1RT4A

Hiv-1 reverse transcriptase complexed with uc781
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
542
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 147
structure length 536
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt4A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt4A05
1S9EB 3FSIA 5KFGA 3FDSA 4B8CA 2FVRA 1XHXA 3M9MB 2PYLA 4CJRA 3OSPA 4RW4A 3S3OA 3SI8A 3NFAA 2KZMA 3KLFB 1C1AA 4O3RA 4EBDA 4RG8A 2HHWA 2ILZA 3O4NA 1X9SA 3PJXA 4FM1A 1JLEA 1J5OA 3B6PA 3MTKA 4R8UB 3LANA 4PWDA 3L2RA 4FZYA 2VG5B 1N56A 4FLZA 3N6NA 1UAXA 4B08A 4B3OB 3NAIA 4EP5A 4ECRA 4KSEB 3I0SB 4WZQA 4F2RA 2NUBA 1U47A 2FC0A 5DQHA 4CEFA 4FS1A 3V6DA 2JC1A 4URQU 2G8VA 4DS4A 4NLSA 2BQRA 4FJMA 4NCBA 1BQMB 2YNGB 1EX4A 1TQLA 2XY8A 5J2NA 4ED2A 1HMVA 5KG3A 1QUVA 4QW9A 1KFDA 3ULDA 3SFGA 4KTWA 3V1QA 3V1RA 2RN2A 4BE0A 3AVNA 3WNEA 3K5NA 5L1LA 4MFBA 1S6QB 3K5MA 1IG9A 4W5NA 2QXFA 4DFMA 1K1SA 3CJ4A 1LWEA 3V6JA 4AHRA 4M3TA 2IDOA 4HUFA 3NH0A 3K5OA 4ED7A 1JLCB 2E4LA 4ECYA 1T05A 5HRRA 2AU0A 3V9XA 4AILC 4Z0UA 3H5XA 4DL3A 3O3FA 3H5YA 3IRXA 4YQWA 3EPIA 1HQUA 4DQIA 1ASVA 1TV6A 3DLKA 2G8HA 3T1AA 2EHGA 3NGIA 3O3GA 4DTUA 4J2EA 3TANA 3MECB 4HTUA 3DYAB 4RUAA 3KOAA 3QEXA 3KK3A 1VRTB 3DMJA 2JGUA 5D3GA 2HB5A 4DL5A 4ECSA 1RDDA 2OYQA 1RNHA 4B9NA 1TL1A 1UA1A 2OPRA 4RW9B 2HNDB 4KB0A 1KVBA 4MK7A 4CGIA 3SPZA 4FZZA 1JXBA 1D5AA 3BQ1A 3S3NA 4EO8A 4DTOA 5DG8A 3OYHA 4DL4A 3KLGB 3ZT2A 2WONB 3NE6A 1S1TB 4H4OA 2RDJA 2XRIA 1TK5A 3B6OA 5KRTA 2ZE2B 4CFDA 2HHTA 5F8NA 1NKCA 4DTMA 5C42A 2D0CA 4KTQA 1TVRB 1TKTB 4DWIA 4LSLB 4ZP8A 5I42B 1U49A 1GX6A 3L3UA 1K6YA 3ICLA 4ED8A 4CGGA 3DLHA 1VSKA 2BE2A 5DGBA 4DTSA 4EYIB 4KE5A 3LAMA 2B4JA 3AO5A 1S1UB 2BGGA 4I2PA 3SFUA 2B6AA 2RF2A 3LWLA 4DLGA 3GQCA 3KLIA 5HLFB 2HAIA 1RBUA 3ITHB 4FBTA 3CYMA 1ASUA 2J6UA 5KGWA 4Y2AA 2E9ZA 3H98A 4FJIA 3TAPA 4HCBA 4IQXA 2HMIA 2D7SA 5E41A 5KFFA 4FJJA 4IH5A 1F21A 3DI6A 5EUHA 2HHUA 2C2EA 4ZVEA 4F2SA 2HVHA 3C6TA 2W7OA 5CZ1A 3OYDA 3E51A 2XHBA 4FXDA 3DOLB 4CFBA 1NJXA 1N4LA 3NF8A 2E9TA 1CZBA 3IG1B 4ECXA 1RTJA 5EU7A 2AWZA 3PZPA 3ZCMA 3RRGA 3VN5A 2P5GA 4FJKA 2ATLA 4ECTA 3QEIA 4RU9A 1IKYB 4OLAA 4KFBB 4ID5A 3MR3A 1GOAA 1MU2B 2BANB 3KHGA 2C22A 2KTQA 1IM4A 4O4GB 3H4DA 3KK2A 4CJ3A 5KFSA 4EBEA 2HVIA 3ASMA 4KHSA 4GC7A 3HPOA 1HNIA 4FM0A 1BQNA 2IAJB 2F96A 3M8PA 5HBMA 3MEDB 4IG0A 3UR0A 1RT6A 3RAQA 5EWEA 3BREA 1HNVB 3VQ8A 5F8LA 2IM1A 3QINA 3C6UA 3UIQA 5KT7A 2CKWA 5KI6A 2IBKA 3KHLA 3ZSQA 3MR2A 1DTQB 3P5JA 4KKOB 2XGQA 3OYAA 2JEIA 4B8AB 5F8IA 2O4GA 3HSTB 3TAQA 3BSNA 1U04A 3V1OA 3G0ZA 1IKWA 2VG6B 4DL6A 4JV1A 4NCAA 4Q45A 4EYHB 1N5YB 3Q8PB 4DTJA 1RDCA 1SH3A 5SZTA 2I5JA 2VA2A 2WRMA 4E1MA 4J9KA 1NOYA 5C25A 4K4WA 4CJLA 4DU3A 5JUMA 3JSMB 1RTIA 1RT7B 2QK9A 4FLXA 1NK5A 1SL1A 1N6QA 5F8GA 2G8WA 1QSSA 2W9CA 4M3ZA 5KG2A 4F3OA 2Q3SA 3PVXA 5KFPA 2FJVA 1RYRA 3OYNA 2G8FA 1L3UA 1C6VA 4AH9A 3OL8A 4MIAA 4OKJA 2HHQA 4E0DA 5L1KA 2HHVA 1WSHA 4KHYA 3MXMA 2KFZA 4YMEA 5KFUA 1HPZB 1R0AB 4G1QA 3H2LA 3MR5A 3KLHA 3L3VA 4ZMMA 3PW5A 5HROB 4HUEA 3U6FA 3CFRA 4KI4A 4O44A 5KG0A 1JLGB 4O4RA 1EP4A 2OPSB 3T3FA 1NJYA 1BI4A 3SV4A 2GC8A 3DOKA 3BQ0A 5J2PA 3D0PA 2A1RA 1QTMA 4DU4A 4HHTA 4FJXA 4RW7A 1C1BA 4O55A 1Z4UA 2G8IA 2YHAA 3I8DA 2B5JB 5F9NA 4B9TA 3Q8RB 1KLMB 3DLEA 1ZYQA 1WNEA 1T03A 4JUZA 4DSIA 3BDPA 2W9BB 3CJ3A 5KT6A 5KFWA 4FK2A 3KJVB 4TYBA 3D28A 3SUOA 2DFFA 4IG3B 3NAEA 3GV7B 1S9EA 1RT1B 1JLAB 5CYMB 1GOCA 4ELTA 5I3UB 4C8NA 4ZPCA 2QV6A 5CZ2A 4K8XA 1K1QA 3TAMB 3PY8A 3H59A 3G6YA 3H5SA 4LSNB 2BQ3A 1IKVB 4ICLA 3OHBA 2FBXA 1ZBLA 3I0RA 1C0TB 3QO9A 4CF8A 3BGRA 1B9FA 4TY8B 3RB3A 4NLPA 4GMJB 2YNFA 1RT4A 4O0JA 4R0EA 4IRCA 2ASLA 4CJTA 4QOZB 3AO3A 1C0UB 2ZD1A 3DRSB 3LP3A 1S1VA 3AO1A 2OPPB 4FJ5A 1FXXA 3NDKA 4CJUA 2WCXA 1QHTA 2JLEA 4K4VA 4ZVFA 4LY7A 2VG7A 5KFQA 4WXOA 4JRQA 3NGDA 4CHPA 4IDKA 2WOMB 4MK9A 3CFOA 4FLYA 3LP0B 4MH8A 4J9SA 4NCGA 3JYTB 2IC3B 4E7HA 3OY9A 4DSKA 2D5RA 4XPCA 1Z25A 4L8RB 4IFYA 1QSYA 3QIPA 3GIKA 4MIBA 4IRKA 5EDWA 4FCYA 1CZ9A 4H4MA 3L2WA 2Y1JA 4RZRA 3OL9A 1LW0B 3BQ2A 2YKMA 2HWIA 3QESA 5KFTA 4KB7A 5HRPA 3LP2A 2RKIA 2W9AA 1S9FA 5FROA 1JKHB 2YNIB 2OH2A 1JLQA 4M41A 2DFHA 3KMSA 2ZQBA 3NCIA 3PR5B 2HNYB 2XCPA 1RTDA 2X6NA 4MK8A 3HXMA 3G6VA 3AO2A 1CXQA 3VQ7A 1RBRA 4CF1A 1S1WA 3OL6A 4RW9A 4CERA 1QE1A 4RNFA 5J2QB 2GUIA 1SKWA 5J2MB 3LDSA 4KTZA 2GIQA 4CK3A 4ZHRB 2GBZA 3EZUA 3K58A 3OVNA 1SH0A 3CJ0A 3P1GA 3MAQA 3MFHA 1XI1A 1DLOA 5FDLB 3AVMA 4YFUA 4TLRA 1LWCA 3AV9A 3ALYA 1NNDA 5C24A 2ALZA 1FKPA 4LH4A 4PUOB 2OPQB 1KHVA 3OL7A 5HP1A 5DGAA 2XY6A 1GOBA 2D0AA 3TI0A 3D45A 1NHVA 4M3YA 1A5WA 1I39A 5KFXA 3V4IA 3QIOA 1LAWA 4RW8B 5DMRA 3G10A 2V4QA 3NBPA 3QZ7A 2V0NA 1SUQB 5L1IA 4CE9A 4DMNA 4B9MA 4LQ9A 3MEEB 3HKWA 1ZTWA 3M8QB 4Q44A 2KW4A 1D0EA 1B92A 3LAKA 3A2FA 3DRPB 1O1WA 1SV5A 3E01B 3OYIA 1VSLA 1FK9A 2VWJA 2V4RA 1T8EA 3TVKA 1QS4A 1TKXB 4FVMA 1JL2A 1VSIA 2XCAA 1XR5A 4F50A 1NK4A 2G8UA 1LW2B 4NZ0A 3SCXA 4NLOA 1S1XB 1JLFA 4H54A 3NH1A 3MR6A 4URGA 3HL8A 3T19A 1ASWA 1WSJA 3GV8B 4EP4A 3RMCA 1ZBHA 3DDKA 1UWBA 3OYMA 3BSAA 4O3SA 4RW6B 2KZZA 2FBTA 4O3NA 2O4IA 4M3XA 5JS1A 3F9KA 2FBVA 