1HR0K

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1hr0K00
2UXCK 3T1YK 2HHHK 4LF9K 4X64K 1XNRK 1N36K 4NXNK 1IBMK 4LF7K 3J81O 2E5LK 4JV5K 4DV5K 4DUZK 4JI4K 4GKKK 4LFCK 2F4VK 1J5EK 4YHHK 4LF6K 5BR8K 5AJ3K 4LF4K 1I94K 4GKJK 4X66K 2UUAK 5LMUK 5IWAK 5LL6Z 4JI0K 4DR2K 4DV2K 2VQEK 3T1HK 4JI2K 4B3MK 4JI5K 4DR7K 1IBKK 1HNWK 4B3RK 4DV0K 1IBLK 2UXBK 4DR4K 1XMQK 4DV7K 3J80O 4B3SK 4DV6K 4DR5K 4CVNE 2UUCK 4DR3K 2UXDK 5FLXO 4JI8K 4LF8K 4X65K 3J7AP 3JAMO 5IT9O 4JI6K 4DR6K 2UU9K 4OX9K 4DR1K 4AQYK 2UUBK 4CW7B 4B3TK 1XMOK 5A2QO 1XNQK 4LF5K 1N33K 4DV1K 4YY3K 5LMNK 1FJGK 2VQFK 1HR0K 1N34K 4V19S 3J7YP 4DUYK 4KHPK 4LFAK 2ZM6K 1HNZK 4JYAK 4JI3K 4JI7K 4JI1K 4DV3K 1HNXK 1N32K 4X62K 4K0KK 4LFBK 4DV4K 3OTOK 4NXMK
chains in the Genus database with same CATH superfamily
4H4OA 2KZZA 3HPHA 1R59O 2P9PB 4C8OA 3RWUA 2Q3SA 3NDKA 4E7KA 1U48A 5C2DA 2G8UA 1RCHA 4YDUA 3QEIA 2E5LK 1NGCA 3CQXA 3THYB 2FXUA 1U2VA 3QBXA 4LF4K 3QICA 3RR8A 2E6LA 2ZJQL 2P9UA 3U9DA 4FLZA 4C8NA 4CGHA 3W3DA 3MCAB 1HQEA 1ZBUA 3AVCA 1LCUA 5E26A 3NGZA 3KIOA 4FWOA 2Q36A 4RWTA 3DAWA 3DLLL 2NRWA 2JGUA 4IKFA 4XH4A 4EP5A 1FK9A 2Z1GA 1M90O 1NGGA 3DM2A 1JCEA 4DCHA 3WNEA 2P9PA 4BRLA 5LJVA 3NCIA 1RGIA 3SAHA 3RSEB 4Z0UA 2ASPA 2I7NA 2G8WA 4FXDA 4LD0A 4E7JA 3Q7CA 2VWKA 4FM1A 1RDBA 3LDPA 2ITGA 4EIAA 4O0IA 3I56N 4IJAA 4HUGA 1RBTA 1NK4A 3C6UA 1QE1A 1VSIA 3DLHA 3DMJA 2KQ2A 2GWJA 4FLVA 2W40A 4IOAL 4M3TA 2IGIA 1X9WA 3F73A 2VG6A 5AQXA 5BR9A 4NCAA 1QQOA 4JI7K 3GL1A 1CZAN 2O4GA 4DFPA 3EN9A 2W42A 4M3WA 4X62K 3S3OA 3DXMA 3HOSA 2D0AA 4WQ4C 3I0RA 3THWA 2F96A 3L2WA 1NGIA 4BC3A 4LF9K 4Z4IA 3JXUA 4KHWA 3DXKA 3UIQA 3OS2A 1L3SA 3MEGA 5F0XA 4J2DA 2B4JA 2WOMA 3VF2A 1RT1A 4NYFA 5EU7A 4CEDA 3ITHA 5M1KA 1N5YA 1I94K 2F8SA 4B3OA 1WSIA 1JXEA 3ATUA 1NGFA 2GX9A 4CGIA 1VQ4N 1C6VA 3AGRA 2UUAK 3V9XA 5AQOA 1RT4A 4Y1DA 4OO1J 4IEEA 5CR4A 3T1HK 4OLAA 1QSLA 2NRRA 4F3TA 4KFBA 2A1RA 1RT7A 1WB9A 2QWMA 3HVTA 2IC3A 4CEAA 5I3UA 4JKEA 1BISA 3CCLN 4CJ4A 3K9KA 1H1VA 3HM9A 4DTXA 1LV5A 2NRTA 4FWNA 1TK0A 1GLLO 4LF8K 2FSNA 1T6DA 3FGUA 4X65K 1JCGA 3A8YA 4ZTJA 3SBTA 1Z05A 1NOYA 3QEXA 2D0PA 3O5BA 4C1NK 1ZBSA 1JCFA 4K25A 5CYQA 2KKZA 3LM9A 2YX6A 3RR7A 3THVA 3ULEA 1SAZA 1S9GA 3AA5X 4CI6A 1XMOK 3QFUA 3DWLA 3SQ2A 1VSMA 1KQSM 3THXA 2G8KA 1RTJA 4YOVA 4KPYA 2P9LA 1FJGK 1A5VA 4FWLA 1HYVA 3O9QA 1HR0K 5J2MA 4KHQA 3O6WA 3NHGA 1X9JA 3JSMA 3AGKA 5E41A 2HHWA 1X9MA 3MWTA 3C6HA 1XC9A 3VQQA 3G71N 5AQPA 3CCJN 3OTOK 3MN5A 4FSVA 1CZ9A 4BRNA 2A42A 3UKUA 4JEPA 4CBUA 4FJKA 4BVOA 4CFCA 2UYTA 4K43A 4KTQA 1VQMN 3F9MA 2A41A 4U7BA 5J2PA 4FJ8A 1GLAG 3VF4A 1Z6RA 1LWCA 4TSXA 3K58A 2YNHA 4JKCA 2B6AA 3ZEUB 4CERA 5ADXA 1RDUA 1EQYA 3L8BA 2KLAA 1J6ZA 2VGNA 1P90A 2HVHA 3QNNA 4IJNA 4H5RA 1SL2A 3LDQA 3O4WA 2A5XA 1T6CA 3PX6A 4XIUA 4WFAL 1HNWK 3QIPA 4DQRA 3D45A 3H3OB 5AQWA 1VSKA 2Q31A 3AA2A 2YNGA 3DRSA 3OYLA 5JLFA 4C1NI 4DQSA 1K73O 3CJ9A 3ZT3A 4MLEA 5FLXO 3WEEA 1NGHA 4M3ZA 3K59A 3HPGA 3GDQA 4DQPA 4IFVA 1XUPO 1TL3A 4CJSA 3HP9A 1WUAA 4CZFA 1U47A 5LJWA 1NGAA 1SZ2A 1QHTA 4CZJA 1VAZA 4NO7A 3P83D 5M1QA 4DTNA 4A59A 4E19A 4BE2A 4BE1A 2HBLA 4FK4A 3FLCO 2B5JA 3PSFA 3U9ZA 4KHSA 4CJVA 3KJVA 4CJKA 4EFHA 2VQFK 2VYPA 4OGCA 1VQLN 3I0SA 3MX2A 5F1XA 5EX5A 1NU0A 3A0IX 1WLJA 2OPSA 4LC9B 5C15A 4K0KK 4F3OA 4N41A 3E9LA 4PUOA 1NNEA 1HNVA 3WQUA 3F2KA 1CXQA 3MEEA 4M7XA 4WF9L 2D1KA 1XNRK 3ZSOA 4CJQA 3QETA 3BDPA 3VEXA 1C0UA 3AVMA 3TAPA 4BR4A 1FKPA 3ZX3A 1R0AA 4FWRA 4O5BA 4EHUA 1YHQN 3J8AA 3TTDA 4CFDA 3WNFA 4OVLA 5DK5A 5AQQA 4K42A 1SUQA 5LL6Z 1J54A 3OHRA 5BRHA 2ZWHA 3OYCA 4YOYA 1VSHA 4N56A 5BRDA 2XHBA 2FSJA 3AAPA 3HZ6A 1T05A 3AO3A 3L2QA 3G25A 5AZJB 3RVCA 1WOQA 3EKSA 2QWRA 1YF5L 2VCPA 5AQYA 1RNHA 3VA3A 1IO2A 3TSQA 4ELTA 3BEXA 4BRHA 1QQCA 2ZE2A 3E01A 3P5JA 1YTAA 5F2RA 4FJLA 3A5MC 3VEZA 4M3XA 1MU2A 3CJAA 5HBMA 4W5OA 1KVBA 5AQUA 3NF6A 5AZIB 4BWJA 1SL1A 4H0TB 3HSCA 3TTFA 2QW9A 3TAMA 3SUNA 3AA3A 3DYAA 3WT0A 4CHPA 2FF3B 3SPYA 4G9ZA 1S6QA 3TSPA 1GLCG 3RMAA 2UUBK 4BC2A 4B3TK 1VQPN 2AJQA 1HX1A 4C8KA 5A2QO 4AHCA 3V9UA 3LAKA 2QKKA 4B8AB 3G10A 5DM6L 4BRMA 1TL1A 3IKMA 1BDGA 5GADP 3CCMN 3SJHA 1W9HA 4PKIA 3KK1A 3E9PA 4JYAK 4IDKA 3AVKA 1HNXK 4PY5A 2O8BB 1UWBA 4YDUC 5MLCQ 2F8TA 3HM8A 4A2AA 4FJ9A 3K57A 1BI4A 1NK5A 4M7YA 3MN9A 4X64K 5C0YA 1I39A 2V52B 1N36K 1HKCA 1S1TA 2O8CB 3KD5E 5BPLA 4DQIA 3VQEA 3IG1A 1BCOA 4MO5A 2RN2A 2ASOA 2HOEA 1VQ9N 1HKGA 3ZETB 3PO4A 1HJOA 2QWQA 2QA4N 3L6QA 1VSDA 4CBXA 3OS0A 1HMVA 4K8XA 2P9UB 4AF1A 4DTUA 3V4IA 3F5TA 1UA1A 4RG8A 3NBPA 2P9KB 2D4WA 2YHXA 3DOLA 3EL2A 3O08A 4KV8A 4JI2K 1VSFA 3KLGA 4B3MK 4H0VB 4JI5K 4CGJA 4DR7K 1TYQB 3BY5A 3ZSWA 2W6KA 1JLCA 2X78A 4KI4A 2FBVA 3J80O 4KB1A 2KW4A 1IG8A 1RDWX 2ASMA 3EZ5A 1S1WA 5CE3A 4DR3K 3J7ZO 5D3GA 2ZQBA 4O4GA 4BR2A 2OYQA 4Z4GA 1KAYA 3K5MA 3LWLA 3OS1A 1B9DA 1VSLA 1FXXA 4DR6K 2PAVA 1U04A 4Y0WA 1TKDA 4AHVA 3ZSYA 4CGGA 3TABA 3NH0A 3FFIA 4BDZA 3ZEUA 4DFKA 3MDQA 2GWKA 3NVKA 4OKJA 4LF5K 