4GKKK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4gkkK00
2UXCK 4K0KK 5LMNK 4DV6K 4LF8K 4DV4K 4LFCK 1N33K 1IBKK 4X65K 5BR8K 4DUYK 4DV2K 2F4VK 4JI8K 5FLXO 4B3SK 1IBMK 4LF9K 1HNZK 4B3MK 1XMOK 4CW7B 5AJ3K 4B3RK 1N32K 4LF7K 5A2QO 4DR7K 4JI6K 4JI5K 4V19S 4CVNE 4DR3K 2E5LK 4LF5K 1IBLK 1XNRK 4JI2K 4JI7K 4OX9K 4JI0K 2UXBK 5IWAK 4LF6K 3T1HK 4DV3K 1J5EK 4LFAK 2UUCK 1HNWK 4JI3K 1FJGK 3J7YP 4JV5K 4DV0K 1N34K 4DV1K 4AQYK 2HHHK 4JYAK 4X66K 4DR6K 3OTOK 4YHHK 4DR1K 4LF4K 1XNQK 2UUBK 4NXMK 3J80O 4DV5K 3J7AP 2VQEK 4KHPK 1HNXK 4JI1K 4DV7K 5LL6Z 4DR5K 3J81O 1XMQK 2UU9K 4DUZK 4X62K 4LFBK 4YY3K 4DR2K 1N36K 4GKJK 3JAMO 2UUAK 4DR4K 2VQFK 5LMUK 4NXNK 2ZM6K 4JI4K 4B3TK 4X64K 1I94K 3T1YK 2UXDK 5IT9O 1HR0K 4GKKK
chains in the Genus database with same CATH superfamily
4KHYA 2UXCK 3DXMB 3O9UA 2HOEA 2A40A 1NK8A 2YHYA 3JXUA 4K41A 1BUPA 3J8AA 1C1CA 1SL2A 2OYQA 5J2NA 4E89A 5EY4A 5KRTA 1EETA 4KPYA 4OLBA 4DV2K 4M7YA 4WCEL 4Z94A 1T7PA 3THYB 2P9LB 3AVGA 2QWOA 4KH5A 4KHUA 4KHQA 4B3MK 1TKZA 3VENA 3NGZA 3LWLA 2A41A 4FM2A 3NF8A 3RVCA 2QWLA 2HSTA 4B9NA 3PY8A 4OPJA 3AO1A 2HNZA 3HK2A 4XH1A 3GDQA 1VQNN 2XRIA 4O0JA 1QSLA 4IBNA 1UA0A 1YTUA 4O44A 3QB0A 3OS1A 4KFBA 3QERA 4KH4A 1HKBA 4CJWA 1RTDA 4DTOA 4JRQA 4BGBA 2ASOA 3TANA 5M1NA 1NK7A 4B8CA 1TKDA 3T69A 2P9PA 4Z4EA 2VG5A 3WT0A 4B1ZA 4CEBA 1P8ZA 1VQKN 3HI0A 4FLWA 5AQFA 1XQSC 4MO5A 2YNHA 3A2FA 2JWLA 1D9FA 3QEIA 1BO5O 5KRSA 1EWQA 3KLGA 2QA4N 1TL3A 1UWBA 4GV3A 2HNYA 1TV6A 1JLBA 2YHXA 4DF8A 1DKGD 4PY5A 1HKCA 3VEZA 2PBDA 1NK6A 3KKRA 4FWOA 1TAUA 4NXNK 4O8UA 3I8BA 1SAZA 2WUSA 2O8DB 1WOQA 1UAXA 4GKKK 5JMVA 3H45C 2V51B 3BGRA 3HT3A 3SAFA 2WFBA 4JD2B 2D0AA 2DFEA 4CZKA 4DV4K 3A8YA 4AM6A 3CCUN 1X3MA 1RT2A 2H3GX 1TGOA 2HF4A 1RDDA 1Y64A 3E66A 1V4TA 3O8MA 1K6YA 3OHRA 4FZYA 2E2NA 4K8ZA 5J2QA 1C0GA 4PWDA 1XMOK 4FW2A 2G8FA 1X9WA 4AHCA 1FXXA 4YOWA 3BDPA 5KGXA 5K14A 2XY7A 4JI5K 1F21A 5AQMA 1VAZA 5TKYA 1RDBA 2F9TA 3WXJA 2HF3A 5F0XA 4H5WA 2HHUA 1QQMA 2AJQA 4GY2B 4W5RA 3AVBA 3OBYA 1C6VA 3U8XA 4LC9B 1T44A 1ZBFA 5CZ2A 4CGDA 2HMPA 4FW1A 3DLLL 5HBMA 3QNOA 4AQYK 3MEEA 3K5MA 2ZGZA 2OPQA 3O08A 4FK4A 4K42A 4C1NK 3D2EB 1OVYA 3GBTA 4GW6A 4E7KA 1VQLN 2D1KA 5FPEA 1Q8IA 4H0XB 3NH2A 2XO7A 4EP5A 3QFUA 4E7IA 3PO5A 1ILYA 1HX1A 4B1YB 4DV5K 1NJXA 3SI6A 4JD2A 4YORA 4BR4A 3CCJN 4CJUA 5J2MA 1S1WA 5HRNA 2F9WA 1VQ4N 3F9KA 3CXCM 3THWA 3NH1A 4FM0A 5HOOA 3QEWA 1ZBLA 3WEEA 5CYMA 1TK8A 3V1OA 4KTZA 5KQDA 1JXEA 3CC7N 2VQFK 3THVA 3KLFA 1JLQA 4CEOA 1NJZA 4IOXA 2UXDK 3CPEA 3WNHA 3K5OA 3S41A 2HB5A 4E0DA 3PSFA 3I0SA 4CF0A 3HP9A 4M45A 1ZC6A 4JK9A 1RBRA 5GADP 1UA1A 3LPTA 4K43A 3IAYA 4CJ3A 4FWPA 4A57A 4RW8A 4DSLA 5I3UA 4DUYK 2P9UB 4F2RA 4GNIA 3FLCO 4PL8A 1S72N 1VQ7N 4B3OA 1HLUA 2ZWHA 2RHKA 2RE2A 4EZ9A 2O8BA 3LAMA 4MDAA 1OH7A 3AVAA 4W5NA 5GIOA 4CK1A 3DYAA 1U48A 3ZETB 3TPQA 1WBBA 3VQ9A 4N47A 5AQKA 4B9QA 3MN5A 1KAZA 4OPHA 5IWAK 4I2QA 4DV3K 1J5EK 3DAWA 1HMVA 5MLCQ 1S1VA 3SV3A 4IO9L 2YNGA 3FZKA 1FJGK 1ATNA 1X3NA 3ITHA 1N34K 4DSFA 3OYAA 2D0PA 3NVMA 4PQUA 3QEVA 4BR0A 2E6LA 4FJMA 2E2OA 3HYFA 3P31A 5BPLA 3SQ0A 2BGGA 1EXQA 2D0CA 4JK7A 3OW2M 1JLGA 4BDZA 1SKRA 2FC0A 3AV9A 3ZYYX 2XY5A 4FWMA 3LP0A 1BQMA 2E20A 1HQUA 1KCFA 1KTQA 1HYZA 4IDHA 5M1PA 4WFAL 1NMNA 4M42A 1XUPO 3LDLA 3MXMA 1QTMA 1GOBA 2KFZA 2I7NA 1WAJA 2BANA 3ENHA 4FWKA 2B6AA 4E7LA 4CFBA 1VSHA 4DR2K 5AR0A 4BC4A 2FSKA 3PUFA 2P9SA 5KQ8A 2Y1JA 4FJ7A 1U04A 3L2WA 2ZM6K 2PYJA 4FOIA 1I94K 4M3XA 3O3HA 1XHXA 2G8VA 4IFEA 4CJPA 5C15A 1WSEA 3BZKA 3CQYA 4QS8A 3NF6A 4JNEA 1Z05A 4U7BA 4DTUA 4B9LA 4LFCK 1N33K 2O8EB 3OY9A 2F4VK 3VQ5A 2QTDA 4B3SK 1E3MA 3VQ6A 1W7AA 4BY9C 3L2QA 2E1ZA 4KRFA 3T1AA 4B08A 1OKJA 4FPAA 3EY1A 2GUIA 3SYZA 5M1QA 3NVKA 4CGIA 4CZMA 5HL7L 5FPMA 5AQTA 3M8RA 3PO4A 4ICLA 3N4PA 1NGBA 2BUPA 4PKHA 4Z4FA 1IH7A 1NU0A 1M1KO 4C8LA 5KTQA 4LFAK 3HRGA 2ATQA 3QFPA 2P9NB 4N76A 4M3TA 4N41A 3SJJA 3AGKA 1HPMA 3SBGA 4BG8A 3HP6A 2BH1A 1RDCA 4DMNA 3Q7CA 2BTFA 4CBXA 1C0UA 1REVA 3NFAA 5JLFA 1VSIA 2Q0UA 2G8KA 3OVNA 2NRVA 4CCHA 4UQGA 3R3LA 4LH5A 2OPPA 2G8UA 1CLQA 4CHNA 3J7AP 3G25A 3TI0A 3O1BA 3OS0A 1VK0A 4DR5K 2P9IB 1ZBIA 4BE0A 3AO5A 4JKBA 3KLHA 3EE9A 3VETA 1P90A 4KI6A 4A5BA 4IXCA 3V9XA 4IOCL 3SQ2A 4JRPA 3RTVA 2D4WA 3A5NC 3OJSA 4OJRA 5AQSA 1BI4B 4DTSA 1HR0K 3VTIA 3MX2A 2Q0RA 3KTQA 2Q2RA 3F9MA 4CHOA 1YITN 2W6KA 3MX5A 1SKWA 3CC4N 1H1VA 3DRSA 2O4IA 3AO3A 2Z1JA 4M3YA 2EHGA 2FBXA 4JKGB 3WXKA 4FK2A 1VSEA 4ELTA 4BRPA 3VA0A 3VEWA 5I9EB 2HBMA 2Y1IA 3CQ8A 5AJ3K 4JI6K 4V19S 4CHPA 1NKCA 3H3NO 4DQRA 1T05A 2HHQA 4EAHD 4AH9A 3O4NA 1GLJO 3QMLA 3DXKB 4LF6K 3AA3A 1TL1A 2YNFA 2NRRA 3CM5A 4AILC 1JL2A 4BRQA 2A6AA 1YHQN 4PUOA 4AHRA 2HHVA 3MN9A 3HOSA 3K59A 1L3TA 4FJ8A 2P9IA 3TABA 4YOUA 2W6LA 3G4SN 2NRXA 1VSLA 3E9OA 4EZ6A 3OYLA 2P5OA 1HUXA 4M63C 1ASWA 3KK7A 2KHOA 3HTVA 2OTJN 4QCLA 3UIQA 3LP2A 5C42A 3DLRA 3CF5L 3AAQA 5C12A 3ID6A 2A5XA 4NYNA 3THXA 3NCIA 4AM7A 3MXIA 2HHTA 3CMAN 4BQLA 3VEYA 