4WF9L

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with telithromycin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
109
structure length
109
Chain Sequence
ISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
total genus 18
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2014-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wf9L01
3OW2M 5GAHP 1K9MO 1VQ9N 3CPWM 4IOCL 4WFNL 1KQSM 5GAEP 1M1KO 1QVGM 5DM6L 3CMEN 4WF9L 3CCLN 2QEXN 3CCJN 3CXCM 4IOAL 1Q7YO 3I56N 1JJ2M 1KD1O 1KC8O 3CCVN 5JVGL 2OTJN 2ZJPL 4U67L 1S72N 3CCSN 1Q86O 1Q82O 5HL7L 1QVFM 3G6EN 1VQMN 3CF5L 3PIOL 3CCMN 4WFBL 2ZJQL 3CMAN 4WCEL 3CC7N 1VQPN 1N8RO 4IO9L 5H1SQ 3CC4N 1YITN 1VQ5N 5GADP 1K73O 3CCUN 1VQ8N 3G71N 1VQ7N 1ILYA 3CCQN 3CCRN 1VQKN 1YJ9N 3G4SN 3CD6N 1VQLN 4WFAL 1YI2N 1OVYA 1K8AO 5DM7L 2ZJRL 1YHQN 1YIJN 1W2BM 4UY8O 3I55N 1YJWN 1VQNN 1Q81O 3PIPL 1VQON 3J7ZO 5JVHL 5GAGP 1M90O 5MLCQ 2QA4N 1VQ6N 1VQ4N 2OTLN 3DLLL 3CCEN 1YJNN 1NJIO 3CC2N
chains in the Genus database with same CATH superfamily
3HO1A 2XRIA 2V7YA 1VQ9N 4WFNL 3H6EA 1EX4A 3P39A 3QFUA 1HKBA 4CHOA 1VSMA 4BG9A 4CFCA 4BWJA 3DJCA 4QAGA 5DM6L 4FWLA 3HOTA 4RW7A 4BROA 2WBNA 3VQAA 3SQ1A 4ZTJA 1TK5A 3CPEA 2Q0RA 4KTQA 2BANA 2PAVA 5BN9A 4LFCK 1NLVA 2UYTA 5SZTA 1QHAA 3KTQA 3JXUA 1WBDA 1JLGA 4JKGB 1HKCA 3SLCA 4BRQA 4M3YA 2YHYA 1BO5O 3D45A 3AVJA 4KTZA 1KC8O 1XC3A 3GG4A 4BC5A 1IBKK 3DMJA 1Z26A 5EU7A 3O80A 2P9IA 4CEEA 3KLEA 1XC9A 4YHHK 1GLEG 1S6PA 4WQ4A 3RTVA 2E20A 5DMRA 1K8KB 1BA0A 3DLKA 3QEIA 5AQGA 4KHUA 4BC2A 3ENHA 1B9DA 1IBLK 1NWKA 1J5EK 1CZAN 5AR0A 1N36K 1KLNA 5FROA 3W0LA 4E1JA 3DXKB 4JD2B 3CM6A 4WYBA 1R59O 4IKFA 1TAQA 2F8SA 1YJ9N 5KGWA 4B8AB 3NVMA 4M3UA 1GOCA 3QLHA 4IG3A 1VSJA 4CZGA 3E9LA 4BGAA 3S3MA 2ZJRL 5M1KA 1UWBA 3MEEA 4M42A 1BQNA 1LOTB 1MDUB 4JI8K 1OH7A 2HNZA 2NRXA 3PIPL 3L3UA 3RMCA 3HM8A 2P9LB 3DLEA 3SZ2A 2XY8A 3GBTA 1G99A 4B1WB 4BE0A 3CC2N 4V19S 3VETA 3CPWM 4CF1A 3M8SA 4CF2A 4OPJA 4DTNA 5HROA 3ZSVA 4DLGA 4DSIA 1RNHA 5FPMA 3MEGA 2G8HA 4M45A 3G10A 4Z4EA 3P1GA 2YHWA 2IVPA 4NB4A 4IOAL 4JKAA 3OYLA 3F5TA 4JN4A 4KH4A 1JJ2M 1D9DA 3A5OC 3ZSWA 3CCVN 4C8KA 4PUOA 5J2PA 1DTTA 4FOIA 4X66K 1R0AA 4CJSA 1TKDA 2KKZA 2P9KA 1EWQA 3CCSN 2EWSA 1HRHA 1JCEA 4JI1K 3FLCO 4JI7K 1KLMA 1NGBA 3CCMN 1WSJA 5AQRA 2ITGA 1C0FA 3CC7N 4JI0K 5FDLA 2RE2A 3DYAA 3D0PA 3TAEA 4JS5A 2YNGA 4DSLA 3JAMO 3LDSA 4CCHA 2XHBA 4H0TB 1VSFA 1S1UA 1JKHA 4DR1K 1RDCA 1ITGA 5EX5A 4HWIA 3UIQA 5B8HA 4BY9C 3O8MA 3VGLA 4BG8A 1WBBA 1RT6A 4CJKA 1C6VA 2E2OA 2GEMA 2P9SA 3F73A 2E2NA 4CHQA 3SV3A 5JS2A 1U04A 3BGRA 2F8TA 2Q36A 3OYHA 1JLBA 3THYB 4LF7K 1CZBA 5AZIA 4CGGA 1NKEA 4G9ZA 3ZCMA 1U2VB 3O9TA 1X3NA 2KFZA 3RR8A 2P9UB 4KH6A 1I3AA 5JVHL 1JLAA 2GX9A 1SL2A 3NDKA 4YDUC 4JS4A 3AVNA 4I2PA 3RRHA 5C25A 4H4MA 5FPNA 2G8WA 4MO5A 3H1VX 4M41A 3FR0A 3H1QA 4K25A 4BRFA 4FWQA 3K0SA 1YVNA 1YVUA 1ZBFA 4DCHA 3V9XA 4F2RA 3K5OA 1GLJO 1S6QA 2CGLA 3ZETA 4WQ4C 4DTUA 4BE1A 3CXCM 3J7YP 5HRSA 4O5BA 3ENOA 2ASOA 3NBPA 1JLFA 1F21A 1MWKA 1Y97A 3ZX0A 3R1XA 4EAHD 4CERA 2IS3A 4IFVA 3KWGA 3VEVA 3OYFA 4B8CA 3T19A 2IGIA 3J7AP 4CHNA 4FJNA 4OGEA 4DSEA 2ZJQL 3M5RA 3CMAN 2P9NB 2D0BA 3CIPA 2DFFA 3I8BA 3EE8A 3JYTA 3ZX2A 4KHYA 3M8QA 2YNFA 3HSCA 2A1RA 1JL1A 3OVNA 1YT3A 5KTQA 4YY3K 3I33A 2D5RA 4FJ7A 1LW0A 2BE2A 3K9JA 1OH8A 4LF6K 3EL2A 3D2EA 4PA1A 2NLXA 2NRVA 5FPDA 4Z4GA 1TL1A 1WSGA 1SS6A 4F2SA 4E19A 2OPQA 3RWUA 4W5RA 2X6SA 5DM7L 1P90A 4BRCA 1HQEA 2OZMA 1RT3A 4A2BA 4BRDA 4K8ZA 3V6DA 4BC4A 2O8CB 3I55N 1RTJA 3AV9A 1NGFA 3KKSA 5ELZA 2E4LA 3A0IX 1NGDA 1OVQA 4EZ6A 2P9PA 4PL7A 5E84A 1LAWA 4DR6K 4B9VA 4XH5A 4FPAA 3K5LA 4CJTA 4CFAA 3LZJA 1IKWA 1NJIO 3SBTA 1HR0K 3ZSOA 4CZHA 3IRXA 5J2QA 3S41A 4C8OA 4AHSA 1NGGA 5EY4A 4BR2A 4DB3A 2UUAK 3VEWA 4H0XB 4FJIA 5JLFA 1M1KO 4J2EA 2HHVA 4PHTX 5F0XA 1QVGM 1KSPA 2LSNA 3MDQA 5BRFA 1QQOA 3TAFA 1WOQA 4KHPK 2UXDK 1RBVA 1EP4A 1QZ6A 3C7NB 3O9SA 1RGIA 2F96A 3E9OA 4HHTA 4I6MA 3V1QA 3ZEUA 2W40A 1X9JA 3CQ8A 4H5TA 4E7IA 3AO1A 5HRRA 1FK9A 5CR4A 1NK0A 1J6ZA 3HBTA 1FXXA 4A5AA 1IJJA 1SQKA 1Q86O 3VQ6A 3SQ2A 1KVBA 2NRRA 4DV3K 1QVFM 2GUIA 1VQMN 4FYDA 2P51A 1N6QA 1G15A 4FWSA 4CZLA 4N56A 3KK3A 1XHXA 3VQQA 1NJXA 2Q2RA 4F3OA 1NGEA 1VHXA 1XQSC 3NVKA 4NLCA 4A61A 2QWMA 3VQ9A 2E2QA 2GWKA 4CECA 5AJ3K 4I7FA 3SAHA 3V9SA 1X9WA 4CJLA 3RSEB 2KLAA 4AM7A 1D4XA 1BCOA 2X6NA 3TAMA 3SV4A 3THWB 1RDBA 4LF4K 1KVCA 2WOMA 4B1VA 4B9LA 3QEPA 1YAGA 3IDHA 2ZD1A 5HRNA 4DTSA 3EO3A 4JK9A 1H1VA 3QEVA 3O1WA 1NJZA 3OS1A 2RF2A 4BRIA 4KHSA 3D7EO 3ITHA 4JV5K 3NF6A 1BI4A 2OTLN 3RR7A 1YJNN 1TVRA 3CJ9A 4CZMA 5C15A 4GMJB 5BR8K 1ZXOA 4F3TA 3DRSA 4OKJA 3QEWA 3UKUA 4DQ8A 2QWNA 4B9UA 1HYVA 1Z6RA 3MAQA 4B1XB 2HW3A 3PX6A 5HRPA 1A5XA 3TABA 3DWLA 5C12A 1VRUA 1HYSA 4IZ9A 4CJQA 4YFUA 2IOCA 5EOYA 4FWPA 1TYQA 1IBMK 3I8DA 3LPUA 4JI4K 3WXIA 4FJXA 2QWPA 2HHXA 1T7PA 1RCHA 2HF4A 3BZKA 4B9TA 2IC3A 2QWRA 3THXB 2P1JA 4AH9A 4CJUA 2A5XA 3CERA 1TAUA 3U4LA 3MXIA 1XUPO 2OTJN 1TKZA 3MN5A 3SPZA 3G6EN 1SKSA 5AQLA 4AHVA 3PIOL 3AAQA 1XMQK 1KAYA 3P38A 3SQ4A 1VQPN 1XHZA 2KZMA 3QMLA 4I9LA 1IKYA 4ICLA 5KRSA 3NH2A 2YI1A 1RTHA 3MN9A 4ISEA 5I9EB 3C65A 3T1YK 1WNSA 1V4TA 3IMXA 4KHNA 1NK4A 4DR3K 3GE1A 3UKRA 3W3DA 4CF9A 3NFAA 2D0OA 3SUNA 3AVKA 5C2DA 3NCIA 4CEDA 2AA4A 4CK2A 1CZ9A 4M7XA 4F9OA 4CF0A 4CFDA 3ALYA 2FBVA 3IG1A 4U7BA 1NOZA 3VQCA 1ZBUA 4OGCA 1L3UA 4EP5A 1DEJA 2KQ2A 4B9SA 2FF3B 4O5FA 4BC3A 5MLCQ 3KK2A 4NYFA 4E7JA 1EQYA 4BDZA 4ILGB 1DLOA 4CJVA 4EIAA 3T69A 2XY7A 2V52B 4JLHA 3EYZA 3ISNC 2A3ZA 1RBSA 3O9UA 1WAJA 4H5NA 3U3YA 3FE1A 4DV0K 3DAWA 4WQ5C 3G25A 4PKHA 1GLCG 4FLZA 3NGYA 4OLAA 4WF9L 1DGKN 2G8UA 1T3VA 3ZSQA 4FLXA 2E6LA 3EN9A 3LM9A 4C1NK 3CFRA 3WXKA 3MEDA 2YKNA 1ASWA 2CGJA 1KD1O 3VEXA 2VGMA 3CI5A 4JKBA 1EXQA 4Z94A 4LFAK 4GV6A 3VQDA 2YNIA 4FVMA 3O6WA 2YNHA 3E66A 3MK6A 4JKFA 4GKJK 3VQ7A 3L2UA 5C0YA 1RBRA 4IXCA 2BH1A 1HQUA 4LC9B 3K5MA 1ATRA 1TUUA 5AQJA 3ZT3A 1HPMA 2HSTA 1GLAG 2OZSA 1B9FA 1ASUA 2B5JA 4K42A 4X65K 4CBXA 3VA0A 1Q9YA 1L5UA 3L4QA 2P9IB 3E1YA 3V9UA 4LF5K 1IG9A 3KWIA 4JKEA 2HBKA 3CJBA 4ZTFA 4CGJA 4FOEA 4MDBA 4I2QA 5AQZA 4JKGA 2NRHA 1QQCA 5SWMA 3DXMA 3PX4A 3VQPA 3ULDA 4BRMA 2D1KA 4DQPA 4DR2K 4H4OA 4JKDA 4F8RA 5AQYA 2Z1GA 3WXJA 4R79A 3EKUA 3J7ZO 3A2FA 3FFIA 5EXWA 5GAGP 1RT1A 3TARA 4DUYK 3OYKA 3UE5A 1IKVA 1RTIA 4AF1A 3K2PA 4KO0A 3VPZA 5GIOA 2FF6A 4CEBA 2X74A 3ZT4A 4IOXA 1BCMA 1KRPA 1SL0A 4IJAA 2XY6A 4FCYA 3QBXA 1LW2A 4O55A 3HK2A 3IS9A 1U47A 4KI6A 1NMDA 3OYMA 4GVMA 4CZFA 2O8DA 5AFUH 1HLUA 1NOYA 3CCLN 1NK6A 3ZSRA 2KZZA 4O0JA 4CZIA 1U6ZA 3HI0A 2W6KA 2E5LK 2ITMA 3AVAA 2UU9K 2WFBA 2X78A 4N47A 3O9RA 5BPMA 3F9KA 4KV8A 3NGZA 4BACA 3EY1A 4H5RA 4DG1A 3AA4A 4CJFA 3SPYA 1NKCA 