3K9JA

Transposase domain of metnase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
224
structure length
201
Chain Sequence
PHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVRRKRPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYWTGINQLISRWQKCVDCNGSYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETMAR
publication title Crystal structure of the human Hsmar1-derived transposase domain in the DNA repair enzyme Metnase.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 201
sequence length 224
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2009-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01359 Transposase_1 Transposase (partial DDE domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3k9jA00
3K9JA 3HOSA 3HOTA 3F2KA 4MDBA 4MDAA 5CR4A 2F7TA 4R79A 5HOOA 3K9KA 4U7BA
chains in the Genus database with same CATH superfamily
2YNGA 2HB5A 3VTIA 3NH0A 5KGWA 3SAGA 4IO8A 1JLFA 4CF0A 3OYIA 4AHVA 3HRGA 1QE1A 1HRHA 5AQWA 3ENBA 1RILA 4BGBA 4FVMA 4CCHA 2OCEA 2YX6A 1U47A 4BRCA 4AM6A 4FJIA 3O9QA 4CBWA 4DTJA 4DS5A 1OKJA 4FL9A 1NU0A 4X64K 4DQRA 3LP0A 5AQQA 3WNGA 1S9GA 3HBTA 4FPBA 1ILYA 4FWKA 3WT0A 1T05A 3QINA 4CFCA 4B3TK 1UA1A 4CHPA 4H0XB 4DLEA 1HX1A 4JI2K 3ASMA 2VCPA 1RDBA 4CFDA 2QWLA 3LALA 1M1KO 3IRXA 4AILC 3LZIA 2P9KA 2P9NA 1BIUA 4RW7A 3NDKA 4M7YA 1RDDA 3LP3A 1SQKA 3JYTA 2UXBK 3CCJN 4C8MA 3CQ8A 1S3XA 2DY4A 1L3VA 1GLFO 1OVQA 1REVA 4KHPK 1Q82O 3VQDA 1VQ6N 3DRRA 1XUPO 3TAQA 4FLYA 4H4OA 1MDUB 3QICA 3O5BA 4NLBA 4EIAA 4J2EA 1BL3A 4M42A 2ZE2A 4DV4K 5JS1A 4CJKA 4FK0A 5KQ8A 4IO9L 1NK4A 3AVHA 2KFNA 3VQ9A 4FJHA 4ISFA 4WQ5C 4O44A 2YNHA 3P39A 1LCUA 2E2NA 1BCOA 2FC0A 5JICA 3FZFA 5J2QA 4CJPA 4O5FA 1QSLA 1YF5L 2DPNA 4DTXA 1HJOA 4IXCA 3D2FB 3KWIA 1L3UA 1JJ2M 4LFBK 4M3XA 3K9KA 3OVNA 2F9WA 4PA1A 1TKTA 4BQZA 3U3GA 3I0SA 4YORA 2ZGZA 1X9MA 3WEEB 2X78A 2P9SA 4DV7K 1XNRK 4UY8O 3PX0A 4LH4A 3RMBA 3CCMN 1QTMA 1JLAA 4JKEA 4W5RA 3V9WA 4BC3A 3CJAA 5JVGL 3AO1A 4W5TA 3CIPA 4EHUA 4AQYK 2GBZA 1C0UA 2P51A 2Q0RA 3WXJA 4FXDA 2ITMA 3DLEA 4HCCA 3TTCA 4CD3A 1NNEA 4BRMA 4IEIA 3VA0A 4DQ8A 1JLQA 2D1KA 5F2RA 2I7PA 3HZ6A 3OYHA 1X9JA 2J4RA 3DLRA 2D4WA 2QA4N 3GOIA 1HQEA 5AQLA 4NXNK 1GLLO 4N47A 2IVNA 4F8RA 4O55A 4Q0BA 3I8BA 4A57A 4MFBA 1XWLA 4CGFA 4DMNA 3ENHA 1NJIO 4CZFA 3NGYA 3LDOA 4MO4A 1TKXA 2ZGYA 3TWHA 3NF8A 1VSFA 1RT3A 2F96A 2XY6A 4CFAA 4OPHA 3ATUA 5DM6L 2VWBA 4CZIA 3DLGA 4BR7A 5BRDA 1Y64A 2D0BA 4PHTX 5AQSA 4CGGA 1BI4A 3CETA 4I6MA 2IIRA 1VSMA 1SUQA 4DHYA 5HOOA 2E20A 4CEDA 1D9DA 3F73A 1TYQB 3DXKA 3HT3A 3AO2A 4X66K 3IDHA 1C0TA 3R1XA 3RSEB 3P5JA 4DF8A 3HL8A 4J8FA 2E8AA 3FE1A 5GINA 4CW7B 1U48A 1A5XA 5AQVA 3O9TA 4CIFA 1BQMA 3THVA 2HF3A 3UIQA 2BDPA 1DLOA 3RRHA 2GELA 1R0AA 2HBMA 3SBGA 2P9LB 5AQOA 1E3MA 2W6LA 3P38A 3KK1A 3MN9A 3TPQA 4IFEA 3NH1A 4FJMA 2XHBA 4M63C 3VERA 2RPIA 4KH5A 3MEDA 3TARA 4B8AB 3MEGA 4BWJA 3O6WA 5GAHP 4NLCA 1VSLA 3QNOA 3H3NO 4JS4A 1IKYA 5AZJB 4ILJA 3O3GA 1SKSA 4X65K 1NKBA 3C6AA 3VEOA 1XC9A 1VQNN 1SKRA 2HMPA 1V4SA 3ZSRA 3CXCM 3MXIA 4IFVA 1XMOK 2YJFA 1SZ2A 2HHHK 3IKMA 3L2WA 4FOIA 4DS4A 3S41A 4PQUA 1QVGM 4C1NI 4BRAA 5AQRA 2KTQA 2O8CA 2O8DA 4L3QA 3ZETA 5KPRA 3MXMA 3MWTA 4H0TB 1N33K 2O4IA 4LF7K 3JAMO 5HRPA 4IKFA 5E26A 1B9FA 2Q1NA 3VQPA 4DUYK 2HHSA 3QO9A 1KLMA 2E2OA 4E0DA 1J5OA 1K8AO 4CZKA 1NJXA 3F2KA 3EE9A 3KLFA 2O8EA 3VGLA 3NF7A 3VN5A 4QS9A 1BCMA 1RBSA 1WSHA 4GNIA 2ITGA 1LOTB 4E1NA 1UA0A 1YI2N 5CZ1A 3SUNA 1WSFA 4NYNA 4FK4A 4HUFA 4R5PA 2VWKA 3HTVA 2A42A 2NRWA 4ZTJA 4KKOA 3G4SN 3CM6A 4L8RB 1VQ8N 4BGAA 1NKEA 1TUYA 3THXA 3CD6N 5KRSA 3DXMA 4WFNL 1GOCA 1QQNA 4KI4A 2G8WA 3F5TA 4W5OA 4X62K 4DV2K 4A5AA 4MDAA 2YCHA 4FM2A 4CEBA 4CZLA 4JI8K 4Z4GA 4C1NK 5C0YA 3GG4A 2G8VA 4E7JA 2X6SA 1TK5A 1KRPA 3RR7A 4CJUA 1QSYA 4CJEA 2UUAK 3MECA 5DK5A 4CJFA 4BE0A 4R79A 4OJRA 2IGIA 4O8UA 1IBMK 3THYA 3PO4A 4CIEA 2YI1A 4H0YB 3E1YA 4V19S 3CG7A 4JKFA 3V9UA 1SL1A 3QBWA 4H0OA 2DFEA 5AZIA 3AVIA 3TTFA 4H5VA 2DFHA 4OPAA 3VGMA 1RTHA 3O9RA 1RFQA 2V52B 4FJ9A 4DTNA 3RWUA 3KHYA 3IAYA 4K8ZA 3I55N 4DQPA 4DSEA 3AVMA 2UYTA 1JLBA 3CQYA 1JL2A 4LF8K 3CM5A 4ILGB 3CJ7A 3LP1A 1Z25A 4E89A 1VSJA 2BANA 3KD5E 4BRHA 3CMEN 1O1WA 2ATQA 5JMVA 3S3NA 4Z4IA 4PY5A 3PSFA 1FK9A 1IJJA 1WBBA 4KH6A 2KZZA 4B3RK 2ASPA 1RT6A 3HP9A 2LSNA 3EN9A 4Z0UA 4M41A 1YHQN 4F3TA 5DM7L 3TANA 1V4TA 4JI1K 3RMAA 4C8OA 1NG9A 4GVMA 2P9NB 1KXPA 3KK7A 4CEFA 1NGBA 3D2EA 4BRIA 1WOQA 3SZ2A 4LF9K 4Z4FA 3CC4N 2QWOA 4CI6A 2GUIA 4FWLA 2GWKA 5C2DA 4WQ4A 3K58A 3AO4A 2UU9K 3CYMA 4U67L 5SZTA 4KHUA 4E7LA 4NXMK 2FXUA 1VAZA 2Z1GA 3O3FA 2H3GX 5AFUA 5LJWA 3RTVA 3H1VX 1BHLA 4FJ8A 1ESVA 1HNIA 4GV6A 2QWNA 4RW8A 4Z4CA 4CZJA 1KC8O 4DSFA 5E41A 2QM1A 4M3RA 5J2MA 2O8FA 1KQSM 1IG8A 2HVIA 5GADP 1DEJA 2HHTA 4JAXA 4O4GA 1RTJA 1BDGA 2NRRA 4U7BA 2YHWA 3M1FA 4E7KA 4BRNA 3VENA 5HRNA 3FZHA 1W97L 3B6PA 4DSIA 4OLAA 5AQUA 3DAWA 1NGJA 1X9WA 4I2QA 2NZTA 3H08A 4K43A 2HW3A 4BREA 3VEXA 3O4QA 3Q7BA 4DFMA 1S72N 3SK3A 1J6ZA 3IS9A 3OYKA 3AVGA 4QS7A 3ZX0A 1SL2A 4OPJA 4CGJA 1U2VA 1Q18A 5E84A 4JK8A 4B1VA 4N5SA 4MDBA 3NH2A 4FLUA 2HHVA 4BG8A 4CESA 1KAZA 4BY9C 3A8YA 5C15A 1JCFA 1KCFA 4F2RA 5FDLA 3K5OA 4M45A 4A2AA 4FPAA 3CMAN 2O4GA 3QEVA 5HLFA 3U9ZA 3C95A 4CHQA 2IC3A 1A5WA 4C8LA 1ZBHA 3ZSXA 1RBRA 4G1QA 2VGNA 1S22A 1YVNA 4BRQA 4XH1A 4PUOA 4K25A 3VGKA 4BVOA 4YFUA 4E3SA 4DQIA 4IG3A 4CEZA 2HF4A 3VQ5A 4FOEA 2ETJA 4O5BA 1RT1A 2PY5A 4JI0K 4CZGA 1RBTA 1YJNN 2OANA 3DOLA 1L3SA 2YNFA 3GBTA 2ASOA 2VQFK 2FBVA 2ZJRL 2P5OA 4IDKA 3JSMA 4CEEA 3ZX2A 5BR8K 1M90O 3S3MA 3E66A 3FFIA 5BRHA 5HL7L 2E1ZA 4IEEA 5TKWA 3LDPA 2XO7A 1KD1O 3C65A 5KPZA 1ASVA 3UB5A 4K42A 1UAXA 4DR3K 5A2QO 3HVTA 3V6DA 3PIOL 4H4MA 2QWPA 4ZHRA 4DKWA 1HKGA 4CJSA 3IMXA 1GLCG 1LAWA 3L4IA 4IFYA 4YOWA 1U4BA 3DWLA 3SMPA 4B9LA 4UQGA 2UXDK 3SYZA 4JKHA 3CC7N 2BTFA 1FKOA 2E2QA 1ASUA 4E19A 1NGAA 5I9EB 3OYLA 4JKGA 3NAEA 3CC2N 3TSQA 4ILHA 4RW9A 2Q2RA 5LMUK 2HOEA 3P83D 3C0BA 3C6TA 3ZT3A 3CFPA 1EWRA 1GOBA 1SAZA 4Z4EA 2FF6A 4CZHA 4FVUA 2X74A 2JLEA 2PFUA 3WQUA 3AVKA 3HPGA 2RF2A 1C0MA 3ITHA 3NCIA 2V51B 4YOUA 3K5LA 4KHQA 1NKCA 4CEAA 