1N32K

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1n32K00
2F4VK 4AQYK 4JI8K 3JAMO 4B3TK 4B3RK 4JYAK 4GKJK 4CVNE 4JI7K 4V19S 2HHHK 2UUBK 1HNZK 4JV5K 4LFAK 4YHHK 2VQEK 4DR3K 4B3MK 1IBMK 4DR6K 4LF5K 2UXBK 2ZM6K 4NXMK 2UUAK 4DV1K 4OX9K 4LFCK 4X64K 4X65K 4NXNK 4JI1K 4DV0K 4LF7K 4DR7K 3J7YP 2UXDK 4JI5K 1N32K 4LF6K 4LF9K 4LFBK 1XNQK 5LMNK 1N33K 4DV6K 4DUZK 4DV2K 5LL6Z 4DR4K 3T1HK 2UXCK 1XMQK 4YY3K 1XNRK 5BR8K 3J80O 4DV3K 2UU9K 4DV7K 4X62K 3J81O 2E5LK 2VQFK 5LMUK 4LF8K 3OTOK 3J7AP 4K0KK 1FJGK 1IBKK 4LF4K 4DR1K 2UUCK 4GKKK 3T1YK 1I94K 5AJ3K 1J5EK 1HNXK 4DUYK 1N34K 4DV5K 4B3SK 4JI3K 4CW7B 1XMOK 5IWAK 4JI6K 4DR2K 4KHPK 4JI2K 4DR5K 1IBLK 1N36K 4JI0K 5FLXO 4X66K 4DV4K 4JI4K 1HNWK 5A2QO 5IT9O 1HR0K
chains in the Genus database with same CATH superfamily
3MAQA 3B6PA 4BGAA 3UKUB 4KH6A 4B3RK 4JI7K 1GLJO 4BRHA 4DTUA 4Z4EA 4MDBA 4BVOA 3AO5A 1RT7A 3AA5X 4BR9A 3HTVA 4BE2A 1ZBIA 4MO5A 4BWJA 3K58A 4OX9K 2P9NB 1X3NA 2GEMA 1IH7A 3VESA 4CJWA 3JS6A 4CHOA 3E9LA 3DRSA 4CIGA 2F9TA 4JKHA 2YNHA 2VWJA 4CEDA 1LW0A 5KRSA 2Q31A 4B9QA 2JGUA 3SQ2A 4C23A 3AARA 3ZT1A 3P39A 1SKWA 4IOXA 2J4RA 1ASWA 2QK9A 3NF9A 1U47A 4DR4K 1BA0A 2E88A 4NCGA 4G9ZA 4AHSA 5GAEP 1WSIA 4FWLA 4YY3K 4IG0A 4NLBA 1BGXT 4FVMA 4BG8A 4H03B 1T8EA 1NGHA 4I2QA 4M45A 3TSPA 1QHTA 3AVKA 1BOTO 5AQKA 1CZ9A 4O8UA 4LH4A 4NYFA 1FJGK 1IBKK 3WXIA 1L3TA 3DLBA 4IFYA 3SV4A 4JK9A 2KQ2A 2PAVA 2VCPA 3A2FA 1K9MO 4FWKA 3K5LA 3CCEN 1M90O 3DLEA 2XHBA 1RDBA 1HNXK 1TKTA 1NKBA 4B3SK 4C1NK 4FWMA 2Q97A 3ZT2A 3L2RA 4J2EA 4YORA 3FFIA 3DRRA 1TK0A 4CHYA 1WSGA 4BRAA 2WOMA 2PYJA 5I9EB 4XH4A 4BY9C 3VMFB 3DLHA 5H1SQ 1KAYA 1VSJA 3CQXA 2KLAA 1NNEA 4PA1A 1VSDA 5AQHA 4FPAA 4CEQA 3K57A 1FKOA 2YNGA 2V7YA 3DJCA 1D9FA 3HJFA 5AZJA 3CD6N 1KC8O 3CCJN 3AY9A 2P9SB 4DWIA 1RBUA 3ZX0A 2E8AA 1VSFA 1WSHA 4A59A 3THWB 2WFBA 5M1OA 4WYBA 2NRHA 3LDLA 5GIPA 2QA4N 2E2OA 5KTQA 4IEEA 2DTUA 3GOIA 4DKWA 3VQDA 1Q9YA 4DR7K 1V4TA 1D9DA 4BC2A 3VQAA 1Q82O 1QHAA 4WFAL 5I3UA 2IIRA 4RCHA 1QTMA 4YOVA 4WCEL 1HJOA 1NM1A 3SBTA 3VQQA 3DLLL 4H5TA 2PFUA 3HT3A 3J8AA 3QB0A 2A6AA 4DSFA 3QICA 2YKNA 3EKUA 4OGCA 1S72N 1HMVA 1HKBA 3HZ6A 5EVZA 3ENBA 1Y64A 2HNYA 3SJHA 3THVA 3BDPA 3EY1A 2GV9A 4Y1CA 4LF8K 4CF0A 5CY4A 4BQLA 4BVPA 3AVFA 4KH5A 4DSLA 3AAQA 3DM2A 4YOYA 2O8EB 3NE6A 4CJ5A 2B4JA 2HBMA 3A5MC 2ATQA 4WQ4C 4M3XA 1BO5O 1GOAA 2E2QA 4WE1A 4FM2A 1KLMA 5HRPA 4ICLA 4AF1A 4CHZA 3ZCMA 5AZIA 4CZLA 2P9IB 1I3AA 2NUBA 1HRHA 1EWQA 1YJWN 3CJCA 4O5BA 2ITMA 5FPNA 2BTFA 4BRDA 3PX6A 4KV8A 3KLIA 1IG8A 2P9LA 3QO9A 1YHQN 4FXDA 3M8QA 4YOTA 4CD3A 3SJJA 4BE1A 4M63C 4YHHK 4JS4A 2A3ZA 4DR3K 4DR6K 3C0BA 4IFEA 1X9MA 1R0AA 3E01A 1SKRA 1GOCA 5HP1A 4IG3A 4HCBA 1WSEA 2BH1A 5JVGL 1XUPO 1S5JA 1L3VA 3H1QA 3HI0A 4FLZA 1KSPA 4ILGB 4GY2B 1W0HA 3MDQA 2AJQA 4EP4A 1GLDG 1ASVA 2A1RA 3ENHA 1XNQK 2QXLA 2UYTA 1N33K 3VA3A 3I0SA 4RW7A 3PIPL 1QQCA 3KLEA 3FZMA 4DV2K 4OGEA 3DLGA 3SUNA 4J2DA 2R7YA 3RRHA 4KHWA 2UXCK 3K0SA 4K25A 5KPZA 2YJEA 4FJMA 2E1YA 4HUFA 4UQGA 4FO0A 3LDQA 5AQNA 3ZSXA 2IS3A 4Z4CA 2WBNA 1BG3A 4UY8O 4XH1A 2HB5A 4X62K 4B8CA 5TKYA 5GIOA 1VQKN 4PL7A 5BN9A 1LCUA 1I39A 3WUHA 4FWQA 2V52B 3S3OA 4K0KK 4PKHA 3HSTB 1JJ2M 4OPJA 3RSEB 4BRIA 4BRFA 1C1BA 4IOCL 3KKSA 3CQYA 3AVJA 3ENOA 4FJ5A 3EZWA 4CJ4A 4KB0A 5AQFA 1T3VA 3F9MA 3HOSA 5AQWA 4BG9A 1XMOK 5IWAK 4NCBA 1TL1A 2Y1JA 4ILHA 2I7NA 1Q18A 2O8DB 4CEEA 1QQMA 2YNIA 2ZGZA 4CZJA 3O08A 5BRDA 4W5OA 4CJQA 3MEDA 3QINA 5A2QO 3QERA 5IT9O 3NH0A 2F4VK 4K42A 3OYFA 4EZ9A 1IKVA 3NAEA 3FZFA 1LAWA 3LPUA 3L6QA 4XIUA 4V19S 4Q5VA 4KAZA 4PWDA 3TAEA 1J53A 3HSCA 4FWRA 2O8CA 3TAMA 4AM6A 3CJ1A 2DFEA 2HW3A 1NWKA 5KRTA 2FC0A 5CZ1A 5EXWA 3SK3A 4QS8A 5GADP 1S22A 2YNFA 3VF2A 3I8DA 3LL3A 5AFUH 4CZKA 1RTHA 2P9UA 5FRMA 4JI5K 2E1ZA 4E1NA 3U9DA 4KPYA 2D0CA 1NK0A 1QZ5A 2HF3A 1N32K 5AQTA 3QEXA 1HPMA 5AQMA 3MXJA 3V9ZA 3LANA 3KLHA 4FZYA 4M3TA 2P9UB 4FJ7A 4B9LA 1Y97A 2G8KA 3H46O 1ATNA 4BDPA 2E6LA 1VQ6N 3SV3A 3ATUA 3OS2A 3VEWA 1VRUA 1X1PA 4CGHA 2HMIA 3UIQA 1QQOA 3C94A 3PLAA 5HL7L 4O0IA 4DSEA 2O8BA 3ZYYX 4FLVA 1EO1A 3ALYA 4CFBA 1QVGM 4Y0WA 3OTOK 2A41A 3OYAA 2D0PA 2P9KA 5F1XA 2YJFA 4M3YA 1UOCA 4GKKK 4IEIA 4BRGA 3RTVA 3IDHA 1S1UA 3NH1A 5M1NA 3OYJA 4H0PA 1KRPA 4M42A 1UA1A 1JKHA 3O5BA 1IBLK 3SQ0A 1ZBSA 4CIEA 4X66K 2CH5A 3MN9A 4DV4K 1EETA 1T03A 2ASMA 1WN7A 1TKZA 1U48A 1S9EA 4MLHA 3ULEA 4JKGA 3I33A 4B1WB 3A0IX 1B92A 5SZTA 1NGAA 4A2BA 4FJXA 4B3MK 4FK0A 4PQUA 1NGFA 3G4SN 1RT6A 3O9RA 3KTQA 2HHUA 4DF8A 4DV1K 1VQ9N 1BIZA 5AQOA 4B1UB 5F0XA 4X65K 1VK0A 4BR4A 4DTMA 4OLAA 2JLEA 4RW4A 3G6EN 4IKFA 3DXKB 3WNGA 5JVHL 3K5OA 4ISEA 3LWLA 2HHVA 2A40A 4K43A 4E1MA 4F4KA 4DG1A 4Z0UA 5BREA 4CE9A 4KHSA 1JLGA 1WAFA 3MWPA 3CG7A 3DOKA 1TGOA 4DB3A 1JCGA 3ID6A 4H4OA 4FVUA 2HF4A 2O4IA 1KVAA 3I55N 3C6HA 3OJUA 2NZTA 3L2VA 3L4IA 4ISGA 3OYLA 2KKZA 5BRHA 4I7FA 2QEXN 1YVUA 2KHOA 3OYDA 4ID5A 4CK3A 3V4IA 3LAMA 3J7ZO 3ZLJA 4Z4IA 4B3OA 5GINA 3A5LC 3HP6A 2GUIA 