3KHYA

Crystal structure of a propionate kinase from francisella tularensis subsp. tularensis schu s4
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
384
structure length
384
Chain Sequence
MSEILVLNCGSSSVKFALINPHTSQSLVTGLAENIATKNCKVVFKAEHKIVKYLENGSYKDVFEMLKDFLVENKHLEKIVAIGHRVVHGGQYFSKSVLINADSLEKIKACIALAPLHNPAHIEGIRFCQQIFPELPQVAVFDTAFHQTMPSYIAEYAIPYELTHKHNIRKYGAHGTSHKYVSEQAAKILTQQKANVIVAHLGNGCSITAVVDGKSIDTSMGLTPLDGLVMGTRSGCIDPSIFAYISDNLGWSVTEITNMLNKQSGLLGICGHNDMREVSQLAAKGDSLAKLAIEIFSHRVAKFVASYMIYFNKLDALVFTGGIGENAANIRKNIISKLANLGFMIDHQKNSNSETFINSKNSHNIMVIATNEELMIAQETQNLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Propionate kinase
publication title Crystal Structure of a propionate kinase from Francisella tularensis subsp. tularensis SCHU S4
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Transferase
total genus 123
structure length 384
sequence length 384
chains with identical sequence B
ec nomenclature ec 2.7.2.-:
pdb deposition date 2009-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3khyA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3khyA02
1BA0A 3U9DA 4BROA 2FSNA 2OANA 3KVGA 4H0PA 1DGKN 3QBWA 3MDQA 2NLXA 2IVNA 3VERA 3KHYA 3FZLA 5AR0A 4L3QA 4BRPA 2V52B 5AQSA 3DAWA 3QBXA 3LM2A 2BTFA 4WYBA 4BREA 4CZKA 3MN6A 3CERA 3D2EB 5KPZA 1J6ZA 3FZFA 5EVZA 1CZAN 2ASPA 2P9IB 1S3XA 3L0QA 4H5RA 3C7NB 3H3OB 1RFQA 1V4SA 3R9PA 4PL8A 3IUCA 2Q31A 4BVPA 4PL7A 5EY4A 1MWMA 3MCPA 2HOEA 1X9JA 1Q18A 2CGJA 2CGLA 4FWOA 5AQGA 3IMXA 1NGGA 3CJ7A 4FWPA 4BRHA 2QXLA 3MK6A 4NB4A 5BPMA 5LJWA 4DQ8A 3FZKA 1K8KB 1NBWA 2QWLA 2ASMA 3SMSA 4Z94A 1R59O 4BRLA 4BQLA 5KQ8A 4HTLA 2QW9A 4BGBA 3WXIA 4BRCA 2FXUA 4JD2B 4IJNA 4K25A 2P9NA 4AM6A 4E1JA 2QWRA 2ZGZA 5AQMA 2HF3A 3L6QA 2P9PA 1ATNA 2QWPA 2D1KA 1EQYA 5AQXA 1C0GA 1YVNA 1YUWA 1ATRA 2P9SA 3FGUA 3HBTA 4B1XB 2ASOA 2GUPA 4A2AA 5JLFA 2A6AA 3CJBA 4EHTA 3H3NO 5BRFA 4H0YB 2E1ZA 2IVPA 4FL9A 3QFPA 1Z05A 1ZXOA 3BF1A 1TYQB 5AQVA 4CZIA 1GLBG 2A5XA 5AZJA 3DJCA 5FPMA 5FPDA 5AQWA 4GNIA 1T44A 4BR5A 4BRIA 3AARA 3VEOA 3QDKA 3FLCO 5AQFA 2YHXA 5AQUA 2YHWA 1XC3A 5BRHA 3D2FB 5KQDA 3JXUA 1NGJA 4CZEA 5ADXH 1U6ZA 5AQZA 3ATUA 4RCHA 2E88A 2CGKA 3CIPA 3EN9A 5JICA 4H5WA 5LY3A 4H5VA 3LDOA 3FR0A 1JCGA 2A40A 3AY9A 3VENA 4B1YB 1XQSC 1YXQA 5E26A 4FWNA 1HKBA 2V51B 1NWKA 3M3ZA 3ZX3A 1X3MA 4Y0WA 1IG8A 1D4XA 3UKUB 2WUSA 3VEZA 2P9KA 4I6MB 4WQ5A 3M1FA 1V4TA 4IO8A 3BF3A 3H45C 4JAXA 1T6CA 4DHYA 4XH1A 4YDUC 3U8XA 2FF3B 3TU5A 1X3NA 2Q36A 2E20A 3H1QA 3B8AX 3GOIA 4BG8A 1Z6RA 3A8YA 4QS8A 1SQKA 1NGHA 5AZIB 3ZEUA 5EX5A 2FSKA 4CD1A 3FE1A 4BR9A 2E2NA 2GWJA 3HTVA 1GLJO 3JS6A 3VGKA 1LOTB 2QWMA 2CH5A 2PAVA 3MN7A 2F9WA 3WXKA 3DXMA 3HZ6A 5EOYA 4MLEA 2AA4A 4MO5A 4CZGA 1QQMA 3DXKB 5KPRA 1Y64A 4BVOA 4WQ4A 3QFUA 3O5BA 5F0XA 5AFUA 2HMPA 1U2VB 2A41A 1NM1A 3SK3A 1TUUA 1WUAA 1BWFO 1GLLO 4B1UB 4CI6A 1TUYA 3LM9A 5JMVA 2E2OA 4QS9A 3CJ1A 4H5TA 4A61A 1KXPA 5JLHA 3O1BA 5AQPA 3FZMA 1HJOA 3MN5A 2F9TA 4BRAA 1QZ5A 1ESVA 3I8BA 4H0VB 1T6DA 1BUPA 4B1ZA 3CETA 3EZWA 3GL1A 1GLDG 4BR7A 2KHOA 3BP8A 3VESA 4BC5A 3VPZA 2GTDA 4BG9A 2IIRA 4DB3A 4B9QA 3J8AA 4A62A 2VYPA 3WQUA 1BOTO 4EAHD 2P9LA 2ZWHA 2VCPA 4H03B 1JCEA 1H1VA 4FOEA 3O6WA 1S22A 2UYTA 4BRFA 3G25A 2I7NA 4HWIA 2QM1A 4BRDA 4GY2B 2Q0UA 4K43A 2P9UA 4CD3A 3HM8A 2CH6A 2GEMA 4M7XA 3OHRA 5AQLA 1ATSA 3HSCA 4XEIA 2V7YA 2GELA 3U4LA 4NO7A 3UKRB 2D4WA 5AQHA 5F1XA 3WUHA 2Q2RA 4C23A 2P9NB 3RSEA 3ATVA 4JNEA 2P9PB 1NGBA 3EO3A 3I33A 1BA1A 2P9SB 1NGIA 4M7YA 5BRDA 5AQKA 3S41A 4IZ9A 1DEJA 3O80A 3L4IA 4JHDA 4MO4A 3H1VX 3VEWA 1SAZA 4CBWA 3D7EO 1DKGD 5FPNA 3WXJA 1NGCA 2E2PA 3W3DA 1QQNA 4F9OA 4BC4A 3GDQA 4XH5A 5BPNA 4AM7A 1GLEG 5EXWA 3WXLA 4PKGA 2YI1A 4BRKA 5CE3A 4CBXA 1HX1A 1C0FA 4PKHA 1HUXA 3F9MA 5BPLA 4FO0A 5B8HA 4PKIA 5BREA 2GWKA 2AP1A 3H46O 2A3ZA 3U9ZA 5AQYA 3AAPA 3EKUA 3WQTA 1LCUA 3VEVA 1IJJA 3ZETA 3P4IA 3VGMA 5LJVA 1BDGA 2NRHA 5AFUH 1GLAG 3A5NC 2FLOA 4IJAA 3UB5A 1P8ZA 1RDWX 2QWQA 2YJEA 4BR2A 3WEEB 5AZIA 4EFHA 5BN8A 2W41A 2V7ZA 3HI0A 3CJAA 1KAXA 3QICA 4O8KA 3CI5A 1E4GT 2YJFA 3CQXA 1SZ2A 3C0BA 4H0OA 1BO5O 2PBDA 1MA9B 4BC2A 3D2EA 1WOQA 2E8AA 3EKSA 1HKCA 1KAYA 2P9KB 4RWTA 2P9IA 3TPQA 3VEXA 4FWQA 4H0TB 3C7NA 1QHAA 2IVOA 5AQQA 4M63C 2H3GX 3VEYA 3O4WA 3DWLA 3MN9A 5AQOA 3CJCA 4CZFA 4FWMA 3GE1A 4MLHA 5BN9A 1NLVA 4FPBA 1OKJA 3WT0A 4KBOA 4B1WB 3CQYA 3MMVA 1NGAA 5AQTA 3A5MC 3VF6A 3ZEUB 3A5OC 3H6EA 1NGFA 4ISEA 4FWKA 3LDNA 1K8KA 3IDHA 4B1VA 1XUPO 2FSJA 3KZBA 2YHYA 4K42A 3DXMB 3QMLA 3VGLA 3ENHA 4FWSA 3ZX0A 2A42A 3O8MA 4JD2A 3SJHA 3CJ9A 1QZ6A 2ZGYA 4ISGA 3LDQA 4O5FA 3SLCA 1BG3A 2FF6A 3GG4A 4LC9B 3ULEA 4FWLA 4A2BA 4FPAA 3LL3A 3O1WA 3GBTA 5KPTA 3UE5A 4YDUA 4BRMA 3VF4A 4H5NA 4WQ5C 5AQIA 2NZTA 4ISFA 2W40A 1HPMA 4XH4A 1TYQA 1MDUB 3UKRA 1NGEA 2E2QA 4CJ7A 2D0PA 2EWSA 3A0IX 3BUZB 3EL2A 2VWBA 2P9LB 3BEXA 4BGAA 2DPNA 3LDPA 5ELZA 1G99A 1E4FT 2J4RA 5TKYA 3ZX2A 4CBUA 3A5LC 4CZJA 3ENOA 3D2FA 3O08A 2BUPA 1BU6O 2YCHA 4BRNA 2P9UB 5I9EB 4FWRA 4BRGA 3R8EA 5FPEA 5BR9A 4WQ4C 1RGIA 1HKGA 5AZJB 5AQNA 2E1YA 5AQJA 1MWKA 4BC3A 4K41A 3UKUA 3ID8A 5F2RA 2QWOA 5E84A 4I6MA 4DCHA 2QWNA 4CZHA 3RSEB 1JCFA 4RTFD 2D0OA 2ZF5O 4FOIA 4CZLA 3SMPA 2ITMA 4FSVA 3ULEB 4JHDB 3WEEA 4QS7A 3LDLA 1NMDA 3QB0A 3IFRA 1GLFO 4BRQA 4CZMA 4BR0A 3AAQA 4IWVA 1GLCG 1ZBSA 4IXCA 2Q0RA 4EIAA 1HLUA 3FZHA 4EHUA 4BR4A 1KAZA 5AQRA 1YAGA 3R6MA 3VOVA 4J8FA 3M6GA 3FFKB 3CHWA 2HF4A 2Q1NA 3VF2A 3W0LA 1ZC6A 2I7PA 1QQOA 3DXKA 4H0XB 3VETA 4BQZA 5ADXA 3ZETB 1U2VA 4JN4A 2Q97A 1NGDA
chains in the Genus database with same CATH superfamily
3DRPA 4BROA 2FSNA 4QOZB 2OANA 3G0ZA 3CC4N 4FLXA 3QEVA 3F9KA 3QBWA 2IVNA 1S9EA 3KHYA 4KH5A 3J7ZO 1OH6A 4L3QA 5AQSA 3QBXA 3AVIA 4BREA 4BE2A 4IO9L 1VQON 3CERA 3D2EB 1C6VA 2QI2A 5KPZA 3NVKA 1J6ZA 1IKVA 3CFOA 4FVMA 2P9IB 3H3OB 4GV3A 3NDKA 2FBTA 4JK9A 1V4SA 4OVLA 4J2DA 1IO2A 4BVPA 5C2FA 3OY9A 4RW6A 3OS1A 4FJIA 4O44A 4CF2A 4AH9A 3LPUA 3THWB 5GAGP 2QXLA 5BPMA 4DSIA 4DQ8A 1K8KB 2VG5A 3EE8A 3IRXA 4YORA 1L5UA 2YNFA 4DG1A 4CJRA 4I9LA 2GUIA 1NOZA 4BRCA 2FXUA 3O9SA 1U45A 3L2VA 2IC3A 1S5JA 1JLEA 3KK1A 1QSYA 4FJ5A 2HHWA 2D1KA 3BDPA 1YVNA 2P9SA 2HHHK 5FDLA 5GINA 3L2WA 5JLFA 2G8FA 4IFVA 4KHYA 2E1ZA 2IVPA 5BR8K 3HP6A 1RTDA 5AQVA 1IBLK 4CZIA 5FPMA 2O8EA 5AQWA 3AARA 3AV9A 3VEOA 3PY8A 4HUFA 1TK0A 1SKWA 4C1NK 2OPRA 4KHPK 5BRHA 1NGJA 4CJVA 4F3OA 3BGRA 3CMAN 4JI5K 2HMIA 3IKMA 1RBSA 1U6ZA 3ISNC 2CGKA 4DQRA 4OGEA 4E89A 4H5WA 5LY3A 4H5VA 1HQEA 2A40A 2YKNA 3VQ6A 1Q86O 1XC9A 3AA5X 1VHXA 3HP9A 5FROA 3M3ZA 4MDAA 3ZX3A 2W42A 4KAZA 4IG3A 3HPOA 1TL3A 5J2QA 5IT9O 2P9KA 4CHPA 4FJLA 4DUYK 4JAXA 3V1OA 4I7FA 4YDUC 5C24A 2KW4A 3HT3A 4Z4IA 4CJQA 3B8AX 3GOIA 3ZEUA 5MLCQ 1NJXA 1VQLN 1GLJO 3JS6A 4DTOA 4CJSA 4DV5K 3NF8A 4FK4A 5EOYA 5KGXA 4MLEA 4CZGA 4LSLA 4WQ4A 4KHWA 3O5BA 5F0XA 5AFUA 2HMPA 3O9QA 1U2VB 2HB5A 2A41A 1BWFO 1GLLO 1I3AA 4FLWA 4QS9A 4A61A 1KXPA 1HJOA 1ESVA 2PZSA 4FLUA 4LY7A 3ZSRA 4M3YA 3EZWA 3CCVN 3TR8A 1HPZA 1S1UA 3OBYA 2JGUA 4U7BA 2UXCK 3CM6A 4R5PA 3ZSYA 4CF8A 4N41A 4BG9A 1W9HA 4FLZA 2D0BA 4DB3A 3CCSN 1WSJA 3NVMA 4A62A 2KQ2A 5M1FA 3WQUA 4IKFA 1BOTO 4EAHD 2ZWHA 3KIOA 4FJMA 2G8HA 5CYMA 1JXBA 3DLLL 2FC0A 3PSIA 4HUGA 4YY3K 1WSEA 1Z25A 1VQ7N 1D5AA 4K43A 1IG9A 2P9UA 2W6LA 4Z4CA 1NK9A 3HM8A 3MEEA 4W5NA 3D45A 4KTWA 4DTJA 3TABA 4E7KA 4JEPA 4XEIA 4YOWA 4AQYK 1YHQN 4Q5VA 3OVNA 4B3RK 5AQHA 2E6MA 2Q2RA 3K5OA 4CEAA 2P9NB 3M8RA 3OS0A 4PA1A 1OVQA 3U6FA 3ATVA 4JNEA 2PY5A 3I33A 1BA1A 5M1OA 1WLJA 5AQKA 3S41A 2XY5A 2NRXA 1DEJA 3O80A 3NGYA 1HYVA 1HYZA 1RNHA 1VQMN 2OTJN 1ZBHA 4F9OA 2O4GA 4V19S 5K14A 4J2BA 5CZ1A 3GDQA 1SL2A 2YI1A 4M3WA 3CFPA 1HNXK 1BQMA 1HJRA 5HRRA 3OYKA 3QO9A 4FO0A 2RKIA 2GWKA 2AP1A 2A3ZA 3AAPA 2YX6A 1QVGM 3VEVA 4DF8A 3DLEA 5I42A 1Q82O 3P4IA 1REVA 2O8DA 5KRTA 3M8PA 5AFUH 4CCHA 4JKGB 5FLXO 4CHZA 2QWQA 5DM6L 3WEEB 5AZIA 3EY1A 4HTUA 1QSLA 2UXBK 3TARA 3QICA 4O8KA 3CI5A 2OPQA 3SQ4A 1YTUA 4H0OA 4CGDA 2KZZA 