3KHYA

Crystal structure of a propionate kinase from francisella tularensis subsp. tularensis schu s4
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
384
structure length
384
Chain Sequence
MSEILVLNCGSSSVKFALINPHTSQSLVTGLAENIATKNCKVVFKAEHKIVKYLENGSYKDVFEMLKDFLVENKHLEKIVAIGHRVVHGGQYFSKSVLINADSLEKIKACIALAPLHNPAHIEGIRFCQQIFPELPQVAVFDTAFHQTMPSYIAEYAIPYELTHKHNIRKYGAHGTSHKYVSEQAAKILTQQKANVIVAHLGNGCSITAVVDGKSIDTSMGLTPLDGLVMGTRSGCIDPSIFAYISDNLGWSVTEITNMLNKQSGLLGICGHNDMREVSQLAAKGDSLAKLAIEIFSHRVAKFVASYMIYFNKLDALVFTGGIGENAANIRKNIISKLANLGFMIDHQKNSNSETFINSKNSHNIMVIATNEELMIAQETQNLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Propionate kinase
publication title Crystal Structure of a propionate kinase from Francisella tularensis subsp. tularensis SCHU S4
rcsb
source organism Francisella tularensis subsp. tularensis
total genus 123
structure length 384
sequence length 384
chains with identical sequence B
ec nomenclature ec 2.7.2.-:
pdb deposition date 2009-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3khyA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3khyA02
1LCUA 3ZETB 2IIRA 4HWIA 2QWNA 1NGBA 4XH5A 3A5MC 1XQSC 3U9DA 3JS6A 2ZF5O 5AZJA 3LDNA 1MA9B 2QWRA 3CJCA 4FWPA 3HSCA 4JHDA 1MDUB 3D2EA 1CZAN 3GE1A 4BRKA 1GLLO 2Q1NA 3ULEA 2ASPA 3MN5A 2GWKA 1YAGA 3U4LA 4MLEA 4KBOA 3AAQA 3FE1A 4K42A 4B1XB 1BU6O 4K25A 2D4WA 3TPQA 3M6GA 1DGKN 3MK6A 1X9JA 1MWMA 1SZ2A 3MN7A 1E4GT 3VESA 3FLCO 3U9ZA 1HLUA 4H0YB 4RTFD 5AQLA 4A62A 2Q97A 3ID8A 1YXQA 4GNIA 5KPRA 4NO7A 4BROA 4JNEA 3WXLA 1BA1A 1D4XA 4H5VA 2P9UA 1XC3A 5E26A 5EXWA 4MO4A 4BRGA 1LOTB 5FPNA 4H5RA 4IO8A 1QZ5A 1NLVA 2AA4A 3VEWA 3VEVA 3JXUA 3GDQA 3O5BA 1NGAA 3L0QA 5FPDA 3FGUA 1GLEG 4H0TB 5AQTA 4FWRA 1BA0A 5E84A 5AQQA 3H1QA 4PKGA 2CGKA 2P9KA 3MN9A 2CH5A 4H0PA 4CI6A 3ATUA 5AQJA 1KXPA 2E1ZA 3L6QA 3SMPA 2IVPA 3WQUA 4BRAA 4IJAA 3VEOA 3CHWA 4BREA 1RFQA 5EX5A 5F2RA 2CH6A 3WEEA 3UB5A 2A40A 3QFPA 3DXMB 3DWLA 2I7NA 4RCHA 4A61A 1NGJA 2I7PA 4BRLA 4CZGA 5AQPA 1NGIA 3ZEUA 1HPMA 2E8AA 3O4WA 1WUAA 3ZETA 1OKJA 3J8AA 4DB3A 3DXKB 4M7XA 3VENA 3SLCA 3VF6A 3FZHA 4MO5A 4BGAA 5BN9A 4RWTA 2IVNA 4FO0A 4EHTA 3VERA 4BVOA 4WQ4C 3MN6A 3W0LA 4QS7A 5JLHA 3I8BA 2A41A 3LL3A 3VGMA 2A5XA 5KQDA 4B1VA 2HMPA 4K43A 2E2NA 2HF3A 3WXKA 3CERA 4CZFA 4NB4A 4EHUA 5AQUA 4EAHD 4MLHA 4B1ZA 4BRNA 1J6ZA 2P9NB 1GLAG 1YUWA 2NZTA 1U2VB 1HX1A 2V7YA 3QFUA 2YCHA 2E1YA 2YHXA 2E88A 4B9QA 4H5NA 1G99A 1ESVA 2QWQA 3CJ9A 4M63C 1E4FT 4DCHA 1X3NA 5BPNA 1K8KA 4QS9A 5F1XA 2P9PB 2YI1A 2D1KA 3VPZA 1WOQA 4I6MB 4CJ7A 2P9LB 4BRQA 1NMDA 3H46O 4O5FA 2Q36A 3O08A 3D2FB 5ADXA 2H3GX 5B8HA 4Y0WA 1X3MA 5EOYA 5AQWA 2CGLA 3R9PA 2GTDA 1BO5O 4H0OA 4CZKA 2P9SB 3WUHA 3MMVA 3F9MA 3H3NO 3CETA 3UKRB 4E1JA 3VOVA 4BQZA 5AQIA 4BG9A 1T44A 3M3ZA 2HF4A 1TYQB 2ZWHA 3AAPA 3DJCA 1T6CA 4FSVA 4CZMA 1KAZA 3KVGA 5FPMA 4BRFA 4F9OA 2V7ZA 3QB0A 4PL7A 3QBWA 1RDWX 3W3DA 4WYBA 1NWKA 3EO3A 1GLFO 2P9IB 3CJ7A 4FWQA 1GLDG 1JCGA 3H1VX 5AQRA 3DXMA 1Y64A 3WXJA 1GLJO 2DPNA 3SMSA 5ELZA 4CBUA 1Q18A 3H3OB 5LY3A 1NGDA 3FR0A 3IDHA 2E2QA 2YHWA 3I33A 1HKGA 3A5NC 5TKYA 4CD3A 3HI0A 3DXKA 1C0GA 3KZBA 1EQYA 5BRHA 3O8MA 2NLXA 4J8FA 4BR7A 4EIAA 2NRHA 3FFKB 1R59O 4BR0A 4CD1A 1ATRA 4B1YB 5BR9A 2ZGYA 5AQGA 1DEJA 3O80A 5JLFA 3EL2A 4K41A 5ADXH 1HKBA 2W41A 1NGGA 2ZGZA 4CZIA 3BF3A 4H03B 4WQ4A 3BP8A 2A42A 4FWKA 2FXUA 4IXCA 4Z94A 2ASMA 3EKSA 1V4SA 3LDPA 4BRHA 4BQLA 3FZFA 3A5OC 3GBTA 5AR0A 3CQYA 3GOIA 4L3QA 2YJFA 4FOIA 3C7NB 2F9WA 1QQOA 4FWSA 2FF3B 3BF1A 5AQXA 3RSEB 2P9NA 2PAVA 3CQXA 1U2VA 3WT0A 1S3XA 2W40A 4XH4A 3OHRA 3C0BA 4YDUA 3ENOA 2IVOA 3U8XA 4M7YA 2E2OA 3HTVA 5AQVA 4DQ8A 4H5TA 1V4TA 3G25A 2P9PA 1XUPO 4BC5A 3BEXA 2Q0UA 4DHYA 5BREA 3VEYA 5AQFA 3R6MA 1U6ZA 1C0FA 1QQMA 4IJNA 4HTLA 5AQSA 3IFRA 3CJAA 5AQYA 3D2FA 1NGEA 3HBTA 5BN8A 3MDQA 4BRMA 5EVZA 2FSKA 3QICA 4QS8A 3AY9A 5AZIB 3B8AX 4YDUC 1JCEA 3GG4A 2P9SA 2ITMA 4BRCA 1QHAA 4A2BA 3UKRA 2QWMA 3H45C 3DAWA 2FF6A 3GL1A 1TYQA 3MCPA 2A6AA 4H0XB 4PKHA 3WXIA 4BR2A 1BUPA 4FWLA 1KAXA 1IJJA 1QQNA 3HZ6A 2V51B 5BPLA 3ZX2A 4GY2B 2Q31A 1GLBG 4ISGA 1NBWA 1ZC6A 4B1UB 4BG8A 2GUPA 4IZ9A 2P9IA 3UKUB 3VEXA 5JICA 3FZMA 3WQTA 1BOTO 3ZX3A 5FPEA 3FZLA 1MWKA 2J4RA 2QXLA 3IUCA 3H6EA 3O1BA 4JD2B 3HM8A 4WQ5C 1BWFO 1SQKA 2QWLA 2QWOA 4PKIA 5AFUA 4FPAA 1DKGD 2FSNA 2VWBA 1NGHA 2VYPA 5LJVA 3O1WA 1NGCA 4B1WB 4BC2A 2E20A 3BUZB 5AZJB 2PBDA 1Z6RA 3O6WA 2KHOA 2GEMA 5AQOA 2V52B 4JHDB 4FWNA 4ISEA 3D2EB 3VGKA 1TUYA 2D0OA 4A2AA 3EN9A 1Z05A 3EZWA 3UE5A 3ZX0A 4ISFA 4BRDA 4EFHA 4BR9A 4CZEA 1S22A 3CI5A 3ULEB 4BRIA 3ATVA 1K8KB 1HUXA 1IG8A 2QM1A 5BRFA 2BUPA 2BTFA 3C7NA 3CIPA 3FZKA 2AP1A 4BC4A 1HJOA 3RSEA 1ATNA 1HKCA 3L4IA 4LC9B 2Q2RA 5AQKA 3R8EA 4JN4A 4C23A 3QMLA 3AARA 5I9EB 1P8ZA 3KHYA 5AQZA 3VF4A 5LJWA 4XH1A 1ZXOA 3LM9A 4XEIA 2HOEA 2OANA 2CGJA 3VGLA 2GWJA 3D7EO 2QWPA 2FSJA 2FLOA 5AQMA 2VCPA 3S41A 4CZJA 1BG3A 1GLCG 3CJ1A 1NM1A 4H0VB 2P9UB 4BVPA 4BRPA 1BDGA 3SJHA 4FOEA 5AZIA 5AFUH 3EKUA 4BR4A 4FPBA 2ASOA 3A5LC 3IMXA 2QW9A 3QDKA 3VEZA 4CBXA 4CZLA 5BRDA 5F0XA 5AQHA 2YHYA 3VF2A 1NGFA 3A8YA 1H1VA 3P4IA 4O8KA 2EWSA 3M1FA 5KPTA 5KQ8A 4CBWA 1T6DA 2YJEA 3ENHA 4I6MA 2A3ZA 2P9LA 4PL8A 4CZHA 1QZ6A 4H5WA 4BC3A 4AM6A 4JAXA 2P9KB 3ZEUB 4IWVA 4FWOA 2E2PA 1YVNA 3UKUA 1JCFA 1TUUA 2GELA 3LDLA 3SK3A 4FL9A 5AQNA 4FWMA 5JMVA 5EY4A 4BR5A 1ATSA 3LDQA 2Q0RA 3LDOA 4BGBA 1RGIA 1ZBSA 1KAYA 5BPMA 5CE3A 3WEEB 2F9TA 4JD2A 3VETA 3LM2A 3QBXA 2UYTA 3A0IX 4AM7A 5KPZA 3CJBA 3TU5A 1SAZA 2WUSA 4WQ5A 2D0PA
chains in the Genus database with same CATH superfamily
1NK4A 1WSJA 4HWIA 2OZMA 1NGBA 3JS6A 2ZF5O 5AZJA 3CJCA 4FWPA 1MDUB 1CZAN 1JLAA 4GV6A 4FLWA 4E7IA 3K57A 4F2SA 3PV8A 2X74A 2O8FB 3ULEA 3KLGA 2E5LK 2HHSA 5CYQA 5C2FA 1YAGA 3E1YA 4DFPA 4KBOA 3AAQA 3ISNC 2O8EA 3FE1A 3C6TA 2F8SA 2YNHA 4B1XB 4GV3A 4DF8A 1RT4A 4CIEA 4K25A 3TPQA 4IFVA 2R7YA 1DGKN 4IG0A 3MN7A 5GADP 1XNRK 4IDHA 4CJSA 4FYDA 1RT7A 1RDDA 3D0PA 3L3UA 1HLUA 4OPKA 4H0YB 3THWB 4RTFD 4LF4K 2PFUA 5AQLA 3NHGA 2VQFK 4FW1A 4CF0A 2QEXN 4IDKA 4GNIA 3ASMA 4NO7A 3MCAB 3ALYA 1BA1A 1D4XA 1VQ8N 1XC3A 5E26A 2VG6A 3DRRA 4FLUA 3MEGA 1VSKA 3AVIA 4EZ6A 2AA4A 4HVJA 4CJEA 3KLFA 1YT3A 5FPDA 1IG9A 3FGUA 2HHTA 1P90A 4M3YA 3DLHA 3E9PA 4DV3K 4CI6A 3OTOK 2Z1HA 5C0YA 1B9DA 5JS2A 3L6QA 3CPWM 3WQUA 4BRAA 4CHQA 4BACA 2F7TA 3SQ4A 2HNZA 1WSEA 5F2RA 2A40A 3QFPA 4W5OA 3DWLA 5FRMA 1XWLA 4RCHA 4CZGA 2HHUA 3VQEA 4CECA 3O4WA 4DB3A 3DXKB 4E1NA 4V19S 3VENA 2QA4N 3HM9A 3SLCA 4CIFA 4DR6K 5BN9A 5HLFA 4M3WA 3BZCA 1SKWA 1QTMA 4K8XA 3SCXA 3TABA 1C1CA 4EHTA 3SBTA 4DV1K 3LL3A 2UUCK 3AGRA 4OKEA 4KV8A 2E4LA 5KQDA 5I3UA 2PZSA 2HMPA 1BI4B 2D5RA 4DF4A 4JI6K 1VSIA 3OJSA 4N56A 3RWUA 2HHXA 5AQUA 3WXMB 3SQ0A 1JLCA 2RN2A 1GLAG 5T7BA 1HX1A 3LP1A 3MEEA 2RKIA 4JKGB 4IOXA 4CEFA 2O8BA 3ITHA 3TSPA 1BGXT 1K9MO 5CZ2A 1QSYA 1LWCA 4JS4A 4FJ5A 2B4JA 2P9PB 2B6AA 3VPZA 4CJ4A 4CK2A 2P9LB 3DM2A 1RT3A 4E7JA 4O5FA 3O08A 5EU7A 1ITGA 4Y0WA 3AVGA 2GX9A 1NJIO 3R9PA 4C1NI 3SUOA 1HNWK 3WUHA 3O3GA 1D9DA 4CHZA 4E1JA 4PY5A 4FJLA 1SL0A 3NDKA 1LV5A 4N76A 3N4QA 4HTUA 1C6VA 1T6CA 3ZT3A 3THXA 5DK5A 5C42A 4BRFA 4F9OA 4CF2A 4GKKK 3QBWA 4WYBA 1RT5A 1NWKA 2NNWA 1GLFO 4DTOA 3HSTB 2DPNA 5ELZA 1Q18A 4C8OA 1IBMK 3R3LA 3F9KA 4JKHA 4DU3A 2KZZA 4Z4HA 3LZIA 1QSSA 2UXBK 4J8FA 4BR7A 4EIAA 2NRHA 1R59O 1WN7A 3C6AA 4OPHA 4CD1A 4B1YB 1RT6A 1F21A 1VQNN 4JKAA 3OJUA 3KKRA 4K41A 2OA8A 2FBTA 3K58A 3BF3A 4H03B 5CHIA 3E01A 3BP8A 4FWKA 3EY1A 3HPOA 3TAFA 3VQ7A 4IXCA 4AHUA 4RG8A 4JI4K 3RTVA 3T1AA 3LDPA 4JI1K 5AR0A 3A5OC 1BIUA 3T7ZA 4IO9L 3Q7CA 2FF3B 3G0ZA 3LALA 1VQ9N 2P9NA 5HRNA 4AH9A 2Y1IA 3CQXA 4DV2K 2UUBK 4IOAL 3WT0A 4B8CA 3OYIA 3MECA 3OYFA 2NUBA 2FC0A 2LSNA 4M7YA 3U8XA 3CCVN 3HTVA 5AQVA 1I94K 3P83D 4H5TA 3M8QA 3BEXA 1D8YA 4CEAA 1KLMA 3WNHA 5BREA 2OTJN 4CF1A 4CK3A 3JAMO 5AQFA 5DM7L 3NVMA 4HTLA 3TI0A 1ZBUA 1FKOA 3D2FA 4I2PA 2RE2A 4BRMA 4NLBA 4A5BA 3MXJA 4AILC 3AVCA 3SV4A 5CY4A 1JCEA 