3KHYA

Crystal structure of a propionate kinase from francisella tularensis subsp. tularensis schu s4
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
384
structure length
384
Chain Sequence
b'MSEILVLNCGSSSVKFALINPHTSQSLVTGLAENIATKNCKVVFKAEHKIVKYLENGSYKDVFEMLKDFLVENKHLEKIVAIGHRVVHGGQYFSKSVLINADSLEKIKACIALAPLHNPAHIEGIRFCQQIFPELPQVAVFDTAFHQTMPSYIAEYAIPYELTHKHNIRKYGAHGTSHKYVSEQAAKILTQQKANVIVAHLGNGCSITAVVDGKSIDTSMGLTPLDGLVMGTRSGCIDPSIFAYISDNLGWSVTEITNMLNKQSGLLGICGHNDMREVSQLAAKGDSLAKLAIEIFSHRVAKFVASYMIYFNKLDALVFTGGIGENAANIRKNIISKLANLGFMIDHQKNSNSETFINSKNSHNIMVIATNEELMIAQETQNLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Propionate kinase
publication title Crystal Structure of a propionate kinase from Francisella tularensis subsp. tularensis SCHU S4
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Transferase
total genus 123
structure length 384
sequence length 384
chains with identical sequence B
ec nomenclature ec 2.7.2.-:
pdb deposition date 2009-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3khyA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3khyA02
1D4XA 1BOTO 2QWMA 2V7YA 4BG8A 1T6CA 1S3XA 4BR4A 1G99A 5AZIA 1NGEA 4DQ8A 5BPNA 1MDUB 1GLLO 2E1ZA 4NB4A 4BRNA 2E1YA 1NGBA 3MN5A 3EKUA 3UKUA 2Q36A 4QS8A 1JCFA 1K8KA 2P9LB 4ISGA 3CJ1A 4BRMA 2A40A 2QWOA 2D0OA 3LDQA 5KQ8A 2QWLA 3ZEUB 3GDQA 3QFUA 2IVOA 3HZ6A 4BRGA 3H3OB 4CZIA 4CZGA 3D2FA 3ENOA 4JAXA 3SLCA 5AQSA 4CZEA 1JCGA 3A5OC 2I7NA 4K43A 3JS6A 2GTDA 1E4GT 1Q18A 2QM1A 5AQKA 2QWQA 1NGJA 2HF3A 3W0LA 1X3MA 1MWKA 3WT0A 4IZ9A 3CETA 2VCPA 5AR0A 4AM6A 3CJ9A 3BF1A 2BTFA 2P9PB 1P8ZA 5B8HA 1NGAA 1QQNA 3LDOA 5JICA 3R9PA 2A5XA 3IUCA 3VEWA 4MO5A 5AFUH 1T44A 3O6WA 3WUHA 2YHWA 4CZMA 3FZKA 5AQHA 5FPEA 2YJEA 2E2NA 1GLFO 4BGAA 5JLFA 2YCHA 1Z05A 4H0YB 4EFHA 5AQNA 4JHDB 3VEXA 3RSEA 1BA1A 5EY4A 1ZXOA 4BR7A 2IVNA 5AQYA 3FGUA 4CJ7A 2A42A 1NMDA 4KBOA 3U8XA 2I7PA 4GNIA 4BRAA 4RCHA 1NWKA 3ULEA 3DXMA 3KHYA 4BR9A 1TYQB 1GLEG 3QFPA 3L0QA 4BC2A 1KXPA 4FOIA 5ELZA 4BRDA 2F9TA 3UB5A 3ATUA 2GWKA 1U2VA 1NGDA 3O80A 5LJVA 3HSCA 2KHOA 4PL8A 3LM9A 3FZMA 5LJWA 2P9SA 4K41A 5EXWA 1BA0A 4FWQA 3LDLA 2YJFA 5AFUA 3O5BA 4BRCA 3LDNA 4FWLA 4CBXA 3AY9A 4BGBA 1MWMA 4O5FA 4H5VA 3DJCA 1SQKA 1GLDG 3C7NB 1KAYA 4ISFA 3IFRA 5AQPA 3LDPA 2UYTA 1YUWA 4AM7A 2A41A 4PL7A 4IJAA 2FF6A 4BR5A 2P9IB 1BWFO 3DXKA 5BRFA 4CD1A 3TU5A 1ESVA 3ZX0A 2Q0UA 2HMPA 4C23A 3WXLA 1J6ZA 5AQOA 2P9UA 4B9QA 2P9KB 3MCPA 4BVPA 3CHWA 1SAZA 2NLXA 3D2EA 3R8EA 3GL1A 2VWBA 5E84A 3HI0A 3GBTA 3HBTA 3ZX2A 3QMLA 3AAQA 5AQGA 1KAZA 4WYBA 3CI5A 5AQVA 3WXKA 3ZETA 4B1ZA 1XC3A 3FZFA 1BUPA 1NGGA 1NGCA 2Q0RA 2ZGZA 2HF4A 3HTVA 5KQDA 4M63C 3L4IA 1DEJA 2WUSA 3FR0A 3QDKA 4O8KA 1DGKN 2ZGYA 2Q2RA 5AQRA 3MN6A 1RGIA 3A8YA 5AQXA 3I33A 5JLHA 4H5NA 3SMSA 3EKSA 5BRDA 3VESA 3F9MA 2FSKA 1HKBA 2FLOA 2FSNA 5BREA 2HOEA 5AQWA 4RTFD 1TUUA 4BROA 4FPAA 4BRLA 3QBWA 4CZFA 4FL9A 4B1UB 1DKGD 3JXUA 3R6MA 4A61A 3KVGA 5BPMA 2QWPA 3LM2A 3DWLA 4BR2A 2GUPA 2W41A 4I6MB 3UKRB 4H0OA 4B1YB 4WQ5C 4Y0WA 1C0FA 4RWTA 1QZ5A 1HPMA 1NBWA 3EO3A 5F2RA 3O1BA 1RFQA 4FWRA 5EVZA 5KPZA 1RDWX 4FWNA 1TUYA 1QZ6A 5AZJB 4EHTA 1ZC6A 4FSVA 5BPLA 3VF6A 3CQXA 4M7YA 3WXJA 4BRFA 3P4IA 2P9LA 5FPMA 4EIAA 2A6AA 4CZKA 3GG4A 3VF2A 1HKCA 4XH1A 4BG9A 4BRQA 3VOVA 3G25A 2ZF5O 5JMVA 2YHXA 1MA9B 2QXLA 1YXQA 3QBXA 3WQTA 3HM8A 3EZWA 3J8AA 2H3GX 2Q1NA 5AQTA 5AQLA 4XH4A 3DAWA 3WEEA 3ENHA 3SK3A 5KPTA 5F0XA 4IXCA 2PAVA 4JD2B 2W40A 3KZBA 4XEIA 1NGIA 4IJNA 2D1KA 2DPNA 2GEMA 3BEXA 2P9PA 3CJAA 2E8AA 3LL3A 2IVPA 2V51B 1LCUA 3MN7A 4K42A 1JCEA 3MK6A 3MDQA 5AZIB 3IDHA 1BDGA 4BRHA 3UKUB 2D4WA 2GELA 1OKJA 1SZ2A 3FZHA 4BREA 1NLVA 2E20A 3FZLA 4HWIA 1K8KB 1XQSC 4BRKA 5ADXA 1GLCG 2YHYA 4MLEA 4JHDA 2P9NA 2ASMA 4A2BA 2CGKA 3H3NO 3VEVA 1V4TA 4B1VA 5EOYA 4WQ5A 4FO0A 3D2FB 3QICA 4JNEA 4DCHA 5KPRA 3ZX3A 3TPQA 4H03B 1GLAG 3M3ZA 4FOEA 5BR9A 1QHAA 2Q31A 1X9JA 3H1QA 1TYQA 3O1WA 3U4LA 5EX5A 3FLCO 3O4WA 1QQMA 1BO5O 2NRHA 4ISEA 4CZLA 1S22A 3VERA 2PBDA 1EQYA 1CZAN 4BR0A 1YAGA 4QS7A 1V4SA 2ZWHA 2E2QA 4YDUC 3AARA 3VGMA 2CH6A 4H5TA 4FWPA 4QS9A 3VEYA 3BP8A 3UE5A 3O8MA 3VETA 3O08A 1ZBSA 5BRHA 4CZJA 2ASOA 4BQLA 5AQZA 2NZTA 1IG8A 3H46O 2CGJA 4F9OA 3FFKB 3C7NA 1Y64A 4H5WA 5AQUA 4H5RA 4FWOA 4BRIA 3RSEB 2E2OA 1QQOA 1HKGA 5ADXH 2E2PA 1HUXA 4WQ4C 2P9IA 3IMXA 4M7XA 5CE3A 4CI6A 3CERA 4EAHD 3WQUA 4JN4A 3ULEB 3DXMB 3SMPA 2P9KA 2V7ZA 2GWJA 3CJCA 1XUPO 1NGFA 3WXIA 3S41A 4NO7A 1WUAA 3H1VX 1GLBG 1ATRA 4HTLA 2YI1A 3WEEB 4CBUA 3BUZB 3I8BA 3CIPA 5F1XA 3BF3A 1U2VB 3MMVA 4K25A 4J8FA 3A0IX 4FWSA 3ID8A 1BU6O 3ATVA 1IJJA 4LC9B 2P9SB 4B1WB 4BC3A 4CBWA 3U9ZA 3OHRA 5TKYA 3M1FA 2CGLA 5FPNA 3EN9A 4DHYA 3ZEUA 4E1JA 3VEZA 2J4RA 1NGHA 3B8AX 3GOIA 5BN9A 5AQQA 4BQZA 2FXUA 4EHUA 1LOTB 1HJOA 1R59O 1Z6RA 4FWMA 4BC5A 4DB3A 4BC4A 3CJ7A 3CJBA 3SJHA 2E88A 1T6DA 2AP1A 1GLJO 2BUPA 4PKIA 3A5LC 2P9NB 3DXKB 1HX1A 3M6GA 3VPZA 4YDUA 4A2AA 3L6QA 3A5MC 3VENA 2AA4A 2FF3B 2OANA 2P9UB 4I6MA 4H0TB 2A3ZA 4MO4A 3UKRA 5AQIA 2QWNA 5I9EB 4L3QA 4XH5A 4H0XB 3D2EB 5AQJA 3ZETB 3MN9A 3H6EA 1BG3A 4BRPA 1C0GA 5BN8A 4H0PA 5AZJA 4CD3A 3EL2A 2FSJA 5FPDA 5AQMA 1HLUA 1NM1A 3VGLA 3GE1A 2QWRA 4WQ4A 2QW9A 4CZHA 4PKHA 5LY3A 3D7EO 2IIRA 2V52B 1X3NA 2F9WA 1WOQA 3AAPA 3A5NC 4B1XB 3VF4A 3VEOA 4MLHA 1U6ZA 2ASPA 2VYPA 4FWKA 4BVOA 3W3DA 4Z94A 4H0VB 2ITMA 4IWVA 2CH5A 4JD2A 1YVNA 1E4FT 3FE1A 4IO8A 4PKGA 3CQYA 4A62A 3H45C 3QB0A 5AQFA 4FPBA 1ATSA 3C0BA 4GY2B 1H1VA 3VGKA 2EWSA 5E26A 1KAXA 3U9DA 2D0PA 2Q97A 1ATNA
chains in the Genus database with same CATH superfamily
3QEWA 2PYJA 2HNZA 4GVEA 4BG8A 1S3XA 3SV3A 1BCMA 1NGEA 1MDUB 3ID6A 2A1SA 1NGBA 3EKUA 2Q36A 4CCHA 1RBRA 3KD5E 5FROA 4QS8A 4A59A 4CEOA 1D9DA 1F21A 2P9LB 4O55A 2X6NA 5J2NA 4DTUA 2D0OA 3S3NA 4DKWA 5AJ3K 3QFUA 1XMOK 2IVOA 3KWGA 4U7BA 3VQQA 1A5XA 3D2FA 4JAXA 3SLCA 4CZEA 1VQKN 4I7FA 3MXJA 2VQEK 4YHHK 1M1KO 1J54A 2BDPA 3THXB 1UWBA 3OTOK 3WT0A 1RT5A 2VCPA 5AR0A 4AM6A 1UOCA 1SL2A 3BF1A 4DR6K 3DOLA 3F2KA 4DV1K 1NGAA 2D0CA 3CCLN 1KVBA 3IUCA 2VQFK 4DLGA 4BDPA 1RT7A 4MO5A 3VQPA 4DLEA 1XI1A 1LWEA 1Q8IA 2O4GA 1T44A 4CK3A 4FZZA 3WUHA 4DTOA 2YHWA 3PUFA 1KTQA 1JL2A 5JLFA 1YTAA 2YCHA 4H0YB 3RR7A 1IH7A 5AQNA 3VEXA 3E01A 4HCCA 5HRSA 2QKKA 4BR7A 3FGUA 4YNQA 3QINA 4MDBA 3HK2A 1NMDA 4KBOA 3U8XA 2HSTA 2I7PA 1X9MA 1VSHA 4DV2K 1HNWK 4JKGB 3DXMA 4BR9A 1KFSA 1OH8A 1VQ8N 4CJRA 4FOIA 3TWHA 3DRPA 2O8FB 1A5WA 2D0BA 3UB5A 4I2PA 3O80A 5LJVA 4JKDA 3L3UA 5CYQA 4OKEA 3FZMA 4JI5K 4K41A 3LDLA 2YJFA 4CFDA 3THVA 3RR8A 3EZ5A 1ZBFA 3LDNA 4DQIA 1HNXK 2ZJRL 4QAGA 3SPYA 4H5VA 4NLBA 2W6KA 3DJCA 1GLDG 3C7NB 1KAYA 4ISFA 3AA3A 4FLYA 1YUWA 4DR3K 2HVHA 4TSXA 4IJAA 1TKZA 1BWFO 3DXKA 4AHCA 5BRFA 3LP3A 3RMCA 4A5AA 3TU5A 5J1EA 4C23A 3WXLA 5AQOA 3LZJA 4B9QA 1Q7YO 1JLQA 3HP9A 3ZT2A 1DTTA 2NLXA 2F7TA 3GBTA 3HBTA 2NRXA 5AQGA 3ZT3A 4WYBA 3CI5A 4AHTA 4FXDA 5AQVA 4M3UA 3K5NA 3S3MA 3FZFA 1NNEA 3OYCA 3SQ0A 4FJ9A 1NGCA 2Q0RA 4HUGA 1TK8A 2PYLA 4GV3A 4Q0BA 4GKJK 2ZE2A 2WUSA 1B9FA 4X64K 5AQRA 1RGIA 3ZT0A 4KREA 4AF1A 4FJMA 2NRZA 3EKSA 5BRDA 3E9LA 3OBYA 3VESA 5HRRA 1LV5A 2FLOA 1VQPN 3CQ8A 3OVNA 4HTUA 1TUUA 5K14A 1SV5A 4JK8A 4FL9A 4A61A 4I9LA 5H1SQ 4H0OA 1KLMA 1WNSA 4B1YB 4Y0WA 2F8SA 1RNHA 3AVJA 5KPZA 1RDWX 1ZC6A 3T1AA 4NYNA 4LF6K 4I2QA 1RT4A 1TVRA 4M7YA 3WXJA 5C0YA 4BRFA 3KKSA 3P4IA 2NUBA 5FPMA 4EIAA 4KI4A 5KI6A 4BRQA 2ZF5O 3T1HK 3AO1A 4F2SA 3SUOA 1IO2A 1S5JA 3AGRA 4CJWA 2YKNA 2O8EA 4IG3A 5MLCQ 4YOXA 4PY5A 1KD1O 3DAWA 1RDAA 5F0XA 4GMJB 4DTNA 4CJ5A 2PAVA 4JD2B 1NK0A 1NGIA 4IJNA 3CC7N 2DPNA 2GEMA 5DM7L 2FBYA 4DS5A 4X65K 5CR4A 3KTQA 1UA0A 1ZBLA 1ASWA 4HUEA 3K58A 3K9KA 1OKJA 3IS9A 3G4SN 2OZSA 2E20A 3FZLA 2OA8A 5TKWA 3G6EN 4B9UA 5ADXA 5CZ1A 4YOUA 2FC0A 4FK0A 3QNNA 1ITGA 2P9NA 2ITGA 3CXCM 5KGXA 4A2BA 2FBVA 3J7ZO 4KHWA 4B1VA 1S1XA 4FJGA 4FO0A 2JWLA 3D2FB 4LF5K 3TAEA 3QEPA 3M3ZA 1KC8O 4OX9K 5DMRA 4LSNA 5EX5A 1EP4A 3FLCO 1QQMA 3O4WA 2KW4A 2HHUA 