4NCGA

Discovery of doravirine, an orally bioavailable non-nucleoside reverse transcriptase inhibitor potent against a wide range of resistant mutant hiv viruses
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
556
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of MK-1439, an orally bioavailable non-nucleoside reverse transcriptase inhibitor potent against a wide range of resistant mutant HIV viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/inhhibitor, hydrolase/inhhibitor
molecule keywords Reverse transcriptase/ribonuclease H
total genus 165
structure length 553
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ncgA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ncgA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ncgA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ncgA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ncgA05
1I39A 5L9XA 4KFBA 3QLHA 4QW8A 4E0DA 4TY9A 1TL1B 4PQUB 3DLRA 3C6TA 4BDPA 1C1BA 4MQ3A 3EPGA 2VA2A 1U45A 4DSKA 1WSGA 2YHBA 4FJ9A 2PY5A 4MK8A 1L3TA 5KG6A 5EUHA 3AVMA 4I2QB 2W7PA 3BJYA 3LWMA 1IKWA 3CM6A 4ELTA 1DTTA 2ZD1A 4FLUA 2OPQA 4DL4A 3DOKB 5KFDA 5SZTA 4KHWA 2D41A 3TAPA 3BSNA 1KRPA 3JYTA 2AX0A 4E7HA 4KAZA 4JRPA 1HQUA 3NGDA 4CF9A 3DI6B 1NOZA 4M42A 4WYWA 4O44B 4DU4A 3SUNA 3M8QB 4FK0A 3FFIA 3OYAA 3RB4A 1N56A 3ZSXA 4OPKA 1MU2B 4QAGA 4ZPBA 4KKOA 1KVAA 3M8RA 3V9SA 3QEPA 4B9VA 4KTQA 4RW6A 5FDLA 4CIGA 5KG7A 4JS5A 4MIBA 4M3UA 5J2MB 3HKWA 2OPPB 3HHKA 4ZPCA 3H98A 1FKOB 3TAMB 1EKEA 2GIQA 4IR1A 1YVFA 1RT6B 3N6MA 5I3UA 3DM2B 1JLEB 2W7OA 4FLVA 4EBCA 1S9FA 1D8YA 1ZETA 4IRCA 4BE0A 1S1TA 3IS9A 5DGAA 3AVFA 2VG5A 1LW2B 2E6MA 3PR5B 3QGHA 4FLYA 1L3SA 3QIPB 1K1QA 5KG5A 4KO0A 3L8BA 4GMJB 3G6XA 4F4KA 5KFRA 1VSLA 1XHXA 4MFBB 1TKDA 1WNSA 2IAJA 2AWZA 2YHAA 3JSMA 3L3VA 4BACA 4HCBA 4ZP7A 3AO1A 4ZVHA 4FZXC 4QPXA 4KO0B 4K4YA 1WLJA 3NFAA 1EETB 2W9AA 3NH1A 4WFYA 4GC6A 5J2NA 4CEOA 3CYMA 4R5PB 1QHTA 3UIQA 3OYEA 1JLBA 2AJQA 1HMVB 2WRMA 4Z4HA 1RILA 1JIHA 4BDYA 3LP3A 3MF5A 4AHRA 4DG1A 3TABA 3ZSYA 1NKCA 3M8PB 1CSJA 3OL7A 1JXEA 3C95A 3SV4A 4DTUA 1TVRB 4HTUA 4M3XA 2Z1JA 4OKKA 4DU3A 4DFKA 2WOMB 5KFWA 2WOMA 4EBDA 3ITHA 5KT3A 3HXMA 4CESA 1QTMA 4XPCA 3KK1A 5DG9A 3V4IA 2VG6A 3E01B 1KCFA 4ZTFA 4FJJA 3QGGA 4CHQA 1RDDA 3QETA 4CCHA 2D0BA 3DLBA 3KLHB 4NLVA 2HNZA 3KLIB 3MEEA 3IGNA 1S9GB 3GIMA 4W5QA 4ECVA 5EWGA 1U09A 3QEIA 1LWCA 1FK9B 4KHQA 1GOBA 4NYFA 2VG7A 3EYZA 1FXXA 4KTZA 4E19A 3BDPA 1LW0B 3MR3A 4YNQA 1U4BA 3PO4A 2Q3SA 4FJKA 4KV8A 5DLFA 4DSEA 1NKEA 4DQIA 2I1RA 3KLGA 1NHUA 1T05A 2HNYB 3SUPA 2FBXA 2HMIB 5FROA 1NNDA 3HPHA 3ZT3A 1J5OA 3AVNA 1QAJA 4KV8B 2FJVA 4ECZA 3TQ1A 2JEJA 1IKYA 3OL9A 1VSEA 3HPGA 3LALA 1IKYB 2QXFA 1C2PA 1I3AA 5F8NA 3NAIA 4IG0A 4QWAA 3LP2A 4Q8FA 5CZ2A 2R2RA 4B3OA 4TQRA 3U3YA 3PX0A 4NYZA 3MEEB 4KFBB 1QS4A 4E7KA 4ED3A 2KW4A 4CJLA 4DSJA 3EZ5A 5KG1A 2HHUA 1MU2A 5C24A 5CYMB 3KD5E 4IQXA 4B3OB 5HRNA 1IKXB 3NF7A 1SUQA 4PWDB 4CJRA 2OZMA 1RTIB 1WN7A 2YV0X 1LW0A 4ED1A 2W8LA 1ASWA 4Y1DA 2XCAA 4KTWA 4YR2A 4RG8A 4DTRA 4TXSA 4JV1A 1IKVA 4J9MA 2ZD1B 4AHCA 3SQ4A 3UPFA 4DTNA 4CJWA 4Y34A 2RDIA 4J2EA 3T19A 3H5UA 4FS1A 4NCBA 4NCAA 4I7FA 4FJXA 2HNYA 2GUIA 5J2QA 3BREA 1QSLA 3DMJA 2ILYA 5K14B 5DLGA 3KNAA 3BGRB 4CJ5A 3TAFA 4CFDA 1TV6B 1LAWA 4IRKA 1LAVA 2F8SA 1Q9XA 3WNEA 1U47A 4E3SA 3IAYA 4EYHB 4E89A 2HHVA 4QWCA 3PJWA 4M45A 2IA6A 3SNNA 3ALYA 4CECA 2P51A 1TVRA 4FS2A 4DQSA 4J9OA 2RPIA 4OGEA 5KFTA 5KFCA 4CGIA 1R0AB 3L2VA 2J6TA 1HNVB 1A5WA 1S1VB 4RZRA 2FC0A 4DG1B 1UA1A 1S6QB 3MAQA 3T3FA 4B9TA 4FW2A 5JXSA 3PX6A 3WNGA 1T03B 3T5HA 4Q8EA 3ZT1A 3OYMA 4KI6A 4H4OA 4F2RA 1S97A 1O1WA 4DQPA 3ZT2A 3MR2A 4FBTA 4ZVGA 3B6PA 3AO4A 4HUGA 5KFSA 1T03A 5KGXA 5E41A 3LZJA 1L3VA 1K6YA 1X9MA 3LAMA 2B4JA 1RDBA 1S1VA 4M3RA 4CJFA 4IRDA 2R2SA 4FM0A 1CLQA 4CJUA 4I9QA 2VWKA 1K1SA 4NLPA 3O3HA 2HHTA 3HVRA 4RW9B 4Z4EA 4HUEA 4QCLA 1RTDA 5KI6A 5HLFB 3OJSA 3QZ8A 3S3NA 4R5PA 1LWFB 1S9EB 4EO6A 1B9FA 4ZP6A 4EP4A 5KRTA 4RUCA 3PO5A 1WNEA 4AHTA 1D5AA 3RWUA 2W8KA 4FM2A 3NGYA 3K57A 1I6JA 2HHWA 3OL6A 4YFUA 3K5LA 1XHZA 1VSMA 4DU1A 4B9UA 1J54A 5KT7A 4N76A 3V9XA 4CHOA 3CJ3A 1ZBFA 4DTJA 3D5MA 5T7BA 3O3FA 1VSHA 4CGDA 1TGOA 4G1QB 1KHWA 3NMAA 1YTUA 4ZHRB 3AVAA 4PQUA 1NK0A 3SFUA 3ZT4A 1JLCB 4DWIA 4DQQA 1XC9A 3MFHA 1ASVA 1BQMA 2E9ZA 1RT4B 1QSSA 1NJZA 2JC0A 1JLFA 3SUOA 5J1EB 2HHXA 1KFDA 1BI4A 2RKIB 4O0JA 2AU0A 4CGJA 2R8HA 4JRQA 2O5DA 2C2EA 2CJQA 1HMVA 3C94A 3IN5A 4O5BA 4OGCA 1REVA 2G8KA 4M95A 5K14A 2BE2A 2QK9A 2FJWA 3CVKA 1SV5A 5KFIA 4F3OA 3AA3A 3HSTB 4AHUA 2XI3A 4ECXA 2YNIA 1REVB 4I2PA 4CGGA 3BR9A 3NL0A 3KIOA 2QV6A 4KAIA 2W9CA 4NLWA 4DL7A 3NH2A 5DG8A 4UQGA 4W5RA 3I5BA 1DLOA 4IFYB 2JC1A 3H5SA 1SL1A 4QWDA 5HRSA 4YQWA 3MECB 4AH9A 2QKKA 2YNGA 4IG3A 4BWJA 4H4OB 4E7IA 5F9LA 3C6TB 2HVIA 3RRHA 3L2RA 4O4RA 4ID1A 2D0AA 1NK5A 5CYQB 4M3WA 1JLEA 2WK4A 5EWEA 1KVCA 3O4QA 3WNHA 4E1NA 3OS1A 3M9OB 4PY5A 1NJWA 2OPSA 4B9SA 3CJ4A 3HPOA 2ASLA 3I0RA 4J9LA 1EX4A 2WONA 2HWIA 1BL3A 3CFRA 3KK3A 3BSCA 2FJXA 1VRTA 1KFSA 5C5JA 3OS0A 2X78A 2YNFB 4TY8A 2OPSB 1RT5B 4RW7A 4Q44A 4FLTA 3KHGA 4OVLA 4I2PB 3G6YA 1RTJA 5L1JA 4O4GB 3KD1E 2RN2A 3M8QA 1X1PA 4ZPDA 