1CZ9A

Atomic resolution asv integrase core domain (d64n) from citrate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
139
structure length
139
Chain Sequence
b'QIWQTNFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AVIAN SARCOMA VIRUS INTEGRASE
publication title Atomic resolution structures of the core domain of avian sarcoma virus integrase and its D64N mutant.
pubmed doi rcsb
source organism Avian sarcoma virus
molecule tags Transferase
total genus 51
structure length 139
sequence length 139
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1cz9A00
3WNFA 2ITGA 4DS5A 4OLAA 3V9SA 1SUQA 1JL2A 1QQCA 4RW7A 1XI1A 1ZBHA 3OVNA 4CJ5A 2HB5A 4E7LA 4XIUA 4OJRA 1TVRA 1NKEA 2F8TA 4CJWA 4FZYA 5CZ2A 2G8HA 3O3HA 4RW9A 2D5RA 4AHSA 4B9TA 3NH0A 5K14A 1KLMA 3O4NA 3LDSA 2FBYA 1D9FA 4MQ3A 1L3SA 4R5PA 3OS1A 3HT3A 3QEIA 3KK1A 3LP2A 4FJNA 3V9WA 2R7YA 5DMRA 4DFJA 2BGGA 4CK2A 1LW0A 3MEDA 5I42A 1HQUA 3SCXA 3DMJA 5KI6A 4KTQA 2Y1IA 3TAQA 5J2NA 4J2AA 4CGFA 2F8SA 5HBMA 1HRHA 3E01A 4B9SA 4KHUA 4BWMA 2Z1JA 4Z4IA 3AA5X 4FW1A 3HPOA 1GOAA 1RT3A 4DSFA 3DI6A 4CF1A 3MEEA 4CJFA 3LZJA 1S6PA 1WSJA 3AVJA 4DU1A 4F2SA 4BDPA 2A1RA 4CJVA 3K5MA 1TV6A 3I8DA 4FJGA 3RRHA 2PY5A 3QEVA 2JGUA 3KK3A 5HRSA 4AHUA 3ZCMA 1IH7A 3T1AA 1VK0A 3WNGA 3LWLA 4NCBA 3V4IA 3DM2A 4CERA 4IKFA 4GMJB 4CEFA 3V1RA 4CHQA 4O4GA 3TAMA 5JS2A 4FJ5A 4DQSA 3VQ5A 3SPYA 2G8WA 4M45A 2D0CA 1CLQA 3I0RA 3QO9A 3IRXA 2W42A 4BACA 3V81A 1KCFA 4M42A 3F73A 1T05A 4ZHRA 5HRPA 1Q9XA 5D3GA 3RTVA 4KPYA 4DTRA 2HHVA 3O4QA 2VWJA 1D9DA 4DQPA 1Z25A 3VQEA 4M3ZA 1SL2A 4FJMA 3AO5A 4PQUA 5KRTA 4MFBA 3PX0A 4M3WA 4FJ8A 2B5JA 3QIPA 4PWDA 1LWEA 4GW6A 4CEEA 1Z26A 4KI6A 1VSKA 4IBNA 1S5JA 1BHLA 4IG0A 3V9UA 4DQRA 4IG3A 1C1BA 3KIOA 1J53A 1TAQA 3DLRA 5FROA 5J1EA 5EU7A 3V6DA 2Z1IA 4LSLA 4OVLA 1VSDA 3FFIA 1YVUA 1BQMA 4DQQA 2Y1JA 2YNFA 4Q5VA 1KFDA 1GOBA 1JLQA 3IG1A 3L2WA 1LW2A 4ICLA 5CYMA 3ZSQA 5J2MA 2ETJA 1WSHA 1TK0A 4CGHA 1IKWA 4JS4A 4CK3A 3M8QA 4CEOA 3OYFA 3TAPA 1L5UA 2PYJA 4CF0A 4F3TA 3NF9A 3KLGA 3TWHA 4KREA 3K57A 2OPSA 1X9WA 3OYIA 4EZ9A 1UA1A 1C0MA 1VSEA 3KKRA 3DLKA 4CF8A 1YTUA 4KHSA 1TL1A 2XY8A 4CFBA 1DTQA 1CXUA 4KHNA 3QNOA 2HNDA 3ASMA 4FW2A 3RR8A 3K2PA 1Y97A 1JKHA 3QIOA 3SPZA 2VWKA 3MECA 3QINA 1IKXA 3ALYA 1KTQA 4B3OA 3KKSA 4N56A 3NGIA 4JS5A 1QTMA 3OYAA 2VG7A 1WSIA 3HYFA 4N47A 4DF4A 3QEPA 3NBPA 3THVA 1SL0A 4FJHA 2NUBA 4AHRA 1ZBFA 3NH2A 2RPIA 4O44A 3CFPA 3K5NA 5HROA 1FK9A 3P83D 4CIGA 1HNVA 3AVBA 3VQQA 1TK5A 2OYQA 3QERA 4ID1A 2PZSA 5FDLA 4KKOA 4PUOA 4B9MA 1Q9YA 3SV4A 1RBRA 1RTJA 1KRPA 1WSFA 2X6NA 1RDCA 3QNNA 4CCHA 2X74A 4CEAA 3AA4A 4RW8A 1TKTA 1KVAA 4LD0A 4CGGA 3EY1A 4CEBA 3HM9A 4OLBA 2HHWA 2G8UA 4Z4GA 4FK4A 1J5OA 2DFEA 3AA3A 4E1NA 4DSLA 3HO1A 4OPJA 4F8RA 4CGIA 4CEDA 1RTIA 5C42A 4NCAA 5FRNA 4ELTA 1XHXA 3VQ6A 3KK2A 3AV9A 1S1XA 3KLHA 1JLGA 1S1TA 4UQGA 1C0UA 3QESA 4FJKA 2KZZA 5JS1A 2IC3A 3HPHA 2G8FA 3VN5A 2KQ2A 4CHOA 4JRQA 1CZBA 3AO1A 3NE6A 2G8KA 4FJXA 4E1MA 3DLEA 1HPZA 4RW6A 3ZSWA 1QSSA 3ZSOA 1B9FA 4QAGA 1TL3A 4FLYA 1RDAA 3IS9A 1HYSA 3B6OA 4N5SA 3S9HA 2Z1GA 4HVJA 3AVGA 4EP5A 4IFVA 5HRNA 2HVHA 3TAFA 1QSLA 3L2QA 1VSHA 3S3MA 4AHCA 3HSTB 3NGZA 1NK8A 3RRGA 4M3RA 1JLCA 4DG1A 1BIZA 1RBTA 3MAQA 4IFYA 1HYVA 4Z0UA 4FLXA 1BIUA 4E0DA 3PX6A 4DSJA 1NKBA 4W5OA 4B9LA 4LSNA 3HP6A 4FLWA 4KHQA 1IG9A 1JLBA 2HHUA 4BDZA 4DTSA 1DLOA 5SZTA 3AVAA 4EP4A 2HHSA 4KTZA 1NOZA 1WAFA 4HUGA 4BE1A 4FXDA 1ZBIA 4DU3A 4DLEA 4CJEA 1BI4B 3VQDA 3VQPA 3VQ8A 3OYBA 3KTQA 1G15A 3NF7A 4CIFA 3K58A 4GVMA 4FM1A 1HMVA 3OYMA 4W5RA 3S3OA 3AO4A 2HVIA 1S1UA 4CJKA 1T8EA 5HRRA 1NOYA 2OPRA 4AHVA 1C6VA 4CJQA 4I2PA 1RT6A 3LALA 3ZT4A 3U3YA 3U6FA 2EHGA 1U48A 4E7JA 3PX4A 4BWJA 1NK7A 4C8OA 1VSJA 1XWLA 3ZSZA 1U4BA 1NK6A 2ZD1A 3G0ZA 3OJUA 2X6SA 3LZIA 1SKWA 2IGIA 1MU2A 1JXEA 4DTMA 3AA2A 3SI6A 4RG8A 3O3GA 5KGXA 3TR8A 2XY7A 3AVIA 3TABA 1QE1A 3NHGA 4CFAA 4B9UA 4J2BA 4CECA 3NH1A 2FBXA 3SNNA 1A5VA 5C25A 3SUOA 2I5JA 3WNHA 1RBUA 2E6MA 3CG7A 3L3UA 4TSXA 4Z4CA 3TI0A 5T7BA 3RR7A 2P51A 3CFOA 1ZYQA 1RT4A 1YTAA 3OYNA 4O0JA 1SKSA 4DTUA 3OYDA 3O3FA 4BE0A 1L3VA 2RKIA 4CIEA 1C1CA 3M8PA 4FK0A 3A2FA 3VA3A 5I3UA 1A5WA 1BL3A 1T7PA 5FRMA 4FLZA 3KD5E 3NFAA 1SL1A 4JLHA 5CYQA 1RCHA 5CZ1A 1BQNA 1JLEA 3VQ9A 1BCOA 3AVNA 1JL1A 1NK0A 1NK4A 4E7KA 4F3OA 2YKNA 4AH9A 2QXFA 3OYEA 1EP4A 3L2UA 2XHBA 3SQ2A 4KB0A 2KTQA 4E3SA 1U47A 4FJIA 4OKKA 4CHPA 1LAVA 1D8YA 4AHTA 3AVMA 4CK1A 3LP0A 3IAYA 2G8IA 3CFRA 1UWBA 3HVRA 3EYZA 4E7HA 2IAJA 4EZ6A 3AVLA 4CHZA 3OYLA 4DTJA 1RT2A 2WONA 2VG5A 3CM6A 3RWUA 4I2QA 4PY5A 3AVHA 1RT7A 3NAEA 4KB1A 4DFMA 1JXBA 1LWCA 1EX4A 4DFKA 4H8KA 4FJLA 5E41A 3DLBA 3ULDA 2F96A 2Q3SA 1BISA 1W0HA 2GV9A 3AVFA 4C8MA 5KRSA 3RMBA 1UA0A 2KW4A 1F21A 4LH5A 4ELVA 1HNIA 3LAMA 4B08A 1RDBA 1WSEA 3RMDA 3C6UA 4CE9A 1DTTA 1TKZA 4K8ZA 1S6QA 4DU4A 4N76A 3AVCA 2HNYA 1WN7A 1RBSA 1FKOA 4M3YA 1X9MA 1K6YA 3P5JA 3KLEA 4FLTA 4Y1CA 3OYHA 1NJYA 4ELUA 2AJQA 3ITHA 3LANA 1TK8A 3HXMA 4DFPA 5HP1A 2P1JA 2Z1HA 3M8SA 1W9HA 3ZSRA 3TANA 3SJJA 3LP1A 4CGDA 3SV3A 3ZSVA 2YNIA 3OYCA 3L3VA 4DTPA 1CZ9A 1KLNA 1SV5A 1UOCA 4FLVA 1QHTA 2GUIA 4FZXC 3S3NA 3QLHA 3V1OA 2LSNA 4IDKA 3ZSXA 2RF2A 2DY4A 4H4OA 3NDKA 1IKYA 4CEZA 4KAZA 2X78A 4O0IA 2IOCA 4HTUA 3SUNA 1U45A 4FM2A 1ZBUA 2OPPA 3C94A 4M3UA 3T19A 3HK2A 3DOKA 1CXQA 1TKDA 2FBTA 1NJXA 4J2DA 2HHTA 2E4LA 1J54A 1B9DA 2EX3A 4CJLA 4W5TA 3VQ4A 4E19A 4DLGA 1RT5A 2XY6A 3D0PA 3I0SA 1B92A 1ZBLA 3P1GA 3K5LA 3ZT2A 4N41A 2O4IA 4OPKA 4CESA 4NYNA 1NJWA 3CM5A 3V9ZA 1L3UA 2RN2A 2P5OA 1A5XA 1WLJA 1BI4A 4FLUA 4DWIA 3ZT1A 4KRFA 4I9QA 1QS4A 4HHTA 3QEXA 1SKRA 1LV5A 1IKVA 2HHXA 1UAXA 4Z4EA 4C8NA 2OZMA 1TKXA 1NK5A 3T3FA 3OYGA 1YT3A 3MEGA 3LWMA 3HJFA 3HP9A 4BE2A 1I39A 4HCCA 4DSIA 4O55A 3LPTA 4M3XA 2HNZA 4I9LA 3L8BA 3ZT3A 1WNSA 1O1WA 4DTXA 2OA8A 3VQAA 4HUFA 1RDDA 3DRRA 3BDPA 4J2EA 4CHNA 2O4GA 1JLFA 1ASVA 3OYKA 3OYJA 4YFUA 1FKPA 4FM0A 4DQIA 4YNQA 1RT1A 1VRTA 3V1QA 4CJUA 4DSEA 2B4JA 4ID5A 3KLFA 4JRPA 3LPUA 1HJRA 3PUFA 1LAWA 2FC0A 1JLAA 2OZSA 1RILA 4H4MA 1ASWA 1VSFA 2ZQBA 3NF8A 1KFSA 4CJPA 5J2QA 2OPQA 2BDPA 3QETA 4W5QA 3B6PA 5C24A 3NF6A 3K5OA 4CFCA 4ZTJA 3F9KA 3PY8A 3SQ1A 1I3AA 1L3TA 2FBVA 3HL8A 4RW4A 2HHQA 3AO3A 4CJ3A 5HLFA 1RNHA 2PYLA 4L8RB 1U04A 1EKEA 2BANA 1IO2A 1KVCA 4B8CA 4CJRA 1KVBA 2BE2A 1HYZA 4Z4HA 2YV0X 3OS0A 3OS2A 3VQ7A 1KSPA 3KD1E 1REVA 5KGWA 4KI4A 3C95A 3JSMA 3HVTA 4F4KA 3MXJA 1C1AA 4FVMA 1NK9A 2DTUA 4CGJA 1S9EA 3LAKA 1BCMA 1TGOA 1BGXT 4B8AB 5J2PA 2E6LA 2HMIA 4NCGA 2A1SA 1XHZA 2YHAA 3DLGA 1XC9A 1NKCA 2ATQA 2XRIA 5KTQA 3M8RA 3TAGA 4M3TA 2WOMA 4K8XA 2QKBA 2HW3A 3VQBA 1VRUA 3D45A 4KFBA 2KFZA 1T03A 2YNHA 3DRSA 3CYMA 4LY7A 3SUPA 4W5NA 3KLIA 1N6QA 1S1VA 4KTWA 4CJTA 4CJ4A 3OJSA 1R0AA 1WAJA 3PO5A 2P5GA 4WE1A 4QOZB 3ZT0A 4BDYA 5SWMA 4Y1DA 3LP3A 2VG6A 4ZTFA 2DFHA 1D5AA 3BGRA 4KV8A 2XY5A 4FYDA 4I7FA 1HQEA 4OGEA 2YHBA 4Z4FA 4C8KA 4F2RA 4O5BA 1C0TA 4E89A 4AILC 2IDOA 4FJJA 4DSKA 3C6TA 2DFFA 1Q8IA 5CY4A 1ASUA 1ITGA 4PA1A 2XO7A 4KHYA 3TARA 1NJZA 3SZ2A 1S9GA 3VA0A 1N5YA 3UIQA 3CQ8A 4FJ7A 3SUQA 3NCIA 4DS4A 1X9SA 1EETA 3H08A 4DTOA 2IS3A 4HUEA 2KZMA 3EZ5A 4OKJA 4FCYA 1TAUA 3NGYA 3RMCA 3K59A 3HPGA 4E7IA 4FJ9A 2JLEA 2YNGA 4CF9A 3QEWA 1VSIA 2YKMA 1LWFA 3V9XA 3PV8A 2GBZA 3DRPA 3WNEA 3U3GA 3DLHA 4G1QA 3ISNC 1GOCA 4DMNA 3KJVA 4FZZA 4B9NA 3AVKA 3SQ0A 1U49A 2QKKA 4CF2A 3JYTA 3SQ4A 1QSYA 4NYFA 3AO2A 2KFNA 4OGCA 4KHWA 3VQCA 4CJSA 2ZE2A 5DK5A 1FXXA 3L2RA 1VSLA 3DYAA 2D0BA 3ZSYA 2D0AA 1J9AA 1WSGA 4KO0A 4CFDA 2B6AA 3SYZA 3MXIA 3PO4A 4HCBA 4QCLA 3OY9A 3MXMA 2G8VA 4CEQA 4Q0BA 4CHYA 1RTDA 3DOLA 1VSMA 1EXQA 4DTNA 3G10A 4B9VA 4C8LA 1S1WA 2QK9A 1X1PA 1RBVA 3L2VA 4LH4A 4DF8A 1RTHA 3TAEA 4OKEA 3RMAA 4FK2A 4M41A
chains in the Genus database with same CATH superfamily
