1RT4A

Hiv-1 reverse transcriptase complexed with uc781
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
542
structure length
536
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
total genus 147
structure length 536
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt4A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt4A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt4A05
1WSHA 2OPSA 4FLXA 2YNFB 2XCPA 4QAGA 5DQHA 2KQ2A 1N48A 5EU7A 4KKOB 3GILA 5HROB 4LSNA 4FVMA 4JLHA 4I2QA 4H4MA 3QEIA 4ECQA 2QE5A 3BREA 4KHRA 1GOAA 3OYCA 4HCBA 2CKWA 4C8MA 3Q8QB 1JLBA 3VQ4A 3H5YA 4K4SA 4CJWA 4R5PB 2F96A 3S9HA 1J5OA 2IDOA 1XR6A 4ECSA 1HPZB 1YTUA 1IKYA 4TQSA 3MEGB 3MR2A 4CGIA 4LH4A 3BQ2A 4EP4A 1IKVA 4CK3A 3SV3A 4RW8A 4BDZA 4QWDA 2XY7A 2VG7A 4FS2A 2IM2A 3DYAA 3KLGB 3FRZA 2J6UA 3TWHA 3K2PA 1L3VA 4ECWA 3NF9A 2C2RA 4K4UA 3KTQA 1S1UA 3AA2A 4DFKA 1KVAA 4ZP6A 2E4LA 4ZHRB 2O5DA 4M42A 3HHKA 4KI4A 1IKVB 4W5TA 5FDLA 5F8IA 1QAJA 5L1JA 5KG7A 3T5HA 4EP5A 3DYAB 2IS3A 2XY6A 2IC3B 4FM2A 4IFVA 4YR2A 1WNEA 2DFHA 3JYTB 1QAIA 4M3WA 3DRPA 1HYSA 4DL2A 2J6SA 2ILYA 3K5NA 2W7OA 2W9BB 4CEFA 4NYNA 3HJFA 2HNDB 2VA2A 2BQUA 3RB0A 1N5YB 3H4BA 2Z1IA 1NOYA 3G6XA 3NH1A 3AO5A 4ZP9A 4AHSA 1X9SA 4OKEA 4IH5A 1KHWA 4PWDA 1NNDA 3CM5A 4IKFA 4CHYA 1VSJA 3VQ8A 3V6JA 1S6QB 3MR6A 1JLEB 5KFXA 4FK0A 3EPGA 4ECYA 3RRHA 1I6JA 3E01A 1JLAB 1RTDA 2WOMB 3OLBA 3VQBA 2EC0A 5HP1B 1YTAA 1U49A 5KFOA 4DS4A 5J2PA 3PX0A 1C1BA 4B8CA 1ZBUA 2FBVA 2V4QA 3DLEB 4CF2A 1NHVA 3G6YA 3SUNA 4EO8A 4YR0A 3IS9A 3VA0A 3CJ4A 2UUWA 1IKXB 4AHVA 1NK8A 4J9PA 3KK1A 4QWAA 2YNIB 3OHBA 3TAGA 3AVGA 3MF5A 2RPIA 4IFYA 4F4WA 4OLAA 3QGHA 4ECTA 1VK0A 4O3PA 2UVUA 3NGIA 3L8BA 2XY5A 2YKMA 4FJXA 4DL7A 2A1RA 3DRSA 3V9SA 4NLQA 2B4JA 2BANA 1NKEA 3TAEA 2GBZA 2HB5A 3RB6A 2F8TA 4YQWA 3VQCA 3SUOA 3CDWA 4B8AB 1Q8IA 4W5OA 2HVIA 3SQ4A 2W8LA 2FBYA 2QV6A 3RBEA 3EYZA 3M8PA 4ICLB 4QPXA 4TYBA 5KG1A 3TAFA 1C0MA 1KFDA 4NLYA 4PUOB 3G6VA 4HTUA 3TAQA 5F8JA 3MFIA 1J54A 2E9ZA 4J9RA 4CJRA 1KVBA 2HMIA 3VQEA 4JRPA 4O4RA 3MECB 5DGAA 3AVFA 4YFUA 4R8UB 4DU4A 3IG1B 1L3TA 1NK5A 4CFCA 1SH2A 1C6VA 4EO6A 5KFCA 4ECRA 5KFMA 4M3ZA 3AVBA 2BQRA 3DM2A 4WXWA 3ISND 4MK7A 3HM9A 1XR5A 3SZ2A 4NLUA 4IG3B 3KLHB 4B9UA 4JV2A 4RUAA 4BDPA 3WNEA 1NK7A 4M95A 3CG7A 3LP1B 3TAMB 4B9TA 2FVCA 4RW6A 1X9MA 5DG9A 3GIMA 1TV6A 2XCAA 4ED2A 1MU2B 4CJTA 3K57A 4M3RA 2DPIA 4MFBA 2VG6A 1HJRA 4C8KA 3I0SA 1BCMA 5K14B 4DTUA 4XO0A 2BDPA 4MH8A 4KRFA 3M8QB 1QSSA 1ASWA 3T5LA 1XR7A 3HXMA 4IRKA 4FCYA 5KFDA 3NGYA 3SI6A 4FJ5A 3CM6A 1TL3A 4RW6B 1BL3A 3SCXA 1TV6B 2ETJA 2OH2A 5KG6A 1SH3A 5KFEA 4ED7A 2CJQA 4RG8A 5JS1A 1Z25A 1TK8A 1RT4B 3PX4A 2OPPA 4CEAA 3NH0A 3LZIA 2WHOA 1KRPA 2DTUA 3K5LA 4YR3A 5J2MB 4J2AA 4B9NA 3I5CA 3MR5A 3NFAA 4DS5A 1NJYA 3V6DB 3NBPA 3MAQA 4F2SA 5CYMA 1HQEB 2ASJA 4OJRA 1VSHA 4O3OA 4E7JA 4NCGB 3HKWA 2FJXA 2W9AA 1B92A 3MEDB 2GIRA 4IG0B 3OYFA 4N41A 1GX5A 3C95A 4J9OA 1SL1A 3KK2A 3UDLA 4H4OA 3SQ0A 4FJ8A 3H59A 4I2PB 3I0RB 1D5AA 5C42A 1T3NA 1N56A 3KLEA 2E9TA 2R2TA 1DTQB 1O1WA 3PO4A 1NHUA 3KK3A 1S49A 1VSDA 3P83D 2P5OA 4RNNA 1RT1A 1NKBA 1LWFA 2IM3A 3OL8A 3OYIA 4M45A 4F4YA 2DFEA 1RT5A 5KG0A 4LH5A 1TK5A 4ECXA 1JL1A 4JV0A 1WSGA 3SFGA 1GOBA 4O0JA 3ZSOA 1T05A 2QKBA 4ZVEA 3OL6A 4NYFA 3OS1A 1WSEA 4DMNA 3SFUA 4CERA 4DTSA 2DY4A 4IBNA 1S97A 1HRHA 1TKTB 2P1JA 4WFXA 3E51A 2R8KA 5KT4A 4DSEA 4FJKA 2B6AA 1ZBIA 3V6KA 3DRRB 1T03A 3QEWA 1VSLA 1QQCA 2QKKA 4BWJA 5J2NA 4DF4A 2W9CA 1RDBA 5KT7A 1T05B 2IM0A 3RR7A 3QESA 1SUQA 5DLGA 3S3OA 4RNHA 4TN2A 1QE1A 1BIZA 1HMVB 3H2LA 3AA5X 4DFJA 2A1SA 2KZZA 4RW9A 4NLOA 2VG5A 1EX4A 2GC8A 1RTIA 2PY5A 5L1KA 4CJEA 5KFVA 4DLEA 1WAJA 3DLKB 4NLSA 1EP4B 3SPZA 3EZUA 5KFLA 3PV8A 1JXEA 3QLHB 4CEZA 4Q45A 3VQAA 3DLBA 1RYRA 1SUQB 4IR9A 2FLPA 3H4DA 1TP7A 4ZP8A 3RTVA 3TAPA 3DOKB 5KFZA 1CXUA 4OKKA 4DTPA 2ILZA 1RTIB 3V81A 4CGDA 3DOLA 3GIKA 3WNGA 4DFMA 1Q9YA 3SJJA 2E6LA 5EDWA 4EBEA 1U04A 4I7FA 4CJVA 3SUQA 2IAJB 3GIJA 2HHSA 3QZ7A 2BGGA 2YNGB 5D3GA 3D45A 1RAJA 3T5KA 4NLVA 3ULDA 3KKRA 1DTTA 4J9KA 3N6NA 3RMCA 1KLMB 1D9FA 2XI3A 3F73A 1TKZA 4E89A 1BQMA 1LAWA 4KHMA 3RMBA 4F3TA 4Y2AA 4URGA 4KBIA 5KFIA 1HNVA 1REVB 3KHRA 4K4YA 1J9AA 5D3GB 4OKJA 4G1QA 2HNYB 3ITHA 1KTQA 4Q0BB 1FKPB 3JSMB 2KFZA 3QEVA 3PW2A 1D0EA 1GOCA 3OYJA 2D3UA 3FFIA 2O4IA 1S1WB 4Z4HA 1C0TA 3OYHA 3OSPA 5KG2A 2R2UA 4G1QB 2Y1JA 3G0ZA 2ITGA 1C1CA 4DL3A 1S4FA 3FQLA 3ZSQA 3L2QA 3IAYA 3AA4A 1ZYQA 4K8XA 1S9GB 2B5JA 5L1LA 4LQ3A 1LW2B 2EHGA 4RW7B 5F8HA 1JXLA 2JGUA 2D41A 3KMSA 3AO1A 3IGVA 4UQGA 4K4VA 1RTHA 1TVRB 3VQ9A 1C0TB 3AVJA 4OGEA 3QZ8A 1N6QB 3Q8SB 2JC0A 4DTRA 3CVKA 1RBUA 2RN2A 1W0HA 5HBMB 1UA1A 4IOBA 2Z1JA 3QYYA 4ZVFA 4CK1A 4ZPDA 4B9SA 4CJSA 1RT7B 3GV8B 3I8DA 1I3AA 1LWEB 3QO9B 2RKIB 5F8GA 4EZ6A 4KHWA 2I5JA 4NLTA 3NGDA 4KAIA 4EBCA 2BE2A 1UOCA 3CFRA 3L3UA 3KLIA 2G8IA 2WK4A 2JEFA 1HYZA 2OPSB 2YNHA 3IRXA 2E6MA 5DLFA 3O3FA 4CJPA 4J2BA 4FLWA 1S10A 4U7CA 3NMAA 4HHTA 4DSFA 4LSNB 1ZETA 4FYDA 2IM1A 4I2QB 1RT3A 4H4MB 4ED6A 5C24A 1CZ9A 2XHBA 4E7HA 4N76A 1XHXA 4FK2A 1R0AA 3ZSVA 2FC0A 2HWHA 1JLBB 2ZE2A 4J9LA 1U09A 1J5OB 5FROA 1RBTA 4NCBA 