5M1PA

Crystal structure of the large terminase nuclease from thermophilic phage g20c with bound calcium
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
187
structure length
187
Chain Sequence
b'AMNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYRTASGNQVMRAYGRGHDDIVMSLALAYSQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Terminase large subunit
publication title Viral genome packaging terminase cleaves DNA using the canonical RuvC-like two-metal catalysis mechanism.
pubmed doi rcsb
source organism Thermus phage g20c
molecule tags Hydrolase
total genus 64
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5m1pA00
3C6AA 5C2DA 5C2FA 5M1FA 5M1NA 5M1KA 4IEEA 3CPEA 3C6HA 5M1QA 5C15A 5M1PA 4IEIA 5C10A 4IFEA 5M1OA 4IDHA 5C12A
chains in the Genus database with same CATH superfamily
1RTJA 5SWMA 4FW2A 4JS4A 2GV9A 3OS0A 4JRPA 2ITGA 1BG3A 3TR8A 4ZTFA 4IO9L 1XI1A 3MWTA 3A5LC 3DRRA 3LP3A 2IIRA 2WONA 4FJLA 2O8EB 2FSKA 3M6GA 3D7EO 1XUPO 4DS4A 4HUEA 3Q7CA 1OVQA 1S9GA 1VSLA 2P9NB 1W7AA 3OYHA 2ASMA 5DM6L 3BEXA 2UXCK 4JKBA 4J2DA 1JXBA 2CGLA 4CJFA 1U4BA 4OLAA 4BDZA 1QHTA 2YHWA 5MLCQ 2OTLN 4ZHRA 4YDUA 3L8BA 3OJSA 5KPRA 1S6QA 3C94A 3D6RA 3LDLA 5J2NA 2YNIA 3ZSRA 3TARA 2BDPA 3T1AA 3MEEA 4BQZA 4LFCK 3BUZB 3SK3A 1RT5A 3NE6A 2OPQA 4W5NA 1QQNA 4DV0K 3WXMB 4CGJA 1XC9A 4LF5K 3K59A 2D5RA 1ZBFA 1NOYA 3RMAA 5J2MA 1VQMN 3OYBA 2RN2A 1F21A 3P5JA 1RT6A 3GL1A 1VQKN 4CESA 1QQOA 4R79A 5EXWA 4BY9C 2PBDA 5JVGL 4NXNK 4CFCA 3BZCA 1QZ6A 4PKGA 3C6TA 2Q2RA 3HVTA 1SKRA 1VQ8N 5TKWA 2B4JA 1HNZK 1BQMA 4M3UA 1KLNA 4BR0A 4OKEA 4KI6A 1NJXA 1YUWA 3SMSA 4PKHA 2Z1HA 4UQGA 4DSLA 3U3GA 4A2AA 4FJNA 4RW7A 2FC0A 2NRRA 5KTQA 4JK7A 1NGEA 3H45C 3QICA 4OJRA 1J6ZA 1Q18A 4BRPA 3I8DA 4KB0A 1IBKK 4E1NA 3RRHA 3QO9A 4JI8K 3TAGA 4BG9A 2ZJPL 5JICA 3S41A 1EQYA 2HNDA 3CCMN 5FRMA 4DQPA 2VWKA 5AQXA 4O4GA 3IUCA 1E4GT 4HTUA 4BRGA 1S22A 4B9UA 2YKMA 3TPQA 4E7IA 2IVOA 4Z4IA 4R5PA 4DV2K 1TV6A 3D2EA 3U9DA 3NF6A 1RILA 5KQ8A 1ZXOA 2FBTA 4RG8A 2HVHA 3UIQA 3L6QA 3VOVA 4FJXA 4YOWA 1D5AA 3ZETA 3KKRA 3THXA 2GEMA 3CMEN 3DXKA 4YOVA 1C1CA 1HPZA 1RTHA 3I0RA 4XH5A 1VSDA 2QA4N 5M1PA 2E20A 3LM9A 4DU4A 1NMNA 3K5LA 1NGDA 5JLFA 4M3WA 4E7HA 3EKUA 3MCAB 1D8YA 3C95A 3LP1A 3L2UA 2VWBA 4J8FA 2A1RA 1TKZA 4WF9L 1VRUA 3SCXA 4CEZA 3ENHA 1VAZA 3AO3A 4ID5A 5AZJB 3KWGA 4Z4HA 3O1WA 1IKWA 5AQHA 2HW3A 1OH6A 4CZLA 2O8EA 3VQ8A 3MMVA 3T19A 1IKYA 5HP1A 4WFBL 3TAFA 2DTUA 3DOKA 4FPBA 3LZJA 1IKXA 2GWJA 1V4TA 3WXJA 1X9SA 1WSIA 1O13A 1N34K 1C0UA 2A5XA 5GAHP 1KC8O 2G8UA 4YOUA 2HNZA 4DTUA 1W97L 1Z25A 3U9ZA 3ASMA 2PYLA 1P90A 2P9UA 4FWKA 2FF3B 2KQ2A 3LAKA 1RBRA 1C1AA 3O6WA 1A5VA 1TVRA 1WSGA 1YJ9N 3QIOA 2G8VA 4GKKK 4DV6K 1RBVA 2NUBA 3VEZA 3JAMO 4DSIA 2HBMA 3WEEB 1VSFA 2W6KA 4AHSA 3H3NO 4CD1A 3CPWM 4NB4A 2BGGA 4DLEA 2HOEA 4C8OA 1UA1A 3KLHA 2UXDK 2E2QA 4ELVA 4A5BA 3MN7A 4XEIA 1WN7A 5LMUK 2DFFA 5H1SQ 4E7KA 4B8AB 3M1FA 2YHYA 4HTLA 3KLGA 4YDUC 3CQ8A 4JS5A 1GOBA 1XHXA 3CC2N 4B9TA 1HX1A 3T3FA 4E1MA 3IAYA 4CF1A 1OH7A 3OJUA 3R1XA 3FFKB 4CBWA 4EZ9A 2P5OA 1NK7A 4IKFA 3LP2A 3P4IA 1DGKN 5E84A 4GVMA 4M3ZA 2KW4A 1XMQK 4FWMA 4IDKA 5AQRA 1TAQA 1FXXA 4MDAA 3QFPA 4MO4A 5BREA 4W5OA 5HOOA 1GLFO 1JLEA 3FZMA 4LF4K 2AA4A 2UUAK 4YY3K 4MLHA 3E9LA 1W2BM 1Q81O 1QTMA 3A0IX 2P9LA 3NFAA 3HYFA 4CZMA 1I3AA 4FJKA 4GVEA 5HL7L 4Y1DA 4QAGA 5HBMA 1JLCA 3LDNA 1TK0A 4DSFA 2O8FB 4K8XA 3AGKA 1KAXA 3O4NA 3SNNA 1EETA 3WXLA 2IVNA 4TSXA 3C7NA 4FO0A 4FJ7A 1W9HA 1Q82O 1ZBHA 4PL7A 2GX9A 2YKNA 2RE2A 5JMVA 3BF3A 4CBUA 4FWRA 1RTIA 2A42A 4BREA 4EIAA 3CFPA 1D9FA 1DLOA 4YHHK 1IBMK 3K0SA 2QEXN 2NRZA 3O9RA 4CF2A 1NK5A 3CIPA 3MDQA 5C25A 3HPHA 1T6DA 2P9PB 2VQFK 3RWUA 2YNGA 1VQLN 1TYQB 4DF4A 3MX2A 5AZJA 4FK0A 4KPYA 4B08A 3E9PA 1GOAA 3CJAA 3AAPA 5FROA 1BCMA 2ATQA 1T7PA 4BWMA 3ZT2A 2GBZA 1JLQA 4MFBA 4HCCA 2O8BA 3HRGA 3F9MA 3SYZA 4M42A 1JCFA 5FLXO 5ADXH 4BDYA 3ZSWA 3UKUB 3WNGA 4BE2A 1NNEA 1E3MA 4ELUA 4CZFA 2F9WA 4C8LA 5F2RA 5BPLA 4FK2A 1BA1A 5AQVA 4JLHA 1VSEA 3HSTB 4M45A 1VSIA 1RT3A 2UUCK 4BROA 2VGNA 3OBYA 1JLBA 1WNSA 2P51A 5C24A 1HKBA 1IO2A 4IO8A 4C8KA 1QSLA 5KPZA 4KB1A 1N8RO 3P31A 3AVKA 2EX3A 3T69A 1XWLA 3WEEA 3VN5A 4FLTA 4A59A 3RRGA 4DSEA 1YVNA 3D45A 3IRXA 3NCIA 4AHCA 4X64K 4JEPA 5BPNA 2E2NA 1VQNN 3A5OC 2QWMA 4O0IA 4N76A 3SQ2A 1EKEA 1NJZA 4I2PA 1NKBA 3VESA 1HNXK 2PZSA 4FJGA 4DR7K 2KLAA 1KVAA 1N6QA 2HVIA 3DRPA 1RDUA 5FDLA 2WOMA 4CJRA 3ZT4A 1BIZA 1WUAA 4BRQA 4DR1K 4PHTX 3KK2A 3HI0A 4O8UA 5LJVA 5HRPA 4ISFA 3HP9A 4I2QA 2NRTA 3L4QA 1YTAA 5FPDA 4BG8A 3CM5A 3P1GA 1L3SA 4BVOA 1XNQK 1NLVA 3QEVA 3I0SA 4FWSA 4FOEA 1G15A 3PLAA 2A40A 3CMAN 3OYGA 3TTDA 1S72N 5C12A 3LWLA 4A2BA 2UYTA 5AJ3K 1A5WA 4DQQA 4WQ4A 4HWIA 3TTFA 4HHTA 3QEXA 3FE1A 1M90O 3OA9A 4FWNA 4M7XA 1KSPA 2YJEA 4FJ8A 4B9LA 3ISNC 4JV5K 2FSJA 3AVBA 4ISGA 4PKIA 3CD6N 3AA4A 4AHTA 3UE5A 4K41A 2P9IB 4MDBA 3SZ2A 4C1NK 2O8FA 3G0ZA 4WCEL 1TKXA 4E1JA 3SMPA 3G6EN 3VEWA 2F8TA 2OTJN 2XY7A 3HZ6A 1RT7A 1EWQA 2R7YA 4H0PA 1O1WA 4CBXA 3SUNA 3PUFA 1IG8A 3D0PA 4LD0A 4DQ8A 3SPYA 2KZZA 5ADXA 3VEVA 3K5MA 4DHYA 3SUPA 4F2SA 2Q0UA 2JWLA 4KHQA 4JI3K 1NKEA 4CEAA 3WUHA 4JNEA 3GE1A 3DMJA 1ASWA 4FXDA 3N4PA 4H0VB 5KGXA 5M1FA 2G8KA 3SAGA 3M8SA 1NK0A 3WNFA 1TYQA 4FVUA 2I7PA 4RTFD 3NF9A 5T7BA 3DLKA 3BZKA 1LWFA 4FYDA 4FWLA 3PIOL 3S3NA 1NJYA 4GY2B 4I9QA 4YOYA 2YHBA 1K6YA 4H0XB 3MXIA 4FJIA 5AQMA 3RMCA 2D0BA 1B9DA 1T44A 5EX5A 3LL3A 1LW2A 3FR0A 3CCJN 4DU1A 4JKGB 1SL2A 1RTDA 1X3MA 4CJTA 1ATSA 4CK3A 4OVLA 3DAWA 4BE0A 4KHWA 3JXUA 4UY8O 4EZ6A 3ZCMA 2X6SA 3LZIA 3UKUA 3VQDA 1NG9A 5BN9A 4CECA 4QS8A 3D2FB 1X1PA 4U67L 1QHAA 3VEOA 5C2FA 4H5WA 4BR5A 3J80O 5CE3A 2AP1A 3OS2A 2HMPA 1NGHA 1U49A 3BP8A 3R3LA 3J81O 3L2VA 2B6AA 5KRSA 2YCHA 4G1QA 4KTWA 4BGBA 4PQUA 4CFBA 4DCHA 2WC9A 3HT3A 5KRTA 3NVMA 3V9SA 3DI6A 3ZT3A 3RR7A 3QMLA 4DTXA 1TK5A 4NYFA 2Q31A 3V9ZA 4PA1A 1GLLO 2D0PA 3QDKA 4IG0A 3PSIA 3SJJA 3ZX0A 4DV4K 3SUOA 2P1JA 5I9EB 3IMXA 4CEEA 1RT2A 4W5TA 3AGRA 2ETJA 4YFUA 4BRDA 3HOSA 1XMOK 1ASVA 3A5NC 3TSPA 4V19S 2CGJA 4B9SA 1RT1A 4JRQA 3AO5A 1S6PA 1MWMA 1NGGA 3O4WA 3SQ4A 1S1VA 1SZ2A 3GG4A 4FZZA 2V7ZA 5C0YA 4OX9K 1BCOA 3KD1E 3G4SN 5FPNA 1U6ZA 4BRNA 3RR8A 3THYA 1QSYA 1L3UA 3F2KA 5J2QA 4IJNA 1T05A 1X9WA 3RSEA 4RW4A 1EP4A 3IFRA 3OY9A 3KZBA 1TK8A 3VQAA 1NU0A 2ZE2A 4B8CA 1VQ5N 2OPSA 3ALYA 4FM0A 4J2AA 3V1RA 2O8CB 3PO5A 4A61A 2ZJQL 3LP0A 5E26A 2F9TA 4FOIA 5AQPA 4DTSA 4HCBA 4LF7K 4B3MK 2D0OA 4BRLA 2P9IA 4X66K 3CJBA 1KVCA 1SUQA 2QWOA 4DR2K 5HRNA 3UKRB 3FGUA 1J53A 3ATVA 5I3UA 3G25A 4E19A 3SPZA 5B8HA 1HJOA 3SQ1A 4I6MA 