4GKKK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4gkkK00
2UUCK 4K0KK 4AQYK 2HHHK 4JI3K 4X64K 4JI8K 4DR5K 4DR7K 4JI0K 4V19S 4YY3K 4JI4K 5FLXO 4DR3K 1FJGK 4X66K 2UXDK 4LFAK 4DR4K 4LF5K 4CVNE 4LF4K 4JI5K 3J7YP 1IBKK 4GKKK 1IBMK 5BR8K 1XMQK 2UUBK 1HNZK 4DUYK 2E5LK 1HNXK 4LF6K 4DV3K 4LFCK 1HR0K 4GKJK 4JYAK 4JV5K 5AJ3K 5LL6Z 4DUZK 1XMOK 4LF7K 4B3RK 4X65K 5A2QO 4DV7K 4KHPK 4NXMK 4LF8K 4DR6K 3T1HK 1XNQK 5IWAK 4YHHK 1IBLK 1J5EK 1N34K 5LMNK 4JI1K 4DV0K 2UUAK 4B3SK 4LFBK 2UXBK 2VQFK 3J80O 4DV1K 4JI2K 2UXCK 4DV5K 3J81O 1N36K 2VQEK 1N33K 3OTOK 4JI7K 5LMUK 4B3TK 4DV4K 3J7AP 3T1YK 1XNRK 1I94K 1N32K 4LF9K 4DV2K 4NXNK 4OX9K 2ZM6K 4CW7B 1HNWK 5IT9O 2UU9K 4DR1K 4B3MK 4DR2K 4X62K 2F4VK 4JI6K 3JAMO 4DV6K
chains in the Genus database with same CATH superfamily
3M5RA 3HPGA 3VESA 3CCSN 4AQYK 2NLXA 1NK8A 1BIZA 3B8AX 1R59O 4G1QA 4JN4A 1BISA 4RWTA 3NF6A 4J2BA 2YX6A 1L3UA 3TANA 5AQNA 3CC4N 2HHSA 4BR2A 3CJ1A 4H4MA 4X66K 3QB0A 5F1XA 4DLGA 3E9PA 3OYEA 2EWSA 2O4GA 3ZT1A 3C7NB 3IAYA 5KPRA 2OPSA 1NK4A 1VSHA 4DU1A 1C1BA 3ID6A 3UKRB 3NH1A 1OKJA 3G10A 3LALA 2NRZA 3LDPA 3O8MA 3VA3A 1YF5L 2A6AA 2OCEA 3FLCO 4BQZA 1RBTA 3MAQA 4FZXC 2GUIA 3QEVA 3QINA 1RGIA 3E1YA 4N41A 1XWLA 3DM2A 3FFKB 4L3QA 3SMPA 4HTLA 4CJEA 3EYZA 2HHTA 3P5JA 1YVUA 1Q82O 3JSMA 3HYFA 1LCUA 4BROA 3RSEA 3NCIA 1ZBSA 4IOCL 3KWIA 3U9ZA 2GEMA 1Y64A 4DB3A 2A1RA 4BRDA 4FJJA 3K57A 1S6QA 2E88A 1SL2A 1JLFA 5LY3A 3K59A 4PKGA 4H5NA 3VETA 3DOKA 1IH7A 5AZJB 3VQPA 4Z4EA 3A2FA 3RWUA 1IG9A 4QS9A 4ILJA 1JLEA 1QS4A 1X3NA 4FCYA 5I9EB 3LZJA 3IKMA 4NYFA 5EXWA 3TSQA 4DQRA 4RG8A 2BH1A 3LAKA 3ZT2A 1BQNA 3KLIA 3CERA 4DR2K 4IG3A 1VSMA 2XY6A 4FJKA 3BDPA 3ALYA 3M6GA 4B1UB 3QEWA 3VGKA 3SZ2A 4K8XA 1DLOA 2NRRA 2CGLA 3ENOA 3TSUA 2EX3A 3DLKA 4CGGA 3AV9A 3M8SA 3VEWA 2IDOA 3DXKA 3PIPL 4MO4A 3IS9A 2IS3A 4B8AB 2HVHA 2D0AA 3QICA 4LC9B 3R1XA 4YOVA 4DS5A 4ELVA 4B9VA 3D0PA 3GG4A 4DSFA 2NRXA 3VEYA 4CJ4A 3MN7A 4IEIA 2X6NA 1LWCA 3F5TA 3ZX0A 3O4QA 4KH5A 1XC9A 4PUOA 1OH5A 3VQBA 3K9JA 1QZ6A 3FZLA 3V6DA 4QS7A 4XEIA 3MWPA 4YFUA 4B3RK 3CETA 4WCEL 2GX9A 3CM5A 2D1KA 2RHKA 5A2QO 4C1NK 3NGYA 4NXMK 3J7ZO 4O55A 1SUQA 2ITMA 3ZSVA 2P9PA 4YOXA 3RTVA 1NGCA 1LAWA 4ELUA 4C1NI 2Z1IA 3CJBA 3QEIA 1Z05A 3RRHA 4NCBA 2W41A 3U3YA 3VGLA 3GE1A 4H0XB 5F0XA 5AQJA 3LP3A 3G71N 1J5OA 4I6MB 1EWQA 1VQ4N 3AVFA 4Q0BA 3TAMA 5AQQA 2FC0A 4MDBA 3VQ7A 5KTQA 1GLFO 4CZHA 4W5QA 1YXQA 2OZSA 3IUCA 2VWKA 3AVBA 4JD2A 4IG0A 4DV2K 1TKZA 1H1VA 4K43A 3K9KA 2O8FB 1REVA 4GVMA 2O8BB 1G15A 4H0YB 4PL8A 4IDKA 3OYMA 4KRFA 1VQ9N 4GY2B 2KW4A 1EETA 4LD0A 3O4WA 4FM1A 4DR5K 3HP6A 2GELA 4MLHA 4NLCA 4MO5A 4JRPA 3CMAN 1UAXA 4OKKA 1VQ8N 2E2PA 1HJOA 3AVIA 4LFAK 3S3NA 1WSGA 4LF5K 4CVNE 1S1WA 3AAPA 4B1ZA 5M1KA 4FJMA 3MDQA 1HYZA 3IRXA 1KLNA 1NGEA 5BR8K 3I0SA 2QTDA 3C7NA 3A5NC 5ADXH 3MXJA 1ASUA 1BL3A 4KH4A 1RTHA 4A59A 3QDKA 4FWRA 4Z4FA 3HO1A 4BVPA 1FKOA 2E6MA 2HHQA 2NRWA 5CR4A 3F9MA 4E7LA 3THWB 1KCFA 3QBWA 1ILYA 4DV7K 4BR7A 2P9SB 4DWIA 4BG8A 4IFYA 2OPQA 2JWLA 2FSKA 4ISFA 2FBXA 3HBTA 4H0VB 1MWKA 5FPNA 3P38A 3VQEA 2KKZA 3KVGA 4CZJA 1B9FA 4QS8A 3MX5A 4DV1K 4M3UA 1TV6A 1C1AA 3NH0A 2QWOA 4GV9A 3A8YA 4CHOA 3M8RA 4B1XB 1CZBA 1HLUA 1CZ9A 3TWHA 3OTOK 5AQZA 4W5OA 3EKUA 1XNRK 2QWMA 3WXKA 1I94K 4BVOA 4JHDA 5KI6A 1T05A 4I2PA 1UOCA 2O8DB 3ZEUA 3TABA 3BGRA 4KAZA 2QKBA 3C0BA 5BRHA 1A5WA 1YAGA 1SV5A 3WNHA 3TARA 1EQYA 1VSDA 1GLJO 1TAUA 1RBRA 1HKBA 2F9TA 4ILGB 3H1QA 1RT4A 2NUBA 2RPIA 2A3ZA 3LPTA 3P39A 5C0YA 4Z4CA 3MXIA 4DG1A 3HZ6A 1E4GT 4BRMA 3ZSYA 3RSEB 3HRGA 1R0AA 4DFKA 2I7NA 2B5JA 4CJ5A 1HNZK 1TK5A 1JL1A 3TAEA 2O8CA 5KGXA 1Q9XA 3U3GA 3CCQN 1WN7A 4M7YA 4FVUA 5SZTA 1IKYA 4CHQA 1A5VA 2QW9A 3MX2A 4GW6A 5LJVA 4DUZK 2D4WA 4FO0A 2VCPA 4FM2A 4H0OA 2I7PA 1BQMA 1TKDA 3ENHA 3DLHA 1BI4B 3UKUB 4CESA 1VQKN 2BGGA 2VG5A 5FROA 3NH2A 4KPYA 5GIPA 3O1WA 2HNYA 1VSFA 4ID5A 4IO9L 4BRLA 3NGZA 4FK0A 4M3YA 1B9DA 4OGCA 4MFBA 2W40A 1SQKA 4CBUA 4BRHA 3EY1A 4J2EA 2KZZA 4C8KA 4BR5A 1RTIA 3VF4A 1N36K 5BRFA 2HB5A 4FJLA 4Y0WA 2VG6A 1KVAA 4FL9A 4CGHA 4NXNK 2QWLA 4CW7B 4R79A 1ZBFA 4FW1A 3H46O 1U6ZA 4CZKA 3E9LA 1YTAA 1NKCA 1YITN 1C0GA 2XRIA 4GVEA 1XI1A 3BF3A 4FYDA 4RW7A 3V9UA 3T3FA 2F9WA 2YJFA 1P8ZA 5HRRA 2OPRA 4A2BA 2E6LA 3V9WA 1QZ5A 1HQEA 3L8BA 1NG9A 3L3VA 4FWKA 3AVGA 2UUBK 4FW2A 3O3FA 2GV9A 2W6LA 3OYJA 4CJFA 2P51A 1HNXK 4KHUA 4IOXA 4J2DA 3VN5A 3KK1A 4WFBL 3IDHA 4PQUA 3KLEA 1TAQA 3WNGA 3W3DA 3KLHA 1WSHA 1VQ5N 1RBSA 4AHUA 1TK8A 3PX6A 3A5MC 1L5UA 3KLGA 4N56A 2O8BA 3AVHA 1NK6A 3I8BA 4FJ9A 4DTRA 1VRUA 3RRGA 4M3WA 2RF2A 3J8AA 4O44A 4LFBK 1QQOA 1GLDG 3PV8A 1T8EA 4O5BA 3GL1A 4CERA 5GAHP 1C0MA 4N5SA 3VTIA 4EAHD 3RR7A 5HP1A 3H3OB 5M1OA 1U04A 2AP1A 3D7EO 4DFPA 1JCEA 3ZT0A 1T03A 5J2NA 4YOUA 4LF9K 4OX9K 4FWPA 2ZM6K 3HL8A 4E1MA 5BN9A 4EHTA 1K9MO 3TU5A 1S5JA 4WFNL 2CGJA 5DK5A 3U6FA 1YJWN 5JLFA 4OPAA 3VEVA 3EL2A 4K0KK 5CY4A 3A5OC 4X64K 5JLHA 1S22A 1UWBA 4JI4K 1GLAG 3KWGA 4ISGA 