1CZ9A

Atomic resolution asv integrase core domain (d64n) from citrate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
139
structure length
139
Chain Sequence
QIWQTNFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AVIAN SARCOMA VIRUS INTEGRASE
publication title Atomic resolution structures of the core domain of avian sarcoma virus integrase and its D64N mutant.
pubmed doi rcsb
source organism Avian sarcoma virus
molecule tags Transferase
total genus 51
structure length 139
sequence length 139
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1cz9A00
4OGCA 3TARA 4FJ7A 3I0RA 3L2UA 4E7IA 1W9HA 4FZXC 1KFDA 2P51A 5DK5A 2OPSA 3AVGA 4FK0A 4E1MA 1GOBA 2DTUA 4KB1A 3QETA 3PX0A 1C0TA 1I3AA 4OVLA 4Q5VA 4RW8A 3VQBA 1Z26A 3ZT2A 4RW9A 4Z0UA 4CIEA 2YNIA 4WE1A 5HRPA 4F4KA 3V9UA 3PV8A 3O3GA 4DSLA 4W5OA 5C24A 3SPZA 3BDPA 4FJ9A 4CGDA 3RMDA 1QSYA 3QESA 1QS4A 3DM2A 3PO4A 1VSIA 2Z1GA 4DS4A 2F8TA 5D3GA 3LZIA 1QQCA 1RT6A 3LP0A 3EYZA 4HUEA 3QEXA 4KI6A 5T7BA 3K57A 1HPZA 1VRUA 4CERA 4N56A 4IBNA 4E7LA 2OZMA 4M3YA 4JS4A 1SKSA 1C0UA 1ZBLA 4M41A 3CYMA 4DWIA 3VQEA 1B9DA 2YHAA 3V1QA 4CGJA 3HXMA 4CHOA 4CF8A 5C42A 1YTAA 2D0AA 3ZSWA 4PQUA 3NE6A 3NGZA 4FJJA 4W5TA 2XHBA 3OYJA 4DU3A 1IKVA 3KK3A 3IAYA 4FJ5A 3MEGA 4ZTJA 1TVRA 3DLGA 2GUIA 2FBTA 1KRPA 4KHSA 4CGIA 2ETJA 3AVBA 1S9EA 3WNGA 3SQ2A 4DTUA 4M3UA 5CY4A 3D45A 4QOZB 3SNNA 1BQNA 4CJLA 1A5VA 1RBTA 2Z1JA 3V6DA 3SQ0A 1BISA 5JS2A 1VSEA 3TAGA 4DF8A 4EZ6A 1A5XA 1HQUA 2BE2A 3M8SA 4OLBA 3LAMA 4UQGA 1CZ9A 2YNHA 3C94A 3M8PA 3HL8A 3ZSOA 3K5MA 3RMBA 2P5GA 3HK2A 2DY4A 1JL1A 5KI6A 5J2MA 3CFPA 3ITHA 4G1QA 4Z4EA 3KLHA 4L8RB 2G8IA 4DMNA 1R0AA 4CHPA 1Z25A 4HUFA 4FM0A 1RILA 4OPKA 4KHNA 4KKOA 4JRQA 3KIOA 1BHLA 3T1AA 4M3WA 4GMJB 3VQ7A 1HRHA 4C8OA 1L3VA 4LSNA 3ZT1A 2ZQBA 3G10A 4BE1A 4B8AB 1WAFA 3HYFA 2WONA 3ZT4A 4CK1A 3AVNA 3DLKA 1NKEA 3U3YA 3TABA 4CEBA 5J2PA 5K14A 2IDOA 5SZTA 3OYGA 3F9KA 3TWHA 1U49A 4CEFA 1T8EA 4E89A 1WSHA 4FM2A 2KFZA 2VG5A 1N5YA 3OYFA 3NF7A 3SV4A 4DS5A 2E6MA 3ALYA 4FCYA 3TAMA 5CZ2A 1BI4A 1J9AA 1JLFA 3LP1A 1JL2A 5FRMA 1SKRA 4Y1CA 1RBVA 3AVIA 1TV6A 4Z4IA 1DTTA 1RDCA 1QHTA 1RT5A 4CIFA 1S5JA 3C6TA 4AILC 4M3XA 4KHWA 4YFUA 4JS5A 3S3NA 3K59A 1RCHA 4I9QA 2JLEA 3ISNC 4C8NA 3DI6A 1YTUA 4RW6A 3WNFA 5E41A 4H4OA 1WNSA 4DU1A 4W5QA 3TANA 3SUQA 2YV0X 4BDYA 4DLGA 4DTMA 1QTMA 1NOZA 3IG1A 2G8VA 4FJXA 3HPHA 4O0JA 3MAQA 3L2RA 5I3UA 3DLHA 4CK3A 3AO2A 3NH0A 4C8LA 4FJIA 4PWDA 1Y97A 4KRFA 3NF8A 3KD1E 1TKDA 3VQCA 4IG0A 2B6AA 4I2QA 4OJRA 4CJSA 3HVRA 3PY8A 3C95A 3SV3A 4FVMA 4C8KA 4CJWA 4B9SA 3AA2A 1ZBHA 2IAJA 1B9FA 4O5BA 1IKXA 1C1CA 3OYEA 4BDZA 3PUFA 3OYNA 3OYKA 2FBXA 3L8BA 1HJRA 4CHNA 2FBYA 1UAXA 1VSKA 3KLFA 3T3FA 4OKKA 1L5UA 1NK4A 4MFBA 2IGIA 1C6VA 4DQSA 2DFFA 1WSEA 4GVMA 4MQ3A 2D0CA 3AVFA 4RW4A 1X9WA 4Z4FA 4DFPA 4M42A 4CIGA 1J5OA 4CJ5A 1BCMA 4LH4A 3L3VA 3OYLA 2YKMA 1IO2A 4CECA 5SWMA 4IG3A 4K8XA 4J2DA 4FW1A 1RBUA 1L3UA 1HMVA 3LWLA 4FLVA 1D5AA 4FLXA 1J54A 1KVCA 1NK8A 3V9XA 3V9ZA 4CF2A 3LZJA 4AHSA 5CYQA 3LDSA 2Z1HA 4KHQA 5CYMA 1KFSA 2B5JA 3AO1A 4B8CA 3O3FA 2KZMA 1BQMA 4CHZA 1LW2A 3L3UA 1NJWA 4LSLA 1LW0A 5HLFA 4EP5A 3M8QA 3S3OA 4E7JA 1RTDA 1A5WA 2XO7A 1BL3A 1S1WA 3CQ8A 4BDPA 4E19A 4B9TA 1NK9A 1QSLA 2ATQA 1BIZA 3VQ9A 4FLZA 5J1EA 1JXEA 4B9MA 1HNIA 3JYTA 4PUOA 1JKHA 3CG7A 4M45A 1KVBA 1RTJA 3HP9A 4B9VA 4OKJA 4B9LA 4CEAA 3SUOA 1L3TA 1D8YA 4B9NA 2R7YA 2KW4A 1LAVA 3OS0A 1WSIA 2HW3A 4JRPA 4CJPA 2D5RA 4O4GA 4YNQA 2W42A 3MXMA 3CM6A 3U6FA 4FYDA 3TR8A 4CGFA 4FXDA 4KFBA 4R5PA 3VN5A 3QERA 1RT7A 1RTHA 3RRHA 4CEQA 4CJEA 3UIQA 4NYNA 3AO3A 1TL1A 2XY6A 3QNOA 1CXUA 1KLNA 1DTQA 4FJHA 4CESA 4FJMA 2O4IA 3AVMA 3PX6A 2NUBA 4BWMA 3VQ4A 3DYAA 3MXJA 2F8SA 1RT2A 1YVUA 1VSDA 3VQQA 4JLHA 3OYDA 1U45A 4DQRA 2OYQA 1IKWA 3OYHA 5KGXA 2AJQA 1NKBA 2QK9A 4KTZA 1RDAA 4Q0BA 3OYAA 3QO9A 4H4MA 4AHTA 3QEVA 4NYFA 4O44A 3DRRA 1J53A 1RTIA 1TKTA 2RKIA 4BWJA 3I8DA 3NAEA 2G8HA 4F2SA 2KFNA 4HTUA 4AHRA 3AO4A 1ASUA 1I39A 1S1TA 2EX3A 2G8KA 1TK8A 3AVLA 4CF0A 1IH7A 1TKZA 4KTWA 4DTPA 5HROA 3AA5X 3DRSA 3WNEA 2X6NA 2IC3A 4IFVA 5C25A 3QINA 3DOKA 3HT3A 4CJFA 4CCHA 2KQ2A 5HRRA 1X9MA 1WSFA 4CJRA 1Q9XA 3PO5A 1REVA 1NJYA 4FJ8A 2DFEA 1UOCA 3VQAA 3VQPA 3LPTA 1RDBA 4BACA 4Z4GA 2XY5A 5FRNA 1RDDA 4PA1A 4F2RA 1TAUA 2KTQA 3AVAA 3ASMA 3NCIA 4ELUA 1JLGA 4DFKA 3PX4A 4KTQA 4EP4A 4CFAA 5CZ1A 1WSJA 4HVJA 1VSLA 2XY8A 2JGUA 3V4IA 3NH2A 4E1NA 1XHXA 3TAEA 1IKYA 2IS3A 4ZTFA 4CFBA 1CLQA 4M3TA 3HPGA 1JLCA 4CGHA 3HVTA 3T19A 4DU4A 2Y1IA 2QKKA 2VWJA 3SCXA 3DMJA 1RT1A 1XHZA 1U4BA 2HHWA 4FLTA 4KB0A 1B92A 1ASVA 3TAQA 2YNFA 3P5JA 4IFYA 1QSSA 3EZ5A 4KREA 1TK0A 3ZSZA 2E6LA 2HNZA 2F96A 3CM5A 4CJKA 3KD5E 4IKFA 4KV8A 2HHVA 4I9LA 3NHGA 2PYLA 2X78A 3IRXA 3JSMA 1SV5A 4DSKA 4KO0A 2B4JA 1U48A 3P1GA 3LP3A 2DFHA 4E3SA 1NKCA 3O4QA 3ZSVA 3MXIA 1ZBFA 4Y1DA 3OS1A 3L2WA 3SUPA 1UA0A 4DSJA 1TGOA 1SL0A 4ID5A 4LY7A 4BE0A 3K2PA 3V1OA 3NH1A 3LWMA 4OPJA 3K5NA 5FROA 3KKRA 4ELVA 1VSMA 3VQ8A 4CJ4A 1S6PA 2BGGA 1FKOA 3RR7A 2ZE2A 2A1RA 3QEPA 3ZT3A 1T03A 1TL3A 4EZ9A 2Z1IA 4CFDA 1CZBA 4E7KA 1EETA 1DLOA 3OY9A 3G0ZA 4CEDA 4XIUA 1SL1A 3RWUA 4J2EA 3LALA 4DLEA 4CF9A 4FJNA 1S9GA 2EHGA 2P1JA 1NK7A 2YKNA 4Z4CA 3NF9A 4H8KA 3AVJA 3NF6A 1JLAA 1U04A 3AA4A 4AH9A 2Y1JA 3KTQA 1KTQA 1S1UA 2OPPA 4HUGA 3WNHA 1EP4A 1SKWA 3MEDA 3OYCA 1HYVA 4CE9A 3DLEA 3D0PA 3ZSXA 2VWKA 3QLHA 4IDKA 4CJVA 1GOAA 4HCBA 4F8RA 3VA3A 2GV9A 3B6PA 4FLUA 4Z4HA 4B3OA 2G8FA 1TK5A 4CEEA 3M8RA 4FLYA 1NK0A 2BANA 4PY5A 5HBMA 4DTXA 3AO5A 1RBRA 3B6OA 1XC9A 4B08A 3ZSQA 3HM9A 3BGRA 1NJZA 1FXXA 1Q9YA 2GBZA 4DSEA 3KKSA 1F21A 3OS2A 5KRTA 1QE1A 3TAPA 4B9UA 3KLEA 4J2BA 1ASWA 1VSHA 3QIPA 4ID1A 3SQ1A 3HO1A 1JLBA 1ZBUA 3K5LA 3RTVA 2LSNA 2RN2A 4M3RA 3SZ2A 3NGIA 3MEEA 4LD0A 3OVNA 3QEWA 3RMAA 1C1AA 3K5OA 1L3SA 1KVAA 4QAGA 4RG8A 3OJUA 3LPUA 3V1RA 3KJVA 4W5NA 4FJKA 4NCAA 1S1VA 3AVCA 3DRPA 3NDKA 2X74A 3HPOA 3RR8A 3CFRA 4KHUA 4KPYA 2QXFA 4N76A 4FW2A 3SUNA 3HJFA 2ITGA 2FC0A 3HSTB 5DMRA 1UWBA 4C8MA 1NK5A 3ZSRA 4FZYA 5KGWA 3KLIA 4BE2A 1YT3A 3OYMA 4RW7A 3RRGA 1BI4B 4GW6A 1JXBA 3L2VA 1D9DA 1HYSA 2IOCA 3SQ4A 1HYZA 1MU2A 4FK4A 2ZD1A 3NBPA 1FK9A 2KZZA 4E7HA 1XWLA 4FJGA 2Q3SA 1O1WA 3O3HA 3TAFA 4FJLA 4CK2A 3L2QA 3SPYA 4LH5A 4O55A 2VG6A 1EXQA 2HVIA 2YHBA 3OYIA 4F3TA 5HRNA 3SYZA 2QKBA 3ZSYA 4CFCA 4CJUA 2WOMA 4HHTA 4DTSA 1ZYQA 1D9FA 2RPIA 3SJJA 4FLWA 1SL2A 4DQPA 1RT4A 3KK1A 1HQEA 3SI6A 3I0SA 1VSFA 4I2PA 1WAJA 4DSFA 1TKXA 4DQIA 4DSIA 1G15A 3S3MA 2HHSA 3V81A 1NK6A 3DOLA 2XRIA 4HCCA 3THVA 4FK2A 1BGXT 3DLBA 2FBVA 3ZCMA 4DFMA 4AHUA 5KRSA 1N6QA 4DTNA 1T05A 1CXQA 1LWFA 2HHTA 3HP6A 5HP1A 2P5OA 1EKEA 3AV9A 4NCGA 3VQ5A 5J2NA 2OA8A 4CEZA 4DF4A 1T7PA 5EU7A 5KTQA 3KK2A 1ZBIA 3LAKA 4N47A 3DLRA 1JLQA 3AA3A 3K58A 4E0DA 2HHUA 3OJSA 4QCLA 4FM1A 4CF1A 1IG9A 4ZHRA 5JS1A 2I5JA 3EY1A 3VQDA 3QIOA 2HVHA 2HNDA 2VG7A 2HHQA 4CJ3A 3AVHA 4OLAA 4CGGA 3FFIA 4O0IA 1NOYA 2HNYA 3LANA 3LP2A 3VA0A 4M3ZA 2O4GA 3MECA 4DTJA 3O4NA 2PY5A 1GOCA 3RMCA 5I42A 1SUQA 2HB5A 5FDLA 4F3OA 1JLEA 1C1BA 4K8ZA 3V9SA 1BCOA 1Q8IA 1VSJA 4DFJA 2OPRA 2E4LA 3IS9A 1X1PA 3NFAA 1KLMA 3ULDA 1X9SA 3CFOA 4DTRA 1LV5A 2X6SA 3P83D 1HNVA 2G8WA 1S6QA 1ITGA 3V9WA 1KSPA 3A2FA 1WSGA 4KHYA 1RBSA 3U3GA 1WLJA 4AHCA 1FKPA 4CHQA 3VQ6A 1K6YA 4DQQA 4FZZA 1BIUA 3QEIA 2A1SA 5HRSA 4J2AA 2HHXA 3C6UA 3ZT0A 1XI1A 2HMIA 4CEOA 4W5RA 3E01A 4N41A 2OZSA 1LWCA 2D0BA 1LAWA 3OYBA 2G8UA 3H08A 4OKEA 2OPQA 4NCBA 1RNHA 1W0HA 4N5SA 3QNNA 2XY7A 4ELTA 3KLGA 1C0MA 1KCFA 4KAZA 5J2QA 3S9HA 2PZSA 3F73A 4DTOA 1LWEA 2PYJA 4KI4A 1TAQA 4CHYA 1UA1A 1EX4A 1U47A 4ICLA 4I7FA 4AHVA 2YNGA 3AVKA 4CJQA 4CJTA 4DG1A 3TI0A 2BDPA 1S1XA 1WN7A 2RF2A 1VK0A 1NJXA 1RT3A 4OGEA 3NGYA 1VRTA 4TSXA
chains in the Genus database with same CATH superfamily