3VQDA 5EUHA 1IKYB 4C8LA 3QIOA 1S6PA 1IO2A 3QINA 2BRLA 3NF6A 4HUGA 1SKWA 2HHXA 1FK9A 1RT3B 2XO7A 4RW8B 4XPCA 2AGOA 2VG7B 5C24B 1QHTA 2C22A 4KB1A 3L2WA 2WONA 3DMJA 3GYNA 4GVMA 2ZE2B 3M8SA 1WNSA 1UWBA 5KFTA 1S1UB 3M9MB 2X74A 2IA6A 1G15A 2YHBA 2KZMA 4K4TA 4QOZB 4TSXA 1SV5A 5J1EA 5KG4A 4DTXA 1S6PB 3HPOA 4O3QA 4KO0A 1QSLA 5FDLB 4Z4CA 4DTNA 1JLGA 2Z1GA 1XWLA 4IFVB 2WONB 4WXOA 2JEIA 3DRPB 2BRKA 1HYSB 3ZCMA 3LDSA 3AO2A 1JL2A 5F9LA 2AGPA 1SV5B 3OYAA 3OL9A 5DG8A 4DEZA 3AO3A 4JS4A 1JLGB 4FJMA 3TVKA 3LWLA 5KFRA 3TQ1A 2XGPA 4L8RB 4U6PA 4PWDB 3OYBA 4NZ0A 3LZJA 1KFSA 2G8KA 5DK5A 3SQ1A 3THVA 2PYJA 1CLQA 3O3GA 4WE1A 3QIDA 4CEDA 2ATQA 4FJ7A 3SV4A 3E01B 3KMQA 3WNFA 1RTDB 4E7IA 2OPQA 5L1IA 4Z4IA 4CF9A 2V9WA 2G8WA 3NF7A 1YT3A 4CJUA 3RRGA 2PZSA 5J2PB 1C1BB 1RT6A 4KB0A 3OLAA 4ID5A 4EZ9A 3OYEA 2O4GA 4FXDA 1S5JA 3V1OA 1RBVA 4B9VA 3K58A 1ZBFA 3IS9B 4ZVGA 3NCIA 4H8KA 3KK1B 4JUZA 4DTOA 1ASUA 1RNHA 4IFYB 3IN5A 3HPGA 3H08A 1RT6B 4WYLA 3H5UA 3NE6A 3QERA 3KD5E 4KFBA 2YKMB 4LQ9A 4TY8A 4DQRA 3LANA 3DRSB 1IG9A 2OZMA 1L3UA 5KFGA 2VA3A 4E7LA 3VQ7A 5KFQA 2BANB 4URSA 4EBDA 2DPJA 3M8RA 5KT2A 2AX1A 3I5BA 2F8EX 5I3UA 4CHQA 3M8PB 5JXSA 4EEYA 4FBUA 1Z4UA 1BIUA 1ZTWA 3LPTA 4IH6A 3HT3A 4KFBB 1J53A 3HK2A 3H98A 4F4KA 1YVUA 2HMIB 4I9QA 1JLFA 3OYMA 4K4WA 4LD0A 4C8NA 3DLGA 4KREA 2F8SA 3ZT2A 4JRQA 2RDIA 2HNZA 1W25A 4IQXA 3K5MA 4F2RA 1CSJA 4KTQA 3CJ3A 4O55A 3FQKA 1JLFB 4TYAA 3DM2B 4W5QA 5JUMA 2P51A 4M3UA 4HUEA 3L2UA 3PY8A 1Y97A 1KHVA 5I42A 4ZPAA 3MXJA 3CJ0A 2HNZB 5KG5A 3ZSYA 3OY9A 4IR1A 4CJLA 2J6TA 3C6UA 2V0NA 4DU3A 4YP3A 3K5OA 4MFBB 4OLBA 2VG6B 5HRNA 3DLHA 1RTJA 3I0SB 1T94A 5C5JA 4NLWA 3U3YA 5CY4A 4CIGA 3PW4A 4Q5VA 4RW4A 4CJ5A 2FBXA 4CHOA 4TQRA 1TL3B 4AILC 4KHYA 3C6UB 1Z26A 5EWGA 5J2QA 2OPRA 4CF1A 1LW0A 3OYLA 3LWMA 3MEEA 2RF2A 4FJHA 3N6MA 1VRTA 1EETA 2OPPB 4DQPA 4DL6A 4KPYA 4MK8A 2AQ4A 4CJFA 1IKWA 3QNOA 3NBPB 4HUFA 1T8EA 4M94A 2HHUA 5HRRA 4YNQA 3U3GA 4O0IA 4F8RA 5CYMB 3SQ2A 2IGIA 3HP9A 4CHPA 4QW9A 5KFAA 2VWKA 5J2QB 2OPRB 4WFZA 3C6TA 4WZMA 2FJWA 3VA3A 4CFAA 1VRTB 2RDJA 3T1AA 4MQ3A 2D0BA 4IDKA 4FW2A 4Z4EA 4XIUA 4HKQA 4DL4A 4N5SA 4RUCA 4J9NA 3ZSRA 3KK2B 4H4OB 3ZSWA 2IBKA 4LSLA 2AWZA 4QWBA 3BQ1A 4PY5A 3V4IA 5C42B 3KLEB 3OJSA 3GV7B 4AHTA 4E0DA 3PUFA 2XC9A 4DSKA 3KK3B 1IH7A 4FJLA 5JS2A 2D7SA 1RT1B 1LWFB 3U6FA 4O4GA 2JC1A 3NHGA 4KV8A 4CESA 1A5XA 1ITGA 3KD1E 1RT5B 4B3OA 5KGWA 1JXBA 3F9KA 2G8VA 2KTQA 1S9EA 4LSLB 2YV0X 2XY8A 3V4IB 3LP2A 3CWJA 2FVQA 2NUBA 3OYDA 2ZKUA 3BSOA 3NKYA 1DLOA 4CIFA 2C2EA 3T19A 2B6AB 5KFBA 1YVFA 4DSLA 1TAQA 2OYQA 3ALYA 1T03B 4O3SA 3UR0A 1S0MA 4KHSA 5J2NB 3BDPA 2KFNA 2W9CB 3VQSA 1HNIA 3A2FA 3ZT4A 3GV5B 3HSTB 3I5AA 4KTZA 4BE1A 1QE1B 4TXSA 2FLLA 4RW9B 4Q8FA 2X6SA 2VG5B 3VQQA 4E3SA 4CJ3A 1K1QA 2BR0A 1D8YA 4QCLA 3CFPA 3CJ5A 5T14A 4CF8A 2ZD1A 2OA8A 4E1NA 4GC6A 1BQNA 4Q8EA 4CGGA 1TKXA 4JS5A 4RNMA 5KT6A 3NGZA 4RU9A 5CZ2A 2HWIA 3L2VA 4OPKA 1EXQA 1XHZA 4O44A 4URQU 3NL0A 4FJIA 4ECVA 1ZTTA 3V81B 3DOLB 4FJNA 1S0NA 4ED0A 3FDSA 3PW5A 3KHHA 1KCFA 2JEGA 3DI6A 4I7FB 5KFJA 1JX4A 4AHRA 3RWUA 3OHAA 1TKXB 1T7PA 4Z0UA 4FJ9A 3ASMA 2C28A 4MKAA 3C94A 4B9LA 1DTTB 3V6HA 3SUPA 3CJ2A 5F8MA 4DFPA 4O44B 2WCXA 4GC7A 4FJJA 5EWEA 4I9LA 1TKZB 3OSNA 1BQMB 3HVTA 3LALA 1QSYA 3RB3A 5C25A 3PX6A 4F4XA 3RAQA 3AVMA 1HNVB 1LWCA 3G86A 4ECZA 3B6OA 1BI4A 3PW0A 3FSIA 2V4RA 3ITHB 4O3RA 3MXMA 4Y2CA 3KNAA 1B9FA 3QEXA 2Q3SA 4BWMA 4FS1A 3T5JA 3HL8A 2FVSA 1C1AA 3FFIB 4CJKA 1ASVA 1TK0A 3NAEA 1X9WA 2PYLA 2D3ZA 3QIPA 1JLQA 1LWCB 1TAUA 3AV9A 3AA3A 1RT2A 4J9QA 2G8FA 1RA6A 1BI4B 4FM1A 3Q8PB 1BHLA 2YNFA 5KGXA 1C1CB 3AVCA 4ELVA 3AVNA 4TY9A 1GX6A 2IJNA 4KKOA 2B5JB 3QGGA 3PHEA 4CF0A 5HROA 3H5SA 1WLJA 3HPHA 3HVAA 3PJXA 1RTHB 5F9NA 4CJ4A 5KRTA 4Y1CA 2IMWP 2KW4A 4NLDA 3BQ0A 4R5PA 1JIHA 4IKAA 3HVRA 4FK4A 4ED8A 1HPZA 5KFFA 4NRUA 3KKSA 3MEGA 3EPIA 3UPFA 1VSIA 4K4ZA 3L2RA 2FJVA 2X78A 2D0AA 4H54A 3BSNA 1JLCA 3QEPA 5DQGA 3CIZA 4CEQA 4NLGA 5HLFA 2XRIA 2I5JB 3OVNA 1SL0A 3KLGA 3KHGA 3H5XA 2BE2B 3KLIB 3ZSXA 2AJQA 4OPJA 4ELTA 3OL7A 2ASLA 3IRXB 2YNHB 4AHUA 3DDKA 4ZHRA 4IRCA 3ZT0A 4MKBA 1C2PA 4ZTFA 3V9XA 1JLCB 3AO4A 2OZSA 3RB4A 3LP3A 4FLTA 1L3SA 2YKNA 5HLFB 1S1VA 4M3TA 4LY7A 2IC3A 2D5RA 3JYTA 4WFYA 4AHCA 1K1SA 1R0AB 5F8NA 1FXXA 5SZTA 2W9BA 4KHUA 4FLYA 3PZPA 2ZQBA 2FVPA 2HNDA 1VSMA 1N5YA 5KT5A 4CK2A 1L5UA 1RA7A 3ZT1A 2Y1IA 2YKNB 1S1VB 4PQUA 1VSFA 1FK9B 3V9ZA 1WSIA 1U4BA 4FLZA 4J9MA 2R2SA 3PVXA 4Z4FA 4QWCA 3DMJB 4DSIA 5KFYA 5DG7A 1WSJA 3PJWA 1S6QA 4DL5A 1JLEA 1UWBB 2UVRA 2IOCA 2FLNA 3V1QA 3ZT3A 1KSPA 2JEJA 2ALZA 3OS2A 3D0PA 4FZXC 5J1EB 3P5JA 5CZ1A 1JLAA 3CO9A 2WOMA 4PQUB 4FM0A 4KO0B 4CJQA 5HP1A 4CCHA 1RYSA 3ZSZA 4BACA 1U45A 4IRDA 1NJXA 3NF8A 4NRTA 5KTQA 2EX3A 3BR9A 2XWYA 3DLEA 4O5BA 5SWMA 4Q43A 1S1XA 4C8OA 4QWEA 1IKXA 1XI1A 4B08A 4CGFA 2HVHA 2YNIA 4R0EA 2R8IA 4F3OA 4RNOA 3ICLA 1N4LA 2WTFA 4ZPBA 1RILA 3QETA 1ZBLA 1B9DA 4WE1B 4CGHA 2I1RA 1S1XB 5KFKA 1D1UA 3O4NA 3NAIA 4QW8A 4CGJA 1RBRA 2W42A 3TI0A 2OPQB 3BSCA 1F21A 4CEOA 5E41A 3TANA 1D9DA 3BGRA 4ICLA 3VQ6A 4FJGA 4DU1A 1RDRA 4DQSA 4DF8A 1RBSA 4PUOA 4ID5B 2AU0A 1C0UA 3TR8A 1WSFA 