1RT5A 5M1NA 4C8NA 4FK0A 3QEIA 3NF9A 4H0TB 4DMNA 5AQQA 1M90O 4LF6K 4M63C 3O4WA 3EEQA 3VTIA 3OA9A 1JL2A 1OKJA 5M1PA 3K57A 3AVHA 3KD1E 4FJXA 1WB9A 3H6EA 2QXFA 1NNEA 2HVIA 4X64K 4FWKA 3IDHA 4B1VA 4ID5A 4LFCK 3SI6A 3DXMB 4WFBL 5JVGL 3QMLA 3QNNA 3CC2N 1EX4A 3AA3A 3WNFA 2YHBA 4CEZA 4IG0A 3OYNA 1XMOK 4A5AA 2A42A 4E7HA 3O8MA 3QEPA 4JD2A 1RTJA 3PIOL 4B3OA 1VSDA 3U3YA 4B3MK 2P1JA 3LDQA 4ISGA 1B92A 3SLCA 3QETA 2UXDK 3GG4A 3ULEA 4FWLA 4A2BA 4E7LA 3THXA 3GBTA 4GVMA 5KPTA 4DR6K 4Z4EA 1RBVA 4W5RA 2A1RA 4YDUA 1RBTA 5CHIA 1TYQA 3PX6A 3KLEA 1NGEA 3C95A 3BUZB 2Z1JA 4JV5K 1TL1A 1SS6A 5HL7L 4M3RA 2DPNA 2OPSA 1QSSA 4B08A 4H4MA 1KLNA 2VG7A 1KD1O 3LP1A 2J4RA 1EWRA 1NJYA 3T1YK 3A5LC 1VSJA 4A5BA 3NGIA 4A57A 3G4SN 1HNWK 3OJSA 4GV6A 4CEOA 3BZKA 4X66K 1CZ9A 2IOCA 1YF5L 4OPHA 2KLAA 3F5TA 3NGZA 4I2QA 4RW9A 3AVBA 4H4OA 3LWLA 1MWKA 4GMJB 4DR2K 3UKUA 5SZTA 3HPGA 2QWNA 1RDAA 4KHSA 2F8SA 1JCFA 4RTFD 1KQSM 3HPHA 4LF8K 2ZF5O 4O5BA 4FSVA 4WF9L 1C1BA 1A5XA 2Y1JA 4QS7A 3L2RA 4BRQA 4CZMA 4KI6A 1ZBSA 2Q0RA 4EIAA 1HLUA 2KKZA 4WFAL 3KLGA 4EHUA 4HCCA 1YAGA 3R6MA 4JKEA 1Q9YA 1BL3A 1TK5A 1ZC6A 4WCEL 4DTSA 4CJTA 4Z4FA 1BCOA 1QQOA 3DXKA 5KTQA 4OGCA 2YNIA 4EZ9A 1Z26A 4BQZA 5ADXA 4JI3K 5GIOA 1BI4A 1VSFA 4LH5A 4JI1K 2YV0X 4FXDA 3KKSA 4FW1A 5HLFA 4KHNA 1QE1A 4H0PA 3OS2A 3MAQA 3SJJA 4AILC 2JWKA 4B9TA 3AVJA 5C10A 3LM2A 4WYBA 2D5RA 5GIPA 4CZKA 1ITGA 3MN6A 4ZTFA 1B9FA 1L3VA 3NBPA 5EVZA 2O8FB 1CZAN 2ASPA 1S3XA 4YHHK 1RFQA 4W5OA 5HRNA 2Q31A 1VSHA 3P38A 4CVNE 1MWMA 3MCPA 4FLTA 4DQPA 1TAUA 1C0TA 3K9JA 4FWOA 1DLOA 4FWPA 3OYJA 1RDDA 4NB4A 4B9NA 2ASMA 2HBLA 4OKKA 3OYAA 2VWJA 4BQLA 4A59A 4IBNA 3VQ7A 4BGBA 3QINA 4E3SA 3NHGA 2QKKA 4NLBA 2ZGZA 1FKPA 3THYB 3ZSWA 3L6QA 1EQYA 5AQXA 1YUWA 3LPTA 2ASOA 4NYFA 4A2AA 4KKOA 2A6AA 3EZ5A 4EHTA 4FM1A 3H3NO 3E1YA 4DLGA 4IEIA 4H8KA 1Z05A 1XWLA 4RW8A 1HQUA 3QERA 4BR5A 1RT7A 2Z1HA 3RMCA 3FLCO 2YHXA 5AQUA 4FCYA 4IFYA 3CG7A 3ZSQA 4I2PA 4CZEA 5ADXH 5AQZA 4CHYA 2E88A 1LWCA 2W6KA 3DLGA 4CF1A 3LDSA 5JICA 1T8EA 4LF7K 3LDOA 1E3MA 4IEEA 3SQ0A 1FW6A 5E26A 4OPAA 4LD0A 1NWKA 3KK2A 4IOAL 4DV2K 1X3MA 5M1QA 5HBMA 3VEZA 4O0IA 4DSKA 3VQDA 3DM2A 4IO8A 2OYQA 3BF3A 4PHTX 1J5EK 4CIEA 4YFUA 4DHYA 4CJLA 1Q81O 4XH1A 2PYLA 2XY6A 4FLYA 2FF3B 3KKRA 1RT3A 1X3NA 2Q36A 3AO4A 4ELUA 4Z4GA 3WNGA 4YOYA 4BG8A 2GBZA 5M1KA 1SQKA 1TGOA 3TWHA 5EX5A 3V9UA 1EO1A 3NF6A 3E9OA 5CYQA 4BR9A 1NK8A 2GWJA 4M3XA 1LOTB 1WN7A 2WBNA 3WXKA 4YOUA 2X74A 1FK9A 4OLBA 4O4GA 3RMDA 2UU9K 3KK7A 3N4QA 5D3GA 2HHXA 2WTUA 2VGNA 4BVOA 3DI6A 2OA8A 3AGRA 4M3UA 5JS1A 2X6SA 1WUAA 4DWIA 3OTOK 3K5NA 3C6AA 4CI6A 1TUYA 3AVFA 2E2OA 4H5TA 4OJRA 1BCMA 3O1BA 3FZMA 2LSNA 4BRAA 1QZ5A 3I8BA 4CESA 4LFBK 2O8BA 3J80O 4J2AA 4FJGA 1GLDG 2VG6A 3VPZA 3OW2M 4CERA 1VQ5N 1QVFM 3L2QA 2P5OA 4DV4K 2G8KA 1N33K 5FRMA 4H03B 4ZTJA 4FM2A 1H1VA 2F4VK 1L3TA 3G25A 3T19A 2QM1A 4G1QA 2XO7A 3MECA 3HK2A 4JYAK 2HBKA 4CGFA 3AVGA 3CPWM 4M7XA 5AJ3K 4AF1A 3LZJA 5HRSA 5AQLA 3CYMA 3Q7BA 3U4LA 3CCLN 2G8IA 3SCXA 4U67L 2D4WA 2HW3A 1K6YA 2WC9A 3MWPA 4F4KA 1KVCA 3CM5A 3RSEA 4M45A 4JKDA 2P9SB 1NGIA 4JK8A 3OJUA 1JJ2M 4IZ9A 4JHDA 4HVJA 1J5OA 1NKBA 3H1VX 1RTHA 5HRPA 1CLQA 4B3SK 4FJKA 2ZE2A 3JSMA 3SBTA 1DKGD 5FPNA 3TTCA 3WXJA 3PIPL 5C12A 1QQNA 3AA4A 4XH5A 5BPNA 4EP4A 3WXLA 2BH1A 4CBXA 1HX1A 5EU7A 5CE3A 2O8EB 5I3UA 4EP5A 5BREA 3M8QA 3HRGA 1D9DA 3AVAA 3VGMA 1FJGK 4DTNA 1JXEA 3K5LA 5TKWA 1WSHA 2FLOA 4IJAA 3UB5A 4N47A 1RDWX 4BR2A 4IDHA 4EFHA 4ICLA 2HNYA 1NK4A 4OPJA 4FJHA 4W5TA 1VQNN 2YJFA 3OYFA 1KFSA 3AVLA 3O4NA 3CD6N 4IOCL 1MA9B 1HRHA 4KO0A 2E8AA 3EKSA 2P9KB 3TPQA 3C7NA 4ILHA 1YJNN 1S6QA 4MLHA 3WT0A 1KVBA 3VF6A 3A5MC 3ZEUB 3A5OC 1NGFA 4ISEA 2XY7A 4B9UA 4KRFA 2FSJA 3RTVA 2IDOA 2NRTA 2YHYA 3LALA 4K42A 2F96A 2DFEA 4O55A 3OYIA 4W5QA 4CJEA 1Y97A 4FWSA 4DS5A 1KSPA 5CR4A 1T3VA 3CJ9A 2NRZA 2VQFK 4DSJA 1QZ6A 4JI6K 2YKMA 4O5FA 2HNDA 1BG3A 1LAWA 1HYSA 2XHBA 4KTZA 4FPAA 3OYBA 1BHLA 3SV3A 3JAMO 2HHQA 1C0MA 3UE5A 1X9SA 1EWQA 4DR7K 2BANA 4KB0A 4WQ5C 2NZTA 3VQQA 1JLAA 3SAFA 2D0PA 4M3TA 4DTUA 3BEXA 3I8DA 2OTLN 2IGIA 1E4FT 3PV8A 3FFIA 3ZX2A 1RT4A 3H08A 3R1XA 4CZJA 3ENOA 4X65K 2E5LK 4DQIA 3D2FA 3TSQA 1LW0A 1BU6O 2P9UB 4MQ3A 1RDUA 3LP0A 2ZQBA 3KTQA 5C0YA 3TANA 4BRGA 2F8TA 5GAEP 4DR3K 4DTPA 4DU1A 4MDBA 3P39A 1A5WA 1LWEA 1RGIA 4O8UA 5AZJB 4IDKA 4BC3A 4K41A 3ID8A 2QWOA 4DCHA 4I6MA 4CZHA 3HL8A 4KHQA 4DSLA 2D0OA 4OX9K 4CZLA 2ITMA 1VQ8N 3V9SA 3MX5A 1YJ9N 3WEEA 5IWAK 3ZLJA 3RR7A 1GLCG 3DOKA 4M41A 1O1WA 1KAZA 2NRRA 4Z4HA 2VGMA 4J8FA 1RBUA 3NFAA 3SPZA 3F73A 3QEXA 3C6HA 2Q1NA 4AHUA 4XIUA 3L4QA 1W7AA 4BDPA 3IS9A 4H0XB 3DRSA 3VTHA 1ASUA 4CJ3A 2WONA 3ASMA 2O8DB 3HVTA 4Y1CA 3SYZA 1T05A 2Q97A 2R7YA 1TV6A 1BA0A 1Q8IA 3QIOA 3HVRA 1EP4A 3VQ9A 3KVGA 2XY8A 3L8BA 4FZXC 2NLXA 2PFUA 4CK3A 3VERA 1N5YA 4E1NA 1NJWA 5AR0A 1WAFA 4DTXA 4O0JA 2BTFA 1C1CA 3S3MA 4B8CA 3CCUN 4H5RA 1SV5A 3NCIA 2IAJA 2NRWA 4GVEA 4PL8A 3IUCA 3R9PA 4CEDA 2PYJA 1KLMA 1C0UA 2HOEA 4JRQA 2CGJA 3ZT0A 4X62K 5AQGA 1NGGA 4CJWA 4G9ZA 2YNHA 4BRHA 4F2SA 3MK6A 1TKDA 3SAHA 2DFFA 1ZBLA 4WFNL 2E6LA 1YJWN 3SMSA 4OLAA 1R59O 3DLHA 5KQ8A 2QW9A 5J1EA 4B3TK 2HHSA 2Q3SA 4JD2B 1LW2A 4CGGA 1A5VA 4K25A 4AM6A 4E1JA 1XI1A 1OH7A 4E7JA 5A2QO 2HF3A 2P9PA 3ULEB 2QWPA 4CEFA 4B9SA 1C0GA 3HBTA 4B1XB 1ATRA 1I39A 4NYNA 2GUPA 4JI7K 4GW6A 3OYLA 3DOLA 4H0YB 4FL9A 3S9HA 3ALYA 1WBDA 1ZXOA 1TYQB 1IKWA 4EZ6A 1HNZK 2IS3A 5FPDA 2UUCK 1KTQA 4GNIA 4BRIA 5AQFA 3C6UA 1BIUA 5KGWA 5KQDA 3JXUA 5T7BA 1JKHA 4C8MA 4JI4K 4JRPA 3VA3A 4KREA 1NK6A 1IKYA 3CIPA 3EN9A 4B9LA 1VAZA 2DY4A 4CE9A 1JCGA 4LF5K 3AY9A 3VENA 4B1YB 1XQSC 5J2NA 1RT2A 3G10A 4CGHA 5C25A 3ZSVA 2OZSA 3SV4A 4RW7A 3ITHA 4Y0WA 5LMUK 3UKUB 2WUSA 4KHUA 1HNVA 1UA0A 1ZBUA 4WQ5A 4FYDA 1XNRK 3M1FA 3NH1A 4DV7K 2JWLA 1T6CA 1U48A 3Q7CA 3U8XA 1GOBA 1IBKK 4GKKK 3DMJA 4LFAK 2GV9A 4LH4A 4LF4K 1Z6RA 3A8YA 4QS8A 1NGHA 3AVMA 2FSKA 3FE1A 1XNQK 3VN5A 1Q7YO 3O9RA 3HTVA 5J2MA 3NAEA 3MN7A 2CH5A 2PAVA 3R3LA 4E1MA 3HZ6A 3ZT1A 4AHRA 3LAMA 2AA4A 1QQMA 3DXKB 1N8RO 4K8XA 3QFUA 4E19A 2ZD1A 1QTMA 3NH0A 1DTQA 1RT1A 3ZSOA 1VQ4N 3C94A 3CPEA 4B1UB 1BI4B 1NK5A 3LM9A 3P1GA 3SBGA 3MN5A 4HCBA 2F9TA 2X6NA 4H0VB 3VQ4A 4B1ZA 4KTQA 5HROA 3EE9A 4BR7A 1DT9A 2GTDA 4C1NI 1VK0A 4DFMA 1O13A 4NLCA 4KH6A 5DK5A 3D6RA 2P9LA 1UWBA 2B5JA 4DTMA 1N32K 2ZJRL 3RVCA 3KLFA 1BISA 1CXQA 3O6WA 3OBWA 3OYHA 3VQPA 3J7AP 1KVAA 3KK3A 2UYTA 4ZHRA 3E01A 2FBYA 2I7NA 1QQCA 4JLHA 3LZIA 4N76A 2EHGA 4BRDA 2Q0UA 2O8CA 3L3UA 3V1RA 3E9LA 4CD3A 2CH6A 4CFBA 3OHRA 4JKCA 1VQ6N 4DSFA 2DTUA 1L3UA 1S1XA 2BDPA 2GELA 5DM7L 1YVUA 4NO7A 1LAVA 2GX9A 3UKRB 1Q9XA 3IAYA 4DU3A 3MXJA 4CJKA 4DR1K 4C23A 3LAKA 3U3GA 1NGBA 1VSKA 4KH4A 3B6PA 3SUOA 4PQUA 3O3GA 1ASWA 4FJJA 1WNSA 3A2FA 4BDYA 1U04A 1U49A 3PX4A 3S3NA 1FXXA 1NGCA 3HOSA 1ILYA 3UIQA 4AHVA 1NK7A 4CF0A 4AM7A 4BRKA 5EXWA 3TAEA 3CFRA 4PKHA 3HSTB 1HUXA 3F9MA 5BPLA 5B8HA 2AJQA 5LL6Z 3O4QA 1LCUA 3K58A 1IJJA 3ZETA 3OYEA 4J2EA 3AO2A 1ZBIA 1GLAG 2NNWA 1IKXA 3KJVA 3HO1A 4YOXA 1P8ZA 1ASVA 1ZBFA 4BE0A 3RWUA 3M8SA 3BY5A 4UY8O 3HOTA 2V7ZA 4Y1DA 4FM0A 3CJAA 1KAXA 1C1AA 2FBXA 1J9AA 3S3OA 2RPIA 4MFBA 4BWMA 3VQEA 1K73O 2QEXN 3CQXA 1SZ2A 1DTTA 3C0BA 4NCBA 1BO5O 3DLKA 1EETA 3D2EA 1TVRA 3I56N 3C65A 2ETJA 4RWTA 3K59A 2P9IA 1GOCA 2IVOA 3C6TA 1S1TA 4DFJA 3O3HA 4M3ZA 3VEYA 3DLRA 3CJCA 4FWMA 1TKXA 2ZM6K 1SL1A 3SQ2A 2G8VA 1X1PA 5BN9A 1NLVA 4FPBA 5DMRA 3DYAA 3CQYA 2RE2A 2KFZA 4CJ5A 1NGAA 3AVKA 3THWA 4CJPA 4CEEA 3LDNA 1K8KA 1XUPO 3F2KA 3KZBA 1WAJA 4B9VA 3PX0A 3ENHA 3ZX0A 3TI0A 1RBRA 2D0AA 1WSFA 3T1AA 4WE1A 3SJHA 3L3VA 3TAMA 1W97L 1RDCA 2ZGYA 3OYMA 1RTIA 2FF6A 1XHZA 4RG8A 3ULDA 3MEDA 3O1WA 2O8BB 2UUBK 4B9MA 4FZZA 4DFKA 4BRMA 4H5NA 5JVHL 4LF9K 4NXNK 4RW4A 2Y1IA 5AQIA 2W40A 4Z0UA 1HPMA 4XH4A 2E2QA 2HVHA 1HNIA 2G8WA 2EWSA 3A0IX 3KWGA 2RHKA 3EL2A 2VWBA 4BGAA 5ELZA 4PUOA 3O08A 2EX3A 4NCGA 3ZT3A 4GV9A 4FWRA 1J53A 4N5SA 5FPEA 5BR9A 1UA1A 2QTDA 1MU2A 3MEGA 3VQAA 2NRVA 4C8LA 1VSIA 1HKGA 5AQNA 3VQ5A 4CIGA 