1N32K

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1n32K00
4LFAK 2UUAK 1N34K 4JYAK 4DR1K 4LFBK 4DV1K 1N32K 3T1HK 4JI1K 3J81O 4LF5K 5LMNK 4JI2K 2HHHK 1XNRK 1N36K 4KHPK 4DV7K 1FJGK 2UXBK 4JI0K 4DR2K 2VQEK 1HNWK 4JI8K 4B3RK 3J80O 3T1YK 2VQFK 4LF7K 4X62K 4DR3K 4JI6K 4DUYK 4DR5K 4YHHK 5LMUK 5AJ3K 2ZM6K 1IBKK 2UUBK 1IBLK 4LF6K 4OX9K 4CW7B 4GKKK 4NXMK 4CVNE 2UUCK 3J7YP 4DV4K 4B3SK 4LF4K 4DV2K 3OTOK 4LFCK 4JI4K 4LF9K 2F4VK 5A2QO 4DV5K 4YY3K 1XMQK 1IBMK 4X65K 2UXDK 4DV3K 5FLXO 4GKJK 5BR8K 4DV6K 4DR6K 4DR7K 1HNXK 4JI3K 1HNZK 4NXNK 4B3MK 4DR4K 3J7AP 4DUZK 1I94K 1J5EK 5LL6Z 3JAMO 4DV0K 4LF8K 4AQYK 2E5LK 4JI7K 4X64K 4B3TK 2UXCK 5IWAK 4JV5K 1N33K 2UU9K 5IT9O 4JI5K 1XNQK 1XMOK 1HR0K 4K0KK 4X66K 4V19S
chains in the Genus database with same CATH superfamily
5BN8A 1Z26A 4TSXA 2YHWA 5MLCQ 4GY2B 1C0GA 2VCPA 3NH0A 1OH6A 3WEEA 4LFBK 4FPBA 3QIOA 1RDAA 1ASWA 2HHXA 1E3MA 1BWFO 2E8AA 1IKXA 2RHKA 2HVIA 3DOKA 3NVMA 1HMVA 1SV5A 3KJVA 1SKSA 4DSLA 1OKJA 1RTHA 3H08A 1YI2N 4ZTFA 1L3UA 2VQEK 5J2NA 2KFNA 4A2AA 2A6AA 3UKUB 3DXMA 4ILGB 3FZLA 3RWUA 1KLMA 4BVPA 3M8SA 4F2SA 1IBKK 1RT7A 4LF6K 2ZE2A 4KH6A 3C65A 1TV6A 1J53A 3AO3A 1NMNA 1OH5A 3DXKA 2FSNA 2E2OA 3V1RA 4C1NK 3OTOK 3CCSN 1Q9XA 4B9QA 2WONA 3NGZA 3VQEA 4BACA 3M1FA 4WFBL 3LAMA 4MDBA 4A62A 4JHDA 4FLVA 4CJQA 3WXJA 4FWNA 4DR7K 3NAEA 3P38A 4DTOA 3VF6A 3A8YA 1WSJA 3LWMA 1CZBA 3TTFA 1ITGA 3LALA 4CERA 3H1QA 4A61A 2EX3A 4PKGA 2EWSA 2XY7A 1BOTO 3G0ZA 5FPEA 3SJJA 3U8XA 1D9FA 3F2KA 1ATSA 3FZMA 5HRRA 4BRMA 1LAWA 4MO5A 3SAFA 3R3LA 1K8AO 4F4KA 4KFBA 3AVJA 4BROA 4O5BA 1BDGA 4CF8A 3EE8A 4Q0BA 5M1PA 3VQ6A 3NVKA 2QK9A 4O4GA 2O4GA 5AQWA 1YHQN 1QS4A 1XC9A 3GDQA 3A5OC 3OS0A 4BRNA 5AZIA 4CFBA 3CJ7A 3KWGA 2KZZA 2KLAA 4L3QA 1QQOA 3QEWA 4HCCA 1EKEA 2ZGYA 3C6TA 3WQTA 4R79A 2HMIA 4CEEA 1QVFM 2OTLN 1C6VA 4FM1A 3IAYA 3U9ZA 3ZLJA 3JSMA 3A5NC 2HHHK 2FXUA 4RTFD 4BRIA 2P9KB 3IRXA 4DTSA 1ATNA 3KKSA 1BIZA 4W5TA 4N76A 4FJ9A 3O9UA 1L5UA 4M3XA 4BR4A 1NK5A 2V52B 1NJZA 2GTDA 3OYAA 3ZSZA 4YHHK 5C2DA 4FO0A 3C94A 3SBGA 4IBNA 4KH4A 2KHOA 5HLFA 3CETA 3C6HA 4JD2B 1S1UA 1N6QA 2O8DB 3VQPA 4BQZA 1MU2A 4E7KA 1W9HA 4LFCK 2HOEA 2I5JA 3SQ0A 1ESVA 2G8VA 3H6EA 3QETA 4YY3K 2HNDA 4PA1A 4X65K 2ZGZA 3TSPA 5HRNA 3THYA 1GLDG 3I0RA 2PY5A 1HJRA 4JKEA 4IKFA 2XRIA 1U6ZA 1YAGA 5BR8K 2BANA 1NKEA 4CBUA 2P9PB 1RDBA 3H1VX 4JKDA 3OYLA 3CM5A 2YI1A 1NM1A 3SBTA 3HPOA 4JAXA 5AQIA 3HM8A 3ALYA 1V4SA 4M3UA 1SZ2A 2Q2RA 5AQLA 4X64K 5GADP 2D5RA 2YJFA 3MDQA 2KQ2A 4JKCA 2R7YA 1YVNA 1NGCA 4JKFA 1VRUA 4AHTA 2BDPA 4H5WA 5EY4A 4BGBA 4U7BA 4EP5A 2ZWHA 3LDQA 4B8CA 4BG9A 1VQLN 1VSFA 4FW2A 1HUXA 4CJEA 3QERA 3EEQA 1XQSC 2XHBA 3HI0A 3O6WA 4N47A 4FVUA 3CJ1A 1HJOA 5EU7A 3O5BA 3M8QA 1VQKN 3LP2A 5EOYA 4NYNA 1BI4B 2IAJA 4JRPA 3TWHA 2FF6A 1VSJA 3OBYA 1KQSM 1C0TA 1WSHA 2QTDA 4QS9A 1HNWK 1K6YA 4BR9A 5HP1A 4CHQA 3N4QA 4FK2A 1KAZA 3ZSYA 5AQTA 4AHCA 4A59A 5F2RA 1JLGA 3WNEA 1YIJN 4L8RB 4IJNA 4BRAA 4DF4A 1CXQA 2A1RA 2UUBK 4HUGA 2YNHA 4CEOA 3I33A 1BQNA 1T3VA 3SMPA 3VEZA 3ZT0A 2FF3B 4BDPA 1RNHA 3ZT2A 3NH2A 4LF4K 4IOXA 2JGUA 1NK7A 1YT3A 3M5RA 2Z1JA 1FW6A 2ZJQL 2FC0A 3V4IA 1ATRA 4NB4A 4B9LA 4JKAA 1KVAA 4CIFA 3ZT4A 3LAKA 3DLGA 5BRHA 4FLUA 4M3YA 1N5YA 1GLCG 4CFAA 3KK2A 3P31A 5AQOA 4C23A 3ULEA 3Q7BA 1HNVA 4IO8A 4CF0A 2CGKA 2YX6A 3D2EB 3G6EN 2FBYA 2GUIA 3TSUA 5SWMA 2Q3SA 1RT2A 3E9LA 1NJXA 3CMEN 5I9EB 3MCAB 2UU9K 4O55A 4FCYA 4H5VA 5DM7L 3CQ8A 4IFEA 1TKZA 4KI6A 2HNZA 4MLHA 3PLAA 4B1VA 1WUAA 2P9SA 2O8FA 1HPZA 4OPAA 3QESA 2E4LA 3THWB 4I7FA 3QB0A 4CCHA 1VK0A 1M1KO 5HROA 3VQDA 2OPRA 5BRDA 5J2QA 1BCOA 2V7YA 3QINA 1H1VA 4IG3A 4CZFA 4OGCA 4FJLA 1EQYA 4LF7K 2DTUA 3OW2M 2WTUA 3K5NA 1VSHA 3PO4A 3EYZA 5E41A 1T03A 2O8EA 4JK8A 4CHPA 4CZLA 3MWTA 3M8PA 2IIRA 4LC9B 1QVGM 5ADXA 3DAWA 1NGIA 2E2QA 3S3MA 4B3SK 1T6DA 3O8MA 2NRZA 3FLCO 1HPMA 3ATUA 1NGFA 4W5OA 4OPHA 1E4GT 4BREA 4H0XB 4BY9C 4M42A 4DTPA 1MWKA 1VQ6N 3C7NA 1G15A 4C8OA 3OYFA 3LDPA 4CJTA 2CGJA 2UXDK 1WB9A 3F73A 1ZXOA 1HYVA 4CBXA 1TYQA 4FWRA 4O8UA 1P90A 2XY8A 2HHWA 1GLLO 3CG7A 1FXXA 3MK6A 5BPNA 3G4SN 2HVHA 1VQON 4H8KA 3HL8A 2QKKA 3LDSA 1ZBIA 4DTUA 2ASMA 4JI7K 5HOOA 4A5BA 2CH5A 3V1QA 1DTTA 3DJCA 3DRPA 3QFPA 3QMLA 3I0SA 3HM9A 3RTVA 4YOXA 1SKRA 3AVCA 5HRSA 2P9LA 1RCHA 3CHWA 3HP6A 3EZWA 2B5JA 1RT6A 1IH7A 4CIEA 1SKWA 5CZ2A 2P9IA 3E66A 3ZETB 4DQRA 3MX5A 1U47A 3HPHA 2P51A 1TL1A 1S1TA 1YJWN 4FJ7A 4AHRA 3KTQA 4KB1A 4H0YB 3WXIA 2ETJA 4IO9L 4FJJA 4IXCA 4ISGA 4C8KA 4W5QA 3S41A 3TAQA 1X9WA 3ISNC 5AFUH 3SNNA 4FWLA 3DYAA 1CXUA 3KLFA 2I7NA 4PL7A 3ENHA 4WF9L 3DLBA 3A5MC 3K2PA 1KLNA 4FJXA 1KCFA 4FYDA 1NGHA 1NJWA 4YDUC 1K8KB 4CEFA 3QEVA 3MN6A 3CCQN 3LWLA 3KD1E 4C8MA 1ZBFA 3NF8A 4U67L 2NZTA 4FZYA 1MA9B 2PZSA 4FWQA 2OZSA 2LSNA 1DGKN 1Q18A 3ZEUA 3R6MA 1EX4A 3IUCA 3OYDA 4Y1DA 1Q7YO 4CGFA 1S6QA 3HVTA 5AQHA 4CD1A 3SK3A 3FFIA 2ATQA 5FLXO 1ZYQA 4LY7A 1UOCA 1NBWA 1VQ5N 1C0UA 1JKHA 5AQSA 3RSEA 3DLLL 3K5MA 4LD0A 