1RT4A

Hiv-1 reverse transcriptase complexed with uc781
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
542
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
total genus 147
structure length 536
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt4A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt4A05
3CJ2A 1SKSA 1KRPA 5JS1A 5C25A 3ZT2A 1FK9A 2YKNB 2IJNA 4ELTA 4CFDA 3GYNA 2A1SA 4NLSA 2J6SA 3M8QB 2DPIA 2OPRB 4KKOA 2FLPA 2OH2A 3DLEA 4YR2A 2OPSA 4EBDA 4KHQA 3L3UA 3PVXA 1YVFA 3V6DB 4EZ6A 3RWUA 3RR7A 4R8UB 2V9WA 4QPXA 3L2WA 1C2PA 3M9MB 1FKPA 3OLBA 4JUZA 4CHPA 3LP2A 3V81B 5F8LA 3FQKA 3U6FA 3VA0A 4BDPA 3NGZA 3OJUA 3OS0A 3BGRA 3KLGB 3FQLA 3CJ4A 4J9NA 1IKXB 4EBEA 1NJZA 4PQUB 1EETB 2DFHA 4OPJA 5KG0A 3V6KA 4CEZA 3PX4A 1WSHA 4RZRA 3AVGA 3QEWA 3OYGA 1DTQB 5CYMA 5L9XA 4F8RA 1OS5A 2YNHB 2G8UA 1N6QA 4ZPBA 2JC0A 4EYHB 3DMJA 4WFXA 4EYIB 3OYLA 2VWJA 4GVMA 3CJ3A 3M8SA 3KLEB 4JRPA 4QAGA 2FLNA 2CKWA 5T7BA 4TLRA 4FK4A 4KKOB 2XGQA 1L3SA 3LWLA 1U47A 4KTWA 2FBYA 1JL2A 3DRRA 5KFSA 3KNAA 1NHVA 4RW9A 3V9XA 1D8YA 1TQLA 2HNZB 3PW0A 2I5JB 1BIUA 3ALYA 3S3NA 2R8JA 4CK3A 4FBTA 2QK9A 4FK2A 4Y2AA 1HARA 1LW0A 1NOZA 1D1UA 1LAVA 4Y1DA 1REVB 4IKAA 3TAFA 3O3HA 1LV5A 2G8VA 4I9QA 2R8HA 4E7LA 3RMDA 2VG5A 1QTMA 2WOMA 4TN2A 3BGRB 1ZBFA 2D7SA 2IAJA 3OHAA 4BACA 2B6AA 3T5HA 3DRPA 1JXEA 2ZD1A 3N6LA 2WHOA 4IRKA 3GV5B 4TQSA 1HNVA 4IOBA 1XR6A 1ZBHA 4DL3A 3QO9A 5CYMB 4K4SA 4R0EA 4M3XA 1BQNA 3DLGA 4AHCA 4KFBB 4FJJA 1RT6A 1C0TA 2KQ2A 3CDUA 4CHNA 3TI0A 3DMJB 3SQ0A 2C2RA 4TSXA 4FLZA 1UA0A 4CJSA 4IQXA 3VQDA 1NNDA 4K8XA 3OYNA 5KG5A 2E4LA 2X74A 4J9KA 3VQ4A 1A5VA 4FZZA 1XHZA 2XC9A 2E6MA 1JLEA 4BWMA 3MTKA 4DFJA 3HPHA 4ECTA 4TXSA 1Q8IA 4RW9B 4F50A 3AV9A 4CJWA 2P1JA 3LANA 2GBZA 3NGIA 4ECSA 2ASLA 1RTHB 3AVHA 4L8RB 3MXIA 1LW0B 4M3ZA 4QWCA 2V4RA 1W9HA 4F2SA 3SJJA 1RTDA 4DQSA 4DU4A 3SQ2A 3IAYA 4PY5A 3VQEA 2WOMB 1EP4A 1L5UA 1IKVB 3D45A 4DSEA 2IAJB 3QIOA 3SQ1A 4B3OB 4E7HA 3H08A 3KMQA 3OL8A 3ITHA 3DM2A 2UUTA 3D0PA 3H4DA 2E9RX 1NK4A 2OZMA 3K58A 3MEEA 4F3TA 3IS9A 2AGQA 2B5JA 1KVCA 3Q8RB 2FVPA 3QO9B 1BQNB 1N48A 4AHSA 1S6PB 3PW4A 3DLGB 3L2QA 3SV3A 3KD1E 2J6UA 1RT6B 1C0TB 4ECWA 1Y97A 1A5WA 3KD5E 1O1WA 5DGBA 2AGOA 5CZ1A 4RNHA 4IH5A 4DU1A 5KFTA 1FKOA 3GIKA 3CYMA 3LALA 3VQ6A 1RA7A 3TAEA 2X78A 3H40A 1JLEB 1TL1B 1B92A 5C24A 1JXLA 3TAPA 1SH0A 3BSNA 3OHBA 4QCLA 5T14A 4FZYA 1TKXA 4K50A 2NUBA 1RTDB 4IDKA 1T7PA 3OL9A 1EP4B 4IH7A 2UVVA 3NKYA 2RN2A 2YKMB 4IG3A 5KT4A 1T05B 3EZUA 3LPTA 4KHMA 4MK8A 5KTQA 2ETJA 1RA6A 3MEGB 1KCFA 2AX0A 3HPGA 3DM2B 3QESA 2GUIA 2IA6A 3C6TA 4I2PA 3WNFA 3FFIA 5DLFA 2HMIB 1W25A 2XI2A 2B5JB 4FM2A 3LDSA 3WNHA 3H5SA 5DGAA 1HMVB 4Z4FA 2W42A 4DL7A 1QUVA 3ZSVA 1RDRA 1RBVA 3SPZA 3V4IA 2E9TA 3DYAA 3HP9A 5I3UA 4ECYA 4ZHRB 4TYAA 4KB1A 1NK9A 1NK7A 4CJLA 3G10A 2KZZA 3VQBA 2UVUA 3UIQA 5KFKA 4NLWA 3GIMA 1BI4A 1NK5A 1LWCB 1KSPA 4KRFA 4N41A 3KJVB 1KHWA 3MXJA 4J2AA 4E19A 3AVBA 1ASVA 2KTQA 1TKXB 3ASMA 1C6VA 3V6JA 1HQUA 3BSCA 2RF2A 1QE1A 4IG3B 2R2SA 2UVWA 5HRPA 2X6SA 4FLTA 4NCGB 2EX3A 3HYFA 1S49A 2D0AA 3UQSA 2WK4A 4WFYA 1WSEA 2BANA 2WTFA 1HYZA 4F2RA 3S3MA 5J2PA 1RBTA 1WAJA 3KKSA 4FJXA 4I2PB 3I0RA 4O0IA 2WB4A 1RTIA 3CIZA 4DS5A 1RBSA 4FYDA 3RBEA 3DDKA 4ED2A 3P1GA 4ED1A 3FDSA 4JLHA 4DWIA 3N6NA 4B08A 3Q8QB 4MH8A 4J2BA 3BJYA 4OGEA 3V4IB 4M3RA 3MAQA 3TVKA 5D3GA 3HK2A 4O3OA 4H4OB 2G8WA 4E7IA 5I3UB 4CJKA 2W9AA 3DLHA 4CF8A 3HVTA 1TKTA 1T94A 1D9DA 5HROA 5EU7A 2R8GA 4ICLB 3NAHA 1R0AB 1SKRA 1NKBA 1TKZA 4M3YA 1GOAA 5L1JA 1TAUA 1T8EA 4CK1A 1XC9A 3ISNC 3ZCMA 2J6TA 1HQEA 1LW2A 2W9CA 3M8RA 4WZQA 4OPKA 4FZXC 2Z1JA 1S9FA 1NHUA 4AHTA 3T1AA 2E6LA 2W9BA 2RF2B 1JX4A 4N76A 5KFXA 1BCMA 3RB3A 4Y1CA 1SUQA 3BSAA 4ID1A 1BQMB 4LQ3A 3F73A 1S4FA 3HP6A 1C0UB 1VSKA 4E1NA 4PUOB 2FVCA 2E9ZA 4QW8A 3H98A 4B9VA 5FRMA 4CERA 5FDLB 3S9HA 3AVMA 4MK7A 1C0MA 1RTIB 2G8FA 1WSJA 1RT7A 3KLVA 4ZMMA 3NGYA 2VG7A 4IFYA 4GC6A 1IH7A 3HT3A 4FLWA 4CHYA 2AGPA 2IBKA 4RG8A 1NK8A 1X1PA 4KSEB 1IM4A 2Q3SA 4UQGA 5J2NB 3PHEA 1S10A 1RTJA 5KG3A 3HVTB 1K1QA 3PJWA 3ZT1A 3HXMA 4BDZA 4JV1A 2LSNA 1L3TA 1BGXT 2ATLA 4DSJA 4IKFA 1T3NA 1RT1B 3CDEA 4OKEA 4WXOA 4N5SA 2YHBA 3WNGA 1ASUA 1LW2B 3C95A 1S1WA 1JKHA 3PO5A 3H2LA 1B9DA 2WONB 3AO4A 5KG2A 3TAMA 1Z4UA 5KFZA 4NLDA 5KG4A 2W9BB 4CK2A 4LSNA 5HLFA 4NLGA 2D3UA 4O4GB 4WFZA 3QETA 4KTQA 3H5UA 5DG8A 4HUEA 1JLFB 5HBMB 4TY9A 3T5JA 1S9GB 4J9OA 4KHSA 1RT2A 1NOYA 3QIPB 2HHTA 2BDPA 2VG6A 4CIEA 3PY8A 2VG7B 4IFYB 2EC0A 4TY8A 5SZTA 4KREA 4OLBA 4K4WA 4B9MA 4CEBA 2HHUA 4OL8A 4WE1A 4DFMA 3LZJA 5KGWA 2G8KA 1CXQA 1XHXA 4CJTA 5DG9A 1JLGB 4CHOA 1IKYA 2FVRA 2YNIA 3HVAA 4HHTA 4EEYA 4O3NA 2Z1IA 4ZP6A 1S1TA 4LQ9A 3I0SB 3H5YA 3DI6A 3ISND 5J2MB 3F9KA 5CY4A 4EP4A 1S1WB 3M8PB 1QS4A 3AVKA 1VSDA 1U45A 4O44A 4JV2A 2YNGB 2ASDA 2O5DA 4DSIA 4EO6A 4MQ3A 4CEDA 1LAWA 3MFIA 5HLFB 1BL3A 3SI8A 4K4XA 4Q44A 4K4TA 4O5BA 3LAMA 2FBXA 4C8KA 2F8EX 3KLFA 3OYCA 3BQ0A 1RT2B 1S0MA 2RDJA 4ECVA 4URSA 2A1RA 4B9TA 4PWDA 2PYLA 5C25B 1FK9B 4ED0A 5KFFA 3BQ1A 2C2EA 1B9FA 3E01A 4I7FA 3PJXA 4MK9A 4TY8B 1Z25A 1MMLA 1VSIA 1HYSA 3ICLA 4K4ZA 2HNYA 2BQUA 