2YX6A

Crystal structure of ph0822
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
110
Chain Sequence
MRVAIPAEDDRGIKSNVSKHFGRSRYFVFVDIEGEDVKNVEVVEVPFGDLPNFIKDHGAKIVLTYGIGRRAIEYFNSLGISVVTGVYGRISDVIKAFIGGKLKIDYDWKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH0822
publication title Crystal structure of PH0822
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 28
structure length 110
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2yx6A01
1P90A 1O13A 1T3VA 1RDUA 2RE2A 2WFBA 2YX6A 2KLAA 1EO1A 2QTDA
chains in the Genus database with same CATH superfamily
4BACA 4DV6K 3TANA 3HBTA 2E20A 3T19A 4H4MA 4DV2K 3R6MA 2Q31A 1Q7YO 3CMEN 4O0JA 4B9SA 3CIPA 4JK7A 4BVOA 4CEOA 4M42A 3M1FA 3SLCA 4XEIA 5CYQA 4M3WA 3OW2M 3CJCA 1KXPA 4JKAA 1NG9A 3L4IA 2ZJPL 4A2AA 3EE8A 2YNGA 1LAVA 3ZYYX 1JLGA 1BUPA 1RDCA 3TSUA 1DTTA 1EWRA 3M8PA 4QS7A 2E88A 1TYQB 4MO5A 1QVGM 1BA1A 3LAKA 4CI6A 3AVCA 1HNZK 1VSLA 2HHTA 1N8RO 4YDUC 1GLCG 2F8TA 1WSEA 3HSCA 3Q7CA 4O8UA 5HLFA 4BRLA 3FE1A 2YHWA 1LV5A 1A5VA 4BR5A 1BA0A 3I55N 3HP6A 4JN4A 2HBLA 1D9DA 1D5AA 1UAXA 1SZ2A 2H3GX 3DXMA 4BRQA 2QM1A 3DRRA 4BY9C 3PSIA 3QFPA 3K5MA 1YT3A 2F7TA 4CGIA 3DM2A 2BANA 4CJEA 1X9WA 4Z4EA 4GW6A 3V1RA 1T8EA 4H5VA 4M3ZA 1BU6O 3QLHA 3EE9A 3MWTA 1VSEA 1BCOA 5FROA 2XRIA 2RPIA 3FZFA 3LAMA 5AQKA 1Z6RA 4FWLA 4E89A 5GADP 4WQ4A 5HROA 3ULEB 4BQLA 5KPRA 3LPTA 1BQNA 1QZ5A 4X62K 5LJWA 3SBTA 4FJIA 3ZSXA 3O3GA 4EZ6A 4OPAA 1K6YA 5KRTA 5BPLA 4X66K 5FLXO 2D5RA 3NH1A 3VMFB 2ZD1A 3E66A 5AQXA 1VSDA 2JGUA 3NBPA 2O8EA 3F73A 1HNXK 1TAQA 4DHYA 1P90A 4XH1A 1GOBA 3I8DA 4IO9L 4LF7K 5JVGL 3L6QA 3HVRA 5EOYA 4CFAA 4BR2A 1VQ9N 4JS4A 4BGAA 1JLQA 4B1YB 5HRNA 5BR9A 4BC4A 5F0XA 3BGRA 3WXJA 3O4QA 4IJAA 4DV5K 4LFCK 4KTZA 4V19S 1SKRA 4DG1A 3JS6A 3VESA 1HRHA 5IWAK 4DR5K 4R5PA 3H1VX 3QINA 5BPNA 4K43A 1RDDA 1TV6A 2A6AA 2FBVA 1Q18A 4B9VA 1YVNA 4KFBA 4CZLA 3AO5A 2IVPA 3D0PA 1IG8A 4FZYA 1J53A 3CHWA 2PZSA 2HNZA 3A5MC 3RMCA 1M90O 3QBXA 3P31A 3VEVA 3CJ7A 4RW7A 4CECA 5E26A 4H8KA 1XWLA 4JI3K 2QWPA 1X9SA 2WFBA 1IKWA 2V52B 1JKHA 1RT7A 3SAGA 2QKKA 4BG8A 3JXUA 2BGGA 3OTOK 1VSKA 4BC5A 2Q0RA 3C6TA 2A42A 2NRVA 3H08A 2V51B 3EZ5A 4CGJA 1HYVA 2E5LK 2KFNA 1ZXOA 2G8FA 4DV4K 3G6EN 3AAPA 1VK0A 2KZZA 1S9GA 2D4WA 4FJGA 5B8HA 1VQKN 4CFBA 2PYLA 5F1XA 1KSPA 4A62A 1R59O 3FZHA 1BG3A 1NOZA 1LW2A 3ZT4A 1GOAA 4B1UB 4DTJA 1RDUA 5AQGA 5I3UA 4DFPA 1KAXA 5MLCQ 2A41A 1QQMA 5KQDA 3VQ7A 1N6QA 4CHPA 1KLMA 3SUQA 4NB4A 2J4RA 3NHGA 4Z4IA 4B3TK 3CC4N 1T44A 4M3UA 2R7YA 1ASUA 2IDOA 4N76A 5LMUK 4BRDA 3KLFA 3QB0A 2YJFA 4FVUA 2HB5A 3L0QA 1B9FA 5AQWA 3HPOA 4JI6K 2P9LB 3R1XA 1U47A 3U6FA 3MK6A 4BRAA 4J2BA 4CJKA 5J2NA 4OLBA 4JI7K 4BVPA 1ATNA 5BRDA 4L3QA 4FJJA 4CK2A 5JVHL 1WSFA 1WB9A 1T6CA 1WUAA 4N5SA 3H3NO 3VEZA 1XI1A 2Q2RA 3CXCM 2BH1A 1K9MO 4DWIA 1OVYA 3OS0A 1NGBA 2D1KA 4K0KK 1RCHA 2ASPA 3NDKA 4KREA 4FJMA 2YNHA 3U8XA 3ULDA 4KPYA 4M3TA 1D8YA 4FJ5A 5AQHA 4JKBA 2E1ZA 3TAQA 5LL6Z 5JS1A 2HHXA 3VEXA 4FJ9A 2HNYA 3CM5A 1RT5A 3V6DA 1J5EK 4GY2B 3KD5E 4F2RA 4M3RA 2QXFA 3CQ8A 1I3AA 2F8SA 3AVMA 4CJSA 1NBWA 3HOTA 5HBMA 2QA4N 3TU5A 3UKRB 4OLAA 2DFHA 4ZTFA 2XY8A 3P38A 2A40A 1RDBA 4IBNA 3DLGA 1J6ZA 4DMNA 3NFAA 3DLEA 3SUNA 4OGCA 4K42A 3HTVA 1YITN 3A5OC 1QS4A 3QNNA 3ENHA 3W0LA 4H5TA 4CIEA 3AO1A 3L8BA 1ATSA 5DM6L 4JKEA 2HHWA 3KKSA 1RT1A 2ZWHA 4AHTA 2V7YA 2D0BA 2NRZA 4CHQA 4FLYA 4CHOA 4FM2A 2UXCK 3A5NC 4KBOA 2ITGA 3SV3A 4CJRA 1IV0A 3PSFA 3AARA 5KGWA 4OPKA 1NK7A 3RRHA 3JYTA 4RWTA 4FLVA 5CE3A 1YXQA 5I9EB 2RN2A 3THYA 4QS9A 2HF3A 4F9OA 5EVZA 4DS4A 4KHNA 1TKXA 3IG1A 3L3UA 2FF6A 5EU7A 1IG9A 1SV5A 3LM2A 4B8AB 1TVRA 3BZKA 3VGMA 4AH9A 3DYAA 4Y0WA 2RHKA 4BGBA 3RVCA 4CEEA 4U7BA 3I56N 4A61A 4IG3A 1GLJO 3D2FA 3H6EA 1RBTA 4LF4K 3EO3A 1JCGA 3EKSA 3VQDA 3QESA 1NJXA 1JLFA 1G15A 5M1OA 3A0IX 4FLWA 4YOWA 4A59A 4NXNK 2OCEA 3LDNA 3PX0A 2HHHK 1TK8A 4ELUA 5C10A 4ILGB 4LF8K 2UYTA 1N5YA 1N36K 3B6OA 2ATQA 5JICA 3HJFA 3P1GA 4DTXA 4DLEA 1TUUA 4I6MB 4H5RA 5HL7L 4DTMA 2P9LA 3LDQA 3WXMB 4DQQA 1E4GT 3H46O 3V9XA 2YNIA 1C0GA 1CZ9A 4JI1K 3K0SA 1VQ6N 3D45A 2I5JA 3OS2A 4EHUA 3HM8A 3QNOA 4JI0K 4JI4K 1LOTB 3HSTB 3MEEA 3V9SA 2VWKA 2OANA 5EXWA 3LP1A 4FWPA 2XHBA 2X78A 4PHTX 2IVOA 3CYMA 1U49A 5M1QA 4DU3A 3M8RA 5CYMA 3K58A 2QEXN 4F4KA 4E7LA 1NK8A 4H5WA 3LANA 4MDAA 3ID8A 3I33A 3K5NA 4IFVA 4DLGA 1Z25A 3OYEA 2OTJN 1HYZA 2D0OA 3TTCA 4NCBA 3NE6A 4K41A 4HVJA 4FWKA 3CERA 3UKRA 4N41A 4HTLA 2P5GA 3O3HA 1O1WA 3JSMA 3T69A 1CZAN 4CW7B 4IXCA 3VENA 1X3MA 3BY5A 4B3OA 3O4WA 3O9UA 3CCMN 3CJ9A 4GVMA 5DK5A 3AY9A 3TAPA 3CI5A 4I9QA 4KB1A 1U45A 1ZBIA 3J7AP 1FKPA 4DSEA 3A2FA 4M3XA 2O8EB 4N47A 3DLRA 1CLQA 1WSGA 4O8KA 1X9JA 3ATUA 2QK9A 2WTUA 2O4GA 3N4PA 4C1NI 1TAUA 1JCFA 3UB5A 3ISNC 1SUQA 1XHXA 1SL0A 1QQNA 4BR4A 4QOZB 1NMDA 4A5BA 4DKWA 4ZHRA 1TKZA 4BDPA 3T1AA 4CJQA 2AJQA 1SL1A 2G8WA 2O8DB 3NVMA 2VCPA 1L3SA 3SZ2A 3AO3A 1HQUA 3WXLA 1VSFA 4KB0A 3E9PA 1IBLK 2NLXA 3AVLA 4IEIA 1WSIA 3AVJA 5BR8K 2P9NA 3SAHA 3L3VA 5FPEA 3PO5A 5C24A 1I94K 1P8ZA 1ESVA 5C0YA 5J1EA 3MECA 5SWMA 3VQQA 5KPTA 1RBRA 4KHUA 4K8XA 3CPEA 4DQSA 4ISEA 1YTAA 4BR0A 3HPGA 4OGEA 3C6AA 3T1HK 4YHHK 2NZTA 1YJNN 5EY4A 2O8BB 2GTDA 1SAZA 2BE2A 3O3FA 3VQEA 1T05A 5C12A 1RT3A 1RBSA 5J2QA 2NRXA 4ILHA 3C7NA 1RTJA 3CQYA 3HVTA 4I6MA 3LDPA 4IKFA 2NRWA 4R79A 4CJWA 2GX9A 3ID6A 5AQFA 3CFOA 3BEXA 1JL2A 2CGJA 3T3FA 1TKDA 2ZGZA 5FRNA 4BWJA 3CFRA 3SQ0A 3TR8A 2UUCK 4FM1A 2HVHA 1QZ6A 3LDOA 1NGAA 4CBXA 4CERA 4PL7A 3CMAN 1RT6A 3QIPA 1CXQA 3ZCMA 2EX3A 4FWQA 5JLHA 3TTFA 4OKJA 4B3RK 4DSLA 1NK5A 3G25A 5LMNK 1JXBA 1JCEA 3SBGA 4JS5A 1NGEA 4MQ3A 3MCPA 3G71N 2E4LA 3QETA 3AA4A 5GIOA 3LWMA 3PIOL 2O8FA 5FRMA 4C8NA 4H0TB 1HMVA 3OYBA 4DQIA 5AQJA 3EYZA 4B9TA 1NGFA 4IDHA 4OKKA 2XY6A 3LP0A 2VG5A 4GKJK 2LSNA 2OYQA 3SI6A 1XMQK 2O4IA 3DMJA 5C42A 3MXMA 1DEJA 3TARA 2E8AA 3QICA 3SNNA 3PX6A 1VQNN 2UU9K 2BUPA 1YJWN 4H0OA 4NCGA 3RSEB 4BC2A 1XC9A 4B9MA 3HK2A 2P51A 2OA8A 1U2VB 3CCJN 4I2QA 5KRSA 4AQYK 3OYFA 2ASMA 3LZIA 4NYNA 4BROA 1N34K 3WEEA 1OVQA 4M3YA 5GAHP 1DKGD 2IGIA 4CF1A 3NF7A 3OJUA 3AVFA 2ZGYA 4LF6K 3AA3A 3QEXA 1HKCA 3VGLA 2O8DA 4WFNL 1W97L 5KPZA 4CHNA 3KK1A 4U67L 1NGGA 4NO7A 3U9DA 2A1RA 1SKSA 5AZJA 1RTHA 1NKCA 4KHSA 4RW6A 4CZFA 4JKGA 3CCLN 1RT4A 3SK3A 1GLEG 4EP4A 3VQCA 4BR9A 4LF9K 5T7BA 2I7NA 3CCEN 4YOYA 4FLZA 3O9TA 1QSLA 1NLVA 3THWB 4DTSA 3LZJA 1FXXA 4DR3K 4AHUA 4PL8A 3RR7A 4B9NA 4YOTA 5M1PA 3L2VA 2ZF5O 1HX1A 3CCVN 3M8SA 2O8BA 5J2PA 3CCQN 4DSJA 1BWFO 2YNFA 3EL2A 3L2UA 3PIPL 4FYDA 4QCLA 3THYB 2VWJA 2OPRA 