4GKKK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4gkkK00
2UUAK 4GKJK 4DR2K 2UU9K 4GKKK 4LF6K 4LFAK 4V19S 4DUZK 2UXDK 4JI6K 1HR0K 4JI1K 5IT9O 2UXBK 3J80O 2F4VK 4NXNK 4DV2K 4LF7K 2UUCK 4DR7K 1XMOK 1HNWK 4DR6K 4YY3K 2VQFK 4CW7B 3OTOK 5A2QO 1IBMK 4DV5K 3J7AP 5AJ3K 4JV5K 4JYAK 4LF9K 4AQYK 4KHPK 2ZM6K 4DV7K 4NXMK 4LF4K 5LMNK 2HHHK 4CVNE 4DV0K 4DV6K 4OX9K 4LFBK 4X64K 4B3SK 4DUYK 4JI5K 4DR3K 1J5EK 1FJGK 1XNQK 2E5LK 1XNRK 4X65K 4YHHK 1I94K 4B3MK 4DV3K 3T1HK 4JI0K 3J7YP 4B3RK 3J81O 4JI7K 3JAMO 1N32K 1HNZK 4JI2K 4LFCK 1IBKK 5BR8K 4JI8K 4DV4K 2UXCK 4B3TK 5FLXO 4LF8K 4DR1K 4JI3K 4K0KK 1HNXK 5IWAK 4X66K 1IBLK 4DV1K 4DR4K 4LF5K 1XMQK 1N33K 4X62K 3T1YK 2UUBK 2VQEK 5LL6Z 1N34K 4DR5K 4JI4K 5LMUK 1N36K
chains in the Genus database with same CATH superfamily
4UY8O 3OHRA 3ZSQA 4BRMA 3MN5A 1RDDA 2PAVA 1RDWX 4KPYA 3EZWA 1YI2N 5I3UA 4IBNA 3VQ5A 2HMIA 4BRHA 4DKWA 4WFNL 1SQKA 2VWJA 3CCEN 1NGCA 1LAVA 4FW1A 1GLJO 4O0JA 5CYMA 3F5TA 3EY1A 4JI1K 4DSIA 1VSFA 4CF8A 2VYPA 4NXNK 3C6HA 3SLCA 2A6AA 4DR7K 3LWMA 2NRRA 1I3AA 3ZX0A 3SV4A 1C1CA 4JHDA 2F96A 2NRZA 3OTOK 4AM7A 4DV5K 4E7IA 3SNNA 3O80A 2QKKA 4DFMA 5C12A 1WSEA 1ZBIA 4KHPK 4K43A 4H0VB 3THWA 3QINA 4GVMA 4FJ9A 3FGUA 3K9KA 4OLBA 5GADP 2W6LA 1JJ2M 1UOCA 5AQQA 2Z1GA 4NO7A 4KTQA 3RVCA 3ENOA 3IKMA 4KH5A 1HQEA 1U6ZA 3WXMB 1WSFA 4FLTA 1Z26A 2NRVA 3KJVA 1S1TA 4BACA 3K0SA 3FZHA 2YKNA 2VG6A 4Q5VA 2Q97A 3NF7A 3NF8A 3K9JA 2W41A 5BN9A 1VRTA 2NLXA 4CGIA 4O5FA 4JS5A 4FSVA 2FSNA 2Z1HA 3LWLA 3CPEA 1QQCA 4AM6A 1KD1O 2G8KA 3CI5A 3LDSA 3LDPA 2PY5A 1XC3A 3I56N 1XI1A 3D6RA 5FPDA 5SZTA 4QAGA 3NF9A 4FW2A 4OKKA 2RKIA 3RRGA 1RT5A 2XY8A 3QBWA 1CXUA 5KGXA 3VTHA 2OPRA 5KRTA 4Y0WA 1GOBA 3VQQA 3G25A 4CJ7A 3HPHA 4BROA 2XY5A 3QETA 4YOXA 3ATVA 3HM9A 1KAYA 1Z6RA 1BA1A 3O6WA 4CGFA 1R59O 3AARA 3C7NA 2F9WA 3E1YA 5HRPA 2GWKA 4B9SA 1TVRA 4FLXA 3L3VA 3VEXA 1SL1A 1KLMA 2ZJPL 3AA2A 4MQ3A 4BR5A 3NGIA 1MWKA 3AGKA 1UA0A 4DQRA 4DHYA 2X74A 1RT3A 3B6PA 1NM1A 3V1OA 1WAJA 3W3DA 3P38A 3LM9A 2QWNA 3O3FA 1KVCA 2YHYA 1TK5A 4N76A 1NJXA 4WF9L 1K73O 3PX6A 3LAKA 3AO4A 2VGMA 4IO9L 2WBNA 4LF9K 2P9LB 3ZLJA 1JLCA 1X3NA 3ZT3A 5AZJB 2AJQA 1KTQA 2Q3SA 3L2QA 3FLCO 1HJRA 3VN5A 4BRIA 3SUNA 5CHIA 2P5OA 1RT2A 2KLAA 3BEXA 1U47A 5FRMA 2JWKA 4JRQA 3LL3A 1RDAA 1U2VA 2X6SA 4DU4A 4F4KA 1HQUA 1N6QA 3TABA 1UWBA 5AR0A 5FRNA 3CCMN 4NCGA 3ZYYX 4CBXA 2WFBA 4EP4A 4F3TA 1IKYA 4MFBA 1C6VA 2KKZA 4LFCK 1IBKK 4DV4K 3KLEA 5AQKA 2G8FA 4CD3A 4LF8K 2KZMA 1MA9B 3KIOA 3PX0A 4DR4K 4KHSA 3A5NC 1EKEA 2W42A 2HBLA 3AA4A 5C2DA 3CD6N 4BRQA 1SV5A 4J2AA 1SKRA 1BWFO 3THXB 3HJFA 1TKTA 3KD5E 4JKEA 3D7EO 3P4IA 2QEXN 1S6PA 4JK8A 4DG1A 1BI4B 1EX4A 5AQSA 1M90O 4FK0A 3QEWA 3VA3A 4ID1A 4DV2K 3RMBA 1NGIA 1BL3A 3WQTA 3ZT0A 1W2BM 5EY4A 2DFHA 2GWJA 1TAQA 4CHZA 2ITGA 1QZ6A 5GIOA 1D8YA 4PKGA 3W0LA 1NK7A 3PLAA 1WB9A 5LJVA 2HMPA 3K5NA 3J7AP 1TV6A 1XC9A 3CFOA 2O8FA 3MWPA 3Q7BA 4DTXA 1CZAN 5F0XA 3BZCA 3RR8A 3IAYA 4K8XA 1G99A 5LMNK 4B9MA 5CY4A 4Z4FA 4F8RA 3VF2A 2ETJA 2F9TA 4N56A 2OTJN 1S9GA 1BQMA 4FPBA 4B9UA 4C23A 2X6NA 2OPQA 3AO2A 3PUFA 2YCHA 4B1WB 1T44A 4BGAA 1O13A 3C0BA 4IG0A 2IDOA 4CZJA 4MLEA 2HHQA 1HYVA 4KHWA 4GV6A 4PKIA 4O4GA 1SS6A 3ASMA 1NJWA 2V52B 1OH6A 2QWPA 4KFBA 2HF3A 1QSSA 4CHPA 1GLBG 3J81O 1K9MO 4BC4A 5H1SQ 1WN7A 2QWOA 2Z1JA 3NAEA 4RG8A 2QWRA 1N32K 4BR4A 4BRNA 2XY7A 2HNYA 4CEQA 1VAZA 3ZT2A 4FWSA 1IBLK 3LANA 4CZFA 2A1RA 2DFFA 3VQ8A 1JL2A 3AGRA 4WYBA 3WQUA 4CHOA 1NKBA 2E1YA 2E2QA 4N47A 1S6QA 2D0CA 2G8WA 1YVNA 4E19A 3V9XA 1QVFM 4B9NA 4AHUA 1K6YA 3VQ6A 1YTAA 3MK6A 4CJQA 1F21A 1VK0A 3OYMA 3L4IA 3LPTA 4GW6A 1LOTB 2HB5A 1Q18A 4ISFA 3T7ZA 3AVJA 3DRSA 4YOUA 2UXBK 4E1NA 2F4VK 2JLEA 3O4QA 4BC5A 1TYQB 3ZX3A 3CJ7A 1NKCA 5J2MA 4BWMA 5KRSA 1BIUA 1BG3A 1ASUA 4B1ZA 3TSPA 4DSEA 3CMEN 1YJ9N 2WTUA 3S41A 3TAEA 3V9WA 5F2RA 1T8EA 3BDPA 3CM5A 1U4BA 4EIAA 5AQNA 3THYA 2P9IA 3JXUA 3IS9A 1P90A 1W0HA 4H0YB 2P9SA 1VSIA 3MXJA 1Q82O 4IFVA 3N4QA 2RE2A 2HW3A 2DPNA 4E89A 3L2UA 1YIJN 3DLGA 1KAXA 4BRFA 4QOZB 3OYGA 1BISA 2WOMA 2WUSA 1QVGM 1VQ5N 4B3MK 3CCJN 2HVIA 3AVIA 2BTFA 3LP3A 2ATQA 3UKUB 4BRDA 3AV9A 3AVLA 4FXDA 4HHTA 4H5NA 1OKJA 1HJOA 5HRSA 1NBWA 4M7YA 4CEAA 1VSMA 3VF4A 4RWTA 4FM2A 3O4WA 4CF9A 4CEZA 3I33A 3NGYA 4CFBA 4H0OA 1P8ZA 1RCHA 2YNGA 1J6ZA 4DQIA 2E88A 4KHYA 2I7PA 2V51B 3GG4A 1WBBA 4BE2A 4DTPA 3SQ4A 1JLGA 4DCHA 2YX6A 2FC0A 4ZHRA 1B92A 2KZZA 5BN8A 3O9TA 2HBKA 5C25A 2DTUA 2KFNA 1QE1A 1T6DA 3UKRA 1YTUA 4IWVA 3NFAA 4IZ9A 4A61A 3OBWA 3OBYA 3JYTA 4KHNA 5I42A 2PYJA 3HZ6A 3LP1A 4CE9A 3TPQA 2A41A 3PIPL 2XHBA 2F8SA 4FO0A 3E66A 4AH9A 5HROA 5AQUA 1Q9YA 3TAPA 1RGIA 2I5JA 2QKBA 4CZGA 4E7LA 4ZTFA 3B8AX 2E6LA 4DTRA 1HYSA 1BO5O 2A1SA 3R9PA 4DQQA 1TAUA 3KWGA 1J53A 3HP6A 2BANA 3SQ1A 3MCPA 1IV0A 1NK4A 2QM1A 3V6DA 4DV6K 3MCAB 1VQ9N 1KAZA 1U48A 4ICLA 4OLAA 5AQLA 3FFKB 4F9OA 4BR2A 1J5EK 1FJGK 5AQTA 1CLQA 2E5LK 3AVMA 3VEVA 3WUHA 3VENA 3HT3A 3WXIA 1Z05A 4H4OA 2ASMA 