1C1CA 4WE1B 2AJQA 4DTMA 3DLEB 4O0JA 2OPSB 3I5BA 2HWIA 5HRNA 3OVNA 2Y1JA 4Z4EA 3O4NA 1TK5A 4Y2CA 3RBDA 4ZPAA 4YFUA 4O3PA 1BIZA 5J2QA 1GX5A 1FKPB 1S1TB 3AA5X 4JS5A 4DEZA 4DTUA 3LP2B 2IMWP 3DI6B 1RDBA 4KE5A 2KZMA 2XWYA 3AVIA 2JEIA 2XI3A 3O3FA 1CSJA 1DTTA 3NH2A 5KFWA 4O44B 2R7YA 4J9PA 4FJGA 2XY6A 1J9AA 3N6MA 4FJIA 4FS2A 3CO9A 4DMNA 2OPPA 2XRIA 4ZVHA 5KT6A 4O3QA 1JLCA 3IGNA 5F9LA 4Z4CA 2IM1A 2VA2A 4CIGA 4LSLA 1RT4A 1UOCA 5L1LA 3FSIA 3HVWA 1X9WA 3C6UA 3G6XA 4CFAA 4YR0A 2ASJA 4HYKA 5EUHA 1N6QB 3DLBA 3THVA 2BQ3A 1HPZA 1BHLA 4URGA 4ED8A 4MFBA 2JGUA 1C1AA 4GMJB 2F8TA 1VRUA 4B8AB 2XCAA 4I7FB 3HKWA 4KBIA 4FBUA 2ZE2A 4OVLA 1HYSB 3NCIA 1NK0A 4RW6A 1EX4A 4NYZA 1SL0A 1JLBA 3MF5A 4FLXA 4QWAA 3DRRB 4CJVA 4GC7A 1XWLA 3ZSOA 4FJKA 3Q8PB 3GQCA 1CXUA 4KHNA 3DOLA 3KLHA 1ZBLA 5KFPA 4KO0A 5DMRA 1BCOA 5J2QB 4N56A 3HHKA 4ZTJA 2FVSA 4DTXA 4E7KA 1C1BA 3V9ZA 2HHXA 3M9OB 4I2QA 3CFRA 1WNSA 4QWEA 3VQCA 3VQAA 1Q9XA 1WSFA 2VG5B 3L8BA 4RNMA 3K57A 1TP7A 2BR0A 3K2PA 4Z4GA 1SV5A 2IS3A 1DTTB 4K4YA 3CJ0A 2GV9A 5F8NA 2F96A 2ZKUA 1N56A 2FBTA 1S0OA 1YT3A 2B6AB 3RB0A 4RW8A 4B8CA 2IC3A 3DRPB 2G8IA 1TVRA 4M41A 2ZD1B 3IG1A 4U7CA 4AHUA 2RDIA 1XI1A 1HNVB 5DG7A 4Z4HA 4RW7A 5KFEA 3SNNA 1JLQA 4NCBA 3KK2A 1LWFA 5JXSA 4QWDA 4YP3A 2ZQBA 3G86A 1VSFA 1VSEA 1VRUB 1WLJA 3QEXA 5DQIA 1UAXA 1HNIA 1SL1A 2ZE2B 1S1VA 4CF1A 4ID5A 1JLBB 4ECXA 1S1UA 1RT5A 4G1QA 1TAQA 5KFYA 2ATQA 4FVMA 3GIJA 3TABA 3SFGA 3DOLB 1I39A 2YNFA 3NGDA 1SH3A 1EXQA 1S97A 1GOCA 2R8KA 1QSYA 2PY5A 1C1BB 4ECZA 4RW4A 3L2RA 3LP0A 3PV8A 1KLMA 4J2DA 1KHVA 4X2BA 2IDOA 2HAIA 5KFLA 2BGGA 1RDDA 2YHAA 4CGHA 4HCBA 4ZTFA 3KIOA 4CGIA 4FS1A 4RW8B 1TVRB 3ITHB 4M95A 3QEIA 3IG1B 3BSOA 2OA8A 5EWGA 4IG0A 4J9MA 4Q0BA 4J9LA 2VWKA 3KTQA 3MEEB 4WXWA 3OYKA 3IS9B 5KFBA 4RW7B 3U3GA 1HYVA 1VK0A 3VQPA 2D41A 4ELUA 1NJYA 4RNOA 3NMAA 5J1EA 4LH5A 4BWJA 1TKDA 1WN7A 2XGPA 3VQ9A 3RAXA 1FKOB 4KI4A 1GX6A 2HB5A 4DL6A 1WSGA 3VN5A 3O3GA 3GIIA 2XCPA 5KFOA 1S1UB 1ZBIA 5F8IA 4ED3A 2V0NA 4M42A 1U49A 2JC1A 3RTVA 4G1QB 1Q9YA 3CG7A 5C24B 4IR9A 5KI6A 3TQ1A 4CGGA 3OS2A 3G0ZA 3V1QA 4KTZA 2FJWA 4XPCA 1K1SA 4RW4B 1SL2A 3LP3A 4J9QA 4IDKB 3NF9A 1K6YA 1QSSA 2HW3A 5KFHA 3PR5B 4KAZA 4MIAA 4FM0A 2JEJA 4CESA 3V9SA 3RRHA 3AA3A 4W5QA 3DRSA 3SPYA 4CIFA 3ULDA 1L3UA 3UR0A 1KTQA 4ED7A 3OJSA 3AA2A 2DFFA 3C6TB 1S6QA 3KK1A 3FFIB 4IG0B 4Q0BB 2I1RA 4ECUA 4G3IA 3I5CA 1LWEA 4J2EA 4FJHA 5KFRA 2OPQA 4DFPA 4XIUA 4J9SA 4CJ4A 3AO2A 3NBPA 3SUOA 3OYEA 3B6PA 4DTOA 1VSJA 5J1EB 4B9SA 4DQPA 3OS1A 3DYAB 4OGCA 1WSIA 2P5GA 3QNOA 3QGHA 4KHUA 1QSLA 5CYQA 3PW2A 5CZ2A 4OKJA 3DOKA 4E3SA 3DLKA 4NRTA 4EBCA 1BI4B 1JXBA 1XR5A 1IKWA 4IRDA 3T5KA 3KLIA 5HP1A 5DLGA 3TR8A 4OKKA 4AH9A 1NJXA 4PA1A 2BRLA 3KHGA 4R5PA 4K8ZA 1HQUB 3V1OA 3SYZA 2HHVA 4E1MA 1QE1B 1U09A 5KT3A 3QGIA 2QV6A 3KK3A 4NLUA 3OL7A 4ED6A 1JIHA 2BANB 3LP1A 4NRUA 4NYNA 3OL6A 1T03A 5J2PB 2CJQA 3ZT3A 4M45A 3PX0A 3I0RB 2DY4A 4IH6A 3MECA 4DG1A 5K14A 1TL3A 3ZT0A 3OYIA 2AWZA 3EY1A 2UVRA 1J5OA 5FRNA 4CFCA 3NBPB 3OY9A 4DTSA 1UWBA 3HJFA 3T19A 1VSHA 3EPIA 4KHRA 4EP5A 5D3GB 2YKNA 3VA3A 4IR1A 1S0NA 1VSMA 2KW4A 4DF8A 1TKTB 5HROB 2OPRA 3HL8A 1TKZB 4F4YA 3SUNA 3AVLA 2KFZA 3HVRA 3CJ5A 4NCAA 5E41A 2ILZA 2FVQA 3K5NA 4HCCA 5KG6A 1HQEB 5C5JA 2W9CB 4CHZA 4RU9A 4AHRA 1Z26A 3PZPA 4JS4A 1SKWA 4O55A 4R8UA 3BREA 2V4QA 3G6VA 2G8HA 4R5PB 3AO1A 3NHGA 3ZT4A 4DS4A 3SCXA 3BQ2A 4CEAA 3QERA 1KVBA 2XY5A 4F4ZA 3V1RA 1RILA 4YMEA 3KK3B 5EDWA 4DL4A 1ITGA 4DQQA 1SUQB 4ZP9A 3KLGA 4O3SA 2B43A 4ZPCA 3LP1B 4JRQA 3MFHA 4CJQA 1IKXA 3RMCA 1RDCA 4W5OA 1JLAA 4ECRA 1TK8A 4PQUA 2X6NA 4CE9A 4IFVA 1RT7B 4BE1A 3SZ2A 3K59A 4CECA 2C22A 1DTQA 5KFAA 3NF7A 1KFDA 4CJPA 2R2TA 4C8MA 2QXFA 3KHRA 3MR3A 2HVHA 1RTJB 4CCHA 3PW5A 2XY7A 3JYTA 4K4VA 3KLEA 3KMSA 2HHWA 4W5NA 1DLOA 4ECQA 1BISA 2OZSA 4NLPA 4BE0A 3SV4A 4RNFA 4NLRA 4KB0A 2HNZA 5EWEA 1JKHB 2I5JA 1N5YA 3QINA 4M3TA 3OLAA 3VQ8A 2DTUA 1IO2A 3TAMB 3C94A 4B9UA 1REVA 5KFGA 3CVKA 1S1XA 4LSNB 4FLUA 3QEPA 2HWHA 4IBNA 2IM2A 1HJRA 2XO7A 2P51A 5KRTA 4C8LA 1ZTWA 3RB4A 4FJMA 3HM9A 2FJXA 3SUQA 3NH0A 1F21A 1JLAB 3SI6A 2XY8A 3QZ8A 4F3OA 1YTAA 5KFMA 5C42A 4Y3CA 5KFCA 4BE2A 4CF9A 2VG6B 4IFVB 4HVJA 3CM6A 2KFNA 3ZSYA 2DPJA 1CZ9A 2B4JA 5F8GA 4FCYA 3AVNA 4KFBA 5JUMA 3SUPA 4MKAA 1CLQA 3MR2A 1RCHA 4RUAA 3LPUA 3V6HA 2WRMA 4BDYA 2GIQA 1IKYB 2YNIB 3JYTB 3BR9A 3AO3A 3K5MA 4NLTA 3OYHA 2RKIA 2HVIA 3ZSZA 1DLOB 3V9WA 4CEOA 1RYSA 2BRKA 3OYFA 1U04A 4DSFA 5KFJA 3HPOA 4LH4A 4WYLA 2P5OA 5KFDA 1N5YB 1QAIA 1W0HA 1S5JA 2WCXA 4O3RA 1RTHA 3RR8A 1ZETA 5SWMA 1N4LA 3NAEA 1X9SA 1RAJA 4CFBA 1ZTTA 3LAKA 3U3YA 1S1XB 3QLHA 2D0BA 4WZMA 1ZBUA 5KRSA 4M3WA 1IKVA 4Q5VA 4CEFA 3MXMA 3KLFB 5KT2A 4FW1A 4CEQA 4B3OA 3T3FA 4DU3A 5C42B 3CDWA 3VQSA 4PWDB 5F8MA 3M9NB 4KHYA 4NLOA 3AVAA 2HHQA 4B9NA 4DLEA 3E01B 4XO0A 3ZSWA 4HKQA 3QYYA 2HNYB 1C1CB 4DSKA 4CEEA 3EPGA 1S6PA 5DQGA 2JEGA 1D0EA 5KFVA 3PR4A 4DL2A 3VQ7A 4DTRA 4ZVGA 1EKEA 4CJFA 4AILC 1L3VA 3D5MA 4CGDA 1I6JA 3P83D 3WNEA 3BDPA 3O4QA 4LD0A 2RKIB 2D5RA 4QOZB 1RT3A 4E7JA 3UPFA 1QHTA 1TL1A 3P5JA 4H54A 5KFNA 2FJVA 1X9MA 3MEDA 4KV8A 4ZPDA 4KAIA 3UDLA 5HRSA 