3LDSA 4DCHA 4ELUA 3ID6A 4LF6K 4JV5K 1C6VA 3HM8A 5FPNA 4KHWA 1NOZA 3HI0A 1T3VA 3F9MA 4BR0A 4YDUA 3AVNA 4TSXA 3FZMA 5CY4A 2KQ2A 1ATNA 4JK7A 5J2PA 5CZ2A 2ASMA 1C1AA 3DOKA 4OKJA 4CZMA 3K57A 3L8BA 4JI7K 1XQSC 1X9SA 4ZTFA 1CLQA 3ZEUB 4CJVA 2X6NA 4DTMA 3VEVA 3L2VA 4B1UB 1BGXT 4FO0A 4FWPA 4LSNA 3MCAB 2ZQBA 4HUGA 3AVCA 3QEIA 4W5QA 5ADXA 1RTDA 4PKHA 4JNEA 2EHGA 1BA1A 1BWFO 4CGHA 3QFUA 2OZSA 3ZYYX 3OW2M 4LD0A 3RRGA 2AP1A 5IWAK 3AVAA 4H5NA 3MX5A 2O8CB 1NK0A 4KAZA 1NGEA 3GDQA 4FJ5A 3NVMA 3V9ZA 4DV5K 2OPPA 1YJWN 1N36K 4B9TA 3UKUB 4QOZB 1GLAG 4B1WB 4CGDA 1FW6A 2P9UA 2WOMA 2AJQA 1NGIA 4H5TA 4O8KA 4EZ9A 1BA0A 5H1SQ 2BUPA 4RCHA 2P9IB 3UKRA 2O8EB 1GLJO 3CCEN 3ZSZA 3V1OA 2QKBA 4JS5A 3P31A 3M8QA 3VEYA 4KV8A 4CJ7A 3LDNA 1ZBSA 3WQTA 2A6AA 3OYEA 1U45A 3OY9A 4F9OA 4MLHA 2E1YA 5AQZA 5M1OA 5LJVA 2QWQA 3BZCA 1JL1A 3AAQA 3OYCA 3QERA 3QBXA 1DKGD 3VQEA 2P9PA 4CBXA 4M3WA 5AQHA 1KVAA 3SUOA 3LAKA 1MA9B 3THXB 1OH8A 3DXMB 3QMLA 3L2QA 1YTUA 4N41A 5CR4A 5CE3A 4BC4A 1GLBG 4KPYA 2RHKA 4B9UA 2P5GA 1JXEA 5AQPA 2F8SA 2D0OA 4FWRA 1XNQK 3SV4A 4IZ9A 4OLBA 2NNWA 3KLIA 4Y1CA 3EL2A 1ZC6A 3C7NB 4ICLA 1NK8A 3KTQA 3J80O 5MLCQ 1IKVA 3ZT2A 1E4FT 1YVUA 3VPZA 3HO1A 3ULEB 4EP5A 3A0IX 2Z1HA 2D0PA 3THYB 3ALYA 4FWMA 3EKUA 3K5NA 4KRFA 1Q8IA 5AZIB 3SPYA 3PX6A 3H45C 4M3TA 4B9MA 4A5BA 2A1SA 3AARA 2ZM6K 4DV1K 3DLKA 3MX2A 3OYMA 3O4WA 2HBKA 1HNZK 5F0XA 4JKCA 3QETA 3W0LA 3EYZA 2OYQA 4A59A 4GV9A 5GIOA 4CJRA 3SI6A 1TK0A 4ID5A 4HUEA 2B5JA 2FLOA 5IT9O 1W2BM 1NK5A 3CCLN 4CFBA 3MAQA 4C8NA 1SS6A 2CGKA 4YNQA 3OS0A 3O8MA 4GVEA 3TAGA 4CE9A 2Q31A 3G0ZA 1YIJN 3M5RA 5CYQA 2PYJA 3WNEA 5T7BA 4W5NA 3VF2A 3K0SA 2RE2A 5AQXA 4RWTA 1Q7YO 3BDPA 2B4JA 3BZKA 4B3MK 1RT7A 1HNVA 1I94K 4NYFA 4AHRA 4DLGA 1QQCA 1U04A 4G9ZA 3O1WA 3CCUN 3MN6A 4IJAA 2YV0X 3D45A 5BPNA 3BY5A 1MU2A 1T44A 2I5JA 4YHHK 3L0QA 4Z94A 1W9HA 4HHTA 4FLVA 3SLCA 4LFAK 4OGEA 1GLEG 1S1VA 3QLHA 3LL3A 1TL1A 1JLEA 2BH1A 1N34K 1E4GT 1JXBA 3T1HK 3O80A 4DFKA 4WCEL 4CEQA 1TK8A 3OS1A 3VF4A 3A5NC 1FJGK 4EAHD 4DTSA 1VSHA 3E9PA 3LM2A 3O4NA 4CD1A 2QWMA 5GAGP 2RN2A 3OYJA 2G8KA 2D0CA 1JLCA 3SNNA 1SL0A 2E2PA 1JKHA 3D0PA 5K14A 3AO3A 1KSPA 2CH6A 2NRTA 3VQ7A 4CBUA 2YKMA 2VG6A 1BU6O 4FWQA 3JXUA 3E01A 4CF2A 3D2FA 2NRVA 4PKIA 1S1XA 2Z1JA 3ENOA 1U2VB 4DU3A 3OTOK 3MEEA 4YDUC 3KWGA 1EP4A 2I7NA 2WUSA 3WEEA 3ZT0A 3LWLA 3CFOA 2PZSA 1H1VA 2EWSA 1TKZA 4BVPA 4JD2A 3BGRA 2WC9A 3R3LA 1LWEA 1S1TA 3TSUA 3AVLA 4EHTA 4LC9B 1BO5O 3J81O 3V1QA 4OX9K 4DG1A 4CK3A 1NBWA 4FM1A 4QAGA 4B9SA 4H03B 4NB4A 1VRTA 4H0VB 2HHQA 3HXMA 3I56N 1S5JA 1ZYQA 4BR9A 4B9VA 3ZT1A 4YOXA 1L5UA 2OA8A 5BPMA 3K2PA 4QCLA 3SUQA 4N56A 3AVFA 3FGUA 2QW9A 5EVZA 3TAPA 2Q0UA 4FZYA 5HP1A 4RG8A 1D5AA 3WXLA 1RDUA 3MXJA 2XY7A 4FYDA 1LAVA 3MN5A 3SQ2A 1NJYA 3SAHA 2F9TA 1NK6A 1VQ4N 3CJ9A 5C2FA 2V7YA 4RW4A 4DR2K 1T6CA 2IDOA 3IFRA 3NGIA 3DLBA 1QHAA 4BDPA 4F2SA 5C10A 2FF3B 4O0JA 1BQNA 3OYGA 5I3UA 3D7EO 4I9QA 1T6DA 1T03A 3CI5A 4CIGA 1LW0A 1TYQA 1C0GA 2HBLA 1K8KA 1ZBIA 1TAQA 2AA4A 2V7ZA 1TAUA 1ZBUA 4JKGB 3RSEA 1WAJA 4B9QA 4Y1DA 2OPSA 3DM2A 2JWLA 3AA3A 3AVJA 2W41A 4WQ5A 4BC2A 3KVGA 5AFUH 1D8YA 4A62A 3EO3A 3R8EA 5EXWA 3OYBA 4CZEA 1DTQA 4BACA 4JI4K 3CCRN 2P9LA 3MCPA 5C24A 4F3OA 5JLHA 3RVCA 1P90A 5AR0A 3AAPA 3VEZA 2F4VK 2P9KB 4E1JA 5BN9A 3ZSYA 2A5XA 3LZJA 4EFHA 2ZWHA 3A2FA 1TV6A 3FZLA 3H6EA 4JKDA 3C94A 4WFBL 3HK2A 2CGJA 5FPEA 2UXCK 2ZJPL 3L3VA 1U6ZA 4J2AA 1KAYA 2VG5A 3S3OA 4CF1A 1EKEA 3J7AP 1S6PA 4BWMA 1W0HA 3TABA 3L3UA 3VEWA 4K41A 4DV3K 3S9HA 3QNNA 3NBPA 3PUFA 4H5WA 1CZ9A 5B8HA 1T7PA 1N8RO 3DI6A 4DR5K 4YOVA 3G6EN 3FZKA 5DMRA 1I3AA 3ZT4A 4FJJA 3ZCMA 1LWFA 2YHAA 4Z4HA 4F4KA 4IWVA 1ASWA 1K73O 1IH7A 3ZSQA 2NRHA 1IG9A 1VQPN 1NGDA 3M8SA 5AQJA 4ISGA 3R9PA 3KLHA 2G8UA 3EE8A 4C23A 1RDCA 4IOXA 1YUWA 4DB3A 3DLHA 2P9SB 2Y1IA 2Q97A 4HTLA 3CHWA 3IG1A 3FR0A 3MWPA 1QQMA 2NRXA 4EP4A 4XH4A 3ZSWA 1R59O 2GTDA 1KFDA 3TAMA 2QXLA 3Q7CA 4AH9A 4FLWA 3P4IA 3PX4A 1DTTA 3KKSA 4KFBA 4DF4A 3T7ZA 3DRSA 3LP2A 3O9SA 3AA4A 3AGKA 1WN7A 3BF3A 3FFKB 3I33A 4DUZK 3O9UA 4HVJA 4OKKA 1HMVA 1LW2A 4FJLA 4B3SK 5M1PA 3G71N 1NLVA 3EKSA 1LWCA 1ZXOA 1NM1A 1QZ5A 1HNXK 4DTRA 1BIZA 4DR1K 3DJCA 5M1FA 5M1QA 4FJ7A 5KRTA 5M1KA 1X1PA 3M8PA 1NGFA 2PBDA 3G10A 2HMIA 1Z26A 3HYFA 4E7HA 3D6RA 2HNDA 3VF6A 2DFFA 4BC5A 1WNSA 2FSJA 5GAEP 2FSKA 4FLZA 3J7ZO 2W6KA 1QHTA 4FW1A 5BPLA 1VQ9N 3DMJA 3HJFA 3ZX3A 1BI4B 3KLGA 1Z05A 3OBYA 1Q9YA 1VSDA 2E6MA 1HR0K 4CJ5A 1WLJA 4I6MB 4GKKK 4NCGA 3T19A 2EX3A 3AV9A 1KLNA 1S9EA 4GW6A 4BG9A 1VHXA 3P1GA 4ID1A 3DXKB 3OBWA 5CYMA 1OH7A 1BUPA 4DTUA 1OH6A 3DLLL 3R6MA 1OVYA 1S1UA 3OHRA 3CPEA 4LF4K 1HQUA 2XY8A 1SV5A 2YNIA 3ZLJA 4AM7A 4AHUA 3OYNA 1CXUA 5FROA 5AQNA 1C1BA 3HPHA 2QWRA 2HHUA 5BREA 4CJWA 3L2UA 1D4XA 5J2NA 5ADXH 3NVKA 4PWDA 2KLAA 1UOCA 5LMNK 3HVRA 1C0FA 3NHGA 1TL3A 3OJUA 3PY8A 4OVLA 1YXQA 2VWJA 3SCXA 4DV0K 3TSPA 3N4PA 3UE5A 5EY4A 3QB0A 4CECA 3HOTA 3KLEA 2E4LA 3WXKA 4PKGA 3SMSA 3B6OA 3IUCA 1WAFA 3LPUA 4HCBA 4LSLA 4B3OA 1S1WA 4NCBA 3VQAA 1IO2A 2GX9A 1F21A 4WYBA 4A2BA 1YJ9N 4DQSA 1P8ZA 2A40A 5C25A 4M7XA 3A5LC 3BEXA 4JHDA 5C12A 2IVPA 2Y1JA 2Z1IA 4AHSA 4AHTA 5HBMA 3CJCA 1GLDG 3MMVA 1U49A 2O8DB 3AA5X 3ZETB 2VQEK 4XEIA 4CK1A 4OKEA 3HSTB 4CK2A 4B8CA 4FJGA 4FJNA 3SUPA 4B9NA 3VQ4A 1ZBFA 3V81A 4WFAL 4RTFD 4DU4A 4CHYA 2KKZA 4JK9A 1QZ6A 3CJBA 4CGIA 5BN8A 3LDQA 4HTUA 3PO5A 4JKBA 3M8RA 3TI0A 4KI6A 3I0RA 5AQFA 3HSCA 1TVRA 3HM9A 3THWA 4FWOA 2R7YA 2WFBA 2HSTA 4FJKA 3OJSA 2GUPA 3CF5L 4DTPA 5HRSA 3OYFA 4NCAA 1VSEA 1NGGA 3L4QA 4WQ4C 3KD1E 4B08A 4JD2B 1GOAA 2CH5A 3QIOA 4BR2A 2WONA 1VQMN 2QI2A 1XI1A 4J2DA 1RCHA 4DSKA 3ZSOA 5FRMA 1QS4A 3SQ1A 2FBYA 4FW2A 1VQ5N 1EX4A 3EEQA 1MWMA 4WF9L 4CERA 1IKXA 1ZBLA 1VSIA 2RKIA 3SJHA 1KFSA 1HYVA 1WSGA 1VQLN 4BDZA 2HBJA 2HNYA 1WBDA 4B1XB 3HPOA 1FKPA 4BE2A 3F9KA 2OTLN 2O8BA 3NF9A 2WBNA 3LM9A 4CJQA 1O13A 4B1ZA 5AQTA 4CJTA 3BF1A 3CCVN 3WXIA 4JN4A 1MWKA 1J9AA 1TGOA 4OO1J 4OGCA 4FK2A 3JS6A 3TR8A 2G8HA 1IV0A 4CHOA 2OPRA 2D0AA 2JGUA 2YHYA 2E88A 4CJ3A 3PLAA 4BE1A 4BRDA 3T69A 1NJWA 5CHIA 4GKJK 2XRIA 4JI5K 5EU7A 1FXXA 3LPTA 4H8KA 1J53A 1K8KB 4BQLA 3VETA 3L2RA 