1RT4A

Hiv-1 reverse transcriptase complexed with uc781
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
542
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
total genus 147
structure length 536
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt4A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt4A05
5DK5A 1BQNA 1F21A 4WZQA 1BCMA 3C95A 1FKOB 3NHGA 1S9GA 4W5RA 4PWDA 4HYKA 4CIFA 3CJ4A 5J2PB 5HRSA 3D0PA 4FW1A 3MXMA 2XC9A 4QWCA 1N6QB 3DRPB 5C24A 3I5BA 2D0AA 1LAWA 1LWEB 2WOMA 4FJJA 5KG1A 3OL8A 4MFBA 4WFZA 2F8SA 4DS5A 3VN5A 5KFMA 2YNFB 3I5AA 1Z4UA 3UDLA 1G15A 4M3YA 3CDWA 1JIHA 3V6JA 2JC1A 4FJMA 1FKPB 1JLGB 1HYSB 2F8EX 1WAFA 1IKYA 2IGIA 4RW9B 3KK3B 3KMQA 2VWKA 2X74A 4RNMA 4CHOA 2UUWA 4ECZA 4CJ5A 3V1QA 3SQ1A 4J9SA 3DYAA 2R8IA 1L3TA 2IOCA 2FLPA 3CDEA 1NK0A 1RT1A 3HP6A 1RDDA 2D41A 3NBPA 3IS9B 1BHLA 3Q8RB 3SUQA 3NH2A 4CJFA 3NF9A 3ISND 3TARA 1TQLA 1LV5A 4O4GA 1U04A 4GVMA 2BRLA 3QEVA 5KFZA 1I39A 2FJXA 3PZPA 4E7IA 2FVQA 1RT5B 1RT3B 2FVRA 2AGQA 4ZPAA 1X1PA 1JLQB 1EP4B 4NRUA 1SV5A 1SH3A 4DFKA 1NOYA 1U49A 2CJQA 3DRRB 3KLGB 1RTJB 1HQEA 2AU0A 4K4ZA 1S1VB 2IC3B 4WZMA 2E6LA 2W7OA 4KHNA 2BGGA 1YT3A 4CJLA 2D3UA 1ASUA 5KG5A 4LH5A 4CFBA 1UA1A 1KHVA 3LP0A 2EC0A 3PO5A 2HAIA 4HKQA 4CGIA 3KLFA 4O3RA 3QETA 3M8QB 1JLFA 4KRFA 2B6AA 3SV4A 3OS2A 5KT5A 1FXXA 1SKRA 4KI6A 4TXSA 4ZTJA 4DTOA 5DG8A 3LPTA 4URSA 4WE1A 3SZ2A 2VG6B 1VSEA 2RF2B 4ZPDA 3PW5A 1UA0A 4W5NA 3BSNA 2VG5A 3HVAA 2C2EA 1NOZA 3TANA 4KHMA 4ELTA 2QE5A 3NAEA 4NLUA 3L2RA 5FDLA 5KFWA 3OYGA 3K58A 1SUQB 3TAMA 3PW0A 4CGFA 3DRSB 3DOLA 2UVVA 3ZSWA 5KFPA 2VG7B 3CFPA 1J5OA 5KT3A 4PQUA 2NUBA 1WSJA 4C8NA 2OPPB 3KLVA 1BISA 5CY4A 2ITGA 4MK9A 1VRTA 2I5JB 3MEEA 3O4QA 2ZKUA 1S6QA 1SH2A 1XR6A 2BQRA 2C2DA 4CJKA 3S9HA 3KLHB 4CGJA 5HLFA 2BE2A 4HCCA 1Y97A 1TP7A 4CF2A 3L3VA 2C2RA 3IG1A 2KTQA 1S0OA 4CHQA 2ZE2A 1X9SA 5E41A 4FJ7A 4IDKA 4DL7A 3KIOA 1HYVA 2OZSA 2HB5A 1QUVA 3WNFA 5EWEA 4Q44A 5KT7A 3G0ZA 3ZT4A 4ED7A 3NF6A 3CVKA 5DQIA 3QERA 3D5MA 2FVCA 4GC6A 5FRMA 4CEBA 2I1RA 4FM0A 1HQUB 4ZP9A 2HVHA 2HHUA 2LSNA 4LSLB 4IFVA 1SL2A 1T03B 1RBVA 4NLYA 2BANA 2WCXA 3M9NB 1VK0A 1EETB 4CERA 4Y34A 5HRPA 1T8EA 4EO6A 4CHPA 4E1MA 1SH0A 3RMAA 1NHUA 3K57A 4FM2A 4FK0A 4FS1A 1QSYA 4J9NA 3QIOA 4KTQA 2E4LA 3WNHA 4O5BA 3OYIA 1S9EB 1S5JA 1N5YA 4B3OB 4RG8A 3KJVB 3ZSOA 4CGGA 4CEOA 3JYTB 1VSFA 1NKCA 2GC8A 1KSPA 1REVA 2RN2A 2AGOA 5CYQB 2JEIA 3NH0A 3V1RA 1U48A 4FLUA 1NK5A 1NK9A 2FJVA 4NLRA 3HHKA 4R5PB 3FRZA 4CE9A 3V4IB 3T19A 2XI2A 3FFIB 3KK2A 4MIBA 2W9CA 3C6UB 2JGUA 1Q8IA 3OS0A 3KK1B 3RBDA 1JL2A 3WNGA 4N76A 2YNGA 4QWBA 2IDOA 3MTKA 3ITHB 3MEDA 1T94A 3PW2A 3QYYA 3QESA 1CZ9A 3VQ9A 1RT4A 3NAIA 2D3ZA 1S1TB 2R7YA 4L8RB 1N6QA 2HHSA 4F4XA 5HP1B 4B9NA 3VQEA 1RDAA 2D0BA 3AVFA 1TKZA 4U7CA 4IG3B 4Z4CA 2EX3A 2KZZA 3NGYA 4HVJA 2YNFA 3V6HA 4TSXA 4M94A 2DPJA 4K4VA 1S1XB 3OYEA 3DLEB 3D28A 4Q0BB 3AVIA 1FKPA 1JLGA 3P1GA 2ASDA 3ZT2A 4RW9A 5J2NB 3KNAA 4CJ3A 3MR2A 2R8GA 5KFQA 1UWBB 1B92A 2DFFA 5KGWA 2B5JA 3GV5B 4FJNA 5DG9A 3U6FA 1RCHA 3P5JA 1KFSA 3DLKA 4OKJA 4KREA 2Y1JA 2OPRA 4CJRA 4EP4A 4M3TA 2ZD1B 4KHUA 2IM3A 2W42A 3RWUA 3VQQA 4FBTA 3SI8A 2G8WA 4Z4IA 4ECUA 4O3NA 1C0UB 4IG0B 4DFMA 3DOKA 3MFIA 3BQ0A 4ZP7A 3QIPA 3Q8PB 3BREA 3KHRA 2R2UA 3GYNA 4JRPA 1VSIA 1RT5A 3C94A 4BE1A 3NGIA 1EP4A 3V9SA 3TVKA 3AVMA 4K50A 1D0EA 2KQ2A 3DRRA 3I0RB 2EHGA 3ZT1A 2VA3A 2E9ZA 4K4WA 1RNHA 1RTJA 5J1EB 3VQ7A 3AVCA 1S1VA 2ATQA 2IC3A 4DTNA 5L1JA 1EXQA 3PUFA 1WSHA 4AHVA 5I3UB 4EO8A 1KCFA 4AILC 5C42B 3OLAA 1CZBA 4KV8B 2JEFA 4DWIA 1TAQA 1TVRB 4NYFA 2BR0A 2E6MA 4CF8A 1S97A 2IBKA 1HRHA 1T3NA 3RTVA 3GIMA 1JXBA 1LWFB 1EKEA 4ED6A 5DQHA 2AGPA 4Q45A 2RF2A 4B8CA 4H4MB 4G1QB 1TK5A 4JV1A 3L3UA 3PVXA 2XI3A 3ICLA 3H5UA 4ZP6A 5JXSA 1QE1A 1ASVA 4ED1A 3V9XA 3V81A 2B43A 1Z25A 3LALA 1RT6B 3ALYA 3LDSA 3ZSQA 4NLVA 1WNEA 4DL3A 1SL1A 2OPPA 4RNHA 1RTDB 3P83D 1KLMB 2YNHB 2I5JA 4J9QA 4NLDA 2W9BB 3SUNA 2BDPA 2R8HA 4CFCA 4CEEA 4Y1DA 3H4BA 1KFDA 4DS4A 4ECQA 3TAPA 2IA6A 3SV3A 3UPFA 4B9MA 3OL9A 3QLHA 4FZYA 2XHBA 4LD0A 1N4LA 2P51A 3QGGA 4DF4A 2HHVA 2OH2A 1T7PA 3NF7A 5KFEA 3KHHA 3SFUA 4F2SA 3KKRA 1TV6A 1RT2B 4AHCA 4DG1A 5JS1A 1TL1B 2DFHA 1IKVA 3M8SA 1S49A 1BI4B 3T5KA 1Q9YA 3E01A 2F8TA 4E19A 4U6PA 1RDBA 2UVRA 1ASWA 2XRIA 4RU9A 3M8RA 5KFRA 4CIGA 3RAXA 2RPIA 2QKBA 4N56A 4YR3A 1T03A 4B9TA 4OGCA 1EETA 5L1KA 2D0CA 3ZT0A 3ULDA 4J9LA 5KFHA 4C8OA 4MH8A 4K4TA 4K4YA 3AA4A 2CKWA 4F4KA 4ECRA 4H8KA 2HNYB 2GIQA 3IGNA 3GIIA 1NNDA 3KJVA 1S4FA 3CO9A 1XWLA 4CK1A 1BIUA 3MXJA 2G8HA 4QAGA 3C6TB 3PJWA 4QW8A 4EYIB 1S9FA 1LWCB 4CJTA 1S1UB 3MECB 3V4IA 2BQUA 3MR5A 3SQ0A 4CIEA 3S3NA 1K1QA 4R8UB 1HMVA 1KVBA 4TLRA 4J9PA 3OYFA 5KFCA 4JUZA 3MR3A 2DY4A 3RB6A 5F8LA 3F9KA 2B4JA 4WYLA 4M3UA 1JLEB 5KG6A 4CJEA 3OYNA 1S1TA 1BQMB 2OYQA 3TAGA 4F50A 3DLGB 2OPSB 3WNEA 4CEFA 5JS2A 4DQSA 4E7KA 3H4DA 3SNNA 2HHTA 4YMEA 3HVWA 3N6MA 2YKMB 1HNVA 1R0AA 4FLTA 4O44A 1S1XA 5F8NA 3QO9B 4HUEA 3DLEA 1NK6A 5I42B 1NJWA 5HBMB 4FJXA 1WSGA 4G3IA 4CHYA 2XO7A 3BDPA 3CDUA 4BWJA 4E7LA 2A1RA 1C1BB 2FBTA 2JC0A 2P1JA 4ZTFA 2ZD1A 3LP2A 1DTTA 3MEGB 4XPEA 4ZVHA 