2YX6A

Crystal structure of ph0822
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
110
Chain Sequence
MRVAIPAEDDRGIKSNVSKHFGRSRYFVFVDIEGEDVKNVEVVEVPFGDLPNFIKDHGAKIVLTYGIGRRAIEYFNSLGISVVTGVYGRISDVIKAFIGGKLKIDYDWKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PH0822
publication title Crystal structure of PH0822
rcsb
source organism Pyrococcus horikoshii
total genus 28
structure length 110
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2yx6A01
1P90A 1RDUA 1T3VA 1EO1A 1O13A 2YX6A 2QTDA 2RE2A 2WFBA 2KLAA
chains in the Genus database with same CATH superfamily
1SKSA 2HHSA 4G1QA 3NBPA 2Q0UA 1J9AA 3IAYA 4PY5A 1FXXA 1UOCA 5AQVA 3ULEA 1RBVA 4FPAA 3NCIA 1V4TA 1TV6A 3JYTA 5HLFA 5J2PA 2E2NA 4A2AA 1BDGA 1J53A 4JI4K 1ZXOA 3DLKA 4BRDA 4V19S 4HUEA 3KZBA 3SBTA 3ZYYX 5FPMA 5ADXA 2NRTA 4J2BA 1CZAN 2YHWA 4IOAL 4H03B 4DTMA 4DFJA 3CCEN 3LDLA 2I5JA 4JI0K 3VGKA 3DOLA 3CCJN 2UU9K 1LWEA 2A6AA 4CJQA 4DS5A 3CFOA 1GOCA 3DLGA 4YOTA 3AA3A 1T8EA 4CHOA 2ITMA 4I7FA 1JLCA 1J5OA 2IOCA 1E4GT 2GV9A 3LDOA 4FJNA 4ELVA 2RHKA 4A59A 3QEPA 3QEIA 4Z4FA 1BWFO 1IH7A 3D0PA 3QO9A 3SUNA 4GV6A 3NMUA 3VQAA 3ZX0A 3NH1A 4I9LA 3L6QA 4Y1CA 4PQUA 2ZM6K 4FOIA 3KLFA 2I7NA 3V9XA 3K57A 4CJTA 4AH9A 1DTTA 4LSNA 3MAQA 2BUPA 4DSLA 1X9MA 2BTFA 2YJFA 2E2PA 2HB5A 3LM2A 3JS6A 4K0KK 1M1KO 5LY3A 1RNHA 4C1NK 4BRAA 4FM1A 3AY9A 3DYAA 3LZIA 5HOOA 2D0BA 3RMCA 3I33A 2OPPA 1JLQA 4OKJA 4OKKA 1GLJO 3ENOA 4JKEA 4JI7K 1JXBA 3BEXA 4IZ9A 3O9SA 4M63C 4DTUA 3AVIA 4DU3A 2X78A 2KW4A 3V4IA 3DLEA 3HPGA 3A2FA 1TKTA 3KKSA 3ZSZA 3C7NA 2P51A 3AVLA 3L0QA 1DLOA 3KHYA 1HPZA 3T19A 4UY8O 1RT1A 4NO7A 3U3GA 1GOAA 1L3VA 4M7YA 4CEDA 3DLRA 3NF8A 4CK1A 4QS9A 1SV5A 2XY6A 3U9DA 2AP1A 2ZD1A 3CCMN 2Q97A 3L3UA 3HXMA 3S3OA 2P1JA 5IT9O 4BRMA 3KTQA 5AZIA 4BDPA 1I39A 2FBTA 3NGZA 3G6EN 3P5JA 5AZIB 5K14A 2OTJN 1YXQA 3L8BA 4RWTA 1EO1A 1U48A 4OGEA 4CZFA 3V9WA 3VF4A 1CZ9A 3LALA 3TARA 1XNRK 4DSIA 2PAVA 2RPIA 5HRNA 1NGCA 1NGAA 4CEOA 3CXCM 4PKHA 3HTVA 3VF2A 1MWKA 2Q3SA 1U47A 5BPMA 3LP0A 5AQZA 3RSEA 1N33K 2E20A 4NCGA 4OKEA 4PWDA 4OPHA 4C8LA 2WC9A 1C1AA 3QICA 5BRDA 1ITGA 4DQIA 1C0UA 2VGMA 1S1WA 4BDYA 4CHZA 3AVKA 2VWJA 1WN7A 4BC5A 4HHTA 4BR2A 3E9LA 3OYJA 3OYCA 3VETA 3QBXA 2D0PA 1JLGA 3O4NA 3NF6A 3T1AA 1NJZA 3MX5A 4KHNA 4YOYA 4PA1A 3F73A 3M5RA 5KGWA 1NJIO 5FRNA 2OCEA 1K8KA 3SUQA 5BPLA 4CZGA 4N76A 3MN6A 1K8KB 4KBOA 3O9TA 3MWPA 1ESVA 3VEWA 4BWJA 1JCGA 3EE9A 1IBLK 4EZ6A 4AHRA 1BG3A 2VGNA 4M3WA 3DWLA 3LWLA 2KTQA 4PL7A 5FDLA 4YORA 1RDCA 3BZKA 3UKRA 2YX6A 2RE2A 3PIPL 3U6FA 4PHTX 3UKRB 1X9WA 1GLFO 4BQZA 4RG8A 4OVLA 2QK9A 5SWMA 3P31A 4KH4A 5GAGP 4JYAK 1XC9A 2KLAA 4CIGA 1NNEA 3NH0A 4GV3A 1NJXA 2DFHA 4Z4IA 3EO3A 3ENHA 2NNWA 3BDPA 4E1NA 1QQOA 2FSJA 2IC3A 3BUZB 4B1VA 3AA5X 3NF7A 4KKOA 2BH1A 4FK0A 5C24A 4JEPA 1S9GA 1B9DA 1VSHA 3T3FA 1KC8O 3ZCMA 3TR8A 3CQXA 4GNIA 4CJ7A 4EP4A 1TKXA 1JKHA 4WFBL 3L3VA 3DXMA 2YNHA 4MDBA 4F9OA 3DXMB 4KB1A 1NOZA 3I0RA 2ZGZA 3TAPA 1VQ8N 4CZHA 3ID8A 3ZX3A 2QXFA 3VQBA 3CD6N 5LMUK 4QS7A 1HRHA 2UUAK 4YDUC 3WUHA 4GMJB 4WF9L 4CESA 1LWCA 3TSUA 4J2EA 4Y0WA 1D4XA 3PIOL 5CZ1A 3UB5A 3KK1A 3SNNA 3LPTA 1TGOA 1KVCA 1S5JA 2E4LA 4F4KA 2EHGA 3KLEA 3H1QA 2IIRA 4MLEA 4FJIA 4DV5K 1J54A 4NYFA 1OH7A 2FBVA 4N41A 3NE6A 1O1WA 5SZTA 2HF4A 4J2DA 3ZEUA 4DR7K 2GWKA 1S72N 1YI2N 3ZEUB 2E6LA 3R8EA 4CHQA 1JCFA 2YKNA 3FFIA 1KVBA 2OTLN 4FJJA 3JAMO 2YHYA 4DQRA 3U4LA 4C8NA 4NB4A 3TTDA 4E1JA 4DFPA 4NLBA 3AV9A 3KLIA 4MQ3A 2HHHK 4O8UA 3DXKA 3V6DA 4JI2K 1VSLA 3DXKB 3OYHA 4BWMA 5C42A 2QW9A 4BG9A 1HKGA 3FZMA 2UYTA 3O4QA 4DR2K 3D2EA 4ILHA 5E41A 2FC0A 4YOWA 4DTOA 2ZJPL 3HSTB 3VQ4A 4K42A 2QWLA 2V52B 1YTAA 4FW1A 3U8XA 4KTQA 4B9VA 4KHSA 1RTIA 1TK8A 4AF1A 1NJWA 1YVNA 4FWSA 4K43A 4DV2K 3VTHA 3ZT4A 2XY7A 3ZSWA 1VHXA 5FPNA 5FRMA 4H5VA 1XC3A 2ZQBA 2YHAA 1KTQA 3TU5A 4E7LA 1YVUA 1HNZK 4BVOA 3QETA 1NOYA 4KTWA 3KVGA 3D6RA 2O4IA 2E5LK 3MN7A 4B1XB 3KD1E 3AO3A 5C2DA 3QNOA 4Z4GA 3DRSA 1K8AO 1U49A 4JHDA 2YNGA 3QERA 3QFPA 1TUUA 2YI1A 4H4OA 1VSEA 5D3GA 1QQCA 1BA1A 4JHDB 3VGLA 2CGLA 3AO4A 1S1TA 3LANA 3VQEA 1WSHA 1SS6A 1RBSA 2HF3A 4RW7A 3SMSA 1YHQN 1BISA 4N56A 4JD2A 3O3HA 2Z1JA 3MK6A 3KLGA 2WUSA 5C15A 4JD2B 4JK7A 3S41A 5HRSA 3THYA 1T05A 4CJEA 5BN8A 3SUOA 3C95A 2O8DA 4DS4A 3IG1A 4YDUA 1E3MA 4YY3K 1X1PA 3NH2A 1U2VA 2GTDA 1UA0A 4FWNA 3OHRA 1ZBLA 3GG4A 1U2VB 5E84A 5KRSA 4XH5A 4JLHA 2WBNA 4YNQA 3H45C 2UXBK 4RW4A 3IUCA 2UUBK 1NK4A 2OPRA 4Z4HA 4W5OA 3SQ0A 1UA1A 3AVAA 2WTUA 1WB9A 3EY1A 3H08A 2JWKA 1C6VA 3JSMA 4QOZB 3CETA 4KHYA 2IVPA 3WXKA 4BACA 4ILGB 5C25A 5KQ8A 2W42A 2QWQA 4HCBA 1NK0A 4H0VB 2VQEK 4H5WA 3CPWM 5LMNK 2YNFA 2IDOA 4FWMA 4CD3A 3R9PA 2F9TA 4FVUA 1Z6RA 4CZJA 3VEYA 4OO1J 2QWPA 4DMNA 3B6PA 4IOCL 4DFMA 3N4QA 3P1GA 4BG8A 4BE2A 1YUWA 4B1WB 3ZSYA 4LF8K 4K25A 3FR0A 1NKBA 3R3LA 4IDHA 5MLCQ 4FJGA 4FWKA 5KPRA 5LJWA 3RRGA 1S3XA 1BL3A 2GX9A 3OS1A 2LSNA 3N4PA 5C12A 4OPAA 5BREA 2ASOA 3ZT2A 5AQSA 2QWOA 1X9SA 3EZWA 4UQGA 4DG1A 3DOKA 3RR8A 1C0FA 3CFPA 1Q18A 4DR6K 3QFUA 4Y1DA 2D5RA 5F1XA 1L3UA 1KFDA 3RRHA 5AQKA 4E19A 3SAFA 4CFDA 1NK9A 3CM6A 3VTIA 2VWBA 1RT6A 1VQ4N 3FZKA 4AHTA 3CCUN 2Q36A 3PSIA 1VRUA 1XNQK 4ISFA 3VGMA 1O13A 3T1YK 2HOEA 2KKZA 4I6MB 3S9HA 3A5NC 4RW8A 1TKZA 2VCPA 4DB3A 3L2UA 2UUCK 3M8PA 4I2QA 3R6MA 3Q7BA 3OYNA 3OTOK 3NVKA 3K5LA 3TI0A 3OYKA 3RVCA 3K0SA 1SKWA 1ATNA 5AR0A 3MN5A 1OH8A 4BGAA 4ID5A 3AVCA 3IKMA 4CZMA 1U4BA 1BGXT 3OYDA 3DLHA 4Q0BA 3BF3A 2QWMA 3QB0A 4CGIA 4KI6A 1CLQA 1IKYA 4BVPA 3ULEB 1BU6O 1QSYA 1X3MA 4CF2A 3CG7A 4A2BA 2QTDA 1SL0A 1G15A 4CZLA 1NG9A 2FXUA 3O3FA 3HRGA 1FW6A 5EY4A 1RTHA 5HBMA 5AJ3K 2A1SA 3V9UA 1NK6A 1C1BA 3QMLA 3CYMA 5AQPA 4W5TA 3A5MC 2O8EA 3VEVA 3FGUA 4KH5A 4H0XB 5J2NA 1VSIA 1DGKN 2O8EB 4ISEA 4E89A 1WSJA 3ZT1A 4DTXA 5J1EA 4BR9A 3U3YA 4Z0UA 2Q0RA 1QTMA 1UAXA 5JS1A 1EWRA 3PX6A 4CEBA 1VQ6N 2JLEA 4A62A 3OBYA 4GVEA 4BRHA 3B6OA 2HW3A 3F2KA 1NGJA 1X9JA 1ASVA 2F4VK 1WSIA 1B92A 3CIPA 3W3DA 4BC3A 1XWLA 4JKCA 2P9IA 3EYZA 2DFFA 3PV8A 2DFEA 4X64K 3C0BA 3CQYA 1RDBA 3TAGA 2P9IB 3DI6A 3SPYA 4H0TB 5BR8K 4AM7A 2IVNA 3OJUA 2QXLA 4DTJA 4GY2B 4FCYA 1WAFA 1MU2A 5AQTA 3ZSVA 5JLFA 4B9UA 4IFVA 3O5BA 4C8KA 2IS3A 5EVZA 5LL6Z 5HP1A 2YHXA 4CJ5A 3KK3A 3Q7CA 2NRRA 1T03A 1D9DA 4B3OA 1J6ZA 2W6LA 1QSSA 3SYZA 2P5GA 1T6CA 1BOTO 1U04A 4KAZA 4FK4A 1FK9A 3TSQA 2HHQA 3VEZA 1RT2A 3H6EA 2ZE2A 3RR7A 3JXUA 3CFRA 3L4QA 2OANA 4DSKA 4FLZA 2D1KA 1S1UA 4CBUA 4LFCK 3VERA 3CMAN 4FJLA 2VG7A 3T7ZA 1XHXA 3K59A 4DR1K 1NGBA 4TSXA 1RT3A 1GLEG 3C7NB 4JAXA 2QEXN 5A2QO 3GBTA 4CW7B 