4OGCA 3TARA 5ADXA 1W9HA 1BA0A 3AVGA 2DTUA 1GOBA 1WBBA 5TKYA 3AAPA 3LL3A 1VQ9N 1Z26A 4M7YA 4Z0UA 3J7AP 5AQTA 3EEQA 4IZ9A 3PV8A 3BDPA 3SPZA 4FJ9A 1S22A 1QSYA 1QS4A 3PO4A 3O9TA 2F8TA 3LZIA 1VRUA 4AF1A 1VQPN 4IBNA 5JLFA 2OZMA 4M3YA 1DKGD 1RGIA 3MN7A 1B9DA 1GLLO 3A5LC 5AQXA 2VQEK 4CHOA 1VQMN 2D0AA 4FJJA 1M1KO 5AQJA 2GUIA 1VQ6N 1VQLN 3GOIA 4QOZB 3SMPA 1RBTA 3V6DA 5JS2A 1A5XA 3T69A 2NZTA 3KK7A 4XH1A 4UQGA 4FOEA 3M8PA 3RMBA 2P5GA 1R0AA 4HUFA 4KHNA 2KHOA 1X3NA 3T1AA 3VQ7A 1HRHA 5BRHA 4LSNA 4JHDA 1WAFA 3DLKA 4FWMA 3TABA 3LDOA 5K14A 3TWHA 5BRFA 1U49A 1T8EA 4CZJA 1WSHA 2FSKA 4H0YB 3OYFA 4XEIA 4FCYA 1BI4A 3LP1A 1JL2A 5FRMA 3AVIA 4M3XA 1QHTA 1RT5A 3CCRN 2QWRA 4YFUA 4LF9K 2JLEA 3ISNC 4C8NA 3WNFA 1WNSA 3SUQA 2YV0X 1QTMA 4DLGA 3NMUA 1NOZA 4B9QA 3ZYYX 4FJXA 3HPHA 3DLHA 3MCPA 3OHRA 2P9KB 4OJRA 2B6AA 3L0QA 4FVMA 4CJWA 3AA2A 1ZBHA 5BR8K 3OYEA 4BDZA 3AAQA 3MN6A 4DWIA 2EWSA 1UAXA 2FBYA 1L5UA 4CZGA 4JI1K 3A8YA 4Z4GA 4IXCA 1NU0A 3OYLA 3P31A 1IO2A 5SWMA 3WUHA 3CJ9A 3A5OC 3LWLA 1D5AA 1LOTB 4WQ5C 4DV7K 5CYQA 5AQHA 5CYMA 2B5JA 1EWRA 1XNRK 4JKHA 2E5LK 1NGCA 1ZBSA 1LW0A 2I7PA 5AZIA 4JI7K 4E7JA 1A5WA 2XO7A 1S1WA 3PSIA 4E19A 2A41A 3GG4A 5J1EA 1JXEA 1K73O 3OBYA 4I6MA 2A5XA 4B9VA 4CEAA 1D8YA 1WSIA 1OKJA 5C12A 3CCUN 2D5RA 4KH6A 1ZC6A 2QW9A 3D2EB 5IT9O 2VGMA 3U6FA 1OH7A 4FWOA 2BUPA 1YHQN 1IBLK 4FXDA 1RTHA 4CEQA 3UIQA 3AO3A 2XY6A 3THYB 1CXUA 2QA4N 1DTQA 3F5TA 3PX6A 4BRFA 2QXLA 2KLAA 3VF6A 3E9LA 2D4WA 3L4IA 2OTLN 1FW6A 3MXJA 2F8SA 1VSDA 1EWQA 4DQRA 3F2KA 2AJQA 2QWOA 2QM1A 3OYAA 4AHTA 3DRRA 1TKTA 4H0VB 1VQON 2D0OA 1BUPA 1S1TA 3VESA 5H1SQ 3I55N 2UYTA 4DTPA 5HROA 2DPNA 4B3MK 4IFVA 5LMNK 2KQ2A 4CVNE 2DFEA 3G4SN 3VQPA 3LPTA 2XY5A 3FR0A 2KTQA 3AVAA 4ELUA 4DFKA 3HI0A 2O8CA 4HVJA 1QZ5A 4WCEL 3R1XA 3V4IA 3QB0A 1XHXA 4M3TA 3T19A 2Y1IA 2VWJA 3SCXA 1XHZA 2BH1A 4FPAA 4BG8A 1B92A 4KBOA 4IFYA 3EZ5A 4H5VA 4BVPA 2AA4A 1TK0A 4KREA 3SAGA 1IBKK 2P9NB 1H1VA 3IRXA 2B4JA 2P9LA 3P1GA 4E3SA 1NKCA 3LDPA 3ZSVA 3MXIA 3ZX2A 1W2BM 4BE0A 3K2PA 3OTOK 2P9PB 1S6PA 1FKOA 2A40A 3QEPA 1T03A 4X64K 4YOVA 4XIUA 4H5WA 4J2EA 3NF9A 4AH9A 3AVJA 3AA4A 4BGAA 1O13A 2UUCK 1EP4A 1HYVA 2VYPA 3G25A 5M1FA 3D0PA 2Q0RA 1GOAA 2GV9A 2GWKA 1TK5A 4WF9L 5HBMA 3TTFA 3BGRA 1FXXA 1Q9YA 4DSEA 3QBXA 1F21A 3CJCA 1QE1A 3LDLA 4ID1A 4B3RK 3SQ1A 3HO1A 4PL7A 3RTVA 3J8AA 1WOQA 4BRQA 2UU9K 4LD0A 1SAZA 1QVFM 1C1AA 4JKEA 4JHDB 4QAGA 5AQWA 2FF6A 1QVGM 3KJVA 1U2VA 2KKZA 3RR8A 4FL9A 3CFRA 4DV6K 3BUZB 2FC0A 1NK5A 3KLIA 4GY2B 3RRGA 1BI4B 1VQNN 1JXBA 5ELZA 3L2VA 1D9DA 2IOCA 1HYZA 4FK4A 3WQTA 2Q3SA 2PFUA 2O8EB 4MO5A 4KH5A 3O9QA 3D2FA 2YHBA 4F3TA 3UKRA 2QKBA 4CFCA 3AGRA 4HHTA 4J8FA 3SJJA 3KK1A 3P39A 3SI6A 4IOCL 1TKXA 4GKKK 1XNQK 2Q2RA 1ATNA 4CZKA 3LDNA 5M1QA 5GAGP 3THVA 3VF2A 3CJ1A 2FBVA 3ZCMA 1HNWK 4AHUA 5KRSA 2HHTA 1KAXA 3AV9A 4NCGA 3TSUA 5EOYA 3ZX0A 5KTQA 3THWB 4E0DA 2HHUA 1I94K 3BZCA 4QCLA 4ILJA 3PLAA 4CF1A 2QTDA 2W6KA 4ZHRA 4NB4A 2QWLA 2HVHA 2HHQA 1GLCG 3VETA 4O0IA 1NOYA 2HNYA 3LANA 4BRNA 5I42A 1SUQA 4FVUA 1BCOA 4JKDA 3FZKA 4I6MB 3ULEA 2E4LA 4JYAK 3NFAA 2GWJA 3P83D 1S6QA 3ZEUA 3VEYA 4AHCA 1FKPA 1BIUA 3QEIA 2A1SA 4M7XA 1VQ5N 1YXQA 5AQLA 4A57A 4JI4K 4LF4K 4QS9A 2G8UA 4OKEA 4NCBA 4N5SA 3KLGA 1N36K 2V52B 5FLXO 1TAQA 2CGLA 2VGNA 1QQNA 4U7BA 1U47A 2YNGA 3TI0A 4CJQA 1KAYA 3DXMA 3CC7N 3HOTA 4BQZA 3L2UA 1WUAA 2P51A 4FK0A 4E1MA 3QETA 3SBTA 3HZ6A 3WXIA 4RW8A 4RW9A 4JV5K 2QWQA 4WE1A 5HRPA 4BC5A 4DSLA 2YX6A 4CGDA 2HOEA 3QESA 3DM2A 1VSIA 2Z1GA 3DXKB 1C0FA 5D3GA 1QQCA 3LP0A 3EYZA 4KI6A 5T7BA 1MWMA 2QWPA 3K57A 3KWGA 1ESVA 4E7LA 3ATUA 1C0UA 2O8CB 1E4GT 4ILGB 1NG9A 5C42A 4PQUA 1QZ6A 3NE6A 3NGZA 1GLDG 2ASMA 2V7ZA 4W5TA 3OYJA 1M90O 4FJ5A 5F1XA 3AVBA 3WNGA 3SQ2A 4DTUA 4M3UA 4YOUA 4IJNA 2JWKA 4CJLA 1A5VA 3A5NC 3K0SA 4JK8A 3TAGA 3CCVN 3U9ZA 3CPWM 3M8SA 3LAMA 4PKHA 1CZ9A 3C94A 3J7ZO 3HK2A 3MK6A 4KHPK 4Z4EA 3CETA 5BPMA 4FM0A 1GLAG 1RILA 3VENA 4JI0K 3FZFA 3W3DA 4A2BA 1BHLA 1GLJO 5BN8A 3N4PA 4WQ5A 1FJGK 3ZT1A 3G10A 4BE1A 4B8AB 3HYFA 4CK1A 3U3YA 4BRGA 4DHYA 2ZJPL 4CEFA 4C1NI 3QICA 3T1HK 4BRPA 1YI2N 5GIOA 3NF7A 3SV4A 4DS5A 5CZ2A 5E84A 1RBVA 4Z4IA 1TV6A 3VMFB 2WC9A 1DTTA 4B1UB 1T6DA 3VF4A 1KQSM 4H0XB 3DI6A 4ILHA 5E41A 4DU1A 4BDYA 3UKUA 5AQMA 2G8VA 3MAQA 5I3UA 1JCEA 4CK3A 4FJIA 5KPZA 1Y97A 3KD1E 4U67L 3C95A 3GDQA 4BRLA 5AR0A 2P9UB 1B9FA 1IKXA 1C1CA 3WEEA 5AQRA 2FBXA 2RHKA 5C10A 3L8BA 3T3FA 4OKKA 1NK4A 1WSEA 2UXBK 1X9WA 1NGDA 3KHYA 1BCMA 4YHHK 3L3VA 3CQXA 4FWPA 4IG3A 4K8XA 4FW1A 2A6AA 1HMVA 2GEMA 4FLVA 4C8LA 1J54A 1KVCA 2NRHA 3V9XA 3LZJA 3LDSA 4KHQA 3RSEA 3CPEA 4B8CA 1BQMA 4FWLA 1GLBG 4YDUA 3M8QA 5JLHA 5DM7L 3CQ8A 3O8MA 1NK9A 1BIZA 2A42A 3UKRB 4B9MA 2FLOA 3L6QA 1RTJA 2NRVA 4H03B 1L3TA 4B9NA 1LAVA 4CJPA 3FFKB 3CF5L 4O4GA 3CMAN 5TKWA 3CM6A 4NXMK 4FYDA 4WFNL 2NLXA 3GBTA 4CGFA 3SAHA 3PIPL 4LFAK 2I7NA 3QNOA 4FJHA 4IO8A 4CESA 4BR7A 2NUBA 3DYAA 3U9DA 3QMLA 3Q7CA 2P9SA 3QEVA 5BRDA 3NAEA 1J53A 4BWJA 3VEVA 3EL2A 3M3ZA 4HTUA 4AHRA 3CCQN 4LC9B 1I39A 2EX3A 3HTVA 1TK8A 4CF0A 3ID8A 4KTWA 3ULEB 5CHIA 3WNEA 3TSPA 2IC3A 5C25A 4CCHA 3ZEUB 4CJFA 4JD2A 5HRRA 3DJCA 4CJRA 4EHUA 4FWKA 3IDHA 1NGGA 3VQAA 1RDBA 2O8BB 5FRNA 4PA1A 1TAUA 3J80O 1JLGA 4KTQA 4EP4A 4CFAA 5CZ1A 1WSJA 3H3OB 3NH2A 1SS6A 3DWLA 4E1NA 5AJ3K 3Q7BA 4AM6A 4CFBA 1EQYA 1U4BA 3FZLA 4FLTA 3CQYA 1ASVA 3TAQA 1V4TA 2OCEA 3VTHA 2HNZA 2F96A 3CM5A 4CJKA 3KD5E 1DT9A 3NHGA 4IWVA 3JSMA 4DSKA 4KO0A 1U48A 3LP3A 1OVYA 3MN5A 4Y1DA 1HNZK 3SUPA 1UA0A 1TGOA 1SL0A 4ID5A 3ZX3A 4EIAA 3NH1A 3HM8A 3TSQA 4OPJA 1VSMA 1YUWA 4CJ4A 3CJ7A 4BR9A 2ZE2A 2Z1IA 3MN9A 4CFDA 3CMEN 4DUYK 3OY9A 1SL1A 4L3QA 3LALA 3CCJN 2HBKA 2YKNA 4Z4CA 3PY8A 4H8KA 1U04A 1Q81O 2V51B 4JN4A 1S1UA 2OPPA 5FPMA 4HUGA 2O8FA 4RCHA 3OYCA 2E1ZA 2QWNA 4IDKA 1E4FT 4M63C 4BG9A 4BREA 5M1NA 5BR9A 4FLUA 2O8DA 4PY5A 2BANA 4DTXA 5JMVA 3H46O 4B08A 3EO3A 3KKSA 4J2BA 3AARA 3KLEA 1ASWA 1VSHA 3IFRA 3K5LA 2RN2A 3QEWA 3RMAA 1X3MA 4PKGA 2CGKA 5EVZA 4RG8A 3OJUA 5BPLA 1BU6O 2D0PA 3ZETB 4X62K 3HPOA 3R8EA 3ENOA 3HJFA 2ITGA 1KC8O 1NGAA 4C8MA 3ZSRA 2BTFA 1YT3A 4BE2A 1ILYA 1HYSA 3QDKA 3THXB 3IUCA 3NBPA 1OH5A 4IEEA 4FJGA 4CK2A 2FSJA 3SPYA 4LH5A 4O55A 2VG6A 4BRMA 3OYIA 3SYZA 4DV2K 4LF8K 2WOMA 4DTSA 2VCPA 1ZYQA 1S3XA 4H0PA 1VHXA 4DQIA 1VSFA 2VQFK 3WEEB 1G15A 3ID6A 3S3MA 2HHSA 3V81A 3DOLA 2WTUA 1BGXT 4H0TB 1CXQA 4JKGB 5AQYA 3HP6A 1T05A 1OH8A 3BF3A 2P5OA 5J2NA 5AZJB 3VQ5A 4CEZA 4DF4A 3IMXA 3WXJA 3KK2A 1R59O 3LAKA 4ISFA 4JK7A 3CCSN 4FM1A 4B1WB 4CBXA 2A3ZA 3EY1A 3VQDA 2VG7A 3RSEB 4OLAA 5KPRA 3LP2A 2GELA 3A5MC 4CBUA 3AY9A 5GADP 3MECA 3O4NA 4BC3A 2W41A 2HB5A 1JLEA 1C1BA 3V9SA 4DFJA 3SJHA 1X1PA 1X9SA 3CFOA 2X6SA 4LFBK 1KXPA 5M1OA 3TTCA 4YOWA 1WSGA 3CI5A 1K6YA 4DQQA 1J6ZA 4IOXA 4J2AA 3OW2M 1N33K 3E01A 2Q1NA 1YIJN 1LAWA 3OYBA 3H08A 3TU5A 2OPQA 1RNHA 3QNNA 2XY7A 4ELTA 4MDBA 3BEXA 4X65K 2WFBA 4ICLA 4I7FA 5LJWA 3M5RA 4DG1A 4CJTA 1NJXA 3NGYA 1U6ZA 4TSXA 4FJ7A 1XUPO 3JS6A 2P9SB 3G6EN 1QQOA 3C65A 1KFDA 5DK5A 2OPSA 3DLLL 4FO0A 1NGBA 4JKBA 4KB1A 4A5AA 3PX0A 1C0TA 4OVLA 3VQBA 4CIEA 3EKUA 2YNIA 4F4KA 3O3GA 5C24A 3JAMO 2IVPA 4CZFA 5DM6L 1V4SA 4DS4A 5BN9A 2UXDK 4IDHA 1BDGA 1YJNN 3PSFA 1HPZA 2CH5A 5AQIA 2NRXA 1SKSA 1X9JA 4M41A 3CYMA 1TUUA 3VQEA 2J4RA 3MMVA 3HXMA 5C0YA 4CF8A 4RTFD 4IOAL 1XMOK 1NMNA 1SQKA 2F9WA 2XHBA 3IAYA 2GTDA 3MEGA 1KRPA 2FBTA 4GNIA 4KHSA 2ETJA 1YJ9N 1S9EA 5CY4A 3D45A 3SNNA 1BQNA 2Z1JA 4A62A 1BISA 1VSEA 3A0IX 4DF8A 2BE2A 1Q7YO 3VOVA 2YNHA 2GUPA 3HL8A 1IJJA 2W6LA 5GAHP 1JL1A 5J2MA 1MWKA 3CFPA 5KQ8A 3KLHA 4L8RB 2G8IA 4DMNA 1Z25A 2HBJA 2ZGZA 4OPKA 1ATSA 3BF1A 4JKAA 1P90A 4M3WA 3H45C 3U4LA 4C8OA 1EO1A 1L3VA 2ZQBA 1KD1O 3H1QA 3AVNA 1NKEA 1ZXOA 3OYGA 3F9KA 4JI2K 3TPQA 4E89A 2KFZA 1N5YA 4DV0K 4FWNA 5AZIB 4CJ7A 4DUZK 1J9AA 4NO7A 1SKRA 2E2QA 1GLEG 4AILC 4CIFA 3C6TA 4KHWA 4JS5A 3S3NA 3K59A 1RCHA 5C2DA 3NVKA 5MLCQ 1YTUA 4RW6A 4W5QA 3IG1A 5CR4A 4O0JA 1T44A 3L2RA 3AO2A 3NH0A 4PWDA 1TKDA 3VEZA 4CJSA 3HVRA 4I2QA 3CCEN 4B3SK 5HL7L 4CBWA 4Y0WA 4B9SA 4B1YB 4BY9C 2F9TA 4O5BA 3LM2A 3OYKA 3O1BA 3OYNA 3HSCA 4FZXC 1HJRA 2ZJRL 1VSKA 3KLFA 2E2NA 2IGIA 3CIPA 1C6VA 4JI8K 4MQ3A 4RW4A 3AVFA 4Z4FA 1VAZA 1J5OA 4CJ5A 1NLVA 2ZWHA 4LH4A 5BPNA 1YITN 3F9MA 1HUXA 1L3UA 3VGMA 4FLXA 4CF2A 4AHSA 3VEOA 4JI3K 2PBDA 3GE1A 2FXUA 2F4VK 5HLFA 4EP5A 3S3OA 1BL3A 4BDPA 4LFCK 1QSLA 2ATQA 3VQ9A 4FLZA 2HSTA 1HNIA 4CD1A 1KVBA 4B9LA 4OKJA 3SUOA 2KW4A 3OS0A 5AQOA 2HW3A 4A59A 4R79A 3O9UA 4JRPA 4YNQA 4CZIA 3MXMA 1J5EK 2P9KA 1Q18A 3TR8A 4R5PA 3VN5A 3QERA 1RT7A 3RRHA 4NYNA 4IFEA 5AQFA 4FJMA 2O4IA 3AVMA 4BWMA 3VQ4A 4CI6A 1RT2A 1YVUA 3VERA 4JLHA 4YORA 2OYQA 3H3NO 5KGXA 1BWFO 2QK9A 4WYBA 4Q0BA 4MLHA 2P9LB 4H4MA 4O44A 1DEJA 1RTIA 2KFNA 2RKIA 1S72N 1NGJA 4F2SA 3AO4A 1TKZA 4JKCA 3K9JA 3AA5X 3WXLA 3DRSA 3DOKA 4BR5A 3HT3A 2CH6A 1CZAN 1HKCA 2YJFA 1X9MA 1WSFA 2E1YA 3E9PA 1K8AO 1Q9XA 3PO5A 1W97L 1UOCA 2HBLA 1HKGA 4BROA 1RDDA 2ITMA 4F2RA 3ASMA 3NCIA 4YOXA 4DR7K 3CERA 1TUYA 4BRHA 2HHHK 4IEIA 1CLQA 3HPGA 1JLCA 3HVTA 4DU4A 2QKKA 2OANA 4PKIA 5I9EB 3DMJA 1RT1A 2HHWA 2YNFA 3C7NA 3P5JA 1N32K 1QSSA 4YOTA 3CD6N 4BRCA 3WT0A 4MDAA 1P8ZA 1SV5A 4DKWA 4LF5K 4F9OA 4YOYA 1SZ2A 1ZBFA 3W0LA 3OS1A 4DSJA 3CHWA 3QFUA 5EX5A 2QEXN 4LY7A 3V1OA 1HJOA 3LWMA 1K9MO 4BGBA 5FROA 4ELVA 1Q82O 1U2VB 4MLEA 3MWPA 5F2RA 3FGUA 1IG8A 1N34K 2A1RA 3CCMN 1TL3A 5EXWA 1EETA 1DLOA 3G0ZA 3H1VX 3RWUA 4FJNA 3SMSA 1T3VA 1NK7A 4WFAL 4M42A 1JLAA 1N8RO 2H3GX 2YCHA 3RVCA 3PIOL 3MEDA 4QS7A 3DLEA 3MCAB 3ZSXA 5M1KA 4HCBA 3D2FB 1Z05A 5FPDA 4B3OA 3KZBA 2G8FA 4CEEA 1Y64A 3M8RA 1NK0A 4DR5K 3B6OA 2HBMA 3ZSQA 3HM9A 1NJZA 2GBZA 2P9NA 4BR4A 4B9UA 3TAPA 4A5BA 4EAHD 1JLBA 1ZBUA 2LSNA 4BC2A 4NXNK 2YI1A 4M3RA 3SZ2A 3NGIA 3MEEA 5BREA 3OVNA 5KQDA 4JKFA 3K5OA 3NVMA 4C1NK 2P9PA 3WQUA 3LPUA 3V1RA 3T1YK 4W5NA 2IIRA 3AVCA 3NDKA 3SLCA 4OX9K 4KPYA 4FW2A 5LL6Z 3BZKA 5AQKA 3HSTB 5DMRA 1UWBA 4FZYA 1TYQA 4K41A 3I56N 4GW6A 3O80A 5IWAK 3SQ4A 1MU2A 5C15A 4DR3K 4FWQA 4CZHA 4E7HA 3CJAA 5AQZA 1O1WA 3O3HA 3J7YP 3TAFA 4LF7K 3L2QA 2E2PA 2YHXA 1HLUA 2Q36A 4DV4K 3ZSYA 3J81O 1XQSC 3GL1A 1RT4A 2ZGYA 3I0SA 4DSFA 4I2PA 1HPMA 1NK6A 1HKBA 2XRIA 3HRGA 4HTLA 1N6QA 4DTNA 2OA8A 3UB5A 3DXMB 3FE1A 1ZBIA 4K42A 4N47A 3DLRA 1JLQA 3K58A 3OJSA 4DB3A 1MDUB 3O4WA 1IG9A 5JS1A 4CJ3A 3AVHA 