3L6QA 2QTDA 2OPQA 3T1AA 4MQ3A 3SV3A 3VMFB 3LDLA 4NO7A 4JEPA 1JCEA 4AF1A 3CPWM 3U4LA 3AGRA 4BRKA 1HKBA 4IJNA 3LANA 1N5YA 3VQBA 5TKYA 1S6QA 2P1JA 4DR4K 1CZBA 2YHXA 4I7FA 4DR7K 3LAMA 3H3OB 1HLUA 1RDAA 4EZ6A 3TTDA 3WXMB 4CEOA 3AY9A 4Q5VA 3HP6A 5AQGA 4DFJA 3D2EB 5JVHL 3SJJA 3KZBA 3SBTA 1QSSA 5JLFA 4E1MA 1NWKA 3ZSVA 1KTQA 4YOTA 3QEWA 1DT9A 4FZZA 5AQYA 3LWMA 3AA2A 1J54A 3ZEUA 4A61A 4BR4A 4LY7A 4BRFA 4LFCK 3EZWA 5AQMA 3O08A 3N4QA 1SKWA 2GV9A 3RMCA 1HPZA 2O8FB 2KW4A 2WTUA 3C6HA 1G99A 5FRNA 3CJ1A 1D9FA 4QS8A 1VQ7N 1XC3A 2GWJA 4KHSA 1WUAA 4N76A 2CGLA 1Q81O 4HWIA 4KTZA 1NGCA 2D5RA 4DQQA 1VSKA 3VQ6A 4MO5A 3BP8A 4ELTA 1NK7A 3FLCO 4Y0WA 4KB1A 4BRPA 2FBTA 1YAGA 3SAFA 1LV5A 1KVCA 4BDYA 4H5RA 2ZD1A 2IAJA 5D3GA 1RT2A 3U9DA 3UKUA 1Z6RA 2A1RA 1HNWK 4JI3K 2E6LA 1NK9A 2F8TA 3BUZB 5HROA 2P9IA 4JI6K 4M3ZA 5I42A 3VQCA 3O1BA 1XHZA 2BGGA 2GEMA 1BISA 2PYLA 2NLXA 2YKNA 2PAVA 5EOYA 1NMNA 1J5EK 4M3UA 1N6QA 4AHCA 2UUCK 1NGHA 4FSVA 1RT5A 3CFRA 4RW6A 3V4IA 3G25A 3H46O 4LH5A 1NJZA 4IG0A 3VQQA 1G15A 3ID8A 3V1RA 1L3TA 2VYPA 1WSIA 2QKKA 1JLGA 3TAFA 1EQYA 4DR6K 1ATSA 4IBNA 4PL7A 3H1QA 1N32K 4ELVA 1HKCA 3NMUA 3NF6A 3A5MC 4FLXA 4K0KK 4E7IA 1QVFM 1ITGA 5KTQA 3CCSN 3C7NA 4OPKA 1Q86O 3GL1A 2G8IA 4ISEA 5JS2A 3T3FA 4IOCL 3DRPA 4CJLA 2HHWA 3O3HA 3ULEA 3VOVA 3KJVA 3V9SA 3I8DA 3MN7A 4CF9A 1YITN 2JWKA 2BE2A 4BRLA 3ATVA 4M3YA 4BRGA 3E9LA 4CJ4A 1XMQK 2HHXA 3KIOA 1ATRA 1KAXA 1YT3A 1OH5A 1RNHA 2G8FA 3WUHA 1CXQA 1HYZA 3KKRA 1EETA 4DV6K 1WSJA 2ZJQL 1TKDA 1XHXA 2VG7A 1K9MO 5KPTA 3U3YA 3DYAA 1B92A 5SWMA 1IBLK 5LY3A 1DGKN 1TUUA 2B6AA 3WNHA 3ULDA 3AO5A 3MK6A 4KB0A 3ISNC 4KREA 1NMDA 2QXFA 2VGMA 2DTUA 2YHBA 3PV8A 4I9LA 3CQXA 1RDWX 3J7YP 4BR5A 3OYDA 3CERA 5HRRA 4JLHA 5KGXA 3QESA 4MLEA 2YJEA 4KBOA 5KI6A 2OZMA 5M1NA 3KK2A 4GMJB 1VK0A 5AZJA 4FCYA 3QDKA 5KQDA 3U6FA 4LF5K 3U8XA 3NFAA 2Q3SA 5AQKA 1HUXA 4DTOA 1W7AA 4DU1A 3VA3A 3GE1A 5C42A 2QEXN 4XH5A 4YY3K 3E9OA 4JHDB 1VQON 2A41A 4XIUA 2W42A 3K59A 1C1CA 1RBUA 4IDHA 5EX5A 1EWQA 2HVHA 3M6GA 3OYAA 2IOCA 2A3ZA 2XY5A 3J8AA 5FPDA 4KHNA 1HPMA 3QFPA 3RMDA 3SQ0A 3A5OC 2KFZA 1B9DA 2HNZA 2F7TA 4BROA 2Q36A 4I2PA 5FLXO 4CVNE 5ELZA 5F1XA 3QEXA 2FBXA 3RR8A 3OS2A 2NRZA 3SPZA 1BG3A 4KH4A 5LL6Z 3EZ5A 3KK3A 4KTWA 2P9UB 3VESA 4FJXA 5GIPA 4KO0A 1YTAA 3CCQN 1VRUA 3MDQA 4JRPA 3UKRB 1RT4A 4DWIA 1HJRA 3OA9A 2ZF5O 5BRFA 1WB9A 3NE6A 4GV3A 2IVOA 2KZMA 2FSNA 3TAEA 3K5MA 1EXQA 4O0IA 1HYSA 2NUBA 3TU5A 3M3ZA 3THWB 1Y97A 3VTHA 1CZAN 4FZXC 1RTIA 4JRQA 1UWBA 4JKAA 4GY2B 1NOYA 2OTJN 1Q9XA 2P9PB 3C6UA 4JYAK 3VQ8A 4CF8A 4DSJA 4FWNA 3NGZA 2QK9A 4FWSA 4WE1A 1BOTO 4DSLA 4KHYA 3QEPA 1K6YA 4K8XA 3HOSA 4KTQA 1RGIA 3B8AX 1QQOA 1X3NA 4B1YB 4J2BA 1IBKK 3AVBA 3PSIA 4FLTA 2E5LK 2W40A 1I39A 2KHOA 5J1EA 5AJ3K 3T1YK 1JCGA 1VQKN 4H0PA 1WSEA 2UUBK 1X3MA 3PIPL 3W3DA 3V9XA 3EY1A 2O8BB 5BR9A 4YOYA 3K9JA 3SQ4A 1RBVA 4FM0A 2IS3A 4CHNA 1A5VA 3WNFA 3QIPA 4CHZA 4PL8A 5AQIA 4IOAL 1KVBA 4DFPA 1T8EA 4C8KA 5FPMA 1EO1A 1IKWA
chains in the Genus database with same CATH topology
4JD2B 3VTIA 2CH5A 3EN9A 4BR2A 1VQMN 4EAHD 3SAGA 2QI2A 3E9PA 3LM2A 1YHQN 4CD1A 4IO8A 5DM7L 2QWMA 1V4TA 5GAGP 1VQ5N 3HRGA 1MWMA 4WF9L 2E2PA 2P9NB 1KXPA 3KK7A 5AQWA 1NGBA 3ENBA 3D2EA 3VF4A 4BRIA 4BGBA 1WOQA 3SJHA 2CH6A 3CC4N 2QWOA 2NRTA 1VQLN 2YX6A 4CBUA 2HBJA 4CI6A 4FWLA 2GWKA 4AM6A 4BRCA 5C2DA 4B1XB 3O9QA 1BU6O 4WQ4A 4CBWA 4FWQA 4U67L 1OKJA 3JXUA 4FL9A 2FXUA 1VAZA 2OTLN 2H3GX 5AFUA 5LJWA 3D2FA 2NRVA 4PKIA 3H1VX 2WBNA 3ENOA 5AQQA 1U2VB 3LM9A 1ESVA 1O13A 4GV6A 2QWNA 3HBTA 4CZJA 1KC8O 4FPBA 1ILYA 4FWKA 4B1ZA 3WT0A 4YDUC 3KWGA 2I7NA 5AQTA 2WUSA 3WEEA 2QM1A 3BF1A 3CCVN 1H1VA 4JN4A 1MWKA 2EWSA 3WXIA 4BVPA 1KQSM 4JD2A 4OO1J 1IG8A 5GADP 1DEJA 2WC9A 4JAXA 4H0XB 1HX1A 3R3LA 3JS6A 3TSUA 4EHTA 2VCPA 4LC9B 1BDGA 1BO5O 2NRRA 4U7BA 2YHWA 2QWLA 3M1FA 1M1KO 4BRNA 2YHYA 3VENA 2E88A 1NBWA 2P9NA 2P9KA 3FZHA 4BRDA 1W97L 3T69A 3PLAA 4H03B 3DAWA 4NB4A 1NGJA 5AQUA 4H0VB 4M7YA 5CHIA 2NZTA 3I56N 1SQKA 4K43A 4BREA 3VEXA 3Q7BA 4BR9A 3CCJN 4YOXA 1S72N 3SK3A 1J6ZA 1K8KB 4BQLA 3VETA 5BPMA 3L6QA 1S3XA 2QTDA 4QS7A 3ZX0A 3FGUA 2QW9A 5EVZA 1GLFO 1U2VA 2Q0UA 1Q18A 5E84A 4JK8A 4B1VA 1Q82O 1VQ6N 4MDBA 3WXLA 1RDUA 1XUPO 3VMFB 4BG8A 1KAZA 3LDLA 4NO7A 4BY9C 4JEPA 1JCEA 1MDUB 3A8YA 3QICA 3O5BA 3MN5A 4NLBA 3U4LA 3AGRA 1JCFA 4BRKA 5C15A 1HKBA 4EIAA 4IJNA 4A2AA 4FPAA 3SAHA 3CMAN 3U9ZA 2F9TA 5KQ8A 5TKYA 1VQ4N 4IO9L 3CJ9A 5C2FA 2V7YA 2VGNA 1T6CA 1S22A 2YHXA 1YVNA 3IFRA 4XH1A 4BRQA 4K25A 3VGKA 1QHAA 3H3OB 1HLUA 4BVOA 5C10A 2FF3B 4ISFA 4WQ5C 3TTDA 3WXMB 3AY9A 3D7EO 5AQGA 1T6DA 3D2EB 2HF4A 3CI5A 3P39A 5JVHL 4FOEA 1LCUA 2E2NA 3KZBA 3SBTA 5JLFA 1NWKA 5JICA 3FZFA 1TYQA 1C0GA 1DT9A 1K8KA 1YF5L 2DPNA 2HBLA 4O5FA 5AQYA 4YOTA 1HJOA 2AA4A 2V7ZA 4IXCA 3D2FB 3KWIA 4CZGA 3ZEUA 4A61A 1JJ2M 1YJNN 4JKGB 3K9KA 2OANA 4BR4A 3RSEA 2F9WA 4B9QA 4BRFA 3GBTA 4BQZA 2ASOA 3EZWA 5AQMA 4YORA 3O08A 2ZJRL 2JWLA 3N4QA 2ZGZA 2W41A 3WEEB 4WQ5A 4BC2A 2P9SA 4UY8O 3ZX2A 1M90O 3C6HA 3E66A 1G99A 3KVGA 5AFUH 5BRHA 3CJ1A 5HL7L 4QS8A 1VQ7N 2E1ZA 4A62A 1XC3A 3CCMN 3EO3A 4JKEA 2GWJA 4IEEA 5TKWA 1WUAA 3LDPA 1KD1O 3R8EA 5EXWA 3C65A 4BC3A 3CJAA 3UB5A 4CZEA 4K42A 5KPZA 5JVGL 3CIPA 4EHUA 2CGLA 3CCRN 1Q81O 2P9LA 4HWIA 3MCPA 5JLHA 3RVCA 1P90A 5AR0A 3AAPA 1NGCA 2Q0RA 3WXJA 3VEZA 3PIOL 2P9KB 4E1JA 2QWPA 4MO5A 3BP8A 2ITMA 5BN9A 4DKWA 1HKGA 2A5XA 3FLCO 3IMXA 1GLCG 4Y0WA 4EFHA 2ZWHA 3TTCA 4CD3A 3L4IA 4BRPA 3FZLA 3H6EA 4BRMA 1YAGA 4IEIA 4JKDA 3SAFA 4DQ8A 2D1KA 5F2RA 4WFBL 4YOWA 2CGJA 5FPEA 3DWLA 4H5RA 3SMPA 2I7PA 2ZJPL 3HZ6A 1X9JA 2J4RA 2D4WA 2QA4N 3GOIA 4JKHA 5AQLA 3U9DA 3UKUA 2BTFA 1GLLO 1Z6RA 2IVNA 3CC7N 2E2QA 1U6ZA 1NGAA 5I9EB 1KAYA 4JKGA 3CC2N 3TSQA 3I8BA 4ILHA 4A57A 2Q2RA 3BUZB 2P9IA 2HOEA 3C0BA 3ENHA 1NJIO 4CZFA 1SAZA 2FF6A 3O1BA 4CZHA 4FVUA 2GEMA 3LDOA 4MO4A 2ZGYA 2NLXA 2PAVA 5EOYA 3VEWA 2PFUA 3WQUA 4K41A 1NGHA 4FSVA 4OPHA 2V51B 4YOUA 3ATUA 5DM6L 2VWBA 4CZIA 4DCHA 3ID6A 4BR7A 4H5WA 5BRDA 5B8HA 1N8RO 3HM8A 1Y64A 5FPNA 3G25A 4PHTX 4YOVA 3G6EN 3H46O 3HI0A 5AQSA 1T3VA 3F9MA 4BR0A 4YDUA 3CETA 4I6MA 2IIRA 3FZKA 3FZMA 