3K9JA

Transposase domain of metnase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
224
structure length
201
Chain Sequence
b'PHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVRRKRPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYWTGINQLISRWQKCVDCNGSYFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase SETMAR
publication title Crystal structure of the human Hsmar1-derived transposase domain in the DNA repair enzyme Metnase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 65
structure length 201
sequence length 224
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2009-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01359 Transposase_1 Transposase (partial DDE domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3k9jA00
3K9JA 3F2KA 3HOSA 5CR4A 2F7TA 5HOOA 3HOTA 4U7BA 3K9KA 4MDBA 4MDAA 4R79A
chains in the Genus database with same CATH superfamily
4NB4A 1CZ9A 2QI2A 1SAZA 2OTJN 2YHWA 1EP4A 3DJCA 5AQHA 3I8DA 2XY5A 2IAJA 1HRHA 2DTUA 5KTQA 3NE6A 3ATUA 1IG8A 3RMDA 3VQDA 1HX1A 1ITGA 4CE9A 4E3SA 1BIZA 2BH1A 3K5LA 2HF3A 1VQ9N 5HROA 4DLGA 1LWCA 4EAHD 5AZJB 3OW2M 1SUQA 5DMRA 1SL1A 2D4WA 4CJFA 3ASMA 2QXFA 1Q86O 5GAGP 1S1UA 2HBKA 4BWJA 4Z4EA 2P9LB 4KTQA 1E4FT 2E6LA 5ELZA 4EZ9A 1V4TA 1MU2A 1IH7A 5EX5A 3HI0A 1DTTA 4FJ5A 2VCPA 4BR9A 3QERA 1S1WA 1SKSA 1GLEG 4GV3A 4DTJA 2QKBA 1X3NA 3TSPA 1BUPA 4JI1K 2Q2RA 1IBKK 1LW0A 2CGLA 3BY5A 2Y1IA 5AQTA 4IXCA 5AQFA 4DF4A 3W0LA 3UKRA 4FVUA 5HRRA 4W5QA 3RMCA 4IJNA 3MMVA 4KHPK 1T6DA 3LP2A 4RW7A 4CHZA 5AQGA 1NNEA 1BIUA 3ZSZA 4KH6A 3SQ2A 4DTPA 1LWFA 3AVNA 2QM1A 4ZHRA 4TSXA 3O9QA 1HJRA 4K0KK 2J4RA 1U6ZA 1ATRA 1SS6A 2HBMA 4KFBA 3N4PA 4BACA 4B9TA 1U45A 4I6MB 3VQAA 1TUUA 3DRSA 2ASMA 4CZKA 4FJMA 4M3RA 3THYB 1DLOA 3B8AX 3EKSA 4A2BA 5M1FA 1HQUA 1NK5A 1Q9XA 4JI5K 2WFBA 2H3GX 4IOAL 3TTDA 3CQYA 4JKGA 4C8KA 3ZLJA 4E1JA 3HP6A 3KD1E 2IDOA 3ZETB 4O4GA 3L0QA 4XH4A 4KKOA 4CJ5A 5C42A 4CHNA 1NKBA 2A1RA 2D1KA 1JCGA 2DPNA 4JEPA 3OTOK 4JN4A 3T1AA 4CF9A 2CGJA 2HB5A 5AQWA 5M1KA 3WEEA 2XO7A 3RVCA 3OS1A 1EWQA 1Z25A 3AV9A 2ITGA 3P39A 2GX9A 2UYTA 2VQEK 2YHBA 1BL3A 2E6MA 3HYFA 3CQ8A 1NK7A 3F73A 2RPIA 1TV6A 2RE2A 1D9DA 1LAVA 1CXQA 5C10A 4KI4A 4MQ3A 3DAWA 3OYCA 4CHQA 4KBOA 2KHOA 5M1NA 4M63C 2QWMA 2GTDA 5C25A 4FOEA 1BO5O 4HUFA 1I94K 3NDKA 4FLVA 3TAEA 4CHPA 1ASVA 3HVRA 3TAMA 3WUHA 4N5SA 5CYMA 3OJUA 3AVBA 5SWMA 2VQFK 3OYJA 4ICLA 1RBSA 3CD6N 5C24A 4FWKA 1KLMA 3LANA 1UAXA 3LP3A 4YOYA 3V9UA 4BRAA 1U04A 3K59A 1T6CA 5J1EA 2KTQA 5FRNA 1BA0A 2P5OA 5BR8K 1GOAA 1C1CA 4FW1A 1ASWA 3OYDA 4DHYA 1YI2N 4KHUA 3ULEB 2E88A 3C7NA 1VRTA 1IBMK 1IKXA 2NRVA 4CFBA 4FLUA 2A1SA 4F2SA 1ZBSA 1RT5A 1QHTA 3V1QA 4OPJA 4AHCA 3O9RA 1YITN 3LDPA 2HHTA 3U3YA 4FZZA 1RILA 3VQEA 3EE9A 2YX6A 2X78A 4MLHA 3CQXA 1SL0A 3WNHA 4CJWA 4MDBA 4NXMK 1N5YA 3ZSQA 2VWBA 4M3XA 4CZLA 5JLFA 1SKWA 4E0DA 3DLKA 3KLEA 3HVTA 3ULDA 1MA9B 3FZFA 3VMFB 1D5AA 1BDGA 1QS4A 5AQJA 4DUZK 4KHNA 2KFNA 5CZ2A 4DS4A 4H0PA 1H1VA 1K6YA 5MLCQ 3SMPA 2WTUA 1KD1O 4A62A 4BC2A 5BPNA 2O8FB 4BWMA 3KKSA 3MEGA 3HRGA 3NVMA 3O4WA 4DV3K 4M3YA 3DLGA 4OLBA 2YNHA 4BGAA 4NCAA 5AQSA 3SQ1A 3ZT1A 4CF1A 3H46O 2CH6A 1HKCA 1EO1A 4IOCL 5C2FA 3HOTA 1WSHA 2EX3A 4CZGA 2HMIA 1YJWN 1BISA 1P8ZA 3JXUA 3PX6A 2HBLA 4ZTJA 4KHYA 1BCOA 1QQNA 1JXEA 4FLTA 1XNQK 3VQPA 4CFAA 4LD0A 1WSJA 4JKCA 3MK6A 1K8AO 3ZX2A 1T05A 2AJQA 1WSFA 3OYBA 2P9UA 1RFQA 4YOWA 4CECA 2HHUA 4FZYA 2OTLN 2WUSA 4UQGA 2ZQBA 3BGRA 3S3OA 4K41A 4BRLA 2WONA 3WNFA 3I33A 2GELA 5DM7L 1WSIA 3EKUA 2GV9A 4B9QA 3BZKA 2RHKA 4BE2A 1VQ7N 2QWNA 2HOEA 4JD2B 4Q0BA 3LDLA 3E9OA 4H0TB 5GAHP 4BRFA 5SZTA 1E3MA 3U4LA 3KLHA 4FZXC 1RT4A 4DKWA 3UB5A 4CJ3A 4CHOA 3O08A 3IS9A 1K9MO 4WFAL 1RT2A 3VQ9A 1NG9A 3VQ4A 5I9EB 3F9MA 2FXUA 5JMVA 3F9KA 1NGDA 5KPZA 4BR7A 3O9UA 1ILYA 4O0JA 3VPZA 3ZT2A 5GAEP 3TR8A 3FZHA 4WQ5C 3ALYA 1L3SA 4B9SA 3SK3A 1RTHA 3CCEN 5CE3A 3TAQA 4PKHA 3CJBA 4LFCK 3AA5X 5M1PA 3AGRA 2HNDA 2FBXA 2OZSA 2FF6A 1GLFO 3AO3A 4KHSA 1REVA 3SAHA 4DSKA 4AILC 3PLAA 3NH1A 1N6QA 3SMSA 4B9NA 3MCPA 4MO4A 2A42A 3AO4A 3E01A 3DXKA 1HR0K 2YJFA 3LAMA 5AFUA 4RCHA 4DSLA 3ZT3A 3K5NA 3T19A 3GOIA 4CZIA 1VQPN 1TL3A 1RT1A 1VSFA 2G8WA 3HBTA 2IOCA 3E9PA 4CFCA 3ZX3A 1SL2A 4FYDA 2EWSA 2DFFA 3HSCA 2ATQA 2IVOA 3AGKA 4KH4A 5TKWA 1MWMA 1TUYA 1BU6O 3NBPA 1ZBLA 3A5NC 2PY5A 1EX4A 2IVPA 3V9SA 3ZSOA 3KJVA 3PSFA 1M1KO 4CEFA 3NH0A 1J54A 1A5WA 1D8YA 1D9FA 3DOKA 5FRMA 4BRCA 3BF3A 3D7EO 3THWA 4HTUA 3IRXA 4PWDA 1C0GA 5M1QA 1Q8IA 5A2QO 3TABA 3NVKA 2O8FA 2JWLA 3G25A 4MDAA 2UUAK 4CEQA 5BN9A 5LMNK 3PIOL 3QO9A 3UKRB 3IKMA 2P9SA 3DMJA 4QS8A 4F8RA 4ISGA 4DR2K 3LWMA 1VQ5N 5FDLA 3O1WA 4DU1A 3MXMA 4DV7K 1Q9YA 3AVMA 3VQCA 4RWTA 3L2QA 3AVFA 3ITHA 4FJIA 4JKBA 1JXBA 3HSTB 2O8BA 1BA1A 2NUBA 3EEQA 5LJVA 2NZTA 3K5MA 2G8IA 4OGCA 1R59O 4CJSA 5FPMA 3OYAA 3V81A 3NF8A 3VEOA 5GIOA 3IFRA 4YORA 3THVA 3QEVA 4AHTA 3CJ9A 4CZHA 3NH2A 4DSIA 1FW6A 4B9LA 3D2EA 1E4GT 2ZE2A 4N47A 1X3MA 3EYZA 2XRIA 1RTIA 3WT0A 2QKKA 1WUAA 4JKGB 3MECA 3P83D 3SQ4A 3A5OC 3FR0A 4U7BA 3PO5A 1LCUA 1WN7A 1XUPO 3O1BA 2PYJA 1WBBA 1RT7A 4EP5A 4IBNA 4JI6K 4OJRA 4B1WB 3SUNA 2PZSA 4ZTFA 4IFYA 3WEEB 3RR7A 4NLBA 4CEZA 4PL7A 1OH6A 2QW9A 3SNNA 1GLDG 5E84A 4CJLA 1S22A 4FWOA 4DU4A 4CIEA 4Z4CA 3WNEA 3CCJN 3OS2A 1GLJO 3CFOA 3TWHA 2OA8A 1NK9A 3NGYA 5CY4A 1VRUA 3OYIA 4CK1A 4B9VA 1HQEA 1I3AA 5JVHL 1OVQA 4DV6K 2KZZA 4H0OA 1FK9A 1BQMA 2A40A 1ASUA 3NF7A 5AQLA 3TTCA 1ZBIA 3M8RA 4C8LA 1N33K 4BQZA 1G15A 4BR0A 3AA3A 2ZJPL 2UUBK 1TVRA 4QCLA 3C0BA 4DR3K 3WQUA 3G10A 4XH5A 1WB9A 1XMQK 1XHXA 4LSLA 1SQKA 1RDCA 4BG9A 4H8KA 3QFPA 4PUOA 4DU3A 1QVGM 1B92A 2NLXA 4DMNA 4E7IA 4DQSA 3CPWM 3KHYA 4BRGA 5HLFA 3M8QA 2Q36A 1NJXA 5M1OA 4IOXA 3ZX0A 1YJNN 5BREA 1S1VA 4JAXA 3OYHA 4O55A 4YHHK 3O80A 3H08A 4DV4K 1NWKA 2ITMA 3C7NB 3QIOA 1A5VA 5K14A 5HL7L 1UWBA 4CK2A 3F2KA 2NRTA 3SV3A 1VSJA 3QBWA 4E7JA 3HJFA 4FW2A 4DFKA 1HNVA 2GEMA 2FBVA 3C6UA 4M41A 1T03A 4O5FA 1TKTA 4BRPA 1NGHA 4OGEA 3VOVA 1TGOA 4FM0A 4FO0A 5D3GA 5KRTA 4B1XB 2KW4A 5F0XA 3K0SA 3P1GA 3KK3A 4JI0K 1X9MA 4JS4A 5KI6A 5KGXA 2EHGA 3KD5E 4ILJA 2HMPA 3QLHA 5AZIA 4KTZA 3LDNA 3O9TA 2O4GA 1IV0A 5AQMA 3JYTA 3EE8A 3CJCA 3NF9A 1FKOA 4CFDA 3BUZB 4F4KA 4FJKA 2BGGA 2P9IA 4CJ7A 2HF4A 2D0PA 3CCLN 3VEYA 4PQUA 4CEDA 2X74A 2YHXA 4GMJB 2YNFA 3FZKA 3ID6A 5AQKA 4HTLA 4A2AA 4EZ6A 2P9NB 4AHUA 1NJWA 1U48A 3CCUN 4HCCA 4BRMA 2OPQA 1NLVA 3TSQA 3ZSRA 1T7PA 3OYKA 3CERA 3RR8A 4RTFD 1NK0A 2QWQA 5AQUA 3RRHA 4FPBA 1XC3A 1L3VA 1NKEA 4O0IA 3AVIA 3LWLA 2BE2A 3HK2A 3QMLA 4LH4A 2UU9K 2VG7A 4B8AB 1YTUA 