1CZ9A

Atomic resolution asv integrase core domain (d64n) from citrate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
139
structure length
139
Chain Sequence
QIWQTNFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords AVIAN SARCOMA VIRUS INTEGRASE
publication title Atomic resolution structures of the core domain of avian sarcoma virus integrase and its D64N mutant.
pubmed doi rcsb
source organism Avian sarcoma virus
total genus 51
structure length 139
sequence length 139
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1cz9A00
4W5NA 1S5JA 1JL1A 1JLAA 2X6SA 3IRXA 1IKVA 3RTVA 4DSJA 5KTQA 4GMJB 1ZBIA 4CE9A 4BE2A 1S1WA 1RBRA 1VSIA 4M41A 1B9DA 4H4MA 2YNFA 3NDKA 4DS5A 3ZSYA 3MAQA 3V9UA 2RF2A 3OYGA 2KQ2A 1ASWA 4DQSA 3RR7A 2IAJA 1FK9A 3ITHA 1BI4A 1JL2A 3ZSWA 1IKYA 1QTMA 4KFBA 1JLGA 3OVNA 4Z4FA 5KI6A 3QEVA 2KTQA 2GV9A 2X6NA 3TAQA 3ZSVA 1EXQA 4FJ5A 3KKRA 5DK5A 4CIGA 4NCBA 1I3AA 4FJNA 2G8HA 1ZBHA 3QIPA 4CJRA 1CLQA 5CZ2A 1WSEA 3KK2A 1ZBLA 4M45A 1SUQA 4CHZA 2P5GA 1BQNA 4LSNA 4CFBA 3TAFA 4F2SA 2FBYA 4LH5A 4CGHA 4RW7A 3HPOA 3KKSA 2G8WA 3SQ2A 1NJYA 3RWUA 3VQAA 1LWFA 2BE2A 4ICLA 4AHSA 1LW2A 4CEFA 4JS4A 4N41A 4MFBA 5JS2A 1TAQA 3TWHA 1SKSA 1Q8IA 4FLXA 1NK7A 4FM1A 1S1UA 3C94A 3L2WA 1KTQA 2G8VA 1NOZA 4FJKA 3ZT4A 4ZTFA 4AHVA 3C6TA 3QINA 4DQPA 4OVLA 1RT5A 3HP9A 5J2QA 3EZ5A 3QNOA 4M3XA 5HP1A 3OYNA 2I5JA 2PYJA 2HHWA 1U45A 2PYLA 2WONA 3ZT0A 2VG5A 4NCGA 4OPKA 1JXBA 2YHAA 3S3MA 1WAFA 4CJQA 4IDKA 3VQ5A 3QIOA 1D9DA 4E0DA 2Z1JA 1LW0A 4OKKA 1VSMA 4E1MA 4CGFA 4DFKA 4C8NA 3WNHA 5J1EA 3G0ZA 4AHCA 4PQUA 4J2AA 2FBXA 4CJKA 1JLFA 3EYZA 3KLGA 2HNDA 2Q3SA 1J54A 1G15A 4DU4A 4BWMA 1CXQA 2B5JA 4Z4GA 1LWEA 2HHTA 4F3OA 4UQGA 2PZSA 3O4QA 4CGJA 1NKCA 1RBVA 3L2QA 4HUEA 3NGZA 2A1RA 3L3VA 1DLOA 1KLMA 5K14A 4AHUA 4IG0A 2P51A 3RRHA 4DF8A 1NK8A 2P5OA 1C1CA 3VQEA 3DLHA 3NF8A 3U6FA 3QESA 5JS1A 4CF1A 4AHRA 1R0AA 4OLBA 4CEOA 1HYSA 1EX4A 2YNHA 1B9FA 1QE1A 1J9AA 1WAJA 3HPGA 4CIEA 2ZD1A 5KRSA 3S3OA 4OKEA 4CEAA 1VSKA 1VSEA 4KREA 2FC0A 2YNIA 1X9WA 3AVIA 1B92A 1NKEA 3CFOA 3DRPA 1VSDA 1CZ9A 3HT3A 4B9NA 1RNHA 1JLCA 2QXFA 4I2PA 1ITGA 3OYAA 5HRSA 2IGIA 1Q9YA 1QS4A 4O4GA 4PY5A 3AA4A 3KLFA 2A1SA 3C6UA 4FZYA 4FVMA 5CYQA 2KFZA 4CHPA 2YV0X 4NYFA 5CY4A 3I8DA 3O3GA 4FJ8A 2Z1HA 3NF9A 1U04A 4J2BA 4KHSA 1BGXT 3KLEA 4DFPA 3BDPA 1HQUA 4HUGA 4CEQA 4HCBA 2Y1IA 3OYKA 4C8MA 3L2RA 3JYTA 1XHZA 2QKKA 3CQ8A 5FRMA 1N5YA 1WSHA 5FDLA 3T3FA 4N56A 4W5RA 3TI0A 2HNYA 1WLJA 3K5OA 4FW2A 2ZQBA 4CERA 3OYEA 2AJQA 3V9WA 3LAKA 4CCHA 1RBSA 2HHUA 3VQQA 1IKXA 4CGGA 4YNQA 1ZBUA 1L3VA 4I2QA 4F8RA 4KRFA 4CF2A 3AA5X 4DSLA 1XWLA 4XIUA 1KRPA 4IFYA 3HVTA 2E4LA 3ASMA 4ZHRA 1RTJA 3CM6A 3RMCA 2OZSA 4BDPA 4DTPA 1ASUA 3OS2A 3PX4A 2G8KA 4KAZA 4FK2A 3AA2A 1TK8A 4ELUA 3SNNA 1TGOA 1F21A 3V1QA 1WSJA 2JGUA 3AVKA 3C95A 5CYMA 4W5QA 3L2UA 1I39A 4FLTA 4E7IA 1LV5A 4DTUA 3V1RA 1ZBFA 2BGGA 3KIOA 3CM5A 3ZSOA 5C42A 2VWJA 2OYQA 4GVMA 1Y97A 3B6PA 3FFIA 2OPQA 4E19A 3MXMA 2HB5A 1TL3A 1LWCA 4RG8A 4E3SA 3HVRA 4DFJA 1NOYA 1D5AA 1LAVA 1RILA 3CYMA 3SPYA 3V6DA 1RT3A 4OJRA 4KHQA 3ZT2A 1FKOA 4FLUA 4EZ6A 3SZ2A 3F73A 4LSLA 2RKIA 4NYNA 3V4IA 1JLQA 4M3WA 3AO5A 4EP4A 1RT7A 3DLEA 1BCMA 3TAMA 5KGXA 4AILC 5D3GA 3QEIA 3SUOA 2O4GA 3LWMA 4O0JA 1CZBA 4CEDA 2HHQA 1XC9A 3AVAA 4TSXA 4Y1DA 1S1TA 4DFMA 4I9LA 1UAXA 3VQ7A 3L3UA 3DRSA 3SYZA 4KI4A 4CHQA 1RT4A 3AVGA 3M8SA 4IG3A 1WNSA 4HVJA 3OYFA 3NCIA 4B9SA 3WNGA 4CJ3A 3RMAA 1QHTA 2F96A 3VQ6A 5HRNA 1RT1A 1U4BA 1L3TA 4M3ZA 1SV5A 4CJLA 4FJ7A 2BDPA 4L8RB 3HM9A 2VG7A 3HJFA 3IS9A 5KRTA 1HYZA 3TABA 5EU7A 2G8UA 3SI6A 3A2FA 4KO0A 2F8TA 4OGEA 4CFAA 3ZSZA 4E7LA 1GOBA 2GUIA 4BACA 4Z4IA 4FCYA 3OJUA 4KKOA 1W0HA 2IC3A 3NGIA 2KZZA 5HROA 3DI6A 2F8SA 4CESA 3OYIA 4B9VA 4DMNA 1EP4A 1WSFA 3MECA 3OYJA 3NAEA 1UOCA 3P83D 3ZT3A 1T03A 3PV8A 4G1QA 3LPUA 4PA1A 4DG1A 1EETA 1CXUA 1BCOA 3ZSXA 5HRPA 3DM2A 2EX3A 1C0UA 3DOLA 2XRIA 3ZSQA 3LZJA 2XHBA 1VRTA 2OA8A 4CIFA 3T1AA 4FLYA 3NBPA 1HQEA 4I7FA 3UIQA 4YFUA 4CF8A 2O4IA 2DFEA 3I0RA 4B3OA 1YTUA 2XO7A 2ATQA 3B6OA 3TR8A 1T05A 3D45A 4KHWA 1S1VA 1BL3A 5C24A 3HP6A 3O4NA 5T7BA 3THVA 1DTTA 4DTRA 1JXEA 1TVRA 3HSTB 3ZSRA 4CJTA 2HMIA 4FJGA 2LSNA 4FYDA 2RPIA 3LP1A 4DSEA 4DTMA 5I42A 5FROA 1NK6A 3LZIA 3DLBA 3DLKA 2B4JA 4KTZA 4M3RA 4FW1A 4M3YA 4DTXA 3LDSA 1X9MA 4I9QA 3L2VA 3PUFA 4FJMA 3PO5A 1NK5A 4OLAA 1ZYQA 4CJ4A 4CJFA 3V9SA 3PO4A 1VSJA 1VSFA 3AO1A 1T8EA 1YTAA 2D5RA 3TAPA 1RT2A 4IBNA 4CFCA 4Q5VA 4HUFA 1TK0A 3QEXA 3VQBA 4FJ9A 4W5TA 1VSLA 2D0BA 3SUPA 3MEGA 3V9ZA 3U3YA 3SCXA 1L3UA 3NF6A 3AVMA 3IG1A 1T7PA 1K6YA 4CHNA 2ETJA 3M8PA 3U3GA 1U47A 1BIZA 2Y1JA 4Z4HA 1RTHA 1C1BA 5CZ1A 4EP5A 2YKNA 3NFAA 1TKDA 1D9FA 1SL1A 4M42A 2D0AA 4NCAA 2DY4A 4FJXA 2Z1IA 3LP3A 3MXJA 1KVBA 3OYDA 1HPZA 3AVJA 4KTWA 2B6AA 4CK2A 3OYHA 3WNEA 4JRQA 4QCLA 4DWIA 4FM2A 3SQ0A 4CJPA 5J2NA 2YNGA 3LAMA 3OYBA 4DTJA 3HO1A 1NK9A 4ID5A 2QKBA 2ITGA 3AVCA 1NJXA 4FJIA 5C25A 2HW3A 4Q0BA 4DTOA 4M3UA 3QLHA 4KHYA 1VRUA 2EHGA 3CG7A 2ZE2A 4DLGA 3KTQA 2DFHA 4AH9A 4K8XA 3OS0A 1O1WA 4CJ5A 4DSFA 4CECA 3KK3A 5J2PA 4F3TA 4CEBA 1REVA 5SZTA 1S1XA 3M8RA 4EZ9A 3ISNC 4CHYA 4RW6A 4O5BA 3HK2A 4B9MA 3VA3A 4FJHA 3AO2A 4F2RA 2PY5A 4N76A 3NHGA 4IKFA 3HXMA 4KB0A 1BI4B 1HYVA 4BDYA 4OGCA 3D0PA 3QERA 5J2MA 2NUBA 2VG6A 1HNVA 3HYFA 4B08A 3CFPA 3AO4A 1RDBA 4BDZA 4BE1A 1Z25A 2DTUA 1KVCA 1MU2A 3MXIA 4ELVA 3EY1A 3V81A 1A5WA 2KW4A 3MEDA 4DU3A 1X1PA 4B9TA 4KB1A 3H08A 3OYLA 4MQ3A 1C1AA 1RDDA 3DRRA 1X9SA 1NKBA 5HBMA 3RMDA 3AVBA 1UWBA 2HVHA 4RW9A 3K5MA 4CK3A 4BWJA 2YKMA 3SV4A 1SKWA 2WOMA 3NE6A 3LANA 1LAWA 1GOAA 1HNIA 3QEWA 1RDCA 2OPRA 2XY5A 3P5JA 4OPJA 4FLWA 5I3UA 1J53A 4O44A 3AVFA 4R5PA 3TANA 1TAUA 4FM0A 1KCFA 3HPHA 1JKHA 4F4KA 3TARA 1TKTA 3SQ1A 3PX6A 1BISA 5DMRA 3KLHA 4FJLA 1IKWA 1HJRA 4QOZB 1Q9XA 1YT3A 2FBTA 2HNZA 4KTQA 4C8OA 3K5NA 1TKZA 2VWKA 4O55A 1IO2A 3ZCMA 4DQRA 1RBUA 4DF4A 2HHVA 1A5VA 4FLZA 4FZZA 5HLFA 3RMBA 1NJWA 2OPSA 4CHOA 4DSKA 1YVUA 3E01A 3OYCA 3NGYA 1N6QA 2GBZA 4KI6A 4M3TA 3QNNA 4IFVA 1S6PA 2Z1GA 1RCHA 1ASVA 4ID1A 1A5XA 4CF0A 4CJWA 4CK1A 3KD1E 1KLNA 4PUOA 4FJJA 1TK5A 2OZMA 3KK1A 3KJVA 3SV3A 4DQIA 1FXXA 4E89A 1XHXA 3NH2A 4DS4A 3L8BA 3AVLA 2FBVA 4DQQA 1QSLA 2X74A 3S3NA 4FK0A 3OJSA 4K8ZA 3M8QA 1NJZA 2G8FA 1VK0A 5FRNA 1C0TA 3DOKA 4B8CA 4DLEA 3CFRA 4FXDA 3LP2A 1J5OA 1VSHA 4E1NA 1RDAA 4B9LA 1FKPA 3VQPA 2P1JA 4BE0A 1IG9A 3OS1A 4N47A 4KHNA 3LWLA 4B9UA 4CGDA 2W42A 1KSPA 3AV9A 3T19A 1RT6A 2X78A 3IAYA 1WN7A 2QK9A 4CJVA 4DSIA 1BHLA 1D8YA 3V9XA 3TAEA 4E7JA 4CJSA 4OKJA 4JLHA 5SWMA 3LP0A 3MEEA 1W9HA 4DTNA 3O3FA 3NH1A 3P1GA 2R7YA 3BGRA 4PWDA 2YHBA 4FLVA 4KV8A 3PY8A 4J2DA 3VQCA 3AO3A 4E7KA 3TAGA 2KFNA 3S9HA 2HVIA 4CJEA 2KZMA 2BANA 1S6QA 4RW4A 3VQ4A 4DU1A 4CEEA 1QQCA 4Z0UA 1KFSA 4HCCA 5E41A 4HTUA 2HHXA 4B8AB 1QSYA 4N5SA 3DMJA 4C8KA 3AVHA 1IH7A 4KHUA 1TKXA 3QETA 2IS3A 1SKRA 3VN5A 4C8LA 1WSIA 3KD5E 1UA1A 3I0SA 4CF9A 3HL8A 3VA0A 3K59A 4DTSA 1SL0A 3SUQA 3AA3A 1KVAA 3G10A 3LALA 3K5LA 3DLGA 4HHTA 2OPPA 1L5UA 3VQ9A 1KFDA 1RTIA 2RN2A 1Z26A 3AVNA 4FK4A 1JLEA 1U48A 4LD0A 2XY8A 2JLEA 2XY7A 1L3SA 2DFFA 3DYAA 4CJUA 4CEZA 4JS5A 2D0CA 4QAGA 3SQ4A 1JLBA 4LY7A 4J2EA 3F9KA 1SL2A 2E6MA 1S9GA 4Z4EA 3DLRA 2IDOA 4LH4A 3OYMA 3ZT1A 3QO9A 4Y1CA 1GOCA 4RW8A 4WE1A 4O0IA 4H8KA 1C0MA 1S9EA 3JSMA 2XY6A 4FZXC 3LPTA 1TL1A 2HHSA 4CGIA 4Z4CA 3OY9A 1DTQA 3ULDA 4GW6A 3RRGA 3K57A 1U49A 4ZTJA 1QSSA 4AHTA 1EKEA 3SUNA 3VQDA 3QEPA 4ELTA 3PX0A 3NH0A 1TV6A 3SPZA 4KPYA 3K58A 3VQ8A 4W5OA 1HRHA 4CFDA 1RTDA 2E6LA 4E7HA 1NK0A 1RBTA 1XI1A 3K2PA 3NF7A 5KGWA 1HMVA 2IOCA 3O3HA 4H4OA 1BIUA 2G8IA 3SJJA 1NK4A 1WSGA 3RR8A 3KLIA 3WNFA 3V1OA 4JRPA 1C6VA 3ALYA 5HRRA 1BQMA 1UA0A
chains in the Genus database with same CATH superfamily
