1N32K

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1n32K00
4LF9K 4OX9K 2UUBK 4KHPK 2UUCK 1XNRK 5AJ3K 1XMOK 4JI8K 3J80O 4DV5K 4B3SK 4DV3K 4JI5K 1I94K 4LF6K 2ZM6K 2UU9K 2HHHK 3J7YP 1HNZK 4X64K 1HR0K 4YHHK 2UUAK 2VQEK 4DV4K 1N36K 4B3RK 5LMNK 4DUYK 1XMQK 1HNWK 4JI0K 4JYAK 4DR5K 5LL6Z 4DV6K 4JI6K 5BR8K 3T1HK 5A2QO 4B3MK 4JI7K 4LFAK 4DR4K 4DR7K 4CVNE 4LF8K 2UXBK 4NXMK 4DV2K 4JI3K 4JI2K 4B3TK 4LF7K 4GKKK 4LF4K 1IBMK 2UXCK 3J7AP 1XNQK 4CW7B 2VQFK 4GKJK 2E5LK 1IBLK 5LMUK 4LFCK 4LFBK 3JAMO 4NXNK 4JI1K 1IBKK 5IT9O 4V19S 1N34K 4DUZK 1J5EK 5IWAK 4DR2K 2F4VK 1N33K 2UXDK 1HNXK 4JI4K 4JV5K 4AQYK 3T1YK 4YY3K 4DV7K 3OTOK 1N32K 4LF5K 4DV0K 5FLXO 4DR6K 4X65K 1FJGK 4K0KK 4X66K 3J81O 4X62K 4DR3K 4DV1K 4DR1K
chains in the Genus database with same CATH superfamily
3TAPA 3VEZA 1VAZA 4KHPK 1NBWA 2XO7A 4FCYA 1NK5A 5HRRA 1Z6RA 2IDOA 1TK8A 4QCLA 2O4GA 1VSJA 2O8CB 1NGDA 1JLEA 2KZMA 1FK9A 1BIUA 1NGCA 2A6AA 4GV3A 4BWMA 4MO5A 1SL0A 1CZAN 1VQPN 4FOEA 1HMVA 5MLCQ 2DPNA 3BY5A 4FK2A 3B8AX 3LAKA 3SAGA 4DLGA 4MDAA 1JLGA 4OJRA 1VRUA 4CEBA 2LSNA 2Q2RA 4EHUA 3I0SA 3SQ0A 2WBNA 3CMEN 4JI6K 2GTDA 3KD5E 3AVHA 2F7TA 2A1RA 4IFEA 1QZ6A 1ZBSA 2BUPA 1Z25A 4FPAA 1WBDA 4YFUA 4IG3A 3NHGA 5GIOA 4DF4A 1K8KB 4JI3K 1CZBA 4GKKK 3P4IA 1ZBIA 3GL1A 4FWSA 4KAZA 4KKOA 5BN8A 4BG8A 1GLAG 1BUPA 3ENOA 2E5LK 4IKFA 4FM2A 3HVRA 5H1SQ 2YHWA 4JAXA 4BACA 4IOAL 3C65A 4NCGA 2F9TA 4B1WB 1NK6A 1BO5O 4DUZK 2WC9A 3D0PA 3CCUN 3O9TA 1SV5A 2HBKA 3O4WA 1X3MA 1HYZA 1S1VA 5J2MA 3DMJA 4W5OA 1N33K 3PO5A 3CCRN 2P9KA 2VG7A 4ELUA 2HHUA 5KPZA 5EX5A 3VQDA 3VEYA 4BQZA 1T7PA 3NH0A 3KLFA 1U45A 3SJHA 1TL1A 4BRKA 3OYMA 4K25A 5KPRA 1BQMA 1CXQA 3U6FA 2RN2A 4BVOA 4KTZA 2D0AA 4DTJA 4JN4A 4MQ3A 2V52B 4CHNA 4IJAA 3J80O 2A1SA 2EWSA 3HJFA 3CC2N 4DV3K 4A61A 5AFUA 1NGJA 4W5QA 1NK4A 2OZSA 4LF6K 5LJVA 3M5RA 3CCEN 4X64K 1HJOA 4DTPA 4BRCA 4EP4A 4A2AA 5KRTA 5BPMA 4BGBA 1ZBHA 1TAUA 1N36K 4FM0A 1BU6O 3K59A 1K73O 4DCHA 3LZJA 2WUSA 4FJNA 1BQNA 3DOLA 2Q31A 1EQYA 3AAPA 3AVMA 1RTIA 5EU7A 1NM1A 3BZCA 1JLFA 4CF9A 3THYA 4KO0A 4JK8A 4CZLA 4PL8A 3G10A 2Y1IA 1RFQA 3B6PA 3VA0A 5I9EB 3O1BA 2VGMA 4ID1A 2VG5A 3V4IA 4CJPA 4CJ3A 5SWMA 1RT5A 3VF6A 4ISEA 2UXCK 5EXWA 3SLCA 2V7YA 4FO0A 1HRHA 2OPPA 1RTHA 2VQFK 1SKRA 3OYBA 4QS7A 4JRQA 4CJ7A 3A5LC 4AM6A 4DQRA 3UIQA 3AV9A 3HM9A 3L0QA 4LD0A 3RMAA 3ULEA 1BA0A 1QVFM 1RT2A 1V4TA 4PHTX 3AARA 2QKBA 1SZ2A 1J5EK 4C8LA 5IWAK 1D4XA 3L4QA 2QWQA 1GOAA 1REVA 4DFJA 1NJWA 1WSEA 2J4RA 2D0OA 4DTSA 1U47A 3NVMA 3OS2A 4N76A 2HVIA 1YVNA 1W97L 3WXKA 3O1WA 4CD3A 3EO3A 1TVRA 4AH9A 4EFHA 5EOYA 4KTQA 1HKCA 4Z4GA 1BHLA 2YI1A 4H0PA 4KHYA 3TARA 3WNEA 4MLHA 4FJLA 4YOYA 3K57A 4AM7A 3QLHA 1TK5A 4JNEA 4HTUA 1S3XA 4A5BA 3SAHA 2P9SA 3IRXA 3JYTA 1I94K 4F3OA 4AILC 3THXA 3D7EO 3A5OC 1HR0K 2UUAK 1MA9B 3OHRA 3TSPA 1SQKA 3MXIA 5AQYA 1WOQA 3M8QA 3SMPA 5HP1A 4AHVA 2W40A 4BC5A 1JKHA 4JD2A 3U3GA 3WNHA 4CJSA 1ZXOA 4N5SA 3FZKA 1BL3A 5C12A 1BI4A 3EZWA 3BF1A 4B3OA 3NDKA 3M1FA 4CGJA 1DTQA 4F2SA 1VQLN 4NXMK 3CFPA 4O8UA 2ATQA 3R1XA 2OZMA 1IBMK 4FJIA 4JKCA 1JCEA 3I8BA 3R3LA 3AA2A 4PKGA 2HHSA 4CHZA 2RPIA 2FBVA 1L3SA 4FWRA 1VQKN 4LFCK 2FSKA 4FLVA 2O8FB 4NXNK 1TL3A 5J1EA 3V9UA 3G71N 4E0DA 2DTUA 4DB3A 1WSGA 3THWB 4FJMA 4B08A 3VMFB 3W3DA 1RT3A 1HPZA 1HX1A 3O4QA 4UQGA 4Y1CA 3LL3A 2E6LA 2I7PA 4FJHA 3CG7A 3KJVA 5HOOA 4JLHA 2QTDA 4KTWA 3ULEB 3ZSYA 4C23A 1P90A 3HO1A 4BRPA 4I7FA 3LP2A 3RVCA 3R8EA 5F0XA 2HMPA 2ZJRL 4BR2A 2JWLA 3PIOL 3MDQA 1NGEA 1FJGK 4K0KK 4X66K 3Q7BA 1CZ9A 3RTVA 3ZT2A 2BDPA 1ZBLA 4DWIA 1IV0A 2UUCK 4FPBA 4BE1A 5BRDA 1RILA 1NNEA 1XMOK 4RCHA 4ILHA 4J2DA 4U7BA 4H5NA 3VQ8A 3TANA 1BGXT 1KVBA 1OH6A 4JKGA 3CFOA 2AP1A 2DY4A 3J7YP 4DQQA 4OPAA 1WAJA 4CE9A 2GEMA 4FW2A 2XY7A 1KAZA 3QBWA 1L5UA 2NUBA 5C24A 2IVNA 3THXB 2ASPA 2ZWHA 3BEXA 3VGKA 1B92A 1KXPA 3V9ZA 3M3ZA 4BQLA 5SZTA 4AHSA 3I33A 2VWKA 4DTMA 5B8HA 2E6MA 4JD2B 2VWJA 5GINA 3DLLL 3WXMB 1BI4B 3L6QA 1LW2A 2WFBA 3QERA 1QQNA 2D0CA 3J7AP 4BDPA 4BR9A 4DSKA 4A57A 3M8RA 5JVGL 5BPLA 1O1WA 3DXKA 4M3TA 3HPHA 5FRNA 5GIPA 2Z1HA 3VETA 5C42A 1JJ2M 1IO2A 4Z4HA 1RBVA 2YV0X 1IJJA 1S22A 4CZJA 3CF5L 3HPGA 1ZC6A 4CHOA 1S6QA 3ZT1A 2ZD1A 3OS1A 1EKEA 4KRFA 2CH6A 4IEIA 3OYLA 1N32K 2IVPA 4DF8A 3S9HA 2ETJA 3KWGA 2G8HA 4DSLA 3UKRA 2E8AA 2CGLA 5FRMA 3TTFA 1YXQA 1QS4A 5K14A 3CC4N 2B4JA 3NAEA 3OA9A 4M41A 1BDGA 4IO9L 1RBTA 4O44A 1E3MA 3I0RA 4BRNA 2FC0A 3AVFA 3VEVA 3HI0A 4I6MA 2O8DA 3QIPA 1XNRK 3C7NA 1NJXA 4FLXA 1TUYA 3VQAA 3LDLA 4KBOA 4IG0A 2GUIA 2P9LB 4PA1A 1NK7A 3K0SA 3U4LA 4YDUC 5DM7L 3J7ZO 1YTUA 2ZM6K 1QQOA 4N56A 3DLRA 1TV6A 5AQHA 3NH2A 3ZSOA 3ZX0A 3MN5A 4H8KA 4CJRA 4JKGB 5AQTA 4FJ9A 3TTCA 1T05A 3SK3A 2FF3B 2OA8A 3BZKA 1WBBA 4Q0BA 4UY8O 2IVOA 2G8KA 3T3FA 3AO4A 3M8PA 4FK0A 4LFAK 1R0AA 4FXDA 2NZTA 1MWMA 3F5TA 5AQUA 2F8TA 4B1XB 4DU3A 4JI2K 3HZ6A 4LF4K 2A40A 4DQIA 5E26A 2G8FA 4CEOA 4B1UB 4BRIA 2NNWA 5AQSA 4J2EA 3J8AA 4CFCA 5FROA 3A5NC 3T69A 4CFBA 