3KHYA

Crystal structure of a propionate kinase from francisella tularensis subsp. tularensis schu s4
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
384
structure length
384
Chain Sequence
MSEILVLNCGSSSVKFALINPHTSQSLVTGLAENIATKNCKVVFKAEHKIVKYLENGSYKDVFEMLKDFLVENKHLEKIVAIGHRVVHGGQYFSKSVLINADSLEKIKACIALAPLHNPAHIEGIRFCQQIFPELPQVAVFDTAFHQTMPSYIAEYAIPYELTHKHNIRKYGAHGTSHKYVSEQAAKILTQQKANVIVAHLGNGCSITAVVDGKSIDTSMGLTPLDGLVMGTRSGCIDPSIFAYISDNLGWSVTEITNMLNKQSGLLGICGHNDMREVSQLAAKGDSLAKLAIEIFSHRVAKFVASYMIYFNKLDALVFTGGIGENAANIRKNIISKLANLGFMIDHQKNSNSETFINSKNSHNIMVIATNEELMIAQETQNLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a propionate kinase from Francisella tularensis subsp. tularensis SCHU S4
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Transferase
molecule keywords Propionate kinase
total genus 123
structure length 384
sequence length 384
chains with identical sequence B
ec nomenclature ec 2.7.2.-:
pdb deposition date 2009-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3khyA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3khyA02
1R59O 2I7PA 2WUSA 3FZHA 1XQSC 3LL3A 4CBUA 3WQUA 1Z6RA 1NGEA 2PAVA 5FPDA 4JHDA 3DXMB 5AQLA 4BG9A 2Q0UA 2HF3A 3UKUB 4C23A 3IDHA 1GLLO 3FR0A 5AQTA 3GE1A 4H0YB 3C0BA 5LY3A 3UB5A 3FZLA 3CHWA 4JN4A 2F9WA 4BVPA 3JXUA 3UKRB 1T44A 4DCHA 2KHOA 3GL1A 3O6WA 4IJNA 1GLJO 2P9PA 3O4WA 3DAWA 4CZGA 4M63C 2QWNA 5BPNA 4WQ4C 1NGIA 4FPBA 2E1ZA 3BF3A 5AQPA 2FF3B 2D1KA 2D0OA 1BA0A 3P4IA 3VEWA 1QQOA 2P9SB 1Q18A 1GLBG 1G99A 1GLEG 3O1WA 5ELZA 4F9OA 1RDWX 3A0IX 4H5RA 1KAZA 2YCHA 1ESVA 2IVPA 4B1VA 2FSKA 3FZKA 3M1FA 3SJHA 4CZJA 3KVGA 3A5OC 5BN9A 3EKUA 3BUZB 5AQMA 2QW9A 3CERA 4H0OA 2P9IB 3W3DA 1HX1A 2P9NA 3I33A 3U8XA 4PL7A 1V4SA 2FXUA 3BEXA 2P9SA 3B8AX 2E88A 3DWLA 1ZXOA 1YVNA 1X3MA 5KPRA 2P9LA 3MMVA 4NB4A 5AQHA 5BRHA 1LOTB 4FWQA 2F9TA 2QWPA 3L6QA 2YJEA 2ITMA 3MK6A 4FWRA 2A40A 4JD2B 5AZIA 1NM1A 2E2NA 2NZTA 4BRQA 5E26A 1P8ZA 2W40A 4WQ5A 5EX5A 4BRCA 2ASPA 1NGFA 4M7YA 1NGJA 4ISFA 3CI5A 1GLCG 2FSNA 4IWVA 2GEMA 4BRNA 4BQZA 3FFKB 3FE1A 3O08A 1HKCA 2GWKA 2D4WA 3D2EB 3VF4A 3JS6A 3VERA 4GNIA 1V4TA 1X3NA 1K8KA 3H1VX 4CZKA 3WXLA 2QWQA 4BREA 2OANA 1MWMA 4CZFA 1JCFA 1T6DA 2P9UB 3SLCA 3MN5A 1NLVA 4BGBA 3ZETB 2E1YA 3AARA 3DJCA 4XH1A 4EFHA 1RFQA 5JMVA 5I9EB 4BC4A 2Q97A 5AQGA 4AM7A 1KAYA 4B1WB 4H0PA 3MDQA 1U6ZA 2IVNA 1DGKN 2I7NA 1DEJA 3ENHA 3ZEUA 1NBWA 5FPEA 5B8HA 4Z94A 3J8AA 4BR2A 3GG4A 3H3NO 4H03B 4YDUA 3WUHA 1EQYA 1ZC6A 3L0QA 2Q31A 4BRMA 3D2FB 1QQMA 1Y64A 4WQ4A 5AQIA 5E84A 4FOEA 4H5WA 5AQUA 5AQOA 5BPLA 4XEIA 1HUXA 4BC2A 5F1XA 5JLHA 5FPMA 3H3OB 5AZJA 3WEEB 3VPZA 2HOEA 4B1UB 4B1ZA 4FWNA 1WOQA 3WT0A 3GDQA 4A61A 3QDKA 4XH5A 5AQXA 3QB0A 5JLFA 3A5LC 3U4LA 3H46O 4ISGA 4BRDA 4H0VB 5AQKA 4AM6A 4JD2A 5AZIB 4CJ7A 5ADXH 2Q1NA 3LDQA 3DXMA 3VEVA 2QM1A 2A41A 1HKBA 2CGJA 4BRGA 2W41A 4JAXA 3LM9A 4DHYA 1BOTO 3C7NA 1RGIA 3SMPA 4BQLA 4O5FA 4QS7A 3LDNA 3CETA 3MN6A 1QZ6A 2P9PB 2QXLA 3DXKB 3LM2A 2E2OA 3O1BA 4BC5A 3VEOA 1S3XA 2GUPA 4CZEA 3H6EA 5AQYA 2CGLA 1HPMA 4NO7A 5KPTA 2J4RA 3WXIA 5EOYA 1SQKA 4PKIA 5AR0A 5AQQA 2GWJA 4K42A 2H3GX 1D4XA 4E1JA 3IFRA 1KXPA 4CZMA 1U2VB 1XC3A 2QWRA 1XUPO 3VEYA 3CQXA 4H5VA 1HJOA 3VF6A 1DKGD 1T6CA 2P9KA 5AQVA 3CJAA 3U9ZA 4EHUA 1GLDG 2HMPA 2AA4A 2Q36A 4BRPA 1BUPA 3QFPA 1YXQA 3WXKA 4K43A 4J8FA 4BRHA 4FSVA 2FSJA 5AQZA 2V51B 3MCPA 1HLUA 2V7ZA 4FWOA 4FWMA 3EN9A 3EKSA 4I6MA 4YDUC 4LC9B 3EZWA 5FPNA 1U2VA 5JICA 1MDUB 1X9JA 3C7NB 4B9QA 3S41A 3FLCO 3BF1A 4CD3A 3O8MA 4BRIA 2Q0RA 2ASMA 4CI6A 4H0TB 2VYPA 4B1XB 4EAHD 3FGUA 3CJ1A 5BN8A 1YAGA 3ZEUB 3AY9A 3VGMA 3LDLA 3QBXA 4FOIA 1Z05A 4JNEA 4HWIA 2FF6A 4CZHA 5EXWA 1GLAG 3MN7A 3TU5A 2V52B 3OHRA 3IMXA 3ULEB 1NGAA 1C0FA 1HKGA 1BO5O 2D0PA 3D2FA 3R6MA 2ZF5O 2CH5A 3QICA 4H5NA 3R9PA 2V7YA 1BU6O 3ZX0A 1J6ZA 5LJWA 4I6MB 3D2EA 5AFUA 4A2AA 2E20A 2E2QA 1K8KB 3ATVA 4FPAA 4BG8A 1GLFO 1MA9B 3GBTA 2NRHA 1SZ2A 5AQRA 1IG8A 4KBOA 4BR0A 1MWKA 3LDOA 4CZLA 3IUCA 3RSEB 3SK3A 2A5XA 1NGBA 4BR5A 4MO4A 3VETA 2E2PA 1NMDA 4BR7A 1NWKA 5AQFA 4A2BA 4IO8A 2GTDA 3TPQA 5KPZA 1TYQB 2UYTA 2DPNA 3CJBA 4RWTA 2QWOA 3ZX2A 3H1QA 2YJFA 2ZGYA 4PL8A 4A62A 5F2RA 4IXCA 3R8EA 2VWBA 5TKYA 5CE3A 3LDPA 1NGHA 3HM8A 5BRDA 2P9LB 2GELA 1OKJA 3FZMA 4RTFD 4BRAA 2YHXA 2FLOA 2QWLA 3ENOA 3VOVA 5KQDA 2ZGZA 2P9NB 4FO0A 3ATUA 4RCHA 1ZBSA 4JHDB 1LCUA 3AAPA 4FWPA 4MO5A 1QQNA 5ADXA 2NLXA 3UKUA 3FZFA 3HTVA 4XH4A 3W0LA 2ZWHA 4BR4A 2IVOA 5AQWA 1NGDA 4DB3A 1BDGA 3UE5A 4ISEA 1BG3A 4BVOA 5AQSA 4BRKA 3A5MC 1TUUA 2A6AA 5AFUH 4O8KA 3M6GA 4GY2B 1QHAA 2AP1A 5BR9A 2BTFA 5LJVA 3SMSA 4FWLA 3WXJA 1BWFO 3I8BA 4WYBA 2YHYA 3VGKA 3DXKA 4Y0WA 2QWMA 2A3ZA 3BP8A 2CGKA 4B1YB 3CJ9A 3GOIA 1TYQA 2YI1A 3HI0A 3F9MA 4K25A 5KQ8A 2VCPA 3D7EO 4H5TA 1E4GT 4PKGA 1E4FT 4FWKA 1ATRA 4M7XA 2IIRA 2YHWA 1KAXA 3KHYA 1CZAN 3EO3A 2CH6A 3H45C 1BA1A 2E8AA 1H1VA 1NGGA 3ID8A 3ZETA 3U9DA 1IJJA 4K41A 4DQ8A 5EVZA 4EHTA 1SAZA 3AAQA 4CBWA 5BREA 2PBDA 1JCEA 2HF4A 4FL9A 4BR9A 4IJAA 4IZ9A 5EY4A 3A8YA 4HTLA 5AQJA 4CZIA 1S22A 3HSCA 3CJCA 1JCGA 4BGAA 2ASOA 4CBXA 3ULEA 3QBWA 3VENA 4BROA 4H0XB 2P9KB 5AZJB 3A5NC 4MLHA 5BRFA 2BUPA 3VESA 2Q2RA 3O80A 3O5BA 4PKHA 3HBTA 3CQYA 4FWSA 3ZX3A 3QMLA 3MN9A 3WQTA 1QZ5A 5BPMA 3CJ7A 1C0GA 3WEEA 3RSEA 3VF2A 4BC3A 3EL2A 3HZ6A 2A42A 3QFUA 5F0XA 3M3ZA 1NGCA 3VEXA 4CD1A 4QS8A 4MLEA 3UKRA 4QS9A 3VGLA 4BRFA 1WUAA 3VEZA 1YUWA 2P9UA 4WQ5C 3L4IA 3CIPA 3KZBA 2EWSA 1ATNA 1TUYA 3G25A 1ATSA 4L3QA 2P9IA 4EIAA 4BRLA 5AQNA
chains in the Genus database with same CATH superfamily
1R59O 2I7PA 4CBUA 1XQSC 3I56N 5FRMA 1W7AA 3B6OA 1RBTA 2ZJQL 2UXCK 2PAVA 4CJLA 1YVUA 4BG9A 4DSJA 1LAWA 1GLLO 3FR0A 1GOAA 2FBYA 3TTCA 3UB5A 1KSPA 3QEVA 1IG9A 4JN4A 4BVPA 3KD5E 3G0ZA 3GL1A 4KTWA 2IOCA 4CZGA 2QWNA 3MWTA 3OA9A 4JKAA 3E9OA 1BA0A 1L3TA 2G8WA 1QQOA 1GLBG 1KLMA 5ELZA 4OKEA 1RDWX 4C8OA 4DSKA 4JS5A 4N56A 3RVCA 3CMEN 3FZKA 1RILA 1Q8IA 2QW9A 1VQ9N 4FLZA 4N41A 2P9IB 1P90A 1HX1A 4PL7A 3U8XA 4V19S 1VQKN 2FXUA 2E88A 3CCLN 1ZXOA 3K0SA 3MMVA 3AVBA 3CFOA 3L3VA 2F9TA 3OS1A 2ITMA 2Z1HA 4FWRA 4JD2B 5CZ2A 2DFHA 5AZIA 4Q5VA 1P8ZA 1WSHA 4CJUA 2XRIA 3VQ5A 1ITGA 3VQ9A 3CPWM 3ZT0A 2FSNA 3MXJA 3U3GA 1L5UA 4BDZA 4WF9L 4HCBA 2RE2A 4G9ZA 3K5LA 3O08A 3O3HA 1JLFA 3QEPA 3VF4A 3JS6A 3RR7A 2QWQA 3B6PA 1MWMA 1JKHA 5HRRA 3T1AA 3THXA 1VRTA 4ELVA 2YV0X 4FZXC 3C95A 1NLVA 1KRPA 1Q9YA 3LAMA 1HMVA 1RFQA 4NCAA 5I9EB 3OTOK 2Q97A 3CPEA 4JI7K 4JK7A 5C42A 1NKCA 4B1WB 3MDQA 1X9WA 1Z25A 1DGKN 1DEJA 4EP4A 3LP3A 4HUEA 5FPEA 4CVNE 5B8HA 4ICLA 4Z94A 1SKWA 3J8AA 2ZQBA 5J2PA 3G10A 2KZMA 3TAFA 3L0QA 4BRMA 2WC9A 3ZSQA 1HYZA 1Y64A 1T05A 1RNHA 1K73O 4FCYA 3D6RA 2HHXA 2E6LA 5BPLA 2W6LA 1HUXA 4DTPA 4AHSA 4AQYK 4W5QA 1HNWK 5FPMA 5GAHP 5AZJA 4FK4A 3OYNA 3VPZA 2HOEA 1C0MA 1U04A 3OYGA 1NNEA 3RMCA 4LFCK 3QLHA 4DUYK 3AV9A 4M3WA 4IG0A 4JD2A 5AZIB 4CJ7A 4YNQA 2VG6A 3VEVA 2A41A 5C10A 2HVHA 4BRGA 3C94A 4JAXA 3LM9A 3CCSN 1BOTO 3DRPA 2OTLN 1RGIA 3SMPA 4O5FA 4F2SA 1D9DA 2P5OA 3CETA 2QXLA 3TI0A 3DXKB 2O8FB 2IAJA 3OS0A 4IFEA 3WNFA 4FJLA 4LF7K 2YNFA 3TWHA 2BANA 2GUPA 5AQYA 3F5TA 2OPPA 4QCLA 1HPMA 5KPTA 3Q7BA 4PWDA 3WXIA 2KFZA 1HPZA 2OZSA 4N76A 4CF2A 1WLJA 1S6PA 5EU7A 4CEFA 3SV4A 4IOAL 3IFRA 1KXPA 4CZMA 3KWIA 1U2VB 3PUFA 3VEYA 4FYDA 1HJOA 3PIPL 4LY7A 3MXMA 2EHGA 1T6CA 4DV6K 3LZIA 4FW1A 3U9ZA 4EHUA 1GLDG 2OA8A 2Q36A 5M1OA 3WXKA 3SUNA 1ZYQA 4BRHA 2FSJA 2HSTA 3MCAB 3HVRA 3LPUA 1HLUA 4FWMA 3O4QA 3EKSA 3QNNA 5CR4A 3KK3A 3EZWA 3KK1A 5CY4A 4IO9L 3C6HA 1VQON 1X9JA 3C7NB 1LAVA 4AHUA 3FLCO 4DFPA 4PHTX 4CI6A 1VSHA 4FXDA 1O1WA 1KC8O 4OVLA 4O4GA 3SBGA 3FGUA 2RN2A 3EE8A 1IKWA 2YNIA 4W5TA 3MXIA 4K8ZA 1HNVA 3LDLA 5AJ3K 4JNEA 4HWIA 3CG7A 1NJXA 2V52B 4B9SA 1C0FA 3AVHA 4DR4K 1SL0A 2FBTA 1BU6O 4CHYA 4MDBA 3V9SA 1J6ZA 4YOUA 4NYNA 1XC9A 4A2AA 4GV9A 1S72N 4WCEL 3ATVA 1GLFO 2WOMA 2O8BB 3JAMO 4FW2A 5AQRA 2YKMA 5C25A 3IUCA 4DTXA 1YJWN 3OY9A 4MO4A 1UWBA 2YNHA 1U47A 3AVJA 