4C1NK 2O8CB 5LY3A 1Y64A 4IKFA 4CERA 3KLIA 4IO8A 5C10A 3DXMB 4BREA 1DEJA 4OPKA 4CFCA 3PX4A 4ILHA 2ZJRL 1ZXOA 1LWFA 2QI2A 5TKWA 2NRWA 1HKBA 4CIEA 4PKHA 4JKAA 4AHVA 3HTVA 4ILJA 4FJJA 3G71N 2UXCK 1C1BA 4DQSA 3G4SN 3RMDA 5BRDA 1E4GT 2Z1IA 5BPMA 5GIPA 1B9DA 4J2DA 5AQHA 2JGUA 1RBTA 4I2PA 3D0PA 1ZBUA 2P9KA 5JLHA 4OKEA 5EX5A 4HUGA 3A2FA 2YNFA 3LAMA 5KI6A 3OYLA 4U67L 1UAXA 3V4IA 4L8RB 3U3GA 1YF5L 3QICA 4JEPA 1CZ9A 3CHWA 2YHAA 3DRPA 1RT6A 4ILGB 3ULEB 2YV0X 4H4MA 1DLOA 3LDOA 3TTCA 1HR0K 3BY5A 4OVLA 3TARA 3TWHA 3P39A 1EXQA 3DWLA 3ZEUB 4IJNA 1ATRA 4BC2A 3D2FB 4CK1A 3DRRA 4IOAL 4CIFA 4DF8A 4XEIA 1Q86O 1BCMA 5CR4A 4Z4CA 4E7JA 3KZBA 1NLVA 2NNWA 1XHZA 1J5OA 2ZM6K 3SV3A 3OS2A 5AQYA 1NJIO 4W5TA 3QEVA 2R7YA 4OJRA 4Y1DA 2P9PB 5T7BA 3O1WA 3NH0A 3BZKA 4FK4A 4Y1CA 3O9SA 3K5MA 2NZTA 3NMUA 3E9LA 1NKEA 1KVAA 3FZFA 3CETA 2HHVA 1RTIA 3A5LC 1A5WA 4DTJA 4B3RK 2IVOA 5AQZA 3VPZA 4BQZA 1K8KA 2CH6A 4BY9C 1R0AA 4C8OA 4CJFA 1V4TA 4KKOA 3DI6A 4OKJA 1C0UA 3VEWA 3M8PA 5FLXO 3QEXA 2XY6A 4DR1K 3ZETA 3CF5L 4X66K 3U9DA 4CEBA 3K59A 3MN6A 1VSDA 4FZYA 3HPGA 3R1XA 4CF2A 2UUBK 1N34K 1FK9A 4FJLA 3EN9A 4GV3A 4FJNA 4FVMA 3AVFA 5EU7A 2CGKA 4CJWA 4HCBA 1YT3A 1X9JA 4FJKA 4JK7A 3SJJA 4WFBL 5TKYA 4JKGB 3CJ9A 5J1EA 4U7BA 4JKCA 5KPTA 3NVKA 3BP8A 3DLHA 3MN7A 1IO2A 4R5PA 2Q36A 4H0XB 5J2PA 3ATUA 4F3OA 2E8AA 3CCLN 3VGKA 2A42A 4RW6A 1BOTO 1JL1A 1YUWA 4CW7B 3D2EA 1WLJA 4WQ4C 3M5RA 4PA1A 2YHXA 4CGHA 2OYQA 1DKGD 2WC9A 3M6GA 2O8BA 3O4NA 1JLBA 4I9LA 4CJUA 4PQUA 1HPZA 3VQEA 3O3HA 4H8KA 4Q0BA 5HP1A 2OA8A 3HL8A 4DS5A 3SMPA 3QNNA 1SL0A 4J2EA 4DFKA 4EZ9A 4KB1A 3NF6A 3VEYA 1MWMA 3CC2N 1HYZA 1L3SA 3QBXA 5AQPA 3HSTB 2KW4A 5GAEP 2AA4A 4ELVA 4EHTA 3G0ZA 4CGDA 4BGBA 5KPRA 1NMDA 4N5SA 2P5GA 4B3TK 3DLEA 3R8EA 3DOKA 1WSJA 5CE3A 5CYQA 1VSJA 4NCAA 3O9UA 3CC4N 2OPSA 4BRLA 2X78A 5BRHA 2IC3A 1TL3A 4FJ5A 3K5LA 5AZIB 3ENHA 2VQEK 1TKXA 3TAGA 1Q7YO 3WNEA 4I2QA 2Q2RA 2ITMA 3ZSVA 4JAXA 1OH5A 4NYFA 5BPNA 1SAZA 3FFIA 1BU6O 1IG8A 3RMAA 1IJJA 1X1PA 3O1BA 4IG3A 4E1MA 3OJUA 4DUZK 3R6MA 4YNQA 5HRNA 1IKXA 3FR0A 5IT9O 3WNFA 4BE0A 4JKFA 2BGGA 4E7KA 1XWLA 5KQ8A 4CZHA 1XMOK 1QQOA 1JKHA 1GLLO 1DTQA 5EXWA 3IG1A 2VQFK 3AO5A 3LPUA 3TAQA 2G8HA 2GUPA 2FF3B 3MEGA 3K57A 5AJ3K 1N8RO 5F1XA 2V7YA 1RDCA 1LWCA 4W5RA 3HK2A 3I8DA 4DV7K 5CZ2A 5BPLA 4BRKA 1NMNA 4NCBA 3EKUA 1JLFA 1OVQA 3EKSA 1SKWA 3MX2A 4CF0A 3THYB 2YHBA 4FLUA 3P31A 3E01A 1CXQA 3CG7A 1X9SA 4FLVA 2IS3A 3SZ2A 4RCHA 3HVRA 1VQPN 2AP1A 2Q0RA 4IFYA 3THVA 3EO3A 2GX9A 3RSEB 5JICA 5AQMA 3WT0A 1YITN 5AQGA 4FJMA 4AHCA 2QK9A 3J7YP 2O8EB 3L4QA 3Q7CA 1VSKA 1OH7A 3SBGA 4M7XA 4Z0UA 1BUPA 5DMRA 3M3ZA 5DM6L 4FWKA 3QIOA 4C8KA 4XIUA 1ITGA 4CGGA 1HKGA 1QTMA 4BRAA 4I6MB 4KTZA 4BG9A 4CZKA 3FZKA 2FBVA 1HNXK 2D1KA 5DM7L 2QWMA 3OYDA 1L3VA 3WEEB 4FZXC 4X62K 3VERA 3MXIA 5GAHP 4FWPA 4JD2B 2P51A 3ZCMA 3DXKB 3ZX2A 3NE6A 4O8UA 2D5RA 3V9UA 4CJLA 1N36K 4FJHA 3V1RA 4DR2K 2P9LA 2UU9K 3ZSXA 3ULDA 1ZBFA 5AZJA 4LFAK 3KVGA 4EZ6A 4DTUA 4V19S 4H0PA 3OS1A 5M1QA 2GUIA 3A5OC 3MEDA 2ZWHA 4CECA 5M1FA 4DFPA 1NGAA 3SAFA 1S5JA 2P9NB 4OO1J 1W9HA 3F2KA 2E2OA 4YDUC 4OPJA 2D4WA 2KTQA 4OPHA 3ZSWA 1LAWA 2Q31A 2PFUA 2QWQA 4CESA 1LCUA 4AHSA 3DOLA 3P1GA 4K8ZA 1JCGA 2HBJA 3LM2A 3I0RA 3TAMA 5M1NA 3G6EN 3LDNA 3EE8A 5I9EB 1HLUA 3MN9A 4OPAA 1WBDA 1WSIA 2ZD1A 1YJWN 2HHHK 3AVGA 3VMFB 1QQMA 1YHQN 4PY5A 3ZSZA 3I8BA 1SL2A 1JXEA 3F9MA 1IG9A 3QLHA 1NG9A 4JRPA 5AQFA 1SUQA 2GTDA 5FROA 1X3MA 4X65K 3CFRA 3U3YA 1M1KO 4IDHA 3VQ9A 5JS2A 3OJSA 2HHUA 5HLFA 3CCSN 1MU2A 3U4LA 3CQ8A 4BC3A 1HNVA 5AQXA 2P9UB 4CCHA 4B8AB 1K8AO 1VQ4N 3PIOL 4ISGA 4JN4A 4DF4A 3M8SA 3THXA 2GEMA 4BR9A 3UIQA 3QEIA 2E2PA 3O5BA 3CJBA 4A5BA 4FCYA 1MDUB 1VSLA 2YJFA 2ZE2A 4MLHA 2E2NA 2NRHA 3DAWA 4JI2K 2G8VA 1JLQA 1BI4A 3AVKA 4CEOA 3HPOA 2VCPA 2O8DB 5C2FA 1RBSA 5IWAK 3QIPA 4DV1K 1ATSA 1ZBSA 4DB3A 1IH7A 3OYCA 3SUOA 1ASWA 2FF6A 4QS8A 3ENBA 2PBDA 3O3GA 3OYKA 2W6KA 5B8HA 3V81A 4JI4K 1U49A 2VGNA 4G9ZA 3DLBA 4FWQA 1IKVA 1WSHA 1EP4A 4FJGA 4BDPA 3PY8A 1T05A 3CC7N 4FWRA 2YI1A 4FL9A 4KO0A 1S22A 3OYFA 4JI6K 3OYJA 1L5UA 1YAGA 3NH2A 3MECA 5AQJA 4DMNA 4H03B 2UUCK 2E4LA 3RRHA 5M1KA 1X9WA 2KQ2A 4NB4A 3AVAA 4DLEA 1H1VA 2XRIA 3BF3A 3VF6A 4CJVA 1D4XA 1RBUA 3HM8A 4ISEA 3JSMA 2VWBA 2ASPA 3HXMA 4BR7A 1HMVA 5EVZA 4CVNE 1VSHA 4FJXA 1Y97A 4IXCA 5KQDA 1GOCA 1U45A 1X9MA 3QESA 1KQSM 3DLLL 3KK7A 1XNRK 3HRGA 1BQNA 5KTQA 5M1OA 1I94K 1U04A 4QS7A 2O4GA 4BR0A 4CJRA 4JHDB 3CPWM 1S1XA 2WONA 4JI0K 4F2SA 4CFDA 3RWUA 2KHOA 5JS1A 2GBZA 3QNOA 4M3YA 1VSEA 4E7HA 3THWB 3QERA 3JAMO 3CERA 2ZGYA 3EZ5A 1J54A 4GY2B 1OVYA 4HUFA 3E9PA 1BDGA 4BDYA 2JWLA 3VQDA 4LSLA 1T3VA 1TYQA 2CH5A 4XH5A 2B5JA 4KI4A 1QHAA 3BUZB 5LL6Z 4FLWA 1NGGA 3O08A 3L2RA 1L3UA 1QZ5A 1VQ6N 3CYMA 1WUAA 4DSFA 3TSQA 1QHTA 4JNEA 5J2NA 4MO5A 2HHWA 4FWOA 2B4JA 3CJCA 3EEQA 3NCIA 4GKJK 1ESVA 4YOWA 4Z4IA 4CFAA 4B3OA 4LF6K 3KLGA 4H5WA 2QWLA 2F8TA 3K58A 2BDPA 3CFPA 2YJEA 3TSUA 3ITHA 3PO5A 