1HR0K

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1hr0K00
4AQYK 1XNRK 4LF6K 4CW7B 2UU9K 3JAMO 3J7AP 4B3TK 4LF8K 4K0KK 4DR3K 4X62K 4YHHK 3OTOK 2UUCK 4JI1K 4DUYK 4B3RK 4DV2K 4DR5K 4JI6K 5LMUK 4DR7K 1J5EK 5LMNK 4DR4K 1XMOK 1N36K 5FLXO 2UUBK 4JI4K 4GKJK 1I94K 2UUAK 4LF7K 4LF4K 1HR0K 3J80O 4JI7K 5LL6Z 5IT9O 4LFBK 4LF9K 4DR1K 4JI2K 1HNZK 4OX9K 4DV6K 1IBKK 4CVNE 2UXBK 1N34K 4DV0K 4GKKK 5IWAK 2UXCK 4X66K 4B3MK 4NXMK 2HHHK 3J81O 4DR2K 4DV7K 4LF5K 4B3SK 4JI0K 4KHPK 4DV5K 1HNWK 3J7YP 4NXNK 1FJGK 4JYAK 4YY3K 1XMQK 4DV4K 1HNXK 4V19S 2UXDK 5BR8K 2VQFK 1N32K 5A2QO 4JV5K 1IBLK 4LFAK 4DR6K 4JI8K 4DV1K 2F4VK 2VQEK 2ZM6K 4JI5K 4X65K 4JI3K 1N33K 5AJ3K 4DUZK 3T1YK 4DV3K 1IBMK 4X64K 3T1HK 2E5LK 4LFCK 1XNQK
chains in the Genus database with same CATH superfamily
1JXBA 4GVEA 1KD1O 5AQJA 2F8TA 3RMDA 3KIOA 2OZSA 1C0UA 3H3OB 2OZMA 1C1AA 4CGHA 3VGKA 3PX4A 4Z4EA 1REVA 2YHAA 4WQ4C 3HJFA 4O0JA 3HPOA 2OCEA 2XY8A 1W97L 1VSIA 1VQ4N 1T03A 4NO7A 3ITHA 1GLDG 1VQLN 1OH8A 4CEFA 2F9WA 1QVGM 2HMIA 5LMNK 3LDSA 3WNGA 4I9LA 2UUBK 3AVMA 2QEXN 2I7PA 4BRKA 5CZ2A 1NG9A 2YKNA 3HM8A 3QEIA 2EHGA 1U45A 1EQYA 5AQQA 3VQ9A 3OS0A 5EY4A 5GADP 2OTLN 1GLAG 1QHTA 5AQWA 3TABA 2O8CB 3ZSOA 5J2PA 2DTUA 4FJHA 2HSTA 1SZ2A 3D2EB 4RW4A 1VQKN 1WBDA 3CQYA 4QOZB 1U4BA 4BRFA 3QB0A 1HNWK 4RW7A 5AZJA 3TAEA 3S3NA 4FWKA 1JXEA 3ZT3A 3C95A 4BQZA 4YY3K 4I2QA 4W5QA 5BPMA 4FJ9A 1N32K 1L3SA 4CJKA 4DLGA 2X78A 2E2QA 1E4GT 2RKIA 4NCGA 3TTDA 4R79A 3SYZA 4CHZA 3VEOA 4BE2A 3CIPA 4E19A 4X65K 3ZT0A 1OH5A 3VEVA 2HBMA 1WB9A 1KC8O 4BG9A 3J7ZO 2V51B 4MDAA 1BA1A 2ASPA 3QFUA 1S9EA 1C0MA 1RT6A 2RF2A 4DTPA 4LY7A 4H0TB 2O8DA 4Y0WA 3T3FA 5B8HA 3TANA 3K5MA 4BRAA 3VF2A 3W3DA 1BWFO 2HBJA 4AQYK 2KZZA 3GOIA 4DB3A 4AHSA 4CEOA 3U6FA 3LANA 2P51A 2E2OA 3VGMA 1BOTO 1CXUA 5AZIB 2IGIA 4Y1DA 4E7IA 4J2AA 3HRGA 3O8MA 2NRVA 3P4IA 4OGCA 5HL7L 3WUHA 1C1BA 4QS9A 4KAZA 5EXWA 2JLEA 4FWNA 3SPYA 4CK1A 4JKEA 1BO5O 3THWA 5M1KA 4F4KA 3CC7N 3OYCA 3OYEA 4AHCA 2CGJA 3BDPA 4WE1A 1SKSA 2G8WA 4JI7K 3BF1A 5IT9O 3SUNA 4MFBA 1S72N 1IO2A 4DR1K 2R7YA 1NGGA 1OVQA 3MEEA 4M63C 1VQ6N 4JHDA 3CFRA 4A62A 2UXBK 2VGNA 4IDHA 3KKRA 1ZBIA 1I3AA 2QTDA 4X66K 2NRXA 2QWPA 2HHHK 3J81O 4L8RB 1HYSA 5GAHP 4NCAA 1J5OA 1KVCA 4F9OA 5FPEA 1NK8A 2Q1NA 2JGUA 4V19S 3VQ4A 4O8UA 3LP1A 4JKBA 1TAUA 4BR5A 1C0GA 3UKRA 4DSIA 1WBBA 2P9IA 4RW9A 3THXB 2F96A 1QQMA 3ZEUB 2E1YA 2VYPA 4CK3A 1TL3A 3VPZA 4FPBA 1RDBA 4F3TA 1UAXA 5M1NA 4FWSA 4ELTA 4IEEA 4RWTA 4B9QA 3GBTA 3L4QA 3A8YA 1U2VB 2NRRA 4CEEA 2W41A 3LALA 1D5AA 3O5BA 4PL8A 1KLNA 4B9UA 4HVJA 5AQXA 1VQ7N 1S22A 1DKGD 4RTFD 2QKBA 1C0TA 5LJVA 3SBTA 4K42A 5AQKA 5AQZA 3VA0A 3SQ2A 3NH0A 4CHQA 3T1HK 3MECA 5AFUA 4C8OA 1JLAA 4CJLA 3DMJA 2D0PA 2QW9A 4CJTA 3D2EA 3NGIA 3THYA 3D2FB 1S9GA 3AA4A 3DLLL 1IV0A 2ITMA 3CCRN 2GUPA 3AVIA 2O8EA 4H0YB 4E1JA 3ZX2A 4FL9A 4BGBA 1NJXA 5F2RA 3N4QA 5C2DA 2KQ2A 4WF9L 3WQUA 3R8EA 4X62K 3BY5A 1ZBUA 4N76A 2YV0X 4DR5K 3OYAA 1W9HA 4N47A 4HCCA 1N36K 1IKXA 2DFHA 3ZSZA 4CEQA 1NGBA 1G99A 4M3UA 4YOYA 5F1XA 3HSTB 3J80O 1QHAA 3CI5A 2FLOA 3CMAN 3TPQA 4JI2K 4AF1A 3LP0A 5GINA 4OKEA 4WCEL 4FW2A 3OJSA 4DV0K 3DJCA 2A42A 2ZF5O 3CM6A 1IKWA 3C7NA 5AQHA 3HOTA 1ZBFA 3FFIA 3IMXA 2ZQBA 5BREA 4DCHA 1NK7A 5LJWA 2O8FB 1HNXK 1QQCA 2ZJRL 3AVLA 1KQSM 4JKFA 4O55A 1KAZA 2VWJA 3V81A 1XHXA 4WQ4A 5AQMA 3ATVA 4L3QA 3OS2A 1FKPA 3L2UA 3DLKA 3SZ2A 2NRHA 2IC3A 3VTHA 3IUCA 1ATSA 2WTUA 1BA0A 4OO1J 2BTFA 3PSFA 1OKJA 4ID1A 2OPRA 3ULEA 4DMNA 4CZGA 4BRGA 4E1MA 2B6AA 3VQ6A 2HW3A 3DYAA 1L5UA 5KPTA 4YOXA 1S6QA 4B08A 3NHGA 3HM9A 4CJSA 1NBWA 4M3YA 4LSNA 4FJ7A 1J53A 3KWIA 4JD2B 1QQNA 4IKFA 3H46O 4EZ9A 4UY8O 4CD1A 4CHYA 5C0YA 5KGWA 3PO5A 4N41A 2AP1A 4JKCA 2IIRA 1S6PA 4IG0A 3MN7A 1ASWA 4CZKA 1NJIO 3EE8A 1R59O 3WEEB 1NJWA 3LWMA 1NK5A 3PX0A 2FSNA 2OTJN 3PV8A 4F2RA 4J2DA 1BU6O 4DU3A 5C25A 1KXPA 2HB5A 4FJLA 2QWRA 5E41A 3KK3A 4Z0UA 4C1NK 4FSVA 4W5NA 3ENBA 5BRFA 1N8RO 5BN9A 4BRHA 4A2BA 4ELVA 3I33A 1N34K 1RT5A 1J6ZA 5IWAK 5FROA 1BG3A 4BE0A 4YNQA 3NCIA 4OLAA 3U9ZA 3ISNC 4B3SK 3CPEA 2O4IA 4DG1A 1KLMA 2O8BB 5D3GA 3KZBA 3VQCA 4CZJA 4DQSA 5C24A 4H0XB 2FBXA 3HBTA 2ZGZA 3ENHA 5E84A 3D2FA 3MXMA 3HOSA 3F5TA 1EETA 2WOMA 4CHNA 3I56N 4K25A 5DK5A 4GVMA 4JS4A 1JCGA 4FJKA 1BIZA 2HF3A 5JVGL 4H03B 4O5FA 5F0XA 3KLEA 4DQRA 3TARA 1U47A 2RN2A 1BUPA 1QTMA 2PYJA 1Q18A 1V4TA 4FW1A 2KFZA 1TVRA 4K41A 4JD2A 3AO1A 3L8BA 4BACA 5HRSA 3VF6A 3TSQA 5KI6A 4AHRA 3KLHA 1XNRK 2X6SA 3D0PA 1BGXT 4LF6K 3A0IX 4CGJA 5EVZA 3W0LA 4CW7B 3CCEN 5BPNA 3HZ6A 4FO0A 4CJWA 4ZTJA 2XY7A 3WXKA 3M8PA 4DUYK 4YOVA 1IKVA 3RSEB 4DV2K 3O9QA 3EYZA 3HO1A 2P9SB 2HNDA 3C65A 1NK4A 3THWB 4KRFA 3M8RA 3HL8A 4IJNA 5KQ8A 4JS5A 1U48A 4FVMA 3QO9A 4LF4K 2VG7A 3WNFA 2YNHA 4FZYA 4CHPA 3PIOL 1VQPN 2G8FA 4FM1A 1T05A 3HXMA 1VQNN 4BR0A 3ULEB 2W6LA 4BRDA 1EWRA 3O3GA 3MX2A 3H1QA 2UYTA 4DR2K 4KHUA 2P9NB 1LAVA 1TKDA 2GWKA 4DV5K 4E7LA 1TYQA 3IAYA 1YJ9N 5KQDA 4OGEA 4BWJA 