4NCGA

Discovery of doravirine, an orally bioavailable non-nucleoside reverse transcriptase inhibitor potent against a wide range of resistant mutant hiv viruses
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
556
structure length
553
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of MK-1439, an orally bioavailable non-nucleoside reverse transcriptase inhibitor potent against a wide range of resistant mutant HIV viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/inhhibitor, hydrolase/inhhibitor
total genus 165
structure length 553
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ncgA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ncgA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ncgA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ncgA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ncgA05
4YQWA 1RT5A 4DU4A 2PYLA 2E9RX 4QAGA 3NF6A 3MR2A 3AVFA 2F8EX 2XWYA 4M3XA 1YT3A 1LV5A 4NLGA 3SYZA 5DLGA 3KK2B 3S9HA 1UA1A 1VSLA 4IDKB 5KFIA 4IR1A 1SL2A 2IM1A 3H5YA 1NJWA 2F8TA 5F8NA 1S0MA 4RW4B 4B3OB 2IGIA 2QV6A 2OPRB 2D5RA 3K5LA 3QNNA 2QE5A 3G0ZA 3AO4A 2IM3A 4CGFA 4TQRA 3H5UA 3C95A 4EBDA 4I9LA 3SPYA 4URSA 3M8PA 1BISA 2XY6A 3C6UB 1WSGA 3LDSA 4DFMA 4AILC 3AVNA 1JXLA 1HNIB 4G3IA 3KK2A 4ZP9A 4CEFA 4IDKA 1TP7A 4CHOA 4RW4A 2OPRA 4DF8A 1EXQA 3SUPA 1C2PA 4LSLA 4M41A 3SNNA 1S4FA 2PY5A 5I3UB 3ULDA 3DI6B 2XY7A 4NLYA 4TLRA 3H59A 4ED1A 1HNIA 4BWJA 3A2FA 1S1TB 1RTDA 3B6OA 4TY9A 3C6TA 3AVAA 1IKWB 2GV9A 5KT4A 4WFYA 4RNMA 1L3TA 5JS2A 4KHYA 2W8LA 1S6PB 1HYVA 2RKIB 3AVLA 1U47A 1BGXT 3NGDA 4KB0A 2QKBA 3CQ8A 4O3SA 5I3UA 4MIBA 2B6AA 1KFDA 3V9XA 4FJIA 2HHTA 1IM4A 4E7JA 1F21A 3THVA 3OL6A 4NRTA 1S1TA 2JC1A 3VQ5A 1VSFA 2DPJA 1IKWA 1HJRA 2WTFA 3PO4A 3M8RA 1JX4A 5KFYA 1NKBA 1S6PA 2RKIA 3MECA 1W25A 5DG8A 1ASWA 5KG5A 4J9RA 4E3SA 4CJ4A 3KHHA 2G8KA 4Y1CA 2YNGB 3D5MA 4ECWA 5KFFA 5CZ2A 1N48A 3H08A 5F8IA 3HXMA 3SFUA 4DL5A 1IO2A 3B6PA 3QGIA 1QTMA 4DWIA 1HARA 2BRLA 3SPZA 5KFZA 1ZBLA 3LAMA 1LW0B 2I1RA 1RBUA 4FJJA 4MK8A 3DOKB 4CF2A 2FJVA 4QOZB 3DMJB 2YNGA 3CVKA 2GC8A 2XRIA 4DSIA 3TAGA 5KFDA 3AVGA 3HPGA 1DTTB 1WSEA 1MU2B 4CGGA 3TARA 1RBVA 4O44B 1XR6A 3AO3A 5JUMA 4ZVFA 5KG2A 1D8YA 1EP4B 4CJWA 3KLEA 4MKBA 4B9MA 1TKDA 1K1SA 5F8MA 3DMJA 2HNYB 3ZT0A 4WYWA 4IOBA 3OYBA 4JV2A 4KBIA 1DTTA 2VWJA 4HHTA 5EU7A 2Y1IA 4CEAA 1MU2A 2WK4A 2AU0A 5FRMA 1BI4B 1VSMA 3WNGA 1ZBFA 4O44A 2O5DA 5DGBA 2JEGA 1TV6B 3HVTB 1S1WA 4EO6A 2KFZA 3PJXA 1XC9A 3D28A 4C8OA 4C8KA 4ZPCA 3HK2A 4EP4A 3DRPA 1ZTTA 1VRTB 1L3SA 4MQ3A 2F96A 4M95A 2WB4A 2ETJA 4ZPAA 1TV6A 4M3UA 3RB3A 3HVTA 1KVAA 1HNVA 2WONB 4N56A 1SH3A 1RDCA 4J9QA 1QSLA 3LP2B 3CO9A 1RAJA 1RDBA 4KAIA 1VRTA 3IN5A 4LD0A 4FK2A 1TVRB 4OPJA 3OJUA 2G8HA 5J2NB 4RW9B 4Y2AA 5KFLA 5DGAA 2D0BA 3KLGA 5DMRA 3TVKA 4O0IA 4FLYA 1ZBIA 3KOAA 2CKWA 2WONA 3LALA 4W5RA 4M45A 1XR7A 5L9XA 1SKRA 3LP2A 4ECRA 4LQ3A 3E51A 3OS2A 1T7PA 2QK9A 3DYAB 1TKTB 4ECXA 4J9PA 1Z26A 5C24B 1FXXA 1TVRA 3ZT1A 1RTHA 1N6QB 1VRUB 5FDLB 3VQ8A 1T05A 3OLBA 2JEJA 5KGWA 2YKNA 3O3FA 4BDZA 1NK6A 1X9WA 3CIZA 4CEDA 4RW9A 4URGA 1CSJA 4E89A 3V1OA 3PHEA 3KKRA 3ISND 3MEEB 3AVCA 3TI0A 3KLHB 4K8ZA 3MXJA 5KG0A 1DLOB 1JL2A 4CFDA 5J2QB 4G1QB 1TKTA 4ELTA 3CJ2A 2B4JA 4BDYA 5C24A 4IFYB 3EPGA 4OGEA 4NYFA 1XR5A 3SFGA 1R0AB 1N6QA 5KFKA 1X9SA 1NK7A 1VRUA 2VG7B 5FDLA 4CJQA 4Y34A 1WSJA 4YR3A 1TAQA 4FYDA 4E7LA 3OYEA 4FJ5A 4O3OA 3DLGB 3I5BA 3MEEA 3V6JA 3ASMA 4CJRA 1N4LA 4QWCA 3KLHA 3SQ1A 1RT7B 3DRSA 1DLOA 3BR9A 4ECVA 3SQ2A 5J2QA 2R8GA 4G1QA 1TK5A 4IFYA 4O5BA 2D0AA 1R0AA 4IKFA 1NJYA 3H98A 2BQ3A 2VG7A 4OVLA 3OHBA 4CJTA 2QKKA 4CFCA 2HHQA 2FLLA 1K6YA 1S97A 3DLGA 3U3GA 4GMJB 3NL0A 2JEFA 3DLBA 1RT7A 1RDDA 3Q8PB 4NLUA 4NLDA 4E19A 2ALZA 4HUFA 3T5HA 3OLAA 2FBTA 1QSYA 3NHGA 4FLZA 3KD5E 1UOCA 1XHZA 4WXOA 2J6TA 1C0MA 2XGPA 4KHRA 4H4MB 3V9SA 4F50A 4BE1A 2IMWP 4X2BA 4IRKA 1TL1B 3QEIA 3HKWA 4ED0A 3NF9A 4IFVB 1RA6A 1C6VA 5KRTA 4XPEA 1NNDA 1RYSA 2ASLA 4AH9A 4AHSA 3VQBA 4KHNA 3EZUA 4JUZA 4M3TA 5KFRA 4CK3A 3PW4A 2DFHA 4H4MA 3DM2B 5DG7A 5C42B 2W42A 3L2RA 3OYJA 3CJ0A 1U45A 2R2SA 4XPCA 2QXFA 2Z1GA 4DTUA 4PA1A 3C94A 4IFVA 5KFSA 4M94A 1T94A 1S10A 2IOCA 5EWFA 4AHTA 5KFHA 3T19A 2C28A 2AQ4A 1VSDA 2KQ2A 3VQ7A 1WNSA 3M8QB 4TXSA 1KHWA 3FQLA 2EHGA 3QZ7A 3DM2A 2XY8A 1ASUA 2XGQA 2HHXA 4J9OA 4CERA 3FRZA 2UVUA 2W8KA 4FCYA 1W0HA 3O3GA 3EY1A 3MXMA 2BGGA 1J54A 3DLEB 5J1EB 4WE1B 4ECYA 4ECQA 3RMCA 3KD1E 3NBPB 4NYNA 1O1WA 3RTVA 3KLIB 1D0EA 1T3NA 2HVHA 1U04A 1QSSA 4OKEA 1QUVA 3H40A 4ZP6A 4B08A 5HRNA 3LZIA 3ZSQA 3M8QA 4DTSA 1K1QA 1SL1A 4FJXA 3PJWA 4CHPA 1RDRA 3AVBA 5CYQB 5J1EA 4ECTA 3RMAA 3SQ0A 4WE1A 4NLWA 3KMQA 4FLWA 3H5XA 4QCLA 5DG9A 5KFCA 3NBPA 2J6UA 2DFEA 2PZSA 3KLIA 3PX4A 4FJKA 2XY5A 4Q45A 4PWDB 4R8UB 4NCBA 4FJLA 3I8DA 4JV1A 4I2PB 4ZMMA 3GV5B 3OYCA 3NH2A 3M9OB 1WN7A 3OS1A 3EYZA 4OL8A 2FC0A 5CYQA 2V4QA 4CGDA 4DMNA 3QGGA 4IG3A 3SI8A 2UVWA 3OYNA 3BREA 3KLVA 3QEVA 4FZYA 4JLHA 4CHYA 4DQIA 2IJNA 3S3NA 1REVB 4E1NA 1WSHA 1FK9B 1CLQA 4NRUA 4PWDA 4U6PA 4R8UA 3FFIB 1LWCB 4IBNA 4KB1A 3NAHA 5KFGA 5KFNA 4WYLA 3QEPA 3UQSA 1Y97A 4ED2A 4DLGA 2VG5B 4DG1A 2FJWA 5HP1B 2HMIB 1S9FA 1YVUA 5HROA 3HPHA 4ZHRB 1L3UA 3KLFB 5CYMB 3VA0A 3RBEA 1REVA 4J9NA 4H54A 1I3AA 3KHGA 2DTUA 4HUEA 4DU3A 2CJQA 4ZPBA 3FFIA 1LWCA 4OLBA 4W5TA 1Q8IA 4FW1A 3SI6A 3BGRB 5DQHA 1KCFA 1IKXB 1LWFB 3CWJA 2FBYA 2VA3A 2VG5A 4KI4A 4N41A 4J9MA 5HP1A 4B3OA 4TYAA 4DL3A 4ZVGA 4EBEA 4DSFA 4CF8A 4F8RA 1A5VA 1SUQB 4KSEB 3AA4A 3LP0B 3K58A 4FK4A 2C2DA 2B5JB 4ZTFA 3C6UA 4EZ9A 2HVIA 3IAYA 1BCMA 3BGRA 4YNQA 4DFPA 3NH1A 1IKXA 4FJGA 3FQKA 3OYMA 1LWFA 2HHUA 3CJ5A 4O4GB 3HVAA 1JLCB 4C8NA 3WNHA 4K4XA 2Q3SA 3V1QA 3Q8RB 2KZMA 2ILZA 4IH5A 2G8WA 4IR9A 1SUQA 3ZSWA 3N6LA 3LP0A 5L1JA 1TKXB 2B5JA 1BQNB 3DI6A 4M3ZA 4F2SA 3KNAA 4KI6A 2DY4A 2V0NA 3MR6A 3F9KA 3PVXA 1WAJA 1X9MA 4KRFA 3ZSOA 4DQRA 2HAIA 1D9DA 3GYNA 5L1KA 3NE6A 3NGIA 4CHQA 5KFWA 3K5MA 4GC6A 2AWZA 2FBXA 2P1JA 1BQNA 1XHXA 2G8FA 3AA3A 2FVRA 2O4IA 3DLKB 3PO5A 3L2WA 4O4RA 3VQSA 5KFAA 3M8SA 2D3ZA 1QAIA 3SV3A 3TQ1A 3FDSA 4K4UA 3CJ4A 4DEZA 5CZ1A 4BDPA 1ITGA 5K14B 4CHNA 4CIEA 3RRHA 1VSHA 4KO0B 3I5AA 3WNFA 1JLAB 5T7BA 3DLKA 1JLQB 3LWLA 3HM9A 1BIUA 1NJXA 3I5CA 3MEGB 5F8LA 4N76A 5KFXA 5KT5A 1GX6A 1VSJA 3OVNA 1S0OA 4B9TA 2XCPA 4HYKA 3ZSYA 1LW0A 2W9CB 4CHZA 4PUOB 5K14A 1NHVA 2HB5A 3DOKA 3KK1B 1JLAA 3SCXA 3G86A 4O3PA 1JLQA 3QEXA 1HQEB 3VQ4A 1U09A 3RB6A 3HT3A 3MEGA 4NLOA 4ED6A 5KFPA 4CFBA 2ZQBA 3OYLA 4N47A 3V6DB 4MKAA 1A5WA 3HJFA 1S9EB 4TSXA 2W9CA 1EP4A 4PUOA 2RF2B 2X6SA 4DFKA 2WCXA 3KK1A 2W9BB 1QS4A 3D0PA 4FJNA 2A1SA 4B9SA 4AHRA 2HNYA 1HQEA 1SH2A 4B9LA 3KKSA 5KFOA 1BQMB 3P1GA 3CFPA 4RG8A 2JC0A 3WNEA 4DL6A 1HQUB 4CESA 5KG6A 1KRPA 1BI4A 3CDUA 4TY8B 1S9EA 5F9LA 3UPFA 4RUCA 4IKAA 4Z4FA 4ELUA 4F3OA 4N5SA 2W9BA 4IQXA 3EPIA 2J6SA 3T5JA 4OGCA 4FLUA 4CJ3A 1RYRA 2FLPA 4ECZA 2E6MA 1BQMA 3MR5A 1L5UA 1HQUA 5KFUA 3KIOA 4CEQA 3O4QA 3KHRA 5J2PB 1RT6B 2G8IA 2OPQB 3VA3A 3PW0A 5C25B 1UAXA 1IH7A 4RW8B 3LP1B 4KHSA 3CJ3A 3BJYA 4W5OA 4FJ7A 5KFVA 4NCAA 4F4YA 4FZZA 3LANA 2R7YA 3G6YA 2IDOA 2RDJA 3ZSRA 2X6NA 4F4WA 2W7OA 2OA8A 3TANA 2ASDA 4FW2A 3M9NB 5J2NA 4NZ0A 3NKYA 1RT6A 4F2RA 4M42A 4KHUA 5C25A 4J2EA 3K57A 2OYQA 4RW8A 3GQCA 1J5OB 4CF9A 1ZTWA 3TAMB 5KT2A 4DSJA 4QPXA 2RDIA 1S1XB 3QIOA 3L8BA 1T8EA 3DYAA 4CEOA 3HYFA 3Q8QB 4Z4EA 2ATQA 4JS5A 4M3RA 1NK8A 4KB7A 3BDPA 3LAKA 3NFAA 3OYKA 1NJZA 2XCAA 3K59A 2HW3A 3TAFA 1XI1A 1RTJB 4DSLA 3DLHA 3KMSA 4CGHA 4YP3A 5F8HA 4K4ZA 4FM0A 3CFRA 3TAMA 1S9GB 4F4ZA 4EZ6A 1S1XA 5T14A 4F3TA 3U3YA 3BQ1A 4GVMA 1NHUA 3EZ5A 2YKMB 2LSNA 3OYFA 3GV8B 4XIUA 1S1UB 4NLRA 5KFTA 1B92A 3BSAA 4FM1A 3VN5A 4Z4CA 3QLHB 1U49A 1FKOB 3HP6A 2AGPA 1TK0A 3ZT2A 1RTJA 3GIJA 3H4BA 2JLEA 3S3MA 4ZP7A 2E9TA 3ICLA 5KG1A 1HYSB 1HMVB 4Q44A 1MMLA 1S9GA 1IKYB 1W9HA 3OYIA 2AGQA 2YKMA 4ICLB 1Z4UA 3NAEA 4B9NA 1S1UA 3CYMA 3DDKA 3PR4A 3I0SB 3RMBA 2IJFA 4BE0A 3PUFA 4LH4A 3HSTB 4EYHB 3V9UA 4J2DA 2OZMA 1EKEA 3QLHA 1FKOA 4UQGA 1JKHB 1XWLA 1RT1B 4ZPDA 1GOCA 2IC3B 3V4IB 1ASVA 4Y1DA 1HYSA 1HMVA 4KHWA 2BRKA 4DTRA 1IKYA 2R8IA 4KAZA 4ICLA 4KV8B 3AVKA 4W5QA 4B8AB 3KTQA 4ED8A 4C8MA 1ZYQA 2W7PA 4I9QA 2G8VA 1QAJA 4FVMA 1D9FA 2I5JB 1SL0A 4ECSA 3K2PA 5KT7A 1JKHA 4FS2A 5KT6A 1C1CB 4CJVA 1TL1A 2IC3A 5KG3A 3V4IA 4OKKA 4IG0B 1HYZA 1LW2B 1GX5A 3NGZA 2GBZA 4LSNB 3MTKA 2ASJA 4KV8A 4NLPA 2JEIA 3VQCA 2O4GA 2E4LA 3JYTB 3CDWA 2I5JA 3IS9B 5HLFB 4O0JA 2YNHB 4YR0A 5C42A 5KFEA 1C1CA 3PR5B 4FJMA 5L1IA 4J2BA 1I6JA 2XI2A 4IG0A 1DTQB 1LW2A 3QNOA 4NCGB 5KT3A 4DL4A 1UWBB 2X78A 4NLVA 2YHBA 1RT2B 3AO5A 3IG1B 3JYTA 3LP3A 5F8JA 4ED7A 3IS9A 1S49A 5HLFA 3O3HA 4CJFA 1BL3A 2IAJB 1C1BB 3MR3A 1RT4B 3FSIA 4FLVA 4O3QA 3CM6A 4LQ9A 1JLEB 4FM2A 1DTQA 3DLEA 3UR0A 1B9FA 4NCGA 4KTZA 4Z4GA 1C0UB 1U4BA 2XI3A 3PW2A 5KRSA 3LPTA 3RMDA 4J9LA 1UWBA 3ZSVA 2UUTA 5DQGA 3NF8A 4RW7B 5KG4A 3U6FA 4PY5A 4EEYA 1RT2A 3IG1A 4FBUA 4YFUA 1KSPA 1RBSA 4YR2A 2KW4A 2IAJA 1L3VA 1HRHA 4WZQA 1C1BA 1RT4A 4CJSA 2RPIA 1VSEA 5DK5A 5FRNA 1JLEA 1JLGB 4L8RB 3TAQA 3OYHA 4RZRA 3DOLB 1C0UA 4DTOA 3G6VA 4E7KA 3AA2A 1SKSA 2GIRA 4E7HA 1KVCA 3GIIA 4RW7A 4K50A 4JRQA 3QEWA 1LAVA 5HRSA 1RA7A 4J9SA 3G10A 2BR0A 4I2PA 4FBTA 2R2UA 1TK8A 3TAPA 3V6HA 2X74A 3SZ2A 4JS4A 1JLGA 1TKZB 3PV8A 1UA0A 3DOLA 2ZE2B 4O3RA 1KVBA 3M8PB 2IM0A 2R8KA 3TAEA 5KFMA 4Y3CA 3GV7B 1FK9A 4CEZA 2D3UA 5I42B 1JLFB 1KLMB 5HRRA 3L2UA 4R5PB 1J9AA 3SJJA 3MFHA 3LPUA 4LSLB 2NUBA 2V9WA 4ED3A 4CJUA 1TKZA 4JRPA 4FLTA 2HMIA 2ZD1B 4ZHRA 2ZE2A 3KLFA 5CYMA 1WAFA 4MIAA 2HHVA 2GUIA 1YVFA 4W5NA 4KHQA 4QWDA 2OH2A 1JIHA 4ELVA 5FROA 1B9DA 3NDKA 1YTUA 3JSMB 1RTDB 4Z0UA 3BSNA 2GIQA 5I42A 4FLXA 4CK1A 2HNDB 3T5LA 3RRGA 3C6TB 3PW7A 5KFQA 4ID5B 2OPSB 4DQPA 1JLFA 2OPPB 1KLMA 4AHVA 2D0CA 4R5PA 3L2VA 4E1MA 4OKJA 4MK7A 3SUQA 2ZD1A 2IM2A 3V1RA 4F4KA 2C22A 1QHTA 4DS4A 4WZMA 3OL8A 3QERA 2B6AB 3SV4A 2D41A 4O55A 4O3NA 1BHLA 1J53A 1S5JA 3ISNC 4FJ9A 3JSMA 4E7IA 2JGUA 5EDWA 1IG9A 2HNDA 3M9MB 4Z4HA 4ID5A 2OPSA 2OPPA 1TQLA 3OY9A 4NYZA 1HPZB 2IS3A 4O4GA 4M3WA 3MECB 1JLCA 3D45A 1NK9A 1NK4A 2C2EA 3O4NA 1S6QB 2A1RA 3UIQA 3VQ9A 4DTMA 1JL1A 4AHUA 2YNFB 1TKXA 3HVWA 1WSFA 4Y2CA 1LWEB 1A5XA 1CXUA 4CIFA 2RN2A 4KKOB 3PX0A 2FVQA 3AA5X 4HVJA 2E9ZA 1HPZA 3MFIA 4QW8A 3KJVB 1OS5A 4Q0BB 2BANB 4KREA 3VQPA 1S6QA 4IH7A 1JXEA 5C5JA 4QW9A 1YTAA 1CZBA 4NLXA 5CY4A 4MFBB 2YNFA 1LWEA 5J2MB 3ZSZA 4C8LA 