1HR0K

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1hr0K00
1N33K 4LF8K 4GKKK 4JI3K 4DUYK 4DV6K 4NXMK 4DR5K 1N36K 2F4VK 4LF9K 1I94K 4DV2K 4LFBK 2UU9K 4JYAK 5LMNK 4JI0K 1N32K 5BR8K 1N34K 4V19S 4YHHK 4X64K 4CVNE 5LMUK 4X66K 4JI4K 4LF5K 5AJ3K 3J7YP 2UXCK 2UXBK 4DV3K 4DR6K 4JI2K 4B3SK 4JV5K 4OX9K 1J5EK 4JI8K 3JAMO 4NXNK 1IBLK 2E5LK 1XMOK 4LF7K 4DR1K 4DV4K 4AQYK 4KHPK 4DR3K 4JI6K 5IT9O 4DV1K 1IBMK 3T1HK 1XMQK 4DV7K 1FJGK 2UUCK 4K0KK 4B3RK 5IWAK 5FLXO 2ZM6K 4X62K 4DR4K 4B3MK 4JI5K 2UUAK 4LFCK 4LFAK 4JI7K 4YY3K 3OTOK 3T1YK 4DR7K 4DUZK 3J81O 1HR0K 4JI1K 2VQFK 4DV0K 4LF6K 4DR2K 1HNZK 1XNRK 3J7AP 4GKJK 4DV5K 4CW7B 1XNQK 2UUBK 4X65K 5A2QO 1HNWK 1HNXK 5LL6Z 2VQEK 1IBKK 4B3TK 2HHHK 2UXDK 3J80O 4LF4K
chains in the Genus database with same CATH superfamily
2YI1A 4N56A 2QWRA 2NRZA 3OA9A 4FLWA 4AF1A 4WFBL 3KKRA 3H6EA 1VSDA 1HX1A 3HBTA 3NAEA 1I94K 2KQ2A 2G8WA 4IWVA 1QQCA 4AM6A 3AA4A 3ISNC 2ATQA 2YHWA 2FBTA 4FJMA 3TARA 3OYEA 2AP1A 4NYNA 3RMCA 1DLOA 3SPYA 2IDOA 5EXWA 4H0YB 5AQSA 4MLEA 1KAYA 1FKPA 3ZEUB 1CLQA 3NH0A 3TANA 1IG8A 1TVRA 4A59A 3C65A 4RW9A 3DLGA 2JWLA 3OYNA 3LDSA 1ATSA 1HPZA 3KZBA 4DQRA 4B9UA 4CJFA 3CIPA 4MDBA 2O8EB 2P5GA 4DR4K 4B3MK 4AM7A 4BGAA 5HROA 2KFNA 2RE2A 3V9WA 3A5OC 4E1MA 4DSEA 4WQ4C 2VG6A 4JKHA 3GOIA 1HKGA 2V7ZA 3BF3A 3V9SA 4DFPA 3VESA 1RBUA 1DKGD 3SBGA 3OYJA 3K2PA 4O8KA 4FPBA 4BRGA 2BUPA 3CERA 4ELUA 1WAFA 3CCVN 1NGJA 4CGJA 5FPDA 4DQSA 1WUAA 4GY2B 3K57A 3NF9A 4E7KA 3Q7BA 5HRRA 4BR9A 3PO5A 3GG4A 1EO1A 1U49A 2UXDK 3BP8A 2KKZA 3RWUA 2X74A 3OYLA 2VG7A 1RTJA 2Q36A 3LM9A 4DLGA 2QM1A 5AQWA 4W5NA 4CJ7A 2WUSA 3ZSVA 3NMUA 4NXMK 1LAVA 1VQ6N 4BE2A 2E6LA 1M1KO 3O9SA 4CIFA 4ISGA 2UU9K 1WBDA 2VWKA 1D5AA 2FBVA 5AQNA 2IC3A 2Q31A 4CGFA 4OKEA 3VMFB 1DTQA 2AA4A 1Q7YO 3CXCM 5BR8K 4LH5A 4E0DA 3LPUA 4LF5K 1LWEA 3DXMA 4E1NA 1EQYA 2DTUA 1CZBA 4PL7A 5C15A 3VGKA 1G15A 4B9MA 3MEEA 1RT6A 3PSFA 4E7IA 1IJJA 3ATUA 3ZSZA 3LDOA 3MN9A 2I5JA 3IDHA 1S9EA 4BC4A 4CJUA 3KK1A 3RSEA 3HPGA 1X9SA 3TI0A 1RBRA 3L3UA 4CGGA 3SYZA 2FSNA 4B1WB 3HP6A 3LP1A 2GUIA 4EZ9A 4DTOA 4CJ4A 4Z4HA 1ESVA 1RBTA 2ZM6K 1TKTA 3HL8A 4ID1A 1OH8A 4EHUA 4JI5K 1XQSC 5LJVA 2UUAK 4R79A 1U47A 3NF7A 3KD5E 5FRNA 4FWSA 3PSIA 3V81A 3H3OB 3LP0A 4I2PA 4KFBA 4JI1K 5C25A 1OKJA 2V7YA 5AQTA 3S41A 5KRSA 1N5YA 2GEMA 3HOTA 3M5RA 5KQDA 4BR0A 3CI5A 4CZJA 3LAMA 3CFOA 4O4GA 4FCYA 3HSTB 3R1XA 1VQNN 3O80A 4CK1A 1C0MA 2O8DA 3FZLA 3HOSA 4GMJB 1J53A 1KCFA 3L4QA 2CGLA 1KLMA 3KWGA 4H4OA 4H4MA 1BIUA 2JLEA 5F1XA 3A5MC 3OHRA 4FLXA 5AQUA 2V52B 3VQ6A 3DXKA 2XRIA 2D0PA 1YUWA 4HUGA 4DV2K 1HKCA 4ICLA 5LMNK 4OGEA 2D4WA 5TKWA 1YI2N 2VGNA 3VA3A 4IDKA 1NGAA 1EKEA 3LDPA 3CM5A 3VTIA 3T1AA 1N34K 1GLDG 2EHGA 2NLXA 3D2EA 3ZSYA 1L3UA 3R3LA 1ATNA 2UYTA 1A5VA 5LJWA 3EE9A 3TTCA 4DWIA 3UE5A 3KKSA 3LDQA 4FW2A 2IAJA 3CJBA 4AHCA 1VQMN 2Z1JA 3FZFA 3U3YA 5JS2A 3EKSA 2KZMA 1Z26A 3CJ1A 2O8CA 4IFYA 1VRTA 4BACA 1JL1A 1TUUA 2IS3A 3MMVA 3CF5L 1TK8A 4YDUC 2PYJA 4BR5A 4FWLA 1LW2A 4DQPA 4NO7A 4X62K 4CD3A 3MN7A 3VQPA 1RILA 5BPMA 1S22A 4KRFA 1EX4A 2HHVA 4CZEA 3AAQA 2OTJN 3O3GA 4DMNA 3DXMB 4CEFA 1IH7A 4BRKA 4ISEA 3QLHA 3LALA 4CI6A 4WFAL 4FWPA 4ISFA 3U9ZA 3D0PA 2Z1IA 3A5LC 3UKRA 1SL0A 3RSEB 1RTHA 5A2QO 3OY9A 3U6FA 3U9DA 3P1GA 4E1JA 4DF8A 4KHNA 3DYAA 1YTUA 3BGRA 2F9TA 1GLAG 3OW2M 3AVAA 5JICA 2HF3A 3OYBA 4YOTA 4RW8A 1EETA 2D0AA 1HJRA 2O4GA 3KJVA 1KSPA 2E2NA 4DR5K 3RR7A 3ZSWA 3HP9A 4CZGA 4Z4IA 5KQ8A 3J7ZO 2VWBA 2B6AA 4O44A 2P9KA 5K14A 4N41A 2PFUA 4BRNA 1C0TA 2FBXA 2HOEA 4CZLA 2JWKA 1N32K 1NNEA 2A42A 3RR8A 2OPSA 1WSGA 3VEZA 4DTJA 3CQXA 2W6LA 2QKKA 4JI4K 3MCPA 3SJHA 3CFPA 4W5RA 1Y64A 5M1KA 1RDWX 5BRHA 4IO9L 2O8DB 4U67L 1YITN 1P90A 1VK0A 4FJ7A 4CERA 1VSKA 1BG3A 3O08A 4CEZA 2GBZA 3VQ8A 1B9DA 2VGMA 1OH7A 3NF8A 3A8YA 5KPZA 3I56N 4H5VA 3VF4A 1IBMK 3DXKB 2NUBA 1FKOA 1BO5O 2A3ZA 3DRPA 3HVRA 3OYIA 3V1OA 5JMVA 4UQGA 3OYKA 2KW4A 4FWMA 2HNZA 5GADP 1G99A 3ENHA 3TWHA 2G8KA 2P9LA 2CH6A 3K5MA 4LFAK 4NLCA 4BRIA 2O4IA 1HQEA 1TL3A 1NOZA 3D2EB 3MDQA 5HRSA 1HR0K 5ADXH 4KHWA 4KKOA 3J8AA 4H5RA 1U04A 3VEYA 2ASOA 2QA4N 4CEOA 5E41A 3AVBA 1T7PA 3SUOA 5SWMA 2E1ZA 3FFIA 3SNNA 3LM2A 4R5PA 3FR0A 2EWSA 4FWOA 1VQ4N 4B9LA 4BROA 2O8CB 2R7YA 2VQEK 1U45A 3PLAA 1NGHA 2D1KA 4CBXA 4WE1A 1Q82O 2HBMA 5SZTA 3JYTA 3TAPA 3OYDA 1NJIO 1XHZA 1QTMA 4Q5VA 3TPQA 3CMEN 3DM2A 2YJFA 1Q9YA 1XUPO 4FM2A 1VQLN 4BREA 1N36K 3CQ8A 1NMNA 3U8XA 3BZKA 4CJEA 1JXBA 2E8AA 3F9KA 5HP1A 2HMIA 1DTTA 2V51B 4IG3A 3SJJA 2KFZA 4TSXA 2XY8A 5AR0A 3UKRB 5KRTA 4B08A 1BI4A 3QNOA 1QE1A 4ILHA 5HL7L 3KLFA 1HNVA 2RPIA 4BRHA 4YOXA 1HYVA 3S3NA 2QEXN 3NGIA 4W5QA 2UXBK 4LH4A 2DPNA 4FLVA 3ITHA 4A5BA 4OX9K 2Z1GA 4RTFD 2D0BA 4B1XB 1BQNA 4M63C 3FFKB 3LL3A 1RGIA 4DV1K 2A5XA 2A1RA 1T03A 2ZJPL 1RCHA 4M7XA 5M1FA 2P9KB 5C0YA 1X3NA 2F8SA 4B9SA 3FLCO 5FLXO 2WOMA 3EZ5A 2ZJQL 4DTRA 3LDNA 2OCEA 3MXJA 4DS4A 1NJZA 3VQEA 4DUZK 1KAZA 5FROA 4DQIA 3WXLA 1JLQA 1VQ8N 2QWMA 