2P9SA 5HRSA 4CCHA 3UKRA 3P31A 4FW2A 1NKBA 4DTRA 1EP4A 3OYHA 3WXIA 4PKHA 2XY8A 1KAXA 1S1TA 1VQMN 1WSFA 3IAYA 3L2QA 5M1QA 1VSLA 1NBWA 4WFNL 5LMUK 3CF5L 5JICA 2P9IA 4FK4A 1RBSA 3QLHA 4J2BA 3DRSA 2J4RA 3IUCA 3H6EA 4CHPA 1WBDA 2G8KA 4F2RA 3NCIA 4B9NA 1T3VA 1BWFO 3AO2A 4JK7A 3ZCMA 4KHYA 2VWBA 3JYTA 3BZKA 4AHRA 1NGCA 2O4IA 4BC2A 1RDCA 1Z6RA 5AQOA 3VGKA 3D2EB 1TUYA 1JXBA 4CHNA 4G1QA 5M1OA 4ISFA 4X64K 1ASUA 2O8BB 2P5GA 3CI5A 2PY5A 4O5BA 3TAPA 2QM1A 3LPTA 5TKWA 2YHAA 3K5NA 4NLCA 2AP1A 3IKMA 4BC4A 3TSQA 1HJOA 3HPGA 5A2QO 1N32K 4C23A 3SNNA 3AARA 4C1NK 1KRPA 5AQZA 3F5TA 3OYDA 3VF4A 3LM9A 1VQPN 2UXCK 5JVHL 5LMNK 3VGLA 4JI5K 4CEDA 4HCBA 2QWPA 4C8KA 3QESA 3S41A 3CJ1A 4H0VB 2P9UB 2ZE2A 1BDGA 4FOEA 1U49A 1WNSA 3VEZA 4CZLA 4FLZA 2YHYA 4LD0A 3A8YA 3L3VA 5M1KA 2NRWA 4YY3K 1BQNA 3M1FA 5KPTA 2A1SA 2Z1IA 1T05A 3NAEA 3KLEA 4KHNA 5KRSA 4JV5K 3LWMA 2P9KB 4I2QA 4IWVA 3O9TA 4ILHA 4M3UA 4CJTA 1DTTA 4MFBA 2OPQA 3SK3A 4YNQA 4FL9A 4CJVA 4Z0UA 2IS3A 1N34K 3NVKA 3OS1A 4BR5A 3KJVA 2IDOA 4DTPA 4DG1A 5IWAK 1OH6A 5BPMA 5C25A 1SL1A 4JD2A 1EWRA 4AHVA 4FK0A 1S1WA 3A0IX 4CEZA 1SAZA 4WQ5A 1LCUA 3ZETB 4DTJA 2IIRA 2QWNA 1S1XA 3ZT1A 3A5MC 3LP2A 1XQSC 3LDNA 1MA9B 3O4QA 3AA4A 4JHDA 3MWPA 2VWKA 3SZ2A 1T7PA 4DR1K 4BRKA 3VQ9A 2WTUA 1Y97A 5GAEP 1VQ4N 2Q1NA 5SWMA 3HVRA 1KFSA 2GWKA 3U4LA 5SZTA 2P5OA 4MLEA 4F3OA 4K42A 3HRGA 3AA5X 2VG5A 3KIOA 4DTNA 2D4WA 4DUZK 3MK6A 1BCMA 3AVJA 1SZ2A 3HL8A 4KHQA 4E7LA 3VESA 1OH8A 1NOZA 4GW6A 1FW6A 5BR8K 3O9UA 5C12A 1NK0A 4WE1A 3CYMA 1YXQA 2JWKA 1NJXA 1Q9XA 4B9VA 1VQON 4B9UA 4CJKA 1JXEA 3WXLA 3KK2A 3FFIA 3HP9A 3G10A 4MO4A 4BRGA 5GAHP 1LOTB 2DFFA 1EKEA 1JL1A 4IO8A 4PHTX 5J2MA 2QK9A 3VEWA 3VEVA 3ZSVA 4FZZA 3O5BA 2XY6A 1SKRA 3L0QA 2QTDA 3NFAA 4E3SA 1X9SA 1GLEG 4H0TB 4GMJB 3B6OA 1BISA 5E84A 2ZJRL 5AQQA 3H1QA 4A59A 4PKGA 1XHXA 1KVBA 1RDBA 2CH5A 3ATUA 4DU1A 3LDSA 2NRZA 4W5RA 2E1ZA 4HUEA 1M90O 3LANA 4KTWA 4FJXA 1NKCA 4JKDA 1W2BM 4CJWA 3CHWA 5EX5A 3WEEA 4ILGB 3DXMB 3BDPA 1TAUA 4E0DA 1S9GA 1Q7YO 2I7NA 2I7PA 3ZSOA 4AHTA 1XHZA 4DTSA 3ZEUA 1IO2A 1L3VA 1HRHA 1VAZA 4KH5A 3NGZA 1KFDA 4DQPA 1KC8O 1KVAA 3FZHA 4MO5A 4BGAA 4RWTA 4QCLA 3HVTA 4LFBK 4CGJA 2FBYA 2IVNA 4BVOA 3W0LA 3CC7N 2A41A 1YHQN 4DV4K 4OKJA 5GINA 2X78A 4CEOA 4B3TK 3T1HK 4B1VA 3R1XA 4DS4A 4DSLA 4CJPA 2WONA 3CERA 3T1YK 3P39A 3PO4A 4FLTA 2O8DA 1YUWA 1U2VB 1HMVA 2KW4A 1XMOK 3ZT4A 5FRNA 3QFUA 4FLXA 4WFBL 2YHXA 1XC9A 4DR4K 2QWQA 4FJ9A 1E4FT 5BPNA 1IKXA 3QEIA 4G9ZA 2YI1A 4U7BA 3SAHA 4CJ7A 1NMDA 3H46O 3OYLA 1A5WA 2HBMA 4KB0A 2Q36A 1NU0A 3IRXA 5B8HA 3J80O 5CYMA 1X3MA 5EOYA 4CK1A 4QOZB 3SQ2A 3F9MA 1RBTA 4O55A 1VQ5N 1J5EK 1T44A 3M3ZA 1BQMA 1TYQB 2ZWHA 3OYMA 5J2NA 4KTZA 1VRTA 4CJ3A 1JJ2M 5FPMA 2IGIA 1IV0A 4EZ9A 2V7ZA 1RDWX 3OYGA 4B3SK 2KLAA 3KWIA 4OGEA 5AQRA 3LZJA 2X6SA 1A5VA 4X66K 3TARA 1UA0A 3TTDA 3SMSA 4CBUA 3KTQA 3H3OB 5LY3A 1NGDA 3FR0A 1RT1A 1S5JA 3I33A 4H8KA 3AGKA 3HYFA 4CD3A 3HI0A 1C0GA 3NF7A 1KLNA 3O8MA 3CMEN 1QS4A 2XRIA 4LF6K 1ATRA 5BR9A 2F96A 2ZGYA 3DRPA 3CCEN 4WCEL 4ELTA 5AQGA 1DEJA 4CEEA 4LH5A 3KK1A 2W41A 1NGGA 2ZGZA 4CZIA 1KSPA 2A42A 2FXUA 5HBMA 4Z94A 1V4SA 4CF8A 3CC4N 5M1FA 1RTIA 4BRHA 1J5OA 3GBTA 3P5JA 3L2VA 4F4KA 4KHUA 4FWSA 3BF1A 1W9HA 5AQXA 3RSEB 1CXQA 3RRGA 4H4OA 4XH4A 2KZMA 3C95A 3TANA 3ENOA 3CFPA 1JLEA 4DQ8A 1V4TA 4BC5A 4W5TA 1WSGA 1RTHA 2Q0UA 4DHYA 2Z1GA 4KPYA 3K59A 1IKYA 3R6MA 1U6ZA 2WC9A 4IJNA 5AQSA 1N6QA 3IFRA 4KHWA 1BIZA 1C0UA 3HBTA 1JLFA 4CFDA 2FSKA 3QICA 1GOBA 3QEVA 1RTJA 3GG4A 3LAMA 1BL3A 2ITMA 2UUAK 4LF8K 3MCPA 1JLGA 4BR2A 1K6YA 4FWLA 3DLLL 1QQNA 3HZ6A 4EP5A 3QEWA 5BPLA 2DY4A 2Q31A 1S9EA 4ISGA 2NRRA 4DSJA 3K5MA 4B1UB 3PIOL 3PSFA 1RT2A 4GKJK 2GUPA 4E7KA 4E7HA 1TGOA 3FZMA 3NF6A 1BOTO 1EO1A 3L8BA 4LF9K 4Z4EA 3OS0A 2VWJA 1MWKA 1Z26A 4JKFA 3PY8A 3QO9A 3QNOA 3O1BA 4HCCA 1EETA 5HROA 1ZBHA 1WSIA 3HM8A 1RCHA 1LWEA 1SQKA 1RNHA 5AFUA 4FPAA 2VYPA 3CXCM 4DR7K 3VQ5A 4O8UA 1RDAA 4E89A 1U45A 5AZJB 3BUZB 1NNEA 4QAGA 1O1WA 4FWNA 2HVHA 1VSJA 2HHVA 3RMCA 1NK6A 4BRDA 3TR8A 3ULEB 4BRIA 4YOXA 4FVUA 2HHQA 5HP1A 2O8EB 3C7NA 3QETA 3KK7A 2D0BA 3THVA 1ATNA 4K0KK 4CFBA 2Q2RA 5AQKA 1WLJA 4JN4A 1IH7A 3O9RA 2JWLA 2HNYA 3HOTA 3AA2A 4KFBA 3KWGA 1E3MA 1W97L 3MX5A 4XEIA 4CVNE 2HOEA 2NRTA 1I39A 4CIGA 2GWJA 3D7EO 3CD6N 1RBUA 1YJ9N 5AQMA 4CZJA 2VCPA 1GLCG 2O8CA 1BCOA 5AZIA 5AFUH 3EKUA 5FROA 4FPBA 4ELVA 3QIOA 3V1OA 4CBXA 1RTDA 1NKEA 2Z1JA 5F0XA 5AQHA 1NGFA 1H1VA 4O8KA 1XNQK 2EWSA 1C0TA 5KQ8A 1REVA 1SUQA 1IBKK 5C2DA 4AM6A 3MEDA 3J7ZO 2HBJA 2OCEA 1VK0A 2EHGA 4C8MA 4ELUA 1TK0A 2D0CA 3UKUA 1HJRA 4M3XA 3LDLA 1KVCA 3CCUN 5AQNA 5JMVA 5EY4A 3F2KA 4M42A 1U04A 2Q0RA 3IS9A 3LDOA 3G6EN 1S72N 1KAYA 3VETA 3LAKA 4CFAA 2OYQA 4KI6A 3QBXA 4FM0A 2UYTA 3CJBA 3S3MA 4ZHRA 1ILYA 2WUSA 5KGXA 3DLEA 4JK8A 4DTUA 4KHPK 1VQ6N 5J2PA 1CZ9A 4E1MA 2HSTA 1S1VA 4FJ7A 1TK8A 1QHTA 1K8AO 1FJGK 3GE1A 1CLQA 3MXIA 5HRPA 3C94A 2QI2A 4DTXA 3B6PA 2XO7A 2HVIA 4EP4A 4FZXC 1QSLA 1BU6O 1FKPA 1VQ7N 2YNGA 3EE8A 4CJFA 4CGGA 4C8NA 2BE2A 2ITGA 1E4GT 3O9SA 4BDZA 3FLCO 5CR4A 1ASWA 4IBNA 4KREA 4BY9C 3V81A 4A62A 3ID8A 1NK5A 4CEQA 4RW7A 4NYFA 4JNEA 4W5NA 4O0IA 4H5VA 1HNIA 5EXWA 5DM6L 1LAVA 4H5RA 3DOLA 3SUPA 3V1QA 1NGAA 3K5OA 5AQTA 1Q8IA 3NF8A 3S3NA 4FWRA 5E41A 1QE1A 2A1RA 3SUNA 2YKNA 3VQQA 1T8EA 4U67L 2GUIA 4M3TA 4LY7A 3MN9A 3THXB 3NF9A 4FCYA 3HOSA 4B9TA 1IKVA 5KGWA 1UA1A 3SMPA 4HUGA 2IVPA 3NH1A 2OPRA 3KKSA 4BREA 1N5YA 4ZTFA 4YOVA 4A61A 4OGCA 1NGJA 2AJQA 2F8TA 1NGIA 3P38A 3DLRA 4FZYA 1WUAA 3ZSRA 1QVGM 4LF5K 3J8AA 3SAFA 3V9SA 3VF6A 3MAQA 5KTQA 1U4BA 3QEXA 1SL2A 2JLEA 3AVBA 4FO0A 3E9LA 1IBLK 4B3OA 2GV9A 4WQ4C 2HBKA 2O8FA 5JLHA 3VGMA 4PUOA 3ZT0A 1JKHA 4K43A 2E2NA 1LW0A 3WXKA 4CZFA 4NB4A 1ASVA 4B08A 4MLHA 4B1ZA 2P9NB 3SBGA 2NZTA 3OA9A 4NXMK 3ZSZA 2V7YA 4YHHK 3THWA 2VGMA 2E1YA 1O13A 1VSEA 4H5NA 4GV9A 2JGUA 1G99A 1ESVA 4NYNA 4M63C 3HT3A 3KD5E 3AVMA 4YOYA 1X3NA 4B9MA 4QS9A 5F1XA 2D1KA 3ZYYX 1WOQA 2ATQA 1RILA 4BRQA 1WAFA 3D2FB 4NXNK 5ADXA 3P1GA 2CGLA 1CXUA 4FJ8A 2GTDA 3QEPA 2YNIA 4H0OA 2YX6A 4LH4A 2P9SB 3CCQN 3UKRB 3U3YA 1HNZK 2HNDA 5AQIA 4BG9A 4BQZA 1VQLN 1ZBIA 3TTCA 3NE6A 3DJCA 4CZMA 3LP0A 5AJ3K 3QB0A 3HK2A 3I56N 3RMBA 1EXQA 3W3DA 1T03A 3EO3A 3AO5A 2P9IB 4FWQA 1EX4A 3H1VX 1Y64A 2OPPA 1GLJO 1TL1A 1TAQA 4JKEA 1QVFM 1HYSA 3IDHA 3OYJA 2E2QA 2YHWA 4OPAA 4YFUA 1HKGA 4JEPA 1SS6A 3V1RA 3L2WA 3V9ZA 3DXKA 4IFEA 4CERA 1EQYA 3CQ8A 4DV0K 1ZBLA 1W0HA 2NLXA 4B8AB 4BR0A 1W7AA 4CGIA 1KD1O 3CPEA 3QNNA 2BANA 3MWTA 3EL2A 5JLFA 5ADXH 1HKBA 1J54A 2ASMA 1Q82O 1BI4A 2OZSA 3AVAA 3JSMA 4BQLA 3FZFA 4LSNA 2VG7A 4LSLA 4NCGA 5C15A 2NRVA 4FOIA 2F9WA 1QQOA 3RVCA 1L3TA 2PAVA 1YTUA 1HQUA 3AVFA 4M3ZA 1S3XA 4YDUA 4JKGA 4JI8K 2FBVA 2IVOA 4JRPA 2E2OA 1JLQA 4FM2A 4YORA 2P9PA 1XUPO 3V9UA 3EZ5A 3K9KA 3VEYA 3SYZA 1C0FA 1QQMA 3ZSXA 5JVGL 3ULDA 3CJAA 1B92A 4KO0A 5AQYA 1NGEA 4LF7K 4AHSA 5BN8A 1B9FA 5C24A 3HJFA 3B8AX 2ZJPL 4YDUC 4BRCA 1QHAA 4FJMA 3NMUA 2Q3SA 2QWMA 3H45C 4FLVA 2FF6A 4H0XB 2A6AA 2DFEA 1ZBFA 3KLHA 1UAXA 1KCFA 3F73A 4BE2A 2IC3A 1RBRA 3TAGA 1ZC6A 3ZSWA 4BG8A 2P51A 3K2PA 2KTQA 2GBZA 3VEXA 4JRQA 4N41A 3AVLA 4K8ZA 3WQTA 3ZSYA 3MXMA 2BDPA 1VSHA 4XIUA 3I0RA 4RW6A 3AVHA 2QXLA 4C8LA 4HUFA 3L2RA 4DS5A 3Q7BA 4JD2B 3V6DA 4X65K 1NJWA 2OPSA 2QWOA 2QWLA 4PKIA 4IEIA 3G4SN 1DKGD 4X62K 2FSNA 4MQ3A 5LJVA 4DQQA 3WNGA 4B1WB 1KTQA 2E20A 2E6MA 3DLBA 3DOKA 2KHOA 2GEMA 4DQRA 2V52B 4JHDB 4ISEA 1NG9A 1N33K 4Y1DA 3EN9A 3EZWA 3CM5A 3G71N 4WF9L 3UE5A 4DMNA 3NGYA 4E19A 3SI6A 4EFHA 3U3GA 4OLBA 4CZEA 4BWMA 3L4QA 5HRRA 3PX0A 4DTMA 5BRFA 3CC2N 3KD1E 4DUYK 2HBLA 3FZKA 3OYKA 5CZ1A 3SJJA 2HHWA 1HKCA 3L4IA 4LC9B 4OVLA 4ID5A 4JK9A 5I9EB 3UIQA 5LJWA 3T3FA 4XH1A 4MDBA 1ZXOA 4ID1A 2CGJA 2XY5A 4PA1A 4CF9A 4PQUA 1BG3A 4LFCK 4BVPA 4OO1J 3AO4A 3SJHA 4BR4A 2ASOA 3ZT2A 1I3AA 2P1JA 5BRDA 4RW4A 3VF2A 3HO1A 5I42A 1YTAA 2EX3A 2IAJA 4DLGA 3J7YP 2UU9K 4CBWA 2YJEA 4YOUA 4I6MA 4PL8A 4CZHA 5J2QA 4KRFA 1TL3A 4FVMA 5FLXO 2E2PA 1HNVA 1ZYQA 1JCFA 