1C1CA 1S9GA 4F4KA 4PKGA 3IUCA 1WAFA 3M3ZA 1W0HA 3ZSYA 4K8XA 4C1NI 4M3TA 4J2DA 4E7KA 4QS7A 2KHOA 3VERA 4RCHA 1NGHA 4OJRA 4CE9A 3WEEA 5GADP 3TAQA 2HHSA 5E26A 4DTRA 1ZYQA 2E8AA 3MN7A 4DU1A 1ILYA 2P9KB 3WNGA 2QKKA 4JHDA 4FJHA 3KLIA 4PKIA 3ZT1A 1J54A 1GLLO 1K8AO 2D4WA 3C94A 3KZBA 3OYGA 3U6FA 3RMDA 1Z05A 4BR0A 1KAZA 1LWEA 4BR5A 3MMVA 1YIJN 2H3GX 1RDWX 1S1VA 4KRFA 4IO8A 1RT5A 1SUQA 2ZM6K 2Q1NA 1BU6O 3HJFA 2JWKA 4CK1A 3EE9A 1NJWA 1GOAA 3WQTA 2DY4A 2OCEA 2QA4N 1QTMA 4CFBA 4KTWA 2FC0A 2P9SB 3LDNA 5J2NA 3ATUA 3GOIA 2OPPA 1RBUA 3LDLA 1K9MO 4H0VB 3CHWA 4BREA 5LMUK 3H45C 4FL9A 1N34K 4Z0UA 1BGXT 1BG3A 4CJPA 3AO3A 3QNOA 3IAYA 2UXCK 3ZT0A 1RDUA 2AP1A 2VQEK 2HBLA 4DSFA 1UA0A 3EZWA 1U4BA 3SUPA 3PO4A 3HYFA 2EX3A 3C0BA 4DQRA 4DFPA 1X9MA 4BRKA 1C1BA 2QXFA 4KHQA 4KBOA 2ZWHA 4X64K 4GV3A 4YOYA 3VF6A 3PX0A 4WE1A 2RHKA 1QHTA 2O4IA 4DSKA 3CFOA 2QWLA 5HL7L 1WSFA 4M7YA 1KFDA 3PSFA 4CEAA 3DLGA 1TL3A 5KQDA 2G8VA 4IDHA 3O08A 2ASMA 5J1EA 3AO4A 3ZETB 3TR8A 1TK8A 2F4VK 5AQPA 3FZMA 1KXPA 2DFEA 4RW8A 3EZ5A 4DS5A 2Z1HA 4CZEA 4CJ4A 2VWBA 3VA3A 1VQKN 4K0KK 3MXMA 4M3XA 5LJVA 4CW7B 5BPLA 3ULEA 2QWQA 4FJ9A 4A59A 1T44A 1ZBIA 4DHYA 1N32K 1EKEA 1S5JA 3HZ6A 3BUZB 3ZX3A 3JS6A 4NCAA 1NU0A 5T7BA 3O9QA 3LDQA 1EWRA 4E89A 2KW4A 4L8RB 1OH5A 2HMIA 1HNIA 5TKYA 5E41A 3D2EB 4QS8A 3DRPA 4H0PA 4BRPA 4Q0BA 1RT4A 2P5OA 1BL3A 4BDPA 4FWNA 5AQSA 1ZC6A 5I3UA 4ISFA 4QS9A 5GAHP 3OW2M 3VTHA 3TSUA 4B1YB 2ETJA 2QXLA 3L2QA 3P83D 1RTDA 4DFMA 5GIPA 3NGIA 3T3FA 1VSKA 4BQZA 5BN8A 4NXNK 3LAKA 3NF7A 1L3TA 3OYEA 2P9PB 4YNQA 1NNEA 1UOCA 2ATQA 2E1YA 3N4QA 2HMPA 1Q7YO 1T05A 4OPHA 4OLBA 4HTUA 1SV5A 2QWOA 1A5WA 1REVA 5AZJA 2W6LA 4CEZA 4CJ3A 4DTOA 3KJVA 1HYZA 2HB5A 4DTPA 4LSNA 1Q82O 2A42A 2YJFA 3SQ0A 3BF1A 3VQBA 3OS2A 4DV6K 4LH4A 4Z4IA 1LV5A 4AHCA 2O8FA 4OPKA 4IO9L 4I6MB 2NUBA 2BUPA 3MN6A 3ZEUB 4Z4HA 4IG0A 1NGJA 4A62A 4YOVA 5FRNA 1JCFA 3CM5A 3QEXA 1HNVA 2Y1JA 1VQ8N 2Q97A 1LWCA 1Q18A 3BF3A 3CD6N 2RKIA 3OTOK 4MFBA 4UQGA 3O5BA 1NK7A 4L3QA 3C6TA 2KFNA 1OVYA 3VGKA 2HHHK 5F2RA 3HM9A 3FZKA 3MCAB 4AILC 3SUOA 4N41A 1MA9B 3F9MA 3LP3A 2BGGA 3D2FA 3DOKA 3DRRA 1N33K 1TK0A 4ID5A 2YX6A 3WXMB 3OYNA 3OJUA 3WXLA 2Y1IA 4KFBA 1Q81O 3PV8A 1VQON 1TGOA 4JK7A 1SZ2A 1W7AA 2UUBK 4FJKA 1VQ4N 4DFJA 1JLCA 1J9AA 5KPTA 1XNRK 4JRPA 2VG6A 2ZF5O 3VF2A 3VQEA 4H0YB 1CXQA 3PY8A 1NBWA 4KB1A 2DTUA 4AM6A 3HT3A 2VCPA 2A40A 2CGKA 5AFUA 1NGCA 5BRHA 2V7ZA 4KREA 3NE6A 4AHRA 1RBTA 2GWJA 3BZCA 5F1XA 1BI4B 2Q3SA 3QB0A 4O4GA 5AQMA 5BR9A 3HP6A 3L4IA 4W5OA 3SI6A 1BISA 4B9QA 5FPEA 4BRHA 5JVGL 4BVOA 2XO7A 3UKUB 4FLVA 4DV5K 1QQMA 2ZGYA 3AA5X 5LMNK 1L3SA 2P5GA 5AQOA 4DQQA 2IDOA 2O8BA 4JK8A 3NAEA 4AHTA 3NMUA 4CD1A 1TYQB 3C6UA 4IEIA 1U45A 4CEOA 1VSLA 3O4NA 3WNHA 3CC4N 1IKXA 3CCUN 2OPRA 3CJAA 1BIZA 4Z4CA 1X9SA 3CCRN 4N5SA 2A6AA 1BUPA 4W5NA 2YHXA 1HPZA 1YI2N 4BVPA 3CJ7A 1IO2A 3AVFA 3ASMA 3SBGA 3TTDA 4CIEA 3WNEA 3HPHA 3B6PA 4CGHA 5HP1A 3HXMA 3MECA 4RWTA 3PLAA 2D0CA 4YOUA 3AO2A 4DTXA 3SAFA 1YJWN 2O8EA 2BDPA 5TKWA 5JLHA 4NYNA 4DV1K 3ATVA 1HX1A 3SYZA 3KD1E 4CEFA 3DI6A 4FWKA 4JNEA 3OYAA 3UKRB 2HHTA 1ATSA 4E3SA 3O4WA 4DR5K 3ZSXA 2OA8A 1K6YA 4JEPA 4B3MK 3C95A 1SL1A 2E1ZA 3QIOA 3RRGA 3KLHA 4HUGA 1ASVA 5GAEP 3V1OA 4CGFA 4BR7A 5KGXA 1HNZK 1VSDA 3KK1A 1UA1A 3QIPA 1QSSA 3GDQA 2F9WA 4QCLA 1Z25A 1Q9XA 2UXBK 1JCGA 3AVLA 4EHTA 4J2AA 4DF8A 2Q0UA 3I56N 4PQUA 4B1ZA 3VQ5A 4FW1A 4E7LA 3TSPA 4CD3A 3KK7A 3O1BA 5AQFA 1S72N 4Y1CA 4LFBK 5M1PA 3R8EA 1OH6A 4WFBL 1QS4A 2FBYA 4I9QA 4FK4A 3BDPA 3CFPA 3SJJA 4EZ9A 3SJHA 3DLBA 4DWIA 4TSXA 3WUHA 5KRTA 1FKOA 3K59A 4YOTA 2GBZA 3EKSA 3OA9A 3AVBA 3HTVA 2HHQA 1IV0A 3K5NA 3CCQN 3KD5E 3GL1A 4W5TA 3NF9A 3G4SN 2HNYA 4DF4A 2OPSA 4WFAL 3N4PA 4GNIA 3RVCA 3HP9A 4JI6K 3HVTA 4RW4A 1Q8IA 3CYMA 4OX9K 1HNXK 5DK5A 2WTUA 3A5NC 1IG8A 3U3GA 1S1TA 2NZTA 4K41A 1BWFO 3C6AA 3AGRA 4B08A 3DOLA 1C0GA 1LAVA 1VK0A 3IFRA 4DV7K 2B4JA 1DKGD 1D9FA 2NRZA 4GV9A 2FXUA 2FBXA 4FO0A 1CLQA 4CEQA 3O3HA 3H3NO 4Y1DA 4YORA 4CF8A 4YDUA 4FXDA 3OYBA 3QICA 3ZT2A 4AHUA 3CCEN 4IFEA 3OJSA 1S1XA 4IBNA 1S3XA 1N5YA 3THVA 3RMBA 1BA1A 3S3OA 3SK3A 1IH7A 3DXMB 3L2RA 3OBYA 1TUYA 3SAGA 1O1WA 2B6AA 5LL6Z 1K8KA 5CZ1A 1YF5L 5M1FA 2YCHA 2PYLA 1QZ5A 3QESA 3U9DA 4C8MA 5J2MA 5AQNA 2VWJA 1QE1A 3UB5A 2IVOA 1J5OA 3AA2A 3DXKA 1SKWA 4JD2A 2HNDA 4A5BA 3VESA 3LP2A 1MWMA 1HKGA 4DU4A 1X3MA 3IKMA 4HVJA 4DFKA 1WUAA 1C0MA 1SAZA 3HPGA 2O8DB 4A57A 4BQLA 3VEZA 1CXUA 4ELTA 2PZSA 4HCBA 2QM1A 4LSLA 4DLEA 1EETA 4EHUA 3L2VA 2VYPA 3CJ1A 1E4FT 4GW6A 3MWPA 1D5AA 2R7YA 1SKRA 1HNWK 1K73O 3PO5A 3VEOA 2G8FA 4DUZK 4KHWA 5M1OA 4CK3A 1QSYA 2F7TA 2P9LA 2VG5A 4RW9A 4JI2K 4BRAA 5C10A 3V4IA 1JL2A 4FJJA 2ZE2A 2F9TA 4DSJA 1VSHA 2IAJA 3L8BA 1LCUA 2FSKA 3I0SA 4M63C 3K9KA 2KTQA 5FLXO 5A2QO 3TSQA 2YHAA 4BR9A 1W2BM 4UY8O 4FLYA 4YOXA 3WEEB 4CZKA 3KIOA 1OKJA 3TU5A 1DT9A 3OY9A 5LJWA 2JLEA 4DR4K 3EEQA 4DTJA 3ENBA 1HJRA 2FLOA 4JHDB 3LPTA 4E0DA 1VQ6N 5AQWA 3VEYA 3CG7A 3AVMA 4NXMK 3LWMA 2HHWA 3ZLJA 5M1QA 3HSTB 4NCBA 3LDOA 3QFPA 3TTFA 3VENA 4IWVA 1GLBG 3VTIA 1T6CA 3I0RA 2PY5A 1XMOK 4CIFA 2JWLA 4MDAA 2AJQA 5ADXH 4JI3K 4MLHA 3T1AA 1TKTA 5C2FA 1VAZA 3S3NA 1BIUA 4GKKK 2PFUA 2WC9A 3AY9A 2HVHA 1J53A 4DS4A 5JMVA 1KVAA 3AVHA 3BEXA 3NF8A 4QOZB 4CJ5A 5CZ2A 3FFKB 4JI5K 4FVUA 5AZIB 3H08A 4MO4A 1MU2A 4B9MA 3S9HA 3KKRA 1GOBA 1B92A 3NH0A 4DMNA 3Q7CA 2OYQA 1EO1A 2Q31A 1WB9A 3AAPA 1N8RO 2I5JA 3NH1A 5H1SQ 4PY5A 3THYA 1ZBSA 4OVLA 4LF8K 1YITN 1VQ5N 3SNNA 2FBTA 1U2VA 4FLWA 5HBMA 4H0OA 1YTUA 2PYJA 4RW6A 2P9UA 3QBWA 4CI6A 2YV0X 4W5QA 2NNWA 1BDGA 3LWLA 4DTMA 3AARA 2DPNA 3KLGA 2I7NA 1S9EA 3KVGA 5AQTA 3WQUA 3WT0A 3CQYA 3P31A 4CGIA 4H5VA 1QQNA 3F2KA 1VRTA 4FW2A 2VQFK 3AVGA 3LALA 3R6MA 3MX5A 5IWAK 4Q5VA 4O8UA 4CJWA 5CHIA 3OYDA 3VMFB 4C23A 5KI6A 4BDYA 2QKBA 1RT2A 4CJ7A 4B3RK 4DV4K 4PL8A 4JAXA 2YJEA 5AQVA 4JYAK 3ULEB 3BP8A 3VF4A 3H3OB 5HOOA 5JS1A 2BTFA 4ZHRA 3DLLL 4BR4A 3JSMA 5BPNA 4DR7K 4CZJA 4DKWA 3T1HK 3CQXA 4ELUA 4N76A 4DQSA 2IIRA 3J80O 1JXBA 4IOCL 3MWTA 5HLFA 1BOTO 3KHYA 1KFSA 4CGDA 4OO1J 2I7PA 4FJLA 4B1UB 4K43A 3CMEN 3TANA 4PWDA 1RT7A 1WLJA 2P9NA 2E2PA 1TKXA 1DTQA 3V1RA 3CCJN 3LP0A 3T7ZA 3VOVA 1U48A 5CYQA 1T03A 2QK9A 4J8FA 5AQIA 5AQUA 1NJYA 5KPRA 3ID8A 1JLEA 5I42A 4E1NA 2HBMA 4YOWA 2J4RA 4XH4A 1P8ZA 3BY5A 3B6OA 2IVNA 1NM1A 4O0IA 2D0AA 5LY3A 3L0QA 1QSLA 3G0ZA 3R3LA 3ZYYX 2O8CA 1RDDA 2RPIA 2OANA 3MXJA 4G1QA 3VQ8A 1XNQK 5AZJB 3HVRA 4FWRA 2FSJA 4C8NA 1NGAA 4KAZA 1ESVA 1VQLN 4FM0A 3P5JA 4EFHA 4NLBA 4AQYK 2GELA 2HF3A 1WSIA 3AA3A 3AVIA 3HL8A 3U9ZA 5AQXA 2D0PA 2HOEA 2O8FB 3ID6A 1YHQN 4FM1A 4CBWA 2HBJA 3KLFA 4E7HA 2RN2A 4XEIA 5CY4A 1JLQA 1ZBLA 4CBUA 4NO7A 1VQNN 2E88A 4O8KA 3VQ4A 4LF9K 3SMPA 1A5VA 1WSEA 