1X3NA 1RILA 1ZC6A 3HT3A 5BRFA 4DUZK 3OYGA 4DS4A 3A0IX 1VSLA 4EHTA 1K9MO 2NRRA 3R8EA 3ASMA 4PWDA 2P9NA 1G99A 1LWEA 1TK8A 1BGXT 4BRKA 4EZ6A 3QFUA 3MMVA 4HCBA 2VG7A 3GG4A 3AVNA 4M41A 3HXMA 1HR0K 2HHQA 3F5TA 1U04A 3AA4A 3I8BA 2UUAK 2D4WA 3VA3A 2GX9A 1NNEA 3K57A 1GLAG 3BF3A 4E7LA 1RT1A 1Y64A 1WSGA 2B4JA 4C1NI 5AR0A 4LF5K 1LW0A 3RRGA 1BO5O 5FDLA 1X3MA 4ELTA 4BE1A 2PBDA 1WLJA 5AFUA 4A57A 3AY9A 3NH1A 5KPRA 4IOAL 2A42A 4FLWA 3J80O 2YKMA 4ICLA 3AGRA 3LDNA 2PYJA 4GVMA 2NRXA 1GOCA 3DXMB 3L6QA 4BRFA 3AV9A 5AJ3K 4KHSA 1HKBA 1EXQA 2PAVA 1OVQA 1XHXA 4BWJA 5FRMA 1S9EA 3H3NO 2QA4N 3D7EO 3HSCA 1QHTA 4FJNA 2UUCK 1NLVA 4OPJA 3UKRB 5AQUA 3OS1A 4BQLA 2IS3A 4YOTA 5H1SQ 4CFCA 2O8BA 3F9MA 4BRQA 4F9OA 3VEVA 4B3OA 3EZ5A 3OHRA 1JCGA 5J2PA 4JN4A 4OLAA 3QEXA 1S1XA 3HOSA 3NF9A 2QWLA 4DV3K 1MDUB 1NGBA 3E01A 1X9SA 4IJAA 2QWRA 4DR6K 3T69A 4UQGA 2FSKA 4O44A 5AZJB 4YOWA 4JK7A 2D0CA 3PUFA 5I3UA 2RE2A 4IEEA 1JLAA 2HF3A 2GV9A 2ASOA 2QW9A 3TABA 3O08A 1QSSA 4E7IA 2W42A 3CF5L 4HWIA 4B1YB 3S3OA 3U4LA 3EY1A 4PY5A 4E3SA 1LV5A 1I39A 2D0BA 2YNGA 4LH5A 3THVA 2PYLA 4Z4CA 3UKUA 4DSKA 3P5JA 4PKIA 4OKJA 3OVNA 1JXEA 4K0KK 3HYFA 1A5VA 4DKWA 3QNOA 4Y0WA 3ZX3A 3I56N 4RW7A 3AVGA 4MO4A 2RPIA 5JS2A 4B9VA 5HL7L 1KXPA 5KPZA 3K0SA 1QSYA 3EL2A 1S9GA 5JLHA 3R1XA 4JI2K 2BTFA 3N4PA 1HQUA 4CHYA 1N36K 4I9LA 1NK4A 1FJGK 4DFMA 4E89A 4JI0K 3ULDA 3LDLA 1WBBA 4AH9A 3DLHA 3MXIA 4B3RK 2OTJN 3P1GA 5KQ8A 3SAHA 5AQNA 4I6MB 1LWFA 1U45A 4JI6K 3ID6A 1JLEA 3VQBA 4ILHA 1O13A 2CGLA 2W40A 1VQ9N 2E1YA 3VN5A 4WFAL 3SUQA 4Z4EA 4CGDA 1LAVA 5TKWA 4CJRA 4M3TA 4H5NA 4JI4K 4NLCA 4DFKA 3FR0A 1SL2A 2OANA 4B9NA 4H0TB 5C2FA 3SQ2A 4AM7A 3NDKA 1FKPA 1QZ5A 3CCRN 5JLFA 1XI1A 4OLBA 3HJFA 3E1YA 3PSIA 3VTIA 2QEXN 2W6LA 3CCLN 3H3OB 3AAQA 4JI3K 3CPEA 1HNZK 1J5OA 4CZEA 2NRVA 3SQ1A 3BUZB 4M3ZA 3WQUA 3O4NA 4LF8K 4KHQA 4FJKA 2E5LK 1BG3A 1S1WA 4B08A 4PKHA 1XWLA 2P9KA 5IWAK 2Y1IA 1TGOA 3K9KA 3WNHA 1EO1A 4JV5K 1N33K 3MX2A 3LL3A 1NWKA 2HF4A 2HMPA 3BGRA 3NE6A 1KFSA 4CZIA 4Z94A 4V19S 1TUYA 4AHSA 3ZX2A 4QS8A 4JYAK 4CJ3A 3UIQA 1D4XA 3WXMB 1IG9A 1NK8A 3L0QA 2A41A 4GMJB 3OYMA 3WNGA 2O8DA 1BA0A 3LPTA 3ZCMA 4BG8A 1KVCA 1VHXA 2G8UA 1IG8A 4CGIA 2I7PA 1GLFO 2YHBA 4O5FA 2IDOA 1JLCA 4O0JA 2BE2A 3TTDA 2HBJA 3ID8A 3L3UA 4NO7A 4BR7A 1U49A 3OYCA 5LMUK 3MCPA 2B6AA 4OKEA 2F8TA 3KHYA 5AQRA 3KLEA 2P9PA 4HHTA 4YNQA 1S3XA 3UB5A 1KAXA 4Z4HA 4WQ5A 3CERA 3MEGA 4KB0A 1T44A 1LW2A 3MXJA 4WFNL 4ZHRA 3KK7A 2DPNA 1DLOA 1J9AA 1Q82O 1KAYA 5GIOA 4K43A 3HO1A 1WSIA 5C0YA 4DU1A 3K58A 3ITHA 3BZKA 3THXA 2Q1NA 3KZBA 3LM2A 1RBVA 4YFUA 4BDYA 4DV6K 1S22A 2E88A 4CJUA 1OH8A 3KD5E 5ADXH 1Z6RA 3G25A 3T7ZA 3TAFA 2HBLA 4DQPA 3SMSA 1BI4A 3L2VA 4B3TK 5CR4A 2G8KA 1TKDA 5F1XA 2OCEA 3VQQA 4W5NA 1DEJA 3CJBA 3RRHA 5KTQA 1QE1A 3E9OA 1TUUA 5B8HA 2QXLA 3HPGA 5HRPA 4CE9A 4FOIA 3U3YA 4FSVA 2WFBA 2DFHA 5EXWA 3TAEA 1HKCA 3R9PA 2P9UB 4K8ZA 1N34K 5E84A 1BU6O 1WSEA 3UE5A 3CXCM 4J2EA 4CGGA 1N32K 3G71N 4GV3A 4FPAA 4J2DA 1SAZA 4M7XA 3O1BA 2QWMA 3TAPA 4CHNA 3BF1A 4PHTX 3VETA 1BIUA 1L3TA 1VQ7N 3RMBA 2VQFK 4FJ5A 5AQPA 1WN7A 3VA0A 4KTQA 4CZGA 4DR5K 4CIGA 3WNFA 4FJ8A 4NCBA 4FM2A 4O8KA 2KZMA 3MN7A 1QTMA 2YKNA 2QWNA 3DLEA 1EP4A 3AVIA 4AM6A 4H0VB 4DV4K 3EE9A 1BCMA 2VGMA 1HQEA 1Z05A 4DV2K 5M1NA 3D6RA 5AQVA 1JCEA 4BC4A 3C6UA 3KLIA 4BR5A 1WNSA 2RN2A 2UYTA 4WQ4A 1CZ9A 2ZF5O 5A2QO 1C0FA 1Z25A 3L4QA 3V9WA 3DRSA 5KI6A 3CCEN 4IEIA 3O3GA 4GVEA 4Z4IA 5K14A 1L3VA 3CCUN 4KRFA 4IZ9A 5CYMA 4DSJA 3AO5A 4XH4A 5FPMA 1A5XA 1NOYA 3THWA 1NG9A 3T1AA 4RW8A 3ZX0A 3CCJN 4B1XB 4AILC 2QWOA 3F9KA 3IMXA 1WBDA 1VQPN 2KKZA 3IFRA 4DSEA 2P1JA 3ZYYX 1T6CA 4N56A 1TAUA 2A40A 3ENOA 4BRPA 3LPUA 1GLJO 4GW6A 4LSLA 4Z0UA 3NF6A 2QM1A 2IGIA 1RTDA 1YTUA 1JLFA 4ILJA 4KKOA 3VENA 1IKYA 1S5JA 2DFEA 3VEWA 3SYZA 2V51B 3J7ZO 4FM0A 3WT0A 3EKUA 2G8FA 3NMUA 4JKHA 1UWBA 2F9WA 4CI6A 4GNIA 3FZFA 3B8AX 2FBVA 5KPTA 4E1MA 3O9TA 2FBXA 5F0XA 1QSLA 2YHXA 3CI5A 1U2VB 3IKMA 4Y1CA 5AQXA 3P83D 3U6FA 4IFYA 2YNFA 4JNEA 4N5SA 4DR3K 2Q0UA 3Q7CA 3QBXA 1FKOA 1C1AA 2WBNA 3FZHA 4FWSA 3S3NA 1QQNA 3TTCA 4E7HA 4DFPA 3AA2A 4CEZA 4NXMK 4JKGB 4QOZB 3O4QA 1B9DA 1NGDA 4F2RA 2GELA 4HTLA 4J8FA 1Q86O 2G8IA 1U4BA 5JICA 1ILYA 1KVBA 4E19A 3ZETA 2ZQBA 4G9ZA 4GKJK 2Q36A 5M1FA 2AP1A 4KBOA 4EAHD 4DTXA 4K42A 5CYQA 2Z1HA 3CJAA 3KVGA 5CE3A 4NXNK 1RBSA 1KC8O 2D0OA 3V9UA 3AO1A 3AA3A 4K41A 1BQMA 2J4RA 3L8BA 3G10A 4CJ7A 1F21A 1JLQA 3LANA 3GE1A 5LJWA 4BC2A 4CJLA 5HBMA 4CJKA 2O8CB 1EWQA 4CF9A 1YUWA 2YHAA 5KRSA 3JS6A 4KH5A 4WE1A 4N41A 4FWPA 3HTVA 4DU3A 5M1KA 3PV8A 1SS6A 4CF2A 2OPPA 1BHLA 4CJFA 3ZSQA 1JCFA 1O1WA 3IG1A 2GWJA 3T19A 3SUPA 1K8KA 4RW9A 4CK1A 2F8SA 4DV1K 4BGAA 2HBKA 4FXDA 3GOIA 3AA5X 3VQCA 2JLEA 5FRNA 3SQ4A 3V9ZA 1HYZA 3SPYA 3PIOL 3VQ5A 4CJ4A 3NGIA 1R0AA 4E7JA 4DR2K 1QQCA 2NNWA 4HUFA 1C1CA 2VWBA 1NKCA 5BR9A 4CECA 3SCXA 3D2FB 1J54A 3SV3A 1X9MA 4F3TA 4ZTJA 2A1SA 3HSTB 3I8DA 4FWOA 3L2WA 5EX5A 3MWPA 4FL9A 4KTZA 