2ITGA 4OLAA 4BRPA 1SUQA 1XI1A 2F4VK 4CJ5A 3C7NA 1TVRA 4FZYA 4ILHA 1BA0A 3O3HA 4RW9A 4AHSA 5K14A 1JCEA 4FWQA 3O4NA 2FBYA 2WUSA 1D9FA 4MQ3A 4R5PA 3O9QA 3H45C 2R7YA 3MEDA 4JKHA 4IOAL 3TAQA 4CGFA 2F8SA 1QHAA 3HPOA 1GOAA 3DI6A 2A1RA 1BA1A 4CJVA 3GOIA 2D0PA 2PY5A 3IKMA 4BC2A 2D0OA 4FWMA 4AM6A 4AHUA 5GINA 3T1AA 3LWLA 4OX9K 4CEFA 2NRVA 2FF6A 1Q82O 2QWNA 2W42A 3IRXA 2F9WA 4Y0WA 3D2FB 2HHVA 3ZEUA 3CJ1A 3G6EN 4M3ZA 4FJMA 3PX0A 4L3QA 4GW6A 2VQEK 5KPZA 3HOTA 2OANA 3V9UA 1VQKN 3LDNA 4IG3A 3LM9A 5FROA 4B3TK 3V6DA 4KH4A 1VSDA 3FFIA 1BQMA 2Y1JA 3GE1A 4NLBA 3SJHA 4JS4A 4CEOA 3TAPA 4F3TA 3TWHA 3K57A 2OPSA 1C0MA 3KKRA 1TL1A 4KBOA 4JI6K 4CFBA 2BH1A 4KHNA 4LFBK 4WQ4C 4O8KA 3QNOA 5BR8K 3L6QA 3ASMA 4B1YB 3MK6A 3VGMA 4BRAA 1JKHA 2JWKA 3SPZA 2VWKA 3ALYA 1KTQA 4JS5A 2GWJA 4CZGA 3H1QA 3ZX0A 3A8YA 1ZBFA 5AFUA 3NH2A 5HROA 3CFPA 4GV9A 2ZGYA 3P83D 2OYQA 3G25A 4ILGB 3VQQA 4IZ9A 3QERA 4KKOA 4B9MA 2ZWHA 1KRPA 3VERA 3SLCA 2X74A 1XNRK 1TKTA 4JKDA 4CEBA 2HHWA 1X3MA 4Z4GA 4LF6K 4F8RA 3VTIA 3AV9A 1S1TA 4FWRA 4CI6A 2V52B 3CC2N 1SZ2A 2AA4A 4CHOA 4JRQA 1MWMA 4E1MA 5JICA 4RW6A 3ZSOA 4FLYA 2ZF5O 1K8KB 4Z94A 3S9HA 4H03B 4HVJA 1NMNA 2PBDA 3AVGA 3ID6A 3TAFA 1QSLA 1VSHA 1HLUA 3S3MA 5AR0A 3NGZA 1NK8A 4MO4A 4Z0UA 1HYVA 4FLXA 5AQTA 1TYQB 3CI5A 1NNEA 1IG9A 1HKCA 4H5WA 4DTSA 1DLOA 4JK9A 2HHSA 1YUWA 4KTZA 1YI2N 5AQIA 2Q31A 4A5AA 3CCSN 4DLEA 3KTQA 4GVEA 3VQDA 4FM1A 3J7AP 3AO4A 3HOSA 1T8EA 2UYTA 4I2PA 1RT6A 1U4BA 3ZSZA 5A2QO 4FPBA 2X6SA 3EKUA 1MU2A 1YXQA 4DTMA 3AA2A 3SI6A 4RG8A 5BPLA 3O3GA 1BG3A 1Q86O 4BRKA 2HOEA 3NHGA 1HPMA 1UA1A 2UUCK 3SUOA 4KHSA 5T7BA 5M1QA 3CFOA 3ZLJA 1XUPO 4YY3K 1KAYA 1L3VA 2RKIA 3FFKB 5AZJB 3VA3A 1A5WA 4FVUA 1SL1A 1BQNA 3AVNA 4YOVA 3TTCA 1EQYA 1NK0A 5ELZA 1U2VA 1BU6O 2QXFA 3OYEA 4HWIA 1U47A 5KPRA 1LAVA 4CK1A 2O8BA 3IFRA 3CFRA 3OYLA 1EWRA 1DEJA 1RT2A 3CM6A 3ZYYX 2W41A 3H6EA 4I2QA 5M1FA 1TUUA 4PY5A 3AVHA 2P9PB 3NAEA 5AQHA 4DFMA 1LWCA 4FJLA 2KLAA 3LM2A 2GV9A 3RMBA 4BRMA 4FOEA 4B08A 1WSEA 3DXMA 4N76A 2HNYA 3AAQA 3BF3A 5EVZA 4M3YA 3TPQA 1NJYA 4ELUA 3THWB 2O8CB 1R59O 2P1JA 2Z1HA 3ZSRA 1WBDA 4CGDA 3CCRN 1GLAG 2YNIA 4DTPA 3EO3A 4CZFA 5EOYA 2GUIA 3S3NA 1GLEG 2VGNA 3V1OA 4RTFD 1N32K 4R79A 1ZC6A 3CCUN 4FWOA 4O0IA 4HTUA 2Q2RA 4FM2A 3T19A 1CXQA 1RDWX 2FBTA 4C1NI 4J2DA 2FLOA 1B9DA 3R9PA 3MX5A 2AP1A 2F9TA 2QWMA 4BR4A 3LDPA 3K5LA 3AY9A 1VQON 2O4IA 4OPKA 1NGAA 2P5OA 3ZT1A 3QEXA 1SKRA 2GEMA 1TKXA 4JAXA 3T3FA 1QVGM 3VGLA 1YT3A 3MEGA 3HJFA 3N4QA 4DSIA 3R3LA 4O55A 3LPTA 2HNZA 4I9LA 3ZT3A 3VQAA 4HUFA 1RDDA 1NBWA 5I9EB 2O4GA 4DV1K 1FKPA 1Q18A 4FM0A 1RT1A 3V1QA 3BP8A 3DXKB 3OHRA 4DUYK 4DSEA 4ID5A 3KLFA 4JRPA 2FC0A 5GAHP 1RILA 1ASWA 2ZQBA 4JI8K 2BDPA 3QETA 1ZBSA 3KVGA 5AJ3K 5C12A 3LL3A 4RW4A 5BN9A 3CCVN 3CC4N 4IO8A 1HJOA 4CJRA 5AZIB 2CGJA 1REVA 2P9LB 4BC3A 4F4KA 3L4QA 1C1AA 4GNIA 1BCMA 3SAHA 3UE5A 2UUAK 4B1UB 2ATQA 4ISEA 4K8XA 2HW3A 2E2OA 3E9PA 4KFBA 1C0GA 2YNHA 3VOVA 2O8EB 3EZWA 1E3MA 3KLIA 2P9SA 1S1VA 2W6LA 1R0AA 3PO5A 4WE1A 4ZTFA 1N33K 1D5AA 4FYDA 1VQ9N 2HF3A 2YHBA 1NGJA 3Q7CA 3CJBA 4C8KA 1W97L 3KWGA 4O5BA 5AFUH 4AILC 4FJJA 4DSKA 3C6TA 1Q8IA 5CY4A 1ASUA 4XH4A 3VF2A 3VA0A 5AQGA 5M1OA 4DS4A 3K59A 2VCPA 4CZMA 4E7IA 2YNGA 4C23A 3OBWA 3H3NO 2Q0UA 1VAZA 4H0OA 3U3GA 2FSKA 3CIPA 3ISNC 1GOCA 4DMNA 4B9NA 2QKKA 5M1KA 2E2PA 5HL7L 3P31A 3W3DA 3DJCA 4NYFA 4EHTA 1VSLA 1I94K 4KO0A 1WSGA 4CFDA 4PKIA 1CZAN 4JI4K 2ASMA 3CCQN 3FGUA 3DOLA 3BUZB 2E2QA 4B9VA 3I55N 1S1WA 4LH4A 4DF8A 4OKEA 1FJGK 2WTUA 3A0IX 2I7NA 4YOXA 3PIPL 5AQMA 2FSJA 3V9SA 2NNWA 2OCEA 1GLJO 2EWSA 1ZBHA 3OVNA 4XIUA 4OJRA 1NKEA 2F8TA 4CJWA 4MDAA 3CCLN 2D5RA 3CJAA 3SAFA 1L3SA 3GG4A 1VQMN 3V9WA 4DFJA 3MCAB 1LW0A 1HQUA 3SCXA 3DMJA 4B1WB 2Y1IA 4CZIA 4DV3K 1BUPA 5HBMA 4IO9L 3VEZA 3MEEA 3I8BA 4CJFA 1S6PA 3LZJA 3O1WA 3KHYA 3VGKA 4JI2K 2JGUA 4CZJA 2W40A 5HRSA 3FZMA 3ZCMA 4LF7K 4EFHA 4H0XB 4CERA 4IKFA 3G71N 3THXB 2G8WA 4OPAA 1CLQA 1KCFA 4GV3A 1XQSC 4DTRA 1D9DA 4PKHA 3QBWA 4BG8A 1ZXOA 3ZETA 1VQ6N 2JWLA 3AGKA 1LWEA 4CEEA 4X62K 5BPNA 4IBNA 1S5JA 2Q0RA 1BHLA 4IG0A 4DQRA 4JN4A 2ZJRL 5J1EA 3KIOA 3DLRA 1HR0K 3C6HA 5BRHA 4OVLA 3ENBA 4DQQA 2YNFA 1KFDA 1JLQA 1GOBA 5M1PA 3ZSQA 5CYMA 2P9UB 3H1VX 5AQJA 3M8QA 4GKKK 4WYBA 4CF0A 1X9WA 3FZFA 2XY8A 4IOXA 1CXUA 2WBNA 3RR8A 3K2PA 3QIOA 3MECA 3QINA 3CCJN 3U8XA 4N56A 1QTMA 3OYAA 4DF4A 4N47A 1LOTB 4PL7A 3WEEB 1MA9B 2NUBA 2OTLN 4JI7K 4O44A 4FWSA 1HNVA 4ID1A 2A6AA 1RBRA 2X6NA 4BR9A 1RDCA 4LFAK 3PLAA 4CEAA 3AA4A 2NRTA 1OVQA 5IWAK 3HM9A 4IEEA 5LJVA 2DFEA 3AA3A 4E1NA 2UXDK 4OPJA 5C42A 1RTIA 4ELTA 1XHXA 3VQ6A 1S1XA 2QWQA 5JS1A 3QESA 2IC3A 4K42A 3VN5A 3C0BA 1CZBA 3AO1A 2G8KA 3DAWA 3ZSWA 1HPZA 3EEQA 1B9FA 1TL3A 4B1ZA 3O6WA 2Z1GA 1K73O 4EP5A 5HRNA 5JVHL 3L2QA 4AHCA 5BRDA 1ATRA 4DV5K 4DG1A 1BIZA 1SQKA 4IFYA 4JKBA 3WXLA 1BIUA 3EN9A 2V7YA 3UKRB 1NKBA 4LSNA 3KWIA 4KHQA 4BR0A 1W2BM 4I6MB 1Y64A 2HHUA 4BDZA 1OH5A 1EO1A 3AVAA 4IDHA 2WFBA 3QB0A 4FXDA 1WAFA 4CJEA 3VQPA 3E9LA 5H1SQ 1QZ6A 3OYBA 3NF7A 3S3OA 4W5RA 2HVIA 5HRRA 2O8DB 2OPRA 4CJQA 3RSEB 3PX4A 1QVFM 4BWJA 2UUBK 4C8OA 1VSJA 3KK7A 2ZD1A 3G0ZA 3K9JA 1JXEA 5LL6Z 2XY7A 3HTVA 3TABA 3ENOA 2FBXA 2I5JA 4QS7A 3TI0A 4X64K 4OO1J 1ZYQA 1HNWK 4O0JA 4DTUA 3OYDA 1NG9A 1OKJA 3CXCM 3J80O 1C1CA 4XEIA 4KH5A 2Q97A 3A2FA 3CJ7A 5I3UA 1T7PA 4FLZA 4CZEA 3H46O 4A5BA 3KD5E 3NFAA 2E1ZA 1BCOA 1JL1A 3D6RA 5GIPA 3QDKA 1NK4A 1W7AA 4AH9A 1BDGA 4K43A 3SQ2A 4KB0A 2KTQA 4A59A 2VWBA 4OKKA 3MCPA 2ZJQL 3IAYA 2G8IA 3ULEA 3BZCA 4DTJA 4BR5A 1U6ZA 1BOTO 1QQOA 2VG5A 1YJNN 3O08A 1JXBA 1NGHA 1NLVA 2Q1NA 3CMAN 3VENA 3ULDA 2Q3SA 1BISA 5KRSA 3F2KA 4LH5A 2O8CA 4ELVA 1GLCG 1IJJA 4CE9A 1DTTA 1KC8O 3AVCA 3JXUA 3SMPA 2HMPA 1WN7A 4YOUA 1YHQN 5F0XA 3UB5A 3KLEA 3OYHA 3JS6A 3LANA 3HXMA 1W9HA 3LP1A 3OYCA 3L3VA 3D2EB 2O8FB 4JV5K 1SV5A 5B8HA 3MDQA 2RHKA 4BRDA 5BN8A 2HF4A 1NMDA 1IKYA 4CEZA 4BC5A 2X78A 5AQWA 2IOCA 3AAPA 1ZBUA 2OPPA 3QICA 4WFBL 4BGAA 3HK2A 1TKDA 1NJXA 2HHTA 5FPMA 3VQ4A 2HBMA 4E19A 2XY6A 1B92A 3DLLL 2F7TA 4U67L 4JI1K 4JKGB 1L3UA 3CM5A 3V9ZA 1A5XA 1WLJA 1BI4A 1P90A 1V4TA 2NRHA 1QS4A 1LV5A 1UAXA 4Z4EA 4C8NA 4H5TA 3UKUB 3HSCA 4HCCA 2UXBK 3L8BA 5BRFA 1WNSA 1O1WA 1BWFO 3J7YP 4CHNA 2KHOA 1ASVA 3OYKA 3OYJA 4YFUA 3C7NB 1VRTA 4CZKA 3SBTA 3SAGA 1RDUA 3LPUA 5AQUA 3PUFA 4YDUA 5J2QA 4W5QA 4ISFA 1GLLO 3VEVA 2H3GX 4CFCA 3F9KA 3F5TA 3HL8A 1NJIO 4CJ3A 1Z6RA 3MWTA 4KH6A 1XC3A 3Q7BA 1KVBA 2BE2A 4Z4HA 1HUXA 4KI4A 2NRRA 1HNZK 3VQ7A 1GLDG 2A5XA 2O8EA 4FVMA 4DR4K 4CGJA 5BPMA 5J2PA 1VQPN 2HMIA 3QFUA 1JJ2M 3VEOA 1XHZA 3DLGA 3J81O 1XC9A 1NKCA 2OTJN 2XRIA 5KTQA 4DUZK 2QKBA 1VRUA 4JHDB 1T03A 3DRSA 2RE2A 4PHTX 1YIJN 4W5NA 2KKZA 1N6QA 3FZKA 3ZEUB 3QFPA 3ZT0A 4KV8A 2P9NA 4OGEA 4DV2K 3CQXA 5ADXA 4F2RA 3O5BA 4E89A 3HI0A 5CHIA 2DFFA 3CD6N 4JD2B 3SZ2A 1S9GA 4A2AA 1N5YA 4JI3K 4FO0A 3H08A 4DTOA 4HUEA 2KZMA 1TAUA 1NGCA 1S3XA 3GBTA 2JLEA 5GADP 3QEWA 5TKWA 4BROA 4DV7K 1LWFA 3AARA 3HRGA 3PV8A 4JI5K 2GBZA 3DRPA 2HSTA 3DLHA 4G1QA 4C1NK 3SQ0A 4AQYK 3I33A 5DK5A 3L2RA 3ZSYA 2D0BA 4LF9K 2D0AA 4HCBA 4QCLA 3MXIA 3P4IA 3MXMA 5JLHA 2G8VA 4KHPK 4CHYA 3GL1A 1Z05A 4H5VA 4DR2K 1RTHA 3T69A 3TAEA 4M41A 1QQCA 4RW7A 4DHYA 4CVNE 4E7LA 2HB5A 3CCMN 4FOIA 5CZ2A 2G8HA 2A40A 4B9TA 5JVGL 3NH0A 3WQUA 2Q36A 1IBKK 4GV6A 3OS1A 4ISGA 3KK1A 3IUCA 5DMRA 4B3SK 4CK2A 1H1VA 4NLCA 5J2NA 4J2AA 1HRHA 4BWMA 2FF3B 3E9OA 1SAZA 3THXA 1WSJA 3AVJA 4F2SA 1EWQA 3I8DA 4J8FA 5CE3A 4DV4K 3QEVA 4WQ5A 4YDUC 4QS9A 4IWVA 3V4IA 3BF1A 4BQLA 1WBBA 4IEIA 2QWOA 2QM1A 3WQTA 3TAMA 3ZX3A 3VEXA 3SPYA 3R8EA 4M45A 2D0CA 1DT9A 3I0RA 3QO9A 4LFCK 3W0LA 3D7EO 2VWJA 4FSVA 1Z25A 4BC4A 1SL2A 1LCUA 3AO5A 4M3WA 4MFBA 3PSIA 4FJ8A 2B5JA 4DR6K 4IOCL 3CMEN 5AQYA 4BG9A 1J53A 1TAQA 4H0VB 3VEWA 2UU9K 4WFAL 2ZJPL 2Z1IA 3WT0A 4F9OA 5J2MA 3L2WA 1LW2A 1TK0A 4V19S 1WSHA 1IKWA 3T1YK 4CK3A 3OYFA 4DR1K 1L5UA 3HM8A 2PYJA 3NF9A 3KLGA 1VSEA 3DLKA 4CF8A 1YTUA 3WEEA 1WUAA 1DTQA 1DGKN 2P9IA 4IJAA 4K0KK 1KQSM 1IKXA 3NGIA 1U2VB 2VG7A 3QEPA 3THVA 3NBPA 1NGFA 4AHRA 3THYA 2O8BB 3K5NA 1J6ZA 3AVBA 3CJCA 3O9SA 2PZSA 5FDLA 4PUOA 1Q9YA 3SV4A 1RTJA 1WSFA 5C2FA 4B1XB 1NU0A 1NGIA 4CCHA 4BRCA 3QBXA 3EY1A 1ATSA 1KVAA 4ILJA 4PKGA 5BR9A 2G8UA 4FK4A 1J5OA 4FWKA 4DSLA 2A41A 3C65A 3HO1A 3OA9A 2CH5A 5FRNA 1N34K 3GDQA 3KLHA 1QQMA 1JLGA 2IVPA 4UQGA 4FJKA 2KZZA 3HPHA 2G8FA 2KQ2A 3U9DA 4BVPA 1GLBG 4RWTA 1T3VA 4FJXA 1QSSA 4QAGA 1RDAA 2J4RA 1NGEA 3IS9A 4CBWA 5GAGP 1HYSA 3UKRA 4CD3A 4M7YA 4IFVA 4I6MA 2HVHA 2UXCK 5LMUK 1IV0A 3HSTB 2IIRA 4XH1A 3RRGA 5GIOA 4M3RA 3MAQA 4JYAK 2YHYA 2WC9A 4DSJA 3ENHA 4FPAA 2ZGZA 3HP6A 2HHHK 5AQKA 1NGGA 2O8DA 1YVNA 1JLBA 2A42A 2FXUA 2GELA 4EP4A 3QMLA 3TTFA 3VEYA 2NRWA 1NOZA 4BE1A 2D4WA 4DU3A 3D2FA 4FJHA 4BRIA 4CIFA 3K58A 2YX6A 1HMVA 3OYMA 3O9TA 4JI0K 4CJKA 1VQLN 1NOYA 3U6FA 1U48A 2QWPA 4E7JA 3K0SA 5AQLA 1NK7A 3BEXA 4YHHK 4A61A 3OJUA 3LZIA 2IGIA 4WQ5C 2NLXA 5KGXA 3TR8A 4AM7A 3AVIA 4HTLA 4J2BA 5C25A 1XNQK 5AQFA 1RT4A 5JLFA 3OYNA 3OW2M 3O3FA 3N4PA 4BE0A 1S22A 5AQQA 3M8PA 4FK0A 4BRHA 2E1YA 5CYQA 1RCHA 3VQ9A 1HNXK 1QZ5A 4BR7A 4O5FA 1E4GT 4F3OA 4DB3A 4NB4A 4E3SA 3OBYA 4FJIA 4JK8A 3AVMA 3LP0A 1UWBA 1Q81O 1M1KO 1T44A 4B9QA 3RWUA 3PIOL 4BRFA 3BY5A 4KB1A 3WXIA 5C15A 4DFKA 3M6GA 5E41A 2F96A 4IJNA 1W0HA 1DKGD 4O8UA 1KD1O 1WB9A 2P9SB 1F21A 3FE1A 4AF1A 3RMDA 5AQXA 1FW6A 2O8FA 4DU4A 5IT9O 3VESA 4EHUA 4YOWA 1X9JA 1HKBA 4E1JA 5DM7L 3P5JA 1K8KA 4Y1CA 2E2NA 2AJQA 3ITHA 5AQVA 1KAZA 1TK8A 5HP1A 3M8SA 2NRZA 2HBKA 4XH5A 3EE9A 3ZSVA 1CZ9A 2YI1A 1QHTA 4JKAA 1ESVA 3QLHA 3ZSXA 2RF2A 4H4OA 5C2DA 3FLCO 2VYPA 4NXNK 4KAZA 1U45A 2HBLA 5FPNA 4M3UA 1QQNA 3CQYA 3DOKA 1TYQA 4LF8K 4G9ZA 1RT5A 1YAGA 3I0SA 4H0YB 4K25A 4BR2A 1OH7A 1NJWA 4A62A 4CESA 4YORA 2RN2A 4FLUA 4DWIA 3TTDA 4I9QA 4JEPA 2HHXA 1IKVA 1GLFO 3LDQA 1KXPA 2OZMA 1NK5A 2VQFK 4CZLA 3K9KA 3LWMA 3HP9A 4BE2A 3EE8A 4DTXA 4A57A 3FZHA 5KPTA 1JLFA 4CJUA 2B4JA 1P8ZA 1HJRA 2GX9A 1LAWA 4DR3K 1VSFA 3NF8A 4CJPA 3L4IA 3T7ZA 3B6PA 3NF6A 5AZJA 3A5LC 3K5OA 4ZTJA 3SQ1A 4LF4K 3AO3A 5FPEA 4B3MK 2CGLA 5HLFA 1RNHA 1U04A 1EKEA 1HYZA 3OS0A 2YV0X 3OS2A 1KSPA 4JHDA 2DTUA 1NK9A 1NGBA 3LAKA 1TGOA 1BGXT 4B8AB 1N8RO 4NCGA 2A1SA 3BZKA 3I56N 1D4XA 2YHAA 3WXJA 4LF5K 2P9PA 4M3TA 1TUYA 3M8RA 5C0YA 3A5OC 3D45A 3CYMA 4LY7A 3SUPA 1ILYA 3RVCA 4KTWA 4JD2A 4CJ4A 