3OLBA 1LWFA 4DL7A 2HNZA 4ZP7A 1D9FA 3OS1A 3HK2A 3CWJA 5KG1A 4W5QA 1UOCA 1BIZA 1TKZB 2XC9A 4Q5VA 4J2AA 1L5UA 5L9XA 2Y1IA 2C2DA 4ECZA 4ELVA 4QAGA 4RW4B 3HPHA 4N41A 4HUGA 2ILYA 4OJRA 4WZMA 2D3ZA 4ZPAA 3O3HA 4OVLA 4W5TA 4E3SA 1WAJA 1T94A 1JLEB 1J5OB 3VQ5A 4FJHA 5EWGA 4URSA 2UVRA 4FK0A 3NL0A 4ECVA 3V9ZA 1RAJA 3RAXA 3AVBA 4N5SA 1X9MA 1SKSA 4B9LA 1VSFA 2WHOA 1Q8IA 4FLWA 3V6DB 2E6LA 4KAZA 3KK1A 2IA6A 5KFLA 5F8MA 4TY9A 4HVJA 2XWYA 1WNSA 2WB4A 5J2NB 3QGIA 5CYQA 1HMVB 4KRFA 5DLGA 4CJVA 4WE1A 2Z1GA 5HRNA 1YTAA 3MEGA 3KHHA 4EBCA 1RT2A 4CCHA 1RDBA 2BRLA 3RR7A 3ISND 3EPGA 4DQSA 4MFBB 1RBTA 2HW3A 3KD5E 2AJQA 3JSMA 2P1JA 2IMWP 4CGHA 3RBEA 3T5LA 4K4TA 1ZBFA 4KHUA 4DG1A 1EETA 4KO0A 1LWEB 2YNHA 2UVVA 3KD1E 4NYNA 5JXSA 2UUTA 4CEAA 2PZSA 1T05B 4CK2A 4CJSA 3T5JA 4E19A 4ECWA 2FVPA 4OGEA 4CK1A 3HVTA 4KREA 5DK5A 4CJ4A 4B9SA 1RT3A 4C8LA 3CDWA 4QWEA 4NLRA 3IRXB 1C1CA 3GILA 3MFIA 1TV6B 3DLKB 3LWMA 1B9DA 1R0AA 1Z26A 1NOZA 3NF6A 2P5OA 1RTHA 3KLEA 1SKRA 3AVKA 4ECQA 3KK3B 1WSEA 3DMJB 3QNNA 5D3GB 1RA6A 4XIUA 4F4ZA 4OGCA 4TYAA 3QLHA 3UQSA 1TL1B 1TL3A 4K50A 4FK4A 2OPRB 2Z1IA 4WYLA 2FLPA 3M8SA 4J9LA 3DM2A 4IKFA 3TAGA 2WK4A 4YR2A 1TAUA 3ZSWA 4I7FA 4IKAA 2QKBA 2D41A 4YR0A 1CLQA 1RBVA 3K59A 4JV0A 4NYFA 4ZTJA 4CESA 1D8YA 2PY5A 3MXJA 3SZ2A 4AHCA 1HJRA 3V9WA 3PUFA 4H4OB 1REVA 5KT3A 4KV8A 2ASDA 3V6HA 1S4FA 4WFXA 4NLDA 2YKNA 2DY4A 3ZT3A 4X2BA 4FJNA 1RILA 4EZ6A 5J1EA 5KG5A 3HO1A 5C42B 3LP1A 3PX6A 1KSPA 5I3UA 1JLBA 1GX5A 3ISNC 4R5PA 5DG7A 4CJ5A 1HQEA 2BE2B 4PQUA 3NHGA 4Q0BA 1T7PA 2R8IA 2F8SA 4NRUA 2QKKA 4C8KA 3HVAA 1TK8A 3OHAA 5KFHA 4CJWA 1FKOA 4NLXA 4I2PB 4I2QA 3CJ2A 3OSNA 3AA4A 2B6AB 2RF2B 4CHZA 3NF9A 3KLIB 4EO6A 4Y3CA 3DRRB 1CSJA 4CEEA 4OKKA 1TP7A 3P83D 3AVGA 1U4BA 2AGQA 1S10A 3QEPA 3L2VA 3DLGA 5KFOA 1S5JA 5HRSA 3SJJA 4OPJA 1OS5A 1YT3A 2W8LA 3V9SA 5KFZA 4O3OA 1L3VA 2DTUA 3DI6B 4O5BA 1S9GA 3OJUA 1SL2A 1DTTA 1S6PA 4IH6A 3OYKA 3C6TB 4G3IA 3OYLA 4N56A 3HM9A 4DEZA 2GV9A 1JXLA 5T7BA 1S0NA 4DL2A 4IFVA 3CVKA 2XGPA 3C94A 3RB6A 3N6LA 1RTJB 1IKXA 4QWAA 3PR4A 2R2RA 3OYBA 4DS5A 2UUWA 1SL0A 1XC9A 4FZXC 1WSFA 2FVSA 1VSDA 5KG7A 1VRUA 4K4UA 1RT5A 4ID5B 5FRMA 1IH7A 4EZ9A 4TSXA 4DTPA 2A1SA 3TARA 1S0MA 3IS9B 4J2BA 3KK2B 3VQ4A 1QSLA 4AHTA 2OZSA 2YNIA 1HNIB 4N76A 1W9HA 4ED1A 1BQNB 3QNOA 2R8KA 4HKQA 3M8PB 3PHEA 5HBMB 4IG0B 3FFIA 1RT6B 4HCCA 2WTFA 5KT5A 4Z4HA 4Q43A 3SUNA 1NJZA 2X74A 2R2SA 5K14A 2XY7A 2FVCA 3C6UB 2X78A 1NKEA 3G6XA 3KLFA 4CHOA 3ZSOA 3CO9A 2FVQA 5KG4A 2R8HA 2X6SA 3ZSXA 2VA3A 4Z4IA 4R8UA 4NLGA 2VG5A 5KFKA 4B3OA 1D9DA 4RNMA 3HVRA 1IKWB 4ZVGA 2V9WA 3I0SA 4K4ZA 3CG7A 4CEBA 3VQAA 3EY1A 3IGVA 4TQRA 4O0IA 1BQMA 5DLFA 4BDYA 2I5JB 2YNGA 4MQ3A 4ID1A 5C25B 4LH5A 4OL8A 3RTVA 1RTIB 4F4YA 4JS4A 1NKBA 2JEGA 3HP9A 1N6QB 4M42A 2W9CB 3HHKA 4RNOA 3AVAA 2AX1A 5CY4A 2XY5A 1NK6A 3GYNA 4IOBA 4ECUA 1I6JA 4J9PA 3QYYA 2AQ4A 1S6QA 2OA8A 4CJPA 1C0MA 2JEFA 4MKBA 1HRHA 1J54A 1HYSB 2PYJA 4BWMA 1JLCA 4Z4CA 1KLNA 3E01A 1TK0A 4OKEA 4DTRA 4M3WA 4G1QB 4YNQA 4TN2A 5KFBA 3VA3A 4BE1A 3KLHB 1S0OA 4Z4EA 5KFCA 4J9NA 4RNNA 2XO7A 4O44B 4ZPBA 3NH2A 1EP4B 1QAJA 2FJWA 2HWHA 2ASJA 4XPEA 3UPFA 1KRPA 1BI4B 3LPTA 3HP6A 4DFJA 5C5JA 3S9HA 4WFYA 1NHUA 4MKAA 3DOKB 3IN5A 5J2PB 4CJEA 3LZIA 1I3AA 3MECA 3DYAA 4RW7B 1C1BB 1VRTA 3QETA 4O3PA 1C2PA 2W42A 4AHVA 2ATQA 3DLEB 2F8EX 3AVHA 1EKEA 3ZT0A 3PW4A 4DSFA 2HNDA 2XI2A 3HYFA 4CGDA 1N48A 3IGNA 1ZETA 5DG9A 4FLTA 3NGYA 3AA2A 3G86A 4Q8FA 4IR9A 2E9RX 3KLGA 2WONA 1W0HA 3F73A 1S1TA 3V81B 3TQ1A 1QQCA 1VSEA 2Z1JA 3SPYA 3I5CA 4DQPA 2ZKUA 2F8TA 3OYGA 4CFCA 1VSMA 2D3UA 2ZE2A 1J9AA 2BDPA 5KFNA 3OYJA 3U3GA 4U6PA 5KG6A 1NK9A 3SV3A 3CDUA 2CJQA 1TVRA 1TKTA 4ICLB 3QERA 4LSLA 2W7PA 5I42A 3I0RB 2UVUA 3QO9B 4F8RA 3AVJA 4FS2A 3BGRB 4K4SA 5KTQA 2I1RA 3PX0A 2Z1HA 4KHMA 2YNFB 4K4YA 4DSJA 1IO2A 3DLBA 1RT4B 1S1UA 3SNNA 3WNFA 4WXWA 3QGHA 5DQGA 3QIDA 2ZD1B 5HLFA 1QAIA 1S1VB 4E1NA 3ITHA 3DLRA 2KQ2A 3TABA 4F4KA 4CEZA 2VG7B 3WNHA 3K57A 1RDAA 5KT2A 4IDKB 3OYFA 1S48A 4YR3A 3V9UA 1D1UA 5KGXA 4E7JA 5T14A 4NCGB 3IAYA 3K2PA 1KHWA 4ED3A 4DFKA 1BL3A 3Q8QB 4IFYB 4FJ7A 4CEOA 3QIPB 3M9OB 3DOLA 3VQSA 5KRSA 1BGXT 4KHNA 4H4MB 3IG1A 2J6SA 1MMLA 3L8BA 2YKMB 2HHXA 4O3QA 3ZT1A 4DFPA 2JC0A 3LP2B 2RKIB 1RA7A 5SWMA 3HVWA 2D0BA 1IKYA 4KFBA 1JLQB 3CIZA 1J53A 4C8OA 1MU2A 2VWKA 2BANA 4KHWA 4DQQA 4ZP9A 1TKDA 4O4GA 3PW2A 5KFYA 1BISA 3KKSA 3TWHA 1RTDB 1Q9XA 3NGZA 2R2UA 2IAJA 3GIIA 1S1WB 3MEDA 3RB0A 3AA5X 1QE1B 2IJNA 2C28A 4IRDA 4K8ZA 4ZPDA 4DSEA 1HNVA 3QZ8A 4H8KA 3FQLA 2FBYA 4AHSA 5KFJA 1DLOB 1HYZA 4PWDB 3ZSVA 3KLVA 1DTQA 4XO0A 3KIOA 4KKOA 1LWCB 2OZMA 3THVA 5C24B 5L1JA 2RPIA 3C95A 1FKPB 4E7LA 2ETJA 4M3RA 4F4WA 2IM0A 3CFPA 2IS3A 4IR1A 2XI3A 4NYZA 3AO4A 4W5OA 5HP1B 1KTQA 2VG6A 1S97A 3L2QA 4EEYA 3FQKA 3K5LA 3V6KA 1YVFA 1VSJA 4CIEA 4M3UA 1N5YA 3SUPA 2R8GA 1X1PA 3PW7A 1SH2A 4B9UA 3MXIA 1YVUA 3NMAA 1VSHA 1BIUA 3V4IB 4BACA 2YHBA 4N47A 3DRRA 3NBPB 1RT7A 2O5DA 4GW6A 5KFIA 3PX4A 2P51A 1TAQA 3SQ4A 4ZTFA 3VQ9A 4FJ9A 4BDPA 1WSIA 4CIGA 3OYEA 1SV5B 4CJFA 3SUQA 1HARA 1FK9B 3FRZA 3VQ6A 4Z4GA 1W25A 4Y1DA 1KVCA 3KNAA 4FW1A 3BSCA 1U48A 