4NCGA

Discovery of doravirine, an orally bioavailable non-nucleoside reverse transcriptase inhibitor potent against a wide range of resistant mutant hiv viruses
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
556
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of MK-1439, an orally bioavailable non-nucleoside reverse transcriptase inhibitor potent against a wide range of resistant mutant HIV viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/inhhibitor, hydrolase/inhhibitor
molecule keywords Reverse transcriptase/ribonuclease H
total genus 165
structure length 553
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ncgA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ncgA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ncgA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ncgA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ncgA05
2GBZA 4KI6A 4O3PA 1EETA 4AHCA 1LWEA 2Z1HA 1YT3A 1FXXA 1RT3B 1IH7A 3HHKA 1YVUA 3T3FA 2E4LA 2RDIA 2KW4A 3OLBA 4YMEA 2D5RA 2BRLA 2B43A 1N48A 3H5UA 4WE1B 3GV7B 3H5SA 5KFCA 3AVMA 2W7OA 5D3GA 4Y2AA 4ECVA 3SPZA 1R0AB 2BANA 3PZPA 3UQSA 4FLUA 4IRKA 4ICLB 4J2AA 2O4IA 3K5OA 1RTDA 3VQEA 2UUTA 4E3SA 3I0RA 3MTKA 2B6AA 3DLGA 2HNYB 4RW8B 3KKRA 4F2SA 4DU1A 3RWUA 3C6TA 5L9XA 3ZSZA 5F8NA 4NLWA 4FLYA 2IGIA 3VQAA 1ZTTA 4ECRA 4LQ9A 1WNSA 3KKSA 4BDZA 4DTRA 3V6HA 1QAJA 4ED6A 2QK9A 1JLAB 4DTJA 4TQRA 5HROB 3SFUA 1JLCB 4DMNA 1ASUA 3NE6A 4RZRA 4JS4A 2ITGA 2IA6A 3QLHA 3SZ2A 1S48A 1LWFA 4ZHRA 1YTUA 1RYSA 4AH9A 5HP1A 1KFSA 1Q9XA 1S1TB 2HHSA 4M3RA 3QGGA 4OJRA 2VA3A 1LW2B 3CFOA 2E6MA 3NGYA 1B9FA 1KVBA 1JXEA 4DS4A 4URSA 4KPYA 5KFPA 4DLGA 4CEZA 4JRPA 3DRPA 1S1WA 3TAFA 4LY7A 3V6DA 5L1IA 1KHVA 3OYKA 1RT6A 3LP2B 3RB6A 1W0HA 3LWMA 1RYRA 3CWJA 4RG8A 4KO0B 5T7BA 2XO7A 2FLPA 4ECZA 1HNVB 5DK5A 4Z4GA 1WSFA 3PX6A 2D0BA 4J9PA 1I39A 3V9WA 4ELUA 2C2RA 1S9FA 2IOCA 2QKKA 1RBUA 2OPRB 1IM4A 4RU9A 4KTQA 4GC7A 1JXBA 1HARA 3NBPB 1S1XB 2OPQB 4HUEA 5KG2A 3AA3A 2WK4A 3AVBA 1RA7A 3I5CA 3KLHA 4KAIA 4DL6A 2HVHA 4PQUB 4DTPA 1HQEA 3QNNA 3K59A 4CEOA 1HNIB 5T14A 4M3TA 4B08A 2A1RA 4Y2CA 4G1QA 4ID5A 3S3OA 3V6JA 4HCBA 1KVAA 1RT4A 3P5JA 3CDUA 1S6QB 5KT5A 3SUQA 3E01B 2R2TA 1LW0A 3I5BA 2VG6A 2OYQA 3H59A 3CIZA 4KB1A 4LQ3A 3OYBA 3G10A 1WNEA 1T03B 1S10A 4MFBB 4HTUA 4FK0A 4RNOA 1L3UA 2E6LA 4FJJA 3SV3A 4EYIB 1NJWA 1TKXB 4F4KA 4FJ7A 1HRHA 2PYJA 2B5JA 1SL1A 3DOLA 3OYMA 1J54A 4PY5A 1N5YA 2FVCA 3QEVA 3QGIA 1YTAA 2OPPB 2G8KA 1D9DA 4M41A 5JUMA 1HMVB 1RBSA 3GIIA 1C1AA 5F8HA 2F96A 1A5XA 3LP0B 4WZMA 2ASLA 1S97A 3VA0A 1JLBA 3MEGB 4DTSA 3KK2B 4FBTA 1S0MA 3M8QB 4FVMA 1XC9A 1C1BB 2CJQA 2YV0X 4AILC 4CJ4A 5I3UA 2W9AA 3L2WA 1BIUA 2R8JA 1TGOA 4DL3A 5F8MA 3HPHA 3KJVB 4H4MB 3BSNA 2ETJA 3OYLA 1HNVA 1NK8A 3G6YA 1NOYA 3LZJA 3TQ1A 4JRQA 3KIOA 3PW0A 3OHAA 2XCPA 4Y34A 1UOCA 4OKEA 2KQ2A 1T94A 4CHNA 4CJKA 3VQSA 3NL0A 3TAEA 4QWCA 1TKDA 3UR0A 4CJSA 4Z4CA 1OS5A 2W9BB 5J2MB 4QWDA 2ATLA 1ASVA 5KFQA 1SV5B 2F8SA 3PO5A 3H4DA 4E7KA 2KFZA 3KLFB 2HMIA 4NCGB 1RT4B 1NK6A 4N76A 2OPSA 3IG1A 3PX0A 2W9CB 1T3NA 2IM3A 3MXIA 2E9TA 2AQ4A 4CJRA 3M9MB 2DTUA 4HHTA 1D5AA 4TN2A 1Z26A 4KHWA 1NK7A 1KSPA 4TXSA 3OYFA 2BE2B 5KFUA 3VQQA 4HVJA 4NLYA 4RW7B 1NNDA 4ED7A 2Z1IA 4BE0A 1N4LA 3BQ0A 2GIRA 1TQLA 3VQ8A 3KOAA 3OYIA 3D0PA 2XY8A 4FJKA 3U3YA 1TP7A 1TKXA 4F8RA 3GV8B 3OL9A 1J9AA 2HVIA 1B92A 5HBMA 3H2LA 3DOLB 5KFDA 1KLNA 3QO9A 3O3FA 1N5YB 3DLGB 3HJFA 3QYYA 3V9SA 3C6UB 1HPZB 1NK9A 1RT3A 3AVNA 3OJUA 3B6OA 2HHUA 1RT5A 3WNFA 3Q8PB 4O3RA 4QAGA 2W8KA 3EY1A 3AVCA 1QQCA 3KK2A 5KT2A 4I2PA 3PVXA 4RW4A 4ZP8A 3V4IB 3MR3A 1C1BA 3IRXA 4MK7A 4CGGA 3LALA 4CF9A 3KLGA 3RBEA 4KTZA 2G8VA 1QAIA 3ZT4A 4QOZB 1S0NA 1JLEB 3BR9A 4WXWA 1Q8IA 4O3NA 4QW9A 1LWFB 4ZHRB 4IH5A 2B4JA 1NJYA 4E0DA 1VSIA 5KG0A 4CJ3A 3KLEB 3V81A 4OLBA 4CECA 3O3GA 2DY4A 4H8KA 3SUNA 4WZQA 4CCHA 3HPGA 4KHRA 4KBIA 4URGA 3I0RB 2IAJB 2YHBA 2B6AB 2D41A 2GUIA 4J9KA 3V1OA 2XC9A 4EEYA 1J53A 1JLFB 4FJXA 3HKWA 3DRPB 3AO4A 2IMWP 1FK9B 1NJXA 1C6VA 3RR8A 1Z25A 4KO0A 4WFYA 4JS5A 2G8FA 1EP4B 5KFEA 2UVVA 5L1LA 2X74A 1KRPA 4NLVA 2W9CA 2YKMA 3Q8QB 3LAMA 2I5JB 2OPRA 4CIFA 2RKIA 1JL2A 2FLNA 4K4ZA 3PUFA 3V6KA 4M45A 3DLHA 1JLQB 2IM2A 4NRTA 2YNGB 3T5KA 1ZBLA 2AGQA 4KHMA 4M3WA 4Q5VA 3PW5A 2VA2A 4CJUA 1LWCA 3ZSXA 1S1TA 2J6TA 3M9OB 2GIQA 4CGHA 4W5RA 1LAWA 4K4UA 1T8EA 5KTQA 1BI4B 2R8GA 1XHZA 1QTMA 4EZ6A 3U6FA 4BWJA 4ZMMA 1IKVB 5E41A 1XR7A 5DQIA 5SWMA 4FS1A 3JYTA 1NOZA 2D0AA 1Q9YA 3ITHA 3C6UA 1HPZA 4R8UB 3V6DB 1BISA 3LP2A 3B6PA 4FJMA 3AVIA 3IGVA 4CHQA 4QW8A 4H54A 1HYVA 2HHVA 4FS2A 3V4IA 4Q45A 4WYWA 3NCIA 3KK3A 4O0JA 5KFFA 1WSEA 1CXUA 2JC0A 3VQCA 3Q8SB 1TAQA 5KFKA 5KFBA 4DS5A 3BGRA 1RT1A 1RDCA 4LD0A 4AHVA 1HQEB 3HM9A 4WFZA 4HKQA 1NHVA 1RBTA 3DI6A 2C2EA 1RNHA 3ZSRA 2HHQA 4QWBA 2G8WA 4GVMA 4C8KA 4FM0A 4ID5B 3OS0A 3VQ7A 4DTNA 1VK0A 1D1UA 5KFLA 4KHNA 2HHWA 4IOBA 3FRZA 1K1SA 4OGCA 2P5GA 4J2DA 5CYMB 5I3UB 3KD5E 2HWIA 5CYQA 1FK9A 4TY8B 3OL7A 5KRTA 1RBVA 4CK3A 2UVUA 1TKTA 2FVQA 4CJFA 1JLGB 2FVRA 4GC6A 1G15A 2Y1IA 3SQ1A 3OSPA 1T03A 3M8PA 3DMJB 4FLXA 3HXMA 1DTTA 4FYDA 3IN5A 2YKMB 5C24A 1CXQA 3RRGA 4KB0A 3LZIA 4ZP9A 4KHYA 3NAHA 3H08A 