1CZBA 4I9LA 1S48A 4ZVFA 4CJUA 4HUGA 3QIDA 3G6YA 3H4BA 5KG7A 2O4IA 3QLHB 4EO8A 2ALZA 2JEFA 5EWFA 4FW2A 2OPPB 3OYBA 2YKMA 3D28A 1JLCB 1T05A 4LSLB 1RT4B 4FJLA 1J53A 4CJRA 4Z4IA 3C6UB 4OLAA 3MEGA 1VRTA 2IM0A 1D5AA 1HPZB 5KT5A 4MFBB 3GILA 1WNEA 3TWHA 2HMIA 3TAGA 2D0CA 3Q8SB 5L1IA 3A2FA 4RW6B 2D3ZA 4URQU 4NLYA 4DL5A 4DTPA 3OSNA 3AVFA 3QNNA 1U4BA 3SQ4A 1HMVA 4NYFA 4YNQA 1S9EA 2Z1GA 4CHQA 3PW7A 3OSPA 3KLHB 5DQHA 4KO0B 3K5OA 2EHGA 3IRXA 4ZHRA 3CFOA 2C28A 3DLRA 5F8HA 1RT3B 4ZVEA 2FC0A 4I2QB 3TARA 2QE5A 5KGXA 4H4MA 4N47A 3MEDB 4KV8B 3NAIA 4Q8EA 5F8JA 1LWCA 2RPIA 3CQ8A 3OYMA 1TGOA 1SV5B 4U6PA 4W5RA 4CJ5A 3KJVA 3CWJA 3T5LA 3NH1A 1MU2A 2BE2A 4C8OA 2JLEA 4HTUA 2W7PA 2IC3B 4E89A 5KFIA 2HHSA 3CFPA 3GV7B 1KVAA 4B9LA 4NCGA 1JLQB 3KK2B 2XHBA 4M3UA 4DFKA 1LWFB 3RB6A 1KLNA 1I3AA 1VRTB 3L2UA 2Y1IA 2HNDA 3RMBA 4KB7A 1IG9A 3QEVA 5I42A 2UUWA 3KKRA 4RNNA 1HNIB 4FLYA 3NFAA 4FJ8A 4DTJA 1S1VB 4ID5B 4YQWA 4HUFA 4F4WA 3S3OA 3NF6A 3QZ7A 4MIBA 2W7OA 4IRCA 3OYJA 1GOBA 1RT5B 2R2UA 1S9EB 4EZ9A 2GC8A 2YNFB 2DFEA 3FRZA 2IGIA 5KFUA 4H4OA 3EZ5A 3RMAA 4KHWA 3IRXB 3OYDA 3RRGA 4ICLA 3LP0B 5KT7A 2W8LA 1R0AA 1KLMB 3MR6A 4FK0A 4H4MB 4TQRA 1SH2A 4J9RA 3AVCA 2OYQA 3E51A 2C2DA 2QKKA 2F8SA 5FROA 5DK5A 4JV0A 4ZP7A 1NKEA 4Y34A 1MU2B 2BE2B 4GW6A 4FM1A 3VQQA 1HRHA 3NF8A 5KFQA 1U48A 4AHVA 1BQMA 3H59A 1J54A 1C0UA 4FXDA 2YV0X 4CGJA 1ZYQA 1NKCA 1JL1A 3LZIA 4PUOA 2HNDB 5FDLA 3KOAA 3QGGA 5I42B 3IN5A 4QWBA 3ZSXA 1G15A 4FJ9A 4DLGA 3MR5A 5L1KA 4E0DA 1RBUA 3K5LA 5F9NA 2VA3A 1QAJA 4MKBA 4Z0UA 3TANA 2PYJA 2R2RA 3AVJA 4CJEA 5J2NA 4FJ5A 4F4XA 3I8DA 2FBVA 3GV8B 4CF2A 3EYZA 4LY7A 1RT1A 3JSMA 4M94A 1ASWA 1QQCA 4XPEA 1TV6A 4YR3A 3HO1A 2FLLA 3PX6A 4ZP8A 2Z1HA 4NLVA 2AU0A 3DRSB 3V9UA 2WONA 3ZSQA 1S6QB 3KK1B 5KG1A 2R8IA 4CF0A 4NLXA 1LWEB 2IJFA 2W8KA 2PZSA 2OPQB 4O4GA 1TK0A 2IM3A 3KHLA 3AA4A 1YTUA 3AO5A 4K4UA 3HSTB 3B6OA 1JLFA 5HBMA 2AX1A 2IOCA 1S9GA 1UA1A 1NJWA 4Q8FA 3NDKA 3VQ5A 3NL0A 2ITGA 2GIRA 3QIPA 5HRRA 2AQ4A 4CJ3A 4DF4A 3NE6A 3ZSRA 4KPYA 4Q43A 3H5XA 4FLVA 1FXXA 2QKBA 1A5XA 3RAQA 5CYQB 1NK6A 3L3VA 4ELVA 4F4KA 4FJ7A 3PUFA 3M8QA 2O4GA 3DOKB 1RYRA 3IGVA 3DLKB 4NLQA 1RDAA 1D9FA 3OYAA 3V6DA 1JLGA 1IKWB 4O4RA 3KLIB 5HP1B 4DTNA 4QW9A 4Q45A 4CGFA 1YVUA 4C8NA 3SFUA 3I0SA 3JSMB 3PO4A 3V81A 4TYBA 3KHHA 1TV6B 4H8KA 5J2MA 4WYWA 3CM5A 1WAFA 3M8PA 4DQRA 5JS2A 1T03B 2YNGA 2BQRA 3L2VA 3TAQA 3MECB 1EETA 4DG1B 5K14B 1TL3B 2ILYA 1J5OB 4DSLA 1VSLA 4NZ0A 4W5TA 3LWMA 1KFSA 1RNHA 4FJNA 1UWBB 4OJRA 3I5AA 1XR7A 4KI6A 2YNHA 1RBRA 4RUCA 4DQIA
chains in the Genus database with same CATH superfamily
1SKSA 3ZT2A 1B4SA 3AXMA 4ELTA 2VWBA 2O8BB 4FZVA 2H65B 2DPIA 2OPRB 4H0XB 2UZAA 5K20B 2OH2A 1AUSL 2LP4A 3DLEA 2NRWA 3M8WA 3DAWA 3NGTA 1VQMN 2CNOB 1ZS6A 3ZLJA 2E8AA 4MAKA 3L2WA 3UE5A 4TNOA 3MMBA 2D1CA 1C2PA 4LFBJ 2COLA 5GVQA 1WC4A 4DV2J 1CEZA 4EHUA 5H1SQ 4DV6K 3V81B 2ZM6F 1VBXA 4BS2A 3OJUA 3OS0A 4OX8A 1NNEA 3EL2A 1IKXB 3HSZA 4P7VA 1XMOJ 2VB6A 2AYBA 2DFHA 4OPJA 1FJGK 5KG0A 2QMUB 2UV8G 5A0YA 2MZSA 3PX4A 4H5RA 2DYAA 3QEWA 2M7SA 3OYGA 1DTQB 2HBQB 5CYMA 2CJKA 1HNXK 2EW9A 1OS5A 1VC5A 1EB0A 3CPEA 3OUYB 2FPHX 4K7QA 2HZAA 2XS2A 3TPQA 2MZTA 3BN4A 3M8SA 2P9SA 3C16A 2NCKL 4ZVQB 3GR0A 2EG1A 4JI0J 4DUYF 4FK4A 4JAXA 4KTWA 2AIRB 1K73O 1NHVA 4RW9A 3V9XA 3DKDA 1FT8A 1TQLA 3AB2B 2FXUA 4LF6K 2B0GA 1RBOB 1BIUA 1QAXA 3VGLA 4MDAA 2R8JA 2HGLA 4YUDA 4UOFA 4FK2A 1UPPA 2JNJA 5DZ6A 4JKDA 1NOZA 1D1UA 4IKAA 4WTOB 3O3HA 1LV5A 4I9QA 1U7LA 3PXGa 2WOMA 1UZHA 3BGRB 3VF6A 4YDXA 1NSAA 2B9YA 1ZBFA 4OX6A 4A2AA 2D7SA 4FYXB 2J9CA 3PCOB 1YBAA 1Z6RA 2DH9A 4X64F 4CWBA 4BACA 1A0OB 2VH7A 2EBGA 4EFHA 2CYYA 4BQZA 1VQLN 3VERA 1XR6A 1ZBHA 2YKPA 4DL3A 3QO9A 4Z94A 4K4SA 1G4CA 4KH0B 3DLGA 4AHCA 1PBUA 1TTHB 2KQ2A 2CGKA 3W9IA 3DMJB 4ED5A 2LU1A 1CPZA 4FLZA 5JVGQ 4IQXA 5KG5A 4J9KA 1NSKL 1SKUB 2L9WA 4DFJA 2E44A 1Q8IA 5H1SV 3AV9A 4CJWA 3LANA 2Y1LB 5LJVA 2GBZA 3NGIA 1HI8A 2JZ5A 2RHQB 1ZZFA 3UDEA 2ASLA 2K1RA 2DRAA 5AQPA 1RTHB 2V8PA 3GMGA 2MKHA 2V67A 3R9LA 4A8SA 2KXFA 4QWCA 4A8YA 2ACYA 1FVQA 4JB8B 4F2SA 3W2WB 1KP6A 1RTDA 2IRYA 1EP4A 1L5UA 1IKVB 3D45A 2QYGA 2OSRA 2A6MA 5LY3A 5AXNA 4JEPA 3KMQA 3FE1A 5CD4H 2VC1A 2ZH7A 3LW5C 2UUTA 2NS1B 5C12A 1Q8BA 1L3KA 1NK4A 5CZXA 4L3QA 2OZMA 1SCJB 2FC9A 3K58A 3MEEA 4IOCQ 3NG8A 2FVPA 3P5BP 3CMES 3HMJG 2B8PA 4YHHF 1KQGB 2ZH5A 3QT8A 4AHSA 1S6PB 1FRKA 1MMDA 3PW4A 3AAPA 2V4JA 2MQPA 1FKAF 3OA9A 1C0TB 4CTAB 2XSJA 1MDUB 4TVAB 1E6YA 1FO1A 3C65A 2AGOA 4CZEA 2H5JB 1SC1B 1RISA 5KFTA 5FPEA 4KRWA 3CYMA 1Q95G 3LALA 3AOAA 3VQ6A 2A3JA 3H40A 3EXYA 2D0PA 1LEOA 3EXCX 3TNVA 2DBBA 4I69A 3BSNA 2G4BA 3THPA 5D0EA 3CCMS 4P72A 4DR5K 4FZYA 1SVDA 4PKGA 4K50A 3DXKA 2GQ2A 2PIIA 4IDKA 3OL9A 4IH7A 3NKYA 1PC5A 2Z2MA 3CCLS 5AQRA 4G6VB 4CO4A 3LPTA 1VIXA 4MK8A 5KTQA 3TUPA 1RA6A 3CERA 1KCFA 3HPGA 1DQ9A 1CULB 1YZ7A 2UP1A 3WNFA 3FFIA 4GV3A 5U47A 3ZYYX 2B5JB 1KD1T 2ROGA 4FM2A 1SQKA 3M32A 1WG4A 1HMVB 1X5PA 2F3JA 1Q0NA 3WQPA 1IQTA 2EI5A 4BVOA 4IOAQ 3HSJA 4LFAJ 4JI3F 1N32F 1MG7A 4ECYA 5D77A 4JI8K 3WC2A 1FWKA 3O2IA 1F1BB 5KFKA 1FI4A 4ZK7M 1LWCB 3SCIE 2NRHA 1VYAA 4J2AA 1ASVA 