4HCCA 3IGNA 4BE2A 1UA0A 5KI6A 3HYFA 2FVRA 3PR5B 3TARA 4F4ZA 3MECA 3MFHA 4CFDA 2R8JA 1WAFA 5L9XA 4NLXA 3K59A 3RR8A 3BGRB 4R8UA 3N6LA 5FRNA 3T3FA 4Y1DA 3NAHA 3RMDA 3IG1A 3GQCA 1VSKA 4FW1A 3S3NA 4CEEA 1C0UB 4CHZA 4NCAA 4K8ZA 4YMEA 1NK9A 2JLEA 3KHLA 4TY8B 4ZVHA 2HW3A 3D5MA 3AVLA 2W8KA 3O3HA 3PO5A 1Q9XA 1S48A 3BSAA 4FZYA 5KRSA 1BISA 4IG3A 3KLHA 1XC9A 3MTKA 3AVKA 3OS0A 3LP1A 3TAMA 5I3UB 1I39A 4HVJA 1NJZA 2G8UA 4OVLA 4J9SA 4WZQA 2WB4A 3Q8RB 3VQ5A 1W9HA 4FLVA 4NLRA 1MU2A 2GUIA 3WNHA 1QTMA 1KLNA 3V9WA 3HO1A 2HHQA 1QUVA 4DG1A 5K14A 3HP6A 3SYZA 2XGQA 3M8QA 3DLRA 3DLGB 2ATLA 3CFOA 1NJWA 4O3NA 4DSJA 3RAXA 5KFNA 3M9NB 4KE5A 4GMJB 4RNFA 1FKOA 4E1MA 2DFFA 2WRMA 4BDYA 3QNNA 1RT4A 1ZBHA 4DG1B 3BJYA 4DTMA 5J2MA 4J2DA 4CFBA 3OYNA 3V6DA 3D28A 5I42B 2QK9A 1HQEA 1JKHA 4NYZA 4DTJA 1FKOB 4Y3CA 2VWJA 4NCGA 2AX0A 4KAZA 4OGCA 3M9OB 4E7KA 3VQPA 3GIIA 4KTWA 3B6PA 3MEDA 2D0CA 4IG0A 4ED1A 3OJUA 4N47A 1HQUA 3CDEA 3LAMA 4CHNA 1RTJB 3RMAA 4GW6A 2B43A 2XI2A 3KIOA 1S0OA 4W5NA 1OS5A 4I2PA 1U48A 3I0RA 5KFUA 5F8LA 5KG3A 4ZTJA 4RW4B 1SL2A 1DTQA 3CYMA 1JKHB 4F50A 1X1PA 4DQQA 4EYIB 4FLUA 1RDDA 1RCHA 5DMRA 4K50A 1LW0B 1HYVA 1WN7A 3AVIA 3MEEB 4ECUA 4M3YA 2RF2B 1HQUB 3ISNC 1EETB 5KFPA 4ZP7A 1S9FA 2UVVA 4M41A 4N56A 1A5WA 3QGIA 3MR3A 1IKWB 4Z4GA 1CXQA 1TL1A 1LV5A 4J2EA 4JV1A 3S3MA 5DQIA 1RDAA 2R7YA 4B9MA 3KJVA 3CQ8A 1TKTA 4ID1A 1CZBA 3V1RA 4G3IA 1NK0A 2Z1HA 3VN5A 2GIQA 3C6TB 1IM4A 4HYKA 3DRRA 4PA1A 4IDKB 5KFSA 1TKDA 3LP0A 1TL1B 2UUTA 4KI6A 2X6NA 3SI8A 5CYQA 3KJVB 1BGXT 3LPUA 2IJFA 1HMVA 3KLVA 2W7PA 2BQ3A 3KLFA 4Q44A 3MXIA 1VSEA 2HHWA 4RZRA 2G8HA 3NDKA 3EY1A 4O4GB 3DLKA 2HHVA 4KV8B 1EP4A 3AVAA 3LP0B 4B3OB 3QLHA 1LAVA 1S9EB 4KB7A 2GV9A 3LP2B 5CYQB 4DWIA 1NOZA 3TABA 4ZPCA 3KLFB 1UAXA 3SNNA 2ASDA 3G10A 3DOKA 4E19A 3P1GA 1DLOB 3NH2A 1KVCA 4KSEB 4X2BA 3RBDA 2YHAA 2IAJA 1NKCA 4NLPA 2R2RA 2YNGA 2AGQA 1TQLA 1HNIB 2FBTA 1U47A 2R8HA 2UVWA 1KLMA 3V9UA 5FRMA 3SPYA 4ED3A 1RDCA 5HRPA 4FZZA 1SH0A 5KFWA 2ZD1B 3HVWA 1REVA 4FBTA 2LSNA 1BQNB 4CIEA 2HNYA 4MK9A 4Q0BA 1HARA 4Y34A 5T7BA 1FKPA 3JSMA 1EKEA 5KFHA 4OL8A 2P5GA 4BE0A 1S1WA 4CE9A 4WYWA 1MMLA 4CECA 1A5VA 3L3VA 4EYHB 2R8GA 4MIBA 3UIQA 3DI6B 4ELUA 4K4XA 3OYKA 3LAKA 1BCOA 1QS4A 1S9GA 4XPEA 1LW2A 4RW7A 2HAIA 3UQSA 2QXFA 3HVTB 3OYGA 1TVRA 4IH7A 3O4QA 2E9RX 3EZ5A 5HRSA 4MIAA 5DGBA 1N6QA 5C25B 1K6YA 1SKSA 1VRUA 1S1TA 4ZMMA 4TLRA 1TGOA 4AH9A 5HBMA 3H40A 3KOAA 4CEBA 3PW7A 4DLGA 3AVHA 4KHQA 4KHNA 1NK4A 1RT7A 1NK6A 1LWEA 3QO9A 2RKIA 3CDUA 5KT3A 1SKRA 4W5RA 5EWFA 1VRUB 4DQIA 3PR4A 2C2DA 1S1TB 4M3XA 2HHTA 3QIPB 1JLQB 1RT2B
chains in the Genus database with same CATH superfamily
3JQJA 4DB3A 1S4EA 2AP6A 1K47A 4QAGA 2Q6BA 2LXFA 5DQHA 1N36F 4HT7A 2KQ2A 4JN4A 1UW9A 2LVWA 2DT9A 3K9KA 1VMBA 3TR5A 1U2FA 4L74A 5I3QA 4Q2LA 3BREA 4KHRA 3OYCA 4ZVRB 2MGZB 3A8YA 4CJWA 3FJ2A 2F96A 2EKYA 1YX2A 1YTUA 2FDNA 4TQSA 3Q8YA 3IXQA 5C2FA 2DCLA 3DYAA 1U6BA 4WFNL 3TWHA 3NF9A 2C2RA 1MDUB 4Z7YA 2C3PA 1M90T 2ZHOA 2FY8A 1IKVB 4R79A 3O1BA 4KGZB 4FM2A 4IFVA 2MLZA 3JYTB 2XHCA 4DZ6A 1QAIA 2MKCA 2GTDA 3W0LA 3DRPA 2YX1A 1V4TA 1M5SA 4L6V3 2BMBA 2VA2A 1H73A 3I55N 4WFAL 1NJIT 4RWXA 4OX9K 1BA0A 3SIPB 3ENAA 2UUCJ 4IH5A 1B70B 3D1OA 2HGNA 4LF6J 3CM5A 2C1EB 3VQ8A 2FGOA 1WJ9A 1VQ4S 5KFXA 1RFQA 4ECYA 3JS9A 3KJFB 1JLAB 2WOMB 4BC4A 3VQBA 1FNMA 3HBTA 5HP1B 3ZTSA 3RGIA 5KFOA 2VPWB 3UN2A 4A62A 5J2PA 4KHPK 4BRHA 2VJUA 1C1BA 4B8CA 4AL7A 3FSYA 3I87A 1KVIA 1NHVA 1UJ6A 3SUNA 2HKEA 4P74A 1VCTA 3L7PA 2UUCF 1IKXB 4J9PA 3KK1A 3WIVA 4LF6F 4IFYA 4F4WA 1H7WA 3QGHA 4DUYK 2E7XA 2UVUA 1NSQA 2YKMA 4FJXA 3UR3C 4NLQA 2BANA 3WDOA 2W2NP 2F8TA 3CDWA 5ETVA 5BRFA 3SQ4A 2XMJA 3EYZA 5GMEA 3FBCA 3BO2A 3TAFA 3F5TA 4NLYA 3TAQA 4FNIA 3VEXA 2DH7A 3AGRA 4USTA 1T9TA 3HHNB 1UKUA 2JX2A 4MYUA 1NGDA 3AVFA 1NPPA 2PMZD 3CPEA 1WKKA 2NYIA 3ZLJA 5ETLA 1JCFA 1C6VA 4ZVTB 1WDDA 5KFMA 1HL6A 3AVBA 2BQRA 3ISND 4MK7A 1XR5A 1MN7A 1CULA 3TWZA 4B9UA 1ZA2B 5IS2A 4JV2A 2VB6A 4K5RA 4WQ4C 4B9TA 2EXUA 4A47A 3AA8A 4RW6A 2H9ZA 2ZJQQ 3GIMA 5LSLA 2DRBA 3BS9A 4R0JA 2ZM6K 3MUMP 2MSTA 3K57A 4M3RA 4L3QA 2DPIA 4ALZA 4C8KA 2EBGA 1BCMA 2VQEK 3RJMB 4DTUA 4MH8A 3M8QB 4PG8A 2GELA 3SI6A 1N32K 4FJ5A 2B3TB 5CHCB 3CM6A 1TL3A 5LMNJ 5D8HB 1BL3A 1RBOB 3SCXA 4FPIA 1RZMA 1RADB 4RG8A 2R7WA 4BR9A 1P8GA 3PX4A 2OPPA 3G82A 2DTUA 3K5LA 1JQGA 4D3HA 3I5CA 3MR5A 4L73A 2POKA 2ASYA 1RACB 4OJRA 4FKYA 1VSHA 3V2UC 1IN0A 4O3OA 2KG1A 4LFAJ 2VGNA 4JKFA 2FJXA 2NREA 1B92A 3LM2A 2GIRA 5BYQA 4J9OA 1U1QA 3SQ0A 3CCJN 2L08A 5LMNF 4I2PB 3P4UB 3RAMA 4ID8A 1WUUA 3KLEA 1SJQA 1DTQB 4UZBA 2KHOA 3D6TB 3BY5A 5TKYA 2P5OA 2A2CA 2A3JA 1NKBA 3QMLA 4H5WA 2PMWA 1WSVA 4BG9A 4LH5A 1TK5A 4ECXA 1IBKF 4Y28C 1GEHA 2W2PP 2KG0A 2XZDB 4YDUA 5C2GA 1T05A 4M5LA 4NYFA 3WT0A 4OYMA 4LFAF 1RAAB 1WSEA 4CERA 2HPUA 1I1GA 4WFXA 2R8KA 4C4WA 2MQ8A 1VI7A 4DSEA 3QBCA 1RJJA 1DQ9A 1HBMA 4WU2A 2XQCA 1QQCA 4EU0A 4BWJA 1JJCB 2W9CA 5KT7A 2GAGC 3D6MB 2A6AA 2IM0A 3VESA 1YJNN 3H20A 3KUGA 3HRGA 4QQBA 4TN2A 4DFJA 3RBXA 3H2LA 4CO5A 3MM6A 5ETMA 2VG5A 4AL5A 2PY5A 2RUGA 5LL6Z 2DGWA 4NLSA 3CJSA 4DV3J 3MM8B 1LXNA 1PSDA 3FEYB 3VEOA 