4GKKK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4gkkK00
4CVNE 4X64K 1FJGK 2ZM6K 4LF5K 4LFBK 2VQEK 4GKJK 1XMQK 4DV1K 4JI0K 2UU9K 4B3MK 5FLXO 1IBMK 5LL6Z 4X66K 4X62K 3J7YP 4DV5K 3T1HK 4LF6K 4JI4K 2HHHK 5LMUK 1XNRK 1N34K 1IBLK 1I94K 2UXCK 3JAMO 4JI1K 4JI6K 5AJ3K 4DV6K 4NXNK 2UUCK 3OTOK 4YY3K 4V19S 1XNQK 4DV0K 4DV4K 4B3TK 4JI8K 2F4VK 4KHPK 4DR1K 4YHHK 2VQFK 4DV7K 2UXBK 4CW7B 4JI2K 4AQYK 4DR5K 3J81O 4DV2K 1HNZK 2UUBK 4LF9K 4DR3K 1J5EK 4DR4K 4X65K 4B3RK 5IT9O 4DUZK 4NXMK 3J7AP 1N33K 1N32K 1HNWK 4LFAK 1IBKK 4DR7K 2UUAK 3J80O 5IWAK 4JYAK 4JV5K 1XMOK 4LF8K 4B3SK 2UXDK 3T1YK 4LF7K 2E5LK 4DR6K 4GKKK 4JI3K 4DR2K 4JI7K 4JI5K 4K0KK 5LMNK 1N36K 5A2QO 5BR8K 4LFCK 4DV3K 4LF4K 4OX9K 1HR0K 1HNXK 4DUYK
chains in the Genus database with same CATH superfamily
3HYFA 5E26A 2F8TA 3OBWA 4FLZA 3ENOA 3LPUA 3LDOA 5HL7L 3OYNA 4CFBA 2G8IA 1NK0A 4CF9A 4LFBK 3K0SA 4DS4A 1DT9A 3PLAA 1NGFA 1U4BA 3KKSA 2RF2A 4CJUA 4Z4HA 2IVOA 1DEJA 3OVNA 1C0FA 4MFBA 3WUHA 2F7TA 3HPGA 3CCVN 1TKDA 2ASOA 1R0AA 3BF1A 3MXIA 3O9TA 3QEWA 5E84A 1RBTA 2KW4A 3KKRA 1ASWA 1VSFA 1VQ6N 3VQ9A 3LZJA 1BOTO 1W9HA 5AQUA 4W5RA 3EZ5A 2Q2RA 2WTUA 1TK8A 4BRDA 3EYZA 2ZJRL 2ITMA 2G8KA 4YY3K 4HUGA 1TK0A 1SL0A 2IVNA 2HHXA 1HUXA 4NLCA 3NE6A 3CM6A 1NWKA 1SAZA 4CCHA 3EZWA 3VQ7A 3MXJA 4FPAA 5HP1A 1NJYA 5HRRA 3D6RA 1HNIA 3MEDA 1OH6A 2FBVA 1WUAA 1X1PA 3OS0A 1Q18A 1REVA 3KK1A 1ZYQA 4Z0UA 4WYBA 2OA8A 2QM1A 4CHOA 1HKCA 2O8EB 1S3XA 1HNWK 3HK2A 1QSYA 4FWOA 3THXA 1QZ6A 3P4IA 1O1WA 1LAWA 3AY9A 3QDKA 3VEZA 1U48A 4BRLA 4YOWA 5JVGL 5EU7A 4EP5A 3DRPA 4MO4A 3KHYA 1GLDG 2ZQBA 4O55A 4ICLA 2OZMA 4BR7A 1RCHA 1RT5A 3NH1A 4OX9K 4M3TA 3F5TA 3L4IA 4M45A 2NRTA 2ZM6K 4FLUA 4JKFA 1BGXT 2HB5A 2H3GX 5HROA 3L3VA 2UU9K 5FLXO 3O8MA 3SQ4A 3EEQA 4H0TB 1W97L 3R1XA 1K8KB 2E1ZA 1Q8IA 1XI1A 1BQMA 2QWMA 1ZBHA 2P9SB 4DU4A 5DM7L 3T19A 4WQ5A 1TVRA 1ZBIA 5LMUK 2BGGA 3KZBA 4JK8A 4E19A 5AQGA 2YCHA 3V9ZA 3FZKA 1BCOA 3IFRA 4LC9B 1C1AA 3L2VA 4B1VA 1SKWA 4DB3A 4EZ9A 3MWPA 4WQ4A 2Q31A 2P9UB 4O4GA 3VQ4A 4H0OA 1D9FA 3M1FA 4ILJA 2E2OA 1BU6O 1CXUA 4YNQA 2PY5A 1NK6A 2OPQA 1HYSA 1HKBA 3JS6A 2HVHA 3QERA 4DMNA 1A5XA 5KRTA 3SBGA 1S1WA 3RSEA 3M5RA 3HP6A 3FFKB 1NKCA 1Q9YA 4CEEA 1YVUA 1RT7A 3C6TA 3D2EB 1GOBA 2OCEA 1YTUA 3MX2A 4BC5A 2Z1GA 1XC9A 3BUZB 3U8XA 2CGLA 2FF3B 2HNDA 2HHWA 2B4JA 4NB4A 4A5AA 3SUQA 4K25A 4ISFA 1CZ9A 3CJ7A 4BVPA 5I9EB 3HM8A 4KFBA 3VQBA 4N41A 2ASMA 4GW6A 4E1MA 3C94A 4CIEA 1N8RO 5BR8K 3SQ2A 1BA0A 3VEYA 3HPOA 1KVBA 3F73A 3SV4A 2HHTA 2KZMA 1U47A 2W6KA 2ZD1A 3ZEUA 1TKXA 2P9NA 3VTIA 2FXUA 4N47A 1DTTA 5J2PA 5J2QA 3V81A 3G4SN 4O0IA 3FLCO 2QKBA 1KLNA 4FK2A 4F3OA 3NHGA 2BTFA 2XRIA 3ZSOA 4JS4A 5GAGP 3RMAA 3OJUA 4FJNA 4X62K 3M6GA 3HOSA 1GOAA 4JI4K 3GOIA 3HP9A 3MMVA 3HM9A 2ZGYA 1YUWA 4MLHA 3H1VX 3VQEA 1CXQA 3AARA 3D2EA 5AQWA 4J8FA 2FF6A 4I2QA 1TUYA 3DAWA 1W2BM 1VSMA 3RR7A 1KAZA 4KH4A 1NKEA 3ULEB 3A5MC 2NNWA 2NRZA 3VGMA 1VQ8N 5AJ3K 4YFUA 5KQDA 2O8FB 3QBXA 3TAEA 1X9JA 4FJ9A 3WNGA 4DTUA 2UYTA 3BP8A 4HWIA 2YX6A 1NGDA 1C1BA 3C0BA 4CW7B 1GLLO 1QVGM 1VQ4N 4IO8A 4MQ3A 3KLEA 1T6DA 4KI6A 3ULDA 1M90O 3AO1A 1BDGA 5AQYA 3ZETA 2QA4N 4XEIA 1RBRA 1TV6A 3K5LA 1VK0A 1JKHA 1XUPO 3KLFA 4H4MA 3O3FA 4JEPA 3WXLA 4CZFA 3O9SA 4QS8A 5BRHA 3M8PA 5AZIB 3WXKA 3QO9A 4A57A 3D2FA 5KGWA 3TAGA 4FJLA 3WT0A 4FM2A 5C10A 1XC3A 1XMOK 2VG6A 4FWPA 2D0AA 3T1YK 3M8RA 3MEGA 3OJSA 1JCFA 4DR2K 1NU0A 1YF5L 1U49A 2V51B 4JI5K 4K0KK 4OLAA 1RDBA 1BA1A 3V9SA 1OH7A 2FBYA 3VEVA 1RT3A 1HR0K 4BRHA 4BRAA 3MWTA 2VG7A 4FWQA 2ZJQL 4AH9A 2X78A 2F9TA 1MWKA 3VQPA 1N5YA 1X9MA 2E4LA 3VQDA 3B6PA 2XY6A 4GKJK 2ITGA 3FE1A 5AQQA 4B1YB 4I9LA 4XH4A 3E9PA 5LL6Z 4FXDA 4MDAA 3CM5A 2BUPA 3PIOL 4KHWA 3QETA 3UKUA 4JHDB 4C8KA 3WQUA 3IDHA 3WEEA 1K73O 3P31A 3O3HA 3NF8A 3I33A 3CERA 4IJNA 2HOEA 4FM1A 2WUSA 3TAPA 5AQRA 3P1GA 4DQIA 1J9AA 3HRGA 4AHRA 2WOMA 4CJSA 4CJ5A 1J6ZA 2O8DB 4CF0A 3DI6A 3OTOK 3ZSYA 4DSEA 3C6UA 3KVGA 3VQ5A 5ELZA 3F9MA 3HXMA 1E3MA 3DRRA 4CGHA 3IMXA 3VESA 3M8QA 4H5VA 2FSNA 2KLAA 4GV9A 1EWRA 1HNZK 2O8DA 2D0CA 3P38A 1P90A 4U7BA 3AGRA 3TAMA 5K14A 3V4IA 4CJVA 1SKSA 1YT3A 1JLGA 4M3ZA 1NKBA 1BHLA 3WEEB 5JMVA 4IBNA 1QSSA 3A0IX 1ZC6A 4YORA 4JYAK 3F2KA 4JKBA 3NBPA 4CEAA 4FJ8A 3TWHA 3C6AA 3U4LA 2OANA 1QQOA 2VYPA 1JLEA 1C0MA 5CHIA 3VPZA 1RBUA 3RRHA 1NGBA 5LMNK 1TKTA 4FZXC 2HBJA 2R7YA 1KFDA 5FDLA 4CJFA 3U6FA 5KI6A 1EWQA 3J7ZO 3WXJA 1F21A 1IO2A 4HUEA 2XHBA 3S3OA 2OPSA 4DFJA 5GAEP 3JXUA 1Q9XA 3SJHA 3ZT2A 3SUNA 3NCIA 4KRFA 3QBWA 4CK2A 4I2PA 4BRQA 4AHSA 5B8HA 1ZXOA 3AV9A 1E4GT 3OYJA 2DPNA 4KHUA 3VERA 4KH6A 3FZLA 4E89A 3K5MA 2G8HA 3MEEA 3CJ1A 3CC4N 3HTVA 3THVA 1NMDA 4CHZA 4A5BA 4CGDA 4EZ6A 1UA1A 4RW7A 2NRRA 3L3UA 3U3YA 1I94K 3DLBA 5FROA 2ZWHA 1Z26A 2W40A 3ZETB 4CGFA 4DV6K 5C0YA 3AO4A 3OS2A 3O1BA 3QESA 1OKJA 3TSPA 4KPYA 1ASUA 4B9MA 3CYMA 4DV0K 1A5VA 4CERA 1YIJN 2ZGZA 4DTPA 4K43A 4BC3A 1C1CA 4C1NK 2RE2A 1WAFA 3B8AX 4KBOA 4Z4GA 3CC2N 3QFPA 