4FLZA 3VQ9A 4KHYA 2R8KA 1RBRA 4H4MB 4ZMMA 3QEWA 2HW3A 2IM2A 3P83D 1KLMB 1KSPA 2EHGA 2WB4A 4ID5A 4BWMA 1OS5A 5DGBA 3DRSA 4K4VA 1IG9A 1BQNA 2G8IA 1N5YB 3VQBA 1VRUA 1XR7A 3LP0A 4IDKA 4IH5A 2FVQA 2BANB 4NLXA 1VSDA 1L3UA 5C24B 5T14A 2VWJA 3CQ8A 4EZ9A 1WSHA 4E1MA 2XGPA 3QIPA 1SH0A 1BCOA 3KLHA 3P1GA 4U7CA 3GV8B 2X6SA 3H40A 4CF8A 4ZTJA 4IG3B 2AX1A 5KFZA 2IM0A 4CJPA 1S1XB 4URQU 4AHVA 3ULDA 5HBMA 4CE9A 1FKOA 2NUBA 3KKRA 4U6PA 4Q43A 3KKSA 1D9FA 2YKMB 1B9DA 2UUTA 2R2UA 3SYZA 2UVRA 2F8EX 2IOCA 1L5UA 3H4DA 5L1LA 1XR6A 4WFXA 1HQEB 4LH5A 3HK2A 4TYAA 3QERA 2BE2B 4CERA 1TP7A 4ECYA 3MXIA 1KVBA 3RAQA 4GVMA 3B6OA 3VQ8A 4TY8B 4RNMA 1UWBB 3SQ1A 2DY4A 1NK7A 4O3PA 5J2QB 3NAEA 4DFJA 2R2TA 4KHMA 4OLBA 3I0RB 1DTTB 4MKBA 4PA1A 4K8XA 3DRPB 1NJXA 3OYCA 3OYKA 1EP4A 3DLHA 3UR0A 5CYMA 1XR5A 5KFFA 4EZ6A 2HWHA 5DQGA 4CGFA 3SUQA 4JV2A 3PJXA 4G1QA 1IKXA 4NYNA 1ZTWA 1RT7A 3KK3B 4JLHA 3OYNA 4OJRA 1QE1A 3OYBA 4AHSA 2PYLA 3LP1A 2RDJA 2R8IA 4CJQA 4Y2AA 3LP1B 5KFOA 4TSXA 3OSNA 4CJ3A 4LD0A 3K59A 2IS3A 3PV8A 4DTXA 3H2LA 3L2QA 2OZSA 1CZBA 4FJ7A 3NAHA 5HBMB 3C6UA 3FSIA 2BR0A 4CJVA 3K5OA 5KFQA 1RBUA 5KFVA 3DLEB 4LSLB 2FVRA 3AVJA 4L8RB 4M3TA 1C0TB 4FJ8A 4ED6A 3OLAA 2W42A 4ECQA 2V9WA 1CXQA 2LSNA 3ZSZA 3KHRA 4EYIB 4H54A 4IFVB 4M3ZA 2BGGA 2GIRA 3H5YA 3GYNA 4QW9A 2FLLA 4NLGA 4DMNA 1S1UB 1Q9YA 4IFVA 5I42A 1A5XA 4TN2A 3RB0A 4ZHRA 4HKQA 1S1TB 1BQNB 3IS9B 4IKAA 2FBVA 1BIZA 2EX3A 4PWDA 2QKBA 4RW7B 1J53A 1VSKA 5FRNA 3O3GA 3ZSWA 3MEGB 4N56A 3OY9A 3G10A 1WSEA 2CKWA 4J9SA 3AO3A 4K8ZA 3VQDA 3E01A 3AVIA 3NF9A 1JLGA 1RTJB 1RT2A 3Q8RB 3V6DB 1SKRA 1RBVA 3V6DA 4WXOA 3KK2A 5KG4A 3IG1B 5KT5A 1YT3A 3ZT0A 2R8JA 2C22A 2ATQA 4QWEA 4KKOB 1S1XA 2IMWP 3CFPA 1BISA 4R8UA 3OYLA 3G0ZA 5HLFA 2P5GA 1C1AA 3KOAA 4CF2A 2DPJA 3IRXA 5HROB 2DPIA 3QGIA 3DOLA 2QE5A 4I7FB 4NRTA 1UA0A 1S0OA 2G8UA 1N4LA 4FLWA 1S1UA 3QO9A 1NOYA 4DTOA 4IH6A 5I42B 1SH2A 3LWLA 4WYLA 3CJ0A 4F3TA 4K50A 2BQRA 2HNDA 1TKTA 3MECA 4MKAA 3QNNA 2BRKA 1N5YA 3DRSB 5KT6A 2IC3B 3H59A 1LW2A 3QIDA 4Y1CA 4CEZA 1SUQB 3HP6A 1S9GA 4KHUA 4MIAA 3KLFA 5C42A 4O0IA 2HAIA 3T5KA 4CFCA 4KB0A 4NLQA 4DQRA 4RNOA 3AVHA 3SCXA 1C1CB 4DTMA 4ICLA 1N6QB 2ZE2B 2KFNA 3OS2A 1JLQB 3DLGA 4K4ZA 3K5NA 4DL2A 2RF2A 3VQ4A 1RT4A 3TAQA 2XWYA 3VA3A 3AVLA 3F9KA 4I9LA 2IM1A 1BHLA 4TYBA 3FRZA 2FVPA 4O55A 3VQ7A 1NHVA 5KFHA 1FK9A 2OH2A 1BI4B 2OPRB 1RT2B 3FFIB 4OL8A 1RYRA 3FDSA 4CEDA 4TLRA 1S0NA 4YR0A 3P5JA 2C28A 5KT2A 2Z1HA 2WCXA 2B43A 4K4XA 3MEGA 5KFPA 3T5LA 1HYVA 1S5JA 3BQ1A 1WSIA 4Q45A 3V4IB 5KFKA 1C6VA 1FKPA 2IJNA 3CIZA 3DI6A 3H5XA 3MR6A 3GILA 2OPRA 3LP0B 1VSIA 1ZBLA 2ASDA 2V4QA 4ED0A 3V9ZA 2W9CB 3NGIA 3KMQA 3MR5A 2HHSA 1DLOB 4AILC 3KLIA 5DK5A 2IAJB 3QLHB 1D0EA 4C8LA 3THVA 1Z25A 2ZE2A 4ECTA 1RTDB 5F8GA 3LZIA 3DRRB 4FJNA 3T5JA 1RT1A 4J9QA 1T7PA 4MK9A 2EC0A 3TI0A 5C42B 2DTUA 3PW4A 3KK1B 4EO8A 2JEGA 1S1WB 1QUVA 3ZSQA 4O3QA 5F9NA 3CWJA 3GIIA 4RW9A 1Z26A 5J1EA 2ALZA 2D3UA 2IGIA 1CZ9A 3M8PA 4FZZA 4CHYA 1C0UB 2IM3A 4RNNA 3EZUA 2HMIA 3TANA 4DTSA 2X6NA 1Q8IA 3PR4A 3V81A 1BQMB 4IH7A 3OL8A 2B5JA 5JS2A 3PW2A 4CJ4A 2E9RX 4NLYA 3KTQA 3V6JA 4FLXA 4FZYA 4DLEA 2P1JA 1R0AA 4FJ5A 4HVJA 4J2BA 1EETA 3EY1A 3FQLA 4CF1A 4E7JA 4E7LA 4CHZA 5KFYA 3TAEA 1TKTB 3ITHB 3L2WA 2KFZA 2Z1GA 2ITGA 3DDKA 3GV5B 2ZKUA 4RNHA 5KT4A 2Y1JA 3KMSA 2X74A 1T8EA 4C8OA 1KLMA 2J6UA 4CJTA 3DYAB 3LANA 3DRRA 4ECRA 4Z4GA 3OVNA 4R8UB 1S10A 1TL1A 4J9KA 4DS5A 1D1UA 3AA5X 4FK2A 4J9PA 1VSJA 1ZBIA 3Q8PB 4O3OA 3SPZA 5I3UB 3V1OA 1VRTB 3UQSA 2XC9A 4URGA 4X2BA 2RKIA 4KI4A 1JL2A 2VA3A 1YTAA 2A1RA 2OPPA 3RMCA 3WNFA 4FXDA 3HO1A 2GBZA 3CJ2A 1VK0A 4JS4A 3M8SA 2P5OA 1JL1A 4DTPA 1C0TA 4LH4A 4RW4B 3LPUA 4CEFA 3CFOA 4ED7A 1GOAA 3BQ0A 3IGVA 4GC7A 1TK5A 4KBIA 1JKHA 2HB5A 3HYFA 1NK8A 2G8VA 4IG0B 4CJSA 4KRFA 2B5JB 3NCIA 2XY5A 1TK8A 3DM2A 4LQ3A 3NHGA 4EBEA 2ATLA 3JSMB 4BE2A 4LQ9A 4CIFA 1JLQA 3DLGB 1EP4B 4FJLA 2YNIB 3LPTA 1VSFA 3OLBA 4FCYA 4FJMA 1SKSA 3BSOA 3VQPA 3U6FA 2C2DA 4NCGB 4ED8A 1U49A 1CXUA 1RCHA 1B92A 4Q5VA 3N6LA 1TL3B 3KHLA 1XI1A 2UVUA 5KFLA 4B9LA 3IG1A 3G6VA 3SQ0A 3KK2B 3VQCA 3AO5A 3NH0A 1KTQA 4CFBA 4LSNA 4KB7A 4Z4IA 5KFMA 2XI2A 2WONB 3NF8A 3OSPA 4MH8A 4FJIA 4J2AA 1U48A 3ASMA 2PZSA 3GIKA 4W5TA 2RF2B 4FYDA 4QOZB 1HNIA 4DSIA 3VQEA 2VG5B 5F8IA 3PUFA 1RTHA 4DS4A 1IO2A 4DL3A 4K4SA 2JEIA 4Z0UA 4F4XA 5J2PA 5L1IA 2IDOA 2A1SA 4XPEA 1TKZA 3CDUA 4CJKA 4KHSA 5KGWA 1NJYA 3MTKA 1TKXA 1ITGA 5KG0A 1S48A 3MXMA 3QNOA 4KPYA 3CJ5A 2XO7A 1RDRA 1NK6A 1HYZA 2O4IA 4Z4CA 4M94A 2HNDB 1ZTTA 3RTVA 1TL3A 1LWEA 1J5OB 1C1BB 2ILZA 5F8LA 5HP1A 2V0NA 3BQ2A 3PVXA 2G8HA 4DF8A 4O44A 3KLGB 2W9BA 4ICLB 4CK1A 3TVKA 4FM1A 4B08A 5KFNA 3GQCA 3CDWA 1RT1B 4ZVFA 3HVTB 3QZ7A 4DEZA 3VQ5A 2F8TA 4Y2CA 1NK4A 4WZQA 2YNFA 4CGHA 4OPJA 4O3RA 2BQUA 1S0MA 4MFBA 4F8RA 1QAIA 3PHEA 1S49A 3PW5A 2XHBA 3S9HA 3VQAA 3AO2A 4ID5B 5KG3A 4CEQA 4N41A 5J2PB 1ZBUA 3CM5A 4W5NA 3I0SB 3OYGA 3DOLB 1RT6A 4N47A 3RRGA 3HL8A 3SQ2A 4NRUA 3SPYA 1WAFA 4OLAA 1TAQA 2FLNA 2GV9A 3LP2B 1RNHA 1U04A 5KTQA 3GIJA 4HYKA 4N5SA 3BSAA 3HVAA 4FJGA 1TV6A 1SH3A 4B9NA 4J9NA 4KSEB 3KJVA 4Q0BB 4NLOA 4DFMA 3OHBA 4B9MA 1HPZA 4F4YA 5KFJA 1RT3B 1HQEA 3RMAA 4ED2A 3CDEA 4F50A 3TARA 3KJVB 1SL0A 