4OKEA 1S6PA 5F2RA 4YOVA 3RSEB 5C2DA 4FJNA 4PY5A 4JK7A 3PO4A 4JI2K 2WOMA 1NOYA 4FZYA 4JHDB 4CEBA 4BACA 4JS4A 1NMDA 3IFRA 1GLFO 2F7TA 4BR0A 3AAQA 3TSPA 3FZHA 2A1SA 1U4BA 4JKHA 3VQBA 4BR4A 3BZCA 3VOVA 5AQRA 3NE6A 2Z1IA 1VSEA 3CHWA 3KWIA 3VQCA 3W0LA 1OVYA 2I7PA 1NJZA 4AHCA 2VQEK 5HP1A 3VETA 1KRPA 2RF2A 1U2VA 3V4IA 5J2PA 4JN4A 3V1QA 1NGDA 2X78A 3U9DA 2I5JA 1DGKN 4DV1K 3MDQA 1JL1A 3NH2A 3FZLA 4CF9A 4BRPA 2V52B 3DLBA 3DAWA 1K9MO 5JS2A 2UUAK 3FZFA 3KD5E 1IH7A 3L0QA 3C7NB 4C8KA 3ZT4A 4PL7A 4CJUA 1IBMK 5EY4A 2HHUA 1YIJN 3T1HK 3WXMB 1X9JA 1Q18A 5C15A 4UQGA 3HYFA 2CGLA 2HHTA 3IMXA 1GOAA 3CJ7A 1N34K 5LJWA 2ZJQL 3AVNA 2KZMA 3FZKA 1NBWA 1VRUA 2QWLA 1S1WA 4CIFA 1LV5A 4Z94A 1HR0K 4BRLA 1SKRA 1YI2N 4HTLA 3WXIA 1UOCA 4IJNA 5E41A 2P9NA 3OYCA 2QWRA 5AQMA 3IG1A 3SUNA 3QEWA 3SUQA 4ID1A 1ATNA 3HXMA 3FGUA 4FJ7A 3WNHA 2ITGA 1L3SA 3TAGA 3CJBA 1RCHA 5BRFA 4HHTA 3QFPA 1F21A 4CHOA 3BF1A 4QCLA 1GLBG 2A5XA 5AZJA 3DJCA 3D0PA 1S72N 5KRSA 1T44A 1HMVA 1NKEA 3QDKA 4K8ZA 4OPKA 3P83D 3V81A 2YHWA 1XC3A 3D2FB 1XHXA 1D8YA 4CEQA 4DFPA 3ATUA 4JKGA 5FRNA 4RCHA 4E0DA 4FVUA 1BGXT 3FR0A 1ZYQA 3K9KA 1K8AO 1YXQA 4FWNA 1HKBA 2V51B 4OKJA 4CFDA 2HHVA 3THVA 2YHAA 4CJ4A 1IG8A 1D4XA 3P31A 4I6MB 1V4TA 4DR4K 3H45C 4QAGA 1T7PA 4ELVA 1UAXA 3OYDA 1NKCA 3E66A 3ZSXA 1NG9A 3TU5A 3VQ8A 2E20A 3H1QA 4NCAA 1EXQA 4CW7B 5AZIB 3LP3A 1M1KO 2Z1GA 4JI8K 4CD1A 2E2NA 3MX2A 5H1SQ 3PO5A 3VGKA 2QWMA 1VQPN 2BE2A 2F9WA 3LP2A 3B6OA 3DXMA 1LWFA 4MO5A 1D9FA 5KPRA 1Y64A 2D0CA 1NM1A 3SK3A 1TUUA 4KFBA 1JLBA 2ATQA 5JMVA 5SWMA 3CJ1A 5JLHA 5AQPA 4NXMK 1N6QA 1T6DA 1BUPA 1SUQA 2HBMA 3CETA 1VQ9N 4DV0K 3DRRA 3GL1A 3T69A 4FJ9A 2YNGA 2KHOA 3BP8A 3VESA 4BC5A 3CCRN 2IIRA 3EYZA 4ILGB 4B9QA 3VA0A 3J8AA 4AHTA 1NJIO 2VYPA 3SQ1A 4JKAA 2VCPA 3OYGA 1JCEA 4FOEA 3L2UA 3O3FA 1S22A 4JKBA 4BRFA 3V9WA 4OO1J 1CXUA 3QIPA 4HWIA 1RT6A 3CXCM 4DV3K 3P5JA 3J81O 4GY2B 4FJ8A 3THXB 1RILA 3CMEN 3M5RA 4LSNA 2GEMA 2G8UA 1SKSA 1X9WA 3JYTA 4Q0BA 3AO5A 4CK1A 1ATSA 3HSCA 2V7YA 4F3TA 2QK9A 2XRIA 2O4IA 2P5GA 5F1XA 3WUHA 2JLEA 1JLQA 3MXIA 4JKFA 3MXMA 2VWKA 3ID6A 1YITN 1QHTA 2P9PB 3EO3A 4YNQA 4M7YA 5BRDA 3T3FA 4L8RB 2B4JA 3L4IA 4MO4A 3I55N 1TAQA 3VEWA 2ZJPL 1JLFA 1SAZA 3TAFA 4CBWA 1NU0A 3D7EO 3G71N 3AO1A 3LANA 4KV8A 5GAHP 2E2PA 3W3DA 4DQQA 4BC4A 5GADP 1GLEG 4PKGA 3TAQA 4CHNA 4BY9C 1C0FA 3O9TA 1KFDA 2QA4N 4PKIA 1KC8O 1IV0A 3H46O 3U9ZA 5AQYA 3TTDA 3J7YP 3EKUA 3WQTA 4DQSA 1OH5A 3AA2A 4DUZK 4K0KK 2RN2A 3T7ZA 5LJVA 1BDGA 2NRHA 1SL0A 4DKWA 3K0SA 1WBBA 3A5NC 1X9MA 2YJEA 1VRTA 3KLIA 3SUPA 5BN8A 2P51A 2W41A 3HI0A 1R0AA 4CHQA 3SAGA 2HBJA 3K2PA 1E4GT 1VQKN 1U47A 3MCAB 2PBDA 4BC2A 1WOQA 4CFAA 1HKCA 1KAYA 2O8FA 3ZCMA 3O9UA 3VEXA 4FWQA 1B9DA 1QHAA 3RMBA 4ELTA 4I9QA 2H3GX 3NF7A 3DWLA 3MN9A 5AQOA 5HOOA 3I0RA 4CZFA 3RRGA 3GE1A 1NK0A 3RR8A 1N36K 4KBOA 4B1WB 3G6EN 4R79A 3MMVA 5AQTA 4DR5K 4DS4A 3KLHA 4HUEA 3V6DA 3ENBA 4YOTA 5C42A 3V9XA 4BDZA 4CK2A 4JI0K 1BQNA 1WSIA 2DFHA 3VGLA 1J54A 2KFNA 3SNNA 3CF5L 4FW2A 4DV6K 3THYA 4LC9B 2QKBA 1TK8A 1YT3A 3QNOA 3LL3A 1T03A 1QS4A 4F8RA 4N56A 2E4LA 1S9GA 3QESA 4CJFA 3VF4A 2WFBA 4GKJK 1NMNA 4ISFA 4BE1A 4DLEA 3CC7N 4FK2A 1EKEA 3PSFA 1MDUB 3UKRA 5CZ2A 1VSLA 4CJ7A 2FBVA 2P9LB 3ZSZA 3LDPA 3RRHA 1G99A 1WSGA 5TKYA 3TAPA 1KCFA 4CBUA 4M42A 1BIZA 1XMQK 3WNEA 1TKZA 4DTRA 2BUPA 2YCHA 4BRNA 2O8CB 5I9EB 1TKTA 1RDBA 3CCQN 3TSUA 3CCJN 4IFEA 3R8EA 5LMNK 3AGKA 4WQ4C 4KB1A 4ILJA 1S1VA 4JS5A 1OH8A 1JLCA 3HM9A 2NUBA 3CCEN 4KI4A 4CGJA 4E7IA 2E1YA 5AQJA 4CGIA 3CCMN 1JLGA 1W0HA 3MWTA 5CY4A 5E84A 4IOXA 3K5MA 2OCEA 1G15A 4KPYA 3SPYA 3TTFA 3V9ZA 3ZYYX 4FOIA 1P90A 3SMPA 2BGGA 4CFCA 4B8AB 3LWMA 3NMUA 3E9PA 4DSEA 1W2BM 3LDLA 4TSXA 3QB0A 4C8OA 3SZ2A 1I94K 4FLVA 4IWVA 2OZMA 3HJFA 3PLAA 4AHSA 4IXCA 1CZBA 3CQ8A 2OPPA 3AO3A 3AVCA 4CECA 4DF4A 4DU4A 3M6GA 4BWJA 2HNZA 5KI6A 4PWDA 3FFKB 3I0SA 2HF4A 3VF2A 3VMFB 2KTQA 3N4PA 2HSTA 2B6AA 1FKOA 4F2RA 3ZETB 3ZT2A 1VSMA 1YTAA 3PUFA 3RMAA 3QLHA
chains in the Genus database with same CATH topology
1BA0A 3U9DA 4BROA 2FSNA 2OANA 3KVGA 4H0PA 3CC4N 1DGKN 3QBWA 3MDQA 2NLXA 2PFUA 2IVNA 3VERA 3KHYA 4KH5A 3J7ZO 3FZLA 2JWKA 5AR0A 4L3QA 4BRPA 2V52B 5AQSA 5C10A 3DAWA 3QBXA 1K9MO 3LM2A 2BTFA 4WYBA 4BREA 5GIPA 4CZKA 3MN6A 4IO9L 1VQON 3CERA 3D2EB 2QI2A 5KPZA 3NVKA 1J6ZA 3FZFA 5EVZA 3CCUN 1CZAN 2ASPA 2P9IB 1S3XA 3L0QA 4H5RA 3C7NB 3H3OB 4GV3A 1RFQA 4JK9A 1V4SA 2NRWA 4GVEA 4PL8A 3IUCA 3R9PA 2Q31A 4BVPA 4PL7A 3P38A 5C2FA 5EY4A 1MWMA 1YIJN 3MCPA 2HOEA 3WXMB 1X9JA 1Q18A 2CGJA 5C15A 2CGLA 3K9JA 4FWOA 5AQGA 3IMXA 1NGGA 3CJ7A 4FWPA 4G9ZA 4BRHA 5GAGP 2QXLA 3MK6A 4NB4A 5BPMA 5LJWA 3SAHA 2ZJQL 4DQ8A 3FZKA 1K8KB 1NBWA 2QWLA 4WFNL 2ASMA 3EE8A 1YJWN 3SMSA 4Z94A 2HBLA 1R59O 4BRLA 4YORA 4BQLA 1YI2N 5KQ8A 4HTLA 4A59A 2QW9A 4BGBA 3WXIA 4BRCA 2FXUA 3O9SA 4JD2B 4IJNA 4K25A 2P9NA 4AM6A 4E1JA 4NLBA 2QWRA 2ZGZA 5AQMA 2HF3A 3L6QA 2P9PA 1ATNA 2QWPA 2D1KA 1EQYA 5AQXA 1C0GA 1YVNA 1YUWA 1ATRA 2P9SA 3FGUA 3HBTA 4B1XB 2ASOA 5GINA 2GUPA 4A2AA 5JLFA 2A6AA 3CJBA 4EHTA 3H3NO 5BRFA 3E1YA 4H0YB 2E1ZA 2IVPA 4FL9A 4IEIA 3QFPA 1Z05A 1ZXOA 3BF1A 1TYQB 5AQVA 4CZIA 1GLBG 2A5XA 5AZJA 3DJCA 5FPMA 5FPDA 1S72N 5AQWA 4GNIA 1T44A 4BR5A 4BRIA 3AARA 3VEOA 3QDKA 3FLCO 5AQFA 2YHXA 5AQUA 4C1NK 2YHWA 1XC3A 5BRHA 3D2FB 5KQDA 3JXUA 1NGJA 3CMAN 4CZEA 5ADXH 3IKMA 1U6ZA 5AQZA 3ATUA 4JKGA 4RCHA 2E88A 2CGKA 3CIPA 3EN9A 5JICA 4H5WA 5LY3A 4FVUA 1VAZA 4H5VA 3LDOA 3FR0A 1JCGA 3K9KA 1K8AO 2A40A 4IEEA 3AY9A 3VENA 4B1YB 1XQSC 1YXQA 1Q86O 5E26A 4FWNA 4OPAA 1HKBA 2V51B 1NWKA 3M3ZA 4MDAA 4IOAL 3ZX3A 1X3MA 5M1QA 4Y0WA 1IG8A 1D4XA 3UKUB 2WUSA 3P31A 3VEZA 2P9KA 4I6MB 4WQ5A 3M1FA 1V4TA 4IO8A 3BF3A 4PHTX 3H45C 2JWLA 4JAXA 1T6CA 4DHYA 1Q81O 3Q7CA 4XH1A 4YDUC 3U8XA 3E66A 2FF3B 3TU5A 1X3NA 2Q36A 2E20A 3H1QA 3B8AX 3GOIA 4YOYA 4BG8A 1Z6RA 5M1KA 3A8YA 4QS8A 1SQKA 1NGHA 5AZIB 3ZEUA 5MLCQ 1M1KO 5EX5A 1EO1A 2FSKA 4CD1A 3E9OA 3FE1A 4BR9A 1Q7YO 2E2NA 2GWJA 3O9RA 3MX2A 3HTVA 5H1SQ 1GLJO 3JS6A 1VQLN 3VGKA 1LOTB 2QWMA 1VQPN 2CH5A 2PAVA 2WBNA 2F9WA 3MN7A 4YOUA 3WXKA 3DXMA 3R3LA 3HZ6A 3KK7A 5EOYA 3N4QA 4MLEA 2AA4A 4MO5A 4CZGA 1QQMA 3DXKB 2VGNA 5KPRA 1Y64A 1N8RO 4BVOA 4WQ4A 3QFUA 3O5BA 5F0XA 5AFUA 2HMPA 3O9QA 3AGRA 1U2VB 2A41A 1NM1A 3SK3A 1TUUA 1WUAA 1BWFO 1GLLO 1VQ4N 3CPEA 4B1UB 3C6AA 4CI6A 1TUYA 3LM9A 5JMVA 2E2OA 4QS9A 3CJ1A 3SBGA 4H5TA 4A61A 1KXPA 5JLHA 3O1BA 5AQPA 3FZMA 1HJOA 3MN5A 2F9TA 4BRAA 1QZ5A 1ESVA 3I8BA 4H0VB 1T6DA 1BUPA 4B1ZA 2HBMA 3CETA 1VQ9N 3EZWA 3CCVN 3EE9A 3GL1A 1GLDG 3T69A 4BR7A 1DT9A 2KHOA 3BP8A 3OBYA 3VESA 4U7BA 4BC5A 3VPZA 3CCRN 2GTDA 4BG9A 4C1NI 3OW2M 1VQ5N 1QVFM 2IIRA 4DB3A 4ILGB 3CCSN 4B9QA 3NVMA 3J8AA 1NJIO 4A62A 1O13A 5M1FA 2VYPA 4NLCA 4KH6A 3WQUA 1BOTO 3D6RA 4JKAA 4EAHD 2P9LA 2ZWHA 2VCPA 2ZJRL 3RVCA 4H03B 1JCEA 1H1VA 3DLLL 4FOEA 3O6WA 1S22A 3OBWA 4JKBA 2UYTA 4BRFA 4OO1J 3G25A 2I7NA 4HWIA 1VQ7N 3CXCM 2QM1A 4BRDA 4GY2B 2Q0UA 4K43A 2P9UA 3E9LA 3CMEN 2HBKA 4CD3A 3HM8A 2CH6A 3M5RA 3CPWM 2GEMA 4M7XA 3OHRA 4AF1A 4JKCA 1VQ6N 5AQLA 1ATSA 3HSCA 4JEPA 4XEIA 3Q7BA 2V7YA 4YOWA 1YHQN 2GELA 3U4LA 3CCLN 5DM7L 4NO7A 3UKRB 2GX9A 4U67L 2D4WA 5AQHA 5F1XA 3WUHA 2Q2RA 4C23A 2WC9A 2P9NB 3MWPA 4JKFA 3ID6A 3RSEA 3ATVA 4JNEA 1YITN 4JKDA 2P9PB 1NGBA 3EO3A 3I33A 4KH4A 1BA1A 5M1OA 2P9SB 1NGIA 4JK8A 4M7YA 5BRDA 1JJ2M 5AQKA 3S41A 4IZ9A 2NRXA 1DEJA 3O80A 3L4IA 4JHDA 4MO4A 3I55N 1VQMN 3H1VX 3VEWA 2ZJPL 2OTJN 1SAZA 4CBWA 3D7EO 3SBTA 1DKGD 5FPNA 3TTCA 3WXJA 3G71N 1NGCA 5C12A 3PIPL 3HOSA 5GAHP 1ILYA 2E2PA 3W3DA 1QQNA 4F9OA 4BC4A 5GADP 3GDQA 4XH5A 5BPNA 4AM7A 1GLEG 5EXWA 3WXLA 4PKGA 2YI1A 4BRKA 2BH1A 4CBXA 1HX1A 5CE3A 4BY9C 1C0FA 4PKHA 1HUXA 3O9TA 3F9MA 5BPLA 4FO0A 5B8HA 2QA4N 4PKIA 1KC8O 5BREA 2GWKA 2AP1A 3H46O 2A3ZA 3U9ZA 5AQYA 3TTDA 3AAPA 2YX6A 1QVGM 3EKUA 3WQTA 1LCUA 3HRGA 3VEVA 1IJJA 3ZETA 1Q82O 3P4IA 3VGMA 3T7ZA 5LJVA 1BDGA 2NRHA 5AFUH 1GLAG 2NNWA 4DKWA 4JKGB 5TKWA 3A5NC 2FLOA 4IJAA 3UB5A 1P8ZA 1RDWX 2QWQA 5DM6L 