1N32K

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1n32K00
4DR4K 4JI8K 3J81O 4B3TK 5FLXO 4DV3K 5IT9O 4X64K 4X66K 4DV2K 4DV4K 4X62K 4LFBK 1N32K 2VQEK 4DV5K 4JI3K 4JI6K 1I94K 1IBKK 3JAMO 3J7AP 3T1YK 4DR6K 4NXNK 1J5EK 5A2QO 4DV1K 4NXMK 4DV6K 1XNQK 4CW7B 4YHHK 4JI5K 4GKKK 5LMNK 1IBLK 4JI2K 4DR2K 4YY3K 4JV5K 4LFCK 1HNXK 1HR0K 1XMOK 4DUYK 2HHHK 5LL6Z 2UUAK 3J80O 2UXCK 4CVNE 4B3SK 1N33K 4LF8K 4LF5K 4JI7K 5IWAK 3T1HK 2UUBK 4V19S 4K0KK 4JI0K 4LFAK 2F4VK 4DUZK 5LMUK 1IBMK 4DR5K 2UU9K 2UXBK 2ZM6K 1N36K 4DV0K 4KHPK 4DR1K 2UUCK 4X65K 4DR3K 1FJGK 2UXDK 4JYAK 1XNRK 4B3RK 4LF4K 4LF9K 1HNZK 4AQYK 3J7YP 3OTOK 4DR7K 4LF7K 4OX9K 4B3MK 4GKJK 1XMQK 4JI4K 5AJ3K 2E5LK 4JI1K 5BR8K 1HNWK 4DV7K 4LF6K 2VQFK 1N34K
chains in the Genus database with same CATH superfamily
3F73A 3SPYA 3THWB 1ASWA 1B92A 4G1QA 4WQ5C 5C10A 2YJEA 3H08A 5AQTA 1OH6A 3DXMA 3WQTA 4B9VA 3VQCA 1EX4A 3MK6A 4M7YA 3VA0A 4FLVA 1GLDG 3WXJA 1C1CA 1VSEA 4ISGA 4CHYA 5FPMA 4OGEA 2KQ2A 3GBTA 4KHNA 3V1QA 1TAQA 3CFOA 4CI6A 4FXDA 2HNDA 5BPLA 4N76A 4YOUA 4JI5K 1YTUA 3DWLA 4I7FA 4FJJA 3O9RA 2FBVA 1G15A 4A2AA 1JLCA 1X9JA 3KKSA 1GLEG 4QS7A 2O8CA 5J1EA 5AQUA 3BGRA 4FOEA 4YOXA 3BZKA 1YT3A 4BACA 4Z0UA 1SQKA 5AZIB 3WXMB 3J80O 4OVLA 3U4LA 3VQ8A 2FBYA 5GAHP 4KFBA 5DMRA 1KFDA 3E1YA 1W2BM 2WC9A 1S72N 2F9WA 4BRQA 1S6PA 1VRTA 3SQ2A 3VQ5A 2HMIA 3B6PA 4WE1A 2JWLA 4RTFD 2A1RA 3KLEA 1BL3A 4FLUA 1WLJA 2PYJA 4DR5K 3NF7A 1S1WA 4C8NA 4NB4A 2E88A 3MXIA 3ZX3A 5JLHA 2O8FA 4DR3K 3ZT2A 1Q86O 1EWQA 4E7JA 3ENBA 4L3QA 1YTAA 4WCEL 3BDPA 4GV3A 3ZT3A 4W5RA 3AVBA 4PWDA 3MEDA 3D0PA 1RBSA 1TK8A 4GY2B 2HVIA 1E4FT 4IOCL 1VAZA 4J2BA 3M8SA 4JI4K 4IO9L 1HYSA 2CGKA 3SPZA 4OO1J 2O8CB 2OPQA 2P9UA 1YI2N 1VSDA 1NNEA 2QWRA 4F2SA 3SAGA 4BDYA 1U2VB 4G9ZA 3C6AA 4BC2A 3S41A 4HCBA 5AQOA 2BGGA 3R9PA 5AQXA 2HOEA 4JI3K 3NGZA 3D2EA 4AHRA 3G71N 1MA9B 1MU2A 1TAUA 3LZJA 1EWRA 3A5NC 3K57A 4BVPA 3DLKA 5FDLA 4WFBL 4FM0A 4B3OA 4GV6A 3CM5A 3L4QA 4FOIA 5HRSA 2BE2A 2XY7A 4OPAA 2GUIA 5FPDA 1J9AA 3HBTA 2QWNA 4FO0A 1UA1A 3AVNA 2Z1IA 4R79A 3SV4A 4EAHD 4IFVA 3OW2M 3MWPA 3TSPA 1VQNN 3BF1A 2HF4A 2YV0X 3QFPA 1RT4A 2OTJN 1NMNA 4BRMA 4ELTA 1VSMA 1C6VA 1CZBA 2E2PA 3QIOA 2F8SA 3OYBA 5JLFA 3CERA 3UB5A 2F96A 2D5RA 1QHAA 2Y1IA 1XQSC 4I9QA 4LC9B 4IOAL 2F4VK 2HHXA 1NKEA 3TAEA 4IJNA 4NCBA 1BQNA 4YOVA 4CK2A 4KB1A 4KHPK 1IKWA 1P8ZA 3TSUA 1TYQA 5J2NA 1NJWA 3I33A 3HT3A 3QICA 3RWUA 3SBTA 3KLIA 3P1GA 1U6ZA 5KGWA 3OTOK 3SJJA 4B9SA 3QNOA 3DLLL 3HSTB 4PL8A 1N5YA 3TAQA 4YORA 2QTDA 1CXQA 2WONA 4OPJA 1QQOA 3VERA 4MDAA 4KRFA 3AVCA 4GVEA 4DS4A 3OA9A 4JD2B 4CJ3A 3OYLA 3VA3A 3CC2N 2NRZA 1RDAA 1VSKA 4DLEA 5C42A 1NK8A 3W3DA 5ADXH 4DV3K 4K8XA 2ZQBA 1JKHA 1JLBA 2YHWA 4CGHA 4DV2K 1SZ2A 3V9ZA 1VQ6N 4M3UA 4NLBA 3P5JA 4W5NA 2KKZA 3PY8A 3HOSA 1ITGA 3QINA 2ZGYA 2FBTA 4GNIA 4DQIA 3AVGA 4UY8O 5LY3A 3SQ0A 3VF6A 1QQNA 1HRHA 5E26A 3J7ZO 3E9PA 3UKUB 4DR2K 4BRFA 4LSNA 1NK7A 2PBDA 3SK3A 3SAHA 3CCVN 2HSTA 4WQ5A 5HRRA 4CD1A 3CQYA 3VESA 3O9QA 2NUBA 4CK1A 2IGIA 1VQON 1NGHA 3EZWA 1SUQA 3L2VA 3FZKA 1BQMA 3Q7CA 4FWOA 3P38A 4PKGA 4CJTA 3K0SA 4ZHRA 4FLTA 3I8BA 3VMFB 4BG8A 3MWTA 2YHYA 4QOZB 1U49A 1S22A 3P31A 3U3YA 4FLYA 1TGOA 4HUFA 2NLXA 2GTDA 3AA5X 4ELUA 3K9JA 2DPNA 3K5OA 1W97L 4E89A 3KK7A 5TKYA 1V4TA 4JLHA 5D3GA 3V6DA 3NVKA 2OZMA 1W9HA 1Z6RA 3ITHA 4GKJK 4CJ4A 2BTFA 1SAZA 4JKDA 2HHSA 1VQ5N 3D6RA 5AQIA 2E5LK 1SKRA 1JCEA 4C1NI 1TK5A 5BRHA 2Z1GA 3C7NB 4CEAA 4LF6K 4FVMA 1IH7A 4M3RA 3H6EA 1GLFO 5KRTA 4I9LA 3OY9A 3ZT0A 4F9OA 3AGKA 2ITMA 3LAKA 5C25A 5HRNA 3OYEA 4DB3A 1EO1A 5IT9O 2YHAA 1IO2A 3DYAA 5FROA 3O3GA 4BG9A 5KPZA 1S6QA 3NCIA 4A57A 1Q9XA 2CGJA 2HBMA 1FXXA 1OVQA 4AHCA 3GG4A 2P9NB 3AAPA 4JS5A 4QS9A 3I56N 3RSEB 3EN9A 3FZHA 4FJGA 4MDBA 4JKCA 2B6AA 1NGEA 3CIPA 3ID6A 1IJJA 2WUSA 5LMNK 1IBLK 1GLCG 3KWGA 2OA8A 3CD6N 5KI6A 3B6OA 3CETA 1KC8O 3AVJA 1KTQA 1D9DA 3IMXA 5LL6Z 4LH5A 5EX5A 3L0QA 3QFUA 3KD5E 4CHNA 4CF1A 1SL2A 5DK5A 2G8KA 2RF2A 4B1YB 1J54A 3VQPA 3MXJA 4OJRA 3VQ7A 1XWLA 1TKTA 4A2BA 1YJ9N 3M6GA 4CZGA 3ZEUB 3S9HA 1ESVA 3RR8A 3I8DA 1BG3A 1ZYQA 3C65A 4BRIA 4C23A 2KZMA 3DLRA 1FKOA 5CYMA 4M3XA 3OYNA 2ZJQL 3ZCMA 3T3FA 2UXBK 3G0ZA 4BGAA 1C0MA 2PFUA 4PL7A 1XHXA 2O8EA 2VGMA 3QEIA 4BY9C 4JYAK 1O1WA 4A62A 4KHYA 3R1XA 2XY8A 3PX6A 4PY5A 3M8QA 1LAWA 1WBBA 3UE5A 3NF6A 3QIPA 4CJKA 1NKCA 4KPYA 1NGFA 1BISA 1WSJA 3DXKB 1LWFA 3C6TA 4NCGA 1HKBA 1BGXT 3H3NO 1BI4A 4K8ZA 3HOTA 1LV5A 1YHQN 5BR8K 3CMEN 3WEEA 3G25A 3BZCA 3P39A 3BEXA 5CYQA 1GLLO 5F2RA 4RWTA 2W40A 5ELZA 3THYA 4IO8A 3RTVA 3E66A 4CZFA 4B9LA 3L2WA 4O5FA 3L2RA 4DSFA 3CG7A 3WNEA 2QXLA 1WSIA 3K9KA 1Q8IA 4NCAA 1KRPA 3NH2A 1OVYA 3DOLA 4JKFA 4WYBA 2HHWA 4JV5K 1KXPA 1JL1A 1HQUA 1QS4A 1VSLA 1VQKN 3MN9A 1YUWA 1GOBA 1ATSA 4B1UB 3A5LC 4WF9L 3DAWA 3C94A 4CVNE 4JKBA 2P9KA 5GIPA 1T8EA 1BIUA 4FLZA 4N56A 4KTQA 4KI4A 1KVBA 3FFKB 4LH4A 4NLCA 5F0XA 3ALYA 3T7ZA 1WSGA 3T1AA 3SUQA 1C1BA 1S1TA 4DTMA 5SWMA 1WAFA 