4IFVA 1L3TA 4O4GA 1Q82O 3LDOA 3WXLA 4IOXA 1N5YA 2P51A 5KGWA 1JXBA 3L2QA 3SNNA 4QS9A 2KFNA 5HL7L 5BPNA 2Z1JA 4IFYA 4HUGA 1HUXA 2GV9A 2W41A 1OVYA 4RW4A 4CIEA 4FLTA 4FWPA 1HKBA 4BE2A 2OTLN 4PKHA 1BISA 3IMXA 3D2FA 2OPRA 4DR3K 4OKKA 1TGOA 3UKRB 2HOEA 1X9MA 3CJBA 3NF7A 4BR4A 3ALYA 4DSJA 4Z4CA 3CJCA 3VQCA 2P9UA 4CEQA 4CZKA 4DV5K 3DRPA 4FWQA 3FZMA 3OW2M 2Q0UA 1A5WA 3C7NB 4CEEA 3NMUA 4OKJA 4DG1A 3I56N 1WB9A 4BG9A 4JKAA 2Q97A 3ULDA 4N47A 1SAZA 3NGYA 3PUFA 1NGGA 3ID8A 4O5BA 3H08A 4BDZA 4CK3A 4R79A 4DUYK 1HYVA 1YAGA 4CF0A 4BR0A 1OVQA 3GG4A 3MX5A 3L2UA 3CCJN 5BR8K 1DKGD 4M7XA 1NGHA 5A2QO 1NG9A 4DS5A 2YJEA 1TK0A 4IO8A 1KFSA 3EN9A 3V6DA 1YITN 1RDWX 4CVNE 2VGNA 3IFRA 3VQBA 2QEXN 5HRSA 1YJWN 4DSIA 5ADXH 4LF7K 5F1XA 5E84A 1QQMA 4KHSA 4BRFA 1HLUA 4E1NA 4YOTA 3RRGA 2YNIA 3JAMO 1P8ZA 2QXLA 1K9MO 3C94A 2RKIA 3UB5A 3PIPL 3IS9A 1QHAA 4H0OA 2YHBA 3RSEB 3ASMA 3NGZA 4WFNL 3TABA 3VQPA 3FZHA 4A62A 3O3FA 3CCVN 2ZJQL 4DFMA 3VF2A 2HW3A 3OYDA 3O80A 3H6EA 1Q81O 3K5NA 1D5AA 4FJ5A 5J2PA 3MMVA 4BC3A 4DR6K 4M3XA 4CJFA 1ATRA 5I3UA 3KK1A 3MECA 1J53A 1GLEG 3S3MA 3V9XA 3ZSXA 3ZETA 4DV1K 4CEZA 3K2PA 1ITGA 1WNSA 4NB4A 5JVHL 3Q7CA 5EVZA 5CY4A 2CGKA 3D2FB 3JXUA 4I2QA 5AQGA 3P39A 1RNHA 5C2FA 3VQEA 4C8OA 1ASWA 3AVNA 3CCLN 1BA1A 1KLMA 2IS3A 3QIOA 1RBRA 3SUOA 3DWLA 2JLEA 3MN9A 3CETA 1N8RO 5FPNA 2E2NA 1RDDA 3T7ZA 3VEXA 4RG8A 3BP8A 3WQUA 3AVLA 1BG3A 1GLCG 5AQOA 3PV8A 1S1WA 3CD6N 4FL9A 4FJXA 3QETA 4MDBA 1Q86O 3R6MA 3EKSA 1C1AA 1NLVA 4F2RA 5DMRA 1E4GT 1M90O 3TSUA 3G0ZA 3C95A 4FM1A 4CBWA 3WNFA 5AZIA 5FDLA 2NRVA 3SAFA 1XNQK 4B9NA 4KREA 5EY4A 1HQEA 3OYJA 2YKMA 3JS6A 4JKEA 5LMUK 2HBMA 2D5RA 1Z26A 3A0IX 4JI1K 3SBTA 1IBKK 4RW8A 3O3HA 4DQ8A 3KWIA 4KB1A 1U4BA 2QKKA 3SV3A 2JGUA 1MDUB 3VTIA 2F4VK 3AVGA 1JLAA 4LC9B 4FW1A 4Y0WA 1VSIA 4WCEL 1VSKA 4CGHA 3NBPA 3L3UA 2HHWA 2AJQA 1EX4A 2JWKA 3OTOK 4I9QA 4WQ4C 4JKDA 4JK9A 4H5RA 4Y1DA 4ZTJA 4LF5K 2O8BA 3K5OA 4X65K 3ZT0A 3QMLA 4B9VA 2OPSA 4ILGB 4H0TB 4I2PA 5KTQA 3KLHA 3K5LA 3FR0A 1LW0A 2YJFA 1T3VA 4EZ6A 2QWMA 3HTVA 3HRGA 5HRNA 1NMDA 3EEQA 2O8EA 2GELA 4OPKA 2IAJA 1WSJA 3ZT3A 4BDYA 4CZEA 1HQUA 3ZETB 1NGFA 1TYQA 3ID6A 4KHNA 1G15A 4FWNA 1IG8A 3GDQA 2P9KB 1OH8A 1K6YA 3DOKA 4BRMA 2QA4N 2YHXA 1QHTA 1A5XA 2I5JA 4IEEA 1W2BM 3K9KA 3OVNA 4RW6A 4B3RK 4QS8A 2PZSA 4WYBA 4BE0A 2KTQA 4M3ZA 1DGKN 3C6HA 5GADP 1VQ5N 1C0TA 3AA3A 3CCQN 3O6WA 4K8XA 2YNFA 1RGIA 5AQRA 1IKWA 1XHXA 3K58A 1NKEA 3HK2A 4LF8K 4CHYA 1D8YA 4Z0UA 4O5FA 3FE1A 4W5RA 1WN7A 2QXFA 2RE2A 5KRSA 1KLNA 3LPUA 4HCCA 3MAQA 3ZYYX 1YUWA 3DLGA 4KHWA 3THVA 5LJWA 1VQ8N 5AZIB 1C0GA 2ASMA 4OO1J 1X1PA 4CHPA 3KLEA 1N34K 1VSEA 4CIGA 3C6UA 3THYB 4E7KA 2V51B 3SJJA 2GWJA 1W9HA 4FWLA 4IXCA 3EY1A 2H3GX 4FLZA 1T03A 1K8AO 4H5WA 5M1PA 3SZ2A 3V9SA 2FXUA 1SS6A 3O9RA 4CZHA 4X62K 1L3UA 3MK6A 2DFEA 1JLCA 2YCHA 2PBDA 1FXXA 3U9ZA 3QBXA 4PQUA 1XC9A 1DTTA 4NLCA 3VA3A 4DU4A 1JCGA 3D2EA 4YORA 3O4NA 4AHCA 2ZF5O 4M63C 4HCBA 3OYKA 3TSQA 5AQXA 4FJJA 1GLFO 4WFBL 4AF1A 2O8EB 3QICA 1HNZK 4H0VB 4RW7A 1U04A 4CZGA 4ISFA 4BREA 4DV4K 1RDUA 1Z05A 4CJVA 3DAWA 2OANA 4DTOA 2FBTA 3CIPA 5AQMA 3EE8A 3OBWA 1YT3A 3L2RA 2IGIA 4IDKA 3KVGA 4XIUA 2E2OA 4CEAA 1Y64A 2E4LA 2HNZA 1HYSA 1CLQA 1M1KO 3D6RA 3MWTA 1IKYA 3F9KA 1VSDA 4JKHA 2KFZA 4FYDA 3HP6A 1NK0A 1VK0A 4QOZB 4BY9C 4B8CA 1KAXA 2KQ2A 1U6ZA 1NJZA 2P9SB 1E4FT 3S41A 4DHYA 1MU2A 4DMNA 3ITHA 2QM1A 1NGBA 2UYTA 3FZFA 1YIJN 3C6AA 5M1KA 2W6KA 2HBLA 3DM2A 4B9MA 1R59O 1VSHA 3CI5A 1B9DA 4CF1A 3WXJA 1ATSA 1XUPO 3MN6A 4KHQA 4GNIA 4WQ4A 2P5OA 3NH1A 1VQON 3SQ4A 3LP3A 4CBXA 3O9UA 4KFBA 4DR2K 2P1JA 3P31A 2FLOA 1GLDG 3A5MC 3DLEA 3QEWA 1HNXK 3O5BA 3P83D 4JV5K 1CXUA 3AGKA 4WQ5C 4CF2A 3CYMA 1GLJO 4YOVA 1Q7YO 4DS4A 3AA5X 2IIRA 4DV0K 2Q0RA 4Z4EA 4M3RA 4OGCA 4JS4A 1WSHA 3IAYA 1MWKA 3AO2A 3UKUA 3RMCA 5CHIA 4LF9K 1S9GA 3F2KA 2NRTA 4CCHA 4XH5A 3HOSA 3PO4A 2W42A 5JICA 3AVBA 3C0BA 5ADXA 3CC7N 4DFKA 4JI5K 1L3VA 5BR9A 4GV6A 1O13A 1WUAA 4CZFA 3D2EB 3N4QA 3OJUA 3IUCA 4B9TA 4YHHK 2E88A 2D0PA 1Q9YA 4LH5A 3TAFA 4KB0A 1KFDA 4JK7A 3DYAA 2XHBA 4OGEA 1GOBA 4E7HA 1BCOA 3HPOA 4JI0K 2VG6A 2P9NA 5M1QA 3MXMA 3V1OA 2Q1NA 4KV8A 3DXMA 3G4SN 2PFUA 4PKIA 2HSTA 4EHTA 4GY2B 2PAVA 1D9DA 1KC8O 4B3MK 4PUOA 3L4IA 3LPTA 3U3YA 1X3NA 4B1YB 1YHQN 3EKUA 3VQQA 1SL2A 3ZCMA 1OKJA 1S1TA 4J8FA 3T19A 4FLUA 1RDAA 3D45A 4CF8A 3MCAB 5IT9O 5CZ2A 1ZBUA 5BN9A 5GAGP 1UWBA 3H3OB 4RW9A 4Z94A 1TAQA 3MEGA 2GWKA 1T44A 3FFIA 3TWHA 3FFKB 4JKFA 2OPQA 3GOIA 4E19A 5BRFA 2NRRA 2Y1JA 2NRZA 3MWPA 4M3UA 3RR8A 4E1MA 1LWEA 3U8XA 5JLHA 4L3QA 4TSXA 2KLAA 3H3NO 1GOCA 2IOCA 4BWJA 3IKMA 3I55N 4GVEA 2FSNA 3AVAA 4F4KA 3DXKB 3CJ9A 5AQKA 1XHZA 4A5AA 3VQ9A 3VN5A 4I9LA 3AVCA 3LM2A 4OPJA 3UKUB 4ICLA 4B3SK 3K5MA 2HHHK 3QB0A 3HL8A 3HXMA 2D1KA 2HHTA 1EP4A 4CBUA 4E7LA 2A41A 1UOCA 4K8ZA 2ZGYA 4CGFA 2Z1IA 4CERA 1KQSM 1VSFA 3TTDA 4J2BA 1S9EA 1EXQA 3OYCA 4DTNA 1Q9XA 1WAFA 5AQIA 3TU5A 3T1HK 2E2PA 2CH5A 3G6EN 1DEJA 4I6MB 