5H1SQ 1UWBA 4IEIA 3BY5A 1TUYA 4RTFD 4A5BA 1RCHA 5M1NA 4B3MK 1U45A 5IWAK 1NK5A 4LFAK 3O9UA 4FZYA 3O6WA 5EOYA 2KZZA 1LCUA 3HJFA 4LY7A 3A0IX 4HTUA 3THXA 2HHTA 2YKMA 4ICLA 1IO2A 4CEEA 3V1QA 1A5VA 4LFBK 4B9NA 5J2MA 3HI0A 4KHWA 3RMBA 4QS8A 4I9QA 1ZC6A 4BY9C 3OJSA 3SQ4A 3C6AA 1NK7A 1VSJA 3ZSRA 3HPOA 4DV4K 1YT3A 1N8RO 4DSFA 3ITHA 3NGYA 3FLCO 3SBGA 3E1YA 3I8BA 4OJRA 4BC4A 1JL1A 4FPBA 4BE1A 1KVAA 2EWSA 5AQWA 2G8WA 5JS2A 1REVA 4H5NA 1NKEA 1ATRA 3RSEB 4N5SA 3O1WA 2NRXA 3SPZA 5AQGA 1T6DA 1YJ9N 2Q1NA 4DQ8A 4Z4CA 1GLDG 3LAMA 4L8RB 4H0OA 4YOXA 1VQ7N 3O3GA 4KRFA 3D7EO 5JLHA 1VQON 1LW2A 4DU4A 2ASPA 1QQMA 1S9EA 4YOUA 4BRGA 4OX9K 2WFBA 4FLWA 5F2RA 2HVHA 3MXIA 1EXQA 4M3TA 2NRVA 1BQNA 3AAPA 2OYQA 5BRFA 2Q31A 4CF9A 3WNHA 4KTZA 1KLNA 4Z4EA 4CZEA 5B8HA 4DWIA 3CCSN 3P4IA 4MO4A 4LH4A 1IKWA 4KH6A 3U9ZA 4HCCA 3MXMA 5I42A 4IO9L 4CEFA 4CGDA 3QBWA 4B1ZA 5AQHA 2O8BA 1KLMA 4RCHA 1ZBFA 1R59O 2P9NA 2O8BB 1CZBA 1ZBUA 4CF1A 1A5XA 1Z25A 1XMOK 5AQYA 5AQOA 4BRNA 3NAEA 5CYMA 3S3NA 4FYDA 1Z05A 3OYEA 1BA0A 4KO0A 2OZMA 4E3SA 1T3VA 2NRZA 4DU1A 1KQSM 4FZXC 2I7PA 4O5FA 2F7TA 1VQMN 4OPJA 4JKBA 5EX5A 2NZTA 4YFUA 3QDKA 4DV6K 1HNIA 2J4RA 4IBNA 2Z1IA 3AA2A 1GLCG 2P9PA 1HYSA 3UIQA 3CJ7A 2XY5A 4JI6K 3H46O 3L2RA 2P9PB 4CI6A 1TK0A 4BGBA 3MXJA 1ZBHA 4CJWA 2IGIA 4CCHA 4FXDA 3AVHA 4ELUA 3VOVA 1KFSA 3K9JA 4FJKA 3EKSA 1KAZA 1C0GA 5KPTA 5AQFA 4DTSA 3AO2A 1X3NA 4CE9A 3WNGA 3V9SA 2HNYA 5GADP 4IG0A 4IEEA 3I55N 2HBKA 3HT3A 3SK3A 1VK0A 3T1HK 3IRXA 4KFBA 2Y1JA 4BDZA 3EEQA 3FZLA 5FPDA 4AHVA 2NRHA 2F9WA 2YV0X 1D8YA 4CZIA 2FF6A 1Q81O 3IMXA 4FWRA 4FO0A 4CHYA 5AFUH 1RBTA 1N34K 2PFUA 4H0YB 5GAEP 5C0YA 1EETA 2DPNA 3O80A 4CHNA 4IOXA 3GE1A 3P39A 4CJFA 2GEMA 2V7ZA 2D0AA 1TYQA 2B4JA 2HNDA 5BPNA 1WBDA 1WLJA 1T44A 4FWQA 1TYQB 2O4GA 3TPQA 4EHTA 1BCOA 2NRWA 4FL9A 3J8AA 3DAWA 4DQSA 2V7YA 3CPEA 4B08A 1CXUA 1HNWK 4CGHA 3F5TA 3MEGA 4EHUA 5E26A 3TAMA 3OYBA 3VQDA 4NXMK 4O0IA 2BANA 4M3RA 3V1RA 3HP9A 2P9KA 3OYAA 4IWVA 5AQUA 4CJUA 4K8ZA 1EX4A 3MECA 4JRQA 4BR7A 2P9KB 5JICA 1YAGA 3NHGA 3WXIA 3B8AX 3IDHA 1W7AA 2W41A 1WSFA 4AQYK 3I8DA 3OVNA 3HYFA 3LP2A 4FLTA 1CXQA 4JI1K 4E7IA 3FZFA 4A57A 3OBWA 2ZJQL 3QEVA 4O5BA 3K5NA 2HBMA 3D2EB 1LOTB 3CI5A 3LL3A 1B9FA 4DUZK 3TTFA 2E1YA 1NGDA 5I3UA 3M3ZA 1A5WA 2YJEA 5BR9A 1HNVA 4FM0A 1VQPN 3IFRA 2IVOA 2QWNA 5FPEA 5JVGL 3HSCA 3V1OA 4M3ZA 4K41A 1EQYA 3AO5A 1HJOA 4CERA 3AGRA 4DKWA 3BGRA 4FLUA 4JV5K 1Y64A 2E88A 4CECA 1QHTA 3C6HA 1WNSA 5TKYA 3OYIA 4W5RA 4QCLA 3KK7A 3RWUA 3CM5A 3LDPA 4FLXA 3OYGA 3SCXA 1HPMA 3H3OB 3CCLN 2B6AA 1HKCA 3A8YA 4RW6A 1BIZA 1DT9A 3VEXA 4BR4A 1HQUA 2P9SA 1GOBA 3MX2A 1OH6A 5EU7A 2GUIA 2KFZA 3OYFA 2P9SB 5C2FA 1HNXK 4B9TA 2DY4A 3EZ5A 2X74A 3MDQA 5HROA 3THYB 1IJJA 3E9OA 3VA3A 2O8DB 3HO1A 2E2QA 2ZF5O 1N36K 2ATQA 3NF9A 3AARA 4XEIA 4FJ5A 1U6ZA 3CF5L 3MCAB 1BHLA 3WQTA 5AQJA 4GKKK 3J7ZO 3VN5A 1IG9A 1IBMK 1YIJN 4WFAL 3WNEA 3ID6A 4BRLA 3MEEA 4ISGA 3KJVA 4RW9A 1KCFA 2G8FA 5AFUA 3SV4A 4X66K 3DJCA 3EKUA 1RT4A 3MEDA 1K73O 2RKIA 2GELA 2HNZA 4OPKA 3HK2A 4AILC 3TABA 2GUPA 4CIFA 3PX4A 4CJLA 3ZT3A 4DTRA 2AJQA 3EN9A 3L4IA 5I9EB 5GIOA 2UXCK 2A41A 3AVNA 4CHPA 5FROA 1DTQA 1NGEA 2A5XA 1JLBA 3ATUA 3VQ6A 3AVBA 5AZJA 3AVJA 4XH1A 5AZJB 4MDAA 1WUAA 5AQQA 3PO5A 4NXNK 3SJHA 4ZHRA 3ZETA 1WBBA 1XHZA 3SI6A 1K6YA 2P9UA 4DQQA 4FLYA 1TVRA 2P9UB 1LAWA 4CJVA 4BQLA 2VYPA 3QESA 4F2RA 1HYZA 2G8UA 1SZ2A 5EXWA 3ZSQA 1VQLN 3THVA 4O55A 3ATVA 2ZWHA 4LF9K 2A40A 1KD1O 4CD1A 4FW2A 4R79A 5GAHP 1Q86O 3PUFA 1RT5A 3TAQA 3D2FA 4CBWA 4B3TK 1GLLO 3GDQA 3CERA 3C65A 5AQRA 4DSJA 2A1RA 5T7BA 4WQ4C 3D2FB 1NWKA 4DF8A 4CGGA 1QE1A 3OYLA 4BR5A 3SMPA 2Z1HA 4ZTFA 5ELZA 1W97L 3VQ5A 4CEAA 3D45A 1NM1A 2YNIA 4JKAA 1QS4A 1V4SA 3VMFB 1Q7YO 1XUPO 4I2PA 4O8KA 2G8VA 3TANA 3NVMA 1NKCA 4MFBA 3P38A 2QI2A 4CFAA 3J81O 4OLBA 4O0JA 4E0DA 2FF3B 2P9LA 1QZ5A 2E6MA 1BCMA 2BDPA 4LF6K 3ZT0A 2P9LB 2HHXA 2JWLA 4B1YB 3HOTA 1TL1A 4BRQA 4FWPA 3MWTA 3QINA 3CCVN 4XIUA 4KREA 1I3AA 2A42A 1OH5A 4DCHA 1LW0A 5CYQA 1P8ZA 1S6PA 2PBDA 5C10A 1SUQA 3A5LC 1HMVA 2O8CA 4NLCA 3VESA 2O8CB 3LPUA 2F96A 3CCRN 4DHYA 3DRPA 3LAKA 4W5NA 2F8TA 3G71N 4QAGA 3E9PA 1YJWN 3KK2A 3RMAA 3VENA 1RTJA 4IJNA 4DV1K 4J2AA 3AGKA 3VQPA 4CJ4A 3GOIA 1ZBIA 3I0SA 1JJ2M 4JKDA 1Q9YA 4PL8A 5AQIA 4WFNL 4FJ9A 1Y97A 1RT7A 5M1FA 3O08A 4CFBA 3NDKA 4HUGA 3UKUA 1GLBG 1RDDA 5BN9A 4BRPA 3UKUB 2GWJA 4EFHA 4IXCA 4FM2A 3ENBA 1NBWA 4JKGA 3R1XA 1HR0K 3VQQA 5M1OA 4DV3K 2Q2RA 4JKGB 5KPZA 1BQMA 4FWLA 4A5AA 1HYVA 3OS2A 1NK8A 4Q5VA 1VQNN 1MDUB 3QIPA 4H5TA 3TAFA 4C8OA 2G8IA 1VRTA 4B3RK 3F9MA 3WXLA 3ULDA 3BZCA 2QKBA 3HP6A 1Q82O 4HUFA 5KRTA 4FSVA 4CJ3A 1ZYQA 4CFCA 4E1MA 1YF5L 4IO8A 2ZGYA 2X6NA 4CJPA 4HVJA 3LWMA 1RBUA 1EP4A 3WEEA 1QQNA 3AVMA 4C23A 2AA4A 3LDQA 1OKJA 3WEEB 4EAHD 3G10A 2HHVA 2VQFK 4WQ4A 4CBXA 5HL7L 5KTQA 4DLEA 1VSDA 1IKVA 5AQNA 1DKGD 2HBLA 2GBZA 4HTLA 3QEXA 3VEOA 4FZZA 1M90O 1HJRA 2HVIA 4KV8A 4JI3K 5GIPA 3THXB 1D9FA 2OZSA 4DV0K 1IBKK 4B9MA 3NFAA 2IAJA 4PKGA 1NMDA 4CIEA 2RF2A 4K8XA 4LSLA 3CJCA 1QVFM 1JL2A 5DK5A 4JK9A 2HMPA 5DM7L 5CE3A 3SUPA 4FOEA 4WQ5C 4WCEL 4M3XA 3ASMA 3S3MA 4CJRA 4BR0A 1S6QA 4E7HA 1C0TA 2QWRA 3SZ2A 1VQ5N 3VQ9A 2FSNA 5CR4A 1ASWA 1SQKA 3J7AP 4LF4K 4FJXA 2PYLA 2H3GX 4U7BA 5F0XA 3HBTA 4B1UB 1N6QA 1LWFA 5AQLA 2WOMA 5LJVA 3LDNA 3M8RA 4BRKA 2HSTA 3H1VX 3HPHA 2CGKA 1NU0A 4BC2A 1VQ9N 4W5QA 2KHOA 1LV5A 4H4MA 2G8KA 4M3YA 2W40A 2B5JA 4DR3K 2DTUA 4GVMA 1TK5A 2FBXA 2Y1IA 3P83D 3SQ2A 1W9HA 3W0LA 3SJJA 3PSFA 3V81A 3AA4A 4GKJK 1WOQA 3CJ9A 1VSMA 1ILYA 3H3NO 3L2VA 4DTPA 2YHBA 3HVTA 5CY4A 4M41A 2VG6A 1IG8A 5M1QA 5JVHL 4X65K 1XMQK 3KKRA 3FE1A 1VAZA 3BP8A 3NGIA 2V51B 3QNNA 1I94K 1S1VA 4AHUA 3HVRA 3OY9A 4LF7K 5TKWA 1L3SA 1MA9B 2P9NB 3MCPA 3WNFA 1FKPA 2QA4N 1RTDA 2ITGA 2HBJA 4KB0A 3MN9A 1VQKN 4BRCA 4BREA 4DQPA 2W6KA 3L2WA 3ALYA 1E4FT 4BROA 2HHWA 3O9RA 2YCHA 4IDKA 3CC4N 3C6TA 2XHBA 1EKEA 1OVYA 4LC9B 4H8KA 1HUXA 2QKKA 4JRPA 3I56N 3G0ZA 4DUYK 4B8AB 3K2PA 4C8MA 4CK2A 4PKIA 2PYJA 4F3OA 3EL2A 3CJ1A 4OLAA 4MO5A 4DR4K 3J80O 2VWKA 5BRHA 1MWMA 4OGCA 1TL3A 3EE8A 4FJ8A 3AAQA 3ZLJA 2HHUA 4DV7K 2BGGA 2OA8A 3OYMA 3TWHA 1ASUA 3A5OC 2KFNA 5DMRA 1QSLA 2Z1GA 4B9SA 4CK3A 4F3TA 3SAGA 3M8SA 1ATSA 4GW6A 1BI4A 3SAHA 3KLHA 1KSPA 3HZ6A 4FJHA 2ETJA 1BI4B 3MMVA 4JI8K 3WQUA 4BRFA 4CF0A 4WQ5A 3OW2M 4ID1A 4KHQA 1NGGA 2BE2A 3DMJA 2VG5A 3PLAA 2D4WA 4DR5K 3BF1A 1RDUA 2E2OA 2CGJA 1QVGM 1NGFA 4F2SA 4GV9A 2JGUA 3VPZA 2F8SA 4FJ7A 5KGXA 2ZJRL 3LM9A 4L3QA 4M7XA 4CF8A 4M45A 4CEZA 2NLXA 3K5OA 1KAXA 2A3ZA 3DM2A 4JKHA 4EZ9A 1NGHA 