1GLCG 2RKIA 2F8SA 3ZSVA 4FJIA 4C1NI 3ZSQA 2PYJA 3H3NO 4BR0A 1LAVA 4DR3K 3AGKA 5KQ8A 1NK8A 3ULEA 1P8ZA 1OVYA 5KPRA 4DSIA 1JCGA 4K8XA 3CCUN 2XO7A 3LWLA 1IKYA 4LSLA 4H0VB 1NGAA 3HL8A 3QLHA 4FLXA 4KKOA 4K8ZA 3LP1A 4CJ4A 3VTHA 1SZ2A 3PY8A 3CETA 3ZT1A 3ZT0A 1GLFO 3SPZA 2UXDK 3NGYA 1D5AA 1SV5A 5AQVA 1OH5A 4BR5A 1KVCA 2EWSA 2GUPA 3DYAA 3UIQA 4OPJA 3K5NA 5A2QO 4CHNA 4J2BA 4B1XB 2QWOA 1YITN 2DFFA 4FWMA 4FOEA 4H5WA 4EHUA 4PY5A 1FJGK 2CGJA 4FO0A 4W5OA 4GV6A 4OKKA 2QXFA 2IOCA 4M3XA 3VA0A 3VA3A 3O9RA 1RT1A 3AVMA 4ISEA 2QWPA 1T03A 3W3DA 2E2PA 2YHYA 3DOLA 4B1ZA 3SNNA 2O8BB 4FWRA 4FW1A 4H8KA 3EO3A 1A5WA 3K5OA 4DFMA 5HRPA 3J7YP 2ATQA 3IG1A 4CGGA 4CZKA 1LV5A 2PZSA 1FXXA 4FVUA 1KCFA 4F9OA 4A2BA 4CHQA 4TSXA 3PO5A 3G71N 1S9GA 1IKXA 1T44A 3VQCA 2UXCK 5AQKA 3PIPL 2RPIA 5LJWA 1NGIA 4E7LA 3OYHA 4NXNK 4B1WB 3QEIA 3JSMA 3WNHA 1YXQA 4JD2B 1UA0A 2O8BA 3N4QA 4OGEA 5M1NA 5AQMA 4DR1K 3CMAN 1HYVA 2VQFK 2UXBK 2O8CA 1Z25A 4DV2K 4FYDA 1C0TA 4C8OA 4BWJA 4CZLA 2G8FA 3D0PA 3THWA 3DMJA 1RDCA 1S6QA 4B3RK 4BR4A 1HX1A 3MN5A 4I6MB 4PKIA 3T7ZA 3HBTA 4HHTA 3QEVA 4C8MA 4FPBA 4JKAA 4DR7K 2HF3A 4YOYA 4BQLA 1K8KA 2P9PB 3QMLA 4KTWA 1NOYA 1KAXA 4DR6K 2I5JA 4BRPA 4JI3K 2F96A 1EX4A 3WXIA 4HTLA 4DTJA 3SMPA 1G15A 3ALYA 1BIUA 3VGLA 3TARA 3K9JA 3RMBA 2B6AA 2YKNA 4LF4K 3MN9A 4DFPA 5DM6L 1QZ5A 3OYCA 4KHQA 2I7NA 3HVTA 4CZHA 1WSJA 1L3SA 4E1JA 2D0PA 4EP4A 3OYGA 3P39A 4B9VA 1XMQK 4R5PA 3C65A 2J4RA 3E66A 1T6CA 2Q97A 2HMIA 3SBTA 2E2QA 5AZJB 1NJIO 4M3WA 4XIUA 4H4OA 3TR8A 3H08A 3V1OA 1HPMA 4IFEA 1KTQA 3AVGA 2WC9A 3L2UA 3TSUA 3CCQN 4O0JA 4FJKA 4UQGA 3HVRA 1X9WA 3AVFA 4BC2A 4Z4IA 1K9MO 2VGNA 4DG1A 3SZ2A 4M42A 3FR0A 4FJ5A 3U9ZA 4A62A 2YHAA 1I3AA 3O3GA 3CCMN 2VWJA 1NK5A 4JS5A 1L3UA 4YHHK 4DV7K 5FPDA 4CJLA 1R59O 1L3VA 1QHTA 3K2PA 4YOXA 4IEIA 2A6AA 1WN7A 4Y1CA 4BRCA 4BY9C 3G10A 1B9DA 2EX3A 2HHVA 4H0XB 5IT9O 3NGIA 5BN8A 3LANA 3CFOA 1FKOA 3LM2A 3QEPA 1ATNA 5AQOA 3VETA 3VGKA 3HSTB 1DLOA 3LAMA 3WXMB 4EHTA 3LAKA 1WLJA 4E1NA 3PX4A 3Q7CA 1KFSA 4J2AA 4ELVA 1E4FT 4Q5VA 3VENA 3J8AA 4KH5A 5BN9A 3ZX3A 3AO3A 2VWBA 1BCMA 3T69A 4WQ4C 2YNFA 1VSDA 4H5NA 1BI4A 4RW8A 4BGAA 1VSLA 3UKRA 1C0GA 3SQ0A 1LWFA 3RTVA 2RN2A 1HNXK 3O4NA 4CVNE 5CZ2A 4EAHD 4JKCA 3AAQA 3CCEN 3VEOA 2WONA 3V1QA 4CJPA 1BWFO 1NGHA 4B9UA 2GX9A 3MN7A 1VSHA 4FLVA 1QTMA 1NG9A 1T7PA 4RW6A 3IAYA 4M7YA 4OVLA 3H6EA 5J1EA 5CZ1A 4CEOA 4H0PA 1XHZA 4CI6A 2AJQA 1ITGA 5HBMA 3V6DA 1IBLK 2PYLA 4BE1A 4WFBL 4JI1K 4N5SA 4JHDA 3UKUB 3QNOA 1T05A 4J2EA 3HI0A 1VHXA 4XH5A 3DRSA 4ELUA 4GVEA 4E7IA 4B3TK 3OS1A 1FKPA 1LOTB 3WNFA 3C95A 2ZE2A 5BRFA 4RWTA 5J2NA 4HCBA 4AQYK 2BH1A 2Q1NA 2UUBK 1HQUA 1QQNA 3G0ZA 3CCLN 3NFAA 4CF1A 4X65K 2Q0UA 3OY9A 4IFVA 5C12A 1SUQA 4KI4A 3AO5A 4IFYA 5TKWA 2P5OA 4FJGA 1K6YA 4DWIA 4CBXA 1WSIA 2VG5A 2QWQA 2P9LB 3NMUA 4DLEA 4ID5A 3OYKA 5GAHP 4B3SK 3D2FB 4RW9A 5JLHA 4LF7K 2OTJN 5AZIA 4LH5A 5F2RA 4PL8A 5E41A 5CYQA 1KSPA 3OYBA 4DLGA 3MX5A 5CYMA 4LFCK 4QCLA 4PQUA 4RTFD 3I55N 3KJVA 3QEXA 2G8WA 3QICA 1VQ9N 3O9UA 3TSQA 4M3UA 1JL1A 3C7NA 4AHUA 5JICA 4CZGA 3CQXA 4GVMA 1RT2A 4WE1A 3THWB 4NYNA 2IDOA 5AZJA 4IKFA 4HVJA 4BG8A 2LSNA 2YJFA 1BUPA 2O8FA 3DXMA 4CF2A 4CF8A 1MU2A 4M63C 1OH8A 4JKDA 2CH6A 1IG8A 1N34K 3KWGA 1MA9B 4CHYA 2NRHA 1D8YA 4NCAA 4QOZB 2QWRA 5GINA 3LP2A 4PUOA 2X6SA 4L8RB 2NRWA 2QWNA 3BF3A 4OLBA 4V19S 3QFUA 3AVBA 1HJRA 3GE1A 4FWKA 3ATUA 1Q82O 2E2NA 1VQMN 2P9NB 4BRFA 1C0UA 4CIGA 4O44A 3VF2A 4DR5K 3WNEA 4H0YB 1SS6A 1TAQA 4K42A 3HO1A 1EETA 4FWSA 3SAFA 3KTQA 3K57A 4N76A 2YNIA 3A5LC 4EIAA 1VSEA 3EY1A 4HUFA 3ZYYX 1BIZA 4CHPA 3OYAA 2KFZA 2Q36A 2ASPA 5CY4A 1L3TA 4L3QA 4HCCA 3ZEUB 3DOKA 1X9SA 4BG9A 2HHQA 2A42A 4EFHA 3V1RA 2V7YA 3VEWA 3CPWM 1S5JA 3E9OA 4C23A 3VF4A 3FZMA 3OYDA 1JLAA 1TYQA 5AQLA 4NCBA 1CZBA 2HMPA 1SL1A 3MDQA 4BRIA 1HKGA 4IWVA 4U67L 3LDLA 3D45A 1N36K 3I0RA 1UWBA 2AP1A 2Z1HA 3ZSZA 4DV3K 3KD1E 2QW9A 3TU5A 1LWEA 2HF4A 4DUYK 3IS9A 5FRMA 3TTDA 2A40A 4IXCA 3TI0A 2JGUA 3SJJA 3LDNA 1ZBUA 4WFNL 3EE8A 3ITHA 2KFNA 3KWIA 3QIPA 4ILHA 2HSTA 1ASVA 4B3MK 4Z94A 3V9XA 2P9IB 3BZKA 2JWKA 1WSFA 2Z1IA 1G99A 4QS9A 1Q7YO 3KD5E 5BR9A 3MCAB 3AA2A 4KTQA 3EKUA 4RCHA 4CJWA 4FLWA 1JXBA 1VQON 1FK9A 3JAMO 4DQRA 3KK3A 4O8KA 3GDQA 3LM9A 1JLCA 2P9SA 3PO4A 1WB9A 1NK7A 5BRDA 3CCRN 1HRHA 3LALA 1MWMA 4DTRA 1W0HA 1RILA 3KLGA 2P9KA 3PUFA 3O4WA 1LWCA 3U3GA 1SL2A 4DSKA 5M1OA 3KK7A 5AQZA 3MXMA 4JN4A 5JS2A 4BGBA 4K41A 3VQ6A 3PV8A 2XY5A 3PSIA 5T7BA 2NRVA 4B8AB 3SAHA 3ENHA 1YJNN 1DGKN 2E88A 3L8BA 4KHNA 4LF9K 1DKGD 2D0BA 1VSKA 5C2DA 4Z4FA 1IG9A 3F9KA 1BQNA 3G6EN 3FGUA 1RGIA 5KPTA 3ATVA 3O9QA 3JYTA 3I56N 2NZTA 4LY7A 3TAFA 3QIOA 5BPLA 1ATRA 2YI1A 3J80O 2AA4A 3LL3A 4FWNA 4M7XA 1XHXA 4O5FA 2I7PA 2G8VA 1YTAA 4C8NA 3B6OA 2YHBA 4BRNA 2HHUA 3GG4A 2PFUA 4DFKA 3LP0A 1RBVA 2GUIA 3BEXA 5F1XA 4E7HA 2QKKA 3CCSN 4B9QA 3Q7BA 3TANA 1RDUA 3AVNA 3ZX2A 1NGGA 4BREA 1HQEA 3N4PA 4YOTA 2JLEA 2HNZA 1EP4A 1Q86O 4AHTA 4KREA 1D4XA 