4GKKK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4gkkK00
4DR2K 1N32K 4LFBK 2F4VK 4JI1K 1XMQK 4CW7B 4DV4K 4AQYK 4DR1K 4JI8K 3J7AP 4JYAK 5IT9O 4DR4K 4X64K 1HNXK 2UXDK 2E5LK 2UUBK 1N34K 4DUZK 2VQEK 4LFAK 5BR8K 4GKKK 4JI4K 4LF6K 3JAMO 4LF9K 1HR0K 4X65K 5LMNK 4LF5K 4YY3K 4NXMK 2VQFK 5LL6Z 4DV5K 4LFCK 2UXCK 1HNWK 4DUYK 4DV0K 1IBLK 4DV2K 2UXBK 3J7YP 2ZM6K 4OX9K 1XNQK 1IBKK 5IWAK 4X66K 4X62K 3OTOK 4DV3K 4DR7K 5A2QO 2HHHK 1HNZK 4DV7K 5AJ3K 4JI7K 1N36K 4JI2K 4JV5K 4B3MK 4CVNE 5FLXO 3T1HK 4K0KK 4B3RK 2UUAK 4GKJK 1IBMK 3J80O 4V19S 1J5EK 4YHHK 5LMUK 4B3TK 4JI6K 4KHPK 2UUCK 1N33K 4JI3K 4DR3K 4LF7K 4LF8K 4NXNK 3J81O 4DR5K 4DR6K 4JI0K 4LF4K 4DV6K 4B3SK 4JI5K 1FJGK 1XNRK 1XMOK 1I94K 3T1YK 2UU9K 4DV1K
chains in the Genus database with same CATH superfamily
1BI4B 4DR2K 4AM6A 4RW7A 1SKSA 4E1NA 1C6VA 2P51A 3MEEA 4JI8K 1T6CA 3D2FA 4JYAK 4FWRA 4BRLA 1NGAA 1S1XA 3G25A 3LL3A 3MCAB 3MX2A 4FWQA 1S6PA 4NYNA 2O8EA 5KQDA 4J8FA 2A6AA 4GNIA 5AQGA 2HHSA 4C1NK 2HBLA 4JHDB 3P5JA 3WT0A 1C0GA 3ZT0A 4CERA 3VEXA 1ZBLA 2ZQBA 4A59A 5LMNK 4NLBA 4M3YA 1ZYQA 1NU0A 1RT2A 4DV5K 1SQKA 2D0OA 1D9DA 3V9ZA 4DV0K 5KQ8A 1C1AA 1RBVA 4IXCA 3NGZA 4E7IA 3VEYA 2UXBK 3OYBA 4BWJA 2ZM6K 3PV8A 4OX9K 3MN9A 1VAZA 1CLQA 3MEDA 3HI0A 5F2RA 1NNEA 3NF6A 4CI6A 1CXUA 1BA0A 3QINA 4DLGA 1IG9A 4DSKA 4GV3A 1CZ9A 3ZLJA 1KXPA 3C7NA 1VRUA 2DFFA 2F7TA 3HSCA 4IFEA 1Z26A 3RRGA 4DSEA 5J2PA 4JKFA 3RVCA 3K58A 4OKEA 1JCGA 4Z4GA 3KK1A 1EO1A 2FXUA 1N33K 3JXUA 3LWMA 5AQIA 4FVUA 4PA1A 4BE0A 3RMBA 3AVNA 4XH1A 4FK2A 1U45A 4FK0A 2HHQA 1GLFO 1EETA 1H1VA 1I39A 2VCPA 3CCSN 5KPRA 4CHZA 3PIOL 5C2FA 4QCLA 3H1QA 4BR2A 4F8RA 4IOAL 3OVNA 2D4WA 3UKUB 1QTMA 1WSFA 4H5VA 2FBTA 5IT9O 3ISNC 2O8CB 4M41A 1NK9A 3IKMA 3HZ6A 5LJWA 3ZCMA 1JLQA 2VQEK 1NG9A 4O5BA 4AHCA 3HP6A 2YKMA 3SJHA 4J2BA 1C0FA 2D1KA 4PKHA 3TR8A 3VA0A 3THWB 2E6MA 2Q0UA 4TSXA 1QQOA 2GWJA 3O9QA 4I2QA 4CFBA 1VQON 2HHWA 3C6UA 4YY3K 1JLGA 3NVMA 4OPKA 5C42A 1YJNN 4OPJA 1RT7A 4E7JA 1FW6A 4K8XA 4MLEA 1WAFA 1KVCA 1TGOA 1QZ6A 4HTLA 3O1WA 1DGKN 3NF9A 5AJ3K 2JWLA 4H0OA 5GIPA 4XH5A 1LW2A 3UKUA 4CK2A 3T1AA 4K0KK 3V4IA 4FJMA 3LWLA 4CF2A 4XIUA 1YT3A 3H6EA 2O8CA 5AQHA 4JS4A 2ATQA 2O8DB 4KAZA 1TUUA 2FBYA 1TVRA 3AVHA 2VG7A 1HYVA 4BDPA 1MWMA 4DTRA 2YHXA 4C8OA 4I9LA 3FZMA 4B1ZA 2QWNA 4O0JA 1LAWA 4W5QA 3WXIA 3K0SA 3A5OC 3HOSA 3SNNA 4WQ4A 4JI0K 3AA2A 2O8FB 2VG6A 3K2PA 2KFNA 1Y97A 4HWIA 1ATSA 4DQQA 3VQEA 3OS2A 1NK4A 1NGGA 3OYIA 3M8PA 3WUHA 2BDPA 4IEIA 4LFBK 3DXMB 2F4VK 5DM6L 3FZLA 4KH6A 4DV4K 5GAEP 4CIGA 3LPUA 5FPDA 2NRRA 3VEWA 4Y1CA 2Y1IA 4KFBA 3OYAA 1S6QA 3SUNA 1MDUB 5AQSA 3AA5X 1JLCA 4Z94A 4CJEA 2DY4A 4U67L 4CESA 4OVLA 4AM7A 4IG3A 3LAMA 4FL9A 4I7FA 4CZLA 4KB0A 3L2WA 2I7PA 3OY9A 2X6SA 1T44A 4KPYA 1GOCA 3WNGA 4FPBA 4EHUA 1KD1O 1QQNA 4OGCA 5K14A 2GX9A 3DLEA 3SPZA 3CG7A 5M1PA 3TAFA 3HVTA 1BU6O 2O8FA 4B3OA 4PL7A 4DG1A 2Q97A 2YNGA 2WTUA 2YV0X 4X62K 5JLHA 5HRRA 4LH5A 4DR7K 5A2QO 4CJ4A 4FWMA 4FJLA 3IAYA 2Q2RA 3SLCA 5HRSA 3AGKA 3L3VA 3O6WA 3VQDA 1E4FT 4KI4A 2KZZA 3DXMA 4IEEA 3H1VX 4LC9B 3R9PA 3DLBA 2QKBA 5J2MA 3ZT2A 4ID1A 1LOTB 3LZJA 1TYQB 5LMUK 3SBTA 3ZSRA 4E89A 4KHPK 3EKSA 3MXJA 1KCFA 5HRNA 3N4QA 3PX4A 1W0HA 2Q1NA 5C2DA 3SQ2A 3FGUA 3P39A 5J2NA 1KC8O 4CZHA 4DHYA 1NGIA 2G8FA 1WSGA 1VHXA 4BRNA 1YJWN 4ISGA 4E0DA 2HHUA 4JK7A 4BRQA 1YAGA 1GLAG 3AVAA 3SPYA 5B8HA 1WB9A 2FLOA 5HRPA 3KK7A 3VQ7A 3QNOA 3CI5A 4CEFA 3U3YA 4DTSA 2OA8A 3KHYA 4CF9A 3RSEB 3ZSYA 3J7AP 5FPMA 5AQXA 1TKXA 3EY1A 3DYAA 4KHWA 1GLDG 3AVKA 1VQLN 3OBWA 3PLAA 1LCUA 4KBOA 3OHRA 2QWQA 2BGGA 5FDLA 3VQ8A 4H0VB 1B92A 4LF6K 3KKRA 3NVKA 2NRXA 3U4LA 3BGRA 2G8KA 1TYQA 4CEEA 2YX6A 3KLIA 4F2SA 3FE1A 1VSEA 5I42A 1SZ2A 1VQ6N 1IG8A 5ADXH 4FWNA 1G99A 2WONA 1RBSA 1HQEA 3VQPA 3NH2A 1ASWA 5AQMA 3IDHA 1DKGD 1EP4A 3F9KA 3J7YP 3E66A 1VK0A 2XY6A 4DFJA 5BPNA 5HLFA 3OTOK 4Q5VA 1DTQA 3ASMA 4JI7K 2QW9A 3CMEN 5DM7L 1S3XA 4B1YB 3V1OA 4CJFA 4B8CA 4B3RK 1Q18A 2UUAK 4DQPA 2Q3SA 2RKIA 1IBMK 3RSEA 1UA1A 3HBTA 4CJQA 4V19S 1HLUA 1X9MA 4M3UA 2HNDA 4DTXA 2BH1A 4GW6A 3QETA 4A5BA 4FM0A 3AVIA 1TK8A 4CBWA 1SUQA 2HVIA 3WEEB 2UUCK 4OLAA 2O4IA 3AY9A 1HNIA 1YTUA 4KRFA 3CCLN 3WXLA 4KHUA 1NK6A 2NNWA 3AVCA 2E6LA 4IO9L 4F2RA 2ZJQL 2YHBA 4FSVA 3VEZA 4FLUA 1K73O 3OYKA 3DXKB 5BPMA 4DFPA 5EX5A 3HL8A 3ALYA 4CGIA 2V7YA 1Q81O 3I0RA 1YIJN 3LP1A 1SL0A 4HUGA 3CJCA 3HXMA 2Q31A 3AO3A 5AQPA 3MAQA 2IDOA 3THXA 4CJPA 1HQUA 5FRMA 1BG3A 4U7BA 3Q7CA 1HNVA 4DR1K 3CJAA 1NJXA 1O13A 1WBBA 4X64K 4O8UA 4CZKA 2UXDK 3CCUN 2QA4N 5LJVA 1HKGA 4L3QA 4OKKA 3CM5A 3Q7BA 1IJJA 3H3NO 1DLOA 3NH1A 4BRMA 5KPZA 3E01A 1RDUA 3QERA 3DRPA 3SI6A 3WEEA 5KTQA 3DOKA 1GOAA 3RMAA 3FLCO 5LL6Z 1SAZA 3ZSZA 4UQGA 4DTMA 2QXFA 5BPLA 4BREA 3NMUA 5GINA 3BY5A 3DXKA 4C23A 3ENOA 3QLHA 5JMVA 3VGKA 1IBKK 3QEIA 4EHTA 3O80A 4CJWA 1VSJA 3HM9A 4N47A 4ILGB 2PYLA 1RBRA 4FZZA 3ZX2A 1YVUA 4NLCA 3HP9A 3NDKA 1N5YA 2CGJA 3WXKA 3THVA 3KD5E 4CBUA 5H1SQ 3AA4A 