4DQRA 4DSEA 1I3AA 3LP1A 1EQYA 4LH4A 3SCXA 3VN5A 3MCAB 4OJRA 1YAGA 4QS7A 4UY8O 1V4SA 4YDUC 3VGMA 4LSLA 3NF6A 4H5TA 2HNYA 3LP2A 4WFBL 1VQMN 2JGUA 4PQUA 3HJFA 3BP8A 4B3MK 3UE5A 1NK9A 3V81A 1NK7A 5KRSA 1ZBSA 4LF7K 3DMJA 4CIEA 1RDBA 2GV9A 3J81O 4H5WA 4H4OA 4RW7A 3C95A 4CEDA 3WNEA 4FW1A 4M3RA 4DFJA 2P9IA 3CCVN 4ID5A 1DTQA 4EAHD 4CF9A 4FVUA 3TABA 3DXMB 3VQAA 5FRMA 2KTQA 1WUAA 4LF9K 5M1KA 4ELUA 1K73O 3PX6A 4PA1A 1UA1A 3I8BA 4K25A 1EWQA 2ZJQL 1BU6O 5C15A 1IJJA 4LC9B 1B9DA 4BC3A 3SZ2A 1S1UA 4B3SK 4B9NA 1C0UA 4CJKA 4DHYA 4E1JA 1XMQK 4JKEA 5E41A 3GOIA 4BQZA 3VQBA 3WNGA 1HYZA 5BN9A 3ZYYX 5BR8K 1LOTB 1Z6RA 2QA4N 4FWMA 1IBMK 4BC4A 3E1YA 4FM0A 3CJ7A 3CJBA 4F2RA 3SJHA 2HHHK 4PKIA 2XO7A 3DXKB 1HX1A 4KPYA 4CJPA 4YDUA 4FJNA 3A5MC 4J2BA 1XHXA 4OPAA 5FRNA 5A2QO 2QWNA 4CHPA 1ZYQA 1FKPA 4XH5A 4H0XB 4ID1A 1OVQA 3LALA 4JKCA 1YJ9N 1KFDA 2HW3A 2PZSA 4LFCK 3QO9A 3V4IA 1VHXA 3R1XA 4KHNA 3EL2A 5FPDA 2RE2A 3VGLA 3TTCA 4J2DA 3THWB 2YHBA 4PKHA 5LY3A 2NRRA 4FJXA 2V52B 1X3NA 4W5OA 3K5OA 1WOQA 1N36K 2OPSA 3A5NC 4DWIA 1LWCA 1UAXA 1VRTA 3VF4A 3VEOA 4IFYA 1U6ZA 2ATQA 3ZSOA 4NCGA 3EYZA 3NF9A 4BVOA 1U4BA 3LPUA 3AA2A 1RBTA 2W42A 2O8FA 3KJVA 1T8EA 1W9HA 4HCBA 5GAGP 1YVNA 2IAJA 1JLGA 3H45C 1ATSA 3PY8A 2XRIA 3DI6A 3U9DA 1QSLA 4M3XA 2D0PA 1N33K 2Y1IA 2QWMA 4B3RK 4A57A 4BR4A 1G99A 5I42A 1GLLO 2E1ZA 3MN5A 4CEFA 1BISA 4YOTA 3I0RA 1JLEA 4DR4K 4DTPA 1K8KA 5J2QA 4BRMA 1C0MA 1RT2A 4FK2A 3NBPA 3H3OB 4CZGA 1K9MO 3CPWM 1W97L 3JS6A 2GTDA 4FLVA 3U3GA 2O8EB 1E4GT 2QM1A 5AQKA 2HB5A 3T69A 3VQCA 4HHTA 3OJSA 1TGOA 4CF1A 4CJ4A 2HF3A 1X3MA 1X1PA 4KI6A 3V9XA 4FJKA 3CFPA 2BTFA 2YX6A 1P8ZA 1C1BA 1QQNA 3AVNA 2BGGA 2YV0X 4KH4A 3SQ2A 4AHRA 2VGMA 3O6WA 4CZMA 3LWLA 5AQHA 5JS2A 2P5OA 3O9QA 4JI0K 5HRNA 2YJEA 2E2NA 4BGAA 4FLTA 5JVGL 4DF8A 3LDSA 3RSEA 4C8LA 4DV4K 1ZXOA 4ZHRA 1VAZA 5AQYA 4YFUA 1B92A 4AHVA 1LW2A 1K6YA 4GNIA 4BRAA 1NWKA 4E19A 4M45A 3QFPA 1GOCA 1KXPA 2Z1HA 4DQQA 3VTHA 2F8TA 2Z1GA 3JAMO 4BRDA 1JLCA 4CJQA 2GWKA 1U2VA 1NGDA 4E7HA 5FDLA 3HSCA 3J80O 3SI6A 1JLFA 2KHOA 4Z4HA 1JJ2M 4B08A 4EZ6A 3O5BA 2KZZA 3HVRA 3VQEA 1EO1A 4BRCA 3L8BA 4DU1A 1CZBA 4BGBA 1N32K 3TR8A 3RMDA 4DSLA 4LF8K 3IFRA 5AQPA 2RN2A 3LDPA 2UYTA 1S9GA 4RW6A 2FF6A 2P9IB 4O4GA 3HPGA 2KFNA 3HRGA 3CC2N 3CC4N 2HVIA 3L2WA 3K2PA 3C6UA 3O3FA 2WC9A 4DV0K 2YKMA 3R8EA 3L2UA 3GL1A 2VWBA 3HI0A 3ZX2A 2G8HA 3QMLA 3AAQA 4CECA 2XHBA 1S6QA 2ZD1A 3THYA 1TK0A 3ZETA 1XC3A 4YY3K 4C8KA 4CFCA 4CGIA 3CM5A 4DMNA 5KQDA 3L4IA 3FR0A 1FJGK 4ELVA 1X9SA 4Y1CA 2ZGYA 1U45A 3I56N 5C2FA 5JLHA 1OH5A 2QI2A 3SMSA 3F9MA 3SQ1A 1VQNN 2FSNA 5BREA 4CJSA 4B1UB 1BI4A 3R6MA 2QWPA 3LWMA 2W41A 1NOZA 2KKZA 1RTIA 4JLHA 1T03A 4FK4A 4N76A 4JS4A 3AA4A 5GIPA 3C6AA 3EO3A 4BE1A 5F2RA 3O1BA 3MXMA 3VQ4A 1QTMA 1EX4A 1TUYA 3KK7A 3CM6A 3K5LA 4WFNL 1S1VA 3CQXA 2Y1JA 5C2DA 1QVGM 1SL1A 1HPZA 4CZKA 4JK9A 1NJWA 2UUBK 1HKCA 3VOVA 3RMAA 3G25A 4JKAA 5JMVA 1SS6A 3TANA 1MA9B 2QXLA 1VQ4N 3HP6A 3PLAA 3WQTA 2ZM6K 4ELTA 3HM8A 3EZWA 3J8AA 5GAHP 3M8PA 5AQLA 3BZKA 4CJEA 3DLEA 4FW2A 4BWJA 3ENHA 1TAQA 2Z1IA 2OTLN 4NYFA 1JXEA 4ILHA 3PIOL 1NK5A 3OYMA 2O4IA 3IKMA 3CJAA 3ISNC 2E8AA 4JKFA 1JCEA 1KLNA 3MK6A 4MQ3A 2YHAA 3IDHA 1J5EK 1TV6A 3M8SA 1RILA 2DY4A 3M8RA 1SZ2A 4BREA 1K8KB 2HNDA 3T7ZA 2E5LK 2YHYA 4MLEA 3CCSN 1YT3A 3PX0A 2IC3A 4HVJA 3H08A 4GV9A 3H3NO 2OPPA 5EOYA 3P5JA 4JNEA 4DCHA 3HO1A 3HYFA 4CF2A 4Z4CA 4FOEA 5BR9A 2G8FA 1X9JA 3O1WA 3U4LA 3KKRA 1BO5O 3C94A 2NRHA 1S22A 2PBDA 4CK2A 1W7AA 1OVYA 1K8AO 5IWAK 1CZAN 4FJ8A 2E2QA 3AARA 3AVAA 3DRRA 4FWPA 3THWA 1SL0A 2HHVA 4CE9A 1IKWA 4DR1K 3K57A 3OYIA 2ASOA 4BQLA 5AQZA 3OYJA 1XHZA 3NGZA 3NH2A 3I8DA 3F5TA 4DSKA 3OS2A 2CGJA 1U48A 3I0SA 5AQUA 1W0HA 4FWOA 3RSEB 2E2OA 3AO5A 1QQOA 1HKGA 4M3ZA 4CHYA 4M7XA 1RDDA 5CE3A 1U47A 3TTDA 4YORA 3CERA 4JN4A 4DV3K 2P9KA 2V7ZA 3OS1A 1NGFA 3T1YK 4NO7A 3H1VX 3RTVA 2YI1A 1NMNA 1N8RO 3PO4A 2PFUA 1EWRA 3BUZB 2VWJA 4JYAK 1U2VB 4LY7A 3A0IX 4E3SA 4FWSA 4B3TK 3ATVA 1EXQA 2QKBA 3VA0A 4JI1K 3OHRA 2CGLA 5FPNA 1L3VA 1NGHA 4EHUA 3O4QA 5HL7L 2FXUA 1YITN 3VQ6A 4E1MA 3NGYA 4BC5A 3MX2A 3DYAA 5CHIA 4RW9A 4OPJA 2HHWA 4CEBA 1GLJO 1VSFA 1WAJA 3D6RA 4CIFA 3VPZA 4DTXA 4JI8K 2Z1JA 3EE9A 2AA4A 4I6MA 3HOSA 4CK1A 5DM6L 3CCUN 4L3QA 4E1NA 1QSYA 1IKVA 1QVFM 2QXFA 1VK0A 1Y97A 1NJXA 3D45A 1HRHA 2ZQBA 3THYB 3ZETB 3MN9A 2OZMA 3H6EA 2IGIA 4W5QA 1NJYA 2XY7A 3PO5A 4CD3A 2FSJA 3P38A 1NOYA 2RPIA 3P83D 3L2QA 1XC9A 1Z26A 4YOWA 2QWRA 3M8QA 2QW9A 2HHSA 2IIRA 4KV8A 4BDYA 3AAPA 4DFPA 4V19S 2HBMA 5GAEP 3ZSYA 3OJUA 4WE1A 1IKYA 2I5JA 3AO3A 4Z94A 1M90O 1BI4B 4H0VB 2ITMA 4E7IA 4OLAA 2CH5A 3RRHA 2WOMA 3L4QA 4Y1DA 5KGWA 1RTDA 3SAGA 5AQFA 4FPBA 1QSSA 1D8YA 4GY2B 4CGJA 1H1VA 1JL1A 2VWKA 3S9HA 1TKDA 3NVMA 1D4XA 1BOTO 1BGXT 3PV8A 3TAGA 4CFBA 1T6CA 2QTDA 2RKIA 5AZIA 5BPNA 3J7YP 5CYMA 4KO0A 1Q82O 4CGDA 2B6AA 4DUZK 4C8NA 1BIUA 4RW8A 1VQ5N 4O0JA 4W5TA 1JCFA 3CMAN 3V1OA 4ISGA 1VQ6N 3CJ1A 5SZTA 2A40A 2QWOA 3SYZA 3OYNA 1LAVA 4CJ3A 2QWLA 4JK7A 2KQ2A 3ZEUB 3P39A 2F4VK 1RTJA 3HZ6A 3OYFA 4U67L 4BRGA 5IT9O 5LMNK 4CZIA 5AQSA 4B9TA 3A5OC 2I7NA 1VSLA 3KK3A 4I9QA 3LAMA 4FJJA 3TI0A 1RBSA 3E66A 3ALYA 2JWKA 2OPRA 1YJWN 4FLWA 4N47A 1EKEA 1VSIA 4IZ9A 3K0SA 4J2EA 3CETA 2KZMA 3K5MA 1KCFA 2WTUA 1KSPA 4FLUA 1IBLK 4DQPA 5B8HA 5JICA 3DRSA 3LDOA 3MEGA 3R9PA 2A5XA 3V9SA 2UXBK 1SKSA 1YTUA 1KRPA 1IG9A 5AFUH 3AVBA 3MEEA 3FZKA 4LFAK 2E4LA 5FPEA 3RRGA 3CCEN 1Z05A 4B9SA 3N4QA 1WSFA 1J9AA 4OLBA 1BA1A 1IBKK 5EY4A 4CEEA 4CJ7A 3VQ8A 3T3FA 1CXQA 4Z4FA 5M1PA 3CG7A 1GLEG 4M41A 1TKXA 4BC2A 1HMVA 3DOKA 2X78A 5ELZA 2P5GA 3DM2A 2UXDK 2IOCA 4FCYA 4FYDA 4J2AA 4PL8A 3QIOA 3ZCMA 3AVMA 3BGRA 4FWQA 4IKFA 4FWLA 1Q86O 3DLBA 1WSGA 3HOTA 5LMUK 4IOAL 4JI2K 1T7PA 3NF7A 3ZT1A 3QEXA 2HMIA 3TAQA 4KH6A 4AM7A 1N6QA 4PL7A 2G8WA 1RDUA 3NH1A 1RCHA 4BR5A 2VG5A 3AO2A 3ULDA 4CF0A 2HMPA 4B3OA 2P9UA 2P9KB 3CD6N 4FJHA 3CHWA 3D2EA 4N56A 3OYDA 5E84A 1YVUA 1G15A 2KFZA 4DTRA 4KHYA 5SWMA 2D0AA 4EZ9A 1VSDA 4CFAA 4NCAA 4M3TA 1OH6A 3PSFA 3QEVA 4WFAL 1NGGA 1T05A 1TL3A 1FXXA 1HQUA 4M63C 2YNGA 4KFBA 2DFFA 1ZBUA 1HNIA 2DTUA 5HRPA 3MN6A 1I94K 3A8YA 3I33A 4JI4K 3BZCA 3T19A 2FSKA 4BE0A 2HOEA 4BROA 3ZSVA 1WLJA 1NKEA 5I3UA 4FZXC 3KVGA 4FJ5A 3Q7CA 4I6MB 1BL3A 1S1TA 3VQ5A 4LD0A 4WQ5C 3NF8A 1HYVA 3CCRN 3MXIA 4FZYA 4PWDA 4RWTA 1I39A 1BCOA 1HPMA 1NBWA 3AVFA 1RFQA 3CPEA 4FWNA 4OKKA 4DSFA 1T3VA 3AVHA 4EHTA 4E89A 2GBZA 3VF6A 3IAYA 4JI3K 4DS4A 3J7AP 3O4NA 3VF2A 4BG9A 4XH1A 4N41A 3JYTA 4AH9A 3EY1A 2YHXA 4M3YA 3L2RA 4WCEL 3AVCA 2YNFA 2OPQA 2R7YA 4XH4A 2B5JA 4CESA 3LAKA 4CJUA 3OY9A 3OYBA 1NK6A 4CEAA 2VGNA 3SAFA 2W40A 4FLXA 3KZBA 4XEIA 3U3YA 1JLAA 2D1KA 3CFRA 4FJIA 3WXMB 4GV6A 2P9PA 1D5AA 4LF4K 2IVPA 3MN7A 4N5SA 1FW6A 3MDQA 3CCMN 1VQON 5AZIB 2EHGA 1BDGA 1HQEA 3DLLL 2GELA 3FZHA 1S72N 4HWIA 4BRKA 2QK9A 1GLCG 3OYHA 4DU4A 4G9ZA 3QLHA 4DR2K 2UU9K 4JHDA 1L5UA 2G8VA 3Q7BA 2ASMA 3VEVA 4W5RA 1V4TA 5GIOA 4WQ5A 4DV6K 3QICA 5KPRA 3TPQA 4H03B 3AGKA 1QHAA 1VQLN 3H1QA 1BQMA 1TYQA 5LL6Z 3NVKA 4ISEA 4CZLA 4X66K 4CJTA 3VERA 1E3MA 3EEQA 4BR0A 4JI6K 2CH6A 3QETA 4QS9A 1GOAA 3O8MA 3VETA 4K8XA 4CZJA 5KTQA 4DV7K 4KHUA 4OKJA 1IG8A 2XY5A 3H46O 3PSIA 4Z4GA 4GW6A 3FFKB 3ZSWA 4H5RA 3AVKA 5CY4A 5ADXH 1HUXA 4FM2A 3IMXA 3LPTA 4NCBA 1YJNN 4QOZB 2OCEA 4WF9L 2A1RA 3SNNA 3F9KA 3WXIA 1XUPO 4OPKA 3VQDA 3S41A 2IDOA 1GLBG 3N4PA 4O44A 3ZSXA 3ZSQA 3WEEB 4UQGA 3HSTB 4AILC 3OA9A 1X9WA 3CIPA 4E7JA 3MMVA 4JV5K 3S3OA 2OTJN 4E0DA 3ID8A 3VA3A 3HT3A 3LP0A 3CYMA 4B1WB 4CBWA 3U9ZA 3O9TA 1WSJA 3M1FA 4KAZA 5C10A 3ZEUA 2J4RA 3B8AX 5AQQA 5KRTA 1HJOA 2UUAK 1Z25A 3SBTA 5C12A 3P31A 3ITHA 4BWMA 3HXMA 2AP1A 2RF2A 4Z4IA 1LWFA 3AVGA 1JLBA 3M6GA 2NNWA 3L6QA 4XIUA 2P9UB 2BH1A 3SBGA 3CMEN 2A3ZA 3UKRA 1HNZK 5AQIA 3K59A 3D2EB 4KHSA 1HJRA 1IV0A 1L3SA 3O9SA 2EX3A 4KKOA 4BRPA 1C0GA 4H0PA 5AZJA 3B6OA 2GX9A 5HROA 1HLUA 1NM1A 2QEXN 4L8RB 3GE1A 4IEEA 3SAHA 1TK5A 1VSJA 4CZHA 1RDCA 2O8DB 5M1QA 3KK1A 2F9WA 2LSNA 4CEQA 4LH5A 4FJLA 3KLEA 4CF8A 