4W5QA 2ITMA 4EP4A 3CHWA 1KFSA 4DQSA 3S3MA 1FW6A 4H4MA 1BQNA 3VETA 1C1BA 4A5AA 2UU9K 1HYVA 1HRHA 4CHYA 2RKIA 2NRVA 3V9WA 4KI4A 4JHDB 2HHQA 4JKFA 4NXMK 1CZAN 5AZIB 2D1KA 1H1VA 2BTFA 4CJQA 3TTCA 1TKDA 1N5YA 4C1NI 3CCQN 4B1YB 4KHUA 1ATRA 4BWJA 4JKGA 2P9SA 3AVLA 4M3XA 2OYQA 4BRHA 4WE1A 3OVNA 4CK1A 2G8FA 2EHGA 3NGYA 3AVHA 1IG9A 4BRCA 1LWCA 5LMNK 4FJ9A 4ILHA 2IAJA 1BISA 3D2FA 3L0QA 3AO2A 2KKZA 3MEGA 2IOCA 4Y1CA 5KQDA 4Z4FA 1HKGA 3V9XA 4CZEA 4CF9A 4GV6A 2P9NA 5AQJA 3O8MA 4M41A 3AARA 4JI5K 3SLCA 5C10A 3HM9A 3KIOA 1WBDA 1BO5O 4IBNA 4A62A 2W41A 2Y1IA 4CZHA 4WFAL 2KZMA 2UUBK 3J7ZO 1C0GA 2FXUA 4AF1A 3I33A 4N47A 4OO1J 1HJRA 1Q8IA 1NM1A 2V52B 4FZYA 4JD2B 1QE1A 3RTVA 4B3TK 1VQON 4IOXA 1QQMA 2E6MA 1U45A 1N33K 3J8AA 4N5SA 2V7YA 2BE2A 4KTQA 3VTIA 4BR2A 3AVMA 3VGKA 3CCLN 3T1YK 1HMVA 4EHUA 1BUPA 5KI6A 3WXKA 2FLOA 1N32K 2O8DB 4BC3A 4C8MA 3U6FA 1U48A 2JWKA 4O44A 2F7TA 2F96A 3DLRA 5CZ1A 3O5BA 4CJEA 1C0FA 2YHXA 3NAEA 3AA3A 2OANA 1LW0A 4PL8A 3QNOA 3HP6A 4RW6A 5AQLA 2XRIA 4IFVA 1K8KB 3GBTA 3K58A 3OYJA 4QOZB 3ENBA 1X3NA 4FJMA 3DLGA 3T1HK 2HBJA 2ZJRL 4E7JA 3VA3A 1J5OA 1DT9A 3L2QA 2IC3A 4H5RA 3CCSN 4YOTA 4CFDA 3CPEA 4DTOA 2DFHA 4L8RB 4BR4A 4CZJA 3HSCA 3BGRA 3FLCO 5AQIA 2NRXA 4LF6K 5J2PA 4BRIA 3OW2M 3CC7N 1BHLA 4KFBA 4MO5A 1K8AO 4U7BA 5JLHA 1Q7YO 3KK1A 4KREA 1RDDA 4J2EA 2Q0RA 5EOYA 4JAXA 4FWQA 4K42A 5AQSA 4G9ZA 4DV7K 1NK6A 3ZLJA 4CJLA 3CJ9A 4NCBA 3PV8A 3HOTA 4KHNA 2BH1A 2E2OA 3AY9A 3F5TA 1YAGA 1OVYA 3VF2A 4DS5A 1L3TA 1BWFO 4IWVA 2YX6A 1RDCA 4BE1A 4DQIA 5AZIA 5LJWA 1NMDA 2QWRA 1JXEA 1WAJA 3QINA 3V6DA 4CIFA 4H8KA 3SI6A 4WQ5A 1A5XA 3OYEA 4FWPA 4FM1A 1Q86O 4BGAA 5BR9A 1KQSM 3VERA 1KCFA 3HXMA 2HNYA 4BVPA 2AJQA 1RNHA 3VQ4A 2Q1NA 3DLLL 3ZX3A 3HPOA 4DKWA 4GW6A 3V1OA 3ZEUB 3EE8A 4Z4EA 1YJNN 1U04A 2QXFA 4AHRA 3PX6A 4PUOA 1RCHA 3OYDA 2HHSA 5BRDA 1R0AA 3K5OA 3SAHA 4NLCA 3O3FA 2E8AA 5FPEA 4FLWA 2RF2A 4CEBA 4BC4A 4DFPA 4L3QA 3NDKA 1JL1A 1YT3A 4K25A 3H1QA 3ZT1A 5M1NA 2BUPA 5HLFA 5M1OA 4KO0A 2GUPA 4KTZA 1N36K 3JSMA 4FZXC 4DWIA 4FCYA 3A5MC 1IBLK 1VQ4N 1DEJA 3DLBA 4JD2A 4RW9A 2XY6A 1YTUA 1GLBG 3KLFA 1IH7A 3LAMA 1UWBA 5M1KA 3I56N 5FRNA 3OYCA 1RDWX 3DYAA 1HYSA 5CR4A 3FZHA 4GV3A 3VGMA 2HF3A 3L4IA 4JKHA 1JCEA 5C2DA 4LH5A 4B1UB 4H0YB 3P38A 3LALA 3SUQA 5HROA 3ZSOA 3U8XA 3VF6A 2O8DA 3O80A 1CLQA 3AVJA 1ZBLA 3ID6A 1UA0A 1VK0A 2V51B 3L3VA 2Z1JA 4B3RK 1S1UA 3FZKA 3KD5E 2QI2A 5DK5A 2YV0X 4KV8A 3NHGA 2I7NA 1S5JA 2OZSA 4LF8K 4DR6K 3IKMA 4H0OA 2G8HA 3CXCM 1K8KA 3EZWA 4FLUA 2YJFA 2QWNA 2QWLA 3U3YA 5F0XA 3TSUA 4CHQA 2QW9A 2YI1A 4LC9B 3LDOA 4CEFA 3H08A 3PO4A 1NGCA 3TABA 2DFEA 4C23A 5KPTA 4K43A 3CERA 3M3ZA 4IFEA 3JS6A 4CJ4A 4CJ3A 4F4KA 3VPZA 3NH0A 3E66A 4H03B 1EWRA 3CJCA 3C6UA 4N56A 1KTQA 4IOCL 1NK4A 2D4WA 4JI0K 3DLEA 1OH5A 4F3OA 2XY5A 3CFOA 2FBYA 4WYBA 1HNWK 1TUUA 1TL3A 1NGIA 4JI4K 4I7FA 4DB3A 4CHNA 2E4LA 3MXJA 1Y64A 2FSNA 3MX5A 4CJWA 3RMBA 3QNNA 4OGEA 4ILJA 5C15A 1TUYA 4DV5K 3VEXA 4CJUA 4BR9A 2BANA 4HUGA 3P39A 2PYJA 4M3YA 3TAQA 4F8RA 2F8SA 3EO3A 3I55N 4WFNL 5I42A 1YI2N 1SQKA 3B6PA 3CF5L 5IT9O 3VQ7A 3EYZA 4Z94A 1DKGD 2KHOA 2QKKA 3K5NA 4OPKA 1GLAG 3VQPA 5CY4A 4X62K 2G8WA 3MWPA 4CZIA 2P9PA 4NCAA 5KGWA 2GWKA 4EP5A 3E01A 3K9JA 5M1QA 4FWOA 2QXLA 3MN5A 4E3SA 1ESVA 4CGHA 2HMIA 5HRSA 3KWIA 2WUSA 4GKJK 3J7AP 3VQQA 1WOQA 3D2EB 4CFAA 3I8BA 3VQEA 4O0JA 1K9MO 4M3TA 3DXMB 2LSNA 3O1BA 3NMUA 1HKCA 3V4IA 3G71N 3HM8A 3CCVN 3IS9A 4FL9A 3NF8A 4LSNA 1HNVA 4XH4A 5AQYA 3ZSYA 4EHTA 3THXB 3CJ7A 2P5GA 3KTQA 4FLYA 1VSJA 4AH9A 1JCGA 1WSHA 5EU7A 5LY3A 3SV3A 1HYZA 2EWSA 4CEDA 2HHVA 4B1XB 3W0LA 4B3SK 3NH2A 3B6OA 1S3XA 2VYPA 5E41A 1ZBSA 3DWLA 4DSJA 4LSLA 4F3TA 4FLXA 2FF6A 1XNRK 5J1EA 3OYNA 4CI6A 4JI6K 3H1VX 4W5RA 2VQEK 2QKBA 1Z26A 1WSEA 5GAEP 3TU5A 1SKSA 4Z4CA 2VG6A 4ICLA 4B1ZA 2OCEA 3EE9A 3OHRA 2QWPA 3AVAA 2H3GX 1HUXA 2G8IA 2Z1IA 4Q5VA 1Y97A 3VA0A 4IDHA 1HLUA 2IGIA 3L2RA 4IEIA 4CEOA 2IDOA 4JYAK 4RWTA 4CJKA 1TKTA 5K14A 3IG1A 4DF8A 3F73A 4AM7A 4ZTJA 2P9KB 1VQ6N 2PFUA 2F4VK 3WQUA 4BRMA 3V9UA 5AQWA 3NGIA 2Z1GA 1NGJA 4IEEA 3DRSA 3MK6A 3LWMA 4BRKA 5DM7L 3A2FA 3K2PA 2P9UB 1I94K 1QQCA 3RVCA 3CCRN 4GV9A 1U2VB 4YNQA 2E88A 4AHUA 4CJ7A 4DTMA 2ZGYA 3VQ9A 3SV4A 4E0DA 1G99A 5A2QO 4JI2K 4CD3A 1NGAA 3OYFA 2A3ZA 3BF1A 3S9HA 3KKSA 4FLVA 1JJ2M 2O4IA 1EO1A 3HL8A 1P8ZA 3OYMA 4DU3A 3QETA 4FJJA 4QCLA 3EEQA 3OS1A 4EFHA 1IKVA 3NVKA 4O55A 1RGIA 1WB9A 4O5FA 4AQYK 3NH1A 1WSFA 2QTDA 1S9EA 3F9KA 4JKAA 3AVIA 1WAFA 3OTOK 1KRPA 4DUYK 2W6LA 5GIPA 1S1XA 1KAZA 4DFJA 2ZM6K 3QERA 4DV3K 3L3UA 1MU2A 2NLXA 3ZYYX 4B1WB 2QWQA 4JI7K 2FBXA 3UB5A 3TAPA 4LF9K 3HK2A 3ULEB 4OPHA 1FK9A 4FJHA 1IJJA 3WQTA 1L5UA 4OGCA 2CGKA 4DTJA 3EY1A 3L2WA 2D0AA 4NO7A 3TSQA 4WQ4C 4NYNA 3LDQA 3AVFA 3ZSVA 3CC4N 2RHKA 2NZTA 5EVZA 4PWDA 1JL2A 1DTQA 1YHQN 2P9LB 1XQSC 1C6VA 3TAMA 3DXMA 3CJ1A 1ZBUA 3FZFA 4CZGA 3VQCA 1VSMA 1J5EK 3ULDA 5AQNA 3C7NB 3KVGA 4ILGB 3MXMA 3H6EA 2HHUA 2DY4A 4FK4A 1VQPN 3U4LA 4H4OA 2GTDA 3M5RA 2XY8A 3A8YA 1ATNA 5AFUH 5D3GA 4LH4A 3WT0A 4M7YA 4CJ5A 5BN8A 4LY7A 3TWHA 1SS6A 5AQGA 3ZT0A 3NF7A 4QS7A 2GUIA 5SZTA 3LPTA 1LAWA 3T7ZA 5GIOA 2KTQA 3O9SA 1QZ5A 4YOXA 4HUFA 3ID8A 3C6HA 5ELZA 1OH8A 3WNHA 5BR8K 1EXQA 3KK3A 3ZSXA 4FJ5A 2YNHA 1WBBA 4B9MA 2VG7A 4KAZA 2JLEA 1DTTA 4OKJA 1JLAA 4Z0UA 4H5NA 4H5TA 3KJVA 1QVGM 3THWB 4LFAK 3AA2A 1LV5A 1T8EA 2QK9A 4CJSA 3NGZA 1D9DA 4A57A 3AVNA 4XIUA 2O8BB 3J7YP 3FZLA 3LPUA 5AR0A 5FPMA 4MQ3A 1UAXA 2P9KA 1YVUA 3C65A 4FVMA 1Z6RA 3AVGA 1BL3A 1IV0A 4RW8A 4GNIA 1YITN 3PSFA 2ASOA 2ASPA 5AQZA 1T6CA 1HPMA 2Q3SA 2VG5A 1HR0K 3N4QA 2D0CA 1U2VA 5AQQA 4DTRA 4IOAL 5AQOA 4ISEA 4JKDA 4JN4A 2UXBK 4FPAA 4JK8A 1WSJA 3IDHA 3PX0A 4CHOA 4FLZA 1KLMA 2E2PA 1LAVA 4RCHA 4E7LA 3MN6A 3PIPL 4J2BA 3QBXA 4AHVA 5HRRA 1S1WA 1RFQA 4LFBK 1RBUA 4DUZK 1NKCA 2ZWHA 3HO1A 3ZSQA 1LOTB 1W0HA 2OA8A 3VQ6A 3BDPA 4PY5A 1X9JA 2VCPA 3VF4A 4F9OA 3VQBA 2I5JA 3O3HA 1QS4A 2O8CA 1C0TA 4DMNA 2PY5A 1I39A 2HBKA 4BR7A 4CIEA 2XHBA 3VEYA 3HJFA 3P83D 4Q0BA 5JVHL 4BC5A 2X6NA 3VGLA 2O4GA 4OPJA 1R59O 1BDGA 3UKRA 3WXIA 1MA9B 4GMJB 1ILYA 4BRAA 4KRFA 3KK7A 2VGMA 1GLJO 4B3OA 2CH6A 1NOZA 2E5LK 5CYMA 1RBTA 2HB5A 4O8KA 4CF0A 3AO4A 4IG3A 1SL0A 4KKOA 3KLEA 3V81A 1OKJA 3ULEA 4DTPA 3FFIA 5JS1A 3CCEN 3AV9A 5AFUA 3CETA 2OZMA 3TI0A 3O4QA 5CZ2A 4CF8A 1MDUB 3OYLA 1KAYA 4JHDA 2IS3A 4Z4GA 4DSKA 4M63C 1BI4B 3CM6A 3LANA 1MWKA 3DJCA 3OBWA 2X78A 1X9MA 3O9TA 4C8NA 3M8QA 5C42A 3HVRA 3MCPA 4QS9A 1QSSA 1LCUA 3DOLA 3OYIA 1SAZA 2ZD1A 3SBTA 4B9NA 1JLFA 3DLHA 1KFDA 4E89A 1J54A 1NBWA 2FBVA 4OKKA 3O9UA 3OYAA 3RMDA 3H46O 1CZ9A 3C0BA 3ZX2A 3PY8A 