1RT4A

Hiv-1 reverse transcriptase complexed with uc781
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
542
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 147
structure length 536
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt4A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt4A05
3PO4A 3PJWA 1RCHA 4FM0A 3I5CA 5DQHA 4DL3A 4E7JA 2ZQBA 1RT5A 4CHOA 5KFWA 1YTAA 2P5OA 3ICLA 3AVAA 2O4GA 2C2EA 3QIPB 3IS9B 3H40A 4BE0A 2UVRA 2QK9A 3O3GA 5CZ2A 4AHVA 3C6TB 2WONA 4MKBA 3TAGA 3QIDA 1VK0A 5T7BA 2EC0A 4CJ3A 4CJPA 3SFGA 4ED7A 1B9FA 4FZYA 4FBUA 4ZVHA 1X9WA 2PZSA 4AHCA 4NLDA 4Y1CA 2G8WA 4KB7A 3CJ5A 5KT5A 4I2QA 1TKTA 4I9LA 4MIAA 4XPEA 3FDSA 2IOCA 1I6JA 4E19A 2PY5A 2BE2B 4ICLB 1BI4A 3GIKA 4YR3A 4EP5A 3ISND 4NRUA 4K4SA 3DLBA 1SV5B 2V9WA 4Y3CA 2F96A 3CJ0A 5KFXA 1RT2A 4CK3A 3TAEA 1WSIA 4ED0A 4IRCA 2R2SA 3Q8SB 3N6MA 1T3NA 4CIGA 3SUOA 4G1QA 4TYBA 1HYSB 2XY7A 2YNIA 5KFUA 2WK4A 4DLGA 1D9DA 3NF9A 3HPOA 2FVQA 3CFPA 3V81A 3A2FA 2VG5B 3ZSQA 4J9OA 3DYAA 3OYLA 3Q8PB 4QAGA 3KLIB 4LSNB 4EP4A 3OL9A 4XIUA 2YV0X 1HQUA 1RBRA 4ED8A 2XI3A 4BE2A 3H98A 2XC9A 4Z4CA 2Y1JA 4URGA 4IFYB 4HUEA 4OKJA 4CFCA 5K14B 2OPSA 3UR0A 4CEDA 1IG9A 1BCMA 3MECB 4B9TA 2E9RX 4LH5A 5DMRA 4OL8A 2RKIB 3KJVA 4M3TA 1WLJA 3PW5A 5HBMB 4YP3A 1R0AB 1JX4A 1C0TA 2I1RA 3ZCMA 1HNIB 1JLFA 4JUZA 3V1QA 3JYTA 1D8YA 4KE5A 4R0EA 4W5NA 1YVFA 4ECWA 1HARA 4FK4A 3SYZA 1RTHA 5I3UB 3RBEA 4URQU 2FBXA 5DLFA 2AQ4A 4Y34A 2XGQA 2ZKUA 2C2RA 5KT2A 3V9ZA 3L2RA 3VQ6A 1QHTA 2GIRA 3BQ0A 2Z1IA 4DSFA 2XY5A 3D0PA 4EBEA 4QWCA 3VN5A 4F4WA 5C25A 3RB4A 4WXWA 3DI6A 3M8SA 4FJ9A 1WSJA 4DL7A 5DLGA 3PX0A 4LQ9A 3VQCA 4BWJA 3CDEA 2VWJA 2P5GA 4KHQA 3CYMA 3QGHA 4IFYA 3HT3A 3EPIA 5KFTA 3JYTB 1C1BA 2ASLA 4H4MB 1T94A 2R8JA 1WSEA 4NLRA 4FCYA 3QO9B 3L2WA 2O4IA 1MU2B 4DU1A 4YQWA 1VSLA 4NCGB 1FXXA 1BISA 4C8KA 1TV6A 1J54A 2ILYA 3O3FA 1JLAA 3KMQA 2X6NA 3OS1A 4FLUA 3MEGA 4CGGA 4K4XA 4ID5A 3AO2A 4B3OB 3AVMA 4WYLA 3GIIA 1HJRA 4IRKA 4RW7B 1XHZA 4RUAA 2ETJA 1S4FA 3AA4A 4QPXA 5J2PA 5HLFB 1U4BA 3V9SA 4RNFA 1A5VA 2CKWA 2D5RA 5FDLA 4DLEA 4ED3A 4KTWA 4CHPA 2BQRA 4G1QB 4DQRA 4DTMA 3KHHA 3LP2B 3VQ8A 1L3UA 1JLQA 4QWBA 2YNHA 1NNDA 3HVTB 1KVBA 1Z4UA 1RT2B 2YNGB 2OYQA 2R7YA 1TQLA 2FBYA 4GMJB 1TK5A 4H8KA 1KFSA 4FJ5A 4O44A 4CF0A 1B9DA 1A5WA 3CQ8A 1NK4A 5FRNA 5KFKA 3H5XA 4DL2A 4FZZA 3GIMA 1LW0A 2DPJA 4IG0B 3ZSXA 2HHSA 4CHZA 3SUNA 4BE1A 3S3NA 4DTRA 2V4QA 4CF1A 1LWCB 4ELTA 2R8HA 1KTQA 4O4GA 1SH0A 1JLEB 1S0OA 3SQ2A 4CEQA 4RNNA 1QUVA 1KFDA 2B4JA 4NLQA 4OKEA 1S1TB 1X9MA 2VA3A 3DM2A 5KG6A 4DU3A 1ASVA 1BL3A 4KB0A 2YKNA 4IFVA 2AU0A 5KFDA 2R2TA 4TYAA 3L2QA 1OS5A 4FS2A 5F8MA 1CXQA 4JLHA 3AVFA 1TL1B 4Q43A 1IKVB 3U6FA 2HNDB 2VA2A 3OYIA 4KHMA 2YKMB 4M94A 1ASWA 2WRMA 4ZHRB 5J2NB 4B9LA 4IDKA 4CK1A 4NLOA 4E7IA 5KI6A 2AGOA 4DFMA 5SWMA 1QAIA 3KLGA 2WTFA 2GUIA 1XR5A 4JV0A 2XI2A 3SI8A 2R2UA 1LAWA 1SUQB 3M8PA 3LPUA 4LQ3A 4CF8A 4ZVEA 1L3SA 3K5OA 4IDKB 2G8UA 3DLEA 4HVJA 1BQNA 3SQ1A 2JGUA 4JS5A 4QOZB 1NHUA 4KKOB 1N6QA 4EYIB 2F8TA 3H5UA 4ELVA 1VSDA 1ZBUA 4KBIA 4B9MA 2WHOA 3EZUA 3T5KA 1B92A 2Y1IA 4URSA 3KD5E 4DG1B 4FJ8A 4AHTA 5KFEA 3ZSRA 4J2AA 4CJQA 1W9HA 4ECVA 3LALA 3G6XA 2ITGA 4CFDA 1QTMA 3AVJA 1NKCA 4FS1A 2BQUA 1TGOA 2IDOA 1LWEB 1QAJA 1TVRB 4MQ3A 3QEPA 5HRRA 3CJ3A 3V4IA 5HP1B 3DMJA 1WNSA 2UUTA 1JL2A 4OGEA 3LWMA 3L3UA 4KSEB 1LAVA 4CJUA 4NLXA 4CFBA 4DTSA 5KFSA 2FVRA 4OLBA 3PX6A 4IG3B 5SZTA 4NLUA 4K4VA 2RDIA 4TSXA 1JLCB 1RTIA 3HKWA 1X9SA 4K8ZA 4EBCA 3HVWA 2QXFA 1CXUA 4Q44A 1IKWA 2B6AB 3I0RA 5CYQA 3GYNA 2A1RA 3H2LA 3V6DB 3IAYA 2HNYB 1S1UA 3VA3A 2PYLA 1NJYA 4J9SA 4O4RA 3LZIA 1WAFA 1SL2A 1GOBA 4RW4A 2G8HA 4L8RB 2W9AA 3LDSA 1D1UA 1WSFA 5J2PB 3OLAA 1TK0A 1W25A 3D45A 3JSMA 4QW9A 1VRUB 5KFPA 4ECXA 1S9EA 4Y1DA 4IBNA 4KHUA 3TAFA 1BGXT 3P5JA 4FW2A 3RR7A 1BHLA 2W9BB 4J9NA 1WSGA 4B3OA 2X78A 4EEYA 5DG8A 3DOKB 4ID5B 3CO9A 5C24B 4CECA 1FKOA 3BSCA 2IAJA 1JLAB 4E1NA 2YNHB 1VRUA 3OJSA 2FLPA 2V0NA 1NJZA 4CK2A 2D3UA 1S49A 2OPRA 3AO3A 3Q8QB 4DS5A 2JEJA 3SQ0A 4C8LA 2BE2A 4FJMA 2IJFA 4DL6A 1IKYB 1S9GA 3UDLA 3KLHA 3AVHA 4FM2A 3HYFA 3HVRA 5CYQB 3PW7A 3HXMA 2HMIB 2FBVA 3SQ4A 2R8GA 4GW6A 2RF2A 4HYKA 4TN2A 5C25B 4J2DA 3NAHA 2IGIA 2IM3A 1U47A 1NK0A 4QWEA 5KRSA 1NKBA 1HPZB 5KFZA 5KG3A 5KFFA 1GOCA 4EBDA 1KRPA 5D3GA 4ZMMA 3V6DA 3LP1A 4W5QA 4CERA 3KLFA 4OVLA 3CM6A 1D5AA 3TAQA 4FJIA 4O0JA 1TKXA 3OJUA 3VQDA 5J1EA 3CJ2A 3KOAA 1C6VA 2LSNA 5EUHA 1QSLA 1R0AA 5KFIA 2E9ZA 1YT3A 4CF2A 5KFYA 1TKZA 4WZMA 3TQ1A 3KIOA 3IGNA 4E7KA 3QEVA 3RRHA 4KTZA 4IKAA 1GX5A 3AVGA 3CDUA 4MKAA 5D3GB 5C42B 2DTUA 3P83D 1EX4A 2AJQA 4B08A 1KLMA 4M42A 3TAMA 3SFUA 3DMJB 3OHBA 3H5YA 5EU7A 1C1CA 4F3TA 3V6KA 3IN5A 3QINA 3DRPA 4UQGA 3V9WA 2R8KA 4M3WA 1N6QB 4J9RA 3ZSWA 4I7FB 4CJFA 2QV6A 4DQIA 4KHYA 3LP0B 1C0TB 3AO1A 1QE1A 3G86A 1RTJB 2HMIA 4I9QA 5I42B 4DG1A 2I5JB 4KHRA 2OPQB 4FM1A 1IKYA 5F8HA 5F8IA 2HHUA 1S5JA 4AHRA 5T14A 4WFZA 3IGVA 3TVKA 4X2BA 3IRXA 3HP6A 3CIZA 4C8NA 4KKOA 4LSNA 4LH4A 4ECYA 2W8KA 3DRRA 4Z4FA 1S10A 3SV3A 3GIJA 3KK3A 3V81B 5J2NA 1NOYA 3SUQA 3UPFA 4FJKA 4FLTA 4ED6A 3B6OA 4KI4A 4LSLB 2J6UA 2RPIA 