1C1AA 4ZTFA 4Z4EA 4MFBA 3LANA 3KK2A 1GOBA 3MX5A 3KLFA 4CHQA 3MEDA 1W2BM 4BE2A 4DU3A 4OGCA 2KLAA 4DR7K 4QCLA 3DLRA 4IO8A 4PKGA 4R5PA 3QB0A 3C0BA 4O5BA 3NGIA 3VGKA 2VG7A 2EWSA 1KAXA 3O3HA 4F3OA 1ATNA 2V7YA 3NHGA 3OW2M 3O9RA 2Q3SA 5M1OA 4DQ8A 1SKWA 1KQSM 4AQYK 4NB4A 4BRNA 2E1YA 3UKUA 3O9UA 1VSKA 1U04A 1BHLA 4DTSA 3KLGA 4C8OA 3LDQA 5KQ8A 3TAFA 4DSJA 3GDQA 3SV4A 1R0AA 1QHTA 3V9ZA 3SJJA 3ENOA 3VMFB 2B4JA 1JCGA 5CZ2A 4K43A 3M5RA 1L3UA 3KWIA 1Q18A 1WAFA 3L3VA 4KTWA 1RT1A 2QWQA 1NGJA 3W0LA 2WONA 1MWKA 3V9WA 3VQ9A 3CJ9A 4CIGA 1IKXA 2P9PB 2JLEA 3QIPA 3OS0A 4IBNA 3VEWA 4X62K 4AHSA 5HBMA 1CLQA 1FK9A 1GLFO 4KB0A 1WSHA 4EFHA 4JHDB 1VQ7N 3NH0A 4CW7B 5J2MA 3KLIA 1Q9YA 1LAWA 2IVNA 3AO4A 3P1GA 2A42A 2P1JA 3AVIA 3RMBA 4RCHA 3DLHA 1KVAA 3ULEA 4B9VA 3KHYA 4IFEA 3WNHA 3DLKA 1TYQB 4O0IA 5HOOA 4LFBK 4JS5A 2DFHA 1NU0A 3L0QA 4IG0A 3JSMA 2D5RA 3CCQN 1ILYA 2F9TA 2HBKA 4DF4A 3TAPA 3ATUA 1C0TA 3E9OA 3LM9A 4YOVA 5LJWA 2P9SA 5EXWA 4IOCL 1BA0A 3OYEA 4K0KK 1U49A 4JEPA 4CBXA 2G8KA 3AY9A 1MWMA 4O5FA 4HUFA 1SUQA 3AA5X 3E9PA 1RT6A 1QQCA 1SQKA 1NJIO 3AVLA 4DSIA 1QE1A 2WBNA 1C1CA 3MECA 1C6VA 1ASVA 2A41A 3NAEA 1TL1A 2O8CA 4EP4A 4CHOA 4GVMA 4CGHA 4CD1A 1ESVA 3ZX0A 2Q0UA 1J6ZA 2YNIA 3C6HA 3ENBA 4RW4A 4ZTJA 5DK5A 3DLGA 1NKCA 2BE2A 3F73A 3MCPA 4BVPA 1S6PA 1SAZA 3HPHA 1NJZA 1KAZA 3MAQA 3WXKA 4B1ZA 1TKTA 2AJQA 1BUPA 4RG8A 4B8CA 4CERA 4CGFA 3SUNA 2ZGZA 2HF4A 1ZBHA 1TAUA 3HTVA 4MDAA 1FKOA 3NE6A 1DEJA 3QDKA 4CJFA 4O8KA 1RBUA 3MWPA 5HP1A 2FBTA 1DGKN 3OYKA 3HL8A 2Q2RA 5AQXA 2NRVA 4H5NA 3G0ZA 4IFVA 1YIJN 1J53A 4KB1A 1HKBA 1O1WA 3V9UA 3QERA 1XNQK 5AQWA 1RTHA 4RTFD 3A2FA 4IO9L 4OO1J 4FPAA 4BRLA 4F3TA 3QBWA 4CZFA 1Q9XA 2UUCK 4B9MA 1BIZA 4DQSA 2UXCK 1DKGD 3JXUA 2O8BA 5BPMA 1DLOA 3LM2A 3DWLA 4BR2A 2GUPA 1DT9A 4JRPA 3UKRB 4DUYK 1OH7A 2XY6A 3OYLA 1C0FA 1QZ5A 4B9LA 4FWRA 4CGGA 2ZJPL 5EVZA 4FM1A 3FFIA 1VSMA 1NKBA 3NFAA 1S1WA 1QZ6A 5AZJB 4DTMA 1A5VA 4FSVA 3TAMA 3ZSZA 1YHQN 1HR0K 3BDPA 5BPLA 4YOYA 4H8KA 1VQ9N 1BQNA 2NRWA 2P9LA 1LW0A 2A6AA 4IEIA 3GG4A 3ASMA 1RBVA 1YXQA 3QBXA 5JS1A 4EP5A 3SQ4A 3V1RA 1NK8A 2H3GX 2Q1NA 5AQTA 1JKHA 3MWTA 3WEEA 3SK3A 5KPTA 1WSIA 3THXA 4IXCA 3TSUA 3TSQA 4FVMA 3U6FA 1VSEA 4G1QA 3BEXA 3QNOA 3LL3A 2V51B 1LCUA 1RT3A 3EE8A 1N5YA 4K42A 2HHQA 4C8MA 2P51A 4KHPK 2HHTA 4BRHA 4DFKA 4A5BA 3UKUB 1P90A 2D4WA 3C65A 4OVLA 4AHUA 1NLVA 3AV9A 1XQSC 1HNVA 1VRUA 2DFEA 3KLHA 3ZT4A 5C25A 3VTIA 2HBJA 3C6TA 3OYAA 3V1QA 4C1NI 2GUIA 4NLCA 4CJLA 2CGKA 3RVCA 1NG9A 2BANA 3QEIA 3OBWA 3ZX3A 3VQ7A 4FJ7A 1GLAG 4JKGA 4ICLA 2Q31A 1O13A 4F8RA 3G71N 5D3GA 4BACA 1D9FA 4GKKK 4JKHA 4DV5K 2VG6A 4JRQA 2G8UA 2ZWHA 4CEZA 4K8ZA 2OYQA 4KHQA 4CHNA 4NXMK 4KTZA 3VEYA 2O8DA 1XWLA 2FBXA 5EU7A 3O08A 5BRHA 4JKBA 3LZIA 2IS3A 2NRTA 1L3TA 2NZTA 3IG1A 4PUOA 1ZBIA 4F9OA 3C7NA 3HM9A 1Y64A 5C42A 1J5OA 1S9EA 3TTFA 4BRIA 4KTQA 4C1NK 2E2PA 5T7BA 3KIOA 4WQ4C 3HVTA 2ETJA 4CI6A 1MU2A 3I55N 1WBDA 3CFOA 3WQUA 4IOXA 3ULEB 4F4KA 3SMPA 3ZLJA 4ILGB 1JXBA 4PHTX 2GWJA 3CJCA 3R3LA 1ATRA 4HTLA 2X6SA 2X74A 4CBUA 2E6LA 4Z0UA 5F1XA 3BF3A 1Q81O 4J8FA 4B8AB 3OYGA 2E6MA 4OPHA 1SKRA 2WFBA 2P9SB 4ILJA 4IDHA 5TKYA 1NK4A 2RHKA 2F96A 2HBLA 4H4MA 3EN9A 3VEZA 3K9JA 4M42A 4DR5K 4E7KA 1R59O 2XY8A 3HPOA 1HYSA 3NDKA 4DB3A 3KD1E 1QS4A 2E88A 1T6DA 2BUPA 4CJVA 3IRXA 5GADP 2O8CB 3A5LC 4M3WA 2P9NB 2YNHA 4BDZA 1N34K 4A2AA 4JI7K 1WSEA 3VENA 1KVCA 4DG1A 2HHXA 2FF3B 2OANA 4H0TB 1WN7A 5J2PA 4MO4A 3PX4A 5I9EB 4O8UA 3BY5A 4IDKA 4NXNK 4KH5A 3O3GA 1YI2N 5JVHL 3WNFA 5AQJA 3UIQA 3NCIA 4FLZA 2G8IA 3PIPL 1WB9A 3CF5L 1BG3A 5BN8A 3TSPA 4Q5VA 4KRFA 1EETA 5AQMA 3B6PA 3ZSRA 4CVNE 5HLFA 4E7LA 4WQ4A 4DFMA 3V6DA 3CCJN 4W5NA 3D7EO 4OGEA 1ASUA 3SUQA 3TARA 1WBBA 4B1XB 2PY5A 3RWUA 4CHZA 1XNRK 3G10A 4MLHA 3SPZA 2ASPA 3D0PA 1YF5L 3NMUA 2VYPA 4FWKA 3W3DA 5M1FA 2W6LA 5FLXO 2O8BB 4IWVA 4BY9C 3SUPA 5M1NA 4JD2A 5GINA 1REVA 1CXUA 1E4FT 3FE1A 5C24A 4DTJA 3CQYA 4A62A 3QESA 1CZ9A 4R79A 3L2VA 5E26A 2Q97A 5AFUA
chains in the Genus database with same CATH topology
1D4XA 1BOTO 2QWMA 2V7YA 4GVEA 4BG8A 1T6CA 1S3XA 2QTDA 4A57A 1G99A 5AZIA 1NGEA 4BR4A 3O9RA 3OW2M 5M1OA 4DQ8A 5BPNA 1MDUB 3ID6A 1GLLO 2E1ZA 4NB4A 4BRNA 1KQSM 2E1YA 1NGBA 3MN5A 3EKUA 3UKUA 1Q82O 2Q36A 4YOTA 3O9UA 4QS8A 4A59A 1VQ5N 1JCFA 1K8KA 2P9LB 3CMAN 4ISGA 1VQ6N 3CJ1A 4BRMA 2A40A 2QWOA 2D0OA 3LDQA 5KQ8A 2QWLA 4DKWA 4JK7A 3ZEUB 3GDQA 3QFUA 2IVOA 3P39A 3HZ6A 3KWGA 4U7BA 4U67L 4BRGA 3H3OB 4CZIA 4CZGA 3D2FA 3ENOA 4JAXA 3SLCA 5AQSA 4CZEA 3VMFB 1K9MO 1JCGA 3CPWM 1VQKN 3A5OC 2I7NA 3M5RA 4K43A 1W97L 3JS6A 2GTDA 1E4GT 1M1KO 3KWIA 1Q18A 3E66A 2QM1A 5AQKA 3T69A 2JWKA 2QWQA 1YJWN 1NGJA 2HF3A 3W0LA 1X3MA 1MWKA 3WT0A 4IZ9A 3CETA 2VCPA 5AR0A 4AM6A 3CJ9A 3BF1A 2BTFA 2P9PB 2YX6A 1P8ZA 3F2KA 5B8HA 1NGAA 1QQNA 3LDOA 5JICA 3R9PA 2A5XA 3CCLN 3IUCA 4KH4A 3VEWA 4MO5A 5AFUH 1T44A 2VGMA 3O6WA 3WUHA 2YHWA 4CZMA 3FZKA 5AQHA 3O9QA 5FPEA 2YJEA 3CCEN 2E2NA 1GLFO 4BGAA 5JLFA 2YCHA 1Z05A 4H0YB 4EFHA 3N4QA 5AQNA 4JHDB 5JVGL 3VEXA 1VQ7N 3RSEA 1BA1A 5EY4A 1ZXOA 4BR7A 1VAZA 2IVNA 3FGUA 5AQYA 4CJ7A 2A42A 4MDBA 1NMDA 4KBOA 3U8XA 2HSTA 2I7PA 4GNIA 4BRAA 4RCHA 1NWKA 4JKGB 3ULEA 3DXMA 3KHYA 4BR9A 4IFEA 1TYQB 5M1PA 1GLEG 1VQ8N 5HOOA 3QFPA 3L0QA 4BC2A 1KXPA 4FOIA 3VTHA 3CCQN 5ELZA 1ILYA 4BRDA 2F9TA 2HBKA 3UB5A 3ATUA 2GWKA 1U2VA 1NGDA 3O80A 5LJVA 4JKDA 3HSCA 3E9OA 2KHOA 4PL8A 3LM9A 4YOVA 1JJ2M 3FZMA 5LJWA 2P9SA 4K41A 5EXWA 4IOCL 1BA0A 4FWQA 3LDLA 2YJFA 5AFUA 3O5BA 1EO1A 4BRCA 3LDNA 4FWLA 1Q86O 3HOTA 4JEPA 2ZJRL 4IOAL 4CBXA 3AY9A 4BGBA 1MWMA 4O5FA 3E9PA 4H5VA 4NLBA 3DJCA 1SQKA 1GLDG 3C7NB 1KAYA 4ISFA 1NJIO 3IFRA 2WBNA 5AQPA 3LDPA 2UYTA 1YUWA 4KH6A 4AM7A 2A41A 4PL7A 4IJAA 1RDUA 2FF6A 4BR5A 2P9IB 1BWFO 3DXKA 5BRFA 4CD1A 4A5AA 3TU5A 1ESVA 3ZX0A 2Q0UA 3HRGA 3CC2N 2HMPA 4C23A 3WXLA 1J6ZA 5JLHA 3CC4N 5AQOA 2P9UA 3C6HA 3ENBA 4B9QA 1Q7YO 2P9KB 3CD6N 2WC9A 3MCPA 4BVPA 3CHWA 1SAZA 2NLXA 3D2EA 3R8EA 3GL1A 2F7TA 2VWBA 3HI0A 3GBTA 3HBTA 5E84A 3ZX2A 3QMLA 3AAQA 2NRXA 5AQGA 1KAZA 4WYBA 3CI5A 5AQVA 3WXKA 3ZETA 4B1ZA 1XC3A 3FZFA 1BUPA 4WFAL 1NGGA 1NGCA 2Q0RA 4GV3A 2ZGZA 2HF4A 3HTVA 5KQDA 4M63C 3L4IA 4MDAA 1DEJA 2WUSA 3FR0A 3QDKA 4O8KA 3MWPA 1DGKN 2ZGYA 3I56N 2Q2RA 5AQRA 5C2FA 3MN6A 1RGIA 3A8YA 5AQXA 2NRVA 3I33A 4H5NA 2QI2A 4AF1A 2NRZA 3EKSA 3SMSA 5BRDA 3E9LA 3F9MA 3OBYA 3VESA 2FSKA 1YIJN 1VQNN 1HKBA 2FLOA 1VQPN 2FSNA 5BREA 2HOEA 5AQWA 4RTFD 1TUUA 4IO9L 4OO1J 4BROA 4FPAA 4BRLA 3QBWA 4JK8A 4CZFA 4FL9A 4B1UB 1DKGD 3JXUA 3R6MA 4A61A 3KVGA 5BPMA 2QWPA 3LM2A 3DWLA 4BR2A 3Q7CA 2GUPA 1DT9A 2W41A 4I6MB 5H1SQ 3UKRB 2KKZA 4H0OA 4B1YB 4WQ5C 4Y0WA 3CCRN 1C0FA 4RWTA 1QZ5A 1HPMA 1NBWA 5GIPA 3C6AA 3EO3A 5F2RA 3O1BA 1RFQA 4FWRA 3CPEA 2ZJPL 5EVZA 5KPZA 1RDWX 4FWNA 1TUYA 1T3VA 3KK7A 1QZ6A 5AZJB 4EHTA 1ZC6A 4FSVA 1YHQN 4WFNL 5BPLA 3VF6A 4YOYA 1VQ9N 3CQXA 4M7YA 3WXJA 4BRFA 5C0YA 5C2DA 2NRWA 3P4IA 2P9LA 5FPMA 4EIAA 2A6AA 4IEIA 4CZKA 4JK9A 1QVGM 3GG4A 3VF2A 1HKCA 4XH1A 4BG9A 4BRQA 3VOVA 3G25A 2ZF5O 4JKAA 2YHXA 5JMVA 1SS6A 1MA9B 4WCEL 2QXLA 1VQ4N 1YXQA 3QBXA 3WQTA 3PLAA 3HM8A 3EZWA 3J8AA 2H3GX 3AGRA 2Q1NA 5GAHP 5AQTA 5AQLA 5MLCQ 4YOXA 4XH4A 3MWTA 1KD1O 3DAWA 3WEEA 3ENHA 3SK3A 5KPTA 5F0XA 2OTLN 4IXCA 3TSUA 3TSQA 2PAVA 4JD2B 2VGNA 3SAFA 3PIOL 4ILHA 2W40A 3KZBA 4XEIA 1NGIA 4IJNA 3CC7N 2D1KA 3WXMB 2DPNA 2GEMA 3IKMA 4GV6A 3BEXA 2P9PA 3CJAA 2E8AA 5DM7L 3LL3A 2IVPA 2V51B 1LCUA 3MN7A 4JKFA 3EE8A 4K42A 1JCEA 3MK6A 5CR4A 3MDQA 3CCMN 1VQON 5AZIB 3IDHA 1BDGA 4BRHA 4A5BA 3DLLL 3UKUB 1P90A 2D4WA 2GELA 3C65A 3K9KA 1OKJA 1SZ2A 3G4SN 3FZHA 4BREA 1NLVA 1S72N 2E20A 3FZLA 4HWIA 5TKWA 1K8KB 1XQSC 4BRKA 5ADXA 1GLCG 4YOUA 3G6EN 3T7ZA 2YHYA 4MLEA 4G9ZA 3VTIA 3CCSN 2HBJA 4JHDA 2P9NA 3CXCM 3Q7BA 2ASMA 4A2BA 4C1NI 4NLCA 4GV9A 2CGKA 3H3NO 3VEVA 3J7ZO 1V4TA 3RVCA 4B1VA 5EOYA 5GIOA 4WQ5A 4FO0A 2JWLA 3D2FB 3QICA 4JNEA 4DCHA 5KPRA 3OBWA 3ZX3A 3TPQA 4H03B 1GLAG 3AGKA 3M3ZA 4FOEA 4JKGA 5BR9A 1KC8O 1QHAA 2Q31A 1VQLN 1O13A 1X9JA 