2Z1JA 4NRUA 1SKWA 4IDKB 4NLDA 1EX4A 4RW6B 4NLUA 4FW1A 4N5SA 2YNGA 3QIDA 2YNFB 2PZSA 3ZSQA 1S4FA 5J2MA 5KG4A 1BCOA 3MR2A 3KMQA 4DTUA 1WLJA 3FSIA 1SV5A 5HRSA 1U49A 4ZVEA 5L1JA 2BQ3A 3QZ8A 1JLBB 4XPCA 3F73A 2VWJA 3BDPA 2VG5B 1VRTB 4TYBA 4JLHA 3MEDB 3HPOA 4M3YA 4QPXA 4CEDA 2XHBA 3GIMA 4TLRA 4Q8FA 3AVHA 2PY5A 2BE2A 4Y3CA 1D8YA 2V0NA 3KJVA 1S9GB 2ZE2A 4M42A 3GILA 2HW3A 3FFIB 1CLQA 4ZTJA 1T05A 2A1SA 4YNQA 3AA2A 3L3UA 5KRSA 4NLTA 4DU3A 4FK4A 5HBMB 4IFYA 4YQWA 5CZ1A 3QO9B 1BQMA 2VG7B 2IM0A 1XHXA 2BQRA 4RNMA 4K4TA 4DQIA 3RAQA 1ZETA 3LAKA 1BQNB 3DI6B 3OYGA 1S1UA 4IFVA 1IO2A 1C0TB 2FVPA 3QEWA 3V9UA 3OLAA 2HMIB 3L2VA 3QNOA 3ZSYA 3QEXA 4EBCA 3DOKA 3HO1A 3QIOA 2FBYA 3CG7A 1U09A 4NYFA 4DFPA 4TY8A 3BSAA 2QXFA 2P1JA 2FC0A 4DSKA 2PYLA 4DQRA 4LSNA 3ZT2A 4LH4A 3OYJA 4KFBA 4DTOA 3HP9A 2OZSA 1DTTB 3S9HA 3HP6A 2XGQA 4ELVA 2UVRA 1C0MA 4ED1A 4CJLA 1K6YA 2NUBA 3CFRA 3RBDA 2OZMA 4MIBA 4B9UA 4RW6A 2KFNA 2YNFA 4U7CA 4IQXA 4KV8A 3D45A 1JLFA 4FM1A 3VQ6A 3KNAA 4J9NA 1WAJA 4Q43A 4K8XA 1C1CB 2DFEA 4JV0A 1U04A 4LSLB 5K14A 2ASJA 1VSMA 1RT5B 4CF1A 4W5TA 3CQ8A 1RTIB 1VRTA 1YVFA 2R2UA 4I2PB 2R7YA 4NYNA 3N6NA 4RW4B 3MEDA 3BSCA 3TI0A 3NH1A 4CK1A 3IRXB 4IBNA 2V9WA 4F3TA 3NGIA 5HLFA 2RKIB 1S1VB 2HAIA 2AGOA 2YNIB 2GC8A 3GIKA 3DRRB 5KFOA 4DFJA 3K57A 4CEBA 1S9GA 2ZE2B 1Z4UA 3D5MA 3KLEA 1LWCB 1U45A 2JEFA 4I7FA 3HT3A 4FLZA 4IR1A 1C2PA 3QESA 1SL0A 3AO5A 4IKAA 4RNHA 3SNNA 5KFVA 3AVAA 1BQMB 2IAJA 3NFAA 1J5OB 1S49A 3KLIA 1IKYA 5KGXA 2FJXA 4F50A 4FJ9A 1EETB 1LWEB 1MU2A 3RR7A 3I0SA 3RRHA 1BQNA 5DQHA 5KT6A 4KREA 4FLWA 2XY7A 4B8CA 2AWZA 4FLVA 3PR5B 4BACA 4J9RA 2OH2A 3PW2A 2WCXA 2O4GA 3VQ4A 4Z4EA 2R2SA 4IH6A 1ZBUA 3MEEA 4J9LA 4E1NA 3IGNA 4WE1A 4O5BA 5CY4A 5KT7A 3QEPA 3AO3A 3TAPA 3UDLA 1JLQA 5KG7A 1RTHA 4FXDA 4CJ5A 3WNGA 2ZD1A 3QIPA 4JV1A 4LSNB 4EBEA 3JSMA 2IS3A 5KFAA 5EDWA 4B9SA 2F8EX 3Q8RB 1HQUB 5L1KA 5J2NB 4FJHA 5F9LA 1WSHA 2UUWA 2RDJA 4CGDA 4CJEA 1QSSA 5CYMA 3MFHA 5CYQB 4ZPDA 3CJ0A 4DSEA 4LSLA 5F8LA 1RTJB 1JLGA 3E51A 4XO0A 2QV6A 1I6JA 3HL8A 4EBDA 1TKZB 4AHTA 4PUOB 1JLAA 1SL2A 5HROA 4IG3B 4RNNA 1L3VA 1N56A 1S1VA 4OKKA 3NF6A 4CK2A 4FBUA 3OL8A 4CGJA 3PR4A 2C28A 4JUZA 3KLVA 3RAXA 3DRSB 4RUCA 3BGRB 1CZBA 1SKSA 3SJJA 4C8OA 1FKOA 5HP1B 1QE1B 4I7FB 3HSTB 2BDPA 4NLQA 3SPYA 1DTQA 3LP1A 5KT4A 1TL1A 5J2QA 3ZSOA 2VG5A 2J6SA 1KTQA 3TWHA 1HYSB 2BRKA 4MK9A 4ZVHA 2WHOA 3SI6A 3OL6A 3KLFA 5EU7A 4FK2A 1ITGA 3T19A 5KFGA 5F9NA 1NK5A 1TL3B 1TKTB 4M3ZA 2Q3SA 4K4YA 4DF8A 3RB3A 4CJQA 4K4VA 3TAMB 4K4WA 3OYEA 4DL4A 2D3ZA 3DMJA 4FZZA 1T05B 3QEIA 3MEEB 4KKOA 4F4YA 4I9QA 2R8KA 4KTWA 4FM2A 4B9NA 4ECQA 5KGWA 4MKAA 2FLLA 2VG7A 4IDKA 4CF8A 5JS1A 1RT7A 2UVWA 3DDKA 1RDDA 2ZD1B 3QIPB 3P1GA 3PO4A 2KTQA 3V9ZA 2RF2A 4IR9A 3ZSWA 3DLKA 2ZKUA 4CFBA 3M8RA 1D9FA 2LSNA 2WRMA 4FW2A 1HQUA 4I2QB 4Q44A 1C0TA 3AVKA 4ECSA 4E7JA 4MKBA 5KFZA 4K8ZA 4K4XA 3NH2A 1Y97A 4O44A 1SH3A 3F9KA 1S6QA 3PW7A 2XCAA 2P5OA 1TV6A 4YR0A 3PHEA 4DTXA 4KRFA 4O55A 3V9XA 4TQSA 3WNHA 3SYZA 4CHPA 4NLGA 1U47A 4FZYA 5SZTA 1TK5A 4O3SA 1ZYQA 4WYLA 4YP3A 3C95A 3ISND 3VQDA 4Z4FA 4FLTA 4KFBB 2FJWA 3BQ1A 3FFIA 2YKNA 4C8MA 4YFUA 1JLCA 3T5JA 3MF5A 4Z4HA 2B5JB 2IC3A 4DG1A 2FBTA 1S6PB 2J6UA 2C22A 4BDPA 2HNZB 5J1EA 2OPPA 5J2PA 4KI4A 3QZ7A 2O5DA 1QS4A 5KG5A 3H98A 1GOBA 1FKOB 1QE1A 2V4RA 3IAYA 4RW9B 4CJTA 1GOAA 4B9VA 1DTQB 4J9SA 3LP1B 4F4WA 5EWFA 3CO9A 1ZBFA 3ISNC 5KG1A 4H4OB 4KB7A 5JS2A 1NJZA 3LPTA 2BGGA 1I3AA 5DLGA 5HRRA 1T7PA 3NAIA 4NLPA 4N56A 4GMJB 2QE5A 4O3OA 2XY5A 3OYHA 1UWBA 2WB4A 1RT6B 1JIHA 4E7IA 3NH0A 2JLEA 4YR3A 2ZQBA 3PW4A 1JXLA 4ZTFA 3UIQA 4KKOB 4N47A 3S3MA 3CJ4A 5KI6A 4DU4A 4OLAA 3HVRA 2XI2A 2OPQA 1J5OA 1RT7B 3O4NA 4Z0UA 4CFCA 4E89A 3TARA 2W9BA 3KLHB 2AJQA 1X9WA 4PQUA 1RDRA 4NZ0A 2HNDB 2BQUA 3MFIA 1XWLA 1C1CA 3CJ3A 3ZSVA 4DSFA 5KFIA 5FRNA 4FJ5A 2G8HA 2WOMB 1ZTWA 4G1QB 1TK0A 2QKBA 2DPIA 4NCGA 2OPSB 3IG1B 4J9QA 1TVRB 4CGIA 1LW0B 3ASMA 1SKRA 4URQU 4W5OA 5I42A 2VG6B 5EUHA 2P51A 1VSDA 3ZCMA 1C0UA 4Q0BB 4M3XA 2Z1GA 4RW7A 2V4QA 1NKBA 3I8DA 1UAXA 3JSMB 4E7LA 3OY9A 1NKEA 2E9ZA 4PWDB 1KHWA 4QWEA 4E19A 1O1WA 3TAQA 1EKEA 3SFGA 3V1RA 3K2PA 3OYDA 3HVWA 1GX6A 2IC3B 1QHTA 3DLRA 1S6PA 1CSJA 2GV9A 2EC0A 5J1EB 4ED3A 1LV5A 5J2PB 4J9OA 2W8LA 4CIGA 4DL7A 3AO2A 2Y1JA 1MU2B 1IKXB 3I0SB 5C5JA 4DEZA 1X9MA 4BDYA 3NGDA 3H4BA 2JC1A 4AHRA 2D3UA 4H4OA 3M8QA 3K5NA 2EHGA 3K5MA 4ECUA 4CF2A 1A5WA 4Z4IA 4QWAA 5DLFA 3KK1A 1WSIA 1MMLA 5HRPA 3RMDA 1VSKA 4NCBA 1JLEA 3EZUA 3ALYA 3G0ZA 4E1MA 3S3NA 5F8GA 2FBXA 4CE9A 3DRSA 4B3OA 4F4XA 1S5JA 1HJRA 3NDKA 4BE2A 1EXQA 1N6QA 4IG0B 3TAGA 3T5LA 2D7SA 4RUAA 3NF7A 3RMCA 5KFYA 5J2QB 3ULDA 5C25A 1IKWB 3CM6A 3RMBA 2XI3A 3MR6A 1RT2B 1KVCA 2JGUA 3VA3A 1U48A 3OS1A 3G6VA 2HNDA 1RDBA 4EP5A 1RTJA 3BSOA 2F8TA 1NKCA 2JEIA 3LWLA 1EP4A 3DM2A 3H5XA 4PUOA 3OSNA 2KZMA 4MQ3A 4CJPA 1FKPA 2DPJA 1L5UA 1REVA 2I5JA 4IG3A 4WXOA 4TY9A 1ZBHA 3MXMA 4Q8EA 3C94A 4CHZA 1WN7A 3D28A 2YNHA 3DYAA 5F8JA 3CFPA 4CESA 4NCAA 2RF2B 5KFXA 1S9EB 4PWDA 3FQLA 2AU0A 4F2RA 4FJ8A 3CDWA 4B8AB 2ATQA 3EYZA 1BGXT 1BI4A 3EPGA 1TL1B 3RB4A 3MR5A 3KHRA 5CZ2A 4O44B 3TANA 4QCLA 4U6PA 1HYSA 2E9RX 4OKJA 1TV6B 2C2DA 1A5VA 1VRUA 3ITHB 1SUQA 3EPIA 4CEQA 