4ZP8A 4QCLA 3ISNC 3ALYA 1S9EB 1EP4B 3OL8A 2JC0A 1ASUA 3LP3A 4CGJA 4NLPA 3OVNA 2XY6A 3OYGA 3V9XA 1BI4B 3TWHA 1RBTA 3ZT3A 5KFOA 1LV5A 3G0ZA 1LWCA 4F2RA 4KFBA 4DF4A 3HK2A 1J5OA 2BANA 1WN7A 3SUPA 4Q5VA 4PQUB 2HHQA 3H4DA 4N41A 1XR6A 2JEGA 1SH2A 4O3OA 1TP7A 1TAQA 3K57A 3QLHA 5L1IA 5F8LA 4J9KA 1ITGA 2WCXA 2UVVA 1LW0B 3CJ4A 1ZETA 4DQPA 5L1LA 1KHVA 3SI6A 4HTUA 1RBUA 3AO5A 1X1PA 4TY8B 3CWJA 3OYFA 1RT5B 3FFIB 1S1XB 1Q9XA 3RMCA 1KLNA 3G6VA 3V4IB 4J2BA 2WOMA 1DLOB 1D0EA 4BDPA 5KGWA 4BWMA 1XWLA 3OYEA 5CY4A 5J2QB 3MXMA 2OZMA 3VQ9A 3VQ4A 3HSTB 3LP2A 4J9PA 3AVNA 5HLFA 1T03A 4I2PB 4WE1A 2KQ2A 1BQMA 3F9KA 3NAIA 3QNNA 5CYMA 1NOZA 3K2PA 4ZTFA 1U04A 1S1VA 2FJVA 2KW4A 2I5JA 3OYHA 4EZ9A 5KT7A 3SPYA 3CG7A 1CLQA 3DOKA 1RTJA 3LAKA 3U3YA 2ILZA 3VQQA 1JLQB 4OLAA 3TABA 4MH8A 2BRKA 3KTQA 3TARA 2ZD1A 4DFJA 1N56A 3MXJA 4RUCA 1RYSA 4FW1A 1C0MA 2HAIA 2D0BA 3NH2A 1C1AA 2XO7A 1U49A 3V1OA 1SUQA 3IRXB 3TAMB 5KFMA 3E51A 1C1BB 3CM5A 4CJRA 2ZE2A 5C42A 3AVLA 2KFZA 3AA5X 3RAQA 4O3NA 2VG7B 4ELUA 4FLVA 3T5HA 4EZ6A 5FROA 3WNEA 3OYAA 1QE1B 2BQ3A 4NCGA 5DQGA 4ZP9A 3LP0A 3QO9A 4ECZA 5KT6A 4M3YA 4IG3A 5C5JA 4O3RA 2YNFB 1RTHB 4E1MA 3I0SB 3OS2A 3LP1B 4B9SA 3H5SA 2BR0A 3UIQA 3ITHB 2E6LA 3RBDA 1HPZA 2AWZA 3QGGA 5I3UA 3OL6A 4GVMA 4WYWA 4IR1A 3I8DA 3KK1A 3I5AA 3NGYA 3SPZA 1FK9B 4Q8FA 1EKEA 4MFBB 1TL3A 3C95A 1HNVA 2DFHA 4F8RA 2RDJA 2CJQA 2F8SA 2YHBA 2RF2B 2X6SA 3QEXA 3MF5A 1ZYQA 3RWUA 1J53A 3BGRB 3C6UB 3M8QB 3UQSA 4CJKA 3OYMA 3DRSB 4ZP6A 1S6PB 1HMVA 4KAZA 1UAXA 2DFFA 2ZD1B 4G3IA 2O5DA 3T1AA 5KG0A 3SV4A 2DY4A 2FLNA 4Y2AA 4QWAA 5HROA 4Y2CA 2IM2A 4PWDA 1A5XA 3PW0A 3CDWA 4GC7A 4FBTA 2ASJA 5KRTA 2KZMA 4PY5A 1BQMB 5JS1A 2ZE2B 1LW2A 3DLGB 4WE1B 3AV9A 1IM4A 3KKSA 4F3OA 3BSAA 4N5SA 4K8XA 2B43A 3MR5A 2UVWA 4CFAA 2Q3SA 1S6QA 4NLTA 2HVIA 1S97A 1L3VA 4W5RA 2W9BA 3ZSOA 3LPTA 2HNDA 4TLRA 3HPGA 2IAJB 1FKOB 2B6AA 3I0RB 2AGQA 2WONB 3NH1A 2D0CA 4IOBA 3QIOA 2J6TA 1WNEA 3GV5B 1VRTA 1HMVB 2IC3A 4DMNA 4OGCA 2BDPA 5F8NA 5KFRA 2KTQA 3OSPA 5J2QA 4ZTJA 1XC9A 4MIBA 3KHGA 3TANA 3QZ8A 1VSHA 1RNHA 1N48A 1DLOA 1RBSA 4FJ7A 1C2PA 3V6JA 4TXSA 4B9NA 4CGDA 3M8RA 3I5BA 3VQPA 3L2VA 3K5MA 3L3VA 3VQBA 3PX4A 3H59A 2UUWA 1RTDB 2ATQA 4CJVA 4ECUA 3QEIA 4XO0A 3CFRA 4O44B 5DQIA 3GV7B 2FBTA 4K4WA 1JLBA 3NKYA 3GQCA 1J5OB 3HHKA 3QZ7A 1LWEA 4FJGA 4K4TA 1SL1A 4AH9A 1QSYA 2V4RA 3QNOA 1TVRA 2GV9A 3O4QA 5KG4A 5EWEA 1RT1B 2G8KA 4MK9A 3KLEB 3NHGA 4CIEA 3H4BA 2XGPA 3GILA 1BIUA 4LY7A 5E41A 4ZPAA 4EYHB 4O3PA 4RW6A 4CJEA 4RW7A 3SNNA 2HW3A 3BJYA 3NAEA 2GIQA 2VG5A 3PUFA 3S3MA 3SCXA 3DRRB 1JLGA 1RT7B 2J6SA 3DLEB 2YKMA 3BR9A 4H4MA 3C94A 3HL8A 4RW6B 5KFNA 1TL1A 4W5OA 3MEEB 4E3SA 2HB5A 4Q8EA 1XHXA 4FLXA 3HPHA 3IG1A 2IS3A 4KB1A 5CYMB 2AX0A 2A1SA 1TKDA 3ZSVA 2R2RA 1UA0A 1REVA 4B8CA 1RT6B 4DQQA 4O55A 4ICLA 5KG2A 2HHXA 2WB4A 4OPKA 3T5LA 4KI6A 4Q0BB 1N5YB 5J1EB 4I2QB 1TKXB 2W9CA 2HWHA 4WXOA 2IJNA 3K59A 4M3UA 3AVBA 2YKNB 4M41A 1IKVA 1K1SA 4CJSA 2W8LA 1NK5A 1GX6A 2JEFA 2VG6B 1JL1A 3B6PA 3IS9A 5F8JA 4KTQA 1RDDA 4KHNA 1DTTB 4CF9A 3DM2B 4IH5A 1JLEA 3KMSA 2HWIA 4DWIA 5KFAA 3Q8RB 1TAUA 4KO0A 4J9LA 4KPYA 4NLGA 4HHTA 3ZT2A 4CHQA 3WNGA 2D7SA 1JIHA 3MECA 3WNFA 3MXIA 2BANB 2PYJA 2HVHA 4IG0A 5L9XA 3KLHB 1S9GB 5HRPA 3E01A 5L1JA 3N6LA 4DF8A 1NK9A 3RMBA 2G8IA 4C8OA 3OY9A 1U48A 2ASDA 2OA8A 5FDLB 4U6PA 3DDKA 3VA0A 4JS4A 2VWKA 1VRTB 3KNAA 4F4YA 3BSOA 3QETA 4DSEA 4ZPBA 1RDBA 4FJLA 3NCIA 1SL0A 3T5JA 1EP4A 3EPGA 4NZ0A 2AGPA 2YNIB 1C0UA 1HYSA 1RT4B 2JEIA 3ZT4A 3NGDA 4Q45A 2IBKA 4FLYA 5DG9A 4PWDB 5KG7A 4RG8A 3RB0A 4N47A 5KFCA 3JSMB 2C2DA 2FVSA 4CJLA 2HHTA 5DGAA 2DFEA 3O4NA 4CGHA 4DL5A 1SKRA 1QS4A 1K1QA 1S1UB 2BRLA 2XCAA 4ZVGA 3DOLA 4CIFA 1XR7A 5J2MA 3OSNA 4CEOA 3DI6B 2OZSA 5EWGA 4F4ZA 4B8AB 1JLCA 1KSPA 5DK5A 4I7FA 3TI0A 3QYYA 2Z1JA 3K5LA 1UWBB 3DRPB 4FK0A 3D28A 4CEBA 3QIPA 4ED1A 2W7OA 4IH6A 4KHWA 2R8IA 1XI1A 3ITHA 1U09A 4Z4EA 2HNYA 3HVAA 4YNQA 3NL0A 3PY8A 4DSIA 3OYBA 1RA6A 1IO2A 1NK6A 4RW9A 1F21A 1BCOA 2E6MA 1HRHA 4N56A 4HUFA 4KAIA 1ZBHA 3WNHA 3DLRA 1RTIB 4F4KA 3KK1B 4NCBA 3V9UA 1REVB 2G8VA 3AVKA 4NYZA 4RW9B 4OPJA 3FQKA 5F8GA 2OPSB 4M95A 1K6YA 3SJJA 5KG1A 1JKHA 3DOLB 1EXQA 3I0SA 4JRPA 4QWDA 4ZPCA 4KV8A 1G15A 1ZBIA 3RMDA 4RZRA 1HQEA 5KFBA 2OPPB 3ZSYA 3AA2A 4CGFA 1RT3B 4NRTA 3DYAB 3PR4A 4E0DA 1LWFB 4R5PA 1QQCA 4CEAA 2P1JA 3V6HA 1JLFB 1HNIA 4HUGA 4HCBA 3NF6A 3D5MA 2ALZA 5F9NA 1ZBLA 1JXBA 1C0UB 5J2MB 5EDWA 5K14A 2XRIA 3KHLA 5FRMA 4EO6A 4K4YA 2XY8A 2B5JB 4DTUA 2FJWA 3TR8A 5HRSA 3NDKA 1HQUB 3M9OB 4TQSA 2OPRB 4FVMA 4I2PA 1KVAA 1T03B 4KRFA 3RAXA 1VSIA 1HYVA 4RNMA 4DFPA 3FSIA 3N6NA 5KFLA 3E01B 3MAQA 2NUBA 3OLBA 3BQ2A 3OYJA 4GC6A 2WOMB 2FLLA 3FRZA 5DG7A 3QGIA 4DU4A 1D9FA 5DGBA 1S1XA 3DLKA 1SV5A 4ID1A 3FFIA 3S9HA 4TY9A 4E7HA 1Z26A 2IM0A 4KHSA 2BGGA 2HHWA 1CZ9A 4ZP7A 1NK8A 3MTKA 1T05A 4JV2A 3QLHB 4ZHRA 4RNHA 4O4GB 4RNOA 3RB6A 4IKFA 5KT3A 1CZBA 1KHWA 2W9CB 4KFBB 1RDAA 2IA6A 1WAJA 3K58A 4IH7A 5KFJA 5KFVA 1YTUA 2IC3B 1VSFA 1S48A 1N4LA 3EY1A 1DTTA 1ZTTA 5KFQA 3NH0A 5L1KA 4K50A 4NLVA 3LZJA 4ECTA 2UVUA 4N76A 1FKPB 3DLKB 2C28A 5HP1A 1CSJA 3PJXA 1JLGB 1RT7A 2QKKA 