3HPOA 3AO5A 3C7NA 1HUXA 5K14A 3L3VA 3LDPA 1NMNA 4B9NA 1Y64A 4R5PA 4FM2A 3WNFA 5M1NA 3LAMA 4KH5A 3VN5A 3M8RA 2VGNA 4CVNE 1GLDG 1L3VA 3D2FB 3PUFA 4WQ5A 2QI2A 1KQSM 5EVZA 3B8AX 1HJOA 2YKMA 3TPQA 2G8IA 3QERA 3TWHA 4Z4FA 1JXEA 1GLFO 4IDKA 4Y0WA 4M3ZA 3TI0A 2WONA 3QNNA 1NG9A 2QEXN 2PBDA 1FKPA 3E01A 5KPZA 4OPAA 5C24A 3E9PA 3MX2A 2NRTA 4BRGA 3QINA 4CJEA 2Z1JA 2CH6A 3V81A 1D8YA 3TAPA 2Z1IA 4FWOA 4U67L 5AQKA 3L2WA 4RTFD 3RSEA 1C1AA 1RFQA 3CF5L 4KPYA 3THWA 3ZSZA 1TV6A 4HCCA 3PSIA 1WN7A 3U8XA 2ZQBA 4WCEL 1YXQA 3LL3A 1YUWA 4BGBA 3M8PA 4J2BA 4GVEA 4FK0A 3TTCA 3O3FA 3K57A 3SUQA 4IJNA 4ELVA 4FJMA 1VSEA 4LD0A 3FZHA 3G71N 3RMAA 1W97L 1ZBHA 3J8AA 4EP4A 4FZYA 4KKOA 1O13A 4ISGA 3V9WA 5CYMA 2O8BB 2GTDA 1BHLA 2O4GA 4B3OA 4H5WA 4DV2K 3OBWA 4BWMA 3O4QA 5BRDA 4BRNA 3SCXA 5CE3A 3A5LC 3FGUA 1RILA 1U49A 1E4GT 2A41A 3LANA 4DU3A 4MQ3A 2ASPA 3TAGA 1NGIA 3A8YA 2HHUA 3NHGA 4JRQA 4C8LA 1M90O 4LH5A 4JKCA 3VGMA 1C0TA 5JICA 3H46O 3LZIA 3THXA 5FRMA 4B3TK 3DLHA 3HOSA 4H8KA 3AVCA 4X62K 2YHBA 3P4IA 4FJ8A 1ATNA 1FJGK 1XI1A 3OS0A 3DLRA 2CH5A 2NRWA 4CESA 2O8EB 3MCPA 4IFYA 3DM2A 3AGKA 5ADXA 1WSHA 3OHRA 1KTQA 2GUPA 4FZZA 1S1WA 3LP1A 1C0UA 2GV9A 2V51B 3SMSA 4IEEA 3K58A 4ILJA 3M6GA 4ILHA 2QW9A 3Q7BA 4FWMA 2VWKA 4NCGA 1I94K 4FZXC 5IT9O 3CJCA 1BQMA 4KB0A 1FW6A 4FLTA 4FPBA 2EHGA 2ZJPL 1V4SA 4HUFA 1XWLA 5KQ8A 3V9ZA 3M1FA 3R9PA 3A5MC 3CETA 4BE2A 3LM2A 1W9HA 4HUEA 3FZFA 3L6QA 4A2AA 2FSNA 4CIGA 5C42A 5AQQA 4XIUA 3OYJA 1KCFA 4HTLA 1NK9A 5BREA 4FJ5A 1NK8A 4O44A 1RDAA 4CJRA 2XY5A 4CHZA 2A1SA 2W42A 1LWFA 1VQ7N 4M3RA 1UAXA 3C6HA 4FK2A 3J81O 4FLUA 2DFHA 4RG8A 4XH1A 4KI4A 4FSVA 3HRGA 1NKBA 2E6MA 3FZLA 1VSIA 2ZGZA 4BRLA 3QETA 4FJGA 1E3MA 1X1PA 4OKKA 1I39A 1S22A 3QDKA 1NK5A 4CHPA 4GY2B 4JKHA 4DQIA 4B3SK 3O3GA 2W41A 4E1MA 2G8KA 3OYCA 1KAXA 2QTDA 3OYIA 1T6DA 5GINA 4CHYA 5D3GA 2VG7A 1HMVA 2UUCK 2WUSA 3QO9A 1YTAA 5AQHA 2JGUA 4MLEA 4H03B 4ID1A 4LY7A 2HVIA 4M3WA 4OKEA 1T8EA 3D6RA
chains in the Genus database with same CATH topology
5M1QA 4ISFA 4QS9A 5GAHP 3OW2M 2V7YA 3VTHA 3TSUA 1VQ9N 1ZXOA 4B1YB 2QXLA 3UKUA 3LDOA 4DQ8A 4WFNL 3H6EA 2QWNA 3QFPA 3P39A 3TTFA 3QFUA 1Z6RA 3VENA 4B1XB 1HKBA 4IWVA 1GLBG 3VTIA 5GIPA 4BG9A 1T6CA 3DJCA 3DWLA 5C12A 5DM6L 4FWLA 3HOTA 4BQZA 5BN8A 4IZ9A 2JWLA 4MDAA 4BROA 5ADXH 2WBNA 2P9PB 5EOYA 4MLHA 4FWPA 1TYQA 5C2FA 1VAZA 2Q0RA 3CPEA 2E1YA 3N4QA 2PFUA 2HMPA 2PAVA 5BN9A 2WC9A 3WXIA 1Q7YO 1NLVA 2QWPA 2UYTA 3AY9A 4OPHA 1QHAA 2HF4A 2QWOA 3JXUA 5JMVA 4JKGB 1HKCA 3SLCA 4BRQA 5AZJA 2QWRA 1BO5O 2YHYA 1KC8O 1XC3A 2A5XA 3BEXA 3GG4A 4BC5A 3CERA 3FFKB 3U4LA 4FVUA 5AZIB 1XUPO 4MO4A 2OTJN 3O80A 2P9IA 1Q82O 1GLEG 3MN5A 2A42A 3G6EN 3Q7CA 4WQ4A 2YJFA 5AQLA 3PIOL 2E20A 1K8KB 1BA0A 1EO1A 5AQGA 2Q31A 3AAQA 3BF1A 4BC2A 1KAYA 3AAPA 3P38A 1VQPN 1N8RO 3ENHA 4IO9L 1NWKA 5H1SQ 4I6MB 1CZAN 1ZBSA 2BUPA 3MN6A 3QMLA 3ZEUB 1YITN 1VQ5N 1NGJA 5AR0A 4A62A 4YOVA 1JCFA 1U2VA 2YI1A 3MN9A 4H0OA 4ISEA 3W0LA 3C65A 5I9EB 4E1JA 3DXKB 2Q97A 1VQ8N 4JD2B 2P9UA 1V4TA 3IMXA 1R59O 4WYBA 1Q18A 3BF3A 1YJ9N 3CD6N 3QBWA 3NVMA 4CI6A 2NNWA 1BDGA 3GE1A 3UKRA 3W3DA 3O5BA 2D0OA 4CZGA 5C2DA 3AARA 4L3QA 1OVYA 3E9LA 3VGKA 4BGAA 5F2RA 2AA4A 2DPNA 3FZKA 3MCAB 4M7XA 2I7NA 4F9OA 1MA9B 3F9MA 3KVGA 5AQTA 2ZJRL 3WQUA 3WT0A 3CQYA 4U7BA 3D2FA 5M1KA 3P31A 4H5VA 1QQNA 3F2KA 2YX6A 3WXMB 3R6MA 1MDUB 1LOTB 3MX5A 4O8UA 2NRXA 3WXLA 5CHIA 1Q81O 3VMFB 4C23A 1DEJA 4CJ7A 3PIPL 1VQON 4JK7A 1SZ2A 4PL8A 3HM8A 2FF3B 4O5FA 2P9LB 2YJEA 4JAXA 5AQVA 4BC3A 3ULEB 5MLCQ 3BP8A 3VF4A 3H3OB 5HOOA 1EQYA 2BTFA 1VQ4N 4ILGB 3DLLL 3GBTA 4BR4A 4EIAA 1G99A 4B1WB 3T69A 5KPTA 2V52B 5BPNA 4CZJA 3CC2N 4DKWA 3CQXA 3VETA 3CPWM 2ZF5O 2A3ZA 2IIRA 3VF2A 4IOCL 3MWTA 4H0YB 3O9UA 1BOTO 3KHYA 4H5NA 5FPMA 1NBWA 4OO1J 3FE1A 2I7PA 3DAWA 4WQ5C 4AM6A 4B1UB 2VCPA 2A40A 3G25A 2CGKA 4PKHA 1GLCG 1NGCA 4K43A 5AFUA 2V7ZA 5BRHA 3CMEN 4WF9L 1DGKN 1T3VA 2P9NA 2E2PA 2GWJA 3EN9A 2YHWA 3CCJN 2IVPA 3LM9A 4NB4A 5F1XA 4IOAL 3T7ZA 3VOVA 4C1NK 3QB0A 4JKAA 3WXKA 3F5TA 4JN4A 5AQMA 5BR9A 4KH4A 1JJ2M 2CGJA 3A5OC 1KD1O 3L4IA 3VEXA 2VGMA 3CI5A 4J8FA 5AQIA 5AQUA 3CCVN 5FPEA 4B9QA 5JVGL 4JKBA 4BRHA 4FOIA 4BVOA 3UKUB 4Z94A 5KPRA 2KKZA 4GV6A 2P9KA 3ID8A 1QQMA 2ZGYA 3CCSN 2EWSA 3O6WA 3E66A 3MK6A 4JKFA 1JCEA 3FLCO 5AQOA 1NGBA 2HBMA 4YOWA 5C0YA 4IXCA 2J4RA 2BH1A 3CCMN 4XH4A 5AQRA 4JK8A 1P8ZA 1C0FA 3NMUA 4CD1A 1TYQB 3CC7N 2IVNA 4IEIA 4LC9B 1ATRA 1TUUA 5AQJA 2RE2A 1NM1A 1HPMA 2HSTA 5LY3A 3L0QA 3CC4N 1GLAG 3R3LA 3ZYYX 4H0TB 2OANA 5AZJB 3CCUN 4FWRA 5EX5A 2FSJA 3CJAA 4HWIA 1NGAA 4K42A 5B8HA 4CBXA 4BY9C 1ESVA 3O8MA 3VGLA 3CCRN 4BG8A 1VQLN 2A6AA 1BUPA 3L4QA 2P9IB 2YHXA 3E1YA 1YI2N 4EFHA 3KWIA 4NLBA 2E2OA 3CJ7A 4JKEA 2GEMA 4BVPA 2HBKA 3SBGA 2GELA 3CJBA 2HF3A 2P9SA 2E2NA 4FOEA 3TTDA 4MDBA 5AQZA 3U9ZA 5AQXA 2D0PA 4JKGA 2HOEA 2NRHA 4RWTA 3ID6A 1YHQN 3DXMA 2Q36A 3PLAA 4BRMA 4CBWA 2HBJA 2D1KA 5AZIA 4G9ZA 4XEIA 4YOUA 3SAFA 1U2VB 1YJWN 4JKDA 3O9TA 1X3NA 4NO7A 5AQYA 5TKWA 4CBUA 1VQNN 5JLHA 2E88A 4O8KA 3WXJA 4R79A 3SMPA 2P9UB 4KH6A 3ATVA 1HX1A 3C7NA 1HUXA 3EKUA 3J7ZO 5EXWA 5GAGP 5JVHL 4FWKA 4JNEA 3UKRB 2GX9A 3LDPA 1ATSA 3UE5A 1Y64A 4AF1A 4YDUC 3O4WA 3VPZA 5GIOA 2FF6A 5FPNA 5M1NA 4JEPA 4KH5A 4IOXA 4MO5A 3H1VX 2E1ZA 2VGNA 1GLDG 3D2FB 4WQ5A 2QI2A 3FR0A 3H1QA 5EVZA 5GAEP 3B8AX 4K25A 1KQSM 4BRFA 4IJAA 1HJOA 4BR7A 4FWQA 3TPQA 3QBXA 3GDQA 1GLFO 1NMDA 1YVNA 2F9WA 4Y0WA 4DCHA 4CZFA 5AFUH 1HLUA 3CCLN 2QEXN 2PBDA 1GLJO 2CGLA 1JCGA 3ZETA 5KPZA 4WQ4C 4OPAA 4EHTA 4CZIA 3CXCM 1U6ZA 3HI0A 3E9PA 2Q0UA 3I56N 3MX2A 2ITMA 4B1ZA 2NRTA 4BRGA 3ENOA 2ASOA 2WFBA 2CH6A 3O9RA 5BPMA 3TSPA 1MWKA 3ZX0A 4H5RA 3R1XA 4EAHD 4FWOA 4CD3A 3KK7A 3O1BA 3KWGA 5AQKA 5AQFA 3VEVA 4U67L 1S72N 4RTFD 5M1PA 3RSEA 3R8EA 4PKGA 3IUCA 1RFQA 3M3ZA 3CF5L 4WFBL 2ZJQL 3M5RA 3CMAN 2P9NB 3U8XA 4C1NI 4WCEL 3CIPA 3I8BA 1YXQA 3EE8A 3LL3A 3ZX2A 1YUWA 4QS7A 4BGBA 2KHOA 3VERA 4RCHA 3SJHA 3HSCA 1NGHA 3WUHA 4YOTA 3EKSA 4GVEA 3WEEA 3TTCA 3OA9A 5GADP 3HTVA 5E26A 3I33A 4IJNA 3G71N 3FZHA 2E8AA 3MN7A 1W97L 1ILYA 3J8AA 3K9JA 3CCQN 3GL1A 3G4SN 3EL2A 3D2EA 2NLXA 2P9KB 4WFAL 2NRVA 5FPDA 3N4PA 4GNIA 4JHDA 3RVCA 1O13A 1SS6A 4ISGA 4PKIA 1GLLO 1K8AO 2D4WA 3KZBA 3A5NC 1IG8A 2GTDA 1Z05A 4BR0A 4H5WA 2NZTA 4K41A 1BWFO 5DM7L 3OBWA 1P90A 4BRCA 1KAZA 3C6AA 5BRDA 3AGRA 4BR5A 1C0GA 4A2BA 4BRDA 3MMVA 3IFRA 1YIJN 2H3GX 1RDWX 4BRNA 4BC4A 1DKGD 3I55N 2NRZA 3A5LC 3FGUA 4IO8A 5CE3A 4GV9A 2FXUA 4FO0A 2Q1NA 1BU6O 1E4GT 2A41A 2JWKA 1NGFA 3H3NO 4YORA 3EE9A 5ELZA 3WQTA 3A0IX 1NGDA 2ASPA 4YDUA 1NGIA 2P9PA 3A8YA 4PL7A 5E84A 1M90O 2QA4N 3QICA 4JKCA 3VGMA 4XH5A 2P9SB 4FPAA 3CCEN 4IFEA 3LDNA 5JICA 1NJIO 3ATUA 3SBTA 3GOIA 3H46O 4CZHA 3LDLA 