1TGOA 3GIJA 1HQUB 1S49A 1HYVA 4HYKA 1JLFB 3RMDA 4M94A 1HPZA 3EZ5A 2DFEA 2FLNA 4Y34A 4KPYA 4ED6A 5HROA 3GIMA 3RRHA 3LALA 1ZBUA 1JLGA 4J9OA 1XR7A 1RBSA 1L3SA 2OPSA 1LV5A 4KHQA 1UWBB 4E7KA 3KHRA 2RDIA 3VQBA 4FJGA 3HT3A 4FYDA 1G15A 4GVMA 4Y1CA 5F8JA 1RYSA 4NRTA 1LWFB 4ED0A 2HNZB 3NF7A 2HHSA 1A5VA 2R2TA 4OLBA 5F9LA 3CQ8A 4DSLA 3IS9A 2B5JA 3H5UA 4QWDA 4JLHA 1KLMA 5DQIA 3QGGA 1XWLA 3AVIA 5KT4A 3EYZA 1ZBIA 5EWFA 4GC6A 1NK7A 4NLUA 2W9BA 3KJVA 4C8MA 3VQQA 4DLEA 4FJ8A 3H40A 4IG3A 2ITGA 3BR9A 3KTQA 3OS0A 4BDZA 3ZT4A 1RT1A 2C2RA 3SQ2A 1JLAA 5CYMA 3U3YA 4DTXA 4KAIA 2IM2A 1BCMA 4RNHA 3BJYA 4F3TA 3PW0A 1JX4A 3AVFA 3TAMA 4M45A 4CJQA 4J9MA 3M8RA 3TAFA 4LSNA 4J9RA 3LZJA 1IKVA 3KK1B 3HJFA 1C0TA 3SYZA 3PO5A 4PY5A 5KFMA 3QEVA 5CYQB 3KKRA 3NKYA 4TY8A 3SQ0A 4FJLA 4NLQA 3VA0A 4WE1B 3MEGB 1NK0A 4U7CA 1RT2B 4CJKA 2AGOA 1WLJA 1KFSA 1C0UA 3VQPA 3S3MA 3DRSA 2HMIB 1X9WA 4QW8A 2OPPA 4BWJA 4W5RA 3HPGA 1WSGA 1T3NA 2EX3A 4QWCA 3OS2A 3PO4A 4DG1B 4CF9A 2FLLA 1EETB 1Y97A 1RCHA 4FLVA 4KO0B 2YNHB 1ZTTA 3H08A 2WOMA 3GV5B 4JV2A 4QCLA 3LP0A 4K4XA 3JYTA 4CEDA 2IC3A 3HVTB 3PJWA 3BSOA 3QEWA 1HYSA 4KBIA 4NLYA 4FLUA 1RT3B 3OYCA 1KCFA 1CXUA 2BR0A 4WYWA 1C1CB 4CHNA 1WN7A 4NLWA 4RUCA 4DU1A 2GIRA 3TR8A 1U45A 2KFNA 4KB1A 3CJ5A 1LW0A 1RTHB 3KLEB 2IJFA 3Q8SB 4IBNA 3WNGA 2QE5A 4KHRA 4I9QA 4Y2CA 4CHYA 4OPKA 1JKHA 3QLHB 3LPUA 4CFAA 4QPXA 2B43A 1TL3B 5JS2A 1VK0A 1BHLA 4FM2A 3PV8A 3MF5A 3DM2B 3RB4A 4CF0A 4AHUA 4E7IA 4ZP6A 4LD0A 4TQSA 4I7FB 2HNYA 3RMAA 1NK8A 4CGJA 3AVLA 2W8KA 3VQEA 1JIHA 3I5AA 3KMQA 3D5MA 5J2QA 4Z4FA 5J2MA 1REVB 4KV8B 5KFDA 2YKNB 4ZHRA 1JL1A 5J1EB 5FDLA 3LP1B 3L2UA 5FRNA 2FJXA 1JLBB 3V81A 1XR6A 4TXSA 1Q9YA 5KFEA 4R5PB 2AGPA 1HQEB 4PQUB 4YP3A 2G8KA 4JS5A 4Q0BB 4PUOA 3T5HA 2J6TA 3UDLA 2OPQA 2R7YA 1FKOB 4ZVHA 4CGFA 1WAFA 4I2QB 1XHZA 4QWBA 3AA3A 4DF8A 3AVCA 4ELUA 2IM3A 4J9QA 3T5KA 2IGIA 4I9LA 3RR8A 4DTNA 1BCOA 2BRKA 2UVWA 4IH7A 3DLGB 4RW8A 4CHQA 1NJWA 3H4BA 4F4XA 1L3TA 2E6MA 2BQUA 4CEQA 4JRPA 4CECA 4M95A 4NLTA 1UA0A 1SUQA 4DQRA 1KVAA 4FBUA 3MEEA 3CM5A 4NLVA 3M8QA 1S9GB 3DRPA 1DTTB 1S6PB 1RDRA 4J2DA 3NAHA 2DPIA 5F8HA 3RWUA 4DF4A 4FW2A 4IFVB 3ZSZA 1U09A 3CDEA 1TKXA 4LQ3A 4UQGA 4PA1A 3SI6A 4B9VA 3RMBA 1JXEA 1IKXB 3OLAA 4Q8EA 3ZSRA 1LW2A 1LAVA 1S1XA 3OJSA 3M9NB 2YV0X 1VRUB 1EXQA 1RT5B 2R8JA 2IOCA 2LSNA 3VQCA 3CM6A 3I5BA 5KFVA 2EC0A 4RW6A 3RBDA 1ITGA 5KFRA 4E89A 3SQ1A 1T03B 2AX0A 3O4QA 3VQDA 4CF2A 2JEJA 2DPJA 3TAEA 4BE2A 3FFIB 1TKZA 4WFZA 3N6MA 5KFAA 1A5XA 3ZSYA 4KI6A 4CIFA 1YTUA 5K14B
chains in the Genus database with same CATH superfamily
3MMBA 3QJPA 1S9EB 1ICEB 3FSIA 4K0KK 3M9MB 2ZUGA 1FXLA 4RW4A 1KQFB 4EI2A 3QRQA 3CCVS 3KLFB 1C1AA 4I6MA 2NRRA 1S99A 1JLEA 3A4TA 2A3ZA 4JI5J 5AQWA 4B3SF 1ULRA 4FF1A 1JCFA 5DQHA 3EO3A 2QYCA 4ER8A 1RAIB 4NXNF 2G8VA 2BQRA 5CQGA 1IWAA 2CPIA 1Q53A 5HI7A 4ED2A 5KG3A 1QUVA 2QSFA 4QW9A 1KFDA 1NU0A 3SFGA 3TZWA 1VBKA 3V1QA 2RN2A 4BE0A 3WNEA 4CD3A 5AJ3J 1U2VB 1QVFR 3ET6A 4X4QA 2LU2A 1OY6A 4W5NA 4DR2K 5K5MA 3ILLA 3CJ4A 3QT8A 4USHA 4DR6J 1RQ0A 2NZCA 4M3TA 3POTA 3FSXA 4KGZB 1YF5L 2G0CA 2QEXS 2G1DA 4ZA1A 3CCJS 3V9XA 3J80U 4AILC 2GVDB 1WF1A 4F0KA 3H5XA 1MWKA 3EPIA 4NEZA 1ASVA 1TV6A 3NGIA 3D1OA 4BHQA 4A8SA 3DYAB 2QWRA 4NYPA 2ZJQL 2L08A 2HB5A 4K41A 1M1HA 4OX9K 3OFFA 1RDDA 4BC3A 1RNHA 4AFFA 1YJVA 1K47A 1XNRK 2I0XA 4TNOA 4DV3K 1T9TA 1HQ2A 1ZA1B 3CEDA 4UW2A 2QWQA 3EXCX 1GMUA 4DV0J 3S3NA 5DG8A 3P8BB 1U6BA 4DL4A 3CDAA 3ZT2A 1NCLA 3NG8A 2DNLA 3CC2S 3NE6A 4BRLA 3OTBA 4A62A 4ED5A 3HI0A 2XZWA 3HRGA 4ENOA 2RDDA 4CFDA 2HHTA 1NKCA 2ZBIA 3SDEB 4KTQA 3BGUA 4QBUA 1CZAN 2LMIA 1KEKA 3ICLA 4ED8A 3G9CA 4CGGA 4XH1A 3UD4P 1VSKA 3VETA 2V4JB 5DGBA 4DTSA 2HK3A 2N82B 4N77A 2E8AA 3AO5A 3SFUA 3FMWA 2RF2A 2FJAB 4DLGA 4UOHA 4NA2A 3QAEA 3W64A 2CQ4A 4DV5K 2E5GA 2HF3A 3EVOA 4OYAA 2FHOB 5KGWA 3B82A 2E9ZA 1BG3A 3H98A 3ZYYX 3AQPA 4IOAL 1RCOB 4IQXA 1Y0HA 2RUSA 2O66A 1KONA 3D6RA 3WQPA 4LF4K 2HHPA 2C2EA 3LPYA 4HDHA 2W7OA 3OYDA 3KUEA 2CPDA 1NJXA 1FRKA 1N4LA 1E3MA 2E9TA 3EM1A 1CZBA 1Q8KA 2RSQA 1X5TA 4CO4A 3CCWA 2P5GA 4FJKA 2B4PA 3U9ZA 1FEHA 3QEIA 4Y28C 1HNXK 4ID5A 5JVGQ 1GOAA 2BANB 4C11B 2HBJA 3D6HB 1ZBSA 3CO0P 3EE9A 2ZBQA 2QL7B 2YWWA 3P3DA 4QR1A 4EBEA 4CLKA 3HPOA 4DPTA 4FM0A 2H9ZA 3MM6B 2P2CB 2E5LJ 4LF1A 3L4BC 1VBYA 2DT9A 2HFZA 3N5BA 1APSA 3BKTA 1X4HA 1RHJB 1IR0A 3BREA 4M8LA 3VQ8A 3QINA 2H1YA 2XYPB 1DTQB 1FDAA 4ILGB 1LXNA 5LJVA 2RHKA 4OI1A 2ZH5A 2JEIA 4B8AB 4CO5A 5FPEA 3HSTB 1OH7A 2P6SA 2W25A 2A41A 2QL5B 3Q2TC 5K8MA 2WSEC 4JHDB 2ASPA 4RU2A 2VG6B 4DL6A 1M1GA 2JNJA 4JV1A 4JV5F 2FTRA 2Q1LA 2CGLA 3BPDA 1B0TA 2VA2A 4NPOA 5ETMA 2UXCF 3JSMB 1RTIA 4IQMA 2VBZA 2I7PA 2DNRA 4X4VA 1SL1A 3VAMA 3HLUA 1J6ZA 3IRWP 2E20A 1S7IA 5JVHQ 1QSSA 3HZ6A 1HBOA 1Q8LA 4M3ZA 4AXJA 5GVQA 4J8FA 1NAQA 1DQAA 3QGPA 3S7RA 3FFKB 4BVOA 4LF9F 1XC3A 1L3UA 1H73A 1NU4A 1UEKA 1RZMA 4ILLA 1F5BA 4MIAA 2XS2A 2HHQA 4E0DA 3WT0A 5L1KA 2HHVA 3CCUN 4CJ7A 1YXQA 3N5FA 5AFUH 4YMEA 3KLHA 4OX8A 1FVQA 4KI4A 1B64A 1BI4A 3VZIA 1BHNA 1VC5A 2DKOB 3VVTA 1LCUA 4X4SA 5J2PA 3D0PA 1LFWA 4Y0WA 2MSSA 5C10A 1VS3A 1Z4UA 2B5JB 4B9TA 