3P1GA 3MR2A 4CHNA 3PHEA 3AO4A 3PO5A 4IQXA 4H54A 1ZTWA 2P51A 4IR9A 4FJHA 4Z4HA 1EETA 3KK3B 4R8UA 4M3ZA 1S0NA 4DL4A 2ATLA 3HJFA 5KGXA 1S9FA 1Q9YA 2W7PA 2W42A 1RT6A 3G10A 4O0IA 4WFYA 4DTJA 1J9AA 4O5BA 3RRGA 4F50A 1RDRA 4LSLA 4RW8B 2OPQA 1NKEA 4NCAA 5I42A 3MFHA 3OYKA 1TV6B 1DTQB 3MEDB 3OHAA 1KCFA 2JLEA 4PUOA 2X74A 4U7CA 3EYZA 2QKBA 3QESA 2B5JA 1RT3A 4KV8B 4QW8A 3THVA 3RMAA 5KT4A 4RU9A 1JKHB 3BGRA 4WZQA 4AHUA 3SZ2A 2JC1A 3LWLA 1RBVA 4YR2A 4JV1A 1VSMA 3QERA 1I3AA 3KK2B 3KLVA 1GOAA 3M9MB 3MFIA 4R8UB 1HNVB 2KZZA 1EETB 3FQLA 1NK7A 4J9MA 1LWFA 4J2EA 3PR5B 2FVCA 4IRDA 3OYDA 1IKXA 1NJWA 3L2UA 1MU2A 1C1CB 2OPPA 2FVPA 5EWFA 1HQEB 3EZ5A 4FZXC 4AHSA 1KLMB 4K4ZA 5JS2A 4CHYA 3ASMA 1RAJA 2Z1GA 4B9UA 3H08A 3L8BA 4IFVB 2YNFA 4DEZA 3NBPB 1I39A 1HYZA 1TKZB 4CCHA 2IM1A 3OS0A 1TK8A 3NGIA 1L3TA 5KFHA 4YMEA 4J9QA 3LANA 3KHRA 3KD1E 3HM9A 3DLHA 4NYFA 4DTOA 2QE5A 2VG7A 3S3OA 1SH3A 3KLFB 1T7PA 4H4OB 3NMAA 4FK2A 4BDYA 4DTPA 3ULDA 3BREA 3BDPA 4JRQA 1T05B 4HCCA 2E9TA 3U3GA 3OYNA 3K5NA 4CGIA 4C8MA 4ED2A 3RR8A 1T8EA 1QSSA 4DTXA 4F2SA 3NF7A 1LW2B 3DLGA 4OJRA 1UA1A 5HBMA 5KFGA 3M9NB 1RDCA 2YNGA 4CEEA 3VQAA 3HVTA 1SKSA 4CEFA 4DSLA 3CVKA 4RW8A 1S0MA 1S6QB 1U45A 5CZ1A 4M3XA 4FJXA 1Z25A 1BIZA 4ZVFA 3RTVA 4NYNA 2C22A 3QEWA 1VSJA 1NHVA 3O3HA 3BSNA 2G8FA 1TKTB 2EX3A 4M3RA 5HRNA 2XHBA 3MR6A 4DTNA 5C24A 4F4XA 3RB3A 4Z0UA 4YFUA 3NFAA 4PA1A 4FYDA 1VSEA 3MEGB 4TY8A 1IKWB 5HROB 4MFBA 3PW4A 4FXDA 1FK9A 4CJWA 4M45A 4ECSA 2FC0A 5JXSA 4RW4B 4YR0A 4AILC 1O1WA 4CEZA 2GC8A 5JUMA 4MK7A 2EHGA 3ZSZA 4ECRA 1S6PA 2OH2A 2RN2A 4Z4GA 4Z4IA 3DRSA 2VG6A 1IH7A 3C6UA 3M8QA 4PQUA 2XWYA 4K4UA 1ZBFA 4KREA 4H4OA 1YVUA 4FLWA 4KO0B 3AA3A 3MR3A 4DSJA 3PZPA 3PVXA 2GBZA 4FLZA 3G6YA 1TL3B 4W5TA 3C6TA 4XPCA 4BACA 4Q0BA 3NBPA 3AVIA 3KK2A 4CE9A 1KVCA 3VQ7A 1MMLA 2D0AA 1NJXA 2IMWP 4NLSA 3KKRA 3IG1B 2D41A 3ZT0A 4WFXA 4B9VA 1W0HA 3MEEA 3PW2A 3TAPA 1IKXB 1VSKA 1UWBA 2Z1HA 2KFNA 1JXLA 2HHVA 1N5YA 3VQSA 3T19A 3BQ1A 2HNZB 4FJJA 4NLYA 3LAMA 1RILA 2RKIA 3KJVB 2DPIA 4DFKA 1RYRA 1RA7A 1Y97A 1S1WB 4CJ5A 4ECQA 3F73A 3OYCA 4TQRA 3M8PB 4CJ4A 4MK8A 1WSHA 3KLEA 4PUOB 3GV8B 3KLIA 3HP9A 3NGZA 1BQNB 3NE6A 4E89A 1RT1A 3CFOA 3NF8A 4R5PB 2AX1A 4HKQA 5KG5A 5KTQA 3HO1A 1DTQA 3MEDA 3PV8A 3VQ5A 4OKKA 1L5UA 1RT4A 4DQSA 3OL7A 4NLWA 1JLBB 3T3FA 1SKWA 1S1VB 4CESA 2FJXA 3KLGB 4ZPDA 3ZT1A 3V1RA 4DS4A 1S1WA 1Q8IA 3VQEA 4DSKA 4LD0A 4EO8A 2XCPA 3AVCA 1S1TA 4FJNA 2HNZA 2YHAA 2F8EX 4E7LA 4O3SA 1RTDA 2E4LA 1JXEA 5F9LA 4BDZA 2D3ZA 4O3QA 4CJTA 1FKPA 1UOCA
chains in the Genus database with same CATH superfamily
2ZHOA 3PO4A 3EE8A 4FM0A 2P2CB 4DL3A 3O3LA 2J9DE 1IR0A 2ZQBA 2E5IA 1HWUA 5KFWA 6FD1A 3GR1A 1U1KA 2C2EA 3O3GA 4WCEL 2VQEK 2XMUA 4J5OA 4MKBA 2E1PA 3CMQA 1Q5YA 3AHPA 1RTZA 5AQVA 2OEJA 4FZYA 4JYAJ 3VAJA 1X9WA 2F40A 4A8FA 4A57A 4LF1A 4I2QA 1TKTA 4I9LA 5B0CA 3G8TA 4XPEA 3WHIA 2ZBPA 4E19A 1BI4A 1KQFB 2I7NA 2CQDA 2L9WA 3IC1A 3DLBA 2VDHA 1SV5B 3CJ0A 3NP5A 1RT2A 3KJFB 4BR7A 3TAEA 4NMXA 4ED0A 5DM7Q 2XS5A 3UE2A 4IRCA 4ANDA 2HBKA 1BUXA 3I87A 4G1QA 4TYBA 5THWA 5FLXU 1D9DA 4GKJF 3GTYX 3DLLQ 2F8HA 3VWSA 3ZSQA 3DYAA 3OYLA 3Q8PB 1VS3A 2W6KA 5AE3A 4LSNB 3CQYA 1HQUA 4ED8A 4AL5A 1ZA1B 3H98A 2ZBRA 4UF4A 4URGA 4HUEA 3HI9A 3M1FA 3UR0A 2ZH1A 1HFEL 3MECB 2DY1A 3O6WA 5C12A 2VQFF 4OL8A 2RAQA 2NRZA 1R0AB 1KAYA 1C0TA 2ZNZA 5DZ7A 2E88A 1FWKA 2BE7D 2RJZA 4NOHA 2JZ5A 1D8YA 3NNCA 1RHKB 3IO1A 4W5NA 4F36A 4IFEA 1HARA 4FK4A 1RTHA 1N36K 1WHYA 1FO1A 5DLFA 3NEKA 2CQ1A 1RISA 4NXNF 4GV3A 5KT2A 5IC4B 1HI1A 3VF6A 2D9OA 4CM2A 3VN5A 4F4WA 3K7RA 5AXLA 3EICA 3VHQA 2DB1A 3JXUA 3M8SA 2VV5A 4QR2A 4DL7A 4HT7A 3PX0A 3GFXA 1XMOK 2W4PA 3PFOA 2P5GA 3CJ1A 3OD2A 4BHQA 4BR2A 2K3KA 2QLWA 2PEHA 2DPNA 4H0VB 1TV6A 2UXDK 3O3FA 3NCRA 3KMQA 3D9BA 5B0DA 3GIIA 4X64K 3ZZTA 1YRUA 3CPWM 2O8DA 3ZYYX 4F67A 3VGKA 2XNQA 2ALYB 2ROGA 4HTLA 3NGKA 1HHTP 4RNFA 2CQ0A 5FIIA 4RX6A 1B7FA 4M5NA 4DLEA 4BLGA 5LJ5Y 3CSKA 2RIJA 3KHHA 1QD1A 1O51A 1L3UA 4CBUA 1RKJA 1NNDA 1XMBA 3V5RA 1Z4UA 5HMYA 1C4AA 3G71S 1NM1A 2OYQA 1TQLA 2FBYA 3K0SA 4FJ5A 2HWTA 2UUAJ 4CF0A 1A5WA 1NK4A 5FRNA 1TELA 4BBYA 4OJGA 1LW0A 1XC3A 2DPJA 2B4OA 4H0PA 4ELTA 1W97L 3ILIA 3ENQA 3GONA 2UUAK 1JLEB 4CLTA 4CEQA 4RNNA 1QUVA 2KLAA 3BH6B 2YQ3A 1S1TB 3HULA 3EUNA 4OLOA 2BW7A 2N3OA 1YGYA 1ASVA 1HNXF 4KB0A 4B3RK 4EUVA 2OSRA 1CXQA 3TSQA 3MUVP 1IKVB 3R1LA 1PG5B 2FLOA 3OYIA 2YKMB 2AW0A 3PIPQ 4YOTA 3K17A 3M7VA 3GFZA 4IDKA 4NLOA 5KI6A 1QAIA 1Q1KA 2XNRA 2GUIA 4MTPA 1KC8T 3P6YC 1FW6A 3EXYA 3SI8A 4FOIA 2R2UA 4USWA 4ZK7M 5JMNA 2Y9HA 1T9XA 4ZVEA 3VPZA 2G8UA 1WDTA 3AGRA 3B4MA 4PXBA 4HVJA 2DH7A 1MA9B 2VC0A 3TQEA 3BEXA 2F8TA 4ZVPB 2NXJA 2P9NA 2DNNA 4LR7A 1HKAA 4JI3F 3H5UA 1ZBUA 4B9MA 4X65J 2Y1IA 2KG0A 3BO3A 2KDOA 1TZ0A 4KR0B 4CJQA 4LF4F 4ECVA 2XEXA 5AQHA 2MJUA 5D77A 4ZDNA 4WCEQ 1NKCA 4OPAA 3MD1A 3D7SB 3QBXA 3CJ3A 3V4IA 2F65A 2RHKA 2QC3A 3QT7A 1RHQB 4ILGB 1M5KC 2OCEA 2V2QA 4I0WA 1LAVA 2CNNB 5KFSA 3PX6A 1ZBSA 2V7YA 3QJJA 4K4VA 2V9KA 5ETKA 3OXGA 1SVDA 3CUNA 8AT1B 2E7XA 4DUYF 4K8ZA 4EBCA 3WZ0A 2IRXA 4WQ4C 4TLQA 2NRRA 5CYQA 3H2LA 1VQLN 3CXCR 3V6DB 1FF2A 1J27A 