4DL2A 4NLQA 3ZT3A 1NK0A 3ALYA 4CGIA 4ZTJA 1TAUA 1BCOA 2XC9A 4KKOA 1D1UA 1ZBHA 2V4RA 3BQ0A 2BE2B 4R0EA 3SUOA 3OL9A 3K5NA 3KJVA 5EWEA 4ZVHA 5KGXA 3AVHA 3KLEB 4Q0BA 5KFBA 2BANA 1GOAA 2ITGA 4MH8A 1GOBA 4CJPA 3MAQA 2FVPA 4RNFA 4MFBA 1SH0A 1G15A 4HCBA 3GILA 4KFBB 3AVIA 4KE5A 4CJLA 1S0NA 4KO0A 5J2MA 3GIKA 3V9ZA 4JV0A 2UUWA 4FK0A 2Y1JA 2FLNA 1S1WB 2BE2A 4CJEA 1VSKA 1SKWA 5EUHA 2BQRA 3T3FA 3NAIA 3H5SA 2G8UA 1T03B 4E0DA 3AV9A 3DRPB 1VSIA 3TR8A 2AGOA 4AHCA 4CEEA 2Z1HA 4KFBA 3ZSXA 3H2LA 4K4SA 3OL7A 1ZETA 3CDEA 4CE9A 4EYIB 4EBCA 4Q8FA 4KHMA 4B8CA 3KK3B 1Q9XA 4CF1A 4HCCA 1SV5B 3G6XA 4DS5A 5JS1A 4CFAA 4BE2A 4K4VA 4DSKA 4K8XA 3QZ8A 1EETB 4U7CA 1HNVB 3V6DA 4DSEA 3VQ6A 2HWHA 1T03A 4NLTA 4DTNA 2P5OA 3OYDA 3NF7A 2RF2A 3RAXA 5F8GA 2HWIA 4DFJA 2YNIB 1WLJA 3RR7A 3DRRB 3NGYA 1QE1B 2F8SA 3IRXB 2HNZB 3KK3A 3KHLA 1N56A 2YHAA 3F73A 1SV5A 3RB0A 3KLGB 4GW6A 3QIPB 3LZJA 2IA6A 1EETA 4WFXA 2ATLA 2PYJA 3OJSA 4TY8A 1QQCA 3TABA 1ZBUA 4DTPA 1RBRA 2FBVA 4OPKA 5SZTA 1JLBB 2YNIA 4MK9A 3S3OA 1RTHB 2ZKUA 4TYBA 3DRRA 1QE1A 1T05B 1RTIB 2YKNB 4OLAA 3IRXA 2HNZA 2BDPA 4Z4IA 4RNHA 5JXSA 1IKVB 1EX4A 1U48A 3QIPA 1LAWA 4FZXC 1N5YB 5J2PA 2OPQA 4ID1A 3E01B 3LP1A 5KFJA 4HUGA 1JLBA 3QO9B 2KFNA 3V9WA 3P83D 3OSNA 3MXIA 4EO8A 3AVJA 3T1AA 1RTIA 4Q5VA 2HHSA 3PX6A 4J2AA 3RB4A 1IKVA 1WNEA 1KHVA 3HVRA 4FJ8A 1FKPB 3CM5A 1N5YA 4YMEA 4ECUA 3V6KA 4B9UA 3E01A 3DRSB 3BSOA 2AJQA 4DF4A 1CZ9A 4BACA 4URQU 4EP5A 1X1PA 4Q43A 1J5OA 2R8JA 2VG6B 3UDLA 4DL7A 3DLRA 3QO9A 2AX1A 4WFZA 4K4WA 3BSCA 5L1LA 4H4OB 1Q9YA 3QYYA 3Q8SB 2VA2A 4FS1A 2E6LA 3P5JA 2WHOA 2P51A 3PY8A 1FKPA 3NCIA 3RAQA 4DLEA 4ZVEA 2UVRA 5DQIA 2WRMA 4H8KA 2KTQA 4PQUB 3AO1A 4IH6A 2VG6A 4F4XA 3QINA 1NK5A 3RR8A 1BIZA 4H4OA 4QWEA 4HTUA 1KTQA 4QWBA 3T5KA 3AO2A 4I7FB 2FVCA 2WOMB 2FJXA 4WXWA 2R2RA 3ZCMA 5F9NA 3HP9A 4RNNA 1TL3B 2AX0A 4K4YA 3SQ4A 4CK2A 2R8HA 3VQDA 4OJRA 4PQUA 2OZSA 5KG7A 3V81B 4CGJA 2ILYA 4K4TA 2EC0A 3MF5A 4TQSA 3GIMA 1WSIA 2Z1IA 3L2QA 4QWAA 3QIDA 4I7FA 4KTWA 3I0SA 2WOMA 4ZP8A 3N6NA 4GC7A 3VQEA 2R2TA 1C1AA 1TL3A 4FXDA 4LH5A 3IGNA 3H4DA 1RNHA 3CFOA 4DTJA 3IGVA 3SUNA 1RT1A 3ZT4A 3L3VA 3V81A 4I2QB 2W9AA 1TGOA 4CCHA 5DLFA 4HKQA 5HRPA 2EX3A 3K5OA 4TN2A 1S48A 3BQ2A 3RBDA 4NLSA 1NKCA 1NOYA 4Q8EA 3HL8A 3ITHB 4LY7A 2XHBA 4KPYA 3RWUA 4RW6B 4FJHA 2D7SA 5E41A 3OHAA 3HPOA 3NMAA 4KTQA 3QESA 1CXQA 4BWMA 4I2QA 2Z1JA 4CIGA 2UVVA 1RBTA 1NOZA 4LSNA 4RNOA 1NKEA 3CG7A 3OYGA 3NH0A 3VQQA 4DTXA 4CECA 4IRCA 3ITHA 4XO0A 4IRDA 4CEBA 5D3GB 4CJ5A 2YNHA 1JXBA 4RW6A 1VK0A 4J9KA 3N6MA 1S1VB 4DU1A 3PW5A 4RUAA 1C0TB 1RCHA 3PZPA 1RT3B 3I0RB 2KZZA 4B9VA 3QETA 3MEDB 2XO7A 3TWHA 5D3GA 3AVMA 5HBMB 4IG3B 2IBKA 4M3YA 2C2RA 2DPIA 1KFSA 1S1VA 5EWGA 1I39A 3VQAA 1KLNA 2BQUA 1RT5B 3HO1A 3QGHA 1C0TA 1D5AA 4CF0A 3OSPA 1Z25A 1RT3A 3I0RA 4DQQA 5SWMA 2P5GA 2VWKA 2YV0X 4DQSA 3MEDA 1RILA 2HHWA 3L3UA 4DG1B 4CJKA 2DFFA 5HBMA 3HHKA 3OYAA 4RU9A 5KI6A 3OS0A 3LWMA 5KTQA 5HROB 2B43A 2FVSA 1RDAA
chains in the Genus database with same CATH superfamily
5H1SV 4DU4A 2HQCA 3CCZA 2E9RX 4NL5A 4N8NA 3NF6A 3FMWA 2XWYA 3C15A 3BO3A 4JI7F 5DLGA 3KK2B 4QYZJ 4JI3K 2IM1A 2F8TA 1S0MA 2OTJN 4HHUA 1FJGJ 5HMXA 1UEVA 1SJFA 4CLFA 1DAXA 2D5RA 5AQJA 3BO4A 4NWBA 2QE5A 4CGFA 4TQRA 2XSJA 3A0IX 3FUYA 4BC9A 4DR1K 3VF2A 5M2RA 4B3SF 5A8WB 1ACMB 4AILC 3AVNA 3S6EA 3DXSX 3IXQA 4P2XA 3CO0P 1WTBA 2QW9A 3KK2A 2LYVA 2P9EA 4CEFA 1TP7A 1U6BA 3J7AP 4DF8A 2CPXA 2VH7A 3FGVA 3FZMA 4O8KA 3HRGA 3SUPA 4DDFA 3VMFB 3KYLA 1S4FA 2LA4A 1YTYA 2PY5A 1DHMA 4I64A 3ULDA 3DI6B 4TLRA 5A8WA 3T7ZA 3VQTA 5I3PA 2GJFA 1WKJA 4FWPA 1RTDA 2UU9K 1IV0A 4TY9A 1P8GA 1X3NA 1RWUA 1L3TA 4KHYA 2E5LJ 1QJHA 4USTA 3FBCA 1I51B 1EQMA 1HYVA 3B78A 3UN5A 1Q7YO 4RTFD 4DR4J 3NGDA 4KB0A 3CQ8A 4MIBA 1M1GA 4A8YA 1KFDA 2X1FA 3JQKA 1ICEB 3R5DA 4E7JA 1I94K 3OL6A 4NRTA 2DPJA 4CWBA 3I56N 4F0KA 2ERRA 4R79A 3R1XA 3W1YC 2FC8A 5KG5A 4E3SA 2YQ0A 2O8FB 3R5GA 5KFFA 4ECWA 4U7UK 1W2BM 3H08A 5F8IA 3HXMA 2LECA 4DL5A 3B6PA 2V7ZA 3QGIA 4DWIA 4D3HA 2W24A 5KFZA 1X3MA 2MGZB 2XS7A 4QPTA 4FJJA 3NG8A 2DNOA 1UZDA 2MLZA 1HWUA 4QOZB 3GB0A 4BGAA 1T9TA 1VQPN 3CI5A 2O8FA 2XRIA 4DSIA 2KLAA 5B0AA 2VBXA 1DTTB 2N7CA 4B3RF 3TARA 4KY3A 3QBCA 1NMNA 2PE8A 2MGZA 5TKWA 5ETVA 4EUVA 2R7UA 3D2FA 4P74A 5E84A 2G9OA 3D1HA 5KQDA 2E7XA 3ZT0A 1VAZA 4IOBA 1DTTA 3CF5Q 4YOEA 2CG4A 2WK4A 4ZLNA 4UF4A 3W9JA 2W2PP 3OTBA 1S1WA 2P9UB 4DBQA 4FN5A 4JI0J 3D28A 4C8OA 3UR3C 1VQKS 2DCUB 4YY3K 2CZ9A 3AOAA 2FY8A 2Z57B 2XLKA 5HVFA 2XTJP 3ENQA 3MCOA 5JVGL 4MQ3A 1U2FA 3R5CA 5CHIA 1VFJA 4M95A 3X3UA 2WB4A 5C2GA 4ZPAA 2Z58B 2CQCA 3VERA 4M3UA 4LF4K 2P9UA 1CJKB 2JWNA 5CZVA 1HNVA 3VCDA 1MWQA 2KKZA 4N56A 1SH3A 1QSLA 1RDCA 3LP2B 1WG4A 1V5IB 1UFWA 4YB5A 4KAIA 4TKTA 3J8AA 4PG7A 4LD0A 4X4VA 1BLUA 1P6TA 4B17A 3JTOA 2POKA 4CO1A 4OPJA 4DXLA 1RISA 2ITMA 4NX9A 4RWTA 4DPOA 4ZDNA 3BZQA 2XWXA 3KLGA 4FLYA 1ZBIA 3KOAA 2CKWA 8RUCA 5BYRA 3LALA 1YRTA 1SKRA 4LF7F 3LP2A 3BEXA 2YJEA 3FZHA 4K0KF 1TKTB 2MZJA 4DJBA 4LFBJ 4ECXA 1ZAXA 4JNEA 1WHWA 3CC7S 3ZZRA 1W2IA 1N6QB 1RB0A 4DR3J 2MXYA 4PYDA 5FDLB 1GXLA 3VQ8A 1VQ9S 4F02A 3CIZA 4UY8T 3KKRA 1E6VB 3SCIE 2YH1A 3MEEB 2ALYB 3Q8VA 3TI0A 4K8ZA 2BX6A 5KG0A 1DLOB 