1TYQA 3H1QA 3O1WA 3U4LA 5EX5A 3FLCO 3O4WA 1QQMA 3G71N 3NVKA 1BO5O 2NRHA 4ISEA 4CZLA 4JKHA 1S22A 3VERA 2PBDA 1EQYA 1OVYA 1K8AO 1CZAN 3MCAB 4BR0A 1YAGA 4QS7A 4UY8O 1V4SA 2ZWHA 2E2QA 4YDUC 3AARA 3VGMA 2CH6A 4H5TA 4FWPA 4WFBL 1VQMN 4QS9A 3VEYA 3BP8A 3UE5A 3O8MA 3VETA 3O08A 1ZBSA 5BRHA 4CZJA 4JKBA 2ASOA 4BQLA 5AQZA 2NRTA 2NZTA 1IG8A 3F5TA 3H46O 2CGJA 4F9OA 3FFKB 3C7NA 1Y64A 4H5WA 5AQUA 4H5RA 3TTFA 4FWOA 4BRIA 3RSEB 2E2OA 4C1NK 1QQOA 1HKGA 5ADXH 2E2PA 1HUXA 4WQ4C 2P9IA 3IMXA 4M7XA 3CCVN 5CE3A 4CI6A 3TTDA 3I55N 4YORA 3CERA 1YJNN 4EAHD 4FVUA 3WQUA 4IOXA 4WF9L 4JN4A 3ULEB 3DXMB 3SMPA 4ILGB 2P9KA 4PHTX 2V7ZA 2GWJA 1XUPO 3CJCA 1NGFA 3R3LA 3WXIA 3S41A 4NO7A 1WUAA 3H1VX 1GLBG 3N4PA 5M1KA 1K73O 1ATRA 4HTLA 2YI1A 3WEEB 4CBUA 1N8RO 2PFUA 3OA9A 3BUZB 3I8BA 3CIPA 5F1XA 3BF3A 1U2VB 3MMVA 4K25A 1Q81O 4J8FA 3A0IX 4FWSA 2OTJN 4OPHA 3ID8A 2WFBA 2ZJQL 1BU6O 3ATVA 1IJJA 4LC9B 2P9SB 5C15A 4ILJA 4B1WB 4BC3A 4CBWA 4IDHA 3U9ZA 3OHRA 5TKYA 2RHKA 3O9TA 2HBLA 3M1FA 2CGLA 5FPNA 3EN9A 4DHYA 3ZEUA 4E1JA 4JKEA 3VEZA 2J4RA 1NGHA 3B8AX 3GOIA 3K9JA 5AQQA 5BN9A 2FXUA 3ZYYX 4BQZA 4EHUA 5HL7L 1LOTB 1HJOA 1YITN 1R59O 1Z6RA 3SBTA 5C12A 2QA4N 3P31A 4FWMA 4BC5A 4DB3A 3MX2A 4BC4A 3E1YA 3CJ7A 3CJBA 5CHIA 3SJHA 2E88A 1T6DA 2AP1A 1GLJO 2BUPA 4PKIA 5GADP 3A5LC 2P9NB 3DXKB 1HX1A 3D6RA 3M6GA 3VPZA 4YDUA 5C10A 4A2AA 2NNWA 3L6QA 3A5MC 3VENA 3EE9A 2AA4A 4OPAA 2FF3B 2OANA 2BH1A 2P9UB 4I6MA 3SBGA 3CMEN 4H0TB 3HOSA 2A3ZA 4MO4A 3UKRA 5AQIA 2QWNA 5DM6L 3CCUN 5I9EB 4L3QA 4XH5A 4H0XB 4O8UA 3D2EB 1QVFM 4KH5A 1YI2N 5JVHL 4JKCA 3O9SA 5AQJA 1YJ9N 3ZETB 3PIPL 3MN9A 3H6EA 3CF5L 1BG3A 4BRPA 1C0GA 5BN8A 4H0PA 5AZJA 3R1XA 4CD3A 2GX9A 2FSJA 3EL2A 3P38A 3TSPA 5FPDA 5AQMA 1HLUA 1NM1A 2RE2A 3VGLA 2QEXN 3GE1A 4YOWA 3TTCA 2QWRA 4IEEA 2QW9A 4WQ4A 3SAHA 4CZHA 3CCJN 4PKHA 5M1QA 5LY3A 2NRRA 3D7EO 2IIRA 2V52B 1X3NA 2F9WA 1WOQA 3AAPA 3A5NC 4B1XB 2HBMA 5GAEP 3VF4A 3VEOA 4MLHA 1U6ZA 2ASPA 1YF5L 3NMUA 2VYPA 4FWKA 4BVOA 3W3DA 4Z94A 1M90O 5M1FA 4H0VB 2ITMA 3MX5A 4IWVA 1W2BM 4BY9C 2CH5A 5M1NA 4JD2A 2KLAA 5GINA 3L4QA 5GAGP 1YVNA 1E4FT 3FE1A 4IO8A 4PKGA 3CQYA 4A62A 3H45C 3QB0A 5AQFA 3SAGA 4FPBA 1ATSA 3C0BA 4GY2B 4R79A 1H1VA 3VGKA 2EWSA 5E26A 1KAXA 3U9DA 2D0PA 2Q97A 1ATNA 3NVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D4X A;  1BOT O;  2QWM A;  2V7Y A;  4BG8 A;  1T6C A;  1S3X A;  4BR4 A;  1G99 A;  5AZI A;  1NGE A;  4DQ8 A;  5BPN A;  1MDU B;  1GLL O;  2E1Z A;  4NB4 A;  4BRN A;  2E1Y A;  1NGB A;  3MN5 A;  3EKU A;  3UKU A;  2Q36 A;  4QS8 A;  1JCF A;  1K8K A;  2P9L B;  4ISG A;  3CJ1 A;  4BRM A;  2A40 A;  2QWO A;  2D0O A;  3LDQ A;  5KQ8 A;  2QWL A;  3ZEU B;  3GDQ A;  3QFU A;  2IVO A;  3HZ6 A;  4BRG A;  3H3O B;  4CZI A;  4CZG A;  3D2F A;  3ENO A;  4JAX A;  3SLC A;  5AQS A;  4CZE A;  1JCG A;  3A5O C;  2I7N A;  4K43 A;  3JS6 A;  2GTD A;  1E4G T;  1Q18 A;  2QM1 A;  5AQK A;  2QWQ A;  1NGJ A;  2HF3 A;  3W0L A;  1X3M A;  1MWK A;  3WT0 A;  4IZ9 A;  3CET A;  2VCP A;  5AR0 A;  4AM6 A;  3CJ9 A;  3BF1 A;  2BTF A;  2P9P B;  1P8Z A;  5B8H A;  1NGA A;  1QQN A;  3LDO A;  5JIC A;  3R9P A;  2A5X A;  3IUC A;  3VEW A;  4MO5 A;  5AFU H;  1T44 A;  3O6W A;  3WUH A;  2YHW A;  4CZM A;  3FZK A;  5AQH A;  5FPE A;  2YJE A;  2E2N A;  1GLF O;  4BGA A;  5JLF A;  2YCH A;  1Z05 A;  4H0Y B;  4EFH A;  5AQN A;  4JHD B;  3VEX A;  3RSE A;  1BA1 A;  5EY4 A;  1ZXO A;  4BR7 A;  2IVN A;  5AQY A;  3FGU A;  4CJ7 A;  2A42 A;  1NMD A;  4KBO A;  3U8X A;  2I7P A;  4GNI A;  4BRA A;  4RCH A;  1NWK A;  3ULE A;  3DXM A;  3KHY A;  4BR9 A;  1TYQ B;  1GLE G;  3QFP A;  3L0Q A;  4BC2 A;  1KXP A;  4FOI A;  5ELZ A;  4BRD A;  2F9T A;  3UB5 A;  3ATU A;  2GWK A;  1U2V A;  1NGD A;  3O80 A;  5LJV A;  3HSC A;  2KHO A;  4PL8 A;  3LM9 A;  3FZM A;  5LJW A;  2P9S A;  4K41 A;  5EXW A;  1BA0 A;  4FWQ A;  3LDL A;  2YJF A;  5AFU A;  3O5B A;  4BRC A;  3LDN A;  4FWL A;  4CBX A;  3AY9 A;  4BGB A;  1MWM A;  4O5F A;  4H5V A;  3DJC A;  1SQK A;  1GLD G;  3C7N B;  1KAY A;  4ISF A;  3IFR A;  5AQP A;  3LDP A;  2UYT A;  1YUW A;  4AM7 A;  2A41 A;  4PL7 A;  4IJA A;  2FF6 A;  4BR5 A;  2P9I B;  1BWF O;  3DXK A;  5BRF A;  4CD1 A;  3TU5 A;  1ESV A;  3ZX0 A;  2Q0U A;  2HMP A;  4C23 A;  3WXL A;  1J6Z A;  5AQO A;  2P9U A;  4B9Q A;  2P9K B;  3MCP A;  4BVP A;  3CHW A;  1SAZ A;  2NLX A;  3D2E A;  3R8E A;  3GL1 A;  2VWB A;  5E84 A;  3HI0 A;  3GBT A;  3HBT A;  3ZX2 A;  3QML A;  3AAQ A;  5AQG A;  1KAZ A;  4WYB A;  3CI5 A;  5AQV A;  3WXK A;  3ZET A;  4B1Z A;  1XC3 A;  3FZF A;  1BUP A;  1NGG A;  1NGC A;  2Q0R A;  2ZGZ A;  2HF4 A;  3HTV A;  5KQD A;  4M63 C;  3L4I A;  1DEJ A;  2WUS A;  3FR0 A;  3QDK A;  4O8K A;  1DGK N;  2ZGY A;  2Q2R A;  5AQR A;  3MN6 A;  1RGI A;  3A8Y A;  5AQX A;  3I33 A;  5JLH A;  4H5N A;  3SMS A;  3EKS A;  5BRD A;  3VES A;  3F9M A;  2FSK A;  1HKB A;  2FLO A;  2FSN A;  5BRE A;  2HOE A;  5AQW A;  4RTF D;  1TUU A;  4BRO A;  4FPA A;  4BRL A;  3QBW A;  4CZF A;  4FL9 A;  4B1U B;  1DKG D;  3JXU A;  3R6M A;  4A61 A;  3KVG A;  5BPM A;  2QWP A;  3LM2 A;  3DWL A;  4BR2 A;  2GUP A;  2W41 A;  4I6M B;  3UKR B;  4H0O A;  4B1Y B;  4WQ5 C;  4Y0W A;  1C0F A;  4RWT A;  1QZ5 A;  1HPM A;  1NBW A;  3EO3 A;  5F2R A;  3O1B A;  1RFQ A;  4FWR A;  5EVZ A;  5KPZ A;  1RDW X;  4FWN A;  1TUY A;  1QZ6 A;  5AZJ B;  4EHT A;  1ZC6 A;  4FSV A;  5BPL A;  3VF6 A;  3CQX A;  4M7Y A;  3WXJ A;  4BRF A;  3P4I A;  2P9L A;  5FPM A;  4EIA A;  2A6A A;  4CZK A;  3GG4 A;  3VF2 A;  1HKC A;  4XH1 A;  4BG9 A;  4BRQ A;  3VOV A;  3G25 A;  2ZF5 O;  5JMV A;  2YHX A;  1MA9 B;  2QXL A;  1YXQ A;  3QBX A;  3WQT A;  3HM8 A;  3EZW A;  3J8A A;  2H3G X;  2Q1N A;  5AQT A;  5AQL A;  4XH4 A;  3DAW A;  3WEE A;  3ENH A;  3SK3 A;  5KPT A;  5F0X A;  4IXC A;  2PAV A;  4JD2 B;  2W40 A;  3KZB A;  4XEI A;  1NGI A;  4IJN A;  2D1K A;  2DPN A;  2GEM A;  3BEX A;  2P9P A;  3CJA A;  2E8A A;  3LL3 A;  2IVP A;  2V51 B;  1LCU A;  3MN7 A;  4K42 A;  1JCE A;  3MK6 A;  3MDQ A;  5AZI B;  3IDH A;  1BDG A;  4BRH A;  3UKU B;  2D4W A;  2GEL A;  1OKJ A;  1SZ2 A;  3FZH A;  4BRE A;  1NLV A;  2E20 A;  3FZL A;  4HWI A;  1K8K B;  1XQS C;  4BRK A;  5ADX A;  1GLC G;  2YHY A;  4MLE A;  4JHD A;  2P9N A;  2ASM A;  4A2B A;  2CGK A;  3H3N O;  3VEV A;  1V4T A;  4B1V A;  5EOY A;  4WQ5 A;  4FO0 A;  3D2F B;  3QIC A;  4JNE A;  4DCH A;  5KPR A;  3ZX3 A;  3TPQ A;  4H03 B;  1GLA G;  3M3Z A;  4FOE A;  5BR9 A;  1QHA A;  2Q31 A;  1X9J A;  3H1Q A;  1TYQ A;  3O1W A;  3U4L A;  5EX5 A;  3FLC O;  3O4W A;  1QQM A;  1BO5 O;  2NRH A;  4ISE A;  4CZL A;  1S22 A;  3VER A;  2PBD A;  1EQY A;  1CZA N;  4BR0 A;  1YAG A;  4QS7 A;  1V4S A;  2ZWH A;  2E2Q A;  4YDU C;  3AAR A;  3VGM A;  2CH6 A;  4H5T A;  4FWP A;  4QS9 A;  3VEY A;  3BP8 A;  3UE5 A;  3O8M A;  3VET A;  3O08 A;  1ZBS A;  5BRH A;  4CZJ A;  2ASO A;  4BQL A;  5AQZ A;  2NZT A;  1IG8 A;  3H46 O;  2CGJ A;  4F9O A;  3FFK B;  3C7N A;  1Y64 A;  4H5W A;  5AQU A;  4H5R A;  4FWO A;  4BRI A;  3RSE B;  2E2O A;  1QQO A;  1HKG A;  5ADX H;  2E2P A;  1HUX A;  4WQ4 C;  2P9I A;  3IMX A;  4M7X A;  5CE3 A;  4CI6 A;  3CER A;  4EAH D;  3WQU A;  4JN4 A;  3ULE B;  3DXM B;  3SMP A;  2P9K A;  2V7Z A;  2GWJ A;  3CJC A;  1XUP O;  1NGF A;  3WXI A;  3S41 A;  4NO7 A;  1WUA A;  3H1V X;  1GLB G;  1ATR A;  4HTL A;  2YI1 A;  3WEE B;  4CBU A;  3BUZ B;  3I8B A;  3CIP A;  5F1X A;  3BF3 A;  1U2V B;  3MMV A;  4K25 A;  4J8F A;  3A0I X;  4FWS A;  3ID8 A;  1BU6 O;  3ATV A;  1IJJ A;  4LC9 B;  2P9S B;  4B1W B;  4BC3 A;  4CBW A;  3U9Z A;  3OHR A;  5TKY A;  3M1F A;  2CGL A;  5FPN A;  3EN9 A;  4DHY A;  3ZEU A;  4E1J A;  3VEZ A;  2J4R A;  1NGH A;  3B8A X;  3GOI A;  5BN9 A;  5AQQ A;  4BQZ A;  2FXU A;  4EHU A;  1LOT B;  1HJO A;  1R59 O;  1Z6R A;  4FWM A;  4BC5 A;  4DB3 A;  4BC4 A;  3CJ7 A;  3CJB A;  3SJH A;  2E88 A;  1T6D A;  2AP1 A;  1GLJ O;  2BUP A;  4PKI A;  3A5L C;  2P9N B;  3DXK B;  1HX1 A;  3M6G A;  3VPZ A;  4YDU A;  4A2A A;  3L6Q A;  3A5M C;  3VEN A;  2AA4 A;  2FF3 B;  2OAN A;  2P9U B;  4I6M A;  4H0T B;  2A3Z A;  4MO4 A;  3UKR A;  5AQI A;  2QWN A;  5I9E B;  4L3Q A;  4XH5 A;  4H0X B;  3D2E B;  5AQJ A;  3ZET B;  3MN9 A;  3H6E A;  1BG3 A;  4BRP A;  1C0G A;  5BN8 A;  4H0P A;  5AZJ A;  4CD3 A;  3EL2 A;  2FSJ A;  5FPD A;  5AQM A;  1HLU A;  1NM1 A;  3VGL A;  3GE1 A;  2QWR A;  4WQ4 A;  2QW9 A;  4CZH A;  4PKH A;  5LY3 A;  3D7E O;  2IIR A;  2V52 B;  1X3N A;  2F9W A;  1WOQ A;  3AAP A;  3A5N C;  4B1X B;  3VF4 A;  3VEO A;  4MLH A;  1U6Z A;  2ASP A;  2VYP A;  4FWK A;  4BVO A;  3W3D A;  4Z94 A;  4H0V B;  2ITM A;  4IWV A;  2CH5 A;  4JD2 A;  1YVN A;  1E4F T;  3FE1 A;  4IO8 A;  4PKG A;  3CQY A;  4A62 A;  3H45 C;  3QB0 A;  5AQF A;  4FPB A;  1ATS A;  3C0B A;  4GY2 B;  1H1V A;  3VGK A;  2EWS A;  5E26 A;  1KAX A;  3U9D A;  2D0P A;  2Q97 A;  1ATN A; 