3SYZA 3R9PA 2DFFA 4LY7A 4BG8A 3K9JA 2D0OA 4CGDA 3SAGA 1N34K 1T03A 5FRNA 2YHAA 3IFRA 3ZT2A 3KK2A 4E3SA 3VETA 5K14A 4B9NA 3DJCA 4DG1A 3VA0A 2X6NA 1U49A 3RMCA 4AM7A 1EXQA 4CECA 4FPAA 4CJFA 5JVHL 4HCBA 1HQUA 2ETJA 4B1WB 1S5JA 2J4RA 2E6MA 5HLFA 3BZKA 4B1ZA 3QIOA 1KRPA 5J2QA 4CE9A 3ID6A 3KK3A 1RT5A 1MA9B 3KHYA 4FW2A 1GOAA 3T7ZA 4F2RA 4H0PA 2HNDA 4DUZK 4GV3A 1BIUA 4O5FA 3E1YA 4FPBA 3OYJA 1YI2N 3LZIA 1WBDA 5ADXH 5GAGP 1NOZA 3C6AA 3M5RA 1ESVA 3HPOA 4DSLA 5EOYA 4OKKA 3TPQA 2E4LA 4H0OA 1NJWA 1WAFA 3K0SA 2PYJA 4JRQA 1L5UA 3THXB 3KTQA 3HYFA 1NJYA 3AVGA 5BREA 3QNOA 3HJFA 3O9SA 4DV2K 4FOIA 3DOKA 1YIJN 4BR0A 2A1SA 3B8AX 1TGOA 5AZJA 3AVJA 4NB4A 2QXFA 4MQ3A 2E2QA 3LP2A 4Q0BA 4RCHA 4CCHA 4FW1A 1KLNA 1C0GA 1BCMA 3QESA 3HVRA 1IKYA 4BWMA 1EP4A 4DR5K 2UUCK 2HMPA 4AILC 2UXDK 3JS6A 3UKUB 5B8HA 3V6DA 3PIPL 2AA4A 1A5WA 4YORA 3PLAA 3WNHA 4BR7A 2QWLA 4OJRA 4L3QA 1Y97A 3TSUA 3THYA 3C65A 4NCBA 3CMAN 1RDAA 4B1UB 4Z4EA 4CF0A 1TKXA 3CFPA 4JKGA 4KHYA 4BR9A 5KPZA 1NK6A 1BOTO 3O9UA 5J2NA 4BE0A 3BF3A 1GLEG 2NZTA 4I9QA 4YY3K 4AHSA 3EE8A 4ILJA 4MDAA 4GV9A 4MDBA 4YOXA 5GINA 5AQMA 4JNEA 4IDHA 5EVZA 1K9MO 3KK7A 4BRFA 2JWLA 1RT6A 2D5RA 4HWIA 2D0CA 4YOUA 3VEYA 4E0DA 4LFBK 2E88A 3VESA 1D4XA 1HJRA 4BRPA 1SQKA 4I7FA 3OYNA 4EHTA 2P9KA 2HBJA 4E1NA 1ASUA 4HTUA 4IOCL 2HNYA 3CM5A 5AQZA 4KREA 3EYZA 4Z4CA 3DLKA 2A6AA 2OZMA 1CLQA 4J2EA 2HF4A 5GAHP 3ZX0A 4GKJK 1QTMA 4DQ8A 4KTZA 3CJ1A 4OPJA 3MXJA 3NFAA 3IS9A 4CZIA 3ZCMA 3ULDA 2X74A 3TAQA 3PUFA 2GUPA 4B9MA 4HCCA 2DPNA 3UKRA 1KAZA 4B3RK 4O44A 1YVUA 1JLQA 3K5LA 3RRHA 2RHKA 3SUQA 4E1JA 3CD6N 2NRHA 1JLAA 3LDLA 2W41A 3M8RA 2PZSA 1BGXT 1KCFA 3S9HA 4BROA 4JKFA 1WNSA 3T19A 1WN7A 4EZ9A 1LAVA 2UU9K 2GUIA 1YXQA 3PX4A 3EY1A 2V7YA 1TUYA 2V51B 3T69A 1XNQK 4F4KA 3K5NA 1FW6A 1C1BA 4RTFD 2VG5A 4CZHA 2YHBA 2CGKA 1NM1A 4KO0A 1RBSA 2PY5A 3VEOA 2GV9A 4XH5A 4JI3K 5CYMA 1HYZA 4IG0A 3O9TA 4I9LA 1ITGA 4CIGA 4FCYA 4CIFA 3TARA 2O8DA 3OBYA 4B9QA 2XRIA 1BQNA 4LH4A 1RT3A 3AO4A 3V81A 2P9LB 3VGKA 3DLEA 3V1QA 3VENA 1UOCA 4BRAA 3QERA 4DLGA 1EO1A 4FZYA 4KHUA 1IBMK 3NF7A 3LALA 4DKWA 3ZT0A 4JV5K 3LP0A 3LPTA 3VGMA 3LDOA 3ULEB 1YJ9N 3MWPA 2QK9A 3TAEA 3L3VA 4FOEA 3CCSN 5KRTA 2OPPA 3D2FB 3RMDA 5SZTA 1JL1A 1IKXA 5IWAK 1ATRA 1YJNN 3WXIA 1OH5A 3L0QA 4DR2K 4B9LA 4CHYA 2O4IA 3C95A 2XY7A 3VQBA 3M1FA 5J1EA 4DQQA 4Z94A 2HSTA 1EX4A 4M41A 1BUPA 1I3AA 2YCHA 3M8SA 2FC0A 1XMQK 4FJHA 3VQ6A 1S9EA 2Z1IA 4WFBL 3QINA 4PHTX 1B92A 3HI0A 1QVFM 2DY4A 5GIPA 1WSHA 3GBTA 3OYHA 4B1XB 5JS2A 4JK9A 4KI6A 4AHRA 1Q82O 2HHQA 4FJ7A 2YNIA 4OGEA 4Z4FA 1RTIA 3TR8A 1Z25A 5HRPA 1YVNA 2HHTA 4XH1A 5HRNA 3KLEA 4GW6A 3OVNA 4A61A 3C7NB 4BR5A 5AQIA 3SBGA 4JK7A 1LWEA 4WFNL 4CHQA 3OJUA 4O8KA 4O55A 4DUYK 5AQTA 3H1VX 1C0MA 3D2EA 4DF4A 1MDUB 3SK3A 3CYMA 3SPZA 2AP1A 5BRFA 1IKWA 3EKUA 1TVRA 3T1YK 3SMSA 3VQ7A 4H5NA 4ZHRA 3CHWA 3DRPA 4A5BA 3EZWA 2G8HA 1TYQA 3CC2N 4QS7A 4U67L 3H46O 2E1YA 3CETA 4LSLA 5BR8K 4DWIA 4IO8A 4ISEA 2W6LA 4AM6A 1X3NA 4DS5A 3KWIA 3MN6A 5HROA 5M1OA 2VQEK 3LDSA 3SAFA 4JHDA 2G8VA 2KTQA 4ID1A 3G6EN 5C24A 1GLBG 4DV0K 4H8KA 5HOOA 1XI1A 5H1SQ 1SKSA 1HKBA 4DV7K 5KGWA 3PSIA 4FWKA 4PKHA 4JI8K 2PYLA 1QVGM 3CJCA 3SQ1A 3CPWM 4OPKA 1IKVA 1ZBLA 1IV0A 4B9UA 4OX9K 3CM6A 1KD1O 4DU4A 4FJJA 4H0XB 2BANA 4DB3A 1Q7YO 4IO9L 1WSFA 2QM1A 3VQDA 3MK6A 3F9KA 3Q7BA 5JS1A 5EY4A 5KQDA 4DSIA 3KKRA 5LMNK 1Q9YA 4ILGB 3RSEA 4QS8A 2ZJRL 5FROA 4QOZB 4CJRA 4N5SA 3P1GA 2I5JA 2FLOA 4I2PA 4FLUA 1EWRA 5FPDA 4OLBA 2ZM6K 2NRVA 1D9FA 4DFJA 3AVAA 3QFPA 3ZYYX 2XY6A 3VN5A 1NJIO 3CIPA 4JN4A 4QS9A 3PV8A 3MX5A 2F7TA 1NG9A 4FZXC 4JKGB 4CHOA 4KB0A 4DV4K 1ZC6A 2JLEA 4DTPA 1KTQA 1FKOA 3VEWA 1K8KB 4M42A 3BUZB 3MCPA 3J81O 4H03B 2KZMA 2FBYA 3LL3A 1NKCA 3H45C 4JI4K 4M3UA 4CD3A 3HK2A 2WUSA 3KLIA 4HTLA 3T1AA 1VQ5N 5CZ1A 1OVYA 5AQLA 1T8EA 3PY8A 1J5EK 2E2NA 4NLBA 3RRGA 1M1KO 1RDCA 2Q97A 4WE1A 2ZJPL 4O8UA 1QS4A 2P5GA 4W5NA 1YT3A 4WCEL 4X66K 4CK1A 2IVNA 1TV6A 3WXJA 3WEEB 1K6YA 1LW2A 3BF1A 4DSEA 4AHUA 4B9TA 3KLFA 2VGMA 2WTUA 3HL8A 4RW9A 4FK0A 2GEMA 3OJSA 2HHVA 3VQPA 2HF3A 4ELVA 3EO3A 5KPRA 1WSEA 1VSEA 3SLCA 4YOTA 1CXUA 1VSJA 1WSGA 1VQON 2O8EB 1BI4B 1LOTB 2I7PA 4FLTA 4IBNA 4G1QA 4HUFA 3S41A 4FM0A 2QTDA 1QHAA 4MFBA 1XHZA 3QEVA 3C6TA 1OKJA 3C7NA 1S6PA 5JVGL 3J7AP 1W7AA 1NJZA 3KLHA 5IT9O 2P1JA 1S22A 1L3UA 5C25A 5BPNA 1LWFA 4CHNA 3JYTA 2EHGA 4JKBA 1S1UA 3VF6A 1W97L 3P38A 3D6RA 4CJWA 4DSFA 3MN7A 4KH5A 3VERA 1ZXOA 3O8MA 1E4GT 3O3FA 3N4PA 3HTVA 3EEQA 4UY8O 2BGGA 3NAEA 3QBWA 1S1VA 5LY3A 3OYGA 3O4QA 3IUCA 1DGKN 3ZLJA 4FVUA 1SKRA 4WQ5C 4LH5A 1GLDG 3ISNC 3SQ0A 2HHSA 2DFHA 3U3YA 1O13A 4CJUA 3ZSQA 3LWMA 3VTIA 2DFEA 4KHNA 1C0TA 4Y1CA 4ICLA 3VGLA 3SCXA 4OKEA 2OANA 3AVFA 3O4NA 4NYNA 2OPQA 4NXNK 3CFOA 4LF7K 3NF9A 2ITMA 1KAXA 1NGDA 1BHLA 5FPMA 1VRTA 3VEVA 5BN8A 1NGBA 3KVGA 3AO5A 4CZLA 3TAGA 2PFUA 3KWGA 3I8DA 4J8FA 3OYEA 1JLFA 3P39A 4JD2A 5AJ3K 2P51A 3C0BA 5I42A 3HRGA 4DLEA 1C1AA 1F21A 2FBXA 