2HFZA 1SI9A 1EX8A 1M1KT 2ZDOA 1NH8A 1QE1A 3HCXA 3U7JA 1U2RA 2R2SA 4K0KK 5E84A 5HRPA 5DDPC 3T41A 2BANA 2WTFA 1HYZA 1UPMB 2ABYA 5D15A 1WAJA 3KKSA 4FJXA 4I2PB 2ZJRL 4C6AA 4AYBD 2WB4A 3OFHA 2QN6B 4BC5A 4HDHA 2ZZTA 1FF2A 1HNZF 1FE4A 4JLHA 4WFNQ 3OVSA 3LO3A 3KZBA 2DR5A 3VTIA 3BJYA 4OGEA 5D3GA 1RI7A 3EICA 3NNAA 4H4OB 3ETOA 4USJC 3HVTA 1TKTA 1T94A 3DN9A 3UE2A 4ICLB 3SDEA 1R0AB 1SKRA 1NKBA 2YH0A 1TKZA 4M3YA 1GOAA 1S57A 5L1JA 4OJ3A 1TAUA 3BH6B 4X4UA 1PG5B 4OZ1A 5FIIA 1HQEA 1Q82O 5FPMA 4D3HA 4WZQA 4B1YB 3GIRA 2Z1JA 3CC7N 2HBKA 2F8HA 2C3UA 2OMLA 2W9BA 2HSTA 3VAKA 3OD2A 5L38A 4KBOA 2BE7D 3RB3A 3AQPA 3MAAB 3M7VA 1SUQA 3QICA 1E3MA 1BQMB 4LQ3A 3HP6A 3HX9A 2A18A 4PUOB 3J8AA 1WOQA 4I0WA 4B9VA 5FDLB 1ZPWX 4MK7A 2G8FA 3DGVA 2GV1A 3N5FA 2A40A 5AQZA 3I87A 3M6WA 1P9YA 4GC6A 4H0VB 5K8NA 4FLWA 3M05A 1NSPA 2HMPA 2IBKA 4O8KA 4ZLJA 1X1PA 2Z2LA 4PKDB 5IV3A 2ZOFA 2IPOB 3IO1A 3DXMA 4UQGA 1TZ0A 3MWPA 4ZN1A 3C2PA 4M7XA 3HXMA 4M5GA 2XWXA 4DSJA 4GV9A 1IQZA 4N5SA 2HBYB 3RAMA 3QNWB 4DCPB 1LW2B 3C95A 2QO3A 2J9DE 4AL6A 3C66A 3PO5A 3UN5A 5JLHA 4DUTA 3P8BB 5BN8A 2QM1A 3IKMA 1Z4UA 4OI3A 5KFZA 1XC3A 2D3UA 4WFZA 4KTQA 2OLWA 1WHYA 5DG8A 2LXIA 3MOZA 3DGPA 3ZZRA 1WF1A 2DNGA 2HHTA 1AZSA 4FWKA 2YI1A 4DL0C 2B51A 3CCZA 2VG6A 2QRRA 2E1PA 2VG7B 3SSQA 4A8WA 4KREA 4OLBA 2L9DA 2HHUA 4OL8A 4DFMA 2DT9A 5KGWA 1X3MA 2MQ8A 1KDNA 2MY7A 1XHXA 4CJTA 4ZITA 5IM0A 3E66A 3NOCA 3HVAA 3J7Z5 2FHKA 4ZP6A 3JQKA 4J8FA 3A5LC 1R27B 3DI6A 3ISND 1NEEA 2NRZA 1PILA 1WSVA 3VCDA 2BYCA 3MPVA 2Y9HA 3TVZA 4A59A 3M8PB 1QS4A 3AVKA 1C0FA 1NGGA 3CCSN 4O44A 4DSIA 3O8MA 3TA1A 4IO8A 1NGDA 3MFIA 3HFZB 5HLFB 1BL3A 2QWRA 4Q44A 4K4TA 4BVPA 2H9ZA 3Q89A 3PRDA 2F8EX 3KLFA 3HM8A 3QT5A 2QWMA 3L7PA 2W1BA 5LL6Z 3TA2A 4PWDA 2D1KA 2LVWA 4BRCA 3GZ7A 3PM9A 4NXMF 2OTJS 3E01A 4I7FA 3L6QA 1HNWK 3HD2A 1VSIA 3V2UC 1X5TA 2ERRA 3CETA 3WIVA 1XIQA 2BQUA 4BRNA 3W7BA 3DLEB 2C2NA 4O0JA 1NDCA 5HRNA 2RHKA 3SAHA 4BR2A 4Z4EA 4K43A 3H3NO 1ZM9A 4O3PA 3DRXA 1BIZA 1IJEB 3MMBB 3LF0A 3CQXA 3JAMO 1S1TB 4PKHA 3OV7A 2KKZA 4ISFA 1X4DA 4JI1F 4CBUA 2GMJA 2DVIA 4L6V3 1WC6A 4CW7B 5LSOA 2ZUAA 2JEIA 1FESA 1ZA2B 3O3FA 3H46O 1DTTA 1Q8LA 5KFWA 3NH2A 2CGLA 1XNQJ 4FJGA 1J9AA 4HDGA 3PFOA 3N6MA 2WW4A 5A0YB 2MZQA 3AXKA 3PYFA 3S7RA 3T9NA 3SSSA 2HAFA 4ZVHA 4O3QA 4Z4CA 4DR7J 2FJEB 2L41A 2V2VA 3ENBA 5L1LA 2W24A 2HYIB 3C6UA 3DLBA 1HPZA 2P6SA 1UVJA 5LMUK 4URGA 4GMJB 1C1AA 2F8TA 1QVFR 2P9SB 1S5ZA 3C0BA 1OH5A 1KWMA 1J2VA 4LFCJ 2BJDA 2OP5A 2HZCA 5CH7B 2AYMA 1AA1B 1NB2A 2MMYA 2XMUA 3G4SS 1Q81O 3DOLA 3A8YA 3EKSA 2GJIA 5J2QB 1FX2A 4DTXA 2OJ3A 1C1BA 3V9ZA 3M9OB 3CFRA 1WNSA 4CLPA 3VQAA 3I4PA 1Q9XA 2GCFA 4RNMA 2HSEB 4WPAA 3K2PA 4B3MJ 2IS3A 4RTFD 2GV9A 5F8NA 4DR3F 2Q31A 1B7FA 1ZOTA 2L9NA 5C2DA 3W8GA 3BO2A 2IC3A 5IOLA 3ZC4A 2JSXA 3IG1A 2LEAA 4AHUA 1JK9B 2L48A 2RDIA 1KC8O 1XI1A 4CYUB 2ZGZA 2AZ3A 2DH7A 1V3RA 3MPDA 5JXSA 3D0HE 3G86A 1NM2A 4PQAA 1R59O 3TJAA 1WLJA 3QEXA 1MMNA 5DQIA 4CO3A 1UAXA 4USMA 1HNIA 2ZE2B 4ID5A 1JLBB 2YCHA 3MZIA 1H2VZ 1WHWA 2C3OA 3VEWA 3OBYA 4F02A 5HQ8A 4FVMA 3GIJA 1M5PC 3R6MA 1RWPB 1XMQK 3QB0A 1UVMA 2AJ0A 3OPKA 5DETA 3HHNB 3LP0A 4PYAA 1HJOA 4C11A 2Q1LA 2NREA 3MWTA 2KT2A 1VQMS 4X2BA 2HAIA 1RDDA 4GKKJ 4RWTA 2FF3B 1HBMA 2GZOA 5KQDA 4IJAA 1J5EF 4FS1A 4RW8B 4I6YA 3L4QA 5EWGA 4J9LA 2BE9B 3MEEB 2DISA 3OYKA 5KFBA 4B3TF 3C14B 3T6JA 1HWIA 4A57A 2ZWPA 2V4JB 2DNNA 1VK0A 2D41A 2XSJB 3GWCA 3AJ1A 3I55N 2F7VA 1ROFA 3NMAA 4BWJA 1XEZA 2CVIA 1WN7A 4HH0A 3RAXA 1OY9A 2XMTA 2HB5A 1R3NA 4ZCIA 1WSGA 2ZVSA 1V5IB 2BV3A 2XCPA 4NWBA 2D4WA 2V0NA 2CQPA 3CC4N 4G1QB 3T1YJ 4IR9A 5KI6A 1Y0HA 2RRNA 3ZFVA 3G0ZA 1R8BA 4XPCA 1ZA1B 4RW4B 2DNRA 3DXKB 1WG5A 4H5TA 4J9QA 4IDKB 2HW3A 1T9XA 2CQHA 3PR5B 3FUYA 2R7VA 1F6TA 3D0GE 1FRHA 2DR9A 2K7KA 4FM0A 5A76A 3W3SA 4DZDA 2JEJA 1P1LA 4W5QA 4H0PA 3T7ZA 1OSDA 1S12A 4ED7A 3KK1A 3FFIB 2XB2D 3BGLA 2PMZD 3V4MA 4ECUA 4HLBA 3MI7X 3KNGA 5IT9Y 5I9EB 4DFPA 3M32B 1Y00A 4DR4J 3AO2A 1NM1A 4N77A 1YF5L 5H9FJ 3B6PA 2P5VA 1WUUA 2V50A 3QDKA 1NJIT 2P5GA 3IM8A 3QGHA 5L9NA 1IBKJ 2OEJA 5CYQA 4MMOA 3PW2A 4JYAF 5CZ2A 1VQSA 4OKJA 1WC0A 1UMJA 4F3MA 4FWPA 4X4RA 2AP6A 1BC6A 1IKWA 2DITA 1JXVA 2FUG9 4FVUA 4OKKA 4AH9A 3O6QA 2UXDK 5FD1A 3G25A 2RU9A 3VR1A 4NE9C 1QE1B 4Y2KA 2HFVA 3IMQJ 3AJ2A 3KK3A 3M8ZA 1BWFO 3IR7B 1ULRA 2BANB 4NA2A 1GH8A 4WK3A 3OL6A 3WIUA 1TUVA 2CJQA 1DGKN 2DGOA 2DY4A 4JI4K 2B7CB 4USVA 3GFHA 2PMHA 2XS5A 3NBPB 2OKQA 2YQ3A 2ZH1A 2M88A 1APSA 4BR5A 2QYCA 3HD1A 3T19A 2F1FA 4LFCF 2QWNA 4OZ5A 3WHIA 5D3GB 3M2UA 1HI0P 2HK2A 1S0NA 2KW4A 3DHWC 1TKTB 4DV4J 4OI0A 2G2ZA 3SDEB 3J81j 1TKZB 4F4YA 2HS4A 3MOJB 2KFZA 4PRFA 4EFAC 1DAXA 4HCCA 1HQEB 4AHRA 3WBZA 2CUYA 4KY3A 3J80Y 2V4QA 2ZM6K 1QZ5A 3ZT4A 4DS4A 2DNYA 3KWIA 4S0MA 4A4JA 3V1RA 2XEXA 3G9CA 4KHPK 1SUQB 4ZLPA 3ZTOA 2SXLA 3KLGA 2NZCA 1I3OB 2JDJA 4ECRA 1TK8A 4EGLA 3RUBL 2X6NA 2KN4A 4XH1A 2DGXA 4IEEA 3RVCA 3W63A 4PPZA 5KFAA 1WB9A 3MK6A 3R2CJ 3NF7A 2R2TA 3DXMB 3KHRA 3MR3A 2HVHA 4LRCA 3GG0A 4DUYK 4CCHA 2XY7A 1FXRA 4WFAL 4W5NA 1RXOB 3I8BA 1V6HA 3SV4A 2HNZA 5EWEA 1OYDA 2JLFA 1BLUA 2R7SA 3H25A 1F2GA 3QINA 1PBAA 1RWOB 2EKNA 4M3TA 