3S41A 1K9MO 4H0VB 1NGGA 1S3XA 3CHWA 5EY4A 3H45C 4FL9A 4BREA 1BA1A 3VEWA 4BR2A 4DB3A 3SK3A 1BG3A 3DXMB 4H0XB 3HOSA 3P4IA 5JLFA 1ATNA 1M1KO 3OBYA 1TUYA 1RDUA 2AP1A 2CH5A 2HBLA 2NRWA 4PHTX 5F0XA 3MCPA 3MDQA 3SAGA 5BRFA 1QVGM 1QQOA 3EZWA 1WOQA 3AGKA 5ADXA 1K8KA 1YF5L 3OHRA 5M1FA 1QZ6A 2YCHA 3C7NB 2GUPA 3O9SA 1RGIA 3C0BA 1QZ5A 3U9DA 3E9OA 2V51B 3SMSA 5AQNA 4IEEA 4I6MA 4ILJA 3M6GA 4BRKA 3ZEUA 4ILHA 2QW9A 2W40A 3Q7BA 4FWMA 4KBOA 2ZWHA 3UB5A 3CJCA 1X9JA 2IVOA 4GV3A 4H5TA 3DXKA 4YOYA 3VF6A 4JD2A 2RHKA 4A5BA 4FPBA 5CR4A 3VESA 1J6ZA 3HBTA 2ZJPL 4A5AA 1MWMA 1V4SA 1HKGA 1IJJA 1SQKA 1X3MA 1Q86O 3IKMA 2QWLA 5HL7L 5KQ8A 4M7YA 3M1FA 2NRRA 1WUAA 3R9PA 1QVFM 3A5MC 3CETA 1VQMN 3LM2A 1SAZA 4A57A 4BQLA 3VEZA 5KQDA 4FWSA 3O08A 4IDHA 2ASMA 3FZFA 4CZLA 3L6QA 2QM1A 4A2AA 2FSNA 3ZETB 4EHUA 5AQQA 5AQPA 2VYPA 2Q2RA 3FZMA 1KXPA 3CJ1A 1E4FT 4HTLA 5BREA 3MWPA 1NGEA 1XQSC 1K73O 4CZEA 3NVKA 3VEOA 1VQ7N 4NLCA 4A61A 2QWMA 2VWBA 5M1OA 1VQKN 2E2QA 2GWKA 5LJVA 3C6HA 2F7TA 5BPLA 2P9LA 3ULEA 3SAHA 2QWQA 3RSEB 4BRAA 4XH1A 5C10A 2KLAA 4FSVA 1T44A 3HRGA 4A59A 4AM7A 4DHYA 1D4XA 3FZLA 2ZGZA 2F9TA 4BRLA 3HZ6A 3BUZB 3ZX3A 4B1VA 1S22A 1LCUA 2FSKA 3JS6A 3QDKA 3K9KA 4M63C 3TSQA 1YAGA 3IDHA 4BR9A 4GY2B 4JKHA 3O9QA 3EO3A 3LDQA 1W2BM 4UY8O 4YOXA 3WEEB 4CZKA 4JK9A 1H1VA 2W41A 1OKJA 1KAXA 3TU5A 1DT9A 2QTDA 3O1WA 1T6DA 5LJWA 5GINA 5TKYA 4BRIA 3D2EB 3D7EO 4QS8A 3ENBA 2WUSA 2FLOA 4H0PA 4JHDB 5AQHA 4BRPA 1VQ6N 4MLEA 5AQWA 3VEYA 4FWNA 4H03B 2OTLN 1YJNN 3CJ9A 4CZMA 5C15A 3D6RA 5AQSA 1ZC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 M;  5GAH P;  1K9M O;  1VQ9 N;  3CPW M;  4IOC L;  4WFN L;  1KQS M;  5GAE P;  1M1K O;  1QVG M;  5DM6 L;  3CME N;  4WF9 L;  3CCL N;  2QEX N;  3CCJ N;  3CXC M;  4IOA L;  1Q7Y O;  3I56 N;  1JJ2 M;  1KD1 O;  1KC8 O;  3CCV N;  5JVG L;  2OTJ N;  2ZJP L;  4U67 L;  1S72 N;  3CCS N;  1Q86 O;  1Q82 O;  5HL7 L;  1QVF M;  3G6E N;  1VQM N;  3CF5 L;  3PIO L;  3CCM N;  4WFB L;  2ZJQ L;  3CMA N;  4WCE L;  3CC7 N;  1VQP N;  1N8R O;  4IO9 L;  5H1S Q;  3CC4 N;  1YIT N;  1VQ5 N;  5GAD P;  1K73 O;  3CCU N;  1VQ8 N;  3G71 N;  1VQ7 N;  1ILY A;  3CCQ N;  3CCR N;  1VQK N;  1YJ9 N;  3G4S N;  3CD6 N;  1VQL N;  4WFA L;  1YI2 N;  1OVY A;  1K8A O;  5DM7 L;  2ZJR L;  1YHQ N;  1YIJ N;  1W2B M;  4UY8 O;  3I55 N;  1YJW N;  1VQN N;  1Q81 O;  3PIP L;  1VQO N;  3J7Z O;  5JVH L;  5GAG P;  1M90 O;  5MLC Q;  2QA4 N;  1VQ6 N;  1VQ4 N;  2OTL N;  3DLL L;  3CCE N;  1YJN N;  1NJI O;  3CC2 N; 
#chains in the Genus database with same CATH topology
 3HO1 A;  2XRI A;  2V7Y A;  1VQ9 N;  4WFN L;  3H6E A;  1EX4 A;  3P39 A;  3QFU A;  1HKB A;  4CHO A;  1VSM A;  4BG9 A;  4CFC A;  4BWJ A;  3DJC A;  4QAG A;  5DM6 L;  4FWL A;  3HOT A;  4RW7 A;  4BRO A;  2WBN A;  3VQA A;  3SQ1 A;  4ZTJ A;  1TK5 A;  3CPE A;  2Q0R A;  4KTQ A;  2BAN A;  2PAV A;  5BN9 A;  4LFC K;  1NLV A;  2UYT A;  5SZT A;  1QHA A;  3KTQ A;  3JXU A;  1WBD A;  1JLG A;  4JKG B;  1HKC A;  3SLC A;  4BRQ A;  4M3Y A;  2YHY A;  1BO5 O;  3D45 A;  3AVJ A;  4KTZ A;  1KC8 O;  1XC3 A;  3GG4 A;  4BC5 A;  1IBK K;  3DMJ A;  1Z26 A;  5EU7 A;  3O80 A;  2P9I A;  4CEE A;  3KLE A;  1XC9 A;  4YHH K;  1GLE G;  1S6P A;  4WQ4 A;  3RTV A;  2E20 A;  5DMR A;  1K8K B;  1BA0 A;  3DLK A;  3QEI A;  5AQG A;  4KHU A;  4BC2 A;  3ENH A;  1B9D A;  1IBL K;  1NWK A;  1J5E K;  1CZA N;  5AR0 A;  1N36 K;  1KLN A;  5FRO A;  3W0L A;  4E1J A;  3DXK B;  4JD2 B;  3CM6 A;  4WYB A;  1R59 O;  4IKF A;  1TAQ A;  2F8S A;  1YJ9 N;  5KGW A;  4B8A B;  3NVM A;  4M3U A;  1GOC A;  3QLH A;  4IG3 A;  1VSJ A;  4CZG A;  3E9L A;  4BGA A;  3S3M A;  2ZJR L;  5M1K A;  1UWB A;  3MEE A;  4M42 A;  1BQN A;  1LOT B;  1MDU B;  4JI8 K;  1OH7 A;  2HNZ A;  2NRX A;  3PIP L;  3L3U A;  3RMC A;  3HM8 A;  2P9L B;  3DLE A;  3SZ2 A;  2XY8 A;  3GBT A;  1G99 A;  4B1W B;  4BE0 A;  3CC2 N;  4V19 S;  3VET A;  3CPW M;  4CF1 A;  3M8S A;  4CF2 A;  4OPJ A;  4DTN A;  5HRO A;  3ZSV A;  4DLG A;  4DSI A;  1RNH A;  5FPM A;  3MEG A;  2G8H A;  4M45 A;  3G10 A;  4Z4E A;  3P1G A;  2YHW A;  2IVP A;  4NB4 A;  4IOA L;  4JKA A;  3OYL A;  3F5T A;  4JN4 A;  4KH4 A;  1JJ2 M;  1D9D A;  3A5O C;  3ZSW A;  3CCV N;  4C8K A;  4PUO A;  5J2P A;  1DTT A;  4FOI A;  4X66 K;  1R0A A;  4CJS A;  1TKD A;  2KKZ A;  2P9K A;  1EWQ A;  3CCS N;  2EWS A;  1HRH A;  1JCE A;  4JI1 K;  3FLC O;  4JI7 K;  1KLM A;  1NGB A;  3CCM N;  1WSJ A;  5AQR A;  2ITG A;  1C0F A;  3CC7 N;  4JI0 K;  5FDL A;  2RE2 A;  3DYA A;  3D0P A;  3TAE A;  4JS5 A;  2YNG A;  4DSL A;  3JAM O;  3LDS A;  4CCH A;  2XHB A;  4H0T B;  1VSF A;  1S1U A;  1JKH A;  4DR1 K;  1RDC A;  1ITG A;  5EX5 A;  4HWI A;  3UIQ A;  5B8H A;  4BY9 C;  3O8M A;  3VGL A;  4BG8 A;  1WBB A;  1RT6 A;  4CJK A;  1C6V A;  2E2O A;  2GEM A;  2P9S A;  3F73 A;  2E2N A;  4CHQ A;  3SV3 A;  5JS2 A;  1U04 A;  3BGR A;  2F8T A;  2Q36 A;  3OYH A;  1JLB A;  3THY B;  4LF7 K;  1CZB A;  5AZI A;  4CGG A;  1NKE A;  4G9Z A;  3ZCM A;  1U2V B;  3O9T A;  1X3N A;  2KFZ A;  3RR8 A;  2P9U B;  4KH6 A;  1I3A A;  5JVH L;  1JLA A;  2GX9 A;  1SL2 A;  3NDK A;  4YDU C;  4JS4 A;  3AVN A;  4I2P A;  3RRH A;  5C25 A;  4H4M A;  5FPN A;  2G8W A;  4MO5 A;  3H1V X;  4M41 A;  3FR0 A;  3H1Q A;  4K25 A;  4BRF A;  4FWQ A;  3K0S A;  1YVN A;  1YVU A;  1ZBF A;  4DCH A;  3V9X A;  4F2R A;  3K5O A;  1GLJ O;  1S6Q A;  2CGL A;  3ZET A;  4WQ4 C;  4DTU A;  4BE1 A;  3CXC M;  3J7Y P;  5HRS A;  4O5B A;  3ENO A;  2ASO A;  3NBP A;  1JLF A;  1F21 A;  1MWK A;  1Y97 A;  3ZX0 A;  3R1X A;  4EAH D;  4CER A;  2IS3 A;  4IFV A;  3KWG A;  3VEV A;  3OYF A;  4B8C A;  3T19 A;  2IGI A;  3J7A P;  4CHN A;  4FJN A;  4OGE A;  4DSE A;  2ZJQ L;  3M5R A;  3CMA N;  2P9N B;  2D0B A;  3CIP A;  2DFF A;  3I8B A;  3EE8 A;  3JYT A;  3ZX2 A;  4KHY A;  3M8Q A;  2YNF A;  3HSC A;  2A1R A;  1JL1 A;  3OVN A;  1YT3 A;  5KTQ A;  4YY3 K;  3I33 A;  2D5R A;  4FJ7 A;  1LW0 A;  2BE2 A;  3K9J A;  1OH8 A;  4LF6 K;  3EL2 A;  3D2E A;  4PA1 A;  2NLX A;  2NRV A;  5FPD A;  4Z4G A;  1TL1 A;  1WSG A;  1SS6 A;  4F2S A;  4E19 A;  2OPQ A;  3RWU A;  4W5R A;  2X6S A;  5DM7 L;  1P90 A;  4BRC A;  1HQE A;  2OZM A;  1RT3 A;  4A2B A;  4BRD A;  4K8Z A;  3V6D A;  4BC4 A;  2O8C B;  3I55 N;  1RTJ A;  3AV9 A;  1NGF A;  3KKS A;  5ELZ A;  2E4L A;  3A0I X;  1NGD A;  1OVQ A;  4EZ6 A;  2P9P A;  4PL7 A;  5E84 A;  1LAW A;  4DR6 K;  4B9V A;  4XH5 A;  4FPA A;  3K5L A;  4CJT A;  4CFA A;  3LZJ A;  1IKW A;  1NJI O;  3SBT A;  1HR0 K;  3ZSO A;  4CZH A;  3IRX A;  5J2Q A;  3S41 A;  4C8O A;  4AHS A;  1NGG A;  5EY4 A;  4BR2 A;  4DB3 A;  2UUA K;  3VEW A;  4H0X B;  4FJI A;  5JLF A;  1M1K O;  