3K9JA

Transposase domain of metnase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
224
structure length
201
Chain Sequence
PHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVRRKRPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYWTGINQLISRWQKCVDCNGSYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETMAR
publication title Crystal structure of the human Hsmar1-derived transposase domain in the DNA repair enzyme Metnase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 65
structure length 201
sequence length 224
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2009-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01359 Transposase_1 Transposase (partial DDE domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3k9jA00
4MDBA 3K9KA 4U7BA 5HOOA 3HOTA 3K9JA 4MDAA 4R79A 3HOSA 5CR4A 2F7TA 3F2KA
chains in the Genus database with same CATH superfamily
1ASWA 1ASUA 1RNHA 3VQ5A 1LWFA 1X3MA 4OLBA 4QS8A 2IAJA 3NVKA 5ELZA 3P1GA 4DV4K 4IFYA 1XC9A 4M3TA 1NNEA 2FF3B 1ZXOA 4IXCA 4RW8A 4AHSA 4UY8O 4H8KA 3BGRA 3BZKA 3SUOA 4X65K 4NO7A 1HJOA 2RF2A 3BY5A 4FYDA 4BRFA 1OH8A 3AVBA 2IVOA 2YX6A 4FWKA 1JXBA 4DKWA 4BGAA 3MWTA 1J5EK 2G8UA 5HBMA 3D2FB 3DLRA 4CHQA 4KB0A 4Z94A 1CXQA 2IVPA 1C0UA 1ATRA 4FWRA 1SL2A 2YKNA 5FROA 3RMCA 3RMBA 1C6VA 3NHGA 2CH5A 3N4QA 2RN2A 3VTHA 2Z1GA 3LAKA 4JI1K 5IT9O 3VMFB 5M1KA 3AO3A 4EFHA 5KPTA 4FWLA 3G71N 3SPYA 4EAHD 4FJJA 3DLHA 1LOTB 4HCCA 3OS0A 5KQ8A 4A61A 3HI0A 1QVGM 1U6ZA 4PUOA 3OYJA 4HUEA 2FSJA 3OYDA 2P9KA 4DSJA 4JRPA 4A59A 2ITMA 3CFRA 4FJMA 3NGIA 2W40A 2KQ2A 4AQYK 1E3MA 3SMPA 3VF6A 2A42A 4J2DA 5FPEA 1BIUA 3HVRA 4C23A 4O5BA 4DR5K 1NK9A 4FJ5A 1VSHA 4E19A 4CJQA 3CETA 1S1XA 1XUPO 4JKAA 4BRLA 4JKGA 1VQMN 3KZBA 4H03B 3AO4A 1VQLN 5LJWA 4CFDA 1JCFA 3WXJA 3H08A 1UA1A 3NF7A 4I6MA 3ENOA 1VQ4N 4IFVA 1CXUA 3M1FA 3VQDA 4J2EA 4DFKA 4FK0A 5AQOA 4ELVA 3P39A 4DF8A 1REVA 4KO0A 5BRDA 4WFNL 2E2NA 4CEQA 3ATVA 3PX4A 1NK4A 4FW1A 2GWJA 1OKJA 5GADP 2BE2A 3CG7A 3CJ1A 3NVMA 3AO2A 4C8NA 4I9QA 4WFAL 1SAZA 1HQEA 1JLCA 3ULDA 1U04A 1UOCA 5KPRA 1NK0A 1TKDA 1S72N 2NLXA 2KW4A 3BEXA 3QETA 1M90O 3AAPA 4E89A 1HKBA 2NRRA 5C2DA 3NGZA 3T19A 3RR8A 1W7AA 4DSLA 3DJCA 3G25A 2F4VK 1VSKA 4CERA 5AQUA 5CE3A 1XNQK 4EIAA 4CF2A 2KTQA 3M3ZA 1S9EA 3QICA 3WXKA 2HBLA 3AVCA 1NGAA 4JKCA 3JAMO 4R79A 2RKIA 1W97L 2DPNA 4JI4K 3DLBA 4KI6A 4CVNE 4NYFA 4LD0A 3DXMB 4BG8A 5C25A 5J2PA 2O8EB 5EVZA 1X9JA 4KHYA 3I8DA 3AY9A 5AQYA 4JK8A 4JI3K 1BQNA 1YTUA 3AVHA 1T8EA 2FBXA 3SAHA 5GAGP 2XY7A 5LMUK 3QDKA 3NH1A 4FJIA 4DQSA 5H1SQ 5JICA 2P9IB 3V4IA 4M3ZA 1A5VA 4X64K 4H5TA 1BA0A 4QCLA 5GIPA 3UB5A 2Q2RA 4JKDA 4XH1A 5EX5A 3CI5A 3AO1A 3S3MA 3KWGA 2ASOA 4OJRA 4E1JA 1N36K 3C6UA 1FKOA 2XHBA 4DSKA 3V9SA 1X1PA 2J4RA 4A2BA 3ASMA 4HUGA 3WXLA 3LDOA 4DV7K 3CCLN 3QEIA 3V6DA 3SYZA 3BF3A 4JI6K 4JS4A 1MWMA 4YOTA 4CZFA 4BY9C 3GL1A 4B9QA 3ZX2A 3SUQA 3DI6A 1NGGA 4EHTA 3MN7A 2HBKA 2XY5A 5ADXA 4H5VA 3UKRB 1BHLA 4B8CA 4BR5A 1N32K 2EX3A 1GLAG 3WUHA 4F8RA 4H5WA 2EWSA 5C2FA 5AQNA 4E7JA 2UXCK 1JJ2M 3CMAN 3ZSRA 1LW2A 4H0YB 3VEYA 1Q18A 4FJNA 2KFZA 3B6OA 3L8BA 4CESA 1WSIA 5EY4A 4DQ8A 3CPEA 4CJ3A 2KKZA 1EWRA 3CM6A 4H0OA 1WSFA 2HVIA 1WOQA 1TAUA 3KK3A 3OYEA 3T1AA 4CF8A 3D7EO 2D0BA 3V9UA 1DTTA 4CHZA 1I39A 1HYVA 4DSIA 3K0SA 4DSEA 1KQSM 2BANA 4IOCL 4B1YB 4FWPA 2E4LA 3TSPA 2GX9A 3AO5A 2GTDA 1T6CA 4FM1A 5DMRA 3MMVA 5T7BA 1QQOA 1EQYA 1RTDA 5M1OA 3T69A 1KVBA 5FPNA 1GLCG 4DR7K 1GOBA 4DF4A 5AQVA 4ISGA 3E9OA 2OPRA 3W3DA 2F8TA 2I5JA 2P9PA 1WSGA 2QK9A 4EP5A 4FWQA 3OJSA 1NMNA 2FLOA 3H46O 3IG1A 1ASVA 1VSDA 3EN9A 5F0XA 1IG9A 4JAXA 3CCMN 3ZT0A 2V51B 4Z4CA 3MAQA 4LFAK 3VEOA 3DAWA 4ISEA 1IJJA 5C42A 4R5PA 1K8AO 1GLFO 1FK9A 4KPYA 3AVJA 3DOLA 2ZWHA 3MXJA 2Q97A 4H0TB 1K8KA 4RWTA 3GOIA 4H0PA 4OKKA 4E1NA 3IAYA 4JS5A 2ZQBA 4LSLA 3KD5E 2B6AA 4BRGA 3MN6A 5K14A 4CF1A 5C0YA 4L8RB 3TARA 4FPAA 3O1BA 3NDKA 4DTMA 4ZTJA 2ATQA 3ALYA 2ZM6K 1TV6A 4IDHA 4CJTA 4CI6A 2QWQA 4FPBA 5KTQA 4V19S 4CEEA 3THWB 4DR6K 3PO4A 2YHWA 2YKMA 3EO3A 4CBUA 2YNIA 1S5JA 4FLVA 2G8VA 2OTJN 1BGXT 1L3TA 3F9MA 4PWDA 3ZX0A 1KFSA 4FOIA 3A5LC 4DTJA 1YUWA 2RHKA 2HNYA 2H3GX 2X6NA 5HRPA 3O1WA 3DOKA 4BWJA 3PO5A 4BDZA 1ZC6A 3EE8A 5HRSA 4DFMA 3PY8A 1YF5L 4DWIA 1B9DA 1GLEG 4IEEA 3AGKA 2HHTA 1NKCA 3KKRA 3P4IA 1T3VA 4BE1A 1OH6A 5JVGL 1S1VA 4MO4A 4FJLA 1HPZA 5AQZA 2P9SA 1HR0K 5AZJA 3LZIA 4HTUA 2FSNA 3O80A 4MQ3A 4OPAA 1NG9A 2O8CA 3O4NA 4DFJA 1LWEA 1N33K 3J7AP 3CCSN 2RE2A 1RT2A 3IMXA 3OYGA 3WQUA 2CGJA 4CFCA 3HP9A 3UIQA 4FWNA 4BVPA 1QSYA 5KRSA 3ZSXA 4AM6A 5KPZA 2P9NB 4BQZA 3CJCA 3LP1A 2W41A 4AM7A 4LFCK 3AA2A 1DT9A 4FWSA 4B1UB 2IDOA 2HF4A 3OS2A 4OKEA 2VWBA 1M1KO 1A5WA 4CEAA 3K5NA 3TI0A 4HHTA 2A41A 2I7PA 3L4QA 5AQRA 4LF5K 4CJEA 5AZIA 3QO9A 3J7ZO 3I33A 1FXXA 3DM2A 1FKPA 1QQMA 2NRTA 3HSCA 3RVCA 1TUYA 1OVYA 3MN9A 3CFOA 1Z6RA 4X62K 4NLCA 3EY1A 3NAEA 3CIPA 2B5JA 3SQ0A 3C6HA 2KZMA 1Q8IA 3PUFA 4AHUA 3EKSA 2GBZA 3ZT3A 1X9SA 3TANA 4W5OA 1B9FA 3QEWA 1ZYQA 4CZMA 4Z4FA 4B1ZA 4BROA 3T1HK 2QXFA 3QBXA 1I94K 1WAFA 4DS4A 3MX5A 3OS1A 4B9SA 5JLHA 2OZSA 4GV9A 1O13A 4ZHRA 4FZYA 4LF9K 4NLBA 3VQ4A 3L6QA 3K9KA 3HP6A 2W6KA 1EKEA 2O8BA 1RT6A 2NZTA 3O3FA 1JXEA 1NOZA 2P9UB 1NJYA 1BU6O 5DK5A 2QWMA 2O8FA 3ITHA 3THXB 3KLGA 1BO5O 4L3QA 4CZEA 3DXKA 4CK3A 3JS6A 4FVMA 2P51A 1EX4A 3VQ8A 5AJ3K 4ISFA 2QKBA 5JLFA 3A5NC 3JSMA 4E7IA 3RRGA 5J2MA 2HSTA 3ZSVA 1RCHA 4CK1A 4DV5K 1RBTA 2PAVA 1L3SA 4CK2A 3KLEA 4Z4EA 3QFPA 3VQAA 3WXMB 4B3OA 3TAGA 2Z1HA 4XIUA 5B8HA 3TR8A 2BUPA 4BC3A 5M1NA 3AVKA 4WQ4A 3VQQA 1IBLK 3ZT1A 4CF0A 2YI1A 2O8DB 4IO9L 2Q1NA 4HWIA 4YFUA 3AA5X 4CJKA 4FOEA 3SNNA 3OY9A 1S1WA 5DM6L 1S22A 4Y1DA 1Q7YO 1KAXA 1WUAA 1RBSA 1NMDA 5I42A 1GOCA 3MK6A 3NF9A 5AQHA 1RGIA 2HOEA 4B1WB 3AVGA 3H1VX 5SZTA 2HBMA 4FK4A 1HUXA 3SBGA 1GOAA 1VRTA 3THVA 4JI2K 2EHGA 1EETA 5F2RA 1UWBA 1U2VA 2IVNA 3S9HA 2HHVA 4ELTA 3OBWA 3V1OA 3C6AA 4Z0UA 5J2NA 4K43A 4IOXA 3L2UA 4OX9K 3MEGA 2BDPA 2ZJRL 4O0IA 4OLAA 5HROA 1NBWA 1E4FT 4PKGA 2QWLA 4NCGA 4MO5A 4GV3A 3C6TA 4N47A 2WOMA 3IDHA 4OPHA 5GINA 3JXUA 3K58A 4CZLA 4FZXC 3VN5A 5AQLA 5BPMA 4FJ9A 3SJJA 3U8XA 4K42A 3PIPL 3CJ7A 4QS7A 3AVLA 2F9TA 3V9WA 4DQPA 4CCHA 2BGGA 4C8KA 3CCQN 3CF5L 1HLUA 1HNIA 1YVNA 4I2QA 3ZETA 1T7PA 3K5MA 1RDAA 3AVNA 4DSFA 1BI4A 2VGNA 3ID8A 2P9KB 4CE9A 4FLTA 2OZMA 1JLQA 4CEFA 1GLLO 3OVNA 3VEWA 1JLFA 4O4GA 2HHHK 2VWKA 3J7YP 3RSEA 1E4GT 3SV3A 5BN8A 1P8ZA 1NGBA 2P9LA 4W5RA 5AQTA 4BR0A 4JKGB 3MECA 3NGYA 3CMEN 4A57A 3U4LA 4C1NK 2ASMA 3VEZA 4I6MB 2UXBK 3LP3A 3B6PA 4U67L 2CGLA 4OKJA 2QWNA 3TPQA 1YAGA 