4GMJB 1S1WA 3RVCA 1IBKK 1B9DA 1NMNA 3NDKA 4DR3K 4FPAA 1T44A 1K8KA 3V9UA 3RR7A 2KQ2A 3VESA 4DQSA 3LM9A 5AR0A 1BI4A 3WQUA 1JL2A 4KFBA 1JLGA 3UE5A 3R1XA 3TAQA 1HUXA 3ZSVA 1NJIO 5DM6L 2GWJA 3ZETB 3H3NO 4YDUC 1ATRA 1I3AA 4FJNA 3QIPA 2KLAA 4FWNA 1ZBLA 4IFEA 2P5GA 1BQNA 3TAFA 3U9DA 2NRHA 1ATSA 3RWUA 4LFAK 3G71N 4AF1A 1HKBA 4JS4A 1KD1O 4MFBA 3DWLA 3J8AA 5JS2A 1Q8IA 1NK7A 5JLFA 1S1UA 2QWNA 4FJKA 3OHRA 1ZXOA 4ZTFA 4AHVA 3MMVA 3CJBA 5J2QA 1OH7A 4IOXA 5E26A 2HBMA 4JD2B 2PYJA 2VQEK 2PYLA 3ZT0A 2VG5A 1JXBA 4CJQA 3VQ5A 3QIOA 4E0DA 2Z1JA 3A5LC 4ISEA 5J1EA 2QTDA 2YI1A 3EYZA 2HNDA 1BDGA 3C7NB 2Q31A 4CGJA 3L2QA 4HUEA 1C0FA 5AQRA 4AHUA 4IG0A 4B3TK 1C1CA 3QESA 5JS1A 2HF4A 4OLBA 1QE1A 4IWVA 5KRSA 5GAHP 1D4XA 3D2FB 1GLEG 3ZX3A 4JHDA 2HBLA 3DRPA 3ULEB 2P9LA 1JLCA 3SBGA 2CGJA 4PY5A 4FVMA 4FOEA 1FJGK 4CHPA 1WOQA 2YV0X 5CY4A 5HOOA 3I8DA 3O3GA 2RE2A 2Z1HA 1U04A 3BDPA 3TTCA 2F9TA 3CMEN 4V19S 3MN5A 5FDLA 3THXA 3QMLA 3UKRA 1C0GA 4N56A 1HKCA 1WLJA 3P39A 3T69A 4CERA 2AP1A 3LAKA 1TUUA 4B3MK 1ZBUA 4CF2A 1NGFA 1XWLA 2E4LA 1VQ4N 5AQPA 1XC3A 1ASUA 4A5BA 1TK8A 1F21A 1HNZK 3V1QA 1WSJA 2JGUA 3C95A 3D7EO 2NZTA 4B9QA 1YJ9N 3ZSOA 1Y97A 3MXMA 5BN9A 3V6DA 3ZT2A 5KQDA 1FKOA 2BH1A 3F73A 4LSLA 3SZ2A 5KQ8A 4M3WA 3DLEA 3VEXA 1BCMA 2V51B 5D3GA 1CZBA 3QICA 4BR5A 4TSXA 3CJ7A 4DFMA 3THWB 1UAXA 1VAZA 3N4PA 3CPEA 1YF5L 3AVGA 4IG3A 1G99A 3GDQA 3OYFA 1GLBG 2F96A 3VQ6A 2PBDA 3L0QA 1SV5A 3DLLL 4LF9K 4CJLA 4FJ7A 3MK6A 4YY3K 4BVPA 1NM1A 5KRTA 3SI6A 4KO0A 4NB4A 2F8TA 4CFAA 2GUIA 4Z4IA 2GWKA 4B1UB 1HR0K 1QVFM 3DI6A 2F8SA 3ZETA 1EP4A 3NAEA 3P83D 3ZT3A 4DG1A 1EETA 1CXUA 1BCOA 5HRPA 3DM2A 2EX3A 3J7YP 3LZJA 2O8FB 4EFHA 4B1VA 4CF8A 3I0RA 5H1SQ 3K0SA 1YTUA 4BRDA 5M1NA 1U2VB 5C24A 4JAXA 3EL2A 5T7BA 3THVA 4DTRA 4FJGA 2LSNA 4X65K 2UYTA 1NK6A 4JD2A 3LZIA 3DLBA 2QM1A 4FJMA 2V7YA 4LF7K 1ZYQA 3V9SA 1VSFA 3LDNA 1YTAA 2D5RA 3O9QA 1RT2A 4IBNA 4Q5VA 5AQLA 2ZJRL 3C7NA 2D0BA 4DV0K 3V9ZA 1L3UA 3CCLN 3KZBA 4M7YA 1T7PA 2ETJA 2Y1JA 4Z4HA 5CZ1A 5AZJB 1TKDA 1SQKA 4K0KK 3SAHA 3R3LA 3D2FA 2Q1NA 3OYHA 3WNEA 4JRQA 4QCLA 3IDHA 2YX6A 3H1QA 4BRLA 4CJPA 3ULEA 2NRTA 3OYBA 2QKBA 2ITGA 4FJIA 3SLCA 4GVEA 4B1YB 5BR9A 4M3UA 5AQNA 4CZKA 3CETA 5EXWA 4CJ5A 4CECA 3M8RA 4I6MB 4RW6A 4K41A 4KHPK 1S3XA 4IKFA 1FW6A 3BZCA 5AQHA 1HNVA 4WFAL 3MDQA 1RDBA 2DTUA 4WQ4C 3EY1A 4WQ5C 3WXJA 3MEDA 1NGBA 3B8AX 4KB1A 3DRRA 1X9SA 1UWBA 3K5MA 3I55N 2WOMA 1GOAA 4LF5K 1RDCA 2OPRA 4DQ8A 1O13A 3LDQA 3FR0A 4FLWA 2P9UB 4O44A 4R5PA 1JKHA 4F4KA 1TKTA 1XMQK 1SS6A 5DMRA 3AAPA 2ITMA 3ENBA 1YT3A 1H1VA 2HNZA 3THWA 4K42A 2VWKA 1RBUA 3GG4A 4FLZA 4FZZA 1YXQA 4DSKA 4M3TA 3E01A 1OH5A 3QNNA 5M1FA 2ASMA 1KLNA 1QZ5A 2OZMA 1FXXA 1XMOK 4E89A 4DS4A 4EIAA 4FK0A 3S3NA 1J6ZA 3OJSA 3BF1A 3C0BA 5HL7L 3CFRA 5C15A 4FXDA 1RDAA 2HHHK 3FZHA 3VQPA 2P1JA 4N47A 1N8RO 4B9UA 4FWPA 2X78A 4CJVA 1BHLA 1D8YA 3V9XA 3TSQA 5EOYA 4UY8O 1W9HA 3O3FA 3W3DA 3BGRA 4HTLA 1T3VA 4KV8A 1U2VA 4J2DA 3VQCA 3O1BA 4BQZA 3FFKB 4CJEA 1GLLO 4BR4A 1NGDA 1QQCA 4LFBK 4Z0UA 1KFSA 2HHXA 1QSYA 4C8KA 1TKXA 2FLOA 3QETA 3VN5A 1WSIA 3CJ9A 2QWPA 3HL8A 4BR0A 5EX5A 3G10A 1NGCA 3K5LA 3EEQA 1Z26A 1L3SA 3DYAA 1TYQB 2E8AA 4QAGA 4PKIA 3F9KA 2E6MA 3MX2A 3DLRA 4LH4A 4Y1CA 1GOCA 5AZJA 4RW8A 1BWFO 3A5OC 4C1NK 2XY6A 1Q7YO 1X9JA 3E9LA 3T1HK 4Z4CA 4JKCA 4CZIA 3OY9A 4KH4A 4AHTA 1EKEA 5CR4A 1NLVA 2YHXA 2UUCK 1TV6A 2A3ZA 3K58A 4W5OA 2W6KA 2E6LA 4CVNE 3MCAB 1RBTA 4E7HA 4O8KA 1HMVA 4JV5K 3SJJA 3ID6A 4JK7A 3WNFA 5TKYA 4JRPA 1C6VA 2Q0UA 2QEXN 1S5JA 1JL1A 3IRXA 1IKVA 2ZF5O 4I6MA 2FXUA 5AFUH 1OVYA 1WB9A 2YNFA 4K25A 4DS5A 3ZSYA 1ASWA 1FK9A 3VPZA 3ZSWA 1QTMA 2HF3A 4Z4FA 5KI6A 2GV9A 1EXQA 3KKRA 4NCBA 2YHYA 4YOTA 2G8HA 2A40A 5CZ2A 4CHZA 3G4SN 4LSNA 4F2SA 2FBYA 4LH5A 4CGHA 3KKSA 3CCSN 1NJYA 3DXKB 4CEFA 1JCEA 1LW2A 5LL6Z 2P9UA 1TAQA 3TWHA 5AFUA 3M3ZA 1SKSA 2WC9A 4FM1A 3C94A 5F1XA 4CBUA 3ZT4A 4PKGA 2HMPA 3WT0A 3HP9A 4LF4K 5HP1A 2HHWA 2UXCK 4LFCK 2E2NA 2E1YA 3C6HA 1VSMA 4CGFA 3WNHA 4AHCA 3KLGA 4BC5A 2Q3SA 3ENHA 3G25A 4DV7K 3GL1A 2Q97A 2HHTA 2PZSA 2Q36A 1RBVA 3G6EN 3NGZA 2A1RA 5K14A 2P51A 4DF8A 3BUZB 4BRAA 3DLHA 3NF8A 1VQ7N 1R0AA 4XH1A 4CEOA 2QA4N 2YNHA 1WAJA 2F4VK 3S3OA 2E88A 4KREA 1VSKA 3ZEUB 1X9WA 1NKEA 3CFOA 2FSJA 1ITGA 3OYAA 3QBWA 2IGIA 5HRSA 4O4GA 3AA4A 3C6UA 4JYAK 4FZYA 1J5EK 3TSUA 3SAFA 4FJ8A 4J2BA 1BGXT 4DFPA 5FRMA 4C8MA 4A2AA 3L2RA 1XHZA 2QKKA 1WSHA 1K73O 3T3FA 3J81O 2HNYA 3K5OA 2AJQA 2ZQBA 4JKHA 3PIPL 2F9WA 3O5BA 4DSLA 4C23A 5JVGL 1RTJA 2P9IB 2OZSA 2E2QA 1TYQA 3OS2A 3CJCA 4ELUA 3ATUA 5CYMA 1XNRK 4BRKA 4E7IA 1LV5A 2BGGA 3CM5A 5C42A 2VWJA 2OYQA 4E19A 3EO3A 2HB5A 1YVNA 4RG8A 4IOCL 4AQYK 3HVRA 1D5AA 2CH6A 4CBWA 4CZGA 4NYNA 5BPLA 3EKSA 3V4IA 1JLQA 3AO5A 2D0PA 4EP4A 3BZKA 5KGXA 3TAMA 4AM6A 3LWMA 4O0JA 1XQSC 5M1PA 2HHQA 1S1TA 1EO1A 1RT4A 1YJWN 3NCIA 4B9SA 3WEEB 4CJ3A 1QHTA 4M3ZA 4L8RB 3LDLA 3HM9A 3QDKA 4A2BA 3UKUB 3A2FA 4OGEA 4CZFA 3ZSZA 1P8ZA 1YI2N 1ZBSA 1YIJN 3R9PA 4BG9A 1W0HA 2IC3A 4B9VA 4DMNA 3MECA 3OYJA 3O80A 3LPUA 1W7AA 4PL8A 3O6WA 5EY4A 4JI5K 3DOLA 2OA8A 3DXKA 3TSPA 3U4LA 2O8EB 3P38A 3UIQA 1KXPA 4YFUA 2DFEA 4B3OA 4BROA 2ATQA 3TR8A 4KHWA 1S1VA 1BL3A 3O4NA 1MA9B 4BVOA 4CJTA 2HMIA 3ZSRA 3TPQA 5JICA 4WFBL 3N4QA 3HZ6A 2RPIA 3DLKA 2JWKA 4M3YA 2QWMA 5FLXO 3J7ZO 4JI4K 3LDSA 3M6GA 4FWRA 1X9MA 4I9QA 3TU5A 2GX9A 2WBNA 5BPNA 4O5FA 4CFCA 3VMFB 4BRFA 3JS6A 3AVMA 3AAQA 5ADXH 4CHNA 5IT9O 3M8PA 4YORA 2YKNA 2DY4A 1HPZA 4CI6A 1QQOA 4BRPA 4KTWA 3ZEUA 1R59O 4DR5K 3DAWA 3WXIA 1NJXA 1Q86O 5C10A 4XEIA 1VRUA 3I56N 1NU0A 2ZE2A 3RSEB 4DLGA 4K8XA 2VGMA 1GLCG 5ADXA 3CCJN 4CEBA 1K9MO 5SZTA 3ATVA 3ISNC 4O5BA 3VA3A 1RFQA 3AO2A 3THYB 2V7ZA 5IWAK 3NHGA 3PLAA 2P9IA 4BDYA 4OGCA 4H0OA 5JMVA 2O8BB 5J2MA 4EHTA 3HYFA 4BE1A 3MN7A 1Z25A 1JCFA 4ELVA 3SMSA 2KW4A 4DV1K 5JVHL 4MQ3A 1C1AA 5HBMA 4RW9A 4B1ZA 4M63C 2YKMA 4CK3A 3SV4A 3QEWA 5AQJA 4ISFA 3ZX2A 4OPJA 1SAZA 1KCFA 3HPHA 1VQNN 1OH8A 1NGIA 3HBTA 3PX6A 1BISA 3BY5A 3KLHA 2E5LK 2BTFA 4QOZB 1HJRA 1Q9XA 4JI2K 2FBTA 4DR2K 4C8OA 1A5VA 3RMBA 4FK2A 2KKZA 3K9JA 3NGYA 1N6QA 3WEEA 4KI6A 1RCHA 3KD1E 4CF0A 2BUPA 3IUCA 3UB5A 4PUOA 4FJJA 1NGJA 4AM7A 4J8FA 3KK1A 4FSVA 3S41A 3VTHA 4DQIA 3FE1A 1XHXA 3NH2A 3UKUA 2FBVA 1QSLA 2X74A 2KHOA 4FWLA 2G8FA 5FRNA 4DUYK 3LP2A 4E1NA 1FKPA 3OS1A 4KHNA 3T19A 2GUPA 4O8UA 3IAYA 1WN7A 5AQQA 3TAEA 5M1KA 4B1WB 4CJSA 2O8CB 2O8EA 5SWMA 2YJFA 4DTNA 3OBYA 3P1GA 2R7YA 4PWDA 2HBKA 2PAVA 2YHBA 3AO3A 2NRVA 3S9HA 2KZMA 3R8EA 4H0YB 4ISGA 4B8AB 4N5SA 2WUSA 1IH7A 2IS3A 1SKRA 4C8LA 2NRXA 4CF9A 3KWIA 3VA0A 3AA3A 4HHTA 3LALA 2OPPA 4M7XA 4G9ZA 1RDWX 3AVNA 1JLEA 4FK4A 3VETA 2XY8A 2XY7A 4CJUA 4H5NA 3SQ4A 1JLBA 4LY7A 4YOUA 4WE1A 3P4IA 4H8KA 1NWKA 4H5RA 4GW6A 3VEWA 4ZTJA 1QHAA 3VQDA 3QEPA 5BRFA 4H0PA 3NH0A 5BREA 4BY9C 3EKUA 1NGHA 1HRHA 3LDPA 1YHQN 3WXLA 1HX1A 4LF8K 5KGWA 2IOCA 5AQKA 4XH5A 3FZLA 4H4OA 2H3GX 3KLIA 3RSEA 5HRRA 1UA0A 4FPBA 4W5NA 3VF2A 1ZBIA 4CE9A 3NVKA 1X3MA 2ZWHA 4M41A 5BR8K 2WTUA 4H4MA 3CHWA 4JKAA 3THYA 4ILJA 2OCEA 5EVZA 4JI0K 3MAQA 3ITHA 1IKYA 2QI2A 2O8BA 3OVNA 2KTQA 4FJ5A 5DK5A 4BC2A 4DKWA 4BRMA 2OTJN 1ZBHA 4CJRA 3MN6A 1WSEA 3VEVA 2E20A 4CW7B 5KPZA 4CFBA 4DV6K 1VQON 3E9OA 3HPOA 4RW7A 2G8WA 3VQAA 1LWFA 2BE2A 4N41A 1E4GT 4U7BA 1DGKN 2G8VA 2IVPA 3ID8A 3OTOK 4DQPA 2E1ZA 2IVOA 1YUWA 1JCGA 4IDHA 3EZ5A 3O9UA 4M3XA 2IVNA 1GLJO 3OYNA 3CD6N 1U45A 2WONA 3T7ZA 2YHAA 2O8FA 3S3MA 2W6LA 1WAFA 5FPNA 4IDKA 4PL7A 1LW0A 3A5MC 4E1MA 3I8BA 4DFKA 1Z05A 3G0ZA 3QFPA 4CJKA 3CCMN 2NNWA 4DU4A 3VF6A 4BWMA 1CXQA 2B5JA 4Z4GA 1LWEA 4F3OA 3PIOL 3HI0A 3L3VA 1DLOA 3RRHA 2P5OA 4H0VB 3VQEA 4FWMA 4CF1A 4AHRA 1HYSA 1J9AA 1T6CA 2O8CA 2ZD1A 3AY9A 4OKEA 4CEAA 1VSEA 2YNIA 1B92A 1VSDA 1CZ9A 3HT3A 4A59A 1Q9YA 3KLFA 1IV0A 1HJOA 1N32K 2KFZA 5CYQA 3A8YA 4GV3A 5C2DA 1HQUA 3ZX0A 4HCBA 1KAZA 3OYKA 3CQ8A 4JI7K 4W5RA 3CJAA 3OYEA 3V9WA 4CCHA 1RBSA 1EQYA 3VQQA 5DM7L 5I9EB 4YNQA 4F8RA 1L3VA 4I2QA 3D6RA 4JKGB 1VQ5N 4KRFA 3AA5X 1Y64A 4XIUA 4ZHRA 2NLXA 4BDPA 4DTPA 4MLEA 2G8KA 2QWLA 3VGKA 1TGOA 3SNNA 5LMUK 3L2UA 4W5QA 4DUZK 1I39A 4GKJK 1CZAN 4JI6K 4DTUA 3C65A 3V1RA 3KIOA 4GVMA 3B6PA 2OPQA 3MN9A 3IFRA 5AQGA 5C12A 4DFJA 3AARA 3VEYA 5AQZA 1LAVA 3KVGA 2NRWA 3HOTA 3VGMA 1VQKN 4FLUA 4GKKK 4IZ9A 1RT7A 4RWTA 3Q7BA 3QEIA 2O4GA 4BR7A 4DCHA 4IJAA 4DR7K 4MDAA 3CCQN 4I9LA 3VQ7A 3L3UA 4KI4A 3DXMB 2UXBK 3M8SA 4HVJA 3RMAA 4RTFD 5HRNA 1RT1A 4BR9A 4YHHK 2BDPA 1GLDG 2VG7A 1QVGM 1IBLK 2E2PA 1HYZA 3TABA 5EU7A 4DB3A 2G8UA 5JLHA 3KWGA 5AQMA 4FO0A 1YJNN 3EN9A 4FCYA 3OJUA 3OW2M 2P9NB 3NGIA 3CCVN 3OYIA 3AGKA 1WSFA 2FF6A 3CCRN 3PV8A 4G1QA 2A6AA 4L3QA 3ZSXA 5LY3A 1KAXA 3A5NC 5KPTA 5CE3A 2XRIA 1VRTA 3PSFA 4CIFA 3T1AA 4FLYA 1HQEA 4I7FA 1VQLN 3HOSA 2O4IA 1T05A 3O9RA 1MDUB 3P31A 3H1VX 3CF5L 2VWBA 1TVRA 2CH5A 4KH5A 3LL3A 3LP1A 1VQ8N 5FROA 4H03B 2B4JA 1X3NA 4KTZA 4FW1A 4M3RA 4DTXA 4JEPA 2EWSA 4OLAA 1NK5A 3PO4A 5FPEA 3IKMA 3NVMA 1T8EA 4ILHA 2P9PB 4HUFA 1S72N 3VQBA 4W5TA 1VSLA 3U3YA 3SCXA 2NRRA 4WCEL 4X64K 4C1NI 1K6YA 4MLHA 4CJ7A 4EP5A 4M42A 2W41A 4FJXA 2Z1IA 3AVJA 4IO8A 2B6AA 3L4IA 3M1FA 5AJ3K 5J2NA 2YNGA 4H5VA 1BOTO 4DTJA 4JKDA 2ASOA 3JXUA 1NK9A 4DR6K 4ID5A 3WUHA 5C25A 2HW3A 3J80O 4BGAA 4Q0BA 3H45C 4DTOA 3QLHA 3F5TA 5BN8A 2EHGA 3CCEN 2J4RA 2DFHA 2GELA 1OVQA 4F3TA 1REVA 2D1KA 1S1XA 4MO5A 3MCPA 4F9OA 4EZ9A 3EE9A 4XH4A 4B3SK 5MLCQ 4JKGA 4F2RA 1MWMA 3CQXA 4OPHA 2PY5A 3HXMA 1QQNA 3D0PA 2NUBA 3CXCM 1RGIA 4BDZA 2ZJPL 1KVCA 1MU2A 3MXIA 3V81A 1A5WA 4YOVA 1X1PA 4B9TA 2FF3B 3H08A 3OYLA 5C0YA 1RDDA 1NKBA 3QFUA 1IBMK 1VQMN 2HVHA 1SKWA 1HNIA 2XY5A 1BUPA 3P5JA 3O9SA 3TANA 3AVFA 2FSNA 3TARA 3SQ1A 4JI8K 1QZ6A 4CBXA 4FJLA 1IKWA 3EE8A 3KK7A 4KTQA 3MWPA 3K5NA 4O55A 2HHVA 3ZCMA 3DXMA 1NJWA 2OPSA 4CHOA 1YVUA 4JI3K 4YDUA 1S6PA 2Z1GA 1A5XA 1LCUA 1TK5A 4DQQA 3L8BA 3AVLA 1HNXK 2QWRA 2A5XA 4DR4K 1E4FT 4K8ZA 1NJZA 1VK0A 3DOKA 4B8CA 3SBTA 3A0IX 4OX9K 2P9NA 4BE0A 4BRGA 1NMDA 3HSCA 3LWLA 4H0XB 4HWIA 4GNIA 4CGDA 2W42A 1KSPA 1Q81O 5LJWA 1DKGD 4DSIA 5AQUA 4OKJA 1EWQA 1HPMA 2P9SB 4NO7A 3JAMO 5AQIA 4FLVA 2OANA 3O08A 3E66A 4E7KA 3EZWA 4FWQA 2HVIA 3OA9A 3GOIA 2BANA 4RW4A 3VQ4A 4DU1A 4CEEA 3CC7N 3VERA 4X62K 4HCCA 5E41A 4HTUA 1OH6A 3CQYA 3DMJA 2QXLA 3AVHA 4KHUA 1P90A 4IEIA 4DV3K 3KD5E 5GADP 1SL0A 3K59A 3Q7CA 3SUQA 4FVUA 4BC4A 1L5UA 2P9PA 3VQ9A 3VENA 4LD0A 