4J2E A;  2HHV A;  4PHT X;  5F0X A;  1QVG M;  1KSP A;  2LSN A;  3MDQ A;  5BRF A;  1QQO A;  3TAF A;  1WOQ A;  4KHP K;  2UXD K;  1RBV A;  1EP4 A;  1QZ6 A;  3C7N B;  3O9S A;  1RGI A;  2F96 A;  3E9O A;  4HHT A;  4I6M A;  3V1Q A;  3ZEU A;  2W40 A;  1X9J A;  3CQ8 A;  4H5T A;  4E7I A;  3AO1 A;  5HRR A;  1FK9 A;  5CR4 A;  1NK0 A;  1J6Z A;  3HBT A;  1FXX A;  4A5A A;  1IJJ A;  1SQK A;  1Q86 O;  3VQ6 A;  3SQ2 A;  1KVB A;  2NRR A;  4DV3 K;  1QVF M;  2GUI A;  1VQM N;  4FYD A;  2P51 A;  1N6Q A;  1G15 A;  4FWS A;  4CZL A;  4N56 A;  3KK3 A;  1XHX A;  3VQQ A;  1NJX A;  2Q2R A;  4F3O A;  1NGE A;  1VHX A;  1XQS C;  3NVK A;  4NLC A;  4A61 A;  2QWM A;  3VQ9 A;  2E2Q A;  2GWK A;  4CEC A;  5AJ3 K;  4I7F A;  3SAH A;  3V9S A;  1X9W A;  4CJL A;  3RSE B;  2KLA A;  4AM7 A;  1D4X A;  1BCO A;  2X6N A;  3TAM A;  3SV4 A;  3THW B;  1RDB A;  4LF4 K;  1KVC A;  2WOM A;  4B1V A;  4B9L A;  3QEP A;  1YAG A;  3IDH A;  2ZD1 A;  5HRN A;  4DTS A;  3EO3 A;  4JK9 A;  1H1V A;  3QEV A;  3O1W A;  1NJZ A;  3OS1 A;  2RF2 A;  4BRI A;  4KHS A;  3D7E O;  3ITH A;  4JV5 K;  3NF6 A;  1BI4 A;  2OTL N;  3RR7 A;  1YJN N;  1TVR A;  3CJ9 A;  4CZM A;  5C15 A;  4GMJ B;  5BR8 K;  1ZXO A;  4F3T A;  3DRS A;  4OKJ A;  3QEW A;  3UKU A;  4DQ8 A;  2QWN A;  4B9U A;  1HYV A;  1Z6R A;  3MAQ A;  4B1X B;  2HW3 A;  3PX6 A;  5HRP A;  1A5X A;  3TAB A;  3DWL A;  5C12 A;  1VRU A;  1HYS A;  4IZ9 A;  4CJQ A;  4YFU A;  2IOC A;  5EOY A;  4FWP A;  1TYQ A;  1IBM K;  3I8D A;  3LPU A;  4JI4 K;  3WXI A;  4FJX A;  2QWP A;  2HHX A;  1T7P A;  1RCH A;  2HF4 A;  3BZK A;  4B9T A;  2IC3 A;  2QWR A;  3THX B;  2P1J A;  4AH9 A;  4CJU A;  2A5X A;  3CER A;  1TAU A;  3U4L A;  3MXI A;  1XUP O;  2OTJ N;  1TKZ A;  3MN5 A;  3SPZ A;  3G6E N;  1SKS A;  5AQL A;  4AHV A;  3PIO L;  3AAQ A;  1XMQ K;  1KAY A;  3P38 A;  3SQ4 A;  1VQP N;  1XHZ A;  2KZM A;  3QML A;  4I9L A;  1IKY A;  4ICL A;  5KRS A;  3NH2 A;  2YI1 A;  1RTH A;  3MN9 A;  4ISE A;  5I9E B;  3C65 A;  3T1Y K;  1WNS A;  1V4T A;  3IMX A;  4KHN A;  1NK4 A;  4DR3 K;  3GE1 A;  3UKR A;  3W3D A;  4CF9 A;  3NFA A;  2D0O A;  3SUN A;  3AVK A;  5C2D A;  3NCI A;  4CED A;  2AA4 A;  4CK2 A;  1CZ9 A;  4M7X A;  4F9O A;  4CF0 A;  4CFD A;  3ALY A;  2FBV A;  3IG1 A;  4U7B A;  1NOZ A;  3VQC A;  1ZBU A;  4OGC A;  1L3U A;  4EP5 A;  1DEJ A;  2KQ2 A;  4B9S A;  2FF3 B;  4O5F A;  4BC3 A;  5MLC Q;  3KK2 A;  4NYF A;  4E7J A;  1EQY A;  4BDZ A;  4ILG B;  1DLO A;  4CJV A;  4EIA A;  3T69 A;  2XY7 A;  2V52 B;  4JLH A;  3EYZ A;  3ISN C;  2A3Z A;  1RBS A;  3O9U A;  1WAJ A;  4H5N A;  3U3Y A;  3FE1 A;  4DV0 K;  3DAW A;  4WQ5 C;  3G25 A;  4PKH A;  1GLC G;  4FLZ A;  3NGY A;  4OLA A;  4WF9 L;  1DGK N;  2G8U A;  1T3V A;  3ZSQ A;  4FLX A;  2E6L A;  3EN9 A;  3LM9 A;  4C1N K;  3CFR A;  3WXK A;  3MED A;  2YKN A;  1ASW A;  2CGJ A;  1KD1 O;  3VEX A;  2VGM A;  3CI5 A;  4JKB A;  1EXQ A;  4Z94 A;  4LFA K;  4GV6 A;  3VQD A;  2YNI A;  4FVM A;  3O6W A;  2YNH A;  3E66 A;  3MK6 A;  4JKF A;  4GKJ K;  3VQ7 A;  3L2U A;  5C0Y A;  1RBR A;  4IXC A;  2BH1 A;  1HQU A;  4LC9 B;  3K5M A;  1ATR A;  1TUU A;  5AQJ A;  3ZT3 A;  1HPM A;  2HST A;  1GLA G;  2OZS A;  1B9F A;  1ASU A;  2B5J A;  4K42 A;  4X65 K;  4CBX A;  3VA0 A;  1Q9Y A;  1L5U A;  3L4Q A;  2P9I B;  3E1Y A;  3V9U A;  4LF5 K;  1IG9 A;  3KWI A;  4JKE A;  2HBK A;  3CJB A;  4ZTF A;  4CGJ A;  4FOE A;  4MDB A;  4I2Q A;  5AQZ A;  4JKG A;  2NRH A;  1QQC A;  5SWM A;  3DXM A;  3PX4 A;  3VQP A;  3ULD A;  4BRM A;  2D1K A;  4DQP A;  4DR2 K;  4H4O A;  4JKD A;  4F8R A;  5AQY A;  2Z1G A;  3WXJ A;  4R79 A;  3EKU A;  3J7Z O;  3A2F A;  3FFI A;  5EXW A;  5GAG P;  1RT1 A;  3TAR A;  4DUY K;  3OYK A;  3UE5 A;  1IKV A;  1RTI A;  4AF1 A;  3K2P A;  4KO0 A;  3VPZ A;  5GIO A;  2FF6 A;  4CEB A;  2X74 A;  3ZT4 A;  4IOX A;  1BCM A;  1KRP A;  1SL0 A;  4IJA A;  2XY6 A;  4FCY A;  3QBX A;  1LW2 A;  4O55 A;  3HK2 A;  3IS9 A;  1U47 A;  4KI6 A;  1NMD A;  3OYM A;  4GVM A;  4CZF A;  2O8D A;  5AFU H;  1HLU A;  1NOY A;  3CCL N;  1NK6 A;  3ZSR A;  2KZZ A;  4O0J A;  4CZI A;  1U6Z A;  3HI0 A;  2W6K A;  2E5L K;  2ITM A;  3AVA A;  2UU9 K;  2WFB A;  2X78 A;  4N47 A;  3O9R A;  5BPM A;  3F9K A;  4KV8 A;  3NGZ A;  4BAC A;  3EY1 A;  4H5R A;  4DG1 A;  3AA4 A;  4CJF A;  3SPY A;  1NKC A;  1C1C A;  1S9G A;  4F4K A;  4PKG A;  3IUC A;  1WAF A;  3M3Z A;  1W0H A;  3ZSY A;  4K8X A;  4C1N I;  4M3T A;  4J2D A;  4E7K A;  4QS7 A;  2KHO A;  3VER A;  4RCH A;  1NGH A;  4OJR A;  4CE9 A;  3WEE A;  5GAD P;  3TAQ A;  2HHS A;  5E26 A;  4DTR A;  1ZYQ A;  2E8A A;  3MN7 A;  4DU1 A;  1ILY A;  2P9K B;  3WNG A;  2QKK A;  4JHD A;  4FJH A;  3KLI A;  4PKI A;  3ZT1 A;  1J54 A;  1GLL O;  1K8A O;  2D4W A;  3C94 A;  3KZB A;  3OYG A;  3U6F A;  3RMD A;  1Z05 A;  4BR0 A;  1KAZ A;  1LWE A;  4BR5 A;  3MMV A;  1YIJ N;  2H3G X;  1RDW X;  1S1V A;  4KRF A;  4IO8 A;  1RT5 A;  1SUQ A;  2ZM6 K;  2Q1N A;  1BU6 O;  3HJF A;  2JWK A;  4CK1 A;  3EE9 A;  1NJW A;  1GOA A;  3WQT A;  2DY4 A;  2OCE A;  2QA4 N;  1QTM A;  4CFB A;  4KTW A;  2FC0 A;  2P9S B;  3LDN A;  5J2N A;  3ATU A;  3GOI A;  2OPP A;  1RBU A;  3LDL A;  1K9M O;  4H0V B;  3CHW A;  4BRE A;  5LMU K;  3H45 C;  4FL9 A;  1N34 K;  4Z0U A;  1BGX T;  1BG3 A;  4CJP A;  3AO3 A;  3QNO A;  3IAY A;  2UXC K;  3ZT0 A;  1RDU A;  2AP1 A;  2VQE K;  2HBL A;  4DSF A;  1UA0 A;  3EZW A;  1U4B A;  3SUP A;  3PO4 A;  3HYF A;  2EX3 A;  3C0B A;  4DQR A;  4DFP A;  1X9M A;  4BRK A;  1C1B A;  2QXF A;  4KHQ A;  4KBO A;  2ZWH A;  4X64 K;  4GV3 A;  4YOY A;  3VF6 A;  3PX0 A;  4WE1 A;  2RHK A;  1QHT A;  2O4I A;  4DSK A;  3CFO A;  2QWL A;  5HL7 L;  1WSF A;  4M7Y A;  1KFD A;  3PSF A;  4CEA A;  3DLG A;  1TL3 A;  5KQD A;  2G8V A;  4IDH A;  3O08 A;  2ASM A;  5J1E A;  3AO4 A;  3ZET B;  3TR8 A;  1TK8 A;  2F4V K;  5AQP A;  3FZM A;  1KXP A;  2DFE A;  4RW8 A;  3EZ5 A;  4DS5 A;  2Z1H A;  4CZE A;  4CJ4 A;  2VWB A;  3VA3 A;  1VQK N;  4K0K K;  3MXM A;  4M3X A;  5LJV A;  4CW7 B;  5BPL A;  3ULE A;  2QWQ A;  4FJ9 A;  4A59 A;  1T44 A;  1ZBI A;  4DHY A;  1N32 K;  1EKE A;  1S5J A;  3HZ6 A;  3BUZ B;  3ZX3 A;  3JS6 A;  4NCA A;  1NU0 A;  5T7B A;  3O9Q A;  3LDQ A;  1EWR A;  4E89 A;  2KW4 A;  4L8R B;  1OH5 A;  2HMI A;  1HNI A;  5TKY A;  5E41 A;  3D2E B;  4QS8 A;  3DRP A;  4H0P A;  4BRP A;  4Q0B A;  1RT4 A;  2P5O A;  1BL3 A;  4BDP A;  4FWN A;  5AQS A;  1ZC6 A;  5I3U A;  4ISF A;  4QS9 A;  5GAH P;  3OW2 M;  3VTH A;  3TSU A;  4B1Y B;  2ETJ A;  2QXL A;  3L2Q A;  3P83 D;  1RTD A;  4DFM A;  5GIP A;  3NGI A;  3T3F A;  1VSK A;  4BQZ A;  5BN8 A;  4NXN K;  3LAK A;  3NF7 A;  1L3T A;  3OYE A;  2P9P B;  