4Z94A 1EWQA 1XUPO 3OYAA 4LD0A 4JKBA 1QSYA 1GLDG 4WCEL 2BH1A 5AFUH 3SMSA 4KH6A 3UKUA 1HNIA 5J2QA 2OPPA 1QSLA 4E0DA 1KXPA 4PWDA 1GLCG 2E1ZA 2FXUA 5BRFA 4JYAK 3WXKA 3KKSA 3CCUN 4XH4A 3AVNA 1GOAA 3NHGA 3C7NB 4HCCA 5DK5A 1YJNN 2HSTA 3U6FA 4OX9K 1ASVA 4DUYK 5C42A 3TI0A 4JI5K 1YVUA 5C15A 4CK3A 5EOYA 4BRGA 4CBUA 4JKHA 3QO9A 4OGEA 2Y1JA 3S3MA 1I39A 4W5NA 4CEDA 4DTNA 4DQ8A 4AILC 3H3NO 4KBOA 2D0OA 3HI0A 4WQ4A 2DFEA 4KHQA 4L3QA 1KFSA 2HHSA 3IUCA 4J2BA 3DMJA 3VA0A 2IVPA 4JI7K 3AO3A 3SAGA 4FWMA 1KRPA 1Q9XA 4O5BA 4DTOA 5ADXA 4WQ5C 1GLFO 3OY9A 4CZEA 5FPNA 1NK9A 4A2BA 4CJ4A 1RTDA 4BG8A 4C8MA 1XMQK 5MLCQ 1N33K 3T1YK 1U2VB 2ZGZA 3KLHA 3RR7A 4M3TA 2ZQBA 3TAFA 1BHLA 2FBXA 5AQIA 3VEOA 4AF1A 3MMVA 4CBWA 3ZT1A 2BUPA 4DSJA 2IVNA 4EAHD 4WE1A 1RTHA 2YKMA 3CM6A 3AA3A 4GVEA 2UUAK 4CHYA 2EWSA 3NGZA 1D9FA 4DSKA 3V9SA 3CXCM 4GKKK 3AO1A 2OZSA 4CJKA 1T6CA 2D0BA 3F73A 1GLEG 4BRCA 3SCXA 5C0YA 3T69A 3QFUA 4PL8A 2XO7A 1HRHA 1NU0A 2NRXA 4DS4A 3BGRA 3EE9A 4PL7A 4FOIA 1VQLN 3C6UA 1HNWK 4B1XB 4AHRA 2FSKA 1EQYA 4FWNA 3VQAA 4A5AA 3HVTA 2HHTA 1GLAG 3PO4A 2O8CA 1DGKN 2OANA 4BDZA 3DXMA 4JV5K 1C0MA 3VTIA 4LF4K 4M3XA 2A40A 4B3SK 2ASOA 2I7NA 4DR3K 2ZF5O 4G1QA 3FZLA 3C94A 2E6MA 3LP0A 4H5VA 1NK0A 1XNQK 4TSXA 3MWTA 4M42A 1WNSA 1BCOA 1O1WA 1D9DA 2ZJQL 4YHHK 4LH5A 2BE2A 1A5XA 3OW2M 3AAPA 2HF4A 3SPZA 4KH4A 3MXMA 3MEEA 4FM0A 2O8FB 3U9ZA 4O8KA 1EWRA 4E1JA 3NH1A 3IDHA 2NRTA 4YOVA 5HL7L 1EO1A 1S1WA 3CCQN 5KGWA 3ULEA 2OCEA 5BR8K 1REVA 3GDQA 2VWKA 1EETA 3ZSRA 2CGLA 4W5OA 3UE5A 4CJPA 1LV5A 2O4IA 3P5JA 3ZEUA 4FJIA 3D2FA 1NJZA 1Z25A 3NDKA 3EYZA 2NUBA 1ATNA 2D0AA 1NK8A 1ZC6A 1G15A 4CF1A 1OH8A 3A5MC 4IEIA 1JLEA 4KRFA 3LZJA 1RBRA 4BVOA 2P1JA 2VG5A 3H45C 3OYBA 1D5AA 1RT7A 1RNHA 4CHQA 2HBMA 4A2AA 2P9PA 1DT9A 4B9LA 1NGDA 3OS0A 1C1AA 1TGOA 4LF7K 3QEPA 3HSCA 3WXJA 4HUEA 4DR6K 1KCFA 2FLOA 4FOEA 1NGJA 4FPAA 4YY3K 3J8AA 4IOXA 3AVHA 4CJ5A 3LZIA 2V7ZA 3UB5A 4FLYA 4Z4HA 3P83D 4RTFD 4AQYK 3DLKA 1A5VA 3T19A 4DU1A 1J9AA 3GE1A 4JLHA 1TL1A 4AHTA 3O8MA 3ZSYA 3GBTA 3SK3A 5E41A 3M1FA 1WOQA 2RN2A 3CCVN 5LJWA 1XHXA 4OGCA 1RILA 5JLFA 1ILYA 1JXBA 3JS6A 4YDUA 5GAGP 1NJYA 3OYHA 3LDQA 3ZSOA 4HWIA 1KSPA 4DQPA 3SUQA 4IDKA 1HUXA 3H6EA 4B9VA 3HYFA 3TU5A 1RT1A 2FBYA 1FW6A 4EP5A 1VRUA 2P9IB 4JKGA 3K5OA 2P9SB 3DJCA 1DTTA 2UYTA 4CZLA 1T03A 3L8BA 1NNEA 5BR9A 3CQXA 3VQCA 3TTFA 5D3GA 5ADXH 1NOZA 4JKDA 4B9TA 3HO1A 4CEFA 5C24A 3VESA 1LW2A 4M3UA 4BQLA 4BVPA 1LWEA 3CQYA 1KFDA 2YHWA 3H3OB 4YFUA 4IFEA 5AQRA 3RTVA 4WFAL 1TKZA 1RT4A 3ID6A 2A5XA 2HOEA 4MDAA 4B9QA 3TTDA 3VGLA 2D0PA 3HOSA 3FZMA 1S9EA 1IKWA 3AA5X 3SJHA 1RFQA 4DWIA 1VQNN 3U8XA 1QS4A 4DTMA 3VQBA 1BIZA 4K41A 3AAQA 2FSJA 3J80O 5E26A 3A8YA 5AQOA 4ZTJA 3HOTA 4EHUA 3TANA 4B08A 1NGHA 4A59A 4LSNA 2PZSA 2PYLA 3F9KA 3KHYA 2G8UA 3D45A 5HBMA 5A2QO 1IBMK 4KAZA 3L6QA 5M1PA 3UKRB 1BA0A 3CJAA 4F2RA 4RW8A 1E4FT 2EHGA 4HTLA 4CI6A 4FYDA 4YORA 4DV0K 5JVGL 1S3XA 1LW0A 2GELA 4KHUA 1VQMN 5AFUA 1TK0A 4B1VA 3HP9A 4CJEA 1FKPA 4RW9A 3G10A 4DFJA 3ISNC 5AZIA 4FJ7A 4YOYA 2OTLN 4KREA 3A0IX 4JK9A 4M3WA 3L2VA 3S3OA 3T1HK 3IRXA 4KI6A 1VQ7N 3O9RA 3KK2A 5FPMA 3T1AA 3C95A 3IFRA 4CJ3A 2FBTA 1JCFA 5CZ1A 5AQWA 3KLFA 1S1UA 2IIRA 1HNZK 3H46O 2HNZA 1VHXA 2HVHA 2A3ZA 3VETA 4KTWA 4BE1A 3TR8A 2B6AA 4DU3A 3GL1A 1BGXT 3GOIA 4FK2A 2LSNA 3NBPA 4HTUA 1HPMA 4CIGA 5FPEA 3AY9A 4PHTX 3AVBA 1VQ8N 3OYIA 5ELZA 1HKCA 2QW9A 3LDLA 2W40A 3ALYA 4UQGA 2QTDA 4KB0A 3L2WA 4CEEA 3B6OA 1Q81O 3QFPA 1TKDA 3CMAN 2DY4A 1S1VA 3V9ZA 4M3ZA 4M63C 4CD1A 2QXLA 2CGJA 5AQVA 3VGMA 5HRRA 3S3NA 4H5RA 4CK2A 4GMJB 3QB0A 1FXXA 3VQ7A 4C8NA 2P9KB 3RSEA 1W97L 5JVHL 2OZMA 1C0TA 2O8EA 4R79A 3AVCA 3OA9A 4MDBA 3BF1A 3KK1A 4O0IA 3LP2A 3L0QA 4GNIA 1QQNA 4NLBA 3EL2A 3QMLA 3QDKA 4M41A 1ZYQA 3E9OA 4NYNA 3KTQA 3SQ0A 4LFBK 3RMCA 3SI6A 3O9QA 4I6MA 3L3UA 1SZ2A 1NK6A 4CJTA 1UA1A 3OYEA 3WEEA 3SUPA 2IAJA 4FWLA 3DLRA 4B1YB 4HVJA 1VQKN 3LALA 4C1NI 3SPYA 4JD2A 3IMXA 4K25A 1RBVA 3KKRA 3MDQA 3DXKA 4IJAA 1TUYA 4DV3K 1TUUA 3M8RA 4CZIA 1NK5A 3VEZA 4O55A 3M8QA 4CZMA 4BRPA 4Z4EA 3I0SA 5K14A 5E84A 4CJSA 1SKSA 1WAFA 3MX5A 5JMVA 4O44A 4CHNA 4M3RA 3C6TA 4YOTA 3H1QA 4ELUA 3N4PA 4LH4A 2QXFA 4LY7A 4BWJA 2P9NA 3PSFA 2G8IA 3ZT4A 1N5YA 1C0FA 4FVUA 4Z4GA 3KD1E 4FJ8A 5LMUK 3H08A 3K2PA 3R3LA 4IEEA 3V1QA 4IOCL 2IGIA 5HOOA 2Y1IA 3DM2A 2YNIA 4I7FA 2J4RA 4W5QA 1K8KB 2VG7A 5BREA 3J7ZO 4N41A 4LC9B 1KC8O 4PUOA 4WQ5A 1L3TA 3NVMA 1Q8IA 3C65A 3PSIA 3CIPA 4C8LA 1C0GA 3KWIA 2UXDK 1B9FA 1NGEA 3KK3A 1NGFA 5FDLA 3ZETB 4E3SA 4EFHA 4I9QA 4JS4A 3DYAA 1WSGA 1JLAA 3WXLA 2Q1NA 5KPZA 1ZBHA 3FE1A 5GINA 1NOYA 4MO4A 1YXQA 2P9UA 3VQ4A 3HBTA 4A62A 3PV8A 4FM1A 1TK8A 4A57A 3SAHA 1KVBA 4FLZA 2E20A 4NXMK 4B8CA 2HNDA 3VQPA 4K42A 2GV9A 2HHXA 4ID5A 1KLNA 4X64K 3OYNA 4XH1A 2QA4N 2O8DA 1W7AA 1NGBA 2H3GX 3SQ2A 3CJ1A 4H5TA 4DSLA 1RDBA 1JCEA 3SBTA 2YNHA 1FKOA 1T7PA 4KV8A 4FZZA 4M45A 1RDUA 1RTJA 3C6AA 1V4SA 4NLCA 3D2EB 1HX1A 2RHKA 3SYZA 4GV9A 3VOVA 3ID8A 3MAQA 5SWMA 1CZBA 4J8FA 1VQON 2RF2A 4RW7A 2RPIA 2O8BB 4JI8K 4QCLA 3I55N 3WNGA 4H0TB 4DTSA 3CCRN 2IOCA 2EX3A 4B1UB 1XQSC 4QS9A 4JI3K 1NWKA 4K0KK 1ZBLA 4CGJA 3T3FA 4LF5K 3OVNA 4RW4A 1S72N 2KFZA 2Q0UA 3S9HA 3WNHA 4DR5K 4ELTA 1E3MA 4DLGA 2F7TA 3H1VX