3OYFA 2E2PA 3HPGA 4BR7A 1C6VA 4NCGA 3TPQA 3P83D 5KPZA 2O8DB 1W2BM 1B9FA 4RWTA 4Y1DA 2ZE2A 5TKYA 4AHTA 1M90O 3QEIA 3E1YA 1OKJA 1W97L 3DI6A 2QWLA 3NCIA 4CHOA 4DS4A 1XNRK 4B3MK 4I7FA 4A59A 4FO0A 4M3RA 4RCHA 3DRRA 3LP1A 1VSLA 1T8EA 1NMNA 4MO5A 1QQNA 1C0TA 3QINA 4FLWA 1N5YA 5AQWA 3BZKA 4DTJA 4KH6A 3SBTA 4DR3K 4ISEA 3R3LA 5MLCQ 4E3SA 1TV6A 5KGWA 3ZLJA 3P5JA 3DLLL 4GY2B 1QHAA 2AP1A 2NRVA 4GW6A 5LJVA 1S1UA 5C0YA 2OPRA 3BP8A 4NCBA 1W0HA 4G1QA 2YHBA 3TAGA 3I8DA 3V6DA 1SL1A 3NH2A 3HP6A 1A5WA 4FWKA 4ELTA 4UY8O 1ATRA 2VQFK 2NRWA 3KJVA 3NVMA 4FJXA 3ID8A 3ZETA 2HBJA 3BY5A 4JS4A 1HNXK 4K41A 5EVZA 4CBWA 1N6QA 3SQ0A 4IZ9A 5EY4A 1FW6A 3BDPA 1O13A 4CZIA 4JV5K 2ZD1A 1K6YA 4CHNA 3CCEN 3SPZA 1XI1A 2O8DA 3S3OA 1BISA 4X66K 2IGIA 1T03A 3CQ8A 3V1OA 5BRFA 3WXMB 1YJ9N 3VQDA 3O80A 4PKHA 3AA5X 3I0RA 1N36K 4DU3A 4JI1K 3RTVA 5HROA 5F0XA 5GADP 2E5LK 1I3AA 1NGCA 3VEXA 4CD1A 3AVMA 4QS8A 2WONA 4QS9A 1LWEA 3OBYA 3CF5L 4DTOA 5GAEP 4OKJA 4DR6K 5J2NA 3CIPA 3T1YK 3AVAA 3DLHA 1TUYA 3G25A 1ATSA 4CFCA 4GVMA 5AQNA 2WUSA 1JLCA 3LL3A 5GAGP 4X65K 1RDAA 1J9AA 1Z6RA 4J2DA 1NGEA 3TANA 5FPDA 4JHDA 1BHLA 5AQLA 4K8XA 1RBUA 3VA3A 4F3TA 4C8LA 3FFIA 1S1WA 3C0BA 3FZLA 3CHWA 4FJHA 1X9SA 1YT3A 5FRNA 3LANA 3JXUA 3LALA 3UKRB 1T44A 2KHOA 4DQPA 4LF5K 2ETJA 4OPAA 4M63C 2HNYA 5AQPA 4FPBA 3BF3A 3OJSA 2FF3B 4I2PA 1VQ5N 2VG5A 3ZYYX 1S9EA 5HL7L 1TKDA 3OYJA 4H4OA 1Q18A 1SS6A 1TL1A 4F9OA 3HOSA 4H5RA 1KAZA 2YCHA 1ESVA 4CF8A 1BI4B 4WFNL 2HMIA 4FJ8A 5BN9A 3EKUA 3KKSA 2F8SA 4LSNA 1YIJN 4YOWA 3Q7CA 3RMDA 1JLBA 1V4SA 1X9MA 3DWLA 2P9SA 3B8AX 4E1NA 1C1BA 2BDPA 4NB4A 4FZYA 4FWQA 1WSEA 2YJEA 2WTUA 2BH1A 4CFDA 1NJIO 1HYSA 4CGFA 4A5AA 2NZTA 4BRQA 2W40A 2G8UA 4H8KA 4LFBK 4W5RA 4DMNA 2HHTA 4IOXA 2ASPA 1JLAA 1NGFA 1BQMA 3CD6N 3QERA 3CI5A 2PZSA 1KVBA 3ZSXA 2GEMA 2F8TA 4DF8A 4BACA 1YTAA 2XY6A 1BIZA 3FE1A 3UIQA 3M8PA 2GWKA 1RT7A 3D2EB 4U67L 4CFAA 1N8RO 3ZT4A 4CZKA 3WXLA 3ZT3A 4OPKA 3VQQA 3MAQA 3TARA 3ASMA 1T6DA 2OTJN 3ZETB 4CK2A 2OCEA 4CGJA 4EFHA 3JYTA 5D3GA 1LV5A 4FLUA 1KAYA 1ASVA 2UUAK 4H0PA 4IFYA 2IVNA 1IV0A 3ENHA 1CXUA 2X78A 1TKTA 1RTDA 2G8VA 5BR8K 4BDYA 1XMOK 2PY5A 1WSIA 3QNOA 3WUHA 5CZ1A 4LF4K 3THWB 4YHHK 1VHXA 2ATQA 5AQIA 3PX4A 4DR7K 5KGXA 4KHUA 3L2VA 4XEIA 5M1KA 3NF6A 4BC2A 5JLHA 3H3OB 4FM0A 3SUOA 1BCOA 5I3UA 4OPHA 2B5JA 2Z1JA 4JKDA 3O9QA 1TL3A 1HR0K 3WT0A 3CCRN 1N32K 3AO5A 3QDKA 4XH5A 3QB0A 3H46O 4ISGA 3OYKA 1JJ2M 4CEOA 4AM6A 4O55A 4MDAA 1RTIA 1VK0A 1WSJA 2CGJA 2G8HA 3BGRA 4IOCL 4HCCA 4BQLA 4Z0UA 4GV6A 4DS5A 4FM2A 3RR8A 2PYLA 4B8AB 2BGGA 4Q0BA 3LM2A 1SUQA 2Q3SA 1EETA 4BC5A 4AILC 1OH7A 4CZEA 3H6EA 4FJGA 1XNQK 3F73A 4NO7A 2J4RA 4CW7B 3PY8A 1CXQA 3HL8A 2QI2A 3HM9A 2HHQA 4PKIA 5AR0A 4OGCA 1JL1A 4K42A 4I2QA 2H3GX 3NGYA 1D4XA 4GMJB 4LF9K 2QWRA 3ZSYA 4H5VA 4OKKA 3CCQN 1Y97A 1D5AA 1RT3A 5AQVA 5HOOA 2HBMA 2AA4A 4BRPA 3QFPA 2PYJA 4KFBA 2V51B 4M3XA 3EYZA 1VQNN 2KKZA 3SUQA 4I6MA 4YDUC 3DLBA 1HNIA 3CCVN 5FPNA 4CJRA 4LFAK 3DLRA 3THYB 2W42A 4B9QA 1JLGA 3SPYA 4E0DA 3VQEA 3C6AA 2JGUA 4NLCA 4EZ6A 1GOBA 3CJ1A 3CXCM 5BN8A 1YAGA 4CF9A 2ZJRL 3K59A 4DQQA 1IKYA 3C65A 3PX0A 1WBBA 4XIUA 2FF6A 5EXWA 1GLAG 4O44A 4C8NA 1NG9A 4IEIA 3ULEB 1IKXA 1HKGA 2D0PA 1BO5O 3D2FA 4FJ5A 5E41A 2V7YA 3IRXA 1FXXA 3D2EA 5DM6L 2E20A 2BE2A 3AGKA 4AHCA 2XY8A 4E7LA 3P31A 3N4PA 4BE1A 3MWPA 3SK3A 2A5XA 4BR5A 1JLEA 4DSIA 3QEWA 1NWKA 3RMBA 3MEGA 4PY5A 1TYQB 3HVTA 1NK4A 4IBNA 3ZSRA 1TGOA 3CJBA 2QWOA 1ZBFA 4A62A 5HLFA 3R8EA 4F3OA 1NGHA 1IO2A 2GELA 5CHIA 3FZMA 1L3SA 3LP2A 3ENOA 3VOVA 4QOZB 2P9NB 3NHGA 4Z4GA 3O3GA 1ZBSA 2VGNA 4LF8K 5ADXA 3FZFA 3HTVA 4XH4A 3IG1A 1TKZA 1NGDA 2GX9A 4DB3A 2DFFA 1BDGA 4CHZA 4KHPK 1KFSA 3CCUN 5KRSA 4IFVA 1GOCA 2KFNA 4O8KA 3M6GA 2VWKA 5CYMA 4Z4CA 4O0IA 4R79A 5LL6Z 3SMSA 3K5MA 3WXJA 4WYBA 4LSLA 2YHYA 4KRFA 4Y0WA 4OO1J 2RPIA 3AVGA 3MEEA 1RT4A 3S3MA 4JI2K 3NH1A 4RW9A 1A5XA 1VQ4N 1KVAA 2VCPA 1E4GT 4NYFA 1J5EK 4PKGA 4E89A 1T7PA 4JKHA 4QAGA 4FLXA 3SJJA 1LWFA 4KAZA 1BA1A 1E3MA 2HHSA 1VSEA 1YF5L 1IJJA 4JKGA 1U49A 4PUOA 4CJTA 3DOKA 3VQAA 2HF4A 1RBRA 3F2KA 4BR9A 4IJAA 3AVLA 3E01A 3VQ8A 3A8YA 4HTLA 1S22A 4JLHA 3AA2A 4DLGA 3O9RA 4HVJA 3O3FA 1QVFM 2Z1GA 3JSMA 4FJIA 1JCGA 4YY3K 4CBXA 3ULEA 1IBKK 4B9NA 3O4NA 3QBWA 3LZJA 2OPSA 1BI4A 1FKOA 3LWLA 2I5JA 1OVQA 4JKGB 5GIPA 4MLHA 2BUPA 5CYQA 1ASWA 5JS1A 4CJWA 4FJKA 4FWSA 3ZX3A 4CEAA 2G8IA 3MN9A 4JRPA 1QZ5A 1C0GA 3WEEA 1VRUA 4M45A 3DLEA 3M3ZA 2QTDA 4MLEA 1VQLN 3UKRA 4BRFA 3PV8A 3VEZA 1YUWA 4WQ5C 2O8EB 4EZ9A 3ZSWA 2X74A 1BCMA 5K14A 1DLOA 3TAMA 3NF7A 4C8MA 2AJQA 3RWUA 4E19A 1ATNA 3ITHA 3DMJA 4HUFA 3M8SA 4L3QA 3QO9A 4I9QA 4IKFA 4Z4HA 1IBMK 4BRLA 4DTNA 1NU0A 2G8KA 3FZHA 4ELUA 1J5OA 4JRQA 1ZBLA 4K0KK 2F4VK 3RRGA 2ZJPL 4DFKA 4CK1A 5HRSA 2Q0UA 3HK2A 4DR2K 1EX4A 3UKUB 4C23A 4RW8A 4M42A 4H0YB 4CGHA 4KO0A 4DSLA 1NJZA 3BZCA 4RW4A 3RRHA 4DCHA 3O6WA 4IJNA 2P9PA 3OW2M 3OBWA 3U3YA 2UUBK 5BPNA 2O8FA 5DK5A 3PIOL 1NGIA 2KLAA 5SZTA 4F8RA 3HP9A 4NLBA 1ZBHA 3VEWA 2P9SB 1HQEA 3NBPA 3OYMA 1VQ7N 1BGXT 1RBVA 1GLEG 4HUGA 3VQ6A 4CIEA 4B9UA 4RW7A 4E7HA 3SCXA 3BUZB 1KTQA 3QETA 5AQMA 1VSDA 2HB5A 4RG8A 4A5BA 3CERA 4CCHA 3W3DA 2VQEK 2P9NA 3TR8A 3I33A 4FK0A 4HTUA 3I0SA 2RHKA 4AH9A 1BL3A 1YVNA 3P39A 1WSGA 1X3MA 5KPRA 1YTUA 1LOTB 4CF1A 1BQNA 1WBDA 4CEZA 1NOZA 3HRGA 1WB9A 2O8CA 1D9FA 4FJJA 2E2NA 3VQCA 2X6SA 4DQRA 3KLEA 4BRCA 1WAJA 4M7YA 1NGJA 4N47A 5M1NA 4ISFA 1GLCG 3CC7N 1N33K 4BWJA 1ILYA 1DT9A 2O8BA 1BIUA 5DM7L 2KTQA 3SAHA 4Z4FA 1HKCA 4OLAA 2D4WA 4CEEA 1NJWA 3DM2A 3VERA 4GNIA 1R0AA 1S5JA 2D0AA 4DF4A 4BREA 2OANA 5C15A 3NMUA 4KHSA 4CZFA 2KW4A 1DTQA 5H1SQ 1QSYA 1KLNA 3V1RA 4BGBA 3AVFA 3DJCA 4ILJA 5JMVA 3OYHA 2NRXA 2YX6A 4AM7A 1U6ZA 2I7NA 2EX3A 3ALYA 4FJNA 4CERA 3PX6A 1K8AO 4C8KA 3ZSZA 4C1NK 1I39A 3H3NO 2RKIA 1DTTA 4H03B 1EQYA 1ZC6A 4LD0A 4OX9K 1QQMA 2KQ2A 3SUPA 3HO1A 4FOEA 5AQUA 5FROA 2ITGA 3LWMA 4E7KA 3WEEB 1OVYA 3ENBA 4B1ZA 4FWNA 1WOQA 1A5VA 4CE9A 3AO1A 3GDQA 4A61A 4E1MA 4WFAL 3TSPA 5JVHL 3A5LC 3K2PA 4BRDA 3OYAA 4MQ3A 4O8UA 4IEEA 5AQKA 4CESA 3IKMA 3VTIA 2Q1NA 3R1XA 3DXMA 2QM1A 1YJNN 2W41A 3PSFA 3MX5A 2PFUA 3K9KA 3HJFA 4GVEA 3C7NA 2HHHK 2HBLA 4QS7A 3LDNA 4O0JA 1RT2A 1K9MO 3HOTA 3O1BA 4HHTA 4DV2K 3VEOA 3AVKA 1S3XA 5FDLA 2NRZA 3HPOA 2FC0A 5EOYA 1SQKA 1EWQA 2GWJA 4JKEA 3T1HK 1KVCA 3E9PA 4JYAK 3M8QA 3CQXA 4FVMA 5C24A 1HRHA 3ZT1A 3VF6A 3E66A 1DKGD 2P9KA 1QTMA 4KB0A 4YOVA 5IWAK 1QVGM 3C6TA 1CZ9A 1BUPA 2NUBA 1YXQA 3V4IA 4CJ4A 1YI2N 3SAGA 5AQZA 3L2RA 2IS3A 3MCPA 4FWOA 2V7ZA 3DLGA 3L2QA 4DTSA 2G8FA 1KD1O 5DMRA 4DV0K 4ILHA 3V9ZA 4DV5K 3VN5A 3ZT2A 4M3TA 5M1PA 3BF1A 4CD3A 3O8MA 4BRIA 1QS4A 2Q0RA 2ASMA 4JI6K 4H0TB 4KV8A 4B1XB 3ZSVA 3OS2A 4ID5A 4DUZK 3ZEUB 3AY9A 3QBXA 1S1TA 3F9KA 4FOIA 1Z05A 3TABA 1JXEA 4TSXA 4CEDA 4B9TA 3EE9A 1QSLA 4CZHA 4E7IA 3TU5A 1TAUA 4KREA 3IMXA 3WNEA 4B8CA 2ZM6K 1S1XA 3THXB 3R6MA 4DV7K 4ZTJA 2ZF5O 3QICA 4H5NA 3R9PA 1S1VA 4DTRA 1XHZA 4B9VA 3ZX0A 3J7ZO 4J2AA 1FJGK 4BY9C 5LJWA 4I6MB 4OJRA 4Z4EA 3KIOA 2E2QA 1UAXA 1K8KB 3IAYA 1MA9B 4CJ5A 3CCJN 3GBTA 2NRHA 1EKEA 1SZ2A 3AA4A 4KBOA 4B3SK 1MWKA 3LDOA 4CZLA 3RSEB 2NNWA 3VA0A 1NMDA 3OYIA 4B9LA 4A2BA 5AQFA 4IO8A 2GTDA 3ZCMA 3I55N 4DLEA 4JI8K 3TTFA 3CFPA 3ZX2A 2NRTA 3H1QA 3L3UA 4PL8A 5F2RA 4IXCA 4YFUA 2VWBA 3K5NA 3TAPA 2F96A 3HM8A 3CCMN 2P9LB 4ZTFA 4CHQA 4RTFD 4FK2A 2FLOA 3G4SN 5KQDA 2ZGZA 4IDHA 4CEQA 4JHDB 3AAPA 2NLXA 3UKUA 1WAFA 2ZWHA 4BR4A 2IVOA 1HYVA 1VQ8N 3UE5A 3AO4A 1BG3A 3P1GA 5AQSA 3V81A 1SL2A 4BRKA 3A5MC 1TUUA 2A6AA 5AFUH 4FM1A 4W5OA 4DWIA 5C2DA 3EEQA 5BR9A 4JKFA 2BTFA 4JI3K 1VSFA 2F7TA 1BWFO 3D45A 4DV4K 3DXKA 5J2QA 3K58A 5LMUK 4M3UA 2QWMA 2A3ZA 4UQGA 4B3TK 3TSUA 4B1YB 5A2QO 4U7BA 3HI0A 4JKCA 4CJQA 1OH5A 4K25A 1NKEA 4AF1A 4H5TA 4BE0A 5JS2A 4M7XA 1VQMN 3TSQA 4B08A 3EO3A 3H45C 3T7ZA 1XHXA 4GKKK 4YOXA 3U9DA 4PQUA 3AO3A 1G15A 2NRRA 4DQ8A 4L8RB 4EHTA 1SAZA 4FZZA 2QKKA 3KKRA 5AQJA 3HSCA 4KH5A 3CJCA 4KI4A 2JLEA 4CJ3A 2YKNA 3VMFB 3VENA 4BROA 3VQBA 3S3NA 2GV9A 3KLFA 