3RRKA 4CI0B 3SCIE 2DISA 3HSGA 5K20B 1TP7A 1K9MT 3RTVA 3PEHA 2I2YA 5KFZA 3MMAB 1CXUA 4OKKA 1GK8A 1RTIB 3TA0A 3UE2A 2ZOMA 1ZM4A 4RX6A 1X4AA 3MMBB 1Q9YA 4HH0A 3WEEA 4PKDB 4USKA 3FKBA 3C3LA 5F0XA 1XMQK 2W6KA 3NCPA 2HHSA 3BKFA 2YNGB 3JS6A 2QFIA 3KKRA 1VLOA 3CCSS 3FR0A 4J9KA 3N6NA 3B8HA 4DV3F 4ZCKA 5C10A 4E89A 1BQMA 1VBYA 1LAWA 4KHMA 4IFEA 4J7CA 3D4JA 3VAFA 5D3GB 4H0XB 1I94F 1KTQA 3W64A 3ZX2A 4NMLA 4B1XB 4KC5A 3H2VE 1D0EA 3OYJA 2D3UA 3VOVA 1VHXA 5ETTA 4M5KA 2ZVIA 3R6GB 5BYSA 2DHSA 2J9CA 3OSPA 3OYHA 3CMEN 2QZ8A 1SIZA 2ADCA 2QT7A 3IM9A 3P5BP 3IM8A 4GV9A 1C1CA 3M5RA 3FQLA 4QR2A 1T9VA 3P49B 2NPFA 1Q18A 3L2QA 1OQ6A 3ETMA 4K8XA 4HHHA 4LQ3A 2EHGA 3O80A 4DR4K 2JGUA 3ZC4A 3HT0A 3VGTA 2LDYA 2IVPA 1RWVB 4UQGA 2LA4A 5BPNA 1TVRB 4A59A 3Q8SB 2V8HA 1YJUA 1VGYA 3MM7A 1W0HA 5D78A 1AB8A 1UA1A 2BJ3A 2V5HG 3QYYA 3M6VA 1FRLA 4ZVFA 4CK1A 4B9SA 5LXRA 2V7ZA 2JLGA 3I8DA 1I3AA 3FK4A 4FKXA 1HQ2A 4C3MA 2BE2A 3JXOA 2G8IA 1NBEB 2WK4A 4U67L 1HYZA 2OPSB 1AW0A 4H5RA 5AQHA 4BQZA 5AQPA 1RHJB 3M30A 5T7LA 4DSFA 4MKYA 2B8QA 4FYDA 4DMZA 2OGUA 4I2QB 1RT3A 1CZ9A 4GVBB 3WXJA 2DR7A 4GV3A 4NCBA 5IOLA 2P9KB 3AAQA 3EO3A 4ZS6A 1IKYB 4ILHA 2P2CB 1TUGB 5D77A 2JFDA 2BRLA 1SQGA 4DQ8A 1X0PA 3MXHP 5LMUK 4XPCA 1X60A 4M5IA 1M1GA 2RQKA 2CQIA 3AHPA 4HTLA 3DMJA 4M5MA 3HTVA 1TL4A 4GVMA 2ZE2B 5ADZA 3HD2A 1WNSA 3GG1A 4DUYJ 3US5A 2KZMA 2CH6A 5J1EA 4DTXA 4PXCA 3BB5A 1QSLA 3MM5A 1F5AA 3C6HA 4Z4CA 4DTNA 2Z1GA 2AYBA 4OI4A 1YRTA 3EZWA 2PI4A 2JEIA 2CQGA 3THPA 2BRKA 1HYSB 3C46A 3LDSA 3AO2A 2DR6A 4B3SF 1JL2A 4CT8A 2AGPA 3OL9A 2NNWA 2ZBCA 1U6FA 3G2XA 4G9ZA 3A5LC 3MWBA 4DEZA 2CPIA 4LFBK 3HOTA 1HUXA 4L8RB 4U6PA 3OYBA 4NZ0A 4DUYF 5CR4A 1VQLN 1X5OA 4MO4A 1CLQA 4V1Ak 1S76D 5EHHA 5M2UA 1VJQA 5A0YA 4CEDA 4FJ7A 4CZKA 3QICA 2QL5B 2G8WA 1YT3A 4JI2J 1MA9B 5ADXA 4ID5A 1DY3A 2YKPA 2GGPA 5THWA 1S5JA 1RBVA 4LF4J 4B9VA 3LH2S 1U24A 3R27A 4H8KA 1W2BR 2XWXA 2VQEJ 5AXNA 3IKMA 1U6ZA 3R9LA 1ASUA 3IN5A 1N32J 4IUFA 4C6AA 4DR7J 3OVAA 4WYLA 3H5UA 4Y6IA 3KD5E 4DQRA 3DHWC 2HF4A 3N9UC 3EZOA 2M3DA 1L3UA 2NRVA 5KFQA 2DITA 2DPJA 2E44A 1RHKB 4JI2F 4OI3A 3M8RA 4TVAB 4ENOA 4B3TF 1LCUA 5KT2A 4E98A 2VGMA 3M8PB 3KWGA 2D4WA 1YITN 1ZTWA 3U9ZA 3HT3A 4RU2A 4LF4F 3P45B 3H98A 1FX2A 3J7YP 1YVUA 1NGFA 1VDHA 3S41A 5AQMA 1JLFA 3GBTA 4K0KK 4ZN3A 4C8NA 2YQ3A 3FCWA 4DR7F 3ZT2A 4LF8F 1UFWA 1FXRA 2HVDA 5JMNA 5ADXH 3S01A 1NLKL 4F2RA 2N3OA 4AE5A 1CSJA 3CCWA 3H45C 1GNKA 4GRSA 1KD1O 3B54A 3CJ3A 1ZM9A 4F0HA 1DURA 3ZFVA 5JUMA 2P51A 2FSKA 1SBRA 4HUEA 3S1TA 3PY8A 5I42A 3DOMA 2ZH9A 1RGVA 4DPWA 2Q6CA 3CD5A 2AJ1A 2VF3A 5CZXA 5DM6Q 2IVMA 2J6TA 2R7RA 4DU3A 3UWTA 4YP3A 5AXMA 1PJ6A 4MFBB 1D4XA 3CCTA 5HRNA 1KONA 3EXYA 1T94A 5C5JA 4NLWA 1N34J 1NM2A 4C98A 4CYUA 4BRCA 3BUZB 3OTEA 1QVGM 1IR1A 4CIOA 1CJTB 3FZLA 3C6UB 4CF1A 3LWMA 3MEEA 4IJAA 2GQQA 2MHNA 2RF2A 1NGBA 3C19A 4QR0A 2KXNB 3M8WA 3PEJA 4MK8A 5DJBA 1KC8O 5E2QA 1V5IB 4I69A 3MCAB 2HHUA 2MMYA 3VGVA 3SQ2A 3CMAS 3POTB 3HP9A 4CHPA 5KFAA 2VWKA 4DN0A 5J2QB 2CZVC 3FRYA 4JI0F 4WZMA 3VA3A 1G2EA 2RDJA 3T1AA 1N34F 3QT7A 2QRRA 2JOQA 4FW2A 1FD2A 1WHXA 1OVQA 4DL4A 1VQKN 4WP3A 2O01C 2NRHA 5IM0A 1GLJO 3VGSA 3MDFA 4WF9Q 5HO4A 3V4IA 4PKHA 1XMQJ 3M4XA 3DU6A 4AHTA 4MKVA 3PUFA 2KKZA 3KK3B 1T11A 2BM1A 5AZJB 1S0VA 3ETOA 4QIVA 5JS2A 1FEEA 3ET6A 1RT1B 2CPFA 3U6FA 2JC1A 4CESA 2OANA 2FJEB 5KGWA 5A8RA 4PEOA 3LP2A 2L9DA 2F9TA 2HQCA 1VQ7N 4M1KA 4PCQA 1FRXA 2PAVA 3BSOA 5JMVA 3NKYA 1K8KB 3BF4A 2EFGA 5D0HA 2C2EA 3T19A 3D6RA 3VGMA 4DSLA 1I51B 4YS2A 3CETA 5JLHA 1S0MA 2LMIA 1XMQF 4N8NA 2D9PA 2YX6A 3ONQA 3NS5A 1OO0B 2C2ZB 1U1MA 1RU2A 3A2FA 3GV5B 3HSTB 3I5AA 2LDIA 1UW4A 4TXSA 2VPZB 1FE0A 1HI8A 4RW9B 4JYAK 4Q8FA 2IY5B 2DJWA 4CJ3A 1GLBG 5K5MA 1D8YA 3CJ5A 2BJDA 2NRXA 2X1BA 2CA9A 2W2QP 3M32A 1JNRB 2P9IA 2DHXA 1BQNA 4NL5A 1P1LA 5A6PA 2HWIA 1M5HA 4F25A 5CZ2A 2IMOA 4HACA 1XHZA 4O44A 4ZCIA 3ENOA 3HZGA 3PCOB 4F26A 4ECVA 3AD9C 1ZTTA 3V81B 2ROEA 1EKSA 4FJIA 1ZZNA 3DOLB 4F0KA 3UI3A 5GAEU 3RW7A 3FDSA 3PW5A 3KHHA 1KCFA 4RJVA 3VCDA 1FWPA 2ZH3A 1BHNA 3K17A 5DM7Q 1JXVA 3ZZOA 3I96A 1AXQA 2PBDA 3ASMA 4LF9K 3CCVS 2H51B 9RUBA 3V6HA 5F8MA 3CHWA 5EWEA 4I9LA 1TKZB 2PIIA 1WOOA 4AXJA 4GO5X 4NLBA 3PIOL 1QSYA 1EB0A 3RB3A 3PX6A 2HQFA 5BJRA 1IR0A 1C0FA 2A3ZA 2EKNA 1N5TA 3R1HA 3RAQA 3AVMA 1HNVB 4ECZA 2XLKA 3B6OA 3UKUB 1BI4A 3PW0A 3MPYA 3LQVA 3OR1B 1FFWB 3PTWA 4O3RA 2Y1RI 1YJ9N 1B9FA 4FS1A 2FUG9 2HQIA 1C4CA 2DGSA 3N4WA 1S72N 4FL9A 4L3NA 2BYCA 2FVSA 3BZKA 1TK0A 2ZBQA 3W60A 2C2KB 4F0MA 5KGXA 1Q4RA 2W1BA 4TY9A 1NHKL 1GX6A 3BYPA 3QGGA 4CF0A 2MLYA 2VD3A 2V2QA 1WLJA 1Q16B 2DY9A 4DX7A 4CJ4A 2D1KA 1GLLO 1PC5A 3DU5A 1FRJA 5M1OA 1Z2ZA 3BQ0A 3IO1A 4R5PA 1ULRA 4IKAA 4FK4A 4ED8A 1G1XA 5KFFA 4B1VA 2D9OA 4NRUA 1N33K 3MEGA 3UPFA 4K4ZA 3L2RA 2FJVA 1UPPA 2DHAA 3QEPA 2JL9A 5HLFA 4CZJA 2LU1A 2OI2A 4LFBJ 2I5JB 1SL0A 3OVNA 4Y0FA 2QSWA 3VALA 5C0YA 2QA4G 4DDFA 3ZSXA 2AJQA 5AQFA 3OL7A 2JSXA 1V5VA 3DDKA 1XNRJ 2JFKA 3VAKA 1R3NA 3BH7B 2YWHA 4JKGB 3AO4A 3V9XA 3I4HX 3LP3A 1VIXA 1L3SA 4FLTA 4X4PA 4CLFA 1IR2A 2OTJS 4M3TA 4KYZA 2IC3A 4CZLA 1NGGA 2KXFA 2MZJA 1JJHA 2LYVA 3O9UA 5SZTA 4M63C 1ZBSA 4EMDA 