2I2YA 2LQJA 1GLLO 2XS7A 3R5CA 1IN0A 1OY8A 5KRTA 4X64K 4DUZJ 3CCJN 4P7TA 4CD1A 3CTRA 4CZKA 1ZTWA 1K8KA 2FJBB 4JI5K 4DN9A 2X3GA 1AZSB 5C42A 1K9MO 4G1IA 2VG6B 4IYQA 2CPZA 5A8WB 3CJAA 4HVJA 5IZHA 5B7WA 2AEJA 1LQ9A 1BWEA 5G0RB 3WXJA 3J7A1 4KFBA 2M8DB 4OYBA 3JXUA 1CLQA 4Y28C 4RUAA 5IM0B 2YWHA 5K8MA 4BDYA 2E66A 1RB0A 2O8DA 4NLTA 2MJNA 4QYZK 3OXLA 2HS3A 4CEOA 1U04A 2QZ8A 3FZHA 4LH4A 4HWIA 3R7NB 1IBLJ 2P5OA 2Q6BA 3H8YA 2CJBA 2QWOA 1HHQA 4X62F 4J9UE 2OI2A 4BC4A 3NAEA 3OHRA 4FNIA 1ZTTA 3BH7B 3K7RA 1UFWA 5E7OB 2UU9F 2NPFA 2X51A 1ZBUA 3CPWM 5KRSA 4M3WA 3CC7S 4DX7A 3MMVA 4CEFA 4OYAA 3KLFB 4CO5A 2LCWA 2PD1A 2RQKA 4CEQA 2HQGA 4KH5A 3T3FA 4DR4F 4DU3A 4PWDB 2CAJA 4OJHA 1YHQN 1Y5LB 3E8OA 4RUBA 3E01B 2VGNA 2AT1B 3ZSWA 5HQLA 4HKQA 3QYYA 1Y3JA 2I7NA 1I94J 5DM6L 4U8YA 2JEGA 3AAWB 1UZDA 3PR4A 2NXJA 1CJKA 4DL2A 3VQ7A 3PSFA 1L3VA 4AILC 3D5MA 3HOSA 1N5QA 1I6JA 3SQOP 1OH6A 2D5RA 4QOZB 1X0PA 2UXBF 3VF0B 1QHTA 4H54A 5KFNA 5KOWA 4JKEA 4CO2A 3MEDA 4KV8A 3PSIA 2KJVA 5HRSA 1X3NA 4I9LA 1M5OC 3R5GA 1MROB 3OXGA 3G6YA 5KG7A 4EO8A 2E2QA 2HGMA 3H7HB 4CZFA 2LKZA 5CQGA 5B0DA 1T11A 1VDHA 2ZBQA 2X1AA 4NX9A 2CZVC 3BZCA 4I6AA 1CC7A 3C6UB 5B09A 3D67A 1Q79A 3HSGA 5D6GA 1D5AA 1MN9A 3ZZTA 1HPZB 4KPCA 1WBBA 4NMXA 1OMSA 3W61A 3VV2B 1M0SA 1EARA 4RPFA 4FKYA 3LM9A 2D0CA 4LMZA 5L1IA 3A2FA 2D3ZA 4URQU 4DL5A 4HACA 1U4BA 2WVBA 4DV4F 2HHPA 4NYFA 3UCGA 4QIWD 3PW7A 5BRHA 3OSPA 2JWNA 1FNMA 5H9EJ 5DQHA 5LSRA 2EHGA 3IRXA 4LFBK 1EO1A 3DLRA 4JV5J 1RT3B 4ETXA 1I51B 4DV2K 2NNWA 2ZJPL 2QE5A 3TOQA 4WF9L 2IHR1 1QLNA 3CCWA 5KGXA 4ISEA 3MWBA 4BBYA 4Q8EA 3CQ8A 1TGOA 1HKAA 4DOZA 4CJ5A 3KJVA 1MU2A 1GXUA 1XMOK 1UJ5A 4YB1P 2IC3B 4OZJA 3UI3A 5KFIA 1U6BA 2HHSA 1Q53A 1KVAA 3OTOJ 3CCSS 4B9LA 3G6ES 2RHSB 4MKVA 4NCGA 5F0XA 1Q16B 1KLNA 1VRTB 5HVFA 3RMBA 1IG9A 1EJ7L 1Q1KA 1HNZK 4RNNA 4ILGB 1HNIB 3NFAA 3UFCX 4FJ8A 1RHKB 4DTJA 3A3NB 4ID5B 4HUFA 2WB1D 4F4WA 3VETA 1SC4B 3NF6A 3S3OA 1NG9A 3ET6B 1GMUA 2R2UA 2LYVA 2V6AA 2RUSA 3I32A 1KVKA 2DFEA 3NS7B 3FRZA 4GO7X 4YOYA 3RMAA 1N8RO 2GUPA 1IWGA 2V63A 2W8LA 3LP0B 5AQOA 4ER8A 4LRFA 4C11B 1JNZB 4J9RA 2O1PA 3TTDA 3E51A 1VQ5N 4CT9A 2QKKA 2UYTA 1B64A 4DUZF 4GW6A 3M8YA 1T9YA 3R9PA 2QT7A 3NF8A 1Y3KA 2IVFB 1XNRJ 4DHYA 4NO7A 3LPYA 1UCNA 3ILLA 2F4VF 3AOBA 2YV0X 1ZYQA 1NKCA 4DZ6A 2MKIA 4A48A 3FLCO 2HNDB 5D0RA 2IDEA 5A6PA 1DBDA 3IR5B 2HG4A 5AQXA 1BHNA 2EBEA 1G15A 1YJWN 4HEA9 3UWTA 2CPIA 5F9NA 1QAJA 3TANA 3LA0A 3VAGA 2F9JA 3Q83A 4P73A 1ZXOA 1MSWD 1ATNA 5DRKA 3I8DA 3BDEA 3NEKA 3EN9A 1UVNA 1RT1A 3CUNA 1TV6A 4CH0S 4USKA 2GX8A 4WCEQ 4ZP8A 2AZ1A 4BRPA 3PG9A 1NDLA 2AU0A 3D2WA 6FDRA 4EWTA 1B0TA 3ZSQA 3KK1B 1T44A 5ADXH 1J6ZA 1RSCA 4O4GA 2P9NA 4PWUA 1YTUA 3CJSA 1T6DA 4WTYA 2HQIA 3HSTB 3B6OA 5CCLA 3TWZA 1JLFA 5HBMA 2AX1A 5EY4A 1S9GA 3PFEA 5B0AA 3TP2A 2GIRA 4G9ZA 1I94F 1N36F 3TSUA 3QIPA 2G13A 4MLHA 2AQ4A 3BY5A 3ZSRA 1BA1A 2B8QA 4FLVA 2QKBA 5CYQB 5GMEA 3L3VA 4F4KA 1IR1A 4FJ7A 3M8QA 2M0GB 1C0GA 1Q7YT 4ZPTR 1ZPVA 1Y9OA 1RDAA 3R6GB 5T41A 2YPZA 4IQMA 4UW2A 1IKWB 1R7IA 1H74A 4YDUA 5HJXA 4QW9A 3SQGA 2NLWA 4C8NA 3I0SA 1I5OB 1SQGA 2NYIA 2QIFA 3GPAA 4WYWA 1N33J 1WAFA 1IXKA 2EFVA 1YBTA 2HRTA 3PTWA 4DR2F 3B78A 1EETA 4BG8A 1Q86O 3NNHA 1JJ2M 1VSLA 2XMKA 4NZ0A 1NDPA 3I5AA 1XR7A 3BM7A 1UP1A 1VQON 1RBRA 1FRMA 5IQ6A 1M90T 1FD8A 4FPIA 3CJ2A 4CI0B 5C25A 3M2UB 3EDRB 1X4AA 4CFDA 3GYNA 4NLSA 4KKOA 4XAKA 3CCRS 3DU5A 2FLPA 2NR0A 4YOTA 4JV5F 4QIEA 4OI4A 2EKYA 4YR2A 5ETLA 1NMEB 3V6DB 1PYTA 1VCTA 4OX7A 1Y11A 3RR7A 1RLDA 2CDRB 2CQIA 3CC4S 2PT0A 4PEOA 3N9UC 4CHPA 1EWQA 4I64A 5AQVA 3U6FA 3VA0A 4U67Q 1OVYA 3K89A 3KLGB 1W2IA 3OTOF 1M1GA 4WP3A 4EBEA 1E6VA 2XNRA 2V7ZA 4I4BA 1GMWD 2O01C 2FTRA 1DKGD 4DV5J 3PYGA 4CEZA 2YKAA 1VFJA 4FVCA 4BRIA 1EQMA 1O8BA 5E26A 4CZLA 3TEHB 3MGJA 4ZPBA 5FLXY 3VAJA 3D6TB 2KHDA 3CXCM 4WFXA 4EYIB 3SAFA 2GNKA 4OHYA 1X60A 4QAGA 4FWLA 5CZVA 2V34A 3R7BB 3KJQB 3O4WA 1L3SA 4NLBA 3LWLA 1U47A 3DRRA 1MWQA 3GYGA 3NMRA 2HNZB 1BD6A 2QFIA 1WKLA 4C1NK 2BVZA 3S3NA 3W66A 1NUEA 5CHCB 3ZX0A 1QHAA 4FP9A 2AJ4A 1LAVA 2CQ1A 1WHVA 2V7YA 2K3IA 4JI7J 3OR2A 4FF4A 3IC1A 1NMDA 2R8HA 4E7LA 3RMDA 2E5IA 1CQNA 4TN2A 5F41A 4DV6F 2IAJA 4LRAA 4EMDA 4F25A 1K8KB 4UY85 1QAYA 1KBRA 1VISA 2PGCA 3DRPA 1JXEA 3OR1A 3N6LA 1T9WA 2H4YB 3TTFA 3O5BA 3GV5B 4UQTA 1FJGF 2RUGA 5LM7E 2FY8A 3R1LA 1RWKB 4M3XA 3IMXA 3MMJA 3BKFA 3D6MB 2V9KA 4KFBB 2ZHAA 3F5TA 2MPUA 4Q2LA 1RT6A 3CJBA 4ED4A 3SQ0A 4TSXA 1UA0A 4CJSA 1H38A 3A8IA 2E4LA 3BBBA 4JBCA 1JLEA 2XMMA 5LXYA 4BWMA 1V3SA 3HPHA 4Z7YA 4F50A 4PG5A 1BQXA 2W25A 3HFKA 3AVHA 4LF6F 1X7VA 1WBDA 1LW0B 2IA0A 1N34F 4ZPVR 3C7NA 3M6XA 1HL6A 2DHGA 2HWTA 2DXEA 2JVRA 4PY5A 1YZ6A 3VQEA 4DSEA 1LOTB 2F40A 4DB3A 3D68A 3SQ1A 3NGSA 2HKEA 3ITHA 3DM2A 1RAAB 3IWXA 5BYQA 1S76D 3ID6A 3IS9A 2U1AA 3Q8RB 3SEOA 1BE4A 4KH4A 1BQNB 4AE5A 3MUTP 4A47A 5DDRC 1CJKB 2FIUA 5ADZA 2V2QA 2ROEA 1O1WA 1PAUB 3I82A 4IH5A 1MW7A 1YJ9N 1NDKA 1A9NB 2BX6A 2RJZA 1F9HA 3K8VA 3MUVP 1WELA 1IWAA 3HBTA 3FGVA 1FERA 2FY1A 5C24A 3TAPA 3J81O 1SH0A 2WAQD 3K2YA 1DQAA 3H2UB 3SIPB 2YH1A 4QCLA 3EZOA 1T7PA 5KT4A 1FE0A 4FL9A 4IUFA 4M7YA 2NUHA 2A6OA 