3CMAN 4JKBA 4PKHA 4CEZA 1Q18A 1I94K 4ILGB 2IDOA 3ZT1A 2UXDK 1W2BM 4O0IA 1C0MA 1S9EA 3JSMA 4DV5K 3LDOA 4FZXC 3LPTA 1TL1A 2HHSA 4CGIA 4YOYA 1BA1A 3ULDA 3VEOA 4JNEA 3K57A 1U49A 4NLCA 3CPWM 1SZ2A 3SUNA 3FLCO 3PX0A 4MO4A 3SPZA 3K2PA 1BIUA 4A5AA 1M1KO 2G8IA 1NBWA 3RR8A 5M1QA 3V1OA 1VQPN 3ALYA 1YAGA 1BQMA 1LOTB 2X6SA 1JLAA 3CCUN 4DSJA 3RTVA 5KTQA 3SAGA 4BE2A 1RBRA 1VSIA 1KC8O 1N36K 4FWOA 2RF2A 3OYGA 3ENOA 2IAJA 3F2KA 2OTLN 3QEVA 3FZFA 2AA4A 2X6NA 5AQTA 4CIGA 5FPDA 2PFUA 4CZEA 1CLQA 2YCHA 1WBDA 3KK2A 3E1YA 4M45A 1SUQA 3E9PA 4JK8A 5TKWA 4CD1A 3SQ2A 3W0LA 2E2OA 4ICLA 4AHSA 3IMXA 3WXMB 1DEJA 4FLXA 4A62A 1XNQK 3SJHA 4PHTX 3L2WA 1KTQA 2QWQA 1NOZA 4NXMK 3CC2N 2HBJA 4B3RK 3C6TA 3QINA 4OVLA 1RT5A 2HOEA 4U67L 3QNOA 2I5JA 3SK3A 4NCGA 4OPKA 1GLAG 4IO9L 1D9DA 3VOVA 3QB0A 4BREA 4OKKA 4C8NA 1MWKA 1HNWK 4PQUA 3H3OB 2FBXA 4J2AA 2DPNA 1JLFA 1NNEA 3KHYA 1J54A 1G15A 4OPAA 2ZGZA 4UQGA 3O4QA 1NKCA 1KLMA 1NK8A 3T1YK 3U6FA 1EX4A 1B9FA 3FGUA 4CIEA 3HPGA 2VYPA 3O1WA 2FC0A 2P9SA 3AVIA 5GIPA 4LF6K 5FPMA 1RNHA 2QXFA 4I2PA 4CD3A 4B9NA 4H5WA 1QS4A 3R6MA 1BO5O 4NLBA 2A1SA 2I7PA 4NYFA 4JK9A 1YITN 3NF9A 4KHSA 3KLEA 1QQMA 4HUGA 1NG9A 4CEQA 2Y1IA 3JYTA 1N5YA 5M1OA 3TI0A 4FW2A 5LJVA 5AZIB 4QS7A 4MDBA 1IJJA 2HHUA 1IKXA 1HLUA 4CGGA 2Q0RA 1VQ6N 1KRPA 4IFYA 3HVTA 3ASMA 4A57A 3CM6A 4EAHD 3RMCA 3PX4A 4KAZA 4NXNK 3AA2A 4DHYA 1KQSM 3LM2A 4FLTA 3AVKA 3H46O 1V4TA 4GV9A 4QS9A 1N34K 5GINA 1ZBFA 3FFIA 1TL3A 1LWCA 1Z6RA 2P9KB 4E3SA 1NOYA 1RILA 3CYMA 3BF3A 3SPYA 1RDUA 1RT3A 4OJRA 2UU9K 4FWSA 4KHQA 4EZ6A 2RKIA 3GE1A 1BA0A 3I33A 1XUPO 2GTDA 2VGNA 4AILC 3HTVA 3SMPA 3SUOA 2IIRA 1HKGA 3O4WA 3CI5A 4CEDA 2CGKA 1XC9A 3AVAA 4BRIA 4Y1DA 4RCHA 3DRSA 3SYZA 5E84A 4CHQA 3WQTA 4WQ4A 1WNSA 2ZGYA 4WQ5A 5F0XA 4CZLA 3WNGA 2W40A 1U4BA 4BG8A 1L3TA 3O9TA 1ATNA 3HJFA 3HM8A 1T6DA 3IS9A 2UUBK 4BRCA 5KPRA 3MX5A 4E7LA 1GOBA 4QS8A 4BACA 4A61A 4YOXA 4KKOA 2KZZA 5HROA 2O8DB 3D2EB 4CESA 2WFBA 5ELZA 1UOCA 1T03A 3DJCA 4PA1A 3VGLA 4B1XB 2QWOA 3ZSQA 1C0UA 2XHBA 4JKEA 4DR1K 4IEEA 3NMUA 3NBPA 3J7AP 3L6QA 1TUYA 4GY2B 3FZKA 2XO7A 3B6OA 2RHKA 3D45A 3HP6A 1DTTA 1JXEA 3HSTB 4FYDA 4IOAL 4DSEA 4OO1J 3CERA 4DTMA 5I42A 1E3MA 5BPMA 2QW9A 1ILYA 4Z94A 3L2VA 3PUFA 3PO5A 4CJ4A 1M90O 4CJFA 1VSJA 3AO1A 3O8MA 3TAPA 1KAYA 1TK0A 4CZJA 3QEXA 4FJ9A 3SUPA 3MEGA 3NF6A 5AQYA 3IG1A 3M5RA 1ESVA 3U3GA 5BRDA 1U47A 1BIZA 5AQOA 1RTHA 1C1BA 4BGBA 3NFAA 2ZJQL 1D9FA 3U9ZA 1SL1A 2D0AA 4NCAA 4DV2K 4JI1K 3LP3A 3MXJA 1KVBA 3OYDA 4Y0WA 4WF9L 3ZYYX 4CK2A 3PSIA 4DWIA 4LC9B 4FM2A 3SQ0A 4WYBA 3CIPA 4KBOA 4GV6A 2NRZA 3LAMA 5C2FA 3AGRA 3U8XA 3HO1A 4FOIA 3AVCA 1K8AO 1VHXA 1ZC6A 2D0OA 4KHYA 5AQVA 3CG7A 1NGGA 3GBTA 3KTQA 4AH9A 3OS0A 1O1WA 4DSFA 3KK3A 5J2PA 3TTDA 1W97L 1JJ2M 3H6EA 5AZIA 3ZLJA 4CHYA 5GIOA 2VQFK 3HK2A 4B9MA 4H5TA 4FJHA 4N76A 5BRHA 1K8KB 4KB0A 4CZMA 1BI4B 1HYVA 2FSKA 4FWKA 1BU6O 3QERA 2VG6A 3CFPA 4H0TB 4B08A 3AO4A 4DU3A 2HSTA 4BRHA 4IXCA 4DV4K 3RMDA 1BG3A 2P9KA 3AVBA 4BWJA 2GEMA 3NE6A 3LANA 1LAWA 1WUAA 3FZMA 3MWTA 1J53A 5I3UA 1TAUA 4FM0A 4BRQA 3VTIA 4KH6A 5A2QO 1U6ZA 1TKZA 1IO2A 4BC3A 4DQRA 4DF4A 2UUAK 4BR2A 5HLFA 5B8HA 3OYCA 2GBZA 5AQXA 4IFVA 1ASVA 2A42A 4ID1A 3BP8A 4CJWA 4CK1A 4EHUA 4E1JA 5AQSA 3KJVA 3SV3A 5GAEP 3M8QA 1C0TA 4DLEA 1J5OA 1VSHA 4B9LA 5CHIA 2O8DA 3D2EA 1Q82O 1IG9A 1VQ9N 4CZHA 2VCPA 4R79A 4JKFA 4BRNA 3AV9A 1RT6A 3L4QA 4IJNA 3CJ1A 2QK9A 2YJEA 1IG8A 4E7JA 1WBBA 4JN4A 4JLHA 3LP0A 3MEEA 4JHDB 3NH1A 2P9LB 3PY8A 3TAGA 2ZM6K 2KFNA 4X66K 1N33K 5F2RA 1S6QA 3CC4N 3C6AA 5AQFA 1GLFO 4FL9A 2D4WA 3THXB 3UKRB 1EWRA 3QBXA 2CGLA 5AQWA 1S22A 1UA1A 3I0SA 4DTSA 1KVAA 2ASPA 2I7NA 2V52B 3DLGA 1KFDA 1RTIA 2RN2A 5LMNK 1U48A 1NGEA 2JLEA 5GAGP 2DFFA 4JS5A 2D0CA 4BQLA 4J2EA 2Q2RA 1SL2A 3BEXA 1S9GA 4Z4EA 2A41A 3OYMA 3QO9A 3HRGA 1V4SA 2F7TA 3F9MA 1DTQA 3RRGA 3WXKA 3OBWA 2JWLA 1QSSA 2YHWA 3VF4A 4ELTA 4KPYA 3VQ8A 1DT9A 4CFDA 1RTDA 1NK0A 3VEZA 1XI1A 3NF7A 3O3HA 4YOWA 3K9KA 1NGAA 1NK4A 1WSGA 3TTFA 4K43A 4WFNL 1OKJA
chains in the Genus database with same CATH topology
4W5NA 1S5JA 1JL1A 1JLAA 2X6SA 3IRXA 1IKVA 3RTVA 4DSJA 5KTQA 4GMJB 1ZBIA 4CE9A 4BE2A 1S1WA 1RBRA 1VSIA 4M41A 1B9DA 4H4MA 2YNFA 3NDKA 4DS5A 3ZSYA 3MAQA 3V9UA 2RF2A 3OYGA 2KQ2A 1ASWA 4DQSA 3RR7A 2IAJA 1FK9A 3ITHA 1BI4A 1JL2A 3ZSWA 1IKYA 1QTMA 4KFBA 1JLGA 3OVNA 4Z4FA 5KI6A 3QEVA 2KTQA 2GV9A 2X6NA 3TAQA 3ZSVA 1EXQA 4FJ5A 3KKRA 5DK5A 4CIGA 4NCBA 1I3AA 4FJNA 2G8HA 1ZBHA 3QIPA 4CJRA 1CLQA 5CZ2A 1WSEA 3KK2A 1ZBLA 4M45A 1SUQA 4CHZA 2P5GA 1BQNA 4LSNA 4CFBA 3TAFA 4F2SA 2FBYA 4LH5A 4CGHA 4RW7A 3HPOA 3KKSA 2G8WA 3SQ2A 1NJYA 3RWUA 3VQAA 1LWFA 2BE2A 4ICLA 4AHSA 1LW2A 4CEFA 4JS4A 4N41A 4MFBA 5JS2A 1TAQA 3TWHA 1SKSA 1Q8IA 4FLXA 1NK7A 4FM1A 1S1UA 3C94A 3L2WA 1KTQA 2G8VA 1NOZA 4FJKA 3ZT4A 4ZTFA 4AHVA 3C6TA 3QINA 4DQPA 4OVLA 1RT5A 3HP9A 5J2QA 3EZ5A 3QNOA 4M3XA 5HP1A 3OYNA 2I5JA 2PYJA 2HHWA 1U45A 2PYLA 2WONA 3ZT0A 2VG5A 4NCGA 4OPKA 1JXBA 2YHAA 3S3MA 1WAFA 4CJQA 4IDKA 3VQ5A 3QIOA 1D9DA 4E0DA 2Z1JA 1LW0A 4OKKA 1VSMA 4E1MA 4CGFA 4DFKA 4C8NA 3WNHA 5J1EA 3G0ZA 4AHCA 4PQUA 4J2AA 2FBXA 4CJKA 1JLFA 3EYZA 3KLGA 2HNDA 2Q3SA 1J54A 1G15A 4DU4A 4BWMA 1CXQA 2B5JA 4Z4GA 1LWEA 2HHTA 4F3OA 4UQGA 2PZSA 3O4QA 4CGJA 1NKCA 1RBVA 3L2QA 4HUEA 3NGZA 2A1RA 3L3VA 1DLOA 1KLMA 5K14A 4AHUA 4IG0A 2P51A 3RRHA 4DF8A 1NK8A 2P5OA 1C1CA 3VQEA 3DLHA 3NF8A 3U6FA 3QESA 5JS1A 4CF1A 4AHRA 1R0AA 4OLBA 4CEOA 1HYSA 1EX4A 2YNHA 1B9FA 1QE1A 1J9AA 1WAJA 3HPGA 4CIEA 2ZD1A 5KRSA 3S3OA 4OKEA 4CEAA 1VSKA 1VSEA 4KREA 2FC0A 2YNIA 1X9WA 3AVIA 1B92A 1NKEA 3CFOA 3DRPA 1VSDA 1CZ9A 3HT3A 4B9NA 1RNHA 1JLCA 2QXFA 4I2PA 1ITGA 3OYAA 5HRSA 2IGIA 1Q9YA 1QS4A 4O4GA 4PY5A 3AA4A 3KLFA 2A1SA 3C6UA 4FZYA 4FVMA 5CYQA 2KFZA 4CHPA 2YV0X 4NYFA 5CY4A 3I8DA 3O3GA 4FJ8A 2Z1HA 3NF9A 1U04A 4J2BA 4KHSA 1BGXT 3KLEA 4DFPA 3BDPA 1HQUA 4HUGA 4CEQA 4HCBA 2Y1IA 3OYKA 4C8MA 3L2RA 3JYTA 1XHZA 2QKKA 3CQ8A 5FRMA 1N5YA 1WSHA 5FDLA 3T3FA 4N56A 4W5RA 3TI0A 2HNYA 1WLJA 3K5OA 4FW2A 2ZQBA 4CERA 3OYEA 2AJQA 3V9WA 3LAKA 4CCHA 1RBSA 2HHUA 3VQQA 1IKXA 4CGGA 4YNQA 1ZBUA 1L3VA 4I2QA 4F8RA 4KRFA 4CF2A 3AA5X 4DSLA 1XWLA 4XIUA 1KRPA 4IFYA 3HVTA 2E4LA 3ASMA 4ZHRA 1RTJA 3CM6A 3RMCA 2OZSA 4BDPA 4DTPA 1ASUA 3OS2A 3PX4A 2G8KA 4KAZA 4FK2A 3AA2A 1TK8A 4ELUA 3SNNA 1TGOA 1F21A 3V1QA 1WSJA 2JGUA 3AVKA 3C95A 5CYMA 4W5QA 3L2UA 1I39A 4FLTA 4E7IA 1LV5A 4DTUA 3V1RA 1ZBFA 2BGGA 3KIOA 3CM5A 3ZSOA 5C42A 2VWJA 2OYQA 4GVMA 1Y97A 3B6PA 3FFIA 2OPQA 4E19A 3MXMA 2HB5A 1TL3A 1LWCA 4RG8A 4E3SA 3HVRA 4DFJA 1NOYA 1D5AA 1LAVA 1RILA 3CYMA 3SPYA 3V6DA 1RT3A 4OJRA 4KHQA 3ZT2A 1FKOA 4FLUA 4EZ6A 3SZ2A 3F73A 4LSLA 2RKIA 4NYNA 3V4IA 1JLQA 4M3WA 3AO5A 4EP4A 1RT7A 3DLEA 1BCMA 3TAMA 5KGXA 4AILC 5D3GA 3QEIA 3SUOA 2O4GA 3LWMA 4O0JA 1CZBA 4CEDA 2HHQA 1XC9A 3AVAA 4TSXA 4Y1DA 1S1TA 4DFMA 4I9LA 1UAXA 3VQ7A 3L3UA 3DRSA 3SYZA 4KI4A 4CHQA 1RT4A 3AVGA 3M8SA 4IG3A 1WNSA 4HVJA 3OYFA 3NCIA 4B9SA 3WNGA 4CJ3A 3RMAA 1QHTA 2F96A 3VQ6A 5HRNA 1RT1A 1U4BA 1L3TA 4M3ZA 1SV5A 4CJLA 4FJ7A 2BDPA 4L8RB 3HM9A 2VG7A 3HJFA 3IS9A 5KRTA 1HYZA 3TABA 5EU7A 2G8UA 3SI6A 3A2FA 4KO0A 2F8TA 4OGEA 4CFAA 3ZSZA 4E7LA 1GOBA 2GUIA 4BACA 4Z4IA 4FCYA 3OJUA 4KKOA 1W0HA 2IC3A 3NGIA 2KZZA 5HROA 3DI6A 2F8SA 4CESA 3OYIA 4B9VA 4DMNA 1EP4A 1WSFA 3MECA 3OYJA 3NAEA 1UOCA 3P83D 3ZT3A 1T03A 3PV8A 4G1QA 3LPUA 4PA1A 4DG1A 1EETA 1CXUA 1BCOA 3ZSXA 5HRPA 3DM2A 2EX3A 1C0UA 3DOLA 2XRIA 3ZSQA 3LZJA 2XHBA 1VRTA 2OA8A 4CIFA 3T1AA 4FLYA 3NBPA 1HQEA 4I7FA 3UIQA 4YFUA 4CF8A 2O4IA 2DFEA 3I0RA 4B3OA 1YTUA 2XO7A 2ATQA 3B6OA 3TR8A 1T05A 3D45A 4KHWA 1S1VA 1BL3A 5C24A 3HP6A 3O4NA 5T7BA 3THVA 1DTTA 4DTRA 1JXEA 1TVRA 3HSTB 3ZSRA 4CJTA 2HMIA 4FJGA 2LSNA 4FYDA 2RPIA 3LP1A 4DSEA 4DTMA 5I42A 5FROA 1NK6A 3LZIA 3DLBA 3DLKA 2B4JA 4KTZA 4M3RA 4FW1A 4M3YA 4DTXA 3LDSA 1X9MA 4I9QA 3L2VA 3PUFA 4FJMA 3PO5A 1NK5A 4OLAA 1ZYQA 4CJ4A 4CJFA 3V9SA 3PO4A 1VSJA 1VSFA 3AO1A 1T8EA 1YTAA 2D5RA 3TAPA 1RT2A 4IBNA 4CFCA 4Q5VA 4HUFA 1TK0A 3QEXA 3VQBA 4FJ9A 4W5TA 1VSLA 2D0BA 3SUPA 3MEGA 3V9ZA 3U3YA 3SCXA 1L3UA 3NF6A 3AVMA 3IG1A 1T7PA 1K6YA 4CHNA 2ETJA 3M8PA 3U3GA 1U47A 1BIZA 2Y1JA 4Z4HA 1RTHA 1C1BA 5CZ1A 4EP5A 2YKNA 3NFAA 1TKDA 1D9FA 1SL1A 4M42A 2D0AA 4NCAA 2DY4A 4FJXA 2Z1IA 3LP3A 3MXJA 1KVBA 3OYDA 1HPZA 3AVJA 4KTWA 2B6AA 4CK2A 3OYHA 3WNEA 4JRQA 4QCLA 4DWIA 4FM2A 3SQ0A 4CJPA 5J2NA 2YNGA 3LAMA 3OYBA 4DTJA 3HO1A 1NK9A 4ID5A 2QKBA 2ITGA 3AVCA 1NJXA 4FJIA 5C25A 2HW3A 4Q0BA 4DTOA 4M3UA 3QLHA 4KHYA 1VRUA 2EHGA 3CG7A 2ZE2A 4DLGA 3KTQA 2DFHA 4AH9A 4K8XA 3OS0A 1O1WA 4CJ5A 4DSFA 4CECA 3KK3A 5J2PA 4F3TA 4CEBA 1REVA 5SZTA 1S1XA 3M8RA 4EZ9A 3ISNC 4CHYA 4RW6A 4O5BA 3HK2A 4B9MA 3VA3A 4FJHA 3AO2A 4F2RA 2PY5A 4N76A 3NHGA 4IKFA 3HXMA 4KB0A 1BI4B 1HYVA 4BDYA 4OGCA 3D0PA 3QERA 5J2MA 2NUBA 2VG6A 1HNVA 3HYFA 4B08A 3CFPA 3AO4A 1RDBA 4BDZA 4BE1A 1Z25A 2DTUA 1KVCA 1MU2A 3MXIA 4ELVA 3EY1A 3V81A 1A5WA 2KW4A 3MEDA 4DU3A 1X1PA 4B9TA 4KB1A 3H08A 3OYLA 4MQ3A 1C1AA 1RDDA 3DRRA 1X9SA 1NKBA 5HBMA 3RMDA 3AVBA 1UWBA 2HVHA 4RW9A 3K5MA 4CK3A 4BWJA 