4FWSA 3AO1A 4DU3A 4FL9A 1ZBHA 4FJ5A 4PWDA 3DLGA 2EWSA 2F9WA 3MXMA 4E7IA 1HYSA 2OPRA 5I9EB 2Y1IA 3UKRB 3D0PA 4CJPA 1BL3A 1DT9A 1IBKK 2HHUA 1ASVA 4MO4A 1IBLK 1X9SA 2ZF5O 3V1RA 4R5PA 3VQCA 5HP1A 1OVQA 1X3MA 3AO2A 3OA9A 3OYBA 3ATVA 3CQYA 4GNIA 3NGYA 2O8DB 1TUUA 4IWVA 1ZBIA 3ALYA 1T3VA 4FJNA 2HMIA 3ENOA 4CHZA 1VQ6N 2P9IA 3KZBA 3FZMA 4A62A 3NMUA 2GTDA 4IG3A 3IAYA 1JJ2M 4J2AA 4I6MA 3DLRA 3SZ2A 2X6SA 5BN9A 2IIRA 5GAEP 1WAJA 4CZEA 4CJ3A 1BA0A 4PQUA 3D2FA 4DV1K 5C12A 4FO0A 1VQKN 4BY9C 3LZJA 4BDPA 5TKWA 4BRQA 3A2FA 3CC7N 3CC4N 3J7YP 3AVNA 4IXCA 3SI6A 3ZETA 1Q9XA 1DTQA 5AQSA 4GMJB 2IVOA 1D5AA 4R79A 4B1VA 2RKIA 2P9SB 2Q0RA 4AHTA 1HNIA 4DFMA 2LSNA 2QEXN 3ID8A 2E1ZA 2UXCK 1EKEA 4FJGA 2QI2A 3DI6A 2YV0X 4OPHA 4Q5VA 5KI6A 4DSJA 4CEFA 4C8LA 3I8BA 2RPIA 2YKNA 1NGEA 4CEEA 1S72N 1GLJO 3A5OC 3CI5A 2P9IB 2GELA 4FM2A 1SL0A 1KSPA 3VQ9A 4M45A 3HOTA 1ZBFA 2BUPA 3C94A 3PX0A 4K41A 4C8MA 5T7BA 1OH6A 4H5WA 5HRRA 2WFBA 3HSTB 1P8ZA 3LANA 3CXCM 1ATSA 1TAUA 4ID5A 1L3TA 1E3MA 4PL8A 1G99A 3NVMA 2EX3A 1YITN 4IFEA 3VQ4A 3MXIA 3CCRN 4LSNA 4FJMA 1SS6A 3D2EB 2P5OA 3NGIA 3IRXA 4E1MA 4KRFA 2P9SA 2VWJA 1X1PA 3UB5A 2BDPA 1NK9A 3AARA 4DV6K 2O8FA 4CVNE 3TI0A 3MMVA 2YJFA 5M1NA 1DTTA 2QWOA 1OH7A 1EETA 1GLFO 3FE1A 4OPAA 3SV3A 3NH1A 4JI6K 1VK0A 3CFRA 3O80A 2A40A 3TWHA 4CEQA 1T7PA 2YHWA 4HUEA 1HLUA 3VTHA 1VQNN 1B9FA 4IEIA 4YOWA 1RBUA 3L3UA 3LAMA 4YFUA 4EAHD 3QLHA 3TAFA 4A5AA 3ZSVA 5AQVA 2E20A 1NK0A 2OCEA 1C0FA 4CF2A 3SV4A 4JHDB 2IDOA 3CJ7A 4H5VA 5JMVA 3CCQN 3QMLA 1ASWA 4DV3K 1J5OA 1N32K 5M1PA 2YI1A 4XEIA 1ZYQA 3L4IA 4BACA 2HNZA 3FZKA 1WSJA 5C42A 1BG3A 3L4QA 3WUHA 2OTLN 4CJEA 3B6PA 2HHHK 3G4SN 2HBKA 3BP8A 4WQ5A 3KD1E 4JK8A 3VQAA 2JWKA 1KLMA 2V7ZA 1Q18A 2IAJA 3OY9A 4MLHA 3L2RA 1KFSA 3R3LA 4DV5K 1SKWA 2F4VK 1KXPA 1NMNA 4LF6K 1TK8A 4IFYA 3H3NO 4IZ9A 1BIZA 1O1WA 3H1QA 4ELUA 3OBWA 4CESA 3FZLA 3O3GA 3LM2A 1KC8O 2HVIA 1DKGD 1JLGA 3VMFB 1IJJA 2Q2RA 5HL7L 3SUPA 3QB0A 4KBOA 3PIOL 3U3GA 4W5TA 4CIEA 3HT3A 3FR0A 3R1XA 4EZ6A 3UE5A 1LAWA 2BH1A 3IDHA 1U4BA 4B3SK 3V9ZA 4CJ5A 1V4SA 3V1OA 2Y1JA 3MECA 2GBZA 4FWPA 5ELZA 4CF1A 1NWKA 4ISGA 5HRSA 3CF5L 1XQSC 3W0LA 2OA8A 4F2SA 2E2OA 4N47A 3RTVA 1VHXA 1OH8A 2PBDA 1HPMA 3ZSRA 5C10A 3BZCA 4AQYK 2XO7A 4KKOA 1GOBA 4FVMA 3NE6A 2E2PA 1N33K 1CZBA 4ISFA 4BVPA 3V9SA 3MAQA 3OYAA 3RMBA 1RBRA 3S3NA 2BTFA 3IMXA 4V19S 2HHXA 2D0BA 5TKYA 1Q81O 1QSYA 4C23A 1NLVA 4JI1K 1UA0A 5AQFA 4DSKA 3CQ8A 1N8RO 3U8XA 4JKAA 1K8KA 4DU1A 1REVA 4GV6A 3GOIA 3QEPA 1MWKA 2ZD1A 1Y64A 3AA4A 1DEJA 3CPEA 4HHTA 1NK8A 2O8BA 2QXLA 4H5TA 5KPTA 1VQ7N 4RW4A 1T44A 4A2BA 1J9AA 4CJTA 3U4LA 5M1FA 1NK7A 3M8PA 2XY5A 1QZ6A 2YJEA 4JI0K 4BDYA 1U45A 2CH5A 1TKZA 3DXKB 4GY2B 4BC4A 4N76A 1Z26A 3ZT1A 3CERA 5FPNA 4F8RA 1V4TA 4BGAA 1A5XA 4E7LA 3DXMB 3BGRA 4CJ7A 4FYDA 3H08A 3OYKA 1S3XA 5AQJA 2XY8A 5E84A 3SJJA 4BRIA 1EWQA 3D7EO 1N6QA 3WQTA 2G8FA 4K8ZA 4RW6A 1ATNA 4NCGA 4BRDA 4CBWA 1Q8IA 2YHYA 1RILA 2HB5A 3VQ8A 3QEWA 2QWNA 4B1YB 3LP3A 2CGJA 1NGJA 4YNQA 3E9OA 3O9RA 4CGFA 2WBNA 4JD2B 4PA1A 1YTUA 4J2BA 4FLXA 5BPMA 4CF9A 1RT2A 5FPEA 5CY4A 5KGXA 4FLYA 1D8YA 3FFKB 4BQLA 3SMPA 1MWMA 3R8EA 5AFUH 1RTDA 1XHXA 5GIOA 1DLOA 4BG9A 4DTMA 4JS5A 3HP6A 2IVPA 3MEDA 4CEBA 2IOCA 2O8FB 2ATQA 3K5OA 4I2QA 3M6GA 5AFUA 3O3HA 4RW8A 4QAGA 3AV9A 3AVBA 3I33A 4FZZA 5AQGA 2OTJN 4GKKK 4E89A 4B9SA 4KH4A 5AQNA 1U6ZA 1U2VB 4M63C 4CFBA 2NRZA 4DF8A 2HW3A 4BRCA 1NBWA 1SV5A 3NF8A 4QCLA 4KAZA 1BA1A 1RTHA 3ENBA 1YJWN 3I55N 2Z1JA 4AH9A 3WNGA 3ZX2A 3TU5A 3WXMB 4HVJA 4H4MA 3M8QA 2ZGZA 3U6FA 4DTRA 2H3GX 5FRMA 5AR0A 2P9NB 3L2VA 2Q0UA 4GVMA 3CCUN 4BRGA 3GG4A 4IOXA 4W5QA 3TTCA 1JL2A 1KFDA 2O8EA 3CCVN 4B8CA 2Z1HA 1NMDA 4DTJA 4ILHA 3P31A 2KFZA 3A5NC 2CGLA 3ZSZA 3VQ5A 4FWQA 1XWLA 5KQ8A 4BGBA 2NUBA 1JKHA 2O8CA 2NRXA 3AAQA 3AVIA 2YKMA 3EE9A 3ZT4A 3JAMO 2FSKA 1C1CA 1XC3A 4JLHA 3VPZA 1BO5O 1TAQA 4CD1A 4KTWA 3TANA 4I6MB 3AVLA 1QZ5A 2BE2A 3AVHA 3NH2A 4JRPA 1JXBA 4CW7B 4E7HA 1W2BM 5CZ2A 3E66A 3CMEN 3QO9A 4M3RA 2Q1NA 2WC9A 1J53A 1YUWA 4PKGA 4GVEA 1JLEA 1L3VA 3B6OA 4NLCA 4CK2A 4B9VA 3PO5A 1KVAA 5AZIA 3QDKA 4WQ4A 4FK2A 2A3ZA 3K2PA 3FZFA 4CF8A 2FF6A 3DRRA 4EP4A 4KHPK 4LFAK 2CH6A 2YNFA 4A57A 3P4IA 1HNZK 2KHOA 4PL7A 1KVCA 4W5RA 1W0HA 3WXKA 3OYFA 5CHIA 4NXMK 3ENHA 5DMRA 4JAXA 1UAXA 2E8AA 1E4FT 5JICA 3G0ZA 4CFAA 1TK5A 4B08A 3HO1A 1BU6O 5KRSA 1IH7A 2WONA 3V9WA 1NKEA 2QWPA 4F9OA 3OW2M 1NJXA 4CZMA 1WBBA 4M3YA 4BQZA 4UQGA 3HXMA 3LDNA 4LFCK 4O0JA 3CCEN 4BREA 4CK3A 5AQHA 5DM7L 4YHHK 3A5LC 5JLHA 1HRHA 3DLBA 5KTQA 4DS4A 3THWB 3LPUA 2HBMA 4FWMA 1HPZA 5LMUK 5EXWA 4FLWA 3O1WA 1JLBA 3L2UA 1RFQA 4DTOA 1VRUA 2OZSA 2P9NA 3SUOA 4CEOA 5SWMA 1NKBA 1QSSA 1RDDA 4JKHA 3T3FA 4H0YB 1VQ8N 1RBVA 3CG7A 3KKSA 4WYBA 1LW0A 4DTSA 4L8RB 2UXBK 4DR4K 3VOVA 3WXLA 2RE2A 4CEZA 1S1XA 3R6MA 4DHYA 3SNNA 2KFNA 2F9TA 4JS4A 1BWFO 3O1BA 4CJLA 1HUXA 4FJXA 2QKBA 2FBTA 4BRKA 3ASMA 2G8IA 5AQRA 3OYMA 4DMNA 3GE1A 4BC5A 1D9DA 1ILYA 2NLXA 5FDLA 2VWBA 4CZKA 1GOCA 3LP1A 4KH6A 4DR1K 3CJBA 3N4QA 1YAGA 3H6EA 2IS3A 2ZGYA 3FZHA 1Q86O 4JKDA 3OYIA 3ZSXA 1G15A 4CZGA 4ZTFA 2VG7A 1QQNA 1IG9A 1BQMA 3AY9A 4RW7A 3SQ4A 1QQMA 3HBTA 4FJIA 4Z4HA 2NNWA 5C2FA 2RF2A 1K8AO 3OYDA 2R7YA 1TKTA 2DTUA 5AQKA 3S3MA 3M3ZA