5FPDA 4QS7A 2QKKA 3CQXA 4OPHA 3V9ZA 4BDZA 5JLFA 2P9PB 3O4NA 2YHYA 4JV5K 2O8CA 1RDCA 2VWKA 4KHNA 2P9IB 4CZFA 4LFAK 4DR6K 4FK0A 1VSKA 2Y1JA 1LW0A 1O1WA 3F9MA 3ZX3A 2FBTA 3THVA 3CJBA 4FJ5A 1RT2A 3HI0A 4O4GA 3E9PA 4CESA 3ZEUA 2D0AA 4DTOA 1CLQA 3DLBA 3V6DA 4JRQA 3RR7A 3FZKA 1NGCA 4HTUA 4KI6A 1HJRA 5BN8A 1DT9A 2HNYA 3PLAA 2NRZA 3J8AA 3F9KA 4HTLA 3OYBA 3CMEN 3ZSWA 1NM1A 2FXUA 4CEZA 4CBUA 1NKEA 3HT3A 3MN9A 3SUQA 3CD6N 2HHQA 2HVHA 3AO4A 2ZJQL 1Z26A 3VQ5A 4KHWA 3VQPA 4TSXA 3V9XA 3NH2A 4KPYA 4DF8A 3M3ZA 1ZC6A 2UU9K 2QWOA 5HBMA 2I7NA 3HVTA 5BRHA 1ITGA 3AARA 2Y1IA 2FBYA 2Q0RA 1Y64A 3QMLA 5BPLA 3I55N 1YJNN 1Q9XA 1RILA 1WSGA 4B9VA 1RBRA 3NF6A 4F8RA 4PY5A 1IKYA 2IVNA 1R0AA 3NH1A 1BISA 4CBWA 4B8CA 4JKDA 1OH6A 4BREA 3QDKA 5FRMA 4B1WB 2NLXA 4B9TA 3N4PA 3QICA 1FK9A 1GLFO 1HQEA 1VRUA 4NXMK 4DV7K 1MWKA 3VERA 5HRNA 3G4SN 3DI6A 1YJWN 4E0DA 4A59A 1VRTA 2IOCA 3QFPA 4DQPA 1NMDA 1OVYA 4H0VB 4DTNA 1VAZA 5TKWA 1Q86O 3AV9A 2AA4A 4JKAA 1ZBLA 1MWMA 3OHRA 3NE6A 3E66A 3OW2M 1QVFM 3PO4A 2A3ZA 2V7YA 2WC9A 4JKHA 4H4OA 1BL3A 5TKYA 4I7FA 3M8SA 1NOYA 4KKOA 3P5JA 3S41A 2PAVA 5AQFA 5J2NA 1YIJN 1HQUA 4WQ5A 2PZSA 3S3MA 3TAGA 4IWVA 1B9FA 2OA8A 1K8AO 3BZCA 1QSSA 3K5NA 3CETA 1KAXA 3KJVA 5CZ1A 4BWMA 1N6QA 1YAGA 3PIPL 3L6QA 4FM2A 2Z1HA 2WUSA 3S3OA 4FK4A 1HNIA 3NF9A 3M8QA 3LDNA 1JKHA 4EAHD 4M3WA 3CXCM 5I42A 2E8AA 3TTFA 1B92A 4IOCL 2P9NA 4FLZA 1HKCA 3KK1A 4E3SA 1YHQN 4WYBA 2D1KA 2GELA 4KFBA 5JS1A 4IG3A 4G9ZA 4B1VA 3C6UA 3VGLA 4MDBA 3R3LA 3CERA 3SI6A 4Z4GA 2P5GA 4N56A 1DGKN 5AQVA 1VQMN 3D45A 5GAEP 5C12A 1UWBA 4LF5K 5ADXA 2YKMA 2V7ZA 4BROA 4C23A 3RRHA 1NGJA 3SQ0A 1ATNA 3HPGA 2G8UA 3BP8A 2B5JA 4NXNK 4O8KA 4K43A 4HWIA 5AQOA 2E88A 1CZ9A 5FRNA 4DTMA 4XIUA 3EKSA 4ISGA 1BIUA 4FK2A 1IG8A 4FJ8A 3I8DA 1K73O 3V9SA 4CGGA 3OYDA 2ETJA 2E4LA 4H5NA 3T7ZA 4JRPA 4BRQA 1N33K 3OS1A 1IJJA 1J54A 2XY5A 3T1YK 2P9UB 3H6EA 4M41A 1VSHA 2OPQA 2RHKA 3KK2A 3MWPA 1IBMK 1S1VA 4X64K 3G25A 5JS2A 4CJRA 3SUPA 3CYMA 4CZLA 3CC4N 1WSFA 3T1AA 2G8IA 2VG6A 3VTIA 1VSJA 4KHQA 2A41A 3MCAB 3VETA 3EE9A 1RDWX 4B3TK 4LF8K 1TGOA 3CCMN 2VG5A 1HUXA 3OTOK 4CFAA 2BE2A 1IG9A 3DAWA 4ID5A 3C6HA 4B8AB 4B9SA 5K14A 3A5NC 1GLJO 3EKUA 3IDHA 4IFVA 3AAQA 5CY4A 3O3FA 5LMUK 3OYIA 1J5EK 1KVAA 1DLOA 1VSDA 3OBWA 1B9DA 4JI4K 4WFNL 1BQNA 1SS6A 2UUAK 5BRDA 3FLCO 2QI2A 4LFBK 3AVGA 4EIAA 1D9DA 4GW6A 3OYNA 4HHTA 4BRNA 3ID8A 3G0ZA 1RBVA 2HHSA 3BGRA 3SLCA 2UXCK 2WONA 3MK6A 4WQ5C 3AA5X 1FXXA 1U6ZA 3OJUA 3K9JA 4I6MB 2B4JA 4DTRA 3J7YP 1YTUA 3JSMA 3H1VX 2ZWHA 5JVHL 4DV4K 4DSFA 1K8KA 4Z4IA 2GTDA 5J1EA 3OYHA 3EN9A 4Z4FA 2XRIA 1HRHA 4PA1A 1ASVA 2E6LA 1YUWA 2HBLA 3HP6A 4KHSA 4CF9A 1L3VA 4DTSA 4BR4A 1UA1A 3C94A 4CJ7A 4FLWA 2A5XA 4FWOA 3M6GA 1JLFA 4XH4A 2HHXA 3A5LC 1RTHA 4EZ6A 3KHYA 4CZEA 4PQUA 3I8BA 2D4WA 2YHBA 1SAZA 2YCHA 3L4IA 5HRPA 1XI1A 4DV3K 3V1RA 4J2EA 3DXKB 1D4XA 3JXUA 3RWUA 3EO3A 3NGZA 4IXCA 1RTJA 3AA2A 3V1OA 1LWFA 4I9QA 3C6AA 1XUPO 4KH6A 1EP4A 4CF2A 2W42A 1NKBA 4CECA 3MCPA 5C2FA 1BCMA 4AHTA 1TUUA 1C1CA 1Q8IA 4K0KK 4CIEA 1C6VA 5CYMA 3TAPA 5KGXA 1Q81O 1DEJA 4DU4A 5H1SQ 1YVUA 1OH7A 4JI6K 4ILGB 3QINA 2G8VA 2PFUA 2YHWA 3AVKA 1MDUB 4QS8A 5AZJB 1P8ZA 4DLEA 4GV3A 2QWQA 4RW8A 4NYNA 1LW2A 3LDPA 3OY9A 3VQEA 3ZETA 3CJ1A 4CJEA 5CYQA 4GV6A 1ZYQA 4BC5A 1NK0A 3PUFA 1WAFA 4KHPK 4CEBA 3LZIA 1KRPA 4DTXA 3SBGA 3QESA 4CZHA 2F8SA 4NYFA 3AO2A 4CF1A 4DQ8A 3L0QA 5GIPA 4AHVA 2QXLA 3ATUA 4DSLA 4MQ3A 1VQ9N 4A61A 4H8KA 4DV1K 1G15A 5M1PA 1S1UA 2EX3A 2YNGA 2F4VK 1NGIA 2VQEK 3MEDA 4CJFA 3BUZB 2A6AA 1TK8A 4O44A 1JLGA 4JI3K 1QSLA 4OLBA 3HTVA 4A57A 4M42A 1RBUA 2PBDA 4DWIA 4LD0A 5GAGP 4W5RA 4JKGB 5EU7A 4C8MA 3NBPA 2HHUA 2KW4A 4IZ9A 5AR0A 3FZHA 3JS6A 1A5VA 2E20A 2ZGYA 3MWTA 3FGUA 3AVCA 4GNIA 3VEYA 3CF5L 1TAQA 3QETA 3UKUB 2Q2RA 4FOEA 3QNNA 1Q82O 5AFUH 4CIGA 1ILYA 4G1QA 4B9MA 1NLVA 1U04A 3CJAA 4YDUA 1WUAA 4AM7A 4JEPA 4BE1A 4XH1A 3VESA 3K2PA 3JAMO 4KB1A 1NJZA 4B9LA 3NVKA 3OYFA 4E1NA 1TKTA 3E01A 3SAGA 4JI1K 2FF3B 3IS9A 2HOEA 4B3RK 4DF4A 4FWMA 3LWLA 1VK0A 4JLHA 2BANA 4KB0A 4YOWA 3BEXA 4KREA 1HPMA 4DQQA 4DU1A 1ZBHA 1I94K 4LF7K 1FW6A 4LF9K 2HF4A 3KK7A 3O9UA 4CF8A 1ASUA 3DRRA 3GE1A 3L2RA 3SV4A 1JCEA 3AGRA 2GX9A 1IH7A 2D0BA 3O80A 2V52B 3RVCA 3AA3A 4MLHA 3TU5A 2NZTA 3VQQA 1CXQA 4H4MA 1NWKA 1JLQA 2FF6A 2JWLA 4KHYA 3VEWA 1U49A 1W2BM 3CFPA 1QZ5A 4OPAA 3ZSVA 2UXDK 4IBNA 3AVNA 3B6OA 3ZLJA 4DSJA 1D8YA 2ZJPL 1BHLA 2QM1A 4BDPA 4H0OA 3WXIA 3K58A 2ITGA 3D7EO 3UIQA 4AH9A 3EZWA 4JI5K 4JK8A 3RSEA 3VA3A 3OYKA 3WXLA 5AJ3K 3P83D 3UKRB 1SL1A 4KBOA 2DY4A 3TI0A 4OKJA 1QE1A 1CZAN 2D5RA 5CHIA 4YFUA 3M1FA 3VQ8A 3CPWM 4CBXA 1VSMA 3CCLN 1RTIA 4FLUA 1NGHA 4CE9A 3B8AX 3CCSN 4BRLA 5C42A 4GV9A 1BCOA 4NLCA 3ASMA 4HUGA 3I0RA 3K5OA 2YHXA 1YTAA 3TWHA 3LP2A 4CJ4A 3VENA 2Q36A 3H3NO 4ELUA 3VQAA 2OPSA 2IVPA 4BVPA 4NCBA 1I39A 3AVBA 4GY2B 2P9PA 4BRIA 1JLCA 2BH1A 4BR7A 4YOTA 3JYTA 3KLGA 4C8LA 3G10A 3KVGA 1XMOK 4DR4K 3ZSYA 3MXIA 3LM2A 1SKRA 