4K50A 4ECYA 1IKXA 4DSIA 5KFSA 4DQPA 2ILYA 1WSGA 4R0EA 1TL3A 2DFFA 4EP4A 3NMAA 3KTQA 4ZVFA 4DFMA 3ZT1A 3NF9A 5KFTA 3OVNA 3HVTA 3TAMA 4DL2A 4ZP6A 4ECWA 4B9MA 2YKNB 2X78A 4BWMA 1BCMA 2D0CA 4NLOA 3SV4A 3HVAA 4DSLA 3KLGB 3RTVA 4OVLA 4DG1B 1RCHA 3CJ2A 2RPIA 3SUPA 4C8NA 4DQQA 3L3VA 1RDAA 4FJIA 4DQSA 3I5AA 3H5YA 4XPEA 3V81B 1RT1B 1X1PA 1F21A 3LPUA 3DLKB 3HYFA 3MAQA 4ECTA 1ASWA 1VSHA 3GYNA 4I2QA 2W42A 2XY6A 4GW6A 2ILZA 3O3HA 3SQ0A 3VQBA 4MK8A 1RT2A 1QUVA 5DQGA 1L3SA 1K1QA 3EZ5A 2VWKA 3MECA 1UWBB 4RNFA 2AX0A 3AVFA 1D0EA 4LH5A 3PX4A 4CIEA 4IH7A 3N6MA 4OGEA 4HUFA 3OS2A 3DM2B 1X9SA 3M9NB 2HHTA 5KFJA 5FDLA 5C24B 1FKPB 4IRDA 2IDOA 1REVB 5DG9A 4CERA 3KD1E 3OYAA 4CFAA 4CEEA 3NHGA 2YHAA 3IS9B 3KHLA 2HNZA 1R0AA 3DYAB 2YNHB 1DLOB 3T1AA 4WFXA 2WONA 4E7HA 2I1RA 4CEAA 5F8IA 2OA8A 4MH8A 2EX3A 3LANA 2JEGA 4RW9A 5KFRA 2WOMA 1RTDB 5C42B 1GOCA 4L8RB 5DGAA 4O4GA 3AV9A 3DLEA 3TVKA 2HNYA 4J2BA 4CHOA 2XWYA 1GX5A 3OYCA 1IKVA 3PJWA 4JV2A 3JYTB 5I42B 4TYAA 3SCXA 1SUQB 3NAEA 4W5NA 4R8UA 3VN5A 1C0UB 4Q0BA 4K4SA 2XGPA 3RMAA 1QSLA 2R8HA 3CYMA 1W25A 2FVSA 3SI8A 3K5LA 3HVTB 3QGHA 1S0OA 4FJLA 3P83D 4DL5A 1W9HA 1XI1A 3KK3B 4G3IA 1XR6A 4NYZA 4IFYB 1JL1A 2HHXA 3GQCA 3AVLA 5D3GB 3QLHB 3NF8A 2BR0A 3PY8A 5FROA 3AA4A 2KZZA 2BANB 2XRIA 1WSJA 4PA1A 3U3GA 1KFDA 3L2QA 2DFHA 4ICLA 3PJXA 1LW2A 1S1UB 4IFVB 4KAZA 4O3QA 3GIJA 1VSLA 4B9LA 3M8SA 4RW8A 3THVA 3VQ5A 1TVRA 3DOKB 2HB5A 3C6TB 2AX1A 4HCCA 3TABA 3KK1B 4ZP7A 4R5PB 3H40A 4ZPCA 4ECXA 3LDSA 4NLRA 4CJWA 5HRNA 3HK2A 4FJGA 4CF0A 1RAJA 4FZXC 3FDSA 4YR2A 1L3TA 3M8PB 2G8IA 4B3OB 2X6NA 1N6QB 1HYZA 5EWEA 4IKFA 4M95A 5KG3A 4ED0A 2IM1A 4NLSA 2IJNA 5KFNA 3BQ2A 5C25B 1BHLA 4OPKA 3NBPA 3FQKA 3NGZA 1S1XA 3AVGA 3IS9A 3UPFA 1KCFA 4EZ9A 3QETA 4KV8B 1RA6A 3L2RA 3QINA 1JX4A 1LAVA 4C8LA 3GV5B 5DMRA 3WNEA 1HNIA 3V1QA 1RBRA 5K14B 5EWGA 3N6LA 3SUOA 1TAUA 3QERA 3BREA 4IRCA 1BIZA 4CJVA 1NHUA 4W5QA 5KG6A 5DGBA 1RTIA 1JKHA 4BE1A 3T5HA 4DFKA 3E01A 3PV8A 3KHHA 2RN2A 3CDEA 1VSEA 1B9DA 1S1WB 3ICLA 1SH0A 4CEFA 3VQ9A 4FJNA 4B9TA 3TR8A 3DRRA 4ID1A 4F3OA 2ASDA 4ZVGA 1VSFA 3SQ4A 4DF4A 2ALZA 1QSYA 5KFHA 3A2FA 3G6XA 4IG0A 2JEJA 1BL3A 3KMSA 4AHSA 3L2UA 2FBVA 4MIAA 4ZPBA 1IKWA 1UA0A 1KLMA 2IBKA 2G8UA 3KLIB 2CKWA 2FJVA 1VRUB 4HUGA 1TK8A 4DWIA 4DSJA 4ED8A 4UQGA 3RB0A 4CFDA 4Y1DA 4CHYA 5DG8A 2X6SA 2AGPA 4ELTA 3AVJA 2R2RA 3MEGA 4AHUA 4EO8A 4OL8A 3OJSA 4FCYA 4O4RA 4J2EA 3AO1A 4KHQA 4N41A 4R5PA 1NK4A 1RTHB 3L8BA 4DLEA 4F4ZA 2R8IA 4MFBA 5FRMA 4EO6A 2W7PA 4Y1CA 1S9EA 5KFWA 1RILA 3AA5X 5J2NA 5KT3A 3OYNA 4ZPAA 2HWHA 1XR5A 3BJYA 1NK0A 4KSEB 4OPJA 3CJ5A 3VQPA 3ZT3A 1VSJA 3MECB 3ZT0A 1HMVA 3LP0A 2IJFA 4TSXA 5DG7A 4NLXA 3OHBA 3NKYA 4M3UA 3O4QA 4M94A 4X2BA 4EYHB 1TKZA 5KFMA 3LP3A 1JKHB 4J9MA 5FDLB 5HLFB 3KHGA 1WAFA 4HYKA 4O0IA 3MXJA 2YNIA 4KE5A 4DTMA 1IG9A 1U4BA 3DLBA 1ZBIA 5JXSA 4H4MA 1DLOA 2WONB 4KHSA 4ED2A 3SQ2A 3CVKA 3K58A 4KHUA 1UA1A 2WTFA 3G86A 4XIUA 1CZ9A 5C42A 4O4GB 3DLEB 3CM5A 1KLMB 4CGFA 4I9LA 1IKYB 1SH2A
chains in the Genus database with same CATH superfamily
2ROPA 1B7YB 4O3PA 4AHCA 1LWEA 3KUHA 4KHPK 2F8HA 2EG2A 2DHHA 2L41A 2E4LA 1RHJB 3OLBA 1E3MA 3VGUA 3FMBA 1N48A 3H5UA 4WE1B 1OY6A 3H5SA 4CH7A 4PL8A 3NEKA 2RRNA 4OZ0A 4WQ4A 2RDDA 2MLZA 1PC4A 1IBLF 4CLZA 5DM6Q 3DGPB 4IOAL 2ZEJA 4FLUA 4G1IA 2MZ1A 1ZOTA 2O4IA 1RTDA 4DR7J 4Y2IA 3KXDA 3DLGA 2KM8C 2DCUB 1TTHB 2KRBA 1BG3A 5L9XA 3ZSZA 4FLYA 1IR2A 4OYPA 3PM9A 1ZTTA 3THPA 1A0OB 1WNSA 3KKSA 4M5DA 5E33A 3NGRA 4DTRA 3CMQA 3A5OC 2QK9A 2J9EA 3VF6A 1H7WA 4DTJA 1VGYA 4KHPF 2VFUA 4TQRA 2YKAA 3TTFA 4USVA 1ASUA 4RZRA 1OQ3A 1Q7YO 1NGIA 4JKBA 2NXUA 1AUSL 3OVAA 3O9SA 4ZHRA 4USTA 1X4DA 3KKFA 2M88A 3NS6A 1OYEA 1Q9XA 4M3RA 3M7VA 2CPZA 2VA3A 4A5BA 2BJEA 1N52B 3NGYA 1YVNA 3CJ8A 1JXEA 4HR2A 3LH2S 3VGLA 4URSA 2OFGX 3Q8VA 2OHDA 3PSIA 4NXMK 3QT7A 4UT4A 5B0DA 3QPIA 3TAFA 3V6DA 5L1IA 1M5SA 1Y64A 4RX6A 3LP2B 3LWMA 3I56S 3CWJA 3SCLE 3RW7A 3OR1A 1OY9A 4ECZA 3AD9C 4YORA 1WSFA 2NXJA 1UFLA 1GLDG 3T6JA 4J9PA 3VZHA 3LDOA 2IOCA 1RBUA 2CWKA 1JXBA 3NBPB 2OPQB 3C7NA 4HUEA 3CMEN 5AQPA 5AZIA 3T1YJ 4ISEA 3QNNA 1FNXH 4CEOA 4M5LA 4HWIA 1M0SA 2GGPB 4M3TA 1SS6A 3S3OA 5BPNA 2H5EA 3WX8A 5HK4A 4GV6A 1FO1A 3SUQA 3A5LC 3FEYB 1SI9A 2VG6A 1GLAG 1I94K 3CIZA 2E20A 1NGEA 2BV3A 3R1XA 4LQ3A 3R2CJ 1VJQA 2BOPA 4HTJA 1X0FA 3R97A 4HTUA 4RNOA 3M30B 1KVJA 3SV3A 3GBTA 1NJWA 4F4KA 1VQ9S 2B5JA 1J54A 4WQ5C 4ZCIA 2FVCA 4CBUA 3QGIA 4A2BA 2OPPB 1RE1B 4IOCL 2ROEA 5JUMA 4LF8J 1RBSA 5F8HA 5IC6B 3P4UB 4PZVA 4IUFA 3VA0A 2JWKA 5AXMA 2YXLA 3KK2B 2WVFA 3TR5A 2RRBA 4CJ4A 5I3UA 2W9AA 4PAAA 4DL3A 3G71N 4X66F 2LU2A 1RGVA 3BSNA 5AQYA 3DXSX 2ETJA 1NK8A 1NOYA 3TQ1A 5HO4A 3PW0A 3DXMA 4OX7A 2XCPA 4LF1A 1RHRB 2KQ2A 1T94A 2XM3A 2W40A 4BREA 1YWXA 4YDUC 3T6BA 1A9NB 1TKDA 4CJSA 1HNZJ 3TUPA 1S0VA 5J2MB 4QWDA 4DKWA 4LF8F 5BRFA 4H0TB 5KFQA 1GFWB 1D4XA 2F8SA 2DNYA 2J9CA 2HYIB 2YTCA 1HPMA 4CT8A 3BGFA 4QJVA 3H4DA 2KFZA 1RAAB 4NLBA 2NXEA 3FJ2A 2ZBRA 2FSJA 2IM3A 1H74A 1V6HA 2V2KA 3M9MB 4TN2A 4KHWA 3VQQA 5KFUA 2B7CB 4RW7B 1NNDA 5D4OA 5GAGU 1BMQB 2GIRA 5HMYA 1TQLA 3VQ8A 3ZYYX 3DGPA 3SQGB 1MA9B 4IOXA 1RGIA 1TP7A 4F8RA 2EK1A 1FRXA 1CS4A 1N5YB 3CPEA 1DEJA 5HI7A 1NMEB 2XZDB 