2YX6A

Crystal structure of ph0822
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
110
Chain Sequence
MRVAIPAEDDRGIKSNVSKHFGRSRYFVFVDIEGEDVKNVEVVEVPFGDLPNFIKDHGAKIVLTYGIGRRAIEYFNSLGISVVTGVYGRISDVIKAFIGGKLKIDYDWKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PH0822
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PH0822
total genus 28
structure length 110
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2yx6A01
2QTDA 1P90A 2KLAA 2WFBA 1RDUA 1O13A 1EO1A 1T3VA 2RE2A 2YX6A
chains in the Genus database with same CATH superfamily
3MEEA 1V4TA 1RDCA 1D9DA 2HBJA 4JI2K 2JGUA 1XNRK 2OPQA 3AVKA 1BQMA 4H5RA 2RF2A 2XHBA 1VQNN 4LF5K 3L6QA 1NMNA 3AARA 3I8DA 3MXJA 3QIPA 4OX9K 3VA0A 1TUUA 4DU4A 3DXMA 1YJ9N 2ZE2A 4B3RK 5IT9O 4IJNA 3D0PA 4RW6A 3R1XA 3U8XA 4DU1A 3WXJA 2WONA 2KZMA 3MXIA 3WNEA 2HF3A 1VSKA 1C1AA 1RDWX 2PY5A 3VN5A 2E2QA 4EHTA 2E88A 1L5UA 1E4GT 4EFHA 3RR7A 4CERA 1W7AA 3MAQA 4JKEA 4FWMA 4LF9K 3OYKA 1HYSA 4FJXA 5HLFA 2QEXN 4YOVA 5FRNA 1CXQA 1DGKN 3CCUN 1Z25A 2AA4A 4OGEA 4LF6K 5EY4A 2NRHA 3CJ7A 3EZ5A 3TU5A 1VQPN 4DHYA 3DLLL 4WQ5C 1U2VA 5AQJA 1JLAA 3NF9A 3LPUA 1XNQK 2E4LA 2GELA 3QLHA 2ITGA 3H08A 3HPHA 1T3VA 4L3QA 2YX6A 3ZT4A 4CBWA 1S1TA 1WOQA 4B1YB 4KB1A 3VTIA 3A5OC 4CHPA 3O3FA 1ATSA 2FLOA 2HB5A 3KWGA 4AHVA 1NMDA 5F0XA 4X64K 4FL9A 4YOXA 3VQQA 5LMUK 3VEYA 3OYIA 4DTSA 4I9QA 1I94K 1T03A 5M1FA 1NOYA 1VQ4N 2WC9A 2X6NA 1VHXA 2FSNA 5AQTA 3VQDA 4CFCA 3GDQA 1TYQA 4PUOA 2ZJRL 1J5EK 5C2DA 4J2EA 3GBTA 3DXKB 4M42A 4O8UA 4CHOA 4CEEA 1TVRA 2P9NA 2Q0UA 1RT7A 1QHTA 2G8UA 4FLTA 2B6AA 4BR2A 3O4WA 2BDPA 4FJJA 2QA4N 3M8SA 2VWJA 4C1NI 4CF8A 3C6AA 3DRRA 2GWJA 4OJRA 3JXUA 3SV4A 3CPEA 4E7LA 4DTMA 3PSFA 2JLEA 3K57A 1BIUA 3MN7A 1HPMA 2O8FB 3KLHA 3UIQA 3L3UA 1I39A 5J2MA 5FPEA 1GLBG 3KTQA 1X3NA 4JKHA 3D6RA 2IVOA 4Z0UA 1VQON 4JI0K 4Z4FA 3VENA 2GUPA 2PAVA 5J2PA 1RBRA 2ASMA 4CJKA 1SZ2A 4WFBL 3OS1A 5CZ2A 4B1VA 5JLHA 5GINA 1HYZA 1C1CA 4F9OA 1NJZA 3E1YA 4CJWA 4A2BA 3CQYA 3BZKA 4CJFA 3HM8A 4JI6K 5AZIA 3ZEUA 4DR2K 1VRUA 1HPZA 1YAGA 1WBBA 5B8HA 4R79A 4JYAK 2D0CA 4DTPA 1K8AO 4AF1A 3CQXA 1BISA 1B9DA 5FLXO 3ATUA 4OGCA 2QXFA 4BRDA 3HPOA 3F2KA 3UE5A 3UKRA 2GBZA 4DTOA 5AQOA 5C25A 4BRGA 1JLCA 1C0GA 3A0IX 3QICA 4CD1A 1LAVA 1SS6A 4DU3A 4XIUA 4DR5K 4NCAA 3DWLA 3TAPA 3J81O 5AQPA 3O3HA 3O80A 4BRKA 1NK6A 5J1EA 4K41A 5M1KA 4IOCL 4FK4A 3LDPA 1TL1A 3CJ1A 4JKFA 4A57A 5JMVA 1C1BA 3V81A 3EKSA 4DR1K 4FWNA 3M1FA 1U49A 4JI8K 2OPPA 2A5XA 3KHYA 3OYHA 3R3LA 3HYFA 3S3NA 3K0SA 4FZZA 5J2NA 2P9KB 4FWSA 4BE2A 1B92A 2JWLA 1JLBA 3VTHA 3AVBA 3EN9A 4IWVA 4CIEA 3KWIA 1CZAN 3DJCA 1NK5A 3KKRA 2VG5A 5BPNA 2W42A 4DQPA 1XC3A 3D2FA 1G15A 4DV1K 4HTUA 3TPQA 4CZGA 1VQ8N 3FGUA 4ELTA 3Q7CA 2D4WA 4CK3A 2WTUA 2UXCK 4N76A 4IFEA 2GWKA 1P90A 4B8AB 4YOWA 3VQ9A 2F7TA 4QS7A 3MCPA 1X1PA 4BE0A 4A5AA 3ULEA 4M3RA 3DI6A 2QK9A 3TAMA 2ZGYA 3CCVN 1S9EA 5LY3A 2UYTA 4LFAK 4JK9A 3H1VX 4Q0BA 2XY8A 3THWA 2D5RA 3CCQN 2F96A 3FZHA 4B9NA 1HMVA 3BF1A 1HNZK 1KSPA 4NLBA 1Q86O 3T1YK 3C95A 5HRSA 4BRHA 4H0OA 5LJWA 1KLMA 2RHKA 3RR8A 4CF0A 2NRTA 1GLAG 1RILA 4BY9C 4CIGA 1RBUA 4KHUA 5GAGP 4JK8A 4ZTFA 3O9SA 3AVHA 3M8PA 4BVPA 1HYVA 3I8BA 1YHQN 1U04A 1IKVA 4A5BA 3NVKA 5JVHL 1CXUA 3KD1E 3C6TA 1DKGD 3M6GA 3O9UA 1BO5O 1JCEA 2OCEA 4H0VB 4BRCA 1WAJA 3VF6A 1GOBA 4Z4GA 4HVJA 5C15A 3DXMB 3IAYA 2HSTA 4JKCA 3F73A 4BDPA 3L2WA 3OHRA 1RT5A 2OANA 2GTDA 3VQCA 4XH1A 1ZXOA 2Q3SA 1HNIA 4L8RB 4F8RA 3OYDA 1NK9A 4DV3K 3S3OA 5TKYA 1RFQA 1R59O 4FSVA 2P1JA 4FK0A 2D0AA 3QEVA 4WQ5A 4EZ6A 3CCMN 3ENHA 3VERA 3EZWA 1X3MA 4B1WB 2NRZA 4DSLA 4WQ4A 3D7EO 2EWSA 3NBPA 3H6EA 5AZJB 5CR4A 2Z1HA 3SBTA 1SL0A 1OKJA 2RPIA 4I7FA 3NE6A 3RRGA 2O8DB 5HBMA 1RBSA 4AM6A 5AR0A 4DR7K 3AVGA 4BRIA 3LZIA 3VMFB 5F1XA 3B8AX 1KD1O 5M1PA 4IDKA 3CM6A 4H5NA 2I7PA 4CIFA 4DCHA 3DLEA 1WAFA 4M7XA 4DTJA 1DLOA 2QWPA 4OKKA 1X9WA 3G71N 4RCHA 3ID6A 3LP3A 5H1SQ 4K25A 4WQ4C 3C65A 4E19A 3IDHA 4H0YB 3DLGA 3TSQA 3SMSA 1KVBA 2B5JA 4KB0A 4CGIA 1RDDA 4ID5A 3EYZA 2BANA 4O5FA 1NK7A 3CERA 2LSNA 2P9UB 1U48A 1D9FA 3OYLA 5E26A 3AVAA 1U45A 4MFBA 5GIOA 1K8KA 3ATVA 1BIZA 4OPJA 3QB0A 2WUSA 2E1ZA 3K5MA 4GV6A 1BDGA 3A5LC 3O6WA 2RN2A 3DRPA 1TAQA 2D0OA 4QOZB 2PZSA 1OH6A 1YTUA 2Y1IA 3HP9A 2P9SB 4KTZA 5SWMA 3TI0A 5KPTA 4C8KA 4NLCA 3M5RA 3L8BA 2NRXA 5SZTA 4FO0A 4IZ9A 4O0JA 3LDSA 4PQUA 3THXA 1JCGA 4BVOA 2EHGA 3VETA 4BQLA 3SPZA 3D2EB 3PY8A 4FCYA 3CCRN 4BRNA 4PHTX 1FKOA 3SCXA 3VF4A 3VOVA 2HBLA 4IG0A 3AVIA 3VQAA 3CFRA 4TSXA 3BZCA 4WE1A 3AA2A 1MWKA 3OYAA 3CPWM 3F9MA 3WQTA 4XH4A 4IO8A 4FLZA 3FZLA 4CEQA 3NVMA 1K8KB 3DOLA 4B3SK 5EOYA 4ISEA 4B9MA 3WNGA 3SAGA 4CZIA 3C94A 4CGJA 2GX9A 2W6KA 1CLQA 1KLNA 2YNFA 3ZSOA 4FJ7A 3QNOA 3CYMA 3G25A 4WFAL 1YUWA 3RMDA 4O55A 3K5LA 3O9QA 3THVA 3EO3A 5JLFA 3LM2A 3JYTA 1LAWA 3HRGA 1Y64A 3CETA 1QS4A 4I6MB 4JI7K 1GLDG 1WN7A 4MDBA 3RMCA 4U67L 3EEQA 1EP4A 4BRMA 3AO3A 5BR8K 2O8EA 3A2FA 1HQUA 3G6EN 2YJEA 3GG4A 4E1MA 4EAHD 1FW6A 3IG1A 3CQ8A 3ITHA 2YHXA 4FVMA 4CGHA 5BRFA 1LCUA 1FJGK 2Q31A 2KFZA 1FXXA 3ZT0A 4CEDA 3QIOA 5AQQA 3OS0A 4Y1CA 5A2QO 4CJRA 4OKEA 4QAGA 3OS2A 3QEXA 2Q0RA 3ASMA 1O13A 5ADXA 4BR7A 4B8CA 3AVJA 2H3GX 1RNHA 2YNHA 3ENBA 4BWMA 1P8ZA 3A8YA 3ZETA 4JHDB 1WSEA 3MN6A 3TAGA 3FLCO 4M7YA 4E1NA 5CZ1A 5I42A 5C24A 1VQMN 4DQ8A 1Q18A 4C23A 3C6HA 3J7YP 1YI2N 3QESA 2YJFA 3FZMA 3LZJA 3E01A 5LJVA 4FLYA 2HHUA 3MECA 1T7PA 5AQKA 3I0SA 4CF1A 1VQKN 4G1QA 3J7ZO 3OYEA 3HXMA 4DFKA 1IG8A 3CMEN 3V1OA 4DSEA 1RDAA 3SQ0A 2DTUA 3GOIA 3AV9A 4FXDA 1GLCG 1O1WA 2RKIA 4KH5A 3E9LA 1EO1A 3AO1A 2E2PA 4J2DA 3H3NO 3PO5A 5AQHA 2HHXA 5LL6Z 4DSJA 5AFUH 2O8EB 2CGLA 2NZTA 5FPMA 4IKFA 4MQ3A 4JAXA 2O8BA 3VQ7A 3VEXA 2YHBA 2OZSA 2HHTA 1WSFA 2PBDA 1EXQA 1KCFA 1KC8O 1IKWA 4E7KA 1EWRA 4HCCA 3I33A 3ISNC 4JHDA 2D0PA 3NHGA 4ZHRA 1SQKA 5AQRA 1BCMA 1BCOA 3JS6A 1N6QA 3DLKA 3UKUB 1S1UA 4FW2A 4PL8A 1ITGA 1A5XA 1YJNN 3O08A 4CJEA 3DYAA 5KRTA 1Q82O 2E1YA 4H03B 4CJ5A 2QM1A 3P83D 4CFAA 5D3GA 4DG1A 4M3YA 2P9LA 4OPKA 3IUCA 3UKRB 1TUYA 3SQ2A 3NH0A 1X9SA 3THYA 2YHWA 3ZX3A 2E20A 3DM2A 4JI1K 1A5VA 3SPYA 3WXLA 2UUCK 5FRMA 1RTHA 1KRPA 3HVTA 5I9EB 5AQMA 4KREA 2CGKA 3LAKA 2ASPA 4DUZK 4FWQA 3FZKA 1GLLO 2YHAA 4IFYA 4CHNA 4WFNL 3I0RA 3VEOA 3THXB 4B9TA 2X6SA 4CEAA 3N4QA 2ZGZA 3AGRA 4N56A 1HKGA 3U9DA 4CZFA 3LWMA 3KLIA 4DV2K 4DMNA 3HBTA 5I3UA 4GV3A 4RW8A 5GIPA 5KI6A 1GLJO 1J6ZA 2G8WA 5M1QA 1HNXK 4CHZA 2Q2RA 1QQMA 1RT2A 4ICLA 2BTFA 3FFIA 1NG9A 4CVNE 3THWB 1VRTA 1QVGM 1VSHA 3WXMB 4Z4EA 1S1XA 4RTFD 2VGNA 3R9PA 2A1SA 2IS3A 4FLUA 4CHYA 3DLRA 