4HUGA 3CI5A 4A5AA 4HUEA 4FK2A 3AAQA 5AQWA 1KAZA 2OANA 4JKAA 4XH4A 5AQFA 3WXJA 4YOWA 2Q1NA 1TGOA 4JK7A 4O8KA 4AHTA 5C15A 2HF3A 1NK0A 3EEQA 4FWQA 2E1YA 1K73O 3Q7BA 3F73A 2QXFA 4CBWA 4NCGA 4PKHA 1YJNN 3PSFA 3CHWA 3HK2A 4AF1A 1B92A 3THYB 3OBYA 4LFCK 3SNNA 3LP2A 2E2OA 1JLBA 3K58A 3DI6A 4FWNA 4B9SA 4M42A 4F3OA 3AVJA 4YNQA 1NOYA 3O1BA 4JK9A 3MCPA 2ZE2A 1W9HA 2DFEA 2E2QA 3QERA 4BDPA 2FBTA 4YHHK 4E1NA 3NGIA 3PO5A 1LV5A 3H6EA 2G8IA 2Q36A 2IVPA 3NBPA 2ZGZA 4CHZA 4UQGA 1F21A 2VWBA 4IEEA 4OKEA 3TI0A 1QVGM 3CFRA 5FRNA 4E0DA 4CEEA 2VQFK 3QO9A 3LM9A 2P9PB 1W97L 2ZJRL 1DTTA 3SI6A 3OYGA 1T3VA 1RT5A 3V9XA 1KC8O 2OTJN 5BN8A 2HBMA 3SBTA 2RE2A 5JVHL 1JJ2M 3O6WA 3SUQA 3QNNA 1ZC6A 3V1QA 2B4JA 3EN9A 1N32K 4ZTFA 3SAHA 1ZBLA 2P9IA 3TTDA 4JKGA 1Z25A 4E89A 3SV4A 2RKIA 4I9LA 3ZLJA 3KKRA 3AY9A 1VQON 4H4OA 4AM7A 2HMPA 2F4VK 4WFAL 2P9UB 3JAMO 2QKKA 3DXMB 1ATRA 2PZSA 2UUCK 3R3LA 5KPTA 4H5VA 3C6UA 2GBZA 3DRPA 1YVNA 1U49A 1CLQA 2YNIA 2B6AA 3G6EN 2ASPA 3TTFA 2YHYA 1S72N 3N4PA 3RMCA 1X9MA 4E7HA 2VG7A 3L6QA 2LSNA 1NBWA 3VEOA 3THYA 3OA9A 1BGXT 1QSLA 1CXUA 3GOIA 3NVMA 1TK0A 1QVFM 1JXBA 4O0IA 1GLBG 4EFHA 1WSEA 3CCLN 4G9ZA 2DFHA 4WQ4C 4LSNA 1LWFA 3EE8A 4CZIA 4LF6K 4DV3K 4DTUA 4BRCA 1WSIA 4FJNA 3BP8A 2YNGA 4R5PA 3ZSQA 4IDHA 5FPEA 5HL7L 3LWLA 2ASMA 1NOZA 2Y1JA 2DFFA 4AHRA 1MDUB 4OLAA 1NGIA 3L4QA 2QK9A 3ULEB 2HNZA 3M8PA 2OTLN 2AJQA 1O13A 1OH7A 1X1PA 2Z1HA 4JK8A 1J6ZA 1RCHA 4CF2A 1EX4A 4FJGA 1ASVA 2Y1IA 2HF4A 3SLCA 4JS4A 2HW3A 5DM7L 4A57A 4IWVA 3I0RA 5TKWA 2YKMA 1HX1A 3CF5L 4FJ5A 1KVBA 2QWNA 1BCOA 1N5YA 3ZETB 3KLFA 5GAEP 3MN9A 4KO0A 4W5RA 3NMUA 2A41A 3QNOA 2WOMA 2P9IB 3CJAA 4PWDA 3NF9A 4CJSA 4FLVA 3NVKA 3DRRA 3G0ZA 4EZ6A 1RFQA 1XHZA 4RW6A 5LMUK 1TL1A 4E7KA 4DQIA 4DQQA 2O8DA 3AO3A 4CZGA 4CF8A 2XY8A 3ASMA 3NHGA 4K25A 4K41A 4OO1J 2P9LB 3IMXA 4B9QA 4DV6K 5F2RA 4I9QA 5B8HA 5KQDA 4ZTJA 2FF6A 5JMVA 2PAVA 4CF1A 4FZYA 3OYDA 3QFPA 1V4SA 1SAZA 4CZFA 2QA4N 5EU7A 1NK5A 3CXCM 4AHSA 5JS1A 2HHXA 2GWJA 5CZ2A 1QE1A 2IAJA 4JI5K 3VQ8A 5AQHA 5E41A 3I8DA 3PX0A 4JKGB 2DTUA 4KREA 2E20A 3CC2N 4F3TA 4MDAA 1Q8IA 5HRPA 3QESA 3ULEA 3VQ4A 4BR0A 4FLZA 1NGJA 4JYAK 2ZWHA 3G4SN 5AQYA 1ZBHA 3U4LA 4BREA 5AQTA 1XMOK 5D3GA 2WBNA 2D5RA 3D45A 3PSIA 1NJXA 3CPWM 2Z1GA 3O80A 4H5TA 4X65K 4DQ8A 1ITGA 4E7JA 1KQSM 3VQ5A 1W7AA 4FWSA 4HVJA 1Q9YA 4KHPK 4M3ZA 1OH8A 3OS0A 1QQMA 4OKJA 1C1CA 2QXLA 1YI2N 1BDGA 3WXLA 3DLEA 1J5EK 4JI1K 4NYNA 1RDAA 4DV0K 2UXBK 1BHLA 4BR4A 3TPQA 3TAGA 3KKSA 3ATUA 1RDWX 5AQXA 3HVRA 1RBUA 5K14A 3VEXA 3ULDA 3J81O 4KH6A 1JXEA 4HWIA 4DU4A 4FOEA 4F4KA 5M1QA 2YKNA 4E19A 1S3XA 4IOAL 3HSCA 1VQ6N 5C2DA 3SJJA 2G8VA 5C25A 5C2FA 3L4IA 3OYHA 3DLBA 4BC4A 5HROA 3DJCA 3VF2A 3BF1A 5CYQA 3CFOA 3HM9A 4C8LA 1C0UA 2HHHK 4BDYA 4DMNA 1TL3A 4JI8K 3CQYA 3OYAA 1D9DA 1DT9A 4JI0K 4PA1A 3VQ6A 3LDLA 1WAFA 3U8XA 2JGUA 4YY3K 1ZXOA 1DEJA 1S1TA 4CGJA 3CQ8A 4Z4GA 3U9DA 2CH6A 4LF4K 4JS5A 4DQSA 2ETJA 5JICA 3KIOA 4GKKK 3L2QA 4C8NA 3AGRA 4J2AA 3HVTA 3KHYA 3DLRA 4FJIA 3FGUA 3DLLL 1RTDA 3LWMA 1WB9A 3OYKA 1BO5O 4WE1A 1WSFA 3F9KA 5GAGP 4LSLA 4FPBA 4M3XA 3H3NO 4BRAA 4I6MA 1RT2A 4EHUA 3WUHA 4CD1A 3R6MA 1HNIA 3AVKA 4OJRA 3VENA 2ZJQL 5JS2A 1NGBA 3ZSZA 3K5OA 2IIRA 4C8MA 2YHXA 5AQMA 5EX5A 3SQ2A 4CFAA 2ZD1A 4RW4A 3EE9A 2KQ2A 5IWAK 1DKGD 2P9SA 2NRHA 2NRTA 2YV0X 4XH5A 2YNFA 4F2RA 2KFZA 4DSKA 5C42A 3NE6A 2ASOA 5AQSA 3MWTA 4JI2K 1IO2A 4FWLA 4KTZA 3WNFA 2QWPA 4DFMA 4E3SA 1YUWA 3ISNC 1BCMA 1OH6A 4B3TK 1EO1A 3OY9A 3M1FA 1U2VA 2KZMA 3O9UA 2G8WA 1KTQA 4JEPA 4CJWA 1KVCA 2P1JA 3K0SA 1HNWK 1JCGA 2ATQA 3HTVA 1SL0A 4DR1K 3CCJN 2UYTA 4B8CA 1K8AO 1NKEA 2PFUA 1NMNA 1D5AA 3C95A 1VSLA 4JKHA 3DMJA 4KHWA 3AO2A 3L3UA 4JRQA 3AA3A 4B08A 3S3MA 4EZ9A 4CGIA 2A40A 3LPUA 3OJUA 2KTQA 3SAFA 5BREA 1RILA 1YHQN 4CZLA 1YTUA 5FLXO 1VSJA 1N6QA 2NNWA 4DR3K 4CHNA 4M3RA 1VSKA 2ZGYA 4YOTA 4EIAA 4BE2A 4DR4K 1GLLO 5J2QA 1VSIA 3RVCA 3J7YP 4DSJA 4KI4A 3RMBA 1S1UA 3PY8A 3AA5X 3DLGA 1T6DA 1VQLN 4HCCA 5FPMA 1E4FT 4YOYA 3SJHA 5ELZA 3K5MA 2O8CB 3BUZB 3V1OA 4CEOA 3MMVA 2IVOA 2OA8A 2HHVA 1S6PA 5AQLA 4Z94A 5AQIA 2YNHA 4CEBA 4F8RA 1C0FA 1Q81O 2F8TA 3KD1E 4CJUA 3SQ0A 3TSPA 4KB0A 3C65A 1WUAA 4RCHA 2VGNA 3ATVA 3DAWA 4DCHA 4BE1A 4JKFA 1ATSA 2UUAK 4Z4HA 2Z1JA 1SKSA 1TUUA 3NFAA 4CI6A 4CEAA 1HKCA 1WBBA 1K8KA 3AGKA 2UXCK 4B9TA 2CGKA 3K2PA 5ADXA 4PKIA 3VTHA 4HTUA 5AFUA 2Q3SA 1KAXA 1BG3A 4ILHA 2E1ZA 3O3GA 3J7AP 3QFUA 4CCHA 3NAEA 1JKHA 3FR0A 4CK3A 3MCAB 4KHNA 5HOOA 4OPKA 3D6RA 4Y1DA 3KK2A 1HKGA 3BY5A 3LDQA 4FM0A 1NLVA 3P4IA 4WQ5A 4JI6K 1L3SA 1GLCG 3S3OA 3I56N 5I3UA 4YDUC 3HOSA 4DFJA 4JI3K 1X9JA 3H08A 2JLEA 3C6AA 2E8AA 2HBKA 3ENBA 4M7XA 4BGBA 3JXUA 4FLUA 3VQQA 1X9WA 2BANA 1ZYQA 5J2PA 2WFBA 4YDUA 2PYLA 1IJJA 1BA0A 3SPYA 1EP4A 1U4BA 1WOQA 2ZQBA 2UXDK 4K42A 1M1KO 3ZT3A 4JKCA 5TKYA 4I2QA 2A42A 1U47A 3AVLA 3V9ZA 1E3MA 4CJQA 4PHTX 5AZIB 1LWEA 1VQ7N 1WLJA 3RR8A 5FRMA 1G99A 1JLQA 4DHYA 4BC2A 2HBJA 3F2KA 5AJ3K 4BR9A 4KHYA 