1NM1A 2NUBA 4FJHA 3HL8A 4FOIA 1REVA 1W9HA 2YHBA 3CCRN 4FK2A 3THXB 2NRHA 3SMSA 1L3TA 3CD6N 1TK5A 3IKMA 3U9ZA 1Q82O 3WUHA 3C65A 3D2FB 5JS2A 5K14A 1VSHA 1Q86O 1S6QA 4FWNA 1S22A 5A2QO 4Z4GA 2B4JA 2HNDA 1SL2A 1JJ2M 4BWMA 2V7ZA 4FWSA 1RBVA 4FCYA 5FDLA 3K5LA 3CQXA 3V1QA 3MXJA 4FJXA 1EQYA 4CZEA 1X9MA 1QVFM 4EIAA 4GMJB 4A57A 3ITHA 3CCSN 3FLCO 4DS5A 3QIOA 3H1QA 1KQSM 3LWLA 4Y1CA 3HPHA 4FJ7A 3TAEA 4LH5A 5E41A 2PFUA 1YJ9N 1XNRK 2ZQBA 1N32K 3GBTA 2Q3SA 2YCHA 1NK9A 5CY4A 3TABA 1SQKA 2X6NA 1V4SA 4IFYA 3OYLA 3TWHA 4CJTA 1FJGK 1ZC6A 3VF4A 3BF1A 1SKWA 4B1WB 3HI0A 3G0ZA 4LF5K 3AVGA 3O9SA 4JI5K 3GE1A 4DV7K 4BRNA 1HR0K 1WN7A 3U3YA 3RSEA 4JAXA 2ITMA 1C1BA 1OH5A 5AQLA 4HCBA 4DUYK 3HRGA 4DF8A 1VSIA 1NJIO 1U2VA 4FPAA 4IO8A 3TPQA 4FXDA 3O8MA 2KKZA 3ZSZA 1HKBA 2UUAK 2P9UB 1WOQA 3LP3A 3SMPA 4DU1A 3QEWA 3QERA 4JKDA 5TKYA 3NH0A 3ZT1A 1NJZA 1D9FA 1Y97A 4W5NA 3EN9A 4H5NA 4DFMA 1KLNA 2VYPA 3VEOA 1C0TA 3DLKA 2GBZA 2DFFA 3ATVA 1U4BA 3KLIA 3MX5A 4KH6A 1S3XA 4YOXA 4TSXA 3CC7N 1EETA 2HVIA 3V9WA 1S1UA 3THWA 1KAYA 4CZMA 5AZIB 4E1MA 2HOEA 1T3VA 3V4IA 1VQMN 1HNVA 2E2NA 3SUPA 4PA1A 1LWEA 3MN9A 4ID1A 4Z0UA 3NAEA 4CVNE 3L2RA 1GLDG 1NNEA 2XO7A 4BDYA 4OJRA 1SS6A 2KZMA 3O4NA 4XH5A 4DFKA 3AGRA 3CG7A 3KVGA 3KD1E 4CEQA 4CF2A 3ZX0A 3ENBA 1TL3A 3GOIA 4F8RA 3ZX2A 2W6KA 2YV0X 4CK1A 3IDHA 1Y64A 3EZWA 3AVIA 1QSYA 4K8ZA 1YTUA 4NLCA 3THXA 2P9IA 2E1YA 3QBWA 4CESA 3IAYA 2P9NB 3D2EB 3BZCA 2E2PA 4IZ9A 4E7JA 5KQ8A 3KWGA 4M63C 5AQIA 3TTDA 3SPZA 3ZSRA 4BRCA 3J80O 4FZXC 4JEPA 4WF9L 4LD0A 3AA5X 2IIRA 1BISA 3TAMA 1ILYA 2Q1NA 1GLAG 2HSTA 1ZBUA 5AQRA 4JK8A 4X64K 1IH7A 1YI2N 1YF5L 3R9PA 4PQUA 5FPNA 3TI0A 3KK2A 4Y1DA 3WQUA 4F3OA 2P9KA 1KTQA 3C0BA 4KHQA 1JLEA 1GLLO 4IOCL 4B1VA 3CCUN 3K9KA 1W2BM 2XY7A 3WQTA 4E7KA 1FK9A 3MCAB 4EAHD 3C7NB 4H4OA 5AQMA 3KHYA 3MWPA 2YHXA 1N33K 5ADXH 3QEVA 1UOCA 1U6ZA 4YOUA 1OH7A 5CHIA 3TSPA 5J2MA 1EX4A 4E19A 4CEZA 1L3VA 1WAFA 1BO5O 4E1JA 1HJRA 5AFUH 1FKOA 4A2BA 1QSSA 4QS8A 3DWLA 4DUZK 2P9SB 4CHZA 2KTQA 4DV0K 2QXLA 3DOLA 2FSNA 2JWKA 3VPZA 1NGCA 4LH4A 4OKEA 3P4IA 5GAGP 1KC8O 3FFKB 3MDQA 4KHYA 5H1SQ 1NGJA 1QE1A 4KAZA 5HRRA 2E2OA 2PBDA 3OS1A 3AAQA 2WOMA 3OYJA 3DOKA 3LL3A 4DR4K 3GG4A 3PUFA 1NGIA 3NF8A 1KFSA 3CJBA 3TAGA 3RR8A 4ICLA 2P9UA 4JRQA 4WFBL 2A1SA 2OTLN 2O8FB 4YNQA 1E4FT 1QHAA 1J9AA 3AA2A 2G8IA 1HJOA 4FO0A 2Z1IA 1C6VA 2YKNA 4H0XB 3T1YK 2P9PA 4BDZA 1JLAA 1VQ5N 1HYSA 3AO4A 1VQ4N 4JI2K 3BF3A 4O5BA 4IWVA 4KV8A 5ADXA 3WT0A 5E84A 4IG0A 3O6WA 3VQ4A 1NOYA 4DR1K 1MWKA 4DCHA 4LSNA 4KHWA 3ZEUA 2Z1HA 4H03B 3NCIA 1VAZA 3GDQA 3VF2A 3HZ6A 5BN9A 2JLEA 2FLOA 2GWJA 4CFCA 1NKEA 2HF4A 3LDSA 3U3GA 3J7ZO 5AZIA 2NRRA 2GUIA 2IC3A 3FZMA 4DTOA 4CJPA 4OX9K 5KTQA 3HM9A 4BRIA 1KVAA 1UWBA 4HUFA 4JKCA 4H0PA 5C25A 3S3OA 4WYBA 3EY1A 2F9TA 4AHSA 5AQZA 4CD3A 5AQSA 3CF5L 3WEEB 5AQPA 4DTPA 1X3NA 2P5OA 2F4VK 4DR2K 3G10A 4XH4A 3O5BA 3O1BA 2DTUA 1NK6A 4FM0A 4WE1A 4BREA 1ASVA 2KHOA 4PUOA 3NF6A 3KIOA 2GUPA 2YHAA 4KH4A 5AZJB 3DAWA 4FSVA 3RMBA 4JKGB 2F96A 1LAWA 3C94A 3FZLA 3WNFA 4AILC 3AVBA 1K8AO 3D2EA 5AR0A 1GLBG 4C8OA 4CHYA 4BQZA 2GWKA 3VETA 3KK7A 1T6DA 3N4QA 4DQ8A 4CEAA 2BTFA 1VSMA 1X1PA 2W40A 1BGXT 1XNQK 3ALYA 3KK3A 1K8KA 4KKOA 3IS9A 4CJUA 4RW4A 3I0SA 4M7XA 2A5XA 4MLEA 4FPBA 3VQPA 2X74A 3UE5A 3OYMA 2IOCA 1NK0A 3QDKA 5C2DA 5AJ3K 4KO0A 2EHGA 1JL1A 4EFHA 1WBDA 4DTNA 3PO4A 3LPUA 3H3OB 1HLUA 4CZJA 2RF2A 5LY3A 2E6LA 2QWOA 5ELZA 2D0CA 3VOVA 3SQ4A 4CBUA 1MDUB 1RNHA 3VF6A 4KRFA 3ENOA 1S1WA 1GOCA 3KJVA 3RTVA 2FBXA 2YI1A 2Z1JA 1OH8A 2P9SA 4DR7K 3LM9A 4HCCA 4FK4A 3MEGA 4CZIA 5F2RA 4OPJA 1IO2A 3WXIA 2CH6A 2FC0A 1ZBHA 5AQNA 1ATRA 3SJHA 4B9QA 4FLXA 4RG8A 2NNWA 4DFJA 3QFUA 4CE9A 1S72N 1ZBLA 3E9LA 4WFAL 2IS3A 4LC9B 2WC9A 1W7AA 3OJSA 1WLJA 1J54A 2I7PA 3ASMA 4OVLA 3DXKB 4YORA 3ZT2A 3OY9A 1VQLN 4CGHA 3A5LC 3P83D 4BC3A 1HQEA 4BRGA 3NGIA 4K25A 4HUEA 2UXDK 3VQAA 4KHPK 3DJCA 1S1VA 1Z05A 4IEEA 1C0UA 1VSJA 1RBUA 2AA4A 2HHUA 3AVNA 3FR0A 3JAMO 4BE2A 3DLHA 4RCHA 3AO2A 4G9ZA 5SZTA 3SUOA 4KH5A 4BR7A 4ELVA 1YUWA 3ZSOA 3MEDA 4CFDA 3FFIA 4LFAK 1S1XA 3J81O 4FW2A 4LY7A 3U4LA 4DSFA 1KFDA 3SV4A 3OA9A 2G8HA 2IAJA 3CFPA 3LALA 3DRSA 3M5RA 1LW0A 5CR4A 5D3GA 3HT3A 2VG6A 1O13A 1VQON 2GEMA 4QAGA 3VQ8A 1BI4A 4AM6A 3V9ZA 4ISGA 4J8FA 4DTRA 3S3MA 3S41A 5C15A 1RT2A 4CBWA 4MO4A 2Y1JA 2HMIA 3EKUA 4CJLA 3VA3A 2GELA 5AQVA 2VQEK 2QWQA 4AHRA 5BN8A 1CZBA 4CZHA 4UQGA 3D6RA 4NCAA 3V81A 4DTUA 3G4SN 3C6HA 1R0AA 4XIUA 4DR6K 2G8UA 1DTQA 5TKWA 2KW4A 3OYKA 4B3MK 4FVMA 4WQ5C 5CZ1A 4O0IA 4J2DA 2PY5A 2CH5A 2DY4A 1S9EA 1I39A 1V4TA 3A8YA 4CEDA 3KKRA 1UA0A 2O8CA 3AVAA 4H0VB 3MN6A 3CJ1A 4E3SA 1S1TA 1DLOA 1EO1A 4I9LA 3E9OA 4CJ7A 4H0YB 1IKYA 3J7YP 3C6UA 1B92A 2W6LA 4B9UA 3K5OA 3VA0A 3F9KA 4F3TA 2JWLA 3ZETB 1TKTA 3OBYA 1C0FA 3ZSYA 4O4GA 3O9QA 4M7YA 1DT9A 4CCHA 2KFZA 4RTFD 4IOXA 4B1XB 1IKXA 4CJFA 3PV8A 1VQPN 3KLHA 4DU4A 4MDBA 4YY3K 3I0RA 4C1NK 4IFEA 5BPMA 5M1FA 4I7FA 4CJVA 2QW9A 4HWIA 3V1OA 1NWKA 2X6SA 3GL1A 3QO9A 5AQTA 2KLAA 4FOEA 2NRTA 2HHVA 3NF9A 3MN5A 3QMLA 2HW3A 3OYNA 4HTUA 4PKHA 4ILJA 4DQPA 1E3MA 3VQ6A 4ID5A 3MXIA 1XHZA 1YVUA 5DMRA 1VRUA 2HHSA 3RRGA 5BRHA 3K9JA 1KCFA 4B9LA 4O5FA 3VQBA 1H1VA 4W5TA 3DRPA 3BP8A 4GNIA 2OPQA 1XUPO 5GIPA 3F9MA 4YOVA 2P9IB 1KRPA 1C1CA 3ZLJA 4X65K 3ZSVA 1NU0A 5C2FA 1CXUA 4LSLA 4DV1K 4C8LA 2FSJA 3OYDA 5FPDA 5AQYA 4JKHA 3NGZA 2HBKA 4CZKA 4GV6A 2FXUA 3KZBA 4NXMK 3RWUA 4WCEL 4FWOA 4J2EA 4NYFA 3O1WA 3O9RA 1EWQA 4E7IA 3P39A 4C8KA 3B8AX 4Z4HA 3TSQA 3ZT0A 2WONA 1MWMA 2P9KB 4AHVA 1TYQA 3OYCA 4CD1A 3VQ5A 4FW1A 3FGUA 2OZSA 3DXKA 3ZSQA 4FLUA 4KTQA 5M1NA 3MAQA 3WXKA 4G1QA 2QWMA 2E2QA 1HPZA 4CF0A 1S6PA 1UA1A 1U48A 1HNIA 5FPMA 4JHDB 4GV3A 1JLBA 3E01A 4JV5K 3ZSWA 4HUGA 1YHQN 1RTIA 1VQ8N 4FK0A 1Z26A 2WUSA 4CGFA 5HRPA 3CETA 3M6GA 5HP1A 4LFBK 1M1KO 2KQ2A 1XMOK 2PAVA 2ASOA 3HO1A 3OYAA 4PY5A 3HYFA 3VN5A 3CPWM 1ZBFA 3J8AA 5BRFA 1A5WA 3KTQA 3D7EO 4IOAL 3ULEA 1LWFA 4EZ9A 3BDPA 4BG9A 2FSKA 4M41A 4JD2B 4JRPA 1Q9XA 4CGDA 3NGYA 3OVNA 2QTDA 3DI6A 4CJ4A 1NGHA 4YFUA 3C95A 4CEBA 1RILA 1L3UA 4HHTA 2BDPA 4DF4A 5I42A 3UIQA 2P9PB 4BRKA 2IVNA 4FL9A 2FBYA 4I2PA 4GV9A 4JKFA 4JI8K 3OYGA 1T7PA 4DSKA 1T03A 2FF3B 5JMVA 4AM7A 3ZEUB 3KLGA 1YIJN 1NMNA 4CZGA 4IDKA 4JK9A 4CF9A 4E1NA 1NK4A 4CEFA 1EP4A 1QQOA 1VHXA 2G8VA 4KTWA 3ZETA 3H45C 4OPHA 4EHTA 1BIUA 3LDLA 4KI6A 1WBBA 3NH2A 3M8QA 2CGLA 2HMPA 5AQUA 1HKGA 4W5OA 5KGXA 4WQ4C 4Q0BA 1QQCA 1KVBA 2DFEA 1K73O 2QKBA 3RMAA 2ZM6K 2WBNA 4JYAK 2Z1GA 3SJJA 3P5JA 1NGDA 3L2WA 4BRPA 1EKEA 3S3NA 2A3ZA 2G8KA 4O55A 1KAZA 3OHRA 