4YY3K 1XWLA 1U45A 4BRIA 3IFRA 4HHTA 3RWUA 3CCSN 3C6AA 3HBTA 3ATUA 1X9MA 4KHNA 1NMDA 4AHTA 4DTMA 4I9LA 3ZSVA 4BE2A 4CZIA 3CYMA 3U6FA 3ATVA 3I33A 3AO2A 4FLXA 1Q9YA 1S5JA 5CR4A 4AHUA 5GINA 4IFYA 3TR8A 1KC8O 4KB0A 4ISFA 2JGUA 4RW4A 4KO0A 4WYBA 2IVNA 5HROA 2P5GA 4X65K 2OPRA 3U9DA 3AGRA 3KK1A 3S3MA 2P9PB 3UKRA 1W0HA 4CF9A 1S9GA 5C24A 4A61A 1IBMK 3MAQA 3NAEA 3G6EN 3NF9A 2RKIA 4CJLA 3OYHA 4OKEA 5M1OA 4F9OA 3QBXA 3AVMA 1QS4A 5M1FA 1N5YA 3CG7A 4LF7K 4I9QA 4YDUA 3EO3A 4IDKA 1HPZA 1VQ9N 1Z26A 1X9JA 4OKJA 4U67L 4OVLA 1ZBUA 4KV8A 3V9UA 4BR5A 4CEEA 1WN7A 3HSCA 4CFCA 3V81A 3LALA 3LDQA 2AA4A 5CY4A 4BC5A 3VQBA 4DFKA 4PA1A 1L5UA 3D0PA 3ZT0A 4FJJA 2NRWA 4H0PA 3R6MA 1BWFO 5HRRA 4O5BA 1NGCA 3HL8A 3M5RA 4WQ4C 3L2UA 3VF6A 3SMSA 2X6SA 3O4WA 4FJHA 4JKAA 3WQTA 3T7ZA 1BIZA 2EX3A 4LF4K 3DRRA 4BRAA 3ULEA 3TSPA 1LW0A 4DSEA 2DFHA 4M3RA 1MDUB 2XY8A 3MWTA 4RCHA 4DS4A 4FVMA 1KFSA 4KHPK 3OBWA 3P38A 4JKFA 2DPNA 4FLUA 4FCYA 5LL6Z 4BWJA 5KI6A 1GLFO 1SS6A 5AQXA 2PFUA 3CCLN 3L3UA 4LFBK 3PX4A 4YOTA 4WQ5A 2VGNA 4B9TA 5DMRA 3ASMA 1YIJN 3P5JA 4CHYA 2LSNA 4EHTA 3T1YK 2F8SA 1I39A 5J2PA 3EKSA 4AF1A 1WUAA 4FWLA 1RBSA 2HBKA 4FZZA 4ELUA 5AQRA 3DM2A 3GE1A 3OYKA 3A5LC 3H3OB 4CGFA 1BOTO 1ATRA 2GWKA 2B4JA 2WTUA 3CERA 5BR8K 4RTFD 1YJNN 1GLDG 3CC2N 1LOTB 3M8SA 2QWMA 3O6WA 3LZIA 4J2EA 3LDNA 3O80A 1DT9A 2YI1A 4B3RK 2X78A 3VQ8A 5A2QO 3FE1A 3ALYA 3G10A 4M3UA 4CJKA 5GAGP 4KH6A 1VRTA 3G71N 2X74A 3J7ZO 1IKVA 4DWIA 4H03B 4QS7A 4PKGA 4FPBA 3THWB 1KVCA 4BE1A 4XEIA 3WEEB 3KK2A 3HJFA 3V1RA 3U3GA 1ZBHA 2HBLA 3WUHA 5JVHL 4C1NI 2HW3A 1VSMA 3TAGA 3I0RA 2Q3SA 2KQ2A 4YOXA 4F8RA 3OTOK 4DTXA 4R5PA 2GTDA 4BC3A 5CZ1A 2CGKA 2YCHA 1KSPA 1NGDA 4NXMK 3BEXA 4NLCA 4F4KA 4G1QA 3M8QA 1VQ6N 3CI5A 3PIPL 4BDYA 3H1QA 3V9WA 3C6TA 1RT6A 4ZTFA 1Q7YO 3MDQA 2J4RA 4JI1K 1J53A 1KRPA 4KI4A 2O8BB 1VRUA 3IG1A 2ZJRL 3V6DA 1EQYA 4F2SA 3VQ4A 1UOCA 2NRZA 3C65A 5B8HA 3HSTB 3VESA 1GLEG 4A62A 4Z4IA 2OZSA 4BGAA 1A5XA 2HVIA 3VEOA 1IJJA 3CM6A 5FRNA 2F8TA 4JKHA 3DLEA 3WXMB 4DB3A 1ESVA 3O9TA 3M8PA 4KHSA 1N8RO 3V4IA 5AQNA 3CQXA 3QETA 4LF8K 4BR9A 3CCRN 3FZHA 4B1VA 3SLCA 1ZYQA 2DFFA 2GEMA 3LP1A 3ZSXA 4Y0WA 3NE6A 3LDPA 1IG9A 1HJOA 5SWMA 4H8KA 3AA5X 5AQZA 1QSYA 1CXUA 2ASPA 4CW7B 5ADXA 1YF5L 4R79A 1SQKA 2PYLA 3IKMA 3DJCA 4H5VA 1EKEA 3ZT4A 1HNVA 4CVNE 1TYQA 1RDUA 5T7BA 4CZGA 2Z1HA 2PZSA 4W5QA 2D0OA 4GV9A 5C2FA 1JL1A 5AQGA 4DQ8A 3RMAA 1KAXA 3DOLA 2UUCK 4CERA 2O4GA 1RTIA 5JVGL 3HVTA 3V1QA 4CESA 2E1YA 4FYDA 2P9SB 1NBWA 3MEGA 4HWIA 3VERA 2HHHK 1TKTA 1VSFA 4DFJA 2E8AA 4NB4A 3OS2A 4H5RA 4C8KA 3IMXA 1L3SA 2ASMA 4C23A 3OYJA 2P9KA 3VQQA 3MXJA 1K73O 2HNDA 4XIUA 3A5OC 2O8FB 3LWMA 5FRMA 1K8AO 1QZ6A 4M7XA 3VQ7A 2VQEK 1BHLA 4H5TA 1T3VA 4KHWA 4CJFA 5GAHP 2CH5A 2Q31A 5KPTA 3QNNA 3M3ZA 4CEZA 4CZHA 4CFAA 4E19A 1V4SA 3D7EO 1D8YA 4DQIA 2Q36A 2CGJA 2HHXA 3SAHA 4JI4K 4NYFA 4DFMA 3TU5A 3CJAA 5BPNA 3B8AX 3DLKA 4GVMA 1JCFA 4BVPA 1NNEA 5BN9A 2YHAA 1NGGA 1D4XA 1HRHA 1L3VA 1RILA 1D9DA 4CJ4A 1SZ2A 2F96A 3KLEA 1HNIA 1WB9A 4WQ5C 3UE5A 3DLHA 4HCCA 3SMPA 3Q7BA 4N5SA 4HUGA 1K8KB 1C1BA 4HVJA 5BR9A 2YJEA 1GLAG 4JHDA 3OA9A 3BZCA 1WSIA 2O8CB 4CJQA 4H0VB 4FL9A 1NWKA 1IG8A 3P4IA 1EX4A 4IOAL 1JLAA 1NLVA 3SZ2A 3SNNA 1A5VA 2FF3B 1TAQA 2FBTA 1GLCG 5JICA 3HPHA 3VOVA 4BACA 2O8FA 5AZJA 2UYTA 1MU2A 1NGEA 5EVZA 1EP4A 4HUFA 1NJIO 4I7FA 4OGEA 3TAFA 1NGAA 4FVUA 3MCAB 1QZ5A 3VF2A 3LDSA 3VF4A 1U49A 4BRGA 3CCVN 2IDOA 3CHWA 3KJVA 3AVLA 5JS2A 1FW6A 3HXMA 4CHZA 3TARA 3K58A 3IDHA 4CJEA 1RNHA 4DTPA 3CJ9A 1NM1A 3HO1A 1BG3A 1NOZA 1LCUA 2QKBA 2V7ZA 3D6RA 4ID5A 5ADXH 4QS9A 2IIRA 1SV5A 4FLZA 4IJAA 4DQPA 2KLAA 3LM2A 1ZBSA 3WQUA 4NLBA 3SV4A 5C2DA 1QHAA 2YX6A 3SBTA 4X62K 4HCBA 1O13A 3MCPA 1CZAN 1ASVA 3AARA 2XY6A 3UKUA 1VSJA 1K8KA 4MQ3A 4W5OA 3QLHA 4DR4K 1WAFA 4FSVA 3CJ7A 3PSIA 5BN8A 2HHWA 4H0OA 2O8CA 3LANA 1BQNA 2E6MA 2IOCA 3FR0A 4ISEA 5AFUA 5IT9O 2IAJA 1JLFA 4FXDA 1WSJA 4CZEA 1CZBA 4YFUA 4E1MA 1I3AA 3PX6A 1JKHA 1JXBA 1S22A 3C94A 3RMBA 1YJ9N 2VCPA 1IBKK 1ZXOA 3AO4A 3TAPA 5EX5A 2E4LA 4JN4A 5AZIA 5BREA 4MFBA 4JI8K 5EU7A 3CFRA 1WSFA 1NKEA 2FSNA 2VG7A 2VWJA 3CFOA 4JK8A 4KKOA 2QKKA 4DR3K 2E5LK 4DG1A 1QVGM 1IBLK 1G15A 1VHXA 4LH4A 4JI2K 1Y97A 4OX9K 4BR7A 1JCEA 3THXB 3T1HK 4GVEA 1WBDA 3SAGA 3VN5A 3NBPA 4DKWA 3LAKA 3IS9A 4M3ZA 4CK2A 4A59A 3SPZA 1J6ZA 2FBYA 4DU3A 3U3YA 4DV0K 1LWEA 2CGLA 2FLOA 3CIPA 2ZJQL 3MN6A 2FSJA 1LWFA 3E9LA 3ENBA 4J2BA 2WONA 4A2AA 2OPSA 1BISA 2DTUA 2OTLN 4IEIA 4DR6K 3CJ1A 1U6ZA 1IKWA 4CJSA 3KWGA 5J1EA 1X1PA 5CYQA 3WNGA 2V7YA 5JLHA 5M1KA 1Q81O 1R0AA 4ILJA 4FJXA 3MN7A 3JS6A 3NH0A 5F2RA 1OH6A 2KZZA 3UKRB 2A1RA 3VQAA 1NKBA 4UY8O 4H4OA 4BRDA 4CJRA 3J81O 1XMQK 3MK6A 4BRCA 4ILGB 4JKDA 4BVOA 4L8RB 3CJBA 3HM9A 3ZSRA 2Q1NA 1WSHA 4WFBL 4FJKA 1IV0A 3ZX0A 1XI1A 1LWCA 1EO1A 1BU6O 3KZBA 2ZJPL 4DU4A 4OPKA 4B9VA 3B6PA 1C0FA 2G8HA 4WFNL 4FJLA 5HRSA 4FO0A 1KD1O 2QXFA 4FK0A 4Z0UA 3H08A 1S9EA 4CK3A 4BRHA 4KBOA 3QINA 1RGIA 