2V7YA 4XIUA 3L6QA 4YDUA 4F9OA 2D0OA 5E41A 4PY5A 2Q1NA 3GE1A 4QS7A 3NGZA 4KO0A 3VTHA 1IBLK 4LY7A 4BVPA 4BRQA 1J6ZA 3MDQA 3U9ZA 3A0IX 3GG4A 5HOOA 3CJ7A 4FSVA 1NGFA 5HRSA 3LM2A 2P9UB 3DYAA 4FVMA 5AFUH 1N36K 1HNZK 1RTDA 4OX9K 4CIGA 4FM2A 5EU7A 3PX0A 5IT9O 4JRQA 3ZSWA 4LC9B 2F4VK 4IEEA 4YOTA 1HNWK 1JKHA 1RBVA 1L5UA 3C94A 1J53A 2IGIA 4LFBK 3ZSVA 5J2MA 2G8VA 3SQ0A 2YKMA 1O13A 4BREA 1IJJA 3AAQA 3G6EN 4AH9A 2ZF5O 1BG3A 4IG0A 4CGFA 3LALA 3CCMN 4IWVA 4DTSA 1HYSA 2P9PA 2F8SA 4DG1A 5KPTA 1LWEA 1X9WA 1RBTA 3C95A 4WF9L 3CCQN 1Y97A 2D0CA 3QNOA 1JL1A 4WQ4C 3T69A 3FLCO 2E20A 1NJIO 2W40A 4GNIA 2PBDA 4CGIA 2YKNA 4J2BA 3J80O 3VGMA 1XWLA 4CJUA 5AQXA 3T1HK 1JLBA 3BF1A 3IUCA 1VAZA 1Q82O 3LDQA 4X64K 2JWKA 1XHZA 2F9TA 4FM1A 4J8FA 5LL6Z 4MFBA 5HRPA 1KAYA 5I42A 4AHVA 2O8CA 4FLXA 5IWAK 4HUEA 1QVFM 2HHWA 3DI6A 4M3WA 3DXKB 3CYMA 1NMDA 1WSEA 4C1NI 3N4QA 4B1VA 4CGDA 4J2EA 4DFMA 3TARA 3AVGA 3L8BA 3OS0A 4JK9A 3VQ5A 2FC0A 2ETJA 1VQLN 2ZJRL 4W5NA 3SJHA 5ADXA 3OJSA 2B5JA 4IJAA 2JGUA 4JYAK 1DEJA 1S6PA 2NRWA 1ZBHA 2KZMA 4DV1K 4U67L 4DR6K 5C12A 1IKVA 2HSTA 4CGJA 1TKDA 1B9DA 4CBWA 3FE1A 4M42A 1RBRA 2GUIA 3T1YK 2HHHK 3LDSA 3H1QA 4CD3A 4MO5A 4AM6A 4E1MA 1LV5A 3WNGA 4LF7K 1GLLO 3KZBA 3MCAB 3LPTA 3GBTA 3FZMA 3VEZA 2NRRA 1QTMA 5F1XA 3THWB 1IKYA 4CJPA 4X65K 5EOYA 2P9NA 3HZ6A 4A5AA 1KLNA 5AQOA 3V1RA 1OVYA 2IIRA 1W97L 4DQRA 4G1QA 1VSIA 4WFBL 1NGBA 4K8ZA 5JS2A 2P9SB 3VGLA 3VF2A 2FLOA 3O6WA 1YAGA 4R79A 4DV0K 2X6SA 4CF2A 4B3TK 2BDPA 3PY8A 1U47A 4FK2A 3OHRA 4RW9A 1V4SA 1KQSM 2A41A 3FFKB 3THXA 2HHXA 2G8HA 1RT3A 2Q3SA 1NU0A 2OPRA 2O8BB 1HPMA 1NMNA 4M7XA 3VESA 4AHRA 4M45A 4M3UA 4W5TA 2VG6A 3PV8A 3K9JA 2NRHA 5DM6L 4DS5A 2ZGZA 2QTDA 2A3ZA 4BRIA 5BPLA 1DKGD 4DQPA 3A8YA 3GDQA 3QEIA 1HMVA 3D2EB 3EZ5A 3RSEA 3CIPA 4OLAA 3O3GA 4PHTX 1QQOA 4JKAA 2E4LA 3SJJA 2DFEA 3QEWA 2O8DA 5AQRA 2W6LA 2CGKA 1KC8O 3MN7A 4DTNA 3PX4A 5AQYA 1VSKA 5KQDA 2HVHA 4BR5A 3SUQA 1KVBA 1GLBG 4JI8K 2VG5A 1YXQA 1KRPA 1SV5A 1OKJA 3SYZA 3CMAN 3QBXA 3CETA 1JLQA 5KRSA 3OBWA 1KFSA 2OPPA 2Z1JA 1ATSA 3D6RA 4B8CA 1Y64A 4BDYA 4FLWA 2QWLA 3G4SN 1EXQA 4CK3A 3A2FA 3EZWA 3KK1A 2AA4A 1C1BA 4B3MK 4W5OA 3BEXA 1I39A 2G8FA 4LF4K 3ZYYX 4YFUA 1NGCA 1BQNA 2FBTA 3K5OA 1QSLA 3NAEA 3KWIA 4FWNA 1S9EA 3O3HA 1WBDA 3C6HA 4Z4HA 5CHIA 4JI4K 1M90O 3UKUA 4KPYA 4XH1A 2IVNA 3VEVA 1RDAA 4CBXA 1GOCA 2OPSA 1K73O 1KCFA 1N32K 1W9HA 3ZEUA 1Q7YO 2F8TA 2KLAA 1O1WA 2Q97A 3DLBA 1ZBUA 1YTAA 2NRXA 4QAGA 1VQ8N 4O44A 3O9SA 4JLHA 3TAPA 4H0YB 2ZD1A 3SAGA 4DTMA 3E1YA 4NYNA 3M8SA 3SV4A 1BI4A 2FF3B 4FWPA 3EL2A 4B3OA 2ZWHA 3U8XA 4O8UA 2WOMA 4FJ9A 1C0TA 2D5RA 3PIPL 3LPUA 1YJ9N 3VF6A 3OYLA 2KFZA 3MX2A 2P9KA 3AA4A 4CZFA 1YT3A 4I2PA 4F2RA 1WSGA 1OH8A 2BTFA 3ZT4A 3LAKA 4QS9A 2V51B 4CEOA 4N41A 3QINA 3H1VX 1EWRA 2UXBK 3HM8A 1VQ4N 1GLAG 1NGGA 1IO2A 4ELUA 3QETA 2UXDK 1QHAA 4E7LA 3R9PA 3DRRA 4C23A 3J7YP 4X66K 5AZIB 3DWLA 2FSKA 4Z0UA 4O5BA 1BHLA 4JK7A 4PL8A 3KLGA 3OVNA 2F96A 1TK0A 5HP1A 1U2VA 2P9IB 5C0YA 4FWQA 4FJLA 3VQ8A 4IO9L 1D4XA 5FPEA 3ZCMA 1S1TA 1OH7A 1QE1A 2I7PA 3Q7CA 4ISFA 3I55N 3VQ6A 4B08A 3SUOA 4O8KA 4B1UB 3CXCM 3D2FA 2YNGA 3IMXA 4LH5A 4CVNE 4FJ7A 5AQPA 1S3XA 3CFRA 4HVJA 4LF6K 2VGMA 4CJTA 4KB1A 4EHUA 3J8AA 4CJQA 3S9HA 3ENBA 4I7FA 1HLUA 3FZLA 1SZ2A 4NO7A 2AP1A 4Z4IA 4A57A 3AAPA 2Z1HA 1WNSA 4CESA 3KK7A 4FJHA 4CZMA 4BRKA 2VWKA 2FBYA 2NRZA 3SUPA 3CMEN 3WXKA 4LF5K 2YJEA 3H3OB 3L2WA 1KSPA 1EQYA 4RG8A 4CJKA 4E7KA 4JI2K 4DUYK 3TAFA 1W7AA 1A5XA 2HW3A 1Z6RA 1UOCA 2FSJA 4CJ4A 3M8PA 4DQIA 3C6AA 5C2DA 1VSHA 4BR2A 4AHSA 4CGGA 4H5TA 3MWPA 3KLIA 4M3ZA 5FPNA 1LW2A 3BZCA 4J2AA 5AJ3K 4M3TA 4HHTA 5BRDA 4FJJA 2QWPA 2YCHA 1W0HA 5FLXO 2XHBA 2P9PB 3MEEA 3KWGA 2O8EA 4W5RA 5KPRA 3RMAA 4C8MA 4JKHA 1ZXOA 1XC9A 1NK8A 3SCXA 1K8KA 3K9KA 3CI5A 5T7BA 5J2PA 2E1YA 4YOXA 1VQON 1CZAN 3R6MA 3F5TA 3J7AP 1TKXA 3CC7N 1TKZA 4JNEA 4CEBA 3H3NO 3SI6A 4H4OA 1S6QA 2GWKA 4FPAA 3KTQA 3ATVA 2FSNA 4DV5K 1X9SA 3PO4A 3VQQA 3AVLA 3V6DA 2QXLA 4BC4A 2ZJQL 2O8CB 1Q81O 4PKIA 1F21A 3RMBA 4KTWA 2B6AA 3C6TA 4L8RB 3T7ZA 4DTXA 4CI6A 3ENOA 4GV9A 4CJEA 4B9MA 5KGWA 4OPKA 2RN2A 4FJGA 3LP1A 2A6AA 4YOVA 3O5BA 4DSJA 3MX5A 2RF2A 3SZ2A 2W41A 3S3NA 3LDOA 2HHVA 4WQ5A 3W3DA 1S1XA 5I3UA 4H5WA 3OYEA 4YY3K 2D0AA 5JLHA 1G99A 4IG3A 3MN6A 4CBUA 3S41A 3J7ZO 1JCFA 4BC5A 1CXUA 4FJNA 1C1AA 4IKFA 3VENA 1OH5A 4IDHA 3I8BA 3H6EA 3VGKA 1HKGA 4FLZA 4LFAK 4BRHA 4EFHA 3BDPA 2E5LK 2ZM6K 1RDDA 3OYNA 2BUPA 1BCMA 4H5NA 3L4QA 3TPQA 3TU5A 1VQNN 3LP0A 4X62K 3AVJA 4LF8K 3VTIA 3CCSN 1J5OA 1JJ2M 1FJGK 3JAMO 1C0UA 4NXNK 5AQVA 5KQ8A 1QZ6A 3G71N 3MXJA 5F2RA 2Z1IA 1NOYA 1TAQA 2V7ZA 4H5VA 5FROA 3MN9A 5FPDA 4Z94A 4JHDA 4BE1A 1KTQA 1ZYQA 1VSMA 1HKBA 2WBNA 1TK5A 4CF8A 1DT9A 4DFPA 5EVZA 3THXB 1JLFA 3HXMA 2RKIA 1JLAA 4CEAA 3A5MC 3P31A 4DTRA 3Q7BA 3NGIA 4H5RA 1JL2A 3M3ZA 4XEIA 3WXLA 4KB0A 3K58A 4ID1A 1C0FA 3QEPA 3SAFA 4DLEA 1NKCA 3TI0A 3WXIA 2O4IA 1J9AA 2Q0RA 3L2RA 4B9UA 5GADP 4BDPA 3SPZA 4IDKA 3OY9A 4DSEA 1JLCA 1HNXK 4GKKK 5AR0A 3G0ZA 3RSEB 4JV5K 4GY2B 2DY4A 2E8AA 2O8DB 4KRFA 3HT3A 4K25A 1QQMA 2KQ2A 4K8XA 2QK9A 3HOSA 1KVCA 4I9LA 4BC3A 4CCHA 4EIAA 1W2BM 4FWSA 3AO2A 3CHWA 1X1PA 3DM2A 1Z05A 3A5LC 3QB0A 3CM6A 4BRDA 4GVMA 1RCHA 2BANA 4RW6A 4H4MA 4NYFA 3HPGA 4OVLA 4JK8A 4DTOA 3DXMA 2GWJA 2VYPA 4DQQA 2ASPA 4Z4GA 3OBYA 5B8HA 2E2NA 3DLRA 4DSFA 1C6VA 4LSNA 3O4NA 5LJWA 1KAZA 3DLLL 1EETA 2YHYA 1BOTO 3ZSYA 1TYQA 4FK0A 4ELTA 3AVHA 3O3FA 3OA9A 2XY7A 2GUPA 4BG8A 4K42A 4QOZB 3I0SA 3MN5A 3U3GA 3E9LA 3HM9A 3V9XA 4IFEA 4FOIA 3UKUB 4GV6A 1C0MA 3RTVA 4GKJK 2QA4N 4F3TA 1ZBFA 1YIJN 1WOQA 3TAGA 2E2QA 3ZEUB 3NCIA 3LZJA 4FL9A 1S72N 3K57A 4CERA 5BRFA 2I5JA 3AO1A 5LMUK 1NK4A 1BI4B 1RNHA 3ENHA 3EO3A 3QESA 2E2PA 4BR4A 5AQNA 2P5GA 4NLCA 1GLCG 3SBGA 1RT6A 1ATNA 3S3MA 4HWIA 2Q0UA 5AZJA 2Y1JA 2ZGYA 3D45A 4FK4A 3KIOA 1VSDA 4FLYA 1J5EK 2P9KB 5JS1A 4DR1K 3NMUA 1HYZA 2P9LA 4YOUA 1HJOA 2YI1A 2HVIA 1TL1A 3SLCA 1GOBA 1WLJA 3WQTA 2B4JA 3VQ7A 4BDZA 3CM5A 1NGIA 4WFNL 3DLEA 4JKDA 4PKGA 2HHQA 2V52B 4FJ8A 3OYGA 4MLEA 4Y1CA 3KVGA 4KAZA 3LL3A 4IO8A 2F9WA 3AVKA 4JKEA 4BRNA 2NNWA 3CF5L 1YHQN 4EP4A 3O4QA 4L3QA 3CG7A 1JCEA 1Q18A 3HPOA 3WXJA 2F7TA 4DV2K 4Q5VA 1U2VB 4ILHA 3I0RA 3DLHA 1RGIA 1LOTB 2A5XA 5BN8A 4DQ8A 5BR9A 4HCBA 5C15A 4CJRA 3FFIA 3VN5A 1FKPA 1NOZA 3UE5A 5EXWA 3ID8A 3D2FB 1UA0A 1T44A 4DFJA 4I6MA 2P1JA 3GL1A 2W42A 4GW6A 3D0PA 2YHAA 1LAWA 1NGAA 4KV8A 4DB3A 3THYA 4JRPA 5JICA 3H45C 1QSYA 4CJVA 3I56N 1L3UA 1P90A 3VEWA 4BQLA 4KHQA 4IFVA 1DGKN 2ASOA 3MWTA 4CHYA 1BWFO 3VEXA 4OPHA 4BVOA 4N56A 4E7HA 1VQKN 2G8KA 1CZBA 3CJAA 1ZC6A 3ZETA 1VQMN 