3ZSXA 3LDSA 1SAZA 4DF4A 4R5PA 1W0HA 3C6UA 4IJAA 3TSPA 4IFYA 2O8FA 3SQ1A 4KHUA 3KWIA 1J5EK 3AO1A 3PO4A 1KAYA 1YJNN 1BO5O 4A61A 4NCAA 3AVGA 4LH5A 2O8FB 3KIOA 2CH6A 3TTCA 1S1XA 3FFKB 2OPQA 3CHWA 3VF6A 4B8CA 4PUOA 1NJYA 2NUBA 1JLEA 3CCQN 2R7YA 1XI1A 3FZHA 5AQMA 1H1VA 4BRIA 4DLGA 1JXEA 1VSFA 2D0OA 1JLFA 3TAEA 3WXJA 1YITN 1GLAG 4O4GA 3KD5E 4FWOA 1RDAA 1Z26A 1OVQA 2FLOA 3J7YP 4JS4A 3LZJA 4EIAA 1QZ6A 2XO7A 3ZSOA 3M8QA 4E7KA 1L3TA 4C1NI 3PY8A 5HRPA 4KHPK 4F8RA 2KQ2A 2E1ZA 3ISNC 4B9QA 1VSKA 4B9LA 3DRRA 1SKRA 3VQ8A 4WYBA 1KXPA 4EP5A 4BE0A 3K5MA 3QLHA 3HM8A 1IKXA 2FSKA 1FKOA 3AVFA 4CGJA 2UXDK 1C1CA 1HX1A 2KZMA 3HL8A 4U67L 1D5AA 3T69A 3CMEN 4AM6A 1RILA 3CC7N 1SL2A 2D0CA 2QM1A 2WONA 4IG3A 5M1KA 1W2BM 1FJGK 3O9QA 1F21A 2G8HA 1N5YA 4H0PA 3G4SN 4FLVA 4NCBA 1NLVA 1Q9XA 5AQXA 4G9ZA 1TKDA 1YTUA 5ADXH 1HLUA 5KQDA 1WAJA 3SV3A 3O4WA 3IS9A 3VA0A 2HMIA 1K9MO 1KRPA 3QEWA 3QIOA 5CZ2A 3GL1A 1BIUA 4B3SK 4KI4A 1TAUA 2RN2A 4ZTJA 3PX0A 5CHIA 3OS0A 2PZSA 5KI6A 2PY5A 4DTNA 3C94A 4N47A 3CQ8A 4NYNA 4Z94A 3G25A 4J8FA 4YOVA 4FK2A 2XY8A 4M42A 4CJKA 3ZX2A 4CGFA 3SLCA 5M1PA 5HRRA 4YHHK 4JI5K 1C0MA 1RGIA 4AHCA 2FBYA 3F9KA 1BUPA 1T7PA 1IV0A 4IFEA 1WSEA 1HQEA 1LAVA 5JMVA 3HOSA 4DFKA 2OPSA 5J2QA 3THWA 3M1FA 4M3UA 3THWB 1EWQA 3K9KA 1NGIA 3O8MA 3CC2N 1TAQA 3M6GA 1S22A 4O44A 4JKFA 1HKBA 3RMDA 2ASMA 4E7JA 3UE5A 3HM9A 1RBRA 4ILJA 3V9ZA 3ZETB 3VQCA 3CJAA 4CVNE 4LF5K 1N32K 1NMNA 1Q8IA 4CJSA 4CZKA 1G99A 4JN4A 1L5UA 1RDWX 2X6SA 3O1BA 3DLLL 1WSGA 4H5RA 3LP3A 1XQSC 2XRIA 2E8AA 2CH5A 1JCEA 2P5OA 4KPYA 4WE1A 5FLXO 1JLAA 3E01A 1P90A 4FJMA 4HWIA 4IKFA 2EX3A 3OA9A 3LP1A 3L2QA 4ELTA 4X62K 3E66A 4I6MA 3RTVA 5DM6L 1SL1A 3DLBA 4JNEA 4MLHA 1ZBSA 1QHAA 1RFQA 3K58A 5GINA 4LD0A 4FVMA 4XH4A 1DEJA 4JS5A 3VQ7A 3CJBA 3KWGA 3WT0A 3WXMB 4AHSA 4JK8A 1R0AA 4CEQA 4DSEA
chains in the Genus database with same CATH topology
1NMDA 4JD2A 2Q0UA 3MK6A 3FZLA 5FPDA 5AQVA 2NRHA 2F9WA 2WUSA 3CJCA 4FPAA 4JD2B 4JK7A 1V4TA 3S41A 3ULEA 5C15A 1QVFM 4JK9A 2HMPA 5BN8A 5DM7L 2E2NA 2FF6A 4CZIA 4FOEA 5CE3A 4A2AA 3IMXA 1Q81O 4WQ5C 4WCEL 1BDGA 4FWRA 4FO0A 1ZXOA 4YDUA 4BRDA 5AFUH 4BR0A 3KZBA 3SBTA 2PFUA 2QWRA 4H0YB 5FPMA 3ZYYX 5GAEP 1U2VA 2GTDA 2DPNA 2NRTA 5ADXA 1VQ5N 5C0YA 1CZAN 2FSNA 2YHWA 3O80A 4FWNA 5CR4A 4IOXA 3OHRA 4IOAL 3GE1A 1SQKA 3GG4A 3P39A 1U2VB 5E84A 2GEMA 4XH5A 2V7ZA 4H03B 3CCEN 1TYQA 2WBNA 3LDLA 2H3GX 3H45C 5BPNA 4U7BA 5F0XA 3HBTA 1T44A 4FWQA 4B1UB 3VGKA 1TYQB 3IUCA 3CCJN 3TPQA 4EHTA 5AQLA 5LJVA 3LDNA 4BRKA 2HSTA 2NRWA 3H1VX 4FL9A 2A6AA 2CGKA 3J8AA 4BC2A 2JWKA 1VQ9N 3DAWA 2KHOA 2V7YA 3CPEA 4YOTA 3F5TA 3CETA 4EHUA 5E26A 2IVPA 3WXKA 2ITMA 2W40A 4ILGB 5KQ8A 2QWQA 1E4GT 2P9KA 3LDOA 4H0VB 4H5WA 4IWVA 5AQUA 3CPWM 4FWMA 4BR7A 3R9PA 4CD3A 2P9KB 3W0LA 2F9TA 2RHKA 4A59A 4FVUA 1Z6RA 4CZJA 3VEYA 1BWFO 1WOQA 2QWPA 4OO1J 5JICA 3CJ9A 1ILYA 4IOCL 1YAGA 3WXIA 3H3NO 4GV6A 3B8AX 3IDHA 3N4QA 4BG8A 1YUWA 3NMUA 4B1WB 3ZX0A 2W41A 3L6QA 4K25A 3FR0A 1IG8A 4FOIA 3R3LA 5M1QA 5JVHL 2I7NA 3FZFA 3FE1A 4IDHA 1VAZA 3OBWA 4A57A 5MLCQ 3BP8A 2ZJQL 4FWKA 5KPRA 5LJWA 1S3XA 2V51B 2BUPA 2HBMA 1LOTB 2GX9A 3CI5A 3D2EB 3LL3A 3N4PA 5C12A 4OPAA 5BREA 2BTFA 2ASOA 5AQSA 2QWOA 5TKWA 3TTFA 2E1YA 3EZWA 1MA9B 1NGDA 2YJFA 3M3ZA 2P9NB 2YJEA 3MCPA 5BR9A 1C0FA 2E2PA 3LM2A 1VQPN 3IFRA 1Q18A 2QA4N 2IVOA 3QFUA 3JS6A 2QWNA 5FPEA 5JVGL 3HSCA 5LY3A 5F1XA 1M1KO 4C1NK 2HBJA 4BRAA 3MN9A 3AY9A 4K41A 1VQKN 5AQKA 4BRCA 5HOOA 4BREA 1EQYA 3SAFA 1HJOA 1E4FT 4BROA 3AGRA 3I33A 3VTIA 3O9RA 2VWBA 2YCHA 3CC4N 1VQ4N 4DKWA 1GLJO 3FZKA 1OVYA 4LC9B 3CCUN 1HUXA 2Q36A 3ENOA 2E88A 1Y64A 4JKEA 4ISFA 3BEXA 3VGMA 4IZ9A 1O13A 3I56N 3C6HA 3O9SA 5TKYA 2HOEA 4M63C 2KKZA 4PKIA 3KK7A 3LDPA 3EL2A 3CJ1A 4I6MB 3A5NC 3C7NA 2VCPA 4DB3A 3L0QA 4MO5A 3KHYA 3R6MA 1HPMA 3Q7BA 3H3OB 5BRHA 3NVKA 3CCLN 3RVCA 4UY8O 1HKCA 1MWMA 4NO7A 3A8YA 1ATNA 3EE8A 5AR0A 3MN5A 3AAQA 1DT9A 4M7YA 4BGAA 3VEXA 3IKMA 4CZMA 4QS9A 4BR4A 2P9SA 3U9DA 2AP1A 3CCMN 2Q97A 3MX2A 4BRMA 3BF3A 2QWMA 3QB0A 5AZIA 2P9SB 3A5OC 5C2FA 4BVPA 3G6EN 5AZIB 3MDQA 1BU6O 1YXQA 3ULEB 2OTJN 1IJJA 1X3MA 3E9OA 3SAGA 4A2BA 4RWTA 1EO1A 1ATSA 2QTDA 3SAHA 2E2QA 2ZF5O 4CZFA 3VF4A 4CZLA 3HZ6A 2FXUA 3HRGA 3AARA 3MMVA 4XEIA 3WQUA 4BRFA 1U6ZA 5EY4A 3CF5L 3MCAB 3WQTA 4WQ5A 5AQJA 3OW2M 2PAVA 3J7ZO 3QMLA 1NGCA 1NGGA 5AQPA 1NGAA 3A5MC 3VEVA 4PKHA 3CXCM 3FGUA 3PLAA 2D4WA 1YIJN 4KH5A 4H0XB 3HTVA 3BF1A 1RDUA 3VF2A 4WFAL 1DGKN 3ID6A 4BRLA 4ISGA 4ISEA 2E2OA 1MWKA 2CGJA 1QVGM 1NGFA 4BR9A 2Q0RA 4GV9A 3VPZA 5BPMA 5AQZA 5AFUA 2ZJRL 3RSEA 1VQ6N 4A62A 2E20A 3OBYA 3LM9A 4GVEA 3DJCA 4OPHA 4L3QA 4BRHA 3EKUA 4M7XA 2NLXA 2WC9A 3QICA 1KAXA 3F2KA 5BRDA 1NGJA 1X9JA 2A3ZA 4JKHA 2VGMA 3CIPA 3W3DA 4BC3A 1NGHA 1K73O 4JKCA 2GELA 2P9IA 1SAZA 2GUPA 3C0BA 4IJAA 3CQYA 3TSPA 4BC5A 2P9IB 4BR2A 3KWIA 3E9LA 3EN9A 1KAYA 3L4IA 4H0TB 3VETA 1BO5O 3QBXA 5I9EB 2D0PA 2A41A 4A61A 4AM7A 5GIOA 2CH6A 1NGEA 2A5XA 2IVNA 3MX5A 3TTCA 4YOYA 3ATUA 2QXLA 4GY2B 5AZJA 3FFKB 3M5RA 4XH1A 5AQTA 3CHWA 5JLFA 5AZJB 3VF6A 4MDAA 1NJIO 1WUAA 5AQQA 3CCQN 1K8KA 3O5BA 5EVZA 3SJHA 5BPLA 3FZHA 4CZGA 5AQMA 3MN6A 1K8KB 1H1VA 4KBOA 3O9TA 3ZETA 2YHXA 3MWPA 4BRIA 2D0OA 2P9UA 1ESVA 3Q7CA 3VEWA 3WXJA 1YITN 1JCGA 1GLAG 2NRRA 3EE9A 1J6ZA 2P9UB 1T6CA 1BOTO 1BG3A 4BQLA 2VGNA 2VYPA 4FWOA 3DWLA 3TSQA 4PL7A 1SZ2A 4YORA 5EXWA 1VQLN 2FLOA 3VEZA 3UKRA 3H6EA 3ATVA 2YX6A 2RE2A 3PIPL 3JXUA 2ZWHA 4EIAA 1QZ6A 3L4QA 4PHTX 2OANA 3UKRB 2A40A 2D1KA 1GLFO 1KD1O 4CBUA 4CD1A 4C1NI 4BQZA 4R79A 5GAHP 3P31A 4KH4A 5GAGP 1Q86O 2KLAA 3VERA 2E1ZA 3CMAN 4GV3A 4B9QA 3T7ZA 4WYBA 3D2FA 1KXPA 4CBWA 1GLLO 3GDQA 1NGBA 3C65A 3CERA 3EO3A 5AQRA 3ENHA 2NNWA 4WQ4C 3D2FB 1GLEG 3HM8A 3C7NB 2FSKA 1NWKA 4JAXA 2QEXN 1QQOA 2FSJA 4BR5A 3BUZB 3GBTA 4B1VA 1HX1A 5H1SQ 3SMPA 4IEIA 4U67L 1TUYA 2BH1A 4RTFD 3T69A 5ELZA 1W97L 4A5BA 4AM6A 5M1NA 4JEPA 3CMEN 3CC7N 1NM1A 4JKAA 3O9UA 1V4SA 2QM1A 1KC8O 3O6WA 3VMFB 1Q7YO 5EOYA 1XUPO 3CQXA 4GNIA 4CJ7A 5M1KA 1LCUA 1W2BM 3O9QA 4O8KA 3A0IX 4WFBL 3DXMA 3NVMA 4H0PA 3G4SN 4MDBA 4F9OA 1NLVA 3DXMB 3P38A 2QI2A 5AQXA 4G9ZA 2ZGZA 1VQ8N 4CZHA 5ADXH 2FF3B 2P9LA 1HLUA 3HI0A 1QZ5A 3ID8A 5KQDA 3ZX3A 4QS8A 3CD6N 1ZC6A 3O4WA 2P9LB 4BY9C 4QS7A 2JWLA 1K9MO 3C6AA 4B1YB 3HOTA 4YDUC 4BRQA 3GL1A 3WUHA 1N8RO 3FLCO 4FWPA 3SBGA 3MWTA 3E1YA 3I8BA 4WF9L 3CCVN 4BC4A 4FPBA 3TSUA 2A42A 5CHIA 4DCHA 4Y0WA 1D4XA 3PIOL 3UB5A 1P8ZA 2PBDA 5C10A 2EWSA 5AQWA 3A5LC 3H1QA 4Z94A 4NLCA 2IIRA 4H5NA 3VESA 4MLEA 3G25A 4J8FA 4YOVA 1ATRA 3CCRN 4DHYA 3RSEB 3O1WA 