HST A;  1YVU A;  4DR4 K;  2JGU A;  2A1S A;  3K5M A;  4OKJ A;  1IV0 A;  4JKD A;  3PX4 A;  2D0O A;  1ZBF A;  1T44 A;  1BCO A;  3MN5 A;  4OGE A;  1SAZ A;  3OTO K;  1KLN A;  3VEY A;  1VQO N;  1ZC6 A;  3O4N A;  4JLH A;  5AQU A;  3CCV N;  4B9N A;  4R79 A;  2O8E B;  1YUW A;  3DM2 A;  2VWJ A;  4CD1 A;  4DR7 K;  1EX4 A;  4PQU A;  3L6Q A;  2VG7 A;  1WSF A;  3TAR A;  5DMR A;  3ULE B;  1NK7 A;  2RHK A;  3NF7 A;  1NJZ A;  4IOC L;  3P1G A;  4JN4 A;  4DR1 K;  4FJ5 A;  3CHW A;  3T1A A;  3LDO A;  3LAN A;  4YOR A;  3THW A;  2FXU A;  3QML A;  3ZSY A;  3AO1 A;  1K8K B;  3T1Y K;  4JHD B;  3DYA A;  4RW9 A;  5EXW A;  4IXC A;  3T7Z A;  4KHW A;  3LAM A;  2RPI A;  1TKT A;  4E19 A;  3SPZ A;  1NKE A;  3VQA A;  4JRQ A;  5AQG A;  1QQN A;  4CBW A;  2XY6 A;  1RT4 A;  1BG3 A;  4O55 A;  4X64 K;  3H1Q A;  1XI1 A;  3CM5 A;  3HPG A;  1RNH A;  3KK2 A;  4FWN A;  4WCE L;  2CGJ A;  1NKC A;  3IFR A;  3WNE A;  1MWK A;  1VSI A;  3LM2 A;  4YY3 K;  1J53 A;  5ADX H;  4F3T A;  1GLL O;  3MEE A;  3GDQ A;  3H46 O;  2YHY A;  1WOQ A;  5GAD P;  1EO1 A;  4TSX A;  2HW3 A;  4KB0 A;  2OYQ A;  1HNW K;  3DMJ A;  4PL7 A;  1NGC A;  4DV6 K;  3OYC A;  4FWO A;  3MMV A;  4KKO A;  1EET A;  4IEI A;  4IEE A;  4FWQ A;  2HBL A;  3M8Q A;  4WQ5 C;  4N47 A;  3WXM B;  3ZT1 A;  1O13 A;  4NXM K;  1JXE A;  3M3Z A;  1UA0 A;  2VQF K;  2PYL A;  4RW8 A;  3MXI A;  3QEW A;  2HND A;  3AVJ A;  4A2B A;  3AGK A;  1IKY A;  4UY8 O;  3CC4 N;  4KAZ A;  3O1W A;  1QSS A;  4FJI A;  5AQL A;  3NVM A;  1JLB A;  3UE5 A;  1YHQ N;  3HK2 A;  4HUF A;  3KK3 A;  2F7T A;  4M41 A;  4Y1D A;  4CZH A;  4DSI A;  3U6F A;  2OAN A;  3JXU A;  4YFU A;  1TK0 A;  3NF6 A;  3RR8 A;  1ASU A;  2X78 A;  2QWL A;  3EO3 A;  1O1W A;  3VQC A;  2OCE A;  2HBM A;  1KRP A;  1RBS A;  1C1C A;  3B6O A;  2HNZ A;  1RTI A;  4BRO A;  2IVO A;  3OYI A;  3KLF A;  3LDS A;  3U9D A;  2G8V A;  3BZC A;  4KI6 A;  3FZF A;  2VG6 A;  1VQ6 N;  3AVL A;  4FZY A;  5AFU A;  3MXM A;  4M45 A;  5GAG P;  3UKU B;  4EP4 A;  4BDY A;  4CZI A;  4I9L A;  4DV7 K;  3V1O A;  2LSN A;  3LDN A;  3LP0 A;  4WQ4 C;  3VEW A;  5EVZ A;  4JV5 K;  1N5Y A;  4LF5 K;  3NAE A;  2GWK A;  3L0Q A;  1RTJ A;  3EKS A;  4CER A;  3WNG A;  4JAX A;  2HHV A;  4OGC A;  4K43 