4DHYA 5HOOA 2E20A 3ID8A 1ATNA 4JK7A 1TYQB 2VYPA 4IWVA 1K73O 3DXKA 2ASMA 4CZMA 2NRHA 1XQSC 1VQPN 1NGDA 1EQYA 3IDHA 3ZEUB 1ATSA 5AQJA 4ISGA 3R9PA 4PL7A 3H1QA 3R1XA 3RSEB 3VEVA 1HKCA 3NMUA 4J8FA 4B1UB 3EE8A 4C23A 3A5MC 4FO0A 2E8AA 4FWPA 3FE1A 3MCAB 4IOXA 1YUWA 4DB3A 5GINA 2P9SB 5AQVA 1QVFM 2Q97A 3O9TA 4HTLA 3CHWA 3CCSN 5ADXA 4PKHA 2HF3A 3C7NA 4JNEA 3FR0A 3MWPA 1BA1A 1BWFO 1QQMA 2NRXA 3GL1A 3QFUA 4XH4A 1Q86O 2GELA 3ZYYX 1R59O 2GTDA 4ISEA 2QXLA 2HBMA 3Q7CA 3SBGA 3P4IA 3OW2M 2P9LB 5AQOA 4IOCL 2AP1A 3P38A 3T7ZA 3MN9A 3TPQA 3ULEA 4H5NA 3VOVA 4IFEA 3MX5A 3O9SA 3AGKA 3MN7A 1YITN 2JWKA 1NGEA 3BF3A 3FFKB 4M63C 3I33A 3VERA 4BRLA 3GDQA 3O9UA 3ATVA 3NVMA 4KH5A 4BRGA 3E9LA 1YJWN 3O6WA 5GAHP 5M1PA 3G71N 1NLVA 4NLCA 3EKSA 1GLAG 3UKUB 3H3NO 4B1WB 1ZXOA 5AZJB 4ILJA 2P9UA 1NM1A 1ATRA 1NGIA 1QZ5A 4H5TA 1KAXA 3C6AA 4O8KA 3VEOA 1BA0A 3WUHA 5H1SQ 1VQNN 2BUPA 4RCHA 2P9IB 2HMPA 4AF1A 1V4SA 3UKRA 3DJCA 5M1FA 5M1QA 3CXCM 1GLJO 3CCEN 5M1KA 2ZJQL 1NGFA 2PBDA 3P31A 1K9MO 3VEYA 5KPTA 2YJFA 4CJ7A 1SZ2A 3D6RA 3LDNA 1ZBSA 3VF6A 3IKMA 2FSJA 3WQTA 4BC5A 2A6AA 5GAEP 2FSKA 4FOIA 3S41A 5LY3A 4F9OA 1DGKN 1TUUA 4MLHA 3J7ZO 2E1YA 5AQZA 5M1OA 5LJVA 2QWQA 1QVGM 4C1NI 4BRAA 5AQRA 3MK6A 5BPLA 3AAQA 1VQ9N 4L3QA 3ZETA 1NMDA 3QBXA 3ZX3A 2VGMA 1DKGD 1Z05A 3OBYA 5KPRA 4I6MB 2P9PA 3CQXA 4CBXA 1RDWX 4BR5A 5AQHA 3MWTA 3CERA 1MA9B 4H0TB 4BG9A 4MLEA 2YJEA 3DXMB 4KBOA 3QMLA 5M1NA 3DXKB 3OBWA 1BUPA 5E26A 2Q1NA 5AZJA 5CR4A 5CE3A 4BC4A 2E2OA 3QDKA 5KQDA 1GLBG 1K8AO 3DLLL 4CZKA 3F2KA 3EE9A 3R6MA 1OVYA 3U8XA 2RHKA 5AQKA 5AQPA 3VGLA 3OHRA 1HUXA 3CPEA 2D0OA 4FWRA 4IZ9A 2NNWA 3GE1A 4AM7A 4QS9A 3EL2A 1ZC6A 3C7NB 2QEXN 4GNIA 4XH5A 5AQNA 3E9OA 1LOTB 4JHDB 3CPWM 2QWRA 1YI2N 5MLCQ 1VQON 2A41A 5BREA 1D4XA 4IDHA 5EX5A 3M6GA 1E4FT 3VPZA 2A3ZA 3ULEB 5ADXH 3A0IX 3J8AA 5FPDA 3HTVA 3NVKA 2D0PA 1HPMA 2KLAA 2A42A 2NRWA 3QFPA 4FWMA 3G4SN 3EKUA 1VQ8N 1C0FA 3A5OC 4BGAA 2F7TA 4BROA 1TUYA 1YXQA 2Q36A 3CD6N 3TSPA 5AZIB 3DXMA 3N4PA 3UE5A 4WFNL 5ELZA 3H45C 5F1XA 1QQNA 4A5BA 2NRZA 5EY4A 3QB0A 3F5TA 3AARA 1BG3A 4KH4A 3HOTA 3MX2A 4A5AA 3O4WA 2P9UB 4MDAA 2HBKA 2YCHA 4PKGA 3VESA 4JKCA 3SMSA 3WXKA 5F0XA 3IUCA 3W0LA 5GIPA 4CZLA 4GV9A 4A59A 3CCQN 5GIOA 3MDQA 3UKRB 4C1NK 5C0YA 3GG4A 2FLOA 2GX9A 4WYBA 3OA9A 2ZF5O 5BRFA 1W2BM 4A2BA 1YJ9N 3CCLN 4GV3A 2IVOA 1P8ZA 2A40A 2FSNA 1SS6A 2CGKA 4M7XA 3A5LC 3BEXA 4JHDA 5C12A 3O8MA 2IVPA 4GVEA 3TU5A 3M3ZA 2Q31A 1YIJN 4R79A 3VTHA 1CZAN 3CJCA 1GLDG 3M5RA 3MMVA 4O8UA 4JKAA 3ZETB 3VF2A 4GY2B 2YI1A 4H0YB 2RE2A 2OTJN 3E1YA 5AQXA 2P9PB 4XEIA 4JKFA 4RWTA 1Q7YO 3QBWA 4H0OA 5AZIA 3TTFA 4FWNA 4H5VA 4OPAA 3VGMA 4WFAL 4FWSA 4RTFD 1BOTO 3O9RA 4G9ZA 2KKZA 3O1WA 1RFQA 2V52B 4JK9A 3CCUN 3HOSA 1QZ6A 1RGIA 3MN6A 3KHYA 3B8AX 4IJAA 1QQOA 3I55N 1X3NA 3CJBA 5BPNA 5BN8A 3LDQA 4B1YB 2UYTA 3CQYA 4ILGB 3CJ7A 4JKBA 1T44A 2W40A 2KHOA 3L0QA 4Z94A 1JCGA 1VQKN 4H0PA 3SLCA 4BRHA 3CMEN 5AQFA 1X3MA 3PIPL 1GLEG 3W3DA 5JMVA 3HSCA 5BR9A 4YOYA 3K9JA 3LL3A 4FWOA 2WFBA 2BH1A 2HSTA 1E4GT 2GUPA 3CF5L 4PL8A 1IJJA 4KH6A 5AQIA 3O80A 4WCEL 4IOAL 1NGGA 5FPMA 3L4QA 1EO1A 2ASPA 4WQ4C 3A5NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9J A;  3HOS A;  3HOT A;  3F2K A;  4MDB A;  4MDA A;  5CR4 A;  2F7T A;  4R79 A;  5HOO A;  3K9K A;  4U7B A; 
#chains in the Genus database with same CATH topology
 2YNG A;  2HB5 A;  3VTI A;  3NH0 A;  5KGW A;  3SAG A;  4IO8 A;  1JLF A;  4CF0 A;  3OYI A;  4AHV A;  3HRG A;  1QE1 A;  1HRH A;  5AQW A;  3ENB A;  1RIL A;  4BGB A;  4FVM A;  4CCH A;  2OCE A;  2YX6 A;  1U47 A;  4BRC A;  4AM6 A;  4FJI A;  3O9Q A;  4CBW A;  4DTJ A;  4DS5 A;  1OKJ A;  4FL9 A;  1NU0 A;  4X64 K;  4DQR A;  3LP0 A;  5AQQ A;  3WNG A;  1S9G A;  3HBT A;  4FPB A;  1ILY A;  4FWK A;  3WT0 A;  1T05 A;  3QIN A;  4CFC A;  4B3T K;  1UA1 A;  4CHP A;  4H0X B;  4DLE A;  1HX1 A;  4JI2 K;  3ASM A;  2VCP A;  1RDB A;  4CFD A;  2QWL A;  3LAL A;  1M1K O;  3IRX A;  4AIL C;  3LZI A;  2P9K A;  2P9N A;  1BIU A;  4RW7 A;  3NDK A;  4M7Y A;  1RDD A;  3LP3 A;  1SQK A;  3JYT A;  2UXB K;  3CCJ N;  4C8M A;  3CQ8 A;  1S3X A;  2DY4 A;  1L3V A;  1GLF O;  1OVQ A;  1REV A;  4KHP K;  1Q82 O;  3VQD A;  1VQ6 N;  3DRR A;  1XUP O;  3TAQ A;  4FLY A;  4H4O A;  1MDU B;  3QIC A;  3O5B A;  4NLB A;  4EIA A;  4J2E A;  1BL3 A;  4M42 A;  2ZE2 A;  4DV4 K;  5JS1 A;  4CJK A;  4FK0 A;  5KQ8 A;  4IO9 L;  1NK4 A;  3AVH A;  2KFN A;  3VQ9 A;  4FJH A;  4ISF A;  4WQ5 C;  4O44 A;  2YNH A;  3P39 A;  1LCU A;  2E2N A;  1BCO A;  2FC0 A;  5JIC A;  3FZF A;  5J2Q A;  4CJP A;  4O5F A;  1QSL A;  1YF5 L;  2DPN A;  4DTX A;  1HJO A;  4IXC A;  3D2F B;  3KWI A;  1L3U A;  1JJ2 M;  4LFB K;  4M3X A;  3K9K A;  3OVN A;  2F9W A;  4PA1 A;  1TKT A;  4BQZ A;  3U3G A;  3I0S A;  4YOR A;  2ZGZ A;  1X9M A;  3WEE B;  2X78 A;  2P9S A;  4DV7 K;  1XNR K;  4UY8 O;  3PX0 A;  4LH4 A;  3RMB A;  3CCM N;  1QTM A;  1JLA A;  4JKE A;  4W5R A;  3V9W A;  4BC3 A;  3CJA A;  5JVG L;  3AO1 A;  4W5T A;  3CIP A;  4EHU A;  4AQY K;  2GBZ A;  1C0U A;  2P51 A;  2Q0R A;  3WXJ A;  4FXD A;  2ITM A;  3DLE A;  4HCC A;  3TTC A;  4CD3 A;  1NNE A;  4BRM A;  4IEI A;  3VA0 A;  4DQ8 A;  1JLQ A;  2D1K A;  5F2R A;  2I7P A;  3HZ6 A;  3OYH A;  1X9J A;  2J4R A;  3DLR A;  2D4W A;  2QA4 N;  3GOI A;  1HQE A;  5AQL A;  4NXN K;  1GLL O;  4N47 A;  2IVN A;  4F8R A;  4O55 A;  4Q0B A;  3I8B A;  4A57 A;  4MFB A;  1XWL A;  4CGF A;  4DMN A;  3ENH A;  1NJI O;  4CZF A;  3NGY A;  3LDO A;  4MO4 A;  1TKX A;  2ZGY A;  3TWH A;  3NF8 A;  1VSF A;  1RT3 A;  2F96 A;  2XY6 A;  4CFA A;  4OPH A;  3ATU A;  5DM6 L;  2VWB A;  4CZI A;  3DLG A;  4BR7 A;  5BRD A;  1Y64 A;  2D0B A;  4PHT X;  5AQS A;  4CGG A;  1BI4 A;  3CET A;  4I6M A;  2IIR A;  1VSM A;  1SUQ A;  4DHY A;  5HOO A;  2E20 A;  4CED A;  1D9D A;  3F73 A;  1TYQ B;  3DXK A;  3HT3 A;  3AO2 A;  4X66 K;  3IDH A;  1C0T A;  3R1X A;  3RSE B;  3P5J A;  4DF8 A;  3HL8 A;  4J8F A;  2E8A A;  3FE1 A;  5GIN A;  4CW7 B;  1U48 A;  1A5X A;  5AQV A;  3O9T A;  4CIF A;  1BQM A;  3THV A;  2HF3 A;  3UIQ A;  2BDP A;  1DLO A;  3RRH