4FWQA 3PX0A 2GX9A 3NDKA 1BCMA 5AQVA 4B9UA 4Y1CA 2CH6A 1KAYA 3MMVA 1HQEA 1LW2A 4JKCA 1NK0A 3FGUA 2ZGYA 4RW6A 3ULEB 4ILHA 2PY5A 1NG9A 1WSGA 1N6QA 4IKFA 2QXLA 1MA9B 5EOYA 3EN9A 1XNRK 3L4QA 3ID8A 3PIOL 3T3FA 5LJVA 1T03A 3RRHA 1E4GT 4AHSA 1D5AA 3D45A 4CGGA 3P83D 2G8WA 5AFUH 3M6GA 4TSXA 4DU1A 1SKSA 3J7YP 4BRLA 3CETA 3WXIA 5LY3A 5F1XA 3LDOA 1MWMA 2VG6A 3R8EA 4ZHRA 2HBJA 4CD3A 1RBUA 3KWIA 4JAXA 1HKGA 2QWRA 3EZWA 3SPYA 1U2VB 4YHHK 3I55N 3ZT2A 3AA4A 4CIEA 2UUBK 2E2PA 4YOVA 3OYMA 1RT7A 2W41A 3LP3A 4LD0A 4Z4CA 3DI6A 4BROA 3OJUA 1QQCA 3RR7A 3HVRA 3W0LA 1RDAA 3CCEN 4DF4A 4KB1A 3QIPA 2IGIA 4LY7A 4FLVA 1KLMA 3FZFA 3B6OA 4FLTA 5E26A 4K25A 2UUAK 1R59O 2OZMA 3OYDA 3QEXA 4IWVA 1RTHA 4O5FA 1HYSA 1Q9XA 1KLNA 1DTQA 2RF2A 1SL1A 3ZSYA 2HHSA 3ZSQA 4ELVA 3HZ6A 4CBUA 4GV6A 1C0MA 4HTUA 3SK3A 2VGMA 3K0SA 1BA1A 4CJ7A 4FJ5A 1GLBG 3S3NA 4FZXC 3TSUA 5CHIA 1RT4A 3RSEB 3L8BA 5BRFA 4K8XA 2A42A 5GIPA 4JKEA 3O9RA 4I6MA 5AQOA 4Z4GA 1BIUA 1T6DA 1TVRA 2P1JA 2ZQBA 1RFQA 3UB5A 2IVPA 1T6CA 1BGXT 1N32K 4FWNA 4O8KA 3CCQN 3AVJA 1IO2A 4DQQA 1U2VA 1C0TA 1IKYA 1S1XA 2Q97A 4B1WB 3QESA 3SUOA 4A2BA 1NK4A 4EHUA 2UXBK 3C0BA 3AAPA 1YAGA 3K9JA 1LAWA 3TSQA 3ENOA 4EIAA 2QI2A 3A0IX 2ZF5O 3ULDA 4CEDA 4CHQA 3DXMA 3TAEA 4KTWA 3MWPA 1HNWK 3QIOA 4FJ9A 3O9SA 4EP4A 3AVHA 2KFNA 3DWLA 1JLEA 1KFDA 4IG3A 3K5NA 3AVNA 5AQHA 1ATSA 2VWBA 3BY5A 4O0IA 3OYGA 1T8EA 3THYA 4FLYA 2P9LA 4MLEA 4CE9A 1HJRA 2OCEA 4CF8A 3O1WA 4FOEA 4C8OA 5DM7L 2IS3A 1FK9A 3K2PA 3AVIA 4CI6A 2XHBA 2PAVA 5FPNA 3KD1E 3SQ1A 1X9SA 1YVNA 2JLEA 4FWRA 2KW4A 1LV5A 3C6HA 2QWNA 1Z25A 1O1WA 4O4GA 2BE2A 2E88A 4DSJA 4PHTX 4DUZK 3RSEA 4CGJA 1J54A 4B8AB 3E1YA 2WC9A 3QDKA 3L2RA 3OYBA 3TAMA 2GV9A 1BL3A 3WXLA 4GKJK 5H1SQ 5LMUK 1A5WA 3GOIA 1TYQB 3SUQA 3HPOA 1YVUA 4DFPA 4BREA 5AQQA 3PLAA 1YUWA 3FFKB 4IG0A 3VMFB 3R1XA 4BRKA 4H5NA 4OGCA 4ZTJA 4Y1DA 3VGMA 1JCGA 5C0YA 1TUUA 3CMEN 2RPIA 5FPDA 4CBWA 1IKXA 3EE8A 5AQYA 4PKIA 4FM1A 5DM6L 2X6NA 3AY9A 4J2AA 5I42A 1XC9A 5FLXO 3F73A 4OKKA 1U4BA 4H0YB 4E7JA 2P9KB 1OH5A 2F7TA 4Z4HA 2NRTA 1FKPA 3O5BA 4LF5K 4BG9A 4N56A 4BRMA 4IJNA 4LSLA 3RR8A 5BRDA 2O8DA 4FJNA 1EWRA 4OPAA 3OYFA 3CJCA 3PV8A 1S3XA 3VEVA 5SZTA 4B9SA 4WE1A 4DHYA 3OYEA 4JV5K 5HP1A 1S6PA 3AVCA 3G0ZA 5AQPA 3CCMN 3WNEA 1GOCA 5AQWA 1B9DA 3TAQA 3SQ4A 3L0QA 1LAVA 1S1UA 2A3ZA 4QAGA 1Q86O 4DR1K 4JS5A 1XNQK 1NGIA 3W3DA 1U47A 3J80O 3CPWM 1NGFA 3I8DA 4JEPA 2I5JA 1BDGA 3L3VA 2QW9A 1RCHA 2W40A 3LL3A 4BWMA 2ETJA 3I56N 1JLCA 3QO9A 4JHDB 4I2PA 4KTQA 3SUPA 4YDUC 4DS5A 2IC3A 3GL1A 2YKNA 4CEAA 3K5LA 5KPZA 4H0TB 3O3FA 1KVAA 3ZLJA 3NF7A 1NGJA 4OLAA 4WF9L 4CIFA 4CZFA 3R9PA 5AZJB 4B1UB 2ZE2A 3D2EA 3V9ZA 3VQPA 4AHVA 2QM1A 3DMJA 4M41A 2AP1A 5LMNK 5C25A 3ZT3A 5TKWA 4DV6K 2IVOA 3ZCMA 1G99A 3D2FB 3L4IA 3TWHA 4NCAA 4DTRA 2NNWA 1OH8A 2GUPA 2YHBA 5AQLA 4E1NA 3AVKA 5LJWA 4F3TA 1J9AA 4IEEA 2DY4A 3OYIA 1QQOA 4CFDA 4RWTA 1VQPN 4LF9K 2KZMA 3FZMA 3VEXA 5KPRA 2RN2A 4O55A 3S9HA 2ITGA 4XH4A 3DRPA 2V52B 4DR7K 4DLGA 5GAEP 1YT3A 1RBTA 5C10A 1SUQA 4JI7K 4JI0K 2P51A 5ELZA 2KTQA 1ITGA 1TKXA 2NZTA 1WNSA 2D0BA 3UKUB 3KHYA 2WOMA 3K9KA 3C6UA 2YHWA 1YXQA 4DV1K 2Z1GA 1KQSM 3H6EA 2VWKA 2P9UA 3FFIA 5FROA 4CZLA 4CIGA 3EYZA 3L6QA 5DK5A 3EEQA 4CJTA 3KK3A 4JS4A 1YTAA 4RW9A 1RBVA 2G8IA 1RT5A 3ZETA 3FZLA 5AZIB 3IRXA 2HVHA 3D2FA 3VA3A 3QBWA 1QHTA 1M90O 3TTDA 1J5OA 1KXPA 4NCBA 3JAMO 4BRFA 1QQNA 1DTTA 3HM8A 3QEPA 1YI2N 4BDPA 1VQON 4DTJA 4B3TK 3JYTA 3AVFA 4DLEA 4M3WA 4JLHA 3N4QA 3O9QA 1E4FT 3CD6N 1RDWX 3NMUA 2QWQA 1VQMN 4KREA 4HTLA 5AQIA 2GBZA 3VQEA 4WQ4A 1DLOA 2A1SA 1B92A 1DGKN 5D3GA 2VYPA 5CE3A 4XH5A 3S3OA 2YV0X 3SCXA 5JS1A 4E1JA 1QE1A 2B5JA 1TK5A 1XC3A 5BPMA 4ID1A 3NGYA 3WNFA 3DLBA 3VGLA 2WBNA 3LPUA 2FBVA 3VQDA 1Q18A 3VGKA 2YNIA 3AA2A 2QWPA 1QSSA 1NK5A 3KD5E 1GLLO 1VQ8N 4FWSA 4A5AA 5E84A 1BCOA 3C7NB 2I7PA 3M1FA 3O4QA 3KKSA 3JSMA 3ZSZA 3DLGA 3QICA 4IFVA 4JI3K 4CF2A 5E41A 5BRHA 2E2QA 3OYNA 3RRGA 3SJHA 4BRNA 4JYAK 2O8EA 1VSKA 4YOYA 4LSNA 1GOAA 4C8NA 2QEXN 1W9HA 4B9MA 4NO7A 1VSDA 3L2VA 4F3OA 4CJ5A 2YJFA 3EZ5A 3A5MC 4B1XB 3MEDA 3OYCA 1NGHA 4BC2A 3EKUA 1YJWN 2D5RA 1TK0A 3LM9A 1HYVA 4DSKA 2NLXA 1HNXK 3LZJA 3BF1A 3SUNA 1VQ5N 5AQJA 4KAZA 3ZT1A 5HRPA 3V9SA 4FJIA 2UU9K 2NUBA 1XHZA 3GG4A 3T19A 1JJ2M 2P9NA 4YNQA 3E01A 3P1GA 3P39A 3ISNC 1RT3A 3ZEUB 3H1VX 1S6QA 3IUCA 5EXWA 4CZJA 4X64K 4W5TA 4DQSA 4H4MA 2BDPA 1NOYA 3H46O 4NCGA 1WLJA 2OA8A 1SL0A 1CZ9A 4K0KK 1DEJA 2JWKA 3U4LA 2HMIA 4GMJB 4RW7A 4DSIA 4OO1J 3RMDA 3C7NA 3HOTA 4G9ZA 3E9PA 3CFPA 3BP8A 2KKZA 3U9ZA 2EWSA 3NHGA 3ZSWA 3VQCA 2ZD1A 1HNZK 1ASUA 4CEFA 4HUEA 2FXUA 4CEQA 4CECA 5KGWA 4CD1A 4E7HA 1RTJA 1Z6RA 3RMCA 2FF6A 2ITMA 4BR2A 3NGIA 1K9MO 1BI4A 4MLHA 1NJWA 1S1TA 4E3SA 1W97L 4QOZB 1QVFM 4MDBA 4CF1A 2YKMA 5FDLA 4CGHA 4X66K 4Q0BA 1C1AA 4JKGA 1L3UA 4DCHA 3EL2A 3ZX2A 4C8MA 4DTNA 3F5TA 3K57A 2R7YA 1CXQA 3ZEUA 3C95A 1RT1A 4CJVA 3KIOA 4FJGA 3TTFA 4Q5VA 1Q82O 1NK9A 2QK9A 3O3GA 1B9FA 3HPGA 3KLIA 3DOKA 3F2KA 1TUYA 1W2BM 4J8FA 3ZX3A 4PL7A 3MECA 4IO8A 2NRHA 2GELA 4I6MB 4DV7K 3DXKA 4MO4A 4ISGA 1OVQA 2W42A 2GWJA 1NJYA 3VPZA 4BQZA 1N36K 5HLFA 3KVGA 2OANA 3BF3A 4IZ9A 3VTHA 3BUZB 2Z1IA 1BA0A 4J2DA 1FKOA 4EFHA 1KVBA 5AQUA 4RG8A 4L3QA 1MWKA 3TTCA 3ZSOA