4K43A 2O8DB 1KTQA 2X74A 4CK2A 4DR7K 2P9NB 2QW9A 1VQ9N 3DXMB 3NVKA 3LALA 3O8MA 2YNGA 4E1JA 4B3TK 1HJRA 4KH5A 3FGUA 1ATNA 4G9ZA 2XY6A 1EWQA 4H0YB 4WE1A 2KZZA 1J54A 4C8KA 4NLBA 4MLEA 4LSNA 2RF2A 4H5TA 4M3YA 4LFBK 1KD1O 1C6VA 4FOIA 3CCMN 5TKYA 3SUNA 1UA0A 4WQ5A 5T7BA 4E7JA 2NRWA 3AVIA 4DTXA 1QTMA 1NKCA 3AA4A 3W0LA 2YKNA 1S1UA 3O9SA 2B5JA 4BRHA 3LZIA 4IBNA 5GAHP 3CXCM 4HHTA 4IOCL 4FJ8A 4AQYK 5AQNA 3VQ5A 3OYHA 5E41A 5JS1A 3PY8A 4FVMA 4B9LA 4YOUA 4R5PA 4H4OA 3EL2A 1B9FA 3O3GA 1QQCA 1ASUA 2QWLA 2ASOA 5C10A 3TAQA 2Z1GA 5M1OA 3ZEUA 3MN7A 5HLFA 4JKBA 1NMNA 3V1RA 3BDPA 4NYFA 4AHRA 1VQ7N 3IDHA 2P9IA 3DRSA 1JXEA 1IKVA 1NKBA 4B1ZA 4JI8K 4M3WA 3VENA 1ZBFA 3TAMA 3KHYA 3PX6A 4FJKA 1FKPA 4FWKA 3ZSQA 4LSLA 4MFBA 3AY9A 4CFDA 3HM8A 3H1QA 1RT6A 2R7YA 3IG1A 2UU9K 1RT7A 3MEEA 4ID5A 5HBMA 4Z4IA 1UA1A 4CK1A 3E1YA 4YDUA 4CJ4A 1J5OA 5M1FA 4BVPA 3HT3A 2FF6A 1RDCA 4O0IA 4JHDA 5GAEP 3KZBA 2W6LA 5D3GA 2NRHA 1TKTA 3QEXA 1DT9A 3B6OA 3L3VA 4LY7A 1OH5A 4CGGA 3RR7A 3F9MA 1HKGA 4BC2A 2UXBK 4B9UA 3DJCA 4DV2K 5C0YA 4EZ9A 2P9UB 3OJSA 4ELVA 1NK9A 3NFAA 1NJYA 5KI6A 1IH7A 4XH1A 4H5VA 4GKJK 4ILJA 3HYFA 1IBLK 1XWLA 3ATUA 4K41A 2XY5A 3SCXA 2HNYA 2A3ZA 2Q36A 5J2NA 1FW6A 2GX9A 3BGRA 4CJKA 4ZTFA 3KD1E 5KGXA 1I3AA 1JL2A 1VQNN 4BGAA 1H1VA 3MCPA 2ZJPL 4BRLA 3EE9A 2X6SA 1HPMA 2B6AA 2BANA 3CJ1A 5AR0A 1LV5A 4W5NA 3CM5A 3CQXA 3ZT4A 1U48A 1YF5L 1LAWA 4KH6A 5C25A 4FVUA 4CGDA 3KTQA 4DTRA 4YOXA 3ZSVA 5AQVA 4BROA 1OH7A 5FPMA 1ILYA 3H45C 4QAGA 3CCSN 1W0HA 2FBXA 3LWLA 2ZGZA 1RDBA 2UUBK 3VQ7A 3AGRA 5C2DA 5AJ3K 1XC3A 3ZEUB 1QE1A 4HUFA 1RT4A 1SUQA 4WF9L 3DI6A 2G8WA 2IC3A 2P9IB 1XQSC 2VWBA 3CQ8A 4C8MA 3VGLA 1SKWA 4Z4FA 3MEDA 4J2AA 2VQEK 1NGAA 1BCMA 3WT0A 3SUQA 4HTLA 2O8FA 1VHXA 3SQ1A 2YHYA 2RHKA 4EIAA 3G25A 4MO4A 3TI0A 4WFAL 3THWA 2V7ZA 4Q5VA 3E9LA 4CJQA 1SL1A 4U67L 3KIOA 4IJNA 4ELTA 3L8BA 3PSFA 3SV4A 1HNVA 4KI6A 2HHQA 1QSLA 3SPYA 1QZ5A 4OPHA 1JLBA 2HBJA 4DSFA 1GLLO 4RTFD 4JHDB 2ITMA 3QO9A 4FJGA 3P1GA 3AO1A 1WLJA 2PYLA 4FZXC 3OYFA 1RTDA 3ENHA 4CJWA 3AAQA 4EAHD 3CHWA 3A8YA 4C8NA 4CW7B 4G1QA 5CR4A 3VF4A 4KH4A 4GVMA 3NGIA 2X78A 3WEEA 1S1XA 1U49A 1VSMA 2HMIA 3A2FA 2QWPA 4KHUA 4NCBA 5BRHA 4XEIA 4OVLA 1JLQA 3TR8A 4C1NI 3VEOA 3C6TA 2YNHA 4B1VA 4M42A 3VTHA 1VRTA 3AVJA 4E3SA 2NRXA 2PYJA 2A42A 3HVTA 3VEWA 5FLXO 2HNDA 1KSPA 4DFPA 4CEDA 2HF4A 4K42A 5AZJA 3HSCA 1LCUA 5C15A 5LY3A 4BC4A 5DM6L 3SUPA 3HBTA 1V4SA 1G99A 2QWRA 3DLKA 1YJ9N 3HOTA 2BTFA 2OCEA 2HHVA 1NOZA 3OBYA 4GMJB 4FJ7A 2E20A 1IKXA 4O8KA 2QK9A 1C0UA 1T6DA 3UE5A 3SQ2A 3LANA 3KKRA 5CYQA 1EETA 4JS5A 1F21A 1C1CA 1WSIA 3BUZB 3E9OA 2F8SA 1UAXA 3VQ4A 3ZX3A 1DLOA 1S72N 4FLWA 4ZHRA 3VOVA 3R9PA 2ITGA 2O8BB 5CZ1A 1I39A 1YTAA 1XMQK 1VQ4N 4JYAK 4AHUA 4GW6A 3LWMA 3E01A 1HNIA 3HP9A 4DR5K 4DV6K 4RWTA 1SKSA 1IG9A 2YX6A 5BREA 1W7AA 3V9WA 3HSTB 3H1VX 4CJEA 3E66A 4JI7K 3DRRA 3MXJA 4DR4K 4FWMA 3ZX2A 4CJUA 4DLEA 2O4IA 2GUPA 1QSSA 3SMSA 4IDHA 1TYQB 4W5TA 2YHAA 2WTUA 3QNOA 4CJ5A 3L2VA 1U2VA 3JSMA 5AFUH 3OS0A 2HB5A 3OY9A 4KPYA 4CHQA 3TAGA 1D9FA 4HUEA 3EYZA 1VQMN 4H03B 3L2WA 2X6NA 2D4WA 3EZ5A 3WXIA 1GLBG 3QFPA 2P9LA 3TPQA 3LDQA 1S5JA 3RRHA 5DK5A 5AQLA 3CFRA 4F3TA 4OKEA 1Q8IA 3CM6A 3WEEB 2HHXA 5AQFA 3DLHA 4XH4A 2AA4A 3P38A 3ISNC 5JS2A 4BRQA 4BR7A 4CI6A 1RT1A 5CYMA 2XY8A 3OYAA 2E1YA 3RMBA 1NWKA 4FK4A 3J81O 4H0XB 2QI2A 1QVGM 3BF3A 1X9WA 1BOTO 3ENBA 3WNGA 2PY5A 4OX9K 3KK3A 1QSYA 1JCFA 4NO7A 4FZZA 2E2QA 2D0BA 3O9QA 5AQWA 3I8DA 5AZJB 4F8RA 1XI1A 1VSLA 3CPWM 5JMVA 3OYNA 1X9JA 3FLCO 3QEPA 5AQZA 3KKSA 4PY5A 1VQ6N 2QWNA 2HF3A 5KPTA 5JLFA 3AO5A 4L8RB 4NYNA 4CECA 1RBSA 3DLBA 5AQPA 4AHTA 2KHOA 1NU0A 3ZSWA 3OYGA 1HNWK 2OYQA 1NGIA 4CZMA 5FPEA 1ESVA 5LL6Z 3LAMA 3F73A 3QEVA 4B9QA 4CESA 4EP5A 1C1BA 1N6QA 4CIFA 1FKOA 1EO1A 2BE2A 2A5XA 2Q3SA 4CGIA 1T8EA 3P5JA 1S6PA 3VPZA 3QNNA 3TAEA 2VYPA 3N4PA 3KLIA 2G8VA 3FZLA 4FSVA 4O55A 1TKXA 2KKZA 1WSFA 3GBTA 4B9SA 4LH4A 3AO3A 3LDNA 2OTJN 3CMAN 3ZSRA 3VERA 3NF9A 4H4MA 4CZIA 4DQPA 3NE6A 5KQ8A 3SPZA 4FWOA 2FSJA 4KI4A 1U2VB 3S3OA 4V19S 3MX2A 4M45A 1BIZA 2F9WA 5ELZA 5J2QA 3LM9A 4C1NK 4GV9A 4FLYA 3PSIA 3QDKA 3V1QA 3M8SA 4PL7A 4YY3K 4E7IA 1NOYA 1JL1A 4DV7K 3QEIA 2P9PA 3SI6A 1J6ZA 3CERA 2ZQBA 3M6GA 3NF6A 4BR5A 3NCIA 3PX4A 1RBUA 5KQDA 4OLAA 5HRPA 3O08A 2O8CA 3ATVA 1YVUA 4PWDA 5FPDA 5I42A 4JRPA 1Q18A 2NLXA 4DR1K 3OYEA 4A2BA 1X9SA 3CJ7A 1C0FA 1BWFO 2ZE2A 4CJTA 3V81A 2GBZA 1YI2N 3VGMA 1C0MA 2G8UA 5HROA 3U9DA 1KVAA 4IWVA 3KK2A 2G8IA 1NJIO 2WOMA 1KRPA 1LOTB 3QINA 5LMNK 4DU1A 2VCPA 1YJNN 4M7YA 2WONA 4IZ9A 4BRGA 4DTUA 3H46O 5AQJA 1RCHA 3RSEA 3T1AA 4HVJA 4E89A 3S3NA 1K8KA 2QWOA 3GE1A 3CJAA 4FZYA 1KCFA 2DFFA 3WUHA 3QESA 2I7NA 2DFHA 3OYIA 3CPEA 3PX0A 3VQ6A 2EHGA 4YNQA 4N41A 1ASVA 1NK8A 1A5VA 2CGJA 3RWUA 3KK7A 2HVHA 4ISGA 4CJLA 1TKDA 3CQYA 2EX3A 3ZSZA 1EWRA 4F9OA 3SBGA 5CE3A 3LDPA 1Y97A 3WQTA 4CFAA 1KAYA 1RTJA 2E1ZA 3KLGA 4CD1A 2BH1A 4BRAA 2F96A 3QFUA 4B8AB 4HWIA 1LAVA 3K9JA 5AQQA 4NCAA 2P5GA 5TKWA 1KVCA 1ZYQA 2KW4A 1J9AA 5F2RA 3LDSA 3SYZA 3AVKA 1LWCA 3PLAA 2UXDK 4JEPA 4OLBA 4JI4K 1LWFA 3T1YK 5M1NA 4A59A 4BRDA 3ZLJA 3LP0A 3LP1A 4DQSA 1T6CA 1TKZA 3NF8A 2XRIA 3E9PA 4CEFA 3RMDA 1TUUA 4DKWA 4DSEA 4YOWA 2BGGA 2P9PB 4O0JA 2FBYA 3VESA