1L5UA 1RA7A 3MN9A 3UKRA 2HBYB 3MCMA 3ZT1A 4UUWA 4LFBF 4NZ6A 5DO2A 4OZLA 1VSFA 3VEZA 4P2XA 3R5BA 1DQAA 4Z4FA 1D8ZA 4HEA9 1XNRF 1UWBB 4NZ7A 2HGLA 2FLNA 3D0PA 1RDUA 2Z2YB 5IZHA 2GW8A 1TL7A 3DWLA 2XMAA 2RU3A 3BGUA 1WORA 4WP8A 1RYSA 4AM6A 1NJXA 2PDAA 1Q53A 2ZJQL 3D2FB 3HX9A 3BR9A 5SWMA 3DRYA 2MJNA 1IXKA 5G0RB 1PYTA 2W24A 2J4RA 4CGFA 4DZDA 2R8IA 4F3OA 2JVOA 2XLIA 1RCXB 2QMWA 4ZPBA 1HLWA 1YQHA 4UZCA 3NGSA 1ICEB 3MD3A 1S1XB 3VAJA 5MLCV 1LNQA 3NAIA 4NI2B 4CGJA 1Q5VA 4ED4A 2Y0BB 1UCNA 1VC0A 1F21A 3BSCA 5LXYA 3GFYA 1HNXF 7FD1A 5HVHA 4JI7K 2KYXA 4DF8A 2VCPA 1RBSA 4CLWA 4A8FA 3H1VX 2RHKA 3EL2A 5A2QY 1K0TA 4Y00A 4Y2KA 3HYFA 3A3OB 3OBWA 4CFDA 4DJBA 2R8JA 1WAFA 2CQ2A 5L9XA 8AT1B 4NLXA 3K59A 2KN4A 5L9NA 3VZHA 3IG1A 1B0VA 1VQ8S 4L72B 1C0UB 2AEMA 2H1YA 1MWMA 4B9QA 4K8ZA 4YMEA 1NK9A 2JLEA 3KHLA 1A9NB 2HW3A 3D5MA 3C14B 3KK7A 4LF5K 3OD2A 1Q9XA 4DX6A 4IO9L 3Q8UA 3AVKA 4HVJA 5I3UB 1EWQA 1FE4A 5D0RA 4FLVA 4NLRA 2DYAA 1JJ4A 5AZIA 1QTMA 3NY0A 4FXWA 3ZEUB 5CE3A 3QJJA 2HHQA 1X4FA 2Q0RA 3WXMB 3I32A 2OTLN 4ZCLA 1OJ4A 3G8QA 3CD7A 4RNFA 3U9DA 2PFFB 1FKOA 4E1MA 3CPWR 4AD6A 4BDYA 3QNNA 3W3DA 5BN9A 3EEQA 3W8PA 1ZBHA 3OA9A 4DTMA 3BM7A 2Y3YA 3OFEA 2RQ4A 3OYNA 5AQGA 2QO3A 3SSSA 4DTJA 2HBLA 1D9AA 2DTJA 4OGCA 1QQOA 5B09A 4CLLA 1X4DA 2E88A 1IUJA 1RE1B 5B0EA 3LAMA 1CS4B 4CHNA 1RTJB 4K7QA 1BC6A 4I6MA 3RMAA 1FKAF 1S0OA 4W5NA 1FXDA 2PA3A 4ILRA 1U48A 1HX1A 1JKHB 1SJ1A 1X1PA 1LOUA 3JSYA 3SCLE 4C11A 5MAOA 4USJC 4MLEA 2UVVA 4M41A 2W40A 2HF3A 1IKWB 1S7IA 2ZZNA 2K3IA 1IBMK 1CXQA 1NDCA 2MKKA 4ZJOA 1U1OA 3EKSA 1TL5A 3AAPA 3P31A 4G3IA 5IFMA 3G25A 4ISGA 1UEVA 2ZF5O 3CCJS 4MIWA 3F56A 2VFSA 5SUHA 2FZCB 4MTPA 2I9SA 4DV1K 2O1PA 1IM6A 4F7VA 4NXNF 1TL1B 3NRBA 2P9PA 3SDEB 3B6BA 1HBNA 1FWKA 2IJFA 1HMVA 2I38A 2WBNA 5AQUA 1Y0HA 1BG3A 4MLHA 1HJOA 1XERA 3D66A 3NDKA 4PXEA 1QZ5A 4KV8B 3CNQP 3AVAA 4B3OB 1T02A 3QLHA 1LAVA 3FZ2A 3QT5A 2QEXN 5CYQB 5HQMA 4CH1A 4DWIA 3PIPQ 2EBEA 4ED5A 4BVPA 3KWMA 3PRVA 2P6SA 3G10A 4FF1A 4NYOA 5BREA 2CVIA 3NH2A 4WK1A 5GADP 4W98A 4KSEB 3R5GA 1O51A 3RBDA 5AQKA 3LW5C 2IPOB 1QAXA 1QM9A 1YJNS 2R7QA 1NKCA 1TMJA 1RI7A 1RHMB 1VQ6S 1I5OB 3ZNUA 1TQLA 1U47A 2CQDA 4YUDA 2Y1LB 4L75A 4S0MA 1HNWK 1KLMA 3V9UA 5FRMA 4X62K 4FZZA 3TUJC 4CLYA 2WB1D 5G4DA 1FNXH 3MGJA 5A2QU 1REVA 3MMJA 2J7UA 2LSNA 3DFEA 1FDBA 5DETA 3VEYA 4Q0BA 2XMMA 1FX4A 3C7NB 2CVEA 1N33J 3OR2A 1S1WA 2P9LA 3O2IA 2E20A 5E3PA 1A6LA 1V3SA 2P9SA 1X4HA 4ELUA 1FFSB 4K4XA 3OYKA 4QYRA 3LAKA 2G1DA 4N77A 2C3UA 2LEPA 2M88A 4RW7A 1FRIA 1DARA 4JKAA 4GVEA 4U9RA 4UT4A 2DKOB 3R5JB 3O3LA 1BWEA 3O4QA 4MIAA 1N6QA 5C25B 1SKSA 2GUPA 2V68A 5DZ6A 1T6CA 3K8WA 1Q8KA 3FMBA 3P96A 4ZMMA 4A2BA 3L09A 1SB6A 2YHYA 1TGOA 4BRQA 5HBMA 4NEZA 2JHEA 3D6HB 1N33F 3PW7A 5F41A 4DLGA 3AVHA 2BBEA 4FWKA 2LLZA 3O9SA 1LWEA 1SKRA 2LCWA 3IR7B 2HHTA 4YB7A 4CTAB 1RT2B 4WIQA 4FLXA 1O5JA 4OPAA 2XCPA 5AQJA 4NEYA 4TLQA 4H5VA 4GV6A 2XEXA 4WQ5C 1NCLA 3BN7A 1SI9A 6AT1B 4JLHA 4H4MA 4A8SA 4ZPVR 2HSEB 2AMCB 4OZ3A 1AZSA 2CKWA 3VQ4A 4K4SA 5EVZA 3L9ZA 3R8YA 3GFZA 4LH4A 2C3OA 4JKEA 5A6WA 1IKVA 2BM0A 4P73A 1KQKA 2XY7A 2VG7A 3SLCA 3HHEA 3E9PA 2XG8A 2YQ0A 3FRZA 2O8BA 4DV4K 3K2PA 4ECWA 4K4UA 3AA2A 2GMJA 4CQ1A 4PAAA 4OHYA 2O5DA 3CD6N 3HHLC 4U95A 4J90A 4M42A 3N28A 4OX6A 2Z57B 3NMRA 4W5TA 5FDLA 2V4JB 5F8IA 1UP1A 4M63A 2UXDK 3T5HA 3UFCX 1NXIA 2XY6A 2HFSA 3I9V9 2UP1A 2OCEA 3UE5A 1WNEA 2ZZMA 3TX0A 4OI0A 2DFHA 3G6EN 3D9BA 1DKGD 1FNOA 4IJNA 1S22A 1FJCA 4A8YA 4PG6A 4JI1K 3BO4A 3ZTPA 2DEJA 3HJFA 4XH5A 3RB0A 2DGXA 3DLJA 1KQSR 3LGMA 3H4BA 3W5YA 3AO5A 3NVKA 1KHWA 1W97L 2UV8A 1TELA 1VSJA 4PPDA 1WTBA 1S6QB 3MR6A 1KD1T 3UB5A 4AQYK 4FK0A 4DN9A 3D1HA 1M5PC 3P38A 3RRHA 1SXLA 3E01A 4X64F 3M05A 4LF5J 3MM9A 4USUA 1TFWA 2EC0A 1X4CA 3I6PA 2J8SA 4LRAA 1ZC6A 1ZBUA 2FBVA 1K0VA 4B3MF 3VENA 3DLEB 3A4TA 1QVFR 1SZ2A 1FJGF 4YR0A 4BCAA 3CJ4A 3VERA 1NK8A 1JJ2R 1VQLS 1DAXA 4OLAA 1JJ2M 3UN3A 1VK0A 2R7UA 3L8BA 1SC1B 5FLXY 4DL7A 2A1RA 5IC4B 1VRQC 4LF5F 3CJRA 2NSCA 1N52B 4PG7A 2GBZA 2HB5A 3SUOA 4B8AB 2LKZA 4OYXA 3JAMY 3EE3A 2FBYA 3M6GA 1BUPA 4ICLB 2IYIA 1YHQN 4TYBA 3G6VA 1AROP 2XMKA 4EI2A 1FVSA 5IT9Y 2BJ8A 3R6LB 3C2PA 2F7TA 4CJRA 1KVBA 1M90O 2ZGYA 3MECB 3ENHA 2YHXA 1G4CA 1NMNA 1GTHA 5F3ZA 2Z8QA 4DU4A 4BR0A 4KH6A 3H25A 4Y2IA 3VAIA 4CFCA 1LWXA 4EO6A 5DDOC 4ECRA 1KNZA 1RHQB 1RU1A 2FSJA 4YY3J 2QTDA 1NZAA 2AP1A 4LBIA 2FIUA 3DM2A 4H5NA 2YKQA 3HM9A 5HVGA 2HHPA 2QL9B 4WFAQ 3G8SA 1YITS 4RUAA 3QT6A 1NK7A 3DXKB 2E5JA 4O5FA 1WEYA 3TUZC 5KOXA 1OMSA 1MU2B 3NNCA 1U1NA 3CEDA 2E2PA 3EUNA 4H0TB 1YJWN 3J7Z5 3CCRN 3I0SA 2MZQA 5K14B 3CIPA 2UXCK 2LECA 4DV6F 2RDDA 4DOZA 2BDPA 4IOXA 4KR0B 4RPFA 1QSSA 1ASWA 4UOFA 4IRKA 3O9RA 5KFDA 3NGYA 3I82A 1OPZA 3A8JA 5FPDA 2R7OA 4YY3F 4QIFA 2B4VA 2ETJA 2OH2A 4JI3K 4PQAA 3I56S 5GMKa 1SH3A 5KFEA 2E1RA 2CJQA 1Z25A 1NZ8A 4YHHK 2K1RA 4DUZF 5M1KA 1RQ0A 4CEAA 3NH0A 3L95X 2WHOA 5J2MB 2K2PA 1AFIA 4J2AA 4DS5A 1OPIA 4B17A 3V6DB 2YQ1A 3I4PA 3MAQA 3A5MC 4F02A 2CNNB 1HQEB 4LIRA 4E7JA 4NCGB 4OZ5A 4C2MA 1KQFB 1FA0A 4CO1A 2RIJA 2O67A 2W9AA 1SL1A 4ZITA 3UCUP 3UDLA 3WXKA 1WI8A 2QXLA 4K2JA 1D5AA 5C42A 1T3NA 2LXUA 