3FZMA 2HF3A 5AQSA 4AM7A 3C0BA 4M3ZA 1C0GA 2ASPA 2O4GA 2PY5A 3VEWA 3HBTA 5FDLA 5GIPA 1RDUA 2HF4A 1JCGA 5AQQA 2OPRA 3IS9A 2O8EA 4DTRA 1IV0A 4NLCA 1LV5A 1HNVA 2G8WA 1KSPA 4Z94A 1RBSA 4FZZA 4CZMA 1XI1A 1ATRA 3VTIA 4CEOA 1K8KA 4N41A 1LWCA 2D0BA 4BRAA 1IBMK 4K25A 1W0HA 3EN9A 1C0MA 1KCFA 4DTOA 1LWEA 5FPEA 3LDQA 1UA1A 1EX4A 4AHVA 3AVKA 2BDPA 1WN7A 2QI2A 1KAZA 1RT3A 3EKSA 4OPHA 1BA1A 1VRTA 3THWA 3I0RA 4E7IA 4DV3K 3K9KA 1E3MA 1I3AA 3C6HA 4BRKA 1G99A 3S41A 4Q5VA 3ZT2A 2WUSA 3HOSA 3V9UA 1W7AA 4W5OA 3SBGA 2D1KA 3RMDA 2Q0UA 4BQLA 4BVOA 4JNEA 5C2FA 1NGEA 4UY8O 3MX5A 3B8AX 1RT6A 3OBWA 4HUEA 3QEXA 1WBDA 1HNXK 4N56A 4CERA 3WXMB 5CE3A 4H5RA 4JS4A 1ZBLA 3V1QA 2YHAA 4CGJA 3C6AA 1YTAA 2CGJA 3KVGA 3ZSWA 3CXCM 2JWLA 1JCFA 2NRWA 5LY3A 4DU3A 1IKVA 3KK3A 4JK9A 2NRTA 4ZTJA 4AQYK 1TVRA 3DLGA 1NJIO 4CGIA 5A2QO 3DAWA 4IO9L 4DR4K 3C7NB 2E88A 3UKUB 1DGKN 3SQ0A 4EZ6A 4FPBA 1HQUA 3IKMA 4OLBA 2QWMA 3QBWA 3K5MA 3ZSOA 4FSVA 4G9ZA 4WQ4C 2DY4A 2YHWA 5KI6A 2ZM6K 3ITHA 4G1QA 4CHPA 2GX9A 4KKOA 4JRQA 3KIOA 4H5NA 4PHTX 3FLCO 4YDUC 4GMJB 3CC2N 3DXKA 4O8KA 4K0KK 2NRZA 2WONA 3ZT4A 3UE5A 3MWTA 4CEBA 5J2PA 2IDOA 5SZTA 4FM2A 4BRIA 1NWKA 2VG5A 2E6MA 3ALYA 3R3LA 3TAMA 1JLFA 4XH4A 4Y1CA 1RDCA 2P9IA 3D6RA 1S5JA 3R6MA 4I9QA 3M6GA 3N4QA 4H4OA 3TANA 4DTMA 4BC4A 4HWIA 3VPZA 3E66A 1BOTO 4KRFA 3NF8A 3VQCA 4IG0A 4DQ8A 3CJBA 3SV3A 2NNWA 4C8KA 2IAJA 4E1JA 5AQPA 4JAXA 3PUFA 4CHNA 4OO1J 2YHYA 4MFBA 3ZLJA 4DQSA 2DFFA 4GVMA 2D0CA 2UXCK 4DFPA 1XMQK 4LF6K 2PAVA 4DCHA 4CIGA 2YKMA 4CECA 4J2DA 1RBUA 3R9PA 2F7TA 1NK8A 1TYQB 3V9ZA 1QQMA 1YVNA 3LM9A 2Z1HA 1KFSA 3O3FA 3AO1A 5FPNA 2KZMA 4CHZA 1LW2A 3L3UA 1NJWA 4RWTA 4LSLA 3I33A 1RTDA 4O8UA 4NLBA 4B9TA 4JD2B 2UUBK 2E20A 4YY3K 3JYTA 4PUOA 1JKHA 3CG7A 4M45A 3VGKA 3HP9A 4A2AA 3KWIA 2R7YA 3BP8A 1VQ4N 2UUAK 4PL8A 3T7ZA 2W42A 3ENBA 4KFBA 3O08A 2P9UA 4CJEA 3O9SA 1RDWX 1YF5L 1TL1A 3MDQA 3VEXA 1KLNA 2AP1A 1NNEA 4GV9A 4B1XB 1YAGA 4DR1K 1BO5O 4JI6K 3VQQA 3OYDA 3BY5A 1U45A 1IKWA 3OYHA 5JICA 1NKBA 4KTZA 1RDAA 3TTDA 3QO9A 4MO4A 4NYFA 3O9RA 3I8DA 2G8HA 3EZWA 4BR0A 4A61A 2G8KA 1ASUA 1WB9A 3AVLA 3M1FA 1IH7A 5AQVA 2X6NA 3QINA 4ISEA 4BR2A 5GINA 3D7EO 5F0XA 1REVA 1NGHA 1NJYA 4FJ8A 2ZJQL 1K8KB 4GV6A 4BACA 3O6WA 1MA9B 3PX4A 1NGFA 2O8FB 2IVNA 3WXKA 1VSLA 2XY8A 2JGUA 3SK3A 3TAEA 1IKYA 2IS3A 4ZTFA 1OH6A 4CGHA 2O8DB 3P38A 4CD3A 4KB0A 1NMDA 2Q31A 4DV5K 3ZSZA 2E6LA 2ZF5O 4IKFA 4KV8A 2HHVA 4I9LA 5LMUK 2PYLA 2X78A 3EE9A 5AQUA 2DFHA 3O4QA 3L2WA 5JVGL 2YJEA 3QFPA 4O5FA 3K5NA 2FSNA 3KKRA 4B1VA 3VQ8A 5EY4A 2BGGA 1BG3A 3RR7A 1NGIA 1HX1A 3ZT3A 4B1ZA 4EZ9A 4V19S 4X66K 1CZBA 4E7KA 2E2OA 4CEDA 4K43A 4DLEA 4CF9A 2O8BA 1S9GA 2EHGA 2P1JA 4C23A 3KTQA 3O5BA 3NF6A 2Y1JA 5M1PA 1XC3A 1Z6RA 1KTQA 1YJWN 3WNHA 1SKWA 4OPAA 4CE9A 4FWRA 2RE2A 2VWKA 4QS8A 3QLHA 4H0OA 2W40A 4CJVA 3CCLN 4F8RA 3VA3A 3B6PA 4KH4A 4H5TA 4Z4HA 1NM1A 2WBNA 4FLYA 1XC9A 3AO5A 1RBRA 3OA9A 4FWSA 3OS2A 5KRTA 5GAEP 5HOOA 4WFBL 3SAFA 3QIPA 1T6CA 4CZLA 4GVEA 5AQGA 1VQ7N 1L3SA 4JI5K 1KVAA 1Q86O 3JXUA 4FJKA 3E1YA 4NCAA 1S1VA 3DRPA 2FF3B 2X74A 2VWBA 4KHUA 1VQ8N 2QXFA 4N76A 3SUNA 4EFHA 2HMPA 2OTJN 1D4XA 5E26A 5KGWA 4DV1K 3OYMA 4RW7A 2E8AA 3E9OA 2IVOA 2P9IB 2ZD1A 1FK9A 2KZZA 3ENHA 1XWLA 2V7YA 4FJLA 5B8HA 1GLFO 3P4IA 1EXQA 2HVIA 4B3TK 5HRNA 4CJUA 3FZHA 4GV3A 1D9FA 2RPIA 4DQPA 4FLWA 1SL2A 1HQEA 4CZEA 1WAJA 4DSIA 3D2EA 4HCCA 4FK2A 3DLBA 3EE8A 3AGKA 4DFMA 1LWFA 5HP1A 1EKEA 1T7PA 5EU7A 3THYA 3CC4N 1NBWA 3AA3A 3L4QA 3ZETA 5KPTA 2I5JA 5AFUH 3QIOA 1RFQA 2Q97A 2HNDA 4IJAA 4CGGA 3FFIA 3VA0A 2ASOA 4GKJK 4XH5A 4DTJA 3ATVA 3H6EA 4JEPA 4EHTA 5AFUA 1GOCA 3RMCA 1HR0K 4F3OA 3THXA 4K8ZA 3MX2A 1Q8IA 1VSJA 4DR2K 5AQNA 4ISGA 1KLMA 3ULDA 3O1WA 4DR6K 1ITGA 3V9WA 3A2FA 4KHYA 4BRDA 3U3GA 1WLJA 4CHQA 3I8BA 3VQ6A 1QHAA 5HRSA 5JVHL 3C6UA 3U8XA 3ZT0A 2HMIA 2HHXA 4W5RA 2NRRA 3VGLA 2OZSA 5LJVA 1JJ2M 4KAZA 5J2QA 3S9HA 2PZSA 3F73A 2PYJA 4KI4A 4CHYA 4CW7B 1VQKN 1LCUA 1OVQA 3G71N 4JKGA 5ADXH 5AZJA 1S1XA 2RF2A 1VK0A 4OGEA 4FOIA 4WQ4A
chains in the Genus database with same CATH topology
4OGCA 3TARA 4FJ7A 3I0RA 3L2UA 4E7IA 1W9HA 4FZXC 1KFDA 2P51A 5DK5A 2OPSA 3AVGA 4FK0A 4E1MA 1GOBA 2DTUA 4KB1A 3QETA 3PX0A 1C0TA 1I3AA 4OVLA 4Q5VA 4RW8A 3VQBA 1Z26A 3ZT2A 4RW9A 4Z0UA 4CIEA 2YNIA 4WE1A 5HRPA 4F4KA 3V9UA 3PV8A 3O3GA 4DSLA 4W5OA 5C24A 3SPZA 3BDPA 4FJ9A 4CGDA 3RMDA 1QSYA 3QESA 1QS4A 3DM2A 3PO4A 1VSIA 2Z1GA 4DS4A 2F8TA 5D3GA 3LZIA 1QQCA 1RT6A 3LP0A 3EYZA 4HUEA 3QEXA 4KI6A 5T7BA 3K57A 1HPZA 1VRUA 4CERA 4N56A 4IBNA 4E7LA 2OZMA 4M3YA 4JS4A 1SKSA 1C0UA 1ZBLA 4M41A 3CYMA 4DWIA 3VQEA 1B9DA 2YHAA 3V1QA 4CGJA 3HXMA 4CHOA 4CF8A 5C42A 1YTAA 2D0AA 3ZSWA 4PQUA 3NE6A 3NGZA 4FJJA 4W5TA 2XHBA 3OYJA 4DU3A 1IKVA 3KK3A 3IAYA 4FJ5A 3MEGA 4ZTJA 1TVRA 3DLGA 2GUIA 2FBTA 1KRPA 4KHSA 4CGIA 2ETJA 3AVBA 1S9EA 3WNGA 3SQ2A 4DTUA 4M3UA 5CY4A 3D45A 4QOZB 3SNNA 1BQNA 4CJLA 1A5VA 1RBTA 2Z1JA 3V6DA 3SQ0A 1BISA 5JS2A 1VSEA 3TAGA 4DF8A 4EZ6A 1A5XA 1HQUA 2BE2A 3M8SA 4OLBA 3LAMA 4UQGA 1CZ9A 2YNHA 3C94A 3M8PA 3HL8A 3ZSOA 3K5MA 3RMBA 2P5GA 3HK2A 2DY4A 1JL1A 5KI6A 5J2MA 3CFPA 3ITHA 4G1QA 4Z4EA 3KLHA 4L8RB 2G8IA 4DMNA 1R0AA 4CHPA 1Z25A 4HUFA 4FM0A 1RILA 4OPKA 4KHNA 4KKOA 4JRQA 3KIOA 1BHLA 3T1AA 4M3WA 4GMJB 3VQ7A 1HRHA 4C8OA 1L3VA 4LSNA 3ZT1A 2ZQBA 3G10A 4BE1A 4B8AB 1WAFA 3HYFA 2WONA 3ZT4A 4CK1A 3AVNA 3DLKA 1NKEA 3U3YA 3TABA 4CEBA 5J2PA 5K14A 2IDOA 5SZTA 3OYGA 3F9KA 3TWHA 1U49A 4CEFA 1T8EA 4E89A 1WSHA 4FM2A 2KFZA 2VG5A 1N5YA 3OYFA 3NF7A 3SV4A 4DS5A 2E6MA 3ALYA 4FCYA 3TAMA 5CZ2A 1BI4A 1J9AA 1JLFA 3LP1A 1JL2A 5FRMA 1SKRA 4Y1CA 1RBVA 3AVIA 1TV6A 4Z4IA 1DTTA 1RDCA 1QHTA 1RT5A 4CIFA 1S5JA 3C6TA 4AILC 4M3XA 4KHWA 4YFUA 4JS5A 3S3NA 3K59A 1RCHA 4I9QA 2JLEA 3ISNC 4C8NA 3DI6A 1YTUA 4RW6A 3WNFA 5E41A 4H4OA 1WNSA 4DU1A 4W5QA 3TANA 3SUQA 2YV0X 4BDYA 4DLGA 4DTMA 1QTMA 1NOZA 3IG1A 2G8VA 4FJXA 3HPHA 4O0JA 3MAQA 3L2RA 5I3UA 3DLHA 4CK3A 3AO2A 3NH0A 4C8LA 4FJIA 4PWDA 1Y97A 4KRFA 3NF8A 3KD1E 1TKDA 3VQCA 4IG0A 2B6AA 4I2QA 4OJRA 4CJSA 3HVRA 3PY8A 3C95A 3SV3A 4FVMA 4C8KA 4CJWA 4B9SA 3AA2A 1ZBHA 2IAJA 1B9FA 4O5BA 1IKXA 1C1CA 3OYEA 4BDZA 3PUFA 3OYNA 3OYKA 2FBXA 3L8BA 1HJRA 4CHNA 2FBYA 1UAXA 1VSKA 3KLFA 3T3FA 4OKKA 1L5UA 1NK4A 4MFBA 2IGIA 1C6VA 4DQSA 2DFFA 1WSEA 4GVMA 4MQ3A 2D0CA 3AVFA 4RW4A 1X9WA 4Z4FA 4DFPA 4M42A 4CIGA 1J5OA 4CJ5A 1BCMA 4LH4A 3L3VA 3OYLA 2YKMA 1IO2A 4CECA 5SWMA 4IG3A 4K8XA 4J2DA 4FW1A 1RBUA 1L3UA 1HMVA 3LWLA 4FLVA 1D5AA 4FLXA 1J54A 1KVCA 1NK8A 3V9XA 3V9ZA 4CF2A 3LZJA 4AHSA 5CYQA 3LDSA 2Z1HA 4KHQA 5CYMA 1KFSA 2B5JA 3AO1A 4B8CA 3O3FA 2KZMA 1BQMA 4CHZA 1LW2A 3L3UA 1NJWA 4LSLA 1LW0A 5HLFA 4EP5A 3M8QA 3S3OA 4E7JA 1RTDA 1A5WA 2XO7A 1BL3A 1S1WA 3CQ8A 4BDPA 4E19A 4B9TA 1NK9A 1QSLA 2ATQA 1BIZA 3VQ9A 4FLZA 5J1EA 1JXEA 4B9MA 1HNIA 3JYTA 4PUOA 1JKHA 3CG7A 4M45A 1KVBA 1RTJA 3HP9A 4B9VA 4OKJA 4B9LA 4CEAA 3SUOA 1L3TA 1D8YA 4B9NA 2R7YA 2KW4A 1LAVA 3OS0A 1WSIA 2HW3A 4JRPA 4CJPA 2D5RA 4O4GA 4YNQA 2W42A 3MXMA 3CM6A 3U6FA 4FYDA 3TR8A 4CGFA 4FXDA 4KFBA 4R5PA 3VN5A 3QERA 1RT7A 1RTHA 3RRHA 4CEQA 4CJEA 3UIQA 4NYNA 3AO3A 1TL1A 2XY6A 3QNOA 1CXUA 1KLNA 1DTQA 4FJHA 4CESA 4FJMA 2O4IA 3AVMA 3PX6A 2NUBA 4BWMA 3VQ4A 3DYAA 3MXJA 2F8SA 1RT2A 1YVUA 1VSDA 3VQQA 4JLHA 3OYDA 1U45A 4DQRA 2OYQA 1IKWA 3OYHA 5KGXA 2AJQA 1NKBA 2QK9A 4KTZA 1RDAA 4Q0BA 3OYAA 3QO9A 4H4MA 4AHTA 3QEVA 4NYFA 4O44A 3DRRA 1J53A 1RTIA 1TKTA 2RKIA 4BWJA 3I8DA 3NAEA 2G8HA 4F2SA 2KFNA 4HTUA 4AHRA 3AO4A 1ASUA 1I39A 1S1TA 2EX3A 2G8KA 1TK8A 3AVLA 4CF0A 1IH7A 1TKZA 4KTWA 4DTPA 5HROA 3AA5X 3DRSA 3WNEA 2X6NA 2IC3A 4IFVA 5C25A 3QINA 3DOKA 3HT3A 4CJFA 4CCHA 2KQ2A 5HRRA 1X9MA 1WSFA 4CJRA 1Q9XA 3PO5A 1REVA 1NJYA 4FJ8A 2DFEA 1UOCA 3VQAA 3VQPA 3LPTA 1RDBA 4BACA 4Z4GA 2XY5A 5FRNA 1RDDA 4PA1A 4F2RA 1TAUA 2KTQA 3AVAA 3ASMA 3NCIA 4ELUA 1JLGA 4DFKA 3PX4A 4KTQA 4EP4A 4CFAA 5CZ1A 1WSJA 4HVJA 1VSLA 2XY8A 2JGUA 3V4IA 3NH2A 4E1NA 1XHXA 3TAEA 1IKYA 2IS3A 4ZTFA 4CFBA 1CLQA 4M3TA 3HPGA 1JLCA 4CGHA 3HVTA 3T19A 4DU4A 2Y1IA 2QKKA 2VWJA 3SCXA 3DMJA 1RT1A 1XHZA 1U4BA 2HHWA 4FLTA 4KB0A 1B92A 1ASVA 3TAQA 2YNFA 3P5JA 4IFYA 1QSSA 3EZ5A 4KREA 1TK0A 3ZSZA 2E6LA 2HNZA 2F96A 3CM5A 4CJKA 3KD5E 4IKFA 4KV8A 2HHVA 4I9LA 3NHGA 2PYLA 2X78A 3IRXA 3JSMA 1SV5A 4DSKA 4KO0A 2B4JA 1U48A 3P1GA 3LP3A 2DFHA 4E3SA 1NKCA 3O4QA 3ZSVA 3MXIA 1ZBFA 4Y1DA 3OS1A 3L2WA 3SUPA 1UA0A 4DSJA 1TGOA 1SL0A 4ID5A 4LY7A 4BE0A 3K2PA 3V1OA 3NH1A 3LWMA 4OPJA 3K5NA 5FROA 3KKRA 4ELVA 1VSMA 3VQ8A 4CJ4A 1S6PA 2BGGA 1FKOA 3RR7A 2ZE2A 2A1RA 3QEPA 3ZT3A 1T03A 1TL3A 4EZ9A 2Z1IA 4CFDA 1CZBA 4E7KA 1EETA 1DLOA 3OY9A 3G0ZA 4CEDA 4XIUA 1SL1A 3RWUA 4J2EA 3LALA 4DLEA 4CF9A 4FJNA 1S9GA 2EHGA 2P1JA 1NK7A 2YKNA 4Z4CA 3NF9A 4H8KA 3AVJA 3NF6A 1JLAA 1U04A 3AA4A 4AH9A 2Y1JA 3KTQA 1KTQA 1S1UA 2OPPA 4HUGA 3WNHA 1EP4A 1SKWA 3MEDA 3OYCA 1HYVA 4CE9A 3DLEA 3D0PA 3ZSXA 2VWKA 3QLHA 4IDKA 4CJVA 1GOAA 4HCBA 4F8RA 3VA3A 2GV9A 3B6PA 4FLUA 4Z4HA 4B3OA 2G8FA 1TK5A 4CEEA 3M8RA 4FLYA 1NK0A 2BANA 4PY5A 5HBMA 4DTXA 3AO5A 1RBRA 3B6OA 1XC9A 4B08A 3ZSQA 