3LDQA 5I42A 5KPZA 4BRMA 5C15A 4M3RA 5CR4A 1I39A 1KQSM 1TL1A 2A1SA 4DTOA 4CBUA 2X6NA 3T1HK 4F3TA 3KIOA 3O6WA 4CK3A 5GADP 1J54A 2IAJA 3AVKA 1VSJA 2P51A 3EE9A 4FM0A 2V52B 4KV8A 4JKEA 4ELTA 4PKHA 1JLQA 4Y0WA 1SQKA 5KGXA 2P5GA 4AHVA 1EQYA 1S22A 4BACA 2YHWA 1DTQA 1KC8O 4CJ7A 2B5JA 3RMCA 4CD1A 4DHYA 4G9ZA 3DLGA 3MCPA 1BI4B 3KLHA 1JXEA 3C6HA 2F4VK 1KLMA 4KHPK 4FJMA 2P9KB 3A8YA 4JI2K 2HBLA 2YNHA 4CEDA 2D0OA 3OBYA 1VSIA 3I8BA 3CJAA 3MECA 2OPRA 3FZFA 1VQPN 3T3FA 3CI5A 4ID1A 1U2VA 5DMRA 3LDSA 4E0DA 2Z1JA 4NXMK 1U04A 4MLEA 1N32K 2DFHA 3SMSA 2F9WA 2P9IA 3L2RA 3ZT3A 3HT3A 3K58A 2JWLA 1W7AA 5JS1A 2NUBA 1FW6A 4KHYA 1KD1O 3DXKB 4GKKK 3O5BA 4BVOA 4JRQA 2HVIA 4FWLA 4E3SA 3RWUA 4JI7K 1IKWA 4FJJA 3O4QA 2GTDA 3TABA 1WSEA 3AO2A 4O5BA 4I9QA 3U9DA 2E8AA 2HNYA 1WNSA 1NMNA 1N6QA 4IEEA 4YOVA 4GV3A 4X64K 2BANA 4UY8O 5EY4A 4CZMA 2YHXA 2IIRA 5FPEA 3SV3A 1U45A 2GWKA 3ISNC 5AQXA 4AILC 2OYQA 1GLEG 1VRTA 4Y1DA 2O4IA 5JLFA 4R79A 4JI0K 4H5TA 2W6LA 4DV5K 3NF7A 4CZIA 1ZBFA 2IVPA 3L0QA 1BL3A 2ETJA 3BGRA 3L6QA 2KZZA 1L5UA 1RBSA 3A5OC 1QQCA 1GLBG 1ATSA 3DLRA 5C24A 1RDDA 3WQTA 5AQIA 1NNEA 5F0XA 4NLBA 3ZSWA 3NVKA 2ZJPL 1T8EA 1VRUA 2G8UA 4GMJB 5FPMA 4BRKA 4CFAA 3VF6A 4JLHA 4B1UB 5BPMA 1JCEA 1WSGA 2RHKA 3MK6A 4DQ8A 4YDUA 1UOCA 2P9PA 4CEBA 1QS4A 4BDYA 5D3GA 4RW4A 1NGCA 1VQ5N 2VWKA 1QE1A 5SWMA 4JK7A 1IV0A 4CD3A 3VOVA 4FJ7A 3NF6A 3S41A 2BE2A 1JL2A 5C42A 5KRSA 3V9UA 3SYZA 3CIPA 3MAQA 4CJKA 4QAGA 5LJVA 3NGZA 1X3NA 1IBKK 5C25A 3V9WA 1Y97A 4PKGA 4IOCL 3ZSRA 1VQ7N 1LCUA 5CE3A 1QSLA 3PSFA 1RTHA 5AQFA 4WF9L 2O8CB 1Z6RA 1NBWA 2E5LK 2GV9A 1Y64A 1X3MA 2EHGA 4DQSA 1S1XA 3ZCMA 3HJFA 4JD2A 1TK5A 4DF4A 1TGOA 3L4QA 3VMFB 1S9EA 1TUUA 3S9HA 4LD0A 2FSKA 1YAGA 2E20A 4O8UA 2W41A 3R8EA 5M1KA 1WAJA 1WBDA 1IH7A 4B9SA 3E1YA 5ADXA 4BR9A 3SQ1A 1C6VA 4NO7A 1YI2N 4DV1K 3A5NC 3UB5A 2WFBA 2A5XA 1GOCA 4Z4CA 2FC0A 2P9LA 1XQSC 3MN6A 5FRNA 4KB1A 3L2QA 3HSCA 4LSNA 2P9UA 1EKEA 4FCYA 3ZLJA 1H1VA 2YJEA 3OHRA 3TAQA 2FSJA 3DJCA 1RTJA 1HJOA 4DKWA 1IJJA 1XWLA 1HMVA 5I3UA 5AQJA 4BDZA 4A59A 1NOZA 4CECA 2QXLA 3SI6A 5AR0A 5H1SQ 4G1QA 3QNNA 3KLIA 2Y1JA 3CD6N 4A2AA 1EXQA 1HPZA 2OPPA 1ZBSA 3NH2A 1J5EK 3VQAA 3SCXA 5J2MA 4C8LA 4CFDA 4PHTX 4PA1A 2PBDA 5M1FA 1NLVA 4PL7A 4H5RA 3BZCA 1K8AO 4IJAA 4OGCA 2YNGA 2UUAK 5EOYA 4JKHA 4DTXA 4WQ5C 3S3MA 4LF8K 4B3OA 4OJRA 1O13A 2IGIA 3H46O 3ID6A 3ZSXA 4GNIA 3H3OB 4H03B 4M3YA 4IOAL 4MO5A 1EO1A 4JNEA 2FBTA 1LW2A 2NRXA 4DU1A 2YKMA 1OVQA 1NJZA 3EN9A 1S6PA 4DS5A 2DTUA 2V7ZA 4I7FA 3UKRB 2XY7A 4KHSA 2KHOA 3CC7N 4IZ9A 4GY2B 4DTSA 4PWDA 4BQZA 4LF5K 1Q81O 1S1TA 3TTFA 1QHAA 4FJXA 2VCPA 3UE5A 1IBMK 3AAPA 2IC3A 4X66K 4LF6K 4F8RA 3SK3A 1NGEA 2HHHK 4DCHA 4FW2A 5AQPA 4B9NA 1TAUA 1CLQA 4BE0A 2WBNA 1RTDA 5HRNA 4E7JA 5AQHA 4XH1A 4CGIA 4YOUA 4JRPA 4BROA 2XY8A 1Z05A 2D1KA 3GBTA 3GL1A 2D4WA 4CGJA 3EL2A 3VEXA 3G25A 4CEQA 3BDPA 4OKJA 4ISGA 4IDHA 3ENBA 4JI8K 3DWLA 3NF9A 1TL3A 3P83D 2BDPA 5M1PA 2HHSA 1S1VA 4M41A 3P5JA 3THXB 1SKRA 4AM7A 4Q0BA 2E6MA 5HOOA 3M3ZA 3CQ8A 4DR4K 4IOXA 4DF8A 2O8EA 3QB0A 1WOQA 1KAYA 1RT6A 3TPQA 4FSVA 4N56A 4IO9L 3CFRA 1GLJO 1N33K 4W5QA 1YHQN 2OZSA 5BPNA 4AF1A 3RMDA 4ZTFA 2QTDA 3DM2A 3BY5A 2GELA 4LH4A 3LWMA 3DLEA 3ASMA 4FK4A 1JJ2M 4OPHA 4JV5K 3CCJN 3LP3A 2X74A 5M1QA 1RFQA 3O1WA 3AA4A 3TTCA 5DK5A 5HRSA 3CXCM 3NAEA 2O4GA 3DLKA 3EKSA 4CIFA 2QI2A 3CJ9A 2HW3A 2Y1IA 4OPAA 3PX6A 3NVMA 4F2SA 3AVJA 4IG3A 3AA3A 4OKEA 1UAXA 3AVLA 1VQKN 4BDPA 5JVHL 4CBWA 4NCGA 1BO5O 2VGMA 4YDUC 3PX0A 4BR2A 2HBKA 1TYQB 3RR8A 2QK9A 4FJHA 1JLFA 1MDUB 4CJ3A 1HNVA 1WSHA 4CEFA 4F4KA 2KTQA 3FFIA 4MDBA 1ZBLA 3LPTA 3OYEA 4AHCA 3M8SA 1S72N 5C2FA 4CZJA 3FZHA 3OW2M 4JKGA 2CGKA 3IRXA 1HLUA 1XNRK 4I6MA 4A61A 2ZF5O 3IUCA 2Q3SA 1ILYA 4JI6K 3O08A 1M1KO 3IKMA 3CPEA 4CJTA 5FPNA 1XNQK 3SLCA 3HPHA 1RTIA 5AQSA 3VN5A 4FZYA 3K59A 4CK1A 3NDKA 2D5RA 1D9DA 4B9LA 3I8DA 5AFUH 4FL9A 2DFEA 5ADXH 3KK2A 3K9KA 4DQPA 2QWLA 3CHWA 4JAXA 5GIPA 3AVCA 4RG8A 3AVAA 4DSLA 4E7KA 1YVNA 3A2FA 4DUZK 1J53A 3S3NA 3HZ6A 3J7AP 1GLAG 5TKYA 4KO0A 3E9LA 2OTLN 4BWMA 3CJCA 4J2DA 5BREA 2FLOA 2A3ZA 2E6LA 3OA9A 3LDPA 1JLBA 3ID8A 4ZTJA 4FLYA 3H45C 3DLHA 1NJXA 3AVHA 3H1QA 1QQMA 1NJWA 4FZZA 1V4SA 2GWJA 4CE9A 1VQLN 4FLTA 4CESA 3CF5L 2KQ2A 5HLFA 2W42A 4WCEL 2E1YA 4DV4K 4OO1J 3VQQA 3SUOA 2Q0RA 4Z4EA 1RDAA 4CJEA 2HBMA 2VQEK 3T1AA 4AM6A 2PAVA 1VQNN 1T3VA 2CH5A 3CMEN 3THYA 5EVZA 3CG7A 1RNHA 4FK0A 4DSJA 4BE2A 1RT4A 4CJQA 3HOTA 3THYB 4B8CA 4KB0A 1BG3A 3CJBA 4JK9A 5SZTA 3OYFA 1ESVA 5EX5A 3R9PA 5LY3A 1NK9A 2GEMA 1HYZA 3QINA 4CJRA 5EXWA 3R3LA 4CEZA 1NGJA 4F2RA 4OPKA 1S1UA 5MLCQ 3DXMB 4CZEA 2UUCK 4DU3A 5GIOA 4NYFA 1KRPA 4HTUA 4KTZA 4JKGB 4DTMA 3SUPA 1BISA 4DQQA 3W0LA 3CQYA 4QS7A 4CFCA 4DTNA 3C7NB 3E01A 3NH0A 3J81O 2IS3A 3RVCA 5KTQA 1VAZA 3AA5X 1TKZA 3OYMA 1QVFM 2NLXA 2GBZA 4KAZA 4BRGA 2DY4A 1NK4A 2FBXA 1NM1A 2KKZA 4ZHRA 4B9TA 4WFAL 2A41A 3I0SA 1CZAN 3O80A 2YV0X 1KVAA 5AFUA 3SPYA 4FOIA 2QEXN 4LFAK 4DSFA 4W5NA 3CFPA 3RSEB 3ZT4A 5IWAK 3L2WA 5AQNA 3SAGA 3R6MA 1RDWX 3RRGA 4FVMA 1KXPA 3OYLA 1IKVA 1B9FA 1YJ9N 4IDKA 3LZIA 3D7EO 1B92A 3OYIA 3DXKA 1U6ZA 4W5TA 1U2VB 5AQTA 2A1RA 4B08A 1YJWN 4BC4A 1V4TA 1J5OA 2P1JA 1LW0A 3VQ8A 1WBBA 3ZX0A 4IG0A 3AVIA 3DLLL 4ILGB