3A8JA 1JL2A 1WC1A 3LDLA 3CF5L 1TKTA 1Y5NB 4BDYA 2V6AA 4B1YB 3J81U 4NYFA 1UJ4A 5LMUF 1OH5A 5MAOA 1R0AB 1N6QA 5KFKA 5HOOA 1X9SA 5FDLA 2D3OR 1YITS 4Y34A 3OW2M 3LDOA 1E6VA 3I5BA 3MEEA 1IBMF 1CVJA 2WTUA 3V6JA 3ASMA 4CJRA 4QWCA 1W7AA 1RT7B 1DLOA 1N32F 3UN2A 3M7VA 4ANEA 1GLLO 1FERA 2K7JA 4UZCA 4ANCA 5C2CA 2Z2MA 2CPIA 2D0AA 1R0AA 1PJ7A 4IKFA 1NJYA 1R31A 3R1LA 3IFEA 4B3MK 2W2OP 3U3GA 3B6BA 1RT7A 1OJ4A 4NXMJ 2ALZA 3OTDA 1M90O 1WKKA 4OV1A 3OLAA 1U7LA 1QSYA 2IPOB 4X4NA 3NHGA 4NB4A 3TUJC 4LIRA 2J6TA 1C0MA 4DR2K 3A5OC 1L3KA 3HHDA 4DL0C 5GAGP 4IEEA 2IMWP 3TX0A 3CJBA 3QEIA 2VHGA 4JYAK 3R9PA 4GVBA 1RA6A 1JCFA 2GW8A 4A48A 4G1IA 1TUUA 1RYSA 2NPFA 4FZVA 3LDQA 3GTYX 3FCVA 2YKQA 3UDVA 3QFHA 3MZIA 3OPKA 2OTLS 3H3NO 4DUYF 3ILIA 3KZBA 3DM2B 3UN3A 1KQGB 3AT1B 3O2IA 2AEFA 5DG7A 3L2RA 4KGKA 4KBOA 3D1OA 4CYUA 3OTEA 4PA1A 4DTUA 4ZLJA 1YJWS 1T94A 3GDQA 2BKOA 4HR2A 4YDUA 1IBCB 2C28A 1ZBSA 2AQ4A 4CD1A 3EN9A 3VQ7A 5ETQA 1KHWA 3NGRA 4OHXA 3DM2A 2KXFA 5DS7A 4CERA 3FRZA 2W8KA 4X66K 3O3GA 2MB0B 3DLEB 4XK8C 4ECYA 4ECQA 2VZ9A 4CLTA 5MLCQ 2HVHA 1WG1A 3H40A 4OKEA 1S76D 4IDHA 4B08A 3DCAA 1H72C 4W90B 4WTYA 1SL1A 1GFWB 2ZH7A 2XLIA 1MWYA 5D4NA 1NPPA 3TUIC 1N33F 5D0EA 3N5FA 4GVLA 1KAYA 4ECTA 3RMAA 3SQ0A 2QA1A 1XMOF 3W8GA 4QCLA 2HIYA 1R43A 1Y3KA 2HBYB 1BOTO 2QM1A 4FJKA 5HMZA 4YB7A 3C7NA 3Q24A 1UPMB 1U2RA 4Q45A 4XEIA 5E33A 1FJEB 2XYPB 3GCXP 5F3ZA 2UV8A 2BW2A 3M9OB 2FC0A 4QS8A 1SBRA 4IG3A 1F6TA 3CGIA 3KLVA 3QEVA 4FZYA 2EVZA 3S3NA 3UD4P 4ZCKA 1WSHA 1CLQA 2AF6A 1GLCG 1VJQA 3DRYA 1FCAA 3IMXA 1Y00A 1RGVA 3C0BA 5KFNA 3DFEA 1DQ8A 3QEPA 1Y97A 2OANA 2WAQD 4OIXA 2FJWA 4DCHA 4BRHA 1QY7A 1R8BA 1L3UA 4ZHRB 4JI5J 3KLFB 5CYMB 5HI7A 2V5HG 2Q31A 4ZPWR 3HD2A 2HOEA 2DTUA 4HUEA 4ZPBA 2PI5A 2VFRA 2FSNA 1Q8IA 4FW1A 4UOHA 5DQHA 4OX9K 3CWJA 3CC4N 5FLXO 3CDBA 2YKAA 2UXDJ 2H4WB 4DL3A 4A8KA 4DSFA 2F63A 2K2PA 4CF8A 1A5VA 1YG0A 2ZDPA 3P3DA 4CZIA 2B5JB 2H51B 1T9XA 4BRIA 4ZTFA 3C6HA 1B4SA 3MN5A 3IAYA 2BH1A 2FHOB 2V2KA 4DKWA 3CJ5A 2YX1A 3PYGA 4JHDB 3HVAA 5BR8J 2U1AA 3WNHA 2Q3SA 3V1QA 3IWNC 3Q8RB 2G8WA 2N3OA 3A13A 4MYTA 3N6LA 3T9ZA 4CLUA 2JVRA 3CMAS 4BRMA 2B5JA 4B02A 2H54B 2KM8C 5HQMA 4KI6A 2DY4A 2V0NA 2NZ4A 4M63C 2GGPA 1RGIA 1X9MA 3N4WA 4JHDA 4B3TF 1R3NA 2BJ3A 2ZWPA 4GKKJ 4DR7J 2C42A 3MN7A 3GYNA 5L1KA 3W66A 3PIPQ 4OYAA 1O51A 2FBXA 2UUCF 5FPDA 1YIJN 5K8NA 3CMEN 5DM7Q 5KQ8A 3PO5A 2Y0BB 5E3AA 4M5KA 3M8SA 4IO8A 3MPWA 2R7WA 4PAAA 2DNZA 3IBCB 1FF2A 1GQEA 1Z1ZA 2DY9A 3BKUA 4ILLA 2OSRA 3O08A 4BVPA 4K4UA 3VTHA 2M4MA 1YJUA 1NPKA 3RBZA 1JJ2M 2OCEA 2MHNA 1I3OB 1FE4A 4LR9A 3OVBA 2MZQA 3HHLC 3FNNA 2NRHA 2I9SA 4EGLA 1ATNA 1F2HA 2VFUA 5AQYA 2VKZG 1BIUA 1NJXA 3I5CA 4O0NA 3MEGB 1V5VA 2UUAK 5KT5A 3CT9A 3AJ1A 1HNZK 1HWLA 3MWBA 2PFUA 3OVNA 4NOHA 2XCPA 4CHZA 4PUOB 2HRUA 3DOKA 3G86A 1HQEB 4DV2J 4DR6K 3RB6A 3MEGA 4ED6A 4DU8A 3M6GA 2VFVA 3M4XA 1S9EB 4PRFA 3OTOK 3C16A 5EX0A 3AGKA 2CH5A 4PUOA 2RF2B 4OFZA 4DFKA 2WCXA 1FJCA 1F2GA 2W9BB 1K8AO 2E1PA 4FJNA 2A1SA 4U67Q 4GV6A 4B9SA 2HNYA 3A4TA 1HQEA 5KFOA 3OTCA 2CDRB 5A6WA 4CO4A 2X7IA 4YB1P 4DL6A 3PIPL 1KRPA 1SC1B 1CC7A 4TY8B 1S9EA 4DV7K 1M5HA 4DZDA 2VBWA 2ZHAA 3UPFA 1Q4RA 2W4CA 4IOCQ 1RAAB 4Z4FA 1Q86T 4MDAA 4IQMA 2W9BA 4IQXA 4PL7A 5BN8A 2CQDA 2OEKA 2MQOA 3UD3P 5GAEU 2CQIA 3W5ZA 1KQKA 1OH7A 4GNIA 1L5UA 4AYBD 3KHRA 2KT5A 4ILMA 1XNQJ 3NGUA 3PW0A 3R7SB 1FDNA 4FWSA 4A57A 3LP1B 1WC5A 1QVFM 2GZOA 2OUGA 3BJYA 1LWXA 4DUZJ 2X1GA 2EFQA 5KFVA 2EWHA 4DPYA 4F4YA 3LANA 3AB4B 1A9NB 1X4DA 3E9LA 2X6NA 3HZGA 3HZ6A 4LF5F 1T9UA 2X51A 4ES3A 5J2NA 2CAJA 2HGNA 5D15A 3D0HE 4JI1J 4HLBA 2J8AA 4FKYA 3W62A 1RAGB 1XC3A 4CF9A 2J7UA 3H6EA 3WBZA 3R7NB 1S1XB 4F67A 4CEOA 3HYFA 1RAFB 2YHWA 1UZHA 3W61A 3BDPA 1IJJA 4LF1A 4DX8H 1NGIA 2GS8A 3Q22A 2RVJA 2JX2A 4DSLA 4MKYA 3RBXA 3QJPA 3KMSA 4U67L 2XMUA 1IUJA 3OFGA 1QAYA 5F8HA 3A5NC 4FM0A 4YOYA 3CFRA 1J5EJ 4Z2XA 1S1XA 5T14A 3EZ5A 2GX9A 4OZ0A 4NLRA 3P6YC 2DNYA 2P8IA 2CH6A 2KVQE 4P10A 5LMNK 2HZVA 1QQOA 3VN5A 4IOCL 1FKOB 2NUHA 1FRXA 1TK0A 1K47A 3ZT2A 3NWGA 3GIJA 2LXUA 2JLEA 3ICLA 5KG1A 1HMVB 3KJNB 4A4JA 1NH8A 3H0PA 2JOQA 3OYIA 1EIYB 1WHVA 1G6BA 3EE9A 4PPDA 3DDKA 1VIXA 5ETPA 3I0SB 2GJ2A 2ZH5A 3RMBA 4B1ZA 4EYHB 1UFKA 4BR0A 3V9UA 4J2DA 1EKEA 4J9UE 3J7A1 1FKOA 5ETSA 1G99A 1H98A 4PYAA 3IM9A 2IC3B 4KHWA 1HMVA 4DUTA 2YHXA 3D66A 4KJIA 3HSJA 4C7QA 2WW8A 4FOEA 1Y9OA 4LVNP 1VQ6N 1VR6A 3KDOA 2EFVA 5GAHI 1D9FA 3DC2A 2I5JB 1NLVA 4FS2A 1C1CB 2H65B 4CJVA 2IC3A 1HYZA 3BO2A 5GAEI 1BUPA 5EX3A 3NGZA 1OY9A 3MTKA 2ASJA 5IV3A 2KHDA 2OELA 2O4GA 1T0TV 4QR0A 1YJ9N 1CJUA 4JK7A 3CDWA 2I5JA 2PA3A 5IC6B 4YR0A 1FRLA 4Y6IA 5B8HA 3VPZA 3VVUA 1C1CA 3PR5B 4BREA 2ZOGA 5L1IA 4JN4A 2F9WA 2HQGA 4HACA 3OFFA 4DL4A 4E98A 3VHQA 4F7VA 4DV3J 1PILA 1FT8A 3HFKA 1VK3A 4I6AA 1TU0B 4ED7A 5AQUA 3OQ2A 5AQWA 3O3HA 2IAJB 4IEIA 2BJ9A 3VF6A 3JAMO 1JLEB 2DGUA 4JP8A 3UR0A 4MAKA 4KTZA 4OJ1A 2CNOB 3EE8A 3PW2A 4B1VA 2E5JA 1R8AA 1UWAA 4RW7B 1IWAA 3TU5A 2VYPA 2RHKA 1JNZB 3CCUS 1YVNA 4FBUA 3OD2A 2IAJA 1X5SA 4P6QA 2VQEF 2Y1RI 5DK5A 3NNCA 2NPIA 5FRNA 1JLEA 3OYHA 2Z2ZA 3GJSB 2GX8A 1RXOB 1SKSA 2HBJA 3BS9A 3I55N 4RW7A 4JI8F 1Y11A 3QEWA 5HRSA 2NUUG 1RA7A 3QT8A 3ENHA 2MZTA 2BR0A 2R2UA 