1TUUA 3HPHA 1CZBA 3DMJA 4A5AA 2GELA 4ZTJA 4FWMA 3EEQA 4DKWA 3OYNA 1ATSA 3LDQA 4DR2K 1TVRA 4BGBA 1RGIA 1ZBSA 3WEEB 3LM2A 4FJIA 4AM7A 3CG7A 4B3RK 1IKWA 4CEBA 3ZEUB 4FJKA 1YI2N 5HL7L 3NBPA 2XHBA 4DV6K 3BY5A 4NCAA 4XH5A 1NMNA 3U9DA 1JL2A 2QWRA 1U48A 3HSCA 4DQSA 3NH2A 4FJJA 3D2EA 4DFMA 1Z25A 4IG3A 1GOCA 3HXMA 4I7FA 4CESA 1GLLO 3U6FA 1EWQA 5K14A 2I5JA 2W6KA 2ASPA 2YNFA 2ZD1A 3VQAA 3MN5A 4UQGA 4DWIA 1VHXA 3T19A 4GVEA 3OBWA 4CJLA 1LW2A 4CHYA 3CMAN 3EE9A 3M6GA 1X9JA 1MWMA 4OKKA 2PYLA 2O8DB 4Y1CA 1HR0K 4JI2K 3CM6A 3K9JA 4JI7K 1S1UA 1LAWA 1C1BA 3U9ZA 3T69A 3L2UA 4KH4A 4CHOA 2Q97A 1TKTA 3CCLN 3CFRA 1SKSA 3OVNA 5KPRA 4O44A 4BROA 1OVQA 3S3OA 1S6QA 3VQBA 2P9UA 4LFAK 3V9XA 5FPNA 5GIOA 4FM1A 1S6PA 1QZ5A 1NLVA 1TKZA 2BGGA 3VQDA 4DU4A 3D6RA 3JXUA 3GDQA 2KKZA 1HPZA 5DMRA 2YV0X 4ICLA 3OW2M 4J2AA 4RW9A 4CJQA 3S9HA 1BA0A 1NJZA 1OH5A 1UWBA 1GOAA 2CGKA 2VGNA 3SAGA 2P9KA 3TAQA 2G8HA 4H0PA 5AQJA 1KXPA 4DFJA 4FLYA 4KAZA 4IJAA 3VEOA 3LPUA 4Z4FA 1RFQA 3WNFA 2CH6A 4M3RA 3UB5A 1DLOA 4JI3K 4IKFA 4BRLA 3AO1A 4KKOA 5AQPA 4J2DA 3M8PA 4WFAL 1HPMA 4OPJA 2E8AA 2F4VK 3ZETA 1OKJA 4M7XA 4BE0A 1C0MA 5FDLA 4IOCL 2OTLN 5M1NA 1OH7A 1RDUA 4KHSA 3VERA 3O3FA 3VTIA 1TV6A 3MN6A 4QS7A 4CGDA 1M1KO 1D5AA 3I8BA 2B5JA 2A5XA 3SQ1A 1FXXA 1FK9A 3M8SA 4I9LA 2HF3A 1A5XA 4EHUA 2D0AA 1NOYA 4EAHD 3OY9A 3PIPL 4BRNA 2E6LA 3EYZA 1J6ZA 1Q81O 1VSDA 2KFNA 3NGIA 3LP3A 3LWLA 5M1PA 3MX2A 1BHLA 2YCHA 2PYJA 2E88A 4B9QA 4KI4A 3CJ9A 1DTQA 5GAGP 4DCHA 1WSHA 1Q9YA 1DT9A 4W5QA 4CE9A 1K8KA 3TTFA 4YOTA 4BWJA 5H1SQ 4FJGA 3VQ6A 4I6MB 4B9LA 5D3GA 4AF1A 4PWDA 3ENBA 2H3GX 3AV9A 2W42A 4DSKA 5AQWA 2HHHK 2WBNA 2YKMA 2RPIA 3CCSN 1BO5O 3VQ4A 3CCMN 4CZKA 3PSIA 2IOCA 3MMVA 5GIPA 3H3NO 3CETA 4JS5A 3VOVA 1HYVA 1X9WA 4BE1A 4HHTA 2HF4A 3AAPA 1HQEA 3VQ8A 4FSVA 2ZM6K 4KTQA 1VQKN 3SPZA 3OS2A 1KAZA 3KVGA 1RBVA 2FBXA 5KI6A 5KRTA 5JS1A 3VN5A 3THYA 4TSXA 1XMQK 3AVNA 3TAMA 4PL7A 3V9WA 4F8RA 3CJ7A 1GLDG 3IG1A 1JCGA 3CFOA 4OJRA 3DXMA 3WXJA 4R79A 4NCBA 1VSMA 4IEEA 1KQSM 1NK9A 3RMAA 4UY8O 2G8FA 4B3MK 1Q86O 2Y1JA 3A5NC 5TKYA 3KZBA 1TKXA 2O4GA 5BRHA 1L5UA 3DLGA 3FFKB 4L8RB 4CJ5A 3AA3A 3RR7A 3O80A 2QKBA 4DV7K 3I55N 1L3SA 5J1EA 4M41A 3C6UA 4WQ4A 4B9SA 4RW8A 1OVYA 1VRUA 3EKSA 1YF5L 3HP6A 3CQYA 3GOIA 4L3QA 2YJFA 1SV5A 3C7NB 1LWFA 1D9FA 1X1PA 3O3HA 3ID6A 1U2VA 3ZLJA 4CJRA 3VA3A 5MLCQ 2W6LA 2W40A 3OHRA 4FJNA 4O0JA 3C0BA 4M45A 4AHCA 1MU2A 2UXDK 4KB1A 1N8RO 3WNEA 3J81O 3PUFA 1NK8A 1R0AA 3I0SA 3G25A 2QXFA 3M5RA 3VQPA 3VA0A 3C65A 3MDQA 3CCJN 1TKDA 2O8CB 2RHKA 5EVZA 4CW7B 4QS8A 3AY9A 1YITN 5AZIB 1WBBA 1XI1A 1J53A 1YIJN 3TAEA 4H4MA 4A2BA 5C10A 1L3UA 3VQCA 3DAWA 3GL1A 2XY7A 1TYQA 2G8UA 4MDAA 4Q5VA 4DSFA 1BUPA 3D45A 4CGFA 1IJJA 2RF2A 3RR8A 2V51B 3ZX2A 4GY2B 4ILJA 1GLBG 1NJYA 2DFHA 3M8RA 4OX9K 2G8WA 4IZ9A 4KH6A 2NRXA 3UKUB 4FJHA 3E9OA 1TK5A 3ZX3A 3I8DA 2VQEK 2ZJQL 3BGRA 3E66A 5FPEA 3FZLA 4A57A 3AVKA 5HOOA 3OYCA 4DV5K 2G8VA 3VTHA 4WQ5C 3K5LA 3TWHA 1NGHA 2BH1A 1YJWN 4DR3K 3DI6A 4N47A 3O1WA 3DYAA 3N4PA 4BDPA 2PBDA 3O6WA 1WB9A 4JKCA 3K0SA 2X6NA 4I9QA 3QIPA 4A2AA 2D0OA 1X9MA 1Z05A 4FXDA 3SPYA 3ZX0A 4JKBA 4BR9A 1S22A 3TSUA 3PX6A 2HMIA 4JI0K 3ATVA 1K8KB 1HUXA 1J9AA 1IG8A 2BUPA 2BTFA 4IFYA 3KLIA 3CIPA 4DSEA 4Z4GA 3RSEA 4AQYK 2YHBA 1HNXK 3R8EA 4Z4CA 4DQIA 3QMLA 1P8ZA 3DLKA 3KHYA 3SV3A 3A2FA 3O9QA 4Z4IA 4J2EA 2G8IA 3RMDA 2ETJA 3PO5A 2OANA 1WAJA 4YOWA 3PLAA 1YVUA 2FSJA 4DFKA 2HW3A 5IT9O 2FLOA 4Q0BA 1JLBA 4R5PA 4DSIA 3QINA 1NM1A 3THYB 1K73O 4BRPA 3ZSQA 3C6HA 1UOCA 3A5LC 3IMXA 4BDYA 2KQ2A 2QW9A 3QDKA 2KFZA 4CFCA 4CJUA 1VSFA 1YJNN 3OBYA 3VMFB 2WFBA 1HYZA 1U47A 3P4IA 1NK7A 3OYAA 1T6DA 4JYAK 3ENHA 4CGHA 2A3ZA 2P9LA 1QZ6A 4H5WA 3OYEA 3QERA 4BC3A 4GVMA 3OYBA 3RRHA 4JLHA 3AO3A 4JAXA 4F3TA 3J7AP 4FWOA 1YVNA 4FK2A 2HB5A 3SUQA 2ZQBA 1C1AA 4N5SA 3KK3A 4DR5K 1N36K 2QKKA 3CCRN 3H08A 4O4GA 5CE3A 5LL6Z 4OLAA 2F9TA 3PX4A 1QQCA 3NH0A 2WOMA 5KPZA 1G15A 3O4NA 4DLEA 3TU5A 2DTUA 2D0PA 3V4IA
chains in the Genus database with same CATH topology
4JK8A 1LCUA 3ZETB 2IIRA 4HWIA 2QWNA 1NGBA 4XH5A 1VQ6N 3A5MC 1XQSC 3U9DA 3JS6A 2ZF5O 5AZJA 2HSTA 1MA9B 2QWRA 3CJCA 3LDNA 3HSCA 4FWPA 4JHDA 1MDUB 3MWPA 3D2EA 1K8AO 1CZAN 3GE1A 4BRKA 4GV6A 5GAEP 1GLLO 1VQ4N 2Q1NA 3ULEA 2ASPA 5C2FA 3MN5A 2GWKA 1YAGA 3E1YA 3U4LA 4MLEA 4KBOA 3AAQA 4GVEA 3FE1A 2QI2A 4K42A 3OBWA 4B1XB 3HRGA 4GV3A 1BU6O 1VQ7N 3CMAN 4K25A 2D4WA 3EE8A 3EE9A 3TPQA 3M6GA 1DGKN 3MK6A 1X9JA 1MWMA 1SZ2A 3MN7A 1E4GT 3O9SA 5GADP 4IDHA 3VESA 3K9JA 3FLCO 5CR4A 3U9ZA 1HLUA 3T69A 4H0YB 4BY9C 4KH4A 4RTFD 2PFUA 5AQLA 4A62A 2Q97A 3CCLN 3ID8A 2QEXN 3O9UA 5C12A 1YXQA 4GNIA 5KPRA 2JWKA 4NO7A 1VQON 4BROA 3MCAB 4JNEA 3WXLA 1BA1A 1D4XA 4H5VA 1VQ8N 2P9UA 1XC3A 5E26A 5EXWA 4MO4A 5DM6L 4BRGA 5GAHP 1LOTB 5FPNA 4PHTX 4H5RA 4IO8A 5GIOA 1QZ5A 1NLVA 2AA4A 3D6RA 3VEWA 3VEVA 3JXUA 3GDQA 3O5BA 2KKZA 1NGAA 3L0QA 2QTDA 5FPDA 3OW2M 3FGUA 1GLEG 4H0TB 5AQTA 4FWRA 1BA0A 1P90A 5E84A 2ZJRL 5AQQA 3H1QA 4A59A 4U67L 4PKGA 2CGKA 2VGNA 3E9PA 3SAGA 2P9KA 3MN9A 2CH5A 4H0PA 4CI6A 3ATUA 5AQJA 3HOSA 5C0YA 1KXPA 2NRZA 2E1ZA 3L6QA 3SMPA 2IVPA 3CPWM 3WQUA 1M90O 4BRAA 4JKDA 1W2BM 2F7TA 4IJAA 3CHWA 3VEOA 4BREA 1RFQA 5EX5A 5F2RA 2CH6A 4ILGB 3WEEA 3UB5A 2A40A 3QFPA 3DXMB 3DWLA 4YOVA 1Q7YO 2I7NA 4RCHA 4A61A 1NGJA 2I7PA 4BRLA 4CZGA 5AQPA 1NGIA 3P38A 3ZEUA 1HPMA 4WFAL 2E8AA 3O4WA 1WUAA 3ZETA 1QVGM 1OKJA 1VAZA 4KH5A 3J8AA 4DB3A 3DXKB 3SAFA 4M7XA 1KQSM 3VENA 2QA4N 1KC8O 3SLCA 3VF6A 3FZHA 4MO5A 4BGAA 5BN9A 4IOCL 4RWTA 2OTLN 5M1NA 1RDUA 2IVNA 4FO0A 3E9LA 4EHTA 3VERA 3VTIA 4BVOA 4WQ4C 2HBKA 3SBTA 3MN6A 3W0LA 4QS7A 5JLHA 1M1KO 3CC7N 3I8BA 2A41A 3LL3A 3VGMA 1YHQN 2A5XA 3AGRA 5GINA 5KQDA 4B1VA 2HMPA 3R1XA 4K43A 2E2NA 2HF3A 3WXKA 3CERA 4CZFA 4NB4A 4EHUA 5AQUA 3WXMB 4MLHA 4EAHD 4B1ZA 3PIPL 4BRNA 3P39A 1J6ZA 1Q81O 2P9NB 1GLAG 1YUWA 3SBGA 2NZTA 1U2VB 3OA9A 1HX1A 5M1PA 2V7YA 3MX2A 3QFUA 2YCHA 2VGMA 2E1YA 4WFBL 2YHXA 2E88A 1O13A 4H5NA 4JKGB 4B9QA 4GV9A 4IOXA 1G99A 1ESVA 2QWQA 3CJ9A 4M63C 3TSPA 1E4FT 4DCHA 5GAGP 1K9MO 4YOYA 1DT9A 1X3NA 5BPNA 1K8KA 3TTFA 4QS9A 4G9ZA 4YOTA 5F1XA 2P9PB 2YI1A 2D1KA 3VPZA 5H1SQ 3ZYYX 4U7BA 3SAHA 1WOQA 4I6MB 4CJ7A 2P9LB 4AF1A 4BRQA 1NMDA 3ENBA 3H46O 2HBMA 4O5FA 4UY8O 2Q36A 3O08A 3D2FB 5ADXA 2H3GX 5B8HA 4Y0WA 1X3MA 2GX9A 5EOYA 5AQWA 2CGLA 2WBNA 3R9PA 1NJIO 4C1NI 3CCSN 2GTDA 1BO5O 3CCMN 4H0OA 2YX6A 4CZKA 2P9SB 3WUHA 3MMVA 3F9MA 5GIPA 3H3NO 3CCQN 3CETA 3UKRB 4E1JA 1VQ5N 3VOVA 4BQZA 5AQIA 4BG9A 1T44A 1VQLN 3M3ZA 2HF4A 3N4QA 3TTCA 1TYQB 2ZWHA 3AAPA 3DJCA 1T6CA 4FSVA 4CZMA 1VQKN 1JJ2M 1KAZA 3KVGA 5FPMA 4BRFA 4F9OA 2V7ZA 3QB0A 4PL7A 3I56N 3QBWA 1RDWX 3W3DA 4WYBA 1NWKA 2NNWA 3EO3A 1GLFO 2P9IB 3CJ7A 4FWQA 1GLDG 2KLAA 1JCGA 3H1VX 3KWIA 5AQRA 3DXMA 1Y64A 3WXJA 4R79A 1GLJO 4JKEA 4IEEA 2DPNA 3SMSA 5ELZA 3TTDA 1Q18A 4CBUA 3H3OB 5LY3A 1NGDA 3FR0A 3IDHA 2E2QA 2YHWA 4OPAA 3I33A 3R3LA 1Q86O 1HKGA 4JKHA 3AGKA 3A5NC 1SS6A 4JEPA 5TKYA 4CD3A 3HI0A 1C0GA 3DXKA 3KZBA 4IFEA 1EQYA 5BRHA 3O8MA 3CMEN 2NLXA 4J8FA 4BR7A 4EIAA 2NRHA 3FFKB 1R59O 4BR0A 3C6AA 4OPHA 4CD1A 1ATRA 4B1YB 5BR9A 2ZGYA 3CCEN 4WCEL 1VQNN 4JKAA 1DEJA 5AQGA 1KD1O 3CPEA 3O80A 3MWTA 3EL2A 4K41A 5JLFA 3I55N 5ADXH 1HKBA 2W41A 1NGGA 2ZGZA 4CZIA 3BF3A 4H03B 5CHIA 4WQ4A 3BP8A 2A42A 4FWKA 1OVYA 2FXUA 4IXCA 4Z94A 2ASMA 3EKSA 1Q82O 1V4SA 1YF5L 3CC4N 5M1FA 3LDPA 4BRHA 4BQLA 3FZFA 3A5OC 3GBTA 5AR0A 3CQYA 3GOIA 4L3QA 5C15A 2YJFA 2NRVA 4FOIA 3T7ZA 4IO9L 3C7NB 2F9WA 1QQOA 3RVCA 3Q7CA 4FWSA 2FF3B 3BF1A 5AQXA 3RSEB 1VQ9N 2P9NA 2PAVA 3CQXA 4IOAL 3ID6A 1U2VA 3WT0A 1S3XA 5MLCQ 2W40A 4XH4A 3OHRA 3C0BA 4YDUA 4JKGA 3ENOA 2IVOA 3CCVN 3U8XA 4M7YA 2E2OA 1N8RO 4YORA 3HTVA 5AQVA 4DQ8A 4H5TA 1V4TA 3G25A 2P9PA 1XUPO 4BC5A 3BEXA 3K9KA 2Q0UA 4DHYA 3M5RA 5BREA 2OTJN 3VEYA 5AQFA 3R6MA 5DM7L 1U6ZA 1C0FA 1QQMA 2WC9A 3NVMA 4HTLA 4IJNA 3IFRA 5AQSA 5JVGL 3CJAA 5AQYA 3D2FA 1NGEA 3C65A 3HBTA 5BN8A 2RE2A 3MDQA 4BRMA 3CCJN 2RHKA 2FSKA 5EVZA 3QICA 4NLBA 4A5BA 