1EB0A 2B4VA 5AQMA 3C3LA 3C6UB 4YB6A 1HPZB 2DPNA 3J80Y 5CH7B 1OO0B 3B6OA 2NCKL 4USJC 1Q7LB 2HHUA 2KFYA 3JXOA 4DPUA 3ETOA 4ILGB 3P31A 3TJ9A 4BBYA 1PBAA 3TX0A 3LALA 3EUNA 3QICA 2G8VA 3ZT4A 4LSZB 1S0NA 1Q8IA 3R5DA 4O3NA 4QW9A 3ZETB 4ZHRB 4IH5A 1NJYA 1WG5A 5KG0A 2ZZMA 3KWIA 3VCDA 5IQ6A 5HMWA 3J8AA 3M5RA 3KDOA 4BC2A 1OIAA 4CCHA 3WQUA 2BM1A 2YQ3A 3N4WA 3I9ZA 4URGA 1ZAVA 3I0RB 4V1Ak 4BLGA 2GUIA 2DIVA 4J9KA 3UDEA 3I55N 2MQOA 2XC9A 1JLFB 2KHDA 3DRPB 3GIRA 3M2VB 2HHHF 2IMWP 1FK9B 2RUGA 1UWAA 2A0FB 4WFAQ 2XMVA 3QT8A 3JTPA 2G8FA 1EP4B 2UVVA 2H48B 2V8PA 2XO6A 2W9CA 1YXQA 4F36A 2YKMA 3VR1A 2VPZB 2I5JB 3Q83A 1AW0A 4CIFA 1NM2A 2RKIA 4K4ZA 3NNCA 4JK7A 4DV0K 3PUFA 2P9UA 4AF1A 4NRTA 2HEKA 1IR1A 3ZZZA 5JMNA 1ZBLA 2Q6BA 4MJKA 2DGWA 4X4PA 3HFKA 4M3WA 5JMVA 4CJUA 4KPCA 3HHLA 3M4XA 2J6TA 4FWNA 2WUSA 4W5RA 2OTLN 2CNOB 1LAWA 4CVNE 4DR7F 5KTQA 3CULA 2ZH2A 5A2QO 1XHZA 5LT5A 4L3NA 4OX9K 4CZHA 3U6FA 1EJ7L 2KH9A 1WD6A 2JZ5A 4ZMMA 3G82B 4JI0F 5SWMA 2R3VA 4OYBA 2JFKA 1NOZA 2Q2RA 4R8UB 4RJVA 4FKYA 2MSTA 5GMKa 4Y00A 1FWPA 3M32A 3LTOA 3IGVA 2HZCA 2NS1B 4QW8A 3GYGA 1G2EA 2HHVA 4LREA 1RWOB 5JVGQ 4KHPJ 1Y0HA 3V4IA 5M2UA 4WYWA 2C3MA 2ZHBA 1YKWA 2MMYA 1JJHA 1EKSA 3M6GA 1N32J 4QIFA 2CUYA 1WSEA 2QM1A 1SVDA 4O8UA 5GINA 3W1YC 3VQCA 1TAQA 5E3CA 2LFVA 4CZGA 1WC0A 4B3TF 2GMJA 1NHVA 2A3JA 1RNHA 1X4BA 2G8WA 4GVMA 3MMBA 3J81O 2FC8A 4U7UD 1KQSR 2GTDA 3OS0A 2ZM6K 3FZKA 5AQZA 1K1SA 2P5GA 2EFPA 5CYQA 2IRUA 1FRJA 1RBVA 1X3NA 4BROA 2UVUA 4C23A 1TKTA 4FP9A 2QEXN 2A6OA 4CTAA 4ZLPA 2F4VF 3N5BA 3M8PA 4FYDA 1CXQA 1NXIA 3WC2A 3D2EA 2IVYA 4IO1A 3B82A 1SKWA 4NLDA 4N5SA 2YJEA 4B17A 3QIDA 1CULA 2PZSA 3MWBA 4OX9F 4RWTA 3LGHA 2N4DA 3ZSQA 5J2MA 2ATCB 3MR2A 3B54A 2C2OB 4Z7CA 4O8KA 3UR3C 1WLJA 3WEEB 5JVHQ 2QO3A 3FSIA 1X4EA 1U49A 4ZVEA 3UD3P 2M2BA 1NPRA 2DYAA 4CBWA 1CJTB 4XPCA 3BDPA 2VWJA 1VRTB 4PWUA 1O0PA 2OD4A 5G0RA 2YHYA 2GVZA 4CEDA 3AY9A 2JRSA 4Q8FA 4X4NA 2B4UA 2UV8A 1LFWA 4OYXA 4CI0B 1T6CA 1FD2A 2YI1A 5A8RA 3GILA 4CI6A 2BJ3A 4R25A 2Q6CA 3K89A 1YRUA 2XMAA 4IFYA 3CE8A 1TL7A 1BQMA 2VG7B 3O3LA 1RAHB 2OIHA 1UMJA 6FDRA 3HMJG 2BQRA 3R5AA 2QWLA 4DQIA 4QR1A 1B70B 4JI3K 3T1HJ 3DI6B 3MAAA 2B9XA 3POTB 1XNQK 1S7IA 2XYPB 4FNIA 3GDQA 2K3IA 3L2VA 3QNOA 2HLTA 5ITHA 2AYMA 1RZMA 2XHCA 5AQWA 3BSAA 1WF0A 5DDRC 1MMDA 4DSKA 3I6PA 3I87A 2PYLA 2Z30B 1TUYA 5U47A 4LSNA 3TEGA 4LH4A 2EBGA 4NXNJ 3J7YU 1DTTB 1WC4A 4CD1A 3HP6A 4M7XA 5CA5A 3PKMA 3BS9A 5DM6L 4CJLA 1Z05A 2VGNA 4DMZA 1PC5A 3PFEA 2OZMA 1KAZA 2YNFA 3BGOP 4KH1B 2ZGZA 3FBCA 2UU9F 4JV0A 3H8YA 3SCKE 3RU0A 3CCSN 3CJ9A 2MGZB 3VTHA 1UZDA 2ASJA 2IDLA 3CJ7A 4RU2A 3CQ8A 2H4WB 1RTIB 2DKOB 5E5NA 4I2PB 4JNEA 4YN3B 4RW4B 1JJCB 1GXTA 3G8TA 3TI0A 3NH1A 3IRXB 4IBNA 2V9WA 2FHKA 1OH6A 4H5WA 2RKIB 3R1HA 1NGGA 4MLHA 2P5VA 3GR0A 1LOTB 4CEBA 1S9GA 2ZE2B 3D5MA 1U45A 2JEFA 1G7CB 2K1RA 3FE1A 3HT3A 3O1WA 2YX4A 3ILJA 3SNNA 2N3LA 3GJRB 3FNNA 5KFVA 4YDUA 3AVAA 3NFAA 1DQAA 3CQYA 3THXB 2FJXA 4FJ9A 4ZLNA 1EWRA 4DN9A 3QNWB 1BQNA 5DQHA 4IYQA 4KREA 4B8CA 1EO1A 3PR5B 4BACA 5BXIA 1FJGK 2C2MB 3KJNB 3A3OB 3HHNB 1FVQA 4RR5A 1HFEL 5F0XA 4A2AA 3BP8A 1JLQA 2FF6A 5KG7A 4LFCK 4GV9A 2ZD1A 1T02A 4JV1A 5KFAA 3Q8RB 2UZAA 5L1KA 2ZJPQ 3FLCO 4I6AA 2LMIA 2G13A 2HF3A 2HBMA 3MM6A 1QSSA 4CIOA 2HMPA 4ZPDA 1AXQA 4LSLA 2MLXA 2YQ0A 3MCAB 1X7VA 4EBDA 3D6FB 3CDAA 1TKZB 1UW4A 1UVLA 1SPBP 1HR0J 3FBEA 3K17A 2ZM6J 2EI5A 4M8LA 3BDEA 3D2EB 4QBUA 2UXCK 2B4OA 2XSJA 4DX7A 4B3SK 3ID8A 3JTNA 1WSRA 4QU6A 2KXFA 4ALZA 2JNJA 3DRSB 1VQYA 3BGRB 3AODA 4P7TA 1WOOA 3HSTB 4KH5A 3J80O 2J0QD 1DRZA 3LP1A 4PXBA 4FOEA 5KT4A 1TL1A 4AM7A 5J2QA 3ZSOA 1F9EB 1NB2A 1KTQA 1MG7A 2E1CA 5BN9A 1S59A 4Q2LA 1S4EA 2G9OA 4PYAA 5KFGA 5ETQA 1M90O 4X65K 5A8RB 4CJQA 4FWQA 5IM0B 1G1XA 3OYEA 3SEOA 4FZZA 4KKOA 4OHXA 2EEYA 4ECQA 2DRAA 3QFUA 5AQTA 4UOHA 1ZA2B 4FWSA 2MKSA 1RT7A 1NNEA 3GB0A 1Q86T 2AJ0A 4KYZA 3P1GA 3V9ZA 2RF2A 3EICA 3M2RB 4W90B 3ZSWA 3DLKA 3IP0A 1WKJA 3HI0A 4ISFA 3A5NC 1XMBA 4OI0A 1FFGB 1HWKA 4I2QB 3AVKA 1SQFA 4MKBA 4K8ZA 3POTA 5THWA 1Y97A 1S22A 4O44A 2VKRA 3A13A 3F9KA 2VH7A 1S6QA 3UKUA 3W2VA 1WHWA 4CNYA 1TV6A 2OELA 4DV2K 1HI8A 2EKNA 4O55A 3V9XA 4DV3K 2DNGA 4NLGA 5SZTA 1TK5A 3DU6A 2R7SA 3NOCA 4WYLA 4C8MA 4CO1A 1NSPA 2W2QP 5GIOA 1U8SA 3J81U 4Z4HA 2B5JB 1X4AA 3HULA 2GW8A 1NLKL 1QZ5A 2C22A 1IN0A 3QZ7A 3CCTA 5EX0A 1VQMS 2V4JA 5KG5A 3H98A 4EHUA 1FKOB 1QE1A 2V4RA 2XLKA 4RW9B 1CPZA 1GOAA 2ADCA 3CC4N 3H7HB 3BF4A 4F4WA 4V19J 1P1TA 5EWFA 3CO9A 1XN9A 1V5IB 2W6LA 1NJZA 5HRRA 3NNAA 1FI4A 2NRTA 1C4AA 2QE5A 5KOWA 3A8JA 1UVMA 3CSKA 1UWBA 2WB4A 3QAEA 3G71S 2Y1RI 4WWSA 2B8PA 4YR3A 4ZN1A 3CUNA 1YK9A 1V3SA 2J7UA 4WFNL 3BH6B 2UUAF 3S3MA 3B8HA 3BKUA 3BBBA 3JQMA 1FRMA 3CJ4A 5KI6A 4ILRA 1BE4A 3JAMU 3F5TA 4CFCA 3TARA 3MUVP 3WIUA 2QTWA 3M1VB 2W9BA 4I56A 1BQXA 1RDRA 1VC0A 3KK7A 4MMOA 2GJIA 1MW7A 1XWLA 5K8NA 2BQUA 3ZSVA 2VPYB 5KFIA 2FSKA 2CGKA 5B0FA 4MTPA 3AY0A 2NLXA 3MN7A 2AJ4A 1G6BA 1IBCB 4NCGA 2P9LA 4J9QA 2BABA 4YOVA 1LW0B 4PG5A 4W5OA 2P51A 1YQHA 5LMUF 5M1KA 4RW7A 1NKBA 2VU5A 3I8DA 4P71A 1SQKA 3MAHA 4ZDNA 2E9ZA 3E3XA 4QWEA 2M5YA 1O1WA 5DM7Q 5B7WA 3H1QA 3HVWA 3ZZTA 4ZLLA 4USHA 1CS4B 1QY7A 2QFIA 5F0UA 2EC0A 3AOBA 5J1EB 