5AZJB 3A5NC 5GINA 4DU1A 2FBVA 4Z4IA 2Q2RA 3RMAA 5M1FA 3QEXA 2VWJA 3CQYA 3KK7A 1WN7A 3QMLA 5BPMA 4CIFA 1VSMA 4O5BA 3RSEA 1NK8A 3VF2A 3K57A 3HZ6A 3QFUA 1NKBA 2DY4A 3SV3A 3VGLA 4J2EA 3T69A 2P9UA 1IBLK 3THVA 1SKRA 1IKVA 1NK9A 3L8BA 5SWMA 2RF2A 4EP5A 1L3VA 2EWSA 2KZZA 3AGRA 1VQPN 3KTQA 3NH0A 1VQ6N 3WQUA 4KH4A 4KHWA 3MECA 3SZ2A 4OLBA 1EP4A 3LP0A 3DXMB 3HXMA 1RTHA 3SAFA 2HF3A 4F4KA 4X62K 2P51A 3IDHA 5AQTA 3GE1A 5LY3A 2P5GA 2F9WA 4CJEA 1NK7A 3V9WA 1GLJO 3O4WA 3DAWA 1VSIA 4WQ4C 2E1ZA 3DRSA 2D1KA 2D0OA 3HPHA 2HHUA 3P4IA 4IDKA 3N4QA 4W5NA 3OYCA 1M1KO 1G99A 3SQ1A 3O1WA 5KTQA 4B9MA 3A0IX 2IVPA 4DFJA 4B1VA 2FSKA 4A57A 3J7AP 3M1FA 3SJHA 4CZJA 3KVGA 3A5OC 1W9HA 2HNDA 2Z1IA 3PO5A 2D0CA 4H0OA 2IC3A 3BEXA 2W6KA 1LW0A 2P9LA 5AQHA 5FLXO 5BRHA 1NK0A 1EXQA 3AVNA 2QWPA 3L6QA 3U6FA 3S9HA 2YHAA 3MK6A 3QIPA 4JI5K 1RDDA 2A40A 4AHRA 1EO1A 1NM1A 3MX2A 5E26A 4M3YA 1YHQN 4WQ5A 5EX5A 3VQ7A 4CIGA 2D0BA 4YOYA 4KHYA 4IWVA 1CLQA 2Y1IA 5HRNA 4DTMA 4BRNA 1B92A 3SYZA 5GIOA 4BQZA 3FFKB 4CGDA 2QK9A 1VSKA 2VG7A 4JK8A 1V4TA 1JL2A 1X3NA 1K8KA 3H1VX 3O9SA 2A1SA 3KWGA 3WNHA 5HBMA 3HYFA 3QIOA 1JCFA 2P9UB 3SLCA 3MN5A 4PA1A 2E1YA 3AARA 4CFBA 1UA0A 4XH1A 3OVNA 3NGZA 3THWA 3DLKA 3E9LA 1OH6A 4BC4A 4GKJK 5AQGA 3CM6A 1OH8A 3ZEUA 1NBWA 3TTDA 3M8RA 3ID6A 3NE6A 2Y1JA 4JI0K 3PSIA 3GG4A 4BR2A 2HHWA 4N5SA 3IS9A 4YDUA 3ULDA 2Q31A 3D2FB 3KD1E 3AVIA 3NF9A 4ZHRA 1XMQK 4WQ4A 3J7YP 5E84A 4CHPA 4H5WA 1HNZK 2QKBA 4IG3A 5AQOA 1QHTA 5F1XA 1TVRA 5KRTA 4CJSA 1QE1A 1HJRA 1RTJA 1ASUA 1J54A 4B1UB 3SQ4A 2FBXA 1JXBA 1TAQA 1RDCA 4Y1CA 4KHQA 2JWLA 4H4MA 5AQXA 1NK5A 1S6QA 5JLFA 3U4LA 4H0VB 3VTHA 4DU4A 2VGMA 4DV3K 3L2WA 5ADXH 3NFAA 3LDQA 3G71N 1UOCA 1HKBA 3G6EN 3OYEA 1TK0A 4CECA 4CJFA 1T3VA 4DHYA 1Q9XA 1ZBUA 4WE1A 3DOLA 2UXBK 1NK6A 1SKSA 1J53A 4DSFA 4R5PA 3MN6A 4I9LA 3WNGA 1EWRA 1QZ6A 1VSJA 2P9PB 2WBNA 2E2OA 3KLGA 3V1QA 5IT9O 2P1JA 1Z26A 4DR5K 1RT1A 3LAKA 2CGLA 3PLAA 5C2FA 1S9GA 1RCHA 1IH7A 3LPTA 2HW3A 4DQIA 4CGIA 1TK5A 1CZBA 5AQQA 1N34K 3VQ4A 4E1JA 1XC3A 1XUPO 1YITN 3HSTB 4FJMA 3CJAA 3TAQA 1RT6A 2HMPA 4FLTA 3MEDA 3K5OA 1ZBIA 5J2MA 3EY1A 4K43A 2DTUA 4J8FA 4FSVA 4J2BA 3AO2A 1Q86O 4YOTA 4CK3A 2GBZA 3KLHA 1L3UA 1LWCA 3EN9A 2QEXN 2QXFA 5C12A 1SV5A 2O8CB 2XY5A 4LC9B 4ID1A 1U2VA 5JICA 1MDUB 4MFBA 3D0PA 3S41A 5KI6A 4KB1A 4KPYA 3VQPA 2VYPA 4EAHD 1C1AA 3OJUA 3VGMA 4DQSA 4BWMA 1B9DA 1RT5A 3MN7A 4FVUA 2XY7A 3OHRA 1I94K 1RDUA 1JLQA 2IDOA 4KTQA 1NGAA 1D8YA 3KLIA 4M41A 2X6NA 2UXDK 2CH5A 3LDSA 2A1RA 1XWLA 1RDBA 1U45A 1KQSM 1FKPA 5AFUA 4FPAA 2HNZA 4BG8A 1QSSA 3SQ2A 4FLYA 1IG8A 4ILGB 4BR0A 3HT3A 5T7BA 4CGGA 1WSFA 4E7JA 1NGBA 2O4GA 4KTZA 3OYDA 3CM5A 3EZ5A 2QA4N 3VETA 4CEBA 4FLVA 3NVKA 1KCFA 4DSEA 3C6UA 3QESA 2E4LA 4FJ9A 2UYTA 3O9TA 4DTUA 4GV3A 2DPNA 3CC4N 3TAEA 5HRPA 2B4JA 2YJFA 2ZGYA 3K9JA 5CE3A 3LDPA 4WFBL 5BRDA 4DV1K 4LH5A 1Q81O 2B6AA 3PO4A 4M3ZA 4BRAA 1QQCA 2YHXA 2HVIA 3OYLA 3V9UA 3L2UA 3ATUA 5LMNK 4NXMK 1LCUA 4FWPA 3CMAN 3W0LA 1TKXA 4KI6A 1F21A 4OGEA 4BDPA 4BVOA 3THYA 3ISNC 1TK8A 3CFRA 2E6MA 2YNGA 3SNNA 4X64K 1LW2A 4DKWA 3A2FA 1C1CA 3P38A 4CF0A 2D5RA 1UA1A 4AHVA 2DFEA 4FWLA 4YORA 4CJPA 3I8BA 5TKWA 3VGKA 2XO7A 1NOYA 3NGIA 2CGKA 3CJ9A 3L4QA 3GOIA 1TYQA 2YI1A 3DYAA 3F9MA 3T3FA 1C0UA 5KQ8A 3D7EO 3H08A 2LSNA 1E4FT 3SI6A 1VAZA 2IIRA 2YHWA 1KAXA 3KHYA 1CZAN 2CH6A 5I42A 2GUIA 2E8AA 3T19A 3V9XA 4DFMA 3NAEA 4B3RK 2OPQA 1H1VA 1NGGA 1WNSA 3AVCA 4RW6A 4KKOA 3AAQA 5BREA 2PBDA 1JCEA 4FL9A 4DR1K 1FK9A 3AA3A 4C1NI 1HQUA 4FJ7A 2O8EA 2UU9K 1RBSA 4BGAA 4F2RA 5HP1A 3NF8A 2ASOA 4CJKA 3O9UA 4CJVA 2XHBA 4H0XB 2P9KB 4BE2A 1NJYA 4JKBA 1REVA 4B3OA 2WFBA 3CC2N 1Q7YO 3VESA 2UUCK 4LF6K 2R7YA 3O5BA 3HBTA 4JEPA 3J80O 2O4IA 5J1EA 1Q82O 3NDKA 2OYQA 3WQTA 3M5RA 1KFDA 3CJ7A 4NXNK 3CYMA 1MU2A 4BC3A 2JWKA 3EL2A 2A42A 5M1QA 5JVGL 4JI4K 2HBKA 1WUAA 4KHNA 1U4BA 3KK2A 3L4IA 4DG1A 3KZBA 2OZMA 2HHVA 1X1PA 4LH4A 4OPJA 1U48A 3ZSOA 3J81O 4JK9A 2P9IA 3OYBA 4EIAA
chains in the Genus database with same CATH topology
1R59O 2I7PA 2WUSA 3FZHA 1XQSC 3LL3A 4CBUA 3WQUA 5GAGP 3I56N 4KH4A 2ZJQL 1Z6RA 1NGEA 2PAVA 5FPDA 4JHDA 2ZJPL 3DXMB 5AQLA 4BG9A 2Q0UA 3SAFA 2HF3A 3UKUB 4C23A 3IDHA 1GLLO 3FR0A 5AQTA 3GE1A 4H0YB 3C0BA 3TTCA 3UB5A 3FZLA 3CHWA 5LY3A 4JN4A 2F9WA 4BVPA 3JXUA 3UKRB 1T44A 4DCHA 2KHOA 3GL1A 3O6WA 4OPAA 4IJNA 1GLJO 2P9PA 3O4WA 3DAWA 3OBWA 4CZGA 3OW2M 4M63C 2QWNA 3MWTA 5BPNA 4WQ4C 3PIOL 1NGIA 4FPBA 2E1ZA 3BF3A 2KLAA 3OA9A 2FF3B 3E9OA 2D1KA 2D0OA 4JKAA 1VQ5N 1BA0A 3ZYYX 3P4IA 4NLBA 3VEWA 1QQOA 2P9SB 5HL7L 3N4QA 1Q18A 1GLBG 1SS6A 1M1KO 1VQ7N 1G99A 1GLEG 3O1WA 5ELZA 4F9OA 1RDWX 3A0IX 3HOSA 4H5RA 1KAZA 2YCHA 1ESVA 2IVPA 3RVCA 4B1VA 3CMEN 2FSKA 4A57A 3FZKA 3M1FA 3SJHA 4CZJA 3KVGA 3A5OC 4WFNL 5BN9A 3EKUA 3BUZB 5AQMA 2QW9A 1VQ9N 4A5BA 1YIJN 4YOWA 3CERA 4H0OA 2P9IB 3Q7CA 3W3DA 1P90A 1HX1A 2P9NA 3I33A 3U8XA 4PL7A 1VQKN 1V4SA 2FXUA 3BEXA 2P9SA 2RHKA 2E88A 3DWLA 3B8AX 3CCLN 1ZXOA 1YVNA 3P39A 1X3MA 5KPRA 2P9LA 3MMVA 4NB4A 5AQHA 5BRHA 1LOTB 4FWQA 2F9TA 2QWPA 3L6QA 2YJEA 2ITMA 2BH1A 3MK6A 1NJIO 4FWRA 2A40A 3HRGA 4JD2B 5AZIA 1EO1A 4A5AA 1NM1A 2E2NA 2NZTA 3MX2A 5E26A 1P8ZA 4BRQA 2W40A 1YHQN 4WQ5A 5EX5A 4BRCA 4IOXA 2ASPA 1NGFA 4M7YA 3CD6N 1NGJA 5M1NA 3CPWM 4ISFA 4YOYA 3CI5A 1GLCG 2FSNA 4IWVA 3CC7N 2GEMA 4WF9L 4BRNA 1ILYA 1DT9A 5GIOA 2RE2A 4BQZA 4G9ZA 5DM7L 3FFKB 3FE1A 3O08A 3SAHA 1HKCA 2GWKA 2D4WA 3D2EB 3VF4A 3JS6A 3VERA 4GNIA 1V4TA 4JK8A 4U67L 1N8RO 1X3NA 1K8KA 3H1VX 4CZKA 3WXLA 2QWQA 3O9SA 4BREA 2OANA 5C15A 3NMUA 1MWMA 3KWGA 4CZFA 5H1SQ 5AQPA 1JCFA 1T6DA 2P9UB 3SLCA 3MN5A 1NLVA 4BGBA 2OTJN 3ZETB 2E1YA 3AARA 3DJCA 4ILJA 4XH1A 4EFHA 1RFQA 5JMVA 3E9LA 5I9EB 2NRXA 4BC4A 2Q97A 3CPEA 2YX6A 5AQGA 4AM7A 1KAYA 4JK7A 4B1WB 4H0PA 3MDQA 1U6ZA 2IVNA 1DGKN 2I7NA 1DEJA 3ENHA 3ZEUA 1NBWA 5FPEA 5B8HA 4Z94A 1K8AO 3TTDA 3ID6A 3J8AA 4BR2A 3GG4A 4C1NK 3H3NO 4H03B 4YDUA 3WUHA 1EQYA 1ZC6A 3L0QA 2Q31A 4BRMA 3D2FB 2WC9A 1QQMA 1Y64A 1K73O 4WQ4A 5AQIA 3D6RA 5E84A 4FOEA 4H5WA 5AQUA 5AQOA 5BPLA 4XEIA 1HUXA 5M1KA 4BC2A 5F1XA 5JLHA 5FPMA 3H3OB 5AZJA 5GAHP 3WEEB 3VPZA 4OPHA 1OVYA 3ENBA 4JKDA 2HOEA 3O9QA 4B1UB 4B1ZA 4FWNA 1WOQA 3WT0A 3CCRN 3GDQA 4A61A 3QDKA 4XH5A 4WFAL 2JWLA 5AQXA 3QB0A 3TSPA 5JLFA 3A5LC 5JVHL 3U4LA 3H46O 4ISGA 4BRDA 4H0VB 3VTHA 4O8UA 1JJ2M 2VGMA 4IEEA 5AQKA 3IKMA 4JD2A 5AZIB 3VTIA 4AM6A 4CJ7A 5ADXH 2Q1NA 3R1XA 3LDQA 3DXMA 3G71N 3VEVA 2QM1A 1YJNN 4MDAA 2A41A 5C10A 1HKBA 2CGJA 4BRGA 3G6EN 2W41A 4JAXA 4IOCL 3LM9A 2PFUA 3MX5A 3K9KA 1T3VA 4GVEA 4DHYA 3CCSN 1BOTO 2OTLN 3C7NA 1RGIA 3SMPA 4BQLA 4O5FA 2HBLA 4QS7A 4GV6A 3LDNA 3CETA 3MN6A 1QZ6A 2P9PB 2QXLA 2WBNA 3DXKB 1K9MO 3LM2A 3HOTA 2E2OA 3O1BA 4IFEA 4BC5A 3VEOA 1S3XA 2GUPA 4CZEA 3H6EA 5AQYA 3F5TA 2CGLA 3PLAA 1HPMA 5C2FA 4NO7A 3Q7BA 2NRZA 2J4RA 5KPTA 1VQ6N 3WXIA 2QI2A 5EOYA 1SQKA 4PKIA 5AR0A 5AQQA 2GWJA 4K42A 4JKEA 2H3GX 4IOAL 1D4XA 4E1JA 3E9PA 1KXPA 3IFRA 3KWIA 1U2VB 1XC3A 4CZMA 2QWRA 1XUPO 3VEYA 3CQXA 4H5VA 1HJOA 3PIPL 3CCQN 3VF6A 1YITN 3E66A 1DKGD 1T6CA 2P9KA 5AQVA 4YOVA 3CJAA 5HOOA 3U9ZA 2HBMA 1GLDG 2HMPA 2AA4A 4EHUA 2Q36A 1QVGM 4BRPA 1BUPA 3QFPA 1YXQA 5M1OA 3WXKA 4K43A 4J8FA 1YI2N 4BRHA 4FSVA 2FSJA 3SAGA 2HSTA 3MCAB 5AQZA 2V51B 1Q86O 1VQNN 3MCPA 2KKZA 4YOTA 1HLUA 2V7ZA 4FWOA 4FWMA 3EN9A 2QEXN 3EKSA 4I6MA 5C12A 4YDUC 5CR4A 3CCVN 4LC9B 3EZWA 5FPNA 1KD1O 1U2VA 5JICA 4IO9L 3C6HA 1MDUB 1VQON 4ILHA 1X9JA 3C7NB 4B9QA 3S41A 3FLCO 5M1PA 3BF1A 4CD3A 3O8MA 4BRIA 2Q0RA 4PHTX 2ASMA 4CI6A 3C6AA 4H0TB 2VYPA 4NLCA 4B1XB 4EAHD 1KC8O 3SBGA 3FGUA 3CJ1A 3EE8A 3CXCM 5BN8A 1YAGA 2ZJRL 3ZEUB 3AY9A 3VGMA 3LDLA 3QBXA 4FOIA 1Z05A 4JNEA 3C65A 3EE9A 4HWIA 2FF6A 4CZHA 5EXWA 1GLAG 3MN7A 4FVUA 3TU5A 2V52B 3OHRA 1RDUA 3IMXA 4IEIA 3ULEB 1NGAA 1C0FA 1HKGA 1BO5O 2D0PA 3D2FA 3R6MA 2ZF5O 2CH5A 3QICA 4H5NA 3R9PA 2V7YA 1BU6O 4MDBA 3ZX0A 1J6ZA 3J7ZO 1KQSM 4BY9C 4YOUA 4I6MB 5LJWA 3D2EA 5DM6L 5AFUA 4A2AA 2E20A 2E2QA 1S72N 4GV9A 1K8KB 4WCEL 3AGKA 3ATVA 4FPAA 