2G8VA 4QPXA 3DMJB 3LWMA 3GIJA 3TAFA 1C0UA 3LP1A 3TWHA 1S6PA 3CM6A 5J2QB 5KG0A 3V1OA 4TN2A 2KW4A 5DLGA 1TKXB 1JLAA 3VQ5A 4K4SA 4I2QB 3NMAA 3NH1A 3RMCA 3CJ3A 4LSNB 4NCGB 5EDWA 3EY1A 2C22A 1S1WA 1JLCB 3KLIB 4WXOA 1VSLA 2DPIA 3E51A 2UVWA 1W9HA 4ED2A 4EBDA 4M3WA 4DL5A 1C0TA 1RBSA 4KO0A 1I3AA 4H4OA 1LAVA 2O4IA 3ZSVA 1JLBB 2XCPA 2Z1IA 5DMRA 1FK9A 3M8PB 4IH5A 3B6OA 2XCAA 1KVCA 1LW0B 4KV8A 3TQ1A 1NK8A 3ZSXA 3PX4A 1RTIB 4CK2A 4BE2A 1GOCA 4X2BA 3OHAA 2PZSA 4ECTA 4O4RA 3MF5A 1CXUA 2Q3SA 5EUHA 2FBVA 1C1CA 2QXFA 3RRHA 1DTQB 4IH7A 2R2RA 3QGIA 3SCXA 2BQ3A 4OLAA 4CJWA 4M3RA 4G1QA 4QWEA 3CJ2A 3AVHA 2PY5A 1W25A 2P5OA 4DEZA 2X78A 1B9FA 2HVIA 1HNIB 1JXLA 3CJ5A 4QCLA 3OYJA 4JS5A 5KFLA 3OSPA 4OPJA 2FBYA 4RW8B 3I5CA 3DI6A 3EZUA 3FSIA 4IRDA 2YKNA 5HRNA 3CYMA 4QOZB 3KLEB 1RAJA 3S3MA 4RW6B 4K8ZA 1CSJA 1CXQA 1RTDA 3PR4A 4DTJA 3M9OB 4IKAA 3SYZA 5KG3A 3OS1A 4Q8FA 1MU2A 5KFSA 2IM1A 2JLEA 3OYBA 1YVUA 4JV0A 4YP3A 2QV6A 3SJJA 4BACA 3K5NA 4F4YA 4OKEA 3SPZA 3HL8A 4RW4A 3VQAA 3KTQA 4DSKA 4RNFA 1J9AA 1RT2A 3LPUA 4BE0A 1S0NA 3HVTB 1TL1A 4KSEB 3RRGA 3HSTB 4DFPA 1TK8A 1HPZA 1TKTB 5C25B 4QWDA 3I0SB 5HROB 2OPQA 1TL3B 3K5OA 4O0IA 3K5MA 4JLHA 1U45A 4DTSA 3OYMA 3OL6A 5T7BA 2O4GA 3RBEA 4C8LA 3GIKA 3CJ0A 4IFYA 2Z1HA 5SZTA 4CFAA 3IN5A 3BJYA 2HNDA 3JSMB 4ECSA 5D3GA 3DM2A 1I6JA 1VSDA 2XY5A 3CIZA 4JV2A 4PA1A 1N56A 4WFXA 4Q43A 4CF9A 3H5YA 4ED0A 4OPKA 2VWJA 4ZPBA 5KFVA 3BSOA 4WYWA 1LW2A 1IG9A 4ZMMA 2ZQBA 5KFYA 2HNYA 1BQNB 4W5OA 1JL1A 4Z0UA 1UAXA 4KTZA 4PWDB 2AX1A 3H40A 2E9RX 1VRUB 2JEGA 4J2BA 3NCIA 2WONB 4MK8A 1FKOA 2IJNA 3UR0A 4DU3A 3S3OA 3C6TA 1TGOA 4CEQA 1IKWB 1QS4A 3V9UA 5C24B 2HHWA 2J6UA 4CHNA 5J2PA 1NJXA 2WOMB 3K5LA 3KHGA 4MFBB 4DTUA 3DRPA 3MECA 4PY5A 4I2PB 4KKOB 3BQ2A 1LWEA 4EYHB 2D5RA 4K8XA 2XY7A 4NYNA 5CZ1A 4DLEA 1IKYB 4DQPA 4Y1CA 4C8MA 1RT7B 4EEYA 1QHTA 3F73A 4MKAA 1TKDA 1HYSA 4OL8A 3KK3A 3HYFA 4M3XA 4FVMA 3AVLA 3VQBA 2DFEA 3DLGA 1RBRA 2XY6A 4KB0A 2OPSA 4B9VA 3H98A 4IOBA 3IS9A 1K6YA 4GC7A 3OYDA 1N48A 4WXWA 3QO9A 1ZBLA 4KAIA 2RDIA 3AO3A 3G6YA 4ZVEA 2FJWA 5I42A 1HJRA 3HJFA 2ILZA 5F9NA 5HRRA 4NLSA 3H5XA 1RDRA 3N6NA 3A2FA 1K1SA 1GOAA 4TYBA 3VQCA 4Z4EA 1SV5B 3QIDA 5KFUA 1RT3A 4IQXA 2ASJA 3IGVA 1KRPA 1JLQA 4ICLB 1WSFA 4CJVA 5CZ2A 1HQEB 3MEGA 3KD1E 1DLOB 3DMJA 3KLGA 3PV8A 2V0NA 2RDJA 2WTFA 4DQRA 3SPYA 3EYZA 1RDCA 2R2TA 2W8KA 3T5LA 3HPHA 1J54A 3V6KA 3LP0B 3QEPA 4KFBB 2G8IA 3CFRA 1ZBIA 4TQSA 4FLXA 3B6PA 2V9WA 4B9SA 2HHXA 3KLFB 4OJRA 4I2QA 3HK2A 1YTUA 4LSNA 4NCGA 4KHWA 2J6SA 2B6AB 5KG7A 3M8QA 2ATLA 3RB0A 4J2DA 2IAJB 3DLHA 4CHZA 3KLIA 3QNOA 5KFIA 4I9QA 5EU7A 1KLNA 4CCHA 4ZVFA 1RBUA 1A5VA 3AA5X 4IBNA 4LQ3A 3CWJA 5DGBA 3VQ8A 3RR8A 3G6VA 3G10A 5KFFA 2VG5B 2WB4A 2VG6A 4ECVA 1NK4A 1SL0A 1NKEA 5FDLB 3V9WA 3TAMB 4I9LA 4YFUA 3RB3A 1U09A 3DOLB 3QINA 1U47A 4ZHRB 1SUQA 4Z4GA 4CJSA 4BDZA 5KT4A 3BSCA 2W9AA 3DRSA 1J5OB 3SFGA 1NJZA 4PQUB 5DGAA 1RTHB 3QEIA 4HUGA 2VG7A 2Z1GA 3VQPA 1GOBA 4J2AA 3V6DB 1VRTB 3L2WA 4FJ8A 1IKXB 1S6QB 4DLGA 1Q9XA 1NJYA 3G86A 4ID5B 2C28A 3DLBA 3LANA 2BE2B 3KLHA 2G8FA 4BDYA 1C1AA 3PW4A 3IG1B 3EZ5A 5KFAA 2ZE2B 3BR9A 2R2SA 3K2PA 1RILA 4FLZA 1OS5A 4CGHA 3D45A 4RW6A 5L1IA 1HARA 5T14A 4N5SA 3LZJA 1JXEA 3PJXA 2RKIB 3DLRA 5KT6A 4WFYA 4DU1A 4ID1A 3OSNA 5KG4A 3ZCMA 4RW7B 3NGDA 3IRXB 3IAYA 4IFVB 4J2EA 4F3TA 4ZP8A 4HTUA 2BANB 3AV9A 1HQUA 2FVPA 4NCAA 1QAJA 4OVLA 4LSLA 2IJFA 4DSIA 5KFKA 1D8YA 3FQKA 4EBCA 4JRQA 5CYMB 4KB1A 4FZXC 1N5YB 4Y2CA 1C6VA 4NYZA 1S9EA 3NAHA 4GMJB 3T5HA 4B3OA 4I7FB 1REVB 3QGHA 3JYTA 4E89A 4FM1A 2WRMA 3HT3A 4IR9A 2HMIB 4AH9A 4DSLA 2IS3A 3KKSA 5CYQA 5KI6A 1D1UA 3MAQA 4AHTA 3GQCA 1L3VA 3UIQA 3KK2B 1NHVA 4R5PA 1SKSA 2W9CB 4CEAA 4KI4A 3AVKA 3FFIA 2W8LA 3NF8A 2YNGB 3MEDB 1QAIA 2XWYA 3C6UA 3PO4A 3KK1A 1VRUA 4F8RA 3LP3A 4NRTA 1Z26A 1RT4B 2WONA 2QK9A 3ITHA 4DQIA 1ZTTA 3TR8A 1VSHA 4F3OA 1IKWA 4FJGA 3AA2A 3OYHA 4CECA 1XR5A 1TKZB 3OJSA 4DTMA 3MR6A 5HP1A 4I2PA 4KKOA 1O1WA 4IR1A 4PUOB 4IG3A 5DLFA 3GV7B 4ECWA 4NZ0A 2Z1JA 3Q8QB 4ZPCA 3DDKA 4KTWA 3OYKA 1RT7A 4Q0BA 3AO2A 2DTUA 2B5JB 5J2NA 1XHXA 5KT2A 4B9UA 1HYZA 5C5JA 1UWBA 3DLKB 2FBXA 2FLNA 1VSKA 4RUCA 1UOCA 2OPRB 3THVA 4BDPA 2KFNA 3H5SA 4TYAA 3NE6A 3OYCA 1ZBUA 4K4XA 2X6NA 4CGDA 4C8KA 3L2QA 4FZZA 2GIRA 4M42A 2HNZB 1QTMA 3DOKB 3HXMA 2UVUA 3H08A 3PW7A 1QSLA 3QIPB 2YNIB 4N41A 4Y2AA 4IG0A 5KRSA 3ZSRA 4FS2A 2WK4A 4FCYA 3GV8B 2OZMA 4CJQA 3LAKA 3T1AA 4F2RA 3LZIA 4QWAA 4B08A 4ICLA 1WSEA 4NLTA 3OYLA 4DTXA 4MIAA 5F8HA 5F8IA 1DLOA 3I0RA 2GV9A 3OHBA 5J1EA 3PHEA 4AHUA 4KFBA 4BWMA 4URGA 3T5JA 1KVAA 5KFXA 4MQ3A 3OY9A 3KD5E 3OVNA 5I3UA 2AWZA 4KBIA 1BCOA 3O3FA 5K14B 4YR2A 5C42A 1WAJA 1CLQA 3TAQA 1L3UA 5KGXA 2X6SA 4AHSA 3BGRB 2AQ4A 4FBUA 2IAJA 3FDSA 1RYSA 4ZVGA 3HVRA 1XI1A 4E7HA 4DL4A 3QEWA 4Z4FA 1TVRA 3VQ6A 3OLBA 3O4NA 3FQLA 1VSMA 1LWFA 2HWIA 3PR5B 1J53A 5J2MB 3AO1A 4Y3CA 3CM5A 1WNSA 5KFOA 3RB4A 3AVGA 3SI6A 4H4MA 4J9OA 1D9FA 4E0DA 4HHTA 4CEZA 3ZT3A 1ZTWA 1QE1B 2KFZA 5KG2A 4O0JA 3V81B 2V4RA 3OL7A 4CJ4A 4ZHRA 4UQGA 3QZ7A 3I8DA 3AVJA 1RT6A 1WSIA 3AVBA 1RTHA 4LQ9A 3HP9A 2XY8A 3V6DA 1KHWA 4LH4A 1IKXA 1IO2A 4TY8B 3PY8A 