chains in the Genus database with same CATH topology
4CVNE 4X64K 1FJGK 2ZM6K 4LF5K 4LFBK 2VQEK 4GKJK 1XMQK 4DV1K 4JI0K 2UU9K 4B3MK 5FLXO 1IBMK 5LL6Z 4X66K 4X62K 3J7YP 4DV5K 3T1HK 4LF6K 4JI4K 2HHHK 5LMUK 1XNRK 1N34K 1IBLK 1I94K 2UXCK 3JAMO 4JI1K 4JI6K 5AJ3K 4DV6K 4NXNK 2UUCK 3OTOK 4YY3K 4V19S 1XNQK 4DV0K 4DV4K 4B3TK 4JI8K 2F4VK 4KHPK 4DR1K 4YHHK 2VQFK 4DV7K 2UXBK 4CW7B 4JI2K 4AQYK 4DR5K 3J81O 4DV2K 1HNZK 2UUBK 4LF9K 4DR3K 1J5EK 4DR4K 4X65K 4B3RK 5IT9O 4DUZK 4NXMK 3J7AP 1N33K 1N32K 1HNWK 4LFAK 1IBKK 4DR7K 2UUAK 3J80O 5IWAK 4JYAK 4JV5K 1XMOK 4LF8K 4B3SK 2UXDK 3T1YK 4LF7K 2E5LK 4DR6K 4GKKK 4JI3K 4DR2K 4JI7K 4JI5K 4K0KK 5LMNK 1N36K 5A2QO 5BR8K 4LFCK 4DV3K 4LF4K 4OX9K 1HR0K 1HNXK 4DUYK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CVN E;  4X64 K;  1FJG K;  2ZM6 K;  4LF5 K;  4LFB K;  2VQE K;  4GKJ K;  1XMQ K;  4DV1 K;  4JI0 K;  2UU9 K;  4B3M K;  5FLX O;  1IBM K;  5LL6 Z;  4X66 K;  4X62 K;  3J7Y P;  4DV5 K;  3T1H K;  4LF6 K;  4JI4 K;  2HHH K;  5LMU K;  1XNR K;  1N34 K;  1IBL K;  1I94 K;  2UXC K;  3JAM O;  4JI1 K;  4JI6 K;  5AJ3 K;  4DV6 K;  4NXN K;  2UUC K;  3OTO K;  4YY3 K;  4V19 S;  1XNQ K;  4DV0 K;  4DV4 K;  4B3T K;  4JI8 K;  2F4V K;  4KHP K;  4DR1 K;  4YHH K;  2VQF K;  4DV7 K;  2UXB K;  4CW7 B;  4JI2 K;  4AQY K;  4DR5 K;  3J81 O;  4DV2 K;  1HNZ K;  2UUB K;  4LF9 K;  4DR3 K;  1J5E K;  4DR4 K;  4X65 K;  4B3R K;  5IT9 O;  4DUZ K;  4NXM K;  3J7A P;  1N33 K;  1N32 K;  1HNW K;  4LFA K;  1IBK K;  4DR7 K;  2UUA K;  3J80 O;  5IWA K;  4JYA K;  4JV5 K;  1XMO K;  4LF8 K;  4B3S K;  2UXD K;  3T1Y K;  4LF7 K;  2E5L K;  4DR6 K;  4GKK K;  4JI3 K;  4DR2 K;  4JI7 K;  4JI5 K;  4K0K K;  5LMN K;  1N36 K;  5A2Q O;  5BR8 K;  4LFC K;  4DV3 K;  4LF4 K;  4OX9 K;  1HR0 K;  1HNX K;  4DUY K; 
#chains in the Genus database with same CATH topology
 3HYF A;  5E26 A;  2F8T A;  3OBW A;  4FLZ A;  3ENO A;  3LPU A;  3LDO A;  5HL7 L;  3OYN A;  4CFB A;  2G8I A;  1NK0 A;  4CF9 A;  4LFB K;  3K0S A;  4DS4 A;  1DT9 A;  3PLA A;  1NGF A;  1U4B A;  3KKS A;  2RF2 A;  4CJU A;  4Z4H A;  2IVO A;  1DEJ A;  3OVN A;  1C0F A;  4MFB A;  3WUH A;  2F7T A;  3HPG A;  3CCV N;  1TKD A;  2ASO A;  1R0A A;  3BF1 A;  3MXI A;  3O9T A;  3QEW A;  5E84 A;  1RBT A;  2KW4 A;  3KKR A;  1ASW A;  1VSF A;  1VQ6 N;  3VQ9 A;  3LZJ A;  1BOT O;  1W9H A;  5AQU A;  4W5R A;  3EZ5 A;  2Q2R A;  2WTU A;  1TK8 A;  4BRD A;  3EYZ A;  2ZJR L;  2ITM A;  2G8K A;  4YY3 K;  4HUG A;  1TK0 A;  1SL0 A;  2IVN A;  2HHX A;  1HUX A;  4NLC A;  3NE6 A;  3CM6 A;  1NWK A;  1SAZ A;  4CCH A;  3EZW A;  3VQ7 A;  3MXJ A;  4FPA A;  5HP1 A;  1NJY A;  5HRR A;  3D6R A;  1HNI A;  3MED A;  1OH6 A;  2FBV A;  1WUA A;  1X1P A;  3OS0 A;  1Q18 A;  1REV A;  3KK1 A;  1ZYQ A;  4Z0U A;  4WYB A;  2OA8 A;  2QM1 A;  4CHO A;  1HKC A;  2O8E B;  1S3X A;  1HNW K;  3HK2 A;  1QSY A;  4FWO A;  3THX A;  1QZ6 A;  3P4I A;  1O1W A;  1LAW A;  3AY9 A;  3QDK A;  3VEZ A;  1U48 A;  4BRL A;  4YOW A;  5JVG L;  5EU7 A;  4EP5 A;  3DRP A;  4MO4 A;  3KHY A;  1GLD G;  2ZQB A;  4O55 A;  4ICL A;  2OZM A;  4BR7 A;  1RCH A;  1RT5 A;  3NH1 A;  4OX9 K;  4M3T A;  3F5T A;  3L4I A;  4M45 A;  2NRT A;  2ZM6 K;  4FLU A;  4JKF A;  1BGX T;  2HB5 A;  2H3G X;  5HRO A;  3L3V A;  2UU9 K;  5FLX O;  3O8M A;  3SQ4 A;  3EEQ A;  4H0T B;  1W97 L;  3R1X A;  1K8K B;  2E1Z A;  1Q8I A;  1XI1 A;  1BQM A;  2QWM A;  1ZBH A;  2P9S B;  4DU4 A;  5DM7 L;  3T19 A;  4WQ5 A;  1TVR A;  1ZBI A;  5LMU K;  2BGG A;  3KZB A;  4JK8 A;  4E19 A;  5AQG A;  2YCH A;  3V9Z A;  3FZK A;  1BCO A;  3IFR A;  4LC9 B;  1C1A A;  3L2V A;  4B1V A;  1SKW A;  4DB3 A;  4EZ9 A;  3MWP A;  4WQ4 A;  2Q31 A;  2P9U B;  4O4G A;  3VQ4 A;  4H0O A;  1D9F A;  3M1F A;  4ILJ A;  2E2O A;  1BU6 O;  1CXU A;  4YNQ A;  2PY5 A;  1NK6 A;  2OPQ A;  1HYS A;  1HKB A;  3JS6 A;  2HVH A;  3QER A;  4DMN A;  1A5X A;  5KRT A;  3SBG A;  1S1W A;  3RSE A;  3M5R A;  3HP6 A;  3FFK B;  1NKC A;  1Q9Y A;  4CEE A;  1YVU A;  1RT7 A;  3C6T A;  3D2E B;  1GOB A;  2OCE A;  1YTU A;  3MX2 A;  4BC5 A;  2Z1G A;  1XC9 A;  3BUZ B;  3U8X A;  2CGL A;  2FF3 B;  2HND A;  2HHW A;  2B4J A;  4NB4 A;  4A5A A;  3SUQ A;  4K25 A;  4ISF A;  1CZ9 A;  3CJ7 A;  4BVP A;  5I9E B;  3HM8 A;  4KFB A;  3VQB A;  4N41 A;  2ASM A;  4GW6 A;  4E1M A;  3C94 A;  4CIE A;  1N8R O;  5BR8 K;  3SQ2 A;  1BA0 A;  3VEY A;  3HPO A;  1KVB A;  3F73 A;  3SV4 A;  2HHT A;  2KZM A;  1U47 A;  2W6K A;  2ZD1 A;  3ZEU A;  1TKX A;  2P9N A;  3VTI A;  2FXU A;  4N47 A;  1DTT A;  5J2P A;  5J2Q A;  3V81 A;  3G4S N;  4O0I A;  3FLC O;  2QKB A;  1KLN A;  4FK2 A;  4F3O A;  3NHG A;  2BTF A;  2XRI