4GKKK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4gkkK00
4CW7B 2ZM6K 4JI7K 4DR1K 4KHPK 4DV3K 1XMOK 4DV2K 4DV1K 4LFCK 1IBMK 1J5EK 4LF4K 4X64K 5FLXO 2HHHK 4B3MK 4LF6K 4GKKK 2UXDK 3OTOK 4AQYK 3T1HK 2UU9K 4LFAK 1XNQK 4LF8K 5AJ3K 4DV4K 1N34K 4DUYK 5A2QO 1IBKK 5LMNK 2VQFK 5LL6Z 4OX9K 4DR7K 3J7YP 4DR5K 1HNZK 4DR6K 5IT9O 4JI0K 1XMQK 1XNRK 4K0KK 1N36K 4LF5K 4B3SK 4DR2K 4JV5K 4JI4K 4YY3K 3J7AP 4DV7K 4DV0K 4LF7K 4LFBK 3JAMO 4B3TK 4JI8K 4X66K 3T1YK 4JI3K 4B3RK 1I94K 4DR4K 4JI5K 4JYAK 1FJGK 2UUBK 1IBLK 4X62K 3J81O 5IWAK 1HNWK 1N33K 2UXBK 4JI1K 4GKJK 4DV5K 2E5LK 4YHHK 4JI2K 1N32K 4DV6K 4DR3K 4V19S 4JI6K 1HNXK 4DUZK 5LMUK 1HR0K 4LF9K 2F4VK 4NXMK 2VQEK 4NXNK 3J80O 2UUCK 5BR8K 4X65K 2UUAK 2UXCK 4CVNE
chains in the Genus database with same CATH superfamily
2WONA 4CW7B 4OPAA 3DRSA 1TGOA 3CQXA 3SMPA 2OPPA 4JI7K 1XMOK 3IKMA 4LFCK 2ITMA 3CD6N 2V52B 1KSPA 5JICA 3SUNA 4CEFA 2P5OA 2I7NA 1H1VA 4CHQA 3OYIA 3K57A 3VQ4A 2G8KA 3P39A 2VQFK 4GMJB 1CZBA 1A5VA 4JD2A 3KLEA 1RTIA 3G0ZA 2PZSA 5FDLA 3VGLA 1BIUA 4FWSA 3SLCA 1T44A 4CZHA 1Y97A 3QMLA 3HT3A 5I3UA 2B6AA 4YDUA 3DLHA 5ADXH 2QXFA 1V4TA 4B3SK 3J8AA 5CR4A 5AZJB 3CJ7A 1QHAA 1S1UA 4YORA 3LZIA 5C2DA 4DHYA 3QB0A 1ASUA 2HB5A 1HLUA 3WNHA 2E6MA 2O8DA 4IO9L 5HRNA 1TL3A 4DLEA 4F8RA 1WSGA 1FK9A 3H08A 3QEIA 1Z05A 3MWPA 3FGUA 1GLCG 1IBLK 3RSEB 5BN8A 4C23A 1YITN 3QFUA 3L2WA 2QWPA 3NH2A 1S9GA 1N33K 3P83D 3OS2A 4DTMA 4MQ3A 3RMAA 1JJ2M 1LWEA 3KHYA 4QCLA 4RW7A 3HVTA 3LAMA 4KV8A 3AAPA 1U45A 2IDOA 4GY2B 1JLEA 5DM7L 2QI2A 3EL2A 4XH1A 2HHUA 2D1KA 1X3NA 1YAGA 3R9PA 3WUHA 4IEIA 3VTHA 3MECA 3EYZA 4M41A 3GOIA 2DFHA 4CGIA 3M6GA 4ILHA 4DWIA 4BRKA 1P8ZA 4FWLA 4CECA 3O3GA 3M8SA 3LAKA 3OYHA 3CM5A 3L4IA 1JCFA 4M3XA 3FR0A 4DV1K 3ATVA 2VWBA 4OPJA 2HHHK 1OVQA 1G99A 4Q0BA 4K43A 4OVLA 1TYQA 3H46O 5AQVA 4LF8K 2EHGA 3IUCA 3HL8A 1Q18A 2QEXN 3CPWM 1EWQA 1W7AA 2P9NA 3UIQA 2D0CA 1WN7A 5GIPA 3BGRA 3L2RA 3T3FA 1Q9XA 3P5JA 3JXUA 4CFAA 4K42A 4A5BA 1TKXA 3TTCA 1NOYA 3O6WA 2FSJA 4WQ4C 1DT9A 3AA2A 1KVAA 1JXBA 2P51A 1NGFA 2ITGA 3HM8A 3K5NA 1GOAA 1VQ4N 2E2NA 1KTQA 1C0MA 1HKCA 2NRTA 2YJEA 4CJQA 3EE8A 4CJSA 2E1ZA 4I7FA 4EAHD 1VQNN 3CCRN 2UUBK 3KLGA 3E9OA 4CBXA 3GG4A 3NF8A 4MLHA 5F1XA 4B8CA 4UQGA 2X74A 4Q5VA 3SQ2A 1M1KO 2RHKA 3QLHA 3SQ0A 1FKOA 2X6SA 4H03B 1Q86O 3PIPL 1IV0A 1B92A 4FLXA 1NNEA 1VQON 1M90O 4HCCA 4DU4A 1YHQN 2D5RA 3RRGA 4LF9K 1KVCA 3I55N 4CI6A 4J2AA 4GV6A 1YTAA 2ZWHA 1SUQA 3SBGA 3O9UA 3MN5A 1T6CA 3AO4A 3VMFB 4O4GA 2P9SA 4ISFA 3NBPA 5KPTA 4R5PA 1KQSM 2EWSA 1NGBA 1JKHA 1VQ7N 2HMIA 3WXLA 5BREA 4FLZA 4BRCA 4DFJA 3SUPA 1UAXA 2D4WA 5JS1A 1E3MA 1WNSA 4WE1A 1U48A 3IDHA 4OLAA 4RCHA 1L3VA 2G8WA 1B9FA 5CZ1A 2F8TA 2Z1GA 3L3UA 5SWMA 4BROA 1NGEA 2AP1A 1BO5O 4CHYA 2O8FB 4PKGA 1JL1A 2E6LA 1VHXA 4Y1CA 2ASOA 4HWIA 1IG8A 3I0SA 5AZIB 3U9ZA 2A1RA 3ZT3A 3SI6A 3K5LA 3THWA 4LD0A 2J4RA 4CJKA 2FSNA 4M3WA 3F2KA 1BI4A 4N56A 3DYAA 4CZLA 1XHZA 1SQKA 4U67L 1XNRK 3CQYA 4FWOA 5JLHA 4B9VA 1JLFA 3QEPA 5AQUA 3UKRB 4CEQA 1YF5L 5M1NA 4B1UB 2DPNA 3R3LA 3PSIA 3IS9A 4HHTA 4KHWA 1SL1A 3NDKA 4EP4A 4BQZA 2Q1NA 3NAEA 1YJ9N 4CGGA 4L8RB 5KPZA 4BVPA 4CK3A 3VF4A 4MDBA 2NZTA 3R1XA 1K9MO 2HNYA 3OYEA 2XY5A 1NK0A 3HI0A 5C25A 4CJ7A 1D8YA 4OGCA 2NRRA 1VRUA 5HL7L 4FW1A 3PO5A 4EZ6A 4BRHA 3KK1A 3C7NB 1GLAG 4NCBA 3CCQN 3V9UA 4CZEA 3O5BA 3VEXA 3K5MA 2HF4A 3A2FA 1QS4A 3B6OA 4YOVA 3DLKA 4O8KA 3KLFA 5LJWA 3AA4A 3CFRA 3QINA 2QW9A 3ZETB 1X1PA 4CBUA 2AJQA 3LP0A 4B9NA 1JLCA 2GBZA 4E7LA 2YHWA 1NM1A 1XC3A 1LWFA 5FLXO 3AARA 2YNFA 4B9MA 1XWLA 4AQYK 3KKSA 2ETJA 4DQIA 2GX9A 2YNHA 1YUWA 4DSKA 3CXCM 4B1WB 3QETA 1VSJA 4IG0A 3HXMA 3P4IA 1LCUA 2E2QA 1T7PA 3TI0A 1BHLA 3V9ZA 5FPDA 2KLAA 3ATUA 5DM6L 1P90A 3OS1A 3HSTB 1S6PA 3CETA 4JI0K 1E4GT 3BDPA 3SCXA 3ZT4A 1KXPA 1L5UA 3TTFA 4B9UA 2JLEA 3HP9A 3E01A 3M5RA 4Z4IA 3E9PA 4CGJA 2RF2A 2P9PA 3TAMA 3O3HA 3KJVA 4JRQA 3LDSA 4LFBK 4IXCA 4A62A 2E1YA 3JYTA 3ZSVA 5J1EA 5F2RA 4C8OA 1T6DA 2HHXA 3Q7BA 3GDQA 2QWRA 1VQ9N 1RILA 2P9IB 1KLMA 2P9UA 4DSFA 4XH4A 1GOCA 1VK0A 4BWMA 3NMUA 3AVFA 3NVKA 4KI4A 1RT4A 1HQEA 4BR5A 3UKUB 1FKPA 3TAFA 3VQCA 2IVNA 3D7EO 3D2FB 1NK9A 3OHRA 5GIOA 2HNDA 4CZIA 3C6UA 1WAFA 4F2SA 4ID1A 2YKNA 2O4GA 4B9QA 3MXJA 4H5RA 3SNNA 3VEOA 3L4QA 2WTUA 4JS5A 5C12A 4CD3A 5EX5A 4CVNE 4JKHA 3M8PA 1OH5A 1XC9A 2HHWA 3D2EA 3EN9A 3VETA 1YJNN 2YI1A 3ZSZA 4CEZA 4JHDB 2OYQA 2A1SA 4ISGA 4LF4K 4M42A 2W40A 3G25A 4JN4A 1VSHA 1LV5A 3RR7A 1GLFO 4OKJA 4WFAL 4DQSA 3K0SA 3T1HK 3LP2A 1NMNA 1HYSA 2BGGA 3ZSRA 1WBBA 2G8VA 5LMNK 3WQUA 3CCUN 4BWJA 3S3OA 4DR7K 2O8CB 4BE0A 4A57A 4FJGA 3HZ6A 3OW2M 2DTUA 1WB9A 3ITHA 2NRWA 2OPSA 2FXUA 2OTLN 4Z4GA 3CJ1A 1U6ZA 3Q7CA 3KIOA 3QEXA 1Q82O 4KBOA 4CEEA 3SYZA 4ID5A 4YOXA 3KK7A 3IAYA 4K41A 3VQDA 4OKEA 3MAQA 5J2PA 1J5OA 3WNGA 4CF1A 3HTVA 3HK2A 5GINA 4BY9C 2WOMA 2PY5A 2O8EB 5KRTA 4B1VA 4IOXA 5AQSA 5C15A 3CMEN 3V1QA 1CLQA 1TK5A 5BR9A 4DV5K 4FLWA 3S9HA 1IKXA 3V4IA 2IAJA 3CCSN 