4FWRA 4C8OA 2E6MA 3SQ1A 1VSMA 2WC9A 2FLOA 3DMJA 5I9EB 1W0HA 4FOEA 1BQMA 3OS2A 3HXMA 5M1QA 2HF4A 1QQMA 3C6AA 4ELTA 1VHXA 1CZ9A 3MN6A 2A40A 1QZ5A 5GINA 1NK5A 3G71N 4PWDA 3VERA 3QEXA 2P9LB 3IRXA 3CETA 3NE6A 5BREA 3EKUA 1BU6O 5BN8A 1SUQA 3HPOA 3DLEA 1LWCA 5AZJA 3CC4N 3O9QA 4J2BA 5CE3A 3V9UA 1WAJA 4JYAK 4PL8A 1FXXA 4AHUA 2E1YA 4JI0K 2WFBA 2NRXA 1XI1A 1QS4A 1BCMA 4I9LA 1BISA 1ZBFA 2QKBA 1P8ZA 2Z1HA 1QVFM 1BCOA 3F9MA 4E7HA 1EWQA 4N5SA 2IVOA 4RCHA 4N47A 3CPWM 4B9NA 3EE8A 3DLHA 4J2DA 4DR6K 3LP3A 4B3SK 5CYQA 3K5LA 1YJWN 5GAEP 3AY9A 4CIEA 2FXUA 2H3GX 4BDZA 4JK9A 4C8NA 1SL1A 4I7FA 1CXUA 4MLHA 1NKBA 3CPEA 3CCUN 4AHRA 1HKBA 4OJRA 4HUEA 5BR9A 4BQLA 4K42A 4E19A 1X9MA 5CR4A 1GLEG 5LY3A 4F3OA 4WQ5A 4H03B 3I0RA 3OYFA 1TYQA 1UA0A 1BI4B 2PY5A 4JKEA 2VWJA 3H08A 5T7BA 3NF6A 3KK3A 4KV8A 2PYLA 4LD0A 3AVJA 5AQQA 3L6QA 4MDAA 4YFUA 4LF6K 3NFAA 3V1RA 1RT4A 3QMLA 1XNQK 4FOIA 3ALYA 3K58A 3ENBA 1MWMA 1YVNA 3W3DA 1VQON 5FRMA 1D4XA 5KGXA 4JS4A 3WXIA 4OO1J 1NGEA 1D9DA 2HHQA 1QVGM 1N6QA 3TAQA 4DTNA 2OA8A 3FGUA 3PX6A 4DS5A 4BC3A 1HYZA 2E2QA 5AQXA 1O13A 3QBWA 4CF2A 3E01A 4CEDA 1WSFA 3ZX0A 4FJIA 4DFJA 2QWOA 3RTVA 2DFHA 5FPEA 1OH5A 4BR4A 1IKVA 3K5OA 2IIRA 4MQ3A 4EP5A 2O8BA 3NGZA 1BWFO 4C8KA 3O6WA 3K59A 1ATRA 3VEOA 3AVNA 4DTMA 4IG0A 5J1EA 3QESA 1KFDA 4CK3A 4FZZA 1Y97A 3M8RA 3VPZA 2KHOA 3QBXA 4KHUA 4BWMA 1TAUA 1J54A 4FYDA 1C6VA 4EZ6A 2YHXA 4C23A 4CFCA 3TABA 3OS0A 4PQUA 1J5EK 3NH1A 4IBNA 1HUXA 3D7EO 1NM1A 4FJ8A 2IVPA 1ITGA 1W97L 1WN7A 5IT9O 5AZJB 4BE0A 2YKMA 4DV7K 1FJGK 1OVYA 1ILYA 1MU2A 3H1VX 4C8LA 1JKHA 5AFUH 4YOUA 3VEXA 1VQPN 2F8TA 3TSUA 4FLUA 3WXKA 4H8KA 3HSCA 4PA1A 4O5BA 3G10A 4K25A 2GV9A 3ZLJA 3IUCA 3NDKA 4JNEA 1WLJA 5J2MA 3EN9A 5HBMA 3ZSOA 4PY5A 4DF4A 3PX4A 2NNWA 3THXA 3L2QA 4BRMA 5AZIA 4CF9A 3KK2A 1UA1A 1QHTA 4AH9A 4WQ4A 1Z25A 4J2EA 4JD2A 3P4IA 1W2BM 1XNRK 3CCMN 4DV5K 4CECA 2QW9A 4H0OA 1N8RO 2DY4A 2Q0RA 1ASVA 3TAFA 4FPAA 3VEVA 1TV6A 3PUFA 4J8FA 1KTQA 1S1TA 1R0AA 1HNXK 1DEJA 1JLEA 2HHHK 1BDGA 4WF9L 3KTQA 4CCHA 3FZHA 4FK4A 1ZC6A 1KAXA 3I8DA 3CQYA 4RG8A 1EP4A 5J2QA 3NCIA 1QQOA 3GDQA 3QETA 4JI3K 4CZMA 1TYQB 5B8HA 5JS1A 1QSYA 5J2NA 4ZTFA 3ZETA 1L3TA 4NLBA 1HLUA 1NU0A 4KB1A 4OPJA 2B5JA 3MEDA 3VGLA 3HYFA 3SUNA 4L8RB 3A0IX 4OGCA 4DTSA 3B8AX 4CJRA 4CEAA 4BRQA 5MLCQ 4NCBA 3KK7A 1NGGA 4XH5A 3I8BA 4CZIA 3KLIA 3AA2A 2FC0A 4XH4A 4I9QA 3V1QA 3GL1A 3AVLA 1E3MA 4DV3K 1Q18A 1JL2A 4GVMA 4GV9A 1NWKA 4FK2A 4IOCL 3SI6A 2HB5A 3K0SA 3V9XA 3JAMO 3THVA 4IZ9A 3OYHA 3CC7N 3KD1E 1RT5A 3M8PA 2YV0X 2HBLA 4XEIA 4WFNL 1JLAA 3F5TA 3JS6A 3T19A 2X6SA 2CGKA 3AVIA 1RT7A 4KTZA 4JEPA 4B9VA 3N4PA 4M3UA 4FZYA 2BGGA 1YXQA 1QSLA 2RKIA 2Y1IA 2O8BB 3CD6N 1LCUA 3VTHA 3ID8A 1RTDA 5KGWA 3SPZA 3F2KA 1H1VA 2YHAA 4FJGA 4N76A 4H0VB 1KVCA 2NRRA 3R9PA 1VRUA 4QAGA 1T44A 2OTLN 4JK7A 4NYFA 1MA9B 3C94A 1U2VA 3ENOA 4O8UA 5C24A 5TKYA 4DTPA 4CE9A 3CCSN 1NGCA 3L2UA 1KC8O 2GX9A 3R8EA 2QWLA 3MEGA 4HVJA 4FLZA 4OVLA 4CFBA 4KO0A 3DOLA 4F9OA 3AA3A 2Q97A 5GAGP 3HM8A 2Q3SA 4CBUA 4A5AA 1TKXA 1NKEA 4LF8K 3DWLA 1TK5A 4C1NI 1RDUA 3MWTA 3ZSRA 1JLFA 4LY7A 4YORA 5I42A 4YOVA 4LF9K 5F2RA 4IJNA 1SQKA 3THXB 2E2OA 3O1BA 5AZIB 3CC2N 4ELVA 1HRHA 2E2PA 4JD2B 3C6HA 1VQ5N 4CHZA 1DGKN 2PZSA 1UAXA 3VEWA 4BRDA 3G4SN 3K9JA 4XH1A 4CJVA 3ZT2A 5LMUK 1J5OA 4Y1CA 5AQMA 1IKYA 1BGXT 1YHQN 3AO2A 2I7NA 2P9IA 2P9NA 2OZSA 4JV5K 1NGIA 4DKWA 5BRDA 4CESA 1WNSA 1S1VA 4CF1A 2E5LK 1OVQA 3HT3A 1RT2A 3THWA 4DR1K 1NOYA 2OANA 4DV4K 5EY4A 3ZETB 4KHPK 4GW6A 1ASWA 2X6NA 2A6AA 3B6PA 4CIGA 5H1SQ 3SV3A 4FJKA 4O5FA 3ZX3A 1WB9A 5EU7A 2UUCK 3QIOA 4CHQA 1JLCA 1GLFO 4CJSA 1SAZA 1ASUA 4YDUA 4ZHRA 1NK9A 4LFCK 2ZF5O 1VSFA 1WBBA 1F21A 1I3AA 1JXEA 4E7JA 1VQKN 1YIJN 1C0GA 1B92A 1S1XA 1TKZA 4ILGB 3V4IA 3AARA 3UIQA 4FK0A 3VQ9A 4BQZA 4KPYA 4KREA 2UUBK 3LANA 4DQ8A 1NLVA 4H5NA 4AHTA 1HNWK 5BN9A 3GE1A 3CCLN 5AQFA 1S6PA 2YNIA 1ZBLA 4FZXC 5AQKA 2NRHA 3SUQA 2OYQA 3AVMA 3V6DA 3BUZB 3RMDA 3TSQA 4DUYK 2A41A 1BA0A 4M3WA 4DV6K 2QWQA 1TGOA 3HZ6A 3P39A 3IS9A 3IFRA 1ZBIA 3DRRA 3CG7A 4KI4A 3QDKA 3KWIA 3OYAA 3JSMA 3NHGA 2F7TA 3SCXA 3AVFA 1GLBG 4DHYA 1U2VB 3OS1A 4BE1A 4KI6A 4KAZA 4BRCA 3RMAA 4KTQA 4M45A 3B6OA 1IKWA 3MN5A 1EXQA 5AJ3K 4H5TA 3FZMA 1FK9A 4F3TA 4CHOA 3NGYA 2YNFA 5AQYA 4A61A 3TAEA 4WCEL 3Q7CA 3LDLA 3CJ9A 2W6KA 1X9JA 3VETA 3NVMA 3ZSQA 4HCBA 4JI8K 4GVEA 3L8BA 1IBLK 4FJ5A 1LW0A 4ILJA 3HVTA 5E26A 1Z05A 2QWNA 2X78A 5HLFA 2P1JA 1WOQA 3BY5A 4L3QA 1L5UA 1TKDA 2HVHA 3LZIA 4FVMA 4CBWA 3DRSA 4LSNA 3C6TA 2HHTA 3EL2A 1KD1O 2FF3B 1ZBSA 1T3VA 3CJAA 3O4WA 4CF8A 3EZWA 4Y1DA 4M3YA 1FW6A 1A5WA 4DSJA 1VAZA 4BDPA 4MO5A 3HPHA 4IOXA 5ELZA 3FZKA 4EHTA 4CGIA 3BEXA 2P9IB 2BH1A 2P9NB 4Q0BA 4DR2K 4DSFA 1V4TA 4BDYA 3QEVA 4U7BA 4B1YB 3E9PA 4OPKA 3D2FA 1C0UA 4B1UB 4QOZB 3THWB 4X65K 3MCAB 3E66A 2FSJA 4EFHA 1D9FA 2CGJA 3SQ4A 1VQ9N 3KLHA 2LSNA 1IKXA 1VQ7N 1KVAA 4BGBA 1TAQA 4EP4A 1SS6A 2BE2A 4B1ZA 2HNDA 3ULDA 4O0JA 2NRVA 4CJLA 4M3TA 