A;  3ZSO A;  4JS4 A;  5GAG P;  3RMA A;  3OJU A;  4FJN A;  4X62 K;  3M6G A;  3HOS A;  1GOA A;  4JI4 K;  3GOI A;  3HP9 A;  3MMV A;  3HM9 A;  2ZGY A;  1YUW A;  4MLH A;  3H1V X;  3VQE A;  1CXQ A;  3AAR A;  3D2E A;  5AQW A;  4J8F A;  2FF6 A;  4I2Q A;  1TUY A;  3DAW A;  1W2B M;  1VSM A;  3RR7 A;  1KAZ A;  4KH4 A;  1NKE A;  3ULE B;  3A5M C;  2NNW A;  2NRZ A;  3VGM A;  1VQ8 N;  5AJ3 K;  4YFU A;  5KQD A;  2O8F B;  3QBX A;  3TAE A;  1X9J A;  4FJ9 A;  3WNG A;  4DTU A;  2UYT A;  3BP8 A;  4HWI A;  2YX6 A;  1NGD A;  1C1B A;  3C0B A;  4CW7 B;  1GLL O;  1QVG M;  1VQ4 N;  4IO8 A;  4MQ3 A;  3KLE A;  1T6D A;  4KI6 A;  3ULD A;  1M90 O;  3AO1 A;  1BDG A;  5AQY A;  3ZET A;  2QA4 N;  4XEI A;  1RBR A;  1TV6 A;  3K5L A;  1VK0 A;  1JKH A;  1XUP O;  3KLF A;  4H4M A;  3O3F A;  4JEP A;  3WXL A;  4CZF A;  3O9S A;  4QS8 A;  5BRH A;  3M8P A;  5AZI B;  3WXK A;  3QO9 A;  4A57 A;  3D2F A;  5KGW A;  3TAG A;  4FJL A;  3WT0 A;  4FM2 A;  5C10 A;  1XC3 A;  1XMO K;  2VG6 A;  4FWP A;  2D0A A;  3T1Y K;  3M8R A;  3MEG A;  3OJS A;  1JCF A;  4DR2 K;  1NU0 A;  1YF5 L;  1U49 A;  2V51 B;  4JI5 K;  4K0K K;  4OLA A;  1RDB A;  1BA1 A;  3V9S A;  1OH7 A;  2FBY A;  3VEV A;  1RT3 A;  1HR0 K;  4BRH A;  4BRA A;  3MWT A;  2VG7 A;  4FWQ A;  2ZJQ L;  4AH9 A;  2X78 A;  2F9T A;  1MWK A;  3VQP A;  1N5Y A;  1X9M A;  2E4L A;  3VQD A;  3B6P A;  2XY6 A;  4GKJ K;  2ITG A;  3FE1 A;  5AQQ A;  4B1Y B;  4I9L A;  4XH4 A;  3E9P A;  5LL6 Z;  4FXD A;  4MDA A;  3CM5 A;  2BUP A;  3PIO L;  4KHW A;  3QET A;  3UKU A;  4JHD B;  4C8K A;  3WQU A;  3IDH A;  3WEE A;  1K73 O;  3P31 A;  3O3H A;  3NF8 A;  3I33 A;  3CER A;  4IJN A;  2HOE A;  4FM1 A;  2WUS A;  3TAP A;  5AQR A;  3P1G A;  4DQI A;  1J9A A;  3HRG A;  4AHR A;  2WOM A;  4CJS A;  4CJ5 A;  1J6Z A;  2O8D B;  4CF0 A;  3DI6 A;  3OTO K;  3ZSY A;  4DSE A;  3C6U A;  3KVG A;  3VQ5 A;  5ELZ A;  3F9M A;  3HXM A;  1E3M A;  3DRR A;  4CGH A;  3IMX A;  3VES A;  3M8Q A;  4H5V A;  2FSN A;  2KLA A;  4GV9 A;  1EWR A;  1HNZ K;  2O8D A;  2D0C A;  3P38 A;  1P90 A;  4U7B A;  3AGR A;  3TAM A;  5K14 A;  3V4I A;  4CJV A;  1SKS A;  1YT3 A;  1JLG A;  4M3Z A;  1NKB A;  1BHL A;  3WEE B;  5JMV A;  4IBN A;  1QSS A;  3A0I X;  1ZC6 A;  4YOR A;  4JYA K;  3F2K A;  4JKB A;  3NBP A;  4CEA A;  4FJ8 A;  3TWH A;  3C6A A;  3U4L A;  2OAN A;  1QQO A;  2VYP A;  1JLE A;  1C0M A;  5CHI A;  3VPZ A;  1RBU A;  3RRH A;  1NGB A;  5LMN K;  1TKT A;  4FZX C;  2HBJ A;  2R7Y A;  1KFD A;  5FDL A;  4CJF A;  3U6F A;  5KI6 A;  1EWQ A;  3J7Z O;  3WXJ A;  1F21 A;  1IO2 A;  4HUE A;  2XHB A;  3S3O A;  2OPS A;  4DFJ A;  5GAE P;  3JXU A;  1Q9X A;  3SJH A;  3ZT2 A;  3SUN A;  3NCI A;  4KRF A;  3QBW A;  4CK2 A;  4I2P A;  4BRQ A;  4AHS A;  5B8H A;  1ZXO A;  3AV9 A;  1E4G T;  3OYJ A;  2DPN A;  4KHU A;  3VER A;  4KH6 A;  3FZL A;  4E89 A;  3K5M A;  2G8H A;  3MEE A;  3CJ1 A;  3CC4 N;  3HTV A;  3THV A;  1NMD A;  4CHZ A;  4A5B A;  4CGD A;  4EZ6 A;  1UA1 A;  4RW7 A;  2NRR A;  3L3U A;  3U3Y A;  1I94 K;  3DLB A;  5FRO A;  2ZWH A;  1Z26 A;  2W40 A;  3ZET B;  4CGF A;  4DV6 K;  5C0Y A;  3AO4 A;  3OS2 A;  3O1B A;  3QES A;  1OKJ A;  3TSP A;  4KPY A;  1ASU A;  4B9M A;  3CYM A;  4DV0 K;  1A5V A;  4CER A;  1YIJ N;  2ZGZ A;  4DTP A;  4K43 A;  4BC3 A;  1C1C A;  4C1N K;  2RE2 A;  1WAF A;  3B8A X;  4KBO A;  4Z4G A;  3CC2 N;  3QFP A;  1GLC G;  2RKI A;  2F8S A;  3ZSV A;  4FJI A;  4C1N I;  3ZSQ A;  2PYJ A;  3H3N O;  4BR0 A;  1LAV A;  4DR3 K;  3AGK A;  5KQ8 A;  1NK8 A;  3ULE A;  1P8Z A;  1OVY A;  5KPR A;  4DSI A;  1JCG A;  4K8X A;  3CCU N;  2XO7 A;  3LWL A;  1IKY A;  4LSL A;  4H0V B;  1NGA A;  3HL8 A;  3QLH A;  4FLX A;  4KKO A;  4K8Z A;  3LP1 A;  4CJ4 A;  3VTH A;  1SZ2 A;  3PY8 A;  3CET A;  3ZT1 A;  3ZT0 A;  1GLF O;  3SPZ A;  2UXD K;  3NGY A;  1D5A A;  1SV5 A;  5AQV A;  1OH5 A;  4BR5 A;  1KVC A;  2EWS A;  2GUP A;  3DYA A;  3UIQ A;  4OPJ A;  3K5N A;  5A2Q O;  4CHN A;  4J2B A;  4B1X B;  2QWO A;  1YIT N;  2DFF A;  4FWM A;  4FOE A;  4H5W A;  4EHU A;  4PY5 A;  1FJG K;  2CGJ A;  4FO0 A;  4W5O A;  4GV6 A;  4OKK A;  2QXF A;  2IOC A;  4M3X A;  3VA0 A;  3VA3 A;  3O9R A;  1RT1 A;  3AVM A;  4ISE A;  2QWP A;  1T03 A;  3W3D A;  2E2P A;  2YHY A;  3DOL A;  4B1Z A;  3SNN A;  2O8B B;  4FWR A;  4FW1 A;  4H8K A;  3EO3 A;  1A5W A;  3K5O A;  4DFM A;  5HRP A;  3J7Y P;  2ATQ A;  3IG1 A;  4CGG A;  4CZK A;  1LV5 A;  2PZS A;  1FXX A;  4FVU A;  1KCF A;  4F9O A;  4A2B A;  4CHQ A;  4TSX A;  3PO5 A;  3G71 N;  1S9G A;  1IKX A;  1T44 A;  3VQC A;  2UXC K;  5AQK A;  3PIP L;  2RPI A;  5LJW A;  1NGI A;  4E7L A;  3OYH A;  4NXN K;  4B1W B;  3QEI A;  3JSM A;  3WNH A;  1YXQ A;  4JD2 B;  1UA0 A;  2O8B A;  3N4Q A;  4OGE A;  5M1N A;  5AQM A;  4DR1 K;  3CMA N;  1HYV A;  2VQF K;  2UXB K;  2O8C A;  1Z25 A;  4DV2 K;  4FYD A;  1C0T A;  4C8O A;  4BWJ A;  4CZL A;  2G8F A;  3D0P A;  3THW A;  3DMJ A;  1RDC