2I7NA 4M3TA 2PFUA 4M3RA 4XEIA 3LPTA 5EXWA 5AR0A 4WCEL 4B3TK 2E8AA 4NB4A 3I56N 4O4GA 2HNYA 1YITN 4BACA 1EKEA 4L8RB 2X74A 1UAXA 2F96A 2OTJN 4Y0WA 4BR5A 3C0BA 4DR3K 3HPOA 4Q0BA 3LM9A 3VQ6A 4DU3A 3QEXA 3ID8A 3MX5A 1D5AA 1QE1A 4DR6K 4CZEA 1R59O 5KPTA 1GLCG 1KAZA 3NCIA 3UB5A 3F2KA 5JS1A 3O4WA 4W5RA 3K5LA 4DSIA 2A3ZA 1XMOK 3F5TA 3IUCA 4FJ8A 4B9SA 3EE8A 5AZIB 4A2AA 5F0XA 1XQSC 4BRDA 5JVHL 3L3UA 2V7ZA 1QVFM 1U49A 2V51B 4DQIA 3KWGA 1N6QA 3V1RA 4DFMA 3P38A 3C65A 3LAKA 2R7YA 5AQQA 4Z4FA 1IKWA 1LWFA 2VGNA 2PBDA 2JWKA 4H8KA 5SWMA 4W5OA 4CHYA 3OYHA 1VSFA 4DFKA 4A61A 4ZTJA 3ID6A 4CD1A 1BDGA 4HCCA 4WQ5C 2QTDA 2IOCA 3O4NA 5CE3A 4B1VA 3KK3A 4RCHA 4DQSA 3D2EB 1M1KO 3LDQA 1K8KB 2OZSA 4E7KA 3OS0A 1Q8IA 4NXMK 4CCHA 2VQFK 1S9GA 1BIUA 1NOYA 4WFNL 3NHGA 4DUYK 2KZMA 3EZ5A 5TKWA 4FM1A 1L3UA 3LALA 4QS8A 4CGDA 2O8BB 1SKRA 3MXMA 1L5UA 4K8ZA 3LANA 2CH6A 1A5WA 4JK8A 4DV7K 4DQRA 1U04A 4DTOA 5CYQA 3DLHA 4DQ8A 1TAQA 5AZIA 3QEVA 4MQ3A 3R3LA 4CJ5A 1BCMA 1VQ7N 4H0XB 2P5GA 5CZ1A 2E2QA 4BGBA 4QS7A 3AV9A 3O5BA 1IH7A 1LW0A 4IKFA 4KH4A 3V1QA 5F1XA 4B8AB 4CF0A 1RTJA 4RW6A 3IS9A 3LDNA 4YDUC 2IVNA 5JS2A 1DT9A 4FXDA 1BWFO 1EWQA 2XHBA 1YVNA 1BI4A 3WQUA 4B1WB 3D2EA 2PY5A 4CZIA 1K8KA 3L2QA 1OH8A 4Z0UA 2KHOA 4BG9A 3QEWA 1DEJA 4OGEA 3ZSXA 4CJVA 4ELVA 1LWCA 3ZSWA 5JICA 5CY4A 3VQ9A 1HKCA 4IWVA 4B3SK 4FW1A 1GOBA 3M8SA 3VQ5A 2P9PB 4E7HA 2YHYA 3U8XA 3TU5A 4JHDA 5HROA 4YFUA 2RE2A 4AHRA 1ATRA 3AGRA 4B1XB 1GLJO 2P9UB 4M63C 4DR4K 2QKKA 4DTNA 4E1MA 1NGJA 1KAXA 3TANA 4M3XA 4FLZA 2HNZA 1J5OA 2E1ZA 4BVPA 4AF1A 4ELUA 1VSMA 1E3MA 3TTCA 4Z4IA 1X1PA 1JL1A 1HKBA 3DLLL 4KB1A 4DF4A 4WE1A 3KK2A 3TAGA 3U9ZA 3KKSA 1KRPA 3QFPA 3MCPA 5AQLA 3ATVA 2P5OA 3ZT1A 3EEQA 3VQBA 2E2OA 3E9OA 2PYJA 4G9ZA 4DKWA 3SUQA 4ILJA 4PKIA 2WFBA 3FZFA 1YXQA 3E9LA 2E4LA 1YTAA 2YHWA 2E1YA 1W97L 5AQOA 4DS5A 3FZKA 4N76A 1OH5A 3J80O 5HL7L 3HO1A 3MK6A 3QIPA 5AQTA 1D8YA 2J4RA 2NRZA 5M1KA 1OH6A 1T3VA 4BC5A 4FJJA 1HYZA 4DTUA 3NF7A 5KRSA 5FPEA 1ZBHA 1U48A 4IBNA 2FBXA 4JNEA 3BZKA 3NE6A 4YOUA 3DLKA 5ELZA 2YI1A 3ZETB 3K5OA 4ILHA 3TTFA 3EE9A 1QS4A 2Q36A 4CEQA 3LDLA 4FO0A 5GAHP 4AILC 2AJQA 3QICA 4LF4K 3HSTB 4RW4A 4FJXA 5AFUA 4CZMA 2QWMA 3SUOA 3LP2A 3AO1A 2ASOA 3SCXA 4PWDA 3AO4A 1RBUA 3RTVA 4ZHRA 1J9AA 2GWKA 3LM2A 1RTHA 4FLWA 3CCVN 3THWA 3TAQA 5AQZA 4AQYK 5EU7A 3L4IA 5J2QA 3O8MA 3CD6N 2QWOA 2OPSA 1MA9B 1NKCA 1HNXK 4FJ9A 3DLRA 1NGFA 2B4JA 3OW2M 4LFAK 3HPHA 4CD3A 1JLFA 4HCBA 3UE5A 3CQYA 3KIOA 3SV3A 3I55N 4NYFA 3WNHA 3OA9A 4CHNA 1A5VA 2KKZA 1KLMA 2HW3A 4KHQA 1J54A 4BWMA 3ZETA 2I5JA 3CQ8A 3O9RA 2FSKA 1MU2A 4M7YA 5C24A 4DV2K 2VWBA 1K9MO 1OVYA 3TSQA 3PY8A 1UWBA 1RTIA 2XY7A 3M3ZA 2O8DA 1RT4A 3P4IA 1TAUA 3OS1A 4KH5A 4DSFA 2Q0RA 3RR7A 1FK9A 3TAEA 3EZWA 3CERA 4H0PA 4BR0A 1ZBFA 3VF2A 1QSLA 2NRTA 4CIEA 3WQTA 4IZ9A 4PKGA 1X3MA 4C8NA 1BO5O 2FBVA 1WSHA 1VQ9N 3AAQA 1OH7A 1XC9A 4BR9A 2EX3A 3O9TA 4H5TA 4F4KA 4KKOA 1S1WA 4CF1A 4B9UA 4B1UB 1KVBA 3I0SA 3MN6A 1QZ5A 3O3FA 2W6LA 4GV6A 2IIRA 5JLFA 5C10A 3KWIA 2QWRA 3VF6A 3HK2A 3CMAN 3P1GA 3J81O 4DR5K 3GG4A 3VGMA 3HYFA 4MFBA 4MO5A 4CZJA 1R0AA 1N8RO 4B9VA 1Q9YA 3T1YK 2Z1IA 3V6DA 1QQMA 1N32K 4BE2A 3E9PA 5DK5A 3K5MA 3HRGA 1BOTO 3DAWA 3HVRA 2A42A 2ETJA 3SAHA 3ZX3A 3TWHA 1TKDA 1OVQA 1NGBA 2UUBK 4H4OA 4K42A 5EY4A 1DTTA 3QFUA 1WBDA 4GKKK 3LDPA 1RFQA 2NZTA 4BR7A 1C0TA 3O1BA 3AVBA 1RTDA 3NBPA 3VF4A 3OYFA 2HHXA 3R8EA 2UXCK 1HPMA 2RPIA 4YOVA 4ID5A 4EP4A 3LDOA 3OYEA 2GV9A 4X66K 4FWLA 4ISEA 2A41A 4CJSA 2KFZA 4C8LA 1FKOA 4KTZA 3T3FA 1RCHA 2ZJRL 4B3MK 3KLEA 1HJRA 5FLXO 1EWRA 1B9DA 1ITGA 1LAVA 5BRDA 1REVA 3G0ZA 4BC3A 4J2EA 3VERA 3NGIA 4CIFA 1RT6A 4AHSA 4OPHA 1VQ5N 3AVLA 4H5RA 1QHTA 5BRHA 3L2RA 1JCEA 4DWIA 4E3SA 2OANA 1EQYA 4LF7K 3DRRA 3QB0A 3F9MA 4OKJA 1NKBA 2XO7A 1X3NA 2A1SA 4M7XA 3QMLA 3O3GA 4FZXC 2IC3A 1JLBA 4IG0A 4JI5K 3BUZB 2FF3B 3EL2A 3ENBA 3JSMA 4JK9A 4CJLA 4ISFA 1Q9XA 3L4QA 1JLEA 4CW7B 1BISA 1ZBSA 1X9SA 1WNSA 3E1YA 1RGIA 2OCEA 4DSLA 2W6KA 4CHQA 3V9XA 4JRPA 1S1TA 2G8UA 3WNEA 2GUIA 5M1NA 4WQ5A 3JAMO 4N5SA 3TAMA 5C0YA 2WBNA 3L0QA 1NK8A 3SUPA 1KFDA 4LF9K 2P9SB 4AH9A 4FWKA 2Z1GA 3S3MA 1RNHA 1O1WA 1YHQN 2QI2A 4IDKA 1HPZA 3B6OA 1CZBA 1WN7A 1RDCA 1BA1A 5CZ2A 1QSYA 4DB3A 1ZBUA 3VN5A 4DU4A 4I6MB 2HF3A 4W5NA 2CGLA 3VESA 3AO5A 3EO3A 3L6QA 5E41A 4ELTA 4GVMA 1N36K 1Y64A 4FLYA 3FR0A 2HOEA 4BDZA 5AQVA 5AQNA 4ICLA 4CVNE 1I3AA 2IVPA 3JYTA 1KLNA 5BN8A 4J2DA 4BROA 4CJUA 1Z6RA 4OPAA 1J5EK 4WF9L 2QM1A 1VQ8N 4CEBA 3AVJA 3K5NA 1VQPN 4YDUA 4W5TA 4IFVA 3EYZA 3SQ0A 3BF1A 2ITGA 2HSTA 2BTFA 1T05A 3B6PA 1BHLA 4JI3K 4EAHD 3OYLA 4OO1J 4CGFA 1FKPA 1IKYA 3K57A 4FLXA 4IO8A 2QWPA 3KJVA 3W0LA 4FWOA 1IO2A 1C0UA 4DLEA 1RDDA 4B9QA 4CJKA 5BREA 1IKXA 1HX1A 4J2AA 3QBXA 2HBKA 1WSIA 2P9KB 1FJGK 4I6MA 4BGAA 1NKEA 5GAGP 5BN9A 3C6TA 4AHTA 4JKAA 3M8RA 2AA4A 3CETA 3ZSOA 2NRVA 2GELA 4JI1K 5CYMA 4N56A 3FZHA 1Q86O 5AQYA 3LP0A 4CEZA 3S3NA 3RMDA 1BUPA 2UYTA 4KO0A 2ZD1A 3NGYA 3IFRA 