A;  2GEL A;  1R0A A;  2HBM A;  3SBG A;  2P9L B;  5AQO A;  1E3M A;  2W6L A;  3P38 A;  3KK1 A;  3MN9 A;  3TPQ A;  4IFE A;  3NH1 A;  4FJM A;  2XHB A;  4M63 C;  3VER A;  2RPI A;  4KH5 A;  3MED A;  3TAR A;  4B8A B;  3MEG A;  4BWJ A;  3O6W A;  5GAH P;  4NLC A;  1VSL A;  3QNO A;  3H3N O;  4JS4 A;  1IKY A;  5AZJ B;  4ILJ A;  3O3G A;  1SKS A;  4X65 K;  1NKB A;  3C6A A;  3VEO A;  1XC9 A;  1VQN N;  1SKR A;  2HMP A;  1V4S A;  3ZSR A;  3CXC M;  3MXI A;  4IFV A;  1XMO K;  2YJF A;  1SZ2 A;  2HHH K;  3IKM A;  3L2W A;  4FOI A;  4DS4 A;  3S41 A;  4PQU A;  1QVG M;  4C1N I;  4BRA A;  5AQR A;  2KTQ A;  2O8C A;  2O8D A;  4L3Q A;  3ZET A;  5KPR A;  3MXM A;  3MWT A;  4H0T B;  1N33 K;  2O4I A;  4LF7 K;  3JAM O;  5HRP A;  4IKF A;  5E26 A;  1B9F A;  2Q1N A;  3VQP A;  4DUY K;  2HHS A;  3QO9 A;  1KLM A;  2E2O A;  4E0D A;  1J5O A;  1K8A O;  4CZK A;  1NJX A;  3F2K A;  3EE9 A;  3KLF A;  2O8E A;  3VGL A;  3NF7 A;  3VN5 A;  4QS9 A;  1BCM A;  1RBS A;  1WSH A;  4GNI A;  2ITG A;  1LOT B;  4E1N A;  1UA0 A;  1YI2 N;  5CZ1 A;  3SUN A;  1WSF A;  4NYN A;  4FK4 A;  4HUF A;  4R5P A;  2VWK A;  3HTV A;  2A42 A;  2NRW A;  4ZTJ A;  4KKO A;  3G4S N;  3CM6 A;  4L8R B;  1VQ8 N;  4BGA A;  1NKE A;  1TUY A;  3THX A;  3CD6 N;  5KRS A;  3DXM A;  4WFN L;  1GOC A;  1QQN A;  4KI4 A;  2G8W A;  3F5T A;  4W5O A;  4X62 K;  4DV2 K;  4A5A A;  4MDA A;  2YCH A;  4FM2 A;  4CEB A;  4CZL A;  4JI8 K;  4Z4G A;  4C1N K;  5C0Y A;  3GG4 A;  2G8V A;  4E7J A;  2X6S A;  1TK5 A;  1KRP A;  3RR7 A;  4CJU A;  1QSY A;  4CJE A;  2UUA K;  3MEC A;  5DK5 A;  4CJF A;  4BE0 A;  4R79 A;  4OJR A;  2IGI A;  4O8U A;  1IBM K;  3THY A;  3PO4 A;  4CIE A;  2YI1 A;  4H0Y B;  3E1Y A;  4V19 S;  3CG7 A;  4JKF A;  3V9U A;  1SL1 A;  3QBW A;  4H0O A;  2DFE A;  5AZI A;  3AVI A;  3TTF A;  4H5V A;  2DFH A;  4OPA A;  3VGM A;  1RTH A;  3O9R A;  1RFQ A;  2V52 B;  4FJ9 A;  4DTN A;  3RWU A;  3KHY A;  3IAY A;  4K8Z A;  3I55 N;  4DQP A;  4DSE A;  3AVM A;  2UYT A;  1JLB A;  3CQY A;  1JL2 A;  4LF8 K;  3CM5 A;  4ILG B;  3CJ7 A;  3LP1 A;  1Z25 A;  4E89 A;  1VSJ A;  2BAN A;  3KD5 E;  4BRH A;  3CME N;  1O1W A;  2ATQ A;  5JMV A;  3S3N A;  4Z4I A;  4PY5 A;  3PSF A;  1FK9 A;  1IJJ A;  1WBB A;  4KH6 A;  2KZZ A;  4B3R K;  2ASP A;  1RT6 A;  3HP9 A;  2LSN A;  3EN9 A;  4Z0U A;  4M41 A;  1YHQ N;  4F3T A;  5DM7 L;  3TAN A;  1V4T A;  4JI1 K;  3RMA A;  4C8O A;  1NG9 A;  4GVM A;  2P9N B;  1KXP A;  3KK7 A;  4CEF A;  1NGB A;  3D2E A;  4BRI A;  1WOQ A;  3SZ2 A;  4LF9 K;  4Z4F A;  3CC4 N;  2QWO A;  4CI6 A;  2GUI A;  4FWL A;  2GWK A;  5C2D A;  4WQ4 A;  3K58 A;  3AO4 A;  2UU9 K;  3CYM A;  4U67 L;  5SZT A;  4KHU A;  4E7L A;  4NXM K;  2FXU A;  1VAZ A;  2Z1G A;  3O3F A;  2H3G X;  5AFU A;  5LJW A;  3RTV A;  3H1V X;  1BHL A;  4FJ8 A;  1ESV A;  1HNI A;  4GV6 A;  2QWN A;  4RW8 A;  4Z4C A;  4CZJ A;  1KC8 O;  4DSF A;  5E41 A;  2QM1 A;  4M3R A;  5J2M A;  2O8F A;  1KQS M;  1IG8 A;  2HVI A;  5GAD P;  1DEJ A;  2HHT A;  4JAX A;  4O4G A;  1RTJ A;  1BDG A;  2NRR A;  4U7B A;  2YHW A;  3M1F A;  4E7K A;  4BRN A;  3VEN A;  5HRN A;  3FZH A;  1W97 L;  3B6P A;  4DSI A;  4OLA A;  5AQU A;  3DAW A;  1NGJ A;  1X9W A;  4I2Q A;  2NZT A;  3H08 A;  4K43 A;  2HW3 A;  4BRE A;  3VEX A;  3O4Q A;  3Q7B A;  4DFM A;  1S72 N;  3SK3 A;  1J6Z A;  3IS9 A;  3OYK A;  3AVG A;  4QS7 A;  3ZX0 A;  1SL2 A;  4OPJ A;  4CGJ A;  1U2V A;  1Q18 A;  5E84 A;  4JK8 A;  4B1V A;  4N5S A;  4MDB A;  3NH2 A;  4FLU A;  2HHV A;  4BG8 A;  4CES A;  1KAZ A;  4BY9 C;  3A8Y A;  5C15 A;  1JCF A;  1KCF A;  4F2R A;  5FDL A;  3K5O A;  4M45 A;  4A2A A;  4FPA A;  3CMA N;  2O4G A;  3QEV A;  5HLF A;  3U9Z A;  3C95 A;  4CHQ A;  2IC3 A;  1A5W A;  4C8L A;  1ZBH A;  3ZSX A;  1RBR A;  4G1Q A;  2VGN A;  1S22 A;  1YVN A;  4BRQ A;  4XH1 A;  4PUO A;  4K25 A;  3VGK A;  4BVO A;  4YFU A;  4E3S A;  4DQI A;  4IG3 A;  4CEZ A;  2HF4 A;  3VQ5 A;  4FOE A;  2ETJ A;  4O5B A;  1RT1 A;  2PY5 A;  4JI0 K;  4CZG A;  1RBT A;  1YJN N;  2OAN A;  3DOL A;  1L3S A;  2YNF A;  3GBT A;  2ASO A;  2VQF K;  2FBV A;  2ZJR L;  2P5O A;  4IDK A;  3JSM A;  4CEE A;  3ZX2 A;  5BR8 K;  1M90 O;  3S3M A;  3E66 A;  3FFI A;  5BRH A;  5HL7 L;  2E1Z A;  4IEE A;  5TKW A;  3LDP A;  2XO7 A;  1KD1 O;  3C65 A;  5KPZ A;  1ASV A;  3UB5 A;  4K42 A;  1UAX A;  4DR3 K;  5A2Q O;  3HVT A;  3V6D A;  3PIO L;  4H4M A;  2QWP A;  4ZHR A;  4DKW A;  1HKG A;  4CJS A;  3IMX A;  1GLC G;  1LAW A;  3L4I A;  4IFY A;  4YOW A;  1U4B A;  3DWL A;  3SMP A;  4B9L A;  4UQG A;  2UXD K;  3SYZ A;  4JKH A;  3CC7 N;  2BTF A;  1FKO A;  2E2Q A;  1ASU A;  4E19 A;  1NGA A;  5I9E B;  3OYL A;  4JKG A;  3NAE A;  3CC2 N;  3TSQ A;  4ILH A;  4RW9 A;  2Q2R A;  5LMU K;  2HOE A;  3P83 D;  3C0B A;  3C6T A;  3ZT3 A;  3CFP A;  1EWR A;  1GOB A;  1SAZ A;  4Z4E A;  2FF6 A;  4CZH A;  4FVU A;  2X74 A;  2JLE A;  2PFU A;  3WQU A;  3AVK A;  3HPG A;  2RF2 A;  1C0M A;  3ITH A;  3NCI A;  2V51 B;  4YOU A;  3K5L A;  4KHQ A;  1NKC A;  4CEA A;  3LDS A;  4DCH A;  4ELU A;  3ID6 A;  4LF6 K;  4JV5 K;  1C6V A;  3HM8 A;  5FPN A;  4KHW A;  1NOZ A;  3HI0 A;  1T3V A;  3F9M A;  4BR0 A;  4YDU A;  3AVN A;  4TSX A;  3FZM A;  5CY4 A;  2KQ2 A;  1ATN A;  4JK7 A;  5J2P A;  5CZ2 A;  2ASM A;  1C1A A;  3DOK A;  4OKJ A;  4CZM A;  3K57 A;  3L8B A;  4JI7 K;  1XQS C;  1X9S A;  4ZTF A;  1CLQ A;  3ZEU B;  4CJV A;  2X6N A;  4DTM A;  3VEV A;  3L2V A;  4B1U B;  1BGX T;  4FO0 A;  4FWP A;  4LSN A;  3MCA B;  2ZQB A;  4HUG A;  3AVC A;  3QEI A;  4W5Q A;  5ADX A;  1RTD A;  4PKH A;  4JNE A;  2EHG A;  1BA1 A;  1BWF O;  4CGH A;  3QFU A;  2OZS A;  3ZYY X;  3OW2 M;  4LD0 A;  3RRG A;  2AP1 A;  5IWA K;  3AVA A;  4H5N A;  3MX5 A;  2O8C B;  1NK0 A;  4KAZ A;  1NGE A;  3GDQ A;  4FJ5 A;  3NVM A;  3V9Z A;  4DV5 K;  2OPP A;  1YJW N;  1N36 K;  4B9T A;  3UKU B;  4QOZ B;  1GLA G;  4B1W B;  4CGD A;  1FW6 A;  2P9U A;  2WOM A;  2AJQ A;  1NGI A;  4H5T A;  4O8K A;  4EZ9 A;  1BA0 A;  5H1S Q;  2BUP A;  4RCH A;  2P9I B;  3UKR A;  2O8E B;  1GLJ O;  3CCE N;  3ZSZ A;  3V1O A;  2QKB A;  4JS5 A;  