4Z4IA 2HF3A 2KZZA 5GAHP 4A5BA 3R8EA 4BRAA 2FBTA 1YHQN 4YOVA 1RT3A 1RT4A 1VQ5N 4Z4HA 3LP0A 4DV6K 3CCVN 3LPUA 3SJHA 4JLHA 4JV5K 1VSFA 2YJFA 1SUQA 4DHYA 2NNWA 1T05A 3VA3A 5FLXO 3TSQA 4DV3K 3L2WA 3TAQA 3LM2A 2R7YA 1Q86O 4IZ9A 4B9TA 4B1VA 3K57A 4DB3A 2Q3SA 4FJXA 1DGKN 2DFHA 4CEDA 3I56N 3HM9A 3A5OC 3VGMA 2UUCK 3VQBA 1QQCA 3HYFA 4BR7A 3M8QA 4JI8K 1ITGA 1NWKA 3KIOA 4OGEA 4FO0A 3BUZB 4JD2A 3CPWM 2VQFK 2A3ZA 4CFBA 3QIPA 1SKSA 1LAWA 3CYMA 5JS2A 1JL1A 1RTJA 4CHPA 1QQNA 3L4IA 1NKBA 2JWKA 4PKHA 4W5NA 1RBUA 4CIEA 1L5UA 3C95A 3V9ZA 1JLGA 3MCPA 4BRKA 4CD3A 1D9DA 3Q7BA 4C1NI 4BGBA 2VQEK 1NJZA 4RCHA 1VQKN 1HRHA 2OTLN 2LSNA 2HNZA 3NFAA 3N4PA 1WAJA 1S1TA 4CIGA 5SWMA 1BWFO 2FBYA 4WFBL 1WN7A 3K5OA 2QKKA 4JKHA 3RR7A 2E2OA 3EZWA 1ESVA 3H6EA 4DFPA 3NH0A 4LF8K 4YOUA 3C7NA 4DTRA 4KKOA 3VF2A 4UQGA 2HVHA 3O5BA 1BDGA 2A1SA 3ZCMA 4H4OA 4RW9A 3U3YA 1HX1A 3VEXA 5LY3A 2QWOA 3C7NB 4NXMK 2P1JA 1NGHA 4RW4A 4C8OA 3U3GA 2E2PA 2ZGZA 4CJRA 4W5QA 4KHPK 2YCHA 3THYA 4DTOA 4B3TK 1VQ8N 3KWIA 4C8LA 2HHSA 4M3XA 4CEBA 1IKVA 4CEZA 1TYQA 5CZ2A 3VA0A 2QA4N 2VG5A 1U49A 3L0QA 3THYB 4M3UA 1KVAA 3TTCA 2NRWA 4AF1A 3D2EA 1QSSA 1YJWN 4CGJA 5KGWA 5DM7L 3WXIA 3M8SA 2AP1A 2O4GA 4F2SA 5LL6Z 2Y1IA 3G4SN 4JI0K 3VF4A 3J80O 4B3SK 2D0OA 4O8KA 4B9UA 2G8FA 3F9KA 4IO8A 4AHRA 4CJWA 4F3OA 2G8WA 3H3NO 3LP2A 4DV0K 1YVUA 1YJNN 2I7NA 3SI6A 3HOTA 3FLCO 5HRNA 4DQIA 4M45A 2NUBA 3TAPA 2QI2A 4K8ZA 1UAXA 3WT0A 4JI7K 4M42A 4M3WA 3H1QA 1EP4A 3V9XA 4GV6A 4HUFA 1WSJA 2ZJPL 4DV2K 4LC9B 3JYTA 3EKUA 3WQTA 1OVQA 1VSEA 4DTXA 4DUYK 1N5YA 3PSFA 3R9PA 3M6GA 1QZ5A 4OPKA 1ATSA 1V4TA 4OO1J 2QXLA 1R59O 3RMAA 3SPZA 2P9PB 1W2BM 4HVJA 3EE9A 2DFFA 3QBWA 4LY7A 4BRPA 5FPDA 2WUSA 3V1RA 4CGHA 1BA1A 2E8AA 4FJHA 4FJ7A 3ZT2A 2JLEA 5BR9A 1LW0A 4BC2A 1WLJA 4OVLA 1K9MO 3CFPA 3WNFA 1JLAA 3QB0A 1HJRA 1ZBHA 2KLAA 4B3MK 2HMIA 2PBDA 3DRSA 1VQ6N 4KH4A 2NRVA 2YHYA 3LZJA 5J1EA 4IDKA 4DR2K 1K8KB 3QFUA 2DFEA 2GV9A 3F5TA 2WC9A 2XY6A 3KLHA 3ENHA 5MLCQ 1BUPA 2NRZA 4IJAA 3LDNA 4E0DA 3DLKA 3W0LA 4G9ZA 1HYSA 3OYBA 4LF6K 1NU0A 5CR4A 3HBTA 3RTVA 3LDPA 4GY2B 4M63C 4BVOA 3NF8A 3OYKA 1YJ9N 3R3LA 3GDQA 3FZHA 3LWLA 3KKSA 4WQ4C 5CZ1A 1P90A 2D4WA 3CCJN 3HVTA 3WNEA 1O1WA 3I8BA 3CM5A 3HK2A 2Q0UA 1IKXA 3EYZA 4CJUA 3KLFA 4LH5A 1KFDA 5AR0A 2QTDA 3K9JA 1CZBA 4CZJA 4QOZB 1CLQA 3AV9A 1XNRK 3FZLA 4O55A 1TAQA 2E6LA 1S9GA 3CQXA 4FWOA 4DR3K 1UA0A 1RDCA 4B9MA 3SBTA 5C24A 1J54A 4DS5A 2IS3A 2AA4A 4BRQA 4IG0A 3LDSA 5TKWA 5BR8K 4IEIA 4RTFD 5AQPA 1VAZA 4I7FA 1ZBUA 3A0IX 2P9SB 1SL0A 5AZJB 3S3OA 5CHIA 4J2BA 4M7XA 1QHAA 2O8CB 1R0AA 1TK8A 3HSTB 3LPTA 1SV5A 3L2QA 1U4BA 3ULEA 1KD1O 1BCMA 4H0XB 2PZSA 2ZE2A 5C10A 3O4WA 3MEEA 4WF9L 4CGGA 3SUNA 1KLMA 1VSLA 1BQMA 1SKWA 2HB5A 3O9RA 4YOYA 3SLCA 4BRHA 1LWCA 3MXIA 5D3GA 3J81O 3BDPA 1GLJO 1Q9XA 2XRIA 4NB4A 5HOOA 1NGFA 4ILGB 4GVEA 3VESA 4CJ5A 5AZIB 2NRXA 1BIZA 3TTFA 4M3YA 2GELA 3K2PA 1DLOA 3DMJA 1K73O 3QLHA 4FCYA 4K8XA 4TSXA 4BR4A 3QEPA 2VCPA 2E88A 2RPIA 1K6YA 1WNSA 4EZ9A 4NYNA 1XWLA 1IKWA 1TVRA 2ZJQL 4ICLA 4JK7A 1Z26A 3LWMA 4KV8A 3CXCM 3OBYA 4BE0A 2FBVA 4RW6A 2UUAK 3OYCA 4JI5K 1MWKA 1RTHA 5BRFA 4BR9A 3CCEN 3F73A 3H3OB 1VHXA 2WBNA 3VQPA 4BQLA 4DU4A 3CJAA 3NE6A 4DMNA 3HT3A 1HNXK 2PYLA 1HNWK 1NGCA 3VERA 3E66A 4BWMA 3VEVA 3IKMA 4CJFA 3SMSA 3KK1A 3ZEUA 3P5JA 1VQNN 1D4XA 1QTMA 3CC7N 1TKXA 3QNNA 1NK6A 2ASPA 4IKFA 3VENA 1VSIA 2D0AA 3TTDA 4YY3K 4A2AA 3AVFA 5AQFA 4H0VB 4B9NA 2YHBA 3M5RA 2O8BB 1BCOA 3FFKB 2JWLA 3CCUN 4LF4K 3M8PA 3HJFA 3I0RA 1XMOK 1EWQA 4CJ4A 2O8FB 4DU1A 1VQPN 4JRQA 3CC2N 3DXKB 1KAZA 3LALA 1LAVA 3MDQA 1RILA 3CERA 2WFBA 3UKUA 4PA1A 4WQ5A 2IOCA 4DR4K 1BOTO 5A2QO 4FLWA 1KRPA 4YDUA 1NGIA 1V4SA 3WEEA 3DRRA 1HKCA 5E84A 4DTNA 4KRFA 1WBDA 4J8FA 4E7HA 4FWMA 2X6SA 1XMQK 3KVGA 4F9OA 4LH4A 2FXUA 4N76A 3CJ9A 3EEQA 2QWPA 3EZ5A 1VSMA 2AJQA 2IC3A 1IKYA 2UU9K 4O5FA 3P31A 4FM0A 1JKHA 3KLIA 3D0PA 3HM8A 1KSPA 3OHRA 4GKKK 3ATUA 3I0SA 4BRMA 5CY4A 4BRIA 2P5OA 3O3GA 2VG7A 1WSHA 3DLLL 2OPPA 3TWHA 4QS9A 1C1BA 4FL9A 3OJUA 5AFUH 1U2VB 3D2FA 4CZIA 3HO1A 3KK2A 5I9EB 5HLFA 1TKZA 2FSKA 2Y1JA 1W0HA 1S1UA 5AQXA 2WTUA 4BDPA 1Q81O 1VK0A 3HRGA 1HNZK 3VQEA 3RMDA 4A62A 2F96A 1BG3A 4ILJA 2HHQA 5IWAK 3D45A 3QEVA 2E1YA 3AA4A 2VGMA 3T3FA 4EP4A 4E7KA 3VQ9A 2BH1A 1IO2A 3FZKA 4FW2A 3TU5A 3ENBA 3O8MA 1XI1A 4O8UA 1G99A 4M3RA 4DTPA 2IIRA 3SUPA 3L3UA 5HP1A 2W6LA 4H5NA 4N56A 4CGDA 3LL3A 3ZETB 3BZCA 5HRRA 3GBTA 4FJKA 1BI4B 1S6QA 4LSNA 1N34K 4HCBA 4XH5A 4Y0WA 1IBKK 3H45C 4MLEA 1DKGD 1RT1A 3ZT4A 1TUUA 3U6FA 3CQYA 3DLEA 3RSEB 2HNDA 1QS4A 2HMPA 3MCAB 4RG8A 1BISA 4NCAA 2P9LB 3IRXA 4B8AB 2E20A 1JCEA 4O0JA 2YNGA 1C0MA 5LMNK 4PY5A 3QNOA 4CJPA 1F21A 1SL1A 4ILHA 3CHWA 5JVHL 3GE1A 4B1XB 1T03A 3ZLJA 4JHDA 2D0PA 1HPMA 4AHTA 4JKEA 3G0ZA 5AQSA 4DTSA 3HZ6A 5BPLA 4K41A 1SQKA 4JHDB 2O4IA 1TKTA 2FC0A 4M41A 2X78A 4KI4A 4C8MA 4H4MA 1RT7A 1ILYA 1S6PA 1GLBG 3TSUA 1YT3A 2V7ZA 2D1KA 4BG9A 3PX6A 4E7LA 2A1RA 4OPJA 4AHVA 3VOVA 4PQUA 3DXMA 2KHOA 3MWPA 5M1PA 2O8EA 2QW9A 2Z1IA 3RWUA 3VQCA 4W5TA 4BDYA 2HHUA 2VG6A 1N6QA 3M8RA 1GLDG 1TL1A 3KD1E 1RDDA 1XQSC 3J8AA 2GEMA 4JD2B 4JKBA 3FFIA 1LCUA 3C65A 5HL7L 3BF1A 5AQGA 1RFQA 4WCEL 4KFBA 1X9MA 3O3HA 4E3SA 2Q31A 2HHXA 3HL8A 3HOSA 3E01A 3A5MC 2P9IA 3ZSQA 4DG1A 4KREA 3HXMA 4DV1K 4CGIA 4KHWA 3AAQA 3U9DA 1VRUA 4CW7B 4KAZA 4BR2A 3OYFA 1NOYA 4B9LA 3VPZA 5JS1A 2YHXA 4CFAA 3SCXA 3HTVA 2OANA 1RT5A 5EU7A 1N8RO 3VGKA 4JN4A 2A5XA 2IGIA 2F7TA 3FR0A 3P38A 4IWVA 3TAMA 4YNQA 4FVUA 5BREA 1D8YA 4XH4A 1IH7A 3CC4N 3QIOA 2YNHA 2QM1A 3AGRA 3HPOA 3UKRA 4GW6A 1QVFM 5BRHA 4JK9A 4H5RA 3S41A 3KHYA 3CJBA 1I3AA 1J6ZA 3RRHA 4I2PA 4IBNA 2HBJA 3ISNC 2Z1JA 2OPQA 4MLHA 2E6MA 1TYQB 1D9FA 3VQ6A 1TK5A 4LF7K 3OYHA 4OGCA 2E1ZA 3GG4A 3IFRA 3D2EB 3U9ZA 3QINA 3E1YA 2Q36A 3R6MA 1D5AA 3AVIA 1W9HA 2ITGA 4BRNA 1B92A 3PSIA 4FLUA 4CF9A 4BREA 3V1QA 1ZBFA 5FPMA 4JEPA 3O9QA 1NKEA 3PIOL 3T1YK 2UUBK 3K5LA 1HYZA 2D0CA 5I3UA 3DYAA 2OPSA 5BPNA 4HTLA 2V52B 4JKFA 5E26A 1NK8A 3AARA 4J2AA 3FZMA 2G8KA 1MU2A 2DTUA 4DTUA 2OA8A 4CHYA 2OYQA 1QE1A 2G8HA 4KHUA 3QERA 2PYJA 1RDWX 3MX2A 4FXDA 2YV0X 4AHCA 4BACA 5E41A 4CJVA 4FJGA 4YORA 1RDBA 4FLZA 4GMJB 3SZ2A 5LJVA 3MN5A 1QZ6A 1KXPA 1Y97A 1KLNA 4NCBA 4DU3A 3Q7CA 1ZBSA 1U45A 2KFNA 1KTQA 1T6DA 3VQ7A 4CIFA 3PLAA 1Z25A 4MFBA 4A5AA 3SV4A 3C94A 2XO7A 5EXWA 3ZSOA 2VYPA 4JYAK 5GAEP 4YOWA 3G10A 2QEXN 1NGEA 4CBWA 4Z4GA 3IS9A 4PHTX 1SS6A 3BP8A 4KHQA 4F2RA 5M1FA 1NGDA 3MEDA 4QAGA 1FW6A 4N5SA 4BC4A 1KC8O 2DY4A 1X3NA 1H1VA 4CEOA 4IG3A 1FJGK 2Q0RA 4ID1A 4IOAL 3VETA 3V81A 4Q0BA 4K0KK 5AFUA 3O9TA 1XHZA 1NLVA 1YIJN 