4NYFA 4DTRA 3D2FB 4JK9A 4BRKA 4CGJA 2YHBA 4DR1K 1REVA 2IAJA 1U48A 4GMJB 3IRXA 1NGGA 2O8BA 1ZBFA 1W0HA 4LF9K 2RKIA 3J7YP 2CH6A 4IFYA 2XY6A 3ISNC 3KJVA 5AJ3K 3SNNA 2X6SA 3AY9A 4LSLA 1NKBA 1K73O 3FLCO 1A5WA 2GX9A 1R59O 4JI1K 4CJPA 3CCSN 4J8FA 3HVRA 3RMBA 2QK9A 4XIUA 1HUXA 1ZBUA 1GLAG 5C2FA 3QERA 2YNGA 2A41A 5FLXO 4XH4A 3QESA 4Z4EA 3LZIA 2RN2A 3LP0A 4ZTFA 2VQEK 4JI6K 1IBKK 3NVMA 5AZJA 5M1KA 2G8HA 1BWFO 4CFBA 4BREA 3LDNA 4AILC 3AGRA 2FSKA 4IDKA 3FE1A 4GKKK 3NBPA 4YFUA 4BGBA 5GADP 4XEIA 3VETA 3OS2A 1DTQA 3THXA 3CF5L 1XMOK 2X74A 4KTZA 1UAXA 1YAGA 4ILJA 2DTUA 1TVRA 2BANA 3PSIA 2XO7A 4W5TA 3T19A 2EX3A 3LDOA 4I6MB 4ISFA 4LY7A 3TTFA 3BUZB 3PSFA 3JS6A 2A42A 1BCMA 3EKUA 3EZ5A 1Q18A 1N33K 3SI6A 3AVIA 4FWNA 4HTUA 4LF5K 3VQ4A 4Y1CA 5IWAK 4BR9A 4HVJA 1ZBLA 3KZBA 2Q36A 4FJMA 4PHTX 4CERA 1NGBA 2X6NA 4H4MA 4CEBA 1KLNA 4K25A 4M45A 3WXKA 3HP9A 3VOVA 1S9GA 3L4IA 4FWRA 4DHYA 2CGLA 4KH5A 4XH5A 3ZSOA 5K14A 3QO9A 5C2DA 3VF2A 3SV3A 3L3VA 5AQPA 1TKZA 3DRRA 1RTIA 3ASMA 3NAEA 1HNZK 3KIOA 2ITGA 1D4XA 2HHTA 5BREA 5KRSA 3M3ZA 2P9SA 4B3MK 4DTSA 3THXB 3DXMB 1Y64A 3TAFA 2D0OA 2D4WA 2IVOA 1HNWK 3OYGA 3TAMA 3SUOA 3E01A 5ADXA 3VTIA 3PIPL 5HP1A 1KLMA 1ZXOA 4O44A 4Z4IA 3CCLN 2GWJA 4RW9A 1LCUA 2HNYA 5AQKA 2IDOA 4IXCA 4CJLA 5KGXA 3AAQA 1L5UA 4B9UA 4IG0A 3SUNA 1WN7A 3MAQA 3WT0A 5J2MA 4MQ3A 4YHHK 1ATNA 4DFJA 4CGDA 5AQYA 3HYFA 4CHZA 3LL3A 5AQSA 3DLBA 3OYCA 3F2KA 1ASUA 3G4SN 4KHQA 5AQGA 3K5LA 2GV9A 1IKVA 4CF0A 3O5BA 3AO1A 2HMPA 1RT5A 3EEQA 2UUAK 4BWJA 4MFBA 4DU3A 2P9SB 2UXCK 1NG9A 3LP1A 1VHXA 4BDZA 2ZJPL 4BRGA 2E6LA 2ZJRL 3P83D 1IKXA 4C1NK 4CGGA 3O8MA 1TL1A 5HOOA 1WSHA 3KLGA 2Z1JA 3J8AA 2O8FB 3L2UA 1BA1A 4BQLA 3CCEN 3ZSXA 3SUPA 2O8DA 4V19S 1NOZA 4E1JA 1DTTA 3OJSA 1DKGD 3PO5A 1T7PA 1WBDA 3AVHA 1TUYA 4CE9A 1J6ZA 2ASMA 5AQVA 3QBXA 4IJAA 1HLUA 1NGJA 3QNNA 1B9FA 4O5BA 3R6MA 4KHWA 3VN5A 4U7BA 5CR4A 4DSKA 2CH5A 3G6EN 4DF4A 1KVAA 3HXMA 2E2NA 1GLJO 3ID8A 2P9UB 5JS2A 1NJZA 3VEWA 4BDPA 2HHUA 3QEWA 2A3ZA 4B3RK 2QWMA 4EHUA 4H0OA 3NFAA 4H5TA 3WUHA 3I0SA 5AQMA 3K59A 1IG8A 3EKSA 3ENOA 4AM7A 3DRPA 1C0GA 4FJIA 2QKBA 4BE1A 3VTHA 2D0PA 2HF3A 3IKMA 4JKEA 4O8KA 3D2EB 4DTOA 2OPPA 1U04A 3MCAB 4CJFA 3AVMA 1T03A 2PYLA 5AQNA 4GV9A 1XI1A 1OH5A 1YVNA 3BP8A 3TARA 3N4QA 2D0CA 4OLBA 1NGDA 1C0TA 3RRGA 3LANA 1M90O 4CEOA 1HKCA 3O9UA 2V51B 3MN5A 3O4QA 4IEIA 2P51A 4NXNK 5A2QO 2OZSA 2P9IA 3KVGA 3KHYA 1K8AO 4B1ZA 1UOCA 3WNGA 3VQ6A 1Q9YA 1EP4A 4KHSA 1RT1A 1BHLA 3FR0A 4BRCA 5GIOA 1CLQA 2O4IA 5KPTA 1HJOA 1K8KA 3MMVA 4BQZA 2HHHK 3JXUA 5C12A 1V4SA 2GBZA 3L8BA 2J4RA 4YOYA 1W7AA 1NOYA 4BRNA 3SBGA 3SMSA 3PV8A 2G8WA 1S1VA 2QWLA 4B9TA 1QSYA 3EL2A 4U67L 4B3SK 4A5BA 1RBTA 1RDCA 5GAEP 1EQYA 4CJSA 4K42A 4BRLA 3GDQA 5CY4A 1TYQB 3D7EO 4DLGA 2UUBK 2VWBA 2JWKA 5AQZA 3CQXA 5HLFA 2KLAA 4BVOA 1WAJA 4E3SA 3TAGA 1RTHA 3H45C 4E19A 3HP6A 5LMUK 2D0AA 3B8AX 1F21A 1ASVA 4IZ9A 4CFAA 5FRNA 3P4IA 4DV0K 1HQEA 3VEOA 3KLFA 3U8XA 4FLWA 2IOCA 2P9IB 5AQQA 4NYNA 1NBWA 3ZSZA 3VPZA 2QA4N 4OKKA 4AQYK 1KCFA 4FJ5A 1QQCA 3KK1A 3QEVA 3U9DA 4CIGA 4CZJA 4AF1A 1XMQK 2E4LA 3ULDA 1FW6A 4CJUA 2BH1A 3SQ4A 2VG6A 3BF3A 4A61A 2QWOA 3CQ8A 4X66K 3H1QA 4JKHA 2OTLN 1NWKA 5M1PA 1KAZA 3ZX0A 4CJRA 2DFHA 5CE3A 1D9FA 3ZSRA 3AA3A 2I7PA 2NRVA 3O1WA 3A5MC 1ZBHA 4DR6K 4JAXA 1NK5A 4BRAA 4RW6A 3AVAA 4E1NA 4BC4A 1VQ4N 2LSNA 2E1YA 4CF2A 2WFBA 4Y0WA 3HO1A 1LAVA 2W6KA 1VQ9N 3QEPA 1HR0K 2A40A 4DUYK 4QAGA 1NK0A 3PX0A 1XUPO 4CEFA 3CM6A 3E9LA 2DFEA 2VYPA 4KAZA 4DQSA 4F3TA 2JLEA 2QWPA 1NU0A 1HKGA 1BIZA 2A5XA 3GOIA 4BC3A 1K9MO 2G8FA 3M8RA 4FWQA 4DU4A 3AO5A 2Q0UA 5HROA 1TV6A 4JS4A 3THVA 3R3LA 2NRWA 1HPZA 2D0BA 1L3UA 3CCUN 3ZYYX 4IWVA 4PKIA 2UU9K 1CZAN 1N36K 3VEZA 3CFPA 4E7IA 4E0DA 2HBJA 1RT7A 4JRPA 1O13A 5F1XA 5AFUH 3AVLA 2XRIA 4KV8A 3ULEA 3EYZA 3V4IA 4DFMA 2BUPA 4L8RB 3OJUA 5HBMA 4DU1A 4BRPA 4BR2A 3ENHA 4J2EA 4KO0A 4DG1A 2HBKA 5BRFA 3OYAA 5MLCQ 2PAVA 4B8AB 3O08A 1BCOA 3OBWA 4F3OA 1CXUA 2NRRA 3KKRA 3FGUA 3ZT1A 1RTJA 4B3TK 3TTCA 1RGIA 3OYJA 4B9QA 3TU5A 4CHOA 5JICA 4DSJA 3LDQA 1EETA 1LW2A 3LDPA 1HX1A 1X9WA 1MWMA 3LWLA 1RT3A 2FXUA 2QW9A 2NRXA 4DV6K 2HVHA 1T6CA 3Q7BA 4Z4FA 2D1KA 1DLOA 1H1VA 3HRGA 4DFKA 3UIQA 2A6AA 3R8EA 3MX5A 4H4OA 3FFIA 2ZE2A 2GUPA 3CCQN 3TR8A 3TTDA 1QSSA 1Q82O 5BR9A 4FJLA 1TK0A 2NRTA 4FWMA 3OS1A 3OYFA 4H03B 2O4GA 4DFPA 3PLAA 1KAYA 4FPBA 3H46O 1FK9A 3M8PA 1YIJN 2NNWA 4WQ4C 1HYZA 4B1XB 4RG8A 1X3NA 3CJCA 1U47A 1JCGA 4JI7K 2ASOA 2O8EB 3PX4A 2Q0RA 2V7ZA 3OYMA 4B9MA 1DT9A 4JK8A 4DUZK 3IG1A 1A5XA 1RBUA 3CC7N 4HHTA 4RCHA 4JHDA 4F8RA 1SKWA 3HTVA 4O8UA 1BI4B 4FZYA 4X65K 3A8YA 1FJGK 3NF8A 3AV9A 3LALA 4AHTA 4IKFA 3NF9A 4AHUA 4CJ5A 3K58A 4DR7K 3WEEB 4CK3A 2KFZA 1NGIA 3THYB 1T6DA 3VQEA 4H0VB 5AR0A 1YVUA 3HM9A 2W42A 4BR7A 4J2AA 2G8VA 4ELVA 5J2PA 3DM2A 1BUPA 3K2PA 1NM1A 4FW1A 2GWKA 4IFEA 3WNHA 1ZBSA 5M1QA 3HZ6A 4CGIA 5M1FA 4M41A 4ID1A 3S3MA 1XC9A 4BR5A 1FKPA 1IV0A 3C6HA 4CZLA 1JXEA 1NLVA 3AA2A 