4YMEA 2FVSA 1GOCA 1W9HA 5DQHA 1RDAA 3MXJA 2AQ4A 1UAXA 3DRPA 2GC8A 4CHNA 3NE6A 4KHNA 1IKVB 3HVWA 1HQUB 3DLKB 4DF4A 3K5MA 1SL2A 2FVCA 4WFZA 1QSYA 2OA8A 3L2UA 5JS1A 1JLAB 2OPQB 4WE1B 3V1RA 3D28A 2J6SA 3I0SA 1RTIA 2YKNA 1GX5A 1KHVA 3M9NB 1IKWB 4ELVA 3RB3A 4CHPA 3GV7B 3Q8SB 1W25A 1HJRA 4F4WA 3V81B 1RBSA 2YNGB 2HVHA 1S6PA 5D3GB 4CJEA 3ZSRA 2XY7A 4M3YA 3V6KA 2D0CA 5DMRA 3SJJA 4DFPA 4HUFA 1F21A 2WTFA 3ZCMA 4YP3A 1S6QA 4NLSA 2D7SA 5SWMA 2IJFA 2E6LA 5J2MA 3ICLA 1RBTA 3TAMA 3VQ6A 1JXBA 4F4ZA 4ZVEA 3QYYA 4DL6A 1C1CA 1SV5B 1RT3A 2ZQBA 2B6AA 2UVVA 1QE1B 3G86A 1S4FA 3SI6A 3IRXB 1UOCA 3HT3A 3AVCA 1LWFA 4IKFA 3D45A 3RBEA 2BANA 3RMBA 5L1KA 2OYQA 1G15A 1ZYQA 1LWEB 2IC3A 4YR3A 3DOKA 5F8JA 3OHAA 1A5VA 5KFGA 1IH7A 4CIEA 3JYTB 1T3NA 2BDPA 4MK7A 1JLFB 3O4NA 1LWCB 3NDKA 3ISNC 2IBKA 3QEVA 5HRRA 3TAGA 4I2QA 2I5JB 3RR8A 1TQLA 3S3MA 4TQSA 1HARA 2DFHA 4R0EA 3N6NA 3OYJA 4QWBA 3KLEA 3AVGA 2XY6A 2Z1IA 3I8DA 3PZPA 3HM9A 2HHQA 3VQQA 3PY8A 4J9RA 1WSFA 2KZZA 4ECWA 2BQ3A 4RW4A 4O3NA 2D3ZA 1RDCA 4FK4A 3K58A 2XY8A 3AA2A 1NK9A 3V1QA 3QIOA 4FW1A 3VQSA 4EP5A 3L3UA 3K2PA 3V9UA 1JLGB 4IDKB 5FDLB 1NKBA 1W0HA 4RW6B 2G8FA 5FRMA 3SI8A 4BDZA 3S3OA 4KHRA 1EXQA 4RUAA 1J9AA 4NCGA 4ECUA 1S1WA 2AGQA 2UUWA 4ZPAA 2BRLA 1TAUA 1RT7B 5JUMA 4XIUA 3MFIA 1RA6A 1GX6A 4IOBA 3DYAA 4CEBA 3LDSA 1YVUA 4RW8A 3TWHA 4ELUA 1Z4UA 2E4LA 3NGZA 2I5JA 4NLDA 4EEYA 2D5RA 1JKHB 3QESA 3QO9B 4WXWA 3PX4A 3ZSOA 4XO0A 1TKXB 1JXLA 4CK3A 4LSLA 3DLEA 1RTHB 3RBDA 4IBNA 1FKPB 2R8GA 1TKZB 4GW6A 5F8MA 3RAXA 5CYQA 3QINA 4J2DA 3DMJB 3NKYA 1BIUA 4W5OA 1XWLA 3UDLA 1C0UA 2ASJA 2ETJA 4JUZA 2G8WA 1HYSB 4OKJA 1X9SA 4KREA 4JV0A 3U3GA 4OKEA 3M9MB 3H4BA 4IR9A 4CK2A 1BCMA 3OYIA 1X9WA 4ECSA 5KFUA 1JLCA 3SFGA 1KLNA 4B8AB 4FJHA 1UWBA 3RB6A 4G3IA 3PW0A 1S6PB 5D3GA 1WSJA 4ZP8A 3H08A 5C25A 3AVKA 3KLVA 2PYJA 1QQCA 4RU9A 2W9BB 4PUOB 4BE1A 5KFXA 2F96A 2YNHA 5HP1B 4C8KA 3I5CA 5HRPA 5KG2A 2YKMA 2JEFA 2C2RA 1RYSA 4C8NA 2FLPA 1DTQB 4Y3CA 4RW8B 1DTQA 3MEDA 4RNFA 4DL5A 4LY7A 5EWFA 4FBUA 3RMDA 4PUOA 1SKWA 1IM4A 3A2FA 2YNHB 4NLTA 1Y97A 3OYFA 1T94A 4CFAA 2Y1IA 1T05B 4C8MA 2DFFA 3NBPB 1RAJA 4H4MA 4URSA 5DQIA 3LAKA 2KQ2A 1RA7A 3SZ2A 4K4UA 4NZ0A 3F73A 2DFEA 4DSFA 1D9DA 4Z4FA 3DLKA 2VG7B 5KFBA 4HHTA 3AA4A 3RR7A 3I5AA 3QEXA 4DSLA 4O3SA 1HYSA 5KFAA 3KHHA 4FVMA 4B8CA 3CG7A 3CO9A 1HPZB 1C0MA 4CEEA 4NLUA 2O4GA 3KLFB 3Q8QB 4CEAA 3PW7A 1HNVA 3EPIA 5KRSA 2YKNB 4KE5A 3OYHA 3VA0A 1JLAA 4WE1A 5DG7A 2KZMA 2AGOA 1ZBHA 4ZP9A 3D0PA 5CZ1A 2JGUA 1VRUB 3KLEB 3NF6A 3MEDB 4K4WA 2FBTA 4M41A 2XCPA 3OJUA 3V9WA 1TK0A 1WAJA 5EU7A 4CF0A 1BGXT 2HNZB 2R7YA 5EDWA 3BGRA 3FQKA 3E51A 4F2SA 4KB1A 2FBYA 5HROA 5C25B 3AVBA 4H8KA 2VG6B 4O4GA 5CY4A 5F8HA 4Q0BA 1JLBB 4K4TA 3T1AA 1S9EA 1HNIB 1N48A 1RT5A 3SV3A 1MMLA 3ISND 3HJFA 2AGPA 5J2NB 2KTQA 3AV9A 2XGQA 3C6UB 3ZSVA 1HRHA 4IFYA 4HCCA 4NLRA 4DLGA 4LSNB 2B6AB 2E9TA 3TR8A 1LV5A 2UVWA 3OYDA 3V6HA 1JX4A 4WZMA 2JLEA 3NBPA 3HP9A 3VN5A 2WHOA 3HVTA 1ASUA 2XRIA 1N6QA 5KFEA 2V4RA
chains in the Genus database with same CATH superfamily
1I39A 5L9XA 4QBUA 4KFBA 1MNEA 3NS7B 4E0DA 1FWPA 4UZCA 3C6TA 4BDPA 4NXMJ 4MQ3A 2O01C 3EPGA 3MWPA 4PR6A 1U45A 2X1FA 2MKKA 3W62A 3ADAC 3UB5A 1NGGA 1L3TA 2FHJA 1XBWA 3R27A 3TEGA 2WVFA 3K7RA 5M2RA 2CJBA 4FWQA 1WBDA 1FFSB 1NGFA 5F2RA 4CWBA 3AAPA 1OH6A 3TAPA 1N52B 1KRPA 4E7HA 2QFIA 3FCVA 3HDSA 3DI6B 4DU4A 3EXYA 4FK0A 3FFIA 3RB4A 4RTFD 3CMAN 3LM9A 4OPKA 3TJ8A 4WFBQ 4L72B 4ZPBA 4F3MA 3R5JB 5ETLA 2ZOGA 4KTQA 4B9VA 1KVAA 1K8KA 1E4FT 4M7XA 4CIGA 2W2OP 1WTFA 4N8OA 4JKGB 3TAMB 5LMNK 2VDHA 3W2WB 2W7OA 2Q31A 2Y0BB 3MEKA 1Q8KA 1QQNA 1RBOB 5HJYA 1VK8A 1S1TA 2ZH9A 5AZIA 3LH2S 3CJKB 2VG5A 1LW2B 1CJTA 3THXB 2QEXS 4FLYA 3MCOA 4YOUA 1GMWD 4GMJB 3G6XA 1DT9A 1VQKN 3LDOA 1M5KC 2QA4G 1FDAA 2AWZA 4HI1A 2FGOA 2PI4A 3JSMA 2ZVSA 4BACA 4LMZA 4QPXA 2VPWB 1YRTA 4K4YA 3WXLA 2HIYA 3HKZD 3M1VA 5E84A 4R5PB 3UIQA 4I6AA 2RHKA 3MUTP 4B3MJ 4N77A 4ILRA 1JJ2M 1JIHA 3L95X 1FKAF 3LP3A 4H4KC 4DU8A 1NKCA 3BKUA 3M8PB 3OL7A 3HHLB 4Y2KA 1MWKA 1ZBTA 5LMUK 4HTUA 3HF5A 5KOWA 4FWMA 4M3XA 4OKKA 3ILIA 3ENQA 4DFKA 3WEEB 2CPFA 2V5HG 3KDNA 1F5BA 3VEYA 2RIJA 3ITHA 3GTYX 4CLFA 3KK1A 4DV3K 3V4IA 2V34A 2YPYA 3M32A 1KCFA 3L0QA 1HLWA 1U1PA 4BC9A 2O8EB 1HI1A 1GLLO 4NX9A 1VC5A 2LDYA 1FDNA 4DV2K 3GIMA 4W5QA 4B3MK 2MSSA 5HI7A 4KHQA 3LPEA 1N33F 1ILYA 3EYZA 3EDQB 4CT9A 5B0AA 3HI0A 1Z2LA 1U4BA 2HBRB 1R59O 3CDBA 3CC4N 1Q81O 3GYXB 4DQIA 4PXDA 2V4JB 3SUPA 1SJQA 2HMIB 1RU2A 3QSYB 5AJ3F 3AVNA 3KDOA 2KH9A 1CVJA 4PWWA 2FJVA 3GWCA 3HPGA 1X4FA 2PT0A 5C0YA 4L6V3 2BJ3A 2F4FA 5F8NA 4QWAA 1SJRA 1ZZNA 1RZMA 4Q8FA 3ZTQA 4F04B 2RHQB 2M88A 4DSJA 3ELHA 3ULEB 1NSAA 1NBWA 2AEMA 5HRNA 1IKXB 4TVAB 2YWFA 1SUQA 4X4UA 4C3KA 2Q79A 4JV5J 4OX7A 5LSOA 1LW0A 4Y1DA 5CE3A 2OCEA 2B7CB 3BBCA 2A2DA 1PYOB 3HCXA 5ELZA 4TXSA 4JV1A 2VHGA 4C11B 4E8UA 1A7GE 3VGVA 4DTNA 3N4WA 2GAHC 1FJGK 2AYBA 3UKRA 2NUHA 3P5BP 2QMXA 4J2EA 2CG4A 3T19A 3OTBA 4FS1A 4NCAA 1CG2A 4I7FA 2HNYA 2GUIA 5J2QA 3G25A 1QSLA 3DMJA 2B3TB 2HBZB 2UYTA 3CCWA 1TV6B 5K8PA 3WNEA 5LMUJ 1U47A 4Y6IA 1OSCA 3MMCA 3PJWA 2IA6A 4YOXA 2UXBK 3QBCA 3G82A 4FS2A 4DQSA 4J9OA 3EM1A 2CJXB 3TP2A 5KFCA 3PRDA 1WC3A 2QX0A 3L2VA 