chains in the Genus database with same CATH topology
2UUAK 4GKJK 4DR2K 2UU9K 4GKKK 4LF6K 4LFAK 4V19S 4DUZK 2UXDK 4JI6K 1HR0K 4JI1K 5IT9O 2UXBK 3J80O 2F4VK 4NXNK 4DV2K 4LF7K 2UUCK 4DR7K 1XMOK 1HNWK 4DR6K 4YY3K 2VQFK 4CW7B 3OTOK 5A2QO 1IBMK 4DV5K 3J7AP 5AJ3K 4JV5K 4JYAK 4LF9K 4AQYK 4KHPK 2ZM6K 4DV7K 4NXMK 4LF4K 5LMNK 2HHHK 4CVNE 4DV0K 4DV6K 4OX9K 4LFBK 4X64K 4B3SK 4DUYK 4JI5K 4DR3K 1J5EK 1FJGK 1XNQK 2E5LK 1XNRK 4X65K 4YHHK 1I94K 4B3MK 4DV3K 3T1HK 4JI0K 3J7YP 4B3RK 3J81O 4JI7K 3JAMO 1N32K 1HNZK 4JI2K 4LFCK 1IBKK 5BR8K 4JI8K 4DV4K 2UXCK 4B3TK 5FLXO 4LF8K 4DR1K 4JI3K 4K0KK 1HNXK 5IWAK 4X66K 1IBLK 4DV1K 4DR4K 4LF5K 1XMQK 1N33K 4X62K 3T1YK 2UUBK 2VQEK 5LL6Z 1N34K 4DR5K 4JI4K 5LMUK 1N36K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUA K;  4GKJ K;  4DR2 K;  2UU9 K;  4GKK K;  4LF6 K;  4LFA K;  4V19 S;  4DUZ K;  2UXD K;  4JI6 K;  1HR0 K;  4JI1 K;  5IT9 O;  2UXB K;  3J80 O;  2F4V K;  4NXN K;  4DV2 K;  4LF7 K;  2UUC K;  4DR7 K;  1XMO K;  1HNW K;  4DR6 K;  4YY3 K;  2VQF K;  4CW7 B;  3OTO K;  5A2Q O;  1IBM K;  4DV5 K;  3J7A P;  5AJ3 K;  4JV5 K;  4JYA K;  4LF9 K;  4AQY K;  4KHP K;  2ZM6 K;  4DV7 K;  4NXM K;  4LF4 K;  5LMN K;  2HHH K;  4CVN E;  4DV0 K;  4DV6 K;  4OX9 K;  4LFB K;  4X64 K;  4B3S K;  4DUY K;  4JI5 K;  4DR3 K;  1J5E K;  1FJG K;  1XNQ K;  2E5L K;  1XNR K;  4X65 K;  4YHH K;  1I94 K;  4B3M K;  4DV3 K;  3T1H K;  4JI0 K;  3J7Y P;  4B3R K;  3J81 O;  4JI7 K;  3JAM O;  1N32 K;  1HNZ K;  4JI2 K;  4LFC K;  1IBK K;  5BR8 K;  4JI8 K;  4DV4 K;  2UXC K;  4B3T K;  5FLX O;  4LF8 K;  4DR1 K;  4JI3 K;  4K0K K;  1HNX K;  5IWA K;  4X66 K;  1IBL K;  4DV1 K;  4DR4 K;  4LF5 K;  1XMQ K;  1N33 K;  4X62 K;  3T1Y K;  2UUB K;  2VQE K;  5LL6 Z;  1N34 K;  4DR5 K;  4JI4 K;  5LMU K;  1N36 K; 
#chains in the Genus database with same CATH topology
 4UY8 O;  3OHR A;  3ZSQ A;  4BRM A;  3MN5 A;  1RDD A;  2PAV A;  1RDW X;  4KPY A;  3EZW A;  1YI2 N;  5I3U A;  4IBN A;  3VQ5 A;  2HMI A;  4BRH A;  4DKW A;  4WFN L;  1SQK A;  2VWJ A;  3CCE N;  1NGC A;  1LAV A;  4FW1 A;  1GLJ O;  4O0J A;  5CYM A;  3F5T A;  3EY1 A;  4JI1 K;  4DSI A;  1VSF A;  4CF8 A;  2VYP A;  4NXN K;  3C6H A;  3SLC A;  2A6A A;  4DR7 K;  3LWM A;  2NRR A;  1I3A A;  3ZX0 A;  3SV4 A;  1C1C A;  4JHD A;  2F96 A;  2NRZ A;  3OTO K;  4AM7 A;  4DV5 K;  4E7I A;  3SNN A;  3O80 A;  2QKK A;  4DFM A;  5C12 A;  1WSE A;  1ZBI A;  4KHP K;  4K43 A;  4H0V B;  3THW A;  3QIN A;  4GVM A;  4FJ9 A;  3FGU A;  3K9K A;  4OLB A;  5GAD P;  2W6L A;  1JJ2 M;  1UOC A;  5AQQ A;  2Z1G A;  4NO7 A;  4KTQ A;  3RVC A;  3ENO A;  3IKM A;  4KH5 A;  1HQE A;  1U6Z A;  3WXM B;  1WSF A;  4FLT A;  1Z26 A;  2NRV A;  3KJV A;  1S1T A;  4BAC A;  3K0S A;  3FZH A;  2YKN A;  2VG6 A;  4Q5V A;  2Q97 A;  3NF7 A;  3NF8 A;  3K9J A;  2W41 A;  5BN9 A;  1VRT A;  2NLX A;  4CGI A;  4O5F A;  4JS5 A;  4FSV A;  2FSN A;  2Z1H A;  3LWL A;  3CPE A;  1QQC A;  4AM6 A;  1KD1 O;  2G8K A;  3CI5 A;  3LDS A;  3LDP A;  2PY5 A;  1XC3 A;  3I56 N;  1XI1 A;  3D6R A;  5FPD A;  5SZT A;  4QAG A;  3NF9 A;  4FW2 A;  4OKK A;  2RKI A;  3RRG A;  1RT5 A;  2XY8 A;  3QBW A;  1CXU A;  5KGX A;  3VTH A;  2OPR A;  5KRT A;  4Y0W A;  1GOB A;  3VQQ A;  3G25 A;  4CJ7 A;  3HPH A;  4BRO A;  2XY5 A;  3QET A;  4YOX A;  3ATV A;  3HM9 A;  1KAY A;  1Z6R A;  1BA1 A;  3O6W A;  4CGF A;  1R59 O;  3AAR A;  3C7N A;  2F9W A;  3E1Y A;  5HRP A;  2GWK A;  4B9S A;  1TVR A;  4FLX A;  3L3V A;  3VEX A;  1SL1 A;  1KLM A;  2ZJP L;  3AA2 A;  4MQ3 A;  4BR5 A;  3NGI A;  1MWK A;  3AGK A;  1UA0 A;  4DQR A;  4DHY A;  2X74 A;  1RT3 A;  3B6P A;  1NM1 A;  3V1O A;  1WAJ A;  3W3D A;  3P38 A;  3LM9 A;  2QWN A;  3O3F A;  1KVC A;  2YHY A;  1TK5 A;  4N76 A;  1NJX A;  4WF9 L;  1K73 O;  3PX6 A;  3LAK A;  3AO4 A;  2VGM A;  4IO9 L;  2WBN A;  4LF9 K;  2P9L B;  3ZLJ A;  1JLC A;  1X3N A;  3ZT3 A;  5AZJ B;  2AJQ A;  1KTQ A;  2Q3S A;  3L2Q A;  3FLC O;  1HJR A;  3VN5 A;  4BRI A;  3SUN A;  5CHI A;  2P5O A;  1RT2 A;  2KLA A;  3BEX A;  1U47 A;  5FRM A;  2JWK A;  4JRQ A;  3LL3 A;  1RDA A;  1U2V A;  2X6S A;  4DU4 A;  4F4K A;  1HQU A;  1N6Q A;  3TAB A;  1UWB A;  5AR0 A;  5FRN A;  3CCM N;  4NCG A;  3ZYY X;  4CBX A;  2WFB A;  4EP4 A;  4F3T A;  1IKY A;  4MFB A;  1C6V A;  2KKZ A;  4LFC K;  1IBK K;  4DV4 K;  3KLE A;  5AQK A;  2G8F A;  4CD3 A;  4LF8 K;  2KZM A;  1MA9 B;  3KIO A;  3PX0 A;  4DR4 K;  4KHS A;  3A5N C;  1EKE A;  2W42 A;  2HBL A;  3AA4 A;  5C2D A;  3CD6 N;  4BRQ A;  1SV5 A;  4J2A A;  1SKR A;  1BWF O;  3THX B;  3HJF A;  1TKT A;  3KD5 E;  4JKE A;  3D7E O;  3P4I A;  2QEX N;  1S6P A;  4JK8 A;  4DG1 A;  1BI4 