2NRXA 5AQGA 3G71N 1T6DA 3E9PA 3ZX2A 1YJ9N 2Q1NA 3SLCA 5M1PA 4DQ8A 1YJWN 1RGIA 1GLDG 1BUPA 2HF4A 3VENA 4H0OA 4IFEA 3ZEUA 4YOXA 1VQ7N 2GWKA 4IJNA 3D7EO 1S72N 5JLHA 3ZEUB 1YI2N 1VQON 3AGKA 3R8EA 5JMVA 2ASPA 3GOIA 1QQMA 1JCFA 4YOUA 4BRGA 3HOSA 2OTLN 2WFBA 2YHYA 1JJ2M 5F2RA 4JKDA 3U4LA 3M1FA 4PL8A 4NB4A 5AQIA 4WFNL 3TTDA 4E1JA 5M1FA 3O08A 4NLBA 3K9KA 2NRVA 3AAPA 3UKUA 1NGIA 3O8MA 3CC2N 4O8UA 5BRFA 1GLBG 2Q31A 3DXKA 3M6GA 5BN9A 1S22A 4BRPA 3UKUB 4JKFA 1HKBA 2GWJA 2ASMA 4EFHA 4IXCA 3DXKB 3ENBA 1NBWA 4CZEA 5B8HA 4JKGA 3UE5A 3R1XA 3P4IA 4ILJA 4MO4A 3CCSN 5M1OA 3ZETB 4KH6A 3U9ZA 3CJAA 2Q2RA 2QW9A 4JKGB 5KPZA 4BG9A 1HKGA 3FZMA 2UYTA 4FWLA 4A5AA 4IO9L 3D2EA 4ILHA 1VQNN 1MDUB 4YOWA 2ZJPL 3QBWA 4B1ZA 4H5TA 5AQHA 4CZKA 1G99A 4JN4A 4K42A 4RCHA 2QWLA 2V52B 1R59O 1RDWX 3F9MA 3WXLA 2P9NA 3O1BA 3DLLL 3U8XA 5AQYA 5AQOA 4BRNA 4H5RA 1Q82O 4AF1A 1XQSC 2E8AA 1YVNA 4FSVA 1Z05A 2CH5A 4FWSA 1BA0A 1JCEA 4K43A 3VTHA 1T3VA 2NRZA 1KQSM 2I7PA 5FPNA 1YF5L 4H5VA 4O5FA 1XC3A 4IO8A 2F7TA 1P90A 2ZGYA 1VQMN 3TU5A 4JKBA 4HWIA 5EX5A 2NZTA 1YJNN 3QDKA 3OA9A 4BVOA 3WEEA 2J4RA 1QQNA 1GLCG 2P9PA 4C23A 2AA4A 3KVGA 3CJ7A 1OKJA 3LDQA 3D6RA 3H46O 3WEEB 4EAHD 3E66A 2P9PB 4CI6A 4WQ4A 4BGBA 4I6MA 3MN7A 4CBXA 4B1XB 5HL7L 5C2DA 5DM6L 1K8AO 5AQNA 3VOVA 1DKGD 2HBLA 3K9JA 4JHDA 4HTLA 4JNEA 3QFPA 1ZBSA 1QHAA 1TUUA 2YI1A 3EKSA 1KAZA 4MLHA 3VEOA 1M90O 1BA1A 1C0GA 4JHDB 5AQFA 3VGLA 1RFQA 2CGLA 5KPTA 1X3NA 5GIPA 5GINA 4XH4A 1DEJA 3CJBA 1SS6A 3KWGA 3WT0A 2HF3A 3SMSA 5GADP 1YHQN 4IEEA 3WXMB 3I55N 2HBKA 4JK8A 3SK3A 4PKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P90 A;  1RDU A;  1T3V A;  1EO1 A;  1O13 A;  2YX6 A;  2QTD A;  2RE2 A;  2WFB A;  2KLA A; 
#chains in the Genus database with same CATH topology
 1SKS A;  2HHS A;  4G1Q A;  3NBP A;  2Q0U A;  1J9A A;  3IAY A;  4PY5 A;  1FXX A;  1UOC A;  5AQV A;  3ULE A;  1RBV A;  4FPA A;  3NCI A;  1V4T A;  1TV6 A;  3JYT A;  5HLF A;  5J2P A;  2E2N A;  4A2A A;  1BDG A;  1J53 A;  4JI4 K;  1ZXO A;  3DLK A;  4BRD A;  4V19 S;  4HUE A;  3KZB A;  3SBT A;  3ZYY X;  5FPM A;  5ADX A;  2NRT A;  4J2B A;  1CZA N;  2YHW A;  4IOA L;  4H03 B;  4DTM A;  4DFJ A;  3CCE N;  3LDL A;  2I5J A;  4JI0 K;  3VGK A;  3DOL A;  3CCJ N;  2UU9 K;  1LWE A;  2A6A A;  4CJQ A;  4DS5 A;  3CFO A;  1GOC A;  3DLG A;  4YOT A;  3AA3 A;  1T8E A;  4CHO A;  2ITM A;  4I7F A;  1JLC A;  1J5O A;  2IOC A;  1E4G T;  2GV9 A;  3LDO A;  4FJN A;  4ELV A;  2RHK A;  4A59 A;  3QEP A;  3QEI A;  4Z4F A;  1BWF O;  1IH7 A;  3D0P A;  3QO9 A;  3SUN A;  4GV6 A;  3NMU A;  3VQA A;  3ZX0 A;  3NH1 A;  4I9L A;  3L6Q A;  4Y1C A;  4PQU A;  2ZM6 K;  4FOI A;  3KLF A;  2I7N A;  3V9X A;  3K57 A;  4CJT A;  4AH9 A;  1DTT A;  4LSN A;  3MAQ A;  2BUP A;  4DSL A;  1X9M A;  2BTF A;  2YJF A;  2E2P A;  2HB5 A;  3LM2 A;  3JS6 A;  4K0K K;  1M1K O;  5LY3 A;  1RNH A;  4C1N K;  4BRA A;  4FM1 A;  3AY9 A;  3DYA A;  3LZI A;  5HOO A;  2D0B A;  3RMC A;  3I33 A;  2OPP A;  1JLQ A;  4OKJ A;  4OKK A;  1GLJ O;  3ENO A;  4JKE A;  4JI7 K;  1JXB A;  3BEX A;  4IZ9 A;  3O9S A;  4M63 C;  4DTU A;  3AVI A;  4DU3 A;  2X78 A;  2KW4 A;  3V4I A;  3DLE A;  3HPG A;  3A2F A;  1TKT A;  3KKS A;  3ZSZ A;  3C7N A;  2P51 A;  3AVL A;  3L0Q A;  1DLO A;  3KHY A;  1HPZ A;  3T19 A;  4UY8 O;  1RT1 A;  4NO7 A;  3U3G A;  1GOA A;  1L3V A;  4M7Y A;  4CED A;  3DLR A;  3NF8 A;  4CK1 A;  4QS9 A;  1SV5 A;  2XY6 A;  3U9D A;  2AP1 A;  2ZD1 A;  3CCM N;  2Q97 A;  3L3U A;  3HXM A;  3S3O A;  2P1J A;  5IT9 O;  4BRM A;  3KTQ A;  5AZI A;  4BDP A;  1I39 A;  2FBT A;  3NGZ A;  3G6E N;  3P5J A;  5AZI B;  5K14 A;  2OTJ N;  1YXQ A;  3L8B A;  4RWT A;  1EO1 A;  1U48 A;  4OGE A;  4CZF A;  3V9W A;  3VF4 A;  1CZ9 A;  3LAL A;  3TAR A;  1XNR K;  4DSI A;  2PAV A;  2RPI A;  5HRN A;  1NGC A;  1NGA A;  4CEO A;  3CXC M;  4PKH A;  3HTV A;  3VF2 A;  1MWK A;  2Q3S A;  1U47 A;  5BPM A;  3LP0 A;  5AQZ A;  3RSE A;  1N33 K;  2E20 A;  4NCG A;  4OKE A;  4PWD A;  4OPH A;  4C8L A;  2WC9 A;  1C1A A;  3QIC A;  5BRD A;  1ITG A;  4DQI A;  1C0U A;  2VGM A;  1S1W A;  4BDY A;  4CHZ A;  3AVK A;  2VWJ A;  1WN7 A;  4BC5 A;  4HHT A;  4BR2 A;  3E9L A;  3OYJ A;  3OYC A;  3VET A;  3QBX A;  2D0P A;  1JLG A;  3O4N A;  3NF6 A;  3T1A A;  1NJZ A;  3MX5 A;  4KHN A;  4YOY A;  4PA1 A;  3F73 A;  3M5R A;  5KGW A;  1NJI O;  5FRN A;  2OCE A;  1K8K A;  3SUQ A;  5BPL A;  4CZG A;  4N76 A;  3MN6 A;  1K8K B;  4KBO A;  3O9T A;  3MWP A;  1ESV A;  3VEW A;  4BWJ A;  1JCG A;  3EE9 A;  1IBL K;  4EZ6 A;  4AHR A;  1BG3 A;  2VGN A;  4M3W A;  3DWL A;  3LWL A;  2KTQ A;  4PL7 A;  5FDL A;  4YOR A;  1RDC A;  3BZK A;  3UKR A;  2YX6 A;  2RE2 A;  3PIP L;  3U6F A;  4PHT X;  3UKR B;  1X9W A;  1GLF O;  4BQZ A;  4RG8 A;  4OVL A;  2QK9 A;  5SWM A;  3P31 A;  4KH4 A;  5GAG P;  4JYA K;  1XC9 A;  2KLA A;  4CIG A;  1NNE A;  3NH0 A;  4GV3 A;  1NJX A;  2DFH A;  4Z4I A;  3EO3 A;  3ENH A;  2NNW A;  3BDP A;  4E1N A;  1QQO A;  2FSJ A;  2IC3 A;  3BUZ B;  4B1V A;  3AA5 X;  3NF7 A;  4KKO A;  2BH1 A;  4FK0 A;  5C24 A;  4JEP A;  1S9G A;  1B9D A;  1VSH A;  3T3F A;  1KC8 O;  3ZCM A;  3TR8 A;  3CQX A;  4GNI A;  4CJ7 A;  4EP4 A;  1TKX A;  1JKH A;  4WFB L;  3L3V A;  3DXM A;  2YNH A;  4MDB A;  4F9O A;  3DXM B;  4KB1 A;  1NOZ A;  3I0R A;  2ZGZ A;  3TAP A;  1VQ8 N;  4CZH A;  3ID8 A;  3ZX3 A;  2QXF A;  3VQB A;  3CD6 N;  5LMU K;  4QS7 A;  1HRH A;  2UUA K;  4YDU C;  3WUH A;  4GMJ B;  4WF9 L;  4CES A;  1LWC A;  3TSU A;  4J2E A;  4Y0W A;  1D4X A;  3PIO L;  5CZ1 A;  3UB5 A;  3KK1 A;  3SNN A;  3LPT A;  1TGO A;  1KVC A;  1S5J A;  2E4L A;  4F4K A;  2EHG A;  3KLE A;  3H1Q A;  2IIR A;  4MLE A;  4FJI A;  4DV5 K;  1J54 A;  4NYF A;  1OH7 A;  2FBV A;  4N41 A;  3NE6 A;  1O1W A;  5SZT A;  2HF4 A;  4J2D A;  3ZEU A;  4DR7 K;  2GWK A;  1S72 N;  1YI2 N;  3ZEU B;  2E6L A;  3R8E A;  4CHQ A;  1JCF A;  2YKN A;  3FFI A;  1KVB A;  2OTL N;  4FJJ A;  3JAM O;  2YHY A;  4DQR A;  3U4L A;  4C8N A;  4NB4 A;  3TTD A;  4E1J A;  4DFP A;  4NLB A;  3AV9 A;  3KLI A;  4MQ3 A;  2HHH K;  4O8U A;  3DXK A;  3V6D A;  4JI2 K;  1VSL A;  3DXK B;  3OYH A;  4BWM A;  5C42 A;  2QW9 A;  4BG9 A;  1HKG A;  3FZM A;  2UYT A;  3O4Q A;  4DR2 K;  3D2E A;  4ILH A;  5E41 A;  2FC0 A;  4YOW A;  4DTO A;  2ZJP L;  3HST B;  3VQ4 A;  4K42 A;  2QWL A;  2V52 B;  1YTA A;  4FW1 A;  3U8X A;  4KTQ A;  4B9V A;  4KHS A;  1RTI A;  1TK8 A;  4AF1 A;  1NJW A;  1YVN A;  4FWS A;  4K43 A;  4DV2 K;  3VTH A;  3ZT4 A;  2XY7 A;  3ZSW