3S3OA 1GLCG 4MLEA 3SBGA 1S1TA 1ITGA 1B92A 4OPAA 4BQLA 5BRFA 4CGDA 2HF4A 5DMRA 1TAUA 4KHSA 3CQYA 3SJHA 3VQ5A 2QM1A 3K57A 4JKEA 5GINA 2Y1JA 1HNIA 2HBLA 3W3DA 1ZYQA 3QB0A 3CQXA 4CGGA 1VHXA 4XH1A 1EX4A 2E1YA 3G10A 4BC2A 3THWA 1VQ7N 4CW7B 1BU6O 1SKWA 5JS2A 3AAQA 1BGXT 4DTNA 1RT4A 5TKYA 1XHZA 3R9PA 3CCUN 4KH4A 1Z05A 1ZBIA 4K8ZA 2WFBA 4EAHD 2GELA 4YORA 1KD1O 1V4SA 4IZ9A 3QLHA 4FM2A 1ZC6A 1BA0A 5BPMA 1JKHA 4BDPA 1T3VA 3EL2A 1B9FA 3WNEA 3GOIA 2Q97A 1UOCA 1JLGA 1ASUA 3E9OA 3QESA 1VSHA 3MAQA 5EY4A 1VRTA 4JI1K 3ATUA 4KHYA 4DQRA 1WLJA 3M8PA 3NBPA 4NCGA 5AQTA 5AQUA 4CGIA 4CE9A 1SV5A 2RPIA 3ITHA 2X74A 3EKSA 2YNFA 1YJWN 1KVBA 2DPNA 4DV1K 4DR3K 4ELTA 1QVFM 2HHTA 4CZKA 3GDQA 1T03A 4CHZA 3B8AX 3JYTA 3TAEA 4CJVA 2E1ZA 2J4RA 3MN9A 1KXPA 3LM2A 4CK2A 1K73O 4KH5A 4DR5K 3EZ5A 1LWEA 5IWAK 4IJAA 1Q9XA 1NGBA 2NRWA 3K9KA 3E1YA 3M8RA 4B9QA 2YHAA 1NK8A 3CI5A 2WTUA 3H3OB 4ID1A 3ENOA 1HQEA 3KHYA 4HVJA 1TL1A 1CXQA 2NNWA 4DFKA 4CJPA 4CVNE 4JK9A 3O3GA 3QFUA 4I9LA 1GLEG 4JKCA 1L3VA 2JGUA 2E6LA 1RDAA 5GAGP 4IFYA 4K0KK 5GADP 4CIGA 3ZSZA 2CH5A 3R6MA 1RDBA 2HHHK 3AVCA 2KFNA 1VSKA 1BIUA 3MECA 2PAVA 3QEPA 1U47A 4OLBA 4KHPK 3THYB 2A41A 4CCHA 5AQKA 1RBSA 3QEWA 1GOCA 2B5JA 2HHXA 3TANA 3RSEB 2XO7A 2A6AA 4BACA 3PX4A 1J9AA 3QBWA 4H5VA 1BOTO 4B1VA 3THVA 3LDSA 3AO1A 1NGFA 2OPRA 1VQ9N 4B9VA 2ZF5O 3QIPA 1BI4A 4FW1A 1C0MA 3O9QA 3EN9A 2VWJA 1YXQA 4F2RA 3Q7BA 3DM2A 2KFZA 1GLDG 2ZGZA 1TGOA 1XC3A 3AA5X 5F1XA 3C6AA 4KH6A 2OPPA 5BRHA 2W40A 3MEDA 4AM6A 1REVA 1SL1A 2HHWA 3V1QA 1CZBA 3CYMA 3HBTA 1NJWA 4FSVA 4X65K 3VTHA 2IVPA 2Q36A 4IXCA 2HSTA 3ZEUA 1CXUA 3LDPA 5CHIA 4CGFA 1FJGK 3CFRA 3R8EA 4I6MB 4DLGA 4AILC 2ZQBA 1YIJN 5LL6Z 4CHPA 4DFMA 4CERA 4N41A 3VMFB 3KLIA 4Y0WA 2A1SA 5CYQA 2NRHA 3HPGA 4M3RA 4DG1A 4KBOA 1NJIO 1HQUA 1M1KO 3ZETB 1YF5L 3DXKB 1NWKA 3BY5A 3SAFA 2W42A 3CG7A 4O5BA 4H0TB 4NLBA 4CEQA 1FKOA 2WBNA 3OYKA 3SQ0A 1FKPA 4WQ5C 3QEIA 5AQFA 1Q9YA 1D4XA 1E4FT 2P9SB 4BRFA 3HTVA 1NK9A 4DR4K 3VENA 3O08A
chains in the Genus database with same CATH topology
4BRIA 3OW2M 3CC7N 4JEPA 3CC4N 5BPNA 2E2NA 2RHKA 3A5OC 2QWMA 4MO5A 2NZTA 1K8AO 4U7BA 1VQNN 5EVZA 5JLHA 1Q7YO 1BG3A 1YHQN 2P9LB 1XQSC 3DXMA 3CJ1A 4IO9L 2Q0RA 3MWTA 5EOYA 3VESA 3A5LC 4JAXA 2KLAA 3FZFA 4FWQA 2IIRA 4K42A 5AQSA 4G9ZA 4CZGA 2FSKA 3M6GA 3D7EO 1RDUA 3CJ9A 5AQNA 1XUPO 4BRQA 1WUAA 3Q7CA 3C7NB 3KVGA 4ILGB 3CCJN 3H6EA 2P9NB 4PHTX 2ASMA 3HOTA 3HI0A 1VQPN 4O8UA 2BH1A 5DM6L 3U4LA 2GTDA 5LJVA 3BEXA 2E2OA 3M5RA 3AY9A 3F5TA 4ISFA 2NRTA 1ATNA 3A8YA 5AFUH 3L4QA 4JKBA 1YAGA 1OVYA 3WT0A 4M7YA 3VF2A 5FPDA 2CGLA 1BWFO 4IWVA 2YX6A 5BN8A 4BG8A 1SS6A 5AQGA 4QS7A 4BVOA 3T7ZA 1NLVA 5AZIA 2YHWA 5LJWA 4FWSA 5GIOA 3O9SA 1NMDA 1QZ5A 2QWRA 4FOEA 5MLCQ 4YOXA 3ID8A 2A40A 3CMAN 3PLAA 3C6HA 5ELZA 4YDUA 3TTDA 5KPRA 4WQ5A 5C12A 1S72N 4A2BA 3D6RA 2UYTA 3LDLA 4FWPA 1Q86O 4WQ4A 4HWIA 3TTFA 4BGAA 5BR9A 1KQSM 4H5NA 3FE1A 4H5TA 3VERA 1M90O 4BQZA 3OA9A 4BVPA 1QVGM 2Q1NA 3DLLL 3BUZB 3ZX3A 4FWNA 4M7XA 3SK3A 4DKWA 4A57A 2YJEA 3ZEUB 3EE8A 2FSJA 1YJNN 2OTLN 3FZLA 4ISGA 4PKIA 1QQNA 3CD6N 5AR0A 5FPMA 3WXMB 5BRDA 3UE5A 4K41A 2P9IB 2P9KA 4MDBA 3C65A 4C1NK 3SAHA 1Z6RA 4NLCA 4WCEL 4E1JA 2E8AA 3SMPA 5FPEA 4GNIA 1YITN 3G6EN 1VQMN 4BC4A 3VEWA 2ASOA 2ASPA 4L3QA 2OTJN 5AQZA 3HZ6A 4K25A 3H1QA 1T6CA 1HPMA 3GL1A 4H0PA 1VQKN 1QQOA 4R79A 4CBXA 5EXWA 1IG8A 4BY9C 5M1NA 2BUPA 3N4QA 2PBDA 5JVGL 4DQ8A 1QZ6A 5ADXA 4PKGA 3VEVA 4DHYA 2Q2RA 2Q0UA 2JWLA 2GUPA 1U2VA 5M1OA 1VQ8N 5AQQA 4IOAL 3WUHA 5AQOA 4JNEA 4ISEA 4JKDA 3GE1A 4JN4A 5TKWA 4FPAA 3A5MC 3O08A 1VQ4N 1DEJA 3N4PA 4H0VB 4JK8A 4JD2A 4BR0A 5M1FA 3SAGA 1GLBG 3IDHA 1YUWA 3SMSA 1TYQA 4PKHA 4FVUA 2E2PA 2I7PA 4RCHA 4RTFD 3MN6A 3PIPL 4A2AA 5M1KA 3I56N 3QBXA 1RDWX 1RFQA 2NRRA 4JK7A 1NGEA 3H45C 3QICA 4FWLA 3PIOL 5CR4A 1J6ZA 1Q18A 4GY2B 2ZWHA 4BRPA 3FZHA 4YOYA 4GV3A 3VGMA 4H0XB 1LOTB 2HF3A 3L4IA 5AQMA 4JKHA 1JCEA 1X9JA 2VCPA 3VF4A 5C2DA 4B1UB 4F9OA 4BG9A 2ZJPL 3P38A 3LL3A 1EQYA 1T44A 4H0YB 3FR0A 5EX5A 5AQXA 3S41A 4JKGB 3IUCA 3CCMN 1X3MA 3U8XA 3VF6A 2HBKA 4BR7A 1ATSA 3O80A 3DAWA 1E4GT 3JXUA 4UY8O 3VEYA 4BRGA 3ID6A 2V51B 1S22A 5JVHL 3TPQA 3FZKA 2IVOA 2QI2A 4BC5A 3UKUA 3VGLA 2I7NA 5BN9A 3D2EA 3U9DA 5KQ8A 1R59O 1ZXOA 1BDGA 3UKRA 3IKMA 3WXIA 4H0OA 3CXCM 1K8KA 3EZWA 1MA9B 4QS8A 3D2FB 1ILYA 2YJFA 4U67L 1QHAA 2QWNA 4BRAA 3VEOA 3L6QA 3KK7A 2VGMA 1GLJO 2QWLA 5C2FA 4H5WA 4BR5A 5CE3A 2AP1A 3VOVA 2HMPA 2CH6A 1NGHA 4YOWA 3BP8A 3R3LA 4O8KA 3ZETA 2YCHA 5F0XA 3TSUA 2GEMA 3CMEN 2QW9A 2YI1A 3DXKA 4LC9B 3LDOA 1OKJA 3ULEA 4YOVA 4BGBA 3CCEN 1NGCA 4DCHA 5AFUA 4XH5A 4B1ZA 2WC9A 4C23A 3CETA 5M1PA 5KPTA 2E20A 3NVMA 3CERA 3LM9A 3M3ZA 4K43A 2QA4N 1MDUB 4IFEA 3QMLA 3JS6A 1KAYA 1NGDA 5JLFA 4JHDA 3EKUA 2Q31A 1GLLO 2D0PA 3MCAB 3VPZA 3E66A 3QDKA 4M63C 4H03B 2VWBA 4J8FA 3CJCA 4WF9L 3ZX0A 1MWKA 3DJCA 3ENHA 3OBWA 5I9EB 3IMXA 1VAZA 3O9TA 4IOCL 3AGRA 5AZJB 3MCPA 3KWGA 4QS9A 4BRDA 2D4WA 1LCUA 3HOSA 3A5NC 3TSPA 3O1WA 1SAZA 2CGJA 3SBTA 5AQHA 4WYBA 4CZLA 1TUUA 1NGIA 4DB3A 3MMVA 1Y64A 2FSNA 1MWMA 4WFBL 1NGGA 3MX5A 3O4WA 1NBWA 4FPBA 1SZ2A 3GG4A 4ILJA 3O9UA 2V7ZA 3H46O 5C0YA 2GWJA 5C15A 1V4TA 3WXJA 3C0BA 3ZX2A 1TUYA 3G4SN 3VEXA 1GLCG 4BR9A 1O13A 4MLEA 5FPNA 3SBGA 1U6ZA 4OPAA 2A5XA 4BRNA 5GAHP 3P39A 4BQLA 1KC8O 5BRFA 4YOUA 2HF4A 3F2KA 1W97L 4IJNA 3U9ZA 3EO3A 3I55N 4WFNL 3RSEA 3CQYA 1P90A 1YI2N 1SQKA 2P9UA 4FWKA 3SJHA 3CF5L 2FF3B 2QM1A 3IFRA 4JKEA 4Z94A 5GINA 3O6WA 3KZBA 1YJ9N 1DKGD 2HBLA 3W3DA 2KHOA 3QB0A 3CQXA 4XH1A 1GLAG 3VEZA 2E1YA 4BC2A 1VQ7N 1VQ5N 3MWPA 4CZIA 2P9PA 1BU6O 2HBMA 3WEEB 2GWKA 4A61A 3K9JA 3AAQA 5M1QA 2ZJQL 4FWOA 5E26A 2F9TA 2QXLA 3H3NO 4FOIA 5AQPA 5TKYA 4CD1A 3CPWM 3MN5A 2D0OA 3R9PA 1ESVA 4BRLA 4NB4A 3CCUN 4KH4A 2P9IA 1Z05A 3KWIA 2WUSA 2HOEA 2WFBA 3CJBA 2GELA 4EAHD 4YORA 1KD1O 1WOQA 1V4SA 3D2EB 3I8BA 2QWOA 1K9MO 4IZ9A 3DXMB 3UKRB 1ZC6A 1BA0A 2E2QA 3FGUA 3ATVA 5BPMA 4A5BA 3G25A 3O1BA 3MN7A 3NMUA 1HKCA 4XEIA 1T3VA 3EL2A 3HM8A 3G71N 5B8HA 3CCVN 1HJOA 4FL9A 4I6MA 3GOIA 5H1SQ 2ITMA 2Q97A 3CHWA 4XH4A 5AQYA 3E9OA 4EHTA 3CJ7A 5JICA 3M1FA 2YHYA 4HTLA 5EY4A 1JCGA 5LY3A 3ATUA 5AQUA 4YDUC 5AQTA 3VETA 2EWSA 3CC2N 4B1XB 3EKSA 3W0LA 1YJWN 1HX1A 4A5AA 1S3XA 2DPNA 2VYPA 1QVFM 2NRVA 1ZBSA 3DWLA 4CZKA 3GDQA 4JHDB 3B8AX 2FF6A 4JKFA 1CZAN 2E1ZA 5AZIB 4CI6A 2J4RA 2D1KA 3MN9A 3H1VX 1KXPA 1H1VA 3LM2A 2BTFA 5GAEP 3TTCA 1K73O 3TU5A 3R1XA 3FFKB 4KH5A 4CBWA 4C1NI 3CCQN 4IJAA 4B1YB 1ATRA 1NGBA 2NRWA 3K9KA 3EE9A 3E1YA 2QWPA 3OHRA 1DGKN 3P4IA 5E84A 4B9QA 2H3GX 1HUXA 2P9SA 4JKGA 3CI5A 4FWMA 3H3OB 5AQRA 3ENOA 