chains in the Genus database with same CATH topology
2UXCK 4K0KK 5LMNK 4DV6K 4LF8K 4DV4K 4LFCK 1N33K 1IBKK 4X65K 5BR8K 4DUYK 4DV2K 2F4VK 4JI8K 5FLXO 4B3SK 1IBMK 4LF9K 1HNZK 4B3MK 1XMOK 4CW7B 5AJ3K 4B3RK 1N32K 4LF7K 5A2QO 4DR7K 4JI6K 4JI5K 4V19S 4CVNE 4DR3K 2E5LK 4LF5K 1IBLK 1XNRK 4JI2K 4JI7K 4OX9K 4JI0K 2UXBK 5IWAK 4LF6K 3T1HK 4DV3K 1J5EK 4LFAK 2UUCK 1HNWK 4JI3K 1FJGK 3J7YP 4JV5K 4DV0K 1N34K 4DV1K 4AQYK 2HHHK 4JYAK 4X66K 4DR6K 3OTOK 4YHHK 4DR1K 4LF4K 1XNQK 2UUBK 4NXMK 3J80O 4DV5K 3J7AP 2VQEK 4KHPK 1HNXK 4JI1K 4DV7K 5LL6Z 4DR5K 3J81O 1XMQK 2UU9K 4DUZK 4X62K 4LFBK 4YY3K 4DR2K 1N36K 4GKJK 3JAMO 2UUAK 4DR4K 2VQFK 5LMUK 4NXNK 2ZM6K 4JI4K 4B3TK 4X64K 1I94K 3T1YK 2UXDK 5IT9O 1HR0K 4GKKK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC K;  4K0K K;  5LMN K;  4DV6 K;  4LF8 K;  4DV4 K;  4LFC K;  1N33 K;  1IBK K;  4X65 K;  5BR8 K;  4DUY K;  4DV2 K;  2F4V K;  4JI8 K;  5FLX O;  4B3S K;  1IBM K;  4LF9 K;  1HNZ K;  4B3M K;  1XMO K;  4CW7 B;  5AJ3 K;  4B3R K;  1N32 K;  4LF7 K;  5A2Q O;  4DR7 K;  4JI6 K;  4JI5 K;  4V19 S;  4CVN E;  4DR3 K;  2E5L K;  4LF5 K;  1IBL K;  1XNR K;  4JI2 K;  4JI7 K;  4OX9 K;  4JI0 K;  2UXB K;  5IWA K;  4LF6 K;  3T1H K;  4DV3 K;  1J5E K;  4LFA K;  2UUC K;  1HNW K;  4JI3 K;  1FJG K;  3J7Y P;  4JV5 K;  4DV0 K;  1N34 K;  4DV1 K;  4AQY K;  2HHH K;  4JYA K;  4X66 K;  4DR6 K;  3OTO K;  4YHH K;  4DR1 K;  4LF4 K;  1XNQ K;  2UUB K;  4NXM K;  3J80 O;  4DV5 K;  3J7A P;  2VQE K;  4KHP K;  1HNX K;  4JI1 K;  4DV7 K;  5LL6 Z;  4DR5 K;  3J81 O;  1XMQ K;  2UU9 K;  4DUZ K;  4X62 K;  4LFB K;  4YY3 K;  4DR2 K;  1N36 K;  4GKJ K;  3JAM O;  2UUA K;  4DR4 K;  2VQF K;  5LMU K;  4NXN K;  2ZM6 K;  4JI4 K;  4B3T K;  4X64 K;  1I94 K;  3T1Y K;  2UXD K;  5IT9 O;  1HR0 K;  4GKK K; 
#chains in the Genus database with same CATH topology
 4KHY A;  2UXC K;  3DXM B;  3O9U A;  2HOE A;  2A40 A;  1NK8 A;  2YHY A;  3JXU A;  4K41 A;  1BUP A;  3J8A A;  1C1C A;  1SL2 A;  2OYQ A;  5J2N A;  4E89 A;  5EY4 A;  5KRT A;  1EET A;  4KPY A;  4OLB A;  4DV2 K;  4M7Y A;  4WCE L;  4Z94 A;  1T7P A;  3THY B;  2P9L B;  3AVG A;  2QWO A;  4KH5 A;  4KHU A;  4KHQ A;  4B3M K;  1TKZ A;  3VEN A;  3NGZ A;  3LWL A;  2A41 A;  4FM2 A;  3NF8 A;  3RVC A;  2QWL A;  2HST A;  4B9N A;  3PY8 A;  4OPJ A;  3AO1 A;  2HNZ A;  3HK2 A;  4XH1 A;  3GDQ A;  1VQN N;  2XRI A;  4O0J A;  1QSL A;  4IBN A;  1UA0 A;  1YTU A;  4O44 A;  3QB0 A;  3OS1 A;  4KFB A;  3QER A;  4KH4 A;  1HKB A;  4CJW A;  1RTD A;  4DTO A;  4JRQ A;  4BGB A;  2ASO A;  3TAN A;  5M1N A;  1NK7 A;  4B8C A;  1TKD A;  3T69 A;  2P9P A;  4Z4E A;  2VG5 A;  3WT0 A;  4B1Z A;  4CEB A;  1P8Z A;  1VQK N;  3HI0 A;  4FLW A;  5AQF A;  1XQS C;  4MO5 A;  2YNH A;  3A2F A;  2JWL A;  1D9F A;  3QEI A;  1BO5 O;  5KRS A;  1EWQ A;  3KLG A;  2QA4 N;  1TL3 A;  1UWB A;  4GV3 A;  2HNY A;  1TV6 A;  1JLB A;  2YHX A;  4DF8 A;  1DKG D;  4PY5 A;  1HKC A;  3VEZ A;  2PBD A;  1NK6 A;  3KKR A;  4FWO A;  1TAU A;  4NXN K;  4O8U A;  3I8B A;  1SAZ A;  2WUS A;  2O8D B;  1WOQ A;  1UAX A;  4GKK K;  5JMV A;  3H45 C;  2V51 B;  3BGR A;  3HT3 A;  3SAF A;  2WFB A;  4JD2 B;  2D0A A;  2DFE A;  4CZK A;  4DV4 K;  3A8Y A;  4AM6 A;  3CCU N;  1X3M A;  1RT2 A;  2H3G X;  1TGO A;  2HF4 A;  1RDD A;  1Y64 A;  3E66 A;  1V4T A;  3O8M A;  1K6Y A;  3OHR A;  4FZY A;  2E2N A;  4K8Z A;  5J2Q A;  1C0G A;  4PWD A;  1XMO K;  4FW2 A;  2G8F A;  1X9W A;  4AHC A;  1FXX A;  4YOW A;  3BDP A;  5KGX A;  5K14 A;  2XY7 A;  4JI5 K;  1F21 A;  5AQM A;  1VAZ A;  5TKY A;  1RDB A;  2F9T A;  3WXJ A;  2HF3 A;  5F0X A;  4H5W A;  2HHU A;  1QQM A;  2AJQ A;  4GY2 B;  4W5R A;  3AVB A;  3OBY A;  1C6V A;  3U8X A;  4LC9 B;  1T44 A;  1ZBF A;  5CZ2 A;  4CGD A;  2HMP A;  4FW1 A;  3DLL L;  5HBM A;  3QNO A;  4AQY K;  3MEE A;  3K5M A;  2ZGZ A;  2OPQ A;  3O08 A;  4FK4 A;  4K42 A;  4C1N K;  3D2E B;  1OVY A;  3GBT A;  4GW6 A;  4E7K A;  1VQL N;  2D1K A;  5FPE A;  1Q8I A;  4H0X B;  3NH2 A;  2XO7 A;  4EP5 A;  3QFU A;  4E7I A;  3PO5 A;  1ILY A;  1HX1 A;  4B1Y B;  4DV5 K;  1NJX A;  3SI6 A;  4JD2 A;  4YOR A;  4BR4 A;  3CCJ N;  4CJU A;  5J2M A;  1S1W A;  5HRN A;  2F9W A;  1VQ4 N;  3F9K A;  3CXC M;  3THW A;  3NH1 A;  4FM0 A;  5HOO A;  3QEW A;  1ZBL A;  3WEE A;  5CYM A;  1TK8 A;  3V1O A;  4KTZ A;  5KQD A;  1JXE A;  3CC7 N;  2VQF K;  3THV A;  3KLF A;  1JLQ A;  4CEO A;  1NJZ A;  4IOX A;  2UXD K;  3CPE A;  3WNH A;  3K5O A;  3S41 A;  2HB5 A;  4E0D A;  3PSF A;  3I0S A;  4CF0 A;  3HP9 A;  4M45 A;  1ZC6 A;  4JK9 A;  1RBR A;  5GAD P;  1UA1 A;  3LPT A;  4K43 A;  3IAY A;  4CJ3 A;  4FWP A;  4A57 A;  4RW8 A;  4DSL