4MYUA 3P31A 3HZEA 3OR2B 4A62A 3R5AA 1LOTB 5CR4A 1UA0A 2V8DA 4O3RA 1KVBA 2YX4A 3M8PB 2R8KA 2KN4A 4ZIWA 3H7HB 1TMJA 4OI4A 3AOCA 4Y3CA 1FK9A 2DHHA 4YHHK 5D4OA 3W2VB 3F9MA 3I4HX 1SKUB 1EX8A 3SXLA 3J80O 4P2FA 1JLFB 4WU3A 5HRRA 4R5PB 1J9AA 1ZM4A 2DO0A 2HBRB 2J9CA 2Y3YA 2CDQA 2OJ3A 4AL7A 1VI7A 1WD6A 2HHVA 3U4LA 4ZPVR 1VHIA 5AJ3J 2DGOA 4WF9L 3W2VA 4CBWA 5AQGA 4QOTA 4FF3A 1SVDA 3CCEN 4BRQA 3BSNA 1VQ4N 2VQFK 4PCQA 3RRGA 3T5LA 3H45C 4CK1A 3C6TB 5KFQA 1JLFA 3FK4A 5C2DA 2D0CA 4R5PA 2FJEB 1WC6A 3EWGA 3L2VA 3SK3A 3TSUA 4E1MA 5L38A 5HVGA 5F41A 1HL6A 2D9PA 5AE2A 1QHTA 3QERA 3N9UC 3SV4A 2D41A 4J5OA 1FD2A 1BHLA 1MWMA 4S0MA 4P7TA 3IBWA 1E6YA 1M1HA 4NXNJ 1J53A 1M5SA 2ADBA 3EXCX 5EDWA 4EMDA 1F60B 2VONA 3OY9A 4O4GA 2BEFA 3UE5A 1NK9A 2J9EA 3IBFB 1NK4A 2HGLA 4BC5A 2ACMA 4IO9Q 4FXVA 1JL1A 2RE1A 1TKXA 3FBEA 3MDFA 2QLFB 4Y2CA 3FZKA 1KVJA 1LWEB 3PXGa 1A5XA 1ZOTA 2XNQA 2MKKA 2RN2A 3PX0A 1WELA 3THTA 1ATRA 1XNRK 4HVJA 2E9ZA 3QSIA 2WFBA 4Y0WA 3PFOA 3VQPA 5GADI 4IH7A 4FWKA 1JXEA 3T1YJ 1LWEA 5J2MB 3QT6A 2J0XA 1WJ9A 2VCPA 4CGIA 2PMZD 4JI6J 3GLJA 4DV1J 1HNWK 1D1UA 3HKZD 1RJJA 3SUOA 3S01A 3R6GB 3K5NA 4ZVHA 4FF2A 5KGXA 3U7JA 1GOAA 4CJPA 4OZNA 4CJ7A 2V8VA 3C3LA 4ISGA 4RO0A 4DV5F 3MAAA 2QWOA 4KFBB 3AVIA 3CCQN 2XZWA 5J2MA 2BJDA 3JTPA 1SQFA 1Y4ZB 4P73A 1WC4A 2GTDA 2ZZTA 1WG5A 2Y1JA 2FLNA 2FXUA 2DR6A 1SKWA 3KUHA 3NAIA 4TNOA 2B4OA 2XMWA 5LOQA 2G8UA 1FJGK 4E0DA 4DPUA 3DRPB 3TR8A 3QDKA 4CEEA 2QJ3A 1U1MA 2Z1HA 4KC5A 3KDNA 1MDUB 4KFBA 3FMBA 5EOYA 5IT9O 3ZSXA 3J7YP 1ZETA 3CDEA 4ILHA 4BBYA 3TVZA 3AD9C 3KK3B 2CZ4A 1Q9XA 4IO9L 1IBLF 3IKMA 4USKA 4CFAA 4K8XA 3QZ8A 1H2VZ 2E2PA 5CYJA 2HBMA 1UEKA 4UY8O 4QS9A 2KXNB 4NLTA 3EZOA 3AD8C 4DTNA 5FLXY 3NOCA 3MI7X 2HWIA 2YNIB 2QT7A 4P7VA 4RUHA 4A2AA 2YWGA 3UCUP 3RR7A 1FRHA 3NGYA 1VLOA 3RGIA 2V69A 3IRXB 2KT2A 3KK3A 3KHLA 4LF8J 1N56A 4K7QA 1ZZNA 4GW6A 4CLZA 3R8EA 4JKEA 4WFXA 1I5OB 2E5LK 2PD1A 3CCTA 4X65F 3OXGA 2FBVA 4JV5F 3I6PA 5SZTA 2HSTA 5LXYA 1OQ3A 2YNIA 1VQLS 4MK9A 2KHCA 1RTHB 4OPHA 1RAOA 1F9EB 3C2PA 3IRXA 4Z4IA 1IKVB 2EK6A 1NGAA 5J2PA 3T1HK 4X62J 4XH4A 3MD3A 3QNWB 1A0OB 3BN7A 1VQMS 2M52A 1VYAA 3EVMA 4LFAF 3ZTOA 4CNYA 2RT3A 3MXIA 3T1AA 5LL6Z 2ZGZA 1Q82T 3U8XA 2MZSA 3TQEA 4J2AA 1IKVA 2AJ4A 1KHVA 3HVRA 4LF6F 3CM5A 3BPSP 2QA4S 2PBDA 3V6KA 3HCXA 4DF4A 4BACA 4URQU 1J5OA 2R7VA 3UDLA 4C97A 2DR7A 5DJBA 5L1LA 5KPZA 1OSDA 1RLCL 3CDAA 1Q9YA 3PYEA 2B9WA 1RFQA 5M1QA 3OW2R 4NO7A 4FS1A 4H4KA 2E6LA 3P5JA 2D4WA 4I67A 1HLWA 4HVZA 4GRSA 2CPYA 2BM0A 1J27A 1N34J 3ENWA 3EMTA 4HI1A 4H8KA 4PKGA 2GHWA 3OFEA 2XNRA 4IH6A 3RR8A 4F4XA 1CBKA 4HH1A 1BIZA 2E5GA 2OEJA 1S0VA 4QWEA 3PNIA 1BO5O 1N33J 3GZ7A 2CQHA 5D0GA 3L95X 3OVSA 1RK8A 4I7FB 2FVCA 2FIUA 2WOMB 4CBXA 3HP9A 3VGTA 1OSCA 1VHXA 3MK6A 1V4SA 4GV3A 2DEIA 3IP0A 4JI0K 5KG7A 3VALA 3MCSA 3QJJA 2ASMA 4X64J 4K4TA 4TQSA 3VGUA 4W4MA 3RU0A 3GE1A 4L74A 4QWAA 1F5AA 2XG8A 2HQ3A 3CTRA 3O1BA 5ETTA 3QIDA 4I7FA 1YJNS 1BHNA 4WWSA 3FVYA 2WOMA 1XUPO 1YX2A 1NSQA 4FXDA 3BV8A 3IGNA 4BQZA 3CFOA 3IC1A 1KWMA 1TGOA 4I2QB 1NU0A 2ZJRQ 4ZCLA 3K5OA 4TN2A 2JHEA 3LL3A 3GCWP 1WACA 5IOLA 3HMJG 4LY7A 2XHBA 1TMMA 4DMZA 4KPYA 1FW6A 4RW6B 2KL8A 2WC9A 4FF4A 5E41A 3PEHA 4KTQA 3NMAA 3QESA 2GUPA 1CXQA 4BWMA 3D1QA 4I2QA 2DIVA 3IO1A 3JSRA 5KPTA 3CG7A 4LFBK 4JKGB 2BTFA 1S7IA 4DTXA 4WK3A 4IRCA 2CWXA 4DR3K 4CJ5A 2YNHA 4RW6A 3I87A 3KUEA 2OGUA 3V2UC 1S1VB 1IM6A 3PW5A 1EARA 3PM9A 4RUAA 1I94J 1DRZA 4WBFA 5AQTA 1DBDA 1NZ8A 2HS0A 2E1CA 3K5PA 4JKGA 2MTLA 4QBUA 2NRTA 2GJIA 3QETA 2XO7A 3OVAA 4QU6A 3TWHA 4FP9A 4AM7A 2QYCA 5HO4A 1KFSA 1S1VA 2WZ1A 3I32A 4JI3F 3U27A 3QB0A 1K8KA 4DZ6A 3OSPA 2W01A 2QXLA 4DR1F 4A8MP 2VWKA 2YV0X 1RILA 1RHJB 4BLGA 3LWMA 2IVOA 5HROB 2B43A 3N4PA 1FA0A 2FVSA 2LKZA 3MM7B 1B99A 5DDRC 3MR2A 2AA4A 2P9LB 2P9KB 3O8MA 4M3XA 2QMXA 1LV5A 1NGEA 3O6WA 5AQMA 2FYXA 3SYZA 3S9HA 4IDKB 4BRLA 1NPRA 4B3OB 2IGIA 2OPRB 5B0DA 2IDLA 1NHKL 2IM3A 2UU9F 3H5UA 3MM7A 3C95A 1UJ6A 4URSA 1N8RT 2Q0RA 2P9KA 3C6UB 3HHLB 1WSGA 3PTWA 2CQ0A 4DFMA 3VEYA 1HNIB 3E9PA 5LJ5Y 4G3IA 2VIHA 3SSQA 2QO3A 3D6TB 4ZP9A 1VQ7S 3ENOA 4IDKA 3WXKA 4YY3J 2OPRA 4IUFA 2DTJA 1YJ7A 1C2PA 4LSLA 3SNNA 3DOMB 3THWB 4YUDA 1VRQC 1SZ2A 3HHLA 2FY1A 2V4JB 1XMQK 3H59A 3GJTB 1HNIA 2L9DA 1RBAA 1JCGA 1IBKK 1S1TB 4PQAA 2EFPA 4WK1A 2MSTA 3C8YA 1IKWB 2GV9A 2W8LA 5F3TA 4AM6A 3H90A 3HI0A 3DOMA 3THWA 3HJVA 4OI0A 2VICA 4BRGA 2XBPA 3PLAA 2FSJA 2V4JA 3V9XA 4M5LA 3THPA 1P9QC 1S1TA 3VQ5A 2BJ7A 1IKWA 1HW8A 1HJRA 2AV5A 3B82A 3M8RA 5HMWA 4KHPJ 2W7AA 3AARA 3MECA 1U6FA 1ASWA 3TTFA 4BCAA 1RWXB 2CXEA 3JAMY 3C6AA 1CQNA 1LCUA 2CJ9A 2DKOB 2QL5B 5DM6Q 1VLYA 5K9FA 4PKHA 1N48A 2DXDA 1NH7A 1DURA 1HARA 3WDOA 4L72B 2PEBA 1JJ2R 4JB8B 3DLLQ 1VQ8N 3SPZA 4OI6A 3LAMA 1LW0B 4KT0C 2LLZA 1RBUA 3G9CA 5K8PA 5A8RB 2ZOFA 2AKWB 3DMJB 3M32A 3QMLA 2KRRA 3NCPA 1Q86O 4USVA 3AVGA 4ZA1A 2NLXA 1RAHB 1MU2B 1Q7YT 4CGGA 1RBVA 1X4EA 1XR6A 5L8RC 3FC9A 4JK8A 3UKUB 4H5WA 5KG2A 1D8YA 5D6GA 2PT0A 1EP4B 4MKBA 1RBLA 5A8RA 2XLJA 5F8MA 3EGWB 3DMJA 4WYWA 3R6MA 4JV2A 2YWHA 2B56A 5C10A 4DI6A 2GCFA 1MU2A 2G0JA 1ZS6A 1BI4B 3JSBA 3M8WA 2O5DA 9RUBA 2JEGA 1TV6B 2W40A 3UKUA 3PJXA 2HIQA 3A8YA 1XK8A 1QLNA 2KYXA 4BR5A 3LDNA 