4B1UB 4ISGA 4FOEA 1VAZA 1U47A 3ZYYX 3HZ6A 1JXEA 4NYNA 2FBTA 4C8LA 4OO1J 2QWMA 4IFVA 4ZTJA 1FKPA 4CJQA 5GADP 4IOXA 4BR4A 3V9ZA 3TTFA 4CCHA 3ID8A 4H5VA 4DLEA 2HBMA 4CJ7A 1C0TA 3B6OA 1NNEA 3BF3A 4CEZA 4X65K 2HHHK 1RTIA 3IMXA 4CZLA 4HUFA 1E3MA 1HKBA 4BR5A 3NMUA 1IH7A 2QW9A 1YITN 1IBLK 4LY7A 1SKWA 3TAEA 1XHXA 4CGGA 3ZX2A 4ID1A 2FSKA 3H1QA 4F2SA 2A1RA 1YIJN 4U7BA 5AQIA 5AQGA 3RMBA 1V4SA 5BR9A 3O4QA 1NJIO 3K9JA 2A6AA 1D4XA 1K73O 3D45A 3DOKA 4FJMA 2PYLA 1VQ6N 5KQ8A 4ILGB 4BRQA 5MLCQ 3OW2M 2HMIA 5FROA 3MMVA 3NGZA 5AZJA 4H4MA 5CY4A 4LH5A 4CK1A 4BRAA 3CCEN 2DFHA 4B1ZA 2Q36A 4KI6A 4CEOA 2FBYA 4FJKA 1S1VA 4KKOA 4FWKA 4EZ9A 4M63C 1GLFO 4CJVA 3QINA 4R5PA 5AQUA 4PA1A 1TYQB 3VGKA 3QBXA 1VSDA 3CF5L 4OLAA 4WCEL 2FSJA 3LDQA 1Z6RA 1WBDA 1HLUA 4IOAL 3AVLA 1JKHA 5AFUA 4RG8A 2DFEA 2I7NA 3OYMA 3QEWA 3AAQA 2E5LK 2Q1NA 3RSEA 2ZJQL 4JD2B 4KHNA 4KI4A 3C7NB 3LDLA 3OVNA 2QWOA 4MLHA 1FK9A 2IOCA 4LF4K 1WSHA 3MN9A 3HT3A 3H45C 2P9PB 1X9MA 4BC5A 4AH9A 4JS4A 5FPNA 1JL1A 1QSLA 4B08A 4DQRA 1LWEA 3V1QA 3TAFA 1Q7YO 4JI4K 4H0PA 4AILC 4OPHA 4Z94A 1NOZA 3MX2A 1L3VA 2FF6A 4QCLA 3CIPA 4Z4IA 2OA8A 3WNHA 1IKXA 2OTJN 4CBUA 3KK3A 4PY5A 1DEJA 1T6CA 1MU2A 4FPBA 4JKGA 5J2QA 3OBYA 4DLGA 3T3FA 4NCGA 4PWDA 4B9QA 4JLHA 4B3TK 2V52B 5AQVA 1RBVA 4IXCA 4HTLA 4JI3K 2O8BB 3PUFA 1VK0A 4CJLA 3AVNA 3LANA 4LSLA 5AQWA 3ULEB 3UB5A 3G0ZA 1SAZA 2WOMA 3H46O 1NWKA 2B4JA 3DXKA 4RW7A 4DKWA 1VQ5N 4PKHA 2VG6A 1L3UA 2FXUA 4M41A 2ASOA 1MDUB 3SJJA 1GOCA 5C12A 1TL3A 3QEPA 4LSNA 4LF7K 4GMJB 3NH2A 5BRDA 4K43A 4AHUA 3K5OA 3QDKA 3VF2A 4KH6A 2P5OA 1D5AA 3L2QA 3L2UA 4B9SA 4W5TA 3OBWA 3MXMA 2BUPA 3ZSWA 3KKSA 1NGFA 3RRHA 4RW4A 3IS9A 2X74A 5JS1A 3QFPA 3VQ8A 4DTRA 4PKGA 4FJHA 4JKAA 5C42A 3OTOK 3NF7A 3DLHA 4X62K 2YCHA 3SI6A 4CESA 3ZSQA 2W41A 4YOYA 3HSCA 1E4FT 1NKBA 1BWFO 1NGIA 3S41A 3ZSZA 3U4LA 2UUBK 3FE1A 3LWLA 4DQIA 2AJQA 5AQFA 4FW1A 1UOCA 3AVMA 4JRQA 1QVFM 4MO5A 3LDOA 3MDQA 1DTQA 4OKJA 2OTLN 1NM1A 1IKYA 3L4IA 4HUEA 1HNVA 2VGMA 4N47A 3W3DA 4FK2A 4C8MA 2ZF5O 4UQGA 4C1NK 1Q81O 4H5TA 3SAFA 4NB4A 2F4VK 4K0KK 4DSIA 4FWLA 1QHAA 3TSPA 4AHTA 1BG3A 4CJPA 4J2AA 3PIOL 2A41A 1NGBA 4DTXA 3S9HA 4DV4K 1G99A 4KTQA 3L4QA 1IBKK 1NKEA 3NGIA 5AQZA 4CE9A 1KAYA 5HOOA 3KJVA 4B3MK 4FPAA 1NGCA 2RE2A 1ASUA 3QO9A 1OH5A 4FWOA 4CGDA 3HM9A 1BQNA 1N5YA 4HHTA 4FWPA 2F8TA 3V9XA 1BOTO 1NJYA 1NGDA 1S6PA 3KVGA 3O3GA 4DV5K 1LOTB 3AA5X 1L3SA 1IV0A 4W5NA 4A62A 2UXBK 2AP1A 3ZSRA 2G8FA 4K8XA 3O1WA 4QS9A 1HR0K 4J2BA 2ITMA 2W6LA 2P9IA 3HPGA 3RWUA 5HL7L 2QI2A 4I2PA 1VQLN 4GKKK 2QXLA 2BGGA 5CHIA 3KLEA 2O8CA 1J5OA 4MDAA 2P9NB 3VESA 2GEMA 4KV8A 4FJ5A 1M1KO 1VSMA 2G8KA 4A2AA 3BEXA 3O9RA 4LF8K 3VA3A 4JN4A 3GL1A 3QETA 3ZCMA 1TKZA 3MX5A 1HUXA 1C0FA 4CFDA 5KQDA 1VSIA 3H3OB 4YDUA 4DV7K 1S6QA 1NGHA 3SJHA 1W2BM 2IC3A 4O4GA 4FLVA 3MCAB 1HQEA 5K14A 5CE3A 1Q9YA 1S5JA 3RTVA 2YNIA 3V6DA 3HK2A 3QNNA 4BR9A 3PX4A 3SYZA 1J53A 4KPYA 3P31A 3TSUA 2VQEK 2HNZA 2YKNA 5HP1A 4CEBA 4E0DA 1HJOA 4GKJK 2D1KA 5BPLA 1RT6A 2HHQA 1T6DA 4AQYK 2QWRA 3VGLA 4EHUA 2O8DA 1LW0A 2UU9K 3BY5A 3CJCA 2CH5A 3VGMA 1KVCA 4DR6K 3NAEA 1HX1A 5JVGL 3TR8A 5ADXH 2HNDA 2VQFK 1BA1A 1DTTA 4AM7A 4JKDA 2G8HA 3SUPA 1T8EA 1LW2A 4LFBK 1N32K 2F9TA 3J8AA 1YVUA 1JL2A 3S3MA 4DB3A 3G4SN 1RTDA 4DWIA 3SUOA 4FJLA 1REVA 3SBGA 4C8NA 4YNQA 4GW6A 4K8ZA 4JNEA 5KPZA 4AHRA 5BRHA 3VQ5A 4O44A 4GV9A 1WSIA 3QFUA 3O5BA 3VQ6A 3PLAA 3NDKA 4BE1A 3TTCA 3RSEB 1NU0A 3M3ZA 3RMAA 3TTDA 5EU7A 4F2RA 3LAMA 4K42A 4FJ9A 2IVNA 1EWQA 4NO7A 3HTVA 2NRVA 1U2VB 2P9IB 3SMPA 4BC3A 2OPRA 3KZBA 1J9AA 4AHCA 1MA9B 4JKGB 4Z4CA 3MN5A 1A5WA 3WUHA 4B9LA 3L3VA 3Q7BA 4CECA 3SNNA 3NCIA 4FJIA 1NLVA 4FYDA 5BREA 1NKCA 5KPRA 2YKMA 4BQZA 4B9UA 4LC9B 4CFBA 5KGXA 2P9PA 1RCHA 1T44A 2Z1JA 3VQBA 3QBWA 1JLQA 3AO5A 1XMQK 3KLGA 3SQ4A 2OPSA 4GVMA 3U9ZA 4CZKA 4BG9A 2EX3A 3L0QA 3V1RA 4CJTA 2I5JA 3KK2A 2YNGA 4DTNA 2FBXA 5M1OA 3D2EA 4B9VA 3HO1A 2Z1GA 3R8EA 4DV0K 1R0AA 2NNWA 5AZIB 3ZEUB 1BGXT 1OVYA 4KHYA 3CCSN 3MEDA 2GUIA 3MEGA 2CGJA 3J7AP 4CJSA 2P5GA 3IKMA 3AO2A 1NJWA 1BU6O 1WNSA 4EP5A 3SUNA 1S72N 3R6MA 4H0XB 3CM5A 4M3TA 1SUQA 2R7YA 2A3ZA 1QE1A 3VEWA 2GV9A 1GOAA 3PX0A 4FVUA 3W0LA 2F8SA 1JCFA 1HRHA 1JLEA 4GVEA 3I55N 3T7ZA 3CXCM 4IEIA 3MWPA 3AVFA 3WEEB 3CMAN 3CJBA 1ZC6A 4BRLA 5ELZA 4DV6K 1D8YA 1SL2A 2IAJA 4PKIA 3ULDA 4E3SA 1W9HA 3BDPA 3VQPA 2QWNA 1YXQA 2BH1A 4O0IA 3BUZB 1N8RO 3DAWA 4KTWA 4PL7A 1EX4A 1SKSA 1QSSA 1ZBLA 5KRSA 2HNYA 5AQXA 3EKUA 2KKZA 5AQYA 1QQOA 4E7JA 4NXMK 4CD3A 1VSFA 3ZT2A 2X78A 3ZT1A 3ALYA 3OYJA 4CZJA 1HKCA 2XO7A 2HF4A 1UA0A 2ZWHA 3DRSA 4DSFA 3QMLA 1X9JA 4N41A 4CJUA 2HW3A 2HVHA 3FFKB 3FR0A 3LPTA 3C6UA 4J8FA 1C0UA 3CI5A 1IG9A 3E9PA 1S9GA 3P5JA 1VQ9N 1OVQA 1UAXA 1LWCA 3KLFA 3QEIA 1KXPA 2IDOA 2E6MA 4DF8A 4CJ3A 1NK4A 5AQSA 3LDNA 5JS2A 2Y1JA 3E66A 4BGBA 3CG7A 4W5RA 4XH5A 1WB9A 3K58A 4KFBA 2F9WA 2FBVA 4DS4A 4E89A 5HRPA 4M3WA 3P1GA 1NGJA 4DQQA 3AY9A 3DMJA 2ATQA 4V19S 4BDYA 1NJXA 5DK5A 2NLXA 1ATRA 4KAZA 5TKWA 1JJ2M 4DF4A 3V9SA 5F2RA 2XRIA 1YF5L 4H8KA 3NH1A 3LP0A 2WBNA 4RW9A 1XC9A 3TARA 2YHYA 2E6LA 3ZSYA 1QTMA 1TKTA 4BRFA 4EIAA 3P4IA 3TWHA 1BA0A 2VCPA 4ISFA 3WT0A 4IG3A 4BR0A 4DUYK 1NGEA 3WNFA 3SAHA 3MWTA 5EXWA 3T19A 3M8RA 5BN8A 3M8QA 4M3ZA 4GNIA 3CFPA 1OH7A 2WFBA 3PX6A 3LALA 5CYMA 1QZ5A 2IGIA 2V7YA 3EE8A 4O5BA 2DPNA 4FM2A 2KFNA 1HJRA 3UKUA 4BC2A 4BGAA 3AVCA 1EQYA 2W40A 5EX5A 1TK5A 4KBOA 1ZYQA 5IWAK 3SQ1A 1BHLA 1U6ZA 1ATNA 3PO4A 3WXKA 4CBXA 1JLFA 4FLWA 4I9LA 2NRWA 4Z4HA 4NYFA 4GY2B 2P51A 2QKKA 1TV6A 5AQNA 4CZMA 1KVAA 3AA3A 4H5WA 1J54A 1Z05A 3EE9A 3CC4N 2V51B 3B6PA 2BE2A 4DQSA 1JXBA 3KK1A 5T7BA 4BWJA 4JRPA 2HBKA 4JS5A 1KFDA 5KGWA 4W5OA 1H1VA 3OYFA 1NBWA 1S1WA 2E2OA 2ZD1A 2A40A 4CW7B 1UA1A 2YV0X 3C7NA 3K2PA 4JD2A 1C0MA 3G10A 2XY6A 2HHSA 2KLAA 1KAZA 3OY9A 4CF9A 4NCBA 1RTJA 1Q9XA 3O8MA 3CC2N 1B9FA 2P9SA 3FZFA 1KTQA 2E8AA 1EETA 3EY1A 4DR3K 5BPMA 5KTQA 4A59A 4E1JA 2JWKA 4N5SA 1TKXA 3WEEA 3HSTB 4YFUA 1IBMK 2OYQA 3HL8A 3O4NA 3OJUA 2KW4A 5E84A 4Q5VA 3NF6A 2DY4A 3TABA 3PSIA 2XY5A 1ESVA 5DM7L 2ZJPL 1ZBHA 1F21A 4A61A 3HJFA 4BC4A 4BACA 3LP1A 4FM0A 2YI1A 1L3TA 3F9KA 2O4IA 2V7ZA 4DTUA 4JK7A 1QSYA 1SV5A 4YY3K 3PIPL 1YT3A 4CGFA 1Z26A 4CHQA 3HVRA 2ZQBA 3CFOA 2HHWA 3I56N 1IJJA 2KQ2A 5LMNK 4B3OA 1Y97A 1ILYA 3A5NC 4HWIA 4G9ZA 4F4KA 4FZYA 1TAUA 4H0TB 4IDHA 3NFAA 1WSJA 1IO2A 1RDUA 1VSEA 5DMRA 3OYCA 1NK0A 1ZBFA 4EP4A 1W97L 2E2NA 1LWFA 1OH8A 4OLBA 1ZBIA 3VEZA 4H4OA 1NGGA 4F3OA 4O8KA 2A42A 4LFCK 3EL2A 2Z1IA 3V9WA 3MK6A 1VQ7N 4FZXC 5DM6L 4KHWA 4LH4A 1VSJA 4FM1A 2D0BA 