5AQIA 1KXPA 4B1VA 2ITMA 3E9LA 2E88A 1YAGA 3K5NA 3QEWA 5AQVA 4IEIA 4YNQA 4CF0A 4FJLA 1BOTO 4YOYA 1E4GT 3O9UA 4CJQA 4DU4A 2XY5A 2G8FA 1RDBA 1KVBA 4LSLA 3SBTA 1K8KA 4JKGA 2GWJA 1GLCG 4QS8A 1Z6RA 2NRWA 5EOYA 4CJKA 3WNFA 4YHHK 4ZTJA 1NGFA 2BDPA 4X66K 3ULEA 2ZD1A 1RTIA 5KPRA 2ASPA 1RBVA 4BWJA 4AHVA 3BF1A 2G8UA 3HTVA 3QERA 4C1NK 4DSKA 3AGRA 4CFAA 2WONA 2IVNA 3VQ7A 2ZE2A 3P5JA 3S3MA 4EAHD 2D5RA 5JVGL 4F2RA 3C7NA 5AQZA 3CJ7A 3MK6A 4M7YA 1SL2A 3AGKA 1ZYQA 2HBKA 3CHWA 4B8AB 5C10A 4JN4A 2OPPA 1K9MO 3MXMA 3S9HA 2CH5A 3CM6A 4RW7A 3HI0A 1C1AA 1VSIA 4MO4A 4M3RA 1OH6A 2GELA 5CY4A 3UKUA 4DR7K 1NGBA 3SV4A 4NCGA 4I2QA 4ID5A 4A57A 3CCRN 4FM0A 3L2VA 3CFRA 4CGHA 3ZX2A 2FSKA 5GAHP 1QZ6A 1RDCA 3D45A 4BG9A 3IG1A 3VENA 4LC9B 1HMVA 5KTQA 2HBJA 1YJNN 3H45C 4B3TK 4B8CA 5F0XA 4Z4GA 1QQNA 1VSHA 3ZCMA 1S6QA 4GKKK 3SAGA 1LV5A 3ZSXA 1S1WA 4JKDA 2G8IA 3OYCA 3F73A 3AVKA 2WTUA 2F4VK 4IOAL 4A62A 3ATVA 1GLJO 1D8YA 1J6ZA 3T69A 3OJSA 5AQHA 3A5NC 1SKSA 1Q81O 3AO5A 3LP2A 3ZT1A 1X1PA 3O5BA 1JJ2M 3D2FB 3WNGA 4JAXA 4CEQA 3OYGA 4FWNA 4UY8O 3C0BA 2PAVA 1S1UA 4IFVA 2RF2A 3OVNA 4DB3A 4O0IA 4Z94A 3CYMA 4B3OA 5HRNA 3QNNA 5FPNA 1LAWA 4OPAA 1S5JA 3M8QA 1B9FA 2P5OA 2VG5A 3O1WA 5KI6A 5C2DA 2QI2A 4FJ9A 3QICA 5CZ1A 5BPLA 4JI6K 4JHDA 1WSJA 4FWQA 3DI6A 3H46O 4WYBA 1KLNA 1KQSM 4K0KK 4B3RK 5BRFA 5IWAK 2Q0UA 3AO4A 3QFUA 4CEBA 2A1SA 3EEQA 4JKAA 2G8VA 4GNIA 4CD1A 4CHPA 3PIOL 1K8KB 2FF6A 2GUPA 4JKGB 3DLKA 3T3FA 1Q9XA 2WBNA 1UWBA 3AA5X 3AVCA 4RW4A 4CJ3A 3IAYA 5AQRA 3M1FA 3L2RA 3AVGA 3OBYA 3OTOK 3ULEB 1W9HA 3J81O 1NJWA 5JLFA 3MX2A 2HSTA 3AV9A 3M6GA 4CEEA 1NK8A 1RT1A 1TUYA 3CJCA 1BUPA 1HNZK 1VSJA 3AAPA 2PBDA 3TR8A 3VF6A 4CW7B 3WEEA 1K6YA 3QIPA 1CXQA 3C7NB 3KIOA 3SMPA 2I7PA 1IG9A 2HHWA 2KTQA 3QB0A 4FL9A 4CZFA 5GIOA 4FJNA 1NMDA 3SZ2A 2KZZA 4A2BA 1Q8IA 4LF4K 3P83D 1N33K 1GOAA 4BRAA 3VA0A 2D0CA 2BANA 4GV3A 4BG8A 3VF2A 4CFDA 3L4IA 4JRPA 3KHYA 3L0QA 5CZ2A 3UKUB 4CJ5A 3G0ZA 3D6RA 3VQDA 1YT3A 4FO0A 5DM6L 3DOKA 4DFKA 3MWPA 3WQUA 4CJPA 4DTXA 1VSLA 5M1NA 2NRTA 3HO1A 4KTWA 4V19S 3TAGA 2XY6A 4F2SA 2HHSA 2HHXA 5HOOA 3SLCA 4DCHA 3CCQN 1XC9A 3ZT4A 2ZGYA 4E7LA 3UB5A 1X3MA 1VSEA 3SMSA 3E1YA 3TAMA 4OKJA 4RW6A 4AQYK 2P9PA 5J2PA 1HJOA 4KH5A 2E20A 3T1HK 1X9WA 2ZGZA 3O8MA 3SUPA 3RRHA 1IV0A 3OBWA 3NH2A 5AQGA 3VN5A 3SAFA 1SZ2A 1MWKA 1ZXOA 4IEEA 5HRPA 5BPNA 1BA1A 2QWPA 1KRPA 4BC2A 1XC3A 1GOCA 3LPTA 1Q86O 1S72N 3I55N 2P9SA 3O3HA 3THYA 4G9ZA 3J7AP 1WSIA 2EX3A 4GKJK 4BC5A 4KB0A 5GIPA 4Z4CA 3RVCA 2ITGA 3DJCA 5JVHL 4JHDB 4G1QA 5LL6Z 4JLHA 5AFUA 4Z0UA 1RBSA 3SK3A 1RDDA 2ZWHA 1C0FA 1U4BA 3HM9A 3I0SA 4OPHA 2YHBA 2YKNA 1A5XA 1TL1A 3CCEN 2O8FA 3VQ5A 3ZT3A 2P51A 2Q1NA 3TTDA 4O55A 3E9OA 4BRFA 4DLEA 1BHLA 4IO8A 4EIAA 2F96A 2ZQBA 1MDUB 3WUHA 1KFSA 3DLRA 3SAHA 3N4QA 2FBYA 4QS7A 2Y1JA 4FWKA 4JKFA 1U48A 4CZHA 3WEEB 3HK2A 4HCCA 5C12A 1S9GA 2YCHA 3OJUA 1GOBA 1CZAN 5DMRA 4DSLA 4M42A 3O9RA 4CVNE 2OZMA 2Q2RA 4IXCA 3J7YP 3JXUA 5AQOA 5FPMA 3WT0A 4OLBA 4BVPA 3C95A 1SKRA 1WSEA 3K9KA 2D0OA 3EYZA 5CHIA 1YVUA 3QINA 5JLHA 2DFEA 2QTDA 1UOCA 3VQQA 3WNHA 4LF7K 3MXIA 4HHTA 1J9AA 4AILC 1U6ZA 4K41A 3S3OA 3G6EN 3BDPA 4FJXA 4XIUA 2XO7A 4FJHA 3L2WA 3BZCA 2B4JA 4BR7A 2OPRA 4MFBA 3AVHA 2E4LA 1XHXA 1XWLA 3VQAA 3U3GA 5CYMA 1JCEA 3MECA 4KH4A 4DG1A 3TSPA 3PX0A 1NK0A 1DT9A 3L3VA 3KLEA 1HNIA 2HW3A 2VYPA 3T1YK 3M8SA 3M3ZA 3PIPL 4YOWA 2GWKA 2KLAA 3HRGA 4H5WA 4CGDA 1K73O 4BRPA 4FLTA 4QS9A 4JKCA 3FE1A 4Z4FA 4KHYA 2ZJRL 3WXMB 1LWFA 1QHAA 3C6UA 2P9PB 1YJ9N 2W40A 2YHYA 2YNGA 3LWLA 4IFEA 3O9TA 1WSHA 5AQJA 2ETJA 5C42A 1T05A 1NGDA 2W42A 4DFMA 1W7AA 3O3FA 1ZBHA 3H3NO 1JCGA 2HHUA 4K8XA 4B9QA 3MAQA 4JRQA 2YJEA 4I6MA 1S3XA 3IMXA 4IKFA 4CHYA 1C1BA 4BVOA 1T6CA 2P9SB 2W41A 3THYB 1NJYA 2AJQA 5EVZA 4Y0WA 1NG9A 1NK7A 1RNHA 3CCJN 2XY7A 1YF5L 3EY1A 3PY8A 1REVA 3CMAN 4B9TA 1R59O 3MX5A 1HPMA 1C1CA 3O4NA 4HWIA 4DU3A 3ZT0A 3G25A 4KH6A 5D3GA 2P9UA 4BR2A 4H0XB 3VQCA 3AO1A 1YTAA 4NB4A 4E3SA 4Z4EA 5AQPA 4M3XA 4DTUA 1JCFA 2O8FB 3SQ2A 3DAWA 4FSVA 4FXDA 1NJXA 3WNEA 1BL3A 2OPQA 4DSIA 3VQBA 5C2FA 2G8HA 1BIZA 4QCLA 3ASMA 3OYMA 1RDAA 4FW1A 2YNHA 3R6MA 4PKHA 2DFFA 4JI7K 4K8ZA 2XHBA 3V9ZA 1E4FT 1SKWA 4BRLA 3VQ4A 4FVUA 1GLLO 2RHKA 2VQFK 4H0PA 4RWTA 1QSSA 4AHSA 4DV0K 5KPTA 3DLLL 3PO4A 4PUOA 2HVIA 2YX6A 4OKKA 4W5TA 3TTFA 3SQ0A 4J2AA 3NVKA 4KHQA 2VCPA 3IKMA 2F9WA 4CJWA 2BTFA 3LZJA 1IBKK 4C8MA 1NBWA 4BY9C 4M3ZA 3GBTA 3QFPA 3TU5A 3J80O 3W0LA 4JK8A 3QEIA 3H1QA 4HUFA 3ZEUA 2IGIA 3U4LA 2QXFA 2QXLA 3KVGA 1T8EA 3RMBA 3QO9A 4FLYA 2ASMA 3I33A 3NBPA 3AO3A 5AQLA 4LFBK 1RFQA 3O4QA 4HTLA 1JLGA 3A2FA 4K43A 2O8EA 1I39A 1RT3A 5FDLA 3DLBA 4F4KA 1IO2A 4IDHA 3HJFA 4W5OA 1K8AO 2NZTA 4JKBA 4KBOA 5EX5A 3VOVA 4X64K 2JGUA 1HYSA 2HMPA 1HQUA 5I3UA 3RRGA 2UXCK 4CK2A 5ADXA 4FM1A 4DQQA 4JI2K 3P38A 4PKIA 4HTUA 3P31A 1ZBUA 4A2AA 4GV6A 4JS5A 4FJJA 5M1PA 1NK4A 1EWRA 1JLBA 1XMOK 4KHSA 4DR3K 3VGMA 4NCAA 4CZKA 3PV8A 2QK9A 1XMQK 1NKCA 4I6MB 4F8RA 4IJAA 4WQ5C 1TK0A 1T6DA 1O1WA 3KLGA 2GTDA 2RN2A 4H0TB 2J4RA 1V4SA 1SV5A 3QEPA 4CJTA 4YY3K 1LOTB 4PHTX 2IOCA 3ID6A 3LAKA 1M90O 3WQTA 2HNYA 3EO3A 5M1OA 2P9UB 5E84A 4CHNA 4PKGA 4M41A 3ZYYX 4OLAA 4E89A 3WXJA 3LWMA 5DK5A 5DM7L 1L3VA 4DU1A 3T7ZA 4NXNK 1NK6A 1L3SA