4BG8A 1GLFO 1MA9B 3CCJN 3GBTA 2NRHA 1SZ2A 3P31A 5AQRA 1IG8A 4ILGB 4KBOA 3N4PA 4BR0A 1MWKA 3LDOA 4CZLA 3IUCA 3RSEB 3MWPA 3SK3A 2A5XA 1NGBA 4BR5A 1YJWN 4MO4A 2NNWA 3VETA 2E2PA 1NMDA 2QA4N 4BR7A 3NVKA 1NWKA 5AQFA 4A2BA 4IO8A 2GTDA 3TPQA 5KPZA 3I55N 1TYQB 2UYTA 3O9TA 1W2BM 4GV3A 2DPNA 3CC4N 3CJBA 4RWTA 3TTFA 2QWOA 2NRTA 3H1QA 3ZX2A 2YJFA 2ZGYA 3K9JA 4PL8A 5F2RA 4IXCA 3R8EA 4A62A 2VWBA 5TKYA 5CE3A 3LDPA 1NGHA 3HM8A 4WFBL 1M90O 5BRDA 3CCMN 2P9LB 2GELA 3E1YA 5CHIA 1Q81O 1OKJA 3FZMA 4RTFD 4BRAA 1W97L 2YHXA 2FLOA 2QWLA 3ENOA 3VOVA 3G4SN 5KQDA 2ZGZA 2P9NB 4A59A 4FO0A 4IDHA 3ATUA 4RCHA 1ZBSA 4JHDB 1LCUA 3AAPA 4FWPA 2VGNA 4MO5A 3CMAN 1QQNA 5ADXA 2NLXA 3UKUA 3FZFA 3HTVA 4XH4A 3W0LA 2ZWHA 4BR4A 2IVOA 5AQWA 1NGDA 4KH6A 2GX9A 1VQ8N 4DB3A 1BDGA 3SBTA 3UE5A 4ISEA 1BG3A 3R3LA 4BVOA 5AQSA 5MLCQ 3CCUN 4BRKA 3A5MC 1TUUA 2A6AA 5AFUH 4O8KA 3DLLL 3M6GA 4GY2B 1QHAA 4DKWA 5C2DA 2AP1A 3P38A 2NRVA 2BTFA 4JKFA 5BR9A 5LJVA 4R79A 2F7TA 3SMSA 4FWLA 4YORA 3WXJA 1BWFO 5C0YA 3I8BA 4WYBA 2YHYA 5TKWA 3DXKA 3VGKA 4Y0WA 4OO1J 2QWMA 2A3ZA 3BP8A 2CGKA 3TSUA 3CJ9A 4B1YB 3L4QA 3GOIA 4U7BA 1TYQA 2YI1A 3HI0A 4JKCA 3F9MA 4K25A 5KQ8A 1VQ4N 4AF1A 2VCPA 3D7EO 4H5TA 1E4GT 4PKGA 1E4FT 4FWKA 4UY8O 1ATRA 4JKHA 4M7XA 1VAZA 2IIRA 2YHWA 1KAXA 2NRWA 3KHYA 3TSQA 1VQMN 1CZAN 3NVMA 3EO3A 2CH6A 3H45C 1BA1A 3T7ZA 2E8AA 4YOXA 1H1VA 1NGGA 3ID8A 3ZETA 1YF5L 1IJJA 2HBJA 4JKGA 2NRRA 4K41A 3U9DA 5EVZA 4DQ8A 4EHTA 1SAZA 3AAQA 4CBWA 5BREA 2PBDA 1JCEA 2HF4A 3F2KA 4FL9A 4BR9A 4IJAA 4IZ9A 5EY4A 3A8YA 1O13A 4HTLA 5AQJA 1S22A 3HSCA 4C1NI 4CZIA 3O9RA 1QVFM 4KH5A 3CJCA 1JCGA 4BGAA 3CCEN 2ASOA 4CBXA 3ULEA 3O9UA 3VMFB 3QBWA 3VENA 4BROA 4H0XB 2P9KB 4JKBA 5AZJB 3A5NC 4JKGB 5GINA 5GIPA 4MLHA 5BRFA 3WXMB 1YJ9N 2WFBA 3CC2N 2BUPA 3VESA 1Q7YO 2Q2RA 3O80A 5M1FA 3O5BA 4PKHA 3HBTA 4JEPA 3CQYA 1Q82O 3KK7A 4FWSA 3ZX3A 3QMLA 3MN9A 3WQTA 1QZ5A 3M5RA 5BPMA 3CJ7A 1C0GA 3WEEA 3RSEA 3VF2A 4BC3A 2JWKA 3EL2A 2A42A 3HZ6A 3QFUA 5F0XA 5GADP 3M3ZA 1NGCA 5M1QA 3VEXA 2QTDA 5JVGL 4CD1A 4QS8A 4MLEA 1VQLN 3UKRA 4QS9A 3VGLA 2HBKA 4BRFA 1WUAA 3OBYA 3VEZA 3T69A 3CF5L 1YUWA 2P9UA 4WQ5C 5GAEP 3L4IA 3CIPA 3KZBA 2EWSA 1ATNA 1TUYA 3AGRA 3G25A 1VQPN 1ATSA 4L3QA 4JK9A 2P9IA 4EIAA 4BRLA 5AQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R59 O;  2I7P A;  2WUS A;  3FZH A;  1XQS C;  3LL3 A;  4CBU A;  3WQU A;  1Z6R A;  1NGE A;  2PAV A;  5FPD A;  4JHD A;  3DXM B;  5AQL A;  4BG9 A;  2Q0U A;  2HF3 A;  3UKU B;  4C23 A;  3IDH A;  1GLL O;  3FR0 A;  5AQT A;  3GE1 A;  4H0Y B;  3C0B A;  5LY3 A;  3UB5 A;  3FZL A;  3CHW A;  4JN4 A;  2F9W A;  4BVP A;  3JXU A;  3UKR B;  1T44 A;  4DCH A;  2KHO A;  3GL1 A;  3O6W A;  4IJN A;  1GLJ O;  2P9P A;  3O4W A;  3DAW A;  4CZG A;  4M63 C;  2QWN A;  5BPN A;  4WQ4 C;  1NGI A;  4FPB A;  2E1Z A;  3BF3 A;  5AQP A;  2FF3 B;  2D1K A;  2D0O A;  1BA0 A;  3P4I A;  3VEW A;  1QQO A;  2P9S B;  1Q18 A;  1GLB G;  1G99 A;  1GLE G;  3O1W A;  5ELZ A;  4F9O A;  1RDW X;  3A0I X;  4H5R A;  1KAZ A;  2YCH A;  1ESV A;  2IVP A;  4B1V A;  2FSK A;  3FZK A;  3M1F A;  3SJH A;  4CZJ A;  3KVG A;  3A5O C;  5BN9 A;  3EKU A;  3BUZ B;  5AQM A;  2QW9 A;  3CER A;  4H0O A;  2P9I B;  3W3D A;  1HX1 A;  2P9N A;  3I33 A;  3U8X A;  4PL7 A;  1V4S A;  2FXU A;  3BEX A;  2P9S A;  3B8A X;  2E88 A;  3DWL A;  1ZXO A;  1YVN A;  1X3M A;  5KPR A;  2P9L A;  3MMV A;  4NB4 A;  5AQH A;  5BRH A;  1LOT B;  4FWQ A;  2F9T A;  2QWP A;  3L6Q A;  2YJE A;  2ITM A;  3MK6 A;  4FWR A;  2A40 A;  4JD2 B;  5AZI A;  1NM1 A;  2E2N A;  2NZT A;  4BRQ A;  5E26 A;  1P8Z A;  2W40 A;  4WQ5 A;  5EX5 A;  4BRC A;  2ASP A;  1NGF A;  4M7Y A;  1NGJ A;  4ISF A;  3CI5 A;  1GLC G;  2FSN A;  4IWV A;  2GEM A;  4BRN A;  4BQZ A;  3FFK B;  3FE1 A;  3O08 A;  1HKC A;  2GWK A;  2D4W A;  3D2E B;  3VF4 A;  3JS6 A;  3VER A;  4GNI A;  1V4T A;  1X3N A;  1K8K A;  3H1V X;  4CZK A;  3WXL A;  2QWQ A;  4BRE A;  2OAN A;  1MWM A;  4CZF A;  1JCF A;  1T6D A;  2P9U B;  3SLC A;  3MN5 A;  1NLV A;  4BGB A;  3ZET B;  2E1Y A;  3AAR A;  3DJC A;  4XH1 A;  4EFH A;  1RFQ A;  5JMV A;  5I9E B;  4BC4 A;  2Q97 A;  5AQG A;  4AM7 A;  1KAY A;  4B1W B;  4H0P A;  3MDQ A;  1U6Z A;  2IVN A;  1DGK N;  2I7N A;  1DEJ A;  3ENH A;  3ZEU A;  1NBW A;  5FPE A;  5B8H A;  4Z94 A;  3J8A A;  4BR2 A;  3GG4 A;  3H3N O;  4H03 B;  4YDU A;  3WUH A;  1EQY A;  1ZC6 A;  3L0Q A;  2Q31 A;  4BRM A;  3D2F B;  1QQM A;  1Y64 A;  4WQ4 A;  5AQI A;  5E84 A;  4FOE A;  4H5W A;  5AQU A;  5AQO A;  5BPL A;  4XEI A;  1HUX A;  4BC2 A;  5F1X A;  5JLH A;  5FPM A;  3H3O B;  5AZJ A;  3WEE B;  3VPZ A;  2HOE A;  4B1U B;  4B1Z A;  4FWN A;  1WOQ A;  3WT0 A;  3GDQ A;  4A61 A;  3QDK A;  4XH5 A;  5AQX A;  3QB0 A;  5JLF A;  3A5L C;  3U4L A;  3H46 O;  4ISG A;  4BRD A;  4H0V B;  5AQK A;  4AM6 A;  4JD2 A;  5AZI B;  4CJ7 A;  5ADX H;  2Q1N A;  3LDQ A;  3DXM A;  3VEV A;  2QM1 A;  2A41 A;  1HKB A;  2CGJ A;  4BRG A;  2W41 A;  4JAX A;  3LM9 A;  4DHY A;  1BOT O;  3C7N A;  1RGI A;  3SMP A;  4BQL A;  4O5F A;  4QS7 A;  3LDN A;  3CET A;  3MN6 A;  1QZ6 A;  2P9P B;  2QXL A;  3DXK B;  3LM2 A;  2E2O A;  3O1B A;  4BC5 A;  3VEO A;  1S3X A;  2GUP A;  4CZE A;  3H6E A;  5AQY A;  2CGL A;  1HPM A;  4NO7 A;  5KPT A;  2J4R A;  3WXI A;  5EOY A;  1SQK A;  4PKI A;  5AR0 A;  5AQQ A;  2GWJ A;  4K42 A;  2H3G X;  1D4X A;  4E1J A;  3IFR A;  1KXP A;  4CZM A;  1U2V B;  1XC3 A;  2QWR A;  1XUP O;  3VEY A;  3CQX A;  4H5V A;  1HJO A;  3VF6 A;  1DKG D;  1T6C A;  2P9K A;  5AQV A;  3CJA A;  3U9Z A;  4EHU A;  1GLD G;  2HMP A;  2AA4 A;  2Q36 A;  4BRP A;  1BUP A;  3QFP A;  1YXQ A;  3WXK A;  4K43 A;  4J8F A;  4BRH A;  4FSV A;  2FSJ A;  5AQZ A;  2V51 B;  3MCP A;  1HLU A;  2V7Z A;  4FWO A;  4FWM A;  3EN9 A;  3EKS A;  4I6M A;  4YDU C;  4LC9 B;  3EZW A;  5FPN A;  1U2V A;  5JIC A;  1MDU B;  1X9J A;  3C7N B;  4B9Q A;  3S41 A;  3FLC O;  3BF1 A;  4CD3 A;  3O8M A;  4BRI A;  2Q0R A;  2ASM A;  4CI6 A;  4H0T B;  2VYP A;  4B1X B;  4EAH D;  3FGU A;  3CJ1 A;  5BN8 A;  1YAG A;  3ZEU B;  3AY9 A;  3VGM A;  3LDL A;  3QBX A;  4FOI A;  1Z05 A;  4JNE A;  4HWI A;  2FF6 A;  4CZH A;  5EXW A;  1GLA G;  3MN7 A;  3TU5 A;  2V52 B;  3OHR A;  3IMX A;  3ULE B;  1NGA A;  1C0F A;  1HKG A;  1BO5 O;  2D0P A;  3D2F A;  3R6M A;  2ZF5 O;  2CH5 A;  3QIC A;  4H5N A;  3R9P A;  2V7Y A;  1BU6 O;  3ZX0 A;  1J6Z A;  5LJW A;  4I6M B;  3D2E A;  5AFU A;  4A2A A;  2E20 A;  2E2Q A;  1K8K B;  3ATV A;  4FPA A;  4BG8 A;  1GLF O;  1MA9 B;  3GBT A;  2NRH A;  1SZ2 A;  5AQR A;  1IG8 A;  4KBO A;  4BR0 A;  1MWK A;  3LDO A;  4CZL A;  3IUC A;  3RSE B;  3SK3 A;  2A5X A;  1NGB A;  4BR5 A;  4MO4 A;  3VET A;  2E2P A;  1NMD A;  4BR7 A;  1NWK A;  5AQF A;  4A2B A;  4IO8 A;  2GTD A;  3TPQ A;  5KPZ A;  1TYQ B;  2UYT A;  2DPN A;  3CJB A;  4RWT A;  2QWO A;  3ZX2 A;  3H1Q A;  2YJF A;  2ZGY A;  4PL8 A;  4A62 A;  5F2R A;  4IXC A;  3R8E A;  2VWB A;  5TKY A;  5CE3 A;  3LDP A;  1NGH A;  3HM8 A;  5BRD A;  2P9L B;  2GEL A;  1OKJ A;  3FZM A;  4RTF D;  4BRA A;  2YHX A;  2FLO A;  2QWL A;  3ENO A;  3VOV A;  5KQD A;  2ZGZ A;  2P9N B;  4FO0 A;  3ATU A;  4RCH A;  1ZBS A;  4JHD B;  1LCU A;  3AAP A;  4FWP A;  4MO5 A;  1QQN A;  5ADX A;  2NLX A;  3UKU A;  3FZF A;  3HTV A;  4XH4 A;  3W0L A;  2ZWH A;  4BR4 A;  2IVO A;  5AQW A;  1NGD A;  4DB3 A;  1BDG A;  3UE5 A;  4ISE A;  1BG3 A;  4BVO A;  5AQS A;  4BRK A;  3A5M C;  1TUU A;  2A6A A;  5AFU H;  4O8K A;  3M6G A;  4GY2 B;  1QHA A;  2AP1 A;  5BR9 A;  2BTF A;  5LJV A;  3SMS A;  4FWL A;  3WXJ A;  1BWF O;  3I8B A;  4WYB A;  2YHY A;  3VGK A;  3DXK A;  4Y0W A;  2QWM A;  2A3Z A;  3BP8 A;  2CGK A;  4B1Y B;  3CJ9 A;  3GOI A;  1TYQ A;  2YI1 A;  3HI0 A;  3F9M A;  4K25 A;  5KQ8 A;  2VCP A;  3D7E O;  4H5T A;  1E4G T;  4PKG A;  1E4F T;  4FWK A;  1ATR A;  4M7X A;  2IIR A;  2YHW A;  1KAX A;  3KHY A;  1CZA N;  3EO3 A;  2CH6 A;  3H45 C;  1BA1 A;  2E8A A;  1H1V A;  1NGG A;  3ID8 A;  3ZET A;  3U9D A;  1IJJ A;  4K41 A;  4DQ8 A;  5EVZ A;  4EHT A;  1SAZ A;  3AAQ A;  4CBW A;  5BRE A;  2PBD A;  1JCE A;  2HF4 A;  4FL9 A;  4BR9 A;  4IJA A;  4IZ9 A;  5EY4 A;  3A8Y A;  4HTL A;  5AQJ A;  4CZI A;  1S22 A;  3HSC A;  3CJC A;  1JCG A;  4BGA A;  2ASO A;  4CBX A;  3ULE A;  3QBW A;  3VEN A;  4BRO A;  4H0X B;  2P9K B;  5AZJ B;  3A5N C;  4MLH A;  5BRF A;  2BUP A;  3VES A;  2Q2R A;  3O80 A;  3O5B A;  4PKH A;  3HBT A;  3CQY A;  4FWS A;  3ZX3 A;  3QML A;  3MN9 A;  3WQT A;  1QZ5 A;  5BPM A;  3CJ7 A;  1C0G A;  3WEE A;  3RSE A;  3VF2 A;  4BC3 A;  3EL2 A;  3HZ6 A;  2A42 A;  3QFU A;  5F0X A;  3M3Z A;  1NGC A;  3VEX A;  4CD1 A;  4QS8 A;  4MLE A;  3UKR A;  4QS9 A;  3VGL A;  4BRF A;  1WUA A;  3VEZ A;  1YUW A;  2P9U A;  4WQ5 C;  3L4I A;  3CIP A;  3KZB A;  2EWS A;  1ATN A;  1TUY A;  3G25 A;  1ATS A;  4L3Q A;  2P9I A;  4EIA A;  4BRL A;  5AQN A; 