chains in the Genus database with same CATH topology
4LF9K 4OX9K 2UUBK 4KHPK 2UUCK 1XNRK 5AJ3K 1XMOK 4JI8K 3J80O 4DV5K 4B3SK 4DV3K 4JI5K 1I94K 4LF6K 2ZM6K 2UU9K 2HHHK 3J7YP 1HNZK 4X64K 1HR0K 4YHHK 2UUAK 2VQEK 4DV4K 1N36K 4B3RK 5LMNK 4DUYK 1XMQK 1HNWK 4JI0K 4JYAK 4DR5K 5LL6Z 4DV6K 4JI6K 5BR8K 3T1HK 5A2QO 4B3MK 4JI7K 4LFAK 4DR4K 4DR7K 4CVNE 4LF8K 2UXBK 4NXMK 4DV2K 4JI3K 4JI2K 4B3TK 4LF7K 4GKKK 4LF4K 1IBMK 2UXCK 3J7AP 1XNQK 4CW7B 2VQFK 4GKJK 2E5LK 1IBLK 5LMUK 4LFCK 4LFBK 3JAMO 4NXNK 4JI1K 1IBKK 5IT9O 4V19S 1N34K 4DUZK 1J5EK 5IWAK 4DR2K 2F4VK 1N33K 2UXDK 1HNXK 4JI4K 4JV5K 4AQYK 3T1YK 4YY3K 4DV7K 3OTOK 1N32K 4LF5K 4DV0K 5FLXO 4DR6K 4X65K 1FJGK 4K0KK 4X66K 3J81O 4X62K 4DR3K 4DV1K 4DR1K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 K;  4OX9 K;  2UUB K;  4KHP K;  2UUC K;  1XNR K;  5AJ3 K;  1XMO K;  4JI8 K;  3J80 O;  4DV5 K;  4B3S K;  4DV3 K;  4JI5 K;  1I94 K;  4LF6 K;  2ZM6 K;  2UU9 K;  2HHH K;  3J7Y P;  1HNZ K;  4X64 K;  1HR0 K;  4YHH K;  2UUA K;  2VQE K;  4DV4 K;  1N36 K;  4B3R K;  5LMN K;  4DUY K;  1XMQ K;  1HNW K;  4JI0 K;  4JYA K;  4DR5 K;  5LL6 Z;  4DV6 K;  4JI6 K;  5BR8 K;  3T1H K;  5A2Q O;  4B3M K;  4JI7 K;  4LFA K;  4DR4 K;  4DR7 K;  4CVN E;  4LF8 K;  2UXB K;  4NXM K;  4DV2 K;  4JI3 K;  4JI2 K;  4B3T K;  4LF7 K;  4GKK K;  4LF4 K;  1IBM K;  2UXC K;  3J7A P;  1XNQ K;  4CW7 B;  2VQF K;  4GKJ K;  2E5L K;  1IBL K;  5LMU K;  4LFC K;  4LFB K;  3JAM O;  4NXN K;  4JI1 K;  1IBK K;  5IT9 O;  4V19 S;  1N34 K;  4DUZ K;  1J5E K;  5IWA K;  4DR2 K;  2F4V K;  1N33 K;  2UXD K;  1HNX K;  4JI4 K;  4JV5 K;  4AQY K;  3T1Y K;  4YY3 K;  4DV7 K;  3OTO K;  1N32 K;  4LF5 K;  4DV0 K;  5FLX O;  4DR6 K;  4X65 K;  1FJG K;  4K0K K;  4X66 K;  3J81 O;  4X62 K;  4DR3 K;  4DV1 K;  4DR1 K; 
#chains in the Genus database with same CATH topology
 3TAP A;  3VEZ A;  1VAZ A;  4KHP K;  1NBW A;  2XO7 A;  4FCY A;  1NK5 A;  5HRR A;  1Z6R A;  2IDO A;  1TK8 A;  4QCL A;  2O4G A;  1VSJ A;  2O8C B;  1NGD A;  1JLE A;  2KZM A;  1FK9 A;  1BIU A;  1NGC A;  2A6A A;  4GV3 A;  4BWM A;  4MO5 A;  1SL0 A;  1CZA N;  1VQP N;  4FOE A;  1HMV A;  5MLC Q;  2DPN A;  3BY5 A;  4FK2 A;  3B8A X;  3LAK A;  3SAG A;  4DLG A;  4MDA A;  1JLG A;  4OJR A;  1VRU A;  4CEB A;  2LSN A;  2Q2R A;  4EHU A;  3I0S A;  3SQ0 A;  2WBN A;  3CME N;  4JI6 K;  2GTD A;  3KD5 E;  3AVH A;  2F7T A;  2A1R A;  4IFE A;  1QZ6 A;  1ZBS A;  2BUP A;  1Z25 A;  4FPA A;  1WBD A;  4YFU A;  4IG3 A;  3NHG A;  5GIO A;  4DF4 A;  1K8K B;  4JI3 K;  1CZB A;  4GKK K;  3P4I A;  1ZBI A;  3GL1 A;  4FWS A;  4KAZ A;  4KKO A;  5BN8 A;  4BG8 A;  1GLA G;  1BUP A;  3ENO A;  2E5L K;  4IKF A;  4FM2 A;  3HVR A;  5H1S Q;  2YHW A;  4JAX A;  4BAC A;  4IOA L;  3C65 A;  4NCG A;  2F9T A;  4B1W B;  1NK6 A;  1BO5 O;  4DUZ K;  2WC9 A;  3D0P A;  3CCU N;  3O9T A;  1SV5 A;  2HBK A;  3O4W A;  1X3M A;  1HYZ A;  1S1V A;  5J2M A;  3DMJ A;  4W5O A;  1N33 K;  3PO5 A;  3CCR N;  2P9K A;  2VG7 A;  4ELU A;  2HHU A;  5KPZ A;  5EX5 A;  3VQD A;  3VEY A;  4BQZ A;  1T7P A;  3NH0 A;  3KLF A;  1U45 A;  3SJH A;  1TL1 A;  4BRK A;  3OYM A;  4K25 A;  5KPR A;  1BQM A;  1CXQ A;  3U6F A;  2RN2 A;  4BVO A;  4KTZ A;  2D0A A;  4DTJ A;  4JN4 A;  4MQ3 A;  2V52 B;  4CHN A;  4IJA A;  3J80 O;  2A1S A;  2EWS A;  3HJF A;  3CC2 N;  4DV3 K;  4A61 A;  5AFU A;  1NGJ A;  4W5Q A;  1NK4 A;  2OZS A;  4LF6 K;  5LJV A;  3M5R A;  3CCE N;  4X64 K;  1HJO A;  4DTP A;  4BRC A;  4EP4 A;  4A2A A;  5KRT A;  5BPM A;  4BGB A;  1ZBH A;  1TAU A;  1N36 K;  4FM0 A;  1BU6 O;  3K59 A;  1K73 O;  4DCH A;  3LZJ A;  2WUS A;  4FJN A;  1BQN A;  3DOL A;  2Q31 A;  1EQY A;  3AAP A;  3AVM A;  1RTI A;  5EU7 A;  1NM1 A;  3BZC A;  1JLF A;  4CF9 A;  3THY A;  4KO0 A;  4JK8 A;  4CZL A;  4PL8 A;  3G10 A;  2Y1I A;  1RFQ A;  3B6P A;  3VA0 A;  5I9E B;  3O1B A;  2VGM A;  4ID1 A;  2VG5 A;  3V4I A;  4CJP A;  4CJ3 A;  5SWM A;  1RT5 A;  3VF6 A;  4ISE A;  2UXC K;  5EXW A;  3SLC A;  2V7Y A;  4FO0 A;  1HRH A;  2OPP A;  1RTH A;  2VQF K;  1SKR A;  3OYB A;  4QS7 A;  4JRQ A;  4CJ7 A;  3A5L C;  4AM6 A;  4DQR A;  3UIQ A;  3AV9 A;  3HM9 A;  3L0Q A;  4LD0 A;  3RMA A;  3ULE A;  1BA0 A;  1QVF M;  1RT2 A;  1V4T A;  4PHT X;  3AAR A;  2QKB A;  1SZ2 A;  1J5E K;  4C8L A;  5IWA K;  1D4X A;  3L4Q A;  2QWQ A;  1GOA A;  1REV A;  4DFJ A;  1NJW A;  1WSE A;  2J4R A;  2D0O A;  4DTS A;  1U47 A;  3NVM A;  3OS2 A;  4N76 A;  2HVI A;  1YVN A;  1W97 L;  3WXK A;  3O1W A;  4CD3 A;  3EO3 A;  1TVR A;  4AH9 A;  4EFH A;  5EOY A;  4KTQ A;  1HKC A;  4Z4G A;  1BHL A;  2YI1 A;  4H0P A;  4KHY A;  3TAR A;  3WNE A;  4MLH A;  4FJL A;  4YOY