4NCGA

Discovery of doravirine, an orally bioavailable non-nucleoside reverse transcriptase inhibitor potent against a wide range of resistant mutant hiv viruses
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
556
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of MK-1439, an orally bioavailable non-nucleoside reverse transcriptase inhibitor potent against a wide range of resistant mutant HIV viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/inhhibitor, hydrolase/inhhibitor
total genus 165
structure length 553
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ncgA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ncgA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ncgA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ncgA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ncgA05
4IG0B 5KG4A 2ILZA 3KLVA 2JC1A 2RKIB 5KT2A 2VG6B 3N6LA 5C24B 1JIHA 2HHWA 2AGQA 3ZSYA 3L2VA 3V6HA 3H40A 4H4OA 1JKHB 1IKYA 5KFIA 1VK0A 2DFHA 4ZP8A 2X78A 3ASMA 2HMIB 4K4SA 3OYAA 4CK2A 4GW6A 3IN5A 1RT6B 3O3GA 4E0DA 4KB1A 3SUPA 3LPTA 3GIIA 3AA5X 2IJNA 5DG8A 2HAIA 5KFBA 2IBKA 4DQSA 4JRQA 5KFCA 4DF4A 1RBUA 4Y2AA 3TARA 4IRKA 4DTPA 4LH4A 2WB4A 2FBYA 3VQ6A 5KFYA 4K4WA 4K4ZA 1RDDA 4DTNA 2E9TA 1TL3A 1DLOB 2UUWA 3UQSA 5SZTA 3MR2A 2AQ4A 2IAJB 3PW2A 2XCAA 4KV8B 3H4BA 1YTAA 4FLTA 1TKZB 1RT4B 4DSIA 5J2MB 1RYSA 1S1WA 5C5JA 1S0OA 4BWJA 4IG0A 3SQ0A 5KRTA 4CGJA 3NFAA 2FVRA 2RKIA 4Z4IA 3T5LA 5L9XA 5C24A 2ASJA 2OH2A 1B92A 3L2WA 2F8TA 3M8SA 4KFBB 3OYFA 3OYHA 4FJNA 1JKHA 1S9GA 3NCIA 3KHHA 4H54A 3S3NA 3V1QA 4LSNA 1QE1A 3QZ7A 2AJQA 2W42A 4BWMA 4KHWA 3LP3A 3ZSOA 4O44B 2P5GA 4WXOA 1L5UA 3PZPA 2D0BA 1I6JA 3FFIB 1SH3A 3I0RB 4CHZA 3BSAA 4X2BA 4AHSA 4DG1B 2JEIA 4FM0A 4FXDA 5FDLB 2R8JA 1LWCA 4CFAA 5JUMA 2IAJA 4KV8A 1GOBA 3KIOA 3AVBA 1RT4A 4PY5A 3ZT4A 1HARA 2HNZB 4C8OA 1TAQA 3DMJA 1EP4B 1RDRA 2X6SA 3DLBA 2HHSA 4M3WA 5SWMA 4DQRA 4KREA 3OJUA 4KSEB 4I2PB 2WCXA 3SYZA 1CZBA 4ZTJA 4KFBA 3TQ1A 3OLBA 1NOYA 2LSNA 1VRUA 4DU4A 2YNIB 2XY6A 1LW2B 3Q8PB 2WONA 1IG9A 4IRDA 4Z4FA 4CHYA 2R8HA 4CGFA 4WFXA 1Q9XA 3FFIA 2XY8A 4J9OA 4ECTA 3KMSA 5KFFA 4DG1A 3BSCA 3E01B 1LW0B 4W5RA 3CFPA 1O1WA 4F4WA 3V81B 4TY8B 4N41A 1QAIA 3TI0A 4Q8EA 2FJXA 4FW1A 3DLKB 4JLHA 2A1RA 1HQUA 3KK2B 1EETA 1S0NA 4ICLB 5F8MA 3HXMA 4O3PA 4B3OB 3M8QB 1GOAA 4HCBA 1S1TB 4R0EA 3HPOA 3OLAA 2KFNA 1RDAA 3G6XA 4E19A 5T7BA 3F9KA 4CEEA 5HP1B 5CZ2A 3QINA 1Z4UA 4I2PA 3DLEB 3ITHA 3K5MA 3O4QA 3FSIA 5T14A 4G3IA 1X9SA 3M9NB 4H4MA 2KQ2A 2P1JA 2G8FA 1Y97A 3HYFA 5HRSA 4NRTA 1LW2A 1KVCA 4E7JA 3D5MA 1S49A 3CJ4A 2XI3A 4DS5A 3VQ7A 1BCMA 2D0AA 4JS4A 3SFGA 2WTFA 2AU0A 5KFDA 3MTKA 1CLQA 4FJGA 1DTTB 3Q8SB 4H8KA 3BDPA 4Q45A 3SFUA 3E01A 1LW0A 3HO1A 4KRFA 3KK1B 1SUQA 3PX4A 4CJ5A 4KHQA 1RA6A 3QYYA 3EPIA 4TY8A 5F8LA 3ULDA 3MEDB 4NCGA 3DLKA 2FJWA 4MK7A 4FJHA 3C6UB 3GIMA 3KK2A 2ZKUA 4DLGA 3LANA 2E4LA 4ICLA 4K8ZA 3NF7A 1TGOA 4NLDA 4NCBA 4B3OA 3M8QA 2R8KA 2YNFB 4DL5A 1J9AA 1A5WA 4Q5VA 5D3GB 5EWFA 4KBIA 5J2QB 3NF6A 4NLPA 1D5AA 3SCXA 4OLAA 1WSJA 4WFZA 3AO2A 4KAIA 1NK9A 4DFJA 3JSMB 2UUTA 4W5NA 4FW2A 3BSNA 1K1SA 1VSHA 3G6VA 4R5PB 1W25A 5KG6A 2FLLA 4IR9A 4ELUA 4FCYA 2V4QA 1CZ9A 1I39A 4CJRA 3SJJA 4NRUA 4FK4A 1JX4A 4ELVA 1DTTA 1HYVA 2RN2A 3SQ2A 4FJMA 1ZBFA 5DQHA 2HHXA 4ZVGA 2HVHA 3ZT3A 2XRIA 4IH7A 5C42A 1NJWA 4CGGA 4KHNA 4CERA 4ED1A 5EUHA 1NOZA 2ZQBA 1IM4A 1U09A 3AVGA 5KFQA 4TY9A 3TAQA 3TAMB 1T7PA 1HRHA 1RT3B 1KTQA 1GOCA 4O4RA 4EEYA 1LWEB 3LZIA 5HLFA 1C0MA 4E7LA 3D45A 5KFEA 3FQKA 1SV5A 1WAFA 3V9SA 3DRSB 4M41A 3RB3A 2IC3B 4CIEA 4FLXA 1W0HA 3MEEB 4R5PA 3UR0A 5KFPA 5JXSA 3PJXA 2ATQA 4RUAA 4CJTA 4DSFA 3H5SA 4ZPCA 4FK2A 4NLQA 5KG1A 3MFHA 5KFLA 2VWKA 5I42A 2BRKA 1B9DA 4LY7A 2C2DA 4PWDB 4AHVA 1WSIA 4B9MA 2OPQB 4I9LA 3F73A 3QNOA 1RTDB 4AILC 4ELTA 3HPGA 1VSDA 2BE2A 3RMDA 3RBDA 4KO0A 3SQ1A 1VRTB 4IG3A 3KK3A 4MQ3A 3WNFA 2YKNB 3T1AA 3SPYA 3OYKA 4AHCA 1RTHB 3OSNA 4WYWA 1A5VA 4CHPA 1L3UA 3RB0A 3DRPA 3OYMA 4AHRA 3LP2B 3MEEA 3GYNA 3VQDA 4CJEA 3PVXA 3KLGB 1S6QB 2BQUA 4QW9A 3CM5A 2R8GA 2D3ZA 1RTJB 3NAHA 3DRRB 2BANB 1HPZA 1D1UA 5KFZA 3I0SA 3VQPA 4HCCA 1C6VA 1CXQA 3OYNA 5HBMB 4J2AA 1HYZA 3KLFB 4I9QA 4KI6A 2UVWA 3ZSVA 4TXSA 4C8MA 2OPQA 2B43A 3DDKA 2CKWA 3PW5A 3BSOA 1Q9YA 2PY5A 2OPSA 2FBTA 1KFDA 1YTUA 3HVAA 1LV5A 4J9NA 3AVFA 1KVBA 2YNHA 4EYHB 4B9LA 4DFMA 2YKNA 3QEIA 4CEBA 4F50A 2G8HA 3EPGA 5HRRA 1JLFB 4IFVB 1S6PB 3SPZA 1NK7A 3L3UA 1RTHA 4KB7A 4ZVEA 3CJ3A 2IA6A 2IM1A 4K4UA 1JLBB 3M9OB 1JLGB 3IGNA 4KHRA 3OY9A 4YR2A 3AO1A 3QESA 3BGRA 2GIRA 3H98A 1ASUA 3TR8A 1WN7A 4LQ3A 1BQNA 3KLGA 3AA4A 4K4TA 1XR7A 4O3SA 4C8LA 1RTJA 4M42A 4FZXC 4Z4GA 3DRRA 1JLEB 1N5YB 1C1BA 4XPEA 1JXBA 4F8RA 4CEQA 2Z1HA 1IKVA 3CJ5A 5KT7A 5KG5A 1QHTA 4URQU 4FJIA 4E7HA 2B6AA 3KLFA 3V9WA 4RNOA 3QO9B 4ECUA 4WZQA 5HRNA 1FK9B 2AX0A 5KFOA 3CQ8A 5L1IA 4JS5A 3V1OA 1QSSA 3AO5A 3L2UA 3BQ2A 4RZRA 4FLUA 4QWAA 4AHTA 1X1PA 4CJUA 4CFBA 1RBVA 3VQBA 4GC7A 5E41A 3V6DA 5FRNA 4MFBB 3KLEB 3KTQA 3QLHB 3O3HA 2F8SA 1EKEA 1X9WA 4MKAA 3T5HA 1JLAA 4N76A 4J2BA 2FVCA 2R2UA 3V1RA 1C0TA 4BE0A 1S5JA 1JLBA 3RTVA 4NLYA 3VQSA 5KFNA 3HPHA 2XY7A 1T05B 3NF9A 4IFYB 3IS9A 1VSLA 