#chains in the Genus database with same CATH topology
 1R59 O;  2I7P A;  4CBU A;  1XQS C;  3I56 N;  5FRM A;  1W7A A;  3B6O A;  1RBT A;  2ZJQ L;  2UXC K;  2PAV A;  4CJL A;  1YVU A;  4BG9 A;  4DSJ A;  1LAW A;  1GLL O;  3FR0 A;  1GOA A;  2FBY A;  3TTC A;  3UB5 A;  1KSP A;  3QEV A;  1IG9 A;  4JN4 A;  4BVP A;  3KD5 E;  3G0Z A;  3GL1 A;  4KTW A;  2IOC A;  4CZG A;  2QWN A;  3MWT A;  3OA9 A;  4JKA A;  3E9O A;  1BA0 A;  1L3T A;  2G8W A;  1QQO A;  1GLB G;  1KLM A;  5ELZ A;  4OKE A;  1RDW X;  4C8O A;  4DSK A;  4JS5 A;  4N56 A;  3RVC A;  3CME N;  3FZK A;  1RIL A;  1Q8I A;  2QW9 A;  1VQ9 N;  4FLZ A;  4N41 A;  2P9I B;  1P90 A;  1HX1 A;  4PL7 A;  3U8X A;  4V19 S;  1VQK N;  2FXU A;  2E88 A;  3CCL N;  1ZXO A;  3K0S A;  3MMV A;  3AVB A;  3CFO A;  3L3V A;  2F9T A;  3OS1 A;  2ITM A;  2Z1H A;  4FWR A;  4JD2 B;  5CZ2 A;  2DFH A;  5AZI A;  4Q5V A;  1P8Z A;  1WSH A;  4CJU A;  2XRI A;  3VQ5 A;  1ITG A;  3VQ9 A;  3CPW M;  3ZT0 A;  2FSN A;  3MXJ A;  3U3G A;  1L5U A;  4BDZ A;  4WF9 L;  4HCB A;  2RE2 A;  4G9Z A;  3K5L A;  3O08 A;  3O3H A;  1JLF A;  3QEP A;  3VF4 A;  3JS6 A;  3RR7 A;  2QWQ A;  3B6P A;  1MWM A;  1JKH A;  5HRR A;  3T1A A;  3THX A;  1VRT A;  4ELV A;  2YV0 X;  4FZX C;  3C95 A;  1NLV A;  1KRP A;  1Q9Y A;  3LAM A;  1HMV A;  1RFQ A;  4NCA A;  5I9E B;  3OTO K;  2Q97 A;  3CPE A;  4JI7 K;  4JK7 A;  5C42 A;  1NKC A;  4B1W B;  3MDQ A;  1X9W A;  1Z25 A;  1DGK N;  1DEJ A;  4EP4 A;  3LP3 A;  4HUE A;  5FPE A;  4CVN E;  5B8H A;  4ICL A;  4Z94 A;  1SKW A;  3J8A A;  2ZQB A;  5J2P A;  3G10 A;  2KZM A;  3TAF A;  3L0Q A;  4BRM A;  2WC9 A;  3ZSQ A;  1HYZ A;  1Y64 A;  1T05 A;  1RNH A;  1K73 O;  4FCY A;  3D6R A;  2HHX A;  2E6L A;  5BPL A;  2W6L A;  1HUX A;  4DTP A;  4AHS A;  4AQY K;  4W5Q A;  1HNW K;  5FPM A;  5GAH P;  5AZJ A;  4FK4 A;  3OYN A;  3VPZ A;  2HOE A;  1C0M A;  1U04 A;  3OYG A;  1NNE A;  3RMC A;  4LFC K;  3QLH A;  4DUY K;  3AV9 A;  4M3W A;  4IG0 A;  4JD2 A;  5AZI B;  4CJ7 A;  4YNQ A;  2VG6 A;  3VEV A;  2A41 A;  5C10 A;  2HVH A;  4BRG A;  3C94 A;  4JAX A;  3LM9 A;  3CCS N;  1BOT O;  3DRP A;  2OTL N;  1RGI A;  3SMP A;  4O5F A;  4F2S A;  1D9D A;  2P5O A;  3CET A;  2QXL A;  3TI0 A;  3DXK B;  2O8F B;  2IAJ A;  3OS0 A;  4IFE A;  3WNF A;  4FJL A;  4LF7 K;  2YNF A;  3TWH A;  2BAN A;  2GUP A;  5AQY A;  3F5T A;  2OPP A;  4QCL A;  1HPM A;  5KPT A;  3Q7B A;  4PWD A;  3WXI A;  2KFZ A;  1HPZ A;  2OZS A;  4N76 A;  4CF2 A;  1WLJ A;  1S6P A;  5EU7 A;  4CEF A;  3SV4 A;  4IOA L;  3IFR A;  1KXP A;  4CZM A;  3KWI A;  1U2V B;  3PUF A;  3VEY A;  4FYD A;  1HJO A;  3PIP L;  4LY7 A;  3MXM A;  2EHG A;  1T6C A;  4DV6 K;  3LZI A;  4FW1 A;  3U9Z A;  4EHU A;  1GLD G;  2OA8 A;  2Q36 A;  5M1O A;  3WXK A;  3SUN A;  1ZYQ A;  4BRH A;  2FSJ A;  2HST A;  3MCA B;  3HVR A;  3LPU A;  1HLU A;  4FWM A;  3O4Q A;  3EKS A;  3QNN A;  5CR4 A;  3KK3 A;  3EZW A;  3KK1 A;  5CY4 A;  4IO9 L;  3C6H A;  1VQO N;  1X9J A;  3C7N B;  1LAV A;  4AHU A;  3FLC O;  4DFP A;  4PHT X;  4CI6 A;  1VSH A;  4FXD A;  1O1W A;  1KC8 O;  4OVL A;  4O4G A;  3SBG A;  3FGU A;  2RN2 A;  3EE8 A;  1IKW A;  2YNI A;  4W5T A;  3MXI A;  4K8Z A;  1HNV A;  3LDL A;  5AJ3 K;  4JNE A;  4HWI A;  3CG7 A;  1NJX A;  2V52 B;  4B9S A;  1C0F A;  3AVH A;  4DR4 K;  1SL0 A;  2FBT A;  1BU6 O;  4CHY A;  4MDB A;  3V9S A;  1J6Z A;  4YOU A;  4NYN A;  1XC9 A;  4A2A A;  4GV9 A;  1S72 N;  4WCE L;  3ATV A;  1GLF O;  2WOM A;  2O8B B;  3JAM O;  4FW2 A;  5AQR A;  2YKM A;  5C25 A;  3IUC A;  4DTX A;  1YJW N;  3OY9 A;  4MO4 A;  1UWB A;  2YNH A;  1U47 A;  3AVJ A;  3OYF A;  2E2P A;  3HPG A;  4BR7 A;  1C6V A;  4NCG A;  3TPQ A;  3P83 D;  5KPZ A;  2O8D B;  1W2B M;  1B9F A;  4RWT A;  4Y1D A;  2ZE2 A;  5TKY A;  4AHT A;  1M90 O;  3QEI A;  3E1Y A;  1OKJ A;  1W97 L;  3DI6 A;  2QWL A;  3NCI A;  4CHO A;  4DS4 A;  1XNR K;  4B3M K;  4I7F A;  4A59 A;  4FO0 A;  4M3R A;  4RCH A;  3DRR A;  3LP1 A;  1VSL A;  1T8E A;  1NMN A;  4MO5 A;  1QQN A;  1C0T A;  3QIN A;  4FLW A;  1N5Y A;  5AQW A;  3BZK A;  4DTJ A;  4KH6 A;  3SBT A;  4DR3 K;  4ISE A;  3R3L A;  5MLC Q;  4E3S A;  1TV6 A;  5KGW A;  3ZLJ A;  3P5J A;  3DLL L;  4GY2 B;  1QHA A;  2AP1 A;  2NRV A;  4GW6 A;  5LJV A;  1S1U A;  5C0Y A;  2OPR A;  3BP8 A;  4NCB A;  1W0H A;  4G1Q A;  2YHB A;  3TAG A;  3I8D A;  3V6D A;  1SL1 A;  3NH2 A;  3HP6 A;  1A5W A;  4FWK A;  4ELT A;  4UY8 O;  1ATR A;  2VQF K;  2NRW A;  3KJV A;  3NVM A;  4FJX A;  3ID8 A;  3ZET A;  2HBJ A;  3BY5 A;  4JS4 A;  1HNX K;  4K41 A;  5EVZ A;  4CBW A;  1N6Q A;  3SQ0 A;  4IZ9 A;  5EY4 A;  1FW6 A;  3BDP A;  1O13 A;  4CZI A;  4JV5 K;  2ZD1 A;  1K6Y A;  4CHN A;  3CCE N;  3SPZ A;  1XI1 A;  2O8D A;  3S3O A;  1BIS A;  4X66 K;  2IGI A;  1T03 A;  3CQ8 A;  3V1O A;  5BRF A;  3WXM B;  1YJ9 N;  3VQD A;  3O80 A;  4PKH A;  3AA5 X;  3I0R A;  1N36 K;  4DU3 A;  4JI1 K;  3RTV A;  5HRO A;  5F0X A;  5GAD P;  2E5L K;  1I3A A;  1NGC A;  3VEX A;  4CD1 A;  3AVM A;  4QS8 A;  2WON A;  4QS9 A;  1LWE A;  3OBY A;  3CF5 L;  4DTO A;  5GAE P;  4OKJ A;  4DR6 K;  5J2N A;  3CIP A;  3T1Y K;  3AVA A;  3DLH A;  1TUY A;  3G25 A;  1ATS A;  4CFC A;  4GVM A;  5AQN A;  2WUS A;  1JLC A;  3LL3 A;  5GAG P;  4X65 K;  1RDA A;  1J9A A;  1Z6R A;  4J2D A;  1NGE A;  3TAN A;  5FPD A;  4JHD A;  1BHL A;  5AQL A;  4K8X A;  1RBU A;  3VA3 A;  4F3T A;  4C8L A;  3FFI A;  1S1W A;  3C0B A;  3FZL A;  3CHW A;  4FJH A;  1X9S A;  1YT3 A;  5FRN A;  3LAN A;  3JXU A;  3LAL A;  3UKR B;  1T44 A;  2KHO A;  4DQP A;  4LF5 K;  2ETJ A;  4OPA A;  4M63 C;  2HNY A;  5AQP A;  4FPB A;  3BF3 A;  3OJS A;  2FF3 B;  4I2P A;  1VQ5 N;  2VG5 A;  3ZYY X;  1S9E A;  5HL7 L;  1TKD A;  3OYJ A;  4H4O A;  1Q18 A;  1SS6 A;  1TL1 A;  4F9O A;  3HOS A;  4H5R A;  1KAZ A;  2YCH A;  1ESV A;  4CF8 A;  1BI4 B;  4WFN L;  2HMI A;  4FJ8 A;  5BN9 A;  3EKU A;  3KKS A;  2F8S A;  4LSN A;  1YIJ N;  4YOW A;  3Q7C A;  3RMD A;  1JLB A;  1V4S A;  1X9M A;  3DWL A;  2P9S A;  3B8A X;  4E1N A;  1C1B A;  2BDP A;  4NB4 A;  4FZY A;  4FWQ A;  1WSE A;  2YJE A;  2WTU A;  2BH1 A;  4CFD A;  1NJI O;  1HYS A;  4CGF A;  4A5A A;  2NZT A;  4BRQ A;  2W40 A;  2G8U A;  4H8K A;  4LFB K;  4W5R A;  4DMN A;  2HHT A;  4IOX A;  2ASP A;  1JLA A;  1NGF A;  1BQM A;  3CD6 N;  3QER A;  3CI5 A;  2PZS A;  1KVB A;  3ZSX A;  2GEM A;  2F8T A;  4DF8 A;  4BAC A;  1YTA A;  2XY6 A;  1BIZ A;  3FE1 A;  3UIQ A;  3M8P A;  2GWK A;  1RT7 A;  3D2E B;  4U67 L;  4CFA A;  1N8R O;  3ZT4 A;  4CZK A;  3WXL A;  3ZT3 A;  4OPK A;  3VQQ A;  3MAQ A;  3TAR A;  3ASM A;  1T6D A;  2OTJ N;  3ZET B;  4CK2 A;  2OCE A;  4CGJ A;  4EFH A;  3JYT A;  5D3G A;  1LV5 A;  4FLU A;  1KAY A;  1ASV A;  2UUA K;  4H0P A;  4IFY A;  2IVN A;  1IV0 A;  3ENH A;  1CXU A;  2X78 A;  1TKT A;  1RTD A;  2G8V A;  5BR8 K;  4BDY A;  1XMO K;  2PY5 A;  1WSI A;  3QNO A;  3WUH A;  5CZ1 A;  4LF4 K;  3THW B;  4YHH K;  1VHX A;  2ATQ A;  5AQI A;  3PX4 A;  4DR7 K;  5KGX A;  4KHU A;  3L2V A;  4XEI A;  5M1K A;  3NF6 A;  4BC2 A;  