4YNQ A;  1NNE A;  1UOC A;  2ATQ A;  2E1Y A;  3N4Q A;  2HMP A;  1Q7Y O;  1T05 A;  4OPH A;  4OLB A;  4HTU A;  1SV5 A;  2QWO A;  1A5W A;  1REV A;  5AZJ A;  2W6L A;  4CEZ A;  4CJ3 A;  4DTO A;  3KJV A;  1HYZ A;  2HB5 A;  4DTP A;  4LSN A;  1Q82 O;  2A42 A;  2YJF A;  3SQ0 A;  3BF1 A;  3VQB A;  3OS2 A;  4DV6 K;  4LH4 A;  4Z4I A;  1LV5 A;  4AHC A;  2O8F A;  4OPK A;  4IO9 L;  4I6M B;  2NUB A;  2BUP A;  3MN6 A;  3ZEU B;  4Z4H A;  4IG0 A;  1NGJ A;  4A62 A;  4YOV A;  5FRN A;  1JCF A;  3CM5 A;  3QEX A;  1HNV A;  2Y1J A;  1VQ8 N;  2Q97 A;  1LWC A;  1Q18 A;  3BF3 A;  3CD6 N;  2RKI A;  3OTO K;  4MFB A;  4UQG A;  3O5B A;  1NK7 A;  4L3Q A;  3C6T A;  2KFN A;  1OVY A;  3VGK A;  2HHH K;  5F2R A;  3HM9 A;  3FZK A;  3MCA B;  4AIL C;  3SUO A;  4N41 A;  1MA9 B;  3F9M A;  3LP3 A;  2BGG A;  3D2F A;  3DOK A;  3DRR A;  1N33 K;  1TK0 A;  4ID5 A;  2YX6 A;  3WXM B;  3OYN A;  3OJU A;  3WXL A;  2Y1I A;  4KFB A;  1Q81 O;  3PV8 A;  1VQO N;  1TGO A;  4JK7 A;  1SZ2 A;  1W7A A;  2UUB K;  4FJK A;  1VQ4 N;  4DFJ A;  1JLC A;  1J9A A;  5KPT A;  1XNR K;  4JRP A;  2VG6 A;  2ZF5 O;  3VF2 A;  3VQE A;  4H0Y B;  1CXQ A;  3PY8 A;  1NBW A;  4KB1 A;  2DTU A;  4AM6 A;  3HT3 A;  2VCP A;  2A40 A;  2CGK A;  5AFU A;  1NGC A;  5BRH A;  2V7Z A;  4KRE A;  3NE6 A;  4AHR A;  1RBT A;  2GWJ A;  3BZC A;  5F1X A;  1BI4 B;  2Q3S A;  3QB0 A;  4O4G A;  5AQM A;  5BR9 A;  3HP6 A;  3L4I A;  4W5O A;  3SI6 A;  1BIS A;  4B9Q A;  5FPE A;  4BRH A;  5JVG L;  4BVO A;  2XO7 A;  3UKU B;  4FLV A;  4DV5 K;  1QQM A;  2ZGY A;  3AA5 X;  5LMN K;  1L3S A;  2P5G A;  5AQO A;  4DQQ A;  2IDO A;  2O8B A;  4JK8 A;  3NAE A;  4AHT A;  3NMU A;  4CD1 A;  1TYQ B;  3C6U A;  4IEI A;  1U45 A;  4CEO A;  1VSL A;  3O4N A;  3WNH A;  3CC4 N;  1IKX A;  3CCU N;  2OPR A;  3CJA A;  1BIZ A;  4Z4C A;  1X9S A;  3CCR N;  4N5S A;  2A6A A;  1BUP A;  4W5N A;  2YHX A;  1HPZ A;  1YI2 N;  4BVP A;  3CJ7 A;  1IO2 A;  3AVF A;  3ASM A;  3SBG A;  3TTD A;  4CIE A;  3WNE A;  3HPH A;  3B6P A;  4CGH A;  5HP1 A;  3HXM A;  3MEC A;  4RWT A;  3PLA A;  2D0C A;  4YOU A;  3AO2 A;  4DTX A;  3SAF A;  1YJW N;  2O8E A;  2BDP A;  5TKW A;  5JLH A;  4NYN A;  4DV1 K;  3ATV A;  1HX1 A;  3SYZ A;  3KD1 E;  4CEF A;  3DI6 A;  4FWK A;  4JNE A;  3OYA A;  3UKR B;  2HHT A;  1ATS A;  4E3S A;  3O4W A;  4DR5 K;  3ZSX A;  2OA8 A;  1K6Y A;  4JEP A;  4B3M K;  3C95 A;  1SL1 A;  2E1Z A;  3QIO A;  3RRG A;  3KLH A;  4HUG A;  1ASV A;  5GAE P;  3V1O A;  4CGF A;  4BR7 A;  5KGX A;  1HNZ K;  1VSD A;  3KK1 A;  1UA1 A;  3QIP A;  1QSS A;  3GDQ A;  2F9W A;  4QCL A;  1Z25 A;  1Q9X A;  2UXB K;  1JCG A;  3AVL A;  4EHT A;  4J2A A;  4DF8 A;  2Q0U A;  3I56 N;  4PQU A;  4B1Z A;  3VQ5 A;  4FW1 A;  4E7L A;  3TSP A;  4CD3 A;  3KK7 A;  3O1B A;  5AQF A;  1S72 N;  4Y1C A;  4LFB K;  5M1P A;  3R8E A;  1OH6 A;  4WFB L;  1QS4 A;  2FBY A;  4I9Q A;  4FK4 A;  3BDP A;  3CFP A;  3SJJ A;  4EZ9 A;  3SJH A;  3DLB A;  4DWI A;  4TSX A;  3WUH A;  5KRT A;  1FKO A;  3K59 A;  4YOT A;  2GBZ A;  3EKS A;  3OA9 A;  3AVB A;  3HTV A;  2HHQ A;  1IV0 A;  3K5N A;  3CCQ N;  3KD5 E;  3GL1 A;  4W5T A;  3NF9 A;  3G4S N;  2HNY A;  4DF4 A;  2OPS A;  4WFA L;  3N4P A;  4GNI A;  3RVC A;  3HP9 A;  4JI6 K;  3HVT A;  4RW4 A;  1Q8I A;  3CYM A;  4OX9 K;  1HNX K;  5DK5 A;  2WTU A;  3A5N C;  1IG8 A;  3U3G A;  1S1T A;  2NZT A;  4K41 A;  1BWF O;  3C6A A;  3AGR A;  4B08 A;  3DOL A;  1C0G A;  1LAV A;  1VK0 A;  3IFR A;  4DV7 K;  2B4J A;  1DKG D;  1D9F A;  2NRZ A;  4GV9 A;  2FXU A;  2FBX A;  4FO0 A;  1CLQ A;  4CEQ A;  3O3H A;  3H3N O;  4Y1D A;  4YOR A;  4CF8 A;  4YDU A;  4FXD A;  3OYB A;  3QIC A;  3ZT2 A;  4AHU A;  3CCE N;  4IFE A;  3OJS A;  1S1X A;  4IBN A;  1S3X A;  1N5Y A;  3THV A;  3RMB A;  1BA1 A;  3S3O A;  3SK3 A;  1IH7 A;  3DXM B;  3L2R A;  3OBY A;  1TUY A;  3SAG A;  1O1W A;  2B6A A;  5LL6 Z;  1K8K A;  5CZ1 A;  1YF5 L;  5M1F A;  2YCH A;  2PYL A;  1QZ5 A;  3QES A;  3U9D A;  4C8M A;  5J2M A;  5AQN A;  2VWJ A;  1QE1 A;  3UB5 A;  2IVO A;  1J5O A;  3AA2 A;  3DXK A;  1SKW A;  4JD2 A;  2HND A;  4A5B A;  3VES A;  3LP2 A;  1MWM A;  1HKG A;  4DU4 A;  1X3M A;  3IKM A;  4HVJ A;  4DFK A;  1WUA A;  1C0M A;  1SAZ A;  3HPG A;  2O8D B;  4A57 A;  4BQL A;  3VEZ A;  1CXU A;  4ELT A;  2PZS A;  4HCB A;  2QM1 A;  4LSL A;  4DLE A;  1EET A;  4EHU A;  3L2V A;  2VYP A;  3CJ1 A;  1E4F T;  4GW6 A;  3MWP A;  1D5A A;  2R7Y A;  1SKR A;  1HNW K;  1K73 O;  3PO5 A;  3VEO A;  2G8F A;  4DUZ K;  4KHW A;  5M1O A;  4CK3 A;  1QSY A;  2F7T A;  2P9L A;  2VG5 A;  4RW9 A;  4JI2 K;  4BRA A;  5C10 A;  3V4I A;  1JL2 A;  4FJJ A;  2ZE2 A;  2F9T A;  4DSJ A;  1VSH A;  2IAJ A;  3L8B A;  1LCU A;  2FSK A;  3I0S A;  4M63 C;  3K9K A;  2KTQ A;  5FLX O;  5A2Q O;  3TSQ A;  2YHA A;  4BR9 A;  1W2B M;  4UY8 O;  4FLY A;  4YOX A;  3WEE B;  4CZK A;  3KIO A;  1OKJ A;  3TU5 A;  1DT9 A;  3OY9 A;  5LJW A;  2JLE A;  4DR4 K;  3EEQ A;  4DTJ A;  3ENB A;  1HJR A;  2FLO A;  4JHD B;  3LPT A;  4E0D A;  1VQ6 N;  5AQW A;  3VEY A;  3CG7 A;  3AVM A;  4NXM K;  3LWM A;  2HHW A;  3ZLJ A;  5M1Q A;  3HST B;  4NCB A;  3LDO A;  3QFP A;  3TTF A;  3VEN A;  4IWV A;  1GLB G;  3VTI A;  1T6C A;  3I0R A;  2PY5 A;  1XMO K;  4CIF A;  2JWL A;  4MDA A;  2AJQ A;  5ADX H;  4JI3 K;  4MLH A;  3T1A A;  1TKT A;  5C2F A;  1VAZ A;  3S3N A;  1BIU A;  4GKK K;  2PFU A;  2WC9 A;  3AY9 A;  2HVH A;  1J53 A;  4DS4 A;  5JMV A;  1KVA A;  3AVH A;  3BEX A;  3NF8 A;  4QOZ B;  4CJ5 A;  5CZ2 A;  3FFK B;  4JI5 K;  4FVU A;  5AZI B;  3H08 A;  4MO4 A;  1MU2 A;  4B9M A;  3S9H A;  3KKR A;  1GOB A;  1B92 A;  3NH0 A;  4DMN A;  3Q7C A;  2OYQ A;  1EO1 A;  2Q31 A;  1WB9 A;  3AAP A;  1N8R O;  2I5J A;  3NH1 A;  5H1S Q;  4PY5 A;  3THY A;  1ZBS A;  4OVL A;  4LF8 K;  1YIT N;  1VQ5 N;  3SNN A;  2FBT A;  1U2V A;  4FLW A;  5HBM A;  4H0O A;  1YTU A;  2PYJ A;  4RW6 A;  2P9U A;  3QBW A;  4CI6 A;  2YV0 X;  4W5Q A;  2NNW A;  1BDG A;  3LWL A;  4DTM A;  3AAR A;  2DPN A;  3KLG A;  2I7N A;  1S9E A;  3KVG A;  5AQT A;  3WQU A;  3WT0 A;  3CQY A;  3P31 A;  4CGI A;  4H5V A;  1QQN A;  3F2K A;  1VRT A;  4FW2 A;  2VQF K;  3AVG A;  3LAL A;  3R6M A;  3MX5 A;  5IWA K;  4Q5V A;  4O8U A;  4CJW A;  5CHI A;  3OYD A;  3VMF B;  4C23 A;  5KI6 A;  4BDY A;  2QKB A;  1RT2 A;  4CJ7 A;  4B3R K;  4DV4 K;  4PL8 A;  4JAX A;  2YJE A;  5AQV A;  4JYA K;  3ULE B;  3BP8 A;  3VF4 A;  3H3O B;  5HOO A;  5JS1 A;  2BTF A;  4ZHR A;  3DLL L;  4BR4 A;  3JSM A;  5BPN A;  4DR7 K;  4CZJ A;  4DKW A;  3T1H K;  3CQX A;  4ELU A;  4N76 A;  4DQS A;  2IIR A;  3J80 O;  1JXB A;  4IOC L;  3MWT A;  5HLF A;  1BOT O;  3KHY A;  1KFS A;  4CGD A;  4OO1 J;  2I7P