2P5GA 3ZETB 4BDYA 4Y1DA 2VG6A 3NVKA 3FZLA 3SBGA 4Z4FA 2NRXA 2A3ZA 3CPEA 2IDOA 2CH6A 3THWA 5MLCQ 4PA1A 3TARA 1V4SA 4MLHA 3UIQA 4U7BA 2E20A 1X9SA 5F2RA 2YHXA 4JNEA 4OKJA 4FCYA 1RFQA 3NGYA 4H0TB 3MMVA 2P9KB 4CF9A 5E84A 5E26A 3MN9A 4H5RA 5JMVA 4CBUA 1XMQK 1VQNN 4CD1A 3KJVA 4FZZA 3A5MC 4WF9L 3JYTA 3SQ4A 1QSYA 4KHWA 3PSFA 3TSPA 3VQCA 3DYAA 2HBJA 1C0FA 5AQRA 3PO4A 2B6AA 1JCGA 4YOTA 3SYZA 3HBTA 1OH8A 4Q0BA 1K9MO 5M1NA 1VSMA 3G10A 4C8LA 2QK9A 1X1PA 3CETA 3M1FA 1RBVA 2DPNA 4FK2A 4CBXA 3WNFA 4DS5A 4X66K 1JL2A 1VQ8N 3DXKA 1KLMA 5BREA 4YOYA 3VTHA 3LDSA 3QEIA 3HT3A 4FJNA 3LP2A 3O4WA 2BGGA 1T6DA 4JKCA 3ID8A 5I42A 3SK3A 3VMFB 5KI6A 3LDOA 4KTQA 3IMXA 2IVNA 3T1HK 3E01A 4B9SA 4KHUA 2Z1JA 4Z4IA 3AA5X 4FW1A 4DSFA 1RT3A 4K41A 5AZIA 4FWLA 5AQZA 4DV0K 4CF1A 2P9LA 4BRGA 4DU1A 4BDPA 3K5MA 1TV6A 1IG8A 3VETA 4FJGA 3RRHA 3KK3A 1IH7A 1VK0A 3WNGA 4BY9C 4NCBA 3DM2A 4GMJB 3V1RA 4BVOA 4O4GA 4CHQA 5JS2A 4FJ5A 4DQSA 3VQ5A 3V81A 4BACA 4M42A 3F73A 1T05A 4ZHRA 5HRPA 1Q9XA 5D3GA 3RTVA 4KPYA 3O4QA 1Q7YO 4DQPA 3VQEA 1ATNA 4PQUA 4PWDA 3O1BA 5KRTA 3QIPA 5FPDA 3TSUA 1Z26A 4KI6A 1VSKA 2NZTA 2YJEA 3G4SN 3AGRA 1C1BA 4DR5K 5EU7A 4LC9B 3O9RA 4LSLA 1YVUA 4Q5VA 3IG1A 4ICLA 4BGBA 2ETJA 4CGHA 2BTFA 1MDUB 4KREA 1HKGA 4EZ9A 3OYIA 1VQ4N 1E4FT 2I7PA 3P39A 2CGKA 1N36K 1IBLK 2HNDA 4FW2A 1Y97A 1X3NA 4B3OA 3KKSA 2QW9A 4A2BA 3HYFA 1WSIA 4CW7B 4CJ7A 1SL0A 2RPIA 2DY4A 1FK9A 3VPZA 4CIGA 2ZM6K 1TK5A 3ULEB 1JCFA 2PFUA 2ITMA 3QNNA 2ASOA 4RW8A 4LD0A 4CGGA 4OLBA 4CGIA 4CEDA 4NCAA 3KK2A 1M90O 3ATUA 1C0UA 1VQ7N 3MN6A 1VHXA 3NE6A 5C10A 3DLEA 2E88A 5AQOA 3B6OA 4N5SA 2YHWA 3CPWM 3WUHA 3E1YA 4BQZA 1JLCA 1RBTA 3LDLA 4E0DA 3PX6A 1OVYA 4H0PA 2D1KA 2IVOA 5TKYA 4EAHD 4W5OA 4FLWA 4B9LA 3M5RA 3U4LA 1WOQA 2ASPA 5HOOA 5SZTA 4HUGA 4PL8A 5LY3A 5LJWA 1ZBIA 1BI4B 3VQ8A 4BRLA 1G15A 4GVMA 4FWNA 3M3ZA 3A5NC 1S1UA 3CERA 1VQ5N 3NMUA 5GAEP 4AHVA 1C6VA 3F9MA 3L0QA 3LALA 3ZT4A 1G99A 3EKSA 3U3YA 4M7XA 2EHGA 1XWLA 1NK6A 1SKWA 1YITN 4BRNA 2BUPA 2QWLA 4JK7A 1QE1A 3C6AA 4CFAA 4B9UA 2QWRA 4CECA 3NH1A 3SNNA 1A5VA 2P9UA 3WNHA 1RBUA 2E6MA 3CG7A 3L3UA 4TSXA 4Z4CA 5LMNK 3RR7A 2P51A 3ZX2A 1YTAA 3MWPA 1SKSA 2QA4N 4MLEA 4CIEA 4OPHA 3J8AA 1BL3A 5FRMA 1BO5O 4JLHA 2E5LK 1SS6A 3TU5A 5CZ1A 1JLEA 3MN5A 3HZ6A 4E7KA 2YKNA 2XHBA 5AQNA 1EP4A 3L2UA 3U9ZA 4B1VA 4CHPA 1D8YA 4AHTA 4E7HA 3EYZA 3HVRA 2IAJA 4EZ6A 3AVLA 4CHZA 4NXMK 5EX5A 3O9UA 4H5NA 2WONA 4RCHA 3ATVA 2GUPA 2V51B 5CR4A 1RT7A 3WXKA 1EX4A 4H8KA 3DLBA 3AVFA 1UA0A 4C8MA 4BRQA 2KW4A 1HNIA 3LAMA 3WXMB 1RDBA 2V7ZA 4B3RK 3C6UA 2QXLA 1TKZA 3KZBA 1S6QA 4K8ZA 2YCHA 2P9NB 1RBSA 1FKOA 1X9MA 1K6YA 4FLTA 5AQPA 4DFPA 3TANA 4DV6K 3SJJA 3R6MA 3DXMB 3SV3A 5F1XA 1KLNA 3O8MA 4FWPA 1UOCA 4FLVA 4FZXC 1J5EK 3FR0A 2LSNA 4IDKA 3NDKA 3SUNA 3C94A 2E4LA 2QEXN 1J54A 2EX3A 4CJLA 4W5TA 4DLGA 1OH6A 3D0PA 1YJ9N 2YJFA 1MWKA 1ZBLA 4GKJK 3P1GA 3CF5L 3CC7N 3ZT2A 4N41A 4NYNA 4KRFA 4HHTA 2FSNA 3R1XA 2W6KA 3NVMA 1YJWN 3SMSA 4IXCA 3OYGA 3RSEA 2QI2A 3OTOK 1I39A 4M3XA 2OA8A 3VF4A 3DRRA 4J2EA 3BDPA 3CJ9A 4QS8A 4DQIA 4YNQA 1JLAA 1IBMK 2OZSA 1HX1A 3MX2A 4H4MA 2GTDA 1KFSA 3CHWA 2OPQA 2GWKA 3S41A 4X65K 5C24A 4JKEA 3O80A 3PY8A 1I3AA 1L3TA 1K8AO 1T6CA 2FBVA 2VGMA 3CCEN 2HHQA 5AQSA 2QTDA 4CZHA 2PYLA 4L8RB 3P38A 2BANA 1IO2A 1KVCA 4B8CA 4DCHA 3KD1E 5KGWA 3C95A 3JAMO 3JSMA 3HVTA 3J7ZO 3MXJA 1KAXA 1S9EA 5KQ8A 1XMOK 5ADXH 2E6LA 3DWLA 4DQ8A 4IFEA 3TAGA 2WOMA 3VQBA 2KFZA 1NM1A 5DM6L 4WCEL 2E8AA 4CJTA 3OJSA 1WAJA 4QOZB 4MDBA 5EY4A 3MN7A 5SWMA 3LP3A 4WQ4A 2DFHA 3BGRA 2XY5A 5KQDA 4I7FA 1HQEA 3B8AX 3EL2A 5FLXO 4UY8O 1C0TA 2P9KA 1NGDA 4EIAA 4DKWA 4M63C 1ITGA 2XO7A 4KHYA 1NJZA 3E66A 4WFNL 4DR7K 4FJ7A 3CQ8A 3SUQA 4BREA 3NCIA 3D2EA 1EETA 2IS3A 3EZ5A 3RMCA 3HPGA 4FJ9A 1VSIA 2YKMA 3V9XA 3IDHA 3WNEA 1YF5L 3H3OB 4JKFA 3AVKA 4NO7A 2P9IB 5EXWA 1U49A 4CF2A 3VF6A 4MO5A 3AO2A 2KFNA 4OGCA 1RGIA 4CJSA 2ZE2A 1FXXA 4JKGA 1O13A 1J9AA 1S72N 3OY9A 4CEQA 1RTDA 1EXQA 4DTNA 3THYB 1NWKA 3L2VA 4FL9A 4GY2B 2PAVA 3UKUA 3RMAA 3TSQA
chains in the Genus database with same CATH topology
3WNFA 2ITGA 4DS5A 4OLAA 3V9SA 1SUQA 1JL2A 1QQCA 4RW7A 1XI1A 1ZBHA 3OVNA 4CJ5A 2HB5A 4E7LA 4XIUA 4OJRA 1TVRA 1NKEA 2F8TA 4CJWA 4FZYA 5CZ2A 2G8HA 3O3HA 4RW9A 2D5RA 4AHSA 4B9TA 3NH0A 5K14A 1KLMA 3O4NA 3LDSA 2FBYA 1D9FA 4MQ3A 1L3SA 4R5PA 3OS1A 3HT3A 3QEIA 3KK1A 3LP2A 4FJNA 3V9WA 2R7YA 5DMRA 4DFJA 2BGGA 4CK2A 1LW0A 3MEDA 5I42A 1HQUA 3SCXA 3DMJA 5KI6A 4KTQA 2Y1IA 3TAQA 5J2NA 4J2AA 4CGFA 2F8SA 5HBMA 1HRHA 3E01A 4B9SA 4KHUA 4BWMA 2Z1JA 4Z4IA 3AA5X 4FW1A 3HPOA 1GOAA 1RT3A 4DSFA 3DI6A 4CF1A 3MEEA 4CJFA 3LZJA 1S6PA 1WSJA 3AVJA 4DU1A 4F2SA 4BDPA 2A1RA 4CJVA 3K5MA 1TV6A 3I8DA 4FJGA 3RRHA 2PY5A 3QEVA 2JGUA 3KK3A 5HRSA 4AHUA 3ZCMA 1IH7A 3T1AA 1VK0A 3WNGA 3LWLA 4NCBA 3V4IA 3DM2A 4CERA 4IKFA 4GMJB 4CEFA 3V1RA 4CHQA 4O4GA 3TAMA 5JS2A 4FJ5A 4DQSA 3VQ5A 3SPYA 2G8WA 4M45A 2D0CA 1CLQA 3I0RA 3QO9A 3IRXA 2W42A 4BACA 3V81A 1KCFA 4M42A 3F73A 1T05A 4ZHRA 5HRPA 1Q9XA 5D3GA 3RTVA 4KPYA 4DTRA 2HHVA 3O4QA 2VWJA 1D9DA 4DQPA 1Z25A 3VQEA 4M3ZA 1SL2A 4FJMA 3AO5A 4PQUA 5KRTA 4MFBA 3PX0A 4M3WA 4FJ8A 2B5JA 3QIPA 4PWDA 1LWEA 4GW6A 4CEEA 1Z26A 4KI6A 1VSKA 4IBNA 1S5JA 1BHLA 4IG0A 3V9UA 4DQRA 4IG3A 1C1BA 3KIOA 1J53A 1TAQA 3DLRA 5FROA 5J1EA 5EU7A 3V6DA 2Z1IA 4LSLA 4OVLA 1VSDA 3FFIA 1YVUA 1BQMA 4DQQA 2Y1JA 2YNFA 4Q5VA 1KFDA 1GOBA 1JLQA 3IG1A 3L2WA 1LW2A 4ICLA 5CYMA 3ZSQA 5J2MA 2ETJA 1WSHA 1TK0A 4CGHA 1IKWA 4JS4A 4CK3A 3M8QA 4CEOA 3OYFA 3TAPA 1L5UA 2PYJA 4CF0A 4F3TA 3NF9A 3KLGA 3TWHA 4KREA 3K57A 2OPSA 1X9WA 3OYIA 4EZ9A 1UA1A 1C0MA 1VSEA 3KKRA 3DLKA 4CF8A 1YTUA 4KHSA 1TL1A 2XY8A 4CFBA 1DTQA 1CXUA 4KHNA 3QNOA 2HNDA 3ASMA 4FW2A 3RR8A 3K2PA 1Y97A 1JKHA 3QIOA 3SPZA 2VWKA 3MECA 3QINA 1IKXA 3ALYA 1KTQA 4B3OA 3KKSA 4N56A 3NGIA 4JS5A 1QTMA 3OYAA 2VG7A 1WSIA 3HYFA 4N47A 4DF4A 3QEPA 3NBPA 3THVA 1SL0A 4FJHA 2NUBA 4AHRA 1ZBFA 3NH2A 2RPIA 4O44A 3CFPA 3K5NA 5HROA 1FK9A 3P83D 4CIGA 1HNVA 3AVBA 3VQQA 1TK5A 2OYQA 3QERA 4ID1A 2PZSA 5FDLA 4KKOA 4PUOA 4B9MA 1Q9YA 3SV4A 1RBRA 1RTJA 1KRPA 1WSFA 2X6NA 1RDCA 3QNNA 4CCHA 2X74A 4CEAA 3AA4A 4RW8A 1TKTA 1KVAA 4LD0A 4CGGA 3EY1A 4CEBA 3HM9A 4OLBA 2HHWA 2G8UA 4Z4GA 4FK4A 1J5OA 2DFEA 3AA3A 4E1NA 4DSLA 3HO1A 4OPJA 4F8RA 4CGIA 4CEDA 1RTIA 5C42A 4NCAA 5FRNA 4ELTA 1XHXA 3VQ6A 3KK2A 3AV9A 1S1XA 3KLHA 1JLGA 1S1TA 4UQGA 1C0UA 3QESA 4FJKA 2KZZA 5JS1A 2IC3A 3HPHA 2G8FA 3VN5A 2KQ2A 4CHOA 4JRQA 1CZBA 3AO1A 3NE6A 2G8KA 4FJXA 4E1MA 3DLEA 1HPZA 4RW6A 3ZSWA 1QSSA 3ZSOA 1B9FA 4QAGA 1TL3A 4FLYA 1RDAA 3IS9A 1HYSA 3B6OA 4N5SA 3S9HA 2Z1GA 4HVJA 3AVGA 4EP5A 4IFVA 5HRNA 2HVHA 3TAFA 1QSLA 3L2QA 1VSHA 3S3MA 4AHCA 3HSTB 3NGZA 1NK8A 3RRGA 4M3RA 1JLCA 4DG1A 1BIZA 1RBTA 3MAQA 4IFYA 1HYVA 4Z0UA 4FLXA 1BIUA 4E0DA 3PX6A 4DSJA 1NKBA 4W5OA 4B9LA 4LSNA 3HP6A 4FLWA 4KHQA 1IG9A 1JLBA 2HHUA 4BDZA 4DTSA 1DLOA 5SZTA 3AVAA 4EP4A 2HHSA 4KTZA 1NOZA 1WAFA 4HUGA 4BE1A 4FXDA 1ZBIA 4DU3A 4DLEA 4CJEA 1BI4B 3VQDA 3VQPA 3VQ8A 3OYBA 3KTQA 1G15A 3NF7A 4CIFA 3K58A 4GVMA 4FM1A 1HMVA 3OYMA 4W5RA 3S3OA 3AO4A 2HVIA 1S1UA 4CJKA 1T8EA 5HRRA 1NOYA 2OPRA 4AHVA 1C6VA 4CJQA 4I2PA 1RT6A 3LALA 3ZT4A 3U3YA 3U6FA 2EHGA 1U48A 4E7JA 3PX4A 4BWJA 1NK7A 4C8OA 1VSJA 1XWLA 3ZSZA 1U4BA 1NK6A 2ZD1A 3G0ZA 3OJUA 2X6SA 3LZIA 1SKWA 2IGIA 1MU2A 1JXEA 4DTMA 3AA2A 3SI6A 4RG8A 3O3GA 5KGXA 3TR8A 2XY7A 3AVIA 3TABA 1QE1A 3NHGA 4CFAA 4B9UA 4J2BA 4CECA 3NH1A 2FBXA 3SNNA 1A5VA 5C25A 3SUOA 2I5JA 3WNHA 1RBUA 2E6MA 3CG7A 3L3UA 4TSXA 4Z4CA 3TI0A 5T7BA 3RR7A 2P51A 3CFOA 1ZYQA 1RT4A 1YTAA 3OYNA 4O0JA 1SKSA 4DTUA 3OYDA 3O3FA 4BE0A 1L3VA 2RKIA 4CIEA 1C1CA 3M8PA 4FK0A 3A2FA 3VA3A 5I3UA 1A5WA 1BL3A 1T7PA 5FRMA 4FLZA 3KD5E 3NFAA 1SL1A 4JLHA 5CYQA 1RCHA 5CZ1A 1BQNA 1JLEA 3VQ9A 1BCOA 3AVNA 1JL1A 1NK0A 1NK4A 4E7KA 4F3OA 2YKNA 4AH9A 2QXFA 3OYEA 1EP4A 3L2UA 2XHBA 3SQ2A 4KB0A 2KTQA 4E3SA 1U47A 4FJIA 4OKKA 4CHPA 1LAVA 1D8YA 4AHTA 3AVMA 4CK1A 3LP0A 3IAYA 2G8IA 3CFRA 1UWBA 3HVRA 3EYZA 4E7HA 2IAJA 4EZ6A 3AVLA 4CHZA 3OYLA 4DTJA 1RT2A 2WONA 2VG5A 3CM6A 3RWUA 4I2QA 4PY5A 3AVHA 1RT7A 3NAEA 4KB1A 4DFMA 1JXBA 1LWCA 1EX4A 4DFKA 4H8KA 4FJLA 5E41A 3DLBA 3ULDA 2F96A 2Q3SA 1BISA 1W0HA 2GV9A 3AVFA 4C8MA 5KRSA 3RMBA 1UA0A 2KW4A 1F21A 4LH5A 4ELVA 1HNIA 3LAMA 4B08A 1RDBA 1WSEA 3RMDA 3C6UA 4CE9A 1DTTA 1TKZA 4K8ZA 1S6QA 4DU4A 4N76A 3AVCA 2HNYA 1WN7A 1RBSA 1FKOA 4M3YA 1X9MA 1K6YA 3P5JA 3KLEA 4FLTA 4Y1CA 3OYHA 1NJYA 4ELUA 2AJQA 3ITHA 3LANA 1TK8A 3HXMA 4DFPA 5HP1A 2P1JA 2Z1HA 3M8SA 1W9HA 3ZSRA 3TANA 3SJJA 3LP1A 4CGDA 3SV3A 3ZSVA 2YNIA 3OYCA 3L3VA 4DTPA 1CZ9A 1KLNA 1SV5A 1UOCA 4FLVA 1QHTA 2GUIA 4FZXC 3S3NA 3QLHA 3V1OA 2LSNA 4IDKA 3ZSXA 2RF2A 2DY4A 4H4OA 3NDKA 1IKYA 4CEZA 4KAZA 2X78A 4O0IA 2IOCA 4HTUA 3SUNA 1U45A 4FM2A 1ZBUA 2OPPA 3C94A 4M3UA 3T19A 3HK2A 3DOKA 1CXQA 1TKDA 2FBTA 1NJXA 4J2DA 2HHTA 2E4LA 1J54A 1B9DA 2EX3A 4CJLA 4W5TA 3VQ4A 4E19A 4DLGA 1RT5A 2XY6A 3D0PA 3I0SA 1B92A 1ZBLA 3P1GA 3K5LA 3ZT2A 4N41A 2O4IA 4OPKA 4CESA 4NYNA 1NJWA 3CM5A 3V9ZA 1L3UA 2RN2A 2P5OA 1A5XA 1WLJA 1BI4A 