4NCGA

Discovery of doravirine, an orally bioavailable non-nucleoside reverse transcriptase inhibitor potent against a wide range of resistant mutant hiv viruses
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
556
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/inhhibitor, hydrolase/inhhibitor
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of MK-1439, an orally bioavailable non-nucleoside reverse transcriptase inhibitor potent against a wide range of resistant mutant HIV viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 165
structure length 553
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ncgA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ncgA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ncgA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ncgA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ncgA05
3GQCA 4O3RA 3DRPB 3V1RA 5KFLA 2OYQA 3KKRA 2DY4A 2R2TA 4K4WA 1BIZA 3U6FA 1T05A 4N76A 4GC7A 4RG8A 1I6JA 4ZVEA 3QGIA 4J2BA 1RTDA 2RF2A 1O1WA 2V9WA 4O4GA 4IR9A 3NHGA 2BQUA 1NK5A 2DPJA 3G6VA 1YVUA 2R8KA 1RYSA 4J2DA 2OPPA 5KT2A 4O4RA 4H4OB 4BE2A 4Z4GA 1JIHA 3M9OB 3VQPA 4RW9B 2RN2A 3AVAA 4LQ9A 3AVHA 3LP3A 2DFHA 1RAJA 1HQUB 4F4WA 4OGCA 4I9QA 4KKOA 2IBKA 3OS2A 2FVCA 2JEIA 5I3UA 3NH2A 4EBCA 1KLNA 3MTKA 2R8GA 5KFVA 3I5AA 4K50A 3RBDA 2ILZA 3AVJA 3QO9A 3QIOA 1RTHA 2AX0A 4ZVFA 5L1KA 3NDKA 4Z4FA 1I3AA 2HWIA 5DLGA 4PA1A 3CVKA 3DM2A 4E7KA 4FXDA 1NK9A 4QW8A 4JV1A 3RTVA 4ECXA 4KO0A 1RT1A 2RKIA 1RDCA 4B08A 3L2RA 1HJRA 2RF2B 2F8SA 3G6XA 3RRHA 4O4GB 4FJGA 1JXEA 3BSAA 3GIMA 5KI6A 2E4LA 1NK6A 4GMJB 1QE1A 1WN7A 3K5NA 1TGOA 4G3IA 2PZSA 3UQSA 2OPPB 3OYCA 2XC9A 1VSKA 1NK8A 1CXUA 1SKWA 3DI6A 1S9EA 4I2QA 5J2NA 1BHLA 1C0MA 3GIIA 3H5SA 3G86A 4W5OA 2D5RA 3QEXA 4KKOB 4CEBA 5KGWA 4IH5A 5I3UB 3DDKA 2UUTA 4FZXC 1N56A 1JLFB 4QW9A 3QO9B 4CJUA 3L2QA 1RTHB 2UVRA 4Q8FA 1JXBA 2GIRA 1KFDA 3OL8A 4B9MA 3V9XA 3ZCMA 2C22A 3AO4A 2BQ3A 4M41A 3CM5A 4WXWA 3SPZA 1EP4A 3RMCA 3LAKA 3MAQA 1VSEA 4KO0B 5EU7A 1RT1B 2RKIB 1A5WA 4KTWA 4KB1A 4NLGA 3HPOA 3MEGA 5I42B 4IFVA 4KHRA 3NH0A 2JC1A 5CYMB 4NLWA 3NAHA 1KLMB 4M3TA 4O0IA 4DSIA 5T7BA 4AH9A 2P5OA 1RBRA 1BQNA 3TAFA 3DI6B 5L1IA 2WK4A 1S9EB 4I2QB 3IG1A 4M94A 4MKBA 1TAQA 4NRTA 4FBTA 3TARA 4KSEB 4JUZA 1QSLA 4TYAA 4DS5A 5F8MA 3P83D 2KFNA 5KG0A 1B9DA 3HHKA 1BI4A 3VQSA 1NK0A 4NLXA 1XR6A 4H4MA 1U4BA 2PY5A 4QPXA 3QIPA 4LSNA 4EP4A 3QERA 4KFBA 3N6MA 5T14A 4O5BA 4KI6A 1Z26A 1XR7A 4ECUA 4J9RA 2YHAA 2PYJA 2ZKUA 5DGAA 4FM0A 1L5UA 1EP4B 4QWDA 1EX4A 4QWBA 3CFPA 3MEGB 1ZBIA 4IFVB 3PW5A 2KFZA 3QEIA 1NK7A 1RCHA 2YNHA 4M95A 3PW4A 4KAZA 4Y2CA 5SWMA 4CCHA 1S9FA 2FBVA 4F2RA 5KT4A 4Q45A 1TKTA 1BQNB 1S1UA 4HYKA 1RT5A 3TAEA 3IG1B 1ASVA 4ECSA 4NLOA 3L2UA 4MFBA 4Z0UA 2XCPA 4NLRA 2ZQBA 1BI4B 4B3OA 1JLAB 3TQ1A 4WFYA 4H4MB 4YQWA 4CJ5A 3QZ7A 5KG3A 2XCAA 4MK9A 1W9HA 3PVXA 1BQMA 3VQAA 2GV9A 4DFPA 3QIPB 4FJ7A 4LSNB 3KLGA 3E51A 4KFBB 2JEFA 4NCGB 2V4QA 5KFNA 4RNNA 4IRCA 4R8UA 3AA3A 5KT6A 3THVA 3ISNC 4KE5A 4FK4A 4B8AB 2WB4A 5EWFA 3P5JA 1WSGA 2W9CA 4DL7A 3HYFA 4Y34A 4OJRA 4WFZA 4MIAA 2XY8A 3CIZA 2YNHB 3DMJA 3VQDA 1NJYA 1X9MA 4CJRA 1TAUA 3SUPA 1GOBA 1TKTB 1S1UB 3RWUA 4ZPDA 4DQSA 3H5YA 4DFJA 1VSFA 4EO6A 4IFYA 4W5QA 4MFBB 2QE5A 2WCXA 4CECA 3ZT0A 5DG7A 3IAYA 1YTAA 3OYFA 1KVBA 4B3OB 5JXSA 4EO8A 1HMVB 4J9KA 4DLEA 4E7JA 4DTJA 1S6QA 1IO2A 1BQMB 4IQXA 2AJQA 3KLGB 5KFBA 1K1QA 4LQ3A 5EWGA 4RW8A 3KLHB 2BRLA 3K5MA 3UIQA 1S5JA 1S1XA 4O44A 4NCAA 4R8UB 4EEYA 4LSLA 2BRKA 4IH6A 2HHWA 1RBSA 1XWLA 3RB0A 1BCMA 4FBUA 2YKMA 3CJ5A 1YT3A 4W5NA 2W9CB 2HHQA 1SUQB 4CHYA 4E7IA 3TR8A 4CIFA 3DMJB 4MKAA 1S1VB 3V6JA 1FK9A 1QQCA 4F4ZA 4KB7A 4AHTA 3LANA 4F4KA 4KHNA 3H2LA 4O3QA 3P1GA 5FRMA 4ZTJA 1TKDA 4IFYB 3NAEA 3UPFA 5C25A 4XO0A 1X9WA 1C0TB 3JSMA 4B9LA 3OS1A 4O0JA 4TSXA 3OYJA 1SKRA 1S6QB 3LALA 4ED8A 2IGIA 4JV2A 4K4UA 1EETA 1NNDA 4AHUA 4BDZA 1IH7A 1S1XB 4O44B 4E3SA 2FVPA 4LSLB 3E01A 3DLBA 2FLNA 3HO1A 3OYEA 1S48A 3AVBA 4J9QA 1TK0A 2YKMB 1TL1A 4WYLA 1TKZA 3AO2A 3HT3A 3NBPA 1S0MA 4GC6A 3NL0A 1RTJA 4B9TA 1XR5A 4IRDA 2BANA 1QUVA 4CERA 3DLKB 4M3XA 3KLEA 1FK9B 4HTUA 1QAIA 3BQ0A 1NOZA 2F8EX 4AHRA 1HNVA 1FKPA 3DLEA 2JEJA 1ZETA 3TANA 2KW4A 2AGQA 1NOYA 5C25B 4RNMA 2A1RA 4FJ9A 4I7FA 3JSMB 1S10A 3ZSQA 4FM2A 3D5MA 3D45A 4UQGA 3RB6A 2FBYA 3Q8PB 3MR6A 3LP2A 2R2RA 3SQ2A 2VWKA 4TY8A 1LW2A 4F50A 3ULDA 4EBDA 3AVGA 2ASDA 4KHYA 5KFMA 1R0AA 3OYMA 3BSNA 3RBEA 4QWCA 4QAGA 3E01B 4KBIA 2LSNA 2E9RX 3QINA 3HXMA 3K58A 3LAMA 1RT4A 4CJQA 4CEDA 1TKZB 4FLWA 3NBPB 3CDWA 1DTTA 1RTJB 3QESA 1JLCA 1C1CA 2G8IA 4CEQA 4JS4A 3KLEB 3RMBA 4BACA 2F8TA 4KI4A 4KTQA 4MQ3A 4F3OA 4DS4A 3KNAA 3DLEB 1FKPB 1HNVB 3KKSA 3K5OA 3CJ4A 3CQ8A 5DQHA 4B9UA 2UVVA 3KK3B 1TK5A 1NK4A 3KTQA 1UWBA 4KAIA 2HAIA 2UVWA 3ZT2A 2XHBA 3QGGA 2FBTA 4J9SA 1GX5A 3O3GA 4IKFA 1D1UA 3RB3A 3LP2B 3JYTA 4TY8B 1LW2B 3CWJA 5KFSA 3AVKA 3VQ7A 4DSJA 3V6HA 1R0AB 2C2EA 1L3TA 5KFWA 1N5YA 3BQ1A 2F96A 5FRNA 2HVHA 1RT4B 5L1LA 3I5BA 2EC0A 1TKXA 4FZZA 4NLTA 4Y3CA 1DTTB 1JLCB 1C1CB 4OKKA 4FJXA 4FM1A 4FK0A 1LWEA 5EDWA 2ATQA 3SQ4A 5L1JA 3RR7A 4FJLA 3AV9A 3ZSWA 3GIJA 4URGA 4PY5A 4CGGA 3MF5A 1J54A 4Z4CA 