#chains in the Genus database with same CATH topology
 3QEW A;  2PYJ A;  2HNZ A;  4GVE A;  4BG8 A;  1S3X A;  3SV3 A;  1BCM A;  1NGE A;  1MDU B;  3ID6 A;  2A1S A;  1NGB A;  3EKU A;  2Q36 A;  4CCH A;  1RBR A;  3KD5 E;  5FRO A;  4QS8 A;  4A59 A;  4CEO A;  1D9D A;  1F21 A;  2P9L B;  4O55 A;  2X6N A;  5J2N A;  4DTU A;  2D0O A;  3S3N A;  4DKW A;  5AJ3 K;  3QFU A;  1XMO K;  2IVO A;  3KWG A;  4U7B A;  3VQQ A;  1A5X A;  3D2F A;  4JAX A;  3SLC A;  4CZE A;  1VQK N;  4I7F A;  3MXJ A;  2VQE K;  4YHH K;  1M1K O;  1J54 A;  2BDP A;  3THX B;  1UWB A;  3OTO K;  3WT0 A;  1RT5 A;  2VCP A;  5AR0 A;  4AM6 A;  1UOC A;  1SL2 A;  3BF1 A;  4DR6 K;  3DOL A;  3F2K A;  4DV1 K;  1NGA A;  2D0C A;  3CCL N;  1KVB A;  3IUC A;  2VQF K;  4DLG A;  4BDP A;  1RT7 A;  4MO5 A;  3VQP A;  4DLE A;  1XI1 A;  1LWE A;  1Q8I A;  2O4G A;  1T44 A;  4CK3 A;  4FZZ A;  3WUH A;  4DTO A;  2YHW A;  3PUF A;  1KTQ A;  1JL2 A;  5JLF A;  1YTA A;  2YCH A;  4H0Y B;  3RR7 A;  1IH7 A;  5AQN A;  3VEX A;  3E01 A;  4HCC A;  5HRS A;  2QKK A;  4BR7 A;  3FGU A;  4YNQ A;  3QIN A;  4MDB A;  3HK2 A;  1NMD A;  4KBO A;  3U8X A;  2HST A;  2I7P A;  1X9M A;  1VSH A;  4DV2 K;  1HNW K;  4JKG B;  3DXM A;  4BR9 A;  1KFS A;  1OH8 A;  1VQ8 N;  4CJR A;  4FOI A;  3TWH A;  3DRP A;  2O8F B;  1A5W A;  2D0B A;  3UB5 A;  4I2P A;  3O80 A;  5LJV A;  4JKD A;  3L3U A;  5CYQ A;  4OKE A;  3FZM A;  4JI5 K;  4K41 A;  3LDL A;  2YJF A;  4CFD A;  3THV A;  3RR8 A;  3EZ5 A;  1ZBF A;  3LDN A;  4DQI A;  1HNX K;  2ZJR L;  4QAG A;  3SPY A;  4H5V A;  4NLB A;  2W6K A;  3DJC A;  1GLD G;  3C7N B;  1KAY A;  4ISF A;  3AA3 A;  4FLY A;  1YUW A;  4DR3 K;  2HVH A;  4TSX A;  4IJA A;  1TKZ A;  1BWF O;  3DXK A;  4AHC A;  5BRF A;  3LP3 A;  3RMC A;  4A5A A;  3TU5 A;  5J1E A;  4C23 A;  3WXL A;  5AQO A;  3LZJ A;  4B9Q A;  1Q7Y O;  1JLQ A;  3HP9 A;  3ZT2 A;  1DTT A;  2NLX A;  2F7T A;  3GBT A;  3HBT A;  2NRX A;  5AQG A;  3ZT3 A;  4WYB A;  3CI5 A;  4AHT A;  4FXD A;  5AQV A;  4M3U A;  3K5N A;  3S3M A;  3FZF A;  1NNE A;  3OYC A;  3SQ0 A;  4FJ9 A;  1NGC A;  2Q0R A;  4HUG A;  1TK8 A;  2PYL A;  4GV3 A;  4Q0B A;  4GKJ K;  2ZE2 A;  2WUS A;  1B9F A;  4X64 K;  5AQR A;  1RGI A;  3ZT0 A;  4KRE A;  4AF1 A;  4FJM A;  2NRZ A;  3EKS A;  5BRD A;  3E9L A;  3OBY A;  3VES A;  5HRR A;  1LV5 A;  2FLO A;  1VQP N;  3CQ8 A;  3OVN A;  4HTU A;  1TUU A;  5K14 A;  1SV5 A;  4JK8 A;  4FL9 A;  4A61 A;  4I9L A;  5H1S Q;  4H0O A;  1KLM A;  1WNS A;  4B1Y B;  4Y0W A;  2F8S A;  1RNH A;  3AVJ A;  5KPZ A;  1RDW X;  1ZC6 A;  3T1A A;  4NYN A;  4LF6 K;  4I2Q A;  1RT4 A;  1TVR A;  4M7Y A;  3WXJ A;  5C0Y A;  4BRF A;  3KKS A;  3P4I A;  2NUB A;  5FPM A;  4EIA A;  4KI4 A;  5KI6 A;  4BRQ A;  2ZF5 O;  3T1H K;  3AO1 A;  4F2S A;  3SUO A;  1IO2 A;  1S5J A;  3AGR A;  4CJW A;  2YKN A;  2O8E A;  4IG3 A;  5MLC Q;  4YOX A;  4PY5 A;  1KD1 O;  3DAW A;  1RDA A;  5F0X A;  4GMJ B;  4DTN A;  4CJ5 A;  2PAV A;  4JD2 B;  1NK0 A;  1NGI A;  4IJN A;  3CC7 N;  2DPN A;  2GEM A;  5DM7 L;  2FBY A;  4DS5 A;  4X65 K;  5CR4 A;  3KTQ A;  1UA0 A;  1ZBL A;  1ASW A;  4HUE A;  3K58 A;  3K9K A;  1OKJ A;  3IS9 A;  3G4S N;  2OZS A;  2E20 A;  3FZL A;  2OA8 A;  5TKW A;  3G6E N;  4B9U A;  5ADX A;  5CZ1 A;  4YOU A;  2FC0 A;  4FK0 A;  3QNN A;  1ITG A;  2P9N A;  2ITG A;  3CXC M;  5KGX A;  4A2B A;  2FBV A;  3J7Z O;  4KHW A;  4B1V A;  1S1X A;  4FJG A;  4FO0 A;  2JWL A;  3D2F B;  4LF5 K;  3TAE A;  3QEP A;  3M3Z A;  1KC8 O;  4OX9 K;  5DMR A;  4LSN A;  5EX5 A;  1EP4 A;  3FLC O;  1QQM A;  3O4W A;  2KW4 A;  2HHU A;  4DQR A;  4DSE A;  1I3A A;  3LP1 A;  1EQY A;  4LH4 A;  3SCX A;  3VN5 A;  3MCA B;  4OJR A;  1YAG A;  4QS7 A;  4UY8 O;  1V4S A;  4YDU C;  3VGM A;  4LSL A;  3NF6 A;  4H5T A;  2HNY A;  3LP2 A;  4WFB L;  1VQM N;  2JGU A;  4PQU A;  3HJF A;  3BP8 A;  4B3M K;  3UE5 A;  1NK9 A;  3V81 A;  1NK7 A;  5KRS A;  1ZBS A;  4LF7 K;  3DMJ A;  4CIE A;  1RDB A;  2GV9 A;  3J81 O;  4H5W A;  4H4O A;  4RW7 A;  3C95 A;  4CED A;  3WNE A;  4FW1 A;  4M3R A;  4DFJ A;  2P9I A;  3CCV N;  4ID5 A;  1DTQ A;  4EAH D;  4CF9 A;  4FVU A;  3TAB A;  3DXM B;  3VQA A;  5FRM A;  2KTQ A;  1WUA A;  4LF9 K;  5M1K A;  4ELU A;  1K73 O;  3PX6 A;  4PA1 A;  1UA1 A;  3I8B A;  4K25 A;  1EWQ A;  2ZJQ L;  1BU6 O;  5C15 A;  1IJJ A;  4LC9 B;  1B9D A;  4BC3 A;  3SZ2 A;  1S1U A;  4B3S K;  4B9N A;  1C0U A;  4CJK A;  4DHY A;  4E1J A;  1XMQ K;  4JKE A;  5E41 A;  3GOI A;  4BQZ A;  3VQB A;  3WNG A;  1HYZ A;  5BN9 A;  3ZYY X;  5BR8 K;  1LOT B;  1Z6R A;  2QA4 N;  4FWM A;  1IBM K;  4BC4 A;  3E1Y A;  4FM0 A;  3CJ7 A;  3CJB A;  4F2R A;  3SJH A;  2HHH K;  4PKI A;  2XO7 A;  3DXK B;  1HX1 A;  4KPY A;  4CJP A;  4YDU A;  4FJN A;  3A5M C;  4J2B A;  1XHX A;  4OPA A;  5FRN A;  5A2Q O;  2QWN A;  4CHP A;  1ZYQ A;  1FKP A;  4XH5 A;  4H0X B;  4ID1 A;  1OVQ A;  3LAL A;  4JKC A;  1YJ9 N;  1KFD A;  2HW3 A;  2PZS A;  4LFC K;  3QO9 A;  3V4I A;  1VHX A;  3R1X A;  4KHN A;  3EL2 A;  5FPD A;  2RE2 A;  3VGL A;  3TTC A;  4J2D A;  3THW B;  2YHB A;  4PKH A;  5LY3 A;  2NRR A;  4FJX A;  2V52 B;  1X3N A;  4W5O A;  3K5O A;  1WOQ A;  1N36 K;  2OPS A;  3A5N C;  4DWI A;  1LWC A;  1UAX A;  1VRT A;  3VF4 A;  3VEO A;  4IFY A;  1U6Z A;  2ATQ A;  3ZSO A;  4NCG A;  3EYZ A;  3NF9 A;  4BVO A;  1U4B A;  3LPU A;  3AA2 A;  1RBT A;  2W42 A;  2O8F A;  3KJV A;  1T8E A;  1W9H A;  4HCB A;  5GAG P;  1YVN A;  2IAJ A;  1JLG A;  3H45 C;  1ATS A;  3PY8 A;  2XRI A;  3DI6 A;  3U9D A;  1QSL A;  4M3X A;  2D0P A;  1N33 K;  2Y1I A;  2QWM A;  4B3R K;  4A57 A;  4BR4 A;  1G99 A;  5I42 A;  1GLL O;  2E1Z A;  3MN5 A;  4CEF A;  1BIS A;  4YOT A;  3I0R A;  1JLE A;  4DR4 K;  4DTP A;  1K8K A;  5J2Q A;  4BRM A;  1C0M A;  1RT2 A;  4FK2 A;  3NBP A;  3H3O B;  4CZG A;  1K9M O;  3CPW M;  1W97 L;  3JS6 A;  2GTD A;  4FLV A;  3U3G A;  2O8E B;  1E4G T;  2QM1 A;  5AQK A;  2HB5 A;  3T69 A;  3VQC A;  4HHT A;  3OJS A;  1TGO A;  4CF1 A;  4CJ4 A;  2HF3 A;  1X3M A;  1X1P A;  4KI6 A;  3V9X A;  4FJK A;  3CFP A;  2BTF A;  2YX6 A;  1P8Z A;  1C1B A;  1QQN A;  3AVN A;  2BGG A;  2YV0 X;  4KH4 A;  3SQ2 A;  4AHR A;  2VGM A;  3O6W A;  4CZM A;  3LWL A;  5AQH A;  5JS2 A;  2P5O A;  3O9Q A;  4JI0 K;  5HRN A;  2YJE A;  2E2N A;  4BGA A;  4FLT A;  5JVG L;  4DF8 A;  3LDS A;  3RSE A;  4C8L A;  4DV4 K;  1ZXO A;  4ZHR A;  1VAZ A;  5AQY A;  4YFU A;  1B92 A;  4AHV A;  1LW2 A;  1K6Y A;  4GNI A;  4BRA A;  1NWK A;  4E19 A;  4M45 A;  3QFP A;  1GOC A;  1KXP A;  2Z1H A;  4DQQ A;  3VTH A;  2F8T A;  2Z1G A;  3JAM O;  4BRD A;  1JLC A;  4CJQ A;  2GWK A;  1U2V A;  1NGD A;  4E7H A;  5FDL A;  3HSC A;  3J80 O;  3SI6 A;  1JLF A;  2KHO A;  4Z4H A;  1JJ2 M;  4B08 A;  4EZ6 A;  3O5B A;  2KZZ A;  3HVR A;  3VQE A;  1EO1 A;  4BRC A;  3L8B A;  4DU1 A;  1CZB A;  4BGB A;  1N32 K;  3TR8 A;  3RMD A;  4DSL A;  4LF8 K;  3IFR A;  5AQP A;  2RN2 A;  3LDP A;  2UYT A;  1S9G A;  4RW6 A;  2FF6 A;  2P9I B;  4O4G A;  3HPG A;  2KFN A;  3HRG A;  3CC2 N;  3CC4 N;  2HVI A;  