1FRKA 2PYLA 1NJYA 1FRMA 2GQ2A 1QUPA 2B4VA 3IDHA 2ZVIA 2W9AA 1D1UA 1WSFA 1W25A 3DRYA 4CLKA 3TU5A 1NGIA 1WUAA 3P5JA 2VDIA 1BHLA 4RWXA 3HX9A 2VFVA 1DKGD 1WSGA 1OQ6A 1HBUA 1JLAB 4E1NA 2YJEA 1ZZNA 2QWPA 4Y0WA 1H0HB 2Q31A 1S49A 3Q8QB 3SQGA 2BE2A 2ZBIA 3TTCA 2DIUA 4FJMA 4YB1P 3DRXA 3P8BB 3OTBA 2QO3A 1Y10A 3KLHA 3R8YA 3AVHA 5CYQB 1R0BG 1FEHA 3RW7A 2LDIA 3SQ4A 2RF2A 4HH1A 4TN2A 3H25A 1VQ7S 3OR2B 2ZBQA 1G7CB 1R31A 2V69A 2E5GA 4PYAA 2EFGA 1HPZB 5KFZA 5KG3A 5K8MA 1KRPA 3EE9A 4B3MJ 3V6DA 5M2UA 5IFMA 3SK3A 1WC5A 5CHCB 1U6FA 3GWCA 3TO8A 4X4SA 3CM6A 1D5AA 2ZHAA 4CZCA 5ETQA 5J1EA 2OGUA 2FPHX 2HBQB 3K8VA 5EUHA 5A6WA 2YTCA 2E9ZA 1U1QA 4WZMA 3TQ1A 3KIOA 1YITS 5B08A 2NRHA 1MMNA 3U1NA 3CDUA 5D3GB 5C42B 5F3ZA 2ZH4A 1V5VA 3TAMA 3R9LA 3OHBA 3SSRA 4JI4K 5EU7A 4LRBA 3M8WA 5CYJA 3QINA 2R8KA 3CD5A 3ZSWA 4I7FB 4QU7A 2QV6A 4CJFA 4F9OA 4C1NK 4DPYA 1YQHA 4C7QA 3G86A 3FSXA 3QJLA 4J7CA 3C7NB 2PI5A 4PXDA 4FM1A 5TKWA 1YJTA 1S5JA 5D4NA 4AHRA 2U1AA 4JK7A 3TVKA 4CH0S 2A5XA 4C8NA 4PKDB 4GVBA 4ECYA 3MPVA 4WFNQ 2W8KA 2C3PA 1S57A 4Z4FA 3RSEB 3ZZUA 3V81B 3D68A 2G9OA 3UPFA 1F9EB 3B6OA 4ZP8A 3EVWA 4DCHA 3BPSP 5LSOA 3D3CJ 4DR2F 2ZM6J 1U1MA 2CDQA 1AT1B 1ASUA 3LP3A 4NLPA 3KFWX 1NRKA 4JI4F 2E1MC 3WIUA 3V9XA 3HKZD 1RBTA 1LV5A 1ZM9A 3LW5C 1DFDA 4F2RA 3IRWP 2QRRA 1N33K 1XR6A 3W2WA 1SH2A 2UUBK 4W4MA 5D0RA 1TP7A 1TAQA 2CXEA 2N7CA 3KWMA 4TU7A 2UVVA 3CJ4A 1X0FA 4ETZA 5LL6d 3AO5A 5BR8K 2J0XA 4UY8T 3E9LA 4FWKA 1S1XB 4S0MA 1Q9XA 1ZZFA 3WXIA 3V4IB 2WOMA 3CC2S 4C8ZA 3FZMA 1D0EA 3P96A 3TA2A 3OYEA 3MM5B 4J9PA 3RSEA 3AVNA 3UCZP 3AXMA 3PIPL 1BD6A 4I56A 2KQ2A 5CYMA 1CULA 5HATA 1U04A 2KW4A 4I6WA 3UFCX 4PQAA 4G65A 4EZ9A 3SPYA 3ZXWA 3DOKA 3U3YA 4OLAA 3MEKA 1CC8A 1Q82O 2BRKA 2M3DA 4O5FA 4RUCA 4FW1A 1TUWA 1IM6A 4LIRA 5A8RA 4YY3K 2XO7A 4CYUB 1EKRA 3CGIA 1BG3A 1VQKN 3W9HA 3TAMB 4PXEA 5C42A 3AVLA 2FUG9 3MOJB 2CGJA 3AA5X 3SCJE 2MKYA 4FLVA 5FROA 3OYAA 2V51B 2HF3A 5AJ3F 4ECZA 4L76A 2UXCK 2XLIA 1RTHB 4E1MA 3OS2A 3LP1B 1WEXA 1KP6A 2ERRA 1RKIA 5M1QA 4B3RJ 4JI6J 2C2NA 3RBDA 1HPZA 3D2EA 3M6VA 3OL6A 4GVMA 4IR1A 1E6VB 1O8BA 3KK1A 3VF4A 2EK6A 2RDDA 2E1RA 3SPZA 2H1YA 3MM9B 4C97A 1TL3A 1HJOA 1LXJA 3O08A 3CD6S 2CQ2A 3GJQB 2RF2B 2X6SA 3DLJA 5D0EA 1J53A 3BGRB 3M8QB 3ZC4A 4OI1A 3UQSA 1X9JA 1P9YA 4U9RA 2NZCA 4EFHA 1I3OB 5LM7E 2PC6A 4HL9A 4FPRA 4HI2A 4OV6A 3PJ9A 3KG1A 4G3IA 4UT4A 1P6TA 2AKWB 2XSFA 2FLNA 1VQNN 2MQLA 4Y2CA 4JI8F 4B1ZA 1N33F 4PWDA 1A5XA 5K5MA 3D2FB 2R7WA 4OX6A 2ASJA 3SJHA 4GNIA 1CZAN 2KZMA 4PY5A 2AP1A 3DLGB 4P9SA 3BN7A 3C3LA 5A8WB 2VH7A 4DJBA 4A8KA 2JFKA 1YBUA 3TWZA 3ZNJ1 3VENA 2W4DA 2SXLA 4FYWB 4F3MA 4CFAA 4DV3K 3R3LA 4NLTA 3LA0A 2YQ1A 4J91A 3MMCB 3SQOP 4DV0K 5IC6B 3ADAC 3D3BJ 2DY9A 2WONB 2D0CA 4IOBA 2XMTA 2XHCA 2OD4A 5AZIA 4ED5A 4KH0B 1F9FA 4DR7K 1X4EA 4MKYA 2BDPA 5KFRA 1NGFA 4AL6A 5J2QA 3MI7X 5EX5A 2LDYA 3TANA 3AQPA 1N48A 1DLOA 2DNGA 4EFAC 2G2OA 1APSA 2R3VA 1Y5NB 3ENHA 4TXSA 3M8RA 3VQPA 4DV5F 3VQBA 3FEZA 3LO3A 5AJ3K 2UUWA 4OX9K 3OTOF 4B3SJ 2P9UB 3OTEA 3BS9A 2DH9A 1WTFA 4LVOP 2FBTA 2EFOA 3R5DA 1J5OB 2W7AA 4K59A 4K4TA 1N52B 3M8YA 7AT1B 1H6KX 4QIWD 1N32F 1X0PA 2V4RA 1OY6A 2AT1B 4ZLNA 5A0YA 5HSPA 3GSDA 1N32J 4WF9L 5EWEA 1I94J 1F60B 1RT1B 2OTLN 3W0LA 1W2BM 2LXUA 3KJQB 1P9QC 3NHGA 1HX1A 3GILA 4EYHB 4O3PA 4RW6A 1BQXA 3KNGA 3LGMA 4DUYK 1HNZK 3S3MA 4ISGA 3DRRB 1N5QA 4GKJK 3AFGA 4RWTA 1YBTA 2YKMA 3U02A 4YY3J 2RHQB 4RW6B 3G6ES 1TL1A 3FRYA 1TMMA 1FDBA 2BJ1A 4FLXA 2FD2A 4KB1A 3UDVA 4DUYJ 2AX0A 4LF5K 3CJBA 3CJCA 4K7QA 4CIOA 3J7AN 4PG7A 2W24A 3TUPA 2VC1A 4DQQA 2AJ0A 3EGZA 5KG2A 4W92B 2K3IA 4KI6A 4Q0BB 2RVJA 4CZMA 4I2QB 2LP4A 1JMTA 3H3NO 2W9CA 5H1SQ 1QAXA 2CZ9A 4M3UA 3W66A 3OFHA 1HIYA 1U1LA 2BKOA 2NXNA 1K1SA 2CVEA 3VGSA 2AJ2A 1HNXK 1B7YB 5FJ4A 1R8HA 2VG6B 2XO6A 1JL1A 1Q4RA 4O8KA 5F8JA 3IM9A 5IT9O 4IH5A 4RBTA 4NXNK 3A3NB 4DWIA 2HWIA 2FIUA 4DR6J 5KFAA 3HZGA 2K1RB 2HVZA 5L8RC 2CQGA 4J9LA 1C0GA 4NLGA 4HHTA 3SBMA 1FE0A 3WNGA 3EEQA 1HR0J 2VHGA 3K8WA 1S9GB 2LA4A 1G1XA 3IA0A 2G8IA 1FDDA 3OY9A 1U48A 2ASDA 1FJCA 3VA0A 4JS4A 4EHTA 3UN3A 4B17A 3KNAA 2IA0A 1VIXA 3T1YK 1QAYA 3T5JA 4ZVQB 2DGUA 2O8DB 4NZ0A 2MLYA 1HYSA 1RT4B 1U1OA 2J5AA 4FLYA 2XYPB 3J80U 2XMKA 3HHLA 5CCMA 3A5MC 1K0VA 3PIOL 4CJLA 2DFEA 4CGHA 3SAFA 2YH1A 1KNZA 4ZKAA 1SKRA 1FJGK 2L41A 2CRLA 2BRLA 4CDIA 1ULRA 4X4NA 2CWKA 3G87A 2JLGA 1GXTA 2EVZA 4CIFA 1V3ZA 3UKRA 2CZ4A 5J1NA 3WT0A 2CPDA 2MMYA 1HBOA 1RCXB 2GUPA 3AJDA 4EHUA 4FOEA 3K5LA 4PR6A 4Z94A 2P9EA 1S99A 3ITHA 1UW9A 1AFJA 2HNYA 4CT8A 4FP9A 2DO0A 3CCJS 1RA6A 3HM8A 4AF1A 2IDEA 2DEJA 1HRHA 4HUFA 3DLRA 1RTIB 3KK1B 2E44A 3V9UA 2OANA 4NYZA 3C6AA 1K8KA 2WSCC 5KG1A 2DR5A 5HVGA 4ILHA 3I0SA 3HZEA 2EK1A 1J5EJ 2Q1LA 3CCRS 2B7CB 2QWQA 2A0FB 5GAHU 1RT3B 3DYAB 4DV7J 4R5PA 3UKUB 4CEAA 3U7JA 2ADCA 3P49B 2VONA 1LFPA 3RRKA 3U1LA 5F9NA 1ZBLA 2FC8A 2JHEA 4MMOA 3BP8A 4UTGA 3KHLA 1DT9A 3AAWB 4CYUA 3N4PA 3T1HF 3M4XA 1S72N 2XY8A 2FJWA 1Q86T 3IFRA 2Q36A 3FMBA 4TQSA 2OPRB 4WWSA 4KRFA 1T03B 4LRFA 3O1WA 3N6NA 1CJKB 4FVCA 3E01B 3EX7B 4EK2A 1I94K 2V8VA 1M5OC 1K47A 3M8ZA 1NGAA 3TPQA 4OQJA 1V3RA 4LF8F 5DO2A 2NRXA 3LH2S 