A;  5I3U A;  4DUY K;  2P9U B;  4F2R A;  4GNI A;  3FLC O;  4PL8 A;  1S72 N;  1VQ7 N;  4B3O A;  1HLU A;  2ZWH A;  2RHK A;  2RE2 A;  4EZ9 A;  2O8B A;  3LAM A;  4MDA A;  1OH7 A;  3AVA A;  4W5N A;  5GIO A;  4CK1 A;  3DYA A;  1U48 A;  3ZET B;  3TPQ A;  1WBB A;  3VQ9 A;  4N47 A;  5AQK A;  4B9Q A;  3MN5 A;  1KAZ A;  4OPH A;  5IWA K;  4I2Q A;  4DV3 K;  1J5E K;  3DAW A;  1HMV A;  5MLC Q;  1S1V A;  3SV3 A;  4IO9 L;  2YNG A;  3FZK A;  1FJG K;  1ATN A;  1X3N A;  3ITH A;  1N34 K;  4DSF A;  3OYA A;  2D0P A;  3NVM A;  4PQU A;  3QEV A;  4BR0 A;  2E6L A;  4FJM A;  2E2O A;  3HYF A;  3P31 A;  5BPL A;  3SQ0 A;  2BGG A;  1EXQ A;  2D0C A;  4JK7 A;  3OW2 M;  1JLG A;  4BDZ A;  1SKR A;  2FC0 A;  3AV9 A;  3ZYY X;  2XY5 A;  4FWM A;  3LP0 A;  1BQM A;  2E20 A;  1HQU A;  1KCF A;  1KTQ A;  1HYZ A;  4IDH A;  5M1P A;  4WFA L;  1NMN A;  4M42 A;  1XUP O;  3LDL A;  3MXM A;  1QTM A;  1GOB A;  2KFZ A;  2I7N A;  1WAJ A;  2BAN A;  3ENH A;  4FWK A;  2B6A A;  4E7L A;  4CFB A;  1VSH A;  4DR2 K;  5AR0 A;  4BC4 A;  2FSK A;  3PUF A;  2P9S A;  5KQ8 A;  2Y1J A;  4FJ7 A;  1U04 A;  3L2W A;  2ZM6 K;  2PYJ A;  4FOI A;  1I94 K;  4M3X A;  3O3H A;  1XHX A;  2G8V A;  4IFE A;  4CJP A;  5C15 A;  1WSE A;  3BZK A;  3CQY A;  4QS8 A;  3NF6 A;  4JNE A;  1Z05 A;  4U7B A;  4DTU A;  4B9L A;  4LFC K;  1N33 K;  2O8E B;  3OY9 A;  2F4V K;  3VQ5 A;  2QTD A;  4B3S K;  1E3M A;  3VQ6 A;  1W7A A;  4BY9 C;  3L2Q A;  2E1Z A;  4KRF A;  3T1A A;  4B08 A;  1OKJ A;  4FPA A;  3EY1 A;  2GUI A;  3SYZ A;  5M1Q A;  3NVK A;  4CGI A;  4CZM A;  5HL7 L;  5FPM A;  5AQT A;  3M8R A;  3PO4 A;  4ICL A;  3N4P A;  1NGB A;  2BUP A;  4PKH A;  4Z4F A;  1IH7 A;  1NU0 A;  1M1K O;  4C8L A;  5KTQ A;  4LFA K;  3HRG A;  2ATQ A;  3QFP A;  2P9N B;  4N76 A;  4M3T A;  4N41 A;  3SJJ A;  3AGK A;  1HPM A;  3SBG A;  4BG8 A;  3HP6 A;  2BH1 A;  1RDC A;  4DMN A;  3Q7C A;  2BTF A;  4CBX A;  1C0U A;  1REV A;  3NFA A;  5JLF A;  1VSI A;  2Q0U A;  2G8K A;  3OVN A;  2NRV A;  4CCH A;  4UQG A;  3R3L A;  4LH5 A;  2OPP A;  2G8U A;  1CLQ A;  4CHN A;  3J7A P;  3G25 A;  3TI0 A;  3O1B A;  3OS0 A;  1VK0 A;  4DR5 K;  2P9I B;  1ZBI A;  4BE0 A;  3AO5 A;  4JKB A;  3KLH A;  3EE9 A;  3VET A;  1P90 A;  4KI6 A;  4A5B A;  4IXC A;  3V9X A;  4IOC L;  3SQ2 A;  4JRP A;  3RTV A;  2D4W A;  3A5N C;  3OJS A;  4OJR A;  5AQS A;  1BI4 B;  4DTS A;  1HR0 K;  3VTI A;  3MX2 A;  2Q0R A;  3KTQ A;  2Q2R A;  3F9M A;  4CHO A;  1YIT N;  2W6K A;  3MX5 A;  1SKW A;  3CC4 N;  1H1V A;  3DRS A;  2O4I A;  3AO3 A;  2Z1J A;  4M3Y A;  2EHG A;  2FBX A;  4JKG B;  3WXK A;  4FK2 A;  1VSE A;  4ELT A;  4BRP A;  3VA0 A;  3VEW A;  5I9E B;  2HBM A;  2Y1I A;  3CQ8 A;  5AJ3 K;  4JI6 K;  4V19 S;  4CHP A;  1NKC A;  3H3N O;  4DQR A;  1T05 A;  2HHQ A;  4EAH D;  4AH9 A;  3O4N A;  1GLJ O;  3QML A;  3DXK B;  4LF6 K;  3AA3 A;  1TL1 A;  2YNF A;  2NRR A;  3CM5 A;  4AIL C;  1JL2 A;  4BRQ A;  2A6A A;  1YHQ N;  4PUO A;  4AHR A;  2HHV A;  3MN9 A;  3HOS A;  3K59 A;  1L3T A;  4FJ8 A;  2P9I A;  3TAB A;  4YOU A;  2W6L A;  3G4S N;  2NRX A;  1VSL A;  3E9O A;  4EZ6 A;  3OYL A;  2P5O A;  1HUX A;  4M63 C;  1ASW A;  3KK7 A;  2KHO A;  3HTV A;  2OTJ N;  4QCL A;  3UIQ A;  3LP2 A;  5C42 A;  3DLR A;  3CF5 L;  3AAQ A;  5C12 A;  3ID6 A;  2A5X A;  4NYN A;  3THX A;  3NCI A;  4AM7 A;  3MXI A;  2HHT A;  3CMA N;  4BQL A;  3VEY A;  4YY3 K;  1XWL A;  1U45 A;  4BRI A;  3IFR A;  4HHT A;  3RWU A;  3CCS N;  3C6A A;  3HBT A;  3ATU A;  1X9M A;  4KHN A;  1NMD A;  4AHT A;  4DTM A;  4I9L A;  3ZSV A;  4BE2 A;  4CZI A;  3CYM A;  3U6F A;  3ATV A;  3I33 A;  3AO2 A;  4FLX A;  1Q9Y A;  1S5J A;  5CR4 A;  4AHU A;  5GIN A;  4IFY A;  3TR8 A;  1KC8 O;  4KB0 A;  4ISF A;  2JGU A;  4RW4 A;  4KO0 A;  4WYB A;  2IVN A;  5HRO A;  2P5G A;  4X65 K;  2OPR A;  3U9D A;  3AGR A;  3KK1 A;  3S3M A;  2P9P B;  3UKR A;  1W0H A;  4CF9 A;  1S9G A;  5C24 A;  4A61 A;  1IBM K;  3MAQ A;  3NAE A;  3G6E N;  3NF9 A;  2RKI A;  4CJL A;  3OYH A;  4OKE A;  5M1O A;  4F9O A;  3QBX A;  3AVM A;  1QS4 A;  5M1F A;  1N5Y A;  3CG7 A;  4LF7 K;  4I9Q A;  4YDU A;  3EO3 A;  4IDK A;  1HPZ A;  1VQ9 N;  1Z26 A;  1X9J A;  4OKJ A;  4U67 L;  4OVL A;  1ZBU A;  4KV8 A;  3V9U A;  4BR5 A;  4CEE A;  1WN7 A;  3HSC A;  4CFC A;  3V81 A;  3LAL A;  3LDQ A;  2AA4 A;  5CY4 A;  4BC5 A;  3VQB A;  4DFK A;  4PA1 A;  1L5U A;  3D0P A;  3ZT0 A;  4FJJ A;  2NRW A;  4H0P A;  3R6M A;  1BWF O;  5HRR A;  4O5B A;  1NGC A;  3HL8 A;  3M5R A;  4WQ4 C;  3L2U A;  3VF6 A;  3SMS A;  2X6S A;  3O4W A;  4FJH A;  4JKA A;  3WQT A;  3T7Z A;  1BIZ A;  2EX3 A;  4LF4 K;  3DRR A;  4BRA A;  3ULE A;  3TSP A;  1LW0 A;  4DSE A;  2DFH A;  4M3R A;  1MDU B;  2XY8 A;  3MWT A;  4RCH A;  4DS4 A;  4FVM A;  1KFS A;  4KHP K;  3OBW A;  3P38 A;  4JKF A;  2DPN A;  4FLU A;  4FCY A;  5LL6 Z;  4BWJ A;  5KI6 A;  1GLF O;  1SS6 A;  5AQX A;  2PFU A;  3CCL N;  3L3U A;  4LFB K;  3PX4 