3QFPA 3KHYA 4MDAA 4MO4A 5BREA 1GLFO 4IDHA 5HOOA 2NNWA 3FZMA 1HLUA 4BRHA 2AA4A 4MLHA 3E9LA 4JK9A 1W2BM 1Q81O 3QFUA 3A0IX 4IEIA 1GLEG 4BRCA 2P9LA 4JKCA 4CZMA 4RWTA 4GVEA 5HL7L 4ILHA 5GAGP 5GADP 3D2FA 3L0QA 2CH5A 3R6MA 3LDNA 4AM7A 2KKZA 2P9KB 1VQ6N 2PFUA 3AGKA 1KAXA 3WQUA 4BRMA 5AQWA 5KQDA 1HKGA 1NGJA 4CZEA 2PAVA 3WXLA 2IVNA 4IEEA 3C7NA 2A41A 4FO0A 2P9NA 5AQJA 3O8MA 5AQKA 4GV6A 3AARA 1Q82O 3MK6A 4PL7A 3SLCA 5C10A 2GX9A 1BO5O 2RE2A 4BRKA 5JMVA 3BF3A 5DM7L 3RSEB 4A62A 2W41A 2A6AA 2P9UB 4CZHA 4WFAL 3J7ZO 1C0GA 3RVCA 4CBUA 3CCRN 2FXUA 3QBWA 4FWRA 4H5VA 1BOTO 4AF1A 4GV9A 4B1VA 3I33A 2A42A 4BREA 4EIAA 1U2VB 1NGFA 2E88A 4CJ7A 1VQ9N 4OO1J 2ZGYA 2ZF5O 2QEXN 1G99A 4CD3A 2NRZA 3O9RA 1NM1A 1NGAA 2V52B 3CIPA 3MDQA 3EN9A 3O9QA 4JD2B 2A3ZA 1T6DA 3BF1A 2P9PB 1YXQA 1VQLN 1TYQB 1JJ2M 3Q7BA 1EO1A 1VQON 3MX2A 1GLDG 5AZJA 2ZGZA 1XC3A 4IOXA 1QQMA 1P8ZA 3C6AA 3J8AA 4KH6A 5F1XA 3E9PA 2V7YA 2W40A 3CJAA 5BRHA 3AAPA 4AM6A 4EFHA 3NVKA 3VTIA 4BR2A 3VGKA 1RGIA 3HBTA 3CCLN 4FSVA 4EHUA 3VTHA 2IVPA 4O5FA 1BUPA 2Q36A 4IXCA 2HSTA 3WXKA 2FLOA 2QTDA 3ZEUA 5CHIA 3LDPA 3HRGA 3F9MA 4BC3A 2JWKA 2F7TA 3O5BA 4JKAA 3R8EA 4I6MB 1C0FA 1JCFA 5ADXH 2YHXA 1YIJN 5GIPA 3UKUB 1KAZA 2OANA 4CZFA 3VMFB 2F9WA 4Y0WA 4PL8A 5AQLA 2NLXA 2NRHA 5F2RA 1K8KB 5BPLA 3GBTA 4KBOA 1BA1A 5AQVA 3ZYYX 4B1WB 1NJIO 2QWQA 3ENBA 1X3NA 3UB5A 4BROA 2VGNA 3OBYA 2HBJA 3ZETB 1M1KO 2ZJRL 1YF5L 1DT9A 3DXKB 1HKBA 4H5RA 3CCSN 4IO8A 3ULEB 1NWKA 4YOTA 5KPZA 4OPHA 3SAFA 1N8RO 3CPEA 3P31A 1IJJA 3WQTA 4H0TB 4NLBA 3T69A 4BR4A 4CZJA 2WBNA 2CGKA 3HSCA 4WQ5C 5AQFA 3WEEA 4A59A 1D4XA 4NO7A 1E4FT 2P9SB 3TSQA 3FLCO 4WQ4C 3HTVA 1YVNA 4BRFA 3LDQA 5AQIA 3VENA 2NRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C6A A;  5C2D A;  5C2F A;  5M1F A;  5M1N A;  5M1K A;  4IEE A;  3CPE A;  3C6H A;  5M1Q A;  5C15 A;  5M1P A;  4IEI A;  5C10 A;  4IFE A;  5M1O A;  4IDH A;  5C12 A; 
#chains in the Genus database with same CATH topology
 1RTJ A;  5SWM A;  4FW2 A;  4JS4 A;  2GV9 A;  3OS0 A;  4JRP A;  2ITG A;  1BG3 A;  3TR8 A;  4ZTF A;  4IO9 L;  1XI1 A;  3MWT A;  3A5L C;  3DRR A;  3LP3 A;  2IIR A;  2WON A;  4FJL A;  2O8E B;  2FSK A;  3M6G A;  3D7E O;  1XUP O;  4DS4 A;  4HUE A;  3Q7C A;  1OVQ A;  1S9G A;  1VSL A;  2P9N B;  1W7A A;  3OYH A;  2ASM A;  5DM6 L;  3BEX A;  2UXC K;  4JKB A;  4J2D A;  1JXB A;  2CGL A;  4CJF A;  1U4B A;  4OLA A;  4BDZ A;  1QHT A;  2YHW A;  5MLC Q;  2OTL N;  4ZHR A;  4YDU A;  3L8B A;  3OJS A;  5KPR A;  1S6Q A;  3C94 A;  3D6R A;  3LDL A;  5J2N A;  2YNI A;  3ZSR A;  3TAR A;  2BDP A;  3T1A A;  3MEE A;  4BQZ A;  4LFC K;  3BUZ B;  3SK3 A;  1RT5 A;  3NE6 A;  2OPQ A;  4W5N A;  1QQN A;  4DV0 K;  3WXM B;  4CGJ A;  1XC9 A;  4LF5 K;  3K59 A;  2D5R A;  1ZBF A;  1NOY A;  3RMA A;  5J2M A;  1VQM N;  3OYB A;  2RN2 A;  1F21 A;  3P5J A;  1RT6 A;  3GL1 A;  1VQK N;  4CES A;  1QQO A;  4R79 A;  5EXW A;  4BY9 C;  2PBD A;  5JVG L;  4NXN K;  4CFC A;  3BZC A;  1QZ6 A;  4PKG A;  3C6T A;  2Q2R A;  3HVT A;  1SKR A;  1VQ8 N;  5TKW A;  2B4J A;  1HNZ K;  1BQM A;  4M3U A;  1KLN A;  4BR0 A;  4OKE A;  4KI6 A;  1NJX A;  1YUW A;  3SMS A;  4PKH A;  2Z1H A;  4UQG A;  4DSL A;  3U3G A;  4A2A A;  4FJN A;  4RW7 A;  2FC0 A;  2NRR A;  5KTQ A;  4JK7 A;  1NGE A;  3H45 C;  3QIC A;  4OJR A;  1J6Z A;  1Q18 A;  4BRP A;  3I8D A;  4KB0 A;  1IBK K;  4E1N A;  3RRH A;  3QO9 A;  4JI8 K;  3TAG A;  4BG9 A;  2ZJP L;  5JIC A;  3S41 A;  1EQY A;  2HND A;  3CCM N;  5FRM A;  4DQP A;  2VWK A;  5AQX A;  4O4G A;  3IUC A;  1E4G T;  4HTU A;  4BRG A;  1S22 A;  4B9U A;  2YKM A;  3TPQ A;  4E7I A;  2IVO A;  4Z4I A;  4R5P A;  4DV2 K;  1TV6 A;  3D2E A;  3U9D A;  3NF6 A;  1RIL A;  5KQ8 A;  1ZXO A;  2FBT A;  4RG8 A;  2HVH A;  3UIQ A;  3L6Q A;  3VOV A;  4FJX A;  4YOW A;  1D5A A;  3ZET A;  3KKR A;  3THX A;  2GEM A;  3CME N;  3DXK A;  4YOV A;  1C1C A;  1HPZ A;  1RTH A;  3I0R A;  4XH5 A;  1VSD A;  2QA4 N;  5M1P A;  2E20 A;  3LM9 A;  4DU4 A;  1NMN A;  3K5L A;  1NGD A;  5JLF A;  4M3W A;  4E7H A;  3EKU A;  3MCA B;  1D8Y A;  3C95 A;  3LP1 A;  3L2U A;  2VWB A;  4J8F A;  2A1R A;  1TKZ A;  4WF9 L;  1VRU A;  3SCX A;  4CEZ A;  3ENH A;  1VAZ A;  3AO3 A;  4ID5 A;  5AZJ B;  3KWG A;  4Z4H A;  3O1W A;  1IKW A;  5AQH A;  2HW3 A;  1OH6 A;  4CZL A;  2O8E A;  3VQ8 A;  3MMV A;  3T19 A;  1IKY A;  5HP1 A;  4WFB L;  3TAF A;  2DTU A;  3DOK A;  4FPB A;  3LZJ A;  1IKX A;  2GWJ A;  1V4T A;  3WXJ A;  1X9S A;  1WSI A;  1O13 A;  1N34 K;  1C0U A;  2A5X A;  5GAH P;  1KC8 O;  2G8U A;  4YOU A;  2HNZ A;  4DTU A;  1W97 L;  1Z25 A;  3U9Z A;  3ASM A;  2PYL A;  1P90 A;  2P9U A;  4FWK A;  2FF3 B;  2KQ2 A;  3LAK A;  1RBR A;  1C1A A;  3O6W A;  1A5V A;  1TVR A;  1WSG A;  1YJ9 N;  3QIO A;  2G8V A;  4GKK K;  4DV6 K;  1RBV A;  2NUB A;  3VEZ A;  3JAM O;  4DSI A;  2HBM A;  3WEE B;  1VSF A;  2W6K A;  4AHS A;  3H3N O;  4CD1 A;  3CPW M;  4NB4 A;  2BGG A;  4DLE A;  2HOE A;  4C8O A;  1UA1 A;  3KLH A;  2UXD K;  2E2Q A;  4ELV A;  4A5B A;  3MN7 A;  4XEI A;  1WN7 A;  5LMU K;  2DFF A;  5H1S Q;  4E7K A;  4B8A B;  3M1F A;  2YHY A;  4HTL A;  3KLG A;  4YDU C;  3CQ8 A;  4JS5 A;  1GOB A;  1XHX A;  3CC2 N;  4B9T A;  1HX1 A;  3T3F A;  4E1M A;  3IAY A;  4CF1 A;  1OH7 A;  3OJU A;  3R1X A;  3FFK B;  4CBW A;  4EZ9 A;  2P5O A;  1NK7 A;  4IKF A;  3LP2 A;  3P4I A;  1DGK N;  5E84 A;  4GVM A;  4M3Z A;  2KW4 A;  1XMQ K;  4FWM A;  4IDK A;  5AQR A;  1TAQ A;  1FXX A;  4MDA A;  3QFP A;  4MO4 A;  5BRE A;  4W5O A;  5HOO A;  1GLF O;  1JLE A;  3FZM A;  4LF4 K;  2AA4 A;  2UUA K;  4YY3 K;  4MLH A;  3E9L A;  1W2B M;  1Q81 O;  1QTM A;  3A0I X;  2P9L A;  3NFA A;  3HYF A;  4CZM A;  1I3A A;  4FJK A;  4GVE A;  5HL7 L;  4Y1D A;  4QAG A;  5HBM A;  1JLC A;  3LDN A;  1TK0 A;  4DSF A;  2O8F B;  4K8X A;  3AGK A;  1KAX A;  3O4N A;  3SNN A;  1EET A;  3WXL A;  2IVN A;  4TSX A;  3C7N A;  4FO0 A;  4FJ7 A;  1W9H A;  1Q82 O;  1ZBH A;  4PL7 A;  2GX9 A;  2YKN A;  2RE2 A;  5JMV A;  3BF3 A;  4CBU A;  4FWR A;  1RTI A;  2A42 A;  4BRE A;  4EIA A;  3CFP A;  1D9F A;  1DLO A;  4YHH K;  1IBM K;  3K0S A;  2QEX N;  2NRZ A;  3O9R A;  4CF2 A;  1NK5 A;  3CIP A;  3MDQ A;  5C25 A;  3HPH A;  1T6D A;  2P9P B;  2VQF K;  3RWU A;  2YNG A;  1VQL N;  1TYQ B;  4DF4 A;  3MX2 A;  5AZJ A;  4FK0 A;  4KPY A;  4B08 A;  3E9P A;  1GOA A;  3CJA A;  3AAP A;  5FRO A;  1BCM A;  2ATQ A;  1T7P A;  4BWM A;  3ZT2 A;  2GBZ A;  1JLQ A;  4MFB A;  4HCC A;  2O8B A;  3HRG A;  3F9M A;  3SYZ A;  4M42 A;  1JCF A;  5FLX O;  5ADX H;  4BDY A;  3ZSW