A;  4FJL A;  4B1U B;  4K43 A;  3CME N;  3TAN A;  4PWD A;  1RT7 A;  1WLJ A;  2P9N A;  2E2P A;  1TKX A;  1DTQ A;  3V1R A;  3CCJ N;  3LP0 A;  3T7Z A;  3VOV A;  1U48 A;  5CYQ A;  1T03 A;  2QK9 A;  4J8F A;  5AQI A;  5AQU A;  1NJY A;  5KPR A;  3ID8 A;  1JLE A;  5I42 A;  4E1N A;  2HBM A;  4YOW A;  2J4R A;  4XH4 A;  1P8Z A;  3BY5 A;  3B6O A;  2IVN A;  1NM1 A;  4O0I A;  2D0A A;  5LY3 A;  3L0Q A;  1QSL A;  3G0Z A;  3R3L A;  3ZYY X;  2O8C A;  1RDD A;  2RPI A;  2OAN A;  3MXJ A;  4G1Q A;  3VQ8 A;  1XNQ K;  5AZJ B;  3HVR A;  4FWR A;  2FSJ A;  4C8N A;  1NGA A;  4KAZ A;  1ESV A;  1VQL N;  4FM0 A;  3P5J A;  4EFH A;  4NLB A;  4AQY K;  2GEL A;  2HF3 A;  1WSI A;  3AA3 A;  3AVI A;  3HL8 A;  3U9Z A;  5AQX A;  2D0P A;  2HOE A;  2O8F B;  3ID6 A;  1YHQ N;  4FM1 A;  4CBW A;  2HBJ A;  3KLF A;  4E7H A;  2RN2 A;  4XEI A;  5CY4 A;  1JLQ A;  1ZBL A;  4CBU A;  4NO7 A;  1VQN N;  2E88 A;  4O8K A;  3VQ4 A;  4LF9 K;  3SMP A;  1A5V A;  1WSE A;  3HPO A;  3AO5 A;  3C7N A;  1HUX A;  5K14 A;  3L3V A;  3LDP A;  1NMN A;  4B9N A;  1Y64 A;  4R5P A;  4FM2 A;  3WNF A;  5M1N A;  3LAM A;  4KH5 A;  3VN5 A;  3M8R A;  2VGN A;  4CVN E;  1GLD G;  1L3V A;  3D2F B;  3PUF A;  4WQ5 A;  2QI2 A;  1KQS M;  5EVZ A;  3B8A X;  1HJO A;  2YKM A;  3TPQ A;  2G8I A;  3QER A;  3TWH A;  4Z4F A;  1JXE A;  1GLF O;  4IDK A;  4Y0W A;  4M3Z A;  3TI0 A;  2WON A;  3QNN A;  1NG9 A;  2QEX N;  2PBD A;  1FKP A;  3E01 A;  5KPZ A;  4OPA A;  5C24 A;  3E9P A;  3MX2 A;  2NRT A;  4BRG A;  3QIN A;  4CJE A;  2Z1J A;  2CH6 A;  3V81 A;  1D8Y A;  3TAP A;  2Z1I A;  4FWO A;  4U67 L;  5AQK A;  3L2W A;  4RTF D;  3RSE A;  1C1A A;  1RFQ A;  3CF5 L;  4KPY A;  3THW A;  3ZSZ A;  1TV6 A;  4HCC A;  3PSI A;  1WN7 A;  3U8X A;  2ZQB A;  4WCE L;  1YXQ A;  3LL3 A;  1YUW A;  4BGB A;  3M8P A;  4J2B A;  4GVE A;  4FK0 A;  3TTC A;  3O3F A;  3K57 A;  3SUQ A;  4IJN A;  4ELV A;  4FJM A;  1VSE A;  4LD0 A;  3FZH A;  3G71 N;  3RMA A;  1W97 L;  1ZBH A;  3J8A A;  4EP4 A;  4FZY A;  4KKO A;  1O13 A;  4ISG A;  3V9W A;  5CYM A;  2O8B B;  2GTD A;  1BHL A;  2O4G A;  4B3O A;  4H5W A;  4DV2 K;  3OBW A;  4BWM A;  3O4Q A;  5BRD A;  4BRN A;  3SCX A;  5CE3 A;  3A5L C;  3FGU A;  1RIL A;  1U49 A;  1E4G T;  2A41 A;  3LAN A;  4DU3 A;  4MQ3 A;  2ASP A;  3TAG A;  1NGI A;  3A8Y A;  2HHU A;  3NHG A;  4JRQ A;  4C8L A;  1M90 O;  4LH5 A;  4JKC A;  3VGM A;  1C0T A;  5JIC A;  3H46 O;  3LZI A;  3THX A;  5FRM A;  4B3T K;  3DLH A;  3HOS A;  4H8K A;  3AVC A;  4X62 K;  2YHB A;  3P4I A;  4FJ8 A;  1ATN A;  1FJG K;  1XI1 A;  3OS0 A;  3DLR A;  2CH5 A;  2NRW A;  4CES A;  2O8E B;  3MCP A;  4IFY A;  3DM2 A;  3AGK A;  5ADX A;  1WSH A;  3OHR A;  1KTQ A;  2GUP A;  4FZZ A;  1S1W A;  3LP1 A;  1C0U A;  2GV9 A;  2V51 B;  3SMS A;  4IEE A;  3K58 A;  4ILJ A;  3M6G A;  4ILH A;  2QW9 A;  3Q7B A;  4FWM A;  2VWK A;  4NCG A;  1I94 K;  4FZX C;  5IT9 O;  3CJC A;  1BQM A;  4KB0 A;  1FW6 A;  4FLT A;  4FPB A;  2EHG A;  2ZJP L;  1V4S A;  4HUF A;  1XWL A;  5KQ8 A;  3V9Z A;  3M1F A;  3R9P A;  3A5M C;  3CET A;  4BE2 A;  3LM2 A;  1W9H A;  4HUE A;  3FZF A;  3L6Q A;  4A2A A;  2FSN A;  4CIG A;  5C42 A;  5AQQ A;  4XIU A;  3OYJ A;  1KCF A;  4HTL A;  1NK9 A;  5BRE A;  4FJ5 A;  1NK8 A;  4O44 A;  1RDA A;  4CJR A;  2XY5 A;  4CHZ A;  2A1S A;  2W42 A;  1LWF A;  1VQ7 N;  4M3R A;  1UAX A;  3C6H A;  4FK2 A;  3J81 O;  4FLU A;  2DFH A;  4RG8 A;  4XH1 A;  4KI4 A;  4FSV A;  3HRG A;  1NKB A;  2E6M A;  3FZL A;  1VSI A;  2ZGZ A;  4BRL A;  3QET A;  4FJG A;  1E3M A;  1X1P A;  4OKK A;  1I39 A;  1S22 A;  3QDK A;  1NK5 A;  4CHP A;  4GY2 B;  4JKH A;  4DQI A;  4B3S K;  3O3G A;  2W41 A;  4E1M A;  2G8K A;  3OYC A;  1KAX A;  2QTD A;  3OYI A;  1T6D A;  5GIN A;  4CHY A;  5D3G A;  2VG7 A;  1HMV A;  2UUC K;  2WUS A;  3QO9 A;  1YTA A;  5AQH A;  2JGU A;  4MLE A;  4H03 B;  4ID1 A;  4LY7 A;  2HVI A;  4M3W A;  4OKE A;  1T8E A;  3D6R A; 
#chains in the Genus database with same CATH homology
 5M1Q A;  4ISF A;  4QS9 A;  5GAH P;  3OW2 M;  2V7Y A;  3VTH A;  3TSU A;  1VQ9 N;  1ZXO A;  4B1Y B;  2QXL A;  3UKU A;  3LDO A;  4DQ8 A;  4WFN L;  3H6E A;  2QWN A;  3QFP A;  3P39 A;  3TTF A;  3QFU A;  1Z6R A;  3VEN A;  4B1X B;  1HKB A;  4IWV A;  1GLB G;  3VTI A;  5GIP A;  4BG9 A;  1T6C A;  3DJC A;  3DWL A;  5C12 A;  5DM6 L;  4FWL A;  3HOT A;  4BQZ A;  5BN8 A;  4IZ9 A;  2JWL A;  4MDA A;  4BRO A;  5ADX H;  2WBN A;  2P9P B;  5EOY A;  4MLH A;  4FWP A;  1TYQ A;  5C2F A;  1VAZ A;  2Q0R A;  3CPE A;  2E1Y A;  3N4Q A;  2PFU A;  2HMP A;  2PAV A;  5BN9 A;  2WC9 A;  3WXI A;  1Q7Y O;  1NLV A;  2QWP A;  2UYT A;  3AY9 A;  4OPH A;  1QHA A;  2HF4 A;  2QWO A;  3JXU A;  5JMV A;  4JKG B;  1HKC A;  3SLC A;  4BRQ A;  5AZJ A;  2QWR A;  1BO5 O;  2YHY A;  1KC8 O;  1XC3 A;  2A5X A;  3BEX A;  3GG4 A;  4BC5 A;  3CER A;  3FFK B;  3U4L A;  4FVU A;  5AZI B;  1XUP O;  4MO4 A;  2OTJ N;  3O80 A;  2P9I A;  1Q82 O;  1GLE G;  3MN5 A;  2A42 A;  3G6E N;  3Q7C A;  4WQ4 A;  2YJF A;  5AQL A;  3PIO L;  2E20 A;  1K8K B;  1BA0 A;  1EO1 A;  5AQG A;  2Q31 A;  3AAQ A;  3BF1 A;  4BC2 A;  1KAY A;  3AAP A;  3P38 A;  1VQP N;  1N8R O;  3ENH A;  4IO9 L;  1NWK A;  5H1S Q;  4I6M B;  1CZA N;  1ZBS A;  2BUP A;  3MN6 A;  3QML A;  3ZEU B;  1YIT N;  1VQ5 N;  1NGJ A;  5AR0 A;  4A62 A;  4YOV A;  1JCF A;  1U2V A;  2YI1 A;  3MN9 A;  4H0O A;  4ISE A;  3W0L A;  3C65 A;  5I9E B;  4E1J A;  3DXK B;  2Q97 A;  1VQ8 N;  4JD2 B;  2P9U A;  1V4T A;  3IMX A;  1R59 O;  4WYB A;  1Q18 A;  3BF3 A;  1YJ9 N;  3CD6 N;  3QBW A;  3NVM A;  4CI6 A;  2NNW A;  1BDG A;  3GE1 A;  3UKR A;  3W3D A;  3O5B A;  2D0O A;  4CZG A;  5C2D A;  3AAR A;  4L3Q A;  1OVY A;  3E9L A;  3VGK A;  4BGA A;  5F2R A;  2AA4 A;  2DPN A;  3FZK A;  3MCA B;  4M7X A;  2I7N A;  4F9O A;  1MA9 B;  3F9M A;  3KVG A;  5AQT A;  2ZJR L;  3WQU A;  3WT0 A;  3CQY A;  4U7B A;  3D2F A;  5M1K A;  3P31 A;  4H5V A;  1QQN A;  3F2K A;  2YX6 A;  3WXM B;  3R6M A;  1MDU B;  1LOT B;  3MX5 A;  4O8U A;  2NRX A;  3WXL A;  5CHI A;  1Q81 O;  3VMF B;  4C23 A;  1DEJ A;  4CJ7 A;  3PIP L;  1VQO N;  4JK7 A;  1SZ2 A;  4PL8 A;  3HM8 A;  2FF3 B;  4O5F A;  2P9L B;  2YJE A;  4JAX A;  5AQV A;  4BC3 A;  3ULE B;  5MLC Q;  3BP8 A;  3VF4 A;  3H3O B;  5HOO A;  1EQY A;  2BTF A;  1VQ4 N;  4ILG B;  3DLL L;  3GBT A;  4BR4 A;  4EIA A;  1G99 A;  4B1W B;  3T69 A;  5KPT A;  2V52 B;  5BPN A;  4CZJ A;  3CC2 N;  4DKW A;  3CQX A;  3VET A;  3CPW M;  2ZF5 O;  2A3Z A;  2IIR A;  3VF2 A;  4IOC L;  3MWT A;  4H0Y B;  3O9U A;  1BOT O;  3KHY A;  4H5N A;  5FPM A;  1NBW A;  4OO1 J;  3FE1 A;  2I7P A;  3DAW A;  4WQ5 C;  4AM6 A;  4B1U B;  2VCP A;  2A40 