2UXDK 3HK2A 4EP4A 2AEMA 4F4AA 5E0OA 4DOZA 1VRTB 2MJNA 4TU8A 1GLBG 2KI2A 2F96A 5AQIA 1MN9A 2ETJA 4DV6J 4BR7A 2NREA 2RD5C 1TV6A 3RB3A 4FSVA 4BC4A 1RAJA 2DCLA 4A8QA 4KGVB 1TR0A 5AQSA 2QSFA 4OZ2A 4A59A 1VRTA 3I4PA 3ZX0A 2AYGA 4FK2A 5HJXA 1TVRB 5CD4A 3OJUA 1Q81O 2LQ5A 1G4CA 4CZGA 2C3OA 2O66A 2CADA 3CXCM 1QUPA 1BC6A 2D0BA 1QVFR 5DMRA 3TVKA 3W3SA 4L76A 1HR0J 4W5RA 4CT8A 2C3PA 5L9XA 4GKKK 4LQ3A 4ZOSA 4YORA 3DJCA 2LU1A 1T7PA 2QK9A 3DYAB 2D3O1 1XERA 1Z26A 1TVRA 2RS8A 3E1YA 3D68A 4GO5X 3NOGA 2JEJA 1NK6A 5KGWA 4BDZA 4F25A 4URGA 1CSJA 2JLGA 4E89A 3V1OA 4LT6A 4PEOA 4IYQA 3PKYA 4CFDA 4B3MF 5J2QB 5B0GA 1U0HB 1G7CB 3DXKB 4KIAA 4ELTA 3ZZPA 3IWXA 2HHHF 3B4DA 4OGEA 3MCPA 2DGVA 1XR5A 3SFGA 4GV9A 5FLXU 1NK7A 2MQNA 4CJQA 2O8BB 1WSJA 4L75A 2DT9A 4YR3A 4FYDA 4NA2A 4P75A 4DR2F 4Y2MA 2YJFA 3GONA 2ZJQL 3EXYA 3SQ1A 1ZPWX 3DRSA 1VQ5S 3BR9A 5J2QA 4ZCIA 1QM9A 1U0HA 3DXKA 4JKAA 3O44A 3MEKA 4JYAF 2Q66A 1TK5A 1QHAA 4RX6A 2MJUA 1FXRA 3H98A 1N36J 1YBUA 4CZFA 4CJTA 1YXQA 3CD7A 3N0VA 1EKSA 2HEKA 1K6YA 1S97A 3F44A 2L08A 5BPLA 3NL0A 1RHMB 4CZEA 4NLUA 4E19A 1FO1A 3T5HA 4ZJLA 1VQOS 4CI0B 4B1WB 4FLZA 2CYYA 1UOCA 3M2RB 1RWVB 2ZZMA 4BR4A 5B09A 2HQIA 1FKAF 2DEJA 5IT9Y 2JZ5A 1TL1B 3HKWA 4ED0A 3IR5B 4JI8J 2AYMA 3WC2A 1YJTA 1Q16B 2OFGX 3D6RA 4X66F 5KRTA 4XPEA 1VQNS 4F04B 2NQPA 4IXCA 2ZWHA 3M2RA 1ESVA 4KHNA 1EZZB 2AJ1A 3EZUA 4M3TA 3SCJE 5KFRA 4CK3A 5M2PA 5M1PA 2DK2A 3A5MC 3VETA 3ZX3A 3AY9A 1YBTA 2W42A 3OYJA 2IVFB 1NEEA 2B8QA 1U45A 2FGOA 3N28A 2R2SA 3C94A 3HHEA 3S1TA 5KFSA 4M94A 5HQLA 1S10A 3BEGB 3PHTA 2YXLA 5KFHA 1DEJA 4DUZK 2KQ2A 4TU9A 3WX4A 2GIFA 3NWRA 2G2OA 3HI9A 4AUKA 3FQLA 2EHGA 2HKEA 2P9GA 2XY8A 2ZH9A 2XGQA 2HHXA 3GFZA 1W0HA 2ZH1A 2AEJA 3EY1A 3MXMA 3BP8A 4JI1K 2SXLA 1S79A 3K9KA 1HKBA 2PAVA 4NYNA 1RABB 1QSSA 4ZP6A 1UVNA 5HRNA 3LZIA 3KNGA 3ZSQA 3ENAA 4DTSA 3LPYA 5A2QO 1WEXA 4FJXA 4JI2J 2KJVA 1FNOA 1TYQB 2VU5A 3D2WA 3DAWA 5CYQB 3I9ZA 1AZSB 2HQDA 4NLWA 3WXJA 3H5XA 1C0FA 4CD3A 2CA9A 3SMZA 2DFEA 4MO4A 1VS3A 2XM3A 1J5EK 4H0VB 2QL9B 1VIOA 2CIMA 3A3PB 4NCBA 4K5RA 4FJLA 2YPZA 3UVJB 4JV1A 4I2PB 3GV5B 2HS4A 3NH2A 1HNXJ 1TYQA 4PR6A 1WN7A 5ADXH 3OS1A 2GMJA 1NMDA 4C0BA 5CYQA 4B9QA 2V4QA 1AZSA 1RTZA 1TUGB 2I7PA 4DMNA 3SI8A 3NS6A 4YDUC 2H1YA 4I68A 5DETA 3PCOB 5E3CA 4DQIA 2IJNA 1REVB 3CJ8A 2AIRB 4EFAC 3T9NA 1VDHA 2GVZB 2OP5A 2P9CA 3NVMA 3L09A 3EEQA 3UVJA 3NAHA 5KFGA 2P9NA 5GAGI 3G25A 1ZC6A 1HNZJ 3G6ES 1IVZA 3EUNA 1CJTB 4J37A 3RYLA 1YVUA 5THWA 1VJWA 2E29A 1REVA 4J9NA 5BRFA 2VJUA 2GVZA 5DDQC 2CJQA 2DNGA 5ETRA 2E5IA 1SXLA 3M8ZA 4W5TA 2F3JA 2KG0A 1KCFA 1LWFB 2VFTA 2FBYA 1CJTA 1FRMA 4Z7CA 2MEWA 4BRNA 4EBEA 4F8RA 4ER8A 3K58A 2RE2A 1HW9A 4YNQA 4DFPA 2H48B 2NRWA 1RWWB 4FJGA 1Y3JA 3FQKA 4DQ8A 1LWFA 1UKUA 2CQ4A 4E2FB 3BBFA 2H5IB 2BW7A 2VV5A 3WZ0A 3ZZ0A 2ILZA 4YOXA 2QYGA 3ZSWA 4B3SK 3Q2TC 1RCOB 5L1JA 1IBLJ 3R27A 1EKRA 2Y0SD 4M3ZA 2QA4G 4F2SA 2WB1D 3MMBA 1EQ0A 3F9KA 1UW4A 4ZVTB 1PC4A 1U6ZA 4KRFA 3ZSOA 1ZZFA 1D9DA 3CQXA 1VHFA 3K5MA 2UUAF 2V2ZA 3LM2A 4Y65A 2G8FA 3DXMB 2O4IA 4RLEA 4RKUC 4O4RA 2ZZNA 1WF0A 2OKQA 1QAIA 3SV3A 1KOOA 3TQ1A 4JV5J 4LFCJ 3HULA 3PACA 3W0LA 4DR6F 4BRDA 4DEZA 3K9JA 3WQPA 4MMOA 2W6KA 3S7RA 2IHR1 4CHNA 1SC6A 2HMPA 3OTOF 3DXMA 3WNFA 5T7BA 1VQLN 3LWLA 1BU6O 3LDPA 3O3LA 2J5AA 1GX6A 4NEZA 3JSYA 4B9TA 1TL7A 4HYKA 2UXBJ 3ZSYA 3AODA 5BYQA 3KK1B 1N0UA 2J0QD 1KKHA 5LMNJ 4J7CA 5BN9A 2QWRA 3AOBA 2AD9A 2YBVA 1UETA 4KH4A 3VGVA 2O8CA 3HT3A 2ZHOA 1R8PA 1WDDA 2B7CB 4CFBA 4N47A 3D3BJ 1XJWB 3HJFA 1WSVA 2QA4N 3P4IA 4TSXA 3BN4A 4OZLA 4P2SA 3KK1A 1RI7A 2O8DB 5AJ3K 3E3XA 1UTAA 2JC0A 1U1QA 4XDDA 5HSPA 1NZAA 1Q82O 5JMNA 1Y64A 1NDPA 3RRKA 3RVCA 1NNEA 1TL5A 4IKAA 2P9PB 2QN6B 2ZVIA 4DX6A 2O8EB 4O8UA 2UXCJ 3LTOA 2FLPA 1TUWA 2FJDB 4NXNK 3KIOA 3O4QA 4CZKA 3NGKA 2XULA 3FSXA 3VA3A 3ENBA 3W7BA 4BR2A 2P9PA 2XS2A 4NCAA 3OR1B 5BR9A 3ZSRA 4F4WA 1ZPVA 1NSKL 2OAUA 5H9FJ 2A40A 1H0HB 3G71N 4NZ7A 2ASDA 4FW2A 1YJNN 4NZ0A 3NKYA 4AXIA 1GLEG 4M42A 2IA0A 4J2EA 3GQCA 4QPXA 3OR1A 2RDIA 1GNKA 1T8EA 1SQEA 4K25A 4Z4EA 2ATQA 1T3OA 1NK8A 4KB7A 3TO8A 3OYKA 3PDNA 3U9ZA 2XCAA 4PZVA 1JQGA 2Z0GA 5ETOA 2HW3A 4DV1K 3TAFA 1UCNA 2KJWA 4K0KK 3I8BA 4YP3A 2ZEJA 3PRVA 2DPNA 1S9GB 4F4ZA 3AA9A 3U3YA 4OYBA 3BQ1A 1NHUA 3L4BC 5IWAJ 3GV8B 5ETMA 5LT5A 1Q53A 3D3CJ 1S1UB 2N7YA 1FNXH 5KFTA 1W7WA 1MMNA 3GSDA 2AJFE 1WBDA 5B08A 1B92A 3BSAA 4Z4CA 1NGCA 2P6SA 1U49A 1LKZA 2FD2A 2RHQB 2D1KA 3H4BA 3S3MA 3WIVA 3A8EA 1C0GA 4Q44A 2M3DA 1S9GA 3U1LA 1W9HA 2CJBA 2Z4PA 4FWOA 5CQGA 4ICLB 3UI3A 1WI6A 2V8HA 1S1UA 2YHYA 3PR4A 5C0YA 4OYOA 4Y00A 4BE0A 3THXA 3PUFA 4LH4A 3HSTB 2KFYA 2OZMA 5HVHA 4UQGA 5DDPC 1GOCA 3AJDA 1ASVA 3O5TB 1G1XA 1FTCA 1TELA 4LF2A 1LFPA 4YHHJ 5K8MA 2V8GA 4ICLA 3SIPB 2CNLB 1ZM9A 1K73T 1X4FA 5D4PA 3DXBA 4C8MA 4I9QA 2G8VA 4FVMA 4ECSA 3K2PA 5KT7A 2F4FA 5MLCV 4ZCMA 4LF8K 3VESA 1R59O 4P9SA 2HBLA 4BGBA 3EGZA 4OKKA 4F3QA 1LW2B 3IFRA 3CNQP 1OY6A 4NLPA 4BROA 4FYXB 2IIHA 3HOSA 2E4LA 2UUBF 2JVOA 3D6FB 3JYTB 3CCJN 1VC5A 3CCMN 3MD1A 1AT1B 5C42A 3OFHA 4DN0A 1F5CA 2C1EB 3V5RA 3IR6B 4P52A 4YEAA 1DTQB 1LW2A 3QNOA 3EGNA 4LREA 5KT3A 3BBCA 4X62K 3L4IA 1A7GE 4DUYK 1JJHA 2MLXA 4J90A 1V3SA 2YHBA 3AD7C 4HDGA 3AO5A 