1CQNA 2FHOB 3FFIA 2V4JA 4TY9A 5BREA 2KM8C 2FTRA 2HHWA 1CZ9A 2BW2A 1OO0B 3IBCB 1PILA 3A5LC 1T9YA 4C23A 4RNHA 4O4GB 4LF5F 3RB6A 2ZC3A 2NREA 3J7ZO 5KT3A 1KHWA 1IV0A 4LFCF 1Q79A 3HJVA 2WFBA 1FX4A 4X66F 2W9CB 4LFBK 4KFBB 4Z2XA 3CCWA 1RACB 1RDAA 2IA6A 1WAJA 4F0MA 1DQ8A 5AQFA 2PIIA 1Y4ZB 1GLAG 4U67Q 1N4LA 2VQFJ 3EY1A 3AD9C 4QR0A 3Q2TC 1HLUA 3E3XA 2EBGA 3D6RA 2GHVC 5D4LA 2CJAA 1ZTTA 2E1CA 3OXFA 5L1KA 2W01A 3IWNC 1TL7B 3US5A 1S0VA 3Q89A 4N76A 1FKPB 4P75A 2F9DA 4CO4A 3KWGA 4PAAA 2J4RA 4CHNA 3PO5A 5KOXA 1ZTWA 4IR9A 4KH4A 1EETA 1DHMA 1QM9A 5L46A 1S9FA 3QSYB 3AB4B 3G10A 2NCKL 2P9CA 1SCJB 2ZDPA 3M2VA 4O5BA 1RDRA 4RW8B 1NEEA 4JKGB 3AA9A 2P9SA 3MX2A 5BXIA 4DUZK 3POTA 2MQNA 1NGBA 2M0GB 3AARA 1SBRA 4IZ9A 1OKJA 1LK7A 2QN6B 2KVIA 3GYGA 4U7CA 1HD0A 4M5IA 5BPMA 2KI2A 1RT3A 1H2VZ 2HZAA 3PEJA 5CXTA 2FSKA 3BGRA 4WZQA 1NBEB 4WQ5C 2CJKA 2AV5A 4B9QA 2HIQA 4A8YA 3G25A 4Y65A 3M9MB 3C16B 4R8UB 1HNVB 3PLAA 1UPPA 4J9MA 2FF3B 1LWFA 4J2EA 3PR5B 4IRDA 3CCTA 1NJWA 3C66A 3L2UA 4MIWA 5AQWA 1AYEA 2HBMA 3T1HJ 4ZLJA 1YI2N 3B54A 3UVJA 5EWFA 4AHSA 4K4ZA 3A4TA 4B9UA 3H08A 2DR7A 1KVIA 2CQPA 2IYIA 2HS3A 2P9UA 3KDOA 3NBPB 1I39A 1PAUB 4CCHA 1GFWB 4UUWA 3OS0A 1WG5A 3NGIA 1N34K 3LL3A 1L3TA 5GAHP 5KFHA 2CQBA 4NXMJ 3KD1E 2BJDA 2UV8G 4DTOA 2QE5A 3S3OA 1SH3A 1NM2A 1T6DA 2Z56B 5D6GA 3G4SS 2MHEA 3HHDA 2J0QD 3ULDA 4DXLA 3BDPA 3PTWA 4YOEA 5JVGQ 4C8MA 3O4WA 2CPYA 4H0XB 1XN9A 1LW2B 4OJRA 2JNJA 5HBMA 2VPXB 3HSGA 1RDCA 3VAGA 1R43A 1VQ6N 1CJTA 1N88A 1WF2A 3CVKA 3CCLS 5RUBA 4K5SA 2XMVA 3CC2N 4GKKK 1UKUA 4UOCA 3RTVA 2XZTB 1IBCB 2K06A 2PMZD 3ULEA 3O3HA 4AE5A 3QT5A 1NB7A 3MM5A 1N32K 2XHBA 3MR6A 4DTNA 4HACA 1UJ4A 3NFAA 2J7WA 2V2KA 3H7HB 4TY8A 4V19X 3VV2B 4FXDA 1VQ8S 4CJWA 3DU6A 4ECSA 2QL9B 2XWXA 1CS4B 5BYSA 3ZSZA 2XSJA 4I64A 1XMQF 2PFDA 4Z4GA 4AUKA 4CM0A 3CD7A 2D1CA 3M8QA 2VJVA 2Q66A 3E9PA 2HGLA 4IOAL 4H4OA 1H2TZ 2QT7A 1JB0C 4DPUA 4ZVTB 4JI3J 2K2PA 4PRFA 2HFZA 3PVXA 3G6YA 3MM9A 3C6TA 2IRUA 2BJ9A 3AVIA 3KK2A 2ZOMA 4ZCKA 1MMLA 4MO5A 5FPNA 2DBBA 1W7AA 4HEA9 4NLSA 5J1PA 3IG1B 3J81O 1GMWD 2KL8A 1IKXB 2QMWA 1UWBA 1N5YA 1KAZA 1HBMB 1FI4A 3VQSA 2ATCB 3BQ1A 4FJJA 4NLYA 1RILA 2RKIA 1EQMA 2DPIA 4LUBA 3UWTA 3CE8A 2EG2A 1YJRA 4P73A 3F73A 3O5BA 2GCFA 2HZCA 2BVZA 4CJ4A 5EN1A 3R5AA 3BDEA 4I4BA 5BR8F 4A59A 4USHA 4DV1F 4K25A 5LMUK 4E89A 4JHDB 1FNXH 3O1LA 1FWPA 1FKAF 2JOQA 4NYPA 4DBQA 2WTUA 1DTQA 2DGVA 3VVUA 3VESA 1WWHA 3IAS9 1U2VA 3QGPA 2UV8A 1X4FA 3FCWA 3KLGB 2GS8A 4USUA 2V2VA 3VQEA 4DSKA 4EO8A 1WF0A 1NGHA 4FJNA 2FQQB 3JAMO 4O3SA 2E4LA 1N5SA 2F7TA 3CCMN 4MLHA 4OYWA 1FKPA 1MWMA 1UOCA 3R5CA 1MW7A 1Y11A 5DQHA 2I38A 1FDNA 3FUYA 1RT5A 3FZFA 4CHOA 1WHXA 2OLWA 1YTAA 2P5OA 1I94F 2YKQA 3AVAA 2QYCA 2ACMA 3C14B 3QIPB 4NEYA 2A42A 4JD2A 1QQNA 1WKJA 4ZOSA 3TAGA 2GMHA 3T1HK 2VASA 5T7BA 3EZOA 2EC0A 1FNOA 1SJRA 2KJVA 3SFGA 2NZ4A 3O80A 1B9FA 1NPKA 1GTEA 1HHQA 2YWWA 4NLDA 4ZIVA 4DV0F 4KYZA 3CJ5A 1PC5A 2HOEA 4MIAA 1E6YB 3VTIA 2IOCA 1I6JA 2PY5A 2BE2B 3GIKA 1RAAB 3LDOA 2KG1A 3P4UB 4YR3A 1RU2A 4NRUA 2HPUA 4USMA 4K4SA 1ACMB 1EQYA 2F96A 3NS7B 1F1BB 5D0GA 2OEMA 3L7UA 1IBLF 1HBUB 1WSIA 4ZJLA 3M6GA 3Q8SB 4Y6IA 3ZZZA 4DLGA 2HBYB 4JHDA 2G0IA 2ZH5A 5EVZA 4EP4A 1FE4A 4GKKF 2YV0X 3NS6A 1RBRA 1OH6A 2QIFA 4KQZA 2XI3A 3IFEA 4GV9A 4OI0A 3WXMB 2Y1JA 1DAXA 3FVYA 4Y2IA 1BCMA 4NYOA 4OHWA 5DMRA 5A2QY 2RKIB 3KJVA 3CMES 5HBMB 1SC6A 4DDFA 2I1RA 3ZCMA 1HNIB 3TSUA 4NI2B 4JUZA 1ZPVA 2APOA 1MWZA 1FESA 1KONA 5AXNA 2CPIA 4YOXA 3MMBA 4BRKA 5I3UB 3RBEA 4QYZJ 1GMVA 2Z8QA 2AQ4A 4Y34A 3V9ZA 2KJWA 5L9NA 1S72S 1QHTA 1FJGF 2Z1IA 2XY5A 4EBEA 1U2FA 2HGMA 1YAGA 5AQZA 5C25A 3RB4A 2R7OA 4WXWA 4FJ9A 1WSJA 1Q78A 4LJMA 1YIJN 2CPHA 2NNWA 3VQCA 1MN7A 4M8LA 3TR5A 4BWJA 1S22A 3CYMA 2IIRA 2C2KB 4Y2MA 3HT3A 3FJ2A 3EPIA 1KC8O 5KFTA 4H4MB 2X1BA 5GADP 2VPWB 1RBOB 1FJGJ 2O4IA 4LSZB 3PYEA 4YQWA 3OPKA 1VSLA 4CTAB 2VJUA 5L39A 1J54A 2KRBA 4K4XA 4LFAF 3JTOA 1YHQN 4U8VA 3AVMA 4JI5J 2KYZA 4BC5A 2AJ1A 4RW7B 2D3OR 1XHZA 1X4CA 1VC5A 3DDNA 1U6ZA 3MUMP 2IVFB 3V9SA 4OYMA 1NZAA 1A5VA 4CJ7A 1XMQK 5EX3A 3D4JA 4PPDA 2DR8A 2YWGA 1MNEA 4CHPA 4DTMA 4JI0K 2NR0A 3FGVA 3LP2B 3VQ8A 3LGHA 1WELA 5KAKA 1NSAA 2YNHA 3ID6A 1AUSL 1PBAA 2HS0A 5ETOA 2RH3A 3M1VA 1RT2B 1GAOA 1IUJA 4X62K 1KFSA 4H8KA 2VFSA 4MO4A 4DCPB 4JEPA 4O44A 4YHHF 2EFPA 1PYSB 5KFKA 2CH5A 2FJDB 1P1LA 2JWNA 3EXCX 3D2WA 4CP5A 3NS5A 3Q22A 4DHVA 1OVQA 3CJTA 2CGKA 2R4FA 2H3EB 4BE1A 2V4QA 1LWCB 2K1RA 3JTNA 4O4GA 1WC4A 4DV4F 1ZAXA 1S0OA 4JKCA 3BEGB 2A6AA 2MJNA 1KFDA 1ZA2B 5JJBA 1RGVA 1H98A 1U26A 2VA3A 3OBWA 3QT6A 3JQKA 1NHKL 1W26A 3PKYA 3L2QA 5F8MA 2BMBA 1VJQA 2VOPA 1FCAA 1RQ0A 3MM7B 2VA2A 4KHMA 2YX6A 1MWKA 1ASWA 5J2NB 4E7IA 2NSBA 4WIQA 2AGOA 3CDBA 5BN8A 1AW0A 3C8YA 3SAGA 1XR5A 2UXDJ 3ATVA 4JV0A 2XI2A 1MROB 4LF7K 1CJVA 1EIYB 4NASA 2HKEA 5D78A 4LQ3A 2GAHC 2HK3A 2QXLA 4IDKB 3TUZC 5LJ3Y 3SCIE 1BQNA 3BM7A 3IP0A 2MSTA 4M5HA 4Q7AA 2E5LK 4ELVA 1VSDA 2WHOA 3EZUA 1GH8A 3T69A 3Q23A 4URSA 3KD5E 4DG1B 4FJ8A 2EWSA 1W9HA 3RU0A 3LALA 2HRTA 5D4PA 3RG6A 3EMTA 3ULHA 2JL9A 4FS1A 4KHPF 1RWXB 1VQ9S 1B70B 1JNZB 1Y9OA 2GX8A 3QEPA 5HRRA 2IBOA 4ER8A 