2W40A 4Q5VA 4OPKA 2XY6A 3V4IA 3U9DA 1CZBA 4XEIA 1HYVA 4CGIA 1SUQA 1GOAA 3LDQA 1X1PA 1DTTA 1NOZA 1WNSA 4IFYA 3DWLA 4WFBL 2LSNA 3ENOA 4YOUA 4GKKK 2VWBA 1ZXOA 3DOLA 4B3MK 3A2FA 4KTQA 4HUFA 3FR0A 3UE5A 4JNEA 5JICA 1KVBA 1RT7A 3VQBA 4Y1CA 1GLCG 1TV6A 3SQ1A 3PX6A 5DM6L 3SMSA 4CFDA 4KO0A 4LC9B 5BR8K 2NNWA 2HHTA 1JL1A 3O4QA 1C0FA 4CJ5A 4M3RA 4PKHA 5FPNA 4I6MA 5ADXH 3TSPA 5AQYA 4Z94A 3LPUA 2X6NA 1RBSA 2QWLA 3QIOA 4IJAA 3KLFA 1ZBSA 2ZM6K 2OYQA 4B1YB 5AQRA 3OYJA 3NAEA 4A5BA 4BG8A 4KV8A 4DTUA 2D0OA 3S9HA 2QK9A 3F2KA 3R1XA 3ULDA 4DUZK 3SCXA 4RCHA 3GG4A 3LDOA 2DPNA 3WEEA 2O8EB 1K6YA 1TK5A 3VQDA 4PHTX 1D9FA 1QSYA 5HOOA 4IO9L 1H1VA 5SWMA 3QEWA 1KCFA 2YNFA 3BZKA 4CZMA 3DM2A 5AQIA 3T19A 1WAJA 3NVMA 3ZSQA 4EHUA 3QERA 2HHVA 2CGKA 3KD5E 3H08A 4DTJA 2EWSA 5KPRA 4MLEA 4B9NA 2E1ZA 4DKWA 3GL1A 3OYMA 3VEXA 1BQMA 5C10A 1YT3A 3U4LA 2HBKA 4FYDA 3AO5A 3DRPA 1VHXA 2Q0UA 3RMBA 3KD1E 2NRWA 4M3XA 4U7BA 4BY9C 2JWKA 1XQSC 5LL6Z 2BDPA 4OVLA 4Z4CA 3O9RA 4FWPA 2P9SA 1YXQA 5J2MA 2IVOA 3IG1A 3GDQA 1SQKA 2GUIA 4C8KA 1JL2A 3TAFA 3K0SA 3HPHA 3LDLA 1HYZA 3HK2A 3V9UA 4IO8A 4MO4A 4EP5A 3NMUA 1S1TA 1XC3A 3HSCA 5EOYA 1RDAA 5LY3A 4J2BA 3EL2A 3CJ9A 4IOAL 4BC4A 4OKKA 1Y97A 3MMVA 3DXMA 3TAMA 3RMCA 5AQNA 2YX6A 2WBNA 3L3UA 3P38A 4FWRA 1TK0A 3L2VA 1KFDA 3O1BA 3Q7BA 3VEZA 5ELZA 5AQPA 4FPAA 3CCJN 3O4WA 1NGDA 4FXDA 4O5BA 1JLBA 1V4SA 4JHDB 1KAYA 1S5JA 1K8KB 1SKWA 3AGKA 3PSIA 4KTZA 1WSHA 3FZFA 3I0SA 2FBVA 1Z6RA 3MEGA 2FSKA 2P9LA 5C15A 3OYLA 2E5LK 5SZTA 3QEXA 1RBTA 2ZE2A 3DLGA 2VGMA 1RTDA 1TL1A 3SAHA 1RNHA 3THXA 2G8HA 3KLIA 5AQLA 4FLTA 5GIOA 4F2SA 1HNVA 3AAPA 4O0IA 3ZT4A 1RCHA 3IRXA 4PL7A 4CJPA 4CJUA 3SMPA 3WQTA 3MDQA 3OVNA 3DXKA 1SV5A 4AILC 5HROA 4DSKA 4YHHK 2IAJA 1KSPA 4NLBA 3CJCA 4M7XA 4LSLA 1NMNA 4CIFA 1BDGA 3FZLA 1HJOA 3MX5A 4CZIA 1NNEA 4GKJK 4E7KA 1J9AA 3CM5A 2XO7A 4DFJA 2HHWA 1TYQB 3O08A 3O9TA 3SQ4A 3A5OC 3ID6A 4DS4A 4W5OA 5KPZA 3EY1A 1LWCA 4CVNE 4CK2A 1ESVA 1FKOA 1A5WA 5FPMA 4U67L 3MAQA 3QNOA 4ZTFA 4LH5A 3AY9A 3THYB 4ILJA 3V9WA 4FJIA 2YNIA 2E2PA 1WSEA 5CR4A 1WLJA 1RT1A 1XWLA 3KKSA 4FJMA 4JYAK 1XMQK 3DXMB 2ATQA 1LAWA 5M1FA 1X9MA 5AQGA 3ZETB 1IBLK 4OPJA 1T7PA 2P9KA 2VCPA 3L3VA 1KTQA 3ZSRA 4BRPA 4RG8A 3LPTA 2Z1GA 4NB4A 2XHBA 4J8FA 5BR9A 2CGLA 4ISFA 5CE3A 1HX1A 3QEVA 1M90O 4DFKA 5DM7L 4BRMA 4CFBA 2FSJA 3O9SA 2DFFA 4H5VA 4FLXA 4CERA 4KH4A 1LV5A 4KI4A 3PY8A 5M1OA 2Q31A 4BR2A 3WNEA 2IDOA 3F73A 1Q7YO 3O3HA 1T44A 1XNQK 3SUOA 1GOCA 1T3VA 3DOKA 4IEIA 1NGFA 1X9JA 3SK3A 4JK7A 5MLCQ 3CFOA 4FLYA 3FFKB 3SNNA 3NGYA 1E3MA 4JKGA 5I9EB 2OPPA 1Z25A 3WXJA 4KH5A 4IDKA 3KTQA 4A5AA 4CF0A 1RT4A 4YDUC 4E7HA 1EXQA 1L3UA 2AJQA 2P5OA 4DS5A 1RT3A 4H5RA 3P1GA 3UKUA 4OJRA 3E1YA 4DR7K 4BC3A 4WFAL 5FLXO 5HLFA 4ISEA 4BRCA 1RDDA 4A2AA 2QA4N 1X9WA 3SV3A 4FZZA 4FJNA 1UOCA 2DFEA 1XHZA 4DFMA 4B1ZA 1Z05A 4DHYA 1VQ5N 1JLEA 4ICLA 4HUEA 1NK9A 1IBKK 5JMVA 1BI4A 3FE1A 1HKGA 2PY5A 4DFPA 1S3XA 2NUBA 4FOIA 3CCQN 4B1UB 3VN5A 3HVRA 3CCVN 3CJ7A 4BQLA 4CI6A 4M3ZA 5KRSA 3RRGA 4EP4A 1K9MO 3D6RA 3V1QA 2QWNA 2E2NA 2G8KA 2VQFK 2CH6A 3WT0A 2HMPA 2F9TA 1LWEA 2QXFA 4K8XA 1LOTB 4JI8K 2GV9A 5EX5A 5J2QA 3SJHA 1WSIA 4CEAA 1RGIA 4B3OA 3KWGA 1LCUA 3CHWA 4FLVA 4FVUA 3LZJA 3H45C 1RDUA 4F3OA 2HNZA 2GBZA 3VF4A 2KLAA 2YI1A 4DQIA 1YF5L 2PYLA 1W7AA 2HVIA 1TUYA 3MN5A 1EKEA 1MA9B 3RMAA 3U3GA 5AZIA 3K57A 4CGFA 1P90A 3QIPA 1RFQA 3B6PA 1WN7A 3EZ5A 3G6EN 1QQOA 5FDLA 5E26A 3ALYA 2YJFA 3CC2N 2BGGA 3ZCMA 1UA0A 5AQUA 2P1JA 2ASOA 3AO3A 3A5MC 4HCBA 4FWLA 3E9OA 3J7AP 2F7TA 3CG7A 3OA9A 3LAMA 2UUCK 4EFHA 3SJJA 2RE2A 3R6MA 2OANA 1VQON 3SAFA 4FZXC 3NF7A 4BDYA 2P9KB 2ZD1A 2KTQA 1TKXA 1GOBA 1TKZA 3C7NB 1HR0K 3K5LA 2O4GA 2O8FA 4W5TA 1BI4B 3TAQA 3CCUN 1A5XA 3OYGA 1T6DA 1KFSA 3L2WA 3RR8A 1ATRA 1VSFA 3ZX0A 1EO1A 4PKIA 4ILHA 4AM6A 4E7JA 4DSEA 4FWQA 1QZ6A 4M7YA 1U2VA 4C1NI 3ZT1A 1YI2N 4E89A 2J4RA 3U3YA 1S1XA 3O6WA 4FCYA 2BUPA 3LL3A 4M3TA 3EEQA 4JK9A 3G71N 4FJGA 2H3GX 4FJJA 5M1QA 2Z1JA 3ZT2A 4LH4A 4QAGA 2KZMA 4MO5A 3OBYA 2ASMA 2YJEA 4IFEA 3Q7CA 2NRTA 2A1SA 3QBWA 2FC0A 1S1WA 3ZSXA 1L3TA 4CJ3A 1XC9A 1X3NA 3SPZA 2WFBA 3DLHA 4CCHA 4XH5A 4BC2A 3NDKA 4PUOA 4H5WA 1NU0A 1N5YA 3R9PA 3UB5A 4JN4A 3U8XA 3LP3A 4PWDA 1NGAA 3NF8A 3DLRA 4RW6A 2GWJA 3L2QA 2KFNA 3M5RA 4IOXA 3DLEA 4H0PA 3RTVA 2KHOA 3MXJA 4K8ZA 3IKMA 2P9LB 2Z1IA 5AQSA 5I3UA 3TR8A 1EX4A 1GLEG 4JAXA 4DR3K 1WSJA 5KRTA 4UQGA 5KTQA 4CJQA 3BF3A 4H5TA 4R5PA 4YORA 3WNHA 1E4FT 1O13A 5HP1A 1YITN 2A40A 3HP9A 1SL0A 3LM9A 3K59A 4GMJB 1VSLA 5T7BA 1HMVA 4BGAA 1NGEA 2O8BA 3DRSA 1VQ8N 1F21A 4C8NA 1YVNA 1JJ2M 2E6MA 1HNZK 4OX9K 4DV6K 4I2PA 3WXMB 1HPZA 3E9LA 4Q0BA 1MU2A 1QS4A 1W0HA 3LAKA 1HKBA 1SL2A 5DMRA 4EHTA 4PKGA 2RPIA 3QEPA 5HRRA 4JI0K 3FZMA 3C0BA 4CFCA 4FJXA 3AVHA 1NJYA 2Q3SA 2KKZA 4M45A 2CH5A 3T69A 1FJGK 4BR9A 5JLHA 2GEMA 5A2QO 4Z4HA 1T6CA 3K9KA 1GLLO 1T8EA 3C6TA 4CEDA 4AHUA 3NFAA 1JCFA 2P9UA 1NKCA 1DTQA 3QLHA 2X74A 1GLBG 2D0CA 1VSEA 3VOVA 4CJVA 5AQTA 1X9SA 1Q9YA 3O1WA 2A1RA 3ZYYX 1NK6A 3IFRA 2I5JA 3TSUA 4CGDA 1X3MA 3AVAA 1M1KO 1WOQA 1EWQA 3TTCA 4CHOA 2IS3A 4QCLA 4FM0A 3MN6A 3AVJA 4B1XB 4ZHRA 1HLUA 3P39A 3CQ8A 4CD3A 4BVOA 3HYFA 2Q97A 2O8DB 4LFCK 3AVFA 2QWMA 4N5SA 3VQ7A 3VMFB 2W6KA 3P31A 4KTWA 3QBXA