4N47A 4AHCA 2XHBA 4DUZK 4C8NA 2VWJA 4FJLA 3OA9A 1CXQA 3CC7N 4CERA 4N76A 1NU0A 3QICA 3HPHA 4M3TA 4C8MA 2X78A 4OO1J 3SPZA 4JKEA 4FJ9A 3CFOA 2GUIA 1Q81O 3FZLA 5KRSA 2OPRA 3CJAA 3DJCA 1QQMA 4DS5A 4HTLA 1TV6A 1BQNA 2QXLA 3L2VA 3M8RA 5KQ8A 1ZBUA 3LP1A 3CERA 3RR8A 3CPEA 4CZFA 3AO3A 5EXWA 1VSMA 1SL0A 4CZJA 3H3NO 3HPOA 2O8BB 1LAWA 3SAGA 1BI4B 3C65A 2Q3SA 3AVIA 4A61A 1MA9B 4CEOA 4CHPA 3T69A 3UB5A 4BDZA 4FZZA 4FPBA 1IBKK 1C1BA 4F3OA 4FM1A 4KHUA 1KFDA 3ZSQA 5J2NA 1X9WA 1X3MA 4MDAA 4DTUA 1JCGA 3T7ZA 3AGRA 4IDHA 2RN2A 2G8FA 3ZSXA 1HNZK 1RDBA 3EO3A 5BPLA 1CZ9A 3WEEA 5T7BA 3THYA 2E88A 1RDUA 3ULEA 3HJFA 4ICLA 4Y0WA 1QQNA 4JK9A 3VERA 1BQMA 4ZHRA 4YOYA 3TAPA 1YIJN 3ZSYA 1W2BM 1LW0A 3QEWA 1RTDA 3QIPA 2FC0A 1T03A 3VQ5A 4GNIA 3OYJA 4BRLA 3DLEA 2NUBA 2F9WA 2W6LA 4J2DA 1DKGD 3BZKA 4U7BA 3DRPA 4CJFA 3WNEA 1Z26A 1HNWK 1BU6O 1S1XA 4CZGA 4F9OA 3OYKA 1F21A 2D0PA 4CE9A 4BC4A 4Z4FA 3DLRA 1BCMA 4HUGA 4YOWA 3HBTA 2QA4N 3SV4A 2HHSA 1A5WA 4IFEA 4DFPA 3L0QA 3KZBA 5CYMA 4O8UA 3K58A 3THXA 2FLOA 3AAQA 4R79A 1ZBLA 4E1NA 2KW4A 3AO2A 3WNFA 2XO7A 1RGIA 3VGKA 1C0FA 4Z4HA 4PWDA 4E89A 3MMVA 1IO2A 3MWTA 4KH4A 3U9DA 2Z1IA 2Q0UA 5BRDA 4CJUA 1BCOA 3AVCA 4E1MA 4IWVA 4KAZA 2HNZA 1WAJA 3L8BA 3PUFA 1SL2A 3RWUA 5AQTA 1EWRA 2QWLA 5C24A 3ENOA 4A59A 5E84A 1G15A 3FZHA 5FRNA 3F5TA 5JVHL 1JLBA 2WUSA 1S1TA 5CE3A 5E26A 4FJ5A 1SAZA 4IFVA 4YFUA 3M8QA 2UU9K 2OTJN 4PKIA 1V4SA 2P9PB 4KRFA 2QTDA 5LL6Z 2P5GA 3DMJA 1BA0A 4KTWA 1RT5A 2YNGA 1ZBHA 3SPYA 1ZYQA 4BR2A 4DR6K 5IT9O 5HRRA 2NRXA 3OYLA 1T3VA 3LWMA 3TSUA 5TKWA 3U3YA 3TABA 1D9DA 2IGIA 5KI6A 3DOLA 1RCHA 2IVOA 4WQ5C 1N5YA 3MCPA 4B3TK 4B9SA 1J54A 3NF9A 4I2QA 4BRDA 4NYFA 3EKUA 3LDNA 1W9HA 2D0BA 3SK3A 2W6KA 1QSSA 1TUUA 1ATNA 4CJTA 3R8EA 1QZ6A 4GV9A 3V9WA 4E3SA 4H5NA 4Z0UA 3TR8A 5ELZA 1NBWA 1LOTB 3ENHA 5JS2A 4OGEA 5KTQA 4CZKA 5FROA 3SUQA 4DS4A 4LC9B 2NLXA 4EIAA 3ZT1A 3GBTA 3H1VX 4W5OA 4FWPA 2QKBA 4RTFD 4PQUA 1QZ5A 4AILC 4CGDA 3ZEUB 2PBDA 4LSLA 3U8XA 1K6YA 3AVLA 5GAEP 3D45A 1KAXA 2ASPA 4BE2A 4EZ9A 4CJVA 3CJCA 3MK6A 3SUOA 1ZXOA 2O4IA 3DLLL 5C2FA 4NLBA 3NGYA 2HBKA 2P9KB 5BN9A 4KHPK 5M1QA 3C94A 4CEAA 3MXIA 2F96A 3TAQA 1NGHA 2KQ2A 3VF2A 2P1JA 3BZCA 2Q31A 4DUYK 1QQCA 3CCLN 4AHRA 3BY5A 3LALA 1O13A 4PUOA 1KD1O 3O9TA 1ZBSA 3VQPA 4O5BA 1ZBFA 4NO7A 2YNIA 3C6TA 4ELUA 1XMQK 2IC3A 5CY4A 4BREA 3CFPA 2ZJRL 5AQIA 4OPKA 1RTHA 2WC9A 4M3ZA 4IDKA 2CGJA 4F2RA 2DY4A 3H45C 4CGHA 3U6FA 2KZZA 2F8SA 1EKEA 4JI8K 4X66K 4CJLA 3FFIA 1ASWA 3CM6A 2ATQA 4DR4K 1HPMA 2FBXA 4BR7A 4YOUA 1XHXA 3TAGA 3MXMA 3MDQA 2P9LB 2B4JA 4BC3A 1OH7A 4X62K 4M3YA 2BE2A 3H3OB 4CF9A 5FPMA 3AVAA 4H4MA 4WQ4A 1YXQA 5H1SQ 1VQPN 3VENA 1VSKA 3FLCO 4YHHK 3E66A 3EZ5A 4I6MB 2YHBA 2OCEA 3DXKA 3FZFA 2I5JA 5JVGL 1HKBA 1BIZA 4A5AA 4CF8A 3KD5E 2VGNA 3V9XA 1QE1A 5LMUK 3MN7A 3BEXA 1ZBIA 3L2QA 3EEQA 5DMRA 1NK8A 4CJ5A 1U2VA 1CXUA 3CI5A 3LANA 1ILYA 3FFKB 3FZMA 4CHZA 4GVEA 3WXMB 4DSIA 3J80O 3KTQA 4M45A 3TANA 5KGXA 2XRIA 1NGJA 4IKFA 4XEIA 4DTPA 4K8XA 2UUAK 4FXDA 3DWLA 2UXCK 3TAEA 4H0VB 1RBUA 4PL7A 1Y64A 1MWMA 5HBMA 3WXJA 1BGXT 4NYNA 1NKEA 2IOCA 4G9ZA 4DV2K 1U4BA 3HVRA 4FOEA 1S1WA 1RT2A 1EQYA 4GKKK 2GTDA 4FJJA 1VSFA 1E4FT 3OTOK 4B1ZA 3VPZA 2UYTA 3AGKA 3AY9A 2AA4A 1HNIA 5ADXA 2DFFA 2QWMA 2ZQBA 4QS8A 5J2QA 1RT7A 2RKIA 3I0RA 4JD2B 2A6AA 4H4OA 3ZLJA 1SZ2A 2PFUA 1WUAA 4CGFA 3AA3A 3O3FA 1BWFO 3IFRA 4CFBA 4CF2A 4OPHA 4B9TA 5AFUH 5D3GA 2A41A 4W5TA 1N36K 1NK7A 3HSCA 5AZJA 4JV5K 2A3ZA 3SZ2A 2QWOA 3G10A 3MCAB 3OYAA 4LF7K 1UA1A 3NH0A 3BF3A 4Y1DA 4WFNL 4LY7A 4KKOA 1IJJA 4CESA 4FJ8A 2O8DB 4DTRA 1BISA 3D0PA 3CCVN 1C6VA 2KZMA 4HVJA 2HOEA 1QQOA 2GV9A 3SJJA 3QDKA 1HQUA 3OJSA 4BR4A 1YI2N 1HMVA 4GVMA 3LPTA 3W3DA 3PV8A 4FK2A 1JCEA 2ZE2A 4JKGA 4CJ3A 1EP4A 1XQSC 3MEGA 3OVNA 5M1PA 3O9SA 2D0AA 3JS6A 5AQRA 1K8KA 4IBNA 2ZJQL 3UE5A 4BGAA 3HPGA 1NJXA 5AQOA 4C1NI 2GELA 1NJZA 1RT6A 4H5TA 4WF9L 3LPUA 4BRFA 1C0TA 4QAGA 4BRIA 4LSNA 1IH7A 3RMDA 3THVA 4FJMA 3TU5A 1NGIA 4YOTA 1SS6A 2F7TA 1EO1A 3A8YA 4LH4A 3AVJA 4H8KA 1IG9A 5SZTA 2VGMA 1J9AA 1RDCA 1Q9YA 3RRHA 1TYQB 3VQ8A 3VQEA 3TPQA 4E7IA 4HUFA 5A2QO 4JNEA 2A42A 1OH6A 5I42A 1RBVA 3S41A 3V1RA 4PY5A 4F3TA 1VSLA 3W0LA 2QWQA 4RW8A 1HUXA 2P9NB 2KFZA 4H0OA 4CJPA 4I9LA 4M3RA 3OBWA 4OKKA 3H6EA 2HVHA 1NGDA 2PAVA 1L3SA 2YJFA 4PKHA 3VQBA 4DV0K 3JAMO 2HHTA 1RBTA 3EY1A 4O44A 5BRHA 3DI6A 3VQQA 4KB1A 1QVFM 5F0XA 1NJYA 5EY4A 4DTSA 3R6MA 1FXXA 1QVGM 4B9LA 3A5LC 3QO9A 3C0BA 1EETA 3CC2N 4FJ7A 5HOOA 1VQ6N 1HKGA 4WFBL 1VSEA 2E5LK 4PA1A 4JI2K 3SAHA 3DLGA 4DV6K 4E7JA 3N4QA 1MU2A 1WSJA 1JXEA 3LDLA 3O1WA 4E19A 1TAQA 1QSLA 4O0IA 2BUPA 3CCMN 4O55A 4NXNK 5AQLA 4FJNA 3PO4A 1BUPA 4HCBA 5HRSA 3ID8A 1K73O 2G8HA 4W5RA 3F73A 4MLEA 3LDOA 2HW3A 2P9SB 3I33A 3K59A 3L3VA 4E1JA 4CFCA 3U4LA 3ASMA 5AQZA 3KVGA 1R0AA 3AVBA 1VSIA 2ZF5O 4BE1A 3U3GA 1DLOA 4B3MK 1NKBA 4CFDA 4FWMA 3QEVA 4FCYA 3TSQA 4C1NK 4YDUC 5AQMA 2KHOA 4FYDA 2Q97A 5AJ3K 2O8FA 3SAFA 3VA0A 1YVNA 