A;  2YNH A;  3BEX A;  1YIJ N;  3AVA A;  4DTU A;  3AY9 A;  5A2Q O;  4CF8 A;  2V51 B;  5CE3 A;  3NF8 A;  1JJ2 M;  3KK7 A;  3A5L C;  3NH1 A;  3M6G A;  4AM7 A;  4J2B A;  3BUZ B;  4ZTJ A;  4C8N A;  1BO5 O;  1NWK A;  1TK8 A;  1HKC A;  1NU0 A;  2EWS A;  2IAJ A;  2IOC A;  3HTV A;  4CBU A;  3BY5 A;  1BCM A;  1ZBI A;  5KGX A;  3E01 A;  3FFK B;  4CE9 A;  3QO9 A;  3E9L A;  3M8S A;  2QWQ A;  1GLB G;  2OZS A;  4NCB A;  3VA0 A;  2X74 A;  1SV5 A;  3I8D A;  1YTA A;  4FJN A;  4CGI A;  4H5V A;  1CZA N;  4BR0 A;  3SNN A;  4ICL A;  3UKR B;  1NK5 A;  2QWM A;  4CZL A;  4BRK A;  2QA4 N;  4FJL A;  2E2N A;  4MO5 A;  3THX B;  2IDO A;  3H3O B;  4H0V B;  1Q81 O;  3PIO L;  2D4W A;  3KKS A;  3HYF A;  4DHY A;  3ZT4 A;  4XH5 A;  5IWA K;  1SQK A;  2FC0 A;  4E7L A;  3H6E A;  3VN5 A;  3QFU A;  1RTH A;  3OVN A;  2XHB A;  5C10 A;  4OPK A;  2Q97 A;  3B8A X;  4DQS A;  1G99 A;  4ZHR A;  3F5T A;  3TU5 A;  3KLE A;  2CGK A;  1E4G T;  5AQW A;  3WNF A;  4XH4 A;  2WON A;  5KPR A;  1K9M O;  1BQM A;  3MEC A;  3NGI A;  4FJK A;  4NCG A;  3VEZ A;  3GOI A;  2KZM A;  4ISF A;  5FPE A;  3ZX0 A;  1CXQ A;  2Y1I A;  3THY A;  1QQO A;  5KI6 A;  2Z1J A;  3AVK A;  2A3Z A;  4YOU A;  3BZK A;  4KTQ A;  1VQ8 N;  4XIU A;  4OX9 K;  3OJS A;  2D0P A;  5E84 A;  2BDP A;  3MED A;  4DU1 A;  5AQT A;  3TAF A;  4I2P A;  5BRH A;  4BR5 A;  1VQM N;  1K8A O;  4JKB A;  4DU3 A;  2DFH A;  4O8U A;  3QNN A;  3C6H A;  4DMN A;  3SZ2 A;  1HNI A;  4CEO A;  1UA1 A;  4CEC A;  1B92 A;  2E6L A;  5AFU H;  4BC2 A;  4CZJ A;  1QHA A;  4JI0 K;  3DXM B;  3JS6 A;  3BDP A;  2B5J A;  5JS2 A;  2UUA K;  2CH6 A;  1RDD A;  3K2P A;  2GEL A;  4DTR A;  3EKU A;  1OH8 A;  3M8R A;  4M42 A;  4JKE A;  4A59 A;  1KAY A;  1IKX A;  5I9E B;  3FR0 A;  1EXQ A;  1KVA A;  3O8M A;  4J2A A;  1MWM A;  5FPD A;  2DTU A;  3WNH A;  3P31 A;  2A40 A;  1N8R O;  3S3N A;  4DSE A;  1X3M A;  2A42 A;  3CCM N;  2XY7 A;  1HLU A;  3T1H K;  2P9I A;  3LDP A;  3DLE A;  2PY5 A;  3E1Y A;  4DV0 K;  4CGD A;  4FJX A;  3G4S N;  4DTO A;  1YAG A;  3NFA A;  3TR8 A;  4ID1 A;  2WUS A;  3NHG A;  1S3X A;  5BN9 A;  5I3U A;  1IBK K;  4JI5 K;  5JVG L;  4L8R B;  4AHR A;  2YJF A;  3D2F A;  4BRC A;  2P5O A;  3ZSW A;  3CFO A;  1C0M A;  4GMJ B;  2GBZ A;  4EIA A;  1U4B A;  2D1K A;  3QEI A;  3DLG A;  2P9L A;  1NGJ A;  1HUX A;  4MDA A;  1L5U A;  4JNE A;  1WSJ A;  4O0J A;  1TKZ A;  4C1N I;  1OH5 A;  4JK8 A;  1WN7 A;  2E2P A;  2WBN A;  4MO4 A;  4E89 A;  3SMP A;  5T7B A;  5AQS A;  4EHU A;  3ALY A;  1WSI A;  3QBW A;  1JLA A;  4JK7 A;  4BRM A;  4DV2 K;  2G8H A;  5TKY A;  4NYF A;  1U47 A;  3K5L A;  1GOB A;  2F9T A;  3QDK A;  1H1V A;  4V19 S;  2QM1 A;  1TGO A;  3BF3 A;  3ISN C;  3CQ8 A;  3A2F A;  4BRP A;  2O8C A;  5GAE P;  5AQY A;  4H4M A;  4KHY A;  2VWB A;  5AQH A;  3VGM A;  2NZT A;  2E2Q A;  4LD0 A;  4FLV A;  4NO7 A;  1RBT A;  4DB3 A;  2Q0U A;  5E26 A;  5BRE A;  2JLE A;  3CJ9 A;  5SWM A;  3RSE B;  5AJ3 K;  2HHH K;  1BGX T;  4ID5 A;  1KVC A;  3AVM A;  3PY8 A;  3A5M C;  3OYH A;  3J81 O;  3L2V A;  2W6K A;  4DQ8 A;  3CM6 A;  1XMQ K;  4BC4 A;  1YTU A;  3AVF A;  4L3Q A;  4M3X A;  3FZK A;  3WXL A;  4CZM A;  1U48 A;  1YT3 A;  2OZM A;  4NLC A;  4DR3 K;  2P9U A;  3K9J A;  4I6M A;  3E9O A;  3VQ8 A;  1QHT A;  2PZS A;  2NNW A;  2JWL A;  3I0S A;  2ZJR L;  1LCU A;  2GUP A;  3O4W A;  4BGA A;  3JSM A;  3MX5 A;  3I56 N;  4RWT A;  3L4I A;  1VK0 A;  1WSH A;  2P5G A;  1JL1 A;  4M3Z A;  3C7N B;  4DUZ K;  3VQ7 A;  4B9S A;  4GV3 A;  3L2Q A;  1Q86 O;  2QXL A;  2EHG A;  2BE2 A;  3CJB A;  1LOT B;  4DQI A;  4Z4F A;  2RKI A;  2ITG A;  4FM0 A;  1NKB A;  1JLQ A;  5M1O A;  4C8M A;  3TTC A;  1NK4 A;  1ILY A;  1KD1 O;  1VQN N;  1S1T A;  3J80 O;  3MAQ A;  3H45 C;  3EY1 A;  3SBG A;  3KHY A;  1NLV A;  3SQ2 A;  1TYQ A;  4E7I A;  3O08 A;  3FZL A;  4LY7 A;  3SJJ A;  3QIP A;  3C95 A;  5J2M A;  1NM1 A;  4QCL A;  2W42 A;  4H5N A;  2V7Z A;  3BP8 A;  2VG5 A;  1QSL A;  1SL2 A;  5DM7 L;  2D5R A;  4AHS A;  3A5N C;  1I3A A;  3S9H A;  3HOS A;  5CHI A;  1IG9 A;  4BDZ A;  4BC5 A;  4RW6 A;  3ZSZ A;  4H8K A;  3H08 A;  3VPZ A;  2ZQB A;  3SMS A;  4JKC A;  1U2V A;  4CJ7 A;  4U67 L;  4B3R K;  3AVG A;  3CET A;  3HL8 A;  1BU6 O;  1RT3 A;  1EP4 A;  4CZG A;  1I94 K;  4G1Q A;  1S1V A;  1M1K O;  4IDH A;  3D6R A;  4OPH A;  4A61 A;  3ITH A;  3MK6 A;  5TKW A;  3WT0 A;  3QET A;  4WF9 L;  2FLO A;  3LDL A;  5C2F A;  3CCU N;  1XQS C;  5H1S Q;  3RMB A;  4JYA K;  3OJU A;  3NBP A;  2P51 A;  3VQ4 A;  5BN8 A;  