3HM9A 3BGRA 1NJZA 1FXXA 1Q9YA 2GBZA 4DSEA 3KKSA 1F21A 3OS2A 5KRTA 1QE1A 3TAPA 4B9UA 3KLEA 4J2BA 1ASWA 1VSHA 3QIPA 4ID1A 3SQ1A 3HO1A 1JLBA 1ZBUA 3K5LA 3RTVA 2LSNA 2RN2A 4M3RA 3SZ2A 3NGIA 3MEEA 4LD0A 3OVNA 3QEWA 3RMAA 1C1AA 3K5OA 1L3SA 1KVAA 4QAGA 4RG8A 3OJUA 3LPUA 3V1RA 3KJVA 4W5NA 4FJKA 4NCAA 1S1VA 3AVCA 3DRPA 3NDKA 2X74A 3HPOA 3RR8A 3CFRA 4KHUA 4KPYA 2QXFA 4N76A 4FW2A 3SUNA 3HJFA 2ITGA 2FC0A 3HSTB 5DMRA 1UWBA 4C8MA 1NK5A 3ZSRA 4FZYA 5KGWA 3KLIA 4BE2A 1YT3A 3OYMA 4RW7A 3RRGA 1BI4B 4GW6A 1JXBA 3L2VA 1D9DA 1HYSA 2IOCA 3SQ4A 1HYZA 1MU2A 4FK4A 2ZD1A 3NBPA 1FK9A 2KZZA 4E7HA 1XWLA 4FJGA 2Q3SA 1O1WA 3O3HA 3TAFA 4FJLA 4CK2A 3L2QA 3SPYA 4LH5A 4O55A 2VG6A 1EXQA 2HVIA 2YHBA 3OYIA 4F3TA 5HRNA 3SYZA 2QKBA 3ZSYA 4CFCA 4CJUA 2WOMA 4HHTA 4DTSA 1ZYQA 1D9FA 2RPIA 3SJJA 4FLWA 1SL2A 4DQPA 1RT4A 3KK1A 1HQEA 3SI6A 3I0SA 1VSFA 4I2PA 1WAJA 4DSFA 1TKXA 4DQIA 4DSIA 1G15A 3S3MA 2HHSA 3V81A 1NK6A 3DOLA 2XRIA 4HCCA 3THVA 4FK2A 1BGXT 3DLBA 2FBVA 3ZCMA 4DFMA 4AHUA 5KRSA 1N6QA 4DTNA 1T05A 1CXQA 1LWFA 2HHTA 3HP6A 5HP1A 2P5OA 1EKEA 3AV9A 4NCGA 3VQ5A 5J2NA 2OA8A 4CEZA 4DF4A 1T7PA 5EU7A 5KTQA 3KK2A 1ZBIA 3LAKA 4N47A 3DLRA 1JLQA 3AA3A 3K58A 4E0DA 2HHUA 3OJSA 4QCLA 4FM1A 4CF1A 1IG9A 4ZHRA 5JS1A 2I5JA 3EY1A 3VQDA 3QIOA 2HVHA 2HNDA 2VG7A 2HHQA 4CJ3A 3AVHA 4OLAA 4CGGA 3FFIA 4O0IA 1NOYA 2HNYA 3LANA 3LP2A 3VA0A 4M3ZA 2O4GA 3MECA 4DTJA 3O4NA 2PY5A 1GOCA 3RMCA 5I42A 1SUQA 2HB5A 5FDLA 4F3OA 1JLEA 1C1BA 4K8ZA 3V9SA 1BCOA 1Q8IA 1VSJA 4DFJA 2OPRA 2E4LA 3IS9A 1X1PA 3NFAA 1KLMA 3ULDA 1X9SA 3CFOA 4DTRA 1LV5A 2X6SA 3P83D 1HNVA 2G8WA 1S6QA 1ITGA 3V9WA 1KSPA 3A2FA 1WSGA 4KHYA 1RBSA 3U3GA 1WLJA 4AHCA 1FKPA 4CHQA 3VQ6A 1K6YA 4DQQA 4FZZA 1BIUA 3QEIA 2A1SA 5HRSA 4J2AA 2HHXA 3C6UA 3ZT0A 1XI1A 2HMIA 4CEOA 4W5RA 3E01A 4N41A 2OZSA 1LWCA 2D0BA 1LAWA 3OYBA 2G8UA 3H08A 4OKEA 2OPQA 4NCBA 1RNHA 1W0HA 4N5SA 3QNNA 2XY7A 4ELTA 3KLGA 1C0MA 1KCFA 4KAZA 5J2QA 3S9HA 2PZSA 3F73A 4DTOA 1LWEA 2PYJA 4KI4A 1TAQA 4CHYA 1UA1A 1EX4A 1U47A 4ICLA 4I7FA 4AHVA 2YNGA 3AVKA 4CJQA 4CJTA 4DG1A 3TI0A 2BDPA 1S1XA 1WN7A 2RF2A 1VK0A 1NJXA 1RT3A 4OGEA 3NGYA 1VRTA 4TSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OGC A;  3TAR A;  4FJ7 A;  3I0R A;  3L2U A;  4E7I A;  1W9H A;  4FZX C;  1KFD A;  2P51 A;  5DK5 A;  2OPS A;  3AVG A;  4FK0 A;  4E1M A;  1GOB A;  2DTU A;  4KB1 A;  3QET A;  3PX0 A;  1C0T A;  1I3A A;  4OVL A;  4Q5V A;  4RW8 A;  3VQB A;  1Z26 A;  3ZT2 A;  4RW9 A;  4Z0U A;  4CIE A;  2YNI A;  4WE1 A;  5HRP A;  4F4K A;  3V9U A;  3PV8 A;  3O3G A;  4DSL A;  4W5O A;  5C24 A;  3SPZ A;  3BDP A;  4FJ9 A;  4CGD A;  3RMD A;  1QSY A;  3QES A;  1QS4 A;  3DM2 A;  3PO4 A;  1VSI A;  2Z1G A;  4DS4 A;  2F8T A;  5D3G A;  3LZI A;  1QQC A;  1RT6 A;  3LP0 A;  3EYZ A;  4HUE A;  3QEX A;  4KI6 A;  5T7B A;  3K57 A;  1HPZ A;  1VRU A;  4CER A;  4N56 A;  4IBN A;  4E7L A;  2OZM A;  4M3Y A;  4JS4 A;  1SKS A;  1C0U A;  1ZBL A;  4M41 A;  3CYM A;  4DWI A;  3VQE A;  1B9D A;  2YHA A;  3V1Q A;  4CGJ A;  3HXM A;  4CHO A;  4CF8 A;  5C42 A;  1YTA A;  2D0A A;  3ZSW A;  4PQU A;  3NE6 A;  3NGZ A;  4FJJ A;  4W5T A;  2XHB A;  3OYJ A;  4DU3 A;  1IKV A;  3KK3 A;  3IAY A;  4FJ5 A;  3MEG A;  4ZTJ A;  1TVR A;  3DLG A;  2GUI A;  2FBT A;  1KRP A;  4KHS A;  4CGI A;  2ETJ A;  3AVB A;  1S9E A;  3WNG A;  3SQ2 A;  4DTU A;  4M3U A;  5CY4 A;  3D45 A;  4QOZ B;  3SNN A;  1BQN A;  4CJL A;  1A5V A;  1RBT A;  2Z1J A;  3V6D A;  3SQ0 A;  1BIS A;  5JS2 A;  1VSE A;  3TAG A;  4DF8 A;  4EZ6 A;  1A5X A;  1HQU A;  2BE2 A;  3M8S A;  4OLB A;  3LAM A;  4UQG A;  1CZ9 A;  2YNH A;  3C94 A;  3M8P A;  3HL8 A;  3ZSO A;  3K5M A;  3RMB A;  2P5G A;  3HK2 A;  2DY4 A;  1JL1 A;  5KI6 A;  5J2M A;  3CFP A;  3ITH A;  4G1Q A;  4Z4E A;  3KLH A;  4L8R B;  2G8I A;  4DMN A;  1R0A A;  4CHP A;  1Z25 A;  4HUF A;  4FM0 A;  1RIL A;  4OPK A;  4KHN A;  4KKO A;  4JRQ A;  3KIO A;  1BHL A;  3T1A A;  4M3W A;  4GMJ B;  3VQ7 A;  1HRH A;  4C8O A;  1L3V A;  4LSN A;  3ZT1 A;  2ZQB A;  3G10 A;  4BE1 A;  4B8A B;  1WAF A;  3HYF A;  2WON A;  3ZT4 A;  4CK1 A;  3AVN A;  3DLK A;  1NKE A;  3U3Y A;  3TAB A;  4CEB A;  5J2P A;  5K14 A;  2IDO A;  5SZT A;  3OYG A;  3F9K A;  3TWH A;  1U49 A;  4CEF A;  1T8E A;  4E89 A;  1WSH A;  4FM2 A;  2KFZ A;  2VG5 A;  1N5Y A;  3OYF A;  3NF7 A;  3SV4 A;  4DS5 A;  2E6M A;  3ALY A;  4FCY A;  3TAM A;  5CZ2 A;  1BI4 A;  1J9A A;  1JLF A;  3LP1 A;  1JL2 A;  5FRM A;  1SKR A;  4Y1C A;  1RBV A;  3AVI A;  1TV6 A;  4Z4I A;  1DTT A;  1RDC A;  1QHT A;  1RT5 A;  4CIF A;  1S5J A;  3C6T A;  4AIL C;  4M3X A;  4KHW A;  4YFU A;  4JS5 A;  3S3N A;  3K59 A;  1RCH A;  4I9Q A;  2JLE A;  3ISN C;  4C8N A;  3DI6 A;  1YTU A;  4RW6 A;  3WNF A;  5E41 A;  4H4O A;  1WNS A;  4DU1 A;  4W5Q A;  3TAN A;  3SUQ A;  2YV0 X;  4BDY A;  4DLG A;  4DTM A;  1QTM A;  1NOZ A;  3IG1 A;  2G8V A;  4FJX A;  3HPH A;  4O0J A;  3MAQ A;  3L2R A;  5I3U A;  3DLH A;  4CK3 A;  3AO2 A;  3NH0 A;  4C8L A;  4FJI A;  4PWD A;  1Y97 A;  4KRF A;  3NF8 A;  3KD1 E;  1TKD A;  3VQC A;  4IG0 A;  2B6A A;  4I2Q A;  4OJR A;  4CJS A;  3HVR A;  3PY8 A;  3C95 A;  3SV3 A;  4FVM A;  4C8K A;  4CJW A;  4B9S A;  3AA2 A;  1ZBH A;  2IAJ A;  1B9F A;  4O5B A;  1IKX A;  1C1C A;  3OYE A;  4BDZ A;  3PUF A;  3OYN A;  3OYK A;  2FBX A;  3L8B A;  1HJR A;  4CHN A;  2FBY A;  1UAX A;  1VSK A;  3KLF A;  3T3F A;  4OKK A;  1L5U A;  1NK4 A;  4MFB A;  2IGI A;  1C6V A;  4DQS A;  2DFF A;  1WSE A;  4GVM A;  4MQ3 A;  2D0C A;  3AVF A;  4RW4 A;  1X9W A;  4Z4F A;  4DFP A;  4M42 A;  4CIG A;  1J5O A;  4CJ5 A;  1BCM A;  4LH4 A;  3L3V A;  3OYL A;  2YKM A;  1IO2 A;  4CEC A;  5SWM A;  4IG3 A;  4K8X A;  4J2D A;  4FW1 A;  1RBU A;  1L3U A;  1HMV A;  3LWL A;  4FLV A;  1D5A A;  4FLX A;  1J54 A;  1KVC A;  1NK8 A;  3V9X A;  3V9Z A;  4CF2 A;  3LZJ A;  4AHS A;  5CYQ A;  3LDS A;  2Z1H A;  4KHQ A;  5CYM A;  1KFS A;  2B5J A;  3AO1 A;  4B8C A;  3O3F A;  2KZM A;  1BQM A;  4CHZ A;  1LW2 A;  3L3U A;  1NJW A;  4LSL A;  1LW0 A;  5HLF A;  4EP5 A;  3M8Q A;  3S3O A;  4E7J A;  1RTD A;  1A5W A;  2XO7 A;  1BL3 A;  1S1W A;  3CQ8 A;  4BDP A;  4E19 A;  4B9T A;  1NK9 A;  1QSL A;  2ATQ A;  1BIZ A;  3VQ9 A;  4FLZ A;  5J1E A;  1JXE A;  4B9M A;  1HNI A;  3JYT A;  4PUO A;  1JKH A;  3CG7 A;  4M45 A;  1KVB A;  1RTJ A;  3HP9 A;  4B9V A;  4OKJ A;  4B9L A;  4CEA A;  3SUO A;  1L3T A;  1D8Y A;  4B9N A;  2R7Y A;  2KW4 A;  1LAV A;  3OS0 A;  1WSI A;  2HW3 A;  4JRP A;  4CJP A;  2D5R A;  4O4G A;  4YNQ A;  2W42 A;  3MXM A;  3CM6 A;  3U6F A;  4FYD A;  3TR8 A;  4CGF A;  4FXD A;  4KFB A;  4R5P A;  3VN5 A;  3QER A;  1RT7 A;  1RTH A;  3RRH A;  4CEQ A;  4CJE A;  3UIQ A;  4NYN A;  3AO3 A;  1TL1 A;  2XY6 A;  3QNO A;  1CXU A;  1KLN A;  1DTQ A;  4FJH A;  4CES A;  4FJM A;  2O4I A;  3AVM A;  3PX6 A;  2NUB A;  4BWM A;  3VQ4 A;  3DYA A;  3MXJ A;  2F8S A;  1RT2 A;  1YVU A;  1VSD A;  3VQQ A;  4JLH A;  3OYD A;  1U45 A;  4DQR A;  2OYQ A;  1IKW A;  3OYH A;  5KGX A;  2AJQ A;  1NKB A;  2QK9 A;  4KTZ A;  1RDA A;  4Q0B A;  3OYA A;  3QO9 A;  4H4M A;  4AHT A;  3QEV A;  4NYF A;  4O44 A;  3DRR A;  1J53 A;  1RTI A;  1TKT A;  2RKI A;  4BWJ A;  3I8D A;  3NAE A;  2G8H A;  4F2S A;  2KFN A;  4HTU A;  4AHR A;  3AO4 A;  1ASU A;  1I39 A;  1S1T A;  2EX3 A;  2G8K A;  1TK8 A;  3AVL A;  4CF0 A;  1IH7 A;  1TKZ A;  4KTW A;  4DTP A;  5HRO A;  3AA5 X;  3DRS A;  3WNE A;  2X6N A;  2IC3 A;  4IFV A;  5C25 A;  3QIN A;  3DOK A;  3HT3 A;  4CJF A;  4CCH A;  2KQ2 A;  5HRR A;  1X9M A;  1WSF A;  4CJR A;  1Q9X A;  3PO5 A;  1REV A;  1NJY A;  4FJ8 A;  2DFE A;  1UOC A;  3VQA A;  3VQP A;  3LPT A;  1RDB A;  4BAC A;  4Z4G A;  2XY5 A;  5FRN A;  1RDD A;  4PA1 A;  4F2R A;  1TAU A;  2KTQ A;  3AVA A;  3ASM A;  3NCI A;  4ELU A;  1JLG A;  4DFK A;  3PX4 A;  4KTQ A;  4EP4 A;  4CFA A;  5CZ1 A;  1WSJ A;  4HVJ A;  1VSL A;  2XY8 A;  2JGU A;  3V4I A;  3NH2 A;  4E1N A;  1XHX A;  3TAE A;  1IKY A;  2IS3 A;  4ZTF A;  4CFB A;  1CLQ A;  4M3T A;  3HPG A;  1JLC A;  4CGH A;  3HVT A;  3T19 A;  4DU4 A;  2Y1I A;  2QKK A;  2VWJ A;  3SCX A;  3DMJ A;  1RT1 A;  1XHZ A;  1U4B A;  2HHW A;  4FLT A;  4KB0 A;  1B92 A;  1ASV A;  3TAQ A;  2YNF A;  3P5J A;  4IFY A;  1QSS A;  3EZ5 A;  4KRE A;  1TK0 A;  3ZSZ A;  2E6L A;  2HNZ A;  2F96 A;  3CM5 A;  4CJK A;  3KD5 E;  4IKF A;  4KV8 A;  2HHV A;  4I9L A;  3NHG A;  2PYL A;  2X78 A;  3IRX A;  3JSM A;  1SV5 A;  4DSK A;  4KO0 A;  2B4J A;  1U48 A;  3P1G A;  3LP3 A;  2DFH A;  4E3S A;  1NKC A;  3O4Q A;  3ZSV A;  3MXI A;  1ZBF A;  4Y1D A;  3OS1 A;  3L2W A;  3SUP A;  1UA0 A;  4DSJ A;  1TGO A;  1SL0 A;  4ID5 A;  4LY7 A;  4BE0 A;  3K2P A;  3V1O A;  3NH1 A;  3LWM A;  4OPJ A;  3K5N A;  5FRO A;  3KKR A;  4ELV A;  1VSM A;  3VQ8 A;  4CJ4 A;  1S6P A;  2BGG A;  1FKO A;  3RR7 A;  2ZE2 A;  2A1R A;  3QEP A;  3ZT3 A;  1T03 A;  1TL3 A;  4EZ9 A;  2Z1I A;  4CFD A;  1CZB A;  4E7K A;  1EET A;  1DLO A;  3OY9 A;  3G0Z A;  4CED A;  4XIU A;  1SL1 A;  3RWU A;  4J2E A;  3LAL A;  