3P31 A;  3M8Q A;  3VEY A;  4KV8 A;  4CJ7 A;  3LDN A;  1ZBS A;  3WQT A;  2A6A A;  3OYE A;  1U45 A;  3OY9 A;  4F9O A;  4MLH A;  2E1Y A;  5AQZ A;  5M1O A;  5LJV A;  2QWQ A;  3BZC A;  1JL1 A;  3AAQ A;  3OYC A;  3QER A;  3QBX A;  1DKG D;  3VQE A;  2P9P A;  4CBX A;  4M3W A;  5AQH A;  1KVA A;  3SUO A;  3LAK A;  1MA9 B;  3THX B;  1OH8 A;  3DXM B;  3QML A;  3L2Q A;  1YTU A;  4N41 A;  5CR4 A;  5CE3 A;  4BC4 A;  1GLB G;  4KPY A;  2RHK A;  4B9U A;  2P5G A;  1JXE A;  5AQP A;  2F8S A;  2D0O A;  4FWR A;  1XNQ K;  3SV4 A;  4IZ9 A;  4OLB A;  2NNW A;  3KLI A;  4Y1C A;  3EL2 A;  1ZC6 A;  3C7N B;  4ICL A;  1NK8 A;  3KTQ A;  3J80 O;  5MLC Q;  1IKV A;  3ZT2 A;  1E4F T;  1YVU A;  3VPZ A;  3HO1 A;  3ULE B;  4EP5 A;  3A0I X;  2Z1H A;  2D0P A;  3THY B;  3ALY A;  4FWM A;  3EKU A;  3K5N A;  4KRF A;  1Q8I A;  5AZI B;  3SPY A;  3PX6 A;  3H45 C;  4M3T A;  4B9M A;  4A5B A;  2A1S A;  3AAR A;  2ZM6 K;  4DV1 K;  3DLK A;  3MX2 A;  3OYM A;  3O4W A;  2HBK A;  1HNZ K;  5F0X A;  4JKC A;  3QET A;  3W0L A;  3EYZ A;  2OYQ A;  4A59 A;  4GV9 A;  5GIO A;  4CJR A;  3SI6 A;  1TK0 A;  4ID5 A;  4HUE A;  2B5J A;  2FLO A;  5IT9 O;  1W2B M;  1NK5 A;  3CCL N;  4CFB A;  3MAQ A;  4C8N A;  1SS6 A;  2CGK A;  4YNQ A;  3OS0 A;  3O8M A;  4GVE A;  3TAG A;  4CE9 A;  2Q31 A;  3G0Z A;  1YIJ N;  3M5R A;  5CYQ A;  2PYJ A;  3WNE A;  5T7B A;  4W5N A;  3VF2 A;  3K0S A;  2RE2 A;  5AQX A;  4RWT A;  1Q7Y O;  3BDP A;  2B4J A;  3BZK A;  4B3M K;  1RT7 A;  1HNV A;  1I94 K;  4NYF A;  4AHR A;  4DLG A;  1QQC A;  1U04 A;  4G9Z A;  3O1W A;  3CCU N;  3MN6 A;  4IJA A;  2YV0 X;  3D45 A;  5BPN A;  3BY5 A;  1MU2 A;  1T44 A;  2I5J A;  4YHH K;  3L0Q A;  4Z94 A;  1W9H A;  4HHT A;  4FLV A;  3SLC A;  4LFA K;  4OGE A;  1GLE G;  1S1V A;  3QLH A;  3LL3 A;  1TL1 A;  1JLE A;  2BH1 A;  1N34 K;  1E4G T;  1JXB A;  3T1H K;  3O80 A;  4DFK A;  4WCE L;  4CEQ A;  1TK8 A;  3OS1 A;  3VF4 A;  3A5N C;  1FJG K;  4EAH D;  4DTS A;  1VSH A;  3E9P A;  3LM2 A;  3O4N A;  4CD1 A;  2QWM A;  5GAG P;  2RN2 A;  3OYJ A;  2G8K A;  2D0C A;  1JLC A;  3SNN A;  1SL0 A;  2E2P A;  1JKH A;  3D0P A;  5K14 A;  3AO3 A;  1KSP A;  2CH6 A;  2NRT A;  3VQ7 A;  4CBU A;  2YKM A;  2VG6 A;  1BU6 O;  4FWQ A;  3JXU A;  3E01 A;  4CF2 A;  3D2F A;  2NRV A;  4PKI A;  1S1X A;  2Z1J A;  3ENO A;  1U2V B;  4DU3 A;  3OTO K;  3MEE A;  4YDU C;  3KWG A;  1EP4 A;  2I7N A;  2WUS A;  3WEE A;  3ZT0 A;  3LWL A;  3CFO A;  2PZS A;  1H1V A;  2EWS A;  1TKZ A;  4BVP A;  4JD2 A;  3BGR A;  2WC9 A;  3R3L A;  1LWE A;  1S1T A;  3TSU A;  3AVL A;  4EHT A;  4LC9 B;  1BO5 O;  3J81 O;  3V1Q A;  4OX9 K;  4DG1 A;  4CK3 A;  1NBW A;  4FM1 A;  4QAG A;  4B9S A;  4H03 B;  4NB4 A;  1VRT A;  4H0V B;  2HHQ A;  3HXM A;  3I56 N;  1S5J A;  1ZYQ A;  4BR9 A;  4B9V A;  3ZT1 A;  4YOX A;  1L5U A;  2OA8 A;  5BPM A;  3K2P A;  4QCL A;  3SUQ A;  4N56 A;  3AVF A;  3FGU A;  2QW9 A;  5EVZ A;  3TAP A;  2Q0U A;  4FZY A;  5HP1 A;  4RG8 A;  1D5A A;  3WXL A;  1RDU A;  3MXJ A;  2XY7 A;  4FYD A;  1LAV A;  3MN5 A;  3SQ2 A;  1NJY A;  3SAH A;  2F9T A;  1NK6 A;  1VQ4 N;  3CJ9 A;  5C2F A;  2V7Y A;  4RW4 A;  4DR2 K;  1T6C A;  2IDO A;  3IFR A;  3NGI A;  3DLB A;  1QHA A;  4BDP A;  4F2S A;  5C10 A;  2FF3 B;  4O0J A;  1BQN A;  3OYG A;  5I3U A;  3D7E O;  4I9Q A;  1T6D A;  1T03 A;  3CI5 A;  4CIG A;  1LW0 A;  1TYQ A;  1C0G A;  2HBL A;  1K8K A;  1ZBI A;  1TAQ A;  2AA4 A;  2V7Z A;  1TAU A;  1ZBU A;  4JKG B;  3RSE A;  1WAJ A;  4B9Q A;  4Y1D A;  2OPS A;  3DM2 A;  2JWL A;  3AA3 A;  3AVJ A;  2W41 A;  4WQ5 A;  4BC2 A;  3KVG A;  5AFU H;  1D8Y A;  4A62 A;  3EO3 A;  3R8E A;  5EXW A;  3OYB A;  4CZE A;  1DTQ A;  4BAC A;  4JI4 K;  3CCR N;  2P9L A;  3MCP A;  5C24 A;  4F3O A;  5JLH A;  3RVC A;  1P90 A;  5AR0 A;  3AAP A;  3VEZ A;  2F4V K;  2P9K B;  4E1J A;  5BN9 A;  3ZSY A;  2A5X A;  3LZJ A;  4EFH A;  2ZWH A;  3A2F A;  1TV6 A;  3FZL A;  3H6E A;  4JKD A;  3C94 A;  4WFB L;  3HK2 A;  2CGJ A;  5FPE A;  2UXC K;  2ZJP L;  3L3V A;  1U6Z A;  4J2A A;  1KAY A;  2VG5 A;  3S3O A;  4CF1 A;  1EKE A;  3J7A P;  1S6P A;  4BWM A;  1W0H A;  3TAB A;  3L3U A;  3VEW A;  4K41 A;  4DV3 K;  3S9H A;  3QNN A;  3NBP A;  3PUF A;  4H5W A;  1CZ9 A;  5B8H A;  1T7P A;  1N8R O;  3DI6 A;  4DR5 K;  4YOV A;  3G6E N;  3FZK A;  5DMR A;  1I3A A;  3ZT4 A;  4FJJ A;  3ZCM A;  1LWF A;  2YHA A;  4Z4H A;  4F4K A;  4IWV A;  1ASW A;  1K73 O;  1IH7 A;  3ZSQ A;  2NRH A;  1IG9 A;  1VQP N;  1NGD A;  3M8S A;  5AQJ A;  4ISG A;  3R9P A;  3KLH A;  2G8U A;  3EE8 A;  4C23 A;  1RDC A;  4IOX A;  1YUW A;  4DB3 A;  3DLH A;  2P9S B;  2Y1I A;  2Q97 A;  4HTL A;  3CHW A;  3IG1 A;  3FR0 A;  3MWP A;  1QQM A;  2NRX A;  4EP4 A;  4XH4 A;  3ZSW A;  1R59 O;  2GTD A;  1KFD A;  3TAM A;  2QXL A;  3Q7C A;  4AH9 A;  4FLW A;  3P4I A;  3PX4 A;  1DTT A;  3KKS A;  4KFB A;  4DF4 A;  3T7Z A;  3DRS A;  3LP2 A;  3O9S A;  3AA4 A;  3AGK A;  1WN7 A;  3BF3 A;  3FFK B;  3I33 A;  4DUZ K;  3O9U A;  4HVJ A;  4OKK A;  1HMV A;  1LW2 A;  4FJL A;  4B3S K;  5M1P A;  3G71 N;  1NLV A;  3EKS A;  1LWC A;  1ZXO A;  1NM1 A;  1QZ5 A;  1HNX K;  4DTR A;  1BIZ A;  4DR1 K;  3DJC A;  5M1F A;  5M1Q A;  4FJ7 A;  5KRT A;  5M1K A;  1X1P A;  3M8P A;  1NGF A;  2PBD A;  3G10 A;  2HMI A;  1Z26 A;  3HYF A;  4E7H A;  3D6R A;  2HND A;  3VF6 A;  2DFF A;  4BC5 A;  1WNS A;  2FSJ A;  5GAE P;  2FSK A;  4FLZ A;  3J7Z O;  2W6K A;  1QHT A;  4FW1 A;  5BPL A;  1VQ9 N;  3DMJ A;  3HJF A;  3ZX3 A;  1BI4 B;  3KLG A;  1Z05 A;  3OBY A;  1Q9Y A;  1VSD A;  2E6M A;  1HR0 K;  4CJ5 A;  1WLJ A;  4I6M B;  4GKK K;  4NCG A;  3T19 A;  2EX3 A;  3AV9 A;  1KLN A;  1S9E A;  4GW6 A;  4BG9 A;  1VHX A;  3P1G A;  4ID1 A;  3DXK B;  3OBW A;  5CYM A;  1OH7 A;  1BUP A;  4DTU A;  1OH6 A;  3DLL L;  3R6M A;  1OVY A;  1S1U A;  3OHR A;  3CPE A;  4LF4 K;  1HQU A;  2XY8 A;  1SV5 A;  2YNI A;  3ZLJ A;  4AM7 A;  4AHU A;  3OYN A;  1CXU A;  5FRO A;  5AQN A;  1C1B A;  3HPH A;  2QWR A;  2HHU A;  5BRE A;  4CJW A;  3L2U A;  1D4X A;  5J2N A;  5ADX H;  3NVK A;  4PWD A;  2KLA A;  1UOC A;  5LMN K;  3HVR A;  1C0F