5M1PA

Crystal structure of the large terminase nuclease from thermophilic phage g20c with bound calcium
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
187
structure length
187
Chain Sequence
AMNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYRTASGNQVMRAYGRGHDDIVMSLALAYSQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Terminase large subunit
publication title Viral genome packaging terminase cleaves DNA using the canonical RuvC-like two-metal catalysis mechanism.
pubmed doi rcsb
source organism Thermus phage g20c
total genus 64
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5m1pA00
5M1OA 5M1QA 5M1PA 4IDHA 4IFEA 5M1FA 5C2FA 5C12A 4IEIA 5M1KA 5M1NA 4IEEA 5C15A 5C2DA 3CPEA 3C6AA 5C10A 3C6HA
chains in the Genus database with same CATH superfamily
3LDQA 1K8KB 5M1OA 3TTDA 2IAJA 1NGDA 3AA3A 4ILHA 3VMFB 3FFIA 4JI6K 4DTJA 4C8LA 4N41A 3ULEA 3ZX2A 4FL9A 4NB4A 4FWSA 2O8DA 3D7EO 4BWMA 1Q81O 3G25A 1T05A 4B9VA 3QFPA 5CY4A 3CETA 5JVGL 4LFCK 3BZKA 5TKYA 1EETA 3OYFA 3CM5A 3P39A 1P8ZA 1RTIA 1MU2A 4BRLA 1BI4B 3O3FA 1E4FT 5GAGP 2UUCK 4BE2A 2P9LB 4H8KA 4A5AA 2ZM6K 1IV0A 1S1XA 4YNQA 1TKZA 3ZSVA 1GLJO 5JMVA 3CJ9A 1XNRK 3LDOA 4OPHA 3CCEN 4H5TA 4FPBA 1X9JA 3RWUA 4W5QA 3SK3A 4AM6A 1LW0A 1T3VA 5GIPA 3OA9A 4I7FA 2BH1A 3SJHA 2DY4A 2KHOA 3KWGA 5JLHA 4RCHA 3MWTA 4QS7A 4FWQA 3TANA 3CCSN 4LC9B 3CQXA 3AA4A 4GV9A 2O8FA 3TPQA 3J80O 1JCEA 3VETA 1VAZA 1KVAA 2VWJA 2Q97A 4F3TA 4Y0WA 2F8SA 1J5EK 1NU0A 5T7BA 2EWSA 3PSIA 4DSJA 4DMNA 4U7BA 2KFNA 3NF8A 3WXLA 4BRHA 1XWLA 5J2QA 5E41A 2YNIA 1W2BM 4KHYA 1VSHA 4DTXA 3BGRA 3HOSA 4O0IA 4JHDB 2BDPA 3P5JA 1B9FA 1RGIA 4BWJA 3CQYA 3QIOA 4CEEA 2QWOA 3F9KA 4CEQA 4CD1A 1YTUA 4I9QA 2DPNA 3M5RA 5CHIA 5BR9A 4BRMA 2Z1HA 4KO0A 2RKIA 1JL2A 3I55N 3DXMA 1BWFO 2QM1A 1D9FA 3P1GA 3LP0A 3TAPA 3DM2A 3LWMA 4FJ7A 3MWPA 3CC2N 4EIAA 1VRTA 5CYQA 3WEEA 3C65A 2OTLN 2F7TA 3EZWA 1NOYA 3G0ZA 4IDHA 1U2VA 3QO9A 3U9DA 1K9MO 2YI1A 1SL0A 4NYNA 5AQRA 3VEVA 4MLEA 4CBXA 2HHHK 1N34K 2BE2A 1M1KO 2IOCA 3CHWA 3IRXA 1JLCA 2P1JA 4BRIA 4CZKA 2D0PA 1Y64A 2QA4N 4FJJA 4FJXA 2GBZA 2GWJA 3SV4A 4HCBA 5AQOA 1XNQK 4B8CA 3CJBA 2WBNA 4A59A 1HNZK 3N4PA 3OW2M 1LAWA 3QEXA 3DLBA 4KH6A 3NH0A 3FLCO 1MWMA 3A5OC 5JVHL 4RW6A 1NGFA 4DTNA 3R6MA 3SZ2A 4CGDA 1SZ2A 1UA1A 4DF4A 4PWDA 1K6YA 2KFZA 4ISFA 4OLBA 3AO5A 4NCAA 2WUSA 4F8RA 4DTOA 1UWBA 1W97L 1RTHA 1C6VA 4C8OA 3MX5A 3SQ2A 2O8EB 5HBMA 3N4QA 4M3XA 2YCHA 3F2KA 4FWRA 3NDKA 1OVQA 3O3GA 4DQSA 2OZMA 1T03A 4HHTA 5EU7A 1LAVA 5BRFA 4M3WA 2Q0RA 3WXKA 1S1VA 4LF4K 3LDPA 1JXBA 3D2FB 4CK1A 4R5PA 1Z6RA 4I2QA 4AHRA 4Z4GA 4FJ5A 3AVHA 4DV1K 2O8CB 3ZSWA 5EY4A 3VERA 4DR3K 4FZYA 4JI4K 1U4BA 4CEBA 2ZQBA 4G1QA 3WXIA 2JWLA 3UKRB 3ZETA 2KQ2A 2RN2A 5M1KA 2W6LA 1RTDA 4HCCA 2YKNA 4CEOA 3VESA 4OPKA 5A2QO 4DLEA 5C25A 2F8TA 4ICLA 4CGJA 3AY9A 2ITMA 1QVFM 1BL3A 3CMAN 3V9UA 1RDBA 3EKUA 3ULEB 3V9SA 5FPMA 4CJ7A 1L3UA 2CGKA 4B9MA 3LANA 4JKBA 3CFRA 3MK6A 5C2FA 3LAMA 5AQJA 4JK8A 5AQQA 4DR7K 4FJNA 4Z4HA 4MFBA 2YNFA 3HXMA 1NGGA 3SCXA 1RT3A 3VQ8A 3TARA 5E26A 4BC4A 2OYQA 3SUNA 3CJ7A 3T1AA 1YAGA 4C1NK 2ZJPL 3ENBA 2ASMA 2YHWA 4GV3A 3MN5A 2YNGA 3JS6A 2GELA 1U04A 1HKBA 3HPHA 2OANA 5B8HA 5KPTA 4JKHA 4DFPA 3VQAA 1ZBLA 3MX2A 3L6QA 3RMCA 2ZWHA 4DTMA 4JKCA 3VQ7A 4BRAA 3S3MA 4DFKA 1HNVA 3NBPA 1BCOA 4BR2A 2ZE2A 4CFBA 1S3XA 4JNEA 1WUAA 2E6LA 3O1WA 3CCLN 3PO4A 1S72N 3AVNA 4FWKA 2DFEA 3O6WA 4N76A 2QWQA 1WNSA 1JLEA 3DYAA 4FW2A 3SAHA 3RSEA 2RF2A 4DFJA 1S1TA 3O9RA 4CJVA 3EE9A 4LFBK 4BQZA 3NE6A 4ISGA 3VEXA 5BN9A 3VEZA 4CEDA 5IT9O 1JXEA 4BVOA 4F4KA 4ZHRA 1C1AA 1K8KA 3NCIA 2WONA 2YJFA 4CE9A 4CHOA 5AQPA 2IVNA 2HHSA 2IGIA 2ZF5O 1NGIA 3VTIA 1CZBA 4HWIA 1N32K 3QINA 5C0YA 1XUPO 1U45A 2VCPA 4CK2A 2HHUA 2G8UA 4BR4A 3MN9A 2HW3A 2NNWA 3OYAA 4JI7K 4FJIA 4CF2A 3DRPA 3V1QA 2FBXA 4FLXA 1BI4A 1QQOA 4KHNA 2P9LA 4E1MA 1ZYQA 4B9LA 4AILC 3EEQA 1HKCA 1VSMA 2V7YA 3AVBA 1LWFA 3V1OA 3CERA 4HUFA 1KVBA 3SYZA 3OHRA 4BRQA 1DLOA 3HSTB 1S1UA 1BQNA 1KC8O 3H6EA 4E89A 3M8RA 4M7YA 1WSHA 1FK9A 1BO5O 5LJWA 4G9ZA 1T8EA 3H3NO 4BE0A 3LPUA 1GLBG 5BR8K 1HYSA 1IO2A 2G8VA 1NMNA 1KAYA 3T1HK 4KHQA 4DQIA 3VA3A 2IVOA 4YOXA 1CZ9A 5KPZA 3M3ZA 1S6PA 3DMJA 4BY9C 1DTTA 1UA0A 5FPDA 4IG3A 1LCUA 3VENA 4QS8A 4A2BA 2P51A 4DB3A 3U8XA 4CVNE 3ZSYA 2FBYA 2KLAA 4OKEA 4XH5A 2RPIA 1L3VA 3JAMO 3LZJA 1D8YA 1E4GT 3V6DA 4B3TK 5LL6Z 2YJEA 3D6RA 1HX1A 4FLZA 4JHDA 1TK0A 1W0HA 1Z25A 4CGFA 3RRHA 3KD1E 4CF8A 4E19A 4FLTA 1KAXA 1QHAA 3U4LA 2QWNA 3ZYYX 4CIGA 3THVA 3AO2A 2XY8A 1S22A 1S9EA 3OYDA 4KB0A 3NFAA 1XC9A 2E2QA 4MO5A 1ZBIA 1ZC6A 2ZJRL 1NKCA 1NJZA 4E0DA 3K0SA 5HLFA 3HT3A 3I0RA 3O1BA 3ZT2A 4B1ZA 1GLLO 4YOVA 2G8IA 2DFHA 1A5VA 3OJUA 4CEFA 1ZBHA 3VPZA 2E2NA 1W9HA 3LZIA 3O4QA 4IBNA 2B4JA 4O8UA 4WCEL 2V7ZA 4B1UB 3H45C 3DLHA 2QEXN 4B1VA 4FZXC 1J6ZA 3TAQA 1HUXA 3TTCA 3KK3A 1ASUA 4FM2A 3L2VA 4M3TA 3OS2A 2QWLA 3AV9A 4LSLA 3WNFA 2Z1JA 3O3HA 2Y1JA 1NNEA 2XY7A 3AVMA 3CCVN 4Z4FA 4KV8A 5K14A 3AO1A 3P83D 3A0IX 1WSFA 3RR8A 1NOZA 4Q0BA 3VGLA 5AZIB 1RDAA 4E7IA 2E4LA 2CH6A 2QWMA 4MDAA 2XHBA 3WNEA 3T7ZA 3BEXA 4A62A 4F2SA 4CIEA 4CEAA 3VQDA 2FXUA 1P90A 3DXKB 2OCEA 3VTHA 2O8EA 4BRCA 4KRFA 3OYBA 4CCHA 3D45A 4PKHA 1HNWK 4KTWA 3OYEA 1BOTO 4DSLA 2IDOA 2HHVA 1A5XA 4N47A 3HL8A 4KHSA 4KKOA 2QW9A 3D2FA 4BROA 2CGLA 4JKGB 4M7XA 1ESVA 3D2EB 1TUUA 4CI6A 4GVMA 2O8CA 5BPNA 4CEZA 3O8MA 4GY2B 4WF9L 1NG9A 3NGYA 1HJOA 5FRMA 5FDLA 3RSEB 3HRGA 1B9DA 5ADXH 4Z4CA 3UKRA 4B1YB 3CCUN 4LF5K 3HM9A 4M42A 4O44A 3FZFA 1JCFA 3V1RA 1YVUA 1BDGA 2KZZA 4UQGA 4FLVA 3FR0A 4GW6A 3DOKA 3NMUA 3DJCA 3O4WA 3ID6A 3NF7A 3CPEA 2V52B 2GEMA 1I39A 2BANA 3S41A 5JICA 3QB0A 4PKIA 5AQHA 4OLAA 3AVIA 3HOTA 4DWIA 5KQDA 3HJFA 4RWTA 4FM1A 1O13A 1L3SA 5AQMA 4DTRA 4BC3A 3KLHA 1DEJA 1ATSA 5AQFA 4M45A 3VN5A 3OBWA 1VSEA 2XO7A 3OYCA 1SAZA 3KLGA 4WE1A 1TL3A 3M8QA 4H0YB 3QESA 1YITN 4OJRA 1UOCA 4H4MA 4K8XA 1M90O 4DG1A 4U67L 1J5OA 3P4IA 3WNGA 3MXJA 4FJLA 4ILJA 5E84A 2G8FA 3P31A 4J2BA 3DI6A 4CESA 1C1BA 1VQON 2Q31A 3K9KA 4BDZA 4LF8K 1CLQA 2KW4A 4M63C 2P5GA 3FE1A 5AQLA 4CBWA 2E20A 5AQYA 1XMOK 4R79A 4FCYA 5KQ8A 5JS1A 3VF2A 3C95A 3UKUB 4JYAK 4KI4A 3AA2A 3KIOA 4CZLA 3J8AA 1TV6A 3MXMA 1KQSM 1U47A 3KTQA 4MDBA 3ISNC 2JGUA 4H5RA 2A6AA 1SL2A 1DT9A 5GIOA 2QTDA 1QS4A 4UY8O 4DV3K 3I8DA 3PY8A 3RMBA 4FYDA 3NF6A 4JN4A 1LWEA 1GOAA 3UB5A 1TAUA 3WXMB 1HYZA 2Q0UA 4CGIA 2FLOA 1VSKA 1XHXA 3MCAB 4JRQA 2NRRA 3L2UA 1TK8A 2VQFK 4HTUA 4GV6A 2OPPA 3QNOA 3OYNA 4IOAL 1GLFO 4IKFA 2Q1NA 4GMJB 3TABA 4N5SA 4IWVA 4CZHA 2PFUA 1EP4A 2E6MA 1R59O 2VGMA 1GLDG 1HMVA 3EZ5A 