3KMQA 3TAQA 4DL3A 4CFAA 1VSMA 4H54A 2ASLA 4KPYA 4E7LA 4ED3A 3O3HA 3DLGA 4QWAA 4CHPA 4Y1CA 1UWBB 4M3UA 2O4IA 3SPYA 4RZRA 4CHNA 3CO9A 1L3UA 3PJXA 3JYTB 1JLFA 4LY7A 4CEFA 1RT2A 1NKCA 4CJTA 3KHHA 3K57A 4ZVHA 3NMAA 1GOCA 3SUOA 5HBMA 5KFYA 3OHBA 1N5YB 3V6KA 4DU1A 3L2VA 1C0UA 3CFOA 4KHMA 4DL5A 2XI2A 1A5VA 4FLTA 1UA0A 1QAJA 1G15A 3LP1A 3PUFA 4ELTA 5F8NA 4KHSA 3SUNA 4WXOA 4JRPA 1TKXB 4DG1B 3ZT3A 2QK9A 1L3VA 4ICLB 5I42A 3NCIA 3QEPA 5CYMA 5KTQA 2AGOA 1LWEB 1ZTWA 4MH8A 2D41A 4RNHA 1KLMA 3HSTB 3RRGA 1J9AA 4CFDA 4B9VA 2JGUA 4K4ZA 4R5PA 1SH2A 4CJWA 5KG7A 4ZPCA 2IM0A 4FCYA 3DLGB 2QV6A 3V4IA 5KFQA 3C95A 2VA3A 2HWHA 1HYSA 1C1AA 4DTOA 4ZTFA 2Z1IA 1KSPA 1QTMA 3KLIA 5HRRA 4RW4A 2JEGA 5KRSA 1CZ9A 4TN2A 2EHGA 4XPEA 1LAVA 3AVMA 1RT2B 4CJLA 4U6PA 4CJ3A 5HBMB 1WSJA 1SL1A 1C0UB 3QEVA 4DF8A 3OYDA 3LP1B 3AVCA 4I9LA 1BISA 3V9UA 4CEZA 4O3SA 4DTNA 4JS5A 1D9DA 2IM2A 4TY9A 3OL6A 3ASMA 1HPZA 4FW1A 4ID5B 4K4VA 1JLGA 4EYHB 4K8ZA 4NLQA 1SH3A 4RNFA 4FLXA 2RDIA 3PX4A 3KD5E 3OL7A 2RDJA 3LPUA 1RT3A 1TK8A 2C2DA 2IM1A 4CIGA 1REVB 3ALYA 4FJ5A 4ZPBA 3NE6A 4R5PB 1RDDA 4ECZA 2IAJA 2G8HA 4B9NA 3V9ZA 2D3UA 3OJSA 4YFUA 3V4IB 1HYZA 3OSNA 3PY8A 3WNGA 1HYSB 3EYZA 3CJ3A 3CFRA 2G8KA 2WTFA 3ISND 3KLIB 1RA6A 1Z25A 4RW4B 2D0AA 1JLAA 1RILA 3ZSZA 1WNEA 2OPQA 3H5XA 5KG4A 2ZD1A 4E89A 3OYNA 1SH0A 2R2UA 3PW2A 1TVRA 2YNFA 1HQEA 4NCGA 1JL2A 5SZTA 2ILYA 1WAFA 2IC3B 1T94A 4OKJA 2OZSA 5J2MB 3BJYA 4Z4HA 5KFRA 1T7PA 4Y1DA 2GC8A 4YP3A 4LH5A 1HPZB 3H08A 3U3GA 3OJUA 2IJNA 1JLGB 3NH1A 3VA3A 2X78A 3WNFA 5HLFA 1Q9XA 2P1JA 3H59A 3OLAA 3M8PA 1XHZA 4DQQA 4ECQA 1RT3B 2FVSA 2XY7A 1K1SA 1L3SA 1JLEB 3I5CA 4C8NA 1ITGA 3ZSRA 2IAJB 1MMLA 2VG7A 2Q3SA 3DRSA 3V1QA 4M3YA 2W7PA 4DQIA 4NYFA 3MXMA 4FJJA 4FJKA 5KFUA 4W5TA 4NRUA 2HHSA 3GV7B 3QZ8A 1HMVA 1OS5A 3U3YA 3PR5B 4L8RB 1BGXT 2OPQB 5CZ1A 2ZD1B 4U7CA 4IR1A 5KFDA 4ED6A 1TVRB 5KFEA 1CLQA 1CSJA 2YNFB 3OL9A 3H4DA 1HQEB 4ZMMA 5FROA 1Q9YA 5KGXA 4KRFA 3KLHA 3ZSOA 5DQGA 3DRRA 3VQ5A 5F9LA 1B92A 1QHTA 4E1MA 4YR3A 1DLOA 3G0ZA 4ZP9A 5FDLB 5KFCA 4TLRA 4FW2A 4OKEA 4AHCA 1SUQA 1IKYA 2W7OA 5HLFB 1NKBA 3M8PB 3SQ0A 2YKNA 3IGVA 2IA6A 3LPTA 4NCBA 4MK7A 2XO7A 1S1VA 4J9NA 2W8KA 1VRTB 3H4BA 4BWMA 2NUBA 2ATLA 4ID1A 2CJQA 2W8LA 2QKKA 4URQU 2GIQA 3ZSYA 2X6SA 2VG7B 3DRSB 1C1BA 3AO1A 3AVLA 3L3UA 2QXFA 2J6SA 3GIKA 4CEAA 1C0TA 2Z1JA 2V4RA 1FKOA 3NGIA 1JLBA 5KFIA 4CHZA 4M3RA 5HRNA 4CJPA 3I0SA 1HRHA 1RBVA 4WFXA 2A1SA 1WSEA 4FJMA 1S6PB 4DSLA 5C42B 2KQ2A 1TL3A 5KFHA 3DLRA 4DTUA 3H98A 3PZPA 1XI1A 4NLUA 3NF6A 1CXQA 3DRRB 3SZ2A 1EKEA 1RDRA 2W42A 1N4LA 1DLOB 4C8MA 4CJVA 3KOAA 1ZBFA 2KTQA 4F4XA 1RT6A 1IKYB 3KK1A 4TQSA 4KHQA 2IJFA 2ASJA 2YKNB 3TAPA 3DLKA 3V1OA 4DL4A 4Z4EA 3FRZA 1S0NA 4YMEA 1X9SA 1NJWA 4IOBA 4OPKA 2FLLA 2BGGA 3L2WA 1MU2A 1SKSA 1C1BB 1S1WB 1KRPA 4DSKA 5C5JA 2HHVA 4BDYA 2HNYA 3A2FA 3PW0A 4Z4IA 3AO3A 1FKOB 1JLBB 1T3NA 3AVIA 1KHWA 4M45A 4OLBA 3IN5A 3HPGA 4CF9A 4I2PA 3HVAA 3I0SB 4ED7A 3GYNA 5DK5A 1TL3B 4IG3A 4CJFA 1YTUA 2BQRA 2WHOA 3OY9A 2AU0A 3NKYA 1A5XA 3NGYA 4CFCA 4G1QB 2VA2A 4DU3A 4DEZA 3SYZA 4B8CA 3MFHA 1SL2A 3S9HA 1RT6B 4RUCA 3KK1B 4HCCA 2FLPA 4DFKA 3T19A 4RU9A 4EYIB 1ZBUA 4N56A 3MXJA 2WOMA 3SQ1A 2HVIA 3HPHA 1JL1A 4ED1A 3O4NA 1U45A 2UUWA 1J5OA 2DFEA 1MU2B 3ZT1A 2E9ZA 3CJ2A 3AA4A 3BREA 3IGNA 3F9KA 3T5KA 3BSCA 3LDSA 2HNYB 2RPIA 3KK3A 3PX0A 3N6LA 2G8WA 1NHVA 4IH7A 3CYMA 4I2PB 3RB4A 3TAMA 4XIUA 3AA2A 1JKHA 1YVFA 1D0EA 2V0NA 4IG3B 4N5SA 3MFIA 5KFZA 2HW3A 3EZUA 4IRKA 3B6PA 1B9FA 3PR4A 3QLHA 4WE1B 1S9GA 2BE2A 4HKQA 4CJEA 4CK2A 4TQRA 2XY6A 4O55A 4CGHA 4LH4A 4JLHA 4FLUA 3KLVA 2IDOA 2WONB 5HROA 4YR0A 1S1TA 3LWLA 4K8XA 2WOMB 4CGIA 1LV5A 3TVKA 4CGFA 5KT7A 3C6UA 4TXSA 4Q0BA 3RAQA 1J5OB 2XI3A 2XGPA 2FBXA 3KHRA 4RW7A 3OYLA 3V81B 3CG7A 4C8KA 2G8FA 1RT7A 3DOLB 3TABA 4Q43A 1RTIB 1KFSA 2W9BA 4HCBA 2ETJA 4J9LA 3TAMB 1JKHB 2FJWA 4ELVA 4X2BA 5DQIA 3KD1E 4E7HA 2OH2A 5JUMA 4ECVA 4CHOA 1WSFA 3QLHB 1S9GB 2BE2B 4MK8A 3OVNA 3M8SA 3NGDA 4WZQA 1KTQA 1U04A 3ZSVA 1XC9A 1C6VA 2D0CA 2EX3A 4CFBA 3NAIA 5KG2A 4DG1A 5HROB 1S1TB 3FSIA 4ICLA 3Q8SB 3VQ4A 1UA1A 4YR2A 1TQLA 4IG0A 3BSOA 4WZMA 3C6UB 3G10A 4IKAA 4OL8A 2O5DA 1ZYQA 3KLFA 5KG1A 4Q0BB 4J9PA 3IRXA 4M3WA 4NLPA 3KHLA 4FS2A 4YNQA 4RW7B 4E1NA 1LW0A 4HHTA 4DSEA 2JC0A 1ZTTA 1K6YA 3GV8B 4RUAA 1RT7B 1NJXA 2YNIA 5DG9A 2W9BB 1W0HA 3V9WA 5HP1A 3N6NA 3FQKA 1W25A 3MEEA 3OLBA 4K4SA 3CDUA 5CZ2A 1RBTA 4DLGA 4F3TA 5DLFA 1BL3A 3SJJA 2G8VA 1RDAA 4DMNA 4DF4A 1QS4A 4CF8A 4EZ9A 4CF1A 3SNNA 5EWEA 1LAWA 3FFIB 1HNIA 2HNDA 1RDBA 3LWMA 3HK2A 5F8HA 3MR3A 3I8DA 4H8KA 4F8RA 3Q8RB 4RW6A 4ID5A 2XWYA 3BR9A 4K4XA 4CJSA 4IG0B 3O3FA 2P5GA 5F9NA 2IS3A 1RYRA 3KLFB 3M8RA 1HARA 1I39A 3IRXB 1LWFA 1REVA 3PW7A 2HNZA 5E41A 1LW0B 2KZMA 4FLYA 3C6TA 1T05B 4HVJA 4KHWA 1WSHA 4AHVA 4ZPAA 1QSYA 4C8OA 1GX6A 1RTDB 2Y1JA 3DLHA 3AVFA 1TV6A 5KG6A 4ZHRA 2YNIB 4EZ6A 3K2PA 5HP1B 4CIEA 4BE0A 4DTSA 4QOZB 3MEEB 1U48A 2VG6A 3QYYA 3L8BA 5J2QA 5DG8A 5EUHA 4ECWA 3PX6A 2IM3A 4KREA 2E9TA 1J53A 2PYLA 3M9NB 2DFFA 5D3GA 2C2RA 2ZE2A 1HNIB 2IC3A 2HNDB 4DFMA 5J2MA 3ICLA 2HHTA 3M8QA 4ELUA 2HHXA 1JXLA 2D0BA 3HL8A 4RW6B 1C2PA 3KHGA 2FC0A 3TWHA 2I1RA 1SL0A 1RA7A 1VSIA 1N48A 3VN5A 