2HHQA 4K4UA 1KLMA 1IH7A 2YNHA 4ID5A 3LAMA 2R8KA 2W9BA 3QLHB 5EWGA 1D5AA 2ALZA 4O3OA 4OGEA 2IMWP 4CEDA 2Y1IA 4YNQA 4CESA 1TV6B 1B9DA 3AVNA 4DG1B 4GW6A 1T05B 1IKVB 2AJQA 3EPGA 4ELUA 4FK2A 2F96A 3E01B 4OLBA 3U3YA 3SUPA 1NK7A 1BI4A 3KMSA 4DMNA 4DQQA 2XGQA 2RKIA 4R0EA 3QNNA 5KTQA 5KFGA 4FJLA 4QW9A 4O3PA 4H54A 3VQDA 4RW7A 1JKHB 4NLWA 3IRXA 4NLOA 5DG7A 3AO5A 5EWFA 4NLGA 3K59A 3HKWA 3QZ8A 1RBTA 1XC9A 1RYRA 4ECYA 3N6LA 4J9MA 3AVAA 1KTQA 4RNOA 1GX6A 4TY9A 1W0HA 1WLJA 5CYMA 3CQ8A 1BIZA 2QKKA 2PYLA 3G6XA 4AHRA 4DF8A 1MMLA 3KOAA 3U3GA 2FC0A 3RMDA 2R8JA 4I7FA 1S9GB 4CK3A 2V4QA 2HMIA 4J9KA 4DSFA 4FJ5A 5L9XA 4IRKA 4M3ZA 1X9WA 3OYAA 1BL3A 2JEJA 1S10A 2ASLA 1LWCA 1HMVB 4Q8EA 1S1UA 3ISNC 4J9RA 4R8UA 3SQ2A 4CFDA 4IKFA 2J6TA 4KHRA 4RUAA 4E3SA 3CG7A 1XR7A 2UUTA 3HPGA 4M45A 4FJ9A 4OKKA 2BRKA 1X9MA 1JLEA 4W5TA 2G8UA 2HWHA 2KZMA 3DYAB 1BQMA 1S48A 3CFOA 1RT1B 2GBZA 3QEXA 3NBPB 1BGXT 4PUOA 1HNVB 3O3GA 1R0AB 4DL6A 3SQ4A 4O44B 1TK0A 3OJUA 1ZBHA 2YKMA 4DSEA 4DL2A 2VA2A 3O3HA 1U4BA 4DFJA 2YV0X 3BQ1A 4EP5A 4O4GB 4XIUA 4CF0A 3PX0A 4CJUA 4KPYA 5F8JA 4MK7A 5HBMA 2GUIA 4KAZA 3TI0A 2W7PA 4KHQA 1L5UA 5JUMA 3LP2B 1DTTB 1C2PA 3VQSA 4CF1A 4F4WA 1C1BA 4KB7A 3RAQA 2HNZA 3LP1B 3PX6A 2YNIA 1S6PB 4KHSA 1IM4A 1JLAB 4HCBA 3UQSA 3Q8SB 2XGPA 5J2QA 4M41A 1TKXA 4KE5A 4ELVA 1S1WB 4E1NA 4ED8A 3NDKA 5F8MA 1JLFB 4M95A 4O3SA 3SUOA 3LWLA 5KRTA 5KFTA 1L3SA 3ZSZA 2IM2A 3MFHA 4RZRA 1JLCA 4EBEA 3RR7A 4ED3A 2O5DA 4O55A 3NGZA 1RA6A 1C0TB 4KO0B 4H4OB 4WE1B 2WHOA 1FK9B 1JX4A 3RMBA 1WN7A 1GX5A 1YVFA 1QSSA 4FXDA 5K14A 4N47A 3AO4A 1JLBA 3M8PA 4DSJA 4B8AB 4NLQA 4FLWA 1EX4A 3HPOA 2AX0A 1LW0A 3MXIA 5F8GA 3BGRA 5KFJA 1RTIA 4FJIA 5F9LA 2PYJA 2P5GA 1YTAA 1C1CB 2YHAA 4KHYA 3EPIA 4FYDA 4W5QA 4Q5VA 4DU4A 4URQU 3NL0A 3NKYA 2YHBA 3V9ZA 3TABA 2IM0A 3AA3A 2OA8A 4YR0A 1DTQA 5KFBA 5J2MA 4B9LA 4FLYA 3MEEB 4O3QA 4FJHA 1VSJA 5HLFB 3HO1A 2E9TA 3DI6B 1HNIA 5KFDA 4YQWA 3HM9A 2YKNB 4RW8A 4RNNA 4DTPA 1A5WA 1A5XA 3H59A 4IDKB 3ZSYA 4XPCA 3L2VA 3KLEA 4LY7A 3H2LA 1NKBA 4IH6A 1S0MA 1ITGA 4TY8A 1MU2B 4Z4HA 1QQCA 1RA7A 4XO0A 5KFNA 4FLVA 3T3FA 4NCBA 2ETJA 4FK4A 4RW4B 1D9DA 4DTRA 4NLXA 1C0MA 1T05A 3L2UA 3GILA 5FRNA 4JS4A 1ZYQA 3L8BA 1HPZB 3HVTA 5SWMA 5DQGA 3VA0A 4MKBA 4NLPA 2OPQB 4HUFA 1TKTA 5C25A 1ZBFA 4EZ6A 2FVSA 3I0SA 3VQ4A 4E7JA 2G8KA 5HROA 1TL3A 3M9MB 3BSAA 4IFYB 1SKWA 3TAEA 1XHZA 1TAUA 4EZ9A 5FROA 2D7SA 4IRCA 4ECXA 1JKHA 2HNDB 4FJKA 3ASMA 5D3GB 3DM2B 2A1SA 3NFAA 3JSMA 2FLLA 4F4ZA 2ILYA 2HW3A 4FW2A 3KHLA 4TQRA 3VA3A 4CJPA 1LW2B 1ZETA 5L1LA
chains in the Genus database with same CATH superfamily
5DK5A 5E3QA 3H7HB 4LSZB 1BQNA 2HRYA 3AAPA 3C95A 3C14B 3NHGA 1N54B 1S9GA 4PWDA 2WW8A 3ZZOA 4CIFA 3CJ4A 3H6EA 2XC9A 4C3MA 1N6QB 4PL8A 3I5BA 2VJVA 3DOMB 1LAWA 5D8HB 2CVIA 5KG1A 2DEIA 4MFBA 3VAKA 2IA0A 1VAZA 1YUWA 5IWAK 2YNFB 5GIOA 1VI7A 2KXFA 1JIHA 2MGZA 4FJMA 3QQCD 4AQYK 1JLGB 1HYSB 4E2FB 2AHOB 2IGIA 2QG9B 3KK3B 3UI3A 4JV5F 4HHJA 5DS7A 4B3RF 3OBWA 2Q1LA 3SQ1A 3FZKA 3CJ9A 2R8IA 2D41A 3IS9B 5E3RA 1BHLA 3L7OA 4IOCL 1FTRA 2DGXA 3BO2A 1N36K 1LOTB 4WCEQ 3ISND 2J7KA 3QJPA 4NLBA 2DO0A 1YK9A 2R7VA 3FUYA 2KRBA 3UKRA 4FWKA 3QEVA 1I39A 2FJXA 2W01A 2VUGA 1UWAA 1RT5B 5BREA 3S8SA 3EEQA 3DHXA 4DV3K 4NRUA 5A6WA 1SV5A 3MMAB 2CJQA 1PJ7A 1RABB 1Y64A 2Z4PA 4OFZA 1PIEA 1S1VB 2H48B 2IC3B 1OSDA 2EFOA 1YT3A 4PWWA 2D3UA 1ASUA 4AM7A 1NG9A 1KHVA 1I1GA 2EC0A 3PG9A 4DV0J 1ZM4A 5AJ3F 4JI0K 3T1YJ 3JQKA 2E2NA 3BV8A 4IEIA 3OT9A 1B0VA 1FE0A 4BRPA 4TXSA 2A40A 5SUHA 5A76A 4NZ6A 4CD3A 4DTOA 1K8AT 2HFVA 3LPTA 3MD1A 4WE1A 3TU5A 1NH7A 3GDQA 2B4PA 2PBDA 4FPIA 3BSNA 2VG5A 3H46O 2UXBJ 4A61A 2C2EA 4AD6A 1A6LA 4FSVA 3NAEA 2NRRA 3OYGA 3K58A 4BC3A 1SUQB 1R8HA 3PW0A 4CGFA 1VQ5S 3DRSB 5CA5A 3GZ7A 4HTIA 3FEZA 2R7WA 1J5OA 4PQUA 2NUBA 2HBQB 2OPPB 4DV1K 5CY4A 2O8CB 3ZFVA 2MZQA 1S6QA 4CJKA 4CGJA 2WVFA 1GXUA 2V2ZA 5HLFA 4X84A 2BE2A 4HCCA 4Z37A 4LBPA 4CHQA 4JKGB 1X9SA 5E41A 2KM8B 4NWBA 1V4TA 3ET6B 5LXRA 2KKZA 4G1PA 1BA0A 2HB5A 5EWEA 4Q44A 1URRA 4WIQA 2XYGB 3ZT4A 4ED7A 3NF6A 3HHLB 2FVCA 3DLLL 1U0HB 4FM0A 4ZP9A 3RYLA 1SCJB 2HHUA 4IFVA 3JTPA 1R43A 1T03B 4UQTA 2XHWA 1RBVA 4NLYA 3M9NB 4DUZK 3GG0A 5CXTA 3DFEA 3SCKE 1EQ0A 4EO6A 2EFQA 1NHUA 1Q7YO 4CI0B 4HI2A 1QSYA 3K0SA 3CCUN 2VPZB 2E1PA 1YZ7A 3OYIA 1WSRA 3MDFA 3NGRA 1FJEB 2O8DB 2RAQA 1YRUA 2IYIA 3G9CA 1PYSB 1Y5NB 1HBNA 1DKGD 1ZS6A 1U48A 3V1RA 1CULB 3JSBA 4CE9A 3V4IB 3S6EA 1N52B 3H20A 3FFIB 5M1KA 4XDCA 3CJ8A 4C11A 4M5MA 1NJIO 4YEAA 4N76A 3WNGA 3VTIA 3W5ZA 3JQMA 3MTKA 4M5IA 3MEDA 4WU3A 4U8VA 2PIIA 3TRGA 4X4SA 2A2DA 3VQ9A 3SQGB 4CO4A 1RT4A 1S1TB 2Z2ZA 4L8RB 4BCAA 4F4XA 4B9NA 1RDAA 5IV3A 1SAZA 4U7CA 2XMMA 5DZ7A 4ZKAA 3N4WA 4A62A 4Z4CA 2VJUA 4OX9K 3NXZA 3V6HA 4TSXA 3MM8B 1OVYA 1Q4RA 3BZCA 3D28A 4Q0BB 2ASDA 3ZT2A 3KNAA 1NHKL 2WB1D 2R8GA 3HOTA 5IZHA 2BM0A 1EB0A 5EN1A 5LMUF 3U6FA 1Q8LA 1Q81O 3P5JA 1YIJN 3DLKA 2VGNA 3VAJA 2Y1JA 2LXIA 4CJRA 2HK2A 4M3TA 2ZD1B 3CNQP 2CA9A 1TUUA 1NPKA 3A12A 3EUNA 4JKCA 1C0UB 4QU6A 2DGTA 5C2GA 4X66J 3BQ0A 3BREA 2AJ0A 4CLZA 2M5YA 1OY9A 3C94A 1WI8A 3VGUA 4BE1A 1F9HA 3AVMA 2A3JA 2MPUA 3DRRA 4CRJA 