1S5JA 3R3LA 3ZX3A 5GINA 1RDAA 3MMVA 1KVCA 5CZ2A 2EWSA 4C8MA 4J2AA 1Q9YA 1DGKN 3AVHA 1Q8IA 2VGNA 2VGMA 2XY5A 2D0AA 2F9WA 2HBMA 4OO1J 2Q97A 5DM7L 2OPPA 1RGIA 1XC3A 3TAFA 5GAEP 1ZYQA 1XQSC 3OBWA 5EX5A 3K59A 4AF1A 3OYHA 2QI2A 1BIZA 3VTIA 1FW6A 3VTHA 3CC2N 2B5JA 3IUCA 3PX4A 1MA9B 1K8KB 2YX6A 4BRFA 1RDWX 4MLHA 3K57A 1ASWA 4YDUA 4W5RA 1JLCA 1IBMK 1G99A 3EEQA 1RFQA 4F2SA 2FBTA 3R8EA 4CF8A 3O08A 3OYIA 2UXBK 3UKUB 3LP2A 4FJNA 2D0PA 1Q81O 4FWRA 4DB3A 4W5QA 4JHDA 4FZZA 3SYZA 2QWNA 3T7ZA 4FJLA 2HHQA 1A5XA 3THVA 1BQMA 1QHTA 4CIGA 4B1ZA 4ELTA 3O80A 5HRSA 2OZMA 1BHLA 1U04A 1TUYA 3K2PA 3Q7BA 4FJKA 2Q0UA 2YJEA 4FWMA 1WAJA 5LJVA 3DLLL 4E7HA 3E1YA 3VQ9A 1QTMA 3F2KA 3HOSA 4BE0A 3DLBA 2PYJA 1OH6A 5KI6A 3NVKA 1WSHA 4FJ8A 1OKJA 3KLEA 4JNEA 4BE1A 3L4QA 1NJYA 3QEIA 4E0DA 2GV9A 1TGOA 3ZT3A 5BREA 3NMUA 4JD2A 2Y1IA 1YAGA 3IFRA 3SAFA 3VEWA 4Z94A 4ZTJA 4WQ5A 4DSIA 1MU2A 2ZE2A 3I8BA 4CK3A 3DXMB 2ZJQL 1BCMA 1LWCA 5AQQA 3CM6A 5JLFA 3PY8A 3SQ1A 4N56A 2YHYA 1IJJA 1J5OA 2YKMA 2W42A 4UY8O 4CJ3A 3F5TA 1BDGA 4CGGA 3MN7A 3HP9A 4NLBA 5AFUA 3W3DA 4DQRA 4EP5A 2UUBK 4KI4A 1WNSA 3IRXA 3KWIA 2QWRA 1BI4B 2RKIA 3PLAA 2VWBA 1KD1O 3AGKA 3L2QA 2HBJA 4Q5VA 1IKVA 1L5UA 4GKKK 1C1AA 2E6MA 4MFBA 4ISFA 3IMXA 3VERA 4B3SK 4Z4FA 4PKIA 3VEYA 4C23A 3WNGA 2P1JA 1HPMA 3VGKA 4B08A 2DPNA 4CJ5A 3SCXA 2RE2A 4RW8A 2VG7A 1GLFO 1LCUA 3SQ2A 3B6PA 2O8CB 2Q36A 1IBKK 3AVKA 1RTDA 3CJAA 1F21A 4CIFA 4FLTA 1HNWK 1W0HA 1BL3A 1TL1A 3AV9A 1BOTO 2W41A 2OPSA 1HUXA 4A5AA 5HOOA 5AQOA 3HXMA 2VQFK 2QWLA 4Z4CA 2ETJA 1ITGA 2ZJRL 4PWDA 3M3ZA 4PKGA 1WSJA 1EXQA 2B6AA 3BUZB 3FZKA 4BRMA 4IJNA 2CGKA 4M45A 1B9DA 2AP1A 5IT9O 3V9UA 4B8CA 4DV3K 1JXEA 1D4XA 1TK0A 4O44A 3MX2A 1VRTA 3S9HA 4GVEA 4L8RB 3WNEA 1NJWA 4BRHA 4AHCA 3WNHA 1VQ7N 4JLHA 4RW9A 3QEPA 5M1KA 3RMDA 1C0MA 3UKUA 1ZBSA 3SPYA 1NKBA
chains in the Genus database with same CATH topology
2JWLA 3HBTA 4JKDA 5TKYA 3HM8A 1C0FA 3OBYA 3ZETB 2E20A 4EHUA 3O9QA 1LOTB 3EN9A 1DT9A 4M7YA 4RTFD 3R6MA 2OANA 2Q31A 4IOXA 5EXWA 4FWPA 4B1XB 1Q7YO 3CMEN 3CIPA 4JK7A 4PHTX 1VQPN 4BVOA 4H5NA 4MDBA 2IVOA 4C1NK 4IFEA 2VYPA 3M1FA 3SLCA 3VEOA 5BPMA 5M1FA 5M1QA 2QW9A 4HWIA 4XEIA 1NWKA 3OW2M 3CJCA 1KXPA 3GL1A 4JKAA 3ATVA 3L4IA 2KLAA 5AQTA 2QEXN 4FOEA 2NRTA 4H5WA 3MN5A 4MDAA 3MX5A 3ID8A 3QMLA 4KH6A 1S3XA 3I33A 4YOXA 2ZJPL 4PKHA 4ILJA 4A2AA 3EE8A 3CC7N 3ZYYX 1BUPA 3TSUA 5BRHA 3K9JA 1KAYA 2OTJN 4CZMA 2D0OA 4O5FA 5AZIB 4QS7A 2HOEA 3TTCA 2E88A 1H1VA 1TYQB 1T3VA 4MO5A 1BA1A 4CI6A 1QVGM 3BP8A 4GNIA 1VQMN 5GIPA 1XUPO 3F9MA 4YOVA 1N8RO 4K41A 4YDUC 1GLCG 2E2NA 2P9IB 3HSCA 3Q7CA 4FWKA 4O8UA 3CERA 4BRLA 3FE1A 2YHWA 3MN9A 3UKRA 5C2FA 4BR5A 1BA0A 4HTLA 3I55N 1GLDG 2FSJA 4JN4A 5FPDA 2HBLA 5AQYA 1CZAN 3T69A 4IXCA 3VENA 4JKHA 2HBKA 1SS6A 1SZ2A 1X3MA 2H3GX 2FXUA 3KZBA 3DXMA 4CZKA 4GV6A 4XH5A 2QM1A 4BRQA 3O4WA 4FWOA 3O9UA 4WCEL 3CCMN 3CJ9A 3O1WA 4BY9C 3AGRA 3O9RA 3QFPA 3KVGA 2F7TA 3AY9A 3ENBA 3ZX0A 3P39A 3CI5A 3GOIA 3B8AX 3ZX2A 3TSQA 3IDHA 4H5VA 1MWMA 1Y64A 2P9KB 3EZWA 1TYQA 4O8KA 4NLCA 1BU6O 1X9JA 3ATUA 3EE9A 3MWTA 4CD1A 3FGUA 3DXKA 2P9IA 3FZFA 5AQKA 2E1YA 3QBWA 2P9NB 3D2EB 5M1NA 1Z6RA 3N4PA 2E2PA 4FWLA 3WXKA 4WQ4A 2QWMA 4IZ9A 4C1NI 5GADP 2E2QA 5KQ8A 1JCFA 3KWGA 3UB5A 3ULEB 4BQLA 4M63C 5KPRA 5FPMA 1QZ5A 5AQIA 4JHDB 1QQNA 3SBTA 3TTDA 5LJWA 4GV3A 4BR4A 4BRCA 4JEPA 1NMDA 4A5BA 4DKWA 4WF9L 2IIRA 4OPAA 1YHQN 2Q1NA 1ILYA 1GLAG 2HSTA 5BPLA 1VQ8N 5AQRA 4JK8A 2WUSA 3NVMA 1YI2N 4IOAL 2VCPA 1YF5L 3R9PA 3CETA 3M6GA 3VMFB 3E66A 1M1KO 5FPNA 5AQXA 3WQUA 2PAVA 2ASOA 2P9KA 3WXLA 3C0BA 3E9PA 1GLLO 2NLXA 4IOCL 4IEIA 4B1VA 4DHYA 3CCUN 1P90A 3CPWM 3K9KA 4XH1A 3J8AA 5BRFA 2P9NA 1W2BM 4IO9L 3D7EO 3WQTA 3L6QA 3MCAB 5EOYA 5FPEA 4BR2A 4EAHD 3SAHA 5JVGL 3C7NB 1VQ9N 3ULEA 1P8ZA 1ESVA 4BGAA 5AQMA 5C0YA 4B1YB 5KPTA 5BR9A 3KHYA 3MWPA 2YHXA 4BC4A 4BG9A 2FSKA 5F0XA 3CPEA 3WXJA 5ADXH 4JD2B 4ISEA 4IJAA 1U6ZA 4BR0A 4YOUA 5CHIA 3TSPA 2QTDA 3C6AA 1BO5O 1NGHA 2NZTA 3JS6A 3VESA 4E1JA 1YJNN 3H1VX 5AFUH 4A2BA 5BPNA 4K43A 4QS8A 3DWLA 2P9SB 5EY4A 2A6AA 1Q18A 1YVNA 2GTDA 2FSNA 2P9PB 2QXLA 4CZLA 2IVPA 2JWKA 3VPZA 4BRKA 2IVNA 4FL9A 1SAZA 1IG8A 1NGCA 3CHWA 4GV9A 3P4IA 5GAGP 5C12A 4JKFA 1KC8O 3FFKB 3MDQA 3A5MC 1M90O 2NRXA 3P31A 3QBXA 1NGJA 3VEVA 3CJ7A 5H1SQ 4ILHA 3C7NA 2E2OA 2PBDA 3CQYA 3AAQA 4I6MA 3LDPA 5E26A 3LL3A 2FF3B 3GG4A 2NRWA 4AM7A 3ZEUB 4R79A 1NGIA 5JMVA 2QWPA 2GX9A 3ID6A 5AQFA 2WFBA 3CJBA 4CZGA 1YIJN 2V52B 4JK9A 3BEXA 3SAGA 2CGJA 2P9UA 4BG8A 1QQOA 3JXUA 4WFBL 2ZGZA 2OTLN 3ZETA 1E4FT 3H45C 1QHAA 4BC5A 2Q0RA 4OPHA 4EHTA 3LDLA 1HJOA 4FO0A 4H0XB 1QZ6A 2A42A 2NRVA 2P9PA 2V51B 1NJIO 3LDOA 1NGAA 2CGLA 2HMPA 5AQUA 1HKGA 1VQ5N 4CBXA 4PL7A 3CMAN 1ZXOA 4WQ4C 1VQ4N 3BF3A 4IWVA 4FWQA 5ADXA 3WT0A 3G6EN 1K73O 3AAPA 5E84A 5JLHA 3TTFA 2WBNA 3O6WA 2D4WA 1NGDA 5B8HA 3G25A 1MWKA 4DCHA 1VQKN 4BRPA 5F1XA 3ZEUA 1JCEA 4H03B 3SBGA 1VAZA 2A3ZA 1NGEA 4A62A 1R59O 3GDQA 3MCPA 1KAZA 3G71N 3OHRA 3VF2A 3FZHA 3R3LA 3HZ6A 3ZX3A 5GIOA 5GINA 3MMVA 5BN9A 1BG3A 2FLOA 2GWJA 2EWSA 3PIOL 2HF4A 4H0TB 3J7ZO 4B1UB 1DGKN 5AZIA 2NRRA 1RDUA 2VGNA 3FZMA 5AQGA 2VGMA 5AQJA 2HBMA 2F9WA 1NGFA 1KAXA 4IDHA 4OO1J 2Q97A 5MLCQ 5DM7L 2A41A 4BRIA 1QQMA 5KQDA 4JKCA 4H0PA 1RGIA 4WYBA 1XC3A 2F9TA 5GAEP 1XQSC 5AQZA 4NB4A 3OBWA 5AQSA 5EX5A 4AF1A 4CD3A 3CF5L 3WEEB 2J4RA 2QI2A 5AQPA 1X3NA 1DEJA 3CC4N 3VTIA 1T44A 3VTHA 3CC2N 3IUCA 2E8AA 1MA9B 1K8KB 2YX6A 4XH4A 3O5BA 3QICA 4BRFA 3O1BA 1VQNN 1RDWX 2BUPA 4MLHA 4BRDA 1YJWN 4H0OA 4BREA 3QB0A 2KHOA 2YJFA 4FVUA 4YDUA 2GUPA 3L0QA 3RSEB 4KH4A 5AZJB 4BC2A 1G99A 1RFQA 3DAWA 5AQWA 4FSVA 1U2VB 2P9LB 3R1XA 4JKGB 3R8EA 3MK6A 3CCJN 4BRAA 3FZLA 3O08A 3UKUB 2ASMA 4BVPA 1K8AO 1ATNA 3D2EA 5AR0A 1GLBG 5BRDA 4L3QA 4BROA 2D0PA 5JVHL 4BQZA 2GWKA 1Q81O 3VETA 3KK7A 4FWRA 3WEEA 1T6DA 4DB3A 1T6CA 1WUAA 3N4QA 3H3NO 4JHDA 3VEZA 1DKGD 5GAHP 4DQ8A 2Q2RA 2BTFA 3CXCM 2QWNA 2BH1A 2W40A 3T7ZA 1K9MO 1OVYA 1K8KA 1NGBA 4B1ZA 2D1KA 2ZGYA 3O80A 1HKCA 1TUYA 3VGLA 2ASPA 4M7XA 4WFNL 3Q7BA 1W97L 2A5XA 2Q0UA 3U8XA 5KPZA 4U67L 4MLEA 1NGGA 4FPBA 2YJEA 4FWMA 4NO7A 3U9DA 5LJVA 5AZJA 3DLLL 3E1YA 3UE5A 3QDKA 4CZFA 4JKGA 3F2KA 3HOSA 5C2DA 5AQHA 4JKBA 3NVKA 2E1ZA 3CCLN 3SK3A 4EFHA 1GLEG 4BR9A 1OKJA 4JNEA 2I7NA 3L4QA 3VEXA 3CCEN 4YOYA 3O9TA 4GY2B 3H3OB 1NLVA 1HLUA 4CZJA 5LY3A 5BREA 3NMUA 4JD2A 2QWOA 4PL8A 5ELZA 3VOVA 4CBUA 4YOTA 5M1PA 1MDUB 1YAGA 3IFRA 3VF6A 1NBWA 2ZF5O 3ENOA 1HX1A 3SAFA 3VEWA 4Z94A 3TU5A 3UKRB 3HOTA 3CCVN 2QA4N 2YI1A 4WQ5A 2P9SA 3P38A 2A40A 3LM9A 3CCQN 4CZIA 3I8BA 