1KQGB 3Q8RB 4CT9A 2OJ3A 1U8WA 3W5ZA 3WEEA 2YBVA 4PABA 3T1HF 3BDPA 2RRAA 5IV3A 1AFJA 3P5TL 4FPAA 3LL3A 3KJVB 3MR7A 4TYBA 2FHKA 1T9UA 3DGPA 5A0YB 5I9EB 3TQEA 3EE3A 5I3UB 5CZ2A 1K1QA 3RVCA 3PY8A 3THPA 3S8SA 3R27A 2N7CA 3H5SA 2FPHX 1IKVB 4IEIA 4ICLA 1XIQA 3QRRA 3Q8VA 1ZBLA 4PPZA 1TYQB 3QO9A 1B9FA 1NM1A 1FRIA 3O8MA 3R5DA 3QBCA 3U1MA 4DUYF 1VC0A 2NCKL 4B3TJ 1OWXA 1C0UB 4H5VA 1S1VA 1TUGB 1NSKL 4FJ5A 2I38A 1RHQB 3ETOA 1QHTA 1Y3KA 3JSYA 3P4UB 3P38A 4CM0A 3R7SB 4FPBA 4WXOA 3QATA 2GTDA 4EFAC 3TA0A 4BRCA 3LDLA 4C0HA 2AEFA 4J9SA 3JYTB 4E7HA 3G6EN 2KT5A 5D0RA 3VEZA 3OY9A 1R43A 2EFQA 2GUPA 4QJVA 3SQGB 3QIPA 4F0MA 2ZJPQ 3GIKA 4IRKA 4H4MA 2CA9A 5F41A 4RZRA 2YTCA 5LMNJ 2YKMA 3CJAA 1ILYA 3J7YU 3T1YK 2XMAA 5LOQA 2RKIA 2LA6A 2NZTA 5C15A 5FROA 2RQMA 5D4NA 4LR7A 4LSZB 3KKFA 4E2FB 2ZH4A 2NXEA 1RKIA 1GEHA 2HURA 3CMEN 2EK6A 2CNKB 3HT0A 3EMTA 7AT1B 1RTDA 2CWKA 4MK8A 3HXMA 1D9AA 1S1WA 4DR5K 3CCSS 1Q7YT 4RNFA 3DOMA 1TFYA 3EWGA 3E66A 1CBKA 2Z4PA 2O8EA 3NGUA 2M70A 4ZHRB 3EZUA 2MB0B 1X0PA 5LXYA 5AFUA 3TYTA 3P1GA 2RB7A 3GJRB 4CBWA 3WHIA 5FDLB 2POKA 1LWCA 3ALYA 3OR2A 2EK1A 4WFNQ 3AJ1A 4BS2A 3THWA 4H0PA 2O3DA 1KHVA 2IDEA 3BB5A 4JI4F 2RQ4A 4USJC 3TU5A 4LF8K 2D0AA 1XNQJ 3D68A 2FHJD 3BZCA 2PEHA 3CNQP 2O8DB 3UD5A 2D69A 3EEQA 3EZWA 3H45C 5D4LA 2V0NA 4PKIA 4B9MA 2A1BA 3IKMA 3MEEB 5CR4A 3GWCA 1EAYC 3M8QB 3LAKA 4DV0F 3DRPB 1SV5A 4DUTA 1NGBA 3OYIA 3N79A 2HIQA 4HACB 2GWKA 2YHYA 2V4RA 1T8EA 2J0WA 5LSRA 3G8SA 2KB2A 3TVKA 5GAGP 1VSIA 5T7LA 1NK4A 1JMTA 2CVEA 3CETA 5DDPC 1YQHA 1R3NA 1GLDG 3NH1A 1UFWA 1PYTA 4F9OA 1VQKN 4TLQA 4ZVRB 2FZGB 1IQTA 3R2DJ 2E1RA 4O3SA 8RUCA 3AHPA 4O3NA 2JZ5A 1LK7A 4M3XA 2UUBJ 3JSBA 2P5VA 1LWFA 3A8KA 4CIOA 1D9FA 4Q5VA 4QIFA 4YOXA 1BE4A 2P9UA 4S0MA 1G3OA 3MMBB 4DPXA 5DM6L 4K59A 2C2DA 2VQEJ 3KHYA 1MNEA 4K5SA 3NLCA 2ZF5O 4RW4B 3WIVA 2IVOA 3OA9A 4K42A 2ILYA 4I6MB 3J7YI 5HATA 1T3OA 2HGLA 1WAJA 1VBXA 1JLEB 1H72C 3J7AN 2YX7A 1ESVA 2UVRA 2AKWB 2VGMA 1RAJA 4PAAA 1N52B 4OHXA 1YITS 3AVBA 3UB5A 3VESA 1RISA 4MKYA 2E6LA 5LMUF 4KAZA 2BW7A 3NCPA 1WDTA 3HJVA 3J7Z5 5CCLA 4QU6A 3NOGA 1IBKF 5AQQA 5DLGA 4CJVA 4WE1A 1QZ6A 4CRJA 3MN9A 4CCHA 2LEPA 2A2CA 4DV1F 2BRLA 3RR7A 2RE2A 3D1QA 3E1YA 5K8OA 3VEVA 1HWIA 4USIA 2HW3A 4RKUC 2P1JA 4CGHA 3ET6B 4KHUA 4W90B 5IXUA 4KO0A 4BC9A 3KD1E 3POTB 2UUTA 2PZSA 2AA4A 3GL1A 4DR1K 4GKKF 5C2DA 1N36J 4ANEA 3HVTA 5DK5A 4CJ4A 1SBRA 4JYAF 3DFEA 4QWEA 3MFIA 1TV6B 3AJ2A 1B9DA 2VDHA 1YI2N 1R0AA 4O23A 2ZZNA 2P5OA 4R0JA 3DRXA 3QNNA 4F4ZA 3AB4B 2FJDB 2LFVA 3MAHA 3QLHA 2KHOA 3UQSA 1D8ZA 1N8RT 4K50A 1QD1A 2GJIA 3M8SA 4B1ZA 3DM2A 2CPJA 3M30A 3TAGA 1F5AA 2KT2A 1DFDA 2BKOA 3THTA 5BR9A 1RBVA 1VQ8S 3IAM9 2UXDF 4P7TA 4NYFA 3GBTA 2XNQA 4AHCA 2ASDA 3V6HA 2ZC3A 1RHRB 2DY4A 3T6JA 2C3MA 5E3RA 4EZ6A 2G0IA 2KDOA 3IFEA 2DR6A 3VERA 3LP1A 3OFHA 1KSPA 1GX5A 2Z2MA 3B8AX 2QI2A 5MLCV 1YJWN 1T7PA 2XMTA 3PYDA 2R8IA 3HVAA 4UUWA 3N01A 2QW9A 2E5IA 4CJWA 2EG1A 2GAGC 3CJ2A 4I2QA 1N34J 3W65A 2RF2B 4CHZA 2YX4A 3NF9A 1VQSA 1OVQA 2BJ3A 2V34A 3P83D 2EPIA 3IMQJ 2CAJA 4Q7AA 2KXFA 2Y1LB 3NY0A 3MPDA 2VJUA 3H3OB 4IJNA 1GXUA 2W4DA 2W8LA 1FNXH 1OO0B 2DTUA 3A3NB 4O5BA 1S9GA 1HLWA 2C3PA 3KZBA 1DTTA 3R3TA 4N56A 3HM9A 2LQ9A 4DEZA 1JXLA 2YJFA 4C8ZA 5IQQA 3C8YA 3C2PA 5D78A 4DL2A 4IFVA 1KKHA 2XGPA 4HH0A 5JLFA 1ROFA 3T6BA 1ACMB 3OBYA 1NPRA 2LECA 5KQ8A 1IKXA 4BC5A 1WUAA 2R2RA 1RBOB 2WUSA 3J7ZT 3BBFA 2UUWA 2JVRA 3MOJB 4FZXC 3HM8A 4LFBJ 1VSDA 5KG7A 4ID5B 1DZ5A 4EZ9A 3WBZA 1NHKL 4C3MA 4DTPA 2XEXA 3TARA 1I94K 3IS9B 3VQ4A 2VQFF 2V94A 2C2MB 2YNIA 3ZZZA 4B9QA 4N76A 4HTIA 3QNOA 2DR7A 1CEZA 1IBCB 1UVLA 2R2SA 4ILJA 4HTJA 1EKSA 2YPZA 2FVCA 4DV6J 2X78A 4TU7A 5AE3A 1HR0J 4CHOA 3UCGA 2PC6A 4FL9A 2DGUA 5KG4A 2XM3A 3Q22A 1TL5A 3ZSXA 3TUPA 4HI1A 4PKDB 4JI7J 3C3LA 1IXKA 2VG5A 2D74B 5KFKA 4B3OA 5FPMA 3M2VA 4CZKA 4K4ZA 3CG7A 3VQAA 3CTRA 3VTIA 4GNIA 2M8HA 2YNGA 4K5RA 2MKJA 4BY9C 2OAUA 1EHWA 1PC5A 4CZGA 3RTVA 3HD2A 4EFHA 1RTIB 2F7VA 1EWRA 1QHAA 2JEGA 2MLYA 3BEGB 3OTEA 5BRFA 1HBOB 3HHKA 4ECUA 4L3QA 3M8ZA 4J9PA 1VQ5S 2CQCA 3QYYA 1CLFA 4LFCK 2XNRA 4CJPA 4B3RF 2JEFA 4IYQA 5E5NA 4MKBA 3ZTSA 2PYJA 2H51B 3C14A 4WP8A 4OI0A 5KOWA 2ZKTA 3E01A 2RNEA 2KYZA 2WAQD 4ZJQA 4OKEA 5LSOA 4M3WA 3MMAA 1Y5LB 1U8SA 4BE1A 3KLHB 4J9NA 5T41A 1UJ4A 4RNNA 2XO7A 1R0CB 3PACA 5D6GA 1XN9A 3CD0A 4CLLA 4PHTX 1BI4B 4DFJA 2H3GX 4M5IA 5J2PB 3CGIA 4G1IA 4LF6F 2CQBA 4LRDA 1XNQF 2CJKA 4FWLA 4X66K 1VRTA 4PG4A 4AHVA 1HUXA 3UDCA 4ES2A 2ATQA 3A1YG 3WEEB 2A6MA 3AVHA 1EKEA 1RP5A 2DRBA 2GHWA 2QFIA 4CGDA 1FHTA 3IGNA 4FLTA 3DGPB 3E2EA 3H42A 3W7BA 3PCOB 5HVGA 4Q8FA 3NGTA 4M7XA 2WONA 1RAGB 3MCAB 5F1XA 3RAMA 4U67L 3F5TA 4ZLPA 2YWEA 3TQ1A 1QQCA 3SPYA 3I5CA 3UW1A 2EKNA 3OYGA 4CYUA 2D3UA 2ZE2A 4DV4F 3U3GA 1WC1A 5KG6A 3GCXP 4TKTA 3SV3A 1TVRA 1K0TA 4ICLB 4X62F 4LSLA 2W7PA 3QO9B 3JAMO 2AYBA 4ZOSA 1N0VC 4K4SA 2DH9A 1JNRB 1FFGB 4DSJA 3U1NA 1IO2A 3KWGA 1SIZA 4WXWA 2RILA 1FXDA 5FPNA 2WSFC 2DNZA 1QAIA 1S1VB 4YY3K 3NVKA 3VWSA 1IBMF 2KQ2A 3TABA 4KGMA 2HHHJ 2AW0A 1EO1A 1ZBTA 1OY9A 2V67A 3P31A 3WNHA 2BUNA 4K8RA 3OYFA 4D3HA 4YR3A 1RLCL 1IM6A 3IAYA 3K2PA 5CZXA 