1CZ9A

Atomic resolution asv integrase core domain (d64n) from citrate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
139
structure length
139
Chain Sequence
QIWQTNFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution structures of the core domain of avian sarcoma virus integrase and its D64N mutant.
pubmed doi rcsb
source organism Avian sarcoma virus
molecule tags Transferase
molecule keywords AVIAN SARCOMA VIRUS INTEGRASE
total genus 51
structure length 139
sequence length 139
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1cz9A00
1VSHA 4KHQA 1VRUA 3KJVA 3AVNA 3I0RA 1IH7A 2IC3A 1LW0A 4FCYA 4DLEA 3LWLA 4DQSA 4DQPA 4IKFA 2KFNA 1JL2A 4E0DA 3HPHA 2KZMA 1IKVA 2RF2A 4CECA 4NYNA 4CK2A 5J2MA 4CEQA 2A1SA 3EYZA 3KLFA 2Y1IA 3K5MA 1LV5A 2NUBA 3F9KA 3DLEA 3M8QA 4R5PA 4FJJA 3QEXA 1KRPA 1WSGA 1D9DA 3PY8A 4RW9A 1NJXA 1RTDA 4Z4HA 2OPPA 3MXMA 3B6PA 3OYJA 5FRMA 4G1QA 4E1NA 3UIQA 3OS2A 4F2SA 1WSIA 1HYZA 1S1WA 1J54A 2Z1JA 5HRRA 3SUOA 1RTIA 4ELVA 2QK9A 1GOAA 3P5JA 1VSMA 4IBNA 4M3UA 3SUNA 3O3HA 1ZBLA 4DSJA 1LAWA 3OYEA 3NGYA 1EKEA 2KQ2A 4CGIA 2XY6A 4JRPA 1U04A 3AVIA 5SZTA 1ZBFA 1TKTA 3HPGA 4AHUA 3F73A 3NCIA 3SYZA 2QKBA 4E7KA 2HNZA 2HHVA 3RRGA 3HVTA 1R0AA 1ZBUA 3VA3A 3SQ4A 3RMAA 4FK0A 4FJXA 1RT4A 1TGOA 4BE1A 1QSSA 2G8IA 4DSLA 3AA4A 1NKCA 3SUQA 4GMJB 2G8FA 1BI4B 3AA3A 3AO3A 3DMJA 5FDLA 4AHCA 4C8OA 3OYFA 4KREA 3AVFA 3TAQA 3S3NA 1XC9A 4IDKA 1ZBHA 1XHXA 4M3ZA 1ZYQA 2PZSA 3C6UA 3KKSA 2DFFA 2VWJA 3EZ5A 1VSDA 3JSMA 1J53A 1HQEA 1U47A 3AVJA 2IAJA 4DQIA 4CESA 3S9HA 2F8TA 4CHQA 2P1JA 2HNYA 3LAMA 4XIUA 4DTUA 3IAYA 4KHYA 3U3GA 4FZYA 3TAPA 3VQEA 1GOCA 1RBVA 1NK6A 1HRHA 4KTWA 4FW2A 4B8AB 1J5OA 1KVBA 3S3MA 1QSLA 5KI6A 2Q3SA 2EHGA 1TK5A 1S5JA 4CIGA 2IDOA 2OPSA 1JXBA 3I0SA 2YNHA 2HHXA 1RT1A 4OPKA 1LWFA 2XO7A 3BDPA 2Z1GA 2VG6A 4LSNA 3ZSQA 5I3UA 4M3TA 1EXQA 1EP4A 3NBPA 4OGCA 3KLEA 4ZHRA 2OZMA 3VN5A 4FK2A 4O5BA 2KTQA 3KK1A 2BGGA 2VWKA 2FBTA 1TAUA 1G15A 3T19A 4O44A 1CZBA 1YTUA 1QQCA 4CK1A 4I9LA 3V9SA 4DTMA 1DLOA 1IKWA 1T7PA 2F96A 4K8XA 3C6TA 4H4OA 1X9MA 4HVJA 4FYDA 2DY4A 3ZSOA 4F4KA 3ULDA 4ID1A 3HXMA 2X78A 4CEZA 3LDSA 3AVHA 3HM9A 4JS4A 2FBXA 4CHPA 3K2PA 5C25A 3PX6A 4AHRA 3AO4A 3V1QA 3VQ8A 4CHYA 1K6YA 4PWDA 1QHTA 4DFKA 3ZT3A 4O0IA 3OS0A 3VQPA 3KK3A 4BWMA 4FM2A 5J2PA 4DTNA 4B9NA 1NK5A 1NK7A 2OPQA 5FROA 2HMIA 1WSFA 4E19A 3SJJA 1HYVA 1UOCA 4W5TA 5KGXA 5HLFA 2I5JA 2FC0A 4CIEA 2B4JA 1L3SA 2HHTA 4I2QA 3OJSA 4FVMA 4E3SA 3QNOA 4FJKA 1RNHA 2YHAA 2YV0X 2ZE2A 3D0PA 1NK9A 4DSKA 2DTUA 1S6QA 3MECA 1N5YA 3PO4A 1SL2A 1S9GA 3VQAA 4J2EA 1FKPA 2RKIA 2G8WA 4DSFA 4KHWA 4JRQA 1NOYA 4QCLA 3RRHA 3OYIA 5C24A 4UQGA 4KKOA 1RT3A 3QIOA 1I39A 1TKDA 4FJ9A 2YNFA 1U4BA 4N56A 3VQ6A 1NJWA 1O1WA 3ZSYA 1WSJA 3VQQA 1SUQA 2ATQA 3V6DA 1FK9A 3DRRA 4FLYA 3TR8A 1HMVA 1JLAA 3SQ0A 3MEEA 4CJRA 4CGFA 3IS9A 3LPTA 3NF9A 4BDZA 2VG7A 3QLHA 1KLMA 3NF7A 4B9UA 4KHUA 4FJNA 4KV8A 3KTQA 3P1GA 3LAKA 4FM1A 3VQ4A 3TABA 3PUFA 4Z4GA 1L5UA 1S1UA 1TVRA 4L8RB 3QINA 1YVUA 4DTJA 1RT2A 3SCXA 2DFEA 3ZSVA 1JLGA 3OJUA 1KFDA 1KVCA 3CM5A 4MFBA 2Z1IA 2E6MA 4N76A 1A5XA 3M8PA 5KRTA 4OKEA 4CJKA 4Q5VA 3L3UA 2ZD1A 1A5WA 1U48A 3HO1A 4QOZB 4FLXA 3LPUA 4OKJA 1UWBA 3AO2A 4CERA 3S3OA 1NJYA 1LWEA 1ASUA 4LY7A 1C1BA 4OGEA 4QAGA 4CF2A 1NK0A 4J2BA 3L2VA 3ISNC 4KHNA 2RPIA 4KAZA 4KTQA 4CFAA 2HW3A 1BI4A 1YTAA 3MEGA 3HPOA 3QIPA 3MAQA 4FK4A 3K5OA 3SV4A 2FBYA 4OLAA 3SNNA 4DQRA 1SKSA 4MQ3A 4DWIA 1RT5A 1CLQA 1GOBA 1RBSA 4W5RA 3M8SA 1TK0A 4F3OA 3VQCA 1VSJA 3DLKA 4AHSA 4Z4EA 2BDPA 4AH9A 4M42A 4EP4A 2E6LA 2YNIA 1IG9A 1B9FA 5CYMA 2XHBA 4HTUA 1RDBA 1RILA 4CJ4A 3NAEA 4J2AA 2KW4A 5D3GA 4CGGA 3LWMA 3NH1A 2YKMA 2R7YA 2B6AA 4DU3A 3WNFA 4E7IA 4CK3A 4AILC 1NJZA 4FXDA 1QSYA 1SKRA 3ZT4A 2JGUA 3WNGA 4KRFA 4CIFA 4KPYA 1WSEA 3OYLA 3IG1A 1RDCA 2QXFA 2B5JA 3VQ5A 4CEFA 3HK2A 2XY7A 5FRNA 3A2FA 3NHGA 4HCCA 2W42A 4CJ3A 4B3OA 4GVMA 3V81A 4I9QA 5T7BA 3LALA 1T03A 4DFMA 4E1MA 1BQMA 4CJ5A 1XWLA 2P51A 4B8CA 3LP2A 1MU2A 4CFDA 3SI6A 3DOLA 3MXIA 3SQ1A 3RR8A 4ID5A 1HNIA 5CZ1A 3V9UA 1J9AA 4FJGA 3AO1A 4N47A 3U3YA 1SKWA 3CFPA 4FLVA 4DSIA 3DLHA 4HUFA 3U6FA 3DM2A 3LANA 4KB0A 4DG1A 1RCHA 2X6NA 4FLWA 3LP3A 3ZCMA 3E01A 4RW7A 4E7JA 3TAEA 1D5AA 1HQUA 3CM6A 4CF9A 1X9WA 4O4GA 3PO5A 1JLFA 3OYGA 3ZT0A 5KRSA 3OY9A 3VQDA 4BE2A 2O4IA 3AVAA 3D45A 3VQ9A 1JLQA 4EP5A 1REVA 4F8RA 4B9LA 4CJWA 4DU4A 4DF4A 1N6QA 2ZQBA 2HHSA 4FLUA 3V9XA 1IKXA 3RMDA 1NOZA 2OPRA 1WAFA 2D5RA 3OVNA 1ASWA 4IG3A 1I3AA 4AHTA 4CEEA 2PY5A 4HCBA 3CYMA 5EU7A 3MEDA 4CJUA 4JS5A 3K57A 4BACA 5HROA 1KSPA 1SL0A 4DTRA 1W9HA 4CHZA 4N5SA 4FZXC 1BGXT 3DRSA 3CQ8A 1BL3A 4CHNA 3L2UA 1DTQA 2O4GA 2Z1HA 3AVGA 5CZ2A 4CHOA 4OKKA 3NH2A 1S9EA 1RBTA 1X1PA 4KO0A 4H8KA 4DTPA 5JS2A 4OJRA 1JLBA 3QEPA 5DK5A 1TKZA 4OLBA 4ZTFA 2KFZA 1TV6A 3HJFA 3MXJA 4WE1A 3CFRA 1WAJA 5HBMA 2YHBA 3AV9A 3SV3A 4K8ZA 1HJRA 4FLZA 4BDYA 1KCFA 3AVKA 1XI1A 1IO2A 4RW8A 4DFJA 1C0UA 4C8KA 3SPZA 4CJEA 3AVCA 4PY5A 4CGJA 1WNSA 3ZSXA 3L2WA 3KKRA 4DF8A 2F8SA 1HNVA 2D0AA 2IS3A 2RN2A 3AO5A 4NCBA 3QETA 1KLNA 3LP1A 3HT3A 4HHTA 4Z4CA 3OYHA 2P5OA 3AA2A 4DTSA 1F21A 5C42A 2Y1JA 3HP6A 1JLEA 4W5QA 3PX4A 1VSIA 4FJHA 4RW4A 4YNQA 4FJMA 1JXEA 2XRIA 3OYAA 5E41A 3NGIA 2HVIA 4Q0BA 1NKBA 2OA8A 1Q9YA 3NFAA 2X6SA 3OYCA 1ZBIA 4CJFA 4YFUA 4M41A 3O4QA 1JL1A 3NGZA 2QKKA 4M3WA 3OYKA 2IOCA 1CXUA 3ALYA 1Y97A 1FXXA 3DLRA 3QEWA 1SV5A 3L3VA 1ASVA 2PYJA 3WNHA 1RDAA 1TKXA 2G8UA 1QE1A 4PA1A 3CFOA 4M3XA 3T1AA 4FJ5A 4NYFA 3TAGA 1A5VA 4RG8A 4RW6A 3G0ZA 1S1TA 2G8HA 2IGIA 1WN7A 5HRSA 4AHVA 2WOMA 4FM0A 3C94A 2A1RA 3LP0A 1WSHA 2P5GA 4FJIA 2BE2A 4H4MA 1LAVA 4B9SA 3O3GA 3P83D 5SWMA 1NK4A 3KK2A 4CCHA 1BHLA 1VSLA 4CEAA 2EX3A 1JLCA 3I8DA 3V9WA 2HHWA 3ZSZA 4E89A 1RDDA 3AVBA 3LZJA 4ELUA 4DS5A 1CXQA 3PV8A 4CE9A 4BDPA 2GUIA 2E4LA 4HUGA 4PUOA 3SPYA 4CJVA 4CEDA 1U49A 4NCAA 4LH4A 4CF8A 3SZ2A 4KI6A 1VSFA 4LD0A 4NCGA 4B9VA 1RBUA 3TANA 3O3FA 1B92A 2WONA 3AVMA 1RTJA 1VSEA 2BANA 4EZ6A 1S6PA 2LSNA 3OS1A 5J2NA 4Z4IA 3DOKA 3QO9A 4CGDA 3THVA 1TK8A 3DRPA 1TAQA 3OYMA 3DLBA 2ETJA 2GBZA 4OPJA 3IRXA 1BCMA 2D0BA 4M3YA 3EY1A 5KTQA 1Z26A 3QEIA 3L2QA 1UA1A 2HHUA 4C8NA 4FLTA 2GV9A 1C0MA 4KTZA 1VRTA 3ZT2A 4CJPA 4HUEA 4CEOA 1BISA 3HL8A 4DFPA 4W5NA 3RR7A 4E7LA 2HVHA 1BCOA 1EETA 4I7FA 4B9MA 3QNNA 4ZTJA 2FBVA 1TL1A 1KVAA 1LW2A 4CJLA 5J2QA 1U45A 3CG7A 3ZT1A 4E7HA 3G10A 1C0TA 2YNGA 1BIUA 4FW1A 4FJ8A 3HP9A 4DSEA 3V4IA 1T05A 5CYQA 3O4NA 3PX0A 3DI6A 3TAFA 1NKEA 3HSTB 3K58A 5KGWA 3QERA 2DFHA 4M3RA 1EX4A 1WLJA 3ITHA 3SUPA 2G8KA 3RMCA 4KHSA 5HRPA 4PQUA 1VK0A 3KD1E 3JYTA 4Y1CA 3NF6A 2XY8A 1IKYA 4CFCA 2VG5A 1S1VA 1S1XA 4I2PA 2G8VA 3KD5E 4FZZA 3T3FA 1C1AA 1B9DA 2D0CA 3HVRA 1Q9XA 3K5LA 3KIOA 4O55A 4CEBA 1SL1A 1FKOA 4TSXA 3WNEA 3AA5X 3FFIA 3NF8A 3K5NA 1X9SA 3AVLA 3C95A 3RTVA 1UA0A 4ICLA 4CJQA 4ELTA 1Z25A 4GW6A 3V1RA 1NK8A 3KLHA 1TL3A 1ITGA 4J2DA 3B6OA 4F2RA 3ASMA 4DLGA 3NE6A 1T8EA 1CZ9A 3V1OA 4DU1A 2ITGA 3M8RA 2PYLA 3L2RA 1LWCA 3VA0A 3HYFA 3H08A 3BGRA 3K59A 3KLGA 1HYSA 3LZIA 1KFSA 4O0JA 2HB5A 1QTMA 4CJSA 3ZSRA 1VSKA 4Y1DA 4CF0A 4CF1A 3NDKA 4DTOA 3TARA 1UAXA 4EZ9A 1D8YA 3DLGA 2X74A 3V9ZA 1KTQA 3VQ7A 4FJLA 4Z0UA 5CY4A 2OZSA 1QS4A 3TWHA 3TAMA 2XY5A 1L3UA 4BE0A 1D9FA 1HPZA 1Q8IA 4Z4FA 4F3TA 5I42A 4C8MA 2AJQA 4IFYA 4CFBA 4LH5A 4DS4A 5K14A 1C1CA 4C8LA 1L3VA 4N41A 1JKHA 2KZZA 4B08A 5HRNA 3NH0A 4KI4A 4CGHA 4IG0A 1DTTA 2HNDA 3KLIA 3VQBA 5DMRA 1W0HA 4M45A 1RTHA 4CJTA 3OYNA 4KB1A 5J1EA 3L8BA 3QEVA 1XHZA 3OYDA 3QESA 3OYBA 3ZSWA 4OVLA 4DTXA 3SQ2A 5HP1A 4KFBA 4B9TA 1L3TA 4FJ7A 2JLEA 4BWJA 4DMNA 4LSLA 4DQQA 1BIZA 2OYQA 2YKNA 3DYAA 4IFVA 1BQNA 3RMBA 1C6VA 3RWUA 5JS1A 3TI0A 1RBRA 2HHQA 1RT6A 1YT3A 4W5OA 4JLHA 1RT7A
chains in the Genus database with same CATH superfamily