3V81A 5BR8K 4CF8A 3VA3A 2FSJA 4PY5A 4FOIA 4H5NA 1NJIO 2CGKA 4FLVA 4JKHA 2ZF5O 3P83D 3UIQA 2YNHA 4PL8A 4QAGA 4F3TA 5C25A 3C6HA 3PO4A 5AQJA 1YI2N 1QVGM 4FJKA 3A2FA 2YJEA 2VWJA 5FPNA 1HRHA 2W40A 3L2UA 2RN2A 1T03A 1TUYA 5IWAK 2PZSA 2KTQA 2CH5A 2B6AA 2P9KA 1CZAN 1XC3A 1V4TA 4K43A 2F9TA 4OLBA 5FRNA 3KLGA 3V9UA 4EFHA 3SZ2A 3T1HK 4JS5A 2IVOA 3SMPA 3O4QA 1NLVA 4FPAA 4FK4A 3V9SA 5EVZA 4DSJA 3ZX0A 4A57A 3VTIA 3CCJN 1FXXA 4IOXA 1U6ZA 2F8TA 4CHPA 2FF6A 2D0CA 4E19A 1VSIA 1ZC6A 3HPGA 5AFUH 3C7NB 2YJFA 3OYGA 4A2BA 4IJAA 3CJ9A 4IDHA 4JD2B 4CZFA 1ASUA 1NK7A 4B9LA 4AHVA 3HOTA 5JVGL 1GLBG 1RILA 3P31A 3G4SN 3VGLA 3H3OB 2XY5A 4BRHA 2D0BA 1M90O 3BDPA 3SMSA 3ZSQA 4OJRA 4NO7A 3AVMA 4M45A 3CJ7A 4BQLA 4B08A 1N34K 1JXBA 3H46O 3VENA 3GDQA 4WFAL 3CCMN 1ILYA 3ZYYX 3QDKA 2O8BA 2P9NB 4GY2B 1WUAA 1QHAA 3DOLA 1RBTA 1S9EA 2BE2A 4LFCK 2VYPA 4HHTA 4YORA 5FROA 4JKGB 3I8BA 3SAFA 4JD2A 2HHTA 3RRHA 3L8BA 1RDWX 3QO9A 3PX6A 4B9TA 3K9KA 3WNFA 4MLHA 4BR4A 5AQRA 3A5LC 4DCHA 4EP5A 1NGCA 3ULEB 1QSSA 3DM2A 2E2NA 2HF4A 1HMVA 3OYDA 4FLTA 1HYSA 4GKJK 4Z4CA 2QWLA 3NAEA 1JJ2M 1S1UA 1LV5A 2YKNA 4CJ7A 3UKRB 4FWSA 3O3HA 1VSHA 3I33A 3DWLA 4KV8A 3S41A 3ZEUB 3CC7N 4H03B 1TKTA 3MMVA 2ZJPL 2W42A 3H08A 4CBXA 4GVEA 4R5PA 2HB5A 2HMPA 2G8WA 1VRTA 3F73A 5KRTA 2P9NA 1W7AA 2ZWHA 1TK0A 3OYMA 2EHGA 1RT3A 2P9PA 4LSLA 4LF8K 2WOMA 5C12A 2NUBA 3C95A 3ZSVA 4CFDA 4G1QA 1S5JA 5HP1A 3G6EN 2P9UA 1NGEA 4JKBA 2HVHA 4FJIA 4JKGA 1S1VA 3K9JA 3IG1A 4FCYA 4DV6K 1C1BA 3ATUA 2OPQA 3FFKB 3S3OA 2ASMA 1TV6A 3K59A 3MN5A 4CZGA 5M1FA 4PHTX 1K8AO 2E88A 2ZGZA 4BG8A 2NRWA 3J7ZO 3ZT3A 3KTQA 1XUPO 2AP1A 1VSLA 3ULEA 3SV4A 4NCBA 4FJ5A 3A5NC 5J1EA 1KSPA 1VQ4N 4CGGA 3QNNA 2XRIA 2JLEA 4BC4A 4HUEA 4CJRA 4O5FA 1BGXT 3UKRA 4LSNA 1T6DA 4JI4K 1WSJA 2YHAA 2NRHA 4F9OA 1VQKN 2F8SA 3ZEUA 4E1JA 1TK5A 3U9DA 1YF5L 3QESA 3N4PA 4LD0A 4X65K 1SL2A 2HHVA 3DLGA 2WC9A 4LF5K 3D0PA 2E20A 2QEXN 2YCHA 3SQ4A 1C1CA 5KGWA 1Q7YO 5HBMA 1UOCA 4Z4EA 2Z1HA 3VOVA 1B9FA 2D5RA 1XWLA 1KVAA 3SJJA 3EN9A 3CCQN 1SS6A 3CCRN 3KLFA 1HUXA 1NWKA 4O44A 2JGUA 1NMDA 3AO2A 1JL2A 4ZTFA 3KLHA 3PUFA 4DV3K 2RF2A 2HHHK 1HNZK 4JRQA 4YNQA 1UA0A 3LP3A 1D4XA 4JI2K 1BQNA 4B9NA 1JKHA 1S72N 4IFYA 4K41A 3SK3A 4KI6A 2ASPA 4CK1A 1YJ9N 1U47A 1VQMN 2VG5A 4YOWA 5C15A 4RG8A 3ULDA 1EXQA 2IGIA 3OYJA 3U6FA 3BF3A 1J53A 3NF8A 3NFAA 4CEDA 4NXNK 3NH0A 1U4BA 3BP8A 3VEVA 1XI1A 4FJHA 5EOYA 4I2PA 4BDYA 4WYBA 4KHNA 1ATNA 1S22A 2XY8A 3GBTA 1U2VB 3CQXA 4I9QA 4HUFA 4A62A 1TL3A 3DRSA 1WOQA 3TTDA 1I94K 4PUOA 1P8ZA 4KHYA 1GLEG 3THYB 1JLAA 3LZIA 2FSNA 1XMQK 5HOOA 3AVFA 4FVMA 2OTLN 5DMRA 2X6NA 3L2VA 4DUZK 4BRAA 4BRGA 5AQFA 1F21A 4QS9A 4RTFD 3G10A 3PX0A 1ZXOA 3KD1E 2E2PA 1IV0A 3OJUA 3TABA 3OJSA 3HM8A 3BEXA 2IS3A 1SKWA 3D7EO 4H0TB 2IAJA 3GL1A 2G8VA 3CJBA 3AA3A 2Z1JA 1NK5A 4GMJB 2GBZA 2GEMA 3WXJA 3CYMA 3MWTA 3AVGA 2OPRA 3MXIA 1J6ZA 1NMNA 3W3DA 1U2VA 1D9FA 4H0YB 1XNQK 4CJ3A 3R6MA 4AHUA 1VQNN 4FWPA 4EZ6A 2QXLA 3DI6A 4A5AA 4JLHA 1NM1A 1RT1A 2ZE2A 4M3ZA 3U3GA 4JV5K 3M5RA 3THYA 3TSPA 3QIOA 4C1NI 3MN7A 2W41A 4KTWA 1W9HA 3CJ1A 5CHIA 4CGJA 3MEGA 1HJOA 4BRCA 4YHHK 4M42A 1T7PA 4JI6K 2NLXA 1NJZA 4UY8O 2ZGYA 4IJNA 3RR8A 3VPZA 2OPPA 5E26A 4O55A 1NK0A 4RWTA 3MWPA 2VWKA 2A1RA 4XH4A 4KREA 4WQ4C 2G8HA 4KHSA 3GE1A 5LY3A 3VQCA 3T19A 4CGHA 4DTPA 1VSDA 5KGXA 3O9SA 1XNRK 3RWUA 3O08A 1OKJA 3I8DA 2WUSA 3CHWA 1YUWA 3IMXA 3SQ1A 1IKVA 5GIOA 1KAYA 1T8EA 1G15A 5AZJB 3ENHA 2P9LB 2YNIA 4BQZA 2KW4A 2YNFA 3A5MC 4LH4A 3M6GA 3CIPA 2P9IB 3C94A 3VTHA 2D0PA 4IOCL 2DTUA 4R79A 3M8QA 1L3SA 4CE9A 2E5LK 1A5XA 3A8YA 4JKEA 4FZYA 3SYZA 2VGMA 4RW9A 2P1JA 5KI6A 4BRIA 4DTJA 1BIZA 3THXB 4CFAA 1L3TA 1NGHA 3SAGA 4DU1A 5BR9A 4HTUA 4BY9C 5M1QA 1XHXA 4FOEA 3A0IX 4F3OA 1HNWK 1C0MA 1WAJA 1X9WA 2DPNA 4JEPA 2QK9A 3DMJA 3VMFB 3D45A 1SV5A 2HMIA 3O9UA 1LWEA 3OBYA 3RMCA 3G71N 3CC4N 4FYDA 3TSUA 2O4GA 4MO4A 4YOXA 3DJCA 3VQAA 1RDBA 4GV9A 1TL1A 4FJ7A 3CM6A 1E4GT 4BRPA 2LSNA 5E84A 4CK3A 5TKYA 2HBJA 5D3GA 4MDAA 5GADP 2KQ2A 1NGDA 4Z4HA 5AQWA 2GTDA 3ZT4A 5AZJA 2P9LA 4BRKA 1GLLO 1ASVA 2P9IA 4BRFA 2GUPA 4CECA 2PAVA 3AAPA 3AARA 3H45C 4PQUA 2A40A 3CFPA 1MWKA 2A5XA 3QBWA 2FC0A 1VSKA 3C6AA 4QOZB 1L3VA 3KVGA 4FJGA 3JS6A 4JN4A 5M1OA 4DS4A 1SL1A 1ZBIA 3MECA 3VETA 1KFSA 2OYQA 3KZBA 4DF8A 3HT3A 1W2BM 4YOYA 5SZTA 4BE1A 2KLAA 4CEAA 5MLCQ 3SBGA 4BVOA 2BANA 3LDSA 4CJTA 1Z05A 3PSIA 1EX4A 1ESVA 1JXEA 1K6YA 3VQQA 4FM2A 1KTQA 4C8KA 4KTQA 3ITHA 4CFCA 3GOIA 4DV1K 3CCEN 1WSEA 4C8MA 4EZ9A 2ITMA 3TI0A 2F9WA 1BCOA 2P9SA 1NBWA 4JKCA 4CEOA 3M1FA 1X9JA 1TKZA 3CFRA 3VQ4A 4Y1DA 5AQKA 2EWSA 4EIAA 5BRFA 5AQUA 1XHZA 1RT5A 3TARA 3WXMB 1NJWA 3PSFA 1Z25A 3TPQA 3VEOA 3T7ZA 1HR0K 3CFOA 4M3WA 1BL3A 3PIPL 2DFEA 3T69A 1WLJA 2HBMA 1BQMA 5CR4A 3CPEA 3IRXA 2X78A 1QQCA 2RHKA 1IBLK 2DFHA 2H3GX 4HVJA 3CXCM 3EKUA 5ADXA 4K25A 5I9EB 1P90A 4N41A 1V4SA 4JKDA 4RW8A 4CHOA 1NOZA 3FFIA 3J8AA 4H5WA 5T7BA 3D2FB 4FW2A 4H4MA 4O0IA 3QEPA 1KQSM 4NCGA 3D6RA 4BC2A 1NJYA 3HJFA 4MDBA 1JCFA 3V9WA 3R1XA 2O8EB 3BZCA 2Y1JA 4LY7A 4B9MA 2V52B 4DMNA 3HTVA 4FJNA 4WFBL 3CPWM 3OYNA 2B5JA 2G8IA 2BUPA 3CC2N 5I3UA 4YOTA 3PO5A 1RDAA 3MDQA 3CF5L 2OZMA 3B8AX 3OYCA 2D0AA 4O8KA 3S9HA 4JAXA 4E7LA 4NCAA 1Q82O 1CXQA 2UU9K 3TAPA