2YKMA 3SV4A 1SKWA 2WOMA 3NE6A 3LANA 1LAWA 1GOAA 1HNIA 3QEWA 1RDCA 2OPRA 2XY5A 3P5JA 4OPJA 4FLWA 5I3UA 1J53A 4O44A 3AVFA 4R5PA 3TANA 1TAUA 4FM0A 1KCFA 3HPHA 1JKHA 4F4KA 3TARA 1TKTA 3SQ1A 3PX6A 1BISA 5DMRA 3KLHA 4FJLA 1IKWA 1HJRA 4QOZB 1Q9XA 1YT3A 2FBTA 2HNZA 4KTQA 4C8OA 3K5NA 1TKZA 2VWKA 4O55A 1IO2A 3ZCMA 4DQRA 1RBUA 4DF4A 2HHVA 1A5VA 4FLZA 4FZZA 5HLFA 3RMBA 1NJWA 2OPSA 4CHOA 4DSKA 1YVUA 3E01A 3OYCA 3NGYA 1N6QA 2GBZA 4KI6A 4M3TA 3QNNA 4IFVA 1S6PA 2Z1GA 1RCHA 1ASVA 4ID1A 1A5XA 4CF0A 4CJWA 4CK1A 3KD1E 1KLNA 4PUOA 4FJJA 1TK5A 2OZMA 3KK1A 3KJVA 3SV3A 4DQIA 1FXXA 4E89A 1XHXA 3NH2A 4DS4A 3L8BA 3AVLA 2FBVA 4DQQA 1QSLA 2X74A 3S3NA 4FK0A 3OJSA 4K8ZA 3M8QA 1NJZA 2G8FA 1VK0A 5FRNA 1C0TA 3DOKA 4B8CA 4DLEA 3CFRA 4FXDA 3LP2A 1J5OA 1VSHA 4E1NA 1RDAA 4B9LA 1FKPA 3VQPA 2P1JA 4BE0A 1IG9A 3OS1A 4N47A 4KHNA 3LWLA 4B9UA 4CGDA 2W42A 1KSPA 3AV9A 3T19A 1RT6A 2X78A 3IAYA 1WN7A 2QK9A 4CJVA 4DSIA 1BHLA 1D8YA 3V9XA 3TAEA 4E7JA 4CJSA 4OKJA 4JLHA 5SWMA 3LP0A 3MEEA 1W9HA 4DTNA 3O3FA 3NH1A 3P1GA 2R7YA 3BGRA 4PWDA 2YHBA 4FLVA 4KV8A 3PY8A 4J2DA 3VQCA 3AO3A 4E7KA 3TAGA 2KFNA 3S9HA 2HVIA 4CJEA 2KZMA 2BANA 1S6QA 4RW4A 3VQ4A 4DU1A 4CEEA 1QQCA 4Z0UA 1KFSA 4HCCA 5E41A 4HTUA 2HHXA 4B8AB 1QSYA 4N5SA 3DMJA 4C8KA 3AVHA 1IH7A 4KHUA 1TKXA 3QETA 2IS3A 1SKRA 3VN5A 4C8LA 1WSIA 3KD5E 1UA1A 3I0SA 4CF9A 3HL8A 3VA0A 3K59A 4DTSA 1SL0A 3SUQA 3AA3A 1KVAA 3G10A 3LALA 3K5LA 3DLGA 4HHTA 2OPPA 1L5UA 3VQ9A 1KFDA 1RTIA 2RN2A 1Z26A 3AVNA 4FK4A 1JLEA 1U48A 4LD0A 2XY8A 2JLEA 2XY7A 1L3SA 2DFFA 3DYAA 4CJUA 4CEZA 4JS5A 2D0CA 4QAGA 3SQ4A 1JLBA 4LY7A 4J2EA 3F9KA 1SL2A 2E6MA 1S9GA 4Z4EA 3DLRA 2IDOA 4LH4A 3OYMA 3ZT1A 3QO9A 4Y1CA 1GOCA 4RW8A 4WE1A 4O0IA 4H8KA 1C0MA 1S9EA 3JSMA 2XY6A 4FZXC 3LPTA 1TL1A 2HHSA 4CGIA 4Z4CA 3OY9A 1DTQA 3ULDA 4GW6A 3RRGA 3K57A 1U49A 4ZTJA 1QSSA 4AHTA 1EKEA 3SUNA 3VQDA 3QEPA 4ELTA 3PX0A 3NH0A 1TV6A 3SPZA 4KPYA 3K58A 3VQ8A 4W5OA 1HRHA 4CFDA 1RTDA 2E6LA 4E7HA 1NK0A 1RBTA 1XI1A 3K2PA 3NF7A 5KGWA 1HMVA 2IOCA 3O3HA 4H4OA 1BIUA 2G8IA 3SJJA 1NK4A 1WSGA 3RR8A 3KLIA 3WNFA 3V1OA 4JRPA 1C6VA 3ALYA 5HRRA 1BQMA 1UA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W5N A;  1S5J A;  1JL1 A;  1JLA A;  2X6S A;  3IRX A;  1IKV A;  3RTV A;  4DSJ A;  5KTQ A;  4GMJ B;  1ZBI A;  4CE9 A;  4BE2 A;  1S1W A;  1RBR A;  1VSI A;  4M41 A;  1B9D A;  4H4M A;  2YNF A;  3NDK A;  4DS5 A;  3ZSY A;  3MAQ A;  3V9U A;  2RF2 A;  3OYG A;  2KQ2 A;  1ASW A;  4DQS A;  3RR7 A;  2IAJ A;  1FK9 A;  3ITH A;  1BI4 A;  1JL2 A;  3ZSW A;  1IKY A;  1QTM A;  4KFB A;  1JLG A;  3OVN A;  4Z4F A;  5KI6 A;  3QEV A;  2KTQ A;  2GV9 A;  2X6N A;  3TAQ A;  3ZSV A;  1EXQ A;  4FJ5 A;  3KKR A;  5DK5 A;  4CIG A;  4NCB A;  1I3A A;  4FJN A;  2G8H A;  1ZBH A;  3QIP A;  4CJR A;  1CLQ A;  5CZ2 A;  1WSE A;  3KK2 A;  1ZBL A;  4M45 A;  1SUQ A;  4CHZ A;  2P5G A;  1BQN A;  4LSN A;  4CFB A;  3TAF A;  4F2S A;  2FBY A;  4LH5 A;  4CGH A;  4RW7 A;  3HPO A;  3KKS A;  2G8W A;  3SQ2 A;  1NJY A;  3RWU A;  3VQA A;  1LWF A;  2BE2 A;  4ICL A;  4AHS A;  1LW2 A;  4CEF A;  4JS4 A;  4N41 A;  4MFB A;  5JS2 A;  1TAQ A;  3TWH A;  1SKS A;  1Q8I A;  4FLX A;  1NK7 A;  4FM1 A;  1S1U A;  3C94 A;  3L2W A;  1KTQ A;  2G8V A;  1NOZ A;  4FJK A;  3ZT4 A;  4ZTF A;  4AHV A;  3C6T A;  3QIN A;  4DQP A;  4OVL A;  1RT5 A;  3HP9 A;  5J2Q A;  3EZ5 A;  3QNO A;  4M3X A;  5HP1 A;  3OYN A;  2I5J A;  2PYJ A;  2HHW A;  1U45 A;  2PYL A;  2WON A;  3ZT0 A;  2VG5 A;  4NCG A;  4OPK A;  1JXB A;  2YHA A;  3S3M A;  1WAF A;  4CJQ A;  4IDK A;  3VQ5 A;  3QIO A;  1D9D A;  4E0D A;  2Z1J A;  1LW0 A;  4OKK A;  1VSM A;  4E1M A;  4CGF A;  4DFK A;  4C8N A;  3WNH A;  5J1E A;  3G0Z A;  4AHC A;  4PQU A;  4J2A A;  2FBX A;  4CJK A;  1JLF A;  3EYZ A;  3KLG A;  2HND A;  2Q3S A;  1J54 A;  1G15 A;  4DU4 A;  4BWM A;  1CXQ A;  2B5J A;  4Z4G A;  1LWE A;  2HHT A;  4F3O A;  4UQG A;  2PZS A;  3O4Q A;  4CGJ A;  1NKC A;  1RBV A;  3L2Q A;  4HUE A;  3NGZ A;  2A1R A;  3L3V A;  1DLO A;  1KLM A;  5K14 A;  4AHU A;  4IG0 A;  2P51 A;  3RRH A;  4DF8 A;  1NK8 A;  2P5O A;  1C1C A;  3VQE A;  3DLH A;  3NF8 A;  3U6F A;  3QES A;  5JS1 A;  4CF1 A;  4AHR A;  1R0A A;  4OLB A;  4CEO A;  1HYS A;  1EX4 A;  2YNH A;  1B9F A;  1QE1 A;  1J9A A;  1WAJ A;  3HPG A;  4CIE A;  2ZD1 A;  5KRS A;  3S3O A;  4OKE A;  4CEA A;  1VSK A;  1VSE A;  4KRE A;  2FC0 A;  2YNI A;  1X9W A;  3AVI A;  1B92 A;  1NKE A;  3CFO A;  3DRP A;  1VSD A;  1CZ9 A;  3HT3 A;  4B9N A;  1RNH A;  1JLC A;  2QXF A;  4I2P A;  1ITG A;  3OYA A;  5HRS A;  2IGI A;  1Q9Y A;  1QS4 A;  4O4G A;  4PY5 A;  3AA4 A;  3KLF A;  2A1S A;  3C6U A;  4FZY A;  4FVM A;  5CYQ A;  2KFZ A;  4CHP A;  2YV0 X;  4NYF A;  5CY4 A;  3I8D A;  3O3G A;  4FJ8 A;  2Z1H A;  3NF9 A;  1U04 A;  4J2B A;  4KHS A;  1BGX T;  3KLE A;  4DFP A;  3BDP A;  1HQU A;  4HUG A;  4CEQ A;  4HCB A;  2Y1I A;  3OYK A;  4C8M A;  3L2R A;  3JYT A;  1XHZ A;  2QKK A;  3CQ8 A;  5FRM A;  1N5Y A;  1WSH A;  5FDL A;  3T3F A;  4N56 A;  4W5R A;  3TI0 A;  2HNY A;  1WLJ A;  3K5O A;  4FW2 A;  2ZQB A;  4CER A;  3OYE A;  2AJQ A;  3V9W A;  3LAK A;  4CCH A;  1RBS A;  2HHU A;  3VQQ A;  1IKX A;  4CGG A;  4YNQ A;  1ZBU A;  1L3V A;  4I2Q A;  4F8R A;  4KRF A;  4CF2 A;  3AA5 X;  4DSL A;  1XWL A;  4XIU A;  1KRP A;  4IFY A;  3HVT A;  2E4L A;  3ASM A;  4ZHR A;  1RTJ A;  3CM6 A;  3RMC A;  2OZS A;  4BDP A;  4DTP A;  1ASU A;  3OS2 A;  3PX4 A;  2G8K A;  4KAZ A;  4FK2 A;  3AA2 A;  1TK8 A;  4ELU A;  3SNN A;  1TGO A;  1F21 A;  3V1Q A;  1WSJ A;  2JGU A;  3AVK A;  3C95 A;  5CYM A;  4W5Q A;  3L2U A;  1I39 A;  4FLT A;  4E7I A;  1LV5 A;  4DTU A;  3V1R A;  1ZBF A;  2BGG A;  3KIO A;  3CM5 A;  3ZSO A;  5C42 A;  2VWJ A;  2OYQ A;  4GVM A;  1Y97 A;  3B6P A;  3FFI A;  2OPQ A;  4E19 A;  3MXM A;  2HB5 A;  1TL3 A;  1LWC A;  4RG8 A;  4E3S A;  3HVR A;  4DFJ A;  1NOY A;  1D5A A;  1LAV A;  1RIL A;  3CYM A;  3SPY A;  3V6D A;  1RT3 A;  4OJR A;  4KHQ A;  3ZT2 A;  1FKO A;  4FLU A;  4EZ6 A;  3SZ2 A;  3F73 A;  4LSL A;  2RKI A;  4NYN A;  3V4I A;  1JLQ A;  4M3W A;  3AO5 A;  4EP4 A;  1RT7 A;  3DLE A;  1BCM A;  3TAM A;  5KGX A;  4AIL C;  5D3G A;  3QEI A;  3SUO A;  2O4G A;  3LWM A;  4O0J A;  1CZB A;  4CED A;  2HHQ A;  1XC9 A;  3AVA A;  4TSX A;  4Y1D A;  1S1T A;  4DFM A;  4I9L A;  1UAX A;  3VQ7 A;  3L3U A;  3DRS A;  3SYZ A;  4KI4 A;  4CHQ A;  1RT4 A;  3AVG A;  3M8S A;  4IG3 A;  1WNS A;  4HVJ A;  3OYF A;  3NCI A;  4B9S A;  3WNG A;  4CJ3 A;  3RMA A;  1QHT A;  2F96 A;  3VQ6 A;  5HRN A;  1RT1 A;  1U4B A;  1L3T A;  4M3Z A;  1SV5 A;  4CJL A;  4FJ7 A;  2BDP A;  4L8R B;  3HM9 A;  2VG7 A;  3HJF A;  3IS9 A;  5KRT A;  1HYZ A;  3TAB A;  5EU7 A;  2G8U A;  3SI6 A;  3A2F A;  4KO0 A;  2F8T A;  4OGE A;  4CFA A;  3ZSZ A;  4E7L A;  1GOB A;  2GUI A;  4BAC A;  4Z4I A;  4FCY A;  3OJU A;  4KKO A;  1W0H A;  2IC3 A;  3NGI A;  2KZZ A;  5HRO A;  3DI6 A;  2F8S A;  4CES A;  3OYI A;  4B9V A;  4DMN A;  1EP4 A;  1WSF A;  3MEC A;  3OYJ A;  3NAE A;  1UOC A;  3P83 D;  3ZT3 A;  1T03 A;  3PV8 A;  4G1Q A;  3LPU A;  4PA1 A;  4DG1 A;  1EET A;  1CXU A;  1BCO A;  3ZSX A;  5HRP A;  3DM2 A;  2EX3 A;  1C0U A;  3DOL A;  2XRI A;  3ZSQ A;  3LZJ A;  2XHB A;  1VRT A;  2OA8 A;  4CIF A;  3T1A A;  4FLY A;  3NBP A;  1HQE A;  4I7F A;  3UIQ A;  4YFU A;  4CF8 A;  2O4I A;  2DFE A;  3I0R A;  4B3O A;  1YTU A;  2XO7 A;  2ATQ A;  3B6O A;  3TR8 A;  1T05 A;  3D45 A;  4KHW A;  1S1V A;  1BL3 A;  5C24 A;  3HP6 A;  3O4N A;  5T7B A;  3THV A;  1DTT A;  4DTR A;  1JXE A;  1TVR A;  3HST B;  3ZSR A;  4CJT A;  2HMI A;  4FJG A;  2LSN A;  4FYD A;  2RPI A;  3LP1 A;  4DSE A;  4DTM A;  5I42 A;  5FRO A;  1NK6 A;  3LZI A;  3DLB A;  3DLK A;  2B4J A;  4KTZ A;  4M3R A;  4FW1 A;  4M3Y A;  4DTX A;  3LDS A;  1X9M A;  4I9Q A;  3L2V A;  3PUF A;  4FJM A;  3PO5 A;  1NK5 A;  4OLA A;  1ZYQ A;  4CJ4 A;  4CJF A;  3V9S A;  3PO4 A;  1VSJ A;  1VSF A;  3AO1 A;  1T8E A;  1YTA A;  2D5R A;  3TAP A;  1RT2 A;  4IBN A;  4CFC A;  4Q5V A;  4HUF A;  1TK0 A;  3QEX A;  3VQB A;  4FJ9 A;  4W5T A;  1VSL A;  2D0B A;  3SUP A;  3MEG A;  3V9Z A;  3U3Y A;  3SCX A;  1L3U A;  3NF6 A;  3AVM A;  3IG1 A;  1T7P A;  1K6Y A;  4CHN A;  2ETJ A;  3M8P A;  3U3G A;  1U47 A;  1BIZ A;  2Y1J A;  4Z4H A;  1RTH A;  1C1B A;  5CZ1 A;  4EP5 A;  2YKN A;  3NFA A;  1TKD A;  1D9F A;  1SL1 A;  4M42 A;  2D0A A;  4NCA A;  2DY4 A;  4FJX A;  2Z1I A;  3LP3 A;  3MXJ A;  1KVB A;  3OYD A;  1HPZ A;  3AVJ A;  4KTW A;  2B6A A;  4CK2 A;  3OYH A;  3WNE A;  4JRQ A;  4QCL A;  4DWI A;  4FM2 A;  3SQ0 A;  4CJP A;  5J2N A;  2YNG A;  3LAM A;  3OYB A;  4DTJ A;  3HO1 A;  1NK9 A;  4ID5 A;  2QKB A;  2ITG A;  3AVC A;  1NJX A;  4FJI A;  5C25 A;  2HW3 A;  4Q0B A;  4DTO A;  4M3U A;  3QLH A;  4KHY A;  1VRU A;  2EHG A;  3CG7 A;  2ZE2 A;  4DLG A;  3KTQ A;  2DFH A;  4AH9 A;  4K8X A;  3OS0 A;  1O1W A;  4CJ5 A;  4DSF A;  4CEC A;  3KK3 A;  5J2P A;  4F3T A;  4CEB A;  1REV A;  5SZT A;  1S1X A;  3M8R A;  4EZ9 A;  3ISN C;  4CHY