1C0MA 3P39A 3ZSOA 4CGHA 3VPZA 3WEEB 1GOBA 2X74A 1S6PA 1TK0A 4GKKK 1LCUA 2VG6A 3AVHA 2QWPA 1BA1A 2YNIA 3P4IA 4BR2A 3E9PA 4BRLA 1NGEA 5FPDA 3B6OA 3ZSVA 4MQ3A 2FSJA 3TAGA 3SPZA 5I42A 4KPYA 1NOZA 3JXUA 3KLHA 2Q97A 3EN9A 4DLGA 1IBMK 2WUSA 4PUOA 2HBMA 3MN5A 3QDKA 4JKBA 2E6LA 2Q0RA 1HNXK 4RG8A 2V7ZA 3CCMN 4FLZA 2F96A 1CZAN 2IOCA 4DCHA 1W0HA 3OBWA 4UY8O 3SUOA 1A5WA 4WQ4C 1YF5L 5LL6Z 3PX4A 3DXKB 2VWJA 5GINA 4OVLA 4Z4FA 3QEPA 3KLGA 4B8AB 3OJSA 3DLRA 3OYIA 5GIPA 4IG0A 4JK9A 5ELZA 5LY3A 3VEOA 3IDHA 1TKXA 4JHDB 4CGJA 1X9JA 3MEDA 4X66K 1VQMN 2BUPA 3FE1A 1VSKA 4E0DA 5C42A 3J81O 2P5OA 1REVA 3L4IA 5BPMA 3UKRA 3K59A 2GBZA 2RKIA 4GV6A 3H46O 3HBTA 4DU4A 5T7BA 4JS5A 3GBTA 3ZSXA 1IO2A 4YOUA 5J2MA 1NGAA 4JI8K 2VG5A 1WOQA 4DSIA 4C8NA 2ZJPL 4X62K 1NGGA 4YOYA 3LDOA 4DB3A 1NGJA 4DUYK 4WYBA 5AZIB 1T7PA 1JL2A 2ZM6K 4KTWA 5AZJA 2JWLA 2A5XA 1RT4A 3NHGA 1NU0A 3OYEA 2IVOA 3VQ4A 1V4TA 1SL0A 4EP4A 1B92A 3SLCA 1QQMA 2ZD1A 1D9DA 5D3GA 4PQUA 2NRHA 2NLXA 4M45A 4AHVA 4CESA 3V81A 1TAQA 3WXLA 4QS7A 4OPKA 5JVGL 2A3ZA 4W5RA 1NJIO 4FLYA 2W41A 4B1UB 1RBTA 2DY4A 1BUPA 1IV0A 1KSPA 3CQYA 1LWCA 2QKBA 3ATVA 4HUEA 3L2UA 3K9JA 2IC3A 4DR4K 4Z4GA 2O4IA 4J2AA 4DSFA 3PX6A 3JAMO 4AQYK 3VQ9A 3DI6A 2HHVA 3S9HA 3TR8A 4H5TA 4M3RA 2UXCK 1IJJA 2P5GA 3D0PA 2Z1GA 5AQGA 3QICA 3ZT3A 1YJNN 3M6GA 4OGEA 1UAXA 3TAMA 3VF4A 4G1QA 3O9QA 4H4OA 4AHUA 1TKTA 1YITN 1RDWX 4FWMA 4B9TA 3EO3A 4DFJA 1XMOK 3THYB 4HTUA 3BDPA 4I9QA 4K25A 4I6MA 3CC4N 3SJHA 4I2QA 4B1WB 3V6DA 4CHZA 4DTNA 3L3VA 5FPNA 1RTIA 3RR8A 1E4FT 3KK1A 2X6SA 1Q8IA 2YJEA 4AF1A 3SV4A 3T1HK 2E2PA 2KFZA 4NCGA 3DOLA 4CJ5A 5SZTA 1GLEG 5AQYA 4DQQA 3VQAA 4EFHA 2FBTA 3PY8A 1MWMA 2W6KA 3W3DA 1RGIA 5C10A 1S72N 1VRTA 4GV9A 4M3WA 3DRRA 5KQDA 4BC3A 5C15A 3C6AA 1SQKA 3T1YK 3I55N 1GLBG 3CC7N 2RF2A 2QWQA 1DTQA 3AVKA 4BC5A 1NK6A 2DFFA 4JD2A 2XY5A 1T05A 3V9XA 4IOCL 2Z1IA 4B9SA 3VF2A 1YVUA 3AO4A 1NK0A 3CJCA 2VGNA 3VGLA 4H0OA 5C25A 3CM6A 4RCHA 2QI2A 1RBRA 5JMVA 1RBUA 1Q9YA 4FJMA 2Q31A 4CVNE 3J7YP 1JLBA 5JVHL 4FZZA 1QHAA 1WAJA 1DT9A 4EIAA 4ID1A 2X78A 5EVZA 4FJGA 4LF9K 1ZBLA 4NLBA 4KV8A 4CF1A 3C95A 5DM6L 2E20A 3O3FA 1HLUA 3ZSRA 3ZSWA 3NCIA 3HOTA 5JS1A 1J6ZA 3CCVN 3THXB 3PSFA 4QAGA 3VOVA 1L3SA 1KD1O 4BE2A 4MLEA 2CH6A 3SUNA 4J2BA 3O9RA 1RFQA 1RTJA 3CFRA 3GL1A 1UA1A 4DQIA 2ZJRL 4JEPA 1W97L 2EHGA 3AVBA 1HNIA 2F7TA 3OYNA 4YDUA 3O9SA 3TARA 2D1KA 5IT9O 2NRTA 4A2BA 3OY9A 2XO7A 1XNQK 4M63C 4MDAA 1VQNN 4ISEA 1ZBUA 1QZ6A 3RMDA 2H3GX 4KI4A 4KHYA 3K5OA 3CFPA 4MFBA 4Q5VA 1RDDA 1D5AA 1RT3A 3ULEB 3HVRA 5CHIA 3U9DA 2E6MA 3SAGA 1I3AA 4OO1J 4CHOA 3RMAA 1EETA 4DS5A 4CJVA 1VSMA 4XH1A 2HHSA 2WC9A 1XNRK 4CZKA 3CYMA 4KHNA 4KHPK 3NGYA 1VAZA 4JLHA 1EWRA 1K73O 2VYPA 2AA4A 2NRWA 3OYHA 5C24A 4FZXC 3FZKA 4R5PA 3L2QA 3AGKA 3CIPA 4O0IA 1RDCA 4CJSA 3MAQA 2YV0X 3OYBA 2P9SB 2O8FB 1IBLK 3LP1A 5M1QA 2KW4A 3EKSA 4OX9K 3TU5A 2KTQA 4BRGA 4ID5A 4CZHA 3KWIA 1CLQA 1YXQA 1OVYA 4LSNA 4CEBA 3AAPA 1UA0A 1HKGA 4E1JA 1IKWA 1TK5A 4DMNA 4BRHA 4BR0A 5AQJA 3AVFA 2ASPA 3BY5A 4CBWA 3D45A 4IDKA 2HSTA 2OA8A 4RW4A 4DWIA 5CZ1A 1W2BM 2D0AA 5E26A 1VSEA 3C0BA 4OKKA 2HW3A 2P9UA 3LZIA 4RW6A 4BRDA 2Y1JA 1W7AA 4K8XA 2O8EB 4BE0A 3VTHA 2NUBA 3CQXA 3MECA 3D2EA 2XY6A 4B3MK 3J7AP 5BN9A 1I94K 1J5EK 2YCHA 3WUHA 5AQMA 4CJWA 2OPSA 1FK9A 3RMCA 3LP3A 4KO0A 3K5LA 1XHZA 4FOEA 3QNNA 4I2PA 2GWKA 4DF8A 3C7NB 2E2NA 1B9FA 3LM9A 3QO9A 1XUPO 3AVLA 5AQKA 4CK3A 4DLEA 4JI5K 3KK3A 3SZ2A 3PIPL 4A5AA 4BWMA 1TYQB 1C1BA 2OZMA 3VEYA 3O80A 4FK4A 2HNYA 3AVAA 1ZBSA 4DR1K 1XC3A 4IFVA 4JI1K 4B9MA 4LH4A 3VQ8A 5GAHP 1N8RO 2VWKA 5KGWA 4FLXA 4FJHA 4F3OA 4F8RA 4BVOA 2IVNA 3M3ZA 2UXBK 4CK2A 4BDZA 2P9LB 1VSIA 3BZCA 5TKYA 2QXFA 4NCAA 1VQ8N 2YHYA 3A5LC 5AQQA 1M90O 3DWLA 4IDHA 4E1NA 5GAEP 1SL1A 1JXBA 2P9IB 1R59O 4H4MA 3JYTA 5LJVA 4DHYA 2G8WA 1IKVA 4XEIA 3VERA 4PL8A 5BREA 1HYSA 3A2FA 1ASVA 3V9SA 1SUQA 4CEDA 2G8HA 3BP8A 4WCEL 4QCLA 1WAFA 5AQZA 3FFKB 1KFDA 4KREA 3CMAN 3DMJA 4JRQA 4DTRA 3NFAA 3TI0A 3MN9A 4H5RA 3TANA 2F4VK 1TVRA 1Y97A 4DV5K 1XMQK 3KIOA 4H0PA 4FLTA 3M8RA 4FK0A 3QIPA 3VESA 4CZJA 4EHUA 1X1PA 3O3HA 3VGKA 3IS9A 3QEIA 1ASUA 4ELUA 3FGUA 4YORA 3NBPA 2GUPA 1RDUA 2ITGA 1VSDA 1NMDA 3J8AA 4DV0K 2BH1A 3O4WA 4CJPA 4DTJA 4IWVA 2HHUA 3DM2A 4H03B 3RR7A 3B6PA 1TL3A 3ZEUB 4CEAA 3VGMA 3L2RA 4FVMA 3WXKA 5KRTA 4FWKA 4WQ5C 3VQ7A 1U2VA 3AARA 4CEQA 1VQ4N 5KGXA 2HB5A 3KKRA 4EZ9A 5DMRA 4BRCA 3RSEB 4LFAK 4HVJA 4ELVA 1RT5A 3BEXA 1YJ9N 1HX1A 1LOTB 3LP0A 3TSQA 5AQFA 1BL3A 4JKGA 4NYFA 3U3GA 5LMNK 1GOAA 2ITMA 4XH5A 3T3FA 3QLHA 2F9TA 2P9NB 2FLOA 3DLKA 1KRPA 3HK2A 4DTMA 4DV7K 1D8YA 4OJRA 3OJUA 1NK9A 3LZJA 2WOMA 2HHTA 2AJQA 4DQSA 3CC2N 2GEMA 2PFUA 1OH7A 2X6NA 3OYKA 3AVMA 5GAGP 3AO2A 4CZMA 4CW7B 4ISFA 4CD3A 3NF7A 4FW1A 3ZT1A 4XIUA 1Q81O 1YTAA 3SI6A 3PO5A 3HRGA 3V1OA 1HRHA 3OS2A 4C8LA 3O1WA 5C12A 4FJIA 2O8CA 1P8ZA 1NKBA 2IVPA 2D0PA 4DG1A 3W0LA 3CPWM 3TPQA 5FROA 3VEXA 1NJYA 4KAZA 3CJ9A 1S1VA 3OYJA 4CFDA 3QBWA 1JJ2M 1WSFA 2BGGA 4KHUA 5CY4A 4B9UA 1U48A 3HZ6A 4RWTA 1JL1A 3RVCA 3CD6N 4YOVA 3PX0A 3VMFB 1T8EA 2OPQA 3CFOA 4M7YA 2O8BB 5J1EA 5DK5A 1ZBHA 1KTQA 2E1ZA 3HP9A 1BISA 3ENBA 3MXMA 4JS4A 2JWKA 1DKGD 3OA9A 5BPLA 4DQ8A 5M1OA 3MEEA 4KHWA 4B1ZA 2OYQA 3H45C 3D2FA