2CQBA 3PO4A 4A8WA 1S49A 1WELA 4G1PA 2FC9A 4FYVB 2NLXA 4JP8A 1Q79A 2NS1B 1RTZA 1H72C 4BHQA 2IM3A 4ZCMA 4M45A 3OVSA 3CF5L 3VWSA 2WUSA 1NG9A 4X62J 5KG0A 1WSGA 3ZSOA 2ZC3A 1GMUA 1IQZA 4DCPB 3HI0A 4DMNA 2BE7D 2H5EA 1Q7YO 2OHDA 3E3XA 1HRHA 4Y0WA 1TKTB 2P1JA 1QAYA 3GG0A 4FJKA 2B6AA 1VQKS 3UDVA 2OEKA 3EGNA 3VPZA 2O8CB 1HKCA 3HHDA 2UU9J 3QESA 2W7AA 1UWAA 2DGTA 4RNHA 1U1RA 1QE1A 2KZZA 4NLOA 1FRMA 3TNVA 2GAHC 5BPLA 4X62F 1RTIA 4DPOA 3GONA 4DLEA 4YOVA 2YI1A 1TZ0A 1EP4B 3SPZA 1XMOJ 4OI1A 1KTVA 5KFLA 1VQ7S 4YB6A 4CEZA 2QLBB 3VQAA 3CC7S 1B3TA 1SC4B 4DX8H 3H4DA 4CLZA 2F9WA 4CM0A 3KDOA 3TAPA 1JK9B 3GIKA 3THXA 2PO4A 4DFMA 1P9QC 1HKGA 1B99A 3SJJA 2KM8B 2UU9F 5H1SV 1U04A 2P8IA 4I7FA 3H46O 5FLXU 5LSRA 3N79A 3GIJA 4KJIA 2ASOA 5D3GA 3K0SA 3D45A 3T5KA 4NLVA 4X65F 3DKDA 3IWLA 8ATCB 1DTTA 3JAMU 2FZGB 3F73A 2E1AA 1XMOF 1M0SA 3OFFA 2MQQA 3DDNA 5AQOA 4F3TA 4Y2AA 2Z2ZA 5KFIA 3E9LA 5IT9U 3LL3A 2ZHBA 1R6VA 1Q0NA 2OELA 4OKJA 2ZBIA 3MEKA 2HNYB 1U2RA 4WFBL 2IYGA 2KFZA 5C15A 3QEVA 2J0QD 3C15A 1GOCA 2W41A 3Q7CA 3FFIA 4Z4HA 2ROPA 3FUYA 1G7CB 3BGLA 1YJ7A 4DR6K 3ZETB 4IEIA 4G1QB 4OYBA 2GVDA 2Y1JA 3SAGA 2BA9A 4DL3A 3AA4A 2KHDA 1ZYQA 4P2SA 5L1LA 1LW2B 5F8HA 3IBFB 4GKKJ 5FIIA 3KMSA 3VGKA 1NDPA 4K4VA 1C0TB 4GKJJ 2JC0A 1AUDA 2Q0UA 2Q31A 4DTRA 4EHUA 1MWYA 1Q95G 4K59A 1YJ9S 3DXMB 4OHVA 4AXIA 3H7HB 2YWEA 4U8YA 1RWXB 4IEEA 4CZGA 1RT7B 5E3RA 1Z6RA 2KRBA 2E1ZA 2RKIB 4K2XA 3NGDA 4EBCA 2DGUA 2YH0A 3CFRA 3KLIA 4B3RF 5F0UA 4WQ5A 5ETQA 1OH7A 3IRXA 2YNHA 1T3VA 2M0GB 1K73O 4GKKF 3CCLN 4J2BA 5FPNA 3GSDA 3DGPB 3N5BA 5IT0A 4PYAA 4GKJF 3GPAA 3NMAA 4HHTA 2M52A 1NDLA 1MMNA 3GYGA 4N76A 4FK2A 4KH5A 3ZSVA 2DNZA 3BN4A 2HWHA 2ZE2A 4IWVA 4J9LA 1U09A 5A76A 3HFZB 5FROA 3CMQA 1RBTA 2MZRA 1AT1B 1N36K 3QIOA 3NF6A 3SBGA 2HHXA 3J7YI 1EARA 2XO7A 2WSEC 2AGOA 1W26A 3HHLA 1R31A 2C22A 2G9OA 2RE2A 2V6AA 1VR6A 2CFXA 1VQMN 2NXUA 2IA6A 1LQ9A 1G15A 4QOZB 4TSXA 4ZLLA 3HPOA 5H1SQ 3BYRA 1CJUA 4DV5F 3AFGA 3QAEA 1XWLA 4EUVA 2PI5A 2Q2RA 3SQGA 3T1YJ 4IFVB 3A1YG 2IRXA 4DPTA 3C0BA 3DRPB 2QWOA 1F2GA 2EFVA 2R42A 1CJKA 4E8UA 3K0JA 3OBYA 3SCKE 3D54A 1BXNA 5DG8A 2E7VA 1I3OB 4FJMA 1U2VB 3TUIC 3MD1A 1GLFO 5DK5A 2PYJA 1FXLA 3AT1B 3AQOA 3F41A 5IQQA 2OUGA 4WE1A 3WC0A 5AQVA 2C2OB 4UY85 3IMQJ 3KXDA 5BR8J 1O6XA 1OIAA 2AW0A 2ZNZA 2ATQA 3NOCA 2OPQA 1RWNB 5L1IA 3T1YF 3M2UA 1RCOB 2GWJA 3NF7A 3F0NA 2IJRA 1NUEA 5J2PB 1C1BB 4EZ9A 3VQTA 4P7TA 4U67Q 4BC9A 1U8WA 3V1OA 3BF3A 1WHWA 1ZBFA 1WG1A 2B0GA 1BDGA 1HNZK 3VF0B 5FLXO 1PIEA 2ZJRL 3KK1B 1Z1ZA 4JUZA 4YB5A 2UXCJ 4FF2A 3CGIA 4KGVB 4IFYB 3ZZUA 3HPGA 1RT6B 3PFEA 1UEUA 5BXIA 2RHSB 3JAMO 5BR8F 2YKMB 4LQ9A 4TY8A 2FHOB 3LANA 1IG9A 4JI3J 2W01A 5HQLA 4E7LA 3HF5A 4OI6A 2BANB 4URSA 4EBDA 4YHHJ 3MUVP 2UUCK 3NCRA 5IT9O 3IAM9 4LF6K 3I5BA 2HQ3A 5JXSA 1Z4UA 2EFQA 4QIWD 3D0IE 1U25A 1YK9A 1J53A 3KUHA 3HK2A 1MROA 1G3OA 4XH4A 2DHGA 4E1JA 1WF0A 1NPKA 4JK7A 5E0OA 4JRQA 2NZ4A 4ZN1A 2RDIA 4X4NA 1VQ9S 2G2ZA 1SIWB 2B9YA 2HHHK 3K5MA 3TEHB 4PHTX 4YHHF 4XAKA 3SQOP 4TYAA 3OTDA 4CM2A 1JB0C 2Y8WA 1CULB 3P4IA 2YH1A 3IBCB 4EFAC 1VQ5N 3MXJA 2BW2A 1MSWD 3ELHA 1HW8A 3H8YA 1PO6A 3C6UA 1HKBA 1F9EB 2NRRA 1M1KO 2OTLS 3DLHA 3CDBA 3UDEA 2FHMA 4NX9A 3ZZRA 3U3YA 1SQFA 3D2EA 3AY9A 2E5GA 4A48A 2E1PA 1YIJN 1TL3B 2RH3A 2VBYA 3RG6A 3WBZA 3A5NC 3POTA 4WTYA 1VOMA 4ZKAA 5J2QA 5DDQC 1KVJA 4C0OC 3N6MA 4ZK7M 2OPPB 3G82B 5GAGP 2PGCA 5LJ5Y 2LQ5A 2HLTA 4WTOB 1PKUA 3Q7BA 2AQ4A 3JTNA 3J7YU 3GCWP 2BJEA 4QW9A 2OPRB 1WF2A 2X7IA 4WFZA 3FSXA 3C6TA 3W9HA 2GQ2A 3NWRA 1IWGA 1QJHA 4QBUA 4DR5K 1VRTB 4P2MA 3VV2B 4MQ3A 2D0BA 4IDKA 2DIVA 4X4VA 4Z4EA 4XIUA 4RUCA 1J5EK 3GR1A 3TVZA 1WD6A 4QWBA 1KOHA 4B1UB 3KLEB 1VC6A 1IH7A 3R5CA 2F4FA 1K8KA 3DRXA 4PWUA 3ZX3A 2HGMA 1TTHB 3P39A 2OFHX 1GAOA 4B1WB 3F9KA 4LSLB 1GT8A 4JD2A 1HR0J 1OSCA 2YCHA 2V9KA 2FVQA 2QYGA 1M5OC 1T44A 1LK5A 2BOPA 4PKGA 1DLOA 2JJ4D 3ILOA 1X3MA 3W2WA 3ALYA 2ZGZA 2HZAA 1IBKK 4BS2A 3BDPA 2KFNA 3GDQA 2W9CB 3VQSA 2AT1B 2N82B 1Y3JA 2OIHA 3G4SS 4DR6J 4LFAK 3U1LA 1CEZA 1HNIA 2H3EB 3ZT4A 4BE1A 1YJRA 3WQTA 3THTA 2P6TA 3MM6B 1X31C 2HOEA 2VG5B 2E66A 3IC1A 3NG8A 3IAS9 2BR0A 2F63A 3FGVA 2GX9A 5IC6B 2V94A 3BBFA 2ZD1A 1HR0F 1FESA 2QEXS 1CJVA 1Q1KA 1VHIA 5KT6A 3ULEA 2FC8A 2MKJA 2QJ3A 3OTOK 5BYRA 2D69A 2F1FA 4RWTA 1EXQA 1Y5IB 4JV5J 5EX0A 4UW2A 1SJFA 1NGIA 1RDWX 1VBZA 3MWTA 4FJNA 3WEEB 2KT2A 4IYQA 3DI6A 5KFJA 1JX4A 2RRAA 3RWUA 1TKXB 2XMWA 1T7PA 3UKUA 2HLUA 5LSOA 3QSIA 4MKAA 2VICA 5J1PA 1BQMB 2GJFA 3LALA 2FB0A 1RAIB 1RGIA 3OXGA 5AE2A 4RCHA 3ZZZA 1NGJA 4BRFA 2A40A 5EXWA 4BR4A 2XS5A 2MQOA 3FSIA 2V4RA 2FF6A 2N4CA 3QEXA 3EN9A 1RK8A 4JV5F 1RUSA 4BWMA 2XHWA 3C16B 3IWXA 3T5JA 4CJKA 1WTFA 1S6OA 1X9WA 4PXDA 2MPUA 3QIPA 4L3KA 3AA3A 3CC2S 1BO5O 3SCJE 3IDHA 2YNFA 1I94K 4FSVA 1C1CB 2IJNA 2GCFA 4KKOA 5HROA 4OX8A 2G0CA 1B0TA 4C97A 1R8CA 1T9WA 3HVAA 4U96A 2PFDA 1KBRA 2QWPA 4M5DA 2MXYA 2KW4A 4NLDA 5B8HA 2HS4A 4ILGB 1JIHA 3VZIA 1HPZA 3TW0A 3WC2A 1VSIA 1YF5L 2X78A 4TU8A 3QDKA 4H54A 3M7VA 5DQGA 5DDRC 2WVFA 4F4AA 4BQLA 1JMTA 2RNEA 4JI8J 3KLGA 3KHGA 2BE2B 3AD8C 4X4UA 2HBJA 4AHUA 4ZHRA 4IRCA 4H0YB 1KAXA 1F60B 4MKBA 1WOQA 1C2PA 