B;  1EX4 A;  5AQS A;  1M90 O;  4FK0 A;  3QEW A;  3VA3 A;  4ID1 A;  4DV2 K;  3RMB A;  1NGI A;  1BL3 A;  3WQT A;  3ZT0 A;  1W2B M;  5EY4 A;  2DFH A;  2GWJ A;  1TAQ A;  4CHZ A;  2ITG A;  1QZ6 A;  5GIO A;  1D8Y A;  4PKG A;  3W0L A;  1NK7 A;  3PLA A;  1WB9 A;  5LJV A;  2HMP A;  3K5N A;  3J7A P;  1TV6 A;  1XC9 A;  3CFO A;  2O8F A;  3MWP A;  3Q7B A;  4DTX A;  1CZA N;  5F0X A;  3BZC A;  3RR8 A;  3IAY A;  4K8X A;  1G99 A;  5LMN K;  4B9M A;  5CY4 A;  4Z4F A;  4F8R A;  3VF2 A;  2ETJ A;  2F9T A;  4N56 A;  2OTJ N;  1S9G A;  1BQM A;  4FPB A;  4B9U A;  4C23 A;  2X6N A;  2OPQ A;  3AO2 A;  3PUF A;  2YCH A;  4B1W B;  1T44 A;  4BGA A;  1O13 A;  3C0B A;  4IG0 A;  2IDO A;  4CZJ A;  4MLE A;  2HHQ A;  1HYV A;  4KHW A;  4GV6 A;  4PKI A;  4O4G A;  1SS6 A;  3ASM A;  1NJW A;  2V52 B;  1OH6 A;  2QWP A;  4KFB A;  2HF3 A;  1QSS A;  4CHP A;  1GLB G;  3J81 O;  1K9M O;  4BC4 A;  5H1S Q;  1WN7 A;  2QWO A;  2Z1J A;  3NAE A;  4RG8 A;  2QWR A;  1N32 K;  4BR4 A;  4BRN A;  2XY7 A;  2HNY A;  4CEQ A;  1VAZ A;  3ZT2 A;  4FWS A;  1IBL K;  3LAN A;  4CZF A;  2A1R A;  2DFF A;  3VQ8 A;  1JL2 A;  3AGR A;  4WYB A;  3WQU A;  4CHO A;  1NKB A;  2E1Y A;  2E2Q A;  4N47 A;  1S6Q A;  2D0C A;  2G8W A;  1YVN A;  4E19 A;  3V9X A;  1QVF M;  4B9N A;  4AHU A;  1K6Y A;  3VQ6 A;  1YTA A;  3MK6 A;  4CJQ A;  1F21 A;  1VK0 A;  3OYM A;  3L4I A;  3LPT A;  4GW6 A;  1LOT B;  2HB5 A;  1Q18 A;  4ISF A;  3T7Z A;  3AVJ A;  3DRS A;  4YOU A;  2UXB K;  4E1N A;  2F4V K;  2JLE A;  3O4Q A;  4BC5 A;  1TYQ B;  3ZX3 A;  3CJ7 A;  1NKC A;  5J2M A;  4BWM A;  5KRS A;  1BIU A;  1BG3 A;  1ASU A;  4B1Z A;  3TSP A;  4DSE A;  3CME N;  1YJ9 N;  2WTU A;  3S41 A;  3TAE A;  3V9W A;  5F2R A;  1T8E A;  3BDP A;  3CM5 A;  1U4B A;  4EIA A;  5AQN A;  3THY A;  2P9I A;  3JXU A;  3IS9 A;  1P90 A;  1W0H A;  4H0Y B;  2P9S A;  1VSI A;  3MXJ A;  1Q82 O;  4IFV A;  3N4Q A;  2RE2 A;  2HW3 A;  2DPN A;  4E89 A;  3L2U A;  1YIJ N;  3DLG A;  1KAX A;  4BRF A;  4QOZ B;  3OYG A;  1BIS A;  2WOM A;  2WUS A;  1QVG M;  1VQ5 N;  4B3M K;  3CCJ N;  2HVI A;  3AVI A;  2BTF A;  3LP3 A;  2ATQ A;  3UKU B;  4BRD A;  3AV9 A;  3AVL A;  4FXD A;  4HHT A;  4H5N A;  1OKJ A;  1HJO A;  5HRS A;  1NBW A;  4M7Y A;  4CEA A;  1VSM A;  3VF4 A;  4RWT A;  4FM2 A;  3O4W A;  4CF9 A;  4CEZ A;  3I33 A;  3NGY A;  4CFB A;  4H0O A;  1P8Z A;  1RCH A;  2YNG A;  1J6Z A;  4DQI A;  2E88 A;  4KHY A;  2I7P A;  2V51 B;  3GG4 A;  1WBB A;  4BE2 A;  4DTP A;  3SQ4 A;  1JLG A;  4DCH A;  2YX6 A;  2FC0 A;  4ZHR A;  1B92 A;  2KZZ A;  5BN8 A;  3O9T A;  2HBK A;  5C25 A;  2DTU A;  2KFN A;  1QE1 A;  1T6D A;  3UKR A;  1YTU A;  4IWV A;  3NFA A;  4IZ9 A;  4A61 A;  3OBW A;  3OBY A;  3JYT A;  4KHN A;  5I42 A;  2PYJ A;  3HZ6 A;  3LP1 A;  4CE9 A;  3TPQ A;  2A41 A;  3PIP L;  2XHB A;  2F8S A;  4FO0 A;  3E66 A;  4AH9 A;  5HRO A;  5AQU A;  1Q9Y A;  3TAP A;  1RGI A;  2I5J A;  2QKB A;  4CZG A;  4E7L A;  4ZTF A;  3B8A X;  2E6L A;  4DTR A;  1HYS A;  1BO5 O;  2A1S A;  3R9P A;  4DQQ A;  1TAU A;  3KWG A;  1J53 A;  3HP6 A;  2BAN A;  3SQ1 A;  3MCP A;  1IV0 A;  1NK4 A;  2QM1 A;  3V6D A;  4DV6 K;  3MCA B;  1VQ9 N;  1KAZ A;  1U48 A;  4ICL A;  4OLA A;  5AQL A;  3FFK B;  4F9O A;  4BR2 A;  1J5E K;  1FJG K;  5AQT A;  1CLQ A;  2E5L K;  3AVM A;  3VEV A;  3WUH A;  3VEN A;  3HT3 A;  3WXI A;  1Z05 A;  4H4O A;  2ASM A;  4C1N K;  2O8C B;  5LY3 A;  1Y64 A;  4IKF A;  4CER A;  3KLI A;  4IO8 A;  5C10 A;  3DXM B;  4BRE A;  1DEJ A;  4OPK A;  4CFC A;  3PX4 A;  4ILH A;  2ZJR L;  1ZXO A;  1LWF A;  2QI2 A;  5TKW A;  2NRW A;  1HKB A;  4CIE A;  4PKH A;  4JKA A;  4AHV A;  3HTV A;  4ILJ A;  4FJJ A;  3G71 N;  2UXC K;  1C1B A;  4DQS A;  3G4S N;  3RMD A;  5BRD A;  1E4G T;  2Z1I A;  5BPM A;  5GIP A;  1B9D A;  4J2D A;  5AQH A;  2JGU A;  1RBT A;  4I2P A;  3D0P A;  1ZBU A;  2P9K A;  5JLH A;  4OKE A;  5EX5 A;  4HUG A;  3A2F A;  2YNF A;  3LAM A;  5KI6 A;  3OYL A;  4U67 L;  1UAX A;  3V4I A;  4L8R B;  3U3G A;  1YF5 L;  3QIC A;  4JEP A;  1CZ9 A;  3CHW A;  2YHA A;  3DRP A;  1RT6 A;  4ILG B;  3ULE B;  2YV0 X;  4H4M A;  1DLO A;  3LDO A;  3TTC A;  1HR0 K;  3BY5 A;  4OVL A;  3TAR A;  3TWH A;  3P39 A;  1EXQ A;  3DWL A;  3ZEU B;  4IJN A;  1ATR A;  4BC2 A;  3D2F B;  4CK1 A;  3DRR A;  4IOA L;  4CIF A;  4DF8 A;  4XEI A;  1Q86 O;  1BCM A;  5CR4 A;  4Z4C A;  4E7J A;  3KZB A;  1NLV A;  2NNW A;  1XHZ A;  1J5O A;  2ZM6 K;  3SV3 A;  3OS2 A;  5AQY A;  1NJI O;  4W5T A;  3QEV A;  2R7Y A;  4OJR A;  4Y1D A;  2P9P B;  5T7B A;  3O1W A;  3NH0 A;  3BZK A;  4FK4 A;  4Y1C A;  3O9S A;  3K5M A;  2NZT A;  3NMU A;  3E9L A;  1NKE A;  1KVA A;  3FZF A;  3CET A;  2HHV A;  1RTI A;  3A5L C;  1A5W A;  4DTJ A;  4B3R K;  2IVO A;  5AQZ A;  3VPZ A;  4BQZ A;  1K8K A;  2CH6 A;  4BY9 C;  1R0A A;  4C8O A;  4CJF A;  1V4T A;  4KKO A;  3DI6 A;  4OKJ A;  1C0U A;  3VEW A;  3M8P A;  5FLX O;  3QEX A;  2XY6 A;  