5AR0A 1A5XA 3OS2A 5SWMA 4OLBA 3O08A 3N4QA 2PBDA 3CJ9A 4CJVA 2HBLA 5CYMA 1NM1A 3SV3A 4DR6K 3SUPA 3LZIA 4A2AA 1TKTA 4IXCA 4CF9A 5KPZA 4IKFA 3HT3A 5H1SQ 3EKSA 3OYNA 2H3GX 1NGAA 3CCVN 3K5LA 3KK7A 3AO5A 3FZKA 5BPNA 4UY8O 3PX4A 2FSJA 4IFVA 2HVIA 3R8EA 2RN2A 1ZBUA 4B9UA 4DV5K 4KHQA 2KLAA 1U2VB 3SPZA 5M1PA 1CXQA 4DTPA 2V7YA 3QEPA 1HPMA 5GINA 1HNVA 4H5RA 4BY9C 2GTDA 3SQ4A 2VWJA 2BE2A 3THXB 1BA1A 3CYMA 5IT9O 4AM6A 2X78A 4CHPA 3UKRA 4CEZA 4X62K 3KD5E 3CQXA 1QHAA 4NB4A 1D9FA 3LDNA 3ZSOA 1SL1A 5J1EA 4AILC 1JLCA 3W0LA 4LH4A 1C0TA 1XC3A 3RMDA 3MEDA 1YJ9N 3I33A 1HYVA 1HMVA 3ZX3A 1BOTO 4DSLA 5BPMA 1D4XA 4NO7A 5C24A 3SK3A 3HP9A 4HUFA 3MN5A 3O9SA 3ZT4A 2X6SA 2GWKA 1I3AA 3QBXA 2XO7A 3FZHA 5BRDA 4JAXA 4CIGA 2A5XA 1IG8A 5AFUH 3AO1A 1Q7YO 4A61A 3E66A 3QETA 1JL2A 2FXUA 3LL3A 5J2MA 4DF4A 4CJRA 3EO3A 1BI4A 4RTFD 5LL6Z 3UKUA 2CH5A 3KJVA 3SUNA 4CEDA 4WF9L 4LF7K 1WBDA 2QWQA 3EZWA 1EXQA 1YIJN 3CMEN 3DRSA 1FK9A 1QTMA 2DY4A 2O8EA 3FFIA 2NRVA 1ATNA 3AVCA 4FLTA 3EZ5A 5AQGA 4KBOA 2NZTA 3C6TA 2JWKA 5LJWA 4DU3A 3QIPA 4GV3A 3ID8A 4PY5A 2O8EB 4MQ3A 1X9SA 4CZEA 1JCFA 3J80O 1KFDA 4ID1A 1RT6A 1S1XA 2QM1A 3MEEA 3AARA 2WUSA 3CCUN 2YCHA 4Z4IA 3D2EB 1W0HA 4FZZA 2VQEK 5M1NA 4C23A 4OPHA 3L0QA 4FPAA 2P9LA 4HCBA 2WC9A 2I5JA 4CECA 3O9QA 3P1GA 5EOYA 3PO4A 4OPJA 4W5NA 1VSEA 4RW9A 3UB5A 3ZX2A 4FLXA 4WQ4A 4Y1CA 5DM6L 4CD3A 2G8KA 4BWMA 1BIUA 1NGHA 3V4IA 4CFCA 1SS6A 4B1VA 4FXDA 2PY5A 1VK0A 1UA1A 4BDZA 1T6CA 4B1WB 2YHWA 1MWMA 3I55N 3V1RA 1JLAA 3VQAA 4FK4A 3THVA 3TAQA 1FJGK 1GOBA 1FXXA 3OVNA 2A1SA 3ZSRA 3VF6A 1IBKK 3TAFA 1IV0A 1V4TA 4I7FA 4CJPA 1HYSA 3P31A 4JHDB 4CIFA 3D2FB 1DGKN 3DXKB 1BWFO 3VGMA 1IKXA 3CFPA 1IKVA 3VEZA 3K5NA 3VMFB 1YT3A 4DUYK 1XHXA 1M90O 1OVQA 3FZMA 4BRFA 3TAPA 3Q7CA 3C94A 3VOVA 1K8KB 4EP5A 3CIPA 2J4RA 3ZSWA 2VYPA 1XQSC 4BRQA 3A0IX 4IZ9A 2QEXN 4DSIA 4KI6A 3O3HA 4BRIA 4KB1A 1NGFA 3VQCA 4JKEA 3ZYYX 4XH1A 4JLHA 1KAYA 4BACA 2HHWA 3CCRN 3CC7N 1QHTA 4AHVA 3M8QA 3GDQA 1NGDA 1I39A 5FPDA 4BRPA 4CJTA 1ASWA 1HPZA 2F8SA 1N34K 4BRKA 1LOTB 4B3SK 5KRTA 3OYIA 5CZ1A 3MN6A 4B1YB 1VQMN 3VERA 1L3TA 4L8RB 1Z6RA 1BU6O 3CJCA 1KD1O 3WXMB 4BC3A 1UA0A 4A5BA 1NJYA 3WXIA 1Q18A 3T69A 1JLGA 4B3OA 5KGWA 4FJHA 4IJAA 1IKWA 3SAGA 2EHGA 5GIOA 2E2NA 1RDCA 1ZBIA 5HBMA 4BC5A 1VHXA 1TYQA 2D0PA 3B6OA 4DTJA 3NDKA 2WTUA 1SKRA 3SBGA 4DS4A 3GBTA 4H8KA 2G8FA 3WEEA 3AVNA 3AVMA 3ITHA 1LW0A 4TSXA 3M3ZA 1XUPO 3PLAA 1NJWA 3PUFA 1FW6A 2DPNA 2KHOA 3LDSA 4V19S 3AVAA 1S9GA 2P9UA 2BDPA 2ZF5O 3DXMA 4FJ7A 1T7PA 4KTQA 3LDOA 4WQ5C 1QSYA 1KRPA 3T1AA 2Q0UA 1KXPA 4QAGA 4CK2A 4CIEA 3VPZA 5HRNA 3SMSA 4NLBA 4YORA 1RT1A 4MLEA 4Q5VA 3CG7A 2GUPA 3LP1A 3FZFA 4CE9A 2FLOA 5AQRA 3HJFA 2E4LA 1SZ2A 2G8HA 3O9TA 1U48A 3VQ9A 1NJZA 2V52B 3L2RA 4M3TA 1J53A 1SKWA 1NK7A 4OVLA 2FBVA 2HHUA 3HI0A 3WQUA 4DQPA 4LF8K 4K8ZA 4BRGA 5AQPA 4FWOA 2ITGA 2PYJA 4CFBA 2IVNA 5E26A 1U45A 3D2FA 2O4IA 3OJSA 3L2VA 1IBLK 5AZJA 4DTXA 3CPEA 1GOAA 4DTOA 4DTSA 4AH9A 2BTFA 5LMNK 1NMDA 5DMRA 3THWA 2QI2A 2P5OA 3H45C 4JKDA 1J9AA 1C6VA 3OYLA 2BUPA 1VQPN 3LP0A 4KV8A 3P83D 2Q97A 4BE0A 4IJNA 1TYQB 3JYTA 5E84A 3LAMA 4KHSA 1MU2A 4A62A 2AA4A 3E9OA 1NK9A 2FSNA 5BPLA 4DV4K 3T1YK 1HUXA 1GOCA 2YI1A 4O4GA 4DLEA 3KK3A 1HJRA 4FWMA 5CE3A 5M1FA 3DOLA 4JD2B 1TUYA 1WAJA 1S1VA 1TVRA 3T7ZA 2QWRA 4KKOA 1WNSA 3MECA 2FBYA 2V7ZA 3VQDA 5AQVA 4N47A 1D8YA 4LY7A 1RBVA 4KFBA 4E7IA 3NF8A 1BUPA 5KQ8A 1X3MA 3SCXA 3SUOA 1O1WA 1RDDA 4N76A 2YHAA 3CCEN 3ZCMA 3IFRA 3HPHA 3RMAA 4LH5A 4C8OA 3A5LC 1IBMK 4H03B 4XIUA 2FF3B 4J8FA 4BGAA 2P9NB 4H0PA 3OBWA 1J54A 4CEQA 5KRSA 5T7BA 2R7YA 3WEEB 3CD6N 1NJIO 1DTQA 2Q31A 1HQUA 1K6YA 2P9NA 3MK6A 2OPPA 5EVZA 3BZCA 3HOTA 4GMJB 3DWLA 4WYBA 4DF8A 2G8UA 4B9LA 3AA4A 4EP4A 3OW2M 4JNEA 2VGMA 2F96A 1RDBA 3CCMN 2V51B 5C10A 5MLCQ 4DSEA 1OVYA 4ISEA 4CZMA 2X74A 4ICLA 3CJ7A 1T44A 3QMLA 4O0JA 3R9PA 3SYZA 4OGEA 1QQCA 1NWKA 1NGGA 3KZBA 4DKWA 3V81A 1FKPA 3HPOA 1VQNN 2YHBA 1NU0A 2ZJPL 1RDUA 3AO4A 2HNDA 1S9EA 1P90A 3IG1A 5AQKA 1Y97A 2HOEA 1QSSA 2KFNA 1GLEG 3FE1A 4FJXA 1TKXA 4CFDA 3PIOL 3UIQA 3L2UA 5C12A 4FOIA 5CHIA 1MA9B 1RNHA 4ELTA 2Q0RA 1RT3A 3HM8A 4H0TB 4IO8A 3AA2A 3QEXA 3HSTB 1EKEA 1LW2A 3HXMA 4B9NA 5BR9A 4CGDA 3QLHA 5AQUA 5EY4A 2IC3A 4O5FA 4CJKA 3G25A 1RTJA 1VAZA 2YJEA 2W42A 3OYCA 3B6PA 4B9MA 2HSTA 4DR7K 4DTNA 3LANA 4IFEA 3C6HA 4W5TA 4FJ8A 3E01A 4HHTA 4CJ7A 5JVGL 1L3VA 4FVMA 2XY5A 4QCLA 1KFSA 5AZIA 4ZHRA 4BQLA 3NF7A 3KTQA 4CGFA 3O4NA 4PL7A 4E1JA 4FSVA 4IBNA 1XMQK 1VRTA 4F9OA 4QOZB 3OYBA 2E5LK 4O8UA 4NCAA 5GADP 3SQ1A 1HR0K 1NNEA 4GKJK 4GV6A 4M45A 4RW8A 4JV5K 4U7BA 5AQOA 5I42A 2HMIA 1CZAN 1KSPA 2W6KA 4H5WA 2D0CA 3V9SA 3OHRA 2XY7A 1Q86O 2IGIA 1WSJA 3S41A 3BEXA 2WONA 3UE5A 4CF0A 3ZETA 3T19A 3OS1A 4F2SA 4M63C 4KTWA 4FLYA 3T1HK 1XNQK 5FDLA 4CK1A 3TR8A 1KLMA 4FLWA 1W2BM 3DYAA 2OYQA 3S9HA 1LAVA 3H1VX 2P9KB 4GNIA 3JS6A 4Z0UA 3O9RA 3CM6A 4BG9A 2Q2RA 2D0BA 4JKBA 3OYFA 4DTMA 5HRSA 1EWRA 1N8RO 4AHCA 2P9KA 4BRNA 3WQTA 1NKBA 1RT7A 2OZMA 3THXA 3WNEA 1N33K 1ESVA 4U67L 3BZKA 2P5GA 2F7TA 3L2WA 4JI7K 3MXMA 3TTCA 4CHYA 2O8FA 2XHBA 3ZEUB 5HLFA 4CJLA 4BWJA 3D2EA 4CBXA 3ZSXA 2D0OA 3QIOA 1HRHA 1Z26A 3VA0A 1QQNA 4CJ3A 4CEFA 3O5BA 2UU9K 3MEGA 4B3MK 2IOCA 4M41A 3LM2A 3WT0A