4FLUA 4DWIA 3ZT1A 4KRFA 4I9QA 1QS4A 4HHTA 3QEXA 1SKRA 1LV5A 1IKVA 2HHXA 1UAXA 4Z4EA 4C8NA 2OZMA 1TKXA 1NK5A 3T3FA 3OYGA 1YT3A 3MEGA 3LWMA 3HJFA 3HP9A 4BE2A 1I39A 4HCCA 4DSIA 4O55A 3LPTA 4M3XA 2HNZA 4I9LA 3L8BA 3ZT3A 1WNSA 1O1WA 4DTXA 2OA8A 3VQAA 4HUFA 1RDDA 3DRRA 3BDPA 4J2EA 4CHNA 2O4GA 1JLFA 1ASVA 3OYKA 3OYJA 4YFUA 1FKPA 4FM0A 4DQIA 4YNQA 1RT1A 1VRTA 3V1QA 4CJUA 4DSEA 2B4JA 4ID5A 3KLFA 4JRPA 3LPUA 1HJRA 3PUFA 1LAWA 2FC0A 1JLAA 2OZSA 1RILA 4H4MA 1ASWA 1VSFA 2ZQBA 3NF8A 1KFSA 4CJPA 5J2QA 2OPQA 2BDPA 3QETA 4W5QA 3B6PA 5C24A 3NF6A 3K5OA 4CFCA 4ZTJA 3F9KA 3PY8A 3SQ1A 1I3AA 1L3TA 2FBVA 3HL8A 4RW4A 2HHQA 3AO3A 4CJ3A 5HLFA 1RNHA 2PYLA 4L8RB 1U04A 1EKEA 2BANA 1IO2A 1KVCA 4B8CA 4CJRA 1KVBA 2BE2A 1HYZA 4Z4HA 2YV0X 3OS0A 3OS2A 3VQ7A 1KSPA 3KD1E 1REVA 5KGWA 4KI4A 3C95A 3JSMA 3HVTA 4F4KA 3MXJA 1C1AA 4FVMA 1NK9A 2DTUA 4CGJA 1S9EA 3LAKA 1BCMA 1TGOA 1BGXT 4B8AB 5J2PA 2E6LA 2HMIA 4NCGA 2A1SA 1XHZA 2YHAA 3DLGA 1XC9A 1NKCA 2ATQA 2XRIA 5KTQA 3M8RA 3TAGA 4M3TA 2WOMA 4K8XA 2QKBA 2HW3A 3VQBA 1VRUA 3D45A 4KFBA 2KFZA 1T03A 2YNHA 3DRSA 3CYMA 4LY7A 3SUPA 4W5NA 3KLIA 1N6QA 1S1VA 4KTWA 4CJTA 4CJ4A 3OJSA 1R0AA 1WAJA 3PO5A 2P5GA 4WE1A 4QOZB 3ZT0A 4BDYA 5SWMA 4Y1DA 3LP3A 2VG6A 4ZTFA 2DFHA 1D5AA 3BGRA 4KV8A 2XY5A 4FYDA 4I7FA 1HQEA 4OGEA 2YHBA 4Z4FA 4C8KA 4F2RA 4O5BA 1C0TA 4E89A 4AILC 2IDOA 4FJJA 4DSKA 3C6TA 2DFFA 1Q8IA 5CY4A 1ASUA 1ITGA 4PA1A 2XO7A 4KHYA 3TARA 1NJZA 3SZ2A 1S9GA 3VA0A 1N5YA 3UIQA 3CQ8A 4FJ7A 3SUQA 3NCIA 4DS4A 1X9SA 1EETA 3H08A 4DTOA 2IS3A 4HUEA 2KZMA 3EZ5A 4OKJA 4FCYA 1TAUA 3NGYA 3RMCA 3K59A 3HPGA 4E7IA 4FJ9A 2JLEA 2YNGA 4CF9A 3QEWA 1VSIA 2YKMA 1LWFA 3V9XA 3PV8A 2GBZA 3DRPA 3WNEA 3U3GA 3DLHA 4G1QA 3ISNC 1GOCA 4DMNA 3KJVA 4FZZA 4B9NA 3AVKA 3SQ0A 1U49A 2QKKA 4CF2A 3JYTA 3SQ4A 1QSYA 4NYFA 3AO2A 2KFNA 4OGCA 4KHWA 3VQCA 4CJSA 2ZE2A 5DK5A 1FXXA 3L2RA 1VSLA 3DYAA 2D0BA 3ZSYA 2D0AA 1J9AA 1WSGA 4KO0A 4CFDA 2B6AA 3SYZA 3MXIA 3PO4A 4HCBA 4QCLA 3OY9A 3MXMA 2G8VA 4CEQA 4Q0BA 4CHYA 1RTDA 3DOLA 1VSMA 1EXQA 4DTNA 3G10A 4B9VA 4C8LA 1S1WA 2QK9A 1X1PA 1RBVA 3L2VA 4LH4A 4DF8A 1RTHA 3TAEA 4OKEA 3RMAA 4FK2A 4M41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WNF A;  2ITG A;  4DS5 A;  4OLA A;  3V9S A;  1SUQ A;  1JL2 A;  1QQC A;  4RW7 A;  1XI1 A;  1ZBH A;  3OVN A;  4CJ5 A;  2HB5 A;  4E7L A;  4XIU A;  4OJR A;  1TVR A;  1NKE A;  2F8T A;  4CJW A;  4FZY A;  5CZ2 A;  2G8H A;  3O3H A;  4RW9 A;  2D5R A;  4AHS A;  4B9T A;  3NH0 A;  5K14 A;  1KLM A;  3O4N A;  3LDS A;  2FBY A;  1D9F A;  4MQ3 A;  1L3S A;  4R5P A;  3OS1 A;  3HT3 A;  3QEI A;  3KK1 A;  3LP2 A;  4FJN A;  3V9W A;  2R7Y A;  5DMR A;  4DFJ A;  2BGG A;  4CK2 A;  1LW0 A;  3MED A;  5I42 A;  1HQU A;  3SCX A;  3DMJ A;  5KI6 A;  4KTQ A;  2Y1I A;  3TAQ A;  5J2N A;  4J2A A;  4CGF A;  2F8S A;  5HBM A;  1HRH A;  3E01 A;  4B9S A;  4KHU A;  4BWM A;  2Z1J A;  4Z4I A;  3AA5 X;  4FW1 A;  3HPO A;  1GOA A;  1RT3 A;  4DSF A;  3DI6 A;  4CF1 A;  3MEE A;  4CJF A;  3LZJ A;  1S6P A;  1WSJ A;  3AVJ A;  4DU1 A;  4F2S A;  4BDP A;  2A1R A;  4CJV A;  3K5M A;  1TV6 A;  3I8D A;  4FJG A;  3RRH A;  2PY5 A;  3QEV A;  2JGU A;  3KK3 A;  5HRS A;  4AHU A;  3ZCM A;  1IH7 A;  3T1A A;  1VK0 A;  3WNG A;  3LWL A;  4NCB A;  3V4I A;  3DM2 A;  4CER A;  4IKF A;  4GMJ B;  4CEF A;  3V1R A;  4CHQ A;  4O4G A;  3TAM A;  5JS2 A;  4FJ5 A;  4DQS A;  3VQ5 A;  3SPY A;  2G8W A;  4M45 A;  2D0C A;  1CLQ A;  3I0R A;  3QO9 A;  3IRX A;  2W42 A;  4BAC A;  3V81 A;  1KCF A;  4M42 A;  3F73 A;  1T05 A;  4ZHR A;  5HRP A;  1Q9X A;  5D3G A;  3RTV A;  4KPY A;  4DTR A;  2HHV A;  3O4Q A;  2VWJ A;  1D9D A;  4DQP A;  1Z25 A;  3VQE A;  4M3Z A;  1SL2 A;  4FJM A;  3AO5 A;  4PQU A;  5KRT A;  4MFB A;  3PX0 A;  4M3W A;  4FJ8 A;  2B5J A;  3QIP A;  4PWD A;  1LWE A;  4GW6 A;  4CEE A;  1Z26 A;  4KI6 A;  1VSK A;  4IBN A;  1S5J A;  1BHL A;  4IG0 A;  3V9U A;  4DQR A;  4IG3 A;  1C1B A;  3KIO A;  1J53 A;  1TAQ A;  3DLR A;  5FRO A;  5J1E A;  5EU7 A;  3V6D A;  2Z1I A;  4LSL A;  4OVL A;  1VSD A;  3FFI A;  1YVU A;  1BQM A;  4DQQ A;  2Y1J A;  2YNF A;  4Q5V A;  1KFD A;  1GOB A;  1JLQ A;  3IG1 A;  3L2W A;  1LW2 A;  4ICL A;  5CYM A;  3ZSQ A;  5J2M A;  2ETJ A;  1WSH A;  1TK0 A;  4CGH A;  1IKW A;  4JS4 A;  4CK3 A;  3M8Q A;  4CEO A;  3OYF A;  3TAP A;  1L5U A;  2PYJ A;  4CF0 A;  4F3T A;  3NF9 A;  3KLG A;  3TWH A;  4KRE A;  3K57 A;  2OPS A;  1X9W A;  3OYI A;  4EZ9 A;  1UA1 A;  1C0M A;  1VSE A;  3KKR A;  3DLK A;  4CF8 A;  1YTU A;  4KHS A;  1TL1 A;  2XY8 A;  4CFB A;  1DTQ A;  1CXU A;  4KHN A;  3QNO A;  2HND A;  3ASM A;  4FW2 A;  3RR8 A;  3K2P A;  1Y97 A;  1JKH A;  3QIO A;  3SPZ A;  2VWK A;  3MEC A;  3QIN A;  1IKX A;  3ALY A;  1KTQ A;  4B3O A;  3KKS A;  4N56 A;  3NGI A;  4JS5 A;  1QTM A;  3OYA A;  2VG7 A;  1WSI A;  3HYF A;  4N47 A;  4DF4 A;  3QEP A;  3NBP A;  3THV A;  1SL0 A;  4FJH A;  2NUB A;  4AHR A;  1ZBF A;  3NH2 A;  2RPI A;  4O44 A;  3CFP A;  3K5N A;  5HRO A;  1FK9 A;  3P83 D;  4CIG A;  1HNV A;  3AVB A;  3VQQ A;  1TK5 A;  2OYQ A;  3QER A;  4ID1 A;  2PZS A;  5FDL A;  4KKO A;  4PUO A;  4B9M A;  1Q9Y A;  3SV4 A;  1RBR A;  1RTJ A;  1KRP A;  1WSF A;  2X6N A;  1RDC A;  3QNN A;  4CCH A;  2X74 A;  4CEA A;  3AA4 A;  4RW8 A;  1TKT A;  1KVA A;  4LD0 A;  4CGG A;  3EY1 A;  4CEB A;  3HM9 A;  4OLB A;  2HHW A;  2G8U A;  4Z4G A;  4FK4 A;  1J5O A;  2DFE A;  3AA3 A;  4E1N A;  4DSL A;  3HO1 A;  4OPJ A;  4F8R A;  4CGI A;  4CED A;  1RTI A;  5C42 A;  4NCA A;  5FRN A;  4ELT A;  1XHX A;  3VQ6 A;  3KK2 A;  3AV9 A;  1S1X A;  3KLH A;  1JLG A;  1S1T A;  4UQG A;  1C0U A;  3QES A;  4FJK A;  2KZZ A;  5JS1 A;  2IC3 A;  3HPH A;  2G8F A;  3VN5 A;  2KQ2 A;  4CHO A;  4JRQ A;  1CZB A;  3AO1 A;  3NE6 A;  2G8K A;  4FJX A;  4E1M A;  3DLE A;  1HPZ A;  4RW6 A;  3ZSW A;  1QSS A;  3ZSO A;  1B9F A;  4QAG A;  1TL3 A;  4FLY A;  1RDA A;  3IS9 A;  1HYS A;  3B6O A;  4N5S A;  3S9H A;  2Z1G A;  4HVJ A;  3AVG A;  4EP5 A;  4IFV A;  5HRN A;  2HVH A;  3TAF A;  1QSL A;  3L2Q A;  1VSH A;  3S3M A;  4AHC A;  3HST B;  3NGZ A;  1NK8 A;  3RRG A;  4M3R A;  1JLC A;  4DG1 A;  1BIZ A;  1RBT A;  3MAQ A;  4IFY A;  1HYV A;  4Z0U A;  4FLX A;  1BIU A;  4E0D A;  3PX6 A;  4DSJ A;  1NKB A;  4W5O A;  4B9L A;  4LSN A;  3HP6 A;  4FLW A;  4KHQ A;  1IG9 A;  1JLB A;  2HHU A;  4BDZ A;  4DTS A;  1DLO A;  5SZT A;  3AVA A;  4EP4 A;  2HHS A;  4KTZ A;  1NOZ A;  1WAF A;  4HUG A;  4BE1 A;  4FXD A;  1ZBI A;  4DU3 A;  4DLE A;  4CJE A;  1BI4 B;  3VQD A;  3VQP A;  3VQ8 A;  3OYB A;  3KTQ A;  1G15 A;  3NF7 A;  4CIF A;  3K58 A;  4GVM A;  4FM1 A;  1HMV A;  3OYM A;  4W5R A;  3S3O A;  3AO4 A;  2HVI A;  1S1U A;  4CJK A;  1T8E A;  5HRR A;  1NOY A;  2OPR A;  4AHV A;  1C6V A;  4CJQ A;  4I2P A;  1RT6 A;  3LAL A;  3ZT4 A;  3U3Y A;  3U6F A;  2EHG A;  1U48 A;  4E7J A;  3PX4 A;  4BWJ A;  1NK7 A;  4C8O A;  1VSJ A;  1XWL A;  3ZSZ A;  1U4B A;  1NK6 A;  2ZD1 A;  3G0Z A;  3OJU A;  2X6S A;  3LZI A;  1SKW A;  2IGI A;  1MU2 A;  1JXE A;  4DTM A;  3AA2 A;  3SI6 A;  4RG8 A;  3O3G A;  5KGX A;  3TR8 A;  2XY7 A;  3AVI A;  3TAB A;  1QE1 A;  3NHG A;  4CFA A;  4B9U A;  4J2B A;  4CEC A;  3NH1 A;  2FBX A;  3SNN A;  1A5V A;  5C25 A;  3SUO A;  2I5J A;  3WNH A;  1RBU A;  2E6M A;  3CG7 A;  3L3U A;  4TSX A;  4Z4C A;  3TI0 A;  5T7B A;  3RR7 A;  2P51 A;  3CFO A;  1ZYQ A;  1RT4 A;  1YTA A;  3OYN A;  4O0J A;  1SKS A;  4DTU A;  3OYD A;  3O3F A;  4BE0 A;  1L3V A;  2RKI A;  4CIE A;  1C1C A;  3M8P A;  4FK0 A;  3A2F A;  3VA3 A;  5I3U A;  1A5W A;  1BL3 A;  1T7P A;  5FRM A;  4FLZ A;  3KD5 E;  3NFA A;  1SL1 A;  4JLH A;  5CYQ A;  1RCH A;  5CZ1 A;  1BQN A;  1JLE A;  3VQ9 A;  1BCO A;  3AVN A;  1JL1 A;  1NK0 A;  1NK4 A;  4E7K A;  4F3O A;  2YKN A;  4AH9 A;  2QXF A;  3OYE A;  1EP4 A;  3L2U A;  2XHB A;  3SQ2 A;  4KB0 A;  2KTQ A;  4E3S A;  1U47 A;  4FJI A;  4OKK A;  4CHP A;  1LAV A;  1D8Y A;  4AHT A;  3AVM A;  4CK1 A;  3LP0 A;  3IAY A;  2G8I A;  3CFR A;  1UWB A;  3HVR A;  3EYZ A;  4E7H A;  2IAJ A;  4EZ6 A;  3AVL A;  4CHZ A;  3OYL A;  4DTJ A;  1RT2 A;  2WON A;  2VG5 A;  3CM6 A;  3RWU A;  4I2Q A;  4PY5 A;  3AVH A;  1RT7 A;  3NAE A;  4KB1 A;  4DFM A;  1JXB A;  1LWC A;  1EX4 A;  4DFK A;  4H8K A;  4FJL A;  5E41 A;  3DLB A;  3ULD A;  2F96 A;  2Q3S A;  1BIS A;  1W0H A;  2GV9 A;  3AVF A;  4C8M A;  5KRS A;  3RMB A;  1UA0 A;  2KW4 A;  1F21 A;  4LH5 A;  4ELV A;  1HNI A;  3LAM A;  4B08 A;  1RDB A;  1WSE A;  3RMD A;  3C6U A;  4CE9 A;  1DTT A;  1TKZ A;  4K8Z A;  1S6Q A;  4DU4 A;  4N76 A;  3AVC A;  2HNY A;  1WN7 A;  1RBS A;  1FKO A;  4M3Y A;  1X9M A;  1K6Y A;  3P5J A;  3KLE A;  4FLT A;  4Y1C A;  3OYH A;  1NJY A;  4ELU A;  2AJQ A;  3ITH A;  3LAN A;  1TK8 A;  3HXM A;  4DFP A;  5HP1 A;  2P1J A;  2Z1H A;  3M8S A;  1W9H A;  3ZSR A;  3TAN A;  3SJJ A;  3LP1 A;  4CGD A;  3SV3 A;  3ZSV A;  2YNI A;  3OYC A;  3L3V A;  4DTP A;  1CZ9 A;  1KLN A;  1SV5 A;  1UOC A;  4FLV A;  1QHT A;  2GUI A;  4FZX C;  3S3N A;  3QLH A;  3V1O A;  