4NOHA 5DO2A 3VEXA 2VICA 1RNHA 5C0YA 5GMKa 3O5BA 2ATQA 3EM1A 4AHVA 1OMSA 3GCXP 2AMCB 4EO8A 3G4SN 2LEAA 2MLXA 5M1PA 1P8ZA 3OLAA 1FVQA 4KV8B 2I0XA 3CJKB 1R89A 4DWIA 3CCMN 1WD6A 2CG4A 1TAQA 3WHIA 1N0UA 3ENWA 2Y0SD 2IBKA 2QWLA 1AUDA 3EKUA 1T3NA 4FYXB 4FWNA 2GWJA 1XNQK 4U7UK 3GIMA 5ETMA 4ED6A 2O8FB 3D6MB 2ZFHA 2N7CA 1AZSA 4JV1A 2Q31A 3L3UA 1G1XA 4AUKA 2XI3A 3PVXA 4CZFA 3H5UA 1OWXA 5JXSA 1ASVA 2ZM6F 2BUPA 2DH9A 3TO8A 1GTHA 1RT6B 1C4CA 2HPUA 3WIVA 2I9SA 3ZSQA 3OFHA 4V19S 4FVCA 1WNEA 4JI1K 3P4UB 2AEMA 4OQJA 1RTDB 3P83D 3NS5A 2I5JA 2LDYA 4J9QA 4NLDA 3SUNA 4CFCA 4P7VA 3H4BA 2RSQA 4B9MA 2N82B 1KAXA 4FVUA 5IM0A 4UY85 3KKRA 4AHCA 2BKPA 2KG0A 1OJ4A 4FNHA 1BI4B 3T5KA 2H1YA 4LF2A 3VAGA 1Q9YA 4E19A 3A4TA 4U6PA 4DR1J 2N4DA 5L38A 2UVRA 1ITPA 4CD1A 3ZYYX 2CRLA 3GPAA 4RU9A 3M8RA 2YH0A 5GAGU 3MEKA 4YDDB 5D0GA 2QKBA 2Q6CA 4NA3A 1F9FA 2HFOA 4NXMJ 3ZT0A 5KFHA 4MH8A 5E3PA 2ZOMA 4ISGA 3CD0A 5ADZA 4P74A 4X4TA 3THXB 3I96A 4PCQA 3KJVA 1S4FA 5A8KA 4OZ0A 3CO9A 1XWLA 4CK1A 1QJHA 3BM7A 4LF4K 2G8HA 4CT9A 1YF5L 4JI2K 5C2DA 3PJWA 1V6HA 3UN3A 4QW8A 1DEJA 3HI0A 2C2OB 4OZ5A 3WX4A 4QR0A 3SQ0A 4RBUA 1K1QA 4YOXA 3QWPA 2E7XA 3J80U 4TLRA 4J9PA 3OYFA 2F5GA 3UWTA 4PAAA 3UNGC 2P6SA 3C15B 4M3UA 1JLEB 5KG6A 3M6WA 2HBRB 4CJEA 1BQMB 3BF3A 2MSTA 4F50A 3OW2R 1R3NA 1HBOB 1CZAN 5JS2A 4HDHA 3WXIA 2HF3A 3C7NA 1OO0B 3N6MA 1XK8A 4FLTA 4DV0F 1S1XA 2JX2A 3SBGA 3T1YF 2VOOA 1NK6A 3CIMA 2GV1A 2YJEA 4BC4A 1YHQN 4DV7K 3Q8UA 4LT6A 2J76E 1IQTA 1CS4B 3OTOK 4AXJA 4LF9K 3BS9A 1GNKA 3BDPA 2ZWHA 2LU2A 1IR0A 1NDLA 3D2EA 4BWJA 4E7LA 4L3NA 3RUBL 2A1RA 1C1BB 2JC0A 5EX0A 3D7SB 4ZVHA 2G8VA 3QMQA 4QPXA 3LM9A 5C12A 1NGCA 5F0WA 3GP9A 4LRCA 2HURA 3NGUA 3TWHA 5J2QB 5KQDA 2GEMA 2KW4A 4WF9Q 4K4SA 3NMAA 3CJ3A 4LSNB 1NSAA 3O9UA 4X65J 4P71A 5AE2A 3GOIA 3GFZA 1JB0C 1W2BM 3RU0A 3G71S 1LAVA 1WTFA 2NZ4A 1CJVA 5LMNJ 4IH5A 4DHYA 2D0OA 1KVCA 1LW0B 1NK8A 1S4EA 7AT1B 2C3YA 1E6VA 2B3TB 3MCSA 5IT9O 1D8ZA 4BE2A 1NCLA 4J8FA 1GOCA 3LDNA 4WKYA 3MF5A 3G2XA 2Q3SA 5EUHA 4L6V3 2DJWA 4IH7A 4CNZA 3C0BA 1RWPB 3TX0A 4CJWA 2FJEB 2FJAB 5AR0A 1B3TA 4QWEA 2HQDA 1XMQJ 3CPWM 3AY9A 4QS9A 1WKLA 1VC5A 2A41A 2X78A 2NNWA 1PCAA 2H5JB 1HNIB 3CJ5A 4DR3J 4JS5A 2FLOA 4A4JA 1PSDA 4BQLA 4OPJA 3I5CA 3DI6A 1VQKS 3FSIA 2YKNA 2CQGA 1E4GT 1ZZFA 3CYMA 4QOZB 2XSJB 1RAJA 2NLXA 4GKKK 1CXQA 4AT1B 3J7AN 2VQEK 4IKAA 4WFAL 3TW0A 5BYRA 1IBKF 3OS1A 4Q8FA 4ALZA 2JLEA 1YVUA 5GAHU 2OEMA 2F63A 2LXFA 4RW4A 3KTQA 1BA1A 1T02A 3MWBA 3D9BA 3DWLA 2IRYA 4HH0A 2VQFJ 1S0NA 1TL1A 1RLCL 3QFPA 4DFPA 3A5MC 4EHUA 1WHWA 2FZCB 4RJVA 4O23A 3JAMU 3I0SB 2OPQA 4JLHA 4HACA 2B0GA 2P9EA 3HFVA 4P10A 3OL6A 3AQOA 4HLBA 5I3PA 3BBBA 3GIKA 4CLSA 3CJ0A 2Z1HA 4Q2MA 2D9OA 1VQ8N 5SZTA 4CFAA 3IN5A 1RAEB 3UDEA 2B7BB 4ECSA 2VDHA 5IT9Y 2CQDA 3DM2A 1I6JA 2XY5A 1VSDA 2NRVA 3CIZA 4H5RA 3O9RA 4JV2A 4PA1A 1FRJA 1N56A 1WC5A 3D0IE 3DXKA 4ED0A 3S7RA 4WYWA 1IG9A 2HNYA 4Z0UA 3MCMA 2ZBPA 3MWTA 2E9RX 2CPZA 5JMNA 4J2BA 3NCIA 3LPEA 2IJNA 2KFYA 3S3OA 1EX8A 3C6TA 1TGOA 4RL1A 1IKWB 2M9KA 3R2CJ 2A6OA 2WOMB 3KHGA 2POKA 3DLJA 3DRPA 3MECA 2V2KA 4I2PB 3R9LA 3CMAS 4OHXA 2UXCF 2PD1A 2B9EA 4DV6J 3FNNA 3DGPA 3GR0A 2MKIA 4DQPA 1BWEA 4Y1CA 2IVPA 1RT7B 2VFTA 4MKAA 4YDUC 3HYFA 2LDIA 2CZ4A 2VGMA 4USTA 3ZC4A 2LA4A 1H7WA 4BRMA 2YKQA 1RBRA 2JZ5A 2YWFA 2OPSA 1UVJA 1TFWA 1DT9A 8RUCA 1HNZF 3VAFA 3T1HJ 4GC7A 3A5LC 1BUXA 4GRSA 4KAIA 1N5QA 4ZVEA 5I42A 2HQGA 2CUYA 2ILZA 2DISA 4NLSA 2J5AA 3BP8A 1K1SA 2IIRA 1P9YA 4WIIA 5U47A 1GOAA 3K7RA 2XEXA 4NLCA 4Z4EA 3WQUA 1EKRA 4X4QA 2ASJA 4CJVA 1FDDA 1VQMS 4H5VA 3ZEUB 1YDLA 4PHTX 3DMJA 4YN3B 3KLGA 2OP5A 3SPYA 3C2PA 2R2TA 4U95A 3IWNC 1RWKB 4Z2XA 3K8WA 1HA1A 3MOZA 2WBRA 3LP0B 3QEPA 4LF8K 4U96A 4LR8A 3I56N 2HHXA 3KLFB 2I7PA 4I2QA 3CW2C 2YHYA 4KY3A 4DHVA 5IQ6A 4KHWA 2IY5B 3R6LB 2J6SA 2HG4A 2Y8YA 4RUHA 2ATLA 3CD6N 5DRKA 4CHZA 4DUTA 3KLIA 3QNOA 2E7VA 3R5GA 3OBYA 3BN4A 3VZIA 1KLNA 5EU7A 4R0JA 4C7QA 3WBZA 1WBBA 4LQ3A 5DGBA 3VQ8A 3L0QA 1WOPA 2FB0A 4DR4J 5AQGA 6FD1A 3G10A 5KFFA 2WB4A 2VG6A 5AQLA 4ECVA 3R7NB 2QX0A 3NOCA 3GLJA 2XYPB 1IQZA 2AT1B 3NOGA 2ZH6A 4AE5A 3V9WA 4S0MA 1UAWA 2VONA 1U09A 3EE3A 5AQSA 3P5TL 3DOLB 3QINA 1M1KO 4DR1F 4CJSA 5K20B 4P2SA 1KKHA 1NJZA 3W2WA 3V6DB 3L2WA 4F67A 3A1YG 5B0AA 4PWUA 1FHTA 2C28A 3PIPL 3P39A 3DLBA 4NXMF 3A5OC 4CZMA 2G8FA 3GMGA 4CQ1A 1DJ0A 1C1AA 3IG1B 1WKKA 2ZE2B 3BR9A 2R2SA 1M5OC 1RILA 2AJFE 3HHEA 5A8WB 4O5FA 4CGHA 5L1IA 1IWAA 3VEYA 3CCTA 1AXQA 4RLEA 3AFGA 4OV1A 1FW6A 1J5EJ 1Y3KA 5KG4A 2A2CA 2KHOA 2I6WA 3GB0A 3NGTA 3IAYA 3M30A 1JJCB 4B3SF 1RWUA 1NMEB 1ULRA 2GGPA 4DSIA 2XM3A 1D8YA 2XG8A 2HZAA 5B09A 1PG5B 1K0TA 2GVZA 1NGDA 4EFHA 4ZJQA 4B3TF 3QSYB 1WSVA 1REVB 5TKYA 2O66A 4E89A 4DSLA 3C46A 3O6WA 1K73O 2JRSA 2K06A 4AHTA 1GK8A 4A8SA 4PG7A 4YOVA 4KI4A 1NGHA 2QWPA 3J7YU 3NF8A 3B4DA 4OYAA 2XWYA 4ER8A 1UMJA 3C6UA 3CF5Q 4JV5K 1SJFA 2WONA 2WC9A 4ZVPB 4DQIA 4UF4A 4B3RK 5JVGL 2Q1NA 4FJGA 5AQNA 5HP1A 4U7BA 1O0PA 1Q7YT 4DR2K 1O1WA 3CCEN 2FDNA 2QRRA 4IG3A 3CXCM 3CCVN 4CM0A 4PKHA 3GV7B 4ECWA 4BRIA 1X5TA 2UUAF 4X65F 1YJ7A 4I1TA 2HLTA 3O3LA 2B5JB 3CHWA 1A9NB 1UWBA 2XWXA 1RBLA 3OQ2A 