3C65A 1X9JA 4CGHA 3O8MA 1S5JA 4H03B 4ID5A 1ESVA 4FJXA 3BP8A 4BROA 4B3SK 3IAYA 4CIFA 1NK6A 3ISNC 5BPMA 3DRPA 3CJ1A 2IS3A 3RRGA 2JLEA 3J81O 3QEXA 1BGXT 1HYVA 4A5BA 3CFPA 5GINA 3KKRA 4I9QA 3EY1A 3TANA 4FWLA 4KHWA 2HNYA 2UXCK 2QWRA 3MXIA 1NBWA 3HTVA 1JLEA 4WE1A 1VQ6N 2HNZA 3T3FA 3JSMA 4F3OA 3U6FA 1NGJA 2OZMA 3LM9A 4WCEL 1RDWX 4KI6A 1B9FA 5DK5A 1HNIA 4FWMA 3AO5A 1QZ5A 3M6GA 3IG1A 3P5JA 4OKJA 4E19A 4K43A 4ILGB 2O8EB 4Y0WA 4M7YA 1YVNA 4H0VB 5H1SQ 5AQIA 1K8KB 3QICA 5LY3A 3EN9A 2Q31A 1XI1A 3L3VA 1TAUA 2OYQA 4E1NA 2HHSA 1EKEA 4FCYA 4OKKA 4CW7B 3VA3A 4AQYK 3ZSXA 3CCRN 2LSNA 5EY4A 3QFUA 4DR5K 4JI7K 4B3RK 3RWUA 3ZT0A 4G9ZA 3ULEA 2PFUA 3VERA 3UIQA 3SPYA 4N76A 1JLGA 1DTQA 4WYBA 4YNQA 3R8EA 2PYLA 2IC3A 1YF5L 4A59A 4C8OA 3M5RA 4DCHA 2GBZA 1FXXA 2VGNA 3NHGA 4NCBA 2XY6A 3U9DA 3LZIA 2HBJA 1MDUB 1RBUA 4V19S 5CZ1A 4CZEA 1MWKA 1XQSC 1NM1A 2P51A 2Z1GA 4ISEA 4KH5A 3B6PA 4BGBA 2QWOA 4JS5A 1QSSA 5GIPA 1T8EA 4WQ4A 4IEIA 3V9ZA 1KFDA 1KVAA 1IG9A 1U4BA 4LF9K 2WC9A 4OPAA 5CR4A 1RDBA 1R0AA 4GVEA 4FXDA 1NGEA 5TKYA 2G8UA 3E66A 3VETA 3V1OA 4YDUC 4RW4A 3HP9A 3IDHA 1YUWA 4UY8O 3L2UA 3AVCA 3P38A 3HL8A 2OANA 1KXPA 4R5PA 4DTUA 4Y1DA 3V4IA 4I2QA 2E1ZA 1RDUA 3TSUA 4NCGA 2X6NA 3AY9A 4CD1A 1XMOK 4CZJA 1N34K 4Z4FA 4E89A 2D0BA 1SKRA 4B1ZA 2DFHA 1KAXA 5BRHA 3OYFA 4JI3K 4CEEA 3KLFA 3K2PA 1XNRK 4DR7K 4EHTA 1VSEA 3DOLA 5E26A 4HUGA 1N8RO 4FWRA 4JHDB 1CLQA 3VF4A 2KKZA 2OCEA 3B6OA 3QIPA 4AF1A 3AARA 2QEXN 3HO1A 3L2VA 3VQBA 3R1XA 3NF6A 1RTJA 3SBTA 4RW8A 4DWIA 2VWJA 4J2DA 5JVGL 4CF0A 1HUXA 1T3VA 4H0XB 1TK8A 3PSIA 1NJYA 3V9WA 4DF8A 4BE0A 4KREA 1S9GA 2YV0X 1NJZA 3R3LA 4C1NK 2I7NA 3L4IA 1UA1A 2W6KA 1L3TA 5J2NA 1HPZA 3KK2A 2CH5A 3QDKA 4C8NA 1VK0A 1WAJA 2R7YA 4A61A 3AVAA 5ADXH 3M1FA 3L3UA 3MAQA 3HPHA 3OYMA 4OKEA 3CC4N 3MEDA 4AM7A 3AA2A 2PAVA 4JD2A 4DR4K 4B1YB 3P4IA 4IZ9A 5J2QA 5HRNA 1WAFA 1VHXA 3DXMB 5AQZA 4JKFA 3TTFA 3WXMB 3CC2N 5CYQA 4OO1J 3CCVN 1U49A 1TYQB 2E2OA 3FGUA 5AQQA 4BY9C 3JS6A 3NFAA 3PUFA 1IKWA 2YNIA 3QNNA 3CPEA 2XY8A 4ELVA 1QQCA 1YVUA 3VA0A 1VSLA 5HBMA 2UUCK 4PA1A 1Z26A
chains in the Genus database with same CATH topology
4NB4A 1Z05A 3A5LC 3FFKB 3QB0A 2QI2A 4BRDA 1M1KO 1SAZA 4JK8A 2OTJN 1HPMA 3DXMA 4M7XA 3VESA 4BRCA 2GWJA 2YHWA 2VYPA 3DJCA 3BF3A 2ASPA 5AQHA 3D7EO 3OBYA 5B8HA 2E2NA 3K9JA 1C0GA 2NRHA 5M1QA 3NVKA 5LJWA 5DM6L 1KAZA 2JWLA 3DLLL 2ZGZA 3G25A 2QTDA 4MDAA 2A3ZA 4BRIA 2YHYA 3ATUA 5BPLA 1BOTO 1DKGD 1IG8A 1TYQA 1HX1A 5BN9A 3A8YA 3PIOL 3GDQA 3UKRB 3IKMA 2BH1A 3OA9A 1VQ9N 2HF3A 2P9SA 3D2EB 4QS8A 3RSEA 2GUPA 3CIPA 4EAHD 4ISGA 4BG8A 4PHTX 5AZJB 1QQOA 4JKAA 3OW2M 4K42A 1VQ5N 5AQRA 2CGKA 2D4WA 3MN7A 3MN5A 3E9LA 3O1WA 1KC8O 4IFEA 1Q86O 4FOIA 3UKUB 5GAGP 2HBKA 4GV6A 5AQYA 5KQDA 2QA4N 2P9LB 4BR5A 4RWTA 1GLBG 1E4FT 1YIJN 5ELZA 1YXQA 1V4TA 1WOQA 4JKBA 2E2QA 3ZEUB 5EX5A 3HI0A 1BA1A 2VCPA 4BR9A 4FL9A 1S72N 1OKJA 3CMAN 3QBXA 1GLEG 3CETA 4GV3A 5LJVA 2NZTA 5BRFA 1X3NA 3TSPA 1BUPA 3OBWA 2Q2RA 1R59O 2CGLA 5FPMA 1ATSA 3D6RA 1Y64A 3VEOA 5AQTA 3IFRA 3ENHA 4YORA 5GIOA 3EO3A 2QWLA 2E2PA 3G4SN 4IXCA 4BR4A 5AQFA 3EZWA 3W0LA 4CZHA 3CJ9A 2AA4A 5AQNA 3UKRA 3BEXA 4FVUA 5FPEA 3D2EA 1E4GT 4NLCA 1GLCG 4IJNA 3MMVA 1X3MA 3SBGA 3ZYYX 1NGCA 1ATNA 1T6DA 4HWIA 3WT0A 5AQGA 3KWIA 1WUAA 4FWNA 2Q0UA 4JKGB 5AZJA 3A5OC 4KH6A 3FR0A 4U7BA 2ZGYA 1LCUA 3C6HA 5CHIA 1XUPO 3O1BA 1M90O 3UKUA 4XH1A 2P9KB 2IVNA 3NMUA 3VEVA 2P9LA 2QM1A 4YOUA 1HJOA 4B1WB 2YI1A 3O9QA 3SLCA 4CBXA 1K73O 2J4RA 3WQTA 1U6ZA 3WEEB 1ATRA 1SS6A 2HBMA 4NLBA 1NGIA 4WFNL 3ZEUA 3N4PA 4JKDA 1Q7YO 2KLAA 4PKGA 4PL7A 2Q97A 2QW9A 2V52B 1GLDG 2NRXA 4MLEA 5E84A 3KVGA 4I6MB 1S22A 4FWOA 3LL3A 1VQ8N 3O9SA 3CCJN 1TUUA 1GLJO 4IO8A 4H0YB 3SAGA 2F9WA 3E1YA 4JKEA 4BRNA 4CZKA 2NNWA 2ASMA 2FF3B 4FWPA 3B8AX 3EL2A 3CF5L 3EKSA 4A2BA 2ZWHA 5JVHL 1YHQN 3U8XA 5M1FA 4O8UA 2WFBA 2H3GX 4L3QA 4H0OA 1JCEA 1Q18A 2A40A 3WXJA 4IOAL 2F7TA 5AQLA 3TTDA 3CQYA 3TTCA 1U2VB 4JKGA 4ILHA 3PIPL 4E1JA 1YJ9N 1RGIA 3VF6A 1LOTB 3ZETB 4BQZA 3MX2A 4BR0A 3L0QA 4XH4A 2A5XA 2P9KA 2ZJPL 4CZFA 5BN8A 2D1KA 1JCGA 2BTFA 3C0BA 4DQ8A 4QS9A 2DPNA 3WQUA 4XH5A 4JEPA 5BR9A 5C15A 5AFUA 2V51B 4JN4A 1SQKA 2CGJA 3UE5A 3H1VX 5AQWA 3WEEA 4BG9A 5EXWA 5M1KA 3ID8A 3HM8A 3D2FB 1VQ4N 1GLAG 3QFPA 3RVCA 1NGGA 1T44A 1QVGM 2NLXA 3CPWM 3KHYA 3P39A 4I6MA 2GX9A 2UYTA 4BRGA 2Q36A 1QHAA 3GL1A 5M1OA 3R9PA 4IOXA 4C23A 3ZX0A 1YJNN 5AZIB 2RE2A 1NGAA 2FSKA 3DWLA 4DB3A 5BREA 4JAXA 5JICA 3H45C 3I56N 5C10A 1P90A 4JK7A 3O80A 3VEWA 4PL8A 1NWKA 2ITMA 4BQLA 1DGKN 3C7NB 2ASOA 1U2VA 3MWTA 2P9IB 1BWFO 3VEXA 5C0YA 3DAWA 5HL7L 4FWQA 4KBOA 2KHOA 4OPHA 4BVOA 5M1NA 4M63C 4IO9L 1VQKN 1D4XA 2NRTA 2QWMA 1ZC6A 2GTDA 3CJAA 3F2KA 3C65A 3QBWA 3ZETA 1VQMN 4FOEA 1X9JA 3O8MA 1BO5O 2GEMA 4H03B 1ESVA 2I7PA 4O5FA 4BRPA 1NGHA 3Q7CA 3BP8A 4ISFA 3VOVA 4BROA 3I55N 4FO0A 5BPMA 3CJ1A 4O8KA 3WUHA 4B1UB 3CXCM 4B1XB 3D2FA 5F0XA 3CD6N 3IMXA 4A5BA 4FWKA 5GINA 5AQPA 1S3XA 4YOYA 4FWLA 4BRAA 2VGMA 4ILJA 2HMPA 1T6CA 5AZIA 1BA0A 2QWRA 3LDNA 3O9TA 4EHUA 3J8AA 5AQMA 1NBWA 3HTVA 1VQ6N 4DHYA 3EE8A 1YI2N 3CJCA 3ULEB 3ENBA 2E88A 3C7NA 1HLUA 3FZLA 1SZ2A 4NO7A 3BUZB 2AP1A 2P9IA 2NRVA 4A57A 1NGJA 3AAPA 2HF4A 4CJ7A 2D0PA 3CCLN 3VEYA 3LM9A 1ZBSA 4WCEL 3KK7A 1RDWX 2YHXA 4CZMA 3O9RA 4FWMA 3FZKA 1QZ5A 3ID6A 3M6GA 4BRKA 5AQKA 1YITN 3LDPA 4HTLA 4K43A 4ILGB 4A2AA 4Y0WA 4M7YA 2P9NB 2NRZA 3CCUN 3CMEN 3WXKA 4BRMA 1YVNA 4H0VB 2YJEA 3EE9A 3H3OB 2YX6A 5H1SQ 4MLHA 1NLVA 5AQIA 1EQYA 1K8KB 3TSQA 3QICA 3CQXA 5LY3A 3CERA 3EN9A 2Q31A 4RTFD 4MDBA 1Z6RA 2QWQA 5AQUA 2FSJA 2VWBA 4FPBA 3C6AA 1XC3A 4CZLA 4BR2A 5C2DA 5JLFA 3CCRN 5EY4A 3QFUA 4H5TA 3MWPA 3QMLA 4G9ZA 1MA9B 3ULEA 2PFUA 3VERA 3FZFA 5FPNA 3VMFB 1BDGA 2V7YA 5AQJA 4WYBA 3R8EA 3L6QA 4YDUA 4F9OA 1YF5L 4A59A 2D0OA 5BRDA 2Q1NA 4H0PA 2QWPA 1H1VA 2YCHA 3GE1A 3M5RA 4QS7A 4DCHA 5MLCQ 2P9PB 3SMPA 2VGNA 1KD1O 3VTHA 3KWGA 4A62A 3U9DA 2HBJA 4BC2A 4BVPA 5BPNA 4BRQA 1J6ZA 3MDQA 3U9ZA 5KPRA 3A0IX 1MDUB 3GG4A 5HOOA 4CZEA 1ZXOA 3CJ7A 1MWKA 1XQSC 1NM1A 1NGFA 4FSVA 3LM2A 4JKHA 2P9UB 3HRGA 4ISEA 4KH5A 5AFUH 1K8KA 4BGBA 3K9KA 3CI5A 3NVMA 2QWOA 3O4WA 5GIPA 4BGAA 2E1YA 4WQ4A 5AQSA 4LC9B 4YOXA 4IEIA 4IEEA 3H46O 2CH6A 4YOTA 2WC9A 1VQON 1CZAN 1HKCA 3R6MA 1EO1A 4OPAA 5CR4A 4IOCL 3F5TA 5C2FA 3HOTA 4CZGA 3CC7N 1YJWN 4GVEA 1NGEA 5TKYA 3E66A 1O13A 3VETA 1IJJA 1P8ZA 4JNEA 3AAQA 4BREA 3H3NO 4YDUC 3G6EN 3IDHA 2ZF5O 1YUWA 3JXUA 1BG3A 4UY8O 2GWKA 4FPAA 2HBLA 3ATVA 2FSNA 3P38A 2OANA 3CCMN 1KXPA 1QQNA 4IWVA 2QXLA 4BC4A 2ZJQL 1Q81O 4PKIA 2P9PA 2E1ZA 1RDUA 3TSUA 4JKCA 3MK6A 3T7ZA 1K8AO 3AY9A 3ZX2A 