chains in the Genus database with same CATH topology
4DR2K 1N32K 4LFBK 2F4VK 4JI1K 1XMQK 4CW7B 4DV4K 4AQYK 4DR1K 4JI8K 3J7AP 4JYAK 5IT9O 4DR4K 4X64K 1HNXK 2UXDK 2E5LK 2UUBK 1N34K 4DUZK 2VQEK 4LFAK 5BR8K 4GKKK 4JI4K 4LF6K 3JAMO 4LF9K 1HR0K 4X65K 5LMNK 4LF5K 4YY3K 4NXMK 2VQFK 5LL6Z 4DV5K 4LFCK 2UXCK 1HNWK 4DUYK 4DV0K 1IBLK 4DV2K 2UXBK 3J7YP 2ZM6K 4OX9K 1XNQK 1IBKK 5IWAK 4X66K 4X62K 3OTOK 4DV3K 4DR7K 5A2QO 2HHHK 1HNZK 4DV7K 5AJ3K 4JI7K 1N36K 4JI2K 4JV5K 4B3MK 4CVNE 5FLXO 3T1HK 4K0KK 4B3RK 2UUAK 4GKJK 1IBMK 3J80O 4V19S 1J5EK 4YHHK 5LMUK 4B3TK 4JI6K 4KHPK 2UUCK 1N33K 4JI3K 4DR3K 4LF7K 4LF8K 4NXNK 3J81O 4DR5K 4DR6K 4JI0K 4LF4K 4DV6K 4B3SK 4JI5K 1FJGK 1XNRK 1XMOK 1I94K 3T1YK 2UU9K 4DV1K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 K;  1N32 K;  4LFB K;  2F4V K;  4JI1 K;  1XMQ K;  4CW7 B;  4DV4 K;  4AQY K;  4DR1 K;  4JI8 K;  3J7A P;  4JYA K;  5IT9 O;  4DR4 K;  4X64 K;  1HNX K;  2UXD K;  2E5L K;  2UUB K;  1N34 K;  4DUZ K;  2VQE K;  4LFA K;  5BR8 K;  4GKK K;  4JI4 K;  4LF6 K;  3JAM O;  4LF9 K;  1HR0 K;  4X65 K;  5LMN K;  4LF5 K;  4YY3 K;  4NXM K;  2VQF K;  5LL6 Z;  4DV5 K;  4LFC K;  2UXC K;  1HNW K;  4DUY K;  4DV0 K;  1IBL K;  4DV2 K;  2UXB K;  3J7Y P;  2ZM6 K;  4OX9 K;  1XNQ K;  1IBK K;  5IWA K;  4X66 K;  4X62 K;  3OTO K;  4DV3 K;  4DR7 K;  5A2Q O;  2HHH K;  1HNZ K;  4DV7 K;  5AJ3 K;  4JI7 K;  1N36 K;  4JI2 K;  4JV5 K;  4B3M K;  4CVN E;  5FLX O;  3T1H K;  4K0K K;  4B3R K;  2UUA K;  4GKJ K;  1IBM K;  3J80 O;  4V19 S;  1J5E K;  4YHH K;  5LMU K;  4B3T K;  4JI6 K;  4KHP K;  2UUC K;  1N33 K;  4JI3 K;  4DR3 K;  4LF7 K;  4LF8 K;  4NXN K;  3J81 O;  4DR5 K;  4DR6 K;  4JI0 K;  4LF4 K;  4DV6 K;  4B3S K;  4JI5 K;  1FJG K;  1XNR K;  1XMO K;  1I94 K;  3T1Y K;  2UU9 K;  4DV1 K; 
#chains in the Genus database with same CATH topology
 1BI4 B;  4DR2 K;  4AM6 A;  4RW7 A;  1SKS A;  4E1N A;  1C6V A;  2P51 A;  3MEE A;  4JI8 K;  1T6C A;  3D2F A;  4JYA K;  4FWR A;  4BRL A;  1NGA A;  1S1X A;  3G25 A;  3LL3 A;  3MCA B;  3MX2 A;  4FWQ A;  1S6P A;  4NYN A;  2O8E A;  5KQD A;  4J8F A;  2A6A A;  4GNI A;  5AQG A;  2HHS A;  4C1N K;  2HBL A;  4JHD B;  3P5J A;  3WT0 A;  1C0G A;  3ZT0 A;  4CER A;  3VEX A;  1ZBL A;  2ZQB A;  4A59 A;  5LMN K;  4NLB A;  4M3Y A;  1ZYQ A;  1NU0 A;  1RT2 A;  4DV5 K;  1SQK A;  2D0O A;  1D9D A;  3V9Z A;  4DV0 K;  5KQ8 A;  1C1A A;  1RBV A;  4IXC A;  3NGZ A;  4E7I A;  3VEY A;  2UXB K;  3OYB A;  4BWJ A;  2ZM6 K;  3PV8 A;  4OX9 K;  3MN9 A;  1VAZ A;  1CLQ A;  3MED A;  3HI0 A;  5F2R A;  1NNE A;  3NF6 A;  4CI6 A;  1CXU A;  1BA0 A;  3QIN A;  4DLG A;  1IG9 A;  4DSK A;  4GV3 A;  1CZ9 A;  3ZLJ A;  1KXP A;  3C7N A;  1VRU A;  2DFF A;  2F7T A;  3HSC A;  4IFE A;  1Z26 A;  3RRG A;  4DSE A;  5J2P A;  4JKF A;  3RVC A;  3K58 A;  4OKE A;  1JCG A;  4Z4G A;  3KK1 A;  1EO1 A;  2FXU A;  1N33 K;  3JXU A;  3LWM A;  5AQI A;  4FVU A;  4PA1 A;  4BE0 A;  3RMB A;  3AVN A;  4XH1 A;  4FK2 A;  1U45 A;  4FK0 A;  2HHQ A;  1GLF O;  1EET A;  1H1V A;  1I39 A;  2VCP A;  3CCS N;  5KPR A;  4CHZ A;  3PIO L;  5C2F A;  4QCL A;  3H1Q A;  4BR2 A;  4F8R A;  4IOA L;  3OVN A;  2D4W A;  3UKU B;  1QTM A;  1WSF A;  4H5V A;  2FBT A;  5IT9 O;  3ISN C;  2O8C B;  4M41 A;  1NK9 A;  3IKM A;  3HZ6 A;  5LJW A;  3ZCM A;  1JLQ A;  2VQE K;  1NG9 A;  4O5B A;  4AHC A;  3HP6 A;  2YKM A;  3SJH A;  4J2B A;  1C0F A;  2D1K A;  4PKH A;  3TR8 A;  3VA0 A;  3THW B;  2E6M A;  2Q0U A;  4TSX A;  1QQO A;  2GWJ A;  3O9Q A;  4I2Q A;  4CFB A;  1VQO N;  2HHW A;  3C6U A;  4YY3 K;  1JLG A;  3NVM A;  4OPK A;  5C42 A;  1YJN N;  4OPJ A;  1RT7 A;  4E7J A;  1FW6 A;  4K8X A;  4MLE A;  1WAF A;  1KVC A;  1TGO A;  1QZ6 A;  4HTL A;  3O1W A;  1DGK N;  3NF9 A;  5AJ3 K;  2JWL A;  4H0O A;  5GIP A;  4XH5 A;  1LW2 A;  3UKU A;  4CK2 A;  3T1A A;  4K0K K;  3V4I A;  4FJM A;  3LWL A;  4CF2 A;  4XIU A;  1YT3 A;  3H6E A;  2O8C A;  5AQH A;  4JS4 A;  2ATQ A;  2O8D B;  4KAZ A;  1TUU A;  2FBY A;  1TVR A;  3AVH A;  2VG7 A;  1HYV A;  4BDP A;  1MWM A;  4DTR A;  2YHX A;  4C8O A;  4I9L A;  3FZM A;  4B1Z A;  2QWN A;  4O0J A;  1LAW A;  4W5Q A;  3WXI A;  3K0S A;  3A5O C;  3HOS A;  3SNN A;  4WQ4 A;  4JI0 K;  3AA2 A;  2O8F B;  2VG6 A;  3K2P A;  2KFN A;  1Y97 A;  4HWI A;  1ATS A;  4DQQ A;  3VQE A;  3OS2 A;  1NK4 A;  1NGG A;  3OYI A;  3M8P A;  3WUH A;  2BDP A;  4IEI A;  4LFB K;  3DXM B;  2F4V K;  5DM6 L;  3FZL A;  4KH6 A;  4DV4 K;  5GAE P;  4CIG A;  3LPU A;  5FPD A;  2NRR A;  3VEW A;  4Y1C A;  2Y1I A;  4KFB A;  3OYA A;  1S6Q A;  3SUN A;  1MDU B;  5AQS A;  3AA5 X;  1JLC A;  4Z94 A;  4CJE A;  2DY4 A;  4U67 L;  4CES