2OZMA 3N4PA 1XI1A 1QZ6A 1CZBA 3TANA 5FPDA 1K9MO 1XQSC 2HMPA 1RT4A 3NGYA 1QQNA 5JICA 4Y1DA 4IJAA 2G8VA 3IRXA 3KD5E 2P9UA 4MO4A 1GLEG 4JI5K 4CJ4A 3P38A 3DLBA 1KQSM 2KTQA 3JAMO 4FWRA 1VSLA 2DFFA 2PYJA 4IO9L 3RVCA 1RT3A 3HOSA 1NK8A 3T1AA 3P39A 4ILJA 5C2FA 4NXNK 2J4RA 4BREA 3A5MC 4Y0WA 1XWLA 4DSKA 3VEVA 3WQUA 3HOTA 3ZLJA 4CI6A 3O1BA 3JSMA 1KAXA 2O4GA 3ZX0A 2IIRA 2VYPA 3V4IA 1S3XA 2UUAK 3OYBA 1U4BA 3CCJN 3KIOA 4E7HA 3THYB 3T69A 3U6FA 4DS5A 3E9OA 2P9LB 1NGAA 1ASWA 4X66K 1TGOA 1W0HA 1XUPO 4OVLA 3ZETB 3V9UA 1BL3A 2QWLA 4BG8A 4BDZA 2VWBA 4I6MA 2NUBA 3O9TA 2FF3B 1RGIA 3OA9A 1SKRA 4FLXA 4YOUA 5GAHP 3U3GA 3VQ4A 4FOIA 4YDUC 4ELUA 1N33K 4CK2A 1T05A 2NRRA 1WSGA 3LP2A 4JKBA 4IEEA 4DFJA 5C0YA 5AQLA 3OYNA 1RT1A 3HI0A 3C0BA 4CEFA 3BP8A 3SZ2A 1SL1A 1M90O 3VPZA 4YHHK 3CJ9A 5M1NA 4F3TA 3D2FB 2ZM6K 3OYGA 1ZBSA 5E41A 4MLEA 3K5NA 3SV3A 3T1HK 4WYBA 2QTDA 2Q97A 3OJSA 1WLJA 2O8CB 2P9KA 4DR4K 3CCLN 1ZBUA 4HUGA 4E7IA 5HRNA 1Q8IA 5HRRA 1YVNA 4M3XA 5GAEP 5BN9A 2HVIA 4KHPK 1ASVA 4KH4A 4M3UA 4I2QA 2CH6A 5CYQA 3U3YA 4KHQA 1XHZA 2FC0A 3SLCA 3L2RA 4FJ8A 2QWQA 2VG7A 3CC7N 2HHVA 4KO0A 4QS8A 1BI4A 5FDLA 1YJWN 2XY7A 4IBNA 1UWBA 1TK8A 4CZEA 4BRPA 4FJNA 3GE1A 3L2VA 3F5TA 1MWMA 3SK3A 1EKEA 3AGKA 3HP6A 1KFSA 4OPAA 2HOEA 2UXDK 3IFRA 4YORA 4ELVA 5HROA 3CHWA 3LM9A 5EVZA 4AHSA 3ZSXA 4RWTA 5C10A 2QKBA 2IVPA 3CJAA 3AAPA 1HNWK 1TKDA 3NF8A 4KHSA 4ILHA 4FJGA 4LD0A 1N36K 1I3AA 1YTAA 3KK7A 2G8IA 1BUPA 1S22A 4UY8O 3VQEA 1C6VA 1QQCA 1LV5A 1CZ9A 4WF9L 4XEIA 1TK0A 1WUAA 3WXIA 3TAQA 4C8OA 4KRFA 4B1XB 3BGRA 2KHOA 3K9KA 2PFUA 3ZSVA 1RDBA 4M45A 2KZZA 4CF2A 4CZHA 2O8FA 3ENOA 1JLGA 1RBTA 1XMOK 1N34K 3J80O 5AJ3K 4DFPA 3PV8A 3AO4A 4W5QA 4BROA 3CD6N 3AA4A 4YOTA 1BI4B 1K6YA 2VWKA 1DT9A 4DFMA 4JV5K 3ZT3A 4HCBA 3QERA 3SUQA 2ETJA 3LL3A 3K59A 4JEPA
chains in the Genus database with same CATH topology
3DXKA 1V4TA 2P9SB 5F2RA 4DKWA 1YF5L 2HBJA 1VQ5N 4PKHA 2WBNA 2FXUA 5KPTA 4NLCA 2ASOA 3M5RA 4H5RA 2NRXA 1MDUB 5C12A 4FO0A 4IZ9A 1VQNN 2YHYA 4BRFA 4EIAA 3P4IA 3L6QA 1JCGA 3AARA 4BVOA 4K43A 3VETA 5BRDA 4BQLA 3QDKA 1BA0A 2VCPA 3D2EB 3VF2A 4ISFA 4KH6A 3WT0A 1TUUA 4BR0A 3CCRN 1NGEA 3SAHA 4BRNA 3MWTA 4PHTX 5EXWA 3DXMA 3OBWA 5BN8A 3VF4A 1YJ9N 4GNIA 2BUPA 4IJNA 3R1XA 3U8XA 1NGFA 3WXJA 3VOVA 2HBLA 2WFBA 3QFPA 2HF3A 1MWKA 4PKGA 4JKAA 1QZ5A 1RDWX 3CPWM 3F9MA 2V7YA 2YCHA 3WQTA 3EE8A 4XH4A 2DPNA 4IO8A 2W41A 3UKUA 2E2QA 4EHTA 2E88A 4YOYA 4BC2A 1E4GT 3HSCA 3FZLA 4EFHA 3NVMA 1K8KB 4BGAA 1E4FT 1EQYA 4JKEA 4ISEA 5EOYA 2W40A 4FWMA 5EX5A 3SAGA 4CZIA 1BWFO 1NGIA 2GX9A 4KBOA 3S41A 3U4LA 4YOVA 2QEXN 1DGKN 3FE1A 3CCUN 2AA4A 5EY4A 1U6ZA 1ATNA 2NRHA 3CJ7A 5AQFA 3WXKA 4CBXA 3TU5A 1VQPN 1QVFM 4DHYA 4MO5A 3DLLL 3G25A 3LDOA 4WFAL 1YUWA 4WQ5C 3MDQA 2NRWA 1U2VA 5AQJA 3O9QA 2GELA 3EO3A 4GY2B 3LM2A 1T3VA 4L3QA 3HRGA 5JLFA 2YX6A 5AQNA 1Y64A 3CETA 4CBWA 4CZMA 1NM1A 1WOQA 4I6MB 4H5WA 4B1YB 1GLDG 3CC4N 1Z05A 3EE9A 3VTIA 3A5OC 2V51B 3L4IA 2VGMA 3W3DA 4MDBA 1ATSA 2FLOA 4U67L 3KWGA 1NMDA 5F0XA 2ZF5O 2HBKA 4BRMA 4C1NK 1Q81O 4H5TA 3SAFA 4NB4A 3G6EN 2YJEA 3GG4A 1H1VA 4EAHD 4FL9A 4FWLA 4YOXA 1QHAA 3TSPA 3VEYA 1BG3A 1NBWA 2E2OA 2A40A 3C7NA 3PIOL 2A41A 5M1FA 1NGBA 2YHXA 1VQ4N 2WC9A 4JD2A 2FSNA 5AQTA 5BRFA 1G99A 2KLAA 1KAZA 1LCUA 3GDQA 1TYQA 3L4QA 5AQZA 5HOOA 1KAYA 2ZJRL 2Q31A 4FPAA 1NGCA 5C2DA 2RE2A 3O8MA 3CC2N 2P9SA 3FZFA 3GBTA 2E8AA 5AQQA 3DXKB 4FWOA 4O8UA 5BPMA 4A59A 4E1JA 2JWKA 3WEEA 2P9NA 2Q0UA 4FWPA 2Q0RA 5E84A 1BOTO 1O13A 4BR2A 3O4WA 5ADXA 4BR7A 2QA4N 4C1NI 2H3GX 1NGDA 3C6AA 2GWJA 3JXUA 3KVGA 3ENBA 1P8ZA 1ESVA 3A8YA 3CPEA 5DM7L 1LOTB 3ZETA 4JHDB 2ZJPL 3MN6A 4A61A 4A62A 2AP1A 3FLCO 4BC4A 3MN7A 4M7YA 3O1WA 4QS9A 1HPMA 2ITMA 2P9IA 2YI1A 1VQMN 4DQ8A 1Q18A 4C23A 2V7ZA 5HL7L 5FPEA 2QI2A 3C6HA 1GLBG 4JK7A 2QXLA 1X3NA 1VQLN 3PIPL 4JKHA 3D6RA 2IVOA 5CHIA 1YI2N 1VQON 2YJFA 3VENA 2GUPA 2PAVA 3FZMA 4MDAA 2P9NB 3VESA 2GEMA 5LJVA 2ASMA 4WFBL 1SZ2A 3I56N 1IJJA 4B1VA 1M1KO 1ILYA 5JLHA 4A2AA 5GINA 3A5NC 5AQKA 1VQKN 4HWIA 3BEXA 4G9ZA 4F9OA 3J7ZO 4H0TB 4IDHA 3O9RA 3E1YA 3CMEN 1IG8A 1RDUA 4A2BA 3CQYA 4JN4A 3GL1A 3HM8A 3MX5A 5AZIA 3ZEUA 3GOIA 1HUXA 1GLCG 1W97L 4KH5A 1C0FA 3E9LA 5KQDA 1EO1A 1YAGA 2E2PA 2E2NA 5B8HA 4R79A 3H3NO 1K8AO 5AQHA 4AF1A 3H3OB 4YDUA 3CQXA 3VEZA 1NGHA 3SJHA 1W2BM 1NGGA 5AFUH 4O8KA 2CGLA 2A42A 3MCAB 5CE3A 2NZTA 3EL2A 3ATUA 5FPMA 4BRDA 3MK6A 4BR9A 3F2KA 4JAXA 1VQ7N 3VEXA 3P31A 3TSUA 5DM6L 3UE5A 3UKRA 2PBDA 5AQOA 1KC8O 1HJOA 4BRGA 3N4PA 3A0IX 1C0GA 2D1KA 1QZ6A 3QICA 4CD1A 5BPLA 3I33A 5FPDA 4JHDA 1K9MO 1SS6A 1T6DA 1XQSC 2D0PA 2QWRA 1SQKA 2HMPA 3DWLA 5AQRA 3VGLA 4EHUA 3JS6A 5AQPA 1QQNA 3CJCA 3UKUB 5JICA 3O80A 2CH5A 4BRKA 4IJAA 3VGMA 4K41A 1HX1A 4PL8A 5M1KA 5JVGL 4IOCL 5ADXH 3LDPA 4JKFA 3CJ1A 1YJNN 4A57A 3O08A 5JMVA 3EKSA 1Q82O 1BA1A 2E1YA 4FWNA 4H03B 4JKDA 4AM7A 2P9UA 2QM1A 3M1FA 4MO4A 1GLEG 2A5XA 3P38A 2P9LA 2F9TA 3J8AA 3KHYA 1KQSM 3R3LA 4FWRA 3IUCA 3UKRB 1TUYA 4DB3A 3G4SN 2P9KB 4FWSA 4IO9L 3RVCA 2YHWA 3HOSA 2E20A 2JWLA 3ZX3A 3P39A 3VTHA 4ILJA 5C2FA 3EN9A 3SBGA 4IWVA 2J4RA 3WXLA 3KWIA 4BREA 1CZAN 3A5MC 3DJCA 4JNEA 4Y0WA 5BRHA 5KPZA 5BPNA 3VEVA 5I9EB 1XC3A 5AQMA 3WQUA 3D2FA 3HOTA 2CGKA 4GV9A 2ASPA 3QFUA 3TPQA 3O5BA 4CI6A 4CZGA 3O1BA 1VQ8N 4FWQA 3FGUA 3PLAA 3FZKA 1GLLO 4WFNL 1KAXA 3Q7CA 2D4WA 3TTCA 3VEOA 3ZX0A 3RSEB 2IIRA 2VYPA 1S3XA 4IFEA 3M3ZA 3CCJN 3N4QA 2GWKA 3TTDA 1P90A 3AGRA 2ZGZA 4YOWA 2F7TA 3T69A 1HKGA 4QS7A 3MCPA 3U9DA 4CZFA 4K42A 2IVNA 3E9OA 2P9LB 4NO7A 3HTVA 2P9IB 1U2VB 2NRVA 3HBTA 1NGAA 3SMPA 4BC3A 4A5AA 3ULEA 3KZBA 4GV3A 5GIPA 1XUPO 2ZGYA 3CCVN 1MA9B 3ZETB 1GLJO 1J6ZA 2UYTA 4JKGB 5LY3A 3MN5A 4JK9A 3H1VX 5M1QA 2QWLA 4BG8A 2Q2RA 1QQMA 3WUHA 2VWBA 3CCQN 3Q7BA 4I6MA 3O9TA 3FZHA 2BTFA 2FF3B 1NLVA 3BF1A 1RGIA 3OA9A 5BREA 4NLBA 1QVGM 5KPRA 1Q86O 4YOUA 3WXMB 4H0OA 4BRHA 5LJWA 5GAHP 4RTFD 2VGNA 4BQZA 4FOIA 4YDUC 3R9PA 2RHKA 4LC9B 2NRRA 2NRTA 1GLAG 2P9PA 4B1UB 4ISGA 4JKBA 4FOEA 4IEEA 1T44A 1VAZA 4BY9C 5C0YA 5AQLA 3ZYYX 3HI0A 3QBWA 3HZ6A 5GAGP 3C0BA 4JK8A 3H46O 4OO1J 2QWMA 3BP8A 3O9SA 4BVPA 5GADP 4IOXA 4BR4A 3I8BA 3U9ZA 4CZKA 1YHQN 1M90O 3VPZA 4BG9A 3TTFA 3CJ9A 3ID8A 4H5VA 5M1NA 4A5BA 3L0QA 3D2FB 3NVKA 2HBMA 4CJ7A 3BF3A 5M1OA 1ZBSA 3D2EA 5JVHL 3R8EA 2NNWA 4MLEA 5AZIB 3ZEUB 1DKGD 3M6GA 3O9UA 1BO5O 3IMXA 4WYBA 1JCEA 2QTDA 4CZLA 4H0VB 2Q97A 1OVYA 4BRCA 3VF6A 3CCSN 1HKBA 4BR5A 2P9KA 5C15A 3NMUA 3DXMB 2CGJA 2QW9A 2HSTA 1YITN 3CCLN 4JKCA 3IKMA 3OHRA 3ZX2A 1BU6O 1YVNA 2FSKA 3H1QA 5BN9A 5GAEP 1S72N 4KH4A 3R6MA 