A;  3UKU B;  3WNG A;  4BE2 A;  1NNE A;  1E3M A;  4ELU A;  4CZF A;  2F9W A;  4C8L A;  5F2R A;  5BPL A;  4FK2 A;  1BA1 A;  5AQV A;  4JLH A;  1VSE A;  3HST B;  4M45 A;  1VSI A;  1RT3 A;  2UUC K;  4BRO A;  2VGN A;  3OBY A;  1JLB A;  1WNS A;  2P51 A;  5C24 A;  1HKB A;  1IO2 A;  4IO8 A;  4C8K A;  1QSL A;  5KPZ A;  4KB1 A;  1N8R O;  3P31 A;  3AVK A;  2EX3 A;  3T69 A;  1XWL A;  3WEE A;  3VN5 A;  4FLT A;  4A59 A;  3RRG A;  4DSE A;  1YVN A;  3D45 A;  3IRX A;  3NCI A;  4AHC A;  4X64 K;  4JEP A;  5BPN A;  2E2N A;  1VQN N;  3A5O C;  2QWM A;  4O0I A;  4N76 A;  3SQ2 A;  1EKE A;  1NJZ A;  4I2P A;  1NKB A;  3VES A;  1HNX K;  2PZS A;  4FJG A;  4DR7 K;  2KLA A;  1KVA A;  1N6Q A;  2HVI A;  3DRP A;  1RDU A;  5FDL A;  2WOM A;  4CJR A;  3ZT4 A;  1BIZ A;  1WUA A;  4BRQ A;  4DR1 K;  4PHT X;  3KK2 A;  3HI0 A;  4O8U A;  5LJV A;  5HRP A;  4ISF A;  3HP9 A;  4I2Q A;  2NRT A;  3L4Q A;  1YTA A;  5FPD A;  4BG8 A;  3CM5 A;  3P1G A;  1L3S A;  4BVO A;  1XNQ K;  1NLV A;  3QEV A;  3I0S A;  4FWS A;  4FOE A;  1G15 A;  3PLA A;  2A40 A;  3CMA N;  3OYG A;  3TTD A;  1S72 N;  5C12 A;  3LWL A;  4A2B A;  2UYT A;  5AJ3 K;  1A5W A;  4DQQ A;  4WQ4 A;  4HWI A;  3TTF A;  4HHT A;  3QEX A;  3FE1 A;  1M90 O;  3OA9 A;  4FWN A;  4M7X A;  1KSP A;  2YJE A;  4FJ8 A;  4B9L A;  3ISN C;  4JV5 K;  2FSJ A;  3AVB A;  4ISG A;  4PKI A;  3CD6 N;  3AA4 A;  4AHT A;  3UE5 A;  4K41 A;  2P9I B;  4MDB A;  3SZ2 A;  4C1N K;  2O8F A;  3G0Z A;  4WCE L;  1TKX A;  4E1J A;  3SMP A;  3G6E N;  3VEW A;  2F8T A;  2OTJ N;  2XY7 A;  3HZ6 A;  1RT7 A;  1EWQ A;  2R7Y A;  4H0P A;  1O1W A;  4CBX A;  3SUN A;  3PUF A;  1IG8 A;  3D0P A;  4LD0 A;  4DQ8 A;  3SPY A;  2KZZ A;  5ADX A;  3VEV A;  3K5M A;  4DHY A;  3SUP A;  4F2S A;  2Q0U A;  2JWL A;  4KHQ A;  4JI3 K;  1NKE A;  4CEA A;  3WUH A;  4JNE A;  3GE1 A;  3DMJ A;  1ASW A;  4FXD A;  3N4P A;  4H0V B;  5KGX A;  5M1F A;  2G8K A;  3SAG A;  3M8S A;  1NK0 A;  3WNF A;  1TYQ A;  4FVU A;  2I7P A;  4RTF D;  3NF9 A;  5T7B A;  3DLK A;  3BZK A;  1LWF A;  4FYD A;  4FWL A;  3PIO L;  3S3N A;  1NJY A;  4GY2 B;  4I9Q A;  4YOY A;  2YHB A;  1K6Y A;  4H0X B;  3MXI A;  4FJI A;  5AQM A;  3RMC A;  2D0B A;  1B9D A;  1T44 A;  5EX5 A;  3LL3 A;  1LW2 A;  3FR0 A;  3CCJ N;  4DU1 A;  4JKG B;  1SL2 A;  1RTD A;  1X3M A;  4CJT A;  1ATS A;  4CK3 A;  4OVL A;  3DAW A;  4BE0 A;  4KHW A;  3JXU A;  4UY8 O;  4EZ6 A;  3ZCM A;  2X6S A;  3LZI A;  3UKU A;  3VQD A;  1NG9 A;  5BN9 A;  4CEC A;  4QS8 A;  3D2F B;  1X1P A;  4U67 L;  1QHA A;  3VEO A;  5C2F A;  4H5W A;  4BR5 A;  3J80 O;  5CE3 A;  2AP1 A;  3OS2 A;  2HMP A;  1NGH A;  1U49 A;  3BP8 A;  3R3L A;  3J81 O;  3L2V A;  2B6A A;  5KRS A;  2YCH A;  4G1Q A;  4KTW A;  4BGB A;  4PQU A;  4CFB A;  4DCH A;  2WC9 A;  3HT3 A;  5KRT A;  3NVM A;  3V9S A;  3DI6 A;  3ZT3 A;  3RR7 A;  3QML A;  4DTX A;  1TK5 A;  4NYF A;  2Q31 A;  3V9Z A;  4PA1 A;  1GLL O;  2D0P A;  3QDK A;  4IG0 A;  3PSI A;  3SJJ A;  3ZX0 A;  4DV4 K;  3SUO A;  2P1J A;  5I9E B;  3IMX A;  4CEE A;  1RT2 A;  4W5T A;  3AGR A;  2ETJ A;  4YFU A;  4BRD A;  3HOS A;  1XMO K;  1ASV A;  3A5N C;  3TSP A;  4V19 S;  2CGJ A;  4B9S A;  1RT1 A;  4JRQ A;  3AO5 A;  1S6P A;  1MWM A;  1NGG A;  3O4W A;  3SQ4 A;  1S1V A;  1SZ2 A;  3GG4 A;  4FZZ A;  2V7Z A;  5C0Y A;  4OX9 K;  1BCO A;  3KD1 E;  3G4S N;  5FPN A;  1U6Z A;  4BRN A;  3RR8 A;  3THY A;  1QSY A;  1L3U A;  3F2K A;  5J2Q A;  4IJN A;  1T05 A;  1X9W A;  3RSE A;  4RW4 A;  1EP4 A;  3IFR A;  3OY9 A;  3KZB A;  1TK8 A;  3VQA A;  1NU0 A;  2ZE2 A;  4B8C A;  1VQ5 N;  2OPS A;  3ALY A;  4FM0 A;  4J2A A;  3V1R A;  2O8C B;  3PO5 A;  4A61 A;  2ZJQ L;  3LP0 A;  5E26 A;  2F9T A;  4FOI A;  5AQP A;  4DTS A;  4HCB A;  4LF7 K;  4B3M K;  2D0O A;  4BRL A;  2P9I A;  4X66 K;  3CJB A;  1KVC A;  1SUQ A;  2QWO A;  4DR2 K;  5HRN A;  3UKR B;  3FGU A;  1J53 A;  3ATV A;  5I3U A;  3G25 A;  4E19 A;  3SPZ A;  5B8H A;  1HJO A;  3SQ1 A;  4I6M A;  4W5Q A;  2ITM A;  4EP4 A;  3CHW A;  1KFS A;  4DQS A;  3S3M A;  1FW6 A;  4H4M A;  1BQN A;  3VET A;  1C1B A;  4A5A A;  2UU9 K;  1HYV A;  1HRH A;  4CHY A;  2RKI A;  2NRV A;  3V9W A;  4KI4 A;  4JHD B;  2HHQ A;  4JKF A;  4NXM K;  1CZA N;  5AZI B;  2D1K A;  1H1V A;  2BTF A;  4CJQ A;  3TTC A;  1TKD A;  1N5Y A;  4C1N I;  3CCQ N;  4B1Y B;  4KHU A;  1ATR A;  4BWJ A;  4JKG A;  2P9S A;  3AVL A;  4M3X A;  2OYQ A;  4BRH A;  4WE1 A;  3OVN A;  4CK1 A;  2G8F A;  2EHG A;  3NGY A;  3AVH A;  1IG9 A;  4BRC A;  1LWC A;  5LMN K;  4FJ9 A;  4ILH A;  2IAJ A;  1BIS A;  3D2F A;  3L0Q A;  3AO2 A;  2KKZ A;  3MEG A;  2IOC A;  4Y1C A;  5KQD A;  4Z4F A;  1HKG A;  3V9X A;  4CZE A;  4CF9 A;  4GV6 A;  2P9N A;  5AQJ A;  3O8M A;  4M41 A;  3AAR A;  4JI5 K;  3SLC A;  5C10 A;  3HM9 A;  3KIO A;  1WBD A;  1BO5 O;  4IBN A;  4A62 A;  2W41 A;  2Y1I A;  4CZH A;  4WFA L;  2KZM A;  2UUB K;  3J7Z O;  1C0G A;  2FXU A;  4AF1 A;  3I33 A;  4N47 A;  4OO1 J;  1HJR A;  1Q8I A;  1NM1 A;  2V52 B;  4FZY A;  4JD2 B;  1QE1 A;  3RTV A;  4B3T K;  1VQO N;  4IOX A;  1QQM A;  2E6M A;  1U45 A;  1N33 K;  3J8A A;  4N5S A;  2V7Y A;  2BE2 A;  4KTQ A;  3VTI A;  4BR2 A;  3AVM A;  3VGK A;  3CCL N;  3T1Y K;  1HMV A;  4EHU A;  1BUP A;  5KI6 A;  3WXK A;  2FLO A;  1N32 K;  2O8D B;  4BC3 A;  4C8M A;  3U6F A;  1U48 A;  2JWK A;  4O44 A;  2F7T A;  2F96 A;  3DLR A;  5CZ1 A;  3O5B A;  4CJE A;  1C0F A;  2YHX A;  3NAE A;  3AA3 A;  2OAN A;  1LW0 A;  4PL8 A;  3QNO A;  3HP6 A;  4RW6 A;  5AQL A;  2XRI A;  4IFV A;  1K8K B;  3GBT A;  3K58 A;  3OYJ A;  4QOZ B;  3ENB A;  1X3N A;  4FJM A;  3DLG A;  3T1H K;  2HBJ A;  2ZJR L;  4E7J A;  3VA3 A;  1J5O A;  1DT9 A;  3L2Q A;  2IC3 A;  4H5R A;  3CCS N;  4YOT A;  4CFD A;  3CPE A;  4DTO A;  2DFH A;  4L8R B;  4BR4 A;  4CZJ A;  3HSC A;  3BGR A;  3FLC O;  5AQI A;  2NRX A;  4LF6 K;  5J2P A;  4BRI A;  3OW2 M;  3CC7 N;  1BHL A;  4KFB A;  4MO5 A;  1K8A O;  4U7B A;  5JLH A;  1Q7Y O;  3KK1 A;  4KRE A;  1RDD A;  4J2E A;  2Q0R A;  5EOY A;  4JAX A;  4FWQ A;  4K42 A;  5AQS A;  4G9Z A;  4DV7 K;  1NK6 A;  3ZLJ A;  4CJL A;  3CJ9 A;  4NCB A;  3PV8 A;  3HOT A;  4KHN A;  2BH1 A;  2E2O A;  3AY9 A;  3F5T A;  1YAG A;  1OVY A;  3VF2 A;  4DS5 A;  1L3T A;  1BWF O;  4IWV A;  2YX6 A;  1RDC A;  4BE1 A;  4DQI A;  5AZI A;  5LJW A;  1NMD A;  2QWR A;  1JXE A;  1WAJ A;  3QIN A;  3V6D A;  4CIF A;  4H8K A;  3SI6 A;  4WQ5 A;  1A5X A;  3OYE A;  4FWP A;  4FM1 A;  1Q86 O;  4BGA A;  5BR9 A;  1KQS M;  3VER A;  1KCF A;  3HXM A;  2HNY A;  4BVP A;  2AJQ A;  1RNH A;  