5K14A 3DM2B 1FXXA 1LWFB 3PO4A 3VQ8A 4DTXA 4FS1A 2HNZB 1JLEA 3OS0A 3KK2A 1CZBA 3C6TB 3HKWA 3NGZA 1BIUA 3SV4A 4JRQA 2VG5A 2G8UA 1IKVA 1TV6B 4ZHRB 4QWEA 2B4JA 1RBUA 1QE1B 4DQPA 2X74A 5KT5A 4Q44A 2W9AA 2E6LA 2VG6B 5KFAA 5J2QB 5J2NB 3V6DA 4E19A 1T03A 3ZT4A 2IOCA 2J6UA 3MR2A 2XGQA 1VRUA 2J6TA 3NFAA 3HJFA 5D3GB 2ZE2B 4CJKA 3SFUA 3M8QB 3QIDA 5FDLA 3BQ2A 4NLYA 4PUOA 1U49A 3VQCA 1JX4A 4CESA 3DOKA 1KVAA 4ECRA 4O3PA 3QEWA 5C24A 4B9SA 3T3FA 5K14B 2OPRA 3T1AA 2VWJA 2IMWP 3DYAA 4MIBA 3H40A 4N47A 2R2SA 4K4YA 3OYKA 1F21A 1VRTA 3KK2B 3GILA 4ED0A 2FJVA 3KIOA 5F8LA 3SI8A 3EY1A 4NYZA 2VG5B 3ZSXA 2O4GA 2Z1GA 1IKVB 4DTPA 1WAJA 2I5JA 5L9XA 2HMIA 4RNOA 1IG9A 4DQRA 4Y2AA 4KV8A 3VQ9A 4BDPA 3NF9A 2OPSA 1D5AA 4DU4A 3V6DB 4CEEA 1T03B 1DTQA 1S6PA 4FK2A 5C42A 2AGPA 1VRUB 3NF8A 3S3MA 1T8EA 4CJ4A 2D7SA 3HVRA 3AA5X 5J1EA 4ECTA 2XY5A 3PO5A 3EPGA 5DMRA 4FJIA 3CJ0A 3EPIA 2AWZA 3D28A 1JLQA 1XHXA 4PUOB 3T5JA 4FLZA 3DOKB 4EP5A 4OVLA 5C24B 3TAGA 3VQEA 2OPRB 5KT3A 3DYAB 3UDLA 2KZZA 4M42A 4CF2A 3AO5A 5KG5A 1ASUA 3QNOA 1S97A 3RR8A 4CGJA 2BR0A 5CY4A 2UVUA 4ZP8A 3OYBA 5KFFA 4CF0A 4DL6A 4CK3A 3MECA 1S1WA 4FVMA 2I5JB 5KFJA 2HMIB 1Q8IA 2XRIA 4N41A 4O3OA 1ZBHA 3SI6A 3HVWA 4OLAA 4KV8B 3VQBA 4JV0A 2OPSB 4IDKA 4NLVA 1RT5B 2FVRA 3RAXA 2FVQA 4AHSA 2FJXA 5CYQA 4Q5VA 1DTQB 3OYIA 3QNNA 4QCLA 4J2AA 2QKBA 3OSPA 1Y97A 3OYGA 1S0OA 2DPIA 2P51A 1U09A 5J1EB 4O3NA 2GBZA 4G1QA 1S4FA 4WYWA 5HRPA 2D3ZA 1JLQB 1WLJA 4CE9A 3VQ6A 2GUIA 2AQ4A 4GVMA 3V9SA 2R7YA 3L3VA 4CK1A 5F8JA 3F73A 3LP0A 4ZVGA 4PWDA 1D9FA 2E6MA 1TP7A 3Q8QB 3SUQA 4CEOA 3MECB 4W5RA 3K5LA 4FJNA 2ITGA 3HP9A 1VSLA 1IKWA 5KFKA 3WNEA 4GW6A 4NYNA 2R8HA 5JS2A 1NKEA 3BDPA 3TI0A 3BGRA 3RMAA 4KB0A 1VSHA 1KHVA 2YHBA 3WNHA 3GV5B 4IDKB 3ITHA 4J9MA 5CYQB 1IKXA 2HB5A 1LWCA 3LZJA 2OA8A 4DTMA 1KVCA 4Q8EA 1N6QA 1VK0A 1S49A 4C8LA 1NJZA 3FQLA 4FJHA 4WE1A 4BE1A 3T5HA 3VQQA 4URSA 4K4TA 4ZP6A 1IM4A 3MEDA 3QETA 4NZ0A 3G6YA 2WONA 4RW8B 4BWJA 1HYVA 2BDPA 3LP0B 3H5UA 3IS9A 4PWDB 2R8JA 1U47A 4PQUA 4FYDA 3CDEA 1BCOA 2R8IA 2ALZA 5F8IA 3HVTA 4NLSA 1ASWA 1X1PA 4ED2A 4ECYA 4HUFA 4LD0A 1WNSA 1Z4UA 2AX1A 2Z1HA 3V81A 3SCXA 3SV3A 3I0RA 3CM6A 1IKWB 4DSFA 1GOAA 3AVNA 3KJVA 1SV5A 2HHUA 4ZP7A 3BGRB 3DOLA 4R0EA 1EXQA 4OPJA 1RTIA 3T5LA 1RNHA 4DTRA 3ITHB 2B5JA 4HUGA 4FJ8A 1IKXB 1LWCB 3FDSA 4FZYA 3UR0A 4J2EA 3RMDA 5KFXA 2X6NA 2OZMA 1N6QB 4NLDA 3S3OA 5JS1A 5J2PA 3KMSA 3D0PA 4CGDA 4AILC 4TYBA 3S3NA 3QGHA 3MEDB 3VA0A 2B6AA 2Y1IA 2YNGA 1EETB 3OHAA 1ZBLA 4F4YA 4XPCA 4HUEA 3PHEA 1QSSA 4OGEA 4DL2A 5KFTA 1NHUA 2JLEA 2YV0X 3IS9B 3HP6A 4KHUA 2B43A 4PQUB 5KFPA 3MXIA 1D8YA 3DRPA 4F2SA 5F8GA 3OYHA 1VSDA 3EZ5A 3HVTB 3SFGA 4FLVA 1TL1B 5HRSA 5KRTA 4J9OA 3I0RB 3M9MB 3LZIA 3MR5A 2WRMA 5KFOA 2BANB 3PV8A 5DGBA 3KJVB 1SV5B 1UOCA 3B6OA 4EBEA 3O4QA 3OYAA 4IBNA 2B5JB 4DWIA 4H4OA 3K59A 2CKWA 4RW9A 1KCFA 3NF7A 4M3ZA 4E0DA 4I7FB 1HQUA 5J2PB 1VSJA 2DTUA 3C94A 3HM9A 3FFIA 3PJWA 4KTZA 4CHQA 2B6AB 2YNGB 1WSIA 1UAXA 2C28A 5KFGA
chains in the Genus database with same CATH superfamily
4LF5F 5KFLA 4OI6A 3KKRA 2AD9A 3RBXA 3U6FA 4GC7A 3QGIA 4OI4A 2RF2A 1F9EB 5E3PA 4IR9A 2EKYA 4PG8A 3GFHA 2BQUA 1HD0A 2MSSA 1Q8KA 1KEKA 3MR7A 3ENHA 3MM5B 3EZOA 1FD8A 5BPNA 3BO2A 5KQDA 4DV3F 1YVUA 3MM8B 4CW7B 1YJ9S 4H4OB 4BE2A 1HR0J 4Z4GA 2QSFA 2KHCA 4CQ1A 4LSZB 3VQPA 4RW9B 2RN2A 4ETZA 1EX8A 1N34J 1YJ9N 1RLDA 2XLIA 2V94A 2FVCA 2JEIA 4BC5A 1F0XA 2VPWB 3S41A 1Q7YT 4EFAC 3MTKA 2JFDA 2B51A 2J0QD 4AQYJ 1ZM2A 5KFVA 1WC3A 3MX2A 1WC1A 3RBDA 4CTAA 6FDRA 2OKQA 1I94J 4FF2A 3CC2S 4ZVFA 2VICA 1H7XA 5L1KA 3NDKA 4Z4FA 1I3AA 2LQBA 1TR0A 4GKJF 3D2FA 1UZHA 1G3OA 4X4PA 4RKUC 4QJVA 3CC2N 1O8BA 5C10A 2RKIA 4B08A 3FBCA 1N36J 2IVOA 4BREA 2CQIA 3HHLB 3RRHA 1H38A 3E9PA 3EL2A 2E4LA 5LMUJ 4ZLLA 2P9GA 2CJBA 3IFRA 2PEHA 2XC9A 1CXUA 3VF6A 3HOTA 2VFVA 3HHEA 3FZ2A 4WPAA 4PG7A 1BHLA 5IM0A 3M30A 2N3LA 2D3OR 1Y3JA 3G86A 3QEXA 4KKOB 2CPDA 3LDLA 3TA0A 2BE9B 2UUTA 2I9SA 9ATCB 3CJBA 2GV1A 2ZBQA 4IZ9A 1HWLA 1VK8A 2XEXA 2PI4A 2VGMA 1NSPA 1KFDA 4B9MA 4A59A 2MZQA 4I0WA 3G82A 4M41A 4DR3J 3ZXWA 2VFTA 2DR5A 1FDDA 1E6YA 5EU7A 1RT1B 3I56S 3U1NA 1Z05A 5D0HA 3J7YP 4IFVA 4KHRA 2VOOA 1N33J 2O8EA 1UW4A 2HBLA 1PYSB 3AJ2A 1QAYA 5ETQA 3I56N 1E3MA 3LF0A 3Q7CA 1F60B 3TAFA 5L1IA 2WK4A 1S9EB 3G8SA 2W4CA 3Q8UA 4NRTA 2UXDF 3VHQA 4CLZA 4CRJA 2RSQA 3P83D 3J7ZO 5KG0A 1WI6A 5B0CA 1B9DA 2HFVA 1WC5A 3M6GA 3LDPA 1R8CA 4JK9A 3MGJA 1WG4A 4LSNA 2PFUA 3QERA 1RCOB 2DJWA 1NGCA 4ECUA 1YDLA 2ZKUA 4FM0A 3HFVA 4AXJA 1BG3A 3I4PA 3TRGA 1PGZA 1CJUA 4X66F 3RW6A 3QDKA 4B3TJ 2ZHBA 1C0FA 2NUHA 3CFPA 2HQGA 2KFZA 4U67L 3QEIA 1RCHA 3HLUA 4M95A 1R0BG 4Y2CA 5SWMA 2YWKA 1YJNS 4CCHA 2FBVA 3W2VA 2AJ0A 4GV9A 4Q45A 1BQNB 3TAEA 3IG1B 3KG0A 4F25A 1ZA1B 3L2UA 1YJNN 2DNQA 4QYZJ 2ZQBA 2MQNA 2ZDOA 3BBCA 4B3OA 3A13A 3TQ1A 2MKHA 3QZ7A 1Z2ZA 3MXHP 2OFGX 1BQMA 2GV9A 4FJ7A 2ZF5O 2JEFA 3KVGA 3Q8VA 2B0GA 3I31A 2QA4G 1HR0F 4CLLA 2Z8QA 2VWBA 4LF1A 3AA3A 5KT6A 1N34F 4FK4A 4B8AB 3CJ9A 4CLPA 2W9CA 4DL7A 3AGRA 3WX8A 1WBBA 2AYGA 4AQYF 1N8RO 4CJRA 1TAUA 1I94F 5HJXA 3MURP 1TKTB 1S1UB 5GINA 3RWUA 4HLBA 4DQSA 3O9SA 2BX6A 2OD6A 3H5YA 1SPBP 1QUPA 5D4OA 4EO6A 4IOXA 5CZXA 4DQ8A 1NSQA 2WW4A 