3L2W A;  3K2P A;  3C6U A;  3O3F A;  2WC9 A;  4DV0 K;  2YKM A;  3R8E A;  3L2U A;  3GL1 A;  2VWB A;  3HI0 A;  3ZX2 A;  2G8H A;  3QML A;  3AAQ A;  4CEC A;  2XHB A;  1S6Q A;  2ZD1 A;  3THY A;  1TK0 A;  3ZET A;  1XC3 A;  4YY3 K;  4C8K A;  4CFC A;  4CGI A;  3CM5 A;  4DMN A;  5KQD A;  3L4I A;  3FR0 A;  1FJG K;  4ELV A;  1X9S A;  4Y1C A;  2ZGY A;  1U45 A;  3I56 N;  5C2F A;  5JLH A;  1OH5 A;  2QI2 A;  3SMS A;  3F9M A;  3SQ1 A;  1VQN N;  2FSN A;  5BRE A;  4CJS A;  4B1U B;  1BI4 A;  3R6M A;  2QWP A;  3LWM A;  2W41 A;  1NOZ A;  2KKZ A;  1RTI A;  4JLH A;  1T03 A;  4FK4 A;  4N76 A;  4JS4 A;  3AA4 A;  5GIP A;  3C6A A;  3EO3 A;  4BE1 A;  5F2R A;  3O1B A;  3MXM A;  3VQ4 A;  1QTM A;  1EX4 A;  1TUY A;  3KK7 A;  3CM6 A;  3K5L A;  4WFN L;  1S1V A;  3CQX A;  2Y1J A;  5C2D A;  1QVG M;  1SL1 A;  1HPZ A;  4CZK A;  4JK9 A;  1NJW A;  2UUB K;  1HKC A;  3VOV A;  3RMA A;  3G25 A;  4JKA A;  5JMV A;  1SS6 A;  3TAN A;  1MA9 B;  2QXL A;  1VQ4 N;  3HP6 A;  3PLA A;  3WQT A;  2ZM6 K;  4ELT A;  3HM8 A;  3EZW A;  3J8A A;  5GAH P;  3M8P A;  5AQL A;  3BZK A;  4CJE A;  3DLE A;  4FW2 A;  4BWJ A;  3ENH A;  1TAQ A;  2Z1I A;  2OTL N;  4NYF A;  1JXE A;  4ILH A;  3PIO L;  1NK5 A;  3OYM A;  2O4I A;  3IKM A;  3CJA A;  3ISN C;  2E8A A;  4JKF A;  1JCE A;  1KLN A;  3MK6 A;  4MQ3 A;  2YHA A;  3IDH A;  1J5E K;  1TV6 A;  3M8S A;  1RIL A;  2DY4 A;  3M8R A;  1SZ2 A;  4BRE A;  1K8K B;  2HND A;  3T7Z A;  2E5L K;  2YHY A;  4MLE A;  3CCS N;  1YT3 A;  3PX0 A;  2IC3 A;  4HVJ A;  3H08 A;  4GV9 A;  3H3N O;  2OPP A;  5EOY A;  3P5J A;  4JNE A;  4DCH A;  3HO1 A;  3HYF A;  4CF2 A;  4Z4C A;  4FOE A;  5BR9 A;  2G8F A;  1X9J A;  3O1W A;  3U4L A;  3KKR A;  1BO5 O;  3C94 A;  2NRH A;  1S22 A;  2PBD A;  4CK2 A;  1W7A A;  1OVY A;  1K8A O;  5IWA K;  1CZA N;  4FJ8 A;  2E2Q A;  3AAR A;  3AVA A;  3DRR A;  4FWP A;  3THW A;  1SL0 A;  2HHV A;  4CE9 A;  1IKW A;  4DR1 K;  3K57 A;  3OYI A;  2ASO A;  4BQL A;  5AQZ A;  3OYJ A;  1XHZ A;  3NGZ A;  3NH2 A;  3I8D A;  3F5T A;  4DSK A;  3OS2 A;  2CGJ A;  1U48 A;  3I0S A;  5AQU A;  1W0H A;  4FWO A;  3RSE B;  2E2O A;  3AO5 A;  1QQO A;  1HKG A;  4M3Z A;  4CHY A;  4M7X A;  1RDD A;  5CE3 A;  1U47 A;  3TTD A;  4YOR A;  3CER A;  4JN4 A;  4DV3 K;  2P9K A;  2V7Z A;  3OS1 A;  1NGF A;  3T1Y K;  4NO7 A;  3H1V X;  3RTV A;  2YI1 A;  1NMN A;  1N8R O;  3PO4 A;  2PFU A;  1EWR A;  3BUZ B;  2VWJ A;  4JYA K;  1U2V B;  4LY7 A;  3A0I X;  4E3S A;  4FWS A;  4B3T K;  3ATV A;  1EXQ A;  2QKB A;  3VA0 A;  4JI1 K;  3OHR A;  2CGL A;  5FPN A;  1L3V A;  1NGH A;  4EHU A;  3O4Q A;  5HL7 L;  2FXU A;  1YIT N;  3VQ6 A;  4E1M A;  3NGY A;  4BC5 A;  3MX2 A;  3DYA A;  5CHI A;  4RW9 A;  4OPJ A;  2HHW A;  4CEB A;  1GLJ O;  1VSF A;  1WAJ A;  3D6R A;  4CIF A;  3VPZ A;  4DTX A;  4JI8 K;  2Z1J A;  3EE9 A;  2AA4 A;  4I6M A;  3HOS A;  4CK1 A;  5DM6 L;  3CCU N;  4L3Q A;  4E1N A;  1QSY A;  1IKV A;  1QVF M;  2QXF A;  1VK0 A;  1Y97 A;  1NJX A;  3D45 A;  1HRH A;  2ZQB A;  3THY B;  3ZET B;  3MN9 A;  2OZM A;  3H6E A;  2IGI A;  4W5Q A;  1NJY A;  2XY7 A;  3PO5 A;  4CD3 A;  2FSJ A;  3P38 A;  1NOY A;  2RPI A;  3P83 D;  3L2Q A;  1XC9 A;  1Z26 A;  4YOW A;  2QWR A;  3M8Q A;  2QW9 A;  2HHS A;  2IIR A;  4KV8 A;  4BDY A;  3AAP A;  4DFP A;  4V19 S;  2HBM A;  5GAE P;  3ZSY A;  3OJU A;  4WE1 A;  1IKY A;  2I5J A;  3AO3 A;  4Z94 A;  1M90 O;  1BI4 B;  4H0V B;  2ITM A;  4E7I A;  4OLA A;  2CH5 A;  3RRH A;  2WOM A;  3L4Q A;  4Y1D A;  5KGW A;  1RTD A;  3SAG A;  5AQF A;  4FPB A;  1QSS A;  1D8Y A;  4GY2 B;  4CGJ A;  1H1V A;  1JL1 A;  2VWK A;  3S9H A;  1TKD A;  3NVM A;  1D4X A;  1BOT O;  1BGX T;  3PV8 A;  3TAG A;  4CFB A;  1T6C A;  2QTD A;  2RKI A;  5AZI A;  5BPN A;  3J7Y P;  5CYM A;  4KO0 A;  1Q82 O;  4CGD A;  2B6A A;  4DUZ K;  4C8N A;  1BIU A;  4RW8 A;  1VQ5 N;  4O0J A;  4W5T A;  1JCF A;  3CMA N;  3V1O A;  4ISG A;  1VQ6 N;  3CJ1 A;  5SZT A;  2A40 A;  2QWO A;  3SYZ A;  3OYN A;  1LAV A;  4CJ3 A;  2QWL A;  4JK7 A;  2KQ2 A;  3ZEU B;  3P39 A;  2F4V K;  1RTJ A;  3HZ6 A;  3OYF A;  4U67 L;  4BRG A;  5IT9 O;  5LMN K;  4CZI A;  5AQS A;  4B9T A;  3A5O C;  2I7N A;  1VSL A;  3KK3 A;  4I9Q A;  3LAM A;  4FJJ A;  3TI0 A;  1RBS A;  3E66 A;  3ALY A;  2JWK A;  2OPR A;  1YJW N;  4FLW A;  4N47 A;  1EKE A;  1VSI A;  4IZ9 A;  3K0S A;  4J2E A;  3CET A;  2KZM A;  3K5M A;  1KCF A;  2WTU A;  1KSP A;  4FLU A;  1IBL K;  4DQP A;  5B8H A;  5JIC A;  3DRS A;  3LDO A;  3MEG A;  3R9P A;  2A5X A;  3V9S A;  2UXB K;  1SKS A;  1YTU A;  1KRP A;  1IG9 A;  5AFU H;  3AVB A;  3MEE A;  3FZK A;  4LFA K;  2E4L A;  5FPE A;  3RRG A;  3CCE N;  1Z05 A;  4B9S A;  3N4Q A;  1WSF A;  1J9A A;  4OLB A;  1BA1 A;  1IBK K;  5EY4 A;  4CEE A;  4CJ7 A;  3VQ8 A;  3T3F A;  1CXQ A;  4Z4F A;  5M1P A;  3CG7 A;  1GLE G;  4M41 A;  1TKX A;  4BC2 A;  1HMV A;  3DOK A;  2X78 A;  5ELZ A;  2P5G A;  3DM2 A;  2UXD K;  2IOC A;  4FCY A;  4FYD A;  4J2A A;  4PL8 A;  3QIO A;  3ZCM A;  3AVM A;  3BGR A;  4FWQ A;  4IKF A;  4FWL A;  1Q86 O;  3DLB A;  1WSG A;  3HOT A;  5LMU K;  4IOA L;  4JI2 K;  1T7P A;  3NF7 A;  3ZT1 A;  3QEX A;  2HMI A;  3TAQ A;  4KH6 A;  4AM7 A;  1N6Q A;  4PL7 A;  2G8W A;  1RDU A;  3NH1 A;  1RCH A;  4BR5 A;  2VG5 A;  3AO2 A;  3ULD A;  4CF0 A;  2HMP A;  4B3O A;  2P9U A;  2P9K B;  3CD6 N;  4FJH A;  3CHW A;  3D2E A;  4N56 A;  3OYD A;  5E84 A;  1YVU A;  1G15 A;  2KFZ A;  4DTR A;  4KHY A;  5SWM A;  2D0A A;  4EZ9 A;  1VSD A;  4CFA A;  4NCA A;  4M3T A;  1OH6 A;  3PSF A;  3QEV A;  4WFA L;  1NGG A;  1T05 A;  1TL3 A;  1FXX A;  1HQU A;  4M63 C;  2YNG A;  4KFB A;  2DFF A;  1ZBU A;  1HNI A;  2DTU A;  5HRP A;  3MN6 A;  1I94 K;  3A8Y A;  3I33 A;  4JI4 K;  3BZC A;  3T19 A;  2FSK A;  4BE0 A;  2HOE A;  4BRO A;  3ZSV A;  1WLJ A;  1NKE A;  5I3U A;  4FZX C;  3KVG A;  4FJ5 A;  3Q7C A;  4I6M B;  1BL3 A;  1S1T A;  3VQ5 A;  4LD0 A;  4WQ5 C;  3NF8 A;  1HYV A;  3CCR N;  3MXI A;  4FZY A;  4PWD A;  4RWT A;  1I39 A;  1BCO A;  1HPM A;  1NBW A;  3AVF A;  1RFQ A;  3CPE A;  4FWN A;  4OKK A;  4DSF A;  1T3V A;  3AVH A;  4EHT A;  4E89 A;  2GBZ A;  3VF6 A;  3IAY A;  4JI3 K;  4DS4 A;  3J7A P;  3O4N A;  3VF2 A;  4BG9 A;  4XH1 A;  4N41 A;  3JYT A;  4AH9 A;  3EY1 A;  2YHX A;  4M3Y A;  3L2R A;  4WCE L;  3AVC A;  2YNF A;  2OPQ A;  2R7Y A;  4XH4 A;  2B5J A;  4CES A;  3LAK A;  4CJU A;  3OY9 A;  3OYB A;  1NK6 A;  4CEA A;  2VGN A;  3SAF A;  2W40 A;  4FLX A;  3KZB A;  4XEI A;  3U3Y A;  1JLA A;  2D1K A;  3CFR A;  4FJI A;  3WXM B;  4GV6 A;  2P9P A;  1D5A A;  4LF4 K;  2IVP A;  3MN7 A;  4N5S A;  1FW6 A;  3MDQ A;  3CCM N;  1VQO N;  5AZI B;  2EHG A;  1BDG A;  1HQE A;  3DLL L;  2GEL A;  3FZH A;  1S72 N;  4HWI A;  4BRK A;  2QK9 A;  1GLC G;  3OYH A;  4DU4 A;  4G9Z A;  3QLH A;  4DR2 K;  2UU9 K;  4JHD A;  1L5U A;  2G8V A;  3Q7B A;  2ASM A;  3VEV A;  4W5R A;  1V4T A;  5GIO A;  4WQ5 A;  4DV6 K;  3QIC A;  5KPR A;  3TPQ A;  4H03 B;  3AGK A;  1QHA A;  1VQL N;  3H1Q A;  1BQM A;  1TYQ A;  5LL6 Z;  3NVK A;  4ISE A;  4CZL A;  4X66 K;  4CJT A;  3VER A;  1E3M A;  3EEQ A;  4BR0 A;  4JI6 K;  2CH6 A;  3QET A;  4QS9 A;  1GOA A;  3O8M A;  3VET A;  4K8X A;  4CZJ A;  5KTQ A;  4DV7 K;  4KHU A;  4OKJ A;  1IG8 A;  2XY5 A;  3H46 O;  3PSI A;  4Z4G A;  4GW6 A;  3FFK B;  3ZSW A;  4H5R A;  3AVK A;  5CY4 A;  5ADX H;  1HUX A;  4FM2 A;  3IMX A;  3LPT A;  4NCB A;  1YJN N;  4QOZ B;  2OCE A;  4WF9 L;  2A1R A;  3SNN A;  3F9K A;  3WXI A;  1XUP O;  4OPK A;  3VQD A;  3S41 A;  2IDO A;  1GLB G;  3N4P A;  4O44 A;  3ZSX A;  3ZSQ A;  3WEE B;  4UQG A;  3HST B;  4AIL C;  3OA9 A;  1X9W A;  3CIP A;  4E7J A;  3MMV A;  4JV5 K;  3S3O A;  2OTJ N;  4E0D A;  3ID8 A;  3VA3 A;  3HT3 A;  3LP0 A;  3CYM A;  4B1W B;  4CBW A;  3U9Z A;  3O9T A;  1WSJ A;  3M1F A;  4KAZ A;  5C10 A;  3ZEU A;  2J4R A;  3B8A X;  5AQQ A;  5KRT A;  1HJO A;  2UUA K;  1Z25 A;  3SBT A;  5C12 A;  3P31 A;  3ITH A;  4BWM A;  