1UCNA 2AJ4A 5K8NA 4RUCA 4BDPA 3THVA 3H5SA 4JI6J 3EDRB 4JKAA 1ZBUA 4K4XA 3SCIE 3A8KA 2J4RA 4FZZA 2O1PA 1NJIT 3U1LA 2WUSA 1WG5A 3DOKB 1UFWA 2HFUA 3HXMA 2E44A 5B0BA 3BF1A 1U2VB 3VETA 3WXMB 2QL5B 4IG0A 5KRSA 4FS2A 3TP2A 2P9UA 3O9SA 3UE5A 2BYCA 5AJ3K 1I3OB 2OTLS 3L95X 2OZMA 1QQOA 4PABA 4CJQA 1KQFB 4BRAA 4F2RA 3Q83A 4C2MA 2UXDJ 2IFXA 3H3OB 4ICLA 4MKVA 1YITS 3ETMA 4MIAA 2YTCA 5F8HA 2GV9A 5H1SQ 3C3LA 2QL9B 3MMBA 5J1EA 2P9CA 3PHEA 1FWLA 4KFBA 2C3OA 3QMLA 4MQ3A 3KD5E 1EQMA 4DR3F 3OVNA 4KBIA 5C42A 1Q81T 5GADI 2W7AA 3J8AA 4LC9B 2AQ4A 5E33A 2IAJA 1RYSA 1U1PA 3SJHA 3IR6B 4WP8A 1S59A 3KG1A 2Q0UA 3TZYA 4OI2A 3FQLA 2ZH5A 1KEKA 2P9SB 1LWFA 4KRWA 3PR5B 1J53A 4Y3CA 4PG4A 1WNSA 3SI6A 3ZT3A 1QE1B 3DXMA 4DCHA 5LJVA 4X4UA 2V4RA 1UW4A 4ZN3A 1U6FA 1YVNA 5AQFA 3MPVA 3R6MA 5JLFA 3IMXA 2NUUG 4QR2A 3D6FB 2CPFA 3AVBA 1RTHA 4ILGB 4A47A 1NGAA 4BG8A 2RRNA 1RADB 2ZJPL 4OHZA 2YNHA 4ID5A 3LAMA 1RHUB 2V8PA 2YVSA 1T95A 2YI1A 2JFKA 4YNQA 5TKWA 3PACA 1B9DA 1OH8A 2W24A 3MM9B 2MQMA 3EPGA 4QBUA 2RU9A 5ELZA 2F96A 3X1LB 1T9VA 1VJWA 4CI6A 5HMXA 4OLBA 3U3YA 3CMES 1SIZA 3KMSA 1R31A 4A8OA 1HFEL 4TNOA 3BGFA 4R0EA 3GONA 3QNNA 4D3HA 5AQQA 3KWMA 1OH6A 2DRDA 3FLCO 4QW9A 4FL9A 4O3PA 4NYOA 3VQDA 2KVQE 4YUDA 2HGNA 4NLGA 1M90T 3K59A 3Q0AA 2IIHA 3VERA 1RYRA 3VR1A 1MW7A 2QA4S 4AXIA 4J9MA 3AVAA 4ATNA 4P6QA 4DX7A 2CJYB 5CYMA 1NRKA 3ZZRA 2U2FA 2K7JA 3OA9A 2QKKA 2PYLA 5JICA 2GW8A 2GJ2A 1MMLA 3UD4P 3KOAA 3U3GA 3M5RA 4I7FA 1S9GB 2H4YB 4CK3A 5B8HA 5D0EA 4CZCA 4X4PA 5HK4A 3RW7A 3T1HF 4J9KA 2BMBA 4FJ5A 2MHEA 5C2CA 2DGVA 4IRKA 3W65A 1K47A 4QOTA 1BL3A 1KQKA 1HMVB 4F7VA 4Q8EA 5AE3A 2QT7A 2EVZA 3KDNA 3M1VA 3CCSN 3QFUA 4K41A 4RU2A 2UUTA 3N5FA 4M45A 5C2FA 4OKKA 1U1OA 3VAIA 1X9MA 1CQNA 2E5LJ 4W5TA 5LMUK 2HWHA 2E5IA 4KJIA 4FP9A 1FFGB 3TSUA 2GBZA 3A8IA 2ZJQQ 4RWWA 3QEXA 4IQMA 5B0FA 5DDPC 2AYEA 3ILOA 5D15A 3GFHA 4O44B 3IM8A 3THWB 4CDIA 2YWEA 2Z0GA 2MKYA 4J9VA 2YV0X 2MQ8A 4IOAQ 4XIUA 4LFCJ 3UKRB 3DKDA 3TNVA 4KGMA 3N4PA 3FSXA 1EWRA 3AARA 1ESVA 4ETZA 3WQTA 4YB1P 5FPEA 3G8TA 1MN9A 2XMTA 5EVZA 2C3UA 4F4WA 2JL9A 4DR4F 2E1MC 4DUYJ 3R3LA 4KB7A 4UTGA 3C16B 1HNXJ 2HNZA 5BR8J 2DGOA 1HKBA 3MUMP 1XMBA 2BXJA 4C97A 4ILLA 5FPDA 1JLAB 2PT0A 4X62F 3UQSA 4M41A 1YTYA 4KE5A 3U27A 4EIAA 2ZGZA 4A8WA 5F8MA 4M95A 2RHSB 4AFFA 2KH9A 5KFTA 2EKYA 1QVGM 2IM2A 2M70A 4EBEA 2YHWA 3HMJG 3BH7B 2HIYA 2QWNA 2IVNA 4KO0B 4H4OB 1R7IA 4WE1B 4B3MJ 1HKCA 1N32F 1FK9B 3RMBA 4X4OA 1GX5A 5K14A 4DU7A 4NLQA 2GTDA 4IFEA 3HPOA 2FQQB 4GMKA 5CAAA 3MXIA 2Z56B 3BGRA 5F3ZA 1HQ2A 2ZM6K 5KFJA 1S5ZA 3WEEA 2ZDOA 3I31A 3P31A 3CC2N 4KHYA 2ITMA 4Q5VA 4DU4A 1X31C 4URQU 2YHBA 4GVBA 2FF6A 3OVSA 2OA8A 1BMQB 4YR0A 3MM5A 2XZWA 2VKZG 1RWMB 3CQXA 4B9LA 1U1LA 2XQCA 2OFGX 1NGFA 3BDEA 1VSJA 3CDAA 2ZVIA 5LSRA 3R3TA 2J0SD 5HLFB 4LF6J 4UZCA 2COLA 2E9TA 2DNRA 3I6PA 5KFDA 4DR6J 4JK7A 1W97L 5CZXA 1U1MA 1HD1A 1U6BA 4DTPA 2LLZA 4YY3J 3H59A 3J7Z5 4XPCA 3L2VA 3KLEA 1E6YA 3H2LA 2MQOA 3WQPA 4PXEA 2I2YA 2FHOB 4XO0A 1D9AA 4NCBA 4EGLA 4FK4A 3QT5A 4J37A 4ANCA 4NLXA 5BJRA 1T05A 4NA2A 2W2QP 3TVZA 2UUBJ 2XB2D 5FRNA 5G0RA 1P1LA 2DY1A 4JI3J 2RD5C 3W1YC 5DQGA 1NU4A 4GVLA 4NLPA 4HUFA 3D1QA 1ZBFA 3MMJA 4EZ6A 1O13A 5HROA 3ENQA 4BR4A 4IFYB 2DGQA 1XHZA 2ACMA 3GJQB 2D7SA 2MKKA 4ECXA 4FJKA 3ASMA 2P9IA 1N34J 2A1SA 3MX2A 3NFAA 4XAKA 4WK1A 4QIFA 3R6GB 4NI2A 3F9MA 4LR7A 1NNEA 3AA8A 3VF6A 2ILYA 2HW3A 1RCOB 4CJPA 2F8MA 1T9TA 1WG1A 4NL5A 2LEPA 3MM7A 1VOMA 4OX8A 1S22A 1FKOB 3TA0A 2AP6A 4HYKA 4IWVA 5L39A 5HRSA 3D0PA 4NXNF 3DHWC 1M5HA 2JOQA 1VQKN 2D0AA 2NREA 1LWEB 3FKBA 3EICA 2FSKA 1FE4A 3IBFB 1UKUA 1KWMA 1Q95G 3K0JA 4DV0K 2QWOA 3D1HA 4NASA 3T1YK 4M3YA 4FZVA 4OLOA 2DH7A 3EGVA 1GLCG 2XLKA 2UXDF 1FFWB 2F8EX 2FJBB 1IKYA 2ZHBA 2X74A 4RNMA 1UZDA 4CHOA 4ECZA 3DYAA 1ZM2A 3Q24A 2M8DB 2DHSA 1UJ4A 4A48A 2ZDPA 5IWAF 1VBZA 1NMDA 5BYSA 3F2KA 2MHNA 3L6QA 2UXBK 2B4OA 4FYVB 3Q22A 5K9FA 1U04A 4CLFA 4H03B 4USIA 1HX1A 4O8KA 1RT3B 2CPEA 3EVWA 4OYIA 4U67Q 1HNWJ 2FVRA 2HHPA 3OR2A 1X1PA 1JLQB 3RSEA 1ATNA 1NOYA 1U49A 2IVOA 3DRRB 1UVMA 3OUYA 3BBFA 3VWSA 1HQEA 2AU0A 4K4ZA 5H9EK 3TEGA 2E6LA 2P5VA 1YJ9N 3QGPA 2GA7A 2YH1A 1G4CA 4ANDA 2HAIA 3GFYA 1LKZA 4DV3F 4JKDA 1WF1A 3E9LA 3TR5A 2F9JA 1JCEA 1SQKA 3V5RA 1JLFA 2B6AA 4OJ3A 1VQ7S 5KT5A 1FXXA 1VFJA 2D1CA 4DR7J 5L46A 4YHHJ 2DR7A 3SZ2A 1Z2LA 3ENBA 4WPAA 1U1QA 2C2MB 3PW5A 1UA0A 1AZSB 4W5NA 4K7QA 3HVAA 1NOZA 4JHDA 1V3RA 4KHMA 2CIMA 3MMCB 1N5SA 5KFWA 3AOCA 1GXTA 3E1YA 1NB2A 3TAMA 4WFBQ 2VC0A 1P27B 2I38A 2DR9A 2UVVA 3I9V9 1TL5A 2VG7B 2OMOA 2DTJA 2E20A 2VOPA 2VPWB 2ZH1A 3KLVA 3VCDA 2I5JB 1IBKK 1ZM9A 1RBAA 3O4QA 1FX4A 1SH2A 1XR6A 2QSFA 1IR1A 3KLHB 2IRUA 4B1ZA 3F5TA 4PEOA 1BXNA 2AYGA 4DXLA 2IVMA 4FF1A 4FO0A 5IM0B 2LFVA 4CF2A 2RS2A 5DM6L 2C2RA 4RBTA 2YX6A 4FJ7A 9RUBA 4IDKA 3MN6A 3KIOA 3IWXA 1HYVA 4DV1F 2HSTA 2G2YA 2OZSA 3ID8A 3WNFA 3HT0A 4EUVA 3SQOP 2YQ0A 2X1FA 2J7WA 3RVCA 2MKJA 3CVKA 2DNQA 3CCZA 3CJTA 2FF3B 4GC6A 2WVBA 4M5KA 3U9ZA 2I1RA 3AB2B 1HQUB 5GAGP 1FKAF 4LSLB 1SL2A 2BANA 1EHWA 1F9EB 4IO9Q 3AJ2A 4DKWA 2J0QD 4CERA 4UY8T 4Y34A 1T8EA 5HRPA 2MKSA 4CHPA 4E1MA 1SH0A 3VAHA 