5JLH A;  3H3O B;  4FM0 A;  3SUO A;  1BCO A;  5I3U A;  4OPH A;  2B5J A;  2Z1J A;  4JKD A;  3O9Q A;  1TL3 A;  1HR0 K;  3WT0 A;  3CCR N;  1N32 K;  3AO5 A;  3QDK A;  4XH5 A;  3QB0 A;  3H46 O;  4ISG A;  3OYK A;  1JJ2 M;  4CEO A;  4AM6 A;  4O55 A;  4MDA A;  1RTI A;  1VK0 A;  1WSJ A;  2CGJ A;  2G8H A;  3BGR A;  4IOC L;  4HCC A;  4BQL A;  4Z0U A;  4GV6 A;  4DS5 A;  4FM2 A;  3RR8 A;  2PYL A;  4B8A B;  2BGG A;  4Q0B A;  3LM2 A;  1SUQ A;  2Q3S A;  1EET A;  4BC5 A;  4AIL C;  1OH7 A;  4CZE A;  3H6E A;  4FJG A;  1XNQ K;  3F73 A;  4NO7 A;  2J4R A;  4CW7 B;  3PY8 A;  1CXQ A;  3HL8 A;  2QI2 A;  3HM9 A;  2HHQ A;  4PKI A;  5AR0 A;  4OGC A;  1JL1 A;  4K42 A;  4I2Q A;  2H3G X;  3NGY A;  1D4X A;  4GMJ B;  4LF9 K;  2QWR A;  3ZSY A;  4H5V A;  4OKK A;  3CCQ N;  1Y97 A;  1D5A A;  1RT3 A;  5AQV A;  5HOO A;  2HBM A;  2AA4 A;  4BRP A;  3QFP A;  2PYJ A;  4KFB A;  2V51 B;  4M3X A;  3EYZ A;  1VQN N;  2KKZ A;  3SUQ A;  4I6M A;  4YDU C;  3DLB A;  1HNI A;  3CCV N;  5FPN A;  4CJR A;  4LFA K;  3DLR A;  3THY B;  2W42 A;  4B9Q A;  1JLG A;  3SPY A;  4E0D A;  3VQE A;  3C6A A;  2JGU A;  4NLC A;  4EZ6 A;  1GOB A;  3CJ1 A;  3CXC M;  5BN8 A;  1YAG A;  4CF9 A;  2ZJR L;  3K59 A;  4DQQ A;  1IKY A;  3C65 A;  3PX0 A;  1WBB A;  4XIU A;  2FF6 A;  5EXW A;  1GLA G;  4O44 A;  4C8N A;  1NG9 A;  4IEI A;  3ULE B;  1IKX A;  1HKG A;  2D0P A;  1BO5 O;  3D2F A;  4FJ5 A;  5E41 A;  2V7Y A;  3IRX A;  1FXX A;  3D2E A;  5DM6 L;  2E20 A;  2BE2 A;  3AGK A;  4AHC A;  2XY8 A;  4E7L A;  3P31 A;  3N4P A;  4BE1 A;  3MWP A;  3SK3 A;  2A5X A;  4BR5 A;  1JLE A;  4DSI A;  3QEW A;  1NWK A;  3RMB A;  3MEG A;  4PY5 A;  1TYQ B;  3HVT A;  1NK4 A;  4IBN A;  3ZSR A;  1TGO A;  3CJB A;  2QWO A;  1ZBF A;  4A62 A;  5HLF A;  3R8E A;  4F3O A;  1NGH A;  1IO2 A;  2GEL A;  5CHI A;  3FZM A;  1L3S A;  3LP2 A;  3ENO A;  3VOV A;  4QOZ B;  2P9N B;  3NHG A;  4Z4G A;  3O3G A;  1ZBS A;  2VGN A;  4LF8 K;  5ADX A;  3FZF A;  3HTV A;  4XH4 A;  3IG1 A;  1TKZ A;  1NGD A;  2GX9 A;  4DB3 A;  2DFF A;  1BDG A;  4CHZ A;  4KHP K;  1KFS A;  3CCU N;  5KRS A;  4IFV A;  1GOC A;  2KFN A;  4O8K A;  3M6G A;  2VWK A;  5CYM A;  4Z4C A;  4O0I A;  4R79 A;  5LL6 Z;  3SMS A;  3K5M A;  3WXJ A;  4WYB A;  4LSL A;  2YHY A;  4KRF A;  4Y0W A;  4OO1 J;  2RPI A;  3AVG A;  3MEE A;  1RT4 A;  3S3M A;  4JI2 K;  3NH1 A;  4RW9 A;  1A5X A;  1VQ4 N;  1KVA A;  2VCP A;  1E4G T;  4NYF A;  1J5E K;  4PKG A;  4E89 A;  1T7P A;  4JKH A;  4QAG A;  4FLX A;  3SJJ A;  1LWF A;  4KAZ A;  1BA1 A;  1E3M A;  2HHS A;  1VSE A;  1YF5 L;  1IJJ A;  4JKG A;  1U49 A;  4PUO A;  4CJT A;  3DOK A;  3VQA A;  2HF4 A;  1RBR A;  3F2K A;  4BR9 A;  4IJA A;  3AVL A;  3E01 A;  3VQ8 A;  3A8Y A;  4HTL A;  1S22 A;  4JLH A;  3AA2 A;  4DLG A;  3O9R A;  4HVJ A;  3O3F A;  1QVF M;  2Z1G A;  3JSM A;  4FJI A;  1JCG A;  4YY3 K;  4CBX A;  3ULE A;  1IBK K;  4B9N A;  3O4N A;  3QBW A;  3LZJ A;  2OPS A;  1BI4 A;  1FKO A;  3LWL A;  2I5J A;  1OVQ A;  4JKG B;  5GIP A;  4MLH A;  2BUP A;  5CYQ A;  1ASW A;  5JS1 A;  4CJW A;  4FJK A;  4FWS A;  3ZX3 A;  4CEA A;  2G8I A;  3MN9 A;  4JRP A;  1QZ5 A;  1C0G A;  3WEE A;  1VRU A;  4M45 A;  3DLE A;  3M3Z A;  2QTD A;  4MLE A;  1VQL N;  3UKR A;  4BRF A;  3PV8 A;  3VEZ A;  1YUW A;  4WQ5 C;  2O8E B;  4EZ9 A;  3ZSW A;  2X74 A;  1BCM A;  5K14 A;  1DLO A;  3TAM A;  3NF7 A;  4C8M A;  2AJQ A;  3RWU A;  4E19 A;  1ATN A;  3ITH A;  3DMJ A;  4HUF A;  3M8S A;  4L3Q A;  3QO9 A;  4I9Q A;  4IKF A;  4Z4H A;  1IBM K;  4BRL A;  4DTN A;  1NU0 A;  2G8K A;  3FZH A;  4ELU A;  1J5O A;  4JRQ A;  1ZBL A;  4K0K K;  2F4V K;  3RRG A;  2ZJP L;  4DFK A;  4CK1 A;  5HRS A;  2Q0U A;  3HK2 A;  4DR2 K;  1EX4 A;  3UKU B;  4C23 A;  4RW8 A;  4M42 A;  4H0Y B;  4CGH A;  4KO0 A;  4DSL A;  1NJZ A;  3BZC A;  4RW4 A;  3RRH A;  4DCH A;  3O6W A;  4IJN A;  2P9P A;  3OW2 M;  3OBW A;  3U3Y A;  2UUB K;  5BPN A;  2O8F A;  5DK5 A;  3PIO L;  1NGI A;  2KLA A;  5SZT A;  4F8R A;  3HP9 A;  4NLB A;  1ZBH A;  3VEW A;  2P9S B;  1HQE A;  3NBP A;  3OYM A;  1VQ7 N;  1BGX T;  1RBV A;  1GLE G;  4HUG A;  3VQ6 A;  4CIE A;  4B9U A;  4RW7 A;  4E7H A;  3SCX A;  3BUZ B;  1KTQ A;  3QET A;  5AQM A;  1VSD A;  2HB5 A;  4RG8 A;  4A5B A;  3CER A;  4CCH A;  3W3D A;  2VQE K;  2P9N A;  3TR8 A;  3I33 A;  4FK0 A;  4HTU A;  3I0S A;  2RHK A;  4AH9 A;  1BL3 A;  1YVN A;  3P39 A;  1WSG A;  1X3M A;  5KPR A;  1YTU A;  1LOT B;  4CF1 A;  1BQN A;  1WBD A;  4CEZ A;  1NOZ A;  3HRG A;  1WB9 A;  2O8C A;  1D9F A;  4FJJ A;  2E2N A;  3VQC A;  2X6S A;  4DQR A;  3KLE A;  4BRC A;  1WAJ A;  4M7Y A;  1NGJ A;  4N47 A;  5M1N A;  4ISF A;  1GLC G;  3CC7 N;  1N33 K;  4BWJ A;  1ILY A;  1DT9 A;  2O8B A;  1BIU A;  5DM7 L;  2KTQ A;  3SAH A;  4Z4F A;  1HKC A;  4OLA A;  2D4W A;  4CEE A;  1NJW A;  3DM2 A;  3VER A;  4GNI A;  1R0A A;  1S5J A;  2D0A A;  4DF4 A;  4BRE A;  2OAN A;  5C15 A;  3NMU A;  4KHS A;  4CZF A;  2KW4 A;  1DTQ A;  5H1S Q;  1QSY A;  1KLN A;  3V1R A;  4BGB A;  3AVF A;  3DJC A;  4ILJ A;  5JMV A;  3OYH A;  2NRX A;  2YX6 A;  4AM7 A;  1U6Z A;  2I7N A;  2EX3 A;  3ALY A;  4FJN A;  4CER A;  3PX6 A;  1K8A O;  4C8K A;  3ZSZ A;  4C1N K;  1I39 A;  3H3N O;  2RKI A;  1DTT A;  4H03 B;  1EQY A;  1ZC6 A;  4LD0 A;  4OX9 K;  1QQM A;  2KQ2 A;  3SUP A;  3HO1 A;  4FOE A;  5AQU A;  5FRO A;  2ITG A;  3LWM A;  4E7K A;  3WEE B;  1OVY A;  3ENB A;  4B1Z A;  4FWN A;  1WOQ A;  1A5V A;  4CE9 A;  3AO1 A;  3GDQ A;  4A61 A;  4E1M A;  4WFA L;  3TSP A;  5JVH L;  3A5L C;  3K2P A;  4BRD A;  3OYA A;  4MQ3 A;  4O8U A;  4IEE A;  5AQK A;  4CES A;  3IKM A;  3VTI A;  2Q1N A;  3R1X A;  3DXM A;  2QM1 A;  1YJN N;  2W41 A;  3PSF A;  3MX5 A;  2PFU A;  3K9K A;  3HJF A;  4GVE A;  3C7N A;  2HHH K;  2HBL A;  4QS7 A;  3LDN A;  4O0J A;  1RT2 A;  1K9M O;  3HOT A;  3O1B A;  4HHT A;  4DV2 K;  3VEO A;  3AVK A;  1S3X A;  5FDL A;  2NRZ A;  3HPO A;  2FC0 A;  5EOY A;  1SQK A;  1EWQ A;  2GWJ A;  4JKE A;  3T1H K;  1KVC A;  3E9P A;  4JYA K;  3M8Q A;  3CQX A;  4FVM A;  5C24 A;  1HRH A;  3ZT1 A;  3VF6 A;  3E66 A;  1DKG D;  2P9K A;  1QTM A;  4KB0 A;  4YOV A;  5IWA K;  1QVG M;  3C6T A;  1CZ9 A;  1BUP A;  2NUB A;  1YXQ A;  3V4I A;  4CJ4 A;  1YI2 N;  3SAG A;  5AQZ A;  3L2R A;  2IS3 A;  3MCP A;  4FWO A;  2V7Z A;  3DLG A;  3L2Q A;  4DTS A;  2G8F A;  1KD1 O;  5DMR A;  4DV0 K;  4ILH A;  3V9Z A;  4DV5 K;  3VN5 A;  3ZT2 A;  4M3T A;  5M1P A;  3BF1 A;  4CD3 A;  3O8M A;  4BRI A;  1QS4 A;  2Q0R A;  2ASM A;  4JI6 K;  4H0T B;  4KV8 A;  4B1X B;  3ZSV A;  3OS2 A;  4ID5 A;  4DUZ K;  3ZEU B;  3AY9 A;  3QBX A;  1S1T A;  3F9K A;  4FOI A;  1Z05 A;  3TAB A;  1JXE A;  4TSX A;  4CED A;  4B9T A;  3EE9 A;  1QSL A;  4CZH A;  4E7I A;  3TU5 A;  1TAU A;  4KRE A;  3IMX A;  3WNE A;  4B8C A;  2ZM6 K;  1S1X A;  3THX B;  3R6M A;  4DV7 K;  4ZTJ A;  2ZF5 O;  3QIC A;  4H5N A;  3R9P A;  1S1V A;  4DTR A;  1XHZ A;  4B9V A;  3ZX0 A;  3J7Z O;  4J2A A;  1FJG K;  4BY9 C;  5LJW A;  4I6M B;  4OJR A;  4Z4E A;  3KIO A;  2E2Q A;  1UAX A;  1K8K B;  3IAY A;  1MA9 B;  4CJ5 A;  3CCJ N;  3GBT A;  2NRH A;  1EKE A;  1SZ2 A;  3AA4 A;  4KBO A;  4B3S K;  1MWK A;  3LDO A;  4CZL A;  3RSE B;  2NNW A;  3VA0 A;  1NMD A;  3OYI A;  4B9L A;  4A2B A;  5AQF A;  4IO8 A;  2GTD A;  3ZCM A;  3I55 N;  4DLE A;  4JI8 K;  3TTF A;  3CFP A;  3ZX2 A;  2NRT A;  3H1Q A;  3L3U A;  4PL8 A;  5F2R A;  4IXC A;  4YFU A;  2VWB A;  3K5N A;  3TAP A;  2F96 A;  3HM8 A;  3CCM N;  2P9L B;  4ZTF A;  4CHQ A;  4RTF D;  4FK2 A;  2FLO A;  3G4S N;  5KQD A;  2ZGZ A;  4IDH A;  4CEQ A;  4JHD B;  3AAP A;  2NLX A;  3UKU A;  1WAF A;  2ZWH A;  4BR4 A;  2IVO A;  1HYV A;  1VQ8 N;  3UE5 A;  3AO4 A;  1BG3 A;  3P1G A;  5AQS A;  3V81 A;  1SL2 A;  4BRK A;  3A5M C;  1TUU A;  2A6A A;  5AFU H;  4FM1 A;  4W5O A;  4DWI A;  5C2D A;  3EEQ A;  5BR9 A;  4JKF A;  2BTF A;  4JI3 K;  1VSF A;  2F7T A;  1BWF O;  3D45 A;  4DV4 K;  3DXK A;  5J2Q A;  