3P1GA 1C1AA 1Q7YO 1HPZA 2V51B 3CC4N 4DU3A 4DQPA 4KB0A 3THWB 1T05A 1TVRA 3MX2A 1GLDG 3AO5A 4JK8A 2QKKA 5GADP 2FBYA 3NCIA 2E8AA 3LM2A 1HNVA 3IMXA 2VG7A 3RMBA 1SKSA 4DF4A 4AHVA 3K2PA 3NH1A 1U04A 1Z6RA 5JMVA 4KHNA 3UKRA 4YY3K 3J7AP 4NB4A 4KPYA 1EX4A 4H0PA 5KQDA 3V6DA 3PLAA 1KCFA 3TTDA 2ASMA 3DAWA 2G8IA 3VEZA 1J6ZA 5M1OA 2YV0X 1VQMN 4CF0A 4KTZA 3PX6A 4FPAA 4J8FA 5DK5A 5KPRA 3AV9A 4BG8A 4DTXA 3VOVA 1SKRA 3V1OA 4B08A 1X9JA 4QOZB 2E2PA 4BRGA 1HRHA 3OBYA 4DQQA 2V7ZA 3C7NA 3SBTA 4RWTA 3NE6A 2OPQA 1A5XA 3MN6A 4FWQA 4JEPA 3MEDA 2VG5A 5AFUA 3AVKA 4DFKA 4M7YA 1R59O 5AQFA 3H1QA 3ZT0A 4WCEL 4BR9A 2BANA 3ZETA 2Q36A 4FLTA 3BUZB 4KFBA 3ZCMA 4N5SA 1TKDA 3WXIA 2LSNA 4CIFA 3S3NA 3VQ6A 3ZX2A 4ISEA 4BR0A 1J5EK 4X64K 3KWIA 2RE2A 1GLEG 2E2OA 3PX0A 2Z1HA 2YCHA 4RG8A 2XY8A 4FM2A 5HRPA 3PSFA 3KK2A 2A40A 1NOZA 4WYBA 1XNQK 4J2EA 4JLHA 4KH6A 3ZSOA 2QWNA 2E20A 4KHQA 4IZ9A 4HUEA 3NFAA 3T19A 3GE1A 3A5NC 1N8RO 3ZYYX 1D4XA 3O8MA 4FL9A 5AQGA 1GLBG 4AHSA 1UA0A 4IG3A 3CHWA 3OS0A 5M1FA 4Z4EA 2KTQA 1VSDA 4E7KA 1NK6A 1L3TA 1WSHA 4JKDA 4JI4K 4BVOA 1D5AA 4RW6A 1K8AO 4ZTJA 1NJIO 3QBXA 1YVUA 3F9MA 4CEBA 2JGUA 1IKVA 5AQQA 4JKGB 4Z4CA 4ELTA 4JI3K 4BACA 2QM1A 3BF1A 4CJEA 4FZYA 3CG7A 3ENBA 3E1YA 4H5WA 4FLVA 5AQWA 1K8KB 1LW2A 4I9QA 4CJRA 1IKWA 1FJGK 1NK5A 3VGMA 4AM7A 2P9IA 4O0JA 5B8HA 5IWAK 2P9UB 3G71N 1UWBA 3N4PA 1ASVA 4JKCA 3UKUA 4FK0A 1DTQA 4V19S 4BRPA 3KLHA 1I3AA 1C1CA 3D2FA 3PX4A 1RDWX 2VQEK 4IJNA 3SMSA 4K8ZA 3HM9A 3NGZA 3DLBA 3HOTA 4MFBA 1REVA 2ZGYA 1WSEA 4CEDA 4X65K 1QSYA 4FJXA 3OYGA 1WLJA 5AQKA 3OYDA 1I39A 4DTNA 3D2EB 4MO5A 1NLVA 4K25A 2PYJA 4FVUA 4JHDA 4DV3K 3K9JA 2FBTA 2KKZA 3I8BA 1IBMK 4BRAA 4EFHA 3RVCA 4RW4A 2UXDK 1W97L 3NGIA 2BDPA 2H3GX 1ESVA 4C8KA 1BL3A 4H5VA 3VQ7A 1SV5A 4FVMA 3SQ4A 1OKJA 1MDUB 3CCEN 1DGKN 4QS9A 3O08A 3QIOA 2HMPA 2O8CA 3B6PA 1BOTO 2R7YA 5J2MA 1WBDA 3WQTA 4ZTFA 3G6EN 1BDGA 3ULDA 1EXQA 1MWKA 1YTUA 1VQ5N 1NGCA 4EHUA 4DSEA 3I56N 1FW6A 2ZGZA 2BTFA 1TK0A 3CIPA 3DM2A 4FJKA 2NNWA 3OJUA 1O1WA 4NCGA 1S6QA 3AO1A 2GEMA 2X6NA 1TAUA 2XY6A 5EVZA 2HBJA 5CZ2A 4DCHA 3DRRA 2F9TA 3VEYA 3VEWA 1I94K 5AQJA 3SQ1A 2ZJPL 2FF3B 4JYAK 3BP8A 4DB3A 2D0OA 2O8EA 4KREA 4BDYA 4B8AB 2CGLA 3J81O 2Q0RA 1DTTA 4FLUA 3G4SN 2IVPA 2V7YA 4WQ5A 1TKTA 1TK8A 3A0IX 4KI6A 3ZT2A 2ZD1A 3QBWA 1N32K 4AM6A 1RDAA 3T1AA 4BC2A 4JI6K 4DR3K 4NCAA 3M3ZA 4B3OA 3O80A 3QFPA 1NKCA 1KRPA 4YNQA 3HO1A 2G8UA 5BR8K 4DU1A 1L3UA 4KHYA 2CH6A 3WXKA 3DXMA 2QK9A 2O8BA 1HYVA 2EX3A 4IO8A 1BG3A 3QNNA 3O9RA 4CJWA 3HYFA 4OJRA 2NRVA 4BQLA 5C42A 3CCJN 1S1VA 3O4WA 5BPMA 3TWHA 4FWRA 3J7ZO 5M1KA 4LFAK 4DMNA 5LY3A 1N34K 1NGAA 4DV4K 1D9FA 5GAGP 3AVGA 3TSPA 2YHAA 3B8AX 3ID6A 3J7YP 1RT3A 3F9KA 4W5QA 4DR5K 1GOBA 2OANA 3SJHA 5AQNA 1S5JA 4FM0A 3RMCA 4UY8O 1HJOA 2VG6A 4CD1A 3WEEB 3THYB 4GW6A 3ULEB 3OYNA 4NLCA 2E4LA 5TKYA 3VQAA 3OYMA 1NG9A 3VQ9A 4JKAA 4A2AA 2JWLA 2HVIA 3KLIA 1TL1A 4DV7K 4B1XB 2VCPA 1KAYA 5C10A 1RBSA 3FZKA 4JRPA 1NGGA 2HHQA 4FO0A 2HBLA 4JK7A 1OVYA 3VN5A 3K9KA 1NMDA 1JL2A 1JLAA 4BDPA 4CHNA 4PHTX 4GKJK 4DTOA 1UOCA 4C8LA 4KTQA 1VRTA 3OYBA 1LAVA 4DG1A 4G1QA 3VESA 3QERA 2Y1IA 5E41A 4H0YB 3VEVA 2YKMA 4IFYA 4TSXA 1TUYA 2CGKA 2F4VK 3THXB 4NXMK 3LP3A 1U49A 4CHOA 5FPNA 3RSEA 2W41A 3FE1A 3IRXA 4I2PA 4FOIA 2UUCK 5BRFA 1GLLO 1RTJA 2OZSA 3ALYA 5CHIA 4B1YB 1Z25A 5AQXA 4IEEA 3O9QA 4JKBA 4K0KK 5GAHP 3LM9A 3L6QA 3WT0A 4ELVA 3K5OA 2JWKA 1KFSA 4KHSA 3OYCA 4M7XA 4AF1A 4FJIA 5KGWA 3MN9A 4DR1K 4E7HA 1XUPO 3LL3A 1X9SA 2I7PA 1B9DA 1KVBA 1LWCA 3M1FA 4MO4A 1JLGA 2GUPA 4BRQA 5JLFA 4ILJA 1ITGA 4EP5A 3LDQA 1S22A 1OH8A 3HOSA 3V9SA 4H0XB 5C0YA 4AHTA 3OY9A 4W5NA 5EOYA 2FBVA 1KC8O 2A5XA 2FF6A 5FRMA 2HHVA 3KWGA 3AVMA 3VA3A 4AHUA 4LF5K 4CZMA 3TARA 3NF6A 4L3QA 4DSJA 3PIOL 3KKRA 4F4KA 3MX5A 3T1YK 3GL1A 2KFNA 3ZX0A 1WSIA 2OZMA 4DSLA 2VYPA 4JI5K 2FSKA 3E9LA 5BPNA 4FW2A 3KD1E 4BRMA 3A5MC 4XH5A 5MLCQ 4CJ4A 3O4NA 2RPIA 5HLFA 5HROA 1VQLN 3D6RA 3L2UA 4KO0A 1VQKN 2UXBK 4FZXC 1C0UA 2WBNA 5AQYA 3KK3A 1XI1A 4QS7A 1RBRA 3AVNA 5EU7A 4IOCL 3CJ9A 2VWKA 2IIRA 3VTIA 4BRNA 4IJAA 2HSTA 3ZEUA 2Y1JA 4CIGA 1RT1A 3P38A 3LZJA 4CIEA 4DFMA 1DEJA 3VF6A 1U47A 2BH1A 1S9EA 4FJHA 3A5OC 3NHGA 3MEEA 1YJWN 2Z1JA 5K14A 1ZC6A 3EZWA 5I9EB 4DF8A 4IOAL 1RFQA 2ZM6K 2P9KA 4RW9A 4LH5A 5FPEA 2YHXA 3I8DA 3C95A 4LF6K 3C6HA 3CJBA 1HX1A 4J2BA 4BG9A 3QNOA 3EE9A 2GWJA 4JAXA 3DOKA 4Z94A 4DTJA 4OX9K 3CYMA 3AA5X 4N41A 4DKWA 4HTUA 4DQ8A 3ZX3A 4FWKA 4BC5A 1KAZA 1NJWA 4CCHA 1W0HA 4H0TB 3AVHA 1N6QA 3V81A 3SV3A 4KH5A 4OLBA 2YHYA 2B5JA 4FLYA 4DQRA 2Q2RA 2CH5A 3CQ8A 2PYLA 1T8EA 4FWNA 3ISNC 1X9MA 3IG1A 3P31A 4BGBA 1WOQA 2OA8A 2HBMA 4CBWA 4M3UA 3S3MA 1JLQA 5AQPA 3ZSWA 4JS4A 4DR2K 1HJRA 5AZIA 4M63C 2W42A 3QESA 4B3RK 1GLJO 1IKYA 1ATSA 5LJVA 4EHTA 4PL8A 3O4QA 5CYQA 3LWLA 4CK1A 1Q8IA 1C0GA 1S72N 4DLGA 1QTMA 3RTVA 4XIUA 1NWKA 1NK4A 2P9LA 4AH9A 3CF5L 3LDPA 4GV3A 4E0DA 1YT3A 3HP6A 3PY8A 4FK4A 4O5FA 1VQ8N 4JI1K 2YX6A 4CK2A 2XY7A 1S3XA 4FSVA 4I6MA 1ATRA 4ILGB 1RNHA 1CZAN 5HP1A 1QHTA 2WFBA 3DXMB 2GWKA 4A2BA 3CMAN 1SKWA 1HNXK 2NRHA 3DXKB 3NVMA 1HR0K 1VAZA 3HRGA 5AR0A 3O1BA 2HF3A 1U2VB 1BA1A 5AQHA 2NRZA 1KLNA 1RDDA 3C6AA 3JSMA 3NF7A 3OYFA 1TKZA 3EKSA 1HYZA 2DFEA 1WSFA 4JKFA 1J53A 2IS3A