2E1YA 1ASVA 3F5TA 4K42A 3CFOA 5AQSA 1NJXA 2DFFA 4FJ8A 3E66A 1RILA 3KVGA 3FFKB 3OYGA 5AQXA 3SPYA 4JAXA 4BR9A 3PX6A 4DR6K 3K5LA 1NK7A 1C0GA 3FZHA 4AHTA 4CECA 4Z4IA 2GWKA 4JV5K 4BVPA 1X9MA 3CCMN 4FOEA 4B9UA 1LWCA 2VWKA 4H0XB 2A5XA 4BG8A 4E7KA 3PX0A 4XEIA 4DU3A 3SQ1A 3O9QA 4KHPK 1HKGA 4AHUA 3GOIA 2OPRA 4CHPA 2P9SB 3SUOA 4FK0A 3ALYA 5HP1A 3TI0A 4DHYA 1Q7YO 2QWPA 3TAGA 4EP5A 1TYQB 3SUQA 1OH7A 3HVRA 4JRPA 3A2FA 4J8FA 4WQ5C 3TTFA 3ZX3A 1X1PA 1R0AA 2F9TA 1YJ9N 2I7NA 1A5WA 3SMSA 3J7ZO 2P9NB 5GAHP 4I6MB 4CD3A 2NRXA 1RT2A 2GUPA 1NM1A 1KVCA 4EP4A 4FK2A 4BDYA 1VRUA 4H03B 1BG3A 1TKTA 1YXQA 3FGUA 4K25A 4B3OA 4DTUA 1VQMN 4H5VA 2I7PA 5KGXA 3L3UA 3V4IA 2EHGA 4KI6A 1C0UA 4CF0A 4E7HA 1ATNA 4NYFA 5AQWA 3SAGA 3KK2A 3MDQA 3QETA 3E1YA 4BRDA 3IS9A 4JI2K 4YOWA 4GKKK 1RDUA 3CFPA 3RMDA 1CZAN 1HQEA 4EAHD 3VQ4A 1LOTB 3HK2A 1NJYA 3W3DA 3AO4A 1QVGM 1T6DA 2GUIA 5C24A 1RFQA 5HRNA 1WBBA 4OKKA 1N33K 1RBVA 2YV0X 3QBWA 4PY5A 3C6TA 1C0TA 5BRHA 3QEVA 2YNHA 1YTAA 3E9PA 1SQKA 1HPMA 5ADXA 3C6UA 1WSEA 3QBXA 4B9SA 4A57A 3QEIA 3SBTA 2Z1GA 3O9UA 3IUCA 2G8WA 3QFUA 5AZIA 3K2PA 3AVKA 5BN8A 4DR5K 1ASWA 1IBMK 3KLIA 3U6FA 1KD1O 1SUQA 1VQLN 3MMVA 3SNNA 3AO3A 3ZSZA 3QEWA 4BC2A 3I8BA 3ZT3A 3R1XA 1Y97A 3DXKA 4XIUA 4JI0K 5AFUH 3LWLA 4KH5A 2HBKA 4ELUA 3FZMA 4C23A 3WXJA 1REVA 3RVCA 4CJPA 3G71N 5HOOA 1RDDA 2UXDK 4CJLA 4WFAL 2QI2A 1HQUA 4IO9L 3U3YA 1VQKN 4L3QA 3H46O 3KLEA 3QDKA 4JKGA 4CJ5A 1SL1A 3VQBA 1OH8A 1EQYA 3D2EA 4DTSA 1GLEG 1Z05A 2Q36A 3NH1A 2YHYA 3G10A 5KTQA 4OPJA 1J9AA 2XY5A 2NRZA 4CZJA 1Q82O 4GKJK 4FWPA 3J81O 2H3GX 4CJWA 1HPZA 4A2AA 1ZBSA 4KB1A 2NZTA 3CIPA 3OYHA 1TKXA 4M41A 1WOQA 2A40A 4O0JA 1KXPA 3D0PA 4CJUA 1KFDA 4K0KK 1QSYA 3SQ0A 2WFBA 2GTDA 1YT3A 2P9KB 4M3UA 4DSKA 4CHNA 3LDLA 3BZCA 5C10A 1HYVA 4CJ3A 4FZZA 1KCFA 1Q8IA 2E1ZA 3CD6N 4KREA 4WQ4C 1J54A 1DGKN 4DS4A 3HSCA 4W5NA 4IFVA 4YDUC 3KHYA 1HLUA 3QLHA 2FSNA 3V9WA 3VA0A 1OH5A 3L3VA 3DRSA 1SKSA 4I9LA 3K58A 4DR4K 3H1QA 1NKBA 1T6CA 1NBWA 3V9XA 2X6SA 2QWRA 2OPQA 2HSTA 3LPTA 3MECA 5CYMA 4CJSA 4GNIA 4YFUA 3K5MA 2AJQA 4YOYA 3H3OB 1OH6A 1CXUA 3O9SA 3MEDA 4PUOA 2A1SA 1VSIA 1NKEA 4LF9K 2IS3A 3O08A 5M1NA 4OKJA 4DSIA 4LH5A 3KD5E 2ZD1A 4E3SA 3OYLA 4EFHA 3HI0A 4NO7A 4LFAK 2D1KA 3CPWM 2Q3SA 3R3LA 3IMXA 4BRFA 5IWAK 4B3RK 4BG9A 5JLFA 4AQYK 4CHQA 4CF9A 4EZ9A 3G4SN 1OVYA 1D4XA 1I94K 3MEEA 3M6GA 2HOEA 3UKUA 2A41A 3ZSOA 1ZXOA 2QXLA 2IIRA 1IKWA 4F3OA 3HP9A 4FPAA 3TSQA 5HRPA 4KFBA 1NGBA 1QZ5A 2HBMA 2J4RA 1VQPN 3GBTA 2OTJN 2ZGZA 3DLEA 2GV9A 4CF1A 5C12A 3B6OA 3E9OA 5GADP 3VGKA 3EL2A 3PUFA 3AVLA 4W5RA 1NK5A 3TAEA 3HO1A 3E01A 3THYB 3E9LA 3A5LC 3GG4A 4MO4A 5FRNA 3CJCA 4CZMA 4JD2B 1EXQA 1RT7A 4C8NA 4BE1A 5M1QA 3THXB 2JLEA 3ZSRA 5FROA 1NMDA 3LALA 1U48A 2D5RA 3RMAA 1RT4A 1VSLA 1X9WA 3QERA 2NRTA 1X9SA 2HNZA 5CZ1A 3OYKA 4WQ4A 3V9ZA 3CF5L 3OYIA 5J2PA 1IJJA 1QZ6A 1E3MA 3CQ8A 2PAVA 4YDUA 4BR7A 3BP8A 4ELTA 4O55A 4BACA 3T1YK 1WSIA 2VQEK 3UE5A 4DUZK 4NXNK 3LM2A 3C6AA 3EY1A 5J1EA 4BREA 1LW2A 1V4TA 4AHSA 5D3GA 1BIUA 3VQ5A 3RTVA 3VF4A 3Q7BA 1T44A 4H5WA 3LAKA 4O5BA 3WNHA 2BGGA 1Q9YA 1ILYA 4B8AB 1RBUA 2AP1A 1W7AA 5GAEP 4BRNA 5HROA 3AAQA 3DOLA 2RHKA 2NRVA 3KK7A 1YI2N 1NK9A 4DQQA 2ASPA 3ZT1A 1BA1A 2YHBA 3IG1A 4X66K 3NGZA 1S5JA 3AVCA 3NVKA 3J7YP 1IBLK 4CHYA 4Q5VA 1GLAG 2P9SA 4CZEA 3S3NA 3AVAA 1BISA 3V81A 1JLBA 3O4NA 4ISEA 4FK4A 4JKFA 3J7AP 3CJAA 4DSEA 1O1WA 1QQMA 3T19A 3HP6A 1TYQA 3HYFA 2Z1IA 4PKGA 3ZCMA 3CMEN 4BRKA 4FLUA 1T7PA 3F73A 4I2PA 4JI3K 4MLHA 4IFYA 4BDPA 3HBTA 2YHAA 2P9NA 5CR4A 2W6KA 4I6MA 1FKPA 3KJVA 3ENHA 3WT0A 3VQPA 5AQTA 3SQ4A 2OZSA 2Q2RA 2UXCK 3RRGA 4JI5K 4B9NA 4CIFA 4FJGA 2YX6A 4JEPA 3KLFA 2CGJA 3LP2A 4B3MK 3ITHA 1L3TA 3H08A 2ITGA 3PIOL 4OGCA 5HRRA 4H4OA 5SZTA 4FWMA 2E5LK 2HMIA 2FBTA 5AFUA 4FSVA 3TU5A 1N36K 3VQ9A 5EOYA 3K57A 1ATRA 4CZGA 2A42A 4E1JA 1OKJA 3KK1A 3F9MA 4OPAA 5DM7L 1TKDA 4LF7K 1XHZA 1U49A 1EWRA 3AAPA 3L2QA 4ZTJA 2HNDA 1WSGA 3L2WA 4BRPA 4B9QA 1U6ZA 3GE1A 1GLCG 4NLBA 1XC3A 4Z4EA 4OX9K 1QQNA 4CFCA 1Q18A 1GOBA 3ZEUB 4CHZA 1WBDA 5J2NA 1BA0A 2HF3A 2E88A 2P9IB 4FXDA 1VSJA 5I42A 4FW1A 3QIPA 2O4IA 2B5JA 4E1NA 4JK9A 2D0CA 4KH4A 1QQCA 1VHXA 5DMRA 4Z94A 5AJ3K 3NGIA 1G99A 1SKWA 5F2RA 2UYTA 1QSSA 3RR7A 5FPEA 4YY3K 4CW7B 2W40A 2A3ZA 3SV3A 5AZJB 4W5OA 2UU9K 4WYBA 1S9GA 3EO3A 2NRWA 4YORA 1BU6O 1SS6A 2X6NA 4B1XB 3I0SA 1FJGK 1K8AO 1S6QA 1YF5L 1Z26A 3SPZA 2VYPA 4DQRA 5AQVA 5FPNA 1LV5A 3SAFA 2UUBK 3CJ1A 1KFSA 2FBVA 2PBDA 4IEEA 5AQGA 4ELVA 3AGKA 4RW8A 1HJRA 4BC5A 1RNHA 1NGJA 1YJNN 3O5BA 4FVMA 4J2EA 4IOCL 1XMQK 3AARA 5BREA 1YHQN 3I56N 4HTLA 1IH7A 3EE8A 1J53A 1ZBFA 3LDNA 2JWKA 1DKGD 4TSXA 5KGWA 1KLMA 2D4WA 2PYLA 4DCHA 3TR8A 3GDQA 3ID8A 4Y1DA 3OS1A 2G8HA 5I3UA 1VQ8N 4F9OA 2P9KA 3S3OA 5M1FA 4LD0A 4RW4A 1I3AA 2WC9A 3BF1A 5CE3A 1IG8A 4JKEA 4FJKA 3VGMA 1D9DA 5AQNA 2NLXA 3QNNA 3TAFA 3L0QA 4IZ9A 2W42A 4NXMK 3S9HA 3IKMA 3AVFA 4FWLA 4PA1A 3SMPA 1KLNA 3K5NA 4HUGA 2DTUA 3CXCM 2CH5A 2P9UA 3R8EA 2V51B 3PIPL 5EX5A 3PO5A 4WFNL 4DR1K 1VSFA 1NWKA 4CERA 3CC4N 3OS0A 2BUPA 4K41A 2E8AA 1G15A 3TSPA 3ZLJA 4CZFA 1BCMA 2A1RA 2F96A 4QCLA 4CZIA 2UUAK 1BQMA 3CCJN 1DTQA 3I33A 3VQQA 3TAMA 1RT5A 3OYJA 1TVRA 4IG0A 3NAEA 3MN6A 5EXWA 1HNIA 3C7NB 2O8BA 1YJWN 4FWNA 1YVNA 3U9ZA 3PX4A 3ATVA 3DLLL 4FLWA 5ELZA 3SLCA 3L2RA 1QE1A 4QS9A 4O4GA 3CI5A 5LMUK 4M3ZA 4B08A 3NHGA 2VG6A 3DLKA 3T3FA 3HTVA 3KZBA 1JLQA 4A5BA 4H0OA 4IXCA 2FSKA 2E2OA 3FZLA 4YHHK 3HZ6A 5CZ2A 4BQLA 4IFEA 1RDWX 2P9PB 3ZX0A 5I9EB 3L4QA 2HBLA 4FJHA 3W0LA 3THYA 5KRTA 3KKRA 4HVJA 4FOIA 2FF3B 1HRHA 4DR2K 4KHWA 3CYMA 4JD2A 1N8RO 1BIZA 4BGBA 3OJSA 4DV0K 4ZTFA 2D0OA 4DUYK 3ZSXA 2W41A 4CGHA 5LY3A 1C0MA 3OY9A 3THXA 4B9TA 4H0PA 3LL3A 2X78A 4EHTA 4E7JA 2I5JA 4IDKA 3NVMA 3VOVA 5GINA 3AVGA 2HMPA 4AHCA 4DU1A 2HHXA 2KTQA 1UAXA 2HVIA 3OYMA 1NJIO 4Z0UA 1QTMA 4N56A 1FKOA 2AA4A 4RW9A 2QXFA 2VG5A 3K9JA 2FF6A 2NUBA 4JI1K 3WQTA 4B3SK 2ETJA 1Q9XA 3QMLA 3THWA 3SBGA 4KPYA 1WSJA 4JKDA 2HBJA 4C8KA 3M8PA 4DSFA 4LH4A 3CCQN 4CJRA 4PQUA 4DV4K 4PL8A 5C42A 3CC7N 5FLXO 4KBOA 2KZMA 1JJ2M 3VQEA 1CXQA 3FZKA 1EO1A 4CJKA 4JLHA 4NCGA 2O8DB 2ASOA 1TAQA 4EHUA 5LJVA 1JLAA 4DKWA 5AQIA 3A5NC 3UIQA 4F2RA 4YOUA 4K8ZA 1C1CA 4C1NI 5C15A 3NH2A 3VF6A 3P38A 1WLJA 5AQZA 1WB9A 2HVHA 4JS5A 3K59A 4CFDA 2FSJA 4WQ5A 4W5TA 1IBKK 4WFBL 5TKWA 3PLAA 1NGCA 2WOMA 2VG7A 1WAFA 4QAGA 3ENOA 4AM7A 2G8KA 3QICA 5DM6L 4KTZA 4H0TB 3AVJA 2HB5A 1RBSA 5KI6A 2PYJA 3ZSQA 3CCRN 4X64K 1JLGA 3B8AX 4DS5A 4CJEA 1GOCA 1L5UA 4CJTA 4RW7A 1QSLA 3SUPA 4JS4A 2O8FB 3PSFA 4DLGA 4J2DA 4L8RB 4LF6K 5BPMA 1YIJN 3CG7A 2XY6A 3OBYA 