3CCZA 4RO0A 5J2PB 1RHKB 2Z0GA 2UU9J 2WC9A 3GLJA 3MGJA 4EK2A 1KP6A 3FMWA 3H4BA 3EGZA 1WG4A 2X3GA 3K5NA 4C3MA 1JWWA 4DHVA 3GTYX 2FXUA 1A5WA 1KOOA 4MIWA 1WBBA 1V9OA 1QJHA 1WSIA 1H6KX 1VSKA 2R7VA 5JVGL 2OAUA 4CE9A 3CCRS 3VEVA 3DRSA 2ZF5O 3NDKA 1SC4B 1EXQA 1N6QA 2RMLA 4C11B 3TAGA 2D7SA 4CWBA 4RUAA 3HHLD 3NF7A 3RMCA 2ZNYA 5KPZA 5C2DA 1FEHA 5KFYA 5J2QB 3ULDA 4PG4A 1IKWB 4QIWD 1MN7A 3CM6A 2XI3A 2BW2A 2OGUA 5AJ3F 3MR6A 2P2CB 4LF5F 4OO1J 2JGUA 4A8FA 3W65A 2DRBA 2Z4PA 3VA3A 1SQEA 3OS1A 3G6VA 4AXIA 3M8ZA 5EY4A 4C97A 2F8TA 4DUZF 5IXUA 4GMKA 4KH0B 1EP4A 3MTJA 2KZMA 2KB2A 1L5UA 2I5JA 5K9FA 1QVGR 4Q8EA 4B9QA 3T9NA 3CT9A 1YIJN 4CESA 3AA8A 5M1QA 4QOTA 2RF2B 3M2RA 3ENBA 4PWDA 2GHVC 3FQLA 1NH7A 4IOCQ 1OJ4A 5C0YA 3CDWA 4LFAK 4OI4A 3RGIA 3MR5A 3KHRA 4O44B 1HYSA 3OTBA 2F3JA 5B0EA 4JKGB 2DNQA 2ASPA 4B1YB 2DB1A 3ITHB 1SJ3P 3EPIA 3QDKA 1XIQA 3AQPA 4GVBA 3VF2A 4JI8J 2FGCA 1T11A 2RE1A 4DQPA 2ZFHA 2X51A 3NMAA 1HI1A 2XMMA 3ZT1A 4AQYJ 2QA4N 1HD1A 2EFVA 5KFTA 3OVNA 4HACA 4NXMJ 2U2FA 4DL2A 4I68A 3D67A 3VEZA 2X78A 4BWMA 2BA9A 4X4TA 1UEKA 2QA4S 4QQBA 3KLGB 4DG1B 3CJ2A 4U7BA 1XERA 1GLLO 2XBPA 3W2WA 2NYIA 1FESA 4DQSA 3PIOL 4WFBL 4HH0A 5D4PA 4OI3A 3OW2M 3QATA 3VZIA 2PI5A 1F21A 4AM6A 4BRLA 4JYAK 3MAQA 1ASWA 3GYNA 1F60B 5AR0A 1HHTP 4GW6A 1YBTA 3E66A 1I51B 3SQ0A 2C3OA 1RT2A 2CZ9A 4NOHA 1L3SA 2WVDA 2HGMA 2R7XA 2AX0A 1UAWA 3H42A 3FCWA 3PX4A 1QHAA 3MDQA 2A5XA 1GNKA 3OS2A 3EX7B 3M9NB 2HVZA 2MZSA 1ITPA 2HHTA 1RWXB 1QM9A 5C24B 4IRDA 1M5HA 2IDOA 4P75A 3EZOA 3OYAA 4CFAA 3H2VE 1K8AT 3KHLA 4M5NA 4XH4A 1R0AA 3DYAB 2YNHB 2DNPA 4LMZA 4E7HA 4CEAA 4DPXA 2OA8A 2W2PP 1FX2A 1WUAA 4JI5J 4UTGA 1EWQA 1CJVA 3QT6A 5KFRA 3OTOJ 3ZTRA 2LQBA 2VB6A 4PYDA 1VOMA 2HNYA 5GMDA 3T41A 3MWPA 1U1MA 4IXCA 4C3KA 4CLLA 1CQNA 3G8QA 5I42B 3P6YC 4TYAA 1SUQB 2Q97A 2AV5A 3VN5A 1YJNN 4Q0BA 1XUPO 3DOMB 3BBFA 4CRJA 1ZM4A 1QSLA 4YHHJ 2R8HA 1WTFA 2P9NB 3QMQA 4EI2A 1NCLA 2FVSA 3TUJC 1S0OA 4FJLA 3U1MA 4DL5A 3KK3B 3QRQA 3AVLA 3NF8A 3US5A 2QWOA 2WZ1A 3PY8A 5ETLA 2KZZA 2XRIA 3NCPA 1M1KO 4ICLA 1D3WA 1LW2A 1ZH5A 1WORA 3UE5A 1RAFB 4FPAA 4DR5J 1ILYA 5D0HA 2H51B 3THVA 3VQ5A 1TR0A 2E5LK 5JVHL 3PYFA 2R7RA 3C6TB 1BO5O 2HB5A 2AX1A 4HCCA 2CGJA 1EARA 4ZPCA 4BRQA 4DV5K 3LDSA 2VQEF 1W2BM 5ETRA 5HRNA 4RTFD 3HK2A 3TVZA 4M7YA 1L3TA 2FY1A 1N6QB 1HYZA 1Y3KA 1B4SA 2PMHA 3EKUA 4M95A 5KG3A 5KFNA 1UEVA 1N36F 3CCMN 1FE4A 2W4PA 2KG0A 2F1FA 3FQKA 4W92B 1PBUA 5TKWA 2F9DA 1NDKA 1OMSA 5H1SV 1RQ0A 2O67A 2XZWA 4CZIA 3QINA 3L2RA 4UY8T 4DR2J 3GV5B 2GCFA 1TUWA 3MPVA 2DGUA 3PYEA 2C2NA 3SUOA 1CLFA 3ATUA 4IRCA 5D8HB 2YCHA 2DHAA 5DGBA 1JKHA 2ABYA 3TTDA 2DNNA 3E01A 3GMGA 4ZVOB 4P10A 1XEZA 4I6YA 1B9DA 1FD8A 2XMKA 1SH0A 4OHZA 3FC9A 4FJNA 4HVZA 1HNXJ 4ID1A 2ASDA 1NM1A 4ZVGA 1VSFA 1IQTA 1X8DA 2RUSA 1QSYA 2O01C 3OVSA 4IG0A 3VGTA 2JEJA 1D09B 4AHSA 1HBUB 3HSJA 4BRFA 3L2UA 4KH6A 4ZPBA 3QSIA 1KLMA 3M8YA 2K7KA 2IBKA 4X4QA 4H03B 1VQON 4DWIA 1U2FA 4UQGA 2NPFA 1VQKN 4TU7A 4Y1DA 3VAMA 2D69A 3ET6B 2Z56B 3O2IA 2AGPA 4XH5A 3P5BP 2J7KA 4K43A 3UN2A 4FCYA 5A0YA 3DDNA 4JV5F 4KHQA 4R5PA 2CZ4A 2PFFB 1PO6A 1NK4A 1N36K 4J9VA 4F4ZA 4EO6A 2W7PA 4Y1CA 2V51B 4FL9A 4OZ5A 1S9EA 1OYDA 4FWPA 3AA5X 2DGOA 3RSEB 3C15B 3TYTA 1NK0A 1YJTA 1FWKA 3QB0A 4IO9Q 4OPJA 3CJ5A 3G4SN 1Y10A 5L9NA 1VSJA 3ZT0A 2HFUA 3JSYA 4UOGA 2IJFA 1CJKB 4TSXA 5DG7A 3BEXA 3U27A 3EVWA 4DUZJ 3O4QA 4M94A 5KFMA 2ZZNA 1WACA 2KJVA 2W1BA 3W5XA 2XULA 3SMPA 4J9MA 4RL1A 4B02A 4O0IA 4HYKA 2XSJB 4U67L 4JI6F 2LQ5A 4J7CA 1U4BA 1XJWB 5JXSA 2DBBA 4ED2A 1UA1A 3G86A 3NS7B 1CZ9A 3AAPA 4EUVA 4ED5A 4E98A 5C42A 1CZAN 5A6PA 1S6OA 1TELA 2ZVIA 5C10A 3W9HA 4UOFA 4MKVA 2QRRA 4KI6A 2BXJA 4WTYA 3ZTQA 3HHKA 2I2YA 2XWXA 1B7FA 2I7PA 2NRWA 4I1TA 5HOOA 1V4TA 2RDIA 2KW4A 1WEZA 2AJ1A 3U9DA 2VODA 5FIIA 3IRWP 3GV7B 1H3DA 1S79A 3AVMA 3N9UC 2J7WA 5D3GA 3BO4A 4ECVA 3PRVA 1K8KB 3RBZA 3SPZA 2G2ZA 1VQ4N 3TZZA 1Q16B 4IO8A 3W61A 4ICLB 2MQPA 4IRKA 4MT1A 1JQGA 2RS8A 4J2AA 3MR7A 3K5OA 2DVIA 5DETA 1S99A 3O9QA 2B6AA 3KKRA 3A3NB 5L8RC 4F2SA 3H3NO 3VERA 2IGIA 2RT3A 1VQOS 4ECRA 4DX8H 5AQOA 5D6GA 1RSCA 4BDZA 3MM7B 2LVWA 4DPWA 1QAJA 2XLIA 2BBEA 4G9ZA 5IT9U 2ACMA 3TSPA 1JLAB 4IDHA 2ZBQA 2NRZA 3MMAB 1JLCB 5EGYA 3GCXP 2ITGA 3QLHA 3M2UB 4O23A 3SZ2A 4M5MA 1LWFA 3R8YA 1YTUA 4NA3A 2JDJA 4FWRA 4ISGA 1RYSA 4AH9A 2PFUA 4ID8A 1M5KC 1NZ8A 4Z94A 5HP1A 3HHLB 1S1TB 3QGGA 4TKTA 4OJRA 3IA0A 3VENA 2WSEC 4CLKA 2E6MA 1FXLA 1B9FA 2R7QA 2HBZB 4JD2A 3FFKB 4DLGA 4CM2A 4I64A 1KHVA 3OYKA 1W0HA 1RYRA 4KO0B 4YHHF 5T7BA 3D7SB 2FLPA 1Y11A 4W98A 5C7PA 2D0BA 2Z57B 2YX7A 4GRSA 3UCZP 2QLJB 1IM4A 2UUBF 4JI6K 4X66K 5IT0A 3JAMY 4GC7A 1VBKA 2DHGA 4IJNA 1S6UA 3AA3A 1WI6A 4KAIA 3KLHA 4DL6A 2HVHA 1SKUB 2D0PA 2GO9A 3UO0A 1HQEA 2HVDA 3K59A 3A8IA 1HNIB 2XS5A 2XSFA 4B08A 2HBYB 1PILA 1R3NA 4Y2CA 3WC0A 3AGKA 4WBFA 5AQIA 1KVAA 4LF9J 4GKJF 4OFZA 1ZPVA 1A6LA 4KGXB 2UUCJ 1WWHA 3DN9A 1HLUA 2O66A 2OYQA 2H9ZA 2XYHB 2U1AA 3CIPA 1WNEA 3G10A 2HG4A 4L3KA 1CC8A 2GELA 1S76D 4FJJA 3KNGA 2DY1A 4EYIB 2QWNA 1HRHA 5H9EK 2PYJA 1SL1A 4IZ9A 2DT9A 1KVIA 3CJBA 5HANA 1N34K 1T9YA 2CVIA 1D9DA 1KAXA 2QXLA 3EE8A 1HMVB 2K2PA 5C2GA 1C1AA 4EAHD 3B78A 1JB0C 5AQQA 4WZMA 2ASLA 2CWXA 1ZBSA 3V5RA 