4WE1A 3OYIA 3G6EN 3OYNA 1X9WA 1Q82O 3CCRN 4CGFA 3SQ4A 1JCGA 5GIOA 4F3TA 1NJIO 3THWA 3TAFA 4BC5A 1WBBA 4RW7A 2JGUA 3KJVA 4F4KA 2YHAA 3DRPA 1RBVA 1HQUA 2ETJA 3PX0A 3B8AX 4BRCA 3C0BA 4K25A 5KGXA 4DQQA 2PFUA 4WQ5C 4ELUA 3NBPA 4GNIA 1IV0A 5KI6A 4YDUC 4DLGA 1IG8A 1C1AA 3OYLA 1HNVA 5KQDA 2CH6A 3LANA 4DCHA 3DLGA 3OW2M 3ZSYA 2NRHA 4MDAA 1WSEA 1XHXA 3SAGA 1VQON 4LFBK 1TK0A 4G1QA 4EZ6A 3OTOK 3QMLA 1EXQA 5AQMA 3FGUA 4PL7A 3HPGA 3VTIA 1YI2N 5JMVA 4CBXA 3DWLA 4B08A 1L3UA 1QSLA 3SK3A 2ZGYA 2YNFA 1LV5A 2P5GA 3LDLA 2BTFA 4ZTFA 1S3XA 1NK5A 3S3NA 1ZBIA 4DQRA 3NCIA 1VQ9N 1DEJA 3A2FA 2HHWA 1MA9B 2UXDK 1Q9YA 1Y64A 5FRMA 4FK2A 2X74A 4FZZA 3NMUA 3LDQA 3PV8A 5AQQA 3T7ZA 1VQ7N 4BE2A 1TGOA 2E5LK 4CJSA 3I55N 3E9PA 2HW3A 1G15A 3SAFA 2F8SA 4X66K 1HMVA 4E1MA 2WONA 2P9NA 1NGJA 4IFEA 5CYQA 5AQJA 3O08A 2ZD1A 1YITN 5FRNA 1JLBA 3ZX3A 4PL8A 4FLYA 1XC3A 3O9UA 1YXQA 1C0TA 2GUIA 2W42A 3ULEB 4PKIA 3A8YA 1ATNA 5F1XA 3F2KA 5AQKA 4CD1A 5KRTA 1A5XA 4GVMA 1NK7A 4B3RK 3VGLA 2PY5A 5AQIA 1BL3A 5EOYA 5C15A 4CECA 3WNGA 3AA3A 4CZHA 1U47A 2V7YA 3EL2A 1YTAA 4KH5A 1U48A 1TL3A 2GWKA 1KVCA 2CGKA 2QWRA 5BN9A 3OYAA 4DLEA 3IUCA 4GKJK 4B9VA 4BRDA 3NH2A 3SQ1A 1C1CA 1IBMK 3AVAA 3NF6A 3OYMA 4FM2A 3L2RA 1KAYA 1JLEA 3O4QA 5FDLA 5C12A 5ADXH 1J5OA 5TKYA 4CZKA 4Q5VA 4XEIA 4KHSA 3L2VA 5J2QA 4FSVA 3ZSZA 3R1XA 1RTIA 2ZF5O 4AH9A 2A6AA 4MDBA 3ZYYX 1CZAN 4EHUA 1NJXA 1C0FA 3AVMA 3FE1A 2FF6A 2E2QA 2YJEA 4KHNA 4JNEA 1C0GA 4DR1K 1L3VA 1HKGA 4I9LA 3KTQA 3L3VA 1ZBLA 4DUZK 4YOXA 3FZFA 1CZ9A 1J53A 3TABA 2OCEA 3KK7A 4FLXA 3O6WA 1KCFA 4KB1A 4CJLA 3K59A 2F9WA 2UYTA 4CHOA 4YHHK 3ZEUB 2A40A 4ID5A 4NXNK 4CJ7A 1QHTA 1MDUB 2GUPA 1DTQA 3OA9A 2P9UA 2XY8A 1SKRA 4KH6A 1SZ2A 3THXA 1NM1A 3CD6N 4U7BA 2G8IA 1WB9A 4KBOA 3LAMA 1OH7A 3MXMA 4CHNA 1OH5A 3D6RA 3P83D 1EO1A 3QESA 3UE5A 1J9AA 4CZGA 1Z05A 4AILC 1NJWA 1JL2A 3WNHA 4M7YA 4N41A 2B4JA 3UKUB 1RBRA 2D5RA 3HPHA 5AQWA 3SQ2A 4KTWA 4KTQA 3E9LA 3CQ8A 2O8DA 3WEEB 4IJNA 1T44A 3ID6A 3O9SA 3ZSWA 3QEXA 4KTZA 1VSJA 1RDUA 4WYBA 5CYMA 4FJ8A 3LM9A 3TAEA 4O44A 5M1QA 2VWJA 4Y1CA
chains in the Genus database with same CATH topology
2QI2A 3TSUA 2V7ZA 2D1KA 3WT0A 4BG9A 3IMXA 3WQUA 2CGJA 3H1QA 4FWNA 1X3MA 4BVPA 4GV6A 4QS8A 3NVKA 5ELZA 3VOVA 4AM6A 5KPZA 2P9NB 2KHOA 3DXMA 4LC9B 3EKUA 4BQZA 2ZJPL 2FF3B 3CJCA 1ZXOA 4IXCA 2W41A 3MWPA 5M1PA 3WQTA 4AM7A 4UY8O 2QW9A 1DT9A 4NO7A 1HJOA 4FWSA 4B1UB 3R9PA 3M6GA 4BRFA 1QZ5A 2HF4A 2IVOA 1ATSA 1V4TA 2YX6A 1GLDG 4FWKA 4OO1J 4DKWA 1XQSC 2VWBA 2QXLA 1R59O 3J8AA 3MWTA 4BGAA 1M1KO 2GEMA 4JD2B 2P9PB 4JKBA 1LCUA 2A41A 1W2BM 2I7PA 3C65A 3D2FB 3BF1A 3EE9A 3L4QA 5AQGA 5AQRA 5HL7L 1RFQA 4WCEL 5AZIA 2Q31A 4Z94A 3J7ZO 3QBWA 3I33A 4BRPA 5FPDA 2WUSA 2IVPA 3HOSA 1BA1A 1ATRA 2E8AA 4FWRA 1QQMA 2NRTA 2P9IA 3A5MC 3HSCA 1TUYA 3RVCA 5BR9A 4BC2A 1OVYA 3MN9A 1K9MO 2CH5A 1Z6RA 3N4QA 4NLCA 3QB0A 3AAQA 3CIPA 3U9DA 3VTHA 2KLAA 3C6HA 2PBDA 3VMFB 4BR2A 5M1KA 4EFHA 1VQ6N 3EKSA 5KPTA 4FWLA 3G71N 4KH4A 3VPZA 4EAHD 2NRVA 2YHXA 1LOTB 2YHYA 3HTVA 2OANA 1N8RO 3VGKA 5KQ8A 4A61A 3HI0A 1QVGM 4JN4A 2A5XA 1K8KB 1U6ZA 3QFUA 4CZMA 3F5TA 4B1ZA 2WC9A 2F7TA 3FR0A 2FSJA 3P38A 4BROA 4IWVA 2P9KA 3QBXA 3ENHA 4A59A 5MLCQ 2ITMA 2W40A 1BUPA 2NRZA 4FVUA 4IJAA 3LDNA 3SMPA 5BREA 3MX5A 3VF6A 2A42A 4XH4A 5FPEA 3W0LA 4G9ZA 3CC4N 5JLHA 4C23A 5CR4A 3HBTA 4GV9A 2QM1A 3LDPA 1O13A 3AGRA 4GY2B 4M63C 3UKRA 1QVFM 3CETA 5BRHA 4BVOA 1XUPO 4JK9A 4JKAA 4H5RA 4BRLA 4NLBA 3S41A 3L6QA 4JKGA 3KHYA 1YJ9N 3K9KA 1VQMN 3KZBA 3R3LA 3CJBA 4H03B 3GDQA 1VQLN 5LJWA 1JCFA 3FZHA 3WXJA 1J6ZA 2NZTA 4I6MA 3ENOA 4WQ4C 1VQ4N 1P90A 2D4WA 2HBJA 2P9UB 1BU6O 3M1FA 2QWMA 3CCJN 4MLHA 5AQOA 1TYQB 3P39A 1BO5O 4L3QA 4CZEA 3I8BA 3DXKA 2Q0UA 3JS6A 2E1ZA 3GG4A 5AR0A 2E2NA 5BRDA 3IFRA 4WFNL 2QTDA 3K9JA 3ATVA 3D2EB 3U9ZA 4CZJA 3E1YA 2Q36A 4ISFA 1YITN 2GWJA 3R6MA 1OKJA 5JLFA 3FZLA 5GADP 3A5NC 3CJ1A 4BRNA 2HSTA 3NVMA 3CQXA 4FWOA 1SAZA 4WFAL 3SBTA 2PAVA 4BREA 5KPRA 3QFPA 1S72N 2NLXA 3WXMB 2AA4A 5FPMA 3BEXA 4JEPA 4BRQA 1M90O 3AAPA 3O9QA 5B8HA 3PIOL 2BUPA 4BC3A 1HKBA 5M1NA 2NRRA 4WQ4A 5TKWA 5C2DA 4IEIA 4RTFD 5AQPA 2YI1A 3DJCA 3G25A 5BPNA 4HTLA 1VAZA 2V52B 4JKFA 2Q1NA 4HWIA 5E26A 4IO9L 3A0IX 3AARA 5AQUA 2P9SB 5CE3A 3FZMA 5AZJB 4EIAA 5CHIA 4FOEA 4M7XA 1QHAA 3M3ZA 5DM6L 1S22A 1Q7YO 1KAXA 1WUAA 1NMDA 3QICA 3WXKA 1RDWX 2HBLA 1NGAA 3MX2A 4JKCA 3MK6A 5AQHA 4R79A 1RGIA 1W97L 2HOEA 4B1WB 2DPNA 3H1VX 3ULEA 2HBMA 1KD1O 4H0XB 1HUXA 3SBGA 4YORA 3DXMB 5C10A 4BG8A 3O4WA 5F2RA 5LJVA 3MN5A 4WF9L 1QZ6A 1U2VA 1KXPA 2IVNA 5EVZA 1X9JA 3OBWA 3Q7CA 1ZBSA 1T6DA 3C6AA 4K43A 4IOXA 3PLAA 3O9RA 4A5AA 4YOYA 3SLCA 3AY9A 5AQYA 4BRHA 4JK8A 5EXWA 2ZJRL 2VYPA 5GAEP 1NBWA 1GLJO 3SAHA 1E4FT 4NB4A 2QWLA 4PKGA 5GAGP 1NGFA 5HOOA 4YOWA 4MO5A 2QEXN 4GV3A 4ILGB 4GVEA 3VESA 3QDKA 1NGEA 5AZIB 4CBWA 2NRXA 3TTFA 5H1SQ 5JICA 2GELA 4PHTX 3IDHA 4OPHA 5GINA 1SS6A 3JXUA 3BP8A 2P9IB 4CZLA 1K73O 5M1FA 5BPMA 5AQLA 4BR4A 1NGDA 4H5TA 1BA0A 2VCPA 4BC4A 5GIPA 2E88A 3UB5A 2Q2RA 4JKDA 4XH1A 1KC8O 1X3NA 1H1VA 3U8XA 5EX5A 3CI5A 4K42A 3PIPL 3CJ7A 3KWGA 4QS7A 2F9TA 2Q0RA 2ZJQL 4IOAL 2ASOA 4JK7A 4E1JA 3CXCM 3VETA 3OBYA 2J4RA 3O9TA 5AFUA 1NLVA 3CCQN 4A2BA 1YIJN 3CF5L 1HLUA 1MWKA 1YVNA 4BR9A 5BRFA 3CCEN 3ZETA 3WXLA 3H3OB 3G6EN 2WBNA 4BQLA 1Q82O 3LDOA 3CJAA 2VGNA 3CCLN 3ID8A 2P9KB 1NGCA 3CCRN 3VERA 1JCGA 1GLLO 5GIOA 1NJIO 3BF3A 3E66A 1MWMA 3VEVA 3IKMA 4YOTA 3VEWA 4BC5A 4CZFA 4BY9C 3GL1A 3SMSA 4B9QA 3ZX2A 3B8AX 1E4GT 3RSEA 3ZEUA 1NGGA 4BRCA 4EHTA 3C0BA 3MN7A 1D4XA 1VQNN 4K25A 5BN8A 2HBKA 1P8ZA 1NGBA 2P9LA 2PFUA 5ADXA 3CC7N 4H5VA 4WQ5C 3UKRB 5AQTA 2ASPA 4GNIA 3VENA 4YDUC 4BR0A 1IG8A 4JKGB 3TTDA 4BR5A 4A2AA 3CMEN 1GLAG 4A57A 5KQDA 3U4LA 4C1NK 2CH6A 4H0VB 5AQFA 2ASMA 3M5RA 3WUHA 4DCHA 3FFKB 3VEZA 2JWLA 4H5WA 4I6MB 2EWSA 3CCUN 2NRHA 5C2FA 4MDAA 3SAGA 3OW2M 5AQNA 4U67L 2CGLA 1VQON 2QWNA 3TPQA 3QMLA 1JJ2M 1YAGA 3CMAN 4H0YB 2HF3A 3VEYA 5AQMA 1VQPN 1Q18A 3FGUA 4A5BA 5GAHP 4PL7A 3DXKB 3CC2N 3R8EA 4BRAA 3VTIA 1YI2N 1KAZA 5JMVA 4CBXA 3DWLA 1YHQN 5EY4A 4DQ8A 3MDQA 3SK3A 2ZGYA 3CPEA 4YOVA 3LDLA 2KKZA 2BTFA 3CERA 1S3XA 2WFBA 4H0OA 3UKUA 1VQ5N 4WQ5A 1WOQA 1BOTO 3CCVN 1VQ9N 1DEJA 3SJHA 4YDUA 1NGIA 1MA9B 1V4SA 3WEEA 1HKCA 5E84A 3D7EO 1Y64A 4J8FA 2YJFA 4FWMA 1KQSM 3NMUA 4DHYA 3KVGA 4F9OA 2NNWA 3LDQA 2FXUA 5AQQA 3TSQA 3CJ9A 4IOCL 4B1YB 4FWPA 3T7ZA 1VQ7N 3LM2A 1Q86O 2QWPA 4IZ9A 3I55N 3TSPA 3E9PA 2GX9A 4B1VA 3SAFA 2GTDA 1T6CA 4DB3A 1DGKN 3MMVA 1QQOA 2P9NA 1EQYA 1NGJA 3P31A 3O08A 4IFEA 4O5FA 5AQJA 5M1OA 3T69A 3HM8A 5FPNA 3ZX3A 1GLCG 3I56N 3A5OC 4PL8A 1XC3A 