chains in the Genus database with same CATH topology
2UUCK 4K0KK 4AQYK 2HHHK 4JI3K 4X64K 4JI8K 4DR5K 4DR7K 4JI0K 4V19S 4YY3K 4JI4K 5FLXO 4DR3K 1FJGK 4X66K 2UXDK 4LFAK 4DR4K 4LF5K 4CVNE 4LF4K 4JI5K 3J7YP 1IBKK 4GKKK 1IBMK 5BR8K 1XMQK 2UUBK 1HNZK 4DUYK 2E5LK 1HNXK 4LF6K 4DV3K 4LFCK 1HR0K 4GKJK 4JYAK 4JV5K 5AJ3K 5LL6Z 4DUZK 1XMOK 4LF7K 4B3RK 4X65K 5A2QO 4DV7K 4KHPK 4NXMK 4LF8K 4DR6K 3T1HK 1XNQK 5IWAK 4YHHK 1IBLK 1J5EK 1N34K 5LMNK 4JI1K 4DV0K 2UUAK 4B3SK 4LFBK 2UXBK 2VQFK 3J80O 4DV1K 4JI2K 2UXCK 4DV5K 3J81O 1N36K 2VQEK 1N33K 3OTOK 4JI7K 5LMUK 4B3TK 4DV4K 3J7AP 3T1YK 1XNRK 1I94K 1N32K 4LF9K 4DV2K 4NXNK 4OX9K 2ZM6K 4CW7B 1HNWK 5IT9O 2UU9K 4DR1K 4B3MK 4DR2K 4X62K 2F4VK 4JI6K 3JAMO 4DV6K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC K;  4K0K K;  4AQY K;  2HHH K;  4JI3 K;  4X64 K;  4JI8 K;  4DR5 K;  4DR7 K;  4JI0 K;  4V19 S;  4YY3 K;  4JI4 K;  5FLX O;  4DR3 K;  1FJG K;  4X66 K;  2UXD K;  4LFA K;  4DR4 K;  4LF5 K;  4CVN E;  4LF4 K;  4JI5 K;  3J7Y P;  1IBK K;  4GKK K;  1IBM K;  5BR8 K;  1XMQ K;  2UUB K;  1HNZ K;  4DUY K;  2E5L K;  1HNX K;  4LF6 K;  4DV3 K;  4LFC K;  1HR0 K;  4GKJ K;  4JYA K;  4JV5 K;  5AJ3 K;  5LL6 Z;  4DUZ K;  1XMO K;  4LF7 K;  4B3R K;  4X65 K;  5A2Q O;  4DV7 K;  4KHP K;  4NXM K;  4LF8 K;  4DR6 K;  3T1H K;  1XNQ K;  5IWA K;  4YHH K;  1IBL K;  1J5E K;  1N34 K;  5LMN K;  4JI1 K;  4DV0 K;  2UUA K;  4B3S K;  4LFB K;  2UXB K;  2VQF K;  3J80 O;  4DV1 K;  4JI2 K;  2UXC K;  4DV5 K;  3J81 O;  1N36 K;  2VQE K;  1N33 K;  3OTO K;  4JI7 K;  5LMU K;  4B3T K;  4DV4 K;  3J7A P;  3T1Y K;  1XNR K;  1I94 K;  1N32 K;  4LF9 K;  4DV2 K;  4NXN K;  4OX9 K;  2ZM6 K;  4CW7 B;  1HNW K;  5IT9 O;  2UU9 K;  4DR1 K;  4B3M K;  4DR2 K;  4X62 K;  2F4V K;  4JI6 K;  3JAM O;  4DV6 K; 
#chains in the Genus database with same CATH topology
 3M5R A;  3HPG A;  3VES A;  3CCS N;  4AQY K;  2NLX A;  1NK8 A;  1BIZ A;  3B8A X;  1R59 O;  4G1Q A;  4JN4 A;  1BIS A;  4RWT A;  3NF6 A;  4J2B A;  2YX6 A;  1L3U A;  3TAN A;  5AQN A;  3CC4 N;  2HHS A;  4BR2 A;  3CJ1 A;  4H4M A;  4X66 K;  3QB0 A;  5F1X A;  4DLG A;  3E9P A;  3OYE A;  2EWS A;  2O4G A;  3ZT1 A;  3C7N B;  3IAY A;  5KPR A;  2OPS A;  1NK4 A;  1VSH A;  4DU1 A;  1C1B A;  3ID6 A;  3UKR B;  3NH1 A;  1OKJ A;  3G10 A;  3LAL A;  2NRZ A;  3LDP A;  3O8M A;  3VA3 A;  1YF5 L;  2A6A A;  2OCE A;  3FLC O;  4BQZ A;  1RBT A;  3MAQ A;  4FZX C;  2GUI A;  3QEV A;  3QIN A;  1RGI A;  3E1Y A;  4N41 A;  1XWL A;  3DM2 A;  3FFK B;  4L3Q A;  3SMP A;  4HTL A;  4CJE A;  3EYZ A;  2HHT A;  3P5J A;  1YVU A;  1Q82 O;  3JSM A;  3HYF A;  1LCU A;  4BRO A;  3RSE A;  3NCI A;  1ZBS A;  4IOC L;  3KWI A;  3U9Z A;  2GEM A;  1Y64 A;  4DB3 A;  2A1R A;  4BRD A;  4FJJ A;  3K57 A;  1S6Q A;  2E88 A;  1SL2 A;  1JLF A;  5LY3 A;  3K59 A;  4PKG A;  4H5N A;  3VET A;  3DOK A;  1IH7 A;  5AZJ B;  3VQP A;  4Z4E A;  3A2F A;  3RWU A;  1IG9 A;  4QS9 A;  4ILJ A;  1JLE A;  1QS4 A;  1X3N A;  4FCY A;  5I9E B;  3LZJ A;  3IKM A;  4NYF A;  5EXW A;  3TSQ A;  4DQR A;  4RG8 A;  2BH1 A;  3LAK A;  3ZT2 A;  1BQN A;  3KLI A;  3CER A;  4DR2 K;  4IG3 A;  1VSM A;  2XY6 A;  4FJK A;  3BDP A;  3ALY A;  3M6G A;  4B1U B;  3QEW A;  3VGK A;  3SZ2 A;  4K8X A;  1DLO A;  2NRR A;  2CGL A;  3ENO A;  3TSU A;  2EX3 A;  3DLK A;  4CGG A;  3AV9 A;  3M8S A;  3VEW A;  2IDO A;  3DXK A;  3PIP L;  4MO4 A;  3IS9 A;  2IS3 A;  4B8A B;  2HVH A;  2D0A A;  3QIC A;  4LC9 B;  3R1X A;  4YOV A;  4DS5 A;  4ELV A;  4B9V A;  3D0P A;  3GG4 A;  4DSF A;  2NRX A;  3VEY A;  4CJ4 A;  3MN7 A;  4IEI A;  2X6N A;  1LWC A;  3F5T A;  3ZX0 A;  3O4Q A;  4KH5 A;  1XC9 A;  4PUO A;  1OH5 A;  3VQB A;  3K9J A;  1QZ6 A;  3FZL A;  3V6D A;  4QS7 A;  4XEI A;  3MWP A;  4YFU A;  4B3R K;  3CET A;  4WCE L;  2GX9 A;  3CM5 A;  2D1K A;  2RHK A;  5A2Q O;  4C1N K;  3NGY A;  4NXM K;  3J7Z O;  4O55 A;  1SUQ A;  2ITM A;  3ZSV A;  2P9P A;  4YOX A;  3RTV A;  1NGC A;  1LAW A;  4ELU A;  4C1N I;  2Z1I A;  3CJB A;  3QEI A;  1Z05 A;  3RRH A;  4NCB A;  2W41 A;  3U3Y A;  3VGL A;  3GE1 A;  4H0X B;  5F0X A;  5AQJ A;  3LP3 A;  3G71 N;  1J5O A;  4I6M B;  1EWQ A;  1VQ4 N;  3AVF A;  4Q0B A;  3TAM A;  5AQQ A;  2FC0 A;  4MDB A;  3VQ7 A;  5KTQ A;  1GLF O;  4CZH A;  4W5Q A;  1YXQ A;  2OZS A;  3IUC A;  2VWK A;  3AVB A;  4JD2 A;  4IG0 A;  4DV2 K;  1TKZ A;  1H1V A;  4K43 A;  3K9K A;  2O8F B;  1REV A;  4GVM A;  2O8B B;  1G15 A;  4H0Y B;  4PL8 A;  4IDK A;  3OYM A;  4KRF A;  1VQ9 N;  4GY2 B;  2KW4 A;  1EET A;  4LD0 A;  3O4W A;  4FM1 A;  4DR5 K;  3HP6 A;  2GEL A;  4MLH A;  4NLC A;  4MO5 A;  4JRP A;  3CMA N;  1UAX A;  4OKK A;  1VQ8 