chains in the Genus database with same CATH topology
1N33K 4LF8K 4GKKK 4JI3K 4DUYK 4DV6K 4NXMK 4DR5K 1N36K 2F4VK 4LF9K 1I94K 4DV2K 4LFBK 2UU9K 4JYAK 5LMNK 4JI0K 1N32K 5BR8K 1N34K 4V19S 4YHHK 4X64K 4CVNE 5LMUK 4X66K 4JI4K 4LF5K 5AJ3K 3J7YP 2UXCK 2UXBK 4DV3K 4DR6K 4JI2K 4B3SK 4JV5K 4OX9K 1J5EK 4JI8K 3JAMO 4NXNK 1IBLK 2E5LK 1XMOK 4LF7K 4DR1K 4DV4K 4AQYK 4KHPK 4DR3K 4JI6K 5IT9O 4DV1K 1IBMK 3T1HK 1XMQK 4DV7K 1FJGK 2UUCK 4K0KK 4B3RK 5IWAK 5FLXO 2ZM6K 4X62K 4DR4K 4B3MK 4JI5K 2UUAK 4LFCK 4LFAK 4JI7K 4YY3K 3OTOK 3T1YK 4DR7K 4DUZK 3J81O 1HR0K 4JI1K 2VQFK 4DV0K 4LF6K 4DR2K 1HNZK 1XNRK 3J7AP 4GKJK 4DV5K 4CW7B 1XNQK 2UUBK 4X65K 5A2QO 1HNWK 1HNXK 5LL6Z 2VQEK 1IBKK 4B3TK 2HHHK 2UXDK 3J80O 4LF4K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N33 K;  4LF8 K;  4GKK K;  4JI3 K;  4DUY K;  4DV6 K;  4NXM K;  4DR5 K;  1N36 K;  2F4V K;  4LF9 K;  1I94 K;  4DV2 K;  4LFB K;  2UU9 K;  4JYA K;  5LMN K;  4JI0 K;  1N32 K;  5BR8 K;  1N34 K;  4V19 S;  4YHH K;  4X64 K;  4CVN E;  5LMU K;  4X66 K;  4JI4 K;  4LF5 K;  5AJ3 K;  3J7Y P;  2UXC K;  2UXB K;  4DV3 K;  4DR6 K;  4JI2 K;  4B3S K;  4JV5 K;  4OX9 K;  1J5E K;  4JI8 K;  3JAM O;  4NXN K;  1IBL K;  2E5L K;  1XMO K;  4LF7 K;  4DR1 K;  4DV4 K;  4AQY K;  4KHP K;  4DR3 K;  4JI6 K;  5IT9 O;  4DV1 K;  1IBM K;  3T1H K;  1XMQ K;  4DV7 K;  1FJG K;  2UUC K;  4K0K K;  4B3R K;  5IWA K;  5FLX O;  2ZM6 K;  4X62 K;  4DR4 K;  4B3M K;  4JI5 K;  2UUA K;  4LFC K;  4LFA K;  4JI7 K;  4YY3 K;  3OTO K;  3T1Y K;  4DR7 K;  4DUZ K;  3J81 O;  1HR0 K;  4JI1 K;  2VQF K;  4DV0 K;  4LF6 K;  4DR2 K;  1HNZ K;  1XNR K;  3J7A P;  4GKJ K;  4DV5 K;  4CW7 B;  1XNQ K;  2UUB K;  4X65 K;  5A2Q O;  1HNW K;  1HNX K;  5LL6 Z;  2VQE K;  1IBK K;  4B3T K;  2HHH K;  2UXD K;  3J80 O;  4LF4 K; 
#chains in the Genus database with same CATH topology
 2YI1 A;  4N56 A;  2QWR A;  2NRZ A;  3OA9 A;  4FLW A;  4AF1 A;  4WFB L;  3KKR A;  3H6E A;  1VSD A;  1HX1 A;  3HBT A;  3NAE A;  1I94 K;  2KQ2 A;  2G8W A;  4IWV A;  1QQC A;  4AM6 A;  3AA4 A;  3ISN C;  2ATQ A;  2YHW A;  2FBT A;  4FJM A;  3TAR A;  3OYE A;  2AP1 A;  4NYN A;  3RMC A;  1DLO A;  3SPY A;  2IDO A;  5EXW A;  4H0Y B;  5AQS A;  4MLE A;  1KAY A;  1FKP A;  3ZEU B;  1CLQ A;  3NH0 A;  3TAN A;  1IG8 A;  1TVR A;  4A59 A;  3C65 A;  4RW9 A;  3DLG A;  2JWL A;  3OYN A;  3LDS A;  1ATS A;  1HPZ A;  3KZB A;  4DQR A;  4B9U A;  4CJF A;  3CIP A;  4MDB A;  2O8E B;  2P5G A;  4DR4 K;  4B3M K;  4AM7 A;  4BGA A;  5HRO A;  2KFN A;  2RE2 A;  3V9W A;  3A5O C;  4E1M A;  4DSE A;  4WQ4 C;  2VG6 A;  4JKH A;  3GOI A;  1HKG A;  2V7Z A;  3BF3 A;  3V9S A;  4DFP A;  3VES A;  1RBU A;  1DKG D;  3SBG A;  3OYJ A;  3K2P A;  4O8K A;  4FPB A;  4BRG A;  2BUP A;  3CER A;  4ELU A;  1WAF A;  3CCV N;  1NGJ A;  4CGJ A;  5FPD A;  4DQS A;  1WUA A;  4GY2 B;  3K57 A;  3NF9 A;  4E7K A;  3Q7B A;  5HRR A;  4BR9 A;  3PO5 A;  3GG4 A;  1EO1 A;  1U49 A;  2UXD K;  3BP8 A;  2KKZ A;  3RWU A;  2X74 A;  3OYL A;  2VG7 A;  1RTJ A;  2Q36 A;  3LM9 A;  4DLG A;  2QM1 A;  5AQW A;  4W5N A;  4CJ7 A;  2WUS A;  3ZSV A;  3NMU A;  4NXM K;  1LAV A;  1VQ6 N;  4BE2 A;  2E6L A;  1M1K O;  3O9S A;  4CIF A;  4ISG A;  2UU9 K;  1WBD A;  2VWK A;  1D5A A;  2FBV A;  5AQN A;  2IC3 A;  2Q31 A;  4CGF A;  4OKE A;  3VMF B;  1DTQ A;  2AA4 A;  1Q7Y O;  3CXC M;  5BR8 K;  4LH5 A;  4E0D A;  3LPU A;  4LF5 K;  1LWE A;  3DXM A;  4E1N A;  1EQY A;  2DTU A;  1CZB A;  4PL7 A;  5C15 A;  3VGK A;  1G15 A;  4B9M A;  3MEE A;  1RT6 A;  3PSF A;  4E7I A;  1IJJ A;  3ATU A;  3ZSZ A;  3LDO A;  3MN9 A;  2I5J A;  3IDH A;  1S9E A;  4BC4 A;  4CJU A;  3KK1 A;  3RSE A;  3HPG A;  1X9S A;  3TI0 A;  1RBR A;  3L3U A;  4CGG A;  3SYZ A;  2FSN A;  4B1W B;  3HP6 A;  3LP1 A;  2GUI A;  4EZ9 A;  4DTO A;  4CJ4 A;  4Z4H A;  1ESV A;  1RBT A;  2ZM6 K;  1TKT A;  3HL8 A;  4ID1 A;  1OH8 A;  4EHU A;  4JI5 K;  1XQS C;  5LJV A;  2UUA K;  4R79 A;  1U47 A;  3NF7 A;  3KD5 E;  5FRN A;  4FWS A;  3PSI A;  3V81 A;  3H3O B;  3LP0 A;  4I2P A;  4KFB A;  4JI1 K;  5C25 A;  1OKJ A;  2V7Y A;  5AQT A;  3S41 A;  5KRS A;  1N5Y A;  2GEM A;  3HOT A;  3M5R A;  5KQD A;  4BR0 A;  3CI5 A;  4CZJ A;  3LAM A;  3CFO A;  4O4G A;  4FCY A;  3HST B;  3R1X A;  1VQN N;  3O80 A;  4CK1 A;  1C0M A;  2O8D A;  3FZL A;  3HOS A;  4GMJ B;  1J53 A;  1KCF A;  3L4Q A;  2CGL A;  1KLM A;  3KWG A;  4H4O A;  4H4M A;  1BIU A;  2JLE A;  5F1X A;  3A5M C;  3OHR A;  4FLX A;  5AQU A;  2V52 B;  3VQ6 A;  3DXK A;  2XRI A;  2D0P A;  1YUW A;  4HUG A;  4DV2 K;  1HKC A;  4ICL A;  5LMN K;  4OGE A;  2D4W A;  5TKW A;  1YI2 N;  2VGN A;  3VA3 A;  4IDK A;  1NGA A;  