1OVQ A;  3O9T A;  5JVH L;  4K25 A;  1KAZ A;  1NJX A;  4OPJ A;  4CJE A;  1KCF A;  1V4T A;  3D0P A;  1NOY A;  1WAJ A;  4BRN A;  4EHT A;  3DOL A;  1X9S A;  2O8F A;  5C2D A;  4K42 A;  3TTF A;  4H0Y B;  3RMC A;  3AGR A;  1A5X A;  3KZB A;  2B4J A;  2YX6 A;  2V52 B;  1T7P A;  1TUU A;  4FW2 A;  3AV9 A;  4IFY A;  3LZI A;  4E3S A;  4IBN A;  2FBX A;  4CJV A;  2QXF A;  1G15 A;  3HM8 A;  1LV5 A;  1JLE A;  4ZTF A;  4Z94 A;  1VSF A;  2NLX A;  5F2R A;  1VQP N;  2O4I A;  1D9F A;  5C24 A;  4YNQ A;  5AQM A;  4B9L A;  1SKR A;  3LWL A;  5FDL A;  3VQP A;  5K14 A;  4LFA K;  3LP1 A;  5AQQ A;  3TAP A;  4IG0 A;  4KHQ A;  3KLG A;  2KLA A;  4DF4 A;  4CJ5 A;  2NRV A;  4FZZ A;  3LP2 A;  3NF9 A;  1Q7Y O;  1Y64 A;  1XUP O;  3L3U A;  4H0X B;  4GKK K;  3A5O C;  2GV9 A;  1MDU B;  3K5N A;  4LF9 K;  1HPZ A;  4CHN A;  4LH5 A;  3MXJ A;  2Q36 A;  5KTQ A;  2F8T A;  5C12 A;  3QIO A;  3T69 A;  1S9E A;  3TAG A;  3HO1 A;  3SV3 A;  2ZE2 A;  1T3V A;  2CGL A;  4B1X B;  3PLA A;  2FSN A;  5KQD A;  1J5O A;  1LWE A;  1UOC A;  4NLB A;  4I2Q A;  2YKM A;  3HST B;  4DSK A;  3KK1 A;  3M5R A;  3D7E O;  1NNE A;  2O8D A;  2P9P A;  2P9S B;  4KI4 A;  3J7Y P;  1Q18 A;  3HVR A;  3VEO A;  4JS5 A;  1RDA A;  4DU4 A;  4FOE A;  4CJL A;  3CMA N;  4DV3 K;  1WUA A;  4AM6 A;  3AA3 A;  2HBJ A;  1BHL A;  4JKG A;  4FJG A;  1NGE A;  3ASM A;  2AP1 A;  4BQZ A;  1L3V A;  3V9Z A;  4HVJ A;  2UXD K;  3MDQ A;  3THY B;  4BRF A;  2W41 A;  1VHX A;  3LDQ A;  4O8K A;  2D0A A;  4DR5 K;  4DV5 K;  1OH6 A;  5AZI A;  3ZEU A;  1SS6 A;  2QEX N;  1S5J A;  4KH6 A;  5LMU K;  4AF1 A;  1RT7 A;  5CZ2 A;  4DWI A;  3RMD A;  4M7X A;  4BWJ A;  4AQY K;  4LFC K;  2NRX A;  5AQI A;  4IZ9 A;  3VTI A;  4C8K A;  5HRO A;  4CIE A;  1VSH A;  2W6L A;  1TV6 A;  2ZJQ L;  4J8F A;  1GLJ O;  1SKW A;  3R9P A;  3OYD A;  4KV8 A;  1Z05 A;  2WC9 A;  2E8A A;  4YOX A;  5SZT A;  1WBD A;  4FWL A;  3VQ6 A;  4JI2 K;  4N56 A;  4FWM A;  2A5X A;  1D8Y A;  1D5A A;  5IT9 O;  4CF1 A;  3AAQ A;  3ZCM A;  1NJY A;  1LWF A;  4DUY K;  1L3T A;  4OLB A;  1KC8 O;  3AVB A;  1NG9 A;  3EL2 A;  1RBU A;  3VQD A;  2BH1 A;  3DWL A;  4DTN A;  1BOT O;  4X62 K;  4U7B A;  4DV1 K;  1C0T A;  5D3G A;  3QIN A;  3TTD A;  2A6A A;  3VTH A;  3VGL