4U7BA 1YIJN 2OANA 4H0XB 2GTDA 5AQIA 5AQGA 4XH1A 1ZXOA 1V4SA 5BR9A 1NJIO 3K9JA 2A6AA 1D4XA 2A3ZA 2CH6A 1K73O 3VEWA 5TKYA 1VQ6N 5KQ8A 4FVUA 1RFQA 3SLCA 1R59O 3W0LA 4FSVA 2QWQA 4ILGB 1JCFA 4BRQA 5MLCQ 3OW2M 3CC7N 4GVEA 3I55N 4WQ5A 3T7ZA 4QS8A 3CXCM 3CCMN 3ENHA 3MMVA 4IEIA 3VERA 3EZWA 3MWPA 5AZJA 1YJWN 1X3MA 4B1WB 4BRAA 3CCEN 2NRZA 3WEEB 4B1ZA 3CMAN 2Q36A 4WQ4A 3CJBA 2EWSA 1ZC6A 3D7EO 4BRLA 5ELZA 3H6EA 4CZEA 5AZJB 5CR4A 4BRPA 4PKIA 4FWKA 3GE1A 4M63C 1GLFO 3SBTA 2QWNA 1YXQA 3F5TA 1MWMA 3SK3A 3AGKA 1OKJA 2BH1A 3BUZB 4OPAA 5AQUA 1N8RO 3DAWA 1TYQB 3VGKA 4PL7A 4AM6A 5AR0A 2HOEA 3QBXA 4BRIA 3VMFB 3CF5L 3IFRA 4YORA 4WCEL 5F1XA 5AQXA 3CHWA 2FSJA 3LDQA 3B8AX 1KD1O 1Z6RA 5M1PA 1HLUA 4IOAL 3EKUA 3LM9A 5AFUA 5EVZA 4H5NA 2KKZA 5AQYA 4RWTA 5C10A 2I7PA 1QQOA 2I7NA 4CD3A 2IVPA 3CJAA 3AAQA 3AAPA 4DCHA 2Q1NA 3RSEA 4M7XA 2ZJQL 4ILHA 4JD2B 2QWPA 4CZJA 1HKCA 3G71N 4RCHA 3C7NB 3LDLA 4MLHA 2QWOA 2HF4A 3ID6A 3KK7A 2ZWHA 3MN9A 1BUPA 5H1SQ 1S22A 3H45C 4UY8O 2P9PB 4K25A 4WQ4C 4BC5A 3QMLA 1X9JA 3C65A 4XEIA 5FPNA 4WF9L 1WUAA 3WXIA 4B1XB 3IDHA 4H0YB 1Q7YO 2KHOA 4H0PA 3SMSA 3FFKB 3TSQA 3FR0A 3K9KA 2PFUA 4OPHA 4Z94A 4J8FA 3CI5A 3MX2A 2FF6A 3E9PA 1VQ9N 3CIPA 4CZHA 4O5FA 1KXPA 3CERA 3ENOA 2OTJN 2P9UB 5AQSA 4CBUA 3LDNA 1DEJA 1T6CA 4FPBA 4JKGA 3CD6N 4BROA 5E26A 3E66A 4BGBA 3OBYA 4XH5A 5GIOA 1K8KA 3ATVA 4YOTA 2OTLN 2F9WA 4B9QA 1DT9A 3QB0A 2V52B 2WUSA 1NGJA 2E1ZA 3AY9A 5AQVA 4GV6A 1BDGA 4IXCA 3A5LC 3O6WA 4HTLA 2NLXA 1ATRA 5AQWA 3LL3A 3ULEB 2D0OA 5TKWA 3UB5A 1SAZA 1JJ2M 1NWKA 4JEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QTD A;  1P90 A;  2KLA A;  2WFB A;  1RDU A;  1O13 A;  1EO1 A;  1T3V A;  2RE2 A;  2YX6 A; 
#chains in the Genus database with same CATH topology
 3MEE A;  1V4T A;  1RDC A;  1D9D A;  2HBJ A;  4JI2 K;  2JGU A;  1XNR K;  2OPQ A;  3AVK A;  1BQM A;  4H5R A;  2RF2 A;  2XHB A;  1VQN N;  4LF5 K;  3L6Q A;  1NMN A;  3AAR A;  3I8D A;  3MXJ A;  3QIP A;  4OX9 K;  3VA0 A;  1TUU A;  4DU4 A;  3DXM A;  1YJ9 N;  2ZE2 A;  4B3R K;  5IT9 O;  4IJN A;  3D0P A;  4RW6 A;  3R1X A;  3U8X A;  4DU1 A;  3WXJ A;  2WON A;  2KZM A;  3MXI A;  3WNE A;  2HF3 A;  1VSK A;  1C1A A;  1RDW X;  2PY5 A;  3VN5 A;  2E2Q A;  4EHT A;  2E88 A;  1L5U A;  1E4G T;  4EFH A;  3RR7 A;  4CER A;  1W7A A;  3MAQ A;  4JKE A;  4FWM A;  4LF9 K;  3OYK A;  1HYS A;  4FJX A;  5HLF A;  2QEX N;  4YOV A;  5FRN A;  1CXQ A;  1DGK N;  3CCU N;  1Z25 A;  2AA4 A;  4OGE A;  4LF6 K;  5EY4 A;  2NRH A;  3CJ7 A;  3EZ5 A;  3TU5 A;  1VQP N;  4DHY A;  3DLL L;  4WQ5 C;  1U2V A;  5AQJ A;  1JLA A;  3NF9 A;  3LPU A;  1XNQ K;  2E4L A;  2GEL A;  3QLH A;  2ITG A;  3H08 A;  3HPH A;  1T3V A;  4L3Q A;  2YX6 A;  3ZT4 A;  4CBW A;  1S1T A;  1WOQ A;  4B1Y B;  4KB1 A;  3VTI A;  3A5O C;  4CHP A;  3O3F A;  1ATS A;  2FLO A;  2HB5 A;  3KWG A;  4AHV A;  1NMD A;  5F0X A;  4X64 K;  4FL9 A;  4YOX A;  3VQQ A;  5LMU K;  3VEY A;  3OYI A;  4DTS A;  4I9Q A;  1I94 K;  1T03 A;  5M1F A;  1NOY A;  1VQ4 N;  2WC9 A;  2X6N A;  1VHX A;  2FSN A;  5AQT A;  3VQD A;  4CFC A;  3GDQ A;  1TYQ A;  4PUO A;  2ZJR L;  1J5E K;  5C2D A;  4J2E A;  3GBT A;  3DXK B;  4M42 A;  4O8U A;  4CHO A;  4CEE A;  1TVR A;  2P9N A;  2Q0U A;  1RT7 A;  1QHT A;  2G8U A;  4FLT A;  2B6A A;  4BR2 A;  3O4W A;  2BDP A;  4FJJ A;  2QA4 N;  3M8S A;  2VWJ A;  4C1N I;  4CF8 A;  3C6A A;  3DRR A;  2GWJ A;  4OJR A;  3JXU A;  3SV4 A;  3CPE A;  4E7L A;  4DTM A;  3PSF A;  2JLE A;  3K57 A;  1BIU A;  3MN7 A;  1HPM A;  2O8F B;  3KLH A;  3UIQ A;  3L3U A;  1I39 A;  5J2M A;  5FPE A;  1GLB G;  3KTQ A;  1X3N A;  4JKH A;  3D6R A;  2IVO A;  4Z0U A;  1VQO N;  4JI0 K;  4Z4F A;  3VEN A;  2GUP A;  2PAV A;  5J2P A;  1RBR A;  2ASM A;  4CJK A;  1SZ2 A;  4WFB L;  3OS1 A;  5CZ2 A;  4B1V A;  5JLH A;  5GIN A;  1HYZ A;  1C1C A;  4F9O A;  1NJZ A;  3E1Y A;  4CJW A;  4A2B A;  3CQY A;  3BZK A;  4CJF A;  3HM8 A;  4JI6 K;  5AZI A;  3ZEU A;  4DR2 K;  1VRU A;  1HPZ A;  1YAG A;  1WBB A;  5B8H A;  4R79 A;  4JYA K;  2D0C A;  4DTP A;  1K8A O;  4AF1 A;  3CQX A;  1BIS A;  1B9D A;  5FLX O;  3ATU A;  4OGC A;  2QXF A;  4BRD A;  3HPO A;  3F2K A;  3UE5 A;  3UKR A;  2GBZ A;  4DTO A;  5AQO A;  5C25 A;  4BRG A;  1JLC A;  1C0G A;  3A0I X;  3QIC A;  4CD1 A;  1LAV A;  1SS6 A;  4DU3 A;  4XIU A;  4DR5 K;  4NCA A;  3DWL A;  3TAP A;  3J81 O;  5AQP A;  3O3H A;  3O80 A;  4BRK A;  1NK6 A;  5J1E A;  4K41 A;  5M1K A;  4IOC L;  4FK4 A;  3LDP A;  1TL1 A;  3CJ1 A;  4JKF A;  4A57 A;  5JMV A;  1C1B A;  3V81 A;  3EKS A;  4DR1 K;  4FWN A;  3M1F A;  1U49 A;  4JI8 K;  2OPP A;  2A5X A;  3KHY A;  3OYH A;  3R3L A;  3HYF A;  3S3N A;  3K0S A;  4FZZ A;  5J2N A;  2P9K B;  4FWS A;  4BE2 A;  1B92 A;  2JWL A;  1JLB A;  3VTH A;  3AVB A;  3EN9 A;  4IWV A;  4CIE A;  3KWI A;  1CZA N;  3DJC A;  1NK5 A;  3KKR A;  2VG5 A;  5BPN A;  2W42 A;  4DQP A;  1XC3 A;  3D2F A;  1G15 A;  4DV1 K;  4HTU A;  3TPQ A;  4CZG A;  1VQ8 N;  3FGU A;  4ELT A;  3Q7C A;  2D4W A;  4CK3 A;  2WTU A;  2UXC K;  4N76 A;  4IFE A;  2GWK A;  1P90 A;  4B8A B;  4YOW A;  3VQ9 A;  2F7T A;  4QS7 A;  3MCP A;  1X1P A;  4BE0 A;  4A5A A;  3ULE A;  4M3R A;  3DI6 A;  2QK9 A;  3TAM A;  2ZGY A;  3CCV N;  1S9E A;  5LY3 A;  2UYT A;  4LFA K;  4JK9 A;  3H1V X;  4Q0B A;  2XY8 A;  3THW A;  2D5R A;  3CCQ N;  2F96 A;  3FZH A;  4B9N A;  1HMV A;  3BF1 A;  1HNZ K;  1KSP A;  4NLB A;  1Q86 O;  3T1Y K;  3C95 A;  5HRS A;  4BRH A;  4H0O A;  5LJW A;  1KLM A;  2RHK A;  3RR8 A;  4CF0 A;  2NRT A;  1GLA G;  1RIL A;  4BY9 C;  4CIG A;  1RBU A;  4KHU A;  5GAG P;  4JK8 A;  4ZTF A;  3O9S A;  3AVH A;  3M8P A;  4BVP A;  1HYV A;  3I8B A;  1YHQ N;  1U04 A;  1IKV A;  4A5B A;  3NVK A;  5JVH L;  1CXU A;  3KD1 E;  3C6T A;  1DKG D;  3M6G A;  3O9U A;  1BO5 O;  1JCE A;  2OCE A;  4H0V B;  4BRC A;  1WAJ A;  3VF6 A;  1GOB A;  4Z4G A;  4HVJ A;  5C15 A;  3DXM B;  3IAY A;  2HST A;  4JKC A;  3F73 A;  4BDP A;  3L2W A;  3OHR A;  1RT5 A;  2OAN A;  2GTD A;  3VQC A;  4XH1 A;  1ZXO A;  2Q3S A;  1HNI A;  4L8R B;  4F8R A;  3OYD A;  1NK9 A;  4DV3 K;  3S3O A;  5TKY A;  1RFQ A;  1R59 O;  4FSV A;  2P1J A;  4FK0 A;  2D0A A;  3QEV A;  4WQ5 A;  4EZ6 A;  3CCM N;  3ENH A;  3VER A;  3EZW A;  1X3M A;  4B1W B;  2NRZ A;  4DSL A;  4WQ4 A;  3D7E O;  2EWS A;  3NBP A;  3H6E A;  5AZJ B;  5CR4 A;  2Z1H A;  3SBT A;  1SL0 A;  1OKJ A;  2RPI A;  4I7F A;  3NE6 A;  3RRG A;  2O8D B;  5HBM A;  1RBS A;  4AM6 A;  5AR0 A;  4DR7 K;  3AVG A;  4BRI A;  3LZI A;  3VMF B;  5F1X