3ZETA 4FM1A 3O1BA 4C8MA 1RDBA 2QKKA 2Q3SA 1I94K 4DQPA 3SZ2A 3G10A 4ZTJA 4CF8A 3RRHA 1QHTA 2JGUA 3THWA 1J5EK 1XNQK 4CW7B 2FLOA 1BOTO 5H1SQ 4W5OA 1QTMA 3L6QA 3MEGA 4JK7A 2P9KB 5TKWA 4YY3K 1BA0A 1Z26A 1DEJA 3AO3A 1WOQA 1SL1A 2YKMA 1NJIO 1HJRA 2IVNA 3EO3A 4PUOA 1GLBG 5SZTA 3O4NA 5LJWA 4KI6A 1Q7YO 5EOYA 4RW8A 2R7YA 4HWIA 5JS1A 4JI0K 3A2FA 3H1VX 5AZIA 3UKRA 2O8BB 5EU7A 4WFAL 2HHVA 4DSEA 1RT2A 3O80A 3MECA 1VRUA 2RE2A 4HUGA 2VWKA 1L3VA 2GELA 3VQAA 1YITN 3F9MA 5BN9A 4CD3A 3IAYA 3O9SA 4UQGA 4FJHA 4Z4CA 1JLGA 4CBUA 4XH1A 5AQJA 1OH8A 3MCPA 2B5JA 1XHZA 4LF7K 1J53A 3NH1A 3O3FA 1J5OA 4MO4A 2F7TA 3PIOL 1LWEA 4FSVA 4DQ8A 1JLFA 4GW6A 3SJHA 3CJ7A 1X9SA 1SKSA 3NGYA 4DV7K 4JKAA 3HVTA 4HTLA 1GOAA 5AZJB 1ILYA 1JLAA 3AA4A 3SCXA 4M63C 4Z94A 4FM2A 4FJKA 4JRQA 4X64K 3LAMA 4J2DA 2VGNA 2RHKA 5E84A 4Q0BA 1N32K 4IBNA 3LDLA 4ILHA 5BRDA 1WNSA 4FJXA 2YNHA 3UKRB 1OH7A 3CCJN 5M1OA 5C15A 4DWIA 1C0FA 1U2VA 4I2QA 3AO2A 4H0PA 3CI5A 4O0JA 4DTXA 3VQ9A 4FZZA 4JI2K 2VWJA 2Q31A 4LFCK 3VEXA 2DFFA 4FJNA 1JLEA 3QDKA 2HBLA 4BRHA 3K5MA 4EIAA 2E2OA 2FSJA 1C1AA 3V9XA 1EKEA 2NRHA 3AO4A 4R5PA 2HNZA 4FJ8A 4DS5A 5CZ1A 2A1SA 1QVFM 5BPNA 4CECA 2Q2RA 2IVPA 1QSLA 4LFAK 4IEEA 2P5GA 2ATQA 4M3YA 3ATUA 4B1VA 3HPHA 3MN7A 1NJXA 3VGKA 4ID5A 2P1JA 3S3NA 1IKYA 3DOKA 4KB0A 1VSJA 2KW4A 3CPWM 1RFQA 5AQRA 4AHVA 2WTUA 4B9NA 3AARA 3C0BA 4LF4K 1RCHA 4WQ4A 2KFNA 2V52B 3DJCA 4Z4GA 1TUUA 2QEXN 4IG3A 4OX9K 3ZSQA 3DRSA 4Q5VA 1QVGM 2W6LA 2QWQA 3OBYA 1L3SA 2OPSA 2YX6A 3KK2A 1D8YA 2WOMA 2UYTA 4OKEA 4HUEA 1U45A 4FPAA 4H0TB 3RMCA 3CHWA 2RPIA 1ZC6A 3M1FA 3WXIA 4BRDA 4JI8K 3IUCA 3O4WA 3CFRA 1VQ8N 4CCHA 3KD1E 3SMPA 3DMJA 4DV4K 1X1PA 3NHGA 4FW2A 4MO5A 3OYIA 5AQHA 1MWKA 4KBOA 4DV5K 3TWHA 1N8RO 1NGCA 4JD2A 4C8KA 4BR4A 2GEMA 2V7YA 2WBNA 4YNQA 1Z05A 4JEPA 3O9TA 4DV1K 4NXMK 4FCYA 2E6MA 1WSFA 4CJ7A 1A5VA 5BPMA 2YNIA 2YJFA 5AQLA 5JVGL 3BY5A 2AP1A 5CHIA 3WXLA 3PUFA 4F2RA 1HNVA 4FK0A 4W5QA 4DQRA 5FPEA 3LPTA 3WQUA 2ZWHA 3PO4A 4CIEA 5DM6L 2YCHA 4O0IA 2O8DB 4FLXA 1X9MA 5AQFA 3NMUA 5I9EB 4LD0A 3JYTA 4B08A 4EZ6A 3UKUA 5E41A 1NJYA 3CJ1A 5JVHL 1VQMN 5EXWA 2XY5A 4CEZA 3MXMA 1P90A 2E1ZA 4CZKA 1RBRA 2Z1HA 4EP4A 5KQDA 3CCMN 3CCRN 4N41A 3LDSA 4FYDA 1KSPA 2OCEA 2OYQA 4YDUC 4YOTA 1RNHA 3ZX2A 4CZIA 4CESA 1RTDA 1NGAA 2Q1NA 5AFUA 3DLHA 3OHRA 2ZM6K 4DSLA 4K43A 3EY1A 3DLEA 3OVNA 3ZT4A 3NGIA 2I5JA 1DGKN 3AVKA 1XC3A 4CJEA 2QI2A 3IDHA 4FJ9A 3MEEA 1I39A 1T05A 5KPRA 3C95A 3EE8A 2FF6A 1S9EA 5JMVA 1G99A 3OS0A 1NMDA 5DM7L 4H5NA 1T3VA 1VK0A 1VQ7N 3O6WA 2VG5A 3CYMA 1QE1A 2FC0A 2VCPA 5AQWA 1QZ6A 2ZGZA 3ZSYA 1M1KO 4B1WB 4M42A 3TABA 2YNFA 3ATVA 4ICLA 1TL3A 3C7NA 1K8KB 4JKGA 5EY4A 1TKXA 2EWSA 2E2QA 4H5WA 4H5RA 1EXQA 1RILA 5LJVA 3H3OB 1VQPN 3LM9A 4BR0A 3JSMA 2KTQA 1Q81O 4KREA 2F9TA 4PA1A 1S1XA 4HCCA 3A5OC 1E3MA 3QB0A 4KHUA 5HRPA 1ZBIA 2OPRA 1UWBA 3DLGA 2P9NA 3CPEA 4OKJA 3SAFA 3S3OA 3WNFA 1VSHA 4JN4A 4OPKA 3RSEA 2IC3A 3SYZA 3KK3A 1R0AA 4OLAA 5FPNA 4DTNA 3U9ZA 3SLCA 4DSIA 4C8OA 3I0RA 2EHGA 2FBXA 2VG7A 1YF5L 3T1HK 1I3AA 1NK6A 3ZSWA 3V1OA 4E7LA 3L2QA 3SQ1A 4EP5A 1WSEA 3QMLA 3K5NA 4CEEA 3VQBA 1IBMK 4JKGB 3ZEUA 1U4BA 4PKHA 4OPHA 3O3HA 4FK2A 2UXDK 1WB9A 2ZD1A 2YKNA 2G8IA 3TSQA 5J2QA 1XNRK 5GINA 2FSNA 4DQQA 4N5SA 3I55N 1K6YA 1KQSM 4FWSA 3CJAA 2P5OA 1RDDA 3D45A 3EE9A 4N47A 4M3TA 4I2PA 1C0UA 4CJQA 4TSXA 1L3TA 4E1MA 3V81A 4AHSA 2XHBA 5KTQA 5B8HA 1N34K 1QZ5A 3HPOA 4FJ7A 4K41A 4KH6A 4BROA 4CZEA 3J81O 4FVUA 1BDGA 3DXKA 3HJFA 4BC5A 3VF4A 4DKWA 1B9DA 3MN6A 3TANA 1N6QA 1SL0A 1E4GT 1SV5A 5I42A 1SS6A 4LFBK 4DMNA 3M5RA 3JAMO 1Z25A 3OYDA 3U3GA 3V9SA 3V1RA 3LPUA 5KQ8A 2I7NA 3VGLA 2E20A 3HSCA 4DCHA 4H0XB 3QLHA 3N4PA 3HPGA 4A59A 1WUAA 2IS3A 3ZLJA 3HI0A 3FZMA 2PY5A 1CZ9A 4E7HA 1VSIA 2QXFA 3FZLA 5CZ2A 1HNXK 2HHQA 4CBXA 4Z4HA 1KVCA 1X3MA 1HYVA 3RVCA 3DI6A 3V9WA 1BU6O 3VENA 1D5AA 1JCFA 2ZF5O 1NK4A 4YOWA 4CZMA 4DTPA 4Y1DA 3F9KA 2OANA 2YI1A 4EFHA 2IIRA 3LP2A 4BWMA 3ULEB 4DTJA 4CZHA 3TPQA 3NDKA 2DY4A 4O4GA 4IOXA 2P9LA 3TAPA 4KKOA 4B8CA 4ILGB 3CJBA 4FZXC 4H5VA 3GL1A 4FWLA 3ZSVA 4JNEA 4CIFA 4E7KA 4FWPA 1KAXA 4H8KA 2W41A 3CJ9A 2ETJA 3IS9A 3E9OA 2UUCK 2YHXA 5C0YA 3VQQA 3AVFA 1KD1O 4M3WA 4CJVA 4CFDA 4MLHA 2P9PA 4MLEA 2BDPA 4FWKA 4CJWA 4EHTA 2HW3A 3D2FA 4H0YB 4CHPA 3CMAN 4OGCA 4ISEA 4BE0A 2F8TA 1MDUB 4RW4A 4BE2A 2VQFK 5EVZA 2AA4A 4C8LA 3IFRA 4GVMA 4YDUA 4AM6A 2H3GX 4DR4K 4A5AA 1VQLN 2QM1A 4QS8A 3F5TA 3QEXA 3HL8A 5M1NA 1TKDA 1S3XA 1UA0A 2Q97A 3T69A 4WFNL 2NZTA 4O55A 1LWCA 3TI0A 4X62K 3FZFA 3RMAA 1JXBA 5BN8A 5I3UA 3J7AP 2ASPA 3QBWA 1LW0A 3T1YK 2AJQA 5T7BA 1RT6A 2B4JA 2P9LB 1S5JA 3VQDA 3KWIA 1HNIA 4CEDA 2FF3B 1T44A 2KZZA 3OYHA 2HB5A 3HK2A 3KTQA 2Y1JA 1ATRA 3HM8A 1YJNN 4RW7A 3KLHA 1JL2A 1HMVA 2P9PB 1NK9A 3VEVA 4CFCA 2KHOA 3LP3A 1JLQA 3OYKA 1GOCA 1LOTB 3RR7A 3NH0A 5GAGP 2G8UA 3MX2A 1RBVA 3NE6A 3W0LA 4CEQA 4JHDB 4LF8K 3GE1A 5FRMA 4CGFA 4IDHA 1RDWX 1S1UA 3LM2A 4NO7A 3QETA 1BO5O 4I6MA 1YJWN 1KFSA 4K0KK 3L3UA 4M3ZA 2PZSA 1HPMA 4PQUA 4DTUA 4AH9A 4KH4A 3VGMA 1RDUA 4CBWA 1Y97A 4EZ9A 1QQMA 3VEYA 1JJ2M 1YXQA 4FL9A 1IG9A 1VSFA 5C24A 3CC4N 2E8AA 3LWMA 3CXCM 3MDQA 3A0IX 4DF8A 3V9UA 3RMDA 4CF9A 2X78A 3U6FA 4KTWA 4F4KA 4FK4A 5HL7L 4CHQA 4M7XA 3C6UA 3ZETB 4QCLA 1OKJA