3K58 A;  5LMU K;  4M3U A;  2QWM A;  2A3Z A;  4UQG A;  4B3T K;  3TSU A;  4B1Y B;  5A2Q O;  4U7B A;  3HI0 A;  4JKC A;  4CJQ A;  1OH5 A;  4K25 A;  1NKE A;  4AF1 A;  4H5T A;  4BE0 A;  5JS2 A;  4M7X A;  1VQM N;  3TSQ A;  4B08 A;  3EO3 A;  3H45 C;  3T7Z A;  1XHX A;  4GKK K;  4YOX A;  3U9D A;  4PQU A;  3AO3 A;  1G15 A;  2NRR A;  4DQ8 A;  4L8R B;  4EHT A;  1SAZ A;  4FZZ A;  2QKK A;  3KKR A;  5AQJ A;  3HSC A;  4KH5 A;  3CJC A;  4KI4 A;  2JLE A;  4CJ3 A;  2YKN A;  3VMF B;  3VEN A;  4BRO A;  3VQB A;  3S3N A;  2GV9 A;  3KLF A;  5AZJ B;  3A5N C;  5GIN A;  4DU1 A;  2FBV A;  4Z4I A;  2Q2R A;  3RMA A;  5M1F A;  3QEX A;  2VWJ A;  3CQY A;  3KK7 A;  1WN7 A;  3QML A;  5BPM A;  4CIF A;  1VSM A;  4O5B A;  3RSE A;  1NK8 A;  3VF2 A;  3K57 A;  3HZ6 A;  3QFU A;  1NKB A;  2DY4 A;  3SV3 A;  3VGL A;  4J2E A;  3T69 A;  2P9U A;  1IBL K;  3THV A;  1SKR A;  1IKV A;  1NK9 A;  3L8B A;  5SWM A;  2RF2 A;  4EP5 A;  1L3V A;  2EWS A;  2KZZ A;  3AGR A;  1VQP N;  3KTQ A;  3NH0 A;  1VQ6 N;  3WQU A;  4KH4 A;  4KHW A;  3MEC A;  3SZ2 A;  4OLB A;  1EP4 A;  3LP0 A;  3DXM B;  3HXM A;  1RTH A;  3SAF A;  2HF3 A;  4F4K A;  4X62 K;  2P51 A;  3IDH A;  5AQT A;  3GE1 A;  5LY3 A;  2P5G A;  2F9W A;  4CJE A;  1NK7 A;  3V9W A;  1GLJ O;  3O4W A;  3DAW A;  1VSI A;  4WQ4 C;  2E1Z A;  3DRS A;  2D1K A;  2D0O A;  3HPH A;  2HHU A;  3P4I A;  4IDK A;  3N4Q A;  4W5N A;  3OYC A;  1M1K O;  1G99 A;  3SQ1 A;  3O1W A;  5KTQ A;  4B9M A;  3A0I X;  2IVP A;  4DFJ A;  4B1V A;  2FSK A;  4A57 A;  3J7A P;  3M1F A;  3SJH A;  4CZJ A;  3KVG A;  3A5O C;  1W9H A;  2HND A;  2Z1I A;  3PO5 A;  2D0C A;  4H0O A;  2IC3 A;  3BEX A;  2W6K A;  1LW0 A;  2P9L A;  5AQH A;  5FLX O;  5BRH A;  1NK0 A;  1EXQ A;  3AVN A;  2QWP A;  3L6Q A;  3U6F A;  3S9H A;  2YHA A;  3MK6 A;  3QIP A;  4JI5 K;  1RDD A;  2A40 A;  4AHR A;  1EO1 A;  1NM1 A;  3MX2 A;  5E26 A;  4M3Y A;  1YHQ N;  4WQ5 A;  5EX5 A;  3VQ7 A;  4CIG A;  2D0B A;  4YOY A;  4KHY A;  4IWV A;  1CLQ A;  2Y1I A;  5HRN A;  4DTM A;  4BRN A;  1B92 A;  3SYZ A;  5GIO A;  4BQZ A;  3FFK B;  4CGD A;  2QK9 A;  1VSK A;  2VG7 A;  4JK8 A;  1V4T A;  1JL2 A;  1X3N A;  1K8K A;  3H1V X;  3O9S A;  2A1S A;  3KWG A;  3WNH A;  5HBM A;  3HYF A;  3QIO A;  1JCF A;  2P9U B;  3SLC A;  3MN5 A;  4PA1 A;  2E1Y A;  3AAR A;  4CFB A;  1UA0 A;  4XH1 A;  3OVN A;  3NGZ A;  3THW A;  3DLK A;  3E9L A;  1OH6 A;  4BC4 A;  4GKJ K;  5AQG A;  3CM6 A;  1OH8 A;  3ZEU A;  1NBW A;  3TTD A;  3M8R A;  3ID6 A;  3NE6 A;  2Y1J A;  4JI0 K;  3PSI A;  3GG4 A;  4BR2 A;  2HHW A;  4N5S A;  3IS9 A;  4YDU A;  3ULD A;  2Q31 A;  3D2F B;  3KD1 E;  3AVI A;  3NF9 A;  4ZHR A;  1XMQ K;  4WQ4 A;  3J7Y P;  5E84 A;  4CHP A;  4H5W A;  1HNZ K;  2QKB A;  4IG3 A;  5AQO A;  1QHT A;  5F1X A;  1TVR A;  5KRT A;  4CJS A;  1QE1 A;  1HJR A;  1RTJ A;  1ASU A;  1J54 A;  4B1U B;  3SQ4 A;  2FBX A;  1JXB A;  1TAQ A;  1RDC A;  4Y1C A;  4KHQ A;  2JWL A;  4H4M A;  5AQX A;  1NK5 A;  1S6Q A;  5JLF A;  3U4L A;  4H0V B;  3VTH A;  4DU4 A;  2VGM A;  4DV3 K;  3L2W A;  5ADX H;  3NFA A;  3LDQ A;  3G71 N;  1UOC A;  1HKB A;  3G6E N;  3OYE A;  1TK0 A;  4CEC A;  4CJF A;  1T3V A;  4DHY A;  1Q9X A;  1ZBU A;  4WE1 A;  3DOL A;  2UXB K;  1NK6 A;  1SKS A;  1J53 A;  4DSF A;  4R5P A;  3MN6 A;  4I9L A;  3WNG A;  1EWR A;  1QZ6 A;  1VSJ A;  2P9P B;  2WBN A;  2E2O A;  3KLG A;  3V1Q A;  5IT9 O;  2P1J A;  1Z26 A;  4DR5 K;  1RT1 A;  3LAK A;  2CGL A;  3PLA A;  5C2F A;  1S9G A;  1RCH A;  1IH7 A;  3LPT A;  2HW3 A;  4DQI A;  4CGI A;  1TK5 A;  1CZB A;  5AQQ A;  1N34 K;  3VQ4 A;  4E1J A;  1XC3 A;  1XUP O;  1YIT N;  3HST B;  4FJM A;  3CJA A;  3TAQ A;  1RT6 A;  2HMP A;  4FLT A;  3MED A;  3K5O A;  1ZBI A;  5J2M A;  3EY1 A;  4K43 A;  2DTU A;  4J8F A;  4FSV A;  4J2B A;  3AO2 A;  1Q86 O;  4YOT A;  4CK3 A;  2GBZ A;  3KLH A;  1L3U A;  1LWC A;  3EN9 A;  2QEX N;  2QXF A;  5C12 A;  1SV5 A;  2O8C B;  2XY5 A;  4LC9 B;  4ID1 A;  1U2V A;  5JIC A;  1MDU B;  4MFB A;  3D0P A;  3S41 A;  5KI6 A;  4KB1 A;  4KPY A;  3VQP A;  2VYP A;  4EAH D;  1C1A A;  3OJU A;  3VGM A;  4DQS A;  4BWM A;  1B9D A;  1RT5 A;  3MN7 A;  4FVU A;  2XY7 A;  3OHR A;  1I94 K;  1RDU A;  1JLQ A;  2IDO A;  4KTQ A;  1NGA A;  1D8Y A;  3KLI A;  4M41 A;  2X6N A;  2UXD K;  2CH5 A;  3LDS A;  2A1R A;  1XWL A;  1RDB A;  1U45 A;  1KQS M;  1FKP A;  5AFU A;  4FPA A;  2HNZ A;  4BG8 A;  1QSS A;  3SQ2 A;  4FLY A;  1IG8 A;  4ILG B;  4BR0 A;  3HT3 A;  5T7B A;  4CGG A;  1WSF A;  4E7J A;  1NGB A;  2O4G A;  4KTZ A;  3OYD A;  3CM5 A;  3EZ5 A;  2QA4 N;  3VET A;  4CEB A;  4FLV A;  3NVK A;  1KCF A;  4DSE A;  3C6U A;  3QES A;  2E4L A;  4FJ9 A;  2UYT A;  3O9T A;  4DTU A;  4GV3 A;  2DPN A;  3CC4 N;  3TAE A;  5HRP A;  2B4J A;  2YJF A;  2ZGY A;  3K9J A;  5CE3 A;  3LDP A;  4WFB L;  5BRD A;  4DV1 K;  4LH5 A;  1Q81 O;  2B6A A;  3PO4 A;  4M3Z A;  4BRA A;  1QQC A;  2YHX A;  2HVI A;  3OYL A;  3V9U A;  3L2U A;  3ATU A;  5LMN K;  4NXM K;  1LCU A;  4FWP A;  3CMA N;  3W0L A;  1TKX A;  4KI6 A;  1F21 A;  4OGE A;  4BDP A;  4BVO A;  3THY A;  3ISN C;  1TK8 A;  3CFR A;  2E6M A;  2YNG A;  3SNN A;  4X64 K;  1LW2 A;  4DKW A;  3A2F A;  1C1C A;  3P38 A;  4CF0 A;  2D5R A;  1UA1 A;  4AHV A;  2DFE A;  4FWL A;  4YOR A;  4CJP A;  3I8B A;  5TKW A;  3VGK A;  2XO7 A;  1NOY A;  3NGI A;  2CGK A;  3CJ9 A;  3L4Q A;  3GOI A;  1TYQ A;  2YI1 A;  3DYA A;  3F9M A;  3T3F A;  1C0U A;  5KQ8 A;  3D7E O;  3H08 A;  2LSN A;  1E4F T;  3SI6 A;  1VAZ A;  2IIR A;  2YHW A;  1KAX A;  3KHY A;  1CZA N;  2CH6 A;  5I42 A;  2GUI A;  2E8A A;  3T19 A;  3V9X A;  4DFM A;  3NAE A;  4B3R K;  2OPQ A;  1H1V A;  1NGG A;  1WNS A;  3AVC A;  4RW6 A;  4KKO A;  3AAQ A;  5BRE A;  2PBD A;  1JCE A;  4FL9 A;  4DR1 K;  1FK9 A;  3AA3 A;  4C1N I;  1HQU A;  4FJ7 A;  2O8E A;  2UU9 K;  1RBS A;  4BGA A;  4F2R A;  5HP1 A;  3NF8 A;  2ASO A;  4CJK A;  3O9U A;  4CJV A;  2XHB A;  4H0X B;  2P9K B;  4BE2 A;  1NJY A;  4JKB A;  1REV A;  4B3O A;  2WFB A;  3CC2 N;  1Q7Y O;  3VES A;  2UUC K;  4LF6 K;  2R7Y A;  3O5B A;  3HBT A;  4JEP A;  3J80 O;  2O4I A;  5J1E A;  1Q82 O;  3NDK A;  2OYQ A;  3WQT A;  3M5R A;  1KFD A;  3CJ7 A;  4NXN K;  3CYM A;  1MU2 A;  4BC3 A;  2JWK A;  3EL2 A;  2A42 A;  5M1Q A;  5JVG L;  4JI4 K;  2HBK A;  1WUA A;  4KHN A;  1U4B A;  3KK2 A;  3L4I A;  4DG1 A;  3KZB A;  2OZM A;  2HHV A;  1X1P A;  4LH4 A;  4OPJ A;  1U48 A;  3ZSO A;  3J81 O;  4JK9 A;  2P9I A;  3OYB A;  4EIA A; 
#chains in the Genus database with same CATH homology
 1R59 O;  2I7P A;  2WUS A;  3FZH A;  1XQS C;  3LL3 A;  4CBU A;  3WQU A;  5GAG P;  3I56 N;  4KH4 A;  2ZJQ L;  1Z6R A;  1NGE A;  2PAV A;  5FPD A;  4JHD A;  2ZJP L;  3DXM B;  5AQL A;  4BG9 A;  2Q0U A;  3SAF A;  2HF3 A;  3UKU B;  4C23 A;  3IDH A;  1GLL O;  3FR0 A;  5AQT A;  3GE1 A;  4H0Y B;  3C0B A;  3TTC A;  3UB5 A;  3FZL A;  3CHW A;  5LY3 A;  4JN4 A;  2F9W A;  4BVP A;  3JXU A;  3UKR B;  1T44 A;  4DCH A;  2KHO A;  3GL1 A;  3O6W A;  4OPA A;  4IJN A;  1GLJ O;  2P9P A;  3O4W A;  3DAW A;  3OBW A;  4CZG A;  3OW2 M;  4M63 C;  2QWN A;  3MWT A;  5BPN A;  4WQ4 C;  3PIO L;  1NGI A;  4FPB A;  2E1Z A;  3BF3 A;  2KLA A;  3OA9 A;  2FF3 B;  3E9O A;  2D1K A;  2D0O A;  4JKA A;  1VQ5 N;  1BA0 A;  3ZYY X;  3P4I A;  4NLB A;  3VEW A;  1QQO A;  2P9S B;  5HL7 L;  3N4Q A;  1Q18 A;  1GLB G;  1SS6 A;  1M1K O;  1VQ7 N;  1G99 A;  1GLE G;  3O1W A;  5ELZ A;  4F9O A;  1RDW X;  3A0I X;  3HOS A;  4H5R A;  1KAZ A;  2YCH A;  1ESV A;  2IVP A;  3RVC A;  4B1V A;  3CME N;  2FSK A;  4A57 A;  3FZK A;  3M1F A;  3SJH A;  4CZJ A;  3KVG A;  3A5O C;  4WFN L;  5BN9 A;  3EKU A;  3BUZ B;  5AQM A;  2QW9 A;  1VQ9 N;  4A5B A;  1YIJ N;  4YOW A;  3CER A;  4H0O A;  2P9I B;  3Q7C A;  3W3D A;  1P90 A;  1HX1 A;  2P9N A;  3I33 A;  3U8X A;  4PL7 A;  1VQK N;  1V4S A;  2FXU A;  3BEX A;  2P9S A;  2RHK A;  2E88 A;  3DWL A;  3B8A X;  3CCL N;  1ZXO A;  1YVN A;  3P39 