2ETJA 4HVZA 4DR6J 2CPXA 2AX0A 1F60B 2RH3A 3QESA 2GUIA 3CCJS 1F3FA 2XBPA 4OYIA 3RZAA 4HACB 4I56A 2K7JA 2DNOA 4U8VA 1NLKL 4X4TA 2RRAA 5EVZA 2WSEC 1ZM2A 3HP9A 5I3UA 1S59A 1K73T 1PCAA 4L72B 3A13A 4TYAA 4C8YA 4KB1A 2CA9A 1NK9A 3M30A 3ZZZA 3VQBA 3NMUA 4NI2B 3RW6A 3WXIA 1BI4A 3UB5A 4BLGA 2VQFJ 3KJVB 4R79A 3MXJA 4E19A 1XNQK 4EAHD 2CWKA 1TKXB 5GAGI 1C6VA 3D66A 3W8PA 3NOGA 3VF4A 3S01A 2RF2A 1OY6A 3LDQA 4IG3B 4DR7K 2YWKA 3FVYA 4NCGB 2EX3A 4P74A 4M63A 2HIQA 4F2RA 5J2PA 5FJ4A 1RBTA 1WC1A 1U8WA 3W9HA 3CIZA 4USTA 3ZEUA 2CADA 4O8UA 3RBEA 1DURA 5I3PA 4ED1A 4LFCK 1Q5VA 4LF4F 2RRBA 2DJWA 1YHQS 3N6NA 4QS9A 2YBVA 5GIOA 3MM9A 3Q8QB 3FBCA 3VAFA 3GL1A 3V4IB 3TVKA 4MJKA 4O3OA 3HK2A 4ZIWA 1FXLA 2W9AA 1WOSA 2XG8A 4DJBA 2N3OA 3N5BA 5EX0A 1XC9A 3ISNC 3BF1A 3U1MA 2GX9A 4B3MK 2W9CA 4WQ4A 4OPKA 4FZXC 5KAKA 4EIAA 4AHTA 2OSQA 5D4PA 4CZJA 5KFXA 2QX0A 1S0VA 2BJ9A 1XBWA 2H51B 3BSAA 3F73A 5F2RA 1S4FA 4JNEA 1VSKA 5M1NA 3CD6N 4IEIA 2IVMA 2DRBA 1PJ7A 3S9HA 4EU0A 4UY8O 1RTIB 1OPIA 4WIIA 1KQSM 1RT7A 3ZZUA 1WTFA 3NGYA 1XQSC 2DO0A 4IFYA 2DR6A 3EZWA 3UD4P 2LECA 3QRPA 2AGPA 4RG8A 1NK8A 1N5VA 1KXPA 4QIFA 2Q3SA 3PHEA 2NPIA 3DLJA 3JQJA 4YEAA 3AD9C 1K1QA 3BYRA 3PJWA 3KDNA 5E3RA 2ATLA 4IKFA 1RT1B 4WXOA 2YPYA 4DX5A 2YHBA 4GKKK 4JI2J 1ASUA 3PIOQ 2J4RA 2IRUA 4CM0A 3BP8A 3EM1A 3VZHA 3DFEA 1RGIA 2QSFA 2QLBB 3AO4A 1UEVA 3TAMA 3ILOA 4J9VA 5KG4A 5DDOC 1UJ6A 1RWMB 4O4GB 2P9NB 3QETA 2P6TA 3PKYA 2LDIA 2UV8A 4HHUA 4B3SJ 2RQMA 1JLFB 5HBMB 1S9GB 3O8WA 4J9OA 4M5JA 4RL1A 1RT2A 1AB8A 1SIWB 2PC6A 3QIPB 2GVZB 2YHXA 3THXA 3R5BA 2CIMA 1HKBA 3O08A 5CABA 3HHDA 4F04B 2EC0A 4CEBA 4RO0A 3W9JA 3QFUA 4WE1A 2VFUA 5IWAJ 2DHHA 5AE2A 4AM6A 3LZJA 4HHHA 2G8KA 3T1YK 1CXQA 1LOUA 1OH7A 4BHQA 4A8QA 2VOOA 1CC8A 4M63C 2BTFA 3MM5A 4O3NA 4A5BA 3IDHA 4LQ9A 3I0SB 5C0YA 4PWWA 1DHMA 4X62K 5ETNA 1WF2A 1S1WB 2V8HA 1U45A 2XSFA 1EKSA 4MQ3A 3SMZA 2G2OA 1VQ5S 1LAWA 1VQPN 2ZHOA 1RAHB 1YLXA 3SI8A 5HL7L 4O5BA 1S4EA 2ZH2A 4DR4K 2FBXA 4C8KA 5GAGP 2CZ9A 3OYCA 1S0MA 2MZJA 4ECVA 4URSA 4C3KA 2A1RA 2J0QD 4JK8A 1TL7A 5C25B 2PFUA 4ED0A 2OFHX 4C0HA 2WW8A 1B9FA 1IBKK 1RDWX 4TY8B 1Z25A 1MMLA 3EGNA 3IAS9 2KYXA 1C1CA 4DTMA 4M5DA 2YTCA 2HPUA 2HWIA 5DO2A 3OVNA 3RGIA 3O4NA 2O8CB 1YJWS 4ZPAA 4YFUA 2R9LA 2UXBK 4AFFA 3QBXA 2LQ9A 2QTDA 5AXLA 5DDQC 1Q82T 2YVSA 3BYPA 2YHYA 3THWB 2JWKA 1RDBA 3AH6A 2VBZA 2XI3A 1KAYA 5K9FA 4EUVA 3CPWR 2ZBCA 1LWXA 3E2EA 1E6VB 3R97A 1UVLA 3H1VX 1CS4A 4OHXA 3WZ0A 5E3QA 1UFKA 3HF5A 2W2NP 3CO9A 4DMNA 2XRIA 2GS8A 3FEYB 5KT6A 2EWHA 3IGNA 2EK6A 2IM1A 4LSLA 5K8PA 5JMNA 1RT4A 2MZRA 1PYOB 4PXDA 4CH7A 3FSIA 4CFAA 2ASJA 2O3DA 3Q8YA 4B3RJ 2MYFA 2HFOA 4DXLA 3THVA 2AYGA 1V4SA 2B7BB 4ED8A 2JGUA 1VRUA 3HSCA 2BZ2A 3CSKA 4B8AB 3OW2M 2AYEA 4DV4K 4U7UK 3HKWA 1WKKA 1HYSB 1NK0A 2V51B 3R27A 1SL0A 2UUBJ 5F1XA 3G87A 3VVTA 4FLXA 4QWAA 2WBNA 3DRRB 3M4XA 4KGXB 3ZSOA 4DR1J 4AQYJ 1YWXA 4ZVPB 4KHNA 4M1KA 3KLHA 3UVJB 4KO0A 4M5HA 4ZTJA 4X66J 2WVFA 3S6EA 4ZVRB 3K57A 3NWRA 2BR0A 3GU0A 3TA0A 1SV5A 3CJ0A 2F96A 5A8KB 4C0BA 2FBTA 3CJ8A 2DIUA 3DRPB 2G8IA 1TVRA 3N01A 3OR1B 2VBWA 3GG4A 3SLCA 2FHOB 4X65J 5DG7A 4Z4HA 3AHPA 5KFEA 4BROA 4BRLA 1JLQA 4NCBA 3KK2A 1NAQA 4KT0C 2CRLA 7AT1B 1U1LA 2Z57B 1WWHA 1UFLA 1TUWA 2GHWA 4ZJLA 4LBIA 1VQOS 4DPWA 4BRKA 4ECXA 2F63A 1SJRA 2GGPA 3O80A 3FJ2A 4CBXA 3KWGA 1DQ8A 1I39A 2YNFA 1WC3A 1MWMA 1SH3A 3CJCA 4JI2F 1EXQA 4HR2A 3W3DA 1U1RA 3ADAC 2R8KA 4NL5A 3C7NB 1TR0A 3L2RA 2ZC3A 4ILRA 5GAHI 2IDOA 5KFLA 1W7AA 2YHAA 2POKA 4DPOA 4DUZK 1Q7LB 1VHXA 1RWVB 3KIOA 4CGIA 5HI7A 5F0UA 2ZH8A 2V2ZA 4M95A 3ITHB 3L7OA 3QEIA 1NBEB 1FJ7A 1RWXB 3IS9B 1K47A 4RW7B 4BR7A 4PABA 4ZPWR 3U3GA 3S41A 2UUCJ 4GVBA 1HYVA 1ACMB 2NXUA 2M9KA 2MGZA 1NJYA 3K8WA 1VQ7N 3FZ2A 1LXNA 5IWAF 3H20A 2W2PP 3HHEA 2XGPA 3VQ9A 1GX6A 4FPRA 1E4GT 1AFIA 3CCTA 2GHVC 1S1UB 1ZBIA 3I31A 5F8IA 4ED3A 4DHVA 3VAIA 1FFSB 2C1EB 3RTVA 1IBLK 5C24B 4CGGA 1Y4ZB 3V1QA 2GQQA 2Q1NA 4KTZA 1XMQF 4QBUA 3CIPA 3ULHA 3NF9A 5KFHA 3O9TA 2PMWA 4IDHA 1HUXA 4DDFA 2DGVA 3WXLA 4KAZA 1SC3B 4N8NA 1RHQB 4USIA 1NMNA 4RBVA 5JVGL 3UR0A 1KTQA 3OJSA 3AA2A 5JVHQ 4IG0B 4RBTA 4Q0BB 1GK8A 4G3IA 4XTTA 1LWEA 3JSBA 4FJHA 4J2EA 4HTIA 2OPQA 4MIWA 2JH3A 4PZVA 1I94K 2RNEA 1NBWA 3SUOA 2JLGA 1HNXJ 1YJNN 3OYEA 3MD3A 2FYXA 1D4XA 5J1EB 3MMCA 3OS1A 4ERDA 4IO9Q 1QSLA 1NPPA 1ATSA 2KRRA 1Q81T 2P8IA 4JK7A 2B56A 4CO1A 2RQ4A 3Q2TC 1BI4B 4CM2A 2H5EA 3VESA 1I1GA 1PYSB 1JXBA 1U26A 3DC2A 4A2BA 4IRDA 4W4MA 2P9EA 4ANCA 3LDLA 5DLGA 3QMLA 4PYDA 1NJXA 4IOCL 3KHGA 5IT9U 1RBAA 3NCRA 3W2VA 3SYZA 1K8AO 1U09A 2KJWA 3FEXB 3CJ7A 2QV6A 1V5VA 3ENVA 4LUBA 1P8ZA 4NLUA 1DFDA 4DR2K 2YQ1A 2I6WA 4C3MA 3OL7A 1JIHA 1GQEA 4ID8A 1KC8T 2Q43A 3BB5A 1T03A 5J2PB 4OYWA 2ZBPA 3ZT3A 2ZDPA 2XLKA 3MECA 3LQVA 5K14A 1TL3A 2BXJA 2CDQA 2ZJQQ 3HI0A 3ZEUB 3ZT0A 3EY1A 4NXNJ 5DS7A 1SJ4P 3U4LA 4LF5J 5LMNJ 1UWBA 4GKJF 3HJFA 4FOIA 5AXMA 2MQNA 4KHRA 4EP5A 1G6BA 4ILHA 5H9EK 1OO0B 1VSMA 1S7IA 2NUUG 4JV5K 2CJXB 2OTLN 3HL8A 1FEHA 3ZZYA 3SUNA 4NCAA 3MX5A 2FVQA 5KG6A 2W9CB 4CHZA 4RU9A 3J7AP 3VGKA 1EWRA 5HATA 1VQNN 1CQMA 3MM8A 1SKWA 4R8UA 2QL5B 2G8HA 2QW9A 4R5PB 3CJKB 4E1JA 