chains in the Genus database with same CATH topology
4DR4K 4JI8K 3J81O 4B3TK 5FLXO 4DV3K 5IT9O 4X64K 4X66K 4DV2K 4DV4K 4X62K 4LFBK 1N32K 2VQEK 4DV5K 4JI3K 4JI6K 1I94K 1IBKK 3JAMO 3J7AP 3T1YK 4DR6K 4NXNK 1J5EK 5A2QO 4DV1K 4NXMK 4DV6K 1XNQK 4CW7B 4YHHK 4JI5K 4GKKK 5LMNK 1IBLK 4JI2K 4DR2K 4YY3K 4JV5K 4LFCK 1HNXK 1HR0K 1XMOK 4DUYK 2HHHK 5LL6Z 2UUAK 3J80O 2UXCK 4CVNE 4B3SK 1N33K 4LF8K 4LF5K 4JI7K 5IWAK 3T1HK 2UUBK 4V19S 4K0KK 4JI0K 4LFAK 2F4VK 4DUZK 5LMUK 1IBMK 4DR5K 2UU9K 2UXBK 2ZM6K 1N36K 4DV0K 4KHPK 4DR1K 2UUCK 4X65K 4DR3K 1FJGK 2UXDK 4JYAK 1XNRK 4B3RK 4LF4K 4LF9K 1HNZK 4AQYK 3J7YP 3OTOK 4DR7K 4LF7K 4OX9K 4B3MK 4GKJK 1XMQK 4JI4K 5AJ3K 2E5LK 4JI1K 5BR8K 1HNWK 4DV7K 4LF6K 2VQFK 1N34K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR4 K;  4JI8 K;  3J81 O;  4B3T K;  5FLX O;  4DV3 K;  5IT9 O;  4X64 K;  4X66 K;  4DV2 K;  4DV4 K;  4X62 K;  4LFB K;  1N32 K;  2VQE K;  4DV5 K;  4JI3 K;  4JI6 K;  1I94 K;  1IBK K;  3JAM O;  3J7A P;  3T1Y K;  4DR6 K;  4NXN K;  1J5E K;  5A2Q O;  4DV1 K;  4NXM K;  4DV6 K;  1XNQ K;  4CW7 B;  4YHH K;  4JI5 K;  4GKK K;  5LMN K;  1IBL K;  4JI2 K;  4DR2 K;  4YY3 K;  4JV5 K;  4LFC K;  1HNX K;  1HR0 K;  1XMO K;  4DUY K;  2HHH K;  5LL6 Z;  2UUA K;  3J80 O;  2UXC K;  4CVN E;  4B3S K;  1N33 K;  4LF8 K;  4LF5 K;  4JI7 K;  5IWA K;  3T1H K;  2UUB K;  4V19 S;  4K0K K;  4JI0 K;  4LFA K;  2F4V K;  4DUZ K;  5LMU K;  1IBM K;  4DR5 K;  2UU9 K;  2UXB K;  2ZM6 K;  1N36 K;  4DV0 K;  4KHP K;  4DR1 K;  2UUC K;  4X65 K;  4DR3 K;  1FJG K;  2UXD K;  4JYA K;  1XNR K;  4B3R K;  4LF4 K;  4LF9 K;  1HNZ K;  4AQY K;  3J7Y P;  3OTO K;  4DR7 K;  4LF7 K;  4OX9 K;  4B3M K;  4GKJ K;  1XMQ K;  4JI4 K;  5AJ3 K;  2E5L K;  4JI1 K;  5BR8 K;  1HNW K;  4DV7 K;  4LF6 K;  2VQF K;  1N34 K; 
#chains in the Genus database with same CATH topology
 3F73 A;  3SPY A;  3THW B;  1ASW A;  1B92 A;  4G1Q A;  4WQ5 C;  5C10 A;  2YJE A;  3H08 A;  5AQT A;  1OH6 A;  3DXM A;  3WQT A;  4B9V A;  3VQC A;  1EX4 A;  3MK6 A;  4M7Y A;  3VA0 A;  4FLV A;  1GLD G;  3WXJ A;  1C1C A;  1VSE A;  4ISG A;  4CHY A;  5FPM A;  4OGE A;  2KQ2 A;  3GBT A;  4KHN A;  3V1Q A;  1TAQ A;  3CFO A;  4CI6 A;  4FXD A;  2HND A;  5BPL A;  4N76 A;  4YOU A;  4JI5 K;  1YTU A;  3DWL A;  4I7F A;  4FJJ A;  3O9R A;  2FBV A;  1G15 A;  4A2A A;  1JLC A;  1X9J A;  3KKS A;  1GLE G;  4QS7 A;  2O8C A;  5J1E A;  5AQU A;  3BGR A;  4FOE A;  4YOX A;  3BZK A;  1YT3 A;  4BAC A;  4Z0U A;  1SQK A;  5AZI B;  3WXM B;  3J80 O;  4OVL A;  3U4L A;  3VQ8 A;  2FBY A;  5GAH P;  4KFB A;  5DMR A;  1KFD A;  3E1Y A;  1W2B M;  2WC9 A;  1S72 N;  2F9W A;  4BRQ A;  1S6P A;  1VRT A;  3SQ2 A;  3VQ5 A;  2HMI A;  3B6P A;  4WE1 A;  2JWL A;  4RTF D;  2A1R A;  3KLE A;  1BL3 A;  4FLU A;  1WLJ A;  2PYJ A;  4DR5 K;  3NF7 A;  1S1W A;  4C8N A;  4NB4 A;  2E88 A;  3MXI A;  3ZX3 A;  5JLH A;  2O8F A;  4DR3 K;  3ZT2 A;  1Q86 O;  1EWQ A;  4E7J A;  3ENB A;  4L3Q A;  1YTA A;  4WCE L;  3BDP A;  4GV3 A;  3ZT3 A;  4W5R A;  3AVB A;  4PWD A;  3MED A;  3D0P A;  1RBS A;  1TK8 A;  4GY2 B;  2HVI A;  1E4F T;  4IOC L;  1VAZ A;  4J2B A;  3M8S A;  4JI4 K;  4IO9 L;  1HYS A;  2CGK A;  3SPZ A;  4OO1 J;  2O8C B;  2OPQ A;  2P9U A;  1YI2 N;  1VSD A;  1NNE A;  2QWR A;  4F2S A;  3SAG A;  4BDY A;  1U2V B;  4G9Z A;  3C6A A;  4BC2 A;  3S41 A;  4HCB A;  5AQO A;  2BGG A;  3R9P A;  5AQX A;  2HOE A;  4JI3 K;  3NGZ A;  3D2E A;  4AHR A;  3G71 N;  1MA9 B;  1MU2 A;  1TAU A;  3LZJ A;  1EWR A;  3A5N C;  3K57 A;  4BVP A;  3DLK A;  5FDL A;  4WFB L;  4FM0 A;  4B3O A;  4GV6 A;  3CM5 A;  3L4Q A;  4FOI A;  5HRS A;  2BE2 A;  2XY7 A;  4OPA A;  2GUI A;  5FPD A;  1J9A A;  3HBT A;  2QWN A;  4FO0 A;  1UA1 A;  3AVN A;  2Z1I A;  4R79 A;  3SV4 A;  4EAH D;  4IFV A;  3OW2 M;  3MWP A;  3TSP A;  1VQN N;  3BF1 A;  2HF4 A;  2YV0 X;  3QFP A;  1RT4 A;  2OTJ N;  1NMN A;  4BRM A;  4ELT A;  1VSM A;  1C6V A;  1CZB A;  2E2P A;  3QIO A;  2F8S A;  3OYB A;  5JLF A;  3CER A;  3UB5 A;  2F96 A;  2D5R A;  1QHA A;  2Y1I A;  1XQS C;  4I9Q A;  4LC9 B;  4IOA L;  2F4V K;  2HHX A;  1NKE A;  3TAE A;  4IJN A;  4NCB A;  1BQN A;  4YOV A;  4CK2 A;  4KB1 A;  4KHP K;  1IKW A;  1P8Z A;  3TSU A;  1TYQ A;  5J2N A;  1NJW A;  3I33 A;  3HT3 A;  3QIC A;  3RWU A;  3SBT A;  3KLI A;  3P1G A;  1U6Z A;  5KGW A;  3OTO K;  3SJJ A;  4B9S A;  3QNO A;  3DLL L;  3HST B;  4PL8 A;  1N5Y A;  3TAQ A;  4YOR A;  2QTD A;  1CXQ A;  2WON A;  4OPJ A;  1QQO A;  3VER A;  4MDA A;  4KRF A;  3AVC A;  4GVE A;  4DS4 A;  3OA9 A;  4JD2 B;  4CJ3 A;  3OYL A;  3VA3 A;  3CC2 N;  2NRZ A;  1RDA A;  1VSK A;  4DLE A;  5C42 A;  1NK8 A;  