3QESA 4ZTJA 4IO9L 1DTQA 1V4SA 2YHAA 5CR4A 2GX9A 1RT1A 3BUZB 3HO1A 5HRRA 3THYB 3AO2A 3KK3A 3AVCA 1JLCA 3QEPA 1U49A 2D1KA 5M1KA 3VQCA 3WQUA 1N36K 3EYZA 5DM6L 5FPMA 4CCHA 3PX0A 4CJ3A 2JWKA 4CIFA 2Q1NA 3AVHA 3V9SA 5CYMA 1X9SA 3LAKA 4WQ5A 4B3TK 4KBOA 3CPWM 1CZAN 4H5WA 1HUXA 5HROA 2YHWA 3TU5A 4KI4A 1L5UA 4FZXC 3V6DA 4CF9A 4I9QA 4BWMA 1WBBA 3GG4A 4LFAK 3E9OA 4OPAA 1K6YA 3CCQN 4NB4A 3OA9A 4YDUA 3UKUA 4CZGA 4LFCK 5DMRA 3D2EB 1CLQA 3R6MA 4FJLA 3JXUA 1QSYA 4LF7K 1XWLA 1N5YA 5EY4A 3VETA 3IKMA 3HVTA 3BZKA 2Y1IA 3SYZA 3Q7CA 4IO8A 5JLHA 4DTSA 5CZ2A 1XC9A 1JLEA 2P9NA 4KI6A 2KW4A 3WXJA 1HLUA 3VEYA 1Q81O 1M1KO 3QIOA 4B9SA 1SKSA 1YT3A 4H0OA 1YJNN 4E0DA 3DOLA 4U7BA 5FROA 3MN6A 1E4FT 1HPZA 3IG1A 3LP3A 2YX6A 1WB9A 1U2VB 4HWIA 4JD2B 3TAQA 4CHQA 2NRZA 4PL8A 2YI1A 5AQPA 5C42A 4L3QA 3HYFA 5LY3A 3CHWA 3V81A 4IBNA 4LD0A 4KHQA 1LWEA 3SAHA 3E66A 3VQ9A 4MQ3A 1N8RO 4JKEA 2XY5A 5EU7A 1H1VA 3OHRA 1GLCG 3O4QA 3JYTA 2DY4A 1C1CA 2D5RA 3MXIA 3AVAA 3ZT0A 4FJ9A 1XHXA 4FOEA 3M8RA 1XQSC 3THXB 4JI6K 4M41A 4OJRA 3HPOA 4H0XB 4JI2K 4DR5K 4FOIA 4GV3A 3F2KA 2D0OA 1LWCA 4RTFD 3MEGA 1LW2A 2OANA 2Z1HA 3AVIA 3D2FA 1GOBA 4BR2A 3VQ6A 3C7NB 1NK4A 3L2UA 1NJIO 1SS6A 3EO3A 4DQPA 3D2FB 2LSNA 3SPZA 4JKBA 2XY7A 5T7BA 1KXPA 5AFUA 1OH5A 3RRGA 4NYNA 1VRTA 1JCEA 2ASPA 3QFUA 1HX1A 3OY9A 3DMJA 1L3UA 2P5OA 4AH9A 4BGBA 5C10A 4NXNK 1JLFA 1MU2A 1MDUB 3SLCA 5TKWA 1YVNA 1KQSM 4O0JA 3R8EA 2UXDK 3P1GA 5AQUA 2P9SA 2XO7A 4HVJA 3NMUA 4A62A 5FPEA 3THWA 1TKDA 1L3SA 3QEWA 5HRSA 5AQVA 3LDSA 3QLHA 1JCFA 3OYKA 3BF3A 3VEOA 3QEVA 4NO7A 1C0FA 1GLEG 4DTJA 2IAJA 5LL6Z 4CJ7A 4F2SA 4B9MA 1VQMN 1VQ7N 5D3GA 1J6ZA 2V7ZA 1DGKN 4FM0A 3HL8A 4A61A 2JWLA 4PY5A 1HYZA 4DV7K 3ZEUB 3J81O 4W5RA 3HP9A 1HNVA 5C2DA 1NGGA 3J7AP 1RBVA 3KJVA 3VEVA 2IGIA 4IZ9A 5AR0A 4JAXA 4EHTA 3U4LA 4CEBA 1VQPN 4HUGA 3DXMB 4AHRA 3AO4A 3QMLA 1S3XA 4HCCA 4IOAL 4OKKA 3TTDA 4CGIA 4B9NA 3VQ7A 4FW2A 4FWSA 2CGJA 2O8EA 2QWLA 4R79A 1YI2N 3ID8A 4JI0K 4FLYA 1J5OA 3M6GA 1HNWK 2PYLA 3MCAB 3A8YA 2F96A 5K14A 5JMVA 2FSJA 1HR0K 2CH6A 3NF8A 2QWOA 4KHNA 4BRMA 4DLEA 3WXLA 4KTWA 3SAGA 2OCEA 3MX2A 4DLGA 4B9UA 1VSHA 3LM9A 1ZBUA 2NRTA 2P9IA 2HBJA 3CF5L 1LOTB 1QSSA 3JSMA 1QVFM 3L3VA 2VQEK 1IBMK 2FSKA 2ZM6K 3V1QA 3K5MA 4FLWA 2V51B 1BCMA 3K2PA 5LJVA 4O55A 2D0AA 5AQLA 3P4IA 3O6WA 4KH4A 1YJ9N 4ELTA 3OVNA 4I6MB 3AA4A 3DWLA 3MN5A 1SL1A 3MK6A 1HQEA 4M3ZA 1TAQA 4MDAA 3AVGA 3ZSYA 1K73O 4LFBK 2NLXA 1ZBHA 3FFKB 4A5AA 3IAYA 4CJLA 4CZEA 5J2NA 3FGUA 3HPHA 2X78A 3VPZA 3QNOA 4OO1J 4CBWA 3GE1A 1YAGA 1NGBA 4PHTX 3D0PA 4O5FA 5KQ8A 1HNIA 2X6NA 3CCMN 4A5BA 3ZT4A 1HYSA 4IJAA 1JLAA 3SQ1A 3H45C 3CETA 4O44A 4JLHA 1NJZA 3UKRB 3ITHA 1DLOA 3FZKA 5J1EA 1D8YA 2FXUA 1QZ6A 4BACA 3ZSQA 3O1BA 2IOCA 4J2AA 1C6VA 4EHUA 3RVCA 3PO5A 2A1SA 3DAWA 4DSJA 4FZZA 4DUYK 2OPSA 2XY6A 4JI3K 3S3NA 4XH5A 1TK8A 3EN9A 5KI6A 3RSEA 4BC4A 3TARA 5GAHP 3NGYA 2ZWHA 4BR7A 4DFJA 4CJUA 1W2BM 3NDKA 4PKGA 3DYAA 4XEIA 5CHIA 1KTQA 1KVCA 4JI8K 1O13A 1NK9A 4A57A 3ZSVA 2O8DA 3HRGA 1OVQA 4GV9A 3L2WA 4DQ8A 3SNNA 2QWPA 1EKEA 4JKDA 4JN4A 3VERA 1TYQB 1TUUA 1C0TA 3OS0A 1VSEA 2FBYA 2YV0X 2BGGA 1TK5A 4AM7A 2ZJPL 2VWBA 3OBYA 3O3GA 4CHPA 4JI1K 3T1AA 2YHXA 3BGRA 1HQUA 1NOZA 4PKIA 3EE9A 2VG6A 3G0ZA 4BDYA 4LF9K 4YOUA 2O8FB 1RBSA 2PY5A 3CCVN 5FPDA 4GVEA 1VQLN 1G99A 3IUCA 1Z05A 3ZETB 5AQZA 3U9ZA 3CCRN 3O8MA 1U6ZA 2W42A 2Q3SA 3QDKA 3O3FA 3VGLA 4R5PA 1HKCA 2BUPA 3I0RA 3LDNA 4OPHA 3D45A 3AVNA 5AQRA 1J54A 1RT2A 3K5NA 1B9DA 3RMAA 1NGJA 1RT5A 3TANA 1IKXA 1KAZA 1YTUA 2KFNA 5SWMA 3CMAN 4M3UA 3U3YA 2G8HA 4CZIA 2IDOA 4EZ6A 1RDCA 1IKWA 2F7TA 3NCIA 4DSKA 4C8OA 4E7JA 3WXMB 1DT9A 3O3HA 4CI6A 4Y1DA 1DTTA 1QS4A 4KTZA 5AQXA 3SBGA 3QNNA 3GL1A 1TKXA 3K59A 3AV9A 3AGKA 4CEAA 3ZT3A 5ELZA 4DTRA 1NLVA 1TL3A 2A5XA 4EP5A 1WSJA 3F73A 1IV0A 1IO2A 4CF2A 4CFDA 2HNZA 3O9UA 3OBWA 5AQGA 1T6DA 5KPTA 4E89A 4F3OA 4B9VA 3CI5A 2HNDA 3LALA 1NMDA 1N6QA 4ZTFA 4BR5A 1HNZK 2QI2A 1D4XA 2P9PB 4AHUA 2XY8A 1SQKA 4CZHA 4NXMK 1IG9A 3LP1A 4FJNA 4CZMA 1YIJN 1VSIA 3CFOA 2ZF5O 2NRRA 1MWKA 3O4NA 1FW6A 3OJSA 2P51A 1O1WA 3FZLA 2KTQA 2X6SA 2HHXA 3KD5E 3HM8A 5AQJA 4FWOA 4H0VB 4WF9L 4DV6K 4DUZK 5M1FA 3V9UA 2W6KA 3CM5A 1S1WA 3C6AA 3PUFA 1K8KB 2RN2A 3MN7A 3FR0A 2FBVA 4KRFA 1WOQA 3KWGA 1NOYA 2OZMA 3DXKA 4IDHA 4CJRA 3MEEA 1KFDA 4H5RA 2QWMA 1T05A 3C6TA 5BPMA 5AQYA 2E5LK 4ID1A 3L3UA 2VQFK 3CCLN 1VAZA 4JK7A 3DI6A 2VYPA 3U8XA 2Q0UA 4YNQA 1SL2A 2E20A 3BEXA 1YTAA 3O9QA 4RWTA 3CYMA 3VA0A 3T1YK 3G71N 4DFMA 4B1ZA 4PUOA 3AO3A 2G8IA 5AQIA 3OS1A 3EL2A 2IVNA 1QE1A 2FBTA 3RWUA 3LPTA 1SL0A 4DR2K 1NJXA 3NH2A 1KCFA 2ZE2A 4DU3A 1A5VA 3VF6A 4RW6A 3DRPA 1BWFO 5FLXO 1LAVA 1HKGA 2Z1JA 1WBDA 2VG7A 5BPLA 3KD1E 4AQYK 1WLJA 1BL3A 1RBRA 3MCPA 1ZBFA 1CXQA 2A42A 4OKJA 3S41A 4FW1A 3THYA 5KPRA 3SZ2A 4CJTA 4M7YA 3WEEB 4WFBL 1Z25A 2QW9A 5ADXA 3K9JA 4MLEA 5FRNA 5AQSA 4W5QA 4CEOA 4BR0A 2UXBK 3KLFA 2GTDA 2UUAK 4TSXA 4OKEA 1HJRA 2YHBA 1OH8A 1W7AA 2OTLN 3CJAA 