A;  4RW6 A;  4O5B A;  3HK2 A;  4B9M A;  3VA3 A;  4FJH A;  3AO2 A;  4F2R A;  2PY5 A;  4N76 A;  3NHG A;  4IKF A;  3HXM A;  4KB0 A;  1BI4 B;  1HYV A;  4BDY A;  4OGC A;  3D0P A;  3QER A;  5J2M A;  2NUB A;  2VG6 A;  1HNV A;  3HYF A;  4B08 A;  3CFP A;  3AO4 A;  1RDB A;  4BDZ A;  4BE1 A;  1Z25 A;  2DTU A;  1KVC A;  1MU2 A;  3MXI A;  4ELV A;  3EY1 A;  3V81 A;  1A5W A;  2KW4 A;  3MED A;  4DU3 A;  1X1P A;  4B9T A;  4KB1 A;  3H08 A;  3OYL A;  4MQ3 A;  1C1A A;  1RDD A;  3DRR A;  1X9S A;  1NKB A;  5HBM A;  3RMD A;  3AVB A;  1UWB A;  2HVH A;  4RW9 A;  3K5M A;  4CK3 A;  4BWJ A;  2YKM A;  3SV4 A;  1SKW A;  2WOM A;  3NE6 A;  3LAN A;  1LAW A;  1GOA A;  1HNI A;  3QEW A;  1RDC A;  2OPR A;  2XY5 A;  3P5J A;  4OPJ A;  4FLW A;  5I3U A;  1J53 A;  4O44 A;  3AVF A;  4R5P A;  3TAN A;  1TAU A;  4FM0 A;  1KCF A;  3HPH A;  1JKH A;  4F4K A;  3TAR A;  1TKT A;  3SQ1 A;  3PX6 A;  1BIS A;  5DMR A;  3KLH A;  4FJL A;  1IKW A;  1HJR A;  4QOZ B;  1Q9X A;  1YT3 A;  2FBT A;  2HNZ A;  4KTQ A;  4C8O A;  3K5N A;  1TKZ A;  2VWK A;  4O55 A;  1IO2 A;  3ZCM A;  4DQR A;  1RBU A;  4DF4 A;  2HHV A;  1A5V A;  4FLZ A;  4FZZ A;  5HLF A;  3RMB A;  1NJW A;  2OPS A;  4CHO A;  4DSK A;  1YVU A;  3E01 A;  3OYC A;  3NGY A;  1N6Q A;  2GBZ A;  4KI6 A;  4M3T A;  3QNN A;  4IFV A;  1S6P A;  2Z1G A;  1RCH A;  1ASV A;  4ID1 A;  1A5X A;  4CF0 A;  4CJW A;  4CK1 A;  3KD1 E;  1KLN A;  4PUO A;  4FJJ A;  1TK5 A;  2OZM A;  3KK1 A;  3KJV A;  3SV3 A;  4DQI A;  1FXX A;  4E89 A;  1XHX A;  3NH2 A;  4DS4 A;  3L8B A;  3AVL A;  2FBV A;  4DQQ A;  1QSL A;  2X74 A;  3S3N A;  4FK0 A;  3OJS A;  4K8Z A;  3M8Q A;  1NJZ A;  2G8F A;  1VK0 A;  5FRN A;  1C0T A;  3DOK A;  4B8C A;  4DLE A;  3CFR A;  4FXD A;  3LP2 A;  1J5O A;  1VSH A;  4E1N A;  1RDA A;  4B9L A;  1FKP A;  3VQP A;  2P1J A;  4BE0 A;  1IG9 A;  3OS1 A;  4N47 A;  4KHN A;  3LWL A;  4B9U A;  4CGD A;  2W42 A;  1KSP A;  3AV9 A;  3T19 A;  1RT6 A;  2X78 A;  3IAY A;  1WN7 A;  2QK9 A;  4CJV A;  4DSI A;  1BHL A;  1D8Y A;  3V9X A;  3TAE A;  4E7J A;  4CJS A;  4OKJ A;  4JLH A;  5SWM A;  3LP0 A;  3MEE A;  1W9H A;  4DTN A;  3O3F A;  3NH1 A;  3P1G A;  2R7Y A;  3BGR A;  4PWD A;  2YHB A;  4FLV A;  4KV8 A;  3PY8 A;  4J2D A;  3VQC A;  3AO3 A;  4E7K A;  3TAG A;  2KFN A;  3S9H A;  2HVI A;  4CJE A;  2KZM A;  2BAN A;  1S6Q A;  4RW4 A;  3VQ4 A;  4DU1 A;  4CEE A;  1QQC A;  4Z0U A;  1KFS A;  4HCC A;  5E41 A;  4HTU A;  2HHX A;  4B8A B;  1QSY A;  4N5S A;  3DMJ A;  4C8K A;  3AVH A;  1IH7 A;  4KHU A;  1TKX A;  3QET A;  2IS3 A;  1SKR A;  3VN5 A;  4C8L A;  1WSI A;  3KD5 E;  1UA1 A;  3I0S A;  4CF9 A;  3HL8 A;  3VA0 A;  3K59 A;  4DTS A;  1SL0 A;  3SUQ A;  3AA3 A;  1KVA A;  3G10 A;  3LAL A;  3K5L A;  3DLG A;  4HHT A;  2OPP A;  1L5U A;  3VQ9 A;  1KFD A;  1RTI A;  2RN2 A;  1Z26 A;  3AVN A;  4FK4 A;  1JLE A;  1U48 A;  4LD0 A;  2XY8 A;  2JLE A;  2XY7 A;  1L3S A;  2DFF A;  3DYA A;  4CJU A;  4CEZ A;  4JS5 A;  2D0C A;  4QAG A;  3SQ4 A;  1JLB A;  4LY7 A;  4J2E A;  3F9K A;  1SL2 A;  2E6M A;  1S9G A;  4Z4E A;  3DLR A;  2IDO A;  4LH4 A;  3OYM A;  3ZT1 A;  3QO9 A;  4Y1C A;  1GOC A;  4RW8 A;  4WE1 A;  4O0I A;  4H8K A;  1C0M A;  1S9E A;  3JSM A;  2XY6 A;  4FZX C;  3LPT A;  1TL1 A;  2HHS A;  4CGI A;  4Z4C A;  3OY9 A;  1DTQ A;  3ULD A;  4GW6 A;  3RRG A;  3K57 A;  1U49 A;  4ZTJ A;  1QSS A;  4AHT A;  1EKE A;  3SUN A;  3VQD A;  3QEP A;  4ELT A;  3PX0 A;  3NH0 A;  1TV6 A;  3SPZ A;  4KPY A;  3K58 A;  3VQ8 A;  4W5O A;  1HRH A;  4CFD A;  1RTD A;  2E6L A;  4E7H A;  1NK0 A;  1RBT A;  1XI1 A;  3K2P A;  3NF7 A;  5KGW A;  1HMV A;  2IOC A;  3O3H A;  4H4O A;  1BIU A;  2G8I A;  3SJJ A;  1NK4 A;  1WSG A;  3RR8 A;  3KLI A;  3WNF A;  3V1O A;  4JRP A;  1C6V A;  3ALY A;  5HRR A;  1BQM A;  1UA0 A; 
#chains in the Genus database with same CATH topology
 4GMJ B;  1S1W A;  3RVC A;  1IBK K;  1B9D A;  1NMN A;  3NDK A;  4DR3 K;  4FPA A;  1T44 A;  1K8K A;  3V9U A;  3RR7 A;  2KQ2 A;  3VES A;  4DQS A;  3LM9 A;  5AR0 A;  1BI4 A;  3WQU A;  1JL2 A;  4KFB A;  1JLG A;  3UE5 A;  3R1X A;  3TAQ A;  1HUX A;  3ZSV A;  1NJI O;  5DM6 L;  2GWJ A;  3ZET B;  3H3N O;  4YDU C;  1ATR A;  1I3A A;  4FJN A;  3QIP A;  2KLA A;  4FWN A;  1ZBL A;  4IFE A;  2P5G A;  1BQN A;  3TAF A;  3U9D A;  2NRH A;  1ATS A;  3RWU A;  4LFA K;  3G71 N;  4AF1 A;  1HKB A;  4JS4 A;  1KD1 O;  4MFB A;  3DWL A;  3J8A A;  5JS2 A;  1Q8I A;  1NK7 A;  5JLF A;  1S1U A;  2QWN A;  4FJK A;  3OHR A;  1ZXO A;  4ZTF A;  4AHV A;  3MMV A;  3CJB A;  5J2Q A;  1OH7 A;  4IOX A;  5E26 A;  2HBM A;  4JD2 B;  2PYJ A;  2VQE K;  2PYL A;  3ZT0 A;  2VG5 A;  1JXB A;  4CJQ A;  3VQ5 A;  3QIO A;  4E0D A;  2Z1J A;  3A5L C;  4ISE A;  5J1E A;  2QTD A;  2YI1 A;  3EYZ A;  2HND A;  1BDG A;  3C7N B;  2Q31 A;  4CGJ A;  3L2Q A;  4HUE A;  1C0F A;  5AQR A;  4AHU A;  4IG0 A;  4B3T K;  1C1C A;  3QES A;  5JS1 A;  2HF4 A;  4OLB A;  1QE1 A;  4IWV A;  5KRS A;  5GAH P;  1D4X A;  3D2F B;  1GLE G;  3ZX3 A;  4JHD A;  2HBL A;  3DRP A;  3ULE B;  2P9L A;  1JLC A;  3SBG A;  2CGJ A;  4PY5 A;  4FVM A;  4FOE A;  1FJG K;  4CHP A;  1WOQ A;  2YV0 X;  5CY4 A;  5HOO A;  3I8D A;  3O3G A;  2RE2 A;  2Z1H A;  1U04 A;  3BDP A;  3TTC A;  2F9T A;  3CME N;  4V19 S;  3MN5 A;  5FDL A;  3THX A;  3QML A;  3UKR A;  1C0G A;  4N56 A;  1HKC A;  1WLJ A;  3P39 A;  3T69 A;  4CER A;  2AP1 A;  3LAK A;  1TUU A;  4B3M K;  1ZBU A;  4CF2 A;  1NGF A;  1XWL A;  2E4L A;  1VQ4 N;  5AQP A;  1XC3 A;  1ASU A;  4A5B A;  1TK8 A;  1F21 A;  1HNZ K;  3V1Q A;  1WSJ A;  2JGU A;  3C95 A;  3D7E O;  2NZT A;  4B9Q A;  1YJ9 N;  3ZSO A;  1Y97 A;  3MXM A;  5BN9 A;  3V6D A;  3ZT2 A;  5KQD A;  1FKO A;  2BH1 A;  3F73 A;  4LSL A;  3SZ2 A;  5KQ8 A;  4M3W A;  3DLE A;  3VEX A;  1BCM A;  2V51 B;  5D3G A;  1CZB A;  3QIC A;  4BR5 A;  4TSX A;  3CJ7 A;  4DFM A;  3THW B;  1UAX A;  1VAZ A;  3N4P A;  3CPE A;  1YF5 L;  3AVG A;  4IG3 A;  1G99 A;  3GDQ A;  3OYF A;  1GLB G;  2F96 A;  3VQ6 A;  2PBD A;  3L0Q A;  1SV5 A;  3DLL L;  4LF9 K;  4CJL A;  4FJ7 A;  3MK6 A;  4YY3 K;  4BVP A;  1NM1 A;  5KRT A;  3SI6 A;  4KO0 A;  4NB4 A;  2F8T A;  4CFA A;  2GUI A;  4Z4I A;  2GWK A;  4B1U B;  1HR0 K;  1QVF M;  3DI6 A;  2F8S A;  3ZET A;  1EP4 A;  3NAE A;  3P83 D;  3ZT3 A;  4DG1 A;  1EET A;  1CXU A;  1BCO A;  5HRP A;  3DM2 A;  2EX3 A;  3J7Y P;  3LZJ A;  2O8F B;  4EFH A;  4B1V A;  4CF8 A;  3I0R A;  5H1S Q;  3K0S A;  1YTU A;  4BRD A;  5M1N A;  1U2V B;  5C24 A;  4JAX A;  3EL2 A;  5T7B A;  3THV A;  4DTR A;  4FJG A;  2LSN A;  4X65 K;  2UYT A;  1NK6 A;  4JD2 A;  3LZI A;  3DLB A;  2QM1 A;  4FJM A;  2V7Y A;  4LF7 K;  1ZYQ A;  3V9S A;  1VSF A;  3LDN A;  1YTA A;  2D5R A;  3O9Q A;  1RT2 A;  4IBN A;  4Q5V A;  5AQL A;  2ZJR L;  3C7N A;  2D0B A;  4DV0 K;  3V9Z A;  1L3U A;  3CCL N;  3KZB A;  4M7Y A;  1T7P A;  2ETJ A;  2Y1J A;  4Z4H A;  5CZ1 A;  5AZJ B;  1TKD A;  1SQK A;  4K0K K;  3SAH A;  3R3L A;  3D2F A;  2Q1N A;  3OYH A;  3WNE A;  4JRQ A;  4QCL A;  3IDH A;  2YX6 A;  3H1Q A;  4BRL A;  4CJP A;  3ULE A;  2NRT A;  3OYB A;  2QKB A;  2ITG A;  4FJI A;  3SLC A;  4GVE A;  4B1Y B;  5BR9 A;  4M3U A;  5AQN A;  4CZK A;  3CET A;  5EXW A;  4CJ5 A;  4CEC A;  3M8R A;  4I6M B;  4RW6 A;  4K41 A;  4KHP K;  1S3X A;  4IKF A;  1FW6 A;  3BZC A;  5AQH A;  1HNV A;  4WFA L;  3MDQ A;  1RDB A;  2DTU A;  4WQ4 C;  3EY1 A;  4WQ5 C;  3WXJ A;  3MED A;  1NGB A;  3B8A X;  4KB1 A;  3DRR A;  1X9S A;  1UWB A;  3K5M A;  3I55 N;  2WOM A;  1GOA A;  4LF5 K;  1RDC A;  2OPR A;  4DQ8 A;  1O13 A;  3LDQ A;  3FR0 A;  4FLW A;  2P9U B;  4O44 A;  4R5P A;  1JKH A;  4F4K A;  1TKT A;  1XMQ K;  1SS6 A;  5DMR A;  3AAP A;  2ITM A;  3ENB A;  1YT3 A;  1H1V A;  2HNZ A;  3THW A;  4K42 A;  2VWK A;  1RBU A;  3GG4 A;  4FLZ A;  4FZZ A;  1YXQ A;  4DSK A;  4M3T A;  3E01 A;  1OH5 A;  3QNN A;  5M1F A;  2ASM A;  1KLN A;  1QZ5 A;  2OZM A;  1FXX A;  1XMO K;  4E89 A;  4DS4 A;  4EIA A;  4FK0 A;  3S3N A;  1J6Z A;  3OJS A;  3BF1 A;  3C0B A;  5HL7 L;  3CFR A;  5C15 A;  4FXD A;  1RDA A;  2HHH K;  3FZH A;  3VQP A;  2P1J A;  4N47 A;  1N8R O;  4B9U A;  4FWP A;  2X78 A;  4CJV A;  1BHL A;  1D8Y A;  3V9X A;  3TSQ A;  5EOY A;  4UY8 O;  1W9H A;  3O3F A;  3W3D A;  3BGR A;  4HTL A;  1T3V A;  4KV8 A;  1U2V A;  4J2D A;  3VQC A;  3O1B A;  4BQZ A;  3FFK B;  4CJE A;  1GLL O;  4BR4 A;  1NGD A;  1QQC A;  4LFB K;  4Z0U A;  1KFS A;  2HHX A;  1QSY A;  4C8K A;  1TKX A;  2FLO A;  3QET A;  3VN5 A;  1WSI A;  3CJ9 A;  2QWP A;  3HL8 A;  4BR0 A;  5EX5 A;  3G10 A;  1NGC A;  3K5L A;  3EEQ A;  1Z26 A;  1L3S A;  3DYA A;  1TYQ B;  2E8A A;  4QAG A;  4PKI A;  3F9K A;  2E6M A;  3MX2 A;  3DLR A;  4LH4 A;  4Y1C A;  1GOC A;  5AZJ A;  4RW8 A;  1BWF O;  3A5O C;  4C1N K;  2XY6 A;  1Q7Y O;  1X9J A;  3E9L A;  3T1H K;  4Z4C A;  4JKC A;  4CZI A;  3OY9 A;  4KH4 A;  4AHT A;  1EKE A;  5CR4 A;  1NLV A;  2YHX A;  2UUC K;  1TV6 A;  2A3Z A;  3K58 A;  4W5O A;  2W6K A;  2E6L A;  4CVN E;  3MCA B;  1RBT