2LSN A;  4IDK A;  3ZSX A;  2RF2 A;  2DY4 A;  4H4O A;  3NDK A;  1IKY A;  4CEZ A;  4KAZ A;  2X78 A;  4O0I A;  2IOC A;  4HTU A;  3SUN A;  1U45 A;  4FM2 A;  1ZBU A;  2OPP A;  3C94 A;  4M3U A;  3T19 A;  3HK2 A;  3DOK A;  1CXQ A;  1TKD A;  2FBT A;  1NJX A;  4J2D A;  2HHT A;  2E4L A;  1J54 A;  1B9D A;  2EX3 A;  4CJL A;  4W5T A;  3VQ4 A;  4E19 A;  4DLG A;  1RT5 A;  2XY6 A;  3D0P A;  3I0S A;  1B92 A;  1ZBL A;  3P1G A;  3K5L A;  3ZT2 A;  4N41 A;  2O4I A;  4OPK A;  4CES A;  4NYN A;  1NJW A;  3CM5 A;  3V9Z A;  1L3U A;  2RN2 A;  2P5O A;  1A5X A;  1WLJ A;  1BI4 A;  4FLU A;  4DWI A;  3ZT1 A;  4KRF A;  4I9Q A;  1QS4 A;  4HHT A;  3QEX A;  1SKR A;  1LV5 A;  1IKV A;  2HHX A;  1UAX A;  4Z4E A;  4C8N A;  2OZM A;  1TKX A;  1NK5 A;  3T3F A;  3OYG A;  1YT3 A;  3MEG A;  3LWM A;  3HJF A;  3HP9 A;  4BE2 A;  1I39 A;  4HCC A;  4DSI A;  4O55 A;  3LPT A;  4M3X A;  2HNZ A;  4I9L A;  3L8B A;  3ZT3 A;  1WNS A;  1O1W A;  4DTX A;  2OA8 A;  3VQA A;  4HUF A;  1RDD A;  3DRR A;  3BDP A;  4J2E A;  4CHN A;  2O4G A;  1JLF A;  1ASV A;  3OYK A;  3OYJ A;  4YFU A;  1FKP A;  4FM0 A;  4DQI A;  4YNQ A;  1RT1 A;  1VRT A;  3V1Q A;  4CJU A;  4DSE A;  2B4J A;  4ID5 A;  3KLF A;  4JRP A;  3LPU A;  1HJR A;  3PUF A;  1LAW A;  2FC0 A;  1JLA A;  2OZS A;  1RIL A;  4H4M A;  1ASW A;  1VSF A;  2ZQB A;  3NF8 A;  1KFS A;  4CJP A;  5J2Q A;  2OPQ A;  2BDP A;  3QET A;  4W5Q A;  3B6P A;  5C24 A;  3NF6 A;  3K5O A;  4CFC A;  4ZTJ A;  3F9K A;  3PY8 A;  3SQ1 A;  1I3A A;  1L3T A;  2FBV A;  3HL8 A;  4RW4 A;  2HHQ A;  3AO3 A;  4CJ3 A;  5HLF A;  1RNH A;  2PYL A;  4L8R B;  1U04 A;  1EKE A;  2BAN A;  1IO2 A;  1KVC A;  4B8C A;  4CJR A;  1KVB A;  2BE2 A;  1HYZ A;  4Z4H A;  2YV0 X;  3OS0 A;  3OS2 A;  3VQ7 A;  1KSP A;  3KD1 E;  1REV A;  5KGW A;  4KI4 A;  3C95 A;  3JSM A;  3HVT A;  4F4K A;  3MXJ A;  1C1A A;  4FVM A;  1NK9 A;  2DTU A;  4CGJ A;  1S9E A;  3LAK A;  1BCM A;  1TGO A;  1BGX T;  4B8A B;  5J2P A;  2E6L A;  2HMI A;  4NCG A;  2A1S A;  1XHZ A;  2YHA A;  3DLG A;  1XC9 A;  1NKC A;  2ATQ A;  2XRI A;  5KTQ A;  3M8R A;  3TAG A;  4M3T A;  2WOM A;  4K8X A;  2QKB A;  2HW3 A;  3VQB A;  1VRU A;  3D45 A;  4KFB A;  2KFZ A;  1T03 A;  2YNH A;  3DRS A;  3CYM A;  4LY7 A;  3SUP A;  4W5N A;  3KLI A;  1N6Q A;  1S1V A;  4KTW A;  4CJT A;  4CJ4 A;  3OJS A;  1R0A A;  1WAJ A;  3PO5 A;  2P5G A;  4WE1 A;  4QOZ B;  3ZT0 A;  4BDY A;  5SWM A;  4Y1D A;  3LP3 A;  2VG6 A;  4ZTF A;  2DFH A;  1D5A A;  3BGR A;  4KV8 A;  2XY5 A;  4FYD A;  4I7F A;  1HQE A;  4OGE A;  2YHB A;  4Z4F A;  4C8K A;  4F2R A;  4O5B A;  1C0T A;  4E89 A;  4AIL C;  2IDO A;  4FJJ A;  4DSK A;  3C6T A;  2DFF A;  1Q8I A;  5CY4 A;  1ASU A;  1ITG A;  4PA1 A;  2XO7 A;  4KHY A;  3TAR A;  1NJZ A;  3SZ2 A;  1S9G A;  3VA0 A;  1N5Y A;  3UIQ A;  3CQ8 A;  4FJ7 A;  3SUQ A;  3NCI A;  4DS4 A;  1X9S A;  1EET A;  3H08 A;  4DTO A;  2IS3 A;  4HUE A;  2KZM A;  3EZ5 A;  4OKJ A;  4FCY A;  1TAU A;  3NGY A;  3RMC A;  3K59 A;  3HPG A;  4E7I A;  4FJ9 A;  2JLE A;  2YNG A;  4CF9 A;  3QEW A;  1VSI A;  2YKM A;  1LWF A;  3V9X A;  3PV8 A;  2GBZ A;  3DRP A;  3WNE A;  3U3G A;  3DLH A;  4G1Q A;  3ISN C;  1GOC A;  4DMN A;  3KJV A;  4FZZ A;  4B9N A;  3AVK A;  3SQ0 A;  1U49 A;  2QKK A;  4CF2 A;  3JYT A;  3SQ4 A;  1QSY A;  4NYF A;  3AO2 A;  2KFN A;  4OGC A;  4KHW A;  3VQC A;  4CJS A;  2ZE2 A;  5DK5 A;  1FXX A;  3L2R A;  1VSL A;  3DYA A;  2D0B A;  3ZSY A;  2D0A A;  1J9A A;  1WSG A;  4KO0 A;  4CFD A;  2B6A A;  3SYZ A;  3MXI A;  3PO4 A;  4HCB A;  4QCL A;  3OY9 A;  3MXM A;  2G8V A;  4CEQ A;  4Q0B A;  4CHY A;  1RTD A;  3DOL A;  1VSM A;  1EXQ A;  4DTN A;  3G10 A;  4B9V A;  4C8L A;  1S1W A;  2QK9 A;  1X1P A;  1RBV A;  3L2V A;  4LH4 A;  4DF8 A;  1RTH A;  3TAE A;  4OKE A;  3RMA A;  4FK2 A;  4M41 A; 
#chains in the Genus database with same CATH topology
 2ITG A;  4OLA A;  4BRP A;  1SUQ A;  1XI1 A;  2F4V K;  4CJ5 A;  3C7N A;  1TVR A;  4FZY A;  4ILH A;  1BA0 A;  3O3H A;  4RW9 A;  4AHS A;  5K14 A;  1JCE A;  4FWQ A;  3O4N A;  2FBY A;  2WUS A;  1D9F A;  4MQ3 A;  4R5P A;  3O9Q A;  3H45 C;  2R7Y A;  3MED A;  4JKH A;  4IOA L;  3TAQ A;  4CGF A;  2F8S A;  1QHA A;  3HPO A;  1GOA A;  3DI6 A;  2A1R A;  1BA1 A;  4CJV A;  3GOI A;  2D0P A;  2PY5 A;  3IKM A;  4BC2 A;  2D0O A;  4FWM A;  4AM6 A;  4AHU A;  5GIN A;  3T1A A;  3LWL A;  4OX9 K;  4CEF A;  2NRV A;  2FF6 A;  1Q82 O;  2QWN A;  2W42 A;  3IRX A;  2F9W A;  4Y0W A;  3D2F B;  2HHV A;  3ZEU A;  3CJ1 A;  3G6E N;  4M3Z A;  4FJM A;  3PX0 A;  4L3Q A;  4GW6 A;  2VQE K;  5KPZ A;  3HOT A;  2OAN A;  3V9U A;  1VQK N;  3LDN A;  4IG3 A;  3LM9 A;  5FRO A;  4B3T K;  3V6D A;  4KH4 A;  1VSD A;  3FFI A;  1BQM A;  2Y1J A;  3GE1 A;  4NLB A;  3SJH A;  4JS4 A;  4CEO A;  3TAP A;  4F3T A;  3TWH A;  3K57 A;  2OPS A;  1C0M A;  3KKR A;  1TL1 A;  4KBO A;  4JI6 K;  4CFB A;  2BH1 A;  4KHN A;  4LFB K;  4WQ4 C;  4O8K A;  3QNO A;  5BR8 K;  3L6Q A;  3ASM A;  4B1Y B;  3MK6 A;  3VGM A;  4BRA A;  1JKH A;  2JWK A;  3SPZ A;  2VWK A;  3ALY A;  1KTQ A;  4JS5 A;  2GWJ A;  4CZG A;  3H1Q A;  3ZX0 A;  3A8Y A;  1ZBF A;  5AFU A;  3NH2 A;  5HRO A;  3CFP A;  4GV9 A;  2ZGY A;  3P83 D;  2OYQ A;  3G25 A;  4ILG B;  3VQQ A;  4IZ9 A;  3QER A;  4KKO A;  4B9M A;  2ZWH A;  1KRP A;  3VER A;  3SLC A;  2X74 A;  1XNR K;  1TKT A;  4JKD A;  4CEB A;  2HHW A;  1X3M A;  4Z4G A;  4LF6 K;  4F8R A;  3VTI A;  3AV9 A;  1S1T A;  4FWR A;  4CI6 A;  2V52 B;  3CC2 N;  1SZ2 A;  2AA4 A;  4CHO A;  4JRQ A;  1MWM A;  4E1M A;  5JIC A;  4RW6 A;  3ZSO A;  4FLY A;  2ZF5 O;  1K8K B;  4Z94 A;  3S9H A;  4H03 B;  4HVJ A;  1NMN A;  2PBD A;  3AVG A;  3ID6 A;  3TAF A;  1QSL A;  1VSH A;  1HLU A;  3S3M A;  5AR0 A;  3NGZ A;  1NK8 A;  4MO4 A;  4Z0U A;  1HYV A;  4FLX A;  5AQT A;  1TYQ B;  3CI5 A;  1NNE A;  1IG9 A;  1HKC A;  4H5W A;  4DTS A;  1DLO A;  4JK9 A;  2HHS A;  1YUW A;  4KTZ A;  1YI2 N;  5AQI A;  2Q31 A;  4A5A A;  3CCS N;  4DLE A;  3KTQ A;  4GVE A;  3VQD A;  4FM1 A;  3J7A P;  3AO4 A;  3HOS A;  1T8E A;  2UYT A;  4I2P A;  1RT6 A;  1U4B A;  3ZSZ A;  5A2Q O;  4FPB A;  2X6S A;  3EKU A;  1MU2 A;  1YXQ A;  4DTM A;  3AA2 A;  3SI6 A;  4RG8 A;  5BPL A;  3O3G A;  1BG3 A;  1Q86 O;  4BRK A;  2HOE A;  3NHG A;  1HPM A;  1UA1 A;  2UUC K;  3SUO A;  4KHS A;  5T7B A;  5M1Q A;  3CFO A;  3ZLJ A;  1XUP O;  4YY3 K;  1KAY A;  1L3V A;  2RKI A;  3FFK B;  5AZJ B;  3VA3 A;  1A5W A;  4FVU A;  1SL1 A;  1BQN A;  3AVN A;  4YOV A;  3TTC A;  1EQY A;  1NK0 A;  5ELZ A;  1U2V A;  1BU6 O;  2QXF A;  3OYE A;  4HWI A;  1U47 A;  5KPR A;  1LAV A;  4CK1 A;  2O8B A;  3IFR A;  3CFR A;  3OYL A;  1EWR A;  1DEJ A;  1RT2 A;  3CM6 A;  3ZYY X;  2W41 A;  3H6E A;  4I2Q A;  5M1F A;  1TUU A;  4PY5 A;  3AVH A;  2P9P B;  3NAE A;  5AQH A;  4DFM A;  1LWC A;  4FJL A;  2KLA A;  3LM2 A;  2GV9 A;  3RMB A;  4BRM A;  4FOE A;  4B08 A;  1WSE A;  3DXM A;  4N76 A;  2HNY A;  3AAQ A;  3BF3 A;  5EVZ A;  4M3Y A;  3TPQ A;  1NJY A;  4ELU A;  3THW B;  2O8C B;  1R59 O;  2P1J A;  2Z1H A;  3ZSR A;  1WBD A;  4CGD A;  3CCR N;  1GLA G;  2YNI A;  4DTP A;  3EO3 A;  4CZF A;  5EOY A;  2GUI A;  3S3N A;  1GLE G;  2VGN A;  3V1O A;  4RTF D;  1N32 K;  4R79 A;  1ZC6 A;  3CCU N;  4FWO A;  4O0I A;  4HTU A;  2Q2R A;  4FM2 A;  3T19 A;  1CXQ A;  1RDW X;  2FBT A;  4C1N I;  4J2D A;  2FLO A;  1B9D A;  3R9P A;  3MX5 A;  2AP1 A;  2F9T A;  2QWM A;  4BR4 A;  3LDP A;  3K5L A;  3AY9 A;  1VQO N;  2O4I A;  4OPK A;  1NGA A;  2P5O A;  3ZT1 A;  3QEX A;  1SKR A;  2GEM A;  1TKX A;  4JAX A;  3T3F A;  1QVG M;  3VGL A;  1YT3 A;  3MEG A;  3HJF A;  3N4Q A;  4DSI A;  3R3L A;  4O55 A;  3LPT A;  2HNZ A;  4I9L A;  3ZT3 A;  3VQA A;  4HUF A;  1RDD A;  1NBW A;  5I9E B;  2O4G A;  4DV1 K;  1FKP A;  1Q18 A;  4FM0 A;  1RT1 A;  3V1Q A;  3BP8 A;  3DXK B;  3OHR A;  4DUY K;  4DSE A;  4ID5 A;  3KLF A;  4JRP A;  2FC0 A;  5GAH P;  1RIL A;  1ASW A;  2ZQB A;  4JI8 K;  2BDP A;  3QET A;  1ZBS A;  3KVG A;  5AJ3 K;  5C12 A;  3LL3 A;  4RW4 A;  5BN9 A;  3CCV N;  3CC4 N;  4IO8 A;  1HJO A;  4CJR A;  5AZI B;  2CGJ A;  1REV A;  2P9L B;  4BC3 A;  4F4K A;  3L4Q A;  1C1A A;  4GNI A;  1BCM A;  3SAH A;  3UE5 A;  2UUA K;  4B1U B;  2ATQ A;  4ISE A;  4K8X A;  2HW3 A;  2E2O A;  3E9P A;  4KFB A;  1C0G A;  2YNH A;  3VOV A;  2O8E B;  3EZW A;  1E3M A;  3KLI A;  2P9S A;  1S1V A;  2W6L A;  1R0A A;  3PO5 A;  4WE1 A;  4ZTF A;  1N33 K;  1D5A A;  4FYD A;  1VQ9 N;  2HF3 A;  2YHB A;  1NGJ A;  3Q7C A;  3CJB A;  4C8K A;  1W97 L;  3KWG A;  4O5B A;  5AFU H;  4AIL C;  4FJJ A;  4DSK A;  3C6T A;  1Q8I A;  5CY4 A;  1ASU A;  4XH4 A;  3VF2 A;  3VA0 A;  5AQG A;  5M1O A;  4DS4 A;  3K59 A;  2VCP A;  4CZM A;  4E7I A;  2YNG A;  4C23 A;  3OBW A;  3H3N O;  2Q0U A;  1VAZ A;  4H0O A;  3U3G A;  2FSK A;  3CIP A;  3ISN C;  1GOC A;  4DMN A;  4B9N A;  2QKK A;  5M1K A;  2E2P A;  5HL7 L;  3P31 A;  3W3D A;  3DJC A;  4NYF A;  4EHT A;  1VSL A;  1I94 K;  4KO0 A;  1WSG A;  4CFD A;  4PKI A;  1CZA N;  4JI4 