2X74A 1KRPA 2HF4A 3DRRA 4CJQA 3QEPA 1MWKA 1FXXA 3EKSA 3H1VX 4RTFD 3MXIA 1K73O 5M1PA 1VQ5N 4FVUA 3ZEUA 2P9UB 3HVTA 4H5NA 1YUWA 4DV2K 2P9IA 5DK5A 1D5AA 1X3NA 4IOXA 1MDUB 1X3MA 4CGGA 2F4VK 1NJWA 4O8KA 5LMNK 3LDSA 3JXUA 3PV8A 3C94A 2QKKA 4JK7A 4CBUA 1TK5A 2OA8A 3LP1A 3AGRA 5BPLA 3ZT4A 1SV5A 5F0XA 3JYTA 5AZJA 3DXMB 3IFRA 5MLCQ 1H1VA 1TL1A 3OVNA 4KTQA 3SI6A 1N6QA 4BR0A 1BHLA 3WEEB 3M8SA 1NGEA 2RE2A 4DF8A 1U2VB 3ULDA 3SJJA 3HPOA 3TWHA 2O8BB 1NK4A 3AA5X 4KAZA 4X65K 3C6HA 5F1XA 4NLCA 4AH9A 4PHTX 4M3RA 2F9WA 1EWQA 4ID1A 2O4GA 4MQ3A 1RCHA 3B6PA 1TGOA 4C8MA 3NF9A 4JI8K 2YHXA 4OO1J 4XH4A 1RBTA 3LP3A 2FC0A 3VEOA 2PZSA 2YKMA 5SWMA 1IKXA 4BR5A 1VK0A 2BTFA 3LM9A 1JCGA 2VGNA 3T69A 5AR0A 4DFMA 2ATQA 3O80A 1NK8A 3BF3A 4EZ6A 2R7YA 1ZBUA 1HNXK 5KRSA 2HNYA 1VSDA 4OGEA 4CJ4A 4Y1CA 1RT6A 1TUYA 3M1FA 4B1WB 4ILGB 4FWOA 4AF1A 5HL7L 1JKHA 1XQSC 1XI1A 2D0BA 1QHTA 3A8YA 3Q7CA 1C0FA 5EVZA 2ZGYA 4DU4A 1WN7A 4PL7A 4O5FA 2PY5A 3DLRA 3IAYA 4RG8A 1VQ6N 2LSNA 1RTJA 4HUEA 4A61A 4IEIA 4CJFA 4V19S 2VWBA 4DQPA 4FO0A 3IDHA 1KAZA 1KTQA 4DQ8A 4IO8A 3HM8A 3DAWA 1BUPA 5AQKA 4ID5A 4K43A 1B92A 2IVPA 1F21A 3DLGA 1EKEA 1VQ4N 3ZETB 1NGAA 4J2AA 4BGAA 4H0VB 5JS2A 1SKRA 2NRHA 3THWB 2ZJQL 4QOZB 3L8BA 3C7NA 5AQUA 5C2DA 3G6EN 3KKSA 4DV6K 3VEYA 3MAQA 1RDCA 1S1WA 3OTOK 2HHTA 3TSUA 4FM0A 4FLYA 1NK6A 2UXBK 1ITGA 4DV5K 4IJNA 1JL1A 3ATUA 4NCBA 5J2MA 1MA9B 2P5OA 4DTPA 5KPRA 2QK9A 5HRSA 3U3GA 3C0BA 1Q86O 1IG9A 1NLVA 1NK0A 3A5MC 2P9PA 3MCPA 1IKYA 4LY7A 3GL1A 1RBRA 3JSMA 3VQCA 1HR0K 2Y1IA 1RT1A 1V4SA 2OPSA 1VQ7N 4AHVA 4FJ9A 3EN9A 2EX3A 1VQNN 1BGXT 3HPGA 3MN7A 3BY5A 2WTUA 2XRIA 4CK3A 1FW6A 3BUZB 4YOTA 1WAJA 3WQUA 2QKBA 4JKAA 3KWIA 1JLFA 4XH1A 1KSPA 1VQ9N 3K5OA 3ASMA 4IJAA 1NGHA 2B6AA 3ZT0A 2GX9A 3R9PA 5H1SQ 3CM6A 3MEGA 4DV7K 3VEWA 4LSNA 1N5YA 3O9TA 4FJMA 4OVLA 3VQ6A 1EX4A 4X62K 4BRGA 3EYZA 3BDPA 2HHQA 1IKVA 4M3YA 2HHWA 5BRDA 2KKZA 4KHUA 3L4IA 4CFAA 3DWLA 4GVEA 2E2PA 4E7LA 2D0AA 2IC3A 3WUHA
chains in the Genus database with same CATH topology
3LDQA 1K8KB 5M1OA 3RVCA 3C7NB 3TTDA 5HOOA 1NGDA 3G71N 1KAXA 1QHAA 4ILHA 4WFAL 2QI2A 2QWNA 3U4LA 1YJWN 4FWNA 3ZYYX 1YVNA 3VMFB 3U9ZA 4IO9L 1VQKN 4L3QA 3H46O 3ATVA 3DLLL 3QDKA 4JKGA 5ELZA 1S22A 3SLCA 1EQYA 3D2EA 1GLEG 4QS9A 3CI5A 1Z05A 2Q36A 3ULEA 3ZX2A 4FL9A 2YHYA 4NB4A 2E2QA 4FWSA 2NRZA 4MO5A 4CZJA 1Q82O 1ZC6A 2ZJRL 3D7EO 1Q81O 3G25A 4FWPA 3QFPA 3CETA 3HTVA 3KZBA 5JVGL 2H3GX 4A5BA 5TKYA 4H0OA 4IXCA 3P39A 1P8ZA 2FSKA 3O1BA 4A2AA 2E2OA 1ZBSA 1GLLO 3FZLA 4B1ZA 4BRLA 4YOVA 1E4FT 2NZTA 3HZ6A 5GAGP 3CIPA 1WOQA 2P9LB 3VPZA 2A40A 4A5AA 4BQLA 2E2NA 1RDWX 2P9PB 4IFEA 3ZX0A 5I9EB 1KXPA 1GLJO 3L4QA 2HBLA 2GTDA 2P9KB 2WFBA 3CJ9A 2V7ZA 3LDOA 4O8UA 4OPHA 3W0LA 4WCEL 4H5TA 4FPBA 3CCEN 1X9JA 4B1UB 3H45C 4FOIA 2FF3B 3LDLA 2QEXN 3SK3A 4AM6A 4B1VA 5C10A 4JD2A 1N8RO 4BGBA 1T3VA 1J6ZA 2D0OA 5GIPA 2E1ZA 2W41A 1HUXA 3OA9A 3TTCA 5LY3A 3CD6N 4WQ4C 2BH1A 3SJHA 1DGKN 4H0PA 3LL3A 2KHOA 3HSCA 2QWLA 3KWGA 4RCHA 5JLHA 4EHTA 3MWTA 4QS7A 3KHYA 1HLUA 4YDUC 2FSNA 4FWQA 3CCVN 3NVMA 3CCSN 3VOVA 5GINA 3H1QA 3A0IX 1T6CA 2HMPA 1NBWA 4LC9B 3CQXA 2QWRA 2HSTA 4GV9A 3VGLA 5AZIB 3TPQA 1JCEA 3VETA 1VAZA 2Q97A 4Y0WA 1NJIO 4GNIA 2EWSA 2CH6A 2QWMA 4MDAA 4YOYA 3H3OB 3T7ZA 2AA4A 3BEXA 4U7BA 3O9SA 4A62A 3WXLA 4BRHA 3K9JA 2FXUA 1P90A 2FF6A 3DXKB 3WQTA 3O08A 5M1NA 3VTHA 1W2BM 4BRCA 3QMLA 4PKHA 3SBGA 4JKDA 4EFHA 3HOSA 2HBJA 3HI0A 1BOTO 4NO7A 4JHDB 2D1KA 3CPWM 1RGIA 3R3LA 3IMXA 4BRFA 3CQYA 4BG9A 5JLFA 3CCQN 4PL8A 3CC7N 2QWOA 3G4SN 2QW9A 1OVYA 1D4XA 3D2FA 4BROA 2CGLA 4JKGB 4KBOA 4CD1A 4M7XA 1ESVA 3D2EB 1TUUA 3M6GA 1JJ2M 2HOEA 3UKUA 4CI6A 2DPNA 2A41A 3FZKA 1EO1A 1ZXOA 2QXLA 2IIRA 3M5RA 5BPNA 2ASOA 3O8MA 4GY2B 5CHIA 4FPAA 5BR9A 4BRMA 4WF9L 3TSQA 4EHUA 5LJVA 1HJOA 3I55N 4DKWA 3DXMA 3RSEB 1BWFO 3HRGA 5ADXH 1NGBA 1QZ5A 2HBMA 2J4RA 2QM1A 3UKRA 4B1YB 5AQIA 3A5NC 1VQPN 4YOUA 3CCUN 3GBTA 3MWPA 2OTJN 2ZGZA 3CC2N 5C12A 4EIAA 3WEEA 4C1NI 5C15A 3C65A 1JCFA 3FZFA 2OTLN 3E9OA 5GADP 2F7TA 3VGKA 3EZWA 1BDGA 3EL2A 3P38A 3VF6A 4IDHA 5AQZA 1U2VA 1K9MO 3U9DA 2YI1A 3FR0A 5AQRA 3VEVA 4MLEA 4CBXA 2FSJA 4WQ5A 3E9LA 4WFBL 3NMUA 3A5LC 5TKWA 3DJCA 3GG4A 3O4WA 4MO4A 1M1KO 3PLAA 3ID6A 3CJCA 4CZMA 1NGCA 4JD2B 3CPEA 2V52B 3CHWA 2GEMA 4BRIA 4CZKA 2D0PA 5M1QA 1Y64A 2QA4N 3ENOA 4AM7A 3QICA 3S41A 1NMDA 3QB0A 5JICA 5DM6L 2GWJA 4PKIA 4H0TB 5AQHA 5AQOA 2NRTA 3HOTA 4WQ4A 3CCRN 3CF5L 3CJBA 5KQDA 3B8AX 2WBNA 4RWTA 4A59A 1O13A 1IJJA 1QZ6A 3N4PA 2PAVA 4YDUA 3OW2M 5AQMA 3BP8A 4BR7A 4BC3A 1DEJA 4KH6A 1ATSA 5AQFA 3OBWA 3FLCO 1MWMA 3UE5A 3A5OC 5JVHL 1NGFA 3LM2A 3R6MA 5BPMA 1YIJN 3OBYA 3C6AA 2HF4A 4BREA 1SZ2A 1SAZA 1V4TA 4ISFA 4H0YB 1YITN 3VF4A 3Q7BA 1T44A 4H5WA 2WUSA 1M90O 4U67L 1MWKA 1ILYA 3P4IA 1W97L 2AP1A 4ILJA 3MX5A 5E84A 3EKSA 3H1VX 3N4QA 3P31A 4RTFD 5GAEP 4BRNA 2YCHA 3F2KA 4FWRA 1VQON 2Q31A 3AAQA 1K73O 3K9KA 2RHKA 5M1PA 1VQ5N 4FVUA 3ZEUA 2NRVA 2P9UB 3KK7A 1YI2N 5JMVA 2ASPA 4M63C 4H5NA 1BA1A 3FE1A 5BRFA 5AQLA 4CBWA 1YUWA 2E20A 2Q0RA 2P9IA 5AQYA 3WXKA 4R79A 1X3NA 4IOXA 1MDUB 1X3MA 3LDPA 3D2FB 5KQ8A 3VF2A 3NVKA 1Z6RA 4O8KA 3JXUA 3UKUB 1GLAG 4JK7A 4CZLA 2P9SA 5EY4A 4CBUA 3J8AA 3VERA 4CZEA 3AGRA 5BPLA 5F0XA 1KQSM 5AZJA 3DXMB 4ISEA 3IFRA 3WXIA 4JKFA 5MLCQ 2JWLA 1H1VA 3CJAA 4MDBA 3UKRB 3ZETA 1QQMA 5M1KA 1TYQA 4H5RA 4PKGA 2A6AA 3CMEN 1DT9A 4BR0A 5GIOA 4BRKA 2QTDA 3WEEB 3VESA 1NGEA 4MLHA 2RE2A 4UY8O 1U2VB 3HBTA 2P9NA 5CR4A 3AY9A 4I6MA 2ITMA 3C6HA 3ENHA 4JN4A 3WT0A 1QVFM 5AQTA 5F1XA 4NLCA 2Q2RA 3CMAN 3UB5A 4PHTX 2YX6A 3WXMB 4JEPA 3EKUA 3ULEB 2CGJA 2F9WA 2Q0UA 2FLOA 5FPMA 4CJ7A 2CGKA 3PIOL 4JKBA 3MCAB 3MK6A 4FWMA 5C2FA 5AQJA 2NRRA 4JK8A 4OO1J 2YHXA 5AFUA 4FSVA 4XH4A 5AQQA 3TU5A 4GV6A 5EOYA 3VEOA 1ATRA 4CZGA 2A42A 1NGGA 4BR5A 4IOAL 1GLFO 4E1JA 5E26A 2BTFA 2Q1NA 3LM9A 1JCGA 2VGNA 1OKJA 3T69A 3F9MA 4OPAA 5AR0A 4IWVA 4BC4A 5DM7L 3O80A 3CJ7A 3BF3A 4CZHA 4C1NK 1YAGA 2PFUA 2ZJPL 3ENBA 2ASMA 2YHWA 1R59O 3AAPA 4GV3A 3MN5A 2VGMA 1GLDG 3JS6A 2GELA 1HKBA 2OANA 2E1YA 4BRPA 3F5TA 1TUYA 3M1FA 4B1WB 4K42A 4B9QA 5AQSA 4ILGB 5B8HA 4FWOA 1U6ZA 4AF1A 5KPTA 1XQSC 3GE1A 3E66A 4JKHA 1GLCG 5HL7L 3MX2A 3L6QA 3KVGA 2ZWHA 4NLBA 3FFKB 4JKCA 1XC3A 5AQXA 3A8YA 3Q7CA 1QQNA 4BRAA 1Q18A 4JAXA 4BR9A 1C0FA 5EVZA 2ZGYA 3ZEUB 1C0GA 3FZHA 4PL7A 4O5FA 2GWKA 4BR2A 1BA0A 2HF3A 4BVPA 2E88A 2P9IB 1VQ6N 1S3XA 3CCMN 4A61A 4FOEA 4JNEA 1WUAA 3O1WA 4IEIA 4JK9A 4H0XB 4KH4A 2A5XA 4BG8A 3CCLN 4Z94A 1G99A 2VWBA 1S72N 4XEIA 4FWKA 3O9QA 4FO0A 5F2RA 3IDHA 1KAZA 1HKGA 2UYTA 3HM8A 2QWQA 3GOIA 3O6WA 4IO8A 3DAWA 