2LDYA 1CJTA 4GO5X 3MEGB 1KS2A 1S0MA 3CCQN 4K5SA 2CDRB 1RWUA 1K73T 2EPIA 2YV0X 2FD2A 1LK5A 5CCMA 1BIUA 2P6TA 3KJVB 4H4MB 4WP8A 3HD2A 1S12A 2FZKB 4LF5K 2DXDA 3G6YA 4JRQA 2V63A 2V7YA 1SXLA 3OHAA 4X4RA 4ZCMA 4OKEA 4CJKA 3KHYA 3EE9A 4FPIA 3NL0A 4EFAC 3TAEA 1X5PA 4RPFA 1MWMA 1U1RA 3UR0A 2DGXA 3PACA 4C0OC 2HQ3A 2QYCA 3IAM9 1WKKA 1SV5B 3PO5A 1WOQA 3HFZB 4E7KA 1JJ2R 2YWWA 4N76A 2OPSA 3IG1A 2W9CB 2HK3A 2CQPA 2E9TA 4CLYA 4CJRA 3GL1A 4F67A 3CJKB 4CZJA 4HHTA 2VD3A 2DTUA 5FJ4A 3CCWA 1VQ5N 4EU0A 4DL0C 1NK7A 1KSPA 1XQSC 2BE2B 1F9FA 2FPHX 3OUYB 2Z1IA 4BE0A 4YOUA 1ZC6A 5AQRA 3KOAA 4JI4J 4OZ2A 3D0PA 3NCRA 3C65A 3D54A 2HSTA 3GV8B 2HVIA 5HBMA 3PXGa 5KFDA 3QO9A 3O3FA 3I33A 4LVNP 1KC8O 5DO2A 3CMAN 4QPTA 4MLEA 3V9SA 1F2HA 3FBFA 3HJVA 2YQ1A 3AVNA 2APOA 2DNMA 3OTDA 3Q8PB 4QAGA 2VFSA 2DIUA 2W8KA 3EY1A 3OW2R 2GQ2A 4I2PA 2E5LF 3CERA 4ZP8A 3MR3A 2GHPA 1C1BA 3IRXA 2PT0A 3CJ1A 4CF9A 3RBEA 1QAIA 5F0WA 1JLEB 2QZ8A 3BR9A 3NVMA 4NO7A 3J81j 4BR5A 2NXCA 4E0DA 2D1KA 3V81A 4JI4F 4CECA 3O3GA 3ZNJ1 5I3QA 4BC9A 1BUPA 4H8KA 2LCWA 3CJSA 2HZVA 4WZQA 4KHRA 2QFJA 2YHBA 4WF9Q 3PRDA 1HHSA 2DRDA 1DY3A 1HW8A 1WTBA 2E29A 3P8BB 2R42A 1C6VA 3RR8A 3L09A 4HLBA 5JICA 3SBGA 1UL3A 2WSFC 4NPOA 5KFEA 5L1LA 4NXMF 1KEKA 3M6XA 2D9PA 2GWJA 3UNGC 1U0HA 2PEBA 3G6EN 3ZZYA 1JLQB 2IM2A 4L75A 3T5KA 3NS5A 5DM7L 1WG1A 1U6BA 5K5MA 4JKDA 4Q5VA 3PW5A 4FWMA 4P2MA 2FLOA 2V2ZA 5H9FJ 3M9OB 3R6MA 2GIQA 4CGHA 3MCSA 1T8EA 1VQSA 4LF7F 1BI4B 1LWXA 2R8GA 4C4WA 5ELZA 4QIVA 1N8RO 1ZBTA 1GK8A 5AQUA 3FK4A 1OVQA 1IKVB 1WKLA 2GVZB 1XR7A 4FS1A 4JKAA 3C6UA 4B1WB 3M3ZA 3BKTA 1HPZA 3NG8A 2ZC4A 4FJMA 3R2DJ 4FF3A 3AVIA 3IBCB 1KD1O 2J8AA 1VQPS 3UI3A 2ZUGA 1Q8LA 1HYVA 2CQIA 2GNKA 4FS2A 4JI4K 1U2CA 3WXLA 3CB4A 3NCIA 3KK3A 2J5AA 4OYMA 5H1SQ 5E0OA 1TL7B 1LEOA 2JC0A 4NB4A 3Q8SB 2DISA 2O8BA 4OHVA 5KFKA 4DV4J 3UB5A 2KKZA 2ASMA 1RT1A 4LD0A 2JFDA 3G6ES 3HM9A 3D68A 4WFZA 1RBTA 3ZSRA 2HHQA 4QWBA 2CH6A 2GGPA 5A8KB 3IBFB 3FCHA 4C8KA 4FM0A 4ID5B 2FUG9 1YLXA 4GV3A 3W62A 2CH5A 2C2ZB 2FQQB 1OH8A 4C7QA 1GT8A 1UTAA 3VAJA 5IC4B 3G87A 4KHNA 2B56A 3QFHA 4IOBA 1N8RT 5CYMB 2KLAA 3FEXB 2HWIA 5KRTA 4CK3A 1PGZA 3L6QA 2OMLA 3S41A 4GC6A 3BEGB 1G15A 4BRDA 5D78A 4CLTA 3OSPA 3DMJB 3EGVA 3HXMA 1DTTA 1FDAA 4KB0A 1BLUA 4FPBA 4ZP9A 4GO7X 4KHYA 2Z1JA 1RJJA 3R5BA 2ZWHA 3X3UA 3TSQA 4FW1A 5M2PA 2YNGA 5BPMA 3O9RA 1ZAWA 5KG4A 1PIEA 3OR2A 5BN8A 5IT9O 5EOYA 5L1JA 1YJWN 2UXDJ 1KTVA 2VG5B 1VCTA 4H0VB 4TYBA 3BZQA 2MXYA 3W2VB 2YY3A 2O3DA 2Q36A 4M3YA 4JKEA 1VHFA 4QPXA 2DR5A 3LPEA 3GIMA 3N0VA 3SXLA 3AVHA 4Y3CA 2E88A 1F5BA 4CD3A 2VQEJ 2Z8QA 4WU3A 4M42A 1BWVA 1YBAA 2RAQA 4QR0A 1CLQA 1VI7A 5KRSA 4WFBQ 5HBMB 2L9DA 4YQWA 5CZ1A 1O6XA 2AZ3A 1NDCA 5AQJA 4LF4K 1Q82O 1AB8A 4K4TA 3RAQA 3LAKA 2HBJA 3OYGA 1S1UA 1C0TB 4OV1A 3JS9A 2OI2A 3EJMA 3OLAA 2HMIB 5AT1B 4EBCA 3DOKA 3KG1A 3HO1A 2FBYA 4FYYB 4CZLA 2FC9A 2PMZD 4A62A 1K47A 1U2RA 4KR0B 3H25A 2VICA 3EZWA 3AA9A 4QYZJ 2GVDB 4I6WA 3UKRA 2ZH9A 5BR8K 3OYJA 4KFBA 3HP9A 3P4IA 1NEEA 4ELVA 1IBMF 8ATCB 2O8CB 2KT2A 3RSEA 2DHSA 1WF1A 1YITN 1FXDA 2Q79A 2FJAB 2AKWB 5F41A 4B9UA 4AXJA 1NMNA 4BRNA 2P9PB 4IQXA 2VIHA 4FM1A 4Q43A 1DQ9A 5F3ZA 4WF9L 5FLXO 4LSLB 3NLCA 4LR9A 1VSMA 4CF1A 2DR7A 2LEBA 4W5TA 4ZJLA 1VRTA 3WUHA 1R8PA 2RS2A 2GIFA 3N6NA 3MEDA 1BDGA 2BOAA 1PYSB 2VBYA 2J9DE 2K8GA 5AQLA 1O51A 3KUGA 4P9SA 2HAIA 2YNIB 4HEA9 2CPEA 3GIKA 1VBXA 4DFJA 3QBXA 3ENOA 3DRXA 1W7WA 5IQQA 1ATRA 3VOVA 4FLZA 4DV7F 2XLJA 1C2PA 3VEXA 1IBMJ 3G8SA 5G4DA 1N33J 1BQMB 1ZS6A 4Q2MA 3OXGA 5ADXH 4QS7A 3KLIA 4CO2A 1WSVA 1NUEA 2WVBA 1HWIA 5GADI 3KJFB 3RRHA 3H90A 5KT6A 2F7TA 2AWZA 3PW2A 2WCXA 2FZGB 2R2SA 3J7A1 4KBOA 4IH6A 2J0XA 4J9UE 3IGNA 3D3BJ 2HBRB 5CY4A 2YVSA 3FVYA 3T69A 1MSWD 3UDLA 4EHTA 4Y65A 3PSFA 2E7XA 3AB4B 3WNGA 3QIPA 3O6WA 4LSNB 2V8DA 4EBEA 3A3PB 3JSMA 4C11A 2UUAK 2CQ4A 2F8EX 4WPAA 1HQUB 3PRBA 2LA6A 2IY5B 5J2NB 1RB0A 2CPIA 5F9LA 2KL8A 1N33F 2Y3YA 2XHWA 4PPDA 4CJEA 3Q89A 1ICEB 2F40A 4U7UK 3MFHA 1ZM2A 5ETMA 1MMNA 4ZOSA 3D7EO 2W01A 5E2QA 3QGPA 4DUYK 4DV2F 2F9JA 3L4BC 3MM5A 1JLAA 5B0AA 3EE3A 3IR6B 1J6ZA 4DV0F 1YJ9N 1XMQK 1VQ8N 2PI4A 4CK2A 3NF6A 4KIAA 3OL8A 2Y8WA 1YGYA 2GZOA 4AD6A 3S8SA 1CZBA 4C8OA 1FKOA 5GIPA 5H9EJ 3FGVA 5FPNA 2ZVSA 4NLQA 2QMUB 1BWEA 4JK9A 2P9SA 3SPYA 1UJ6A 1UJ4A 4M63A 4B3MK 5HL7Q 5C15A 5ETVA 2VPXB 2VG5A 4L72B 2ROGA 2J6SA 2CQDA 3LQVA 4MK9A 4ZVHA 2WHOA 3OL6A 3THTA 3KLFA 2N7YA 1Q79A 5FLXY 3LPYA 3HT0A 1YIJS 1KONA 1YJVA 1ITGA 5ETTA 3W8PA 5F9NA 1NK5A 4CLPA 5FPMA 5LMUK 4C3LA 4DX6A 4DF8A 4OZ1A 2M52A 4B3MJ 3C6AA 4OHYA 4DL4A 1SIZA 2O8DB 1T05B 3OBWA 4F4YA 2R8KA 4GY2B 3LM9A 2CNKB 4MO5A 2VPWB 4MKAA 3MMJA 2VDHA 3FSXA 4IDKA 3W2WB 4CF8A 5JS1A 3DDKA 1RDDA 3PJ9A 3GU0A 3CCLS 3VAHA 1NMDA 1ESVA 2WRMA 4DUYJ 4Q44A 1WEYA 1T0TV 2VCPA 4K4XA 2VV5A 3NH2A 4JKHA 1P9YA 3Q7CA 2P5OA 4YR0A 3PHEA 4DCJB 4KRFA 4TQSA 3OFGA 1UFKA 3WNHA 4CHPA 4ZS6A 4MO4A 4YDDB 4FZYA 5E3AA 4O3SA 3UKRB 2MKKA 3VQDA 1IJFB 2HIQA 4YFUA 4ZJOA 3UN3A 2J6UA 4WYBA 5D0RA 5ETNA 2P9PA 5J2PA 3BH7B 3R7NB 4KI4A 4PCQA 1QS4A 3ADAC 1W97L 1GOBA 1PYOB 2GFFA 4I67A 4JI5F 2E2NA 3IAYA 1CJVB 4L6V3 5A8WB 2IA0A 3UCGA 3MAAB 3LP1B 4BC5A 3W9JA 3RVCA 4H4OB 4K2JA 4KB7A 1O8BA 2E5HA 3L9ZA 