2J6TA 1S0VA 2YWKA 5AXKA 4FW2A 1UAWA 5JXSA 2E1AA 3PX6A 4NEYA 3T5HA 4Q8EA 2GHPA 1YJVA 4PKGA 1N5TA 3R5BA 1FVQA 1S97A 1R8HA 1E6VB 3I4PA 1T0TV 1I1GA 4ZVGA 1BWEA 1X5TA 1LWXA 2HLUA 3LZJA 2MY8A 4NA3A 3IBWA 2DGSA 4C1NI 1UJ6A 5A8RB 2VFRA 1Q7LB 5J1PA 4CJFA 3CIMA 2V9KA 2XEXA 2Q66A 1BUXA 2H3GX 3CCSN 5CYJA 3QQCD 2HHTA 3HVRA 4RW9B 1RP5A 5U47A 4QCLA 4Z4EA 2UUAK 1RTDA 2C2ZB 2MLXA 4OJ1A 4AM6A 4DPYA 4WBFA 2NXNA 1WNEA 3QRRA 1SJ4P 2W8KA 3SIPB 4A47A 3JXUA 2HHWA 1I6JA 4WTYA 4W98A 4WWSA 4DU1A 2CRLA 2GO8A 1IBKK 4UF4A 2ZH4A 3OW2M 4N76A 1ZXOA 2Z4PA 3FNNA 3HLUA 1YITS 3V9XA 4CHOA 3QRQA 4WQ5A 3PJ9A 3AQPA 2FZGB 3P5TL 4C1NK 1WF2A 1WKKA 4G1QB 1KHWA 2VIHA 1KEKA 1R8AA 5M1FA 3NMAA 3DHXA 4O23A 2PI5A 4ZHRB 4PQUA 3TVYA 4FP9A 1F5AA 3P8BB 4CIOA 2E9ZA 1RT4B 2NNWA 2JC0A 2P9LB 2K06A 5IQ6A 5J1EB 4EGLA 1UFLA 1SQGA 4U7UK 2GCFA 2PMWA 4LFBK 3DOMB 5DDPC 3BGOP 1PJ6A 2XHWA 2RKIB 2H4WB 3RUBL 1JWWA 3QBXA 2AU0A 4I67A 3O9RA 4DHYA 2EVZA 3C94A 3IN5A 5BR9A 3D3BJ 4KGZB 4MKVA 2BE2A 3CVKA 5AJ3K 1NMDA 8ATCB 3AA3A 3HSTB 4WIIA 4ECXA 5CH7B 1REVB 4I2PA 4CGGA 5LM7E 4BCAA 3BR9A 3JQMA 2PC6A 3NL0A 4HTIA 3F2KA 3KIOA 1UFKA 1N33K 4AM7A 5F3ZA 4KAIA 4DL7A 3NH2A 5DG8A 4UQGA 2KKHA 1DLOA 4HVZA 3H5SA 3B54A 4I6WA 1SL1A 2M8DB 4D3GA 5HRSA 2AEFA 2QKKA 3NWGA 5D6GA 1QDUB 3RRHA 3EEQA 3P96A 2LFVA 3DWLA 2WK4A 1G99A 2YWGA 5EWEA 4E1NA 2A5XA 3OS1A 4WTOB 4DV6J 2CJYB 1NM1A 1NJWA 1Y5IB 2OPSA 4B9SA 4LFAK 3CJ4A 2QJ3A 2P9UB 3I0RA 1NGEA 1IBCB 1KVJA 2MKSA 1HWIA 3CFRA 3BSCA 2WSEC 3Q2TC 1VRTA 5C5JA 5JVHL 2QO3A 1Q7YT 1RT5B 4RW7A 1M5HA 4PXEA 3ENHA 4OVLA 3KD1E 1QQOA 1RWUA 2K1RA 3ID8A 1K9MO 3FBFA 2IM2A 4EMDA 1KSPA 1HNWF 3PLAA 5AQKA 4DV7K 4CLKA 3VAHA 2HZVA 3BY5A 4L74A 4K4VA 3TRGA 2G8IA 3IWNC 1RBAA 5E3CA 1FRHA 1N5YB 2LXUA 1RHMB 1XR7A 4LF4K 4AQYJ 3CD6S 1Y10A 4XAKA 2L9NA 2DRDA 5G0RB 3AODA 1WSHA 1HBMA 3QIPA 4U7CA 1DQ9A 3GV8B 3ZX3A 4GO7X 3JSRA 3DFEA 3AARA 2FXUA 5G0RA 5IWAK 4IG3B 5KFZA 4FF3A 4CJPA 3B8HA 1OKJA 3GYGA 5GMEA 1K0TA 4B9QA 5HBMA 2IPOB 3ZZZA 2UV8A 1RWXB 4LFAJ 3VWSA 4FPAA 3PIOL 3KKRA 4Q43A 1D9FA 4CDIA 3VERA 4DR2J 2QWNA 3O6WA 4NL5A 1L5UA 1XR6A 1HQEB 4TYAA 4CERA 1TP7A 3MXIA 2E7WA 4PPZA 3EKSA 5A8WA 1K47A 4P7TA 2VQFJ 1NK7A 2VFTA 3HSCA 3PACA 4CBXA 2MTLA 2WTUA 4DFJA 2R2TA 1BWFO 3I0RB 4WIQA 1DTTB 4PA1A 1YDLA 3Q86A 1UVIA 1HX1A 3OR2B 3ETOA 3WXJA 2KM8B 3C8YA 3OTDA 2OIHA 5T7LA 2FPHX 2UXDF 3P49B 5I3QA 2HWHA 4BG8A 4NYNA 1ZTWA 1YJWS 4J9VA 3VCDA 4FO0A 4HWIA 4JLHA 4HHJA 2DGXA 3OXGA 4OJRA 1QE1A 2UXDJ 3UKUB 4AHSA 4UTGA 4M5DB 4Y00A 4LFBF 3LW5C 1TYQB 5M1PA 4JI1F 4CJ3A 3K59A 3PV8A 3GCWP 3H2LA 3QFWA 1VIXA 2JDJA 1VBXA 4FJ7A 3ETMA 4HDHA 5KFQA 1H74A 5KFVA 1CQMA 2DNPA 1YJTA 1NXIA 1S12A 4LBIA 5AQHA 1CXQA 1R43A 3ZXWA 1YBAA 3KHRA 4H54A 2NUUG 3BBFA 2BGGA 1FTRA 2FLLA 2HHHF 4NLGA 4WFNL 4IFVA 4YDXA 3T1YF 5I42A 1DY3A 1NZ8A 4PYAA 1BE4A 4HDGA 3TZXA 1A5XA 5C15A 1HBOA 2WVCA 1HBUB 4ZHRA 1UEVA 1VI7A 1CBKA 1GFWB 1S1TB 5E7OB 3TSPA 1SZ2A 2EX3A 1M90T 1FE4A 3MK6A 4RW7B 1KONA 1VSKA 3ZSWA 4DPOA 3G10A 4ZPWR 1W2BM 1XIQA 4JI4K 4KYZA 3MAAB 2QXLA 1RTJB 5AXMA 1WBBA 2P9SA 2E44A 1YZ7A 3ENOA 2DNRA 3CJ8A 1OH7A 5KT5A 1PAEX 3ZT0A 5K8MA 4A8SA 1UL3A 1OPZA 5GAGP 4DV7F 4LVNP 4A4JA 3G0ZA 4CF2A 2ZNYA 4JAXA 4A48A 3ZZOA 2G8UA 5ETKA 3QO9A 3R5GA 5IS2A 2HS3A 4JI0F 2HFZA 2RRAA 4MO5A 3CJ0A 2R9LA 4K50A 1OQ3A 4C9DA 1TKTA 1H98A 2AV5A 4FWRA 2IC3B 4LRCA 2QL9B 4NXMF 3J7AN 1S9GA 4MJKA 2L3MA 3P45B 1Q5VA 3WQPA 2HAIA 3T5KA 5ETTA 4KB0A 4DQRA 1G4CA 3SCXA 1C1CB 2DR5A 4RCHA 3VESA 1N6QB 3TSUA 3CW2C 1FD8A 1JLQB 4OX6A 5GIOA 2RF2A 5CCMA 1RT4A 1N32J 2XWYA 3F9KA 3DAWA 2IM1A 2FVPA 4X62J 1FK9A 3MURP 2Q0UA 1SQKA 4GMKA 2C28A 3DCAA 3UDCA 4TNOA 3GJRB 5K5MA 2HF4A 2KXNB 3BQ1A 4M5NA 2Q43A 3X3UA 3DRYA 2CFXA 2EK1A 1FKPA 3M6XA 2OPRA 2XLIA 3RSEB 2XYHB 2DHHA 2ASDA 2FSKA 3IBFB 4HACB 2WZ1A 3NGIA 4U9RA 3KMQA 2LXFA 5KPTA 2IAJB 1Z25A 1I5OB 4ECTA 1RTDB 2QL7B 3LZIA 3DRRB 3UD5A 4FJNA 3M30B 3T5JA 4J9QA 1HFEL 4MK9A 4EO8A 2JEGA 3BGFA 3CHWA 4LBHA 2DY1A 4E2FB 2YWWA 4P73A 4FVUA 3UO0A 1I94F 5J1EA 2GMHA 4F0KA 3S1TA 3HFKA 4CHYA 2QA1A 5DM6Q 1C0UB 4RNNA 3EZUA 3LL3A 2HMIA 3PSIA 1Q8IA 3PR4A 3THYA 1BQMB 3LPYA 2A6AA 3QMLA 3OL8A 2B5JA 4AFFA 3AT1B 1X9JA 2V8DA 1TL7A 1FW6A 3T6JA 4HVJA 3EY1A 1Q79A 3O9SA 4A8WA 1HWUA 3TAEA 1TKTB 1Y64A 1VQMN 3MZIA 3MMCB 3PM9A 4B3RJ 2ITGA 3DDKA 3TW0A 3D2FA 4K41A 4RNHA 1EWQA 5KT4A 5ETSA 3FSYA 2X74A 1T8EA 1KLMA 1T9YA 3DRRA 2CJAA 1X5OA 4P2SA 5THWA 3IMXA 2KN4A 2R7XA 4Z4GA 3E2EA 2XQCA 5BR8F 5E26A 4J9KA 4PQAA 3FMBA 3MCNA 1VSJA 3CERA 4O3OA 3V1OA 2JX2A 2HFNA 1YTAA 2A1RA 4OHZA 2OPPA 1S4EA 3RMCA 3WNFA 4A8QA 2BEFA 3MAAA 1S79A 2B4VA 3K8VA 1JL1A 1GT8A 2RRBA 4LH4A 4RW4B 2N4CA 1FRLA 2Q1NA 2M52A 1K73O 1HNZJ 3IGVA 4CBWA 4DV0F 4FSVA 4JI7F 1FA0A 4PG6A 1VHXA 2OI2A 3NGRA 3HYFA 2EFVA 1PC5A 4KRFA 2P9NA 1I3OB 1YG0A 3NCIA 4S0MA 4LQ3A 3GG1A 1UW4A 2OD4A 3JSMB 5AXLA 2R7TA 5A2QO 1B99A 1JLQA 2CPZA 3CCRS 4FJLA 4LF7J 4DU7A 1VSFA 4CZCA 2QWOA 3BSOA 2RE1A 2K7KA 1VAZA 1RCHA 5JVHQ 1IBKF 1XEZA 2BKOA 3N6LA 4BRNA 1N5VA 5KFLA 1ZS6A 4PWUA 1GLAG 3NH0A 4XH1A 4CZIA 1VQKS 4AL7A 3TEHB 1LNQA 4FXWA 4CQ1A 2WONB 3OSPA 4MH8A 3GIKA 4W5TA 2AYEA 2XSJA 1IBLK 1HNIA 4DSIA 1QZ6A 2FSNA 4ILHA 1FD2A 1MG7A 1UPMB 1XMOK 2ZGZA 