chains in the Genus database with same CATH topology
4AQYK 1XNRK 4LF6K 4CW7B 2UU9K 3JAMO 3J7AP 4B3TK 4LF8K 4K0KK 4DR3K 4X62K 4YHHK 3OTOK 2UUCK 4JI1K 4DUYK 4B3RK 4DV2K 4DR5K 4JI6K 5LMUK 4DR7K 1J5EK 5LMNK 4DR4K 1XMOK 1N36K 5FLXO 2UUBK 4JI4K 4GKJK 1I94K 2UUAK 4LF7K 4LF4K 1HR0K 3J80O 4JI7K 5LL6Z 5IT9O 4LFBK 4LF9K 4DR1K 4JI2K 1HNZK 4OX9K 4DV6K 1IBKK 4CVNE 2UXBK 1N34K 4DV0K 4GKKK 5IWAK 2UXCK 4X66K 4B3MK 4NXMK 2HHHK 3J81O 4DR2K 4DV7K 4LF5K 4B3SK 4JI0K 4KHPK 4DV5K 1HNWK 3J7YP 4NXNK 1FJGK 4JYAK 4YY3K 1XMQK 4DV4K 1HNXK 4V19S 2UXDK 5BR8K 2VQFK 1N32K 5A2QO 4JV5K 1IBLK 4LFAK 4DR6K 4JI8K 4DV1K 2F4VK 2VQEK 2ZM6K 4JI5K 4X65K 4JI3K 1N33K 5AJ3K 4DUZK 3T1YK 4DV3K 1IBMK 4X64K 3T1HK 2E5LK 4LFCK 1XNQK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY K;  1XNR K;  4LF6 K;  4CW7 B;  2UU9 K;  3JAM O;  3J7A P;  4B3T K;  4LF8 K;  4K0K K;  4DR3 K;  4X62 K;  4YHH K;  3OTO K;  2UUC K;  4JI1 K;  4DUY K;  4B3R K;  4DV2 K;  4DR5 K;  4JI6 K;  5LMU K;  4DR7 K;  1J5E K;  5LMN K;  4DR4 K;  1XMO K;  1N36 K;  5FLX O;  2UUB K;  4JI4 K;  4GKJ K;  1I94 K;  2UUA K;  4LF7 K;  4LF4 K;  1HR0 K;  3J80 O;  4JI7 K;  5LL6 Z;  5IT9 O;  4LFB K;  4LF9 K;  4DR1 K;  4JI2 K;  1HNZ K;  4OX9 K;  4DV6 K;  1IBK K;  4CVN E;  2UXB K;  1N34 K;  4DV0 K;  4GKK K;  5IWA K;  2UXC K;  4X66 K;  4B3M K;  4NXM K;  2HHH K;  3J81 O;  4DR2 K;  4DV7 K;  4LF5 K;  4B3S K;  4JI0 K;  4KHP K;  4DV5 K;  1HNW K;  3J7Y P;  4NXN K;  1FJG K;  4JYA K;  4YY3 K;  1XMQ K;  4DV4 K;  1HNX K;  4V19 S;  2UXD K;  5BR8 K;  2VQF K;  1N32 K;  5A2Q O;  4JV5 K;  1IBL K;  4LFA K;  4DR6 K;  4JI8 K;  4DV1 K;  2F4V K;  2VQE K;  2ZM6 K;  4JI5 K;  4X65 K;  4JI3 K;  1N33 K;  5AJ3 K;  4DUZ K;  3T1Y K;  4DV3 K;  1IBM K;  4X64 K;  3T1H K;  2E5L K;  4LFC K;  1XNQ K; 
#chains in the Genus database with same CATH topology
 1JXB A;  4GVE A;  1KD1 O;  5AQJ A;  2F8T A;  3RMD A;  3KIO A;  2OZS A;  1C0U A;  3H3O B;  2OZM A;  1C1A A;  4CGH A;  3VGK A;  3PX4 A;  4Z4E A;  1REV A;  2YHA A;  4WQ4 C;  3HJF A;  4O0J A;  3HPO A;  2OCE A;  2XY8 A;  1W97 L;  1VSI A;  1VQ4 N;  1T03 A;  4NO7 A;  3ITH A;  1GLD G;  1VQL N;  1OH8 A;  4CEF A;  2F9W A;  1QVG M;  2HMI A;  5LMN K;  3LDS A;  3WNG A;  4I9L A;  2UUB K;  3AVM A;  2QEX N;  2I7P A;  4BRK A;  5CZ2 A;  1NG9 A;  2YKN A;  3HM8 A;  3QEI A;  2EHG A;  1U45 A;  1EQY A;  5AQQ A;  3VQ9 A;  3OS0 A;  5EY4 A;  5GAD P;  2OTL N;  1GLA G;  1QHT A;  5AQW A;  3TAB A;  2O8C B;  3ZSO A;  5J2P A;  2DTU A;  4FJH A;  2HST A;  1SZ2 A;  3D2E B;  4RW4 A;  1VQK N;  1WBD A;  3CQY A;  4QOZ B;  1U4B A;  4BRF A;  3QB0 A;  1HNW K;  4RW7 A;  5AZJ A;  3TAE A;  3S3N A;  4FWK A;  1JXE A;  3ZT3 A;  3C95 A;  4BQZ A;  4YY3 K;  4I2Q A;  4W5Q A;  5BPM A;  4FJ9 A;  1N32 K;  1L3S A;  4CJK A;  4DLG A;  2X78 A;  2E2Q A;  1E4G T;  2RKI A;  4NCG A;  3TTD A;  4R79 A;  3SYZ A;  4CHZ A;  3VEO A;  4BE2 A;  3CIP A;  4E19 A;  4X65 K;  3ZT0 A;  1OH5 A;  3VEV A;  2HBM A;  1WB9 A;  1KC8 O;  4BG9 A;  3J7Z O;  2V51 B;  4MDA A;  1BA1 A;  2ASP A;  3QFU A;  1S9E A;  1C0M A;  1RT6 A;  2RF2 A;  4DTP A;  4LY7 A;  4H0T B;  2O8D A;  4Y0W A;  3T3F A;  5B8H A;  3TAN A;  3K5M A;  4BRA A;  3VF2 A;  3W3D A;  1BWF O;  2HBJ A;  4AQY K;  2KZZ A;  3GOI A;  4DB3 A;  4AHS A;  4CEO A;  3U6F A;  3LAN A;  2P51 A;  2E2O A;  3VGM A;  1BOT O;  1CXU A;  5AZI B;  2IGI A;  4Y1D A;  4E7I A;  4J2A A;  3HRG A;  3O8M A;  2NRV A;  3P4I A;  4OGC A;  5HL7 L;  3WUH A;  1C1B A;  4QS9 A;  4KAZ A;  5EXW A;  2JLE A;  4FWN A;  3SPY A;  4CK1 A;  4JKE A;  1BO5 O;  3THW A;  5M1K A;  4F4K A;  3CC7 N;  3OYC A;  3OYE A;  4AHC A;  2CGJ A;  3BDP A;  4WE1 A;  1SKS A;  2G8W A;  4JI7 K;  3BF1 A;  5IT9 O;  3SUN A;  4MFB A;  1S72 N;  1IO2 A;  4DR1 K;  2R7Y A;  1NGG A;  1OVQ A;  3MEE A;  4M63 C;  1VQ6 N;  4JHD A;  3CFR A;  4A62 A;  2UXB K;  2VGN A;  4IDH A;  3KKR A;  1ZBI A;  1I3A A;  2QTD A;  4X66 K;  2NRX A;  2QWP A;  2HHH K;  3J81 O;  4L8R B;  1HYS A;  5GAH P;  4NCA A;  1J5O A;  1KVC A;  4F9O A;  5FPE A;  1NK8 A;  2Q1N A;  2JGU A;  4V19 S;  3VQ4 A;  4O8U A;  3LP1 A;  4JKB A;  1TAU A;  4BR5 A;  1C0G A;  3UKR A;  4DSI A;  1WBB A;  2P9I A;  4RW9 A;  3THX B;  2F96 A;  1QQM A;  3ZEU B;  2E1Y A;  2VYP A;  4CK3 A;  1TL3 A;  3VPZ A;  4FPB A;  1RDB A;  4F3T A;  1UAX A;  5M1N A;  4FWS A;  4ELT A;  4IEE A;  4RWT A;  4B9Q A;  3GBT A;  3L4Q A;  3A8Y A;  1U2V B;  2NRR A;  4CEE A;  2W41 A;  3LAL A;  1D5A A;  3O5B A;  4PL8 A;  1KLN A;  4B9U A;  4HVJ A;  5AQX A;  1VQ7 N;  1S22 A;  1DKG D;  4RTF D;  2QKB A;  1C0T A;  5LJV A;  3SBT A;  4K42 A;  5AQK A;  5AQZ A;  3VA0 A;  