5A2QY 3LPTA 1I3AA 5DLGA 4NLPA 3KUEA 2WAQD 5KOXA 1O13A 3C2PA 3J7ZT 3HRGA 4E7IA 2KI2A 3NH0A 2JLEA 2ZJRQ 4USMA 5K8OA 3MEKA 2JVOA 4HHHA 3OR1B 2ZQBA 4ZA1A 3PW4A 4K42A 4UOCA 2IYIA 1U1KA 3UIQA 1F2GA 4YB1P 1T95A 1AA1B 2ZOFA 2AIRB 2QWMA 2VUGA 1J5OA 3C7NB 3J7YI 3O4NA 3TO8A 5GAGP 2AJQA 1X9WA 4PQUA 4YOXA 1C1CA 3CJ3A 2JSXA 2G8HA 3OXFA 2QKBA 4EWTA 5IV3A 1RTZA 3D4JA 2V7ZA 3ZXWA 5IWAJ 2MJUA 1URRA 4WP9A 1D8ZA 3SJHA 2VG6B 3BB5A 1MROB 5EUHA 2KVQE 2FTRA 3AXKA 3BN4A 2LDIA 4DR4K 2Z1GA 2V4QA 4BR7A 5HVGA 1P8ZA 1EHWA 3JSMB 4AQYF 4E7LA 3OY9A 1NKEA 1GQEA 4PWDB 1AFIA 3V1RA 3D1QA 3CC4S 3OYDA 4Y2KA 1QHTA 1K44A 2GV9A 2H5IB 5AQGA 2KO1A 1VQ7N 2BKNA 2R7WA 4F4AA 2I8EA 3AO2A 4H0YB 3MPDA 1NB7A 1MU2B 2EVZA 4BC4A 1V5VA 1MN9A 5HJXA 2V69A 2R7UA 3IR5B 3MD1A 5AE3A 1E4FT 3G2XA 3MPWA 2D3UA 3S01A 4A8QA 3C0BA 3K5MA 2OLWA 1BA1A 5CHIA 2OFHX 1LXNA 4Z4IA 3VVTA 3A12A 3KK1A 1MMLA 5HRPA 1JNZB 3EZUA 2G1DA 2Z2LA 3ALYA 2D4WA 3G0ZA 5F8GA 2FBXA 2W41A 3MCPA 3WBZA 1S5JA 1HJRA 4BE2A 1FXRA 5IWAK 3D0HE 3H45C 4ZN3A 2VDIA 5FLXU 3L0QA 4WCEL 3PKYA 2FHJA 3F2KA 4EMDA 1Y3JA 2HFZA 1UVIA 4TU9A 5A2QU 2ZH8A 2FJDB 1FRKA 2EBEA 1U48A 2HQFA 4EP5A 4KQZA 3BSOA 5EVZA 5MLCQ 1NKCA 2JEIA 3EDQB 3IM9A 2P9LB 2L48A 3FZ2A 1FEEA 4PHTX 4CJPA 1NGCA 5CABA 1U0HB 3OA9A 5ADZA 3MXMA 1H38A 4JV5J 2P9IB 1ULRA 3CXCM 2FHOB 1U1PA 3SQGA 4NCAA 4OZLA 1TL5A 2IJRA 4F2RA 4FJ8A 4B8AB 2H3GX 4OJGA 3EYZA 1BGXT 1BI4A 2RD5C 2BACA 2FJBB 2E1AA 2HFOA 4HT5A 4ZKAA 1IBKK 4U6PA 4F0HA 2E9RX 1WC6A 2C2DA 1OSCA 1A5VA 4DB3A 4CEQA 3DAWA 1IKXA 4DSIA 1N5VA 2ILYA 1I94F 1WSGA 4R0EA 4ZVFA 5AQVA 4NZ7A 3NF9A 2P9NA 2ZH5A 5IM0A 3HVTA 2NRHA 2WVEA 3ZZRA 1HWLA 2YKNB 1VHIA 2HIYA 3HVAA 2GJ2A 4DSLA 4JI1J 4L73A 3AH6A 5EN1A 1RCHA 2RPIA 2VC0A 2EK6A 4DQQA 3Q2TC 5IV4A 2CXEA 2L9NA 3H5YA 2LXIA 1RT1B 3NOGA 2BJ7A 1YJRA 2W42A 5CZVA 2VL1A 1B0VA 3O6QA 4JI0K 1XC3A 1QUVA 1UFWA 3EZ5A 3BPSP 4ANEA 4BRHA 3MZIA 3AVFA 2ZHOA 2NZTA 1D0EA 4JHDA 4J90A 3N6MA 1RWMB 4HUFA 4J91A 3GPAA 4ILMA 2ZBPA 3IMQJ 3M1FA 1K8AO 3L4QA 5DG9A 4CERA 2VJVA 1QAXA 3KD1E 4LF6K 3G9CA 3NHGA 2HNZA 3AJ2A 4C9DA 3T1AA 5FPDA 1MWQA 4OLPA 3MN5A 3O9TA 2UXCF 2JEGA 4LT6A 4RW9A 1SC1B 5E84A 2W7AA 3CD5A 4BGAA 1H73A 1GOCA 3AV9A 2CG4A 3VAGA 1R8AA 4CHOA 4A8WA 5LMNK 2N4CA 3R9PA 3GZ7A 1FF2A 1GMWD 2YWEA 3I8BA 1ROFA 4ZVTB 2XGPA 3RMAA 3RYLA 2G1HA 3CYMA 3RRKA 1W25A 2N7CA 2GAGC 2YX6A 2N3OA 3GSDA 3MXHP 5BYRA 9RUBA 5EX3A 4G3IA 3PLAA 5ETOA 1XR6A 4C6AA 2HHXA 2CFXA 3GQCA 2CA9A 1XMOJ 3O5BA 3QLHB 3TTCA 3Q24A 2F9TA 2I0XA 4ZPWR 2IDEA 2XNQA 1KFDA 3KDNA 3QRPA 3L2QA 3AARA 5B0BA 3HF5A 4NWBA 4IFVB 4H5NA 3QAUA 4O3QA 1X5SA 3GJTB 4KGMA 5LSRA 2K7JA 1VSLA 4M5HA 3M8SA 1Z2LA 4BRMA 4DR1J 1TVRA 2QLXA 2LQ9A 1GEHA 1HD0A 2HKEA 4RLEA 4ZP7A 4R5PB 1RCXB 4ECXA 4NLRA 2GVDA 4FJGA 2PSZA 4CF0A 5LJ5Y 2X1FA 3FDSA 4PWWA 3M8PB 4CDIA 5LJ3Y 1WJ9A 2PAVA 4FXWA 5T7LB 4IKFA 3DU5A 2IM1A 3NRBA 1WC1A 3VAKA 2EWSA 3BQ2A 1VIXA 3GJSB 1SJ4P 1BHLA 1X4CA 3NGZA 1XMOF 1YDLA 4YY3J 3UPFA 2NLWA 1HL6A 4WK1A 2KVIA 2IRYA 2COLA 2JL9A 1JX4A 1LAVA 4C8LA 4OJ3A 3CI5A 2MPUA 1HNIA 3V1QA 5LXYA 4ER8A 1XNQF 2G2OA 3H6EA 1UVJA 2XMJA 3VV2B 4TU8A 3BREA 1BIZA 4CJVA 1NHUA 4W5QA 3T5HA 1FTCA 1UPPA 1DQ8A 3KHHA 2RN2A 1VSEA 4DV7K 3CCLN 1S1WB 3K5PA 2KT5A 3ICLA 4CEFA 3NGSA 3VQ9A 4DUZK 2RQCA 2GX9A 3SQ4A 4DF4A 5KFHA 3G6XA 3QT5A 2Y8YA 1RADB 1RHUB 4O5FA 2MDAA 1IKWA 3MUMP 3O8MA 3A8YA 2CNNB 3AT1B 1VRUB 4IJAA 4HUGA 1TK8A 4DXLA 2JLGA 3MM9A 4OQJA 4BCAA 4ANCA 1XNQJ 3BF1A 3PYGA 2R2RA 2ZITA 4OL8A 4IOAQ 4O4RA 3THYA 1LCUA 4JI0J 2RJZA 4JOUA 5HSPA 1RWWB 4DDFA 1RTHB 4JI8F 3VGMA 3L8BA 3BF3A 3L4IA 2OSRA 5KFWA 1RILA 4NX9A 1TMJA 1FJEB 5BRHA 5KT3A 3OYNA 4KSEB 1F5CA 1WC5A 4I6MA 4O0NA 4JI1K 4KGKA 3ZNUA 1Q95G 2MY7A 1RP5A 2FHMA 2V8VA 3BO3A 4X64J 2E1YA 5FDLB 1VIOA 1Y5NB 3KHGA 2GS8A 3MXJA 2C3PA 3CPWR 4DTMA 3DLBA 1VQMN 2PA3A 3DHWC 1TL4A 4P2FA 2WONB 3TA0A 1NGBA 4BR4A 4KHSA 1IVZA 3CVKA 2OD6A 2ITMA 4OZJA 2EG1A 2CQHA 1W26A 4XIUA 3WXIA 1QQMA 2QW9A 2GAHC 1IXKA 2PMWA 3CCJS 2SXLA 3Q8YA 1RHQB 1N33K 3DLEB 2UUBJ 2YH1A 3Q8UA 2QI2A 1IKYB 3KLFB 1SH2A 3WT0A 2GBZA 4BC3A 2Z1HA 1YT3A 1RT3B 1IH7A 4OMFG 2YKQA 3A1YG 2VFRA 3TUZC 1YVUA 2LQ8A 3T3FA 3F41A 1H98A 2RILA 2HQDA 3VAFA 1NU0A 2D5RA 5LXRA 1S57A 4A8OA 3BZKA 4PKGA 3ENHA 2B43A 5LL6Z 4DR6K 2E5LJ 4LC9B 4E1JA 1RDWX 1KC8T 2O8FA 5IFMA 5C2FA 4OYIA 3FGUA 5HVHA 1R0AB 2HZAA 1TFYA 2AEFA 2BANA 1N34F 1GLCG 1DT9A 1JJ2M 1Y7PA 3THWA 3SQOP 2H65B 1X0PA 2UUTA 5CR4A 4LF7K 4E3SA 3MTKA 2HNYB 2XEXA 1BXNA 3ULEB 1X60A 4DU1A 3RWUA 4I69A 5HAOA 3J81Y 3VQAA 1NDPA 4HTLA 1IV0A 4PR6A 2CJAA 1VMBA 1HKAA 4LQ9A 2ADBA 3SCIE 1RDUA 3Q86A 4ED6A 1TYQA 1TU0B 4JV5K 5HROB 3SFUA 4DMNA 3HM8A 4JS4A 2IA6A 4ZCLA 1U2VB 2CAJA 1SJRA 5K20B 2XQCA 1KFSA 2Q0RA 1LW2B 2IFXA 3MN6A 4LF7J 4DS4A 1GMVA 4CLSA 2GX8A 3HSDA 3PCOB 4KPYA 5KFPA 3P38A 1SAZA 1HHQA 3DRPA 1S1WA 3GFZA 2AMCB 3J7AP 3L7UA 2V2QA 2WBMA 4NE9C 5LSOA 3EM1A 4IWVA 4RG8A 3JQJA 3AOCA 2RSQA 2XO7A 5RUBA 3K0SA 1HNVB 5DK5A 4Z4GA 3K9KA 1J2VA 2QA1A 3C66A 1Z1ZA 4H5RA 1I39A 3V9WA 1N88A 4ELUA 2C2RA 3W64A 3IWNC 3AAQA 2DH8A 5AQFA 2OPRB 1YX2A 4KTQA 3HZGA 2VQFJ 4M63C 4DR7K 3HCXA 2Z2YB 5B8HA 2NSCA 1J5EF 4CM0A 2AA4A 2CJKA 4DV4F 4PQUB 4DTPA 1WBDA 2VKZG 3O8WA 1LKZA 5T14A 