4DLE A;  4CF9 A;  4FJN A;  1S9G A;  2EHG A;  2P1J A;  1NK7 A;  2YKN A;  4Z4C A;  3NF9 A;  4H8K A;  3AVJ A;  3NF6 A;  1JLA A;  1U04 A;  3AA4 A;  4AH9 A;  2Y1J A;  3KTQ A;  1KTQ A;  1S1U A;  2OPP A;  4HUG A;  3WNH A;  1EP4 A;  1SKW A;  3MED A;  3OYC A;  1HYV A;  4CE9 A;  3DLE A;  3D0P A;  3ZSX A;  2VWK A;  3QLH A;  4IDK A;  4CJV A;  1GOA A;  4HCB A;  4F8R A;  3VA3 A;  2GV9 A;  3B6P A;  4FLU A;  4Z4H A;  4B3O A;  2G8F A;  1TK5 A;  4CEE A;  3M8R A;  4FLY A;  1NK0 A;  2BAN A;  4PY5 A;  5HBM A;  4DTX A;  3AO5 A;  1RBR A;  3B6O A;  1XC9 A;  4B08 A;  3ZSQ A;  3HM9 A;  3BGR A;  1NJZ A;  1FXX A;  1Q9Y A;  2GBZ A;  4DSE A;  3KKS A;  1F21 A;  3OS2 A;  5KRT A;  1QE1 A;  3TAP A;  4B9U A;  3KLE A;  4J2B A;  1ASW A;  1VSH A;  3QIP A;  4ID1 A;  3SQ1 A;  3HO1 A;  1JLB A;  1ZBU A;  3K5L A;  3RTV A;  2LSN A;  2RN2 A;  4M3R A;  3SZ2 A;  3NGI A;  3MEE A;  4LD0 A;  3OVN A;  3QEW A;  3RMA A;  1C1A A;  3K5O A;  1L3S A;  1KVA A;  4QAG A;  4RG8 A;  3OJU A;  3LPU A;  3V1R A;  3KJV A;  4W5N A;  4FJK A;  4NCA A;  1S1V A;  3AVC A;  3DRP A;  3NDK A;  2X74 A;  3HPO A;  3RR8 A;  3CFR A;  4KHU A;  4KPY A;  2QXF A;  4N76 A;  4FW2 A;  3SUN A;  3HJF A;  2ITG A;  2FC0 A;  3HST B;  5DMR A;  1UWB A;  4C8M A;  1NK5 A;  3ZSR A;  4FZY A;  5KGW A;  3KLI A;  4BE2 A;  1YT3 A;  3OYM A;  4RW7 A;  3RRG A;  1BI4 B;  4GW6 A;  1JXB A;  3L2V A;  1D9D A;  1HYS A;  2IOC A;  3SQ4 A;  1HYZ A;  1MU2 A;  4FK4 A;  2ZD1 A;  3NBP A;  1FK9 A;  2KZZ A;  4E7H A;  1XWL A;  4FJG A;  2Q3S A;  1O1W A;  3O3H A;  3TAF A;  4FJL A;  4CK2 A;  3L2Q A;  3SPY A;  4LH5 A;  4O55 A;  2VG6 A;  1EXQ A;  2HVI A;  2YHB A;  3OYI A;  4F3T A;  5HRN A;  3SYZ A;  2QKB A;  3ZSY A;  4CFC A;  4CJU A;  2WOM A;  4HHT A;  4DTS A;  1ZYQ A;  1D9F A;  2RPI A;  3SJJ A;  4FLW A;  1SL2 A;  4DQP A;  1RT4 A;  3KK1 A;  1HQE A;  3SI6 A;  3I0S A;  1VSF A;  4I2P A;  1WAJ A;  4DSF A;  1TKX A;  4DQI A;  4DSI A;  1G15 A;  3S3M A;  2HHS A;  3V81 A;  1NK6 A;  3DOL A;  2XRI A;  4HCC A;  3THV A;  4FK2 A;  1BGX T;  3DLB A;  2FBV A;  3ZCM A;  4DFM A;  4AHU A;  5KRS A;  1N6Q A;  4DTN A;  1T05 A;  1CXQ A;  1LWF A;  2HHT A;  3HP6 A;  5HP1 A;  2P5O A;  1EKE A;  3AV9 A;  4NCG A;  3VQ5 A;  5J2N A;  2OA8 A;  4CEZ A;  4DF4 A;  1T7P A;  5EU7 A;  5KTQ A;  3KK2 A;  1ZBI A;  3LAK A;  4N47 A;  3DLR A;  1JLQ A;  3AA3 A;  3K58 A;  4E0D A;  2HHU A;  3OJS A;  4QCL A;  4FM1 A;  4CF1 A;  1IG9 A;  4ZHR A;  5JS1 A;  2I5J A;  3EY1 A;  3VQD A;  3QIO A;  2HVH A;  2HND A;  2VG7 A;  2HHQ A;  4CJ3 A;  3AVH A;  4OLA A;  4CGG A;  3FFI A;  4O0I A;  1NOY A;  2HNY A;  3LAN A;  3LP2 A;  3VA0 A;  4M3Z A;  2O4G A;  3MEC A;  4DTJ A;  3O4N A;  2PY5 A;  1GOC A;  3RMC A;  5I42 A;  1SUQ A;  2HB5 A;  5FDL A;  4F3O A;  1JLE A;  1C1B A;  4K8Z A;  3V9S A;  1BCO A;  1Q8I A;  1VSJ A;  4DFJ A;  2OPR A;  2E4L A;  3IS9 A;  1X1P A;  3NFA A;  1KLM A;  3ULD A;  1X9S A;  3CFO A;  4DTR A;  1LV5 A;  2X6S A;  3P83 D;  1HNV A;  2G8W A;  1S6Q A;  1ITG A;  3V9W A;  1KSP A;  3A2F A;  1WSG A;  4KHY A;  1RBS A;  3U3G A;  1WLJ A;  4AHC A;  1FKP A;  4CHQ A;  3VQ6 A;  1K6Y A;  4DQQ A;  4FZZ A;  1BIU A;  3QEI A;  2A1S A;  5HRS A;  4J2A A;  2HHX A;  3C6U A;  3ZT0 A;  1XI1 A;  2HMI A;  4CEO A;  4W5R A;  3E01 A;  4N41 A;  2OZS A;  1LWC A;  2D0B A;  1LAW A;  3OYB A;  2G8U A;  3H08 A;  4OKE A;  2OPQ A;  4NCB A;  1RNH A;  1W0H A;  4N5S A;  3QNN A;  2XY7 A;  4ELT A;  3KLG A;  1C0M A;  1KCF A;  4KAZ A;  5J2Q A;  3S9H A;  2PZS A;  3F73 A;  4DTO A;  1LWE A;  2PYJ A;  4KI4 A;  1TAQ A;  4CHY A;  1UA1 A;  1EX4 A;  1U47 A;  4ICL A;  4I7F A;  4AHV A;  2YNG A;  3AVK A;  4CJQ A;  4CJT A;  4DG1 A;  3TI0 A;  2BDP A;  1S1X A;  1WN7 A;  2RF2 A;  1VK0 A;  1NJX A;  1RT3 A;  4OGE A;  3NGY A;  1VRT A;  4TSX A; 
#chains in the Genus database with same CATH topology
 4OGC A;  3TAR A;  5ADX A;  1W9H A;  1BA0 A;  3AVG A;  2DTU A;  1GOB A;  1WBB A;  5TKY A;  3AAP A;  3LL3 A;  1VQ9 N;  1Z26 A;  4M7Y A;  4Z0U A;  3J7A P;  5AQT A;  3EEQ A;  4IZ9 A;  3PV8 A;  3BDP A;  3SPZ A;  4FJ9 A;  1S22 A;  1QSY A;  1QS4 A;  3PO4 A;  3O9T A;  2F8T A;  3LZI A;  1VRU A;  4AF1 A;  1VQP N;  4IBN A;  5JLF A;  2OZM A;  4M3Y A;  1DKG D;  1RGI A;  3MN7 A;  1B9D A;  1GLL O;  3A5L C;  5AQX A;  2VQE K;  4CHO A;  1VQM N;  2D0A A;  4FJJ A;  1M1K O;  5AQJ A;  2GUI A;  1VQ6 N;  1VQL N;  3GOI A;  4QOZ B;  3SMP A;  1RBT A;  3V6D A;  5JS2 A;  1A5X A;  3T69 A;  2NZT A;  3KK7 A;  4XH1 A;  4UQG A;  4FOE A;  3M8P A;  3RMB A;  2P5G A;  1R0A A;  4HUF A;  4KHN A;  2KHO A;  1X3N A;  3T1A A;  3VQ7 A;  1HRH A;  5BRH A;  4LSN A;  4JHD A;  1WAF A;  3DLK A;  4FWM A;  3TAB A;  3LDO A;  5K14 A;  3TWH A;  5BRF A;  1U49 A;  1T8E A;  4CZJ A;  1WSH A;  2FSK A;  4H0Y B;  3OYF A;  4XEI A;  4FCY A;  1BI4 A;  3LP1 A;  1JL2 A;  5FRM A;  3AVI A;  4M3X A;  1QHT A;  1RT5 A;  3CCR N;  2QWR A;  4YFU A;  4LF9 K;  2JLE A;  3ISN C;  4C8N A;  3WNF A;  1WNS A;  3SUQ A;  2YV0 X;  1QTM A;  4DLG A;  3NMU A;  1NOZ A;  4B9Q A;  3ZYY X;  4FJX A;  3HPH A;  3DLH A;  3MCP A;  3OHR A;  2P9K B;  4OJR A;  2B6A A;  3L0Q A;  4FVM A;  4CJW A;  3AA2 A;  1ZBH A;  5BR8 K;  3OYE A;  4BDZ A;  3AAQ A;  3MN6 A;  4DWI A;  2EWS A;  1UAX A;  2FBY A;  1L5U A;  4CZG A;  4JI1 K;  3A8Y A;  4Z4G A;  4IXC A;  1NU0 A;  3OYL A;  3P31 A;  1IO2 A;  5SWM A;  3WUH A;  3CJ9 A;  3A5O C;  3LWL A;  1D5A A;  1LOT B;  4WQ5 C;  4DV7 K;  5CYQ A;  5AQH A;  5CYM A;  2B5J A;  1EWR A;  1XNR K;  4JKH A;  2E5L K;  1NGC A;  1ZBS A;  1LW0 A;  2I7P A;  5AZI A;  4JI7 K;  4E7J A;  1A5W A;  2XO7 A;  1S1W A;  3PSI A;  4E19 A;  2A41 A;  3GG4 A;  5J1E A;  1JXE A;  1K73 O;  3OBY A;  4I6M A;  2A5X A;  4B9V A;  4CEA A;  1D8Y A;  1WSI A;  1OKJ A;  5C12 A;  3CCU N;  2D5R A;  4KH6 A;  1ZC6 A;  2QW9 A;  3D2E B;  5IT9 O;  2VGM A;  3U6F A;  1OH7 A;  4FWO A;  2BUP A;  1YHQ N;  1IBL K;  4FXD A;  1RTH A;  4CEQ A;  3UIQ A;  3AO3 A;  2XY6 A;  3THY B;  1CXU A;  2QA4 N;  1DTQ A;  3F5T A;  3PX6 A;  4BRF A;  2QXL A;  2KLA A;  3VF6 A;  3E9L A;  2D4W A;  3L4I A;  2OTL N;  1FW6 A;  3MXJ A;  2F8S A;  1VSD A;  1EWQ A;  4DQR A;  3F2K A;  2AJQ A;  2QWO A;  2QM1 A;  3OYA A;  4AHT A;  3DRR A;  1TKT A;  4H0V B;  1VQO N;  2D0O A;  1BUP A;  1S1T A;  3VES A;  5H1S Q;  3I55 N;  2UYT A;  4DTP A;  5HRO A;  2DPN A;  4B3M K;  4IFV A;  5LMN K;  2KQ2 A;  4CVN E;  2DFE A;  3G4S N;  3VQP A;  3LPT A;  2XY5 A;  3FR0 A;  2KTQ A;  3AVA A;  4ELU A;  4DFK A;  3HI0 A;  2O8C A;  4HVJ A;  1QZ5 A;  4WCE L;  3R1X A;  3V4I A;  3QB0 A;  1XHX A;  4M3T A;  3T19 A;  2Y1I A;  2VWJ A;  3SCX A;  1XHZ A;  2BH1 A;  4FPA A;  4BG8 A;  1B92 A;  4KBO A;  4IFY A;  3EZ5 A;  4H5V A;  4BVP A;  2AA4 A;  1TK0 A;  4KRE A;  3SAG A;  1IBK K;  2P9N B;  1H1V A;  3IRX A;  2B4J A;  2P9L A;  3P1G A;  4E3S A;  1NKC A;  3LDP A;  3ZSV A;  3MXI A;  3ZX2 A;  1W2B M;  4BE0 A;  3K2P A;  3OTO K;  2P9P B;  1S6P A;  1FKO A;  2A40 A;  3QEP A;  1T03 A;  4X64 K;  4YOV A;  4XIU A;  4H5W A;  4J2E A;  3NF9 A;  4AH9 A;  3AVJ A;  3AA4 A;  4BGA A;  1O13 A;  2UUC K;  1EP4 A;  1HYV A;  2VYP A;  3G25 A;  5M1F A;  3D0P A;  2Q0R A;  1GOA A;  2GV9 A;  2GWK A;  1TK5 A;  4WF9 L;  5HBM A;  3TTF A;  3BGR A;  1FXX A;  1Q9Y A;  4DSE A;  3QBX A;  1F21 A;  3CJC A;  1QE1 A;  3LDL A;  4ID1 A;  4B3R K;  3SQ1 A;  3HO1 A;  4PL7 A;  3RTV A;  3J8A A;  1WOQ A;  4BRQ A;  2UU9 K;  4LD0 A;  1SAZ A;  1QVF M;  1C1A A;  4JKE A;  4JHD B;  4QAG A;  5AQW A;  2FF6 A;  1QVG M;  3KJV A;  1U2V A;  2KKZ A;  3RR8 A;  4FL9 A;  3CFR A;  4DV6 K;  3BUZ B;  2FC0 A;  1NK5 A;  3KLI A;  4GY2 B;  3RRG A;  1BI4 B;  1VQN N;  1JXB A;  5ELZ A;  3L2V A;  1D9D A;  2IOC A;  1HYZ A;  4FK4 A;  3WQT A;  2Q3S A;  2PFU A;  2O8E B;  4MO5 A;  4KH5 A;  3O9Q A;  3D2F A;  2YHB A;  4F3T A;  3UKR A;  2QKB A;  4CFC A;  3AGR A;  4HHT A;  4J8F A;  3SJJ A;  3KK1 A;  3P39 A;  3SI6 A;  4IOC L;  1TKX A;  4GKK K;  1XNQ K;  2Q2R A;  1ATN A;  4CZK A;  3LDN A;  5M1Q A;  5GAG P;  3THV A;  3VF2 A;  3CJ1 A;  2FBV A;  3ZCM A;  1HNW K;  4AHU A;  5KRS A;  2HHT A;  1KAX A;  3AV9 A;  4NCG A;  3TSU A;  5EOY A;  3ZX0 A;  5KTQ A;  3THW B;  4E0D A;  2HHU A;  1I94 K;  3BZC A;  4QCL A;  4ILJ A;  3PLA A;  4CF1 A;  2QTD A;  2W6K A;  4ZHR A;  4NB4 A;  2QWL A;  2HVH A;  2HHQ A;  1GLC G;  3VET A;  4O0I A;  1NOY A;  2HNY A;  3LAN A;  4BRN A;  5I42 A;  1SUQ A;  4FVU A;  1BCO A;  4JKD A;  3FZK A;  4I6M B;  3ULE A;  2E4L A;  4JYA K;  3NFA A;  2GWJ A;  3P83 D;  1S6Q A;  3ZEU A;  3VEY A;  4AHC A;  1FKP A;  1BIU A;  3QEI A;  2A1S A;  4M7X A;  1VQ5 N;  1YXQ A;  5AQL A;  4A57 A;  4JI4 K;  4LF4 K;  4QS9 A;  2G8U A;  4OKE A;  4NCB A;  4N5S A;  3KLG A;  1N36 K;  2V52 B;  5FLX O;  1TAQ A;  2CGL A;  2VGN A;  1QQN A;  4U7B A;  1U47 A;  2YNG A;  3TI0 A;  4CJQ A;  1KAY A;  3DXM A;  3CC7 N;  3HOT A;  4BQZ A;  3L2U A;  1WUA A;  2P51 A;  4FK0 A;  4E1M A;  3QET A;  3SBT A;  3HZ6 A;  3WXI A;  4RW8 A;  4RW9 