chains in the Genus database with same CATH topology
4LFAK 2UUAK 1N34K 4JYAK 4DR1K 4LFBK 4DV1K 1N32K 3T1HK 4JI1K 3J81O 4LF5K 5LMNK 4JI2K 2HHHK 1XNRK 1N36K 4KHPK 4DV7K 1FJGK 2UXBK 4JI0K 4DR2K 2VQEK 1HNWK 4JI8K 4B3RK 3J80O 3T1YK 2VQFK 4LF7K 4X62K 4DR3K 4JI6K 4DUYK 4DR5K 4YHHK 5LMUK 5AJ3K 2ZM6K 1IBKK 2UUBK 1IBLK 4LF6K 4OX9K 4CW7B 4GKKK 4NXMK 4CVNE 2UUCK 3J7YP 4DV4K 4B3SK 4LF4K 4DV2K 3OTOK 4LFCK 4JI4K 4LF9K 2F4VK 5A2QO 4DV5K 4YY3K 1XMQK 1IBMK 4X65K 2UXDK 4DV3K 5FLXO 4GKJK 5BR8K 4DV6K 4DR6K 4DR7K 1HNXK 4JI3K 1HNZK 4NXNK 4B3MK 4DR4K 3J7AP 4DUZK 1I94K 1J5EK 5LL6Z 3JAMO 4DV0K 4LF8K 4AQYK 2E5LK 4JI7K 4X64K 4B3TK 2UXCK 5IWAK 4JV5K 1N33K 2UU9K 5IT9O 4JI5K 1XNQK 1XMOK 1HR0K 4K0KK 4X66K 4V19S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA K;  2UUA K;  1N34 K;  4JYA K;  4DR1 K;  4LFB K;  4DV1 K;  1N32 K;  3T1H K;  4JI1 K;  3J81 O;  4LF5 K;  5LMN K;  4JI2 K;  2HHH K;  1XNR K;  1N36 K;  4KHP K;  4DV7 K;  1FJG K;  2UXB K;  4JI0 K;  4DR2 K;  2VQE K;  1HNW K;  4JI8 K;  4B3R K;  3J80 O;  3T1Y K;  2VQF K;  4LF7 K;  4X62 K;  4DR3 K;  4JI6 K;  4DUY K;  4DR5 K;  4YHH K;  5LMU K;  5AJ3 K;  2ZM6 K;  1IBK K;  2UUB K;  1IBL K;  4LF6 K;  4OX9 K;  4CW7 B;  4GKK K;  4NXM K;  4CVN E;  2UUC K;  3J7Y P;  4DV4 K;  4B3S K;  4LF4 K;  4DV2 K;  3OTO K;  4LFC K;  4JI4 K;  4LF9 K;  2F4V K;  5A2Q O;  4DV5 K;  4YY3 K;  1XMQ K;  1IBM K;  4X65 K;  2UXD K;  4DV3 K;  5FLX O;  4GKJ K;  5BR8 K;  4DV6 K;  4DR6 K;  4DR7 K;  1HNX K;  4JI3 K;  1HNZ K;  4NXN K;  4B3M K;  4DR4 K;  3J7A P;  4DUZ K;  1I94 K;  1J5E K;  5LL6 Z;  3JAM O;  4DV0 K;  4LF8 K;  4AQY K;  2E5L K;  4JI7 K;  4X64 K;  4B3T K;  2UXC K;  5IWA K;  4JV5 K;  1N33 K;  2UU9 K;  5IT9 O;  4JI5 K;  1XNQ K;  1XMO K;  1HR0 K;  4K0K K;  4X66 K;  4V19 S; 
#chains in the Genus database with same CATH topology
 5BN8 A;  1Z26 A;  4TSX A;  2YHW A;  5MLC Q;  4GY2 B;  1C0G A;  2VCP A;  3NH0 A;  1OH6 A;  3WEE A;  4LFB K;  4FPB A;  3QIO A;  1RDA A;  1ASW A;  2HHX A;  1E3M A;  1BWF O;  2E8A A;  1IKX A;  2RHK A;  2HVI A;  3DOK A;  3NVM A;  1HMV A;  1SV5 A;  3KJV A;  1SKS A;  4DSL A;  1OKJ A;  1RTH A;  3H08 A;  1YI2 N;  4ZTF A;  1L3U A;  2VQE K;  5J2N A;  2KFN A;  4A2A A;  2A6A A;  3UKU B;  3DXM A;  4ILG B;  3FZL A;  3RWU A;  1KLM A;  4BVP A;  3M8S A;  4F2S A;  1IBK K;  1RT7 A;  4LF6 K;  2ZE2 A;  4KH6 A;  3C65 A;  1TV6 A;  1J53 A;  3AO3 A;  1NMN A;  1OH5 A;  3DXK A;  2FSN A;  2E2O A;  3V1R A;  4C1N K;  3OTO K;  3CCS N;  1Q9X A;  4B9Q A;  2WON A;  3NGZ A;  3VQE A;  4BAC A;  3M1F A;  4WFB L;  3LAM A;  4MDB A;  4A62 A;  4JHD A;  4FLV A;  4CJQ A;  3WXJ A;  4FWN A;  4DR7 K;  3NAE A;  3P38 A;  4DTO A;  3VF6 A;  3A8Y A;  1WSJ A;  3LWM A;  1CZB A;  3TTF A;  1ITG A;  3LAL A;  4CER A;  3H1Q A;  4A61 A;  2EX3 A;  4PKG A;  2EWS A;  2XY7 A;  1BOT O;  3G0Z A;  5FPE A;  3SJJ A;  3U8X A;  1D9F A;  3F2K A;  1ATS A;  3FZM A;  5HRR A;  4BRM A;  1LAW A;  4MO5 A;  3SAF A;  3R3L A;  1K8A O;  4F4K A;  4KFB A;  3AVJ A;  4BRO A;  4O5B A;  1BDG A;  4CF8 A;  3EE8 A;  4Q0B A;  5M1P A;  3VQ6 A;  3NVK A;  2QK9 A;  4O4G A;  2O4G A;  5AQW A;  1YHQ N;  1QS4 A;  1XC9 A;  3GDQ A;  3A5O C;  3OS0 A;  4BRN A;  5AZI A;  4CFB A;  3CJ7 A;  3KWG A;  2KZZ A;  2KLA A;  4L3Q A;  1QQO A;  3QEW A;  4HCC A;  1EKE A;  2ZGY A;  3C6T A;  3WQT A;  4R79 A;  2HMI A;  4CEE A;  1QVF M;  2OTL N;  1C6V A;  4FM1 A;  3IAY A;  3U9Z A;  3ZLJ A;  3JSM A;  3A5N C;  2HHH K;  2FXU A;  4RTF D;  4BRI A;  2P9K B;  3IRX A;  4DTS A;  1ATN A;  3KKS A;  1BIZ A;  4W5T A;  4N76 A;  4FJ9 A;  3O9U A;  1L5U A;  4M3X A;  4BR4 A;  1NK5 A;  2V52 B;  1NJZ A;  2GTD A;  3OYA A;  3ZSZ A;  4YHH K;  5C2D A;  4FO0 A;  3C94 A;  3SBG A;  4IBN A;  4KH4 A;  2KHO A;  5HLF A;  3CET A;  3C6H A;  4JD2 B;  1S1U A;  1N6Q A;  2O8D B;  3VQP A;  4BQZ A;  1MU2 A;  4E7K A;  1W9H A;  4LFC K;  2HOE A;  2I5J A;  3SQ0 A;  1ESV A;  2G8V A;  3H6E A;  3QET A;  4YY3 K;  2HND A;  4PA1 A;  4X65 K;  2ZGZ A;  3TSP A;  5HRN A;  3THY A;  1GLD G;  3I0R A;  2PY5 A;  1HJR A;  4JKE A;  4IKF A;  2XRI A;  1U6Z A;  1YAG A;  5BR8 K;  2BAN A;  1NKE A;  4CBU A;  2P9P B;  1RDB A;  3H1V X;  4JKD A;  3OYL A;  3CM5 A;  2YI1 A;  1NM1 A;  3SBT A;  3HPO A;  4JAX A;  5AQI A;  3HM8 A;  3ALY A;  1V4S A;  4M3U A;  1SZ2 A;  2Q2R A;  5AQL A;  4X64 K;  5GAD P;  2D5R A;  2YJF A;  3MDQ A;  2KQ2 A;  4JKC A;  2R7Y A;  1YVN A;  1NGC A;  4JKF A;  1VRU A;  4AHT A;  2BDP A;  4H5W A;  5EY4 A;  4BGB A;  4U7B A;  4EP5 A;  2ZWH A;  3LDQ A;  4B8C A;  4BG9 A;  1VQL N;  1VSF A;  4FW2 A;  1HUX A;  4CJE A;  3QER A;  3EEQ A;  1XQS C;  2XHB