5F2RA 1BWFO 1J6ZA 3DXMB 2ZJQL 3EL2A 3WXIA 3PIPL 2CH6A 5AQQA 4K42A 3HTVA 1YITN 5AQNA 1ATRA 3A5OC 3SJHA 5JLFA 1NM1A 2YHYA 3ENHA 1IJJA 3W0LA 4B9QA 4H5TA 2NNWA 4UY8O 4FOIA 1ATSA 3F5TA 3QFUA 1S72N 5DM6L 1BDGA 3E9LA 3MN7A 4JKEA 4WFAL 4LC9B 4NLBA 5AFUA 3CCRN 2ZWHA 2WC9A 2V7YA 3W3DA 2I7PA 4YORA 3DXKB 1VQLN 2NRHA 2NRZA 3SMSA 3CD6N 3A5LC 4BC3A 3IKMA 4BRGA 3KWIA 3U9ZA 2QWRA 4K25A 3A5NC 3WUHA 1Q82O 4KBOA 3PLAA 3C65A 3D2FB 3DJCA 1Z05A 4IEEA 3AARA 2AA4A 2VWBA 1KD1O 1Q86O 3AGKA 2HBJA 4FWNA 3FR0A 1S22A 4RWTA 4RCHA 5CE3A 4G9ZA 1YXQA 5I9EB 4QS9A 2HF3A 4KH5A 4BR7A 5EVZA 4ISFA 4F9OA 1YUWA 3IMXA 1JJ2M 2FF6A 2V7ZA 3VERA 3LM2A 3U4LA 4FWSA 3VGMA 3OA9A 4PKIA 3CQXA 3VEYA 4Y0WA 2RHKA 4C23A 1EQYA 3M5RA 4CZEA 5CR4A 3RVCA 1HPMA 3VGKA 4BGBA 4U7BA 1O13A 2DPNA 1VQON 1QVFM 2GEMA 3I56N 2RE2A 4EIAA 1GLFO 1LCUA 4A61A 4A57A 1GLJO 4AM6A 3CCSN 3D2FA 3FLCO 2Q36A 3H6EA 4ISGA 4J8FA 3H1QA 3S41A 3EO3A 1KQSM 5C15A 4CBWA 3CJAA 4MO4A 1JCGA 3EKSA 1YJ9N 2PFUA 3GBTA 2YCHA 3A0IX 5M1OA 1BOTO 3EKUA 2W41A 2GELA 1HUXA 4A5AA 4YOWA 4A59A 5AQOA 5HOOA 5AQVA 1SQKA 2QWLA 1V4SA 2QWQA 5BN8A 2ZJRL 4CZHA 3D6RA 3M3ZA 3LDNA 4PKGA 1ZC6A 3VF4A 3BF1A 3G4SN 3BUZB 3C6HA 3FZKA 4BRMA 5C10A 4IJNA 3HI0A 2CGKA 4ILGB 2AP1A 5TKWA 2UYTA 4B1WB 1D4XA 3O9SA 3GE1A 5JICA 4WQ5C 3MX2A 4BRNA 2CH5A 4GVEA 3RSEA 4JAXA 1V4TA 3A8YA 2ITMA 5AQLA 1TUUA 3HRGA 4I6MB 4BRHA 4H5RA 4H0VB 5HL7L 1U2VA 3MN6A 2P9LA 3CJ1A 3LDQA 4FPAA 4IO8A 3O8MA 3TPQA 3WXMB 1VQ7N 2KKZA 1E4GT 3H46O 5M1KA 1HKBA 1C0GA 1EO1A 3UKUA 4CJ7A 3E9OA 4H0YB 2P9UB 1WOQA 1ZBSA 3SMPA 1VQ6N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P90 A;  1O13 A;  1T3V A;  1RDU A;  2RE2 A;  2WFB A;  2YX6 A;  2KLA A;  1EO1 A;  2QTD A; 
#chains in the Genus database with same CATH topology
 4BAC A;  4DV6 K;  3TAN A;  3HBT A;  2E20 A;  3T19 A;  4H4M A;  4DV2 K;  3R6M A;  2Q31 A;  1Q7Y O;  3CME N;  4O0J A;  4B9S A;  3CIP A;  4JK7 A;  4BVO A;  4CEO A;  4M42 A;  3M1F A;  3SLC A;  4XEI A;  5CYQ A;  4M3W A;  3OW2 M;  3CJC A;  1KXP A;  4JKA A;  1NG9 A;  3L4I A;  2ZJP L;  4A2A A;  3EE8 A;  2YNG A;  1LAV A;  3ZYY X;  1JLG A;  1BUP A;  1RDC A;  3TSU A;  1DTT A;  1EWR A;  3M8P A;  4QS7 A;  2E88 A;  1TYQ B;  4MO5 A;  1QVG M;  1BA1 A;  3LAK A;  4CI6 A;  3AVC A;  1HNZ K;  1VSL A;  2HHT A;  1N8R O;  4YDU C;  1GLC G;  2F8T A;  1WSE A;  3HSC A;  3Q7C A;  4O8U A;  5HLF A;  4BRL A;  3FE1 A;  2YHW A;  1LV5 A;  1A5V A;  4BR5 A;  1BA0 A;  3I55 N;  3HP6 A;  4JN4 A;  2HBL A;  1D9D A;  1D5A A;  1UAX A;  1SZ2 A;  2H3G X;  3DXM A;  4BRQ A;  2QM1 A;  3DRR A;  4BY9 C;  3PSI A;  3QFP A;  3K5M A;  1YT3 A;  2F7T A;  4CGI A;  3DM2 A;  2BAN A;  4CJE A;  1X9W A;  4Z4E A;  4GW6 A;  3V1R A;  1T8E A;  4H5V A;  4M3Z A;  1BU6 O;  3QLH A;  3EE9 A;  3MWT A;  1VSE A;  1BCO A;  5FRO A;  2XRI A;  2RPI A;  3FZF A;  3LAM A;  5AQK A;  1Z6R A;  4FWL A;  4E89 A;  5GAD P;  4WQ4 A;  5HRO A;  3ULE B;  4BQL A;  5KPR A;  3LPT A;  1BQN A;  1QZ5 A;  4X62 K;  5LJW A;  3SBT A;  4FJI A;  3ZSX A;  3O3G A;  4EZ6 A;  4OPA A;  1K6Y A;  5KRT A;  5BPL A;  4X66 K;  5FLX O;  2D5R A;  3NH1 A;  3VMF B;  2ZD1 A;  3E66 A;  5AQX A;  1VSD A;  2JGU A;  3NBP A;  2O8E A;  3F73 A;  1HNX K;  1TAQ A;  4DHY A;  1P90 A;  4XH1 A;  1GOB A;  3I8D A;  4IO9 L;  4LF7 K;  5JVG L;  3L6Q A;  3HVR A;  5EOY A;  4CFA A;  4BR2 A;  1VQ9 N;  4JS4 A;  4BGA A;  1JLQ A;  4B1Y B;  5HRN A;  5BR9 A;  4BC4 A;  5F0X A;  3BGR A;  3WXJ A;  3O4Q A;  4IJA A;  4DV5 K;  4LFC K;  4KTZ A;  4V19 S;  1SKR A;  4DG1 A;  3JS6 A;  3VES A;  1HRH A;  5IWA K;  4DR5 K;  4R5P A;  3H1V X;  3QIN A;  5BPN A;  4K43 A;  1RDD A;  1TV6 A;  2A6A A;  2FBV A;  1Q18 A;  4B9V A;  1YVN A;  4KFB A;  4CZL A;  3AO5 A;  2IVP A;  3D0P A;  1IG8 A;  4FZY A;  1J53 A;  3CHW A;  2PZS A;  2HNZ A;  3A5M C;  3RMC A;  1M90 O;  3QBX A;  3P31 A;  3VEV A;  3CJ7 A;  4RW7 A;  4CEC A;  5E26 A;  4H8K A;  1XWL A;  4JI3 K;  2QWP A;  1X9S A;  2WFB A;  1IKW A;  2V52 B;  1JKH A;  1RT7 A;  3SAG A;  2QKK A;  4BG8 A;  3JXU A;  2BGG A;  3OTO K;  1VSK A;  4BC5 A;  2Q0R A;  3C6T A;  2A42 A;  2NRV A;  3H08 A;  2V51 B;  3EZ5 A;  4CGJ A;  1HYV A;  2E5L K;  2KFN A;  1ZXO A;  2G8F A;  4DV4 K;  3G6E N;  3AAP A;  1VK0 A;  2KZZ A;  1S9G A;  2D4W A;  4FJG A;  5B8H A;  1VQK N;  4CFB A;  2PYL A;  5F1X A;  1KSP A;  4A62 A;  1R59 O;  3FZH A;  1BG3 A;  1NOZ A;  1LW2 A;  3ZT4 A;  1GOA A;  4B1U B;  4DTJ A;  1RDU A;  5AQG A;  5I3U A;  4DFP A;  1KAX A;  5MLC Q;  2A41 A;  1QQM A;  5KQD A;  3VQ7 A;  1N6Q A;  4CHP A;  1KLM A;  3SUQ A;  4NB4 A;  2J4R A;  3NHG A;  4Z4I A;  4B3T K;  3CC4 N;  1T44 A;  4M3U A;  2R7Y A;  1ASU A;  2IDO A;  4N76 A;  5LMU K;  4BRD A;  3KLF A;  3QB0 A;  2YJF A;  4FVU A;  2HB5 A;  3L0Q A;  1B9F A;  5AQW A;  3HPO A;  4JI6 K;  2P9L B;  3R1X A;  1U47 A;  3U6F A;  3MK6 A;  4BRA A;  4J2B A;  4CJK A;  5J2N A;  4OLB A;  4JI7 K;  4BVP A;  1ATN A;  5BRD A;  4L3Q A;  4FJJ A;  4CK2 A;  5JVH L;  1WSF A;  1WB9 A;  1T6C A;  1WUA A;  4N5S A;  3H3N O;  3VEZ A;  1XI1 A;  2Q2R A;  3CXC M;  2BH1 A;  1K9M O;  4DWI A;  1OVY A;  3OS0 A;  1NGB A;  2D1K A;  4K0K K;  1RCH A;  2ASP A;  3NDK A;  4KRE A;  4FJM A;  2YNH A;  3U8X A;  3ULD A;  4KPY A;  4M3T A;  1D8Y A;  4FJ5 A;  5AQH A;  4JKB A;  2E1Z A;  3TAQ A;  5LL6 Z;  5JS1 A;  2HHX A;  3VEX A;  4FJ9 A;  2HNY A;  3CM5 A;  1RT5 A;  3V6D A;  1J5E K;  4GY2 B;  3KD5 E;  4F2R A;  4M3R A;  2QXF A;  3CQ8 A;  1I3A A;  2F8S A;  3AVM A;  4CJS A;  1NBW A;  3HOT A;  5HBM A;  2QA4 N;  3TU5 A;  3UKR B;  4OLA A;  2DFH A;  4ZTF A;  2XY8 A;  3P38 A;  2A40 A;  1RDB A;  4IBN A;  3DLG A;  1J6Z A;  4DMN A;  3NFA A;  3DLE A;  3SUN A;  4OGC A;  4K42 A;  3HTV A;  1YIT N;  3A5O C;  1QS4 A;  3QNN A;  3ENH A;  3W0L A;  4H5T A;  4CIE A;  3AO1 A;  3L8B A;  1ATS A;  5DM6 L;  4JKE A;  2HHW A;  3KKS A;  1RT1 A;  2ZWH A;  4AHT A;  2V7Y A;  2D0B A;  2NRZ A;  4CHQ A;  4FLY A;  4CHO A;  4FM2 A;  2UXC K;  3A5N C;  4KBO A;  2ITG A;  3SV3 A;  4CJR A;  1IV0 A;  3PSF A;  3AAR A;  5KGW A;  4OPK A;  1NK7 A;  3RRH A;  3JYT A;  4RWT A;  4FLV A;  5CE3 A;  1YXQ A;  5I9E B;  2RN2 A;  3THY A;  4QS9 A;  2HF3 A;  4F9O A;  5EVZ A;  4DS4 A;  4KHN A;  1TKX A;  3IG1 A;  3L3U A;  2FF6 A;  5EU7 A;  1IG9 A;  1SV5 A;  3LM2 A;  4B8A B;  1TVR A;  3BZK A;  3VGM A;  4AH9 A;  3DYA A;  4Y0W A;  2RHK A;  4BGB A;  3RVC A;  4CEE A;  4U7B A;  3I56 N;  4A61 A;  4IG3 A;  1GLJ O;  3D2F A;  3H6E A;  1RBT A;  4LF4 K;  3EO3 A;  1JCG A;  3EKS A;  