A;  4JV5 K;  2QWQ A;  4WE1 A;  5HRP A;  4BC5 A;  4DSL A;  2YX6 A;  4CGD A;  2HOE A;  3QES A;  3DM2 A;  1VSI A;  2Z1G A;  3DXK B;  1C0F A;  5D3G A;  1QQC A;  3LP0 A;  3EYZ A;  4KI6 A;  5T7B A;  1MWM A;  2QWP A;  3K57 A;  3KWG A;  1ESV A;  4E7L A;  3ATU A;  1C0U A;  2O8C B;  1E4G T;  4ILG B;  1NG9 A;  5C42 A;  4PQU A;  1QZ6 A;  3NE6 A;  3NGZ A;  1GLD G;  2ASM A;  2V7Z A;  4W5T A;  3OYJ A;  1M90 O;  4FJ5 A;  5F1X A;  3AVB A;  3WNG A;  3SQ2 A;  4DTU A;  4M3U A;  4YOU A;  4IJN A;  2JWK A;  4CJL A;  1A5V A;  3A5N C;  3K0S A;  4JK8 A;  3TAG A;  3CCV N;  3U9Z A;  3CPW M;  3M8S A;  3LAM A;  4PKH A;  1CZ9 A;  3C94 A;  3J7Z O;  3HK2 A;  3MK6 A;  4KHP K;  4Z4E A;  3CET A;  5BPM A;  4FM0 A;  1GLA G;  1RIL A;  3VEN A;  4JI0 K;  3FZF A;  3W3D A;  4A2B A;  1BHL A;  1GLJ O;  5BN8 A;  3N4P A;  4WQ5 A;  1FJG K;  3ZT1 A;  3G10 A;  4BE1 A;  4B8A B;  3HYF A;  4CK1 A;  3U3Y A;  4BRG A;  4DHY A;  2ZJP L;  4CEF A;  4C1N I;  3QIC A;  3T1H K;  4BRP A;  1YI2 N;  5GIO A;  3NF7 A;  3SV4 A;  4DS5 A;  5CZ2 A;  5E84 A;  1RBV A;  4Z4I A;  1TV6 A;  3VMF B;  2WC9 A;  1DTT A;  4B1U B;  1T6D A;  3VF4 A;  1KQS M;  4H0X B;  3DI6 A;  4ILH A;  5E41 A;  4DU1 A;  4BDY A;  3UKU A;  5AQM A;  2G8V A;  3MAQ A;  5I3U A;  1JCE A;  4CK3 A;  4FJI A;  5KPZ A;  1Y97 A;  3KD1 E;  4U67 L;  3C95 A;  3GDQ A;  4BRL A;  5AR0 A;  2P9U B;  1B9F A;  1IKX A;  1C1C A;  3WEE A;  5AQR A;  2FBX A;  2RHK A;  5C10 A;  3L8B A;  3T3F A;  4OKK A;  1NK4 A;  1WSE A;  2UXB K;  1X9W A;  1NGD A;  3KHY A;  1BCM A;  4YHH K;  3L3V A;  3CQX A;  4FWP A;  4IG3 A;  4K8X A;  4FW1 A;  2A6A A;  1HMV A;  2GEM A;  4FLV A;  4C8L A;  1J54 A;  1KVC A;  2NRH A;  3V9X A;  3LZJ A;  3LDS A;  4KHQ A;  3RSE A;  3CPE A;  4B8C A;  1BQM A;  4FWL A;  1GLB G;  4YDU A;  3M8Q A;  5JLH A;  5DM7 L;  3CQ8 A;  3O8M A;  1NK9 A;  1BIZ A;  2A42 A;  3UKR B;  4B9M A;  2FLO A;  3L6Q A;  1RTJ A;  2NRV A;  4H03 B;  1L3T A;  4B9N A;  1LAV A;  4CJP A;  3FFK B;  3CF5 L;  4O4G A;  3CMA N;  5TKW A;  3CM6 A;  4NXM K;  4FYD A;  4WFN L;  2NLX A;  3GBT A;  4CGF A;  3SAH A;  3PIP L;  4LFA K;  2I7N A;  3QNO A;  4FJH A;  4IO8 A;  4CES A;  4BR7 A;  2NUB A;  3DYA A;  3U9D A;  3QML A;  3Q7C A;  2P9S A;  3QEV A;  5BRD A;  3NAE A;  1J53 A;  4BWJ A;  3VEV A;  3EL2 A;  3M3Z A;  4HTU A;  4AHR A;  3CCQ N;  4LC9 B;  1I39 A;  2EX3 A;  3HTV A;  1TK8 A;  4CF0 A;  3ID8 A;  4KTW A;  3ULE B;  5CHI A;  3WNE A;  3TSP A;  2IC3 A;  5C25 A;  4CCH A;  3ZEU B;  4CJF A;  4JD2 A;  5HRR A;  3DJC A;  4CJR A;  4EHU A;  4FWK A;  3IDH A;  1NGG A;  3VQA A;  1RDB A;  2O8B B;  5FRN A;  4PA1 A;  1TAU A;  3J80 O;  1JLG A;  4KTQ A;  4EP4 A;  4CFA A;  5CZ1 A;  1WSJ A;  3H3O B;  3NH2 A;  1SS6 A;  3DWL A;  4E1N A;  5AJ3 K;  3Q7B A;  4AM6 A;  4CFB A;  1EQY A;  1U4B A;  3FZL A;  4FLT A;  3CQY A;  1ASV A;  3TAQ A;  1V4T A;  2OCE A;  3VTH A;  2HNZ A;  2F96 A;  3CM5 A;  4CJK A;  3KD5 E;  1DT9 A;  3NHG A;  4IWV A;  3JSM A;  4DSK A;  4KO0 A;  1U48 A;  3LP3 A;  1OVY A;  3MN5 A;  4Y1D A;  1HNZ K;  3SUP A;  1UA0 A;  1TGO A;  1SL0 A;  4ID5 A;  3ZX3 A;  4EIA A;  3NH1 A;  3HM8 A;  3TSQ A;  4OPJ A;  1VSM A;  1YUW A;  4CJ4 A;  3CJ7 A;  4BR9 A;  2ZE2 A;  2Z1I A;  3MN9 A;  4CFD A;  3CME N;  4DUY K;  3OY9 A;  1SL1 A;  4L3Q A;  3LAL A;  3CCJ N;  2HBK A;  2YKN A;  4Z4C A;  3PY8 A;  4H8K A;  1U04 A;  1Q81 O;  2V51 B;  4JN4 A;  1S1U A;  2OPP A;  5FPM A;  4HUG A;  2O8F A;  4RCH A;  3OYC A;  2E1Z A;  2QWN A;  4IDK A;  1E4F T;  4M63 C;  4BG9 A;  4BRE A;  5M1N A;  5BR9 A;  4FLU A;  2O8D A;  4PY5 A;  2BAN A;  4DTX A;  5JMV A;  3H46 O;  4B08 A;  3EO3 A;  3KKS A;  4J2B A;  3AAR A;  3KLE A;  1ASW A;  1VSH A;  3IFR A;  3K5L A;  2RN2 A;  3QEW A;  3RMA A;  1X3M A;  4PKG A;  2CGK A;  5EVZ A;  4RG8 A;  3OJU A;  5BPL A;  1BU6 O;  2D0P A;  3ZET B;  4X62 K;  3HPO A;  3R8E A;  3ENO A;  3HJF A;  2ITG A;  1KC8 O;  1NGA A;  4C8M A;  3ZSR A;  2BTF A;  1YT3 A;  4BE2 A;  1ILY A;  1HYS A;  3QDK A;  3THX B;  3IUC A;  3NBP A;  1OH5 A;  4IEE A;  4FJG A;  4CK2 A;  2FSJ A;  3SPY A;  4LH5 A;  4O55 A;  2VG6 A;  4BRM A;  3OYI A;  3SYZ A;  4DV2 K;  4LF8 K;  2WOM A;  4DTS A;  2VCP A;  1ZYQ A;  1S3X A;  4H0P A;  1VHX A;  4DQI A;  1VSF A;  2VQF K;  3WEE B;  1G15 A;  3ID6 A;  3S3M A;  2HHS A;  3V81 A;  3DOL A;  2WTU A;  1BGX T;  4H0T B;  1CXQ A;  4JKG B;  5AQY A;  3HP6 A;  1T05 A;  1OH8 A;  3BF3 A;  2P5O A;  5J2N A;  5AZJ B;  3VQ5 A;  4CEZ A;  4DF4 A;  3IMX A;  3WXJ A;  3KK2 A;  1R59 O;  3LAK A;  4ISF A;  4JK7 A;  3CCS N;  4FM1 A;  4B1W B;  4CBX A;  2A3Z A;  3EY1 A;  3VQD A;  2VG7 A;  3RSE B;  4OLA A;  5KPR A;  3LP2 A;  2GEL A;  3A5M C;  4CBU A;  3AY9 A;  5GAD P;  3MEC A;  3O4N A;  4BC3 A;  2W41 A;  2HB5 A;  1JLE A;  1C1B A;  3V9S A;  4DFJ A;  3SJH A;  1X1P A;  1X9S A;  3CFO A;  2X6S A;  4LFB K;  1KXP A;  5M1O A;  3TTC A;  4YOW A;  1WSG A;  3CI5 A;  1K6Y A;  4DQQ A;  1J6Z A;  4IOX A;  4J2A A;  3OW2 M;  1N33 K;  3E01 A;  2Q1N A;  1YIJ N;  1LAW A;  3OYB A;  3H08 A;  3TU5 A;  2OPQ A;  1RNH A;  3QNN A;  2XY7 A;  4ELT A;  4MDB A;  3BEX A;  4X65 K;  2WFB A;  4ICL A;  4I7F A;  5LJW A;  3M5R A;  4DG1 A;  4CJT A;  1NJX A;  3NGY A;  1U6Z A;  4TSX A;  4FJ7 A;  1XUP O;  3JS6 A;  2P9S B;  3G6E N;  1QQO A;  3C65 A;  1KFD A;  5DK5 A;  2OPS A;  3DLL L;  4FO0 A;  1NGB A;  4JKB A;  4KB1 A;  4A5A A;  3PX0 A;  1C0T A;  4OVL A;  3VQB A;  4CIE A;  3EKU A;  2YNI A;  4F4K A;  3O3G A;  5C24 A;  3JAM O;  2IVP A;  4CZF A;  5DM6 L;  1V4S A;  4DS4 A;  5BN9 A;  2UXD K;  4IDH A;  1BDG A;  1YJN N;  3PSF A;  1HPZ A;  2CH5 A;  5AQI A;  2NRX A;  1SKS A;  1X9J A;  4M41 A;  3CYM A;  1TUU A;  3VQE A;  2J4R A;  3MMV A;  3HXM A;  5C0Y A;  4CF8 A;  4RTF D;  4IOA L;  1XMO K;  1NMN A;  1SQK A;  2F9W A;  2XHB A;  3IAY A;  2GTD A;  3MEG A;  1KRP A;  2FBT A;  4GNI A;  4KHS A;  2ETJ A;  1YJ9 N;  1S9E A;  5CY4 A;  3D45 A;  3SNN A;  1BQN A;  2Z1J A;  4A62 A;  1BIS A;  1VSE A;  3A0I X;  4DF8 A;  2BE2 A;  1Q7Y O;  3VOV A;  2YNH A;  2GUP A;  3HL8 A;  1IJJ A;  2W6L A;  5GAH P;  1JL1 A;  5J2M A;  1MWK A;  3CFP A;  5KQ8 A;  3KLH A;  4L8R B;  2G8I A;  4DMN A;  1Z25 A;  2HBJ A;  2ZGZ A;  4OPK A;  1ATS A;  3BF1 A;  4JKA A;  1P90 A;  4M3W A;  3H45 C;  3U4L A;  4C8O A;  1EO1 A;  1L3V A;  2ZQB A;  1KD1 O;  3H1Q A;  3AVN A;  1NKE A;  1ZXO A;  3OYG A;  3F9K A;  4JI2 K;  3TPQ A;  4E89 A;  2KFZ A;  1N5Y A;  4DV0 K;  4FWN A;  5AZI B;  4CJ7 A;  4DUZ K;  1J9A A;  4NO7 A;  1SKR A;  2E2Q A;  1GLE G;  4AIL C;  4CIF A;  3C6T A;  4KHW A;  4JS5 A;  3S3N A;  3K59 A;  1RCH A;  5C2D A;  3NVK A;  5MLC Q;  1YTU A;  4RW6 A;  4W5Q A;  3IG1 A;  5CR4 A;  4O0J A;  1T44 A;  3L2R A;  3AO2 A;  3NH0 A;  4PWD A;  1TKD A;  3VEZ A;  4CJS A;  3HVR A;  4I2Q A;  3CCE N;  4B3S K;  5HL7 L;  4CBW A;  4Y0W A;  4B9S A;  4B1Y B;  4BY9 C;  2F9T A;  4O5B A;  3LM2 A;  3OYK A;  3O1B A;  3OYN A;  3HSC A;  4FZX C;  1HJR A;  2ZJR L;  1VSK A;  3KLF A;  2E2N A;  2IGI A;  3CIP A;  1C6V A;  4JI8 K;  4MQ3 A;  4RW4 A;  3AVF A;  4Z4F A;  1VAZ A;  1J5O A;  4CJ5 A;  1NLV A;  2ZWH A;  4LH4 A;  5BPN A;  1YIT N;  3F9M A;  1HUX A;  1L3U A;  3VGM A;  4FLX A;  4CF2 A;  4AHS A;  3VEO A;  4JI3 K;  2PBD A;  3GE1 A;  2FXU A;  2F4V K;  5HLF A;  4EP5 A;  3S3O A;  1BL3 A;  4BDP A;  4LFC K;  1QSL A;  2ATQ A;  3VQ9 A;  4FLZ A;  2HST A;  1HNI A;  4CD1 A;  1KVB A;  4B9L A;  4OKJ A;  3SUO A;  2KW4 A;  3OS0 A;  5AQO A;  2HW3 A;  4A59 A;  4R79 A;  3O9U A;  4JRP A;  4YNQ A;  4CZI A;  3MXM A;  1J5E K;  2P9K A;  1Q18 A;  3TR8 A;  4R5P A;  3VN5 A;  3QER A;  1RT7 A;  3RRH A;  4NYN A;  4IFE A;  5AQF A;  4FJM A;  2O4I A;  3AVM A;  4BWM A;  3VQ4 A;  4CI6 A;  1RT2 A;  1YVU A;  3VER A;  4JLH A;  4YOR A;  2OYQ A;  3H3N O;  5KGX A;  1BWF O;  2QK9 A;  4WYB A;  4Q0B A;  4MLH A;  2P9L B;  4H4M A;  4O44 A;  1DEJ A;  1RTI A;  2KFN A;  2RKI A;  1S72 N;  1NGJ A;  4F2S A;  3AO4 A;  1TKZ A;  4JKC A;  3K9J A;  3AA5 X;  3WXL A;  3DRS A;  3DOK A;  4BR5 A;  3HT3 A;  2CH6 A;  1CZA N;  1HKC A;  2YJF A;  1X9M A;  1WSF A;  2E1Y A;  3E9P A;  1K8A O;  1Q9X A;  3PO5 A;  1W97 L;  1UOC A;  2HBL A;  1HKG A;  4BRO A;  1RDD A;  2ITM A;  4F2R A;  3ASM A;  3NCI A;  4YOX A;  4DR7 K;  3CER A;  1TUY A;  4BRH A;  2HHH K;  4IEI A;  1CLQ A;  3HPG A;  1JLC A;  3HVT A;  4DU4 A;  2QKK A;  2OAN A;  4PKI A;  5I9E B;  3DMJ A;  1RT1 A;  2HHW A;  2YNF A;  3C7N A;  3P5J A;  1N32 K;  1QSS A;  4YOT A;  3CD6 N;  4BRC A;  3WT0 A;  4MDA A;  1P8Z A;  1SV5 A;  4DKW A;  4LF5 K;  4F9O A;  4YOY A;  1SZ2 A;  1ZBF A;  3W0L A;  3OS1 A;  4DSJ A;  3CHW A;  3QFU A;  5EX5 A;  2QEX N;  4LY7 A;  3V1O A;  1HJO A;  3LWM A;  1K9M O;  4BGB A;  5FRO A;  4ELV A;  1Q82 O;  1U2V B;  4MLE A;  3MWP A;  5F2R A;  3FGU A;  1IG8 A;  1N34 K;  2A1R A;  3CCM N;  1TL3 A;  5EXW A;  1EET A;  1DLO A;  3G0Z A;  3H1V X;  3RWU A;  4FJN A;  3SMS A;  1T3V A;  1NK7 A;  4WFA L;  4M42 A;  1JLA A;  1N8R O;  2H3G X;  2YCH