K;  2ASM A;  3CCQ N;  3FGU A;  3DOL A;  3BUZ B;  2E2Q A;  4B9V A;  3I55 N;  1S1W A;  4LH4 A;  4DF8 A;  4OKE A;  1FJG K;  2WTU A;  3A0I X;  2I7N A;  4YOX A;  3PIP L;  5AQM A;  2FSJ A;  3V9S A;  2NNW A;  2OCE A;  1GLJ O;  2EWS A;  1ZBH A;  3OVN A;  4XIU A;  4OJR A;  1NKE A;  2F8T A;  4CJW A;  4MDA A;  3CCL N;  2D5R A;  3CJA A;  3SAF A;  1L3S A;  3GG4 A;  1VQM N;  3V9W A;  4DFJ A;  3MCA B;  1LW0 A;  1HQU A;  3SCX A;  3DMJ A;  4B1W B;  2Y1I A;  4CZI A;  4DV3 K;  1BUP A;  5HBM A;  4IO9 L;  3VEZ A;  3MEE A;  3I8B A;  4CJF A;  1S6P A;  3LZJ A;  3O1W A;  3KHY A;  3VGK A;  4JI2 K;  2JGU A;  4CZJ A;  2W40 A;  5HRS A;  3FZM A;  3ZCM A;  4LF7 K;  4EFH A;  4H0X B;  4CER A;  4IKF A;  3G71 N;  3THX B;  2G8W A;  4OPA A;  1CLQ A;  1KCF A;  4GV3 A;  1XQS C;  4DTR A;  1D9D A;  4PKH A;  3QBW A;  4BG8 A;  1ZXO A;  3ZET A;  1VQ6 N;  2JWL A;  3AGK A;  1LWE A;  4CEE A;  4X62 K;  5BPN A;  4IBN A;  1S5J A;  2Q0R A;  1BHL A;  4IG0 A;  4DQR A;  4JN4 A;  2ZJR L;  5J1E A;  3KIO A;  3DLR A;  1HR0 K;  3C6H A;  5BRH A;  4OVL A;  3ENB A;  4DQQ A;  2YNF A;  1KFD A;  1JLQ A;  1GOB A;  5M1P A;  3ZSQ A;  5CYM A;  2P9U B;  3H1V X;  5AQJ A;  3M8Q A;  4GKK K;  4WYB A;  4CF0 A;  1X9W A;  3FZF A;  2XY8 A;  4IOX A;  1CXU A;  2WBN A;  3RR8 A;  3K2P A;  3QIO A;  3MEC A;  3QIN A;  3CCJ N;  3U8X A;  4N56 A;  1QTM A;  3OYA A;  4DF4 A;  4N47 A;  1LOT B;  4PL7 A;  3WEE B;  1MA9 B;  2NUB A;  2OTL N;  4JI7 K;  4O44 A;  4FWS A;  1HNV A;  4ID1 A;  2A6A A;  1RBR A;  2X6N A;  4BR9 A;  1RDC A;  4LFA K;  3PLA A;  4CEA A;  3AA4 A;  2NRT A;  1OVQ A;  5IWA K;  3HM9 A;  4IEE A;  5LJV A;  2DFE A;  3AA3 A;  4E1N A;  2UXD K;  4OPJ A;  5C42 A;  1RTI A;  4ELT A;  1XHX A;  3VQ6 A;  1S1X A;  2QWQ A;  5JS1 A;  3QES A;  2IC3 A;  4K42 A;  3VN5 A;  3C0B A;  1CZB A;  3AO1 A;  2G8K A;  3DAW A;  3ZSW A;  1HPZ A;  3EEQ A;  1B9F A;  1TL3 A;  4B1Z A;  3O6W A;  2Z1G A;  1K73 O;  4EP5 A;  5HRN A;  5JVH L;  3L2Q A;  4AHC A;  5BRD A;  1ATR A;  4DV5 K;  4DG1 A;  1BIZ A;  1SQK A;  4IFY A;  4JKB A;  3WXL A;  1BIU A;  3EN9 A;  2V7Y A;  3UKR B;  1NKB A;  4LSN A;  3KWI A;  4KHQ A;  4BR0 A;  1W2B M;  4I6M B;  1Y64 A;  2HHU A;  4BDZ A;  1OH5 A;  1EO1 A;  3AVA A;  4IDH A;  2WFB A;  3QB0 A;  4FXD A;  1WAF A;  4CJE A;  3VQP A;  3E9L A;  5H1S Q;  1QZ6 A;  3OYB A;  3NF7 A;  3S3O A;  4W5R A;  2HVI A;  5HRR A;  2O8D B;  2OPR A;  4CJQ A;  3RSE B;  3PX4 A;  1QVF M;  4BWJ A;  2UUB K;  4C8O A;  1VSJ A;  3KK7 A;  2ZD1 A;  3G0Z A;  3K9J A;  1JXE A;  5LL6 Z;  2XY7 A;  3HTV A;  3TAB A;  3ENO A;  2FBX A;  2I5J A;  4QS7 A;  3TI0 A;  4X64 K;  4OO1 J;  1ZYQ A;  1HNW K;  4O0J A;  4DTU A;  3OYD A;  1NG9 A;  1OKJ A;  3CXC M;  3J80 O;  1C1C A;  4XEI A;  4KH5 A;  2Q97 A;  3A2F A;  3CJ7 A;  5I3U A;  1T7P A;  4FLZ A;  4CZE A;  3H46 O;  4A5B A;  3KD5 E;  3NFA A;  2E1Z A;  1BCO A;  1JL1 A;  3D6R A;  5GIP A;  3QDK A;  1NK4 A;  1W7A A;  4AH9 A;  1BDG A;  4K43 A;  3SQ2 A;  4KB0 A;  2KTQ A;  4A59 A;  2VWB A;  4OKK A;  3MCP A;  2ZJQ L;  3IAY A;  2G8I A;  3ULE A;  3BZC A;  4DTJ A;  4BR5 A;  1U6Z A;  1BOT O;  1QQO A;  2VG5 A;  1YJN N;  3O08 A;  1JXB A;  1NGH A;  1NLV A;  2Q1N A;  3CMA N;  3VEN A;  3ULD A;  2Q3S A;  1BIS A;  5KRS A;  3F2K A;  4LH5 A;  2O8C A;  4ELV A;  1GLC G;  1IJJ A;  4CE9 A;  1DTT A;  1KC8 O;  3AVC A;  3JXU A;  3SMP A;  2HMP A;  1WN7 A;  4YOU A;  1YHQ N;  5F0X A;  3UB5 A;  3KLE A;  3OYH A;  3JS6 A;  3LAN A;  3HXM A;  1W9H A;  3LP1 A;  3OYC A;  3L3V A;  3D2E B;  2O8F B;  4JV5 K;  1SV5 A;  5B8H A;  3MDQ A;  2RHK A;  4BRD A;  5BN8 A;  2HF4 A;  1NMD A;  1IKY A;  4CEZ A;  4BC5 A;  2X78 A;  5AQW A;  2IOC A;  3AAP A;  1ZBU A;  2OPP A;  3QIC A;  4WFB L;  4BGA A;  3HK2 A;  1TKD A;  1NJX A;  2HHT A;  5FPM A;  3VQ4 A;  2HBM A;  4E19 A;  2XY6 A;  1B92 A;  3DLL L;  2F7T A;  4U67 L;  4JI1 K;  4JKG B;  1L3U A;  3CM5 A;  3V9Z A;  1A5X A;  1WLJ A;  1BI4 A;  1P90 A;  1V4T A;  2NRH A;  1QS4 A;  1LV5 A;  1UAX A;  4Z4E A;  4C8N A;  4H5T A;  3UKU B;  3HSC A;  4HCC A;  2UXB K;  3L8B A;  5BRF A;  1WNS A;  1O1W A;  1BWF O;  3J7Y P;  4CHN A;  2KHO A;  1ASV A;  3OYK A;  3OYJ A;  4YFU A;  3C7N B;  1VRT A;  4CZK A;  3SBT A;  3SAG A;  1RDU A;  3LPU A;  5AQU A;  3PUF A;  4YDU A;  5J2Q A;  4W5Q A;  4ISF A;  1GLL O;  3VEV A;  2H3G X;  4CFC A;  3F9K A;  3F5T A;  3HL8 A;  1NJI O;  4CJ3 A;  1Z6R A;  3MWT A;  4KH6 A;  1XC3 A;  3Q7B A;  1KVB A;  2BE2 A;  4Z4H A;  1HUX A;  4KI4 A;  2NRR A;  1HNZ K;  3VQ7 A;  1GLD G;  2A5X A;  2O8E A;  4FVM A;  4DR4 K;  4CGJ A;  5BPM A;  5J2P A;  1VQP N;  2HMI A;  3QFU A;  1JJ2 M;  3VEO A;  1XHZ A;  3DLG A;  3J81 O;  1XC9 A;  1NKC A;  2OTJ N;  2XRI A;  5KTQ A;  4DUZ K;  2QKB A;  1VRU A;  4JHD B;  1T03 A;  3DRS A;  2RE2 A;  4PHT X;  1YIJ N;  4W5N A;  2KKZ A;  1N6Q A;  3FZK A;  3ZEU B;  3QFP A;  3ZT0 A;  4KV8 A;  2P9N A;  4OGE A;  4DV2 K;  3CQX A;  5ADX A;  4F2R A;  3O5B A;  4E89 A;  3HI0 A;  5CHI A;  2DFF A;  3CD6 N;  4JD2 B;  3SZ2 A;  1S9G A;  4A2A A;  1N5Y A;  4JI3 K;  4FO0 A;  3H08 A;  4DTO A;  4HUE A;  2KZM A;  1TAU A;  1NGC A;  1S3X A;  3GBT A;  2JLE A;  5GAD P;  3QEW A;  5TKW A;  4BRO A;  4DV7 K;  1LWF A;  3AAR A;  3HRG A;  3PV8 A;  4JI5 K;  2GBZ A;  3DRP A;  2HST A;  3DLH A;  4G1Q A;  4C1N K;  3SQ0 A;  4AQY K;  3I33 A;  5DK5 A;  3L2R A;  3ZSY A;  2D0B A;  4LF9 K;  2D0A A;  4HCB A;  4QCL A;  3MXI A;  3P4I A;  3MXM A;  5JLH A;  2G8V A;  4KHP K;  4CHY A;  3GL1 A;  1Z05 A;  4H5V A;  4DR2 K;  1RTH A;  3T69 A;  3TAE A;  4M41 A;  1QQC A;  4RW7 A;  4DHY A;  4CVN E;  4E7L A;  2HB5 A;  3CCM N;  4FOI A;  5CZ2 A;  2G8H A;  2A40 A;  4B9T A;  5JVG L;  3NH0 A;  3WQU A;  2Q36 A;  1IBK K;  4GV6 A;  3OS1 A;  4ISG A;  3KK1 A;  3IUC A;  5DMR A;  4B3S K;  4CK2 A;  1H1V A;  4NLC A;  5J2N A;  4J2A A;  1HRH A;  4BWM A;  2FF3 B;  3E9O A;  1SAZ A;  3THX A;  1WSJ A;  3AVJ A;  4F2S A;  1EWQ A;  3I8D A;  4J8F A;  5CE3 A;  4DV4 K;  3QEV A;  4WQ5 A;  4YDU C;  4QS9 A;  4IWV A;  3V4I A;  3BF1 A;  4BQL A;  1WBB A;  4IEI A;  2QWO A;  2QM1 A;  3WQT A;  3TAM A;  3ZX3 A;  3VEX A;  3SPY A;  3R8E A;  4M45 A;  2D0C A;  1DT9 A;  3I0R A;  3QO9 A;  4LFC K;  3W0L A;  3D7E O;  2VWJ A;  4FSV A;  1Z25 A;  4BC4 A;  1SL2 A;  1LCU A;  3AO5 A;  4M3W A;  4MFB A;  3PSI A;  4FJ8 A;  2B5J A;  4DR6 K;  4IOC L;  3CME N;  5AQY A;  4BG9 A;  1J53 A;  1TAQ A;  4H0V B;  3VEW A;  2UU9 K;  4WFA L;  2ZJP L;  2Z1I A;  3WT0 A;  4F9O A;  5J2M A;  3L2W A;  1LW2 A;  1TK0 A;  4V19 S;  1WSH A;  1IKW A;  3T1Y K;  4CK3 A;  3OYF A;  4DR1 K;  1L5U A;  3HM8 A;  2PYJ A;  3NF9 A;  3KLG A;  1VSE A;  3DLK A;  4CF8 A;  1YTU A;  3WEE A;  1WUA A;  1DTQ A;  1DGK N;  2P9I A;  4IJA A;  4K0K K;  1KQS M;  1IKX A;  3NGI A;  1U2V B;  2VG7 A;  3QEP A;  3THV A;  3NBP A;  1NGF A;  4AHR A;  3THY A;  2O8B B;  3K5N A;  1J6Z A;  3AVB A;  3CJC A;  3O9S A;  2PZS A;  5FDL A;  4PUO A;  1Q9Y A;  3SV4 A;  1RTJ A;  1WSF A;  5C2F A;  4B1X B;  1NU0 A;  1NGI A;  4CCH A;  4BRC A;  3QBX A;  3EY1 A;  1ATS A;  1KVA A;  4ILJ A;  4PKG A;  5BR9 A;  2G8U A;  4FK4 A;  1J5O A;  4FWK A;  4DSL A;  2A41 A;  3C65 A;  3HO1 A;  3OA9 A;  2CH5 A;  5FRN A;  1N34 K;  3GDQ A;  3KLH A;  1QQM A;  1JLG A;  2IVP A;  4UQG A;  4FJK A;  2KZZ A;  3HPH A;  2G8F A;  2KQ2 A;  3U9D A;  4BVP A;  1GLB G;  4RWT A;  1T3V A;  4FJX A;  1QSS A;  4QAG A;  1RDA A;  2J4R A;  1NGE A;  3IS9 A;  4CBW A;  5GAG P;  1HYS A;  3UKR A;  4CD3 A;  4M7Y A;  4IFV A;  4I6M A;  2HVH A;  2UXC K;  5LMU K;  1IV0 A;  3HST B;  2IIR A;  4XH1 A;  3RRG A;  5GIO A;  4M3R A;  3MAQ A;  4JYA K;  2YHY A;  2WC9 A;  4DSJ A;  3ENH A;  4FPA A;  2ZGZ A;  3HP6 A;  2HHH K;  5AQK A;  1NGG A;  2O8D A;  1YVN A;  1JLB A;  2A42 A;  2FXU A;  2GEL A;  4EP4 A;  3QML A;  3TTF A;  3VEY A;  2NRW A;  1NOZ A;  4BE1 A;  2D4W A;  4DU3 A;  3D2F A;  4FJH A;  4BRI A;  4CIF A;  3K58 A;  2YX6 A;  1HMV A;  3OYM A;  3O9T A;  4JI0 K;  4CJK A;  1VQL N;  1NOY A;  3U6F A;  1U48 A;  2QWP A;  4E7J A;  3K0S A;  5AQL A;  1NK7 A;  3BEX A;  4YHH K;  4A61 A;  3OJU A;  3LZI A;  2IGI A;  4WQ5 C;  2NLX A;  5KGX A;  3TR8 A;  4AM7 A;  3AVI A;  4HTL A;  4J2B A;  5C25 A;  1XNQ K;  5AQF A;  1RT4 A;  5JLF A;  3OYN A;  3OW2 M;  3O3F A;  3N4P A;  4BE0 A;  1S22 A;  5AQQ A;  3M8P A;  4FK0 A;  4BRH A;  2E1Y A;  5CYQ A;  1RCH A;  3VQ9 A;  1HNX K;  1QZ5 A;  4BR7 A;  4O5F A;  1E4G T;  4F3O A;  4DB3 A;  4NB4 A;  4E3S A;  3OBY A;  4FJI A;  4JK8 A;  3AVM A;  3LP0 A;  1UWB A;  1Q81 O;  1M1K O;  1T44 A;  4B9Q A;  3RWU A;  3PIO L;  4BRF A;  3BY5 A;  4KB1 A;  3WXI A;  5C15 A;  4DFK A;  3M6G A;  5E41 A;  2F96 A;  4IJN A;  1W0H A;  1DKG D;  4O8U A;  1KD1 O;  1WB9 A;  2P9S B;  1F21 A;  3FE1 A;  4AF1 A;  3RMD A;  5AQX A;  1FW6 A;  2O8F A;  4DU4 A;  5IT9 O;  3VES A;  4EHU A;  4YOW A;  1X9J A;  1HKB A;  4E1J A;  5DM7 L;  3P5J A;  1K8K A;  4Y1C A;  2E2N A;  2AJQ A;  3ITH A;  5AQV A;  1KAZ A;  1TK8 A;  5HP1 A;  3M8S