A;  4E7H A;  4O8K A;  1HMV A;  4JV5 K;  3SJJ A;  3ID6 A;  4JK7 A;  3WNF A;  5TKY A;  4JRP A;  1C6V A;  2Q0U A;  2QEX N;  1S5J A;  1JL1 A;  3IRX A;  1IKV A;  2ZF5 O;  4I6M A;  2FXU A;  5AFU H;  1OVY A;  1WB9 A;  2YNF A;  4K25 A;  4DS5 A;  3ZSY A;  1ASW A;  1FK9 A;  3VPZ A;  3ZSW A;  1QTM A;  2HF3 A;  4Z4F A;  5KI6 A;  2GV9 A;  1EXQ A;  3KKR A;  4NCB A;  2YHY A;  4YOT A;  2G8H A;  2A40 A;  5CZ2 A;  4CHZ A;  3G4S N;  4LSN A;  4F2S A;  2FBY A;  4LH5 A;  4CGH A;  3KKS A;  3CCS N;  1NJY A;  3DXK B;  4CEF A;  1JCE A;  1LW2 A;  5LL6 Z;  2P9U A;  1TAQ A;  3TWH A;  5AFU A;  3M3Z A;  1SKS A;  2WC9 A;  4FM1 A;  3C94 A;  5F1X A;  4CBU A;  3ZT4 A;  4PKG A;  2HMP A;  3WT0 A;  3HP9 A;  4LF4 K;  5HP1 A;  2HHW A;  2UXC K;  4LFC K;  2E2N A;  2E1Y A;  3C6H A;  1VSM A;  4CGF A;  3WNH A;  4AHC A;  3KLG A;  4BC5 A;  2Q3S A;  3ENH A;  3G25 A;  4DV7 K;  3GL1 A;  2Q97 A;  2HHT A;  2PZS A;  2Q36 A;  1RBV A;  3G6E N;  3NGZ A;  2A1R A;  5K14 A;  2P51 A;  4DF8 A;  3BUZ B;  4BRA A;  3DLH A;  3NF8 A;  1VQ7 N;  1R0A A;  4XH1 A;  4CEO A;  2QA4 N;  2YNH A;  1WAJ A;  2F4V K;  3S3O A;  2E88 A;  4KRE A;  1VSK A;  3ZEU B;  1X9W A;  1NKE A;  3CFO A;  2FSJ A;  1ITG A;  3OYA A;  3QBW A;  2IGI A;  5HRS A;  4O4G A;  3AA4 A;  3C6U A;  4JYA K;  4FZY A;  1J5E K;  3TSU A;  3SAF A;  4FJ8 A;  4J2B A;  1BGX T;  4DFP A;  5FRM A;  4C8M A;  4A2A A;  3L2R A;  1XHZ A;  2QKK A;  1WSH A;  1K73 O;  3T3F A;  3J81 O;  2HNY A;  3K5O A;  2AJQ A;  2ZQB A;  4JKH A;  3PIP L;  2F9W A;  3O5B A;  4DSL A;  4C23 A;  5JVG L;  1RTJ A;  2P9I B;  2OZS A;  2E2Q A;  1TYQ A;  3OS2 A;  3CJC A;  4ELU A;  3ATU A;  5CYM A;  1XNR K;  4BRK A;  4E7I A;  1LV5 A;  2BGG A;  3CM5 A;  5C42 A;  2VWJ A;  2OYQ A;  4E19 A;  3EO3 A;  2HB5 A;  1YVN A;  4RG8 A;  4IOC L;  4AQY K;  3HVR A;  1D5A A;  2CH6 A;  4CBW A;  4CZG A;  4NYN A;  5BPL A;  3EKS A;  3V4I A;  1JLQ A;  3AO5 A;  2D0P A;  4EP4 A;  3BZK A;  5KGX A;  3TAM A;  4AM6 A;  3LWM A;  4O0J A;  1XQS C;  5M1P A;  2HHQ A;  1S1T A;  1EO1 A;  1RT4 A;  1YJW N;  3NCI A;  4B9S A;  3WEE B;  4CJ3 A;  1QHT A;  4M3Z A;  4L8R B;  3LDL A;  3HM9 A;  3QDK A;  4A2B A;  3UKU B;  3A2F A;  4OGE A;  4CZF A;  3ZSZ A;  1P8Z A;  1YI2 N;  1ZBS A;  1YIJ N;  3R9P A;  4BG9 A;  1W0H A;  2IC3 A;  4B9V A;  4DMN A;  3MEC A;  3OYJ A;  3O80 A;  3LPU A;  1W7A A;  4PL8 A;  3O6W A;  5EY4 A;  4JI5 K;  3DOL A;  2OA8 A;  3DXK A;  3TSP A;  3U4L A;  2O8E B;  3P38 A;  3UIQ A;  1KXP A;  4YFU A;  2DFE A;  4B3O A;  4BRO A;  2ATQ A;  3TR8 A;  4KHW A;  1S1V A;  1BL3 A;  3O4N A;  1MA9 B;  4BVO A;  4CJT A;  2HMI A;  3ZSR A;  3TPQ A;  5JIC A;  4WFB L;  3N4Q A;  3HZ6 A;  2RPI A;  3DLK A;  2JWK A;  4M3Y A;  2QWM A;  5FLX O;  3J7Z O;  4JI4 K;  3LDS A;  3M6G A;  4FWR A;  1X9M A;  4I9Q A;  3TU5 A;  2GX9 A;  2WBN A;  5BPN A;  4O5F A;  4CFC A;  3VMF B;  4BRF A;  3JS6 A;  3AVM A;  3AAQ A;  5ADX H;  4CHN A;  5IT9 O;  3M8P A;  4YOR A;  2YKN A;  2DY4 A;  1HPZ A;  4CI6 A;  1QQO A;  4BRP A;  4KTW A;  3ZEU A;  1R59 O;  4DR5 K;  3DAW A;  3WXI A;  1NJX A;  1Q86 O;  5C10 A;  4XEI A;  1VRU A;  3I56 N;  1NU0 A;  2ZE2 A;  3RSE B;  4DLG A;  4K8X A;  2VGM A;  1GLC G;  5ADX A;  3CCJ N;  4CEB A;  1K9M O;  5SZT A;  3ATV A;  3ISN C;  4O5B A;  3VA3 A;  1RFQ A;  3AO2 A;  3THY B;  2V7Z A;  5IWA K;  3NHG A;  3PLA A;  2P9I A;  4BDY A;  4OGC A;  4H0O A;  5JMV A;  2O8B B;  5J2M A;  4EHT A;  3HYF A;  4BE1 A;  3MN7 A;  1Z25 A;  1JCF A;  4ELV A;  3SMS A;  2KW4 A;  4DV1 K;  5JVH L;  4MQ3 A;  1C1A A;  5HBM A;  4RW9 A;  4B1Z A;  4M63 C;  2YKM A;  4CK3 A;  3SV4 A;  3QEW A;  5AQJ A;  4ISF A;  3ZX2 A;  4OPJ A;  1SAZ A;  1KCF A;  3HPH A;  1VQN N;  1OH8 A;  1NGI A;  3HBT A;  3PX6 A;  1BIS A;  3BY5 A;  3KLH A;  2E5L K;  2BTF A;  4QOZ B;  1HJR A;  1Q9X A;  4JI2 K;  2FBT A;  4DR2 K;  4C8O A;  1A5V A;  3RMB A;  4FK2 A;  2KKZ A;  3K9J A;  3NGY A;  1N6Q A;  3WEE A;  4KI6 A;  1RCH A;  3KD1 E;  4CF0 A;  2BUP A;  3IUC A;  3UB5 A;  4PUO A;  4FJJ A;  1NGJ A;  4AM7 A;  4J8F A;  3KK1 A;  4FSV A;  3S41 A;  3VTH A;  4DQI A;  3FE1 A;  1XHX A;  3NH2 A;  3UKU A;  2FBV A;  1QSL A;  2X74 A;  2KHO A;  4FWL A;  2G8F A;  5FRN A;  4DUY K;  3LP2 A;  4E1N A;  1FKP A;  3OS1 A;  4KHN A;  3T19 A;  2GUP A;  4O8U A;  3IAY A;  1WN7 A;  5AQQ A;  3TAE A;  5M1K A;  4B1W B;  4CJS A;  2O8C B;  2O8E A;  5SWM A;  2YJF A;  4DTN A;  3OBY A;  3P1G A;  2R7Y A;  4PWD A;  2HBK A;  2PAV A;  2YHB A;  3AO3 A;  2NRV A;  3S9H A;  2KZM A;  3R8E A;  4H0Y B;  4ISG A;  4B8A B;  4N5S A;  2WUS A;  1IH7 A;  2IS3 A;  1SKR A;  4C8L A;  2NRX A;  4CF9 A;  3KWI A;  3VA0 A;  3AA3 A;  4HHT A;  3LAL A;  2OPP A;  4M7X A;  4G9Z A;  1RDW X;  3AVN A;  1JLE A;  4FK4 A;  3VET A;  2XY8 A;  2XY7 A;  4CJU A;  4H5N A;  3SQ4 A;  1JLB A;  4LY7 A;  4YOU A;  4WE1 A;  3P4I A;  4H8K A;  1NWK A;  4H5R A;  4GW6 A;  3VEW A;  4ZTJ A;  1QHA A;  3VQD A;  3QEP A;  5BRF A;  4H0P A;  3NH0 A;  5BRE A;  4BY9 C;  3EKU A;  1NGH A;  1HRH A;  3LDP A;  1YHQ N;  3WXL A;  1HX1 A;  4LF8 K;  5KGW A;  2IOC A;  5AQK A;  4XH5 A;  3FZL A;  4H4O A;  2H3G X;  3KLI A;  3RSE A;  5HRR A;  1UA0 A;  4FPB A;  4W5N A;  3VF2 A;  1ZBI A;  4CE9 A;  3NVK A;  1X3M A;  2ZWH A;  4M41 A;  5BR8 K;  2WTU A;  4H4M A;  3CHW A;  4JKA A;  3THY A;  4ILJ A;  2OCE A;  5EVZ A;  4JI0 K;  3MAQ A;  3ITH A;  1IKY A;  2QI2 A;  2O8B A;  3OVN A;  2KTQ A;  4FJ5 A;  5DK5 A;  4BC2 A;  4DKW A;  4BRM A;  2OTJ N;  1ZBH A;  4CJR A;  3MN6 A;  1WSE A;  3VEV A;  2E20 A;  4CW7 B;  5KPZ A;  4CFB A;  4DV6 K;  1VQO N;  3E9O A;  3HPO A;  4RW7 A;  2G8W A;  3VQA A;  1LWF A;  2BE2 A;  4N41 A;  1E4G T;  4U7B A;  1DGK N;  2G8V A;  2IVP A;  3ID8 A;  3OTO K;  4DQP A;  2E1Z A;  2IVO A;  1YUW A;  1JCG A;  4IDH A;  3EZ5 A;  3O9U A;  4M3X A;  2IVN A;  1GLJ O;  3OYN A;  3CD6 N;  1U45 A;  2WON A;  3T7Z A;  2YHA A;  2O8F A;  3S3M A;  2W6L A;  1WAF A;  5FPN A;  4IDK A;  4PL7 A;  1LW0 A;  3A5M C;  4E1M A;  3I8B A;  4DFK A;  1Z05 A;  3G0Z A;  3QFP A;  4CJK A;  3CCM N;  2NNW A;  4DU4 A;  3VF6 A;  4BWM A;  1CXQ A;  2B5J A;  4Z4G A;  1LWE A;  4F3O A;  3PIO L;  3HI0 A;  3L3V A;  1DLO A;  3RRH A;  2P5O A;  4H0V B;  3VQE A;  4FWM A;  4CF1 A;  4AHR A;  1HYS A;  1J9A A;  1T6C A;  2O8C A;  2ZD1 A;  3AY9 A;  4OKE A;  4CEA A;  1VSE A;  2YNI A;  1B92 A;  1VSD A;  1CZ9 A;  3HT3 A;  4A59 A;  1Q9Y A;  3KLF A;  1IV0 A;  1HJO A;  1N32 K;  2KFZ A;  5CYQ A;  3A8Y A;  4GV3 A;  5C2D A;  1HQU A;  3ZX0 A;  4HCB A;  1KAZ A;  3OYK A;  3CQ8 A;  4JI7 K;  4W5R A;  3CJA A;  3OYE A;  3V9W A;  4CCH A;  1RBS A;  1EQY A;  3VQQ A;  5DM7 L;  5I9E B;  4YNQ A;  4F8R A;  1L3V A;  4I2Q A;  3D6R A;  4JKG B;  1VQ5 N;  4KRF A;  3AA5 X;  1Y64 A;  4XIU A;  4ZHR A;  2NLX A;  4BDP A;  4DTP A;  4MLE A;  2G8K A;  2QWL A;  3VGK A;  1TGO A;  3SNN A;  5LMU K;  3L2U A;  4W5Q A;  4DUZ K;  1I39 A;  4GKJ K;  1CZA N;  4JI6 K;  4DTU A;  3C65 A;  3V1R A;  3KIO A;  4GVM A;  3B6P A;  2OPQ A;  3MN9 A;  3IFR A;  5AQG A;  5C12 A;  4DFJ A;  3AAR A;  3VEY A;  5AQZ A;  1LAV A;  3KVG A;  2NRW A;  3HOT A;  3VGM A;  1VQK N;  4FLU A;  4GKK K;  4IZ9 A;  1RT7 A;  4RWT A;  3Q7B A;  3QEI A;  2O4G A;  4BR7 A;  4DCH A;  4IJA A;  4DR7 K;  4MDA A;  3CCQ N;  4I9L A;  3VQ7 A;  3L3U A;  4KI4 A;  3DXM B;  2UXB K;  3M8S A;  4HVJ A;  3RMA A;  4RTF D;  5HRN A;  1RT1 A;  4BR9 A;  4YHH K;  2BDP A;  1GLD G;  2VG7 A;  1QVG M;  1IBL K;  2E2P A;  1HYZ A;  3TAB A;  5EU7 A;  4DB3 A;  2G8U A;  5JLH A;  3KWG A;  5AQM A;  4FO0 A;  1YJN N;  3EN9 A;  4FCY A;  3OJU A;  3OW2 M;  2P9N B;  3NGI A;  3CCV N;  3OYI A;  3AGK A;  1WSF A;  2FF6 A;  3CCR N;  3PV8 A;  4G1Q A;  2A6A A;  4L3Q A;  3ZSX A;  5LY3 A;  1KAX A;  3A5N C;  5KPT A;  5CE3 A;  2XRI A;  1VRT A;  3PSF A;  4CIF A;  3T1A A;  4FLY A;  1HQE A;  4I7F A;  1VQL N;  3HOS A;  2O4I A;  1T05 A;  3O9R A;  1MDU B;  3P31 A;  3H1V X;  3CF5 L;  2VWB A;  1TVR A;  2CH5 A;  4KH5 A;  3LL3 A;  3LP1 A;  1VQ8 N;  5FRO A;  4H03 B;  2B4J A;  1X3N A;  4KTZ A;  4FW1 A;  4M3R A;  4DTX A;  4JEP A;  2EWS A;  4OLA A;  1NK5 A;  3PO4 A;  5FPE A;  3IKM A;  3NVM A;  1T8E A;  4ILH A;  2P9P B;  4HUF A;  1S72 N;  3VQB A;  4W5T A;  1VSL A;  3U3Y A;  3SCX A;  2NRR A;  4WCE L;  4X64 K;  4C1N I;  1K6Y A;  4MLH A;  4CJ7 A;  4EP5 A;  4M42 A;  2W41 A;  4FJX A;  2Z1I A;  3AVJ A;  4IO8 A;  2B6A A;  3L4I A;  3M1F A;  5AJ3 K;  5J2N A;  2YNG A;  4H5V A;  1BOT O;  4DTJ A;  4JKD A;  2ASO A;  3JXU A;  1NK9 A;  4DR6 K;  4ID5 A;  3WUH A;  5C25 A;  2HW3 A;  3J80 O;  4BGA A;  4Q0B A;  3H45 C;  4DTO A;  3QLH A;  3F5T A;  5BN8 A;  2EHG A;  3CCE N;  2J4R A;  2DFH A;  2GEL A;  1OVQ A;  4F3T A;  1REV A;  2D1K A;  1S1X A;  4MO5 A;  3MCP A;  4F9O A;  4EZ9 A;  3EE9 A;  4XH4 A;  4B3S K;  5MLC Q;  4JKG A;  4F2R A;  1MWM A;  3CQX A;  4OPH A;  2PY5 A;  3HXM A;  1QQN A;  3D0P A;  2NUB A;  3CXC M;  1RGI A;  4BDZ A;  2ZJP L;  1KVC A;  1MU2 A;  3MXI A;  3V81 A;  1A5W A;  