A;  3NHG A;  1TL3 A;  3OJU A;  3PY8 A;  4OVL A;  1YXQ A;  2VWJ A;  3SCX A;  4DV0 K;  3TSP A;  3N4P A;  3UE5 A;  5EY4 A;  3QB0 A;  4CEC A;  3HOT A;  3KLE A;  2E4L A;  3WXK A;  4PKG A;  3SMS A;  3B6O A;  3IUC A;  1WAF A;  3LPU A;  4HCB A;  4LSL A;  4B3O A;  1S1W A;  4NCB A;  3VQA A;  1IO2 A;  2GX9 A;  1F21 A;  4WYB A;  4A2B A;  1YJ9 N;  4DQS A;  1P8Z A;  2A40 A;  5C25 A;  4M7X A;  3A5L C;  3BEX A;  4JHD A;  5C12 A;  2IVP A;  2Y1J A;  2Z1I A;  4AHS A;  4AHT A;  5HBM A;  3CJC A;  1GLD G;  3MMV A;  1U49 A;  2O8D B;  3AA5 X;  3ZET B;  2VQE K;  4XEI A;  4CK1 A;  4OKE A;  3HST B;  4CK2 A;  4B8C A;  4FJG A;  4FJN A;  3SUP A;  4B9N A;  3VQ4 A;  1ZBF A;  3V81 A;  4WFA L;  4RTF D;  4DU4 A;  4CHY A;  2KKZ A;  4JK9 A;  1QZ6 A;  3CJB A;  4CGI A;  5BN8 A;  3LDQ A;  4HTU A;  3PO5 A;  4JKB A;  3M8R A;  3TI0 A;  4KI6 A;  3I0R A;  5AQF A;  3HSC A;  1TVR A;  3HM9 A;  3THW A;  4FWO A;  2R7Y A;  2WFB A;  2HST A;  4FJK A;  3OJS A;  2GUP A;  3CF5 L;  4DTP A;  5HRS A;  3OYF A;  4NCA A;  1VSE A;  1NGG A;  3L4Q A;  4WQ4 C;  3KD1 E;  4B08 A;  4JD2 B;  1GOA A;  2CH5 A;  3QIO A;  4BR2 A;  2WON A;  1VQM N;  2QI2 A;  1XI1 A;  4J2D A;  1RCH A;  4DSK A;  3ZSO A;  5FRM A;  1QS4 A;  3SQ1 A;  2FBY A;  4FW2 A;  1VQ5 N;  1EX4 A;  3EEQ A;  1MWM A;  4WF9 L;  4CER A;  1IKX A;  1ZBL A;  1VSI A;  2RKI A;  3SJH A;  1KFS A;  1HYV A;  1WSG A;  1VQL N;  4BDZ A;  2HBJ A;  2HNY A;  1WBD A;  4B1X B;  3HPO A;  1FKP A;  4BE2 A;  3F9K A;  2OTL N;  2O8B A;  3NF9 A;  2WBN A;  3LM9 A;  4CJQ A;  1O13 A;  4B1Z A;  5AQT A;  4CJT A;  3BF1 A;  3CCV N;  3WXI A;  4JN4 A;  1MWK A;  1J9A A;  1TGO A;  4OO1 J;  4OGC A;  4FK2 A;  3JS6 A;  3TR8 A;  2G8H A;  1IV0 A;  4CHO A;  2OPR A;  2D0A A;  2JGU A;  2YHY A;  2E88 A;  4CJ3 A;  3PLA A;  4BE1 A;  4BRD A;  3T69 A;  1NJW A;  5CHI A;  4GKJ K;  2XRI A;  4JI5 K;  5EU7 A;  1FXX A;  3LPT A;  4H8K A;  1J53 A;  1K8K B;  4BQL A;  3VET A;  3L2R A;  3L6Q A;  2QTD A;  2OPQ A;  3T1A A;  4MQ3 A;  3SV3 A;  3VMF B;  3LDL A;  4NO7 A;  4JEP A;  1JCE A;  4AF1 A;  3CPW M;  3U4L A;  3AGR A;  4BRK A;  1HKB A;  4IJN A;  3LAN A;  1N5Y A;  3VQB A;  5TKY A;  1S6Q A;  2P1J A;  4DR4 K;  1CZB A;  2YHX A;  4I7F A;  4DR7 K;  3LAM A;  3H3O B;  1HLU A;  1RDA A;  4EZ6 A;  3TTD A;  3WXM B;  4CEO A;  3AY9 A;  4Q5V A;  3HP6 A;  5AQG A;  4DFJ A;  3D2E B;  5JVH L;  3SJJ A;  3KZB A;  3SBT A;  1QSS A;  5JLF A;  4E1M A;  1NWK A;  3ZSV A;  1KTQ A;  4YOT A;  3QEW A;  1DT9 A;  4FZZ A;  5AQY A;  3LWM A;  3AA2 A;  1J54 A;  3ZEU A;  4A61 A;  4BR4 A;  4LY7 A;  4BRF A;  4LFC K;  3EZW A;  5AQM A;  3O08 A;  3N4Q A;  1SKW A;  2GV9 A;  3RMC A;  1HPZ A;  2O8F B;  2KW4 A;  2WTU A;  3C6H A;  1G99 A;  5FRN A;  3CJ1 A;  1D9F A;  4QS8 A;  1VQ7 N;  1XC3 A;  2GWJ A;  4KHS A;  1WUA A;  4N76 A;  2CGL A;  1Q81 O;  4HWI A;  4KTZ A;  1NGC A;  2D5R A;  4DQQ A;  1VSK A;  3VQ6 A;  4MO5 A;  3BP8 A;  4ELT A;  1NK7 A;  3FLC O;  4Y0W A;  4KB1 A;  4BRP A;  2FBT A;  1YAG A;  3SAF A;  1LV5 A;  1KVC A;  4BDY A;  4H5R A;  2ZD1 A;  2IAJ A;  5D3G A;  1RT2 A;  3U9D A;  3UKU A;  1Z6R A;  2A1R A;  1HNW K;  4JI3 K;  2E6L A;  1NK9 A;  2F8T A;  3BUZ B;  5HRO A;  2P9I A;  4JI6 K;  4M3Z A;  5I42 A;  3VQC A;  3O1B A;  1XHZ A;  2BGG A;  2GEM A;  1BIS A;  2PYL A;  2NLX A;  2YKN A;  2PAV A;  5EOY A;  1NMN A;  1J5E K;  4M3U A;  1N6Q A;  4AHC A;  2UUC K;  1NGH A;  4FSV A;  1RT5 A;  3CFR A;  4RW6 A;  3V4I A;  3G25 A;  3H46 O;  4LH5 A;  1NJZ A;  4IG0 A;  3VQQ A;  1G15 A;  3ID8 A;  3V1R A;  1L3T A;  2VYP A;  1WSI A;  2QKK A;  1JLG A;  3TAF A;  1EQY A;  4DR6 K;  1ATS A;  4IBN A;  4PL7 A;  3H1Q A;  1N32 K;  4ELV A;  1HKC A;  3NMU A;  3NF6 A;  3A5M C;  4FLX A;  4K0K K;  4E7I A;  1QVF M;  1ITG A;  5KTQ A;  3CCS N;  3C7N A;  4OPK A;  1Q86 O;  3GL1 A;  2G8I A;  4ISE A;  5JS2 A;  3T3F A;  4IOC L;  3DRP A;  4CJL A;  2HHW A;  3O3H A;  3ULE A;  3VOV A;  3KJV A;  3V9S A;  3I8D A;  3MN7 A;  4CF9 A;  1YIT N;  2JWK A;  2BE2 A;  4BRL A;  3ATV A;  4M3Y A;  4BRG A;  3E9L A;  4CJ4 A;  1XMQ K;  2HHX A;  3KIO A;  1ATR A;  1KAX A;  1YT3 A;  1OH5 A;  1RNH A;  2G8F A;  3WUH A;  1CXQ A;  1HYZ A;  3KKR A;  1EET A;  4DV6 K;  1WSJ A;  2ZJQ L;  1TKD A;  1XHX A;  2VG7 A;  1K9M O;  5KPT A;  3U3Y A;  3DYA A;  1B92 A;  5SWM A;  1IBL K;  5LY3 A;  1DGK N;  1TUU A;  2B6A A;  3WNH A;  3ULD A;  3AO5 A;  3MK6 A;  4KB0 A;  3ISN C;  4KRE A;  1NMD A;  2QXF A;  2VGM A;  2DTU A;  2YHB A;  3PV8 A;  4I9L A;  3CQX A;  1RDW X;  3J7Y P;  4BR5 A;  3OYD A;  3CER A;  5HRR A;  4JLH A;  5KGX A;  3QES A;  4MLE A;  2YJE A;  4KBO A;  5KI6 A;  2OZM A;  5M1N A;  3KK2 A;  4GMJ B;  1VK0 A;  5AZJ A;  4FCY A;  3QDK A;  5KQD A;  3U6F A;  4LF5 K;  3U8X A;  3NFA A;  2Q3S A;  5AQK A;  1HUX A;  4DTO A;  1W7A A;  4DU1 A;  3VA3 A;  3GE1 A;  5C42 A;  2QEX N;  4XH5 A;  4YY3 K;  3E9O A;  4JHD B;  1VQO N;  2A41 A;  4XIU A;  2W42 A;  3K59 A;  1C1C A;  1RBU A;  4IDH A;  5EX5 A;  1EWQ A;  2HVH A;  3M6G A;  3OYA A;  2IOC A;  2A3Z A;  2XY5 A;  3J8A A;  5FPD A;  4KHN A;  1HPM A;  3QFP A;  3RMD A;  3SQ0 A;  3A5O C;  2KFZ A;  1B9D A;  2HNZ A;  2F7T A;  4BRO A;  2Q36 A;  4I2P A;  5FLX O;  4CVN E;  5ELZ A;  5F1X A;  3QEX A;  2FBX A;  3RR8 A;  3OS2 A;  2NRZ A;  3SPZ A;  1BG3 A;  4KH4 A;  5LL6 Z;  3EZ5 A;  3KK3 A;  4KTW A;  2P9U B;  3VES A;  4FJX A;  5GIP A;  4KO0 A;  1YTA A;  3CCQ N;  1VRU A;  3MDQ A;  4JRP A;  3UKR B;  1RT4 A;  4DWI A;  1HJR A;  3OA9 A;  2ZF5 O;  5BRF A;  1WB9 A;  3NE6 A;  4GV3 A;  2IVO A;  2KZM A;  2FSN A;  3TAE A;  3K5M A;  1EXQ A;  4O0I A;  1HYS A;  2NUB A;  3TU5 A;  3M3Z A;  3THW B;  1Y97 A;  3VTH A;  1CZA N;  4FZX C;  1RTI A;  4JRQ A;  1UWB A;  4JKA A;  4GY2 B;  1NOY A;  2OTJ N;  1Q9X A;  2P9P B;  3C6U A;  4JYA K;  3VQ8 A;  4CF8 A;  4DSJ A;  4FWN A;  3NGZ A;  2QK9 A;  4FWS A;  4WE1 A;  1BOT O;  4DSL A;  4KHY A;  3QEP A;  1K6Y A;  4K8X A;  3HOS A;  4KTQ A;  1RGI A;  3B8A X;  1QQO A;  1X3N A;  4B1Y B;  4J2B A;  1IBK K;  3AVB A;  3PSI A;  4FLT A;  2E5L K;  2W40 A;  1I39 A;  2KHO A;  5J1E A;  5AJ3 K;  3T1Y K;  1JCG A;  1VQK N;  4H0P A;  1WSE A;  2UUB K;  1X3M A;  3PIP L;  3W3D A;  3V9X A;  3EY1 A;  2O8B B;  5BR9 A;  4YOY A;  3K9J A;  3SQ4 A;  1RBV A;  4FM0 A;  2IS3 A;  4CHN A;  1A5V A;  3WNF A;  3QIP A;  4CHZ A;  4PL8 A;  5AQI A;  4IOA L;  1KVB A;  4DFP A;  1T8E A;  4C8K A;  5FPM A;  1EO1 A;  1IKW A; 