A;  3B8A X;  1KD1 O;  5M1P A;  4IDK A;  3CM6 A;  4H5N A;  2I7P A;  4CIF A;  4DCH A;  3DLE A;  1WAF A;  4M7X A;  4DTJ A;  1DLO A;  2QWP A;  4OKK A;  1X9W A;  3G71 N;  4RCH A;  3ID6 A;  3LP3 A;  5H1S Q;  4K25 A;  4WQ4 C;  3C65 A;  4E19 A;  3IDH A;  4H0Y B;  3DLG A;  3TSQ A;  3SMS A;  1KVB A;  2B5J A;  4KB0 A;  4CGI A;  1RDD A;  4ID5 A;  3EYZ A;  2BAN A;  4O5F A;  1NK7 A;  3CER A;  2LSN A;  2P9U B;  1U48 A;  1D9F A;  3OYL A;  5E26 A;  3AVA A;  1U45 A;  4MFB A;  5GIO A;  1K8K A;  3ATV A;  1BIZ A;  4OPJ A;  3QB0 A;  2WUS A;  2E1Z A;  3K5M A;  4GV6 A;  1BDG A;  3A5L C;  3O6W A;  2RN2 A;  3DRP A;  1TAQ A;  2D0O A;  4QOZ B;  2PZS A;  1OH6 A;  1YTU A;  2Y1I A;  3HP9 A;  2P9S B;  4KTZ A;  5SWM A;  3TI0 A;  5KPT A;  4C8K A;  4NLC A;  3M5R A;  3L8B A;  2NRX A;  5SZT A;  4FO0 A;  4IZ9 A;  4O0J A;  3LDS A;  4PQU A;  3THX A;  1JCG A;  4BVO A;  2EHG A;  3VET A;  4BQL A;  3SPZ A;  3D2E B;  3PY8 A;  4FCY A;  3CCR N;  4BRN A;  4PHT X;  1FKO A;  3SCX A;  3VF4 A;  3VOV A;  2HBL A;  4IG0 A;  3AVI A;  3VQA A;  3CFR A;  4TSX A;  3BZC A;  4WE1 A;  3AA2 A;  1MWK A;  3OYA A;  3CPW M;  3F9M A;  3WQT A;  4XH4 A;  4IO8 A;  4FLZ A;  3FZL A;  4CEQ A;  3NVM A;  1K8K B;  3DOL A;  4B3S K;  5EOY A;  4ISE A;  4B9M A;  3WNG A;  3SAG A;  4CZI A;  3C94 A;  4CGJ A;  2GX9 A;  2W6K A;  1CLQ A;  1KLN A;  2YNF A;  3ZSO A;  4FJ7 A;  3QNO A;  3CYM A;  3G25 A;  4WFA L;  1YUW A;  3RMD A;  4O55 A;  3K5L A;  3O9Q A;  3THV A;  3EO3 A;  5JLF A;  3LM2 A;  3JYT A;  1LAW A;  3HRG A;  1Y64 A;  3CET A;  1QS4 A;  4I6M B;  4JI7 K;  1GLD G;  1WN7 A;  4MDB A;  3RMC A;  4U67 L;  3EEQ A;  1EP4 A;  4BRM A;  3AO3 A;  5BR8 K;  2O8E A;  3A2F A;  1HQU A;  3G6E N;  2YJE A;  3GG4 A;  4E1M A;  4EAH D;  1FW6 A;  3IG1 A;  3CQ8 A;  3ITH A;  2YHX A;  4FVM A;  4CGH A;  5BRF A;  1LCU A;  1FJG K;  2Q31 A;  2KFZ A;  1FXX A;  3ZT0 A;  4CED A;  3QIO A;  5AQQ A;  3OS0 A;  4Y1C A;  5A2Q O;  4CJR A;  4OKE A;  4QAG A;  3OS2 A;  3QEX A;  2Q0R A;  3ASM A;  1O13 A;  5ADX A;  4BR7 A;  4B8C A;  3AVJ A;  2H3G X;  1RNH A;  2YNH A;  3ENB A;  4BWM A;  1P8Z A;  3A8Y A;  3ZET A;  4JHD B;  1WSE A;  3MN6 A;  3TAG A;  3FLC O;  4M7Y A;  4E1N A;  5CZ1 A;  5I42 A;  5C24 A;  1VQM N;  4DQ8 A;  1Q18 A;  4C23 A;  3C6H A;  3J7Y P;  1YI2 N;  3QES A;  2YJF A;  3FZM A;  3LZJ A;  3E01 A;  5LJV A;  4FLY A;  2HHU A;  3MEC A;  1T7P A;  5AQK A;  3I0S A;  4CF1 A;  1VQK N;  4G1Q A;  3J7Z O;  3OYE A;  3HXM A;  4DFK A;  1IG8 A;  3CME N;  3V1O A;  4DSE A;  1RDA A;  3SQ0 A;  2DTU A;  3GOI A;  3AV9 A;  4FXD A;  1GLC G;  1O1W A;  2RKI A;  4KH5 A;  3E9L A;  1EO1 A;  3AO1 A;  2E2P A;  4J2D A;  3H3N O;  3PO5 A;  5AQH A;  2HHX A;  5LL6 Z;  4DSJ A;  5AFU H;  2O8E B;  2CGL A;  2NZT A;  5FPM A;  4IKF A;  4MQ3 A;  4JAX A;  2O8B A;  3VQ7 A;  3VEX A;  2YHB A;  2OZS A;  2HHT A;  1WSF A;  2PBD A;  1EXQ A;  1KCF A;  1KC8 O;  1IKW A;  4E7K A;  1EWR A;  4HCC A;  3I33 A;  3ISN C;  4JHD A;  2D0P A;  3NHG A;  4ZHR A;  1SQK A;  5AQR A;  1BCM A;  1BCO A;  3JS6 A;  1N6Q A;  3DLK A;  3UKU B;  1S1U A;  4FW2 A;  4PL8 A;  1ITG A;  1A5X A;  1YJN N;  3O08 A;  4CJE A;  3DYA A;  5KRT A;  1Q82 O;  2E1Y A;  4H03 B;  4CJ5 A;  2QM1 A;  3P83 D;  4CFA A;  5D3G A;  4DG1 A;  4M3Y A;  2P9L A;  4OPK A;  3IUC A;  3UKR B;  1TUY A;  3SQ2 A;  3NH0 A;  1X9S A;  3THY A;  2YHW A;  3ZX3 A;  2E20 A;  3DM2 A;  4JI1 K;  1A5V A;  3SPY A;  3WXL A;  2UUC K;  5FRM A;  1RTH A;  1KRP A;  3HVT A;  5I9E B;  5AQM A;  4KRE A;  2CGK A;  3LAK A;  2ASP A;  4DUZ K;  4FWQ A;  3FZK A;  1GLL O;  2YHA A;  4IFY A;  4CHN A;  4WFN L;  3I0R A;  3VEO A;  3THX B;  4B9T A;  2X6S A;  4CEA A;  3N4Q A;  2ZGZ A;  3AGR A;  4N56 A;  1HKG A;  3U9D A;  4CZF A;  3LWM A;  3KLI A;  4DV2 K;  4DMN A;  3HBT A;  5I3U A;  4GV3 A;  4RW8 A;  5GIP A;  5KI6 A;  1GLJ O;  1J6Z A;  2G8W A;  5M1Q A;  1HNX K;  4CHZ A;  2Q2R A;  1QQM A;  1RT2 A;  4ICL A;  2BTF A;  3FFI A;  1NG9 A;  4CVN E;  3THW B;  1VRT A;  1QVG M;  1VSH A;  3WXM B;  4Z4E A;  1S1X A;  4RTF D;  2VGN A;  3R9P A;  2A1S A;  2IS3 A;  4FLU A;  4CHY A;  3DLR A;  4B1U B;  4ISG A;  4FOE A;  1VAZ A;  1U47 A;  3ZYY X;  3HZ6 A;  1JXE A;  4NYN A;  2FBT A;  4C8L A;  4OO1 J;  2QWM A;  4IFV A;  4ZTJ A;  1FKP A;  4CJQ A;  5GAD P;  4IOX A;  4BR4 A;  3V9Z A;  3TTF A;  4CCH A;  3ID8 A;  4H5V A;  4DLE A;  2HBM A;  4CJ7 A;  1C0T A;  3B6O A;  1NNE A;  3BF3 A;  4CEZ A;  4X65 K;  2HHH K;  1RTI A;  3IMX A;  4CZL A;  4HUF A;  1E3M A;  1HKB A;  4BR5 A;  3NMU A;  1IH7 A;  2QW9 A;  1YIT N;  1IBL K;  4LY7 A;  1SKW A;  3TAE A;  1XHX A;  4CGG A;  3ZX2 A;  4ID1 A;  2FSK A;  3H1Q A;  4F2S A;  2A1R A;  1YIJ N;  4U7B A;  5AQI A;  5AQG A;  3RMB A;  1V4S A;  5BR9 A;  3O4Q A;  1NJI O;  3K9J A;  2A6A A;  1D4X A;  1K73 O;  3D45 A;  3DOK A;  4FJM A;  2PYL A;  1VQ6 N;  5KQ8 A;  4ILG B;  4BRQ A;  5MLC Q;  3OW2 M;  2HMI A;  5FRO A;  3MMV A;  3NGZ A;  5AZJ A;  4H4M A;  5CY4 A;  4LH5 A;  4CK1 A;  4BRA A;  3CCE N;  2DFH A;  4B1Z A;  2Q36 A;  4KI6 A;  4CEO A;  2FBY A;  4FJK A;  1S1V A;  4KKO A;  4FWK A;  4EZ9 A;  4M63 C;  1GLF O;  4CJV A;  3QIN A;  4R5P A;  5AQU A;  4PA1 A;  1TYQ B;  3VGK A;  3QBX A;  1VSD A;  3CF5 L;  4OLA A;  4WCE L;  2FSJ A;  3LDQ A;  1Z6R A;  1WBD A;  1HLU A;  4IOA L;  3AVL A;  1JKH A;  5AFU A;  4RG8 A;  2DFE A;  2I7N A;  3OYM A;  3QEW A;  3AAQ A;  2E5L K;  2Q1N A;  3RSE A;  2ZJQ L;  4JD2 B;  4KHN A;  4KI4 A;  3C7N B;  3LDL A;  3OVN A;  2QWO A;  4MLH A;  1FK9 A;  2IOC A;  4LF4 K;  1WSH A;  3MN9 A;  3HT3 A;  3H45 C;  2P9P B;  1X9M A;  4BC5 A;  4AH9 A;  4JS4 A;  5FPN A;  1JL1 A;  1QSL A;  4B08 A;  4DQR A;  1LWE A;  3V1Q A;  3TAF A;  1Q7Y O;  4JI4 K;  4H0P A;  4AIL C;  4OPH A;  4Z94 A;  1NOZ A;  3MX2 A;  1L3V A;  2FF6 A;  4QCL A;  3CIP A;  4Z4I A;  2OA8 A;  3WNH A;  1IKX A;  2OTJ N;  4CBU A;  3KK3 A;  4PY5 A;  1DEJ A;  1T6C A;  1MU2 A;  4FPB A;  4JKG A;  5J2Q A;  3OBY A;  4DLG A;  3T3F A;  4NCG A;  4PWD A;  4B9Q A;  4JLH A;  4B3T K;  2V52 B;  5AQV A;  1RBV A;  4IXC A;  4HTL A;  4JI3 K;  2O8B B;  3PUF A;  1VK0 A;  4CJL A;  3AVN A;  3LAN A;  4LSL A;  5AQW A;  3ULE B;  3UB5 A;  3G0Z A;  1SAZ A;  2WOM A;  3H46 O;  1NWK A;  2B4J A;  3DXK A;  4RW7 A;  4DKW A;  1VQ5 N;  4PKH A;  2VG6 A;  1L3U A;  2FXU A;  4M41 A;  2ASO A;  1MDU B;  3SJJ A;  1GOC A;  5C12 A;  1TL3 A;  3QEP A;  4LSN A;  4LF7 K;  4GMJ B;  3NH2 A;  5BRD A;  4K43 A;  4AHU A;  3K5O A;  3QDK A;  3VF2 A;  4KH6 