A;  3K57 A;  4AM7 A;  3QLH A;  1TK5 A;  4JNE A;  4HTU A;  1S3X A;  4A5B A;  3SAH A;  2P9S A;  3IRX A;  3JYT A;  1I94 K;  4F3O A;  4AIL C;  3THX A;  3D7E O;  3A5O C;  1HR0 K;  2UUA K;  1MA9 B;  3OHR A;  3TSP A;  1SQK A;  3MXI A;  5AQY A;  1WOQ A;  3M8Q A;  3SMP A;  5HP1 A;  4AHV A;  2W40 A;  4BC5 A;  1JKH A;  4JD2 A;  3U3G A;  3WNH A;  4CJS A;  1ZXO A;  4N5S A;  3FZK A;  1BL3 A;  5C12 A;  1BI4 A;  3EZW A;  3BF1 A;  4B3O A;  3NDK A;  3M1F A;  4CGJ A;  1DTQ A;  4F2S A;  1VQL N;  4NXM K;  3CFP A;  4O8U A;  2ATQ A;  3R1X A;  2OZM A;  1IBM K;  4FJI A;  4JKC A;  1JCE A;  3I8B A;  3R3L A;  3AA2 A;  4PKG A;  2HHS A;  4CHZ A;  2RPI A;  2FBV A;  1L3S A;  4FWR A;  1VQK N;  4LFC K;  2FSK A;  4FLV A;  2O8F B;  4NXN K;  1TL3 A;  5J1E A;  3V9U A;  3G71 N;  4E0D A;  2DTU A;  4DB3 A;  1WSG A;  3THW B;  4FJM A;  4B08 A;  3VMF B;  3W3D A;  1RT3 A;  1HPZ A;  1HX1 A;  3O4Q A;  4UQG A;  4Y1C A;  3LL3 A;  2E6L A;  2I7P A;  4FJH A;  3CG7 A;  3KJV A;  5HOO A;  4JLH A;  2QTD A;  4KTW A;  3ULE B;  3ZSY A;  4C23 A;  1P90 A;  3HO1 A;  4BRP A;  4I7F A;  3LP2 A;  3RVC A;  3R8E A;  5F0X A;  2HMP A;  2ZJR L;  4BR2 A;  2JWL A;  3PIO L;  3MDQ A;  1NGE A;  1FJG K;  4K0K K;  4X66 K;  3Q7B A;  1CZ9 A;  3RTV A;  3ZT2 A;  2BDP A;  1ZBL A;  4DWI A;  1IV0 A;  2UUC K;  4FPB A;  4BE1 A;  5BRD A;  1RIL A;  1NNE A;  1XMO K;  4RCH A;  4ILH A;  4J2D A;  4U7B A;  4H5N A;  3VQ8 A;  3TAN A;  1BGX T;  1KVB A;  1OH6 A;  4JKG A;  3CFO A;  2AP1 A;  2DY4 A;  3J7Y P;  4DQQ A;  4OPA A;  1WAJ A;  4CE9 A;  2GEM A;  4FW2 A;  2XY7 A;  1KAZ A;  3QBW A;  1L5U A;  2NUB A;  5C24 A;  2IVN A;  3THX B;  2ASP A;  2ZWH A;  3BEX A;  3VGK A;  1B92 A;  1KXP A;  3V9Z A;  3M3Z A;  4BQL A;  5SZT A;  4AHS A;  3I33 A;  2VWK A;  4DTM A;  5B8H A;  2E6M A;  4JD2 B;  2VWJ A;  5GIN A;  3DLL L;  3WXM B;  1BI4 B;  3L6Q A;  1LW2 A;  2WFB A;  3QER A;  1QQN A;  2D0C A;  3J7A P;  4BDP A;  4BR9 A;  4DSK A;  4A57 A;  3M8R A;  5JVG L;  5BPL A;  1O1W A;  3DXK A;  4M3T A;  3HPH A;  5FRN A;  5GIP A;  2Z1H A;  3VET A;  5C42 A;  1JJ2 M;  1IO2 A;  4Z4H A;  1RBV A;  2YV0 X;  1IJJ A;  1S22 A;  4CZJ A;  3CF5 L;  3HPG A;  1ZC6 A;  4CHO A;  1S6Q A;  3ZT1 A;  2ZD1 A;  3OS1 A;  1EKE A;  4KRF A;  2CH6 A;  4IEI A;  3OYL A;  1N32 K;  2IVP A;  4DF8 A;  3S9H A;  2ETJ A;  3KWG A;  2G8H A;  4DSL A;  3UKR A;  2E8A A;  2CGL A;  5FRM A;  3TTF A;  1YXQ A;  1QS4 A;  5K14 A;  3CC4 N;  2B4J A;  3NAE A;  3OA9 A;  4M41 A;  1BDG A;  4IO9 L;  1RBT A;  4O44 A;  1E3M A;  3I0R A;  4BRN A;  2FC0 A;  3AVF A;  3VEV A;  3HI0 A;  4I6M A;  2O8D A;  3QIP A;  1XNR K;  3C7N A;  1NJX A;  4FLX A;  1TUY A;  3VQA A;  3LDL A;  4KBO A;  4IG0 A;  2GUI A;  2P9L B;  4PA1 A;  1NK7 A;  3K0S A;  3U4L A;  4YDU C;  5DM7 L;  3J7Z O;  1YTU A;  2ZM6 K;  1QQO A;  4N56 A;  3DLR A;  1TV6 A;  5AQH A;  3NH2 A;  3ZSO A;  3ZX0 A;  3MN5 A;  4H8K A;  4CJR A;  4JKG B;  5AQT A;  4FJ9 A;  3TTC A;  1T05 A;  3SK3 A;  2FF3 B;  2OA8 A;  3BZK A;  1WBB A;  4Q0B A;  4UY8 O;  2IVO A;  2G8K A;  3T3F A;  3AO4 A;  3M8P A;  4FK0 A;  4LFA K;  1R0A A;  4FXD A;  2NZT A;  1MWM A;  3F5T A;  5AQU A;  2F8T A;  4B1X B;  4DU3 A;  4JI2 K;  3HZ6 A;  4LF4 K;  2A40 A;  4DQI A;  5E26 A;  2G8F A;  4CEO A;  4B1U B;  4BRI A;  2NNW A;  5AQS A;  4J2E A;  3J8A A;  4CFC A;  5FRO A;  3A5N C;  3T69 A;  4CFB A;  4IFV A;  1L3T A;  4O4G A;  1Q82 O;  3LDO A;  3WXL A;  4IOX A;  1N5Y A;  2P51 A;  5KGW A;  1JXB A;  3L2Q A;  3SNN A;  4QS9 A;  2KFN A;  5HL7 L;  5BPN A;  2Z1J A;  4IFY A;  4HUG A;  1HUX A;  2GV9 A;  2W41 A;  1OVY A;  4RW4 A;  4CIE A;  4FLT A;  4FWP A;  1HKB A;  4BE2 A;  2OTL N;  4PKH A;  1BIS A;  3IMX A;  3D2F A;  2OPR A;  4DR3 K;  4OKK A;  1TGO A;  3UKR B;  2HOE A;  1X9M A;  3CJB A;  3NF7 A;  4BR4 A;  3ALY A;  4DSJ A;  4Z4C A;  3CJC A;  3VQC A;  2P9U A;  4CEQ A;  4CZK A;  4DV5 K;  3DRP A;  4FWQ A;  3FZM A;  3OW2 M;  2Q0U A;  1A5W A;  3C7N B;  4CEE A;  3NMU A;  4OKJ A;  4DG1 A;  3I56 N;  1WB9 A;  4BG9 A;  4JKA A;  2Q97 A;  3ULD A;  4N47 A;  1SAZ A;  3NGY A;  3PUF A;  1NGG A;  3ID8 A;  4O5B A;  3H08 A;  4BDZ A;  4CK3 A;  4R79 A;  4DUY K;  1HYV A;  1YAG A;  4CF0 A;  4BR0 A;  1OVQ A;  3GG4 A;  3MX5 A;  3L2U A;  3CCJ N;  5BR8 K;  1DKG D;  4M7X A;  1NGH A;  5A2Q O;  1NG9 A;  4DS5 A;  2YJE A;  1TK0 A;  4IO8 A;  1KFS A;  3EN9 A;  3V6D A;  1YIT N;  1RDW X;  4CVN E;  2VGN A;  3IFR A;  3VQB A;  2QEX N;  5HRS A;  1YJW N;  4DSI A;  5ADX H;  4LF7 K;  5F1X A;  5E84 A;  1QQM A;  4KHS A;  4BRF A;  1HLU A;  4E1N A;  4YOT A;  3RRG A;  2YNI A;  3JAM O;  1P8Z A;  2QXL A;  1K9M O;  3C94 A;  2RKI A;  3UB5 A;  3PIP L;  3IS9 A;  1QHA A;  4H0O A;  2YHB A;  3RSE B;  3ASM A;  3NGZ A;  4WFN L;  3TAB A;  3VQP A;  3FZH A;  4A62 A;  3O3F A;  3CCV N;  2ZJQ L;  4DFM A;  3VF2 A;  2HW3 A;  3OYD A;  3O80 A;  3H6E A;  1Q81 O;  3K5N A;  1D5A A;  4FJ5 A;  