A;  3E9P A;  3P38 A;  4B1W B;  1NK6 A;  4JKH A;  4CF2 A;  4AHU A;  1SUQ A;  1GOC A;  3SQ4 A;  3THV A;  3OA9 A;  1BWF O;  4FJH A;  1KVB A;  1KSP A;  1IH7 A;  4E7H A;  2HVH A;  3QBX A;  1V4S A;  4RW4 A;  5MLC Q;  4FSV A;  4AIL C;  4B9T A;  4BG9 A;  5JS1 A;  3D2F B;  2XY8 A;  2HHW A;  2UUB K;  2E2O A;  1ATR A;  4Q5V A;  5LMN K;  2O8E A;  1I39 A;  2P9L B;  5J2Q A;  3CCQ N;  2A41 A;  2QKK A;  3HVT A;  2YI1 A;  3AO3 A;  4E1M A;  1FKP A;  1ASW A;  1BL3 A;  1FK9 A;  4FLX A;  4F3O A;  1HJO A;  1VQK N;  3D2E A;  2Q0R A;  1NGB A;  1KXP A;  3LPU A;  4MLE A;  4BRG A;  2ASO A;  2BGG A;  2RN2 A;  1NOZ A;  2HF4 A;  3RWU A;  4FJJ A;  3SBT A;  1C0G A;  4E0D A;  5DM6 L;  1XC3 A;  5KRS A;  4DFK A;  2QI2 A;  1GLA G;  4IJN A;  1X3N A;  1U49 A;  3GG4 A;  1CXU A;  3FZH A;  2I7N A;  5M1N A;  5EU7 A;  2VYP A;  1S72 N;  1IKV A;  3IS9 A;  2O8C B;  3CD6 N;  3ATU A;  5BRD A;  2HHU A;  5JLH A;  3RRG A;  5KPZ A;  1VRT A;  2PFU A;  3C0B A;  3ZSV A;  2ZWH A;  1TKX A;  2F9W A;  2ASP A;  4OLA A;  1VQ4 N;  3C6A A;  1HRH A;  5CY4 A;  3CJ1 A;  4BVP A;  3OS0 A;  2UYT A;  3A8Y A;  1IBL K;  3CCL N;  4CHQ A;  3R1X A;  2E20 A;  3AVN A;  1X9M A;  1NGD A;  3DRP A;  4B9Q A;  3DOK A;  4KHU A;  1Q82 O;  1RDC A;  3ZSX A;  2OTL N;  4CJR A;  2O8B A;  4H5R A;  2P9U B;  1KQS M;  3QIC A;  4I6M B;  3TI0 A;  1EKE A;  3RR7 A;  4Z4G A;  3K9K A;  1RDU A;  4BRA A;  1T8E A;  1ZXO A;  2DFF A;  4ISG A;  1J5E K;  3CC2 N;  4WE1 A;  4EAH D;  4QS8 A;  3OBW A;  4QOZ B;  3HP9 A;  2IVN A;  3HT3 A;  3OS2 A;  4DQQ A;  4BAC A;  1BQN A;  4CGJ A;  4A5A A;  1JCG A;  3SUQ A;  4DF8 A;  1WSE A;  1NJI O;  4DTS A;  1VQ7 N;  1BIS A;  5HRP A;  4YDU A;  4FLZ A;  3VEV A;  3KWI A;  3OYE A;  4W5N A;  1VSL A;  3F9K A;  2ZJP L;  3O3H A;  1A5W A;  1TAU A;  5GIN A;  4B3M K;  3CJA A;  1RBR A;  2Z1G A;  1WSG A;  4IOA L;  3AAP A;  2HNY A;  4DSL A;  2E6M A;  1OKJ A;  1RTD A;  2G8K A;  2ZF5 O;  4DTM A;  4O4G A;  4C1N K;  3VEN A;  3V9S A;  3CXC M;  2I7P A;  3K58 A;  5DK5 A;  3TAM A;  1ZBU A;  4KTZ A;  3QNO A;  4CD3 A;  4JI4 K;  4FWR A;  1TYQ B;  3RMA A;  4DR2 K;  5AQR A;  1S6P A;  5EX5 A;  3LL3 A;  4GKJ K;  4E1N A;  5CZ1 A;  3HRG A;  2XY5 A;  1YJW N;  3VQ9 A;  3ZX3 A;  4B1V A;  