2GJIA 4K4SA 4YB5A 3GCXP 3TJAA 3D2EA 3HJVA 2XSJB 4PG7A 2DGTA 2JEIA 4Z0UA 4F4XA 5L1IA 2YVSA 1TKZA 3PIPQ 4H0OA 4C0BA 2DNGA 2SXLA 2ZH8A 3QAEA 1IJFB 3CEDA 3CJ5A 1MWQA 1NSQA 4JV5K 5G4DA 3CCVS 1HYZA 1MW7A 3D2WA 2MHEA 4M94A 1ZTTA 5IWAJ 1U1NA 2OELA 3POTA 2MLYA 3TYTA 4QS8A 2G8HA 2G1HA 4QYZK 2GUPA 4CK1A 3TVKA 5D0EA 5KFNA 4M5HA 3CDWA 3GQCA 3MM9B 3C15B 4IXCA 2W25A 4C97A 4ZLNA 1NK4A 2ASOA 4ETXA 3SCLE 4OX9F 3IFRA 3O3LA 2IJRA 6FDRA 4IYQA 1T11A 3C6HA 3PHEA 2ZJQQ 5BRFA 3PW5A 2XHBA 3S9HA 3OV7A 3AO2A 3B82A 3HZ6A 3A8EA 4Y0WA 1Q8LA 3DXMB 3PNIA 5FD1A 3DHWC 2KVIA 4N47A 3RRGA 1MLAA 3D6TB 3VGTA 3H6EA 2NYIA 1A6LA 1TAQA 2VFUA 4IO1A 2KVQE 1JNZB 3CD5A 4AXJA 4HYKA 1AYEA 2YQ0A 5A6WA 3CJ1A 3QJPA 3MPYA 2CG8A 2IHR1 5L9NA 4LSZB 3IAS9 2WC9A 1Y9OA 3TTCA 2P9PB 3OHBA 1HPZA 1NGAA 1KBRA 1O0PA 4WKYA 3CDEA 3TARA 1SL0A 4PCQA 5I3PA 2XMAA 4LF5J 1W9HA 5DQHA 1RDAA 2EEYA 4KHNA 1IKVB 1SL2A 2FVCA 2P9UA 1IBMK 4OZLA 1JLAB 2OPQB 2M5YA 4OYOA 2J6SA 1GX5A 1V6HA 2I2YA 3CCSS 3I82A 4CHPA 1TL7B 3Q8SB 1KXPA 1W25A 2XTJP 3RW6A 3THYB 1RBSA 2DNQA 1EARA 1S6PA 2CDRB 2N3LA 2NXCA 4M3YA 2V2KA 4Z7YA 2D0CA 4X64F 2WTFA 2ZDPA 4KH0B 5FJ4A 5SWMA 2BMBA 4DR5F 1RBTA 2FYXA 3P4UB 2GELA 1U6ZA 4R0JA 4WK3A 4Z7CA 3JAMY 2BYCA 4FKXA 3QYYA 4DL6A 2GQ2A 5B0CA 2ZQBA 4BY9C 2E1CA 3J7AP 3GDQA 3M30A 1UOCA 4UOHA 1YIJS 4IKFA 3MM6B 3N01A 4IEIA 5DETA 1Y00A 1GTHA 3WC2A 1N5QA 2AJ0A 4X84A 1Y4ZB 3PIPL 4LUBA 3DGVA 3O4NA 2E66A 1LWCB 1KQSM 2YJEA 5ITHA 3LO3A 3TAGA 2I5JB 1SC3B 1TQLA 2XZTB 1M1KO 2DFHA 5D4PA 3OYJA 3AVGA 5K9FA 3PY8A 4ECWA 1RDCA 2DYAA 3UDVA 2XY8A 4KPCA 1IWGA 1UTAA 1NK9A 4PXBA 4YHHK 5AQUA 4JV5F 4EP5A 3L3UA 3K2PA 3TNVA 1JLGB 4IDKB 2DVIA 3SSQA 2NZTA 5FRMA 5BJRA 4GKJF 4NCGA 1HR0F 1XTZA 1WC5A 2AGQA 4X66J 3HZGA 1RT7B 4B3SF 3LGNA 1UVMA 3MFIA 3GFXA 1QVGR 3DYAA 1WJ9A 4CEBA 2P9PA 4PYDA 4K59A 3NGZA 2I5JA 3OBWA 1WEYA 1C4AA 3Q83A 4QIEA 4ZVTB 2V94A 3FSXA 3HZEA 3QO9B 2BOPA 3W0LA 3VQTA 1IQTA 3MI7X 4BC7A 2MQOA 1HLUA 1RTHB 3MM6A 3RAXA 4CLLA 4KQZA 3QINA 4J2DA 5T7LB 2MZQA 1BIUA 3K17A 1GLEG 2ETJA 1HYSB 3J81O 3ZTPA 1AB8A 4JV0A 2QIFA 4OKEA 2KLAA 1Z6RA 3KK7A 5LXYA 1RCXB 4DOZA 3OYIA 4ECSA 1WD6A 4FJHA 2A41A 3NEKA 1FX4A 1VBKA 5BR8J 3FKBA 3OT9A 3RB6A 4G3IA 1XQIA 1X8DA 1S6PB 1WSJA 4ZP8A 4HT7A 4ZJQA 3KLVA 4OYAA 2PYJA 1YJRA 2B4PA 3TZYA 4RU9A 4BE1A 4JI8K 4QIVA 5HRPA 1M1HA 5KG2A 3KG4A 2JEFA 7FDRA 3M7VA 1KD1O 1G2EA 3SDEB 3CUNA 4RW8B 2YXLA 4DR7J 3DLLQ 3MEDA 4DL5A 4FBUA 4PUOA 2IVFB 5DM6L 1TUGB 3HSJA 3T41A 2YNHB 4NLTA 4H4MA 4A8OA 2KQ2A 1RISA 1RA7A 2WBRA 2W4PA 3SZ2A 2PD1A 4DSFA 2WUSA 2QEXN 4JKCA 2VG7B 3AHPA 2IY5B 2FB0A 1QHAA 1K8AT 4CZMA 4JI5F 3AFGA 1RAEB 2APOA 2IVYA 5JVGL 3KHHA 4CEEA 4NLUA 3PRVA 1KKHA 2OGUA 3PW7A 4KE5A 1YJUA 2ASMA 1JLAA 2EK6A 4ZP9A 3D0PA 4KGVB 4YN3B 2P8IA 4M41A 5M2PA 2DNKA 1DRZA 2HFOA 1BGXT 4A5BA 3KNGA 2LMIA 3Q2SC 5EDWA 2BKNA 3D0GE 4MDAA 3M5RA 1RB0A 1XNQJ 2ZM6F 5HROA 1I94J 3AVBA 4C0OC 3SMZA 1RDWX 1JLBB 5H9FJ 1P8ZA 4DL0C 1NDLA 1HNIB 1ZBSA 2KTQA 1D09B 5JICA 5HMXA 2YX7A 3NY0A 2B6AB 2E9TA 4WZMA 3GJSB 2ZH3A 1LCUA 3VN5A 1S57A 3HVTA 1ZM4A 1K8KB 5KFEA 4DUTA 1E4GT 2V4RA 1NSKL 1RHKB 4BR0A 3QLHA 4QW8A 4WFAL 4FWKA 3OTOJ 3BF3A 3MOJB 1YJNN 4JEPA 4XH4A 2JVOA 3TZZA 4WCEL 2VA2A 4DSKA 2RQKA 5LMNJ 2NLWA 4FJ9A 1HNXK 4QR1A 4MK8A 1Z2ZA 1R3NA 2KI2A 2GFFA 2W7PA 4OI4A 3BJYA 3OR2A 3LWMA 2CNLB 3TSQA 1IKWA 1YBUA 3OFGA 4ZVQB 2LECA 5LJ5Y 3SJHA 1BHNA 1DTTA 3DOKB 5JJBA 3FZMA 3AD9C 2ZFHA 3BSNA 3G2XA 3JYTA 2AX0A 2EI5A 1HQUA 2MQPA 4M42A 1I94K 2OUGA 1YJ9S 3SUNA 1ATRA 2HVDA 2MXYA 5K8OA 3A4TA 2ROEA 3ENAA 2QFJA 5DO2A 5H1SQ 5B0GA 1HD0A 4KKOA 3GB0A 5HOOA 1U6BA 2RB7A 5FDLA 4M5JA 3HKWA 4DV4F 2OPPB 3HHKA 5AQTA 2WFBA 4IR1A 3N6MA 1SXLA 2UZAA 5CZXA 2IVMA 4EBCA 1S9FA 3IS9A 5DGAA 1U26A 1WG5A 1QQMA 3BN4A 2E5GA 1L3SA 4OZ5A 3QIPB 5KG5A 1H1VA 3MMAA 4UY8T 3T6BA 5KFRA 4F4AA 1U2CA 2D3OR 2HSEB 3TUIC 5BYQA 1WNSA 2IAJA 4LRDA 1WC0A 4LF7K 4BRAA 3AO1A 3K8WA 1RU1A 1WLJA 3NFAA 4ZK7M 2W9AA 4RWWA 4ZCMA 4GC6A 4CEOA 1QHTA 1D8ZA 1JLBA 1MMDA 2ZUGA 4OJ3A 1IV0A 3MWTA 4MIWA 2AW0A 4BDYA 4EI2A 4AHRA 3ZSYA 2RMLA 2VBXA 4F9OA 3VMFB 2FF6A 3T1HK 2IFXA 3ZYYX 1E6YA 2F4VF 2Z1JA 3W5YA 3TJ9A 4EHTA 4EBDA 4Y0FA 3HXMA 2EBEA 3UE5A 3JTOA 4YEAA 3E01B 2MGZB 3L3CA 4ZTFA 1ZPVA 3QGGA 2AZ1A 4CCHA 1YAGA 4NYPA 1NZAA 2JRSA 4NLVA 2HNZA 5AE1A 1N88A 4DUZF 1S9GB 3O44A 2LKZA 4ECVA 4JI6J 3P31A 4YB7A 3UVJA 1LWCA 2V51B 1RLCL 4JI5K 2VG7A 4RPFA 1FXXA 3GSIA 1FWLA 4E19A 1WC1A 3BDPA 3BS9A 1LW0B 3MR3A 4YNQA 2Q3SA 3G8QA 2J7UA 1Q4RA 3Q7CA 3J80Y 4FJKA 1WHWA 3RBXA 4X4OA 2BJEA 1MWMA 4J5OA 2E1MC 1U0HA 2E1PA 3KLGA 2FQQB 4H5VA 4OYZA 3AA9A 1NNDA 2B8PA 3TTDA 2YQ1A 1J5OA 1VS3A 4CBUA 2WW8A 1HNZF 1SKUB 4ECZA 3TQ1A 2CDQA 1M5VC 2HK2A 1VSEA 4ZJOA 4OFZA 3MPDA 1ELOA 2P9LA 4IG0A 3HM8A 3LP2A 1KD1T 1HNWK 4C7QA 3L4IA 3VF0B 4B3OA 4KFBB 1WELA 3CCMS 1QS4A 4WFNQ 3IKMA 1K0VA 2KW4A 3EZ5A 2HHUA 5C24A 5CYMB 3CD6N 3EZWA 4LF4F 4B3TF 4B3OB 3NF7A 4U96A 4P71A 3W61A 5HATA 4ED5A 2HURA 3UWTA 5IM0B 2G2YA 2UV8G 1P9QC 2VKZG 4DTRA 1IKVA 2VONA 4AHCA 4LFCF 4ILMA 2AJFE 2LQ8A 4YOYA 4CJWA 4Y34A 2RDIA 2HS0A 2LQJA 4LC9B 1AZSB 1Q18A 4FJXA 2ILYA 4FPIA 2VICA 3TAFA 4ERDA 1T02A 5BPNA 1F9HA 4IRKA 2FC8A 1LAVA 1WI6A 2ZJRQ 4ITSA 3RVCA 2R7UA 1F9FA 