3HXM A;  2AP1 A;  2RF2 A;  4Z4I A;  1LWF A;  3AVG A;  1JLB A;  3M6G A;  2NNW A;  3L6Q A;  4XIU A;  2P9U B;  2BH1 A;  3SBG A;  3CME N;  2A3Z A;  3UKR A;  1HNZ K;  5AQI A;  3K59 A;  3D2E B;  4KHS A;  1HJR A;  1IV0 A;  1L3S A;  3O9S A;  2EX3 A;  4KKO A;  4BRP A;  1C0G A;  4H0P A;  5AZJ A;  3B6O A;  2GX9 A;  5HRO A;  1HLU A;  1NM1 A;  2QEX N;  4L8R B;  3GE1 A;  4IEE A;  3SAH A;  1TK5 A;  1VSJ A;  4CZH A;  1RDC A;  2O8D B;  5M1Q A;  3KK1 A;  2F9W A;  2LSN A;  4CEQ A;  4LH5 A;  4FJL A;  3KLE A;  4CF8 A;  1C1A A;  4ZTF A;  4Z4E A;  4MFB A;  3LAN A;  3KK2 A;  1GOB A;  3MX5 A;  3KLF A;  4CHQ A;  3MED A;  1W2B M;  4BE2 A;  4DU3 A;  4OGC A;  2KLA A;  4DR7 K;  4QCL A;  3DLR A;  4IO8 A;  4PKG A;  4R5P A;  3QB0 A;  3C0B A;  4O5B A;  3NGI A;  3VGK A;  2VG7 A;  2EWS A;  1KAX A;  3O3H A;  4F3O A;  1ATN A;  2V7Y A;  3NHG A;  3OW2 M;  3O9R A;  2Q3S A;  5M1O A;  4DQ8 A;  1SKW A;  1KQS M;  4AQY K;  4NB4 A;  4BRN A;  2E1Y A;  3UKU A;  3O9U A;  1VSK A;  1U04 A;  1BHL A;  4DTS A;  3KLG A;  4C8O A;  3LDQ A;  5KQ8 A;  3TAF A;  4DSJ A;  3GDQ A;  3SV4 A;  1R0A A;  1QHT A;  3V9Z A;  3SJJ A;  3ENO A;  3VMF B;  2B4J A;  1JCG A;  5CZ2 A;  4K43 A;  3M5R A;  1L3U A;  3KWI A;  1Q18 A;  1WAF A;  3L3V A;  4KTW A;  1RT1 A;  2QWQ A;  1NGJ A;  3W0L A;  2WON A;  1MWK A;  3V9W A;  3VQ9 A;  3CJ9 A;  4CIG A;  1IKX A;  2P9P B;  2JLE A;  3QIP A;  3OS0 A;  4IBN A;  3VEW A;  4X62 K;  4AHS A;  5HBM A;  1CLQ A;  1FK9 A;  1GLF O;  4KB0 A;  1WSH A;  4EFH A;  4JHD B;  1VQ7 N;  3NH0 A;  4CW7 B;  5J2M A;  3KLI A;  1Q9Y A;  1LAW A;  2IVN A;  3AO4 A;  3P1G A;  2A42 A;  2P1J A;  3AVI A;  3RMB A;  4RCH A;  3DLH A;  1KVA A;  3ULE A;  4B9V A;  3KHY A;  4IFE A;  3WNH A;  3DLK A;  1TYQ B;  4O0I A;  5HOO A;  4LFB K;  4JS5 A;  2DFH A;  1NU0 A;  3L0Q A;  4IG0 A;  3JSM A;  2D5R A;  3CCQ N;  1ILY A;  2F9T A;  2HBK A;  4DF4 A;  3TAP A;  3ATU A;  1C0T A;  3E9O A;  3LM9 A;  4YOV A;  5LJW A;  2P9S A;  5EXW A;  4IOC L;  1BA0 A;  3OYE A;  4K0K K;  1U49 A;  4JEP A;  4CBX A;  2G8K A;  3AY9 A;  1MWM A;  4O5F A;  4HUF A;  1SUQ A;  3AA5 X;  3E9P A;  1RT6 A;  1QQC A;  1SQK A;  1NJI O;  3AVL A;  4DSI A;  1QE1 A;  2WBN A;  1C1C A;  3MEC A;  1C6V A;  1ASV A;  2A41 A;  3NAE A;  1TL1 A;  2O8C A;  4EP4 A;  4CHO A;  4GVM A;  4CGH A;  4CD1 A;  1ESV A;  3ZX0 A;  2Q0U A;  1J6Z A;  2YNI A;  3C6H A;  3ENB A;  4RW4 A;  4ZTJ A;  5DK5 A;  3DLG A;  1NKC A;  2BE2 A;  3F73 A;  3MCP A;  4BVP A;  1S6P A;  1SAZ A;  3HPH A;  1NJZ A;  1KAZ A;  3MAQ A;  3WXK A;  4B1Z A;  1TKT A;  2AJQ A;  1BUP A;  4RG8 A;  4B8C A;  4CER A;  4CGF A;  3SUN A;  2ZGZ A;  2HF4 A;  1ZBH A;  1TAU A;  3HTV A;  4MDA A;  1FKO A;  3NE6 A;  1DEJ A;  3QDK A;  4CJF A;  4O8K A;  1RBU A;  3MWP A;  5HP1 A;  2FBT A;  1DGK N;  3OYK A;  3HL8 A;  2Q2R A;  5AQX A;  2NRV A;  4H5N A;  3G0Z A;  4IFV A;  1YIJ N;  1J53 A;  4KB1 A;  1HKB A;  1O1W A;  3V9U A;  3QER A;  1XNQ K;  5AQW A;  1RTH A;  4RTF D;  3A2F A;  4IO9 L;  4OO1 J;  4FPA A;  4BRL A;  4F3T A;  3QBW A;  4CZF A;  1Q9X A;  2UUC K;  4B9M A;  1BIZ A;  4DQS A;  2UXC K;  1DKG D;  3JXU A;  2O8B A;  5BPM A;  1DLO A;  3LM2 A;  3DWL A;  4BR2 A;  2GUP A;  1DT9 A;  4JRP A;  3UKR B;  4DUY K;  1OH7 A;  2XY6 A;  3OYL A;  1C0F A;  1QZ5 A;  4B9L A;  4FWR A;  4CGG A;  2ZJP L;  5EVZ A;  4FM1 A;  3FFI A;  1VSM A;  1NKB A;  3NFA A;  1S1W A;  1QZ6 A;  5AZJ B;  4DTM A;  1A5V A;  4FSV A;  3TAM A;  3ZSZ A;  1YHQ N;  1HR0 K;  3BDP A;  5BPL A;  4YOY A;  4H8K A;  1VQ9 N;  1BQN A;  2NRW A;  2P9L A;  1LW0 A;  2A6A A;  4IEI A;  3GG4 A;  3ASM A;  1RBV A;  1YXQ A;  3QBX A;  5JS1 A;  4EP5 A;  3SQ4 A;  3V1R A;  1NK8 A;  2H3G X;  2Q1N A;  5AQT A;  1JKH A;  3MWT A;  3WEE A;  3SK3 A;  5KPT A;  1WSI A;  3THX A;  4IXC A;  3TSU A;  3TSQ A;  4FVM A;  3U6F A;  1VSE A;  4G1Q A;  3BEX A;  3QNO A;  3LL3 A;  2V51 B;  1LCU A;  1RT3 A;  3EE8 A;  1N5Y A;  4K42 A;  2HHQ A;  4C8M A;  2P51 A;  4KHP K;  2HHT A;  4BRH A;  4DFK A;  4A5B A;  3UKU B;  1P90 A;  2D4W A;  3C65 A;  4OVL A;  4AHU A;  1NLV A;  3AV9 A;  1XQS C;  1HNV A;  1VRU A;  2DFE A;  3KLH A;  3ZT4 A;  5C25 A;  3VTI A;  2HBJ A;  3C6T A;  3OYA A;  3V1Q A;  4C1N I;  2GUI A;  4NLC A;  4CJL A;  2CGK A;  3RVC A;  1NG9 A;  2BAN A;  3QEI A;  3OBW A;  3ZX3 A;  3VQ7 A;  4FJ7 A;  1GLA G;  4JKG A;  4ICL A;  2Q31 A;  1O13 A;  4F8R A;  3G71 N;  5D3G A;  4BAC A;  1D9F A;  4GKK K;  4JKH A;  4DV5 K;  2VG6 A;  4JRQ A;  2G8U A;  2ZWH A;  4CEZ A;  4K8Z A;  2OYQ A;  4KHQ A;  4CHN A;  4NXM K;  4KTZ A;  3VEY A;  2O8D A;  1XWL A;  2FBX A;  5EU7 A;  3O08 A;  5BRH A;  4JKB A;  3LZI A;  2IS3 A;  2NRT A;  1L3T A;  2NZT A;  3IG1 A;  4PUO A;  1ZBI A;  4F9O A;  3C7N A;  3HM9 A;  1Y64 A;  5C42 A;  1J5O A;  1S9E A;  3TTF A;  4BRI A;  4KTQ A;  4C1N K;  2E2P A;  5T7B A;  3KIO A;  4WQ4 C;  3HVT A;  2ETJ A;  4CI6 A;  1MU2 A;  3I55 N;  1WBD A;  3CFO A;  3WQU A;  4IOX A;  3ULE B;  4F4K A;  3SMP A;  3ZLJ A;  4ILG B;  1JXB A;  4PHT X;  2GWJ A;  3CJC A;  3R3L A;  1ATR A;  4HTL A;  2X6S A;  2X74 A;  4CBU A;  2E6L A;  4Z0U A;  5F1X A;  3BF3 A;  1Q81 O;  4J8F A;  4B8A B;  3OYG A;  2E6M A;  4OPH A;  1SKR A;  2WFB A;  2P9S B;  4ILJ A;  4IDH A;  5TKY A;  1NK4 A;  2RHK A;  2F96 A;  2HBL A;  4H4M A;  3EN9 A;  3VEZ A;  3K9J A;  4M42 A;  4DR5 K;  4E7K A;  1R59 O;  2XY8 A;  3HPO A;  1HYS A;  3NDK A;  4DB3 A;  3KD1 E;  1QS4 A;  2E88 A;  1T6D A;  2BUP A;  4CJV A;  3IRX A;  5GAD P;  2O8C B;  3A5L C;  4M3W A;  2P9N B;  2YNH A;  4BDZ A;  1N34 K;  4A2A A;  4JI7 K;  1WSE A;  3VEN A;  1KVC A;  4DG1 A;  2HHX A;  2FF3 B;  2OAN A;  4H0T B;  1WN7 A;  5J2P A;  4MO4 A;  3PX4 A;  5I9E B;  4O8U A;  3BY5 A;  4IDK A;  4NXN K;  4KH5 A;  3O3G A;  1YI2 N;  5JVH L;  3WNF A;  5AQJ A;  3UIQ A;  3NCI A;  4FLZ A;  2G8I A;  3PIP L;  1WB9 A;  3CF5 L;  1BG3 A;  5BN8 A;  3TSP A;  4Q5V A;  4KRF A;  1EET A;  5AQM A;  3B6P A;  3ZSR A;  4CVN E;  5HLF A;  4E7L A;  4WQ4 A;  4DFM A;  3V6D A;  3CCJ N;  4W5N A;  3D7E O;  4OGE A;  1ASU A;  3SUQ A;  3TAR A;  1WBB A;  4B1X B;  2PY5 A;  3RWU A;  4CHZ A;  1XNR K;  3G10 A;  4MLH A;  3SPZ A;  2ASP A;  3D0P A;  1YF5 L;  3NMU A;  2VYP A;  4FWK A;  3W3D A;  5M1F A;  2W6L A;  5FLX O;  2O8B B;  4IWV A;  4BY9 C;  3SUP A;  5M1N A;  4JD2 A;  5GIN A;  1REV A;  1CXU A;  1E4F T;  3FE1 A;  5C24 A;  4DTJ A;  3CQY A;  4A62 A;  3QES A;  1CZ9 A;  4R79 A;  3L2V A;  5E26 A;  2Q97 A;  5AFU A; 
#chains in the Genus database with same CATH homology
 1D4X A;  1BOT O;  2QWM A;  2V7Y A;  4GVE A;  4BG8 A;  1T6C A;  1S3X A;  2QTD A;  4A57 A;  1G99 A;  5AZI A;  1NGE A;  4BR4 A;  3O9R A;  3OW2 M;  5M1O A;  4DQ8 A;  5BPN A;  1MDU B;  3ID6 A;  1GLL O;  2E1Z A;  4NB4 A;  4BRN A;  1KQS M;  2E1Y A;  1NGB A;  3MN5 A;  3EKU A;  3UKU A;  1Q82 O;  2Q36 A;  4YOT A;  3O9U A;  4QS8 A;  4A59 A;  1VQ5 N;  1JCF A;  1K8K A;  2P9L B;  3CMA N;  4ISG A;  1VQ6 N;  3CJ1 A;  4BRM A;  2A40 A;  2QWO A;  2D0O A;  3LDQ A;  5KQ8 A;  2QWL A;  4DKW A;  4JK7 A;  3ZEU B;  3GDQ A;  3QFU A;  2IVO A;  3P39 A;  3HZ6 A;  3KWG A;  4U7B A;  4U67 L;  4BRG A;  3H3O B;  4CZI A;  4CZG A;  3D2F A;  3ENO A;  4JAX A;  3SLC A;  5AQS A;  4CZE A;  3VMF B;  1K9M O;  1JCG A;  3CPW M;  1VQK N;  3A5O C;  2I7N A;  3M5R A;  4K43 A;  1W97 L;  3JS6 A;  2GTD A;  1E4G T;  1M1K O;  3KWI A;  1Q18 A;  3E66 A;  2QM1 A;  5AQK A;  3T69 A;  2JWK A;  2QWQ A;  1YJW N;  1NGJ A;  2HF3 A;  3W0L A;  1X3M A;  1MWK A;  3WT0 A;  4IZ9 A;  3CET A;  2VCP A;  5AR0 A;  4AM6 A;  3CJ9 A;  3BF1 A;  2BTF A;  2P9P B;  2YX6 A;  1P8Z A;  3F2K A;  5B8H A;  1NGA A;  1QQN A;  3LDO A;  5JIC A;  3R9P A;  2A5X A;  3CCL N;  3IUC A;  4KH4 A;  3VEW A;  4MO5 A;  5AFU H;  1T44 A;  2VGM A;  3O6W A;  3WUH A;  2YHW A;  4CZM A;  3FZK A;  5AQH A;  3O9Q A;  5FPE A;  2YJE A;  3CCE N;  2E2N A;  1GLF O;  4BGA A;  5JLF A;  2YCH A;  1Z05 A;  4H0Y B;  4EFH