1YITN 4QS8A 3AY9A 5AZIB 3B8AX 2ZJPL 4YDUC 1JCEA 3GG4A 1YIJN 2P9SA 2ITMA 4BRCA 1QHAA 4A2BA 5C10A 3NMUA 3UKRA 3P31A 2QWMA 3H45C 3DAWA 2FF6A 3GL1A 1TYQA 3MCPA 2A6AA 4H0XB 4MDAA 4PKHA 3WXIA 4BR2A 1BUPA 4FWLA 3DLLL 1KAXA 1VQMN 1IJJA 1QQNA 3HZ6A 2V51B 5BPLA 3ZX2A 4GY2B 5M1QA 2Q31A 4ILJA 1GLBG 4ISGA 1NBWA 2NRRA 1ZC6A 4B1UB 4WFNL 4BG8A 3PIOL 3CF5L 2GUPA 4IZ9A 2P9IA 2NRXA 4KH6A 3UKUB 3VEXA 5JICA 3FZMA 3E9OA 3WQTA 1BOTO 1EO1A 3ZX3A 2ZJQL 3E66A 5FPEA 3FZLA 1MWKA 4JKFA 2J4RA 2QXLA 4A57A 5HOOA 3IUCA 3H6EA 3O1BA 3Q7BA 4JD2B 1T3VA 3HM8A 3VTHA 4WQ5C 1BWFO 4JK7A 1SQKA 2QWLA 2QWOA 4PKIA 4IEIA 5AFUA 3G4SN 4FPAA 1DKGD 2FSNA 2VWBA 1NGHA 2BH1A 2VYPA 1YJWN 3CXCM 5LJVA 3O1WA 1NGCA 4O8UA 4B1WB 3N4PA 4BC2A 2E20A 3BUZB 5AZJB 2PBDA 1Z6RA 3O6WA 4JKCA 2KHOA 2GEMA 5AQOA 2V52B 4JHDB 4FWNA 4ISEA 3D2EB 3VGKA 1TUYA 2D0OA 4A2AA 3EN9A 1Z05A 3EZWA 3G71N 5M1OA 4WF9L 3UE5A 3ZX0A 4ISFA 4JKBA 4BRDA 4EFHA 4BR9A 4CZEA 1S22A 3CI5A 3TSUA 3ULEB 4BRIA 3ATVA 4YOXA 1K8KB 3L4QA 1HUXA 4FVUA 1IG8A 2QM1A 5BRFA 3CC2N 2BUPA 2BTFA 5TKWA 3C7NA 2HBLA 3CIPA 3FZKA 4NLCA 3KK7A 2AP1A 3IKMA 4BC4A 3TSQA 1HJOA 3RSEA 1ATNA 1HKCA 3L4IA 4LC9B 2Q2RA 5AQKA 3R8EA 4JN4A 4C23A 3O9RA 3QMLA 4JK9A 3AARA 4C1NK 5I9EB 1P8ZA 2JWLA 3KHYA 5AQZA 3HOTA 3F5TA 3VF4A 3O9QA 5LJWA 4XH1A 3KWGA 1W97L 1QVFM 4MDBA 1ZXOA 3LM9A 3MX5A 4XEIA 1VQPN 2HOEA 2OANA 5JVHL 2CGJA 2NRTA 3VGLA 4YOWA 2GWJA 3D7EO 3PLAA 3CD6N 2QWPA 2FSJA 1YJ9N 2FLOA 5AQMA 2VCPA 3S41A 4CZJA 1BG3A 1GLCG 3CJ1A 1NM1A 4H0VB 2P9UB 4BVPA 1K73O 4BRPA 4OO1J 3C6HA 1BDGA 3SJHA 4FOEA 5AZIA 5AFUH 3EKUA 4BR4A 4FPBA 2ASOA 3A5LC 3IMXA 2QW9A 3QDKA 3VEZA 4CBXA 4CZLA 5BRDA 5F0XA 5AQHA 2YHYA 3OBYA 3VF2A 2WFBA 1NGFA 3VMFB 1YJNN 3A8YA 1H1VA 5M1KA 3P4IA 2NRWA 4O8KA 2EWSA 3M1FA 5KPTA 5KQ8A 4CBWA 1T6DA 2YJEA 3ENHA 4YOUA 4I6MA 2A3ZA 5C2DA 2P9LA 4PL8A 4CZHA 1QZ6A 4H5WA 4BC3A 4AM6A 4JAXA 3J7ZO 2HBJA 2P9KB 3ZEUB 4IWVA 3O9TA 2E2PA 1YVNA 4FWOA 4ILHA 3UKUA 1JCFA 1TUUA 4A5AA 2GELA 3LDLA 3SK3A 3CCUN 4FL9A 5AQNA 4FWMA 3NVKA 4DKWA 5JMVA 5EY4A 4BR5A 3F2KA 1ATSA 3LDQA 3CCRN 2Q0RA 3LDOA 3G6EN 1S72N 4BGBA 1RGIA 1ZBSA 1KAYA 5BPMA 5CE3A 3WEEB 2F9TA 4JD2A 3VETA 3LM2A 3QBXA 2UYTA 3A0IX 4AM7A 5KPZA 3CJBA 1ILYA 3TU5A 1SAZA 2WUSA 4WQ5A 2D0PA 1YI2N 5HL7L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LCU A;  3ZET B;  2IIR A;  4HWI A;  2QWN A;  1NGB A;  4XH5 A;  3A5M C;  1XQS C;  3U9D A;  3JS6 A;  2ZF5 O;  5AZJ A;  3LDN A;  1MA9 B;  2QWR A;  3CJC A;  4FWP A;  3HSC A;  4JHD A;  1MDU B;  3D2E A;  1CZA N;  3GE1 A;  4BRK A;  1GLL O;  2Q1N A;  3ULE A;  2ASP A;  3MN5 A;  2GWK A;  1YAG A;  3U4L A;  4MLE A;  4KBO A;  3AAQ A;  3FE1 A;  4K42 A;  4B1X B;  1BU6 O;  4K25 A;  2D4W A;  3TPQ A;  3M6G A;  1DGK N;  3MK6 A;  1X9J A;  1MWM A;  1SZ2 A;  3MN7 A;  1E4G T;  3VES A;  3FLC O;  3U9Z A;  1HLU A;  4H0Y B;  4RTF D;  5AQL A;  4A62 A;  2Q97 A;  3ID8 A;  1YXQ A;  4GNI A;  5KPR A;  4NO7 A;  4BRO A;  4JNE A;  3WXL A;  1BA1 A;  1D4X A;  4H5V A;  2P9U A;  1XC3 A;  5E26 A;  5EXW A;  4MO4 A;  4BRG A;  1LOT B;  5FPN A;  4H5R A;  4IO8 A;  1QZ5 A;  1NLV A;  2AA4 A;  3VEW A;  3VEV A;  3JXU A;  3GDQ A;  3O5B A;  1NGA A;  3L0Q A;  5FPD A;  3FGU A;  1GLE G;  4H0T B;  5AQT A;  4FWR A;  1BA0 A;  5E84 A;  5AQQ A;  3H1Q A;  4PKG A;  2CGK A;  2P9K A;  3MN9 A;  2CH5 A;  4H0P A;  4CI6 A;  3ATU A;  5AQJ A;  1KXP A;  2E1Z A;  3L6Q A;  3SMP A;  2IVP A;  3WQU A;  4BRA A;  4IJA A;  3VEO A;  3CHW A;  4BRE A;  1RFQ A;  5EX5 A;  5F2R A;  2CH6 A;  3WEE A;  3UB5 A;  2A40 A;  3QFP A;  3DXM B;  3DWL A;  2I7N A;  4RCH A;  4A61 A;  1NGJ A;  2I7P A;  4BRL A;  4CZG A;  5AQP A;  1NGI A;  3ZEU A;  1HPM A;  2E8A A;  3O4W A;  1WUA A;  3ZET A;  1OKJ A;  3J8A A;  4DB3 A;  3DXK B;  4M7X A;  3VEN A;  3SLC A;  3VF6 A;  3FZH A;  4MO5 A;  4BGA A;  5BN9 A;  4RWT A;  2IVN A;  4FO0 A;  4EHT A;  3VER A;  4BVO A;  4WQ4 C;  3MN6 A;  3W0L A;  4QS7 A;  5JLH A;  3I8B A;  2A41 A;  3LL3 A;  3VGM A;  2A5X A;  5KQD A;  4B1V A;  2HMP A;  4K43 A;  2E2N A;  2HF3 A;  3WXK A;  3CER A;  4CZF A;  4NB4 A;  4EHU A;  5AQU A;  4EAH D;  4MLH A;  4B1Z A;  4BRN A;  1J6Z A;  2P9N B;  1GLA G;  1YUW A;  2NZT A;  1U2V B;  1HX1 A;  2V7Y A;  3QFU A;  2YCH A;  2E1Y A;  2YHX A;  2E88 A;  4B9Q A;  4H5N A;  1G99 A;  1ESV A;  2QWQ A;  3CJ9 A;  4M63 C;  1E4F T;  4DCH A;  1X3N A;  5BPN A;  1K8K A;  4QS9 A;  5F1X A;  2P9P B;  2YI1 A;  2D1K A;  3VPZ A;  1WOQ A;  4I6M B;  4CJ7 A;  2P9L B;  4BRQ A;  1NMD A;  3H46 O;  4O5F A;  2Q36 A;  3O08 A;  3D2F B;  5ADX A;  2H3G X;  5B8H A;  4Y0W A;  1X3M A;  5EOY A;  5AQW A;  2CGL A;  3R9P A;  2GTD A;  1BO5 O;  4H0O A;  4CZK A;  2P9S B;  3WUH A;  3MMV A;  3F9M A;  3H3N O;  3CET A;  3UKR B;  4E1J A;  3VOV A;  4BQZ A;  5AQI A;  4BG9 A;  1T44 A;  3M3Z A;  2HF4 A;  1TYQ B;  2ZWH A;  3AAP A;  3DJC A;  1T6C A;  4FSV A;  4CZM A;  1KAZ A;  3KVG A;  5FPM A;  4BRF A;  4F9O A;  2V7Z A;  3QB0 A;  4PL7 A;  3QBW A;  1RDW X;  3W3D A;  4WYB A;  1NWK A;  3EO3 A;  1GLF O;  2P9I B;  3CJ7 A;  4FWQ A;  1GLD G;  1JCG A;  3H1V X;  5AQR A;  3DXM A;  1Y64 A;  3WXJ A;  1GLJ O;  2DPN A;  3SMS A;  5ELZ A;  4CBU A;  1Q18 A;  3H3O B;  5LY3 A;  1NGD A;  3FR0 A;  3IDH A;  2E2Q A;  2YHW A;  3I33 A;  1HKG A;  3A5N C;  5TKY A;  4CD3 A;  3HI0 A;  3DXK A;  1C0G A;  3KZB A;  1EQY A;  5BRH A;  3O8M A;  2NLX A;  4J8F A;  4BR7 A;  4EIA A;  2NRH A;  3FFK B;  1R59 O;  4BR0 A;  4CD1 A;  1ATR A;  4B1Y B;  5BR9 A;  2ZGY A;  5AQG A;  1DEJ A;  3O80 A;  5JLF A;  3EL2 A;  4K41 A;  5ADX H;  1HKB A;  2W41 A;  1NGG A;  2ZGZ A;  4CZI A;  3BF3 A;  4H03 B;  4WQ4 A;  3BP8 A;  2A42 A;  4FWK A;  2FXU A;  4IXC A;  4Z94 A;  2ASM A;  3EKS A;  1V4S A;  3LDP A;  4BRH A;  4BQL A;  3FZF A;  3A5O C;  3GBT A;  5AR0 A;  3CQY A;  3GOI A;  4L3Q A;  2YJF A;  4FOI A;  3C7N B;  2F9W A;  1QQO A;  4FWS A;  2FF3 B;  3BF1 A;  5AQX A;  3RSE B;  2P9N A;  2PAV A;  3CQX A;  1U2V A;  3WT0 A;  1S3X A;  2W40 A;  4XH4 A;  3OHR A;  3C0B A;  4YDU A;  3ENO A;  2IVO A;  3U8X A;  4M7Y A;  2E2O A;  3HTV A;  5AQV A;  4DQ8 A;  4H5T A;  1V4T A;  3G25 A;  2P9P A;  1XUP O;  4BC5 A;  3BEX A;  2Q0U A;  4DHY A;  5BRE A;  3VEY A;  5AQF A;  3R6M A;  1U6Z A;  1C0F A;  1QQM A;  4IJN A;  4HTL A;  5AQS A;  3IFR A;  3CJA A;  5AQY A;  3D2F A;  1NGE A;  3HBT A;  5BN8 A;  3MDQ A;  4BRM A;  5EVZ A;  2FSK A;  3QIC A;  4QS8 A;  3AY9 A;  5AZI B;  3B8A X;  4YDU C;  1JCE A;  3GG4 A;  2P9S A;  2ITM A;  4BRC A;  1QHA A;  4A2B A;  3UKR A;  2QWM A;  3H45 C;  3DAW A;  2FF6 A;  3GL1 A;  1TYQ A;  3MCP A;  2A6A A;  4H0X B;  4PKH A;  3WXI A;  4BR2 A;  1BUP A;  4FWL A;  1KAX A;  1IJJ A;  1QQN A;  3HZ6 A;  2V51 B;  5BPL A;  3ZX2 A;  4GY2 B;  2Q31 A;  1GLB G;  4ISG A;  1NBW A;  1ZC6 A;  4B1U B;  4BG8 A;  2GUP A;  4IZ9 A;  2P9I A;  3UKU B;  3VEX A;  5JIC A;  3FZM A;  3WQT A;  1BOT O;  3ZX3 A;  5FPE A;  3FZL A;  1MWK A;  2J4R A;  2QXL A;  3IUC A;  3H6E A;  3O1B A;  4JD2 B;  3HM8 A;  4WQ5 C;  1BWF O;  1SQK A;  2QWL A;  2QWO A;  4PKI A;  5AFU A;  4FPA A;  1DKG D;  2FSN A;  2VWB A;  1NGH A;  2VYP A;  5LJV A;  3O1W A;  1NGC A;  4B1W B;  4BC2 A;  2E20 A;  3BUZ B;  5AZJ B;  2PBD A;  1Z6R A;  3O6W A;  2KHO A;  2GEM A;  5AQO A;  2V52 B;  4JHD B;  4FWN A;  4ISE A;  3D2E B;  3VGK A;  1TUY A;  2D0O A;  4A2A A;  3EN9 A;  1Z05 A;  3EZW A;  3UE5 A;  3ZX0 A;  4ISF A;  4BRD A;  4EFH A;  4BR9 A;  4CZE A;  1S22 A;  3CI5 A;  3ULE B;  4BRI A;  3ATV A;  1K8K B;  1HUX A;  1IG8 A;  2QM1 A;  5BRF A;  2BUP A;  2BTF A;  3C7N A;  3CIP A;  3FZK A;  2AP1 A;  4BC4 A;  1HJO A;  3RSE A;  1ATN A;  1HKC A;  3L4I A;  4LC9 B;  2Q2R A;  5AQK A;  3R8E A;  4JN4 A;  4C23 A;  3QML A;  3AAR A;  5I9E B;  1P8Z A;  3KHY A;  5AQZ A;  3VF4 A;  5LJW A;  4XH1 A;  1ZXO A;  3LM9 A;  4XEI A;  2HOE A;  2OAN A;  2CGJ A;  3VGL A;  2GWJ A;  3D7E O;  2QWP A;  2FSJ A;  2FLO A;  5AQM A;  2VCP A;  3S41 A;  4CZJ A;  1BG3 A;  1GLC G;  3CJ1 A;  1NM1 A;  4H0V B;  2P9U B;  4BVP A;  4BRP A;  1BDG A;  3SJH A;  4FOE A;  5AZI A;  5AFU H;  3EKU A;  4BR4 A;  4FPB A;  2ASO A;  3A5L C;  3IMX A;  2QW9 A;  3QDK A;  3VEZ A;  4CBX A;  4CZL A;  5BRD A;  5F0X A;  5AQH A;  2YHY A;  3VF2 A;  1NGF A;  3A8Y A;  1H1V A;  3P4I A;  4O8K A;  2EWS A;  3M1F A;  5KPT A;  5KQ8 A;  4CBW A;  1T6D A;  2YJE A;  3ENH A;  4I6M A;  2A3Z A;  2P9L A;  4PL8 A;  4CZH A;  1QZ6 A;  4H5W A;  4BC3 A;  4AM6 A;  4JAX A;  2P9K B;  3ZEU B;  4IWV A;  4FWO A;  2E2P A;  1YVN A;  3UKU A;  1JCF A;  1TUU A;  2GEL A;  3LDL A;  3SK3 A;  4FL9 A;  5AQN A;  4FWM A;  5JMV A;  5EY4 A;  4BR5 A;  1ATS A;  3LDQ A;  2Q0R A;  3LDO A;  4BGB A;  1RGI A;  1ZBS A;  1KAY A;  5BPM A;  5CE3 A;  3WEE B;  2F9T A;  4JD2 A;  3VET A;  3LM2 A;  3QBX A;  2UYT A;  3A0I X;  4AM7 A;  5KPZ A;  3CJB A;  3TU5 A;  1SAZ A;  2WUS A;  4WQ5 A;  2D0P A; 