1VSHA 1KC8O 1IH7A 4IXCA 4IKFA 1YF5L 2KFNA 5AQUA 1BWFO 2PFUA 1E4FT 4NYNA 4CK2A 3DXMB 2Q36A 4JI7K 2A1SA 1LV5A 2NUBA 3BF3A 3C7NB 3DLEA 3VF6A 4FJJA 3QEXA 1XNRK 1D9DA 4Z4HA 2OPPA 3VEWA 1XMQK 5FRMA 3OS2A 4F2SA 5HRRA 4H0YB 1GOAA 4IBNA 3O3HA 1ZBLA 4DSJA 1LAWA 2KQ2A 3HPGA 4AHUA 1QHAA 4BGAA 4WQ4A 3QDKA 3RRGA 2WBNA 1DEJA 2QWOA 1R0AA 4FK0A 4DQ8A 5FPMA 4CBWA 3QICA 1TGOA 2G8IA 5KPZA 1VQNN 2GWJA 3AA4A 1BA1A 5AQGA 1BI4B 4KREA 3U9ZA 1OH8A 4LF9K 4IDKA 1ZBHA 3OW2M 4H5WA 3ZLJA 1VSDA 3UKRB 5KQ8A 3AVJA 4DQIA 2HNYA 4DR2K 3FZKA 3TAPA 1NK6A 5JICA 4B8AB 2YJEA 1KVBA 1BA0A 2V7ZA 4C1NI 5KI6A 4PKHA 3S3MA 4CIGA 1JXBA 4ISEA 4OPKA 3BDPA 2Z1GA 3MWPA 4M3TA 1EP4A 4FK2A 3VN5A 2BGGA 1IG8A 3HI0A 4O44A 1CZBA 1NGAA 2Q31A 1YTUA 1NBWA 2F96A 3C6TA 4FYDA 3ULDA 3SBTA 3A5NC 3LDSA 3AVHA 4JS4A 2FBXA 3O6WA 1NGHA 3AO4A 4DFKA 3VQPA 4BWMA 5J2PA 4B9NA 2P9NB 3W0LA 1NK7A 2HMIA 1DGKN 5KGXA 4JKHA 4I6MB 2HHTA 4M7YA 4K25A 2P9IB 3OJSA 2PBDA 2YHAA 4DSKA 3MECA 4CVNE 3L6QA 4BRNA 4JD2B 2BH1A 4JRQA 3MWTA 3CCEN 4KKOA 1X9JA 2GWKA 1RT3A 3TU5A 1I39A 2YNFA 5AQMA 4N56A 1VQ5N 3MDQA 3ZSYA 4B3SK 4JKFA 3P31A 1MDUB 3V6DA 1FK9A 3DRRA 4BRLA 4AQYK 3O9UA 1NG9A 3IS9A 3LPTA 3NF9A 3AARA 4JK8A 3SAHA 3NF7A 4FJNA 3P1GA 4BG8A 2E88A 3CPWM 3PUFA 5AFUA 2GX9A 3QINA 2O8EB 1Q18A 2VWBA 1JLGA 4DB3A 1KFDA 2E2OA 1BUPA 3CM5A 4IEIA 4MLHA 1A5XA 1NGCA 3M8PA 5LJWA 1A5WA 1IBKK 1UWBA 3AO2A 4CERA 1LWEA 1ASUA 1NK0A 4DR4K 3E66A 1J6ZA 3L2VA 2ASOA 3Q7BA 2RHKA 3HM8A 3SNNA 2V52B 4KHPK 4BRKA 4X65K 1GOBA 4O8KA 4W5RA 4DKWA 3M8SA 1TK0A 1FJGK 5EOYA 4AH9A 1LCUA 2E6LA 1IG9A 4J2AA 4CGGA 2R7YA 4RCHA 3NH1A 3ULEB 5AZJB 4CK3A 1N32K 1NJZA 1QSYA 2JGUA 3WNGA 3R6MA 5AQXA 3OYLA 3ENHA 3RVCA 3HK2A 4WF9L 1HKCA 4FWPA 4DR3K 3ULEA 1NGDA 3MX2A 4B3OA 4GVMA 4I9QA 3CHWA 1FW6A 2CGKA 4CJ5A 4FWQA 1XWLA 3PIPL 3ZETB 3DOLA 4JKDA 5CZ1A 5C15A 1SKWA 5E26A 4MO5A 3DM2A 1K73O 1IV0A 5AZIB 3VEOA 3RSEA 3TAEA 3T1YK 4H0OA 5KPRA 2DPNA 2P9PB 3OYGA 3L4QA 3D45A 2VGMA 4IFEA 4PKIA 4B3MK 1REVA 4BRHA 2HHSA 3ENOA 1IKXA 3RMDA 3VGLA 3CCJN 4AHTA 2PY5A 2HHHK 2FSKA 4BACA 2ZJRL 4DTRA 3ID8A 5HL7L 4BREA 4YOVA 3CQ8A 2O4GA 3AVGA 4CHOA 1T6CA 4LC9B 4OKKA 5LY3A 4YDUA 3THXA 3SK3A 4OLBA 1TKZA 4GVEA 4ZTFA 1TV6A 2NRRA 3MXJA 3FZMA 4CI6A 2YHBA 4FLZA 3CCQN 3AVKA 3T69A 4DFJA 1C0UA 2O8FB 1XMOK 4BRAA 4CJEA 1RFQA 3AVCA 4CBUA 3AO5A 3QETA 3H3NO 3HT3A 3THWA 2P5OA 5CE3A 3PSFA 4C23A 5AQJA 3J7ZO 3PX4A 2UU9K 3CF5L 4ILHA 2UUBK 3UKUB 4IJAA 5E41A 2HVIA 1RDWX 2OA8A 5HOOA 4M41A 3NGZA 4M3WA 4DV7K 4H5NA 1CXUA 1SV5A 3I56N 2BUPA 1P90A 2G8UA 4WCEL 1BU6O 4NYFA 2QM1A 4U67L 1WN7A 3WXIA 3D2EB 4DV0K 4B9SA 2D0PA 4X62K 3VF2A 5SWMA 1NK4A 1BHLA 4CEAA 4OPHA 4EAHD 5FPDA 1HKGA 2UYTA 4CEDA 2QWNA 4O8UA 1VSFA 4CZKA 4FOEA 5F1XA 3KHYA 1VSEA 3D7EO 3J81O 5AQHA 3QO9A 1VQ6N 5GIOA 2GBZA 3IRXA 2D0BA 1Z26A 1BDGA 4A5BA 4C8NA 1S72N 1C0MA 1VRTA 3BZCA 4FWNA 1ZC6A 4E7LA 4IWVA 2HVHA 1BCOA 1ILYA 3QNNA 1TL1A 1KVAA 5J2QA 3FGUA 3CG7A 2YNGA 4FW1A 4KH6A 2GEMA 3J7AP 4JYAK 3F5TA 1R59O 1YJWN 3KD1E 4Y1CA 3NF6A 1X3MA 2VG5A 4I2PA 4FWLA 3T3FA 1W97L 1KD1O 1SL1A 4TSXA 2KKZA 3K9JA 3HTVA 5F2RA 3CC4N 5AQPA 4ELTA 3B6OA 4A61A 4DUYK 4DLGA 4FWOA 5IT9O 2PYLA 4BRCA 1NJIO 5IWAK 3ATVA 3H08A 3TTDA 4CJSA 5DM7L 3HZ6A 4CF1A 3NDKA 4DTOA 5KQDA 2D4WA 3V9ZA 2IIRA 2YJFA 2W41A 3TWHA 2XY5A 3O9TA 3R1XA 1HPZA 2P9SB 2YX6A 4F9OA 4LH5A 3MCPA 1L3VA 1JKHA 3VERA 4BY9C 3NH0A 1MWKA 3G25A 5JLHA 3CJ7A 4JHDB 4EHUA 1RTHA 1XHZA 3MK6A 3OYDA 3SAFA 4DTXA 3SQ2A 4B9TA 4FJ7A 3AY9A 4BWJA 4DMNA 4JI8K 2OYQA 4DQQA 2YKNA 1YHQN 4DR7K 1C6VA 1N36K 3RWUA 1RT6A 4KTQA 4W5OA 2Y1JA 2QWPA 1NMDA 4FCYA 4DQPA 1LW0A 4DLEA 3LWLA 1JL2A 3HPHA 1IKVA 4CECA 1WBDA 2FXUA 2Y1IA 3K5MA 4GV6A 3M8QA 3LDNA 1KRPA 3O5BA 2ZGYA 1NJXA 1HUXA 1RTDA 3HOTA 3CCVN 2UXCK 4G1QA 5AJ3K 3UIQA 4RWTA 4DUZK 1S1WA 3SUOA 4ELVA 3P5JA 1VSMA 4CZGA 4M3UA 3SUNA 1VQ8N 1QZ5A 4CBXA 3NGYA 4CGIA 2NRTA 5SZTA 3LM2A 4NXNK 1SAZA 3CPEA 3F73A 5C2FA 4JKEA 4E7KA 2HNZA 5BPNA 2ASPA 4IZ9A 3SQ4A 1RT4A 4BE1A 4DSLA 3K9KA 4B1XB 2NRXA 3SUQA 1NKCA 2JWLA 3AO3A 3AVFA 3S3NA 1XHXA 4DR1K 1YUWA 1ZYQA 4M3ZA 3CCUN 3C6UA 4B3TK 4ILGB 5JVHL 4CESA 3S9HA 2P1JA 3LAMA 4KHYA 3U3GA 3VMFB 4FZYA 3LL3A 1HRHA 4KTWA 1QSLA 2F9TA 3VTIA 2IDOA 3I0SA 4DV4K 3L0QA 1K9MO 3QFPA 1OVQA 2VG6A 5I3UA 3KLEA 4LFAK 3SMPA 4O5BA 1SS6A 4BRIA 4M7XA 1QQCA 1T7PA 1IKWA 3QMLA 1X9MA 3ZSOA 5BRFA 2EWSA 4H5VA 3HM9A 5LMNK 3K2PA 4AHRA 3V1QA 3VQ8A 1K6YA 2HOEA 3KK3A 4FM2A 2ASMA 1NK5A 3O8MA 2W6KA 5FROA 4AF1A 4OX9K 2P9PA 3FZFA 4DHYA 1NGBA 4I2QA 4FVMA 3BP8A 4CZIA 4FJKA 1RNHA 4K42A 4K43A 3D0PA 2FLOA 1S6QA 5AQIA 1OH5A 3FZHA 1O13A 1TUYA 3VETA 4K0KK 4DSFA 3JAMO 4IEEA 2QWQA 5C24A 3M5RA 2HBJA 1VQON 2OANA 1U4BA 1NJWA 1O1WA 3EN9A 1LOTB 3TR8A 1JLAA 3WXMB 1YJNN 1NM1A 2P9KB 1K8KA 4KH4A 5M1KA 2WC9A 3D6RA 4KHUA 4KV8A 4IOCL 3LAKA 4H0PA 2NZTA 1TVRA 4L8RB 4DTJA 1RT2A 3SCXA 3OJUA 2UUCK 4LFCK 1KVCA 3CQXA 4I6MA 3ZEUA 2E6MA 4N76A 4B9QA 5KRTA 5EXWA 2ZD1A 4Z94A 4OKJA 3S3OA 4LY7A 4OGEA 1TYQB 4KHNA 4KAZA 4AM6A 4CFAA 2HW3A 3MAQA 4FK4A 4DQRA 4MLEA 4YDUC 4F3OA 4BVOA 1NU0A 4M42A 4NLBA 2P9UB 1T44A 4EP4A 3H1QA 3LWMA 2FF3B 4DU3A 3ZYYX 4E7IA 3GG4A 5BREA 1JJ2M 1SKRA 1OH7A 3IG1A 2QXFA 2XY7A 3NHGA 1C0GA 3QBWA 4BRFA 3LALA 4DFMA 4BR5A 2E8AA 1MU2A 4DR6K 4JI0K 2O8BA 2NNWA 2IVNA 3AO1A 2QWRA 4DG1A 1RCHA 2X6NA 3LP3A 3E01A 4RW7A 1HQUA 3U4LA 3HSCA 1JLFA 3KVGA 3C0BA 4A62A 4B1WB 4EP5A 4DU4A 2E2PA 4XH4A 4FLUA 4YOUA 1WAFA 1P8ZA 4IG3A 1I3AA 4A2BA 5C0YA 5BN9A 3CYMA 5EU7A 3ZX0A 4JS5A 5HROA 1KSPA 2WFBA 1W9HA 2P9SA 1YITN 4KH5A 4LF7K 1N8RO 3NH2A 5BPMA 1S9EA 4OJRA 3CI5A 1JLBA 3KWIA 4AM7A 2VGNA 5HBMA 3ZX2A 4NO7A 4NB4A 1IO2A 4RW8A 3CERA 4C8KA 1XUPO 1IBMK 3EKSA 4Y0WA 3RSEB 5M1PA 4CGJA 5AQLA 2NRZA 3L2WA 2RN2A 3THYA 2NRVA 3OYHA 1NNEA 4DTSA 1F21A 3BY5A 5C42A 1VSIA 1VQ9N 2XRIA 4WFBL 3THYB 3NFAA 3OYCA 3NMUA 3O4QA 1JL1A 3ALYA 1Y97A 5AFUH 1Q86O 1JCFA 3WNHA 1RDAA 1TKXA 4H03B 2NLXA 4FJ5A 4BRPA 1QVGM 5C10A 3ATUA 4FM0A 4AHVA 4R79A 4DV6K 3O4WA 3LP0A 1WSHA 4FJIA 4BVPA 3O3GA 2ZF5O 2O8DB 4CCHA 1VSLA 2EX3A 1JLCA 3EKUA 3WEEA 3ZSZA 1YVNA 3LZJA 4ELUA 4DS5A 3H46O 1SQKA 2E4LA 4PUOA 3MCAB 3TTCA 4C1NK 3TANA 1ATNA 2WONA 3AVMA 1RTJA 2BANA 1T6DA 3TSPA 1S6PA 2AA4A 2LSNA 4X64K 5J2NA 3DOKA 5TKWA 3OYMA 2E1YA 4M3YA 3JS6A 3QEIA 1UA1A 3IUCA 2HHUA 5JLFA 4FLTA 4HTLA 3TPQA 4OO1J 2HSTA 3ENBA 3ZT2A 4CEOA 3HL8A 2Q1NA 3RR7A 3CCLN 3CCSN 4B9MA 1KQSM 3ZT1A 2O8FA 2J4RA 3G10A 3OBYA 1BIUA 3CXCM 2P9NA 3PX0A 4XH1A 3TAFA 3ITHA 1EWRA 1M1KO 1NGEA 3SUPA 3EE9A 4E1JA 1V4TA 3JYTA 4DV2K 1IKYA 4CFCA 2G8VA 1S1XA 1B9DA 3EZWA 4KBOA 3K5LA 4G9ZA 3WNEA 3NF8A 2HF4A 3C95A 1UA0A 1Z25A 4GW6A 3DLLL 3KLHA 1TL3A 1ITGA 2E1ZA 3ASMA 3NE6A 4GKJK 1CZ9A 4DU1A 3CJBA 1BG3A 3NVMA 2PAVA 4XEIA 4O0JA 2HB5A 3ZSRA 4CF0A 2UUAK 4OPAA 2D1KA 4FJLA 4CD1A 1GLJO 2OZSA 3TAMA 4BE0A 1GLLO 5I42A 3IFRA 3GBTA 4C8MA 4C8LA 1C1CA 4N41A 3BF1A 5HRNA 1VQ4N 3E9OA 3I33A 5BR9A 1Z05A 3KLIA 3OYNA 5AQQA 5AQZA 3AAQA 3QEVA 3QESA 1HR0K 3SBGA 1BIZA 4BRMA 1RBRA 4DCHA 3CMEN 1VRUA 3KJVA 3VOVA 3I0RA 4WFNL 4DQSA 3FLCO 1MWMA 3WQUA 3BZKA 2RF2A 5C12A 5J2MA 3VEZA 4BC2A 4R5PA 3PY8A 3MXMA 3P4IA 2UXBK 4E1NA 4NLCA 3JXUA 3VF4A 1RTIA 3VGKA 3WXKA 1HKBA 3OYEA 1EKEA 2XY6A 1GLCG 3QFUA 1IBLK 3AVIA 4JHDA 1ZBFA 1TKTA 4FPAA 3NCIA 2O8DA 4PL7A 1QQMA 2F7TA 4FJXA 3VA3A 3OBWA 1TYQA 3L4IA 5GIPA 4GMJB 2G8FA 3DMJA 3AA3A 3F2KA 5FDLA 4AHCA 3OYFA 1MA9B 3DXKA 3FZLA 2VWJA 1VQPN 2VCPA 1J53A 1HQEA 1U47A 2F8TA 2IAJA 5FPNA 4CHQA 4XIUA 4DTUA 3VQEA 1RBVA 3FFKB 4FW2A 3I55N 1J5OA 3CIPA 2E5LK 4BR7A 2EHGA 1TK5A 2OPSA 3DJCA 2YNHA 2HHXA 3CJ9A 3ZSQA 1EXQA 3NBPA 1Q7YO 4BR2A 4MDAA 2OZMA 3EL2A 3KK1A 4JI4K 1YJ9N 2VWKA 2FBTA 1HPMA 3T19A 4CK1A 5CR4A 2YCHA 4K8XA 4H4OA 4O5FA 1U2VB 2X78A 4DV1K 1OH6A 3O1WA 4IOAL 5AQVA 1QZ6A 3ZT3A 4O0IA 3OS0A 4DTNA 2OPQA 4DV3K 5AQWA 4W5TA 3EEQA 2I5JA 4CIEA 2DTUA 2ZE2A 2YV0X 3A5MC 1NK9A 3CD6N 3VTHA 3PO4A 3CC7N 1SL2A 5BRHA 4CZLA 4J2EA 1FKPA 2YHYA 2RKIA 2G8WA 1NOYA 1E3MA 4QCLA 3RRHA 3OYIA 4UQGA 3E9PA 4M63C 3CCRN 4H0VB 3S41A 4YY3K 1WSJA 3VQQA 1SUQA 2ATQA 2P9LA 1WOQA 2ZJQL 2GTDA 3MN9A 1VQLN 3MEEA 1HNWK 3THXB 3UE5A 4CGFA 3KK7A 4BDZA 2VG7A 3QLHA 3KTQA 3ZEUB 4YOYA 1ZBSA 4FM1A 3TABA 4Z4GA 4UY8O 5BR8K 4B1UB 4FWKA 3VEYA 4MFBA 3MMVA 1U48A 4Q5VA 3HO1A 3L3UA 1TAUA 1NJYA 3D2EA 2F4VK 4CF2A 4J2BA 2Q97A 3TSQA 3ISNC 5FPEA 5AZJA 1YTAA 3QIPA 4OLAA 1S22A 1W7AA 1Z6RA 1SKSA 3BUZB 1RT5A 1N34K 1Q82O 1RBSA 4JNEA 5ADXH 4AHSA 4IO9L 4FPBA 2BDPA 1GLFO 2YNIA 1XQSC 2XHBA 5B8HA 4HTUA 4GV3A 4CZEA 4ILJA 3NAEA 2KW4A 1EWQA 5D3GA 3C65A 2YKMA 2B6AA 5AQTA 3WNFA 3ZT4A 4J8FA 4CZFA 1RDCA 2B5JA 4CEFA 5FRNA 3A2FA 4HCCA 5A2QO 4PHTX 4CJ3A 1KAXA 1BO5O 4FO0A 3IMXA 4E1MA 2A3ZA 1T3VA 2P51A 4B8CA 3CCMN 3MXIA 4PKGA 4ID5A 3SAGA 4YHHK 1HNIA 3V9UA 2VQEK 1J9AA 4FJGA 4N47A 4FLVA 4DSIA 2FSJA 4HUFA 3GDQA 4XH5A 3CMAN 4KB0A 4FLWA 5F0XA 1D5AA 3CM6A 4CF9A 1X9WA 4O4GA 1V4SA 5C2DA 3CJCA 5KRSA 4BE2A 2O4IA 4B1VA 5M1FA 3AVAA 3VQ9A 1JLQA 4F8RA 4B9LA 5AQFA 2ZQBA 3V9XA 1NOZA 2OPRA 1RGIA 3OVNA 4YOTA 1HNXK 2A41A 1VHXA 4FVUA 4N5SA 4FZXC 3DRSA 2QI2A 1BL3A 4CHNA 3J7YP 3L2UA 5AQNA 5CZ2A 4BQLA 4H8KA 1RBTA 3DWLA 4DTPA 5JS2A 4CD3A 5DK5A 4WE1A 3CFRA 1WAJA 3AAPA 4JI6K 3SV3A 4K8ZA 2V7YA 1KCFA 1EQYA 3MN5A 1YAGA 3KZBA 4PY5A 2Q0UA 1WNSA 4DF8A 1HNVA 2D0AA 2IS3A 3CETA 4NCBA 3PLAA 1NGFA 1KLNA 4HHTA 3VEXA 1I94K 4FJHA 4YNQA 2FF6A 3O9RA 3A8YA 4FJMA 4WQ5C 3OYAA 4EHTA 3NGIA 4LFBK 4Q0BA 4LF5K 1Q9YA 2X6SA 2P9IA 4YFUA 2QKKA 2W6LA 3A0IX 4FL9A 1NMNA 3OYKA 3DLRA 1DKGD 5FLXO 3L3VA 1ASVA 3K0SA 2YHWA 2A40A 4M3XA 2O8BB 3T1AA 1A5VA 3IKMA 4RG8A 3G0ZA 1S1TA 2G8HA 2O8CA 2WOMA 3C94A 2A1RA 2P5GA 3I8BA 1LAVA 5AQYA 3ZX3A 3KK2A 3LDOA 3I8DA 1C0FA 2HHWA 3M6GA 3AVBA 1ZBIA 4BDPA 1CXQA 2ITMA 1X3NA 4CE9A 2GUIA 4HUGA 3SPYA 1U49A 4ISGA 4CF8A 4KI6A 4H0TB 4LD0A 5TKYA 4NCGA 4JKCA 1RBUA 2H3GX 3HRGA 1NGJA 4EZ6A 3VESA 4WYBA 2W40A 3MN7A 3QB0A 4JI1K 4CGDA 3BEXA 3DXKB 2HF3A 3DLBA 4K41A 1GLEG 4OPJA 3CJ1A 1VQMN 4FWSA 4PL8A 3G4SN 5KTQA 3L2QA 1HNZK 3H6EA 2GV9A 4CJPA 4DR5K 1U6ZA 1BISA 3WT0A 4DFPA 4W5NA 1HLUA 2D0OA 4ZTJA 3H1VX 4E7HA 1C0TA 3GOIA 4FJ8A 3HP9A 4DSEA 3V4IA 1CZAN 5CYQA 3O4NA 1VQKN 4JEPA 3TSUA 2FSNA 1M90O 3CJAA 3RMCA 2G8KA 1XC3A 1VK0A 5GADP 5AZIA 1S1VA 4YORA 1C1AA 2D0CA 3HVRA 1YIJN 1U2VA 5ADXA 4CEBA 1GLBG 1FKOA 3FFIA 1X9SA 2HBMA 3AVLA 3RTVA 4CJQA 3V1RA 3GL1A 