A;  1X3M A;  5KPR A;  2P9L A;  3MMV A;  4NB4 A;  5AQH A;  5BRH A;  1LOT B;  4FWQ A;  2F9T A;  2QWP A;  3L6Q A;  2YJE A;  2ITM A;  2BH1 A;  3MK6 A;  1NJI O;  4FWR A;  2A40 A;  3HRG A;  4JD2 B;  5AZI A;  1EO1 A;  4A5A A;  1NM1 A;  2E2N A;  2NZT A;  3MX2 A;  5E26 A;  1P8Z A;  4BRQ A;  2W40 A;  1YHQ N;  4WQ5 A;  5EX5 A;  4BRC A;  4IOX A;  2ASP A;  1NGF A;  4M7Y A;  3CD6 N;  1NGJ A;  5M1N A;  3CPW M;  4ISF A;  4YOY A;  3CI5 A;  1GLC G;  2FSN A;  4IWV A;  3CC7 N;  2GEM A;  4WF9 L;  4BRN A;  1ILY A;  1DT9 A;  5GIO A;  2RE2 A;  4BQZ A;  4G9Z A;  5DM7 L;  3FFK B;  3FE1 A;  3O08 A;  3SAH A;  1HKC A;  2GWK A;  2D4W A;  3D2E B;  3VF4 A;  3JS6 A;  3VER A;  4GNI A;  1V4T A;  4JK8 A;  4U67 L;  1N8R O;  1X3N A;  1K8K A;  3H1V X;  4CZK A;  3WXL A;  2QWQ A;  3O9S A;  4BRE A;  2OAN A;  5C15 A;  3NMU A;  1MWM A;  3KWG A;  4CZF A;  5H1S Q;  5AQP A;  1JCF A;  1T6D A;  2P9U B;  3SLC A;  3MN5 A;  1NLV A;  4BGB A;  2OTJ N;  3ZET B;  2E1Y A;  3AAR A;  3DJC A;  4ILJ A;  4XH1 A;  4EFH A;  1RFQ A;  5JMV A;  3E9L A;  5I9E B;  2NRX A;  4BC4 A;  2Q97 A;  3CPE A;  2YX6 A;  5AQG A;  4AM7 A;  1KAY A;  4JK7 A;  4B1W B;  4H0P A;  3MDQ A;  1U6Z A;  2IVN A;  1DGK N;  2I7N A;  1DEJ A;  3ENH A;  3ZEU A;  1NBW A;  5FPE A;  5B8H A;  4Z94 A;  1K8A O;  3TTD A;  3ID6 A;  3J8A A;  4BR2 A;  3GG4 A;  4C1N K;  3H3N O;  4H03 B;  4YDU A;  3WUH A;  1EQY A;  1ZC6 A;  3L0Q A;  2Q31 A;  4BRM A;  3D2F B;  2WC9 A;  1QQM A;  1Y64 A;  1K73 O;  4WQ4 A;  5AQI A;  3D6R A;  5E84 A;  4FOE A;  4H5W A;  5AQU A;  5AQO A;  5BPL A;  4XEI A;  1HUX A;  5M1K A;  4BC2 A;  5F1X A;  5JLH A;  5FPM A;  3H3O B;  5AZJ A;  5GAH P;  3WEE B;  3VPZ A;  4OPH A;  1OVY A;  3ENB A;  4JKD A;  2HOE A;  3O9Q A;  4B1U B;  4B1Z A;  4FWN A;  1WOQ A;  3WT0 A;  3CCR N;  3GDQ A;  4A61 A;  3QDK A;  4XH5 A;  4WFA L;  2JWL A;  5AQX A;  3QB0 A;  3TSP A;  5JLF A;  3A5L C;  5JVH L;  3U4L A;  3H46 O;  4ISG A;  4BRD A;  4H0V B;  3VTH A;  4O8U A;  1JJ2 M;  2VGM A;  4IEE A;  5AQK A;  3IKM A;  4JD2 A;  5AZI B;  3VTI A;  4AM6 A;  4CJ7 A;  5ADX H;  2Q1N A;  3R1X A;  3LDQ A;  3DXM A;  3G71 N;  3VEV A;  2QM1 A;  1YJN N;  4MDA A;  2A41 A;  5C10 A;  1HKB A;  2CGJ A;  4BRG A;  3G6E N;  2W41 A;  4JAX A;  4IOC L;  3LM9 A;  2PFU A;  3MX5 A;  3K9K A;  1T3V A;  4GVE A;  4DHY A;  3CCS N;  1BOT O;  2OTL N;  3C7N A;  1RGI A;  3SMP A;  4BQL A;  4O5F A;  2HBL A;  4QS7 A;  4GV6 A;  3LDN A;  3CET A;  3MN6 A;  1QZ6 A;  2P9P B;  2QXL A;  2WBN A;  3DXK B;  1K9M O;  3LM2 A;  3HOT A;  2E2O A;  3O1B A;  4IFE A;  4BC5 A;  3VEO A;  1S3X A;  2GUP A;  4CZE A;  3H6E A;  5AQY A;  3F5T A;  2CGL A;  3PLA A;  1HPM A;  5C2F A;  4NO7 A;  3Q7B A;  2NRZ A;  2J4R A;  5KPT A;  1VQ6 N;  3WXI A;  2QI2 A;  5EOY A;  1SQK A;  4PKI A;  5AR0 A;  5AQQ A;  2GWJ A;  4K42 A;  4JKE A;  2H3G X;  4IOA L;  1D4X A;  4E1J A;  3E9P A;  1KXP A;  3IFR A;  3KWI A;  1U2V B;  1XC3 A;  4CZM A;  2QWR A;  1XUP O;  3VEY A;  3CQX A;  4H5V A;  1HJO A;  3PIP L;  3CCQ N;  3VF6 A;  1YIT N;  3E66 A;  1DKG D;  1T6C A;  2P9K A;  5AQV A;  4YOV A;  3CJA A;  5HOO A;  3U9Z A;  2HBM A;  1GLD G;  2HMP A;  2AA4 A;  4EHU A;  2Q36 A;  1QVG M;  4BRP A;  1BUP A;  3QFP A;  1YXQ A;  5M1O A;  3WXK A;  4K43 A;  4J8F A;  1YI2 N;  4BRH A;  4FSV A;  2FSJ A;  3SAG A;  2HST A;  3MCA B;  5AQZ A;  2V51 B;  1Q86 O;  1VQN N;  3MCP A;  2KKZ A;  4YOT A;  1HLU A;  2V7Z A;  4FWO A;  4FWM A;  3EN9 A;  2QEX N;  3EKS A;  4I6M A;  5C12 A;  4YDU C;  5CR4 A;  3CCV N;  4LC9 B;  3EZW A;  5FPN A;  1KD1 O;  1U2V A;  5JIC A;  4IO9 L;  3C6H A;  1MDU B;  1VQO N;  4ILH A;  1X9J A;  3C7N B;  4B9Q A;  3S41 A;  3FLC O;  5M1P A;  3BF1 A;  4CD3 A;  3O8M A;  4BRI A;  2Q0R A;  4PHT X;  2ASM A;  4CI6 A;  3C6A A;  4H0T B;  2VYP A;  4NLC A;  4B1X B;  4EAH D;  1KC8 O;  3SBG A;  3FGU A;  3CJ1 A;  3EE8 A;  3CXC M;  5BN8 A;  1YAG A;  2ZJR L;  3ZEU B;  3AY9 A;  3VGM A;  3LDL A;  3QBX A;  4FOI A;  1Z05 A;  4JNE A;  3C65 A;  3EE9 A;  4HWI A;  2FF6 A;  4CZH A;  5EXW A;  1GLA G;  3MN7 A;  4FVU A;  3TU5 A;  2V52 B;  3OHR A;  1RDU A;  3IMX A;  4IEI A;  3ULE B;  1NGA A;  1C0F A;  1HKG A;  1BO5 O;  2D0P A;  3D2F A;  3R6M A;  2ZF5 O;  2CH5 A;  3QIC A;  4H5N A;  3R9P A;  2V7Y A;  1BU6 O;  4MDB A;  3ZX0 A;  1J6Z A;  3J7Z O;  1KQS M;  4BY9 C;  4YOU A;  4I6M B;  5LJW A;  3D2E A;  5DM6 L;  5AFU A;  4A2A A;  2E20 A;  2E2Q A;  1S72 N;  4GV9 A;  1K8K B;  4WCE L;  3AGK A;  3ATV A;  4FPA A;  4BG8 A;  1GLF O;  1MA9 B;  3CCJ N;  3GBT A;  2NRH A;  1SZ2 A;  3P31 A;  5AQR A;  1IG8 A;  4ILG B;  4KBO A;  3N4P A;  4BR0 A;  1MWK A;  3LDO A;  4CZL A;  3IUC A;  3RSE B;  3MWP A;  3SK3 A;  2A5X A;  1NGB A;  4BR5 A;  1YJW N;  4MO4 A;  2NNW A;  3VET A;  2E2P A;  1NMD A;  2QA4 N;  4BR7 A;  3NVK A;  1NWK A;  5AQF A;  4A2B A;  4IO8 A;  2GTD A;  3TPQ A;  5KPZ A;  3I55 N;  1TYQ B;  2UYT A;  3O9T A;  1W2B M;  4GV3 A;  2DPN A;  3CC4 N;  3CJB A;  4RWT A;  3TTF A;  2QWO A;  2NRT A;  3H1Q A;  3ZX2 A;  2YJF A;  2ZGY A;  3K9J A;  4PL8 A;  5F2R A;  4IXC A;  3R8E A;  4A62 A;  2VWB A;  5TKY A;  5CE3 A;  3LDP A;  1NGH A;  3HM8 A;  4WFB L;  1M90 O;  5BRD A;  3CCM N;  2P9L B;  2GEL A;  3E1Y A;  5CHI A;  1Q81 O;  1OKJ A;  3FZM A;  4RTF D;  4BRA A;  1W97 L;  2YHX A;  2FLO A;  2QWL A;  3ENO A;  3VOV A;  3G4S N;  5KQD A;  2ZGZ A;  2P9N B;  4A59 A;  4FO0 A;  4IDH A;  3ATU A;  4RCH A;  1ZBS A;  4JHD B;  1LCU A;  3AAP A;  4FWP A;  2VGN A;  4MO5 A;  3CMA N;  1QQN A;  5ADX A;  2NLX A;  3UKU A;  3FZF A;  3HTV A;  4XH4 A;  3W0L A;  2ZWH A;  4BR4 A;  2IVO A;  5AQW A;  1NGD A;  4KH6 A;  2GX9 A;  1VQ8 N;  4DB3 A;  1BDG A;  3SBT A;  3UE5 A;  4ISE A;  1BG3 A;  3R3L A;  4BVO A;  5AQS A;  5MLC Q;  3CCU N;  4BRK A;  3A5M C;  1TUU A;  2A6A A;  5AFU H;  4O8K A;  3DLL L;  3M6G A;  4GY2 B;  1QHA A;  4DKW A;  5C2D A;  2AP1 A;  3P38 A;  2NRV A;  2BTF A;  4JKF A;  5BR9 A;  5LJV A;  4R79 A;  2F7T A;  3SMS A;  4FWL A;  4YOR A;  3WXJ A;  1BWF O;  5C0Y A;  3I8B A;  4WYB A;  2YHY A;  5TKW A;  3DXK A;  3VGK A;  4Y0W A;  4OO1 J;  2QWM A;  2A3Z A;  3BP8 A;  2CGK A;  3TSU A;  3CJ9 A;  4B1Y B;  3L4Q A;  3GOI A;  4U7B A;  1TYQ A;  2YI1 A;  3HI0 A;  4JKC A;  3F9M A;  4K25 A;  5KQ8 A;  1VQ4 N;  4AF1 A;  2VCP A;  3D7E O;  4H5T A;  1E4G T;  4PKG A;  1E4F T;  4FWK A;  4UY8 O;  1ATR A;  4JKH A;  4M7X A;  1VAZ A;  2IIR A;  2YHW A;  1KAX A;  2NRW A;  3KHY A;  3TSQ A;  1VQM N;  1CZA N;  3NVM A;  3EO3 A;  2CH6 A;  3H45 C;  1BA1 A;  3T7Z A;  2E8A A;  4YOX A;  1H1V A;  1NGG A;  3ID8 A;  3ZET A;  1YF5 L;  1IJJ A;  2HBJ A;  4JKG A;  2NRR A;  4K41 A;  3U9D A;  5EVZ A;  4DQ8 A;  4EHT A;  1SAZ A;  3AAQ A;  4CBW A;  5BRE A;  2PBD A;  1JCE A;  2HF4 A;  3F2K A;  4FL9 A;  4BR9 A;  4IJA A;  4IZ9 A;  5EY4 A;  3A8Y A;  1O13 A;  4HTL A;  5AQJ A;  1S22 A;  3HSC A;  4C1N I;  4CZI A;  3O9R A;  1QVF M;  4KH5 A;  3CJC A;  1JCG A;  4BGA A;  3CCE N;  2ASO A;  4CBX A;  3ULE A;  3O9U A;  3VMF B;  3QBW A;  3VEN A;  4BRO A;  4H0X B;  2P9K B;  4JKB A;  5AZJ B;  3A5N C;  4JKG B;  5GIN A;  5GIP A;  4MLH A;  5BRF A;  3WXM B;  1YJ9 N;  2WFB A;  3CC2 N;  2BUP A;  3VES A;  1Q7Y O;  2Q2R A;  3O80 A;  5M1F A;  3O5B A;  4PKH A;  3HBT A;  4JEP A;  3CQY A;  1Q82 O;  3KK7 A;  4FWS A;  3ZX3 A;  3QML A;  3MN9 A;  3WQT A;  1QZ5 A;  3M5R A;  5BPM A;  3CJ7 A;  1C0G A;  3WEE A;  3RSE A;  3VF2 A;  4BC3 A;  2JWK A;  3EL2 A;  2A42 A;  3HZ6 A;  3QFU A;  5F0X A;  5GAD P;  3M3Z A;  1NGC A;  5M1Q A;  3VEX A;  2QTD A;  5JVG L;  4CD1 A;  4QS8 A;  4MLE A;  1VQL N;  3UKR A;  4QS9 A;  3VGL A;  2HBK A;  4BRF A;  1WUA A;  3OBY A;  3VEZ A;  3T69 A;  3CF5 L;  1YUW A;  2P9U A;  4WQ5 C;  5GAE P;  3L4I A;  3CIP A;  3KZB A;  2EWS A;  1ATN A;  1TUY A;  3AGR A;  3G25 A;  1VQP N;  1ATS A;  4L3Q A;  4JK9 A;  2P9I A;  4EIA A;  4BRL A;  5AQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...