3VQBA 1IKYA 3J7YP 2IVOA 1JL2A 4M7XA 2GELA 4YOXA 4CGJA 2HHQA 1MWMA 2FSNA 3CCUN 2B5JA 2DFFA 3D2EA 4KB1A 1J9AA 1NGDA 3VEZA 4C1NI 3VGMA 4H0TB 4FYDA 1D5AA 3T1HK 4J2BA 3AVMA 4GW6A 3T7ZA 4KO0A 1NKEA 3M3ZA 1ZYQA 2RPIA 3AVBA 4IWVA 3M8SA 4AHTA 3OYHA 4OLBA 1OH6A 4B9TA 3A5OC 3HK2A 4CF1A 1JL1A 3OYCA 3ATVA 3L0QA 1A5XA 3WXKA 2NNWA 1BISA 4CHNA 3T19A 2FLOA 1U2VA 3QFPA 4FLTA 4OVLA 3AAPA 4JD2A 1RDWX 4DQSA 4CGGA 1VQ8N 3SMSA 3TWHA 3H6EA 5BPNA 1NK7A 2KFZA 4DV5K 4DMNA 4DFPA 3OW2M 1TVRA 2VWKA 4H5NA 4I2PA 4LC9B 5J2QA 2OA8A 3G10A 1FK9A 4FK4A 5J2PA 3VQ8A 3UE5A 1SAZA 4BRCA 4DU4A 1XHZA 1TV6A 1NG9A 4BE0A 4FCYA 3PSFA 3THXA 1NBWA 3VTIA 5JLFA 3CC2N 3O9TA 3VTHA 4CVNE 1BHLA 3LDOA 3SAFA 3B6OA 5M1PA 2QKBA 2B6AA 3T3FA 4HHTA 2NRVA 3V1OA 1NJWA 4F2RA 4JV5K 2WTUA 4CFCA 3CFPA 4DTPA 1T44A 3C7NA 3HOTA 5BRFA 1C0GA 4HTLA 1RDDA 5MLCQ 3PV8A 1WSFA 3RMBA 1ITGA 4KHYA 4IDKA 4DV0K 2KZZA 4CEZA 1ZXOA 3M8PA 2HBLA 5F2RA 2EX3A 3TSQA 4M3WA 3LZJA 1BQNA 4LF6K 3FLCO 4JEPA 3EEQA 3WNEA 2W6LA 4G1QA 4H8KA 2E6MA 5BR9A 3H1VX 1IJJA 1RFQA 4IJNA 4BRLA 4LH5A 4BROA 3B8AX 3GDQA 3SI6A 2IC3A 4H4MA 1YXQA 2OPQA 1S6QA 2VGMA 3OYIA 1LV5A 4DHYA 1XNRK 1A5WA 2E2NA 4FJIA 1U45A 3LWMA 4DQQA 5E41A 3QEIA 4FSVA 1RDAA 3LP2A 3CC4N 2RE2A 3Q7BA 2Q36A 4CJSA 2Z1GA 2OTJN 4JS5A 3K9KA 4RW9A 2CGLA 1RILA 4EIAA 4YFUA 1CZBA 1W9HA 5AJ3K 3ZEUA 4W5TA 5B8HA 3CCSN 5JS1A 4JKFA 1ESVA 3HPGA 4CW7B 3EKSA 1BA1A 3G25A 4Q0BA 3HBTA 4MO4A 5C0YA 3ZX3A 1NMNA 2Q0RA 4CGFA 3DXMA 4FPBA 1G15A 3CJBA 4JNEA 5AZJB 1SUQA 3PX4A 1BDGA 2RKIA 3HVRA 2QM1A 3TI0A 1TUYA 4NLCA 3CPEA 4KTQA 3F9KA 1U4BA 3E1YA 4WFNL 3TAFA 3LDPA 3C65A 3D7EO 1VHXA 4B8AB 1ATSA 1T6CA 4FLXA 2P1JA 2EHGA 3V1RA 2HHWA 3ISNC 4LF5K 4JRQA 1OKJA 5LJWA 3TTCA 2IVPA 3SUQA 3MECA 2O4GA 4E1JA 4X64K 4QCLA 3KK1A 4FJKA 1DKGD 1MA9B 4EAHD 5HRNA 4N5SA 2YHYA 4CJEA 4CZFA 3F5TA 2G8WA 2OZSA 4QOZB 4A2AA 4JKAA 3AVLA 4QS9A 3N4QA 1EX4A 4KREA 3T69A 2ZJRL 3W3DA 3S9HA 4NCAA 4AHVA 4DQRA 2F8TA 4L8RB 3R1XA 3CC7N 4I6MA 5J2MA 4O4GA 3O80A 1EP4A 3PY8A 1WUAA 5HBMA 2PZSA 4RG8A 1BU6O 2AA4A 4K8ZA 1BI4A 3WNHA 1RCHA 4BRPA 2ETJA 5ADXH 1YITN 4CFAA 3I56N 1E4GT 5AQQA 1K8AO 3SMPA 5LMUK 1RDUA 4DTXA 4BRKA 1BI4B 3NVMA 4DTOA 3SCXA 1NK5A 3W0LA 3NHGA 1NU0A 2CGKA 4WQ4A 1C0MA 1QSLA 1S9GA 3AGRA 4FJGA 5AZIB 1EXQA 3CIPA 3KVGA 3R3LA 2WUSA 1KLNA 5KQDA 3GBTA 2GWKA 2WONA 1S1XA 1OH7A 3KK2A 3MMVA 2QTDA 1Q8IA 3UKRA 1RTJA 4HTUA 4BREA 2P9LB 4KHPK 4IFVA 1RT3A 4CD1A 2RF2A 4GNIA 3HM9A 5FDLA 2HSTA 1Z26A 4JRPA 4E7IA 4CBUA 4JI4K 1T7PA 3NGIA 2NRXA 1GLBG 3KWIA 4DS5A 1Q9XA 3NBPA 3TAGA 2OYQA 1P8ZA 4JYAK 4YOWA 3NF6A 3RMDA 4B1VA 4M3RA 2BANA 2UUBK 3KLGA 3DLRA 4ISFA 4C8KA 3WT0A 4ILJA 4FL9A 3ZSZA 2FBXA 3V9WA 4CBXA 1WNSA 3BZCA 3OYGA 3EE8A 3IRXA 2HHTA 4DCHA 1Q7YO 4F8RA 1VQON 1Q86O 4J8FA 4CECA 4CK1A 2QWNA 3H3OB 1X3MA 4FWPA 1KVBA 4DF4A 3FZHA 4I9LA 1TYQA 3KKRA 5C24A 3MXMA 5JS2A 2G8FA 3VGKA 2E4LA 3NFAA 5DM7L 1Z6RA 1VSLA 4N47A 4FJHA 5CE3A 1QQNA 2ASOA 3LM2A 3QIPA 3N4PA 4O8KA 3KHYA 1NGEA 2BE2A 1C1AA 3RR8A 1U04A 1SV5A 3ZSOA 3DLKA 3VENA 4BRNA 3CFRA 1ILYA 3OYMA 4K41A 2HBKA 1VQ4N 3QBXA 2O8FA 3J80O 5HLFA 1F21A 1BCOA 2GBZA 2UU9K 4GV6A 4Z4FA 4KHUA 1ASUA 3P83D 1BUPA 1GLLO 2W41A 3ZETA 2HVIA 2KZMA 4FK2A 2D4WA 1ZC6A 3C95A 4LF4K 4N56A 1KD1O 3ASMA 1R59O 3L2QA 3CJ9A 2UUCK 2Q2RA 3CJ7A 3SQ4A 1NGIA 3U3GA 4CJFA 4FJ8A 2OPRA 3P5JA 2YCHA 2DFHA 3L4QA 3AA2A 3SUOA 3TABA 2BDPA 3IFRA 4U67L 3O9SA 4BC5A 3O1WA 1S1TA 3BY5A 4BQZA 2RHKA 1TAUA 1E3MA 4C8NA 4EFHA 3TAPA 3RR7A 2O8CB 1NJYA 3TSUA 1JLBA 3NGZA 4GKJK 3V9XA 1X9WA 3VOVA 4H0YB 5E26A 3ZSWA 2DPNA 2HHHK 4ELVA 4RW8A 2G8UA 4FJJA 5I42A 2NRWA 2EWSA 4KFBA 3WQTA 4W5NA 2HMPA 2XRIA 4N76A 1BQMA 3QBWA 2AP1A 1RNHA 1NKCA 3VEXA 4B08A 3LP0A 3NVKA 2I7PA 3AA3A 3L8BA 5BN8A 2P9PA 3KZBA 4FWNA 3TPQA 5KGXA 3WNFA 4BC3A 3SUPA 4E7HA 1JXBA 1VSMA 2ITGA 5LMNK 3C6UA 2O8BB 1FKPA 2OPPA 3TTFA 5JICA 4Z94A 1BIUA 2P9KB 3IS9A 3AO1A 3A5NC 3O4WA 3OYNA 2HHSA 3EZ5A 1NGCA 5BR8K 1GLFO 5EX5A 2E2PA 4BRQA 1XI1A 4Z4GA 4BDZA 3BF1A 4IXCA 1UA0A 4GVMA 5C2FA 1K8KA 1RTIA 2D0BA 1SZ2A 5HOOA 3CXCM 4OPKA 1YUWA 1RBTA 1VQ5N 3VQ4A 4AILC 4B1YB 1VSKA 2QWQA 2ZQBA 5KGWA 5C12A 2HVHA 3RMCA 4MFBA 2H3GX 4DTNA 5M1QA 1KAXA 2HOEA 4E7KA 3QETA 2P5GA 1C0UA 4FLUA 4C8LA 3FE1A 3VF4A 3ULEB 3D6RA 2YKMA 4JKGB 1RGIA 1NK6A 2QKKA 2X74A 3P31A 4CEFA 4LSNA 3LZIA 4LSLA 4DFKA 5EOYA 3S3MA 1RTDA 1P90A 1FXXA 1S1VA 4CGDA 3HXMA 3CMEN 1XC3A 3NF7A 4QAGA 1UAXA 2G8VA 4AHCA 3IMXA 3JAMO 4Z4HA 4DU1A 2FF3B 3MX5A 3UB5A 3M1FA 1EQYA 5GAGP 1DEJA 3CERA 3ULDA 2VG5A 4LY7A 1W97L 2W40A 4JK8A 3VQPA 4F9OA 3PIOL 3P38A 1B9FA 3VN5A 3WEEA 1UWBA 4HUEA 2F9WA 3OYEA 3H08A 1REVA 3KIOA 1X9JA 1CXUA 3ZSRA 1ZBLA 4ELUA 4H5VA 3CQ8A 4E19A 4C8MA 4WQ5C 1EWRA 5C15A 1JXEA 4CK2A 3TR8A 4CERA 2FF6A 1HYVA 3KK7A 3PO4A 1WAJA 1XMQK 3PSIA 1ATRA 2I5JA 2PBDA 1NK8A 5DK5A 3U6FA 1JLQA 3VQEA 4CJKA 4DSIA 3CM6A 3VQ5A 2GWJA 4CJVA 4DV3K 1S6PA 4YDUC 3OYBA 2GUPA 1KFSA 1VQNN 3I8BA 4JKCA 4FM1A 2WC9A 3SPYA 3R9PA 2QWRA 4CJPA 4K8XA 4DS4A 4E3SA 4DR1K 1RT4A 4CESA 2F8SA 2VGNA 2Z1IA 1I94K 4E7LA 3MWTA 4ZHRA 4CF8A 1J5EK 4F3TA 2ZGYA 4DQIA 1N34K 2ZJQL 3M5RA 5E84A 3BP8A 1LWFA 2QXFA 4JHDA 4KKOA 3ZX2A 5C25A 1GLAG 1YF5L 5CYQA 1OVYA 3H3NO 4N41A 4B1XB 3E9PA 4GMJB 2ZD1A 4JHDB 4QS7A