A;  3HI0 A;  3O6W A;  4N47 A;  4FVU A;  3CJ1 A;  1HJO A;  5EU7 A;  3O5B A;  3M8Q A;  1VQK N;  3LP2 A;  5EOY A;  4NYN A;  1BI4 B;  2IAJ A;  4JRP A;  3TWH A;  2FF6 A;  1VSJ A;  3OBY A;  1KQS M;  1C0T A;  1WSH A;  2QTD A;  4QS9 A;  1HNW K;  1K6Y A;  4BR9 A;  5HP1 A;  4CHQ A;  3N4Q A;  4FK2 A;  1KAZ A;  3ZSY A;  5AQT A;  4AHC A;  4A59 A;  5F2R A;  1JLG A;  3WNE A;  1YIJ N;  4L8R B;  4IJN A;  4BRA A;  4DF4 A;  1CXQ A;  2A1R A;  2UUB K;  4HUG A;  2YNH A;  4CEO A;  3I33 A;  1BQN A;  1T3V A;  3SMP A;  3VEZ A;  3ZT0 A;  2FF3 B;  4BDP A;  1RNH A;  3ZT2 A;  3NH2 A;  4LF4 K;  4IOX A;  2JGU A;  1NK7 A;  1YT3 A;  3M5R A;  2Z1J A;  1FW6 A;  2ZJQ L;  2FC0 A;  3V4I A;  1ATR A;  4NB4 A;  4B9L A;  4JKA A;  1KVA A;  4CIF A;  3ZT4 A;  3LAK A;  3DLG A;  5BRH A;  4FLU A;  4M3Y A;  1N5Y A;  1GLC G;  4CFA A;  3KK2 A;  3P31 A;  5AQO A;  4C23 A;  3ULE A;  3Q7B A;  1HNV A;  4IO8 A;  4CF0 A;  2CGK A;  2YX6 A;  3D2E B;  3G6E N;  2FBY A;  2GUI A;  3TSU A;  5SWM A;  2Q3S A;  1RT2 A;  3E9L A;  1NJX A;  3CME N;  5I9E B;  3MCA B;  2UU9 K;  4O55 A;  4FCY A;  4H5V A;  5DM7 L;  3CQ8 A;  4IFE A;  1TKZ A;  4KI6 A;  2HNZ A;  4MLH A;  3PLA A;  4B1V A;  1WUA A;  2P9S A;  2O8F A;  1HPZ A;  4OPA A;  3QES A;  2E4L A;  3THW B;  4I7F A;  3QB0 A;  4CCH A;  1VK0 A;  1M1K O;  5HRO A;  3VQD A;  2OPR A;  5BRD A;  5J2Q A;  1BCO A;  2V7Y A;  3QIN A;  1H1V A;  4IG3 A;  4CZF A;  4OGC A;  4FJL A;  1EQY A;  4LF7 K;  2DTU A;  3OW2 M;  2WTU A;  3K5N A;  1VSH A;  3PO4 A;  3EYZ A;  5E41 A;  1T03 A;  2O8E A;  4JK8 A;  4CHP A;  4CZL A;  3MWT A;  3M8P A;  2IIR A;  4LC9 B;  1QVG M;  5ADX A;  3DAW A;  1NGI A;  2E2Q A;  3S3M A;  4B3S K;  1T6D A;  3O8M A;  2NRZ A;  3FLC O;  1HPM A;  3ATU A;  1NGF A;  4W5O A;  4OPH A;  1E4G T;  4BRE A;  4H0X B;  4BY9 C;  4M42 A;  4DTP A;  1MWK A;  1VQ6 N;  3C7N A;  1G15 A;  4C8O A;  3OYF A;  3LDP A;  4CJT A;  2CGJ A;  2UXD K;  1WB9 A;  3F73 A;  1ZXO A;  1HYV A;  4CBX A;  1TYQ A;  4FWR A;  4O8U A;  1P90 A;  2XY8 A;  2HHW A;  1GLL O;  3CG7 A;  1FXX A;  3MK6 A;  5BPN A;  3G4S N;  2HVH A;  1VQO N;  4H8K A;  3HL8 A;  2QKK A;  3LDS A;  1ZBI A;  4DTU A;  2ASM A;  4JI7 K;  5HOO A;  4A5B A;  2CH5 A;  3V1Q A;  1DTT A;  3DJC A;  3DRP A;  3QFP A;  3QML A;  3I0S A;  3HM9 A;  3RTV A;  4YOX A;  1SKR A;  3AVC A;  5HRS A;  2P9L A;  1RCH A;  3CHW A;  3HP6 A;  3EZW A;  2B5J A;  1RT6 A;  1IH7 A;  4CIE A;  1SKW A;  5CZ2 A;  2P9I A;  3E66 A;  3ZET B;  4DQR A;  3MX5 A;  1U47 A;  3HPH A;  2P51 A;  1TL1 A;  1S1T A;  1YJW N;  4FJ7 A;  4AHR A;  3KTQ A;  4KB1 A;  4H0Y B;  3WXI A;  2ETJ A;  4IO9 L;  4FJJ A;  4IXC A;  4ISG A;  4C8K A;  4W5Q A;  3S41 A;  3TAQ A;  1X9W A;  3ISN C;  5AFU H;  3SNN A;  4FWL A;  3DYA A;  1CXU A;  3KLF A;  2I7N A;  4PL7 A;  3ENH A;  4WF9 L;  3DLB A;  3A5M C;  3K2P A;  1KLN A;  4FJX A;  1KCF A;  4FYD A;  1NGH A;  1NJW A;  4YDU C;  1K8K B;  4CEF A;  3QEV A;  3MN6 A;  3CCQ N;  3LWL A;  3KD1 E;  4C8M A;  1ZBF A;  3NF8 A;  4U67 L;  2NZT A;  4FZY A;  1MA9 B;  2PZS A;  4FWQ A;  2OZS A;  2LSN A;  1DGK N;  1Q18 A;  3ZEU A;  3R6M A;  1EX4 A;  3IUC A;  3OYD A;  4Y1D A;  1Q7Y O;  4CGF A;  1S6Q A;  3HVT A;  5AQH A;  4CD1 A;  3SK3 A;  3FFI A;  2ATQ A;  5FLX O;  1ZYQ A;  4LY7 A;  1UOC A;  1NBW A;  1VQ5 N;  1C0U A;  1JKH A;  5AQS A;  3RSE A;  3DLL L;  3K5M A;  4LD0 A;  1X3N A;  1RIL A;  1ZC6 A;  3HT3 A;  5BRF A;  4DUZ K;  3OYG A;  4DS4 A;  3A0I X;  1VSL A;  4EHT A;  1K9M O;  2NRR A;  3R8E A;  3ASM A;  4PWD A;  2P9N A;  1G99 A;  1LWE A;  1TK8 A;  1BGX T;  4BRK A;  4EZ6 A;  3QFU A;  3MMV A;  4HCB A;  2VG7 A;  3GG4 A;  3AVN A;  4M41 A;  3HXM A;  1HR0 K;  2HHQ A;  3F5T A;  1U04 A;  3AA4 A;  3I8B A;  2UUA K;  2D4W A;  3VA3 A;  2GX9 A;  1NNE A;  3K57 A;  1GLA G;  3BF3 A;  4E7L A;  1RT1 A;  1Y64 A;  1WSG A;  2B4J A;  4C1N I;  5AR0 A;  4LF5 K;  1LW0 A;  3RRG A;  1BO5 O;  5FDL A;  1X3M A;  4ELT A;  4BE1 A;  2PBD A;  1WLJ A;  5AFU A;  4A57 A;  3AY9 A;  3NH1 A;  5KPR A;  4IOA L;  2A42 A;  4FLW A;  3J80 O;  2YKM A;  4ICL A;  3AGR A;  3LDN A;  2PYJ A;  4GVM A;  2NRX A;  1GOC A;  3DXM B;  3L6Q A;  4BRF A;  3AV9 A;  5AJ3 K;  4KHS A;  1HKB A;  1EXQ A;  2PAV A;  1OVQ A;  1XHX A;  4BWJ A;  5FRM A;  1S9E A;  3H3N O;  2QA4 N;  3D7E O;  3HSC A;  1QHT A;  4FJN A;  2UUC K;  1NLV A;  4OPJ A;  3UKR B;  5AQU A;  3OS1 A;  4BQL A;  2IS3 A;  4YOT A;  5H1S Q;  4CFC A;  2O8B A;  3F9M A;  4BRQ A;  4F9O A;  3VEV A;  4B3O A;  3EZ5 A;  3OHR A;  1JCG A;  5J2P A;  4JN4 A;  4OLA A;  3QEX A;  1S1X A;  3HOS A;  3NF9 A;  2QWL A;  4DV3 K;  1MDU B;  1NGB A;  3E01 A;  1X9S A;  4IJA A;  2QWR A;  4DR6 K;  3T69 A;  4UQG A;  2FSK A;  4O44 A;  5AZJ B;  4YOW A;  4JK7 A;  2D0C A;  3PUF A;  5I3U A;  2RE2 A;  4IEE A;  1JLA A;  2HF3 A;  2GV9 A;  2ASO A;  2QW9 A;  3TAB A;  3O08 A;  1QSS A;  4E7I A;  2W42 A;  3CF5 L;  4HWI A;  4B1Y B;  