2P9SB 4DQ8A 5FPEA 1BUPA 5AQKA 3SAHA 2W40A 4K43A 3RSEA 2A3ZA 5AZJB 2IVPA 3O9RA 4WYBA 4DHYA 3EE9A 3EO3A 2QWPA 3ZETB 1Q7YO 1VQ4N 2NRWA 4YORA 1BU6O 1SS6A 4B1XB 4BQZA 1TYQB 1NGAA 1K8AO 4ISGA 3VEXA 4BGAA 5BN9A 3VEZA 4J8FA 1YF5L 4WQ5C 4H0VB 3TTFA 4BVOA 3ZX3A 2NRHA 2ZJQL 1K8KA 2VYPA 3C7NA 5AQUA 2F9TA 5C2DA 5AQVA 2I7NA 3G6EN 1YJ9N 3SMSA 5FPNA 3J7ZO 2YJFA 3SAFA 2P9NB 3CJ1A 3VEYA 5GAHP 5AQPA 2IVNA 2PBDA 4I6MB 4IEEA 5AQGA 4CD3A 2NRXA 3TSUA 2ZF5O 1NGIA 2GUPA 3AGKA 1NM1A 4BC5A 3VTIA 4HWIA 1NGJA 4H03B 1BG3A 1YJNN 3O5BA 5C0YA 4IJNA 1YXQA 3FGUA 1XUPO 4K25A 4IOCL 2VCPA 1VQMN 3ATUA 4H5VA 2I7PA 3AARA 5BREA 1MA9B 4BR4A 3MN9A 1YHQN 3I56N 2NNWA 5KPRA 1ATNA 4HTLA 5AQWA 3SAGA 3EE8A 3LDNA 2JWKA 1DKGD 3C0BA 3MDQA 2D4WA 1QQOA 3E1YA 1Q86O 4DCHA 4BRDA 3GDQA 2P9LA 1NLVA 3A5MC 2P9PA 3MCPA 3ID8A 3GL1A 1HKCA 2V7YA 4YOWA 1VQ8N 4F9OA 1V4SA 2P9KA 1RDUA 5M1FA 1CZAN 2WC9A 3CERA 4EAHD 1VQ7N 3BF1A 3EN9A 5CE3A 1VQNN 1IG8A 1LOTB 3MN7A 3W3DA 3OHRA 4JKEA 3VGMA 4BRQA 5AQNA 1QVGM 3BUZB 1T6DA 2NLXA 1RFQA 3L0QA 4IZ9A 4YOTA 1KC8O 3H6EA 3IKMA 3WQUA 4M7YA 4FWLA 3QBWA 5BRHA 3SMPA 1BO5O 5LJWA 4G9ZA 3H3NO 3E9PA 1SQKA 4JKAA 3CXCM 1HPMA 5ADXA 1GLBG 2CH5A 2P9UA 3KWIA 3R8EA 3QBXA 2V51B 4XH1A 3PIPL 4A57A 1VQ9N 5EX5A 3SBTA 3O9UA 4WFNL 3IUCA 4IJAA 3QFUA 1NGHA 1KAYA 5AZIA 2GX9A 3R9PA 5BN8A 2IVOA 5H1SQ 4YOXA 1NWKA 3CC4N 5KPZA 2BUPA 4K41A 2E8AA 3M3ZA 3TSPA 4CZFA 4BY9C 5FPDA 1KD1O 1VQLN 3VEWA 1LCUA 3MMVA 3O9TA 4CZIA 3VENA 4QS8A 3CCJN 4BC2A 4A2BA 3I33A 3I8BA 4DB3A 4BRGA 3U8XA 3R1XA 2KLAA 3DXKA 5AFUH 4XH5A 5BRDA 4KH5A 1E4GT 2KKZA 3L4IA 3DWLA 2HBKA 4GVEA 2E2PA 2YJEA 3D6RA 3FZMA 1HX1A 3MN6A 3WXJA 4C23A 5EXWA 3WUHA 4JHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M1O A;  5M1Q A;  5M1P A;  4IDH A;  4IFE A;  5M1F A;  5C2F A;  5C12 A;  4IEI A;  5M1K A;  5M1N A;  4IEE A;  5C15 A;  5C2D A;  3CPE A;  3C6A A;  5C10 A;  3C6H A; 
#chains in the Genus database with same CATH topology
 3LDQ A;  1K8K B;  5M1O A;  3TTD A;  2IAJ A;  1NGD A;  3AA3 A;  4ILH A;  3VMF B;  3FFI A;  4JI6 K;  4DTJ A;  4C8L A;  4N41 A;  3ULE A;  3ZX2 A;  4FL9 A;  4NB4 A;  4FWS A;  2O8D A;  3D7E O;  4BWM A;  1Q81 O;  3G25 A;  1T05 A;  4B9V A;  3QFP A;  5CY4 A;  3CET A;  5JVG L;  4LFC K;  3BZK A;  5TKY A;  1EET A;  3OYF A;  3CM5 A;  3P39 A;  1P8Z A;  1RTI A;  1MU2 A;  4BRL A;  1BI4 B;  3O3F A;  1E4F T;  5GAG P;  2UUC K;  4BE2 A;  2P9L B;  4H8K A;  4A5A A;  2ZM6 K;  1IV0 A;  1S1X A;  4YNQ A;  1TKZ A;  3ZSV A;  1GLJ O;  5JMV A;  3CJ9 A;  1XNR K;  3LDO A;  4OPH A;  3CCE N;  4H5T A;  4FPB A;  1X9J A;  3RWU A;  4W5Q A;  3SK3 A;  4AM6 A;  1LW0 A;  1T3V A;  5GIP A;  3OA9 A;  4I7F A;  2BH1 A;  3SJH A;  2DY4 A;  2KHO A;  3KWG A;  5JLH A;  4RCH A;  3MWT A;  4QS7 A;  4FWQ A;  3TAN A;  3CCS N;  4LC9 B;  3CQX A;  3AA4 A;  4GV9 A;  2O8F A;  3TPQ A;  3J80 O;  1JCE A;  3VET A;  1VAZ A;  1KVA A;  2VWJ A;  2Q97 A;  4F3T A;  4Y0W A;  2F8S A;  1J5E K;  1NU0 A;  5T7B A;  2EWS A;  3PSI A;  4DSJ A;  4DMN A;  4U7B A;  2KFN A;  3NF8 A;  3WXL A;  4BRH A;  1XWL A;  5J2Q A;  5E41 A;  2YNI A;  1W2B M;  4KHY A;  1VSH A;  4DTX A;  3BGR A;  3HOS A;  4O0I A;  4JHD B;  2BDP A;  3P5J A;  1B9F A;  1RGI A;  4BWJ A;  3CQY A;  3QIO A;  4CEE A;  2QWO A;  3F9K A;  4CEQ A;  4CD1 A;  1YTU A;  4I9Q A;  2DPN A;  3M5R A;  5CHI A;  5BR9 A;  4BRM A;  2Z1H A;  4KO0 A;  2RKI A;  1JL2 A;  3I55 N;  3DXM A;  1BWF O;  2QM1 A;  1D9F A;  3P1G A;  3LP0 A;  3TAP A;  3DM2 A;  3LWM A;  4FJ7 A;  3MWP A;  3CC2 N;  4EIA A;  1VRT A;  5CYQ A;  3WEE A;  3C65 A;  2OTL N;  2F7T A;  3EZW A;  1NOY A;  3G0Z A;  4IDH A;  1U2V A;  3QO9 A;  3U9D A;  1K9M O;  2YI1 A;  1SL0 A;  4NYN A;  5AQR A;  3VEV A;  4MLE A;  4CBX A;  2HHH K;  1N34 K;  2BE2 A;  1M1K O;  2IOC A;  3CHW A;  3IRX A;  1JLC A;  2P1J A;  4BRI A;  4CZK A;  2D0P A;  1Y64 A;  2QA4 N;  4FJJ A;  4FJX A;  2GBZ A;  2GWJ A;  3SV4 A;  4HCB A;  5AQO A;  1XNQ K;  4B8C A;  3CJB A;  2WBN A;  4A59 A;  1HNZ K;  3N4P A;  3OW2 M;  1LAW A;  3QEX A;  3DLB A;  4KH6 A;  3NH0 A;  3FLC O;  1MWM A;  3A5O C;  5JVH L;  4RW6 A;  1NGF A;  4DTN A;  3R6M A;  3SZ2 A;  4CGD A;  1SZ2 A;  1UA1 A;  4DF4 A;  4PWD A;  1K6Y A;  2KFZ A;  4ISF A;  4OLB A;  3AO5 A;  4NCA A;  2WUS A;  4F8R A;  4DTO A;  1UWB A;  1W97 L;  1RTH A;  1C6V A;  4C8O A;  3MX5 A;  3SQ2 A;  2O8E B;  5HBM A;  3N4Q A;  4M3X A;  2YCH A;  3F2K A;  4FWR A;  3NDK A;  1OVQ A;  3O3G A;  4DQS A;  2OZM A;  1T03 A;  4HHT A;  5EU7 A;  1LAV A;  5BRF A;  4M3W A;  2Q0R A;  3WXK A;  1S1V A;  4LF4 K;  3LDP A;  1JXB A;  3D2F B;  4CK1 A;  4R5P A;  1Z6R A;  4I2Q A;  4AHR A;  4Z4G A;  4FJ5 A;  3AVH A;  4DV1 K;  2O8C B;  3ZSW A;  5EY4 A;  3VER A;  4DR3 K;  4FZY A;  4JI4 K;  1U4B A;  4CEB A;  2ZQB A;  4G1Q A;  3WXI A;  2JWL A;  3UKR B;  3ZET A;  2KQ2 A;  2RN2 A;  5M1K A;  2W6L A;  1RTD A;  4HCC A;  2YKN A;  4CEO A;  3VES A;  4OPK A;  5A2Q O;  4DLE A;  5C25 A;  2F8T A;  4ICL A;  4CGJ A;  3AY9 A;  2ITM A;  1QVF M;  1BL3 A;  3CMA N;  3V9U A;  1RDB A;  3EKU A;  3ULE B;  3V9S A;  5FPM A;  4CJ7 A;  1L3U A;  2CGK A;  4B9M A;  3LAN A;  4JKB A;  3CFR A;  3MK6 A;  5C2F A;  3LAM A;  5AQJ A;  4JK8 A;  5AQQ A;  4DR7 K;  4FJN A;  4Z4H A;  4MFB A;  2YNF A;  3HXM A;  1NGG A;  3SCX A;  1RT3 A;  3VQ8 A;  3TAR A;  5E26 A;  4BC4 A;  2OYQ A;  3SUN A;  3CJ7 A;  3T1A A;  1YAG A;  4C1N K;  2ZJP L;  3ENB A;  2ASM A;  2YHW A;  4GV3 A;  3MN5 A;  2YNG A;  3JS6 A;  2GEL A;  1U04 A;  1HKB A;  3HPH A;  2OAN A;  5B8H A;  5KPT A;  4JKH A;  4DFP A;  3VQA A;  1ZBL A;  3MX2 A;  3L6Q A;  3RMC A;  2ZWH A;  4DTM A;  4JKC A;  3VQ7 A;  4BRA A;  3S3M A;  4DFK A;  1HNV A;  3NBP A;  1BCO A;  4BR2 A;  2ZE2 A;  4CFB A;  1S3X A;  4JNE A;  1WUA A;  2E6L A;  3O1W A;  3CCL N;  3PO4 A;  1S72 N;  3AVN A;  4FWK A;  2DFE A;  3O6W A;  4N76 A;  2QWQ A;  1WNS A;  1JLE A;  3DYA A;  4FW2 A;  3SAH A;  3RSE A;  2RF2 A;  4DFJ A;  1S1T A;  3O9R A;  4CJV A;  3EE9 A;  4LFB K;  4BQZ A;  3NE6 A;  4ISG A;  3VEX A;  5BN9 A;  3VEZ A;  4CED A;  5IT9 O;  1JXE A;  4BVO A;  4F4K A;  4ZHR A;  1C1A A;  1K8K A;  3NCI A;  2WON A;  2YJF A;  4CE9 A;  4CHO A;  5AQP A;  2IVN A;  2HHS A;  2IGI A;  2ZF5 O;  1NGI A;  3VTI A;  1CZB A;  4HWI A;  1N32 K;  3QIN A;  5C0Y A;  1XUP O;  1U45 A;  2VCP A;  4CK2 A;  2HHU A;  2G8U A;  4BR4 A;  3MN9 A;  2HW3 A;  2NNW A;  3OYA A;  4JI7 K;  4FJI A;  4CF2 A;  3DRP A;  3V1Q A;  2FBX A;  4FLX A;  1BI4 A;  1QQO A;  4KHN A;  2P9L A;  4E1M A;  1ZYQ A;  4B9L A;  4AIL C;  3EEQ A;  1HKC A;  1VSM A;  2V7Y A;  3AVB A;  1LWF A;  3V1O A;  3CER A;  4HUF A;  1KVB A;  3SYZ A;  3OHR A;  4BRQ A;  1DLO A;  3HST B;  1S1U A;  1BQN A;  1KC8 O;  3H6E A;  4E89 A;  3M8R A;  4M7Y A;  1WSH A;  1FK9 A;  1BO5 O;  5LJW A;  4G9Z A;  1T8E A;  3H3N O;  4BE0 A;  3LPU A;  1GLB G;  5BR8 K;  1HYS A;  1IO2 A;  2G8V A;  1NMN A;  1KAY A;  3T1H K;  4KHQ A;  4DQI A;  3VA3 A;  2IVO A;  4YOX A;  1CZ9 A;  5KPZ A;  3M3Z A;  1S6P A;  3DMJ A;  4BY9 C;  1DTT A;  1UA0 A;  5FPD A;  4IG3 A;  1LCU A;  3VEN A;  4QS8 A;  4A2B A;  2P51 A;  4DB3 A;  3U8X A;  4CVN E;  3ZSY A;  2FBY A;  2KLA A;  4OKE A;  4XH5 A;  2RPI A;  1L3V A;  3JAM O;  3LZJ A;  1D8Y A;  1E4G T;  3V6D A;  4B3T K;  5LL6 Z;  2YJE A;  3D6R A;  1HX1 A;  4FLZ A;  4JHD A;  1TK0 A;  1W0H A;  1Z25 A;  4CGF A;  3RRH A;  3KD1 E;  4CF8 A;  4E19 A;  4FLT A;  1KAX A;  1QHA A;  3U4L A;  2QWN A;  3ZYY X;  4CIG A;  3THV A;  3AO2 A;  2XY8 A;  1S22 A;  1S9E A;  3OYD A;  4KB0 A;  3NFA A;  1XC9 A;  2E2Q A;  4MO5 A;  1ZBI A;  1ZC6 A;  2ZJR L;  1NKC A;  1NJZ A;  4E0D A;  3K0S A;  5HLF A;  3HT3 A;  3I0R A;  3O1B A;  3ZT2 A;  4B1Z A;  1GLL O;  4YOV A;  2G8I A;  2DFH A;  1A5V A;  3OJU A;  4CEF A;  1ZBH A;  3VPZ A;  2E2N A;  1W9H A;  3LZI A;  3O4Q A;  4IBN A;  2B4J A;  4O8U A;  4WCE L;  2V7Z A;  4B1U B;  3H45 C;  3DLH A;  2QEX N;  4B1V A;  4FZX C;  1J6Z A;  3TAQ A;  1HUX A;  3TTC A;  3KK3 A;  1ASU A;  4FM2 A;  3L2V A;  4M3T A;  3OS2 A;  2QWL A;  3AV9 A;  4LSL A;  3WNF A;  2Z1J A;  3O3H A;  2Y1J A;  1NNE A;  2XY7 A;  3AVM A;  3CCV N;  4Z4F A;  4KV8 A;  5K14 A;  3AO1 A;  3P83 D;  3A0I X;  1WSF A;  3RR8 A;  1NOZ A;  4Q0B A;  3VGL A;  5AZI B;  1RDA A;  4E7I A;  2E4L A;  2CH6 A;  2QWM A;  4MDA A;  2XHB A;  3WNE A;  3T7Z A;  3BEX A;  4A62 A;  4F2S A;  4CIE A;  4CEA A;  3VQD A;  2FXU A;  1P90 A;  3DXK B;  2OCE A;  3VTH A;  2O8E A;  4BRC A;  4KRF A;  3OYB A;  4CCH A;  3D45 A;  4PKH A;  1HNW K;  4KTW A;  3OYE A;  1BOT O;  4DSL A;  2IDO A;  2HHV A;  1A5X A;  4N47 A;  3HL8 A;  4KHS A;  4KKO A;  2QW9 A;  3D2F A;  4BRO A;  2CGL A;  4JKG B;  4M7X A;  1ESV A;  3D2E B;  1TUU A;  4CI6 A;  4GVM A;  2O8C A;  5BPN A;  4CEZ A;  3O8M A;  4GY2 B;  4WF9 L;  1NG9 A;  3NGY A;  1HJO A;  5FRM A;  5FDL A;  3RSE B;  3HRG A;  1B9D A;  5ADX H;  4Z4C A;  3UKR A;  4B1Y B;  3CCU N;  4LF5 K;  3HM9 A;  4M42 A;  4O44 A;  3FZF A;  1JCF A;  3V1R A;  1YVU A;  1BDG A;  2KZZ A;  4UQG A;  4FLV A;  3FR0 A;  4GW6 A;  3DOK A;  3NMU A;  3DJC A;  3O4W A;  3ID6 A;  3NF7 A;  3CPE A;  2V52 B;  2GEM A;  1I39 A;  2BAN A;  3S41 A;  5JIC A;  3QB0 A;  4PKI A;  5AQH A;  4OLA A;  3AVI A;  3HOT A;  4DWI A;  5KQD A;  3HJF A;  4RWT A;  4FM1 A;  1O13 A;  1L3S A;  5AQM A;  4DTR A;  4BC3 A;  3KLH A;  1DEJ A;  1ATS A;  5AQF A;  4M45 A;  3VN5 A;  3OBW A;  1VSE A;  2XO7 A;  3OYC A;  1SAZ A;  3KLG A;  4WE1 A;  1TL3 A;  3M8Q A;  4H0Y B;  3QES A;  1YIT N;  4OJR A;  1UOC A;  4H4M A;  4K8X A;  1M90 O;  4DG1 A;  4U67 L;  1J5O A;  3P4I A;  3WNG A;  3MXJ A;  4FJL A;  4ILJ A;  5E84 A;  2G8F A;  3P31 A;  4J2B A;  3DI6 A;  4CES A;  1C1B A;  1VQO N;  2Q31 A;  3K9K A;  4BDZ A;  4LF8 K;  1CLQ A;  2KW4 A;  4M63 C;  2P5G A;  3FE1 A;  5AQL A;  4CBW A;  2E20 A;  5AQY A;  1XMO K;  4R79 A;  4FCY A;  5KQ8 A;  5JS1 A;  3VF2 A;  3C95 A;  3UKU B;  4JYA K;  4KI4 A;  3AA2 A;  3KIO A;  4CZL A;  3J8A A;  1TV6 A;  3MXM A;  1KQS M;  1U47 A;  3KTQ A;  4MDB A;  3ISN C;  2JGU A;  4H5R A;  2A6A A;  1SL2 A;  1DT9 A;  5GIO A;  2QTD A;  1QS4 A;  4UY8 O;  4DV3 K;  3I8D A;  3PY8 A;  3RMB A;  4FYD A;  3NF6 A;  4JN4 A;  1LWE A;  1GOA A;  3UB5 A;  1TAU A;  3WXM B;  1HYZ A;  2Q0U A;  4CGI A;  2FLO A;  1VSK A;  1XHX A;  3MCA B;  4JRQ A;  2NRR A;  3L2U A;  1TK8 A;  2VQF K;  4HTU A;  4GV6 A;  2OPP A;  3QNO A;  3OYN A;  4IOA L;  1GLF O;  4IKF A;  2Q1N A;  4GMJ B;  3TAB A;  4N5S A;  4IWV A;  4CZH A;  2PFU A;  1EP4 A;  2E6M A;  1R59 O;  2VGM A;  1GLD G;  1HMV A;  3EZ5 A;  2E1Y A;  1ASV A;  3F5T A;  4K42 A;  3CFO A;  5AQS A;  1NJX A;  2DFF A;  4FJ8 A;  3E66 A;  1RIL A;  3KVG A;  3FFK B;  3OYG A;  5AQX A;  3SPY A;  4JAX A;  4BR9 A;  3PX6 A;  4DR6 K;  3K5L A;  1NK7 A;  1C0G A;  3FZH A;  4AHT A;  4CEC A;  4Z4I A;  2GWK A;  4JV5 K;  4BVP A;  1X9M A;  3CCM N;  4FOE A;  4B9U A;  1LWC A;  2VWK A;  4H0X B;  2A5X A;  4BG8 A;  4E7K A;  3PX0 A;  4XEI A;  4DU3 A;  3SQ1 A;  3O9Q A;  4KHP K;  1HKG A;  4AHU A;  3GOI A;  2OPR A;  4CHP A;  2P9S B;  3SUO A;  4FK0 A;  3ALY A;  5HP1 A;  3TI0 A;  4DHY A;  1Q7Y O;  2QWP A;  3TAG A;  4EP5 A;  1TYQ B;  3SUQ A;  1OH7 A;  3HVR A;  4JRP A;  3A2F A;  4J8F A;  4WQ5 C;  3TTF A;  3ZX3 A;  1X1P A;  1R0A A;  2F9T A;  1YJ9 N;  2I7N A;  1A5W A;  3SMS A;  3J7Z O;  2P9N B;  5GAH P;  4I6M B;  4CD3 A;  2NRX A;  1RT2 A;  2GUP A;  1NM1 A;  1KVC A;  4EP4 A;  4FK2 A;  4BDY A;  1VRU A;  4H03 B;  1BG3 A;  1TKT A;  1YXQ A;  3FGU A;  4K25 A;  4B3O A;  4DTU A;  1VQM N;  4H5V A;  2I7P A;  5KGX A;  3L3U A;  3V4I A;  2EHG A;  4KI6 A;  1C0U A;  4CF0 A;  4E7H A;  1ATN A;  4NYF A;  5AQW A;  3SAG A;  3KK2 A;  3MDQ A;  3QET A;  3E1Y A;  4BRD A;  3IS9 A;  4JI2 K;  4YOW A;  4GKK K;  1RDU A;  3CFP A;  3RMD A;  1CZA N;  1HQE A;  4EAH D;  3VQ4 A;  1LOT B;  3HK2 A;  1NJY A;  3W3D A;  3AO4 A;  1QVG M;  1T6D A;  2GUI A;  5C24 A;  1RFQ A;  5HRN A;  1WBB A;  4OKK A;  1N33 K;  1RBV A;  2YV0 X;  3QBW A;  4PY5 A;  3C6T A;  1C0T A;  5BRH A;  3QEV A;  2YNH A;  1YTA A;  3E9P A;  1SQK A;  1HPM A;  5ADX A;  3C6U A;  1WSE A;  3QBX A;  4B9S A;  4A57 A;  3QEI A;  3SBT A;  2Z1G A;  3O9U A;  3IUC A;  2G8W A;  3QFU A;  5AZI A;  3K2P A;  3AVK A;  5BN8 A;  4DR5 K;  1ASW A;  1IBM K;  3KLI A;  3U6F A;  1KD1 O;  1SUQ A;  1VQL N;  3MMV A;  3SNN A;  3AO3 A;  3ZSZ A;  3QEW A;  4BC2 A;  3I8B A;  3ZT3 A;  3R1X A;  1Y97 A;  3DXK A;  4XIU A;  4JI0 K;  5AFU H;  3LWL A;  4KH5 A;  2HBK A;  4ELU A;  3FZM A;  4C23 A;  3WXJ A;  1REV A;  3RVC A;  4CJP A;  3G71 N;  5HOO A;  1RDD A;  2UXD K;  4CJL A;  4WFA L;  2QI2 A;  1HQU A;  4IO9 L;  3U3Y A;  1VQK N;  4L3Q A;  3H46 O;  3KLE A;  3QDK A;  4JKG A;  4CJ5 A;  1SL1 A;  3VQB A;  1OH8 A;  1EQY A;  3D2E A;  4DTS A;  1GLE G;  1Z05 A;  2Q36 A;  3NH1 A;  2YHY A;  3G10 A;  5KTQ A;  4OPJ A;  1J9A A;  2XY5 A;  2NRZ A;  4CZJ A;  1Q82 O;  4GKJ K;  4FWP A;  3J81 O;  2H3G X;  4CJW A;  1HPZ A;  4A2A A;  1ZBS A;  4KB1 A;  2NZT A;  3CIP A;  3OYH A;  1TKX A;  4M41 A;  1WOQ A;  2A40 A;  4O0J A;  1KXP A;  3D0P A;  4CJU A;  1KFD A;  