5J2P A;  3MMV A;  4BC3 A;  4DR6 K;  4M3X A;  4CJF A;  1ATR A;  5I3U A;  3KK1 A;  3MEC A;  1J53 A;  1GLE G;  3S3M A;  3V9X A;  3ZSX A;  3ZET A;  4DV1 K;  4CEZ A;  3K2P A;  1ITG A;  1WNS A;  4NB4 A;  5JVH L;  3Q7C A;  5EVZ A;  5CY4 A;  2CGK A;  3D2F B;  3JXU A;  4I2Q A;  5AQG A;  3P39 A;  1RNH A;  5C2F A;  3VQE A;  4C8O A;  1ASW A;  3AVN A;  3CCL N;  1BA1 A;  1KLM A;  2IS3 A;  3QIO A;  1RBR A;  3SUO A;  3DWL A;  2JLE A;  3MN9 A;  3CET A;  1N8R O;  5FPN A;  2E2N A;  1RDD A;  3T7Z A;  3VEX A;  4RG8 A;  3BP8 A;  3WQU A;  3AVL A;  1BG3 A;  1GLC G;  5AQO A;  3PV8 A;  1S1W A;  3CD6 N;  4FL9 A;  4FJX A;  3QET A;  4MDB A;  1Q86 O;  3R6M A;  3EKS A;  1C1A A;  1NLV A;  4F2R A;  5DMR A;  1E4G T;  1M90 O;  3TSU A;  3G0Z A;  3C95 A;  4FM1 A;  4CBW A;  3WNF A;  5AZI A;  5FDL A;  2NRV A;  3SAF A;  1XNQ K;  4B9N A;  4KRE A;  5EY4 A;  1HQE A;  3OYJ A;  2YKM A;  3JS6 A;  4JKE A;  5LMU K;  2HBM A;  2D5R A;  1Z26 A;  3A0I X;  4JI1 K;  3SBT A;  1IBK K;  4RW8 A;  3O3H A;  4DQ8 A;  3KWI A;  4KB1 A;  1U4B A;  2QKK A;  3SV3 A;  2JGU A;  1MDU B;  3VTI A;  2F4V K;  3AVG A;  1JLA A;  4LC9 B;  4FW1 A;  4Y0W A;  1VSI A;  4WCE L;  1VSK A;  4CGH A;  3NBP A;  3L3U A;  2HHW A;  2AJQ A;  1EX4 A;  2JWK A;  3OTO K;  4I9Q A;  4WQ4 C;  4JKD A;  4JK9 A;  4H5R A;  4Y1D A;  4ZTJ A;  4LF5 K;  2O8B A;  3K5O A;  4X65 K;  3ZT0 A;  3QML A;  4B9V A;  2OPS A;  4ILG B;  4H0T B;  4I2P A;  5KTQ A;  3KLH A;  3K5L A;  3FR0 A;  1LW0 A;  2YJF A;  1T3V A;  4EZ6 A;  2QWM A;  3HTV A;  3HRG A;  5HRN A;  1NMD A;  3EEQ A;  2O8E A;  2GEL A;  4OPK A;  2IAJ A;  1WSJ A;  3ZT3 A;  4BDY A;  4CZE A;  1HQU A;  3ZET B;  1NGF A;  1TYQ A;  3ID6 A;  4KHN A;  1G15 A;  4FWN A;  1IG8 A;  3GDQ A;  2P9K B;  1OH8 A;  1K6Y A;  3DOK A;  4BRM A;  2QA4 N;  2YHX A;  1QHT A;  1A5X A;  2I5J A;  4IEE A;  1W2B M;  3K9K A;  3OVN A;  4RW6 A;  4B3R K;  4QS8 A;  2PZS A;  4WYB A;  4BE0 A;  2KTQ A;  4M3Z A;  1DGK N;  3C6H A;  5GAD P;  1VQ5 N;  1C0T A;  3AA3 A;  3CCQ N;  3O6W A;  4K8X A;  2YNF A;  1RGI A;  5AQR A;  1IKW A;  1XHX A;  3K58 A;  1NKE A;  3HK2 A;  4LF8 K;  4CHY A;  1D8Y A;  4Z0U A;  4O5F A;  3FE1 A;  4W5R A;  1WN7 A;  2QXF A;  2RE2 A;  5KRS A;  1KLN A;  3LPU A;  4HCC A;  3MAQ A;  3ZYY X;  1YUW A;  3DLG A;  4KHW A;  3THV A;  5LJW A;  1VQ8 N;  5AZI B;  1C0G A;  2ASM A;  4OO1 J;  1X1P A;  4CHP A;  3KLE A;  1N34 K;  1VSE A;  4CIG A;  3C6U A;  3THY B;  4E7K A;  2V51 B;  3SJJ A;  2GWJ A;  1W9H A;  4FWL A;  4IXC A;  3EY1 A;  2H3G X;  4FLZ A;  1T03 A;  1K8A O;  4H5W A;  5M1P A;  3SZ2 A;  3V9S A;  2FXU A;  1SS6 A;  3O9R A;  4CZH A;  4X62 K;  1L3U A;  3MK6 A;  2DFE A;  1JLC A;  2YCH A;  2PBD A;  1FXX A;  3U9Z A;  3QBX A;  4PQU A;  1XC9 A;  1DTT A;  4NLC A;  3VA3 A;  4DU4 A;  1JCG A;  3D2E A;  4YOR A;  3O4N A;  4AHC A;  2ZF5 O;  4M63 C;  4HCB A;  3OYK A;  3TSQ A;  5AQX A;  4FJJ A;  1GLF O;  4WFB L;  4AF1 A;  2O8E B;  3QIC A;  1HNZ K;  4H0V B;  4RW7 A;  1U04 A;  4CZG A;  4ISF A;  4BRE A;  4DV4 K;  1RDU A;  1Z05 A;  4CJV A;  3DAW A;  2OAN A;  4DTO A;  2FBT A;  3CIP A;  5AQM A;  3EE8 A;  3OBW A;  1YT3 A;  3L2R A;  2IGI A;  4IDK A;  3KVG A;  4XIU A;  2E2O A;  4CEA A;  1Y64 A;  2E4L A;  2HNZ A;  1HYS A;  1CLQ A;  1M1K O;  3D6R A;  3MWT A;  1IKY A;  3F9K A;  1VSD A;  4JKH A;  2KFZ A;  4FYD A;  3HP6 A;  1NK0 A;  1VK0 A;  4QOZ B;  4BY9 C;  4B8C A;  1KAX A;  2KQ2 A;  1U6Z A;  1NJZ A;  2P9S B;  1E4F T;  3S41 A;  4DHY A;  1MU2 A;  4DMN A;  3ITH A;  2QM1 A;  1NGB A;  2UYT A;  3FZF A;  1YIJ N;  3C6A A;  5M1K A;  2W6K A;  2HBL A;  3DM2 A;  4B9M A;  1R59 O;  1VSH A;  3CI5 A;  1B9D A;  4CF1 A;  3WXJ A;  1ATS A;  1XUP O;  3MN6 A;  4KHQ A;  4GNI A;  4WQ4 A;  2P5O A;  3NH1 A;  1VQO N;  3SQ4 A;  3LP3 A;  4CBX A;  3O9U A;  4KFB A;  4DR2 K;  2P1J A;  3P31 A;  2FLO A;  1GLD G;  3A5M C;  3DLE A;  3QEW A;  1HNX K;  3O5B A;  3P83 D;  4JV5 K;  1CXU A;  3AGK A;  4WQ5 C;  4CF2 A;  3CYM A;  1GLJ O;  4YOV A;  1Q7Y O;  4DS4 A;  3AA5 X;  2IIR A;  4DV0 K;  2Q0R A;  4Z4E A;  4M3R A;  4OGC A;  4JS4 A;  1WSH A;  3IAY A;  1MWK A;  3AO2 A;  3UKU A;  3RMC A;  5CHI A;  4LF9 K;  1S9G A;  3F2K A;  2NRT A;  4CCH A;  4XH5 A;  3HOS A;  3PO4 A;  2W42 A;  5JIC A;  3AVB A;  3C0B A;  5ADX A;  3CC7 N;  4DFK A;  4JI5 K;  1L3V A;  5BR9 A;  4GV6 A;  1O13 A;  1WUA A;  4CZF A;  3D2E B;  3N4Q A;  3OJU A;  3IUC A;  4B9T A;  4YHH K;  2E88 A;  2D0P A;  1Q9Y A;  4LH5 A;  3TAF A;  4KB0 A;  1KFD A;  4JK7 A;  3DYA A;  2XHB A;  4OGE A;  1GOB A;  4E7H A;  1BCO A;  3HPO A;  4JI0 K;  2VG6 A;  2P9N A;  5M1Q A;  3MXM A;  3V1O A;  2Q1N A;  4KV8 A;  3DXM A;  3G4S N;  2PFU A;  4PKI A;  2HST A;  4EHT A;  4GY2 B;  2PAV A;  1D9D A;  1KC8 O;  4B3M K;  4PUO A;  3L4I A;  3LPT A;  3U3Y A;  1X3N A;  4B1Y B;  1YHQ N;  3EKU A;  3VQQ A;  1SL2 A;  3ZCM A;  1OKJ A;  1S1T A;  4J8F A;  3T19 A;  4FLU A;  1RDA A;  