N;  2E2P A;  1HJO A;  3AVI A;  4LFA K;  3S3N A;  1WSG A;  4LF5 K;  4CVN E;  1S1W A;  3AAP A;  4B1Z A;  5M1K A;  4FJM A;  3MDQ A;  1HYZ A;  3IRX A;  1KLN A;  1NGE A;  5BR8 K;  3I0S A;  2QTD A;  3C7N A;  3A5N C;  5ADX H;  3MXJ A;  1ASU A;  1BL3 A;  4KH4 A;  1RTH A;  4A59 A;  3QDK A;  4FWR A;  4Z4F A;  3HO1 A;  4BVP A;  1FKO A;  2E6M A;  2HHQ A;  2NRW A;  5CR4 A;  3F9M A;  4E7L A;  3THW B;  1KCF A;  3QBW A;  1ILY A;  4DV7 K;  4BR7 A;  2P9S B;  4DWI A;  4BG8 A;  4IFY A;  2OPQ A;  2JWL A;  2FSK A;  4ISF A;  2FBX A;  3HBT A;  4H0V B;  1MWK A;  5FPN A;  3P38 A;  3VQE A;  2KKZ A;  3KVG A;  4CZJ A;  1B9F A;  4QS8 A;  3MX5 A;  4DV1 K;  4M3U A;  1TV6 A;  1C1A A;  3NH0 A;  2QWO A;  4GV9 A;  3A8Y A;  4CHO A;  3M8R A;  4B1X B;  1CZB A;  1HLU A;  1CZ9 A;  3TWH A;  3OTO K;  5AQZ A;  4W5O A;  3EKU A;  1XNR K;  2QWM A;  3WXK A;  1I94 K;  4BVO A;  4JHD A;  5KI6 A;  1T05 A;  4I2P A;  1UOC A;  2O8D B;  3ZEU A;  3TAB A;  3BGR A;  4KAZ A;  2QKB A;  3C0B A;  5BRH A;  1A5W A;  1YAG A;  1SV5 A;  3WNH A;  3TAR A;  1EQY A;  1VSD A;  1GLJ O;  1TAU A;  1RBR A;  1HKB A;  2F9T A;  4ILG B;  3H1Q A;  1RT4 A;  2NUB A;  2RPI A;  2A3Z A;  3LPT A;  3P39 A;  5C0Y A;  4Z4C A;  3MXI A;  4DG1 A;  3HZ6 A;  1E4G T;  4BRM A;  3ZSY A;  3RSE B;  3HRG A;  1R0A A;  4DFK A;  2I7N A;  2B5J A;  4CJ5 A;  1HNZ K;  1TK5 A;  1JL1 A;  3TAE A;  2O8C A;  5KGX A;  1Q9X A;  3U3G A;  3CCQ N;  1WN7 A;  4M7Y A;  4FVU A;  5SZT A;  1IKY A;  4CHQ A;  1A5V A;  2QW9 A;  3MX2 A;  4GW6 A;  5LJV A;  4DUZ K;  2D4W A;  4FO0 A;  2VCP A;  4FM2 A;  4H0O A;  2I7P A;  1BQM A;  1TKD A;  3ENH A;  3DLH A;  1BI4 B;  3UKU B;  4CES A;  1VQK N;  2BGG A;  2VG5 A;  5FRO A;  3NH2 A;  4KPY A;  5GIP A;  3O1W A;  2HNY A;  1VSF A;  4ID5 A;  4IO9 L;  4BRL A;  3NGZ A;  4FK0 A;  4M3Y A;  1B9D A;  4OGC A;  4MFB A;  2W40 A;  1SQK A;  4CBU A;  4BRH A;  3EY1 A;  4J2E A;  2KZZ A;  4C8K A;  4BR5 A;  1RTI A;  3VF4 A;  1N36 K;  5BRF A;  2HB5 A;  4FJL A;  4Y0W A;  2VG6 A;  1KVA A;  4FL9 A;  4CGH A;  4NXN K;  2QWL A;  4CW7 B;  4R79 A;  1ZBF A;  4FW1 A;  3H46 O;  1U6Z A;  4CZK A;  3E9L A;  1YTA A;  1NKC A;  1YIT N;  1C0G A;  2XRI A;  4GVE A;  1XI1 A;  3BF3 A;  4FYD A;  4RW7 A;  3V9U A;  3T3F A;  2F9W A;  2YJF A;  1P8Z A;  5HRR A;  2OPR A;  4A2B A;  2E6L A;  3V9W A;  1QZ5 A;  1HQE A;  3L8B A;  1NG9 A;  3L3V A;  4FWK A;  3AVG A;  2UUB K;  4FW2 A;  3O3F A;  2GV9 A;  2W6L A;  3OYJ A;  4CJF A;  2P51 A;  1HNX K;  4KHU A;  4IOX A;  4J2D A;  3VN5 A;  3KK1 A;  4WFB L;  3IDH A;  4PQU A;  3KLE A;  1TAQ A;  3WNG A;  3W3D A;  3KLH A;  1WSH A;  1VQ5 N;  1RBS A;  4AHU A;  1TK8 A;  3PX6 A;  3A5M C;  1L5U A;  3KLG A;  4N56 A;  2O8B A;  3AVH A;  1NK6 A;  3I8B A;  4FJ9 A;  4DTR A;  1VRU A;  3RRG A;  4M3W A;  2RF2 A;  3J8A A;  4O44 A;  4LFB K;  1QQO A;  1GLD G;  3PV8 A;  1T8E A;  4O5B A;  3GL1 A;  4CER A;  5GAH P;  1C0M A;  4N5S A;  3VTI A;  4EAH D;  3RR7 A;  5HP1 A;  3H3O B;  5M1O A;  1U04 A;  2AP1 A;  3D7E O;  4DFP A;  1JCE A;  3ZT0 A;  1T03 A;  5J2N A;  4YOU A;  4LF9 K;  4OX9 K;  4FWP A;  2ZM6 K;  3HL8 A;  4E1M A;  5BN9 A;  4EHT A;  1K9M O;  3TU5 A;  1S5J A;  4WFN L;  2CGJ A;  5DK5 A;  3U6F A;  1YJW N;  5JLF A;  4OPA A;  3VEV A;  3EL2 A;  4K0K K;  5CY4 A;  3A5O C;  4X64 K;  5JLH A;  1S22 A;  1UWB A;  4JI4 K;  1GLA G;  3KWG A;  4ISG A;  4HUG A;  3CI5 A;  4A5A A;  4HUE A;  4FK2 A;  3AAQ A;  5AQW A;  1KAZ A;  2OAN A;  4JKA A;  4XH4 A;  5AQF A;  3WXJ A;  4YOW A;  2Q1N A;  1TGO A;  4JK7 A;  4O8K A;  4AHT A;  5C15 A;  2HF3 A;  1NK0 A;  3EEQ A;  4FWQ A;  2E1Y A;  1K73 O;  3Q7B A;  3F73 A;  2QXF A;  4CBW A;  4NCG A;  4PKH A;  1YJN N;  3PSF A;  3CHW A;  3HK2 A;  4AF1 A;  1B92 A;  3THY B;  3OBY A;  4LFC K;  3SNN A;  3LP2 A;  2E2O A;  1JLB A;  3K58 A;  3DI6 A;  4FWN A;  4B9S A;  4M42 A;  4F3O A;  3AVJ A;  4YNQ A;  1NOY A;  3O1B A;  4JK9 A;  3MCP A;  2ZE2 A;  1W9H A;  2DFE A;  2E2Q A;  3QER A;  4BDP A;  2FBT A;  4YHH K;  4E1N A;  3NGI A;  3PO5 A;  1LV5 A;  3H6E A;  2G8I A;  2Q36 A;  2IVP A;  3NBP A;  2ZGZ A;  4CHZ A;  4UQG A;  1F21 A;  2VWB A;  4IEE A;  4OKE A;  3TI0 A;  1QVG M;  3CFR A;  5FRN A;  4E0D A;  4CEE A;  2VQF K;  3QO9 A;  3LM9 A;  2P9P B;  1W97 L;  2ZJR L;  1DTT A;  3SI6 A;  3OYG A;  1T3V A;  1RT5 A;  3V9X A;  1KC8 O;  2OTJ N;  5BN8 A;  2HBM A;  3SBT A;  2RE2 A;  5JVH L;  1JJ2 M;  3O6W A;  3SUQ A;  3QNN A;  1ZC6 A;  3V1Q A;  2B4J A;  3EN9 A;  1N32 K;  4ZTF A;  3SAH A;  1ZBL A;  2P9I A;  3TTD A;  4JKG A;  1Z25 A;  4E89 A;  3SV4 A;  2RKI A;  4I9L A;  3ZLJ A;  3KKR A;  3AY9 A;  1VQO N;  4H4O A;  4AM7 A;  2HMP A;  2F4V K;  4WFA L;  2P9U B;  3JAM O;  2QKK A;  3DXM B;  1ATR A;  2PZS A;  2UUC K;  3R3L A;  5KPT A;  4H5V A;  3C6U A;  2GBZ A;  3DRP A;  1YVN A;  1U49 A;  1CLQ A;  2YNI A;  2B6A A;  3G6E N;  2ASP A;  3TTF A;  2YHY A;  1S72 N;  3N4P A;  3RMC A;  1X9M