4F2RA 1T8EA 3V1OA 3M8RA 4BC4A 1N33K 1LWCA 3KLGA 1HYSA 1KFSA 3DXMA 3SLCA 2HMPA 1QTMA 2UXDK 1H1VA 3TARA 1UAXA 1D8YA 3DLGA 1Y64A 3T7ZA 2X74A 4LF8K 4Z0UA 3G71N 5CY4A 1GLAG 1QS4A 4BGBA 3F9MA 1L3UA 2KHOA 2CH5A 1D9FA 1Q8IA 4Z4FA 2OTLN 2AJQA 4JKBA 4DS4A 3LDPA 5BRDA 1BOTO 4B08A 4CGHA 4IG0A 1DTTA 2HNDA 5DMRA 1W0HA 4CJTA 5J1EA 5HP1A 4KFBA 1JCEA 4LSLA 3SJHA 4JKGB 3DYAA 3TI0A 3WQTA 3U9DA 5AR0A 1YT3A 4JLHA 1RT7A 4KHQA 3J8AA 4EIAA 3AVNA 2IC3A 1VAZA 4CZHA 4E0DA 2KZMA 3W3DA 4CEQA 5GAGP 3EYZA 3KLFA 3F9KA 5MLCQ 1WSGA 4IJNA 4RW9A 5EX5A 4ISFA 3B6PA 3C6AA 4BG9A 3OYJA 5LMUK 3R3LA 4LF4K 1DT9A 1WB9A 4JK7A 3VGMA 1WSIA 1HYZA 1J54A 2Z1JA 2QK9A 1E4GT 2Q2RA 2VYPA 3C7NA 3OTOK 3THWB 2GUPA 2QW9A 4JRPA 1OKJA 1U04A 2OCEA 2WTUA 4JD2A 3WXJA 3SYZA 1ESVA 4V19S 2HHVA 3HVTA 1HX1A 1ZBUA 3N4PA 3RMAA 1YI2N 1QSSA 2A6AA 3E9LA 5JMVA 4C8OA 3O80A 4RTFD 3TAQA 1XC9A 1NWKA 2PZSA 3KKSA 2DFFA 1VQ7N 3EZ5A 3JSMA 4IOXA 2O8EA 3IAYA 1GOCA 3P39A 2Q3SA 3EE8A 1S5JA 5M1OA 1RT1A 2WUSA 1LWFA 2XO7A 2HBLA 3WXLA 1K8AO 1D4XA 4LSNA 4YOXA 4OGCA 1KAZA 1QQNA 4ZHRA 1EO1A 2KTQA 1G15A 2YI1A 3V9SA 4I9LA 4MDBA 4DTMA 1DLOA 4JI2K 4HVJA 2DY4A 4F4KA 4ID1A 3IDHA 4QS7A 2QA4N 3HXMA 4CEZA 3UB5A 4BQZA 4CHPA 5C25A 1TUUA 3PX6A 4H5TA 1WUAA 4CHYA 4PWDA 1QHTA 3SMSA 3PSIA 1WSFA 4CJ7A 4E19A 2I7PA 3SJJA 1HYVA 1UOCA 5HLFA 2FC0A 1L3SA 2B4JA 5AQSA 4E3SA 3QNOA 3A5OC 1N5YA 1S9GA 4BC3A 3VQAA 4U7BA 4KHWA 2IVOA 3PIOL 4HWIA 4WFAL 4JK9A 3QIOA 1TKDA 4FJ9A 5GINA 1HJOA 3VQ6A 4A2AA 2Q0RA 4H5RA 4FLYA 1HMVA 3SQ0A 1QQOA 3FE1A 3TTFA 4CJRA 3WEEB 1KLMA 4B9UA 2ZWHA 4GY2B 3VQ4A 1L5UA 1S1UA 2CGLA 1YVUA 2DFEA 3ZSVA 4WQ4C 3CC2N 5M1NA 1SZ2A 2Z1IA 2CGJA 4OKEA 4CJKA 4QOZB 2CH6A 4FLXA 3LPUA 1C1BA 4QAGA 4CW7B 3ZETA 2RPIA 4JI5K 1BI4A 2E2QA 1NGIA 3MEGA 3HPOA 4WQ5A 3K5OA 3SV4A 2FBYA 5H1SQ 4MQ3A 4DWIA 1CLQA 1G99A 3DAWA 3VQCA 1VSJA 2GELA 3DLKA 3UKRA 1B9FA 3QBXA 5CYMA 5KPTA 1RDBA 1RILA 4CJ4A 2QEXN 3MX5A 4FXDA 4AILC 3B8AX 4BRGA 2ZM6K 4JKAA 4KRFA 2AP1A 4H0XB 4CIFA 4KPYA 3M1FA 1WSEA 3AGKA 4MO4A 3VQ5A 4BROA 2W42A 3V81A 5T7BA 3OHRA 1T03A 4FSVA 4B3RK 1BQMA 2A5XA 3LP2A 3SI6A 4CFDA 3N4QA 3SQ1A 3RR8A 5AQRA 5LL6Z 3U3YA 4NXMK 3CFPA 3DLHA 3U6FA 2HBKA 3LANA 4GKKK 4E7JA 5GAHP 3ZCMA 1XNQK 3PO5A 4A5AA 2F9WA 1ATSA 3ZT0A 3OY9A 3VQDA 4CJWA 3M3ZA 4DF4A 1N6QA 5M1QA 3WUHA 4CEEA 2D5RA 5JVGL 1ASWA 4HCBA 3AGRA 3EO3A 3MEDA 3O9SA 3ID6A 4CJUA 3K57A 3VPZA 3C6HA 3HOSA 1SL0A 4CHZA 3G6EN 1BGXT 2YHXA 1DTQA 2Z1HA 2KLAA 4BR0A 4KO0A 1X1PA 4QS8A 4CZJA 3QEPA 2KFZA 3HJFA 2IVPA 4JAXA 3AV9A 1HJRA 4JN4A 4BDYA 3OA9A 2P9UA 3Q7CA 1XI1A 4JKGA 3SPZA 3U8XA 3ZSXA 3KKRA 1ATRA 2F8SA 3LP1A 4BR9A 4Z4CA 3AA2A 5ELZA 3HP6A 1JLEA 4W5QA 5CHIA 3VENA 3HBTA 4RW4A 1J5EK 2P9KA 3O08A 2NRWA 3LDLA 1JXEA 5I9EB 3J80O 4FWRA 1NKBA 4CJFA 2RE2A 2A42A 2IOCA 1QVFM 1FXXA 4FOIA 3QEWA 2PYJA 1QE1A 4PA1A 3CFOA 4LF6K 3TAGA 4EFHA 2QXLA 4RW6A 2IGIA 5HRSA 2BE2A 4H4MA 3P83D 3A5LC 3V9WA 4YOWA 1K8KB 4E89A 1RDDA 2QKBA 3PV8A 5AQKA 4A59A 3NVKA 4CJVA 4NCAA 4LH4A 3SZ2A 5DM6L 4B9VA 3O3FA 1B92A 3P38A 2BTFA 4BRDA 5BN8A 2OTJN 2I7NA 3OS1A 4Z4IA 2ZGZA 3THVA 1TK8A 3DRPA 1TAQA 5AQOA 2ETJA 4A57A 4GV9A 1BCMA 3EY1A 3LM9A 5EVZA 5EY4A 3E1YA 4KTZA 3FR0A 3LDQA 3O1BA 4L3QA 4BC5A 4HUEA 3KWGA 4IDHA 1EETA 4I7FA 2QWMA 3VEVA 2O8CB 2FBVA 1LW2A 4CJLA 1U45A 3H45C 1KAYA 5LJVA 5GAEP 1T05A 3DI6A 4B1ZA 1OVYA 1NKEA 3T1HK 3HSTB 3K58A 5KGWA 2VQFK 2DFHA 4DV5K 3QERA 4M3RA 1EX4A 1WLJA 4KHSA 5HRPA 3O9QA 4PQUA 1NGGA 1JCGA 3GE1A 3KD5E 2XY8A 1RDUA 4Z4EA 4FZZA 1Q9XA 3KIOA 4O55A 3K5NA 3H3OB 3AA5X 1YXQA 2QWLA 4ICLA 4J2DA 1NK8A 3R8EA 1NLVA 2ZJPL 1W2BM 2P9LB 2E2NA 2ITGA 3L2RA 1WBBA 3VA0A 3HYFA 3BGRA 3K59A 3LZIA 1Q81O 1ZXOA 4BRQA 1VSKA 3R9PA 4Y1DA 4EZ9A 1KTQA 3VQ7A 1GLDG 2V51B 3UKUA 4F3TA 2JWKA 2QTDA 2E20A 3CQYA 3MN6A 4IFYA 4CFBA 3D2FB 5K14A 2KZZA 4IO8A 2NRHA 4KI4A 4CZMA 4QS9A 3VQBA 4KB1A 4M45A 4JI3K 4GNIA 4BR4A 3L8BA 5E84A 3OYBA 3ZSWA 1IJJA 4OVLA 4JV5K 4B1YB 1L3TA 2JLEA 3D2FA 1KXPA 4IFVA 1S3XA 1BQNA 4FWMA 3RMBA 4X66K 5JS1A 2HHQA 5BPLA
chains in the Genus database with same CATH topology
1VSHA 4KHQA 1VRUA 3KJVA 3AVNA 3I0RA 1IH7A 2IC3A 1LW0A 4FCYA 4DLEA 3LWLA 4DQSA 4DQPA 4IKFA 2KFNA 1JL2A 4E0DA 3HPHA 2KZMA 1IKVA 2RF2A 4CECA 4NYNA 4CK2A 5J2MA 4CEQA 2A1SA 3EYZA 3KLFA 2Y1IA 3K5MA 1LV5A 2NUBA 3F9KA 3DLEA 3M8QA 4R5PA 4FJJA 3QEXA 1KRPA 1WSGA 1D9DA 3PY8A 4RW9A 1NJXA 1RTDA 4Z4HA 2OPPA 3MXMA 3B6PA 3OYJA 5FRMA 4G1QA 4E1NA 3UIQA 3OS2A 4F2SA 1WSIA 1HYZA 1S1WA 1J54A 2Z1JA 5HRRA 3SUOA 1RTIA 4ELVA 2QK9A 1GOAA 3P5JA 1VSMA 4IBNA 4M3UA 3SUNA 3O3HA 1ZBLA 4DSJA 1LAWA 3OYEA 3NGYA 1EKEA 2KQ2A 4CGIA 2XY6A 4JRPA 1U04A 3AVIA 5SZTA 1ZBFA 1TKTA 3HPGA 4AHUA 3F73A 3NCIA 3SYZA 2QKBA 4E7KA 2HNZA 2HHVA 3RRGA 3HVTA 1R0AA 1ZBUA 3VA3A 3SQ4A 3RMAA 4FK0A 4FJXA 1RT4A 1TGOA 4BE1A 1QSSA 2G8IA 4DSLA 3AA4A 1NKCA 3SUQA 4GMJB 2G8FA 1BI4B 3AA3A 3AO3A 3DMJA 5FDLA 4AHCA 4C8OA 3OYFA 4KREA 3AVFA 3TAQA 3S3NA 1XC9A 4IDKA 1ZBHA 1XHXA 4M3ZA 1ZYQA 2PZSA 3C6UA 3KKSA 2DFFA 2VWJA 3EZ5A 1VSDA 3JSMA 1J53A 1HQEA 1U47A 3AVJA 2IAJA 4DQIA 4CESA 3S9HA 2F8TA 4CHQA 2P1JA 2HNYA 3LAMA 4XIUA 4DTUA 3IAYA 4KHYA 3U3GA 4FZYA 3TAPA 3VQEA 1GOCA 1RBVA 1NK6A 1HRHA 4KTWA 4FW2A 4B8AB 1J5OA 1KVBA 3S3MA 1QSLA 5KI6A 2Q3SA 2EHGA 1TK5A 1S5JA 4CIGA 2IDOA 2OPSA 1JXBA 3I0SA 2YNHA 2HHXA 1RT1A 4OPKA 1LWFA 2XO7A 3BDPA 2Z1GA 2VG6A 4LSNA 3ZSQA 5I3UA 4M3TA 1EXQA 1EP4A 3NBPA 4OGCA 3KLEA 4ZHRA 2OZMA 3VN5A 4FK2A 4O5BA 2KTQA 3KK1A 2BGGA 2VWKA 2FBTA 1TAUA 1G15A 3T19A 4O44A 1CZBA 1YTUA 1QQCA 4CK1A 4I9LA 3V9SA 4DTMA 1DLOA 1IKWA 1T7PA 2F96A 4K8XA 3C6TA 4H4OA 1X9MA 4HVJA 4FYDA 2DY4A 3ZSOA 4F4KA 3ULDA 4ID1A 3HXMA 2X78A 4CEZA 3LDSA 3AVHA 3HM9A 4JS4A 2FBXA 4CHPA 3K2PA 5C25A 3PX6A 4AHRA 3AO4A 3V1QA 3VQ8A 4CHYA 1K6YA 4PWDA 1QHTA 4DFKA 3ZT3A 4O0IA 3OS0A 3VQPA 3KK3A 4BWMA 4FM2A 5J2PA 4DTNA 4B9NA 1NK5A 1NK7A 2OPQA 5FROA 2HMIA 1WSFA 4E19A 3SJJA 1HYVA 1UOCA 4W5TA 5KGXA 5HLFA 2I5JA 2FC0A 4CIEA 2B4JA 1L3SA 2HHTA 4I2QA 3OJSA 4FVMA 4E3SA 3QNOA 4FJKA 1RNHA 2YHAA 2YV0X 2ZE2A 3D0PA 1NK9A 4DSKA 2DTUA 1S6QA 3MECA 1N5YA 3PO4A 1SL2A 1S9GA 3VQAA 4J2EA 1FKPA 2RKIA 2G8WA 4DSFA 4KHWA 4JRQA 1NOYA 4QCLA 3RRHA 3OYIA 5C24A 4UQGA 4KKOA 1RT3A 3QIOA 1I39A 1TKDA 4FJ9A 2YNFA 1U4BA 4N56A 3VQ6A 1NJWA 1O1WA 3ZSYA 1WSJA 3VQQA 1SUQA 2ATQA 3V6DA 1FK9A 3DRRA 4FLYA 3TR8A 1HMVA 1JLAA 3SQ0A 3MEEA 4CJRA 4CGFA 3IS9A 3LPTA 3NF9A 4BDZA 2VG7A 3QLHA 1KLMA 3NF7A 4B9UA 4KHUA 4FJNA 4KV8A 3KTQA 3P1GA 3LAKA 4FM1A 3VQ4A 3TABA 3PUFA 4Z4GA 1L5UA 1S1UA 1TVRA 4L8RB 3QINA 1YVUA 4DTJA 1RT2A 3SCXA 2DFEA 3ZSVA 1JLGA 3OJUA 1KFDA 1KVCA 3CM5A 4MFBA 2Z1IA 2E6MA 4N76A 1A5XA 3M8PA 5KRTA 4OKEA 4CJKA 4Q5VA 3L3UA 2ZD1A 1A5WA 1U48A 3HO1A 4QOZB 4FLXA 3LPUA 4OKJA 1UWBA 3AO2A 4CERA 3S3OA 1NJYA 1LWEA 1ASUA 4LY7A 1C1BA 4OGEA 4QAGA 4CF2A 1NK0A 4J2BA 3L2VA 3ISNC 4KHNA 2RPIA 4KAZA 4KTQA 4CFAA 2HW3A 1BI4A 1YTAA 3MEGA 3HPOA 3QIPA 3MAQA 4FK4A 3K5OA 3SV4A 2FBYA 4OLAA 3SNNA 4DQRA 1SKSA 4MQ3A 4DWIA 1RT5A 1CLQA 1GOBA 1RBSA 4W5RA 3M8SA 1TK0A 4F3OA 3VQCA 1VSJA 3DLKA 4AHSA 4Z4EA 2BDPA 4AH9A 4M42A 4EP4A 2E6LA 2YNIA 1IG9A 1B9FA 5CYMA 2XHBA 4HTUA 1RDBA 1RILA 4CJ4A 3NAEA 4J2AA 2KW4A 5D3GA 4CGGA 3LWMA 3NH1A 2YKMA 2R7YA 2B6AA 4DU3A 3WNFA 4E7IA 4CK3A 4AILC 1NJZA 4FXDA 1QSYA 1SKRA 3ZT4A 2JGUA 3WNGA 4KRFA 4CIFA 4KPYA 1WSEA 3OYLA 3IG1A 1RDCA 2QXFA 2B5JA 3VQ5A 4CEFA 3HK2A 2XY7A 5FRNA 3A2FA 3NHGA 4HCCA 2W42A 4CJ3A 4B3OA 4GVMA 3V81A 4I9QA 5T7BA 3LALA 1T03A 4DFMA 4E1MA 1BQMA 4CJ5A 1XWLA 2P51A 4B8CA 3LP2A 1MU2A 4CFDA 3SI6A 3DOLA 3MXIA 3SQ1A 3RR8A 4ID5A 1HNIA 5CZ1A 3V9UA 1J9AA 4FJGA 3AO1A 4N47A 3U3YA 1SKWA 3CFPA 4FLVA 4DSIA 3DLHA 4HUFA 3U6FA 3DM2A 3LANA 4KB0A 4DG1A 1RCHA 2X6NA 4FLWA 3LP3A 3ZCMA 3E01A 4RW7A 4E7JA 3TAEA 1D5AA 1HQUA 3CM6A 4CF9A 1X9WA 4O4GA 3PO5A 1JLFA 3OYGA 3ZT0A 5KRSA 3OY9A 3VQDA 4BE2A 2O4IA 3AVAA 3D45A 3VQ9A 1JLQA 4EP5A 1REVA 4F8RA 4B9LA 4CJWA 4DU4A 4DF4A 1N6QA 2ZQBA 2HHSA 4FLUA 3V9XA 1IKXA 3RMDA 1NOZA 2OPRA 1WAFA 2D5RA 3OVNA 1ASWA 4IG3A 1I3AA 4AHTA 4CEEA 2PY5A 4HCBA 3CYMA 5EU7A 3MEDA 4CJUA 4JS5A 3K57A 4BACA 5HROA 1KSPA 1SL0A 4DTRA 1W9HA 4CHZA 4N5SA 4FZXC 1BGXT 3DRSA 3CQ8A 1BL3A 4CHNA 3L2UA 1DTQA 2O4GA 2Z1HA 3AVGA 5CZ2A 4CHOA 4OKKA 3NH2A 1S9EA 1RBTA 1X1PA 4KO0A 4H8KA 4DTPA 5JS2A 4OJRA 1JLBA 3QEPA 5DK5A 1TKZA 4OLBA 4ZTFA 2KFZA 1TV6A 3HJFA 3MXJA 4WE1A 3CFRA 1WAJA 5HBMA 2YHBA 3AV9A 3SV3A 4K8ZA 1HJRA 4FLZA 4BDYA 1KCFA 3AVKA 1XI1A 1IO2A 4RW8A 4DFJA 1C0UA 4C8KA 3SPZA 4CJEA 3AVCA 4PY5A 4CGJA 1WNSA 3ZSXA 3L2WA 3KKRA 4DF8A 2F8SA 1HNVA 2D0AA 2IS3A 2RN2A 3AO5A 4NCBA 3QETA 1KLNA 3LP1A 3HT3A 4HHTA 4Z4CA 3OYHA 2P5OA 3AA2A 4DTSA 1F21A 5C42A 2Y1JA 3HP6A 1JLEA 4W5QA 3PX4A 1VSIA 4FJHA 4RW4A 4YNQA 4FJMA 1JXEA 2XRIA 3OYAA 5E41A 3NGIA 2HVIA 4Q0BA 1NKBA 2OA8A 1Q9YA 3NFAA 2X6SA 3OYCA 1ZBIA 4CJFA 4YFUA 4M41A 3O4QA 1JL1A 3NGZA 2QKKA 4M3WA 3OYKA 2IOCA 1CXUA 3ALYA 1Y97A 1FXXA 3DLRA 3QEWA 1SV5A 3L3VA 1ASVA 2PYJA 3WNHA 1RDAA 1TKXA 2G8UA 1QE1A 4PA1A 3CFOA 4M3XA 3T1AA 4FJ5A 4NYFA 3TAGA 1A5VA 4RG8A 4RW6A 3G0ZA 1S1TA 2G8HA 2IGIA 1WN7A 5HRSA 4AHVA 