4DR1 K;  3ZET A;  3CF5 L;  4X66 K;  3U9D A;  4CEB A;  3K59 A;  3MN6 A;  1VSD A;  4FZY A;  3HPG A;  3R1X A;  4CF2 A;  2UUB K;  1N34 K;  1FK9 A;  4FJL A;  3EN9 A;  4GV3 A;  4FJN A;  4FVM A;  3AVF A;  5EU7 A;  2CGK A;  4CJW A;  4HCB A;  1YT3 A;  1X9J A;  4FJK A;  4JK7 A;  3SJJ A;  4WFB L;  5TKY A;  4JKG B;  3CJ9 A;  5J1E A;  4U7B A;  4JKC A;  5KPT A;  3NVK A;  3BP8 A;  3DLH A;  3MN7 A;  1IO2 A;  4R5P A;  2Q36 A;  4H0X B;  5J2P A;  3ATU A;  4F3O A;  2E8A A;  3CCL N;  3VGK A;  2A42 A;  4RW6 A;  1BOT O;  1JL1 A;  1YUW A;  4CW7 B;  3D2E A;  1WLJ A;  4WQ4 C;  3M5R A;  4PA1 A;  2YHX A;  4CGH A;  2OYQ A;  1DKG D;  2WC9 A;  3M6G A;  2O8B A;  3O4N A;  1JLB A;  4I9L A;  4CJU A;  4PQU A;  1HPZ A;  3VQE A;  3O3H A;  4H8K A;  4Q0B A;  5HP1 A;  2OA8 A;  3HL8 A;  4DS5 A;  3SMP A;  3QNN A;  1SL0 A;  4J2E A;  4DFK A;  4EZ9 A;  4KB1 A;  3NF6 A;  3VEY A;  1MWM A;  3CC2 N;  1HYZ A;  1L3S A;  3QBX A;  5AQP A;  3HST B;  2KW4 A;  5GAE P;  2AA4 A;  4ELV A;  4EHT A;  3G0Z A;  4CGD A;  4BGB A;  5KPR A;  1NMD A;  4N5S A;  2P5G A;  4B3T K;  3DLE A;  3R8E A;  3DOK A;  1WSJ A;  5CE3 A;  5CYQ A;  1VSJ A;  4NCA A;  3O9U A;  3CC4 N;  2OPS A;  4BRL A;  2X78 A;  5BRH A;  2IC3 A;  1TL3 A;  4FJ5 A;  3K5L A;  5AZI B;  3ENH A;  2VQE K;  1TKX A;  3TAG A;  1Q7Y O;  3WNE A;  4I2Q A;  2Q2R A;  2ITM A;  3ZSV A;  4JAX A;  1OH5 A;  4NYF A;  5BPN A;  1SAZ A;  3FFI A;  1BU6 O;  1IG8 A;  3RMA A;  1IJJ A;  1X1P A;  3O1B A;  4IG3 A;  4E1M A;  3OJU A;  4DUZ K;  3R6M A;  4YNQ A;  5HRN A;  1IKX A;  3FR0 A;  5IT9 O;  3WNF A;  4BE0 A;  4JKF A;  2BGG A;  4E7K A;  1XWL A;  5KQ8 A;  4CZH A;  1XMO K;  1QQO A;  1JKH A;  1GLL O;  1DTQ A;  5EXW A;  3IG1 A;  2VQF K;  3AO5 A;  3LPU A;  3TAQ A;  2G8H A;  2GUP A;  2FF3 B;  3MEG A;  3K57 A;  5AJ3 K;  1N8R O;  5F1X A;  2V7Y A;  1RDC A;  1LWC A;  4W5R A;  3HK2 A;  3I8D A;  4DV7 K;  5CZ2 A;  5BPL A;  4BRK A;  1NMN A;  4NCB A;  3EKU A;  1JLF A;  1OVQ A;  3EKS A;  1SKW A;  3MX2 A;  4CF0 A;  3THY B;  2YHB A;  4FLU A;  3P31 A;  3E01 A;  1CXQ A;  3CG7 A;  1X9S A;  4FLV A;  2IS3 A;  3SZ2 A;  4RCH A;  3HVR A;  1VQP N;  2AP1 A;  2Q0R A;  4IFY A;  3THV A;  3EO3 A;  2GX9 A;  3RSE B;  5JIC A;  5AQM A;  3WT0 A;  1YIT N;  5AQG A;  4FJM A;  4AHC A;  2QK9 A;  3J7Y P;  2O8E B;  3L4Q A;  3Q7C A;  1VSK A;  1OH7 A;  3SBG A;  4M7X A;  4Z0U A;  1BUP A;  5DMR A;  3M3Z A;  5DM6 L;  4FWK A;  3QIO A;  4C8K A;  4XIU A;  1ITG A;  4CGG A;  1HKG A;  1QTM A;  4BRA A;  4I6M B;  4KTZ A;  4BG9 A;  4CZK A;  3FZK A;  2FBV A;  1HNX K;  2D1K A;  5DM7 L;  2QWM A;  3OYD A;  1L3V A;  3WEE B;  4FZX C;  4X62 K;  3VER A;  3MXI A;  5GAH P;  4FWP A;  4JD2 B;  2P51 A;  3ZCM A;  3DXK B;  3ZX2 A;  3NE6 A;  4O8U A;  2D5R A;  3V9U A;  4CJL A;  1N36 K;  4FJH A;  3V1R A;  4DR2 K;  2P9L A;  2UU9 K;  3ZSX A;  3ULD A;  1ZBF A;  5AZJ A;  4LFA K;  3KVG A;  4EZ6 A;  4DTU A;  4V19 S;  4H0P A;  3OS1 A;  5M1Q A;  2GUI A;  3A5O C;  3MED A;  2ZWH A;  4CEC A;  5M1F A;  4DFP A;  1NGA A;  3SAF A;  1S5J A;  2P9N B;  4OO1 J;  1W9H A;  3F2K A;  2E2O A;  4YDU C;  4OPJ A;  2D4W A;  2KTQ A;  4OPH A;  3ZSW A;  1LAW A;  2Q31 A;  2PFU A;  2QWQ A;  4CES A;  1LCU A;  4AHS A;  3DOL A;  3P1G A;  4K8Z A;  1JCG A;  2HBJ A;  3LM2 A;  3I0R A;  3TAM A;  5M1N A;  3G6E N;  3LDN A;  3EE8 A;  5I9E B;  1HLU A;  3MN9 A;  4OPA A;  1WBD A;  1WSI A;  2ZD1 A;  1YJW N;  2HHH K;  3AVG A;  3VMF B;  1QQM A;  1YHQ N;  4PY5 A;  3ZSZ A;  3I8B A;  1SL2 A;  1JXE A;  3F9M A;  1IG9 A;  3QLH A;  1NG9 A;  4JRP A;  5AQF A;  1SUQ A;  2GTD A;  5FRO A;  1X3M A;  4X65 K;  3CFR A;  3U3Y A;  1M1K O;  4IDH A;  3VQ9 A;  5JS2 A;  3OJS A;  2HHU A;  5HLF A;  3CCS N;  1MU2 A;  3U4L A;  3CQ8 A;  4BC3 A;  1HNV A;  5AQX A;  2P9U B;  4CCH A;  4B8A B;  1K8A O;  1VQ4 N;  3PIO L;  4ISG A;  4JN4 A;  4DF4 A;  3M8S A;  3THX A;  2GEM A;  4BR9 A;  3UIQ A;  3QEI A;  2E2P A;  3O5B A;  3CJB A;  4A5B A;  4FCY A;  1MDU B;  1VSL A;  2YJF A;  2ZE2 A;  4MLH A;  2E2N A;  2NRH A;  3DAW A;  4JI2 K;  2G8V A;  1JLQ A;  1BI4 A;  3AVK A;  4CEO A;  3HPO A;  2VCP A;  2O8D B;  5C2F A;  1RBS A;  5IWA K;  3QIP A;  4DV1 K;  1ATS A;  1ZBS A;  4DB3 A;  1IH7 A;  3OYC A;  3SUO A;  1ASW A;  2FF6 A;  4QS8 A;  3ENB A;  2PBD A;  3O3G A;  3OYK A;  2W6K A;  5B8H A;  3V81 A;  4JI4 K;  1U49 A;  2VGN A;  4G9Z A;  3DLB A;  4FWQ A;  1IKV A;  1WSH A;  1EP4 A;  4FJG A;  4BDP A;  3PY8 A;  1T05 A;  3CC7 N;  4FWR A;  2YI1 A;  4FL9 A;  4KO0 A;  1S22 A;  3OYF A;  4JI6 K;  3OYJ A;  1L5U A;  1YAG A;  3NH2 A;  3MEC A;  5AQJ A;  4DMN A;  4H03 B;  2UUC K;  2E4L A;  3RRH A;  5M1K A;  1X9W A;  2KQ2 A;  4NB4 A;  3AVA A;  4DLE A;  1H1V A;  2XRI A;  3BF3 A;  3VF6 A;  4CJV A;  1D4X A;  1RBU A;  3HM8 A;  4ISE A;  3JSM A;  2VWB A;  2ASP A;  3HXM A;  4BR7 A;  1HMV A;  5EVZ A;  4CVN E;  1VSH A;  4FJX A;  1Y97 A;  4IXC A;  5KQD A;  1GOC A;  