A;  2P5O A;  1D5A A;  3L2Q A;  3L2U A;  4B9S A;  4W5T A;  3OBW A;  3MXM A;  2BUP A;  3ZSW A;  3KKS A;  1NGF A;  3RRH A;  4RW4 A;  3IS9 A;  2X74 A;  5JS1 A;  3QFP A;  3VQ8 A;  4DTR A;  4PKG A;  4FJH A;  4JKA A;  5C42 A;  3OTO K;  3NF7 A;  3DLH A;  4X62 K;  2YCH A;  3SI6 A;  4CES A;  3ZSQ A;  2W41 A;  4YOY A;  3HSC A;  1E4F T;  1NKB A;  1BWF O;  1NGI A;  3S41 A;  3ZSZ A;  3U4L A;  2UUB K;  3FE1 A;  3LWL A;  4DQI A;  2AJQ A;  5AQF A;  4FW1 A;  1UOC A;  3AVM A;  4JRQ A;  1QVF M;  4MO5 A;  3LDO A;  3MDQ A;  1DTQ A;  4OKJ A;  2OTL N;  1NM1 A;  1IKY A;  3L4I A;  4HUE A;  1HNV A;  2VGM A;  4N47 A;  3W3D A;  4FK2 A;  4C8M A;  2ZF5 O;  4UQG A;  4C1N K;  1Q81 O;  4H5T A;  3SAF A;  4NB4 A;  2F4V K;  4K0K K;  4DSI A;  4FWL A;  1QHA A;  3TSP A;  4AHT A;  1BG3 A;  4CJP A;  4J2A A;  3PIO L;  2A41 A;  1NGB A;  4DTX A;  3S9H A;  4DV4 K;  1G99 A;  4KTQ A;  3L4Q A;  1IBK K;  1NKE A;  3NGI A;  5AQZ A;  4CE9 A;  1KAY A;  5HOO A;  3KJV A;  4B3M K;  4FPA A;  1NGC A;  2RE2 A;  1ASU A;  3QO9 A;  1OH5 A;  4FWO A;  4CGD A;  3HM9 A;  1BQN A;  1N5Y A;  4HHT A;  4FWP A;  2F8T A;  3V9X A;  1BOT O;  1NJY A;  1NGD A;  1S6P A;  3KVG A;  3O3G A;  4DV5 K;  1LOT B;  3AA5 X;  1L3S A;  1IV0 A;  4W5N A;  4A62 A;  2UXB K;  2AP1 A;  3ZSR A;  2G8F A;  4K8X A;  3O1W A;  4QS9 A;  1HR0 K;  4J2B A;  2ITM A;  2W6L A;  2P9I A;  3HPG A;  3RWU A;  5HL7 L;  2QI2 A;  4I2P A;  1VQL N;  4GKK K;  2QXL A;  2BGG A;  5CHI A;  3KLE A;  2O8C A;  1J5O A;  4MDA A;  2P9N B;  3VES A;  2GEM A;  4KV8 A;  4FJ5 A;  1M1K O;  1VSM A;  2G8K A;  4A2A A;  3BEX A;  3O9R A;  4LF8 K;  3VA3 A;  4JN4 A;  3GL1 A;  3QET A;  3ZCM A;  1TKZ A;  3MX5 A;  1HUX A;  1C0F A;  4CFD A;  5KQD A;  1VSI A;  3H3O B;  4YDU A;  4DV7 K;  1S6Q A;  1NGH A;  3SJH A;  1W2B M;  2IC3 A;  4O4G A;  4FLV A;  3MCA B;  1HQE A;  5K14 A;  5CE3 A;  1Q9Y A;  1S5J A;  3RTV A;  2YNI A;  3V6D A;  3HK2 A;  3QNN A;  4BR9 A;  3PX4 A;  3SYZ A;  1J53 A;  4KPY A;  3P31 A;  3TSU A;  2VQE K;  2HNZ A;  2YKN A;  5HP1 A;  4CEB A;  4E0D A;  1HJO A;  4GKJ K;  2D1K A;  5BPL A;  1RT6 A;  2HHQ A;  1T6D A;  4AQY K;  2QWR A;  3VGL A;  4EHU A;  2O8D A;  1LW0 A;  2UU9 K;  3BY5 A;  3CJC A;  2CH5 A;  3VGM A;  1KVC A;  4DR6 K;  3NAE A;  1HX1 A;  5JVG L;  3TR8 A;  5ADX H;  2HND A;  2VQF K;  1BA1 A;  1DTT A;  4AM7 A;  4JKD A;  2G8H A;  3SUP A;  1T8E A;  1LW2 A;  4LFB K;  1N32 K;  2F9T A;  3J8A A;  1YVU A;  1JL2 A;  3S3M A;  4DB3 A;  3G4S N;  1RTD A;  4DWI A;  3SUO A;  4FJL A;  1REV A;  3SBG A;  4C8N A;  4YNQ A;  4GW6 A;  4K8Z A;  4JNE A;  5KPZ A;  4AHR A;  5BRH A;  3VQ5 A;  4O44 A;  4GV9 A;  1WSI A;  3QFU A;  3O5B A;  3VQ6 A;  3PLA A;  3NDK A;  4BE1 A;  3TTC A;  3RSE B;  1NU0 A;  3M3Z A;  3RMA A;  3TTD A;  5EU7 A;  4F2R A;  3LAM A;  4K42 A;  4FJ9 A;  2IVN A;  1EWQ A;  4NO7 A;  3HTV A;  2NRV A;  1U2V B;  2P9I B;  3SMP A;  4BC3 A;  2OPR A;  3KZB A;  1J9A A;  4AHC A;  1MA9 B;  4JKG B;  4Z4C A;  3MN5 A;  1A5W A;  3WUH A;  4B9L A;  3L3V A;  3Q7B A;  4CEC A;  3SNN A;  3NCI A;  4FJI A;  1NLV A;  4FYD A;  5BRE A;  1NKC A;  5KPR A;  2YKM A;  4BQZ A;  4B9U A;  4LC9 B;  4CFB A;  5KGX A;  2P9P A;  1RCH A;  1T44 A;  2Z1J A;  3VQB A;  3QBW A;  1JLQ A;  3AO5 A;  1XMQ K;  3KLG A;  3SQ4 A;  2OPS A;  4GVM A;  3U9Z A;  4CZK A;  4BG9 A;  2EX3 A;  3L0Q A;  3V1R A;  4CJT A;  2I5J A;  3KK2 A;  2YNG A;  4DTN A;  2FBX A;  5M1O A;  3D2E A;  4B9V A;  3HO1 A;  2Z1G A;  3R8E A;  4DV0 K;  1R0A A;  2NNW A;  5AZI B;  3ZEU B;  1BGX T;  1OVY A;  4KHY A;  3CCS N;  3MED A;  2GUI A;  3MEG A;  2CGJ A;  3J7A P;  4CJS A;  2P5G A;  3IKM A;  3AO2 A;  1NJW A;  1BU6 O;  1WNS A;  4EP5 A;  3SUN A;  1S72 N;  3R6M A;  4H0X B;  3CM5 A;  4M3T A;  1SUQ A;  2R7Y A;  2A3Z A;  1QE1 A;  3VEW A;  2GV9 A;  1GOA A;  3PX0 A;  4FVU A;  3W0L A;  2F8S A;  1JCF A;  1HRH A;  1JLE A;  4GVE A;  3I55 N;  3T7Z A;  3CXC M;  4IEI A;  3MWP A;  3AVF A;  3WEE B;  3CMA N;  3CJB A;  1ZC6 A;  4BRL A;  5ELZ A;  4DV6 K;  1D8Y A;  1SL2 A;  2IAJ A;  4PKI A;  3ULD A;  4E3S A;  1W9H A;  3BDP A;  3VQP A;  2QWN A;  1YXQ A;  2BH1 A;  4O0I A;  3BUZ B;  1N8R O;  3DAW A;  4KTW A;  4PL7 A;  1EX4 A;  1SKS A;  1QSS A;  1ZBL A;  5KRS A;  2HNY A;  5AQX A;  3EKU A;  2KKZ A;  5AQY A;  1QQO A;  4E7J A;  4NXM K;  4CD3 A;  1VSF A;  3ZT2 A;  2X78 A;  3ZT1 A;  3ALY A;  3OYJ A;  4CZJ A;  1HKC A;  2XO7 A;  2HF4 A;  1UA0 A;  2ZWH A;  3DRS A;  4DSF A;  3QML A;  1X9J A;  4N41 A;  4CJU A;  2HW3 A;  2HVH A;  3FFK B;  3FR0 A;  3LPT A;  3C6U A;  4J8F A;  1C0U A;  3CI5 A;  1IG9 A;  3E9P A;  1S9G A;  3P5J A;  1VQ9 N;  1OVQ A;  1UAX A;  1LWC A;  3KLF A;  3QEI A;  1KXP A;  2IDO A;  2E6M A;  4DF8 A;  4CJ3 A;  1NK4 A;  5AQS A;  3LDN A;  5JS2 A;  2Y1J A;  3E66 A;  4BGB A;  3CG7 A;  4W5R A;  4XH5 A;  1WB9 A;  3K58 A;  4KFB A;  2F9W A;  2FBV A;  4DS4 A;  4E89 A;  5HRP A;  4M3W A;  3P1G A;  1NGJ A;  4DQQ A;  3AY9 A;  3DMJ A;  2ATQ A;  4V19 S;  4BDY A;  1NJX A;  5DK5 A;  2NLX A;  1ATR A;  4KAZ A;  5TKW A;  1JJ2 M;  4DF4 A;  3V9S A;  5F2R A;  2XRI A;  1YF5 L;  4H8K A;  3NH1 A;  3LP0 A;  2WBN A;  4RW9 A;  1XC9 A;  3TAR A;  2YHY A;  2E6L A;  3ZSY A;  1QTM A;  1TKT A;  4BRF A;  4EIA A;  3P4I A;  3TWH A;  1BA0 A;  2VCP A;  4ISF A;  3WT0 A;  4IG3 A;  4BR0 A;  4DUY K;  1NGE A;  3WNF A;  3SAH A;  3MWT A;  5EXW A;  3T19 A;  3M8R A;  5BN8 A;  3M8Q A;  4M3Z A;  4GNI A;  3CFP A;  1OH7 A;  2WFB A;  3PX6 A;  3LAL A;  5CYM A;  1QZ5 A;  2IGI A;  2V7Y A;  3EE8 A;  4O5B A;  2DPN A;  4FM2 A;  2KFN A;  1HJR A;  3UKU A;  4BC2 A;  4BGA A;  3AVC A;  1EQY A;  2W40 A;  5EX5 A;  1TK5 A;  4KBO A;  1ZYQ A;  5IWA K;  3SQ1 A;  1BHL A;  1U6Z A;  1ATN A;  3PO4 A;  3WXK A;  4CBX A;  1JLF A;  4FLW A;  4I9L A;  2NRW A;  4Z4H A;  4NYF A;  4GY2 B;  2P51 A;  2QKK A;  1TV6 A;  5AQN A;  4CZM A;  1KVA A;  3AA3 A;  4H5W A;  1J54 A;  1Z05 A;  3EE9 A;  3CC4 N;  2V51 B;  3B6P A;  2BE2 A;  4DQS A;  1JXB A;  3KK1 A;  5T7B A;  4BWJ A;  4JRP A;  2HBK A;  4JS5 A;  1KFD A;  5KGW A;  4W5O A;  1H1V A;  3OYF A;  1NBW A;  1S1W A;  2E2O A;  2ZD1 A;  2A40 A;  4CW7 B;  1UA1 A;  2YV0 X;  3C7N A;  3K2P A;  4JD2 A;  1C0M A;  3G10 A;  2XY6 A;  2HHS A;  2KLA A;  1KAZ A;  3OY9 A;  4CF9 A;  4NCB A;  1RTJ A;  1Q9X A;  3O8M A;  3CC2 N;  1B9F A;  2P9S A;  3FZF A;  1KTQ A;  2E8A A;  1EET A;  3EY1 A;  4DR3 K;  5BPM A;  5KTQ A;  4A59 A;  4E1J A;  2JWK A;  4N5S A;  1TKX A;  3WEE A;  3HST B;  4YFU A;  1IBM K;  