2WOMA 4FM0A 3C94A 2A1RA 3LP0A 1WSHA 2P5GA 4FJIA 2BE2A 4H4MA 1LAVA 4B9SA 3O3GA 3P83D 5SWMA 1NK4A 3KK2A 4CCHA 1BHLA 1VSLA 4CEAA 2EX3A 1JLCA 3I8DA 3V9WA 2HHWA 3ZSZA 4E89A 1RDDA 3AVBA 3LZJA 4ELUA 4DS5A 1CXQA 3PV8A 4CE9A 4BDPA 2GUIA 2E4LA 4HUGA 4PUOA 3SPYA 4CJVA 4CEDA 1U49A 4NCAA 4LH4A 4CF8A 3SZ2A 4KI6A 1VSFA 4LD0A 4NCGA 4B9VA 1RBUA 3TANA 3O3FA 1B92A 2WONA 3AVMA 1RTJA 1VSEA 2BANA 4EZ6A 1S6PA 2LSNA 3OS1A 5J2NA 4Z4IA 3DOKA 3QO9A 4CGDA 3THVA 1TK8A 3DRPA 1TAQA 3OYMA 3DLBA 2ETJA 2GBZA 4OPJA 3IRXA 1BCMA 2D0BA 4M3YA 3EY1A 5KTQA 1Z26A 3QEIA 3L2QA 1UA1A 2HHUA 4C8NA 4FLTA 2GV9A 1C0MA 4KTZA 1VRTA 3ZT2A 4CJPA 4HUEA 4CEOA 1BISA 3HL8A 4DFPA 4W5NA 3RR7A 4E7LA 2HVHA 1BCOA 1EETA 4I7FA 4B9MA 3QNNA 4ZTJA 2FBVA 1TL1A 1KVAA 1LW2A 4CJLA 5J2QA 1U45A 3CG7A 3ZT1A 4E7HA 3G10A 1C0TA 2YNGA 1BIUA 4FW1A 4FJ8A 3HP9A 4DSEA 3V4IA 1T05A 5CYQA 3O4NA 3PX0A 3DI6A 3TAFA 1NKEA 3HSTB 3K58A 5KGWA 3QERA 2DFHA 4M3RA 1EX4A 1WLJA 3ITHA 3SUPA 2G8KA 3RMCA 4KHSA 5HRPA 4PQUA 1VK0A 3KD1E 3JYTA 4Y1CA 3NF6A 2XY8A 1IKYA 4CFCA 2VG5A 1S1VA 1S1XA 4I2PA 2G8VA 3KD5E 4FZZA 3T3FA 1C1AA 1B9DA 2D0CA 3HVRA 1Q9XA 3K5LA 3KIOA 4O55A 4CEBA 1SL1A 1FKOA 4TSXA 3WNEA 3AA5X 3FFIA 3NF8A 3K5NA 1X9SA 3AVLA 3C95A 3RTVA 1UA0A 4ICLA 4CJQA 4ELTA 1Z25A 4GW6A 3V1RA 1NK8A 3KLHA 1TL3A 1ITGA 4J2DA 3B6OA 4F2RA 3ASMA 4DLGA 3NE6A 1T8EA 1CZ9A 3V1OA 4DU1A 2ITGA 3M8RA 2PYLA 3L2RA 1LWCA 3VA0A 3HYFA 3H08A 3BGRA 3K59A 3KLGA 1HYSA 3LZIA 1KFSA 4O0JA 2HB5A 1QTMA 4CJSA 3ZSRA 1VSKA 4Y1DA 4CF0A 4CF1A 3NDKA 4DTOA 3TARA 1UAXA 4EZ9A 1D8YA 3DLGA 2X74A 3V9ZA 1KTQA 3VQ7A 4FJLA 4Z0UA 5CY4A 2OZSA 1QS4A 3TWHA 3TAMA 2XY5A 1L3UA 4BE0A 1D9FA 1HPZA 1Q8IA 4Z4FA 4F3TA 5I42A 4C8MA 2AJQA 4IFYA 4CFBA 4LH5A 4DS4A 5K14A 1C1CA 4C8LA 1L3VA 4N41A 1JKHA 2KZZA 4B08A 5HRNA 3NH0A 4KI4A 4CGHA 4IG0A 1DTTA 2HNDA 3KLIA 3VQBA 5DMRA 1W0HA 4M45A 1RTHA 4CJTA 3OYNA 4KB1A 5J1EA 3L8BA 3QEVA 1XHZA 3OYDA 3QESA 3OYBA 3ZSWA 4OVLA 4DTXA 3SQ2A 5HP1A 4KFBA 4B9TA 1L3TA 4FJ7A 2JLEA 4BWJA 4DMNA 4LSLA 4DQQA 1BIZA 2OYQA 2YKNA 3DYAA 4IFVA 1BQNA 3RMBA 1C6VA 3RWUA 5JS1A 3TI0A 1RBRA 2HHQA 1RT6A 1YT3A 4W5OA 4JLHA 1RT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VSH A;  4KHQ A;  1VRU A;  3KJV A;  3AVN A;  3I0R A;  1IH7 A;  2IC3 A;  1LW0 A;  4FCY A;  4DLE A;  3LWL A;  4DQS A;  4DQP A;  4IKF A;  2KFN A;  1JL2 A;  4E0D A;  3HPH A;  2KZM A;  1IKV A;  2RF2 A;  4CEC A;  4NYN A;  4CK2 A;  5J2M A;  4CEQ A;  2A1S A;  3EYZ A;  3KLF A;  2Y1I A;  3K5M A;  1LV5 A;  2NUB A;  3F9K A;  3DLE A;  3M8Q A;  4R5P A;  4FJJ A;  3QEX A;  1KRP A;  1WSG A;  1D9D A;  3PY8 A;  4RW9 A;  1NJX A;  1RTD A;  4Z4H A;  2OPP A;  3MXM A;  3B6P A;  3OYJ A;  5FRM A;  4G1Q A;  4E1N A;  3UIQ A;  3OS2 A;  4F2S A;  1WSI A;  1HYZ A;  1S1W A;  1J54 A;  2Z1J A;  5HRR A;  3SUO A;  1RTI A;  4ELV A;  2QK9 A;  1GOA A;  3P5J A;  1VSM A;  4IBN A;  4M3U A;  3SUN A;  3O3H A;  1ZBL A;  4DSJ A;  1LAW A;  3OYE A;  3NGY A;  1EKE A;  2KQ2 A;  4CGI A;  2XY6 A;  4JRP A;  1U04 A;  3AVI A;  5SZT A;  1ZBF A;  1TKT A;  3HPG A;  4AHU A;  3F73 A;  3NCI A;  3SYZ A;  2QKB A;  4E7K A;  2HNZ A;  2HHV A;  3RRG A;  3HVT A;  1R0A A;  1ZBU A;  3VA3 A;  3SQ4 A;  3RMA A;  4FK0 A;  4FJX A;  1RT4 A;  1TGO A;  4BE1 A;  1QSS A;  2G8I A;  4DSL A;  3AA4 A;  1NKC A;  3SUQ A;  4GMJ B;  2G8F A;  1BI4 B;  3AA3 A;  3AO3 A;  3DMJ A;  5FDL A;  4AHC A;  4C8O A;  3OYF A;  4KRE A;  3AVF A;  3TAQ A;  3S3N A;  1XC9 A;  4IDK A;  1ZBH A;  1XHX A;  4M3Z A;  1ZYQ A;  2PZS A;  3C6U A;  3KKS A;  2DFF A;  2VWJ A;  3EZ5 A;  1VSD A;  3JSM A;  1J53 A;  1HQE A;  1U47 A;  3AVJ A;  2IAJ A;  4DQI A;  4CES A;  3S9H A;  2F8T A;  4CHQ A;  2P1J A;  2HNY A;  3LAM A;  4XIU A;  4DTU A;  3IAY A;  4KHY A;  3U3G A;  4FZY A;  3TAP A;  3VQE A;  1GOC A;  1RBV A;  1NK6 A;  1HRH A;  4KTW A;  4FW2 A;  4B8A B;  1J5O A;  1KVB A;  3S3M A;  1QSL A;  5KI6 A;  2Q3S A;  2EHG A;  1TK5 A;  1S5J A;  4CIG A;  2IDO A;  2OPS A;  1JXB A;  3I0S A;  2YNH A;  2HHX A;  1RT1 A;  4OPK A;  1LWF A;  2XO7 A;  3BDP A;  2Z1G A;  2VG6 A;  4LSN A;  3ZSQ A;  5I3U A;  4M3T A;  1EXQ A;  1EP4 A;  3NBP A;  4OGC A;  3KLE A;  4ZHR A;  2OZM A;  3VN5 A;  4FK2 A;  4O5B A;  2KTQ A;  3KK1 A;  2BGG A;  2VWK A;  2FBT A;  1TAU A;  1G15 A;  3T19 A;  4O44 A;  1CZB A;  1YTU A;  1QQC A;  4CK1 A;  4I9L A;  3V9S A;  4DTM A;  1DLO A;  1IKW A;  1T7P A;  2F96 A;  4K8X A;  3C6T A;  4H4O A;  1X9M A;  4HVJ A;  4FYD A;  2DY4 A;  3ZSO A;  4F4K A;  3ULD A;  4ID1 A;  3HXM A;  2X78 A;  4CEZ A;  3LDS A;  3AVH A;  3HM9 A;  4JS4 A;  2FBX A;  4CHP A;  3K2P A;  5C25 A;  3PX6 A;  4AHR A;  3AO4 A;  3V1Q A;  3VQ8 A;  4CHY A;  1K6Y A;  4PWD A;  1QHT A;  4DFK A;  3ZT3 A;  4O0I A;  3OS0 A;  3VQP A;  3KK3 A;  4BWM A;  4FM2 A;  5J2P A;  4DTN A;  4B9N A;  1NK5 A;  1NK7 A;  2OPQ A;  5FRO A;  2HMI A;  1WSF A;  4E19 A;  3SJJ A;  1HYV A;  1UOC A;  4W5T A;  5KGX A;  5HLF A;  2I5J A;  2FC0 A;  4CIE A;  2B4J A;  1L3S A;  2HHT A;  4I2Q A;  3OJS A;  4FVM A;  4E3S A;  3QNO A;  4FJK A;  1RNH A;  2YHA A;  2YV0 X;  2ZE2 A;  3D0P A;  1NK9 A;  4DSK A;  2DTU A;  1S6Q A;  3MEC A;  1N5Y A;  3PO4 A;  1SL2 A;  1S9G A;  3VQA A;  4J2E A;  1FKP A;  2RKI A;  2G8W A;  4DSF A;  4KHW A;  4JRQ A;  1NOY A;  4QCL A;  3RRH A;  3OYI A;  5C24 A;  4UQG A;  4KKO A;  1RT3 A;  3QIO A;  1I39 A;  1TKD A;  4FJ9 A;  2YNF A;  1U4B A;  4N56 A;  3VQ6 A;  1NJW A;  1O1W A;  3ZSY A;  1WSJ A;  3VQQ A;  1SUQ A;  2ATQ A;  3V6D A;  1FK9 A;  3DRR A;  4FLY A;  3TR8 A;  1HMV A;  1JLA A;  3SQ0 A;  3MEE A;  4CJR A;  4CGF A;  3IS9 A;  3LPT A;  3NF9 A;  4BDZ A;  2VG7 A;  3QLH A;  1KLM A;  3NF7 A;  4B9U A;  4KHU A;  4FJN A;  4KV8 A;  3KTQ A;  3P1G A;  3LAK A;  4FM1 A;  3VQ4 A;  3TAB A;  3PUF A;  4Z4G A;  1L5U A;  1S1U A;  1TVR A;  4L8R B;  3QIN A;  1YVU A;  4DTJ A;  1RT2 A;  3SCX A;  2DFE A;  3ZSV A;  1JLG A;  3OJU A;  1KFD A;  1KVC A;  3CM5 A;  4MFB A;  2Z1I A;  2E6M A;  4N76 A;  1A5X A;  3M8P A;  5KRT A;  4OKE A;  4CJK A;  4Q5V A;  3L3U A;  2ZD1 A;  1A5W A;  1U48 A;  3HO1 A;  4QOZ B;  4FLX A;  3LPU A;  4OKJ A;  1UWB A;  3AO2 A;  4CER A;  3S3O A;  1NJY A;  1LWE A;  1ASU A;  4LY7 A;  1C1B A;  4OGE A;  4QAG A;  4CF2 A;  1NK0 A;  4J2B A;  3L2V A;  3ISN C;  4KHN A;  2RPI A;  4KAZ A;  4KTQ A;  4CFA A;  2HW3 A;  1BI4 A;  1YTA A;  3MEG A;  3HPO A;  3QIP A;  3MAQ A;  4FK4 A;  3K5O A;  3SV4 A;  2FBY A;  4OLA A;  3SNN A;  4DQR A;  1SKS A;  4MQ3 A;  4DWI A;  1RT5 A;  1CLQ A;  1GOB A;  1RBS A;  4W5R A;  3M8S A;  1TK0 A;  4F3O A;  3VQC A;  1VSJ A;  3DLK A;  4AHS A;  4Z4E A;  2BDP A;  4AH9 A;  4M42 A;  4EP4 A;  2E6L A;  2YNI A;  1IG9 A;  1B9F A;  5CYM A;  2XHB A;  4HTU A;  1RDB A;  1RIL A;  4CJ4 A;  3NAE A;  4J2A A;  2KW4 A;  5D3G A;  4CGG A;  3LWM A;  3NH1 A;  2YKM A;  2R7Y A;  2B6A A;  4DU3 A;  3WNF A;  4E7I A;  4CK3 A;  4AIL C;  1NJZ A;  4FXD A;  1QSY A;  1SKR A;  3ZT4 A;  2JGU A;  3WNG A;  4KRF A;  4CIF A;  4KPY A;  1WSE A;  3OYL A;  3IG1 A;  1RDC A;  2QXF A;  2B5J A;  3VQ5 A;  4CEF A;  3HK2 A;  2XY7 A;  5FRN A;  3A2F A;  3NHG A;  4HCC A;  2W42 A;  4CJ3 A;  4B3O A;  4GVM A;  3V81 A;  4I9Q A;  5T7B A;  3LAL A;  1T03 A;  4DFM A;  4E1M A;  1BQM A;  4CJ5 A;  1XWL A;  2P51 A;  4B8C A;  3LP2 A;  1MU2 A;  4CFD A;  3SI6 A;  3DOL A;  3MXI A;  3SQ1 A;  3RR8 A;  4ID5 A;  1HNI A;  5CZ1 A;  3V9U A;  1J9A A;  4FJG A;  3AO1 A;  4N47 A;  3U3Y A;  1SKW A;  3CFP A;  4FLV A;  4DSI A;  3DLH A;  4HUF A;  3U6F A;  3DM2 A;  3LAN A;  4KB0 A;  4DG1 A;  1RCH A;  2X6N A;  4FLW A;  3LP3 A;  3ZCM A;  3E01 A;  4RW7 A;  4E7J A;  3TAE A;  1D5A A;  1HQU A;  3CM6 A;  4CF9 A;  1X9W A;  4O4G A;  3PO5 A;  1JLF A;  3OYG A;  3ZT0 A;  5KRS A;  3OY9 A;  3VQD A;  4BE2 A;  2O4I A;  3AVA A;  3D45 A;  3VQ9 A;  1JLQ A;  4EP5 A;  1REV A;  4F8R A;  4B9L A;  4CJW A;  4DU4 A;  4DF4 A;  1N6Q A;  2ZQB A;  2HHS A;  4FLU A;  3V9X A;  1IKX A;  3RMD A;  1NOZ A;  2OPR A;  1WAF A;  2D5R A;  3OVN A;  1ASW A;  4IG3 A;  1I3A A;  4AHT A;  4CEE A;  2PY5 A;  4HCB A;  3CYM A;  5EU7 A;  3MED A;  4CJU A;  4JS5 A;  3K57 A;  4BAC A;  5HRO A;  1KSP A;  1SL0 A;  4DTR A;  1W9H A;  4CHZ A;  4N5S A;  4FZX C;  1BGX T;  3DRS A;  3CQ8 A;  1BL3 A;  4CHN A;  3L2U A;  1DTQ A;  2O4G A;  2Z1H A;  3AVG A;  5CZ2 A;  4CHO A;  4OKK A;  3NH2 A;  1S9E A;  1RBT A;  1X1P A;  4KO0 A;  4H8K A;  4DTP A;  5JS2 A;  4OJR A;  1JLB A;  3QEP A;  5DK5 A;  1TKZ A;  4OLB A;  4ZTF A;  2KFZ A;  1TV6 A;  3HJF A;  3MXJ A;  4WE1 A;  3CFR A;  1WAJ A;  5HBM A;  2YHB A;  3AV9 A;  3SV3 A;  4K8Z A;  1HJR A;  4FLZ A;  4BDY A;  1KCF A;  3AVK A;  1XI1 A;  1IO2 A;  4RW8 A;  4DFJ A;  1C0U A;  4C8K A;  3SPZ A;  4CJE A;  3AVC A;  4PY5 A;  4CGJ A;  1WNS A;  3ZSX A;  3L2W A;  3KKR A;  4DF8 A;  2F8S A;  1HNV A;  2D0A A;  2IS3 A;  2RN2 A;  3AO5 A;  4NCB A;  3QET A;  1KLN A;  3LP1 A;  3HT3 A;  4HHT A;  4Z4C A;  3OYH A;  2P5O A;  3AA2 A;  4DTS A;  1F21 A;  5C42 A;  2Y1J A;  3HP6 A;  1JLE A;  