chains in the Genus database with same CATH topology
2F4VK 4AQYK 4JI8K 3JAMO 4B3TK 4B3RK 4JYAK 4GKJK 4CVNE 4JI7K 4V19S 2HHHK 2UUBK 1HNZK 4JV5K 4LFAK 4YHHK 2VQEK 4DR3K 4B3MK 1IBMK 4DR6K 4LF5K 2UXBK 2ZM6K 4NXMK 2UUAK 4DV1K 4OX9K 4LFCK 4X64K 4X65K 4NXNK 4JI1K 4DV0K 4LF7K 4DR7K 3J7YP 2UXDK 4JI5K 1N32K 4LF6K 4LF9K 4LFBK 1XNQK 5LMNK 1N33K 4DV6K 4DUZK 4DV2K 5LL6Z 4DR4K 3T1HK 2UXCK 1XMQK 4YY3K 1XNRK 5BR8K 3J80O 4DV3K 2UU9K 4DV7K 4X62K 3J81O 2E5LK 2VQFK 5LMUK 4LF8K 3OTOK 3J7AP 4K0KK 1FJGK 1IBKK 4LF4K 4DR1K 2UUCK 4GKKK 3T1YK 1I94K 5AJ3K 1J5EK 1HNXK 4DUYK 1N34K 4DV5K 4B3SK 4JI3K 4CW7B 1XMOK 5IWAK 4JI6K 4DR2K 4KHPK 4JI2K 4DR5K 1IBLK 1N36K 4JI0K 5FLXO 4X66K 4DV4K 4JI4K 1HNWK 5A2QO 5IT9O 1HR0K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V K;  4AQY K;  4JI8 K;  3JAM O;  4B3T K;  4B3R K;  4JYA K;  4GKJ K;  4CVN E;  4JI7 K;  4V19 S;  2HHH K;  2UUB K;  1HNZ K;  4JV5 K;  4LFA K;  4YHH K;  2VQE K;  4DR3 K;  4B3M K;  1IBM K;  4DR6 K;  4LF5 K;  2UXB K;  2ZM6 K;  4NXM K;  2UUA K;  4DV1 K;  4OX9 K;  4LFC K;  4X64 K;  4X65 K;  4NXN K;  4JI1 K;  4DV0 K;  4LF7 K;  4DR7 K;  3J7Y P;  2UXD K;  4JI5 K;  1N32 K;  4LF6 K;  4LF9 K;  4LFB K;  1XNQ K;  5LMN K;  1N33 K;  4DV6 K;  4DUZ K;  4DV2 K;  5LL6 Z;  4DR4 K;  3T1H K;  2UXC K;  1XMQ K;  4YY3 K;  1XNR K;  5BR8 K;  3J80 O;  4DV3 K;  2UU9 K;  4DV7 K;  4X62 K;  3J81 O;  2E5L K;  2VQF K;  5LMU K;  4LF8 K;  3OTO K;  3J7A P;  4K0K K;  1FJG K;  1IBK K;  4LF4 K;  4DR1 K;  2UUC K;  4GKK K;  3T1Y K;  1I94 K;  5AJ3 K;  1J5E K;  1HNX K;  4DUY K;  1N34 K;  4DV5 K;  4B3S K;  4JI3 K;  4CW7 B;  1XMO K;  5IWA K;  4JI6 K;  4DR2 K;  4KHP K;  4JI2 K;  4DR5 K;  1IBL K;  1N36 K;  4JI0 K;  5FLX O;  4X66 K;  4DV4 K;  4JI4 K;  1HNW K;  5A2Q O;  5IT9 O;  1HR0 K; 
#chains in the Genus database with same CATH topology
 3MAQ A;  3B6P A;  4BGA A;  3UKU B;  4KH6 A;  4B3R K;  4JI7 K;  1GLJ O;  4BRH A;  4DTU A;  4Z4E A;  4MDB A;  4BVO A;  3AO5 A;  1RT7 A;  3AA5 X;  4BR9 A;  3HTV A;  4BE2 A;  1ZBI A;  4MO5 A;  4BWJ A;  3K58 A;  4OX9 K;  2P9N B;  1X3N A;  2GEM A;  1IH7 A;  3VES A;  4CJW A;  3JS6 A;  4CHO A;  3E9L A;  3DRS A;  4CIG A;  2F9T A;  4JKH A;  2YNH A;  2VWJ A;  4CED A;  1LW0 A;  5KRS A;  2Q31 A;  4B9Q A;  2JGU A;  3SQ2 A;  4C23 A;  3AAR A;  3ZT1 A;  3P39 A;  1SKW A;  4IOX A;  2J4R A;  1ASW A;  2QK9 A;  3NF9 A;  1U47 A;  4DR4 K;  1BA0 A;  2E88 A;  4NCG A;  4G9Z A;  4AHS A;  5GAE P;  1WSI A;  4FWL A;  4YY3 K;  4IG0 A;  4NLB A;  1BGX T;  4FVM A;  4BG8 A;  4H03 B;  1T8E A;  1NGH A;  4I2Q A;  4M45 A;  3TSP A;  1QHT A;  3AVK A;  1BOT O;  5AQK A;  1CZ9 A;  4O8U A;  4LH4 A;  4NYF A;  1FJG K;  1IBK K;  3WXI A;  1L3T A;  3DLB A;  4IFY A;  3SV4 A;  4JK9 A;  2KQ2 A;  2PAV A;  2VCP A;  3A2F A;  1K9M O;  4FWK A;  3K5L A;  3CCE N;  1M90 O;  3DLE A;  2XHB A;  1RDB A;  1HNX K;  1TKT A;  1NKB A;  4B3S K;  4C1N K;  4FWM A;  2Q97 A;  3ZT2 A;  3L2R A;  4J2E A;  4YOR A;  3FFI A;  3DRR A;  1TK0 A;  4CHY A;  1WSG A;  4BRA A;  2WOM A;  2PYJ A;  5I9E B;  4XH4 A;  4BY9 C;  3VMF B;  3DLH A;  5H1S Q;  1KAY A;  1VSJ A;  3CQX A;  2KLA A;  1NNE A;  4PA1 A;  1VSD A;  5AQH A;  4FPA A;  4CEQ A;  3K57 A;  1FKO A;  2YNG A;  2V7Y A;  3DJC A;  1D9F A;  3HJF A;  5AZJ A;  3CD6 N;  1KC8 O;  3CCJ N;  3AY9 A;  2P9S B;  4DWI A;  1RBU A;  3ZX0 A;  2E8A A;  1VSF A;  1WSH A;  4A59 A;  3THW B;  2WFB A;  5M1O A;  4WYB A;  2NRH A;  3LDL A;  5GIP A;  2QA4 N;  2E2O A;  5KTQ A;  4IEE A;  2DTU A;  3GOI A;  4DKW A;  3VQD A;  1Q9Y A;  4DR7 K;  1V4T A;  1D9D A;  4BC2 A;  3VQA A;  1Q82 O;  1QHA A;  4WFA L;  5I3U A;  2IIR A;  4RCH A;  1QTM A;  4YOV A;  4WCE L;  1HJO A;  1NM1 A;  3SBT A;  3VQQ A;  3DLL L;  4H5T A;  2PFU A;  3HT3 A;  3J8A A;  3QB0 A;  2A6A A;  4DSF A;  3QIC A;  2YKN A;  3EKU A;  4OGC A;  1S72 N;  1HMV A;  1HKB A;  3HZ6 A;  5EVZ A;  3ENB A;  1Y64 A;  2HNY A;  3SJH A;  3THV A;  3BDP A;  3EY1 A;  2GV9 A;  4Y1C A;  4LF8 K;  4CF0 A;  5CY4 A;  4BQL A;  4BVP A;  3AVF A;  4KH5 A;  4DSL A;  3AAQ A;  3DM2 A;  4YOY A;  2O8E B;  3NE6 A;  4CJ5 A;  2B4J A;  2HBM A;  3A5M C;  2ATQ A;  4WQ4 C;  4M3X A;  1BO5 O;  1GOA A;  2E2Q A;  4WE1 A;  4FM2 A;  1KLM A;  5HRP A;  4ICL A;  4AF1 A;  4CHZ A;  3ZCM A;  5AZI A;  4CZL A;  2P9I B;  1I3A A;  2NUB A;  1HRH A;  1EWQ A;  1YJW N;  3CJC A;  4O5B A;  2ITM A;  5FPN A;  2BTF A;  4BRD A;  3PX6 A;  4KV8 A;  3KLI A;  1IG8 A;  2P9L A;  3QO9 A;  1YHQ N;  4FXD A;  3M8Q A;  4YOT A;  4CD3 A;  3SJJ A;  4BE1 A;  4M63 C;  4YHH K;  4JS4 A;  2A3Z A;  4DR3 K;  4DR6 K;  3C0B A;  4IFE A;  1X9M A;  1R0A A;  3E01 A;  1SKR