4E3SA 3IAYA 4EYHB 4EFHA 4WKRA 3UN5A 4E89A 2HHVA 3BYRA 2GVZA 4M45A 2KG1A 1HHQA 2M8HA 2X1AA 4JI0J 4A62A 3R5AA 5KFTA 5KPRA 2CQ2A 4CGIA 2FC0A 1A5WA 4RZRA 3AOCA 5HVHA 3NOCA 1FT8A 3CETA 3Q8VA 2RHSB 3G4SS 2XMWA 1WG4A 3LGMA 4DV3F 5FPDA 2I6WA 1UVLA 4XTTA 2B51A 2ZNZA 2J8SA 2XNQA 1VQ5N 4H4OA 2E5LF 2GJ2A 4NZ7A 2LYVA 4LF6J 1O1WA 4DQPA 4ZIWA 4FBTA 1HBUA 3B6PA 3CCJN 2QWMA 2E7XA 4WYBA 5E41A 1HJOA 1L3VA 2KYXA 3EGNA 3J7YP 2Q6CA 5FLXO 3O9UA 3G6ES 4IRDA 2ZBQA 1CLQA 2JLGA 3DXKB 2EWHA 4CJUA 4PHTX 3J8AA 1GH8A 2KXFA 2RRNA 3MM9A 1U6FA 4KJIA 2NREA 4JK9A 4BBYA 3CQYA 2W6LA 2N4DA 3S3NA 4EO6A 5KRTA 3SAFA 3PO5A 4IJNA 4AHTA 2HWTA 1UW9A 1BA0A 1LFWA 1UFWA 3OL6A 4YFUA 3T1HF 2UXBJ 2V8GA 3L09A 3AJ2A 3K5LA 4B9UA 4DX7A 3HHLD 4QR2A 2W2MP 1UP1A 1UKUA 3JTNA 3UN2A 4X64K 1IUJA 1N34J 4EFAC 1ZBFA 3DRXA 4YOEA 3G96A 3O3FA 4CGDA 1TGOA 3MPVA 1VYAA 1Z05A 2MQNA 5EX5A 1X4EA 3RJMB 3ZT4A 4KRWA 2CPXA 2IRUA 1TL4A 4KGKA 5H9EJ 4BR9A 2F5GA 3AB2B 1NJZA 4FL9A 1FRKA 3SUOA 4ISFA 1O6XA 2LA4A 4CLTA 2GS8A 2OTJS 1S22A 2O66A 4O0JA 2CJKA 2RQMA 4CGJA 2R8HA 1M0SA 4JRQA 2O5DA 2C2EA 5IOLA 2J4RA 4O5BA 2VUGA 3BKFA 1C0FA 5K14A 1JK9B 1SV5A 2XI3A 1OJ4A 3WIUA 2QM1A 5D4LA 2G13A 3NXZA 1UVNA 2CGLA 1DGKN 1VBZA 1OSDA 5DM7L 2W9CA 3DXKA 1BD6A 4NLWA 2QTDA 2XBPA 6FD1A 1RAGB 1VQNS 1KQKA 5CD4H 3ENVA 4IG3A 2DITA 4E7IA 2ATCB 4ZKAA 4OZ0A 2BACA 5A76A 3L2RA 4ID1A 4PL7A 2O8EA 1HBMB 2XMVA 5GINA 1KDNA 3VHQA 1NK5A 1KR4A 3W2WA 1KVCA 3O4QA 5B0DA 1IM6A 5GAGI 5BPLA 3KYLA 3H42A 3QB0A 4O0NA 3BYPA 2ASLA 2CQBA 4M5LA 3UE2A 2WONA 1KC8T 2XS7A 2HWIA 5D78A 3OS0A 2J8AA 2HRUA 4Q44A 4C3MA 3KHGA 4I2PB 5IC6B 3FUYA 4CZKA 5L1JA 1NPKA 4KHYA 4XEIA 5KOXA 4FPBA 4H4MB 2HW3A 3QEWA 1U1OA 3DXMA 1KLMB 4P9SA 1HKAA 4HT5A 1DARA 3HTVA 4BWMA 4DV0J 1OS5A 4C8ZA 1FJEB 4IOXA 1BQNA 3ZZ0A 5AQYA 4BR4A 2JWNA 2XG8A 3US5A 4IDKA 2W40A 1S6OA 2FVQA 2BANB 4U67L 5BXIA 4NLXA 1VQ4S 1VSDA 3DDNA 5M2UA 1R31A 1AUDA 3CQ8A 2QA2A 4OZ3A 3ZZUA 1ZA1B 4JNEA 3ISZA 3KG1A 3KLHA 2X6SA 2GQQA 4DUYF 1LQ9A 4IEEA 4HLBA 4HTJA 2K7JA 3M6UA 3PXGa 5KQDA 1W7AA 4ZN3A 1S1XB 3CULA 4G1PA 3ULDA 3HD1A 5BRDA 2DGUA 2NUBA 2I9SA 2PSZA 1FNMA 3BV8A 3KKSA 2CPHA 2GWKA 1HKBA 1B7FA 2DGVA 4OJHA 2UVRA 2IOCA 2V7ZA 4WFXA 2DB1A 2JFKA 1T95A 2BE2B 3O1LA 1F9EB 2E2PA 3RAQA 1WOPA 3NCQA 3VQ8A 4TY8B 3A5MC 2BJ1A 3SQ1A 2Z58B 1NJIT 1WC4A 2D69A 4KHMA 4P75A 2AJ2A 1KS2A 2FZCB 3OYKA 1X4GA 4DX6A 3C7NA 2DEJA 2AZ3A 1YI2N 4USTA 4BC3A 2OD6A 4EZ6A 2JJ4D 5D77A 5DQGA 3ZETB 3SUQA 3C16A 4G1QA 2KHOA 4TU7A 1RT7A 2Y8YA 3MCMA 1PYSB 3VZHA 3ZC4A 3OYNA 3PFEA 2E20A 1SCJB 3GPAA 3RGIA 5EX3A 1EHWA 3LP1A 3ZZTA 3LP1B 4K2XA 2YKAA 1YRUA 2B9WA 4MO4A 3GJQB 3L2QA 2OZSA 3QRPA 3NAHA 4GV6A 3P3DA 3C6UA 2BR0A 5GAEI 2KFYA 3D7SB 3I33A 1UEUA 4KY3A 4DV1J 2KT2A 5BPMA 3RW7A 4FJ8A 4ED6A 1HA1A 4CLSA 1F2HA 2V9WA 1VGYA 2XNRA 2KRRA 5IFMA 2UUCJ 2GIRA 1J5EF 3S6EA 4QW9A 1RXOB 1UETA 2ZF5O 5C10A 1Q9YA 1SI9A 5M1QA 2Q2RA 5A0YA 3VF4A 3RSEA 2BE7D 3W2VA 1NM2A 1LKZA 1U1RA 2UUCF 4IKAA 2QKBA 3N4QA 3H3NO 5FRNA 4J9SA 3FZFA 2B56A 1W2IA 3THWB 2BOAA 3VQDA 3E01A 3D1HA 4KH1B 3NF9A 1JLGA 2LQ5A 2V2QA 3WT0A 2ZITA 3VTIA 1SKRA 3M6WA 3HT0A 1XNRJ 3TPQA 3I9V9 2R8JA 2ERRA 1KAXA 4KKOB 2IRXA 5A8RA 3D68A 4JYAK 3CFPA 4R8UA 3OYLA 5HLFA 3ZNUA 3F56A 1LOUA 2DPJA 4H0XB 1S3XA 3QGIA 2FJAB 4I7FB 2QE5A 2NPFA 1UA0A 3SBMA 2H65B 1S1UA 2UP1A 1NOYA 4OMFG 2MQQA 4DTOA 2MLZA 5I42B 4C0HA 4F3TA 4NMXA 2W1BA 3A1YG 3H1VX 1XMOF 2NXEA 1QAXA 2W4DA 3MECA 2W4CA 4OLOA 2BRKA 5KT6A 5GADU 1C0GA 2YKOA 3QIDA 4CEZA 1SUQB 1VLYA 2MKYA 1QLNA 4ES3A 4PABA 2RE2A 4MIAA 2AJ1A 4CW7B 4O0IA 4BRMA 5AZJA 2DIVA 1W26A 3SAGA 3HHEA 1DBDA 4RNOA 4JI2K 2FC9A 3O5TB 4ICLA 2KFNA 4GO5X 4OX9J 3Q24A 2POKA 3VQ4A 1DURA 4L76A 4I9LA 2GEMA 3FRZA 2OH2A 1BI4B 2OPRB 3N5BA 3CCUN 4TLRA 3P5JA 5KT2A 4PXCA 2WSFC 1JMTA 2CUYA 4Y2MA 5KFPA 3A12A 3T5LA 1S5JA 2V6AA 1VIOA 1WI8A 5DM7Q 2EFNA 5KFKA 3FZBA 3SAHA 1VHIA 4GVBA 1VSIA 1FJGJ 4JI3J 4ED0A 3AAWB 3EGVA 2J7KA 3MR5A 2VDIA 3VEXA 3VVUA 2BH1A 2V8PA 3DXSX 3CC7N 4Y2IA 1XMQF 1CULB 2EC0A 3TI0A 2XULA 1FO1A 1YX2A 4AUKA 3THXA 2LU2A 1CJVB 2HQCA 3NGTA 4FN5A 3PW4A 4B1UB 3KK1B 3DC2A 2ROPA 4JI4F 1NMEB 2F3JA 2UXCK 2MZSA 1N36J 4WK1A 2DH9A 2IGIA 2D3UA 3M8PA 4FZZA 4UT4A 3VEWA 2GZOA 1GTEA 3TANA 4DTSA 2X6NA 4B1ZA 3HFZB 2PA3A 4DKWA 1WB9A 3PW2A 4X4QA 2JWLA 4CJ4A 2J76E 3KTQA 1Y3JA 4FZYA 1IR0A 2AYMA 2Y8WA 1R0AA 3MMJA 3FQLA 5KFYA 3ITHB 3L2WA 3O80A 3WEEA 2Z1GA 4F0MA 3SDEA 2CAJA 3GV5B 3D2FB 4OZ2A 5HK4A 3KMSA 3SCJE 3G6EN 2UUCK 2J6UA 2CNKB 5E2QA 1IR2A 3OBIA 4ECRA 4PG8A 3CB4A 1GLFO 2OO4A 2CGJA 3OVNA 2H54B 3DNCA 2B0GA 4DS5A 4FK2A 2GJFA 2OEJA 1VRTB 3UQSA 2XC9A 4X2BA 3H46O 1UCNA 2OKQA 3MTJA 1DAXA 1X3NA 4CJ7A 4X65J 1GXTA 1HW9A 3JSBA 3IO1A 2MMYA 4ED7A 3H8YA 2HQFA 4GC7A 1TK5A 1BO5O 4KBIA 2QWQA 4DR2K 3IRWP 1JKHA 5ETOA 3NGSA 1DKGD 4QIFA 4UZBA 4IO8A 1TK8A 3CJ9A 4NO7A 4DPXA 3CF5L 3ENBA 5D15A 4BE2A 4DR4J 3W5ZA 1EP4B 4EAHD 4DPWA 1R6YA 3JS6A 4LRFA 2Q36A 4CM0A 3O08A 4FCYA 2CVEA 4OYMA 4LF8K 3CPWR 4BRPA 2C2DA 4ED8A 1FRMA 3SQGB 2ZZNA 1B92A 4ED4A 5CR4A 1OVQA 4Q5VA 2W2PP 1TL3B 1XI1A 1OH8A 2UVUA 3OW2R 2ZWPA 4YB6A 5C7PA 3JAMU 4WU2A 3IG1A 4UOFA 3EVMA 3SQ0A 1P6TA 3KK2B 3HSDA 2XMJA 4RLEA 3VQCA 3ZZRA 4ZVOB 3CMAS 4JKAA 4LSNA 2KT5A 