1EKE A;  3LDP A;  3CM5 A;  3VTI A;  3T1A A;  1N34 K;  1GLD G;  2EHG A;  2NLX A;  3D2E A;  3ZSY A;  1L3U A;  3R3L A;  1ATN A;  2UYT A;  1A5V A;  5LJW A;  3EE9 A;  3TTC A;  4DWI A;  3UE5 A;  3KKS A;  3LDQ A;  4FW2 A;  2IAJ A;  3CJB A;  4AHC A;  1VQM N;  2Z1J A;  3FZF A;  3U3Y A;  5JS2 A;  3EKS A;  2KZM A;  1Z26 A;  3CJ1 A;  2O8C A;  4IFY A;  1VRT A;  4BAC A;  1JL1 A;  1TUU A;  2IS3 A;  3MMV A;  3CF5 L;  1TK8 A;  4YDU C;  2PYJ A;  4BR5 A;  4FWL A;  1LW2 A;  4DQP A;  4NO7 A;  4X62 K;  4CD3 A;  3MN7 A;  3VQP A;  1RIL A;  5BPM A;  1S22 A;  4KRF A;  1EX4 A;  2HHV A;  4CZE A;  3AAQ A;  2OTJ N;  3O3G A;  4DMN A;  3DXM B;  4CEF A;  1IH7 A;  4BRK A;  4ISE A;  3QLH A;  3LAL A;  4CI6 A;  4WFA L;  4FWP A;  4ISF A;  3U9Z A;  3D0P A;  2Z1I A;  3A5L C;  3UKR A;  1SL0 A;  3RSE B;  1RTH A;  5A2Q O;  3OY9 A;  3U6F A;  3U9D A;  3P1G A;  4E1J A;  4DF8 A;  4KHN A;  3DYA A;  1YTU A;  3BGR A;  2F9T A;  1GLA G;  3OW2 M;  3AVA A;  5JIC A;  2HF3 A;  3OYB A;  4YOT A;  4RW8 A;  1EET A;  2D0A A;  1HJR A;  2O4G A;  3KJV A;  1KSP A;  2E2N A;  4DR5 K;  3RR7 A;  3ZSW A;  3HP9 A;  4CZG A;  4Z4I A;  5KQ8 A;  3J7Z O;  2VWB A;  2B6A A;  4O44 A;  2P9K A;  5K14 A;  4N41 A;  2PFU A;  4BRN A;  1C0T A;  2FBX A;  2HOE A;  4CZL A;  2JWK A;  1N32 K;  1NNE A;  2A42 A;  3RR8 A;  2OPS A;  1WSG A;  3VEZ A;  4DTJ A;  3CQX A;  2W6L A;  2QKK A;  4JI4 K;  3MCP A;  3SJH A;  3CFP A;  4W5R A;  1Y64 A;  5M1K A;  1RDW X;  5BRH A;  4IO9 L;  2O8D B;  4U67 L;  1YIT N;  1P90 A;  1VK0 A;  4FJ7 A;  4CER A;  1VSK A;  1BG3 A;  3O08 A;  4CEZ A;  2GBZ A;  3VQ8 A;  1B9D A;  2VGM A;  1OH7 A;  3NF8 A;  3A8Y A;  5KPZ A;  3I56 N;  4H5V A;  3VF4 A;  1IBM K;  3DXK B;  2NUB A;  1FKO A;  1BO5 O;  2A3Z A;  3DRP A;  3HVR A;  3OYI A;  3V1O A;  5JMV A;  4UQG A;  3OYK A;  2KW4 A;  4FWM A;  2HNZ A;  5GAD P;  1G99 A;  3ENH A;  3TWH A;  2G8K A;  2P9L A;  2CH6 A;  3K5M A;  4LFA K;  4NLC A;  4BRI A;  2O4I A;  1HQE A;  1TL3 A;  1NOZ A;  3D2E B;  3MDQ A;  5HRS A;  1HR0 K;  5ADX H;  4KHW A;  4KKO A;  3J8A A;  4H5R A;  1U04 A;  3VEY A;  2ASO A;  2QA4 N;  4CEO A;  5E41 A;  3AVB A;  1T7P A;  3SUO A;  5SWM A;  2E1Z A;  3FFI A;  3SNN A;  3LM2 A;  4R5P A;  3FR0 A;  2EWS A;  4FWO A;  1VQ4 N;  4B9L A;  4BRO A;  2O8C B;  2R7Y A;  2VQE K;  1U45 A;  3PLA A;  1NGH A;  2D1K A;  4CBX A;  4WE1 A;  1Q82 O;  2HBM A;  5SZT A;  3JYT A;  3TAP A;  3OYD A;  1NJI O;  1XHZ A;  1QTM A;  4Q5V A;  3TPQ A;  3CME N;  3DM2 A;  2YJF A;  1Q9Y A;  1XUP O;  4FM2 A;  1VQL N;  4BRE A;  1N36 K;  3CQ8 A;  1NMN A;  3U8X A;  3BZK A;  4CJE A;  1JXB A;  2E8A A;  3F9K A;  5HP1 A;  2HMI A;  1DTT A;  2V51 B;  4IG3 A;  3SJJ A;  2KFZ A;  4TSX A;  2XY8 A;  5AR0 A;  3UKR B;  5KRT A;  4B08 A;  1BI4 A;  3QNO A;  1QE1 A;  4ILH A;  5HL7 L;  3KLF A;  1HNV A;  2RPI A;  4BRH A;  4YOX A;  1HYV A;  3S3N A;  2QEX N;  3NGI A;  4W5Q A;  2UXB K;  4LH4 A;  2DPN A;  4FLV A;  3ITH A;  4A5B A;  4OX9 K;  2Z1G A;  4RTF D;  2D0B A;  4B1X B;  1BQN A;  4M63 C;  3FFK B;  3LL3 A;  1RGI A;  4DV1 K;  2A5X A;  2A1R A;  1T03 A;  2ZJP L;  1RCH A;  4M7X A;  5M1F A;  2P9K B;  5C0Y A;  1X3N A;  2F8S A;  4B9S A;  3FLC O;  5FLX O;  2WOM A;  3EZ5 A;  2ZJQ L;  4DTR A;  3LDN A;  2OCE A;  3MXJ A;  4DS4 A;  1NJZ A;  3VQE A;  4DUZ K;  1KAZ A;  5FRO A;  4DQI A;  3WXL A;  1JLQ A;  1VQ8 N;  2QWM A;  4FWR A;  4C8O A;  2E6M A;  3SQ1 A;  1VSM A;  2WC9 A;  2FLO A;  3DMJ A;  5I9E B;  1W0H A;  4FOE A;  1BQM A;  3OS2 A;  3HXM A;  5M1Q A;  2HF4 A;  1QQM A;  3C6A A;  4ELT A;  1VHX A;  1CZ9 A;  3MN6 A;  2A40 A;  1QZ5 A;  5GIN A;  1NK5 A;  3G71 N;  4PWD A;  3VER A;  3QEX A;  2P9L B;  3IRX A;  3CET A;  3NE6 A;  5BRE A;  3EKU A;  1BU6 O;  5BN8 A;  1SUQ A;  3HPO A;  3DLE A;  1LWC A;  5AZJ A;  3CC4 N;  3O9Q A;  4J2B A;  5CE3 A;  3V9U A;  1WAJ A;  4JYA K;  4PL8 A;  1FXX A;  4AHU A;  2E1Y A;  4JI0 K;  2WFB A;  2NRX A;  1XI1 A;  1QS4 A;  1BCM A;  4I9L A;  1BIS A;  1ZBF A;  2QKB A;  1P8Z A;  2Z1H A;  1QVF M;  1BCO A;  3F9M A;  4E7H A;  1EWQ A;  4N5S A;  2IVO A;  4RCH A;  4N47 A;  3CPW M;  4B9N A;  3EE8 A;  3DLH A;  4J2D A;  4DR6 K;  3LP3 A;  4B3S K;  5CYQ A;  3K5L A;  1YJW N;  5GAE P;  3AY9 A;  4CIE A;  2FXU A;  2H3G X;  4BDZ A;  4JK9 A;  4C8N A;  1SL1 A;  4I7F A;  1CXU A;  4MLH A;  1NKB A;  3CPE A;  3CCU N;  4AHR A;  1HKB A;  4OJR A;  4HUE A;  5BR9 A;  4BQL A;  4K42 A;  4E19 A;  1X9M A;  5CR4 A;  1GLE G;  5LY3 A;  4F3O A;  4WQ5 A;  4H03 B;  3I0R A;  3OYF A;  1TYQ A;  1UA0 A;  1BI4 B;  2PY5 A;  4JKE A;  2VWJ A;  3H08 A;  5T7B A;  3NF6 A;  3KK3 A;  4KV8 A;  2PYL A;  4LD0 A;  3AVJ A;  5AQQ A;  3L6Q A;  4MDA A;  4YFU A;  4LF6 K;  3NFA A;  3V1R A;  1RT4 A;  3QML A;  1XNQ K;  4FOI A;  3ALY A;  3K58 A;  3ENB A;  1MWM A;  1YVN A;  3W3D A;  1VQO N;  5FRM A;  1D4X A;  5KGX A;  4JS4 A;  3WXI A;  4OO1 J;  1NGE A;  1D9D A;  2HHQ A;  1QVG M;  