3VQ4 A;  2Q1N A;  3DLL L;  3ZX3 A;  3HPO A;  4DKW A;  4GW6 A;  3V1O A;  3ZEU B;  3EE8 A;  4Z4E A;  1YJN N;  1U04 A;  2QXF A;  4AHR A;  3PX6 A;  4PUO A;  1RCH A;  3OYD A;  2HHS A;  5BRD A;  1R0A A;  3K5O A;  3SAH A;  4NLC A;  3O3F A;  2E8A A;  5FPE A;  4FLW A;  2RF2 A;  4CEB A;  4BC4 A;  4DFP A;  4L3Q A;  3NDK A;  1JL1 A;  1YT3 A;  4K25 A;  3H1Q A;  3ZT1 A;  5M1N A;  2BUP A;  5HLF A;  5M1O A;  4KO0 A;  2GUP A;  4KTZ A;  1N36 K;  3JSM A;  4FZX C;  4DWI A;  4FCY A;  3A5M C;  1IBL K;  1VQ4 N;  1DEJ A;  3DLB A;  4JD2 A;  4RW9 A;  2XY6 A;  1YTU A;  1GLB G;  3KLF A;  1IH7 A;  3LAM A;  1UWB A;  5M1K A;  3I56 N;  5FRN A;  3OYC A;  1RDW X;  3DYA A;  1HYS A;  5CR4 A;  3FZH A;  4GV3 A;  3VGM A;  2HF3 A;  3L4I A;  4JKH A;  1JCE A;  5C2D A;  4LH5 A;  4B1U B;  4H0Y B;  3P38 A;  3LAL A;  3SUQ A;  5HRO A;  3ZSO A;  3U8X A;  3VF6 A;  2O8D A;  3O80 A;  1CLQ A;  3AVJ A;  1ZBL A;  3ID6 A;  1UA0 A;  1VK0 A;  2V51 B;  3L3V A;  2Z1J A;  4B3R K;  1S1U A;  3FZK A;  3KD5 E;  2QI2 A;  5DK5 A;  2YV0 X;  4KV8 A;  3NHG A;  2I7N A;  1S5J A;  2OZS A;  4LF8 K;  4DR6 K;  3IKM A;  4H0O A;  2G8H A;  3CXC M;  1K8K A;  3EZW A;  4FLU A;  2YJF A;  2QWN A;  2QWL A;  3U3Y A;  5F0X A;  3TSU A;  4CHQ A;  2QW9 A;  2YI1 A;  4LC9 B;  3LDO A;  4CEF A;  3H08 A;  3PO4 A;  1NGC A;  3TAB A;  2DFE A;  4C23 A;  5KPT A;  4K43 A;  3CER A;  3M3Z A;  4IFE A;  3JS6 A;  4CJ4 A;  4CJ3 A;  4F4K A;  3VPZ A;  3NH0 A;  3E66 A;  4H03 B;  1EWR A;  3CJC A;  3C6U A;  4N56 A;  1KTQ A;  4IOC L;  1NK4 A;  2D4W A;  4JI0 K;  3DLE A;  1OH5 A;  4F3O A;  2XY5 A;  3CFO A;  2FBY A;  4WYB A;  1HNW K;  1TUU A;  1TL3 A;  1NGI A;  4JI4 K;  4I7F A;  4DB3 A;  4CHN A;  2E4L A;  3MXJ A;  1Y64 A;  2FSN A;  3MX5 A;  4CJW A;  3RMB A;  3QNN A;  4OGE A;  4ILJ A;  5C15 A;  1TUY A;  4DV5 K;  3VEX A;  4CJU A;  4BR9 A;  2BAN A;  4HUG A;  3P39 A;  2PYJ A;  4M3Y A;  3TAQ A;  4F8R A;  2F8S A;  3EO3 A;  3I55 N;  4WFN L;  5I42 A;  1YI2 N;  1SQK A;  3B6P A;  3CF5 L;  5IT9 O;  3VQ7 A;  3EYZ A;  4Z94 A;  1DKG D;  2KHO A;  2QKK A;  3K5N A;  4OPK A;  1GLA G;  3VQP A;  5CY4 A;  4X62 K;  2G8W A;  3MWP A;  4CZI A;  2P9P A;  4NCA A;  5KGW A;  2GWK A;  4EP5 A;  3E01 A;  3K9J A;  5M1Q A;  4FWO A;  2QXL A;  3MN5 A;  4E3S A;  1ESV A;  4CGH A;  2HMI A;  5HRS A;  3KWI A;  2WUS A;  4GKJ K;  3J7A P;  3VQQ A;  1WOQ A;  3D2E B;  4CFA A;  3I8B A;  3VQE A;  4O0J A;  1K9M O;  4M3T A;  3DXM B;  2LSN A;  3O1B A;  3NMU A;  1HKC A;  3V4I A;  3G71 N;  3HM8 A;  3CCV N;  3IS9 A;  4FL9 A;  3NF8 A;  4LSN A;  1HNV A;  4XH4 A;  5AQY A;  3ZSY A;  4EHT A;  3THX B;  3CJ7 A;  2P5G A;  3KTQ A;  4FLY A;  1VSJ A;  4AH9 A;  1JCG A;  1WSH A;  5EU7 A;  5LY3 A;  3SV3 A;  1HYZ A;  2EWS A;  4CED A;  2HHV A;  4B1X B;  3W0L A;  4B3S K;  3NH2 A;  3B6O A;  1S3X A;  2VYP A;  5E41 A;  1ZBS A;  3DWL A;  4DSJ A;  4LSL A;  4F3T A;  4FLX A;  2FF6 A;  1XNR K;  5J1E A;  3OYN A;  4CI6 A;  4JI6 K;  3H1V X;  4W5R A;  2VQE K;  2QKB A;  1Z26 A;  1WSE A;  5GAE P;  3TU5 A;  1SKS A;  4Z4C A;  2VG6 A;  4ICL A;  4B1Z A;  2OCE A;  3EE9 A;  3OHR A;  2QWP A;  3AVA A;  2H3G X;  1HUX A;  2G8I A;  2Z1I A;  4Q5V A;  1Y97 A;  3VA0 A;  4IDH A;  1HLU A;  2IGI A;  3L2R A;  4IEI A;  4CEO A;  2IDO A;  4JYA K;  4RWT A;  4CJK A;  1TKT A;  5K14 A;  3IG1 A;  4DF8 A;  3F73 A;  4AM7 A;  4ZTJ A;  2P9K B;  1VQ6 N;  2PFU A;  2F4V K;  3WQU A;  4BRM A;  3V9U A;  5AQW A;  3NGI A;  2Z1G A;  1NGJ A;  4IEE A;  3DRS A;  3MK6 A;  3LWM A;  4BRK A;  5DM7 L;  3A2F A;  3K2P A;  2P9U B;  1I94 K;  1QQC A;  3RVC A;  3CCR N;  4GV9 A;  1U2V B;  4YNQ A;  2E88 A;  4AHU A;  4CJ7 A;  4DTM A;  2ZGY A;  3VQ9 A;  3SV4 A;  4E0D A;  1G99 A;  5A2Q O;  4JI2 K;  4CD3 A;  1NGA A;  3OYF A;  2A3Z A;  3BF1 A;  3S9H A;  3KKS A;  4FLV A;  1JJ2 M;  2O4I A;  1EO1 A;  3HL8 A;  1P8Z A;  3OYM A;  4DU3 A;  3QET A;  4FJJ A;  4QCL A;  3EEQ A;  3OS1 A;  4EFH A;  1IKV A;  3NVK A;  4O55 A;  1RGI A;  1WB9 A;  4O5F A;  4AQY K;  3NH1 A;  1WSF A;  2QTD A;  1S9E A;  3F9K A;  4JKA A;  3AVI A;  1WAF A;  3OTO K;  1KRP A;  4DUY K;  2W6L A;  5GIP A;  1S1X A;  1KAZ A;  4DFJ A;  2ZM6 K;  3QER A;  4DV3 K;  3L3U A;  1MU2 A;  2NLX A;  3ZYY X;  4B1W B;  2QWQ A;  4JI7 K;  2FBX A;  3UB5 A;  3TAP A;  4LF9 K;  3HK2 A;  3ULE B;  4OPH A;  1FK9 A;  4FJH A;  1IJJ A;  3WQT A;  1L5U A;  4OGC A;  2CGK A;  4DTJ A;  3EY1 A;  3L2W A;  2D0A A;  4NO7 A;  3TSQ A;  4WQ4 C;  4NYN A;  3LDQ A;  3AVF A;  3ZSV A;  3CC4 N;  2RHK A;  2NZT A;  5EVZ A;  4PWD A;  1JL2 A;  1DTQ A;  1YHQ N;  2P9L B;  1XQS C;  1C6V A;  3TAM A;  3DXM A;  3CJ1 A;  1ZBU A;  3FZF A;  4CZG A;  3VQC A;  1VSM A;  1J5E K;  3ULD A;  5AQN A;  3C7N B;  3KVG A;  4ILG B;  3MXM A;  3H6E A;  2HHU A;  2DY4 A;  4FK4 A;  1VQP N;  3U4L A;  4H4O A;  2GTD A;  3M5R A;  2XY8 A;  3A8Y A;  1ATN A;  5AFU H;  5D3G A;  4LH4 A;  3WT0 A;  4M7Y A;  4CJ5 A;  5BN8 A;  4LY7 A;  3TWH A;  1SS6 A;  5AQG A;  3ZT0 A;  3NF7 A;  4QS7 A;  2GUI A;  5SZT A;  3LPT A;  1LAW A;  3T7Z A;  5GIO A;  2KTQ A;  3O9S A;  1QZ5 A;  4YOX A;  4HUF A;  3ID8 A;  3C6H A;  5ELZ A;  1OH8 A;  3WNH A;  5BR8 K;  1EXQ A;  3KK3 A;  3ZSX A;  4FJ5 A;  2YNH A;  1WBB A;  4B9M A;  2VG7 A;  4KAZ A;  2JLE A;  1DTT A;  4OKJ A;  1JLA A;  4Z0U A;  4H5N A;  4H5T A;  3KJV A;  1QVG M;  3THW B;  4LFA K;  3AA2 A;  1LV5 A;  1T8E A;  2QK9 A;  4CJS A;  3NGZ A;  1D9D A;  4A57 A;  3AVN A;  4XIU A;  2O8B B;  3J7Y P;  3FZL A;  3LPU A;  5AR0 A;  5FPM A;  4MQ3 A;  1UAX A;  2P9K A;  1YVU A;  3C65 A;  4FVM A;  1Z6R A;  3AVG A;  1BL3 A;  1IV0 A;  4RW8 A;  4GNI A;  1YIT N;  3PSF A;  2ASO A;  2ASP A;  5AQZ A;  1T6C A;  1HPM A;  2Q3S A;  2VG5 A;  1HR0 K;  3N4Q A;  2D0C A;  1U2V A;  5AQQ A;  4DTR A;  4IOA L;  5AQO A;  4ISE A;  4JKD A;  4JN4 A;  2UXB K;  4FPA A;  4JK8 A;  1WSJ A;  3IDH A;  3PX0 A;  4CHO A;  4FLZ A;  1KLM A;  2E2P A;  1LAV A;  4RCH A;  4E7L A;  3MN6 A;  3PIP L;  4J2B A;  3QBX A;  4AHV A;  5HRR A;  1S1W A;  1RFQ A;  4LFB K;  1RBU A;  4DUZ K;  1NKC A;  2ZWH A;  3HO1 A;  3ZSQ A;  1LOT B;  1W0H A;  2OA8 A;  3VQ6 A;  3BDP A;  4PY5 A;  1X9J A;  2VCP A;  3VF4 A;  4F9O A;  3VQB A;  2I5J A;  3O3H A;  1QS4 A;  2O8C A;  1C0T A;  4DMN A;  2PY5 A;  1I39 A;  2HBK A;  4BR7 A;  4CIE A;  2XHB A;  3VEY A;  3HJF A;  3P83 D;  4Q0B A;  5JVH L;  4BC5 A;  2X6N A;  3VGL A;  2O4G A;  4OPJ A;  1R59 O;  1BDG A;  3UKR A;  3WXI A;  1MA9 B;  4GMJ B;  1ILY A;  4BRA A;  4KRF A;  3KK7 A;  2VGM A;  1GLJ O;  4B3O A;  2CH6 A;  1NOZ A;  