3VQD A;  3QES A;  1NJX A;  1JLF A;  1G15 A;  5M1O A;  3A0I X;  4FLW A;  4YOW A;  4A59 A;  4NXN K;  2OCE A;  3LDN A;  3PX0 A;  2HHH K;  1TK8 A;  4ELU A;  5C10 A;  4ILG B;  4LF8 K;  2UYT A;  1N5Y A;  1N36 K;  3B6O A;  2ATQ A;  5JIC A;  3HJF A;  3P1G A;  4DTX A;  4DLE A;  1TUU A;  4I6M B;  4H5R A;  5HL7 L;  4DTM A;  2P9L A;  3LDQ A;  3WXM B;  4DQQ A;  1E4G T;  3H46 O;  3V9X A;  2YNI A;  1C0G A;  1CZ9 A;  4JI1 K;  3K0S A;  1VQ6 N;  3D45 A;  2I5J A;  3OS2 A;  4EHU A;  3HM8 A;  3QNO A;  4JI0 K;  4JI4 K;  1LOT B;  3HST B;  3MEE A;  3V9S A;  2VWK A;  2OAN A;  5EXW A;  3LP1 A;  4FWP A;  2XHB A;  2X78 A;  4PHT X;  2IVO A;  3CYM A;  1U49 A;  5M1Q A;  4DU3 A;  3M8R A;  5CYM A;  3K58 A;  2QEX N;  4F4K A;  4E7L A;  1NK8 A;  4H5W A;  3LAN A;  4MDA A;  3ID8 A;  3I33 A;  3K5N A;  4IFV A;  4DLG A;  1Z25 A;  3OYE A;  2OTJ N;  1HYZ A;  2D0O A;  3TTC A;  4NCB A;  3NE6 A;  4K41 A;  4HVJ A;  4FWK A;  3CER A;  3UKR A;  4N41 A;  4HTL A;  2P5G A;  3O3H A;  1O1W A;  3JSM A;  3T69 A;  1CZA N;  4CW7 B;  4IXC A;  3VEN A;  1X3M A;  3BY5 A;  4B3O A;  3O4W A;  3O9U A;  3CCM N;  3CJ9 A;  4GVM A;  5DK5 A;  3AY9 A;  3TAP A;  3CI5 A;  4I9Q A;  4KB1 A;  1U45 A;  1ZBI A;  3J7A P;  1FKP A;  4DSE A;  3A2F A;  4M3X A;  2O8E B;  4N47 A;  3DLR A;  1CLQ A;  1WSG A;  4O8K A;  1X9J A;  3ATU A;  2QK9 A;  2WTU A;  2O4G A;  3N4P A;  4C1N I;  1TAU A;  1JCF A;  3UB5 A;  3ISN C;  1SUQ A;  1XHX A;  1SL0 A;  1QQN A;  4BR4 A;  4QOZ B;  1NMD A;  4A5B A;  4DKW A;  4ZHR A;  1TKZ A;  4BDP A;  3T1A A;  4CJQ A;  2AJQ A;  1SL1 A;  2G8W A;  2O8D B;  3NVM A;  2VCP A;  1L3S A;  3SZ2 A;  3AO3 A;  1HQU A;  3WXL A;  1VSF A;  4KB0 A;  3E9P A;  1IBL K;  2NLX A;  3AVL A;  4IEI A;  1WSI A;  3AVJ A;  5BR8 K;  2P9N A;  3SAH A;  3L3V A;  5FPE A;  3PO5 A;  5C24 A;  1I94 K;  1P8Z A;  1ESV A;  5C0Y A;  5J1E A;  3MEC A;  5SWM A;  3VQQ A;  5KPT A;  1RBR A;  4KHU A;  4K8X A;  3CPE A;  4DQS A;  4ISE A;  1YTA A;  4BR0 A;  3HPG A;  4OGE A;  3C6A A;  3T1H K;  4YHH K;  2NZT A;  1YJN N;  5EY4 A;  2O8B B;  2GTD A;  1SAZ A;  2BE2 A;  3O3F A;  3VQE A;  1T05 A;  5C12 A;  1RT3 A;  1RBS A;  5J2Q A;  2NRX A;  4ILH A;  3C7N A;  1RTJ A;  3CQY A;  3HVT A;  4I6M A;  3LDP A;  4IKF A;  2NRW A;  4R79 A;  4CJW A;  2GX9 A;  3ID6 A;  5AQF A;  3CFO A;  3BEX A;  1JL2 A;  2CGJ A;  3T3F A;  1TKD A;  2ZGZ A;  5FRN A;  4BWJ A;  3CFR A;  3SQ0 A;  3TR8 A;  2UUC K;  4FM1 A;  2HVH A;  1QZ6 A;  3LDO A;  1NGA A;  4CBX A;  4CER A;  4PL7 A;  3CMA N;  1RT6 A;  3QIP A;  1CXQ A;  3ZCM A;  2EX3 A;  4FWQ A;  5JLH A;  3TTF A;  4OKJ A;  4B3R K;  4DSL A;  1NK5 A;  3G25 A;  5LMN K;  1JXB A;  1JCE A;  3SBG A;  4JS5 A;  1NGE A;  4MQ3 A;  3MCP A;  3G71 N;  2E4L A;  3QET A;  3AA4 A;  5GIO A;  3LWM A;  3PIO L;  2O8F A;  5FRM A;  4C8N A;  4H0T B;  1HMV A;  3OYB A;  4DQI A;  5AQJ A;  3EYZ A;  4B9T A;  1NGF A;  4IDH A;  4OKK A;  2XY6 A;  3LP0 A;  2VG5 A;  4GKJ K;  2LSN A;  2OYQ A;  3SI6 A;  1XMQ K;  2O4I A;  3DMJ A;  5C42 A;  3MXM A;  1DEJ A;  3TAR A;  2E8A A;  3QIC A;  3SNN A;  3PX6 A;  1VQN N;  2UU9 K;  2BUP A;  1YJW N;  4H0O A;  4NCG A;  3RSE B;  4BC2 A;  1XC9 A;  4B9M A;  3HK2 A;  2P51 A;  2OA8 A;  1U2V B;  3CCJ N;  4I2Q A;  5KRS A;  4AQY K;  3OYF A;  2ASM A;  3LZI A;  4NYN A;  4BRO A;  1N34 K;  3WEE A;  1OVQ A;  4M3Y A;  5GAH P;  1DKG D;  2IGI A;  4CF1 A;  3NF7 A;  3OJU A;  3AVF A;  2ZGY A;  4LF6 K;  3AA3 A;  3QEX A;  1HKC A;  3VGL A;  2O8D A;  4WFN L;  1W97 L;  5KPZ A;  4CHN A;  3KK1 A;  4U67 L;  1NGG A;  4NO7 A;  3U9D A;  2A1R A;  1SKS A;  5AZJ A;  1RTH A;  1NKC A;  4KHS A;  4RW6 A;  4CZF A;  4JKG A;  3CCL N;  1RT4 A;  3SK3 A;  1GLE G;  4EP4 A;  3VQC A;  4BR9 A;  4LF9 K;  5T7B A;  2I7N A;  3CCE N;  4YOY A;  4FLZ A;  3O9T A;  1QSL A;  1NLV A;  3THW B;  4DTS A;  3LZJ A;  1FXX A;  4DR3 K;  4AHU A;  4PL8 A;  3RR7 A;  4B9N A;  4YOT A;  5M1P A;  3L2V A;  2ZF5 O;  1HX1 A;  3CCV N;  3M8S A;  2O8B A;  5J2P A;  3CCQ N;  4DSJ A;  1BWF O;  2YNF A;  3EL2 A;  3L2U A;  3PIP L;  4FYD A;  4QCL A;  3THY B;  2VWJ A;  2OPR A;  1NM1 A;  2NUB A;  4FJH A;  3HL8 A;  4FOI A;  1REV A;  1W9H A;  2YHB A;  3CCR N;  4FK2 A;  3THX B;  2NRH A;  3SMS A;  1L3T A;  3CD6 N;  1TK5 A;  3IKM A;  3U9Z A;  1Q82 O;  3WUH A;  3C65 A;  3D2F B;  5JS2 A;  5K14 A;  1VSH A;  1Q86 O;  1S6Q A;  4FWN A;  1S22 A;  5A2Q O;  4Z4G A;  2B4J A;  2HND A;  1SL2 A;  1JJ2 M;  4BWM A;  2V7Z A;  4FWS A;  1RBV A;  4FCY A;  5FDL A;  3K5L A;  3CQX A;  3V1Q A;  3MXJ A;  4FJX A;  1EQY A;  4CZE A;  1X9M A;  1QVF M;  4EIA A;  4GMJ B;  4A57 A;  3ITH A;  3CCS N;  3FLC O;  4DS5 A;  3QIO A;  3H1Q A;  1KQS M;  3LWL A;  4Y1C A;  3HPH A;  4FJ7 A;  3TAE A;  4LH5 A;  5E41 A;  2PFU A;  1YJ9 N;  1XNR K;  2ZQB A;  1N32 K;  3GBT A;  2Q3S A;  2YCH A;  1NK9 A;  5CY4 A;  3TAB A;  1SQK A;  2X6N A;  1V4S A;  4IFY A;  3OYL A;  3TWH A;  4CJT A;  1FJG K;  1ZC6 A;  3VF4 A;  3BF1 A;  1SKW A;  4B1W B;  3HI0 A;  3G0Z A;  4LF5 K;  3AVG A;  3O9S A;  4JI5 K;  3GE1 A;  4DV7 K;  4BRN A;  1HR0 K;  1WN7 A;  3U3Y A;  3RSE A;  4JAX A;  2ITM A;  1C1B A;  1OH5 A;  5AQL A;  4HCB A;  4DUY K;  3HRG A;  4DF8 A;  1VSI A;  1NJI O;  1U2V A;  4FPA A;  4IO8 A;  3TPQ A;  4FXD A;  3O8M A;  2KKZ A;  3ZSZ A;  1HKB A;  2UUA K;  2P9U B;  1WOQ A;  3LP3 A;  3SMP A;  4DU1 A;  3QEW A;  3QER A;  4JKD A;  5TKY A;  3NH0 A;  3ZT1 A;  1NJZ A;  1D9F A;  1Y97 A;  4W5N A;  3EN9 A;  4H5N A;  4DFM A;  1KLN A;  2VYP A;  3VEO A;  1C0T A;  3DLK A;  2GBZ A;  2DFF A;  3ATV A;  1U4B A;  3KLI A;  3MX5 A;  4KH6 A;  1S3X A;  4YOX A;  4TSX A;  3CC7 N;  1EET A;  2HVI A;  3V9W A;  1S1U A;  3THW A;  1KAY A;  4CZM A;  5AZI B;  4E1M A;  2HOE A;  1T3V A;  3V4I A;  1VQM N;  1HNV A;  2E2N A;  3SUP A;  4PA1 A;  1LWE A;  3MN9 A;  4ID1 A;  4Z0U A;  3NAE A;  4CVN E;  3L2R A;  1GLD G;  1NNE A;  2XO7 A;  4BDY A;  4OJR A;  1SS6 A;  2KZM A;  3O4N A;  4XH5 A;  4DFK A;  3AGR A;  3CG7 A;  3KVG A;  3KD1 E;  4CEQ A;  4CF2 A;  3ZX0 A;  3ENB A;  1TL3 A;  3GOI A;  4F8R A;  3ZX2 A;  2W6K A;  2YV0 X;  4CK1 A;  3IDH A;  1Y64 A;  3EZW A;  3AVI A;  1QSY A;  4K8Z A;  1YTU A;  4NLC A;  3THX A;  2P9I A;  2E1Y A;  3QBW A;  4CES A;  3IAY A;  2P9N B;  3D2E B;  3BZC A;  2E2P A;  4IZ9 A;  4E7J A;  5KQ8 A;  3KWG A;  4M63 C;  5AQI A;  3TTD A;  3SPZ A;  3ZSR A;  4BRC A;  3J80 O;  4FZX C;  4JEP A;  4WF9 L;  4LD0 A;  3AA5 X;  2IIR A;  1BIS A;  3TAM A;  1ILY A;  2Q1N A;  1GLA G;  2HST A;  1ZBU