A;  4YOT A;  4WQ5 A;  2VGN A;  4B9T A;  5DMR A;  3ASM A;  1YIJ N;  3P5J A;  4CHY A;  2LSN A;  4EHT A;  3T1Y K;  2F8S A;  1I39 A;  5J2P A;  3EKS A;  4AF1 A;  1WUA A;  4FWL A;  1RBS A;  2HBK A;  4FZZ A;  4ELU A;  5AQR A;  3DM2 A;  3GE1 A;  3OYK A;  3A5L C;  3H3O B;  4CGF A;  1BOT O;  1ATR A;  2GWK A;  2B4J A;  2WTU A;  3CER A;  5BR8 K;  4RTF D;  1YJN N;  1GLD G;  3CC2 N;  1LOT B;  3M8S A;  2QWM A;  3O6W A;  3LZI A;  4J2E A;  3LDN A;  3O80 A;  1DT9 A;  2YI1 A;  4B3R K;  2X78 A;  3VQ8 A;  5A2Q O;  3FE1 A;  3ALY A;  3G10 A;  4M3U A;  4CJK A;  5GAG P;  4KH6 A;  1VRT A;  3G71 N;  2X74 A;  3J7Z O;  1IKV A;  4DWI A;  4H03 B;  4QS7 A;  4PKG A;  4FPB A;  3THW B;  1KVC A;  4BE1 A;  4XEI A;  3WEE B;  3KK2 A;  3HJF A;  3V1R A;  3U3G A;  1ZBH A;  2HBL A;  3WUH A;  5JVH L;  4C1N I;  2HW3 A;  1VSM A;  3TAG A;  3I0R A;  2Q3S A;  2KQ2 A;  4YOX A;  4F8R A;  3OTO K;  4DTX A;  4R5P A;  2GTD A;  4BC3 A;  5CZ1 A;  2CGK A;  2YCH A;  1KSP A;  1NGD A;  4NXM K;  3BEX A;  4NLC A;  4F4K A;  4G1Q A;  3M8Q A;  1VQ6 N;  3CI5 A;  3PIP L;  4BDY A;  3H1Q A;  3V9W A;  3C6T A;  1RT6 A;  4ZTF A;  1Q7Y O;  3MDQ A;  2J4R A;  4JI1 K;  1J53 A;  1KRP A;  4KI4 A;  2O8B B;  1VRU A;  3IG1 A;  2ZJR L;  3V6D A;  1EQY A;  4F2S A;  3VQ4 A;  1UOC A;  2NRZ A;  3C65 A;  5B8H A;  3HST B;  3VES A;  1GLE G;  4A62 A;  4Z4I A;  2OZS A;  4BGA A;  1A5X A;  2HVI A;  3VEO A;  1IJJ A;  3CM6 A;  5FRN A;  2F8T A;  4JKH A;  3DLE A;  3WXM B;  4DB3 A;  1ESV A;  3O9T A;  3M8P A;  4KHS A;  1N8R O;  3V4I A;  5AQN A;  3CQX A;  3QET A;  4LF8 K;  4BR9 A;  3CCR N;  3FZH A;  4B1V A;  3SLC A;  1ZYQ A;  2DFF A;  2GEM A;  3LP1 A;  3ZSX A;  4Y0W A;  3NE6 A;  3LDP A;  1IG9 A;  1HJO A;  5SWM A;  4H8K A;  3AA5 X;  5AQZ A;  1QSY A;  1CXU A;  2ASP A;  4CW7 B;  5ADX A;  1YF5 L;  4R79 A;  1SQK A;  2PYL A;  3IKM A;  3DJC A;  4H5V A;  1EKE A;  3ZT4 A;  1HNV A;  4CVN E;  1TYQ A;  1RDU A;  5T7B A;  4CZG A;  2Z1H A;  2PZS A;  4W5Q A;  2D0O A;  4GV9 A;  5C2F A;  1JL1 A;  5AQG A;  4DQ8 A;  3RMA A;  1KAX A;  3DOL A;  2UUC K;  4CER A;  2O4G A;  1RTI A;  5JVG L;  3HVT A;  3V1Q A;  4CES A;  2E1Y A;  4FYD A;  2P9S B;  1NBW A;  3MEG A;  4HWI A;  3VER A;  2HHH K;  1TKT A;  1VSF A;  4DFJ A;  2E8A A;  4NB4 A;  3OS2 A;  4H5R A;  4C8K A;  3IMX A;  1L3S A;  2ASM A;  4C23 A;  3OYJ A;  2P9K A;  3VQQ A;  3MXJ A;  1K73 O;  2HND A;  4XIU A;  3A5O C;  2O8F B;  3LWM A;  5FRM A;  1K8A O;  1QZ6 A;  4M7X A;  3VQ7 A;  2VQE K;  1BHL A;  4H5T A;  1T3V A;  4KHW A;  4CJF A;  5GAH P;  2CH5 A;  2Q31 A;  5KPT A;  3QNN A;  3M3Z A;  4CEZ A;  4CZH A;  4CFA A;  4E19 A;  1V4S A;  3D7E O;  1D8Y A;  4DQI A;  2Q36 A;  2CGJ A;  2HHX A;  3SAH A;  4JI4 K;  4NYF A;  4DFM A;  3TU5 A;  3CJA A;  5BPN A;  3B8A X;  3DLK A;  4GVM A;  1JCF A;  4BVP A;  1NNE A;  5BN9 A;  2YHA A;  1NGG A;  1D4X A;  1HRH A;  1L3V A;  1RIL A;  1D9D A;  4CJ4 A;  1SZ2 A;  2F96 A;  3KLE A;  1HNI A;  1WB9 A;  4WQ5 C;  3UE5 A;  3DLH A;  4HCC A;  3SMP A;  3Q7B A;  4N5S A;  4HUG A;  1K8K B;  1C1B A;  4HVJ A;  5BR9 A;  2YJE A;  1GLA G;  4JHD A;  3OA9 A;  3BZC A;  1WSI A;  2O8C B;  4CJQ A;  4H0V B;  4FL9 A;  1NWK A;  1IG8 A;  3P4I A;  1EX4 A;  4IOA L;  1JLA A;  1NLV A;  3SZ2 A;  3SNN A;  1A5V A;  2FF3 B;  1TAQ A;  2FBT A;  1GLC G;  5JIC A;  3HPH A;  3VOV A;  4BAC A;  2O8F A;  5AZJ A;  2UYT A;  1MU2 A;  1NGE A;  5EVZ A;  1EP4 A;  4HUF A;  1NJI O;  4I7F A;  4OGE A;  3TAF A;  1NGA A;  4FVU A;  3MCA B;  1QZ5 A;  3VF2 A;  3LDS A;  3VF4 A;  1U49 A;  4BRG A;  3CCV N;  2IDO A;  3CHW A;  3KJV A;  3AVL A;  5JS2 A;  1FW6 A;  3HXM A;  4CHZ A;  3TAR A;  3K58 A;  3IDH A;  4CJE A;  1RNH A;  4DTP A;  3CJ9 A;  1NM1 A;  3HO1 A;  1BG3 A;  1NOZ A;  1LCU A;  2QKB A;  2V7Z A;  3D6R A;  4ID5 A;  5ADX H;  4QS9 A;  2IIR A;  1SV5 A;  4FLZ A;  4IJA A;  4DQP A;  2KLA A;  3LM2 A;  1ZBS A;  3WQU A;  4NLB A;  3SV4 A;  5C2D A;  1QHA A;  2YX6 A;  3SBT A;  4X62 K;  4HCB A;  1O13 A;  3MCP A;  1CZA N;  1ASV A;  3AAR A;  2XY6 A;  3UKU A;  1VSJ A;  1K8K A;  4MQ3 A;  4W5O A;  3QLH A;  4DR4 K;  1WAF A;  4FSV A;  3CJ7 A;  3PSI A;  5BN8 A;  2HHW A;  4H0O A;  2O8C A;  3LAN A;  1BQN A;  2E6M A;  2IOC A;  3FR0 A;  4ISE A;  5AFU A;  5IT9 O;  2IAJ A;  1JLF A;  4FXD A;  1WSJ A;  4CZE A;  1CZB A;  4YFU A;  4E1M A;  1I3A A;  3PX6 A;  1JKH A;  1JXB A;  1S22 A;  3C94 A;  3RMB A;  1YJ9 N;  2VCP A;  1IBK K;  1ZXO A;  3AO4 A;  3TAP A;  5EX5 A;  2E4L A;  4JN4 A;  5AZI A;  5BRE A;  4MFB A;  4JI8 K;  5EU7 A;  3CFR A;  1WSF A;  1NKE A;  2FSN A;  2VG7 A;  2VWJ A;  3CFO A;  4JK8 A;  4KKO A;  2QKK A;  4DR3 K;  2E5L K;  4DG1 A;  1QVG M;  1IBL K;  1G15 A;  1VHX A;  4LH4 A;  4JI2 K;  1Y97 A;  4OX9 K;  4BR7 A;  1JCE A;  3THX B;  3T1H K;  4GVE A;  1WBD A;  3SAG A;  3VN5 A;  3NBP A;  4DKW A;  3LAK A;  3IS9 A;  4M3Z A;  4CK2 A;  4A59 A;  3SPZ A;  1J6Z A;  2FBY A;  