2YJEA 4BR2A 4IDHA 3WEEB 5AZIA 4EFHA 5BN8A 2W41A 4UY8O 3HOTA 2V7ZA 3HI0A 3CJAA 1KAXA 3QICA 4O8KA 3SAGA 2HBJA 3CI5A 1VQNN 1E4GT 1K73O 1VQKN 2QEXN 2YJFA 3CQXA 1SZ2A 3C0BA 3CD6N 4H0OA 4IOCL 1BO5O 3MCAB 2PBDA 1MA9B 4BC2A 3D2EA 1WOQA 5M1NA 2E8AA 3I56N 3C65A 1HKCA 1KAYA 3EKSA 2P9KB 4RWTA 3O9UA 2P9IA 3TPQA 3VEXA 4FWQA 4H0TB 3C7NA 4ILHA 1QHAA 1YJNN 2IVOA 5AQQA 1M90O 4M63C 2H3GX 3VEYA 3O4WA 3DWLA 3MN9A 5AQOA 3CJCA 5HOOA 4CZFA 4FWMA 3GE1A 3VTIA 3OA9A 4MLHA 5BN9A 1NLVA 4FPBA 1OKJA 5M1PA 3WT0A 4KBOA 4B1WB 3G6EN 3CQYA 2RE2A 4R79A 3MMVA 1NGAA 5AQTA 3A5MC 3VF6A 3ZEUB 3A5OC 3H6EA 1NGFA 4ISEA 4FWKA 3ENBA 3LDNA 4YOTA 1K8KA 3IDHA 4B1VA 1XUPO 3F2KA 2FSJA 3KZBA 2NRTA 2YHYA 4K42A 3DXMB 4WFBL 5JVGL 3QMLA 3CC2N 3VGLA 3ENHA 4FWSA 3ZX0A 5CR4A 4A5AA 2A42A 3O8MA 4JD2A 1T3VA 3SJHA 3PIOL 3CJ9A 1W97L 2NRZA 3CF5L 1QZ6A 2ZGYA 4ISGA 3LDQA 4O5FA 3SLCA 1BG3A 2FF6A 3GG4A 4LC9B 3ULEA 4FWLA 4A2BA 4FPAA 3LL3A 3O1WA 3GBTA 5KPTA 3UE5A 4YDUA 4BRMA 3VF4A 4H5NA 5JVHL 4WQ5C 2WFBA 5AQIA 2NZTA 4ISFA 5CHIA 2W40A 3SAFA 3CC7N 1HPMA 4XH4A 1TYQA 1MDUB 3UKRA 1NGEA 2E2QA 4CJ7A 2D0PA 2EWSA 3A0IX 3BUZB 3KWGA 2RHKA 3EL2A 2VWBA 1SS6A 2P9LB 3BEXA 4BGAA 2DPNA 5HL7L 3LDPA 2OTLN 1KD1O 5ELZA 1G99A 1E4FT 2J4RA 5TKYA 3ZX2A 4CBUA 3A5LC 3R1XA 4CZJA 4A5BA 3ENOA 3D2FA 3TSQA 3O08A 4A57A 3G4SN 2BUPA 1BU6O 2YCHA 4BRNA 2P9UB 1RDUA 5I9EB 4GV6A 3CCQN 5C0YA 4GV9A 3TSUA 4FWRA 4BRGA 3CCJN 4IFEA 1YF5L 5GAEP 3R8EA 5FPEA 3AGKA 5BR9A 4WQ4C 2QTDA 4ILJA 2KLAA 4MDBA 4OPHA 3F5TA 3P39A 3CCEN 2NRVA 1RGIA 4O8UA 1HKGA 5AZJB 5AQNA 2E1YA 5AQJA 1MWKA 3CCMN 4BC3A 4K41A 3MWTA 3UKUA 3ID8A 5F2RA 4YOVA 2QWOA 5E84A 4I6MA 4IOXA 2QWNA 4CZHA 3RSEB 4DCHA 1JCFA 4RTFD 1KQSM 5C2DA 2D0OA 3TTFA 2ZF5O 3ZYYX 4FOIA 1P90A 4JK7A 4CZLA 3SMPA 2ITMA 4FSVA 4WF9L 3ULEB 1VQ8N 1YJ9N 3MX5A 4JHDB 4YOXA 3NMUA 3E9PA 1W2BM 3WEEA 4QS7A 3LDLA 1NMDA 3QB0A 3IFRA 1GLFO 2F7TA 4BRQA 4BR0A 4CZMA 3AAQA 3PLAA 4IWVA 1GLCG 3TSPA 1ZBSA 4IXCA 2Q0RA 4EIAA 1HLUA 2KKZA 3FZHA 4WFAL 4EHUA 4JKHA 4BR4A 1KAZA 2NRRA 1YAGA 3R6MA 5AQRA 2VGMA 4J8FA 4JKEA 3VOVA 3M6GA 3FFKB 3CHWA 3KWIA 3C6HA 2HF4A 2Q1NA 3VF2A 3VMFB 3W0LA 1OVYA 1ZC6A 4WCEL 2I7PA 3L4QA 3N4PA 1QQOA 2HSTA 3DXKA 4H0XB 3VETA 3VTHA 4BQZA 5ADXA 3ZETB 1U2VA 5GIOA 4JN4A 2Q97A 1NGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BA0 A;  3U9D A;  4BRO A;  2FSN A;  2OAN A;  3KVG A;  4H0P A;  1DGK N;  3QBW A;  3MDQ A;  2NLX A;  2IVN A;  3VER A;  3KHY A;  3FZL A;  5AR0 A;  4L3Q A;  4BRP A;  2V52 B;  5AQS A;  3DAW A;  3QBX A;  3LM2 A;  2BTF A;  4WYB A;  4BRE A;  4CZK A;  3MN6 A;  3CER A;  3D2E B;  5KPZ A;  1J6Z A;  3FZF A;  5EVZ A;  1CZA N;  2ASP A;  2P9I B;  1S3X A;  3L0Q A;  4H5R A;  3C7N B;  3H3O B;  1RFQ A;  1V4S A;  3R9P A;  4PL8 A;  3IUC A;  2Q31 A;  4BVP A;  4PL7 A;  5EY4 A;  1MWM A;  3MCP A;  2HOE A;  1X9J A;  1Q18 A;  2CGJ A;  2CGL A;  4FWO A;  5AQG A;  3IMX A;  1NGG A;  3CJ7 A;  4FWP A;  4BRH A;  2QXL A;  3MK6 A;  4NB4 A;  5BPM A;  5LJW A;  4DQ8 A;  3FZK A;  1K8K B;  1NBW A;  2QWL A;  2ASM A;  3SMS A;  4Z94 A;  1R59 O;  4BRL A;  4BQL A;  5KQ8 A;  4HTL A;  2QW9 A;  4BGB A;  3WXI A;  4BRC A;  2FXU A;  4JD2 B;  4IJN A;  4K25 A;  2P9N A;  4AM6 A;  4E1J A;  2QWR A;  2ZGZ A;  5AQM A;  2HF3 A;  3L6Q A;  2P9P A;  1ATN A;  2QWP A;  2D1K A;  1EQY A;  5AQX A;  1C0G A;  1YVN A;  1YUW A;  1ATR A;  2P9S A;  3FGU A;  3HBT A;  4B1X B;  2ASO A;  2GUP A;  4A2A A;  5JLF A;  2A6A A;  3CJB A;  4EHT A;  3H3N O;  5BRF A;  4H0Y B;  2E1Z A;  2IVP A;  4FL9 A;  3QFP A;  1Z05 A;  1ZXO A;  3BF1 A;  1TYQ B;  5AQV A;  4CZI A;  1GLB G;  2A5X A;  5AZJ A;  3DJC A;  5FPM A;  5FPD A;  5AQW A;  4GNI A;  1T44 A;  4BR5 A;  4BRI A;  3AAR A;  3VEO A;  3QDK A;  3FLC O;  5AQF A;  2YHX A;  5AQU A;  2YHW A;  1XC3 A;  5BRH A;  3D2F B;  5KQD A;  3JXU A;  1NGJ A;  4CZE A;  5ADX H;  1U6Z A;  5AQZ A;  3ATU A;  4RCH A;  2E88 A;  2CGK A;  3CIP A;  3EN9 A;  5JIC A;  4H5W A;  5LY3 A;  4H5V A;  3LDO A;  3FR0 A;  1JCG A;  2A40 A;  3AY9 A;  3VEN A;  4B1Y B;  1XQS C;  1YXQ A;  5E26 A;  4FWN A;  1HKB A;  2V51 B;  1NWK A;  3M3Z A;  3ZX3 A;  1X3M A;  4Y0W A;  1IG8 A;  1D4X A;  3UKU B;  2WUS A;  3VEZ A;  2P9K A;  4I6M B;  4WQ5 A;  3M1F A;  1V4T A;  4IO8 A;  3BF3 A;  3H45 C;  4JAX A;  1T6C A;  4DHY A;  4XH1 A;  4YDU C;  3U8X A;  2FF3 B;  3TU5 A;  1X3N A;  2Q36 A;  2E20 A;  3H1Q A;  3B8A X;  3GOI A;  4BG8 A;  1Z6R A;  3A8Y A;  4QS8 A;  1SQK A;  1NGH A;  5AZI B;  3ZEU A;  5EX5 A;  2FSK A;  4CD1 A;  3FE1 A;  4BR9 A;  2E2N A;  2GWJ A;  3HTV A;  1GLJ O;  3JS6 A;  3VGK A;  1LOT B;  2QWM A;  2CH5 A;  2PAV A;  3MN7 A;  2F9W A;  3WXK A;  3DXM A;  3HZ6 A;  5EOY A;  4MLE A;  2AA4 A;  4MO5 A;  4CZG A;  1QQM A;  3DXK B;  5KPR A;  1Y64 A;  4BVO A;  4WQ4 A;  3QFU A;  3O5B A;  5F0X A;  5AFU A;  2HMP A;  1U2V B;  2A41 A;  1NM1 A;  3SK3 A;  1TUU A;  1WUA A;  1BWF O;  1GLL O;  4B1U B;  4CI6 A;  1TUY A;  3LM9 A;  5JMV A;  2E2O A;  4QS9 A;  3CJ1 A;  4H5T A;  4A61 A;  1KXP A;  5JLH A;  3O1B A;  5AQP A;  3FZM A;  1HJO A;  3MN5 A;  2F9T A;  4BRA A;  1QZ5 A;  1ESV A;  3I8B A;  4H0V B;  1T6D A;  1BUP A;  4B1Z A;  3CET A;  3EZW A;  3GL1 A;  1GLD G;  4BR7 A;  2KHO A;  3BP8 A;  3VES A;  4BC5 A;  3VPZ A;  2GTD A;  4BG9 A;  2IIR A;  4DB3 A;  4B9Q A;  3J8A A;  4A62 A;  2VYP A;  3WQU A;  1BOT O;  4EAH D;  2P9L A;  2ZWH A;  2VCP A;  4H03 B;  1JCE A;  1H1V A;  4FOE A;  3O6W A;  1S22 A;  2UYT A;  4BRF A;  3G25 A;  2I7N A;  4HWI A;  2QM1 A;  4BRD A;  4GY2 B;  2Q0U A;  4K43 A;  2P9U A;  4CD3 A;  3HM8 A;  2CH6 A;  2GEM A;  4M7X A;  3OHR A;  5AQL A;  1ATS A;  3HSC A;  4XEI A;  2V7Y A;  2GEL A;  3U4L A;  4NO7 A;  3UKR B;  2D4W A;  5AQH A;  5F1X A;  3WUH A;  2Q2R A;  4C23 A;  2P9N B;  3RSE A;  3ATV A;  4JNE A;  2P9P B;  1NGB A;  3EO3 A;  3I33 A;  1BA1 A;  2P9S B;  1NGI A;  4M7Y A;  5BRD A;  5AQK A;  3S41 A;  4IZ9 A;  1DEJ A;  3O80 A;  3L4I A;  4JHD A;  4MO4 A;  3H1V X;  3VEW A;  1SAZ A;  4CBW A;  3D7E O;  1DKG D;  5FPN A;  3WXJ A;  1NGC A;  2E2P A;  3W3D A;  1QQN A;  4F9O A;  4BC4 A;  3GDQ A;  4XH5 A;  5BPN A;  4AM7 A;  1GLE G;  5EXW A;  3WXL A;  4PKG A;  2YI1 A;  4BRK A;  5CE3 A;  4CBX A;  1HX1 A;  1C0F A;  4PKH A;  1HUX A;  3F9M A;  5BPL A;  4FO0 A;  5B8H A;  4PKI A;  5BRE A;  2GWK A;  2AP1 A;  3H46 O;  2A3Z A;  3U9Z A;  5AQY A;  3AAP A;  3EKU A;  3WQT A;  1LCU A;  3VEV A;  1IJJ A;  3ZET A;  3P4I A;  3VGM A;  5LJV A;  1BDG A;  2NRH A;  5AFU H;  1GLA G;  3A5N C;  2FLO A;  4IJA A;  3UB5 A;  1P8Z A;  1RDW X;  2QWQ A;  2YJE A;  4BR2 A;  3WEE B;  5AZI A;  4EFH A;  5BN8 A;  2W41 A;  2V7Z A;  3HI0 A;  3CJA A;  1KAX A;  3QIC A;  4O8K A;  3CI5 A;  1E4G T;  2YJF A;  3CQX A;  1SZ2 A;  3C0B A;  4H0O A;  1BO5 O;  2PBD A;  1MA9 B;  4BC2 A;  3D2E A;  1WOQ A;  2E8A A;  3EKS A;  1HKC A;  1KAY A;  2P9K B;  4RWT A;  2P9I A;  3TPQ A;  3VEX A;  4FWQ A;  4H0T B;  3C7N A;  1QHA A;  2IVO A;  5AQQ A;  4M63 C;  2H3G X;  3VEY A;  3O4W A;  3DWL A;  3MN9 A;  5AQO A;  3CJC A;  4CZF A;  4FWM A;  3GE1 A;  4MLH A;  5BN9 A;  1NLV A;  4FPB A;  1OKJ A;  3WT0 A;  4KBO A;  4B1W B;  3CQY A;  3MMV A;  1NGA A;  5AQT A;  3A5M C;  3VF6 A;  3ZEU B;  3A5O C;  3H6E A;  1NGF A;  4ISE A;  4FWK A;  3LDN A;  1K8K A;  3IDH A;  4B1V A;  1XUP O;  2FSJ A;  3KZB A;  2YHY A;  4K42 A;  3DXM B;  3QML A;  3VGL A;  3ENH A;  4FWS A;  3ZX0 A;  2A42 A;  3O8M A;  4JD2 A;  3SJH A;  3CJ9 A;  1QZ6 A;  2ZGY A;  4ISG A;  3LDQ A;  4O5F A;  3SLC A;  1BG3 A;  2FF6 A;  3GG4 A;  4LC9 B;  3ULE A;  4FWL A;  4A2B A;  4FPA A;  3LL3 A;  3O1W A;  3GBT A;  5KPT A;  3UE5 A;  4YDU A;  4BRM A;  3VF4 A;  4H5N A;  4WQ5 C;  5AQI A;  2NZT A;  4ISF A;  2W40 A;  1HPM A;  4XH4 A;  1TYQ A;  1MDU B;  3UKR A;  1NGE A;  2E2Q A;  4CJ7 A;  2D0P A;  2EWS A;  3A0I X;  3BUZ B;  3EL2 A;  2VWB A;  2P9L B;  3BEX A;  4BGA A;  2DPN A;  3LDP A;  5ELZ A;  1G99 A;  1E4F T;  2J4R A;  5TKY A;  3ZX2 A;  4CBU A;  3A5L C;  4CZJ A;  3ENO A;  3D2F A;  3O08 A;  2BUP A;  1BU6 O;  2YCH A;  4BRN A;  2P9U B;  5I9E B;  4FWR A;  4BRG A;  3R8E A;  5FPE A;  5BR9 A;  4WQ4 C;  1RGI A;  1HKG A;  5AZJ B;  5AQN A;  2E1Y A;  5AQJ A;  1MWK A;  4BC3 A;  4K41 A;  3UKU A;  3ID8 A;  5F2R A;  2QWO A;  5E84 A;  4I6M A;  4DCH A;  2QWN A;  4CZH A;  3RSE B;  1JCF A;  4RTF D;  2D0O A;  2ZF5 O;  4FOI A;  4CZL A;  3SMP A;  2ITM A;  4FSV A;  3ULE B;  4JHD B;  3WEE A;  4QS7 A;  3LDL A;  1NMD A;  3QB0 A;  3IFR A;  1GLF O;  4BRQ A;  4CZM A;  4BR0 A;  3AAQ A;  4IWV A;  1GLC G;  1ZBS A;  4IXC A;  2Q0R A;  4EIA A;  1HLU A;  3FZH A;  4EHU A;  4BR4 A;  1KAZ A;  5AQR A;  1YAG A;  3R6M A;  3VOV A;  4J8F A;  3M6G A;  3FFK B;  3CHW A;  2HF4 A;  2Q1N A;  3VF2 A;  3W0L A;  1ZC6 A;  2I7P A;  1QQO A;  3DXK A;  4H0X B;  3VET A;  4BQZ A;  5ADX A;  3ZET B;  1U2V A;  4JN4 A;  2Q97 A;  1NGD A; 