1U45 A;  1X9M A;  3QES A;  1KQS M;  3DLL L;  3KK7 A;  1XNR K;  3HRG A;  1BQN A;  5KTQ A;  5M1O A;  1I94 K;  1U04 A;  4QS7 A;  2O4G A;  4BR0 A;  4CJR A;  4JHD B;  3CPW M;  1S1X A;  2WON A;  4JI0 K;  4F2S A;  4CFD A;  3RWU A;  2KHO A;  5JS1 A;  2GBZ A;  3QNO A;  4M3Y A;  1VSE A;  4E7H A;  3THW B;  3QER A;  3JAM O;  3CER A;  2ZGY A;  3EZ5 A;  1J54 A;  4GY2 B;  1OVY A;  4HUF A;  3E9P A;  1BDG A;  4BDY A;  2JWL A;  3VQD A;  4LSL A;  1T3V A;  1TYQ A;  2CH5 A;  4XH5 A;  2B5J A;  4KI4 A;  1QHA A;  3BUZ B;  5LL6 Z;  4FLW A;  1NGG A;  3O08 A;  3L2R A;  1L3U A;  1QZ5 A;  1VQ6 N;  3CYM A;  1WUA A;  4DSF A;  3TSQ A;  1QHT A;  4JNE A;  5J2N A;  4MO5 A;  2HHW A;  4FWO A;  2B4J A;  3CJC A;  3EEQ A;  3NCI A;  4GKJ K;  1ESV A;  4YOW A;  4Z4I A;  4CFA A;  4B3O A;  4LF6 K;  3KLG A;  4H5W A;  2QWL A;  2F8T A;  3K58 A;  2BDP A;  3CFP A;  2YJE A;  3TSU A;  3ITH A;  3PO5 A;  4Z94 A;  1EWQ A;  1XUP O;  3OYA A;  4LD0 A;  4JKB A;  1QSY A;  1GLD G;  4WCE L;  2BH1 A;  5AFU H;  3SMS A;  4KH6 A;  3UKU A;  1HNI A;  5J2Q A;  2OPP A;  1QSL A;  4E0D A;  1KXP A;  4PWD A;  1GLC G;  2E1Z A;  2FXU A;  5BRF A;  4JYA K;  3WXK A;  3KKS A;  3CCU N;  4XH4 A;  3AVN A;  1GOA A;  3NHG A;  3C7N B;  4HCC A;  5DK5 A;  1YJN N;  2HST A;  3U6F A;  4OX9 K;  1ASV A;  4DUY K;  5C42 A;  3TI0 A;  4JI5 K;  1YVU A;  5C15 A;  4CK3 A;  5EOY A;  4BRG A;  4CBU A;  4JKH A;  3QO9 A;  4OGE A;  2Y1J A;  3S3M A;  1I39 A;  4W5N A;  4CED A;  4DTN A;  4DQ8 A;  4AIL C;  3H3N O;  4KBO A;  2D0O A;  3HI0 A;  4WQ4 A;  2DFE A;  4KHQ A;  4L3Q A;  1KFS A;  2HHS A;  3IUC A;  4J2B A;  3DMJ A;  3VA0 A;  2IVP A;  4JI7 K;  3AO3 A;  3SAG A;  4FWM A;  1KRP A;  1Q9X A;  4O5B A;  4DTO A;  5ADX A;  4WQ5 C;  1GLF O;  3OY9 A;  4CZE A;  5FPN A;  1NK9 A;  4A2B A;  4CJ4 A;  1RTD A;  4BG8 A;  4C8M A;  1XMQ K;  5MLC Q;  1N33 K;  3T1Y K;  1U2V B;  2ZGZ A;  3KLH A;  3RR7 A;  4M3T A;  2ZQB A;  3TAF A;  1BHL A;  2FBX A;  5AQI A;  3VEO A;  4AF1 A;  3MMV A;  4CBW A;  3ZT1 A;  2BUP A;  4DSJ A;  2IVN A;  4EAH D;  4WE1 A;  1RTH A;  2YKM A;  3CM6 A;  3AA3 A;  4GVE A;  2UUA K;  4CHY A;  2EWS A;  3NGZ A;  1D9F A;  4DSK A;  3V9S A;  3CXC M;  4GKK K;  3AO1 A;  2OZS A;  4CJK A;  1T6C A;  2D0B A;  3F73 A;  1GLE G;  4BRC A;  3SCX A;  5C0Y A;  3T69 A;  3QFU A;  4PL8 A;  2XO7 A;  1HRH A;  1NU0 A;  2NRX A;  4DS4 A;  3BGR A;  3EE9 A;  4PL7 A;  4FOI A;  1VQL N;  3C6U A;  1HNW K;  4B1X B;  4AHR A;  2FSK A;  1EQY A;  4FWN A;  3VQA A;  4A5A A;  3HVT A;  2HHT A;  1GLA G;  3PO4 A;  2O8C A;  1DGK N;  2OAN A;  4BDZ A;  3DXM A;  4JV5 K;  1C0M A;  3VTI A;  4LF4 K;  4M3X A;  2A40 A;  4B3S K;  2ASO A;  2I7N A;  4DR3 K;  2ZF5 O;  4G1Q A;  3FZL A;  3C94 A;  2E6M A;  3LP0 A;  4H5V A;  1NK0 A;  1XNQ K;  4TSX A;  3MWT A;  4M42 A;  1WNS A;  1BCO A;  1O1W A;  1D9D A;  2ZJQ L;  4YHH K;  4LH5 A;  2BE2 A;  1A5X A;  3OW2 M;  3AAP A;  2HF4 A;  3SPZ A;  4KH4 A;  3MXM A;  3MEE A;  4FM0 A;  2O8F B;  3U9Z A;  4O8K A;  1EWR A;  4E1J A;  3NH1 A;  3IDH A;  2NRT A;  4YOV A;  5HL7 L;  1EO1 A;  1S1W A;  3CCQ N;  5KGW A;  3ULE A;  2OCE A;  5BR8 K;  1REV A;  3GDQ A;  2VWK A;  1EET A;  3ZSR A;  2CGL A;  4W5O A;  3UE5 A;  4CJP A;  1LV5 A;  2O4I A;  3P5J A;  3ZEU A;  4FJI A;  3D2F A;  1NJZ A;  1Z25 A;  3NDK A;  3EYZ A;  2NUB A;  1ATN A;  2D0A A;  1NK8 A;  1ZC6 A;  1G15 A;  4CF1 A;  1OH8 A;  3A5M C;  4IEI A;  1JLE A;  4KRF A;  3LZJ A;  1RBR A;  4BVO A;  2P1J A;  2VG5 A;  3H45 C;  3OYB A;  1D5A A;  1RT7 A;  1RNH A;  4CHQ A;  2HBM A;  4A2A A;  2P9P A;  1DT9 A;  4B9L A;  1NGD A;  3OS0 A;  1C1A A;  1TGO A;  4LF7 K;  3QEP A;  3HSC A;  3WXJ A;  4HUE A;  4DR6 K;  1KCF A;  2FLO A;  4FOE A;  1NGJ A;  4FPA A;  4YY3 K;  3J8A A;  4IOX A;  3AVH A;  4CJ5 A;  3LZI A;  2V7Z A;  3UB5 A;  4FLY A;  4Z4H A;  3P83 D;  4RTF D;  4AQY K;  3DLK A;  1A5V A;  3T19 A;  4DU1 A;  1J9A A;  3GE1 A;  4JLH A;  1TL1 A;  4AHT A;  3O8M A;  3ZSY A;  3GBT A;  3SK3 A;  5E41 A;  3M1F A;  1WOQ A;  2RN2 A;  3CCV N;  5LJW A;  1XHX A;  4OGC A;  1RIL A;  5JLF A;  1ILY A;  1JXB A;  3JS6 A;  4YDU A;  5GAG P;  1NJY A;  3OYH A;  3LDQ A;  3ZSO A;  4HWI A;  1KSP A;  4DQP A;  3SUQ A;  4IDK A;  1HUX A;  3H6E A;  4B9V A;  3HYF A;  3TU5 A;  1RT1 A;  2FBY A;  1FW6 A;  4EP5 A;  1VRU A;  2P9I B;  4JKG A;  3K5O A;  2P9S B;  3DJC A;  1DTT A;  2UYT A;  4CZL A;  1T03 A;  3L8B A;  1NNE A;  5BR9 A;  3CQX A;  3VQC A;  3TTF A;  5D3G A;  5ADX H;  1NOZ A;  4JKD A;  4B9T A;  3HO1 A;  4CEF A;  5C24 A;  3VES A;  1LW2 A;  4M3U A;  4BQL A;  4BVP A;  1LWE A;  3CQY A;  1KFD A;  2YHW A;  3H3O B;  4YFU A;  4IFE A;  5AQR A;  3RTV A;  4WFA L;  1TKZ A;  1RT4 A;  3ID6 A;  2A5X A;  2HOE A;  4MDA A;  4B9Q A;  3TTD A;  3VGL A;  2D0P A;  3HOS A;  3FZM A;  1S9E A;  1IKW A;  3AA5 X;  3SJH A;  1RFQ A;  4DWI A;  1VQN N;  3U8X A;  1QS4 A;  4DTM A;  3VQB A;  1BIZ A;  4K41 A;  