4ZTFA 1JLCB 3RB4A 3M30B 4GMKA 5T7LB 4ANDA 2D5RA 4KRWA 1K1SA 3Q0AA 2X3DA 1FEHA 5GMDA 1H98A 2KJWA 1SJ4P 2DR8A 1DHMA 4USIA 2W9BA 4KHUA 3SBMA 2HNDA 4HWIA 5U47A 1N5YA 5KT5A 4ANCA 3BBCA 1Y10A 2OFGX 2E5HA 4WPAA 4U7UK 2DNKA 4R25A 3QRQA 4P7VA 4JI8F 2YKNB 3ZZPA 2A42A 5JVHL 3ZZTA 4JI5J 4FYWB 4FF4A 1F3VA 1HNZJ 3V9ZA 3PIOQ 2RVJA 4XH1A 2YPYA 3DMJB 5KFYA 3MHYA 2UVRA 1JLEA 2XMUA 3AXKA 3ZT3A 1KSPA 2ALZA 3OS2A 2MJUA 5J1EB 1W7WA 5CZ1A 3SMSA 3W2VB 4HLBA 4PQUB 4FM0A 1N5SA 3MM5B 4CJQA 4CZCA 2W6LA 3NXZA 3ZSZA 4BACA 3AOBA 5M1NA 3L3CA 5HI7A 3TO8A 3J7ZO 2VL1A 4F36A 2CWXA 3OTBA 3JQKA 3KZBA 1S1XA 4C8OA 4JI5F 4NOHA 1D3WA 1HNZF 2Y9HA 4NI2A 2NUUG 5E5NA 3O5BA 1FRKA 3EM1A 4J9VA 2YNIA 9ATCB 5E3AA 2WTFA 1N4LA 2CJXB 1RILA 1RHUB 3P6YC 3QETA 3W7BA 4X84A 3GE9A 3M2VA 4B3SK 2B7CB 5I4MA 3LGNA 2HHHJ 5KFKA 2MQPA 3C65A 3O4NA 1VQYA 2D3O1 3NEKA 3C6AA 2VUGA 1RBRA 4QR1A 1T9UA 1OVYA 5LJVA 2ZDOA 4A8OA 5E41A 1EIYB 1QLNA 3E1YA 2K8GA 3VQ6A 2WBMA 4DU1A 4FJGA 2XYPB 4PUOA 4X66F 2O8DA 4ID5B 1C0UA 4NE9C 2OSQA 2R7XA 4HCCA 3IGNA 1UA0A 1RHRB 2MQNA 3LO3A 2KT3A 3C14A 3Q8VA 5EX5A 3VVUA 2Q3PA 3EDQB 2UXBJ 5EGYA 5A8WA 3TTCA 4ES2A 2GO8A 2WBRA 3BGRB 4R8UA 5B0CA 2M2BA 1RAGB 3S3NA 4NYPA 4WK3A 4G1IA 2HHHF 2VC1A 1YTYA 4FXVA 4K42A 5HVFA 4ZVHA 4M7YA 2NXNA 2W8KA 3O3HA 2QFJA 2VWBA 1S48A 3BSAA 1BISA 4IG3A 2AYMA 3KLHA 3ZTRA 3TSUA 1XC9A 2HFVA 2QG9B 4CNZA 2GFFA 3LP1A 3TAMA 1I39A 2G8UA 4J9SA 3ID6A 3PYGA 1Q7YT 2BZ2A 3AOCA 1W9HA 2GO9A 4DU8A 2GUIA 3SJHA 2CNKB 2UXBF 1YRXA 1OYEA 4LVOP 3EE9A 4DR5J 1UVJA 4DX5A 3NCQA 4ZVQB 4JI2K 3T7ZA 3WZ0A 4B3TK 1CQNA 1FT8A 4Y65A 1J5EJ 1E6YB 1E3MA 5GADI 4FPBA 3CCQN 3DXBA 1VQON 1NJWA 3CCUN 5KFNA 1IQTA 1CC7A 4LF4K 1U7LA 2WRMA 3UD4P 5KPTA 1RT4A 3CXCR 4JKHA 1NB2A 5FPMA 2N7YA 3D0HE 2QWMA 4CFBA 3CXCM 2X1AA 4ETXA 2VKZG 4DR7K 4LF8K 5I42B 3DOMB 4OV6A 3MAAA 1EX8A 3PG9A 4DV7F 1Y4ZB 3OT9A 1JKHA 4NYZA 4B1YB 3CI5A 1YJWS 3CCRS 4E7KA 4KGMA 1QQNA 4DR5F 1YBUA 1EWRA 3MEDA 2D0CA 1TU0B 4IG0A 4CO2A 2CGLA 4HI1A 1J5EF 2B43A 2XI2A 2BACA 2VH7A 3I0RA 1IBKJ 2DH8A 4LF7F 5KG3A 4ZTJA 4CYUB 3HFVA 4F50A 4LT6A 4DQQA 1YVNA 1WC6A 4HL9A 3UNGC 2G13A 4P52A 2XTJP 2CIMA 3MEEB 4ECUA 1V4SA 2RF2B 4NWBA 3CERA 3PM9A 3MPDA 4KBOA 3QGIA 3T1HJ 4ZDNA 4ZLPA 1NWKA 4Z4GA 5KOWA 1TL1A 1LV5A 3A0IX 4JV1A 1UZHA 2ITMA 2HS3A 2GQCA 4DU7A 5GAEP 2KXHA 2R7YA 4LUBA 3V1RA 4M5GA 3M8YA 1OY6A 3OTOJ 4HYKA 3KG4A 3DRRA 2VPXB 4PA1A 3G71N 1TKDA 2E8AA 4IO9Q 4WBFA 4MO5A 1FRHA 5IM0B 5LL6d 1FJEB 4NO7A 4KI6A 2X6NA 2IIRA 5CYQA 4XTTA 3FLCO 2W7PA 3JSBA 1BA1A 4JI0K 3MXIA 2HHWA 4G65A 1UL3A 1N34K 2G8HA 1RKJA 3EY1A 3DLKA 2VFVA 3T1HF 2V69A 3LP0B 4A57A 4ZJQA 5A8RB 5B0FA 4KB7A 4ZVSB 2GV9A 3FEZA 3LP2B 2GJIA 3NNHA 1NOZA 3OTOF 2M5YA 4ZPCA 1UAXA 2ASDA 3DOKA 2O8FB 2OAUA 3BR8A 3C8YA 2AZ3A 1HD0A 1PCAA 3WHIA 3CC4S 1WACA 2YHAA 2DGOA 2IAJA 1RLDA 4BROA 4NLPA 1K73T 2SXLA 2FBTA 1I94J 2UVWA 2FGCA 5HJXA 3SPYA 2W25A 2HQGA 3R3LA 3R7SB 3GJRB 1SH0A 2XULA 3R7BB 4OZ0A 5ETNA 3B8AX 1FD8A 2P9IB 2MY7A 1BQNB 1OSDA 4P10A 1FKPA 3JSMA 2OEMA 1H74A 4A46A 5KFHA 2ZH7A 3BF1A 2OD6A 4HACB 2XS2A 1UVMA 3MCSA 4CE9A 1A5VA 4WCEL 3UIQA 4O8UA 3DCAA 1MG7A 2HFOA 1PAEX 2UZAA 1BCOA 1UFKA 1S9GA 5K8MA 4XPEA 2W2OP 1GMWA 4LF2A 2GX8A 1BMQB 1RABB 3OYGA 3VTIA 2B51A 2E9RX 5EOYA 5D0GA 2VOPA 3J81j 5AR0A 3H3OB 3VGLA 1JCEA 3H40A 2RMLA 4CEBA 2AIRB 1VLYA 3GIRA 4L76A 1N5VA 5KT3A 3QO9A 4CLKA 1VRUB 3HZ6A 1S1TB 3BZCA 4M3XA 2P9CA 3KYLA 3K8VA 1OWXA 2QX0A 1N88A 3VETA 1LFPA 4OZNA 4BGBA 3M1VA 3NGUA 2RJZA 1N48A 5EU7A 2CQCA 2FJDB 4P72A 2MDAA 3GILA 1QZ6A 4LSNA 1WOPA 2P9NB 4FVMA 2VC0A 4ETZA 3QEIA 5B08A 2CPZA 2CADA 5CCLA 1HBOA 4C8MA 3Q8QB 2WSFC 1JLBA 4OPHA 4R5PB 1J5OA 1YDLA 1XR6A 4ECSA 3LUYA 3CCMN 3MEGB 3MR2A 4CGIA 3BQ2A 4EP4A 3THYA 1N5QA 4RW8A 5CH7B 3R8EA 4BDZA 4QWDA 4FS2A 2IM2A 5HJYA 2J6UA 3BO3A 4BRDA 2ZH1A 1L3VA 3KTQA 1S1UA 2EVZA 4DFKA 4U7BA 3CJCA 2E4LA 4WWSA 4B3SJ 1NB7A 2VHGA 4FOEA 4CT9A 1QDUB 3HHKA 2J8AA 4PL7A 3KNGA 4BRKA 1QAJA 5L1JA 2H65B 5ITHA 1O0PA 1X8DA 2DIUA 2COLA 2IC3B 4YR2A 2RT3A 2CNLB 2IVYA 4DL2A 2J6SA 2ILYA 1F6TA 3K5NA 2W7OA 2B4PA 4NYNA 1P27B 2BQUA 1NO8A 1WUAA 3UKRB 4GVLA 2Z1IA 1NOYA 4Z7CA 2C42A 2C2NA 4XDCA 4DHVA 1SQKA 3NNAA 3QFWA 1X9SA 2ZHAA 1VQMS 4OKEA 2VBWA 4PWDA 3DLLQ 4H0PA 4FF3A 4IKFA 4JI4J 3WXIA 1D09B 1PJ5A 1VIOA 1QD1A 4AT1B 1TL7B 3QAUA 1RTDA 1HWUA 4BBYA 2VODA 2OP5A 3Q24A 2BW7A 3PKYA 1XNRK 4QZVB 2DNQA 2H4WB 2RILA 2ZBPA 1M1KT 2AEJA 3G6YA 4CNYA 2VFUA 1UETA 3IS9A 3VA0A 2G2OA 4FWMA 5HAOA 4Z94A 2BTFA 5F0WA 3ZYYX 3K89A 3OHBA 3TAGA 4JI4F 3MF5A 3CB4A 1VQPS 4B3TJ 2ZWHA 3NGRA 2CNOB 4ECTA 2DGQA 3BV8A 3QFHA 4O3PA 3NGIA 1WKLA 2C2MB 4EWTA 3DRSA 1UVLA 3H6EA 3IA0A 3U02A 2B4JA 2EG1A 3TAEA 3RB6A 3R9PA 3VQCA 2J7KA 1UJ5A 2FF3B 1Q8IA 2HVIA 4W5OA 1W2BM 2W8LA 3RBEA 3X3UA 5H9FK 4QPXA 5EY4A 4F9OA 1C0MA 4LF8J 1KFDA 4HTUA 1F0XA 5F8JA 4A8MP 1J54A 4NMXA 2HMIA 1GLDG 4MYTA 5DGAA 3JXUA 1YBAA 2VQFK 5DRKA 4FO0A 5D15A 4YFUA 1HNXK 4OYOA 2AJFE 2CDQA 2L48A 3IG1B 5RUBA 1NK5A 1SH2A 2J7WA 4DV2J 4W90B 1PAUB 5D4OA 1TMMA 3GWCA 4J5OA 2VONA 5HANA 4WXWA 2UUAK 2CG8A 4DHYA 2XSJA 3GYXB 4KQZA 4NLUA 2E1YA 2ZKTA 1H2TZ 4M95A 2A6OA 5HOOA 4C9DA 3BKTA 1X9MA 