A;  1VHX A;  5FPN A;  5FRM A;  4H5V A;  1XC3 A;  2ZQB A;  2YHA A;  1KTQ A;  3TU5 A;  4E7L A;  1YVU A;  1HNZ K;  4BVO A;  3QET A;  1NOY A;  4KTW A;  3KVG A;  3D6R A;  2O4I A;  2E5L K;  3MN7 A;  4B1X B;  3KD1 E;  3AO3 A;  5C2D A;  3QNO A;  4Z4G A;  3DRS A;  1K8A O;  1U49 A;  4JHD A;  2YNG A;  3QER A;  3QFP A;  1TUU A;  2YI1 A;  4H4O A;  1VSE A;  5D3G A;  1QQC A;  1BA1 A;  4JHD B;  3VGL A;  2CGL A;  3AO4 A;  1S1T A;  3LAN A;  3VQE A;  1WSH A;  1SS6 A;  1RBS A;  2HF3 A;  4RW7 A;  3SMS A;  1YHQ N;  1BIS A;  4N56 A;  4JD2 A;  3O3H A;  2Z1J A;  3MK6 A;  3KLG A;  2WUS A;  5C15 A;  4JD2 B;  4JK7 A;  3S41 A;  5HRS A;  3THY A;  1T05 A;  4CJE A;  5BN8 A;  3SUO A;  3C95 A;  2O8D A;  4DS4 A;  3IG1 A;  4YDU A;  1E3M A;  4YY3 K;  1X1P A;  3NH2 A;  1U2V A;  2GTD A;  1UA0 A;  4FWN A;  3OHR A;  1ZBL A;  3GG4 A;  1U2V B;  5E84 A;  5KRS A;  4XH5 A;  4JLH A;  2WBN A;  4YNQ A;  3H45 C;  2UXB K;  4RW4 A;  3IUC A;  2UUB K;  1NK4 A;  2OPR A;  4Z4H A;  4W5O A;  3SQ0 A;  1UA1 A;  3AVA A;  2WTU A;  1WB9 A;  3EY1 A;  3H08 A;  2JWK A;  1C6V A;  3JSM A;  4QOZ B;  3CET A;  4KHY A;  2IVP A;  3WXK A;  4BAC A;  4ILG B;  5C25 A;  5KQ8 A;  2W42 A;  2QWQ A;  4HCB A;  1NK0 A;  4H0V B;  2VQE K;  4H5W A;  3CPW M;  5LMN K;  2YNF A;  2IDO A;  4FWM A;  4CD3 A;  3R9P A;  2F9T A;  4FVU A;  1Z6R A;  4CZJ A;  3VEY A;  4OO1 J;  2QWP A;  4DMN A;  3B6P A;  4IOC L;  4DFM A;  3N4Q A;  3P1G A;  4BG8 A;  4BE2 A;  1YUW A;  4B1W B;  3ZSY A;  4LF8 K;  4K25 A;  3FR0 A;  1NKB A;  3R3L A;  4IDH A;  5MLC Q;  4FJG A;  4FWK A;  5KPR A;  5LJW A;  3RRG A;  1S3X A;  1BL3 A;  2GX9 A;  3OS1 A;  2LSN A;  3N4P A;  5C12 A;  4OPA A;  5BRE A;  2ASO A;  3ZT2 A;  5AQS A;  2QWO A;  1X9S A;  3EZW A;  4UQG A;  4DG1 A;  3DOK A;  3RR8 A;  1C0F A;  3CFP A;  1Q18 A;  4DR6 K;  3QFU A;  4Y1D A;  2D5R A;  5F1X A;  1L3U A;  1KFD A;  3RRH A;  5AQK A;  4E19 A;  3SAF A;  4CFD A;  1NK9 A;  3CM6 A;  3VTI A;  2VWB A;  1RT6 A;  1VQ4 N;  3FZK A;  4AHT A;  3CCU N;  2Q36 A;  3PSI A;  1VRU A;  1XNQ K;  4ISF A;  3VGM A;  1O13 A;  3T1Y K;  2HOE A;  2KKZ A;  4I6M B;  3S9H A;  3A5N C;  4RW8 A;  1TKZ A;  2VCP A;  4DB3 A;  3L2U A;  2UUC K;  3M8P A;  4I2Q A;  3R6M A;  3Q7B A;  3OYN A;  3OTO K;  3NVK A;  3K5L A;  3TI0 A;  3OYK A;  3RVC A;  3K0S A;  1SKW A;  1ATN A;  5AR0 A;  3MN5 A;  1OH8 A;  4BGA A;  4ID5 A;  3AVC A;  3IKM A;  4CZM A;  1U4B A;  1BGX T;  3OYD A;  3DLH A;  4Q0B A;  3BF3 A;  2QWM A;  3QB0 A;  4CGI A;  4KI6 A;  1CLQ A;  1IKY A;  4BVP A;  3ULE B;  1BU6 O;  1QSY A;  1X3M A;  4CF2 A;  3CG7 A;  4A2B A;  2QTD A;  1SL0 A;  1G15 A;  4CZL A;  1NG9 A;  2FXU A;  3O3F A;  3HRG A;  1FW6 A;  5EY4 A;  1RTH A;  5HBM A;  5AJ3 K;  2A1S A;  3V9U A;  1NK6 A;  1C1B A;  3QML A;  3CYM A;  5AQP A;  4W5T A;  3A5M C;  2O8E A;  3VEV A;  3FGU A;  4KH5 A;  4H0X B;  5J2N A;  1VSI A;  1DGK N;  2O8E B;  4ISE A;  4E89 A;  1WSJ A;  3ZT1 A;  4DTX A;  5J1E A;  4BR9 A;  3U3Y A;  4Z0U A;  2Q0R A;  1QTM A;  1UAX A;  5JS1 A;  1EWR A;  3PX6 A;  4CEB A;  1VQ6 N;  2JLE A;  4A62 A;  3OBY A;  4GVE A;  4BRH A;  3B6O A;  2HW3 A;  3F2K A;  1NGJ A;  1X9J A;  1ASV A;  2F4V K;  1WSI A;  1B92 A;  3CIP A;  3W3D A;  4BC3 A;  1XWL A;  4JKC A;  2P9I A;  3EYZ A;  2DFF A;  3PV8 A;  2DFE A;  4X64 K;  3C0B A;  3CQY A;  1RDB A;  3TAG A;  2P9I B;  3DI6 A;  3SPY A;  4H0T B;  5BR8 K;  4AM7 A;  2IVN A;  3OJU A;  2QXL A;  4DTJ A;  4GY2 B;  4FCY A;  1WAF A;  1MU2 A;  5AQT A;  3ZSV A;  5JLF A;  4B9U A;  4IFV A;  3O5B A;  4C8K A;  2IS3 A;  5EVZ A;  5LL6 Z;  5HP1 A;  2YHX A;  4CJ5 A;  3KK3 A;  3Q7C A;  2NRR A;  1T03 A;  1D9D A;  4B3O A;  1J6Z A;  2W6L A;  1QSS A;  3SYZ A;  2P5G A;  1T6C A;  1BOT O;  1U04 A;  4KAZ A;  4FK4 A;  1FK9 A;  3TSQ A;  2HHQ A;  3VEZ A;  1RT2 A;  3H6E A;  2ZE2 A;  3RR7 A;  3JXU A;  3CFR A;  3L4Q A;  2OAN A;  4DSK A;  4FLZ A;  2D1K A;  1S1U A;  4CBU A;  4LFC K;  3VER A;  3CMA N;  4FJL A;  2VG7 A;  3T7Z A;  1XHX A;  3K59 A;  4DR1 K;  1NGB A;  4TSX A;  1RT3 A;  1GLE G;  3C7N B;  4JAX A;  2QEX N;  5A2Q O;  3GBT A;  4CW7 B;  5H1S Q;  1UWB A;  4IEI A;  3BY5 A;  1TUY A;  4RTF D;  4A5B A;  1RCH A;  5M1N A;  4B3M K;  1U45 A;  5IWA K;  1NK5 A;  4LFA K;  3O9U A;  4FZY A;  3O6W A;  5EOY A;  2KZZ A;  1LCU A;  3HJF A;  4LY7 A;  3A0I X;  4HTU A;  3THX A;  2HHT A;  2YKM A;  4ICL A;  1IO2 A;  4CEE A;  3V1Q A;  1A5V A;  4LFB K;  4B9N A;  5J2M A;  3HI0 A;  4KHW A;  3RMB A;  4QS8 A;  4I9Q A;  1ZC6 A;  4BY9 C;  3OJS A;  3SQ4 A;  3C6A A;  1NK7 A;  1VSJ A;  3ZSR A;  3HPO A;  4DV4 K;  1YT3 A;  1N8R O;  4DSF A;  3ITH A;  3NGY A;  3FLC O;  3SBG A;  3E1Y A;  3I8B A;  4OJR A;  4BC4 A;  1JL1 A;  4FPB A;  4BE1 A;  1KVA A;  2EWS A;  5AQW A;  2G8W A;  5JS2 A;  1REV A;  4H5N A;  1NKE A;  1ATR A;  3RSE B;  4N5S A;  3O1W A;  2NRX A;  3SPZ A;  5AQG A;  1T6D A;  1YJ9 N;  2Q1N A;  4DQ8 A;  4Z4C A;  1GLD G;  3LAM A;  4L8R B;  4H0O A;  4YOX A;  1VQ7 N;  3O3G A;  4KRF A;  3D7E O;  5JLH A;  1VQO N;  1LW2 A;  4DU4 A;  2ASP A;  1QQM A;  1S9E A;  4YOU A;  4BRG A;  4OX9 K;  2WFB A;  4FLW A;  5F2R A;  2HVH A;  3MXI A;  1EXQ A;  4M3T A;  2NRV A;  1BQN A;  3AAP A;  2OYQ A;  5BRF A;  2Q31 A;  4CF9 A;  3WNH A;  4KTZ A;  1KLN A;  4Z4E A;  4CZE A;  5B8H A;  4DWI A;  3CCS N;  3P4I A;  4MO4 A;  4LH4 A;  1IKW A;  4KH6 A;  3U9Z A;  4HCC A;  3MXM A;  5I42 A;  4IO9 L;  4CEF A;  4CGD A;  3QBW A;  4B1Z A;  5AQH A;  2O8B A;  1KLM A;  4RCH A;  1ZBF A;  1R59 O;  2P9N A;  2O8B B;  1CZB A;  1ZBU A;  4CF1 A;  1A5X A;  1Z25 A;  1XMO K;  5AQY A;  5AQO A;  4BRN A;  3NAE A;  5CYM A;  3S3N A;  4FYD A;  1Z05 A;  3OYE A;  1BA0 A;  4KO0 A;  2OZM A;  4E3S A;  1T3V A;  2NRZ A;  4DU1 A;  1KQS M;  4FZX C;  2I7P A;  4O5F A;  2F7T A;  1VQM N;  4OPJ A;  4JKB A;  5EX5 A;  2NZT A;  4YFU A;  3QDK A;  4DV6 K;  1HNI A;  2J4R A;  4IBN A;  2Z1I A;  3AA2 A;  1GLC G;  2P9P A;  1HYS A;  3UIQ A;  3CJ7 A;  2XY5 A;  4JI6 K;  3H46 O;  3L2R A;  2P9P B;  4CI6 A;  1TK0 A;  4BGB A;  3MXJ A;  1ZBH A;  4CJW A;  2IGI A;  4CCH A;  4FXD A;  3AVH A;  4ELU A;  3VOV A;  1KFS A;  3K9J A;  4FJK A;  3EKS A;  1KAZ A;  1C0G A;  5KPT A;  5AQF A;  4DTS A;  3AO2 A;  1X3N A;  4CE9 A;  3WNG A;  3V9S A;  2HNY A;  5GAD P;  4IG0 A;  4IEE A;  3I55 N;  2HBK A;  3HT3 A;  3SK3 A;  1VK0 A;  3T1H K;  3IRX A;  4KFB A;  2Y1J A;  4BDZ A;  3EEQ A;  3FZL A;  5FPD A;  4AHV A;  2NRH A;  2F9W A;  2YV0 X;  1D8Y A;  4CZI A;  2FF6 A;  1Q81 O;  3IMX A;  4FWR