5KG7A 5KFHA 3D0PA 4KHUA 3LP0A 1RTIB 4FLZA 4IRCA 2OA8A 1RT7B 3QIPB 3EZUA 4B9SA 1DTQA 1SKWA 1UA0A 3DOLB 5KFAA 1NK5A 4EZ6A 1L3VA 4CF0A 5EDWA 4LH5A 3IG1B 1XR5A 2FJVA 2BRLA 1C1CB 1S1XB 4DTSA 3CDWA 1S10A 1NK8A 1D9FA 4DMNA 3QO9A 2OYQA 1JLCA 2ILYA 2B5JB 1QSLA 3MECB 1RBSA 1NKCA 4RW6A 3AA3A 3OL9A 2HNYB 1VSIA 4CJWA 4LD0A 2ASLA 1T8EA 2VG6A 4C8KA 3P1GA 4MFBA 3RB6A 4CEOA 2UVRA 4NLTA 3LP1B 1XWLA 3NL0A 3DYAB 4DSLA 2HMIA 2I5JB 4CJFA 3ZSXA 3K59A 1RT6A 3JYTB 1YVUA 1C2PA 3V9ZA 2VA3A 3TAFA 3C6TB 3WNEA 3NH0A 4M94A 2G8UA 2NUBA 1T05A 2WOMB 5F9NA 4IFYA 1NNDA 5F8HA 3A2FA 5DK5A 1ZBHA 1Z26A 3NBPB 1UOCA 2WRMA 4IDKB 4Z4HA 4CGIA 1XHXA 4LSLB 1DLOA 4EBCA 4M3YA 2C28A 1S1XA 4ED8A 3P5JA 3NGYA 3EY1A 3V6KA 1TKZA 4RW9B 4DL4A 3Q8RB 1K6YA 3ZT2A 1N56A 4E1NA 2D5RA 2B5JA 4FJ7A 3KD5E 3QEPA 5J2MA 3B6OA 4NYZA 5EWGA 4Y2CA 3AA2A 1RT5B 1S9EB 3L2RA 4DL2A 1BGXT 3PO5A 3NH2A 4ECSA 4O3QA 4IBNA 4MK9A 4F4ZA 4CF1A 2W9CB 4KAZA 4KKOB 2PYLA 4HKQA 3LP1A 2IOCA 4HVJA 2W7OA 4DSKA 3OS1A 2HHUA 2C2EA 4F4KA 3H5UA 5KT3A 3JYTA 1MU2B 2IM2A 3HJFA 3PUFA 4CEFA 3OYJA 3C6TA 2YV0X 3QIOA 4O44A 4F3TA 3DLHA 2O4IA 3RWUA 4HUGA 1TP7A 4E89A 3RAXA 3C95A 3I0RA 1T3NA 2D7SA 3QEXA 3DM2B 4F4YA 3DOKB 5FDLA 3CG7A 4ZP7A 3ALYA 1RBTA 4DEZA 3FQLA 1HNIB 1U45A 5F8GA 3CWJA 3RBEA 1NJZA 1QTMA 4B08A 2JEJA 4DQQA 3T5JA 4DQPA 2HNZA 2HHQA 4CEAA 3BR9A 4JV2A 1TKTB 1UAXA 1EP4A 2O5DA 1RNHA 2J6TA 2RF2B 3OYBA 3M8PB 4DU3A 3QERA 4TYAA 3WNHA 3GQCA 4CF9A 2YKMB 2R8IA 5HRPA 1IH7A 2YNIA 1BIZA 2KZMA 3I8DA 4EBEA 1NK6A 4DL6A 5KT6A 2XI2A 4U6PA 3IRXB 2DY4A 3TABA 1FXXA 4DTMA 3AVNA 4FZYA 5DQGA 1RA7A 1IKWB 1C0UB 2OZSA 2ZE2B 3OVNA 1BL3A 4DTRA 1JXEA 1SH0A 1U4BA 3LPUA 2GIQA 3V81A 2HHTA 2DFFA 5KFGA 4NLWA 3NGIA 4W5OA 3OHBA 4HHTA 4BDYA 5J2PB 4EO6A 4FS2A 3HSTB 5HROB 2G8WA 4Z0UA 1S1TA 5KI6A 4DTXA 4DS4A 2ZD1B 3MR5A 2F96A 5HP1A 2RF2A 4NLUA 4J9MA 4O55A 5DG9A 4M3RA 3DLEA 2X6NA 3H5YA 3RMCA 1GX5A 3RMBA 5KT4A 3PO4A 3I5BA 2D41A 1HQEB 2DPIA 4JV1A 4FM2A 2YNGB 4QWEA 3HVWA 3NMAA 4NLRA 2QXFA 5DLFA 3DLRA 2UVUA 4Q43A 3CIZA 3KHLA 4ECQA 3U3GA 1XR6A 4BDZA 3G10A 4TLRA 4QPXA 1I3AA 1C0UA 1T03B 4TQRA 5KFRA 1TV6B 4XPCA 2XHBA 3PW0A 1IKXB 3NHGA 3KK1A 1SL1A 4OKKA 3E51A 2HVIA 4G1QB 2P5OA 4J9QA 5J2NB 1S0MA 4B9NA 3MEDA 3T3FA 3KLHB 4F2RA 3SV4A 4MIAA 5J2PA 2KZZA 3C6UA 4OPKA 4FLYA 3HVTB 5CYMB 3FRZA 1SKSA 2YNFA 4IH5A 2W9AA 3L2QA 2KTQA 4ZPBA 5D3GA 2ZD1A 2W7PA 4O0IA 5DLGA 4KB0A 3AO3A 5J2QA 1SKRA 1ZETA 3MEGB 2HHVA 1TKDA 4KPYA 4ZPDA 4J9LA 3N6MA 1HQEA 2DFEA 3K5NA 3LAMA 3OJSA 1WSFA 4I2QB 3JSMA 4DF8A 4YR3A 1REVB 4IKFA 1QAJA 5L1LA 3QNNA 3IGVA 5KFJA 4R8UB 1TK5A 3LWMA 4Z4CA 3EYZA 4FBUA 2AX1A 4Q0BB 1S4FA 3CVKA 3I5CA 3KHRA 1B9FA 4PUOB 3M8RA 3HM9A 4EYIB 1TV6A 3TAPA 3AVHA 1IKXA 4WXWA 1SH2A 1S97A 1KCFA 2WHOA 1BHLA 1LWFB 4Y34A 4G1QA 3TANA 4B8AB 4O3OA 3S9HA 2Z1GA 4PQUB 1J5OB 3PHEA 3KLHA 1BI4B 1N6QB 5F8NA 1HYSB 1S1UB 3TAMA 1RT3A 4FJXA 1JL2A 3HVTA 2B4JA 5CYMA 2J6UA 4OVLA 4NCAA 2E6LA 4UQGA 3QGIA 3DLGB 2HWIA 4RW8B 3QEWA 1EXQA 4KHMA 1LWEA 4WZMA 4YMEA 4OL8A 3VA0A 3CDUA 2IM0A 2E6MA 5KGWA 1U48A 4YQWA 1ZYQA 3H4DA 4I2QA 4OJRA 2CJQA 3DRSA 4HYKA 2IC3A 3I5AA 1RT1B 4O4GB 2HNDB 4WE1B 1D9DA 3VQAA 5I3UB 2JEGA 4OKEA 3ZCMA 3S3OA 3MXJA 4MKBA 1U47A 4IOBA 3TAGA 3ZT0A 4I7FB 1Q8IA 2PZSA 2D3UA 1WLJA 3RB4A 4PWDA 1OS5A 1KLMB 3AVCA 2XGQA 2JEFA 2V9WA 3AO4A 3CDEA 2JLEA 3SUQA 5KFKA 4CFCA 3CO9A 1RTDA 4FK0A 1KHWA 2FLNA 1BI4A 1S1UA 3MFIA 1RILA 5KTQA 4OLBA 1VRTA 2J6SA 4J2DA 2IDOA 4CF8A 5J1EB 2OPPB 3DLGA 3VQ5A 3PV8A 1QSYA 3OHAA 3OYDA 1TKXB 3GV5B 3OYEA 4IH6A 1ZBLA 3EZ5A 3PX6A 1YT3A 4IR1A 1K1QA 4FM1A 4FYDA 1JL1A 3LP2A 4ZP6A 3S3MA 4CJLA 2W8KA 1RT1A 4XO0A 1ASVA 4WE1A 1IKYB 4QCLA 4FBTA 1S6QA 1HJRA 1IO2A 2V0NA 4KTWA 5F9LA 5DMRA 2BANA 5DGBA 2IMWP 5HBMA 1SL0A 2Z1JA 3ICLA 4F3OA 3ZT1A 1KLMA 1WSGA 3KD1E 3B6PA 1BISA 1BQMB 1ZTWA 2IM3A 4M3XA 1C1AA 2D0CA 2W8LA 4ED3A 4DSJA 1NHUA 2E9ZA 1TL1B 2R2RA 3U3YA 3L3VA 1TL3B 3K2PA 2DPJA 4RW4B 5J1EA 4E1MA 4W5QA 3UIQA 2R7YA 2OZMA 4FZZA 4NLVA 4EP5A 4DL7A 3MXMA 3VQ9A 4M3ZA 1S1WB 4DTOA 4FS1A 1JLFA 4IFVA 3MR6A 1S6PA 3GIJA 4U7CA 4O3NA 2C2RA 1YVFA 1RBRA 4HUEA 2PYJA 1JLGA 1U49A 5KG3A 4CK1A 4CJ4A 2BQ3A 4QWCA 3SZ2A 4IQXA 3NGZA 4FJ9A 1S9GB 2GC8A 4CK3A 3GIKA 3AV9A 1KRPA 4CF2A 4RW7B 1JLEA 3ZSRA 1N5YA 4FJJA 2RDIA 5CY4A 3BQ1A 3HP9A 3LDSA 4LSNB 1TVRB 1QE1B 4ECXA 5JS1A 2O4GA 4HTUA 3AVIA 4MIBA 3KKSA 4RG8A 1FK9A 1NKEA 4YP3A 3AVKA 4AHUA 1HNVB 2G8IA 1KLNA 3V9XA 4KHYA 1BQMA 1SL2A 1S1VB 3NF8A 2FBXA 1TL1A 4GC6A 3QEVA 1LWCB 1UA1A 4RW4A 4CHNA 1A5XA 1RT2B 3QGGA 2XGPA 1CXUA 1U04A 3KLEA 1NJXA 3QLHA 1L3TA 5KG0A 4ECZA 1ITGA 1QS4A 4OKJA 4CJ3A 3V4IB 3DMJB 4JV0A 2QE5A 3RAQA 3SI6A 1X9MA 3CFOA 3HK2A 4CHOA 1VRUB 3LALA 4M45A 1RTIA 4RNMA 4J9KA 1RT7A 3QIPA 4OPJA 2ITGA 4RW7A 4CJKA 4DL3A 3DOLA 2WONB 4O5BA 3H08A 1TVRA 1HMVB 3P83D 2YHBA 4B9TA 3IG1A 4K8XA 5DQIA 1C1CA 1GX6A 4N56A 4KTZA 2R2TA 1J54A 2Z1IA 4DU1A 2V4RA 3NH1A 4XIUA 5FROA 1HNVA 5C25B 4B9UA 3BQ0A 3MECA 3LAKA 1S1VA 2VA2A 4ZTFA 2IJFA 2HNYA 3NAEA 2AGOA 4CESA 4GVMA 2QKKA 2QK9A 2XCPA 3GV8B 1FKOB 3TWHA 1RT2A 4CGDA 3OL8A 2OPRB 4ED6A 4Y3CA 4ED0A 4TYBA 4FJKA 1JLQB 4EZ9A 2HW3A 1HQUB 4NZ0A 4RNHA 1EETB 3DYAA 4ED2A 2P51A 2I5JA 4DQIA 4TQSA 3V4IA 