3SQ2 A;  3NH0 A;  4CHQ A;  3T1H K;  3MEC A;  5AFU A;  4C8O A;  1JLA A;  4CJL A;  3DMJ A;  2D0P A;  2QW9 A;  4CJT A;  3D2E A;  3NGI A;  3THY A;  3D2F B;  1S9G A;  3AA4 A;  3DLL L;  1IV0 A;  2ITM A;  3CCR N;  2GUP A;  3AVI A;  2O8E A;  4H0Y B;  4E1J A;  3ZX2 A;  4FL9 A;  4BGB A;  1NJX A;  5F2R A;  3N4Q A;  5C2D A;  2KQ2 A;  4WF9 L;  3WQU A;  3R8E A;  4X62 K;  3BY5 A;  1ZBU A;  4N76 A;  2YV0 X;  4DR5 K;  3OYA A;  1W9H A;  4N47 A;  4HCC A;  1N36 K;  1IKX A;  2DFH A;  3ZSZ A;  4CEQ A;  1NGB A;  1G99 A;  4M3U A;  4YOY A;  5F1X A;  3HST B;  3J80 O;  1QHA A;  3CI5 A;  2FLO A;  3CMA N;  3TPQ A;  4JI2 K;  4AF1 A;  3LP0 A;  5GIN A;  4OKE A;  4WCE L;  4FW2 A;  3OJS A;  4DV0 K;  3DJC A;  2A42 A;  2ZF5 O;  3CM6 A;  1IKW A;  3C7N A;  5AQH A;  3HOT A;  1ZBF A;  3FFI A;  3IMX A;  2ZQB A;  5BRE A;  4DCH A;  1NK7 A;  5LJW A;  2O8F B;  1HNX K;  1QQC A;  2ZJR L;  3AVL A;  1KQS M;  4JKF A;  4O55 A;  1KAZ A;  2VWJ A;  3V81 A;  1XHX A;  4WQ4 A;  5AQM A;  3ATV A;  4L3Q A;  3OS2 A;  1FKP A;  3L2U A;  3DLK A;  3SZ2 A;  2NRH A;  2IC3 A;  3VTH A;  3IUC A;  1ATS A;  2WTU A;  1BA0 A;  4OO1 J;  2BTF A;  3PSF A;  1OKJ A;  4ID1 A;  2OPR A;  3ULE A;  4DMN A;  4CZG A;  4BRG A;  4E1M A;  2B6A A;  3VQ6 A;  2HW3 A;  3DYA A;  1L5U A;  5KPT A;  4YOX A;  1S6Q A;  4B08 A;  3NHG A;  3HM9 A;  4CJS A;  1NBW A;  4M3Y A;  4LSN A;  4FJ7 A;  1J53 A;  3KWI A;  4JD2 B;  1QQN A;  4IKF A;  3H46 O;  4EZ9 A;  4UY8 O;  4CD1 A;  4CHY A;  5C0Y A;  5KGW A;  3PO5 A;  4N41 A;  2AP1 A;  4JKC A;  2IIR A;  1S6P A;  4IG0 A;  3MN7 A;  1ASW A;  4CZK A;  1NJI O;  3EE8 A;  1R59 O;  3WEE B;  1NJW A;  3LWM A;  1NK5 A;  3PX0 A;  2FSN A;  2OTJ N;  3PV8 A;  4F2R A;  4J2D A;  1BU6 O;  4DU3 A;  5C25 A;  1KXP A;  2HB5 A;  4FJL A;  2QWR A;  5E41 A;  3KK3 A;  4Z0U A;  4C1N K;  4FSV A;  4W5N A;  3ENB A;  5BRF A;  1N8R O;  5BN9 A;  4BRH A;  4A2B A;  4ELV A;  3I33 A;  1N34 K;  1RT5 A;  1J6Z A;  5IWA K;  5FRO A;  1BG3 A;  4BE0 A;  4YNQ A;  3NCI A;  4OLA A;  3U9Z A;  3ISN C;  4B3S K;  3CPE A;  2O4I A;  4DG1 A;  1KLM A;  2O8B B;  5D3G A;  3KZB A;  3VQC A;  4CZJ A;  4DQS A;  5C24 A;  4H0X B;  2FBX A;  3HBT A;  2ZGZ A;  3ENH A;  5E84 A;  3D2F A;  3MXM A;  3HOS A;  3F5T A;  1EET A;  2WOM A;  4CHN A;  3I56 N;  4K25 A;  5DK5 A;  4GVM A;  4JS4 A;  1JCG A;  4FJK A;  1BIZ A;  2HF3 A;  5JVG L;  4H03 B;  4O5F A;  5F0X A;  3KLE A;  4DQR A;  3TAR A;  1U47 A;  2RN2 A;  1BUP A;  1QTM A;  2PYJ A;  1Q18 A;  1V4T A;  4FW1 A;  2KFZ A;  1TVR A;  4K41 A;  4JD2 A;  3AO1 A;  3L8B A;  4BAC A;  5HRS A;  3VF6 A;  3TSQ A;  5KI6 A;  4AHR A;  3KLH A;  1XNR K;  2X6S A;  3D0P A;  1BGX T;  4LF6 K;  3A0I X;  4CGJ A;  5EVZ A;  3W0L A;  4CW7 B;  3CCE N;  5BPN A;  3HZ6 A;  4FO0 A;  4CJW A;  4ZTJ A;  2XY7 A;  3WXK A;  3M8P A;  4DUY K;  4YOV A;  1IKV A;  3RSE B;  4DV2 K;  3O9Q A;  3EYZ A;  3HO1 A;  2P9S B;  2HND A;  3C65 A;  1NK4 A;  3THW B;  4KRF A;  3M8R A;  3HL8 A;  4IJN A;  5KQ8 A;  4JS5 A;  1U48 A;  4FVM A;  3QO9 A;  4LF4 K;  2VG7 A;  3WNF A;  2YNH A;  4FZY A;  4CHP A;  3PIO L;  1VQP N;  2G8F A;  4FM1 A;  1T05 A;  3HXM A;  1VQN N;  4BR0 A;  3ULE B;  2W6L A;  4BRD A;  1EWR A;  3O3G A;  3MX2 A;  3H1Q A;  2UYT A;  4DR2 K;  4KHU A;  2P9N B;  1LAV A;  1TKD A;  2GWK A;  4DV5 K;  4E7L A;  1TYQ A;  3IAY A;  1YJ9 N;  5KQD A;  4OGE A;  4BWJ A;  5FPD A;  4QS7 A;  2QKK A;  3CQX A;  4OPH A;  3V9Z A;  4BDZ A;  5JLF A;  2P9P B;  3O4N A;  2YHY A;  4JV5 K;  2O8C A;  1RDC A;  2VWK A;  4KHN A;  2P9I B;  4CZF A;  4LFA K;  4DR6 K;  4FK0 A;  1VSK A;  2Y1J A;  1LW0 A;  1O1W A;  3F9M A;  3ZX3 A;  2FBT A;  3THV A;  3CJB A;  4FJ5 A;  1RT2 A;  3HI0 A;  4O4G A;  3E9P A;  4CES A;  3ZEU A;  2D0A A;  4DTO A;  1CLQ A;  3DLB A;  3V6D A;  4JRQ A;  3RR7 A;  3FZK A;  1NGC A;  4HTU A;  4KI6 A;  1HJR A;  5BN8 A;  1DT9 A;  2HNY A;  3PLA A;  2NRZ A;  3J8A A;  3F9K A;  4HTL A;  3OYB A;  3CME N;  3ZSW A;  1NM1 A;  2FXU A;  4CEZ A;  4CBU A;  1NKE A;  3HT3 A;  3MN9 A;  3SUQ A;  3CD6 N;  2HHQ A;  2HVH A;  3AO4 A;  2ZJQ L;  1Z26 A;  3VQ5 A;  4KHW A;  3VQP A;  4TSX A;  3V9X A;  3NH2 A;  4KPY A;  4DF8 A;  3M3Z A;  1ZC6 A;  2UU9 K;  2QWO A;  5HBM A;  2I7N A;  3HVT A;  5BRH A;  1ITG A;  3AAR A;  2Y1I A;  2FBY A;  2Q0R A;  1Y64 A;  3QML A;  5BPL A;  3I55 N;  1YJN N;  1Q9X A;  1RIL A;  1WSG A;  4B9V A;  1RBR A;  3NF6 A;  4F8R A;  4PY5 A;  1IKY A;  2IVN A;  1R0A A;  3NH1 A;  1BIS A;  4CBW A;  4B8C A;  4JKD A;  1OH6 A;  4BRE A;  3QDK A;  5FRM A;  4B1W B;  2NLX A;  4B9T A;  3N4P A;  3QIC A;  1FK9 A;  1GLF O;  1HQE A;  1VRU A;  4NXM K;  4DV7 K;  1MWK A;  3VER A;  5HRN A;  3G4S N;  3DI6 A;  1YJW N;  4E0D A;  4A59 A;  1VRT A;  2IOC A;  3QFP A;  4DQP A;  1NMD A;  1OVY A;  4H0V B;  4DTN A;  1VAZ A;  5TKW A;  1Q86 O;  3AV9 A;  2AA4 A;  4JKA A;  1ZBL A;  1MWM A;  3OHR A;  3NE6 A;  3E66 A;  3OW2 M;  1QVF M;  