2OYQ A;  3HL8 A;  3O4N A;  3OJU A;  2KW4 A;  5E84 A;  4Q5V A;  3NF6 A;  2DY4 A;  3TAB A;  3PSI A;  2XY5 A;  1ESV A;  5DM7 L;  2ZJP L;  1ZBH A;  1F21 A;  4A61 A;  3HJF A;  4BC4 A;  4BAC A;  3LP1 A;  4FM0 A;  2YI1 A;  1L3T A;  3F9K A;  2O4I A;  2V7Z A;  4DTU A;  4JK7 A;  1QSY A;  1SV5 A;  4YY3 K;  3PIP L;  1YT3 A;  4CGF A;  1Z26 A;  4CHQ A;  3HVR A;  2ZQB A;  3CFO A;  2HHW A;  3I56 N;  1IJJ A;  2KQ2 A;  5LMN K;  4B3O A;  1Y97 A;  1ILY A;  3A5N C;  4HWI A;  4G9Z A;  4F4K A;  4FZY A;  1TAU A;  4H0T B;  4IDH A;  3NFA A;  1WSJ A;  1IO2 A;  1RDU A;  1VSE A;  5DMR A;  3OYC A;  1NK0 A;  1ZBF A;  4EP4 A;  1W97 L;  2E2N A;  1LWF A;  1OH8 A;  4OLB A;  1ZBI A;  3VEZ A;  4H4O A;  1NGG A;  4F3O A;  4O8K A;  2A42 A;  4LFC K;  3EL2 A;  2Z1I A;  3V9W A;  3MK6 A;  1VQ7 N;  4FZX C;  5DM6 L;  4KHW A;  4LH4 A;  1VSJ A;  4FM1 A;  2D0B A;  2OZM A;  3N4P A;  1XI1 A;  1QZ6 A;  1CZB A;  3TAN A;  5FPD A;  1K9M O;  1XQS C;  2HMP A;  1RT4 A;  3NGY A;  1QQN A;  5JIC A;  4Y1D A;  4IJA A;  2G8V A;  3IRX A;  3KD5 E;  2P9U A;  4MO4 A;  1GLE G;  4JI5 K;  4CJ4 A;  3P38 A;  3DLB A;  1KQS M;  2KTQ A;  3JAM O;  4FWR A;  1VSL A;  2DFF A;  2PYJ A;  4IO9 L;  3RVC A;  1RT3 A;  3HOS A;  1NK8 A;  3T1A A;  3P39 A;  4ILJ A;  5C2F A;  4NXN K;  2J4R A;  4BRE A;  3A5M C;  4Y0W A;  1XWL A;  4DSK A;  3VEV A;  3WQU A;  3HOT A;  3ZLJ A;  4CI6 A;  3O1B A;  3JSM A;  1KAX A;  2O4G A;  3ZX0 A;  2IIR A;  2VYP A;  3V4I A;  1S3X A;  2UUA K;  3OYB A;  1U4B A;  3CCJ N;  3KIO A;  4E7H A;  3THY B;  3T69 A;  3U6F A;  4DS5 A;  3E9O A;  2P9L B;  1NGA A;  1ASW A;  4X66 K;  1TGO A;  1W0H A;  1XUP O;  4OVL A;  3ZET B;  3V9U A;  1BL3 A;  2QWL A;  4BG8 A;  4BDZ A;  2VWB A;  4I6M A;  2NUB A;  3O9T A;  2FF3 B;  1RGI A;  3OA9 A;  1SKR A;  4FLX A;  4YOU A;  5GAH P;  3U3G A;  3VQ4 A;  4FOI A;  4YDU C;  4ELU A;  1N33 K;  4CK2 A;  1T05 A;  2NRR A;  1WSG A;  3LP2 A;  4JKB A;  4IEE A;  4DFJ A;  5C0Y A;  5AQL A;  3OYN A;  1RT1 A;  3HI0 A;  3C0B A;  4CEF A;  3BP8 A;  3SZ2 A;  1SL1 A;  1M90 O;  3VPZ A;  4YHH K;  3CJ9 A;  5M1N A;  4F3T A;  3D2F B;  2ZM6 K;  3OYG A;  1ZBS A;  5E41 A;  4MLE A;  3K5N A;  3SV3 A;  3T1H K;  4WYB A;  2QTD A;  2Q97 A;  3OJS A;  1WLJ A;  2O8C B;  2P9K A;  4DR4 K;  3CCL N;  1ZBU A;  4HUG A;  4E7I A;  5HRN A;  1Q8I A;  5HRR A;  1YVN A;  4M3X A;  5GAE P;  5BN9 A;  2HVI A;  4KHP K;  1ASV A;  4KH4 A;  4M3U A;  4I2Q A;  2CH6 A;  5CYQ A;  3U3Y A;  4KHQ A;  1XHZ A;  2FC0 A;  3SLC A;  3L2R A;  4FJ8 A;  2QWQ A;  2VG7 A;  3CC7 N;  2HHV A;  4KO0 A;  4QS8 A;  1BI4 A;  5FDL A;  1YJW N;  2XY7 A;  4IBN A;  1UWB A;  1TK8 A;  4CZE A;  4BRP A;  4FJN A;  3GE1 A;  3L2V A;  3F5T A;  1MWM A;  3SK3 A;  1EKE A;  3AGK A;  3HP6 A;  1KFS A;  4OPA A;  2HOE A;  2UXD K;  3IFR A;  4YOR A;  4ELV A;  5HRO A;  3CHW A;  3LM9 A;  5EVZ A;  4AHS A;  3ZSX A;  4RWT A;  5C10 A;  2QKB A;  2IVP A;  3CJA A;  3AAP A;  1HNW K;  1TKD A;  3NF8 A;  4KHS A;  4ILH A;  4FJG A;  4LD0 A;  1N36 K;  1I3A A;  1YTA A;  3KK7 A;  2G8I A;  1BUP A;  1S22 A;  4UY8 O;  3VQE A;  1C6V A;  1QQC A;  1LV5 A;  1CZ9 A;  4WF9 L;  4XEI A;  1TK0 A;  1WUA A;  3WXI A;  3TAQ A;  4C8O A;  4KRF A;  4B1X B;  3BGR A;  2KHO A;  3K9K A;  2PFU A;  3ZSV A;  1RDB A;  4M45 A;  2KZZ A;  4CF2 A;  4CZH A;  2O8F A;  3ENO A;  1JLG A;  1RBT A;  1XMO K;  1N34 K;  3J80 O;  5AJ3 K;  4DFP A;  3PV8 A;  3AO4 A;  4W5Q A;  4BRO A;  3CD6 N;  3AA4 A;  4YOT A;  1BI4 B;  1K6Y A;  2VWK A;  1DT9 A;  4DFM A;  4JV5 K;  3ZT3 A;  4HCB A;  3QER A;  3SUQ A;  2ETJ A;  3LL3 A;  3K59 A;  4JEP A; 
#chains in the Genus database with same CATH homology
 3DXK A;  1V4T A;  2P9S B;  5F2R A;  4DKW A;  1YF5 L;  2HBJ A;  1VQ5 N;  4PKH A;  2WBN A;  2FXU A;  5KPT A;  4NLC A;  2ASO A;  3M5R A;  4H5R A;  2NRX A;  1MDU B;  5C12 A;  4FO0 A;  4IZ9 A;  1VQN N;  2YHY A;  4BRF A;  4EIA A;  3P4I A;  3L6Q A;  1JCG A;  3AAR A;  4BVO A;  4K43 A;  3VET A;  5BRD A;  4BQL A;  3QDK A;  1BA0 A;  2VCP A;  3D2E B;  3VF2 A;  4ISF A;  4KH6 A;  3WT0 A;  1TUU A;  4BR0 A;  3CCR N;  1NGE A;  3SAH A;  4BRN A;  3MWT A;  4PHT X;  5EXW A;  3DXM A;  3OBW A;  5BN8 A;  3VF4 A;  1YJ9 N;  4GNI A;  2BUP A;  4IJN A;  3R1X A;  3U8X A;  1NGF A;  3WXJ A;  3VOV A;  2HBL A;  2WFB A;  3QFP A;  2HF3 A;  1MWK A;  4PKG A;  4JKA A;  1QZ5 A;  1RDW X;  3CPW M;  3F9M A;  2V7Y A;  2YCH A;  3WQT A;  3EE8 A;  4XH4 A;  2DPN A;  4IO8 A;  2W41 A;  3UKU A;  2E2Q A;  4EHT A;  2E88 A;  4YOY A;  4BC2 A;  1E4G T;  3HSC A;  3FZL A;  4EFH A;  3NVM A;  1K8K B;  4BGA A;  1E4F T;  1EQY A;  4JKE A;  4ISE A;  5EOY A;  2W40 A;  4FWM A;  5EX5 A;  3SAG A;  4CZI A;  1BWF O;  1NGI A;  2GX9 A;  4KBO A;  3S41 A;  3U4L A;  4YOV A;  2QEX N;  1DGK N;  3FE1 A;  3CCU N;  2AA4 A;  5EY4 A;  1U6Z A;  1ATN A;  2NRH A;  3CJ7 A;  5AQF A;  3WXK A;  4CBX A;  3TU5 A;  1VQP N;  1QVF M;  4DHY A;  4MO5 A;  3DLL L;  3G25 A;  3LDO A;  4WFA L;  1YUW A;  4WQ5 C;  3MDQ A;  2NRW A;  1U2V A;  5AQJ A;  3O9Q A;  2GEL A;  3EO3 A;  4GY2 B;  3LM2 A;  1T3V A;  4L3Q A;  3HRG A;  5JLF A;  2YX6 A;  5AQN A;  1Y64 A;  3CET A;  4CBW A;  4CZM A;  1NM1 A;  1WOQ A;  4I6M B;  4H5W A;  4B1Y B;  1GLD G;  3CC4 N;  1Z05 A;  3EE9 A;  3VTI A;  3A5O C;  2V51 B;  3L4I A;  2VGM A;  3W3D A;  4MDB A;  1ATS A;  2FLO A;  4U67 L;  3KWG A;  1NMD A;  5F0X A;  2ZF5 O;  2HBK A;  4BRM A;  4C1N K;  1Q81 O;  4H5T A;  3SAF A;  4NB4 A;  3G6E N;  2YJE A;  3GG4 A;  1H1V A;  4EAH D;  4FL9 A;  4FWL A;  4YOX A;  1QHA A;  3TSP A;  3VEY A;  1BG3 A;  1NBW A;  2E2O A;  2A40 A;  3C7N A;  3PIO L;  2A41 A;  5M1F A;  1NGB A;  2YHX A;  1VQ4 N;  2WC9 A;  4JD2 A;  2FSN A;  5AQT A;  5BRF A;  1G99 A;  2KLA A;  1KAZ A;  1LCU A;  3GDQ A;  1TYQ A;  3L4Q A;  5AQZ A;  5HOO A;  1KAY A;  2ZJR L;  2Q31 A;  4FPA A;  1NGC A;  5C2D A;  2RE2 A;  3O8M A;  3CC2 N;  2P9S A;  3FZF A;  3GBT A;  2E8A A;  5AQQ A;  3DXK B;  4FWO A;  4O8U A;  5BPM A;  4A59 A;  4E1J A;  2JWK A;  3WEE A;  2P9N A;  2Q0U A;  4FWP A;  2Q0R A;  5E84 A;  1BOT O;  1O13 A;  4BR2 A;  3O4W A;  5ADX A;  4BR7 A;  2QA4 N;  4C1N I;  2H3G X;  1NGD A;  3C6A A;  2GWJ A;  3JXU A;  3KVG A;  3ENB A;  1P8Z A;  1ESV A;  3A8Y A;  3CPE A;  5DM7 L;  1LOT B;  3ZET A;  4JHD B;  2ZJP L;  3MN6 A;  4A61 A;  4A62 A;  2AP1 A;  3FLC O;  4BC4 A;  3MN7 A;  4M7Y A;  3O1W A;  4QS9 A;  1HPM A;  2ITM A;  2P9I A;  2YI1 A;  1VQM N;  4DQ8 A;  1Q18 A;  4C23 A;  2V7Z A;  5HL7 L;  5FPE A;  2QI2 A;  