A;  4E7H A;  2VG7 A;  3L6Q A;  2LSN A;  1NBW A;  3VEO A;  3THY A;  3OA9 A;  1BGX T;  1QSL A;  1CXU A;  3GOI A;  3NVM A;  1TK0 A;  1QVF M;  1JXB A;  4O0I A;  1GLB G;  4EFH A;  1WSE A;  3CCL N;  4G9Z A;  2DFH A;  4WQ4 C;  4LSN A;  1LWF A;  3EE8 A;  4CZI A;  4LF6 K;  4DV3 K;  4DTU A;  4BRC A;  1WSI A;  4FJN A;  3BP8 A;  2YNG A;  4R5P A;  3ZSQ A;  4IDH A;  5FPE A;  5HL7 L;  3LWL A;  2ASM A;  1NOZ A;  2Y1J A;  2DFF A;  4AHR A;  1MDU B;  4OLA A;  1NGI A;  3L4Q A;  2QK9 A;  3ULE B;  2HNZ A;  3M8P A;  2OTL N;  2AJQ A;  1O13 A;  1OH7 A;  1X1P A;  2Z1H A;  4JK8 A;  1J6Z A;  1RCH A;  4CF2 A;  1EX4 A;  4FJG A;  1ASV A;  2Y1I A;  2HF4 A;  3SLC A;  4JS4 A;  2HW3 A;  5DM7 L;  4A57 A;  4IWV A;  3I0R A;  5TKW A;  2YKM A;  1HX1 A;  3CF5 L;  4FJ5 A;  1KVB A;  2QWN A;  1BCO A;  1N5Y A;  3ZET B;  3KLF A;  5GAE P;  3MN9 A;  4KO0 A;  4W5R A;  3NMU A;  2A41 A;  3QNO A;  2WOM A;  2P9I B;  3CJA A;  4PWD A;  3NF9 A;  4CJS A;  4FLV A;  3NVK A;  3DRR A;  3G0Z A;  4EZ6 A;  1RFQ A;  1XHZ A;  4RW6 A;  5LMU K;  1TL1 A;  4E7K A;  4DQI A;  4DQQ A;  2O8D A;  3AO3 A;  4CZG A;  4CF8 A;  2XY8 A;  3ASM A;  3NHG A;  4K25 A;  4K41 A;  4OO1 J;  2P9L B;  3IMX A;  4B9Q A;  4DV6 K;  5F2R A;  4I9Q A;  5B8H A;  5KQD A;  4ZTJ A;  2FF6 A;  5JMV A;  2PAV A;  4CF1 A;  4FZY A;  3OYD A;  3QFP A;  1V4S A;  1SAZ A;  4CZF A;  2QA4 N;  5EU7 A;  1NK5 A;  3CXC M;  4AHS A;  5JS1 A;  2HHX A;  2GWJ A;  5CZ2 A;  1QE1 A;  2IAJ A;  4JI5 K;  3VQ8 A;  5AQH A;  5E41 A;  3I8D A;  3PX0 A;  4JKG B;  2DTU A;  4KRE A;  2E20 A;  3CC2 N;  4F3T A;  4MDA A;  1Q8I A;  5HRP A;  3QES A;  3ULE A;  3VQ4 A;  4BR0 A;  4FLZ A;  1NGJ A;  4JYA K;  2ZWH A;  3G4S N;  5AQY A;  1ZBH A;  3U4L A;  4BRE A;  5AQT A;  1XMO K;  5D3G A;  2WBN A;  2D5R A;  3D45 A;  3PSI A;  1NJX A;  3CPW M;  2Z1G A;  3O80 A;  4H5T A;  4X65 K;  4DQ8 A;  1ITG A;  4E7J A;  1KQS M;  3VQ5 A;  1W7A A;  4FWS A;  4HVJ A;  1Q9Y A;  4KHP K;  4M3Z A;  1OH8 A;  3OS0 A;  1QQM A;  4OKJ A;  1C1C A;  2QXL A;  1YI2 N;  1BDG A;  3WXL A;  3DLE A;  1J5E K;  4JI1 K;  4NYN A;  1RDA A;  4DV0 K;  2UXB K;  1BHL A;  4BR4 A;  3TPQ A;  3TAG A;  3KKS A;  3ATU A;  1RDW X;  5AQX A;  3HVR A;  1RBU A;  5K14 A;  3VEX A;  3ULD A;  3J81 O;  4KH6 A;  1JXE A;  4HWI A;  4DU4 A;  4FOE A;  4F4K A;  5M1Q A;  2YKN A;  4E19 A;  1S3X A;  4IOA L;  3HSC A;  1VQ6 N;  5C2D A;  3SJJ A;  2G8V A;  5C25 A;  5C2F A;  3L4I A;  3OYH A;  3DLB A;  4BC4 A;  5HRO A;  3DJC A;  3VF2 A;  3BF1 A;  5CYQ A;  3CFO A;  3HM9 A;  4C8L A;  1C0U A;  2HHH K;  4BDY A;  4DMN A;  1TL3 A;  4JI8 K;  3CQY A;  3OYA A;  1D9D A;  1DT9 A;  4JI0 K;  4PA1 A;  3VQ6 A;  3LDL A;  1WAF A;  3U8X A;  2JGU A;  4YY3 K;  1ZXO A;  1DEJ A;  1S1T A;  4CGJ A;  3CQ8 A;  4Z4G A;  3U9D A;  2CH6 A;  4LF4 K;  4JS5 A;  4DQS A;  2ETJ A;  5JIC A;  3KIO A;  4GKK K;  3L2Q A;  4C8N A;  3AGR A;  4J2A A;  3HVT A;  3KHY A;  3DLR A;  4FJI A;  3FGU A;  3DLL L;  1RTD A;  3LWM A;  1WB9 A;  3OYK A;  1BO5 O;  4WE1 A;  1WSF A;  3F9K A;  5GAG P;  4LSL A;  4FPB A;  4M3X A;  3H3N O;  4BRA A;  4I6M A;  1RT2 A;  4EHU A;  3WUH A;  4CD1 A;  3R6M A;  1HNI A;  3AVK A;  4OJR A;  3VEN A;  2ZJQ L;  5JS2 A;  1NGB A;  3ZSZ A;  3K5O A;  2IIR A;  4C8M A;  2YHX A;  5AQM A;  5EX5 A;  3SQ2 A;  4CFA A;  2ZD1 A;  4RW4 A;  3EE9 A;  2KQ2 A;  5IWA K;  1DKG D;  2P9S A;  2NRH A;  2NRT A;  2YV0 X;  4XH5 A;  2YNF A;  4F2R A;  2KFZ A;  4DSK A;  5C42 A;  3NE6 A;  2ASO A;  5AQS A;  3MWT A;  4JI2 K;  1IO2 A;  4FWL A;  4KTZ A;  3WNF A;  2QWP A;  4DFM A;  4E3S A;  1YUW A;  3ISN C;  1BCM A;  1OH6 A;  4B3T K;  1EO1 A;  3OY9 A;  3M1F A;  1U2V A;  2KZM A;  3O9U A;  2G8W A;  1KTQ A;  4JEP A;  4CJW A;  1KVC A;  2P1J A;  3K0S A;  1HNW K;  1JCG A;  2ATQ A;  3HTV A;  1SL0 A;  4DR1 K;  3CCJ N;  2UYT A;  4B8C A;  1K8A O;  1NKE A;  2PFU A;  1NMN A;  1D5A A;  3C95 A;  1VSL A;  4JKH A;  3DMJ A;  4KHW A;  3AO2 A;  3L3U A;  4JRQ A;  3AA3 A;  4B08 A;  3S3M A;  4EZ9 A;  4CGI A;  2A40 A;  3LPU A;  3OJU A;  2KTQ A;  3SAF A;  5BRE A;  1RIL A;  1YHQ N;  4CZL A;  1YTU A;  5FLX O;  1VSJ A;  1N6Q A;  2NNW A;  4DR3 K;  4CHN A;  4M3R A;  1VSK A;  2ZGY A;  4YOT A;  4EIA A;  4BE2 A;  4DR4 K;  1GLL O;  5J2Q A;  1VSI A;  3RVC A;  3J7Y P;  4DSJ A;  4KI4 A;  3RMB A;  1S1U A;  3PY8 A;  3AA5 X;  3DLG A;  1T6D A;  1VQL N;  4HCC A;  5FPM A;  1E4F T;  4YOY A;  3SJH A;  5ELZ A;  3K5M A;  2O8C B;  3BUZ B;  3V1O A;  4CEO A;  3MMV A;  2IVO A;  2OA8 A;  2HHV A;  1S6P A;  5AQL A;  4Z94 A;  5AQI A;  2YNH A;  4CEB A;  4F8R A;  1C0F A;  1Q81 O;  2F8T A;  3KD1 E;  4CJU A;  3SQ0 A;  3TSP A;  4KB0 A;  3C65 A;  1WUA A;  4RCH A;  2VGN A;  3ATV A;  3DAW A;  4DCH A;  4BE1 A;  4JKF A;  1ATS A;  2UUA K;  4Z4H A;  2Z1J A;  1SKS A;  1TUU A;  3NFA A;  4CI6 A;  4CEA A;  1HKC A;  1WBB A;  1K8K A;  3AGK A;  2UXC K;  4B9T A;  2CGK A;  3K2P A;  5ADX A;  