A;  1GOC A;  5HP1 A;  4IG3 A;  4HCB A;  1WSE A;  2BH1 A;  5JVG L;  1XUP O;  1S5J A;  1L3V A;  3H1Q A;  3HI0 A;  4FLZ A;  1KSP A;  4ILG B;  4GY2 B;  1W0H A;  3MDQ A;  2AJQ A;  4EP4 A;  1GLD G;  1ASV A;  2A1R A;  3ENH A;  1XNQ K;  2QXL A;  2UYT A;  1N33 K;  3VA3 A;  3I0S A;  4RW7 A;  3PIP L;  1QQC A;  3KLE A;  3FZM A;  4DV2 K;  4OGE A;  3DLG A;  3SUN A;  4J2D A;  2R7Y A;  3RRH A;  4KHW A;  2UXC K;  3K0S A;  4K25 A;  5KPZ A;  2YJE A;  4FJM A;  2E1Y A;  4HUF A;  4UQG A;  4FO0 A;  3LDQ A;  5AQN A;  3ZSX A;  2IS3 A;  4Z4C A;  2WBN A;  1BG3 A;  4UY8 O;  4XH1 A;  2HB5 A;  4X62 K;  4B8C A;  5TKY A;  5GIO A;  1VQK N;  4PL7 A;  5BN9 A;  1LCU A;  1I39 A;  3WUH A;  4FWQ A;  2V52 B;  3S3O A;  4K0K K;  4PKH A;  3HST B;  1JJ2 M;  4OPJ A;  3RSE B;  4BRI A;  4BRF A;  1C1B A;  4IOC L;  3KKS A;  3CQY A;  3AVJ A;  3ENO A;  4FJ5 A;  3EZW A;  4CJ4 A;  4KB0 A;  5AQF A;  1T3V A;  3F9M A;  3HOS A;  5AQW A;  4BG9 A;  1XMO K;  5IWA K;  4NCB A;  1TL1 A;  2Y1J A;  4ILH A;  2I7N A;  1Q18 A;  2O8D B;  4CEE A;  1QQM A;  2YNI A;  2ZGZ A;  4CZJ A;  3O08 A;  5BRD A;  4W5O A;  4CJQ A;  3MED A;  3QIN A;  5A2Q O;  3QER A;  5IT9 O;  3NH0 A;  2F4V K;  4K42 A;  3OYF A;  4EZ9 A;  1IKV A;  3NAE A;  3FZF A;  1LAW A;  3LPU A;  3L6Q A;  4XIU A;  4V19 S;  4Q5V A;  4KAZ A;  4PWD A;  3TAE A;  1J53 A;  3HSC A;  4FWR A;  2O8C A;  3TAM A;  4AM6 A;  3CJ1 A;  2DFE A;  2HW3 A;  1NWK A;  5KRT A;  2FC0 A;  5CZ1 A;  5EXW A;  3SK3 A;  4QS8 A;  5GAD P;  1S22 A;  2YNF A;  3VF2 A;  3I8D A;  3LL3 A;  5AFU H;  4CZK A;  1RTH A;  2P9U A;  5FRM A;  4JI5 K;  2E1Z A;  4E1N A;  3U9D A;  4KPY A;  2D0C A;  1NK0 A;  1QZ5 A;  2HF3 A;  1N32 K;  5AQT A;  3QEX A;  1HPM A;  5AQM A;  3MXJ A;  3V9Z A;  3LAN A;  3KLH A;  4FZY A;  4M3T A;  2P9U B;  4FJ7 A;  4B9L A;  1Y97 A;  2G8K A;  3H46 O;  1ATN A;  4BDP A;  2E6L A;  1VQ6 N;  3SV3 A;  3ATU A;  3OS2 A;  3VEW A;  1VRU A;  1X1P A;  4CGH A;  2HMI A;  3UIQ A;  1QQO A;  3C94 A;  3PLA A;  5HL7 L;  4O0I A;  4DSE A;  2O8B A;  3ZYY X;  4FLV A;  1EO1 A;  3ALY A;  4CFB A;  1QVG M;  4Y0W A;  3OTO K;  2A41 A;  3OYA A;  2D0P A;  2P9K A;  5F1X A;  2YJF A;  4M3Y A;  1UOC A;  4GKK K;  4IEI A;  4BRG A;  3RTV A;  3IDH A;  1S1U A;  3NH1 A;  5M1N A;  3OYJ A;  4H0P A;  1KRP A;  4M42 A;  1UA1 A;  1JKH A;  3O5B A;  1IBL K;  3SQ0 A;  1ZBS A;  4CIE A;  4X66 K;  2CH5 A;  3MN9 A;  4DV4 K;  1EET A;  1T03 A;  2ASM A;  1WN7 A;  1TKZ A;  1U48 A;  1S9E A;  4MLH A;  3ULE A;  4JKG A;  3I33 A;  4B1W B;  3A0I X;  1B92 A;  5SZT A;  1NGA A;  4A2B A;  4FJX A;  4B3M K;  4FK0 A;  4PQU A;  1NGF A;  3G4S N;  1RT6 A;  3O9R A;  3KTQ A;  2HHU A;  4DF8 A;  4DV1 K;  1VQ9 N;  1BIZ A;  5AQO A;  4B1U B;  5F0X A;  4X65 K;  1VK0 A;  4BR4 A;  4DTM A;  4OLA A;  2JLE A;  4RW4 A;  3G6E N;  4IKF A;  3DXK B;  3WNG A;  5JVH L;  3K5O A;  4ISE A;  3LWL A;  2HHV A;  2A40 A;  4K43 A;  4E1M A;  4F4K A;  4DG1 A;  4Z0U A;  5BRE A;  4CE9 A;  4KHS A;  1JLG A;  1WAF A;  3MWP A;  3CG7 A;  3DOK A;  1TGO A;  4DB3 A;  1JCG A;  3ID6 A;  4H4O A;  4FVU A;  2HF4 A;  2O4I A;  1KVA A;  3I55 N;  3C6H A;  3OJU A;  2NZT A;  3L2V A;  3L4I A;  4ISG A;  3OYL A;  2KKZ A;  5BRH A;  4I7F A;  2QEX N;  1YVU A;  2KHO A;  3OYD A;  4ID5 A;  4CK3 A;  3V4I A;  3LAM A;  3J7Z O;  3ZLJ A;  4Z4I A;  4B3O A;  5GIN A;  3A5L C;  3HP6 A;  2GUI A;  3QES A;  4ZTJ A;  4IO9 L;  1DTQ A;  1V4S A;  2YHA A;  5CR4 A;  2GX9 A;  1RT1 A;  3BUZ B;  3HO1 A;  5HRR A;  3THY B;  3AO2 A;  3KK3 A;  3AVC A;  1JLC A;  3QEP A;  1U49 A;  2D1K A;  5M1K A;  3VQC A;  3WQU A;  1N36 K;  3EYZ A;  5DM6 L;  5FPM A;  4CCH A;  3PX0 A;  4CJ3 A;  2JWK A;  4CIF A;  2Q1N A;  3AVH A;  3V9S A;  5CYM A;  1X9S A;  3LAK A;  4WQ5 A;  4B3T K;  4KBO A;  3CPW M;  1CZA N;  4H5W A;  1HUX A;  5HRO A;  2YHW A;  3TU5 A;  4KI4 A;  1L5U A;  4FZX C;  3V6D A;  4CF9 A;  4I9Q A;  4BWM A;  1WBB A;  3GG4 A;  4LFA K;  3E9O A;  4OPA A;  1K6Y A;  3CCQ N;  4NB4 A;  3OA9 A;  4YDU A;  3UKU A;  4CZG A;  4LFC K;  5DMR A;  3D2E B;  1CLQ A;  3R6M A;  4FJL A;  3JXU A;  1QSY A;  4LF7 K;  1XWL A;  1N5Y A;  5EY4 A;  3VET A;  3IKM A;  3HVT A;  3BZK A;  2Y1I A;  3SYZ A;  3Q7C A;  4IO8 A;  5JLH A;  4DTS A;  5CZ2 A;  1XC9 A;  1JLE A;  2P9N A;  4KI6 A;  2KW4 A;  3WXJ A;  1HLU A;  3VEY A;  1Q81 O;  1M1K O;  3QIO A;  4B9S A;  1SKS A;  1YT3 A;  4H0O A;  1YJN N;  4E0D A;  3DOL A;  4U7B A;  5FRO A;  3MN6 A;  1E4F T;  1HPZ A;  3IG1 A;  3LP3 A;  2YX6 A;  1WB9 A;  1U2V B;  4HWI A;  4JD2 B;  3TAQ A;  4CHQ A;  2NRZ A;  4PL8 A;  2YI1 A;  5AQP A;  5C42 A;  4L3Q A;  3HYF A;  5LY3 A;  3CHW A;  3V81 A;  4IBN A;  4LD0 A;  4KHQ A;  1LWE A;  3SAH A;  3E66 A;  3VQ9 A;  4MQ3 A;  1N8R O;  4JKE A;  2XY5 A;  5EU7 A;  1H1V A;  3OHR A;  1GLC G;  3O4Q A;  3JYT A;  2DY4 A;  1C1C A;  2D5R A;  3MXI A;  3AVA A;  3ZT0 A;  4FJ9 A;  1XHX A;  4FOE A;  3M8R A;  1XQS C;  