4W5Q A;  3PX4 A;  1VSI A;  4FJH A;  4RW4 A;  4YNQ A;  4FJM A;  1JXE A;  2XRI A;  3OYA A;  5E41 A;  3NGI A;  2HVI A;  4Q0B A;  1NKB A;  2OA8 A;  1Q9Y A;  3NFA A;  2X6S A;  3OYC A;  1ZBI A;  4CJF A;  4YFU A;  4M41 A;  3O4Q A;  1JL1 A;  3NGZ A;  2QKK A;  4M3W A;  3OYK A;  2IOC A;  1CXU A;  3ALY A;  1Y97 A;  1FXX A;  3DLR A;  3QEW A;  1SV5 A;  3L3V A;  1ASV A;  2PYJ A;  3WNH A;  1RDA A;  1TKX A;  2G8U A;  1QE1 A;  4PA1 A;  3CFO A;  4M3X A;  3T1A A;  4FJ5 A;  4NYF A;  3TAG A;  1A5V A;  4RG8 A;  4RW6 A;  3G0Z A;  1S1T A;  2G8H A;  2IGI A;  1WN7 A;  5HRS A;  4AHV A;  2WOM A;  4FM0 A;  3C94 A;  2A1R A;  3LP0 A;  1WSH A;  2P5G A;  4FJI A;  2BE2 A;  4H4M A;  1LAV A;  4B9S A;  3O3G A;  3P83 D;  5SWM A;  1NK4 A;  3KK2 A;  4CCH A;  1BHL A;  1VSL A;  4CEA A;  2EX3 A;  1JLC A;  3I8D A;  3V9W A;  2HHW A;  3ZSZ A;  4E89 A;  1RDD A;  3AVB A;  3LZJ A;  4ELU A;  4DS5 A;  1CXQ A;  3PV8 A;  4CE9 A;  4BDP A;  2GUI A;  2E4L A;  4HUG A;  4PUO A;  3SPY A;  4CJV A;  4CED A;  1U49 A;  4NCA A;  4LH4 A;  4CF8 A;  3SZ2 A;  4KI6 A;  1VSF A;  4LD0 A;  4NCG A;  4B9V A;  1RBU A;  3TAN A;  3O3F A;  1B92 A;  2WON A;  3AVM A;  1RTJ A;  1VSE A;  2BAN A;  4EZ6 A;  1S6P A;  2LSN A;  3OS1 A;  5J2N A;  4Z4I A;  3DOK A;  3QO9 A;  4CGD A;  3THV A;  1TK8 A;  3DRP A;  1TAQ A;  3OYM A;  3DLB A;  2ETJ A;  2GBZ A;  4OPJ A;  3IRX A;  1BCM A;  2D0B A;  4M3Y A;  3EY1 A;  5KTQ A;  1Z26 A;  3QEI A;  3L2Q A;  1UA1 A;  2HHU A;  4C8N A;  4FLT A;  2GV9 A;  1C0M A;  4KTZ A;  1VRT A;  3ZT2 A;  4CJP A;  4HUE A;  4CEO A;  1BIS A;  3HL8 A;  4DFP A;  4W5N A;  3RR7 A;  4E7L A;  2HVH A;  1BCO A;  1EET A;  4I7F A;  4B9M A;  3QNN A;  4ZTJ A;  2FBV A;  1TL1 A;  1KVA A;  1LW2 A;  4CJL A;  5J2Q A;  1U45 A;  3CG7 A;  3ZT1 A;  4E7H A;  3G10 A;  1C0T A;  2YNG A;  1BIU A;  4FW1 A;  4FJ8 A;  3HP9 A;  4DSE A;  3V4I A;  1T05 A;  5CYQ A;  3O4N A;  3PX0 A;  3DI6 A;  3TAF A;  1NKE A;  3HST B;  3K58 A;  5KGW A;  3QER A;  2DFH A;  4M3R A;  1EX4 A;  1WLJ A;  3ITH A;  3SUP A;  2G8K A;  3RMC A;  4KHS A;  5HRP A;  4PQU A;  1VK0 A;  3KD1 E;  3JYT A;  4Y1C A;  3NF6 A;  2XY8 A;  1IKY A;  4CFC A;  2VG5 A;  1S1V A;  1S1X A;  4I2P A;  2G8V A;  3KD5 E;  4FZZ A;  3T3F A;  1C1A A;  1B9D A;  2D0C A;  3HVR A;  1Q9X A;  3K5L A;  3KIO A;  4O55 A;  4CEB A;  1SL1 A;  1FKO A;  4TSX A;  3WNE A;  3AA5 X;  3FFI A;  3NF8 A;  3K5N A;  1X9S A;  3AVL A;  3C95 A;  3RTV A;  1UA0 A;  4ICL A;  4CJQ A;  4ELT A;  1Z25 A;  4GW6 A;  3V1R A;  1NK8 A;  3KLH A;  1TL3 A;  1ITG A;  4J2D A;  3B6O A;  4F2R A;  3ASM A;  4DLG A;  3NE6 A;  1T8E A;  1CZ9 A;  3V1O A;  4DU1 A;  2ITG A;  3M8R A;  2PYL A;  3L2R A;  1LWC A;  3VA0 A;  3HYF A;  3H08 A;  3BGR A;  3K59 A;  3KLG A;  1HYS A;  3LZI A;  1KFS A;  4O0J A;  2HB5 A;  1QTM A;  4CJS A;  3ZSR A;  1VSK A;  4Y1D A;  4CF0 A;  4CF1 A;  3NDK A;  4DTO A;  3TAR A;  1UAX A;  4EZ9 A;  1D8Y A;  3DLG A;  2X74 A;  3V9Z A;  1KTQ A;  3VQ7 A;  4FJL A;  4Z0U A;  5CY4 A;  2OZS A;  1QS4 A;  3TWH A;  3TAM A;  2XY5 A;  1L3U A;  4BE0 A;  1D9F A;  1HPZ A;  1Q8I A;  4Z4F A;  4F3T A;  5I42 A;  4C8M A;  2AJQ A;  4IFY A;  4CFB A;  4LH5 A;  4DS4 A;  5K14 A;  1C1C A;  4C8L A;  1L3V A;  4N41 A;  1JKH A;  2KZZ A;  4B08 A;  5HRN A;  3NH0 A;  4KI4 A;  4CGH A;  4IG0 A;  1DTT A;  2HND A;  3KLI A;  3VQB A;  5DMR A;  1W0H A;  4M45 A;  1RTH A;  4CJT A;  3OYN A;  4KB1 A;  5J1E A;  3L8B A;  3QEV A;  1XHZ A;  3OYD A;  3QES A;  3OYB A;  3ZSW A;  4OVL A;  4DTX A;  3SQ2 A;  5HP1 A;  4KFB A;  4B9T A;  1L3T A;  4FJ7 A;  2JLE A;  4BWJ A;  4DMN A;  4LSL A;  4DQQ A;  1BIZ A;  2OYQ A;  2YKN A;  3DYA A;  4IFV A;  1BQN A;  3RMB A;  1C6V A;  3RWU A;  5JS1 A;  3TI0 A;  1RBR A;  2HHQ A;  1RT6 A;  1YT3 A;  4W5O A;  4JLH A;  1RT7 A; 
#chains in the Genus database with same CATH topology
 1VSH A;  1KC8 O;  1IH7 A;  4IXC A;  4IKF A;  1YF5 L;  2KFN A;  5AQU A;  1BWF O;  2PFU A;  1E4F T;  4NYN A;  4CK2 A;  3DXM B;  2Q36 A;  4JI7 K;  2A1S A;  1LV5 A;  2NUB A;  3BF3 A;  3C7N B;  3DLE A;  3VF6 A;  4FJJ A;  3QEX A;  1XNR K;  1D9D A;  4Z4H A;  2OPP A;  3VEW A;  1XMQ K;  5FRM A;  3OS2 A;  4F2S A;  5HRR A;  4H0Y B;  1GOA A;  4IBN A;  3O3H A;  1ZBL A;  4DSJ A;  1LAW A;  2KQ2 A;  3HPG A;  4AHU A;  1QHA A;  4BGA A;  4WQ4 A;  3QDK A;  3RRG A;  2WBN A;  1DEJ A;  2QWO A;  1R0A A;  4FK0 A;  4DQ8 A;  5FPM A;  4CBW A;  3QIC A;  1TGO A;  2G8I A;  5KPZ A;  1VQN N;  2GWJ A;  3AA4 A;  1BA1 A;  5AQG A;  1BI4 B;  4KRE A;  3U9Z A;  1OH8 A;  4LF9 K;  4IDK A;  1ZBH A;  3OW2 M;  4H5W A;  3ZLJ A;  1VSD A;  3UKR B;  5KQ8 A;  3AVJ A;  4DQI A;  2HNY A;  4DR2 K;  3FZK A;  3TAP A;  1NK6 A;  5JIC A;  4B8A B;  2YJE A;  1KVB A;  1BA0 A;  2V7Z A;  4C1N I;  5KI6 A;  4PKH A;  3S3M A;  4CIG A;  1JXB A;  4ISE A;  4OPK A;  3BDP A;  2Z1G A;  3MWP A;  4M3T A;  1EP4 A;  4FK2 A;  3VN5 A;  2BGG A;  1IG8 A;  3HI0 A;  4O44 A;  1CZB A;  1NGA A;  2Q31 A;  1YTU A;  1NBW A;  2F96 A;  3C6T A;  4FYD A;  3ULD A;  3SBT A;  3A5N C;  3LDS A;  3AVH A;  4JS4 A;  2FBX A;  3O6W A;  1NGH A;  3AO4 A;  4DFK A;  3VQP A;  4BWM A;  5J2P A;  4B9N A;  2P9N B;  3W0L A;  1NK7 A;  2HMI A;  1DGK N;  5KGX A;  4JKH A;  4I6M B;  2HHT A;  4M7Y A;  4K25 A;  2P9I B;  3OJS A;  2PBD A;  2YHA A;  4DSK A;  3MEC A;  4CVN E;  3L6Q A;  4BRN A;  4JD2 B;  2BH1 A;  4JRQ A;  3MWT A;  3CCE N;  4KKO A;  1X9J A;  2GWK A;  1RT3 A;  3TU5 A;  1I39 A;  2YNF A;  5AQM A;  4N56 A;  1VQ5 N;  3MDQ A;  3ZSY A;  4B3S K;  4JKF A;  3P31 A;  1MDU B;  3V6D A;  1FK9 A;  3DRR A;  4BRL A;  4AQY K;  3O9U A;  1NG9 A;  3IS9 A;  3LPT A;  3NF9 A;  3AAR A;  4JK8 A;  3SAH A;  3NF7 A;  4FJN A;  3P1G A;  4BG8 A;  2E88 A;  3CPW M;  3PUF A;  5AFU A;  2GX9 A;  3QIN A;  2O8E B;  1Q18 A;  2VWB A;  1JLG A;  4DB3 A;  1KFD A;  2E2O A;  1BUP A;  3CM5 A;  4IEI A;  4MLH A;  1A5X A;  1NGC A;  3M8P A;  5LJW A;  1A5W A;  1IBK K;  1UWB A;  3AO2 A;  4CER A;  1LWE A;  1ASU A;  1NK0 A;  4DR4 K;  3E66 A;  1J6Z A;  3L2V A;  2ASO A;  3Q7B A;  2RHK A;  3HM8 A;  3SNN A;  2V52 B;  4KHP K;  4BRK A;  4X65 K;  1GOB A;  4O8K A;  4W5R A;  4DKW A;  3M8S A;  1TK0 A;  1FJG K;  5EOY A;  4AH9 A;  1LCU A;  2E6L A;  1IG9 A;  4J2A A;  4CGG A;  2R7Y A;  4RCH A;  3NH1 A;  3ULE B;  5AZJ B;  4CK3 A;  1N32 K;  1NJZ A;  1QSY A;  2JGU A;  3WNG A;  3R6M A;  5AQX A;  3OYL A;  3ENH A;  3RVC A;  3HK2 A;  4WF9 L;  1HKC A;  4FWP A;  4DR3 K;  3ULE A;  1NGD A;  3MX2 A;  4B3O A;  4GVM A;  4I9Q A;  3CHW A;  1FW6 A;  2CGK A;  4CJ5 A;  4FWQ A;  1XWL A;  3PIP L;  3ZET B;  3DOL A;  4JKD A;  5CZ1 A;  5C15 A;  1SKW A;  5E26 A;  4MO5 A;  3DM2 A;  1K73 O;  1IV0 A;  5AZI B;  3VEO A;  3RSE A;  3TAE A;  3T1Y K;  4H0O A;  5KPR A;  2DPN A;  2P9P B;  3OYG A;  3L4Q A;  3D45 A;  2VGM A;  4IFE A;  4PKI A;  4B3M K;  1REV A;  4BRH A;  2HHS A;  3ENO A;  1IKX A;  3RMD A;  3VGL A;  3CCJ N;  4AHT A;  2PY5 A;  2HHH K;  2FSK A;  4BAC A;  2ZJR L;  4DTR A;  3ID8 A;  5HL7 L;  4BRE A;  4YOV A;  3CQ8 A;  2O4G A;  3AVG A;  4CHO A;  1T6C A;  4LC9 B;  4OKK A;  5LY3 A;  4YDU A;  3THX A;  3SK3 A;  4OLB A;  1TKZ A;  4GVE A;  4ZTF A;  1TV6 A;  2NRR A;  3MXJ A;  3FZM A;  4CI6 A;  2YHB A;  4FLZ A;  3CCQ N;  3AVK A;  3T69 A;  4DFJ A;  1C0U A;  2O8F B;  1XMO K;  4BRA A;  4CJE A;  1RFQ A;  3AVC A;  4CBU A;  3AO5 A;  3QET A;  3H3N O;  3HT3 A;  3THW A;  2P5O A;  5CE3 A;  3PSF A;  4C23 A;  5AQJ A;  3J7Z O;  3PX4 A;  2UU9 K;  3CF5 L;  4ILH A;  2UUB K;  3UKU B;  4IJA A;  5E41 A;  2HVI A;  1RDW X;  2OA8 A;  5HOO A;  4M41 A;  3NGZ A;  4M3W A;  4DV7 K;  4H5N A;  1CXU A;  1SV5 A;  3I56 N;  2BUP A;  1P90 A;  2G8U A;  4WCE L;  1BU6 O;  4NYF A;  2QM1 A;  4U67 L;  1WN7 A;  3WXI A;  3D2E B;  4DV0 K;  4B9S A;  2D0P A;  4X62 K;  3VF2 A;  5SWM A;  1NK4 A;  1BHL A;  4CEA A;  4OPH A;  4EAH D;  5FPD A;  1HKG A;  2UYT A;  4CED A;  2QWN A;  4O8U A;  1VSF A;  4CZK A;  4FOE A;  5F1X A;  3KHY A;  1VSE A;  3D7E O;  3J81 O;  5AQH A;  3QO9 A;  1VQ6 N;  5GIO A;  2GBZ A;  3IRX A;  2D0B A;  1Z26 A;  1BDG A;  4A5B A;  4C8N A;  1S72 N;  1C0M A;  1VRT A;  3BZC A;  4FWN A;  1ZC6 A;  4E7L A;  4IWV A;  2HVH A;  1BCO A;  1ILY A;  3QNN A;  1TL1 A;  1KVA A;  5J2Q A;  3FGU A;  3CG7 A;  2YNG A;  4FW1 A;  4KH6 A;  2GEM A;  3J7A P;  4JYA K;  3F5T A;  1R59 O;  1YJW N;  3KD1 E;  4Y1C A;  3NF6 A;  1X3M A;  2VG5 A;  4I2P A;  4FWL A;  3T3F A;  1W97 L;  1KD1 O;  1SL1 A;  4TSX A;  2KKZ A;  3K9J A;  3HTV A;  5F2R A;  3CC4 N;  5AQP A;  4ELT A;  3B6O A;  4A61 A;  4DUY K;  4DLG A;  4FWO A;  5IT9 O;  2PYL A;  4BRC A;  1NJI O;  5IWA K;  3ATV A;  3H08 A;  3TTD A;  4CJS A;  5DM7 L;  3HZ6 A;  4CF1 A;  3NDK A;  4DTO A;  5KQD A;  2D4W A;  3V9Z A;  2IIR A;  2YJF A;  2W41 A;  3TWH A;  2XY5 A;  3O9T A;  3R1X A;  1HPZ A;  2P9S B;  2YX6 A;  4F9O A;  4LH5 A;  3MCP A;  1L3V A;  1JKH A;  3VER A;  4BY9 C;  3NH0 A;  1MWK A;  3G25 A;  5JLH A;  3CJ7 A;  4JHD B;  4EHU A;  1RTH A;  