3SCXA 3QERA 2AEFA 2J7WA 3HSDA 2UXDF 3OTOK 4DQQA 2WVDA 4X65F 3RMCA 3LP1B 2BBEA 3MPUB 3MFHA 4IOAL 3O1BA 2MKJA 4OJGA 2M3DA 4PQUA 5HMWA 5GAHP 3O44A 1YI2N 1HBUA 1U2VA 1HWJA 4CE9A 3HFVA 3G96A 1RT7B 3QRQA 3O9UA 4JI4F 3WC0A 4QZVB 4CECA 4LF7J 1IBMJ 1WORA 2KKHA 5C2FA 1B99A 3GJQB 4LRBA 2CNKB 2N4CA 4I6WA 3KG4A 2QXFA 3J80U 3E9PA 3JYTA 1HWLA 3KLEA 3KMSA 1IR2A 5E0OA 3M1VB 5AQNA 5AE3A 1BISA 5M2RA 4B02A 1V4TA 4QPTA 4BE0A 4NLRA 4PXCA 1RLCL 1FTCA 2Y0SD 2DEIA 2I5JA 5BRFA 4C97A 4K2JA 1IO2A 2N7CA 3TAMB 1REVA 1CVJA 3ZNJ1 3ZTPA 2LXUA 2W6KA 2GIFA 2HWHA 3KUGA 3NXZA 2IM2A 1HJRA 2QWLA 3N0VA 2P51A 3UR3C 2W2MP 3G82A 3RB4A 3HM9A 4AL5A 4KHPF 3SI6A 3NH0A 1JLAB 2UUCF 5KFMA 4NZ7A 1BA0A 4IFVB 2GELA 2KFNA 4V19X 2DPJA 4A5AA 2EWSA 5GINA 5AZJA 3BS9A 4RR5A 2N7YA 1MN7A 2AA4A 2DXDA 1RCHA 3RRKA 2NZTA 2WRMA 3NS5A 2GIQA 5BR8F 1AW0A 1URRA 3UKUA 3MM5B 3BR9A 4U7UD 4HL9A 2RKIA 1DLOB 2PSZA 1RYSA 4FKXA 2FZCB 2U2FA 3KVGA 3AB4B 3LDPA 5KFDA 1N5YB 1N34K 1W0HA 2WCXA 4OPHA 4U96A 5IT9O 5D4OA 3AFGA 3IWNC 1N4LA 1U24A 3DHXA 4ZCLA 1S1XB 3F56A 3PRBA 4JI6J 2D0BA 4UUWA 4J5OA 4K0KJ 3EVWA 4PKIA 5KT2A 2VICA 4FW1A 4ZS6A 4B3OA 1VJWA 2HGNA 3R8EA 1TL7B 5F8MA 4DU8A 4JI5F 1X8DA 1YGYA 2LFVA 3AVAA 4I6MB 3ENWA 4HT7A 4CLSA 3H6EA 3T1HJ 3CD6S 2C42A 1C1CB 3T69A 4WK1A 4M5DB 2NLXA 1CJVB 2HRYA 5KFVA 3CDAA 2ZNZA 4EK2A 1RWNB 1SBRA 3ZZ0A 4ZVGA 1EKEA 1NLVA 3D54A 2QA1A 2DNQA 2E1AA 3WQTA 3GBTA 3BDPA 6AT1B 1GTHA 1KQFB 3O1WA 2KT3A 1S72N 2IBOA 5GADU 5EX3A 3P5JA 2EG2A 3PRVA 3LGHA 1TMJA 3UDLA 4KAIA 1N33K 4GMKA 1CZBA 4ZVFA 4CZCA 4HUGA 1CS4B 2ZFHA 3BPDA 1NHKL 3QLHB 4ZOSA 5EWFA 4FW2A 2HFSA 2YX6A 2YKMA 1T05A 1YJVA 4LSLB 4LR8A 1RT4B 3I9V9 1J53A 4L76A 4P9SA 4M8LA 3ILIA 2IM0A 5LMNF 4V19S 3VEVA 3MCSA 4KGKA 1X4HA 5KT5A 4FYYB 3VEOA 3TAGA 3GYXB 3Q8SB 3LDNA 3SQ4A 4NEYA 1TFYA 3J80O 2Z1GA 3E9OA 4CHQA 5IT4A 2UXCJ 1ZH5A 3KLHB 4K8RA 4KO0B 2A2CA 5HK4A 2QJ3A 5CR4A 3C15A 3CFOA 5F8HA 2FC0A 1KN6A 3H45C 4H4MA 4H5VA 1SV5B 1N0UA 2CNNB 4U6PA 4AL7A 4W5RA 1VAZA 2PA3A 3T5LA 3M1FA 2BE2A 4C8OA 2JLEA 1NCLA 2OD4A 1SJ3P 3M2RA 2QGFB 3CFPA 2KVQE 1XUPO 2FJAB 3NVKA 1K9MT 4MTPA 1JLQB 3KK2B 4DFKA 3RB6A 3L2UA 2D3OR 1IBMF 2AV5A 4YS2A 2BJ8A 2W4DA 4KB7A 1RWWB 4HTJA 4DV7J 5I42A 1TL5A 1KS2A 3KKRA 4LF4K 2GWKA 2GVDA 4MIBA 1HLUA 4DPXA 4A8KA 2J8SA 3WX4A 1S9EB 4QYRA 2GC8A 4KQZA 2YNFB 2IGIA 2ZVIA 5KFUA 4KHWA 2KVIA 1TYQB 4OX9J 5JMVA 3MPYA 4NYPA 4JI7K 2DXFA 3CJRA 3TQEA 3EEQA 4ES3A 4LFBF 4OLPA 2E1ZA 2XZWA 1SH2A 4DV2F 2OYQA 2E5GA 1VQ8N 4ZP7A 1NKEA 2CPHA 2OD6A 1RU1A 1KKHA 1UW9A 1WEXA 1XMOF 1JMTA 2B4UA 3VGMA 4AHVA 5HMZA 1MA9B 1PJ6A 4ATNA 2A42A 1UAWA 1C0UA 1PSDA 4GVBB 4FXDA 4CGJA 3AD8C 3KOAA 3H2VE 3SCLE 2BJ3A 3ZSXA 2R7XA 3GE1A 3BZQA 1U6FA 4U9RA 4K42A 2J9DA 1R0CB 1HNWJ 2NSBA 5L1KA 3K5LA 4IWVA 4JI0F 4CVNE 3P3DA 2R2RA 2RSQA 2F9TA 2D69A 1JQGA 3CT9A 3KK7A 4JKFA 3N28A 3QRRA 4CF2A 2DRDA 1WI8A 2KFYA 4GNIA 3X1LB 1ASWA 3JAMU 1HWUA 5ETPA 1VK8A 1W7WA 4JI6F 1RACB 2FLLA 4BC3A 1BO5O 2WTUA 4NLVA 5G4DA 1DT9A 4R0JA 3MDFA 4CF0A 4NLXA 1LWEB 3B82A 4NA3A 2OPQB 2YWWA 4WYBA 3UDVA 3FGUA 3D0IE 3TSPA 3T1HF 3VQ5A 3NL0A 3MCNA 4Y6IA 3MMCB 1FJEB 1CZAN 4FWNA 3B54A 4Q43A 3H5XA 1A5XA 2YKOA 1H2TZ 1T3OA 1AYEA 2CJAA 2O4GA 1RYRA 2APOA 3IXQA 3IGVA 5B0BA 5CXTA 2Z30B 2HQ3A 5IQQA 4O4RA 3R1XA 2P9GA 3RG6A 4CGFA 1YVUA 2XLIA 2HBLA 3W2VB 1AUDA 1VBKA 3JSMB 2A2DA 3U27A 3PO4A 3V81A 4TYBA 2NRTA 3FZKA 2HHHJ 2HS0A 3CM5A 3UD3P 1P90A 4QR2A 1REGX 2DPNA 2VF3A 4DR6K 1T03B 4E2FB 2YNGA 5L39A 3TAQA 3U1LA 3MECB 5IFMA 2QG9B 5K14B 1SJFA 1TL3B 1FNXH 2ZH4A 4DSLA 3UNYA 3GONA 3IBWA 4FDFA 1KFSA 1RNHA 4B1WB 1UWBB 2J8AA 2HURA 1S3XA 4OQJA 3OUYA 4OV6A 1X0FA 5JS1A 1FK9A 2IJNA 2DNLA 2UXCF 4BRAA 1OSCA 4CBWA 2A1SA 5AFUA 2D74B 4OPAA 1N8RT 4B1XB 5MLCQ 4MO4A 3HHLA 4B1VA 5BREA 1YVFA 4Y2MA 3RWUA 2CQ0A 4R8UB 3DLLQ 5BPMA 2V9WA 4LBPA 4QPXA 5GAEU 2RE1A 2NRVA 1FKPA 4L3NA 1FX4A 4JUZA 3LP2A 3HJVA 4BDPA 3NGZA 4BC7A 3BGRA 4Q2MA 4ZVTB 3P6YC 3FQLA 3EE3A 3MX2A 3M6UA 1WOOA 2BUNA 1GTEA 4PQUB 5B08A 1CJTA 4ZCMA 1HBUB 1HD1A 3V6KA 3QFWA 3AVGA 1UETA 5A2QY 4F0MA 5L9XA 3SBMA 5JJBA 2YNHB 4P10A 4P71A 2F9DA 2K8GA 1UJ4A 2G8UA 5M2PA 1TUUA 4EYHB 3DMJA 3OYLA 2KT5A 4GVMA 3CJ3A 2Y1RI 1RAOA 1YJNS 3KLEB 4LFAF 2FLNA 5T7BA 3NP5A 2A41A 4OX9F 2FBYA 2P9IA 5KFSA 4GVLA 3KNAA 1D8YA 2W01A 3PW0A 2I5JB 1LK5A 4CK3A 2AJFE 1A7GE 2B4VA 4Y2AA 1HARA 2J0XA 2MLZA 1REVB 3W2WA 3D6HB 1RDUA 1NU4A 2VL1A 2VU5A 4AD6A 2VPYB 2J7KA 4IXCA 3RSEA 1DY3A 1YJ7A 3VHQA 1S6UA 1EAYC 2IVYA 2XTJP 3G82B 3THTA 1W2BM 3OHAA 4Z7CA 5LOQA 5FLXU 4NMLA 3EJMA 5GIPA 2B6AA 3T5HA 1V9OA 1U0SA 5LT5A 2YWFA 2KLAA 2WHOA 3CMAN 3ISZA 4LRDA 4IOBA 3KDOA 5CYMB 3QGPA 2QWQA 4F4AA 3MN9A 2B4OA 2UUAJ 3HDSA 2CQGA 2PEHA 4FJJA 2CH6A 1C0TA 1WKJA 2QLFB 4PG7A 2J9EA 4CHNA 2DGUA 3H3OB 3TI0A 4CLWA 3EGZA 3C16B 3OYNA 2Z8QA 1HBOA 2X74A 1B7YB 3EUNA 4C9DA 3VQ4A 1FDAA 1A5VA 4FZZA 2DHSA 4BRDA 1XHZA 2CPYA 2XC9A 3MTKA 4BRFA 4NZ6A 4TXSA 4RW9B 2E2OA 2P1JA 4JI2K 3DOMA 5AJ3J 4ECSA 5ETQA 5M1PA 3CQYA 2MQMA 1G7CB 3GG1A 5DZ7A 2OTLS 2JWLA 4P2FA 1CJUA 4M3ZA 1W9HA 2G1DA 2GO8A 2C2MB 2F7TA 5GAEI 3SJJA 4KC5A 4DQSA 4DU4A 3Q22A 3IAYA 4BCAA 2WOMB 1VQNS 1HPMA 4B3SK 