#chains in the Genus database with same CATH topology
 3DRP A;  4BRO A;  2FSN A;  4QOZ B;  2OAN A;  3G0Z A;  3CC4 N;  4FLX A;  3QEV A;  3F9K A;  3QBW A;  2IVN A;  1S9E A;  3KHY A;  4KH5 A;  3J7Z O;  1OH6 A;  4L3Q A;  5AQS A;  3QBX A;  3AVI A;  4BRE A;  4BE2 A;  4IO9 L;  1VQO N;  3CER A;  3D2E B;  1C6V A;  2QI2 A;  5KPZ A;  3NVK A;  1J6Z A;  1IKV A;  3CFO A;  4FVM A;  2P9I B;  3H3O B;  4GV3 A;  3NDK A;  2FBT A;  4JK9 A;  1V4S A;  4OVL A;  4J2D A;  1IO2 A;  4BVP A;  5C2F A;  3OY9 A;  4RW6 A;  3OS1 A;  4FJI A;  4O44 A;  4CF2 A;  4AH9 A;  3LPU A;  3THW B;  5GAG P;  2QXL A;  5BPM A;  4DSI A;  4DQ8 A;  1K8K B;  2VG5 A;  3EE8 A;  3IRX A;  4YOR A;  1L5U A;  2YNF A;  4DG1 A;  4CJR A;  4I9L A;  2GUI A;  1NOZ A;  4BRC A;  2FXU A;  3O9S A;  1U45 A;  3L2V A;  2IC3 A;  1S5J A;  1JLE A;  3KK1 A;  1QSY A;  4FJ5 A;  2HHW A;  2D1K A;  3BDP A;  1YVN A;  2P9S A;  2HHH K;  5FDL A;  5GIN A;  3L2W A;  5JLF A;  2G8F A;  4IFV A;  4KHY A;  2E1Z A;  2IVP A;  5BR8 K;  3HP6 A;  1RTD A;  5AQV A;  1IBL K;  4CZI A;  5FPM A;  2O8E A;  5AQW A;  3AAR A;  3AV9 A;  3VEO A;  3PY8 A;  4HUF A;  1TK0 A;  1SKW A;  4C1N K;  2OPR A;  4KHP K;  5BRH A;  1NGJ A;  4CJV A;  4F3O A;  3BGR A;  3CMA N;  4JI5 K;  2HMI A;  3IKM A;  1RBS A;  1U6Z A;  3ISN C;  2CGK A;  4DQR A;  4OGE A;  4E89 A;  4H5W A;  5LY3 A;  4H5V A;  1HQE A;  2A40 A;  2YKN A;  3VQ6 A;  1Q86 O;  1XC9 A;  3AA5 X;  1VHX A;  3HP9 A;  5FRO A;  3M3Z A;  4MDA A;  3ZX3 A;  2W42 A;  4KAZ A;  4IG3 A;  3HPO A;  1TL3 A;  5J2Q A;  5IT9 O;  2P9K A;  4CHP A;  4FJL A;  4DUY K;  4JAX A;  3V1O A;  4I7F A;  4YDU C;  5C24 A;  2KW4 A;  3HT3 A;  4Z4I A;  4CJQ A;  3B8A X;  3GOI A;  3ZEU A;  5MLC Q;  1NJX A;  1VQL N;  1GLJ O;  3JS6 A;  4DTO A;  4CJS A;  4DV5 K;  3NF8 A;  4FK4 A;  5EOY A;  5KGX A;  4MLE A;  4CZG A;  4LSL A;  4WQ4 A;  4KHW A;  3O5B A;  5F0X A;  5AFU A;  2HMP A;  3O9Q A;  1U2V B;  2HB5 A;  2A41 A;  1BWF O;  1GLL O;  1I3A A;  4FLW A;  4QS9 A;  4A61 A;  1KXP A;  1HJO A;  1ESV A;  2PZS A;  4FLU A;  4LY7 A;  3ZSR A;  4M3Y A;  3EZW A;  3CCV N;  3TR8 A;  1HPZ A;  1S1U A;  3OBY A;  2JGU A;  4U7B A;  2UXC K;  3CM6 A;  4R5P A;  3ZSY A;  4CF8 A;  4N41 A;  4BG9 A;  1W9H A;  4FLZ A;  2D0B A;  4DB3 A;  3CCS N;  1WSJ A;  3NVM A;  4A62 A;  2KQ2 A;  5M1F A;  3WQU A;  4IKF A;  1BOT O;  4EAH D;  2ZWH A;  3KIO A;  4FJM A;  2G8H A;  5CYM A;  1JXB A;  3DLL L;  2FC0 A;  3PSI A;  4HUG A;  4YY3 K;  1WSE A;  1Z25 A;  1VQ7 N;  1D5A A;  4K43 A;  1IG9 A;  2P9U A;  2W6L A;  4Z4C A;  1NK9 A;  3HM8 A;  3MEE A;  4W5N A;  3D45 A;  4KTW A;  4DTJ A;  3TAB A;  4E7K A;  4JEP A;  4XEI A;  4YOW A;  4AQY K;  1YHQ N;  4Q5V A;  3OVN A;  4B3R K;  5AQH A;  2E6M A;  2Q2R A;  3K5O A;  4CEA A;  2P9N B;  3M8R A;  3OS0 A;  4PA1 A;  1OVQ A;  3U6F A;  3ATV A;  4JNE A;  2PY5 A;  3I33 A;  1BA1 A;  5M1O A;  1WLJ A;  5AQK A;  3S41 A;  2XY5 A;  2NRX A;  1DEJ A;  3O80 A;  3NGY A;  1HYV A;  1HYZ A;  1RNH A;  1VQM N;  2OTJ N;  1ZBH A;  4F9O A;  2O4G A;  4V19 S;  5K14 A;  4J2B A;  5CZ1 A;  3GDQ A;  1SL2 A;  2YI1 A;  4M3W A;  3CFP A;  1HNX K;  1BQM A;  1HJR A;  5HRR A;  3OYK A;  3QO9 A;  4FO0 A;  2RKI A;  2GWK A;  2AP1 A;  2A3Z A;  3AAP A;  2YX6 A;  1QVG M;  3VEV A;  4DF8 A;  3DLE A;  5I42 A;  1Q82 O;  3P4I A;  1REV A;  2O8D A;  5KRT A;  3M8P A;  5AFU H;  4CCH A;  4JKG B;  5FLX O;  4CHZ A;  2QWQ A;  5DM6 L;  3WEE B;  5AZI A;  3EY1 A;  4HTU A;  1QSL A;  2UXB K;  3TAR A;  3QIC A;  4O8K A;  3CI5 A;  2OPQ A;  3SQ4 A;  1YTU A;  4H0O A;  4CGD A;  2KZZ A;  1RT5 A;  5M1N A;  4C8N A;  4FK0 A;  3QEI A;  3NF9 A;  4H0T B;  4DMN A;  5AQQ A;  1M90 O;  4LF6 K;  4M63 C;  3O4W A;  3EEQ A;  3VTI A;  3OA9 A;  1JL2 A;  1OKJ A;  5M1P A;  3K57 A;  3AVH A;  3KD1 E;  4FJX A;  1WB9 A;  3H6E A;  2QXF A;  1NNE A;  2HVI A;  4X64 K;  4FWK A;  3IDH A;  4B1V A;  4ID5 A;  4LFC K;  3SI6 A;  3DXM B;  4WFB L;  5JVG L;  3QML A;  3QNN A;  3CC2 N;  1EX4 A;  3AA3 A;  3WNF A;  2YHB A;  4CEZ A;  4IG0 A;  3OYN A;  1XMO K;  4A5A A;  2A42 A;  4E7H A;  3O8M A;  3QEP A;  4JD2 A;  1RTJ A;  3PIO L;  4B3O A;  1VSD A;  3U3Y A;  4B3M K;  2P1J A;  3LDQ A;  4ISG A;  1B92 A;  3SLC A;  3QET A;  2UXD K;  3GG4 A;  3ULE A;  4FWL A;  4A2B A;  4E7L A;  3THX A;  3GBT A;  4GVM A;  5KPT A;  4DR6 K;  4Z4E A;  1RBV A;  4W5R A;  2A1R A;  4YDU A;  1RBT A;  5CHI A;  1TYQ A;  3PX6 A;  3KLE A;  1NGE A;  3C95 A;  3BUZ B;  2Z1J A;  4JV5 K;  1TL1 A;  1SS6 A;  5HL7 L;  4M3R A;  2DPN A;  2OPS A;  1QSS A;  4B08 A;  4H4M A;  1KLN A;  2VG7 A;  1KD1 O;  3LP1 A;  2J4R A;  1EWR A;  1NJY A;  3T1Y K;  3A5L C;  1VSJ A;  4A5B A;  3NGI A;  4A57 A;  3G4S N;  1HNW K;  3OJS A;  4GV6 A;  4CEO A;  3BZK A;  4X66 K;  1CZ9 A;  2IOC A;  1YF5 L;  4OPH A;  2KLA A;  3F5T A;  3NGZ A;  4I2Q A;  4RW9 A;  3AVB A;  4H4O A;  3LWL A;  1MWK A;  4GMJ B;  4DR2 K;  3UKU A;  5SZT A;  3HPG A;  2QWN A;  1RDA A;  4KHS A;  2F8S A;  1JCF A;  4RTF D;  1KQS M;  3HPH A;  4LF8 K;  2ZF5 O;  4O5B A;  4FSV A;  4WF9 L;  1C1B A;  1A5X A;  2Y1J A;  4QS7 A;  3L2R A;  4BRQ A;  4CZM A;  4KI6 A;  1ZBS A;  2Q0R A;  4EIA A;  1HLU A;  2KKZ A;  4WFA L;  3KLG A;  4EHU A;  4HCC A;  1YAG A;  3R6M A;  4JKE A;  1Q9Y A;  1BL3 A;  1TK5 A;  1ZC6 A;  4WCE L;  4DTS A;  4CJT A;  4Z4F A;  1BCO A;  1QQO A;  3DXK A;  5KTQ A;  4OGC A;  2YNI A;  4EZ9 A;  1Z26 A;  4BQZ A;  5ADX A;  4JI3 K;  5GIO A;  1BI4 A;  1VSF A;  4LH5 A;  4JI1 K;  2YV0 X;  4FXD A;  3KKS A;  4FW1 A;  5HLF A;  4KHN A;  1QE1 A;  4H0P A;  3OS2 A;  3MAQ A;  3SJJ A;  4AIL C;  2JWK A;  4B9T A;  3AVJ A;  5C10 A;  3LM2 A;  4WYB A;  2D5R A;  5GIP A;  4CZK A;  1ITG A;  3MN6 A;  4ZTF A;  1B9F A;  1L3V A;  3NBP A;  5EVZ A;  2O8F B;  1CZA N;  2ASP A;  1S3X A;  4YHH K;  1RFQ A;  4W5O A;  5HRN A;  2Q31 A;  1VSH A;  3P38 A;  4CVN E;  1MWM A;  3MCP A;  4FLT A;  4DQP A;  1TAU A;  1C0T A;  3K9J A;  4FWO A;  1DLO A;  4FWP A;  3OYJ A;  1RDD A;  4NB4 A;  4B9N A;  2ASM A;  2HBL A;  4OKK A;  3OYA A;  2VWJ A;  4BQL A;  4A59 A;  4IBN A;  3VQ7 A;  4BGB A;  3QIN A;  4E3S A;  3NHG A;  2QKK A;  4NLB A;  2ZGZ A;  1FKP A;  3THY B;  3ZSW A;  3L6Q A;  1EQY A;  5AQX A;  1YUW A;  3LPT A;  2ASO A;  4NYF A;  4A2A A;  4KKO A;  2A6A A;  3EZ5 A;  4EHT A;  4FM1 A;  3H3N O;  3E1Y A;  4DLG A;  4IEI A;  4H8K A;  1Z05 A;  1XWL A;  4RW8 A;  1HQU A;  3QER A;  4BR5 A;  1RT7 A;  2Z1H A;  3RMC A;  3FLC O;  2YHX A;  5AQU A;  4FCY A;  4IFY A;  3CG7 A;  3ZSQ A;  4I2P A;  4CZE A;  5ADX H;  5AQZ A;  4CHY A;  2E88 A;  1LWC A;  2W6K A;  3DLG A;  4CF1 A;  3LDS A;  5JIC A;  1T8E A;  4LF7 K;  3LDO A;  1E3M A;  4IEE A;  3SQ0 A;  1FW6 A;  5E26 A;  4OPA A;  4LD0 A;  1NWK A;  3KK2 A;  4IOA L;  4DV2 K;  1X3M A;  5M1Q A;  5HBM A;  3VEZ A;  4O0I A;  4DSK A;  3VQD A;  3DM2 A;  4IO8 A;  2OYQ A;  3BF3 A;  4PHT X;  1J5E K;  4CIE A;  4YFU A;  4DHY A;  4CJL A;  1Q81 O;  4XH1 A;  2PYL A;  2XY6 A;  4FLY A;  2FF3 B;  3KKR A;  1RT3 A;  1X3N A;  2Q36 A;  