4K0K K;  1QSY A;  3SQ0 A;  2WFB A;  2GTD A;  1YT3 A;  2P9K B;  4M3U A;  4DSK A;  4CHN A;  3LDL A;  3BZC A;  5C10 A;  1HYV A;  4CJ3 A;  4FZZ A;  1KCF A;  1Q8I A;  2E1Z A;  3CD6 N;  4KRE A;  4WQ4 C;  1J54 A;  1DGK N;  4DS4 A;  3HSC A;  4W5N A;  4IFV A;  4YDU C;  3KHY A;  1HLU A;  3QLH A;  2FSN A;  3V9W A;  3VA0 A;  1OH5 A;  3L3V A;  3DRS A;  1SKS A;  4I9L A;  3K58 A;  4DR4 K;  3H1Q A;  1NKB A;  1T6C A;  1NBW A;  3V9X A;  2X6S A;  2QWR A;  2OPQ A;  2HST A;  3LPT A;  3MEC A;  5CYM A;  4CJS A;  4GNI A;  4YFU A;  3K5M A;  2AJQ A;  4YOY A;  3H3O B;  1OH6 A;  1CXU A;  3O9S A;  3MED A;  4PUO A;  2A1S A;  1VSI A;  1NKE A;  4LF9 K;  2IS3 A;  3O08 A;  5M1N A;  4OKJ A;  4DSI A;  4LH5 A;  3KD5 E;  2ZD1 A;  4E3S A;  3OYL A;  4EFH A;  3HI0 A;  4NO7 A;  4LFA K;  2D1K A;  3CPW M;  2Q3S A;  3R3L A;  3IMX A;  4BRF A;  5IWA K;  4B3R K;  4BG9 A;  5JLF A;  4AQY K;  4CHQ A;  4CF9 A;  4EZ9 A;  3G4S N;  1OVY A;  1D4X A;  1I94 K;  3MEE A;  3M6G A;  2HOE A;  3UKU A;  2A41 A;  3ZSO A;  1ZXO A;  2QXL A;  2IIR A;  1IKW A;  4F3O A;  3HP9 A;  4FPA A;  3TSQ A;  5HRP A;  4KFB A;  1NGB A;  1QZ5 A;  2HBM A;  2J4R A;  1VQP N;  3GBT A;  2OTJ N;  2ZGZ A;  3DLE A;  2GV9 A;  4CF1 A;  5C12 A;  3B6O A;  3E9O A;  5GAD P;  3VGK A;  3EL2 A;  3PUF A;  3AVL A;  4W5R A;  1NK5 A;  3TAE A;  3HO1 A;  3E01 A;  3THY B;  3E9L A;  3A5L C;  3GG4 A;  4MO4 A;  5FRN A;  3CJC A;  4CZM A;  4JD2 B;  1EXQ A;  1RT7 A;  4C8N A;  4BE1 A;  5M1Q A;  3THX B;  2JLE A;  3ZSR A;  5FRO A;  1NMD A;  3LAL A;  1U48 A;  2D5R A;  3RMA A;  1RT4 A;  1VSL A;  1X9W A;  3QER A;  2NRT A;  1X9S A;  2HNZ A;  5CZ1 A;  3OYK A;  4WQ4 A;  3V9Z A;  3CF5 L;  3OYI A;  5J2P A;  1IJJ A;  1QZ6 A;  1E3M A;  3CQ8 A;  2PAV A;  4YDU A;  4BR7 A;  3BP8 A;  4ELT A;  4O55 A;  4BAC A;  3T1Y K;  1WSI A;  2VQE K;  3UE5 A;  4DUZ K;  4NXN K;  3LM2 A;  3C6A A;  3EY1 A;  5J1E A;  4BRE A;  1LW2 A;  1V4T A;  4AHS A;  5D3G A;  1BIU A;  3VQ5 A;  3RTV A;  3VF4 A;  3Q7B A;  1T44 A;  4H5W A;  3LAK A;  4O5B A;  3WNH A;  2BGG A;  1Q9Y A;  1ILY A;  4B8A B;  1RBU A;  2AP1 A;  1W7A A;  5GAE P;  4BRN A;  5HRO A;  3AAQ A;  3DOL A;  2RHK A;  2NRV A;  3KK7 A;  1YI2 N;  1NK9 A;  4DQQ A;  2ASP A;  3ZT1 A;  1BA1 A;  2YHB A;  3IG1 A;  4X66 K;  3NGZ A;  1S5J A;  3AVC A;  3NVK A;  3J7Y P;  1IBL K;  4CHY A;  4Q5V A;  1GLA G;  2P9S A;  4CZE A;  3S3N A;  3AVA A;  1BIS A;  3V81 A;  1JLB A;  3O4N A;  4ISE A;  4FK4 A;  4JKF A;  3J7A P;  3CJA A;  4DSE A;  1O1W A;  1QQM A;  3T19 A;  3HP6 A;  1TYQ A;  3HYF A;  2Z1I A;  4PKG A;  3ZCM A;  3CME N;  4BRK A;  4FLU A;  1T7P A;  3F73 A;  4I2P A;  4JI3 K;  4MLH A;  4IFY A;  4BDP A;  3HBT A;  2YHA A;  2P9N A;  5CR4 A;  2W6K A;  4I6M A;  1FKP A;  3KJV A;  3ENH A;  3WT0 A;  3VQP A;  5AQT A;  3SQ4 A;  2OZS A;  2Q2R A;  2UXC K;  3RRG A;  4JI5 K;  4B9N A;  4CIF A;  4FJG A;  2YX6 A;  4JEP A;  3KLF A;  2CGJ A;  3LP2 A;  4B3M K;  3ITH A;  1L3T A;  3H08 A;  2ITG A;  3PIO L;  4OGC A;  5HRR A;  4H4O A;  5SZT A;  4FWM A;  2E5L K;  2HMI A;  2FBT A;  5AFU A;  4FSV A;  3TU5 A;  1N36 K;  3VQ9 A;  5EOY A;  3K57 A;  1ATR A;  4CZG A;  2A42 A;  4E1J A;  1OKJ A;  3KK1 A;  3F9M A;  4OPA A;  5DM7 L;  1TKD A;  4LF7 K;  1XHZ A;  1U49 A;  1EWR A;  3AAP A;  3L2Q A;  4ZTJ A;  2HND A;  1WSG A;  3L2W A;  4BRP A;  4B9Q A;  1U6Z A;  3GE1 A;  1GLC G;  4NLB A;  1XC3 A;  4Z4E A;  4OX9 K;  1QQN A;  4CFC A;  1Q18 A;  1GOB A;  3ZEU B;  4CHZ A;  1WBD A;  5J2N A;  1BA0 A;  2HF3 A;  2E88 A;  2P9I B;  4FXD A;  1VSJ A;  5I42 A;  4FW1 A;  3QIP A;  2O4I A;  2B5J A;  4E1N A;  4JK9 A;  2D0C A;  4KH4 A;  1QQC A;  1VHX A;  5DMR A;  4Z94 A;  5AJ3 K;  3NGI A;  1G99 A;  1SKW A;  5F2R A;  2UYT A;  1QSS A;  3RR7 A;  5FPE A;  4YY3 K;  4CW7 B;  2W40 A;  2A3Z A;  3SV3 A;  5AZJ B;  4W5O A;  2UU9 K;  4WYB A;  1S9G A;  3EO3 A;  2NRW A;  4YOR A;  1BU6 O;  1SS6 A;  2X6N A;  4B1X B;  3I0S A;  1FJG K;  1K8A O;  1S6Q A;  1YF5 L;  1Z26 A;  3SPZ A;  2VYP A;  4DQR A;  5AQV A;  5FPN A;  1LV5 A;  3SAF A;  2UUB K;  3CJ1 A;  1KFS A;  2FBV A;  2PBD A;  4IEE A;  5AQG A;  4ELV A;  3AGK A;  4RW8 A;  1HJR A;  4BC5 A;  1RNH A;  1NGJ A;  1YJN N;  3O5B A;  4FVM A;  4J2E A;  4IOC L;  1XMQ K;  3AAR A;  5BRE A;  1YHQ N;  3I56 N;  4HTL A;  1IH7 A;  3EE8 A;  1J53 A;  1ZBF A;  3LDN A;  2JWK A;  1DKG D;  4TSX A;  5KGW A;  1KLM A;  2D4W A;  2PYL A;  4DCH A;  3TR8 A;  3GDQ A;  3ID8 A;  4Y1D A;  3OS1 A;  2G8H A;  5I3U A;  1VQ8 N;  4F9O A;  2P9K A;  3S3O A;  5M1F A;  4LD0 A;  4RW4 A;  1I3A A;  2WC9 A;  3BF1 A;  5CE3 A;  1IG8 A;  4JKE A;  4FJK A;  3VGM A;  1D9D A;  5AQN A;  2NLX A;  3QNN A;  3TAF A;  3L0Q A;  4IZ9 A;  2W42 A;  4NXM K;  3S9H A;  3IKM A;  3AVF A;  4FWL A;  4PA1 A;  3SMP A;  1KLN A;  3K5N A;  4HUG A;  2DTU A;  3CXC M;  2CH5 A;  2P9U A;  3R8E A;  2V51 B;  3PIP L;  5EX5 A;  3PO5 A;  4WFN L;  4DR1 K;  1VSF A;  1NWK A;  4CER A;  3CC4 N;  3OS0 A;  2BUP A;  4K41 A;  2E8A A;  1G15 A;  3TSP A;  3ZLJ A;  4CZF A;  1BCM A;  2A1R A;  2F96 A;  4QCL A;  4CZI A;  2UUA K;  1BQM A;  3CCJ N;  1DTQ A;  3I33 A;  3VQQ A;  3TAM A;  1RT5 A;  3OYJ A;  1TVR A;  4IG0 A;  3NAE A;  3MN6 A;  5EXW A;  1HNI A;  3C7N B;  2O8B A;  1YJW N;  4FWN A;  1YVN A;  3U9Z A;  3PX4 A;  3ATV A;  3DLL L;  4FLW A;  5ELZ A;  3SLC A;  3L2R A;  1QE1 A;  4QS9 A;  4O4G A;  3CI5 A;  5LMU K;  4M3Z A;  4B08 A;  3NHG A;  2VG6 A;  3DLK A;  3T3F A;  3HTV A;  3KZB A;  1JLQ A;  4A5B A;  4H0O A;  4IXC A;  2FSK A;  2E2O A;  3FZL A;  4YHH K;  3HZ6 A;  5CZ2 A;  4BQL A;  4IFE A;  1RDW X;  2P9P B;  3ZX0 A;  5I9E B;  3L4Q A;  2HBL A;  4FJH A;  3W0L A;  3THY A;  5KRT A;  3KKR A;  4HVJ A;  4FOI A;  2FF3 B;  1HRH A;  4DR2 K;  4KHW A;  3CYM A;  4JD2 A;  1N8R O;  1BIZ A;  4BGB A;  3OJS A;  4DV0 K;  4ZTF A;  2D0O A;  4DUY K;  3ZSX A;  2W41 A;  4CGH A;  5LY3 A;  1C0M A;  3OY9 A;  3THX A;  4B9T A;  4H0P A;  3LL3 A;  2X78 A;  4EHT A;  4E7J A;  2I5J A;  4IDK A;  3NVM A;  3VOV A;  5GIN A;  3AVG A;  2HMP A;  4AHC A;  4DU1 A;  2HHX A;  2KTQ A;  1UAX A;  2HVI A;  3OYM A;  1NJI O;  4Z0U A;  1QTM A;  4N56 A;  1FKO A;  2AA4 A;  4RW9 A;  2QXF A;  2VG5 A;  3K9J A;  2FF6 A;  2NUB A;  4JI1 K;  3WQT A;  4B3S K;  2ETJ A;  1Q9X A;  3QML A;  3THW A;  3SBG A;  4KPY A;  1WSJ A;  4JKD A;  2HBJ A;  4C8K A;  3M8P A;  4DSF A;  4LH4 A;  3CCQ N;  4CJR A;  4PQU A;  4DV4 K;  4PL8 A;  5C42 A;  3CC7 N;  5FLX O;  4KBO A;  2KZM A;  1JJ2 M;  3VQE A;  1CXQ A;  3FZK A;  1EO1 A;  4CJK A;  4JLH A;  4NCG