3PO4 A;  2A3Z A;  2V7Y A;  2WC9 A;  4JKH A;  4H4O A;  1BL3 A;  5TKY A;  4I7F A;  3M8S A;  1NOY A;  4KKO A;  3P5J A;  3S41 A;  2PAV A;  5AQF A;  5J2N A;  1YIJ N;  1HQU A;  4WQ5 A;  2PZS A;  3S3M A;  3TAG A;  4IWV A;  1B9F A;  2OA8 A;  1K8A O;  3BZC A;  1QSS A;  3K5N A;  3CET A;  1KAX A;  3KJV A;  5CZ1 A;  4BWM A;  1N6Q A;  1YAG A;  3PIP L;  3L6Q A;  4FM2 A;  2Z1H A;  2WUS A;  3S3O A;  4FK4 A;  1HNI A;  3NF9 A;  3M8Q A;  3LDN A;  1JKH A;  4EAH D;  4M3W A;  3CXC M;  5I42 A;  2E8A A;  3TTF A;  1B92 A;  4IOC L;  2P9N A;  4FLZ A;  1HKC A;  3KK1 A;  4E3S A;  1YHQ N;  4WYB A;  2D1K A;  2GEL A;  4KFB A;  5JS1 A;  4IG3 A;  4G9Z A;  4B1V A;  3C6U A;  3VGL A;  4MDB A;  3R3L A;  3CER A;  3SI6 A;  4Z4G A;  2P5G A;  4N56 A;  1DGK N;  5AQV A;  1VQM N;  3D45 A;  5GAE P;  5C12 A;  1UWB A;  4LF5 K;  5ADX A;  2YKM A;  2V7Z A;  4BRO A;  4C23 A;  3RRH A;  1NGJ A;  3SQ0 A;  1ATN A;  3HPG A;  2G8U A;  3BP8 A;  2B5J A;  4NXN K;  4O8K A;  4K43 A;  4HWI A;  5AQO A;  2E88 A;  1CZ9 A;  5FRN A;  4DTM A;  4XIU A;  3EKS A;  4ISG A;  1BIU A;  4FK2 A;  1IG8 A;  4FJ8 A;  3I8D A;  1K73 O;  3V9S A;  4CGG A;  3OYD A;  2ETJ A;  2E4L A;  4H5N A;  3T7Z A;  4JRP A;  4BRQ A;  1N33 K;  3OS1 A;  1IJJ A;  1J54 A;  2XY5 A;  3T1Y K;  2P9U B;  3H6E A;  4M41 A;  1VSH A;  2OPQ A;  2RHK A;  3KK2 A;  3MWP A;  1IBM K;  1S1V A;  4X64 K;  3G25 A;  5JS2 A;  4CJR A;  3SUP A;  3CYM A;  4CZL A;  3CC4 N;  1WSF A;  3T1A A;  2G8I A;  2VG6 A;  3VTI A;  1VSJ A;  4KHQ A;  2A41 A;  3MCA B;  3VET A;  3EE9 A;  1RDW X;  4B3T K;  4LF8 K;  1TGO A;  3CCM N;  2VG5 A;  1HUX A;  3OTO K;  4CFA A;  2BE2 A;  1IG9 A;  3DAW A;  4ID5 A;  3C6H A;  4B8A B;  4B9S A;  5K14 A;  3A5N C;  1GLJ O;  3EKU A;  3IDH A;  4IFV A;  3AAQ A;  5CY4 A;  3O3F A;  5LMU K;  3OYI A;  1J5E K;  1KVA A;  1DLO A;  1VSD A;  3OBW A;  1B9D A;  4JI4 K;  4WFN L;  1BQN A;  1SS6 A;  2UUA K;  5BRD A;  3FLC O;  2QI2 A;  4LFB K;  3AVG A;  4EIA A;  1D9D A;  4GW6 A;  3OYN A;  4HHT A;  4BRN A;  3ID8 A;  3G0Z A;  1RBV A;  2HHS A;  3BGR A;  3SLC A;  2UXC K;  2WON A;  3MK6 A;  4WQ5 C;  3AA5 X;  1FXX A;  1U6Z A;  3OJU A;  3K9J A;  4I6M B;  2B4J A;  4DTR A;  3J7Y P;  1YTU A;  3JSM A;  3H1V X;  2ZWH A;  5JVH L;  4DV4 K;  4DSF A;  1K8K A;  4Z4I A;  2GTD A;  5J1E A;  3OYH A;  3EN9 A;  4Z4F A;  2XRI A;  1HRH A;  4PA1 A;  1ASV A;  2E6L A;  1YUW A;  2HBL A;  3HP6 A;  4KHS A;  4CF9 A;  1L3V A;  4DTS A;  4BR4 A;  1UA1 A;  3C94 A;  4CJ7 A;  4FLW A;  2A5X A;  4FWO A;  3M6G A;  1JLF A;  4XH4 A;  2HHX A;  3A5L C;  1RTH A;  4EZ6 A;  3KHY A;  4CZE A;  4PQU A;  3I8B A;  2D4W A;  2YHB A;  1SAZ A;  2YCH A;  3L4I A;  5HRP A;  1XI1 A;  4DV3 K;  3V1R A;  4J2E A;  3DXK B;  1D4X A;  3JXU A;  3RWU A;  3EO3 A;  3NGZ A;  4IXC A;  1RTJ A;  3AA2 A;  3V1O A;  1LWF A;  4I9Q A;  3C6A A;  1XUP O;  4KH6 A;  1EP4 A;  4CF2 A;  2W42 A;  1NKB A;  4CEC A;  3MCP A;  5C2F A;  1BCM A;  4AHT A;  1TUU A;  1C1C A;  1Q8I A;  4K0K K;  4CIE A;  1C6V A;  5CYM A;  3TAP A;  5KGX A;  1Q81 O;  1DEJ A;  4DU4 A;  5H1S Q;  1YVU A;  1OH7 A;  4JI6 K;  4ILG B;  3QIN A;  2G8V A;  2PFU A;  2YHW A;  3AVK A;  1MDU B;  4QS8 A;  5AZJ B;  1P8Z A;  4DLE A;  4GV3 A;  2QWQ A;  4RW8 A;  4NYN A;  1LW2 A;  3LDP A;  3OY9 A;  3VQE A;  3ZET A;  3CJ1 A;  4CJE A;  5CYQ A;  4GV6 A;  1ZYQ A;  4BC5 A;  1NK0 A;  3PUF A;  1WAF A;  4KHP K;  4CEB A;  3LZI A;  1KRP A;  4DTX A;  3SBG A;  3QES A;  4CZH A;  2F8S A;  4NYF A;  3AO2 A;  4CF1 A;  4DQ8 A;  3L0Q A;  5GIP A;  4AHV A;  2QXL A;  3ATU A;  4DSL A;  4MQ3 A;  1VQ9 N;  4A61 A;  4H8K A;  4DV1 K;  1G15 A;  5M1P A;  1S1U A;  2EX3 A;  2YNG A;  2F4V K;  1NGI A;  2VQE K;  3MED A;  4CJF A;  3BUZ B;  2A6A A;  1TK8 A;  4O44 A;  1JLG A;  4JI3 K;  1QSL A;  4OLB A;  3HTV A;  4A57 A;  4M42 A;  1RBU A;  2PBD A;  4DWI A;  4LD0 A;  5GAG P;  4W5R A;  4JKG B;  5EU7 A;  4C8M A;  3NBP A;  2HHU A;  2KW4 A;  4IZ9 A;  5AR0 A;  3FZH A;  3JS6 A;  1A5V A;  2E20 A;  2ZGY A;  3MWT A;  3FGU A;  3AVC A;  4GNI A;  3VEY A;  3CF5 L;  1TAQ A;  3QET A;  3UKU B;  2Q2R A;  4FOE A;  3QNN A;  1Q82 O;  5AFU H;  4CIG A;  1ILY A;  4G1Q A;  4B9M A;  1NLV A;  1U04 A;  3CJA A;  4YDU A;  1WUA A;  4AM7 A;  4JEP A;  4BE1 A;  4XH1 A;  3VES A;  3K2P A;  3JAM O;  4KB1 A;  1NJZ A;  4B9L A;  3NVK A;  3OYF A;  4E1N A;  1TKT A;  3E01 A;  3SAG A;  4JI1 K;  2FF3 B;  3IS9 A;  2HOE A;  4B3R K;  4DF4 A;  4FWM A;  3LWL A;  1VK0 A;  4JLH A;  2BAN A;  4KB0 A;  4YOW A;  3BEX A;  4KRE A;  1HPM A;  4DQQ A;  4DU1 A;  1ZBH A;  1I94 K;  4LF7 K;  1FW6 A;  4LF9 K;  2HF4 A;  3KK7 A;  3O9U A;  4CF8 A;  1ASU A;  3DRR A;  3GE1 A;  3L2R A;  3SV4 A;  1JCE A;  3AGR A;  2GX9 A;  1IH7 A;  2D0B A;  3O80 A;  2V52 B;  3RVC A;  3AA3 A;  4MLH A;  3TU5 A;  2NZT A;  3VQQ A;  1CXQ A;  4H4M A;  1NWK A;  1JLQ A;  2FF6 A;  2JWL A;  4KHY A;  3VEW A;  1U49 A;  1W2B M;  3CFP A;  