A;  2NRZ A;  2HBK A;  4XH5 A;  3EE9 A;  3ZSV A;  1CZ9 A;  2YI1 A;  1QHT A;  4JKA A;  1ESV A;  3QLH A;  3ZSX A;  2RF2 A;  4H4O A;  5C2D A;  3FLC O;  2VYP A;  4NXN K;  4KAZ A;  1U45 A;  2HBL A;  5FPN A;  4M3U A;  1QQN A;  3CQY A;  3DOK A;  1TYQ A;  4LF8 K;  4G9Z A;  1RT5 A;  1YAG A;  3I0S A;  4H0Y B;  4K25 A;  4BR2 A;  1OH7 A;  1NJW A;  4A62 A;  4CES A;  4YOR A;  2RN2 A;  4FLU A;  4DWI A;  3TTD A;  4I9Q A;  4JEP A;  2HHX A;  1IKV A;  1GLF O;  3LDQ A;  1KXP A;  2OZM A;  1NK5 A;  2VQF K;  4CZL A;  3K9K A;  3LWM A;  3HP9 A;  4BE2 A;  3EE8 A;  4DTX A;  4A57 A;  3FZH A;  5KPT A;  1JLF A;  4CJU A;  2B4J A;  1P8Z A;  1HJR A;  2GX9 A;  1LAW A;  4DR3 K;  1VSF A;  3NF8 A;  4CJP A;  3L4I A;  3T7Z A;  3B6P A;  3NF6 A;  5AZJ A;  3A5L C;  3K5O A;  4ZTJ A;  3SQ1 A;  4LF4 K;  3AO3 A;  5FPE A;  4B3M K;  2CGL A;  5HLF A;  1RNH A;  1U04 A;  1EKE A;  1HYZ A;  3OS0 A;  2YV0 X;  3OS2 A;  1KSP A;  4JHD A;  2DTU A;  1NK9 A;  1NGB A;  3LAK A;  1TGO A;  1BGX T;  4B8A B;  1N8R O;  4NCG A;  2A1S A;  3BZK A;  3I56 N;  1D4X A;  2YHA A;  3WXJ A;  4LF5 K;  2P9P A;  4M3T A;  1TUY A;  3M8R A;  5C0Y A;  3A5O C;  3D45 A;  3CYM A;  4LY7 A;  3SUP A;  1ILY A;  3RVC A;  4KTW A;  4JD2 A;  4CJ4 A;  2P5G A;  3ZET B;  4BDY A;  4Y1D A;  2VG6 A;  3NVK A;  3FZL A;  3SBG A;  4Z4F A;  2NRX A;  2A3Z A;  3CPE A;  2IDO A;  2CH6 A;  3THW A;  5MLC Q;  4PA1 A;  3TAR A;  1V4S A;  4MLH A;  3UIQ A;  4U7B A;  2E20 A;  1X9S A;  5F2R A;  2YHX A;  4JNE A;  4OKJ A;  4FCY A;  1RFQ A;  3NGY A;  4H0T B;  3MMV A;  2P9K B;  4CF9 A;  5E84 A;  5E26 A;  3MN9 A;  4H5R A;  5JMV A;  4CBU A;  1XMQ K;  1VQN N;  4CD1 A;  3KJV A;  4FZZ A;  3A5M C;  4WF9 L;  3JYT A;  3SQ4 A;  1QSY A;  4KHW A;  3PSF A;  3TSP A;  3VQC A;  3DYA A;  2HBJ A;  1C0F A;  5AQR A;  3PO4 A;  2B6A A;  1JCG A;  4YOT A;  3SYZ A;  3HBT A;  1OH8 A;  4Q0B A;  1K9M O;  5M1N A;  1VSM A;  3G10 A;  4C8L A;  2QK9 A;  1X1P A;  3CET A;  3M1F A;  1RBV A;  2DPN A;  4FK2 A;  4CBX A;  3WNF A;  4DS5 A;  4X66 K;  1JL2 A;  1VQ8 N;  3DXK A;  1KLM A;  5BRE A;  4YOY A;  3VTH A;  3LDS A;  3QEI A;  3HT3 A;  4FJN A;  3LP2 A;  3O4W A;  2BGG A;  1T6D A;  4JKC A;  3ID8 A;  5I42 A;  3SK3 A;  3VMF B;  5KI6 A;  3LDO A;  4KTQ A;  3IMX A;  2IVN A;  3T1H K;  3E01 A;  4B9S A;  4KHU A;  2Z1J A;  4Z4I A;  3AA5 X;  4FW1 A;  4DSF A;  1RT3 A;  4K41 A;  5AZI A;  4FWL A;  5AQZ A;  4DV0 K;  4CF1 A;  2P9L A;  4BRG A;  4DU1 A;  4BDP A;  3K5M A;  1TV6 A;  1IG8 A;  3VET A;  4FJG A;  3RRH A;  3KK3 A;  1IH7 A;  1VK0 A;  3WNG A;  4BY9 C;  4NCB A;  3DM2 A;  4GMJ B;  3V1R A;  4BVO A;  4O4G A;  4CHQ A;  5JS2 A;  4FJ5 A;  4DQS A;  3VQ5 A;  3V81 A;  4BAC A;  4M42 A;  3F73 A;  1T05 A;  4ZHR A;  5HRP A;  1Q9X A;  5D3G A;  3RTV A;  4KPY A;  3O4Q A;  1Q7Y O;  4DQP A;  3VQE A;  1ATN A;  4PQU A;  4PWD A;  3O1B A;  5KRT A;  3QIP A;  5FPD A;  3TSU A;  1Z26 A;  4KI6 A;  1VSK A;  2NZT A;  2YJE A;  3G4S N;  3AGR A;  1C1B A;  4DR5 K;  5EU7 A;  4LC9 B;  3O9R A;  4LSL A;  1YVU A;  4Q5V A;  3IG1 A;  4ICL A;  4BGB A;  2ETJ A;  4CGH A;  2BTF A;  1MDU B;  4KRE A;  1HKG A;  4EZ9 A;  3OYI A;  1VQ4 N;  1E4F T;  2I7P A;  3P39 A;  2CGK A;  1N36 K;  1IBL K;  2HND A;  4FW2 A;  1Y97 A;  1X3N A;  4B3O A;  3KKS A;  2QW9 A;  4A2B A;  3HYF A;  1WSI A;  4CW7 B;  4CJ7 A;  1SL0 A;  2RPI A;  2DY4 A;  1FK9 A;  3VPZ A;  4CIG A;  2ZM6 K;  1TK5 A;  3ULE B;  1JCF A;  2PFU A;  2ITM A;  3QNN A;  2ASO A;  4RW8 A;  4LD0 A;  4CGG A;  4OLB A;  4CGI A;  4CED A;  4NCA A;  3KK2 A;  1M90 O;  3ATU A;  1C0U A;  1VQ7 N;  3MN6 A;  1VHX A;  3NE6 A;  5C10 A;  3DLE A;  2E88 A;  5AQO A;  3B6O A;  4N5S A;  2YHW A;  3CPW M;  3WUH A;  3E1Y A;  4BQZ A;  1JLC A;  1RBT A;  3LDL A;  4E0D A;  3PX6 A;  1OVY A;  4H0P A;  2D1K A;  2IVO A;  5TKY A;  4EAH D;  4W5O A;  4FLW A;  4B9L A;  3M5R A;  3U4L A;  1WOQ A;  2ASP A;  5HOO A;  5SZT A;  4HUG A;  4PL8 A;  5LY3 A;  5LJW A;  1ZBI A;  1BI4 B;  3VQ8 A;  4BRL A;  1G15 A;  4GVM A;  4FWN A;  3M3Z A;  3A5N C;  1S1U A;  3CER A;  1VQ5 N;  3NMU A;  5GAE P;  4AHV A;  1C6V A;  3F9M A;  3L0Q A;  3LAL A;  3ZT4 A;  1G99 A;  3EKS A;  3U3Y A;  4M7X A;  2EHG A;  1XWL A;  1NK6 A;  1SKW A;  1YIT N;  4BRN A;  2BUP A;  2QWL A;  4JK7 A;  1QE1 A;  3C6A A;  4CFA A;  4B9U A;  2QWR A;  4CEC A;  3NH1 A;  3SNN A;  1A5V A;  2P9U A;  3WNH A;  1RBU A;  2E6M A;  3CG7 A;  3L3U A;  4TSX A;  4Z4C A;  5LMN K;  3RR7 A;  2P51 A;  3ZX2 A;  1YTA A;  3MWP A;  1SKS A;  2QA4 N;  4MLE A;  4CIE A;  4OPH A;  3J8A A;  1BL3 A;  5FRM A;  1BO5 O;  4JLH A;  2E5L K;  1SS6 A;  3TU5 A;  5CZ1 A;  1JLE A;  3MN5 A;  3HZ6 A;  4E7K A;  2YKN A;  2XHB A;  5AQN A;  1EP4 A;  3L2U A;  3U9Z A;  4B1V A;  4CHP A;  1D8Y A;  4AHT A;  4E7H A;  3EYZ A;  3HVR A;  2IAJ A;  4EZ6 A;  3AVL A;  4CHZ A;  4NXM K;  5EX5 A;  3O9U A;  4H5N A;  2WON A;  4RCH A;  3ATV A;  2GUP A;  2V51 B;  5CR4 A;  1RT7 A;  3WXK A;  1EX4 A;  4H8K A;  3DLB A;  3AVF A;  1UA0 A;  4C8M A;  4BRQ A;  2KW4 A;  1HNI A;  3LAM A;  3WXM B;  1RDB A;  2V7Z A;  4B3R K;  3C6U A;  2QXL A;  1TKZ A;  3KZB A;  1S6Q A;  4K8Z A;  2YCH A;  2P9N B;  1RBS A;  1FKO A;  1X9M A;  1K6Y A;  4FLT A;  5AQP A;  4DFP A;  3TAN A;  4DV6 K;  3SJJ A;  3R6M A;  3DXM B;  3SV3 A;  5F1X A;  1KLN A;  3O8M A;  4FWP A;  1UOC A;  4FLV A;  4FZX C;  1J5E K;  3FR0 A;  2LSN A;  4IDK A;  3NDK A;  3SUN A;  3C94 A;  2E4L A;  2QEX N;  1J54 A;  2EX3 A;  4CJL A;  4W5T A;  4DLG A;  1OH6 A;  3D0P A;  1YJ9 N;  2YJF A;  1MWK A;  1ZBL A;  4GKJ K;  3P1G A;  3CF5 L;  3CC7 N;  3ZT2 A;  4N41 A;  4NYN A;  4KRF A;  4HHT A;  2FSN A;  3R1X A;  2W6K A;  3NVM A;  1YJW N;  3SMS A;  4IXC A;  3OYG A;  3RSE A;  2QI2 A;  3OTO K;  1I39 A;  4M3X A;  2OA8 A;  3VF4 A;  3DRR A;  4J2E A;  3BDP A;  3CJ9 A;  4QS8 A;  4DQI A;  4YNQ A;  1JLA A;  1IBM K;  2OZS A;  1HX1 A;  3MX2 A;  4H4M A;  2GTD A;  1KFS A;  3CHW A;  2OPQ A;  2GWK A;  3S41 A;  4X65 K;  5C24 A;  4JKE A;  3O80 A;  3PY8 A;  1I3A A;  1L3T A;  1K8A O;  1T6C A;  2FBV A;  2VGM A;  3CCE N;  2HHQ A;  5AQS A;  2QTD A;  4CZH A;  2PYL A;  4L8R B;  3P38 A;  2BAN A;  1IO2 A;  1KVC A;  4B8C A;  4DCH A;  3KD1 E;  5KGW A;  3C95 A;  3JAM O;  3JSM A;  3HVT A;  3J7Z O;  3MXJ A;  1KAX A;  1S9E A;  5KQ8 A;  1XMO K;  5ADX H;  2E6L A;  3DWL A;  4DQ8 A;  4IFE A;  3TAG A;  2WOM A;  3VQB A;  2KFZ A;  1NM1 A;  5DM6 L;  4WCE L;  2E8A A;  4CJT A;  3OJS A;  1WAJ A;  4QOZ B;  4MDB A;  5EY4 A;  3MN7 A;  5SWM A;  3LP3 A;  4WQ4 A;  2DFH A;  3BGR A;  2XY5 A;  5KQD A;  4I7F A;  1HQE A;  3B8A X;  3EL2 A;  5FLX O;  4UY8 O;  1C0T A;  2P9K A;  1NGD A;  4EIA A;  4DKW A;  4M63 C;  1ITG A;  2XO7 A;  4KHY A;  1NJZ A;  3E66 A;  4WFN L;  4DR7 K;  4FJ7 A;  3CQ8 A;  3SUQ A;  4BRE A;  3NCI A;  3D2E A;  1EET A;  2IS3 A;  3EZ5 A;  3RMC A;  3HPG A;  4FJ9 A;  1VSI A;  2YKM A;  3V9X A;  3IDH A;  3WNE A;  1YF5 L;  3H3O B;  4JKF A;  3AVK A;  4NO7 A;  2P9I B;  5EXW A;  1U49 A;  4CF2 A;  3VF6 A;  4MO5 A;  3AO2 A;  2KFN A;  4OGC A;  1RGI A;  4CJS A;  2ZE2 A;  1FXX A;  4JKG A;  1O13 A;  1J9A A;  1S72 N;  3OY9 A;  4CEQ A;  1RTD A;  1EXQ A;  4DTN A;  3THY B;  1NWK A;  3L2V A;  4FL9 A;  4GY2 B;  2PAV A;  3UKU A;  3RMA A;  3TSQ A; 
#chains in the Genus database with same CATH homology
 3WNF A;  2ITG A;  4DS5 A;  4OLA A;  3V9S A;  1SUQ A;  1JL2 A;  1QQC A;  4RW7 A;  1XI1 A;  1ZBH A;  3OVN A;  4CJ5 A;  2HB5 A;  4E7L A;  4XIU A;  4OJR A;  1TVR A;  1NKE A;  2F8T A;  4CJW A;  4FZY A;  5CZ2 A;  2G8H A;  3O3H A;  4RW9 A;  2D5R A;  4AHS A;  4B9T A;  3NH0 A;  5K14 A;  1KLM A;  3O4N A;  3LDS A;  2FBY A;  1D9F A;  4MQ3 A;  1L3S A;  4R5P A;  3OS1 A;  3HT3 A;  3QEI A;  3KK1 A;  3LP2 A;  4FJN A;  3V9W A;  2R7Y A;  5DMR A;  4DFJ A;  2BGG A;  4CK2 A;  1LW0 A;  3MED A;  5I42 A;  1HQU A;  3SCX A;  3DMJ A;  5KI6 A;  4KTQ A;  2Y1I A;  3TAQ A;  5J2N A;  4J2A A;  4CGF A;  2F8S A;  5HBM A;  1HRH A;  3E01 A;  4B9S A;  4KHU A;  4BWM A;  2Z1J A;  4Z4I A;  3AA5 X;  4FW1 A;  3HPO A;  1GOA A;  1RT3 A;  4DSF A;  3DI6 A;  4CF1 A;  3MEE A;  4CJF A;  3LZJ A;  1S6P A;  1WSJ A;  3AVJ A;  4DU1 A;  4F2S A;  4BDP A;  2A1R A;  4CJV A;  3K5M A;  1TV6 A;  3I8D A;  4FJG A;  3RRH A;  2PY5 A;  3QEV A;  2JGU A;  3KK3 A;  5HRS A;  4AHU A;  3ZCM A;  1IH7 A;  3T1A A;  1VK0 A;  3WNG A;  3LWL A;  4NCB A;  3V4I A;  3DM2 A;  4CER A;  4IKF A;  4GMJ B;  4CEF A;  3V1R A;  4CHQ A;  4O4G A;  3TAM A;  5JS2 A;  4FJ5 A;  4DQS A;  3VQ5 A;  3SPY A;  2G8W A;  4M45 A;  2D0C A;  1CLQ A;  3I0R A;  3QO9 A;  3IRX A;  2W42 A;  4BAC A;  3V81 A;  1KCF A;  4M42 A;  3F73 A;  1T05 A;  4ZHR A;  5HRP A;  1Q9X A;  5D3G A;  3RTV A;  4KPY A;  4DTR A;  2HHV A;  3O4Q A;  2VWJ A;  1D9D A;  4DQP A;  1Z25 A;  3VQE A;  4M3Z A;  1SL2 A;  4FJM A;  3AO5 A;  4PQU A;  5KRT A;  4MFB A;  3PX0 A;  4M3W A;  4FJ8 A;  2B5J A;  3QIP A;  4PWD A;  1LWE A;  4GW6 A;  4CEE A;  1Z26 A;  4KI6 A;  1VSK A;  4IBN A;  1S5J A;  