4CD1A 5KPTA 4CI6A 4CZJA 3ENOA 4GV9A 4WF9L 3CCQN 2P9UA 4WQ4C 1RFQA 3FLCO 2E20A 3T69A 4YOWA 4B1ZA 1NJIO 2W40A 2A6AA 4YOVA 2OTLN 4GNIA 2PBDA 3O5BA 1KAXA 2WUSA 5BRHA 3VGMA 3MX5A 5AQXA 2W41A 4K41A 4BRLA 3LDOA 3BF1A 4WQ5A 3W3DA 3IUCA 4EHTA 1VAZA 1Q82O 3I33A 3LDQA 4H5WA 5E26A 5JLHA 1G99A 4CBUA 3MN6A 2JWKA 1N8RO 2GELA 4FWRA 3EKUA 3S41A 5DM7L 4B9QA 2F9TA 2RHKA 4JHDB 1VQ7N 2QWNA 4J8FA 3J7ZO 2HOEA 2KKZA 3VF4A 1JCFA 4BC5A 4AF1A 3AARA 2QEXN 1KAYA 4JD2B 3VENA 3LDLA 3E9OA 4H0TB 3R1XA 5GAHP 3SBTA 4BRFA 1QVFM 3U4LA 4DKWA 5JVGL 3UB5A 4IDHA 3I8BA 3H6EA 3O08A 1HUXA 1K9MO 1T3VA 4WFAL 4H0XB 3VGKA 1HKGA 3DXKB 1NMDA 5I9EB 3F9MA 4BRHA 4C1NI 4EFHA 2FXUA 3N4QA 5JMVA 4B1VA 1NGDA 2BUPA 4H5NA 5KPZA 3R3LA 4BR7A 3O9UA 4C1NK 2I7NA 3L4IA 1ILYA 3L4QA 4JK9A 3TPQA 3TU5A 3VPZA 1VQNN 5GAEP 1VQLN 2ZJRL 3FZHA 3SJHA 3VTIA 3CCSN 1JJ2M 4WQ5C 5ADXA 3SK3A 2CH5A 3QDKA 1QZ6A 5AQVA 4IJAA 5KQ8A 3G71N 3CCEN 4A61A 5CE3A 5F2RA 4PKHA 1DEJA 2NRWA 5ADXH 3CJBA 3M1FA 4U67L 2V7ZA 4H5VA 3MN9A 5FPDA 4Z94A 5C12A 2HSTA 5M1PA 4JHDA 3CC4N 4AM7A 1HKBA 3AGRA 2WBNA 4CBWA 2PAVA 3FE1A 2FF6A 4JD2A 1DT9A 1GLFO 4B1YB 5EVZA 3H1QA 3SAHA 3P4IA 4IZ9A 4CD3A 4MO5A 4AM6A 3PLAA 3A5MC 3P31A 3SMSA 1GLLO 3DXMB 3MCPA 4MO4A 5AQZA 3KZBA 2A42A 3MCAB 3DXKA 4JKFA 3GBTA 3TTFA 3Q7BA 3FZMA 3VEZA 3WXMB 2NRRA 3CC2N 5F1XA 2YJFA 4H5RA 5EOYA 3M3ZA 4RCHA 2P9NA 3HZ6A 4XEIA 3WXLA 4A5AA 3GOIA 1C0FA 5AQOA 4CZIA 1VQPN 3SAFA 4OO1J 1OVYA 2IIRA 3WXIA 1W97L 3CCVN 1TYQB 2Q0RA 3HBTA 5GADP 4WFBL 3E9PA 1NGBA 3ZX3A 2E2OA 2P9SB 3FGUA 5AQQA 4BY9C 5AR0A 3RSEB 3VGLA 2EWSA 3JS6A 3VF2A 2FLOA 3HSCA 1YAGA 3O6WA 4R79A 2IVOA 3AGKA 4GY2B 4KH4A 2E8AA 5TKWA 1MWMA 3CPEA 1TUYA 1BU6O 4K25A 1QQMA 3HOSA 3A5NC 4BC3A 3OHRA 4EIAA 1W2BM 1V4SA 2IVPA 1KQSM 2A41A 4FWSA 3CHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9J A;  3F2K A;  3HOS A;  5CR4 A;  2F7T A;  5HOO A;  3HOT A;  4U7B A;  3K9K A;  4MDB A;  4MDA A;  4R79 A; 
#chains in the Genus database with same CATH topology
 4NB4 A;  1CZ9 A;  2QI2 A;  1SAZ A;  2OTJ N;  2YHW A;  1EP4 A;  3DJC A;  5AQH A;  3I8D A;  2XY5 A;  2IAJ A;  1HRH A;  2DTU A;  5KTQ A;  3NE6 A;  3ATU A;  1IG8 A;  3RMD A;  3VQD A;  1HX1 A;  1ITG A;  4CE9 A;  4E3S A;  1BIZ A;  2BH1 A;  3K5L A;  2HF3 A;  1VQ9 N;  5HRO A;  4DLG A;  1LWC A;  4EAH D;  5AZJ B;  3OW2 M;  1SUQ A;  5DMR A;  1SL1 A;  2D4W A;  4CJF A;  3ASM A;  2QXF A;  1Q86 O;  5GAG P;  1S1U A;  2HBK A;  4BWJ A;  4Z4E A;  2P9L B;  4KTQ A;  1E4F T;  2E6L A;  5ELZ A;  4EZ9 A;  1V4T A;  1MU2 A;  1IH7 A;  5EX5 A;  3HI0 A;  1DTT A;  4FJ5 A;  2VCP A;  4BR9 A;  3QER A;  1S1W A;  1SKS A;  1GLE G;  4GV3 A;  4DTJ A;  2QKB A;  1X3N A;  3TSP A;  1BUP A;  4JI1 K;  2Q2R A;  1IBK K;  1LW0 A;  2CGL A;  3BY5 A;  2Y1I A;  5AQT A;  4IXC A;  5AQF A;  4DF4 A;  3W0L A;  3UKR A;  4FVU A;  5HRR A;  4W5Q A;  3RMC A;  4IJN A;  3MMV A;  4KHP K;  1T6D A;  3LP2 A;  4RW7 A;  4CHZ A;  5AQG A;  1NNE A;  1BIU A;  3ZSZ A;  4KH6 A;  3SQ2 A;  4DTP A;  1LWF A;  3AVN A;  2QM1 A;  4ZHR A;  4TSX A;  3O9Q A;  1HJR A;  4K0K K;  2J4R A;  1U6Z A;  1ATR A;  1SS6 A;  2HBM A;  4KFB A;  3N4P A;  4BAC A;  4B9T A;  1U45 A;  4I6M B;  3VQA A;  1TUU A;  3DRS A;  2ASM A;  4CZK A;  4FJM A;  4M3R A;  3THY B;  1DLO A;  3B8A X;  3EKS A;  4A2B A;  5M1F A;  1HQU A;  1NK5 A;  1Q9X A;  4JI5 K;  2WFB A;  2H3G X;  4IOA L;  3TTD A;  3CQY A;  4JKG A;  4C8K A;  3ZLJ A;  4E1J A;  3HP6 A;  3KD1 E;  2IDO A;  3ZET B;  4O4G A;  3L0Q A;  4XH4 A;  4KKO A;  4CJ5 A;  5C42 A;  4CHN A;  1NKB A;  2A1R A;  2D1K A;  1JCG A;  2DPN A;  4JEP A;  3OTO K;  4JN4 A;  3T1A A;  4CF9 A;  2CGJ A;  2HB5 A;  5AQW A;  5M1K A;  3WEE A;  2XO7 A;  3RVC A;  3OS1 A;  1EWQ A;  1Z25 A;  3AV9 A;  2ITG A;  3P39 A;  2GX9 A;  2UYT A;  2VQE K;  2YHB A;  1BL3 A;  2E6M A;  3HYF A;  3CQ8 A;  1NK7 A;  3F73 A;  2RPI A;  1TV6 A;  2RE2 A;  1D9D A;  1LAV A;  1CXQ A;  5C10 A;  4KI4 A;  4MQ3 A;  3DAW A;  3OYC A;  4CHQ A;  4KBO A;  2KHO A;  5M1N A;  4M63 C;  2QWM A;  2GTD A;  5C25 A;  4FOE A;  1BO5 O;  4HUF A;  1I94 K;  3NDK A;  4FLV A;  3TAE A;  4CHP A;  1ASV A;  3HVR A;  3TAM A;  3WUH A;  4N5S A;  5CYM A;  3OJU A;  3AVB A;  5SWM A;  2VQF K;  3OYJ A;  4ICL A;  1RBS A;  3CD6 N;  5C24 A;  4FWK A;  1KLM A;  3LAN A;  1UAX A;  3LP3 A;  4YOY A;  3V9U A;  4BRA A;  1U04 A;  3K59 A;  1T6C A;  5J1E A;  2KTQ A;  5FRN A;  1BA0 A;  2P5O A;  5BR8 K;  1GOA A;  1C1C A;  4FW1 A;  1ASW A;  3OYD A;  4DHY A;  1YI2 N;  4KHU A;  3ULE B;  2E88 A;  3C7N A;  1VRT A;  1IBM K;  1IKX A;  2NRV A;  4CFB A;  4FLU A;  2A1S A;  4F2S A;  1ZBS A;  1RT5 A;  1QHT A;  3V1Q A;  4OPJ A;  4AHC A;  3O9R A;  1YIT N;  3LDP A;  2HHT A;  3U3Y A;  4FZZ A;  1RIL A;  3VQE A;  3EE9 A;  2YX6 A;  2X78 A;  4MLH A;  3CQX A;  1SL0 A;  3WNH A;  4CJW A;  4MDB A;  4NXM K;  1N5Y A;  3ZSQ A;  2VWB A;  4M3X A;  4CZL A;  5JLF A;  1SKW A;  4E0D A;  3DLK A;  3KLE A;  3HVT A;  3ULD A;  1MA9 B;  3FZF A;  3VMF B;  1D5A A;  1BDG A;  1QS4 A;  5AQJ A;  4DUZ K;  4KHN A;  2KFN A;  5CZ2 A;  4DS4 A;  4H0P A;  1H1V A;  1K6Y A;  5MLC Q;  3SMP A;  2WTU A;  1KD1 O;  4A62 A;  4BC2 A;  5BPN A;  2O8F B;  4BWM A;  3KKS A;  3MEG A;  3HRG A;  3NVM A;  3O4W A;  4DV3 K;  4M3Y A;  3DLG A;  4OLB A;  2YNH A;  4BGA A;  4NCA A;  5AQS A;  3SQ1 A;  3ZT1 A;  4CF1 A;  3H46 O;  2CH6 A;  1HKC A;  1EO1 A;  4IOC L;  5C2F A;  3HOT A;  1WSH A;  2EX3 A;  4CZG A;  2HMI A;  1YJW N;  1BIS A;  1P8Z A;  3JXU A;  3PX6 A;  2HBL A;  4ZTJ A;  4KHY A;  1BCO A;  1QQN A;  1JXE A;  4FLT A;  1XNQ K;  3VQP A;  4CFA A;  4LD0 A;  1WSJ A;  4JKC A;  3MK6 A;  1K8A O;  3ZX2 A;  1T05 A;  2AJQ A;  1WSF A;  3OYB A;  2P9U A;  1RFQ A;  4YOW A;  4CEC A;  2HHU A;  4FZY A;  2OTL N;  2WUS A;  4UQG A;  2ZQB A;  3BGR A;  3S3O A;  4K41 A;  4BRL A;  2WON A;  3WNF A;  3I33 A;  2GEL A;  5DM7 L;  1WSI A;  3EKU A;  2GV9 A;  4B9Q A;  3BZK A;  2RHK A;  4BE2 A;  1VQ7 N;  2QWN A;  2HOE A;  4JD2 B;  4Q0B A;  3LDL A;  3E9O A;  4H0T B;  5GAH P;  4BRF A;  5SZT A;  1E3M A;  3U4L A;  3KLH A;  4FZX C;  1RT4 A;  4DKW A;  3UB5 A;  4CJ3 A;  4CHO A;  3O08 A;  3IS9 A;  1K9M O;  4WFA L;  1RT2 A;  3VQ9 A;  1NG9 A;  3VQ4 A;  5I9E B;  3F9M A;  2FXU A;  5JMV A;  3F9K A;  1NGD A;  5KPZ A;  4BR7 A;  3O9U A;  1ILY A;  4O0J A;  3VPZ A;  3ZT2 A;  5GAE P;  3TR8 A;  3FZH A;  4WQ5 C;  3ALY A;  1L3S A;  4B9S A;  3SK3 A;  1RTH A;  3CCE N;  5CE3 A;  3TAQ A;  4PKH A;  3CJB A;  4LFC K;  3AA5 X;  5M1P A;  3AGR A;  2HND A;  2FBX A;  2OZS A;  2FF6 A;  1GLF O;  3AO3 