5LJW A;  2YHA A;  2UXC K;  2FSJ A;  1U2V B;  5E41 A;  4CHZ A;  4N5S A;  4CCH A;  4CJ3 A;  3OYA A;  5LY3 A;  5M1F A;  4DSJ A;  2G8W A;  4W5T A;  4CHO A;  3NDK A;  2FBT A;  5GIO A;  2OPR A;  1NGH A;  4J2D A;  5C0Y A;  3ZYY X;  3VES A;  4FK2 A;  1K6Y A;  1NMN A;  4CGG A;  4H03 B;  1F21 A;  3NH0 A;  3IG1 A;  1T6D A;  1Z26 A;  3N4Q A;  2P9K A;  5FRM A;  3TWH A;  1NK0 A;  2ZM6 K;  3R8E A;  3F73 A;  4M3U A;  2Q2R A;  3CIP A;  1Q8I A;  4JEP A;  4F9O A;  5HRR A;  1KTQ A;  1BIZ A;  5HBM A;  2QWN A;  1IBM K;  2YCH A;  1BIU A;  4CEE A;  4BRE A;  4IG3 A;  3L8B A;  1YJ9 N;  1J54 A;  2O8F B;  3TAB A;  1K73 O;  1MU2 A;  2HVI A;  2ITM A;  2D0C A;  5BR9 A;  3AO2 A;  4FPB A;  1WAF A;  4O44 A;  1QSY A;  4H0O A;  5M1Q A;  4HWI A;  3OYB A;  2P9N A;  2VWK A;  3O9S A;  4QS7 A;  3PIP L;  1Z6R A;  1TUY A;  4IKF A;  3C6T A;  2KFZ A;  1R59 O;  3IMX A;  2R7Y A;  3VGK A;  2Y1J A;  4KFB A;  4M3R A;  3I55 N;  2F4V K;  3D45 A;  3THW B;  1WBB A;  4YOW A;  4JKF A;  3HBT A;  1HYZ A;  3U3G A;  3H3N O;  4DKW A;  4FJ9 A;  4GW6 A;  5KQ8 A;  4Y0W A;  2QW9 A;  1ASV A;  3P39 A;  3OBY A; 
#chains in the Genus database with same CATH homology
 4B3T K;  5LMU K;  5LL6 Z;  4AQY K;  4LFC K;  4JI1 K;  4GKJ K;  4K0K K;  4X64 K;  2UXC K;  4X65 K;  4DV7 K;  4LF7 K;  3J80 O;  4JV5 K;  4LF5 K;  4LFA K;  4LF4 K;  4B3S K;  4YHH K;  4YY3 K;  1HNX K;  4JI2 K;  4DV2 K;  5IT9 O;  1IBL K;  1N33 K;  4OX9 K;  2UUC K;  4DUY K;  4NXN K;  4JI3 K;  2UU9 K;  4DR6 K;  1FJG K;  4V19 S;  5A2Q O;  1HNW K;  1HR0 K;  4GKK K;  4X62 K;  4JI8 K;  4LF9 K;  4DV1 K;  4DV6 K;  2ZM6 K;  2UXB K;  4JI6 K;  3JAM O;  1XNR K;  4X66 K;  4B3R K;  4JI0 K;  1J5E K;  5FLX O;  4DR4 K;  1IBM K;  5AJ3 K;  2HHH K;  2UUA K;  1I94 K;  4NXM K;  2VQF K;  3J81 O;  5BR8 K;  2VQE K;  1XMQ K;  4JI7 K;  1XNQ K;  1N34 K;  4LF8 K;  3OTO K;  4JYA K;  2UUB K;  4DR3 K;  1N36 K;  1HNZ K;  5LMN K;  4DR7 K;  3J7Y P;  4B3M K;  4KHP K;  1N32 K;  4CVN E;  4LFB K;  4DV4 K;  4CW7 B;  3T1H K;  4DV3 K;  2E5L K;  4DR1 K;  2F4V K;  4DV0 K;  5IWA K;  3J7A P;  2UXD K;  4LF6 K;  1XMO K;  4DUZ K;  1IBK K;  4JI5 K;  3T1Y K;  4JI4 K;  4DR5 K;  4DV5 K;  4DR2 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...