4YOV A;  1X1P A;  4B9T A;  2FF3 B;  3H08 A;  3OYL A;  5C0Y A;  1RDD A;  1NKB A;  3QFU A;  1IBM K;  1VQM N;  2HVH A;  1SKW A;  1HNI A;  2XY5 A;  1BUP A;  3P5J A;  3O9S A;  3TAN A;  3AVF A;  2FSN A;  3TAR A;  3SQ1 A;  4JI8 K;  1QZ6 A;  4CBX A;  4FJL A;  1IKW A;  3EE8 A;  3KK7 A;  4KTQ A;  3MWP A;  3K5N A;  4O55 A;  2HHV A;  3ZCM A;  3DXM A;  1NJW A;  2OPS A;  4CHO A;  1YVU A;  4JI3 K;  4YDU A;  1S6P A;  2Z1G A;  1A5X A;  1LCU A;  1TK5 A;  4DQQ A;  3L8B A;  3AVL A;  1HNX K;  2QWR A;  2A5X A;  4DR4 K;  1E4F T;  4K8Z A;  1NJZ A;  1VK0 A;  3DOK A;  4B8C A;  3SBT A;  3A0I X;  4OX9 K;  2P9N A;  4BE0 A;  4BRG A;  1NMD A;  3HSC A;  3LWL A;  4H0X B;  4HWI A;  4GNI A;  4CGD A;  2W42 A;  1KSP A;  1Q81 O;  5LJW A;  1DKG D;  4DSI A;  5AQU A;  4OKJ A;  1EWQ A;  1HPM A;  2P9S B;  4NO7 A;  3JAM O;  5AQI A;  4FLV A;  2OAN A;  3O08 A;  3E66 A;  4E7K A;  3EZW A;  4FWQ A;  2HVI A;  3OA9 A;  3GOI A;  2BAN A;  4RW4 A;  3VQ4 A;  4DU1 A;  4CEE A;  3CC7 N;  3VER A;  4X62 K;  4HCC A;  5E41 A;  4HTU A;  1OH6 A;  3CQY A;  3DMJ A;  2QXL A;  3AVH A;  4KHU A;  1P90 A;  4IEI A;  4DV3 K;  3KD5 E;  5GAD P;  1SL0 A;  3K59 A;  3Q7C A;  3SUQ A;  4FVU A;  4BC4 A;  1L5U A;  2P9P A;  3VQ9 A;  3VEN A;  4LD0 A;  3CMA N;  4JKB A;  4PKH A;  4CEZ A;  1Q18 A;  1I94 K;  4ILG B;  2IDO A;  3ZT1 A;  2UXD K;  1W2B M;  4O0I A;  1C0M A;  1S9E A;  3JSM A;  4DV5 K;  3LDO A;  4FZX C;  3LPT A;  1TL1 A;  2HHS A;  4CGI A;  4YOY A;  1BA1 A;  3ULD A;  3VEO A;  4JNE A;  3K57 A;  1U49 A;  4NLC A;  3CPW M;  1SZ2 A;  3SUN A;  3FLC O;  3PX0 A;  4MO4 A;  3SPZ A;  3K2P A;  1BIU A;  4A5A A;  1M1K O;  2G8I A;  1NBW A;  3RR8 A;  5M1Q A;  3V1O A;  1VQP N;  3ALY A;  1YAG A;  1BQM A;  1LOT B;  2X6S A;  1JLA A;  3CCU N;  4DSJ A;  3RTV A;  5KTQ A;  3SAG A;  4BE2 A;  1RBR A;  1VSI A;  1KC8 O;  1N36 K;  4FWO A;  2RF2 A;  3OYG A;  3ENO A;  2IAJ A;  3F2K A;  2OTL N;  3QEV A;  3FZF A;  2AA4 A;  2X6N A;  5AQT A;  4CIG A;  5FPD A;  2PFU A;  4CZE A;  1CLQ A;  2YCH A;  1WBD A;  3KK2 A;  3E1Y A;  4M45 A;  1SUQ A;  3E9P A;  4JK8 A;  5TKW A;  4CD1 A;  3SQ2 A;  3W0L A;  2E2O A;  4ICL A;  4AHS A;  3IMX A;  3WXM B;  1DEJ A;  4FLX A;  4A62 A;  1XNQ K;  3SJH A;  4PHT X;  3L2W A;  1KTQ A;  2QWQ A;  1NOZ A;  4NXM K;  3CC2 N;  2HBJ A;  4B3R K;  3C6T A;  3QIN A;  4OVL A;  1RT5 A;  2HOE A;  4U67 L;  3QNO A;  2I5J A;  3SK3 A;  4NCG A;  4OPK A;  1GLA G;  4IO9 L;  1D9D A;  3VOV A;  3QB0 A;  4BRE A;  4OKK A;  4C8N A;  1MWK A;  1HNW K;  4PQU A;  3H3O B;  2FBX A;  4J2A A;  2DPN A;  1JLF A;  1NNE A;  3KHY A;  1J54 A;  1G15 A;  4OPA A;  2ZGZ A;  4UQG A;  3O4Q A;  1NKC A;  1KLM A;  1NK8 A;  3T1Y K;  3U6F A;  1EX4 A;  1B9F A;  3FGU A;  4CIE A;  3HPG A;  2VYP A;  3O1W A;  2FC0 A;  2P9S A;  3AVI A;  5GIP A;  4LF6 K;  5FPM A;  1RNH A;  2QXF A;  4I2P A;  4CD3 A;  4B9N A;  4H5W A;  1QS4 A;  3R6M A;  1BO5 O;  4NLB A;  2A1S A;  2I7P A;  4NYF A;  4JK9 A;  1YIT N;  3NF9 A;  4KHS A;  3KLE A;  1QQM A;  4HUG A;  1NG9 A;  4CEQ A;  2Y1I A;  3JYT A;  1N5Y A;  5M1O A;  3TI0 A;  4FW2 A;  5LJV A;  5AZI B;  4QS7 A;  4MDB A;  1IJJ A;  2HHU A;  1IKX A;  1HLU A;  4CGG A;  2Q0R A;  1VQ6 N;  1KRP A;  4IFY A;  3HVT A;  3ASM A;  4A57 A;  3CM6 A;  4EAH D;  3RMC A;  3PX4 A;  4KAZ A;  4NXN K;  3AA2 A;  4DHY A;  1KQS M;  3LM2 A;  4FLT A;  3AVK A;  3H46 O;  1V4T A;  4GV9 A;  4QS9 A;  1N34 K;  5GIN A;  1ZBF A;  3FFI A;  1TL3 A;  1LWC A;  1Z6R A;  2P9K B;  4E3S A;  1NOY A;  1RIL A;  3CYM A;  3BF3 A;  3SPY A;  1RDU A;  1RT3 A;  4OJR A;  2UU9 K;  4FWS A;  4KHQ A;  4EZ6 A;  2RKI A;  3GE1 A;  1BA0 A;  3I33 A;  1XUP O;  2GTD A;  2VGN A;  4AIL C;  3HTV A;  3SMP A;  3SUO A;  2IIR A;  1HKG A;  3O4W A;  3CI5 A;  4CED A;  2CGK A;  1XC9 A;  3AVA A;  4BRI A;  4Y1D A;  4RCH A;  3DRS A;  3SYZ A;  5E84 A;  4CHQ A;  3WQT A;  4WQ4 A;  1WNS A;  2ZGY A;  4WQ5 A;  5F0X A;  4CZL A;  3WNG A;  2W40 A;  1U4B A;  4BG8 A;  1L3T A;  3O9T A;  1ATN A;  3HJF A;  3HM8 A;  1T6D A;  3IS9 A;  2UUB K;  4BRC A;  5KPR A;  3MX5 A;  4E7L A;  1GOB A;  4QS8 A;  4BAC A;  4A61 A;  4YOX A;  4KKO A;  2KZZ A;  5HRO A;  2O8D B;  3D2E B;  4CES A;  2WFB A;  5ELZ A;  1UOC A;  1T03 A;  3DJC A;  4PA1 A;  3VGL A;  4B1X B;  2QWO A;  3ZSQ A;  1C0U A;  2XHB A;  4JKE A;  4DR1 K;  4IEE A;  3NMU A;  3NBP A;  3J7A P;  3L6Q A;  1TUY A;  4GY2 B;  3FZK A;  2XO7 A;  3B6O A;  2RHK A;  3D45 A;  3HP6 A;  1DTT A;  1JXE A;  3HST B;  4FYD A;  4IOA L;  4DSE A;  4OO1 J;  3CER A;  4DTM A;  5I42 A;  1E3M A;  5BPM A;  2QW9 A;  1ILY A;  4Z94 A;  3L2V A;  3PUF A;  3PO5 A;  4CJ4 A;  1M90 O;  4CJF A;  1VSJ A;  3AO1 A;  3O8M A;  3TAP A;  1KAY A;  1TK0 A;  4CZJ A;  3QEX A;  4FJ9 A;  3SUP A;  3MEG A;  3NF6 A;  5AQY A;  3IG1 A;  3M5R A;  1ESV A;  3U3G A;  5BRD A;  1U47 A;  1BIZ A;  5AQO A;  1RTH A;  1C1B A;  4BGB A;  3NFA A;  2ZJQ L;  1D9F A;  3U9Z A;  1SL1 A;  2D0A A;  4NCA A;  4DV2 K;  4JI1 K;  3LP3 A;  3MXJ A;  1KVB A;  3OYD A;  4Y0W A;  4WF9 L;  3ZYY X;  4CK2 A;  3PSI A;  4DWI A;  4LC9 B;  4FM2 A;  3SQ0 A;  4WYB A;  3CIP A;  4KBO A;  4GV6 A;  2NRZ A;  3LAM A;  5C2F A;  3AGR A;  3U8X A;  3HO1 A;  4FOI A;  3AVC A;  1K8A O;  1VHX A;  1ZC6 A;  2D0O A;  4KHY A;  5AQV A;  3CG7 A;  1NGG A;  3GBT A;  3KTQ A;  4AH9 A;  3OS0 A;  1O1W A;  4DSF A;  3KK3 A;  5J2P A;  3TTD A;  1W97 L;  1JJ2 M;  3H6E A;  5AZI A;  3ZLJ A;  4CHY A;  5GIO A;  2VQF K;  3HK2 A;  4B9M A;  4H5T A;  4FJH A;  4N76 A;  5BRH A;  1K8K B;  4KB0 A;  4CZM A;  1BI4 B;  1HYV A;  2FSK A;  4FWK A;  1BU6 O;  3QER A;  2VG6 A;  3CFP A;  4H0T B;  4B08 A;  3AO4 A;  4DU3 A;  2HST A;  4BRH A;  4IXC A;  4DV4 K;  3RMD A;  1BG3 A;  2P9K A;  3AVB A;  4BWJ A;  2GEM A;  3NE6 A;  3LAN A;  1LAW A;  1WUA A;  3FZM A;  3MWT A;  1J53 A;  5I3U A;  1TAU A;  4FM0 A;  4BRQ A;  3VTI A;  4KH6 A;  5A2Q O;  1U6Z A;  1TKZ A;  1IO2 A;  4BC3 A;  4DQR A;  4DF4 A;  2UUA K;  4BR2 A;  5HLF A;  5B8H A;  3OYC A;  2GBZ A;  5AQX A;  4IFV A;  1ASV A;  2A42 A;  4ID1 A;  3BP8 A;  4CJW A;  4CK1 A;  4EHU A;  4E1J A;  5AQS A;  3KJV A;  3SV3 A;  5GAE P;  3M8Q A;  1C0T A;  4DLE A;  1J5O A;  1VSH A;  4B9L A;  5CHI A;  2O8D A;  3D2E A;  1Q82 O;  1IG9 A;  1VQ9 N;  4CZH A;  2VCP A;  4R79 A;  4JKF A;  4BRN A;  3AV9 A;  1RT6 A;  3L4Q A;  4IJN A;  3CJ1 A;  2QK9 A;  2YJE A;  1IG8 A;  4E7J A;  1WBB A;  4JN4 A;  4JLH A;  3LP0 A;  3MEE A;  4JHD B;  3NH1 A;  2P9L B;  3PY8 A;  3TAG A;  2ZM6 K;  2KFN A;  4X66 K;  1N33 K;  5F2R A;  1S6Q A;  3CC4 N;  3C6A A;  5AQF A;  1GLF O;  4FL9 A;  2D4W A;  3THX B;  3UKR B;  1EWR A;  3QBX A;  2CGL A;  5AQW A;  1S22 A;  1UA1 A;  3I0S A;  4DTS A;  1KVA A;  2ASP A;  2I7N A;  2V52 B;  3DLG A;  1KFD A;  1RTI A;  2RN2 A;  5LMN K;  1U48 A;  1NGE A;  2JLE A;  5GAG P;  2DFF A;  4JS5 A;  2D0C A;  4BQL A;  4J2E A;  2Q2R A;  1SL2 A;  3BEX A;  1S9G A;  4Z4E A;  2A41 A;  3OYM A;  3QO9 A;  3HRG A;  1V4S A;  2F7T A;  3F9M A;  1DTQ A;  3RRG A;  3WXK A;  3OBW A;  2JWL A;  1QSS A;  2YHW A;  3VF4 A;  4ELT A;  4KPY A;  3VQ8 A;  1DT9 A;  4CFD A;  1RTD A;  1NK0 A;  3VEZ A;  1XI1 A;  3NF7 A;  3O3H A;  4YOW A;  3K9K A;  1NGA A;  1NK4 A;  1WSG A;  3TTF A;  4K43 A;  4WFN L;  1OKJ A; 
#chains in the Genus database with same CATH homology
 4W5N A;  1S5J A;  1JL1 A;  1JLA A;  2X6S A;  3IRX A;  1IKV A;  3RTV A;  4DSJ A;  5KTQ A;  4GMJ B;  1ZBI A;  4CE9 A;  4BE2 A;  1S1W A;  1RBR A;  1VSI A;  4M41 A;  1B9D A;  4H4M A;  2YNF A;  3NDK A;  4DS5 A;  3ZSY A;  3MAQ A;  3V9U A;  2RF2 A;  3OYG A;  2KQ2 A;  1ASW A;  4DQS A;  3RR7 A;  2IAJ A;  1FK9 A;  3ITH A;  1BI4 A;  1JL2 A;  3ZSW A;  1IKY A;  1QTM A;  4KFB A;  1JLG A;  3OVN A;  4Z4F A;  5KI6 A;  3QEV A;  2KTQ A;  2GV9 A;  2X6N A;  3TAQ A;  3ZSV A;  1EXQ A;  4FJ5 A;  3KKR A;  5DK5 A;  4CIG A;  4NCB A;  1I3A A;  4FJN A;  2G8H A;  1ZBH A;  3QIP A;  4CJR A;  1CLQ A;  5CZ2 A;  1WSE A;  3KK2 A;  1ZBL A;  4M45 A;  1SUQ A;  4CHZ A;  2P5G A;  1BQN A;  4LSN A;  4CFB A;  3TAF A;  4F2S A;  2FBY A;  4LH5 A;  4CGH A;  4RW7 A;  3HPO A;  3KKS A;  2G8W A;  3SQ2 A;  1NJY A;  3RWU A;  3VQA A;  1LWF A;  2BE2 A;  4ICL A;  4AHS A;  1LW2 A;  4CEF A;  4JS4 A;  4N41 A;  4MFB A;  5JS2 A;  1TAQ A;  3TWH A;  1SKS A;  1Q8I A;  4FLX A;  1NK7 A;  4FM1 A;  1S1U A;  3C94 A;  3L2W A;  1KTQ A;  2G8V A;  1NOZ A;  4FJK A;  3ZT4 A;  4ZTF A;  4AHV A;  3C6T A;  3QIN A;  4DQP A;  4OVL A;  1RT5 A;  3HP9 A;  5J2Q A;  3EZ5 A;  3QNO A;  4M3X A;  5HP1 A;  3OYN A;  2I5J A;  2PYJ A;  2HHW A;  1U45 A;  2PYL A;  2WON A;  3ZT0 A;  2VG5 A;  4NCG A;  4OPK A;  1JXB A;  2YHA A;  3S3M A;  1WAF A;  4CJQ A;  4IDK A;  3VQ5 A;  3QIO A;  1D9D A;  4E0D A;  2Z1J A;  1LW0 A;  4OKK A;  1VSM A;  4E1M A;  4CGF A;  4DFK A;  4C8N A;  3WNH A;  5J1E A;  3G0Z A;  4AHC A;  4PQU A;  4J2A A;  2FBX A;  4CJK A;  1JLF A;  3EYZ A;  3KLG A;  2HND A;  2Q3S A;  1J54 A;  1G15 A;  4DU4 A;  4BWM A;  1CXQ A;  2B5J A;  