3THX B;  4JI6 K;  4M41 A;  4OJR A;  3HPO A;  4H0X B;  4JI2 K;  4DR5 K;  4FOI A;  4GV3 A;  3F2K A;  2D0O A;  1LWC A;  4RTF D;  3MEG A;  1LW2 A;  2OAN A;  2Z1H A;  3AVI A;  3D2F A;  1GOB A;  4BR2 A;  3VQ6 A;  3C7N B;  1NK4 A;  3L2U A;  1NJI O;  1SS6 A;  3EO3 A;  4DQP A;  3D2F B;  2LSN A;  3SPZ A;  4JKB A;  2XY7 A;  5T7B A;  1KXP A;  5AFU A;  1OH5 A;  3RRG A;  4NYN A;  1VRT A;  1JCE A;  2ASP A;  3QFU A;  1HX1 A;  3OY9 A;  3DMJ A;  1L3U A;  2P5O A;  4AH9 A;  4BGB A;  5C10 A;  4NXN K;  1JLF A;  1MU2 A;  1MDU B;  3SLC A;  5TKW A;  1YVN A;  1KQS M;  4O0J A;  3R8E A;  2UXD K;  3P1G A;  5AQU A;  2P9S A;  2XO7 A;  4HVJ A;  3NMU A;  4A62 A;  5FPE A;  3THW A;  1TKD A;  1L3S A;  3QEW A;  5HRS A;  5AQV A;  3LDS A;  3QLH A;  1JCF A;  3OYK A;  3BF3 A;  3VEO A;  3QEV A;  4NO7 A;  1C0F A;  1GLE G;  4DTJ A;  2IAJ A;  5LL6 Z;  4CJ7 A;  4F2S A;  4B9M A;  1VQM N;  1VQ7 N;  5D3G A;  1J6Z A;  2V7Z A;  1DGK N;  4FM0 A;  3HL8 A;  4A61 A;  2JWL A;  4PY5 A;  1HYZ A;  4DV7 K;  3ZEU B;  3J81 O;  4W5R A;  3HP9 A;  1HNV A;  5C2D A;  1NGG A;  3J7A P;  1RBV A;  3KJV A;  3VEV A;  2IGI A;  4IZ9 A;  5AR0 A;  4JAX A;  4EHT A;  3U4L A;  4CEB A;  1VQP N;  4HUG A;  3DXM B;  4AHR A;  3AO4 A;  3QML A;  1S3X A;  4HCC A;  4IOA L;  4OKK A;  3TTD A;  4CGI A;  4B9N A;  3VQ7 A;  4FW2 A;  4FWS A;  2CGJ A;  2O8E A;  2QWL A;  4R79 A;  1YI2 N;  3ID8 A;  4JI0 K;  4FLY A;  1J5O A;  3M6G A;  1HNW K;  2PYL A;  3MCA B;  3A8Y A;  2F96 A;  5K14 A;  5JMV A;  2FSJ A;  1HR0 K;  2CH6 A;  3NF8 A;  2QWO A;  4KHN A;  4BRM A;  4DLE A;  3WXL A;  4KTW A;  3SAG A;  2OCE A;  3MX2 A;  4DLG A;  4B9U A;  1VSH A;  3LM9 A;  1ZBU A;  2NRT A;  2P9I A;  2HBJ A;  3CF5 L;  1LOT B;  1QSS A;  3JSM A;  1QVF M;  3L3V A;  2VQE K;  1IBM K;  2FSK A;  2ZM6 K;  3V1Q A;  3K5M A;  4FLW A;  2V51 B;  1BCM A;  3K2P A;  5LJV A;  4O55 A;  2D0A A;  5AQL A;  3P4I A;  3O6W A;  4KH4 A;  1YJ9 N;  4ELT A;  3OVN A;  4I6M B;  3AA4 A;  3DWL A;  3MN5 A;  1SL1 A;  3MK6 A;  1HQE A;  4M3Z A;  1TAQ A;  4MDA A;  3AVG A;  3ZSY A;  1K73 O;  4LFB K;  2NLX A;  1ZBH A;  3FFK B;  4A5A A;  3IAY A;  4CJL A;  4CZE A;  5J2N A;  3FGU A;  3HPH A;  2X78 A;  3VPZ A;  3QNO A;  4OO1 J;  4CBW A;  3GE1 A;  1YAG A;  1NGB A;  4PHT X;  3D0P A;  4O5F A;  5KQ8 A;  1HNI A;  2X6N A;  3CCM N;  4A5B A;  3ZT4 A;  1HYS A;  4IJA A;  1JLA A;  3SQ1 A;  3H45 C;  3CET A;  4O44 A;  4JLH A;  1NJZ A;  3UKR B;  3ITH A;  1DLO A;  3FZK A;  5J1E A;  1D8Y A;  2FXU A;  1QZ6 A;  4BAC A;  3ZSQ A;  3O1B A;  2IOC A;  4J2A A;  1C6V A;  4EHU A;  3RVC A;  3PO5 A;  2A1S A;  3DAW A;  4DSJ A;  4FZZ A;  4DUY K;  2OPS A;  2XY6 A;  4JI3 K;  3S3N A;  4XH5 A;  1TK8 A;  3EN9 A;  5KI6 A;  3RSE A;  4BC4 A;  3TAR A;  5GAH P;  3NGY A;  2ZWH A;  4BR7 A;  4DFJ A;  4CJU A;  1W2B M;  3NDK A;  4PKG A;  3DYA A;  4XEI A;  5CHI A;  1KTQ A;  1KVC A;  4JI8 K;  1O13 A;  1NK9 A;  4A57 A;  3ZSV A;  2O8D A;  3HRG A;  1OVQ A;  4GV9 A;  3L2W A;  4DQ8 A;  3SNN A;  2QWP A;  1EKE A;  4JKD A;  4JN4 A;  3VER A;  1TYQ B;  1TUU A;  1C0T A;  3OS0 A;  1VSE A;  2FBY A;  2YV0 X;  2BGG A;  1TK5 A;  4AM7 A;  2ZJP L;  2VWB A;  3OBY A;  3O3G A;  4CHP A;  4JI1 K;  3T1A A;  2YHX A;  3BGR A;  1HQU A;  1NOZ A;  4PKI A;  3EE9 A;  2VG6 A;  3G0Z A;  4BDY A;  4LF9 K;  4YOU A;  2O8F B;  1RBS A;  2PY5 A;  3CCV N;  5FPD A;  4GVE A;  1VQL N;  1G99 A;  3IUC A;  1Z05 A;  3ZET B;  5AQZ A;  3U9Z A;  3CCR N;  3O8M A;  1U6Z A;  2W42 A;  2Q3S A;  3QDK A;  3O3F A;  3VGL A;  4R5P A;  1HKC A;  2BUP A;  3I0R A;  3LDN A;  4OPH A;  3D45 A;  3AVN A;  5AQR A;  1J54 A;  1RT2 A;  3K5N A;  1B9D A;  3RMA A;  1NGJ A;  1RT5 A;  3TAN A;  1IKX A;  1KAZ A;  1YTU A;  2KFN A;  5SWM A;  3CMA N;  4M3U A;  3U3Y A;  2G8H A;  4CZI A;  2IDO A;  4EZ6 A;  1RDC A;  1IKW A;  2F7T A;  3NCI A;  4DSK A;  4C8O A;  4E7J A;  3WXM B;  1DT9 A;  3O3H A;  4CI6 A;  4Y1D A;  1DTT A;  1QS4 A;  4KTZ A;  5AQX A;  3SBG A;  3QNN A;  3GL1 A;  1TKX A;  3K59 A;  3AV9 A;  3AGK A;  4CEA A;  3ZT3 A;  5ELZ A;  4DTR A;  1NLV A;  1TL3 A;  2A5X A;  4EP5 A;  1WSJ A;  3F73 A;  1IV0 A;  1IO2 A;  4CF2 A;  4CFD A;  2HNZ A;  3O9U A;  3OBW A;  5AQG A;  1T6D A;  5KPT A;  4E89 A;  4F3O A;  4B9V A;  3CI5 A;  2HND A;  3LAL A;  1NMD A;  1N6Q A;  4ZTF A;  4BR5 A;  1HNZ K;  2QI2 A;  1D4X A;  2P9P B;  4AHU A;  2XY8 A;  1SQK A;  4CZH A;  4NXM K;  1IG9 A;  3LP1 A;  4FJN A;  4CZM A;  1YIJ N;  1VSI A;  3CFO A;  2ZF5 O;  2NRR A;  1MWK A;  3O4N A;  1FW6 A;  3OJS A;  2P51 A;  1O1W A;  3FZL A;  2KTQ A;  2X6S A;  2HHX A;  3KD5 E;  3HM8 A;  5AQJ A;  4FWO A;  4H0V B;  4WF9 L;  4DV6 K;  4DUZ K;  5M1F A;  3V9U A;  2W6K A;  3CM5 A;  1S1W A;  3C6A A;  3PUF A;  1K8K B;  2RN2 A;  3MN7 A;  3FR0 A;  2FBV A;  4KRF A;  1WOQ A;  3KWG A;  1NOY A;  2OZM A;  3DXK A;  4IDH A;  4CJR A;  3MEE A;  1KFD A;  4H5R A;  2QWM A;  1T05 A;  3C6T A;  5BPM A;  