A;  1S6Q A;  4B3R K;  4BR4 A;  1HX1 A;  3MN5 A;  4I6M B;  4PKI A;  3T7Z A;  3HBT A;  4HHT A;  3QEV A;  4C8M A;  4FPB A;  4JKA A;  4DR7 K;  2HF3 A;  4YOY A;  4BQL A;  1K8K A;  2P9P B;  3QML A;  4KTW A;  1NOY A;  1KAX A;  4DR6 K;  2I5J A;  4BRP A;  4JI3 K;  2F96 A;  1EX4 A;  3WXI A;  4HTL A;  4DTJ A;  3SMP A;  1G15 A;  3ALY A;  1BIU A;  3VGL A;  3TAR A;  3K9J A;  3RMB A;  2B6A A;  2YKN A;  4LF4 K;  3MN9 A;  4DFP A;  5DM6 L;  1QZ5 A;  3OYC A;  4KHQ A;  2I7N A;  3HVT A;  4CZH A;  1WSJ A;  1L3S A;  4E1J A;  2D0P A;  4EP4 A;  3OYG A;  3P39 A;  4B9V A;  1XMQ K;  4R5P A;  3C65 A;  2J4R A;  3E66 A;  1T6C A;  2Q97 A;  2HMI A;  3SBT A;  2E2Q A;  5AZJ B;  1NJI O;  4M3W A;  4XIU A;  4H4O A;  3TR8 A;  3H08 A;  3V1O A;  1HPM A;  4IFE A;  1KTQ A;  3AVG A;  2WC9 A;  3L2U A;  3TSU A;  3CCQ N;  4O0J A;  4FJK A;  4UQG A;  3HVR A;  1X9W A;  3AVF A;  4BC2 A;  4Z4I A;  1K9M O;  2VGN A;  4DG1 A;  3SZ2 A;  4M42 A;  3FR0 A;  4FJ5 A;  3U9Z A;  4A62 A;  2YHA A;  1I3A A;  3O3G A;  3CCM N;  2VWJ A;  1NK5 A;  4JS5 A;  1L3U A;  4YHH K;  4DV7 K;  5FPD A;  4CJL A;  1R59 O;  1L3V A;  1QHT A;  3K2P A;  4YOX A;  4IEI A;  2A6A A;  1WN7 A;  4Y1C A;  4BRC A;  4BY9 C;  3G10 A;  1B9D A;  2EX3 A;  2HHV A;  4H0X B;  5IT9 O;  3NGI A;  5BN8 A;  3LAN A;  3CFO A;  1FKO A;  3LM2 A;  3QEP A;  1ATN A;  5AQO A;  3VET A;  3VGK A;  3HST B;  1DLO A;  3LAM A;  3WXM B;  4EHT A;  3LAK A;  1WLJ A;  4E1N A;  3PX4 A;  3Q7C A;  1KFS A;  4J2A A;  4ELV A;  1E4F T;  4Q5V A;  3VEN A;  3J8A A;  4KH5 A;  5BN9 A;  3ZX3 A;  3AO3 A;  2VWB A;  1BCM A;  3T69 A;  4WQ4 C;  2YNF A;  1VSD A;  4H5N A;  1BI4 A;  4RW8 A;  4BGA A;  1VSL A;  3UKR A;  1C0G A;  3SQ0 A;  1LWF A;  3RTV A;  2RN2 A;  1HNX K;  3O4N A;  4CVN E;  5CZ2 A;  4EAH D;  4JKC A;  3AAQ A;  3CCE N;  3VEO A;  2WON A;  3V1Q A;  4CJP A;  1BWF O;  1NGH A;  4B9U A;  2GX9 A;  3MN7 A;  1VSH A;  4FLV A;  1QTM A;  1NG9 A;  1T7P A;  4RW6 A;  3IAY A;  4M7Y A;  4OVL A;  3H6E A;  5J1E A;  5CZ1 A;  4CEO A;  4H0P A;  1XHZ A;  4CI6 A;  2AJQ A;  1ITG A;  5HBM A;  3V6D A;  1IBL K;  2PYL A;  4BE1 A;  4WFB L;  4JI1 K;  4N5S A;  4JHD A;  3UKU B;  3QNO A;  1T05 A;  4J2E A;  3HI0 A;  1VHX A;  4XH5 A;  3DRS A;  4ELU A;  4GVE A;  4E7I A;  4B3T K;  3OS1 A;  1FKP A;  1LOT B;  3WNF A;  3C95 A;  2ZE2 A;  5BRF A;  4RWT A;  5J2N A;  4HCB A;  4AQY K;  2BH1 A;  2Q1N A;  2UUB K;  1HQU A;  1QQN A;  3G0Z A;  3CCL N;  3NFA A;  4CF1 A;  4X65 K;  2Q0U A;  3OY9 A;  4IFV A;  5C12 A;  1SUQ A;  4KI4 A;  3AO5 A;  4IFY A;  5TKW A;  2P5O A;  4FJG A;  1K6Y A;  4DWI A;  4CBX A;  1WSI A;  2VG5 A;  2QWQ A;  2P9L B;  3NMU A;  4DLE A;  4ID5 A;  3OYK A;  5GAH P;  4B3S K;  3D2F B;  4RW9 A;  5JLH A;  4LF7 K;  2OTJ N;  5AZI A;  4LH5 A;  5F2R A;  4PL8 A;  5E41 A;  5CYQ A;  1KSP A;  3OYB A;  4DLG A;  3MX5 A;  5CYM A;  4LFC K;  4QCL A;  4PQU A;  4RTF D;  3I55 N;  3KJV A;  3QEX A;  2G8W A;  3QIC A;  1VQ9 N;  3O9U A;  3TSQ A;  4M3U A;  1JL1 A;  3C7N A;  4AHU A;  5JIC A;  4CZG A;  3CQX A;  4GVM A;  1RT2 A;  4WE1 A;  3THW B;  4NYN A;  2IDO A;  5AZJ A;  4IKF A;  4HVJ A;  4BG8 A;  2LSN A;  2YJF A;  1BUP A;  2O8F A;  3DXM A;  4CF2 A;  4CF8 A;  1MU2 A;  4M63 C;  1OH8 A;  4JKD A;  2CH6 A;  1IG8 A;  1N34 K;  3KWG A;  1MA9 B;  4CHY A;  2NRH A;  1D8Y A;  4NCA A;  4QOZ B;  2QWR A;  5GIN A;  3LP2 A;  4PUO A;  2X6S A;  4L8R B;  2NRW A;  2QWN A;  3BF3 A;  4OLB A;  4V19 S;  3QFU A;  3AVB A;  1HJR A;  3GE1 A;  4FWK A;  3ATU A;  1Q82 O;  2E2N A;  1VQM N;  2P9N B;  4BRF A;  1C0U A;  4CIG A;  4O44 A;  3VF2 A;  4DR5 K;  3WNE A;  4H0Y B;  1SS6 A;  1TAQ A;  4K42 A;  3HO1 A;  1EET A;  4FWS A;  3SAF A;  3KTQ A;  3K57 A;  4N76 A;  2YNI A;  3A5L C;  4EIA A;  1VSE A;  3EY1 A;  4HUF A;  3ZYY X;  1BIZ A;  4CHP A;  3OYA A;  2KFZ A;  2Q36 A;  2ASP A;  5CY4 A;  1L3T A;  4L3Q A;  4HCC A;  3ZEU B;  3DOK A;  1X9S A;  4BG9 A;  2HHQ A;  2A42 A;  4EFH A;  3V1R A;  2V7Y A;  3VEW A;  3CPW M;  1S5J A;  3E9O A;  4C23 A;  3VF4 A;  3FZM A;  3OYD A;  1JLA A;  1TYQ A;  5AQL A;  4NCB A;  1CZB A;  2HMP A;  1SL1 A;  3MDQ A;  4BRI A;  1HKG A;  4IWV A;  4U67 L;  3LDL A;  3D45 A;  1N36 K;  3I0R A;  1UWB A;  2AP1 A;  2Z1H A;  3ZSZ A;  4DV3 K;  3KD1 E;  2QW9 A;  3TU5 A;  1LWE A;  2HF4 A;  4DUY K;  3IS9 A;  5FRM A;  3TTD A;  2A40 A;  4IXC A;  3TI0 A;  2JGU A;  3SJJ A;  3LDN A;  1ZBU A;  4WFN L;  3EE8 A;  3ITH A;  2KFN A;  3KWI A;  3QIP A;  4ILH A;  2HST A;  1ASV A;  4B3M K;  4Z94 A;  3V9X A;  2P9I B;  3BZK A;  2JWK A;  1WSF A;  2Z1I A;  1G99 A;  4QS9 A;  1Q7Y O;  3KD5 E;  5BR9 A;  3MCA B;  3AA2 A;  4KTQ A;  3EKU A;  4RCH A;  4CJW A;  4FLW A;  1JXB A;  1VQO N;  1FK9 A;  3JAM O;  4DQR A;  3KK3 A;  4O8K A;  3GDQ A;  3LM9 A;  1JLC A;  2P9S A;  3PO4 A;  1WB9 A;  1NK7 A;  5BRD A;  3CCR N;  1HRH A;  3LAL A;  1MWM A;  4DTR A;  1W0H A;  1RIL A;  3KLG A;  2P9K A;  