3FC9A 4ANDA 1Q86T 4B3OB 3FKBA 2LQ5A 3P45B 4NA1A 2CG4A 4LSZB 4CLZA 3HHLC 3D0PA 1CULA 2F8MA 2E9RX 1HA1A 2OO4A 3GCXP 1HKCA 2B5JA 1KVCA 3K9JA 3QO9B 1VQYA 3IM9A 3FBFA 2BABA 4PAAA 1YI2S 3L2QA 3DLGB 5IWAK 2LA4A 2DK2A 1QD1A 3KD1E 2J6UA 4I68A 2LQ8A 3RYLA 2XMWA 3CB4A 2RDDA 5DGBA 5AQHA 1FDNA 4DU1A 5D8HB 1HR0J 3A0IX 3GIKA 3HTVA 5GMDA 4K25A 1RA7A 1BG3A 1F9EB 4XEIA 3UNGC 3H0PA 1B92A 3B4DA 1BUXA 2K1RB 4CNZA 4KIAA 3FCVA 2IVOA 3OHBA 2NUBA 1RTDB 3I6PA 5LSLA 1FA0A 4RBUA 1W26A 3A3PB 1EP4B 2UVVA 3N4WA 2RN2A 2YKMB 3VGTA 1T05B 3EZUA 3OTEA 1QTNB 4KHMA 3PDNA 1VHFA 1PKUA 3D7EO 4WQ5A 4PXBA 4CRJA 2IA6A 3C6TA 3UD5A 4I2PA 2Q0RA 1WOPA 1JJHA 2DEJA 4BR9A 1YG0A 2XI2A 4Q7AA 3SXLA 2D9OA 3LDSA 3KG1A 3H5SA 2IRXA 4FSVA 4CNYA 9ATCB 2E1CA 1O5JA 3C3LA 1QUVA 1E6YB 3A8KA 1RBVA 3CIMA 4USUA 3SPZA 2ASPA 1PJ5A 3TX0A 4DUYJ 1KNZA 3UO0A 3ATVA 1NK7A 5F3TA 2KZZA 3IFEA 5AQJA 2UVUA 2DD8S 1NK5A 2OELA 4KRFA 2XMAA 1QQMA 2W4PA 3FK4A 2KTQA 1JCEA 2RB7A 2KG1A 2WVCA 3ASMA 1RCOB 1HQUA 3J7ZO 2QLWA 3JSYA 3F44A 4DV3J 2CGJA 5FLXO 1O0PA 2X6SA 1OH8A 2VBXA 5MAOA 1S49A 2D0AA 3CCQN 3UQSA 3KXDA 2WK4A 5FPNA 4WFYA 1WSEA 1H0HB 4B3RK 2IIRA 3S3MA 1HQ2A 4O0IA 5AQWA 3L4BC 2VFVA 3SBGA 3VGUA 2MLYA 1RBSA 4GKJK 3TZXA 3DDKA 4ED2A 2GVDB 1K0TA 4CJ7A 2ALYB 1VRQC 2QLXA 4DWIA 4B08A 2W40A 4MH8A 4J2BA 4DR1K 4AQYK 1VQLS 4M3RA 3MAQA 3C6AA 1UKUA 4E7IA 2E7VA 3D2FA 4RLEA 1D9AA 4X66K 3CF5Q 2PBDA 3DLHA 4CF8A 1D9DA 4QU6A 5HROA 4QYZJ 3M6GA 2G9OA 1NGBA 2AW0A 3D6RA 3ZCMA 2J6TA 1LW2A 5IC4B 1U1NA 1SC6A 1S72S 1NHUA 2E6LA 2VV5A 1XNQF 1HW9A 4X65K 1BCMA 4ZCKA 2GQCA 5LJWA 2I9SA 1Q5YA 1C0UB 5AE1A 4DR7F 3P31A 1MLAA 5AQSA 4E1NA 5GAEP 2FVCA 2E9ZA 2KXHA 3AVMA 2VJVA 5AZIA 3D1OA 4ZIVA 1SQFA 1WSJA 3KLVA 4YHHJ 2HF3A 2VG7A 3HT3A 1IH7A 4FO0A 2YX1A 1HBNA 2X7IA 1P9QC 3R6LB 1IM4A 4ILJA 2I7PA 5D4LA 4PL7A 3OFEA 4Z2XA 1D8ZA 1RTJA 5KG3A 4WQ5C 1GLFO 2BJ7A 2EC2A 3HVTB 4BDZA 1L3TA 2LSNA 5AQQA 1BGXT 1T3NA 2BUPA 5HAOA 3CDEA 3ZTQA 3TEGA 1F5BA 3TUIC 4F7VA 2Y8YA 3SK3A 1NH7A 1JKHA 5ETOA 3H2LA 1B9DA 2KXNB 1T6CA 4B3MF 5LJ3Y 1G1XA 3ULEA 5AT1B 1W97L 4NLDA 2W9BB 4CK2A 4LSNA 4DCOB 1ZAVA 2GAHC 2KYZA 3RJMB 5HLFA 4XDCA 1IR0A 5C2CA 1E4FT 3G2XA 2UUCK 3AGKA 1JB0C 2XM3A 5M2UA 5AQIA 1Y7PA 2BDPA 1FW6A 3JS9A 4CLFA 3PY8A 2QA2A 1X4BA 1HR0F 5SZTA 3DRYA 4C48A 5AQKA 2M5YA 4BR4A 2DNKA 5BR8K 3JTOA 3W62A 4JI3J 1N32J 1HHTP 5AQTA 5BR9A 5BYRA 3BBFA 5BJRA 4CHOA 1IKYA 1YQHA 2H1YA 1S1TA 2OUGA 2ZBRA 3MXHP 3H5YA 3JS6A 1BU6O 1WI6A 3ZZOA 3F9KA 5CY4A 4EP4A 4GKKF 3PEHA 3U9ZA 3NGRA 5BPNA 4JV2A 2YNGB 2ASDA 4NYOA 1VQ8S 2PO4A 1KEKA 3VMFB 3V5RA 1U1OA 3K17A 4FPBA 4K4XA 3DGPB 2LEPA 2MB0B 4CZMA 4YOXA 4WP9A 1F5AA 3OVBA 4B9TA 5AR0A 2PYLA 1FK9B 5KFFA 5CA5A 3KKFA 2ADCA 1HNZJ 3PJXA 3ICLA 4ETZA 4K4ZA 2HNYA 4WCEL 2AMCB 2AJQA 4C98A 3GJSB 2PDAA 2Q36A 3HHLB 3TU5A 3TZYA 3P4IA 3RBDA 3T1YF 3B6BA 3CD0A 1GLJO 2IVPA 4L3KA 5J2QA 4P2MA 1VQ9N 3MD1A 1FKPB 3AA5X 3QJLA 4JS5A 4DEZA 4DTUA 5HN0A 3LP2B 3PIPQ 2G1HA 2IMWP 2P9CA 3DI6B 4MT1A 2Z2ZA 2KZMA 3AVIA 2B9XA 1WC5A 2E2NA 4QJVA 4DV3F 4CLUA 4BR0A 4O44B 1H73A 4M5IA 2DNZA 3X3UA 4LREA 1CJTB 3GJRB 3ZX2A 1VGYA 4WWSA 3U8XA 4A8OA 1RHMB 2J7UA 2QMWA 4NXNK 2JL9A 2PAVA 1JLCA 5F9LA 4CYUA 2IYGA 4P6QA 4KGZB 4CIGA 4LF5K 3TVYA 5LMNK 4UY8T 3HVWA 2VD3A 1X9WA 3G6XA 4BREA 1H6KX 5EUHA 4OHWA 1FRXA 2BQ3A 2WBMA 3B4MA 1BHLA 1FWPA 4I7FB 4KBIA 2ZE2A 1PAEX 1FXDA 1NB7A 4Y0FA 1EX4A 4NYZA 1IBKF 1JLBA 2E20A 1VQ6N 4M5MA 1S79A 4BRGA 2P9IB 4GC7A 4H03B 1XWLA 4FJKA 3Q8PB 2XYHB 2IVNA 5KFPA 5DMRA 1BCOA 2NQPA 4N56A 3HHKA 1GLCG 2FVSA 4PL8A 2HHXA 4I2QA 3GB0A 4BRMA 4EI2A 3VQCA 1AT1B 1QQNA 5M1FA 1WSFA 4DX8H 2A1BA 1DRZA 1TP7A 3RSEB 2ZBIA 1DTTB 2ZKUA 1N56A 2EPIA 3MMAA 1S0OA 2B6AB 2CXEA 3R7SB 1LCUA 1RHUB 3RB0A 4RW8A 2ZITA 4M41A 5HOOA 4U7CA 1YBUA 4BY9C 4QOTA 4HHJA 4PG6A 1TUYA 1H3DA 3C14A 4LF7K 1IBMK 4IZ9A 2KDOA 3SNNA 1UEKA 1LWFA 2YWGA 3M3ZA 1A6LA 4QWDA 4YP3A 1WEZA 3G8TA 2HQFA 1VSFA 4MYTA 1GMWA 1HBOB 1RGVA 1SL1A 4U67L 4CF1A 3FSYA 2VUGA 1RT5A 2CZ4A 3DOMB 4G1QA 2HZVA 4LIRA 2ATQA 1S22A 3SFGA 3DOLB 1QJHA 1XQIA 3Q23A 4LBHA 1CJUB 4JKGA 1GOCA 1QSYA 2KI2A 2ZZNA 1C1BB 4ZLNA 4YDDB 4RW4A 5M1OA 1ILYA 3P5TL 4J2DA 4A61A 2BGGA 2VONA 1U8SA 2DHXA 4LF8J 2QTWA 4HCBA 4ZTFA 1XTZA 2E2PA 3H1QA 1ZZNA 3IG1B 3FZLA 2M70A 2E5LJ 2OA8A 4J9MA 2HBZB 2WZ1A 2VWKA 4WXWA 2K3KA 1YKWA 4C0OC 3ZX3A 5IC6B 1U25A 3BEGB 2DCLA 3VQPA 1NO8A 1ICEB 2MLXA 4ELUA 2RE2A 2OEMA 4DQ8A 2RAQA 4RNOA 1IM6A 4NXMJ 4LH5A 2YWEA 5I4MA 3UDCA 4KI4A 1U1QA 1G2EA 3VN5A 3O3GA 2CVEA 4JI0K 2YX7A 1SIZA 4BGBA 2HVEA 3BV8A 4G65A 2JC1A 4W98A 4X4SA 1Q9YA 4AXJA 1AXQA 3TQ1A 5EGYA 4K41A 3GOIA 5A8RA 2W7AA 5L46A 5ETMA 3MTJA 4JI1J 3JB9k 3QAEA 1SL2A 3LP3A 4BG9A 5C15A 2DTJA 4JI6K 3CJ9A 1QSSA 2FJDB 4OMFG 3VAHA 4LT6A 2VPWB 2PI5A 1BMQB 2CJYB 1HBMB 3O1LA 4MIAA 1U1PA 4ZDNA 3RRHA 3V9SA 3DRSA 2RD5C 1HD0A 4CIFA 2DFFA 3C6TB 1S6QA 2CQDA 3QFPA 3L7UA 4E98A 3I5CA 3AAQA 1WTBA 2G0IA 5KFRA 3P38A 3T1HK 1ATRA 2PA8D 3D9BA 4CJ4A 3NBPA 4OI1A 3QAUA 2HQCA 5B0GA 3SSRA 4W90B 1OYEA 3HRGA 3CMAS 4F9OA 4B9SA 4DQPA 4CZGA 3BGUA 4OGCA 1EIYB 3QNOA 4KHUA 4ZA1A 1KAZA 3CJ1A 1YK9A 3DLKA 4NRTA 2NXEA 1YRXA 2BA9A 3WEEA</