A;  3RVC A;  3PIO L;  3MED A;  4QS7 A;  3DLE A;  3MCA B;  3ZSX A;  5M1K A;  4HCB A;  3D2F B;  1Z05 A;  5FPD A;  4B3O A;  3KZB A;  2G8F A;  4CEE A;  1Y64 A;  3M8R A;  1NK0 A;  4DR5 K;  3B6O A;  2HBM A;  3ZSQ A;  3HM9 A;  1NJZ A;  2GBZ A;  2P9N A;  4BR4 A;  4B9U A;  3TAP A;  4A5B A;  4EAH D;  1JLB A;  1ZBU A;  2LSN A;  4BC2 A;  4NXN K;  2YI1 A;  4M3R A;  3SZ2 A;  3NGI A;  3MEE A;  5BRE A;  3OVN A;  5KQD A;  4JKF A;  3K5O A;  3NVM A;  4C1N K;  2P9P A;  3WQU A;  3LPU A;  3V1R A;  3T1Y K;  4W5N A;  2IIR A;  3AVC A;  3NDK A;  3SLC A;  4OX9 K;  4KPY A;  4FW2 A;  5LL6 Z;  3BZK A;  5AQK A;  3HST B;  5DMR A;  1UWB A;  4FZY A;  1TYQ A;  4K41 A;  3I56 N;  4GW6 A;  3O80 A;  5IWA K;  3SQ4 A;  1MU2 A;  5C15 A;  4DR3 K;  4FWQ A;  4CZH A;  4E7H A;  3CJA A;  5AQZ A;  1O1W A;  3O3H A;  3J7Y P;  3TAF A;  4LF7 K;  3L2Q A;  2E2P A;  2YHX A;  1HLU A;  2Q36 A;  4DV4 K;  3ZSY A;  3J81 O;  1XQS C;  3GL1 A;  1RT4 A;  2ZGY A;  3I0S A;  4DSF A;  4I2P A;  1HPM A;  1NK6 A;  1HKB A;  2XRI A;  3HRG A;  4HTL A;  1N6Q A;  4DTN A;  2OA8 A;  3UB5 A;  3DXM B;  3FE1 A;  1ZBI A;  4K42 A;  4N47 A;  3DLR A;  1JLQ A;  3K58 A;  3OJS A;  4DB3 A;  1MDU B;  3O4W A;  1IG9 A;  5JS1 A;  4CJ3 A;  3AVH A;  3FZM A;  2HF3 A;  5AQS A;  4AM7 A;  3C0B A;  4M3Z A;  1C0G A;  2ASP A;  2O4G A;  2PY5 A;  3VEW A;  3HBT A;  5FDL A;  5GIP A;  1RDU A;  2HF4 A;  1JCG A;  5AQQ A;  2OPR A;  3IS9 A;  2O8E A;  4DTR A;  1IV0 A;  4NLC A;  1LV5 A;  1HNV A;  2G8W A;  1KSP A;  4Z94 A;  1RBS A;  4FZZ A;  4CZM A;  1XI1 A;  1ATR A;  3VTI A;  4CEO A;  1K8K A;  4N41 A;  1LWC A;  2D0B A;  4BRA A;  1IBM K;  4K25 A;  1W0H A;  3EN9 A;  1C0M A;  1KCF A;  4DTO A;  1LWE A;  5FPE A;  3LDQ A;  1UA1 A;  1EX4 A;  4AHV A;  3AVK A;  2BDP A;  1WN7 A;  2QI2 A;  1KAZ A;  1RT3 A;  3EKS A;  4OPH A;  1BA1 A;  1VRT A;  3THW A;  3I0R A;  4E7I A;  4DV3 K;  3K9K A;  1E3M A;  1I3A A;  3C6H A;  4BRK A;  1G99 A;  3S41 A;  4Q5V A;  3ZT2 A;  2WUS A;  3HOS A;  3V9U A;  1W7A A;  4W5O A;  3SBG A;  2D1K A;  3RMD A;  2Q0U A;  4BQL A;  4BVO A;  4JNE A;  5C2F A;  1NGE A;  4UY8 O;  3MX5 A;  3B8A X;  1RT6 A;  3OBW A;  4HUE A;  3QEX A;  1WBD A;  1HNX K;  4N56 A;  4CER A;  3WXM B;  5CE3 A;  4H5R A;  4JS4 A;  1ZBL A;  3V1Q A;  2YHA A;  4CGJ A;  3C6A A;  1YTA A;  2CGJ A;  3KVG A;  3ZSW A;  3CXC M;  2JWL A;  1JCF A;  2NRW A;  5LY3 A;  4DU3 A;  1IKV A;  3KK3 A;  4JK9 A;  2NRT A;  4ZTJ A;  4AQY K;  1TVR A;  3DLG A;  1NJI O;  4CGI A;  5A2Q O;  3DAW A;  4IO9 L;  4DR4 K;  3C7N B;  2E88 A;  3UKU B;  1DGK N;  3SQ0 A;  4EZ6 A;  4FPB A;  1HQU A;  3IKM A;  4OLB A;  2QWM A;  3QBW A;  3K5M A;  3ZSO A;  4FSV A;  4G9Z A;  4WQ4 C;  2DY4 A;  2YHW A;  5KI6 A;  2ZM6 K;  3ITH A;  4G1Q A;  4CHP A;  2GX9 A;  4KKO A;  4JRQ A;  3KIO A;  4H5N A;  4PHT X;  3FLC O;  4YDU C;  4GMJ B;  3CC2 N;  3DXK A;  4O8K A;  4K0K K;  2NRZ A;  2WON A;  3ZT4 A;  3UE5 A;  3MWT A;  4CEB A;  5J2P A;  2IDO A;  5SZT A;  4FM2 A;  4BRI A;  1NWK A;  2VG5 A;  2E6M A;  3ALY A;  3R3L A;  3TAM A;  1JLF A;  4XH4 A;  4Y1C A;  1RDC A;  2P9I A;  3D6R A;  1S5J A;  3R6M A;  4I9Q A;  3M6G A;  3N4Q A;  4H4O A;  3TAN A;  4DTM A;  4BC4 A;  4HWI A;  3VPZ A;  3E66 A;  1BOT O;  4KRF A;  3NF8 A;  3VQC A;  4IG0 A;  4DQ8 A;  3CJB A;  3SV3 A;  2NNW A;  4C8K A;  2IAJ A;  4E1J A;  5AQP A;  4JAX A;  3PUF A;  4CHN A;  4OO1 J;  2YHY A;  4MFB A;  3ZLJ A;  4DQS A;  2DFF A;  4GVM A;  2D0C A;  2UXC K;  4DFP A;  1XMQ K;  4LF6 K;  2PAV A;  4DCH A;  4CIG A;  2YKM A;  4CEC A;  4J2D A;  1RBU A;  3R9P A;  2F7T A;  1NK8 A;  1TYQ B;  3V9Z A;  1QQM A;  1YVN A;  3LM9 A;  2Z1H A;  1KFS A;  3O3F A;  3AO1 A;  5FPN A;  2KZM A;  4CHZ A;  1LW2 A;  3L3U A;  1NJW A;  4RWT A;  4LSL A;  3I33 A;  1RTD A;  4O8U A;  4NLB A;  4B9T A;  4JD2 B;  2UUB K;  2E20 A;  4YY3 K;  3JYT A;  4PUO A;  1JKH A;  3CG7 A;  4M45 A;  3VGK A;  3HP9 A;  4A2A A;  3KWI A;  2R7Y A;  3BP8 A;  1VQ4 N;  2UUA K;  4PL8 A;  3T7Z A;  2W42 A;  3ENB A;  4KFB A;  3O08 A;  2P9U A;  4CJE A;  3O9S A;  1RDW X;  1YF5 L;  1TL1 A;  3MDQ A;  3VEX A;  1KLN A;  2AP1 A;  1NNE A;  4GV9 A;  4B1X B;  1YAG A;  4DR1 K;  1BO5 O;  4JI6 K;  3VQQ A;  3OYD A;  3BY5 A;  1U45 A;  1IKW A;  3OYH A;  5JIC A;  1NKB A;  4KTZ A;  1RDA A;  3TTD A;  3QO9 A;  4MO4 A;  4NYF A;  3O9R A;  3I8D A;  2G8H A;  3EZW A;  4BR0 A;  4A61 A;  2G8K A;  1ASU A;  1WB9 A;  3AVL A;  3M1F A;  1IH7 A;  5AQV A;  2X6N A;  3QIN A;  4ISE A;  4BR2 A;  5GIN A;  3D7E O;  5F0X A;  1REV A;  1NGH A;  1NJY A;  4FJ8 A;  2ZJQ L;  1K8K B;  4GV6 A;  4BAC A;  3O6W A;  1MA9 B;  3PX4 A;  1NGF A;  2O8F B;  2IVN A;  3WXK A;  1VSL A;  2XY8 A;  2JGU A;  3SK3 A;  3TAE A;  1IKY A;  2IS3 A;  4ZTF A;  1OH6 A;  4CGH A;  2O8D B;  3P38 A;  4CD3 A;  4KB0 A;  1NMD A;  2Q31 A;  4DV5 K;  3ZSZ A;  2E6L A;  2ZF5 O;  4IKF A;  4KV8 A;  2HHV A;  4I9L A;  5LMU K;  2PYL A;  2X78 A;  3EE9 A;  5AQU A;  2DFH A;  3O4Q A;  3L2W A;  5JVG L;  2YJE A;  3QFP A;  4O5F A;  3K5N A;  2FSN A;  3KKR A;  4B1V A;  3VQ8 A;  5EY4 A;  2BGG A;  1BG3 A;  3RR7 A;  1NGI A;  1HX1 A;  3ZT3 A;  4B1Z A;  4EZ9 A;  4V19 S;  4X66 K;  1CZB A;  4E7K A;  2E2O A;  4CED A;  4K43 A;  4DLE A;  4CF9 A;  2O8B A;  1S9G A;  2EHG A;  2P1J A;  4C23 A;  3KTQ A;  3O5B A;  3NF6 A;  2Y1J A;  5M1P A;  1XC3 A;  1Z6R A;  1KTQ A;  1YJW N;  3WNH A;  1SKW A;  4OPA A;  4CE9 A;  4FWR A;  2RE2 A;  2VWK A;  4QS8 A;  3QLH A;  4H0O A;  2W40 A;  4CJV A;  3CCL N;  4F8R A;  3VA3 A;  3B6P A;  4KH4 A;  4H5T A;  4Z4H A;  1NM1 A;  2WBN A;  4FLY A;  1XC9 A;  3AO5 A;  1RBR A;  3OA9 A;  4FWS A;  3OS2 A;  5KRT A;  5GAE P;  5HOO A;  4WFB L;  3SAF A;  3QIP A;  1T6C A;  4CZL A;  4GVE A;  5AQG A;  1VQ7 N;  1L3S A;  4JI5 K;  1KVA A;  1Q86 O;  3JXU A;  4FJK A;  3E1Y A;  4NCA A;  1S1V A;  3DRP A;  2FF3 B;  2X74 A;  2VWB A;  4KHU A;  1VQ8 N;  2QXF A;  4N76 A;  3SUN A;  4EFH A;  2HMP A;  2OTJ N;  1D4X A;  5E26 A;  5KGW A;  4DV1 K;  3OYM A;  4RW7 A;  2E8A A;  3E9O A;  2IVO A;  2P9I B;  2ZD1 A;  1FK9 A;  2KZZ A;  3ENH A;  1XWL A;  2V7Y A;  4FJL A;  5B8H A;  1GLF O;  3P4I A;  1EXQ A;  2HVI A;  4B3T K;  5HRN A;  4CJU A;  3FZH A;  4GV3 A;  1D9F A;  2RPI A;  4DQP A;  4FLW A;  1SL2 A;  1HQE A;  4CZE A;  1WAJ A;  4DSI A;  3D2E A;  4HCC A;  4FK2 A;  3DLB A;  3EE8 A;  3AGK A;  4DFM A;  1LWF A;  5HP1 A;  1EKE A;  1T7P A;  5EU7 A;  3THY A;  3CC4 N;  1NBW A;  3AA3 A;  3L4Q A;  3ZET A;  5KPT A;  2I5J A;  5AFU H;  3QIO A;  1RFQ A;  2Q97 A;  2HND A;  4IJA A;  4CGG A;  3FFI A;  3VA0 A;  2ASO A;  4GKJ K;  4XH5 A;  4DTJ A;  3ATV A;  3H6E A;  4JEP A;  4EHT A;  5AFU A;  1GOC A;  3RMC A;  1HR0 K;  4F3O A;  3THX A;  4K8Z A;  3MX2 A;  1Q8I A;  1VSJ A;  4DR2 K;  5AQN A;  4ISG A;  1KLM A;  3ULD A;  3O1W A;  4DR6 K;  1ITG A;  3V9W A;  3A2F A;  4KHY A;  4BRD A;  3U3G A;  1WLJ A;  4CHQ A;  3I8B A;  3VQ6 A;  1QHA A;  5HRS A;  5JVH L;  3C6U A;  3U8X A;  3ZT0 A;  2HMI A;  2HHX A;  4W5R A;  2NRR A;  3VGL A;  2OZS A;  5LJV A;  1JJ2 M;  4KAZ A;  5J2Q A;  3S9H A;  2PZS A;  3F73 A;  2PYJ A;  4KI4 A;  4CHY A;  4CW7 B;  1VQK N;  1LCU A;  1OVQ A;  3G71 N;  4JKG A;  5ADX H;  5AZJ A;  1S1X A;  2RF2 A;  1VK0 A;  4OGE A;  4FOI A;  4WQ4 A; 
#chains in the Genus database with same CATH homology
 4OGC A;  3TAR A;  4FJ7 A;  3I0R A;  3L2U A;  4E7I A;  1W9H A;  4FZX C;  1KFD A;  2P51 A;  5DK5 A;  2OPS A;  3AVG A;  4FK0 A;  4E1M A;  1GOB A;  2DTU A;  4KB1 A;  3QET A;  3PX0 A;  1C0T A;  1I3A A;  4OVL A;  4Q5V A;  4RW8 A;  3VQB A;  1Z26 A;  3ZT2 A;  4RW9 A;  4Z0U A;  4CIE A;  2YNI A;  4WE1 A;  5HRP A;  4F4K A;  3V9U A;  3PV8 A;  3O3G A;  4DSL A;  4W5O A;  5C24 A;  3SPZ A;  3BDP A;  4FJ9 A;  4CGD A;  3RMD A;  1QSY A;  3QES A;  1QS4 A;  3DM2 A;  3PO4 A;  1VSI A;  2Z1G A;  4DS4 A;  2F8T A;  5D3G A;  3LZI A;  1QQC A;  1RT6 A;  3LP0 A;  3EYZ A;  4HUE A;  3QEX A;  4KI6 A;  5T7B A;  3K57 A;  1HPZ A;  1VRU A;  4CER A;  4N56 A;  4IBN A;  4E7L A;  2OZM A;  4M3Y A;  4JS4 A;  1SKS A;  1C0U A;  1ZBL A;  4M41 A;  3CYM A;  4DWI A;  3VQE A;  1B9D A;  2YHA A;  3V1Q A;  4CGJ A;  3HXM A;  4CHO A;  4CF8 A;  5C42 A;  1YTA A;  2D0A A;  3ZSW A;  4PQU A;  3NE6 A;  3NGZ A;  4FJJ A;  4W5T A;  2XHB A;  3OYJ A;  4DU3 A;  1IKV A;  3KK3 A;  3IAY A;  4FJ5 A;  3MEG A;  4ZTJ A;  1TVR A;  3DLG A;  2GUI A;  2FBT A;  1KRP A;  4KHS A;  4CGI A;  2ETJ A;  3AVB A;  1S9E A;  3WNG A;  3SQ2 A;  4DTU A;  4M3U A;  5CY4 A;  3D45 A;  4QOZ B;  3SNN A;  1BQN A;  4CJL A;  1A5V A;  1RBT A;  2Z1J A;  3V6D A;  3SQ0 A;  1BIS A;  5JS2 A;  1VSE A;  3TAG A;  4DF8 A;  4EZ6 A;  1A5X A;  1HQU A;  2BE2 A;  3M8S A;  4OLB A;  3LAM A;  4UQG A;  1CZ9 A;  2YNH A;  3C94 A;  3M8P A;  3HL8 A;  3ZSO A;  3K5M A;  3RMB A;  2P5G A;  3HK2 A;  2DY4 A;  1JL1 A;  5KI6 A;  5J2M A;  3CFP A;  3ITH A;  4G1Q A;  4Z4E A;  3KLH A;  4L8R B;  2G8I A;  4DMN A;  1R0A A;  4CHP A;  1Z25 A;  4HUF A;  4FM0 A;  1RIL A;  4OPK A;  