3W3D A;  5ADX H;  4DV3 K;  4K8X A;  2ZQB A;  1JKH A;  1JLB A;  2YHW A;  4CGH A;  4DV2 K;  1SZ2 A;  3V9Z A;  1VQ6 N;  4M3U A;  4NLB A;  3P5J A;  4W5N A;  2KKZ A;  3PY8 A;  3HOS A;  1ITG A;  3QIN A;  2ZGY A;  2FBT A;  4GNI A;  4DQI A;  3AVG A;  4UY8 O;  5LY3 A;  3SQ0 A;  3VF6 A;  1QQN A;  1HRH A;  5E26 A;  3J7Z O;  3E9P A;  3UKU B;  4DR2 K;  4BRF A;  4LSN A;  1NK7 A;  2PBD A;  3SK3 A;  3SAH A;  3CCV N;  2HST A;  4WQ5 A;  5HRR A;  4CD1 A;  3CQY A;  3VES A;  3O9Q A;  2NUB A;  4CK1 A;  2IGI A;  1VQO N;  1NGH A;  3EZW A;  1SUQ A;  3L2V A;  3FZK A;  1BQM A;  3Q7C A;  4FWO A;  3P38 A;  4PKG A;  4CJT A;  3K0S A;  4ZHR A;  4FLT A;  3I8B A;  3VMF B;  4BG8 A;  3MWT A;  2YHY A;  4QOZ B;  1U49 A;  1S22 A;  3P31 A;  3U3Y A;  4FLY A;  1TGO A;  4HUF A;  2NLX A;  2GTD A;  3AA5 X;  4ELU A;  3K9J A;  2DPN A;  3K5O A;  1W97 L;  4E89 A;  3KK7 A;  5TKY A;  1V4T A;  4JLH A;  5D3G A;  3V6D A;  3NVK A;  2OZM A;  1W9H A;  1Z6R A;  3ITH A;  4GKJ K;  4CJ4 A;  2BTF A;  1SAZ A;  4JKD A;  2HHS A;  1VQ5 N;  3D6R A;  5AQI A;  2E5L K;  1SKR A;  1JCE A;  4C1N I;  1TK5 A;  5BRH A;  2Z1G A;  3C7N B;  4CEA A;  4LF6 K;  4FVM A;  1IH7 A;  4M3R A;  3H6E A;  1GLF O;  5KRT A;  4I9L A;  3OY9 A;  3ZT0 A;  4F9O A;  3AGK A;  2ITM A;  3LAK A;  5C25 A;  5HRN A;  3OYE A;  4DB3 A;  1EO1 A;  5IT9 O;  2YHA A;  1IO2 A;  3DYA A;  5FRO A;  3O3G A;  4BG9 A;  5KPZ A;  1S6Q A;  3NCI A;  4A57 A;  1Q9X A;  2CGJ A;  2HBM A;  1FXX A;  1OVQ A;  4AHC A;  3GG4 A;  2P9N B;  3AAP A;  4JS5 A;  4QS9 A;  3I56 N;  3RSE B;  3EN9 A;  3FZH A;  4FJG A;  4MDB A;  4JKC A;  2B6A A;  1NGE A;  3CIP A;  3ID6 A;  1IJJ A;  2WUS A;  5LMN K;  1IBL K;  1GLC G;  3KWG A;  2OA8 A;  3CD6 N;  5KI6 A;  3B6O A;  3CET A;  1KC8 O;  3AVJ A;  1KTQ A;  1D9D A;  3IMX A;  5LL6 Z;  4LH5 A;  5EX5 A;  3L0Q A;  3QFU A;  3KD5 E;  4CHN A;  4CF1 A;  1SL2 A;  5DK5 A;  2G8K A;  2RF2 A;  4B1Y B;  1J54 A;  3VQP A;  3MXJ A;  4OJR A;  3VQ7 A;  1XWL A;  1TKT A;  4A2B A;  1YJ9 N;  3M6G A;  4CZG A;  3ZEU B;  3S9H A;  1ESV A;  3RR8 A;  3I8D A;  1BG3 A;  1ZYQ A;  3C65 A;  4BRI A;  4C23 A;  2KZM A;  3DLR A;  1FKO A;  5CYM A;  4M3X A;  3OYN A;  2ZJQ L;  3ZCM A;  3T3F A;  2UXB K;  3G0Z A;  4BGA A;  1C0M A;  2PFU A;  4PL7 A;  1XHX A;  2O8E A;  2VGM A;  3QEI A;  4BY9 C;  4JYA K;  1O1W A;  4A62 A;  4KHY A;  3R1X A;  2XY8 A;  3PX6 A;  4PY5 A;  3M8Q A;  1LAW A;  1WBB A;  3UE5 A;  3NF6 A;  3QIP A;  4CJK A;  1NKC A;  4KPY A;  1NGF A;  1BIS A;  1WSJ A;  3DXK B;  1LWF A;  3C6T A;  4NCG A;  1HKB A;  1BGX T;  3H3N O;  1BI4 A;  4K8Z A;  3HOT A;  1LV5 A;  1YHQ N;  5BR8 K;  3CME N;  3WEE A;  3G25 A;  3BZC A;  3P39 A;  3BEX A;  5CYQ A;  1GLL O;  5F2R A;  4RWT A;  2W40 A;  5ELZ A;  3THY A;  4IO8 A;  3RTV A;  3E66 A;  4CZF A;  4B9L A;  3L2W A;  4O5F A;  3L2R A;  4DSF A;  3CG7 A;  3WNE A;  2QXL A;  1WSI A;  3K9K A;  1Q8I A;  4NCA A;  1KRP A;  3NH2 A;  1OVY A;  3DOL A;  4JKF A;  4WYB A;  2HHW A;  4JV5 K;  1KXP A;  1JL1 A;  1HQU A;  1QS4 A;  1VSL A;  1VQK N;  3MN9 A;  1YUW A;  1GOB A;  1ATS A;  4B1U B;  3A5L C;  4WF9 L;  3DAW A;  3C94 A;  4CVN E;  4JKB A;  2P9K A;  5GIP A;  1T8E A;  1BIU A;  4FLZ A;  4N56 A;  4KTQ A;  4KI4 A;  1KVB A;  3FFK B;  4LH4 A;  4NLC A;  5F0X A;  3ALY A;  3T7Z A;  1WSG A;  3T1A A;  3SUQ A;  1C1B A;  1S1T A;  4DTM A;  5SWM A;  1WAF A;  4NYF A;  4DTR A;  3D2F B;  4JK9 A;  4BRK A;  4CGJ A;  2YHB A;  4DR1 K;  1REV A;  2IAJ A;  1U48 A;  4GMJ B;  3IRX A;  1NGG A;  2O8B A;  1ZBF A;  1W0H A;  4LF9 K;  2RKI A;  3J7Y P;  2CH6 A;  4IFY A;  2XY6 A;  3ISN C;  3KJV A;  5AJ3 K;  3SNN A;  2X6S A;  3AY9 A;  4LSL A;  1NKB A;  1K73 O;  3FLC O;  1A5W A;  2GX9 A;  1R59 O;  4JI1 K;  4CJP A;  3CCS N;  4J8F A;  3HVR A;  3RMB A;  2QK9 A;  4XIU A;  1HUX A;  1ZBU A;  1GLA G;  5C2F A;  3QER A;  2YNG A;  2A41 A;  5FLX O;  4XH4 A;  3QES A;  4Z4E A;  3LZI A;  2RN2 A;  3LP0 A;  4ZTF A;  2VQE K;  4JI6 K;  1IBK K;  3NVM A;  5AZJ A;  5M1K A;  2G8H A;  1BWF O;  4CFB A;  4BRE A;  3LDN A;  4AIL C;  3AGR A;  2FSK A;  4IDK A;  3FE1 A;  4GKK K;  3NBP A;  4YFU A;  4BGB A;  5GAD P;  4XEI A;  3VET A;  3OS2 A;  1DTQ A;  3THX A;  3CF5 L;  1XMO K;  2X74 A;  4KTZ A;  1UAX A;  1YAG A;  4ILJ A;  2DTU A;  1TVR A;  2BAN A;  3PSI A;  2XO7 A;  4W5T A;  3T19 A;  2EX3 A;  3LDO A;  4I6M B;  4ISF A;  4LY7 A;  3TTF A;  3BUZ B;  3PSF A;  3JS6 A;  2A42 A;  1BCM A;  3EKU A;  3EZ5 A;  1Q18 A;  1N33 K;  3SI6 A;  3AVI A;  4FWN A;  4HTU A;  4LF5 K;  3VQ4 A;  4Y1C A;  5IWA K;  4BR9 A;  4HVJ A;  1ZBL A;  3KZB A;  2Q36 A;  4FJM A;  4PHT X;  4CER A;  1NGB A;  2X6N A;  4H4M A;  4CEB A;  1KLN A;  4K25 A;  4M45 A;  3WXK A;  3HP9 A;  3VOV A;  1S9G A;  3L4I A;  4FWR A;  4DHY A;  2CGL A;  4KH5 A;  4XH5 A;  3ZSO A;  5K14 A;  3QO9 A;  5C2D A;  3VF2 A;  3SV3 A;  3L3V A;  5AQP A;  1TKZ A;  3DRR A;  1RTI A;  3ASM A;  3NAE A;  