3HVRA 2AWZA 4CCHA 4WFYA 3ITHB 2WOMA 2GV9A 1R0AB 1T94A 4RNFA 4H4MB 5KFUA 2XWYA 4K4VA 3BJYA 3NBPA 4LQ9A 3O4NA 3MF5A 2KW4A 5CZ1A 3PW7A 3VQ8A 5JS2A 4IDKA 1KVAA 3N6NA 1HMVA 3FDSA 4DTUA 1NK4A 3OYCA 1KSPA 3AVMA 4LSLA 4CJSA 4ZMMA 4J9PA 4PA1A 3RR8A 1QUVA 4RW9A 5C25A 4FJLA 3THVA 4L8RB 4RUCA 2F8EX 4DFKA 1NHVA 3C94A 1RT5A 1SUQB 1S9EA 4ID5B 3SUNA 4QW8A 5F8JA 3PX0A 1FKOA 4ECYA 2W9CA 4KKOA 2OPRA 3OS0A 1ZBUA 4NCGB 2IGIA 4CJPA 1JLQA 1Z25A 3VQCA 4ZVHA 4BDPA 3KJVB 3OL7A 3PY8A 4M95A 3NE6A 5K14B 1WSEA 4DWIA 1MU2A 3CFRA 3G6YA 2HWHA 4KI4A 4K50A 2Q3SA 3G86A 4KHSA 4URSA 1R0AA 3NKYA 4DTJA 1TK0A 4TN2A 2EX3A 3MR3A 3QIDA 4MH8A 4CE9A 2KFZA 1RYRA 5KGXA 2GBZA 1VSMA 1TK8A 1ASWA 3DM2A 3DOKA 3K5LA 2FVQA 3M9MB 3ISNC 1HNIA 2RDJA 3KNAA 5KRSA 3K57A 3TVKA 1RCHA 4E7KA 2XO7A 4J9SA 3OYIA 1D8YA 3OS2A 4M3TA 4C8NA 3CJ0A 3GV7B 1TKTA 3GILA 1UWBB 4N5SA 4J2EA 4ID5A 3OL6A 5C42B 3M8PA 4BE1A 3SV3A 4BE2A 4O3RA 3AVLA 1S9FA 1EX4A 3ZSWA 1KHVA 3PR4A 2BR0A 2YKMA 3RR7A 3KJVA 3PR5B 3AVJA 4DLEA 3TAEA 3KKRA 2G8VA 4ED7A 5DGAA 3RRHA 4K4YA 5K14A 4M3UA 4CJQA 4CFDA 2ETJA 4Z4EA 3IRXA 4F4XA 5HLFB 4B9VA 4YNQA 3WNGA 4O0JA 1VSEA 1WAJA 3OSPA 4CGHA 1SV5B 1IKWA 3HL8A 4KTQA 2ZE2A 1WNSA 1W9HA 4Q44A 2HB5A 3OYGA 2VG7B 5KFMA 3QETA 3LWLA 3RMAA 3KLIB 3CYMA 4N47A 3CM6A 5FRMA 3QZ8A 4NLGA 1XI1A 2FVPA 1XHZA 3K58A 1FKPB 3SUOA 5KT5A 2ALZA 1XC9A 5HROA 4RU9A 2W9BB 3HT3A 2VG5B 4ECRA 5I42B 1UWBA 2ASDA 4CJVA 5F8IA 1KFSA 4ID1A 3SQ4A 4ECWA 4YFUA 2Y1IA 4FJ5A 4ZVFA 2GUIA 2BE2B 3T19A 2ATLA 2X74A 4KO0B 3HP6A 4IG3B 2YNGA 4QAGA 1D0EA 4E7IA 4CIFA 3UDLA 3OYLA 1J53A 3KK3B 3VN5A 4NYFA 2BQRA 4DSEA 2BDPA 4FLVA 4W5TA 1T03A 1QQCA 3DRPB 4IKAA 3DI6B 3NDKA 1TAUA 2VG7A 4ZHRB 2AGPA 3ZSQA 2EC0A 4B8CA 2BGGA 1NKBA 3KLIA 4Q8FA 4K4XA 3CJ2A 4WYLA 4ZP9A 4JRPA 5J2NA 1S48A 3KOAA 1HPZB 2A1SA 3O3FA 5KFVA 3I0SB 1FKPA 4URGA 2XY5A 1LAWA 1NJYA 2W9BA 4J9RA 1VSKA 1N48A 2VG5A 2WK4A 3PJWA 2EHGA 4JUZA 4YR0A 3Q8QB 4GMJB 2R2SA 3PW4A 1F21A 2FLPA 3MEGA 1L3SA 4HUFA 1VSJA 2OPSB 3VA3A 4EBDA 5L1KA 1BIUA 4OGEA 2DTUA 5KFWA 3SNNA 1REVA 4MK8A 2YHAA 3K5OA 2YNHB 1BCOA 1CSJA 5KG2A 4CIGA 5KFXA 4R8UA 1WNEA 2RPIA 4Q0BA 4FJ8A 3H59A 3V6JA 3KMQA 4CHQA 4E3SA 4F2SA 2FBVA 3SI8A 4PUOA 3MXIA 1N4LA 4NLOA 2VWJA 3NAIA 2JGUA 4QWBA 3HHKA 3DI6A 3BGRB 4BACA 4ZHRA 5KFSA 4TSXA 4Y1CA 1BQNB 4RNNA 1LWFA 5L1JA 4ZPAA 4EP4A 3G0ZA 4DFPA 3UPFA 4PQUA 5EU7A 1J5OA 4NLSA 1C1BB 1VSFA 1N6QA 1ZBIA 1HYSA 1IKVB 1NK0A 1ZTTA 2B6AB 4RW8A 5CYQB 1LAVA 2Y1JA 3T5KA 3U6FA 4OGCA 3ZSZA 4QOZB 5KFTA 4NLXA 3H2LA 4KE5A 5DG7A 3NGDA 4O4GA 3V6DB 2HNDA 4H4OB 3VQEA 2FVSA 4NYNA 3MAQA 1WSHA 4FLWA 2JC0A 5I3UA 2UVVA 3AVAA 1G15A 1JLAB 4CEDA 3H5XA 4I7FA 3LZJA 1C0TB 3HKWA 1RDBA 5EWEA 4FVMA 4CEZA 3VQQA 2XC9A 4CECA 3IAYA 3KHGA 2QV6A 2E9RX 1MMLA 3V9UA 3IS9B 2IS3A 3LP0B 2I1RA 4ECVA 2FC0A 1DTQB 2G8KA 3L8BA 3ISND 3VQ4A 1TQLA 4AH9A 3D28A 1RAJA 2OPPA 2C22A 1JLCB 4Y1DA 3RRGA 5CYQA 4EO8A 2QKBA 3BREA 1TKXA 4QWDA 1JXLA 1RDCA 3QGHA 4RW6B
chains in the Genus database with same CATH superfamily
2QMWA 3KLVA 2DNKA 2RKIB 4CIOA 2VG6B 3WIUA 3TA0A 1JIHA 3CQYA 1IR1A 4H4OA 1U0SA 1JKHB 1IKYA 2CQHA 5KFIA 2ZFHA 1VK0A 1RLDA 4WTOB 4OX7A 4FYYB 2WVEA 3EMTA 4CK2A 1LK7A 4BREA 1RT6B 3M2UA 2DIUA 1U02A 3O3GA 2XLJA 3FLCO 1Q4RA 2UUBJ 5DG8A 2HAIA 2EFPA 1EWRA 1RBUA 1JXVA 1FE4A 4J37A 3RGIA 2ZZMA 2MZSA 5KFYA 3BF4A 1K9MO 2PE8A 5LMUJ 2PDAA 2NZ4A 2O01C 1QUPA 3HSZA 5ETVA 3OVSA 3SDEB 3CCLS 1MWKA 3PW2A 1UZHA 5G4DA 2QLJB 3TSUA 1YTAA 5B8HA 1RT4B 1N36F 5J2MB 1FX4A 3OPKA 4UZCA 4CGJA 3WC0A 5L9XA 1B92A 3OVBA 1NMEB 2MJUA 4UY8T 3OYHA 4F0KA 5DJBA 4H5RA 4A2BA 5AT1B 3Q8UA 3S3NA 2QMXA 3VPZA 3V1QA 4LSNA 2HFZA 1QE1A 2AJQA 1K44A 1Y5LB 4PKIA 2BM1A 4LF5J 1OSCA 2RIJA 4BRNA 2Q43A 5F3ZA 3U9DA 3BSAA 3R8YA 4DG1B 2LDIA 4HI2A 1B0TA 4FM0A 5FDLB 2R8JA 1LWCA 2CRLA 3J8AA 2VPZB 4QR2A 4Y28C 3A12A 4JI6K 3KIOA 1JQGA 4WK3A 1N32J 4ZLNA 3HRGA 3FZMA 4B3MJ 2DNGA 4X66F 1TAQA 1VQYA 2GHPA 1EP4B 2HEKA 1FNMA 4KREA 3SYZA 2UXCJ 1CZBA 4ZTJA 3KUHA 5GADI 1YJNS 3CC7N 2KN4A 3CJ8A 2M88A 3PIOQ 1IBKK 5B0BA 4JYAJ 1LW2B 1H38A 4ZVOB 4CLTA 4MO5A 1U7LA 4DV1K 1T9UA 1JNZB 2R8HA 2LQBA 3BV8A 1Q9XA 3MAHA 3FFIA 2DGTA 4FP9A 5A8RB 2ZH1A 4J9OA 3TZYA 3SCJE 4A5AA 4USIA 3KMSA 1KD1T 3SSSA 5EX0A 3E01B 4X64J 5LL6d 3TNVA 4EUVA 4F4WA 4ZITA 4FW1A 3TEHB 1EETA 1S0NA 4JI8K 4ICLB 2XWXA 3LGHA 1VLOA 3MPVA 1R8CA 2UZAA 3HPOA 3OLAA 5T7BA 1ELOA 5HQLA 4AQYF 1HFEL 1VQNN 2V4JA 4CZHA 3DLEB 3D3BJ 3J81O 3O4QA 5AQKA 1YBTA 3VGLA 4XEIA 1FX2A 5AZIB 3HYFA 4NRTA 4E7JA 3DGPB 3VAKA 3CJ4A 4IQMA 1RKJA 2DISA 4DS5A 4C11A 3VZIA 2MZ1A 1KAYA 2DO4A 1Y7PA 3TSQA 2VFRA 3PRBA 1CJUB 4H8KA 2W4CA 4ETXA 4CJ5A 1X5PA 1GMWD 2QWLA 3ULDA 3DLKA 2FJWA 2CQBA 2E4LA 1TL4A 3TW0A 3M8QA 3CGIA 1HW8A 4DL5A 3B82A 1J9AA 1YBAA 3GCWP 2BJ1A 3QB0A 2NRWA 1PAUB 3LM2A 2BX6A 1GLAG 4KBIA 2PT0A 2JVOA 2RH3A 3CB4A 2MKIA 3NF6A 4NLPA 1WC3A 4OV1A 3Q2TC 2VCPA 3GU0A 5JLFA 3LH2S 4USKA 4OX6A 4L74A 1M90O 3Q24A 4FW2A 3CJTA 2R9LA 1K1SA 4Y2IA 2UUCJ 5GADP 4RWWA 3OFHA 1ZM3A 1R7IA 3NRBA 1I39A 2J9DA 1HYVA 1L3KA 3G6EN 2XYGB 3B8AX 1I94J 3RRKA 2KL8A 2HHXA 4KH4A 2HVHA 1UAWA 4IH7A 5C42A 1NJWA 3BO2A 2LCWA 3VEOA 1J2VA 2PO4A 1OQ3A 3D1OA 2HVZA 2YJFA 4MJKA 1J5EK 3TAMB 2DGVA 