1XHZ A;  3MK6 A;  3OYD A;  3SAF A;  4DTX A;  3SQ2 A;  4B9T A;  4FJ7 A;  3AY9 A;  4BWJ A;  4DMN A;  4JI8 K;  2OYQ A;  4DQQ A;  2YKN A;  1YHQ N;  4DR7 K;  1C6V A;  1N36 K;  3RWU A;  1RT6 A;  4KTQ A;  4W5O A;  2Y1J A;  2QWP A;  1NMD A;  4FCY A;  4DQP A;  1LW0 A;  4DLE A;  3LWL A;  1JL2 A;  3HPH A;  1IKV A;  4CEC A;  1WBD A;  2FXU A;  2Y1I A;  3K5M A;  4GV6 A;  3M8Q A;  3LDN A;  1KRP A;  3O5B A;  2ZGY A;  1NJX A;  1HUX A;  1RTD A;  3HOT A;  3CCV N;  2UXC K;  4G1Q A;  5AJ3 K;  3UIQ A;  4RWT A;  4DUZ K;  1S1W A;  3SUO A;  4ELV A;  3P5J A;  1VSM A;  4CZG A;  4M3U A;  3SUN A;  1VQ8 N;  1QZ5 A;  4CBX A;  3NGY A;  4CGI A;  2NRT A;  5SZT A;  3LM2 A;  4NXN K;  1SAZ A;  3CPE A;  3F73 A;  5C2F A;  4JKE A;  4E7K A;  2HNZ A;  5BPN A;  2ASP A;  4IZ9 A;  3SQ4 A;  1RT4 A;  4BE1 A;  4DSL A;  3K9K A;  4B1X B;  2NRX A;  3SUQ A;  1NKC A;  2JWL A;  3AO3 A;  3AVF A;  3S3N A;  1XHX A;  4DR1 K;  1YUW A;  1ZYQ A;  4M3Z A;  3CCU N;  3C6U A;  4B3T K;  4ILG B;  5JVH L;  4CES A;  3S9H A;  2P1J A;  3LAM A;  4KHY A;  3U3G A;  3VMF B;  4FZY A;  3LL3 A;  1HRH A;  4KTW A;  1QSL A;  2F9T A;  3VTI A;  2IDO A;  3I0S A;  4DV4 K;  3L0Q A;  1K9M O;  3QFP A;  1OVQ A;  2VG6 A;  5I3U A;  3KLE A;  4LFA K;  3SMP A;  4O5B A;  1SS6 A;  4BRI A;  4M7X A;  1QQC A;  1T7P A;  1IKW A;  3QML A;  1X9M A;  3ZSO A;  5BRF A;  2EWS A;  4H5V A;  3HM9 A;  5LMN K;  3K2P A;  4AHR A;  3V1Q A;  3VQ8 A;  1K6Y A;  2HOE A;  3KK3 A;  4FM2 A;  2ASM A;  1NK5 A;  3O8M A;  2W6K A;  5FRO A;  4AF1 A;  4OX9 K;  2P9P A;  3FZF A;  4DHY A;  1NGB A;  4I2Q A;  4FVM A;  3BP8 A;  4CZI A;  4FJK A;  1RNH A;  4K42 A;  4K43 A;  3D0P A;  2FLO A;  1S6Q A;  5AQI A;  1OH5 A;  3FZH A;  1O13 A;  1TUY A;  3VET A;  4K0K K;  4DSF A;  3JAM O;  4IEE A;  2QWQ A;  5C24 A;  3M5R A;  2HBJ A;  1VQO N;  2OAN A;  1U4B A;  1NJW A;  1O1W A;  3EN9 A;  1LOT B;  3TR8 A;  1JLA A;  3WXM B;  1YJN N;  1NM1 A;  2P9K B;  1K8K A;  4KH4 A;  5M1K A;  2WC9 A;  3D6R A;  4KHU A;  4KV8 A;  4IOC L;  3LAK A;  4H0P A;  2NZT A;  1TVR A;  4L8R B;  4DTJ A;  1RT2 A;  3SCX A;  3OJU A;  2UUC K;  4LFC K;  1KVC A;  3CQX A;  4I6M A;  3ZEU A;  2E6M A;  4N76 A;  4B9Q A;  5KRT A;  5EXW A;  2ZD1 A;  4Z94 A;  4OKJ A;  3S3O A;  4LY7 A;  4OGE A;  1TYQ B;  4KHN A;  4KAZ A;  4AM6 A;  4CFA A;  2HW3 A;  3MAQ A;  4FK4 A;  4DQR A;  4MLE A;  4YDU C;  4F3O A;  4BVO A;  1NU0 A;  4M42 A;  4NLB A;  2P9U B;  1T44 A;  4EP4 A;  3H1Q A;  3LWM A;  2FF3 B;  4DU3 A;  3ZYY X;  4E7I A;  3GG4 A;  5BRE A;  1JJ2 M;  1SKR A;  1OH7 A;  3IG1 A;  2QXF A;  2XY7 A;  3NHG A;  1C0G A;  3QBW A;  4BRF A;  3LAL A;  4DFM A;  4BR5 A;  2E8A A;  1MU2 A;  4DR6 K;  4JI0 K;  2O8B A;  2NNW A;  2IVN A;  3AO1 A;  2QWR A;  4DG1 A;  1RCH A;  2X6N A;  3LP3 A;  3E01 A;  4RW7 A;  1HQU A;  3U4L A;  3HSC A;  1JLF A;  3KVG A;  3C0B A;  4A62 A;  4B1W B;  4EP5 A;  4DU4 A;  2E2P A;  4XH4 A;  4FLU A;  4YOU A;  1WAF A;  1P8Z A;  4IG3 A;  1I3A A;  4A2B A;  5C0Y A;  5BN9 A;  3CYM A;  5EU7 A;  3ZX0 A;  4JS5 A;  5HRO A;  1KSP A;  2WFB A;  1W9H A;  2P9S A;  1YIT N;  4KH5 A;  4LF7 K;  1N8R O;  3NH2 A;  5BPM A;  1S9E A;  4OJR A;  3CI5 A;  1JLB A;  3KWI A;  4AM7 A;  2VGN A;  5HBM A;  3ZX2 A;  4NO7 A;  4NB4 A;  1IO2 A;  4RW8 A;  3CER A;  4C8K A;  1XUP O;  1IBM K;  3EKS A;  4Y0W A;  3RSE B;  5M1P A;  4CGJ A;  5AQL A;  2NRZ A;  3L2W A;  2RN2 A;  3THY A;  2NRV A;  3OYH A;  1NNE A;  4DTS A;  1F21 A;  3BY5 A;  5C42 A;  1VSI A;  1VQ9 N;  2XRI A;  4WFB L;  3THY B;  3NFA A;  3OYC A;  3NMU A;  3O4Q A;  1JL1 A;  3ALY A;  1Y97 A;  5AFU H;  1Q86 O;  1JCF A;  3WNH A;  1RDA A;  1TKX A;  4H03 B;  2NLX A;  4FJ5 A;  4BRP A;  1QVG M;  5C10 A;  3ATU A;  4FM0 A;  4AHV A;  4R79 A;  4DV6 K;  3O4W A;  3LP0 A;  1WSH A;  4FJI A;  4BVP A;  3O3G A;  2ZF5 O;  2O8D B;  4CCH A;  1VSL A;  2EX3 A;  1JLC A;  3EKU A;  3WEE A;  3ZSZ A;  1YVN A;  3LZJ A;  4ELU A;  4DS5 A;  3H46 O;  1SQK A;  2E4L A;  4PUO A;  3MCA B;  3TTC A;  4C1N K;  3TAN A;  1ATN A;  2WON A;  3AVM A;  1RTJ A;  2BAN A;  1T6D A;  3TSP A;  1S6P A;  2AA4 A;  2LSN A;  4X64 K;  5J2N A;  3DOK A;  5TKW A;  3OYM A;  2E1Y A;  4M3Y A;  3JS6 A;  3QEI A;  1UA1 A;  3IUC A;  2HHU A;  5JLF A;  4FLT A;  4HTL A;  3TPQ A;  4OO1 J;  2HST A;  3ENB A;  3ZT2 A;  4CEO A;  3HL8 A;  2Q1N A;  3RR7 A;  3CCL N;  3CCS N;  4B9M A;  1KQS M;  3ZT1 A;  2O8F A;  2J4R A;  3G10 A;  3OBY A;  1BIU A;  3CXC M;  2P9N A;  3PX0 A;  4XH1 A;  3TAF A;  3ITH A;  1EWR A;  1M1K O;  1NGE A;  3SUP A;  3EE9 A;  4E1J A;  1V4T A;  3JYT A;  4DV2 K;  1IKY A;  4CFC A;  2G8V A;  1S1X A;  1B9D A;  3EZW A;  4KBO A;  3K5L A;  4G9Z A;  3WNE A;  3NF8 A;  2HF4 A;  3C95 A;  1UA0 A;  1Z25 A;  4GW6 A;  3DLL L;  3KLH A;  1TL3 A;  1ITG A;  2E1Z A;  3ASM A;  3NE6 A;  4GKJ K;  1CZ9 A;  4DU1 A;  3CJB A;  1BG3 A;  3NVM A;  2PAV A;  4XEI A;  4O0J A;  2HB5 A;  3ZSR A;  4CF0 A;  2UUA K;  4OPA A;  2D1K A;  4FJL A;  4CD1 A;  1GLJ O;  2OZS A;  3TAM A;  4BE0 A;  1GLL O;  5I42 A;  3IFR A;  3GBT A;  4C8M A;  4C8L A;  1C1C A;  4N41 A;  3BF1 A;  5HRN A;  1VQ4 N;  3E9O A;  3I33 A;  5BR9 A;  1Z05 A;  3KLI A;  3OYN A;  5AQQ A;  5AQZ A;  3AAQ A;  3QEV A;  3QES A;  1HR0 K;  3SBG A;  1BIZ A;  4BRM A;  1RBR A;  4DCH A;  3CME N;  1VRU A;  3KJV A;  3VOV A;  3I0R A;  4WFN L;  4DQS A;  3FLC O;  1MWM A;  3WQU A;  3BZK A;  2RF2 A;  5C12 A;  5J2M A;  3VEZ A;  4BC2 A;  4R5P A;  3PY8 A;  3MXM A;  3P4I A;  2UXB K;  4E1N A;  4NLC A;  3JXU A;  3VF4 A;  1RTI A;  3VGK A;  3WXK A;  1HKB A;  3OYE A;  1EKE A;  2XY6 A;  1GLC G;  3QFU A;  1IBL K;  3AVI A;  4JHD A;  1ZBF A;  1TKT A;  4FPA A;  3NCI A;  2O8D A;  4PL7 A;  1QQM A;  2F7T A;  4FJX A;  3VA3 A;  3OBW A;  1TYQ A;  3L4I A;  5GIP A;  4GMJ B;  2G8F A;  3DMJ A;  3AA3 A;  3F2K A;  5FDL A;  4AHC A;  3OYF A;  1MA9 B;  3DXK A;  3FZL A;  2VWJ A;  1VQP N;  2VCP A;  1J53 A;  1HQE A;  1U47 A;  2F8T A;  2IAJ A;  5FPN A;  4CHQ A;  4XIU A;  4DTU A;  3VQE A;  1RBV A;  3FFK B;  4FW2 A;  3I55 N;  1J5O A;  3CIP A;  2E5L K;  4BR7 A;  2EHG A;  1TK5 A;  2OPS A;  3DJC A;  2YNH A;  2HHX A;  3CJ9 A;  3ZSQ A;  1EXQ A;  3NBP A;  1Q7Y O;  4BR2 A;  4MDA A;  2OZM A;  3EL2 A;  3KK1 A;  4JI4 K;  1YJ9 N;  2VWK A;  2FBT A;  1HPM A;  3T19 A;  4CK1 A;  5CR4 A;  2YCH A;  4K8X A;  4H4O A;  4O5F A;  1U2V B;  2X78 A;  4DV1 K;  1OH6 A;  3O1W A;  4IOA L;  5AQV A;  1QZ6 A;  3ZT3 A;  4O0I A;  3OS0 A;  4DTN A;  2OPQ A;  4DV3 K;  5AQW A;  4W5T A;  3EEQ A;  2I5J A;  4CIE A;  2DTU A;  2ZE2 A;  2YV0 X;  3A5M C;  1NK9 A;  3CD6 N;  3VTH A;  3PO4 A;  3CC7 N;  1SL2 A;  5BRH A;  4CZL A;  4J2E A;  1FKP A;  2YHY A;  2RKI A;  2G8W A;  1NOY A;  1E3M A;  4QCL A;  3RRH A;  3OYI A;  4UQG A;  3E9P A;  4M63 C;  3CCR N;  4H0V B;  3S41 A;  4YY3 K;  1WSJ A;  3VQQ A;  1SUQ A;  2ATQ A;  2P9L A;  1WOQ A;  2ZJQ L;  2GTD A;  3MN9 A;  1VQL N;  3MEE A;  1HNW K;  3THX B;  3UE5 A;  4CGF A;  3KK7 A;  4BDZ A;  2VG7 A;  3QLH A;  3KTQ A;  3ZEU B;  4YOY A;  1ZBS A;  4FM1 A;  3TAB A;  4Z4G A;  4UY8 O;  5BR8 K;  4B1U B;  4FWK A;  3VEY A;  4MFB A;  3MMV A;  1U48 A;  4Q5V A;  3HO1 A;  3L3U A;  1TAU A;  1NJY A;  3D2E A;  2F4V K;  4CF2 A;  4J2B A;  2Q97 A;  3TSQ A;  3ISN C;  5FPE A;  5AZJ A;  1YTA A;  3QIP A;  4OLA A;  1S22 A;  1W7A A;  1Z6R A;  1SKS A;  3BUZ B;  1RT5 A;  1N34 K;  1Q82 O;  1RBS A;  4JNE A;  5ADX H;  4AHS A;  4IO9 L;  4FPB A;  2BDP A;  1GLF O;  2YNI A;  1XQS C;  2XHB A;  5B8H A;  4HTU A;  4GV3 A;  4CZE A;  4ILJ A;  3NAE A;  2KW4 A;  1EWQ A;  5D3G A;  3C65 A;  2YKM A;  2B6A A;  5AQT A;  3WNF A;  3ZT4 A;  4J8F A;  4CZF A;  1RDC A;  2B5J A;  4CEF A;  5FRN A;  3A2F A;  4HCC A;  5A2Q O;  4PHT X;  4CJ3 A;  1KAX A;  1BO5 O;  4FO0 A;  3IMX A;  4E1M A;  2A3Z A;  1T3V A;  2P51 A;  4B8C A;  3CCM N;  3MXI A;  4PKG A;  4ID5 A;  3SAG A;  4YHH K;  1HNI A;  3V9U A;  2VQE K;  1J9A A;  4FJG A;  4N47 A;  4FLV A;  4DSI A;  2FSJ A;  4HUF A;  3GDQ A;  4XH5 A;  3CMA N;  4KB0 A;  4FLW A;  5F0X A;  1D5A A;  3CM6 A;  4CF9 A;  1X9W A;  4O4G A;  1V4S A;  5C2D A;  3CJC A;  5KRS A;  4BE2 A;  2O4I A;  4B1V A;  5M1F A;  3AVA A;  3VQ9 A;  1JLQ A;  4F8R A;  4B9L A;  5AQF A;  2ZQB A;  3V9X A;  1NOZ A;  2OPR A;  1RGI A;  3OVN A;  4YOT A;  1HNX K;  2A41 A;  1VHX A;  4FVU A;  4N5S A;  4FZX C;  3DRS A;  2QI2 A;  1BL3 A;  4CHN A;  3J7Y P;  3L2U A;  5AQN A;  5CZ2 A;  4BQL A;  4H8K A;  1RBT A;  3DWL A;  4DTP A;  5JS2 A;  4CD3 A;  5DK5 A;  4WE1 A;  3CFR A;  1WAJ A;  3AAP A;  4JI6 K;  3SV3 A;  4K8Z A;  2V7Y A;  1KCF A;  1EQY A;  3MN5 A;  1YAG A;  3KZB A;  4PY5 A;  2Q0U A;  1WNS A;  4DF8 A;  1HNV A;  2D0A A;  2IS3 A;  3CET A;  4NCB A;  3PLA A;  1NGF A;  1KLN A;  4HHT A;  3VEX A;  1I94 K;  4FJH A;  4YNQ A;  2FF6 A;  3O9R A;  3A8Y A;  4FJM A;  4WQ5 C;  3OYA A;  4EHT A;  3NGI A;  4LFB K;  4Q0B A;  4LF5 K;  1Q9Y A;  2X6S A;  2P9I A;  4YFU A;  2QKK A;  2W6L A;  3A0I X;  4FL9 A;  1NMN A;  3OYK A;  3DLR