A;  4OVL A;  4AM7 A;  4IG3 A;  3LAM A;  4FL9 A;  4I7F A;  4CZL A;  4KB0 A;  3L2W A;  2I7P A;  3OY9 A;  2X6S A;  1T44 A;  4KPY A;  1GOC A;  3WNG A;  4FPB A;  4EHU A;  1KD1 O;  1QQN A;  4OGC A;  5K14 A;  2GX9 A;  3DLE A;  3SPZ A;  3CG7 A;  5M1P A;  3TAF A;  3HVT A;  1BU6 O;  2O8F A;  4B3O A;  4PL7 A;  4DG1 A;  2Q97 A;  2YNG A;  2WTU A;  2YV0 X;  4X62 K;  5JLH A;  5HRR A;  4LH5 A;  4DR7 K;  5A2Q O;  4CJ4 A;  4FWM A;  4FJL A;  3IAY A;  2Q2R A;  3SLC A;  5HRS A;  3AGK A;  3L3V A;  3O6W A;  3VQD A;  1E4F T;  4KI4 A;  2KZZ A;  3DXM A;  4IEE A;  3H1V X;  4LC9 B;  3R9P A;  3DLB A;  2QKB A;  5J2M A;  3ZT2 A;  4ID1 A;  1LOT B;  3LZJ A;  1TYQ B;  5LMU K;  3SBT A;  3ZSR A;  4E89 A;  4KHP K;  3EKS A;  3MXJ A;  1KCF A;  5HRN A;  3N4Q A;  3PX4 A;  1W0H A;  2Q1N A;  5C2D A;  3SQ2 A;  3FGU A;  3P39 A;  5J2N A;  1KC8 O;  4CZH A;  4DHY A;  1NGI A;  2G8F A;  1WSG A;  1VHX A;  4BRN A;  1YJW N;  4ISG A;  4E0D A;  2HHU A;  4JK7 A;  4BRQ A;  1YAG A;  1GLA G;  3AVA A;  3SPY A;  5B8H A;  1WB9 A;  2FLO A;  5HRP A;  3KK7 A;  3VQ7 A;  3QNO A;  3CI5 A;  4CEF A;  3U3Y A;  4DTS A;  2OA8 A;  3KHY A;  4CF9 A;  3RSE B;  3ZSY A;  3J7A P;  5FPM A;  5AQX A;  1TKX A;  3EY1 A;  3DYA A;  4KHW A;  1GLD G;  3AVK A;  1VQL N;  3OBW A;  3PLA A;  1LCU A;  4KBO A;  3OHR A;  2QWQ A;  2BGG A;  5FDL A;  3VQ8 A;  4H0V B;  1B92 A;  4LF6 K;  3KKR A;  3NVK A;  2NRX A;  3U4L A;  3BGR A;  2G8K A;  1TYQ A;  4CEE A;  2YX6 A;  3KLI A;  4F2S A;  3FE1 A;  1VSE A;  5I42 A;  1SZ2 A;  1VQ6 N;  1IG8 A;  5ADX H;  4FWN A;  1G99 A;  2WON A;  1RBS A;  1HQE A;  3VQP A;  3NH2 A;  1ASW A;  5AQM A;  3IDH A;  1DKG D;  1EP4 A;  3F9K A;  3J7Y P;  3E66 A;  1VK0 A;  2XY6 A;  4DFJ A;  5BPN A;  5HLF A;  3OTO K;  4Q5V A;  1DTQ A;  3ASM A;  4JI7 K;  2QW9 A;  3CME N;  5DM7 L;  1S3X A;  4B1Y B;  3V1O A;  4CJF A;  4B8C A;  4B3R K;  1Q18 A;  2UUA K;  4DQP A;  2Q3S A;  2RKI A;  1IBM K;  3RSE A;  1UA1 A;  3HBT A;  4CJQ A;  4V19 S;  1HLU A;  1X9M A;  4M3U A;  2HND A;  4DTX A;  2BH1 A;  4GW6 A;  3QET A;  4A5B A;  4FM0 A;  3AVI A;  1TK8 A;  4CBW A;  1SUQ A;  2HVI A;  3WEE B;  2UUC K;  4OLA A;  2O4I A;  3AY9 A;  1HNI A;  1YTU A;  4KRF A;  3CCL N;  3WXL A;  4KHU A;  1NK6 A;  2NNW A;  3AVC A;  2E6L A;  4IO9 L;  4F2R A;  2ZJQ L;  2YHB A;  4FSV A;  3VEZ A;  4FLU A;  1K73 O;  3OYK A;  3DXK B;  5BPM A;  4DFP A;  5EX5 A;  3HL8 A;  3ALY A;  4CGI A;  2V7Y A;  1Q81 O;  3I0R A;  1YIJ N;  3LP1 A;  1SL0 A;  4HUG A;  3CJC A;  3HXM A;  2Q31 A;  3AO3 A;  5AQP A;  3MAQ A;  2IDO A;  3THX A;  4CJP A;  1HQU A;  5FRM A;  1BG3 A;  4U7B A;  3Q7C A;  1HNV A;  4DR1 K;  3CJA A;  1NJX A;  1O13 A;  1WBB A;  4X64 K;  4O8U A;  4CZK A;  2UXD K;  3CCU N;  2QA4 N;  5LJV A;  1HKG A;  4L3Q A;  4OKK A;  3CM5 A;  3Q7B A;  1IJJ A;  3H3N O;  1DLO A;  3NH1 A;  4BRM A;  5KPZ A;  3E01 A;  1RDU A;  3QER A;  3DRP A;  3SI6 A;  3WEE A;  5KTQ A;  3DOK A;  1GOA A;  3RMA A;  3FLC O;  5LL6 Z;  1SAZ A;  3ZSZ A;  4UQG A;  4DTM A;  2QXF A;  5BPL A;  4BRE A;  3NMU A;  5GIN A;  3BY5 A;  3DXK A;  4C23 A;  3ENO A;  3QLH A;  5JMV A;  3VGK A;  1IBK K;  3QEI A;  4EHT A;  3O80 A;  4CJW A;  1VSJ A;  3HM9 A;  4N47 A;  4ILG B;  2PYL A;  1RBR A;  4FZZ A;  3ZX2 A;  1YVU A;  4NLC A;  3HP9 A;  3NDK A;  1N5Y A;  2CGJ A;  3WXK A;  3THV A;  3KD5 E;  4CBU A;  5H1S Q;  3AA4 A;  2I7N A;  4M3T A;  2PFU A;  4M3R A;  4XEI A;  3LPT A;  5EXW A;  5AR0 A;  4WCE L;  4B3T K;  2E8A A;  4NB4 A;  3I56 N;  4O4G A;  2HNY A;  1YIT N;  4BAC A;  1EKE A;  4L8R B;  2X74 A;  1UAX A;  2F96 A;  2OTJ N;  4Y0W A;  4BR5 A;  3C0B A;  4DR3 K;  3HPO A;  4Q0B A;  3LM9 A;  3VQ6 A;  4DU3 A;  3QEX A;  3ID8 A;  3MX5 A;  1D5A A;  1QE1 A;  4DR6 K;  4CZE A;  1R59 O;  5KPT A;  1GLC G;  1KAZ A;  3NCI A;  3UB5 A;  3F2K A;  5JS1 A;  3O4W A;  4W5R A;  3K5L A;  4DSI A;  2A3Z A;  1XMO K;  3F5T A;  3IUC A;  4FJ8 A;  4B9S A;  3EE8 A;  5AZI B;  4A2A A;  5F0X A;  1XQS C;  4BRD A;  5JVH L;  3L3U A;  2V7Z A;  1QVF M;  1U49 A;  2V51 B;  4DQI A;  3KWG A;  1N6Q A;  3V1R A;  4DFM A;  3P38 A;  3C65 A;  3LAK A;  2R7Y A;  5AQQ A;  4Z4F A;  1IKW A;  1LWF A;  2VGN A;  2PBD A;  2JWK A;  4H8K A;  5SWM A;  4W5O A;  4CHY A;  3OYH A;  1VSF A;  4DFK A;  4A61 A;  4ZTJ A;  3ID6 A;  4CD1 A;  1BDG A;  4HCC A;  4WQ5 C;  2QTD A;  2IOC A;  3O4N A;  5CE3 A;  4B1V A;  3KK3 A;  4RCH A;  4DQS A;  3D2E B;  1M1K O;  3LDQ A;  1K8K B;  2OZS A;  4E7K A;  3OS0 A;  1Q8I A;  4NXM K;  4CCH A;  2VQF K;  1S9G A;  1BIU A;  1NOY A;  4WFN L;  3NHG A;  4DUY K;  2KZM A;  3EZ5 A;  5TKW A;  4FM1 A;  1L3U A;  3LAL A;  4QS8 A;  4CGD A;  2O8B B;  1SKR A;  3MXM A;  1L5U A;  4K8Z A;  3LAN A;  2CH6 A;  1A5W A;  4JK8 A;  4DV7 K;  4DQR A;  1U04 A;  4DTO A;  5CYQ A;  3DLH A;  4DQ8 A;  1TAQ A;  5AZI A;  3QEV A;  4MQ3 A;  3R3L A;  4CJ5 A;  1BCM A;  1VQ7 N;  4H0X B;  2P5G A;  5CZ1 A;  2E2Q A;  4BGB