1KTQA 3W9IA 4BHQA 2ZBCA 1NBEB 1P9QC 2XQCA 3LPYA 2W4DA 8ATCB 1O6XA 3PYGA 1RP5A 3H25A 5LMNF 2QEXN 4CIEA 1TMMA 3R1LA 3MEEB 4LF4F 1HNZK 2O8DA 1KNZA 5D4OA 1Y5IB 3Q22A 2W6LA 4NASA 2QI2A 4JHDA 3WEEB 3H5SA 3MN9A 4NL5A 1O5JA 3CC7S 3QMQA 4ZVSB 4JI1J 4DR6F 3MFHA 1VQ4N 5I42A 3W7BA 1B9DA 3W63A 5F1XA 1WSIA 1CJTA 1RCOB 2AW0A 4JKDA 2G2YA 2HBZB 3F73A 1RTDB 4ELTA 1NEEA 1VSDA 2BE2A 2HHHF 3F0NA 3SQ1A 1ZS6A 4IG3A 1S22A 1OH8A 1YRTA 3MPUB 2OEMA 2KHDA 4IWVA 4PXEA 3NNCA 3KK3A 2FIUA 1Z2ZA 3T1AA 4LFBK 3OYKA 4DV7F 2C2KB 3DRPA 4AHRA 5GMKa 2UXDF 1UPMB 4ILJA 3VQDA 5FPMA 4F36A 3G8TA 1S6QB 3C15B 1H0HB 5D4NA 4QW9A 4ZCKA 2ZH2A 2R8GA 2KFYA 1VQNS 5C2GA 2GHWA 1D1UA 1OY8A 3VQPA 3R7NB 4JD2A 1C6VA 1I1GA 4F4AA 2QLWA 1IBLJ 3KLFB 4I9QA 4KI6A 5AQOA 2QA1A 1M1KO 3PW5A 3UKRA 3BM7A 3ID8A 1RWKB 4OLOA 1TUGB 1KFDA 1ZPWX 5IV4A 1I5OB 1OJ4A 4LRBA 4UOCA 3EDQB 3F9MA 1LV5A 3GPAA 4J9NA 4NXNK 1AXQA 1KVBA 3G25A 2MQPA 2VQFJ 3CF5Q 3MM7B 5HMWA 4DFMA 4GV3A 4IFVB 5GAEI 3CJ3A 4LBPA 2IA6A 1BUPA 3IUCA 5EX5A 2ACYA 2B7CB 4KHRA 4YR2A 2OKQA 3QESA 3H98A 1HR0F 2OSQA 3OUYB 3AA4A 4K4TA 4HTJA 4JI4F 4WIIA 3IDHA 4FZXC 3DRRA 1JLEB 4A8OA 1IBMK 4CEQA 3ILLA 2VOPA 4JI3F 1QHTA 3N5FA 4WZQA 2AX0A 5KFOA 2KJWA 3V1OA 3BQ2A 2HKEA 2O8BA 2HS4A 4CFBA 4ZK7M 4L3KA 2HBQB 3VQBA 3G6ES 3VAIA 3UE5A 5E41A 4LBIA 5KQDA 2AIRB 3KLEB 3KTQA 4CBUA 3GZ7A 4DR1F 5BN8A 3VGVA 4WFBL 3CMAN 3V1RA 4L75A 1LQ9A 4JI5F 1S5JA 3A5NC 3RTVA 3MCSA 4NLYA 2XY7A 3NF9A 3RU0A 4QOTA 3A3OB 3D0PA 3LP0A 2KXNB 3T7ZA 3QIPB 4B9SA 1HNXF 5KFAA 1OH5A 4EZ6A 2B9WA 1Q1KA 5EDWA 4LH5A 2HFVA 3IG1B 2BRLA 4P74A 2NRXA 1Q16B 2Z0GA 1C1CB 1UEUA 3IMXA 2HRYA 4CWBA 3DWLA 3QO9A 4WTYA 2W01A 2PA8D 1JK9B 1X5SA 5D0HA 1NKCA 5DM6Q 4CJWA 2HVDA 3I9ZA 4LD0A 1T8EA 1QVFM 2CDRB 4C8KA 3QT6A 1VQ4S 3W3DA 4CJ7A 2J7WA 2KB2A 4GVBB 3G9CA 3LP1B 2QM1A 4DSLA 5AQPA 2HMIA 3O9UA 3SQOP 3ZSXA 1C2PA 2CPYA 4NLCA 1S7IA 2BTFA 3WNEA 3NH0A 4M94A 3IR5B 1N33J 3VWSA 4OJHA 5GAEP 3A2FA 4XH5A 4KGVB 1ZBHA 4OYWA 2SXLA 4IDKB 4LSLB 4OZJA 3NGYA 1TKZA 3ATVA 4DL4A 3Q8RB 3ZT2A 2ZBIA 2B5JA 4FJ7A 3QEPA 2YH1A 3BF3A 5FLXY 2QG9B 4Y2CA 1RT5B 1BGXT 4DL2A 2HSTA 3FZLA 1MW7A 2F7TA 3NH2A 4MK9A 2LXFA 2AZ1A 2R42A 5F2RA 1NM1A 4KKOB 2PYLA 2J8SA 4MYTA 2YKAA 2FPHX 3OTBA 2QC3A 2IOCA 4HVJA 4DSKA 2FC8A 2HHUA 1XNRK 4F4KA 1HL6A 3H5UA 2NNWA 5K5MA 2V7ZA 2I6WA 3E8OA 2FHOB 3I8BA 3EGVA 2CJAA 3TO8A 1CLFA 4U7BA 5ITHA 4O44A 3DXMA 2AJ1A 3DLHA 4RUHA 2O4IA 2E2NA 4WQ5C 1URRA 3G82B 2QWPA 1Q82T 4ZP7A 3L6QA 2NRTA 1KXPA 4HWIA 5BPNA 1NMDA 3B6BA 1HNIB 1F6TA 5F8GA 2ZC4A 4NEYA 1S59A 3MUMP 1KAZA 2E5HA 3RBEA 1RDUA 2L9NA 5E33A 2KHOA 2JEJA 4DQPA 1FWPA 5LSRA 3VEWA 3VVTA 2O5DA 2RD5C 3HI9A 2MQOA 3OYBA 3CW2C 4LBHA 2QTWA 2CPIA 7FDRA 4YY3K 1IH7A 5KPZA 2FHJD 2ZOMA 2QWOA 3I8DA 1W2BM 3VEZA 2UU9F 3G71N 4OHXA 3CCMN 4U6PA 4RUBA 1CULB 4X4UA 1FXXA 1H74A 4DZ6A 4NLBA 3BYPA 5JVGL 2DJWA 1WF2A 2ZE2B 3MMCA 5GADU 2QFJA 1SH0A 3CMAS 1U4BA 4OX9K 3V5RA 2B51A 2GIQA 4H0TB 1RQ0A 5I4MA 2VPWB 4BDYA 4L76A 5J2PB 3HSTB 5HROB 1HBNB 1S1TA 1DGKN 3MCAB 4PYDA 3MMBA 2RF2A 4NLUA 3AA8A 3KVGA 1NRKA 4DR3J 3L4IA 1RZMA 2D74B 3RMCA 2OHDA 4CTAA 2ZZTA 3PO4A 3RMBA 4B3TK 2V2KA 3I5BA 2FF6A 3HVWA 3NMAA 1DARA 1NWKA 2W24A 4W4MA 2UVUA 4MKVA 1TELA 4Q43A 3OW2M 2UXBF 5IM0A 4FWKA 3BF1A 4YOEA 3G10A 3MDQA 4QPXA 5AQFA 1GMVA 3KK1A 2K3IA 3A5OC 2HVIA 4DUYJ 3MMVA 5HMXA 8AT1B 4J9QA 1FFGB 4B9NA 1XQIA 3T3FA 1QAXA 3C6UA 3ZX3A 4I69A 4OPKA 4FLYA 4TKTA 2YNFA 2F8MA 2KHCA 4TVAB 5D3GA 2ZD1A 3U1MA 5CHIA 5DLGA 5E3QA 3E66A 2HHVA 4J9LA 4Y0FA 3JQKA 4IUFA 2PSZA 3K5NA 3I31A 2MY7A 4LMZA 2C3UA 4I2QB 2PA3A 1BE4A 4OYXA 2FSKA 5GMDA 4USUA 3M32B 1QAJA 5AQZA 3QNNA 3HLUA 3QGPA 3TVZA 1N52B 1TK5A 1S4FA 3I5CA 2AMCB 4DN0A 2QL5B 4TU8A 3M8RA 1Q7YO 3DCAA 1FFSB 5AQTA 4ZPVR 2NXNA 1SH2A 5MLCV 1KCFA 2XEXA 3TANA 4B8AB 4RU2A 4O3OA 2GAHC 3ZNUA 4TLQA 1GLEG 2E5GA 5F8NA 4CH0S 1HA1A 4FJXA 2IRUA 3HVTA 2B4JA 5CYMA 3LPEA 3ZTQA 4OVLA 2BJDA 3QGIA 1EXQA 4PR6A 2IHR1 4OL8A 3VA0A 4DV0K 4CQ1A 1LXJA 4DR5K 5GAHI 3M2VB 3AJ2A 4YQWA 1SPBP 3LOUA 2MPUA 1JB0C 1Q5VA 3IRWP 4OJRA 3DRSA 3J7ZO 2BJ7A 1RT1B 2MSTA 3NGSA 4ERDA 3ATUA 2BOPA 3BGLA 2JEGA 5BR8K 3MXJA 2XLKA 2VJUA 3TAGA 1Q81T 2ZUAA 1TMJA 1WLJA 3DXKB 3A8JA 1QZ6A 3G71S 4B9QA 3CCMS 2AJFE 2OSRA 5J1NA 1E4FT 4ZKAA 3NGKA 3ELHA 3P3DA 2JEFA 2V9WA 3AO4A 2VICA 3CDEA 1BA0A 3OFGA 3Q7BA 4I1TA 4NI2A 3MFIA 1VRTA 4XH4A 2J6SA 4J2DA 2IDOA 2G2OA 4Y2KA 1VLYA 3PV8A 1QSYA 3UDCA 1KC8O 3TYTA 4H0XB 4IH6A 1ZBLA 1KWMA 2GO8A 4DCOB 1ZAWA 4EIAA 1VHXA 4IR1A 4FM1A 2DHSA 2W7AA 4FYDA 2NREA 1ZBSA 5C15A 3S3MA 3KUGA 4Z94A 4DOZA 1R6YA 4FBTA 5M2RA 1IO2A 1BQXA 4ANCA 4W90B 5DMRA 2OIHA 3BH7B 3U1NA 2Z56B 4LF8F 3OTOF 3P45B 1EWQA 3MWPA 2IMWP 4DMZA 2VQEK 3WHIA 4EGLA 3ICLA 1KLMA 4JI6J 3PIPL 3T1HF 5B09A 3R3LA 4ED3A 1HBUB 1RACB 2AV5A 1Q79A 3X1LB 1TL3B 1M5SA 3K2PA 2CIMA 2VV5A 1M1KT 5J1EA 4WWSA 4E1MA 4A48A 4X4PA 4LF6F 1RWVB 3ZZYA 4DL7A 3VQ9A 3E2EA 2M0GB 3L0QA 3MR6A 1IBKJ 4U7CA 4O3NA 3X3UA 4KHPF 4BC9A 1FF2A 4DV1J 2BM0A 1RB0A 5KG3A 4PKGA 5GAHP 4RPFA 1UEKA 4KGZB 3SZ2A 4IQXA 1YF5L 2GIFA 2GC8A 1RFQA 4RW7B 1N5YA 2VODA 4FJJA 3BQ1A 3LDSA 2VC0A 1GXLA 4ECXA 3EE8A 4EFHA 3KKSA 5GAEU 4YP3A 4WK1A 1R59O 1HNVB 1KLNA 1BQMA 3HZGA 4JI8J 4DV5K 3D0GE 