5AQY A;  2E5L K;  4ID1 A;  3L3U A;  2VQF K;  3CCL N;  1VAZ A;  4JK7 A;  3DI6 A;  2VYP A;  3U8X A;  2Q0U A;  4YNQ A;  1SL2 A;  2E20 A;  3BEX A;  1YTA A;  3O9Q A;  4RWT A;  3CYM A;  3VA0 A;  3T1Y K;  3G71 N;  4DFM A;  4B1Z A;  4PUO A;  3AO3 A;  2G8I A;  5AQI A;  3OS1 A;  3EL2 A;  2IVN A;  1QE1 A;  2FBT A;  3RWU A;  3LPT A;  1SL0 A;  4DR2 K;  1NJX A;  3NH2 A;  1KCF A;  2ZE2 A;  4DU3 A;  1A5V A;  3VF6 A;  4RW6 A;  3DRP A;  1BWF O;  5FLX O;  1LAV A;  1HKG A;  2Z1J A;  1WBD A;  2VG7 A;  5BPL A;  3KD1 E;  4AQY K;  1WLJ A;  1BL3 A;  1RBR A;  3MCP A;  1ZBF A;  1CXQ A;  2A42 A;  4OKJ A;  3S41 A;  4FW1 A;  3THY A;  5KPR A;  3SZ2 A;  4CJT A;  4M7Y A;  3WEE B;  4WFB L;  1Z25 A;  2QW9 A;  5ADX A;  3K9J A;  4MLE A;  5FRN A;  5AQS A;  4W5Q A;  4CEO A;  4BR0 A;  2UXB K;  3KLF A;  2GTD A;  2UUA K;  4TSX A;  4OKE A;  1HJR A;  2YHB A;  1OH8 A;  1W7A A;  2OTL N;  3CJA A;  3VQB A;  1IKY A;  3J7Y P;  2IVO A;  1JL2 A;  4M7X A;  2GEL A;  4YOX A;  4CGJ A;  2HHQ A;  1MWM A;  2FSN A;  3CCU N;  2B5J A;  2DFF A;  3D2E A;  4KB1 A;  1J9A A;  1NGD A;  3VEZ A;  4C1N I;  3VGM A;  4H0T B;  4FYD A;  1D5A A;  3T1H K;  4J2B A;  3AVM A;  4GW6 A;  3T7Z A;  4KO0 A;  1NKE A;  3M3Z A;  1ZYQ A;  2RPI A;  3AVB A;  4IWV A;  3M8S A;  4AHT A;  3OYH A;  4OLB A;  1OH6 A;  4B9T A;  3A5O C;  3HK2 A;  4CF1 A;  1JL1 A;  3OYC A;  3ATV A;  3L0Q A;  1A5X A;  3WXK A;  2NNW A;  1BIS A;  4CHN A;  3T19 A;  2FLO A;  1U2V A;  3QFP A;  4FLT A;  4OVL A;  3AAP A;  4JD2 A;  1RDW X;  4DQS A;  4CGG A;  1VQ8 N;  3SMS A;  3TWH A;  3H6E A;  5BPN A;  1NK7 A;  2KFZ A;  4DV5 K;  4DMN A;  4DFP A;  3OW2 M;  1TVR A;  2VWK A;  4H5N A;  4I2P A;  4LC9 B;  5J2Q A;  2OA8 A;  3G10 A;  1FK9 A;  4FK4 A;  5J2P A;  3VQ8 A;  3UE5 A;  1SAZ A;  4BRC A;  4DU4 A;  1XHZ A;  1TV6 A;  1NG9 A;  4BE0 A;  4FCY A;  3PSF A;  3THX A;  1NBW A;  3VTI A;  5JLF A;  3CC2 N;  3O9T A;  3VTH A;  4CVN E;  1BHL A;  3LDO A;  3SAF A;  3B6O A;  5M1P A;  2QKB A;  2B6A A;  3T3F A;  4HHT A;  2NRV A;  3V1O A;  1NJW A;  4F2R A;  4JV5 K;  2WTU A;  4CFC A;  3CFP A;  4DTP A;  1T44 A;  3C7N A;  3HOT A;  5BRF A;  1C0G A;  4HTL A;  1RDD A;  5MLC Q;  3PV8 A;  1WSF A;  3RMB A;  1ITG A;  4KHY A;  4IDK A;  4DV0 K;  2KZZ A;  4CEZ A;  1ZXO A;  3M8P A;  2HBL A;  5F2R A;  2EX3 A;  3TSQ A;  4M3W A;  3LZJ A;  1BQN A;  4LF6 K;  3FLC O;  4JEP A;  3EEQ A;  3WNE A;  2W6L A;  4G1Q A;  4H8K A;  2E6M A;  5BR9 A;  3H1V X;  1IJJ A;  1RFQ A;  4IJN A;  4BRL A;  4LH5 A;  4BRO A;  3B8A X;  3GDQ A;  3SI6 A;  2IC3 A;  4H4M A;  1YXQ A;  2OPQ A;  1S6Q A;  2VGM A;  3OYI A;  1LV5 A;  4DHY A;  1XNR K;  1A5W A;  2E2N A;  4FJI A;  1U45 A;  3LWM A;  4DQQ A;  5E41 A;  3QEI A;  4FSV A;  1RDA A;  3LP2 A;  3CC4 N;  2RE2 A;  3Q7B A;  2Q36 A;  4CJS A;  2Z1G A;  2OTJ N;  4JS5 A;  3K9K A;  4RW9 A;  2CGL A;  1RIL A;  4EIA A;  4YFU A;  1CZB A;  1W9H A;  5AJ3 K;  3ZEU A;  4W5T A;  5B8H A;  3CCS N;  5JS1 A;  4JKF A;  1ESV A;  3HPG A;  4CW7 B;  3EKS A;  1BA1 A;  3G25 A;  4Q0B A;  3HBT A;  4MO4 A;  5C0Y A;  3ZX3 A;  1NMN A;  2Q0R A;  4CGF A;  3DXM A;  4FPB A;  1G15 A;  3CJB A;  4JNE A;  5AZJ B;  1SUQ A;  3PX4 A;  1BDG A;  2RKI A;  3HVR A;  2QM1 A;  3TI0 A;  1TUY A;  4NLC A;  3CPE A;  4KTQ A;  3F9K A;  1U4B A;  3E1Y A;  4WFN L;  3TAF A;  3LDP A;  3C65 A;  3D7E O;  1VHX A;  4B8A B;  1ATS A;  1T6C A;  4FLX A;  2P1J A;  2EHG A;  3V1R A;  2HHW A;  3ISN C;  4LF5 K;  4JRQ A;  1OKJ A;  5LJW A;  3TTC A;  2IVP A;  3SUQ A;  3MEC A;  2O4G A;  4E1J A;  4X64 K;  4QCL A;  3KK1 A;  4FJK A;  1DKG D;  1MA9 B;  4EAH D;  5HRN A;  4N5S A;  2YHY A;  4CJE A;  4CZF A;  3F5T A;  2G8W A;  2OZS A;  4QOZ B;  4A2A A;  4JKA A;  3AVL A;  4QS9 A;  3N4Q A;  1EX4 A;  4KRE A;  3T69 A;  2ZJR L;  3W3D A;  3S9H A;  4NCA A;  4AHV A;  4DQR A;  2F8T A;  4L8R B;  3R1X A;  3CC7 N;  4I6M A;  5J2M A;  4O4G A;  3O80 A;  1EP4 A;  3PY8 A;  1WUA A;  5HBM A;  2PZS A;  4RG8 A;  1BU6 O;  2AA4 A;  4K8Z A;  1BI4 A;  3WNH A;  1RCH A;  4BRP A;  2ETJ A;  5ADX H;  1YIT N;  4CFA A;  3I56 N;  1E4G T;  5AQQ A;  1K8A O;  3SMP A;  5LMU K;  1RDU A;  4DTX A;  4BRK A;  1BI4 B;  3NVM A;  4DTO A;  3SCX A;  1NK5 A;  3W0L A;  3NHG A;  1NU0 A;  2CGK A;  4WQ4 A;  1C0M A;  1QSL A;  1S9G A;  3AGR A;  4FJG A;  5AZI B;  1EXQ A;  3CIP A;  3KVG A;  3R3L A;  2WUS A;  1KLN A;  5KQD A;  3GBT A;  2GWK A;  2WON A;  1S1X A;  1OH7 A;  3KK2 A;  3MMV A;  2QTD A;  1Q8I A;  3UKR A;  1RTJ A;  4HTU A;  4BRE A;  2P9L B;  4KHP K;  4IFV A;  1RT3 A;  4CD1 A;  2RF2 A;  4GNI A;  3HM9 A;  5FDL A;  2HST A;  1Z26 A;  4JRP A;  4E7I A;  4CBU A;  4JI4 K;  1T7P A;  3NGI A;  2NRX A;  1GLB G;  3KWI A;  4DS5 A;  1Q9X A;  3NBP A;  3TAG A;  2OYQ A;  1P8Z A;  4JYA K;  4YOW A;  3NF6 A;  3RMD A;  4B1V A;  4M3R A;  2BAN A;  2UUB K;  3KLG A;  3DLR A;  4ISF A;  4C8K A;  3WT0 A;  4ILJ A;  4FL9 A;  3ZSZ A;  2FBX A;  