chains in the Genus database with same CATH topology
2UXCK 3T1YK 2HHHK 4LF9K 4X64K 1XNRK 1N36K 4NXNK 1IBMK 4LF7K 3J81O 2E5LK 4JV5K 4DV5K 4DUZK 4JI4K 4GKKK 4LFCK 2F4VK 1J5EK 4YHHK 4LF6K 5BR8K 5AJ3K 4LF4K 1I94K 4GKJK 4X66K 2UUAK 5LMUK 5IWAK 5LL6Z 4JI0K 4DR2K 4DV2K 2VQEK 3T1HK 4JI2K 4B3MK 4JI5K 4DR7K 1IBKK 1HNWK 4B3RK 4DV0K 1IBLK 2UXBK 4DR4K 1XMQK 4DV7K 3J80O 4B3SK 4DV6K 4DR5K 4CVNE 2UUCK 4DR3K 2UXDK 5FLXO 4JI8K 4LF8K 4X65K 3J7AP 3JAMO 5IT9O 4JI6K 4DR6K 2UU9K 4OX9K 4DR1K 4AQYK 2UUBK 4CW7B 4B3TK 1XMOK 5A2QO 1XNQK 4LF5K 1N33K 4DV1K 4YY3K 5LMNK 1FJGK 2VQFK 1HR0K 1N34K 4V19S 3J7YP 4DUYK 4KHPK 4LFAK 2ZM6K 1HNZK 4JYAK 4JI3K 4JI7K 4JI1K 4DV3K 1HNXK 1N32K 4X62K 4K0KK 4LFBK 4DV4K 3OTOK 4NXMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC K;  3T1Y K;  2HHH K;  4LF9 K;  4X64 K;  1XNR K;  1N36 K;  4NXN K;  1IBM K;  4LF7 K;  3J81 O;  2E5L K;  4JV5 K;  4DV5 K;  4DUZ K;  4JI4 K;  4GKK K;  4LFC K;  2F4V K;  1J5E K;  4YHH K;  4LF6 K;  5BR8 K;  5AJ3 K;  4LF4 K;  1I94 K;  4GKJ K;  4X66 K;  2UUA K;  5LMU K;  5IWA K;  5LL6 Z;  4JI0 K;  4DR2 K;  4DV2 K;  2VQE K;  3T1H K;  4JI2 K;  4B3M K;  4JI5 K;  4DR7 K;  1IBK K;  1HNW K;  4B3R K;  4DV0 K;  1IBL K;  2UXB K;  4DR4 K;  1XMQ K;  4DV7 K;  3J80 O;  4B3S K;  4DV6 K;  4DR5 K;  4CVN E;  2UUC K;  4DR3 K;  2UXD K;  5FLX O;  4JI8 K;  4LF8 K;  4X65 K;  3J7A P;  3JAM O;  5IT9 O;  4JI6 K;  4DR6 K;  2UU9 K;  4OX9 K;  4DR1 K;  4AQY K;  2UUB K;  4CW7 B;  4B3T K;  1XMO K;  5A2Q O;  1XNQ K;  4LF5 K;  1N33 K;  4DV1 K;  4YY3 K;  5LMN K;  1FJG K;  2VQF K;  1HR0 K;  1N34 K;  4V19 S;  3J7Y P;  4DUY K;  4KHP K;  4LFA K;  2ZM6 K;  1HNZ K;  4JYA K;  4JI3 K;  4JI7 K;  4JI1 K;  4DV3 K;  1HNX K;  1N32 K;  4X62 K;  4K0K K;  4LFB K;  4DV4 K;  3OTO K;  4NXM K; 
#chains in the Genus database with same CATH topology
 4H4O A;  2KZZ A;  3HPH A;  1R59 O;  2P9P B;  4C8O A;  3RWU A;  2Q3S A;  3NDK A;  4E7K A;  1U48 A;  5C2D A;  2G8U A;  1RCH A;  4YDU A;  3QEI A;  2E5L K;  1NGC A;  3CQX A;  3THY B;  2FXU A;  1U2V A;  3QBX A;  4LF4 K;  3QIC A;  3RR8 A;  2E6L A;  2ZJQ L;  2P9U A;  3U9D A;  4FLZ A;  4C8N A;  4CGH A;  3W3D A;  3MCA B;  1HQE A;  1ZBU A;  3AVC A;  1LCU A;  5E26 A;  3NGZ A;  3KIO A;  4FWO A;  2Q36 A;  4RWT A;  3DAW A;  3DLL L;  2NRW A;  2JGU A;  4IKF A;  4XH4 A;  4EP5 A;  1FK9 A;  2Z1G A;  1M90 O;  1NGG A;  3DM2 A;  1JCE A;  4DCH A;  3WNE A;  2P9P A;  4BRL A;  5LJV A;  3NCI A;  1RGI A;  3SAH A;  3RSE B;  4Z0U A;  2ASP A;  2I7N A;  2G8W A;  4FXD A;  4LD0 A;  4E7J A;  3Q7C A;  2VWK A;  4FM1 A;  1RDB A;  3LDP A;  2ITG A;  4EIA A;  4O0I A;  3I56 N;  4IJA A;  4HUG A;  1RBT A;  1NK4 A;  3C6U A;  1QE1 A;  1VSI A;  3DLH A;  3DMJ A;  2KQ2 A;  2GWJ A;  4FLV A;  2W40 A;  4IOA L;  4M3T A;  2IGI A;  1X9W A;  3F73 A;  2VG6 A;  5AQX A;  5BR9 A;  4NCA A;  1QQO A;  4JI7 K;  3GL1 A;  1CZA N;  2O4G A;  4DFP A;  3EN9 A;  2W42 A;  4M3W A;  4X62 K;  3S3O A;  3DXM A;  3HOS A;  2D0A A;  4WQ4 C;  3I0R A;  3THW A;  2F96 A;  3L2W A;  1NGI A;  4BC3 A;  4LF9 K;  4Z4I A;  3JXU A;  4KHW A;  3DXK A;  3UIQ A;  3OS2 A;  1L3S A;  3MEG A;  5F0X A;  4J2D A;  2B4J A;  2WOM A;  3VF2 A;  1RT1 A;  4NYF A;  5EU7 A;  4CED A;  3ITH A;  5M1K A;  1N5Y A;  1I94 K;  2F8S A;  4B3O A;  1WSI A;  1JXE A;  3ATU A;  1NGF A;  2GX9 A;  4CGI A;  1VQ4 N;  1C6V A;  3AGR A;  2UUA K;  3V9X A;  5AQO A;  1RT4 A;  4Y1D A;  4OO1 J;  4IEE A;  5CR4 A;  3T1H K;  4OLA A;  1QSL A;  2NRR A;  4F3T A;  4KFB A;  2A1R A;  1RT7 A;  1WB9 A;  2QWM A;  3HVT A;  2IC3 A;  4CEA A;  5I3U A;  4JKE A;  1BIS A;  3CCL N;  4CJ4 A;  3K9K A;  1H1V A;  3HM9 A;  4DTX A;  1LV5 A;  2NRT A;  4FWN A;  1TK0 A;  1GLL O;  4LF8 K;  2FSN A;  1T6D A;  3FGU A;  4X65 K;  1JCG A;  3A8Y A;  4ZTJ A;  3SBT A;  1Z05 A;  1NOY A;  3QEX A;  2D0P A;  3O5B A;  4C1N K;  1ZBS A;  1JCF A;  4K25 A;  5CYQ A;  2KKZ A;  3LM9 A;  2YX6 A;  3RR7 A;  3THV A;  3ULE A;  1SAZ A;  1S9G A;  3AA5 X;  4CI6 A;  1XMO K;  3QFU A;  3DWL A;  3SQ2 A;  1VSM A;  1KQS M;  3THX A;  2G8K A;  1RTJ A;  4YOV A;  4KPY A;  2P9L A;  1FJG K;  1A5V A;  4FWL A;  1HYV A;  3O9Q A;  1HR0 K;  5J2M A;  4KHQ A;  3O6W A;  3NHG A;  1X9J A;  3JSM A;  3AGK A;  5E41 A;  2HHW A;  1X9M A;  3MWT A;  3C6H A;  1XC9 A;  3VQQ A;  3G71 N;  5AQP A;  3CCJ N;  3OTO K;  3MN5 A;  4FSV A;  1CZ9 A;  4BRN A;  2A42 A;  3UKU A;  4JEP A;  4CBU A;  4FJK A;  4BVO A;  4CFC A;  2UYT A;  4K43 A;  4KTQ A;  1VQM N;  3F9M A;  2A41 A;  4U7B A;  5J2P A;  4FJ8 A;  1GLA G;  3VF4 A;  1Z6R A;  1LWC A;  4TSX A;  3K58 A;  2YNH A;  4JKC A;  2B6A A;  3ZEU B;  4CER A;  5ADX