#chains in the Genus database with same CATH topology
 1NK4 A;  1WSJ A;  4HWI A;  2OZM A;  1NGB A;  3JS6 A;  2ZF5 O;  5AZJ A;  3CJC A;  4FWP A;  1MDU B;  1CZA N;  1JLA A;  4GV6 A;  4FLW A;  4E7I A;  3K57 A;  4F2S A;  3PV8 A;  2X74 A;  2O8F B;  3ULE A;  3KLG A;  2E5L K;  2HHS A;  5CYQ A;  5C2F A;  1YAG A;  3E1Y A;  4DFP A;  4KBO A;  3AAQ A;  3ISN C;  2O8E A;  3FE1 A;  3C6T A;  2F8S A;  2YNH A;  4B1X B;  4GV3 A;  4DF8 A;  1RT4 A;  4CIE A;  4K25 A;  3TPQ A;  4IFV A;  2R7Y A;  1DGK N;  4IG0 A;  3MN7 A;  5GAD P;  1XNR K;  4IDH A;  4CJS A;  4FYD A;  1RT7 A;  1RDD A;  3D0P A;  3L3U A;  1HLU A;  4OPK A;  4H0Y B;  3THW B;  4RTF D;  4LF4 K;  2PFU A;  5AQL A;  3NHG A;  2VQF K;  4FW1 A;  4CF0 A;  2QEX N;  4IDK A;  4GNI A;  3ASM A;  4NO7 A;  3MCA B;  3ALY A;  1BA1 A;  1D4X A;  1VQ8 N;  1XC3 A;  5E26 A;  2VG6 A;  3DRR A;  4FLU A;  3MEG A;  1VSK A;  3AVI A;  4EZ6 A;  2AA4 A;  4HVJ A;  4CJE A;  3KLF A;  1YT3 A;  5FPD A;  1IG9 A;  3FGU A;  2HHT A;  1P90 A;  4M3Y A;  3DLH A;  3E9P A;  4DV3 K;  4CI6 A;  3OTO K;  2Z1H A;  5C0Y A;  1B9D A;  5JS2 A;  3L6Q A;  3CPW M;  3WQU A;  4BRA A;  4CHQ A;  4BAC A;  2F7T A;  3SQ4 A;  2HNZ A;  1WSE A;  5F2R A;  2A40 A;  3QFP A;  4W5O A;  3DWL A;  5FRM A;  1XWL A;  4RCH A;  4CZG A;  2HHU A;  3VQE A;  4CEC A;  3O4W A;  4DB3 A;  3DXK B;  4E1N A;  4V19 S;  3VEN A;  2QA4 N;  3HM9 A;  3SLC A;  4CIF A;  4DR6 K;  5BN9 A;  5HLF A;  4M3W A;  3BZC A;  1SKW A;  1QTM A;  4K8X A;  3SCX A;  3TAB A;  1C1C A;  4EHT A;  3SBT A;  4DV1 K;  3LL3 A;  2UUC K;  3AGR A;  4OKE A;  4KV8 A;  2E4L A;  5KQD A;  5I3U A;  2PZS A;  2HMP A;  1BI4 B;  2D5R A;  4DF4 A;  4JI6 K;  1VSI A;  3OJS A;  4N56 A;  3RWU A;  2HHX A;  5AQU A;  3WXM B;  3SQ0 A;  1JLC A;  2RN2 A;  1GLA G;  5T7B A;  1HX1 A;  3LP1 A;  3MEE A;  2RKI A;  4JKG B;  4IOX A;  4CEF A;  2O8B A;  3ITH A;  3TSP A;  1BGX T;  1K9M O;  5CZ2 A;  1QSY A;  1LWC A;  4JS4 A;  4FJ5 A;  2B4J A;  2P9P B;  2B6A A;  3VPZ A;  4CJ4 A;  4CK2 A;  2P9L B;  3DM2 A;  1RT3 A;  4E7J A;  4O5F A;  3O08 A;  5EU7 A;  1ITG A;  4Y0W A;  3AVG A;  2GX9 A;  1NJI O;  3R9P A;  4C1N I;  3SUO A;  1HNW K;  3WUH A;  3O3G A;  1D9D A;  4CHZ A;  4E1J A;  4PY5 A;  4FJL A;  1SL0 A;  3NDK A;  1LV5 A;  4N76 A;  3N4Q A;  4HTU A;  1C6V A;  1T6C A;  3ZT3 A;  3THX A;  5DK5 A;  5C42 A;  4BRF A;  4F9O A;  4CF2 A;  4GKK K;  3QBW A;  4WYB A;  1RT5 A;  1NWK A;  2NNW A;  1GLF O;  4DTO A;  3HST B;  2DPN A;  5ELZ A;  1Q18 A;  4C8O A;  1IBM K;  3R3L A;  3F9K A;  4JKH A;  4DU3 A;  2KZZ A;  4Z4H A;  3LZI A;  1QSS A;  2UXB K;  4J8F A;  4BR7 A;  4EIA A;  2NRH A;  1R59 O;  1WN7 A;  3C6A A;  4OPH A;  4CD1 A;  4B1Y B;  1RT6 A;  1F21 A;  1VQN N;  4JKA A;  3OJU A;  3KKR A;  4K41 A;  2OA8 A;  2FBT A;  3K58 A;  3BF3 A;  4H03 B;  5CHI A;  3E01 A;  3BP8 A;  4FWK A;  3EY1 A;  3HPO A;  3TAF A;  3VQ7 A;  4IXC A;  4AHU A;  4RG8 A;  4JI4 K;  3RTV A;  3T1A A;  3LDP A;  4JI1 K;  5AR0 A;  3A5O C;  1BIU A;  3T7Z A;  4IO9 L;  3Q7C A;  2FF3 B;  3G0Z A;  3LAL A;  1VQ9 N;  2P9N A;  5HRN A;  4AH9 A;  2Y1I A;  3CQX A;  4DV2 K;  2UUB K;  4IOA L;  3WT0 A;  4B8C A;  3OYI A;  3MEC A;  3OYF A;  2NUB A;  2FC0 A;  2LSN A;  4M7Y A;  3U8X A;  3CCV N;  3HTV A;  5AQV A;  1I94 K;  3P83 D;  4H5T A;  3M8Q A;  3BEX A;  1D8Y A;  4CEA A;  1KLM A;  3WNH A;  5BRE A;  2OTJ N;  4CF1 A;  4CK3 A;  3JAM O;  5AQF A;  5DM7 L;  3NVM A;  4HTL A;  3TI0 A;  1ZBU A;  1FKO A;  3D2F A;  4I2P A;  2RE2 A;  4BRM A;  4NLB A;  4A5B A;  3MXJ A;  4AIL C;  3AVC A;  3SV4 A;  5CY4 A;  1JCE A;  2P9S A;  5HRS A;  4CCH A;  3UKR A;  3P31 A;  4FW2 A;  1NKB A;  4DTR A;  1EP4 A;  3OYH A;  3WXI A;  4PKH A;  2XY8 A;  1KAX A;  1S1T A;  1VQM N;  1WSF A;  3IAY A;  3L2Q A;  5M1Q A;  1VSL A;  1NBW A;  4WFN L;  5LMU K;  3CF5 L;  5JIC A;  2P9I A;  4FK4 A;  1RBS A;  3QLH A;  4J2B A;  3DRS A;  2J4R A;  3IUC A;  3H6E A;  4CHP A;  1WBD A;  2G8K A;  4F2R A;  3NCI A;  4B9N A;  1T3V A;  1BWF O;  3AO2 A;  4JK7 A;  3ZCM A;  4KHY A;  2VWB A;  3JYT A;  3BZK A;  4AHR A;  1NGC A;  2O4I A;  4BC2 A;  1RDC A;  1Z6R A;  5AQO A;  3VGK A;  3D2E B;  1TUY A;  1JXB A;  4CHN A;  4G1Q A;  5M1O A;  4ISF A;  4X64 K;  1ASU A;  2O8B B;  2P5G A;  3CI5 A;  2PY5 A;  4O5B A;  3TAP A;  2QM1 A;  3LPT A;  5TKW A;  2YHA A;  3K5N A;  4NLC A;  2AP1 A;  3IKM A;  4BC4 A;  3TSQ A;  1HJO A;  3HPG A;  5A2Q O;  1N32 K;  4C23 A;  3SNN A;  3AAR A;  4C1N K;  1KRP A;  5AQZ A;  3F5T A;  3OYD A;  3VF4 A;  3LM9 A;  1VQP N;  2UXC K;  5JVH L;  5LMN K;  3VGL A;  4JI5 K;  4CED A;  4HCB A;  2QWP A;  4C8K A;  3QES A;  3S41 A;  3CJ1 A;  4H0V B;  2P9U B;  2ZE2 A;  1BDG A;  4FOE A;  1U49 A;  1WNS A;  3VEZ A;  4CZL A;  4FLZ A;  2YHY A;  4LD0 A;  3A8Y A;  3L3V A;  5M1K A;  2NRW A;  4YY3 K;  1BQN A;  3M1F A;  5KPT A;  2A1S A;  2Z1I A;  1T05 A;  3NAE A;  3KLE A;  4KHN A;  5KRS A;  4JV5 K;  3LWM A;  2P9K B;  4I2Q A;  4IWV A;  3O9T A;  4ILH A;  4M3U A;  4CJT A;  1DTT A;  4MFB A;  2OPQ A;  3SK3 A;  4YNQ A;  4FL9 A;  4CJV A;  4Z0U A;  2IS3 A;  1N34 K;  3NVK A;  3OS1 A;  4BR5 A;  3KJV A;  2IDO A;  4DTP A;  4DG1 A;  5IWA K;  1OH6 A;  5BPM A;  5C25 A;  1SL1 A;  4JD2 A;  1EWR A;  4AHV A;  4FK0 A;  1S1W A;  3A0I X;  4CEZ A;  1SAZ A;  4WQ5 A;  1LCU A;  3ZET B;  4DTJ A;  2IIR A;  2QWN A;  1S1X A;  3ZT1 A;  3A5M C;  3LP2 A;  1XQS C;  3LDN A;  1MA9 B;  3O4Q A;  3AA4 A;  4JHD A;  3MWP A;  2VWK A;  3SZ2 A;  1T7P A;  4DR1 K;  4BRK A;  3VQ9 A;  2WTU A;  1Y97 A;  5GAE P;  1VQ4 N;  2Q1N A;  5SWM A;  3HVR A;  1KFS A;  2GWK A;  3U4L A;  5SZT A;  2P5O A;  4MLE A;  4F3O A;  4K42 A;  3HRG A;  3AA5 X;  2VG5 A;  3KIO A;  4DTN A;  2D4W A;  4DUZ K;  3MK6 A;  1BCM A;  3AVJ A;  1SZ2 A;  3HL8 A;  4KHQ A;  4E7L A;  3VES A;  1OH8 A;  1NOZ A;  4GW6 A;  1FW6 A;  5BR8 K;  3O9U A;  5C12 A;  1NK0 A;  4WE1 A;  3CYM A;  1YXQ A;  2JWK A;  1NJX A;  1Q9X A;  4B9V A;  1VQO N;  4B9U A;  4CJK A;  1JXE A;  3WXL A;  3KK2 A;  3FFI A;  3HP9 A;  3G10 A;  4MO4 A;  4BRG A;  5GAH P;  1LOT B;  2DFF A;  1EKE A;  1JL1 A;  4IO8 A;  4PHT X;  5J2M A;  2QK9 A;  3VEW A;  3VEV A;  3ZSV A;  4FZZ A;  3O5B A;  2XY6 A;  1SKR A;  3L0Q A;  2QTD A;  3NFA A;  4E3S A;  1X9S A;  1GLE G;  4H0T B;  4GMJ B;  3B6O A;  1BIS A;  5E84 A;  2ZJR L;  5AQQ A;  3H1Q A;  4A59 A;  4PKG A;  1XHX A;  1KVB A;  1RDB A;  2CH5 A;  3ATU A;  4DU1 A;  3LDS A;  2NRZ A;  4W5R A;  2E1Z A;  4HUE A;  1M90 O;  3LAN A;  4KTW A;  4FJX A;  1NKC A;  4JKD A;  1W2B M;  4CJW A;  3CHW A;  5EX5 A;  3WEE A;  4ILG B;  3DXM B;  3BDP A;  1TAU A;  4E0D A;  1S9G A;  1Q7Y O;  2I7N A;  2I7P A;  3ZSO A;  4AHT A;  1XHZ A;  4DTS A;  3ZEU A;  1IO2 A;  1L3V A;  1HRH A;  1VAZ A;  4KH5 A;  3NGZ A;  1KFD A;  4DQP A;  1KC8 O;  1KVA A;  3FZH A;  4MO5 A;  4BGA A;  4RWT A;  4QCL A;  3HVT A;  4LFB K;  4CGJ A;  2FBY A;  2IVN A;  4BVO A;  3W0L A;  3CC7 N;  2A41 A;  1YHQ N;  4DV4 K;  4OKJ A;  5GIN A;  2X78 A;  4CEO A;  4B3T K;  3T1H K;  4B1V A;  