5DG9A 5HMYA 3MMCA 2JLFA 4H0OA 1RWUA 3DHXA 5AZIB 3PSFA 2VG6A 2EW9A 5E33A 4Q7AA 4KRFA 4DV2F 3T5LA 3CULA 3HXMA 2GNKA 3GSIA 1A7GE 1TV6B 5KG6A 2DO4A 4RR5A 5JS1A 1RB0A 3LPEA 3MX5A 4JI0J 3LOUA 1HWJA 3LZIA 1XIQA 3J7A1 3PYDA 1NJYA 4JI6J 3NBPA 4P6QA 3TX8A 2BV3A 2W2MP 5CYMA 4NPOA 2EC2A 4OQJA 1EO1A 4YOTA 2ZH2A 2CDRB 1TFYA 1LXJA 4CJ7A 3HKWA 2ABYA 4BRMA 1R43A 2KH9A 1NPRA 4N41A 2PN6A 1GX5A 3C95A 2DCUB 3KK2A 4I6MB 3A8KA 4H4OA 3OPKA 3NP5A 2O66A 2QA2A 4O23A 4FJ8A 3ADAC 2E9TA 2JWNA 1ATNA 2R2TA 1NNEA 1NHUA 4V19J 2YXLA 1Q81O 3TPQA 3P83D 4RNNA 2HFZA 4DKWA 4C11B 1LWFA 1LKZA 3OYIA 4F4YA 4JI6F 2DFEA 1Z2LA 1RT5A 1JL1A 1WKJA 3M2RA 4JV0A 3FBEA 2O8CA 1VC5A 1GOBA 4O0JA 1U2CA 2QKBA 1RISA 2W4DA 3QT8A 5AJ3K 2WW8A 4DTSA 2DY4A 1S97A 3R1LA 5IWAF 5AXKA 1RWOB 2Z0GA 6FDRA 1ZBIA 3V6KA 3MCPA 1ATRA 1T03A 2PEBA 4BVOA 3BGFA 2E5LJ 2QKKA 2WVDA 5M2RA 1DFDA 2AA4A 3LDOA 5J2NA 4DF4A 3ZTQA 1ESVA 1X3NA 3RR7A 2DNHA 2P9PB 4OHZA 5DLGA 3S3OA 1HBNB 1GXUA 1BIZA 1HMVB 3AA5X 2A1SA 5AQTA 3MPWA 3U8XA 1EX4A 2A5XA 2GC8A 3EJMA 3TZXA 4CJEA 5C2DA 1WAJA 1Q86O 2ZEJA 3IP0A 3FCVA 1JXEA 4CP5A 3QLHB 4NXNK 2J0XA 3FMWA 5L38A 3DLBA 1RYRA 1SUQB 3H1QA 2V2VA 4BC5A 3Q89A 5IV4A 1X5PA 4ZP8A 2ASMA 5LT5A 4C3KA 2ILZA 2E5LF 4W4MA 3AJ2A 1R0CB 2F9JA 1BD6A 2ATCB 5EDWA 4EBEA 3FZKA 2X1GA 4FZVA 2KDOA 1MWQA 5D6GA 1V6HA 4O0NA 3SUQA 1RKIA 2HBKA 4EGLA 3ILIA 2BGGA 1RAJA 5AQRA 2MB0B 5ETRA 2V7YA 3OUYA 1ELOA 1KLMB 5D4LA 1WHVA 2XI3A 4PG5A 4DR1K 1FWLA 4BC3A 3RMBA 4URGA 3AB2B 1TUVA 3KUEA 2QC3A 3KHRA 1REVB 4K4YA 3QFPA 3ZETA 1DGKN 4XEIA 4G1QA 3ITHA 4Q0BB 3GL1A 2KI2A 2F4VK 3PW2A 4J37A 3TRGA 2RRNA 1K44A 3QRRA 3MOJB 3OR2B 5E3QA 2O4IA 1S1WB 2P9LB 2HRUA 2NRWA 2IVOA 4UUXA 4CZEA 1CBKA 3CF5Q 2AV5A 1C0TA 2Y0SD 2P9SB 5ETPA 1TUUA 4ILLA 1S4FA 3VR1A 3IWNC 2B5JA 3HHLD 4X4OA 1RLCL 1BE4A 4RW7B 3BEXA 1JXLA 2D41A 2FD2A 3A13A 1GMVA 3IGVA 1RTHA 3VQ9A 4QOTA 5E3CA 3J7ZT 4OGEA 2XZWA 1N6QB 4XK8C 4CRJA 2EPIA 3CVKA 1RBUA 2RN2A 5HBMB 4E2FB 4OYWA 4IOBA 5C12A 2B4UA 3DGPA 1RWWB 4MJKA 3GV8B 4P2FA 1LWEB 3CJQA 5EX3A 1PYSB 1YUWA 4KHWA 2DR5A 1WEZA 5CZVA 4C8YA 2OTJN 4RUBA 5IXUA 2NLWA 3M1FA 1UMJA 3O3FA 4CJPA 1Y5NB 3CE8A 5AE1A 4FLWA 4U7CA 4OFZA 2IM1A 2H4YB 2BXJA 4ED6A 2X3GA 4H4MB 4CD3A 4E7HA 1GXLA 3ENVA 1BU6O 1R0AA 4HHJA 2BKPA 1AZSB 4YOWA 2QSFA 7AT1B 3CD0A 3VQDA 5EUHA 3U1MA 4C8LA 4FN5A 4ATNA 4HUGA 3CQYA 3MK6A 1HWKA 1NBWA 1FK9A 2QN6B 2KVIA 2VG7B 5C24B 1QHTA 3UNYA 1NH7A 3VAGA 2EG2A 2O8BB 3GYNA 3M8SA 4G6VB 2R9LA 1M5KC 5DDPC 2AYGA 2BUNA 4K4TA 2GEMA 4A2AA 4JOUA 4WFBQ 1S6PB 5AQYA 4O3QA 4KO0A 3HSJA 5FDLB 2EI5A 1U2VA 1ZA1B 2WONB 4WXOA 4UOCA 5H9FJ 2H54B 2R7SA 1SC6A 3GCXP 4I56A 1OYDA 2UUBJ 1SV5B 3OYAA 4Z37A 1C4AA 2XYGB 1YZ7A 2OJ3A 2MHEA 1U02A 2B9WA 4JS4A 1JLGB 2VQFJ 3TVKA 3LWLA 2MY8A 4ANEA 5KFRA 4USHA 2BKOA 2XGPA 1HNXJ 4JHDA 3O4WA 3LZJA 1KFSA 2G8KA 4ZA1A 3THVA 2ZBRA 2RUSA 3I55S 3O3GA 1TYQA 2GHVC 4LBHA 3QIDA 1U0SA 4HH1A 3E01B 4P75A 5GINA 3MM9B 2UUAJ 2V8PA 1Y64A 4Z4IA 4CF9A 1DEJA 1H38A 3T9NA 1H3DA 2V9WA 2WVEA 4CJUA 3CJ7A 2PZSA 1IVZA 1VFJA 2BUPA 5GAGI 1RT6A 2NUHA 4KB0A 2UUBF 3OLAA 3OYEA 2FLOA 2O4GA 1FJ7A 2X51A 1VQ8N 2VQFF 4ZVGA 1WB9A 4X64K 2GJ2A 2MQLA 3ZZYA 4PABA 4DTOA 1UVIA 3CJKA 1B64A 2KKHA 1WBBA 4OV1A 3H08A 2YX4A 2NCKL 3H3NO 4B3MK 4LJMA 3LA0A 1AFJA 4FWOA 1FJGK 2OZMA 1EAYC 5KFGA 3VQ7A 2MYFA 2UUAF 1REGX 1GLAG 3UVJB 2RQCA 2AX1A 2F8EX 3DAWA 4FBUA 1BIUA 3X1LB 5C2CA 1X0FA 3A3NB 3LPTA 4IH6A 1RSCA 2JVRA 3MDQA 4KFBB 1BQXA 4B1ZA 4J9UE 1L3KA 4I9QA 2ZH6A 3OYMA 5AFUA 4LD0A 3BDEA 3DLGA 4K8RA 2F8SA 3TTFA 4FP9A 1W25A 4NB4A 2GVZB 3JTOA 3IUCA 2Q1NA 5DS7A 4O55A 3DM2B 4W5QA 4M3UA 2HWTA 3KG1A 5J1NA 2QWNA 2MKHA 3O5TB 1Y97A 1KHVA 2NXCA 4ZPAA 3T41A 1N8RT 3GU0A 2DPNA 4ISEA 2HNZB 5KG5A 1K8AO 4YB1P 3ZSYA 1FTRA 1IJFB 3OY9A 5LOQA 2NZTA 4IR1A 1T9YA 5AJ3J 2XNQA 2V0NA 2QGFB 3CPWM 4OLBA 3BBBA 1RXOB 3I0SB 2G1HA 3FBBA 3CCQS 1VQOS 1HI1A 2VZ9A 3MI7X 5CY4A 3CCUS 3I8BA 4BRPA 4RW4A 1ZBTA 2FBXA 4CHOA 4TQRA 2QL7B 3DGVA 3QB0A 3DXSX 4F3QA 1Z26A 3RSEA 1Q7LB 2OPRA 1LW0A 3OYLA 3NMUA 2HBMA 1SPBP 5E7OB 2K1RB 1VRTA 1EETA 1PYOB 4DL6A 1F1BB 4DPUA 4KPYA 4LF1A 5AFUH 4DV6K 1ZM3A 4USVA 2ZJRQ 2XB2D 3R7NB 1T8EA 5AJ3F 3MAHA 4NXNJ 5HRRA 4YY3K 4YOEA 5AE3A 4YOYA 4MT1A 3WQUA 2QLFB 1BWFO 1WC1A 4DUZK 1QY7A 4HKQA 2BOAA 4N5SA 1FDNA 4J9NA 3CDAA 3ZSRA 1PBAA 2IRYA 4I6AA 3A3PB 3RYLA 4LSLA 2AWZA 5JICA 5KPZA 1OY8A 2ZJPL 3BQ1A 4UF4A 5C42B 1ZAVA 3OJSA 1PJ7A 4IQMA 5MLCQ 3F2KA 1F5CA 4E0DA 2XC9A 2HEKA 3RZAA 3R6MA 4BR5A 2D7SA 3AJDA 2YBVA 4O4GA 2F8HA 4ZOSA 2VYPA 1A5XA 4QS8A 3TUPA 3KD1E 1NU0A 4DR1J 3WX4A 1JXBA 1W2IA 1S9EA 2YV0X 2XY8A 2IDLA 3CWJA 2NUBA 2WVCA 3IBWA 1E6VA 2IDEA 2ZKUA 1VQ6N 3G71S 1OH5A 4CIFA 2A0FB 2B6AB 5KFBA 2F4VJ 4KH4A 1YVFA 2DGVA 4DV0J 2HS0A 5L46A 4UY8T 1HBUA 3EKUA 1BLUA 1Q82O 3UR0A 3D6FB 3BKUA 1WEXA 1ILYA 1P8ZA 3HJVA 4HTJA 5GAGU 3BGOP 4KTZA 3VF4A 1QE1B 2OLWA 2GHWA 2BJ1A 2FY1A 5L39A 2X6SA 3VQQA 4E3SA 1F9FA 1K1QA 4NXMK 2LXIA 4DR1F 4QCLA 3CFPA 4IOCQ 4CF8A 1U8SA 3ILLA 4GC6A 2P9UA 2MZ1A 4CGGA 4RL1A 1TKXA 3OXLA 2LFVA 3TVYA 2F4VF 1J6ZA 3L2VA 1UZDA 5CABA 4DV0F 4N7TA 4K41A 4OPKA 3TTDA 4URQU 3NL0A 1R8BA 1FO1A 3AH6A 3THXB 1Q8L