3AO4 A;  4ELU A;  4Z4G A;  3WNG A;  4YOY A;  4BG8 A;  2GBZ A;  5M1K A;  1SQK A;  1TGO A;  3TWH A;  5EX5 A;  3V9U A;  1EO1 A;  3NF6 A;  3E9O A;  5CYQ A;  4BR9 A;  1NK8 A;  2GWJ A;  4M3X A;  1LOT B;  1WN7 A;  2WBN A;  3WXK A;  4YOU A;  2X74 A;  1FK9 A;  4OLB A;  4O4G A;  3RMD A;  2UU9 K;  3KK7 A;  3N4Q A;  5D3G A;  2HHX A;  2WTU A;  2VGN A;  4BVO A;  3DI6 A;  2OA8 A;  3AGR A;  4M3U A;  5JS1 A;  2X6S A;  1WUA A;  4DWI A;  3OTO K;  3K5N A;  3C6A A;  4CI6 A;  1TUY A;  3AVF A;  2E2O A;  4H5T A;  4OJR A;  1BCM A;  3O1B A;  3FZM A;  2LSN A;  4BRA A;  1QZ5 A;  3I8B A;  4CES A;  4LFB K;  2O8B A;  3J80 O;  4J2A A;  4FJG A;  1GLD G;  2VG6 A;  3VPZ A;  3OW2 M;  4CER A;  1VQ5 N;  1QVF M;  3L2Q A;  2P5O A;  4DV4 K;  2G8K A;  1N33 K;  5FRM A;  4H03 B;  4ZTJ A;  4FM2 A;  1H1V A;  2F4V K;  1L3T A;  3G25 A;  3T19 A;  2QM1 A;  4G1Q A;  2XO7 A;  3MEC A;  3HK2 A;  4JYA K;  2HBK A;  4CGF A;  3AVG A;  3CPW M;  4M7X A;  5AJ3 K;  4AF1 A;  3LZJ A;  5HRS A;  5AQL A;  3CYM A;  3Q7B A;  3U4L A;  3CCL N;  2G8I A;  3SCX A;  4U67 L;  2D4W A;  2HW3 A;  1K6Y A;  2WC9 A;  3MWP A;  4F4K A;  1KVC A;  3CM5 A;  3RSE A;  4M45 A;  4JKD A;  2P9S B;  1NGI A;  4JK8 A;  3OJU A;  1JJ2 M;  4IZ9 A;  4JHD A;  4HVJ A;  1J5O A;  1NKB A;  3H1V X;  1RTH A;  5HRP A;  1CLQ A;  4B3S K;  4FJK A;  2ZE2 A;  3JSM A;  3SBT A;  1DKG D;  5FPN A;  3TTC A;  3WXJ A;  3PIP L;  5C12 A;  1QQN A;  3AA4 A;  4XH5 A;  5BPN A;  4EP4 A;  3WXL A;  2BH1 A;  4CBX A;  1HX1 A;  5EU7 A;  5CE3 A;  2O8E B;  5I3U A;  4EP5 A;  5BRE A;  3M8Q A;  3HRG A;  1D9D A;  3AVA A;  3VGM A;  1FJG K;  4DTN A;  1JXE A;  3K5L A;  5TKW A;  1WSH A;  2FLO A;  4IJA A;  3UB5 A;  4N47 A;  1RDW X;  4BR2 A;  4IDH A;  4EFH A;  4ICL A;  2HNY A;  1NK4 A;  4OPJ A;  4FJH A;  4W5T A;  1VQN N;  2YJF A;  3OYF A;  1KFS A;  3AVL A;  3O4N A;  3CD6 N;  4IOC L;  1MA9 B;  1HRH A;  4KO0 A;  2E8A A;  3EKS A;  2P9K B;  3TPQ A;  3C7N A;  4ILH A;  1YJN N;  1S6Q A;  4MLH A;  3WT0 A;  1KVB A;  3VF6 A;  3A5M C;  3ZEU B;  3A5O C;  1NGF A;  4ISE A;  2XY7 A;  4B9U A;  4KRF A;  2FSJ A;  3RTV A;  2IDO A;  2NRT A;  2YHY A;  3LAL A;  4K42 A;  2F96 A;  2DFE A;  4O55 A;  3OYI A;  4W5Q A;  4CJE A;  1Y97 A;  4FWS A;  4DS5 A;  1KSP A;  5CR4 A;  1T3V A;  3CJ9 A;  2NRZ A;  2VQF K;  4DSJ A;  1QZ6 A;  4JI6 K;  2YKM A;  4O5F A;  2HND A;  1BG3 A;  1LAW A;  1HYS A;  2XHB A;  4KTZ A;  4FPA A;  3OYB A;  1BHL A;  3SV3 A;  3JAM O;  2HHQ A;  1C0M A;  3UE5 A;  1X9S A;  1EWQ A;  4DR7 K;  2BAN A;  4KB0 A;  4WQ5 C;  2NZT A;  3VQQ A;  1JLA A;  3SAF A;  2D0P A;  4M3T A;  4DTU A;  3BEX A;  3I8D A;  2OTL N;  2IGI A;  1E4F T;  3PV8 A;  3FFI A;  3ZX2 A;  1RT4 A;  3H08 A;  3R1X A;  4CZJ A;  3ENO A;  4X65 K;  2E5L K;  4DQI A;  3D2F A;  3TSQ A;  1LW0 A;  1BU6 O;  2P9U B;  4MQ3 A;  1RDU A;  3LP0 A;  2ZQB A;  3KTQ A;  5C0Y A;  3TAN A;  4BRG A;  2F8T A;  5GAE P;  4DR3 K;  4DTP A;  4DU1 A;  4MDB A;  3P39 A;  1A5W A;  1LWE A;  1RGI A;  4O8U A;  5AZJ B;  4IDK A;  4BC3 A;  4K41 A;  3ID8 A;  2QWO A;  4DCH A;  4I6M A;  4CZH A;  3HL8 A;  4KHQ A;  4DSL A;  2D0O A;  4OX9 K;  4CZL A;  2ITM A;  1VQ8 N;  3V9S A;  3MX5 A;  1YJ9 N;  3WEE A;  5IWA K;  3ZLJ A;  3RR7 A;  1GLC G;  3DOK A;  4M41 A;  1O1W A;  1KAZ A;  2NRR A;  4Z4H A;  2VGM A;  4J8F A;  1RBU A;  3NFA A;  3SPZ A;  3F73 A;  3QEX A;  3C6H A;  2Q1N A;  4AHU A;  4XIU A;  3L4Q A;  1W7A A;  4BDP A;  3IS9 A;  4H0X B;  3DRS A;  3VTH A;  1ASU A;  4CJ3 A;  2WON A;  3ASM A;  2O8D B;  3HVT A;  4Y1C A;  3SYZ A;  1T05 A;  2Q97 A;  2R7Y A;  1TV6 A;  1BA0 A;  1Q8I A;  3QIO A;  3HVR A;  1EP4 A;  3VQ9 A;  3KVG A;  2XY8 A;  3L8B A;  4FZX C;  2NLX A;  2PFU A;  4CK3 A;  3VER A;  1N5Y A;  4E1N A;  1NJW A;  5AR0 A;  1WAF A;  4DTX A;  4O0J A;  2BTF A;  1C1C A;  3S3M A;  4B8C A;  3CCU N;  4H5R A;  1SV5 A;  3NCI A;  2IAJ A;  2NRW A;  4GVE A;  4PL8 A;  3IUC A;  3R9P A;  4CED A;  2PYJ A;  1KLM A;  1C0U A;  2HOE A;  4JRQ A;  2CGJ A;  3ZT0 A;  4X62 K;  5AQG A;  1NGG A;  4CJW A;  4G9Z A;  2YNH A;  4BRH A;  4F2S A;  3MK6 A;  1TKD A;  3SAH A;  2DFF A;  1ZBL A;  4WFN L;  2E6L A;  1YJW N;  3SMS A;  4OLA A;  1R59 O;  3DLH A;  5KQ8 A;  2QW9 A;  5J1E A;  4B3T K;  2HHS A;  2Q3S A;  4JD2 B;  1LW2 A;  4CGG A;  1A5V A;  4K25 A;  4AM6 A;  4E1J A;  1XI1 A;  1OH7 A;  4E7J A;  5A2Q O;  2HF3 A;  2P9P A;  3ULE B;  2QWP A;  4CEF A;  4B9S A;  1C0G A;  3HBT A;  4B1X B;  1ATR A;  1I39 A;  4NYN A;  2GUP A;  4JI7 K;  4GW6 A;  3OYL A;  3DOL A;  4H0Y B;  4FL9 A;  3S9H A;  3ALY A;  1WBD A;  1ZXO A;  1TYQ B;  1IKW A;  4EZ6 A;  1HNZ K;  2IS3 A;  5FPD A;  2UUC K;  1KTQ A;  4GNI A;  4BRI A;  5AQF A;  3C6U A;  1BIU A;  5KGW A;  5KQD A;  3JXU A;  5T7B A;  1JKH A;  4C8M A;  4JI4 K;  4JRP A;  3VA3 A;  4KRE A;  1NK6 A;  1IKY A;  3CIP A;  3EN9 A;  4B9L A;  1VAZ A;  2DY4 A;  4CE9 A;  1JCG A;  4LF5 K;  3AY9 A;  3VEN A;  4B1Y B;  1XQS C;  5J2N A;  1RT2 A;  3G10 A;  4CGH A;  5C25 A;  3ZSV A;  2OZS A;  3SV4 A;  4RW7 A;  3ITH A;  4Y0W A;  5LMU K;  3UKU B;  2WUS A;  4KHU A;  1HNV A;  1UA0 A;  1ZBU A;  4WQ5 A;  4FYD A;  1XNR K;  3M1F A;  3NH1 A;  4DV7 K;  2JWL A;  1T6C A;  1U48 A;  3Q7C A;  3U8X A;  1GOB A;  1IBK K;  4GKK K;  3DMJ A;  4LFA K;  2GV9 A;  4LH4 A;  4LF4 K;  1Z6R A;  3A8Y A;  4QS8 A;  1NGH A;  3AVM A;  2FSK A;  3FE1 A;  1XNQ K;  3VN5 A;  1Q7Y O;  3O9R A;  3HTV A;  5J2M A;  3NAE A;  3MN7 A;  2CH5 A;  2PAV A;  3R3L A;  4E1M A;  3HZ6 A;  3ZT1 A;  4AHR A;  3LAM A;  2AA4 A;  1QQM A;  3DXK B;  1N8R O;  4K8X A;  3QFU A;  4E19 A;  2ZD1 A;  1QTM A;  3NH0 A;  1DTQ A;  1RT1 A;  3ZSO A;  1VQ4 N;  3C94 A;  3CPE A;  4B1U B;  1BI4 B;  1NK5 A;  3LM9 A;  3P1G A;  3SBG A;  3MN5 A;  4HCB A;  2F9T A;  2X6N A;  4H0V B;  3VQ4 A;  4B1Z A;  4KTQ A;  5HRO A;  3EE9 A;  4BR7 A;  1DT9 A;  2GTD A;  4C1N I;  1VK0 A;  4DFM A;  1O13 A;  4NLC A;  4KH6 A;  5DK5 A;  3D6R A;  2P9L A;  1UWB A;  2B5J A;  4DTM A;  1N32 K;  2ZJR L;  3RVC A;  3KLF A;  1BIS A;  1CXQ A;  3O6W A;  3OBW A;  3OYH A;  3VQP A;  3J7A P;  1KVA A;  3KK3 A;  2UYT A;  4ZHR A;  3E01 A;  2FBY A;  2I7N A;  1QQC A;  4JLH A;  3LZI A;  4N76 A;  2EHG A;  4BRD A;  2Q0U A;  2O8C A;  3L3U A;  3V1R A;  3E9L A;  4CD3 A;  2CH6 A;  4CFB A;  3OHR A;  4JKC A;  1VQ6 N;  4DSF A;  2DTU A;  1L3U A;  1S1X A;  2BDP A;  2GEL A;  5DM7 L;  1YVU A;  4NO7 A;  1LAV A;  2GX9 A;  3UKR B;  1Q9X A;  3IAY A;  4DU3 A;  3MXJ A;  4CJK A;  4DR1 K;  4C23 A;  3LAK A;  3U3G A;  1NGB A;  1VSK A;  4KH4 A;  3B6P A;  3SUO A;  4PQU A;  3O3G A;  1ASW A;  4FJJ A;  1WNS A;  3A2F A;  4BDY A;  1U04 A;  1U49 A;  3PX4 A;  3S3N A;  1FXX A;  1NGC A;  3HOS A;  1ILY A;  3UIQ A;  4AHV A;  1NK7 A;  4CF0 A;  4AM7 A;  4BRK A;  5EXW A;  3TAE A;  3CFR A;  4PKH A;  3HST B;  1HUX A;  3F9M A;  5BPL A;  5B8H A;  2AJQ A;  5LL6 Z;  3O4Q A;  1LCU A;  3K58 A;  1IJJ A;  3ZET A;  3OYE A;  4J2E A;  3AO2 A;  1ZBI A;  1GLA G;  2NNW A;  1IKX A;  3KJV A;  3HO1 A;  4YOX A;  1P8Z A;  1ASV A;  1ZBF A;  4BE0 A;  3RWU A;  3M8S A;  3BY5 A;  4UY8 O;  3HOT A;  2V7Z A;  4Y1D A;  4FM0 A;  3CJA A;  1KAX A;  1C1A A;  2FBX A;  1J9A A;  3S3O A;  2RPI A;  4MFB A;  4BWM A;  3VQE A;  1K73 O;  2QEX N;  3CQX A;  1SZ2 A;  1DTT A;  3C0B A;  4NCB A;  1BO5 O;  3DLK A;  1EET A;  3D2E A;  1TVR A;  3I56 N;  3C65 A;  2ETJ A;  4RWT A;  3K59 A;  2P9I A;  1GOC A;  2IVO A;  3C6T A;  1S1T A;  4DFJ A;  3O3H A;  4M3Z A;  3VEY A;  3DLR A;  3CJC A;  4FWM A;  1TKX A;  2ZM6 K;  1SL1 A;  3SQ2 A;  2G8V A;  1X1P A;  5BN9 A;  1NLV A;  4FPB A;  5DMR A;  3DYA A;  3CQY A;  2RE2 A;  2KFZ A;  4CJ5 A;  1NGA A;  3AVK A;  3THW A;  4CJP A;  4CEE A;  3LDN A;  1K8K A;  1XUP O;  3F2K A;  3KZB A;  1WAJ A;  4B9V A;  3PX0 A;  3ENH A;  3ZX0 A;  3TI0 A;  1RBR A;  2D0A A;  1WSF A;  3T1A A;  4WE1 A;  3SJH A;  3L3V A;  3TAM A;  1W97 L;  1RDC A;  2ZGY A;  3OYM A;  1RTI A;  2FF6 A;  