A;  4FO0 A;  4CHY A;  5AFU H;  1RBT A;  1N34 K;  2PFU A;  4H0Y B;  5GAE P;  5C0Y A;  1EET A;  2DPN A;  3O80 A;  4CHN A;  4IOX A;  3GE1 A;  3P39 A;  4CJF A;  2GEM A;  2V7Z A;  2D0A A;  1TYQ A;  2B4J A;  2HND A;  5BPN A;  1WBD A;  1WLJ A;  1T44 A;  4FWQ A;  1TYQ B;  2O4G A;  3TPQ A;  4EHT A;  1BCO A;  2NRW A;  4FL9 A;  3J8A A;  3DAW A;  4DQS A;  2V7Y A;  3CPE A;  4B08 A;  1CXU A;  1HNW K;  4CGH A;  3F5T A;  3MEG A;  4EHU A;  5E26 A;  3TAM A;  3OYB A;  3VQD A;  4NXM K;  4O0I A;  2BAN A;  4M3R A;  3V1R A;  3HP9 A;  2P9K A;  3OYA A;  4IWV A;  5AQU A;  4CJU A;  4K8Z A;  1EX4 A;  3MEC A;  4JRQ A;  4BR7 A;  2P9K B;  5JIC A;  1YAG A;  3NHG A;  3WXI A;  3B8A X;  3IDH A;  1W7A A;  2W41 A;  1WSF A;  4AQY K;  3I8D A;  3OVN A;  3HYF A;  3LP2 A;  4FLT A;  1CXQ A;  4JI1 K;  4E7I A;  3FZF A;  4A57 A;  3OBW A;  2ZJQ L;  3QEV A;  4O5B A;  3K5N A;  2HBM A;  3D2E B;  1LOT B;  3CI5 A;  3LL3 A;  1B9F A;  4DUZ K;  3TTF A;  2E1Y A;  1NGD A;  5I3U A;  3M3Z A;  1A5W A;  2YJE A;  5BR9 A;  1HNV A;  4FM0 A;  1VQP N;  3IFR A;  2IVO A;  2QWN A;  5FPE A;  5JVG L;  3HSC A;  3V1O A;  4M3Z A;  4K41 A;  1EQY A;  3AO5 A;  1HJO A;  4CER A;  3AGR A;  4DKW A;  3BGR A;  4FLU A;  4JV5 K;  1Y64 A;  2E88 A;  4CEC A;  1QHT A;  3C6H A;  1WNS A;  5TKY A;  3OYI A;  4W5R A;  4QCL A;  3KK7 A;  3RWU A;  3CM5 A;  3LDP A;  4FLX A;  3OYG A;  3SCX A;  1HPM A;  3H3O B;  3CCL N;  2B6A A;  1HKC A;  3A8Y A;  4RW6 A;  1BIZ A;  1DT9 A;  3VEX A;  4BR4 A;  1HQU A;  2P9S A;  1GOB A;  3MX2 A;  1OH6 A;  5EU7 A;  2GUI A;  2KFZ A;  3OYF A;  2P9S B;  5C2F A;  1HNX K;  4B9T A;  2DY4 A;  3EZ5 A;  2X74 A;  3MDQ A;  5HRO A;  3THY B;  1IJJ A;  3E9O A;  3VA3 A;  2O8D B;  3HO1 A;  2E2Q A;  2ZF5 O;  1N36 K;  2ATQ A;  3NF9 A;  3AAR A;  4XEI A;  4FJ5 A;  1U6Z A;  3CF5 L;  3MCA B;  1BHL A;  3WQT A;  5AQJ A;  4GKK K;  3J7Z O;  3VN5 A;  1IG9 A;  1IBM K;  1YIJ N;  4WFA L;  3WNE A;  3ID6 A;  4BRL A;  3MEE A;  4ISG A;  3KJV A;  4RW9 A;  1KCF A;  2G8F A;  5AFU A;  3SV4 A;  4X66 K;  3DJC A;  3EKU A;  1RT4 A;  3MED A;  1K73 O;  2RKI A;  2GEL A;  2HNZ A;  4OPK A;  3HK2 A;  4AIL C;  3TAB A;  2GUP A;  4CIF A;  3PX4 A;  4CJL A;  3ZT3 A;  4DTR A;  2AJQ A;  3EN9 A;  3L4I A;  5I9E B;  5GIO A;  2UXC K;  2A41 A;  3AVN A;  4CHP A;  5FRO A;  1DTQ A;  1NGE A;  2A5X A;  1JLB A;  3ATU A;  3VQ6 A;  3AVB A;  5AZJ A;  3AVJ A;  4XH1 A;  5AZJ B;  4MDA A;  1WUA A;  5AQQ A;  3PO5 A;  4NXN K;  3SJH A;  4ZHR A;  3ZET A;  1WBB A;  1XHZ A;  3SI6 A;  1K6Y A;  2P9U A;  4DQQ A;  4FLY A;  1TVR A;  2P9U B;  1LAW A;  4CJV A;  4BQL A;  2VYP A;  3QES A;  4F2R A;  1HYZ A;  2G8U A;  1SZ2 A;  5EXW A;  3ZSQ A;  1VQL N;  3THV A;  4O55 A;  3ATV A;  2ZWH A;  4LF9 K;  2A40 A;  1KD1 O;  4CD1 A;  4FW2 A;  4R79 A;  5GAH P;  1Q86 O;  3PUF A;  1RT5 A;  3TAQ A;  3D2F A;  4CBW A;  4B3T K;  1GLL O;  3GDQ A;  3CER A;  3C65 A;  5AQR A;  4DSJ A;  2A1R A;  5T7B A;  4WQ4 C;  3D2F B;  1NWK A;  4DF8 A;  4CGG A;  1QE1 A;  3OYL A;  4BR5 A;  3SMP A;  2Z1H A;  4ZTF A;  5ELZ A;  1W97 L;  3VQ5 A;  4CEA A;  3D45 A;  1NM1 A;  2YNI A;  4JKA A;  1QS4 A;  1V4S A;  3VMF B;  1Q7Y O;  1XUP O;  4I2P A;  4O8K A;  2G8V A;  3TAN A;  3NVM A;  1NKC A;  4MFB A;  3P38 A;  2QI2 A;  4CFA A;  3J81 O;  4OLB A;  4O0J A;  4E0D A;  2FF3 B;  2P9L A;  1QZ5 A;  2E6M A;  1BCM A;  2BDP A;  4LF6 K;  3ZT0 A;  2P9L B;  2HHX A;  2JWL A;  4B1Y B;  3HOT A;  1TL1 A;  4BRQ A;  4FWP A;  3MWT A;  3QIN A;  3CCV N;  4XIU A;  4KRE A;  1I3A A;  2A42 A;  1OH5 A;  4DCH A;  1LW0 A;  5CYQ A;  1P8Z A;  1S6P A;  2PBD A;  5C10 A;  1SUQ A;  3A5L C;  1HMV A;  2O8C A;  4NLC A;  3VES A;  2O8C B;  3LPU A;  2F96 A;  3CCR N;  4DHY A;  3DRP A;  3LAK A;  4W5N A;  2F8T A;  3G71 N;  4QAG A;  3E9P A;  1YJW N;  3KK2 A;  3RMA A;  3VEN A;  1RTJ A;  4IJN A;  4DV1 K;  4J2A A;  3AGK A;  3VQP A;  4CJ4 A;  3GOI A;  1ZBI A;  3I0S A;  1JJ2 M;  4JKD A;  1Q9Y A;  4PL8 A;  5AQI A;  4WFN L;  4FJ9 A;  1Y97 A;  1RT7 A;  5M1F A;  3O08 A;  4CFB A;  3NDK A;  4HUG A;  3UKU A;  1GLB G;  1RDD A;  5BN9 A;  4BRP A;  3UKU B;  2GWJ A;  4EFH A;  4IXC A;  4FM2 A;  3ENB A;  1NBW A;  4JKG A;  3R1X A;  1HR0 K;  3VQQ A;  5M1O A;  4DV3 K;  2Q2R A;  4JKG B;  5KPZ A;  1BQM A;  4FWL A;  4A5A A;  1HYV A;  3OS2 A;  1NK8 A;  4Q5V A;  1VQN N;  1MDU B;  3QIP A;  4H5T A;  3TAF A;  4C8O A;  2G8I A;  1VRT A;  4B3R K;  3F9M A;  3WXL A;  3ULD A;  3BZC A;  2QKB A;  3HP6 A;  1Q82 O;  4HUF A;  5KRT A;  4FSV A;  4CJ3 A;  1ZYQ A;  4CFC A;  4E1M A;  1YF5 L;  4IO8 A;  2ZGY A;  2X6N A;  4CJP A;  4HVJ A;  3LWM A;  1RBU A;  1EP4 A;  3WEE A;  1QQN A;  3AVM A;  4C23 A;  2AA4 A;  3LDQ A;  1OKJ A;  3WEE B;  4EAH D;  3G10 A;  2HHV A;  2VQF K;  4WQ4 A;  4CBX A;  5HL7 L;  5KTQ A;  4DLE A;  1VSD A;  1IKV A;  5AQN A;  1DKG D;  2HBL A;  2GBZ A;  4HTL A;  3QEX A;  3VEO A;  4FZZ A;  1M90 O;  1HJR A;  2HVI A;  4KV8 A;  4JI3 K;  5GIP A;  3THX B;  1D9F A;  2OZS A;  4DV0 K;  1IBK K;  4B9M A;  3NFA A;  2IAJ A;  4PKG A;  1NMD A;  4CIE A;  2RF2 A;  4K8X A;  4LSL A;  3CJC A;  1QVF M;  1JL2 A;  5DK5 A;  4JK9 A;  2HMP A;  5DM7 L;  5CE3 A;  3SUP A;  4FOE A;  4WQ5 C;  4WCE L;  4M3X A;  3ASM A;  3S3M A;  4CJR A;  4BR0 A;  1S6Q A;  4E7H A;  1C0T A;  2QWR A;  3SZ2 A;  1VQ5 N;  3VQ9 A;  2FSN A;  5CR4 A;  1ASW A;  1SQK A;  3J7A P;  4LF4 K;  4FJX A;  2PYL A;  2H3G X;  4U7B A;  5F0X A;  3HBT A;  4B1U B;  1N6Q A;  1LWF A;  5AQL A;  2WOM A;  5LJV A;  3LDN A;  3M8R A;  4BRK A;  2HST A;  3H1V X;  3HPH A;  2CGK A;  1NU0 A;  4BC2 A;  1VQ9 N;  4W5Q A;  2KHO A;  1LV5 A;  4H4M A;  2G8K A;  4M3Y A;  2W40 A;  2B5J A;  4DR3 K;  2DTU A;  4GVM A;  1TK5 A;  2FBX A;  2Y1I A;  3P83 D;  3SQ2 A;  1W9H A;  3W0L A;  3SJJ A;  3PSF A;  3V81 A;  3AA4 A;  4GKJ K;  1WOQ A;  3CJ9 A;  1VSM A;  1ILY A;  3H3N O;  3L2V A;  4DTP A;  2YHB A;  3HVT A;  5CY4 A;  4M41 A;  2VG6 A;  1IG8 A;  5M1Q A;  5JVH L;  4X65 K;  1XMQ K;  3KKR A;  3FE1 A;  1VAZ A;  3BP8 A;  3NGI A;  2V51 B;  3QNN A;  1I94 K;  1S1V A;  4AHU A;  3HVR A;  3OY9 A;  4LF7 K;  5TKW A;  1L3S A;  1MA9 B;  2P9N B;  3MCP A;  3WNF A;  1FKP A;  2QA4 N;  1RTD A;  2ITG A;  2HBJ A;  4KB0 A;  3MN9 A;  1VQK N;  4BRC A;  4BRE A;  4DQP A;  2W6K A;  3L2W A;  3ALY A;  1E4F T;  4BRO A;  2HHW A;  3O9R A;  2YCH A;  4IDK A;  3CC4 N;  3C6T A;  2XHB A;  1EKE A;  1OVY A;  4LC9 B;  4H8K A;  1HUX A;  2QKK A;  4JRP A;  3I56 N;  3G0Z A;  4DUY K;  4B8A B;  3K2P A;  4C8M A;  