2E5L K;  5CYM A;  1RBT A;  2HB5 A;  4O8K A;  4CF0 A;  3AO4 A;  4IG3 A;  1SL0 A;  4KKO A;  3KLE A;  3V81 A;  1OKJ A;  3ULE A;  4DTP A;  3FFI A;  5JS1 A;  3CCE N;  3AV9 A;  5AFU A;  3CET A;  2OZM A;  3TI0 A;  3O4Q A;  5CZ2 A;  4CF8 A;  1MDU B;  3OYL A;  1KAY A;  4JHD A;  2IS3 A;  4Z4G A;  4DSK A;  4M63 C;  1BI4 B;  3CM6 A;  3LAN A;  1MWK A;  3DJC A;  3OBW A;  2X78 A;  1X9M A;  3O9T A;  4C8N A;  3M8Q A;  5C42 A;  3HVR A;  3MCP A;  4QS9 A;  1QSS A;  1LCU A;  3DOL A;  3OYI A;  1SAZ A;  2ZD1 A;  3SBT A;  4B9N A;  1JLF A;  3DLH A;  1KFD A;  4E89 A;  1J54 A;  1NBW A;  2FBV A;  4OKK A;  3O9U A;  3OYA A;  3RMD A;  3H46 O;  1CZ9 A;  3C0B A;  3ZX2 A;  3PY8 A;  3S3O A;  1GLC G;  4MLE A;  3SBG A;  1S1T A;  1ITG A;  1B92 A;  4OPA A;  4BQL A;  5BRF A;  4CGD A;  2HF4 A;  5DMR A;  1TAU A;  4KHS A;  3CQY A;  3SJH A;  3VQ5 A;  2QM1 A;  3K57 A;  4JKE A;  5GIN A;  2Y1J A;  1HNI A;  2HBL A;  3W3D A;  1ZYQ A;  3QB0 A;  3CQX A;  4CGG A;  1VHX A;  4XH1 A;  1EX4 A;  2E1Y A;  3G10 A;  4BC2 A;  3THW A;  1VQ7 N;  4CW7 B;  1BU6 O;  1SKW A;  5JS2 A;  3AAQ A;  1BGX T;  4DTN A;  1RT4 A;  5TKY A;  1XHZ A;  3R9P A;  3CCU N;  4KH4 A;  1Z05 A;  1ZBI A;  4K8Z A;  2WFB A;  4EAH D;  2GEL A;  4YOR A;  1KD1 O;  1V4S A;  4IZ9 A;  3QLH A;  4FM2 A;  1ZC6 A;  1BA0 A;  5BPM A;  1JKH A;  4BDP A;  1T3V A;  3EL2 A;  1B9F A;  3WNE A;  3GOI A;  2Q97 A;  1UOC A;  1JLG A;  1ASU A;  3E9O A;  3QES A;  1VSH A;  3MAQ A;  5EY4 A;  1VRT A;  4JI1 K;  3ATU A;  4KHY A;  4DQR A;  1WLJ A;  3M8P A;  3NBP A;  4NCG A;  5AQT A;  5AQU A;  4CGI A;  4CE9 A;  1SV5 A;  2RPI A;  3ITH A;  2X74 A;  3EKS A;  2YNF A;  1YJW N;  1KVB A;  2DPN A;  4DV1 K;  4DR3 K;  4ELT A;  1QVF M;  2HHT A;  4CZK A;  3GDQ A;  1T03 A;  4CHZ A;  3B8A X;  3JYT A;  3TAE A;  4CJV A;  2E1Z A;  2J4R A;  3MN9 A;  1KXP A;  3LM2 A;  4CK2 A;  1K73 O;  4KH5 A;  4DR5 K;  3EZ5 A;  1LWE A;  5IWA K;  4IJA A;  1Q9X A;  1NGB A;  2NRW A;  3K9K A;  3E1Y A;  3M8R A;  4B9Q A;  2YHA A;  1NK8 A;  3CI5 A;  2WTU A;  3H3O B;  4ID1 A;  3ENO A;  1HQE A;  3KHY A;  4HVJ A;  1TL1 A;  1CXQ A;  2NNW A;  4DFK A;  4CJP A;  4CVN E;  4JK9 A;  3O3G A;  3QFU A;  4I9L A;  1GLE G;  4JKC A;  1L3V A;  2JGU A;  2E6L A;  1RDA A;  5GAG P;  4IFY A;  4K0K K;  5GAD P;  4CIG A;  3ZSZ A;  2CH5 A;  3R6M A;  1RDB A;  2HHH K;  3AVC A;  2KFN A;  1VSK A;  1BIU A;  3MEC A;  2PAV A;  3QEP A;  1U47 A;  4OLB A;  4KHP K;  3THY B;  2A41 A;  4CCH A;  5AQK A;  1RBS A;  3QEW A;  1GOC A;  2B5J A;  2HHX A;  3TAN A;  3RSE B;  2XO7 A;  2A6A A;  4BAC A;  3PX4 A;  1J9A A;  3QBW A;  4H5V A;  1BOT O;  4B1V A;  3THV A;  3LDS A;  3AO1 A;  1NGF A;  2OPR A;  1VQ9 N;  4B9V A;  2ZF5 O;  3QIP A;  1BI4 A;  4FW1 A;  1C0M A;  3O9Q A;  3EN9 A;  2VWJ A;  1YXQ A;  4F2R A;  3Q7B A;  3DM2 A;  2KFZ A;  1GLD G;  2ZGZ A;  1TGO A;  1XC3 A;  3AA5 X;  5F1X A;  3C6A A;  4KH6 A;  2OPP A;  5BRH A;  2W40 A;  3MED A;  4AM6 A;  1REV A;  1SL1 A;  2HHW A;  3V1Q A;  1CZB A;  3CYM A;  3HBT A;  1NJW A;  4FSV A;  4X65 K;  3VTH A;  2IVP A;  2Q36 A;  4IXC A;  2HST A;  3ZEU A;  1CXU A;  3LDP A;  5CHI A;  4CGF A;  1FJG K;  3CFR A;  3R8E A;  4I6M B;  4DLG A;  4AIL C;  2ZQB A;  1YIJ N;  5LL6 Z;  4CHP A;  4DFM A;  4CER A;  4N41 A;  3VMF B;  3KLI A;  4Y0W A;  2A1S A;  5CYQ A;  2NRH A;  3HPG A;  4M3R A;  4DG1 A;  4KBO A;  1NJI O;  1HQU A;  1M1K O;  3ZET B;  1YF5 L;  3DXK B;  1NWK A;  3BY5 A;  3SAF A;  2W42 A;  3CG7 A;  4O5B A;  4H0T B;  4NLB A;  4CEQ A;  1FKO A;  2WBN A;  3OYK A;  3SQ0 A;  1FKP A;  4WQ5 C;  3QEI A;  5AQF A;  1Q9Y A;  1D4X A;  1E4F T;  2P9S B;  4BRF A;  3HTV A;  1NK9 A;  4DR4 K;  3VEN A;  3O08 A; 
#chains in the Genus database with same CATH homology
 4BRI A;  3OW2 M;  3CC7 N;  4JEP A;  3CC4 N;  5BPN A;  2E2N A;  2RHK A;  3A5O C;  2QWM A;  4MO5 A;  2NZT A;  1K8A O;  4U7B A;  1VQN N;  5EVZ A;  5JLH A;  1Q7Y O;  1BG3 A;  1YHQ N;  2P9L B;  1XQS C;  3DXM A;  3CJ1 A;  4IO9 L;  2Q0R A;  3MWT A;  5EOY A;  3VES A;  3A5L C;  4JAX A;  2KLA A;  3FZF A;  4FWQ A;  2IIR A;  4K42 A;  5AQS A;  4G9Z A;  4CZG A;  2FSK A;  3M6G A;  3D7E O;  1RDU A;  3CJ9 A;  5AQN A;  1XUP O;  4BRQ A;  1WUA A;  3Q7C A;  3C7N B;  3KVG A;  4ILG B;  3CCJ N;  3H6E A;  2P9N B;  4PHT X;  2ASM A;  3HOT A;  3HI0 A;  1VQP N;  4O8U A;  2BH1 A;  5DM6 L;  3U4L A;  2GTD A;  5LJV A;  3BEX A;  2E2O A;  3M5R A;  3AY9 A;  3F5T A;  4ISF A;  2NRT A;  1ATN A;  3A8Y A;  5AFU H;  3L4Q A;  4JKB A;  1YAG A;  1OVY A;  3WT0 A;  4M7Y A;  3VF2 A;  5FPD A;  2CGL A;  1BWF O;  4IWV A;  2YX6 A;  5BN8 A;  4BG8 A;  1SS6 A;  5AQG A;  4QS7 A;  4BVO A;  3T7Z A;  1NLV A;  5AZI A;  2YHW A;  5LJW A;  4FWS A;  5GIO A;  3O9S A;  1NMD A;  1QZ5 A;  2QWR A;  4FOE A;  5MLC Q;  4YOX A;  3ID8 A;  2A40 A;  3CMA N;  3PLA A;  3C6H A;  5ELZ A;  4YDU A;  3TTD A;  5KPR A;  4WQ5 A;  5C12 A;  1S72 N;  4A2B A;  3D6R A;  2UYT A;  3LDL A;  4FWP A;  1Q86 O;  4WQ4 A;  4HWI A;  3TTF A;  4BGA A;  5BR9 A;  1KQS M;  4H5N A;  3FE1 A;  4H5T A;  3VER A;  1M90 O;  4BQZ A;  3OA9 A;  4BVP A;  1QVG M;  2Q1N A;  3DLL L;  3BUZ B;  3ZX3 A;  4FWN A;  4M7X A;  3SK3 A;  4DKW A;  4A57 A;  2YJE A;  3ZEU B;  3EE8 A;  2FSJ A;  1YJN N;  2OTL N;  3FZL A;  4ISG A;  4PKI A;  1QQN A;  3CD6 N;  5AR0 A;  5FPM A;  3WXM B;  5BRD A;  3UE5 A;  4K41 A;  2P9I B;  2P9K A;  4MDB A;  3C65 A;  4C1N K;  3SAH A;  1Z6R A;  4NLC A;  4WCE L;  4E1J A;  2E8A A;  3SMP A;  5FPE A;  4GNI A;  1YIT N;  3G6E N;  1VQM N;  4BC4 A;  3VEW A;  2ASO A;  2ASP A;  4L3Q A;  2OTJ N;  5AQZ A;  3HZ6 A;  4K25 A;  3H1Q A;  1T6C A;  1HPM A;  3GL1 A;  4H0P A;  1VQK N;  1QQO A;  4R79 A;  4CBX A;  5EXW A;  1IG8 A;  4BY9 C;  5M1N A;  2BUP A;  3N4Q A;  2PBD A;  5JVG L;  4DQ8 A;  1QZ6 A;  5ADX A;  4PKG A;  3VEV A;  4DHY A;  2Q2R A;  2Q0U A;  2JWL A;  2GUP A;  1U2V A;  5M1O A;  1VQ8 N;  5AQQ A;  4IOA L;  3WUH A;  5AQO A;  4JNE A;  4ISE A;  4JKD A;  3GE1 A;  4JN4 A;  5TKW A;  4FPA A;  3A5M C;  3O08 A;  1VQ4 N;  1DEJ A;  3N4P A;  4H0V B;  4JK8 A;  4JD2 A;  4BR0 A;  5M1F A;  3SAG A;  1GLB G;  3IDH A;  1YUW A;  3SMS A;  1TYQ A;  4PKH A;  4FVU A;  2E2P A;  2I7P A;  4RCH A;  4RTF D;  3MN6 A;  3PIP L;  4A2A A;  5M1K A;  3I56 N;  3QBX A;  1RDW X;  1RFQ A;  2NRR A;  4JK7 A;  1NGE A;  3H45 C;  3QIC A;  4FWL A;  3PIO L;  5CR4 A;  1J6Z A;  1Q18 A;  4GY2 B;  2ZWH A;  4BRP A;  3FZH A;  4YOY A;  4GV3 A;  3VGM A;  4H0X B;  1LOT B;  2HF3 A;  3L4I A;  5AQM A;  4JKH A;  1JCE A;  1X9J A;  2VCP A;  3VF4 