A;  1RDU A;  1EQY A;  3L8B A;  2KLA A;  1J6Z A;  2VGN A;  1P90 A;  2HVH A;  3QNN A;  4IJN A;  4H5R A;  1SL2 A;  3LDQ A;  3O4W A;  2A5X A;  1T6C A;  3PX6 A;  4XIU A;  4WFA L;  1HNW K;  3QIP A;  4DQR A;  3D45 A;  3H3O B;  5AQW A;  1VSK A;  2Q31 A;  3AA2 A;  2YNG A;  3DRS A;  3OYL A;  5JLF A;  4C1N I;  4DQS A;  1K73 O;  3CJ9 A;  3ZT3 A;  4MLE A;  5FLX O;  3WEE A;  1NGH A;  4M3Z A;  3K59 A;  3HPG A;  3GDQ A;  4DQP A;  4IFV A;  1XUP O;  1TL3 A;  4CJS A;  3HP9 A;  1WUA A;  4CZF A;  1U47 A;  5LJW A;  1NGA A;  1SZ2 A;  1QHT A;  4CZJ A;  1VAZ A;  4NO7 A;  3P83 D;  5M1Q A;  4DTN A;  4A59 A;  4E19 A;  4BE2 A;  4BE1 A;  2HBL A;  4FK4 A;  3FLC O;  2B5J A;  3PSF A;  3U9Z A;  4KHS A;  4CJV A;  3KJV A;  4CJK A;  4EFH A;  2VQF K;  2VYP A;  4OGC A;  1VQL N;  3I0S A;  3MX2 A;  5F1X A;  5EX5 A;  1NU0 A;  3A0I X;  1WLJ A;  2OPS A;  4LC9 B;  5C15 A;  4K0K K;  4F3O A;  4N41 A;  3E9L A;  4PUO A;  1NNE A;  1HNV A;  3WQU A;  3F2K A;  1CXQ A;  3MEE A;  4M7X A;  4WF9 L;  2D1K A;  1XNR K;  3ZSO A;  4CJQ A;  3QET A;  3BDP A;  3VEX A;  1C0U A;  3AVM A;  3TAP A;  4BR4 A;  1FKP A;  3ZX3 A;  1R0A A;  4FWR A;  4O5B A;  4EHU A;  1YHQ N;  3J8A A;  3TTD A;  4CFD A;  3WNF A;  4OVL A;  5DK5 A;  5AQQ A;  4K42 A;  1SUQ A;  5LL6 Z;  1J54 A;  3OHR A;  5BRH A;  2ZWH A;  3OYC A;  4YOY A;  1VSH A;  4N56 A;  5BRD A;  2XHB A;  2FSJ A;  3AAP A;  3HZ6 A;  1T05 A;  3AO3 A;  3L2Q A;  3G25 A;  5AZJ B;  3RVC A;  1WOQ A;  3EKS A;  2QWR A;  1YF5 L;  2VCP A;  5AQY A;  1RNH A;  3VA3 A;  1IO2 A;  3TSQ A;  4ELT A;  3BEX A;  4BRH A;  1QQC A;  2ZE2 A;  3E01 A;  3P5J A;  1YTA A;  5F2R A;  4FJL A;  3A5M C;  3VEZ A;  4M3X A;  1MU2 A;  3CJA A;  5HBM A;  4W5O A;  1KVB A;  5AQU A;  3NF6 A;  5AZI B;  4BWJ A;  1SL1 A;  4H0T B;  3HSC A;  3TTF A;  2QW9 A;  3TAM A;  3SUN A;  3AA3 A;  3DYA A;  3WT0 A;  4CHP A;  2FF3 B;  3SPY A;  4G9Z A;  1S6Q A;  3TSP A;  1GLC G;  3RMA A;  2UUB K;  4BC2 A;  4B3T K;  1VQP N;  2AJQ A;  1HX1 A;  4C8K A;  5A2Q O;  4AHC A;  3V9U A;  3LAK A;  2QKK A;  4B8A B;  3G10 A;  5DM6 L;  4BRM A;  1TL1 A;  3IKM A;  1BDG A;  5GAD P;  3CCM N;  3SJH A;  1W9H A;  4PKI A;  3KK1 A;  3E9P A;  4JYA K;  4IDK A;  3AVK A;  1HNX K;  4PY5 A;  2O8B B;  1UWB A;  4YDU C;  5MLC Q;  2F8T A;  3HM8 A;  4A2A A;  4FJ9 A;  3K57 A;  1BI4 A;  1NK5 A;  4M7Y A;  3MN9 A;  4X64 K;  5C0Y A;  1I39 A;  2V52 B;  1N36 K;  1HKC A;  1S1T A;  2O8C B;  3KD5 E;  5BPL A;  4DQI A;  3VQE A;  3IG1 A;  1BCO A;  4MO5 A;  2RN2 A;  2ASO A;  2HOE A;  1VQ9 N;  1HKG A;  3ZET B;  3PO4 A;  1HJO A;  2QWQ A;  2QA4 N;  3L6Q A;  1VSD A;  4CBX A;  3OS0 A;  1HMV A;  4K8X A;  2P9U B;  4AF1 A;  4DTU A;  3V4I A;  3F5T A;  1UA1 A;  4RG8 A;  3NBP A;  2P9K B;  2D4W A;  2YHX A;  3DOL A;  3EL2 A;  3O08 A;  4KV8 A;  4JI2 K;  1VSF A;  3KLG A;  4B3M K;  4H0V B;  4JI5 K;  4CGJ A;  4DR7 K;  1TYQ B;  3BY5 A;  3ZSW A;  2W6K A;  1JLC A;  2X78 A;  4KI4 A;  2FBV A;  3J80 O;  4KB1 A;  2KW4 A;  1IG8 A;  1RDW X;  2ASM A;  3EZ5 A;  1S1W A;  5CE3 A;  4DR3 K;  3J7Z O;  5D3G A;  2ZQB A;  4O4G A;  4BR2 A;  2OYQ A;  4Z4G A;  1KAY A;  3K5M A;  3LWL A;  3OS1 A;  1B9D A;  1VSL A;  1FXX A;  4DR6 K;  2PAV A;  1U04 A;  4Y0W A;  1TKD A;  4AHV A;  3ZSY A;  4CGG A;  3TAB A;  3NH0 A;  3FFI A;  4BDZ A;  3ZEU A;  4DFK A;  3MDQ A;  2GWK A;  3NVK A;  4OKJ A;  4LF5 K;  3SYZ A;  3R9P A;  2DFF A;  4LY7 A;  4BG8 A;  3K9J A;  2D0O A;  4CGD A;  3SAG A;  1N34 K;  1T03 A;  5FRN A;  2YHA A;  3IFR A;  3ZT2 A;  3KK2 A;  4E3S A;  3VET A;  5K14 A;  4B9N A;  3DJC A;  4DG1 A;  3VA0 A;  2X6N A;  1U49 A;  3RMC A;  4AM7 A;  1EXQ A;  4CEC A;  4FPA A;  4CJF A;  5JVH L;  4HCB A;  1HQU A;  2ETJ A;  4B1W B;  1S5J A;  2J4R A;  2E6M A;  5HLF A;  3BZK A;  4B1Z A;  3QIO A;  1KRP A;  5J2Q A;  4CE9 A;  3ID6 A;  3KK3 A;  1RT5 A;  1MA9 B;  3KHY A;  4FW2 A;  1GOA A;  3T7Z A;  4F2R A;  4H0P A;  2HND A;  4DUZ K;  4GV3 A;  1BIU A;  4O5F A;  3E1Y A;  4FPB A;  3OYJ A;  1YI2 N;  3LZI A;  1WBD A;  5ADX H;  5GAG P;  1NOZ A;  3C6A A;  3M5R A;  1ESV A;  3HPO A;  4DSL A;  5EOY A;  4OKK A;  3TPQ A;  2E4L A;  4H0O A;  1NJW A;  1WAF A;  3K0S A;  2PYJ A;  4JRQ A;  1L5U A;  3THX B;  3KTQ A;  3HYF A;  1NJY A;  3AVG A;  5BRE A;  3QNO A;  3HJF A;  3O9S A;  4DV2 K;  4FOI A;  3DOK A;  1YIJ N;  4BR0 A;  2A1S A;  3B8A X;  1TGO A;  5AZJ A;  3AVJ A;  4NB4 A;  2QXF A;  4MQ3 A;  2E2Q A;  3LP2 A;  4Q0B A;  4RCH A;  4CCH A;  4FW1 A;  1KLN A;  1C0G A;  1BCM A;  3QES A;  3HVR A;  1IKY A;  4BWM A;  1EP4 A;  4DR5 K;  2UUC K;  2HMP A;  4AIL C;  2UXD K;  3JS6 A;  3UKU B;  5B8H A;  3V6D A;  3PIP L;  2AA4 A;  1A5W A;  4YOR A;  3PLA A;  3WNH A;  4BR7 A;  2QWL A;  4OJR A;  4L3Q A;  1Y97 A;  3TSU A;  3THY A;  3C65 A;  4NCB A;  3CMA N;  1RDA A;  4B1U B;  4Z4E A;  4CF0 A;  1TKX A;  3CFP A;  4JKG A;  4KHY A;  4BR9 A;  5KPZ A;  1NK6 A;  1BOT O;  3O9U A;  