1XHZ A;  4RG8 A;  3ULD A;  3MED A;  3O1W A;  2O8B B;  2UUB K;  4B9M A;  4FZZ A;  4DFK A;  4BRM A;  4H5N A;  5JVH L;  4LF9 K;  4NXN K;  4RW4 A;  2Y1I A;  5AQI A;  2W40 A;  4Z0U A;  1HPM A;  4XH4 A;  2E2Q A;  2HVH A;  1HNI A;  2G8W A;  2EWS A;  3A0I X;  3KWG A;  2RHK A;  3EL2 A;  2VWB A;  4BGA A;  5ELZ A;  4PUO A;  3O08 A;  2EX3 A;  4NCG A;  3ZT3 A;  4GV9 A;  4FWR A;  1J53 A;  4N5S A;  5FPE A;  5BR9 A;  1UA1 A;  2QTD A;  1MU2 A;  3MEG A;  3VQA A;  2NRV A;  4C8L A;  1VSI A;  1HKG A;  5AQN A;  3VQ5 A;  4CIG A;  4OKE A;  1S6P A;  5F2R A;  4YOV A;  3RSE B;  5C2D A;  4FJN A;  4PY5 A;  4JK7 A;  3PO4 A;  4JI2 K;  2WOM A;  1NOY A;  4FZY A;  4JHD B;  4CEB A;  4BAC A;  4JS4 A;  1NMD A;  3IFR A;  1GLF O;  2F7T A;  4BR0 A;  3AAQ A;  3TSP A;  3FZH A;  2A1S A;  1U4B A;  4JKH A;  3VQB A;  4BR4 A;  3BZC A;  3VOV A;  5AQR A;  3NE6 A;  2Z1I A;  1VSE A;  3CHW A;  3KWI A;  3VQC A;  3W0L A;  1OVY A;  2I7P A;  1NJZ A;  4AHC A;  2VQE K;  5HP1 A;  3VET A;  1KRP A;  2RF2 A;  1U2V A;  3V4I A;  5J2P A;  4JN4 A;  3V1Q A;  1NGD A;  2X78 A;  3U9D A;  2I5J A;  1DGK N;  4DV1 K;  3MDQ A;  1JL1 A;  3NH2 A;  3FZL A;  4CF9 A;  4BRP A;  2V52 B;  3DLB A;  3DAW A;  1K9M O;  5JS2 A;  2UUA K;  3FZF A;  3KD5 E;  1IH7 A;  3L0Q A;  3C7N B;  4C8K A;  3ZT4 A;  4PL7 A;  4CJU A;  1IBM K;  5EY4 A;  2HHU A;  1YIJ N;  3T1H K;  3WXM B;  1X9J A;  1Q18 A;  5C15 A;  4UQG A;  3HYF A;  2CGL A;  2HHT A;  3IMX A;  1GOA A;  3CJ7 A;  1N34 K;  5LJW A;  2ZJQ L;  3AVN A;  2KZM A;  3FZK A;  1NBW A;  1VRU A;  2QWL A;  1S1W A;  4CIF A;  1LV5 A;  4Z94 A;  1HR0 K;  4BRL A;  1SKR A;  1YI2 N;  4HTL A;  3WXI A;  1UOC A;  4IJN A;  5E41 A;  2P9N A;  3OYC A;  2QWR A;  5AQM A;  3IG1 A;  3SUN A;  3QEW A;  3SUQ A;  4ID1 A;  1ATN A;  3HXM A;  3FGU A;  4FJ7 A;  3WNH A;  2ITG A;  1L3S A;  3TAG A;  3CJB A;  1RCH A;  5BRF A;  4HHT A;  3QFP A;  1F21 A;  4CHO A;  3BF1 A;  4QCL A;  1GLB G;  2A5X A;  5AZJ A;  3DJC A;  3D0P A;  1S72 N;  5KRS A;  1T44 A;  1HMV A;  1NKE A;  3QDK A;  4K8Z A;  4OPK A;  3P83 D;  3V81 A;  2YHW A;  1XC3 A;  3D2F B;  1XHX A;  1D8Y A;  4CEQ A;  4DFP A;  3ATU A;  4JKG A;  5FRN A;  4RCH A;  4E0D A;  4FVU A;  1BGX T;  3FR0 A;  1ZYQ A;  3K9K A;  1K8A O;  1YXQ A;  4FWN A;  1HKB A;  2V51 B;  4OKJ A;  4CFD A;  2HHV A;  3THV A;  2YHA A;  4CJ4 A;  1IG8 A;  1D4X A;  3P31 A;  4I6M B;  1V4T A;  4DR4 K;  3H45 C;  4QAG A;  1T7P A;  4ELV A;  1UAX A;  3OYD A;  1NKC A;  3E66 A;  3ZSX A;  1NG9 A;  3TU5 A;  3VQ8 A;  2E20 A;  3H1Q A;  4NCA A;  1EXQ A;  4CW7 B;  5AZI B;  3LP3 A;  1M1K O;  2Z1G A;  4JI8 K;  4CD1 A;  2E2N A;  3MX2 A;  5H1S Q;  3PO5 A;  3VGK A;  2QWM A;  1VQP N;  2BE2 A;  2F9W A;  3LP2 A;  3B6O A;  3DXM A;  1LWF A;  4MO5 A;  1D9F A;  5KPR A;  1Y64 A;  2D0C A;  1NM1 A;  3SK3 A;  1TUU A;  4KFB A;  1JLB A;  2ATQ A;  5JMV A;  5SWM A;  3CJ1 A;  5JLH A;  5AQP A;  4NXM K;  1N6Q A;  1T6D A;  1BUP A;  1SUQ A;  2HBM A;  3CET A;  1VQ9 N;  4DV0 K;  3DRR A;  3GL1 A;  3T69 A;  4FJ9 A;  2YNG A;  2KHO A;  3BP8 A;  3VES A;  4BC5 A;  3CCR N;  2IIR A;  3EYZ A;  4ILG B;  4B9Q A;  3VA0 A;  3J8A A;  4AHT A;  1NJI O;  2VYP A;  3SQ1 A;  4JKA A;  2VCP A;  3OYG A;  1JCE A;  4FOE A;  3L2U A;  3O3F A;  1S22 A;  4JKB A;  4BRF A;  3V9W A;  4OO1 J;  1CXU A;  3QIP A;  4HWI A;  1RT6 A;  3CXC M;  4DV3 K;  3P5J A;  3J81 O;  4GY2 B;  4FJ8 A;  3THX B;  1RIL A;  3CME N;  3M5R A;  4LSN A;  2GEM A;  2G8U A;  1SKS A;  1X9W A;  3JYT A;  4Q0B A;  3AO5 A;  4CK1 A;  1ATS A;  3HSC A;  2V7Y A;  4F3T A;  2QK9 A;  2XRI A;  2O4I A;  2P5G A;  5F1X A;  3WUH A;  2JLE A;  1JLQ A;  3MXI A;  4JKF A;  3MXM A;  2VWK A;  3ID6 A;  1YIT N;  1QHT A;  2P9P B;  3EO3 A;  4YNQ A;  4M7Y A;  5BRD A;  3T3F A;  4L8R B;  2B4J A;  3L4I A;  4MO4 A;  3I55 N;  1TAQ A;  3VEW A;  2ZJP L;  1JLF A;  1SAZ A;  3TAF A;  4CBW A;  1NU0 A;  3D7E O;  3G71 N;  3AO1 A;  3LAN A;  4KV8 A;  5GAH P;  2E2P A;  3W3D A;  4DQQ A;  4BC4 A;  5GAD P;  1GLE G;  4PKG A;  3TAQ A;  4CHN A;  4BY9 C;  1C0F A;  3O9T A;  1KFD A;  2QA4 N;  4PKI A;  1KC8 O;  1IV0 A;  3H46 O;  3U9Z A;  5AQY A;  3TTD A;  3J7Y P;  3EKU A;  3WQT A;  4DQS A;  1OH5 A;  3AA2 A;  4DUZ K;  4K0K K;  2RN2 A;  3T7Z A;  5LJV A;  1BDG A;  2NRH A;  1SL0 A;  4DKW A;  3K0S A;  1WBB A;  3A5N C;  1X9M A;  2YJE A;  1VRT A;  3KLI A;  3SUP A;  5BN8 A;  2P51 A;  2W41 A;  3HI0 A;  1R0A A;  4CHQ A;  3SAG A;  2HBJ A;  3K2P A;  1E4G T;  1VQK N;  1U47 A;  3MCA B;  2PBD A;  4BC2 A;  1WOQ A;  4CFA A;  1HKC A;  1KAY A;  2O8F A;  3ZCM A;  3O9U A;  3VEX A;  4FWQ A;  1B9D A;  1QHA A;  3RMB A;  4ELT A;  4I9Q A;  2H3G X;  3NF7 A;  3DWL A;  3MN9 A;  5AQO A;  5HOO A;  3I0R A;  4CZF A;  3RRG A;  3GE1 A;  1NK0 A;  3RR8 A;  1N36 K;  4KBO A;  4B1W B;  3G6E N;  4R79 A;  3MMV A;  5AQT A;  4DR5 K;  4DS4 A;  3KLH A;  4HUE A;  3V6D A;  3ENB A;  4YOT A;  5C42 A;  3V9X A;  4BDZ A;  4CK2 A;  4JI0 K;  1BQN A;  1WSI A;  2DFH A;  3VGL A;  1J54 A;  2KFN A;  3SNN A;  3CF5 L;  4FW2 A;  4DV6 K;  3THY A;  4LC9 B;  2QKB A;  1TK8 A;  1YT3 A;  3QNO A;  3LL3 A;  1T03 A;  1QS4 A;  4F8R A;  4N56 A;  2E4L A;  1S9G A;  3QES A;  4CJF A;  3VF4 A;  2WFB A;  4GKJ K;  1NMN A;  4ISF A;  4BE1 A;  4DLE A;  3CC7 N;  4FK2 A;  1EKE A;  3PSF A;  1MDU B;  3UKR A;  5CZ2 A;  1VSL A;  4CJ7 A;  2FBV A;  2P9L B;  3ZSZ A;  3LDP A;  3RRH A;  1G99 A;  1WSG A;  5TKY A;  3TAP A;  1KCF A;  4CBU A;  4M42 A;  1BIZ A;  1XMQ K;  3WNE A;  1TKZ A;  4DTR A;  2BUP A;  2YCH A;  4BRN A;  2O8C B;  5I9E B;  1TKT A;  1RDB A;  3CCQ N;  3TSU A;  3CCJ N;  4IFE A;  3R8E A;  5LMN K;  3AGK A;  4WQ4 C;  4KB1 A;  4ILJ A;  1S1V A;  4JS5 A;  1OH8 A;  1JLC A;  3HM9 A;  2NUB A;  3CCE N;  4KI4 A;  4CGJ A;  4E7I A;  2E1Y A;  5AQJ A;  4CGI A;  3CCM N;  1JLG A;  1W0H A;  3MWT A;  5CY4 A;  5E84 A;  4IOX A;  3K5M A;  2OCE A;  1G15 A;  4KPY A;  3SPY A;  3TTF A;  3V9Z A;  3ZYY X;  4FOI A;  1P90 A;  3SMP A;  2BGG A;  4CFC A;  4B8A B;  3LWM A;  3NMU A;  3E9P A;  4DSE A;  1W2B M;  3LDL A;  4TSX A;  3QB0 A;  4C8O A;  3SZ2 A;  1I94 K;  4FLV A;  4IWV A;  2OZM A;  3HJF A;  3PLA A;  4AHS A;  4IXC A;  1CZB A;  3CQ8 A;  2OPP A;  3AO3 A;  3AVC A;  4CEC A;  4DF4 A;  4DU4 A;  3M6G A;  4BWJ A;  2HNZ A;  5KI6 A;  4PWD A;  3FFK B;  3I0S A;  2HF4 A;  3VF2 A;  3VMF B;  2KTQ A;  3N4P A;  2HST A;  2B6A A;  1FKO A;  4F2R A;  3ZET B;  3ZT2 A;  1VSM A;  1YTA A;  3PUF A;  3RMA A;  3QLH A; 
#chains in the Genus database with same CATH homology
 1BA0 A;  3U9D A;  4BRO A;  2FSN A;  2OAN A;  3KVG A;  4H0P A;  3CC4 N;  1DGK N;  3QBW A;  3MDQ A;  2NLX A;  2PFU A;  2IVN A;  3VER A;  3KHY A;  4KH5 A;  3J7Z O;  3FZL A;  2JWK A;  5AR0 A;  4L3Q A;  4BRP A;  2V52 B;  5AQS A;  5C10 A;  3DAW A;  3QBX A;  1K9M O;  3LM2 A;  2BTF A;  4WYB A;  4BRE A;  5GIP A;  4CZK A;  3MN6 A;  4IO9 L;  1VQO N;  3CER A;  3D2E B;  2QI2 A;  5KPZ A;  3NVK A;  1J6Z A;  3FZF A;  5EVZ A;  3CCU N;  1CZA N;  2ASP A;  2P9I B;  1S3X A;  3L0Q A;  4H5R A;  3C7N B;  3H3O B;  4GV3 A;  1RFQ A;  4JK9 A;  1V4S A;  2NRW A;  4GVE A;  4PL8 A;  3IUC A;  3R9P A;  2Q31 A;  4BVP A;  4PL7 A;  3P38 A;  5C2F A;  5EY4 A;  1MWM A;  1YIJ N;  3MCP A;  2HOE A;  3WXM B;  1X9J A;  1Q18 A;  2CGJ A;  5C15 A;  2CGL A;  3K9J A;  4FWO A;  5AQG A;  3IMX A;  1NGG A;  3CJ7 A;  4FWP A;  4G9Z A;  4BRH A;  5GAG P;  2QXL A;  3MK6 A;  4NB4 A;  5BPM A;  5LJW A;  3SAH A;  2ZJQ L;  4DQ8 A;  3FZK A;  1K8K B;  1NBW A;  2QWL A;  4WFN L;  2ASM A;  3EE8 A;  1YJW N;  3SMS A;  4Z94 A;  2HBL A;  1R59 O;  4BRL A;  4YOR A;  4BQL A;  1YI2 N;  5KQ8 A;  4HTL A;  4A59 A;  2QW9 A;  4BGB A;  3WXI A;  4BRC A;  2FXU A;  3O9S A;  4JD2 B;  4IJN A;  4K25 A;  2P9N A;  4AM6 A;  4E1J A;  4NLB A;  2QWR A;  2ZGZ A;  5AQM A;  2HF3 A;  3L6Q A;  2P9P A;  1ATN A;  2QWP A;  2D1K A;  1EQY A;  5AQX A;  1C0G A;  1YVN A;  1YUW A;  1ATR A;  2P9S A;  3FGU