3OHRA 3O9UA 3ATUA 3VGMA 1YXQA 5AQVA 4ISGA 3ULEB 4PKIA 3A8YA 4BRMA 1ATNA 3E9OA 4BRIA 3F2KA 5AQKA 4BR7A 1NWKA 4CD1A 5F1XA 3W3DA 3DLLL 4FO0A 3BUZB 4JD2A 3CPWM 2P9PA 4QS9A 2A3ZA 4FL9A 4FWQA 5AFUH 1U2VB 3D2FA 3VGLA 2FLOA 4CZIA 3H46O 5I9EB 2FSKA 5AQIA 5EOYA 5C15A 3EN9A 1QQNA 5F0XA 3L4IA 4CZHA 4JAXA 5AQXA 2JWKA 2V7YA 3EL2A 4PKHA 3CCMN 4KH5A 2V51B 2GWKA 1Q81O 3HRGA 2CGKA 2QWRA 5BN9A 3IUCA 3MCPA 4A62A 1BG3A 4BRDA 4ILJA 4BRKA 4CD3A 3VEOA 3Q7BA 4C1NI 4BGBA 3DAWA 4ISEA 1IJJA 4RCHA 1VQKN 1KAYA 2OTLN 1K8AO 3N4PA 2E1YA 5ADXH 5C12A 5TKYA 1GLFO 2VGMA 4CZKA 4XEIA 2ZWHA 4FSVA 2BH1A 3R1XA 2Q97A 1BWFO 2ZF5O 3FZKA 4H0TB 2A6AA 4MDBA 3TU5A 1K8KA 3ZYYX 3ENBA 1CZAN 3O8MA 4WFBL 4RWTA 4O8UA 4EHUA 1G99A 3GOIA 1C0FA 4H0PA 2IIRA 4JKHA 2E2OA 3FE1A 3EZWA 1ESVA 2FF6A 2E2QA 2YJEA 4H5NA 4JNEA 3H6EA 3MN6A 4BRGA 5C0YA 1C0GA 4YOUA 1HKGA 3C7NA 4FPAA 3O1BA 3VF2A 3LL3A 3ZETB 3O5BA 1BDGA 3GBTA 4IDHA 4CI6A 2QWQA 4XH5A 1HX1A 4FPBA 3FZFA 4YOXA 3VEXA 4Y0WA 5LY3A 3H45C 4MLEA 3KK7A 2QWOA 3C7NB 1DKGD 3O6WA 1NGHA 2YHWA 1TUUA 2F9WA 2UYTA 3CQYA 3EO3A 3RSEB 4CBUA 3ZEUB 2A40A 2E2PA 2ZGZA 4CJ7A 2HMPA 2YCHA 3MCAB 1MDUB 2GUPA 2P9LB 2OTJN 1VQ8N 3KWIA 2E20A 3OA9A 2P9UA 3F9MA 4KH6A 1SZ2A 3ZX0A 4FOIA 1NM1A 3A5LC 1TYQA 4U7BA 3CD6N 1JCEA 2QA4N 1YUWA 3L0QA 4KBOA 2RHKA 2H3GX 3TTCA 2NRWA 3O1WA 4AF1A 3D2EA 3D6RA 1YJWN 4ILHA 3CHWA 5JVHL 5DM7L 3GE1A 1ZC6A 3WXIA 4B1XB 1EO1A 3EE8A 3UE5A 2AP1A 4JHDA 2D0PA 4CZGA 1YF5L 1Z05A 1HPMA 1GLEG 4IEEA 3AGKA 3G4SN 4JKEA 4M7YA 3P4IA 3VF4A 1T3VA 5AQSA 3HZ6A 2D0OA 3UKUB 5AQWA 5BPLA 4K41A 4O8KA 5JVGL 1SQKA 4MO4A 4JHDB 3E9LA 4IO8A 3WEEB 4IJNA 5AQZA 1T44A 2P9SA 3ID6A 3H3NO 3O9SA 5AZJA 1RDUA 2FSNA 3O80A 4WYBA 1YJNN 2I7NA 3HOTA 4OPAA 3FLCO 1ILYA 3LM9A 5M1QA 1GLBG 3CCSN 2RE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MDB A;  3K9K A;  4U7B A;  5HOO A;  3HOT A;  3K9J A;  4MDA A;  4R79 A;  3HOS A;  5CR4 A;  2F7T A;  3F2K A; 
#chains in the Genus database with same CATH topology
 1ASW A;  1ASU A;  1RNH A;  3VQ5 A;  1LWF A;  1X3M A;  4OLB A;  4QS8 A;  2IAJ A;  3NVK A;  5ELZ A;  3P1G A;  4DV4 K;  4IFY A;  1XC9 A;  4M3T A;  1NNE A;  2FF3 B;  1ZXO A;  4IXC A;  4RW8 A;  4AHS A;  4UY8 O;  4H8K A;  3BGR A;  3BZK A;  3SUO A;  4X65 K;  4NO7 A;  1HJO A;  2RF2 A;  3BY5 A;  4FYD A;  4BRF A;  1OH8 A;  3AVB A;  2IVO A;  2YX6 A;  4FWK A;  1JXB A;  4DKW A;  4BGA A;  3MWT A;  1J5E K;  2G8U A;  5HBM A;  3D2F B;  3DLR A;  4CHQ A;  4KB0 A;  4Z94 A;  1CXQ A;  2IVP A;  1C0U A;  1ATR A;  4FWR A;  1SL2 A;  2YKN A;  5FRO A;  3RMC A;  3RMB A;  1C6V A;  3NHG A;  2CH5 A;  3N4Q A;  2RN2 A;  3VTH A;  2Z1G A;  3LAK A;  4JI1 K;  5IT9 O;  3VMF B;  5M1K A;  3AO3 A;  4EFH A;  5KPT A;  4FWL A;  3G71 N;  3SPY A;  4EAH D;  4FJJ A;  3DLH A;  1LOT B;  4HCC A;  3OS0 A;  5KQ8 A;  4A61 A;  3HI0 A;  1QVG M;  1U6Z A;  4PUO A;  3OYJ A;  4HUE A;  2FSJ A;  3OYD A;  2P9K A;  4DSJ A;  4JRP A;  4A59 A;  2ITM A;  3CFR A;  4FJM A;  3NGI A;  2W40 A;  2KQ2 A;  4AQY K;  1E3M A;  3SMP A;  3VF6 A;  2A42 A;  4J2D A;  5FPE A;  1BIU A;  3HVR A;  4C23 A;  4O5B A;  4DR5 K;  1NK9 A;  4FJ5 A;  1VSH A;  4E19 A;  4CJQ A;  3CET A;  1S1X A;  1XUP O;  4JKA A;  4BRL A;  4JKG A;  1VQM N;  3KZB A;  4H03 B;  3AO4 A;  1VQL N;  5LJW A;  4CFD A;  1JCF A;  3WXJ A;  3H08 A;  1UA1 A;  3NF7 A;  4I6M A;  3ENO A;  1VQ4 N;  4IFV A;  1CXU A;  3M1F A;  3VQD A;  4J2E A;  4DFK A;  4FK0 A;  5AQO A;  4ELV A;  3P39 A;  4DF8 A;  1REV A;  4KO0 A;  5BRD A;  4WFN L;  2E2N A;  4CEQ A;  3ATV A;  3PX4 A;  1NK4 A;  4FW1 A;  2GWJ A;  1OKJ A;  5GAD P;  2BE2 A;  3CG7 A;  3CJ1 A;  3NVM A;  3AO2 A;  4C8N A;  4I9Q A;  4WFA L;  1SAZ A;  1HQE A;  1JLC A;  3ULD A;  1U04 A;  1UOC A;  5KPR A;  1NK0 A;  1TKD A;  1S72 N;  2NLX A;  2KW4 A;  3BEX A;  3QET A;  1M90 O;  3AAP A;  4E89 A;  1HKB A;  2NRR A;  5C2D A;  3NGZ A;  3T19 A;  3RR8 A;  1W7A A;  4DSL A;  3DJC A;  3G25 A;  2F4V K;  1VSK A;  4CER A;  5AQU A;  5CE3 A;  1XNQ K;  4EIA A;  4CF2 A;  2KTQ A;  3M3Z A;  1S9E A;  3QIC A;  3WXK A;  2HBL A;  3AVC A;  1NGA A;  4JKC A;  3JAM O;  4R79 A;  2RKI A;  1W97 L;  2DPN A;  4JI4 K;  3DLB A;  4KI6 A;  4CVN E;  4NYF A;  4LD0 A;  3DXM B;  4BG8 A;  5C25 A;  5J2P A;  2O8E B;  5EVZ A;  1X9J A;  4KHY A;  3I8D A;  3AY9 A;  5AQY A;  4JK8 A;  4JI3 K;  1BQN A;  1YTU A;  3AVH A;  1T8E A;  2FBX A;  3SAH A;  5GAG P;  2XY7 A;  5LMU K;  3QDK A;  3NH1 A;  4FJI A;  4DQS A;  5H1S Q;  5JIC A;  2P9I B;  3V4I A;  4M3Z A;  1A5V A;  4X64 K;  4H5T A;  1BA0 A;  4QCL A;  5GIP A;  3UB5 A;  2Q2R A;  4JKD A;  4XH1 A;  5EX5 A;  3CI5 A;  3AO1 A;  3S3M A;  3KWG A;  2ASO A;  4OJR A;  4E1J A;  1N36 K;  3C6U A;  1FKO A;  2XHB A;  4DSK A;  3V9S A;  1X1P A;  2J4R A;  4A2B A;  3ASM A;  4HUG A;  3WXL A;  3LDO A;  4DV7 K;  3CCL N;  3QEI A;  3V6D A;  3SYZ A;  3BF3 A;  4JI6 K;  4JS4 A;  1MWM A;  4YOT A;  4CZF A;  4BY9 C;  3GL1 A;  4B9Q A;  3ZX2 A;  3SUQ A;  3DI6 A;  1NGG A;  4EHT A;  3MN7 A;  2HBK A;  2XY5 A;  5ADX A;  4H5V A;  3UKR B;  1BHL A;  4B8C A;  4BR5 A;  1N32 K;  2EX3 A;  1GLA G;  3WUH A;  4F8R A;  4H5W A;  2EWS A;  5C2F A;  5AQN A;  4E7J A;  2UXC K;  1JJ2 M;  3CMA N;  3ZSR A;  1LW2 A;  4H0Y B;  3VEY A;  1Q18 A;  4FJN A;  2KFZ A;  3B6O A;  3L8B A;  4CES A;  1WSI A;  5EY4 A;  4DQ8 A;  3CPE A;  4CJ3 A;  2KKZ A;  1EWR A;  3CM6 A;  4H0O A;  1WSF A;  2HVI A;  1WOQ A;  1TAU A;  3KK3 A;  3OYE A;  3T1A A;  4CF8 A;  3D7E O;  2D0B A;  3V9U A;  1DTT A;  4CHZ A;  1I39 A;  1HYV A;  4DSI A;  3K0S A;  4DSE A;  1KQS M;  2BAN A;  4IOC L;  4B1Y B;  4FWP A;  2E4L A;  3TSP A;  2GX9 A;  3AO5 A;  2GTD A;  1T6C A;  4FM1 A;  5DMR A;  3MMV A;  5T7B A;  1QQO A;  1EQY A;  1RTD A;  5M1O A;  3T69 A;  1KVB A;  5FPN A;  1GLC G;  4DR7 K;  1GOB A;  4DF4 A;  5AQV A;  4ISG A;  3E9O A;  2OPR A;  3W3D A;  2F8T A;  2I5J A;  2P9P A;  1WSG A;  2QK9 A;  4EP5 A;  4FWQ A;  3OJS A;  1NMN A;  2FLO A;  3H46 O;  3IG1 A;  1ASV A;  1VSD A;  3EN9 A;  5F0X A;  1IG9 A;  4JAX A;  3CCM N;  3ZT0 A;  2V51 B;  4Z4C A;  3MAQ A;  4LFA K;  3VEO A;  3DAW A;  4ISE A;  1IJJ A;  5C42 A;  4R5P A;  1K8A O;  1GLF O;  1FK9 A;  4KPY A;  3AVJ A;  3DOL A;  2ZWH A;  3MXJ A;  2Q97 A;  4H0T B;  1K8K A;  4RWT A;  3GOI A;  4H0P A;  4OKK A;  4E1N A;  3IAY A;  4JS5 A;  2ZQB A;  4LSL A;  3KD5 E;  2B6A A;  4BRG A;  3MN6 A;  5K14 A;  4CF1 A;  5C0Y A;  4L8R B;  3TAR A;  4FPA A;  3O1B A;  3NDK A;  4DTM A;  4ZTJ A;  2ATQ A;  3ALY A;  2ZM6 K;  1TV6 A;  4IDH A;  4CJT A;  4CI6 A;  2QWQ A;  4FPB