3S3O A;  3U4L A;  3EY1 A;  4PY5 A;  4E3S A;  1LV5 A;  1I39 A;  2D0B A;  2YNG A;  4LH5 A;  3THV A;  2PYL A;  4Z4C A;  3UKU A;  4DSK A;  3P5J A;  4PKI A;  4OKJ A;  3OVN A;  1JXE A;  4K0K K;  3HYF A;  1A5V A;  4DKW A;  3QNO A;  4Y0W A;  3ZX3 A;  3I56 N;  4RW7 A;  3AVG A;  4MO4 A;  2RPI A;  5JS2 A;  4B9V A;  5HL7 L;  1KXP A;  5KPZ A;  3K0S A;  1QSY A;  3EL2 A;  1S9G A;  5JLH A;  3R1X A;  4JI2 K;  2BTF A;  3N4P A;  1HQU A;  4CHY A;  1N36 K;  4I9L A;  1NK4 A;  1FJG K;  4DFM A;  4E89 A;  4JI0 K;  3ULD A;  3LDL A;  1WBB A;  4AH9 A;  3DLH A;  3MXI A;  4B3R K;  2OTJ N;  3P1G A;  5KQ8 A;  3SAH A;  5AQN A;  4I6M B;  1LWF A;  1U45 A;  4JI6 K;  3ID6 A;  1JLE A;  3VQB A;  4ILH A;  1O13 A;  2CGL A;  2W40 A;  1VQ9 N;  2E1Y A;  3VN5 A;  4WFA L;  3SUQ A;  4Z4E A;  4CGD A;  1LAV A;  5TKW A;  4CJR A;  4M3T A;  4H5N A;  4JI4 K;  4NLC A;  4DFK A;  3FR0 A;  1SL2 A;  2OAN A;  4B9N A;  4H0T B;  5C2F A;  3SQ2 A;  4AM7 A;  3NDK A;  1FKP A;  1QZ5 A;  3CCR N;  5JLF A;  1XI1 A;  4OLB A;  3HJF A;  3E1Y A;  3PSI A;  3VTI A;  2QEX N;  2W6L A;  3CCL N;  3H3O B;  3AAQ A;  4JI3 K;  3CPE A;  1HNZ K;  1J5O A;  4CZE A;  2NRV A;  3SQ1 A;  3BUZ B;  4M3Z A;  3WQU A;  3O4N A;  4LF8 K;  4KHQ A;  4FJK A;  2E5L K;  1BG3 A;  1S1W A;  4B08 A;  4PKH A;  1XWL A;  2P9K A;  5IWA K;  2Y1I A;  1TGO A;  3K9K A;  3WNH A;  1EO1 A;  4JV5 K;  1N33 K;  3MX2 A;  3LL3 A;  1NWK A;  2HF4 A;  2HMP A;  3BGR A;  3NE6 A;  1KFS A;  4CZI A;  4Z94 A;  4V19 S;  1TUY A;  4AHS A;  3ZX2 A;  4QS8 A;  4JYA K;  4CJ3 A;  3UIQ A;  1D4X A;  3WXM B;  1IG9 A;  1NK8 A;  3L0Q A;  2A41 A;  4GMJ B;  3OYM A;  3WNG A;  2O8D A;  1BA0 A;  3LPT A;  3ZCM A;  4BG8 A;  1KVC A;  1VHX A;  2G8U A;  1IG8 A;  4CGI A;  2I7P A;  1GLF O;  2YHB A;  4O5F A;  2IDO A;  1JLC A;  4O0J A;  2BE2 A;  3TTD A;  2HBJ A;  3ID8 A;  3L3U A;  4NO7 A;  4BR7 A;  1U49 A;  3OYC A;  5LMU K;  3MCP A;  2B6A A;  4OKE A;  2F8T A;  3KHY A;  5AQR A;  3KLE A;  2P9P A;  4HHT A;  4YNQ A;  1S3X A;  3UB5 A;  1KAX A;  4Z4H A;  4WQ5 A;  3CER A;  3MEG A;  4KB0 A;  1T44 A;  1LW2 A;  3MXJ A;  4WFN L;  4ZHR A;  3KK7 A;  2DPN A;  1DLO A;  1J9A A;  1Q82 O;  1KAY A;  5GIO A;  4K43 A;  3HO1 A;  1WSI A;  5C0Y A;  4DU1 A;  3K58 A;  3ITH A;  3BZK A;  3THX A;  2Q1N A;  3KZB A;  3LM2 A;  1RBV A;  4YFU A;  4BDY A;  4DV6 K;  1S22 A;  2E88 A;  4CJU A;  1OH8 A;  3KD5 E;  5ADX H;  1Z6R A;  3G25 A;  3T7Z A;  3TAF A;  2HBL A;  4DQP A;  3SMS A;  1BI4 A;  3L2V A;  4B3T K;  5CR4 A;  2G8K A;  1TKD A;  5F1X A;  2OCE A;  3VQQ A;  4W5N A;  1DEJ A;  3CJB A;  3RRH A;  5KTQ A;  1QE1 A;  3E9O A;  1TUU A;  5B8H A;  2QXL A;  3HPG A;  5HRP A;  4CE9 A;  4FOI A;  3U3Y A;  4FSV A;  2WFB A;  2DFH A;  5EXW A;  3TAE A;  1HKC A;  3R9P A;  2P9U B;  4K8Z A;  1N34 K;  5E84 A;  1BU6 O;  1WSE A;  3UE5 A;  3CXC M;  4J2E A;  4CGG A;  1N32 K;  3G71 N;  4GV3 A;  4FPA A;  4J2D A;  1SAZ A;  4M7X A;  3O1B A;  2QWM A;  3TAP A;  4CHN A;  3BF1 A;  4PHT X;  3VET A;  1BIU A;  1L3T A;  1VQ7 N;  3RMB A;  2VQF K;  4FJ5 A;  5AQP A;  1WN7 A;  3VA0 A;  4KTQ A;  4CZG A;  4DR5 K;  4CIG A;  3WNF A;  4FJ8 A;  4NCB A;  4FM2 A;  4O8K A;  2KZM A;  3MN7 A;  1QTM A;  2YKN A;  2QWN A;  3DLE A;  1EP4 A;  3AVI A;  4AM6 A;  4H0V B;  4DV4 K;  3EE9 A;  1BCM A;  2VGM A;  1HQE A;  1Z05 A;  4DV2 K;  5M1N A;  3D6R A;  5AQV A;  1JCE A;  4BC4 A;  3C6U A;  3KLI A;  4BR5 A;  1WNS A;  2RN2 A;  2UYT A;  4WQ4 A;  1CZ9 A;  2ZF5 O;  5A2Q O;  1C0F A;  1Z25 A;  3L4Q A;  3V9W A;  3DRS A;  5KI6 A;  3CCE N;  4IEI A;  3O3G A;  4GVE A;  4Z4I A;  5K14 A;  1L3V A;  3CCU N;  4KRF A;  4IZ9 A;  5CYM A;  4DSJ A;  3AO5 A;  4XH4 A;  5FPM A;  1A5X A;  1NOY A;  3THW A;  1NG9 A;  3T1A A;  4RW8 A;  3ZX0 A;  3CCJ N;  4B1X B;  4AIL C;  2QWO A;  3F9K A;  3IMX A;  1WBD A;  1VQP N;  2KKZ A;  3IFR A;  4DSE A;  2P1J A;  3ZYY X;  1T6C A;  4N56 A;  1TAU A;  2A40 A;  3ENO A;  4BRP A;  3LPU A;  1GLJ O;  4GW6 A;  4LSL A;  4Z0U A;  3NF6 A;  2QM1 A;  2IGI A;  1RTD A;  1YTU A;  1JLF A;  4ILJ A;  4KKO A;  3VEN A;  1IKY A;  1S5J A;  2DFE A;  3VEW A;  3SYZ A;  2V51 B;  3J7Z O;  4FM0 A;  3WT0 A;  3EKU A;  2G8F A;  3NMU A;  4JKH A;  1UWB A;  2F9W A;  4CI6 A;  4GNI A;  3FZF A;  3B8A X;  2FBV A;  5KPT A;  4E1M A;  3O9T A;  2FBX A;  5F0X A;  1QSL A;  2YHX A;  3CI5 A;  1U2V B;  3IKM A;  4Y1C A;  5AQX A;  3P83 D;  3U6F A;  4IFY A;  2YNF A;  4JNE A;  4N5S A;  4DR3 K;  2Q0U A;  3Q7C A;  3QBX A;  1FKO A;  1C1A A;  2WBN A;  3FZH A;  4FWS A;  3S3N A;  1QQN A;  3TTC A;  4E7H A;  4DFP A;  3AA2 A;  4CEZ A;  4NXM K;  4JKG B;  4QOZ B;  3O4Q A;  1B9D A;  1NGD A;  4F2R A;  2GEL A;  4HTL A;  4J8F A;  1Q86 O;  2G8I A;  1U4B A;  5JIC A;  1ILY A;  1KVB A;  4E19 A;  3ZET A;  2ZQB A;  4G9Z A;  4GKJ K;  2Q36 A;  5M1F A;  2AP1 A;  4KBO A;  4EAH D;  4DTX A;  4K42 A;  5CYQ A;  2Z1H A;  3CJA A;  3KVG A;  5CE3 A;  4NXN K;  