4B1VA 3MCMA 2A1RA 4ID5A 2MJNA 3V6JA 4YOTA 1IM6A 3PFOA 3CDUA 2DEJA 3IWXA 1S6QB 3UKUB 5KT5A 2NXNA 3E01B 2R2TA 2JLFA 3I5BA 3DWLA 2CG8A 1H7XA 5HMZA 1F5AA 4KB1A 4DU7A 1RAEB 3EKSA 1OKJA 4C0BA 1OY8A 4LF9K 1L3UA 4YB5A 4YEAA 3VF4A 1Q82T 4FJ7A 2PDAA 4X64K 3MPUB 4ZLJA 3DOLA 3WIVA 3N01A 3CCVN 2QMWA 2G8KA 4BVPA 2M4MA 1DURA 3HI9A 3ZO7A 3N5FA 5BPLA 2F96A 1A5XA 2H4YB 4QR2A 1G99A 5EXWA 3R7SB 3HLUA 3M05A 3AJ1A 2QIFA 5E3QA 2BZ2A 4JKFA 1JLBA 2UXDF 4FBTA 2QWQA 3M8QB 4BRKA 4FVMA 4CO5A 2V5HG 1XC9A 5A0YB 3OBYA 1C1BB 2V8GA 4K8RA 5IWAF 4LBHA 3RBXA 5F8MA 3HPHA 1R8HA 4GKJK 4Y6IA 1NO8A 3LZJA 1MWKA 3KIOA 2QSFA 1SC3B 1YZ7A 4Y34A 1UOCA 4CHNA 2E2OA 1Y5LB 1G3OA 2F8MA 4QWCA 5HQLA 5A6WA 2KRRA 1VQPN 2MY8A 4OYOA 1OS5A 1N0VC 2W9BB 3GP9A 3FR0A 3D6RA 2ATLA 3K0JA 2NNWA 4U8YA 4E8UA 4A47A 1ASVA 1NGAA 2ZH3A 1RUSA 2VOOA 4DV1J 2ZH6A 2G0CA 3HHLC 2HMIA 4NCGB 1RT4B 3PX0A 2AQ4A 1C0GA 4NA2A 1YRXA 3Q23A 1R8CA 1CC7A 2MLYA 3R3TA 4J5OA 5DJBA 4TXSA 4HVJA 2ASYA 2HHHJ 4NLYA 3OFEA 4ED7A 2UXDK 2DITA 1N4LA 4WQ5A 3BQ0A 1T9TA 3ZLJA 2A40A 3OYIA 4FJKA 2WTUA 4M5GA 2NSBA 2A6AA 1TKXA 3OL9A 1J9AA 2OANA 2OSQA 3H2LA 1U1OA 4FF2A 1RHMB 2NR0A 3DLGB 3HJFA 5IT9Y 3IR7B 8AT1B 5BRDA 1NK9A 4HT7A 5A76A 3WHIA 1KD1T 2RU3A 1F0XA 4BG9A 2QSWA 1OQ6A 3AVCA 5KT2A 4LBIA 2BX6A 2HHPA 3QWUA 1EKRA 1QQOA 2BEFA 3D2WA 4FNHA 3PEJA 3UVJA 4QOZB 4WXWA 2K3KA 3VVUA 2B4JA 4OLBA 5BJRA 3O5TB 1H2UX 4E2FB 4DR1K 2BKPA 3SUNA 5BYSA 2E66A 2EC2A 2IMOA 3NCQA 2DHXA 1JNRB 4V19X 3HPGA 4KBIA 3L95X 5HATA 2B6AB 2D41A 4JI7J 3I32A 2LU1A 3MHYA 5D0EA 5L46A 1T3VA 4FJXA 3FSYA 2Y9HA 1VQ7S 3AO4A 3NVKA 3R6GB 1OH5A 2Z58B 4B3TJ 1F1BB 3LGMA 1E6YA 3JXUA 3D1HA 4NMLA 3RW6A 4WFYA 2X74A 1KVKA 1KRPA 4NLVA 4N8NA 3LAMA 3PNIA 2OPRA 2CADA 2CQBA 1X5TA 3R8EA 2YNGB 2QMXA 2AGQA 1N34J 4KHMA 2OEMA 2VA2A 1NH8A 2C42A 3OR2B 1LWCA 2P9KA 2BE7D 3ZSXA 1S1TA 3GFHA 5M1FA 5ADXA 2QTDA 1QTMA 1M5VC 4EZ6A 4X4UA 4BWJA 3J7Z5 2B8QA 2RB7A 3VGSA 3JYTA 1VDHA 1Q9YA 3ITHA 3B8AX 4WKRA 3EXYA 3UFCX 2KHOA 2V67A 3CGIA 3VETA 5AFUA 1U26A 1S72S 4CHQA 2VBWA 4AL7A 4CZEA 4DV2J 4GKJJ 3TZYA 2DXEA 2WFBA 3EMTA 3VAIA 2LA4A 2EWHA 4O0JA 1RK8A 4I0WA 4IEEA 2OMOA 2XNRA 4FF1A 3IUCA 2E5IA 3CPWM 1GTEA 2ZH7A 4DS5A 2Q0UA 3U1LA 1P6TA 4EFHA 4YOYA 4AHVA 1HQEB 1BD6A 4HKQA 1X4FA 2C2EA 2MEWA 2FYXA 2BJ9A 3C14A 2VC1A 1PAUB 5CZXA 1FTRA 2P6SA 3QBWA 4KRWA 2CYYA 1D1UA 2MQMA 5KFLA 3HX9A 2HGNA 4DR4J 5I3UB 3GE1A 3CIMA 3K7RA 2UXBJ 3SAFA 3E9PA 3OL7A 2L3MA 4CJFA 2FVRA 1U02A 3OFHA 3SQ1A 4AL5A 1T03A 3DLJA 4FLXA 4XH1A 5C24A 2AHOB 3RRGA 4KJIA 1NG9A 3LZIA 1HNWK 1NAQA 2GA7A 4IDKB 4LFCF 2NRVA 2N82B 3R3LA 1Q8BA 4WFAL 4NLUA 2LQJA 3GG1A 2Q43A 4DV6F 2JH3A 2AW0A 1B0PA 1BCOA 3BR8A 2CRLA 3KMQA 4OZ3A 4DTUA 2CQ3A 2QG9B 4OX6A 1KXPA 3C16A 5HRSA 3NGKA 2BQ3A 4A8SA 3QZ8A 2DGVA 3F73A 3W63A 3H0PA 3MEDB 3HPOA 4LF8K 2NPIA 5J1NA 4F26A 1HBOA 4TLRA 2B3TB 1U6FA 4LR8A 2PY5A 2YKOA 4QZVB 1D8YA 3KJVA 2DR6A 3O80A 1HBNB 1RABB 2CZVC 3C46A 2DCLA 3SAGA 1YI2S 2QLBB 4ZTJA 2A1SA 4B3TK 4DU3A 1GLEG 2ZC3A 1IUJA 5JJBA 4A59A 2OP5A 1XHXA 4ZVUB 1QUPA 4DV6J 2QL7B 4XDCA 1ZETA 3P3DA 5A8WA 3CXCR 3LA0A 1IO2A 2OCEA 2VBXA 2FVPA 4LF4J 3QEWA 3V9UA 2ZBCA 3KG0A 4GKKF 3ZSYA 2LLZA 3QEXA 2HVEA 3QIOA 1HKCA 4BR9A 1DARA 3CG7A 1V4SA 4NYFA 4DFPA 4TY8A 3UD5A 2FC0A 4OI1A 3FRYA 4DQRA 1S77D 2P8IA 1SZ2A 4DTOA 2OZSA 4ZPTR 2XGQA 4LF6F 3OTOK 2UVRA 4ED1A 4JYAF 3TU5A 2NUBA 3RBDA 2QL9B 4MIBA 3CCSS 4RW6A 4IEIA 3MMCB 1KOHA 3I56N 5F3TA 4KV8A 1JLFA 3VQ6A 2KT3A 3KNAA 4J9NA 1WAJA 3SBTA 1U7LA 4K8XA 1C1CB 2DFEA 2MTLA 2Q3PA 1U04A 1AROP 1XTZA 3VALA 2B4PA 1RT5B 1VC6A 1DFDA 3CC7N 3N28A 5LMNJ 3KVGA 1YVFA 1H2TZ 2R7YA 1PJ5A 2E7WA 5DRKA 3BSCA 3EL2A 4JI3F 5HLFA 4ATNA 4A48A 1RU1A 1UKUA 2J0WA 3VMFB 4K2XA 3DRRB 1E6VB 5KFOA 4PXDA 1Z4UA 2O1PA 3KLEA 5CHCB 4FVCA 2P9KB 1LWCB 4B1ZA 4YS2A 4JP8A 4PABA 4IR1A 1FVSA 3QESA 1FX4A 1SL0A 4K0KJ 1HBUA 4LRFA 4LF6J 4DU8A 4JYAJ 2OO4A 3ZX0A 2IAJA 1PAEX 1S72N 2QGFB 5C12A 1FKAF 1S49A 3CJAA 2MYFA 1J5EK 1IKYA 5KGXA 1UJ5A 3FZHA 1LWEB 1MU2A 1R43A 1ZA1B 2KKHA 1LOUA 2NYHA 4OPHA 2XY7A 3L3CA 4UUWA 2OH2A 2QX0A 2V8HA 2O4GA 4Z37A 4ZCKA 2KYXA 3L7OA 4MDBA 4Z4EA 4C98A 3VQTA 4YY3K 1RI7A 4WE1A 4C8YA 1EAYC 1OVYA 3AO3A 5KPTA 1R7IA 3VEYA 4LUBA 1ZPWX 4LBPA 3CMES 2B7BB 2CDQA 1M5PC 4BRAA 1WHYA 2H3EB 4PKHA 4B9SA 1PJ6A 1P90A 2E8AA 4C2MA 4C1NI 3MMBB 4K0KF 4FJHA 3FKBA 1WSHA 5ETSA 3C8YA 3OBIA 4CGDA 1Q8KA 5DZ6A 3GSIA 4Y28C 3IBWA 1U6ZA 4LFBJ 2A3ZA 5CYQB 1NSKL 2A18A 4OJ1A 4LRDA 3CJ0A 5J1PA 2CNLB 5F8LA 1RTJB 1FRHA 3Q22A 3E51A 4XO0A 4OV6A 1I6JA 2DNKA 3HL8A 3EVOA 1YJWS 3AQOA 2CJYB 1FDDA 3KG4A 1HQ2A 5HROA 4RNNA 1L3VA 1RCOB 4A46A 1S1VA 4FKXA 4YHHK 1IBLK 1HR0K 3SK3A 3H3OB 4CGJA 2C28A 1JK9B 3KLVA 2BUNA 5LM7E 1SKSA 1AUDA 2W2NP 4I7FB 2BDPA 1HLWA 4AE5A 1H72C 1HJOA 5AZJA 4PG6A 2MKYA 2X7IA 2I38A 3PDNA 1GLBG 3TWHA 5B09A 4NYPA 2BRKA 2XMWA 3DFEA 3CC2N 3TZXA 1BOTO 4DV5J 2QLWA 1VK8A 1GLJO 4JI5K 2VQFK 1DZ5A 4WP3A 5AE2A 4M3ZA 1IWGA 4CYUA 3RB3A 2ZJQL 1URNA 4K4VA 2AP6A 2D3ZA 3DMJA 4A8YA 3MEEB 4FM2A 3T9ZA 4DPTA 1CEZA 3TQEA 3E1YA 3KJQB 1Z6RA 2VG7A 5E3PA 1X5OA 5AXNA 3I82A 4LF2A 5CD4A 3QIPB 3PO4A 4FVUA 3GWCA 7AT1B 2KTQA 3DC2A 2CPJA 2ZKUA 2CIMA 1D9FA 1HKBA 3BZCA 1HQUA 3EGWB 4XTTA 2H1YA 2V2VA 4OX8A