A;  5KTQ A;  4V19 S;  4CEE A;  3THW B;  4DR6 K;  3PO4 A;  2YHW A;  2YKM A;  3EO3 A;  4CBU A;  2YNI A;  1S5J A;  4FLV A;  2G8V A;  2OTJ N;  1BGX T;  1L3T A;  3F9M A;  4PWD A;  3ZX0 A;  1KFS A;  4FOI A;  3A5L C;  4DTJ A;  1YUW A;  2RHK A;  2HNY A;  2H3G X;  2X6N A;  5HRP A;  3O1W A;  3DOK A;  4BWJ A;  3PO5 A;  4BDZ A;  1ZC6 A;  3EE8 A;  5HRS A;  4DFM A;  3PY8 A;  1YF5 L;  4DWI A;  1B9D A;  1GLE G;  4IEE A;  3AGK A;  2HHT A;  1NKC A;  3KKR A;  3P4I A;  1T3V A;  4BE1 A;  1OH6 A;  5JVG L;  1S1V A;  4MO4 A;  4FJL A;  1HPZ A;  5AQZ A;  2P9S A;  1HR0 K;  5AZJ A;  3LZI A;  4HTU A;  2FSN A;  3O80 A;  4MQ3 A;  4OPA A;  1NG9 A;  2O8C A;  3O4N A;  4DFJ A;  1LWE A;  1N33 K;  3J7A P;  3CCS N;  2RE2 A;  1RT2 A;  3IMX A;  3OYG A;  3WQU A;  2CGJ A;  4CFC A;  3HP9 A;  3UIQ A;  4FWN A;  4BVP A;  1QSY A;  5KRS A;  3ZSX A;  4AM6 A;  5KPZ A;  2P9N B;  4BQZ A;  3CJC A;  3LP1 A;  2W41 A;  4AM7 A;  4LFC K;  3AA2 A;  1DT9 A;  4FWS A;  4B1U B;  2IDO A;  2HF4 A;  3OS2 A;  4OKE A;  2VWB A;  1M1K O;  1A5W A;  4CEA A;  3K5N A;  3TI0 A;  4HHT A;  2A41 A;  2I7P A;  3L4Q A;  5AQR A;  4LF5 K;  4CJE A;  5AZI A;  3QO9 A;  3J7Z O;  3I33 A;  1FXX A;  3DM2 A;  1FKP A;  1QQM A;  2NRT A;  3HSC A;  3RVC A;  1TUY A;  1OVY A;  3MN9 A;  3CFO A;  1Z6R A;  4X62 K;  4NLC A;  3EY1 A;  3NAE A;  3CIP A;  2B5J A;  3SQ0 A;  3C6H A;  2KZM A;  1Q8I A;  3PUF A;  4AHU A;  3EKS A;  2GBZ A;  3ZT3 A;  1X9S A;  3TAN A;  4W5O A;  1B9F A;  3QEW A;  1ZYQ A;  4CZM A;  4Z4F A;  4B1Z A;  4BRO A;  3T1H K;  2QXF A;  3QBX A;  1I94 K;  1WAF A;  4DS4 A;  3MX5 A;  3OS1 A;  4B9S A;  5JLH A;  2OZS A;  4GV9 A;  1O13 A;  4ZHR A;  4FZY A;  4LF9 K;  4NLB A;  3VQ4 A;  3L6Q A;  3K9K A;  3HP6 A;  2W6K A;  1EKE A;  2O8B A;  1RT6 A;  2NZT A;  3O3F A;  1JXE A;  1NOZ A;  2P9U B;  1NJY A;  1BU6 O;  5DK5 A;  2QWM A;  2O8F A;  3ITH A;  3THX B;  3KLG A;  1BO5 O;  4L3Q A;  4CZE A;  3DXK A;  4CK3 A;  3JS6 A;  4FVM A;  2P51 A;  1EX4 A;  3VQ8 A;  5AJ3 K;  4ISF A;  2QKB A;  5JLF A;  3A5N C;  3JSM A;  4E7I A;  3RRG A;  5J2M A;  2HST A;  3ZSV A;  1RCH A;  4CK1 A;  4DV5 K;  1RBT A;  2PAV A;  1L3S A;  4CK2 A;  3KLE A;  4Z4E A;  3QFP A;  3VQA A;  3WXM B;  4B3O A;  3TAG A;  2Z1H A;  4XIU A;  5B8H A;  3TR8 A;  2BUP A;  4BC3 A;  5M1N A;  3AVK A;  4WQ4 A;  3VQQ A;  1IBL K;  3ZT1 A;  4CF0 A;  2YI1 A;  2O8D B;  4IO9 L;  2Q1N A;  4HWI A;  4YFU A;  3AA5 X;  4CJK A;  4FOE A;  3SNN A;  3OY9 A;  1S1W A;  5DM6 L;  1S22 A;  4Y1D A;  1Q7Y O;  1KAX A;  1WUA A;  1RBS A;  1NMD A;  5I42 A;  1GOC A;  3MK6 A;  3NF9 A;  5AQH A;  1RGI A;  2HOE A;  4B1W B;  3AVG A;  3H1V X;  5SZT A;  2HBM A;  4FK4 A;  1HUX A;  3SBG A;  1GOA A;  1VRT A;  3THV A;  4JI2 K;  2EHG A;  1EET A;  5F2R A;  1UWB A;  1U2V A;  2IVN A;  3S9H A;  2HHV A;  4ELT A;  3OBW A;  3V1O A;  3C6A A;  4Z0U A;  5J2N A;  4K43 A;  4IOX A;  3L2U A;  4OX9 K;  3MEG A;  2BDP A;  2ZJR L;  4O0I A;  4OLA A;  5HRO A;  1NBW A;  1E4F T;  4PKG A;  2QWL A;  4NCG A;  4MO5 A;  4GV3 A;  3C6T A;  4N47 A;  2WOM A;  3IDH A;  4OPH A;  5GIN A;  3JXU A;  3K58 A;  4CZL A;  4FZX C;  3VN5 A;  5AQL A;  5BPM A;  4FJ9 A;  3SJJ A;  3U8X A;  4K42 A;  3PIP L;  3CJ7 A;  4QS7 A;  3AVL A;  2F9T A;  3V9W A;  4DQP A;  4CCH A;  2BGG A;  4C8K A;  3CCQ N;  3CF5 L;  1HLU A;  1HNI A;  1YVN A;  4I2Q A;  3ZET A;  1T7P A;  3K5M A;  1RDA A;  3AVN A;  4DSF A;  1BI4 A;  2VGN A;  3ID8 A;  2P9K B;  4CE9 A;  4FLT A;  2OZM A;  1JLQ A;  4CEF A;  1GLL O;  3OVN A;  3VEW A;  1JLF A;  4O4G A;  2HHH K;  2VWK A;  3J7Y P;  3RSE A;  1E4G T;  3SV3 A;  5BN8 A;  1P8Z A;  1NGB A;  2P9L A;  4W5R A;  5AQT A;  4BR0 A;  4JKG B;  3MEC A;  3NGY A;  3CME N;  4A57 A;  3U4L A;  4C1N K;  2ASM A;  3VEZ A;  4I6M B;  2UXB K;  3LP3 A;  3B6P A;  4U67 L;  2CGL A;  4OKJ A;  2QWN A;  3TPQ A;  1YAG A;  4Z4I A;  2HF3 A;  2KZZ A;  5GAH P;  4A5B A;  3R8E A;  4BRA A;  2FBT A;  1YHQ N;  4YOV A;  1RT3 A;  1RT4 A;  1VQ5 N;  4Z4H A;  3LP0 A;  4DV6 K;  3CCV N;  3LPU A;  3SJH A;  4JLH A;  4JV5 K;  1VSF A;  2YJF A;  1SUQ A;  4DHY A;  2NNW A;  1T05 A;  3VA3 A;  5FLX O;  3TSQ A;  4DV3 K;  3L2W A;  3TAQ A;  3LM2 A;  2R7Y A;  1Q86 O;  4IZ9 A;  4B9T A;  4B1V A;  3K57 A;  4DB3 A;  2Q3S A;  4FJX A;  1DGK N;  2DFH A;  4CED A;  3I56 N;  3HM9 A;  3A5O C;  3VGM A;  2UUC K;  3VQB A;  1QQC A;  3HYF A;  4BR7 A;  3M8Q A;  4JI8 K;  1ITG A;  1NWK A;  3KIO A;  4OGE A;  4FO0 A;  3BUZ B;  4JD2 A;  3CPW M;  2VQF K;  2A3Z A;  4CFB A;  3QIP A;  1SKS A;  1LAW A;  3CYM A;  5JS2 A;  1JL1 A;  1RTJ A;  4CHP A;  1QQN A;  3L4I A;  1NKB A;  2JWK A;  4PKH A;  4W5N A;  1RBU A;  4CIE A;  1L5U A;  3C95 A;  3V9Z A;  1JLG A;  3MCP A;  4BRK A;  4CD3 A;  1D9D A;  3Q7B A;  4C1N I;  4BGB A;  2VQE K;  1NJZ A;  4RCH A;  1VQK N;  1HRH A;  2OTL N;  2LSN A;  2HNZ A;  3NFA A;  3N4P A;  1WAJ A;  1S1T A;  4CIG A;  5SWM A;  1BWF O;  2FBY A;  4WFB L;  1WN7 A;  3K5O A;  2QKK A;  4JKH A;  3RR7 A;  2E2O A;  3EZW A;  1ESV A;  3H6E A;  4DFP A;  3NH0 A;  4LF8 K;  4YOU A;  3C7N A;  4DTR A;  4KKO A;  3VF2 A;  4UQG A;  2HVH A;  3O5B A;  1BDG A;  2A1S A;  3ZCM A;  4H4O A;  4RW9 A;  3U3Y A;  1HX1 A;  3VEX A;  5LY3 A;  2QWO A;  3C7N B;  4NXM K;  2P1J A;  1NGH A;  4RW4 A;  4C8O A;  3U3G A;  2E2P A;  2ZGZ A;  4CJR A;  4W5Q A;  4KHP K;  2YCH A;  3THY A;  4DTO A;  4B3T K;  1VQ8 N;  3KWI A;  4C8L A;  2HHS A;  4M3X A;  4CEB A;  1IKV A;  4CEZ A;  1TYQ A;  5CZ2 A;  3VA0 A;  2QA4 N;  2VG5 A;  1U49 A;  3L0Q A;  3THY B;  4M3U A;  1KVA A;  3TTC A;  2NRW A;  4AF1 A;  3D2E A;  1QSS A;  1YJW N;  4CGJ A;  5KGW A;  5DM7 L;  3WXI A;  3M8S A;  2AP1 A;  2O4G A;  4F2S A;  5LL6 Z;  2Y1I A;  3G4S N;  4JI0 K;  3VF4 A;  3J80 O;  4B3S K;  2D0O A;  4O8K A;  4B9U A;  2G8F A;  3F9K A;  4IO8 A;  4AHR A;  4CJW A;  4F3O A;  2G8W A;  3H3N O;  3LP2 A;  4DV0 K;  1YVU A;  1YJN N;  2I7N A;  3SI6 A;  3HOT A;  3FLC O;  5HRN A;  4DQI A;  4M45 A;  2NUB A;  3TAP A;  2QI2 A;  4K8Z A;  1UAX A;  3WT0 A;  4JI7 K;  4M42 A;  4M3W A;  3H1Q A;  1EP4 A;  3V9X A;  4GV6 A;  4HUF A;  1WSJ A;  2ZJP L;  4DV2 K;  4LC9 B;  3JYT A;  3EKU A;  3WQT A;  1OVQ A;  1VSE A;  4DTX A;  4DUY K;  1N5Y A;  3PSF A;  3R9P A;  3M6G A;  1QZ5 A;  4OPK A;  1ATS A;  1V4T A;  4OO1 J;  2QXL A;  1R59 O;  3RMA A;  3SPZ A;  2P9P B;  1W2B M;  4HVJ A;  3EE9 A;  2DFF A;  3QBW A;  4LY7 A;  4BRP A;  5FPD A;  2WUS A;  3V1R A;  4CGH A;  1BA1 A;  2E8A A;  4FJH A;  4FJ7 A;  3ZT2 A;  2JLE A;  5BR9 A;  1LW0 A;  4BC2 A;  1WLJ A;  4OVL A;  