3ZT0A 3B78A 5DG7A 3IXQA 4JP8A 3MN6A 5BYQA 5BPLA 3OYFA 4J9KA 1HMVB 2MKYA 4DLEA 4E7JA 3UN3A 4JK8A 4IQXA 2XMTA 5LMUF 4BG9A 4BRCA 4LQ3A 2W40A 3KLHB 1JMTA 1N0VC 4NCAA 2YHWA 4CNYA 1BCMA 4FBUA 1YT3A 2HHQA 1Q82O 5HJYA 1FD2A 2RAQA 3DMJB 4MKAA 3O80A 4KHPF 2ZHOA 4F4ZA 2WSCC 4KB7A 2DGQA 2JWKA 3DGVA 3H2LA 2ZDPA 3M2RB 1Q79A 5FRMA 4RUBA 2E44A 2YJFA 5GADI 3D3BJ 3UPFA 4DR3F 5C25A 3ID8A 3JSMA 2H65B 3OS1A 4O0JA 4XEIA 5A6PA 1N33F 1SKRA 4TSXA 3OYJA 1K73T 3LALA 2LEPA 3HSJA 4OZLA 1I1GA 1MA9B 3BPDA 2NZ4A 2PEBA 4AHUA 1ZH5A 3SDEB 3TTCA 1S1XB 3MK6A 4FO0A 2FVPA 3UCUP 5J1PA 2Q66A 2Z58B 3HT3A 2EW9A 3NBPA 1S0MA 1EKSA 4GC6A 4PG4A 2AZ1A 1XR5A 3MCAB 3VGVA 4BRNA 1AROP 4ITSA 4B3RJ 4CERA 4DDFA 4M3XA 1FK9B 2DNOA 4GKKF 1FRXA 2F8EX 3WXIA 3DLEA 5GAEI 4USUA 5AQHA 3DXKB 4YHHF 1LOTB 4OPAA 1ZETA 2HURA 4GO7X 2VQFJ 3JQJA 4OYZA 1IBMJ 4I7FA 2ASYA 2KYXA 3ZSQA 4FM2A 3D5MA 4UQGA 4B3TF 1IVZA 1U1PA 2XSJB 3RB6A 4BS2A 3LP2A 2R2RA 4TY8A 1LW2A 4F50A 2UUBK 2Y8YA 4USWA 5HL7Q 1UFKA 4KHYA 1R0AA 3TX8A 3N28A 3OV7A 4QAGA 1VDHA 3HXMA 2E9RX 3QINA 3M2VA 2BTFA 2YWHA 4DV1F 2YPYA 1DTTA 3JXOA 2M9KA 1RTJB 1AFJA 2VQEK 1C1CA 4IJAA 4JS4A 3KLEB 3RMBA 1U1NA 5ETOA 2DXDA 5CR4A 5E3RA 1APSA 2VOPA 4MQ3A 4LFAJ 1RE1B 1H0HB 4BR7A 2J8AA 1AZSA 3ET6B 3LPYA 2M5YA 2E7WA 3MN7A 2VJUA 3SCKE 2Q3PA 4IO9Q 2UVVA 2DNMA 1TK5A 1NK4A 3KTQA 2HZVA 3QRRA 3L4QA 2ADBA 2H4WB 1QVFR 5GVQA 3QGGA 4IKFA 1D1UA 3RB3A 4WP8A 2GGPA 5I3QA 5JLFA 3CWJA 2DY1A 2MZJA 1FJCA 4A8FA 3HD1A 2C2EA 1XIQA 4AT1B 1NLKL 2BJ9A 3QWPA 2QA1A 2CADA 2L48A 5DZ7A 5L1LA 3IBFB 3GJQB 3SQGA 2XNRA 1MSWD 2F5GA 4JYAF 2DHHA 4FM1A 3ZX3A 3P8BB 1LWEA 4QIWD 1WTBA 3T6JA 4FJLA 3MCPA 3AV9A 2PN6A 4LF4J 4JV5J 2XS2A 2XHWA 2E88A 3MF5A 3KMQA 4NI2A 2E5LK 1R6YA 2BJ3A 4H54A 2J9CA 1D09B 1LKZA 2B56A 4DR1F 2CWXA 3SPYA 1ZXOA 4WIIA 3PDNA 1YKWA 1HPMA 8ATCB 2BUPA 3D4JA 3PJXA 4DR6F 3JYTB 1JLFA 2W4PA 3GYXB 4CJTA 3NMAA 3CI5A 3QT7A 4AE5A 3OHBA 1N5YB 1A5VA 1FRIA 2V4JB 3W8GA 4KHSA 1YHQS 4H0PA 1ICEB 4WXOA 2WSEC 1IBLK 2QLWA 3ZT3A 1EB0A 4QS7A 2QK9A 5HQ8A 1L3VA 5I42A 1R89A 3DWLA 1YHQN 3VTIA 4USIA 5CYMA 4MH8A 4IFEA 1N5VA 1KBRA 2YTCA 4X65J 4CFDA 3ZTPA 2JGUA 4NL5A 3C6AA 1SH2A 4CJWA 3W66A 4DUZK 2IM0A 4FCYA 3DLGB 2Z2ZA 2ZH5A 3DLJA 3C95A 4ZVRB 1RJJA 5LMNK 1GFWB 3R2CJ 3C14A 2WBMA 5HRRA 4RW4A 4TN2A 2RU9A 4B3RF 5EOYA 5JVHL 3HBTA 4H4KC 3R6MA 2C1EB 5AT1B 1YITS 2G13A 2G1DA 3VVTA 1C0UB 3QEVA 4YN3B 2COLA 1Z2LA 3LP1B 2CJ9A 4MDBA 4I9LA 3V9UA 2VQFF 2RU3A 4CEZA 1U2VA 4DTNA 3NGUA 1D9DA 2BMBA 1IBMF 1YITN 3OL6A 1XMOF 1Q86O 3NOCA 4ID5B 4K4VA 3BEXA 4NLQA 3LPUA 3ULEB 4DX5A 4ZPBA 3NE6A 3W0LA 1RDDA 4ECZA 2BJDA 3SSQA 2D3UA 1JJ4A 4N8OA 2OGUA 2G8KA 1RFQA 1NXIA 1FDNA 1Q16B 1IWGA 3B8AX 1F5AA 2D0AA 4JI0J 5B09A 2CPZA 2ZH3A 4E89A 2R2UA 4F26A 4LFAF 1GMUA 5T41A 4NCGA 3BPSP 2IDLA 1JL2A 4DL0C 3OBYA 3TO8A 3CJ1A 1WAFA 2IC3B 4OKJA 5J2MB 3BJYA 1LFPA 2XHCA 5KFRA 2GC8A 2N4DA 4BC3A 4PRFA 1VRQC 4CJ7A 3OJUA 2HFSA 2IJNA 4GMKA 2CQ2A 1JLGB 2C3OA 2E1YA 3OXLA 3PACA 4JNEA 3C15B 3CCMS 1Y11A 2FVSA 4B1VA 1JLEB 3MMBA 3D0HE 2KG1A 1JCFA 1ITGA 3BZKA 3CCMN 4ZS6A 3ZSRA 4WTYA 1MMLA 2E5JA 1HBNB 4DQIA 4LRAA 4NYFA 3MXMA 4FJKA 5KFUA 4W5TA 3IM9A 2RS2A 3ZEUB 2B4UA 4BHQA 1OS5A 3U3YA 4DR4K 3PFOA 2DB1A 3NY0A 2HQ3A 4LFBF 1BGXT 2OPQB 2GHVC 4BY9C 4IR1A 4HDGA 4ED6A 1TVRB 2PBDA 5K8PA 4JV5F 4LF4F 1UVMA 2OJ3A 4LF7K 3JAMO 4ZMMA 5FROA 1Q9YA 5KGXA 3DRRA 3FRYA 4JI8J 4LF8J 5F9LA 4E1MA 1SC3B 1SIZA 1GQEA 4Y6IA 4TLRA 5CHIA 2DCUB 4AHCA 4DR7K 3HHLC 1IKYA 1NKBA 3M8PB 2EI5A 3IGVA 2IA6A 2NYHA 4MK7A 3QWUA 3UN2A 3H4BA 4BWMA 2ATLA 2WSFC 2WVCA 3CF5L 2CJQA 2W8LA 1GK8A 1BO5O 2D1CA 2VG7B 1C1BA 2WUSA 2BW7A 2YWGA 1MWKA 4WFNL 4PWUA 3NGIA 3M32B 1RAIB 2VGNA 1WUUA 2B7CB 2E29A 3FC9A 3CJAA 3I0SA 2A1SA 3ZTRA 1WSEA 1S6PB 4DSLA 3VMFB 2CPEA 1NJIO 5C42B 5KFHA 4X65F 2ATCB 3H98A 3PZPA 1XI1A 4ZN1A 1CXQA 5AZIB 3WEEA 2VKZG 5AXLA 4QR2A 4A5AA 4FWOA 4ILMA 4DV4J 2XWXA 4C8MA 3NP5A 5IT9Y 2V2ZA 1RK8A 2ZKTA 1ZBFA 2O8BA 5MLCV 4KHQA 3TUZC 3KJNB 4DV6F 4OYAA 1T9YA 1QM9A 3LGNA 2PAVA 5T7LA 1Y10A 1N5SA 2C2NA 4GVBB 3GDQA 4YY3K 2K3IA 2C2ZB 2VCPA 3CIMA 3L2WA 3AB2B 1VHIA 3UCGA 1U8SA 5AQSA 3DHXA 1S1WB 4DSKA 3CETA 4BDYA 4AYBD 3PW0A 3IMQJ 4AFFA 1FKOB 2DRDA 2CQ4A 1KHWA 2V2VA 1BE4A 4I2PA 5DK5A 2PMWA 1ATSA 5AQZA 4CJFA 3OY9A 3O6QA 2AU0A 2IRUA 3NKYA 3PLAA 4DU3A 1OY9A 4DEZA 4K41A 2ZOFA 4WTOB 4E2FB 3MFHA 5CD4H 1L3KA 4P2SA 4RU9A 2WOMA 3WXKA 1HKCA 3OTEA 1JL1A 5D78A 3H3OB 2ZBIA 3Q83A 2DFEA 1MU2B 1HBMB 4OI3A 3IGNA 4GY2B 2CDRB 3VGLA 1KD1T 3F9KA 2MQ8A 2LQ8A 4YOTA 1B0TA 1IWAA 3A8YA 2G8WA 1NHVA 2DGTA 3AODA 5L38A 2Z2MA 3RB4A 2ROEA 5M2PA 2MQLA 1IM6A 4WK3A 1KS2A 2V34A 5CH7B 4IG3B 3QFUA 2HGMA 5KFZA 3EZUA 1H74A 3PR4A 2YWFA 5AZJB 4IEEA 2QFIA 1SBRA 4WE1B 1S9GA 2BE2A 1SQFA 4OYBA 3D7SB 2F9JA 4CK2A 2XY6A 3DLLL 2J76E 3M6XA 2A42A 3LDNA 3CCZA 4FLUA 4JLHA 2PGCA 2H3EB 2WONB 3O3LA 3LWLA 2B9XA 2YX6A 5JLHA 5DM7L 1WEYA 1HR0K 4CGIA 2ZH1A 4NLBA 2WB1D 2AJFE 1KP6A 1ZA2B 5KT7A 3C6UA 3ATVA 4FWKA 3WQPA 1J5OB 2O67A 2XGPA 4MO5A 4JI8F 3V81B 3UCZP 4YOVA 2W4DA 2G8FA 3M8YA 1RT7A 1T44A 1A7GE 1I94K 1SXLA 3GP9A 3H1QA 2BKNA 4A62A 1JKHB 4IEIA 4ELVA 4OLPA 2E5IA 3KD1E 4E7HA 2ZM6J 4UZCA 5JUMA 4CHOA 3QLHB 5AQJA 2CNNB 2DPNA 1N36K 