chains in the Genus database with same CATH topology
4CW7B 2ZM6K 4JI7K 4DR1K 4KHPK 4DV3K 1XMOK 4DV2K 4DV1K 4LFCK 1IBMK 1J5EK 4LF4K 4X64K 5FLXO 2HHHK 4B3MK 4LF6K 4GKKK 2UXDK 3OTOK 4AQYK 3T1HK 2UU9K 4LFAK 1XNQK 4LF8K 5AJ3K 4DV4K 1N34K 4DUYK 5A2QO 1IBKK 5LMNK 2VQFK 5LL6Z 4OX9K 4DR7K 3J7YP 4DR5K 1HNZK 4DR6K 5IT9O 4JI0K 1XMQK 1XNRK 4K0KK 1N36K 4LF5K 4B3SK 4DR2K 4JV5K 4JI4K 4YY3K 3J7AP 4DV7K 4DV0K 4LF7K 4LFBK 3JAMO 4B3TK 4JI8K 4X66K 3T1YK 4JI3K 4B3RK 1I94K 4DR4K 4JI5K 4JYAK 1FJGK 2UUBK 1IBLK 4X62K 3J81O 5IWAK 1HNWK 1N33K 2UXBK 4JI1K 4GKJK 4DV5K 2E5LK 4YHHK 4JI2K 1N32K 4DV6K 4DR3K 4V19S 4JI6K 1HNXK 4DUZK 5LMUK 1HR0K 4LF9K 2F4VK 4NXMK 2VQEK 4NXNK 3J80O 2UUCK 5BR8K 4X65K 2UUAK 2UXCK 4CVNE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CW7 B;  2ZM6 K;  4JI7 K;  4DR1 K;  4KHP K;  4DV3 K;  1XMO K;  4DV2 K;  4DV1 K;  4LFC K;  1IBM K;  1J5E K;  4LF4 K;  4X64 K;  5FLX O;  2HHH K;  4B3M K;  4LF6 K;  4GKK K;  2UXD K;  3OTO K;  4AQY K;  3T1H K;  2UU9 K;  4LFA K;  1XNQ K;  4LF8 K;  5AJ3 K;  4DV4 K;  1N34 K;  4DUY K;  5A2Q O;  1IBK K;  5LMN K;  2VQF K;  5LL6 Z;  4OX9 K;  4DR7 K;  3J7Y P;  4DR5 K;  1HNZ K;  4DR6 K;  5IT9 O;  4JI0 K;  1XMQ K;  1XNR K;  4K0K K;  1N36 K;  4LF5 K;  4B3S K;  4DR2 K;  4JV5 K;  4JI4 K;  4YY3 K;  3J7A P;  4DV7 K;  4DV0 K;  4LF7 K;  4LFB K;  3JAM O;  4B3T K;  4JI8 K;  4X66 K;  3T1Y K;  4JI3 K;  4B3R K;  1I94 K;  4DR4 K;  4JI5 K;  4JYA K;  1FJG K;  2UUB K;  1IBL K;  4X62 K;  3J81 O;  5IWA K;  1HNW K;  1N33 K;  2UXB K;  4JI1 K;  4GKJ K;  4DV5 K;  2E5L K;  4YHH K;  4JI2 K;  1N32 K;  4DV6 K;  4DR3 K;  4V19 S;  4JI6 K;  1HNX K;  4DUZ K;  5LMU K;  1HR0 K;  4LF9 K;  2F4V K;  4NXM K;  2VQE K;  4NXN K;  3J80 O;  2UUC K;  5BR8 K;  4X65 K;  2UUA K;  2UXC K;  4CVN E; 
#chains in the Genus database with same CATH topology
 2WON A;  4CW7 B;  4OPA A;  3DRS A;  1TGO A;  3CQX A;  3SMP A;  2OPP A;  4JI7 K;  1XMO K;  3IKM A;  4LFC K;  2ITM A;  3CD6 N;  2V52 B;  1KSP A;  5JIC A;  3SUN A;  4CEF A;  2P5O A;  2I7N A;  1H1V A;  4CHQ A;  3OYI A;  3K57 A;  3VQ4 A;  2G8K A;  3P39 A;  2VQF K;  4GMJ B;  1CZB A;  1A5V A;  4JD2 A;  3KLE A;  1RTI A;  3G0Z A;  2PZS A;  5FDL A;  3VGL A;  1BIU A;  4FWS A;  3SLC A;  1T44 A;  4CZH A;  1Y97 A;  3QML A;  3HT3 A;  5I3U A;  2B6A A;  4YDU A;  3DLH A;  5ADX H;  2QXF A;  1V4T A;  4B3S K;  3J8A A;  5CR4 A;  5AZJ B;  3CJ7 A;  1QHA A;  1S1U A;  4YOR A;  3LZI A;  5C2D A;  4DHY A;  3QB0 A;  1ASU A;  2HB5 A;  1HLU A;  3WNH A;  2E6M A;  2O8D A;  4IO9 L;  5HRN A;  1TL3 A;  4DLE A;  4F8R A;  1WSG A;  1FK9 A;  3H08 A;  3QEI A;  1Z05 A;  3MWP A;  3FGU A;  1GLC G;  1IBL K;  3RSE B;  5BN8 A;  4C23 A;  1YIT N;  3QFU A;  3L2W A;  2QWP A;  3NH2 A;  1S9G A;  1N33 K;  3P83 D;  3OS2 A;  4DTM A;  4MQ3 A;  3RMA A;  1JJ2 M;  1LWE A;  3KHY A;  4QCL A;  4RW7 A;  3HVT A;  3LAM A;  4KV8 A;  3AAP A;  1U45 A;  2IDO A;  4GY2 B;  1JLE A;  5DM7 L;  2QI2 A;  3EL2 A;  4XH1 A;  2HHU A;  2D1K A;  1X3N A;  1YAG A;  3R9P A;  3WUH A;  4IEI A;  3VTH A;  3MEC A;  3EYZ A;  4M41 A;  3GOI A;  2DFH A;  4CGI A;  3M6G A;  4ILH A;  4DWI A;  4BRK A;  1P8Z A;  4FWL A;  4CEC A;  3O3G A;  3M8S A;  3LAK A;  3OYH A;  3CM5 A;  3L4I A;  1JCF A;  4M3X A;  3FR0 A;  4DV1 K;  3ATV A;  2VWB A;  4OPJ A;  2HHH K;  1OVQ A;  1G99 A;  4Q0B A;  4K43 A;  4OVL A;  1TYQ A;  3H46 O;  5AQV A;  4LF8 K;  2EHG A;  3IUC A;  3HL8 A;  1Q18 A;  2QEX N;  3CPW M;  1EWQ A;  1W7A A;  2P9N A;  3UIQ A;  2D0C A;  1WN7 A;  5GIP A;  3BGR A;  3L2R A;  3T3F A;  1Q9X A;  3P5J A;  3JXU A;  4CFA A;  4K42 A;  4A5B A;  1TKX A;  3TTC A;  1NOY A;  3O6W A;  2FSJ A;  4WQ4 C;  1DT9 A;  3AA2 A;  1KVA A;  1JXB A;  2P51 A;  1NGF A;  2ITG A;  3HM8 A;  3K5N A;  1GOA A;  1VQ4 N;  2E2N A;  1KTQ A;  1C0M A;  1HKC A;  2NRT A;  2YJE A;  4CJQ A;  3EE8 A;  4CJS A;  2E1Z A;  4I7F A;  4EAH D;  1VQN N;  3CCR N;  2UUB K;  3KLG A;  3E9O A;  4CBX A;  3GG4 A;  3NF8 A;  4MLH A;  5F1X A;  4B8C A;  4UQG A;  2X74 A;  4Q5V A;  3SQ2 A;  1M1K O;  2RHK A;  3QLH A;  3SQ0 A;  1FKO A;  2X6S A;  4H03 B;  1Q86 O;  3PIP L;  1IV0 A;  1B92 A;  4FLX A;  1NNE A;  1VQO N;  1M90 O;  4HCC A;  4DU4 A;  1YHQ N;  2D5R A;  3RRG A;  4LF9 K;  1KVC A;  3I55 N;  4CI6 A;  4J2A A;  4GV6 A;  1YTA A;  2ZWH A;  1SUQ A;  3SBG A;  3O9U A;  3MN5 A;  1T6C A;  3AO4 A;  3VMF B;  4O4G A;  2P9S A;  4ISF A;  3NBP A;  5KPT A;  4R5P A;  1KQS M;  2EWS A;  1NGB A;  1JKH A;  1VQ7 N;  2HMI A;  3WXL A;  5BRE A;  4FLZ A;  4BRC A;  4DFJ A;  3SUP A;  1UAX A;  2D4W A;  5JS1 A;  1E3M A;  1WNS A;  4WE1 A;  1U48 A;  3IDH A;  4OLA A;  4RCH A;  1L3V A;  2G8W A;  1B9F A;  5CZ1 A;  2F8T A;  2Z1G A;  3L3U A;  5SWM A;  4BRO A;  1NGE A;  2AP1 A;  1BO5 O;  4CHY A;  2O8F B;  4PKG A;  1JL1 A;  2E6L A;  1VHX A;  4Y1C A;  2ASO A;  4HWI A;  1IG8 A;  3I0S A;  5AZI B;  3U9Z A;  2A1R A;  3ZT3 A;  3SI6 A;  3K5L A;  3THW A;  4LD0 A;  2J4R A;  4CJK A;  2FSN A;  4M3W A;  3F2K A;  1BI4 A;  4N56 A;  3DYA A;  4CZL A;  1XHZ A;  1SQK A;  4U67 L;  1XNR K;  3CQY A;  4FWO A;  5JLH A;  4B9V A;  1JLF A;  3QEP A;  5AQU A;  3UKR B;  4CEQ A;  1YF5 L;  5M1N A;  4B1U B;  2DPN A;  3R3L A;  3PSI A;  3IS9 A;  4HHT A;  4KHW A;  1SL1 A;  3NDK A;  4EP4 A;  4BQZ A;  2Q1N A;  3NAE A;  1YJ9 N;  4CGG A;  4L8R B;  5KPZ A;  4BVP A;  4CK3 A;  3VF4 A;  4MDB A;  2NZT A;  3R1X A;  1K9M O;  2HNY A;  3OYE A;  2XY5 A;  1NK0 A;  3HI0 A;  5C25 A;  4CJ7 A;  1D8Y A;  4OGC A;  2NRR A;  1VRU A;  5HL7 L;  4FW1 A;  3PO5 A;  4EZ6 A;  4BRH A;  3KK1 A;  3C7N B;  1GLA G;  4NCB A;  3CCQ N;  3V9U A;  4CZE A;  3O5B A;  3VEX A;  3K5M A;  2HF4 A;  3A2F A;  1QS4 A;  3B6O A;  4YOV A;  3DLK A;  4O8K A;  3KLF A;  5LJW A;  3AA4 A;  3CFR A;  3QIN A;  2QW9 A;  3ZET B;  1X1P A;  4CBU A;  2AJQ A;  3LP0 A;  4B9N A;  1JLC A;  2GBZ A;  4E7L A;  2YHW A;  1NM1 A;  1XC3 A;  1LWF A;  5FLX O;  3AAR A;  2YNF A;  4B9M A;  1XWL A;  4AQY K;  3KKS A;  2ETJ A;  4DQI A;  2GX9 A;  2YNH A;  1YUW A;  4DSK A;  3CXC M;  4B1W B;  3QET A;  1VSJ A;  4IG0 A;  3HXM A;  3P4I A;  1LCU A;  2E2Q A;  1T7P A;  3TI0 A;  1BHL A;  3V9Z A;  5FPD A;  2KLA A;  3ATU A;  5DM6 L;  1P90 A;  3OS1 A;  3HST B;  1S6P A;  3CET A;  4JI0 K;  1E4G T;  3BDP A;  3SCX A;  3ZT4 A;  1KXP A;  1L5U A;  3TTF A;  4B9U A;  2JLE A;  3HP9 A;  3E01 A;  3M5R A;  4Z4I A;  3E9P A;  4CGJ A;  2RF2 A;  2P9P A;  3TAM A;  3O3H A;  3KJV A;  4JRQ A;  3LDS A;  4LFB K;  4IXC A;  4A62 A;  2E1Y A;  3JYT A;  3ZSV A;  5J1E A;  5F2R A;  4C8O A;  1T6D A;  2HHX A;  3Q7B A;  3GDQ A;  2QWR A;  1VQ9 N;  1RIL A;  2P9I B;  1KLM A;  2P9U A;  4DSF A;  4XH4 A;  1GOC A;  1VK0 A;  4BWM A;  3NMU A;  3AVF A;  3NVK A;  4KI4 A;  1RT4 A;  1HQE A;  4BR5 A;  3UKU B;  1FKP A;  3TAF A;  3VQC A;  2IVN A;  3D7E O;  3D2F B;  1NK9 A;  3OHR A;  5GIO A;  2HND A;  4CZI A;  3C6U A;  1WAF A;  4F2S A;  4ID1 A;  2YKN A;  2O4G A;  4B9Q A;  3MXJ A;  4H5R A;  3SNN A;  3VEO A;  3L4Q A;  2WTU A;  4JS5 A;  5C12 A;  4CD3 A;  5EX5 A;  4CVN E;  4JKH A;  3M8P A;  1OH5 A;  1XC9 A;  2HHW A;  3D2E A;  3EN9 A;  3VET A;  1YJN N;  2YI1 A;  3ZSZ A;  4CEZ A;  4JHD B;  2OYQ A;  2A1S A;  4ISG A;  4LF4 K;  4M42 A;  2W40 A;  3G25 A;  4JN4 A;  1VSH A;  1LV5 A;  3RR7 A;  1GLF O;  4OKJ A;  4WFA L;  4DQS A;  3K0S A;  3T1H K;  3LP2 A;  1NMN A;  1HYS A;  2BGG A;  3ZSR A;  1WBB A;  2G8V A;  5LMN K;  3WQU A;  3CCU N;  4BWJ A;  3S3O A;  4DR7 K;  2O8C B;  4BE0 A;  4A57 A;  4FJG A;  3HZ6 A;  3OW2 M;  2DTU A;  1WB9 A;  3ITH A;  2NRW A;  2OPS A;  2FXU A;  2OTL N;  4Z4G A;  3CJ1 A;  1U6Z A;  3Q7C A;  3KIO A;  3QEX A;  1Q82 O;  4KBO A;  4CEE A;  3SYZ A;  4ID5 A;  4YOX A;  3KK7 A;  3IAY A;  4K41 A;  3VQD A;  4OKE A;  3MAQ A;  5J2P A;  1J5O A;  3WNG A;  4CF1 A;  3HTV A;  3HK2 A;  5GIN A;  4BY9 C;  2WOM A;  2PY5 A;  2O8E B;  5KRT A;  4B1V A;  4IOX A;  5AQS A;  5C15 A;  3CME N;  3V1Q A;  1CLQ A;  1TK5 A;  5BR9 A;  4DV5 K;  4FLW A;  3S9H A;  1IKX A;  3V4I A;  2IAJ A;  3CCS N;  4N47 A;  4AHC A;  2XHB A;  4DUZ K;  4C8N A;  2VWJ A;  4FJL A;  3OA9 A;  1CXQ A;  3CC7 N;  4CER A;  4N76 A;  1NU0 A;  3QIC A;  3HPH A;  4M3T A;  4C8M A;  2X78 A;  4OO1 J;  3SPZ A;  4JKE A;  4FJ9 A;  3CFO A;  2GUI A;  1Q81 O;  3FZL A;  5KRS A;  2OPR A;  3CJA A;  3DJC A;  1QQM A;  4DS5 A;  4HTL A;  1TV6 A;  1BQN A;  2QXL A;  3L2V A;  3M8R A;  5KQ8 A;  1ZBU A;  3LP1 A;  3CER A;  3RR8 A;  3CPE A;  4CZF A;  3AO3 A;  5EXW A;  1VSM A;  1SL0 A;  4CZJ A;  3H3N O;  3HPO A;  2O8B B;  1LAW A;  3SAG A;  1BI4 B;  3C65 A;  2Q3S A;  3AVI A;  4A61 A;  1MA9 B;  4CEO A;  4CHP A;  3T69 A;  3UB5 A;  4BDZ A;  4FZZ A;  4FPB A;  1IBK K;  1C1B A;  4F3O A;  4FM1 A;  4KHU A;  1KFD A;  3ZSQ A;  5J2N A;  1X9W A;  1X3M A;  4MDA A;  4DTU A;  1JCG A;  3T7Z A;  3AGR A;  4IDH A;  2RN2 A;  2G8F A;  3ZSX A;  1HNZ K;  1RDB A;  3EO3 A;  5BPL A;  1CZ9 A;  3WEE A;  5T7B A;  3THY A;  2E88 A;  1RDU A;  3ULE A;  3HJF A;  4ICL A;  4Y0W A;  1QQN A;  4JK9 A;  3VER A;  1BQM A;  4ZHR A;  4YOY A;  3TAP A;  1YIJ N;  3ZSY A;  1W2B M;  1LW0 A;  3QEW A;  1RTD A;  3QIP A;  2FC0 A;  1T03 A;  3VQ5 A;  4GNI A;  3OYJ A;  4BRL A;  3DLE A;  2NUB A;  2F9W A;  2W6L A;  4J2D A;  1DKG D;  3BZK A;  4U7B A;  3DRP A;  4CJF A;  3WNE A;  1Z26 A;  1HNW K;  1BU6 O;  1S1X A;  4CZG A;  4F9O A;  3OYK A;  1F21 A;  2D0P A;  4CE9 A;  4BC4 A;  4Z4F A;  3DLR A;  1BCM A;  4HUG A;  4YOW A;  3HBT A;  2QA4 N;  3SV4 A;  2HHS A;  1A5W A;  4IFE A;  4DFP A;  3L0Q A;  3KZB A;  5CYM A;  4O8U A;  3K58 A;  