1K9M O;  3CFP A;  3WNF A;  1JLA A;  3QB0 A;  1HJR A;  1ZBH A;  2KLA A;  4B3M K;  2HMI A;  2PBD A;  3DRS A;  1VQ6 N;  4KH4 A;  2NRV A;  2YHY A;  3LZJ A;  5J1E A;  4IDK A;  4DR2 K;  1K8K B;  3QFU A;  2DFE A;  2GV9 A;  3F5T A;  2WC9 A;  2XY6 A;  3KLH A;  3ENH A;  5MLC Q;  1BUP A;  2NRZ A;  4IJA A;  3LDN A;  4E0D A;  3DLK A;  3W0L A;  4G9Z A;  1HYS A;  3OYB A;  4LF6 K;  1NU0 A;  5CR4 A;  3HBT A;  3RTV A;  3LDP A;  4GY2 B;  4M63 C;  4BVO A;  3NF8 A;  3OYK A;  1YJ9 N;  3R3L A;  3GDQ A;  3FZH A;  3LWL A;  3KKS A;  4WQ4 C;  5CZ1 A;  1P90 A;  2D4W A;  3CCJ N;  3HVT A;  3WNE A;  1O1W A;  3I8B A;  3CM5 A;  3HK2 A;  2Q0U A;  1IKX A;  3EYZ A;  4CJU A;  3KLF A;  4LH5 A;  1KFD A;  5AR0 A;  2QTD A;  3K9J A;  1CZB A;  4CZJ A;  4QOZ B;  1CLQ A;  3AV9 A;  1XNR K;  3FZL A;  4O55 A;  1TAQ A;  2E6L A;  1S9G A;  3CQX A;  4FWO A;  4DR3 K;  1UA0 A;  1RDC A;  4B9M A;  3SBT A;  5C24 A;  1J54 A;  4DS5 A;  2IS3 A;  2AA4 A;  4BRQ A;  4IG0 A;  3LDS A;  5TKW A;  5BR8 K;  4IEI A;  4RTF D;  5AQP A;  1VAZ A;  4I7F A;  1ZBU A;  3A0I X;  2P9S B;  1SL0 A;  5AZJ B;  3S3O A;  5CHI A;  4J2B A;  4M7X A;  1QHA A;  2O8C B;  1R0A A;  1TK8 A;  3HST B;  3LPT A;  1SV5 A;  3L2Q A;  1U4B A;  3ULE A;  1KD1 O;  1BCM A;  4H0X B;  2PZS A;  2ZE2 A;  5C10 A;  3O4W A;  3MEE A;  4WF9 L;  4CGG A;  3SUN A;  1KLM A;  1VSL A;  1BQM A;  1SKW A;  2HB5 A;  3O9R A;  4YOY A;  3SLC A;  4BRH A;  1LWC A;  3MXI A;  5D3G A;  3J81 O;  3BDP A;  1GLJ O;  1Q9X A;  2XRI A;  4NB4 A;  5HOO A;  1NGF A;  4ILG B;  4GVE A;  3VES A;  4CJ5 A;  5AZI B;  2NRX A;  1BIZ A;  3TTF A;  4M3Y A;  2GEL A;  3K2P A;  1DLO A;  3DMJ A;  1K73 O;  3QLH A;  4FCY A;  4K8X A;  4TSX A;  4BR4 A;  3QEP A;  2VCP A;  2E88 A;  2RPI A;  1K6Y A;  1WNS A;  4EZ9 A;  4NYN A;  1XWL A;  1IKW A;  1TVR A;  2ZJQ L;  4ICL A;  4JK7 A;  1Z26 A;  3LWM A;  4KV8 A;  3CXC M;  3OBY A;  4BE0 A;  2FBV A;  4RW6 A;  2UUA K;  3OYC A;  4JI5 K;  1MWK A;  1RTH A;  5BRF A;  4BR9 A;  3CCE N;  3F73 A;  3H3O B;  1VHX A;  2WBN A;  3VQP A;  4BQL A;  4DU4 A;  3CJA A;  3NE6 A;  4DMN A;  3HT3 A;  1HNX K;  2PYL A;  1HNW K;  1NGC A;  3VER A;  3E66 A;  4BWM A;  3VEV A;  3IKM A;  4CJF A;  3SMS A;  3KK1 A;  3ZEU A;  3P5J A;  1VQN N;  1D4X A;  1QTM A;  3CC7 N;  1TKX A;  3QNN A;  1NK6 A;  2ASP A;  4IKF A;  3VEN A;  1VSI A;  2D0A A;  3TTD A;  4YY3 K;  4A2A A;  3AVF A;  5AQF A;  4H0V B;  4B9N A;  2YHB A;  3M5R A;  2O8B B;  1BCO A;  3FFK B;  2JWL A;  3CCU N;  4LF4 K;  3M8P A;  3HJF A;  3I0R A;  1XMO K;  1EWQ A;  4CJ4 A;  2O8F B;  4DU1 A;  1VQP N;  4JRQ A;  3CC2 N;  3DXK B;  1KAZ A;  3LAL A;  1LAV A;  3MDQ A;  1RIL A;  3CER A;  2WFB A;  3UKU A;  4PA1 A;  4WQ5 A;  2IOC A;  4DR4 K;  1BOT O;  5A2Q O;  4FLW A;  1KRP A;  4YDU A;  1NGI A;  1V4S A;  3WEE A;  3DRR A;  1HKC A;  5E84 A;  4DTN A;  4KRF A;  1WBD A;  4J8F A;  4E7H A;  4FWM A;  2X6S A;  1XMQ K;  3KVG A;  4F9O A;  4LH4 A;  2FXU A;  4N76 A;  3CJ9 A;  3EEQ A;  2QWP A;  3EZ5 A;  1VSM A;  2AJQ A;  2IC3 A;  1IKY A;  2UU9 K;  4O5F A;  3P31 A;  4FM0 A;  1JKH A;  3KLI A;  3D0P A;  3HM8 A;  1KSP A;  3OHR A;  4GKK K;  3ATU A;  3I0S A;  4BRM A;  5CY4 A;  4BRI A;  2P5O A;  3O3G A;  2VG7 A;  1WSH A;  3DLL L;  2OPP A;  3TWH A;  4QS9 A;  1C1B A;  4FL9 A;  3OJU A;  5AFU H;  1U2V B;  3D2F A;  4CZI A;  3HO1 A;  3KK2 A;  5I9E B;  5HLF A;  1TKZ A;  2FSK A;  2Y1J A;  1W0H A;  1S1U A;  5AQX A;  2WTU A;  4BDP A;  1Q81 O;  1VK0 A;  3HRG A;  1HNZ K;  3VQE A;  3RMD A;  4A62 A;  2F96 A;  1BG3 A;  4ILJ A;  2HHQ A;  5IWA K;  3D45 A;  3QEV A;  2E1Y A;  3AA4 A;  2VGM A;  3T3F A;  4EP4 A;  4E7K A;  3VQ9 A;  2BH1 A;  1IO2 A;  3FZK A;  4FW2 A;  3TU5 A;  3ENB A;  3O8M A;  1XI1 A;  4O8U A;  1G99 A;  4M3R A;  4DTP A;  2IIR A;  3SUP A;  3L3U A;  5HP1 A;  2W6L A;  4H5N A;  4N56 A;  4CGD A;  3LL3 A;  3ZET B;  3BZC A;  5HRR A;  3GBT A;  4FJK A;  1BI4 B;  1S6Q A;  4LSN A;  1N34 K;  4HCB A;  4XH5 A;  4Y0W A;  1IBK K;  3H45 C;  4MLE A;  1DKG D;  1RT1 A;  3ZT4 A;  1TUU A;  3U6F A;  3CQY A;  3DLE A;  3RSE B;  2HND A;  1QS4 A;  2HMP A;  3MCA B;  4RG8 A;  1BIS A;  4NCA A;  2P9L B;  3IRX A;  4B8A B;  2E20 A;  1JCE A;  4O0J A;  2YNG A;  1C0M A;  5LMN K;  4PY5 A;  3QNO A;  4CJP A;  1F21 A;  1SL1 A;  4ILH A;  3CHW A;  5JVH L;  3GE1 A;  4B1X B;  1T03 A;  3ZLJ A;  4JHD A;  2D0P A;  1HPM A;  4AHT A;  4JKE A;  3G0Z A;  5AQS A;  4DTS A;  3HZ6 A;  5BPL A;  4K41 A;  1SQK A;  4JHD B;  2O4I A;  1TKT A;  2FC0 A;  4M41 A;  2X78 A;  4KI4 A;  4C8M A;  4H4M A;  1RT7 A;  1ILY A;  1S6P A;  1GLB G;  3TSU A;  1YT3 A;  2V7Z A;  2D1K A;  4BG9 A;  3PX6 A;  4E7L A;  2A1R A;  4OPJ A;  4AHV A;  3VOV A;  4PQU A;  3DXM A;  2KHO A;  3MWP A;  5M1P A;  2O8E A;  2QW9 A;  2Z1I A;  3RWU A;  3VQC A;  4W5T A;  4BDY A;  2HHU A;  2VG6 A;  1N6Q A;  3M8R A;  1GLD G;  1TL1 A;  3KD1 E;  1RDD A;  1XQS C;  3J8A A;  2GEM A;  4JD2 B;  4JKB A;  3FFI A;  1LCU A;  3C65 A;  5HL7 L;  3BF1 A;  5AQG A;  1RFQ A;  4WCE L;  4KFB A;  1X9M A;  3O3H A;  4E3S A;  2Q31 A;  2HHX A;  3HL8 A;  3HOS A;  3E01 A;  3A5M C;  2P9I A;  3ZSQ A;  4DG1 A;  4KRE A;  3HXM A;  4DV1 K;  4CGI A;  4KHW A;  3AAQ A;  3U9D A;  1VRU A;  4CW7 B;  4KAZ A;  4BR2 A;  3OYF A;  1NOY A;  4B9L A;  3VPZ A;  5JS1 A;  2YHX A;  4CFA A;  3SCX A;  3HTV A;  2OAN A;  1RT5 A;  5EU7 A;  1N8R O;  3VGK A;  4JN4 A;  2A5X A;  2IGI A;  2F7T A;  3FR0 A;  3P38 A;  4IWV A;  3TAM A;  4YNQ A;  4FVU A;  5BRE A;  1D8Y A;  4XH4 A;  1IH7 A;  3CC4 N;  3QIO A;  2YNH A;  2QM1 A;  3AGR A;  3HPO A;  3UKR A;  4GW6 A;  1QVF M;  5BRH A;  4JK9 A;  4H5R A;  3S41 A;  3KHY A;  3CJB A;  1I3A A;  1J6Z A;  3RRH A;  4I2P A;  4IBN A;  2HBJ A;  3ISN C;  2Z1J A;  2OPQ A;  4MLH A;  2E6M A;  1TYQ B;  1D9F A;  3VQ6 A;  1TK5 A;  4LF7 K;  3OYH A;  4OGC A;  2E1Z A;  3GG4 A;  3IFR A;  3D2E B;  3U9Z A;  3QIN A;  3E1Y A;  2Q36 A;  3R6M A;  1D5A A;  3AVI A;  1W9H A;  2ITG A;  4BRN A;  1B92 A;  3PSI A;  4FLU A;  4CF9 A;  4BRE A;  3V1Q A;  1ZBF A;  5FPM A;  4JEP A;  3O9Q A;  1NKE A;  3PIO L;  3T1Y K;  2UUB K;  3K5L A;  1HYZ A;  2D0C A;  5I3U A;  3DYA A;  2OPS A;  5BPN A;  4HTL A;  2V52 B;  4JKF A;  5E26 A;  1NK8 A;  3AAR A;  4J2A A;  3FZM A;  2G8K A;  1MU2 A;  2DTU A;  4DTU A;  2OA8 A;  4CHY A;  2OYQ A;  1QE1 A;  2G8H A;  4KHU A;  3QER A;  2PYJ A;  1RDW X;  3MX2 A;  4FXD A;  2YV0 X;  4AHC A;  4BAC A;  5E41 A;  4CJV A;  4FJG A;  4YOR A;  1RDB A;  4FLZ A;  4GMJ B;  3SZ2 A;  5LJV A;  3MN5 A;  1QZ6 A;  1KXP A;  1Y97 A;  