4Y2KA 4X4QA 4JKCA 3HI0A 2GIFA 2DGOA 4K59A 4WZQA 2ZC4A 2M70A 4K8RA 2RS8A 2EX3A 4DZDA 1M5VC 5KG2A 4ES1A 5F0UA 1RI7A 1S1TB 4JI5K 1AA1B 3FSIA 3FEYB 1K8KB 4ICLA 4JI7J 3J7AN 4YR2A 3D0GE 3AXKA 2KT5A 2R7RA 4LIRA 2W2QP 1EQYA 4Q0BB 5D4PA 4DV5J 3KHLA 3GE9A 2NREA 4FS2A 1XMQJ 3ENAA 2DXEA 5D8HB 2ZITA 5AE1A 3RRKA 3GV8B 2FF6A 2WVBA 3MM7B 1FE0A 4R79A 1EO1A 3QJJA 3CCES 1F5BA 3FQKA 1ZZFA 1NMEB 2CVEA 1ILYA 1B0PA 3CDUA 2I8EA 2QN6B 1RWOB 3EWGA 3R7BB 4WKRA 4M5GA 3VETA 3RBZA 3GR0A 3CCEN 3L7PA 5EVZA 4CF8A 4CF1A 1PO6A 1LAWA 3BUZB 1T3OA 5IWAK 3FFIB 1RDBA 3HK2A 3MR3A 4F8RA 3Q8RB 2HFUA 3AOBA 2PFDA 4IG0B 5CE3A 1B64A 2IS3A 1RQ0A 3KLFB 1I39A 4PL7A 3PW7A 4KHWA 4OX9J 1GMWA 1QSYA 2OCEA 3MM6A 1TV6A 4WFBL 2YNIB 4EZ6A 2DIVA 2AIRB 4DN9A 1WUAA 3EXYA 2DXFA 1U48A 3I6PA 2VG6A 3QYYA 4O8KA 1KC8O 1UPPA 5DG8A 2ZFHA 3B6BA 4KREA 2CQDA 3SCIE 5HVFA 3D6FB 4JD2B 1HNIB 3ICLA 4ELUA 2HHXA 3FCVA 4X4TA 1M90O 5ETMA 4RW6B 3KHGA 3I96A 1IQZA 2I1RA 1SL0A 1FX2A 4LFCJ 2DNGA 5D6GA 2MKJA 3VN5A 5K14A 4ANCA 3CCWA 2Y3YA 2MKSA 3VQ8A 2JX2A 4DTXA 1X8DA 1LFWA 2IPOB 4JI1F 4QYZK 4CLYA 3AAWB 4OHVA 2O8FB 2F3JA 4JRQA 2VG5A 5AQWA 2JNJA 2G8UA 4QWEA 1RBUA 4MTPA 4YB5A 2QLBB 4ZVUB 3HCXA 2V68A 2W6LA 5J2QB 1XNRK 2GQCA 2KXFA 4E19A 2FF3B 4WP3A 3MR2A 1VRUA 5H9FJ 4ATNA 3NFAA 2R7UA 5D3GB 2ZE2B 3FBEA 1VC5A 5IV3A 4CJKA 1CJKA 2HBZB 2XMMA 4WKYA 3SFUA 2I7NA 3QIDA 4NO7A 2KHDA 5FDLA 1EHWA 1C0GA 4PUOA 4JEPA 2F4VJ 3DOKA 4ETXA 4JI3J 4A8WA 4B9SA 3J7AP 4X84A 2DVIA 2IMWP 5JVGQ 2ASMA 4MIBA 3H40A 3UVJB 3OYKA 1F21A 1VRTA 3KK2B 2YQ1A 1KAZA 1E6YB 4AUKA 3UD3P 2FGOA 5H1SV 3R1LA 3ZSXA 2M2BA 5CCLA 1IKVB 4DTPA 4HHJA 2H9ZA 3D6TB 4JI2F 1IG9A 4DQRA 4PZVA 4Y2AA 5RUBA 3VQ9A 2DT9A 4JI7F 4DU4A 3Q89A 4KGZB 4EFHA 3V6DB 4CEEA 2Y0BB 1T03B 3O9TA 5M2RA 2R9LA 3CJSA 2AGPA 2WTUA 4AM7A 2CQPA 3NF8A 5M1PA 3K0JA 2D7SA 1T9TA 3W9JA 2ZJQQ 3RUBL 3AA5X 5HQLA 3QAUA 3CJ0A 3D28A 1JLQA 2DHAA 5C12A 1HIYA 2NR0A 4I56A 4PG6A 2KZZA 2CGJA 4M42A 4PKHA 1NO8A 4ZCLA 1TL5A 3ZTQA 2HLUA 2UVUA 2O8DB 4CF0A 1SKUB 1D3WA 1SAZA 4PPZA 5L39A 4IXCA 4FVMA 2HMIB 1Q8IA 4USVA 1JNZB 2XRIA 3S7RA 3GFXA 2A10A 2HQDA 2DR8A 2A6MA 1FWKA 1QVFM 4KV8B 5FPDA 4JV0A 1F6TA 2CNOB 3W3DA 2E1MC 2GTDA 3U27A 3N4WA 3GU0A 5GAEU 2OSQA 4JI6J 2HBMA 2CQBA 2CGKA 4OZ3A 2K3KA 1VBXA 5H9EJ 4XH4A 4G1QA 2G9OA 1S4FA 4WYWA 2F7TA 3DRXA 3VESA 4OQJA 4B3RK 2MGZA 4P52A 3C7NB 1Q81O 1WLJA 1ZAXA 1GLLO 4CE9A 4F3MA 3V9SA 4M1KA 2R7YA 2P9NA 3L3VA 2HS3A 4F3QA 2VKRA 4ZVGA 1D9FA 3HJVA 3K0SA 3QFPA 1K47A 4DR5K 3DGPA 3Q8QB 4OYXA 4W5RA 4FJNA 3HP9A 4LF2A 4UOFA 3QBWA 1VBKA 4ES2A 2XLKA 4GW6A 2YHBA 4QYRA 1WHVA 1PJ5A 5EX0A 3VQTA 2J7WA 2HB5A 3ETOA 2OA8A 2MQOA 3LTOA 1VK0A 4C8LA 2X51A 1NJZA 3I87A 1RWPB 3FQLA 4FJHA 2DRBA 2FY1A 1Y00A 4BE1A 4OHXA 3VQQA 1VQ6S 2OEMA 4K4TA 1IM4A 3T9ZA 1TZ0A 2RJZA 3H20A 2P9UB 1I3OB 2BVZA 4H4KA 1YVNA 2A0FB 3NG8A 3OUYB 2VJVA 1VQ6N 3T1YJ 3H5UA 4PWDB 5A8KB 2ZJPQ 2R8IA 5F8IA 5E0OA 3HVTA 1X1PA 4ECYA 1WNSA 4V19J 2VDIA 3IRWP 3SCXA 3SV3A 3I0RA 1NGEA 4H0OA 2BOPA 5DM6Q 2HZAA 3DOLA 4CVNE 4R0EA 2KM8B 1OMSA 3FR0A 4RPFA 3EVMA 3W9HA 2QGFB 4RLEA 4JI3F 4DX7A 1LWCB 2FUG9 4J2EA 2OLWA 2X6NA 2OZMA 4NLDA 3JTNA 4MYUA 3F41A 5JS1A 5J2PA 3N0VA 1OYEA 1KQFB 2EG1A 4CGDA 1QDUB 4B17A 3QGHA 3MEDB 2OAUA 1YRXA 3OD2A 2B6AA 4JB8B 3UDCA 5ADXA 3OHAA 2IVPA 4KH5A 1QTNB 4F4YA 3PHEA 3A0IX 1QSSA 4OGEA 1GLEG 2JLEA 3THYA 3BYRA 2UXBJ 4PQUB 3RZAA 5KFPA 2DHXA 2NYIA 2EFQA 3OYHA 1VSDA 3CHWA 2RH3A 3DRYA 2OP5A 5HRSA 4M5DB 3RG6A 4J9OA 3BBBA 4HL9A 3LZIA 1U26A 4ZITA 3KJVB 3GBTA 3QQCD 3MM5A 3C3LA 2PD1A 3O4QA 3MM8A 1S7HA 3OYAA 2QTWA 4H4OA 5AQPA 1FKAF 4V19X 3M6VA 4RW9A 1YJTA 2PE8A 4JHDB 1KCFA 3NF7A 4M3ZA 2NCKL 2NSBA 4I7FB 2WBRA 4QIFA 1VSJA 2GAHC 2QMXA 5AJ3J 5DETA 1IBKJ 4USHA 3SJHA 5GAGI 3FZBA 4CHQA 3R5CA 2YNGB 2GJFA 5K9FA 1NGHA 1WSIA 1UAXA 1IR1A 5KFGA 2AYMA 2OYQA 2O1PA 2PMZD 2F9TA 3VCDA 4K4WA 1WBDA 1I6JA 3A1YG 2EXUA 3HHLA 2C3PA 1NK5A 1HKBA 1UFLA 4X64J 1HKGA 3HX9A 4J2DA 1KN6A 4O4RA 3M05A 5CZVA 1JIHA 1WOPA 3M9OB 1HHTP 2I0XA 3LP3A 3D6MB 1RAJA 4ZN3A 1WSVA 3CXCR 4OGCA 1HUXA 2Q1LA 2M4MA 4I9QA 5FPMA 4KKOA 5CABA 1T6CA 3OS2A 3NH2A 4M5JA 3WXLA 2DGUA 1SC6A 4ZPTR 3PRBA 3GB0A 2HBYB 5AQTA 1ROFA 3BF3A 1Q78A 1ESVA 2EWSA 3VGKA 1OSCA 2FZCB 1VBZA 3NS7B 1H7WA 5DLGA 4JKEA 4ISGA 2ZUGA 1C4CA 1VLYA 3RTVA 2RE2A 4ECXA 2IFXA 2VYPA 1RT1A 4PKIA 1P6TA 4NB4A 3L2RA 2YJEA 3QGPA 3G6XA 2MLYA 1JXEA 4JI0K 3BSAA 1NRKA 1B0VA 5FJ4A 1X4DA 1QE1A 3K5NA 2IVMA 4X4NA 2K7JA 3OYCA 1VSKA 1NK8A 1SKWA 1S9EA 3OQ2A 1TMJA 4FPBA 3TPQA 5J2NA 5LM7E 2VFRA 5CQGA 2UUAK 1GLDG 1S22A 4FZVA 2RILA 1WI8A 5I3UB 2XYHB 2EFNA 4NXNJ 4BGBA 1JK9B 4S0MA 3G6ES 1JLFB 4HWIA 3HZEA 4U67Q 1RBOB 2G0JA 3MMCB 1RTHB 1JXBA 2GIRA 1HNWJ 3G6EN 4GV3A 4FXWA 2RQCA 2BKPA 3CM5A 4FKXA 1SS6A 1A5WA 4KTWA 4NLGA 3HPOA 2QWLA 5I42B 3AHPA 5CYMB 2DR9A 2N4CA 2IVNA 2C3UA 3NAHA 4ZIWA 1T0TV 4WIQA 4O0IA 3VEVA 4DSIA 4PAAA 4JI8K 1BQNA 4LF8K 3DI6B 5U47A 3IG1A 4MKBA 4UT4A 3IR5B 3TARA 4FBTA 5F8MA 4C11B 2IIRA 4CNZA 1NB2A 4P73A 1Z6RA 4P2FA 2R7TA 3DFEA 4PWWA 3S6EA 1XR6A 4XTTA 1W7WA 5B0BA 3OFHA 4C0OC 3JSBA 3N6MA 1T9XA 4O5BA 1XR7A 2LKZA 4J9RA 2W1BA 3MWTA 1L5UA 1U2VB 1EP4B 5AQIA 4Y00A 1VC0A 1EX4A 5AJ3F 1CJTB 1IBKF 4OZ2A 2BJ1A 1S6UA 4F4AA 1UEKA 2M88A 1NK7A 3R97A 3GJRB 3VTHA 1FNOA 3UDVA 4QOTA 1S9FA 1AW0A 3Q2SC 1TKTA 1S1UA 1RT5A 4R25A 4DV4K 2WZ1A 3ENOA 2GFFA 2HQCA 1MN9A 3FZMA 4NLRA 3IFEA 5C0YA 1KR4A 2P2CB 4ID8A 5BRDA 4YQWA 1FJ7A 3PYFA 3PVXA 3H42A 4X64F 3QIPB 3DOMB 4NCGB 3BKTA 5C15A 3MDQA 2QG9B 3ISNC 2DGXA 2DGVA 1NGJA 1NPRA 4Y0WA 1YZ6A 1WSGA 3HYFA 4ZDNA 4WFZA 2XULA 3CIZA 2YNHB 3DMJA 2VC0A 2A5XA 1NJYA 1YBTA 3FMBA 2YKQA 4CP5A 1U2FA 3SUPA 4R0JA 1GOBA 5ETPA 4MLHA 3DHWC 3MMAB 2NRTA 4W5QA 3VR1A 5DDPC 4MFBB 2WCXA 3C2PA 2W24A 1WDTA 3UN5A 5JXSA 2FB0A 3EGZA 3A5NC 1M5OC 2FHJA 2KRBA 5BREA 2F1FA 3SBTA 3OVAA 1EAYC 1K8AT 4V1Ak 5EWGA 3F9MA 4NEYA 3K5MA 3SDEA 2ZC3A 2CNKB 1KTVA 1S1XA 4LT6A 3ZFVA 5L8RC 3RYLA 4IH6A 2X7IA 3A8IA 2RDDA 4W5NA 2GAGC 4NXNF 2NRHA 1R6VA 2W6KA 3OW2R 2YX4A 4DPXA 1FK9A 1QQCA 5TKYA 2G1HA 2GHPA 4KHNA 4F4KA 1KAXA 3MUTP 3DXKA 4ZTJA 4IFYB 3NAEA 4LF9J 1FDBA 4XO0A 1FEEA 3B82A 2UUCK 2CVIA 4C8YA 3NVKA 1WORA 3VZHA 1QZ5A 2DNZA 2P6TA 1VYAA 2H5EA 1S6QB 3C0BA 2IGIA 4JV2A 4K4UA 1J5EJ 2ZGYA 3WC2A 1U02A 3L09A 1KQSR 4H5WA 1JCGA 3K7RA 1IH7A 4O44B 4LSLB 4E1JA 2FLNA 1X9JA 3OYEA 1S48A 1TK0A 3CJQA 3AO2A 4P6QA 4ZLPA 1RTJA 2DIUA 4B3SK 5DDRC 4IRDA 3J81Y 5AXKA 3HFZB 4ZPVR 1QUVA 4G65A 3I32A 3KLEA 4UZBA 2ZM6K 4HTUA 5I4MA 1X60A 3QSIA 3BQ0A 1NOZA 4AHRA 3AOCA 2LXIA 1VQYA 2NPFA 3ET6A 1TUUA 3T6BA 3D2EA 3HKZD 3KG4A 3ZC4A 3EZWA 1UW9A 2NXEA 3GSIA 1PAEX 2HFZA 2FSNA 5LJWA 2FSJA 1KVJA 3FZKA 2V8PA 1SC1B 3Q8PB 3MCMA 2L9WA 3MR6A 3UNGC 2FGCA 4DV5K 5D0EA 3ILOA 2J0XA 1XMQK 2LXFA 4A8QA 4H5RA 1AT1B 3MM9B 4F0MA 4KBIA 2NXUA 3K58A 5SUHA 4CEDA 1TKZB 3CDWA 3MAAB 3QESA 5GAHU 1NEEA 2G8IA 1VQ7S 2HLTA 4BACA 2F8TA 2ACYA 3TVYA 2EKNA 5LJVA 1R7IA 1HNVB 1OPZA 2ZBCA 1HD1A 2RRAA 1VQ7N 1UPMB 4UY85 3AFGA 4PXDA 5DQHA 3EKUA 3PSIA 2OTJS 3MAHA 1FE4A 2PC6A 2EK6A 4BC4A 4KAIA 2DEJA 2UVWA 3ZT2A 2XHBA 1ITPA 2FBTA 3HFKA 4J9SA 3VGMA 3A3NB 4ILJA 2OTJN 3JYTA 2BH1A 3CIPA 1CS4B 3FVYA 1T9VA 1U7LA 2B9EA 3V6HA 4LMZA 3FJ2A 2AF6A 4OX9K 1N5YA 3OVSA 4A46A 2V4JA 4ZVQB 2LDIA 1H1VA 3BR8A 4U8YA 4L75A 1GXUA 2EC0A 2YKAA 4FZZA 2O8CB 3DXMB 4Y3CA 1I5OB 3QBXA 1MWZA 1FW6A 3Q2TC 1F3FA 4ZCIA 1JLCB 1RKIA 4OKKA 2XMAA 4FJXA 5JMNA 1P27B 4BC2A 2A2DA 1HNXK 3SQ4A 5C2FA 5JVHQ 1S99A 1WWHA 2F40A 5HANA 4CYUB 2FTRA 2QI2A 4Z4CA 2ABYA 1UZDA 3IAM9 2N7CA 1VK3A 2ASLA 2IRXA 4OI1A 4E7LA 5BN9A 3X3UA 3DLGA 4QWAA 4Y1CA 1UWBB 3BYPA 1FFSB 3EGNA 3R3TA 1HBUB 4LFCK 2VQEJ 3WIVA 2CQ3A 1NKCA 3SUOA 4B02A 1SJQA 1IV0A 2CIMA 3FZFA 1C0UA 2HIYA 4KHMA 1UA0A 1G15A 3LP1A 2YH0A 4FVUA 3SUNA 4A57A 3R5DA 2ROPA 3AOAA 4PYDA 1K9MT 1Y64A 4CO0A 4ICLB 2MQMA 2HHPA 5KTQA 1WF0A 3ULEA 3KJFB 2YHYA 4RO0A 2D41A 3K8WA 1KLMA 3HSTB 3LM2A 3ZLJA 4HH1A 3RRGA 2FZGB 1HBOB 4K4ZA 4EHTA 2EBEA 3HI9A 3EKSA 3G2XA 5IC4B 1RABB 1FJGK 3W1YC 2VA3A 4DTOA 2Z1IA 1KSPA 2F4VK 3TEGA 3WQUA 2JEGA 3ZETB 1YRUA 1CZ9A 1XC3A 1LAVA 3AVMA 2AA4A 1RT2B 3THTA 3LH2S 4QR0A 2ZJRL 1WSRA 2IY5B 2FC9A 2H5JB 1R8BA 4PKDB 3AVCA 4O3SA 4I6YA 3OXGA 2ZH7A 2IM2A 5KAKA 5A6WA 1JLGA 2D9PA 4OO1J 1DRZA 2UXCJ 2JLFA 2OUGA 4RNFA 4FLXA 3OR1B 3PX4A 3LM9A 3C15A 2RDJA 2D0PA 2AW0A 4M5IA 2C2DA 2W2MP 2IM1A 2WC9A 4CIGA 1YWXA 3ALYA 3IR6B 3ZTSA 2X1AA 4B1UB 1OH8A 2DGWA 3V9ZA 3MM6B 1HBNA 3V4IB 1XERA 1BA0A 3PY8A 3EYZA 4NYPA 1D9AA 1IBLJ 1T02A 1Z25A 2P6SA 1OVQA 5AQNA 3ZEUA 4Q7AA 1JLAA 2YHXA 3O08A 2NRRA 2OPQA 3CMAS 3GYGA 4A8KA 4JN4A 1TVRA 4MDAA 1O5JA 3EE3A 2Z57B 3CF5Q 1UJ6A 4C3MA 3CMAN 4DUZJ 1U2CA 2OZSA 4Y1DA 4LH5A 1HPZB 3H08A 3G96A 4CO5A 5LMNJ 2HQIA 2C2KB 4MMOA 4C97A 4WFNQ 3M8PA 4RBVA 2RQKA 3C65A 3I82A 2I38A 2XY7A 1YAGA 3W5ZA 5AFUA 4JI6K 3I5CA 2BABA 2HK3A 5H9EK 1NU0A 2IAJB 3R6GB 2VG7A 2O01C 4LUBA 1OO0B 3M5RA 2W7PA 3MCNA 3FFKB 1XK8A 1Q7YO 2YI1A 3CMQA 1GMWD 3NNHA 2AHOB 4CZLA 4LR9A 4L8RB 3L95X 1FVQA 2ZD1B 2DNNA 4K5RA 5KFEA 1CLQA 2YNFB 3OL9A 2UUBF 3TJ8A 1HQEB 2JZ5A 5DQGA 3KDNA 1FWLA 2RIJA 2M52A 4FOIA 2CZVC 2QWNA 2MKKA 3H25A 2Z2LA 6AT1B 5FDLB 2YWEA 2NSCA 3A8KA 5HLFB 1IUJA 3J7Z5 4UOHA 3SQ0A 2VHGA 1FFGB 2VQEF 3LPTA 3NLCA 1VQ5S 2BZ2A 3RAMA 2BJ8A 4LF6J 1VRTB 2QEXS 4PCQA 4ID1A 4GVBA 4CM0A 1CULB 2CDQA 2X6SA 1VQ5N 4JKGB 3A5LC 1UKUA 2QEXN 4O0NA 4ZCMA 2CPHA 1C0TA 1T95A 3J7A1 4I69A 3U7JA 1FKOA 2F4FA 1SQGA 3T1YK 1K0TA 1HRHA 3JS6A 4WFXA 5AXMA 3R9PA 3CC4S 5B0GA 3R8YA 3GCXP 1U6FA 3KWGA 4PKGA 4EAHD 1S7IA 1RDRA 3CD5A 1DLOB 4CJVA 3CC4N 4LVOP 3KOAA 3IKMA 2NRXA 1OH5A 1TL4A 2ASJA 3PCOB 1RAEB 4ZVPB 4BRGA 4RX6A 4DR4J 2RUSA 3DLKA 4RCHA 4DL4A 1M5KC 2HRYA 3B4DA 1X9SA 4J8FA 5E2QA 2BUNA 2BGGA 1MU2A 4AL7A 1SKSA 4FYWB 2E5LF 3CXCM 3A2FA 4HACB 1MWMA 1JLBB 4BRIA 3GWCA 3DLLQ 1NSKL 1T3NA 3E3XA 3AVIA 4M45A 3IN5A 3HPGA 1NZ8A 3KYLA 3HVAA 4ED7A 2UXBK 4ERDA 3GYNA 3BKFA 5DM7Q 2A6AA 3MWPA 1TL3B 4IG3A 1UCNA 2BA9A 1GAOA 3AH6A 1YTUA 2BQRA 3JTOA 1AFIA 3NGYA 2J5AA 4G1QB 3PIPL 3QT8A 3SYZA 1ZS6A 4B8CA 4RUCA 1IBLF 2NXNA 2FLPA 5GAGU 5A8RA 4EYIB 3SEOA 1NZAA 4N56A 5BRHA 4Q2MA 5GADP 1V9OA 1U45A 5TKWA 2UUWA 1J5OA 3DGPB 5AJ3K 3CD7A 1IBKK 3CJ2A 3AA4A 2HHHJ 1YUWA 4OLOA 2HGLA 4DUZF 2RPIA 4WBFA 3KK3A 3DDIA 2EBGA 3N6LA 2FY8A 5LMNF 3THXB 3GZ7A 1JKHA 4MKYA 2DYAA 2V0NA 4YY3J 3QLHA 4GVEA 3L4BC 4LRFA 4TQRA 3WT0A 3PM9A 4CGHA 1Y5NB 4OI2A 4DCOB 3NNAA 1S1TA 4DOZA 5GAEP 4M5LA 3K5PA 4P71A 5AE2A 