3V9W A;  4CBX A;  1WNS A;  3BZC A;  3OYG A;  3EE8 A;  3IRX A;  2HHT A;  4DCH A;  1Q7Y O;  4F8R A;  1VQO N;  1Q86 O;  4J8F A;  4CEC A;  4CK1 A;  2QWN A;  3H3O B;  1X3M A;  4FWP A;  1KVB A;  4DF4 A;  3FZH A;  4I9L A;  1TYQ A;  3KKR A;  5C24 A;  3MXM A;  5JS2 A;  2G8F A;  3VGK A;  2E4L A;  3NFA A;  5DM7 L;  1Z6R A;  1VSL A;  4N47 A;  4FJH A;  5CE3 A;  1QQN A;  2ASO A;  3LM2 A;  3QIP A;  3N4P A;  4O8K A;  3KHY A;  1NGE A;  2BE2 A;  1C1A A;  3RR8 A;  1U04 A;  1SV5 A;  3ZSO A;  3DLK A;  3VEN A;  4BRN A;  3CFR A;  1ILY A;  3OYM A;  4K41 A;  2HBK A;  1VQ4 N;  3QBX A;  2O8F A;  3J80 O;  5HLF A;  1F21 A;  1BCO A;  2GBZ A;  2UU9 K;  4GV6 A;  4Z4F A;  4KHU A;  1ASU A;  3P83 D;  1BUP A;  1GLL O;  2W41 A;  3ZET A;  2HVI A;  2KZM A;  4FK2 A;  2D4W A;  1ZC6 A;  3C95 A;  4LF4 K;  4N56 A;  1KD1 O;  3ASM A;  1R59 O;  3L2Q A;  3CJ9 A;  2UUC K;  2Q2R A;  3CJ7 A;  3SQ4 A;  1NGI A;  3U3G A;  4CJF A;  4FJ8 A;  2OPR A;  3P5J A;  2YCH A;  2DFH A;  3L4Q A;  3AA2 A;  3SUO A;  3TAB A;  2BDP A;  3IFR A;  4U67 L;  3O9S A;  4BC5 A;  3O1W A;  1S1T A;  3BY5 A;  4BQZ A;  2RHK A;  1TAU A;  1E3M A;  4C8N A;  4EFH A;  3TAP A;  3RR7 A;  2O8C B;  1NJY A;  3TSU A;  1JLB A;  3NGZ A;  4GKJ K;  3V9X A;  1X9W A;  3VOV A;  4H0Y B;  5E26 A;  3ZSW A;  2DPN A;  2HHH K;  4ELV A;  4RW8 A;  2G8U A;  4FJJ A;  5I42 A;  2NRW A;  2EWS A;  4KFB A;  3WQT A;  4W5N A;  2HMP A;  2XRI A;  4N76 A;  1BQM A;  3QBW A;  2AP1 A;  1RNH A;  1NKC A;  3VEX A;  4B08 A;  3LP0 A;  3NVK A;  2I7P A;  3AA3 A;  3L8B A;  5BN8 A;  2P9P A;  3KZB A;  4FWN A;  3TPQ A;  5KGX A;  3WNF A;  4BC3 A;  3SUP A;  4E7H A;  1JXB A;  1VSM A;  2ITG A;  5LMN K;  3C6U A;  2O8B B;  1FKP A;  2OPP A;  3TTF A;  5JIC A;  4Z94 A;  1BIU A;  2P9K B;  3IS9 A;  3AO1 A;  3A5N C;  3O4W A;  3OYN A;  2HHS A;  3EZ5 A;  1NGC A;  5BR8 K;  1GLF O;  5EX5 A;  2E2P A;  4BRQ A;  1XI1 A;  4Z4G A;  4BDZ A;  3BF1 A;  4IXC A;  1UA0 A;  4GVM A;  5C2F A;  1K8K A;  1RTI A;  2D0B A;  1SZ2 A;  5HOO A;  3CXC M;  4OPK A;  1YUW A;  1RBT A;  1VQ5 N;  3VQ4 A;  4AIL C;  4B1Y B;  1VSK A;  2QWQ A;  2ZQB A;  5KGW A;  5C12 A;  2HVH A;  3RMC A;  4MFB A;  2H3G X;  4DTN A;  5M1Q A;  1KAX A;  2HOE A;  4E7K A;  3QET A;  2P5G A;  1C0U A;  4FLU A;  4C8L A;  3FE1 A;  3VF4 A;  3ULE B;  3D6R A;  2YKM A;  4JKG B;  1RGI A;  1NK6 A;  2QKK A;  2X74 A;  3P31 A;  4CEF A;  4LSN A;  3LZI A;  4LSL A;  4DFK A;  5EOY A;  3S3M A;  1RTD A;  1P90 A;  1FXX A;  1S1V A;  4CGD A;  3HXM A;  3CME N;  1XC3 A;  3NF7 A;  4QAG A;  1UAX A;  2G8V A;  4AHC A;  3IMX A;  3JAM O;  4Z4H A;  4DU1 A;  2FF3 B;  3MX5 A;  3UB5 A;  3M1F A;  1EQY A;  5GAG P;  1DEJ A;  3CER A;  3ULD A;  2VG5 A;  4LY7 A;  1W97 L;  2W40 A;  4JK8 A;  3VQP A;  4F9O A;  3PIO L;  3P38 A;  1B9F A;  3VN5 A;  3WEE A;  1UWB A;  4HUE A;  2F9W A;  3OYE A;  3H08 A;  1REV A;  3KIO A;  1X9J A;  1CXU A;  3ZSR A;  1ZBL A;  4ELU A;  4H5V A;  3CQ8 A;  4E19 A;  4C8M A;  4WQ5 C;  1EWR A;  5C15 A;  1JXE A;  4CK2 A;  3TR8 A;  4CER A;  2FF6 A;  1HYV A;  3KK7 A;  3PO4 A;  1WAJ A;  1XMQ K;  3PSI A;  1ATR A;  2I5J A;  2PBD A;  1NK8 A;  5DK5 A;  3U6F A;  1JLQ A;  3VQE A;  4CJK A;  4DSI A;  3CM6 A;  3VQ5 A;  2GWJ A;  4CJV A;  4DV3 K;  1S6P A;  4YDU C;  3OYB A;  2GUP A;  1KFS A;  1VQN N;  3I8B A;  4JKC A;  4FM1 A;  2WC9 A;  3SPY A;  3R9P A;  2QWR A;  4CJP A;  4K8X A;  4DS4 A;  4E3S A;  4DR1 K;  1RT4 A;  4CES A;  2F8S A;  2VGN A;  2Z1I A;  1I94 K;  4E7L A;  3MWT A;  4ZHR A;  4CF8 A;  1J5E K;  4F3T A;  2ZGY A;  4DQI A;  1N34 K;  2ZJQ L;  3M5R A;  5E84 A;  3BP8 A;  1LWF A;  2QXF A;  4JHD A;  4KKO A;  3ZX2 A;  5C25 A;  1GLA G;  1YF5 L;  5CYQ A;  1OVY A;  3H3N O;  4N41 A;  4B1X B;  3E9P A;  4GMJ B;  2ZD1 A;  4JHD B;  4QS7 A; 
#chains in the Genus database with same CATH homology
 2F4V K;  4AQY K;  4JI8 K;  3JAM O;  4B3T K;  4B3R K;  4JYA K;  4GKJ K;  4CVN E;  4JI7 K;  4V19 S;  2HHH K;  2UUB K;  1HNZ K;  4JV5 K;  4LFA K;  4YHH K;  2VQE K;  4DR3 K;  4B3M K;  1IBM K;  4DR6 K;  4LF5 K;  2UXB K;  2ZM6 K;  4NXM K;  2UUA K;  4DV1 K;  4OX9 K;  4LFC K;  4X64 K;  4X65 K;  4NXN K;  4JI1 K;  4DV0 K;  4LF7 K;  4DR7 K;  3J7Y P;  2UXD K;  4JI5 K;  1N32 K;  4LF6 K;  4LF9 K;  4LFB K;  1XNQ K;  5LMN K;  1N33 K;  4DV6 K;  4DUZ K;  4DV2 K;  5LL6 Z;  4DR4 K;  3T1H K;  2UXC K;  1XMQ K;  4YY3 K;  1XNR K;  5BR8 K;  3J80 O;  4DV3 K;  2UU9 K;  4DV7 K;  4X62 K;  3J81 O;  2E5L K;  2VQF K;  5LMU K;  4LF8 K;  3OTO K;  3J7A P;  4K0K K;  1FJG K;  1IBK K;  4LF4 K;  4DR1 K;  2UUC K;  4GKK K;  3T1Y K;  1I94 K;  5AJ3 K;  1J5E K;  1HNX K;  4DUY K;  1N34 K;  4DV5 K;  4B3S K;  4JI3 K;  4CW7 B;  1XMO K;  5IWA K;  4JI6 K;  4DR2 K;  4KHP K;  4JI2 K;  4DR5 K;  1IBL K;  1N36 K;  4JI0 K;  5FLX O;  4X66 K;  4DV4 K;  4JI4 K;  1HNW K;  5A2Q O;  5IT9 O;  1HR0 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...