3PUF A;  3O4W A;  1LWC A;  3U3G A;  1SL2 A;  4DSK A;  5M1O A;  3KK7 A;  5AQZ A;  3MXM A;  4JN4 A;  5JS2 A;  4BGB A;  4K41 A;  3VQ6 A;  3PV8 A;  2XY5 A;  3PSI A;  5T7B A;  2NRV A;  4B8A B;  3SAH A;  3ENH A;  1YJN N;  1DGK N;  2E88 A;  3L8B A;  4KHN A;  4LF9 K;  1DKG D;  2D0B A;  1VSK A;  5C2D A;  4Z4F A;  1IG9 A;  3F9K A;  1BQN A;  3G6E N;  3FGU A;  1RGI A;  5KPT A;  3ATV A;  3O9Q A;  3JYT A;  3I56 N;  2NZT A;  4LY7 A;  3TAF A;  3QIO A;  5BPL A;  1ATR A;  2YI1 A;  3J80 O;  2AA4 A;  3LL3 A;  4FWN A;  4M7X A;  1XHX A;  4O5F A;  2I7P A;  2G8V A;  1YTA A;  4C8N A;  3B6O A;  2YHB A;  4BRN A;  2HHU A;  3GG4 A;  2PFU A;  4DFK A;  3LP0 A;  1RBV A;  2GUI A;  3BEX A;  5F1X A;  4E7H A;  2QKK A;  3CCS N;  4B9Q A;  3Q7B A;  3TAN A;  1RDU A;  3AVN A;  3ZX2 A;  1NGG A;  4BRE A;  1HQE A;  3N4P A;  4YOT A;  2JLE A;  2HNZ A;  1EP4 A;  1Q86 O;  4AHT A;  4KRE A;  1D4X A;  3LDQ A;  5I42 A;  5KPZ A;  4BRM A;  5C15 A;  4M3R A;  5CR4 A;  1I39 A;  1KQS M;  1TL1 A;  2A1S A;  4DTO A;  4CBU A;  2X6N A;  3T1H K;  4F3T A;  3KIO A;  3O6W A;  4CK3 A;  5GAD P;  1J54 A;  2IAJ A;  3AVK A;  1VSJ A;  2P51 A;  3EE9 A;  4FM0 A;  2V52 B;  4KV8 A;  4JKE A;  4ELT A;  4PKH A;  1JLQ A;  4Y0W A;  1SQK A;  5KGX A;  2P5G A;  4AHV A;  1EQY A;  1S22 A;  4BAC A;  2YHW A;  1DTQ A;  1KC8 O;  4CJ7 A;  2B5J A;  3RMC A;  4CD1 A;  4DHY A;  4G9Z A;  3DLG A;  3MCP A;  1BI4 B;  3KLH A;  1JXE A;  3C6H A;  2F4V K;  1KLM A;  4KHP K;  4FJM A;  2P9K B;  3A8Y A;  4JI2 K;  2HBL A;  2YNH A;  4CED A;  2D0O A;  3OBY A;  1VSI A;  3I8B A;  3CJA A;  3MEC A;  2OPR A;  3FZF A;  1VQP N;  3T3F A;  3CI5 A;  4ID1 A;  1U2V A;  5DMR A;  3LDS A;  4E0D A;  2Z1J A;  4NXM K;  1U04 A;  4MLE A;  1N32 K;  2DFH A;  3SMS A;  2F9W A;  2P9I A;  3L2R A;  3ZT3 A;  3HT3 A;  3K58 A;  2JWL A;  1W7A A;  5JS1 A;  2NUB A;  1FW6 A;  4KHY A;  1KD1 O;  3DXK B;  4GKK K;  3O5B A;  4BVO A;  4JRQ A;  2HVI A;  4FWL A;  4E3S A;  3RWU A;  4JI7 K;  1IKW A;  4FJJ A;  3O4Q A;  2GTD A;  3TAB A;  1WSE A;  3AO2 A;  4O5B A;  4I9Q A;  3U9D A;  2E8A A;  2HNY A;  1WNS A;  1NMN A;  1N6Q A;  4IEE A;  4YOV A;  4GV3 A;  4X64 K;  2BAN A;  4UY8 O;  5EY4 A;  4CZM A;  2YHX A;  2IIR A;  5FPE A;  3SV3 A;  1U45 A;  2GWK A;  3ISN C;  5AQX A;  4AIL C;  2OYQ A;  1GLE G;  1VRT A;  4Y1D A;  2O4I A;  5JLF A;  4R79 A;  4JI0 K;  4H5T A;  2W6L A;  4DV5 K;  3NF7 A;  4CZI A;  1ZBF A;  2IVP A;  3L0Q A;  1BL3 A;  2ETJ A;  3BGR A;  3L6Q A;  2KZZ A;  1L5U A;  1RBS A;  3A5O C;  1QQC A;  1GLB G;  1ATS A;  3DLR A;  5C24 A;  1RDD A;  3WQT A;  5AQI A;  1NNE A;  5F0X A;  4NLB A;  3ZSW A;  3NVK A;  2ZJP L;  1T8E A;  1VRU A;  2G8U A;  4GMJ B;  5FPM A;  4BRK A;  4CFA A;  3VF6 A;  4JLH A;  4B1U B;  5BPM A;  1JCE A;  1WSG A;  2RHK A;  3MK6 A;  4DQ8 A;  4YDU A;  1UOC A;  2P9P A;  4CEB A;  1QS4 A;  4BDY A;  5D3G A;  4RW4 A;  1NGC A;  1VQ5 N;  2VWK A;  1QE1 A;  5SWM A;  4JK7 A;  1IV0 A;  4CD3 A;  3VOV A;  4FJ7 A;  3NF6 A;  3S41 A;  2BE2 A;  1JL2 A;  5C42 A;  5KRS A;  3V9U A;  3SYZ A;  3CIP A;  3MAQ A;  4CJK A;  4QAG A;  5LJV A;  3NGZ A;  1X3N A;  1IBK K;  5C25 A;  3V9W A;  1Y97 A;  4PKG A;  4IOC L;  3ZSR A;  1VQ7 N;  1LCU A;  5CE3 A;  1QSL A;  3PSF A;  1RTH A;  5AQF A;  4WF9 L;  2O8C B;  1Z6R A;  1NBW A;  2E5L K;  2GV9 A;  1Y64 A;  1X3M A;  2EHG A;  4DQS A;  1S1X A;  3ZCM A;  3HJF A;  4JD2 A;  1TK5 A;  4DF4 A;  1TGO A;  3L4Q A;  3VMF B;  1S9E A;  1TUU A;  3S9H A;  4LD0 A;  2FSK A;  1YAG A;  2E20 A;  4O8U A;  2W41 A;  3R8E A;  5M1K A;  1WAJ A;  1WBD A;  1IH7 A;  4B9S A;  3E1Y A;  5ADX A;  4BR9 A;  3SQ1 A;  1C6V A;  4NO7 A;  1YI2 N;  4DV1 K;  3A5N C;  3UB5 A;  2WFB A;  2A5X A;  1GOC A;  4Z4C A;  2FC0 A;  2P9L A;  1XQS C;  3MN6 A;  5FRN A;  4KB1 A;  3L2Q A;  3HSC A;  4LSN A;  2P9U A;  1EKE A;  4FCY A;  3ZLJ A;  1H1V A;  2YJE A;  3OHR A;  3TAQ A;  2FSJ A;  3DJC A;  1RTJ A;  1HJO A;  4DKW A;  1IJJ A;  1XWL A;  1HMV A;  5I3U A;  5AQJ A;  4BDZ A;  4A59 A;  1NOZ A;  4CEC A;  2QXL A;  3SI6 A;  5AR0 A;  5H1S Q;  4G1Q A;  3QNN A;  3KLI A;  2Y1J A;  3CD6 N;  4A2A A;  1EXQ A;  1HPZ A;  2OPP A;  1ZBS A;  3NH2 A;  1J5E K;  3VQA A;  3SCX A;  5J2M A;  4C8L A;  4CFD A;  4PHT X;  4PA1 A;  2PBD A;  5M1F A;  1NLV A;  4PL7 A;  4H5R A;  3BZC A;  1K8A O;  4IJA A;  4OGC A;  2YNG A;  2UUA K;  5EOY A;  4JKH A;  4DTX A;  4WQ5 C;  3S3M A;  4LF8 K;  4B3O A;  4OJR A;  1O13 A;  2IGI A;  3H46 O;  3ID6 A;  3ZSX A;  4GNI A;  3H3O B;  4H03 B;  4M3Y A;  4IOA L;  4MO5 A;  1EO1 A;  4JNE A;  2FBT A;  1LW2 A;  2NRX A;  4DU1 A;  2YKM A;  1OVQ A;  1NJZ A;  3EN9 A;  1S6P A;  4DS5 A;  2DTU A;  2V7Z A;  4I7F A;  3UKR B;  2XY7 A;  4KHS A;  2KHO A;  3CC7 N;  4IZ9 A;  4GY2 B;  4DTS A;  4PWD A;  4BQZ A;  4LF5 K;  1Q81 O;  1S1T A;  3TTF A;  1QHA A;  4FJX A;  2VCP A;  3UE5 A;  1IBM K;  3AAP A;  2IC3 A;  4X66 K;  4LF6 K;  4F8R A;  3SK3 A;  