3R1X A;  4DS4 A;  4DSL A;  4CJP A;  2WON A;  3CER A;  3T1Y K;  3P39 A;  3PO4 A;  4FLT A;  2O8D A;  1YUW A;  1U2V B;  1HMV A;  2KW4 A;  1XMO K;  3ZT4 A;  5FRN A;  3QFU A;  4FLX A;  4WFB L;  2YHX A;  1XC9 A;  4DR4 K;  2QWQ A;  4FJ9 A;  1E4F T;  5BPN A;  1IKX A;  3QEI A;  4G9Z A;  2YI1 A;  4U7B A;  3SAH A;  4CJ7 A;  1NMD A;  3H46 O;  3OYL A;  1A5W A;  2HBM A;  4KB0 A;  2Q36 A;  1NU0 A;  3IRX A;  5B8H A;  3J80 O;  5CYM A;  1X3M A;  5EOY A;  4CK1 A;  4QOZ B;  3SQ2 A;  3F9M A;  1RBT A;  4O55 A;  1VQ5 N;  1J5E K;  1T44 A;  3M3Z A;  1BQM A;  1TYQ B;  2ZWH A;  3OYM A;  5J2N A;  4KTZ A;  1VRT A;  4CJ3 A;  1JJ2 M;  5FPM A;  2IGI A;  1IV0 A;  4EZ9 A;  2V7Z A;  1RDW X;  3OYG A;  4B3S K;  2KLA A;  3KWI A;  4OGE A;  5AQR A;  3LZJ A;  2X6S A;  1A5V A;  4X66 K;  3TAR A;  1UA0 A;  3TTD A;  3SMS A;  4CBU A;  3KTQ A;  3H3O B;  5LY3 A;  1NGD A;  3FR0 A;  1RT1 A;  1S5J A;  3I33 A;  4H8K A;  3AGK A;  3HYF A;  4CD3 A;  3HI0 A;  1C0G A;  3NF7 A;  1KLN A;  3O8M A;  3CME N;  1QS4 A;  2XRI A;  4LF6 K;  1ATR A;  5BR9 A;  2F96 A;  2ZGY A;  3DRP A;  3CCE N;  4WCE L;  4ELT A;  5AQG A;  1DEJ A;  4CEE A;  4LH5 A;  3KK1 A;  2W41 A;  1NGG A;  2ZGZ A;  4CZI A;  1KSP A;  2A42 A;  2FXU A;  5HBM A;  4Z94 A;  1V4S A;  4CF8 A;  3CC4 N;  5M1F A;  1RTI A;  4BRH A;  1J5O A;  3GBT A;  3P5J A;  3L2V A;  4F4K A;  4KHU A;  4FWS A;  3BF1 A;  1W9H A;  5AQX A;  3RSE B;  1CXQ A;  3RRG A;  4H4O A;  4XH4 A;  2KZM A;  3C95 A;  3TAN A;  3ENO A;  3CFP A;  1JLE A;  4DQ8 A;  1V4T A;  4BC5 A;  4W5T A;  1WSG A;  1RTH A;  2Q0U A;  4DHY A;  2Z1G A;  4KPY A;  3K59 A;  1IKY A;  3R6M A;  1U6Z A;  2WC9 A;  4IJN A;  5AQS A;  1N6Q A;  3IFR A;  4KHW A;  1BIZ A;  1C0U A;  3HBT A;  1JLF A;  4CFD A;  2FSK A;  3QIC A;  1GOB A;  3QEV A;  1RTJ A;  3GG4 A;  3LAM A;  1BL3 A;  2ITM A;  2UUA K;  4LF8 K;  3MCP A;  1JLG A;  4BR2 A;  1K6Y A;  4FWL A;  3DLL L;  1QQN A;  3HZ6 A;  4EP5 A;  3QEW A;  5BPL A;  2DY4 A;  2Q31 A;  1S9E A;  4ISG A;  2NRR A;  4DSJ A;  3K5M A;  4B1U B;  3PIO L;  3PSF A;  1RT2 A;  4GKJ K;  2GUP A;  4E7K A;  4E7H A;  1TGO A;  3FZM A;  3NF6 A;  1BOT O;  1EO1 A;  3L8B A;  4LF9 K;  4Z4E A;  3OS0 A;  2VWJ A;  1MWK A;  1Z26 A;  4JKF A;  3PY8 A;  3QO9 A;  3QNO A;  3O1B A;  4HCC A;  1EET A;  5HRO A;  1ZBH A;  1WSI A;  3HM8 A;  1RCH A;  1LWE A;  1SQK A;  1RNH A;  5AFU A;  4FPA A;  2VYP A;  3CXC M;  4DR7 K;  3VQ5 A;  4O8U A;  1RDA A;  4E89 A;  1U45 A;  5AZJ B;  3BUZ B;  1NNE A;  4QAG A;  1O1W A;  4FWN A;  2HVH A;  1VSJ A;  2HHV A;  3RMC A;  1NK6 A;  4BRD A;  3TR8 A;  3ULE B;  4BRI A;  4YOX A;  4FVU A;  2HHQ A;  5HP1 A;  2O8E B;  3C7N A;  3QET A;  3KK7 A;  2D0B A;  3THV A;  1ATN A;  4K0K K;  4CFB A;  2Q2R A;  5AQK A;  1WLJ A;  4JN4 A;  1IH7 A;  3O9R A;  2JWL A;  2HNY A;  3HOT A;  3AA2 A;  4KFB A;  3KWG A;  1E3M A;  1W97 L;  3MX5 A;  4XEI A;  4CVN E;  2HOE A;  2NRT A;  1I39 A;  4CIG A;  2GWJ A;  3D7E O;  3CD6 N;  1RBU A;  1YJ9 N;  5AQM A;  4CZJ A;  2VCP A;  1GLC G;  2O8C A;  1BCO A;  5AZI A;  5AFU H;  3EKU A;  5FRO A;  4FPB A;  4ELV A;  3QIO A;  3V1O A;  4CBX A;  1RTD A;  1NKE A;  2Z1J A;  5F0X A;  5AQH A;  1NGF A;  1H1V A;  4O8K A;  1XNQ K;  2EWS A;  1C0T A;  5KQ8 A;  1REV A;  1SUQ A;  1IBK K;  5C2D A;  4AM6 A;  3MED A;  3J7Z O;  2HBJ A;  2OCE A;  1VK0 A;  2EHG A;  4C8M A;  4ELU A;  1TK0 A;  2D0C A;  3UKU A;  1HJR A;  4M3X A;  3LDL A;  1KVC A;  3CCU N;  5AQN A;  5JMV A;  5EY4 A;  3F2K A;  4M42 A;  1U04 A;  2Q0R A;  3IS9 A;  3LDO A;  3G6E N;  1S72 N;  1KAY A;  3VET A;  3LAK A;  4CFA A;  2OYQ A;  4KI6 A;  3QBX A;  4FM0 A;  2UYT A;  3CJB A;  3S3M A;  4ZHR A;  1ILY A;  2WUS A;  5KGX A;  3DLE A;  4JK8 A;  4DTU A;  4KHP K;  1VQ6 N;  5J2P A;  1CZ9 A;  4E1M A;  2HST A;  1S1V A;  4FJ7 A;  1TK8 A;  1QHT A;  1K8A O;  1FJG K;  3GE1 A;  1CLQ A;  3MXI A;  5HRP A;  3C94 A;  2QI2 A;  4DTX A;  3B6P A;  2XO7 A;  2HVI A;  4EP4 A;  4FZX C;  1QSL A;  1BU6 O;  1FKP A;  1VQ7 N;  2YNG A;  3EE8 A;  4CJF A;  4CGG A;  4C8N A;  2BE2 A;  2ITG A;  1E4G T;  3O9S A;  4BDZ A;  3FLC O;  5CR4 A;  1ASW A;  4IBN A;  4KRE A;  4BY9 C;  3V81 A;  4A62 A;  3ID8 A;  1NK5 A;  4CEQ A;  4RW7 A;  4NYF A;  4JNE A;  4W5N A;  4O0I A;  4H5V A;  1HNI A;  5EXW A;  5DM6 L;  1LAV A;  4H5R A;  3DOL A;  3SUP A;  3V1Q A;  1NGA A;  3K5O A;  5AQT A;  1Q8I A;  3NF8 A;  3S3N A;  4FWR A;  5E41 A;  1QE1 A;  2A1R A;  3SUN A;  2YKN A;  3VQQ A;  1T8E A;  4U67 L;  2GUI A;  4M3T A;  4LY7 A;  3MN9 A;  3THX B;  3NF9 A;  4FCY A;  3HOS A;  4B9T A;  1IKV A;  5KGW A;  1UA1 A;  3SMP A;  4HUG A;  2IVP A;  3NH1 A;  2OPR A;  3KKS A;  4BRE A;  1N5Y A;  4ZTF A;  4YOV A;  4A61 A;  4OGC A;  1NGJ A;  2AJQ A;  2F8T A;  1NGI A;  3P38 A;  3DLR A;  4FZY A;  1WUA A;  3ZSR A;  1QVG M;  4LF5 K;  3J8A A;  3SAF A;  3V9S A;  3VF6 A;  3MAQ A;  5KTQ A;  1U4B A;  3QEX A;  1SL2 A;  2JLE A;  3AVB A;  4FO0 A;  3E9L A;  1IBL K;  4B3O A;  2GV9 A;  4WQ4 C;  2HBK A;  2O8F A;  5JLH A;  3VGM A;  4PUO A;  3ZT0 A;  1JKH A;  4K43 A;  2E2N A;  1LW0 A;  3WXK A;  4CZF A;  4NB4 A;  1ASV A;  4B08 A;  4MLH A;  4B1Z A;  2P9N B;  3SBG A;  2NZT A;  3OA9 A;  4NXM K;  3ZSZ A;  2V7Y A;  4YHH K;  3THW A;  2VGM A;  2E1Y A;  1O13 A;  1VSE A;  4H5N A;  4GV9 A;  2JGU A;  1G99 A;  1ESV A;  4NYN A;  4M63 C;  3HT3 A;  3KD5 E;  3AVM A;  4YOY A;  1X3N A;  4B9M A;  4QS9 A;  5F1X A;  2D1K A;  3ZYY X;  1WOQ A;  2ATQ A;  1RIL A;  4BRQ A;  1WAF A;  3D2F B;  4NXN K;  5ADX A;  3P1G A;  2CGL A;  1CXU A;  4FJ8 A;  2GTD A;  3QEP A;  2YNI A;  4H0O A;  2YX6 A;  4LH4 A;  2P9S B;  3CCQ N;  3UKR B;  3U3Y A;  1HNZ K;  2HND A;  5AQI A;  4BG9 A;  4BQZ A;  1VQL N;  1ZBI A;  3TTC A;  3NE6 A;  3DJC A;  4CZM A;  3LP0 A;  5AJ3 K;  3QB0 A;  3HK2 A;  3I56 N;  3RMB A;  1EXQ A;  3W3D A;  1T03 A;  3EO3 A;  3AO5 A;  2P9I B;  4FWQ A;  1EX4 A;  3H1V X;  1Y64 A;  2OPP A;  1GLJ O;  1TL1 A;  1TAQ A;  4JKE A;  1QVF M;  1HYS A;  3IDH A;  3OYJ A;  2E2Q A;  2YHW A;  4OPA A;  4YFU A;  1HKG A;  4JEP A;  1SS6 A;  3V1R A;  3L2W A;  3V9Z A;  3DXK A;  4IFE A;  4CER A;  1EQY A;  3CQ8 A;  4DV0 K;  1ZBL A;  1W0H A;  2NLX A;  4B8A B;  4BR0 A;  1W7A A;  4CGI A;  1KD1 O;  3CPE A;  3QNN A;  2BAN A;  3MWT A;  3EL2 A;  5JLF A;  5ADX H;  1HKB A;  1J54 A;  2ASM A;  1Q82 O;  1BI4 A;  2OZS A;  3AVA A;  3JSM A;  4BQL A;  3FZF A;  4LSN A;  2VG7 A;  4LSL A;  4NCG A;  5C15 A;  2NRV A;  4FOI A;  2F9W A;  1QQO A;  3RVC A;  1L3T A;  2PAV A;  1YTU A;  1HQU A;  3AVF A;  4M3Z A;  1S3X A;  4YDU A;  4JKG A;  4JI8 K;  2FBV A;  2IVO A;  4JRP A;  2E2O A;  1JLQ A;  4FM2 A;  4YOR A;  2P9P A;  1XUP O;  3V9U A;  3EZ5 A;  3K9K A;  3VEY A;  3SYZ A;  1C0F A;  1QQM A;  3ZSX A;  5JVG L;  3ULD A;  3CJA A;  1B92 A;  4KO0 A;  5AQY A;  1NGE A;  4LF7 K;  4AHS A;  5BN8 A;  1B9F A;  5C24 A;  3HJF A;  3B8A X;  2ZJP L;  4YDU C;  4BRC A;  1QHA A;  4FJM A;  3NMU A;  2Q3S A;  2QWM A;  3H45 C;  4FLV A;  2FF6 A;  4H0X B;  2A6A A;  2DFE A;  1ZBF A;  3KLH A;  1UAX A;  1KCF A;  3F73 A;  4BE2 A;  2IC3 A;  1RBR A;  3TAG A;  1ZC6 A;  3ZSW A;  4BG8 A;  2P51 A;  3K2P A;  2KTQ A;  2GBZ A;  3VEX A;  4JRQ A;  4N41 A;  3AVL A;  4K8Z A;  3WQT A;  3ZSY A;  3MXM A;  2BDP A;  1VSH A;  4XIU A;  3I0R A;  4RW6 A;  3AVH A;  2QXL A;  4C8L A;  4HUF A;  3L2R A;  4DS5 A;  3Q7B A;  4JD2 B;  3V6D A;  4X65 K;  1NJW A;  2OPS A;  2QWO A;  2QWL A;  4PKI A;  4IEI A;  3G4S N;  1DKG D;  4X62 K;  2FSN A;  4MQ3 A;  5LJV A;  4DQQ A;  3WNG A;  4B1W B;  1KTQ A;  2E20 A;  2E6M A;  3DLB A;  3DOK A;  2KHO A;  2GEM A;  4DQR A;  2V52 B;  4JHD B;  4ISE A;  1NG9 A;  1N33 K;  4Y1D A;  3EN9 A;  3EZW A;  3CM5 A;  3G71 N;  4WF9 L;  3UE5 A;  4DMN A;  3NGY A;  4E19 A;  3SI6 A;  4EFH A;  3U3G A;  4OLB A;  4CZE A;  4BWM A;  3L4Q A;  5HRR A;  3PX0 A;  4DTM A;  5BRF A;  3CC2 N;  3KD1 E;  4DUY K;  2HBL A;  3FZK A;  3OYK A;  5CZ1 A;  3SJJ A;  2HHW