A;  1DKG D;  5FLX O;  3L3V A;  1ASV A;  3K0S A;  2YHW A;  2A40 A;  4M3X A;  2O8B B;  3T1A A;  1A5V A;  3IKM A;  4RG8 A;  3G0Z A;  1S1T A;  2G8H A;  2O8C A;  2WOM A;  3C94 A;  2A1R A;  2P5G A;  3I8B A;  1LAV A;  5AQY A;  3ZX3 A;  3KK2 A;  3LDO A;  3I8D A;  1C0F A;  2HHW A;  3M6G A;  3AVB A;  1ZBI A;  4BDP A;  1CXQ A;  2ITM A;  1X3N A;  4CE9 A;  2GUI A;  4HUG A;  3SPY A;  1U49 A;  4ISG A;  4CF8 A;  4KI6 A;  4H0T B;  4LD0 A;  5TKY A;  4NCG A;  4JKC A;  1RBU A;  2H3G X;  3HRG A;  1NGJ A;  4EZ6 A;  3VES A;  4WYB A;  2W40 A;  3MN7 A;  3QB0 A;  4JI1 K;  4CGD A;  3BEX A;  3DXK B;  2HF3 A;  3DLB A;  4K41 A;  1GLE G;  4OPJ A;  3CJ1 A;  1VQM N;  4FWS A;  4PL8 A;  3G4S N;  5KTQ A;  3L2Q A;  1HNZ K;  3H6E A;  2GV9 A;  4CJP A;  4DR5 K;  1U6Z A;  1BIS A;  3WT0 A;  4DFP A;  4W5N A;  1HLU A;  2D0O A;  4ZTJ A;  3H1V X;  4E7H A;  1C0T A;  3GOI A;  4FJ8 A;  3HP9 A;  4DSE A;  3V4I A;  1CZA N;  5CYQ A;  3O4N A;  1VQK N;  4JEP A;  3TSU A;  2FSN A;  1M90 O;  3CJA A;  3RMC A;  2G8K A;  1XC3 A;  1VK0 A;  5GAD P;  5AZI A;  1S1V A;  4YOR A;  1C1A A;  2D0C A;  3HVR A;  1YIJ N;  1U2V A;  5ADX A;  4CEB A;  1GLB G;  1FKO A;  3FFI A;  1X9S A;  2HBM A;  3AVL A;  3RTV A;  4CJQ A;  3V1R A;  3GL1 A;  4F2R A;  1T8E A;  3V1O A;  3M8R A;  4BC4 A;  1N33 K;  1LWC A;  3KLG A;  1HYS A;  1KFS A;  3DXM A;  3SLC A;  2HMP A;  1QTM A;  2UXD K;  1H1V A;  3TAR A;  1UAX A;  1D8Y A;  3DLG A;  1Y64 A;  3T7Z A;  2X74 A;  4LF8 K;  4Z0U A;  3G71 N;  5CY4 A;  1GLA G;  1QS4 A;  4BGB A;  3F9M A;  1L3U A;  2KHO A;  2CH5 A;  1D9F A;  1Q8I A;  4Z4F A;  2OTL N;  2AJQ A;  4JKB A;  4DS4 A;  3LDP A;  5BRD A;  1BOT O;  4B08 A;  4CGH A;  4IG0 A;  1DTT A;  2HND A;  5DMR A;  1W0H A;  4CJT A;  5J1E A;  5HP1 A;  4KFB A;  1JCE A;  4LSL A;  3SJH A;  4JKG B;  3DYA A;  3TI0 A;  3WQT A;  3U9D A;  5AR0 A;  1YT3 A;  4JLH A;  1RT7 A;  4KHQ A;  3J8A A;  4EIA A;  3AVN A;  2IC3 A;  1VAZ A;  4CZH A;  4E0D A;  2KZM A;  3W3D A;  4CEQ A;  5GAG P;  3EYZ A;  3KLF A;  3F9K A;  5MLC Q;  1WSG A;  4IJN A;  4RW9 A;  5EX5 A;  4ISF A;  3B6P A;  3C6A A;  4BG9 A;  3OYJ A;  5LMU K;  3R3L A;  4LF4 K;  1DT9 A;  1WB9 A;  4JK7 A;  3VGM A;  1WSI A;  1HYZ A;  1J54 A;  2Z1J A;  2QK9 A;  1E4G T;  2Q2R A;  2VYP A;  3C7N A;  3OTO K;  3THW B;  2GUP A;  2QW9 A;  4JRP A;  1OKJ A;  1U04 A;  2OCE A;  2WTU A;  4JD2 A;  3WXJ A;  3SYZ A;  1ESV A;  4V19 S;  2HHV A;  3HVT A;  1HX1 A;  1ZBU A;  3N4P A;  3RMA A;  1YI2 N;  1QSS A;  2A6A A;  3E9L A;  5JMV A;  4C8O A;  3O80 A;  4RTF D;  3TAQ A;  1XC9 A;  1NWK A;  2PZS A;  3KKS A;  2DFF A;  1VQ7 N;  3EZ5 A;  3JSM A;  4IOX A;  2O8E A;  3IAY A;  1GOC A;  3P39 A;  2Q3S A;  3EE8 A;  1S5J A;  5M1O A;  1RT1 A;  2WUS A;  1LWF A;  2XO7 A;  2HBL A;  3WXL A;  1K8A O;  1D4X A;  4LSN A;  4YOX A;  4OGC A;  1KAZ A;  1QQN A;  4ZHR A;  1EO1 A;  2KTQ A;  1G15 A;  2YI1 A;  3V9S A;  4I9L A;  4MDB A;  4DTM A;  1DLO A;  4JI2 K;  4HVJ A;  2DY4 A;  4F4K A;  4ID1 A;  3IDH A;  4QS7 A;  2QA4 N;  3HXM A;  4CEZ A;  3UB5 A;  4BQZ A;  4CHP A;  5C25 A;  1TUU A;  3PX6 A;  4H5T A;  1WUA A;  4CHY A;  4PWD A;  1QHT A;  3SMS A;  3PSI A;  1WSF A;  4CJ7 A;  4E19 A;  2I7P A;  3SJJ A;  1HYV A;  1UOC A;  5HLF A;  2FC0 A;  1L3S A;  2B4J A;  5AQS A;  4E3S A;  3QNO A;  3A5O C;  1N5Y A;  1S9G A;  4BC3 A;  3VQA A;  4U7B A;  4KHW A;  2IVO A;  3PIO L;  4HWI A;  4WFA L;  4JK9 A;  3QIO A;  1TKD A;  4FJ9 A;  5GIN A;  1HJO A;  3VQ6 A;  4A2A A;  2Q0R A;  4H5R A;  4FLY A;  1HMV A;  3SQ0 A;  1QQO A;  3FE1 A;  3TTF A;  4CJR A;  3WEE B;  1KLM A;  4B9U A;  2ZWH A;  4GY2 B;  3VQ4 A;  1L5U A;  1S1U A;  2CGL A;  1YVU A;  2DFE A;  3ZSV A;  4WQ4 C;  3CC2 N;  5M1N A;  1SZ2 A;  2Z1I A;  2CGJ A;  4OKE A;  4CJK A;  4QOZ B;  2CH6 A;  4FLX A;  3LPU A;  1C1B A;  4QAG A;  4CW7 B;  3ZET A;  2RPI A;  4JI5 K;  1BI4 A;  2E2Q A;  1NGI A;  3MEG A;  3HPO A;  4WQ5 A;  3K5O A;  3SV4 A;  2FBY A;  5H1S Q;  4MQ3 A;  4DWI A;  1CLQ A;  1G99 A;  3DAW A;  3VQC A;  1VSJ A;  2GEL A;  3DLK A;  3UKR A;  1B9F A;  3QBX A;  5CYM A;  5KPT A;  1RDB A;  1RIL A;  4CJ4 A;  2QEX N;  3MX5 A;  4FXD A;  4AIL C;  3B8A X;  4BRG A;  2ZM6 K;  4JKA A;  4KRF A;  2AP1 A;  4H0X B;  4CIF A;  4KPY A;  3M1F A;  1WSE A;  3AGK A;  4MO4 A;  3VQ5 A;  4BRO A;  2W42 A;  3V81 A;  5T7B A;  3OHR A;  1T03 A;  4FSV A;  4B3R K;  1BQM A;  2A5X A;  3LP2 A;  3SI6 A;  4CFD A;  3N4Q A;  3SQ1 A;  3RR8 A;  5AQR A;  5LL6 Z;  3U3Y A;  4NXM K;  3CFP A;  3DLH A;  3U6F A;  2HBK A;  3LAN A;  4GKK K;  4E7J A;  5GAH P;  3ZCM A;  1XNQ K;  3PO5 A;  4A5A A;  2F9W A;  1ATS A;  3ZT0 A;  3OY9 A;  3VQD A;  4CJW A;  3M3Z A;  4DF4 A;  1N6Q A;  5M1Q A;  3WUH A;  4CEE A;  2D5R A;  5JVG L;  1ASW A;  4HCB A;  3AGR A;  3EO3 A;  3MED A;  3O9S A;  3ID6 A;  4CJU A;  3K57 A;  3VPZ A;  3C6H A;  3HOS A;  1SL0 A;  4CHZ A;  3G6E N;  1BGX T;  2YHX A;  1DTQ A;  2Z1H A;  2KLA A;  4BR0 A;  4KO0 A;  1X1P A;  4QS8 A;  4CZJ A;  3QEP A;  2KFZ A;  3HJF A;  2IVP A;  4JAX A;  3AV9 A;  1HJR A;  4JN4 A;  4BDY A;  3OA9 A;  2P9U A;  3Q7C A;  1XI1 A;  4JKG A;  3SPZ A;  3U8X A;  3ZSX A;  3KKR A;  1ATR A;  2F8S A;  3LP1 A;  4BR9 A;  4Z4C A;  3AA2 A;  5ELZ A;  3HP6 A;  1JLE A;  4W5Q A;  5CHI A;  3VEN A;  3HBT A;  4RW4 A;  1J5E K;  2P9K A;  3O08 A;  2NRW A;  3LDL A;  1JXE A;  5I9E B;  3J80 O;  4FWR A;  1NKB A;  4CJF A;  2RE2 A;  2A42 A;  2IOC A;  1QVF M;  1FXX A;  4FOI A;  3QEW A;  2PYJ A;  1QE1 A;  4PA1 A;  3CFO A;  4LF6 K;  3TAG A;  4EFH A;  2QXL A;  4RW6 A;  2IGI A;  5HRS A;  2BE2 A;  4H4M A;  3P83 D;  3A5L C;  3V9W A;  4YOW A;  1K8K B;  4E89 A;  1RDD A;  2QKB A;  3PV8 A;  5AQK A;  4A59 A;  3NVK A;  4CJV A;  4NCA A;  4LH4 A;  3SZ2 A;  5DM6 L;  4B9V A;  3O3F A;  1B92 A;  3P38 A;  2BTF A;  4BRD A;  5BN8 A;  2OTJ N;  2I7N A;  3OS1 A;  4Z4I A;  2ZGZ A;  3THV A;  1TK8 A;  3DRP A;  1TAQ A;  5AQO A;  2ETJ A;  4A57 A;  4GV9 A;  1BCM A;  3EY1 A;  3LM9 A;  5EVZ A;  5EY4 A;  3E1Y A;  4KTZ A;  3FR0 A;  3LDQ A;  3O1B A;  4L3Q A;  4BC5 A;  4HUE A;  3KWG A;  4IDH A;  1EET A;  4I7F A;  2QWM A;  3VEV A;  2O8C B;  2FBV A;  1LW2 A;  4CJL A;  1U45 A;  3H45 C;  1KAY A;  5LJV A;  5GAE P;  1T05 A;  3DI6 A;  4B1Z A;  1OVY A;  1NKE A;  3T1H K;  3HST B;  3K58 A;  5KGW A;  2VQF K;  2DFH A;  4DV5 K;  3QER A;  4M3R A;  1EX4 A;  1WLJ A;  4KHS A;  5HRP A;  3O9Q A;  4PQU A;  1NGG A;  1JCG A;  3GE1 A;  3KD5 E;  2XY8 A;  1RDU A;  4Z4E A;  4FZZ A;  1Q9X A;  3KIO A;  4O55 A;  3K5N A;  3H3O B;  3AA5 X;  1YXQ A;  2QWL A;  4ICL A;  4J2D A;  1NK8 A;  3R8E A;  1NLV A;  2ZJP L;  1W2B M;  2P9L B;  2E2N A;  2ITG A;  3L2R A;  1WBB A;  3VA0 A;  3HYF A;  3BGR A;  3K59 A;  3LZI A;  1Q81 O;  1ZXO A;  4BRQ A;  1VSK A;  3R9P A;  4Y1D A;  4EZ9 A;  1KTQ A;  3VQ7 A;  1GLD G;  2V51 B;  3UKU A;  4F3T A;  2JWK A;  2QTD A;  2E20 A;  3CQY A;  3MN6 A;  4IFY A;  4CFB A;  3D2F B;  5K14 A;  2KZZ A;  4IO8 A;  2NRH A;  4KI4 A;  4CZM A;  4QS9 A;  3VQB A;  4KB1 A;  4M45 A;  4JI3 K;  4GNI A;  4BR4 A;  3L8B A;  5E84 A;  3OYB A;  3ZSW A;  1IJJ A;  4OVL A;  4JV5 K;  4B1Y B;  1L3T A;  2JLE A;  3D2F A;  1KXP A;  4IFV A;  1S3X A;  1BQN A;  4FWM A;  3RMB A;  4X66 K;  5JS1 A;  2HHQ A;  5BPL A; 
#chains in the Genus database with same CATH homology
 1VSH A;  4KHQ A;  1VRU A;  3KJV A;  3AVN A;  3I0R A;  1IH7 A;  2IC3 A;  1LW0 A;  4FCY A;  4DLE A;  3LWL A;  4DQS A;  4DQP A;  4IKF A;  2KFN A;  1JL2 A;  4E0D A;  3HPH A;  2KZM A;  1IKV A;  2RF2 A;  4CEC A;  4NYN A;  4CK2 A;  5J2M A;  4CEQ A;  2A1S A;  3EYZ A;  3KLF A;  2Y1I A;  3K5M A;  1LV5 A;  2NUB A;  3F9K A;  3DLE A;  3M8Q A;  4R5P A;  4FJJ A;  3QEX A;  1KRP A;  1WSG A;  1D9D A;  3PY8 A;  4RW9 A;  1NJX A;  1RTD A;  4Z4H A;  2OPP A;  3MXM A;  3B6P A;  3OYJ A;  5FRM A;  4G1Q A;  4E1N A;  3UIQ A;  3OS2 A;  4F2S A;  1WSI A;  1HYZ A;  1S1W A;  1J54 A;  2Z1J A;  5HRR A;  3SUO A;  1RTI A;  4ELV A;  2QK9 A;  1GOA A;  3P5J A;  1VSM A;  4IBN A;  4M3U A;  3SUN A;  3O3H A;  1ZBL A;  4DSJ A;  1LAW A;  3OYE A;  3NGY A;  1EKE A;  2KQ2 A;  4CGI A;  2XY6 A;  4JRP A;  1U04 A;  3AVI A;  5SZT A;  1ZBF A;  1TKT A;  3HPG A;  4AHU A;  3F73 A;  3NCI A;  3SYZ A;  2QKB A;  4E7K A;  2HNZ A;  2HHV A;  3RRG A;  3HVT A;  1R0A A;  1ZBU A;  3VA3 A;  3SQ4 A;  3RMA A;  4FK0 A;  4FJX A;  1RT4 A;  1TGO A;  4BE1 A;  1QSS A;  2G8I A;  4DSL A;  3AA4 A;  1NKC A;  3SUQ A;  4GMJ B;  2G8F A;  1BI4 B;  3AA3 A;  3AO3 A;  3DMJ A;  5FDL A;  4AHC A;  4C8O A;  3OYF A;  4KRE A;  3AVF A;  3TAQ A;  3S3N A;  1XC9 A;  4IDK A;  1ZBH A;  1XHX A;  4M3Z A;  1ZYQ A;  2PZS A;  3C6U A;  3KKS A;  2DFF A;  2VWJ A;  3EZ5 A;  1VSD A;  3JSM A;  1J53 A;  1HQE A;  1U47 A;  3AVJ A;  2IAJ A;  4DQI A;  4CES A;  3S9H A;  2F8T A;  4CHQ A;  2P1J A;  2HNY A;  3LAM A;  4XIU A;  4DTU A;  3IAY A;  4KHY A;  3U3G A;  4FZY A;  3TAP A;  3VQE A;  1GOC A;  1RBV A;  1NK6 A;  1HRH A;  4KTW A;  4FW2 A;  4B8A B;  1J5O A;  