1QZ5 A;  4OPA A;  3ZSV A;  2UXD K;  4IBN A;  3AVN A;  3B6O A;  3ZLJ A;  4DSJ A;  1D8Y A;  2ZJP L;  1BHL A;  2QM1 A;  4BDP A;  4H0O A;  3WXI A;  3K58 A;  2ITG A;  3D7E O;  3UIQ A;  4AH9 A;  3EZW A;  4JI5 K;  4JK8 A;  3RSE A;  3VA3 A;  3OYK A;  3WXL A;  5AJ3 K;  3P83 D;  3UKR B;  1SL1 A;  4KBO A;  2DY4 A;  3TI0 A;  4OKJ A;  1QE1 A;  1CZA N;  2D5R A;  5CHI A;  4YFU A;  3M1F A;  3VQ8 A;  3CPW M;  4CBX A;  1VSM A;  3CCL N;  1RTI A;  4FLU A;  1NGH A;  4CE9 A;  3B8A X;  3CCS N;  4BRL A;  5C42 A;  4GV9 A;  1BCO A;  4NLC A;  3ASM A;  4HUG A;  3I0R A;  3K5O A;  2YHX A;  1YTA A;  3TWH A;  3LP2 A;  4CJ4 A;  3VEN A;  2Q36 A;  3H3N O;  4ELU A;  3VQA A;  2OPS A;  2IVP A;  4BVP A;  4NCB A;  1I39 A;  3AVB A;  4GY2 B;  2P9P A;  4BRI A;  1JLC A;  2BH1 A;  4BR7 A;  4YOT A;  3JYT A;  3KLG A;  4C8L A;  3G10 A;  3KVG A;  1XMO K;  4DR4 K;  3ZSY A;  3MXI A;  3LM2 A;  1SKR A;  2W40 A;  4Q5V A;  4OPK A;  2XY6 A;  3V4I A;  3U9D A;  1CZB A;  4XEI A;  1HYV A;  4CGI A;  1SUQ A;  1GOA A;  3LDQ A;  1X1P A;  1DTT A;  1NOZ A;  1WNS A;  4IFY A;  3DWL A;  4WFB L;  2LSN A;  3ENO A;  4YOU A;  4GKK K;  2VWB A;  1ZXO A;  3DOL A;  4B3M K;  3A2F A;  4KTQ A;  4HUF A;  3FR0 A;  3UE5 A;  4JNE A;  5JIC A;  1KVB A;  1RT7 A;  3VQB A;  4Y1C A;  1GLC G;  1TV6 A;  3SQ1 A;  3PX6 A;  5DM6 L;  3SMS A;  4CFD A;  4KO0 A;  4LC9 B;  5BR8 K;  2NNW A;  2HHT A;  1JL1 A;  3O4Q A;  1C0F A;  4CJ5 A;  4M3R A;  4PKH A;  5FPN A;  4I6M A;  5ADX H;  3TSP A;  5AQY A;  4Z94 A;  3LPU A;  2X6N A;  1RBS A;  2QWL A;  3QIO A;  4IJA A;  3KLF A;  1ZBS A;  2ZM6 K;  2OYQ A;  4B1Y B;  5AQR A;  3OYJ A;  3NAE A;  4A5B A;  4BG8 A;  4KV8 A;  4DTU A;  2D0O A;  3S9H A;  2QK9 A;  3F2K A;  3R1X A;  3ULD A;  4DUZ K;  3SCX A;  4RCH A;  3GG4 A;  3LDO A;  2DPN A;  3WEE A;  2O8E B;  1K6Y A;  1TK5 A;  3VQD A;  4PHT X;  1D9F A;  1QSY A;  5HOO A;  4IO9 L;  1H1V A;  5SWM A;  3QEW A;  1KCF A;  2YNF A;  3BZK A;  4CZM A;  3DM2 A;  5AQI A;  3T19 A;  1WAJ A;  3NVM A;  3ZSQ A;  4EHU A;  3QER A;  2HHV A;  2CGK A;  3KD5 E;  3H08 A;  4DTJ A;  2EWS A;  5KPR A;  4MLE A;  4B9N A;  2E1Z A;  4DKW A;  3GL1 A;  3OYM A;  3VEX A;  1BQM A;  5C10 A;  1YT3 A;  3U4L A;  2HBK A;  4FYD A;  3AO5 A;  3DRP A;  1VHX A;  2Q0U A;  3RMB A;  3KD1 E;  2NRW A;  4M3X A;  4U7B A;  4BY9 C;  2JWK A;  1XQS C;  5LL6 Z;  2BDP A;  4OVL A;  4Z4C A;  3O9R A;  4FWP A;  2P9S A;  1YXQ A;  5J2M A;  2IVO A;  3IG1 A;  3GDQ A;  1SQK A;  2GUI A;  4C8K A;  1JL2 A;  3TAF A;  3K0S A;  3HPH A;  3LDL A;  1HYZ A;  3HK2 A;  3V9U A;  4IO8 A;  4MO4 A;  4EP5 A;  3NMU A;  1S1T A;  1XC3 A;  3HSC A;  5EOY A;  1RDA A;  5LY3 A;  4J2B A;  3EL2 A;  3CJ9 A;  4IOA L;  4BC4 A;  4OKK A;  1Y97 A;  3MMV A;  3DXM A;  3TAM A;  3RMC A;  5AQN A;  2YX6 A;  2WBN A;  3L3U A;  3P38 A;  4FWR A;  1TK0 A;  3L2V A;  1KFD A;  3O1B A;  3Q7B A;  3VEZ A;  5ELZ A;  5AQP A;  4FPA A;  3CCJ N;  3O4W A;  1NGD A;  4FXD A;  4O5B A;  1JLB A;  1V4S A;  4JHD B;  1KAY A;  1S5J A;  1K8K B;  1SKW A;  3AGK A;  3PSI A;  4KTZ A;  1WSH A;  3FZF A;  3I0S A;  2FBV A;  1Z6R A;  3MEG A;  2FSK A;  2P9L A;  5C15 A;  3OYL A;  2E5L K;  5SZT A;  3QEX A;  1RBT A;  2ZE2 A;  3DLG A;  2VGM A;  1RTD A;  1TL1 A;  3SAH A;  1RNH A;  3THX A;  2G8H A;  3KLI A;  5AQL A;  4FLT A;  5GIO A;  4F2S A;  1HNV A;  3AAP A;  4O0I A;  3ZT4 A;  1RCH A;  3IRX A;  4PL7 A;  4CJP A;  4CJU A;  3SMP A;  3WQT A;  3MDQ A;  3OVN A;  3DXK A;  1SV5 A;  4AIL C;  5HRO A;  4DSK A;  4YHH K;  2IAJ A;  1KSP A;  4NLB A;  3CJC A;  4M7X A;  4LSL A;  1NMN A;  4CIF A;  1BDG A;  3FZL A;  1HJO A;  3MX5 A;  4CZI A;  1NNE A;  4GKJ K;  4E7K A;  1J9A A;  3CM5 A;  2XO7 A;  4DFJ A;  2HHW A;  1TYQ B;  3O08 A;  3O9T A;  3SQ4 A;  3A5O C;  3ID6 A;  4DS4 A;  4W5O A;  5KPZ A;  3EY1 A;  1LWC A;  4CVN E;  4CK2 A;  1ESV A;  1FKO A;  1A5W A;  5FPM A;  4U67 L;  3MAQ A;  3QNO A;  4ZTF A;  4LH5 A;  3AY9 A;  3THY B;  4ILJ A;  3V9W A;  4FJI A;  2YNI A;  2E2P A;  1WSE A;  5CR4 A;  1WLJ A;  1RT1 A;  1XWL A;  3KKS A;  4FJM A;  4JYA K;  1XMQ K;  3DXM B;  2ATQ A;  1LAW A;  5M1F A;  1X9M A;  5AQG A;  3ZET B;  1IBL K;  4OPJ A;  1T7P A;  2P9K A;  2VCP A;  3L3V A;  1KTQ A;  3ZSR A;  4BRP A;  4RG8 A;  3LPT A;  2Z1G A;  4NB4 A;  2XHB A;  4J8F A;  5BR9 A;  2CGL A;  4ISF A;  5CE3 A;  1HX1 A;  3QEV A;  1M90 O;  4DFK A;  5DM7 L;  4BRM A;  4CFB A;  2FSJ A;  3O9S A;  2DFF A;  4H5V A;  4FLX A;  4CER A;  4KH4 A;  1LV5 A;  4KI4 A;  3PY8 A;  5M1O A;  2Q31 A;  4BR2 A;  3WNE A;  2IDO A;  3F73 A;  1Q7Y O;  3O3H A;  1T44 A;  1XNQ K;  3SUO A;  1GOC A;  1T3V A;  3DOK A;  4IEI A;  1NGF A;  1X9J A;  3SK3 A;  4JK7 A;  5MLC Q;  3CFO A;  4FLY A;  3FFK B;  3SNN A;  3NGY A;  1E3M A;  4JKG A;  5I9E B;  2OPP A;  1Z25 A;  3WXJ A;  4KH5 A;  4IDK A;  3KTQ A;  4A5A A;  4CF0 A;  1RT4 A;  4YDU C;  4E7H A;  1EXQ A;  1L3U A;  2AJQ A;  2P5O A;  4DS5 A;  