1NGE A;  2HHH K;  4DCH A;  4FW2 A;  5AQP A;  4B9N A;  1TAU A;  1CLQ A;  4BE0 A;  2WBN A;  1RTD A;  5HRN A;  4E7J A;  5AQH A;  4XH1 A;  4CGI A;  4YOU A;  4JRP A;  4BRO A;  2XY8 A;  1Z05 A;  2D1K A;  3GBT A;  3GL1 A;  2D4W A;  4CGJ A;  3EL2 A;  3VEX A;  3G25 A;  4CEQ A;  3BDP A;  4OKJ A;  4ISG A;  4IDH A;  3ENB A;  4JI8 K;  3DWL A;  3NF9 A;  1TL3 A;  3P83 D;  2BDP A;  5M1P A;  2HHS A;  1S1V A;  4M41 A;  3P5J A;  3THX B;  1SKR A;  4AM7 A;  4Q0B A;  2E6M A;  5HOO A;  3M3Z A;  3CQ8 A;  4DR4 K;  4IOX A;  4DF8 A;  2O8E A;  3QB0 A;  1WOQ A;  1KAY A;  1RT6 A;  3TPQ A;  4FSV A;  4N56 A;  4IO9 L;  3CFR A;  1GLJ O;  1N33 K;  4W5Q A;  1YHQ N;  2OZS A;  5BPN A;  4AF1 A;  3RMD A;  4ZTF A;  2QTD A;  3DM2 A;  3BY5 A;  2GEL A;  4LH4 A;  3LWM A;  3DLE A;  3ASM A;  4FK4 A;  1JJ2 M;  4OPH A;  4JV5 K;  3CCJ N;  3LP3 A;  2X74 A;  5M1Q A;  1RFQ A;  3O1W A;  3AA4 A;  3TTC A;  5DK5 A;  5HRS A;  3CXC M;  3NAE A;  2O4G A;  3DLK A;  3EKS A;  4CIF A;  2QI2 A;  3CJ9 A;  2HW3 A;  2Y1I A;  4OPA A;  3PX6 A;  3NVM A;  4F2S A;  3AVJ A;  4IG3 A;  3AA3 A;  4OKE A;  1UAX A;  3AVL A;  1VQK N;  4BDP A;  5JVH L;  4CBW A;  4NCG A;  1BO5 O;  2VGM A;  4YDU C;  3PX0 A;  4BR2 A;  2HBK A;  1TYQ B;  3RR8 A;  2QK9 A;  4FJH A;  1JLF A;  1MDU B;  4CJ3 A;  1HNV A;  1WSH A;  4CEF A;  4F4K A;  2KTQ A;  3FFI A;  4MDB A;  1ZBL A;  3LPT A;  3OYE A;  4AHC A;  3M8S A;  1S72 N;  5C2F A;  4CZJ A;  3FZH A;  3OW2 M;  4JKG A;  2CGK A;  3IRX A;  1HLU A;  1XNR K;  4I6M A;  4A61 A;  2ZF5 O;  3IUC A;  2Q3S A;  1ILY A;  4JI6 K;  3O08 A;  1M1K O;  3IKM A;  3CPE A;  4CJT A;  5FPN A;  1XNQ K;  3SLC A;  3HPH A;  1RTI A;  5AQS A;  3VN5 A;  4FZY A;  3K59 A;  4CK1 A;  3NDK A;  2D5R A;  1D9D A;  4B9L A;  3I8D A;  5AFU H;  4FL9 A;  2DFE A;  5ADX H;  3KK2 A;  3K9K A;  4DQP A;  2QWL A;  3CHW A;  4JAX A;  5GIP A;  3AVC A;  4RG8 A;  3AVA A;  4DSL A;  4E7K A;  1YVN A;  3A2F A;  4DUZ K;  1J53 A;  3S3N A;  3HZ6 A;  3J7A P;  1GLA G;  5TKY A;  4KO0 A;  3E9L A;  2OTL N;  4BWM A;  3CJC A;  4J2D A;  5BRE A;  2FLO A;  2A3Z A;  2E6L A;  3OA9 A;  3LDP A;  1JLB A;  3ID8 A;  4ZTJ A;  4FLY A;  3H45 C;  3DLH A;  1NJX A;  3AVH A;  3H1Q A;  1QQM A;  1NJW A;  4FZZ A;  1V4S A;  2GWJ A;  4CE9 A;  1VQL N;  4FLT A;  4CES A;  3CF5 L;  2KQ2 A;  5HLF A;  2W42 A;  4WCE L;  2E1Y A;  4DV4 K;  4OO1 J;  3VQQ A;  3SUO A;  2Q0R A;  4Z4E A;  1RDA A;  4CJE A;  2HBM A;  2VQE K;  3T1A A;  4AM6 A;  2PAV A;  1VQN N;  1T3V A;  2CH5 A;  3CME N;  3THY A;  5EVZ A;  3CG7 A;  1RNH A;  4FK0 A;  4DSJ A;  4BE2 A;  1RT4 A;  4CJQ A;  3HOT A;  3THY B;  4B8C A;  4KB0 A;  1BG3 A;  3CJB A;  4JK9 A;  5SZT A;  3OYF A;  1ESV A;  5EX5 A;  3R9P A;  5LY3 A;  1NK9 A;  2GEM A;  1HYZ A;  3QIN A;  4CJR A;  5EXW A;  3R3L A;  4CEZ A;  1NGJ A;  4F2R A;  4OPK A;  1S1U A;  5MLC Q;  3DXM B;  4CZE A;  2UUC K;  4DU3 A;  5GIO A;  4NYF A;  1KRP A;  4HTU A;  4KTZ A;  4JKG B;  4DTM A;  3SUP A;  1BIS A;  4DQQ A;  3W0L A;  3CQY A;  4QS7 A;  4CFC A;  4DTN A;  3C7N B;  3E01 A;  3NH0 A;  3J81 O;  2IS3 A;  3RVC A;  5KTQ A;  1VAZ A;  3AA5 X;  1TKZ A;  3OYM A;  1QVF M;  2NLX A;  2GBZ A;  4KAZ A;  4BRG A;  2DY4 A;  1NK4 A;  2FBX A;  1NM1 A;  2KKZ A;  4ZHR A;  4B9T A;  4WFA L;  2A41 A;  3I0S A;  1CZA N;  3O80 A;  2YV0 X;  1KVA A;  5AFU A;  3SPY A;  4FOI A;  2QEX N;  4LFA K;  4DSF A;  4W5N A;  3CFP A;  3RSE B;  3ZT4 A;  5IWA K;  3L2W A;  5AQN A;  3SAG A;  3R6M A;  1RDW X;  3RRG A;  4FVM A;  1KXP A;  3OYL A;  1IKV A;  1B9F A;  1YJ9 N;  4IDK A;  3LZI A;  3D7E O;  1B92 A;  3OYI A;  3DXK A;  1U6Z A;  4W5T A;  1U2V B;  5AQT A;  2A1R A;  4B08 A;  1YJW N;  4BC4 A;  1V4T A;  1J5O A;  2P1J A;  1LW0 A;  3VQ8 A;  1WBB A;  3ZX0 A;  4IG0 A;  3AVI A;  3DLL L;  4ILG B; 
#chains in the Genus database with same CATH homology
 4CVN E;  4X64 K;  1FJG K;  2ZM6 K;  4LF5 K;  4LFB K;  2VQE K;  4GKJ K;  1XMQ K;  4DV1 K;  4JI0 K;  2UU9 K;  4B3M K;  5FLX O;  1IBM K;  5LL6 Z;  4X66 K;  4X62 K;  3J7Y P;  4DV5 K;  3T1H K;  4LF6 K;  4JI4 K;  2HHH K;  5LMU K;  1XNR K;  1N34 K;  1IBL K;  1I94 K;  2UXC K;  3JAM O;  4JI1 K;  4JI6 K;  5AJ3 K;  4DV6 K;  4NXN K;  2UUC K;  3OTO K;  4YY3 K;  4V19 S;  1XNQ K;  4DV0 K;  4DV4 K;  4B3T K;  4JI8 K;  2F4V K;  4KHP K;  4DR1 K;  4YHH K;  2VQF K;  4DV7 K;  2UXB K;  4CW7 B;  4JI2 K;  4AQY K;  4DR5 K;  3J81 O;  4DV2 K;  1HNZ K;  2UUB K;  4LF9 K;  4DR3 K;  1J5E K;  4DR4 K;  4X65 K;  4B3R K;  5IT9 O;  4DUZ K;  4NXM K;  3J7A P;  1N33 K;  1N32 K;  1HNW K;  4LFA K;  1IBK K;  4DR7 K;  2UUA K;  3J80 O;  5IWA K;  4JYA K;  4JV5 K;  1XMO K;  4LF8 K;  4B3S K;  2UXD K;  3T1Y K;  4LF7 K;  2E5L K;  4DR6 K;  4GKK K;  4JI3 K;  4DR2 K;  4JI7 K;  4JI5 K;  4K0K K;  5LMN K;  1N36 K;  5A2Q O;  5BR8 K;  4LFC K;  4DV3 K;  4LF4 K;  4OX9 K;  1HR0 K;  1HNX K;  4DUY K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...