4PKI A;  3VTH A;  4HTU A;  5AFU A;  2Q3S A;  1KAX A;  1BG3 A;  4ILH A;  2E1Z A;  3O3G A;  3J7A P;  3QFU A;  4CCH A;  3NAE A;  1JKH A;  3FR0 A;  4CK3 A;  3MCA B;  4KHN A;  5HOO A;  4OPK A;  3D6R A;  4Y1D A;  3KK2 A;  1HKG A;  3BY5 A;  3LDQ A;  4FM0 A;  1NLV A;  3P4I A;  4WQ5 A;  4JI6 K;  1L3S A;  1GLC G;  3S3O A;  3I56 N;  5I3U A;  4YDU C;  3HOS A;  4DFJ A;  4JI3 K;  1X9J A;  3H08 A;  2JLE A;  3C6A A;  2E8A A;  2HBK A;  3ENB A;  4M7X A;  4BGB A;  3JXU A;  4FLU A;  3VQQ A;  1X9W A;  2BAN A;  1ZYQ A;  5J2P A;  2WFB A;  4YDU A;  2PYL A;  1IJJ A;  1BA0 A;  3SPY A;  1EP4 A;  1U4B A;  1WOQ A;  2ZQB A;  2UXD K;  4K42 A;  1M1K O;  3ZT3 A;  4JKC A;  5TKY A;  4I2Q A;  2A42 A;  1U47 A;  3AVL A;  3V9Z A;  1E3M A;  4CJQ A;  4PHT X;  5AZI B;  1LWE A;  1VQ7 N;  1WLJ A;  3RR8 A;  5FRM A;  1G99 A;  1JLQ A;  4DHY A;  4BC2 A;  2HBJ A;  3F2K A;  5AJ3 K;  4BR9 A;  4KHY A;  5AR0 A;  1A5X A;  3OS2 A;  5SWM A;  4OLB A;  3O08 A;  3N4Q A;  2PBD A;  3CJ9 A;  4CJV A;  2HBL A;  5CYM A;  1NM1 A;  3SV3 A;  4DR6 K;  3SUP A;  3LZI A;  4A2A A;  1TKT A;  4IXC A;  4CF9 A;  5KPZ A;  4IKF A;  3HT3 A;  5H1S Q;  3EKS A;  3OYN A;  2H3G X;  1NGA A;  3CCV N;  3K5L A;  3KK7 A;  3AO5 A;  3FZK A;  5BPN A;  4UY8 O;  3PX4 A;  2FSJ A;  4IFV A;  2HVI A;  3R8E A;  2RN2 A;  1ZBU A;  4B9U A;  4DV5 K;  4KHQ A;  2KLA A;  1U2V B;  3SPZ A;  5M1P A;  1CXQ A;  4DTP A;  2V7Y A;  3QEP A;  1HPM A;  5GIN A;  1HNV A;  4H5R A;  4BY9 C;  2GTD A;  3SQ4 A;  2VWJ A;  2BE2 A;  3THX B;  1BA1 A;  3CYM A;  5IT9 O;  4AM6 A;  2X78 A;  4CHP A;  3UKR A;  4CEZ A;  4X62 K;  3KD5 E;  3CQX A;  1QHA A;  4NB4 A;  1D9F A;  3LDN A;  3ZSO A;  1SL1 A;  5J1E A;  4AIL C;  1JLC A;  3W0L A;  4LH4 A;  1C0T A;  1XC3 A;  3RMD A;  3MED A;  1YJ9 N;  3I33 A;  1HYV A;  1HMV A;  3ZX3 A;  1BOT O;  4DSL A;  5BPM A;  1D4X A;  4NO7 A;  5C24 A;  3SK3 A;  3HP9 A;  4HUF A;  3MN5 A;  3O9S A;  3ZT4 A;  2X6S A;  2GWK A;  1I3A A;  3QBX A;  2XO7 A;  3FZH A;  5BRD A;  4JAX A;  4CIG A;  2A5X A;  1IG8 A;  5AFU H;  3AO1 A;  1Q7Y O;  4A61 A;  3E66 A;  3QET A;  1JL2 A;  2FXU A;  3LL3 A;  5J2M A;  4DF4 A;  4CJR A;  3EO3 A;  1BI4 A;  4RTF D;  5LL6 Z;  3UKU A;  2CH5 A;  3KJV A;  3SUN A;  4CED A;  4WF9 L;  4LF7 K;  1WBD A;  2QWQ A;  3EZW A;  1EXQ A;  1YIJ N;  3CME N;  3DRS A;  1FK9 A;  1QTM A;  2DY4 A;  2O8E A;  3FFI A;  2NRV A;  1ATN A;  3AVC A;  4FLT A;  3EZ5 A;  5AQG A;  4KBO A;  2NZT A;  3C6T A;  2JWK A;  5LJW A;  4DU3 A;  3QIP A;  4GV3 A;  3ID8 A;  4PY5 A;  2O8E B;  4MQ3 A;  1X9S A;  4CZE A;  1JCF A;  3J80 O;  1KFD A;  4ID1 A;  1RT6 A;  1S1X A;  2QM1 A;  3MEE A;  3AAR A;  2WUS A;  3CCU N;  2YCH A;  4Z4I A;  3D2E B;  1W0H A;  4FZZ A;  2VQE K;  5M1N A;  4C23 A;  4OPH A;  3L0Q A;  4FPA A;  2P9L A;  4HCB A;  2WC9 A;  2I5J A;  4CEC A;  3O9Q A;  3P1G A;  5EOY A;  3PO4 A;  4OPJ A;  4W5N A;  1VSE A;  4RW9 A;  3UB5 A;  3ZX2 A;  4FLX A;  4WQ4 A;  4Y1C A;  5DM6 L;  4CD3 A;  2G8K A;  4BWM A;  1BIU A;  1NGH A;  3V4I A;  4CFC A;  1SS6 A;  4B1V A;  4FXD A;  2PY5 A;  1VK0 A;  1UA1 A;  4BDZ A;  1T6C A;  4B1W B;  2YHW A;  1MWM A;  3I55 N;  3V1R A;  1JLA A;  3VQA A;  4FK4 A;  3THV A;  3TAQ A;  1FJG K;  1GOB A;  1FXX A;  3OVN A;  2A1S A;  3ZSR A;  3VF6 A;  1IBK K;  3TAF A;  1IV0 A;  1V4T A;  4I7F A;  4CJP A;  1HYS A;  3P31 A;  4JHD B;  4CIF A;  3D2F B;  1DGK N;  3DXK B;  1BWF O;  3VGM A;  1IKX A;  3CFP A;  1IKV A;  3VEZ A;  3K5N A;  3VMF B;  1YT3 A;  4DUY K;  1XHX A;  1M90 O;  1OVQ A;  3FZM A;  4BRF A;  3TAP A;  3Q7C A;  3C94 A;  3VOV A;  1K8K B;  4EP5 A;  3CIP A;  2J4R A;  3ZSW A;  2VYP A;  1XQS C;  4BRQ A;  3A0I X;  4IZ9 A;  2QEX N;  4DSI A;  4KI6 A;  3O3H A;  4BRI A;  4KB1 A;  1NGF A;  3VQC A;  4JKE A;  3ZYY X;  4XH1 A;  4JLH A;  1KAY A;  4BAC A;  2HHW A;  3CCR N;  3CC7 N;  1QHT A;  4AHV A;  3M8Q A;  3GDQ A;  1NGD A;  1I39 A;  5FPD A;  4BRP A;  4CJT A;  1ASW A;  1HPZ A;  2F8S A;  1N34 K;  4BRK A;  1LOT B;  4B3S K;  5KRT A;  3OYI A;  5CZ1 A;  3MN6 A;  4B1Y B;  1VQM N;  3VER A;  1L3T A;  4L8R B;  1Z6R A;  1BU6 O;  3CJC A;  1KD1 O;  3WXM B;  4BC3 A;  1UA0 A;  4A5B A;  1NJY A;  3WXI A;  1Q18 A;  3T69 A;  1JLG A;  4B3O A;  5KGW A;  4FJH A;  4IJA A;  1IKW A;  3SAG A;  2EHG A;  5GIO A;  2E2N A;  1RDC A;  1ZBI A;  5HBM A;  4BC5 A;  1VHX A;  1TYQ A;  2D0P A;  3B6O A;  4DTJ A;  3NDK A;  2WTU A;  1SKR A;  3SBG A;  4DS4 A;  3GBT A;  4H8K A;  2G8F A;  3WEE A;  3AVN A;  3AVM A;  3ITH A;  1LW0 A;  4TSX A;  3M3Z A;  1XUP O;  3PLA A;  1NJW A;  3PUF A;  1FW6 A;  2DPN A;  2KHO A;  3LDS A;  4V19 S;  3AVA A;  1S9G A;  2P9U A;  2BDP A;  2ZF5 O;  3DXM A;  4FJ7 A;  1T7P A;  4KTQ A;  3LDO A;  4WQ5 C;  1QSY A;  1KRP A;  3T1A A;  2Q0U A;  1KXP A;  4QAG A;  4CK2 A;  4CIE A;  3VPZ A;  5HRN A;  3SMS A;  4NLB A;  4YOR A;  1RT1 A;  4MLE A;  4Q5V A;  3CG7 A;  2GUP A;  3LP1 A;  3FZF A;  4CE9 A;  