3THX A;  2FLO A;  3AAQ A;  4R79 A;  1ZBL A;  4E1N A;  2KW4 A;  3AO2 A;  3WNF A;  2XO7 A;  1RGI A;  3VGK A;  1C0F A;  4Z4H A;  4PWD A;  4E89 A;  3MMV A;  1IO2 A;  3MWT A;  4KH4 A;  3U9D A;  2Z1I A;  2Q0U A;  5BRD A;  4CJU A;  1BCO A;  3AVC A;  4E1M A;  4IWV A;  4KAZ A;  2HNZ A;  1WAJ A;  3L8B A;  3PUF A;  1SL2 A;  3RWU A;  5AQT A;  1EWR A;  2QWL A;  5C24 A;  3ENO A;  4A59 A;  5E84 A;  1G15 A;  3FZH A;  5FRN A;  3F5T A;  5JVH L;  1JLB A;  2WUS A;  1S1T A;  5CE3 A;  5E26 A;  4FJ5 A;  1SAZ A;  4IFV A;  4YFU A;  3M8Q A;  2UU9 K;  2OTJ N;  4PKI A;  1V4S A;  2P9P B;  4KRF A;  2QTD A;  5LL6 Z;  2P5G A;  3DMJ A;  1BA0 A;  4KTW A;  1RT5 A;  2YNG A;  1ZBH A;  3SPY A;  1ZYQ A;  4BR2 A;  4DR6 K;  5IT9 O;  5HRR A;  2NRX A;  3OYL A;  1T3V A;  3LWM A;  3TSU A;  5TKW A;  3U3Y A;  3TAB A;  1D9D A;  2IGI A;  5KI6 A;  3DOL A;  1RCH A;  2IVO A;  4WQ5 C;  1N5Y A;  3MCP A;  4B3T K;  4B9S A;  1J54 A;  3NF9 A;  4I2Q A;  4BRD A;  4NYF A;  3EKU A;  3LDN A;  1W9H A;  2D0B A;  3SK3 A;  2W6K A;  1QSS A;  1TUU A;  1ATN A;  4CJT A;  3R8E A;  1QZ6 A;  4GV9 A;  3V9W A;  4E3S A;  4H5N A;  4Z0U A;  3TR8 A;  5ELZ A;  1NBW A;  1LOT B;  3ENH A;  5JS2 A;  4OGE A;  5KTQ A;  4CZK A;  5FRO A;  3SUQ A;  4DS4 A;  4LC9 B;  2NLX A;  4EIA A;  3ZT1 A;  3GBT A;  3H1V X;  4W5O A;  4FWP A;  2QKB A;  4RTF D;  4PQU A;  1QZ5 A;  4AIL C;  4CGD A;  3ZEU B;  2PBD A;  4LSL A;  3U8X A;  1K6Y A;  3AVL A;  5GAE P;  3D45 A;  1KAX A;  2ASP A;  4BE2 A;  4EZ9 A;  4CJV A;  3CJC A;  3MK6 A;  3SUO A;  1ZXO A;  2O4I A;  3DLL L;  5C2F A;  4NLB A;  3NGY A;  2HBK A;  2P9K B;  5BN9 A;  4KHP K;  5M1Q A;  3C94 A;  4CEA A;  3MXI A;  2F96 A;  3TAQ A;  1NGH A;  2KQ2 A;  3VF2 A;  2P1J A;  3BZC A;  2Q31 A;  4DUY K;  1QQC A;  3CCL N;  4AHR A;  3BY5 A;  3LAL A;  1O13 A;  4PUO A;  1KD1 O;  3O9T A;  1ZBS A;  3VQP A;  4O5B A;  1ZBF A;  4NO7 A;  2YNI A;  3C6T A;  4ELU A;  1XMQ K;  2IC3 A;  5CY4 A;  4BRE A;  3CFP A;  2ZJR L;  5AQI A;  4OPK A;  1RTH A;  2WC9 A;  4M3Z A;  4IDK A;  2CGJ A;  4F2R A;  2DY4 A;  3H45 C;  4CGH A;  3U6F A;  2KZZ A;  2F8S A;  1EKE A;  4JI8 K;  4X66 K;  4CJL A;  3FFI A;  1ASW A;  3CM6 A;  2ATQ A;  4DR4 K;  1HPM A;  2FBX A;  4BR7 A;  4YOU A;  1XHX A;  3TAG A;  3MXM A;  3MDQ A;  2P9L B;  2B4J A;  4BC3 A;  1OH7 A;  4X62 K;  4M3Y A;  2BE2 A;  3H3O B;  4CF9 A;  5FPM A;  3AVA A;  4H4M A;  4WQ4 A;  1YXQ A;  5H1S Q;  1VQP N;  3VEN A;  1VSK A;  3FLC O;  4YHH K;  3E66 A;  3EZ5 A;  4I6M B;  2YHB A;  2OCE A;  3DXK A;  3FZF A;  2I5J A;  5JVG L;  1HKB A;  1BIZ A;  4A5A A;  4CF8 A;  3KD5 E;  2VGN A;  3V9X A;  1QE1 A;  5LMU K;  3MN7 A;  3BEX A;  1ZBI A;  3L2Q A;  3EEQ A;  5DMR A;  1NK8 A;  4CJ5 A;  1U2V A;  1CXU A;  3CI5 A;  3LAN A;  1ILY A;  3FFK B;  3FZM A;  4CHZ A;  4GVE A;  3WXM B;  4DSI A;  3J80 O;  3KTQ A;  4M45 A;  3TAN A;  5KGX A;  2XRI A;  1NGJ A;  4IKF A;  4XEI A;  4DTP A;  4K8X A;  2UUA K;  4FXD A;  3DWL A;  2UXC K;  3TAE A;  4H0V B;  1RBU A;  4PL7 A;  1Y64 A;  1MWM A;  5HBM A;  3WXJ A;  1BGX T;  4NYN A;  1NKE A;  2IOC A;  4G9Z A;  4DV2 K;  1U4B A;  3HVR A;  4FOE A;  1S1W A;  1RT2 A;  1EQY A;  4GKK K;  2GTD A;  4FJJ A;  1VSF A;  1E4F T;  3OTO K;  4B1Z A;  3VPZ A;  2UYT A;  3AGK A;  3AY9 A;  2AA4 A;  1HNI A;  5ADX A;  2DFF A;  2QWM A;  2ZQB A;  4QS8 A;  5J2Q A;  1RT7 A;  2RKI A;  3I0R A;  4JD2 B;  2A6A A;  4H4O A;  3ZLJ A;  1SZ2 A;  2PFU A;  1WUA A;  4CGF A;  3AA3 A;  3O3F A;  1BWF O;  3IFR A;  4CFB A;  4CF2 A;  4OPH A;  4B9T A;  5AFU H;  5D3G A;  2A41 A;  4W5T A;  1N36 K;  1NK7 A;  3HSC A;  5AZJ A;  4JV5 K;  2A3Z A;  3SZ2 A;  2QWO A;  3G10 A;  3MCA B;  3OYA A;  4LF7 K;  1UA1 A;  3NH0 A;  3BF3 A;  4Y1D A;  4WFN L;  4LY7 A;  4KKO A;  1IJJ A;  4CES A;  4FJ8 A;  2O8D B;  4DTR A;  1BIS A;  3D0P A;  3CCV N;  1C6V A;  2KZM A;  4HVJ A;  2HOE A;  1QQO A;  2GV9 A;  3SJJ A;  3QDK A;  1HQU A;  3OJS A;  4BR4 A;  1YI2 N;  1HMV A;  4GVM A;  3LPT A;  3W3D A;  3PV8 A;  4FK2 A;  1JCE A;  2ZE2 A;  4JKG A;  4CJ3 A;  1EP4 A;  1XQS C;  3MEG A;  3OVN A;  5M1P A;  3O9S A;  2D0A A;  3JS6 A;  5AQR A;  1K8K A;  4IBN A;  2ZJQ L;  3UE5 A;  4BGA A;  3HPG A;  1NJX A;  5AQO A;  4C1N I;  2GEL A;  1NJZ A;  1RT6 A;  4H5T A;  4WF9 L;  3LPU A;  4BRF A;  1C0T A;  4QAG A;  4BRI A;  4LSN A;  1IH7 A;  3RMD A;  3THV A;  4FJM A;  3TU5 A;  1NGI A;  4YOT A;  1SS6 A;  2F7T A;  1EO1 A;  3A8Y A;  4LH4 A;  3AVJ A;  4H8K A;  1IG9 A;  5SZT A;  2VGM A;  1J9A A;  1RDC A;  1Q9Y A;  3RRH A;  1TYQ B;  3VQ8 A;  3VQE A;  3TPQ A;  4E7I A;  4HUF A;  5A2Q O;  4JNE A;  2A42 A;  1OH6 A;  5I42 A;  1RBV A;  3S41 A;  3V1R A;  4PY5 A;  4F3T A;  1VSL A;  3W0L A;  2QWQ A;  4RW8 A;  1HUX A;  2P9N B;  2KFZ A;  4H0O A;  4CJP A;  4I9L A;  4M3R A;  3OBW A;  4OKK A;  3H6E A;  2HVH A;  1NGD A;  2PAV A;  1L3S A;  2YJF A;  4PKH A;  3VQB A;  4DV0 K;  3JAM O;  2HHT A;  1RBT A;  