A;  3N4Q A;  5AQN A;  4JHD B;  5JVG L;  3VEX A;  1VQ7 N;  3RSE A;  1BA1 A;  5EY4 A;  1ZXO A;  4BR7 A;  1VAZ A;  2IVN A;  3FGU A;  5AQY A;  4CJ7 A;  2A42 A;  4MDB A;  1NMD A;  4KBO A;  3U8X A;  2HST A;  2I7P A;  4GNI A;  4BRA A;  4RCH A;  1NWK A;  4JKG B;  3ULE A;  3DXM A;  3KHY A;  4BR9 A;  4IFE A;  1TYQ B;  5M1P A;  1GLE G;  1VQ8 N;  5HOO A;  3QFP A;  3L0Q A;  4BC2 A;  1KXP A;  4FOI A;  3VTH A;  3CCQ N;  5ELZ A;  1ILY A;  4BRD A;  2F9T A;  2HBK A;  3UB5 A;  3ATU A;  2GWK A;  1U2V A;  1NGD A;  3O80 A;  5LJV A;  4JKD A;  3HSC A;  3E9O A;  2KHO A;  4PL8 A;  3LM9 A;  4YOV A;  1JJ2 M;  3FZM A;  5LJW A;  2P9S A;  4K41 A;  5EXW A;  4IOC L;  1BA0 A;  4FWQ A;  3LDL A;  2YJF A;  5AFU A;  3O5B A;  1EO1 A;  4BRC A;  3LDN A;  4FWL A;  1Q86 O;  3HOT A;  4JEP A;  2ZJR L;  4IOA L;  4CBX A;  3AY9 A;  4BGB A;  1MWM A;  4O5F A;  3E9P A;  4H5V A;  4NLB A;  3DJC A;  1SQK A;  1GLD G;  3C7N B;  1KAY A;  4ISF A;  1NJI O;  3IFR A;  2WBN A;  5AQP A;  3LDP A;  2UYT A;  1YUW A;  4KH6 A;  4AM7 A;  2A41 A;  4PL7 A;  4IJA A;  1RDU A;  2FF6 A;  4BR5 A;  2P9I B;  1BWF O;  3DXK A;  5BRF A;  4CD1 A;  4A5A A;  3TU5 A;  1ESV A;  3ZX0 A;  2Q0U A;  3HRG A;  3CC2 N;  2HMP A;  4C23 A;  3WXL A;  1J6Z A;  5JLH A;  3CC4 N;  5AQO A;  2P9U A;  3C6H A;  3ENB A;  4B9Q A;  1Q7Y O;  2P9K B;  3CD6 N;  2WC9 A;  3MCP A;  4BVP A;  3CHW A;  1SAZ A;  2NLX A;  3D2E A;  3R8E A;  3GL1 A;  2F7T A;  2VWB A;  3HI0 A;  3GBT A;  3HBT A;  5E84 A;  3ZX2 A;  3QML A;  3AAQ A;  2NRX A;  5AQG A;  1KAZ A;  4WYB A;  3CI5 A;  5AQV A;  3WXK A;  3ZET A;  4B1Z A;  1XC3 A;  3FZF A;  1BUP A;  4WFA L;  1NGG A;  1NGC A;  2Q0R A;  4GV3 A;  2ZGZ A;  2HF4 A;  3HTV A;  5KQD A;  4M63 C;  3L4I A;  4MDA A;  1DEJ A;  2WUS A;  3FR0 A;  3QDK A;  4O8K A;  3MWP A;  1DGK N;  2ZGY A;  3I56 N;  2Q2R A;  5AQR A;  5C2F A;  3MN6 A;  1RGI A;  3A8Y A;  5AQX A;  2NRV A;  3I33 A;  4H5N A;  2QI2 A;  4AF1 A;  2NRZ A;  3EKS A;  3SMS A;  5BRD A;  3E9L A;  3F9M A;  3OBY A;  3VES A;  2FSK A;  1YIJ N;  1VQN N;  1HKB A;  2FLO A;  1VQP N;  2FSN A;  5BRE A;  2HOE A;  5AQW A;  4RTF D;  1TUU A;  4IO9 L;  4OO1 J;  4BRO A;  4FPA A;  4BRL A;  3QBW A;  4JK8 A;  4CZF A;  4FL9 A;  4B1U B;  1DKG D;  3JXU A;  3R6M A;  4A61 A;  3KVG A;  5BPM A;  2QWP A;  3LM2 A;  3DWL A;  4BR2 A;  3Q7C A;  2GUP A;  1DT9 A;  2W41 A;  4I6M B;  5H1S Q;  3UKR B;  2KKZ A;  4H0O A;  4B1Y B;  4WQ5 C;  4Y0W A;  3CCR N;  1C0F A;  4RWT A;  1QZ5 A;  1HPM A;  1NBW A;  5GIP A;  3C6A A;  3EO3 A;  5F2R A;  3O1B A;  1RFQ A;  4FWR A;  3CPE A;  2ZJP L;  5EVZ A;  5KPZ A;  1RDW X;  4FWN A;  1TUY A;  1T3V A;  3KK7 A;  1QZ6 A;  5AZJ B;  4EHT A;  1ZC6 A;  4FSV A;  1YHQ N;  4WFN L;  5BPL A;  3VF6 A;  4YOY A;  1VQ9 N;  3CQX A;  4M7Y A;  3WXJ A;  4BRF A;  5C0Y A;  5C2D A;  2NRW A;  3P4I A;  2P9L A;  5FPM A;  4EIA A;  2A6A A;  4IEI A;  4CZK A;  4JK9 A;  1QVG M;  3GG4 A;  3VF2 A;  1HKC A;  4XH1 A;  4BG9 A;  4BRQ A;  3VOV A;  3G25 A;  2ZF5 O;  4JKA A;  2YHX A;  5JMV A;  1SS6 A;  1MA9 B;  4WCE L;  2QXL A;  1VQ4 N;  1YXQ A;  3QBX A;  3WQT A;  3PLA A;  3HM8 A;  3EZW A;  3J8A A;  2H3G X;  3AGR A;  2Q1N A;  5GAH P;  5AQT A;  5AQL A;  5MLC Q;  4YOX A;  4XH4 A;  3MWT A;  1KD1 O;  3DAW A;  3WEE A;  3ENH A;  3SK3 A;  5KPT A;  5F0X A;  2OTL N;  4IXC A;  3TSU A;  3TSQ A;  2PAV A;  4JD2 B;  2VGN A;  3SAF A;  3PIO L;  4ILH A;  2W40 A;  3KZB A;  4XEI A;  1NGI A;  4IJN A;  3CC7 N;  2D1K A;  3WXM B;  2DPN A;  2GEM A;  3IKM A;  4GV6 A;  3BEX A;  2P9P A;  3CJA A;  2E8A A;  5DM7 L;  3LL3 A;  2IVP A;  2V51 B;  1LCU A;  3MN7 A;  4JKF A;  3EE8 A;  4K42 A;  1JCE A;  3MK6 A;  5CR4 A;  3MDQ A;  3CCM N;  1VQO N;  5AZI B;  3IDH A;  1BDG A;  4BRH A;  4A5B A;  3DLL L;  3UKU B;  1P90 A;  2D4W A;  2GEL A;  3C65 A;  3K9K A;  1OKJ A;  1SZ2 A;  3G4S N;  3FZH A;  4BRE A;  1NLV A;  1S72 N;  2E20 A;  3FZL A;  4HWI A;  5TKW A;  1K8K B;  1XQS C;  4BRK A;  5ADX A;  1GLC G;  4YOU A;  3G6E N;  3T7Z A;  2YHY A;  4MLE A;  4G9Z A;  3VTI A;  3CCS N;  2HBJ A;  4JHD A;  2P9N A;  3CXC M;  3Q7B A;  2ASM A;  4A2B A;  4C1N I;  4NLC A;  4GV9 A;  2CGK A;  3H3N O;  3VEV A;  3J7Z O;  1V4T A;  3RVC A;  4B1V A;  5EOY A;  5GIO A;  4WQ5 A;  4FO0 A;  2JWL A;  3D2F B;  3QIC A;  4JNE A;  4DCH A;  5KPR A;  3OBW A;  3ZX3 A;  3TPQ A;  4H03 B;  1GLA G;  3AGK A;  3M3Z A;  4FOE A;  4JKG A;  5BR9 A;  1KC8 O;  1QHA A;  2Q31 A;  1VQL N;  1O13 A;  1X9J A;  1TYQ A;  3H1Q A;  3O1W A;  3U4L A;  5EX5 A;  3FLC O;  3O4W A;  1QQM A;  3G71 N;  3NVK A;  1BO5 O;  2NRH A;  4ISE A;  4CZL A;  4JKH A;  1S22 A;  3VER A;  2PBD A;  1EQY A;  1OVY A;  1K8A O;  1CZA N;  3MCA B;  4BR0 A;  1YAG A;  4QS7 A;  4UY8 O;  1V4S A;  2ZWH A;  2E2Q A;  4YDU C;  3AAR A;  3VGM A;  2CH6 A;  4H5T A;  4FWP A;  4WFB L;  1VQM N;  4QS9 A;  3VEY A;  3BP8 A;  3UE5 A;  3O8M A;  3VET A;  3O08 A;  1ZBS A;  5BRH A;  4CZJ A;  4JKB A;  2ASO A;  4BQL A;  5AQZ A;  2NRT A;  2NZT A;  1IG8 A;  3F5T A;  3H46 O;  2CGJ A;  4F9O A;  3FFK B;  3C7N A;  1Y64 A;  4H5W A;  5AQU A;  4H5R A;  3TTF A;  4FWO A;  4BRI A;  3RSE B;  2E2O A;  4C1N K;  1QQO A;  1HKG A;  5ADX H;  2E2P A;  1HUX A;  4WQ4 C;  2P9I A;  3IMX A;  4M7X A;  3CCV N;  5CE3 A;  4CI6 A;  3TTD A;  3I55 N;  4YOR A;  3CER A;  1YJN N;  4EAH D;  4FVU A;  3WQU A;  4IOX A;  4WF9 L;  4JN4 A;  3ULE B;  3DXM B;  3SMP A;  4ILG B;  2P9K A;  4PHT X;  2V7Z A;  2GWJ A;  1XUP O;  3CJC A;  1NGF A;  3R3L A;  3WXI A;  3S41 A;  4NO7 A;  1WUA A;  3H1V X;  1GLB G;  3N4P A;  5M1K A;  1K73 O;  1ATR A;  4HTL A;  2YI1 A;  3WEE B;  4CBU A;  1N8R O;  2PFU A;  3OA9 A;  3BUZ B;  3I8B A;  3CIP A;  5F1X A;  3BF3 A;  1U2V B;  3MMV A;  4K25 A;  1Q81 O;  4J8F A;  3A0I X;  4FWS A;  2OTJ N;  4OPH A;  3ID8 A;  2WFB A;  2ZJQ L;  1BU6 O;  3ATV A;  1IJJ A;  4LC9 B;  2P9S B;  5C15 A;  4ILJ A;  4B1W B;  4BC3 A;  4CBW A;  4IDH A;  3U9Z A;  3OHR A;  5TKY A;  2RHK A;  3O9T A;  2HBL A;  3M1F A;  2CGL A;  5FPN A;  3EN9 A;  4DHY A;  3ZEU A;  4E1J A;  4JKE A;  3VEZ A;  2J4R A;  1NGH A;  3B8A X;  3GOI A;  3K9J A;  5AQQ A;  5BN9 A;  2FXU A;  3ZYY X;  4BQZ A;  4EHU A;  5HL7 L;  1LOT B;  1HJO A;  1YIT N;  1R59 O;  1Z6R A;  3SBT A;  5C12 A;  2QA4 N;  3P31 A;  4FWM A;  4BC5 A;  4DB3 A;  3MX2 A;  4BC4 A;  3E1Y A;  3CJ7 A;  3CJB A;  5CHI A;  3SJH A;  2E88 A;  1T6D A;  2AP1 A;  1GLJ O;  2BUP A;  4PKI A;  5GAD P;  3A5L C;  2P9N B;  3DXK B;  1HX1 A;  3D6R A;  3M6G A;  3VPZ A;  4YDU A;  5C10 A;  4A2A A;  2NNW A;  3L6Q A;  3A5M C;  3VEN A;  3EE9 A;  2AA4 A;  4OPA A;  2FF3 B;  2OAN A;  2BH1 A;  2P9U B;  4I6M A;  3SBG A;  3CME N;  4H0T B;  3HOS A;  2A3Z A;  4MO4 A;  3UKR A;  5AQI A;  2QWN A;  5DM6 L;  3CCU N;  5I9E B;  4L3Q A;  4XH5 A;  4H0X B;  4O8U A;  3D2E B;  1QVF M;  4KH5 A;  1YI2 N;  5JVH L;  4JKC A;  3O9S A;  5AQJ A;  1YJ9 N;  3ZET B;  3PIP L;  3MN9 A;  3H6E A;  3CF5 L;  1BG3 A;  4BRP A;  1C0G A;  5BN8 A;  4H0P A;  5AZJ A;  3R1X A;  4CD3 A;  2GX9 A;  2FSJ A;  3EL2 A;  3P38 A;  3TSP A;  5FPD A;  5AQM A;  1HLU A;  1NM1 A;  2RE2 A;  3VGL A;  2QEX N;  3GE1 A;  4YOW A;  3TTC A;  2QWR A;  4IEE A;  2QW9 A;  4WQ4 A;  3SAH A;  4CZH A;  3CCJ N;  4PKH A;  5M1Q A;  5LY3 A;  2NRR A;  3D7E O;  2IIR A;  2V52 B;  1X3N A;  2F9W A;  1WOQ A;  3AAP A;  3A5N C;  4B1X B;  2HBM A;  5GAE P;  3VF4 A;  3VEO A;  4MLH A;  1U6Z A;  2ASP A;  1YF5 L;  3NMU A;  2VYP A;  4FWK A;  4BVO A;  3W3D A;  4Z94 A;  1M90 O;  5M1F A;  4H0V B;  2ITM A;  3MX5 A;  4IWV A;  1W2B M;  4BY9 C;  2CH5 A;  5M1N A;  4JD2 A;  2KLA A;  5GIN A;  3L4Q A;  5GAG P;  1YVN A;  1E4F T;  3FE1 A;  4IO8 A;  4PKG A;  3CQY A;  4A62 A;  3H45 C;  3QB0 A;  5AQF A;  3SAG A;  4FPB A;  1ATS A;  3C0B A;  4GY2 B;  4R79 A;  1H1V A;  3VGK A;  2EWS A;  5E26 A;  1KAX A;  3U9D A;  2D0P A;  2Q97 A;  1ATN A;  3NVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...