1RBS A;  1KC8 O;  2D0O A;  3V9U A;  3AO1 A;  3AA3 A;  4K41 A;  1BQM A;  2J4R A;  3L8B A;  3G10 A;  4CJ7 A;  1F21 A;  1JLQ A;  3LAN A;  3GE1 A;  5LJW A;  4BC2 A;  4CJL A;  5HBM A;  4CJK A;  2O8C B;  1EWQ A;  4CF9 A;  1YUW A;  2YHA A;  5KRS A;  3JS6 A;  4KH5 A;  4WE1 A;  4N41 A;  4FWP A;  3HTV A;  4DU3 A;  5M1K A;  3PV8 A;  1SS6 A;  4CF2 A;  2OPP A;  1BHL A;  4CJF A;  3ZSQ A;  1JCF A;  1O1W A;  3IG1 A;  2GWJ A;  3T19 A;  3SUP A;  1K8K A;  4RW9 A;  4CK1 A;  2F8S A;  4DV1 K;  4BGA A;  2HBK A;  4FXD A;  3GOI A;  3AA5 X;  3VQC A;  2JLE A;  5FRN A;  3SQ4 A;  3V9Z A;  1HYZ A;  3SPY A;  3PIO L;  3VQ5 A;  4CJ4 A;  3NGI A;  1R0A A;  4E7J A;  4DR2 K;  1QQC A;  2NNW A;  4HUF A;  1C1C A;  2VWB A;  1NKC A;  5BR9 A;  4CEC A;  3SCX A;  3D2F B;  1J54 A;  3SV3 A;  1X9M A;  4F3T A;  4ZTJ A;  2A1S A;  3HST B;  3I8D A;  4FWO A;  3L2W A;  5EX5 A;  3MWP A;  4FL9 A;  4KTZ A;  1C0M A;  3P39 A;  3ZSO A;  4CGH A;  3VPZ A;  3WEE B;  1GOB A;  2X74 A;  1S6P A;  1TK0 A;  4GKK K;  1LCU A;  2VG6 A;  3AVH A;  2QWP A;  1BA1 A;  2YNI A;  3P4I A;  4BR2 A;  3E9P A;  4BRL A;  1NGE A;  5FPD A;  3B6O A;  3ZSV A;  4MQ3 A;  2FSJ A;  3TAG A;  3SPZ A;  5I42 A;  4KPY A;  1NOZ A;  3JXU A;  3KLH A;  2Q97 A;  3EN9 A;  4DLG A;  1IBM K;  2WUS A;  4PUO A;  2HBM A;  3MN5 A;  3QDK A;  4JKB A;  2E6L A;  2Q0R A;  1HNX K;  4RG8 A;  2V7Z A;  3CCM N;  4FLZ A;  2F96 A;  1CZA N;  2IOC A;  4DCH A;  1W0H A;  3OBW A;  4UY8 O;  3SUO A;  1A5W A;  4WQ4 C;  1YF5 L;  5LL6 Z;  3PX4 A;  3DXK B;  2VWJ A;  5GIN A;  4OVL A;  4Z4F A;  3QEP A;  3KLG A;  4B8A B;  3OJS A;  3DLR A;  3OYI A;  5GIP A;  4IG0 A;  4JK9 A;  5ELZ A;  5LY3 A;  3VEO A;  3IDH A;  1TKX A;  4JHD B;  4CGJ A;  1X9J A;  3MED A;  4X66 K;  1VQM N;  2BUP A;  3FE1 A;  1VSK A;  4E0D A;  5C42 A;  3J81 O;  2P5O A;  1REV A;  3L4I A;  5BPM A;  3UKR A;  3K59 A;  2GBZ A;  2RKI A;  4GV6 A;  3H46 O;  3HBT A;  4DU4 A;  5T7B A;  4JS5 A;  3GBT A;  3ZSX A;  1IO2 A;  4YOU A;  5J2M A;  1NGA A;  4JI8 K;  2VG5 A;  1WOQ A;  4DSI A;  4C8N A;  2ZJP L;  4X62 K;  1NGG A;  4YOY A;  3LDO A;  4DB3 A;  1NGJ A;  4DUY K;  4WYB A;  5AZI B;  1T7P A;  1JL2 A;  2ZM6 K;  4KTW A;  5AZJ A;  2JWL A;  2A5X A;  1RT4 A;  3NHG A;  1NU0 A;  3OYE A;  2IVO A;  3VQ4 A;  1V4T A;  1SL0 A;  4EP4 A;  1B92 A;  3SLC A;  1QQM A;  2ZD1 A;  1D9D A;  5D3G A;  4PQU A;  2NRH A;  2NLX A;  4M45 A;  4AHV A;  4CES A;  3V81 A;  1TAQ A;  3WXL A;  4QS7 A;  4OPK A;  5JVG L;  2A3Z A;  4W5R A;  1NJI O;  4FLY A;  2W41 A;  4B1U B;  1RBT A;  2DY4 A;  1BUP A;  1IV0 A;  1KSP A;  3CQY A;  1LWC A;  2QKB A;  3ATV A;  4HUE A;  3L2U A;  3K9J A;  2IC3 A;  4DR4 K;  4Z4G A;  2O4I A;  4J2A A;  4DSF A;  3PX6 A;  3JAM O;  4AQY K;  3VQ9 A;  3DI6 A;  2HHV A;  3S9H A;  3TR8 A;  4H5T A;  4M3R A;  2UXC K;  1IJJ A;  2P5G A;  3D0P A;  2Z1G A;  5AQG A;  3QIC A;  3ZT3 A;  1YJN N;  3M6G A;  4OGE A;  1UAX A;  3TAM A;  3VF4 A;  4G1Q A;  3O9Q A;  4H4O A;  4AHU A;  1TKT A;  1YIT N;  1RDW X;  4FWM A;  4B9T A;  3EO3 A;  4DFJ A;  1XMO K;  3THY B;  4HTU A;  3BDP A;  4I9Q A;  4K25 A;  4I6M A;  3CC4 N;  3SJH A;  4I2Q A;  4B1W B;  3V6D A;  4CHZ A;  4DTN A;  3L3V A;  5FPN A;  1RTI A;  3RR8 A;  1E4F T;  3KK1 A;  2X6S A;  1Q8I A;  2YJE A;  4AF1 A;  3SV4 A;  3T1H K;  2E2P A;  2KFZ A;  4NCG A;  3DOL A;  4CJ5 A;  5SZT A;  1GLE G;  5AQY A;  4DQQ A;  3VQA A;  4EFH A;  2FBT A;  3PY8 A;  1MWM A;  2W6K A;  3W3D A;  1RGI A;  5C10 A;  1S72 N;  1VRT A;  4GV9 A;  4M3W A;  3DRR A;  5KQD A;  4BC3 A;  5C15 A;  3C6A A;  1SQK A;  3T1Y K;  3I55 N;  1GLB G;  3CC7 N;  2RF2 A;  2QWQ A;  1DTQ A;  3AVK A;  4BC5 A;  1NK6 A;  2DFF A;  4JD2 A;  2XY5 A;  1T05 A;  3V9X A;  4IOC L;  2Z1I A;  4B9S A;  3VF2 A;  1YVU A;  3AO4 A;  1NK0 A;  3CJC A;  2VGN A;  3VGL A;  4H0O A;  5C25 A;  3CM6 A;  4RCH A;  2QI2 A;  1RBR A;  5JMV A;  1RBU A;  1Q9Y A;  4FJM A;  2Q31 A;  4CVN E;  3J7Y P;  1JLB A;  5JVH L;  4FZZ A;  1QHA A;  1WAJ A;  1DT9 A;  4EIA A;  4ID1 A;  2X78 A;  5EVZ A;  4FJG A;  4LF9 K;  1ZBL A;  4NLB A;  4KV8 A;  4CF1 A;  3C95 A;  5DM6 L;  2E20 A;  3O3F A;  1HLU A;  3ZSR A;  3ZSW A;  3NCI A;  3HOT A;  5JS1 A;  1J6Z A;  3CCV N;  3THX B;  3PSF A;  4QAG A;  3VOV A;  1L3S A;  1KD1 O;  4BE2 A;  4MLE A;  2CH6 A;  3SUN A;  4J2B A;  3O9R A;  1RFQ A;  1RTJ A;  3CFR A;  3GL1 A;  1UA1 A;  4DQI A;  2ZJR L;  4JEP A;  1W97 L;  2EHG A;  3AVB A;  1HNI A;  2F7T A;  3OYN A;  4YDU A;  3O9S A;  3TAR A;  2D1K A;  5IT9 O;  2NRT A;  4A2B A;  3OY9 A;  2XO7 A;  1XNQ K;  4M63 C;  4MDA A;  1VQN N;  4ISE A;  1ZBU A;  1QZ6 A;  3RMD A;  2H3G X;  4KI4 A;  4KHY A;  3K5O A;  3CFP A;  4MFB A;  4Q5V A;  1RDD A;  1D5A A;  1RT3 A;  3ULE B;  3HVR A;  5CHI A;  3U9D A;  2E6M A;  3SAG A;  1I3A A;  4OO1 J;  4CHO A;  3RMA A;  1EET A;  4DS5 A;  4CJV A;  1VSM A;  4XH1 A;  2HHS A;  2WC9 A;  1XNR K;  4CZK A;  3CYM A;  4KHN A;  