3D45 A;  4CF8 A;  3MCA B;  5IT9 O;  5CZ2 A;  1ZBU A;  5BN9 A;  5GAG P;  1UWB A;  3H3O B;  4RW9 A;  4Z94 A;  1TAQ A;  3MEG A;  2GWK A;  1T44 A;  3FFI A;  3TWH A;  3FFK B;  4JKF A;  2OPQ A;  3GOI A;  4E19 A;  5BRF A;  2NRR A;  2Y1J A;  2NRZ A;  3MWP A;  4M3U A;  3RR8 A;  4E1M A;  1LWE A;  3U8X A;  5JLH A;  4L3Q A;  4TSX A;  2KLA A;  3H3N O;  1GOC A;  2IOC A;  4BWJ A;  3IKM A;  3I55 N;  4GVE A;  2FSN A;  3AVA A;  4F4K A;  3DXK B;  3CJ9 A;  5AQK A;  1XHZ A;  4A5A A;  3VQ9 A;  3VN5 A;  4I9L A;  3AVC A;  3LM2 A;  4OPJ A;  3UKU B;  4ICL A;  4B3S K;  3K5M A;  2HHH K;  3QB0 A;  3HL8 A;  3HXM A;  2D1K A;  2HHT A;  1EP4 A;  4CBU A;  4E7L A;  2A41 A;  1UOC A;  4K8Z A;  2ZGY A;  4CGF A;  2Z1I A;  4CER A;  1KQS M;  1VSF A;  3TTD A;  4J2B A;  1S9E A;  1EXQ A;  3OYC A;  4DTN A;  1Q9X A;  1WAF A;  5AQI A;  3TU5 A;  3T1H K;  2E2P A;  2CH5 A;  3G6E N;  1DEJ A;  4I6M B;  4K43 A;  2O8D B;  1KTQ A;  2X74 A;  4CK2 A;  4DR7 K;  2P9N B;  2QW9 A;  1VQ9 N;  3DXM B;  3NVK A;  3LAL A;  3O8M A;  2YNG A;  4E1J A;  4B3T K;  1HJR A;  4KH5 A;  3FGU A;  1ATN A;  4G9Z A;  2XY6 A;  1EWQ A;  4H0Y B;  4WE1 A;  2KZZ A;  1J54 A;  4C8K A;  4NLB A;  4MLE A;  4LSN A;  2RF2 A;  4H5T A;  4M3Y A;  4LFB K;  1KD1 O;  1C6V A;  4FOI A;  3CCM N;  5TKY A;  3SUN A;  1UA0 A;  4WQ5 A;  5T7B A;  4E7J A;  2NRW A;  3AVI A;  4DTX A;  1QTM A;  1NKC A;  3AA4 A;  3W0L A;  2YKN A;  1S1U A;  3O9S A;  2B5J A;  4BRH A;  3LZI A;  4IBN A;  5GAH P;  3CXC M;  4HHT A;  4IOC L;  4FJ8 A;  4AQY K;  5AQN A;  3VQ5 A;  3OYH A;  5E41 A;  5JS1 A;  3PY8 A;  4FVM A;  4B9L A;  4YOU A;  4R5P A;  4H4O A;  3EL2 A;  1B9F A;  3O3G A;  1QQC A;  1ASU A;  2QWL A;  2ASO A;  5C10 A;  3TAQ A;  2Z1G A;  5M1O A;  3ZEU A;  3MN7 A;  5HLF A;  4JKB A;  1NMN A;  3V1R A;  3BDP A;  4NYF A;  4AHR A;  1VQ7 N;  3IDH A;  2P9I A;  3DRS A;  1JXE A;  1IKV A;  1NKB A;  4B1Z A;  4JI8 K;  4M3W A;  3VEN A;  1ZBF A;  3TAM A;  3KHY A;  3PX6 A;  4FJK A;  1FKP A;  4FWK A;  3ZSQ A;  4LSL A;  4MFB A;  3AY9 A;  4CFD A;  3HM8 A;  3H1Q A;  1RT6 A;  2R7Y A;  3IG1 A;  2UU9 K;  1RT7 A;  3MEE A;  4ID5 A;  5HBM A;  4Z4I A;  1UA1 A;  4CK1 A;  3E1Y A;  4YDU A;  4CJ4 A;  1J5O A;  5M1F A;  4BVP A;  3HT3 A;  2FF6 A;  1RDC A;  4O0I A;  4JHD A;  5GAE P;  3KZB A;  2W6L A;  5D3G A;  2NRH A;  1TKT A;  3QEX A;  1DT9 A;  3B6O A;  3L3V A;  4LY7 A;  1OH5 A;  4CGG A;  3RR7 A;  3F9M A;  1HKG A;  4BC2 A;  2UXB K;  4B9U A;  3DJC A;  4DV2 K;  5C0Y A;  4EZ9 A;  2P9U B;  3OJS A;  4ELV A;  1NK9 A;  3NFA A;  1NJY A;  5KI6 A;  1IH7 A;  4XH1 A;  4H5V A;  4GKJ K;  4ILJ A;  3HYF A;  1IBL K;  1XWL A;  3ATU A;  4K41 A;  2XY5 A;  3SCX A;  2HNY A;  2A3Z A;  2Q36 A;  5J2N A;  1FW6 A;  2GX9 A;  3BGR A;  4CJK A;  4ZTF A;  3KD1 E;  5KGX A;  1I3A A;  1JL2 A;  1VQN N;  4BGA A;  1H1V A;  3MCP A;  2ZJP L;  4BRL A;  3EE9 A;  2X6S A;  1HPM A;  2B6A A;  2BAN A;  3CJ1 A;  5AR0 A;  1LV5 A;  4W5N A;  3CM5 A;  3CQX A;  3ZT4 A;  1U48 A;  1YF5 L;  1LAW A;  4KH6 A;  5C25 A;  4FVU A;  4CGD A;  3KTQ A;  4DTR A;  4YOX A;  3ZSV A;  5AQV A;  4BRO A;  1OH7 A;  5FPM A;  1ILY A;  3H45 C;  4QAG A;  3CCS N;  1W0H A;  2FBX A;  3LWL A;  2ZGZ A;  1RDB A;  2UUB K;  3VQ7 A;  3AGR A;  5C2D A;  5AJ3 K;  1XC3 A;  3ZEU B;  1QE1 A;  4HUF A;  1RT4 A;  1SUQ A;  4WF9 L;  3DI6 A;  2G8W A;  2IC3 A;  2P9I B;  1XQS C;  2VWB A;  3CQ8 A;  4C8M A;  3VGL A;  1SKW A;  4Z4F A;  3MED A;  4J2A A;  2VQE K;  1NGA A;  1BCM A;  3WT0 A;  3SUQ A;  4HTL A;  2O8F A;  1VHX A;  3SQ1 A;  2YHY A;  2RHK A;  4EIA A;  3G25 A;  4MO4 A;  3TI0 A;  4WFA L;  3THW A;  2V7Z A;  4Q5V A;  3E9L A;  4CJQ A;  1SL1 A;  4U67 L;  3KIO A;  4IJN A;  4ELT A;  3L8B A;  3PSF A;  3SV4 A;  1HNV A;  4KI6 A;  2HHQ A;  1QSL A;  3SPY A;  1QZ5 A;  4OPH A;  1JLB A;  2HBJ A;  4DSF A;  1GLL O;  4RTF D;  4JHD B;  2ITM A;  3QO9 A;  4FJG A;  3P1G A;  3AO1 A;  1WLJ A;  2PYL A;  4FZX C;  3OYF A;  1RTD A;  3ENH A;  4CJW A;  3AAQ A;  4EAH D;  3CHW A;  3A8Y A;  4C8N A;  4CW7 B;  4G1Q A;  5CR4 A;  3VF4 A;  4KH4 A;  4GVM A;  3NGI A;  2X78 A;  3WEE A;  1S1X A;  1U49 A;  1VSM A;  2HMI A;  3A2F A;  2QWP A;  4KHU A;  4NCB A;  5BRH A;  4XEI A;  4OVL A;  1JLQ A;  3TR8 A;  4C1N I;  3VEO A;  3C6T A;  2YNH A;  4B1V A;  4M42 A;  3VTH A;  1VRT A;  3AVJ A;  4E3S A;  2NRX A;  2PYJ A;  2A42 A;  3HVT A;  3VEW A;  5FLX O;  2HND A;  1KSP A;  4DFP A;  4CED A;  2HF4 A;  4K42 A;  5AZJ A;  3HSC A;  1LCU A;  5C15 A;  5LY3 A;  4BC4 A;  5DM6 L;  3SUP A;  3HBT A;  1V4S A;  1G99 A;  2QWR A;  3DLK A;  1YJ9 N;  3HOT A;  2BTF A;  2OCE A;  2HHV A;  1NOZ A;  3OBY A;  4GMJ B;  4FJ7 A;  2E20 A;  1IKX A;  4O8K A;  2QK9 A;  1C0U A;  1T6D A;  3UE5 A;  3SQ2 A;  3LAN A;  3KKR A;  5CYQ A;  1EET A;  4JS5 A;  1F21 A;  1C1C A;  1WSI A;  3BUZ B;  3E9O A;  2F8S A;  1UAX A;  3VQ4 A;  3ZX3 A;  1DLO A;  1S72 N;  4FLW A;  4ZHR A;  3VOV A;  