A;  4KHS A;  1REV A;  3SAH A;  4DSK A;  4AIL C;  3PLA A;  3NH1 A;  1N6Q A;  3SMS A;  4B9N A;  3MCP A;  4MO4 A;  2A42 A;  3AO4 A;  3E01 A;  3DXK A;  1HR0 K;  2YJF A;  3LAM A;  5AFU A;  4RCH A;  4DSL A;  3ZT3 A;  3K5N A;  3T19 A;  3GOI A;  4CZI A;  1VQP N;  1TL3 A;  1RT1 A;  1VSF A;  2G8W A;  3HBT A;  2IOC A;  3E9P A;  4CFC A;  3ZX3 A;  1SL2 A;  4FYD A;  2EWS A;  2DFF A;  3HSC A;  2ATQ A;  2IVO A;  3AGK A;  4KH4 A;  5TKW A;  1MWM A;  1TUY A;  1BU6 O;  3NBP A;  1ZBL A;  3A5N C;  2PY5 A;  1EX4 A;  2IVP A;  3V9S A;  3ZSO A;  3KJV A;  3PSF A;  1M1K O;  4CEF A;  3NH0 A;  1J54 A;  1A5W A;  1D8Y A;  1D9F A;  3DOK A;  5FRM A;  4BRC A;  3BF3 A;  3D7E O;  3THW A;  4HTU A;  3IRX A;  4PWD A;  1C0G A;  5M1Q A;  1Q8I A;  5A2Q O;  3TAB A;  3NVK A;  2O8F A;  2JWL A;  3G25 A;  4MDA A;  2UUA K;  4CEQ A;  5BN9 A;  5LMN K;  3PIO L;  3QO9 A;  3UKR B;  3IKM A;  2P9S A;  3DMJ A;  4QS8 A;  4F8R A;  4ISG A;  4DR2 K;  3LWM A;  1VQ5 N;  5FDL A;  3O1W A;  4DU1 A;  3MXM A;  4DV7 K;  1Q9Y A;  3AVM A;  3VQC A;  4RWT A;  3L2Q A;  3AVF A;  3ITH A;  4FJI A;  4JKB A;  1JXB A;  3HST B;  2O8B A;  1BA1 A;  2NUB A;  3EEQ A;  5LJV A;  2NZT A;  3K5M A;  2G8I A;  4OGC A;  1R59 O;  4CJS A;  5FPM A;  3OYA A;  3V81 A;  3NF8 A;  3VEO A;  5GIO A;  3IFR A;  4YOR A;  3THV A;  3QEV A;  4AHT A;  3CJ9 A;  4CZH A;  3NH2 A;  4DSI A;  1FW6 A;  4B9L A;  3D2E A;  1E4G T;  2ZE2 A;  4N47 A;  1X3M A;  3EYZ A;  2XRI A;  1RTI A;  3WT0 A;  2QKK A;  1WUA A;  4JKG B;  3MEC A;  3P83 D;  3SQ4 A;  3A5O C;  3FR0 A;  4U7B A;  3PO5 A;  1LCU A;  1WN7 A;  1XUP O;  3O1B A;  2PYJ A;  1WBB A;  1RT7 A;  4EP5 A;  4IBN A;  4JI6 K;  4OJR A;  4B1W B;  3SUN A;  2PZS A;  4ZTF A;  4IFY A;  3WEE B;  3RR7 A;  4NLB A;  4CEZ A;  4PL7 A;  1OH6 A;  2QW9 A;  3SNN A;  1GLD G;  5E84 A;  4CJL A;  1S22 A;  4FWO A;  4DU4 A;  4CIE A;  4Z4C A;  3WNE A;  3CCJ N;  3OS2 A;  1GLJ O;  3CFO A;  3TWH A;  2OA8 A;  1NK9 A;  3NGY A;  5CY4 A;  1VRU A;  3OYI A;  4CK1 A;  4B9V A;  1HQE A;  1I3A A;  5JVH L;  1OVQ A;  4DV6 K;  2KZZ A;  4H0O A;  1FK9 A;  1BQM A;  2A40 A;  1ASU A;  3NF7 A;  5AQL A;  3TTC A;  1ZBI A;  3M8R A;  4C8L A;  1N33 K;  4BQZ A;  1G15 A;  4BR0 A;  3AA3 A;  2ZJP L;  2UUB K;  1TVR A;  4QCL A;  3C0B A;  4DR3 K;  3WQU A;  3G10 A;  4XH5 A;  1WB9 A;  1XMQ K;  1XHX A;  4LSL A;  1SQK A;  1RDC A;  4BG9 A;  4H8K A;  3QFP A;  4PUO A;  4DU3 A;  1QVG M;  1B92 A;  2NLX A;  4DMN A;  4E7I A;  4DQS A;  3CPW M;  3KHY A;  4BRG A;  5HLF A;  3M8Q A;  2Q36 A;  1NJX A;  5M1O A;  4IOX A;  3ZX0 A;  1YJN N;  5BRE A;  1S1V A;  4JAX A;  3OYH A;  4O55 A;  4YHH K;  3O80 A;  3H08 A;  4DV4 K;  1NWK A;  2ITM A;  3C7N B;  3QIO A;  1A5V A;  5K14 A;  5HL7 L;  1UWB A;  4CK2 A;  3F2K A;  2NRT A;  3SV3 A;  1VSJ A;  3QBW A;  4E7J A;  3HJF A;  4FW2 A;  4DFK A;  1HNV A;  2GEM A;  2FBV A;  3C6U A;  4M41 A;  1T03 A;  4O5F A;  1TKT A;  4BRP A;  1NGH A;  4OGE A;  3VOV A;  1TGO A;  4FM0 A;  4FO0 A;  5D3G A;  5KRT A;  4B1X B;  2KW4 A;  5F0X A;  3K0S A;  3P1G A;  3KK3 A;  4JI0 K;  1X9M A;  4JS4 A;  5KI6 A;  5KGX A;  2EHG A;  3KD5 E;  4ILJ A;  2HMP A;  3QLH A;  5AZI A;  4KTZ A;  3LDN A;  3O9T A;  2O4G A;  1IV0 A;  5AQM A;  3JYT A;  3EE8 A;  3CJC A;  3NF9 A;  1FKO A;  4CFD A;  3BUZ B;  4F4K A;  4FJK A;  2BGG A;  2P9I A;  4CJ7 A;  2HF4 A;  2D0P A;  3CCL N;  3VEY A;  4PQU A;  4CED A;  2X74 A;  2YHX A;  4GMJ B;  2YNF A;  3FZK A;  3ID6 A;  5AQK A;  4HTL A;  4A2A A;  4EZ6 A;  2P9N B;  4AHU A;  1NJW A;  1U48 A;  3CCU N;  4HCC A;  4BRM A;  2OPQ A;  1NLV A;  3TSQ A;  3ZSR A;  1T7P A;  3OYK A;  3CER A;  3RR8 A;  4RTF D;  1NK0 A;  2QWQ A;  5AQU A;  3RRH A;  4FPB A;  1XC3 A;  1L3V A;  1NKE A;  4O0I A;  3AVI A;  3LWL A;  2BE2 A;  3HK2 A;  3QML A;  4LH4 A;  2UU9 K;  2VG7 A;  4B8A B;  1YTU A;  2V7Y A;  4XIU A;  3L6Q A;  4YDU A;  4F9O A;  2D0O A;  5E41 A;  4PY5 A;  2Q1N A;  3GE1 A;  4QS7 A;  3NGZ A;  4KO0 A;  3VTH A;  1IBL K;  4LY7 A;  4BVP A;  4BRQ A;  1J6Z A;  3MDQ A;  3U9Z A;  3A0I X;  3GG4 A;  5HOO A;  3CJ7 A;  4FSV A;  1NGF A;  5HRS A;  3LM2 A;  2P9U B;  3DYA A;  4FVM A;  5AFU H;  1N36 K;  1HNZ K;  1RTD A;  4OX9 K;  4CIG A;  4FM2 A;  5EU7 A;  3PX0 A;  5IT9 O;  4JRQ A;  3ZSW A;  4LC9 B;  2F4V K;  4IEE A;  4YOT A;  1HNW K;  1JKH A;  1RBV A;  1L5U A;  3C94 A;  1J53 A;  2IGI A;  4LFB K;  3ZSV A;  5J2M A;  2G8V A;  3SQ0 A;  2YKM A;  1O13 A;  4BRE A;  1IJJ A;  3AAQ A;  3G6E N;  4AH9 A;  2ZF5 O;  1BG3 A;  4IG0 A;  4CGF A;  3LAL A;  3CCM N;  4IWV A;  4DTS A;  1HYS A;  2P9P A;  2F8S A;  4DG1 A;  5KPT A;  1LWE A;  1X9W A;  1RBT A;  3C95 A;  4WF9 L;  3CCQ N;  1Y97 A;  2D0C A;  3QNO A;  1JL1 A;  4WQ4 C;  3T69 A;  3FLC O;  2E20 A;  1NJI O;  2W40 A;  4GNI A;  2PBD A;  4CGI A;  2YKN A;  4J2B A;  3J80 O;  3VGM A;  1XWL A;  4CJU A;  5AQX A;  3T1H K;  1JLB A;  3BF1 A;  3IUC A;  1VAZ A;  1Q82 O;  3LDQ A;  4X64 K;  2JWK A;  1XHZ A;  2F9T A;  4FM1 A;  4J8F A;  5LL6 Z;  4MFB A;  5HRP A;  1KAY A;  5I42 A;  4AHV A;  2O8C A;  4FLX A;  5IWA K;  4HUE A;  1QVF M;  2HHW A;  3DI6 A;  4M3W A;  3DXK B;  3CYM A;  1NMD A;  1WSE A;  4C1N I;  3N4Q A;  4B1V A;  4CGD A;  4J2E A;  4DFM A;  3TAR A;  3AVG A;  3L8B A;  3OS0 A;  4JK9 A;  3VQ5 A;  2FC0 A;  2ETJ A;  1VQL N;  2ZJR L;  4W5N A;  3SJH A;  5ADX A;  3OJS A;  2B5J A;  4IJA A;  2JGU A;  4JYA K;  1DEJ A;  1S6P A;  2NRW A;  1ZBH A;  2KZM A;  4DV1 K;  4U67 L;  4DR6 K;  5C12 A;  1IKV A;  2HST A;  4CGJ A;  1TKD A;  1B9D A;  4CBW A;  3FE1 A;  4M42 A;  1RBR A;  2GUI A;  3T1Y K;  2HHH K;  3LDS A;  3H1Q A;  4CD3 A;  4MO5 A;  4AM6 A;  4E1M A;  1LV5 A;  3WNG A;  4LF7 K;  1GLL O;  3KZB A;  3MCA B;  3LPT A;  3GBT A;  3FZM A;  3VEZ A;  2NRR A;  1QTM A;  5F1X A;  3THW B;  1IKY A;  4CJP A;  4X65 K;  5EOY A;  2P9N A;  3HZ6 A;  4A5A A;  1KLN A;  5AQO A;  3V1R A;  1OVY A;  2IIR A;  1W97 L;  4DQR A;  4G1Q A;  1VSI A;  4WFB L;  1NGB A;  4K8Z A;  5JS2 A;  2P9S B;  3VGL A;  3VF2 A;  2FLO A;  3O6W A;  1YAG A;  4R79 A;  4DV0 K;  2X6S A;  4CF2 A;  4B3T K;  2BDP A;  3PY8 A;  1U47 A;  4FK2 A;  3OHR A;  4RW9 A;  1V4S A;  1KQS M;  2A41 A;  3FFK B;  3THX A;  2HHX A;  2G8H A;  1RT3 A;  2Q3S A;  1NU0 A;  2OPR A;  2O8B B;  1HPM A;  1NMN A;  4M7X A;  3VES A;  4AHR A;  4M45 A;  4M3U A;  4W5T A;  2VG6 A;  3PV8 A;  3K9J A;  2NRH A;  5DM6 L;  4DS5 A;  2ZGZ A;  2QTD A;  2A3Z A;  4BRI A;  5BPL A;  1DKG D;  4DQP A;  3A8Y A;  3GDQ A;  3QEI A;  1HMV A;  3D2E B;  3EZ5 A;  3RSE A;  3CIP A;  4OLA A;  3O3G