1HNZ K;  3KIO A;  2ITG A;  1D4X A;  2HHT A;  5BRE A;  5KRS A;  3M3Z A;  2P9S A;  4B3M K;  4DTS A;  3THX B;  3DXM B;  1Y64 A;  3TAF A;  2D0O A;  2D4W A;  2IVO A;  1HNW K;  3OYG A;  3TAM A;  3SUO A;  3E01 A;  5ADX A;  3VTI A;  3PIP L;  5HP1 A;  1KLM A;  1ZXO A;  4O44 A;  4Z4I A;  3CCL N;  2GWJ A;  4RW9 A;  1LCU A;  2HNY A;  5AQK A;  2IDO A;  4IXC A;  4CJL A;  5KGX A;  3AAQ A;  1L5U A;  4B9U A;  4IG0 A;  3SUN A;  1WN7 A;  3MAQ A;  3WT0 A;  5J2M A;  4MQ3 A;  4YHH K;  1ATN A;  4DFJ A;  4CGD A;  5AQY A;  3HYF A;  4CHZ A;  3LL3 A;  5AQS A;  3DLB A;  3OYC A;  3F2K A;  1ASU A;  3G4S N;  4KHQ A;  5AQG A;  3K5L A;  2GV9 A;  1IKV A;  4CF0 A;  3O5B A;  3AO1 A;  2HMP A;  1RT5 A;  3EEQ A;  2UUA K;  4BWJ A;  4MFB A;  4DU3 A;  2P9S B;  2UXC K;  1NG9 A;  3LP1 A;  1VHX A;  4BDZ A;  2ZJP L;  4BRG A;  2E6L A;  2ZJR L;  3P83 D;  1IKX A;  4C1N K;  4CGG A;  3O8M A;  1TL1 A;  5HOO A;  1WSH A;  3KLG A;  2Z1J A;  3J8A A;  2O8F B;  3L2U A;  1BA1 A;  4BQL A;  3CCE N;  3ZSX A;  3SUP A;  2O8D A;  4V19 S;  1NOZ A;  4E1J A;  1DTT A;  3OJS A;  1DKG D;  3PO5 A;  1T7P A;  1WBD A;  3AVH A;  1TUY A;  4CE9 A;  1J6Z A;  2ASM A;  5AQV A;  3QBX A;  4IJA A;  1HLU A;  1NGJ A;  3QNN A;  1B9F A;  4O5B A;  3R6M A;  4KHW A;  3VN5 A;  4U7B A;  5CR4 A;  4DSK A;  2CH5 A;  3G6E N;  4DF4 A;  1KVA A;  3HXM A;  2E2N A;  1GLJ O;  3ID8 A;  2P9U B;  5JS2 A;  1NJZ A;  3VEW A;  4BDP A;  2HHU A;  3QEW A;  2A3Z A;  4B3R K;  2QWM A;  4EHU A;  4H0O A;  3NFA A;  4H5T A;  3WUH A;  3I0S A;  5AQM A;  3K59 A;  1IG8 A;  3EKS A;  3ENO A;  4AM7 A;  3DRP A;  1C0G A;  4FJI A;  2QKB A;  4BE1 A;  3VTH A;  2D0P A;  2HF3 A;  3IKM A;  4JKE A;  4O8K A;  3D2E B;  4DTO A;  2OPP A;  1U04 A;  3MCA B;  4CJF A;  3AVM A;  1T03 A;  2PYL A;  5AQN A;  4GV9 A;  1XI1 A;  1OH5 A;  1YVN A;  3BP8 A;  3TAR A;  3N4Q A;  2D0C A;  4OLB A;  1NGD A;  1C0T A;  3RRG A;  3LAN A;  1M90 O;  4CEO A;  1HKC A;  3O9U A;  2V51 B;  3MN5 A;  3O4Q A;  4IEI A;  2P51 A;  4NXN K;  5A2Q O;  2OZS A;  2P9I A;  3KVG A;  3KHY A;  1K8A O;  4B1Z A;  1UOC A;  3WNG A;  3VQ6 A;  1Q9Y A;  1EP4 A;  4KHS A;  1RT1 A;  1BHL A;  3FR0 A;  4BRC A;  5GIO A;  1CLQ A;  2O4I A;  5KPT A;  1HJO A;  1K8K A;  3MMV A;  4BQZ A;  2HHH K;  3JXU A;  5C12 A;  1V4S A;  2GBZ A;  3L8B A;  2J4R A;  4YOY A;  1W7A A;  1NOY A;  4BRN A;  3SBG A;  3SMS A;  3PV8 A;  2G8W A;  1S1V A;  2QWL A;  4B9T A;  1QSY A;  3EL2 A;  4U67 L;  4B3S K;  4A5B A;  1RBT A;  1RDC A;  5GAE P;  1EQY A;  4CJS A;  4K42 A;  4BRL A;  3GDQ A;  5CY4 A;  1TYQ B;  3D7E O;  4DLG A;  2UUB K;  2VWB A;  2JWK A;  5AQZ A;  3CQX A;  5HLF A;  2KLA A;  4BVO A;  1WAJ A;  4E3S A;  3TAG A;  1RTH A;  3H45 C;  4E19 A;  3HP6 A;  5LMU K;  2D0A A;  3B8A X;  1F21 A;  1ASV A;  4IZ9 A;  4CFA A;  5FRN A;  3P4I A;  4DV0 K;  1HQE A;  3VEO A;  3KLF A;  3U8X A;  4FLW A;  2IOC A;  2P9I B;  5AQQ A;  4NYN A;  1NBW A;  3ZSZ A;  3VPZ A;  2QA4 N;  4OKK A;  4AQY K;  1KCF A;  4FJ5 A;  1QQC A;  3KK1 A;  3QEV A;  3U9D A;  4CIG A;  4CZJ A;  4AF1 A;  1XMQ K;  2E4L A;  3ULD A;  1FW6 A;  4CJU A;  2BH1 A;  3SQ4 A;  2VG6 A;  3BF3 A;  4A61 A;  2QWO A;  3CQ8 A;  4X66 K;  3H1Q A;  4JKH A;  2OTL N;  1NWK A;  5M1P A;  1KAZ A;  3ZX0 A;  4CJR A;  2DFH A;  5CE3 A;  1D9F A;  3ZSR A;  3AA3 A;  2I7P A;  2NRV A;  3O1W A;  3A5M C;  1ZBH A;  4DR6 K;  4JAX A;  1NK5 A;  4BRA A;  4RW6 A;  3AVA A;  4E1N A;  4BC4 A;  1VQ4 N;  2LSN A;  2E1Y A;  4CF2 A;  2WFB A;  4Y0W A;  3HO1 A;  1LAV A;  2W6K A;  1VQ9 N;  3QEP A;  1HR0 K;  2A40 A;  4DUY K;  4QAG A;  1NK0 A;  3PX0 A;  1XUP O;  4CEF A;  3CM6 A;  3E9L A;  2DFE A;  2VYP A;  4KAZ A;  4DQS A;  4F3T A;  2JLE A;  2QWP A;  1NU0 A;  1HKG A;  1BIZ A;  2A5X A;  3GOI A;  4BC3 A;  1K9M O;  2G8F A;  3M8R A;  4FWQ A;  4DU4 A;  3AO5 A;  2Q0U A;  5HRO A;  1TV6 A;  4JS4 A;  3THV A;  3R3L A;  2NRW A;  1HPZ A;  2D0B A;  1L3U A;  3CCU N;  3ZYY X;  4IWV A;  4PKI A;  2UU9 K;  1CZA N;  1N36 K;  3VEZ A;  3CFP A;  4E7I A;  4E0D A;  2HBJ A;  1RT7 A;  4JRP A;  1O13 A;  5F1X A;  5AFU H;  3AVL A;  2XRI A;  4KV8 A;  3ULE A;  3EYZ A;  3V4I A;  4DFM A;  2BUP A;  4L8R B;  3OJU A;  5HBM A;  4DU1 A;  4BRP A;  4BR2 A;  3ENH A;  4J2E A;  4KO0 A;  4DG1 A;  2HBK A;  5BRF A;  3OYA A;  5MLC Q;  2PAV A;  4B8A B;  3O08 A;  1BCO A;  3OBW A;  4F3O A;  1CXU A;  2NRR A;  3KKR A;  3FGU A;  3ZT1 A;  1RTJ A;  4B3T K;  3TTC A;  1RGI A;  3OYJ A;  4B9Q A;  3TU5 A;  4CHO A;  5JIC A;  4DSJ A;  3LDQ A;  1EET A;  1LW2 A;  3LDP A;  1HX1 A;  1X9W A;  1MWM A;  3LWL A;  1RT3 A;  2FXU A;  2QW9 A;  2NRX A;  4DV6 K;  2HVH A;  1T6C A;  3Q7B A;  4Z4F A;  2D1K A;  1DLO A;  1H1V A;  3HRG A;  4DFK A;  3UIQ A;  2A6A A;  3R8E A;  3MX5 A;  4H4O A;  3FFI A;  2ZE2 A;  2GUP A;  3CCQ N;  3TR8 A;  3TTD A;  1QSS A;  1Q82 O;  5BR9 A;  4FJL A;  1TK0 A;  2NRT A;  4FWM A;  3OS1 A;  3OYF A;  4H03 B;  2O4G A;  