5DRKA 3THYA 3D6TB 2KXFA 3QEVA 1FNXH 1Y3JA 4RW4A 2I0XA 1A5XA 1RT2B 1OKJA 2ZH7A 1CXUA 2WVDA 4ZPWR 1NGGA 2PD1A 1L3TA 3MM5B 1ITGA 4M8LA 4YEAA 1LFPA 2OMOA 3DMJB 3W2VA 1N36K 4GV6A 2QE5A 5AQMA 4OJ1A 4AL7A 3SI6A 1X9MA 1PC4A 1WHVA 1VRUB 3LALA 4M45A 1RTIA 5IXUA 1M5PC 2P9NB 2ITGA 3MURP 2KLAA 3R5DA 3MPDA 1X31C 2YHBA 3CJQA 5CD4A 2R2TA 4DU1A 5EHHA 4FWMA 4YOXA 5C25B 2K06A 2IYGA 3MECA 4DB3A 4N8OA 2IJFA 2C2MB 2HNYA 1YKWA 3ZFVA 4JI2K 4BCAA 2QKKA 3MM9A 2XCPA 2YQ3A 5G0RA 1FRIA 4Y3CA 4ED0A 1JLQB 2HW3A 4H5WA 3CXCR 2QZ8A 5AE2A 2ZC3A 2P51A 2I5JA 3BEGB 4CLLA 4ISFA 5D4PA 3EXCX 2AWZA 5K8MA 5C0YA 1NDKA 3D0HE 4WFYA 4BC5A 4X66K 1GLLO 3GYXB 2WOMA 1R0AB 3PEJA 1S99A 3MWTA 2I8EA 3KUEA 3NBPA 4OFZA 3O4NA 3TWZA 2KW4A 3ULEB 3PW7A 1J6ZA 1WBBA 1F9FA 1HMVA 3FDSA 5M1NA 4CZCA 2O3DA 4J9PA 2FHKA 1X4AA 4FJLA 3CJ1A 5BRHA 3THVA 4L8RB 4RX6A 1QM9A 5LT5A 4XH1A 3VENA 4YORA 1SUQB 1S9EA 4ID5B 3SUNA 2JSXA 3MR7A 4NA1A 4QW8A 2U1AA 3NS6A 2VHGA 1OSDA 2W9CA 5CHCB 3FZ2A 4YOUA 3Q89A 4BDPA 2M52A 1OPZA 4M95A 3I55N 1D3WA 5K14B 4V19X 4KY3A 1C0GA 3CFRA 3G6YA 5BN9A 1WOPA 4RTFD 2PN6A 2Q3SA 2YHWA 2HFNA 1HNZJ 2V8DA 4Q7AA 3BZKA 3BB5A 4PPDA 3QIDA 3MOJB 4AQYK 2GBZA 4DR4F 1T11A 1QQMA 3GG0A 5F3TA 4H0PA 3M9MB 2J8AA 3ZX2A 4CZFA 3AXMA 1UPPA 2O8FA 5A8KB 4P7VA 4D3GA 1X4CA 2HPUA 3W5YA 2AHOB 1X3MA 4J9SA 1HWIA 3CJ0A 1T3VA 4FNHA 4OI4A 3FRYA 4LR9A 1X5OA 4BE1A 5H1SQ 4LFBJ 4O3RA 3AVLA 4IOAL 1U6ZA 2VH7A 4P73A 1EX4A 3ZSWA 1KHVA 3PR4A 3CC4N 1VC6A 4JNEA 3KJVA 3AVJA 3BKFA 4YB6A 1H7WA 3SMSA 4CFDA 3M7VA 2NZTA 2M5YA 4P72A 4Z4EA 2GUPA 4B9VA 2WUSA 4C7QA 1NXIA 1VSEA 1WAJA 3OSPA 5HI7A 3R2DJ 4CGHA 1SV5B 4ZVUB 1WACA 2XZWA 4KTQA 1TYQA 5ADZA 3BPSP 3AD7C 1WNSA 1W9HA 1PKUA 3UNGC 3BYRA 5KFMA 1Z2LA 4DV6F 4N47A 3CM6A 4DXLA 2RQKA 2H3GX 5HN0A 1WHYA 3P6YC 4FKYA 2FVPA 3PXGa 2RE1A 2ZBPA 5KT5A 2CPJA 2ALZA 1Y11A 1ATNA 3PLAA 2CXEA 1UWBA 4NXNJ 1VQ5N 3W1YC 1KFSA 3DAWA 3K89A 2IFXA 1UW4A 3C14A 4ZVFA 2HBKA 3HJVA 4JI0F 3I4HX 3HP6A 2YNGA 1D0EA 3SQGA 4CIFA 2MGZA 5M1KA 2ZVSA 3UDLA 3OYLA 2X1FA 3HMJG 3QBWA 1U0HB 5K20B 2HK2A 3UKUA 1I51B 3OFFA 4GO5X 1IBMJ 4FLVA 1QQCA 1V5VA 1TZ0A 2VGMA 4IKAA 1SBRA 1TAUA 4ZHRB 5HQ8A 1FDAA 4B8CA 3KLIA 1SQGA 4J91A 5LMNK 4YB1P 4ZP9A 3KOAA 1HPZB 3PSFA 4LF4K 5IT0A 3I0SB 1NJYA 2XY5A 2ASYA 3MM6B 1G7CB 5RUBA 2WK4A 3BDEA 2EHGA 2OJ3A 3NEKA 4JUZA 2PMWA 1W7WA 3MDFA 3VF4A 4A4JA 3MEGA 1L3SA 2CZVC 1BIUA 2Q0UA 3N9UC 4OGEA 4JV5F 3CE8A 5KFWA 4X4QA 2BKNA 4MK8A 2YHAA 4IO9Q 4OYOA 1BCOA 2HHHK 3UR3C 5KG2A 2HF4A 4OZ5A 1WNEA 3C8YA 1GLFO 5BR9A 4HI1A 4OZ1A 3TUIC 2CJXB 2DNRA 1N4LA 2DD8S 2K1RA 3KG0A 4YDUA 3I55S 3NAIA 1FEHA 4DV7K 3CD0A 1BQNB 1LWFA 4K42A 2A3ZA 1URNA 2UXDK 2A10A 1Q7YT 3G0ZA 5FIIA 2CPHA 1ZBIA 1HYSA 1IKVB 2M9KA 2CYYA 2A5XA 2B6AB 3NWRA 2J76E 2ZKTA 2ZF5O 2BE9B 4U96A 4FXWA 5DG7A 3UB5A 4UZBA 3JQJA 4O4GA 3V6DB 2HNDA 4H4OB 4DR7F 4G1IA 4BR5A 1WSHA 4C8YA 4NZ7A 1IQTA 3AOBA 2F9TA 4BR9A 2CJBA 4ZJQA 2VKRA 3M2UB 3CD5A 2ZUGA 4C97A 3CC4S 5GAHU 3L7OA 3DFEA 3VQQA 3VZHA 1MMLA 3V9UA 1UVNA 2IS3A 2FJBB 2QXLA 1HR0K 4QQBA 3A3NB 1ZH5A 3VQ4A 5JICA 2V94A 4AT1B 3LL3A 2J9EA 4JI4K 3D28A 4AD6A 2MQLA 3TUPA 1JLCB 5CYQA 1HI8A 1IJFB 4OZNA 1WJ9A 1TKXA 4JI3K 4DUZF 1W26A 3TTDA 4C1NI 2HGLA 3DN9A 1BHNA 1U1PA 1BG3A 4LVOP 2MQQA 4TU9A 2ILZA 2RQMA 3EJMA 3D1HA 3M30A 2KO1A 1NDPA 3N6LA 2V5HG 1KC8T 4UQTA 3ZSYA 3L2VA 3DU5A 2DFHA 1VQ5S 3A5MC 4GW6A 3NCRA 2GW8A 2ZOGA 4E0DA 4N7TA 3SUPA 1QLNA 3GIIA 4U8VA 4M5LA 5KFBA 3M6WA 5KFCA 5ETMA 2GHVC 3FC9A 4QZVB 4LH4A 2LEAA 2WB4A 3VQ6A 5HANA 3D2EB 3HSJA 1U1LA 1QDUB 4DTNA 3IO1A 3UQSA 5SZTA 2P9GA 2XCAA 1HNXK 5DZ6A 3CJKA 3H4BA 3W2WA 2HBLA 2E7VA 2E8AA 1S1WA 4YY3J 5C5JA 4YOWA 1ZM2A 2HBYB 4IG0A 1V4SA 2GQQA 2IRXA 3CJ9A 1F9EB 3NFAA 3FUYA 5C24A 6FD1A 2OH2A 2HMPA 1U25A 3Q8VA 3TJAA 3DLLQ 3OYFA 1IQZA 3MN5A 1S9GA 1VQON 3VVUA 5ADXH 3AJ1A 4C8ZA 5DDRC 3RG6A 2XLIA 4WPAA 4BRQA 3KKFA 2XMVA 4BWMA 4OX9J 3ZSOA 2L9DA 2P5GA 4FXVA 4PCQA 2ZNYA 1K0TA 5AQWA 3ZLJA 5M1PA 3HSGA 3FFIB 3VERA 2GCFA 3WX8A 3I0RB 3CJSA 4CHZA 4X2BA 2NQPA 1EZZB 3BR8A 4CFAA 1B0PA 4UF4A 1NJIT 3THPA 2IAJA 4KV8A 1IN0A 3AVBA 1ZBTA 4PY5A 1FRXA 2BYCA 3ZT4A 2V7YA 2IVMA 4B3TJ 1DT9A 1JJ2R 1P27B 4C8OA 5ETRA 3MGJA 1H98A 3Q7CA 2Q1LA 3V4MA 2X6SA 5D0EA 2HHSA 4A8QA 1O8BA 4M3WA 4DQRA 2A2CA 3OJUA 4KSEB 1N34F 1RTZA 4KFBA 1WC5A 3OLBA 4DU4A 3QT8A 5AXNA 2DB1A 4F67A 2YNIB 3Q8PB 2VJVA 4IRDA 5KQ8A 4C11B 4CGFA 3BO4A 4UOFA 1GFWB 3D9BA 2ZHOA 1RGIA 3N0VA 3SBGA 2XY8A 1KTVA 2DNPA 2DGQA 2GGPA 3NS7B 4B1UB 4JKGB 3BSCA 1O1WA 1MMDA 1UMJA 2GAGC 3V81B 2CZ4A 3AQPA 1NB7A 4Q8EA 3MXHP 4C3KA 3DLKB 2A1RA 2OUGA 1HQUA 1V3SA 1S4EA 5F8MA 3HXMA 4O3PA 3J7A1 3M8QB 1GOAA 4HCBA 2DH9A 2AJ2A 2RHSB 1YI2N 2NPFA 1QJHA 3F9KA 4CEEA 5HP1B 2BEFA 2V2QA 5C2FA 4LF9F 1ZAXA 4I2PA 3ZTPA 1EHWA 5LJWA 5HMZA 5T14A 1PYOB 3M9NB 4H4MA 4M63A 2G8FA 2JVRA 3D4JA 5I3QA 3L4BC 4PRFA 4M5MA 4X84A 1S49A 3C65A 3GDQA 3P96A 1BCMA 4JS4A 2JNJA 1NMNA 2WTFA 2UU9K 5M1QA 1PC5A 2WW8A 1JCEA 3TA1A 5DM7L 5KFDA 2WSCC 3MTKA 4FJGA 1PYTA 1FDBA 1IBCB 4LF2A 4CBWA 1X5TA 2DBBA 4Q45A 3D66A 3SFUA 3H90A 1LW0A 3PX4A 4KHQA 4CVNE 3QYYA 3EPIA 1SXLA 1KQSR 4HVZA 1R27B 4DV0J 4EWTA 1EQYA 5F8LA 3MEDB 4DR5J 4OO1J 2Z4PA 4MK7A 1JMTA 3CQXA 2DT9A 3KK2A 