1N6Q A;  3TAQ A;  4DTN A;  2OA8 A;  3FGU A;  3PX6 A;  4DS5 A;  4BC3 A;  1HYZ A;  2E2Q A;  5AQX A;  1O13 A;  3QBW A;  4CF2 A;  3E01 A;  4CED A;  1WSF A;  3ZX0 A;  4FJI A;  4DFJ A;  2QWO A;  3RTV A;  2DFH A;  5FPE A;  1OH5 A;  4BR4 A;  1IKV A;  3K5O A;  2IIR A;  4MQ3 A;  4EP5 A;  2O8B A;  3NGZ A;  1BWF O;  4C8K A;  3O6W A;  3K59 A;  1ATR A;  3VEO A;  3AVN A;  4DTM A;  4IG0 A;  5J1E A;  3QES A;  1KFD A;  4CK3 A;  4FZZ A;  1Y97 A;  3M8R A;  3VPZ A;  2KHO A;  3QBX A;  4KHU A;  4BWM A;  1TAU A;  1J54 A;  4FYD A;  1C6V A;  4EZ6 A;  2YHX A;  4C23 A;  4CFC A;  3TAB A;  3OS0 A;  4PQU A;  1J5E K;  3NH1 A;  4IBN A;  1HUX A;  3D7E O;  1NM1 A;  4FJ8 A;  2IVP A;  1ITG A;  1W97 L;  1WN7 A;  5IT9 O;  5AZJ B;  4BE0 A;  2YKM A;  4DV7 K;  1FJG K;  1OVY A;  1ILY A;  1MU2 A;  3H1V X;  4C8L A;  1JKH A;  5AFU H;  4YOU A;  3VEX A;  1VQP N;  2F8T A;  3TSU A;  4FLU A;  3WXK A;  4H8K A;  3HSC A;  4PA1 A;  4O5B A;  3G10 A;  4K25 A;  2GV9 A;  3ZLJ A;  3IUC A;  3NDK A;  4JNE A;  1WLJ A;  5J2M A;  3EN9 A;  5HBM A;  3ZSO A;  4PY5 A;  4DF4 A;  3PX4 A;  2NNW A;  3THX A;  3L2Q A;  4BRM A;  5AZI A;  4CF9 A;  3KK2 A;  1UA1 A;  1QHT A;  4AH9 A;  4WQ4 A;  1Z25 A;  4J2E A;  4JD2 A;  3P4I A;  1W2B M;  1XNR K;  3CCM N;  4DV5 K;  4CEC A;  2QW9 A;  4H0O A;  1N8R O;  2DY4 A;  2Q0R A;  1ASV A;  3TAF A;  4FPA A;  3VEV A;  1TV6 A;  3PUF A;  4J8F A;  1KTQ A;  1S1T A;  1R0A A;  1HNX K;  1DEJ A;  1JLE A;  2HHH K;  1BDG A;  4WF9 L;  3KTQ A;  4CCH A;  3FZH A;  4FK4 A;  1ZC6 A;  1KAX A;  3I8D A;  3CQY A;  4RG8 A;  1EP4 A;  5J2Q A;  3NCI A;  1QQO A;  3GDQ A;  3QET A;  4JI3 K;  4CZM A;  1TYQ B;  5B8H A;  5JS1 A;  1QSY A;  5J2N A;  4ZTF A;  3ZET A;  1L3T A;  4NLB A;  1HLU A;  1NU0 A;  4KB1 A;  4OPJ A;  2B5J A;  3MED A;  3VGL A;  3HYF A;  3SUN A;  4L8R B;  3A0I X;  4OGC A;  4DTS A;  3B8A X;  4CJR A;  4CEA A;  4BRQ A;  5MLC Q;  4NCB A;  3KK7 A;  1NGG A;  4XH5 A;  3I8B A;  4CZI A;  3KLI A;  3AA2 A;  2FC0 A;  4XH4 A;  4I9Q A;  3V1Q A;  3GL1 A;  3AVL A;  1E3M A;  4DV3 K;  1Q18 A;  1JL2 A;  4GVM A;  4GV9 A;  1NWK A;  4FK2 A;  4IOC L;  3SI6 A;  2HB5 A;  3K0S A;  3V9X A;  3JAM O;  3THV A;  4IZ9 A;  3OYH A;  3CC7 N;  3KD1 E;  1RT5 A;  3M8P A;  2YV0 X;  2HBL A;  4XEI A;  4WFN L;  1JLA A;  3F5T A;  3JS6 A;  3T19 A;  2X6S A;  2CGK A;  3AVI A;  1RT7 A;  4KTZ A;  4JEP A;  4B9V A;  3N4P A;  4M3U A;  4FZY A;  2BGG A;  1YXQ A;  1QSL A;  2RKI A;  2Y1I A;  2O8B B;  3CD6 N;  1LCU A;  3VTH A;  3ID8 A;  1RTD A;  5KGW A;  3SPZ A;  3F2K A;  1H1V A;  2YHA A;  4FJG A;  4N76 A;  4H0V B;  1KVC A;  2NRR A;  3R9P A;  1VRU A;  4QAG A;  1T44 A;  2OTL N;  4JK7 A;  4NYF A;  1MA9 B;  3C94 A;  1U2V A;  3ENO A;  4O8U A;  5C24 A;  5TKY A;  4DTP A;  4CE9 A;  3CCS N;  1NGC A;  3L2U A;  1KC8 O;  2GX9 A;  3R8E A;  2QWL A;  3MEG A;  4HVJ A;  4FLZ A;  4OVL A;  4CFB A;  4KO0 A;  3DOL A;  4F9O A;  3AA3 A;  2Q97 A;  5GAG P;  3HM8 A;  2Q3S A;  4CBU A;  4A5A A;  1TKX A;  1NKE A;  4LF8 K;  3DWL A;  1TK5 A;  4C1N I;  1RDU A;  3MWT A;  3ZSR A;  1JLF A;  4LY7 A;  4YOR A;  5I42 A;  4YOV A;  4LF9 K;  5F2R A;  4IJN A;  1SQK A;  3THX B;  2E2O A;  3O1B A;  5AZI B;  3CC2 N;  4ELV A;  1HRH A;  2E2P A;  4JD2 B;  3C6H A;  1VQ5 N;  4CHZ A;  1DGK N;  2PZS A;  1UAX A;  3VEW A;  4BRD A;  3G4S N;  3K9J A;  4XH1 A;  4CJV A;  3ZT2 A;  5LMU K;  1J5O A;  4Y1C A;  5AQM A;  1IKY A;  1BGX T;  1YHQ N;  3AO2 A;  2I7N A;  2P9I A;  2P9N A;  2OZS A;  4JV5 K;  1NGI A;  4DKW A;  5BRD A;  4CES A;  1WNS A;  1S1V A;  4CF1 A;  2E5L K;  1OVQ A;  3HT3 A;  1RT2 A;  3THW A;  4DR1 K;  1NOY A;  2OAN A;  4DV4 K;  5EY4 A;  3ZET B;  4KHP K;  4GW6 A;  1ASW A;  2X6N A;  2A6A A;  3B6P A;  4CIG A;  5H1S Q;  3SV3 A;  4FJK A;  4O5F A;  3ZX3 A;  1WB9 A;  5EU7 A;  2UUC K;  3QIO A;  4CHQ A;  1JLC A;  1GLF O;  4CJS A;  1SAZ A;  1ASU A;  4YDU A;  4ZHR A;  1NK9 A;  4LFC K;  2ZF5 O;  1VSF A;  1WBB A;  1F21 A;  1I3A A;  1JXE A;  4E7J A;  1VQK N;  1YIJ N;  1C0G A;  1B92 A;  1S1X A;  1TKZ A;  4ILG B;  3V4I A;  3AAR A;  3UIQ A;  4FK0 A;  3VQ9 A;  4BQZ A;  4KPY A;  4KRE A;  2UUB K;  3LAN A;  4DQ8 A;  1NLV A;  4H5N A;  4AHT A;  1HNW K;  5BN9 A;  3GE1 A;  3CCL N;  5AQF A;  1S6P A;  2YNI A;  1ZBL A;  4FZX C;  5AQK A;  2NRH A;  3SUQ A;  2OYQ A;  3AVM A;  3V6D A;  3BUZ B;  3RMD A;  3TSQ A;  4DUY K;  2A41 A;  1BA0 A;  4M3W A;  4DV6 K;  2QWQ A;  1TGO A;  3HZ6 A;  3P39 A;  3IS9 A;  3IFR A;  1ZBI A;  3DRR A;  3CG7 A;  4KI4 A;  3QDK A;  3KWI A;  3OYA A;  3JSM A;  3NHG A;  2F7T A;  3SCX A;  3AVF A;  1GLB G;  4DHY A;  1U2V B;  3OS1 A;  4BE1 A;  4KI6 A;  4KAZ A;  4BRC A;  3RMA A;  4KTQ A;  4M45 A;  3B6O A;  1IKW A;  3MN5 A;  1EXQ A;  5AJ3 K;  4H5T A;  3FZM A;  1FK9 A;  4F3T A;  4CHO A;  3NGY A;  2YNF A;  5AQY A;  4A61 A;  3TAE A;  4WCE L;  3Q7C A;  3LDL A;  3CJ9 A;  2W6K A;  1X9J A;  3VET A;  3NVM A;  3ZSQ A;  