3I87A 5HMYA 4EI2A 4FK0A 1JJ2M 2PI5A 5GAGI 4WFNL 3QIOA 2E4LA 3WNHA 4O5BA 1N5YA 4B3OB 3KJVB 1FFSB 4CEOA 3JYTB 1WUUA 2GO9A 3AODA 1KSPA 5A0YB 4DX6A 2AGOA 5CYQB 2HVEA 2B4VA 5K8OA 3FRZA 4ZPWR 4DCOB 3J80O 3KK2A 3C19A 4FPAA 3AAQA 4MIBA 2HGLA 1Q8IA 4CH7A 3KK1B 3GG4A 4ZK7M 4QWBA 3ITHB 1T94A 2DIVA 3QYYA 3PFEA 3QESA 2PMWA 4DUYF 3F41A 3M2VA 5F1XA 1HUXA 2WAQD 1HNXF 1GLEG 2EEYA 2BZ2A 1TKZA 2NXUA 3W62A 3A13A 4M5DA 1HNZK 3HOSA 1GLAG 3C7NB 2NZTA 1S72N 4A5BA 2EPIA 1RBOB 4HVJA 4M94A 2DPJA 1S1XB 4A46A 1FCAA 5BRHA 1YJUA 2IDEA 4RW9A 3MR2A 1F5CA 4CBWA 3IDHA 2DFFA 5KGWA 2G2OA 2RU3A 2DNMA 3R1XA 4BS2A 2FC9A 3AT1B 1BWFO 4KREA 3R9PA 4X64J 4HWIA 4KHUA 4OX9F 3L09A 4HL9A 3RWUA 1OY8A 5F0UA 4FBTA 4FPRA 3SI8A 2G8WA 5AQHA 2ZWPA 4PPZA 3QIPA 3BKTA 2R2UA 1REGX 2C42A 2LQBA 3GYNA 3H8YA 4LFBF 3LW5C 2EWHA 2P9NB 4JRPA 4BRGA 2OD4A 2YX7A 2ZNZA 1XUPO 1HW8A 1EP4A 3QT8A 3TVKA 2GIFA 1D0EA 1HHTP 3I0RB 1FJ7A 2VA3A 4USMA 4K4WA 2E9ZA 1RTJA 1B0TA 3JSYA 1N33J 3I4PA 4AYBD 3VQ7A 5HN0A 5LM7E 2CZ9A 3J80Y 2DGUA 1EXQA 1WSHA 3PCOB 1PBAA 2R9LA 2HRUA 4LF6F 4ZVQB 4ZVUB 4DCJB 4YORA 4DR6F 1CZBA 5D77A 4HT7A 1VYAA 1XQSC 2AP1A 4YY3F 2DCLA 1K8KB 2QIFA 1KQGB 3NGKA 2ZH9A 1RGVA 4DR1K 3R8YA 3ZZ0A 1TVRB 2QL7B 4KH4A 2E6MA 4QS8A 4PR6A 3CCQS 2Z2YB 3WZ0A 3CCUS 3M2UA 5CYJA 5A8RB 2AGPA 2CG8A 2DNKA 2HVZA 4Q45A 1NPRA 2RF2A 4H4MB 1TK5A 4P9SA 1HW9A 1QVFM 4USWA 2XNRA 2UUBF 3CJ7A 5IT9U 4NXMK 2SXLA 4JI3F 2CQ4A 3V9XA 3V81A 2B43A 4Y6IA 1Z25A 4DV2J 3OTBA 3ALYA 5RUBA 2LCWA 5E2QA 3KNGA 1XNQF 4BVPA 3L3CA 5CR4A 2KXNB 2QLBB 4DL3A 1C0FA 1SL1A 4RNHA 5LJ5Y 1KLMB 3MCAB 1N34F 2W9BB 2NLWA 2FPHX 4IO8A 1KFDA 5E3AA 2W2PP 3CCJS 3UPFA 1H2TZ 4ZOSA 3QLHA 4JD2A 4JB8B 4F25A 5GAHP 2OH2A 3D2FA 3UNYA 3KHHA 1G3OA 3VGVA 4WQ5A 4M63C 1DURA 5HMWA 3TTFA 5JS1A 2P6TA 1TL1B 5IV4A 2DFHA 1IKVA 3M8SA 2V4JA 3MCNA 2F8TA 1RDUA 3P3DA 4P2MA 3O80A 3JAMO 3FFKB 4HACB 3PRDA 4FOIA 3G6EN 4B3TK 1NSPA 3VV2B 3FZ2A 5KFRA 4CO2A 1SZ2A 3RAXA 4CZKA 2BX6A 1BU6O 2JWLA 4YR3A 4B9TA 1X4CA 4OGCA 1EETA 3PXGa 2D0CA 2J0WA 3MN5A 3ULDA 3GJRB 4GVEA 4C8OA 3DXKB 4K4TA 3UFCX 4K4YA 3AA4A 2CKWA 4F4KA 3ZTOA 3HZEA 4IOXA 3E66A 4ECRA 4H8KA 2HNYB 3GIIA 3TOQA 4JI5F 1NNDA 4MTPA 5BRFA 2CXEA 1CJKA 5E0OA 2DNPA 2FC8A 1BIUA 3SXLA 4QAGA 1Q1KA 3C6TB 1SVDA 5EXWA 2PN6A 1X3NA 1YJRA 5HMZA 1LWCB 1S1UB 2ASMA 3MECB 3HSDA 1LCUA 3MR5A 2R4FA 1AYEA 1FRHA 4PZVA 4E1JA 4RTFD 3HJVA 1HNWF 2UUAK 1ICEB 3G4SS 2HS4A 4X65K 1U8SA 3RB6A 3F9KA 4WYLA 3NG8A 4JI2F 2P9KB 1SXLA 3CCMS 4PRFA 2OPSB 3WNEA 4E7KA 2H51B 3DGVA 3CMEN 4YMEA 2ZHAA 4BVOA 5LMNK 1GXLA 2YKMB 3NVKA 1HNVA 1R0AA 3O44A 4USKA 1QQMA 2QEXN 3PEJA 3JAMY 3DLEA 3ZETB 5I42B 1NJWA 5HBMB 3BZKA 1WSGA 5FJ4A 2GQQA 2MZSA 4JN4A 4M5LA 2X1AA 4DR7F 2N4CA 9ATCB 3KJNB 2FBTA 5DZ6A 5EX3A 4ZTFA 4Q2LA 3P96A 4OZ3A 4XPEA 3DMJB 1N0VC 4ZDNA 1SPBP 3LWMA 1XMQK 4OMFG 1FWPA 3H0PA 3OXGA 3D54A 3HLUA 3LP1A 4DV7F 1BG3A 2RQKA 4DR3K 3OTOF 3CM6A 4TN2A 1SB6A 2GVDA 1MWQA 1TTHB 3QJJA 1TKXB 1FEHA 3VQ5A 2IMOA 1LWXA 4I2QB 2DRAA 3OR1B 3KYLA 4ZITA 5BN8A 2W4CA 3OFEA 4AQYJ 1S1WA 4XEIA 2FHJA 3KLIB 2QMWA 2DPIA 3A8EA 1W9HA 4YB6A 4ED2A 2O01C 5AZIB 4EBDA 4M3WA 2W41A 4TU7A 1RBSA 1I3AA 3ZSVA 5DMRA 2Z1IA 3M8PB 5H9FJ 3OV7A 2VQFK 5DM7L 2KLAA 3PX4A 2V67A 1RTIB 2DK2A 1YRXA 3OHAA 5D6GA 4ECTA 2BTFA 5HL7Q 5THWA 1C1CA 3W2WB 2MQLA 4G65A 4OJGA 3BZQA 3QGIA 4L74A 5ETKA 2BQ3A 4D3GA 4G1QA 3UE2A 3AVHA 3AQPA 1PC4A 1TYQA 2QXLA 3OYJA 2CQPA 4RW8B 1GT8A 4IRDA 2BE7D 3TVYA 1I5OB 2CFXA 1U8WA 2C2ZB 4DTJA 4C98A 3GR1A 1ZH5A 5K8PA 3KFWX 3SYZA 4JI7J 3OW2M 4IO1A 2YHXA 4K0KJ 1MU2A 5LSLA 2IM1A 2KG1A 2MB0B 2QV6A 1Y10A 3ENHA 2E7WA 4OKEA 3SPZA 4WP3A 3N01A 4DV6K 4RNFA 1J9AA 1Q8KA 1FNMA 2K1RA 3TJAA 2VBZA 2Z2MA 4OYZA 2GGPB 4OO1J 3CJSA 3GSIA 1KVIA 3HSTB 1TK8A 1TKTB 5C25B 3P45B 1FRKA 4O0IA 3K5MA 3K5OA 1VK8A 2CDQA 3ZTSA 1YHQS 4DTSA 1XEZA 5T7BA 2BVZA 3BJYA 2WBNA 3T1HK 5D3GA 2NUHA 3DRYA 1PJ5A 3EE8A 4PQAA 3EJMA 4CF9A 3G87A 2V68A 2BOAA 3U1MA 3CPEA 4CJ7A 4ZPBA 5KFVA 3BSOA 1TR0A 5M1QA 1LW2A 5KFYA 4W5OA 2GAGC 1JL1A 1UAXA 3EGNA 4KTZA 3A3PB 4Y2MA 2AX1A 3J7YP 3CSKA 2DR5A 2WONB 3C14A 2OEJA 4H0PA 5C24B 2J6UA 4CHNA 1U1KA 1NJXA 3K5LA 1QDUB 3J7YI 1W7AA 4C0HA 3BQ2A 3DOMA 2XY7A 3PEHA 1TELA 4NYNA 1RK8A 4FWLA 1Q16B 1RHKB 3ZX0A 3F44A 3KXDA 5HVGA 4DLEA 3GBTA 4BC2A 3ISZA 1HYSA 2N3OA 2HOEA 3BB5A 1NWKA 3KK3A 4FVMA 3CCWA 1NU0A 3AVLA 3VQBA 3EVMA 1N33F 2DXEA 4H0OA 3DLGA 4I4BA 4J9UE 4ERDA 2X1GA 4DR4K 3H98A 4IOBA 2IJRA 3WX8A 3IS9A 4UOFA 3AA9A 1K6YA 3NNHA 5AXKA 3O1WA 3OYDA 1N48A 4JI8J 3QO9A 4ZIWA 1ZBLA 1KS2A 2RDIA 4ZLNA 2FJWA 2DNZA 3HJFA 4X62K 4DV4J 1XN9A 3JS9A 4BR0A 3G82B 3GWCA 3M05A 4CO1A 2ZGYA 1KRPA 1K9MO 4ICLB 2KJWA 4A2BA 3MEGA 3MMAA 3KD1E 3T6JA 4IEEA 3PV8A 2V0NA 5LJWA 3MMBB 4LBHA 4FKYA 3EYZA 2W8KA 2DCUB 2AA4A 3VEVA 1N32K 1Q86T 4KFBB 3FGUA 4RKUC 3CFRA 5AFUA 4BRFA 3ILLA 2V9WA 4B9SA 3CCLS 4DV2F 4OJRA 4ES1A 4LIWA 4A8MP 2WVDA 4DN9A 3RB0A 2D9PA 2IAJB 4DPWA 3BEXA 1ZPWX 4BROA 5KFIA 1J5EK 4I9QA 4CCHA 1PKUA 4QS7A 2AYMA 2R7SA 1WEXA 3RR8A 2RRBA 2MZJA 5AXNA 1H1VA 3B82A 3QPIA 2AZ1A 5FDLB 1VQ8S 2J9DE 4JKBA 3ID6A 3QBCA 1U47A 4HH1A 1SUQA 4Z4GA 3R1LA 4BDZA 5KT4A 3BSCA 