A;  5AQR A;  4JK8 A;  4X64 K;  1IH7 A;  1YI2 N;  1YF5 L;  3R9P A;  4PQU A;  5FPN A;  3TI0 A;  3KK2 A;  4Y1D A;  3WQU A;  4F3O A;  2P9K A;  1KTQ A;  3C0B A;  4KHQ A;  1JLE A;  1GLL O;  4IOC L;  4B1V A;  3CCU N;  3K9K A;  1W2B M;  2XY7 A;  3WQT A;  4E7K A;  1FK9 A;  3MCA B;  4EAH D;  3C7N B;  4H4O A;  5AQM A;  3KHY A;  3MWP A;  2YHX A;  1N33 K;  5ADX H;  3QEV A;  1UOC A;  1U6Z A;  4YOU A;  1OH7 A;  5CHI A;  3TSP A;  5J2M A;  1EX4 A;  4E19 A;  4CEZ A;  1L3V A;  1WAF A;  1BO5 O;  4E1J A;  1HJR A;  5AFU H;  1FKO A;  4A2B A;  1QSS A;  4QS8 A;  3DWL A;  4DUZ K;  2P9S B;  4CHZ A;  2KTQ A;  4DV0 K;  2QXL A;  3DOL A;  2FSN A;  2JWK A;  3VPZ A;  1NGC A;  4LH4 A;  4OKE A;  3P4I A;  5GAG P;  1KC8 O;  3FFK B;  3MDQ A;  4KHY A;  5H1S Q;  1NGJ A;  1QE1 A;  4KAZ A;  5HRR A;  2E2O A;  2PBD A;  3OS1 A;  3AAQ A;  2WOM A;  3OYJ A;  3DOK A;  3LL3 A;  4DR4 K;  3GG4 A;  3PUF A;  1NGI A;  3NF8 A;  1KFS A;  3CJB A;  3TAG A;  3RR8 A;  4ICL A;  2P9U A;  4JRQ A;  4WFB L;  2A1S A;  2OTL N;  2O8F B;  4YNQ A;  1E4F T;  1QHA A;  1J9A A;  3AA2 A;  2G8I A;  1HJO A;  4FO0 A;  2Z1I A;  1C6V A;  2YKN A;  4H0X B;  3T1Y K;  2P9P A;  4BDZ A;  1JLA A;  1VQ5 N;  1HYS A;  3AO4 A;  1VQ4 N;  4JI2 K;  3BF3 A;  4O5B A;  4IWV A;  4KV8 A;  5ADX A;  3WT0 A;  5E84 A;  4IG0 A;  3O6W A;  3VQ4 A;  1NOY A;  4DR1 K;  1MWK A;  4DCH A;  4LSN A;  4KHW A;  3ZEU A;  2Z1H A;  4H03 B;  3NCI A;  1VAZ A;  3GDQ A;  3VF2 A;  3HZ6 A;  5BN9 A;  2JLE A;  2FLO A;  2GWJ A;  4CFC A;  1NKE A;  2HF4 A;  3LDS A;  3U3G A;  3J7Z O;  5AZI A;  2NRR A;  2GUI A;  2IC3 A;  3FZM A;  4DTO A;  4CJP A;  4OX9 K;  5KTQ A;  3HM9 A;  4BRI A;  1KVA A;  1UWB A;  4HUF A;  4JKC A;  4H0P A;  5C25 A;  3S3O A;  4WYB A;  3EY1 A;  2F9T A;  4AHS A;  5AQZ A;  4CD3 A;  5AQS A;  3CF5 L;  3WEE B;  5AQP A;  4DTP A;  1X3N A;  2P5O A;  2F4V K;  4DR2 K;  3G10 A;  4XH4 A;  3O5B A;  3O1B A;  2DTU A;  1NK6 A;  4FM0 A;  4WE1 A;  4BRE A;  1ASV A;  2KHO A;  4PUO A;  3NF6 A;  3KIO A;  2GUP A;  2YHA A;  4KH4 A;  5AZJ B;  3DAW A;  4FSV A;  3RMB A;  4JKG B;  2F96 A;  1LAW A;  3C94 A;  3FZL A;  3WNF A;  4AIL C;  3AVB A;  1K8A O;  3D2E A;  5AR0 A;  1GLB G;  4C8O A;  4CHY A;  4BQZ A;  2GWK A;  3VET A;  3KK7 A;  1T6D A;  3N4Q A;  4DQ8 A;  4CEA A;  2BTF A;  1VSM A;  1X1P A;  2W40 A;  1BGX T;  1XNQ K;  3ALY A;  3KK3 A;  1K8K A;  4KKO A;  3IS9 A;  4CJU A;  4RW4 A;  3I0S A;  4M7X A;  2A5X A;  4MLE A;  4FPB A;  3VQP A;  2X74 A;  3UE5 A;  3OYM A;  2IOC A;  1NK0 A;  3QDK A;  5C2D A;  5AJ3 K;  4KO0 A;  2EHG A;  1JL1 A;  4EFH A;  1WBD A;  4DTN A;  3PO4 A;  3LPU A;  3H3O B;  1HLU A;  4CZJ A;  2RF2 A;  5LY3 A;  2E6L A;  2QWO A;  5ELZ A;  2D0C A;  3VOV A;  3SQ4 A;  4CBU A;  1MDU B;  1RNH A;  3VF6 A;  4KRF A;  3ENO A;  1S1W A;  1GOC A;  3KJV A;  3RTV A;  2FBX A;  2YI1 A;  2Z1J A;  1OH8 A;  2P9S A;  4DR7 K;  3LM9 A;  4HCC A;  4FK4 A;  3MEG A;  4CZI A;  5F2R A;  4OPJ A;  1IO2 A;  3WXI A;  2CH6 A;  2FC0 A;  1ZBH A;  5AQN A;  1ATR A;  3SJH A;  4B9Q A;  4FLX A;  4RG8 A;  2NNW A;  4DFJ A;  3QFU A;  4CE9 A;  1S72 N;  1ZBL A;  3E9L A;  4WFA L;  2IS3 A;  4LC9 B;  2WC9 A;  1W7A A;  3OJS A;  1WLJ A;  1J54 A;  2I7P A;  3ASM A;  4OVL A;  3DXK B;  4YOR A;  3ZT2 A;  3OY9 A;  1VQL N;  4CGH A;  3A5L C;  3P83 D;  4BC3 A;  1HQE A;  4BRG A;  3NGI A;  4K25 A;  4HUE A;  2UXD K;  3VQA A;  4KHP K;  3DJC A;  1S1V A;  1Z05 A;  4IEE A;  1C0U A;  1VSJ A;  1RBU A;  2AA4 A;  2HHU A;  3AVN A;  3FR0 A;  3JAM O;  4BE2 A;  3DLH A;  4RCH A;  3AO2 A;  4G9Z A;  5SZT A;  3SUO A;  4KH5 A;  4BR7 A;  4ELV A;  1YUW A;  3ZSO A;  3MED A;  4CFD A;  3FFI A;  4LFA K;  1S1X A;  3J81 O;  4FW2 A;  4LY7 A;  3U4L A;  4DSF A;  1KFD A;  3SV4 A;  3OA9 A;  2G8H A;  2IAJ A;  3CFP A;  3LAL A;  3DRS A;  3M5R A;  1LW0 A;  5CR4 A;  5D3G A;  3HT3 A;  2VG6 A;  1O13 A;  1VQO N;  2GEM A;  4QAG A;  3VQ8 A;  1BI4 A;  4AM6 A;  3V9Z A;  4ISG A;  4J8F A;  4DTR A;  3S3M A;  3S41 A;  5C15 A;  1RT2 A;  4CBW A;  4MO4 A;  2Y1J A;  2HMI A;  3EKU A;  4CJL A;  3VA3 A;  2GEL A;  5AQV A;  2VQE K;  2QWQ A;  4AHR A;  5BN8 A;  1CZB A;  4CZH A;  4UQG A;  3D6R A;  4NCA A;  3V81 A;  4DTU A;  3G4S N;  3C6H A;  1R0A A;  4XIU A;  4DR6 K;  2G8U A;  1DTQ A;  5TKW A;  2KW4 A;  3OYK A;  4B3M K;  4FVM A;  4WQ5 C;  5CZ1 A;  4O0I A;  4J2D A;  2PY5 A;  2CH5 A;  2DY4 A;  1S9E A;  1I39 A;  1V4T A;  3A8Y A;  4CED A;  3KKR A;  1UA0 A;  2O8C A;  3AVA A;  4H0V B;  3MN6 A;  3CJ1 A;  4E3S A;  1S1T A;  1DLO A;  1EO1 A;  4I9L A;  3E9O A;  4CJ7 A;  4H0Y B;  1IKY A;  3J7Y P;  3C6U A;  1B92 A;  2W6L A;  4B9U A;  3K5O A;  3VA0 A;  3F9K A;  4F3T A;  2JWL A;  3ZET B;  1TKT A;  3OBY A;  1C0F A;  3ZSY A;  4O4G A;  3O9Q A;  4M7Y A;  1DT9 A;  4CCH A;  2KFZ A;  4RTF D;  4IOX A;  4B1X B;  1IKX A;  4CJF A;  3PV8 A;  1VQP N;  3KLH A;  4DU4 A;  4MDB A;  4YY3 K;  3I0R A;  4C1N K;  4IFE A;  5BPM A;  5M1F A;  4I7F A;  4CJV A;  2QW9 A;  4HWI A;  3V1O A;  1NWK A;  2X6S A;  3GL1 A;  3QO9 A;  5AQT A;  2KLA A;  4FOE A;  2NRT A;  2HHV A;  3NF9 A;  3MN5 A;  3QML A;  2HW3 A;  3OYN A;  4HTU A;  4PKH A;  4ILJ A;  4DQP A;  1E3M A;  3VQ6 A;  4ID5 A;  3MXI A;  1XHZ A;  1YVU A;  5DMR A;  1VRU A;  2HHS A;  3RRG A;  5BRH A;  3K9J A;  1KCF A;  4B9L A;  4O5F A;  3VQB A;  1H1V A;  4W5T A;  3DRP A;  3BP8 A;  4GNI A;  2OPQ A;  1XUP O;  5GIP A;  3F9M A;  4YOV A;  2P9I B;  1KRP A;  1C1C A;  3ZLJ A;  4X65 K;  3ZSV A;  1NU0 A;  5C2F A;  1CXU A;  4LSL A;  4DV1 K;  4C8L A;  2FSJ A;  3OYD A;  5FPD A;  5AQY A;  4JKH A;  3NGZ A;  2HBK A;  4CZK A;  4GV6 A;  2FXU A;  3KZB A;  4NXM K;  3RWU A;  4WCE L;  4FWO A;  4J2E A;  4NYF A;  3O1W A;  3O9R A;  1EWQ A;  4E7I A;  3P39 A;  4C8K A;  3B8A X;  4Z4H A;  3TSQ A;  3ZT0 A;  2WON A;  1MWM A;  2P9K B;  4AHV A;  1TYQ A;  3OYC A;  4CD1 A;  3VQ5 A;  4FW1 A;  3FGU A;  2OZS A;  3DXK A;  3ZSQ A;  4FLU A;  4KTQ A;  5M1N A;  3MAQ A;  3WXK A;  4G1Q A;  2QWM A;  2E2Q A;  1HPZ A;  4CF0 A;  1S6P A;  1UA1 A;  1U48 A;  1HNI A;  5FPM A;  4JHD B;  4GV3 A;  1JLB A;  3E01 A;  4JV5 K;  3ZSW A;  4HUG A;  1YHQ N;  1RTI A;  1VQ8 N;  4FK0 A;  1Z26 A;  2WUS A;  4CGF A;  5HRP A;  3CET A;  3M6G A;  5HP1 A;  4LFB K;  1M1K O;  2KQ2 A;  1XMO K;  2PAV A;  2ASO A;  3HO1 A;  3OYA A;  4PY5 A;  3HYF A;  3VN5 A;  3CPW M;  1ZBF A;  3J8A A;  5BRF A;  1A5W A;  3KTQ A;  3D7E O;  4IOA L;  3ULE A;  1LWF A;  4EZ9 A;  3BDP A;  4BG9 A;  2FSK A;  4M41 A;  4JD2 B;  4JRP A;  1Q9X