1BHL A;  4IG0 A;  3V9U A;  4DQR A;  4IG3 A;  1C1B A;  3KIO A;  1J53 A;  1TAQ A;  3DLR A;  5FRO A;  5J1E A;  5EU7 A;  3V6D A;  2Z1I A;  4LSL A;  4OVL A;  1VSD A;  3FFI A;  1YVU A;  1BQM A;  4DQQ A;  2Y1J A;  2YNF A;  4Q5V A;  1KFD A;  1GOB A;  1JLQ A;  3IG1 A;  3L2W A;  1LW2 A;  4ICL A;  5CYM A;  3ZSQ A;  5J2M A;  2ETJ A;  1WSH A;  1TK0 A;  4CGH A;  1IKW A;  4JS4 A;  4CK3 A;  3M8Q A;  4CEO A;  3OYF A;  3TAP A;  1L5U A;  2PYJ A;  4CF0 A;  4F3T A;  3NF9 A;  3KLG A;  3TWH A;  4KRE A;  3K57 A;  2OPS A;  1X9W A;  3OYI A;  4EZ9 A;  1UA1 A;  1C0M A;  1VSE A;  3KKR A;  3DLK A;  4CF8 A;  1YTU A;  4KHS A;  1TL1 A;  2XY8 A;  4CFB A;  1DTQ A;  1CXU A;  4KHN A;  3QNO A;  2HND A;  3ASM A;  4FW2 A;  3RR8 A;  3K2P A;  1Y97 A;  1JKH A;  3QIO A;  3SPZ A;  2VWK A;  3MEC A;  3QIN A;  1IKX A;  3ALY A;  1KTQ A;  4B3O A;  3KKS A;  4N56 A;  3NGI A;  4JS5 A;  1QTM A;  3OYA A;  2VG7 A;  1WSI A;  3HYF A;  4N47 A;  4DF4 A;  3QEP A;  3NBP A;  3THV A;  1SL0 A;  4FJH A;  2NUB A;  4AHR A;  1ZBF A;  3NH2 A;  2RPI A;  4O44 A;  3CFP A;  3K5N A;  5HRO A;  1FK9 A;  3P83 D;  4CIG A;  1HNV A;  3AVB A;  3VQQ A;  1TK5 A;  2OYQ A;  3QER A;  4ID1 A;  2PZS A;  5FDL A;  4KKO A;  4PUO A;  4B9M A;  1Q9Y A;  3SV4 A;  1RBR A;  1RTJ A;  1KRP A;  1WSF A;  2X6N A;  1RDC A;  3QNN A;  4CCH A;  2X74 A;  4CEA A;  3AA4 A;  4RW8 A;  1TKT A;  1KVA A;  4LD0 A;  4CGG A;  3EY1 A;  4CEB A;  3HM9 A;  4OLB A;  2HHW A;  2G8U A;  4Z4G A;  4FK4 A;  1J5O A;  2DFE A;  3AA3 A;  4E1N A;  4DSL A;  3HO1 A;  4OPJ A;  4F8R A;  4CGI A;  4CED A;  1RTI A;  5C42 A;  4NCA A;  5FRN A;  4ELT A;  1XHX A;  3VQ6 A;  3KK2 A;  3AV9 A;  1S1X A;  3KLH A;  1JLG A;  1S1T A;  4UQG A;  1C0U A;  3QES A;  4FJK A;  2KZZ A;  5JS1 A;  2IC3 A;  3HPH A;  2G8F A;  3VN5 A;  2KQ2 A;  4CHO A;  4JRQ A;  1CZB A;  3AO1 A;  3NE6 A;  2G8K A;  4FJX A;  4E1M A;  3DLE A;  1HPZ A;  4RW6 A;  3ZSW A;  1QSS A;  3ZSO A;  1B9F A;  4QAG A;  1TL3 A;  4FLY A;  1RDA A;  3IS9 A;  1HYS A;  3B6O A;  4N5S A;  3S9H A;  2Z1G A;  4HVJ A;  3AVG A;  4EP5 A;  4IFV A;  5HRN A;  2HVH A;  3TAF A;  1QSL A;  3L2Q A;  1VSH A;  3S3M A;  4AHC A;  3HST B;  3NGZ A;  1NK8 A;  3RRG A;  4M3R A;  1JLC A;  4DG1 A;  1BIZ A;  1RBT A;  3MAQ A;  4IFY A;  1HYV A;  4Z0U A;  4FLX A;  1BIU A;  4E0D A;  3PX6 A;  4DSJ A;  1NKB A;  4W5O A;  4B9L A;  4LSN A;  3HP6 A;  4FLW A;  4KHQ A;  1IG9 A;  1JLB A;  2HHU A;  4BDZ A;  4DTS A;  1DLO A;  5SZT A;  3AVA A;  4EP4 A;  2HHS A;  4KTZ A;  1NOZ A;  1WAF A;  4HUG A;  4BE1 A;  4FXD A;  1ZBI A;  4DU3 A;  4DLE A;  4CJE A;  1BI4 B;  3VQD A;  3VQP A;  3VQ8 A;  3OYB A;  3KTQ A;  1G15 A;  3NF7 A;  4CIF A;  3K58 A;  4GVM A;  4FM1 A;  1HMV A;  3OYM A;  4W5R A;  3S3O A;  3AO4 A;  2HVI A;  1S1U A;  4CJK A;  1T8E A;  5HRR A;  1NOY A;  2OPR A;  4AHV A;  1C6V A;  4CJQ A;  4I2P A;  1RT6 A;  3LAL A;  3ZT4 A;  3U3Y A;  3U6F A;  2EHG A;  1U48 A;  4E7J A;  3PX4 A;  4BWJ A;  1NK7 A;  4C8O A;  1VSJ A;  1XWL A;  3ZSZ A;  1U4B A;  1NK6 A;  2ZD1 A;  3G0Z A;  3OJU A;  2X6S A;  3LZI A;  1SKW A;  2IGI A;  1MU2 A;  1JXE A;  4DTM A;  3AA2 A;  3SI6 A;  4RG8 A;  3O3G A;  5KGX A;  3TR8 A;  2XY7 A;  3AVI A;  3TAB A;  1QE1 A;  3NHG A;  4CFA A;  4B9U A;  4J2B A;  4CEC A;  3NH1 A;  2FBX A;  3SNN A;  1A5V A;  5C25 A;  3SUO A;  2I5J A;  3WNH A;  1RBU A;  2E6M A;  3CG7 A;  3L3U A;  4TSX A;  4Z4C A;  3TI0 A;  5T7B A;  3RR7 A;  2P51 A;  3CFO A;  1ZYQ A;  1RT4 A;  1YTA A;  3OYN A;  4O0J A;  1SKS A;  4DTU A;  3OYD A;  3O3F A;  4BE0 A;  1L3V A;  2RKI A;  4CIE A;  1C1C A;  3M8P A;  4FK0 A;  3A2F A;  3VA3 A;  5I3U A;  1A5W A;  1BL3 A;  1T7P A;  5FRM A;  4FLZ A;  3KD5 E;  3NFA A;  1SL1 A;  4JLH A;  5CYQ A;  1RCH A;  5CZ1 A;  1BQN A;  1JLE A;  3VQ9 A;  1BCO A;  3AVN A;  1JL1 A;  1NK0 A;  1NK4 A;  4E7K A;  4F3O A;  2YKN A;  4AH9 A;  2QXF A;  3OYE A;  1EP4 A;  3L2U A;  2XHB A;  3SQ2 A;  4KB0 A;  2KTQ A;  4E3S A;  1U47 A;  4FJI A;  4OKK A;  4CHP A;  1LAV A;  1D8Y A;  4AHT A;  3AVM A;  4CK1 A;  3LP0 A;  3IAY A;  2G8I A;  3CFR A;  1UWB A;  3HVR A;  3EYZ A;  4E7H A;  2IAJ A;  4EZ6 A;  3AVL A;  4CHZ A;  3OYL A;  4DTJ A;  1RT2 A;  2WON A;  2VG5 A;  3CM6 A;  3RWU A;  4I2Q A;  4PY5 A;  3AVH A;  1RT7 A;  3NAE A;  4KB1 A;  4DFM A;  1JXB A;  1LWC A;  1EX4 A;  4DFK A;  4H8K A;  4FJL A;  5E41 A;  3DLB A;  3ULD A;  2F96 A;  2Q3S A;  1BIS A;  1W0H A;  2GV9 A;  3AVF A;  4C8M A;  5KRS A;  3RMB A;  1UA0 A;  2KW4 A;  1F21 A;  4LH5 A;  4ELV A;  1HNI A;  3LAM A;  4B08 A;  1RDB A;  1WSE A;  3RMD A;  3C6U A;  4CE9 A;  1DTT A;  1TKZ A;  4K8Z A;  1S6Q A;  4DU4 A;  4N76 A;  3AVC A;  2HNY A;  1WN7 A;  1RBS A;  1FKO A;  4M3Y A;  1X9M A;  1K6Y A;  3P5J A;  3KLE A;  4FLT A;  4Y1C A;  3OYH A;  1NJY A;  4ELU A;  2AJQ A;  3ITH A;  3LAN A;  1TK8 A;  3HXM A;  4DFP A;  5HP1 A;  2P1J A;  2Z1H A;  3M8S A;  1W9H A;  3ZSR A;  3TAN A;  3SJJ A;  3LP1 A;  4CGD A;  3SV3 A;  3ZSV A;  2YNI A;  3OYC A;  3L3V A;  4DTP A;  1CZ9 A;  1KLN A;  1SV5 A;  1UOC A;  4FLV A;  1QHT A;  2GUI A;  4FZX C;  3S3N A;  3QLH A;  3V1O A;  2LSN A;  4IDK A;  3ZSX A;  2RF2 A;  2DY4 A;  4H4O A;  3NDK A;  1IKY A;  4CEZ A;  4KAZ A;  2X78 A;  4O0I A;  2IOC A;  4HTU A;  3SUN A;  1U45 A;  4FM2 A;  1ZBU A;  2OPP A;  3C94 A;  4M3U A;  3T19 A;  3HK2 A;  3DOK A;  1CXQ A;  1TKD A;  2FBT A;  1NJX A;  4J2D A;  2HHT A;  2E4L A;  1J54 A;  1B9D A;  2EX3 A;  4CJL A;  4W5T A;  3VQ4 A;  4E19 A;  4DLG A;  1RT5 A;  2XY6 A;  3D0P A;  3I0S A;  1B92 A;  1ZBL A;  3P1G A;  3K5L A;  3ZT2 A;  4N41 A;  2O4I A;  4OPK A;  4CES A;  4NYN A;  1NJW A;  3CM5 A;  3V9Z A;  1L3U A;  2RN2 A;  2P5O A;  1A5X A;  1WLJ A;  1BI4 A;  4FLU A;  4DWI A;  3ZT1 A;  4KRF A;  4I9Q A;  1QS4 A;  4HHT A;  3QEX A;  1SKR A;  1LV5 A;  1IKV A;  2HHX A;  1UAX A;  4Z4E A;  4C8N A;  2OZM A;  1TKX A;  1NK5 A;  3T3F A;  3OYG A;  1YT3 A;  3MEG A;  3LWM A;  3HJF A;  3HP9 A;  4BE2 A;  1I39 A;  4HCC A;  4DSI A;  4O55 A;  3LPT A;  4M3X A;  2HNZ A;  4I9L A;  3L8B A;  3ZT3 A;  1WNS A;  1O1W A;  4DTX A;  2OA8 A;  3VQA A;  4HUF A;  1RDD A;  3DRR A;  3BDP A;  4J2E A;  4CHN A;  2O4G A;  1JLF A;  1ASV A;  3OYK A;  3OYJ A;  4YFU A;  1FKP A;  4FM0 A;  4DQI A;  4YNQ A;  1RT1 A;  1VRT A;  3V1Q A;  4CJU A;  4DSE A;  2B4J A;  4ID5 A;  3KLF A;  4JRP A;  3LPU A;  1HJR A;  3PUF A;  1LAW A;  2FC0 A;  1JLA A;  2OZS A;  1RIL A;  4H4M A;  1ASW A;  1VSF A;  2ZQB A;  3NF8 A;  1KFS A;  4CJP A;  5J2Q A;  2OPQ A;  2BDP A;  3QET A;  4W5Q A;  3B6P A;  5C24 A;  3NF6 A;  3K5O A;  4CFC A;  4ZTJ A;  3F9K A;  3PY8 A;  3SQ1 A;  1I3A A;  1L3T A;  2FBV A;  3HL8 A;  4RW4 A;  2HHQ A;  3AO3 A;  4CJ3 A;  5HLF A;  1RNH A;  2PYL A;  4L8R B;  1U04 A;  1EKE A;  2BAN A;  1IO2 A;  1KVC A;  4B8C A;  4CJR A;  1KVB A;  2BE2 A;  1HYZ A;  4Z4H A;  2YV0 X;  3OS0 A;  3OS2 A;  3VQ7 A;  1KSP A;  3KD1 E;  1REV A;  5KGW A;  4KI4 A;  3C95 A;  3JSM A;  3HVT A;  4F4K A;  3MXJ A;  1C1A A;  4FVM A;  1NK9 A;  2DTU A;  4CGJ A;  1S9E A;  3LAK A;  1BCM A;  1TGO A;  1BGX T;  4B8A B;  5J2P A;  2E6L A;  2HMI A;  4NCG A;  2A1S A;  1XHZ A;  2YHA A;  3DLG A;  1XC9 A;  1NKC A;  2ATQ A;  2XRI A;  5KTQ A;  3M8R A;  3TAG A;  4M3T A;  2WOM A;  4K8X A;  2QKB A;  2HW3 A;  3VQB A;  1VRU A;  3D45 A;  4KFB A;  2KFZ A;  1T03 A;  2YNH A;  3DRS A;  3CYM A;  4LY7 A;  3SUP A;  4W5N A;  3KLI A;  1N6Q A;  1S1V A;  4KTW A;  4CJT A;  4CJ4 A;  3OJS A;  1R0A A;  1WAJ A;  3PO5 A;  2P5G A;  4WE1 A;  4QOZ B;  3ZT0 A;  4BDY A;  5SWM A;  4Y1D A;  3LP3 A;  2VG6 A;  4ZTF A;  2DFH A;  1D5A A;  3BGR A;  4KV8 A;  2XY5 A;  4FYD A;  4I7F A;  1HQE A;  4OGE A;  2YHB A;  4Z4F A;  4C8K A;  4F2R A;  4O5B A;  1C0T A;  4E89 A;  4AIL C;  2IDO A;  4FJJ A;  4DSK A;  3C6T A;  2DFF A;  1Q8I A;  5CY4 A;  1ASU A;  1ITG A;  4PA1 A;  2XO7 A;  4KHY A;  3TAR A;  1NJZ A;  3SZ2 A;  1S9G A;  3VA0 A;  1N5Y A;  3UIQ A;  3CQ8 A;  4FJ7 A;  3SUQ A;  3NCI A;  4DS4 A;  1X9S A;  1EET A;  3H08 A;  4DTO A;  2IS3 A;  4HUE A;  2KZM A;  3EZ5 A;  4OKJ A;  4FCY A;  1TAU A;  3NGY A;  3RMC A;  3K59 A;  3HPG A;  4E7I A;  4FJ9 A;  2JLE A;  2YNG A;  4CF9 A;  3QEW A;  1VSI A;  2YKM A;  1LWF A;  3V9X A;  3PV8 A;  2GBZ A;  3DRP A;  3WNE A;  3U3G A;  3DLH A;  4G1Q A;  3ISN C;  1GOC A;  4DMN A;  3KJV A;  4FZZ A;  4B9N A;  3AVK A;  3SQ0 A;  1U49 A;  2QKK A;  4CF2 A;  3JYT A;  3SQ4 A;  1QSY A;  4NYF A;  3AO2 A;  2KFN A;  4OGC A;  4KHW A;  3VQC A;  4CJS A;  2ZE2 A;  5DK5 A;  1FXX A;  3L2R A;  1VSL A;  3DYA A;  2D0B A;  3ZSY A;  2D0A A;  1J9A A;  1WSG A;  4KO0 A;  4CFD A;  2B6A A;  3SYZ A;  3MXI A;  3PO4 A;  4HCB A;  4QCL A;  3OY9 A;  3MXM A;  2G8V A;  4CEQ A;  4Q0B A;  4CHY A;  1RTD A;  3DOL A;  1VSM A;  1EXQ A;  4DTN A;  3G10 A;  4B9V A;  4C8L A;  1S1W A;  2QK9 A;  1X1P A;  1RBV A;  3L2V A;  4LH4 A;  4DF8 A;  1RTH A;  3TAE A;  4OKE A;  3RMA A;  4FK2 A;  4M41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...