1KLN A;  4NCB A;  4DU3 A;  3Q7C A;  1ZBS A;  1U45 A;  2KFN A;  1KTQ A;  1T6D A;  3VQ7 A;  4CIF A;  3PLA A;  1Z25 A;  4MFB A;  4A5A A;  3SV4 A;  3C94 A;  2XO7 A;  5EXW A;  3ZSO A;  2VYP A;  4JYA K;  5GAE P;  4YOW A;  3G10 A;  2QEX N;  1NGE A;  4CBW A;  4Z4G A;  3IS9 A;  4PHT X;  1SS6 A;  3BP8 A;  4KHQ A;  4F2R A;  5M1F A;  1NGD A;  3MED A;  4QAG A;  1FW6 A;  4N5S A;  4BC4 A;  1KC8 O;  2DY4 A;  1X3N A;  1H1V A;  4CEO A;  4IG3 A;  1FJG K;  2Q0R A;  4ID1 A;  4IOA L;  3VET A;  3V81 A;  4Q0B A;  4K0K K;  5AFU A;  3O9T A;  1XHZ A;  1NLV A;  1YIJ N;  4WE1 A;  3OYI A;  3G6E N;  3OYN A;  1X9W A;  1Q82 O;  3CCR N;  4CGF A;  3SQ4 A;  1JCG A;  5GIO A;  4F3T A;  1NJI O;  3THW A;  3TAF A;  4BC5 A;  1WBB A;  4RW7 A;  2JGU A;  3KJV A;  4F4K A;  2YHA A;  3DRP A;  1RBV A;  1HQU A;  2ETJ A;  3PX0 A;  3B8A X;  4BRC A;  3C0B A;  4K25 A;  5KGX A;  4DQQ A;  2PFU A;  4WQ5 C;  4ELU A;  3NBP A;  4GNI A;  1IV0 A;  5KI6 A;  4YDU C;  4DLG A;  1IG8 A;  1C1A A;  3OYL A;  1HNV A;  5KQD A;  2CH6 A;  3LAN A;  4DCH A;  3DLG A;  3OW2 M;  3ZSY A;  2NRH A;  4MDA A;  1WSE A;  1XHX A;  3SAG A;  1VQO N;  4LFB K;  1TK0 A;  4G1Q A;  4EZ6 A;  3OTO K;  3QML A;  1EXQ A;  5AQM A;  3FGU A;  4PL7 A;  3HPG A;  3VTI A;  1YI2 N;  5JMV A;  4CBX A;  3DWL A;  4B08 A;  1L3U A;  1QSL A;  3SK3 A;  2ZGY A;  2YNF A;  1LV5 A;  2P5G A;  3LDL A;  2BTF A;  4ZTF A;  1S3X A;  1NK5 A;  3S3N A;  1ZBI A;  4DQR A;  3NCI A;  1VQ9 N;  1DEJ A;  3A2F A;  2HHW A;  1MA9 B;  2UXD K;  1Q9Y A;  1Y64 A;  5FRM A;  4FK2 A;  2X74 A;  4FZZ A;  3NMU A;  3LDQ A;  3PV8 A;  5AQQ A;  3T7Z A;  1VQ7 N;  4BE2 A;  1TGO A;  2E5L K;  4CJS A;  3I55 N;  3E9P A;  2HW3 A;  1G15 A;  3SAF A;  2F8S A;  4X66 K;  1HMV A;  4E1M A;  2WON A;  2P9N A;  1NGJ A;  4IFE A;  5CYQ A;  5AQJ A;  3O08 A;  2ZD1 A;  1YIT N;  5FRN A;  1JLB A;  3ZX3 A;  4PL8 A;  4FLY A;  1XC3 A;  3O9U A;  1YXQ A;  1C0T A;  2GUI A;  2W42 A;  3ULE B;  4PKI A;  3A8Y A;  1ATN A;  5F1X A;  3F2K A;  5AQK A;  4CD1 A;  5KRT A;  1A5X A;  4GVM A;  1NK7 A;  4B3R K;  3VGL A;  2PY5 A;  5AQI A;  1BL3 A;  5EOY A;  5C15 A;  4CEC A;  3WNG A;  3AA3 A;  4CZH A;  1U47 A;  2V7Y A;  3EL2 A;  1YTA A;  4KH5 A;  1U48 A;  1TL3 A;  2GWK A;  1KVC A;  2CGK A;  2QWR A;  5BN9 A;  3OYA A;  4DLE A;  3IUC A;  4GKJ K;  4B9V A;  4BRD A;  3NH2 A;  3SQ1 A;  1C1C A;  1IBM K;  3AVA A;  3NF6 A;  3OYM A;  4FM2 A;  3L2R A;  1KAY A;  1JLE A;  3O4Q A;  5FDL A;  5C12 A;  5ADX H;  1J5O A;  5TKY A;  4CZK A;  4Q5V A;  4XEI A;  4KHS A;  3L2V A;  5J2Q A;  4FSV A;  3ZSZ A;  3R1X A;  1RTI A;  2ZF5 O;  4AH9 A;  2A6A A;  4MDB A;  3ZYY X;  1CZA N;  4EHU A;  1NJX A;  1C0F A;  3AVM A;  3FE1 A;  2FF6 A;  2E2Q A;  2YJE A;  4KHN A;  4JNE A;  1C0G A;  4DR1 K;  1L3V A;  1HKG A;  4I9L A;  3KTQ A;  3L3V A;  1ZBL A;  4DUZ K;  4YOX A;  3FZF A;  1CZ9 A;  1J53 A;  3TAB A;  2OCE A;  3KK7 A;  4FLX A;  3O6W A;  1KCF A;  4KB1 A;  4CJL A;  3K59 A;  2F9W A;  2UYT A;  4CHO A;  4YHH K;  3ZEU B;  2A40 A;  4ID5 A;  4NXN K;  4CJ7 A;  1QHT A;  1MDU B;  2GUP A;  1DTQ A;  3OA9 A;  2P9U A;  2XY8 A;  1SKR A;  4KH6 A;  1SZ2 A;  3THX A;  1NM1 A;  3CD6 N;  4U7B A;  2G8I A;  1WB9 A;  4KBO A;  3LAM A;  1OH7 A;  3MXM A;  4CHN A;  1OH5 A;  3D6R A;  3P83 D;  1EO1 A;  3QES A;  3UE5 A;  1J9A A;  4CZG A;  1Z05 A;  4AIL C;  1NJW A;  1JL2 A;  3WNH A;  4M7Y A;  4N41 A;  2B4J A;  3UKU B;  1RBR A;  2D5R A;  3HPH A;  5AQW A;  3SQ2 A;  4KTW A;  4KTQ A;  3E9L A;  3CQ8 A;  2O8D A;  3WEE B;  4IJN A;  1T44 A;  3ID6 A;  3O9S A;  3ZSW A;  3QEX A;  4KTZ A;  1VSJ A;  1RDU A;  4WYB A;  5CYM A;  4FJ8 A;  3LM9 A;  3TAE A;  4O44 A;  5M1Q A;  2VWJ A;  4Y1C A; 
#chains in the Genus database with same CATH homology
 2QI2 A;  3TSU A;  2V7Z A;  2D1K A;  3WT0 A;  4BG9 A;  3IMX A;  3WQU A;  2CGJ A;  3H1Q A;  4FWN A;  1X3M A;  4BVP A;  4GV6 A;  4QS8 A;  3NVK A;  5ELZ A;  3VOV A;  4AM6 A;  5KPZ A;  2P9N B;  2KHO A;  3DXM A;  4LC9 B;  3EKU A;  4BQZ A;  2ZJP L;  2FF3 B;  3CJC A;  1ZXO A;  4IXC A;  2W41 A;  3MWP A;  5M1P A;  3WQT A;  4AM7 A;  4UY8 O;  2QW9 A;  1DT9 A;  4NO7 A;  1HJO A;  4FWS A;  4B1U B;  3R9P A;  3M6G A;  4BRF A;  1QZ5 A;  2HF4 A;  2IVO A;  1ATS A;  1V4T A;  2YX6 A;  1GLD G;  4FWK A;  4OO1 J;  4DKW A;  1XQS C;  2VWB A;  2QXL A;  1R59 O;  3J8A A;  3MWT A;  4BGA A;  1M1K O;  2GEM A;  4JD2 B;  2P9P B;  4JKB A;  1LCU A;  2A41 A;  1W2B M;  2I7P A;  3C65 A;  3D2F B;  3BF1 A;  3EE9 A;  3L4Q A;  5AQG A;  5AQR A;  5HL7 L;  1RFQ A;  4WCE L;  5AZI A;  2Q31 A;  4Z94 A;  3J7Z O;  3QBW A;  3I33 A;  4BRP A;  5FPD A;  2WUS A;  2IVP A;  3HOS A;  1BA1 A;  1ATR A;  2E8A A;  4FWR A;  1QQM A;  2NRT A;  2P9I A;  3A5M C;  3HSC A;  1TUY A;  3RVC A;  5BR9 A;  4BC2 A;  1OVY A;  3MN9 A;  1K9M O;  2CH5 A;  1Z6R A;  3N4Q A;  4NLC A;  3QB0 A;  3AAQ A;  3CIP A;  3U9D A;  3VTH A;  2KLA A;  3C6H A;  2PBD A;  3VMF B;  4BR2 A;  5M1K A;  4EFH A;  1VQ6 N;  3EKS A;  5KPT A;  4FWL A;  3G71 N;  4KH4 A;  3VPZ A;  4EAH D;  2NRV A;  2YHX A;  1LOT B;  2YHY A;  3HTV A;  2OAN A;  1N8R O;  3VGK A;  5KQ8 A;  4A61 A;  3HI0 A;  1QVG M;  4JN4 A;  2A5X A;  1K8K B;  1U6Z A;  3QFU A;  4CZM A;  3F5T A;  4B1Z A;  2WC9 A;  2F7T A;  3FR0 A;  2FSJ A;  3P38 A;  4BRO A;  4IWV A;  2P9K A;  3QBX A;  3ENH A;  4A59 A;  5MLC Q;  2ITM A;  2W40 A;  1BUP A;  2NRZ A;  4FVU A;  4IJA A;  3LDN A;  3SMP A;  5BRE A;  3MX5 A;  3VF6 A;  2A42 A;  4XH4 A;  5FPE A;  3W0L A;  4G9Z A;  3CC4 N;  5JLH A;  4C23 A;  5CR4 A;  3HBT A;  4GV9 A;  2QM1 A;  3LDP A;  1O13 A;  3AGR A;  4GY2 B;  4M63 C;  3UKR A;  1QVF M;  3CET A;  5BRH A;  4BVO A;  1XUP O;  4JK9 A;  4JKA A;  4H5R A;  4BRL A;  4NLB A;  3S41 A;  3L6Q A;  4JKG A;  3KHY A;  1YJ9 N;  3K9K A;  1VQM N;  3KZB A;  3R3L A;  3CJB A;  4H03 B;  3GDQ A;  1VQL N;  5LJW A;  1JCF A;  3FZH A;  3WXJ A;  1J6Z A;  2NZT A;  4I6M A;  3ENO A;  4WQ4 C;  1VQ4 N;  1P90 A;  2D4W A;  2HBJ A;  2P9U B;  1BU6 O;  3M1F A;  2QWM A;  3CCJ N;  4MLH A;  5AQO A;  1TYQ B;  3P39 A;  1BO5 O;  4L3Q A;  4CZE A;  3I8B A;  3DXK A;  2Q0U A;  3JS6 A;  2E1Z A;  3GG4 A;  5AR0 A;  2E2N A;  5BRD A;  3IFR A;  4WFN L;  2QTD A;  3K9J A;  3ATV A;  3D2E B;  3U9Z A;  4CZJ A;  3E1Y A;  2Q36 A;  4ISF A;  1YIT N;  2GWJ A;  3R6M A;  1OKJ A;  5JLF A;  3FZL A;  5GAD P;  3A5N C;  3CJ1 A;  4BRN A;  2HST A;  3NVM A;  3CQX A;  4FWO A;  1SAZ A;  4WFA L;  3SBT A;  2PAV A;  4BRE A;  5KPR A;  3QFP A;  1S72 N;  2NLX A;  3WXM B;  2AA4 A;  5FPM A;  3BEX A;  4JEP A;  4BRQ A;  1M90 O;  3AAP A;  3O9Q A;  5B8H A;  3PIO L;  2BUP A;  4BC3 A;  1HKB A;  5M1N A;  2NRR A;  4WQ4 A;  5TKW A;  5C2D A;  4IEI A;  4RTF D;  5AQP A;  2YI1 A;  3DJC A;  3G25 A;  5BPN A;  4HTL A;  1VAZ A;  2V52 B;  4JKF A;  2Q1N A;  4HWI A;  5E26 A;  4IO9 L;  3A0I X;  3AAR A;  5AQU A;  2P9S B;  5CE3 A;  3FZM A;  5AZJ B;  4EIA A;  5CHI A;  4FOE A;  4M7X A;  1QHA A;  3M3Z A;  5DM6 L;  1S22 A;  1Q7Y O;  1KAX A;  1WUA A;  1NMD A;  3QIC A;  3WXK A;  1RDW X;  2HBL A;  1NGA A;  3MX2 A;  4JKC A;  3MK6 A;  5AQH A;  4R79 A;  1RGI A;  1W97 L;  2HOE A;  4B1W B;  2DPN A;  3H1V X;  3ULE A;  2HBM A;  1KD1 O;  4H0X B;  1HUX A;  3SBG A;  4YOR A;  3DXM B;  5C10 A;  4BG8 A;  3O4W A;  5F2R A;  5LJV A;  3MN5 A;  4WF9 L;  1QZ6 A;  1U2V A;  1KXP A;  2IVN A;  5EVZ A;  1X9J A;  3OBW A;  3Q7C A;  1ZBS A;  1T6D A;  3C6A A;  4K43 A;  4IOX A;  3PLA A;  3O9R A;  4A5A A;  4YOY A;  3SLC A;  3AY9 A;  5AQY A;  4BRH A;  4JK8 A;  5EXW A;  2ZJR L;  2VYP A;  5GAE P;  1NBW A;  1GLJ O;  3SAH A;  1E4F T;  4NB4 A;  2QWL A;  4PKG A;  5GAG P;  1NGF A;  5HOO A;  4YOW A;  4MO5 A;  2QEX N;  4GV3 A;  4ILG B;  4GVE A;  3VES A;  3QDK A;  1NGE A;  5AZI B;  4CBW A;  2NRX A;  3TTF A;  5H1S Q;  5JIC A;  2GEL A;  4PHT X;  3IDH A;  4OPH A;  5GIN A;  1SS6 A;  3JXU A;  3BP8 A;  2P9I B;  4CZL A;  1K73 O;  5M1F A;  5BPM A;  5AQL A;  4BR4 A;  1NGD A;  4H5T A;  1BA0 A;  2VCP A;  4BC4 A;  5GIP A;  2E88 A;  3UB5 A;  2Q2R A;  4JKD A;  4XH1 A;  1KC8 O;  1X3N A;  1H1V A;  3U8X A;  5EX5 A;  3CI5 A;  4K42 A;  3PIP L;  3CJ7 A;  3KWG A;  4QS7 A;  2F9T A;  2Q0R A;  2ZJQ L;  4IOA L;  2ASO A;  4JK7 A;  4E1J A;  3CXC M;  3VET A;  3OBY A;  2J4R A;  3O9T A;  5AFU A;  1NLV A;  3CCQ N;  4A2B A;  1YIJ N;  3CF5 L;  1HLU A;  1MWK A;  1YVN A;  4BR9 A;  5BRF A;  3CCE N;  3ZET A;  3WXL A;  3H3O B;  3G6E N;  2WBN A;  4BQL A;  1Q82 O;  3LDO A;  3CJA A;  2VGN A;  3CCL N;  3ID8 A;  2P9K B;  1NGC A;  3CCR N;  3VER A;  1JCG A;  1GLL O;  5GIO A;  1NJI O;  3BF3 A;  3E66 A;  1MWM A;  3VEV A;  3IKM A;  4YOT A;  3VEW A;  4BC5 A;  4CZF A;  4BY9 C;  3GL1 A;  3SMS A;  4B9Q A;  3ZX2 A;  3B8A X;  1E4G T;  3RSE A;  3ZEU A;  1NGG A;  4BRC A;  4EHT A;  3C0B A;  3MN7 A;  1D4X A;  1VQN N;  4K25 A;  5BN8 A;  2HBK A;  1P8Z A;  1NGB A;  2P9L A;  2PFU A;  5ADX A;  3CC7 N;  4H5V A;  4WQ5 C;  3UKR B;  5AQT A;  2ASP A;  4GNI A;  3VEN A;  4YDU C;  4BR0 A;  1IG8 A;  4JKG B;  3TTD A;  4BR5 A;  4A2A A;  3CME N;  1GLA G;  4A57 A;  5KQD A;  3U4L A;  4C1N K;  2CH6 A;  4H0V B;  5AQF A;  2ASM A;  3M5R A;  3WUH A;  4DCH A;  3FFK B;  3VEZ A;  2JWL A;  4H5W A;  4I6M B;  2EWS A;  3CCU N;  2NRH A;  5C2F A;  4MDA A;  3SAG A;  3OW2 M;  5AQN A;  4U67 L;  2CGL A;  1VQO N;  2QWN A;  3TPQ A;  3QML A;  1JJ2 M;  1YAG A;  3CMA N;  4H0Y B;  2HF3 A;  3VEY A;  5AQM A;  1VQP N;  1Q18 A;  3FGU A;  4A5B A;  5GAH P;  4PL7 A;  3DXK B;  3CC2 N;  3R8E A;  4BRA A;  3VTI A;  1YI2 N;  1KAZ A;  5JMV A;  4CBX A;  3DWL A;  1YHQ N;  5EY4 A;  4DQ8 A;  3MDQ A;  3SK3 A;  2ZGY A;  3CPE A;  4YOV A;  3LDL A;  2KKZ A;  2BTF A;  3CER A;  1S3X A;  2WFB A;  4H0O A;  3UKU A;  1VQ5 N;  4WQ5 A;  1WOQ A;  1BOT O;  3CCV N;  1VQ9 N;  1DEJ A;  3SJH A;  4YDU A;  1NGI A;  1MA9 B;  1V4S A;  3WEE A;  1HKC A;  5E84 A;  3D7E O;  1Y64 A;  4J8F A;  2YJF A;  4FWM A;  1KQS M;  3NMU A;  4DHY A;  3KVG A;  4F9O A;  2NNW A;  3LDQ A;  2FXU A;  5AQQ A;  3TSQ A;  3CJ9 A;  4IOC L;  4B1Y B;  4FWP A;  3T7Z A;  1VQ7 N;  3LM2 A;  1Q86 O;  2QWP A;  4IZ9 A;  3I55 N;  3TSP A;  3E9P A;  2GX9 A;  4B1V A;  3SAF A;  2GTD A;  1T6C A;  4DB3 A;  1DGK N;  3MMV A;  1QQO A;  2P9N A;  1EQY A;  1NGJ A;  3P31 A;  3O08 A;  4IFE A;  4O5F A;  5AQJ A;  5M1O A;  3T69 A;  3HM8 A;  5FPN A;  3ZX3 A;  1GLC G;  3I56 N;  3A5O C;  4PL8 A;  1XC3 A;  3OHR A;  3O9U A;  3ATU A;  3VGM A;  1YXQ A;  5AQV A;  4ISG A;  3ULE B;  4PKI A;  3A8Y A;  4BRM A;  1ATN A;  3E9O A;  4BRI A;  3F2K A;  5AQK A;  4BR7 A;  1NWK A;  4CD1 A;  5F1X A;  3W3D A;  3DLL L;  4FO0 A;  3BUZ B;  4JD2 A;  3CPW M;  2P9P A;  4QS9 A;  2A3Z A;  4FL9 A;  4FWQ A;  5AFU H;  1U2V B;  3D2F A;  3VGL A;  2FLO A;  4CZI A;  3H46 O;  5I9E B;  2FSK A;  5AQI A;  5EOY A;  5C15 A;  3EN9 A;  1QQN A;  5F0X A;  3L4I A;  4CZH A;  4JAX A;  5AQX A;  2JWK A;  2V7Y A;  3EL2 A;  4PKH A;  3CCM N;  4KH5 A;  2V51 B;  2GWK A;  1Q81 O;  3HRG A;  2CGK A;  2QWR A;  5BN9 A;  3IUC A;  3MCP A;  4A62 A;  1BG3 A;  4BRD A;  4ILJ A;  4BRK A;  4CD3 A;  3VEO A;  3Q7B A;  4C1N I;  4BGB A;  3DAW A;  4ISE A;  1IJJ A;  4RCH A;  1VQK N;  1KAY A;  2OTL N;  1K8A O;  3N4P A;  2E1Y A;  5ADX H;  5C12 A;  5TKY A;  1GLF O;  2VGM A;  4CZK A;  4XEI A;  2ZWH A;  4FSV A;  2BH1 A;  3R1X A;  2Q97 A;  1BWF O;  2ZF5 O;  3FZK A;  4H0T B;  2A6A A;  4MDB A;  3TU5 A;  1K8K A;  3ZYY X;  3ENB A;  1CZA N;  3O8M A;  4WFB L;  4RWT A;  4O8U A;  4EHU A;  1G99 A;  3GOI A;  1C0F A;  4H0P A;  2IIR A;  4JKH A;  2E2O A;  3FE1 A;  3EZW A;  1ESV A;  2FF6 A;  2E2Q A;  2YJE A;  4H5N A;  4JNE A;  3H6E A;  3MN6 A;  4BRG A;  5C0Y A;  1C0G A;  4YOU A;  1HKG A;  3C7N A;  4FPA A;  3O1B A;  3VF2 A;  3LL3 A;  3ZET B;  3O5B A;  1BDG A;  3GBT A;  4IDH A;  4CI6 A;  2QWQ A;  4XH5 A;  1HX1 A;  4FPB A;  3FZF A;  4YOX A;  3VEX A;  4Y0W A;  5LY3 A;  3H45 C;  4MLE A;  3KK7 A;  2QWO A;  3C7N B;  1DKG D;  3O6W A;  1NGH A;  2YHW A;  1TUU A;  2F9W A;  2UYT A;  3CQY A;  3EO3 A;  3RSE B;  4CBU A;  3ZEU B;  2A40 A;  2E2P A;  2ZGZ A;  4CJ7 A;  2HMP A;  2YCH A;  3MCA B;  1MDU B;  2GUP A;  2P9L B;  2OTJ N;  1VQ8 N;  3KWI A;  2E20 A;  3OA9 A;  2P9U A;  3F9M A;  4KH6 A;  1SZ2 A;  3ZX0 A;  4FOI A;  1NM1 A;  3A5L C;  1TYQ A;  4U7B A;  3CD6 N;  1JCE A;  2QA4 N;  1YUW A;  3L0Q A;  4KBO A;  2RHK A;  2H3G X;  3TTC A;  2NRW A;  3O1W A;  4AF1 A;  3D2E A;  3D6R A;  1YJW N;  4ILH A;  3CHW A;  5JVH L;  5DM7 L;  3GE1 A;  1ZC6 A;  3WXI A;  4B1X B;  1EO1 A;  3EE8 A;  3UE5 A;  2AP1 A;  4JHD A;  2D0P A;  4CZG A;  1YF5 L;  1Z05 A;  1HPM A;  1GLE G;  4IEE A;  3AGK A;  3G4S N;  4JKE A;  4M7Y A;  3P4I A;  3VF4 A;  1T3V A;  5AQS A;  3HZ6 A;  2D0O A;  3UKU B;  5AQW A;  5BPL A;  4K41 A;  4O8K A;  5JVG L;  1SQK A;  4MO4 A;  4JHD B;  3E9L A;  4IO8 A;  3WEE B;  4IJN A;  5AQZ A;  1T44 A;  2P9S A;  3ID6 A;  3H3N O;  3O9S A;  5AZJ A;  1RDU A;  2FSN A;  3O80 A;  4WYB A;  1YJN N;  2I7N A;  3HOT A;  4OPA A;  3FLC O;  1ILY A;  3LM9 A;  5M1Q A;  1GLB G;  3CCS N;  2RE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...