A;  4CGD A;  3NGY A;  3OVN A;  2QTD A;  3DI6 A;  4CJ4 A;  1NGH A;  4YFU A;  3C95 A;  4CEB A;  1RIL A;  1L3U A;  4HHT A;  2BDP A;  4DF4 A;  5I42 A;  3UIQ A;  2P9P B;  4BRK A;  2IVN A;  4FL9 A;  2FBY A;  4I2P A;  4GV9 A;  4JKF A;  4JI8 K;  3OYG A;  1T7P A;  4DSK A;  1T03 A;  2FF3 B;  5JMV A;  4AM7 A;  3ZEU B;  3KLG A;  1YIJ N;  1NMN A;  4CZG A;  4IDK A;  4JK9 A;  4CF9 A;  4E1N A;  1NK4 A;  4CEF A;  1EP4 A;  1QQO A;  1VHX A;  2G8V A;  4KTW A;  3ZET A;  3H45 C;  4OPH A;  4EHT A;  1BIU A;  3LDL A;  4KI6 A;  1WBB A;  3NH2 A;  3M8Q A;  2CGL A;  2HMP A;  5AQU A;  1HKG A;  4W5O A;  5KGX A;  4WQ4 C;  4Q0B A;  1QQC A;  1KVB A;  2DFE A;  1K73 O;  2QKB A;  3RMA A;  2ZM6 K;  2WBN A;  4JYA K;  2Z1G A;  3SJJ A;  3P5J A;  1NGD A;  3L2W A;  4BRP A;  1EKE A;  3S3N A;  2A3Z A;  2G8K A;  4O55 A;  1KAZ A;  3OHR A;  1S5J A;  3R3L A;  3ZX3 A;  5GIN A;  1RDA A;  3MMV A;  1KVC A;  5CZ2 A;  2EWS A;  4C8M A;  4J2A A;  1Q9Y A;  1DGK N;  3AVH A;  1Q8I A;  2VGN A;  2VGM A;  2XY5 A;  2D0A A;  2F9W A;  2HBM A;  4OO1 J;  2Q97 A;  5DM7 L;  2OPP A;  1RGI A;  1XC3 A;  3TAF A;  5GAE P;  1ZYQ A;  1XQS C;  3OBW A;  5EX5 A;  3K59 A;  4AF1 A;  3OYH A;  2QI2 A;  1BIZ A;  3VTI A;  1FW6 A;  3VTH A;  3CC2 N;  2B5J A;  3IUC A;  3PX4 A;  1MA9 B;  1K8K B;  2YX6 A;  4BRF A;  1RDW X;  4MLH A;  3K57 A;  1ASW A;  4YDU A;  4W5R A;  1JLC A;  1IBM K;  1G99 A;  3EEQ A;  1RFQ A;  4F2S A;  2FBT A;  3R8E A;  4CF8 A;  3O08 A;  3OYI A;  2UXB K;  3UKU B;  3LP2 A;  4FJN A;  2D0P A;  1Q81 O;  4FWR A;  4DB3 A;  4W5Q A;  4JHD A;  4FZZ A;  3SYZ A;  2QWN A;  3T7Z A;  4FJL A;  2HHQ A;  1A5X A;  3THV A;  1BQM A;  1QHT A;  4CIG A;  4B1Z A;  4ELT A;  3O80 A;  5HRS A;  2OZM A;  1BHL A;  1U04 A;  1TUY A;  3K2P A;  3Q7B A;  4FJK A;  2Q0U A;  2YJE A;  4FWM A;  1WAJ A;  5LJV A;  3DLL L;  4E7H A;  3E1Y A;  3VQ9 A;  1QTM A;  3F2K A;  3HOS A;  4BE0 A;  3DLB A;  2PYJ A;  1OH6 A;  5KI6 A;  3NVK A;  1WSH A;  4FJ8 A;  1OKJ A;  3KLE A;  4JNE A;  4BE1 A;  3L4Q A;  1NJY A;  3QEI A;  4E0D A;  2GV9 A;  1TGO A;  3ZT3 A;  5BRE A;  3NMU A;  4JD2 A;  2Y1I A;  1YAG A;  3IFR A;  3SAF A;  3VEW A;  4Z94 A;  4ZTJ A;  4WQ5 A;  4DSI A;  1MU2 A;  2ZE2 A;  3I8B A;  4CK3 A;  3DXM B;  2ZJQ L;  1BCM A;  1LWC A;  5AQQ A;  3CM6 A;  5JLF A;  3PY8 A;  3SQ1 A;  4N56 A;  2YHY A;  1IJJ A;  1J5O A;  2YKM A;  2W42 A;  4UY8 O;  4CJ3 A;  3F5T A;  1BDG A;  4CGG A;  3MN7 A;  3HP9 A;  4NLB A;  5AFU A;  3W3D A;  4DQR A;  4EP5 A;  2UUB K;  4KI4 A;  1WNS A;  3IRX A;  3KWI A;  2QWR A;  1BI4 B;  2RKI A;  3PLA A;  2VWB A;  1KD1 O;  3AGK A;  3L2Q A;  2HBJ A;  4Q5V A;  1IKV A;  1L5U A;  4GKK K;  1C1A A;  2E6M A;  4MFB A;  4ISF A;  3IMX A;  3VER A;  4B3S K;  4Z4F A;  4PKI A;  3VEY A;  4C23 A;  3WNG A;  2P1J A;  1HPM A;  3VGK A;  4B08 A;  2DPN A;  4CJ5 A;  3SCX A;  2RE2 A;  4RW8 A;  2VG7 A;  1GLF O;  1LCU A;  3SQ2 A;  3B6P A;  2O8C B;  2Q36 A;  1IBK K;  3AVK A;  1RTD A;  3CJA A;  1F21 A;  4CIF A;  4FLT A;  1HNW K;  1W0H A;  1BL3 A;  1TL1 A;  3AV9 A;  1BOT O;  2W41 A;  2OPS A;  1HUX A;  4A5A A;  5HOO A;  5AQO A;  3HXM A;  2VQF K;  2QWL A;  4Z4C A;  2ETJ A;  1ITG A;  2ZJR L;  4PWD A;  3M3Z A;  4PKG A;  1WSJ A;  1EXQ A;  2B6A A;  3BUZ B;  3FZK A;  4BRM A;  4IJN A;  2CGK A;  4M45 A;  1B9D A;  2AP1 A;  5IT9 O;  3V9U A;  4B8C A;  4DV3 K;  1JXE A;  1D4X A;  1TK0 A;  4O44 A;  3MX2 A;  1VRT A;  3S9H A;  4GVE A;  4L8R B;  3WNE A;  1NJW A;  4BRH A;  4AHC A;  3WNH A;  1VQ7 N;  4JLH A;  4RW9 A;  3QEP A;  5M1K A;  3RMD A;  1C0M A;  3UKU A;  1ZBS A;  3SPY A;  1NKB A; 
#chains in the Genus database with same CATH homology
 2JWL A;  3HBT A;  4JKD A;  5TKY A;  3HM8 A;  1C0F A;  3OBY A;  3ZET B;  2E20 A;  4EHU A;  3O9Q A;  1LOT B;  3EN9 A;  1DT9 A;  4M7Y A;  4RTF D;  3R6M A;  2OAN A;  2Q31 A;  4IOX A;  5EXW A;  4FWP A;  4B1X B;  1Q7Y O;  3CME N;  3CIP A;  4JK7 A;  4PHT X;  1VQP N;  4BVO A;  4H5N A;  4MDB A;  2IVO A;  4C1N K;  4IFE A;  2VYP A;  3M1F A;  3SLC A;  3VEO A;  5BPM A;  5M1F A;  5M1Q A;  2QW9 A;  4HWI A;  4XEI A;  1NWK A;  3OW2 M;  3CJC A;  1KXP A;  3GL1 A;  4JKA A;  3ATV A;  3L4I A;  2KLA A;  5AQT A;  2QEX N;  4FOE A;  2NRT A;  4H5W A;  3MN5 A;  4MDA A;  3MX5 A;  3ID8 A;  3QML A;  4KH6 A;  1S3X A;  3I33 A;  4YOX A;  2ZJP L;  4PKH A;  4ILJ A;  4A2A A;  3EE8 A;  3CC7 N;  3ZYY X;  1BUP A;  3TSU A;  5BRH A;  3K9J A;  1KAY A;  2OTJ N;  4CZM A;  2D0O A;  4O5F A;  5AZI B;  4QS7 A;  2HOE A;  3TTC A;  2E88 A;  1H1V A;  1TYQ B;  1T3V A;  4MO5 A;  1BA1 A;  4CI6 A;  1QVG M;  3BP8 A;  4GNI A;  1VQM N;  5GIP A;  1XUP O;  3F9M A;  4YOV A;  1N8R O;  4K41 A;  4YDU C;  1GLC G;  2E2N A;  2P9I B;  3HSC A;  3Q7C A;  4FWK A;  4O8U A;  3CER A;  4BRL A;  3FE1 A;  2YHW A;  3MN9 A;  3UKR A;  5C2F A;  4BR5 A;  1BA0 A;  4HTL A;  3I55 N;  1GLD G;  2FSJ A;  4JN4 A;  5FPD A;  2HBL A;  5AQY A;  1CZA N;  3T69 A;  4IXC A;  3VEN A;  4JKH A;  2HBK A;  1SS6 A;  1SZ2 A;  1X3M A;  2H3G X;  2FXU A;  3KZB A;  3DXM A;  4CZK A;  4GV6 A;  4XH5 A;  2QM1 A;  4BRQ A;  3O4W A;  4FWO A;  3O9U A;  4WCE L;  3CCM N;  3CJ9 A;  3O1W A;  4BY9 C;  3AGR A;  3O9R A;  3QFP A;  3KVG A;  2F7T A;  3AY9 A;  3ENB A;  3ZX0 A;  3P39 A;  3CI5 A;  3GOI A;  3B8A X;  3ZX2 A;  3TSQ A;  3IDH A;  4H5V A;  1MWM A;  1Y64 A;  2P9K B;  3EZW A;  1TYQ A;  4O8K A;  4NLC A;  1BU6 O;  1X9J A;  3ATU A;  3EE9 A;  3MWT A;  4CD1 A;  3FGU A;  3DXK A;  2P9I A;  3FZF A;  5AQK A;  2E1Y A;  3QBW A;  2P9N B;  3D2E B;  5M1N A;  1Z6R A;  3N4P A;  2E2P A;  4FWL A;  3WXK A;  4WQ4 A;  2QWM A;  4IZ9 A;  4C1N I;  5GAD P;  2E2Q A;  5KQ8 A;  1JCF A;  3KWG A;  3UB5 A;  3ULE B;  4BQL A;  4M63 C;  5KPR A;  5FPM A;  1QZ5 A;  5AQI A;  4JHD B;  1QQN A;  3SBT A;  3TTD A;  5LJW A;  4GV3 A;  4BR4 A;  4BRC A;  4JEP A;  1NMD A;  4A5B A;  4DKW A;  4WF9 L;  2IIR A;  4OPA A;  1YHQ N;  2Q1N A;  1ILY A;  1GLA G;  2HST A;  5BPL A;  1VQ8 N;  5AQR A;  4JK8 A;  2WUS A;  3NVM A;  1YI2 N;  4IOA L;  2VCP A;  1YF5 L;  3R9P A;  3CET A;  3M6G A;  3VMF B;  3E66 A;  1M1K O;  5FPN A;  5AQX A;  3WQU A;  2PAV A;  2ASO A;  2P9K A;  3WXL A;  3C0B A;  3E9P A;  1GLL O;  2NLX A;  4IOC L;  4IEI A;  4B1V A;  4DHY A;  3CCU N;  1P90 A;  3CPW M;  3K9K A;  4XH1 A;  3J8A A;  5BRF A;  2P9N A;  1W2B M;  4IO9 L;  3D7E O;  3WQT A;  3L6Q A;  3MCA B;  5EOY A;  5FPE A;  4BR2 A;  4EAH D;  3SAH A;  5JVG L;  3C7N B;  1VQ9 N;  3ULE A;  1P8Z A;  1ESV A;  4BGA A;  5AQM A;  