3AAQ A;  2FSJ A;  3J80 O;  5E26 A;  3A8Y A;  5AQO A;  4ZTJ A;  3HOT A;  4EHU A;  3TAN A;  4B08 A;  1NGH A;  4A59 A;  4LSN A;  2PZS A;  2PYL A;  3F9K A;  3KHY A;  2G8U A;  3D45 A;  5HBM A;  5A2Q O;  1IBM K;  4KAZ A;  3L6Q A;  5M1P A;  3UKR B;  1BA0 A;  3CJA A;  4F2R A;  4RW8 A;  1E4F T;  2EHG A;  4HTL A;  4CI6 A;  4FYD A;  4YOR A;  4DV0 K;  5JVG L;  1S3X A;  1LW0 A;  2GEL A;  4KHU A;  1VQM N;  5AFU A;  1TK0 A;  4B1V A;  3HP9 A;  4CJE A;  1FKP A;  4RW9 A;  3G10 A;  4DFJ A;  3ISN C;  5AZI A;  4FJ7 A;  4YOY A;  2OTL N;  4KRE A;  3A0I X;  4JK9 A;  4M3W A;  3L2V A;  3S3O A;  3T1H K;  3IRX A;  4KI6 A;  1VQ7 N;  3O9R A;  3KK2 A;  5FPM A;  3T1A A;  3C95 A;  3IFR A;  4CJ3 A;  2FBT A;  1JCF A;  5CZ1 A;  5AQW A;  3KLF A;  1S1U A;  2IIR A;  1HNZ K;  3H46 O;  2HNZ A;  1VHX A;  2HVH A;  2A3Z A;  3VET A;  4KTW A;  4BE1 A;  3TR8 A;  2B6A A;  4DU3 A;  3GL1 A;  1BGX T;  3GOI A;  4FK2 A;  2LSN A;  3NBP A;  4HTU A;  1HPM A;  4CIG A;  5FPE A;  3AY9 A;  4PHT X;  3AVB A;  1VQ8 N;  3OYI A;  5ELZ A;  1HKC A;  2QW9 A;  3LDL A;  2W40 A;  3ALY A;  4UQG A;  2QTD A;  4KB0 A;  3L2W A;  4CEE A;  3B6O A;  1Q81 O;  3QFP A;  1TKD A;  3CMA N;  2DY4 A;  1S1V A;  3V9Z A;  4M3Z A;  4M63 C;  4CD1 A;  2QXL A;  2CGJ A;  5AQV A;  3VGM A;  5HRR A;  3S3N A;  4H5R A;  4CK2 A;  4GMJ B;  3QB0 A;  1FXX A;  3VQ7 A;  4C8N A;  2P9K B;  3RSE A;  1W97 L;  5JVH L;  2OZM A;  1C0T A;  2O8E A;  4R79 A;  3AVC A;  3OA9 A;  4MDB A;  3BF1 A;  3KK1 A;  4O0I A;  3LP2 A;  3L0Q A;  4GNI A;  1QQN A;  4NLB A;  3EL2 A;  3QML A;  3QDK A;  4M41 A;  1ZYQ A;  3E9O A;  4NYN A;  3KTQ A;  3SQ0 A;  4LFB K;  3RMC A;  3SI6 A;  3O9Q A;  4I6M A;  3L3U A;  1SZ2 A;  1NK6 A;  4CJT A;  1UA1 A;  3OYE A;  3WEE A;  3SUP A;  2IAJ A;  4FWL A;  3DLR A;  4B1Y B;  4HVJ A;  1VQK N;  3LAL A;  4C1N I;  3SPY A;  4JD2 A;  3IMX A;  4K25 A;  1RBV A;  3KKR A;  3MDQ A;  3DXK A;  4IJA A;  1TUY A;  4DV3 K;  1TUU A;  3M8R A;  4CZI A;  1NK5 A;  3VEZ A;  4O55 A;  3M8Q A;  4CZM A;  4BRP A;  4Z4E A;  3I0S A;  5K14 A;  5E84 A;  4CJS A;  1SKS A;  1WAF A;  3MX5 A;  5JMV A;  4O44 A;  4CHN A;  4M3R A;  3C6T A;  4YOT A;  3H1Q A;  4ELU A;  3N4P A;  4LH4 A;  2QXF A;  4LY7 A;  4BWJ A;  2P9N A;  3PSF A;  2G8I A;  3ZT4 A;  1N5Y A;  1C0F A;  4FVU A;  4Z4G A;  3KD1 E;  4FJ8 A;  5LMU K;  3H08 A;  3K2P A;  3R3L A;  4IEE A;  3V1Q A;  4IOC L;  2IGI A;  5HOO A;  2Y1I A;  3DM2 A;  2YNI A;  4I7F A;  2J4R A;  4W5Q A;  1K8K B;  2VG7 A;  5BRE A;  3J7Z O;  4N41 A;  4LC9 B;  1KC8 O;  4PUO A;  4WQ5 A;  1L3T A;  3NVM A;  1Q8I A;  3C65 A;  3PSI A;  3CIP A;  4C8L A;  1C0G A;  3KWI A;  2UXD K;  1B9F A;  1NGE A;  3KK3 A;  1NGF A;  5FDL A;  3ZET B;  4E3S A;  4EFH A;  4I9Q A;  4JS4 A;  3DYA A;  1WSG A;  1JLA A;  3WXL A;  2Q1N A;  5KPZ A;  1ZBH A;  3FE1 A;  5GIN A;  1NOY A;  4MO4 A;  1YXQ A;  2P9U A;  3VQ4 A;  3HBT A;  4A62 A;  3PV8 A;  4FM1 A;  1TK8 A;  4A57 A;  3SAH A;  1KVB A;  4FLZ A;  2E20 A;  4NXM K;  4B8C A;  2HND A;  3VQP A;  4K42 A;  2GV9 A;  2HHX A;  4ID5 A;  1KLN A;  4X64 K;  3OYN A;  4XH1 A;  2QA4 N;  2O8D A;  1W7A A;  1NGB A;  2H3G X;  3SQ2 A;  3CJ1 A;  4H5T A;  4DSL A;  1RDB A;  1JCE A;  3SBT A;  2YNH A;  1FKO A;  1T7P A;  4KV8 A;  4FZZ A;  4M45 A;  1RDU A;  1RTJ A;  3C6A A;  1V4S A;  4NLC A;  3D2E B;  1HX1 A;  2RHK A;  3SYZ A;  4GV9 A;  3VOV A;  3ID8 A;  3MAQ A;  5SWM A;  1CZB A;  4J8F A;  1VQO N;  2RF2 A;  4RW7 A;  2RPI A;  2O8B B;  4JI8 K;  4QCL A;  3I55 N;  3WNG A;  4H0T B;  4DTS A;  3CCR N;  2IOC A;  2EX3 A;  4B1U B;  1XQS C;  4QS9 A;  4JI3 K;  1NWK A;  4K0K K;  1ZBL A;  4CGJ A;  3T3F A;  4LF5 K;  3OVN A;  4RW4 A;  1S72 N;  2KFZ A;  2Q0U A;  3S9H A;  3WNH A;  4DR5 K;  4ELT A;  1E3M A;  4DLG A;  2F7T A;  3H1V X; 
#chains in the Genus database with same CATH homology
 2UUA K;  4GKJ K;  4DR2 K;  2UU9 K;  4GKK K;  4LF6 K;  4LFA K;  4V19 S;  4DUZ K;  2UXD K;  4JI6 K;  1HR0 K;  4JI1 K;  5IT9 O;  2UXB K;  3J80 O;  2F4V K;  4NXN K;  4DV2 K;  4LF7 K;  2UUC K;  4DR7 K;  1XMO K;  1HNW K;  4DR6 K;  4YY3 K;  2VQF K;  4CW7 B;  3OTO K;  5A2Q O;  1IBM K;  4DV5 K;  3J7A P;  5AJ3 K;  4JV5 K;  4JYA K;  4LF9 K;  4AQY K;  4KHP K;  2ZM6 K;  4DV7 K;  4NXM K;  4LF4 K;  5LMN K;  2HHH K;  4CVN E;  4DV0 K;  4DV6 K;  4OX9 K;  4LFB K;  4X64 K;  4B3S K;  4DUY K;  4JI5 K;  4DR3 K;  1J5E K;  1FJG K;  1XNQ K;  2E5L K;  1XNR K;  4X65 K;  4YHH K;  1I94 K;  4B3M K;  4DV3 K;  3T1H K;  4JI0 K;  3J7Y P;  4B3R K;  3J81 O;  4JI7 K;  3JAM O;  1N32 K;  1HNZ K;  4JI2 K;  4LFC K;  1IBK K;  5BR8 K;  4JI8 K;  4DV4 K;  2UXC K;  4B3T K;  5FLX O;  4LF8 K;  4DR1 K;  4JI3 K;  4K0K K;  1HNX K;  5IWA K;  4X66 K;  1IBL K;  4DV1 K;  4DR4 K;  4LF5 K;  1XMQ K;  1N33 K;  4X62 K;  3T1Y K;  2UUB K;  2VQE K;  5LL6 Z;  1N34 K;  4DR5 K;  4JI4 K;  5LMU K;  1N36 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...