A;  1HKC A;  3L4I A;  4LC9 B;  4OVL A;  4ID5 A;  4JK9 A;  5I9E B;  3UIQ A;  5LJW A;  3T3F A;  4XH1 A;  4MDB A;  1ZXO A;  4ID1 A;  2CGJ A;  2XY5 A;  4PA1 A;  4CF9 A;  4PQU A;  1BG3 A;  4LFC K;  4BVP A;  4OO1 J;  3AO4 A;  3SJH A;  4BR4 A;  2ASO A;  3ZT2 A;  1I3A A;  2P1J A;  5BRD A;  4RW4 A;  3VF2 A;  3HO1 A;  5I42 A;  1YTA A;  2EX3 A;  2IAJ A;  4DLG A;  3J7Y P;  2UU9 K;  4CBW A;  2YJE A;  4YOU A;  4I6M A;  4PL8 A;  4CZH A;  5J2Q A;  4KRF A;  1TL3 A;  4FVM A;  5FLX O;  2E2P A;  1HNV A;  1ZYQ A;  1JCF A;  1TUU A;  3HPH A;  1CZB A;  3DMJ A;  4A5A A;  2GEL A;  4ZTJ A;  4FWM A;  3EEQ A;  4DKW A;  3OYN A;  1ATS A;  3LDQ A;  4DR2 K;  1TVR A;  4BGB A;  1RGI A;  1ZBS A;  3WEE B;  3LM2 A;  4FJI A;  4AM7 A;  3CG7 A;  4B3R K;  1IKW A;  4CEB A;  3ZEU B;  4FJK A;  1YI2 N;  5HL7 L;  3NBP A;  2XHB A;  4DV6 K;  3BY5 A;  4NCA A;  4XH5 A;  1NMN A;  3U9D A;  1JL2 A;  2QWR A;  1U48 A;  3HSC A;  4DQS A;  3NH2 A;  4FJJ A;  3D2E A;  4DFM A;  1Z25 A;  4IG3 A;  1GOC A;  3HXM A;  4I7F A;  4CES A;  1GLL O;  3U6F A;  1EWQ A;  5K14 A;  2I5J A;  2W6K A;  2ASP A;  2YNF A;  2ZD1 A;  3VQA A;  3MN5 A;  4UQG A;  4DWI A;  1VHX A;  3T19 A;  4GVE A;  3OBW A;  4CJL A;  1LW2 A;  4CHY A;  3CMA N;  3EE9 A;  3M6G A;  1X9J A;  1MWM A;  4OKK A;  2PYL A;  2O8D B;  4Y1C A;  1HR0 K;  4JI2 K;  3CM6 A;  3K9J A;  4JI7 K;  1S1U A;  1LAW A;  1C1B A;  3U9Z A;  3T69 A;  3L2U A;  4KH4 A;  4CHO A;  2Q97 A;  1TKT A;  3CCL N;  3CFR A;  1SKS A;  3OVN A;  5KPR A;  4O44 A;  4BRO A;  1OVQ A;  3S3O A;  1S6Q A;  3VQB A;  2P9U A;  4LFA K;  3V9X A;  5FPN A;  5GIO A;  4FM1 A;  1S6P A;  1QZ5 A;  1NLV A;  1TKZ A;  2BGG A;  3VQD A;  4DU4 A;  3D6R A;  3JXU A;  3GDQ A;  2KKZ A;  1HPZ A;  5DMR A;  2YV0 X;  4ICL A;  3OW2 M;  4J2A A;  4RW9 A;  4CJQ A;  3S9H A;  1BA0 A;  1NJZ A;  1OH5 A;  1UWB A;  1GOA A;  2CGK A;  2VGN A;  3SAG A;  2P9K A;  3TAQ A;  2G8H A;  4H0P A;  5AQJ A;  1KXP A;  4DFJ A;  4FLY A;  4KAZ A;  4IJA A;  3VEO A;  3LPU A;  4Z4F A;  1RFQ A;  3WNF A;  2CH6 A;  4M3R A;  3UB5 A;  1DLO A;  4JI3 K;  4IKF A;  4BRL A;  3AO1 A;  4KKO A;  5AQP A;  4J2D A;  3M8P A;  4WFA L;  1HPM A;  4OPJ A;  2E8A A;  2F4V K;  3ZET A;  1OKJ A;  4M7X A;  4BE0 A;  1C0M A;  5FDL A;  4IOC L;  2OTL N;  5M1N A;  1OH7 A;  1RDU A;  4KHS A;  3VER A;  3O3F A;  3VTI A;  1TV6 A;  3MN6 A;  4QS7 A;  4CGD A;  1M1K O;  1D5A A;  3I8B A;  2B5J A;  2A5X A;  3SQ1 A;  1FXX A;  1FK9 A;  3M8S A;  4I9L A;  2HF3 A;  1A5X A;  4EHU A;  2D0A A;  1NOY A;  4EAH D;  3OY9 A;  3PIP L;  4BRN A;  2E6L A;  3EYZ A;  1J6Z A;  1Q81 O;  1VSD A;  2KFN A;  3NGI A;  3LP3 A;  3LWL A;  5M1P A;  3MX2 A;  1BHL A;  2YCH A;  2PYJ A;  2E88 A;  4B9Q A;  4KI4 A;  3CJ9 A;  1DTQ A;  5GAG P;  4DCH A;  1WSH A;  1Q9Y A;  1DT9 A;  4W5Q A;  4CE9 A;  1K8K A;  3TTF A;  4YOT A;  4BWJ A;  5H1S Q;  4FJG A;  3VQ6 A;  4I6M B;  4B9L A;  5D3G A;  4AF1 A;  4PWD A;  3ENB A;  2H3G X;  3AV9 A;  2W42 A;  4DSK A;  5AQW A;  2HHH K;  2WBN A;  2YKM A;  2RPI A;  3CCS N;  1BO5 O;  3VQ4 A;  3CCM N;  4CZK A;  3PSI A;  2IOC A;  3MMV A;  5GIP A;  3H3N O;  3CET A;  4JS5 A;  3VOV A;  1HYV A;  1X9W A;  4BE1 A;  4HHT A;  2HF4 A;  3AAP A;  1HQE A;  3VQ8 A;  4FSV A;  2ZM6 K;  4KTQ A;  1VQK N;  3SPZ A;  3OS2 A;  1KAZ A;  3KVG A;  1RBV A;  2FBX A;  5KI6 A;  5KRT A;  5JS1 A;  3VN5 A;  3THY A;  4TSX A;  1XMQ K;  3AVN A;  3TAM A;  4PL7 A;  3V9W A;  4F8R A;  3CJ7 A;  1GLD G;  3IG1 A;  1JCG A;  3CFO A;  4OJR A;  3DXM A;  3WXJ A;  4R79 A;  4NCB A;  1VSM A;  4IEE A;  1KQS M;  1NK9 A;  3RMA A;  4UY8 O;  2G8F A;  4B3M K;  1Q86 O;  2Y1J A;  3A5N C;  5TKY A;  3KZB A;  1TKX A;  2O4G A;  5BRH A;  1L5U A;  3DLG A;  3FFK B;  4L8R B;  4CJ5 A;  3AA3 A;  3RR7 A;  3O80 A;  2QKB A;  4DV7 K;  3I55 N;  1L3S A;  5J1E A;  4M41 A;  3C6U A;  4WQ4 A;  4B9S A;  4RW8 A;  1OVY A;  1VRU A;  3EKS A;  1YF5 L;  3HP6 A;  3CQY A;  3GOI A;  4L3Q A;  2YJF A;  1SV5 A;  3C7N B;  1LWF A;  1D9F A;  1X1P A;  3O3H A;  3ID6 A;  1U2V A;  3ZLJ A;  4CJR A;  3VA3 A;  5MLC Q;  2W6L A;  2W40 A;  3OHR A;  4FJN A;  4O0J A;  3C0B A;  4M45 A;  4AHC A;  1MU2 A;  2UXD K;  4KB1 A;  1N8R O;  3WNE A;  3J81 O;  3PUF A;  1NK8 A;  1R0A A;  3I0S A;  3G25 A;  2QXF A;  3M5R A;  3VQP A;  3VA0 A;  3C65 A;  3MDQ A;  3CCJ N;  1TKD A;  2O8C B;  2RHK A;  5EVZ A;  4CW7 B;  4QS8 A;  3AY9 A;  1YIT N;  5AZI B;  1WBB A;  1XI1 A;  1J53 A;  1YIJ N;  3TAE A;  4H4M A;  4A2B A;  5C10 A;  1L3U A;  3VQC A;  3DAW A;  3GL1 A;  2XY7 A;  1TYQ A;  2G8U A;  4MDA A;  4Q5V A;  4DSF A;  1BUP A;  3D45 A;  4CGF A;  1IJJ A;  2RF2 A;  3RR8 A;  2V51 B;  3ZX2 A;  4GY2 B;  4ILJ A;  1GLB G;  1NJY A;  2DFH A;  3M8R A;  4OX9 K;  2G8W A;  4IZ9 A;  4KH6 A;  2NRX A;  3UKU B;  4FJH A;  3E9O A;  1TK5 A;  3ZX3 A;  3I8D A;  2VQE K;  2ZJQ L;  3BGR A;  3E66 A;  5FPE A;  3FZL A;  4A57 A;  3AVK A;  5HOO A;  3OYC A;  4DV5 K;  2G8V A;  3VTH A;  4WQ5 C;  3K5L A;  3TWH A;  1NGH A;  2BH1 A;  1YJW N;  4DR3 K;  3DI6 A;  4N47 A;  3O1W A;  3DYA A;  3N4P A;  4BDP A;  2PBD A;  3O6W A;  1WB9 A;  4JKC A;  3K0S A;  2X6N A;  4I9Q A;  3QIP A;  4A2A A;  2D0O A;  1X9M A;  1Z05 A;  4FXD A;  3SPY A;  3ZX0 A;  4JKB A;  4BR9 A;  1S22 A;  3TSU A;  3PX6 A;  2HMI A;  4JI0 K;  3ATV A;  1K8K B;  1HUX A;  1J9A A;  1IG8 A;  2BUP A;  2BTF A;  4IFY A;  3KLI A;  3CIP A;  4DSE A;  4Z4G A;  3RSE A;  4AQY K;  2YHB A;  1HNX K;  3R8E A;  4Z4C A;  4DQI A;  3QML A;  1P8Z A;  3DLK A;  3KHY A;  3SV3 A;  3A2F A;  3O9Q A;  4Z4I A;  4J2E A;  2G8I A;  3RMD A;  2ETJ A;  3PO5 A;  2OAN A;  1WAJ A;  4YOW A;  3PLA A;  1YVU A;  2FSJ A;  4DFK A;  2HW3 A;  5IT9 O;  2FLO A;  4Q0B A;  1JLB A;  4R5P A;  4DSI A;  3QIN A;  1NM1 A;  3THY B;  1K73 O;  4BRP A;  3ZSQ A;  3C6H A;  1UOC A;  3A5L C;  3IMX A;  4BDY A;  2KQ2 A;  2QW9 A;  3QDK A;  2KFZ A;  4CFC A;  4CJU A;  1VSF A;  1YJN N;  3OBY A;  3VMF B;  2WFB A;  1HYZ A;  1U47 A;  3P4I A;  1NK7 A;  3OYA A;  1T6D A;  4JYA K;  3ENH A;  4CGH A;  2A3Z A;  2P9L A;  1QZ6 A;  4H5W A;  3OYE A;  3QER A;  4BC3 A;  4GVM A;  3OYB A;  3RRH A;  4JLH A;  3AO3 A;  4JAX A;  4F3T A;  3J7A P;  4FWO A;  1YVN A;  4FK2 A;  2HB5 A;  3SUQ A;  2ZQB A;  1C1A A;  4N5S A;  3KK3 A;  4DR5 K;  1N36 K;  2QKK A;  3CCR N;  3H08 A;  4O4G A;  5CE3 A;  5LL6 Z;  4OLA A;  2F9T A;  3PX4 A;  1QQC A;  3NH0 A;  2WOM A;  5KPZ A;  1G15 A;  3O4N A;  4DLE A;  3TU5 A;  2DTU A;  2D0P A;  3V4I A; 
#chains in the Genus database with same CATH homology
 4JK8 A;  1LCU A;  3ZET B;  2IIR A;  4HWI A;  2QWN A;  1NGB A;  4XH5 A;  1VQ6 N;  3A5M C;  1XQS C;  3U9D A;  3JS6 A;  2ZF5 O;  5AZJ A;  2HST A;  1MA9 B;  2QWR A;  3CJC A;  3LDN A;  3HSC A;  4FWP A;  4JHD A;  1MDU B;  3MWP A;  3D2E A;  1K8A O;  1CZA N;  3GE1 A;  4BRK A;  4GV6 A;  5GAE P;  1GLL O;  1VQ4 N;  2Q1N A;  3ULE A;  2ASP A;  5C2F A;  3MN5 A;  2GWK A;  1YAG A;  3E1Y A;  3U4L A;  4MLE A;  4KBO A;  3AAQ A;  4GVE A;  3FE1 A;  2QI2 A;  4K42 A;  3OBW A;  4B1X B;  3HRG A;  4GV3 A;  1BU6 O;  1VQ7 N;  3CMA N;  4K25 A;  2D4W A;  3EE8 A;  3EE9 A;  3TPQ A;  3M6G A;  1DGK N;  3MK6 A;  1X9J A;  1MWM A;  1SZ2 A;  3MN7 A;  1E4G T;  3O9S A;  5GAD P;  4IDH A;  3VES A;  3K9J A;  3FLC O;  5CR4 A;  3U9Z A;  1HLU A;  3T69 A;  4H0Y B;  4BY9 C;  4KH4 A;  4RTF D;  2PFU A;  5AQL A;  4A62 A;  2Q97 A;  3CCL N;  3ID8 A;  2QEX N;  3O9U A;  5C12 A;  1YXQ A;  4GNI A;  5KPR A;  2JWK A;  4NO7 A;  1VQO N;  4BRO A;  3MCA B;  4JNE A;  3WXL A;  1BA1 A;  1D4X A;  4H5V A;  1VQ8 N;  2P9U A;  1XC3 A;  5E26 A;  5EXW A;  4MO4 A;  5DM6 L;  4BRG A;  5GAH P;  1LOT B;  5FPN A;  4PHT X;  4H5R A;  4IO8 A;  5GIO A;  1QZ5 A;  1NLV A;  2AA4 A;  3D6R A;  3VEW A;  3VEV A;  3JXU A;  3GDQ A;  3O5B A;  2KKZ A;  1NGA A;  3L0Q A;  2QTD A;  5FPD A;  3OW2 M;  3FGU A;  1GLE G;  4H0T B;  5AQT A;  4FWR A;  1BA0 A;  1P90 A;  5E84 A;  2ZJR L;  5AQQ A;  3H1Q