4HCB A;  4JI8 K;  4GVE A;  3L8B A;  1IBL K;  4FJ5 A;  1LW0 A;  4ILJ A;  3HVT A;  5E26 A;  1Z05 A;  2QWN A;  2X78 A;  5HLF A;  2P1J A;  1WOQ A;  3BY5 A;  4L3Q A;  1L5U A;  1TKD A;  2HVH A;  3LZI A;  4FVM A;  4CBW A;  3DRS A;  4LSN A;  3C6T A;  2HHT A;  3EL2 A;  1KD1 O;  2FF3 B;  1ZBS A;  1T3V A;  3CJA A;  3O4W A;  4CF8 A;  3EZW A;  4Y1D A;  4M3Y A;  1FW6 A;  1A5W A;  4DSJ A;  1VAZ A;  4BDP A;  4MO5 A;  3HPH A;  4IOX A;  5ELZ A;  3FZK A;  4EHT A;  4CGI A;  3BEX A;  2P9I B;  2BH1 A;  2P9N B;  4Q0B A;  4DR2 K;  4DSF A;  1V4T A;  4BDY A;  3QEV A;  4U7B A;  4B1Y B;  3E9P A;  4OPK A;  3D2F A;  1C0U A;  4B1U B;  4QOZ B;  3THW B;  4X65 K;  3MCA B;  3E66 A;  2FSJ A;  4EFH A;  1D9F A;  2CGJ A;  3SQ4 A;  1VQ9 N;  3KLH A;  2LSN A;  1IKX A;  1VQ7 N;  1KVA A;  4BGB A;  1TAQ A;  4EP4 A;  1SS6 A;  2BE2 A;  4B1Z A;  2HND A;  3ULD A;  4O0J A;  2NRV A;  4CJL A;  4M3T A;  5AQI A;  1KXP A;  4B1V A;  2ITM A;  3E9L A;  2E88 A;  1YAG A;  3K5N A;  3QEW A;  5AQV A;  4IEI A;  4YNQ A;  4CF0 A;  4FJL A;  1BOT O;  4YOY A;  1E4G T;  3O9U A;  4CJQ A;  4DU4 A;  2XY5 A;  2G8F A;  1RDB A;  1KVB A;  4LSL A;  3SBT A;  1K8K A;  4JKG A;  2GWJ A;  1GLC G;  4QS8 A;  1Z6R A;  2NRW A;  5EOY A;  4CJK A;  3WNF A;  4YHH K;  4ZTJ A;  1NGF A;  2BDP A;  4X66 K;  3ULE A;  2ZD1 A;  1RTI A;  5KPR A;  2ASP A;  1RBV A;  4BWJ A;  4AHV A;  3BF1 A;  2G8U A;  3HTV A;  3QER A;  4C1N K;  4DSK A;  3AGR A;  4CFA A;  2WON A;  2IVN A;  3VQ7 A;  2ZE2 A;  3P5J A;  3S3M A;  4EAH D;  2D5R A;  5JVG L;  4F2R A;  3C7N A;  5AQZ A;  3CJ7 A;  3MK6 A;  4M7Y A;  1SL2 A;  3AGK A;  1ZYQ A;  2HBK A;  3CHW A;  4B8A B;  5C10 A;  4JN4 A;  2OPP A;  1K9M O;  3MXM A;  3S9H A;  2CH5 A;  3CM6 A;  4RW7 A;  3HI0 A;  1C1A A;  1VSI A;  4MO4 A;  4M3R A;  1OH6 A;  2GEL A;  5CY4 A;  3UKU A;  4DR7 K;  1NGB A;  3SV4 A;  4NCG A;  4I2Q A;  4ID5 A;  4A57 A;  3CCR N;  4FM0 A;  3L2V A;  3CFR A;  4CGH A;  3ZX2 A;  2FSK A;  5GAH P;  1QZ6 A;  1RDC A;  3D45 A;  4BG9 A;  3IG1 A;  3VEN A;  4LC9 B;  1HMV A;  5KTQ A;  2HBJ A;  1YJN N;  3H45 C;  4B3T K;  4B8C A;  5F0X A;  4Z4G A;  1QQN A;  1VSH A;  3ZCM A;  1S6Q A;  4GKK K;  3SAG A;  1LV5 A;  3ZSX A;  1S1W A;  4JKD A;  2G8I A;  3OYC A;  3F73 A;  3AVK A;  2WTU A;  2F4V K;  4IOA L;  4A62 A;  3ATV A;  1GLJ O;  1D8Y A;  1J6Z A;  3T69 A;  3OJS A;  5AQH A;  3A5N C;  1SKS A;  1Q81 O;  3AO5 A;  3LP2 A;  3ZT1 A;  1X1P A;  3O5B A;  1JJ2 M;  3D2F B;  3WNG A;  4JAX A;  4CEQ A;  3OYG A;  4FWN A;  4UY8 O;  3C0B A;  2PAV A;  1S1U A;  4IFV A;  2RF2 A;  3OVN A;  4DB3 A;  4O0I A;  4Z94 A;  3CYM A;  4B3O A;  5HRN A;  3QNN A;  5FPN A;  1LAW A;  4OPA A;  1S5J A;  3M8Q A;  1B9F A;  2P5O A;  2VG5 A;  3O1W A;  5KI6 A;  5C2D A;  2QI2 A;  4FJ9 A;  3QIC A;  5CZ1 A;  5BPL A;  4JI6 K;  4JHD A;  1WSJ A;  4FWQ A;  3DI6 A;  3H46 O;  4WYB A;  1KLN A;  1KQS M;  4K0K K;  4B3R K;  5BRF A;  5IWA K;  2Q0U A;  3AO4 A;  3QFU A;  4CEB A;  2A1S A;  3EEQ A;  4JKA A;  2G8V A;  4GNI A;  4CD1 A;  4CHP A;  3PIO L;  1K8K B;  2FF6 A;  2GUP A;  4JKG B;  3DLK A;  3T3F A;  1Q9X A;  2WBN A;  1UWB A;  3AA5 X;  3AVC A;  4RW4 A;  4CJ3 A;  3IAY A;  5AQR A;  3M1F A;  3L2R A;  3AVG A;  3OBY A;  3OTO K;  3ULE B;  1W9H A;  3J81 O;  1NJW A;  5JLF A;  3MX2 A;  2HST A;  3AV9 A;  3M6G A;  4CEE A;  1NK8 A;  1RT1 A;  1TUY A;  3CJC A;  1BUP A;  1HNZ K;  1VSJ A;  3AAP A;  2PBD A;  3TR8 A;  3VF6 A;  4CW7 B;  3WEE A;  1K6Y A;  3QIP A;  1CXQ A;  3C7N B;  3KIO A;  3SMP A;  2I7P A;  1IG9 A;  2HHW A;  2KTQ A;  3QB0 A;  4FL9 A;  4CZF A;  5GIO A;  4FJN A;  1NMD A;  3SZ2 A;  2KZZ A;  4A2B A;  1Q8I A;  4LF4 K;  3P83 D;  1N33 K;  1GOA A;  4BRA A;  3VA0 A;  2D0C A;  2BAN A;  4GV3 A;  4BG8 A;  3VF2 A;  4CFD A;  3L4I A;  4JRP A;  3KHY A;  3L0Q A;  5CZ2 A;  3UKU B;  4CJ5 A;  3G0Z A;  3D6R A;  3VQD A;  1YT3 A;  4FO0 A;  5DM6 L;  3DOK A;  4DFK A;  3MWP A;  3WQU A;  4CJP A;  4DTX A;  1VSL A;  5M1N A;  2NRT A;  3HO1 A;  4KTW A;  4V19 S;  3TAG A;  2XY6 A;  4F2S A;  2HHS A;  2HHX A;  5HOO A;  3SLC A;  4DCH A;  3CCQ N;  1XC9 A;  3ZT4 A;  2ZGY A;  4E7L A;  3UB5 A;  1X3M A;  1VSE A;  3SMS A;  3E1Y A;  3TAM A;  4OKJ A;  4RW6 A;  4AQY K;  2P9P A;  5J2P A;  1HJO A;  4KH5 A;  2E20 A;  3T1H K;  1X9W A;  2ZGZ A;  3O8M A;  3SUP A;  3RRH A;  1IV0 A;  3OBW A;  3NH2 A;  5AQG A;  3VN5 A;  3SAF A;  1SZ2 A;  1MWK A;  1ZXO A;  4IEE A;  5HRP A;  5BPN A;  1BA1 A;  2QWP A;  1KRP A;  4BC2 A;  1XC3 A;  1GOC A;  3LPT A;  1Q86 O;  1S72 N;  3I55 N;  2P9S A;  3O3H A;  3THY A;  4G9Z A;  3J7A P;  1WSI A;  2EX3 A;  4GKJ K;  4BC5 A;  4KB0 A;  5GIP A;  4Z4C A;  3RVC A;  2ITG A;  3DJC A;  5JVH L;  4JHD B;  4G1Q A;  5LL6 Z;  4JLH A;  5AFU A;  4Z0U A;  1RBS A;  3SK3 A;  1RDD A;  2ZWH A;  1C0F A;  1U4B A;  3HM9 A;  3I0S A;  4OPH A;  2YHB A;  2YKN A;  1A5X A;  1TL1 A;  3CCE N;  2O8F A;  3VQ5 A;  3ZT3 A;  2P51 A;  