A;  3G25 A;  2CGK A;  4PKH A;  1GLC G;  1NGC A;  4K43 A;  5AFU A;  2V7Z A;  5BRH A;  3CME N;  4WF9 L;  1DGK N;  1T3V A;  2P9N A;  2E2P A;  2GWJ A;  3EN9 A;  2YHW A;  3CCJ N;  2IVP A;  3LM9 A;  4NB4 A;  5F1X A;  4IOA L;  3T7Z A;  3VOV A;  4C1N K;  3QB0 A;  4JKA A;  3WXK A;  3F5T A;  4JN4 A;  5AQM A;  5BR9 A;  4KH4 A;  1JJ2 M;  2CGJ A;  3A5O C;  1KD1 O;  3L4I A;  3VEX A;  2VGM A;  3CI5 A;  4J8F A;  5AQI A;  5AQU A;  3CCV N;  5FPE A;  4B9Q A;  5JVG L;  4JKB A;  4BRH A;  4FOI A;  4BVO A;  3UKU B;  4Z94 A;  5KPR A;  2KKZ A;  4GV6 A;  2P9K A;  3ID8 A;  1QQM A;  2ZGY A;  3CCS N;  2EWS A;  3O6W A;  3E66 A;  3MK6 A;  4JKF A;  1JCE A;  3FLC O;  5AQO A;  1NGB A;  2HBM A;  4YOW A;  5C0Y A;  4IXC A;  2J4R A;  2BH1 A;  3CCM N;  4XH4 A;  5AQR A;  4JK8 A;  1P8Z A;  1C0F A;  3NMU A;  4CD1 A;  1TYQ B;  3CC7 N;  2IVN A;  4IEI A;  4LC9 B;  1ATR A;  1TUU A;  5AQJ A;  2RE2 A;  1NM1 A;  1HPM A;  2HST A;  5LY3 A;  3L0Q A;  3CC4 N;  1GLA G;  3R3L A;  3ZYY X;  4H0T B;  2OAN A;  5AZJ B;  3CCU N;  4FWR A;  5EX5 A;  2FSJ A;  3CJA A;  4HWI A;  1NGA A;  4K42 A;  5B8H A;  4CBX A;  4BY9 C;  1ESV A;  3O8M A;  3VGL A;  3CCR N;  4BG8 A;  1VQL N;  2A6A A;  1BUP A;  3L4Q A;  2P9I B;  2YHX A;  3E1Y A;  1YI2 N;  4EFH A;  3KWI A;  4NLB A;  2E2O A;  3CJ7 A;  4JKE A;  2GEM A;  4BVP A;  2HBK A;  3SBG A;  2GEL A;  3CJB A;  2HF3 A;  2P9S A;  2E2N A;  4FOE A;  3TTD A;  4MDB A;  5AQZ A;  3U9Z A;  5AQX A;  2D0P A;  4JKG A;  2HOE A;  2NRH A;  4RWT A;  3ID6 A;  1YHQ N;  3DXM A;  2Q36 A;  3PLA A;  4BRM A;  4CBW A;  2HBJ A;  2D1K A;  5AZI A;  4G9Z A;  4XEI A;  4YOU A;  3SAF A;  1U2V B;  1YJW N;  4JKD A;  3O9T A;  1X3N A;  4NO7 A;  5AQY A;  5TKW A;  4CBU A;  1VQN N;  5JLH A;  2E88 A;  4O8K A;  3WXJ A;  4R79 A;  3SMP A;  2P9U B;  4KH6 A;  3ATV A;  1HX1 A;  3C7N A;  1HUX A;  3EKU A;  3J7Z O;  5EXW A;  5GAG P;  5JVH L;  4FWK A;  4JNE A;  3UKR B;  2GX9 A;  3LDP A;  1ATS A;  3UE5 A;  1Y64 A;  4AF1 A;  4YDU C;  3O4W A;  3VPZ A;  5GIO A;  2FF6 A;  5FPN A;  5M1N A;  4JEP A;  4KH5 A;  4IOX A;  4MO5 A;  3H1V X;  2E1Z A;  2VGN A;  1GLD G;  3D2F B;  4WQ5 A;  2QI2 A;  3FR0 A;  3H1Q A;  5EVZ A;  5GAE P;  3B8A X;  4K25 A;  1KQS M;  4BRF A;  4IJA A;  1HJO A;  4BR7 A;  4FWQ A;  3TPQ A;  3QBX A;  3GDQ A;  1GLF O;  1NMD A;  1YVN A;  2F9W A;  4Y0W A;  4DCH A;  4CZF A;  5AFU H;  1HLU A;  3CCL N;  2QEX N;  2PBD A;  1GLJ O;  2CGL A;  1JCG A;  3ZET A;  5KPZ A;  4WQ4 C;  4OPA A;  4EHT A;  4CZI A;  3CXC M;  1U6Z A;  3HI0 A;  3E9P A;  2Q0U A;  3I56 N;  3MX2 A;  2ITM A;  4B1Z A;  2NRT A;  4BRG A;  3ENO A;  2ASO A;  2WFB A;  2CH6 A;  3O9R A;  5BPM A;  3TSP A;  1MWK A;  3ZX0 A;  4H5R A;  3R1X A;  4EAH D;  4FWO A;  4CD3 A;  3KK7 A;  3O1B A;  3KWG A;  5AQK A;  5AQF A;  3VEV A;  4U67 L;  1S72 N;  4RTF D;  5M1P A;  3RSE A;  3R8E A;  4PKG A;  3IUC A;  1RFQ A;  3M3Z A;  3CF5 L;  4WFB L;  2ZJQ L;  3M5R A;  3CMA N;  2P9N B;  3U8X A;  4C1N I;  4WCE L;  3CIP A;  3I8B A;  1YXQ A;  3EE8 A;  3LL3 A;  3ZX2 A;  1YUW A;  4QS7 A;  4BGB A;  2KHO A;  3VER A;  4RCH A;  3SJH A;  3HSC A;  1NGH A;  3WUH A;  4YOT A;  3EKS A;  4GVE A;  3WEE A;  3TTC A;  3OA9 A;  5GAD P;  3HTV A;  5E26 A;  3I33 A;  4IJN A;  3G71 N;  3FZH A;  2E8A A;  3MN7 A;  1W97 L;  1ILY A;  3J8A A;  3K9J A;  3CCQ N;  3GL1 A;  3G4S N;  3EL2 A;  3D2E A;  2NLX A;  2P9K B;  4WFA L;  2NRV A;  5FPD A;  3N4P A;  4GNI A;  4JHD A;  3RVC A;  1O13 A;  1SS6 A;  4ISG A;  4PKI A;  1GLL O;  1K8A O;  2D4W A;  3KZB A;  3A5N C;  1IG8 A;  2GTD A;  1Z05 A;  4BR0 A;  4H5W A;  2NZT A;  4K41 A;  1BWF O;  5DM7 L;  3OBW A;  1P90 A;  4BRC A;  1KAZ A;  3C6A A;  5BRD A;  3AGR A;  4BR5 A;  1C0G A;  4A2B A;  4BRD A;  3MMV A;  3IFR A;  1YIJ N;  2H3G X;  1RDW X;  4BRN A;  4BC4 A;  1DKG D;  3I55 N;  2NRZ A;  3A5L C;  3FGU A;  4IO8 A;  5CE3 A;  4GV9 A;  2FXU A;  4FO0 A;  2Q1N A;  1BU6 O;  1E4G T;  2A41 A;  2JWK A;  1NGF A;  3H3N O;  4YOR A;  3EE9 A;  5ELZ A;  3WQT A;  3A0I X;  1NGD A;  2ASP A;  4YDU A;  1NGI A;  2P9P A;  3A8Y A;  4PL7 A;  5E84 A;  1M90 O;  2QA4 N;  3QIC A;  4JKC A;  3VGM A;  4XH5 A;  2P9S B;  4FPA A;  3CCE N;  4IFE A;  3LDN A;  5JIC A;  1NJI O;  3ATU A;  3SBT A;  3GOI A;  3H46 O;  4CZH A;  3LDL A;  3S41 A;  1K9M O;  4H0V B;  1NGG A;  1S3X A;  3CHW A;  5EY4 A;  3H45 C;  4FL9 A;  4BRE A;  1BA1 A;  3VEW A;  4BR2 A;  4DB3 A;  3SK3 A;  1BG3 A;  3DXM B;  4H0X B;  3HOS A;  3P4I A;  5JLF A;  1ATN A;  1M1K O;  3OBY A;  1TUY A;  1RDU A;  2AP1 A;  2CH5 A;  2HBL A;  2NRW A;  4PHT X;  5F0X A;  3MCP A;  3MDQ A;  3SAG A;  5BRF A;  1QVG M;  1QQO A;  3EZW A;  1WOQ A;  3AGK A;  5ADX A;  1K8K A;  1YF5 L;  3OHR A;  5M1F A;  1QZ6 A;  2YCH A;  3C7N B;  2GUP A;  3O9S A;  1RGI A;  3C0B A;  1QZ5 A;  3U9D A;  3E9O A;  2V51 B;  3SMS A;  5AQN A;  4IEE A;  4I6M A;  4ILJ A;  3M6G A;  4BRK A;  3ZEU A;  4ILH A;  2QW9 A;  2W40 A;  3Q7B A;  4FWM A;  4KBO A;  2ZWH A;  3UB5 A;  3CJC A;  1X9J A;  2IVO A;  4GV3 A;  4H5T A;  3DXK A;  4YOY A;  3VF6 A;  4JD2 A;  2RHK A;  4A5B A;  4FPB A;  5CR4 A;  3VES A;  1J6Z A;  3HBT A;  2ZJP L;  4A5A A;  1MWM A;  1V4S A;  1HKG A;  1IJJ A;  1SQK A;  1X3M A;  1Q86 O;  3IKM A;  2QWL A;  5HL7 L;  5KQ8 A;  4M7Y A;  3M1F A;  2NRR A;  1WUA A;  3R9P A;  1QVF M;  3A5M C;  3CET A;  1VQM N;  3LM2 A;  1SAZ A;  4A57 A;  4BQL A;  3VEZ A;  5KQD A;  4FWS A;  3O08 A;  4IDH A;  2ASM A;  3FZF A;  4CZL A;  3L6Q A;  2QM1 A;  4A2A A;  2FSN A;  3ZET B;  4EHU A;  5AQQ A;  5AQP A;  2VYP A;  2Q2R A;  3FZM A;  1KXP A;  3CJ1 A;  1E4F T;  4HTL A;  5BRE A;  3MWP A;  1NGE A;  1XQS C;  1K73 O;  4CZE A;  3NVK A;  3VEO A;  1VQ7 N;  4NLC A;  4A61 A;  2QWM A;  2VWB A;  5M1O A;  1VQK N;  2E2Q A;  2GWK A;  5LJV A;  3C6H A;  2F7T A;  5BPL A;  2P9L A;  3ULE A;  3SAH A;  2QWQ A;  3RSE B;  4BRA A;  4XH1 A;  5C10 A;  2KLA A;  4FSV A;  1T44 A;  3HRG A;  4A59 A;  4AM7 A;  4DHY A;  1D4X A;  3FZL A;  2ZGZ A;  2F9T A;  4BRL A;  3HZ6 A;  3BUZ B;  3ZX3 A;  4B1V A;  1S22 A;  1LCU A;  2FSK A;  3JS6 A;  3QDK A;  3K9K A;  4M63 C;  3TSQ A;  1YAG A;  3IDH A;  4BR9 A;  4GY2 B;  4JKH A;  3O9Q A;  3EO3 A;  3LDQ A;  1W2B M;  4UY8 O;  4YOX A;  3WEE B;  4CZK A;  4JK9 A;  1H1V A;  2W41 A;  1OKJ A;  1KAX A;  3TU5 A;  1DT9 A;  2QTD A;  3O1W A;  1T6D A;  5LJW A;  5GIN A;  5TKY A;  4BRI A;  3D2E B;  3D7E O;  4QS8 A;  3ENB A;  2WUS A;  2FLO A;  4H0P A;  4JHD B;  5AQH A;  4BRP A;  1VQ6 N;  4MLE A;  5AQW A;  3VEY A;  4FWN A;  4H03 B;  2OTL N;  1YJN N;  3CJ9 A;  4CZM A;  5C15 A;  3D6R A;  5AQS A;  1ZC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...