5J2N A;  4BE0 A;  3BF3 A;  1GLE G;  2NZT A;  4I9Q A;  4YY3 K;  4AHS A;  3EE8 A;  4ILJ A;  4MDA A;  4GV9 A;  4MDB A;  4YOX A;  5GIN A;  5AQM A;  4JNE A;  4IDH A;  5EVZ A;  1K9M O;  3KK7 A;  4BRF A;  2JWL A;  1RT6 A;  2D5R A;  4HWI A;  2D0C A;  4YOU A;  3VEY A;  4E0D A;  4LFB K;  2E88 A;  3VES A;  1D4X A;  1HJR A;  4BRP A;  1SQK A;  4I7F A;  3OYN A;  4EHT A;  2P9K A;  2HBJ A;  4E1N A;  1ASU A;  4HTU A;  4IOC L;  2HNY A;  3CM5 A;  5AQZ A;  4KRE A;  3EYZ A;  4Z4C A;  3DLK A;  2A6A A;  2OZM A;  1CLQ A;  4J2E A;  2HF4 A;  5GAH P;  3ZX0 A;  4GKJ K;  1QTM A;  4DQ8 A;  4KTZ A;  3CJ1 A;  4OPJ A;  3MXJ A;  3NFA A;  3IS9 A;  4CZI A;  3ZCM A;  3ULD A;  2X74 A;  3TAQ A;  3PUF A;  2GUP A;  4B9M A;  4HCC A;  2DPN A;  3UKR A;  1KAZ A;  4B3R K;  4O44 A;  1YVU A;  1JLQ A;  3K5L A;  3RRH A;  2RHK A;  3SUQ A;  4E1J A;  3CD6 N;  2NRH A;  1JLA A;  3LDL A;  2W41 A;  3M8R A;  2PZS A;  1BGX T;  1KCF A;  3S9H A;  4BRO A;  4JKF A;  1WNS A;  3T19 A;  1WN7 A;  4EZ9 A;  1LAV A;  2UU9 K;  2GUI A;  1YXQ A;  3PX4 A;  3EY1 A;  2V7Y A;  1TUY A;  2V51 B;  3T69 A;  1XNQ K;  4F4K A;  3K5N A;  1FW6 A;  1C1B A;  4RTF D;  2VG5 A;  4CZH A;  2YHB A;  2CGK A;  1NM1 A;  4KO0 A;  1RBS A;  2PY5 A;  3VEO A;  2GV9 A;  4XH5 A;  4JI3 K;  5CYM A;  1HYZ A;  4IG0 A;  3O9T A;  4I9L A;  1ITG A;  4CIG A;  4FCY A;  4CIF A;  3TAR A;  2O8D A;  3OBY A;  4B9Q A;  2XRI A;  1BQN A;  4LH4 A;  1RT3 A;  3AO4 A;  3V81 A;  2P9L B;  3VGK A;  3DLE A;  3V1Q A;  3VEN A;  1UOC A;  4BRA A;  3QER A;  4DLG A;  1EO1 A;  4FZY A;  4KHU A;  1IBM K;  3NF7 A;  3LAL A;  4DKW A;  3ZT0 A;  4JV5 K;  3LP0 A;  3LPT A;  3VGM A;  3LDO A;  3ULE B;  1YJ9 N;  3MWP A;  2QK9 A;  3TAE A;  3L3V A;  4FOE A;  3CCS N;  5KRT A;  2OPP A;  3D2F B;  3RMD A;  5SZT A;  1JL1 A;  1IKX A;  5IWA K;  1ATR A;  1YJN N;  3WXI A;  1OH5 A;  3L0Q A;  4DR2 K;  4B9L A;  4CHY A;  2O4I A;  3C95 A;  2XY7 A;  3VQB A;  3M1F A;  5J1E A;  4DQQ A;  4Z94 A;  2HST A;  1EX4 A;  4M41 A;  1BUP A;  1I3A A;  2YCH A;  3M8S A;  2FC0 A;  1XMQ K;  4FJH A;  3VQ6 A;  1S9E A;  2Z1I A;  4WFB L;  3QIN A;  4PHT X;  1B92 A;  3HI0 A;  1QVF M;  2DY4 A;  5GIP A;  1WSH A;  3GBT A;  3OYH A;  4B1X B;  5JS2 A;  4JK9 A;  4KI6 A;  4AHR A;  1Q82 O;  2HHQ A;  4FJ7 A;  2YNI A;  4OGE A;  4Z4F A;  1RTI A;  3TR8 A;  1Z25 A;  5HRP A;  1YVN A;  2HHT A;  4XH1 A;  5HRN A;  3KLE A;  4GW6 A;  3OVN A;  4A61 A;  3C7N B;  4BR5 A;  5AQI A;  3SBG A;  4JK7 A;  1LWE A;  4WFN L;  4CHQ A;  3OJU A;  4O8K A;  4O55 A;  4DUY K;  5AQT A;  3H1V X;  1C0M A;  3D2E A;  4DF4 A;  1MDU B;  3SK3 A;  3CYM A;  3SPZ A;  2AP1 A;  5BRF A;  1IKW A;  3EKU A;  1TVR A;  3T1Y K;  3SMS A;  3VQ7 A;  4H5N A;  4ZHR A;  3CHW A;  3DRP A;  4A5B A;  3EZW A;  2G8H A;  1TYQ A;  3CC2 N;  4QS7 A;  4U67 L;  3H46 O;  2E1Y A;  3CET A;  4LSL A;  5BR8 K;  4DWI A;  4IO8 A;  4ISE A;  2W6L A;  4AM6 A;  1X3N A;  4DS5 A;  3KWI A;  3MN6 A;  5HRO A;  5M1O A;  2VQE K;  3LDS A;  3SAF A;  4JHD A;  2G8V A;  2KTQ A;  4ID1 A;  3G6E N;  5C24 A;  1GLB G;  4DV0 K;  4H8K A;  5HOO A;  1XI1 A;  5H1S Q;  1SKS A;  1HKB A;  4DV7 K;  5KGW A;  3PSI A;  4FWK A;  4PKH A;  4JI8 K;  2PYL A;  1QVG M;  3CJC A;  3SQ1 A;  3CPW M;  4OPK A;  1IKV A;  1ZBL A;  1IV0 A;  4B9U A;  4OX9 K;  3CM6 A;  1KD1 O;  4DU4 A;  4FJJ A;  4H0X B;  2BAN A;  4DB3 A;  1Q7Y O;  4IO9 L;  1WSF A;  2QM1 A;  3VQD A;  3MK6 A;  3F9K A;  3Q7B A;  5JS1 A;  5EY4 A;  5KQD A;  4DSI A;  3KKR A;  5LMN K;  1Q9Y A;  4ILG B;  3RSE A;  4QS8 A;  2ZJR L;  5FRO A;  4QOZ B;  4CJR A;  4N5S A;  3P1G A;  2I5J A;  2FLO A;  4I2P A;  4FLU A;  1EWR A;  5FPD A;  4OLB A;  2ZM6 K;  2NRV A;  1D9F A;  4DFJ A;  3AVA A;  3QFP A;  3ZYY X;  2XY6 A;  3VN5 A;  1NJI O;  3CIP A;  4JN4 A;  4QS9 A;  3PV8 A;  3MX5 A;  2F7T A;  1NG9 A;  4FZX C;  4JKG B;  4CHO A;  4KB0 A;  4DV4 K;  1ZC6 A;  2JLE A;  4DTP A;  1KTQ A;  1FKO A;  3VEW A;  1K8K B;  4M42 A;  3BUZ B;  3MCP A;  3J81 O;  4H03 B;  2KZM A;  2FBY A;  3LL3 A;  1NKC A;  3H45 C;  4JI4 K;  4M3U A;  4CD3 A;  3HK2 A;  2WUS A;  3KLI A;  4HTL A;  3T1A A;  1VQ5 N;  5CZ1 A;  1OVY A;  5AQL A;  1T8E A;  3PY8 A;  1J5E K;  2E2N A;  4NLB A;  3RRG A;  1M1K O;  1RDC A;  2Q97 A;  4WE1 A;  2ZJP L;  4O8U A;  1QS4 A;  2P5G A;  4W5N A;  1YT3 A;  4WCE L;  4X66 K;  4CK1 A;  2IVN A;  1TV6 A;  3WXJ A;  3WEE B;  1K6Y A;  1LW2 A;  3BF1 A;  4DSE A;  4AHU A;  4B9T A;  3KLF A;  2VGM A;  2WTU A;  3HL8 A;  4RW9 A;  4FK0 A;  2GEM A;  3OJS A;  2HHV A;  3VQP A;  2HF3 A;  4ELV A;  3EO3 A;  5KPR A;  1WSE A;  1VSE A;  3SLC A;  4YOT A;  1CXU A;  1VSJ A;  1WSG A;  1VQO N;  2O8E B;  1BI4 B;  1LOT B;  2I7P A;  4FLT A;  4IBN A;  4G1Q A;  4HUF A;  3S41 A;  4FM0 A;  2QTD A;  1QHA A;  4MFB A;  1XHZ A;  3QEV A;  3C6T A;  1OKJ A;  3C7N A;  1S6P A;  5JVG L;  3J7A P;  1W7A A;  1NJZ A;  3KLH A;  5IT9 O;  2P1J A;  1S22 A;  1L3U A;  5C25 A;  