2DTJA 3DFEA 3L4IA 2I6WA 1HKCA 3CNQP 2VQFK 5JICA 3L3UA 3J7Z5 3G8QA 4KSEB 4NLXA 1RWVB 2Q43A 4OLBA 5SZTA 1EAYC 2DYAA 4NLUA 2C3UA 4WIIA 3QFUA 2RDIA 1CS4A 1X9SA 1G6BA 4Y0FA 3IR5B 2CPZA 1IKWA 1S6UA 3MM8B 3MPYA 2HMPA 3UD5A 3ZLJA 3JQJA 4XK8C 1N33J 2HNYB 4PG5A 2PMWA 1AB8A 3VA3A 4O4RA 2R7RA 1GOBA 2W2PP 1HWIA 3OLAA 1TK0A 3D45A 3JSMA 5AR0A 3MK6A 2YJFA 2X78A 5I3PA 5FD1A 4NA1A 4LFBF 1FKOA 1ESVA 3D1QA 1NDLA 4JP8A 2V0NA 3EN9A 1NJZA 2MYFA 4F0HA 2D3UA 1TR0A 5CHIA 4NEZA 2OPRA 2R7SA 4DS5A 4JYAK 2JEJA 1CBKA 2Q79A 3G71N 3ZTRA 2IVMA 3MAHA 1OY9A 4B3RF 2PBDA 2C3MA 2HMIB 3CEDA 3PXGa 2MEWA 2R8GA 4GW6A 3MDQA 2NZTA 2N3LA 2LECA 1AUDA 3BH7B 2JH3A 5AJ3J 3W7BA 2IM3A 1K44A 1UTAA 3UI3A 3BGLA 2HQCA 4DZDA 4CD3A 4AYBD 1VQ9N 1GOCA 2ZC4A 5KFFA 4EBDA 3UNYA 4K42A 4BC4A 1KOHA 4CERA 2BABA 3QFWA 4PG4A 3U9ZA 3K9KA 4O0JA 3OJUA 3CJ2A 3KOAA 1C6VA 1QSLA 1R0AA 5KFIA 1PJ5A 3VVTA 2ASYA 5IV3A 5KFYA 2XYHB 1TKZA 1IBKF 4ED4A 1Q8KA 1QJHA 4KTZA 4CZKA 4LRDA 4MKAA 4JI2K 2O01C 1J6ZA 1EX4A 1OMSA 2AJQA 2M70A 4BRCA 3AY9A 4IXCA 1KLMA 2M88A 3N0VA 3ETMA 1C1CA 4FXVA 2LEAA 1RJJA 1QLNA 4M3WA 4J9RA 3LP0B 1U02A 3FNNA 2RU9A 1QE1A 2HMIA 2VB6A 2WW8A 4I9QA 5I42B 3MCNA 4TU9A 4L3QA 1GMWA 2I5JB 3UKRB 1YK9A 1WSVA 4KHRA 1MSWD 2ZVSA 3DCAA 3MCSA 5F8IA 2UP1A 3BO2A 1U2RA 4CQ1A 5A8RB 4OFZA 4WFZA 4X2BA 2W4CA 3HP6A 3K2YA 3OHRA 3DRRA 3C15A 1YJUA 2A18A 2FJAB 2HLTA 3KK3A 2V94A 3MN7A 3GP9A 1JCGA 3HHLB 3SUQA 4FJKA 5ADZA 2N4DA 4DV6K 1IBMK 1RWMB 2RPIA 1CULB 3FBEA 3ZNUA 2HFVA 3C0BA 4JI3K 4JI5F 3OL8A 1TL7A 3WXKA 3OFFA 3QWUA 2XY6A 1HKBA 2AIRB 4PL8A 2YHWA 1BI4B 3TWHA 2NPFA 5KFOA 4NL5A 4OYOA 1LWCA 3ENBA 1N36F 4DF4A 4UUXA 2W40A 3PKMA 3SUPA 4Q5VA 4B3MK 3H4DA 3WEEA 2JEGA 5T7LB 5M2RA 1VQON 4HT5A 1TUVA 4UW2A 4OI4A 2BV3A 3HD1A 3H46O 1OSCA 5F8LA 1LW0B 3BZCA 5L1LA 1KHVA 2RRBA 2CQ4A 1X1PA 2E7WA 2ASMA 1Y5LB 4YS2A 3DGPB 5T7LA 4OHXA 2YXLA 1KLNA 3G6VA 1DLOB 2FSNA 1VHIA 2CJXB 1HNXJ 4BWMA 5J2QB 2V68A 3I9V9 3HSTB 4FF3A 5HLFA 1T03A 3JSBA 2QYGA 3QFHA 2LVWA 1T6CA 1Q16B 3WX4A 2O3DA 4ZTFA 4M5KA 2HFUA 4K41A 4MLEA 1LOTB 4K0KK 1CLQA 1RTJA 2RHSB 4CTAA 1JLQB 3KTQA 2ZZNA 1T9UA 1QVFR 3TARA 1SKUB 1N56A 3TYTA 1RYSA 1WC0A 4NZ7A 1C0MA 2HAIA 3C15B 3NH2A 1C1AA 3J8AA 4P10A 1YJWN 1SUQA 3IRXB 1CPZA 4L75A 5BYRA 1FDAA 5E3AA 3BF1A 3I56N 1UVMA 4O3NA 5CR4A 4ELUA 3T5HA 3VR1A 2BQ3A 5GADI 3CDAA 4C3LA 4ZP9A 4YOWA 3LP0A 1E6VA 3QO9A 5KT6A 3AOBA 3THYA 2AEFA 4IG3A 2V50A 4FF1A 5C5JA 4O3RA 2AYEA 3MMBB 4F4AA 1KD1O 3K5PA 2AF6A 2DD8S 1OH8A 4P2XA 2AWZA 4WU2A 3AY0A 4RJVA 3MM6A 5LMUF 4BCAA 1N34F 2D9PA 2FGCA 3CCUS 1NGDA 1EWQA 1RGIA 3LM9A 1T9TA 3C95A 4WFNL 1NBWA 1V4TA 4AD6A 2DFHA 3BKUA 2YY3A 2YHBA 2F7VA 1RSCA 4ANEA 1VYAA 3NWGA 3RWUA 3GZ7A 3M6XA 4MDBA 2MKSA 2ZZMA 3OYMA 4BRAA 3DRSB 5F0WA 1E4FT 4KAZA 2ZD1B 3KUEA 2EG1A 5KG0A 4B1WB 5GMKa 2JSXA 4Y2AA 2UUCJ 1KXPA 4J9UE 2GWKA 2IM2A 3JSYA 3CDWA 2A2CA 1RWNB 1R8CA 4LF7J 1VQ5S 5KRTA 5M1KA 3DXKA 5JS1A 4CZJA 4WE1B 3KG4A 3TRGA 4JNEA 1H73A 3BSAA 1D8ZA 4UZCA 4KHPJ 3AQOA 4B3TK 2B43A 2QGFB 1P8GA 1JCFA 4OLPA 4DV2F 5K8PA 2UVWA 1VMBA 4L72B 1S6QA 3GLJA 2HVIA 3EZWA 2GHPA 2H5IB 2W2MP 3HPGA 2KH9A 2G2YA 1SAZA 2B6AA 3I0RB 1BMQB 1KR4A 3QDKA 3NG8A 2M4MA 1KS2A 2DNHA 1K73T 2J6TA 1YWXA 2CPEA 1WI8A 4HTIA 3GE9A 4DMNA 3AXKA 3LGNA 4BRMA 5C2GA 1KQSR 4OGCA 2RQMA 2WBRA 4M5JA 3OSPA 4ZTJA 1XC9A 3KHGA 3QZ8A 2KU7A 1RNHA 3GJTB 2MQPA 1RP5A 4CGDA 3PX4A 3MGJA 4H5WA 1RTDB 2DHXA 2ATQA 3H45C 4F25A 4K0KF 2FY1A 1NZ8A 2B7BB 5DDRC 3B8AX 2NXUA 5DQIA 1Q53A 3M32B 3W9JA 4OYPA 4X4PA 3A8KA 2LQ9A 1U1RA 4DV2J 1REGX 3NGSA 5IT4A 2GX9A 4FJGA 5KPTA 5AQJA 4AH9A 1QSYA 3BBFA 4QR1A 2GV9A 1B64A 4JV5J 4IJNA 1GTHA 2Q97A 3CCEN 3KLEB 3N5BA 1BIUA 4ZPAA 1DEJA 2ZJQL 3FK4A 4IO1A 1UW4A 2Z57B 5HQMA 2HW3A 3J81j 3L4QA 3NAEA 3HTVA 2ZWOA 2D69A 2ROPA 4OZ1A 3FEYB 2FJBB 1O13A 1WEYA 2LYVA 1WOSA 3LDPA 5H9FK 3EL2A 3SCXA 3MD3A 2J6SA 2DXEA 2M52A 4H4MA 1SC4B 3ZETB 5F3TA 5HO4A 2W2QP 1RWWB 1XHXA 4YY3F 3HPHA 2IS3A 2ASPA 1P1TA 2A1SA 1DARA 5CA5A 1NCLA 1RT6B 1XTZA 2E2PA 2NPIA 1V6HA 1N5YB 2ASOA 3G6EN 4IEEA 4N8OA 1TKXB 2XM3A 2RD5C 1ZPWX 3FZKA 1T0TV 2CGLA 3E9OA 1FRIA 3UB5A 8ATCB 2RE1A 1NK5A 2KHOA 3C6HA 2BM1A 3IS9A 1LFWA 3B6PA 3DDIA 4KHNA 2YWKA 1N34J 1YIJS 1OPZA 3DM2B 2DR9A 1RWUA 2ZJRQ 4CZEA 2BJ8A 3UD3P 2LQ8A 2D7SA 3WNFA 2VBZA 2L9NA 3MXIA 5AXKA 3SSSA 4IG0A 4EIAA 5HRPA 4I69A 1HI0P 5BPLA 5D0HA 2GVDB 3RMBA 2MLXA 1NSQA 3GFYA 5FDLB 2VWKA 4KBOA 3HLUA 3JS6A 5DDPC 4BROA 2WBMA 4DV5J 4WQ4A 4F4YA 1RDBA 1SL0A 4FVUA 1S5ZA 1EP4A 3CCZA 3BYRA 4YDDB 2AGPA 1C0UA 4P7TA 3BV8A 3H3OB 4ID8A 3NGDA 2A3JA 4YOYA 5KG7A 4N47A 2C2DA 3R27A 4U8YA 2HHTA 3FKBA 4J37A 1AA1B 4U67L 1K1QA 3OVBA 2DNQA 2KT3A 5E0OA 2XCAA 2GFFA 4ZVGA 1WHWA 1VBYA 4DR6K 3DOLA 3ZFVA 5LJWA 1XR7A 4BRIA 3OSNA 3PFEA 3EM1A 1YITN 4F4ZA 4JI6K 3SMZA 4I7FA 4PXCA 3TI0A 1ZM4A 2M8HA 1FRLA 4JD2B 4DR4J 3O8WA 3ZZRA 3AOAA 1F5BA 4IH6A 4KHWA 5A2QO 5HVFA 1NU0A 3HVAA 4YNQA 4DCJB 3VEVA 1DRZA 3PY8A 4YUDA 3OYBA 1NK6A 2FHJD 4RW9A 3G9CA 3DKDA 3OTCA 2IJRA 1TUYA 1PIEA 3MX5A 1Z2ZA 4N56A 1ZBHA 3A13A 4NCBA 2MTLA 1QVGM 4QJVA 2VFRA 4RW9B 1NO8A 2GJIA 2OPSB 3SJJA 3NMRA 4L3NA 1JKHA 4OI3A 4OO1J 3CCJN 