A;  2O8D B;  2ASO A;  1TAQ A;  4EHU A;  5LJV A;  1JLA A;  4DKW A;  5AQI A;  3A5N C;  3UIQ A;  4F2R A;  4YOU A;  4K8Z A;  1C1C A;  4C1N I;  5C15 A;  3NH2 A;  3VF6 A;  3P38 A;  1WLJ A;  5AQZ A;  1WB9 A;  2HVH A;  4JS5 A;  3K59 A;  4CFD A;  2FSJ A;  4WQ5 A;  4W5T A;  1IBK K;  4WFB L;  5TKW A;  3PLA A;  1NGC A;  2WOM A;  2VG7 A;  1WAF A;  4QAG A;  3ENO A;  4AM7 A;  2G8K A;  3QIC A;  5DM6 L;  4KTZ A;  4H0T B;  3AVJ A;  2HB5 A;  1RBS A;  5KI6 A;  2PYJ A;  3ZSQ A;  3CCR N;  4X64 K;  1JLG A;  3B8A X;  4DS5 A;  4CJE A;  1GOC A;  1L5U A;  4CJT A;  4RW7 A;  1QSL A;  3SUP A;  4JS4 A;  2O8F B;  3PSF A;  4DLG A;  4J2D A;  4L8R B;  4LF6 K;  5BPM A;  1YIJ N;  3CG7 A;  2XY6 A;  3OBY A;  2X74 A;  1KRP A;  2HF4 A;  3DRR A;  4CJQ A;  3QEP A;  1MWK A;  1FXX A;  3EKS A;  3H1V X;  4RTF D;  3MXI A;  1K73 O;  5M1P A;  1VQ5 N;  4FVU A;  3ZEU A;  2P9U B;  3HVT A;  4H5N A;  1YUW A;  4DV2 K;  2P9I A;  5DK5 A;  1D5A A;  1X3N A;  4IOX A;  1MDU B;  1X3M A;  4CGG A;  2F4V K;  1NJW A;  4O8K A;  5LMN K;  3LDS A;  3JXU A;  3PV8 A;  3C94 A;  2QKK A;  4JK7 A;  4CBU A;  1TK5 A;  2OA8 A;  3LP1 A;  3AGR A;  5BPL A;  3ZT4 A;  1SV5 A;  5F0X A;  3JYT A;  5AZJ A;  3DXM B;  3IFR A;  5MLC Q;  1H1V A;  1TL1 A;  3OVN A;  4KTQ A;  3SI6 A;  1N6Q A;  4BR0 A;  1BHL A;  3WEE B;  3M8S A;  1NGE A;  2RE2 A;  4DF8 A;  1U2V B;  3ULD A;  3SJJ A;  3HPO A;  3TWH A;  2O8B B;  1NK4 A;  3AA5 X;  4KAZ A;  4X65 K;  3C6H A;  5F1X A;  4NLC A;  4AH9 A;  4PHT X;  4M3R A;  2F9W A;  1EWQ A;  4ID1 A;  2O4G A;  4MQ3 A;  1RCH A;  3B6P A;  1TGO A;  4C8M A;  3NF9 A;  4JI8 K;  2YHX A;  4OO1 J;  4XH4 A;  1RBT A;  3LP3 A;  2FC0 A;  3VEO A;  2PZS A;  2YKM A;  5SWM A;  1IKX A;  4BR5 A;  1VK0 A;  2BTF A;  3LM9 A;  1JCG A;  2VGN A;  3T69 A;  5AR0 A;  4DFM A;  2ATQ A;  3O80 A;  1NK8 A;  3BF3 A;  4EZ6 A;  2R7Y A;  1ZBU A;  1HNX K;  5KRS A;  2HNY A;  1VSD A;  4OGE A;  4CJ4 A;  4Y1C A;  1RT6 A;  1TUY A;  3M1F A;  4B1W B;  4ILG B;  4FWO A;  4AF1 A;  5HL7 L;  1JKH A;  1XQS C;  1XI1 A;  2D0B A;  1QHT A;  3A8Y A;  3Q7C A;  1C0F A;  5EVZ A;  2ZGY A;  4DU4 A;  1WN7 A;  4PL7 A;  4O5F A;  2PY5 A;  3DLR A;  3IAY A;  4RG8 A;  1VQ6 N;  2LSN A;  1RTJ A;  4HUE A;  4A61 A;  4IEI A;  4CJF A;  4V19 S;  2VWB A;  4DQP A;  4FO0 A;  3IDH A;  1KAZ A;  1KTQ A;  4DQ8 A;  4IO8 A;  3HM8 A;  3DAW A;  1BUP A;  5AQK A;  4ID5 A;  4K43 A;  1B92 A;  2IVP A;  1F21 A;  3DLG A;  1EKE A;  1VQ4 N;  3ZET B;  1NGA A;  4J2A A;  4BGA A;  4H0V B;  5JS2 A;  1SKR A;  2NRH A;  3THW B;  2ZJQ L;  4QOZ B;  3L8B A;  3C7N A;  5AQU A;  5C2D A;  3G6E N;  3KKS A;  4DV6 K;  3VEY A;  3MAQ A;  1RDC A;  1S1W A;  3OTO K;  2HHT A;  3TSU A;  4FM0 A;  4FLY A;  1NK6 A;  2UXB K;  1ITG A;  4DV5 K;  4IJN A;  1JL1 A;  3ATU A;  4NCB A;  5J2M A;  1MA9 B;  2P5O A;  4DTP A;  5KPR A;  2QK9 A;  5HRS A;  3U3G A;  3C0B A;  1Q86 O;  1IG9 A;  1NLV A;  1NK0 A;  3A5M C;  2P9P A;  3MCP A;  1IKY A;  4LY7 A;  3GL1 A;  1RBR A;  3JSM A;  3VQC A;  1HR0 K;  2Y1I A;  1RT1 A;  1V4S A;  2OPS A;  1VQ7 N;  4AHV A;  4FJ9 A;  3EN9 A;  2EX3 A;  1VQN N;  1BGX T;  3HPG A;  3MN7 A;  3BY5 A;  2WTU A;  2XRI A;  4CK3 A;  1FW6 A;  3BUZ B;  4YOT A;  1WAJ A;  3WQU A;  2QKB A;  4JKA A;  3KWI A;  1JLF A;  4XH1 A;  1KSP A;  1VQ9 N;  3K5O A;  3ASM A;  4IJA A;  1NGH A;  2B6A A;  3ZT0 A;  2GX9 A;  3R9P A;  5H1S Q;  3CM6 A;  3MEG A;  4DV7 K;  3VEW A;  4LSN A;  1N5Y A;  3O9T A;  4FJM A;  4OVL A;  3VQ6 A;  1EX4 A;  4X62 K;  4BRG A;  3EYZ A;  3BDP A;  2HHQ A;  1IKV A;  4M3Y A;  2HHW A;  5BRD A;  2KKZ A;  4KHU A;  3L4I A;  4CFA A;  3DWL A;  4GVE A;  2E2P A;  4E7L A;  2D0A A;  2IC3 A;  3WUH A; 
#chains in the Genus database with same CATH homology
 3LDQ A;  1K8K B;  5M1O A;  3RVC A;  3C7N B;  3TTD A;  5HOO A;  1NGD A;  3G71 N;  1KAX A;  1QHA A;  4ILH A;  4WFA L;  2QI2 A;  2QWN A;  3U4L A;  1YJW N;  4FWN A;  3ZYY X;  1YVN A;  3VMF B;  3U9Z A;  4IO9 L;  1VQK N;  4L3Q A;  3H46 O;  3ATV A;  3DLL L;  3QDK A;  4JKG A;  5ELZ A;  1S22 A;  3SLC A;  1EQY A;  3D2E A;  1GLE G;  4QS9 A;  3CI5 A;  1Z05 A;  2Q36 A;  3ULE A;  3ZX2 A;  4FL9 A;  2YHY A;  4NB4 A;  2E2Q A;  4FWS A;  2NRZ A;  4MO5 A;  4CZJ A;  1Q82 O;  1ZC6 A;  2ZJR L;  3D7E O;  1Q81 O;  3G25 A;  4FWP A;  3QFP A;  3CET A;  3HTV A;  3KZB A;  5JVG L;  2H3G X;  4A5B A;  5TKY A;  4H0O A;  4IXC A;  3P39 A;  1P8Z A;  2FSK A;  3O1B A;  4A2A A;  2E2O A;  1ZBS A;  1GLL O;  3FZL A;  4B1Z A;  4BRL A;  4YOV A;  1E4F T;  2NZT A;  3HZ6 A;  5GAG P;  3CIP A;  1WOQ A;  2P9L B;  3VPZ A;  2A40 A;  4A5A A;  4BQL A;  2E2N A;  1RDW X;  2P9P B;  4IFE A;  3ZX0 A;  5I9E B;  1KXP A;  1GLJ O;  3L4Q A;  2HBL A;  2GTD A;  2P9K B;  2WFB A;  3CJ9 A;  2V7Z A;  3LDO A;  4O8U A;  4OPH A;  3W0L A;  4WCE L;  4H5T A;  4FPB A;  3CCE N;  1X9J A;  4B1U B;  3H45 C;  4FOI A;  2FF3 B;  3LDL A;  2QEX N;  3SK3 A;  4AM6 A;  4B1V A;  5C10 A;  4JD2 A;  1N8R O;  4BGB A;  1T3V A;  1J6Z A;  2D0O A;  5GIP A;  2E1Z A;  2W41 A;  1HUX A;  3OA9 A;  3TTC A;  5LY3 A;  3CD6 N;  4WQ4 C;  2BH1 A;  3SJH A;  1DGK N;  4H0P A;  3LL3 A;  2KHO A;  3HSC A;  2QWL A;  3KWG A;  4RCH A;  5JLH A;  4EHT A;  3MWT A;  4QS7 A;  3KHY A;  1HLU A;  4YDU C;  2FSN A;  4FWQ A;  3CCV N;  3NVM A;  3CCS N;  3VOV A;  5GIN A;  3H1Q A;  3A0I X;  1T6C A;  2HMP A;  1NBW A;  4LC9 B;  3CQX A;  2QWR A;  2HST A;  4GV9 A;  3VGL A;  5AZI B;  3TPQ A;  1JCE A;  3VET A;  1VAZ A;  2Q97 A;  4Y0W A;  1NJI O;  4GNI A;  2EWS A;  2CH6 A;  2QWM A;  4MDA A;  4YOY A;  3H3O B;  3T7Z A;  2AA4 A;  3BEX A;  4U7B A;  3O9S A;  4A62 A;  3WXL A;  4BRH A;  3K9J A;  2FXU A;  1P90 A;  2FF6 A;  3DXK B;  3WQT A;  3O08 A;  5M1N A;  3VTH A;  1W2B M;  4BRC A;  3QML A;  4PKH A;  3SBG A;  4JKD A;  4EFH A;  3HOS A;  2HBJ A;  3HI0 A;  1BOT O;  4NO7 A;  4JHD B;  2D1K A;  3CPW M;  1RGI A;  3R3L A;  3IMX A;  4BRF A;  3CQY A;  4BG9 A;  5JLF A;  3CCQ N;  4PL8 A;  3CC7 N;  2QWO A;  3G4S N;  2QW9 A;  1OVY A;  1D4X A;  3D2F A;  4BRO A;  2CGL A;  4JKG B;  4KBO A;  4CD1 A;  4M7X A;  1ESV A;  3D2E B;  1TUU A;  3M6G A;  1JJ2 M;  2HOE A;  3UKU A;  4CI6 A;  2DPN A;  2A41 A;  3FZK A;  1EO1 A;  1ZXO A;  2QXL A;  2IIR A;  3M5R A;  5BPN A;  2ASO A;  3O8M A;  4GY2 B;  5CHI A;  4FPA A;  5BR9 A;  4BRM A;  4WF9 L;  3TSQ A;  4EHU A;  5LJV A;  1HJO A;  3I55 N;  4DKW A;  3DXM A;  3RSE B;  1BWF O;  3HRG A;  5ADX H;  1NGB A;  1QZ5 A;  2HBM A;  2J4R A;  2QM1 A;  3UKR A;  4B1Y B;  5AQI A;  3A5N C;  1VQP N;  4YOU A;  3CCU N;  