4Z4G A;  1LWE A;  2HHT A;  4F3O A;  4UQG A;  2PZS A;  3O4Q A;  4CGJ A;  1NKC A;  1RBV A;  3L2Q A;  4HUE A;  3NGZ A;  2A1R A;  3L3V A;  1DLO A;  1KLM A;  5K14 A;  4AHU A;  4IG0 A;  2P51 A;  3RRH A;  4DF8 A;  1NK8 A;  2P5O A;  1C1C A;  3VQE A;  3DLH A;  3NF8 A;  3U6F A;  3QES A;  5JS1 A;  4CF1 A;  4AHR A;  1R0A A;  4OLB A;  4CEO A;  1HYS A;  1EX4 A;  2YNH A;  1B9F A;  1QE1 A;  1J9A A;  1WAJ A;  3HPG A;  4CIE A;  2ZD1 A;  5KRS A;  3S3O A;  4OKE A;  4CEA A;  1VSK A;  1VSE A;  4KRE A;  2FC0 A;  2YNI A;  1X9W A;  3AVI A;  1B92 A;  1NKE A;  3CFO A;  3DRP A;  1VSD A;  1CZ9 A;  3HT3 A;  4B9N A;  1RNH A;  1JLC A;  2QXF A;  4I2P A;  1ITG A;  3OYA A;  5HRS A;  2IGI A;  1Q9Y A;  1QS4 A;  4O4G A;  4PY5 A;  3AA4 A;  3KLF A;  2A1S A;  3C6U A;  4FZY A;  4FVM A;  5CYQ A;  2KFZ A;  4CHP A;  2YV0 X;  4NYF A;  5CY4 A;  3I8D A;  3O3G A;  4FJ8 A;  2Z1H A;  3NF9 A;  1U04 A;  4J2B A;  4KHS A;  1BGX T;  3KLE A;  4DFP A;  3BDP A;  1HQU A;  4HUG A;  4CEQ A;  4HCB A;  2Y1I A;  3OYK A;  4C8M A;  3L2R A;  3JYT A;  1XHZ A;  2QKK A;  3CQ8 A;  5FRM A;  1N5Y A;  1WSH A;  5FDL A;  3T3F A;  4N56 A;  4W5R A;  3TI0 A;  2HNY A;  1WLJ A;  3K5O A;  4FW2 A;  2ZQB A;  4CER A;  3OYE A;  2AJQ A;  3V9W A;  3LAK A;  4CCH A;  1RBS A;  2HHU A;  3VQQ A;  1IKX A;  4CGG A;  4YNQ A;  1ZBU A;  1L3V A;  4I2Q A;  4F8R A;  4KRF A;  4CF2 A;  3AA5 X;  4DSL A;  1XWL A;  4XIU A;  1KRP A;  4IFY A;  3HVT A;  2E4L A;  3ASM A;  4ZHR A;  1RTJ A;  3CM6 A;  3RMC A;  2OZS A;  4BDP A;  4DTP A;  1ASU A;  3OS2 A;  3PX4 A;  2G8K A;  4KAZ A;  4FK2 A;  3AA2 A;  1TK8 A;  4ELU A;  3SNN A;  1TGO A;  1F21 A;  3V1Q A;  1WSJ A;  2JGU A;  3AVK A;  3C95 A;  5CYM A;  4W5Q A;  3L2U A;  1I39 A;  4FLT A;  4E7I A;  1LV5 A;  4DTU A;  3V1R A;  1ZBF A;  2BGG A;  3KIO A;  3CM5 A;  3ZSO A;  5C42 A;  2VWJ A;  2OYQ A;  4GVM A;  1Y97 A;  3B6P A;  3FFI A;  2OPQ A;  4E19 A;  3MXM A;  2HB5 A;  1TL3 A;  1LWC A;  4RG8 A;  4E3S A;  3HVR A;  4DFJ A;  1NOY A;  1D5A A;  1LAV A;  1RIL A;  3CYM A;  3SPY A;  3V6D A;  1RT3 A;  4OJR A;  4KHQ A;  3ZT2 A;  1FKO A;  4FLU A;  4EZ6 A;  3SZ2 A;  3F73 A;  4LSL A;  2RKI A;  4NYN A;  3V4I A;  1JLQ A;  4M3W A;  3AO5 A;  4EP4 A;  1RT7 A;  3DLE A;  1BCM A;  3TAM A;  5KGX A;  4AIL C;  5D3G A;  3QEI A;  3SUO A;  2O4G A;  3LWM A;  4O0J A;  1CZB A;  4CED A;  2HHQ A;  1XC9 A;  3AVA A;  4TSX A;  4Y1D A;  1S1T A;  4DFM A;  4I9L A;  1UAX A;  3VQ7 A;  3L3U A;  3DRS A;  3SYZ A;  4KI4 A;  4CHQ A;  1RT4 A;  3AVG A;  3M8S A;  4IG3 A;  1WNS A;  4HVJ A;  3OYF A;  3NCI A;  4B9S A;  3WNG A;  4CJ3 A;  3RMA A;  1QHT A;  2F96 A;  3VQ6 A;  5HRN A;  1RT1 A;  1U4B A;  1L3T A;  4M3Z A;  1SV5 A;  4CJL A;  4FJ7 A;  2BDP A;  4L8R B;  3HM9 A;  2VG7 A;  3HJF A;  3IS9 A;  5KRT A;  1HYZ A;  3TAB A;  5EU7 A;  2G8U A;  3SI6 A;  3A2F A;  4KO0 A;  2F8T A;  4OGE A;  4CFA A;  3ZSZ A;  4E7L A;  1GOB A;  2GUI A;  4BAC A;  4Z4I A;  4FCY A;  3OJU A;  4KKO A;  1W0H A;  2IC3 A;  3NGI A;  2KZZ A;  5HRO A;  3DI6 A;  2F8S A;  4CES A;  3OYI A;  4B9V A;  4DMN A;  1EP4 A;  1WSF A;  3MEC A;  3OYJ A;  3NAE A;  1UOC A;  3P83 D;  3ZT3 A;  1T03 A;  3PV8 A;  4G1Q A;  3LPU A;  4PA1 A;  4DG1 A;  1EET A;  1CXU A;  1BCO A;  3ZSX A;  5HRP A;  3DM2 A;  2EX3 A;  1C0U A;  3DOL A;  2XRI A;  3ZSQ A;  3LZJ A;  2XHB A;  1VRT A;  2OA8 A;  4CIF A;  3T1A A;  4FLY A;  3NBP A;  1HQE A;  4I7F A;  3UIQ A;  4YFU A;  4CF8 A;  2O4I A;  2DFE A;  3I0R A;  4B3O A;  1YTU A;  2XO7 A;  2ATQ A;  3B6O A;  3TR8 A;  1T05 A;  3D45 A;  4KHW A;  1S1V A;  1BL3 A;  5C24 A;  3HP6 A;  3O4N A;  5T7B A;  3THV A;  1DTT A;  4DTR A;  1JXE A;  1TVR A;  3HST B;  3ZSR A;  4CJT A;  2HMI A;  4FJG A;  2LSN A;  4FYD A;  2RPI A;  3LP1 A;  4DSE A;  4DTM A;  5I42 A;  5FRO A;  1NK6 A;  3LZI A;  3DLB A;  3DLK A;  2B4J A;  4KTZ A;  4M3R A;  4FW1 A;  4M3Y A;  4DTX A;  3LDS A;  1X9M A;  4I9Q A;  3L2V A;  3PUF A;  4FJM A;  3PO5 A;  1NK5 A;  4OLA A;  1ZYQ A;  4CJ4 A;  4CJF A;  3V9S A;  3PO4 A;  1VSJ A;  1VSF A;  3AO1 A;  1T8E A;  1YTA A;  2D5R A;  3TAP A;  1RT2 A;  4IBN A;  4CFC A;  4Q5V A;  4HUF A;  1TK0 A;  3QEX A;  3VQB A;  4FJ9 A;  4W5T A;  1VSL A;  2D0B A;  3SUP A;  3MEG A;  3V9Z A;  3U3Y A;  3SCX A;  1L3U A;  3NF6 A;  3AVM A;  3IG1 A;  1T7P A;  1K6Y A;  4CHN A;  2ETJ A;  3M8P A;  3U3G A;  1U47 A;  1BIZ A;  2Y1J A;  4Z4H A;  1RTH A;  1C1B A;  5CZ1 A;  4EP5 A;  2YKN A;  3NFA A;  1TKD A;  1D9F A;  1SL1 A;  4M42 A;  2D0A A;  4NCA A;  2DY4 A;  4FJX A;  2Z1I A;  3LP3 A;  3MXJ A;  1KVB A;  3OYD A;  1HPZ A;  3AVJ A;  4KTW A;  2B6A A;  4CK2 A;  3OYH A;  3WNE A;  4JRQ A;  4QCL A;  4DWI A;  4FM2 A;  3SQ0 A;  4CJP A;  5J2N A;  2YNG A;  3LAM A;  3OYB A;  4DTJ A;  3HO1 A;  1NK9 A;  4ID5 A;  2QKB A;  2ITG A;  3AVC A;  1NJX A;  4FJI A;  5C25 A;  2HW3 A;  4Q0B A;  4DTO A;  4M3U A;  3QLH A;  4KHY A;  1VRU A;  2EHG A;  3CG7 A;  2ZE2 A;  4DLG A;  3KTQ A;  2DFH A;  4AH9 A;  4K8X A;  3OS0 A;  1O1W A;  4CJ5 A;  4DSF A;  4CEC A;  3KK3 A;  5J2P A;  4F3T A;  4CEB A;  1REV A;  5SZT A;  1S1X A;  3M8R A;  4EZ9 A;  3ISN C;  4CHY A;  4RW6 A;  4O5B A;  3HK2 A;  4B9M A;  3VA3 A;  4FJH A;  3AO2 A;  4F2R A;  2PY5 A;  4N76 A;  3NHG A;  4IKF A;  3HXM A;  4KB0 A;  1BI4 B;  1HYV A;  4BDY A;  4OGC A;  3D0P A;  3QER A;  5J2M A;  2NUB A;  2VG6 A;  1HNV A;  3HYF A;  4B08 A;  3CFP A;  3AO4 A;  1RDB A;  4BDZ A;  4BE1 A;  1Z25 A;  2DTU A;  1KVC A;  1MU2 A;  3MXI A;  4ELV A;  3EY1 A;  3V81 A;  1A5W A;  2KW4 A;  3MED A;  4DU3 A;  1X1P A;  4B9T A;  4KB1 A;  3H08 A;  3OYL A;  4MQ3 A;  1C1A A;  1RDD A;  3DRR A;  1X9S A;  1NKB A;  5HBM A;  3RMD A;  3AVB A;  1UWB A;  2HVH A;  4RW9 A;  3K5M A;  4CK3 A;  4BWJ A;  2YKM A;  3SV4 A;  1SKW A;  2WOM A;  3NE6 A;  3LAN A;  1LAW A;  1GOA A;  1HNI A;  3QEW A;  1RDC A;  2OPR A;  2XY5 A;  3P5J A;  4OPJ A;  4FLW A;  5I3U A;  1J53 A;  4O44 A;  3AVF A;  4R5P A;  3TAN A;  1TAU A;  4FM0 A;  1KCF A;  3HPH A;  1JKH A;  4F4K A;  3TAR A;  1TKT A;  3SQ1 A;  3PX6 A;  1BIS A;  5DMR A;  3KLH A;  4FJL A;  1IKW A;  1HJR A;  4QOZ B;  1Q9X A;  1YT3 A;  2FBT A;  2HNZ A;  4KTQ A;  4C8O A;  3K5N A;  1TKZ A;  2VWK A;  4O55 A;  1IO2 A;  3ZCM A;  4DQR A;  1RBU A;  4DF4 A;  2HHV A;  1A5V A;  4FLZ A;  4FZZ A;  5HLF A;  3RMB A;  1NJW A;  2OPS A;  4CHO A;  4DSK A;  1YVU A;  3E01 A;  3OYC A;  3NGY A;  1N6Q A;  2GBZ A;  4KI6 A;  4M3T A;  3QNN A;  4IFV A;  1S6P A;  2Z1G A;  1RCH A;  1ASV A;  4ID1 A;  1A5X A;  4CF0 A;  4CJW A;  4CK1 A;  3KD1 E;  1KLN A;  4PUO A;  4FJJ A;  1TK5 A;  2OZM A;  3KK1 A;  3KJV A;  3SV3 A;  4DQI A;  1FXX A;  4E89 A;  1XHX A;  3NH2 A;  4DS4 A;  3L8B A;  3AVL A;  2FBV A;  4DQQ A;  1QSL A;  2X74 A;  3S3N A;  4FK0 A;  3OJS A;  4K8Z A;  3M8Q A;  1NJZ A;  2G8F A;  1VK0 A;  5FRN A;  1C0T A;  3DOK A;  4B8C A;  4DLE A;  3CFR A;  4FXD A;  3LP2 A;  1J5O A;  1VSH A;  4E1N A;  1RDA A;  4B9L A;  1FKP A;  3VQP A;  2P1J A;  4BE0 A;  1IG9 A;  3OS1 A;  4N47 A;  4KHN A;  3LWL A;  4B9U A;  4CGD A;  2W42 A;  1KSP A;  3AV9 A;  3T19 A;  1RT6 A;  2X78 A;  3IAY A;  1WN7 A;  2QK9 A;  4CJV A;  4DSI A;  1BHL A;  1D8Y A;  3V9X A;  3TAE A;  4E7J A;  4CJS A;  4OKJ A;  4JLH A;  5SWM A;  3LP0 A;  3MEE A;  1W9H A;  4DTN A;  3O3F A;  3NH1 A;  3P1G A;  2R7Y A;  3BGR A;  4PWD A;  2YHB A;  4FLV A;  4KV8 A;  3PY8 A;  4J2D A;  3VQC A;  3AO3 A;  4E7K A;  3TAG A;  2KFN A;  3S9H A;  2HVI A;  4CJE A;  2KZM A;  2BAN A;  1S6Q A;  4RW4 A;  3VQ4 A;  4DU1 A;  4CEE A;  1QQC A;  4Z0U A;  1KFS A;  4HCC A;  5E41 A;  4HTU A;  2HHX A;  4B8A B;  1QSY A;  4N5S A;  3DMJ A;  4C8K A;  3AVH A;  1IH7 A;  4KHU A;  1TKX A;  3QET A;  2IS3 A;  1SKR A;  3VN5 A;  4C8L A;  1WSI A;  3KD5 E;  1UA1 A;  3I0S A;  4CF9 A;  3HL8 A;  3VA0 A;  3K59 A;  4DTS A;  1SL0 A;  3SUQ A;  3AA3 A;  1KVA A;  3G10 A;  3LAL A;  3K5L A;  3DLG A;  4HHT A;  2OPP A;  1L5U A;  3VQ9 A;  1KFD A;  1RTI A;  2RN2 A;  1Z26 A;  3AVN A;  4FK4 A;  1JLE A;  1U48 A;  4LD0 A;  2XY8 A;  2JLE A;  2XY7 A;  1L3S A;  2DFF A;  3DYA A;  4CJU A;  4CEZ A;  4JS5 A;  2D0C A;  4QAG A;  3SQ4 A;  1JLB A;  4LY7 A;  4J2E A;  3F9K A;  1SL2 A;  2E6M A;  1S9G A;  4Z4E A;  3DLR A;  2IDO A;  4LH4 A;  3OYM A;  3ZT1 A;  3QO9 A;  4Y1C A;  1GOC A;  4RW8 A;  4WE1 A;  4O0I A;  4H8K A;  1C0M A;  1S9E A;  3JSM A;  2XY6 A;  4FZX C;  3LPT A;  1TL1 A;  2HHS A;  4CGI A;  4Z4C A;  3OY9 A;  1DTQ A;  3ULD A;  4GW6 A;  3RRG A;  3K57 A;  1U49 A;  4ZTJ A;  1QSS A;  4AHT A;  1EKE A;  3SUN A;  3VQD A;  3QEP A;  4ELT A;  3PX0 A;  3NH0 A;  1TV6 A;  3SPZ A;  4KPY A;  3K58 A;  3VQ8 A;  4W5O A;  1HRH A;  4CFD A;  1RTD A;  2E6L A;  4E7H A;  1NK0 A;  1RBT A;  1XI1 A;  3K2P A;  3NF7 A;  5KGW A;  1HMV A;  2IOC A;  3O3H A;  4H4O A;  1BIU A;  2G8I A;  3SJJ A;  1NK4 A;  1WSG A;  3RR8 A;  3KLI A;  3WNF A;  3V1O A;  4JRP A;  1C6V A;  3ALY A;  5HRR A;  1BQM A;  1UA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...