5C0Y A;  4B1Y B;  5KPT A;  5BR9 A;  3KHY A;  3MWP A;  2YHX A;  4BC4 A;  4BG9 A;  2FSK A;  5F0X A;  3CPE A;  3WXJ A;  5ADX H;  4JD2 B;  4ISE A;  4IJA A;  1U6Z A;  4BR0 A;  4YOU A;  5CHI A;  3TSP A;  2QTD A;  3C6A A;  1BO5 O;  1NGH A;  2NZT A;  3JS6 A;  3VES A;  4E1J A;  1YJN N;  3H1V X;  5AFU H;  4A2B A;  5BPN A;  4K43 A;  4QS8 A;  3DWL A;  2P9S B;  5EY4 A;  2A6A A;  1Q18 A;  1YVN A;  2GTD A;  2FSN A;  2P9P B;  2QXL A;  4CZL A;  2IVP A;  2JWK A;  3VPZ A;  4BRK A;  2IVN A;  4FL9 A;  1SAZ A;  1IG8 A;  1NGC A;  3CHW A;  4GV9 A;  3P4I A;  5GAG P;  5C12 A;  4JKF A;  1KC8 O;  3FFK B;  3MDQ A;  3A5M C;  1M90 O;  2NRX A;  3P31 A;  3QBX A;  1NGJ A;  3VEV A;  3CJ7 A;  5H1S Q;  4ILH A;  3C7N A;  2E2O A;  2PBD A;  3CQY A;  3AAQ A;  4I6M A;  3LDP A;  5E26 A;  3LL3 A;  2FF3 B;  3GG4 A;  2NRW A;  4AM7 A;  3ZEU B;  4R79 A;  1NGI A;  5JMV A;  2QWP A;  2GX9 A;  3ID6 A;  5AQF A;  2WFB A;  3CJB A;  4CZG A;  1YIJ N;  2V52 B;  4JK9 A;  3BEX A;  3SAG A;  2CGJ A;  2P9U A;  4BG8 A;  1QQO A;  3JXU A;  4WFB L;  2ZGZ A;  2OTL N;  3ZET A;  1E4F T;  3H45 C;  1QHA A;  4BC5 A;  2Q0R A;  4OPH A;  4EHT A;  3LDL A;  1HJO A;  4FO0 A;  4H0X B;  1QZ6 A;  2A42 A;  2NRV A;  2P9P A;  2V51 B;  1NJI O;  3LDO A;  1NGA A;  2CGL A;  2HMP A;  5AQU A;  1HKG A;  1VQ5 N;  4CBX A;  4PL7 A;  3CMA N;  1ZXO A;  4WQ4 C;  1VQ4 N;  3BF3 A;  4IWV A;  4FWQ A;  5ADX A;  3WT0 A;  3G6E N;  1K73 O;  3AAP A;  5E84 A;  5JLH A;  3TTF A;  2WBN A;  3O6W A;  2D4W A;  1NGD A;  5B8H A;  3G25 A;  1MWK A;  4DCH A;  1VQK N;  4BRP A;  5F1X A;  3ZEU A;  1JCE A;  4H03 B;  3SBG A;  1VAZ A;  2A3Z A;  1NGE A;  4A62 A;  1R59 O;  3GDQ A;  3MCP A;  1KAZ A;  3G71 N;  3OHR A;  3VF2 A;  3FZH A;  3R3L A;  3HZ6 A;  3ZX3 A;  5GIO A;  5GIN A;  3MMV A;  5BN9 A;  1BG3 A;  2FLO A;  2GWJ A;  2EWS A;  3PIO L;  2HF4 A;  4H0T B;  3J7Z O;  4B1U B;  1DGK N;  5AZI A;  2NRR A;  1RDU A;  2VGN A;  3FZM A;  5AQG A;  2VGM A;  5AQJ A;  2HBM A;  2F9W A;  1NGF A;  1KAX A;  4IDH A;  4OO1 J;  2Q97 A;  5MLC Q;  5DM7 L;  2A41 A;  4BRI A;  1QQM A;  5KQD A;  4JKC A;  4H0P A;  1RGI A;  4WYB A;  1XC3 A;  2F9T A;  5GAE P;  1XQS C;  5AQZ A;  4NB4 A;  3OBW A;  5AQS A;  5EX5 A;  4AF1 A;  4CD3 A;  3CF5 L;  3WEE B;  2J4R A;  2QI2 A;  5AQP A;  1X3N A;  1DEJ A;  3CC4 N;  3VTI A;  1T44 A;  3VTH A;  3CC2 N;  3IUC A;  2E8A A;  1MA9 B;  1K8K B;  2YX6 A;  4XH4 A;  3O5B A;  3QIC A;  4BRF A;  3O1B A;  1VQN N;  1RDW X;  2BUP A;  4MLH A;  4BRD A;  1YJW N;  4H0O A;  4BRE A;  3QB0 A;  2KHO A;  2YJF A;  4FVU A;  4YDU A;  2GUP A;  3L0Q A;  3RSE B;  4KH4 A;  5AZJ B;  4BC2 A;  1G99 A;  1RFQ A;  3DAW A;  5AQW A;  4FSV A;  1U2V B;  2P9L B;  3R1X A;  4JKG B;  3R8E A;  3MK6 A;  3CCJ N;  4BRA A;  3FZL A;  3O08 A;  3UKU B;  2ASM A;  4BVP A;  1K8A O;  1ATN A;  3D2E A;  5AR0 A;  1GLB G;  5BRD A;  4L3Q A;  4BRO A;  2D0P A;  5JVH L;  4BQZ A;  2GWK A;  1Q81 O;  3VET A;  3KK7 A;  4FWR A;  3WEE A;  1T6D A;  4DB3 A;  1T6C A;  1WUA A;  3N4Q A;  3H3N O;  4JHD A;  3VEZ A;  1DKG D;  5GAH P;  4DQ8 A;  2Q2R A;  2BTF A;  3CXC M;  2QWN A;  2BH1 A;  2W40 A;  3T7Z A;  1K9M O;  1OVY A;  1K8K A;  1NGB A;  4B1Z A;  2D1K A;  2ZGY A;  3O80 A;  1HKC A;  1TUY A;  3VGL A;  2ASP A;  4M7X A;  4WFN L;  3Q7B A;  1W97 L;  2A5X A;  2Q0U A;  3U8X A;  5KPZ A;  4U67 L;  4MLE A;  1NGG A;  4FPB A;  2YJE A;  4FWM A;  4NO7 A;  3U9D A;  5LJV A;  5AZJ A;  3DLL L;  3E1Y A;  3UE5 A;  3QDK A;  4CZF A;  4JKG A;  3F2K A;  3HOS A;  5C2D A;  5AQH A;  4JKB A;  3NVK A;  2E1Z A;  3CCL N;  3SK3 A;  4EFH A;  1GLE G;  4BR9 A;  1OKJ A;  4JNE A;  2I7N A;  3L4Q A;  3VEX A;  3CCE N;  4YOY A;  3O9T A;  4GY2 B;  3H3O B;  1NLV A;  1HLU A;  4CZJ A;  5LY3 A;  5BRE A;  3NMU A;  4JD2 A;  2QWO A;  4PL8 A;  5ELZ A;  3VOV A;  4CBU A;  4YOT A;  5M1P A;  1MDU B;  1YAG A;  3IFR A;  3VF6 A;  1NBW A;  2ZF5 O;  3ENO A;  1HX1 A;  3SAF A;  3VEW A;  4Z94 A;  3TU5 A;  3UKR B;  3HOT A;  3CCV N;  2QA4 N;  2YI1 A;  4WQ5 A;  2P9S A;  3P38 A;  2A40 A;  3LM9 A;  3CCQ N;  4CZI A;  3I8B A;  5F2R A;  1BWF O;  1J6Z A;  3DXM B;  2ZJQ L;  3EL2 A;  3WXI A;  3PIP L;  2CH6 A;  5AQQ A;  4K42 A;  3HTV A;  1YIT N;  5AQN A;  1ATR A;  3A5O C;  3SJH A;  5JLF A;  1NM1 A;  2YHY A;  3ENH A;  1IJJ A;  3W0L A;  4B9Q A;  4H5T A;  2NNW A;  4UY8 O;  4FOI A;  1ATS A;  3F5T A;  3QFU A;  1S72 N;  5DM6 L;  1BDG A;  3E9L A;  3MN7 A;  4JKE A;  4WFA L;  4LC9 B;  4NLB A;  5AFU A;  3CCR N;  2ZWH A;  2WC9 A;  2V7Y A;  3W3D A;  2I7P A;  4YOR A;  3DXK B;  1VQL N;  2NRH A;  2NRZ A;  3SMS A;  3CD6 N;  3A5L C;  4BC3 A;  3IKM A;  4BRG A;  3KWI A;  3U9Z A;  2QWR A;  4K25 A;  3A5N C;  3WUH A;  1Q82 O;  4KBO A;  3PLA A;  3C65 A;  3D2F B;  3DJC A;  1Z05 A;  4IEE A;  3AAR A;  2AA4 A;  2VWB A;  1KD1 O;  1Q86 O;  3AGK A;  2HBJ A;  4FWN A;  3FR0 A;  1S22 A;  4RWT A;  4RCH A;  5CE3 A;  4G9Z A;  1YXQ A;  5I9E B;  4QS9 A;  2HF3 A;  4KH5 A;  4BR7 A;  5EVZ A;  4ISF A;  4F9O A;  1YUW A;  3IMX A;  1JJ2 M;  2FF6 A;  2V7Z A;  3VER A;  3LM2 A;  3U4L A;  4FWS A;  3VGM A;  3OA9 A;  4PKI A;  3CQX A;  3VEY A;  4Y0W A;  2RHK A;  4C23 A;  1EQY A;  3M5R A;  4CZE A;  5CR4 A;  3RVC A;  1HPM A;  3VGK A;  4BGB A;  4U7B A;  1O13 A;  2DPN A;  1VQO N;  1QVF M;  2GEM A;  3I56 N;  2RE2 A;  4EIA A;  1GLF O;  1LCU A;  4A61 A;  4A57 A;  1GLJ O;  4AM6 A;  3CCS N;  3D2F A;  3FLC O;  2Q36 A;  3H6E A;  4ISG A;  4J8F A;  3H1Q A;  3S41 A;  3EO3 A;  1KQS M;  5C15 A;  4CBW A;  3CJA A;  4MO4 A;  1JCG A;  3EKS A;  1YJ9 N;  2PFU A;  3GBT A;  2YCH A;  3A0I X;  5M1O A;  1BOT O;  3EKU A;  2W41 A;  2GEL A;  1HUX A;  4A5A A;  4YOW A;  4A59 A;  5AQO A;  5HOO A;  5AQV A;  1SQK A;  2QWL A;  1V4S A;  2QWQ A;  5BN8 A;  2ZJR L;  4CZH A;  3D6R A;  3M3Z A;  3LDN A;  4PKG A;  1ZC6 A;  3VF4 A;  3BF1 A;  3G4S N;  3BUZ B;  3C6H A;  3FZK A;  4BRM A;  5C10 A;  4IJN A;  3HI0 A;  2CGK A;  4ILG B;  2AP1 A;  5TKW A;  2UYT A;  4B1W B;  1D4X A;  3O9S A;  3GE1 A;  5JIC A;  4WQ5 C;  3MX2 A;  4BRN A;  2CH5 A;  4GVE A;  3RSE A;  4JAX A;  1V4T A;  3A8Y A;  2ITM A;  5AQL A;  1TUU A;  3HRG A;  4I6M B;  4BRH A;  4H5R A;  4H0V B;  5HL7 L;  1U2V A;  3MN6 A;  2P9L A;  3CJ1 A;  3LDQ A;  4FPA A;  4IO8 A;  3O8M A;  3TPQ A;  3WXM B;  1VQ7 N;  2KKZ A;  1E4G T;  3H46 O;  5M1K A;  1HKB A;  1C0G A;  1EO1 A;  3UKU A;  4CJ7 A;  3E9O A;  4H0Y B;  2P9U B;  1WOQ A;  1ZBS A;  3SMP A;  1VQ6 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...