2J9DE 1K8KA 3VEXA 4NASA 3FMWA 1EJ7L 3TVKA 4CGFA 4DPUA 1FTCA 4TXSA 2V7ZA 3N01A 3HULA 4Q0BA 3RAQA 2XI3A 2G0IA 3H2UB 4DUYJ 1U24A 3R5GA 3ATUA 3O9QA 4DPTA 3M8ZA 3TZYA 5IQ6A 3DOLB 4X62K 2MDAA 1VQSA 1N54B 3MM7A 4Q43A 3LL3A 1KFSA 5HMXA 2W7AA 4TKTA 2RT3A 4HCBA 1SJRA 3QATA 5DJBA 1XBWA 2FJWA 4X2BA 3WUHA 2E20A 1Q7LB 3J7YU 3BDEA 4ECVA 1WSFA 4PXEA 1T11A 4J9VA 4MK8A 3M8SA 1U04A 3ZSVA 1XC9A 1C6VA 4U7BA 2YWWA 3NAIA 4DG1A 2GHWA 4OHWA 4WFBQ 2X3GA 4UW2A 3THYB 3EVOA 1UA1A 3CE8A 4IG0A 4LR7A 3G10A 1ZYQA 4OL8A 2O5DA 3KLFA 5KG1A 1EZZB 4NLPA 4RW7B 3IBWA 4E1NA 1UJ5A 2JC0A 3D0IE 1Y7PA 4NXNK 2F63A 4LRCA 2MSTA 1QY7A 1YGYA 2KLAA 3KXDA 1NJXA 2F9DA 2YNIA 5DG9A 1NB7A 3T9NA 2M0GB 1K73O 1NM1A 3CB4A 1HNWK 1W25A 4DR4F 3OLBA 4K4SA 5CZ2A 5K20B 4DV2J 4WU2A 1BL3A 3SJJA 4DMNA 4DF4A 4LF7F 4EZ9A 1JB0C 3OXFA 4W4MA 1LEOA 4JD2A 1HNIA 4AL5A 2YKOA 3U1LA 2GJ2A 4RW6A 2H1YA 3MPUB 2OTLS 2RHQB 4DR7F 4C8ZA 3H90A 4LRDA 4FSVA 4O5FA 4CJSA 2P5GA 3HSDA 1MNEA 4ZIVA 2JOQA 3R1HA 2ZVSA 1REVA 3VEOA 1S76D 2OTLN 5E41A 1FXLA 2O8FA 4ZPAA 4C8OA 5A2QY 1G99A 3NGTA 2Y1JA 2EC2A 5KG6A 1YK9A 4NZ7A 1XQIA 3K2PA 4IOAL 5HP1B 1BC6A 4CIEA 4JI5J 1P1TA 2RQ4A 4KPCA 2J4RA 4QOZB 1YSJA 1WB9A 4TU8A 5J2QA 5EUHA 4ECWA 3PX6A 3R7NB 4H0VB 2PDAA 3P49B 1OQ3A 3M9NB 4DXLA 2HYIB 5D3GA 2C2RA 2ZE2A 1Y5LB 3D6HB 3SXLA 2BJ7A 2R7VA 3OFEA 3HL8A 4CI6A 3GJTB 3TWHA 2AKWB 1X4CA 2BXJA 1OQ6A 4OYIA 5THWA 3OW2M 1LWFB 3PO4A 4FS1A 3UVJA 5FD1A 3KK2A 4ANDA 1CZBA 4YY3F 3VVUA 2KL8A 5IWAJ 4IWVA 1IKVA 4ZHRB 1N5TA 2B4JA 1QE1B 4Y2IA 5EHHA 5MLCQ 2DEIA 2EFGA 2ZHAA 3HHLD 5ETTA 5KFAA 5J2NB 3V6DA 2GWJA 1T03A 2J8SA 5EN1A 1KQSM 2P9SB 3I4HX 5A8WB 4DUYF 1B7FA 1YRTA 3E1YA 4BR4A 2KN4A 4NPOA 3M8QB 3IBCB 4FNIA 1NMDA 3VQCA 1JX4A 3ZYYX 4CESA 1KVAA 4O3PA 3T3FA 4LVNP 2J9EA 1VISA 1W2BR 2VWJA 4DJBA 2VL1A 1QVGR 3KZBA 4FF3A 1BWVA 2YCHA 3QMQA 4RU2A 3G87A 2FJVA 3KIOA 3SI8A 5E84A 4NYZA 2O8DA 4PPDA 4CH1A 2E5HA 4LR8A 3JB9k 1WAJA 2HMIA 4GRSA 4RNOA 3GOIA 2V8GA 3TSUA 3P45B 4KV8A 4HVZA 4G9ZA 5B0AA 4A47A 3CUNA 2GX9A 3S3MA 1B3TA 9RUBA 3PO5A 3P3DA 1OH7A 4FJIA 3C7NA 3OTOK 1XHXA 3T5JA 3UDEA 1RWXB 1D8ZA 4OZNA 1GLFO 4ZLJA 2OPRB 3LOUA 5KT3A 4I4BA 2MQPA 2NXCA 4FWSA 4BR2A 3AO5A 4LF9K 1NGGA 1XNRJ 5KG5A 1ASUA 3AJDA 3NEKA 4CGJA 2OO4A 5F3ZA 1CVJA 3D68A 5KFFA 4IYQA 3PNIA 2V7YA 4CK3A 1M1GA 3PJ9A 3T7ZA 4ENOA 1DGKN 2WW8A 1S57A 1JXVA 3D9BA 4WFAL 4N41A 4O3OA 1J5EK 3HVWA 5ETLA 2W2OP 5CCMA 2DO4A 1X0FA 3VQBA 1WG1A 2OPSB 2W41A 4UQTA 1X4AA 1RT5B 2FVRA 1H2VZ 1P90A 1PSDA 1N0UA 3OYIA 2KKZA 4J2AA 4CBWA 5K8NA 3OYGA 2DPIA 2P51A 1X7VA 1N36F 5LSLA 3FE1A 4QS9A 3O5TB 2GBZA 4KBOA 3CCVS 2P9UA 4MKVA 4JI5F 2HK2A 2KDOA 4CK1A 3OUYA 2CXEA 2ALYB 2FQQB 3CCVN 2KG0A 4PWDA 5A8KA 4OJ3A 1XEZA 2XB2D 3IC1A 1MROB 2Q43A 4KGXB 2DGSA 1VSLA 1PBUA 4F04B 3VWSA 5JS2A 4WF9L 3C8YA 3EE8A 1VQMS 4IDKB 4C7QA 2CQHA 3GMGA 3M1VB 2J7KA 5CYQB 3D54A 3WXJA 5D15A 1LWCA 2ZNYA 2UU9J 3N79A 1VQMN 3T41A 4XH5A 3D66A 3ENQA 4PR6A 3T5HA 3CCQS 2DBBA 4I67A 5IWAF 4M5MA 3MEDA 3QETA 2DKOB 2D74B 1FA0A 2ACMA 2ADCA 3IUCA 3CCQN 4CIOA 3FUYA 2NLXA 4PQUA 3CDEA 2DH7A 4FNHA 1FCAA 3I9ZA 1KDNA 4M5DA 4L3QA 4HUFA 1Y5IB 3E9OA 2Z1HA 3KDOA 4DR2K 4USMA 1GOAA 3W62A 3KJVA 3BGRB 4PXCA 3LDQA 2Z0GA 2RB7A 3PG9A 3Q24A 1YTYA 3GCWP 1RNHA 3AY0A 5LL6Z 3ITHB 5HO4A 3NNCA 4FJ8A 1IKXB 3FDSA 4FZYA 1WOQA 2Q97A 5D0RA 3RMDA 4JHDA 1N6QB 4HHUA 2VC1A 1RADB 4DR5J 1U6BA 4YS2A 3OTBA 4AILC 5IZHA 2LA6A 2JVOA 4ZKAA 2Y1IA 2YNGA 4OV1A 1DAXA 4BRFA 4OYMA 5KFTA 3IS9B 1FDAA 4KHUA 1B99A 1NGBA 1LK7A 2FHJD 1U1LA 1X4BA 5M2UA 3SFGA 4FLVA 4CO3A 5KRTA 2VZ9A 2BACA 2NNWA 3M9MB 4UUXA 3MR5A 2GCFA 3PV8A 1SV5B 1DJ0A 1N5QA 3B6OA 1G6BA 3WX4A 3DXBA 4JI4K 5C2CA 4EBEA 3MEKA 5B8HA 5E3QA 4ZJQA 4RTFD 4PYAA 1CQMA 3D2EB 1XNRF 1JQGA 2YH1A 3EGWB 3V2UC 5FLXY 3AD9C 4LC9B 3TQEA 1H72C 1BY9A 2FIUA 2DTUA 3C94A 4B9QA 3HM9A 4B3MJ 1T9UA 2AYEA 1RDUA 2HBQB 2C28A 3UKRB 1LQ9A 3GQCA 1YI2S 4UOCA 1TYQA 3V1RA 2DY4A 1CEZA 2MKIA 4RG8A 4DV0J 2JSXA 2BYCA 1RHUB 1YI2N 2V9WA 3NHGA 2CQ1A 2ZWPA 1VQ8S 4KJIA 3G6VA 2R8KA 2FXUA 3PXGa 1RYSA 2OIHA 3R6LB 3X1LB 1MMDA 4H0XB 1NPKA 1MW7A 3SAGA 1VQ8N 2EVZA 1V3RA 3AVAA 2AJ1A 1DEJA 3AVHA 1BD6A 1NDLA 3QT6A 2WVEA 2CJXB 2DFHA 1YBUA 1R8HA 1HQUB 4F4WA 2QWOA 1XQSC 2VH7A 2IBKA 3HSCA 5H1SQ 4A8XA 5I3UA 2QWRA 2UXCK 1TMMA 3LDOA 1KLNA 4FYVB 1RUSA 4UOGA 2VPYB 1OY8A 3I5AA 1DY3A 3MHYA 2U1AA 3QIOA 3P96A 2CWKA 1PIEA 3MMCA 1RTHA 2JJ4D 5L46A 2OANA 5C2DA 3GE1A 3CVKA 3DM2A 4E7KA 2AYBA 1KD1O 1RDCA 2Y1RI 1H2TZ 1HJRA 4O4GB 3R1XA 4FJGA 3C6HA 2ZVIA 5KI6A 3F56A 3SMSA 1SCJB 4A8YA 1HNZJ 1FNMA 4G3IA 3OTCA 3UQSA 2OPPB 1PILA 1UVJA 3W60A 3DI6A 2CGLA 2AMCB 3VALA 4WYBA 1URNA 4W5OA 2JL9A 3TOQA 4C11A 3CDAA 4CEBA 4IH5A 1UWAA 2AEFA 3O9UA 2LECA 4FZXC 1N56A 4QW9A 3K8VA 2B9WA 3QO9B 4CJUA 2C2MB 2MLXA 4ZK7M 4Q8FA 2E2NA 2MPUA 2QZ8A 2LP4A 3WXMB 4WXWA 1EP4A 3RMCA 3LAKA 3H46O 3BGUA 1WOOA 4KO0B 1HI1A 3KUGA 4DR5F 4KB1A 1CJTA 3KHYA 3P5TL 2P9CA 3VAMA 2JC1A 3OR2A 1RWNB 4NLWA 2LQJA 3ETMA 4OIXA 1J27A 4K5SA 1TFYA 3AARA 1KLMB 1RDWX 4M3TA 2NUUG 1R27B 3ZZ0A 4AH9A 2HAFA 2Q31A 4I2QB 2QMWA 2VBXA 5IT9O 1PG5B 2B4PA 3BO3A 4JUZA 4MAKA 4U8VA 1Q8BA 1S4EA 3VQSA 1NK0A 2OHDA 4NLXA 2OELA 2PY5A 4LF6K 1IJEB 4Z7CA 3QIPA 4EP4A 2MKCA 