A;  4PHT X;  1QQO A;  4JKA A;  2E4L A;  3SJJ A;  2DFE A;  3QEW A;  2O8D A;  5AQR A;  2W6L A;  2CGK A;  1KC8 O;  3MN7 A;  4DTN A;  3PX4 A;  5AQY A;  1VSK A;  5KQD A;  2HVH A;  4BR5 A;  3SUQ A;  1KVB A;  1GLB G;  4JI8 K;  2VG5 A;  1YXQ A;  1KRP A;  1SV5 A;  1OKJ A;  3SYZ A;  3CMA N;  3QBX A;  3CET A;  1JLQ A;  5KRS A;  3OBW A;  1KFS A;  2OPP A;  2Z1J A;  1ATS A;  3D6R A;  4B8C A;  1Y64 A;  4BDY A;  4FLW A;  2QWL A;  3G4S N;  1EXQ A;  4CK3 A;  3A2F A;  3EZW A;  3KK1 A;  2AA4 A;  1C1B A;  4B3M K;  4W5O A;  3BEX A;  1I39 A;  2G8F A;  4LF4 K;  3ZYY X;  4YFU A;  1NGC A;  1BQN A;  2FBT A;  3K5O A;  1QSL A;  3NAE A;  3KWI A;  4FWN A;  1S9E A;  3O3H A;  1WBD A;  3C6H A;  4Z4H A;  5CHI A;  4JI4 K;  1M90 O;  3UKU A;  4KPY A;  4XH1 A;  2IVN A;  3VEV A;  1RDA A;  4CBX A;  1GOC A;  2OPS A;  1K73 O;  1KCF A;  1N32 K;  1W9H A;  3ZEU A;  1Q7Y O;  2F8T A;  2KLA A;  1O1W A;  2Q97 A;  3DLB A;  1ZBU A;  1YTA A;  2NRX A;  4QAG A;  1VQ8 N;  4O44 A;  3O9S A;  4JLH A;  3TAP A;  4H0Y B;  2ZD1 A;  3SAG A;  4DTM A;  3E1Y A;  4NYN A;  3M8S A;  3SV4 A;  1BI4 A;  2FF3 B;  4FWP A;  3EL2 A;  4B3O A;  2ZWH A;  3U8X A;  4O8U A;  2WOM A;  4FJ9 A;  1C0T A;  2D5R A;  3PIP L;  3LPU A;  1YJ9 N;  3VF6 A;  3OYL A;  2KFZ A;  3MX2 A;  2P9K A;  3AA4 A;  4CZF A;  1YT3 A;  4I2P A;  4F2R A;  1WSG A;  1OH8 A;  2BTF A;  3ZT4 A;  3LAK A;  4QS9 A;  2V51 B;  4CEO A;  4N41 A;  3QIN A;  3H1V X;  1EWR A;  2UXB K;  3HM8 A;  1VQ4 N;  1GLA G;  1NGG A;  1IO2 A;  4ELU A;  3QET A;  2UXD K;  1QHA A;  4E7L A;  3R9P A;  3DRR A;  4C23 A;  3J7Y P;  4X66 K;  5AZI B;  3DWL A;  2FSK A;  4Z0U A;  4O5B A;  1BHL A;  4JK7 A;  4PL8 A;  3KLG A;  3OVN A;  2F96 A;  1TK0 A;  5HP1 A;  1U2V A;  2P9I B;  5C0Y A;  4FWQ A;  4FJL A;  3VQ8 A;  4IO9 L;  1D4X A;  5FPE A;  3ZCM A;  1S1T A;  1OH7 A;  1QE1 A;  2I7P A;  3Q7C A;  4ISF A;  3I55 N;  3VQ6 A;  4B08 A;  3SUO A;  4O8K A;  4B1U B;  3CXC M;  3D2F A;  2YNG A;  3IMX A;  4LH5 A;  4CVN E;  4FJ7 A;  5AQP A;  1S3X A;  3CFR A;  4HVJ A;  4LF6 K;  2VGM A;  4CJT A;  4KB1 A;  4EHU A;  3J8A A;  4CJQ A;  3S9H A;  3ENB A;  4I7F A;  1HLU A;  3FZL A;  1SZ2 A;  4NO7 A;  2AP1 A;  4Z4I A;  4A57 A;  3AAP A;  2Z1H A;  1WNS A;  4CES A;  3KK7 A;  4FJH A;  4CZM A;  4BRK A;  2VWK A;  2FBY A;  2NRZ A;  3SUP A;  3CME N;  3WXK A;  4LF5 K;  2YJE A;  3H3O B;  3L2W A;  1KSP A;  1EQY A;  4RG8 A;  4CJK A;  4E7K A;  4JI2 K;  4DUY K;  3TAF A;  1W7A A;  1A5X A;  2HW3 A;  1Z6R A;  1UOC A;  2FSJ A;  4CJ4 A;  3M8P A;  4DQI A;  3C6A A;  5C2D A;  1VSH A;  4BR2 A;  4AHS A;  4CGG A;  4H5T A;  3MWP A;  3KLI A;  4M3Z A;  5FPN A;  1LW2 A;  3BZC A;  4J2A A;  5AJ3 K;  4M3T A;  4HHT A;  5BRD A;  4FJJ A;  2QWP A;  2YCH A;  1W0H A;  5FLX O;  2XHB A;  2P9P B;  3MEE A;  3KWG A;  2O8E A;  4W5R A;  5KPR A;  3RMA A;  4C8M A;  4JKH A;  1ZXO A;  1XC9 A;  1NK8 A;  3SCX A;  1K8K A;  3K9K A;  3CI5 A;  5T7B A;  5J2P A;  2E1Y A;  4YOX A;  1VQO N;  1CZA N;  3R6M A;  3F5T A;  3J7A P;  1TKX A;  3CC7 N;  1TKZ A;  4JNE A;  4CEB A;  3H3N O;  3SI6 A;  4H4O A;  1S6Q A;  2GWK A;  4FPA A;  3KTQ A;  3ATV A;  2FSN A;  4DV5 K;  1X9S A;  3PO4 A;  3VQQ A;  3AVL A;  3V6D A;  2QXL A;  4BC4 A;  2ZJQ L;  2O8C B;  1Q81 O;  4PKI A;  1F21 A;  3RMB A;  4KTW A;  2B6A A;  3C6T A;  4L8R B;  3T7Z A;  4DTX A;  4CI6 A;  3ENO A;  4GV9 A;  4CJE A;  4B9M A;  5KGW A;  4OPK A;  2RN2 A;  4FJG A;  3LP1 A;  2A6A A;  4YOV A;  3O5B A;  4DSJ A;  3MX5 A;  2RF2 A;  3SZ2 A;  2W41 A;  3S3N A;  3LDO A;  2HHV A;  4WQ5 A;  3W3D A;  1S1X A;  5I3U A;  4H5W A;  3OYE A;  4YY3 K;  2D0A A;  5JLH A;  1G99 A;  4IG3 A;  3MN6 A;  4CBU A;  3S41 A;  3J7Z O;  1JCF A;  4BC5 A;  1CXU A;  4FJN A;  1C1A A;  4IKF A;  3VEN A;  1OH5 A;  4IDH A;  3I8B A;  3H6E A;  3VGK A;  1HKG A;  4FLZ A;  4LFA K;  4BRH A;  4EFH A;  3BDP A;  2E5L K;  2ZM6 K;  1RDD A;  3OYN A;  2BUP A;  1BCM A;  4H5N A;  3L4Q A;  3TPQ A;  3TU5 A;  1VQN N;  3LP0 A;  4X62 K;  3AVJ A;  4LF8 K;  3VTI A;  3CCS N;  1J5O A;  1JJ2 M;  1FJG K;  3JAM O;  1C0U A;  4NXN K;  5AQV A;  5KQ8 A;  1QZ6 A;  3G71 N;  3MXJ A;  5F2R A;  2Z1I A;  1NOY A;  1TAQ A;  2V7Z A;  4H5V A;  5FRO A;  3MN9 A;  5FPD A;  4Z94 A;  4JHD A;  4BE1 A;  1KTQ A;  1ZYQ A;  1VSM A;  1HKB A;  2WBN A;  1TK5 A;  4CF8 A;  1DT9 A;  4DFP A;  5EVZ A;  3THX B;  1JLF A;  3HXM A;  2RKI A;  1JLA A;  4CEA A;  3A5M C;  3P31 A;  4DTR A;  3Q7B A;  3NGI A;  4H5R A;  1JL2 A;  3M3Z A;  4XEI A;  3WXL A;  4KB0 A;  3K58 A;  4ID1 A;  1C0F A;  3QEP A;  3SAF A;  4DLE A;  1NKC A;  3TI0 A;  3WXI A;  2O4I A;  1J9A A;  2Q0R A;  3L2R A;  4B9U A;  5GAD P;  4BDP A;  3SPZ A;  4IDK A;  3OY9 A;  4DSE A;  1JLC A;  1HNX K;  4GKK K;  5AR0 A;  3G0Z A;  3RSE B;  4JV5 K;  4GY2 B;  2DY4 A;  2E8A A;  2O8D B;  4KRF A;  3HT3 A;  4K25 A;  1QQM A;  2KQ2 A;  4K8X A;  2QK9 A;  3HOS A;  1KVC A;  4I9L A;  4BC3 A;  4CCH A;  4EIA A;  1W2B M;  4FWS A;  3AO2 A;  3CHW A;  1X1P A;  3DM2 A;  1Z05 A;  3A5L C;  3QB0 A;  3CM6 A;  4BRD A;  4GVM A;  1RCH A;  2BAN A;  4RW6 A;  4H4M A;  4NYF A;  3HPG A;  4OVL A;  4JK8 A;  4DTO A;  3DXM A;  2GWJ A;  2VYP A;  4DQQ A;  2ASP A;  4Z4G A;  3OBY A;  5B8H A;  2E2N A;  3DLR A;  4DSF A;  1C6V A;  4LSN A;  3O4N A;  5LJW A;  1KAZ A;  3DLL L;  1EET A;  2YHY A;  1BOT O;  3ZSY A;  1TYQ A;  4FK0 A;  4ELT A;  3AVH A;  3O3F A;  3OA9 A;  2XY7 A;  2GUP A;  4BG8 A;  4K42 A;  4QOZ B;  3I0S A;  3MN5 A;  3U3G A;  3E9L A;  3HM9 A;  3V9X A;  4IFE A;  4FOI A;  3UKU B;  4GV6 A;  1C0M A;  3RTV A;  4GKJ K;  2QA4 N;  4F3T A;  1ZBF A;  1YIJ N;  1WOQ A;  3TAG A;  2E2Q A;  3ZEU B;  3NCI A;  3LZJ A;  4FL9 A;  1S72 N;  3K57 A;  4CER A;  5BRF A;  2I5J A;  3AO1 A;  5LMU K;  1NK4 A;  1BI4 B;  1RNH A;  3ENH A;  3EO3 A;  3QES A;  2E2P A;  4BR4 A;  5AQN A;  2P5G A;  4NLC A;  1GLC G;  3SBG A;  1RT6 A;  1ATN A;  3S3M A;  4HWI A;  2Q0U A;  5AZJ A;  2Y1J A;  2ZGY A;  3D45 A;  4FK4 A;  3KIO A;  1VSD A;  4FLY A;  1J5E K;  2P9K B;  5JS1 A;  4DR1 K;  3NMU A;  1HYZ A;  2P9L A;  4YOU A;  1HJO A;  2YI1 A;  2HVI A;  1TL1 A;  3SLC A;  1GOB A;  1WLJ A;  3WQT A;  2B4J A;  3VQ7 A;  4BDZ A;  3CM5 A;  1NGI A;  4WFN L;  3DLE A;  4JKD A;  4PKG A;  2HHQ A;  2V52 B;  4FJ8 A;  3OYG A;  4MLE A;  4Y1C A;  3KVG A;  4KAZ A;  3LL3 A;  4IO8 A;  2F9W A;  3AVK A;  4JKE A;  4BRN A;  2NNW A;  3CF5 L;  1YHQ N;  4EP4 A;  3O4Q A;  4L3Q A;  3CG7 A;  1JCE A;  1Q18 A;  3HPO A;  3WXJ A;  2F7T A;  4DV2 K;  4Q5V A;  1U2V B;  4ILH A;  3I0R A;  3DLH A;  1RGI A;  