4DFKA 2UXBK 1FRMA 1F3VA 1WI8A 1BL3A 3Q8QB 2F5GA 2QMUB 3QIPB 2DNQA 3VQSA 1WC3A 2L41A 1MW7A 5HK4A 2P9CA 3HBTA 2ABYA 2E1YA 5BYSA 4KHNA 4H4MB 1EARA 3KVGA 1VQ9N 3IG1A 2J6SA 5EN1A 4WCEQ 3MMCA 3FLCO 2F4FA 3T69A 2RU9A 2PMWA 2YKMB 2NQPA 2JC0A 3VHQA 2RKIB 1RA7A 2OTJS 3JTNA 3PFOA 4WK3A 2ZWHA 5AQMA 1MWQA 1MU2A 2P9GA 1AZSA 1MDUB 1FRLA 3OR1A 1HHTP 4HDGA 4YHHF 3KKSA 1S0VA 4F7VA 4FKXA 1RTDB 2R2UA 5AQPA 3TUZC 4A2BA 3NRBA 1S1WB 6AT1B 2DHSA 4DI6A 3QJLA 3DOMB 4IRDA 2DHHA 2O8EB 4K0KF 1HNVA 4JB8B 5KPTA 3A3OB 1T9VA 1UVJA 1XMOJ 3ZSVA 4LF7J 4XO0A 4CO3A 1LWCB 2OZMA 1UW4A 3VGUA 3OR2B 3W1YC 1YJUA 2AJ2A 1QY7A 3THWB 3ENAA 2XI3A 2DD8S 3AO4A 1H1VA 4W5OA 1YBTA 1YVFA 4CIEA 2HSTA 4L75A 3BZQA 1J2VA 2BKNA 2PSZA 4CNZA 2VYPA 3D54A 4ZVUB 4N47A 4GW6A 1NPKA 1TAQA 4P52A 3VQ9A 3ZETA 1VQON 1WSIA 1ZXOA 1CQNA 1Y11A 1V9OA 1SV5B 3OBIA 3W3SA 4DR2F 1W25A 2UU9J 2XBPA 1Q5YA 2AZ1A 4M5DB 2F8HA 1B0VA 1X3MA 2KFYA 3W9IA 4GO5X 2J0XA 3JTPA 4HYKA 1MWZA 3BKUA 2FXUA 3PSIA 2DFEA 5E33A 3QT7A 1YJ7A 2W01A 2HBQB 2IA0A 4J9OA 5L8RC 1RBSA 4KHQA 3WXKA 2CVIA 3HFVA 2KU7A 4JI2K 4FJGA 2HLTA 4FYDA 1UEVA 4L3KA 2V7ZA 3W62A 1LWFB 3D0HE 4ED0A 3NF7A 4OX9F 2GW8A 5ETOA 4DSLA 3U9DA 5DQIA 5KT4A 1XNRF 4DV3F 1NK7A 3BYRA 1CJKB 2HQIA 3E9LA 1RHMB 4USUA 4NO7A 4FJ8A 2F4VK 4IG3A 2ITGA 1VK8A 2BJEA 4H4KA 4G1PA 1U1KA 1W7AA 3JSRA 2RQCA 2AIRB 1JLAA 4DTXA 4KAIA 2IM2A 5AQIA 3BJYA 2BJ9A 4F3TA 3PW0A 4KR0B 3AVFA 5BR8J 3DU6A 3M8RA 3TAFA 1HWJA 4LSNA 3QFPA 3LZJA 1MMNA 1YBAA 4M5KA 1GLLO 3HSZA 3SYZA 2M88A 3PO5A 3TEGA 2DY1A 4PY5A 4GY2B 2UUAK 2AYMA 4UZBA 3C0BA 4WE1B 2QM1A 4U7CA 5IWAK 1LXJA 3CXCR 5G0RA 3N9UC 1WLJA 1EZZB 4FVCA 1VQ7N 4DV5F 2Z2LA 4BWJA 1VQ6S 3HPGA 1CJVA 3CJSA 2R7WA 2FF3B 3TTDA 1B70B 2AEJA 4KBOA 1HA1A 1Y97A 1RCHA 4FLVA 4KO0B 2MKHA 2GZOA 2GHPA 1E6VA 4F3MA 3H08A 2IVYA 1DKGD 4PKGA 3R9LA 2ZHOA 3DHWC 4LF4F 1IN0A 2HZCA 4K4XA 3HVTB 2Y9HA 3K2YA 4KBIA 4GKJJ 1FFWB 2MJUA 2ZM6K 1T9YA 1K0VA 1KCFA 4WYWA 4CHNA 1VQLS 2GA7A 4Z94A 2R4FA 3HHLD 2ATCB 3AA9A 4KB1A 2W6LA 5CE3A 2Y3YA 4X64J 1NEEA 1BXNA 3ZO7A 1HNXF 4AQYJ 1VFJA 4Y2CA 4CHYA 1JKHA 3QLHB 4BC7A 2KN4A 2ZJRL 4QPXA 2EFVA 1NGAA 3FRYA 5EX3A 5JS2A 1VK0A 1GXLA 5BN9A 4N8OA 3DM2B 3M30B 2HNYA 2OANA 1NK8A 4CGJA 3AODA 2X1FA 4FOEA 1DRZA 2NXNA 3KMQA 4JKGA 4EIAA 3IXQA 4FWKA 5J2MA 3A5OC 2VBYA 3DLLL 3GONA 5KFDA 1E6YA 1NB2A 1Q4RA 1JL1A 1FTRA 3LP1B 1VQMS 1PCAA 5FRNA 3V81A 4JI1J 1Q9YA 4ZK7M 4FWMA 1NDKA 4YP3A 3FKBA 3BF1A 1TMMA 2J6TA 2VL1A 3UDLA 2OPQA 2E1CA 4CLZA 1S72S 4CGFA 3U7JA 4I2QB 2CJ9A 4CDIA 1NGJA 2HF4A 4QWBA 2COLA 1Q79A 4ELUA 2MQLA 4DTNA 1BCOA 2ZOFA 1JJHA 2FD2A 4RW8A 3QMQA 4WBFA 1NJWA 4CHQA 2YKQA 3IC1A 4DCJB 2BQUA 2E6MA 2YCHA 4M95A 1SUQA 2BA9A 4FBUA 4P75A 1Z6RA 3VENA 1NJIO 1S9GB 1VQNN 1DTTB 3EDRB 3HHLC 1RDRA 3MN5A 2GFFA 2FGOA 2HBZB 2DPIA 2WW8A 3CJ8A 3DC2A 4IFVB 4LT6A 1ZZNA 3CDEA 1TKXA 2RH3A 3RMBA 1F0XA 1IKXB 3OLAA 3GP9A 5E3CA 1LW2A 4EMDA 4BR5A 5M1FA 3OTCA 3CPWR 3WC0A 4M5HA 2IMOA 1E4GT 1TU0B 2YV0X 3FZKA 3A8EA 3VQCA 3FZBA 3CM6A 3I5BA 4G65A 5KFVA 2IVMA 4CLUA 1WG5A 5A76A 4E89A 2DRAA 2W6KA 4DUZK 1VOMA 2JEJA 1QZ5A 3TAEA 4DHVA 4A46A 2GHVC 2XLKA 1A5XA 1Z2ZA 1B3TA 4NE9C 3GFXA 4CIFA 1WELA 3FDSA 4ZKAA 1HX1A 5M1PA 3OSPA 2XZTB 1KOOA 2DEJA 1U0HB 4EBDA 4RG8A 1K9MO 4CZCA 3KJQB 1F2HA 4HHJA 4JI8J 4AYBD 3CD6S 3S41A 4PWDA 3L2RA 2VG5B 1N56A 2VUGA 2AJ4A 3N6NA 5K9FA 4B3OB 3UE2A 3W66A 4P7VA 4ECRA 3GG1A 4WZQA 3M2VB 3FBFA 1OSDA 2FC0A 4G9ZA 2J8AA 4BRKA 2FC9A 4URQU 4NLSA 3DU5A 4FJMA 2YNGB 1OIAA 2GVZA 1TQLA 3MCOA 5J2NA 1RABB 5FLXO 2D9OA 3FUYA 1U1OA 3OVAA 4DMZA 1HW9A 3CD7A 2ROGA 3V1RA 4ZDNA 1VI7A 1GLAG 1F60B 1YJNN 5L1LA 4MFBA 5ETQA 1N32J 1IG9A 2QXFA 4KH6A 3P5BP 4AHRA 3V6JA 2IDOA 1C4AA 3C14B 3RBZA 4N7TA 2QLWA 2E4LA 4JI6K 4MMOA 1T05A 4BRQA 4K43A 2H3EB 2ZHAA 2GX9A 3CCQS 5B08A 3MMAB 3M2UA 4Z0UA 3G25A 3DXBA 5LJ3Y 2P9EA 1H98A 3IRXA 4YQWA 5A2QO 4CTAA 3OTOJ 2G8HA 1HBUA 2MKIA 2LQJA 2ACMA 4WYBA 3O3GA 4DTUA 4J2EA 2CRLA 3T1YF 5GAHP 2FB0A 1VRTB 4BRNA 5AQFA 2CFXA 1JJ2M 4DL5A 2OYQA 4BRFA 3M1VA 4YOTA 2G2ZA 3CE8A 2OPRA 1WHYA 2VDIA 5E3PA 2KXNB 4KB0A 2RMLA 5H9FK 4CGIA 1YZ6A 1BMQB 1H7WA 2G2OA 4PG5A 4FZZA 1ZH5A 1D5AA 3ZEUB 1UL3A 3EGWB 4WFAQ 4DR5F 2C3OA 2WONB 3TUJC 3ZTPA 4H4OA 5ADXA 2XRIA 4CYUB 5AXLA 2ZE2B 2XS5A 4MO4A 1XEZA 3C19A 2AZ3A 4BGBA 1TVRB 2GJ2A 3LO3A 4LSLB 4KH1B 2QRRA 3L3UA 2OGUA 3TX0A 4OFZA 3QICA 4PXBA 1XMQK 3W5XA 3ZTQA 4KE5A 1AYEA 2ZH1A 4OPHA 4LF8F 2B6AA 2NYIA 2J7KA 4UTGA 2BOPA 1YG0A 2H5IB 2Y1RI 2J6UA 5IS2A 4JD2A 3TR5A 1E4FT 4JKEA 2EXUA 5KAKA 5CA5A 4FJIA 4FF2A 1IQZA 3C16A 4HCBA 4ZN3A 1S6OA 3DWLA 1SJQA 1IBLJ 1OMSA 4DR7J 3AXMA 1S76D 1SC6A 4DX6A 4FJJA 1F21A 3WXLA 5M1KA 2HHUA 2O1PA 4F2SA 1MLAA 5CZ1A 3MPVA 1UVNA 1KD1T 2YJEA 5CCMA 3AOCA 4RWTA 2XTJP 3IG1B 3CJTA 3MMCB 1TR0A 5CHCB 2VIHA 2XYHB 4ECTA 3ZFVA 4RU9A 4LFAK 5FLXY 4DV2J 4JK8A 1Y7PA 1MU2B 3KHGA 1AZSB 5F0XA 3OR1B 2CDRB 1C4CA 1S7HA 4PRFA 2HVIA 4L3NA 4KHSA 1F6TA 3DXMA 1N33K 1HNIA 5D8HB 3M8PA 2F96A 1NGCA 5HBMA 3I56S 3KNGA 1RT6A 3T9ZA 2ASOA 2HFSA 4U7UK 1HNWK 5BJRA 1HNVB 2PFDA 2GELA 2OFHX 1P8GA 1RFQA 2CKWA 5KI6A 2IBKA 3T41A 4EHTA 3LGHA 3PDNA 3R5GA 3V4MA 3OYAA 2WVEA 5F8IA 