1KVB A;  3S3M A;  1QSL A;  5KI6 A;  2Q3S A;  2EHG A;  1TK5 A;  1S5J A;  4CIG A;  2IDO A;  2OPS A;  1JXB A;  3I0S A;  2YNH A;  2HHX A;  1RT1 A;  4OPK A;  1LWF A;  2XO7 A;  3BDP A;  2Z1G A;  2VG6 A;  4LSN A;  3ZSQ A;  5I3U A;  4M3T A;  1EXQ A;  1EP4 A;  3NBP A;  4OGC A;  3KLE A;  4ZHR A;  2OZM A;  3VN5 A;  4FK2 A;  4O5B A;  2KTQ A;  3KK1 A;  2BGG A;  2VWK A;  2FBT A;  1TAU A;  1G15 A;  3T19 A;  4O44 A;  1CZB A;  1YTU A;  1QQC A;  4CK1 A;  4I9L A;  3V9S A;  4DTM A;  1DLO A;  1IKW A;  1T7P A;  2F96 A;  4K8X A;  3C6T A;  4H4O A;  1X9M A;  4HVJ A;  4FYD A;  2DY4 A;  3ZSO A;  4F4K A;  3ULD A;  4ID1 A;  3HXM A;  2X78 A;  4CEZ A;  3LDS A;  3AVH A;  3HM9 A;  4JS4 A;  2FBX A;  4CHP A;  3K2P A;  5C25 A;  3PX6 A;  4AHR A;  3AO4 A;  3V1Q A;  3VQ8 A;  4CHY A;  1K6Y A;  4PWD A;  1QHT A;  4DFK A;  3ZT3 A;  4O0I A;  3OS0 A;  3VQP A;  3KK3 A;  4BWM A;  4FM2 A;  5J2P A;  4DTN A;  4B9N A;  1NK5 A;  1NK7 A;  2OPQ A;  5FRO A;  2HMI A;  1WSF A;  4E19 A;  3SJJ A;  1HYV A;  1UOC A;  4W5T A;  5KGX A;  5HLF A;  2I5J A;  2FC0 A;  4CIE A;  2B4J A;  1L3S A;  2HHT A;  4I2Q A;  3OJS A;  4FVM A;  4E3S A;  3QNO A;  4FJK A;  1RNH A;  2YHA A;  2YV0 X;  2ZE2 A;  3D0P A;  1NK9 A;  4DSK A;  2DTU A;  1S6Q A;  3MEC A;  1N5Y A;  3PO4 A;  1SL2 A;  1S9G A;  3VQA A;  4J2E A;  1FKP A;  2RKI A;  2G8W A;  4DSF A;  4KHW A;  4JRQ A;  1NOY A;  4QCL A;  3RRH A;  3OYI A;  5C24 A;  4UQG A;  4KKO A;  1RT3 A;  3QIO A;  1I39 A;  1TKD A;  4FJ9 A;  2YNF A;  1U4B A;  4N56 A;  3VQ6 A;  1NJW A;  1O1W A;  3ZSY A;  1WSJ A;  3VQQ A;  1SUQ A;  2ATQ A;  3V6D A;  1FK9 A;  3DRR A;  4FLY A;  3TR8 A;  1HMV A;  1JLA A;  3SQ0 A;  3MEE A;  4CJR A;  4CGF A;  3IS9 A;  3LPT A;  3NF9 A;  4BDZ A;  2VG7 A;  3QLH A;  1KLM A;  3NF7 A;  4B9U A;  4KHU A;  4FJN A;  4KV8 A;  3KTQ A;  3P1G A;  3LAK A;  4FM1 A;  3VQ4 A;  3TAB A;  3PUF A;  4Z4G A;  1L5U A;  1S1U A;  1TVR A;  4L8R B;  3QIN A;  1YVU A;  4DTJ A;  1RT2 A;  3SCX A;  2DFE A;  3ZSV A;  1JLG A;  3OJU A;  1KFD A;  1KVC A;  3CM5 A;  4MFB A;  2Z1I A;  2E6M A;  4N76 A;  1A5X A;  3M8P A;  5KRT A;  4OKE A;  4CJK A;  4Q5V A;  3L3U A;  2ZD1 A;  1A5W A;  1U48 A;  3HO1 A;  4QOZ B;  4FLX A;  3LPU A;  4OKJ A;  1UWB A;  3AO2 A;  4CER A;  3S3O A;  1NJY A;  1LWE A;  1ASU A;  4LY7 A;  1C1B A;  4OGE A;  4QAG A;  4CF2 A;  1NK0 A;  4J2B A;  3L2V A;  3ISN C;  4KHN A;  2RPI A;  4KAZ A;  4KTQ A;  4CFA A;  2HW3 A;  1BI4 A;  1YTA A;  3MEG A;  3HPO A;  3QIP A;  3MAQ A;  4FK4 A;  3K5O A;  3SV4 A;  2FBY A;  4OLA A;  3SNN A;  4DQR A;  1SKS A;  4MQ3 A;  4DWI A;  1RT5 A;  1CLQ A;  1GOB A;  1RBS A;  4W5R A;  3M8S A;  1TK0 A;  4F3O A;  3VQC A;  1VSJ A;  3DLK A;  4AHS A;  4Z4E A;  2BDP A;  4AH9 A;  4M42 A;  4EP4 A;  2E6L A;  2YNI A;  1IG9 A;  1B9F A;  5CYM A;  2XHB A;  4HTU A;  1RDB A;  1RIL A;  4CJ4 A;  3NAE A;  4J2A A;  2KW4 A;  5D3G A;  4CGG A;  3LWM A;  3NH1 A;  2YKM A;  2R7Y A;  2B6A A;  4DU3 A;  3WNF A;  4E7I A;  4CK3 A;  4AIL C;  1NJZ A;  4FXD A;  1QSY A;  1SKR A;  3ZT4 A;  2JGU A;  3WNG A;  4KRF A;  4CIF A;  4KPY A;  1WSE A;  3OYL A;  3IG1 A;  1RDC A;  2QXF A;  2B5J A;  3VQ5 A;  4CEF A;  3HK2 A;  2XY7 A;  5FRN A;  3A2F A;  3NHG A;  4HCC A;  2W42 A;  4CJ3 A;  4B3O A;  4GVM A;  3V81 A;  4I9Q A;  5T7B A;  3LAL A;  1T03 A;  4DFM A;  4E1M A;  1BQM A;  4CJ5 A;  1XWL A;  2P51 A;  4B8C A;  3LP2 A;  1MU2 A;  4CFD A;  3SI6 A;  3DOL A;  3MXI A;  3SQ1 A;  3RR8 A;  4ID5 A;  1HNI A;  5CZ1 A;  3V9U A;  1J9A A;  4FJG A;  3AO1 A;  4N47 A;  3U3Y A;  1SKW A;  3CFP A;  4FLV A;  4DSI A;  3DLH A;  4HUF A;  3U6F A;  3DM2 A;  3LAN A;  4KB0 A;  4DG1 A;  1RCH A;  2X6N A;  4FLW A;  3LP3 A;  3ZCM A;  3E01 A;  4RW7 A;  4E7J A;  3TAE A;  1D5A A;  1HQU A;  3CM6 A;  4CF9 A;  1X9W A;  4O4G A;  3PO5 A;  1JLF A;  3OYG A;  3ZT0 A;  5KRS A;  3OY9 A;  3VQD A;  4BE2 A;  2O4I A;  3AVA A;  3D45 A;  3VQ9 A;  1JLQ A;  4EP5 A;  1REV A;  4F8R A;  4B9L A;  4CJW A;  4DU4 A;  4DF4 A;  1N6Q A;  2ZQB A;  2HHS A;  4FLU A;  3V9X A;  1IKX A;  3RMD A;  1NOZ A;  2OPR A;  1WAF A;  2D5R A;  3OVN A;  1ASW A;  4IG3 A;  1I3A A;  4AHT A;  4CEE A;  2PY5 A;  4HCB A;  3CYM A;  5EU7 A;  3MED A;  4CJU A;  4JS5 A;  3K57 A;  4BAC A;  5HRO A;  1KSP A;  1SL0 A;  4DTR A;  1W9H A;  4CHZ A;  4N5S A;  4FZX C;  1BGX T;  3DRS A;  3CQ8 A;  1BL3 A;  4CHN A;  3L2U A;  1DTQ A;  2O4G A;  2Z1H A;  3AVG A;  5CZ2 A;  4CHO A;  4OKK A;  3NH2 A;  1S9E A;  1RBT A;  1X1P A;  4KO0 A;  4H8K A;  4DTP A;  5JS2 A;  4OJR A;  1JLB A;  3QEP A;  5DK5 A;  1TKZ A;  4OLB A;  4ZTF A;  2KFZ A;  1TV6 A;  3HJF A;  3MXJ A;  4WE1 A;  3CFR A;  1WAJ A;  5HBM A;  2YHB A;  3AV9 A;  3SV3 A;  4K8Z A;  1HJR A;  4FLZ A;  4BDY A;  1KCF A;  3AVK A;  1XI1 A;  1IO2 A;  4RW8 A;  4DFJ A;  1C0U A;  4C8K A;  3SPZ A;  4CJE A;  3AVC A;  4PY5 A;  4CGJ A;  1WNS A;  3ZSX A;  3L2W A;  3KKR A;  4DF8 A;  2F8S A;  1HNV A;  2D0A A;  2IS3 A;  2RN2 A;  3AO5 A;  4NCB A;  3QET A;  1KLN A;  3LP1 A;  3HT3 A;  4HHT A;  4Z4C A;  3OYH A;  2P5O A;  3AA2 A;  4DTS A;  1F21 A;  5C42 A;  2Y1J A;  3HP6 A;  1JLE A;  4W5Q A;  3PX4 A;  1VSI A;  4FJH A;  4RW4 A;  4YNQ A;  4FJM A;  1JXE A;  2XRI A;  3OYA A;  5E41 A;  3NGI A;  2HVI A;  4Q0B A;  1NKB A;  2OA8 A;  1Q9Y A;  3NFA A;  2X6S A;  3OYC A;  1ZBI A;  4CJF A;  4YFU A;  4M41 A;  3O4Q A;  1JL1 A;  3NGZ A;  2QKK A;  4M3W A;  3OYK A;  2IOC A;  1CXU A;  3ALY A;  1Y97 A;  1FXX A;  3DLR A;  3QEW A;  1SV5 A;  3L3V A;  1ASV A;  2PYJ A;  3WNH A;  1RDA A;  1TKX A;  2G8U A;  1QE1 A;  4PA1 A;  3CFO A;  4M3X A;  3T1A A;  4FJ5 A;  4NYF A;  3TAG A;  1A5V A;  4RG8 A;  4RW6 A;  3G0Z A;  1S1T A;  2G8H A;  2IGI A;  1WN7 A;  5HRS A;  4AHV A;  2WOM A;  4FM0 A;  3C94 A;  2A1R A;  3LP0 A;  1WSH A;  2P5G A;  4FJI A;  2BE2 A;  4H4M A;  1LAV A;  4B9S A;  3O3G A;  3P83 D;  5SWM A;  1NK4 A;  3KK2 A;  4CCH A;  1BHL A;  1VSL A;  4CEA A;  2EX3 A;  1JLC A;  3I8D A;  3V9W A;  2HHW A;  3ZSZ A;  4E89 A;  1RDD A;  3AVB A;  3LZJ A;  4ELU A;  4DS5 A;  1CXQ A;  3PV8 A;  4CE9 A;  4BDP A;  2GUI A;  2E4L A;  4HUG A;  4PUO A;  3SPY A;  4CJV A;  4CED A;  1U49 A;  4NCA A;  4LH4 A;  4CF8 A;  3SZ2 A;  4KI6 A;  1VSF A;  4LD0 A;  4NCG A;  4B9V A;  1RBU A;  3TAN A;  3O3F A;  1B92 A;  2WON A;  3AVM A;  1RTJ A;  1VSE A;  2BAN A;  4EZ6 A;  1S6P A;  2LSN A;  3OS1 A;  5J2N A;  4Z4I A;  3DOK A;  3QO9 A;  4CGD A;  3THV A;  1TK8 A;  3DRP A;  1TAQ A;  3OYM A;  3DLB A;  2ETJ A;  2GBZ A;  4OPJ A;  3IRX A;  1BCM A;  2D0B A;  4M3Y A;  3EY1 A;  5KTQ A;  1Z26 A;  3QEI A;  3L2Q A;  1UA1 A;  2HHU A;  4C8N A;  4FLT A;  2GV9 A;  1C0M A;  4KTZ A;  1VRT A;  3ZT2 A;  4CJP A;  4HUE A;  4CEO A;  1BIS A;  3HL8 A;  4DFP A;  4W5N A;  3RR7 A;  4E7L A;  2HVH A;  1BCO A;  1EET A;  4I7F A;  4B9M A;  3QNN A;  4ZTJ A;  2FBV A;  1TL1 A;  1KVA A;  1LW2 A;  4CJL A;  5J2Q A;  1U45 A;  3CG7 A;  3ZT1 A;  4E7H A;  3G10 A;  1C0T A;  2YNG A;  1BIU A;  4FW1 A;  4FJ8 A;  3HP9 A;  4DSE A;  3V4I A;  1T05 A;  5CYQ A;  3O4N A;  3PX0 A;  3DI6 A;  3TAF A;  1NKE A;  3HST B;  3K58 A;  5KGW A;  3QER A;  2DFH A;  4M3R A;  1EX4 A;  1WLJ A;  3ITH A;  3SUP A;  2G8K A;  3RMC A;  4KHS A;  5HRP A;  4PQU A;  1VK0 A;  3KD1 E;  3JYT A;  4Y1C A;  3NF6 A;  2XY8 A;  1IKY A;  4CFC A;  2VG5 A;  1S1V A;  1S1X A;  4I2P A;  2G8V A;  3KD5 E;  4FZZ A;  3T3F A;  1C1A A;  1B9D A;  2D0C A;  3HVR A;  1Q9X A;  3K5L A;  3KIO A;  4O55 A;  4CEB A;  1SL1 A;  1FKO A;  4TSX A;  3WNE A;  3AA5 X;  3FFI A;  3NF8 A;  3K5N A;  1X9S A;  3AVL A;  3C95 A;  3RTV A;  1UA0 A;  4ICL A;  4CJQ A;  4ELT A;  1Z25 A;  4GW6 A;  3V1R A;  1NK8 A;  3KLH A;  1TL3 A;  1ITG A;  4J2D A;  3B6O A;  4F2R A;  3ASM A;  4DLG A;  3NE6 A;  1T8E A;  1CZ9 A;  3V1O A;  4DU1 A;  2ITG A;  3M8R A;  2PYL A;  3L2R A;  1LWC A;  3VA0 A;  3HYF A;  3H08 A;  3BGR A;  3K59 A;  3KLG A;  1HYS A;  3LZI A;  1KFS A;  4O0J A;  2HB5 A;  1QTM A;  4CJS A;  3ZSR A;  1VSK A;  4Y1D A;  4CF0 A;  4CF1 A;  3NDK A;  4DTO A;  3TAR A;  1UAX A;  4EZ9 A;  1D8Y A;  3DLG A;  2X74 A;  3V9Z A;  1KTQ A;  3VQ7 A;  4FJL A;  4Z0U A;  5CY4 A;  2OZS A;  1QS4 A;  3TWH A;  3TAM A;  2XY5 A;  1L3U A;  4BE0 A;  1D9F A;  1HPZ A;  1Q8I A;  4Z4F A;  4F3T A;  5I42 A;  4C8M A;  2AJQ A;  4IFY A;  4CFB A;  4LH5 A;  4DS4 A;  5K14 A;  1C1C A;  4C8L A;  1L3V A;  4N41 A;  1JKH A;  2KZZ A;  4B08 A;  5HRN A;  3NH0 A;  4KI4 A;  4CGH A;  4IG0 A;  1DTT A;  2HND A;  3KLI A;  3VQB A;  5DMR A;  1W0H A;  4M45 A;  1RTH A;  4CJT A;  3OYN A;  4KB1 A;  5J1E A;  3L8B A;  3QEV A;  1XHZ A;  3OYD A;  3QES A;  3OYB A;  3ZSW A;  4OVL A;  4DTX A;  3SQ2 A;  5HP1 A;  4KFB A;  4B9T A;  1L3T A;  4FJ7 A;  2JLE A;  4BWJ A;  4DMN A;  4LSL A;  4DQQ A;  1BIZ A;  2OYQ A;  2YKN A;  3DYA A;  4IFV A;  1BQN A;  3RMB A;  1C6V A;  3RWU A;  5JS1 A;  3TI0 A;  1RBR A;  2HHQ A;  1RT6 A;  1YT3 A;  4W5O A;  4JLH A;  1RT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...