A;  4QS7 A;  3AV9 A;  3O5B A;  1IH7 A;  1LW0 A;  4IKF A;  4KH4 A;  3V1Q A;  5F1X A;  4B8A B;  4CF0 A;  1RTJ A;  4RW6 A;  3IS9 A;  3LDN A;  4YDU C;  2IVN A;  5JS2 A;  1DT9 A;  4FXD A;  1BWF O;  1EWQ A;  2XHB A;  1YVN A;  1BI4 A;  3WQU A;  4B1W B;  3D2E A;  2PY5 A;  4CZI A;  1K8K A;  3L2Q A;  1OH8 A;  4Z0U A;  2KHO A;  4BG9 A;  3QEW A;  1DEJ A;  4OGE A;  3ZSX A;  4CJV A;  4ELV A;  1LWC A;  3ZSW A;  5JIC A;  5CY4 A;  3VQ9 A;  1HKC A;  4IWV A;  4B3S K;  4FW1 A;  1GOB A;  3M8S A;  3VQ5 A;  2P9P B;  4E7H A;  2YHY A;  3U8X A;  3TU5 A;  4JHD A;  5HRO A;  4YFU A;  2RE2 A;  4AHR A;  1ATR A;  3AGR A;  4B1X B;  1GLJ O;  2P9U B;  4M63 C;  4DR4 K;  2QKK A;  4DTN A;  4E1M A;  1NGJ A;  1KAX A;  3TAN A;  4M3X A;  4FLZ A;  2HNZ A;  1J5O A;  2E1Z A;  4BVP A;  4AF1 A;  4ELU A;  1VSM A;  1E3M A;  3TTC A;  4Z4I A;  1X1P A;  1JL1 A;  1HKB A;  3DLL L;  4KB1 A;  4DF4 A;  4WE1 A;  3KK2 A;  3TAG A;  3U9Z A;  3KKS A;  1KRP A;  3QFP A;  3MCP A;  5AQL A;  3ATV A;  2P5O A;  3ZT1 A;  3EEQ A;  3VQB A;  2E2O A;  3E9O A;  2PYJ A;  4G9Z A;  4DKW A;  3SUQ A;  4ILJ A;  4PKI A;  2WFB A;  3FZF A;  1YXQ A;  3E9L A;  2E4L A;  1YTA A;  2YHW A;  2E1Y A;  1W97 L;  5AQO A;  4DS5 A;  3FZK A;  4N76 A;  1OH5 A;  3J80 O;  5HL7 L;  3HO1 A;  3MK6 A;  3QIP A;  5AQT A;  1D8Y A;  2J4R A;  2NRZ A;  5M1K A;  1OH6 A;  1T3V A;  4BC5 A;  4FJJ A;  1HYZ A;  4DTU A;  3NF7 A;  5KRS A;  5FPE A;  1ZBH A;  1U48 A;  4IBN A;  2FBX A;  4JNE A;  3BZK A;  3NE6 A;  4YOU A;  3DLK A;  5ELZ A;  2YI1 A;  3ZET B;  3K5O A;  4ILH A;  3TTF A;  3EE9 A;  1QS4 A;  2Q36 A;  4CEQ A;  3LDL A;  4FO0 A;  5GAH P;  4AIL C;  2AJQ A;  3QIC A;  4LF4 K;  3HST B;  4RW4 A;  4FJX A;  5AFU A;  4CZM A;  2QWM A;  3SUO A;  3LP2 A;  3AO1 A;  2ASO A;  3SCX A;  4PWD A;  3AO4 A;  1RBU A;  3RTV A;  4ZHR A;  1J9A A;  2GWK A;  3LM2 A;  1RTH A;  4FLW A;  3CCV N;  3THW A;  3TAQ A;  5AQZ A;  4AQY K;  5EU7 A;  3L4I A;  5J2Q A;  3O8M A;  3CD6 N;  2QWO A;  2OPS A;  1MA9 B;  1NKC A;  1HNX K;  4FJ9 A;  3DLR A;  1NGF A;  2B4J A;  3OW2 M;  4LFA K;  3HPH A;  4CD3 A;  1JLF A;  4HCB A;  3UE5 A;  3CQY A;  3KIO A;  3SV3 A;  3I55 N;  4NYF A;  3WNH A;  3OA9 A;  4CHN A;  1A5V A;  2KKZ A;  1KLM A;  2HW3 A;  4KHQ A;  1J54 A;  4BWM A;  3ZET A;  2I5J A;  3CQ8 A;  3O9R A;  2FSK A;  1MU2 A;  4M7Y A;  5C24 A;  4DV2 K;  2VWB A;  1K9M O;  1OVY A;  3TSQ A;  3PY8 A;  1UWB A;  1RTI A;  2XY7 A;  3M3Z A;  2O8D A;  1RT4 A;  3P4I A;  1TAU A;  3OS1 A;  4KH5 A;  4DSF A;  2Q0R A;  3RR7 A;  1FK9 A;  3TAE A;  3EZW A;  3CER A;  4H0P A;  4BR0 A;  1ZBF A;  3VF2 A;  1QSL A;  2NRT A;  4CIE A;  3WQT A;  4IZ9 A;  4PKG A;  1X3M A;  4C8N A;  1BO5 O;  2FBV A;  1WSH A;  1VQ9 N;  3AAQ A;  1OH7 A;  1XC9 A;  4BR9 A;  2EX3 A;  3O9T A;  4H5T A;  4F4K A;  4KKO A;  1S1W A;  4CF1 A;  4B9U A;  4B1U B;  1KVB A;  3I0S A;  3MN6 A;  1QZ5 A;  3O3F A;  2W6L A;  4GV6 A;  2IIR A;  5JLF A;  5C10 A;  3KWI A;  2QWR A;  3VF6 A;  3HK2 A;  3CMA N;  3P1G A;  3J81 O;  4DR5 K;  3GG4 A;  3VGM A;  3HYF A;  4MFB A;  4MO5 A;  4CZJ A;  1R0A A;  1N8R O;  4B9V A;  1Q9Y A;  3T1Y K;  2Z1I A;  3V6D A;  1QQM A;  1N32 K;  4BE2 A;  3E9P A;  5DK5 A;  3K5M A;  3HRG A;  1BOT O;  3DAW A;  3HVR A;  2A42 A;  2ETJ A;  3SAH A;  3ZX3 A;  3TWH A;  1TKD A;  1OVQ A;  1NGB A;  2UUB K;  4H4O A;  4K42 A;  5EY4 A;  1DTT A;  3QFU A;  1WBD A;  4GKK K;  3LDP A;  1RFQ A;  2NZT A;  4BR7 A;  1C0T A;  3O1B A;  3AVB A;  1RTD A;  3NBP A;  3VF4 A;  3OYF A;  2HHX A;  3R8E A;  2UXC K;  1HPM A;  2RPI A;  4YOV A;  4ID5 A;  4EP4 A;  3LDO A;  3OYE A;  2GV9 A;  4X66 K;  4FWL A;  4ISE A;  2A41 A;  4CJS A;  2KFZ A;  4C8L A;  1FKO A;  4KTZ A;  3T3F A;  1RCH A;  2ZJR L;  4B3M K;  3KLE A;  1HJR A;  5FLX O;  1EWR A;  1B9D A;  1ITG A;  1LAV A;  5BRD A;  1REV A;  3G0Z A;  4BC3 A;  4J2E A;  3VER A;  3NGI A;  4CIF A;  1RT6 A;  4AHS A;  4OPH A;  1VQ5 N;  3AVL A;  4H5R A;  1QHT A;  5BRH A;  3L2R A;  1JCE A;  4DWI A;  4E3S A;  2OAN A;  1EQY A;  4LF7 K;  3DRR A;  3QB0 A;  3F9M A;  4OKJ A;  1NKB A;  2XO7 A;  1X3N A;  2A1S A;  4M7X A;  3QML A;  3O3G A;  4FZX C;  2IC3 A;  1JLB A;  4IG0 A;  4JI5 K;  3BUZ B;  2FF3 B;  3EL2 A;  3ENB A;  3JSM A;  4JK9 A;  4CJL A;  4ISF A;  1Q9X A;  3L4Q A;  1JLE A;  4CW7 B;  1BIS A;  1ZBS A;  1X9S A;  1WNS A;  3E1Y A;  1RGI A;  2OCE A;  4DSL A;  2W6K A;  4CHQ A;  3V9X A;  4JRP A;  1S1T A;  2G8U A;  3WNE A;  2GUI A;  5M1N A;  4WQ5 A;  3JAM O;  4N5S A;  3TAM A;  5C0Y A;  2WBN A;  3L0Q A;  1NK8 A;  3SUP A;  1KFD A;  4LF9 K;  2P9S B;  4AH9 A;  4FWK A;  2Z1G A;  3S3M A;  1RNH A;  1O1W A;  1YHQ N;  2QI2 A;  4IDK A;  1HPZ A;  3B6O A;  1CZB A;  1WN7 A;  1RDC A;  1BA1 A;  5CZ2 A;  1QSY A;  4DB3 A;  1ZBU A;  3VN5 A;  4DU4 A;  4I6M B;  2HF3 A;  4W5N A;  2CGL A;  3VES A;  3AO5 A;  3EO3 A;  3L6Q A;  5E41 A;  4ELT A;  4GVM A;  1N36 K;  1Y64 A;  4FLY A;  