4DU3 A;  3U3Y A;  4DV0 K;  1LWE A;  2CGL A;  2FLO A;  3CIP A;  2ZJQ L;  3MN6 A;  2FSJ A;  1LWF A;  3E9L A;  3ENB A;  4J2B A;  2WON A;  4A2A A;  2OPS A;  1BIS A;  2DTU A;  2OTL N;  4IEI A;  4DR6 K;  3CJ1 A;  1U6Z A;  1IKW A;  4CJS A;  3KWG A;  5J1E A;  1X1P A;  5CYQ A;  3WNG A;  2V7Y A;  5JLH A;  5M1K A;  1Q81 O;  1R0A A;  4ILJ A;  4FJX A;  3MN7 A;  3JS6 A;  3NH0 A;  5F2R A;  1OH6 A;  2KZZ A;  3UKR B;  2A1R A;  3VQA A;  1NKB A;  4UY8 O;  4H4O A;  4BRD A;  4CJR A;  3J81 O;  1XMQ K;  3MK6 A;  4BRC A;  4ILG B;  4JKD A;  4BVO A;  4L8R B;  3CJB A;  3HM9 A;  3ZSR A;  2Q1N A;  1WSH A;  4WFB L;  4FJK A;  1IV0 A;  3ZX0 A;  1XI1 A;  1LWC A;  1EO1 A;  1BU6 O;  3KZB A;  2ZJP L;  4DU4 A;  4OPK A;  4B9V A;  3B6P A;  1C0F A;  2G8H A;  4WFN L;  4FJL A;  5HRS A;  4FO0 A;  1KD1 O;  2QXF A;  4FK0 A;  4Z0U A;  3H08 A;  1S9E A;  4CK3 A;  4BRH A;  4KBO A;  3QIN A;  1RGI A;  4FWQ A;  3PX0 A;  2GX9 A;  3NDK A;  1BCM A;  5AQV A;  4B9U A;  4Y1C A;  2CH6 A;  1KAY A;  3MMV A;  1HQE A;  1LW2 A;  4JKC A;  1NK0 A;  3FGU A;  2ZGY A;  4RW6 A;  3ULE B;  4ILH A;  2PY5 A;  1NG9 A;  1WSG A;  1N6Q A;  4IKF A;  2QXL A;  1MA9 B;  5EOY A;  3EN9 A;  1XNR K;  3L4Q A;  3ID8 A;  3PIO L;  3T3F A;  5LJV A;  1T03 A;  3RRH A;  1E4G T;  4AHS A;  1D5A A;  3D45 A;  4CGG A;  3P83 D;  2G8W A;  5AFU H;  3M6G A;  4TSX A;  4DU1 A;  1SKS A;  3J7Y P;  4BRL A;  3CET A;  3WXI A;  5LY3 A;  5F1X A;  3LDO A;  1MWM A;  2VG6 A;  3R8E A;  4ZHR A;  2HBJ A;  4CD3 A;  1RBU A;  3KWI A;  4JAX A;  1HKG A;  2QWR A;  3EZW A;  3SPY A;  1U2V B;  4YHH K;  3I55 N;  3ZT2 A;  3AA4 A;  4CIE A;  2UUB K;  2E2P A;  4YOV A;  3OYM A;  1RT7 A;  2W41 A;  3LP3 A;  4LD0 A;  4Z4C A;  3DI6 A;  4BRO A;  3OJU A;  1QQC A;  3RR7 A;  3HVR A;  3W0L A;  1RDA A;  3CCE N;  4DF4 A;  4KB1 A;  3QIP A;  2IGI A;  4LY7 A;  4FLV A;  1KLM A;  3FZF A;  3B6O A;  4FLT A;  5E26 A;  4K25 A;  2UUA K;  1R59 O;  2OZM A;  3OYD A;  3QEX A;  4IWV A;  1RTH A;  4O5F A;  1HYS A;  1Q9X A;  1KLN A;  1DTQ A;  2RF2 A;  1SL1 A;  3ZSY A;  2HHS A;  3ZSQ A;  4ELV A;  3HZ6 A;  4CBU A;  4GV6 A;  1C0M A;  4HTU A;  3SK3 A;  2VGM A;  3K0S A;  1BA1 A;  4CJ7 A;  4FJ5 A;  1GLB G;  3S3N A;  4FZX C;  3TSU A;  5CHI A;  1RT4 A;  3RSE B;  3L8B A;  5BRF A;  4K8X A;  2A42 A;  5GIP A;  4JKE A;  3O9R A;  4I6M A;  5AQO A;  4Z4G A;  1BIU A;  1T6D A;  1TVR A;  2P1J A;  2ZQB A;  1RFQ A;  3UB5 A;  2IVP A;  1T6C A;  1BGX T;  1N32 K;  4FWN A;  4O8K A;  3CCQ N;  3AVJ A;  1IO2 A;  4DQQ A;  1U2V A;  1C0T A;  1IKY A;  1S1X A;  2Q97 A;  4B1W B;  3QES A;  3SUO A;  4A2B A;  1NK4 A;  4EHU A;  2UXB K;  3C0B A;  3AAP A;  1YAG A;  3K9J A;  1LAW A;  3TSQ A;  3ENO A;  4EIA A;  2QI2 A;  3A0I X;  2ZF5 O;  3ULD A;  4CED A;  4CHQ A;  3DXM A;  3TAE A;  4KTW A;  3MWP A;  1HNW K;  3QIO A;  4FJ9 A;  3O9S A;  4EP4 A;  3AVH A;  2KFN A;  3DWL A;  1JLE A;  1KFD A;  4IG3 A;  3K5N A;  3AVN A;  5AQH A;  1ATS A;  2VWB A;  3BY5 A;  4O0I A;  3OYG A;  1T8E A;  3THY A;  4FLY A;  2P9L A;  4MLE A;  4CE9 A;  1HJR A;  2OCE A;  4CF8 A;  3O1W A;  4FOE A;  4C8O A;  5DM7 L;  2IS3 A;  1FK9 A;  3K2P A;  3AVI A;  4CI6 A;  2XHB A;  2PAV A;  5FPN A;  3KD1 E;  3SQ1 A;  1X9S A;  1YVN A;  2JLE A;  4FWR A;  2KW4 A;  1LV5 A;  3C6H A;  2QWN A;  1Z25 A;  1O1W A;  4O4G A;  2BE2 A;  2E88 A;  4DSJ A;  4PHT X;  4DUZ K;  3RSE A;  4CGJ A;  1J54 A;  4B8A B;  3E1Y A;  2WC9 A;  3QDK A;  3L2R A;  3OYB A;  3TAM A;  2GV9 A;  1BL3 A;  3WXL A;  4GKJ K;  5H1S Q;  5LMU K;  1A5W A;  3GOI A;  1TYQ B;  3SUQ A;  3HPO A;  1YVU A;  4DFP A;  4BRE A;  5AQQ A;  3PLA A;  1YUW A;  3FFK B;  4IG0 A;  3VMF B;  3R1X A;  4BRK A;  4H5N A;  4OGC A;  4ZTJ A;  4Y1D A;  3VGM A;  1JCG A;  5C0Y A;  1TUU A;  3CME N;  2RPI A;  5FPD A;  4CBW A;  1IKX A;  3EE8 A;  5AQY A;  4PKI A;  4FM1 A;  5DM6 L;  2X6N A;  3AY9 A;  4J2A A;  5I42 A;  1XC9 A;  5FLX O;  3F73 A;  4OKK A;  1U4B A;  4H0Y B;  4E7J A;  2P9K B;  1OH5 A;  2F7T A;  4Z4H A;  2NRT A;  1FKP A;  3O5B A;  4LF5 K;  4BG9 A;  4N56 A;  4BRM A;  4IJN A;  4LSL A;  3RR8 A;  5BRD A;  2O8D A;  4FJN A;  1EWR A;  4OPA A;  3OYF A;  3CJC A;  3PV8 A;  1S3X A;  3VEV A;  5SZT A;  4B9S A;  4WE1 A;  4DHY A;  3OYE A;  4JV5 K;  5HP1 A;  1S6P A;  3AVC A;  3G0Z A;  5AQP A;  3CCM N;  3WNE A;  1GOC A;  5AQW A;  1B9D A;  3TAQ A;  3SQ4 A;  3L0Q A;  1LAV A;  1S1U A;  2A3Z A;  4QAG A;  1Q86 O;  4DR1 K;  4JS5 A;  1XNQ K;  1NGI A;  3W3D A;  1U47 A;  3J80 O;  3CPW M;  1NGF A;  3I8D A;  4JEP A;  2I5J A;  1BDG A;  3L3V A;  2QW9 A;  1RCH A;  2W40 A;  3LL3 A;  4BWM A;  2ETJ A;  3I56 N;  1JLC A;  3QO9 A;  4JHD B;  4I2P A;  4KTQ A;  3SUP A;  4YDU C;  4DS5 A;  2IC3 A;  3GL1 A;  2YKN A;  4CEA A;  3K5L A;  5KPZ A;  4H0T B;  3O3F A;  1KVA A;  3ZLJ A;  3NF7 A;  1NGJ A;  4OLA A;  4WF9 L;  4CIF A;  4CZF A;  3R9P A;  5AZJ B;  4B1U B;  2ZE2 A;  3D2E A;  3V9Z A;  3VQP A;  