1LOT B;  2A5X A;  5BN8 A;  4DQ8 A;  5BR9 A;  4HCB A;  5C15 A;  4CJR A;  3FFI A;  3VN5 A;  1FKP A;  1NOZ A;  3UE5 A;  5EXW A;  3ID8 A;  3D2F B;  1UA0 A;  1T44 A;  4DFJ A;  4I6M A;  2P1J A;  3GL1 A;  2W42 A;  4GW6 A;  3D0P A;  2YHA A;  1LAW A;  1NGA A;  4KV8 A;  4DB3 A;  3THY A;  4JRP A;  5JIC A;  3H45 C;  1QSY A;  4CJV A;  3I56 N;  1L3U A;  1P90 A;  3VEW A;  4BQL A;  4KHQ A;  4IFV A;  1DGK N;  2ASO A;  3MWT A;  4CHY A;  1BWF O;  3VEX A;  4OPH A;  4BVO A;  4N56 A;  4E7H A;  1VQK N;  2G8K A;  1CZB A;  3CJA A;  1ZC6 A;  3ZET A;  1VQM N;  3C65 A;  1X9J A;  4CGH A;  3O8M A;  1S5J A;  4H03 B;  4ID5 A;  1ESV A;  4FJX A;  3BP8 A;  4BRO A;  4B3S K;  3IAY A;  4CIF A;  1NK6 A;  3ISN C;  5BPM A;  3DRP A;  3CJ1 A;  2IS3 A;  3RRG A;  2JLE A;  3J81 O;  3QEX A;  1BGX T;  1HYV A;  4A5B A;  3CFP A;  5GIN A;  3KKR A;  4I9Q A;  3EY1 A;  3TAN A;  4FWL A;  4KHW A;  2HNY A;  2UXC K;  2QWR A;  3MXI A;  1NBW A;  3HTV A;  1JLE A;  4WE1 A;  1VQ6 N;  2HNZ A;  3T3F A;  3JSM A;  4F3O A;  3U6F A;  1NGJ A;  2OZM A;  3LM9 A;  4WCE L;  1RDW X;  4KI6 A;  1B9F A;  5DK5 A;  1HNI A;  4FWM A;  3AO5 A;  1QZ5 A;  3M6G A;  3IG1 A;  3P5J A;  4OKJ A;  4E19 A;  4K43 A;  4ILG B;  2O8E B;  4Y0W A;  4M7Y A;  1YVN A;  4H0V B;  5H1S Q;  5AQI A;  1K8K B;  3QIC A;  5LY3 A;  3EN9 A;  2Q31 A;  1XI1 A;  3L3V A;  1TAU A;  2OYQ A;  4E1N A;  2HHS A;  1EKE A;  4FCY A;  4OKK A;  4CW7 B;  3VA3 A;  4AQY K;  3ZSX A;  3CCR N;  2LSN A;  5EY4 A;  3QFU A;  4DR5 K;  4JI7 K;  4B3R K;  3RWU A;  3ZT0 A;  4G9Z A;  3ULE A;  2PFU A;  3VER A;  3UIQ A;  3SPY A;  4N76 A;  1JLG A;  1DTQ A;  4WYB A;  4YNQ A;  3R8E A;  2PYL A;  2IC3 A;  1YF5 L;  4A59 A;  4C8O A;  3M5R A;  4DCH A;  2GBZ A;  1FXX A;  2VGN A;  3NHG A;  4NCB A;  2XY6 A;  3U9D A;  3LZI A;  2HBJ A;  1MDU B;  1RBU A;  4V19 S;  5CZ1 A;  4CZE A;  1MWK A;  1XQS C;  1NM1 A;  2P51 A;  2Z1G A;  4ISE A;  4KH5 A;  3B6P A;  4BGB A;  2QWO A;  4JS5 A;  1QSS A;  5GIP A;  1T8E A;  4WQ4 A;  4IEI A;  3V9Z A;  1KFD A;  1KVA A;  1IG9 A;  1U4B A;  4LF9 K;  2WC9 A;  4OPA A;  5CR4 A;  1RDB A;  1R0A A;  4GVE A;  4FXD A;  1NGE A;  5TKY A;  2G8U A;  3E66 A;  3VET A;  3V1O A;  4YDU C;  4RW4 A;  3HP9 A;  3IDH A;  1YUW A;  4UY8 O;  3L2U A;  3AVC A;  3P38 A;  3HL8 A;  2OAN A;  1KXP A;  4R5P A;  4DTU A;  4Y1D A;  3V4I A;  4I2Q A;  2E1Z A;  1RDU A;  3TSU A;  4NCG A;  2X6N A;  3AY9 A;  4CD1 A;  1XMO K;  4CZJ A;  1N34 K;  4Z4F A;  4E89 A;  2D0B A;  1SKR A;  4B1Z A;  2DFH A;  1KAX A;  5BRH A;  3OYF A;  4JI3 K;  4CEE A;  3KLF A;  3K2P A;  1XNR K;  4DR7 K;  4EHT A;  1VSE A;  3DOL A;  5E26 A;  4HUG A;  1N8R O;  4FWR A;  4JHD B;  1CLQ A;  3VF4 A;  2KKZ A;  2OCE A;  3B6O A;  3QIP A;  4AF1 A;  3AAR A;  2QEX N;  3HO1 A;  3L2V A;  3VQB A;  3R1X A;  3NF6 A;  1RTJ A;  3SBT A;  4RW8 A;  4DWI A;  2VWJ A;  4J2D A;  5JVG L;  4CF0 A;  1HUX A;  1T3V A;  4H0X B;  1TK8 A;  3PSI A;  1NJY A;  3V9W A;  4DF8 A;  4BE0 A;  4KRE A;  1S9G A;  2YV0 X;  1NJZ A;  3R3L A;  4C1N K;  2I7N A;  3L4I A;  1UA1 A;  2W6K A;  1L3T A;  5J2N A;  1HPZ A;  3KK2 A;  2CH5 A;  3QDK A;  4C8N A;  1VK0 A;  1WAJ A;  2R7Y A;  4A61 A;  3AVA A;  5ADX H;  3M1F A;  3L3U A;  3MAQ A;  3HPH A;  3OYM A;  4OKE A;  3CC4 N;  3MED A;  4AM7 A;  3AA2 A;  2PAV A;  4JD2 A;  4DR4 K;  4B1Y B;  3P4I A;  4IZ9 A;  5J2Q A;  5HRN A;  1WAF A;  1VHX A;  3DXM B;  5AQZ A;  4JKF A;  3TTF A;  3WXM B;  3CC2 N;  5CYQ A;  4OO1 J;  3CCV N;  1U49 A;  1TYQ B;  2E2O A;  3FGU A;  5AQQ A;  4BY9 C;  3JS6 A;  3NFA A;  3PUF A;  1IKW A;  2YNI A;  3QNN A;  3CPE A;  2XY8 A;  4ELV A;  1QQC A;  1YVU A;  3VA0 A;  1VSL A;  5HBM A;  2UUC K;  4PA1 A;  1Z26 A; 
#chains in the Genus database with same CATH homology
 4NB4 A;  1Z05 A;  3A5L C;  3FFK B;  3QB0 A;  2QI2 A;  4BRD A;  1M1K O;  1SAZ A;  4JK8 A;  2OTJ N;  1HPM A;  3DXM A;  4M7X A;  3VES A;  4BRC A;  2GWJ A;  2YHW A;  2VYP A;  3DJC A;  3BF3 A;  2ASP A;  5AQH A;  3D7E O;  3OBY A;  5B8H A;  2E2N A;  3K9J A;  1C0G A;  2NRH A;  5M1Q A;  3NVK A;  5LJW A;  5DM6 L;  1KAZ A;  2JWL A;  3DLL L;  2ZGZ A;  3G25 A;  2QTD A;  4MDA A;  2A3Z A;  4BRI A;  2YHY A;  3ATU A;  5BPL A;  1BOT O;  1DKG D;  1IG8 A;  1TYQ A;  1HX1 A;  5BN9 A;  3A8Y A;  3PIO L;  3GDQ A;  3UKR B;  3IKM A;  2BH1 A;  3OA9 A;  1VQ9 N;  2HF3 A;  2P9S A;  3D2E B;  4QS8 A;  3RSE A;  2GUP A;  3CIP A;  4EAH D;  4ISG A;  4BG8 A;  4PHT X;  5AZJ B;  1QQO A;  4JKA A;  3OW2 M;  4K42 A;  1VQ5 N;  5AQR A;  2CGK A;  2D4W A;  3MN7 A;  3MN5 A;  3E9L A;  3O1W A;  1KC8 O;  4IFE A;  1Q86 O;  4FOI A;  3UKU B;  5GAG P;  2HBK A;  4GV6 A;  5AQY A;  5KQD A;  2QA4 N;  2P9L B;  4BR5 A;  4RWT A;  1GLB G;  1E4F T;  1YIJ N;  5ELZ A;  1YXQ A;  1V4T A;  1WOQ A;  4JKB A;  2E2Q A;  3ZEU B;  5EX5 A;  3HI0 A;  1BA1 A;  2VCP A;  4BR9 A;  4FL9 A;  1S72 N;  1OKJ A;  3CMA N;  3QBX A;  1GLE G;  3CET A;  4GV3 A;  5LJV A;  2NZT A;  5BRF A;  1X3N A;  3TSP A;  1BUP A;  3OBW A;  2Q2R A;  1R59 O;  2CGL A;  5FPM A;  1ATS A;  3D6R A;  1Y64 A;  3VEO A;  5AQT A;  3IFR A;  3ENH A;  4YOR A;  5GIO A;  3EO3 A;  2QWL A;  2E2P A;  3G4S N;  4IXC A;  4BR4 A;  5AQF A;  3EZW A;  3W0L A;  4CZH A;  3CJ9 A;  2AA4 A;  5AQN A;  3UKR A;  3BEX A;  4FVU A;  5FPE A;  3D2E A;  1E4G T;  4NLC A;  1GLC G;  4IJN A;  3MMV A;  1X3M A;  3SBG A;  3ZYY X;  1NGC A;  1ATN A;  1T6D A;  4HWI A;  3WT0 A;  5AQG A;  3KWI A;  1WUA A;  4FWN A;  2Q0U A;  4JKG B;  5AZJ A;  3A5O C;  4KH6 A;  3FR0 A;  4U7B A;  2ZGY A;  1LCU A;  3C6H A;  5CHI A;  1XUP O;  3O1B A;  1M90 O;  3UKU A;  4XH1 A;  2P9K B;  2IVN A;  3NMU A;  3VEV A;  2P9L A;  2QM1 A;  4YOU A;  1HJO A;  4B1W B;  2YI1 A;  3O9Q A;  3SLC A;  4CBX A;  1K73 O;  2J4R A;  3WQT A;  1U6Z A;  3WEE B;  1ATR A;  1SS6 A;  2HBM A;  4NLB A;  1NGI A;  4WFN L;  3ZEU A;  3N4P A;  4JKD A;  1Q7Y O;  2KLA A;  4PKG A;  4PL7 A;  2Q97 A;  2QW9 A;  2V52 B;  1GLD G;  2NRX A;  4MLE A;  5E84 A;  3KVG A;  4I6M B;  1S22 A;  4FWO A;  3LL3 A;  1VQ8 N;  3O9S A;  3CCJ N;  1TUU A;  1GLJ O;  4IO8 A;  4H0Y B;  3SAG A;  2F9W A;  3E1Y A;  4JKE A;  4BRN A;  4CZK A;  2NNW A;  2ASM A;  2FF3 B;  4FWP A;  3B8A X;  3EL2 A;  3CF5 L;  3EKS A;  4A2B A;  2ZWH A;  5JVH L;  1YHQ N;  3U8X A;  5M1F A;  4O8U A;  2WFB A;  2H3G X;  4L3Q A;  4H0O A;  1JCE A;  1Q18 A;  2A40 A;  3WXJ A;  4IOA L;  2F7T A;  5AQL A;  3TTD A;  3CQY A;  3TTC A;  1U2V B;  4JKG A;  4ILH A;  3PIP L;  4E1J A;  1YJ9 N;  1RGI A;  3VF6 A;  1LOT B;  3ZET B;  4BQZ A;  3MX2 A;  4BR0 A;  