3EY1 A;  4O44 A;  5BRH A;  3DI6 A;  3VQQ A;  4KB1 A;  1QVF M;  5F0X A;  1NJY A;  5EY4 A;  4DTS A;  3R6M A;  1FXX A;  1QVG M;  4B9L A;  3A5L C;  3QO9 A;  3C0B A;  1EET A;  3CC2 N;  4FJ7 A;  5HOO A;  1VQ6 N;  1HKG A;  4WFB L;  1VSE A;  2E5L K;  4PA1 A;  4JI2 K;  3SAH A;  3DLG A;  4DV6 K;  4E7J A;  3N4Q A;  1MU2 A;  1WSJ A;  1JXE A;  3LDL A;  3O1W A;  4E19 A;  1TAQ A;  1QSL A;  4O0I A;  2BUP A;  3CCM N;  4O55 A;  4NXN K;  5AQL A;  4FJN A;  3PO4 A;  1BUP A;  4HCB A;  5HRS A;  3ID8 A;  1K73 O;  2G8H A;  4W5R A;  3F73 A;  4MLE A;  3LDO A;  2HW3 A;  2P9S B;  3I33 A;  3K59 A;  3L3V A;  4E1J A;  4CFC A;  3U4L A;  3ASM A;  5AQZ A;  3KVG A;  1R0A A;  3AVB A;  1VSI A;  2ZF5 O;  4BE1 A;  3U3G A;  1DLO A;  4B3M K;  1NKB A;  4CFD A;  4FWM A;  3QEV A;  4FCY A;  3TSQ A;  4C1N K;  4YDU C;  5AQM A;  2KHO A;  4FYD A;  2Q97 A;  5AJ3 K;  2O8F A;  3SAF A;  3VA0 A;  1YVN A;  3P1G A;  1C1A A;  1Q7Y O;  1HPZ A;  2V51 B;  3CC4 N;  4DU3 A;  4DQP A;  4KB0 A;  3THW B;  1T05 A;  1TVR A;  3MX2 A;  1GLD G;  3AO5 A;  4JK8 A;  2QKK A;  5GAD P;  2FBY A;  3NCI A;  2E8A A;  3LM2 A;  1HNV A;  3IMX A;  2VG7 A;  3RMB A;  1SKS A;  4DF4 A;  4AHV A;  3K2P A;  3NH1 A;  1U04 A;  1Z6R A;  5JMV A;  4KHN A;  3UKR A;  4YY3 K;  3J7A P;  4NB4 A;  4KPY A;  1EX4 A;  4H0P A;  5KQD A;  3V6D A;  3PLA A;  1KCF A;  3TTD A;  2ASM A;  3DAW A;  2G8I A;  3VEZ A;  1J6Z A;  5M1O A;  2YV0 X;  1VQM N;  4CF0 A;  4KTZ A;  3PX6 A;  4FPA A;  4J8F A;  5DK5 A;  5KPR A;  3AV9 A;  4BG8 A;  4DTX A;  3VOV A;  1SKR A;  3V1O A;  4B08 A;  1X9J A;  4QOZ B;  2E2P A;  4BRG A;  1HRH A;  3OBY A;  4DQQ A;  2V7Z A;  3C7N A;  3SBT A;  4RWT A;  3NE6 A;  2OPQ A;  1A5X A;  3MN6 A;  4FWQ A;  4JEP A;  3MED A;  2VG5 A;  5AFU A;  3AVK A;  4DFK A;  4M7Y A;  1R59 O;  5AQF A;  3H1Q A;  3ZT0 A;  4WCE L;  4BR9 A;  2BAN A;  3ZET A;  2Q36 A;  4FLT A;  3BUZ B;  4KFB A;  3ZCM A;  4N5S A;  1TKD A;  3WXI A;  2LSN A;  4CIF A;  3S3N A;  3VQ6 A;  3ZX2 A;  4ISE A;  4BR0 A;  1J5E K;  4X64 K;  3KWI A;  2RE2 A;  1GLE G;  2E2O A;  3PX0 A;  2Z1H A;  2YCH A;  4RG8 A;  2XY8 A;  4FM2 A;  5HRP A;  3PSF A;  3KK2 A;  2A40 A;  1NOZ A;  4WYB A;  1XNQ K;  4J2E A;  4JLH A;  4KH6 A;  3ZSO A;  2QWN A;  2E20 A;  4KHQ A;  4IZ9 A;  4HUE A;  3NFA A;  3T19 A;  3GE1 A;  3A5N C;  1N8R O;  3ZYY X;  1D4X A;  3O8M A;  4FL9 A;  5AQG A;  1GLB G;  4AHS A;  1UA0 A;  4IG3 A;  3CHW A;  3OS0 A;  5M1F A;  4Z4E A;  2KTQ A;  1VSD A;  4E7K A;  1NK6 A;  1L3T A;  1WSH A;  4JKD A;  4JI4 K;  4BVO A;  1D5A A;  4RW6 A;  1K8A O;  4ZTJ A;  1NJI O;  3QBX A;  1YVU A;  3F9M A;  4CEB A;  2JGU A;  1IKV A;  5AQQ A;  4JKG B;  4Z4C A;  4ELT A;  4JI3 K;  4BAC A;  2QM1 A;  3BF1 A;  4CJE A;  4FZY A;  3CG7 A;  3ENB A;  3E1Y A;  4H5W A;  4FLV A;  5AQW A;  1K8K B;  1LW2 A;  4I9Q A;  4CJR A;  1IKW A;  1FJG K;  1NK5 A;  3VGM A;  4AM7 A;  2P9I A;  4O0J A;  5B8H A;  5IWA K;  2P9U B;  3G71 N;  1UWB A;  3N4P A;  1ASV A;  4JKC A;  3UKU A;  4FK0 A;  1DTQ A;  4V19 S;  4BRP A;  3KLH A;  1I3A A;  1C1C A;  3D2F A;  3PX4 A;  1RDW X;  2VQE K;  4IJN A;  3SMS A;  4K8Z A;  3HM9 A;  3NGZ A;  3DLB A;  3HOT A;  4MFB A;  1REV A;  2ZGY A;  1WSE A;  4CED A;  4X65 K;  1QSY A;  4FJX A;  3OYG A;  1WLJ A;  5AQK A;  3OYD A;  1I39 A;  4DTN A;  3D2E B;  4MO5 A;  1NLV A;  4K25 A;  2PYJ A;  4FVU A;  4JHD A;  4DV3 K;  3K9J A;  2FBT A;  2KKZ A;  3I8B A;  1IBM K;  4BRA A;  4EFH A;  3RVC A;  4RW4 A;  2UXD K;  1W97 L;  3NGI A;  2BDP A;  2H3G X;  1ESV A;  4C8K A;  1BL3 A;  4H5V A;  3VQ7 A;  1SV5 A;  4FVM A;  3SQ4 A;  1OKJ A;  1MDU B;  3CCE N;  1DGK N;  4QS9 A;  3O08 A;  3QIO A;  2HMP A;  2O8C A;  3B6P A;  1BOT O;  2R7Y A;  5J2M A;  1WBD A;  3WQT A;  4ZTF A;  3G6E N;  1BDG A;  3ULD A;  1EXQ A;  1MWK A;  1YTU A;  1VQ5 N;  1NGC A;  4EHU A;  4DSE A;  3I56 N;  1FW6 A;  2ZGZ A;  2BTF A;  1TK0 A;  3CIP A;  3DM2 A;  4FJK A;  2NNW A;  3OJU A;  1O1W A;  4NCG A;  1S6Q A;  3AO1 A;  2GEM A;  2X6N A;  1TAU A;  2XY6 A;  5EVZ A;  2HBJ A;  5CZ2 A;  4DCH A;  3DRR A;  2F9T A;  3VEY A;  3VEW A;  1I94 K;  5AQJ A;  3SQ1 A;  2ZJP L;  2FF3 B;  4JYA K;  3BP8 A;  4DB3 A;  2D0O A;  2O8E A;  4KRE A;  4BDY A;  4B8A B;  2CGL A;  3J81 O;  2Q0R A;  1DTT A;  4FLU A;  3G4S N;  2IVP A;  2V7Y A;  4WQ5 A;  1TKT A;  1TK8 A;  3A0I X;  4KI6 A;  3ZT2 A;  2ZD1 A;  3QBW A;  1N32 K;  4AM6 A;  1RDA A;  3T1A A;  4BC2 A;  4JI6 K;  4DR3 K;  4NCA A;  3M3Z A;  4B3O A;  3O80 A;  3QFP A;  1NKC A;  1KRP A;  4YNQ A;  3HO1 A;  2G8U A;  5BR8 K;  4DU1 A;  1L3U A;  4KHY A;  2CH6 A;  3WXK A;  3DXM A;  2QK9 A;  2O8B A;  1HYV A;  2EX3 A;  4IO8 A;  1BG3 A;  3QNN A;  3O9R A;  4CJW A;  3HYF A;  4OJR A;  2NRV A;  4BQL A;  5C42 A;  3CCJ N;  1S1V A;  3O4W A;  5BPM A;  3TWH A;  4FWR A;  3J7Z O;  5M1K A;  4LFA K;  4DMN A;  5LY3 A;  1N34 K;  1NGA A;  4DV4 K;  1D9F A;  5GAG P;  3AVG A;  3TSP A;  2YHA A;  