4AHV A;  2QM1 A;  3DMJ A;  4M41 A;  2AP1 A;  5LMN K;  5C25 A;  3ZT3 A;  5TKW A;  4DV6 K;  2IVO A;  3ZCM A;  1G99 A;  3D2F B;  3L4I A;  3TWH A;  4NCA A;  4DTR A;  2NNW A;  1OH8 A;  2GUP A;  2YHB A;  5AQL A;  4E1N A;  3AVK A;  5LJW A;  4F3T A;  1J9A A;  4IEE A;  2DY4 A;  3OYI A;  1QQO A;  4CFD A;  4RWT A;  1VQP N;  4LF9 K;  2KZM A;  3FZM A;  3VEX A;  5KPR A;  2RN2 A;  4O55 A;  3S9H A;  2ITG A;  4XH4 A;  3DRP A;  2V52 B;  4DR7 K;  4DLG A;  5GAE P;  1YT3 A;  1RBT A;  5C10 A;  1SUQ A;  4JI7 K;  4JI0 K;  2P51 A;  5ELZ A;  2KTQ A;  1ITG A;  1TKX A;  2NZT A;  1WNS A;  2D0B A;  3UKU B;  3KHY A;  2WOM A;  3K9K A;  3C6U A;  2YHW A;  1YXQ A;  4DV1 K;  2Z1G A;  1KQS M;  3H6E A;  2VWK A;  2P9U A;  3FFI A;  5FRO A;  4CZL A;  4CIG A;  3EYZ A;  3L6Q A;  5DK5 A;  3EEQ A;  4CJT A;  3KK3 A;  4JS4 A;  1YTA A;  4RW9 A;  1RBV A;  2G8I A;  1RT5 A;  3ZET A;  3FZL A;  5AZI B;  3IRX A;  2HVH A;  3D2F A;  3VA3 A;  3QBW A;  1QHT A;  1M90 O;  3TTD A;  1J5O A;  1KXP A;  4NCB A;  3JAM O;  4BRF A;  1QQN A;  1DTT A;  3HM8 A;  3QEP A;  1YI2 N;  4BDP A;  1VQO N;  4DTJ A;  4B3T K;  3JYT A;  3AVF A;  4DLE A;  4M3W A;  4JLH A;  3N4Q A;  3O9Q A;  1E4F T;  3CD6 N;  1RDW X;  3NMU A;  2QWQ A;  1VQM N;  4KRE A;  4HTL A;  5AQI A;  2GBZ A;  3VQE A;  4WQ4 A;  1DLO A;  2A1S A;  1B92 A;  1DGK N;  5D3G A;  2VYP A;  5CE3 A;  4XH5 A;  3S3O A;  2YV0 X;  3SCX A;  5JS1 A;  4E1J A;  1QE1 A;  2B5J A;  1TK5 A;  1XC3 A;  5BPM A;  4ID1 A;  3NGY A;  3WNF A;  3DLB A;  3VGL A;  2WBN A;  3LPU A;  2FBV A;  3VQD A;  1Q18 A;  3VGK A;  2YNI A;  3AA2 A;  2QWP A;  1QSS A;  1NK5 A;  3KD5 E;  1GLL O;  1VQ8 N;  4FWS A;  4A5A A;  5E84 A;  1BCO A;  3C7N B;  2I7P A;  3M1F A;  3O4Q A;  3KKS A;  3JSM A;  3ZSZ A;  3DLG A;  3QIC A;  4IFV A;  4JI3 K;  4CF2 A;  5E41 A;  5BRH A;  2E2Q A;  3OYN A;  3RRG A;  3SJH A;  4BRN A;  4JYA K;  2O8E A;  1VSK A;  4YOY A;  4LSN A;  1GOA A;  4C8N A;  2QEX N;  1W9H A;  4B9M A;  4NO7 A;  1VSD A;  3L2V A;  4F3O A;  4CJ5 A;  2YJF A;  3EZ5 A;  3A5M C;  4B1X B;  3MED A;  3OYC A;  1NGH A;  4BC2 A;  3EKU A;  1YJW N;  2D5R A;  1TK0 A;  3LM9 A;  1HYV A;  4DSK A;  2NLX A;  1HNX K;  3LZJ A;  3BF1 A;  3SUN A;  1VQ5 N;  5AQJ A;  4KAZ A;  3ZT1 A;  5HRP A;  3V9S A;  4FJI A;  2UU9 K;  2NUB A;  1XHZ A;  3GG4 A;  3T19 A;  1JJ2 M;  2P9N A;  4YNQ A;  3E01 A;  3P1G A;  3P39 A;  3ISN C;  1RT3 A;  3ZEU B;  3H1V X;  1S6Q A;  3IUC A;  5EXW A;  4CZJ A;  4X64 K;  4W5T A;  4DQS A;  4H4M A;  2BDP A;  1NOY A;  3H46 O;  4NCG A;  1WLJ A;  2OA8 A;  1SL0 A;  1CZ9 A;  4K0K K;  1DEJ A;  2JWK A;  3U4L A;  2HMI A;  4GMJ B;  4RW7 A;  4DSI A;  4OO1 J;  3RMD A;  3C7N A;  3HOT A;  4G9Z A;  3E9P A;  3CFP A;  3BP8 A;  2KKZ A;  3U9Z A;  2EWS A;  3NHG A;  3ZSW A;  3VQC A;  2ZD1 A;  1HNZ K;  1ASU A;  4CEF A;  4HUE A;  2FXU A;  4CEQ A;  4CEC A;  5KGW A;  4CD1 A;  4E7H A;  1RTJ A;  1Z6R A;  3RMC A;  2FF6 A;  2ITM A;  4BR2 A;  3NGI A;  1K9M O;  1BI4 A;  4MLH A;  1NJW A;  1S1T A;  4E3S A;  1W97 L;  4QOZ B;  1QVF M;  4MDB A;  4CF1 A;  2YKM A;  5FDL A;  4CGH A;  4X66 K;  4Q0B A;  1C1A A;  4JKG A;  1L3U A;  4DCH A;  3EL2 A;  3ZX2 A;  4C8M A;  4DTN A;  3F5T A;  3K57 A;  2R7Y A;  1CXQ A;  3ZEU A;  3C95 A;  1RT1 A;  4CJV A;  3KIO A;  4FJG A;  3TTF A;  4Q5V A;  1Q82 O;  1NK9 A;  2QK9 A;  3O3G A;  1B9F A;  3HPG A;  3KLI A;  3DOK A;  3F2K A;  1TUY A;  1W2B M;  4J8F A;  3ZX3 A;  4PL7 A;  3MEC A;  4IO8 A;  2NRH A;  2GEL A;  4I6M B;  4DV7 K;  3DXK A;  4MO4 A;  4ISG A;  1OVQ A;  2W42 A;  2GWJ A;  1NJY A;  3VPZ A;  4BQZ A;  1N36 K;  5HLF A;  3KVG A;  2OAN A;  3BF3 A;  4IZ9 A;  3VTH A;  3BUZ B;  2Z1I A;  1BA0 A;  4J2D A;  1FKO A;  4EFH A;  1KVB A;  5AQU A;  4RG8 A;  4L3Q A;  1MWK A;  3TTC A;  3ZSO A; 
#chains in the Genus database with same CATH homology
 2UXC K;  4K0K K;  5LMN K;  4DV6 K;  4LF8 K;  4DV4 K;  4LFC K;  1N33 K;  1IBK K;  4X65 K;  5BR8 K;  4DUY K;  4DV2 K;  2F4V K;  4JI8 K;  5FLX O;  4B3S K;  1IBM K;  4LF9 K;  1HNZ K;  4B3M K;  1XMO K;  4CW7 B;  5AJ3 K;  4B3R K;  1N32 K;  4LF7 K;  5A2Q O;  4DR7 K;  4JI6 K;  4JI5 K;  4V19 S;  4CVN E;  4DR3 K;  2E5L K;  4LF5 K;  1IBL K;  1XNR K;  4JI2 K;  4JI7 K;  4OX9 K;  4JI0 K;  2UXB K;  5IWA K;  4LF6 K;  3T1H K;  4DV3 K;  1J5E K;  4LFA K;  2UUC K;  1HNW K;  4JI3 K;  1FJG K;  3J7Y P;  4JV5 K;  4DV0 K;  1N34 K;  4DV1 K;  4AQY K;  2HHH K;  4JYA K;  4X66 K;  4DR6 K;  3OTO K;  4YHH K;  4DR1 K;  4LF4 K;  1XNQ K;  2UUB K;  4NXM K;  3J80 O;  4DV5 K;  3J7A P;  2VQE K;  4KHP K;  1HNX K;  4JI1 K;  4DV7 K;  5LL6 Z;  4DR5 K;  3J81 O;  1XMQ K;  2UU9 K;  4DUZ K;  4X62 K;  4LFB K;  4YY3 K;  4DR2 K;  1N36 K;  4GKJ K;  3JAM O;  2UUA K;  4DR4 K;  2VQF K;  5LMU K;  4NXN K;  2ZM6 K;  4JI4 K;  4B3T K;  4X64 K;  1I94 K;  3T1Y K;  2UXD K;  5IT9 O;  1HR0 K;  4GKK K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...