2FLO A;  5AQR A;  3HJF A;  2E4L A;  1SZ2 A;  2G8H A;  3O9T A;  1U48 A;  3VQ9 A;  1NJZ A;  2V52 B;  3L2R A;  4M3T A;  1J53 A;  1SKW A;  1NK7 A;  4OVL A;  2FBV A;  2HHU A;  3HI0 A;  3WQU A;  4DQP A;  4LF8 K;  4K8Z A;  4BRG A;  5AQP A;  4FWO A;  2ITG A;  2PYJ A;  4CFB A;  2IVN A;  5E26 A;  1U45 A;  3D2F A;  2O4I A;  3OJS A;  3L2V A;  1IBL K;  5AZJ A;  4DTX A;  3CPE A;  1GOA A;  4DTO A;  4DTS A;  4AH9 A;  2BTF A;  5LMN K;  1NMD A;  5DMR A;  3THW A;  2QI2 A;  2P5O A;  3H45 C;  4JKD A;  1J9A A;  1C6V A;  3OYL A;  2BUP A;  1VQP N;  3LP0 A;  4KV8 A;  3P83 D;  2Q97 A;  4BE0 A;  4IJN A;  1TYQ B;  3JYT A;  5E84 A;  3LAM A;  4KHS A;  1MU2 A;  4A62 A;  2AA4 A;  3E9O A;  1NK9 A;  2FSN A;  5BPL A;  4DV4 K;  3T1Y K;  1HUX A;  1GOC A;  2YI1 A;  4O4G A;  4DLE A;  3KK3 A;  1HJR A;  4FWM A;  5CE3 A;  5M1F A;  3DOL A;  4JD2 B;  1TUY A;  1WAJ A;  1S1V A;  1TVR A;  3T7Z A;  2QWR A;  4KKO A;  1WNS A;  3MEC A;  2FBY A;  2V7Z A;  3VQD A;  5AQV A;  4N47 A;  1D8Y A;  4LY7 A;  1RBV A;  4KFB A;  4E7I A;  3NF8 A;  1BUP A;  5KQ8 A;  1X3M A;  3SCX A;  3SUO A;  1O1W A;  1RDD A;  4N76 A;  2YHA A;  3CCE N;  3ZCM A;  3IFR A;  3HPH A;  3RMA A;  4LH5 A;  4C8O A;  3A5L C;  1IBM K;  4H03 B;  4XIU A;  2FF3 B;  4J8F A;  4BGA A;  2P9N B;  4H0P A;  3OBW A;  1J54 A;  4CEQ A;  5KRS A;  5T7B A;  2R7Y A;  3WEE B;  3CD6 N;  1NJI O;  1DTQ A;  2Q31 A;  1HQU A;  1K6Y A;  2P9N A;  3MK6 A;  2OPP A;  5EVZ A;  3BZC A;  3HOT A;  4GMJ B;  3DWL A;  4WYB A;  4DF8 A;  2G8U A;  4B9L A;  3AA4 A;  4EP4 A;  3OW2 M;  4JNE A;  2VGM A;  2F96 A;  1RDB A;  3CCM N;  2V51 B;  5C10 A;  5MLC Q;  4DSE A;  1OVY A;  4ISE A;  4CZM A;  2X74 A;  4ICL A;  3CJ7 A;  1T44 A;  3QML A;  4O0J A;  3R9P A;  3SYZ A;  4OGE A;  1QQC A;  1NWK A;  1NGG A;  3KZB A;  4DKW A;  3V81 A;  1FKP A;  3HPO A;  1VQN N;  2YHB A;  1NU0 A;  2ZJP L;  1RDU A;  3AO4 A;  2HND A;  1S9E A;  1P90 A;  3IG1 A;  5AQK A;  1Y97 A;  2HOE A;  1QSS A;  2KFN A;  1GLE G;  3FE1 A;  4FJX A;  1TKX A;  4CFD A;  3PIO L;  3UIQ A;  3L2U A;  5C12 A;  4FOI A;  5CHI A;  1MA9 B;  1RNH A;  4ELT A;  2Q0R A;  1RT3 A;  3HM8 A;  4H0T B;  4IO8 A;  3AA2 A;  3QEX A;  3HST B;  1EKE A;  1LW2 A;  3HXM A;  4B9N A;  5BR9 A;  4CGD A;  3QLH A;  5AQU A;  5EY4 A;  2IC3 A;  4O5F A;  4CJK A;  3G25 A;  1RTJ A;  1VAZ A;  2YJE A;  2W42 A;  3OYC A;  3B6P A;  4B9M A;  2HST A;  4DR7 K;  4DTN A;  3LAN A;  4IFE A;  3C6H A;  4W5T A;  4FJ8 A;  3E01 A;  4HHT A;  4CJ7 A;  5JVG L;  1L3V A;  4FVM A;  2XY5 A;  4QCL A;  1KFS A;  5AZI A;  4ZHR A;  4BQL A;  3NF7 A;  3KTQ A;  4CGF A;  3O4N A;  4PL7 A;  4E1J A;  4FSV A;  4IBN A;  1XMQ K;  1VRT A;  4F9O A;  4QOZ B;  3OYB A;  2E5L K;  4O8U A;  4NCA A;  5GAD P;  3SQ1 A;  1HR0 K;  1NNE A;  4GKJ K;  4GV6 A;  4M45 A;  4RW8 A;  4JV5 K;  4U7B A;  5AQO A;  5I42 A;  2HMI A;  1CZA N;  1KSP A;  2W6K A;  4H5W A;  2D0C A;  3V9S A;  3OHR A;  2XY7 A;  1Q86 O;  2IGI A;  1WSJ A;  3S41 A;  3BEX A;  2WON A;  3UE5 A;  4CF0 A;  3ZET A;  3T19 A;  3OS1 A;  4F2S A;  4M63 C;  4KTW A;  4FLY A;  3T1H K;  1XNQ K;  5FDL A;  4CK1 A;  3TR8 A;  1KLM A;  4FLW A;  1W2B M;  3DYA A;  2OYQ A;  3S9H A;  1LAV A;  3H1V X;  2P9K B;  4GNI A;  3JS6 A;  4Z0U A;  3O9R A;  3CM6 A;  4BG9 A;  2Q2R A;  2D0B A;  4JKB A;  3OYF A;  4DTM A;  5HRS A;  1EWR A;  1N8R O;  4AHC A;  2P9K A;  4BRN A;  3WQT A;  1NKB A;  1RT7 A;  2OZM A;  3THX A;  3WNE A;  1N33 K;  1ESV A;  4U67 L;  3BZK A;  2P5G A;  2F7T A;  3L2W A;  4JI7 K;  3MXM A;  3TTC A;  4CHY A;  2O8F A;  2XHB A;  3ZEU B;  5HLF A;  4CJL A;  4BWJ A;  3D2E A;  4CBX A;  3ZSX A;  2D0O A;  3QIO A;  1HRH A;  1Z26 A;  3VA0 A;  1QQN A;  4CJ3 A;  4CEF A;  3O5B A;  2UU9 K;  3MEG A;  4B3M K;  2IOC A;  4M41 A;  3LM2 A;  3WT0 A; 
#chains in the Genus database with same CATH homology
 2UUC K;  4K0K K;  4AQY K;  2HHH K;  4JI3 K;  4X64 K;  4JI8 K;  4DR5 K;  4DR7 K;  4JI0 K;  4V19 S;  4YY3 K;  4JI4 K;  5FLX O;  4DR3 K;  1FJG K;  4X66 K;  2UXD K;  4LFA K;  4DR4 K;  4LF5 K;  4CVN E;  4LF4 K;  4JI5 K;  3J7Y P;  1IBK K;  4GKK K;  1IBM K;  5BR8 K;  1XMQ K;  2UUB K;  1HNZ K;  4DUY K;  2E5L K;  1HNX K;  4LF6 K;  4DV3 K;  4LFC K;  1HR0 K;  4GKJ K;  4JYA K;  4JV5 K;  5AJ3 K;  5LL6 Z;  4DUZ K;  1XMO K;  4LF7 K;  4B3R K;  4X65 K;  5A2Q O;  4DV7 K;  4KHP K;  4NXM K;  4LF8 K;  4DR6 K;  3T1H K;  1XNQ K;  5IWA K;  4YHH K;  1IBL K;  1J5E K;  1N34 K;  5LMN K;  4JI1 K;  4DV0 K;  2UUA K;  4B3S K;  4LFB K;  2UXB K;  2VQF K;  3J80 O;  4DV1 K;  4JI2 K;  2UXC K;  4DV5 K;  3J81 O;  1N36 K;  2VQE K;  1N33 K;  3OTO K;  4JI7 K;  5LMU K;  4B3T K;  4DV4 K;  3J7A P;  3T1Y K;  1XNR K;  1I94 K;  1N32 K;  4LF9 K;  4DV2 K;  4NXN K;  4OX9 K;  2ZM6 K;  4CW7 B;  1HNW K;  5IT9 O;  2UU9 K;  4DR1 K;  4B3M K;  4DR2 K;  4X62 K;  2F4V K;  4JI6 K;  3JAM O;  4DV6 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...