3R9P A;  2ITG A;  2O8B B;  5CZ1 A;  1I39 A;  1YTA A;  1XMQ K;  1VQ4 N;  4JYA K;  4AHU A;  4GW6 A;  3LWM A;  3E01 A;  1HNI A;  3HP9 A;  4DR5 K;  4DV6 K;  4RWT A;  1SKS A;  1IG9 A;  2YX6 A;  5BRE A;  1W7A A;  3V9W A;  3HST B;  3H1V X;  4CJE A;  3E66 A;  4JI7 K;  3DRR A;  3MXJ A;  4DR4 K;  4FWM A;  3ZX2 A;  4CJU A;  4DLE A;  2O4I A;  2GUP A;  1QSS A;  3SMS A;  4IDH A;  1TYQ B;  4W5T A;  2YHA A;  2WTU A;  3QNO A;  4CJ5 A;  3L2V A;  1U2V A;  3JSM A;  5AFU H;  3OS0 A;  2HB5 A;  3OY9 A;  4KPY A;  4CHQ A;  3TAG A;  1D9F A;  4HUE A;  3EYZ A;  1VQM N;  4H03 B;  3L2W A;  2X6N A;  2D4W A;  3EZ5 A;  3WXI A;  1GLB G;  3QFP A;  2P9L A;  3TPQ A;  3LDQ A;  1S5J A;  3RRH A;  5DK5 A;  5AQL A;  3CFR A;  4F3T A;  4OKE A;  1Q8I A;  3CM6 A;  3WEE B;  2HHX A;  5AQF A;  3DLH A;  4XH4 A;  2AA4 A;  3P38 A;  3ISN C;  5JS2 A;  4BRQ A;  4BR7 A;  4CI6 A;  1RT1 A;  5CYM A;  2XY8 A;  3OYA A;  2E1Y A;  3RMB A;  1NWK A;  4FK4 A;  3J81 O;  4H0X B;  2QI2 A;  1QVG M;  3BF3 A;  1X9W A;  1BOT O;  3ENB A;  3WNG A;  2PY5 A;  4OX9 K;  3KK3 A;  1QSY A;  1JCF A;  4NO7 A;  4FZZ A;  2E2Q A;  2D0B A;  3O9Q A;  5AQW A;  3I8D A;  5AZJ B;  4F8R A;  1XI1 A;  1VSL A;  3CPW M;  5JMV A;  3OYN A;  1X9J A;  3FLC O;  3QEP A;  5AQZ A;  3KKS A;  4PY5 A;  1VQ6 N;  2QWN A;  2HF3 A;  5KPT A;  5JLF A;  3AO5 A;  4L8R B;  4NYN A;  4CEC A;  1RBS A;  3DLB A;  5AQP A;  4AHT A;  2KHO A;  1NU0 A;  3ZSW A;  3OYG A;  1HNW K;  2OYQ A;  1NGI A;  4CZM A;  5FPE A;  1ESV A;  5LL6 Z;  3LAM A;  3F73 A;  3QEV A;  4B9Q A;  4CES A;  4EP5 A;  1C1B A;  1N6Q A;  4CIF A;  1FKO A;  1EO1 A;  2BE2 A;  2A5X A;  2Q3S A;  4CGI A;  1T8E A;  3P5J A;  1S6P A;  3VPZ A;  3QNN A;  3TAE A;  2VYP A;  3N4P A;  3KLI A;  2G8V A;  3FZL A;  4FSV A;  4O55 A;  1TKX A;  2KKZ A;  1WSF A;  3GBT A;  4B9S A;  4LH4 A;  3AO3 A;  3LDN A;  2OTJ N;  3CMA N;  3ZSR A;  3VER A;  3NF9 A;  4H4M A;  4CZI A;  4DQP A;  3NE6 A;  5KQ8 A;  3SPZ A;  4FWO A;  2FSJ A;  4KI4 A;  1U2V B;  3S3O A;  4V19 S;  3MX2 A;  4M45 A;  1BIZ A;  2F9W A;  5ELZ A;  5J2Q A;  3LM9 A;  4C1N K;  4GV9 A;  4FLY A;  3PSI A;  3QDK A;  3V1Q A;  3M8S A;  4PL7 A;  4YY3 K;  4E7I A;  1NOY A;  1JL1 A;  4DV7 K;  3QEI A;  2P9P A;  3SI6 A;  1J6Z A;  3CER A;  2ZQB A;  3M6G A;  3NF6 A;  4BR5 A;  3NCI A;  3PX4 A;  1RBU A;  5KQD A;  4OLA A;  5HRP A;  3O08 A;  2O8C A;  3ATV A;  1YVU A;  4PWD A;  5FPD A;  5I42 A;  4JRP A;  1Q18 A;  2NLX A;  4DR1 K;  3OYE A;  4A2B A;  1X9S A;  3CJ7 A;  1C0F A;  1BWF O;  2ZE2 A;  4CJT A;  3V81 A;  2GBZ A;  1YI2 N;  3VGM A;  1C0M A;  2G8U A;  5HRO A;  3U9D A;  1KVA A;  4IWV A;  3KK2 A;  2G8I A;  1NJI O;  2WOM A;  1KRP A;  1LOT B;  3QIN A;  5LMN K;  4DU1 A;  2VCP A;  1YJN N;  4M7Y A;  2WON A;  4IZ9 A;  4BRG A;  4DTU A;  3H46 O;  5AQJ A;  1RCH A;  3RSE A;  3T1A A;  4HVJ A;  4E89 A;  3S3N A;  1K8K A;  2QWO A;  3GE1 A;  3CJA A;  4FZY A;  1KCF A;  2DFF A;  3WUH A;  3QES A;  2I7N A;  2DFH A;  3OYI A;  3CPE A;  3PX0 A;  3VQ6 A;  2EHG A;  4YNQ A;  4N41 A;  1ASV A;  1NK8 A;  1A5V A;  2CGJ A;  3RWU A;  3KK7 A;  2HVH A;  4ISG A;  4CJL A;  1TKD A;  3CQY A;  2EX3 A;  3ZSZ A;  1EWR A;  4F9O A;  3SBG A;  5CE3 A;  3LDP A;  1Y97 A;  3WQT A;  4CFA A;  1KAY A;  1RTJ A;  2E1Z A;  3KLG A;  4CD1 A;  2BH1 A;  4BRA A;  2F96 A;  3QFU A;  4B8A B;  4HWI A;  1LAV A;  3K9J A;  5AQQ A;  4NCA A;  2P5G A;  5TKW A;  1KVC A;  1ZYQ A;  2KW4 A;  1J9A A;  5F2R A;  3LDS A;  3SYZ A;  3AVK A;  1LWC A;  3PLA A;  2UXD K;  4JEP A;  4OLB A;  4JI4 K;  1LWF A;  3T1Y K;  5M1N A;  4A59 A;  4BRD A;  3ZLJ A;  3LP0 A;  3LP1 A;  4DQS A;  1T6C A;  1TKZ A;  3NF8 A;  2XRI A;  3E9P A;  4CEF A;  3RMD A;  1TUU A;  4DKW A;  4DSE A;  4YOW A;  2BGG A;  2P9P B;  4O0J A;  2FBY A;  3VES A; 
#chains in the Genus database with same CATH homology
 4LF9 K;  4OX9 K;  2UUB K;  4KHP K;  2UUC K;  1XNR K;  5AJ3 K;  1XMO K;  4JI8 K;  3J80 O;  4DV5 K;  4B3S K;  4DV3 K;  4JI5 K;  1I94 K;  4LF6 K;  2ZM6 K;  2UU9 K;  2HHH K;  3J7Y P;  1HNZ K;  4X64 K;  1HR0 K;  4YHH K;  2UUA K;  2VQE K;  4DV4 K;  1N36 K;  4B3R K;  5LMN K;  4DUY K;  1XMQ K;  1HNW K;  4JI0 K;  4JYA K;  4DR5 K;  5LL6 Z;  4DV6 K;  4JI6 K;  5BR8 K;  3T1H K;  5A2Q O;  4B3M K;  4JI7 K;  4LFA K;  4DR4 K;  4DR7 K;  4CVN E;  4LF8 K;  2UXB K;  4NXM K;  4DV2 K;  4JI3 K;  4JI2 K;  4B3T K;  4LF7 K;  4GKK K;  4LF4 K;  1IBM K;  2UXC K;  3J7A P;  1XNQ K;  4CW7 B;  2VQF K;  4GKJ K;  2E5L K;  1IBL K;  5LMU K;  4LFC K;  4LFB K;  3JAM O;  4NXN K;  4JI1 K;  1IBK K;  5IT9 O;  4V19 S;  1N34 K;  4DUZ K;  1J5E K;  5IWA K;  4DR2 K;  2F4V K;  1N33 K;  2UXD K;  1HNX K;  4JI4 K;  4JV5 K;  4AQY K;  3T1Y K;  4YY3 K;  4DV7 K;  3OTO K;  1N32 K;  4LF5 K;  4DV0 K;  5FLX O;  4DR6 K;  4X65 K;  1FJG K;  4K0K K;  4X66 K;  3J81 O;  4X62 K;  4DR3 K;  4DV1 K;  4DR1 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...