3C6H A;  1GLB G;  4JK7 A;  2QXL A;  1X3N A;  1VQL N;  3PIP L;  4JKH A;  3D6R A;  2IVO A;  5CHI A;  1YI2 N;  1VQO N;  2YJF A;  3VEN A;  2GUP A;  2PAV A;  3FZM A;  4MDA A;  2P9N B;  3VES A;  2GEM A;  5LJV A;  2ASM A;  4WFB L;  1SZ2 A;  3I56 N;  1IJJ A;  4B1V A;  1M1K O;  1ILY A;  5JLH A;  4A2A A;  5GIN A;  3A5N C;  5AQK A;  1VQK N;  4HWI A;  3BEX A;  4G9Z A;  4F9O A;  3J7Z O;  4H0T B;  4IDH A;  3O9R A;  3E1Y A;  3CME N;  1IG8 A;  1RDU A;  4A2B A;  3CQY A;  4JN4 A;  3GL1 A;  3HM8 A;  3MX5 A;  5AZI A;  3ZEU A;  3GOI A;  1HUX A;  1GLC G;  1W97 L;  4KH5 A;  1C0F A;  3E9L A;  5KQD A;  1EO1 A;  1YAG A;  2E2P A;  2E2N A;  5B8H A;  4R79 A;  3H3N O;  1K8A O;  5AQH A;  4AF1 A;  3H3O B;  4YDU A;  3CQX A;  3VEZ A;  1NGH A;  3SJH A;  1W2B M;  1NGG A;  5AFU H;  4O8K A;  2CGL A;  2A42 A;  3MCA B;  5CE3 A;  2NZT A;  3EL2 A;  3ATU A;  5FPM A;  4BRD A;  3MK6 A;  4BR9 A;  3F2K A;  4JAX A;  1VQ7 N;  3VEX A;  3P31 A;  3TSU A;  5DM6 L;  3UE5 A;  3UKR A;  2PBD A;  5AQO A;  1KC8 O;  1HJO A;  4BRG A;  3N4P A;  3A0I X;  1C0G A;  2D1K A;  1QZ6 A;  3QIC A;  4CD1 A;  5BPL A;  3I33 A;  5FPD A;  4JHD A;  1K9M O;  1SS6 A;  1T6D A;  1XQS C;  2D0P A;  2QWR A;  1SQK A;  2HMP A;  3DWL A;  5AQR A;  3VGL A;  4EHU A;  3JS6 A;  5AQP A;  1QQN A;  3CJC A;  3UKU B;  5JIC A;  3O80 A;  2CH5 A;  4BRK A;  4IJA A;  3VGM A;  4K41 A;  1HX1 A;  4PL8 A;  5M1K A;  5JVG L;  4IOC L;  5ADX H;  3LDP A;  4JKF A;  3CJ1 A;  1YJN N;  4A57 A;  3O08 A;  5JMV A;  3EKS A;  1Q82 O;  1BA1 A;  2E1Y A;  4FWN A;  4H03 B;  4JKD A;  4AM7 A;  2P9U A;  2QM1 A;  3M1F A;  4MO4 A;  1GLE G;  2A5X A;  3P38 A;  2P9L A;  2F9T A;  3J8A A;  3KHY A;  1KQS M;  3R3L A;  4FWR A;  3IUC A;  3UKR B;  1TUY A;  4DB3 A;  3G4S N;  2P9K B;  4FWS A;  4IO9 L;  3RVC A;  2YHW A;  3HOS A;  2E20 A;  2JWL A;  3ZX3 A;  3P39 A;  3VTH A;  4ILJ A;  5C2F A;  3EN9 A;  3SBG A;  4IWV A;  2J4R A;  3WXL A;  3KWI A;  4BRE A;  1CZA N;  3A5M C;  3DJC A;  4JNE A;  4Y0W A;  5BRH A;  5KPZ A;  5BPN A;  3VEV A;  5I9E B;  1XC3 A;  5AQM A;  3WQU A;  3D2F A;  3HOT A;  2CGK A;  4GV9 A;  2ASP A;  3QFU A;  3TPQ A;  3O5B A;  4CI6 A;  4CZG A;  3O1B A;  1VQ8 N;  4FWQ A;  3FGU A;  3PLA A;  3FZK A;  1GLL O;  4WFN L;  1KAX A;  3Q7C A;  2D4W A;  3TTC A;  3VEO A;  3ZX0 A;  3RSE B;  2IIR A;  2VYP A;  1S3X A;  4IFE A;  3M3Z A;  3CCJ N;  3N4Q A;  2GWK A;  3TTD A;  1P90 A;  3AGR A;  2ZGZ A;  4YOW A;  2F7T A;  3T69 A;  1HKG A;  4QS7 A;  3MCP A;  3U9D A;  4CZF A;  4K42 A;  2IVN A;  3E9O A;  2P9L B;  4NO7 A;  3HTV A;  2P9I B;  1U2V B;  2NRV A;  3HBT A;  1NGA A;  3SMP A;  4BC3 A;  4A5A A;  3ULE A;  3KZB A;  4GV3 A;  5GIP A;  1XUP O;  2ZGY A;  3CCV N;  1MA9 B;  3ZET B;  1GLJ O;  1J6Z A;  2UYT A;  4JKG B;  5LY3 A;  3MN5 A;  4JK9 A;  3H1V X;  5M1Q A;  2QWL A;  4BG8 A;  2Q2R A;  1QQM A;  3WUH A;  2VWB A;  3CCQ N;  3Q7B A;  4I6M A;  3O9T A;  3FZH A;  2BTF A;  2FF3 B;  1NLV A;  3BF1 A;  1RGI A;  3OA9 A;  5BRE A;  4NLB A;  1QVG M;  5KPR A;  1Q86 O;  4YOU A;  3WXM B;  4H0O A;  4BRH A;  5LJW A;  5GAH P;  4RTF D;  2VGN A;  4BQZ A;  4FOI A;  4YDU C;  3R9P A;  2RHK A;  4LC9 B;  2NRR A;  2NRT A;  1GLA G;  2P9P A;  4B1U B;  4ISG A;  4JKB A;  4FOE A;  4IEE A;  1T44 A;  1VAZ A;  4BY9 C;  5C0Y A;  5AQL A;  3ZYY X;  3HI0 A;  3QBW A;  3HZ6 A;  5GAG P;  3C0B A;  4JK8 A;  3H46 O;  4OO1 J;  2QWM A;  3BP8 A;  3O9S A;  4BVP A;  5GAD P;  4IOX A;  4BR4 A;  3I8B A;  3U9Z A;  4CZK A;  1YHQ N;  1M90 O;  3VPZ A;  4BG9 A;  3TTF A;  3CJ9 A;  3ID8 A;  4H5V A;  5M1N A;  4A5B A;  3L0Q A;  3D2F B;  3NVK A;  2HBM A;  4CJ7 A;  3BF3 A;  5M1O A;  1ZBS A;  3D2E A;  5JVH L;  3R8E A;  2NNW A;  4MLE A;  5AZI B;  3ZEU B;  1DKG D;  3M6G A;  3O9U A;  1BO5 O;  3IMX A;  4WYB A;  1JCE A;  2QTD A;  4CZL A;  4H0V B;  2Q97 A;  1OVY A;  4BRC A;  3VF6 A;  3CCS N;  1HKB A;  4BR5 A;  2P9K A;  5C15 A;  3NMU A;  3DXM B;  2CGJ A;  2QW9 A;  2HST A;  1YIT N;  3CCL N;  4JKC A;  3IKM A;  3OHR A;  3ZX2 A;  1BU6 O;  1YVN A;  2FSK A;  3H1Q A;  5BN9 A;  5GAE P;  1S72 N;  4KH4 A;  3R6M A;  4U7B A;  1YIJ N;  2OAN A;  4H0X B;  2GTD A;  5AQI A;  5AQG A;  4XH1 A;  1ZXO A;  1V4S A;  5BR9 A;  1NJI O;  3K9J A;  2A6A A;  1D4X A;  2A3Z A;  2CH6 A;  1K73 O;  3VEW A;  5TKY A;  1VQ6 N;  5KQ8 A;  4FVU A;  1RFQ A;  3SLC A;  1R59 O;  3W0L A;  4FSV A;  2QWQ A;  4ILG B;  1JCF A;  4BRQ A;  5MLC Q;  3OW2 M;  3CC7 N;  4GVE A;  3I55 N;  4WQ5 A;  3T7Z A;  4QS8 A;  3CXC M;  3CCM N;  3ENH A;  3MMV A;  4IEI A;  3VER A;  3EZW A;  3MWP A;  5AZJ A;  1YJW N;  1X3M A;  4B1W B;  4BRA A;  3CCE N;  2NRZ A;  3WEE B;  4B1Z A;  3CMA N;  2Q36 A;  4WQ4 A;  3CJB A;  2EWS A;  1ZC6 A;  3D7E O;  4BRL A;  5ELZ A;  3H6E A;  4CZE A;  5AZJ B;  5CR4 A;  4BRP A;  4PKI A;  4FWK A;  3GE1 A;  4M63 C;  1GLF O;  3SBT A;  2QWN A;  1YXQ A;  3F5T A;  1MWM A;  3SK3 A;  3AGK A;  1OKJ A;  2BH1 A;  3BUZ B;  4OPA A;  5AQU A;  1N8R O;  3DAW A;  1TYQ B;  3VGK A;  4PL7 A;  4AM6 A;  5AR0 A;  2HOE A;  3QBX A;  4BRI A;  3VMF B;  3CF5 L;  3IFR A;  4YOR A;  4WCE L;  5F1X A;  5AQX A;  3CHW A;  2FSJ A;  3LDQ A;  3B8A X;  1KD1 O;  1Z6R A;  5M1P A;  1HLU A;  4IOA L;  3EKU A;  3LM9 A;  5AFU A;  5EVZ A;  4H5N A;  2KKZ A;  5AQY A;  4RWT A;  5C10 A;  2I7P A;  1QQO A;  2I7N A;  4CD3 A;  2IVP A;  3CJA A;  3AAQ A;  3AAP A;  4DCH A;  2Q1N A;  3RSE A;  4M7X A;  2ZJQ L;  4ILH A;  4JD2 B;  2QWP A;  4CZJ A;  1HKC A;  3G71 N;  4RCH A;  3C7N B;  3LDL A;  4MLH A;  2QWO A;  2HF4 A;  3ID6 A;  3KK7 A;  2ZWH A;  3MN9 A;  1BUP A;  5H1S Q;  1S22 A;  3H45 C;  4UY8 O;  2P9P B;  4K25 A;  4WQ4 C;  4BC5 A;  3QML A;  1X9J A;  3C65 A;  4XEI A;  5FPN A;  4WF9 L;  1WUA A;  3WXI A;  4B1X B;  3IDH A;  4H0Y B;  1Q7Y O;  2KHO A;  4H0P A;  3SMS A;  3FFK B;  3TSQ A;  3FR0 A;  3K9K A;  2PFU A;  4OPH A;  4Z94 A;  4J8F A;  3CI5 A;  3MX2 A;  2FF6 A;  3E9P A;  1VQ9 N;  3CIP A;  4CZH A;  4O5F A;  1KXP A;  3CER A;  3ENO A;  2OTJ N;  2P9U B;  5AQS A;  4CBU A;  3LDN A;  1DEJ A;  1T6C A;  4FPB A;  4JKG A;  3CD6 N;  4BRO A;  5E26 A;  3E66 A;  4BGB A;  3OBY A;  4XH5 A;  5GIO A;  1K8K A;  3ATV A;  4YOT A;  2OTL N;  2F9W A;  4B9Q A;  1DT9 A;  3QB0 A;  2V52 B;  2WUS A;  1NGJ A;  2E1Z A;  3AY9 A;  5AQV A;  4GV6 A;  1BDG A;  4IXC A;  3A5L C;  3O6W A;  4HTL A;  2NLX A;  1ATR A;  5AQW A;  3LL3 A;  3ULE B;  2D0O A;  5TKW A;  3UB5 A;  1SAZ A;  1JJ2 M;  1NWK A;  4JEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...