2VASA 1PYTA 3DRSA 3HRGA 2YBVA 5DGAA 1RTHB 3UN2A 2Z1GA 1U24A 1VRTB 2FZKB 2HGMA 4K43A 2K3KA 1RTZA 2V94A 4I6MA 5AQXA 3VQTA 1Q9XA 2KB2A 4USJC 4ID5B 3CC7N 2O8CA 3LANA 1VBYA 2BBEA 3I82A 4A57A 4FKXA 2L08A 2H4WB 2BABA 3PW4A 2JLFA 3H45C 3SMSA 4BY9C 3CD5A 1MA9B 1HARA 3ET6A 1G7CB 1NDCA 4KH1B 1JXEA 3PJXA 3DLRA 2NXJA 4WFYA 1HHSA 1VBXA 4DU1A 4W98A 3ZCMA 1W2BR 5AXLA 3FEYB 3HHLA 3NGDA 2PA8D 2A1BA 4HTUA 3D3CJ 2V7ZA 2V50A 1QAJA 2DHHA 1AFJA 4LFAJ 1URNA 1NGJA 1EAYC 5CYMB 1VHIA 4L75A 5AE1A 3R2DJ 1FXRA 4FZXC 3SEOA 3RG6A 2Q2RA 4M7YA 1KR4A 3NAHA 1XIQA 4JI6K 5GAEI 2YXLA 4GMJB 2W40A 1IWGA 3LUYA 4I7FB 2LKZA 2O8DA 4FM1A 2WRMA 2YCHA 1RACB 4NXNK 3HT3A 4IR9A 3GL1A 1SQFA 1VS3A 1IBLJ 3ZZPA 5KI6A 3CPWR 1O5JA 2V2QA 2Z8QA 2LMIA 2W9CB 3F0NA 2H65B 3FFIA 2YNGB 3FC9A 5LOQA 3WXKA 4ZJLA 2UXDK 3HSCA 1J27A 5GINA 4PXCA 1B70B 3JSRA 3I56S 1VRUA 4N8NA 1TZ0A 2OD6A 2ZOFA 2YKPA 1ZTTA 1F0XA 3SQGA 4CECA 3CD6S 4KKOA 4JKEA 5E7OB 4A8KA 5E26A 3OTCA 2HF4A 3ZX2A 2JHEA 2EK1A 3C6HA 5BXIA 3MM8A 1PC5A 2IVFB 3R97A 3DDKA 1VJQA 1Y5IB 1ELOA 2ZITA 4Q0BA 2DTUA 2Q36A 1XHXA 5KT2A 4B9UA 4LVNP 1HYZA 3TQEA 2FBXA 2OPRB 2KFNA 3OYCA 4DR2F 2X6NA 4C8KA 3L2QA 1KN6A 4JI4J 3O2IA 2GIRA 4M42A 2HNZB 2UVUA 1QSLA 2ZZNA 1QAXA 4M8LA 4RCHA 2WK4A 2BW2A 2BJ3A 2NXNA 5AQOA 2NRXA 2RE1A 3MOJB 4RR5A 2L41A 3MPDA 3OYLA 2H5EA 5F8IA 1DLOA 2MYFA 2QYGA 3OXFA 3ZXWA 1HBMB 4LIRA 1GFWB 2JVOA 3UDVA 1WC6A 2QI2A 4URGA 3T5JA 1BC6A 4IOCQ 3R27A 3MZIA 3OY9A 4TU9A 2AWZA 2V8DA 5K14B 1WAJA 4DBQA 1CLQA 5KGXA 3VEZA 4C23A 4AHSA 4E98A 2B9WA 1FD8A 3BGRB 3PYFA 3CJKA 4FBUA 3WEEB 2VWBA 2CGKA 5KAKA 1XI1A 4Z4FA 2CWXA 4LF9J 4IUFA 4K25A 2CWKA 4JBCA 3VQ6A 4JI7F 2XBPA 3OLBA 4K0KF 1CJTB 1UL3A 2UYTA 2O8FA 4CP5A 2L48A 4DPTA 2XZDB 5T7LA 5KFOA 3AVGA 5AQMA 4J9OA 3NCPA 2OLWA 5KG2A 2KFZA 3ULEB 4O0JA 4J5OA 2GCFA 4CJ4A 4ZHRA 1PAUB 2QMUB 4O8UA 3I8DA 1RT6A 1WSIA 5ETSA 3J7A1 2XY8A 3VVTA 4PG8A 1E6YB 5EOYA 1MWYA 4QJVA 1IKXA 1IO2A 4FXVA 2HHQA 1IH7A 3I4HX 3KUHA 5KPRA 2R8KA 2ALZA 4OGEA 2Z58B 2L3MA 3UD5A 3UVJA 4ED5A 4CESA 1TV6B 1M1GA 3M4XA 4DG1B 1T05B 4DU8A 1H98A 1UEVA 4CLLA 3CCES 5ADXA 3CCVS 1Z6RA 3E01B 4BRHA 5LY3A 1NK7A 2DH8A 2CH5A 1BI4A 1C0GA 2X3GA 2RKIA 1R27B 2E5LK 1FRIA 5KTQA 2F7TA 2J0XA 1DY3A 4H54A 2E2PA 4RW7A 3IRXA 4NLOA 2V8VA 4CZEA 2G9OA 2P9IB 2G2ZA 4GO7X 4CO0A 1RBTA 2EFVA 1XC9A 4QYZJ 3N6LA 2E5HA 1JMTA 4HVZA 4TVAB 3CCQN 1UPPA 4DV5J 3EDQB 3PLAA 2XLJA 2O8EA 2JH3A 4OHWA 3THXA 3RMDA 2JWKA 2HMPA 1APSA 3U9DA 1FXLA 4DUYK 4C0OC 2V4QA 2HMIA 1HNXK 3K89A 4DSFA 1NZAA 4JI8F 2HBYB 2QMXA 3DLLQ 2JEJA 1H74A 2KI2A 5GIPA 4DV4F 2V8HA 2ASPA 4J9RA 3SQ2A 2IVYA 2W2NP 1R6VA 1VDHA 4KHRA 2DNOA 4RUAA 1XR7A 1N5TA 3CCJN 1HD0A 1JLEA 2G8UA 2NRTA 3DYAB 1XMOJ 1BQMA 1WOQA 1S48A 4B3MK 4HT5A 3FMWA 3NEKA 3OJUA 2EKNA 3JS6A 1WEYA 4DSEA 4DL2A 1U4BA 1NO8A 1CLFA 4HR2A 4LF7J 4EP5A 1X4GA 5JVHL 3PX0A 2OMLA 5AQZA 4LFBK 4QZVB 1IUJA 1HI1A 2QYCA 1HWJA 2V6AA 4CLTA 2W7PA 1WELA 4C6AA 3RSEB 3EZWA 4GV9A 4F0MA 3T41A 3LP2B 1DTTB 1C2PA 3VQSA 4CF1A 1C1BA 2KYZA 3D68A 2V9KA 2D4WA 1TFYA 4B1XB 4DOZA 1S6PB 3R5AA 4LF6K 2RHKA 4DR6K 2V2VA 5J2QA 4A8QA 3MGJA 3BO4A 1WORA 4EHTA 4YY3K 5F3TA 4ED8A 3NDKA 3M8ZA 1JLFB 4O3SA 4UZBA 3LWLA 5IOLA 1KONA 2O5DA 2DBBA 1C0TB 3H2VE 4Y65A 1JNZB 2WHOA 4BC7A 4ZCKA 4FXDA 5DDQC 3CXCR 3THYA 3AO4A 4JHDB 4DSJA 2UUBK 4C48A 4FLWA 1EX4A 1LW0A 1W7WA 4JI3K 4LRAA 3SDEB 1S6UA 3ZTRA 3IAM9 1SJRA 4I6AA 5B0DA 2GX8A 1FNXH 2EBEA 1YTAA 1Q5VA 2VU5A 3CGIA 4I0WA 2DB1A 2YHAA 4H0VB 4CTAA 2BA9A 3NL0A 2XMJA 2IM0A 2ZJRL 1WC1A 5KFBA 5J2MA 2XSFA 1S12A 1N34K 3NWGA 4FLYA 5IT4A 4KHPJ 1KVKA 2YY3A 2DIUA 3M1FA 1RAAB 3HO1A 4LFAF 1GH8A 5E5NA 1HNIA 2VBYA 1M90O 4F36A 4RNNA 1EO1A 4U9RA 1I94J 1OH5A 1A5XA 4IDKB 2ABYA 5HATA 5AQUA 3THPA 3MX5A 4LY7A 1NKBA 1JCGA 1RB0A 1ITGA 3CCSS 2X51A 1QQCA 3WDOA 1YQHA 4FLVA 3R8EA 3KVGA 4FYYB 4ID8A 3ONQA 1MMNA 1C0MA 2VIHA 2YWWA 3VPZA 2RUGA 3G96A 2KKHA 2ZZTA 1CEZA 1HPZB 4MKBA 1GLJO 3J81U 2FVSA 3I0SA 2RDDA 4JI5K 3SMPA 3VQ4A 4E7JA 3Q23A 1B7FA 3TAEA 1N8RO 2HNDB 3L4IA 2E1AA 3JTOA 1SC4B 3FJ2A 1VQ6N 5DJBA 3TZXA 2J9CA 1XC3A 1R59O 4OI4A 4V19J 4TQRA 2NPIA 3SSQA 1ZETA 2XMUA 4ISEA 1HNWK 4OYWA 3LA0A 5CCMA 3DU5A 4WZQA 1M1HA 4W5RA 1RLDA 3CT9A 2WSCC 5J2PB 4FW1A 3MXMA 2GWKA 1YG0A 5E3CA 4B9QA 2WOMA 4FJJA 1F1BB 3NWRA 2ZC3A 2HQFA 2F7VA 2F8SA 5HANA 3VN5A 3I5AA 2QSWA 3OXLA 5HAOA 3CDWA 3V6JA 2JC1A 3W9IA 1E3MA 1HWKA 2BJEA 1WAFA 1VQ9S 4RW9B 3KMQA 2VWKA 2EWSA 2V52B 4KC5A 4CJ5A 3V1QA 1IN0A 2FHMA 5AQYA 4DR7K 4J9SA 4Z7YA 4YHHK 2LQ5A 1NK0A 2FLPA 2IOCA 4KGVB 3JB9k 3GYGA 3CC2S 2YJFA 3Q8VA 3VZHA 3Q8RB 3SUQA 3NH2A 4CJFA 3NF9A 3W9JA 2ZH7A 3TARA 4F04B 1LV5A 3KWGA 3QBXA 4GVMA 3D1OA 3GIRA 1U0SA 3MAAA 2E1YA 4E7IA 4QPTA 2LQ9A 2Y0BB 2AGQA 4ZPAA 1WHVA 3W61A 1EP4B 3IFRA 5EHHA 5AFUH 1GLFO 3MDQA 2UXBF 1EQYA 1RTJB 2FIUA 4CLUA 3OTDA 3ZEUA 1GAOA 4F0KA 4DN0A 3NS7B 4WZMA 4KQZA 2W7OA 4KHNA 4GY2B 2BGGA 1RI7A 4CJLA 3ZNJ1 1FRLA 1KC8O 4LH5A 4CFBA 1UA1A 3LP0A 2MSSA 3EN9A 3PSIA 4J90A 2RT3A 3PO5A 3EXYA 2A10A 1IJJA 4HKQA 4CGIA 2F8HA 3KLFA 2MLZA 4UOGA 2VHGA 4O3RA 3M8QB 3UDCA 4KRFA 3G8SA 3L7UA 3OS2A 4ES3A 1SKRA 4UT4A 1TMJA 2E5JA 5DG8A 1OH7A 4CH0S 