3JYTA 1HI8A 3LA0A 1HJOA 4OYIA 4XTTA 2FHMA 2HS3A 1X7VA 3G82B 3MR3A 1RHQB 4FLVA 3CM6A 4FM2A 1DTQA 4Z4GA 2J9DA 1Q0NA 5KRSA 2RAQA 5GMEA 3RMDA 1UEUA 3BB5A 1U2VB 4N77A 3G8QA 4EI2A 5KG4A 2HAFA 2CPZA 4PY5A 4EEYA 1FXLA 2LQ9A 1N8RO 1KSPA 3G82A 4WZQA 5EX5A 4CJSA 4ES2A 2U2FA 1UVIA 3TUPA 4CI6A 2M88A 4LR7A 5AXLA 1N34K 3ZFVA 2Q6CA 1U25A 1H2UX 5AQRA 2GIRA 1U2VA 1YAGA 1KVCA 4K5SA 2JSXA 5CABA 2RDDA 1LAVA 5E3PA 1N33K 4J9SA 3TVYA 4X4RA 3G10A 1TK8A 2DGWA 4QIFA 2VQFF 4OPAA 1TKZB 1PGZA 2XSJB 3M3ZA 2LEBA 3MCNA 4YDDB 2ZE2B 2B7BB 1OQ6A 2IM0A 3C46A 3GU0A 3GV7B 4X64K 1IR1A 3F56A 4AQYJ 4CEZA 4X4QA 4OZ3A 4BRPA 1SIZA 5B0FA 2WSFC 3RJMB 3L2UA 1TUVA 3SJJA 3LPUA 2NUBA 6FD1A 4CJUA 1TKZA 1XN9A 4FLTA 3KG4A 2HMIA 1TZ0A 2H3EB 2ZD1B 2ZE2A 1T9VA 3PG9A 4RCHA 4QYRA 3LO3A 1HPMA 2OH2A 3NCRA 4ELVA 5FROA 2DB1A 4H03B 3JSMB 1RTDB 4Z0UA 1X60A 4FLXA 2HNDB 3PW7A 4KH6A 1FFGB 4AHVA 5E5NA 4OKJA 4MK7A 2ZD1A 1RWPB 2IM2A 1XNRF 3E8OA 4UQTA 4F4KA 3SJHA 4DS4A 2NXCA 1YZ7A 2HRYA 5IT0A 1S72N 4C3LA 1HWIA 4FJ9A 3JSMA 3TA1A 1IG9A 2HNDA 4CRJA 1TQLA 3D6MB 2ZC3A 4NYZA 5A76A 1HPZB 2B3TB 3T6JA 3HF5A 4C3KA 1JLCA 2AT1B 2RQ4A 2E7VA 4DN9A 3SSSA 1HNWF 2C2EA 2DHAA 2RH3A 3K89A 1Y0HA 4UUXA 4DTMA 4AHUA 2YNFB 3HVWA 1WSFA 4RBTA 5DZ6A 5JVGQ 4LF9J 4QIWD 3T1HJ 2E2NA 2FVQA 3AA5X 2M7SA 1HPZA 2OTJS 3FZLA 3KJVB 2PDAA 3M30A 1Q8LA 4WFAQ 1OS5A 4Q0BB 4UW2A 1YKWA 4QW9A 1GAOA 2CUYA 5CY4A 4MFBB 2YNFA 1FJGF 4NYPA 4IJNA 3GFYA 3ZT3A 5F2RA 5IT4A 2GWJA 4ZTJA 2ZH8A 1TAUA 2XC9A 2V4RA 2BOAA 3BQ0A 3OL9A 1X8DA 3KJVA 3AVHA 2AJ2A 4Q0BA 3JXOA 3MMCB 2UUCK 3D2FB 1GOBA 2CZVC 3MAQA 2FVPA 4MFBA 2ZUAA 3MWPA 4HCBA 5L9NA 4ZLLA 4H0PA 1YJRA 1D8ZA 4KE5A 4KO0A 2R7QA 3MPVA 3BF4A 4IJAA 2BJ8A 4DHYA 4WQ4A 4JV0A 3MURP 3J7YU 3EE3A 1S1WB 4CJEA 3OA9A 3KG1A 5AQZA 2DO4A 2A41A 3MMCA 1T03B 3AV9A 1PSDA 2AGOA 4LSZB 1PBUA 2YTCA 3NNAA 3MHYA 2E5LF 4PKIA 4K4SA 2W6LA 5AQLA 4NLCA 4DR4F 1WF1A 1BE4A 2DR8A 1NSAA 3VF4A 1RACB 2IFXA 1SV5B 4DS5A 1CS4B 4DSKA 1EETB 4JKCA 1HNVB 3R2DJ 4USJC 4ZVRB 4OYXA 4ED4A 4DSEA 3V6DA 1GMWD 3MMAB 1U2CA 3CD6N 4YB6A 1T03A 1JXVA 2RRAA 1VQ5N 1TL4A 2MHEA 3SAHA 4DFJA 5D77A 4LBHA 4OHYA 5GIOA 1QZ6A 1WLJA 1D3WA 2RJZA 1RKIA 1QE1B 4LVOP 1V4TA 4WFAL 3VGLA 1SV5A 2FZGB 3RB0A 3KLGB 2YQ3A 3GOIA 1CS4A 3J7ZT 3LZJA 1EETA 2F9DA 3ELHA 2ATLA 3MMAA 1XQIA 1RAEB 2ZM6J 2KHOA 3BGOP 1M5PC 1OY8A 4FNIA 5JMVA 3TABA 4G9ZA 4C2MA 2ZH6A 1U24A 1HBUB 1DQ9A 4OPKA 2RIJA 3A8KA 1VQPS 5ADXA 2ZBPA 2R7XA 5I3QA 1QE1A 3E66A 1RTIB 3CXCR 1AB8A 4OLAA 1Y5IB 2BDPA 1PJ6A 2HF4A 1DT9A 1U48A 1EX4A 5D78A 3SMPA 4G6VB 2OPQA 3E01B 4C9DA 4KHPK 1HBUA 2JL9A 3QO9B 2KFNA 3V9WA 4RJVA 4DPTA 4EO8A 3GYXB 1RTIA 1TFYA 1APSA 1UVKA 1S77D 4FJ8A 4YMEA 1E3MA 2E66A 3E01A 4UT4A 4Q43A 1CPZA 4H5RA 4DL7A 2R3VA 4V1Ak 4LF5K 1YRUA 3QO9A 3AA8A 3M6XA 1SS6A 4FXWA 3QYYA 4JI0F 2D0PA 1ZAWA 4AL6A 4M5HA 4GKJJ 2AZ3A 2P51A 1PYSB 4A47A 5JJBA 4DLEA 3MUTP 2VASA 3TYTA 5DQIA 1KC8T 3VEWA 1S4EA 5AZIA 2IRYA 3AO1A 3QINA 3CJ1A 3J7YI 2KT3A 1NB2A 1RQ0A 3ID8A 1GLFO 3AO2A 3CCRN 2F65A 4ZN3A 4WXWA 3LM9A 2R2RA 5F9NA 2E20A 2G0IA 4MT1A 1S5ZA 2AX0A 4K4YA 1VK8A 2XYGB 3SQ4A 4PXEA 4GVBB 4CK2A 2R7TA 2R8HA 1R89A 2BE7D 1UP1A 4E8UA 1EB0A 5TKYA 1REGX 3MM8A 3UE2A 4EIAA 2QWMA 2QIFA 4DB3A 1QD1A 3MF5A 4JI4J 1TTHB 3W3DA 3HBTA 1FRIA 2XS5A 3ATUA 4ZP8A 4BG9A 4V19X 4WPAA 4LFBF 1E4GT 4CYUB 1GXTA 4DV6K 7FDRA 4DTJA 1RT1A 4DR3F 4A61A 2OLWA 2ROPA 5U47A 4D3GA 1H3DA 3BYRA 1MN7A 4HKQA 1GEHA 5HRPA 5DRKA 1H6KX 2LQ8A 3CW2C 4H4KC 2CPFA 3SSRA 4CLWA 2E8AA 4NLSA 4Q8EA 4AL5A 3BY5A 3R2CJ 4ZN1A 2D7SA 3DN9A 1NM2A 1XMQJ 1HR0K 3D67A 1SJ1A 4CIGA 4LSNA 1IBKJ 4RNOA 2J7WA 1XQSC 4JKBA 3OYGA 2GV1A 2LMIA 3UO0A 3CC2N 3BBBA 4CECA 3HSGA 4CEBA 1PKUA 2GO8A 4ETXA 1JXBA 4J9KA 3UB5A 5FPEA 3VGMA 2ZHBA 1IR0A 2Q97A 4F0HA 4NYOA 1U26A 1FWLA 3C7NB 3VEXA 3ZNJ1 3G4SN 3I0RB 2K1RA 3M6UA 4NXMF 1DKGD 3EDQB 2EFOA 3W8PA 5HBMB 4IG3B 2B9EA 5CXTA 2C2RA 5LSOA 1RKJA 2DPIA 3R5JB 5GMKa 4JBCA 3VQAA 1RT5B 2ZH3A 4FPAA 3QGHA 2G4BA 2AW0A 3I0RA 5GIPA 2NRXA 2P5GA 4IO1A 3DKDA 4DQSA 5J1PA 2HHWA 3CJKA 3L3UA 1N36K 2MSSA 5HBMA 3HHKA 1OVYA 3OYAA 4RU9A 3OS0A 1YUWA 2D0OA 1N88A 1WEZA 4K2JA 5T7LB 1RT5A 2PYLA 3T69A 1FTRA 2CWKA 3Q83A 2F8EX 2MDAA 1YT3A 4NLGA 2QG9B 2W2MP 3SBMA 2Y8YA 3ZZUA 2F8MA 3EGVA 4RL1A 3AB2B 3MCAB 2BE9B 2I38A 1PBAA 2Q79A 1RLDA 3SMSA 3K5LA 4LRBA 4P71A 5T7LA 2E88A 3G0ZA 4JI8K 4I9LA 3F0NA 2VF3A 3LDSA 1RWNB 4KH5A 1HI1A 2R42A 1N5VA 2EI5A 4WJBA 5LSLA 3SCLE 3NCQA 4FKXA 3WT0A 5GINA 2ASOA 1P1LA 2F5GA 3N4QA 4AFFA 2W4PA 2VPWB 2O01C 2MQPA 1WOSA 3NNHA 5C12A 4M41A 1WDTA 1VC6A 2V51B 2E7WA 4ISEA 5I3UB 1CJVB 1H1VA 4DV0J 4ED1A 2N4DA 1URNA 2GELA 2GGPB 4ETZA 4F9OA 1F9FA 2QLJB 5KT4A 4WFYA 1HHTP 5JS2A 1AXQA 4BG8A 2RUSA 1RWOB 1LK7A 3OXLA 4K42A 2RKIB 1U47A 3AVLA 5B0CA 1AYEA 2QKBA 5F0WA 1NSPA 3ULHA 1JK9B 5I3UA 1CJVA 1DGKN 2B6AA 1N5QA 4FJIA 1IM4A 4ITSA 1CZAN 2DJWA 1F21A 3THVA 1VSFA 5IS2A 3Q89A 4JI2K 2WTFA 2GAHC 4IOAQ 3W2WB 2VBZA 1EWQA 2RKIA 3POTA 5G4DA 1W25A 4KQZA 4J9RA 3QT5A 3JQJA 2G8KA 2HVDA 2YPYA 3K17A 1HWJA 3C66A 4Y1CA 3D5MA 5EXWA 3B8AX 4JI5F 1KR4A 5D0HA 4FYYB 3U9DA 4OZ1A 2EBEA 3CC4S 2J8SA 4L73A 1HNXK 3W2WA 1JNRB 3TA2A 1ZBLA 3CCVS 2MZRA 3TRGA 5F0XA 4MK8A 2MLYA 3DOKB 4CF2A 3DDNA 