3GBT A;  3MWP A;  2OTJ N;  2ZGZ A;  3CC2 N;  5C12 A;  4EIA A;  3WEE A;  4C1N I;  5C15 A;  3C65 A;  1JCF A;  3FZF A;  2OTL N;  3E9O A;  5GAD P;  2F7T A;  3VGK A;  3EZW A;  1BDG A;  3EL2 A;  3P38 A;  3VF6 A;  4IDH A;  5AQZ A;  1U2V A;  1K9M O;  3U9D A;  2YI1 A;  3FR0 A;  5AQR A;  3VEV A;  4MLE A;  4CBX A;  2FSJ A;  4WQ5 A;  3E9L A;  4WFB L;  3NMU A;  3A5L C;  5TKW A;  3DJC A;  3GG4 A;  3O4W A;  4MO4 A;  1M1K O;  3PLA A;  3ID6 A;  3CJC A;  4CZM A;  1NGC A;  4JD2 B;  3CPE A;  2V52 B;  3CHW A;  2GEM A;  4BRI A;  4CZK A;  2D0P A;  5M1Q A;  1Y64 A;  2QA4 N;  3ENO A;  4AM7 A;  3QIC A;  3S41 A;  1NMD A;  3QB0 A;  5JIC A;  5DM6 L;  2GWJ A;  4PKI A;  4H0T B;  5AQH A;  5AQO A;  2NRT A;  3HOT A;  4WQ4 A;  3CCR N;  3CF5 L;  3CJB A;  5KQD A;  3B8A X;  2WBN A;  4RWT A;  4A59 A;  1O13 A;  1IJJ A;  1QZ6 A;  3N4P A;  2PAV A;  4YDU A;  3OW2 M;  5AQM A;  3BP8 A;  4BR7 A;  4BC3 A;  1DEJ A;  4KH6 A;  1ATS A;  5AQF A;  3OBW A;  3FLC O;  1MWM A;  3UE5 A;  3A5O C;  5JVH L;  1NGF A;  3LM2 A;  3R6M A;  5BPM A;  1YIJ N;  3OBY A;  3C6A A;  2HF4 A;  4BRE A;  1SZ2 A;  1SAZ A;  1V4T A;  4ISF A;  4H0Y B;  1YIT N;  3VF4 A;  3Q7B A;  1T44 A;  4H5W A;  2WUS A;  1M90 O;  4U67 L;  1MWK A;  1ILY A;  3P4I A;  1W97 L;  2AP1 A;  4ILJ A;  3MX5 A;  5E84 A;  3EKS A;  3H1V X;  3N4Q A;  3P31 A;  4RTF D;  5GAE P;  4BRN A;  2YCH A;  3F2K A;  4FWR A;  1VQO N;  2Q31 A;  3AAQ A;  1K73 O;  3K9K A;  2RHK A;  5M1P A;  1VQ5 N;  4FVU A;  3ZEU A;  2NRV A;  2P9U B;  3KK7 A;  1YI2 N;  5JMV A;  2ASP A;  4M63 C;  4H5N A;  1BA1 A;  3FE1 A;  5BRF A;  5AQL A;  4CBW A;  1YUW A;  2E20 A;  2Q0R A;  2P9I A;  5AQY A;  3WXK A;  4R79 A;  1X3N A;  4IOX A;  1MDU B;  1X3M A;  3LDP A;  3D2F B;  5KQ8 A;  3VF2 A;  3NVK A;  1Z6R A;  4O8K A;  3JXU A;  3UKU B;  1GLA G;  4JK7 A;  4CZL A;  2P9S A;  5EY4 A;  4CBU A;  3J8A A;  3VER A;  4CZE A;  3AGR A;  5BPL A;  5F0X A;  1KQS M;  5AZJ A;  3DXM B;  4ISE A;  3IFR A;  3WXI A;  4JKF A;  5MLC Q;  2JWL A;  1H1V A;  3CJA A;  4MDB A;  3UKR B;  3ZET A;  1QQM A;  5M1K A;  1TYQ A;  4H5R A;  4PKG A;  2A6A A;  3CME N;  1DT9 A;  4BR0 A;  5GIO A;  4BRK A;  2QTD A;  3WEE B;  3VES A;  1NGE A;  4MLH A;  2RE2 A;  4UY8 O;  1U2V B;  3HBT A;  2P9N A;  5CR4 A;  3AY9 A;  4I6M A;  2ITM A;  3C6H A;  3ENH A;  4JN4 A;  3WT0 A;  1QVF M;  5AQT A;  5F1X A;  4NLC A;  2Q2R A;  3CMA N;  3UB5 A;  4PHT X;  2YX6 A;  3WXM B;  4JEP A;  3EKU A;  3ULE B;  2CGJ A;  2F9W A;  2Q0U A;  2FLO A;  5FPM A;  4CJ7 A;  2CGK A;  3PIO L;  4JKB A;  3MCA B;  3MK6 A;  4FWM A;  5C2F A;  5AQJ A;  2NRR A;  4JK8 A;  4OO1 J;  2YHX A;  5AFU A;  4FSV A;  4XH4 A;  5AQQ A;  3TU5 A;  4GV6 A;  5EOY A;  3VEO A;  1ATR A;  4CZG A;  2A42 A;  1NGG A;  4BR5 A;  4IOA L;  1GLF O;  4E1J A;  5E26 A;  2BTF A;  2Q1N A;  3LM9 A;  1JCG A;  2VGN A;  1OKJ A;  3T69 A;  3F9M A;  4OPA A;  5AR0 A;  4IWV A;  4BC4 A;  5DM7 L;  3O80 A;  3CJ7 A;  3BF3 A;  4CZH A;  4C1N K;  1YAG A;  2PFU A;  2ZJP L;  3ENB A;  2ASM A;  2YHW A;  1R59 O;  3AAP A;  4GV3 A;  3MN5 A;  2VGM A;  1GLD G;  3JS6 A;  2GEL A;  1HKB A;  2OAN A;  2E1Y A;  4BRP A;  3F5T A;  1TUY A;  3M1F A;  4B1W B;  4K42 A;  4B9Q A;  5AQS A;  4ILG B;  5B8H A;  4FWO A;  1U6Z A;  4AF1 A;  5KPT A;  1XQS C;  3GE1 A;  3E66 A;  4JKH A;  1GLC G;  5HL7 L;  3MX2 A;  3L6Q A;  3KVG A;  2ZWH A;  4NLB A;  3FFK B;  4JKC A;  1XC3 A;  5AQX A;  3A8Y A;  3Q7C A;  1QQN A;  4BRA A;  1Q18 A;  4JAX A;  4BR9 A;  1C0F A;  5EVZ A;  2ZGY A;  3ZEU B;  1C0G A;  3FZH A;  4PL7 A;  4O5F A;  2GWK A;  4BR2 A;  1BA0 A;  2HF3 A;  4BVP A;  2E88 A;  2P9I B;  1VQ6 N;  1S3X A;  3CCM N;  4A61 A;  4FOE A;  4JNE A;  1WUA A;  3O1W A;  4IEI A;  4JK9 A;  4H0X B;  4KH4 A;  2A5X A;  4BG8 A;  3CCL N;  4Z94 A;  1G99 A;  2VWB A;  1S72 N;  4XEI A;  4FWK A;  3O9Q A;  4FO0 A;  5F2R A;  3IDH A;  1KAZ A;  1HKG A;  2UYT A;  3HM8 A;  2QWQ A;  3GOI A;  3O6W A;  4IO8 A;  3DAW A;  2P9S B;  4DQ8 A;  5FPE A;  1BUP A;  5AQK A;  3SAH A;  2W40 A;  4K43 A;  3RSE A;  2A3Z A;  5AZJ B;  2IVP A;  3O9R A;  4WYB A;  4DHY A;  3EE9 A;  3EO3 A;  2QWP A;  3ZET B;  1Q7Y O;  1VQ4 N;  2NRW A;  4YOR A;  1BU6 O;  1SS6 A;  4B1X B;  4BQZ A;  1TYQ B;  1NGA A;  1K8A O;  4ISG A;  3VEX A;  4BGA A;  5BN9 A;  3VEZ A;  4J8F A;  1YF5 L;  4WQ5 C;  4H0V B;  3TTF A;  4BVO A;  3ZX3 A;  2NRH A;  2ZJQ L;  1K8K A;  2VYP A;  3C7N A;  5AQU A;  2F9T A;  5C2D A;  5AQV A;  2I7N A;  3G6E N;  1YJ9 N;  3SMS A;  5FPN A;  3J7Z O;  2YJF A;  3SAF A;  2P9N B;  3CJ1 A;  3VEY A;  5GAH P;  5AQP A;  2IVN A;  2PBD A;  4I6M B;  4IEE A;  5AQG A;  4CD3 A;  2NRX A;  3TSU A;  2ZF5 O;  1NGI A;  2GUP A;  3AGK A;  1NM1 A;  4BC5 A;  3VTI A;  4HWI A;  1NGJ A;  4H03 B;  1BG3 A;  1YJN N;  3O5B A;  5C0Y A;  4IJN A;  1YXQ A;  3FGU A;  1XUP O;  4K25 A;  4IOC L;  2VCP A;  1VQM N;  3ATU A;  4H5V A;  2I7P A;  3AAR A;  5BRE A;  1MA9 B;  4BR4 A;  3MN9 A;  1YHQ N;  3I56 N;  2NNW A;  5KPR A;  1ATN A;  4HTL A;  5AQW A;  3SAG A;  3EE8 A;  3LDN A;  2JWK A;  1DKG D;  3C0B A;  3MDQ A;  2D4W A;  1QQO A;  3E1Y A;  1Q86 O;  4DCH A;  4BRD A;  3GDQ A;  2P9L A;  1NLV A;  3A5M C;  2P9P A;  3MCP A;  3ID8 A;  3GL1 A;  1HKC A;  2V7Y A;  4YOW A;  1VQ8 N;  4F9O A;  1V4S A;  2P9K A;  1RDU A;  5M1F A;  1CZA N;  2WC9 A;  3CER A;  4EAH D;  1VQ7 N;  3BF1 A;  3EN9 A;  5CE3 A;  1VQN N;  1IG8 A;  1LOT B;  3MN7 A;  3W3D A;  3OHR A;  4JKE A;  3VGM A;  4BRQ A;  5AQN A;  1QVG M;  3BUZ B;  1T6D A;  2NLX A;  1RFQ A;  3L0Q A;  4IZ9 A;  4YOT A;  1KC8 O;  3H6E A;  3IKM A;  3WQU A;  4M7Y A;  4FWL A;  3QBW A;  5BRH A;  3SMP A;  1BO5 O;  5LJW A;  4G9Z A;  3H3N O;  3E9P A;  1SQK A;  4JKA A;  3CXC M;  1HPM A;  5ADX A;  1GLB G;  2CH5 A;  2P9U A;  3KWI A;  3R8E A;  3QBX A;  2V51 B;  4XH1 A;  3PIP L;  4A57 A;  1VQ9 N;  5EX5 A;  3SBT A;  3O9U A;  4WFN L;  3IUC A;  4IJA A;  3QFU A;  1NGH A;  1KAY A;  5AZI A;  2GX9 A;  3R9P A;  5BN8 A;  2IVO A;  5H1S Q;  4YOX A;  1NWK A;  3CC4 N;  5KPZ A;  2BUP A;  4K41 A;  2E8A A;  3M3Z A;  3TSP A;  4CZF A;  4BY9 C;  5FPD A;  1KD1 O;  1VQL N;  3VEW A;  1LCU A;  3MMV A;  3O9T A;  4CZI A;  3VEN A;  4QS8 A;  3CCJ N;  4BC2 A;  4A2B A;  3I33 A;  3I8B A;  4DB3 A;  4BRG A;  3U8X A;  3R1X A;  2KLA A;  3DXK A;  5AFU H;  4XH5 A;  5BRD A;  4KH5 A;  1E4G T;  2KKZ A;  3L4I A;  3DWL A;  2HBK A;  4GVE A;  2E2P A;  2YJE A;  3D6R A;  3FZM A;  1HX1 A;  3MN6 A;  3WXJ A;  4C23 A;  5EXW A;  3WUH A;  4JHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...