3FR0 A;  2HOE A;  4BDZ A;  5AQV A;  5AQN A;  4ICL A;  4CVN E;  1I3A A;  2IVP A;  3JYT A;  1KLN A;  5BN8 A;  4J2D A;  4BRO A;  4CJU A;  1Z6R A;  4OPA A;  1J5E K;  4WF9 L;  2QM1 A;  1VQ8 N;  4CEB A;  3AVJ A;  3K5N A;  1VQP N;  4YDU A;  4W5T A;  4IFV A;  3EYZ A;  3SQ0 A;  3BF1 A;  2ITG A;  2HST A;  2BTF A;  1T05 A;  3B6P A;  1BHL A;  4JI3 K;  4EAH D;  3OYL A;  4OO1 J;  4CGF A;  1FKP A;  1IKY A;  3K57 A;  4FLX A;  4IO8 A;  2QWP A;  3KJV A;  3W0L A;  4FWO A;  1IO2 A;  1C0U A;  4DLE A;  1RDD A;  4B9Q A;  4CJK A;  5BRE A;  1IKX A;  1HX1 A;  4J2A A;  3QBX A;  2HBK A;  1WSI A;  2P9K B;  1FJG K;  4I6M A;  4BGA A;  1NKE A;  5GAG P;  5BN9 A;  3C6T A;  4AHT A;  4JKA A;  3M8R A;  2AA4 A;  3CET A;  3ZSO A;  2NRV A;  2GEL A;  4JI1 K;  5CYM A;  4N56 A;  3FZH A;  1Q86 O;  5AQY A;  3LP0 A;  4CEZ A;  3S3N A;  3RMD A;  1BUP A;  2UYT A;  4KO0 A;  2ZD1 A;  3NGY A;  3IFR A;  3V81 A;  5BR8 K;  4CF8 A;  3VA3 A;  2FSJ A;  4PY5 A;  4FOI A;  4H5N A;  1NJI O;  2CGK A;  4FLV A;  4JKH A;  2ZF5 O;  3P83 D;  3UIQ A;  2YNH A;  4PL8 A;  4QAG A;  4F3T A;  5C25 A;  3C6H A;  3PO4 A;  5AQJ A;  1YI2 N;  1QVG M;  4FJK A;  3A2F A;  2YJE A;  2VWJ A;  5FPN A;  1HRH A;  2W40 A;  3L2U A;  2RN2 A;  1T03 A;  1TUY A;  5IWA K;  2PZS A;  2KTQ A;  2CH5 A;  2B6A A;  2P9K A;  1CZA N;  1XC3 A;  1V4T A;  4K43 A;  2F9T A;  4OLB A;  5FRN A;  3KLG A;  3V9U A;  4EFH A;  3SZ2 A;  3T1H K;  4JS5 A;  2IVO A;  3SMP A;  3O4Q A;  1NLV A;  4FPA A;  4FK4 A;  3V9S A;  5EVZ A;  4DSJ A;  3ZX0 A;  4A57 A;  3VTI A;  3CCJ N;  1FXX A;  4IOX A;  1U6Z A;  2F8T A;  4CHP A;  2FF6 A;  2D0C A;  4E19 A;  1VSI A;  1ZC6 A;  3HPG A;  5AFU H;  3C7N B;  2YJF A;  3OYG A;  4A2B A;  4IJA A;  3CJ9 A;  4IDH A;  4JD2 B;  4CZF A;  1ASU A;  1NK7 A;  4B9L A;  4AHV A;  3HOT A;  5JVG L;  1GLB G;  1RIL A;  3P31 A;  3G4S N;  3VGL A;  3H3O B;  2XY5 A;  4BRH A;  2D0B A;  1M90 O;  3BDP A;  3SMS A;  3ZSQ A;  4OJR A;  4NO7 A;  3AVM A;  4M45 A;  3CJ7 A;  4BQL A;  4B08 A;  1N34 K;  1JXB A;  3H46 O;  3VEN A;  3GDQ A;  4WFA L;  3CCM N;  1ILY A;  3ZYY X;  3QDK A;  2O8B A;  2P9N B;  4GY2 B;  1WUA A;  1QHA A;  3DOL A;  1RBT A;  1S9E A;  2BE2 A;  4LFC K;  2VYP A;  4HHT A;  4YOR A;  5FRO A;  4JKG B;  3I8B A;  3SAF A;  4JD2 A;  2HHT A;  3RRH A;  3L8B A;  1RDW X;  3QO9 A;  3PX6 A;  4B9T A;  3K9K A;  3WNF A;  4MLH A;  4BR4 A;  5AQR A;  3A5L C;  4DCH A;  4EP5 A;  1NGC A;  3ULE B;  1QSS A;  3DM2 A;  2E2N A;  2HF4 A;  1HMV A;  3OYD A;  4FLT A;  1HYS A;  4GKJ K;  4Z4C A;  2QWL A;  3NAE A;  1JJ2 M;  1S1U A;  1LV5 A;  2YKN A;  4CJ7 A;  3UKR B;  4FWS A;  3O3H A;  1VSH A;  3I33 A;  3DWL A;  4KV8 A;  3S41 A;  3ZEU B;  3CC7 N;  4H03 B;  1TKT A;  3MMV A;  2ZJP L;  2W42 A;  3H08 A;  4CBX A;  4GVE A;  4R5P A;  2HB5 A;  2HMP A;  2G8W A;  1VRT A;  3F73 A;  5KRT A;  2P9N A;  1W7A A;  2ZWH A;  1TK0 A;  3OYM A;  2EHG A;  1RT3 A;  2P9P A;  4LSL A;  4LF8 K;  2WOM A;  5C12 A;  2NUB A;  3C95 A;  3ZSV A;  4CFD A;  4G1Q A;  1S5J A;  5HP1 A;  3G6E N;  2P9U A;  1NGE A;  4JKB A;  2HVH A;  4FJI A;  4JKG A;  1S1V A;  3K9J A;  3IG1 A;  4FCY A;  4DV6 K;  1C1B A;  3ATU A;  2OPQ A;  3FFK B;  3S3O A;  2ASM A;  1TV6 A;  3K59 A;  3MN5 A;  4CZG A;  5M1F A;  4PHT X;  1K8A O;  2E88 A;  2ZGZ A;  4BG8 A;  2NRW A;  3J7Z O;  3ZT3 A;  3KTQ A;  1XUP O;  2AP1 A;  1VSL A;  3ULE A;  3SV4 A;  4NCB A;  4FJ5 A;  3A5N C;  5J1E A;  1KSP A;  1VQ4 N;  4CGG A;  3QNN A;  2XRI A;  2JLE A;  4BC4 A;  4HUE A;  4CJR A;  4O5F A;  1BGX T;  3UKR A;  4LSN A;  1T6D A;  4JI4 K;  1WSJ A;  2YHA A;  2NRH A;  4F9O A;  1VQK N;  2F8S A;  3ZEU A;  4E1J A;  1TK5 A;  3U9D A;  1YF5 L;  3QES A;  3N4P A;  4LD0 A;  4X65 K;  1SL2 A;  2HHV A;  3DLG A;  2WC9 A;  4LF5 K;  3D0P A;  2E20 A;  2QEX N;  2YCH A;  3SQ4 A;  1C1C A;  5KGW A;  1Q7Y O;  5HBM A;  1UOC A;  4Z4E A;  2Z1H A;  3VOV A;  1B9F A;  2D5R A;  1XWL A;  1KVA A;  3SJJ A;  3EN9 A;  3CCQ N;  1SS6 A;  3CCR N;  3KLF A;  1HUX A;  1NWK A;  4O44 A;  2JGU A;  1NMD A;  3AO2 A;  1JL2 A;  4ZTF A;  3KLH A;  3PUF A;  4DV3 K;  2RF2 A;  2HHH K;  1HNZ K;  4JRQ A;  4YNQ A;  1UA0 A;  3LP3 A;  1D4X A;  4JI2 K;  1BQN A;  4B9N A;  1JKH A;  1S72 N;  4IFY A;  4K41 A;  3SK3 A;  4KI6 A;  2ASP A;  4CK1 A;  1YJ9 N;  1U47 A;  1VQM N;  2VG5 A;  4YOW A;  5C15 A;  4RG8 A;  3ULD A;  1EXQ A;  2IGI A;  3OYJ A;  3U6F A;  3BF3 A;  1J53 A;  3NF8 A;  3NFA A;  4CED A;  4NXN K;  3NH0 A;  1U4B A;  3BP8 A;  3VEV A;  1XI1 A;  4FJH A;  5EOY A;  4I2P A;  4BDY A;  4WYB A;  4KHN A;  1ATN A;  1S22 A;  2XY8 A;  3GBT A;  1U2V B;  3CQX A;  4I9Q A;  4HUF A;  4A62 A;  1TL3 A;  3DRS A;  1WOQ A;  3TTD A;  1I94 K;  4PUO A;  1P8Z A;  4KHY A;  1GLE G;  3THY B;  1JLA A;  3LZI A;  2FSN A;  1XMQ K;  5HOO A;  3AVF A;  4FVM A;  2OTL N;  5DMR A;  2X6N A;  3L2V A;  4DUZ K;  4BRA A;  4BRG A;  5AQF A;  1F21 A;  4QS9 A;  4RTF D;  3G10 A;  