3B8A X;  3ID6 A;  3J7Y P;  1RT3 A;  3F9K A;  4W5Q A;  4DR5 K;  1GOB A;  2OAN A;  3SJH A;  5AQN A;  1S5J A;  4FM0 A;  3RMC A;  4UY8 O;  1HJO A;  2VG6 A;  4CD1 A;  3WEE B;  3THY B;  4GW6 A;  3ULE B;  3OYN A;  4NLC A;  2E4L A;  5TKY A;  3VQA A;  3OYM A;  1NG9 A;  3VQ9 A;  4JKA A;  4A2A A;  2JWL A;  2HVI A;  3KLI A;  1TL1 A;  4DV7 K;  4B1X B;  2VCP A;  1KAY A;  5C10 A;  1RBS A;  3FZK A;  4JRP A;  1NGG A;  2HHQ A;  4FO0 A;  2HBL A;  4JK7 A;  1OVY A;  3VN5 A;  3K9K A;  1NMD A;  1JL2 A;  1JLA A;  4BDP A;  4CHN A;  4PHT X;  4GKJ K;  4DTO A;  1UOC A;  4C8L A;  4KTQ A;  1VRT A;  3OYB A;  1LAV A;  4DG1 A;  4G1Q A;  3VES A;  3QER A;  2Y1I A;  5E41 A;  4H0Y B;  3VEV A;  2YKM A;  4IFY A;  4TSX A;  1TUY A;  2CGK A;  2F4V K;  3THX B;  4NXM K;  3LP3 A;  1U49 A;  4CHO A;  5FPN A;  3RSE A;  2W41 A;  3FE1 A;  3IRX A;  4I2P A;  4FOI A;  2UUC K;  5BRF A;  1GLL O;  1RTJ A;  2OZS A;  3ALY A;  5CHI A;  4B1Y B;  1Z25 A;  5AQX A;  4IEE A;  3O9Q A;  4JKB A;  4K0K K;  5GAH P;  3LM9 A;  3L6Q A;  3WT0 A;  4ELV A;  3K5O A;  2JWK A;  1KFS A;  4KHS A;  3OYC A;  4M7X A;  4AF1 A;  4FJI A;  5KGW A;  3MN9 A;  4DR1 K;  4E7H A;  1XUP O;  3LL3 A;  1X9S A;  2I7P A;  1B9D A;  1KVB A;  1LWC A;  3M1F A;  4MO4 A;  1JLG A;  2GUP A;  4BRQ A;  5JLF A;  4ILJ A;  1ITG A;  4EP5 A;  3LDQ A;  1S22 A;  1OH8 A;  3HOS A;  3V9S A;  4H0X B;  5C0Y A;  4AHT A;  3OY9 A;  4W5N A;  5EOY A;  2FBV A;  1KC8 O;  2A5X A;  2FF6 A;  5FRM A;  2HHV A;  3KWG A;  3AVM A;  3VA3 A;  4AHU A;  4LF5 K;  4CZM A;  3TAR A;  3NF6 A;  4L3Q A;  4DSJ A;  3PIO L;  3KKR A;  4F4K A;  3MX5 A;  3T1Y K;  3GL1 A;  2KFN A;  3ZX0 A;  1WSI A;  2OZM A;  4DSL A;  2VYP A;  4JI5 K;  2FSK A;  3E9L A;  5BPN A;  4FW2 A;  3KD1 E;  4BRM A;  3A5M C;  4XH5 A;  5MLC Q;  4CJ4 A;  3O4N A;  2RPI A;  5HLF A;  5HRO A;  1VQL N;  3D6R A;  3L2U A;  4KO0 A;  1VQK N;  2UXB K;  4FZX C;  1C0U A;  2WBN A;  5AQY A;  3KK3 A;  1XI1 A;  4QS7 A;  1RBR A;  3AVN A;  5EU7 A;  4IOC L;  3CJ9 A;  2VWK A;  2IIR A;  3VTI A;  4BRN A;  4IJA A;  2HST A;  3ZEU A;  2Y1J A;  4CIG A;  1RT1 A;  3P38 A;  3LZJ A;  4CIE A;  4DFM A;  1DEJ A;  3VF6 A;  1U47 A;  2BH1 A;  1S9E A;  4FJH A;  3A5O C;  3NHG A;  3MEE A;  1YJW N;  2Z1J A;  5K14 A;  1ZC6 A;  3EZW A;  5I9E B;  4DF8 A;  4IOA L;  1RFQ A;  2ZM6 K;  2P9K A;  4RW9 A;  4LH5 A;  5FPE A;  2YHX A;  3I8D A;  3C95 A;  4LF6 K;  3C6H A;  3CJB A;  1HX1 A;  4J2B A;  4BG9 A;  3QNO A;  3EE9 A;  2GWJ A;  4JAX A;  3DOK A;  4Z94 A;  4DTJ A;  4OX9 K;  3CYM A;  3AA5 X;  4N41 A;  4DKW A;  4HTU A;  4DQ8 A;  3ZX3 A;  4FWK A;  4BC5 A;  1KAZ A;  1NJW A;  4CCH A;  1W0H A;  4H0T B;  3AVH A;  1N6Q A;  3V81 A;  3SV3 A;  4KH5 A;  4OLB A;  2YHY A;  2B5J A;  4FLY A;  4DQR A;  2Q2R A;  2CH5 A;  3CQ8 A;  2PYL A;  1T8E A;  4FWN A;  3ISN C;  1X9M A;  3IG1 A;  3P31 A;  4BGB A;  1WOQ A;  2OA8 A;  2HBM A;  4CBW A;  4M3U A;  3S3M A;  1JLQ A;  5AQP A;  3ZSW A;  4JS4 A;  4DR2 K;  1HJR A;  5AZI A;  4M63 C;  2W42 A;  3QES A;  4B3R K;  1GLJ O;  1IKY A;  1ATS A;  5LJV A;  4EHT A;  4PL8 A;  3O4Q A;  5CYQ A;  3LWL A;  4CK1 A;  1Q8I A;  1C0G A;  1S72 N;  4DLG A;  1QTM A;  3RTV A;  4XIU A;  1NWK A;  1NK4 A;  2P9L A;  4AH9 A;  3CF5 L;  3LDP A;  4GV3 A;  4E0D A;  1YT3 A;  3HP6 A;  3PY8 A;  4FK4 A;  4O5F A;  1VQ8 N;  4JI1 K;  2YX6 A;  4CK2 A;  2XY7 A;  1S3X A;  4FSV A;  4I6M A;  1ATR A;  4ILG B;  1RNH A;  1CZA N;  5HP1 A;  1QHT A;  2WFB A;  3DXM B;  2GWK A;  4A2B A;  3CMA N;  1SKW A;  1HNX K;  2NRH A;  3DXK B;  3NVM A;  1HR0 K;  1VAZ A;  3HRG A;  5AR0 A;  3O1B A;  2HF3 A;  1U2V B;  1BA1 A;  5AQH A;  2NRZ A;  1KLN A;  1RDD A;  3C6A A;  3JSM A;  3NF7 A;  3OYF A;  1TKZ A;  3EKS A;  1HYZ A;  2DFE A;  1WSF A;  4JKF A;  1J53 A;  2IS3 A; 
#chains in the Genus database with same CATH homology
 4CW7 B;  2ZM6 K;  4JI7 K;  4DR1 K;  4KHP K;  4DV3 K;  1XMO K;  4DV2 K;  4DV1 K;  4LFC K;  1IBM K;  1J5E K;  4LF4 K;  4X64 K;  5FLX O;  2HHH K;  4B3M K;  4LF6 K;  4GKK K;  2UXD K;  3OTO K;  4AQY K;  3T1H K;  2UU9 K;  4LFA K;  1XNQ K;  4LF8 K;  5AJ3 K;  4DV4 K;  1N34 K;  4DUY K;  5A2Q O;  1IBK K;  5LMN K;  2VQF K;  5LL6 Z;  4OX9 K;  4DR7 K;  3J7Y P;  4DR5 K;  1HNZ K;  4DR6 K;  5IT9 O;  4JI0 K;  1XMQ K;  1XNR K;  4K0K K;  1N36 K;  4LF5 K;  4B3S K;  4DR2 K;  4JV5 K;  4JI4 K;  4YY3 K;  3J7A P;  4DV7 K;  4DV0 K;  4LF7 K;  4LFB K;  3JAM O;  4B3T K;  4JI8 K;  4X66 K;  3T1Y K;  4JI3 K;  4B3R K;  1I94 K;  4DR4 K;  4JI5 K;  4JYA K;  1FJG K;  2UUB K;  1IBL K;  4X62 K;  3J81 O;  5IWA K;  1HNW K;  1N33 K;  2UXB K;  4JI1 K;  4GKJ K;  4DV5 K;  2E5L K;  4YHH K;  4JI2 K;  1N32 K;  4DV6 K;  4DR3 K;  4V19 S;  4JI6 K;  1HNX K;  4DUZ K;  5LMU K;  1HR0 K;  4LF9 K;  2F4V K;  4NXM K;  2VQE K;  4NXN K;  3J80 O;  2UUC K;  5BR8 K;  4X65 K;  2UUA K;  2UXC K;  4CVN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...