4DLGA 1UJ5A 1TGOA 3I96A 4FOIA 3OXLA 2R8KA 1OH6A 4J9UE 4ZJOA 2VWBA 2P2CB 3EVWA 3SCXA 4B17A 2OP5A 5BR8J 4WFZA 3UCUP 4KAIA 3WT0A 1HKGA 3NNHA 4Z2XA 3NVMA 1W25A 4CH1A 1BOTO 2FLLA 2O8DB 3U7JA 3TZXA 4LIRA 4NRUA 2YWHA 2BH1A 4G1PA 3VETA 3SQ2A 3W65A 2UXBK 3HF5A 2OI2A 1VQOS 3VGUA 1VBKA 3WXIA 4CZGA 4ZVGA 2GQCA 4P2XA 3W66A 3ZT3A 2XRIA 4ILHA 1CJTB 4U8YA 4CGGA 4CERA 4ED1A 3M8WA 2BMBA 2QA2A 1IM4A 1U09A 1NU4A 5BREA 3NOCA 1OY6A 2ROGA 1F5AA 1LWEB 3JQMA 2LECA 5HLFA 2HBRB 1NM2A 1JJ2M 3AODA 4E7LA 2DRAA 2OEJA 4OPAA 3V9SA 1PJ5A 4CZJA 1WB9A 1UFKA 3RB3A 2IC3B 2VQEJ 4CYUA 3M1VB 3UR0A 1WKKA 5KFPA 2VBXA 3QNWB 3PJXA 2ATQA 4CJTA 1UJ4A 4DSFA 3NCQA 1P8GA 4ZPCA 4FK2A 4Y2MA 3MEKA 1XC3A 4BLGA 5KG1A 2CQCA 5KFLA 3O1WA 4LY7A 2WBNA 3GWCA 1Q8BA 5F41A 2G0IA 1IVZA 3QWPA 1NLVA 4B9MA 4E1JA 4I9LA 1XMQF 4BGBA 3UKRB 4L72B 4W98A 1WSRA 4KRWA 2MKKA 4P6QA 4PYAA 2DR8A 3VGMA 4A59A 2L3MA 3SCKE 1VGYA 1T9TA 2HBJA 3VTIA 2MDAA 3O1BA 1OMSA 2HK3A 4HTLA 3WNFA 3JTPA 4L3NA 3TTFA 3LDNA 2I9SA 4AHCA 3OSNA 1X4EA 3N01A 4ZVRB 1EQ0A 2ZJPQ 1Q7LB 5IWAF 3RB0A 3OYMA 2BKPA 2L48A 4CJEA 1YI2S 4OI1A 1IM6A 2D3ZA 3NAHA 2ACMA 3CCUN 3DRRB 2BANB 2RAQA 4HCCA 2E7XA 1CXQA 3PACA 2G2ZA 5HBMB 2LXUA 1CEZA 2PI5A 2GZOA 4JOUA 3ZSVA 4TXSA 2CKWA 4DPWA 4BQZA 2RJZA 2ZH8A 3VF6A 3KFWX 1Q9YA 2OPSA 1H2TZ 3CSKA 1N36J 2RQCA 4ZN3A 3R5JB 1KQSM 1YBUA 4KH1B 1U2VB 3HVAA 4P7TA 3GB0A 4C4WA 3W62A 1Z1ZA 3QEIA 1SJFA 3VCDA 3A4TA 2Y9HA 5HRRA 1JLFB 3FCVA 3O44A 4KB7A 2IM1A 4HDHA 3R7SB 2DY1A 1U2FA 4DHVA 5M1FA 3BGRA 1JNRB 4HLBA 2QWQA 1HBMA 3TR8A 1WN7A 4Y6IA 3MM8A 4WF9L 2GNKA 1XR7A 4OZ0A 2R4FA 4C8LA 1RTJA 2E1YA 4M42A 1CS4B 5DZ7A 1C1BA 1VQLN 3GSDA 2Z8QA 5CAAA 5KT7A 4I4BA 5KG5A 5BPLA 4E7HA 4O8UA 3V9WA 4RNOA 3QO9B 4ECUA 2EFNA 4M5DB 1GMWA 4LF8K 3OTOK 1FK9B 3CQ8A 1QSSA 1X8DA 4BRAA 2K7JA 2YQ1A 5FD1A 3OR1A 3MN7A 4RZRA 4OX8A 2XS5A 1NGIA 2FY1A 5BRFA 3MWBA 4CJUA 3OTDA 2FUG9 3T1HK 3LTOA 4CM0A 2NYHA 4K5RA 1R89A 4DCJB 2R7VA 2FQQB 4X66J 1IWAA 3QLHB 4HACA 3EICA 2E5LF 2F8SA 4NX9A 1X9WA 2AJ0A 5BPMA 2DHHA 1NPPA 1JLAA 1FCAA 2E7WA 2B9YA 1BO5O 1N88A 3MAAB 4KHPK 1Z05A 1M5KC 3IS9A 1TL7A 2WW4A 1FWLA 3MX2A 1JJHA 4OYIA 3R97A 1DTQA 3GP9A 1SKWA 1F2GA 2V52B 4FWNA 3DOLB 4A8YA 2OTLN 1NK5A 5LY3A 1SJ1A 4ATNA 2FJVA 4USJC 1NK8A 3J7YI 2OYQA 2QMUB 2ILYA 1KS2A 2B5JB 4H5NA 2CQGA 3LGMA 4Y65A 2KM8B 4RW6A 3AA3A 1LOUA 4HH1A 3Q0AA 2VG6A 4FNIA 3I4PA 1NU0A 3V2UC 3P1GA 4MFBA 5AE1A 1U2RA 2XS7A 2IYIA 4CH7A 3AJDA 3CIMA 1AB8A 2EFQA 1VQMN 4USWA 3OBIA 3DYAB 4AQYJ 5F0UA 1RT6A 4U95A 3CETA 2XNQA 2N4CA 3DXMB 1T05A 3M2RA 1S57A 4FF3A 2Z30B 2F9WA 2ZBQA 2DEJA 1N8RT 5DK5A 4CZMA 1UOCA 3LF0A 4CGIA 4EBCA 5HQMA 2C28A 3MTJA 3L09A 3MPYA 3P5JA 4X4VA 2XTJP 1VMBA 1QVGM 1F5CA 4DV4F 3T6JA 3KD5E 5J2MA 3GJSB 3B6OA 4NYZA 2C3OA 3CCUS 2I7NA 3J80Y 1AW0A 3PO5A 4ECSA 4RLEA 1F0XA 4KAZA 3EWGA 4C0BA 5E3AA 3OS1A 1TFYA 1WORA 2D4WA 1ITPA 2C2EA 4YB5A 2IM2A 2F1FA 4EK2A 8RUCA 2EFGA 1MSWD 4ED5A 2F7VA 2YX1A 3TJ9A 1TP7A 1WHWA 4E89A 3RAXA 4B1VA 2L08A 4K41A 3EX7B 2YWGA 1T3NA 2NXUA 1EIYB 2D7SA 2CQIA 1XNQF 2APOA 1LOTB 3DOKB 2AYMA 5FDLA 4H0YB 3ALYA 5C7PA 4YS2A 1YJUA 4DEZA 3FQLA 1U45A 2V63A 2A0FB 4CLUA 2P6TA 4B08A 2BJ9A 3T5JA 2HHQA 3BR9A 4MMOA 1TKTB 3J7YP 1EP4A 1VQLS 3ZZOA 5ETOA 4R79A 1RNHA 2XZDB 2J6TA 2UUAF 2RF2B 4X65F 3JAMO 3M8PB 2H65B 3QERA 4ETZA 3GQCA 4HEA9 3K9JA 4CF9A 3VF2A 2YKMB 4LF7F 1BIZA 2E66A 3ZYYX 2KZMA 2O66A 2XI2A 3O8MA 2KT2A 1YJ9N 4ANDA 3R5CA 4DTMA 1GH8A 2J0WA 5IM0B 5LMNJ 2J7UA 2CWKA 4ES2A 3IBCB 4IOAQ 1RA7A 2BJ8A 4LF4J 5K9FA 4Q2LA 2OZSA 1VK3A 1BL3A 4O8KA 2GMLA 3NG8A 4DR4K 3JS6A 1C4AA 2ZOFA 2ADCA 4DR6J 3NGIA 1VIOA 1FNOA 3TRGA 1Q0NA 1M1HA 3J80U 3KJFB 2OTLS 2ZD1B 3MR5A 2HHHJ 4O55A 5DG9A 3DLEA 2GVDB 1GX5A 2N3OA 5KT4A 3B8HA 5LJ5Y 2DPIA 4LSZB 5AZIA 4BRFA 2V9KA 3SAFA 3ET6A 3PHTA 2V8HA 2HWTA 3DGPA 4UTGA 4Y00A 4RBUA 1AYEA 3PM9A 2HOEA 1EAYC 3W61A 1K8AT 4DV7J 4DPOA 4OJ3A 3NGUA 3MI7X 2UXDJ 3D68A 2HQDA 3E1YA 1P9YA 1YQHA 2H5IB 1HD0A 1CJUA 3JXOA 1I3AA 1C0UA 1VQMS 4A62A 4TQRA 1B4SA 3U27A 2NR0A 1SL1A 3J7AN 3T1YF 2C2OB 2P9SB 4OKKA 5AQJA 4IOCL 1RAGB 2DCUB 3E51A 3DNCA 4CBXA 2P5OA 5J2NB 1S0MA 3QATA 2B7BB 4FWSA 4DV6K 4F2RA 3SV4A 2DK2A 3TZZA 2HFOA 3HVTB 5CYMB 3D7EO 1SKSA 1N5QA 3WQTA 2W9AA 1X0PA 4KB0A 3AO3A 4C0HA 2CJ9A 1OPIA 1Y5NB 4PXDA 3A8KA 1UETA 4ZPDA 5KAKA 3N6MA 1HQEA 3ADAC 2XZTB 3SSQA 1WC4A 1WSFA 2ITMA 1REVB 3JTNA 4IZ9A 3L3CA 4JI0K 2Q0RA 3EYZA 4Z4CA 4FBUA 3FBFA 5A6WA 4Q0BB 3CVKA 5E3CA 1HR0J 4U67L 2ZH3A 1TV6A 4BVPA 3TAPA 4S0MA 1IKXA 4JI4J 4LREA 3BGFA 3KXDA 4Y34A 4G1QA 2HIYA 3QT7A 3CCQN 4JI3J 2Z1GA 4CZKA 4P75A 1SC4B 3TAMA 2VIHA 9RUBA 2J6UA 2KKHA 4UQGA 2E6LA 2BZ2A 3AT1B 2HWIA 5BRDA 3QEWA 4KHMA 4V19J 1WC6A 3CDUA 4QJVA 2IM0A 2CJKA 4NPOA 2PMHA 3JB9k 4IXCA 3H4DA 2E1MC 2FYXA 2NRRA 3B78A 4BRDA 4OYZA 2EI5A 2KVIA 2HVEA 5H9EK 4J8FA 4CLYA 3GFHA 3VAGA 4JV5K 3VQAA 5I3UB 4JI5J 3EGWB 1YVNA 3O2IA 3S3OA 4MKBA 1U47A 2DR7A 3ZT0A 1Q8IA 4ILLA 2PZSA 2P9LB 2D3UA 2EG2A 1CQMA 3RB4A 3KHYA 5T41A 2EBEA 4DDFA 1HNXJ 1KLMB 2PIIA 2YVSA 1WSVA 1YJ9S 3O9RA 2JLEA 4CFCA 1DHMA 1RTDA 1BI4A 1HPMA 1ICEB 4AL5A 3FKBA 2MKSA 1GAOA 1RHMB 4CF8A 5J1EB 2OPPB 3HHNB 1EB0A 3VQ5A 3WQUA 3QFWA 4LFCF 2IRYA 1YZ6A 3GV5B 3F56A 3POTB 1X3NA 