3PX0 A;  1ZXO A;  3KD1 E;  2E2P A;  1IV0 A;  3OJU A;  3TAB A;  3OJS A;  3HM8 A;  3BEX A;  2IS3 A;  1SKW A;  3D7E O;  4H0T B;  2IAJ A;  3GL1 A;  2G8V A;  3CJB A;  3AA3 A;  2Z1J A;  1NK5 A;  4GMJ B;  2GBZ A;  2GEM A;  3WXJ A;  3CYM A;  3MWT A;  3AVG A;  2OPR A;  3MXI A;  1J6Z A;  1NMN A;  3W3D A;  1U2V A;  1D9F A;  4H0Y B;  1XNQ K;  4CJ3 A;  3R6M A;  4AHU A;  1VQN N;  4FWP A;  4EZ6 A;  2QXL A;  3DI6 A;  4A5A A;  4JLH A;  1NM1 A;  1RT1 A;  2ZE2 A;  4M3Z A;  3U3G A;  4JV5 K;  3M5R A;  3THY A;  3TSP A;  3QIO A;  4C1N I;  3MN7 A;  2W41 A;  4KTW A;  1W9H A;  3CJ1 A;  5CHI A;  4CGJ A;  3MEG A;  1HJO A;  4BRC A;  4YHH K;  4M42 A;  1T7P A;  4JI6 K;  2NLX A;  1NJZ A;  4UY8 O;  2ZGY A;  4IJN A;  3RR8 A;  3VPZ A;  2OPP A;  5E26 A;  4O55 A;  1NK0 A;  4RWT A;  3MWP A;  2VWK A;  2A1R A;  4XH4 A;  4KRE A;  4WQ4 C;  2G8H A;  4KHS A;  3GE1 A;  5LY3 A;  3VQC A;  3T19 A;  4CGH A;  4DTP A;  1VSD A;  5KGX A;  3O9S A;  1XNR K;  3RWU A;  3O08 A;  1OKJ A;  3I8D A;  2WUS A;  3CHW A;  1YUW A;  3IMX A;  3SQ1 A;  1IKV A;  5GIO A;  1KAY A;  1T8E A;  1G15 A;  5AZJ B;  3ENH A;  2P9L B;  2YNI A;  4BQZ A;  2KW4 A;  2YNF A;  3A5M C;  4LH4 A;  3M6G A;  3CIP A;  2P9I B;  3C94 A;  3VTH A;  2D0P A;  4IOC L;  2DTU A;  4R79 A;  3M8Q A;  1L3S A;  4CE9 A;  2E5L K;  1A5X A;  3A8Y A;  4JKE A;  4FZY A;  3SYZ A;  2VGM A;  4RW9 A;  2P1J A;  5KI6 A;  4BRI A;  4DTJ A;  1BIZ A;  3THX B;  4CFA A;  1L3T A;  1NGH A;  3SAG A;  4DU1 A;  5BR9 A;  4HTU A;  4BY9 C;  5M1Q A;  1XHX A;  4FOE A;  3A0I X;  4F3O A;  1HNW K;  1C0M A;  1WAJ A;  1X9W A;  2DPN A;  4JEP A;  2QK9 A;  3DMJ A;  3VMF B;  3D45 A;  1SV5 A;  2HMI A;  3O9U A;  1LWE A;  3OBY A;  3RMC A;  3G71 N;  3CC4 N;  4FYD A;  3TSU A;  2O4G A;  4MO4 A;  4YOX A;  3DJC A;  3VQA A;  1RDB A;  4GV9 A;  1TL1 A;  4FJ7 A;  3CM6 A;  1E4G T;  4BRP A;  2LSN A;  5E84 A;  4CK3 A;  5TKY A;  2HBJ A;  5D3G A;  4MDA A;  5GAD P;  2KQ2 A;  1NGD A;  4Z4H A;  5AQW A;  2GTD A;  3ZT4 A;  5AZJ A;  2P9L A;  4BRK A;  1GLL O;  1ASV A;  2P9I A;  4BRF A;  2GUP A;  4CEC A;  2PAV A;  3AAP A;  3AAR A;  3H45 C;  4PQU A;  2A40 A;  3CFP A;  1MWK A;  2A5X A;  3QBW A;  2FC0 A;  1VSK A;  3C6A A;  4QOZ B;  1L3V A;  3KVG A;  4FJG A;  3JS6 A;  4JN4 A;  5M1O A;  4DS4 A;  1SL1 A;  1ZBI A;  3MEC A;  3VET A;  1KFS A;  2OYQ A;  3KZB A;  4DF8 A;  3HT3 A;  1W2B M;  4YOY A;  5SZT A;  4BE1 A;  2KLA A;  4CEA A;  5MLC Q;  3SBG A;  4BVO A;  2BAN A;  3LDS A;  4CJT A;  1Z05 A;  3PSI A;  1EX4 A;  1ESV A;  1JXE A;  1K6Y A;  3VQQ A;  4FM2 A;  1KTQ A;  4C8K A;  4KTQ A;  3ITH A;  4CFC A;  3GOI A;  4DV1 K;  3CCE N;  1WSE A;  4C8M A;  4EZ9 A;  2ITM A;  3TI0 A;  2F9W A;  1BCO A;  2P9S A;  1NBW A;  4JKC A;  4CEO A;  3M1F A;  1X9J A;  1TKZ A;  3CFR A;  3VQ4 A;  4Y1D A;  5AQK A;  2EWS A;  4EIA A;  5BRF A;  5AQU A;  1XHZ A;  1RT5 A;  3TAR A;  3WXM B;  1NJW A;  3PSF A;  1Z25 A;  3TPQ A;  3VEO A;  3T7Z A;  1HR0 K;  3CFO A;  4M3W A;  1BL3 A;  3PIP L;  2DFE A;  3T69 A;  1WLJ A;  2HBM A;  1BQM A;  5CR4 A;  3CPE A;  3IRX A;  2X78 A;  1QQC A;  2RHK A;  1IBL K;  2DFH A;  2H3G X;  4HVJ A;  3CXC M;  3EKU A;  5ADX A;  4K25 A;  5I9E B;  1P90 A;  4N41 A;  1V4S A;  4JKD A;  4RW8 A;  4CHO A;  1NOZ A;  3FFI A;  3J8A A;  4H5W A;  5T7B A;  3D2F B;  4FW2 A;  4H4M A;  4O0I A;  3QEP A;  1KQS M;  4NCG A;  3D6R A;  4BC2 A;  1NJY A;  3HJF A;  4MDB A;  1JCF A;  3V9W A;  3R1X A;  2O8E B;  3BZC A;  2Y1J A;  4LY7 A;  4B9M A;  2V52 B;  4DMN A;  3HTV A;  4FJN A;  4WFB L;  3CPW M;  3OYN A;  2B5J A;  2G8I A;  2BUP A;  3CC2 N;  5I3U A;  4YOT A;  3PO5 A;  1RDA A;  3MDQ A;  3CF5 L;  2OZM A;  3B8A X;  3OYC A;  2D0A A;  4O8K A;  3S9H A;  4JAX A;  4E7L A;  4NCA A;  1Q82 O;  1CXQ A;  2UU9 K;  3TAP A; 
#chains in the Genus database with same CATH homology
 4DR2 K;  1N32 K;  4LFB K;  2F4V K;  4JI1 K;  1XMQ K;  4CW7 B;  4DV4 K;  4AQY K;  4DR1 K;  4JI8 K;  3J7A P;  4JYA K;  5IT9 O;  4DR4 K;  4X64 K;  1HNX K;  2UXD K;  2E5L K;  2UUB K;  1N34 K;  4DUZ K;  2VQE K;  4LFA K;  5BR8 K;  4GKK K;  4JI4 K;  4LF6 K;  3JAM O;  4LF9 K;  1HR0 K;  4X65 K;  5LMN K;  4LF5 K;  4YY3 K;  4NXM K;  2VQF K;  5LL6 Z;  4DV5 K;  4LFC K;  2UXC K;  1HNW K;  4DUY K;  4DV0 K;  1IBL K;  4DV2 K;  2UXB K;  3J7Y P;  2ZM6 K;  4OX9 K;  1XNQ K;  1IBK K;  5IWA K;  4X66 K;  4X62 K;  3OTO K;  4DV3 K;  4DR7 K;  5A2Q O;  2HHH K;  1HNZ K;  4DV7 K;  5AJ3 K;  4JI7 K;  1N36 K;  4JI2 K;  4JV5 K;  4B3M K;  4CVN E;  5FLX O;  3T1H K;  4K0K K;  4B3R K;  2UUA K;  4GKJ K;  1IBM K;  3J80 O;  4V19 S;  1J5E K;  4YHH K;  5LMU K;  4B3T K;  4JI6 K;  4KHP K;  2UUC K;  1N33 K;  4JI3 K;  4DR3 K;  4LF7 K;  4LF8 K;  4NXN K;  3J81 O;  4DR5 K;  4DR6 K;  4JI0 K;  4LF4 K;  4DV6 K;  4B3S K;  4JI5 K;  1FJG K;  1XNR K;  1XMO K;  1I94 K;  3T1Y K;  2UU9 K;  4DV1 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...