4DFP A;  3PLA A;  1KAY A;  4FPB A;  3H46 O;  1FK9 A;  3M8P A;  1YIJ N;  2NNW A;  4WQ4 C;  1HYZ A;  4B1X B;  4RG8 A;  1X3N A;  3CJC A;  1U47 A;  1JCG A;  4JI7 K;  2ASO A;  2O8E B;  3PX4 A;  2Q0R A;  2V7Z A;  3OYM A;  4B9M A;  1DT9 A;  4JK8 A;  4DUZ K;  3IG1 A;  1A5X A;  1RBU A;  3CC7 N;  4HHT A;  4RCH A;  4JHD A;  4F8R A;  1SKW A;  3HTV A;  4O8U A;  1BI4 B;  4FZY A;  4X65 K;  3A8Y A;  1FJG K;  3NF8 A;  3AV9 A;  3LAL A;  4AHT A;  4IKF A;  3NF9 A;  4AHU A;  4CJ5 A;  3K58 A;  4DR7 K;  3WEE B;  4CK3 A;  2KFZ A;  1NGI A;  3THY B;  1T6D A;  3VQE A;  4H0V B;  5AR0 A;  1YVU A;  3HM9 A;  2W42 A;  4BR7 A;  4J2A A;  2G8V A;  4ELV A;  5J2P A;  3DM2 A;  1BUP A;  3K2P A;  1NM1 A;  4FW1 A;  2GWK A;  4IFE A;  3WNH A;  1ZBS A;  5M1Q A;  3HZ6 A;  4CGI A;  5M1F A;  4M41 A;  4ID1 A;  3S3M A;  1XC9 A;  4BR5 A;  1FKP A;  1IV0 A;  3C6H A;  4CZL A;  1JXE A;  1NLV A;  3AA2 A;  3ZET A;  4FM1 A;  3O1B A;  4C8M A;  1RDB A;  2QKK A;  2Q3S A;  1I94 K;  4DQP A;  3SZ2 A;  3G10 A;  4ZTJ A;  4CF8 A;  3RRH A;  1QHT A;  2JGU A;  3THW A;  1J5E K;  1XNQ K;  4CW7 B;  2FLO A;  1BOT O;  5H1S Q;  4W5O A;  1QTM A;  3L6Q A;  3MEG A;  4JK7 A;  2P9K B;  5TKW A;  4YY3 K;  1BA0 A;  1Z26 A;  1DEJ A;  3AO3 A;  1WOQ A;  1SL1 A;  2YKM A;  1NJI O;  1HJR A;  2IVN A;  3EO3 A;  4PUO A;  1GLB G;  5SZT A;  3O4N A;  5LJW A;  4KI6 A;  1Q7Y O;  5EOY A;  4RW8 A;  2R7Y A;  4HWI A;  5JS1 A;  4JI0 K;  3A2F A;  3H1V X;  5AZI A;  3UKR A;  2O8B B;  5EU7 A;  4WFA L;  2HHV A;  4DSE A;  1RT2 A;  3O80 A;  3MEC A;  1VRU A;  2RE2 A;  4HUG A;  2VWK A;  1L3V A;  2GEL A;  3VQA A;  1YIT N;  3F9M A;  5BN9 A;  4CD3 A;  3IAY A;  3O9S A;  4UQG A;  4FJH A;  4Z4C A;  1JLG A;  4CBU A;  4XH1 A;  5AQJ A;  1OH8 A;  3MCP A;  2B5J A;  1XHZ A;  4LF7 K;  1J53 A;  3NH1 A;  3O3F A;  1J5O A;  4MO4 A;  2F7T A;  3PIO L;  1LWE A;  4FSV A;  4DQ8 A;  1JLF A;  4GW6 A;  3SJH A;  3CJ7 A;  1X9S A;  1SKS A;  3NGY A;  4DV7 K;  4JKA A;  3HVT A;  4HTL A;  1GOA A;  5AZJ B;  1ILY A;  1JLA A;  3AA4 A;  3SCX A;  4M63 C;  4Z94 A;  4FM2 A;  4FJK A;  4JRQ A;  4X64 K;  3LAM A;  4J2D A;  2VGN A;  2RHK A;  5E84 A;  4Q0B A;  1N32 K;  4IBN A;  3LDL A;  4ILH A;  5BRD A;  1WNS A;  4FJX A;  2YNH A;  3UKR B;  1OH7 A;  3CCJ N;  5M1O A;  5C15 A;  4DWI A;  1C0F A;  1U2V A;  4I2Q A;  3AO2 A;  4H0P A;  3CI5 A;  4O0J A;  4DTX A;  3VQ9 A;  4FZZ A;  4JI2 K;  2VWJ A;  2Q31 A;  4LFC K;  3VEX A;  2DFF A;  4FJN A;  1JLE A;  3QDK A;  2HBL A;  4BRH A;  3K5M A;  4EIA A;  2E2O A;  2FSJ A;  1C1A A;  3V9X A;  1EKE A;  2NRH A;  3AO4 A;  4R5P A;  2HNZ A;  4FJ8 A;  4DS5 A;  5CZ1 A;  2A1S A;  1QVF M;  5BPN A;  4CEC A;  2Q2R A;  2IVP A;  1QSL A;  4LFA K;  4IEE A;  2P5G A;  2ATQ A;  4M3Y A;  3ATU A;  4B1V A;  3HPH A;  3MN7 A;  1NJX A;  3VGK A;  4ID5 A;  2P1J A;  3S3N A;  1IKY A;  3DOK A;  4KB0 A;  1VSJ A;  2KW4 A;  3CPW M;  1RFQ A;  5AQR A;  4AHV A;  2WTU A;  4B9N A;  3AAR A;  3C0B A;  4LF4 K;  1RCH A;  4WQ4 A;  2KFN A;  2V52 B;  3DJC A;  4Z4G A;  1TUU A;  2QEX N;  4IG3 A;  4OX9 K;  3ZSQ A;  3DRS A;  4Q5V A;  1QVG M;  2W6L A;  2QWQ A;  3OBY A;  1L3S A;  2OPS A;  2YX6 A;  3KK2 A;  1D8Y A;  2WOM A;  2UYT A;  4OKE A;  4HUE A;  1U45 A;  4FPA A;  4H0T B;  3RMC A;  3CHW A;  2RPI A;  1ZC6 A;  3M1F A;  3WXI A;  4BRD A;  4JI8 K;  3IUC A;  3O4W A;  3CFR A;  1VQ8 N;  4CCH A;  3KD1 E;  3SMP A;  3DMJ A;  4DV4 K;  1X1P A;  3NHG A;  4FW2 A;  4MO5 A;  3OYI A;  5AQH A;  1MWK A;  4KBO A;  4DV5 K;  3TWH A;  1N8R O;  1NGC A;  4JD2 A;  4C8K A;  4BR4 A;  2GEM A;  2V7Y A;  2WBN A;  4YNQ A;  1Z05 A;  4JEP A;  3O9T A;  4DV1 K;  4NXM K;  4FCY A;  2E6M A;  1WSF A;  4CJ7 A;  1A5V A;  5BPM A;  2YNI A;  2YJF A;  5AQL A;  5JVG L;  3BY5 A;  2AP1 A;  5CHI A;  3WXL A;  3PUF A;  4F2R A;  1HNV A;  4FK0 A;  4W5Q A;  4DQR A;  5FPE A;  3LPT A;  3WQU A;  2ZWH A;  3PO4 A;  4CIE A;  5DM6 L;  2YCH A;  4O0I A;  2O8D B;  4FLX A;  1X9M A;  5AQF A;  3NMU A;  5I9E B;  4LD0 A;  3JYT A;  4B08 A;  4EZ6 A;  3UKU A;  5E41 A;  1NJY A;  3CJ1 A;  5JVH L;  1VQM N;  5EXW A;  2XY5 A;  4CEZ A;  3MXM A;  1P90 A;  2E1Z A;  4CZK A;  1RBR A;  2Z1H A;  4EP4 A;  5KQD A;  3CCM N;  3CCR N;  4N41 A;  3LDS A;  4FYD A;  1KSP A;  2OCE A;  2OYQ A;  4YDU C;  4YOT A;  1RNH A;  3ZX2 A;  4CZI A;  4CES A;  1RTD A;  1NGA A;  2Q1N A;  5AFU A;  3DLH A;  3OHR A;  2ZM6 K;  4DSL A;  4K43 A;  3EY1 A;  3DLE A;  3OVN A;  3ZT4 A;  3NGI A;  2I5J A;  1DGK N;  3AVK A;  1XC3 A;  4CJE A;  2QI2 A;  3IDH A;  4FJ9 A;  3MEE A;  1I39 A;  1T05 A;  5KPR A;  3C95 A;  3EE8 A;  2FF6 A;  1S9E A;  5JMV A;  1G99 A;  3OS0 A;  1NMD A;  5DM7 L;  4H5N A;  1T3V A;  1VK0 A;  1VQ7 N;  3O6W A;  2VG5 A;  3CYM A;  1QE1 A;  2FC0 A;  2VCP A;  5AQW A;  1QZ6 A;  2ZGZ A;  3ZSY A;  1M1K O;  4B1W B;  4M42 A;  3TAB A;  2YNF A;  3ATV A;  4ICL A;  1TL3 A;  3C7N A;  1K8K B;  4JKG A;  5EY4 A;  1TKX A;  