A;  3HBT A;  4B1X B;  2ASO A;  5GIN A;  2GUP A;  4A2A A;  5JLF A;  2A6A A;  3CJB A;  4EHT A;  3H3N O;  5BRF A;  3E1Y A;  4H0Y B;  2E1Z A;  2IVP A;  4FL9 A;  4IEI A;  3QFP A;  1Z05 A;  1ZXO A;  3BF1 A;  1TYQ B;  5AQV A;  4CZI A;  1GLB G;  2A5X A;  5AZJ A;  3DJC A;  5FPM A;  5FPD A;  1S72 N;  5AQW A;  4GNI A;  1T44 A;  4BR5 A;  4BRI A;  3AAR A;  3VEO A;  3QDK A;  3FLC O;  5AQF A;  2YHX A;  5AQU A;  4C1N K;  2YHW A;  1XC3 A;  5BRH A;  3D2F B;  5KQD A;  3JXU A;  1NGJ A;  3CMA N;  4CZE A;  5ADX H;  3IKM A;  1U6Z A;  5AQZ A;  3ATU A;  4JKG A;  4RCH A;  2E88 A;  2CGK A;  3CIP A;  3EN9 A;  5JIC A;  4H5W A;  5LY3 A;  4FVU A;  1VAZ A;  4H5V A;  3LDO A;  3FR0 A;  1JCG A;  3K9K A;  1K8A O;  2A40 A;  4IEE A;  3AY9 A;  3VEN A;  4B1Y B;  1XQS C;  1YXQ A;  1Q86 O;  5E26 A;  4FWN A;  4OPA A;  1HKB A;  2V51 B;  1NWK A;  3M3Z A;  4MDA A;  4IOA L;  3ZX3 A;  1X3M A;  5M1Q A;  4Y0W A;  1IG8 A;  1D4X A;  3UKU B;  2WUS A;  3P31 A;  3VEZ A;  2P9K A;  4I6M B;  4WQ5 A;  3M1F A;  1V4T A;  4IO8 A;  3BF3 A;  4PHT X;  3H45 C;  2JWL A;  4JAX A;  1T6C A;  4DHY A;  1Q81 O;  3Q7C A;  4XH1 A;  4YDU C;  3U8X A;  3E66 A;  2FF3 B;  3TU5 A;  1X3N A;  2Q36 A;  2E20 A;  3H1Q A;  3B8A X;  3GOI A;  4YOY A;  4BG8 A;  1Z6R A;  5M1K A;  3A8Y A;  4QS8 A;  1SQK A;  1NGH A;  5AZI B;  3ZEU A;  5MLC Q;  1M1K O;  5EX5 A;  1EO1 A;  2FSK A;  4CD1 A;  3E9O A;  3FE1 A;  4BR9 A;  1Q7Y O;  2E2N A;  2GWJ A;  3O9R A;  3MX2 A;  3HTV A;  5H1S Q;  1GLJ O;  3JS6 A;  1VQL N;  3VGK A;  1LOT B;  2QWM A;  1VQP N;  2CH5 A;  2PAV A;  2WBN A;  2F9W A;  3MN7 A;  4YOU A;  3WXK A;  3DXM A;  3R3L A;  3HZ6 A;  3KK7 A;  5EOY A;  3N4Q A;  4MLE A;  2AA4 A;  4MO5 A;  4CZG A;  1QQM A;  3DXK B;  2VGN A;  5KPR A;  1Y64 A;  1N8R O;  4BVO A;  4WQ4 A;  3QFU A;  3O5B A;  5F0X A;  5AFU A;  2HMP A;  3O9Q A;  3AGR A;  1U2V B;  2A41 A;  1NM1 A;  3SK3 A;  1TUU A;  1WUA A;  1BWF O;  1GLL O;  1VQ4 N;  3CPE A;  4B1U B;  3C6A A;  4CI6 A;  1TUY A;  3LM9 A;  5JMV A;  2E2O A;  4QS9 A;  3CJ1 A;  3SBG A;  4H5T A;  4A61 A;  1KXP A;  5JLH A;  3O1B A;  5AQP A;  3FZM A;  1HJO A;  3MN5 A;  2F9T A;  4BRA A;  1QZ5 A;  1ESV A;  3I8B A;  4H0V B;  1T6D A;  1BUP A;  4B1Z A;  2HBM A;  3CET A;  1VQ9 N;  3EZW A;  3CCV N;  3EE9 A;  3GL1 A;  1GLD G;  3T69 A;  4BR7 A;  1DT9 A;  2KHO A;  3BP8 A;  3OBY A;  3VES A;  4U7B A;  4BC5 A;  3VPZ A;  3CCR N;  2GTD A;  4BG9 A;  4C1N I;  3OW2 M;  1VQ5 N;  1QVF M;  2IIR A;  4DB3 A;  4ILG B;  3CCS N;  4B9Q A;  3NVM A;  3J8A A;  1NJI O;  4A62 A;  1O13 A;  5M1F A;  2VYP A;  4NLC A;  4KH6 A;  3WQU A;  1BOT O;  3D6R A;  4JKA A;  4EAH D;  2P9L A;  2ZWH A;  2VCP A;  2ZJR L;  3RVC A;  4H03 B;  1JCE A;  1H1V A;  3DLL L;  4FOE A;  3O6W A;  1S22 A;  3OBW A;  4JKB A;  2UYT A;  4BRF A;  4OO1 J;  3G25 A;  2I7N A;  4HWI A;  1VQ7 N;  3CXC M;  2QM1 A;  4BRD A;  4GY2 B;  2Q0U A;  4K43 A;  2P9U A;  3E9L A;  3CME N;  2HBK A;  4CD3 A;  3HM8 A;  2CH6 A;  3M5R A;  3CPW M;  2GEM A;  4M7X A;  3OHR A;  4AF1 A;  4JKC A;  1VQ6 N;  5AQL A;  1ATS A;  3HSC A;  4JEP A;  4XEI A;  3Q7B A;  2V7Y A;  4YOW A;  1YHQ N;  2GEL A;  3U4L A;  3CCL N;  5DM7 L;  4NO7 A;  3UKR B;  2GX9 A;  4U67 L;  2D4W A;  5AQH A;  5F1X A;  3WUH A;  2Q2R A;  4C23 A;  2WC9 A;  2P9N B;  3MWP A;  4JKF A;  3ID6 A;  3RSE A;  3ATV A;  4JNE A;  1YIT N;  4JKD A;  2P9P B;  1NGB A;  3EO3 A;  3I33 A;  4KH4 A;  1BA1 A;  5M1O A;  2P9S B;  1NGI A;  4JK8 A;  4M7Y A;  5BRD A;  1JJ2 M;  5AQK A;  3S41 A;  4IZ9 A;  2NRX A;  1DEJ A;  3O80 A;  3L4I A;  4JHD A;  4MO4 A;  3I55 N;  1VQM N;  3H1V X;  3VEW A;  2ZJP L;  2OTJ N;  1SAZ A;  4CBW A;  3D7E O;  3SBT A;  1DKG D;  5FPN A;  3TTC A;  3WXJ A;  3G71 N;  1NGC A;  5C12 A;  3PIP L;  3HOS A;  5GAH P;  1ILY A;  2E2P A;  3W3D A;  1QQN A;  4F9O A;  4BC4 A;  5GAD P;  3GDQ A;  4XH5 A;  5BPN A;  4AM7 A;  1GLE G;  5EXW A;  3WXL A;  4PKG A;  2YI1 A;  4BRK A;  2BH1 A;  4CBX A;  1HX1 A;  5CE3 A;  4BY9 C;  1C0F A;  4PKH A;  1HUX A;  3O9T A;  3F9M A;  5BPL A;  4FO0 A;  5B8H A;  2QA4 N;  4PKI A;  1KC8 O;  5BRE A;  2GWK A;  2AP1 A;  3H46 O;  2A3Z A;  3U9Z A;  5AQY A;  3TTD A;  3AAP A;  2YX6 A;  1QVG M;  3EKU A;  3WQT A;  1LCU A;  3HRG A;  3VEV A;  1IJJ A;  3ZET A;  1Q82 O;  3P4I A;  3VGM A;  3T7Z A;  5LJV A;  1BDG A;  2NRH A;  5AFU H;  1GLA G;  2NNW A;  4DKW A;  4JKG B;  5TKW A;  3A5N C;  2FLO A;  4IJA A;  3UB5 A;  1P8Z A;  1RDW X;  2QWQ A;  5DM6 L;  2YJE A;  4BR2 A;  4IDH A;  3WEE B;  5AZI A;  4EFH A;  5BN8 A;  2W41 A;  4UY8 O;  3HOT A;  2V7Z A;  3HI0 A;  3CJA A;  1KAX A;  3QIC A;  4O8K A;  3SAG A;  2HBJ A;  3CI5 A;  1VQN N;  1E4G T;  1K73 O;  1VQK N;  2QEX N;  2YJF A;  3CQX A;  1SZ2 A;  3C0B A;  3CD6 N;  4H0O A;  4IOC L;  1BO5 O;  3MCA B;  2PBD A;  1MA9 B;  4BC2 A;  3D2E A;  1WOQ A;  5M1N A;  2E8A A;  3I56 N;  3C65 A;  1HKC A;  1KAY A;  3EKS A;  2P9K B;  4RWT A;  3O9U A;  2P9I A;  3TPQ A;  3VEX A;  4FWQ A;  4H0T B;  3C7N A;  4ILH A;  1QHA A;  1YJN N;  2IVO A;  5AQQ A;  1M90 O;  4M63 C;  2H3G X;  3VEY A;  3O4W A;  3DWL A;  3MN9 A;  5AQO A;  3CJC A;  5HOO A;  4CZF A;  4FWM A;  3GE1 A;  3VTI A;  3OA9 A;  4MLH A;  5BN9 A;  1NLV A;  4FPB A;  1OKJ A;  5M1P A;  3WT0 A;  4KBO A;  4B1W B;  3G6E N;  3CQY A;  2RE2 A;  4R79 A;  3MMV A;  1NGA A;  5AQT A;  3A5M C;  3VF6 A;  3ZEU B;  3A5O C;  3H6E A;  1NGF A;  4ISE A;  4FWK A;  3ENB A;  3LDN A;  4YOT A;  1K8K A;  3IDH A;  4B1V A;  1XUP O;  3F2K A;  2FSJ A;  3KZB A;  2NRT A;  2YHY A;  4K42 A;  3DXM B;  4WFB L;  5JVG L;  3QML A;  3CC2 N;  3VGL A;  3ENH A;  4FWS A;  3ZX0 A;  5CR4 A;  4A5A A;  2A42 A;  3O8M A;  4JD2 A;  1T3V A;  3SJH A;  3PIO L;  3CJ9 A;  1W97 L;  2NRZ A;  3CF5 L;  1QZ6 A;  2ZGY A;  4ISG A;  3LDQ A;  4O5F A;  3SLC A;  1BG3 A;  2FF6 A;  3GG4 A;  4LC9 B;  3ULE A;  4FWL A;  4A2B A;  4FPA A;  3LL3 A;  3O1W A;  3GBT A;  5KPT A;  3UE5 A;  4YDU A;  4BRM A;  3VF4 A;  4H5N A;  5JVH L;  4WQ5 C;  2WFB A;  5AQI A;  2NZT A;  4ISF A;  5CHI A;  2W40 A;  3SAF A;  3CC7 N;  1HPM A;  4XH4 A;  1TYQ A;  1MDU B;  3UKR A;  1NGE A;  2E2Q A;  4CJ7 A;  2D0P A;  2EWS A;  3A0I X;  3BUZ B;  3KWG A;  2RHK A;  3EL2 A;  2VWB A;  1SS6 A;  2P9L B;  3BEX A;  4BGA A;  2DPN A;  5HL7 L;  3LDP A;  2OTL N;  1KD1 O;  5ELZ A;  1G99 A;  1E4F T;  2J4R A;  5TKY A;  3ZX2 A;  4CBU A;  3A5L C;  3R1X A;  4CZJ A;  4A5B A;  3ENO A;  3D2F A;  3TSQ A;  3O08 A;  4A57 A;  3G4S N;  2BUP A;  1BU6 O;  2YCH A;  4BRN A;  2P9U B;  1RDU A;  5I9E B;  4GV6 A;  3CCQ N;  5C0Y A;  4GV9 A;  3TSU A;  4FWR A;  4BRG A;  3CCJ N;  4IFE A;  1YF5 L;  5GAE P;  3R8E A;  5FPE A;  3AGK A;  5BR9 A;  4WQ4 C;  2QTD A;  4ILJ A;  2KLA A;  4MDB A;  4OPH A;  3F5T A;  3P39 A;  3CCE N;  2NRV A;  1RGI A;  4O8U A;  1HKG A;  5AZJ B;  5AQN A;  2E1Y A;  5AQJ A;  1MWK A;  3CCM N;  4BC3 A;  4K41 A;  3MWT A;  3UKU A;  3ID8 A;  5F2R A;  4YOV A;  2QWO A;  5E84 A;  4I6M A;  4IOX A;  2QWN A;  4CZH A;  3RSE B;  4DCH A;  1JCF A;  4RTF D;  1KQS M;  5C2D A;  2D0O A;  3TTF A;  2ZF5 O;  3ZYY X;  4FOI A;  1P90 A;  4JK7 A;  4CZL A;  3SMP A;  2ITM A;  4FSV A;  4WF9 L;  3ULE B;  1VQ8 N;  1YJ9 N;  3MX5 A;  4JHD B;  4YOX A;  3NMU A;  3E9P A;  1W2B M;  3WEE A;  4QS7 A;  3LDL A;  1NMD A;  3QB0 A;  3IFR A;  1GLF O;  2F7T A;  4BRQ A;  4BR0 A;  4CZM A;  3AAQ A;  3PLA A;  4IWV A;  1GLC G;  3TSP A;  1ZBS A;  4IXC A;  2Q0R A;  4EIA A;  1HLU A;  2KKZ A;  3FZH A;  4WFA L;  4EHU A;  4JKH A;  4BR4 A;  1KAZ A;  2NRR A;  1YAG A;  3R6M A;  5AQR A;  2VGM A;  4J8F A;  4JKE A;  3VOV A;  3M6G A;  3FFK B;  3CHW A;  3KWI A;  3C6H A;  2HF4 A;  2Q1N A;  3VF2 A;  3VMF B;  3W0L A;  1OVY A;  1ZC6 A;  4WCE L;  2I7P A;  3L4Q A;  3N4P A;  1QQO A;  2HST A;  3DXK A;  4H0X B;  3VET A;  3VTH A;  4BQZ A;  5ADX A;  3ZET B;  1U2V A;  5GIO A;  4JN4 A;  2Q97 A;  1NGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...