2Q1N A;  3TTD A;  4O55 A;  3E9O A;  4BRF A;  4DLE A;  1BHL A;  4IO8 A;  4EIA A;  2F96 A;  2ZQB A;  1MDU B;  3WUH A;  1KFS A;  3DLR A;  3SAH A;  3N4Q A;  2FBY A;  4QS7 A;  2Y1J A;  4FWK A;  4JKF A;  1U48 A;  4CZH A;  3WEE B;  3HK2 A;  4HCC A;  5C12 A;  1S9G A;  2YCH A;  3OJU A;  1GOB A;  1CZA N;  5DMR A;  4DSL A;  4M42 A;  3O9R A;  4CVN E;  2OZM A;  2Q2R A;  4IXC A;  3J7Y P;  3JXU A;  5AQO A;  5FPM A;  3WT0 A;  4OLB A;  4BVP A;  3C95 A;  1SKR A;  1WSE A;  3K9K A;  2D0O A;  3EYZ A;  5CHI A;  1YVU A;  3QIN A;  5JLH A;  2DFE A;  2QTD A;  1UOC A;  3VQQ A;  3WNH A;  4LF7 K;  3MXI A;  4HHT A;  1J9A A;  4AIL C;  1U6Z A;  4K41 A;  3S3O A;  3G6E N;  3BDP A;  4FJX A;  4XIU A;  2XO7 A;  4FJH A;  3L2W A;  3BZC A;  2B4J A;  4BR7 A;  2OPR A;  4MFB A;  3AVH A;  2E4L A;  1XHX A;  1XWL A;  3VQA A;  3U3G A;  5CYM A;  1JCE A;  3MEC A;  4KH4 A;  4DG1 A;  3TSP A;  3PX0 A;  1NK0 A;  1DT9 A;  3L3V A;  3KLE A;  1HNI A;  2HW3 A;  2VYP A;  3T1Y K;  3M8S A;  3M3Z A;  3PIP L;  4YOW A;  2GWK A;  2KLA A;  3HRG A;  4H5W A;  4CGD A;  1K73 O;  4BRP A;  4FLT A;  4QS9 A;  4JKC A;  3FE1 A;  4Z4F A;  4KHY A;  2ZJR L;  3WXM B;  1LWF A;  1QHA A;  3C6U A;  2P9P B;  1YJ9 N;  2W40 A;  2YHY A;  2YNG A;  3LWL A;  4IFE A;  3O9T A;  1WSH A;  5AQJ A;  2ETJ A;  5C42 A;  1T05 A;  1NGD A;  2W42 A;  4DFM A;  1W7A A;  3O3F A;  1ZBH A;  3H3N O;  1JCG A;  2HHU A;  4K8X A;  4B9Q A;  3MAQ A;  4JRQ A;  2YJE A;  4I6M A;  1S3X A;  3IMX A;  4IKF A;  4CHY A;  1C1B A;  4BVO A;  1T6C A;  2P9S B;  2W41 A;  3THY B;  1NJY A;  2AJQ A;  5EVZ A;  4Y0W A;  1NG9 A;  1NK7 A;  1RNH A;  3CCJ N;  2XY7 A;  1YF5 L;  3EY1 A;  3PY8 A;  1REV A;  3CMA N;  4B9T A;  1R59 O;  3MX5 A;  1HPM A;  1C1C A;  3O4N A;  4HWI A;  4DU3 A;  3ZT0 A;  3G25 A;  4KH6 A;  5D3G A;  2P9U A;  4BR2 A;  4H0X B;  3VQC A;  3AO1 A;  1YTA A;  4NB4 A;  4E3S A;  4Z4E A;  5AQP A;  4M3X A;  4DTU A;  1JCF A;  2O8F B;  3SQ2 A;  3DAW A;  4FSV A;  4FXD A;  1NJX A;  3WNE A;  1BL3 A;  2OPQ A;  4DSI A;  3VQB A;  5C2F A;  2G8H A;  1BIZ A;  4QCL A;  3ASM A;  3OYM A;  1RDA A;  4FW1 A;  2YNH A;  3R6M A;  4PKH A;  2DFF A;  4JI7 K;  4K8Z A;  2XHB A;  3V9Z A;  1E4F T;  1SKW A;  4BRL A;  3VQ4 A;  4FVU A;  1GLL O;  2RHK A;  2VQF K;  4H0P A;  4RWT A;  1QSS A;  4AHS A;  4DV0 K;  5KPT A;  3DLL L;  3PO4 A;  4PUO A;  2HVI A;  2YX6 A;  4OKK A;  4W5T A;  3TTF A;  3SQ0 A;  4J2A A;  3NVK A;  4KHQ A;  2VCP A;  3IKM A;  2F9W A;  4CJW A;  2BTF A;  3LZJ A;  1IBK K;  4C8M A;  1NBW A;  4BY9 C;  4M3Z A;  3GBT A;  3QFP A;  3TU5 A;  3J80 O;  3W0L A;  4JK8 A;  3QEI A;  3H1Q A;  4HUF A;  3ZEU A;  2IGI A;  3U4L A;  2QXF A;  2QXL A;  3KVG A;  1T8E A;  3RMB A;  3QO9 A;  4FLY A;  2ASM A;  3I33 A;  3NBP A;  3AO3 A;  5AQL A;  4LFB K;  1RFQ A;  3O4Q A;  4HTL A;  1JLG A;  3A2F A;  4K43 A;  2O8E A;  1I39 A;  1RT3 A;  5FDL A;  3DLB A;  4F4K A;  1IO2 A;  4IDH A;  3HJF A;  4W5O A;  1K8A O;  2NZT A;  4JKB A;  4KBO A;  5EX5 A;  3VOV A;  4X64 K;  2JGU A;  1HYS A;  2HMP A;  1HQU A;  5I3U A;  3RRG A;  2UXC K;  4CK2 A;  5ADX A;  4FM1 A;  4DQQ A;  4JI2 K;  3P38 A;  4PKI A;  4HTU A;  3P31 A;  1ZBU A;  4A2A A;  4GV6 A;  4JS5 A;  4FJJ A;  5M1P A;  1NK4 A;  1EWR A;  1JLB A;  1XMO K;  4KHS A;  4DR3 K;  3VGM A;  4NCA A;  4CZK A;  3PV8 A;  2QK9 A;  1XMQ K;  1NKC A;  4I6M B;  4F8R A;  4IJA A;  4WQ5 C;  1TK0 A;  1T6D A;  1O1W A;  3KLG A;  2GTD A;  2RN2 A;  4H0T B;  2J4R A;  1V4S A;  1SV5 A;  3QEP A;  4CJT A;  4YY3 K;  1LOT B;  4PHT X;  2IOC A;  3ID6 A;  3LAK A;  1M90 O;  3WQT A;  2HNY A;  3EO3 A;  5M1O A;  2P9U B;  5E84 A;  4CHN A;  4PKG A;  4M41 A;  3ZYY X;  4OLA A;  4E89 A;  3WXJ A;  3LWM A;  5DK5 A;  5DM7 L;  1L3V A;  4DU1 A;  3T7Z A;  4NXN K;  1NK6 A;  1L3S A; 
#chains in the Genus database with same CATH homology
 1N33 K;  4LF8 K;  4GKK K;  4JI3 K;  4DUY K;  4DV6 K;  4NXM K;  4DR5 K;  1N36 K;  2F4V K;  4LF9 K;  1I94 K;  4DV2 K;  4LFB K;  2UU9 K;  4JYA K;  5LMN K;  4JI0 K;  1N32 K;  5BR8 K;  1N34 K;  4V19 S;  4YHH K;  4X64 K;  4CVN E;  5LMU K;  4X66 K;  4JI4 K;  4LF5 K;  5AJ3 K;  3J7Y P;  2UXC K;  2UXB K;  4DV3 K;  4DR6 K;  4JI2 K;  4B3S K;  4JV5 K;  4OX9 K;  1J5E K;  4JI8 K;  3JAM O;  4NXN K;  1IBL K;  2E5L K;  1XMO K;  4LF7 K;  4DR1 K;  4DV4 K;  4AQY K;  4KHP K;  4DR3 K;  4JI6 K;  5IT9 O;  4DV1 K;  1IBM K;  3T1H K;  1XMQ K;  4DV7 K;  1FJG K;  2UUC K;  4K0K K;  4B3R K;  5IWA K;  5FLX O;  2ZM6 K;  4X62 K;  4DR4 K;  4B3M K;  4JI5 K;  2UUA K;  4LFC K;  4LFA K;  4JI7 K;  4YY3 K;  3OTO K;  3T1Y K;  4DR7 K;  4DUZ K;  3J81 O;  1HR0 K;  4JI1 K;  2VQF K;  4DV0 K;  4LF6 K;  4DR2 K;  1HNZ K;  1XNR K;  3J7A P;  4GKJ K;  4DV5 K;  4CW7 B;  1XNQ K;  2UUB K;  4X65 K;  5A2Q O;  1HNW K;  1HNX K;  5LL6 Z;  2VQE K;  1IBK K;  4B3T K;  2HHH K;  2UXD K;  3J80 O;  4LF4 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...