2EWS A;  2E2Q A;  4H5W A;  4H5R A;  1EXQ A;  1RIL A;  5LJV A;  3H3O B;  1VQP N;  3LM9 A;  4BR0 A;  3JSM A;  2KTQ A;  1Q81 O;  4KRE A;  2F9T A;  4PA1 A;  1S1X A;  4HCC A;  3A5O C;  1E3M A;  3QB0 A;  4KHU A;  5HRP A;  1ZBI A;  2OPR A;  1UWB A;  3DLG A;  2P9N A;  3CPE A;  4OKJ A;  3SAF A;  3S3O A;  3WNF A;  1VSH A;  4JN4 A;  4OPK A;  3RSE A;  2IC3 A;  3SYZ A;  3KK3 A;  1R0A A;  4OLA A;  5FPN A;  4DTN A;  3U9Z A;  3SLC A;  4DSI A;  4C8O A;  3I0R A;  2EHG A;  2FBX A;  2VG7 A;  1YF5 L;  3T1H K;  1I3A A;  1NK6 A;  3ZSW A;  3V1O A;  4E7L A;  3L2Q A;  3SQ1 A;  4EP5 A;  1WSE A;  3QML A;  3K5N A;  4CEE A;  3VQB A;  1IBM K;  4JKG B;  3ZEU A;  1U4B A;  4PKH A;  4OPH A;  3O3H A;  4FK2 A;  2UXD K;  1WB9 A;  2ZD1 A;  2YKN A;  2G8I A;  3TSQ A;  5J2Q A;  1XNR K;  5GIN A;  2FSN A;  4DQQ A;  4N5S A;  3I55 N;  1K6Y A;  1KQS M;  4FWS A;  3CJA A;  2P5O A;  1RDD A;  3D45 A;  3EE9 A;  4N47 A;  4M3T A;  4I2P A;  1C0U A;  4CJQ A;  4TSX A;  1L3T A;  4E1M A;  3V81 A;  4AHS A;  2XHB A;  5KTQ A;  5B8H A;  1N34 K;  1QZ5 A;  3HPO A;  4FJ7 A;  4K41 A;  4KH6 A;  4BRO A;  4CZE A;  3J81 O;  4FVU A;  1BDG A;  3DXK A;  3HJF A;  4BC5 A;  3VF4 A;  4DKW A;  1B9D A;  3MN6 A;  3TAN A;  1N6Q A;  1SL0 A;  1E4G T;  1SV5 A;  5I42 A;  1SS6 A;  4LFB K;  4DMN A;  3M5R A;  3JAM O;  1Z25 A;  3OYD A;  3U3G A;  3V9S A;  3V1R A;  3LPU A;  5KQ8 A;  2I7N A;  3VGL A;  2E20 A;  3HSC A;  4DCH A;  4H0X B;  3QLH A;  3N4P A;  3HPG A;  4A59 A;  1WUA A;  2IS3 A;  3ZLJ A;  3HI0 A;  3FZM A;  2PY5 A;  1CZ9 A;  4E7H A;  1VSI A;  2QXF A;  3FZL A;  5CZ2 A;  1HNX K;  2HHQ A;  4CBX A;  4Z4H A;  1KVC A;  1X3M A;  1HYV A;  3RVC A;  3DI6 A;  3V9W A;  1BU6 O;  3VEN A;  1D5A A;  1JCF A;  2ZF5 O;  1NK4 A;  4YOW A;  4CZM A;  4DTP A;  4Y1D A;  3F9K A;  2OAN A;  2YI1 A;  4EFH A;  2IIR A;  3LP2 A;  4BWM A;  3ULE B;  4DTJ A;  4CZH A;  3TPQ A;  3NDK A;  2DY4 A;  4O4G A;  4IOX A;  2P9L A;  3TAP A;  4KKO A;  4B8C A;  4ILG B;  3CJB A;  4FZX C;  4H5V A;  3GL1 A;  4FWL A;  3ZSV A;  4JNE A;  4CIF A;  4E7K A;  4FWP A;  1KAX A;  4H8K A;  2W41 A;  3CJ9 A;  2ETJ A;  3IS9 A;  3E9O A;  2UUC K;  2YHX A;  5C0Y A;  3VQQ A;  3AVF A;  1KD1 O;  4M3W A;  4CJV A;  4CFD A;  4MLH A;  2P9P A;  4MLE A;  2BDP A;  4FWK A;  4CJW A;  4EHT A;  2HW3 A;  3D2F A;  4H0Y B;  4CHP A;  3CMA N;  4OGC A;  4ISE A;  4BE0 A;  2F8T A;  1MDU B;  4RW4 A;  4BE2 A;  2VQF K;  5EVZ A;  2AA4 A;  4C8L A;  3IFR A;  4GVM A;  4YDU A;  4AM6 A;  2H3G X;  4DR4 K;  4A5A A;  1VQL N;  2QM1 A;  4QS8 A;  3F5T A;  3QEX A;  3HL8 A;  5M1N A;  1TKD A;  1S3X A;  1UA0 A;  2Q97 A;  3T69 A;  4WFN L;  2NZT A;  4O55 A;  1LWC A;  3TI0 A;  4X62 K;  3FZF A;  3RMA A;  1JXB A;  5BN8 A;  5I3U A;  3J7A P;  2ASP A;  3QBW A;  1LW0 A;  3T1Y K;  2AJQ A;  5T7B A;  1RT6 A;  2B4J A;  2P9L B;  1S5J A;  3VQD A;  3KWI A;  1HNI A;  4CED A;  2FF3 B;  1T44 A;  2KZZ A;  3OYH A;  2HB5 A;  3HK2 A;  3KTQ A;  2Y1J A;  1ATR A;  3HM8 A;  1YJN N;  4RW7 A;  3KLH A;  1JL2 A;  1HMV A;  2P9P B;  1NK9 A;  3VEV A;  4CFC A;  2KHO A;  3LP3 A;  1JLQ A;  3OYK A;  1GOC A;  1LOT B;  3RR7 A;  3NH0 A;  5GAG P;  2G8U A;  3MX2 A;  1RBV A;  3NE6 A;  3W0L A;  4CEQ A;  4JHD B;  4LF8 K;  3GE1 A;  5FRM A;  4CGF A;  4IDH A;  1RDW X;  1S1U A;  3LM2 A;  4NO7 A;  3QET A;  1BO5 O;  4I6M A;  1YJW N;  1KFS A;  4K0K K;  3L3U A;  4M3Z A;  2PZS A;  1HPM A;  4PQU A;  4DTU A;  4AH9 A;  4KH4 A;  3VGM A;  1RDU A;  4CBW A;  1Y97 A;  4EZ9 A;  1QQM A;  3VEY A;  1JJ2 M;  1YXQ A;  4FL9 A;  1IG9 A;  1VSF A;  5C24 A;  3CC4 N;  2E8A A;  3LWM A;  3CXC M;  3MDQ A;  3A0I X;  4DF8 A;  3V9U A;  3RMD A;  4CF9 A;  2X78 A;  3U6F A;  4KTW A;  4F4K A;  4FK4 A;  5HL7 L;  4CHQ A;  4M7X A;  3C6U A;  3ZET B;  4QCL A;  1OKJ A; 
#chains in the Genus database with same CATH homology
 4DR4 K;  4JI8 K;  3J81 O;  4B3T K;  5FLX O;  4DV3 K;  5IT9 O;  4X64 K;  4X66 K;  4DV2 K;  4DV4 K;  4X62 K;  4LFB K;  1N32 K;  2VQE K;  4DV5 K;  4JI3 K;  4JI6 K;  1I94 K;  1IBK K;  3JAM O;  3J7A P;  3T1Y K;  4DR6 K;  4NXN K;  1J5E K;  5A2Q O;  4DV1 K;  4NXM K;  4DV6 K;  1XNQ K;  4CW7 B;  4YHH K;  4JI5 K;  4GKK K;  5LMN K;  1IBL K;  4JI2 K;  4DR2 K;  4YY3 K;  4JV5 K;  4LFC K;  1HNX K;  1HR0 K;  1XMO K;  4DUY K;  2HHH K;  5LL6 Z;  2UUA K;  3J80 O;  2UXC K;  4CVN E;  4B3S K;  1N33 K;  4LF8 K;  4LF5 K;  4JI7 K;  5IWA K;  3T1H K;  2UUB K;  4V19 S;  4K0K K;  4JI0 K;  4LFA K;  2F4V K;  4DUZ K;  5LMU K;  1IBM K;  4DR5 K;  2UU9 K;  2UXB K;  2ZM6 K;  1N36 K;  4DV0 K;  4KHP K;  4DR1 K;  2UUC K;  4X65 K;  4DR3 K;  1FJG K;  2UXD K;  4JYA K;  1XNR K;  4B3R K;  4LF4 K;  4LF9 K;  1HNZ K;  4AQY K;  3J7Y P;  3OTO K;  4DR7 K;  4LF7 K;  4OX9 K;  4B3M K;  4GKJ K;  1XMQ K;  4JI4 K;  5AJ3 K;  2E5L K;  4JI1 K;  5BR8 K;  1HNW K;  4DV7 K;  4LF6 K;  2VQF K;  1N34 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...