3UI3A 1UP1A 5HJYA 1BWFO 2XLJA 3V1OA 1RKJA 4QR2A 3G0ZA 1IKWA 3CMAN 1X4FA 3Q8PB 2H54B 1RDCA 2YQ1A 3A5NC 1YRTA 5SZTA 5LT5A 1NOYA 5C25A 4C3LA 4H0VB 2B56A 5CZVA 4H5WA 4EHUA 5RUBA 4FLXA 1GAOA 1N6QA 1SJRA 3ZETB 2G8WA 1NSPA 1FI4A 2Q3SA 5IC6B 3TVZA 3L7PA 3PVXA 1U2RA 1RYRA 3OYNA 3PG9A 2NRWA 2JH3A 1NB7A 3MUVP 2L3MA 1C6VA 3O1LA 4ZCLA 3QJJA 4DR1F 1WKKA 5ADZA 4UOGA 3Q86A 2Q6BA 3ZZUA 1R6VA 2QTWA 2A42A 3L0QA 2OTLS 5FLXU 3IR5B 3L3VA 3SJHA 3N4PA 3QAUA 5ETRA 3U6FA 4PEOA 3CFRA 5KG0A 4WWSA 1U26A 3SV4A 4DN9A 4AL5A 4FPRA 2YKPA 3ZTRA 4C3KA 2GC8A 3BQ0A 2ZNZA 1FX4A 1GLBG 2D4WA 1REGX 4HHTA 4ZVSB 2RS8A 3DCAA 2XYGB 4O55A 2G8IA 2DHGA 4IEEA 1XUPO 3DLEA 2ZUAA 2PMZD 1T03A 5D0GA 1YK9A 1WC6A 3CJ3A 5KFWA 4FK2A 3GPAA 4ISGA 4P74A 3SUOA 2DFFA 2B4UA 3UNGC 4IG3B 3FZHA 2CPEA 3NNAA 3GV7B 4XDCA 5A2QU 1S9EA 1V4TA 1JLAB 4ELTA 5AQRA 3W5YA 2YPYA 2HQCA 4B3MJ 1UJ6A 2QV6A 5B0GA 4K8XA 2PD1A 1YVNA 2ZOGA 4FYYB 3AD9C 3G6YA 2F1FA 4LSNB 3WXIA 2Q3PA 4JI3J 4TU8A 2FBXA 3I0RA 3D66A 2M3DA 4CF8A 3BGRA 1X4GA 3MGJA 3RB3A 5LL6Z 2YNFA 5M1NA 2YWHA 4O0JA 4R0EA 4IRCA 5G0RB 1FERA 1TZ0A 1M1KO 2ZD1A 1SCJB 2HYIB 3AO1A 3TZZA 5D77A 1CJVB 4K4VA 4LY7A 2GCFA 3NWRA 3EUNA 3OT9A 1X31C 4CLYA 3I55S 5GAHI 1UTAA 1E6VB 4IDKA 4QIVA 4F36A 1TL4A 5ELZA 3GR0A 2Z30B 4NXMK 1WOQA 4FLYA 2MQ8A 2DVIA 3CDBA 4DSKA 4XPCA 1Z25A 4L8RB 2DNOA 2B0GA 3FEXB 1FE4A 3X3UA 1QSYA 3GMGA 4CWBA 1DT9A 4FCYA 5IM0A 4YOUA 3L2WA 3MI7X 3C15A 3MOZA 3BQ2A 4RLEA 3CCVN 2W9AA 4JKDA 5DZ6A 1KBRA 1KAZA 1JKHB 2OH2A 2ACYA 2D9PA 3K8WA 2BJDA 4M41A 1I94F 2PBDA 3G6ES 1JK9B 3OPKA 2QA4S 2MJNA 2KXHA 3NCIA 3UWTA 2HNYB 2EFNA 2XCPA 2X6NA 1KQSR 1CXQA 3OL6A 1QE1A 1CULA 4JKGB 3MWPA 1SKWA 2LLZA 5J2MB 2BYCA 3CC7S 4CK3A 1E6YB 3VQTA 2GBZA 2M9KA 4C4WA 3OVNA 1V6HA 3CJ0A 3MAQA 1OQ6A 4YFUA 3HMJG 1U6ZA 1YGYA 4PXCA 2ALZA 1FKPA 5FJ4A 5AQNA 3R6MA 1TUYA 3NXZA 1VYAA 2OPQB 2MZJA 5BN8A 2XY6A 2V68A 3TI0A 3VAFA 3CCJN 4AUKA 2CH5A 1NHVA 2R7QA 2MDAA 1H7XA 2C2NA 2AV5A 5KFXA 1R27B 2NXUA 2DNMA 4RW8B 1VIOA 5DMRA 3G10A 2V4QA 3NBPA 1SUQB 4CE9A 3W3DA 1Z2LA 1OH6A 3HKWA 1ZTWA 2D3O1 1B92A 1O1WA 4LFCF 2XB2D 4C0BA 3VF4A 5AQKA 2RHQB 1TKXB 3F41A 4FVMA 5GIPA 3PTWA 1LW2B 5DM7Q 3QBXA 3T19A 2DPNA 4C1NK 4IO9L 3CC2N 4B3SJ 2E1ZA 3RMCA 4YDDB 2F3JA 3DDKA 1UWBA 3G87A 1WJ9A 2J9EA 3BSAA 4NXNJ 4DBQA 2N3OA 4X66F 1LFPA 4P2XA 3FCWA 4WQ4A 3HK2A 3RJMB 5KG1A 4W5QA 2OMOA 2XC9A 3HZGA 5LM7E 4IO8A 1RACB 5GAEP 5L9XA 4WQ4C 2Y1IA 1NO8A 3K0JA 2OD6A 4ELVA 4QAGA 1M5SA 1Q1KA 4I4BA 4N41A 3LM9A 2D3ZA 3O3HA 3IP0A 3VAGA 4OVLA 3EKSA 2Z0GA 5U47A 4W5TA 2V8VA 3KUHA 1T94A 3J8AA 4BG8A 3SSQA 2ROEA 1M5HA 4TU9A 3RAXA 3PYEA 1X9MA 2M4MA 1VSFA 4X4PA 2WHOA 3WC2A 2BVZA 2QLJB 5AQSA 1OY8A 3GG4A 3KK1A 5KFLA 2XLIA 1X4DA 1Q7YO 3N4QA 2GVZB 2XWYA 2WB4A 5J2NB 3QGIA 3IWLA 4FXVA 5E2QA 2DK2A 2Z1GA 3LF0A 4FWOA 1YTAA 1CG2A 1T6CA 3ISND 3ULEA 3T9NA 4YY3F 3R5AA 4MFBB 3KD5E 4I6YA 2AJQA 3O5BA 3JSMA 3A3PB 1CS4A 3Q8YA 2E2NA 3A13A 3PIOQ 1PYSB 4I68A 2APOA 1EETA 1BOTO 2DHAA 2YNHA 1SI9A 2UVVA 2OELA 5IQ6A 2E29A 1T05B 4QS7A 4JKAA 2UXBF 3M2UB 4YN3B 4KREA 2DR9A 5K8PA 1WF0A 3O5TB 2NRTA 2NS1B 4C8LA 4HLBA 2RUGA 4NLRA 3IRXB 3ULHA 4CTAB 1C1CA 3GILA 1HBUB 2Q31A 4KY3A 1AA1B 2CWXA 3ENVA 1NOZA 3SSRA 3AVKA 2JLFA 2K7JA 5IOLA 2CZ9A 1R8AA 3NNCA 4ED4A 2BXJA 4JEPA 1TL3A 3M1VB 2OPRB 4WYLA 1UZDA 3D2EA 2FLPA 3CCLS 4A8YA 4YS2A 2WK4A 4MJKA 1PGZA 4LF5K 3MURP 4R79A 1O5JA 3H46O 3VGMA 5C2GA 1JWWA 4JV0A 1D8YA 1VJWA 2LDYA 2G4BA 4H4OB 4DCHA 4KV8A 4JN4A 1X4CA 2XMKA 1S4FA 2YKNA 5BPNA 2MKKA 3IBWA 3M1FA 5J1EA 1N5QA 1FNMA 1WHWA 1V3ZA 5I3UA 4Y2IA 4BR0A 2ZH8A 3ISNC 3NHGA 4PQUA 4Q0BA 1HNZK 4NRUA 1TUWA 3OHAA 2E66A 1FKOA 1PBAA 4NLXA 1TYQA 1NJIT 3CJBA 2B6AB 2RU3A 4Y3CA 3DRRB 1FXRA 4CEEA 2MQNA 4ZJLA 2AJFE 3R6LB 4JD2B 3GDQA 3C16B 4LBIA 3ZZ0A 1S5JA 3AAQA 5HRSA 1WOOA 1SVDA 1YJWS 2KH9A 1QUPA 3A5MC 2Y8YA 5KFZA 1ZM3A 3OJUA 1SL2A 2V69A 3VPZA 4KGVB 3OYKA 2DO4A 4G3IA 2DISA 3MZIA 1KR4A 3IAS9 3RB6A 3N6LA 2BJ1A 2FSNA 4X4TA 3QSIA 4DS5A 1FT8A 2FVSA 4A8XA 4K4UA 1RT5A 5FRMA 5AXMA 3KG0A 1IH7A 1PJ5A 4FYVB 1AB8A 2KKHA 4JI2F 4JV5J 2A1SA 4J2BA 1FD8A 1QSLA 4DKWA 1J5EK 3DXMB 1HNIB 2UXCJ 5B7WA 3AH6A 4HKQA 3M8PB 4L76A 3UVJB 5HBMB 4O5FA 1RT6B 5J1NA 4BQLA 1SJ3P 4OYOA 5ETNA 2Z57B 5KT5A 1QDUB 1NJZA 4PYDA 1WHXA 2NXJA 5K14A 2XY7A 4Z7CA 1PC4A 3I4HX 4DDFA 4LF9J 2F4VF 4OJ3A 2IYGA 2XULA 4B02A 3G6XA 2BUPA 2M52A 5HL7L 1HWUA 1IV0A 2VONA 2FVQA 2X6SA 2VA3A 1S6UA 2Y8WA 3LGNA 4FZVA 5H9EJ 3CULA 1WUUA 4R8UA 3KG1A 4OV1A 1N0UA 1D9DA 3R8EA 1IKWB 1N88A 2Z8QA 4BRAA 3I0SA 4FWNA 3FNNA 4CEBA 3TJ8A 5CABA 2E1AA 3G96A 4KH5A 2GX8A 2ZH2A 4OYMA 1BQMA 2UUAF 2DGQA 2HIYA 2R7OA 5C25B 4LH5A 5HVHA 1A7GE 4OL8A 3HSGA 5IWAF 4F4YA 2NYHA 2RD5C 3SMPA 4M5GA 1N6QB 4M42A 3TWZA 1RWOB 3MM9A 4RNOA 2XY5A 3GYNA 4LR8A 4IOBA 4L73A 4NMLA 1I6JA 2VWBA 7FDRA 3T1HJ 1S6QA 2HRYA 3L4IA 2OA8A 3U27A 2K3KA 4W92B 3EE8A 1IUJA 1JLCA 2J76E 2J9DA 3SSSA 1IJFB 3VA3A 2ZM6F 4IWVA 4OJ1A 5F3ZA 4IUFA 4ZPBA 2WBRA 3JS6A 3NH2A 1QAJA 2HWHA 3GR1A 3D1HA 3LPTA 5C5JA 4DR4K 2B4OA 3IN5A 4CJEA 1NDPA 2DJWA 4HH1A 4UY8O 2ZZMA 3MM8A 4DUYJ 3I96A 2N4CA 1H74A 3DLEB 2QG9B 2F8EX 2ERRA 2A40A 3ZT0A 4DSFA 