3DOLB 2DK2A 4F02A 1EXQA 1Y64A 3F0NA 2GQCA 4X65K 4KT0C 1M5VC 2GGPA 4RZRA 5KFBA 4LF5J 2OTLS 1Y5IB 3MZIA 4B1UB 4LBPA 3PR4A 4E0DA 2IRYA 2HBJA 3OR2A 3BY5A 2P1JA 1HNIA 4OJ1A 4HCBA 3THTA 3D5MA 4JV5K 2CPXA 2VPYB 2H4YB 5EDWA 4CLPA 4LF8J 1N5TA 4JYAF 3WQUA 2BJ3A 4K4YA 1R3NA 4NB4A 1IR1A 4FPAA 4DTUA 3TR8A 2P9NB 3NDKA 1Q86O 2A40A 2GJFA 4FVMA 2CQCA 1VSIA 3D1OA 1HYVA 1WTBA 2NUBA 2MKIA 3R9PA 3GG0A 5B8HA 3OYJA 4CO2A 4LF8K 2D3O1 4WYBA 3FRZA 5DG7A 2OTJN 1XMOJ 1WSRA 4P2MA 4X4VA 3DLKA 1SV5A 4ID1A 3WXLA 4KGKA 4E7HA 4HH0A 2K7KA 5E7OB 4JV2A 3QLHB 5CD4H 5MLCV 4IYQA 3CC7N 1PGZA 3PCOB 4FWMA 4EGLA 1CZBA 3ZX0A 1E3MA 3GOIA 2LQ5A 2RS8A 3W64A 5KFVA 3CT9A 2C3OA 1R6YA 5DZ6A 3O1BA 1S12A 1NH7A 1DTTA 3PIOQ 3I8BA 4U96A 5KFQA 4K50A 1LXNA 1X4DA 3TJ8A 2W6LA 4ECTA 1RAIB 2QM1A 5IT9Y 3W62A 2HSTA 3L4BC 1G3OA 1S59A 3PJXA 2QKKA 2DKOB 1AROP 4H54A 5AFUA 2ZZTA 4JK9A 3VZIA 1H38A 2D4WA 4OZLA 4R8UA 4C2MA 3QRPA 1ITPA 2CDRB 1S0NA 3FCHA 1Y00A 5HMWA 3TX0A 4WFYA 1UMJA 2WVEA 2KFYA 3B4DA 1VQLS 2PI4A 3QSIA 4F50A 3J7YU 4LSLA 1PJ6A 1VJWA 4OYZA 1BA1A 1X4BA 1S79A 5BYQA 1TV6B 2BXJA 1GK8A 3CCRN 1FJEB 3W63A 4NLBA 4DX6A 1KCFA 3HHEA 3RYLA 2E5LJ 2MKHA 1BY9A 3F44A 3R97A 3THVA 3QESA 4KV8B 4QW8A 2AD9A 4Q2LA 5HL7Q 1YZ7A 2BKPA 4RU9A 5IQ6A 4CZHA 1RBVA 3FLCO 4YR2A 1HWLA 3QERA 2B56A 2XHWA 3MFIA 2R7QA 4J8FA 3VEXA 2FVCA 3OYDA 3ENVA 1MU2A 2KHDA 3FSYA 1YRXA 4PZVA 3EZ5A 4FZXC 1KLMB 2P9PA 3B6BA 4J9VA 4CO0A 5HOOA 2VOOA 1UVJA 2RQKA 4X4TA 3L8BA 4IFVB 2YNFA 1VQNS 4LFCK 1TKZB 2IM1A 5IT0A 1Q81T 3WDOA 3KHRA 1OH7A 4ILMA 3HM9A 1MWYA 2KB2A 1R59O 4NYFA 3K9JA 4OZNA 3GMGA 3OBIA 3KLFB 4HR2A 1T7PA 4H4OB 1WI6A 3NMAA 2WAQD 4C8YA 5AQUA 4FK2A 3ENOA 2HFOA 4BDYA 2P9IA 1LNQA 3BREA 2E5LF 3OFGA 3OYNA 4CGIA 4E98A 4ZCIA 3BB5A 1UA1A 1D09B 3AJ1A 3S01A 1VI7A 5KFGA 3FBCA 3HHLD 2YNGA 1HBOB 4WFAQ 3NXZA 4O0NA 3HVTA 3QAUA 3IBFB 4CEFA 4DSLA 1XNRF 4RW8A 1YSJA 1YVNA 1H7WA 4FJXA 3IR6B 2YVSA 2FXUA 3IM8A 4C9DA 1MWQA 1NNEA 1VSJA 2GNKA 1TKTB 1GLJO 1VBXA 4M3RA 4USKA 3O6QA 3AAPA 3NGUA 3HFZB 2MZ1A 4YFUA 3RB3A 1RAHB 4FYDA 4PA1A 1WOPA 4FDFA 2WVDA 5HROB 4MFBA 2ZITA 2CWXA 3ENAA 4M45A 3ZX2A 2FC0A 5JXSA 2HF4A 1U0HB 4CEZA 3DU5A 5K20B 3JB9k 2V8PA 4Z4IA 2XLJA 3DRSA 3HSDA 1I51B 2XWYA 3T9ZA 1VQ7N 3Q8VA 3LPEA 4P6QA 1YVUA 4KO0B 2GW8A 4F7VA 4FLZA 4BRPA 2UXBF 3BZQA 4BACA 3ZZYA 1NUEA 4IQMA 2DRDA 1KVCA 1JCEA 3VGVA 2OSQA 4O23A 2YWEA 2WUSA 2IMWP 3VGMA 5M1NA 3KKRA 1U2CA 3UW1A 3SCKE 4B9VA 5G4DA 3MEEA 3M5RA 1X7VA 1VSKA 2KFNA 2Z1HA 1FNMA 2B9WA 3DAWA 2HNZB 2DXDA 3LAMA 1RYRA 1Y97A 4ZVUB 1M1KT 4CJ5A 1WBBA 3O2IA 4TQRA 2FZKB 2XTJP 1JJCB 2DHAA 4I67A 3KLEA 3MMAA 3NGZA 1FXLA 3NE6A 3M05A 4DU7A 3PSIA 4OJ3A 3CFOA 4DR5F 1UJ6A 5KG5A 4JI1K 3N4WA 1NLVA 1OPIA 3R1HA 3POTB 3GCWP 3PV8A 3MMAB 4OKKA 4DQSA 1RAOA 1MROA 2J76E 1JLBB 1SKWA 1BA0A 4NO7A 2FJXA 3Q7CA 3F41A 4KGZB 3ZT1A 3V1RA 1IBLK 4OZ2A 1N54B 4H5VA 2UU9J 3UN2A 3CI5A 2WSFC 5ETLA 4M5DA 2F8EX 4XDCA 3GFHA 1JXEA 3MM7A 3IKMA 2MGZB 2VQEJ 3PJWA 1RCHA 2EFQA 3CJQA 3A8JA 3OR1A 4RTFD 4E7JA 3P45B 1F0XA 1DGKN 1H74A 3ICLA 1CG2A 3H40A 2RNEA 4BE0A 1JNRB 4DUTA 1TUGB 2Z2MA 4A46A 3A3PB 2JVRA 2WONA 2QMXA 3CJ8A 1KQKA 1VK0A 3Q8YA 4AT1B 3WC0A 2RE2A 4CJPA 2Z30B 4FBUA 2PZSA 4AHCA 4Y1CA 2G8WA 1NWKA 4KB7A 3CCSN 2KVQE 3DGVA 5KT5A 1ATRA 2HBZB 2QA2A 3FDSA 1CJKA 1RB0A 2CIMA 3IMQJ 4FWOA 3SDEB 1FRJA 4FYVB 2ZH2A 3MN5A 5ETVA 1U0HA 4DV4K 4EP5A 4QBUA 3NOCA 3SXLA 4Y3CA 1VK3A 4CK3A 2X1GA 4DR3J 3IUCA 1NDCA 1T3NA 4CIGA 3SUOA 2MY8A 5AT1B 3T9NA 1FERA 1HYSB 3HD2A 5IV4A 3HPOA 2FVQA 1NDPA 1ATNA 4KHPK 5AZJA 2B9XA 4BRNA 4QAGA 2EPIA 4X4OA 3KLIB 5B0EA 1FEEA 4XIUA 4JI0J 5GMEA 1HI8A 3IWXA 2POKA 1SZ2A 3H2VE 4BE2A 1DY3A 5AE2A 5DM6Q 2XC9A 4Z4CA 3HT0A 4OKJA 3U8XA 3WBZA 5K14B 2PT0A 5HL7L 5BPNA 1R8BA 1IG9A 2H5EA 5LT5A 4B9TA 2E9RX 4LH5A 4ES2A 3ZO7A 1T9WA 4M3TA 1WLJA 4ZS6A 2ZH7A 1VCTA 4DX7A 3PRDA 1JLFA 5A8KB 2GAGC 3KVGA 4Z7YA 3H2UB 3V1QA 4KE5A 5LMNJ 1WB9A 4LFBJ 3CJSA 2NLXA 4ECWA 5FLXO 3M2UA 3O8MA 4IUFA 5D8HB 1V3SA 1WDDA 4JI2J 1IJJA 1EJ7L 2FBXA 4DR7F 5AQRA 1U0SA 3AB2B 2XGQA 1FX2A 1SQFA 2ZKUA 2Z4PA 1R8PA 3VQ6A 2GIRA 3D0PA 1PC4A 2OUGA 2HURA 3HBTA 4H0YB 2IIHA 2AEMA 2QFIA 1TL5A 1YJ9N 2NRTA 4KH5A 4KHQA 2IYGA 3QGHA 2DNOA 1N0UA 3H20A 3CJ7A 3L7PA 3JYTB 1C1BA 1T94A 2R8JA 1WSEA 4FCYA 3I55S 2CNOB 2LQJA 1MU2B 2VBXA 3TEGA 1VDHA 1FXXA 2HK2A 2GWJA 3G82B 3W2VB 2X6NA 3OS1A 3J7YI 3MEGA 4CGGA 4NA2A 4MYTA 3OV7A 1O0PA 4B3OB 4WYLA 1HJRA 2VIHA 2C1EB 1FA0A 3MAAB 4RUAA 3ET6A 1KOOA 2ETJA 1S4FA 2QEXS 4QPXA 5J2PA 1VQ6S 2CJ9A 4WTYA 4DKWA 4O8UA 3TP2A 2CKWA 2HEKA 3ZZPA 4JKAA 3F2KA 4ED3A 3R2CJ 5E3CA 4KTWA 2BQRA 4DQRA 2EW9A 4C0HA 3L9ZA 4X84A 1LEOA 1N8RO 1CJUA 4F26A 4QWBA 3ZTPA 3HVTB 3VTHA 2CADA 4DZ6A 5M1OA 2YNGB 2PN6A 1S6OA 1VQPS 2R7YA 1FRXA 1TYQB 1JWWA 4GMJB 2UUCF 5HVHA 5IT9U 1RAFB 3CQ8A 3MXHP 3VF0B 2BJEA 5L38A 2YPYA 4OYBA 3MN9A 4MT1A 4IG0B 1SC1B 2P9GA 2HHSA 3ZSXA 3MR7A 3ETOA 4CHZA 3SUNA 2G4BA 3OR1B 1X3NA 3M6WA 4ZCMA 2CA9A 2AA4A 4ZN1A 1XNQJ 3CXCM 2QG9B 1SH0A 2GEMA 1FXRA 2QSWA 2ZH6A 3T6BA 4C4WA 4NLQA 1UZHA 1HHSA 4WFBQ 2Q6BA 5B09A 2V8GA 5AQOA 5KG6A 5KPZA 5G0RA 1NGCA 3MWPA 4IO8A 1BL3A 2JRSA 4IFVA 2B51A 