2QTDA 3AAWB 5D4PA 2RF2B 5E84A 1Y9OA 5F0XA 1B0PA 3TANA 4ITSA 2CZVC 2CPJA 4ELTA 1K9MT 3L4BC 3EGZA 4NLUA 4ILMA 3LOUA 1MWMA 3SIPB 4B17A 3CIPA 4R25A 1M5SA 4DX5A 3O08A 4MO4A 1FDNA 3DOLA 3SAFA 3ZSWA 5KFPA 4HHHA 2E2OA 2EG1A 3CFPA 3RBXA 1WOOA 4WJBA 5KT3A 4KGKA 4C8NA 3E2EA 3IBWA 3M6VA 2QW9A 3LGNA 3MEEA 1V9OA 2P9PB 3EXCX 3I9ZA 3VGSA 3HDSA 3TTCA 3HHDA 2C2DA 1R8CA 2UUCJ 2G0CA 3EVOA 2YKAA 1TP7A 4DV5F 4CM2A 3IR5B 3Q8YA 1P90A 3D2FB 3L3VA 2BJ8A 3RW6A 3IG1A 2ACYA 4UW2A 2KTQA 2ZE2A 2HFSA 1F2HA 5A8WA 4DL7A 4XK8C 1RKJA 3G8QA 1BD6A 5KT7A 3CCLN 3PDNA 2ZKTA 3NRBA 1FA0A 1QVGR 5CD4H 3WC2A 2K8GA 1QD1A 1CVJA 3VMFB 5FRMA 4CEBA 1RHRB 4DR5J 5FIIA 2LSNA 2YKOA 1VK0A 1EETB 3CUNA 1BQXA 4ILRA 1FNOA 2DO4A 3TYTA 3RMAA 2KL8A 3K57A 4FS1A 2DR8A 4CWBA 1S9EB 1S5JA 2XYHB 5K5MA 3ZZZA 1VQLS 5AT1B 4RG8A 1XMOF 3ZSOA 2VFVA 3OFGA 2WVCA 4CGGA 4X64K 3PIOL 2H9ZA 1CJKB 1X5OA 1VSFA 1NKCA 2G0JA 1HHQA 2GC8A 4F3QA 4WFAQ 2WZ1A 1REVA 1AB8A 2JEIA 3NH0A 5C7PA 2YPYA 1NK5A 1NK9A 2FJVA 1WDDA 3HHKA 4R5PB 4NPOA 1KTVA 4DDFA 3T19A 2GAHC 2XI2A 1NGIA 3VGLA 1YJ9S 2L9WA 3SK3A 3UKUB 2VODA 2JGUA 1DAXA 3OS0A 1FT8A 3RBDA 3DDIA 2IDOA 3KJFB 1VLYA 4X4NA 1UVIA 3QRQA 1M5PC 3ENVA 3T6BA 3U02A 3NAIA 1N33K 2MZTA 2D3ZA 2W4DA 4NE9C 2CAJA 2GQ2A 2HHSA 3VQEA 3AVFA 1R8BA 4X66F 1O8BA 3D7EO 1WKJA 2CNOB 1UETA 1P8GA 2EX3A 1DGKN 1SJ1A 5LL6Z 1U02A 4TU8A 2E5GA 1FDAA 3OYEA 3DLEB 1UFKA 3AVIA 1FKPA 3P1GA 5J2NB 4H4KC 2CJKA 3NGSA 3GE9A 4WQ4A 5CZVA 5KFQA 4Y0WA 3D4JA 2B5JA 3MM6B 3ULHA 1IM6A 1YKWA 3GV5B 4FJNA 4PYDA 2CNLB 4EFAC 1SJQA 4OKJA 1DZ5A 4ZPVR 1NUEA 4EP4A 4BC5A 2IM3A 1S99A 2W42A 3VQQA 4Z4IA 4ECUA 1SIWB 2ALYB 3R7SB 3DOKA 3B8HA 4DFMA 3MFIA 2O67A 3W8PA 3LDLA 4ZP7A 1U2VA 1YJWN 2VFUA 1FF2A 4YS2A 4DV2K 4J91A 4XH4A 1VQSA 3E8OA 2KHCA 2DHAA 3NGIA 3SAGA 4K50A 2FSJA 1XTZA 2QWQA 1U2RA 1WI6A 3SSSA 4KHPF 3GJSB 5GADU 3PUFA 5I3UB 1KCFA 1PYOB 2ZNYA 1I94F 1KQSM 3QAEA 2JEFA 4I64A 1ZAVA 3J81j 2BR0A 1FEEA 2D74B 4CF8A 2L9DA 1S97A 5HSPA 1HRHA 2CDRB 1EKEA 2MTLA 3CTRA 1YGYA 3CMQA 1HR0J 4C1NI 2P9SA 4B8CA 4CYUB 4NA1A 4G1QB 4Y0FA 4ZP6A 2V51B 1QE1A 4F0HA 1GMUA 3ENOA 3UR3C 4M7XA 1OPIA 2AW0A 4IJAA 2DNLA 1VQNN 3DDNA 5LT5A 1OIAA 2PFDA 2QLFB 4NLVA 2ZBQA 4UY8O 2CJXB 3MHYA 2PFUA 5KOWA 1V3ZA 2BDPA 4CEEA 4Y1DA 2DGSA 4DS4A 3VVUA 5HQMA 2IA6A 4FZYA 4LD0A 1N4LA 4DF4A 2HHVA 3QRPA 3NF7A 5KFEA 2DT9A 2RH3A 3MM9A 5M2UA 1S72S 1AUSL 1Y5LB 4TLQA 1RDBA 3QNWB 3VHQA 1S76D 4K8RA 3A3NB 2XMWA 2KHDA 2MJUA 2XRIA 5AXMA 1RFQA 2RPIA 4U8YA 3PIPQ 2ATCB 1RWNB 1V5IB 3UW1A 5L1KA 3D2WA 2Q0RA 2FXUA 4KGZB 2W1BA 3TA2A 4BGAA 4P7TA 2GIQA 3IGNA 3BKFA 1EIYB 2DNNA 4YB7A 4V19X 1WBDA 3MPUB 3HHNB 1QM9A 3MXJA 1SS6A 3POTB 1UZHA 4KT0C 3VF0B 4I68A 4WCEL 3NY0A 1VQ4N 5HQLA 1NM2A 2BQUA 2CH6A 4OYPA 3ETOA 5MLCV 4R8UB 4AF1A 2E66A 1HMVA 3PYGA 1RU2A 2ZBIA 3PSFA 2B7CB 2HZCA 4CBUA 1A7GE 4JUZA 4DI6A 1NMNA 3MR3A 3U8XA 2DY4A 3NS6A 5F8LA 1AROP 2CQCA 2KT2A 2B4JA 5L8RC 3M3ZA 3GJTB 4M1KA 3TAGA 3DLGB 4CEFA 1ZA1B 4DQSA 3A0IX 1B64A 2EK6A 4KBOA 3SNNA 1TU0B 2HHTA 2PFFB 3HVWA 4QIWD 5H9FK 3O9QA 4O44A 3THWA 3QO9B 1XQIA 4HUEA 2O3DA 3PM9A 4DQ8A 4BG9A 1RKIA 3JXOA 4N7TA 4F02A 3OBIA 2XO7A 1JJ2R 2VL1A 3ZZTA 2P1JA 3D6HB 3V4MA 5LMNF 5JVGQ 3MEGB 2VH7A 1VHFA 3O4WA 3GIJA 2PMHA 4OYOA 1P9QC 3C16A 2O8BB 1PJ6A 5DLGA 3IAS9 1JLAA 1VR6A 3NH1A 2CPDA 3FBFA 2C22A 4FWRA 1J6ZA 1JLCB 3LGMA 2VZ9A 3CI5A 2Q6BA 4WXOA 1XMQF 1VSLA 4WK3A 2ROPA 4JI7K 5BN9A 2OTJS 4K0KK 3GFXA 4UUWA 4ZS6A 4DL5A 2NSBA 2UUCF 4KO0A 2MMYA 4H4OA 1F2GA 2O4IA 4OZNA 3RGIA 2ZUAA 1JLBB 3UCGA 2XCPA 2P9LB 3G6ES 1FK9A 1EJ7L 1S7HA 2KO1A 2XCAA 2XS7A 1RAIB 2FGOA 1HI8A 4GKJJ 4P52A 4OZ1A 4CK2A 4M5HA 3OPKA 1XNRJ 3SMZA 2QFIA 4O4RA 1KOHA 3W7BA 2DNYA 1CXUA 3RRHA 2QXFA 1DTQB 3QFHA 4FXWA 2R2RA 1W2IA 3SCXA 4HTLA 1QAYA 3OTEA 2R7RA 1RAFB 1BDGA 4DR5F 4I6MB 2VQFF 2V8GA 2PY5A 4LMZA 3M2RA 5H9EJ 4OZ2A 4BR9A 4QCLA 1MWKA 5KFLA 3OSPA 2FBYA 1JJHA 3EZUA 1WF0A 3TWZA 1C4AA 1CC8A 2JFDA 4TKTA 3QRRA 3S3MA 4K8ZA 3RAMA 1CSJA 3PR4A 2HWTA 3M9OB 1LEOA 2W2MP 1NLKL 1FRMA 3L4QA 4N77A 3MD3A 4K2JA 4JOUA 5KFSA 4JV0A 4YP3A 3SJJA 3CD7A 4F4YA 3BY5A 3H3NO 3HL8A 3Q89A 1JNRB 1RHJB 1RT2A 3LPUA 4BE0A 3HVTB 1LFWA 1M0SA 1BUPA 3IR7B 2CJBA 8ATCB 3WUHA 3NMRA 4QWDA 5MLCQ 2QEXS 3L9ZA 1TL3B 4P2XA 3OYMA 4R79A 2O4GA 4C8LA 2VYPA 4IFYA 2UU9J 3TA1A 3W60A 4DV6F 2ZJPQ 1H38A 1U2FA 5FLXO 3JSMB 1F3VA 4JI8K 4FWQA 1IBKJ 2OCEA 4O0NA 1QVFR 4Q43A 4DV4K 4OPKA 2WFBA 5D4OA 3AOAA 3DJCA 3MK6A 2VWJA 4DB3A 3M6UA 3LQVA 1BQNB 4H4KA 3MR7A 4PWDB 3KJQB 1VRUB 2JEGA 1PO6A 1ATSA 1EZZB 2M88A 1FKOA 3UR0A 4DU3A 2DRBA 4KPCA 2BW7A 4CEQA 2RHQB 2HHWA 3AHPA 4QIVA 2R3VA 4BREA 1XERA 2X1BA 1IJEB 4MFBB 4DTUA 4YB5A 4KKOB 2NXEA 2NCKL 1LWEA 4EYHB 2D5RA 2LYVA 2MGZB 2MY7A 1NM1A 1IJFB 1N8RT 4C8MA 1QHTA 3F73A 4CZHA 4M3XA 2F4VJ 2HIQA 3GCWP 5A6PA 2DFEA 2M3DA 3MAHA 3D6TB 2A42A 4KB0A 4CZIA 4LVOP 1OY6A 4QIEA 3CJBA 2BKNA 2IHR1 4LUBA 4H5WA 4PPDA 3AO3A 3G6YA 4P2FA 3LPYA 3TUJC 1HJRA 1YBAA 3B78A 4UUXA 5BR9A 5HVFA 3H5XA 4WBFA 1RDRA 3N6NA 3A2FA 2UXCJ 3KDOA 1VBKA 3X3UA 3VQCA 1SV5B 1RT3A 5FLXY 4IQXA 2AEJA 3HD1A 3N9UC 3VALA 3IGVA 1JLQA 1GLBG 1X9JA 3IXQA 1HR0F 2JLGA 1KVJA 1DLOB</