A;  5C2D A;  4B1U B;  4F9O A;  4BG9 A;  2ZJP L;  3P38 A;  3LL3 A;  1EQY A;  1T44 A;  4H0Y B;  3FR0 A;  5EX5 A;  5AQX A;  3S41 A;  4JKG B;  3IUC A;  3CCM N;  1X3M A;  3U8X A;  3VF6 A;  2HBK A;  4BR7 A;  1ATS A;  3O80 A;  3DAW A;  1E4G T;  3JXU A;  4UY8 O;  3VEY A;  4BRG A;  3ID6 A;  2V51 B;  1S22 A;  5JVH L;  3TPQ A;  3FZK A;  2IVO A;  2QI2 A;  4BC5 A;  3UKU A;  3VGL A;  2I7N A;  5BN9 A;  3D2E A;  3U9D A;  5KQ8 A;  1R59 O;  1ZXO A;  1BDG A;  3UKR A;  3IKM A;  3WXI A;  4H0O A;  3CXC M;  1K8K A;  3EZW A;  1MA9 B;  4QS8 A;  3D2F B;  1ILY A;  2YJF A;  4U67 L;  1QHA A;  2QWN A;  4BRA A;  3VEO A;  3L6Q A;  3KK7 A;  2VGM A;  1GLJ O;  2QWL A;  5C2F A;  4H5W A;  4BR5 A;  5CE3 A;  2AP1 A;  3VOV A;  2HMP A;  2CH6 A;  1NGH A;  4YOW A;  3BP8 A;  3R3L A;  4O8K A;  3ZET A;  2YCH A;  5F0X A;  3TSU A;  2GEM A;  3CME N;  2QW9 A;  2YI1 A;  3DXK A;  4LC9 B;  3LDO A;  1OKJ A;  3ULE A;  4YOV A;  4BGB A;  3CCE N;  1NGC A;  4DCH A;  5AFU A;  4XH5 A;  4B1Z A;  2WC9 A;  4C23 A;  3CET A;  5M1P A;  5KPT A;  2E20 A;  3NVM A;  3CER A;  3LM9 A;  3M3Z A;  4K43 A;  2QA4 N;  1MDU B;  4IFE A;  3QML A;  3JS6 A;  1KAY A;  1NGD A;  5JLF A;  4JHD A;  3EKU A;  2Q31 A;  1GLL O;  2D0P A;  3MCA B;  3VPZ A;  3E66 A;  3QDK A;  4M63 C;  4H03 B;  2VWB A;  4J8F A;  3CJC A;  4WF9 L;  3ZX0 A;  1MWK A;  3DJC A;  3ENH A;  3OBW A;  5I9E B;  3IMX A;  1VAZ A;  3O9T A;  4IOC L;  3AGR A;  5AZJ B;  3MCP A;  3KWG A;  4QS9 A;  4BRD A;  2D4W A;  1LCU A;  3HOS A;  3A5N C;  3TSP A;  3O1W A;  1SAZ A;  2CGJ A;  3SBT A;  5AQH A;  4WYB A;  4CZL A;  1TUU A;  1NGI A;  4DB3 A;  3MMV A;  1Y64 A;  2FSN A;  1MWM A;  4WFB L;  1NGG A;  3MX5 A;  3O4W A;  1NBW A;  4FPB A;  1SZ2 A;  3GG4 A;  4ILJ A;  3O9U A;  2V7Z A;  3H46 O;  5C0Y A;  2GWJ A;  5C15 A;  1V4T A;  3WXJ A;  3C0B A;  3ZX2 A;  1TUY A;  3G4S N;  3VEX A;  1GLC G;  4BR9 A;  1O13 A;  4MLE A;  5FPN A;  3SBG A;  1U6Z A;  4OPA A;  2A5X A;  4BRN A;  5GAH P;  3P39 A;  4BQL A;  1KC8 O;  5BRF A;  4YOU A;  2HF4 A;  3F2K A;  1W97 L;  4IJN A;  3U9Z A;  3EO3 A;  3I55 N;  4WFN L;  3RSE A;  3CQY A;  1P90 A;  1YI2 N;  1SQK A;  2P9U A;  4FWK A;  3SJH A;  3CF5 L;  2FF3 B;  2QM1 A;  3IFR A;  4JKE A;  4Z94 A;  5GIN A;  3O6W A;  3KZB A;  1YJ9 N;  1DKG D;  2HBL A;  3W3D A;  2KHO A;  3QB0 A;  3CQX A;  4XH1 A;  1GLA G;  3VEZ A;  2E1Y A;  4BC2 A;  1VQ7 N;  1VQ5 N;  3MWP A;  4CZI A;  2P9P A;  1BU6 O;  2HBM A;  3WEE B;  2GWK A;  4A61 A;  3K9J A;  3AAQ A;  5M1Q A;  2ZJQ L;  4FWO A;  5E26 A;  2F9T A;  2QXL A;  3H3N O;  4FOI A;  5AQP A;  5TKY A;  4CD1 A;  3CPW M;  3MN5 A;  2D0O A;  3R9P A;  1ESV A;  4BRL A;  4NB4 A;  3CCU N;  4KH4 A;  2P9I A;  1Z05 A;  3KWI A;  2WUS A;  2HOE A;  2WFB A;  3CJB A;  2GEL A;  4EAH D;  4YOR A;  1KD1 O;  1WOQ A;  1V4S A;  3D2E B;  3I8B A;  2QWO A;  1K9M O;  4IZ9 A;  3DXM B;  3UKR B;  1ZC6 A;  1BA0 A;  2E2Q A;  3FGU A;  3ATV A;  5BPM A;  4A5B A;  3G25 A;  3O1B A;  3MN7 A;  3NMU A;  1HKC A;  4XEI A;  1T3V A;  3EL2 A;  3HM8 A;  3G71 N;  5B8H A;  3CCV N;  1HJO A;  4FL9 A;  4I6M A;  3GOI A;  5H1S Q;  2ITM A;  2Q97 A;  3CHW A;  4XH4 A;  5AQY A;  3E9O A;  4EHT A;  3CJ7 A;  5JIC A;  3M1F A;  2YHY A;  4HTL A;  5EY4 A;  1JCG A;  5LY3 A;  3ATU A;  5AQU A;  4YDU C;  5AQT A;  3VET A;  2EWS A;  3CC2 N;  4B1X B;  3EKS A;  3W0L A;  1YJW N;  1HX1 A;  4A5A A;  1S3X A;  2DPN A;  2VYP A;  1QVF M;  2NRV A;  1ZBS A;  3DWL A;  4CZK A;  3GDQ A;  4JHD B;  3B8A X;  2FF6 A;  4JKF A;  1CZA N;  2E1Z A;  5AZI B;  4CI6 A;  2J4R A;  2D1K A;  3MN9 A;  3H1V X;  1KXP A;  1H1V A;  3LM2 A;  2BTF A;  5GAE P;  3TTC A;  1K73 O;  3TU5 A;  3R1X A;  3FFK B;  4KH5 A;  4CBW A;  4C1N I;  3CCQ N;  4IJA A;  4B1Y B;  1ATR A;  1NGB A;  2NRW A;  3K9K A;  3EE9 A;  3E1Y A;  2QWP A;  3OHR A;  1DGK N;  3P4I A;  5E84 A;  4B9Q A;  2H3G X;  1HUX A;  2P9S A;  4JKG A;  3CI5 A;  4FWM A;  3H3O B;  5AQR A;  3ENO A;  3QFP A;  3KHY A;  4MDA A;  4MO4 A;  5BRE A;  1GLF O;  4IDH A;  5HOO A;  2NNW A;  3FZM A;  1HLU A;  4BRH A;  2AA4 A;  4MLH A;  3E9L A;  4JK9 A;  1W2B M;  1Q81 O;  3QFU A;  3A0I X;  4IEI A;  1GLE G;  4BRC A;  2P9L A;  4JKC A;  4CZM A;  4RWT A;  4GVE A;  5HL7 L;  4ILH A;  5GAG P;  5GAD P;  3D2F A;  3L0Q A;  2CH5 A;  3R6M A;  3LDN A;  4AM7 A;  2KKZ A;  2P9K B;  1VQ6 N;  2PFU A;  3AGK A;  1KAX A;  3WQU A;  4BRM A;  5AQW A;  5KQD A;  1HKG A;  1NGJ A;  4CZE A;  2PAV A;  3WXL A;  2IVN A;  4IEE A;  3C7N A;  2A41 A;  4FO0 A;  2P9N A;  5AQJ A;  3O8M A;  5AQK A;  4GV6 A;  3AAR A;  1Q82 O;  3MK6 A;  4PL7 A;  3SLC A;  5C10 A;  2GX9 A;  1BO5 O;  2RE2 A;  4BRK A;  5JMV A;  3BF3 A;  5DM7 L;  3RSE B;  4A62 A;  2W41 A;  2A6A A;  2P9U B;  4CZH A;  4WFA L;  3J7Z O;  1C0G A;  3RVC A;  4CBU A;  3CCR N;  2FXU A;  3QBW A;  4FWR A;  4H5V A;  1BOT O;  4AF1 A;  4GV9 A;  4B1V A;  3I33 A;  2A42 A;  4BRE A;  4EIA A;  1U2V B;  1NGF A;  2E88 A;  4CJ7 A;  1VQ9 N;  4OO1 J;  2ZGY A;  2ZF5 O;  2QEX N;  1G99 A;  4CD3 A;  2NRZ A;  3O9R A;  1NM1 A;  1NGA A;  2V52 B;  3CIP A;  3MDQ A;  3EN9 A;  3O9Q A;  4JD2 B;  2A3Z A;  1T6D A;  3BF1 A;  2P9P B;  1YXQ A;  1VQL N;  1TYQ B;  1JJ2 M;  3Q7B A;  1EO1 A;  1VQO N;  3MX2 A;  1GLD G;  5AZJ A;  2ZGZ A;  1XC3 A;  4IOX A;  1QQM A;  1P8Z A;  3C6A A;  3J8A A;  4KH6 A;  5F1X A;  3E9P A;  2V7Y A;  2W40 A;  3CJA A;  5BRH A;  3AAP A;  4AM6 A;  4EFH A;  3NVK A;  3VTI A;  4BR2 A;  3VGK A;  1RGI A;  3HBT A;  3CCL N;  4FSV A;  4EHU A;  3VTH A;  2IVP A;  4O5F A;  1BUP A;  2Q36 A;  4IXC A;  2HST A;  3WXK A;  2FLO A;  2QTD A;  3ZEU A;  5CHI A;  3LDP A;  3HRG A;  3F9M A;  4BC3 A;  2JWK A;  2F7T A;  3O5B A;  4JKA A;  3R8E A;  4I6M B;  1C0F A;  1JCF A;  5ADX H;  2YHX A;  1YIJ N;  5GIP A;  3UKU B;  1KAZ A;  2OAN A;  4CZF A;  3VMF B;  2F9W A;  4Y0W A;  4PL8 A;  5AQL A;  2NLX A;  2NRH A;  5F2R A;  1K8K B;  5BPL A;  3GBT A;  4KBO A;  1BA1 A;  5AQV A;  3ZYY X;  4B1W B;  1NJI O;  2QWQ A;  3ENB A;  1X3N A;  3UB5 A;  4BRO A;  2VGN A;  3OBY A;  2HBJ A;  3ZET B;  1M1K O;  2ZJR L;  1YF5 L;  1DT9 A;  3DXK B;  1HKB A;  4H5R A;  3CCS N;  4IO8 A;  3ULE B;  1NWK A;  4YOT A;  5KPZ A;  4OPH A;  3SAF A;  1N8R O;  3CPE A;  3P31 A;  1IJJ A;  3WQT A;  4H0T B;  4NLB A;  3T69 A;  4BR4 A;  4CZJ A;  2WBN A;  2CGK A;  3HSC A;  4WQ5 C;  5AQF A;  3WEE A;  4A59 A;  1D4X A;  4NO7 A;  1E4F T;  2P9S B;  3TSQ A;  3FLC O;  4WQ4 C;  3HTV A;  1YVN A;  4BRF A;  3LDQ A;  5AQI A;  3VEN A;  2NRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...