5BPN A;  1LWF A;  4CHN A;  3JYT A;  2EHG A;  4JKB A;  1S1U A;  3VF6 A;  1W97 L;  3P38 A;  3D6R A;  4CJW A;  4DSF A;  3MN7 A;  4KH5 A;  3VER A;  1ZXO A;  3O8M A;  1E4G T;  3O3F A;  3N4P A;  3HTV A;  3EEQ A;  4UY8 O;  2BGG A;  3NAE A;  3QBW A;  1S1V A;  5LY3 A;  3OYG A;  3O4Q A;  3IUC A;  1DGK N;  3ZLJ A;  4FVU A;  1SKR A;  4WQ5 C;  4LH5 A;  1GLD G;  3ISN C;  3SQ0 A;  2HHS A;  2DFH A;  3U3Y A;  1O13 A;  4CJU A;  3ZSQ A;  3LWM A;  3VTI A;  2DFE A;  4KHN A;  1C0T A;  4Y1C A;  4ICL A;  3VGL A;  3SCX A;  4OKE A;  2OAN A;  3AVF A;  3O4N A;  4NYN A;  2OPQ A;  4NXN K;  3CFO A;  4LF7 K;  3NF9 A;  2ITM A;  1KAX A;  1NGD A;  1BHL A;  5FPM A;  1VRT A;  3VEV A;  5BN8 A;  1NGB A;  3KVG A;  3AO5 A;  4CZL A;  3TAG A;  2PFU A;  3KWG A;  3I8D A;  4J8F A;  3OYE A;  1JLF A;  3P39 A;  4JD2 A;  5AJ3 K;  2P51 A;  3C0B A;  5I42 A;  3HRG A;  4DLE A;  1C1A A;  1F21 A;  2FBX A;  4FWS A;  3AO1 A;  4DU3 A;  4FL9 A;  1ZBH A;  4FJ5 A;  4PWD A;  3DLG A;  2EWS A;  2F9W A;  3MXM A;  4E7I A;  1HYS A;  2OPR A;  5I9E B;  2Y1I A;  3UKR B;  3D0P A;  4CJP A;  1BL3 A;  1DT9 A;  1IBK K;  2HHU A;  1ASV A;  4MO4 A;  1IBL K;  1X9S A;  2ZF5 O;  3V1R A;  4R5P A;  3VQC A;  5HP1 A;  1OVQ A;  1X3M A;  3AO2 A;  3OA9 A;  3OYB A;  3ATV A;  3CQY A;  4GNI A;  3NGY A;  2O8D B;  1TUU A;  4IWV A;  1ZBI A;  3ALY A;  1T3V A;  4FJN A;  2HMI A;  3ENO A;  4CHZ A;  1VQ6 N;  2P9I A;  3KZB A;  3FZM A;  4A62 A;  3NMU A;  2GTD A;  4IG3 A;  3IAY A;  1JJ2 M;  4J2A A;  4I6M A;  3DLR A;  3SZ2 A;  2X6S A;  5BN9 A;  2IIR A;  5GAE P;  1WAJ A;  4CZE A;  4CJ3 A;  1BA0 A;  4PQU A;  3D2F A;  4DV1 K;  5C12 A;  4FO0 A;  1VQK N;  4BY9 C;  3LZJ A;  4BDP A;  5TKW A;  4BRQ A;  3A2F A;  3CC7 N;  3CC4 N;  3J7Y P;  3AVN A;  4IXC A;  3SI6 A;  3ZET A;  1Q9X A;  1DTQ A;  5AQS A;  4GMJ B;  2IVO A;  1D5A A;  4R79 A;  4B1V A;  2RKI A;  2P9S B;  2Q0R A;  4AHT A;  1HNI A;  4DFM A;  2LSN A;  2QEX N;  3ID8 A;  2E1Z A;  2UXC K;  1EKE A;  4FJG A;  2QI2 A;  3DI6 A;  2YV0 X;  4OPH A;  4Q5V A;  5KI6 A;  4DSJ A;  4CEF A;  4C8L A;  3I8B A;  2RPI A;  2YKN A;  1NGE A;  4CEE A;  1S72 N;  1GLJ O;  3A5O C;  3CI5 A;  2P9I B;  2GEL A;  4FM2 A;  1SL0 A;  1KSP A;  3VQ9 A;  4M45 A;  3HOT A;  1ZBF A;  2BUP A;  3C94 A;  3PX0 A;  4K41 A;  4C8M A;  5T7B A;  1OH6 A;  4H5W A;  5HRR A;  2WFB A;  3HST B;  1P8Z A;  3LAN A;  3CXC M;  1ATS A;  1TAU A;  4ID5 A;  1L3T A;  1E3M A;  4PL8 A;  1G99 A;  3NVM A;  2EX3 A;  1YIT N;  4IFE A;  3VQ4 A;  3MXI A;  3CCR N;  4LSN A;  4FJM A;  1SS6 A;  3D2E B;  2P5O A;  3NGI A;  3IRX A;  4E1M A;  4KRF A;  2P9S A;  2VWJ A;  1X1P A;  3UB5 A;  2BDP A;  1NK9 A;  3AAR A;  4DV6 K;  2O8F A;  4CVN E;  3TI0 A;  3MMV A;  2YJF A;  5M1N A;  1DTT A;  2QWO A;  1OH7 A;  1EET A;  1GLF O;  3FE1 A;  4OPA A;  3SV3 A;  3NH1 A;  4JI6 K;  1VK0 A;  3CFR A;  3O80 A;  2A40 A;  3TWH A;  4CEQ A;  1T7P A;  2YHW A;  4HUE A;  1HLU A;  3VTH A;  1VQN N;  1B9F A;  4IEI A;  4YOW A;  1RBU A;  3L3U A;  3LAM A;  4YFU A;  4EAH D;  3QLH A;  3TAF A;  4A5A A;  3ZSV A;  5AQV A;  2E20 A;  1NK0 A;  2OCE A;  1C0F A;  4CF2 A;  3SV4 A;  4JHD B;  2IDO A;  3CJ7 A;  4H5V A;  5JMV A;  3CCQ N;  3QML A;  1ASW A;  4DV3 K;  1J5O A;  1N32 K;  5M1P A;  2YI1 A;  4XEI A;  1ZYQ A;  3L4I A;  4BAC A;  2HNZ A;  3FZK A;  1WSJ A;  5C42 A;  1BG3 A;  3L4Q A;  3WUH A;  2OTL N;  4CJE A;  3B6P A;  2HHH K;  3G4S N;  2HBK A;  3BP8 A;  4WQ5 A;  3KD1 E;  4JK8 A;  3VQA A;  2JWK A;  1KLM A;  2V7Z A;  1Q18 A;  2IAJ A;  3OY9 A;  4MLH A;  3L2R A;  1KFS A;  3R3L A;  4DV5 K;  1SKW A;  2F4V K;  1KXP A;  1NMN A;  4LF6 K;  1TK8 A;  4IFY A;  3H3N O;  4IZ9 A;  1BIZ A;  1O1W A;  3H1Q A;  4ELU A;  3OBW A;  4CES A;  3FZL A;  3O3G A;  3LM2 A;  1KC8 O;  2HVI A;  1DKG D;  1JLG A;  3VMF B;  1IJJ A;  2Q2R A;  5HL7 L;  3SUP A;  3QB0 A;  4KBO A;  3PIO L;  3U3G A;  4W5T A;  4CIE A;  3HT3 A;  3FR0 A;  3R1X A;  4EZ6 A;  3UE5 A;  1LAW A;  2BH1 A;  3IDH A;  1U4B A;  4B3S K;  3V9Z A;  4CJ5 A;  1V4S A;  3V1O A;  2Y1J A;  3MEC A;  2GBZ A;  4FWP A;  5ELZ A;  4CF1 A;  1NWK A;  4ISG A;  5HRS A;  3CF5 L;  1XQS C;  3W0L A;  2OA8 A;  4F2S A;  2E2O A;  4N47 A;  3RTV A;  1VHX A;  1OH8 A;  2PBD A;  1HPM A;  3ZSR A;  5C10 A;  3BZC A;  4AQY K;  2XO7 A;  4KKO A;  1GOB A;  4FVM A;  3NE6 A;  2E2P A;  1N33 K;  1CZB A;  4ISF A;  4BVP A;  3V9S A;  3MAQ A;  3OYA A;  3RMB A;  1RBR A;  3S3N A;  2BTF A;  3IMX A;  4V19 S;  2HHX A;  2D0B A;  5TKY A;  1Q81 O;  1QSY A;  4C23 A;  1NLV A;  4JI1 K;  1UA0 A;  5AQF A;  4DSK A;  3CQ8 A;  1N8R O;  3U8X A;  4JKA A;  1K8K A;  4DU1 A;  1REV A;  4GV6 A;  3GOI A;  3QEP A;  1MWK A;  2ZD1 A;  1Y64 A;  3AA4 A;  1DEJ A;  3CPE A;  4HHT A;  1NK8 A;  2O8B A;  2QXL A;  4H5T A;  5KPT A;  1VQ7 N;  4RW4 A;  1T44 A;  4A2B A;  1J9A A;  4CJT A;  3U4L A;  5M1F A;  1NK7 A;  3M8P A;  2XY5 A;  1QZ6 A;  2YJE A;  4JI0 K;  4BDY A;  