1H1VA 2J9EA 2R2TA 1OS5A 4AM6A 4JLHA 1TL1B 4Q43A 3MURP 2PA3A 3U6FA 4R25A 1NB2A 4B3MF 4NX9A 5LMNF 3OA9A 2DISA 1K9MT 6FDRA 2GVZB 4B9LA 4CK1A 3JTPA 2RS2A 4CLSA 4DFMA 2VYPA 3E8OA 2BM0A 3KLGA 1VQSA 3VETA 1KQGB 4M1KA 3C7NA 2MKJA 3R7BB 5CQGA 2CG8A 2KXFA 1LAWA 4C3KA 5HI7A 4H4KC 3PACA 1UP1A 3CCVS 4RBVA 2G13A 1L3SA 4BGAA 3DLEA 3M6UA 1BLUA 3QQCD 2N7YA 2JGUA 4JS5A 1NHUA 2BEFA 2Z2LA 1N6QA 1F5CA 2GGPB 3AD8C 1C4CA 3FCVA 2BX6A 3SMPA 3SBGA 3T5KA 2D0OA 1B92A 1YZ6A 1OY8A 4AHTA 3CTRA 4CNYA 1S7IA 2OIHA 2ITGA 3HF5A 3AVJA 3THXA 2BQUA 2IDOA 3Q8UA 2X3GA 1EKSA 2Y0BB 1SS6A 2NRWA 1TVRB 1T44A 2PAVA 4H0OA 3D6TB 4WP9A 2U2FA 1H72C 5HP1B 2UUTA 5EY4A 1HBNB 4A5BA 4OGEA 3HHNB 2JWLA 4ATNA 2XULA 4CJUA 5SUHA 2C3YA 4DTSA 4PYDA 2FVRA 4NXMF 4GVEA 4K5RA 2EC2A 5EHHA 1DJ0A 4BVPA 4RUBA 1JLCB 3HKWA 4EU0A 2A3ZA 4K2JA 3HVWA 2QXFA 2LLZA 2E5JA 4Q44A 1SJ1A 3WQPA 1UAWA 3GYNA 2ZH3A 2WB1D 1NLKL 2LFVA 3OVAA 3UR3C 2YWFA 2B4UA 1WAFA 4L8RB 1BWFO 3LDSA 4TVAB 4B3TJ 2LEPA 2O8EB 4ZPWR 1VRUB 4DN0A 1WC1A 2HGNA 3VEZA 4KY3A 4KHUA 3TAFA 5BN9A 4FW2A 4J9NA 2VUGA 1DQ9A 3ZEUB 5DG8A 4RUHA 3DOKB 4ID5B 1IBMJ 4MKVA 4CECA 5E2QA 3BSCA 2L08A 2IAJA 2YNHB 1VRUA 3RW6A 3OJSA 2J0WA 2MHNA 4CK2A 1P27B 5AQYA 4DR5K 4DR5J 2CNKB 2CVIA 2LCWA 3QFPA 2DCLA 3BGFA 1UCNA 1U1PA 1QDUB 2IJFA 2EWHA 4DL6A 4LF4K 1IKYB 1V5IB 4FWLA 3FZ2A 3HYFA 3PW7A 4N77A 1CVJA 4QS8A 3TX8A 2FBVA 3PRBA 4GKKJ 5C25B 1M90O 2LEBA 1H2UX 3NAHA 2NRVA 3R6MA 1EWRA 3O9RA 4TKTA 1U47A 2NUUG 1NK0A 4QWEA 2Q1NA 5KRSA 4U95A 1NKBA 1RFQA 2FYXA 3FEXB 5D3GA 1ZH5A 1KAXA 1PKUA 3LP1A 2GTDA 4OVLA 1VC6A 3CJKA 3TAQA 1NH8A 3EVMA 2P9PB 4FJIA 3F5TA 1TKXA 3LDLA 1XNQK 2ZJRL 4OI2A 2LSNA 2QWOA 3A0IX 4CF2A 2MQMA 2Y1RI 4F3QA 3I32A 2RRAA 3FR0A 2QA4G 3IGNA 3GPAA 3QEVA 3J7AP 3RRHA 1Q0NA 1QVFM 1GX5A 2OHDA 3AVGA 2QL7B 4M42A 3BGUA 3H5YA 4GMKA 3DRPA 3V9WA 4KPCA 4B3TF 1URNA 4WQ5A 4D3GA 1YLXA 2HS4A 4K2XA 4LR9A 3AO1A 4PPZA 2GHWA 4GVBB 2Z2ZA 1XNRJ 4KRWA 4YOVA 5D4OA 4BC7A 4EMDA 2IHR1 3VAIA 1IKYA 2HHUA 3EKSA 4A8XA 5T14A 2QW9A 2XYGB 3SQGB 5I3QA 3IGVA 3CIZA 3NCPA 4DV7F 3QBCA 1S3XA 1VK8A 1S10A 3SV3A 1RAEB 3H1VX 4OYIA 1KDNA 2O8BB 5J2NA 2O67A 1DZ5A 2E1AA 4ED6A 4KI4A 3DC2A 1WKLA 4LF6K 2ZJQQ 3M2VB 3KXDA 3KYLA 2E2OA 4QPTA 5DJBA 3ZZOA 1EP4B 3GG4A 1IBKJ 4OX9J 4XEIA 4RCHA 3OVNA 4C6AA 5FPDA 1H3DA 3T7ZA 2IMOA 3OYGA 3UNGC 5DETA 1J2VA 3ZT3A 2HBLA 2FSJA 3G0ZA 3G8SA 1VOMA 2ROEA 3DHWC 1X60A 5GAGP 1RDUA 5I4MA 1WN7A 4PQUB 4EI2A 2PE8A 1S7HA 4O3OA 3LM2A 3A5OC 3P31A 3K57A 2DNZA 1FFWB 3QICA 3QLHA 4J9KA 1YHQS 1ITGA 2WCXA 2WW4A 5JLFA 1ZETA 4FWPA 4HTUA 1NSKL 3C14A 1RBUA 3CQXA 4TY8B 3CWJA 3OYFA 4CO3A 1RT5B 1DBDA 2H51B 4BR4A 3RMCA 2V67A 4BDPA 1M0SA 5CY4A 1X4GA 3LP2A 3R5GA 5B0AA 3HFKA 3H8YA 4BRFA 1HWKA 3ET6B 4F04B 4OIXA 4WE1A 1BQMA 3NAIA 2GJ2A 3K2PA 2LQBA 2FJVA 3OYHA 5KT7A 3D6HB 3JQMA 4LR8A 4BRDA 2B0GA 4Z37A 2E66A 3LAKA 4A4JA 2R7UA 3TABA 4MH8A 3L09A 2RU3A 2ZD1A 4WP3A 1GLDG 3U9DA 4DFJA 5LSLA 4K0KJ 3CPEA 2ZGYA 2NS1B 3P5BP 2AHOB 3WQTA 3ISZA 1GXLA 5HN0A 1U49A 4UZBA 3V1OA 4GKJJ 2W25A 5KFMA 3CM5A 4CJRA 2I9SA 3DXKB 3M30B 4CBWA 3OW2R 5IM0A 3RAQA 2OTJS 4WFAL 4EZ6A 3N4QA 1UVNA 4LFAK 4JKHA 4ISFA 4JB8B 4HTJA 1NAQA 2H65B 3ELHA 2PMHA 2Q3PA 2YX4A 1XERA 1X5PA 3CJKB 1WC3A 3M2UB 3I0SB 4GVLA 2A6MA 4CBXA 3RBZA 5LJVA 3T6JA 1NMDA 3UIQA 5G0RB 2J7KA 4OZ3A 3QGGA 5I3UA 3I8DA 2F9TA 3TOQA 3DN9A 1YI2S 4LRAA 3NGYA 1FK9B 4Q8FA 4OX9F 1EKEA 2FHJA 1HNVA 3MCAB 2MQQA 5AQMA 1EZZB 3A8EA 2CJQA 2F8SA 3ILJA 3MM6B 4A62A 3IBWA 4A8MP 3JS9A 2W1BA 3MF5A 3R5JB 4E8UA 1ZYQA 3CMAN 4LF7F 2HSEB 2IVNA 3MMJA 2HFNA 4DMZA 1BO5O 1Q81O 3X1LB 2O5DA 3T1AA 3SV4A 1VQMS 3MPWA 2DY4A 3WX8A 5H1SV 3T1YJ 1VFJA 4GC7A 1IN0A 3GB0A 2G0CA 2FC9A 4PG8A 2ZE2B 1LW2A 1CC7A 1IM4A 1Y0HA 3KKSA 2VBYA 3I4PA 4F3OA 4WJBA 2DNRA 3BYPA 3BR8A 4K8XA 3F56A 4OI6A 2ZWHA 2I8EA 2VODA 3W8GA 3PM9A 1Q82T 4XH1A 1S97A 1L3VA 6AT1B 2NYHA 2W9BA 3ZSOA 2DNLA 4X65F 3LPTA 4P71A 3U1MA 4JI2F 4TLRA 2IAJB 2QI2A 3TZWA 3NH1A 3VAHA 4G1IA 4IWVA 3QIOA 4HHHA 4CRJA 3NVKA 1TMJA 3M2RA 1H7XA 3GV5B 5CAAA 1HMVB 2EEYA 1NGGA 5B0GA 4BR5A 2J9DA 4WTOB 2O8CB 2KTQA 2HQIA 3TEHB 4DOZA 1B99A 1VSHA 4C11B 2QL5B 1RBSA 4CZLA 5A76A 3V6JA 4B02A 5GAHI 3S41A 3L2VA 3L3VA 1PJ7A 3H59A 2H3GX 4CJVA 4ECUA 2IY5B 3QEIA 4XO0A 3CFRA 5C2CA 3HCXA 3HSJA 1KVJA 9ATCB 3D7EO 4OMFG 2A10A 3NY0A 3NCQA 3NKYA 3GQCA 1SIZA 3QZ7A 1OIAA 1CJUB 1LWEA 2MKKA 1NDKA 2Y8YA 2V7ZA 3QNOA 4BGBA 2HVEA 1TVRA 3O4QA 1IWGA 5KG4A 5C10A 2G8KA 4MK9A 4CIEA 5E41A 1SQKA 5A2QU 4X64J 4LFAJ 4JK8A 3RAMA 4CJEA 5ETPA 3BJYA 1K8AO 2C42A 1UEKA 1IWAA 2GIQA 4FPIA 4OZJA 4NA3A 4LF2A 4ZJQA 2XS7A 3RZAA 4MAKA 1JLGA 1RT7B 3DLEB 3BR9A 2P9SB 3C94A 3HL8A 5KFNA 2LU2A 4W5OA 4DPTA 2O8FB 1NJIT 2BUPA 4Q8EA 4LVNP 4J90A 5B0FA 1IJFB 2XQCA 1S77D 3IG1A 1J5EK 3ZSVA 1JJ2R 2R2RA 4UOFA 1UA0A 2V63A 1A6LA 4O55A 1A0OB 3SDEA 2RRNA 2HHXA 2PSZA 1UZDA 2WB4A 3N28A 4DR2K 3J80Y 2GVZA 4WXOA 4X4RA 2OP5A 2IJNA 3D6FB 3K59A 2AYGA 1FRHA 4L6V3 2YKNB 2Q0UA 5KPRA 1IKVA 1XK8A 3WIVA 4CJSA 2GIFA 4L73A 2ZJPL 1QZ5A 3Q2SC 2UXCF 3RUBL 4I1TA 3CCMS 4KTQA 1RDDA 4CF9A 3AJ2A 3KDNA 3KMSA 1QY7A 4KGXB 3Q8RB 1TAUA 2MLZA 2HHHK 4KO0A 1RE1B 3ZT2A