A;  4A59 A;  4U67 L;  4PKG A;  2CGK A;  2VGN A;  3E9P A;  3SAG A;  2P9K A;  3MN9 A;  2CH5 A;  4H0P A;  4CI6 A;  3ATU A;  5AQJ A;  3HOS A;  5C0Y A;  1KXP A;  2NRZ A;  2E1Z A;  3L6Q A;  3SMP A;  2IVP A;  3CPW M;  3WQU A;  1M90 O;  4BRA A;  4JKD A;  1W2B M;  2F7T A;  4IJA A;  3CHW A;  3VEO A;  4BRE A;  1RFQ A;  5EX5 A;  5F2R A;  2CH6 A;  4ILG B;  3WEE A;  3UB5 A;  2A40 A;  3QFP A;  3DXM B;  3DWL A;  4YOV A;  1Q7Y O;  2I7N A;  4RCH A;  4A61 A;  1NGJ A;  2I7P A;  4BRL A;  4CZG A;  5AQP A;  1NGI A;  3P38 A;  3ZEU A;  1HPM A;  4WFA L;  2E8A A;  3O4W A;  1WUA A;  3ZET A;  1QVG M;  1OKJ A;  1VAZ A;  4KH5 A;  3J8A A;  4DB3 A;  3DXK B;  3SAF A;  4M7X A;  1KQS M;  3VEN A;  2QA4 N;  1KC8 O;  3SLC A;  3VF6 A;  3FZH A;  4MO5 A;  4BGA A;  5BN9 A;  4IOC L;  4RWT A;  2OTL N;  5M1N A;  1RDU A;  2IVN A;  4FO0 A;  3E9L A;  4EHT A;  3VER A;  3VTI A;  4BVO A;  4WQ4 C;  2HBK A;  3SBT A;  3MN6 A;  3W0L A;  4QS7 A;  5JLH A;  1M1K O;  3CC7 N;  3I8B A;  2A41 A;  3LL3 A;  3VGM A;  1YHQ N;  2A5X A;  3AGR A;  5GIN A;  5KQD A;  4B1V A;  2HMP A;  3R1X A;  4K43 A;  2E2N A;  2HF3 A;  3WXK A;  3CER A;  4CZF A;  4NB4 A;  4EHU A;  5AQU A;  3WXM B;  4MLH A;  4EAH D;  4B1Z A;  3PIP L;  4BRN A;  3P39 A;  1J6Z A;  1Q81 O;  2P9N B;  1GLA G;  1YUW A;  3SBG A;  2NZT A;  1U2V B;  3OA9 A;  1HX1 A;  5M1P A;  2V7Y A;  3MX2 A;  3QFU A;  2YCH A;  2VGM A;  2E1Y A;  4WFB L;  2YHX A;  2E88 A;  1O13 A;  4H5N A;  4JKG B;  4B9Q A;  4GV9 A;  4IOX A;  1G99 A;  1ESV A;  2QWQ A;  3CJ9 A;  4M63 C;  3TSP A;  1E4F T;  4DCH A;  5GAG P;  1K9M O;  4YOY A;  1DT9 A;  1X3N A;  5BPN A;  1K8K A;  3TTF A;  4QS9 A;  4G9Z A;  4YOT A;  5F1X A;  2P9P B;  2YI1 A;  2D1K A;  3VPZ A;  5H1S Q;  3ZYY X;  4U7B A;  3SAH A;  1WOQ A;  4I6M B;  4CJ7 A;  2P9L B;  4AF1 A;  4BRQ A;  1NMD A;  3ENB A;  3H46 O;  2HBM A;  4O5F A;  4UY8 O;  2Q36 A;  3O08 A;  3D2F B;  5ADX A;  2H3G X;  5B8H A;  4Y0W A;  1X3M A;  2GX9 A;  5EOY A;  5AQW A;  2CGL A;  2WBN A;  3R9P A;  1NJI O;  4C1N I;  3CCS N;  2GTD A;  1BO5 O;  3CCM N;  4H0O A;  2YX6 A;  4CZK A;  2P9S B;  3WUH A;  3MMV A;  3F9M A;  5GIP A;  3H3N O;  3CCQ N;  3CET A;  3UKR B;  4E1J A;  1VQ5 N;  3VOV A;  4BQZ A;  5AQI A;  4BG9 A;  1T44 A;  1VQL N;  3M3Z A;  2HF4 A;  3N4Q A;  3TTC A;  1TYQ B;  2ZWH A;  3AAP A;  3DJC A;  1T6C A;  4FSV A;  4CZM A;  1VQK N;  1JJ2 M;  1KAZ A;  3KVG A;  5FPM A;  4BRF A;  4F9O A;  2V7Z A;  3QB0 A;  4PL7 A;  3I56 N;  3QBW A;  1RDW X;  3W3D A;  4WYB A;  1NWK A;  2NNW A;  3EO3 A;  1GLF O;  2P9I B;  3CJ7 A;  4FWQ A;  1GLD G;  2KLA A;  1JCG A;  3H1V X;  3KWI A;  5AQR A;  3DXM A;  1Y64 A;  3WXJ A;  4R79 A;  1GLJ O;  4JKE A;  4IEE A;  2DPN A;  3SMS A;  5ELZ A;  3TTD A;  1Q18 A;  4CBU A;  3H3O B;  5LY3 A;  1NGD A;  3FR0 A;  3IDH A;  2E2Q A;  2YHW A;  4OPA A;  3I33 A;  3R3L A;  1Q86 O;  1HKG A;  4JKH A;  3AGK A;  3A5N C;  1SS6 A;  4JEP A;  5TKY A;  4CD3 A;  3HI0 A;  1C0G A;  3DXK A;  3KZB A;  4IFE A;  1EQY A;  5BRH A;  3O8M A;  3CME N;  2NLX A;  4J8F A;  4BR7 A;  4EIA A;  2NRH A;  3FFK B;  1R59 O;  4BR0 A;  3C6A A;  4OPH A;  4CD1 A;  1ATR A;  4B1Y B;  5BR9 A;  2ZGY A;  3CCE N;  4WCE L;  1VQN N;  4JKA A;  1DEJ A;  5AQG A;  1KD1 O;  3CPE A;  3O80 A;  3MWT A;  3EL2 A;  4K41 A;  5JLF A;  3I55 N;  5ADX H;  1HKB A;  2W41 A;  1NGG A;  2ZGZ A;  4CZI A;  3BF3 A;  4H03 B;  5CHI A;  4WQ4 A;  3BP8 A;  2A42 A;  4FWK A;  1OVY A;  2FXU A;  4IXC A;  4Z94 A;  2ASM A;  3EKS A;  1Q82 O;  1V4S A;  1YF5 L;  3CC4 N;  5M1F A;  3LDP A;  4BRH A;  4BQL A;  3FZF A;  3A5O C;  3GBT A;  5AR0 A;  3CQY A;  3GOI A;  4L3Q A;  5C15 A;  2YJF A;  2NRV A;  4FOI A;  3T7Z A;  4IO9 L;  3C7N B;  2F9W A;  1QQO A;  3RVC A;  3Q7C A;  4FWS A;  2FF3 B;  3BF1 A;  5AQX A;  3RSE B;  1VQ9 N;  2P9N A;  2PAV A;  3CQX A;  4IOA L;  3ID6 A;  1U2V A;  3WT0 A;  1S3X A;  5MLC Q;  2W40 A;  4XH4 A;  3OHR A;  3C0B A;  4YDU A;  4JKG A;  3ENO A;  2IVO A;  3CCV N;  3U8X A;  4M7Y A;  2E2O A;  1N8R O;  4YOR A;  3HTV A;  5AQV A;  4DQ8 A;  4H5T A;  1V4T A;  3G25 A;  2P9P A;  1XUP O;  4BC5 A;  3BEX A;  3K9K A;  2Q0U A;  4DHY A;  3M5R A;  5BRE A;  2OTJ N;  3VEY A;  5AQF A;  3R6M A;  5DM7 L;  1U6Z A;  1C0F A;  1QQM A;  2WC9 A;  3NVM A;  4HTL A;  4IJN A;  3IFR A;  5AQS A;  5JVG L;  3CJA A;  5AQY A;  3D2F A;  1NGE A;  3C65 A;  3HBT A;  5BN8 A;  2RE2 A;  3MDQ A;  4BRM A;  3CCJ N;  2RHK A;  2FSK A;  5EVZ A;  3QIC A;  4NLB A;  4A5B A;  1YIT N;  4QS8 A;  3AY9 A;  5AZI B;  3B8A X;  2ZJP L;  4YDU C;  1JCE A;  3GG4 A;  1YIJ N;  2P9S A;  2ITM A;  4BRC A;  1QHA A;  4A2B A;  5C10 A;  3NMU A;  3UKR A;  3P31 A;  2QWM A;  3H45 C;  3DAW A;  2FF6 A;  3GL1 A;  1TYQ A;  3MCP A;  2A6A A;  4H0X B;  4MDA A;  4PKH A;  3WXI A;  4BR2 A;  1BUP A;  4FWL A;  3DLL L;  1KAX A;  1VQM N;  1IJJ A;  1QQN A;  3HZ6 A;  2V51 B;  5BPL A;  3ZX2 A;  4GY2 B;  5M1Q A;  2Q31 A;  4ILJ A;  1GLB G;  4ISG A;  1NBW A;  2NRR A;  1ZC6 A;  4B1U B;  4WFN L;  4BG8 A;  3PIO L;  3CF5 L;  2GUP A;  4IZ9 A;  2P9I A;  2NRX A;  4KH6 A;  3UKU B;  3VEX A;  5JIC A;  3FZM A;  3E9O A;  3WQT A;  1BOT O;  1EO1 A;  3ZX3 A;  2ZJQ L;  3E66 A;  5FPE A;  3FZL A;  1MWK A;  4JKF A;  2J4R A;  2QXL A;  4A57 A;  5HOO A;  3IUC A;  3H6E A;  3O1B A;  3Q7B A;  4JD2 B;  1T3V A;  3HM8 A;  3VTH A;  4WQ5 C;  1BWF O;  4JK7 A;  1SQK A;  2QWL A;  2QWO A;  4PKI A;  4IEI A;  5AFU A;  3G4S N;  4FPA A;  1DKG D;  2FSN A;  2VWB A;  1NGH A;  2BH1 A;  2VYP A;  1YJW N;  3CXC M;  5LJV A;  3O1W A;  1NGC A;  4O8U A;  4B1W B;  3N4P A;  4BC2 A;  2E20 A;  3BUZ B;  5AZJ B;  2PBD A;  1Z6R A;  3O6W A;  4JKC A;  2KHO A;  2GEM A;  5AQO A;  2V52 B;  4JHD B;  4FWN A;  4ISE A;  3D2E B;  3VGK A;  1TUY A;  2D0O A;  4A2A A;  3EN9 A;  1Z05 A;  3EZW A;  3G71 N;  5M1O A;  4WF9 L;  3UE5 A;  3ZX0 A;  4ISF A;  4JKB A;  4BRD A;  4EFH A;  4BR9 A;  4CZE A;  1S22 A;  3CI5 A;  3TSU A;  3ULE B;  4BRI A;  3ATV A;  4YOX A;  1K8K B;  3L4Q A;  1HUX A;  4FVU A;  1IG8 A;  2QM1 A;  5BRF A;  3CC2 N;  2BUP A;  2BTF A;  5TKW A;  3C7N A;  2HBL A;  3CIP A;  3FZK A;  4NLC A;  3KK7 A;  2AP1 A;  3IKM A;  4BC4 A;  3TSQ A;  1HJO A;  3RSE A;  1ATN A;  1HKC A;  3L4I A;  4LC9 B;  2Q2R A;  5AQK A;  3R8E A;  4JN4 A;  4C23 A;  3O9R A;  3QML A;  4JK9 A;  3AAR A;  4C1N K;  5I9E B;  1P8Z A;  2JWL A;  3KHY A;  5AQZ A;  3HOT A;  3F5T A;  3VF4 A;  3O9Q A;  5LJW A;  4XH1 A;  3KWG A;  1W97 L;  1QVF M;  4MDB A;  1ZXO A;  3LM9 A;  3MX5 A;  4XEI A;  1VQP N;  2HOE A;  2OAN A;  5JVH L;  2CGJ A;  2NRT A;  3VGL A;  4YOW A;  2GWJ A;  3D7E O;  3PLA A;  3CD6 N;  2QWP A;  2FSJ A;  1YJ9 N;  2FLO A;  5AQM A;  2VCP A;  3S41 A;  4CZJ A;  1BG3 A;  1GLC G;  3CJ1 A;  1NM1 A;  4H0V B;  2P9U B;  4BVP A;  1K73 O;  4BRP A;  4OO1 J;  3C6H A;  1BDG A;  3SJH A;  4FOE A;  5AZI A;  5AFU H;  3EKU A;  4BR4 A;  4FPB A;  2ASO A;  3A5L C;  3IMX A;  2QW9 A;  3QDK A;  3VEZ A;  4CBX A;  4CZL A;  5BRD A;  5F0X A;  5AQH A;  2YHY A;  3OBY A;  3VF2 A;  2WFB A;  1NGF A;  3VMF B;  1YJN N;  3A8Y A;  1H1V A;  5M1K A;  3P4I A;  2NRW A;  4O8K A;  2EWS A;  3M1F A;  5KPT A;  5KQ8 A;  4CBW A;  1T6D A;  2YJE A;  3ENH A;  4YOU A;  4I6M A;  2A3Z A;  5C2D A;  2P9L A;  4PL8 A;  4CZH A;  1QZ6 A;  4H5W A;  4BC3 A;  4AM6 A;  4JAX A;  3J7Z O;  2HBJ A;  2P9K B;  3ZEU B;  4IWV A;  3O9T A;  2E2P A;  1YVN A;  4FWO A;  4ILH A;  3UKU A;  1JCF A;  1TUU A;  4A5A A;  2GEL A;  3LDL A;  3SK3 A;  3CCU N;  4FL9 A;  5AQN A;  4FWM A;  3NVK A;  4DKW A;  5JMV A;  5EY4 A;  4BR5 A;  3F2K A;  1ATS A;  3LDQ A;  3CCR N;  2Q0R A;  3LDO A;  3G6E N;  1S72 N;  4BGB A;  1RGI A;  1ZBS A;  1KAY A;  5BPM A;  5CE3 A;  3WEE B;  2F9T A;  4JD2 A;  3VET A;  3LM2 A;  3QBX A;  2UYT A;  3A0I X;  4AM7 A;  5KPZ A;  3CJB A;  1ILY A;  3TU5 A;  1SAZ A;  2WUS A;  4WQ5 A;  2D0P A;  1YI2 N;  5HL7 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...