3CVKA 3UNYA 3SQGB 2GC8A 3TAGA 2OEMA 3QJLA 2UXDF 3M6WA 1SQGA 2FJBB 1KQSM 2P5VA 2O67A 3Q8UA 4O44B 3CD0A 5B0BA 2V7YA 2FLOA 5LY3A 3UD5A 4BS2A 3C16B 1SIWB 1KTVA 3KLEA 4B9MA 2F4VJ 1TKDA 4KGZB 2D69A 1K1SA 1Q5YA 1YJVA 3SQGA 5FJ4A 2HNYB 5BR8F 1MWKA 4K59A 2Q2RA 3LQVA 4MO5A 1MROB 2AMCB 4HHTA 1BWVA 4CEAA 2N4CA 4LRFA 1VSMA 4TLQA 2OO4A 4BVOA 4O44A 1ZBFA 5DGBA 3TJ9A 3QQCD 4ILJA 4EO6A 2A6AA 2KFZA 3VEOA 2WBNA 1XC9A 3R7BB 4DV5K 2M8HA 4C8KA 4ZPCA 2FSKA 1ITPA 1M5OC 2XZDB 4GKKF 3CMES 1L3SA 4DR7F 1MROA 4IOAL 2BVZA 5CCLA 2BKPA 1NDKA 2HFNA 4DV4J 4ALZA 1K9MT 5GAHU 4CQ1A 3TZXA 4PG6A 1IN0A 4OJGA 3GSIA 4JD2B 2WONB 5K5MA 4J9QA 3G96A 1P27B 2H4YB 3MM5B 4C6AA 3H1QA 3BYPA 2RMLA 2AP1A 1K0VA 3IN5A 3OHRA 1IBLK 2G8HA 1S6OA 5J2NB 1YF5L 1BWFO 4Y2AA 3BKTA 2IVYA 1IG8A 4USMA 2L9NA 2V52B 2WONA 2ZGYA 4JD2A 1XR7A 2IDEA 4FPIA 3MM5A 1F9HA 3E51A 3OS2A 4LJMA 2RILA 3L7UA 5C24B 1HBMA 2IRUA 1FXXA 3ZT1A 1RAIB 1FESA 4FWNA 2FPHX 1T05A 3OLBA 3O3FA 2YKNA 3BUZB 1X9WA 3E9OA 5HANA 4CEDA 1U02A 1R27B 4X65K 3PHEA 2HG4A 1ATSA 4JV5K 3TTCA 3KLHB 4LFCK 2VD3A 4DV2F 3DNCA 2A3ZA 2F8HA 2J9DE 4G1QB 4X4SA 3CJ2A 1T95A 5IXUA 2P9SA 5C24A 3TSPA 2DRBA 1A6LA 3ZX2A 4JAXA 2OMOA 1K73O 5CAAA 2FHKA 1GTEA 2CPHA 3L6QA 4FJ5A 4O3OA 2I6WA 3KLHA 2P6TA 4LFAK 3SQ2A 1Q81T 3I33A 3K0JA 4G1QA 2UXBK 1CG2A 1T9WA 4USIA 1LNQA 2CG8A 4O5BA 4FPRA 4UOGA 2VOPA 2BQ3A 4LF6K 4OVLA 3OHBA 1GLAG 5IZHA 3ET6B 5LSRA 2JLFA 1YHQN 4BRFA 4GMJB 4C0HA 3A12A 2JEFA 3DLBA 4B1UB 2OD4A 2QEXN 4USHA 1RDDA 4M5NA 3R3LA 3W60A 4DR5J 2FBTA 3KD5E 1XHZA 1XNQF 4WXOA 2EPIA 1NDLA 2HSEB 2XGPA 1W26A 4KHRA 2L9WA 3WX8A 4H4MB 4DUZF 3ET6A 3HFVA 4KPCA 4BE1A 4C8ZA 4X2BA 4IRKA 3BH6B 2B8PA 3FZFA 3VENA 3NF9A 4IFVB 4DPWA 1X5PA 3UDEA 2YWKA 2EKYA 4LRAA 2FJAB 2FB0A 1NNDA 4AH9A 4JI1F 1RUSA 3AXMA 3VQBA 1NG9A 2DNHA 3KK7A 2CVEA 1CJUB 2UXCK 2A2CA 3AQOA 4H4MA 1EJ7L 1DFDA 1FNMA 3CJ0A 1SPBP 5T41A 2GAGC 2GMHA 3GG4A 4JI7J 2HZAA 4U9RA 4OJ3A 4IFVA 4HACB 2ZDOA 3GWCA 2QLXA 3RUBL 2CJKA 3CPWM 3THYB 1LFWA 5FPNA 4FVUA 3VVTA 3W64A 3BM7A 3M8QB 4TXSA 3D7EO 3OT9A 2MZ1A 5H9FK 4ID8A 5G0RB 2UVUA 4FDFA 4B3SJ 4I56A 2A6OA 4M7YA 1J54A 3CD5A 4MTPA 1QDUB 3NBPB 3MPYA 2DXEA 3THYA 1O1WA 3RTVA 3KLIB 1D0EA 1T3NA 1U04A 2NS1B 1QUVA 1RSCA 2M0GB 4AD6A 3M8QA 1K1QA 3PJWA 2R9LA 4WF9Q 1CEZA 4WIIA 3W65A 5G0RA 5A0YA 4EHTA 3MWTA 2D9OA 3KMQA 3CIMA 3KUGA 3OXFA 5DG9A 3TNVA 5KFCA 2BOPA 4H0OA 2CVIA 3NBPA 4F0MA 1ILYA 3K8WA 2EK1A 2PZSA 3KLIA 1VBXA 1SC3B 4YOWA 2J7KA 5GADU 2XY5A 1VQ6S 1P8ZA 3VGKA 3US5A 2MQLA 5ETKA 5IWAK 3I8DA 3O9RA 4F26A 4ZMMA 4FYWB 5CD4H 1NGDA 4PWWA 1T44A 4CGDA 3ILJA 3WQUA 2HBZB 2UVWA 2HURA 3BREA 3QRQA 4CHYA 4IZ9A 2F1FA 2BUPA 2R7RA 3ILLA 2VB6A 1FK9B 5AQQA 1X5TA 3A3OB 2VC1A 3FFIB 3FEYB 4FPBA 4KB1A 1YJ9S 1OYDA 2VWBA 1N0VC 3EJMA 4WYLA 3UQSA 1J6ZA 4ED2A 1NGHA 2VG5B 4DG1A 4Z7YA 1S9FA 2UV8G 3BPDA 2HZCA 1P90A 3HPHA 3VA0A 3RBEA 2B9XA 3OBIA 5DDOC 1I3AA 3KHGA 1B70B 4DU3A 2CQ3A 3FFIA 4OLBA 4C98A 1FWKA 4W98A 3SI6A 1YLXA 3BGRB 1IKXB 1NXIA 1FJ7A 3O80A 2VG5A 4KI4A 1KXPA 4CLLA 3CCLS 2CRLA 2QFIA 4OQJA 4DV3F 4TYAA 2O1PA 4OHVA 5AFUA 1SUQB 4KSEB 4B3RJ 3AA4A 3LP0B 4FK4A 2C2DA 2W2NP 1E6YB 4LMZA 3CJQA 1BCMA 3BGRA 1IKXA 3OYMA 1RBOB 2HHUA 2ASYA 1B3TA 2ADCA 3PEJA 4O4GB 4C8NA 4K43A 1WB9A 2HF3A 4FWRA 3GR0A 4K4XA 3N79A 1ZA2B 5EN1A 1SUQA 3LP0A 1TKXB 2F40A 1BQNB 3I55S 5CH7B 3DI6A 3NS7B 4V19J 1RWMB 2EKNA 1RADB 4NEYA 4LBPA 4OX6A 3PVXA 2LQBA 5AXMA 4R25A 2ZC4A 2CJAA 2HAIA 2HK3A 3IDHA 2WVCA 1VQKN 3NGIA 5GMDA 5KFWA 3M8YA 2P1JA 5EY4A 1BQNA 2DISA 2MKHA 2FVRA 1KVKA 3DLKB 4L3NA 4C1NI 5KFAA 2GEMA 3IRWP 2D3ZA 3LGMA 4OLPA 2R7OA 3FZ2A 2IYGA 1UJ5A 3P96A 5CZ1A 1ITGA 2WBRA 4R0JA 1CULB 3RRHA 3MAAB 4CIEA 2MYFA 1VSHA 4DPXA 3I5AA 1JLAB 3DLKA 2Q0UA 1JLQB 3LPEA 4LF7J 3HM9A 3NXZA 3CCES 1NGBA 1VQ4S 2EXUA 5CCMA 3H20A 4K0KJ 4PG8A 3QSYB 1HKAA 5F8LA 5AJ3F 1VSJA 1Q18A 3J7ZO 2QWQA 3TSQA 2W9CB 3K7RA 4ZIVA 1CULA 2KDOA 4WIQA 1JLAA 3CC7N 1JLQA 4KH1B 5H9EK 3A3NB 4U7BA 1QVGM 3MPUB 4NE9C 1YRXA 5HQ8A 3VQ4A 1U09A 4AQYK 1VQ9N 1IQTA 4NLOA 4QIEA 1YQHA 3KKFA 5KFPA 2ZQBA 3OYLA 4MKAA 5LMUJ 4C3MA 3O8WA 3H3OB 4NXNF 3O1WA 5AR0A 2W9CA 3U02A 4C1NK 1MNEA 3TX8A 1D9AA 4XAKA 2YKOA 5FD1A 1IBMJ 4AHRA 2IVMA 4B9LA 3KKSA 1N32J 3P1GA 1YITN 4RG8A 4Y28C 5CHCB 5FPMA 3FLCO 2HLUA 1BDGA 1M0SA 3KWGA 3FGUA 1HD0A 5F9LA 2W25A 4UZBA 4UOCA 4WFBQ 1T11A 4YS2A 5LL6d 1QAXA 3TEHB 3C14B 4N5SA 1N54B 3EPIA 4OYWA 2J6SA 3ZO7A 5HAOA 2OIHA 3DLJA 4CJ3A 1RYRA 4ECZA 2E6MA 2GO9A 3GG1A 3MR5A 2MKYA 1NBEB 3T1YF 4CEQA 2DHXA 5J2PB 4N7TA 1RT6B 1UAXA 2F7TA 1XMBA 1CJKA 4RW8B 3PYFA 4L3KA 2DNLA 1SC4B 2PGCA 4JI6F 2Q3PA 4DV1F 3DHWC 3C14A 1KC8O 2R7YA 2BM1A 3G6YA 2IDOA 2RDJA 4CVNE 4WQ5A 2W1BA 1M1KO 2MQMA 3CCQS 1XBWA 3AH6A 3X1LB 1IR2A 3TANA 4G1PA 4A8FA 2DR9A 2E44A 1HI0P 2CQ1A 2K06A 3PSFA 1RT6A 1S12A 1PO6A 4LF9K 5L39A 3FSYA 3K57A 2OYQA 4RW8A 4DUYJ 1J5OB 1WORA 3MCMA 1ZTWA 5KT2A 4DSJA 1B64A 3QIOA 2VGNA 2V50A 4JS5A 1FHTA 3F2KA 2OTLN 1WOQA 2YKPA 3KWMA 1NJZA 2B4PA 2F7VA 1XI1A 1RTJB 5LXRA 3MGJA 3DLHA 2QA2A 4CGHA 1YJWN 2EC2A 3PKMA 4WP8A 4EZ6A 4F3TA 4A5AA 2YKMB 3OYFA 2NRVA 4NZ6A 4XIUA 3QATA 2E1AA 4WFBL 4H5NA 3QLHB 1SQKA 2E1RA 4QIVA 3HP6A 4UTGA 1J2VA 2AGPA 1RTJA 2QMWA 5M1KA 3BGLA 2BKNA