4KB7A 4Z4IA 1Q53A 1D9AA 3NF8A 1DQ8A 1DEJA 1U48A 3JAMO 2XM3A 2WSCC 2RF2B 2ZJPQ 1H73A 2VG5B 1CJTB 5F8IA 3PUFA 3VQEA 3QBWA 3CMES 3WX4A 2DGOA 2FJDB 4DL3A 5ETRA 3D66A 4IDHA 2KHCA 2J0XA 3CDUA 2ZM6J 3OTOF 4C3LA 3NG8A 2EXUA 1NJYA 3IR7B 2E1YA 3QJLA 1RHUB 2HVZA 2MKHA 3TQEA 3NS5A 1ITGA 1GLCG 3MXMA 1JJ4A 4KPYA 1NCLA 3I8BA 5ADXA 2ZZMA 1RDRA 2BA9A 2O4IA 4N8NA 2IYIA 4Z4CA 1NB2A 3RTVA 2W2NP 2ILZA 1FWKA 4JOUA 3TX8A 3QMQA 3MHYA 5HP1A 2HHPA 2YY3A 3BQ2A 3H25A 1VDHA 1HUXA 1FX2A 2QZ8A 2W9BA 4ICLB 2F40A 1U8WA 2FY8A 1FFGB 4DR3J 4B08A 2CQGA 1U8SA 2X7IA 4DEZA 1VBYA 2F8TA 4Y2CA 1WDTA 2YNFA 2VPXB 2C2NA 2CQDA 2E2QA 2BQUA 2NLXA 3TU5A 2HMPA 3CIPA 1JJCB 2NS1B 4HEA9 1NU0A 4GVEA 1QAIA 1HI0P 4DHVA 1P8GA 1UPPA 1VQ4N 1Q8BA 2KO1A 3MPUB 3VQAA 5KG3A 4CEQA 4ZIVA 3MN7A 4N41A 2CVIA 3CM5A 5KPZA 4W5NA 3R6GB 4ZN1A 2A3JA 3SQ2A 3W3SA 5KQ8A 1NH7A 4XK8C 2QWPA 3LP2B 1NHKL 1RNHA 1U04A 1LFPA 5KTQA 3GIJA 1GLJO 4C4WA 4QOTA 3MM5A 4N5SA 2Z2MA 3HVAA 4FJGA 2ROGA 4KSEB 1GXLA 4NLOA 1U2VA 2DNHA 2DHSA 4BRCA 5KFJA 4ZJLA 1K9MT 3RMAA 4F50A 3KJVB 4H5WA 4P6QA 3MXJA 2CPEA 3DRPA 1S77D 3P38A 2GC8A 1RGVA 2DPNA 5L8RC 3V2UC 3HVWA 1TELA 5T41A 2RUSA 5BN9A 2BJ7A 1QSYA 2OA8A 2O8CB 3L2UA 4DUYJ 3V1RA 3I0SA 2MZ1A 1KHVA 4ELVA 1XNRK 1YF5L 4ZCKA 2F8HA 3CCRN 4K25A 3PTWA 3CJ7A 4O8KA 4F4WA 3V81B 2YNGB 1WF0A 3V6KA 4ID8A 5DMRA 3SJJA 4B3MF 4DFPA 5HANA 4CI0B 4HUFA 3M4XA 1MROB 1TMMA 4XH5A 4YP3A 2D0PA 5AQGA 4ZLJA 4M63A 3M6VA 2E6LA 1BA1A 2FHOB 3VQ6A 1JXBA 2FHKA 4FWOA 3CDAA 4ZVEA 1KAZA 1BUPA 1C1CA 3IA0A 4FDFA 3O2IA 3G86A 4DR4K 4U67Q 3HT3A 1BC6A 2V2VA 3RBEA 2HK3A 5A8WB 2W01A 3FEYB 4FOEA 2OYQA 1ZYQA 2IC3A 4WFBL 3MMVA 3EWGA 1RGIA 1NDPA 3CXCM 3JYTB 2BVZA 1K44A 4HI2A 1LOTB 2IBKA 5HRRA 5E33A 4I2QA 3RR8A 1VCTA 2ZH7A 3MX2A 3CSKA 1HARA 4R0EA 3N6NA 4U7BA 3MMAB 4QWBA 3KLEA 3C0BA 4A2AA 2Z1IA 3PZPA 3Q0AA 4BRGA 4J9RA 5IC4B 4C8YA 2D9PA 4OHVA 1Q82O 2A6OA 2C3PA 4ENOA 4PL8A 3AA2A 2PFDA 2P9IB 2ZWOA 1B64A 1PJ5A 2VFVA 4IJAA 3QIOA 1GMVA 3VAJA 1AW0A 2YJFA 4FW1A 2E5IA 3VQSA 4PRFA 3ZTSA 4Q2MA 3WX8A 2Q97A 5FDLB 3T1YK 1NKBA 3GLJA 2G8FA 3SI8A 3BBBA 3R97A 1J9AA 1FESA 1DHMA 4I56A 4BC5A 5GAHP 4ZPAA 5JMVA 2F8MA 4I69A 3IXQA 1RA6A 4USKA 1P1TA 4LT6A 5IQQA 3AJDA 1FJGF 4RWXA 3MN6A 1H2UX 1YVUA 3CGIA 2JWKA 2BE9B 4NPOA 1EKRA 2GNKA 1NAQA 2DKOB 2K3KA 2D5RA 3W9HA 2KYZA 4RBUA 2QT7A 4LRAA 3HD2A 3U7JA 3PX4A 4CK3A 3MDFA 4K5RA 2L08A 1JQGA 3GL1A 2HAFA 2R8GA 1TKZB 4MKYA 2AT1B 1FXLA 3CJSA 3DMJB 3D2EB 2CADA 1FNOA 4LF2A 2BABA 3UDLA 2ASJA 1IN0A 4JUZA 2G8WA 1X9SA 1EKSA 5ADXH 3TX0A 4KGMA 4IR9A 3FCHA 4CK2A 5LL6Z 2P2CB 2QWLA 4P52A 1HWJA 1IBMJ 3CJQA 3QT7A 4B3RK 4AXIA 4G9ZA 2MQLA 2YKQA 3VOVA 2CPJA 3AVKA 4RU2A 4DV3J 1QQCA 4JD2B 2IA0A 2CZ4A 1QZ5A 2F96A 2YNHA 5F41A 3WXMB 2C2RA 2GX9A 4C8NA 4Y3CA 2J0SD 1DTQA 3U1NA 3HFVA 1J27A 4RNFA 1HNWJ 1RHJB 1RKJA 2CYYA 4RWTA 2DNMA 2D9OA 3DN9A 3FBEA 4JN4A 3VTHA 1Y97A 4JKHA 1T94A 2Y1IA 5I9EB 4M63C 2RQ4A 2YI1A 3NBPB 1RAJA 2MJNA 3KVGA 5CHCB 3LAKA 1UZDA 2A18A 3BH6B 4R79A 3SSSA 1D9DA 3DLKA 4DR6F 5IXUA 3KJNB 3WIVA 5KFBA 4HHTA 1CJKA 4OV6A 4CYUA 3AA4A 1EJ7L 3VVTA 1U7LA 3BH7B 2XLKA 3QEXA 4NI2B 1HYSA 3B78A 4H0VB 3ZLJA 3THWA 4GKJJ 1C0MA 3PYEA 3KLFB 3Q8QB 4CEAA 4LF9K 2YKNB 2FHMA 4TU9A 4DBQA 4CZGA 5D8HB 3AOBA 2VB6A 1ZBHA 3GP9A 5A2QY 3KLEB 4X4PA 3MEDB 2XMUA 3RG6A 2FBTA 1D4XA 3TWZA 1G1XA 5LJVA 1TK0A 4CLZA 3OUYA 3Q8YA 1WAJA 2FHJD 2NXJA 2YBVA 2ITMA 3MCPA 2MHNA 3ID6A 1B0PA 2DXDA 1T6CA 2VQEF 2N7YA 2HRYA 5AQVA 3TA0A 5B7WA 1PYTA 2JNJA 4ZA1A 3L4BC 5F3TA 1RABB 1YXQA 4Q0BA 3T1AA 2QLBB 2ZVIA 1N48A 1RT5A 4CYUB 3HJFA 2JH3A 2RDDA 2AGPA 3FRYA 3OPKA 3AV9A 2XGQA 1VQPS 2MDAA 3C6UB 4RUBA 3NNHA 3ZSVA 4RBTA 1HRHA 4NLRA 4WCEQ 4DLGA 2JOQA 1AFIA 4H5RA 2UVWA 3OYDA 3V6HA 3D7EO 3WQUA 1JX4A 5CHIA 3IM9A 4M7YA 3NBPA 3HP9A 1H2VZ 3KKFA 3OBYA 5M1NA 2WHOA 1IJJA 3N0VA 1N6QA 2C3UA 2B7BB 2PE8A 2E5LJ 2GA7A 4TY9A 4PQUB 3CJKA 3ONQA 1C1BA 3QICA 2PDAA 1EX8A 1CJUB 1P27B 1WSGA 2YHBA 2OEMA 5L38A 4X62F 2NYHA 5KG6A 2HGMA 3AVMA 1FVSA 4CM2A 5BREA 4AL6A 1CQNA 2OHDA 3QT6A 3CM6A 4USHA 2MKJA 2QWRA 1MN9A 4FLUA 5SZTA 5KFDA 1TR0A 5GVQA 2D41A 4KAZA 4JRPA 4BG9A 3IDHA 4CF9A 1NOZA 1QUPA 4O44B 3M8QB 4TKTA 3EZOA 4K0KF 3OYAA 3ZZYA 1OIAA 3R7NB 1N56A 4QAGA 1ZAXA 5GAEU 2QLJB 1HWLA 2GHWA 1AROP 3M8RA 5LY3A 3V9SA 2VV5A 2NRHA 4BRQA 4JS5A 1RCOB 2DIUA 4MIBA 4M3UA 5J2MB 4OI1A 4MAKA 2EWSA 4ZPCA 3GOIA 1M5SA 2QMUB 5SUHA 2Q3PA 1Q16B 2B9YA 1HD1A 2R7SA 1RT6B 4F67A 5ETMA 3DM2B 1JLEB 4FLVA 3MM5B 1ZETA 4IRCA 3KUGA 1YHQN 3DKDA 2AP1A 3AVFA 1TU0B 1B0TA 2I7PA 1YZ6A 1Q86T 4KO0A 1PAUB 3F41A 1H0HB 4M5MA 2QA4S 4MFBB 4WF9L 2YWHA 3UNYA 3G9CA 4HCBA 4ZP7A 3HSGA 4BHQA 5F0XA 4KO0B 2A40A 4DV2F 1EETB 1YBTA 3NH1A 4FNHA 5J2NA 3CYMA 2HOEA 2C2MB 2PGCA 3M2VA 3U9ZA 3QFHA 3KWMA 1BXNA 3R8EA 1U0HB 3L7OA 2XLJA 3LTOA 4N7TA 1CSJA 1JXEA 2C2OB 3C95A 1SC1B 3KWGA 2HIQA 1TVRB 2DGWA 3ILJA 3CPWM 5KFWA 2MZJA 4CESA 1QTMA 4XPCA 3OR1B 3G87A 5DG9A 1VQ7N 4BRDA 4FYWB 2VG6A 2ZJRL 3MMBB 1NB7A 3OFEA 4FJJA 3QETA 5IV3A 3DLBA 4NLBA 4QZVB 3HBTA 5AQPA 4OO1J 1QD1A 3KLIB 4AF1A 1SVDA 2LEPA 2MGZA 2NXUA 2DHGA 5EWGA 3QEIA 1RKIA 1N32F 1FK9B 3GFZA 3VGSA 3LDPA 3PO4A 3D54A 2PFFB 1RWWB 3MM8B 4ER8A 1BDGA 2EKNA 5DLFA 4JHDB 4BC2A 1T9XA 