2HNDA 2MZQA 3RUBL 3HYFA 5DG9A 1TELA 1MWMA 4QYZK 2E9RX 2E1PA 4V1Ak 3PNIA 1S3XA 1VSEA 3KYLA 2E7VA 4M1KA 4ZLLA 1J9AA 3GE9A 3M8WA 3CDUA 3QERA 2ZH7A 3BV8A 3I0RB 2UVUA 3K9KA 5CXTA 3BGRB 3BM7A 2I1RA 4EAHD 5AXKA 5AQHA 2YNFB 1RI7A 2ZITA 4HHUA 3SNNA 3VAKA 3QIDA 2ZD1B 3MEKA 3ITHA 3DLRA 3EDQB 4F4KA 1FJ7A 4CEZA 4PG8A 4X84A 3K57A 1SJ4P 1RDAA 5KT2A 4IDKB 1AUDA 1S48A 3WQTA 1D1UA 5KGXA 3VCDA 3K17A 3AJDA 4CI6A 5T14A 3PKMA 1KAXA 3AB2B 2I7NA 3IWXA 1WBBA 3FMBA 2PO4A 5KRSA 3MD1A 1N54B 3AOBA 5IM0B 4NWBA 3D0GE 3C15B 1MMLA 4WFBL 3H3NO 2BTFA 3ATVA 2R7RA 3GFZA 4DFPA 2M8DB 1W2IA 1Q16B 2AF6A 4X4OA 4JI4J 5FPDA 1S77D 1IR1A 1TKDA 2V5HG 3PW2A 3NEKA 5KFYA 1BISA 4JK9A 4DUZF 3TWHA 3DAWA 2BV3A 3NGZA 4X65K 1ZM2A 3GYXB 3MEDA 3CJ1A 1QE1B 2F63A 2IJNA 1CULB 2FYXA 4CLWA 1SB6A 3Q83A 8ATCB 1FDBA 4NOHA 4U8YA 4H8KA 3QZ8A 2CQIA 4WP3A 2FBYA 2XHWA 1RWWB 5KFJA 2V8DA 4I6AA 3GB0A 1HYZA 3GSIA 3MUTP 1M5VC 1RHKB 3KDNA 5L1JA 1WTFA 2RPIA 1Y00A 1FKPB 4E7LA 3ZX2A 2GO9A 4MTPA 3QFWA 1BA1A 1WF2A 4F4WA 2VJVA 1NDLA 2VFVA 2IS3A 1MSWD 4NYZA 2KO1A 3G82B 3TP2A 2MKYA 4MLEA 3V6KA 1VSJA 2VKZG 4X4RA 4M3UA 4ES3A 2R8GA 4JKBA 1WSRA 2B9XA 4U7UD 4FXWA 3MN6A 4BACA 1YAGA 4L74A 2YHBA 3NBPB 3CCMS 1VQ4S 5KFIA 1BC6A 3PX4A 1RWVB 2P51A 3SQ4A 4ZTFA 4FJ9A 4CZHA 4KHPK 1DGKN 1GMWA 1XTZA 4USKA 4CJFA 3GOIA 3H20A 4Z4GA 4OYZA 1KVCA 3M05A 3BSCA 4JI6F 3L9ZA 5B0CA 4RL1A 1UVIA 3A5LC 1HQUB 4DV7K 3AD7C 2FLNA 4Y34A 3O1WA 5I3QA 3GIMA 3NNHA 3LALA 1ZBUA 1C0GA 1XR7A 4WQ5A 1UWBB 4E7KA 3KHRA 2RDIA 5LMUJ 3TA1A 4GVMA 5F8JA 1K8AT 4WQ5C 2JFDA 1IBKJ 4ID8A 2ZGYA 5BRHA 1NLVA 2R2TA 4OLBA 2NPIA 1BU6O 3GE1A 3TA2A 3IS9A 5ETSA 4QWDA 4DV1J 1KVJA 4JLHA 3VF2A 1O0PA 3AVIA 3KK7A 3EYZA 4GC6A 1LWXA 2I2YA 4JI0K 2KM8B 2P9LA 2VU5A 3BN4A 4F04B 5HO4A 3H40A 3W61A 1XQIA 4X4UA 3OS0A 3LDOA 2Q0UA 1FA0A 4CQ1A 1RT1A 3U3YA 3LA0A 4GKKJ 2OFGX 5KOXA 1M1KT 4MO5A 1WTBA 2DNKA 4JYAJ 3AA8A 4NASA 3KK1B 2VZ9A 3HJFA 1XMQF 5KFMA 3VEYA 3NKYA 4NLQA 1BLUA 4FN5A 2JWLA 2MLZA 4OPAA 5HQLA 3ULEB 1YHQN 3SXLA 2VPXB 3J7YP 3DRSA 1FJGK 2GMHA 2HMIB 1SQFA 3M3ZA 5F2RA 1CS4B 4A57A 4QWCA 4NI2A 4DU7A 3PO4A 2KJWA 2FLLA 1EETB 3Q24A 3OVBA 3H2UB 2YNHB 3MDFA 4KRWA 2MQQA 2UXDJ 3I4PA 3I9ZA 2VBWA 3H2VE 1NZ8A 4CO2A 4JI5K 3O1BA 2CNLB 1C1CB 4NLWA 1NUEA 2NZ4A 4U96A 3TR8A 1U45A 4JNEA 1LW0A 2IJFA 5EOYA 4IBNA 1IG8A 4KHRA 3W8PA 3ZNUA 2MTLA 1FVSA 2P9NB 3LPUA 2VC1A 4CFAA 1TL3B 3D2EB 1LOTB 5AJ3K 4AHUA 4ZP6A 4LD0A 1N33F 4OJHA 2HVZA 2B8PA 5JVGL 1NZAA 3SCLE 2W8KA 4DR6K 3I5AA 4FVUA 5EGYA 3PIPQ 5J2QA 1HNWF 4KV8B 1R31A 3OW2R 2YKNB 2VPWB 4HEA9 5J1EB 2VC0A 2FJXA 2G13A 1BY9A 2HQGA 3ILJA 3NS7B 4ZLJA 4PQUB 2XO6A 4Q0BB 3D0IE 2DXEA 5EHHA 1FKOB 1Q78A 1Y64A 2Y0BB 5E84A 4DF8A 1RWMB 2IGIA 3SEOA 2W24A 1RWPB 2CNNB 2VFRA 1SQGA 2X1AA 2VQFJ 1VR6A 3UKUA 2ZFHA 4IH7A 2ZC4A 4L72B 2NRZA 3H4BA 4F4XA 2R42A 4WIQA 4A4JA 4CEQA 4JRPA 3QQCD 4CECA 1UA0A 1U02A 4MYUA 3CM5A 1JNZB 1Y5NB 1KWMA 2JSXA 2Q97A 3NAHA 5F8HA 5JVHL 4DF4A 2BOAA 3ZSZA 2BE7D 4IOCQ 1U09A 3L4QA 4B9VA 1S12A 4RO0A 2O67A 3LM2A 2V7YA 1LAVA 1S1XA 3CCTA 5AZJA 1EXQA 1RT5B 4UZCA 2V51B 2IOCA 1ZPVA 4NMXA 1RU1A 2CIMA 5HQ8A 1R6YA 2O8CA 2QMXA 1X9JA 4NEYA 2EC0A 4RW6A 4DN0A 1ITGA 2E2OA 2AX0A 3O4QA 3VQDA 4KIAA 2HBRB 2DTJA 2DPJA 2LU1A 4UOFA 3JXOA 5C2CA 3ILIA 1RDWX 1TKZA 4R25A 4KI6A 4B9LA 5K14B 3ATUA 3Q2SC 4B8CA 2BKPA 1GQEA 1OJ4A 4CJRA 3SI8A 2KZMA 4B3RJ 2KKZA 2FJBB 3O4NA 3H25A 1P8ZA 3HFKA 3EJMA 3B6PA 4R8UB 4FZYA 2C3YA 4FLZA 1UAXA 4B08A 4EP5A 2AD9A 1FJEB 3I0SB 4F2RA 2QA4G 2NUBA 5GMKa 1WEYA 1UAWA 4FS1A 3V6DA 2JC1A 4NCBA 4BRIA 1BQMB 4ZLNA 1EX4A 4LBPA 4O0NA 2F9WA 2XY8A 4MYTA 4LF6J 2NRHA 2X3GA 2E5LK 3K89A 2IFXA 3ULDA 5H1SV 3IBCB 2LDIA 3MM9B 3K5NA 3V2UC 2OTJN 2V8GA 1S6QB 1IR2A 1P1LA 2L48A 1BD6A 4DFMA 3HKZD 3K7RA 1K1SA 1LWEA 4HUFA 1JLCB 3EVMA 4NXMF 3H6EA 5HRRA 2AMCB 2HFVA 1R0BG 4U7BA 4M5DA 3PKYA 2VODA 4DV4J 4NB4A 4DB3A 1G7CB 3QBWA 3O3FA 3G71S 4DQIA 4YOEA 4X62J 3T1AA 4JKFA 2DNNA 3QSYB 2OIHA 3NS6A 2EHGA 2MZRA 2ZJPL 3TANA 1VQYA 4HTUA 4RBVA 3KOAA 4LC9B 3QEXA 3KK3A 2GMJA 4C48A 5D3GA 3MM8B 2G9OA 2QFJA 1TL1A 3SAFA 4RW9B 2KI2A 2HNDB 2ZVSA 1KVBA 3AAPA 3SPZA 1IBMJ 2R3VA 3MDQA 4NX9A 3D3BJ 4K25A 2ZH9A 1BDGA 3E9OA 5JMVA 3OYHA 4M5LA 1CJKA 3UFCX 2X1BA 2GAHC 3OVSA 3I6PA 4CH1A 2RDJA 4QYRA 4P10A 1TK5A 2GQCA 3ZLJA 5EX0A 4AL7A 3L09A 3VGLA 4DTMA 4FWSA 2D0CA 2MY8A 4ZP8A 4UY85 1CVJA 2DNYA 1K6YA 3DLHA 3NGRA 2BE2A 1DY3A 4EYIB 3C46A 1YWXA 1AT1B 4AE5A 2B4JA 5AQUA 2BGGA 4WFNL 4I0WA 3LWLA 3KLIA 3ITHB 4FBTA 3CYMA 1ASUA 4V19X 2QTDA 4J9VA 3MCSA 3RRKA 4YHHJ 2V9KA 3UN5A 1NH8A 2R7UA 3FBCA 2D7SA 1LKZA 1UMJA 3PM9A 5F0WA 4YDUA 1G1XA 4K0KJ 2D1KA 3DJCA 2HVHA 3C6TA 2VF3A 1BQXA 3E51A 4FXDA 2XHBA 1JJ2R 3ENBA 2EFGA 5HSPA 3NF8A 4ECXA 2V52B 5EU7A 5EVZA 3ZCMA 2KYXA 3F56A 1VLYA 3VN5A 2ATLA 1FX2A 3HSJA 4OLAA 2A10A 3MR3A 4B3TK 4YUDA 5HANA 3PSFA 1RAEB 2C22A 3S6EA 4ANDA 4QOTA 3KK2A 4CJ3A 5KFSA 4KC5A 2LA4A 3L7OA 4RJVA 3ASMA 3NMUA 1BQNA 1HW8A 3WUHA 3VEWA 3MEDB 3RAQA 3MAAA 2DXFA 3LDQA 3ONQA 1VQPN 1PAUB 2OCEA 1WWHA 5EWEA 3ZX0A 1R8CA 2DNHA 2ZEJA 4Y0FA 3H1QA 3FE1A 4ZVTB 1MA9B 5F8LA 2IVNA 2LQ8A 3UIQA 1FJCA 1KVKA 3ZSQA 3TZXA 4DR2J 