4CK2 A;  4PKI A;  2PYJ A;  4F3O A;  3EL2 A;  3CJ1 A;  4OLA A;  4MO5 A;  4DR4 K;  3J80 O;  2VWK A;  5BRH A;  1MWM A;  4OGC A;  1TL3 A;  3EE8 A;  4FJ8 A;  3AAQ A;  3ZLJ A;  2HHU A;  4DV7 K;  2BGG A;  2OA8 A;  3OYM A;  3TWH A;  1ASU A;  3A5O C;  2KFN A;  5DMR A;  1QSL A;  2Z1G A;  4B9S A;  4CK3 A;  4F3T A;  3SAG A;  3M8S A;  1ATS A;  4GW6 A;  1BI4 A;  3SAH A;  3KLH A;  1KSP A;  3HZ6 A;  4FJH A;  2ETJ A;  1BI4 B;  3MMV A;  4JI8 K;  3WQU A;  4BRF A;  4CF0 A;  4WQ5 A;  3OW2 M;  4ID1 A;  4KHQ A;  1NGG A;  2BE2 A;  3DMJ A;  2VG5 A;  3PLA A;  2D4W A;  4DR5 K;  3BF1 A;  1RDU A;  2E2O A;  2CGJ A;  1QVG M;  1NGF A;  4F2S A;  4GV9 A;  2JGU A;  3VPZ A;  2F8S A;  4FJ7 A;  5KGX A;  2ZJR L;  3LM9 A;  4L3Q A;  4M7X A;  4CF8 A;  4M45 A;  4CEZ A;  2NLX A;  3K5O A;  1KAX A;  2A3Z A;  3DM2 A;  4JKH A;  4EZ9 A;  1NGH A;  3ZSX A;  3LDS A;  1SAZ A;  4DF4 A;  4R5P A;  1W0H A;  3C6U A;  4IJA A;  3TSP A;  4IFY A;  2O8F A;  3SQ1 A;  4KHU A;  3KWI A;  1J5E K;  3AO1 A;  3PO4 A;  1KAY A;  1YJN N;  1BO5 O;  4A61 A;  4NCA A;  3AVG A;  4LH5 A;  2O8F B;  3KIO A;  2CH6 A;  3TTC A;  1S1X A;  3FFK B;  2OPQ A;  3CHW A;  3VF6 A;  4B8C A;  4PUO A;  1NJY A;  2NUB A;  1JLE A;  3CCQ N;  2R7Y A;  1XI1 A;  3FZH A;  5AQM A;  1H1V A;  4BRI A;  4DLG A;  1JXE A;  1VSF A;  2D0O A;  1JLF A;  3TAE A;  3WXJ A;  1YIT N;  1GLA G;  4O4G A;  3KD5 E;  4FWO A;  1RDA A;  1Z26 A;  1OVQ A;  2FLO A;  3J7Y P;  4JS4 A;  3LZJ A;  4EIA A;  1QZ6 A;  2XO7 A;  3ZSO A;  3M8Q A;  4E7K A;  1L3T A;  4C1N I;  3PY8 A;  5HRP A;  4KHP K;  4F8R A;  2KQ2 A;  2E1Z A;  3ISN C;  4B9Q A;  1VSK A;  4B9L A;  3DRR A;  1SKR A;  3VQ8 A;  4WYB A;  1KXP A;  4EP5 A;  4BE0 A;  3K5M A;  3QLH A;  3HM8 A;  1IKX A;  2FSK A;  1FKO A;  3AVF A;  4CGJ A;  2UXD K;  1C1C A;  1HX1 A;  2KZM A;  3HL8 A;  4U67 L;  1D5A A;  3T69 A;  3CME N;  4AM6 A;  1RIL A;  3CC7 N;  1SL2 A;  2D0C A;  2QM1 A;  2WON A;  4IG3 A;  5M1K A;  1W2B M;  1FJG K;  3O9Q A;  1F21 A;  2G8H A;  1N5Y A;  4H0P A;  3G4S N;  4FLV A;  4NCB A;  1NLV A;  1Q9X A;  5AQX A;  4G9Z A;  1TKD A;  1YTU A;  5ADX H;  1HLU A;  5KQD A;  1WAJ A;  3SV3 A;  3O4W A;  3IS9 A;  3VA0 A;  2HMI A;  1K9M O;  1KRP A;  3QEW A;  3QIO A;  5CZ2 A;  3GL1 A;  1BIU A;  4B3S K;  4KI4 A;  1TAU A;  2RN2 A;  4ZTJ A;  3PX0 A;  5CHI A;  3OS0 A;  2PZS A;  5KI6 A;  2PY5 A;  4DTN A;  3C94 A;  4N47 A;  3CQ8 A;  4NYN A;  4Z94 A;  3G25 A;  4J8F A;  4YOV A;  4FK2 A;  2XY8 A;  4M42 A;  4CJK A;  3ZX2 A;  4CGF A;  3SLC A;  5M1P A;  5HRR A;  4YHH K;  4JI5 K;  1C0M A;  1RGI A;  4AHC A;  2FBY A;  3F9K A;  1BUP A;  1T7P A;  1IV0 A;  4IFE A;  1WSE A;  1HQE A;  1LAV A;  5JMV A;  3HOS A;  4DFK A;  2OPS A;  5J2Q A;  3THW A;  3M1F A;  4M3U A;  3THW B;  1EWQ A;  3K9K A;  1NGI A;  3O8M A;  3CC2 N;  1TAQ A;  3M6G A;  1S22 A;  4O44 A;  4JKF A;  1HKB A;  3RMD A;  2ASM A;  4E7J A;  3UE5 A;  3HM9 A;  1RBR A;  4ILJ A;  3V9Z A;  3ZET B;  3VQC A;  3CJA A;  4CVN E;  4LF5 K;  1N32 K;  1NMN A;  1Q8I A;  4CJS A;  4CZK A;  1G99 A;  4JN4 A;  1L5U A;  1RDW X;  2X6S A;  3O1B A;  3DLL L;  1WSG A;  4H5R A;  3LP3 A;  1XQS C;  2XRI A;  2E8A A;  2CH5 A;  1JCE A;  2P5O A;  4KPY A;  4WE1 A;  5FLX O;  1JLA A;  3E01 A;  1P90 A;  4FJM A;  4HWI A;  4IKF A;  2EX3 A;  3OA9 A;  3LP1 A;  3L2Q A;  4ELT A;  4X62 K;  3E66 A;  4I6M A;  3RTV A;  5DM6 L;  1SL1 A;  3DLB A;  4JNE A;  4MLH A;  1ZBS A;  1QHA A;  1RFQ A;  3K58 A;  5GIN A;  4LD0 A;  4FVM A;  4XH4 A;  1DEJ A;  4JS5 A;  3VQ7 A;  3CJB A;  3KWG A;  3WT0 A;  3WXM B;  4AHS A;  4JK8 A;  1R0A A;  4CEQ A;  4DSE A; 
#chains in the Genus database with same CATH homology
 1NMD A;  4JD2 A;  2Q0U A;  3MK6 A;  3FZL A;  5FPD A;  5AQV A;  2NRH A;  2F9W A;  2WUS A;  3CJC A;  4FPA A;  4JD2 B;  4JK7 A;  1V4T A;  3S41 A;  3ULE A;  5C15 A;  1QVF M;  4JK9 A;  2HMP A;  5BN8 A;  5DM7 L;  2E2N A;  2FF6 A;  4CZI A;  4FOE A;  5CE3 A;  4A2A A;  3IMX A;  1Q81 O;  4WQ5 C;  4WCE L;  1BDG A;  4FWR A;  4FO0 A;  1ZXO A;  4YDU A;  4BRD A;  5AFU H;  4BR0 A;  3KZB A;  3SBT A;  2PFU A;  2QWR A;  4H0Y B;  5FPM A;  3ZYY X;  5GAE P;  1U2V A;  2GTD A;  2DPN A;  2NRT A;  5ADX A;  1VQ5 N;  5C0Y A;  1CZA N;  2FSN A;  2YHW A;  3O80 A;  4FWN A;  5CR4 A;  4IOX A;  3OHR A;  4IOA L;  3GE1 A;  1SQK A;  3GG4 A;  3P39 A;  1U2V B;  5E84 A;  2GEM A;  4XH5 A;  2V7Z A;  4H03 B;  3CCE N;  1TYQ A;  2WBN A;  3LDL A;  2H3G X;  3H45 C;  5BPN A;  4U7B A;  5F0X A;  3HBT A;  1T44 A;  4FWQ A;  4B1U B;  3VGK A;  1TYQ B;  3IUC A;  3CCJ N;  3TPQ A;  4EHT A;  5AQL A;  5LJV A;  3LDN A;  4BRK A;  2HST A;  2NRW A;  3H1V X;  4FL9 A;  2A6A A;  2CGK A;  3J8A A;  4BC2 A;  2JWK A;  1VQ9 N;  3DAW A;  2KHO A;  2V7Y A;  3CPE A;  4YOT A;  3F5T A;  3CET A;  4EHU A;  5E26 A;  2IVP A;  3WXK A;  2ITM A;  2W40 A;  4ILG B;  5KQ8 A;  2QWQ A;  1E4G T;  2P9K A;  3LDO A;  4H0V B;  4H5W A;  4IWV A;  5AQU A;  3CPW M;  4FWM A;  4BR7 A;  3R9P A;  4CD3 A;  2P9K B;  3W0L A;  2F9T A;  2RHK A;  4A59 A;  4FVU A;  1Z6R A;  4CZJ A;  3VEY A;  1BWF O;  1WOQ A;  2QWP A;  4OO1 J;  5JIC A;  3CJ9 A;  1ILY A;  4IOC L;  1YAG A;  3WXI A;  3H3N O;  4GV6 A;  3B8A X;  3IDH A;  3N4Q A;  4BG8 A;  1YUW A;  3NMU A;  4B1W B;  3ZX0 A;  2W41 A;  3L6Q A;  4K25 A;  3FR0 A;  1IG8 A;  4FOI A;  3R3L A;  5M1Q A;  5JVH L;  2I7N A;  3FZF A;  3FE1 A;  4IDH A;  1VAZ A;  3OBW A;  4A57 A;  5MLC Q;  3BP8 A;  2ZJQ L;  4FWK A;  5KPR A;  5LJW A;  1S3X A;  2V51 B;  2BUP A;  2HBM A;  1LOT B;  2GX9 A;  3CI5 A;  3D2E B;  3LL3 A;  3N4P A;  5C12 A;  4OPA A;  5BRE A;  2BTF A;  2ASO A;  5AQS A;  2QWO A;  5TKW A;  3TTF A;  2E1Y A;  3EZW A;  1MA9 B;  1NGD A;  2YJF A;  3M3Z A;  2P9N B;  2YJE A;  3MCP A;  5BR9 A;  1C0F A;  2E2P A;  3LM2 A;  1VQP N;  3IFR A;  1Q18 A;  2QA4 N;  2IVO A;  3QFU A;  3JS6 A;  2QWN A;  5FPE A;  5JVG L;  3HSC A;  5LY3 A;  5F1X A;  1M1K O;  4C1N K;  2HBJ A;  4BRA A;  3MN9 A;  3AY9 A;  4K41 A;  1VQK N;  5AQK A;  4BRC A;  5HOO A;  4BRE A;  1EQY A;  3SAF A;  1HJO A;  1E4F T;  4BRO A;  3AGR A;  3I33 A;  3VTI A;  3O9R A;  2VWB A;  2YCH A;  3CC4 N;  1VQ4 N;  4DKW A;  1GLJ O;  3FZK A;  1OVY A;  4LC9 B;  3CCU N;  1HUX A;  2Q36 A;  3ENO A;  2E88 A;  1Y64 A;  4JKE A;  4ISF A;  3BEX A;  3VGM A;  4IZ9 A;  1O13 A;  3I56 N;  3C6H A;  3O9S A;  5TKY A;  2HOE A;  4M63 C;  2KKZ A;  4PKI A;  3KK7 A;  3LDP A;  3EL2 A;  3CJ1 A;  4I6M B;  3A5N C;  3C7N A;  2VCP A;  4DB3 A;  3L0Q A;  4MO5 A;  3KHY A;  3R6M A;  