3B4MA 1HHTP 2VASA 2I1RA 3I87A 1NHUA 4ES1A 1T05A 2HNYB 2FBXA 3IAM9 5FROA 3HPHA 2C42A 3ZT3A 3L6QA 2ZBIA 1QAJA 3D1QA 3VAIA 4I6MA 4X4TA 1FDBA 1QVGM 1WEXA 3OL9A 5AQFA 1IKYB 1X0PA 1I3AA 4DR5K 2XMMA 4H5TA 3NAIA 3MCAB 3P4IA 3OTOK 2OTLN 3CCLN 2V63A 4OV1A 4M5DA 2F9DA 5CZ2A 2R2RA 4TQRA 3U3YA 4NYZA 4H0TB 2DNLA 4DV6K 2F1FA 4E7KA 3MR7A 4CJLA 1JB0C 3H90A 1L3KA 2PEHA 3RU0A 4IQXA 4K0KK 4DV7J 1H7WA 4CJRA 2OZMA 1RTIB 1WN7A 4ETZA 2W8LA 1ASWA 2RU3A 1VQPN 2XCAA 4YR2A 2DH8A 1TL5A 1HPMA 2LXIA 4J9MA 4WQ4A 3SQ4A 3UPFA 2J7WA 4B3TJ 3QJJA 2BJ9A 3FGUA 3EE9A 3M2RA 2E88A 3R7BB 1FI4A 2V4JA 2WVEA 3BREA 3ZFVA 1NGDA 3BGRB 4CJ5A 3MPWA 2K1RB 4CFDA 2Y9HA 2F8SA 4WQ4C 3EUNA 2J0QD 3I56N 2HVEA 2UUAF 3VGMA 3ALYA 2AIRB 2KKZA 2RNEA 3G8SA 2RPIA 4OGEA 5HQ8A 4C23A 1P9YA 1HNVB 1S1VB 3M8WA 1FJ7A 4DG1B 2HGLA 3MAQA 4B9TA 4J8FA 2DY9A 4CP5A 3WNGA 5AR0A 2O8BA 4QJVA 3TOQA 1BY9A 3ZT2A 3VV2B 2VOPA 3AO4A 4HUGA 2G0IA 1T03A 3D0IE 2CXEA 2GGPB 1K6YA 1R8CA 3LAMA 1QVFR 3JTPA 4OQJA 2B4JA 1JXVA 1WUUA 4M3RA 2E5JA 2R2SA 1U25A 1FERA 2A42A 4FM0A 3GG0A 4IWVA 5FLXU 4JKGA 2Z2ZA 1R8BA 1GMWA 2VWKA 1X7VA 3VAFA 1YTYA 4K42A 1WDDA 4UUWA 1BLUA 1RUSA 1Y7PA 4HUEA 5EY4A 3QZ8A 5AQLA 4R5PA 1NO8A 1LWFB 1B9FA 4EP4A 4RUCA 3M1VB 1D5AA 4RO0A 1N34F 4FM2A 5D4NA 3NGYA 2HBQB 3K57A 1ZM9A 1FEEA 5AQWA 1HBNB 4USIA 4LF6K 1X3MA 1VSMA 4CZJA 2CNNB 2PA8D 8RUCA 1J54A 4NZ6A 1V3ZA 1N8RT 4CO0A 4QS9A 1JJHA 4UUXA 3D5MA 3C14B 2HF3A 2KM8C 1VSHA 3CTRA 3BO3A 2WBNA 3AVAA 3SFUA 3FC9A 1JLCB 4DWIA 4DQQA 4EIAA 3MFHA 4WJBA 5DRKA 5BYRA 1BQMA 4USJC 2K3IA 1QSSA 2KHDA 1YIJN 1JLFA 4LF5F 1E3MA 1UWAA 4JKDA 2CPIA 1TMJA 4FZVA 1BI4A 1FHTA 2AF6A 3M2UB 1T6DA 4ANCA 1Q86O 1T44A 5AQNA 2VF3A 2BX6A 1HMVA 2BUPA 1H72C 5CXTA 3VR1A 5LJ3Y 3JSYA 1REVA 4X64J 2R3VA 2I38A 2FJWA 5KFIA 4AHUA 3VGUA 2YNIA 3L7PA 4JYAF 4OZ1A 4WQ5C 2KT3A 2N3OA 5BRHA 3X1LB 4W5RA 3I5BA 1M5PC 4IFYB 2JC1A 2H5JB 3MECB 4HACA 4AH9A 1V4TA 3C6TB 3AOAA 3V4MA 4O4RA 2ZJPL 1RJJA 3A13A 4UW2A 2D0AA 4USWA 2GMLA 4M3WA 2J5AA 3RYLA 4PY5A 3VGKA 3NP5A 4JI1J 3TUZC 5ETNA 3FZHA 4J9LA 2V68A 3OXFA 2E1RA 3KK3A 4PKIA 2P9KB 1KFSA 2AP6A 3A3OB 5DZ6A 4DV6F 2OPSB 4YS2A 4TLQA 2XZDB 4M5IA 4NEZA 3NWRA 2RN2A 3VQ9A 2VH7A 2R8KA 4I4BA 1RBRA 4ZMMA 4JI8J 3FR0A 2NCKL 2EHGA 1X4AA 5FPEA 2GMJA 4JKBA 3BN7A 2WB4A 2RS2A 2DO4A 3VZIA 1R0CB 3THPA 2UXCJ 3DRSA 1S72N 1YWXA 1IG9A 3TUJC 1X4BA 4DXLA 3VQBA 4DDFA 4V1Ak 1VRUA 3E9LA 2VBZA 4P10A 4IH5A 3FEXB 1RSCA 3CCMN 1CS4B 2KG0A 1L3UA 4OHXA 4Z2XA 2VWJA 4EZ9A 2UUBK 2U1AA 3CJCA 4E1MA 1FE0A 4LFAF 2XGPA 1SH0A 3GG4A 1EZZB 2VOOA 2QGFB 4Z94A 1FRXA 2OP5A 1VLOA 3H40A 3R2DJ 4ZTJA 4BRIA 3H1QA 3PFOA 2IM0A 1VOMA 1SBRA 3JB9k 4WP3A 4M5KA 4AHVA 3K9JA 2CQ3A 5HVFA 2ZGYA 2VPZB 3AXMA 4FWPA 1FKOA 4U6PA 3SCKE 2YKMB 1B9DA 3PRBA 2HBLA 2Z56B 4H5NA 3IP0A 3GIRA 3SYZA 1R7IA 3H4DA 3S41A 4A8KA 4LH5A 2A2CA 3HK2A 1ATSA 3K89A 3QERA 1ACMB 3CQXA 4NA1A 1KVBA 4ILLA 3B6OA 3C65A 4MTPA 3PEJA 4RNMA 1UWBB 2YHWA 4KIAA 5LSLA 3O1WA 2DY4A 4O3PA 4DV1K 3UCGA 4FF1A 1W97L 5J2QB 2ZKTA 2WVBA 2HBKA 3TZWA 4MKBA 5ETQA 2VU5A 4LF5K 3I9ZA 4JBCA 5LOQA 4JI2J 3DLHA 5MLCQ 4CH7A 2KB2A 2K2PA 3PKMA 2VBWA 5CYMA 2YX6A 2N82B 1XR5A 1J2VA 5KFFA 3AGRA 2Z8QA 4A8FA 4OIXA 3AB4B 2FUG9 3HI9A 5BYSA 3MD1A 4GVLA 1HIYA 1IKXA 1AA1B 5B0BA 1GXUA 5GMKa 3ZTRA 4P7VA 5CA5A 3D9BA 2VWBA 3QT8A 3W8PA 2RDJA 2P9SB 2X3GA 3HX9A 1FEHA 3DXBA 3OSNA 4LD0A 2IS3A 1QJHA 2AKWB 3BGUA 2VL1A 3U9DA 3B8AX 1ATNA 3FSIA 4YY3J 3VF2A 5AE2A 1HNXJ 2FVRA 2RJZA 4YOVA 3CT9A 4KT0C 5D0GA 1C0TB 2CPDA 2KJWA 2W42A 2LSNA 3ZSZA 1OVYA 4EYIB 4IFVB 4M3ZA 3AAQA 4CZEA 3GYNA 2QRRA 4DMNA 1S1UB 3R9LA 3CCES 2HBJA 1Y3KA 4TN2A 2E29A 1KP6A 3OD2A 1BQNB 2NRVA 4IQMA 2FBVA 1BIZA 1A0OB 1S6UA 2HS4A 4PWDA 2V69A 3BB5A 3KUEA 3MEGB 2YH1A 3OY9A 4L73A 1CC7A 2J9CA 3T1YJ 3EXCX 3AO3A 4YDDB 4K8ZA 3K0SA 3M32B 2LEAA 1RT2A 3Q8RB 3R1HA 3V6DA 3KK2A 4C11A 5GAHU 3IG1B 1YT3A 3P6YC 2C22A 1X31C 2OEKA 1IVZA 3N28A 3E9OA 2IMWP 4PPDA 2VGMA 1BISA 2ZH5A 4ZCLA 2WW4A 3D67A 1QVFM 1AT1B 2M0GB 2P5GA 5DDQC 3IRXA 2H3EB 2QG9B 2MQ8A 4NRTA 1N4LA 5KAKA 5TKYA 2JLFA 2EKYA 4FLWA 1X5PA 1XERA 3CJTA 4ZVRB 3QFPA 4RKUC 3WXKA 3U1MA 4WYLA 2HNDA 4A57A 5GADP 3QNNA 2HQGA 1N5YA 3DRSB 3AQOA 2B8QA 3HP6A 4KHUA 3KLFA 5C42A 2O8BB 4NWBA 4Q2LA 4CFCA 1XUPO 2QSWA 3MM7A 4I0WA 4NLQA 3BPDA 1VQ9S 3R7SB 4B3TK 3M2UA 1B0VA 2DCLA 5AZIB 4LR9A 1QM9A 3OS2A 3DLGA 3O1BA 3R6LB 2Y1RI 4ISGA 4DL2A 4ZPTR 1EQMA 2F9JA 3LGHA 4TYBA 1BU6O 5RUBA 3NNCA 2MB0B 3FFKB 1NHVA 2R42A 4OL8A 4K0KJ 1RYRA 3CJBA 3W1YC 1OY8A 1S0NA 1YJ7A 4YR0A 4FF2A 1ESVA 1BOTO 2WCXA 4WF9Q 4K4XA 2VD3A 3L7UA 1HYVA 1VQ8S 3NNAA 3CXCR 2ZOMA 4X66F 3C7NB 2VC1A 3C19A 3GFHA 5K20B 4Q45A 1HI8A 3V4IB 1C6VA 1ICEB 3CIZA 3S01A 3DI6A 3WBZA 3MR6A 1W2BR 1NSPA 3I56S 3EL2A 2H5EA 3EN9A 3V9ZA 1ITPA 2M70A 2EG2A 4YOWA 1DLOB 4RL1A 5M1KA 2L9WA 4ES2A 3HHLA 3QLHB 4C8LA 3HOTA 3THVA 2ZE2A 2XYPB 1YGYA 3FK4A 5F8GA 3OFFA 4A8MP 1RT1A 1FCAA 2XZWA 2PO4A 2RSQA 1JCFA 1S1WB 1C4CA 1QUVA 3HHLC 3ZSQA 5FIIA 2W6KA 4O3QA 2VQEJ 5F9NA 5LT5A 3SBGA 3GIIA 3QFUA 3VEVA 1Z26A 2ALZA 3DLJA 2GIFA 1SIZA 4B1VA 4MDBA 1CZ9A 3N4PA 2AD9A 2X1BA 2OAUA 3VEZA 4YDUC 1WOOA 2E8AA 3GJTB 3AD7C 5JS2A 3GR1A 4FLXA 5FLXY 2P1JA 3MM8A 4FJ5A 2CIMA 1PBAA 4E7LA 4CHZA 3RRKA