3L4QA 3OYEA 1XTZA 2CJYB 1AA1B 3WXJA 3EZ5A 1Y0HA 4NYPA 3PX6A 4LFAF 2A3JA 2PI4A 2Z2ZA 4IFEA 3QMLA 2HIQA 4FOEA 5M1OA 4QCLA 4HTIA 1S6QA 3C15A 1HNWF 2GWKA 3LM9A 4GKJF 3CPWR 4C98A 4KTWA 1WDDA 1Q86T 4DR7K 4ILMA 3IAS9 2BJ3A 1X0FA 3K0SA 2KG1A 2D0PA 3RZAA 2BUPA 3G4SN 4F3OA 3QBXA 2WVBA 3B6PA 2GJIA 3ENQA 3QRRA 5IFMA 1BQMB 2IM3A 4M3XA 2H3EB 2W8LA 4DSJA 3THYB 1NHUA 4JK9A 3U3YA 3MN6A 1K8KB 4RW4B 4FYXB 4QS7A 3C16B 2OZMA 1RE1B 2FZCB 4OI6A 5TKYA 3MM7A 3MXMA 2YKOA 4M3ZA 3EDRB 4PL7A 4IFVA 2C2RA 1FE0A 5E3RA 3I6PA 3K8VA 3BPDA 4CK1A 2ADBA 1Q5YA 5ETPA 3R5BA 4A8KA 1DQ9A 1IG8A 3G2XA 2J7KA 1JLEA 2CA9A 4NZ6A 3ZSRA 1YJRA 2GS8A 2LU2A 2RDIA 2IVFB 1WD6A 1TUVA 1E6VB 5I3PA 4JKCA 3AVIA 2ZHAA 2DR6A 4I6WA 4DUTA 3R3TA 5B08A 1LFWA 5C12A 4CI6A 1SL2A 3FBBA 3WXLA 2POKA 2FBXA 3MCPA 1TL1A 2DRBA 1T02A 1R6VA 1UA1A 5AQIA 3MM9B 5G0RB 1FI4A 1M0SA 1WC1A 3QGGA 3I33A 2VFUA 2BACA 3KLEA 4ZVQB 1B7YB 2LMIA 5KG0A 2O8CA 3UN5A 1QS4A 3CCQS 4CJ3A 2XB2D 5AQNA 1B99A 4IJAA 1RBOB 4WYBA 4CHOA 2UU9J 1A7GE 1TUWA 1UJ6A 4J9KA 3QIPA 4J9VA 5E5NA 4CJKA 3BUZB 1HIYA 5IC6B 2WONB 1TR0A 2F5GA 1HMVB 3UD3P 1SQKA 3IG1A 1C1CA 4N56A 1J54A 4CZIA 2H54B 3NH1A 5AXLA 1YIJN 1B3TA 3BQ0A 1XBWA 4CO2A 3LAKA 2VA2A 1Q8KA 3NAEA 1MMNA 2AGOA 3KWIA 4WFAL 2ZWHA 4H03B 2QRRA 1FO1A 4CT9A 4CT8A 1MROB 3TWHA 1DBDA 4CGDA 3H1QA 4LR8A 4FJKA 2ZM6F 1WI8A 3HHLB 4ED2A 3BBFA 3J7YU 2FTRA 4DQIA 3FVYA 3EE9A 4TQSA 1U1NA 2F9DA 5E26A 4M5IA 3TPQA 1GXUA 3ITHB 1T94A 3D1QA 4ZJLA 2XWYA 3BJYA 1N34K 4LQ9A 2UXBJ 5JS2A 4IDKA 1KVAA 2OCEA 4WQ5A 2QL9B 3HSDA 4DTUA 4LSLA 1GLCG 3A3PB 2YBVA 3NNAA 4C9DA 3CPWM 3RR8A 1QUVA 1XMBA 3EO3A 3PIOL 2C3YA 2I7PA 4DBQA 2F8EX 5AJ3F 4C2MA 4F02A 2CVEA 1RT5A 1GQEA 1IUJA 3HHLC 2VUGA 2KRBA 3TJ8A 4A61A 1NUEA 5MAOA 4LC9B 4KKOA 2OPRA 4NCGB 3G4SS 2JL9A 3VQCA 5DM7Q 3IR7B 1VQPS 3KJVB 3OL7A 4Y0WA 5HJYA 5I9EB 4KI4A 3KYLA 4M1KA 2CWXA 3G86A 3WC2A 3NP5A 5IT9O 3EGNA 1WC0A 3MR3A 3BH6B 4CE9A 2J0XA 1RYRA 1HBOB 4M7XA 4LF9K 3G82A 1VSMA 5ETTA 3GR0A 4K7QA 3A8EA 2FVQA 3QRQA 2RRNA 2B9XA 1WWHA 3P5BP 3M5RA 4ZN1A 1HNIA 1N0VC 3KNAA 1VRQC 2J5AA 1R0CB 3QDKA 5KPRA 2P9KB 1SIWB 4E7KA 2XO7A 1IWGA 1NDCA 1UWBB 3VHQA 3OL6A 3MK6A 2H5JB 3ENOA 4BE2A 4RL1A 2KU7A 4K8RA 1S9FA 3C14B 1FJ7A 2CADA 2Y8YA 4DLEA 3ILIA 5DGAA 3RRHA 2QSFA 4M3UA 4CJQA 1VFJA 3SQGB 2MGZB 5U47A 3L95X 1MWQA 4F4XA 1CULA 4FF4A 3PFOA 2O8EB 1WEXA 3C7NB 1SC6A 2G13A 2F4FA 3R2CJ 3HSCA 3OTCA 1TU0B 2ZE2A 5H9FK 3DOMB 3TX0A 3OYGA 2JWKA 3RW7A 4HT5A 3KLIB 1J5EF 5FRMA 3N5BA 4NLGA 1XI1A 3AHPA 1XHZA 3K58A 4RCHA 4MO4A 2VFVA 3G8SA 4UUXA 5HROA 4RU9A 3HT3A 4ECRA 3S41A 1HBNA 4FF1A 3LW5C 3C6HA 4CJVA 4ID1A 4BG8A 4YFUA 2MZTA 2Y1IA 1S12A 2DY9A 4ZIWA 2VD3A 2X74A 4KO0B 2XMAA 1WHXA 1WEYA 1A6LA 4QAGA 4E7IA 1HHSA 1H2VZ 1YHQN 2JDJA 1S0VA 2JWLA 4A8MP 1Q8LA 1G6BA 1M5HA 3SMPA 2YX4A 2B4VA 3HOSA 4LRFA 2K1RB 1FXRA 5H1SV 3K2YA 5IZHA 1BXNA 1XMOF 3NDKA 4P9SA 4NB4A 4AFFA 1NKBA 4QIWD 4LF8J 4Q8FA 3OTOJ 3CT9A 4K4XA 5C10A 1GXTA 4AM7A 4WYLA 1FW6A 2W4PA 3HHDA 3D2FA 2A1SA 3ETOA 1VAZA 4ED4A 1PSDA 4J9RA 3T1HJ 2VG5A 2DPNA 2R7XA 1LK5A 1QVFR 2RQ4A 4YR0A 4AE5A 2FLPA 1SJQA 2DRDA 3QFUA 4K5SA 1RWWB 1RWXB 4EBDA 3IXQA 1XMQK 4LF6J 4YOYA 5JVHL 2Q6BA 2UV8A 3I82A 3R5GA 4ALZA 3HFVA 4KYZA 4WCEQ 2FSJA 3RBZA 3M32A 3K5OA 3W5XA 2YNHB 1CSJA 2GQ2A 4KHPJ 3THXA 4CO3A 2RPIA 1FJCA 3H59A 3V6JA 4CHQA 3CCRN 3SI8A 3MXIA 3FMWA 4NLOA 3RYLA 3CCJN 1LWXA 2VWJA 2JHEA 4QWBA 3HHKA 3DI6A 3J7Z5 4BACA 4TSXA 3JSBA 4Y1CA 1WELA 5IWAK 5L1JA 3NXZA 4EP4A 5EU7A 4NLSA 3U9ZA 3R1HA 1FERA 3RW6A 4WQ4C 1NK0A 3AA9A 4M5HA 3DKDA 3LDOA 5CYQB 2Y1JA 1PO6A 2ZDPA 3U6FA 3H3NO 2VOOA 2MKJA 3ZSZA 3HHLD 4QOZB 2NXJA 5GMEA 1FJGF 2MEWA 2BBEA 2DTJA 3R1XA 1V3ZA 2LU1A 3VQEA 3GFZA 3UD4P 4NYNA 2UP1A 3C66A 2ZZNA 2IBOA 2ZJRQ 3AVAA 1G15A 4CEDA 2YWEA 2E2QA 3MUVP 2VL1A 3LZJA 4DPXA 1C0TB 3M3ZA 4CEZA 4YHHF 4F9OA 1NHKL 3KHGA 2E9RX 3CD7A 2WZ1A 3CF5L 5CXTA 4PEOA 4ECVA 2J9DE 5M2PA 3UO0A 4PG5A 3L8BA 3M6XA 1TQLA 1G99A 1RAJA 2F4VF 4DR2F 3P49B 2RU3A 2P9UB 3RRGA 4CM2A 3W2WB 3ZETB 5T7LA 2QKBA 2NCKL 5HAOA 5M2UA 2OANA 2CG4A 4UY8O 4DI6A 4NWBA 4IG0B 5KG4A 4A57A 2AD9A 2JC1A 2OMLA 4CO4A 4BGAA 5C24B 2HHWA 2AGQA 3HT0A 2CQPA 2GELA 1W2BR 4BR0A 2F65A 5CE3A 3V6HA 2QWMA 3AFGA 3H40A 1T0TV 4ZP8A 5LM7E 3ASMA 2Q2RA 3IN5A 1APSA 2E5LK 4KB1A 3AA5X 3R9LA 4DQSA 2WBRA 4DF4A 2XM3A 3TARA 1N54B 1YHQS 3AY9A 3IR6B 1RJJA 4K4ZA 4K2JA 2O67A 2HQCA 3ZZRA 1HBUA 2XYHB 2E9TA 4H5TA 1TL3A 1DLOB 3ID6A 3MR2A 2AQ4A 2IAJB 5AQRA 4KV8B 2QEXS 2DGXA 4FLTA 2EC2A 3UNYA 1KAXA 2MZRA 4BWJA 4DV2F 5KRTA 1HKAA 2CPEA 2QLBB 3T5LA 4BR7A 2ASJA 4H4KA 3L2WA 2F8TA 2DNNA 3M8SA 2VONA 3O9TA 4KFBB 4FJNA 4H5VA 4MTPA 3VGKA 1BA1A 3OW2R 1CC7A 3J81j 2OFHX 3NCIA 1D8ZA 1U6BA 2R7SA 1KD1O 3QZ7A 2ASMA 3S6EA 4KHWA 4DR4J 1L5UA 4X4TA 3PZPA 3LGNA 2FF3B 3RSEA 3C0BA 4ZLPA 2AYBA 2GGPB 5GVQA 1RWPB 2JEIA 1V5IB 3CCRS 3GSIA 4B02A 5JUMA 1WF1A 3D3CJ 3CCJS 1XNRF 4PPZA 1K9MT 2RU9A 5D4LA 1PCAA 1HARA 3MM5A 2GTDA 5B0AA 2HNZB 3R6GB 4USHA 3DMJA 1F60B 3S8SA 4DV4K 2FZGB 4P2FA 1FRKA 1HQ2A 2QYGA 4LRCA 4I2PB 3EVOA 1T9XA 1NOYA 2LSNA 1VRUA 2JLFA 2VASA 1PILA 2P9NA 4PHTX 3EXYA 4AL6A 5FLXO 4OIXA 4Z4FA 4CHYA 3GYGA 3A8YA 3UCGA 3OXGA 4QS9A 2DHXA 4WFXA 3UE2A 1EX8A 2P5VA 