3L0Q A;  4XH4 A;  2A5X A;  2P9K A;  2ZJP L;  4CZF A;  5BN8 A;  2D1K A;  1JCG A;  2BTF A;  3C0B A;  4DQ8 A;  4QS9 A;  2DPN A;  3WQU A;  4XH5 A;  4JEP A;  5BR9 A;  5C15 A;  5AFU A;  2V51 B;  4JN4 A;  1SQK A;  2CGJ A;  3UE5 A;  3H1V X;  5AQW A;  3WEE A;  4BG9 A;  5EXW A;  5M1K A;  3ID8 A;  3HM8 A;  3D2F B;  1VQ4 N;  1GLA G;  3QFP A;  3RVC A;  1NGG A;  1T44 A;  1QVG M;  2NLX A;  3CPW M;  3KHY A;  3P39 A;  4I6M A;  2GX9 A;  2UYT A;  4BRG A;  2Q36 A;  1QHA A;  3GL1 A;  5M1O A;  3R9P A;  4IOX A;  4C23 A;  3ZX0 A;  1YJN N;  5AZI B;  2RE2 A;  1NGA A;  2FSK A;  3DWL A;  4DB3 A;  5BRE A;  4JAX A;  5JIC A;  3H45 C;  3I56 N;  5C10 A;  1P90 A;  4JK7 A;  3O80 A;  3VEW A;  4PL8 A;  1NWK A;  2ITM A;  4BQL A;  1DGK N;  3C7N B;  2ASO A;  1U2V A;  3MWT A;  2P9I B;  1BWF O;  3VEX A;  5C0Y A;  3DAW A;  5HL7 L;  4FWQ A;  4KBO A;  2KHO A;  4OPH A;  4BVO A;  5M1N A;  4M63 C;  4IO9 L;  1VQK N;  1D4X A;  2NRT A;  2QWM A;  1ZC6 A;  2GTD A;  3CJA A;  3F2K A;  3C65 A;  3QBW A;  3ZET A;  1VQM N;  4FOE A;  1X9J A;  3O8M A;  1BO5 O;  2GEM A;  4H03 B;  1ESV A;  2I7P A;  4O5F A;  4BRP A;  1NGH A;  3Q7C A;  3BP8 A;  4ISF A;  3VOV A;  4BRO A;  3I55 N;  4FO0 A;  5BPM A;  3CJ1 A;  4O8K A;  3WUH A;  4B1U B;  3CXC M;  4B1X B;  3D2F A;  5F0X A;  3CD6 N;  3IMX A;  4A5B A;  4FWK A;  5GIN A;  5AQP A;  1S3X A;  4YOY A;  4FWL A;  4BRA A;  2VGM A;  4ILJ A;  2HMP A;  1T6C A;  5AZI A;  1BA0 A;  2QWR A;  3LDN A;  3O9T A;  4EHU A;  3J8A A;  5AQM A;  1NBW A;  3HTV A;  1VQ6 N;  4DHY A;  3EE8 A;  1YI2 N;  3CJC A;  3ULE B;  3ENB A;  2E88 A;  3C7N A;  1HLU A;  3FZL A;  1SZ2 A;  4NO7 A;  3BUZ B;  2AP1 A;  2P9I A;  2NRV A;  4A57 A;  1NGJ A;  3AAP A;  2HF4 A;  4CJ7 A;  2D0P A;  3CCL N;  3VEY A;  3LM9 A;  1ZBS A;  4WCE L;  3KK7 A;  1RDW X;  2YHX A;  4CZM A;  3O9R A;  4FWM A;  3FZK A;  1QZ5 A;  3ID6 A;  3M6G A;  4BRK A;  5AQK A;  1YIT N;  3LDP A;  4HTL A;  4K43 A;  4ILG B;  4A2A A;  4Y0W A;  4M7Y A;  2P9N B;  2NRZ A;  3CCU N;  3CME N;  3WXK A;  4BRM A;  1YVN A;  4H0V B;  2YJE A;  3EE9 A;  3H3O B;  2YX6 A;  5H1S Q;  4MLH A;  1NLV A;  5AQI A;  1EQY A;  1K8K B;  3TSQ A;  3QIC A;  3CQX A;  5LY3 A;  3CER A;  3EN9 A;  2Q31 A;  4RTF D;  4MDB A;  1Z6R A;  2QWQ A;  5AQU A;  2FSJ A;  2VWB A;  4FPB A;  3C6A A;  1XC3 A;  4CZL A;  4BR2 A;  5C2D A;  5JLF A;  3CCR N;  5EY4 A;  3QFU A;  4H5T A;  3MWP A;  3QML A;  4G9Z A;  1MA9 B;  3ULE A;  2PFU A;  3VER A;  3FZF A;  5FPN A;  3VMF B;  1BDG A;  2V7Y A;  5AQJ A;  4WYB A;  3R8E A;  3L6Q A;  4YDU A;  4F9O A;  1YF5 L;  4A59 A;  2D0O A;  5BRD A;  2Q1N A;  4H0P A;  2QWP A;  1H1V A;  2YCH A;  3GE1 A;  3M5R A;  4QS7 A;  4DCH A;  5MLC Q;  2P9P B;  3SMP A;  2VGN A;  1KD1 O;  3VTH A;  3KWG A;  4A62 A;  3U9D A;  2HBJ A;  4BC2 A;  4BVP A;  5BPN A;  4BRQ A;  1J6Z A;  3MDQ A;  3U9Z A;  5KPR A;  3A0I X;  1MDU B;  3GG4 A;  5HOO A;  4CZE A;  1ZXO A;  3CJ7 A;  1MWK A;  1XQS C;  1NM1 A;  1NGF A;  4FSV A;  3LM2 A;  4JKH A;  2P9U B;  3HRG A;  4ISE A;  4KH5 A;  5AFU H;  1K8K A;  4BGB A;  3K9K A;  3CI5 A;  3NVM A;  2QWO A;  3O4W A;  5GIP A;  4BGA A;  2E1Y A;  4WQ4 A;  5AQS A;  4LC9 B;  4YOX A;  4IEI A;  4IEE A;  3H46 O;  2CH6 A;  4YOT A;  2WC9 A;  1VQO N;  1CZA N;  1HKC A;  3R6M A;  1EO1 A;  4OPA A;  5CR4 A;  4IOC L;  3F5T A;  5C2F A;  3HOT A;  4CZG A;  3CC7 N;  1YJW N;  4GVE A;  1NGE A;  5TKY A;  3E66 A;  1O13 A;  3VET A;  1IJJ A;  1P8Z A;  4JNE A;  3AAQ A;  4BRE A;  3H3N O;  4YDU C;  3G6E N;  3IDH A;  2ZF5 O;  1YUW A;  3JXU A;  1BG3 A;  4UY8 O;  2GWK A;  4FPA A;  2HBL A;  3ATV A;  2FSN A;  3P38 A;  2OAN A;  3CCM N;  1KXP A;  1QQN A;  4IWV A;  2QXL A;  4BC4 A;  2ZJQ L;  1Q81 O;  4PKI A;  2P9P A;  2E1Z A;  1RDU A;  3TSU A;  4JKC A;  3MK6 A;  3T7Z A;  1K8A O;  3AY9 A;  3ZX2 A;  4CD1 A;  5KPT A;  4CI6 A;  4CZJ A;  3ENO A;  4GV9 A;  4WF9 L;  3CCQ N;  2P9U A;  4WQ4 C;  1RFQ A;  3FLC O;  2E20 A;  3T69 A;  4YOW A;  4B1Z A;  1NJI O;  2W40 A;  2A6A A;  4YOV A;  2OTL N;  4GNI A;  2PBD A;  3O5B A;  1KAX A;  2WUS A;  5BRH A;  3VGM A;  3MX5 A;  5AQX A;  2W41 A;  4K41 A;  4BRL A;  3LDO A;  3BF1 A;  4WQ5 A;  3W3D A;  3IUC A;  4EHT A;  1VAZ A;  1Q82 O;  3I33 A;  3LDQ A;  4H5W A;  5E26 A;  5JLH A;  1G99 A;  4CBU A;  3MN6 A;  2JWK A;  1N8R O;  2GEL A;  4FWR A;  3EKU A;  3S41 A;  5DM7 L;  4B9Q A;  2F9T A;  2RHK A;  4JHD B;  1VQ7 N;  2QWN A;  4J8F A;  3J7Z O;  2HOE A;  2KKZ A;  3VF4 A;  1JCF A;  4BC5 A;  4AF1 A;  3AAR A;  2QEX N;  1KAY A;  4JD2 B;  3VEN A;  3LDL A;  3E9O A;  4H0T B;  3R1X A;  5GAH P;  3SBT A;  4BRF A;  1QVF M;  3U4L A;  4DKW A;  5JVG L;  3UB5 A;  4IDH A;  3I8B A;  3H6E A;  3O08 A;  1HUX A;  1K9M O;  1T3V A;  4WFA L;  4H0X B;  3VGK A;  1HKG A;  3DXK B;  1NMD A;  5I9E B;  3F9M A;  4BRH A;  4C1N I;  4EFH A;  2FXU A;  3N4Q A;  5JMV A;  4B1V A;  1NGD A;  2BUP A;  4H5N A;  5KPZ A;  3R3L A;  4BR7 A;  3O9U A;  4C1N K;  2I7N A;  3L4I A;  1ILY A;  3L4Q A;  4JK9 A;  3TPQ A;  3TU5 A;  3VPZ A;  1VQN N;  5GAE P;  1VQL N;  2ZJR L;  3FZH A;  3SJH A;  3VTI A;  3CCS N;  1JJ2 M;  4WQ5 C;  5ADX A;  3SK3 A;  2CH5 A;  3QDK A;  1QZ6 A;  5AQV A;  4IJA A;  5KQ8 A;  3G71 N;  3CCE N;  4A61 A;  5CE3 A;  5F2R A;  4PKH A;  1DEJ A;  2NRW A;  5ADX H;  3CJB A;  3M1F A;  4U67 L;  2V7Z A;  4H5V A;  3MN9 A;  5FPD A;  4Z94 A;  5C12 A;  2HST A;  5M1P A;  4JHD A;  3CC4 N;  4AM7 A;  1HKB A;  3AGR A;  2WBN A;  4CBW A;  2PAV A;  3FE1 A;  2FF6 A;  4JD2 A;  1DT9 A;  1GLF O;  4B1Y B;  5EVZ A;  3H1Q A;  3SAH A;  3P4I A;  4IZ9 A;  4CD3 A;  4MO5 A;  4AM6 A;  3PLA A;  3A5M C;  3P31 A;  3SMS A;  1GLL O;  3DXM B;  3MCP A;  4MO4 A;  5AQZ A;  3KZB A;  2A42 A;  3MCA B;  3DXK A;  4JKF A;  3GBT A;  3TTF A;  3Q7B A;  3FZM A;  3VEZ A;  3WXM B;  2NRR A;  3CC2 N;  5F1X A;  2YJF A;  4H5R A;  5EOY A;  3M3Z A;  4RCH A;  2P9N A;  3HZ6 A;  4XEI A;  3WXL A;  4A5A A;  3GOI A;  1C0F A;  5AQO A;  4CZI A;  1VQP N;  3SAF A;  4OO1 J;  1OVY A;  2IIR A;  3WXI A;  1W97 L;  3CCV N;  1TYQ B;  2Q0R A;  3HBT A;  5GAD P;  4WFB L;  3E9P A;  1NGB A;  3ZX3 A;  2E2O A;  2P9S B;  3FGU A;  5AQQ A;  4BY9 C;  5AR0 A;  3RSE B;  3VGL A;  2EWS A;  3JS6 A;  3VF2 A;  2FLO A;  3HSC A;  1YAG A;  3O6W A;  4R79 A;  2IVO A;  3AGK A;  4GY2 B;  4KH4 A;  2E8A A;  5TKW A;  1MWM A;  3CPE A;  1TUY A;  1BU6 O;  4K25 A;  1QQM A;  3HOS A;  3A5N C;  4BC3 A;  3OHR A;  4EIA A;  1W2B M;  1V4S A;  2IVP A;  1KQS M;  2A41 A;  4FWS A;  3CHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...