1RT3 A;  4H5R A;  3P1G A;  3UKU A;  4OJR A;  3E1Y A;  4DR7 K;  4BC3 A;  4WFA L;  5FLX O;  5HLF A;  4ISE A;  4BRC A;  1RDD A;  4A2A A;  2QA4 N;  1X9W A;  3SV3 A;  4FZZ A;  4FJN A;  1UOC A;  2DFE A;  1XHZ A;  4DFM A;  4B1Z A;  1Z05 A;  4DHY A;  1VQ5 N;  1JLE A;  4ICL A;  4HUE A;  1NK9 A;  1IBK K;  5JMV A;  1BI4 A;  3FE1 A;  1HKG A;  2PY5 A;  4DFP A;  1S3X A;  2NUB A;  4FOI A;  3CCQ N;  4B1U B;  3VN5 A;  3HVR A;  3CCV N;  3CJ7 A;  4BQL A;  4CI6 A;  4M3Z A;  5KRS A;  3RRG A;  4EP4 A;  1K9M O;  3D6R A;  3V1Q A;  2QWN A;  2E2N A;  2G8K A;  2VQF K;  2CH6 A;  3WT0 A;  2HMP A;  2F9T A;  1LWE A;  2QXF A;  4K8X A;  1LOT B;  4JI8 K;  2GV9 A;  5EX5 A;  5J2Q A;  3SJH A;  1WSI A;  4CEA A;  1RGI A;  4B3O A;  3KWG A;  1LCU A;  3CHW A;  4FLV A;  4FVU A;  3LZJ A;  3H45 C;  1RDU A;  4F3O A;  2HNZ A;  2GBZ A;  3VF4 A;  2KLA A;  2YI1 A;  4DQI A;  1YF5 L;  2PYL A;  1W7A A;  2HVI A;  1TUY A;  3MN5 A;  1EKE A;  1MA9 B;  3RMA A;  3U3G A;  5AZI A;  3K57 A;  4CGF A;  1P90 A;  3QIP A;  1RFQ A;  3B6P A;  1WN7 A;  3EZ5 A;  3G6E N;  1QQO A;  5FDL A;  5E26 A;  3ALY A;  2YJF A;  3CC2 N;  2BGG A;  3ZCM A;  1UA0 A;  5AQU A;  2P1J A;  2ASO A;  3AO3 A;  3A5M C;  4HCB A;  4FWL A;  3E9O A;  3J7A P;  2F7T A;  3CG7 A;  3OA9 A;  3LAM A;  2UUC K;  4EFH A;  3SJJ A;  2RE2 A;  3R6M A;  2OAN A;  1VQO N;  3SAF A;  4FZX C;  3NF7 A;  4BDY A;  2P9K B;  2ZD1 A;  2KTQ A;  1TKX A;  1GOB A;  1TKZ A;  3C7N B;  1HR0 K;  3K5L A;  2O4G A;  2O8F A;  4W5T A;  1BI4 B;  3TAQ A;  3CCU N;  1A5X A;  3OYG A;  1T6D A;  1KFS A;  3L2W A;  3RR8 A;  1ATR A;  1VSF A;  3ZX0 A;  1EO1 A;  4PKI A;  4ILH A;  4AM6 A;  4E7J A;  4DSE A;  4FWQ A;  1QZ6 A;  4M7Y A;  1U2V A;  4C1N I;  3ZT1 A;  1YI2 N;  4E89 A;  2J4R A;  3U3Y A;  1S1X A;  3O6W A;  4FCY A;  2BUP A;  3LL3 A;  4M3T A;  3EEQ A;  4JK9 A;  3G71 N;  4FJG A;  2H3G X;  4FJJ A;  5M1Q A;  2Z1J A;  3ZT2 A;  4LH4 A;  4QAG A;  2KZM A;  4MO5 A;  3OBY A;  2ASM A;  2YJE A;  4IFE A;  3Q7C A;  2NRT A;  2A1S A;  3QBW A;  2FC0 A;  1S1W A;  3ZSX A;  1L3T A;  4CJ3 A;  1XC9 A;  1X3N A;  3SPZ A;  2WFB A;  3DLH A;  4CCH A;  4XH5 A;  4BC2 A;  3NDK A;  4PUO A;  4H5W A;  1NU0 A;  1N5Y A;  3R9P A;  3UB5 A;  4JN4 A;  3U8X A;  3LP3 A;  4PWD A;  1NGA A;  3NF8 A;  3DLR A;  4RW6 A;  2GWJ A;  3L2Q A;  2KFN A;  3M5R A;  4IOX A;  3DLE A;  4H0P A;  3RTV A;  2KHO A;  3MXJ A;  4K8Z A;  3IKM A;  2P9L B;  2Z1I A;  5AQS A;  5I3U A;  3TR8 A;  1EX4 A;  1GLE G;  4JAX A;  4DR3 K;  1WSJ A;  5KRT A;  4UQG A;  5KTQ A;  4CJQ A;  3BF3 A;  4H5T A;  4R5P A;  4YOR A;  3WNH A;  1E4F T;  1O13 A;  5HP1 A;  1YIT N;  2A40 A;  3HP9 A;  1SL0 A;  3LM9 A;  3K59 A;  4GMJ B;  1VSL A;  5T7B A;  1HMV A;  4BGA A;  1NGE A;  2O8B A;  3DRS A;  1VQ8 N;  1F21 A;  4C8N A;  1YVN A;  1JJ2 M;  2E6M A;  1HNZ K;  4OX9 K;  4DV6 K;  4I2P A;  3WXM B;  1HPZ A;  3E9L A;  4Q0B A;  1MU2 A;  1QS4 A;  1W0H A;  3LAK A;  1HKB A;  1SL2 A;  5DMR A;  4EHT A;  4PKG A;  2RPI A;  3QEP A;  5HRR A;  4JI0 K;  3FZM A;  3C0B A;  4CFC A;  4FJX A;  3AVH A;  1NJY A;  2Q3S A;  2KKZ A;  4M45 A;  2CH5 A;  3T69 A;  1FJG K;  4BR9 A;  5JLH A;  2GEM A;  5A2Q O;  4Z4H A;  1T6C A;  3K9K A;  1GLL O;  1T8E A;  3C6T A;  4CED A;  4AHU A;  3NFA A;  1JCF A;  2P9U A;  1NKC A;  1DTQ A;  3QLH A;  2X74 A;  1GLB G;  2D0C A;  1VSE A;  3VOV A;  4CJV A;  5AQT A;  1X9S A;  1Q9Y A;  3O1W A;  2A1R A;  3ZYY X;  1NK6 A;  3IFR A;  2I5J A;  3TSU A;  4CGD A;  1X3M A;  3AVA A;  1M1K O;  1WOQ A;  1EWQ A;  3TTC A;  4CHO A;  2IS3 A;  4QCL A;  4FM0 A;  3MN6 A;  3AVJ A;  4B1X B;  4ZHR A;  1HLU A;  3P39 A;  3CQ8 A;  4CD3 A;  4BVO A;  3HYF A;  2Q97 A;  2O8D B;  4LFC K;  3AVF A;  2QWM A;  4N5S A;  3VQ7 A;  3VMF B;  2W6K A;  3P31 A;  4KTW A;  3QBX A; 
#chains in the Genus database with same CATH homology
 4AQY K;  1XNR K;  4LF6 K;  4CW7 B;  2UU9 K;  3JAM O;  3J7A P;  4B3T K;  4LF8 K;  4K0K K;  4DR3 K;  4X62 K;  4YHH K;  3OTO K;  2UUC K;  4JI1 K;  4DUY K;  4B3R K;  4DV2 K;  4DR5 K;  4JI6 K;  5LMU K;  4DR7 K;  1J5E K;  5LMN K;  4DR4 K;  1XMO K;  1N36 K;  5FLX O;  2UUB K;  4JI4 K;  4GKJ K;  1I94 K;  2UUA K;  4LF7 K;  4LF4 K;  1HR0 K;  3J80 O;  4JI7 K;  5LL6 Z;  5IT9 O;  4LFB K;  4LF9 K;  4DR1 K;  4JI2 K;  1HNZ K;  4OX9 K;  4DV6 K;  1IBK K;  4CVN E;  2UXB K;  1N34 K;  4DV0 K;  4GKK K;  5IWA K;  2UXC K;  4X66 K;  4B3M K;  4NXM K;  2HHH K;  3J81 O;  4DR2 K;  4DV7 K;  4LF5 K;  4B3S K;  4JI0 K;  4KHP K;  4DV5 K;  1HNW K;  3J7Y P;  4NXN K;  1FJG K;  4JYA K;  4YY3 K;  1XMQ K;  4DV4 K;  1HNX K;  4V19 S;  2UXD K;  5BR8 K;  2VQF K;  1N32 K;  5A2Q O;  4JV5 K;  1IBL K;  4LFA K;  4DR6 K;  4JI8 K;  4DV1 K;  2F4V K;  2VQE K;  2ZM6 K;  4JI5 K;  4X65 K;  4JI3 K;  1N33 K;  5AJ3 K;  4DUZ K;  3T1Y K;  4DV3 K;  1IBM K;  4X64 K;  3T1H K;  2E5L K;  4LFC K;  1XNQ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...