1HPM A;  3Q7B A;  3H3O B;  5BRH A;  3NVK A;  3CCL N;  3RVC A;  4UY8 O;  1HKC A;  1MWM A;  4NO7 A;  3A8Y A;  1ATN A;  3EE8 A;  5AR0 A;  3MN5 A;  3AAQ A;  1DT9 A;  4M7Y A;  4BGA A;  3VEX A;  3IKM A;  4CZM A;  4QS9 A;  4BR4 A;  2P9S A;  3U9D A;  2AP1 A;  3CCM N;  2Q97 A;  3MX2 A;  4BRM A;  3BF3 A;  2QWM A;  3QB0 A;  5AZI A;  2P9S B;  3A5O C;  5C2F A;  4BVP A;  3G6E N;  5AZI B;  3MDQ A;  1BU6 O;  1YXQ A;  3ULE B;  2OTJ N;  1IJJ A;  1X3M A;  3E9O A;  3SAG A;  4A2B A;  4RWT A;  1EO1 A;  1ATS A;  2QTD A;  3SAH A;  2E2Q A;  2ZF5 O;  4CZF A;  3VF4 A;  4CZL A;  3HZ6 A;  2FXU A;  3HRG A;  3AAR A;  3MMV A;  4XEI A;  3WQU A;  4BRF A;  1U6Z A;  5EY4 A;  3CF5 L;  3MCA B;  3WQT A;  4WQ5 A;  5AQJ A;  3OW2 M;  2PAV A;  3J7Z O;  3QML A;  1NGC A;  1NGG A;  5AQP A;  1NGA A;  3A5M C;  3VEV A;  4PKH A;  3CXC M;  3FGU A;  3PLA A;  2D4W A;  1YIJ N;  4KH5 A;  4H0X B;  3HTV A;  3BF1 A;  1RDU A;  3VF2 A;  4WFA L;  1DGK N;  3ID6 A;  4BRL A;  4ISG A;  4ISE A;  2E2O A;  1MWK A;  2CGJ A;  1QVG M;  1NGF A;  4BR9 A;  2Q0R A;  4GV9 A;  3VPZ A;  5BPM A;  5AQZ A;  5AFU A;  2ZJR L;  3RSE A;  1VQ6 N;  4A62 A;  2E20 A;  3OBY A;  3LM9 A;  4GVE A;  3DJC A;  4OPH A;  4L3Q A;  4BRH A;  3EKU A;  4M7X A;  2NLX A;  2WC9 A;  3QIC A;  1KAX A;  3F2K A;  5BRD A;  1NGJ A;  1X9J A;  2A3Z A;  4JKH A;  2VGM A;  3CIP A;  3W3D A;  4BC3 A;  1NGH A;  1K73 O;  4JKC A;  2GEL A;  2P9I A;  1SAZ A;  2GUP A;  3C0B A;  4IJA A;  3CQY A;  3TSP A;  4BC5 A;  2P9I B;  4BR2 A;  3KWI A;  3E9L A;  3EN9 A;  1KAY A;  3L4I A;  4H0T B;  3VET A;  1BO5 O;  3QBX A;  5I9E B;  2D0P A;  2A41 A;  4A61 A;  4AM7 A;  5GIO A;  2CH6 A;  1NGE A;  2A5X A;  2IVN A;  3MX5 A;  3TTC A;  4YOY A;  3ATU A;  2QXL A;  4GY2 B;  5AZJ A;  3FFK B;  3M5R A;  4XH1 A;  5AQT A;  3CHW A;  5JLF A;  5AZJ B;  3VF6 A;  4MDA A;  1NJI O;  1WUA A;  5AQQ A;  3CCQ N;  1K8K A;  3O5B A;  5EVZ A;  3SJH A;  5BPL A;  3FZH A;  4CZG A;  5AQM A;  3MN6 A;  1K8K B;  1H1V A;  4KBO A;  3O9T A;  3ZET A;  2YHX A;  3MWP A;  4BRI A;  2D0O A;  2P9U A;  1ESV A;  3Q7C A;  3VEW A;  3WXJ A;  1YIT N;  1JCG A;  1GLA G;  2NRR A;  3EE9 A;  1J6Z A;  2P9U B;  1T6C A;  1BOT O;  1BG3 A;  4BQL A;  2VGN A;  2VYP A;  4FWO A;  3DWL A;  3TSQ A;  4PL7 A;  1SZ2 A;  4YOR A;  5EXW A;  1VQL N;  2FLO A;  3VEZ A;  3UKR A;  3H6E A;  3ATV A;  2YX6 A;  2RE2 A;  3PIP L;  3JXU A;  2ZWH A;  4EIA A;  1QZ6 A;  3L4Q A;  4PHT X;  2OAN A;  3UKR B;  2A40 A;  2D1K A;  1GLF O;  1KD1 O;  4CBU A;  4CD1 A;  4C1N I;  4BQZ A;  4R79 A;  5GAH P;  3P31 A;  4KH4 A;  5GAG P;  1Q86 O;  2KLA A;  3VER A;  2E1Z A;  3CMA N;  4GV3 A;  4B9Q A;  3T7Z A;  4WYB A;  3D2F A;  1KXP A;  4CBW A;  1GLL O;  3GDQ A;  1NGB A;  3C65 A;  3CER A;  3EO3 A;  5AQR A;  3ENH A;  2NNW A;  4WQ4 C;  3D2F B;  1GLE G;  3HM8 A;  3C7N B;  2FSK A;  1NWK A;  4JAX A;  2QEX N;  1QQO A;  2FSJ A;  4BR5 A;  3BUZ B;  3GBT A;  4B1V A;  1HX1 A;  5H1S Q;  3SMP A;  4IEI A;  4U67 L;  1TUY A;  2BH1 A;  4RTF D;  3T69 A;  5ELZ A;  1W97 L;  4A5B A;  4AM6 A;  5M1N A;  4JEP A;  3CME N;  3CC7 N;  1NM1 A;  4JKA A;  3O9U A;  1V4S A;  2QM1 A;  1KC8 O;  3O6W A;  3VMF B;  1Q7Y O;  5EOY A;  1XUP O;  3CQX A;  4GNI A;  4CJ7 A;  5M1K A;  1LCU A;  1W2B M;  3O9Q A;  4O8K A;  3A0I X;  4WFB L;  3DXM A;  3NVM A;  4H0P A;  3G4S N;  4MDB A;  4F9O A;  1NLV A;  3DXM B;  3P38 A;  2QI2 A;  5AQX A;  4G9Z A;  2ZGZ A;  1VQ8 N;  4CZH A;  5ADX H;  2FF3 B;  2P9L A;  1HLU A;  3HI0 A;  1QZ5 A;  3ID8 A;  5KQD A;  3ZX3 A;  4QS8 A;  3CD6 N;  1ZC6 A;  3O4W A;  2P9L B;  4BY9 C;  4QS7 A;  2JWL A;  1K9M O;  3C6A A;  4B1Y B;  3HOT A;  4YDU C;  4BRQ A;  3GL1 A;  3WUH A;  1N8R O;  3FLC O;  4FWP A;  3SBG A;  3MWT A;  3E1Y A;  3I8B A;  4WF9 L;  3CCV N;  4BC4 A;  4FPB A;  3TSU A;  2A42 A;  5CHI A;  4DCH A;  4Y0W A;  1D4X A;  3PIO L;  3UB5 A;  1P8Z A;  2PBD A;  5C10 A;  2EWS A;  5AQW A;  3A5L C;  3H1Q A;  4Z94 A;  4NLC A;  2IIR A;  4H5N A;  3VES A;  4MLE A;  3G25 A;  4J8F A;  4YOV A;  1ATR A;  3CCR N;  4DHY A;  3RSE B;  3O1W A;  2NRX A;  5AQG A;  3G71 N;  1T6D A;  3E9P A;  3ZX2 A;  1YJ9 N;  2Q1N A;  3SLC A;  5M1P A;  4DQ8 A;  1YJW N;  1RGI A;  1GLD G;  1BUP A;  2HF4 A;  3VEN A;  4H0O A;  4IFE A;  3ZEU A;  4YOX A;  1VQ7 N;  2GWK A;  4IJN A;  3D7E O;  1S72 N;  5JLH A;  3ZEU B;  1YI2 N;  1VQO N;  3AGK A;  3R8E A;  5JMV A;  2ASP A;  3GOI A;  1QQM A;  1JCF A;  4YOU A;  4BRG A;  3HOS A;  2OTL N;  2WFB A;  2YHY A;  1JJ2 M;  5F2R A;  4JKD A;  3U4L A;  3M1F A;  4PL8 A;  4NB4 A;  5AQI A;  4WFN L;  3TTD A;  4E1J A;  5M1F A;  3O08 A;  4NLB A;  3K9K A;  2NRV A;  3AAP A;  3UKU A;  1NGI A;  3O8M A;  3CC2 N;  4O8U A;  5BRF A;  1GLB G;  2Q31 A;  3DXK A;  3M6G A;  5BN9 A;  1S22 A;  4BRP A;  3UKU B;  4JKF A;  1HKB A;  2GWJ A;  2ASM A;  4EFH A;  4IXC A;  3DXK B;  3ENB A;  1NBW A;  4CZE A;  5B8H A;  4JKG A;  3UE5 A;  3R1X A;  3P4I A;  4ILJ A;  4MO4 A;  3CCS N;  5M1O A;  3ZET B;  4KH6 A;  3U9Z A;  3CJA A;  2Q2R A;  2QW9 A;  4JKG B;  5KPZ A;  4BG9 A;  1HKG A;  3FZM A;  2UYT A;  4FWL A;  4A5A A;  4IO9 L;  3D2E A;  4ILH A;  1VQN N;  1MDU B;  4YOW A;  2ZJP L;  3QBW A;  4B1Z A;  4H5T A;  5AQH A;  4CZK A;  1G99 A;  4JN4 A;  4K42 A;  4RCH A;  2QWL A;  2V52 B;  1R59 O;  1RDW X;  3F9M A;  3WXL A;  2P9N A;  3O1B A;  3DLL L;  3U8X A;  5AQY A;  5AQO A;  4BRN A;  4H5R A;  1Q82 O;  4AF1 A;  1XQS C;  2E8A A;  1YVN A;  4FSV A;  1Z05 A;  2CH5 A;  4FWS A;  1BA0 A;  1JCE A;  4K43 A;  3VTH A;  1T3V A;  2NRZ A;  1KQS M;  2I7P A;  5FPN A;  1YF5 L;  4H5V A;  4O5F A;  1XC3 A;  4IO8 A;  2F7T A;  1P90 A;  2ZGY A;  1VQM N;  3TU5 A;  4JKB A;  4HWI A;  5EX5 A;  2NZT A;  1YJN N;  3QDK A;  3OA9 A;  4BVO A;  3WEE A;  2J4R A;  1QQN A;  1GLC G;  2P9P A;  4C23 A;  2AA4 A;  3KVG A;  3CJ7 A;  1OKJ A;  3LDQ A;  3D6R A;  3H46 O;  3WEE B;  4EAH D;  3E66 A;  2P9P B;  4CI6 A;  4WQ4 A;  4BGB A;  4I6M A;  3MN7 A;  4CBX A;  4B1X B;  5HL7 L;  5C2D A;  5DM6 L;  1K8A O;  5AQN A;  3VOV A;  1DKG D;  2HBL A;  3K9J A;  4JHD A;  4HTL A;  4JNE A;  3QFP A;  1ZBS A;  1QHA A;  1TUU A;  2YI1 A;  3EKS A;  1KAZ A;  4MLH A;  3VEO A;  1M90 O;  1BA1 A;  1C0G A;  4JHD B;  5AQF A;  3VGL A;  1RFQ A;  2CGL A;  5KPT A;  1X3N A;  5GIP A;  5GIN A;  4XH4 A;  1DEJ A;  3CJB A;  1SS6 A;  3KWG A;  3WT0 A;  2HF3 A;  3SMS A;  5GAD P;  1YHQ N;  4IEE A;  3WXM B;  3I55 N;  2HBK A;  4JK8 A;  3SK3 A;  4PKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...