1U45 A;  2CH5 A;  1TKZ A;  3DXK B;  4GY2 B;  4BC4 A;  4N76 A;  1Z26 A;  3ZT1 A;  3CER A;  5FPN A;  4F8R A;  1V4T A;  4BGA A;  1A5X A;  4E7L A;  3DXM B;  3BGR A;  4CJ7 A;  4FYD A;  3H08 A;  3OYK A;  1S3X A;  5AQJ A;  2XY8 A;  5E84 A;  3SJJ A;  4BRI A;  1EWQ A;  3D7E O;  1N6Q A;  3WQT A;  2G8F A;  4K8Z A;  4RW6 A;  1ATN A;  4NCG A;  4BRD A;  4CBW A;  1Q8I A;  2YHY A;  1RIL A;  2HB5 A;  3VQ8 A;  3QEW A;  2QWN A;  4B1Y B;  3LP3 A;  2CGJ A;  1NGJ A;  4YNQ A;  3E9O A;  3O9R A;  4CGF A;  2WBN A;  4JD2 B;  4PA1 A;  1YTU A;  4J2B A;  4FLX A;  5BPM A;  4CF9 A;  1RT2 A;  5FPE A;  5CY4 A;  5KGX A;  4FLY A;  1D8Y A;  3FFK B;  4BQL A;  3SMP A;  1MWM A;  3R8E A;  5AFU H;  1RTD A;  1XHX A;  5GIO A;  1DLO A;  4BG9 A;  4DTM A;  4JS5 A;  3HP6 A;  2IVP A;  3MED A;  4CEB A;  2IOC A;  2O8F B;  2ATQ A;  3K5O A;  4I2Q A;  3M6G A;  5AFU A;  3O3H A;  4RW8 A;  4QAG A;  3AV9 A;  3AVB A;  3I33 A;  4FZZ A;  5AQG A;  2OTJ N;  4GKK K;  4E89 A;  4B9S A;  4KH4 A;  5AQN A;  1U6Z A;  1U2V B;  4M63 C;  4CFB A;  2NRZ A;  4DF8 A;  2HW3 A;  4BRC A;  1NBW A;  1SV5 A;  3NF8 A;  4QCL A;  4KAZ A;  1BA1 A;  1RTH A;  3ENB A;  1YJW N;  3I55 N;  2Z1J A;  4AH9 A;  3WNG A;  3ZX2 A;  3TU5 A;  3WXM B;  4HVJ A;  4H4M A;  3M8Q A;  2ZGZ A;  3U6F A;  4DTR A;  2H3G X;  5FRM A;  5AR0 A;  2P9N B;  3L2V A;  2Q0U A;  4GVM A;  3CCU N;  4BRG A;  3GG4 A;  4IOX A;  4W5Q A;  3TTC A;  1JL2 A;  1KFD A;  2O8E A;  3CCV N;  4B8C A;  2Z1H A;  1NMD A;  4DTJ A;  4ILH A;  3P31 A;  2KFZ A;  3A5N C;  2CGL A;  3ZSZ A;  3VQ5 A;  4FWQ A;  1XWL A;  5KQ8 A;  4BGB A;  2NUB A;  1JKH A;  2O8C A;  2NRX A;  3AAQ A;  3AVI A;  2YKM A;  3EE9 A;  3ZT4 A;  3JAM O;  2FSK A;  1C1C A;  1XC3 A;  4JLH A;  3VPZ A;  1BO5 O;  1TAQ A;  4CD1 A;  4KTW A;  3TAN A;  4I6M B;  3AVL A;  1QZ5 A;  2BE2 A;  3AVH A;  3NH2 A;  4JRP A;  1JXB A;  4CW7 B;  4E7H A;  1W2B M;  5CZ2 A;  3E66 A;  3CME N;  3QO9 A;  4M3R A;  2Q1N A;  2WC9 A;  1J53 A;  1YUW A;  4PKG A;  4GVE A;  1JLE A;  1L3V A;  3B6O A;  4NLC A;  4CK2 A;  4B9V A;  3PO5 A;  1KVA A;  5AZI A;  3QDK A;  4WQ4 A;  4FK2 A;  2A3Z A;  3K2P A;  3FZF A;  4CF8 A;  2FF6 A;  3DRR A;  4EP4 A;  4KHP K;  4LFA K;  2CH6 A;  2YNF A;  4A57 A;  3P4I A;  1HNZ K;  2KHO A;  4PL7 A;  1KVC A;  4W5R A;  1W0H A;  3WXK A;  3OYF A;  5CHI A;  4NXM K;  3ENH A;  5DMR A;  4JAX A;  1UAX A;  2E8A A;  1E4F T;  5JIC A;  3G0Z A;  4CFA A;  1TK5 A;  4B08 A;  3HO1 A;  1BU6 O;  5KRS A;  1IH7 A;  2WON A;  3V9W A;  1NKE A;  2QWP A;  4F9O A;  3OW2 M;  1NJX A;  4CZM A;  1WBB A;  4M3Y A;  4BQZ A;  4UQG A;  3HXM A;  3LDN A;  4LFC K;  4O0J A;  3CCE N;  4BRE A;  4CK3 A;  5AQH A;  5DM7 L;  4YHH K;  3A5L C;  5JLH A;  1HRH A;  3DLB A;  5KTQ A;  4DS4 A;  3THW B;  3LPU A;  2HBM A;  4FWM A;  1HPZ A;  5LMU K;  5EXW A;  4FLW A;  3O1W A;  1JLB A;  3L2U A;  1RFQ A;  4DTO A;  1VRU A;  2OZS A;  2P9N A;  3SUO A;  4CEO A;  5SWM A;  1NKB A;  1QSS A;  1RDD A;  4JKH A;  3T3F A;  4H0Y B;  1VQ8 N;  1RBV A;  3CG7 A;  3KKS A;  4WYB A;  1LW0 A;  4DTS A;  4L8R B;  2UXB K;  4DR4 K;  3VOV A;  3WXL A;  2RE2 A;  4CEZ A;  1S1X A;  3R6M A;  4DHY A;  3SNN A;  2KFN A;  2F9T A;  4JS4 A;  1BWF O;  3O1B A;  4CJL A;  1HUX A;  4FJX A;  2QKB A;  2FBT A;  4BRK A;  3ASM A;  2G8I A;  5AQR A;  3OYM A;  4DMN A;  3GE1 A;  4BC5 A;  1D9D A;  1ILY A;  2NLX A;  5FDL A;  2VWB A;  4CZK A;  1GOC A;  3LP1 A;  4KH6 A;  4DR1 K;  3CJB A;  3N4Q A;  1YAG A;  3H6E A;  2IS3 A;  2ZGY A;  3FZH A;  1Q86 O;  4JKD A;  3OYI A;  3ZSX A;  1G15 A;  4CZG A;  4ZTF A;  2VG7 A;  1QQN A;  1IG9 A;  1BQM A;  3AY9 A;  4RW7 A;  3SQ4 A;  1QQM A;  3HBT A;  4FJI A;  4Z4H A;  2NNW A;  5C2F A;  2RF2 A;  1K8A O;  3OYD A;  2R7Y A;  1TKT A;  2DTU A;  5AQK A;  3S3M A;  3M3Z A; 
#chains in the Genus database with same CATH homology
 2UXC K;  3T1Y K;  2HHH K;  4LF9 K;  4X64 K;  1XNR K;  1N36 K;  4NXN K;  1IBM K;  4LF7 K;  3J81 O;  2E5L K;  4JV5 K;  4DV5 K;  4DUZ K;  4JI4 K;  4GKK K;  4LFC K;  2F4V K;  1J5E K;  4YHH K;  4LF6 K;  5BR8 K;  5AJ3 K;  4LF4 K;  1I94 K;  4GKJ K;  4X66 K;  2UUA K;  5LMU K;  5IWA K;  5LL6 Z;  4JI0 K;  4DR2 K;  4DV2 K;  2VQE K;  3T1H K;  4JI2 K;  4B3M K;  4JI5 K;  4DR7 K;  1IBK K;  1HNW K;  4B3R K;  4DV0 K;  1IBL K;  2UXB K;  4DR4 K;  1XMQ K;  4DV7 K;  3J80 O;  4B3S K;  4DV6 K;  4DR5 K;  4CVN E;  2UUC K;  4DR3 K;  2UXD K;  5FLX O;  4JI8 K;  4LF8 K;  4X65 K;  3J7A P;  3JAM O;  5IT9 O;  4JI6 K;  4DR6 K;  2UU9 K;  4OX9 K;  4DR1 K;  4AQY K;  2UUB K;  4CW7 B;  4B3T K;  1XMO K;  5A2Q O;  1XNQ K;  4LF5 K;  1N33 K;  4DV1 K;  4YY3 K;  5LMN K;  1FJG K;  2VQF K;  1HR0 K;  1N34 K;  4V19 S;  3J7Y P;  4DUY K;  4KHP K;  4LFA K;  2ZM6 K;  1HNZ K;  4JYA K;  4JI3 K;  4JI7 K;  4JI1 K;  4DV3 K;  1HNX K;  1N32 K;  4X62 K;  4K0K K;  4LFB K;  4DV4 K;  3OTO K;  4NXM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...