4KHP K;  3NGY A;  1VAZ A;  4JLH A;  1EWR A;  1K73 O;  2VYP A;  2AA4 A;  2NRW A;  3OYH A;  5C24 A;  4FZX C;  3FZK A;  4R5P A;  3L2Q A;  3AGK A;  3CIP A;  4O0I A;  1RDC A;  4CJS A;  3MAQ A;  2YV0 X;  3OYB A;  2P9S B;  2O8F B;  1IBL K;  3LP1 A;  5M1Q A;  2KW4 A;  3EKS A;  4OX9 K;  3TU5 A;  2KTQ A;  4BRG A;  4ID5 A;  4CZH A;  3KWI A;  1CLQ A;  1YXQ A;  1OVY A;  4LSN A;  4CEB A;  3AAP A;  1UA0 A;  1HKG A;  4E1J A;  1IKW A;  1TK5 A;  4DMN A;  4BRH A;  4BR0 A;  5AQJ A;  3AVF A;  2ASP A;  3BY5 A;  4CBW A;  3D45 A;  4IDK A;  2HST A;  2OA8 A;  4RW4 A;  4DWI A;  5CZ1 A;  1W2B M;  2D0A A;  5E26 A;  1VSE A;  3C0B A;  4OKK A;  2HW3 A;  2P9U A;  3LZI A;  4RW6 A;  4BRD A;  2Y1J A;  1W7A A;  4K8X A;  2O8E B;  4BE0 A;  3VTH A;  2NUB A;  3CQX A;  3MEC A;  3D2E A;  2XY6 A;  4B3M K;  3J7A P;  5BN9 A;  1I94 K;  1J5E K;  2YCH A;  3WUH A;  5AQM A;  4CJW A;  2OPS A;  1FK9 A;  3RMC A;  3LP3 A;  4KO0 A;  3K5L A;  1XHZ A;  4FOE A;  3QNN A;  4I2P A;  2GWK A;  4DF8 A;  3C7N B;  2E2N A;  1B9F A;  3LM9 A;  3QO9 A;  1XUP O;  3AVL A;  5AQK A;  4CK3 A;  4DLE A;  4JI5 K;  3KK3 A;  3SZ2 A;  3PIP L;  4A5A A;  4BWM A;  1TYQ B;  1C1B A;  2OZM A;  3VEY A;  3O80 A;  4FK4 A;  2HNY A;  3AVA A;  1ZBS A;  4DR1 K;  1XC3 A;  4IFV A;  4JI1 K;  4B9M A;  4LH4 A;  3VQ8 A;  5GAH P;  1N8R O;  2VWK A;  5KGW A;  4FLX A;  4FJH A;  4F3O A;  4F8R A;  4BVO A;  2IVN A;  3M3Z A;  2UXB K;  4CK2 A;  4BDZ A;  2P9L B;  1VSI A;  3BZC A;  5TKY A;  2QXF A;  4NCA A;  1VQ8 N;  2YHY A;  3A5L C;  5AQQ A;  1M90 O;  3DWL A;  4IDH A;  4E1N A;  5GAE P;  1SL1 A;  1JXB A;  2P9I B;  1R59 O;  4H4M A;  3JYT A;  5LJV A;  4DHY A;  2G8W A;  1IKV A;  4XEI A;  3VER A;  4PL8 A;  5BRE A;  1HYS A;  3A2F A;  1ASV A;  3V9S A;  1SUQ A;  4CED A;  2G8H A;  3BP8 A;  4WCE L;  4QCL A;  1WAF A;  5AQZ A;  3FFK B;  1KFD A;  4KRE A;  3CMA N;  3DMJ A;  4JRQ A;  4DTR A;  3NFA A;  3TI0 A;  3MN9 A;  4H5R A;  3TAN A;  2F4V K;  1TVR A;  1Y97 A;  4DV5 K;  1XMQ K;  3KIO A;  4H0P A;  4FLT A;  3M8R A;  4FK0 A;  3QIP A;  3VES A;  4CZJ A;  4EHU A;  1X1P A;  3O3H A;  3VGK A;  3IS9 A;  3QEI A;  1ASU A;  4ELU A;  3FGU A;  4YOR A;  3NBP A;  2GUP A;  1RDU A;  2ITG A;  1VSD A;  1NMD A;  3J8A A;  4DV0 K;  2BH1 A;  3O4W A;  4CJP A;  4DTJ A;  4IWV A;  2HHU A;  3DM2 A;  4H03 B;  3RR7 A;  3B6P A;  1TL3 A;  3ZEU B;  4CEA A;  3VGM A;  3L2R A;  4FVM A;  3WXK A;  5KRT A;  4FWK A;  4WQ5 C;  3VQ7 A;  1U2V A;  3AAR A;  4CEQ A;  1VQ4 N;  5KGX A;  2HB5 A;  3KKR A;  4EZ9 A;  5DMR A;  4BRC A;  3RSE B;  4LFA K;  4HVJ A;  4ELV A;  1RT5 A;  3BEX A;  1YJ9 N;  1HX1 A;  1LOT B;  3LP0 A;  3TSQ A;  5AQF A;  1BL3 A;  4JKG A;  4NYF A;  3U3G A;  5LMN K;  1GOA A;  2ITM A;  4XH5 A;  3T3F A;  3QLH A;  2F9T A;  2P9N B;  2FLO A;  3DLK A;  1KRP A;  3HK2 A;  4DTM A;  4DV7 K;  1D8Y A;  4OJR A;  3OJU A;  1NK9 A;  3LZJ A;  2WOM A;  2HHT A;  2AJQ A;  4DQS A;  3CC2 N;  2GEM A;  2PFU A;  1OH7 A;  2X6N A;  3OYK A;  3AVM A;  5GAG P;  3AO2 A;  4CZM A;  4CW7 B;  4ISF A;  4CD3 A;  3NF7 A;  4FW1 A;  3ZT1 A;  4XIU A;  1Q81 O;  1YTA A;  3SI6 A;  3PO5 A;  3HRG A;  3V1O A;  1HRH A;  3OS2 A;  4C8L A;  3O1W A;  5C12 A;  4FJI A;  2O8C A;  1P8Z A;  1NKB A;  2IVP A;  2D0P A;  4DG1 A;  3W0L A;  3CPW M;  3TPQ A;  5FRO A;  3VEX A;  1NJY A;  4KAZ A;  3CJ9 A;  1S1V A;  3OYJ A;  4CFD A;  3QBW A;  1JJ2 M;  1WSF A;  2BGG A;  4KHU A;  5CY4 A;  4B9U A;  1U48 A;  3HZ6 A;  4RWT A;  1JL1 A;  3RVC A;  3CD6 N;  4YOV A;  3PX0 A;  3VMF B;  1T8E A;  2OPQ A;  3CFO A;  4M7Y A;  2O8B B;  5J1E A;  5DK5 A;  1ZBH A;  1KTQ A;  2E1Z A;  3HP9 A;  1BIS A;  3ENB A;  3MXM A;  4JS4 A;  2JWK A;  1DKG D;  3OA9 A;  5BPL A;  4DQ8 A;  5M1O A;  3MEE A;  4KHW A;  4B1Z A;  2OYQ A;  3H45 C;  3D2F A; 
#chains in the Genus database with same CATH homology
 4LFA K;  2UUA K;  1N34 K;  4JYA K;  4DR1 K;  4LFB K;  4DV1 K;  1N32 K;  3T1H K;  4JI1 K;  3J81 O;  4LF5 K;  5LMN K;  4JI2 K;  2HHH K;  1XNR K;  1N36 K;  4KHP K;  4DV7 K;  1FJG K;  2UXB K;  4JI0 K;  4DR2 K;  2VQE K;  1HNW K;  4JI8 K;  4B3R K;  3J80 O;  3T1Y K;  2VQF K;  4LF7 K;  4X62 K;  4DR3 K;  4JI6 K;  4DUY K;  4DR5 K;  4YHH K;  5LMU K;  5AJ3 K;  2ZM6 K;  1IBK K;  2UUB K;  1IBL K;  4LF6 K;  4OX9 K;  4CW7 B;  4GKK K;  4NXM K;  4CVN E;  2UUC K;  3J7Y P;  4DV4 K;  4B3S K;  4LF4 K;  4DV2 K;  3OTO K;  4LFC K;  4JI4 K;  4LF9 K;  2F4V K;  5A2Q O;  4DV5 K;  4YY3 K;  1XMQ K;  1IBM K;  4X65 K;  2UXD K;  4DV3 K;  5FLX O;  4GKJ K;  5BR8 K;  4DV6 K;  4DR6 K;  4DR7 K;  1HNX K;  4JI3 K;  1HNZ K;  4NXN K;  4B3M K;  4DR4 K;  3J7A P;  4DUZ K;  1I94 K;  1J5E K;  5LL6 Z;  3JAM O;  4DV0 K;  4LF8 K;  4AQY K;  2E5L K;  4JI7 K;  4X64 K;  4B3T K;  2UXC K;  5IWA K;  4JV5 K;  1N33 K;  2UU9 K;  5IT9 O;  4JI5 K;  1XNQ K;  1XMO K;  1HR0 K;  4K0K K;  4X66 K;  4V19 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...