3P5JA 3L6QA 4FNIA 3QWPA 4F3QA 3GJTB 1VQ6N 1FRXA 3CCRS 2MKSA 2O4GA 3JXUA 2M7SA 1O6XA 5LMNK 2CXEA 1RGVA 4Y65A 1U04A 1K8KA 2DGTA 3RGIA 3EXYA 5GAEU 3PEJA 5BREA 4RWXA 3GU0A 4EYHB 3P96A 3RW6A 1SH3A 2FZKB 2WRMA 4E1MA 2RIJA 3R5BA 4J9KA 4DU3A 3HSDA 2HSEB 5HQMA 1VQLN 4CZLA 4OX9J 2QK9A 1NK5A 2GWJA 4QU7A 5F8GA 1DARA 4ZITA 2ZWPA 5KG2A 2DCLA 2PI5A 1XNRJ 4DV3J 1RWKB 3CMAS 5IT9Y 3DHXA 2O8FA 4AH9A 2EBGA 3TSQA 1URRA 4OKJA 3MMVA 1SJ1A 1RTZA 4UY8T 1SIWB 4WF9Q 3W60A 4C0OC 5KFUA 2WBNA 4G1QA 3MR5A 1NMDA 4Y6IA 4ZMMA 3PW5A 4HUEA 3HSCA 4O44A 1UFLA 4ISFA 5GINA 1EP4A 1GXTA 1M90T 2QWPA 2W4PA 5D15A 2OEMA 2F40A 3DOKA 2DNGA 3W9JA 4P2FA 2A1RA 3O9TA 2Q43A 2W2OP 1QTMA 4DU4A 1UKUA 1G6BA 1VQMN 2BX6A 3ADAC 1C1BA 3JQKA 4JP8A 3I8DA 1RWXB 1KD1O 3MXHP 1ZYQA 2KLAA 1QVGM 3P6YC 1WNEA 4BRMA 4ALZA 4JUZA 3D6TB 3R5CA 4DV5J 4DSIA 2LP4A 3FC9A 1S72N 4LF5F 4NLBA 4WKYA 2P9LB 5A8WA 5ETVA 2LXUA 4IXCA 2HGNA 1UFKA 2K3IA 1U2CA 3NMRA 4MLHA 1RT1B 2B3TB 2BJ7A 4C8NA 4CZMA 3D2WA 4LF4J 3RU0A 2A6OA 1U0HA 5JMNA 1RAAB 3H59A 1O13A 2J5AA 2BQ3A 3OHBA 4UT4A 3CCES 5G4DA 3J81Y 3AGKA 2P9IA 2AP6A 2HKEA 1HNZF 1QJHA 2UUBK 4PWWA 4PZVA 1H2TZ 1CQMA 4NLPA 4GMJB 4AM6A 3M6WA 1RT4A 1HNXJ 2V6AA 3NCQA 4CJTA 4QOZB 3AO3A 2NRXA 3DRSB 4ERDA 4ZVPB 4ZIWA 5IT9U 2VKRA 2VQEK 1FXXA 3NDKA 4CJUA 2WCXA 2JLEA 4NI2B 4P9SA 5HMWA 2VG7A 5KFQA 2FGCA 4CHPA 5IC4B 5TKYA 2WFBA 1K44A 4MK9A 5GADU 4MH8A 4GMKA 2D5RA 4FNHA 2HMPA 3BO4A 2KRRA 1U1LA 1S79A 4MIBA 2QL9B 1NMNA 3MCPA 4QS9A 2ZJQQ 1ZM4A 3CCZA 1LW0B 4USMA 4ZVQB 5KFTA 4KB7A 4MDBA 3OXLA 2FSJA 5HRPA 1S9FA 2HG4A 3TJAA 2Z58B 1A9NB 3CD6N 3HULA 2XMMA 1NSQA 2HFNA 3B78A 1J5EF 3K8VA 3PR5B 3DLJA 3VR1A 4LF2A 2K2PA 2B7CB 3VQ7A 1RBRA 4CF1A 2MEWA 2AEMA 4USTA 3CD5A 5J2QB 2C2ZB 2AT1B 1N36K 3LDSA 4KTZA 3G4SS 2IVPA 3ZEUA 3K9JA 3UKRA 3K58A 1SH0A 1RAHB 3UCZP 4BC2A 2IJRA 2X51A 3QWUA 4CO0A 3J81U 2CJXB 3R97A 2J7UA 2EI5A 3LPEA 1FFSB 3R7BB 2EKYA 3O9RA 3MUMP 2Z2ZA 3GTYX 2E44A 3OL7A 5CD4A 3O4WA 2K1RA 3FBBA 3DRYA 2UUCK 2A5XA 3CERA 3TSUA 2KHCA 3D45A 3CCQN 3WXJA 4IOAQ 1I39A 3BH6B 2QWMA 2OEKA 3QIOA 3V4IA 1UETA 3UKUB 1LAWA 3EKUA 5B8HA 1HIYA 4PL7A 5L1IA 1NPPA 2LXIA 5AXNA 2FY1A 3M6XA 1NG9A 2KW4A 1D0EA 4NA3A 2VWJA 1QS4A 3FJ2A 1JL2A 2HAFA 2XCAA 1XR5A 1X5SA 2QJ3A 5AQXA 1CJUA 3N0VA 1S1XB 1JLFA 4H54A 4PYAA 2DGXA 4URGA 3HL8A 5AZJB 1FRJA 3M32A 3W9HA 1OPZA 3U1LA 2GGPA 1N34K 3GV8B 4C6AA 1SZ2A 2VD3A 4EP4A 1ZBHA 3CIPA 3OYMA 4DR4F 2H65B 2WB1D 2O8CB 1YSJA 4DOZA 3O08A 4RW6B 5FD1A 2O4IA 2CGKA 5JS1A 3F9KA 5GADI 3KJFB 2FBVA 2HNZA 1G2EA 3OS1A 2DXDA 3CWJA 3RW7A 1UOCA 1BIZA 1TKZB 1AFIA 1L5UA 3BGFA 3T7ZA 1GK8A 3UCUP 3K0SA 4WZMA 4ZPAA 5BRDA 3MN7A 4OI3A 2Q36A 2Q2RA 2SXLA 2IRXA 3VQ5A 1HI8A 2J7WA 4FJHA 2CDQA 5EWGA 3GLJA 4FK0A 3NL0A 3V9ZA 4LFBK 4Y00A 4N5SA 1VBZA 2ZH6A 3AARA 3V6DB 2HVEA 2IA6A 1ATNA 2KT3A 3AFGA 4HVJA 3DKDA 1NGIA 1C0FA 1NBWA 2GO8A 5CYQA 4KRFA 2HFOA 3T1YJ 1KS2A 5HRNA 3KHHA 4EBCA 3R1HA 3D7EO 3SMZA 2MMYA 4CLFA 4G6VB 3EPGA 3Q8UA 2BZ2A 1RBTA 2HEKA 3MX2A 2IMWP 4DV6K 2LQBA 4J9UE 3T5LA 1SPBP 1ZBFA 2C3UA 1HR0K 1LWEB 2DITA 4FP9A 2ADCA 4DR5J 4NYNA 5JXSA 1YJTA 1EQ0A 4CK2A 4CJSA 1DAXA 3T5JA 4E19A 4JI7K 1SQKA 1KC8T 3I56N 4LIRA 1U7LA 1FNOA 2GJFA 2CZVC 3UNYA 1P90A 1RT3A 2KG0A 3CDWA 2EFPA 3MTJA 3MX5A 2VASA 5EXWA 4KYZA 4DHYA 3TNVA 1RTHA 1PO6A 2KRBA 4K7QA 4ECQA 3KK3B 1WSEA 2DIVA 5D3GB 4A47A 4OGCA 2B9WA 1FESA 4JAXA 4WCEL 4GVLA 4LF8J 1TL1B 4A61A 2CQ1A 4J9LA 4IKFA 3BR8A 1ZA2B 2PFUA 4YR2A 1TAUA 3ZSWA 4I7FA 2DH7A 4IKAA 3MCNA 2HS3A 4ZPVR 4X65F 2WZ1A 3K59A 1ELOA 3D9BA 2PY5A 4AL6A 3MXJA 1KDNA 3FEZA 3FZ2A 1HJRA 3V9WA 1REVA 5KT3A 3TOQA 3IFRA 5IFMA 1SC3B 2J8SA 3DDIA 4JOUA 4QR0A 1RILA 4FJNA 1MN7A 5KG5A 4V19S 4ZS6A 1HHQA 3HO1A 1JLBA 1W7WA 2XSFA 4H4KC 1IVZA 4A48A 2QT7A 5AR0A 3PJ9A 4CP5A 4PG6A 2BE2B 4OYPA 3CW2C 2F8SA 1TK8A 3QB0A 5KFHA 2MQOA 3AA4A 3OSNA 3I8BA 4YOVA 1GT8A 5A8RA 1RAOA 3KLIB 3OTDA 3ETMA 3TUIC 1CSJA 7FD1A 2OTLN 2NXCA 1TP7A 4OJGA 5KPZA 1Q8BA 4XH5A 1U4BA 2F7TA 2AGQA 1UVKA 1S10A 3L2VA 3DLGA 2HPUA 1YJ9S 3TPQA 2AYGA 3SJJA 4DPOA 1OS5A 4KHPF 1YT3A 2H5EA 4YB7A 3V9SA 3CB4A 1YIJS 4K2XA 1S6PA 4IH6A 3MPWA 3C6TB 2U1AA 3OYLA 3TJ9A 4H0TB 2GV9A 5T7BA 3SMSA 1HD1A 2BW2A 4AM7A 3C94A 2EC2A 3CC4S 3U02A 3PR4A 4DV7F 2OP5A 3KUGA 4HT7A 4V19J 1FW6A 1RAFB 3OYBA 3Q23A 3ENHA 1SL0A 1WSFA 3GJQB 2P9SA 3IBFB 1UCNA 3C6AA 4TSXA 1N5SA 2F8MA 2DBBA 3VGTA 1S0MA 5AQLA 3KK2B 4Q2LA 2P9PB 2HHHK 3O6QA 1YX2A 1B7FA 4ED1A 1BQNB 4O8UA 2R8KA 3FK4A 3PHEA 4J37A 4ZCKA 3FGUA 2LKZA 3FFIA 3MAAB 2HGMA 2WTFA 5C7PA 2Z56B 3F0NA 4Q43A 3SUNA 1EQMA 4CM2A 4W4MA 2X74A 4JI0F 1Q0NA 3BN7A 3P49B 2W7AA 2W4CA 1DJ0A 5THWA 4B1WB 5J1PA 1FO1A 2QA1A 2NREA 3CO9A 2CG4A 2IVFB 2LVWA 1VHFA 3Q89A 2LYVA 1KQSM 4DR1J 4Z4IA 4P71A 4CO1A 3ID6A 3I55N 4P2MA 1K8KB 4RNMA 2PEBA 1NBEB 1T0TV 5BPMA 4I6WA 2MY7A 1MROA 4BROA 1I3OB 1RHUB 3IGVA 4YOYA 4TQRA 1A0OB 4O0IA 4BDYA 3HI9A 4ID1A 1JJCB 4OZJA 2FZCB 2MPUA 3GYGA 4A8QA 3KWMA 4WKRA 1NKBA 4I67A 3DN9A 2FHMA 1Q18A 1PJ7A 1FJGF 1F3FA 3CJ7A 5CY4A 3HHEA 1U1RA 2FJEB 2O8FB 1XMOK 1C0MA 4LF7K 2HWTA 2LEAA 1X4EA 1ZZFA 2DB1A 1HYSB 2QA4N 1MWYA 3J7AP 3ZXWA 2QWLA 1KLNA 1KTVA 3L95