4NEZA 4DV6J 3JTOA 5KFFA 1PJ6A 3D6MB 2IPOB 4BG9A 1LW0B 4W5RA 3D67A 2CH5A 1FKAF 1XNQK 1QAIA 3CIPA 3TI0A 4X4RA 4FKXA 5LJ3Y 4DU7A 3O1LA 2FJXA 3OQ2A 3ZZ0A 3KK2B 1Y9OA 4R0JA 2HQIA 4R0EA 1V6HA 4BBYA 1P8ZA 1RDAA 3ZEUA 4E19A 4ISGA 1Q18A 1RAOA 3QINA 3O8WA 1EO1A 1Z4UA 2JZ5A 4JI0J 3K5MA 4IO1A 3FSIA 1EARA 2UUAK 4X65K 5EVZA 1AFIA 1DFDA 2P1JA 2RSQA 5HRSA 2Q97A 5D6GA 3ULEA 5CA5A 3D5MA 1NG9A 4B3SF 1OVYA 3ILOA 2XI3A 4LF7K 1N0UA 3SFGA 2DGSA 2EBGA 3A0IX 1QHAA 3AD8C 1R8BA 1VYAA 2YH0A 3Q8SB 4HDGA 4I68A 2B3TB 2AYGA 4K0KF 1T9WA 3HO1A 4KRFA 1SUQA 1W97L 1RA6A 4TY8A 5LSOA 4M5JA 1YJTA 3A5LC 2MTLA 1FA0A 2DNLA 4FJHA 2L41A 1CJVB 1FRMA 2RMLA 4HR2A 4NLDA 4NCBA 2GMJA 4B3OA 4DKWA 3HZEA 1A5WA 1DJ0A 4Q5VA 6FDRA 5H9EJ 5EWFA 2LDYA 4OYAA 2AKWB 5J2QB 1HI1A 4JV5J 4A8WA 2GVZA 1D5AA 3IBFB 4DCHA 2LYVA 1FXLA 1WSJA 1VBZA 1NK9A 2RS8A 3R9PA 3CNQP 2MKHA 3IBWA 3JSMB 2UUTA 4W5NA 5L9NA 3BSNA 3JAMU 2BJEA 3OR2B 1VSHA 4CYUB 4LIWA 1ZA1B 3G6VA 2GV1A 3T9NA 4IR9A 4FCYA 1E6YB 2V4QA 2AP6A 3UDVA 3SJJA 4FK4A 1BUXA 4ELVA 1DTTA 5A8KA 1XUPO 4FJMA 1REGX 2KJVA 1ZBFA 1BC6A 1R31A 2E1PA 4GO7X 1VQ9N 1B70B 3IFRA 2J9CA 4UOHA 5EUHA 2ZQBA 3AVGA 3T1YK 5ETLA 2E5JA 3BY5A 2H4YB 1T7PA 1HRHA 1RT3B 4U67Q 1GOCA 2LA4A 3R27A 4O4RA 4NMLA 3EL2A 3OT9A 3NY0A 4EEYA 1D9AA 1VR6A 3NOGA 2QX0A 5L38A 4YUDA 1FJEB 1C0MA 3SSRA 3PYDA 3CJRA 3D45A 1SV5A 4DR7J 1U1QA 2QTDA 4FLXA 3M1FA 4U7UK 2V8VA 6AT1B 4R5PA 2LLZA 5F0WA 3UD5A 3C19A 2GJ2A 1SKUB 3ZTOA 1M90T 3O9SA 4I67A 1P90A 2RS2A 2DITA 1YRXA 4NLQA 4LJMA 2VWKA 2BRKA 4ES1A 3THTA 2C2DA 4PWDB 2B0GA 1F9HA 3TP2A 3AARA 2RILA 2NUHA 4KGXB 5ETQA 1WEZA 3QNOA 2B4PA 3RMDA 4ZA1A 4AUKA 3T6BA 3RBDA 3JXUA 5EGYA 2WAQD 1PBAA 4MQ3A 3K17A 3SPYA 1MA9B 1IV0A 3R7BB 1A5VA 4CRJA 4CHPA 1L3UA 2EKYA 3LP2B 3GYNA 1HBMB 3PVXA 3OBYA 3MM8B 1VBXA 1RAFB 1RTJB 2MKCA 2LQ9A 3PEHA 4CZEA 3O6WA 1HPZA 5KFZA 3I0SA 4P2MA 4E8UA 1WKLA 3AQOA 3OYNA 3J7AP 2D9PA 5L8RC 2HF3A 4J2AA 4FVUA 1HYZA 2W41A 2DGUA 2MLXA 5IOLA 2OPQA 2B43A 3DDKA 1RI7A 4CLFA 4F0HA 5L39A 5B0EA 2FBTA 5EN1A 2HGNA 1EJ7L 1YTUA 2FD2A 3FGUA 3AVFA 2CH6A 7AT1B 4EYHB 4B9LA 1SJ3P 2YKNA 4F50A 1S6PB 1S6OA 1NK7A 3H45C 1RTHA 4LFCK 4ZVEA 2ZH4A 4YOTA 1NDLA 2EG1A 5HVFA 2QGFB 3M9OB 1JLGB 3AO1A 2MLZA 2V67A 4LFAK 4LQ3A 1BQNA 3KLGA 1TUYA 1TL7B 5AQVA 4O3SA 1UVJA 3VTHA 1DURA 2V8PA 4HL9A 4F8RA 1JXBA 5KOWA 1HNWK 2A41A 2QJ3A 2Z1HA 1IKVA 1N5TA 2JX2A 2B6AA 1ZOTA 2EVZA 5L1IA 4JS5A 3T69A 4PG6A 3IP0A 3H2UB 4QWAA 5AFUA 1DEJA 4AHTA 1RHRB 4DV3F 3UVJA 1RBVA 4GC7A 1RWUA 2QIFA 3V6DA 4MFBB 2BW2A 3WX4A 1VQ9S 2RE2A 2NRZA 3O3HA 1CC8A 2Z2MA 4MKAA 1N34J 2FVCA 1QD1A 5AE3A 1JLBA 1Y10A 4RKUC 2CQ1A 3VQSA 1CJKA 1T05B 3M2RB 4DV5F 3I32A 4NXMF 4IRCA 3B4MA 3HM8A 2OA8A 1RT7B 1KOOA 3JSRA 3EZUA 4RBVA 1UA0A 5DO2A 2NXCA 1L3VA 4QPTA 1NO8A 1ILYA 4MKYA 1XR5A 3CD6N 1FTRA 4DTSA 3CDWA 1S10A 1JLCA 4B3RF 3H0PA 3KJNB 2CDQA 1QSLA 2HQFA 2KH9A 3CCVN 2YI1A 1Q78A 3QBCA 2MKYA 3OL9A 1VSIA 3L9ZA 3U8XA 3LDQA 1FEEA 3ENBA 3TEGA 1YITN 3OXFA 4BC7A 3LQVA 4AYBD 2R7UA 4DN9A 4NLTA 1BY9A 1XWLA 3NL0A 4OYMA 5HVHA 4H4KC 4CJFA 4LF9J 3K59A 3ENVA 3GR1A 1HUXA 1YVUA 5AQGA 4WFNL 3V9ZA 2VA3A 4WFAQ 2G8UA 5F9NA 7FD1A 4IFYA 1Q82O 2MZJA 3SEOA 4JI2F 4CNZA 1Z26A 3D2EA 3GCXP 1H2UX 2WRMA 4GY2B 5K8NA 1AZSB 1S1XA 3HCXA 2H5EA 1K73O 3KNGA 3EY1A 4RW9B 2Y0BB 1N56A 2D5RA 3I87A 1SIZA 1O51A 1RGVA 1R43A 5EWGA 3R5AA 3AH6A 3THWB 4XDDA 3L2RA 4O3QA 4IBNA 4JEPA 2LEPA 3SJHA 2C1EB 3BZQA 2G4BA 4HKQA 3MMAA 2CPXA 3JYTA 1MU2B 1T95A 5H9FJ 3HJFA 4CD1A 2ZM6K 2HBMA 4CEFA 3C6TA 2PC6A 2DO0A 5KOXA 1S5ZA 3RWUA 5LJVA 4HUGA 3C95A 2ZJQL 3I0RA 3QEXA 3IWLA 2NRVA 3DM2B 2D3OR 4C3LA 3CG7A 2ABYA 3J81Y 5IT9Y 4LVNP 1QTMA 3VMFB 1WOOA 5LXRA 1RDWX 3GL1A 4DQQA 2DNHA 4DJBA 3M05A 1UAXA 3IC1A 5AJ3K 4C6AA 4TYAA 3PDNA 3U1LA 3WNHA 1NGCA 1VQ7N 2XBPA 2R8IA 2UYTA 5HRPA 3OVAA 5AFUH 1B0VA 3ET6B 2YNIA 1RISA 4ZLLA 4IEIA 4A8FA 2DHAA 1NK6A 5GIPA 3HD1A 5KT6A 3IRXB 2DY4A 1KOHA 2YQ0A 4PQAA 1X4BA 3IA0A 1IKWB 2WVFA 1C0UB 2WC9A 2Y1LB 3OVNA 1V3RA 4Z7CA 4JKGA 2E20A 2K3KA 2X1GA 2W1BA 1ZA2B 1FRJA 3V81A 4RO0A 3RAMA 2DFFA 4NLWA 4W5OA 4HHTA 2D1KA 1Q53A 4BRKA 3FFKB 4EO6A 2Q31A 2G8WA 2GO9A 1XMQJ 3KDNA 4B1XB 2ZH9A 3RVCA 5HP1A 3H2VE 1VDHA 4I0WA 4J9MA 4M3RA 3CD6S 4BRLA 2X6NA 4ZPTR 2XMJA 2D41A 1HQEB 4JV1A 4FM2A 5KPTA 1RU2A 4DL0C 3E3XA 3CCVS 4QWEA 2QXFA 4NLRA 3F41A 5DLFA 3DLRA 1FRHA 3EKSA 3OHRA 1RWNB 5IT4A 5IWAJ 2HQGA 3U3GA 1XR6A 1YITS 4BRIA 4CI0B 5A2QO 3GE9A 3HBTA 1XERA 1T03B 3CULA 5KFRA 1TV6B 4XPCA 2XHBA 3PW0A 2XO6A 1IKXB 3SAGA 3CCSN 5L46A 3J81U 1UFWA 4G1QB 5IT9U 4CD3A 4NA3A 3AGRA 4BRGA 3MEDA 2XMWA 2CGKA 3EEQA 3FRZA 5A8WB 4IH5A 4USMA 4ZPBA 4O0IA 3QJLA 5CD4H 2HS3A 2CG8A 3UWTA 1SKRA 1ZETA 2VDHA 1TKDA 1IR0A 1BU6O 4KPYA 4JKAA 4BROA 1GTEA 3OJSA 1HD1A 4DF8A 2NRHA 4KC5A 1QAYA 1ROFA 5L1LA 1Q81O 1H1VA 1NNEA 5KFJA 4R8UB 3IAM9 2N82B 3LWMA 3EM1A 3GG1A 2QA4G 1XJWB 3W9JA 3KHRA 4PUOB 3HM9A 1JCGA 2MYFA 4EYIB 3G8QA 5JVHQ 3AVHA 2WHOA 3ULHA 3DHXA 1VI7A 3EE3A 1FDNA 2DNMA 1XMOK 1YSJA 4PQUB 4ZS6A 1J5OB 3PHEA 1KQGB 3KLHA 1BI4B 1N6QB 3OBWA 3MCMA 4DPTA 3H42A 1NH7A 2F40A 4B1ZA 2ZDOA 1SS6A 1X9JA 4RW8B 1LWEA 1SQFA 4DR6K 2RDDA 4BR4A 2XS2A 2V34A 1ZYQA 1DRZA 2E5LJ 2IC3A 3H3OB 1YUWA 4PXCA 2JFDA 3M1VA