3BGLA 4KI6A 3DOMA 4L6V3 5DGAA 1Q4RA 4QWDA 3I55S 5JMVA 3ZX0A 2BEFA 3HDSA 2UUAJ 3MEGB 3PW5A 4IOCL 2YPZA 1IR2A 4ISFA 3M4XA 2L08A 3R8EA 3I55N 2YNHA 4KAZA 4ZLNA 3BB5A 3AQOA 4USJC 2DNRA 4CBUA 2OFHX 3MMAA 1RGIA 1PYTA 4NLOA 2FJAB 1VQNS 4MFBA 4Z0UA 2CQGA 2XCPA 5HMYA 3IMXA 3CCRS 4TU7A 1BI4B 4DV0F 2AV5A 1JLAB 4H4MB 4CD3A 1VQNN 2XCAA 4MK9A 1W9HA 3ULHA 3VQAA 3BH6B 3CCRN 1O51A 4KFBB 4C0HA 2V4QA 5KFNA 3G25A 3JSRA 1TL7B 5J1NA 3NGKA 1YF5L 3AAQA 2GWKA 5EWFA 2P8IA 2PIIA 2G2ZA 4OJRA 4MIAA 4XAKA 3VQDA 1X9MA 2I2YA 3L3CA 1M5HA 1X5SA 1X4FA 4LF5J 4DFJA 3M2UB 4IFYA 2XQCA 3AXMA 4CECA 5CXTA 2FHMA 3UKUA 2VU5A 3IAYA 5BR8K 1KVBA 4EO8A 3MD1A 2QLXA 2Y9HA 3CJTA 2APOA 1S6QA 1IO2A 3CJCA 1RTZA 1MMNA 3KLGB 1K1QA 2OMLA 2YBVA 3AGKA 2BRLA 5CHCB 3CCJS 2HHHK 1QHAA 4O44A 4R8UB 4WQ4A 4EEYA 4LSLA 2P9LB 2BRKA 1E6VB 3D6RA 1FHTA 2HHWA 1VQPS 3CD6S 2QMUB 3CCJN 4CHYA 2QXLA 1FESA 3BEGB 4E7IA 3TR8A 2G2OA 2GMJA 2DNHA 1VQPN 2EG2A 3CD6N 2VODA 4DX6A 5ETRA 4AHTA 3D1HA 3P1GA 3P4UB 5AQGA 2I7PA 1W2IA 4GKJJ 3MMVA 1X9WA 1C0TB 4FP9A 1KQGB 2JWNA 1U0SA 3M6UA 4FPAA 2UYTA 1M1KT 1HL6A 1NNEA 1NNDA 3U9DA 2D3O1 3PFEA 1TFWA 1M5PC 4DUYK 2MY8A 2HBRB 1O0PA 4BDZA 3CCTA 4E3SA 2ZH2A 3MM9A 1QLNA 3DLBA 3W65A 3AVBA 4J9QA 3GFZA 2YKMB 4WYLA 1TKZA 1P9YA 3MAAA 2CZ4A 4B9TA 3NL0A 2FSKA 3QRQA 1RWWB 1Q8LA 1GXLA 2BANA 3MCOA 4JI0F 3DLKB 2MMYA 1ULRA 4K42A 1F5CA 1QAIA 2CPXA 3PTWA 4LJMA 1HNVA 1KXPA 1NCLA 4KYZA 2KXHA 3TANA 2KW4A 2AGQA 3N9UC 1YJRA 3R3LA 3D45A 2UUAF 1DZ5A 4YOUA 1H2UX 4NXMJ 1CC8A 1RXOB 3THPA 2VWKA 3SQ2A 1CS4A 2KU7A 3DCAA 3MUVP 3AVGA 2ASDA 3BSNA 1UTAA 3E01B 4ED4A 2LSNA 3VAFA 5E26A 1NU4A 4BG8A 1U25A 4FLWA 2UUCJ 2O8CA 3DXMA 4OHZA 4TVAB 5A8RB 4L3KA 3J81U 2QWPA 2HVZA 1JLCA 1FXDA 2BM0A 3NMUA 4WWSA 5ADXH 4OYPA 5EXWA 4DV2K 2G0CA 1VHFA 2WAQD 2ZH6A 1FKPB 3KKSA 4CYUA 3K5OA 2HSEB 2R4FA 3CJ4A 4LF8F 3CQ8A 4B9UA 5IFMA 3KK3B 4X66J 1UWBA 3O4WA 4B3SJ 1HBUA 1V5IB 1NAQA 3MTJA 1J6ZA 3VQ7A 1RHQB 1DQAA 5AQFA 1L3TA 4ZPWR 3TUJC 3CJ7A 1W2BM 1VJQA 1QVGM 4Z7YA 3BZQA 3HZGA 3CD0A 1RT4B 3I5BA 2YX1A 2D4WA 3AJ1A 3M3ZA 5AQOA 1SJ3P 3DNCA 1VQKS 4FK0A 4M8LA 1BA1A 3G8TA 2MTLA 5L1JA 3RR7A 2FJBB 1ELOA 3CEDA 1EQ0A 1H98A 4H5TA 4PY5A 4CGGA 1J54A 1HBOA 1VQKN 5GAGP 4CFAA 2ZJRQ 1VSMA 4DV4F 4KPYA 1RU2A 3O3HA 4FWQA 4M3UA 2O4IA 1WHYA 3D67A 1VMBA 4NE9C 4RZRA 5LJ5Y 5AXNA 3CO9A 1L3UA 4QPTA 3ZETA 4CEFA 1RT2A 2Z2YB 5KOWA 3KHHA 3C16B 4UTGA 3RJMB 2O3DA 3V6KA 4O8UA 2V63A 1WELA 3L2VA 3H6EA 4DL5A 2XI2A 4FLTA 2GUPA 3BZCA 5F8NA 1U1KA 5GAHI 3ILLA 4J7CA 1TKXB 4DG1B 3K9KA 2DCLA 3QEPA 3OR1A 1ZTWA 2KT3A 4GVLA 2C3YA 1J9AA 4B9VA 1YZ7A 4NLCA 1OWXA 5KG7A 4LBHA 2GX8A 1ZOTA 1Q5VA 2QV6A 3V4IA 4YDXA 3VERA 2XMWA 2HWHA 4F9OA 1IXKA 2RRNA 1SZ2A 4HI1A 5KRSA 2EHGA 4WK1A 4XPEA 2NXJA 4KHPJ 1HNXJ 3HHDA 5HBMB 3KKFA 2QRRA 4OJGA 1KVIA 4AD6A 3OYDA 2EEYA 3IO1A 1BISA 3NMRA 4JS5A 2YKPA 3J80Y 4JKDA 3ASMA 1HPZA 4FW1A 5HATA 5AQQA 5CA5A 3BY5A 4EYHB 1SH3A 4NXMF 2RDIA 1X4EA 3KD5E 3OL7A 2LEBA 4CZHA 1TK8A 3TUIC 4KGKA 3A8EA 2E8AA 1RHMB 1REVB 4YOXA 4FPIA 4FJ5A 5AE3A 1FWPA 3PHTA 4R5PB 3IWNC 2LXUA 2GVDB 2MHEA 3V5RA 2IAJA 2G8HA 4B9NA 3OJSA 4YFUA 1HYZA 2P9KB 3CO0P 3CJKB 3WNGA 4WCEL 1HYSB 3CFRA 1LXJA 2WTFA 2UUCF 4CZCA 1BOTO 3ISND 5AQRA 3KLIB 1RA6A 2P9EA 3N5FA 2NRZA 4D3HA 3AA8A 1WNEA 3ZSZA 3PKYA 2MZRA 4GKKJ 3WHIA 2ZD1A 1V3SA 2YNFA 5DDQC 3SBGA 3VENA 1HQEA 4YHHJ 5SZTA 1ZPVA 2ILYA 1T94A 2HPUA 1U0HB 1V5VA 3WDOA 1FJGJ 2GQQA 4QQBA 3NH1A 3VA3A 2X78A 5HLFA 5K5MA 2P1JA 4B3SF 3H59A 4PABA 3OLAA 4P2MA 1XHZA 3DU5A 4DQQA 4ECQA 1RT3B 3FKBA 1K1SA 3THWA 4UY8T 1L3SA 2ZM6F 3KWIA 1SVDA 2VFSA 3ENWA 4C8NA 1CULA 5AQLA 2E7XA 1E4GT 3V1QA 4JKGA 3BS9A 4J90A 4DV1J 4FJJA 1XN9A 1QQNA 2HHSA 2HMPA 2IRYA 2CUYA 1FEHA 3HSZA 4U7CA 4WJBA 4DV5F 3H4DA 1XMQF 4KRFA 3ZSOA 2R3VA 3NS6A 1B92A 1QHTA 4YR3A 1DLOA 2K7KA 4H0YB 1X4GA 2CAJA 4C4WA 1Y4ZB 5HK4A 1F1BB 1SUQA 2W7OA 3EGVA 4FWRA 3GTYX 2LLZA 4FXVA 3TEHB 2IMOA 4G1PA 5AQXA 2UU9K 1S1VA 2JVRA 4J91A 2W8KA 1O13A 2XMVA 2DR7A 3QICA 4FWNA 3ZSYA 1CPZA 3DRSB 3AO1A 2QXFA 2J6SA 1K0VA 2R7WA 3EICA 3PIPQ 2Z1JA 4HACA 1JLBA 2V67A 4JYAJ 4CJPA 2QO3A 4KH1B 3P4IA 3O6WA 1P8GA 2KI2A 1DHMA 4FJMA 2POKA 2ZZNA 4ILLA 4I6MB 4DTUA 1TL3A 2DITA 4PXBA 2HS0A 1SJFA 4LRBA 3SZ2A 3CC7S 2K1RB 1ZC6A 1EKEA 4OX9F 2W42A 1N4LA 4CO4A 5BPMA 1GMVA 2WBNA 1RCXB 2HWTA 5DO2A 3LA0A 4DR1J 2W2NP 3DKDA 2SXLA 4FN5A 3MI7X 4F4XA 3CC7N 1GTEA 1X5TA 1U1MA 1NH7A 4TQSA 1V4TA 2IJFA 2YKNB 1AB8A 4DR6J 2GO8A 4V19S 1A0OB 2KVIA 3JSYA 4Z4EA 1HNXF 1F3VA 3FRZA 1S0NA 3FEXB 4OPKA 2FLLA 4OMFG 2A3ZA 3MPDA 2HEKA 1B70B 3GL1A 3CPWR 3VAKA 4CLWA 3W9IA 3AO3A 4UF4A 4W90B 4BRPA 2ZZMA 3PRVA 3THXA 3O44A 4OLBA 1N88A 3UI3A 4LFCF 4CF9A 4A8MP 2VBWA 1UEUA 3VGUA 5IT4A 1HWUA 1LWXA 4IO1A 3TSQA 3KNGA 4JKBA 2VA2A 1WF1A 2G4BA 5KPTA 1SL2A 4RL1A 3HRGA 1ZM4A 1RT6B 5GMKa 3KK1B 4DFKA 3T19A 2KFYA 5BJRA 3D3CJ 1ZBUA 2HVIA 2DY9A 3TJAA 3I8BA 1FF2A 1ZZNA 3HPHA 4ED1A 4AXIA 3O4NA 3A5MC 2FHOB 3MPVA 2CH6A 4L3NA 3ZT1A 2E9ZA 4P2XA 3P38A 2Q1NA 1HFEL 2FC8A 4M5KA 4G6VB 3LDSA 2HNYB 1YQHA 4B3MK 3H1VX 1FJGF 3QFHA 3O8WA 1XMOJ 2J7UA 2F4VF 2PA3A 3CYMA 1LXNA 1VIOA 4XIUA 1OH6A 1YVFA 4CO1A 1D0EA 4QU7A 2HW3A 4K2XA 4IRKA 1B9FA 3W5XA 2M3DA 3TYTA 1ATRA 4DV0K 2RRBA 3ZZTA