4KHN A;  4KKO A;  4JRQ A;  3KIO A;  1BHL A;  3T1A A;  4M3W A;  4GMJ B;  3VQ7 A;  1HRH A;  4C8O A;  1L3V A;  4LSN A;  3ZT1 A;  2ZQB A;  3G10 A;  4BE1 A;  4B8A B;  1WAF A;  3HYF A;  2WON A;  3ZT4 A;  4CK1 A;  3AVN A;  3DLK A;  1NKE A;  3U3Y A;  3TAB A;  4CEB A;  5J2P A;  5K14 A;  2IDO A;  5SZT A;  3OYG A;  3F9K A;  3TWH A;  1U49 A;  4CEF A;  1T8E A;  4E89 A;  1WSH A;  4FM2 A;  2KFZ A;  2VG5 A;  1N5Y A;  3OYF A;  3NF7 A;  3SV4 A;  4DS5 A;  2E6M A;  3ALY A;  4FCY A;  3TAM A;  5CZ2 A;  1BI4 A;  1J9A A;  1JLF A;  3LP1 A;  1JL2 A;  5FRM A;  1SKR A;  4Y1C A;  1RBV A;  3AVI A;  1TV6 A;  4Z4I A;  1DTT A;  1RDC A;  1QHT A;  1RT5 A;  4CIF A;  1S5J A;  3C6T A;  4AIL C;  4M3X A;  4KHW A;  4YFU A;  4JS5 A;  3S3N A;  3K59 A;  1RCH A;  4I9Q A;  2JLE A;  3ISN C;  4C8N A;  3DI6 A;  1YTU A;  4RW6 A;  3WNF A;  5E41 A;  4H4O A;  1WNS A;  4DU1 A;  4W5Q A;  3TAN A;  3SUQ A;  2YV0 X;  4BDY A;  4DLG A;  4DTM A;  1QTM A;  1NOZ A;  3IG1 A;  2G8V A;  4FJX A;  3HPH A;  4O0J A;  3MAQ A;  3L2R A;  5I3U A;  3DLH A;  4CK3 A;  3AO2 A;  3NH0 A;  4C8L A;  4FJI A;  4PWD A;  1Y97 A;  4KRF A;  3NF8 A;  3KD1 E;  1TKD A;  3VQC A;  4IG0 A;  2B6A A;  4I2Q A;  4OJR A;  4CJS A;  3HVR A;  3PY8 A;  3C95 A;  3SV3 A;  4FVM A;  4C8K A;  4CJW A;  4B9S A;  3AA2 A;  1ZBH A;  2IAJ A;  1B9F A;  4O5B A;  1IKX A;  1C1C A;  3OYE A;  4BDZ A;  3PUF A;  3OYN A;  3OYK A;  2FBX A;  3L8B A;  1HJR A;  4CHN A;  2FBY A;  1UAX A;  1VSK A;  3KLF A;  3T3F A;  4OKK A;  1L5U A;  1NK4 A;  4MFB A;  2IGI A;  1C6V A;  4DQS A;  2DFF A;  1WSE A;  4GVM A;  4MQ3 A;  2D0C A;  3AVF A;  4RW4 A;  1X9W A;  4Z4F A;  4DFP A;  4M42 A;  4CIG A;  1J5O A;  4CJ5 A;  1BCM A;  4LH4 A;  3L3V A;  3OYL A;  2YKM A;  1IO2 A;  4CEC A;  5SWM A;  4IG3 A;  4K8X A;  4J2D A;  4FW1 A;  1RBU A;  1L3U A;  1HMV A;  3LWL A;  4FLV A;  1D5A A;  4FLX A;  1J54 A;  1KVC A;  1NK8 A;  3V9X A;  3V9Z A;  4CF2 A;  3LZJ A;  4AHS A;  5CYQ A;  3LDS A;  2Z1H A;  4KHQ A;  5CYM A;  1KFS A;  2B5J A;  3AO1 A;  4B8C A;  3O3F A;  2KZM A;  1BQM A;  4CHZ A;  1LW2 A;  3L3U A;  1NJW A;  4LSL A;  1LW0 A;  5HLF A;  4EP5 A;  3M8Q A;  3S3O A;  4E7J A;  1RTD A;  1A5W A;  2XO7 A;  1BL3 A;  1S1W A;  3CQ8 A;  4BDP A;  4E19 A;  4B9T A;  1NK9 A;  1QSL A;  2ATQ A;  1BIZ A;  3VQ9 A;  4FLZ A;  5J1E A;  1JXE A;  4B9M A;  1HNI A;  3JYT A;  4PUO A;  1JKH A;  3CG7 A;  4M45 A;  1KVB A;  1RTJ A;  3HP9 A;  4B9V A;  4OKJ A;  4B9L A;  4CEA A;  3SUO A;  1L3T A;  1D8Y A;  4B9N A;  2R7Y A;  2KW4 A;  1LAV A;  3OS0 A;  1WSI A;  2HW3 A;  4JRP A;  4CJP A;  2D5R A;  4O4G A;  4YNQ A;  2W42 A;  3MXM A;  3CM6 A;  3U6F A;  4FYD A;  3TR8 A;  4CGF A;  4FXD A;  4KFB A;  4R5P A;  3VN5 A;  3QER A;  1RT7 A;  1RTH A;  3RRH A;  4CEQ A;  4CJE A;  3UIQ A;  4NYN A;  3AO3 A;  1TL1 A;  2XY6 A;  3QNO A;  1CXU A;  1KLN A;  1DTQ A;  4FJH A;  4CES A;  4FJM A;  2O4I A;  3AVM A;  3PX6 A;  2NUB A;  4BWM A;  3VQ4 A;  3DYA A;  3MXJ A;  2F8S A;  1RT2 A;  1YVU A;  1VSD A;  3VQQ A;  4JLH A;  3OYD A;  1U45 A;  4DQR A;  2OYQ A;  1IKW A;  3OYH A;  5KGX A;  2AJQ A;  1NKB A;  2QK9 A;  4KTZ A;  1RDA A;  4Q0B A;  3OYA A;  3QO9 A;  4H4M A;  4AHT A;  3QEV A;  4NYF A;  4O44 A;  3DRR A;  1J53 A;  1RTI A;  1TKT A;  2RKI A;  4BWJ A;  3I8D A;  3NAE A;  2G8H A;  4F2S A;  2KFN A;  4HTU A;  4AHR A;  3AO4 A;  1ASU A;  1I39 A;  1S1T A;  2EX3 A;  2G8K A;  1TK8 A;  3AVL A;  4CF0 A;  1IH7 A;  1TKZ A;  4KTW A;  4DTP A;  5HRO A;  3AA5 X;  3DRS A;  3WNE A;  2X6N A;  2IC3 A;  4IFV A;  5C25 A;  3QIN A;  3DOK A;  3HT3 A;  4CJF A;  4CCH A;  2KQ2 A;  5HRR A;  1X9M A;  1WSF A;  4CJR A;  1Q9X A;  3PO5 A;  1REV A;  1NJY A;  4FJ8 A;  2DFE A;  1UOC A;  3VQA A;  3VQP A;  3LPT A;  1RDB A;  4BAC A;  4Z4G A;  2XY5 A;  5FRN A;  1RDD A;  4PA1 A;  4F2R A;  1TAU A;  2KTQ A;  3AVA A;  3ASM A;  3NCI A;  4ELU A;  1JLG A;  4DFK A;  3PX4 A;  4KTQ A;  4EP4 A;  4CFA A;  5CZ1 A;  1WSJ A;  4HVJ A;  1VSL A;  2XY8 A;  2JGU A;  3V4I A;  3NH2 A;  4E1N A;  1XHX A;  3TAE A;  1IKY A;  2IS3 A;  4ZTF A;  4CFB A;  1CLQ A;  4M3T A;  3HPG A;  1JLC A;  4CGH A;  3HVT A;  3T19 A;  4DU4 A;  2Y1I A;  2QKK A;  2VWJ A;  3SCX A;  3DMJ A;  1RT1 A;  1XHZ A;  1U4B A;  2HHW A;  4FLT A;  4KB0 A;  1B92 A;  1ASV A;  3TAQ A;  2YNF A;  3P5J A;  4IFY A;  1QSS A;  3EZ5 A;  4KRE A;  1TK0 A;  3ZSZ A;  2E6L A;  2HNZ A;  2F96 A;  3CM5 A;  4CJK A;  3KD5 E;  4IKF A;  4KV8 A;  2HHV A;  4I9L A;  3NHG A;  2PYL A;  2X78 A;  3IRX A;  3JSM A;  1SV5 A;  4DSK A;  4KO0 A;  2B4J A;  1U48 A;  3P1G A;  3LP3 A;  2DFH A;  4E3S A;  1NKC A;  3O4Q A;  3ZSV A;  3MXI A;  1ZBF A;  4Y1D A;  3OS1 A;  3L2W A;  3SUP A;  1UA0 A;  4DSJ A;  1TGO A;  1SL0 A;  4ID5 A;  4LY7 A;  4BE0 A;  3K2P A;  3V1O A;  3NH1 A;  3LWM A;  4OPJ A;  3K5N A;  5FRO A;  3KKR A;  4ELV A;  1VSM A;  3VQ8 A;  4CJ4 A;  1S6P A;  2BGG A;  1FKO A;  3RR7 A;  2ZE2 A;  2A1R A;  3QEP A;  3ZT3 A;  1T03 A;  1TL3 A;  4EZ9 A;  2Z1I A;  4CFD A;  1CZB A;  4E7K A;  1EET A;  1DLO A;  3OY9 A;  3G0Z A;  4CED A;  4XIU A;  1SL1 A;  3RWU A;  4J2E A;  3LAL A;  4DLE A;  4CF9 A;  4FJN A;  1S9G A;  2EHG A;  2P1J A;  1NK7 A;  2YKN A;  4Z4C A;  3NF9 A;  4H8K A;  3AVJ A;  3NF6 A;  1JLA A;  1U04 A;  3AA4 A;  4AH9 A;  2Y1J A;  3KTQ A;  1KTQ A;  1S1U A;  2OPP A;  4HUG A;  3WNH A;  1EP4 A;  1SKW A;  3MED A;  3OYC A;  1HYV A;  4CE9 A;  3DLE A;  3D0P A;  3ZSX A;  2VWK A;  3QLH A;  4IDK A;  4CJV A;  1GOA A;  4HCB A;  4F8R A;  3VA3 A;  2GV9 A;  3B6P A;  4FLU A;  4Z4H A;  4B3O A;  2G8F A;  1TK5 A;  4CEE A;  3M8R A;  4FLY A;  1NK0 A;  2BAN A;  4PY5 A;  5HBM A;  4DTX A;  3AO5 A;  1RBR A;  3B6O A;  1XC9 A;  4B08 A;  3ZSQ A;  3HM9 A;  3BGR A;  1NJZ A;  1FXX A;  1Q9Y A;  2GBZ A;  4DSE A;  3KKS A;  1F21 A;  3OS2 A;  5KRT A;  1QE1 A;  3TAP A;  4B9U A;  3KLE A;  4J2B A;  1ASW A;  1VSH A;  3QIP A;  4ID1 A;  3SQ1 A;  3HO1 A;  1JLB A;  1ZBU A;  3K5L A;  3RTV A;  2LSN A;  2RN2 A;  4M3R A;  3SZ2 A;  3NGI A;  3MEE A;  4LD0 A;  3OVN A;  3QEW A;  3RMA A;  1C1A A;  3K5O A;  1L3S A;  1KVA A;  4QAG A;  4RG8 A;  3OJU A;  3LPU A;  3V1R A;  3KJV A;  4W5N A;  4FJK A;  4NCA A;  1S1V A;  3AVC A;  3DRP A;  3NDK A;  2X74 A;  3HPO A;  3RR8 A;  3CFR A;  4KHU A;  4KPY A;  2QXF A;  4N76 A;  4FW2 A;  3SUN A;  3HJF A;  2ITG A;  2FC0 A;  3HST B;  5DMR A;  1UWB A;  4C8M A;  1NK5 A;  3ZSR A;  4FZY A;  5KGW A;  3KLI A;  4BE2 A;  1YT3 A;  3OYM A;  4RW7 A;  3RRG A;  1BI4 B;  4GW6 A;  1JXB A;  3L2V A;  1D9D A;  1HYS A;  2IOC A;  3SQ4 A;  1HYZ A;  1MU2 A;  4FK4 A;  2ZD1 A;  3NBP A;  1FK9 A;  2KZZ A;  4E7H A;  1XWL A;  4FJG A;  2Q3S A;  1O1W A;  3O3H A;  3TAF A;  4FJL A;  4CK2 A;  3L2Q A;  3SPY A;  4LH5 A;  4O55 A;  2VG6 A;  1EXQ A;  2HVI A;  2YHB A;  3OYI A;  4F3T A;  5HRN A;  3SYZ A;  2QKB A;  3ZSY A;  4CFC A;  4CJU A;  2WOM A;  4HHT A;  4DTS A;  1ZYQ A;  1D9F A;  2RPI A;  3SJJ A;  4FLW A;  1SL2 A;  4DQP A;  1RT4 A;  3KK1 A;  1HQE A;  3SI6 A;  3I0S A;  1VSF A;  4I2P A;  1WAJ A;  4DSF A;  1TKX A;  4DQI A;  4DSI A;  1G15 A;  3S3M A;  2HHS A;  3V81 A;  1NK6 A;  3DOL A;  2XRI A;  4HCC A;  3THV A;  4FK2 A;  1BGX T;  3DLB A;  2FBV A;  3ZCM A;  4DFM A;  4AHU A;  5KRS A;  1N6Q A;  4DTN A;  1T05 A;  1CXQ A;  1LWF A;  2HHT A;  3HP6 A;  5HP1 A;  2P5O A;  1EKE A;  3AV9 A;  4NCG A;  3VQ5 A;  5J2N A;  2OA8 A;  4CEZ A;  4DF4 A;  1T7P A;  5EU7 A;  5KTQ A;  3KK2 A;  1ZBI A;  3LAK A;  4N47 A;  3DLR A;  1JLQ A;  3AA3 A;  3K58 A;  4E0D A;  2HHU A;  3OJS A;  4QCL A;  4FM1 A;  4CF1 A;  1IG9 A;  4ZHR A;  5JS1 A;  2I5J A;  3EY1 A;  3VQD A;  3QIO A;  2HVH A;  2HND A;  2VG7 A;  2HHQ A;  4CJ3 A;  3AVH A;  4OLA A;  4CGG A;  3FFI A;  4O0I A;  1NOY A;  2HNY A;  3LAN A;  3LP2 A;  3VA0 A;  4M3Z A;  2O4G A;  3MEC A;  4DTJ A;  3O4N A;  2PY5 A;  1GOC A;  3RMC A;  5I42 A;  1SUQ A;  2HB5 A;  5FDL A;  4F3O A;  1JLE A;  1C1B A;  4K8Z A;  3V9S A;  1BCO A;  1Q8I A;  1VSJ A;  4DFJ A;  2OPR A;  2E4L A;  3IS9 A;  1X1P A;  3NFA A;  1KLM A;  3ULD A;  1X9S A;  3CFO A;  4DTR A;  1LV5 A;  2X6S A;  3P83 D;  1HNV A;  2G8W A;  1S6Q A;  1ITG A;  3V9W A;  1KSP A;  3A2F A;  1WSG A;  4KHY A;  1RBS A;  3U3G A;  1WLJ A;  4AHC A;  1FKP A;  4CHQ A;  3VQ6 A;  1K6Y A;  4DQQ A;  4FZZ A;  1BIU A;  3QEI A;  2A1S A;  5HRS A;  4J2A A;  2HHX A;  3C6U A;  3ZT0 A;  1XI1 A;  2HMI A;  4CEO A;  4W5R A;  3E01 A;  4N41 A;  2OZS A;  1LWC A;  2D0B A;  1LAW A;  3OYB A;  2G8U A;  3H08 A;  4OKE A;  2OPQ A;  4NCB A;  1RNH A;  1W0H A;  4N5S A;  3QNN A;  2XY7 A;  4ELT A;  3KLG A;  1C0M A;  1KCF A;  4KAZ A;  5J2Q A;  3S9H A;  2PZS A;  3F73 A;  4DTO A;  1LWE A;  2PYJ A;  4KI4 A;  1TAQ A;  4CHY A;  1UA1 A;  1EX4 A;  1U47 A;  4ICL A;  4I7F A;  4AHV A;  2YNG A;  3AVK A;  4CJQ A;  4CJT A;  4DG1 A;  3TI0 A;  2BDP A;  1S1X A;  1WN7 A;  2RF2 A;  1VK0 A;  1NJX A;  1RT3 A;  4OGE A;  3NGY A;  1VRT A;  4TSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...