#chains in the Genus database with same CATH homology
 4JD2 B;  3VTI A;  2CH5 A;  3EN9 A;  4BR2 A;  1VQM N;  4EAH D;  3SAG A;  2QI2 A;  3E9P A;  3LM2 A;  1YHQ N;  4CD1 A;  4IO8 A;  5DM7 L;  2QWM A;  1V4T A;  5GAG P;  1VQ5 N;  3HRG A;  1MWM A;  4WF9 L;  2E2P A;  2P9N B;  1KXP A;  3KK7 A;  5AQW A;  1NGB A;  3ENB A;  3D2E A;  3VF4 A;  4BRI A;  4BGB A;  1WOQ A;  3SJH A;  2CH6 A;  3CC4 N;  2QWO A;  2NRT A;  1VQL N;  2YX6 A;  4CBU A;  2HBJ A;  4CI6 A;  4FWL A;  2GWK A;  4AM6 A;  4BRC A;  5C2D A;  4B1X B;  3O9Q A;  1BU6 O;  4WQ4 A;  4CBW A;  4FWQ A;  4U67 L;  1OKJ A;  3JXU A;  4FL9 A;  2FXU A;  1VAZ A;  2OTL N;  2H3G X;  5AFU A;  5LJW A;  3D2F A;  2NRV A;  4PKI A;  3H1V X;  2WBN A;  3ENO A;  5AQQ A;  1U2V B;  3LM9 A;  1ESV A;  1O13 A;  4GV6 A;  2QWN A;  3HBT A;  4CZJ A;  1KC8 O;  4FPB A;  1ILY A;  4FWK A;  4B1Z A;  3WT0 A;  4YDU C;  3KWG A;  2I7N A;  5AQT A;  2WUS A;  3WEE A;  2QM1 A;  3BF1 A;  3CCV N;  1H1V A;  4JN4 A;  1MWK A;  2EWS A;  3WXI A;  4BVP A;  1KQS M;  4JD2 A;  4OO1 J;  1IG8 A;  5GAD P;  1DEJ A;  2WC9 A;  4JAX A;  4H0X B;  1HX1 A;  3R3L A;  3JS6 A;  3TSU A;  4EHT A;  2VCP A;  4LC9 B;  1BDG A;  1BO5 O;  2NRR A;  4U7B A;  2YHW A;  2QWL A;  3M1F A;  1M1K O;  4BRN A;  2YHY A;  3VEN A;  2E88 A;  1NBW A;  2P9N A;  2P9K A;  3FZH A;  4BRD A;  1W97 L;  3T69 A;  3PLA A;  4H03 B;  3DAW A;  4NB4 A;  1NGJ A;  5AQU A;  4H0V B;  4M7Y A;  5CHI A;  2NZT A;  3I56 N;  1SQK A;  4K43 A;  4BRE A;  3VEX A;  3Q7B A;  4BR9 A;  3CCJ N;  4YOX A;  1S72 N;  3SK3 A;  1J6Z A;  1K8K B;  4BQL A;  3VET A;  5BPM A;  3L6Q A;  1S3X A;  2QTD A;  4QS7 A;  3ZX0 A;  3FGU A;  2QW9 A;  5EVZ A;  1GLF O;  1U2V A;  2Q0U A;  1Q18 A;  5E84 A;  4JK8 A;  4B1V A;  1Q82 O;  1VQ6 N;  4MDB A;  3WXL A;  1RDU A;  1XUP O;  3VMF B;  4BG8 A;  1KAZ A;  3LDL A;  4NO7 A;  4BY9 C;  4JEP A;  1JCE A;  1MDU B;  3A8Y A;  3QIC A;  3O5B A;  3MN5 A;  4NLB A;  3U4L A;  3AGR A;  1JCF A;  4BRK A;  5C15 A;  1HKB A;  4EIA A;  4IJN A;  4A2A A;  4FPA A;  3SAH A;  3CMA N;  3U9Z A;  2F9T A;  5KQ8 A;  5TKY A;  1VQ4 N;  4IO9 L;  3CJ9 A;  5C2F A;  2V7Y A;  2VGN A;  1T6C A;  1S22 A;  2YHX A;  1YVN A;  3IFR A;  4XH1 A;  4BRQ A;  4K25 A;  3VGK A;  1QHA A;  3H3O B;  1HLU A;  4BVO A;  5C10 A;  2FF3 B;  4ISF A;  4WQ5 C;  3TTD A;  3WXM B;  3AY9 A;  3D7E O;  5AQG A;  1T6D A;  3D2E B;  2HF4 A;  3CI5 A;  3P39 A;  5JVH L;  4FOE A;  1LCU A;  2E2N A;  3KZB A;  3SBT A;  5JLF A;  1NWK A;  5JIC A;  3FZF A;  1TYQ A;  1C0G A;  1DT9 A;  1K8K A;  1YF5 L;  2DPN A;  2HBL A;  4O5F A;  5AQY A;  4YOT A;  1HJO A;  2AA4 A;  2V7Z A;  4IXC A;  3D2F B;  3KWI A;  4CZG A;  3ZEU A;  4A61 A;  1JJ2 M;  1YJN N;  4JKG B;  3K9K A;  2OAN A;  4BR4 A;  3RSE A;  2F9W A;  4B9Q A;  4BRF A;  3GBT A;  4BQZ A;  2ASO A;  3EZW A;  5AQM A;  4YOR A;  3O08 A;  2ZJR L;  2JWL A;  3N4Q A;  2ZGZ A;  2W41 A;  3WEE B;  4WQ5 A;  4BC2 A;  2P9S A;  4UY8 O;  3ZX2 A;  1M90 O;  3C6H A;  3E66 A;  1G99 A;  3KVG A;  5AFU H;  5BRH A;  3CJ1 A;  5HL7 L;  4QS8 A;  1VQ7 N;  2E1Z A;  4A62 A;  1XC3 A;  3CCM N;  3EO3 A;  4JKE A;  2GWJ A;  4IEE A;  5TKW A;  1WUA A;  3LDP A;  1KD1 O;  3R8E A;  5EXW A;  3C65 A;  4BC3 A;  3CJA A;  3UB5 A;  4CZE A;  4K42 A;  5KPZ A;  5JVG L;  3CIP A;  4EHU A;  2CGL A;  3CCR N;  1Q81 O;  2P9L A;  4HWI A;  3MCP A;  5JLH A;  3RVC A;  1P90 A;  5AR0 A;  3AAP A;  1NGC A;  2Q0R A;  3WXJ A;  3VEZ A;  3PIO L;  2P9K B;  4E1J A;  2QWP A;  4MO5 A;  3BP8 A;  2ITM A;  5BN9 A;  4DKW A;  1HKG A;  2A5X A;  3FLC O;  3IMX A;  1GLC G;  4Y0W A;  4EFH A;  2ZWH A;  3TTC A;  4CD3 A;  3L4I A;  4BRP A;  3FZL A;  3H6E A;  4BRM A;  1YAG A;  4IEI A;  4JKD A;  3SAF A;  4DQ8 A;  2D1K A;  5F2R A;  4WFB L;  4YOW A;  2CGJ A;  5FPE A;  3DWL A;  4H5R A;  3SMP A;  2I7P A;  2ZJP L;  3HZ6 A;  1X9J A;  2J4R A;  2D4W A;  2QA4 N;  3GOI A;  4JKH A;  5AQL A;  3U9D A;  3UKU A;  2BTF A;  1GLL O;  1Z6R A;  2IVN A;  3CC7 N;  2E2Q A;  1U6Z A;  1NGA A;  5I9E B;  1KAY A;  4JKG A;  3CC2 N;  3TSQ A;  3I8B A;  4ILH A;  4A57 A;  2Q2R A;  3BUZ B;  2P9I A;  2HOE A;  3C0B A;  3ENH A;  1NJI O;  4CZF A;  1SAZ A;  2FF6 A;  3O1B A;  4CZH A;  4FVU A;  2GEM A;  3LDO A;  4MO4 A;  2ZGY A;  2NLX A;  2PAV A;  5EOY A;  3VEW A;  2PFU A;  3WQU A;  4K41 A;  1NGH A;  4FSV A;  4OPH A;  2V51 B;  4YOU A;  3ATU A;  5DM6 L;  2VWB A;  4CZI A;  4DCH A;  3ID6 A;  4BR7 A;  4H5W A;  5BRD A;  5B8H A;  1N8R O;  3HM8 A;  1Y64 A;  5FPN A;  3G25 A;  4PHT X;  4YOV A;  3G6E N;  3H46 O;  3HI0 A;  5AQS A;  1T3V A;  3F9M A;  4BR0 A;  4YDU A;  3CET A;  4I6M A;  2IIR A;  3FZK A;  3FZM A;  4DHY A;  5HOO A;  2E20 A;  3ID8 A;  1ATN A;  4JK7 A;  1TYQ B;  2VYP A;  4IWV A;  1K73 O;  3DXK A;  2ASM A;  4CZM A;  2NRH A;  1XQS C;  1VQP N;  1NGD A;  1EQY A;  3IDH A;  3ZEU B;  1ATS A;  5AQJ A;  4ISG A;  3R9P A;  4PL7 A;  3H1Q A;  3R1X A;  3RSE B;  3VEV A;  1HKC A;  3NMU A;  4J8F A;  4B1U B;  3EE8 A;  4C23 A;  3A5M C;  4FO0 A;  2E8A A;  4FWP A;  3FE1 A;  3MCA B;  4IOX A;  1YUW A;  4DB3 A;  5GIN A;  2P9S B;  5AQV A;  1QVF M;  2Q97 A;  3O9T A;  4HTL A;  3CHW A;  3CCS N;  5ADX A;  4PKH A;  2HF3 A;  3C7N A;  4JNE A;  3FR0 A;  3MWP A;  1BA1 A;  1BWF O;  1QQM A;  2NRX A;  3GL1 A;  3QFU A;  4XH4 A;  1Q86 O;  2GEL A;  3ZYY X;  1R59 O;  2GTD A;  4ISE A;  2QXL A;  2HBM A;  3Q7C A;  3SBG A;  3P4I A;  3OW2 M;  2P9L B;  5AQO A;  4IOC L;  2AP1 A;  3P38 A;  3T7Z A;  3MN9 A;  3TPQ A;  3ULE A;  4H5N A;  3VOV A;  4IFE A;  3MX5 A;  3O9S A;  3AGK A;  3MN7 A;  1YIT N;  2JWK A;  1NGE A;  3BF3 A;  3FFK B;  4M63 C;  3I33 A;  3VER A;  4BRL A;  3GDQ A;  3O9U A;  3ATV A;  3NVM A;  4KH5 A;  4BRG A;  3E9L A;  1YJW N;  3O6W A;  5GAH P;  5M1P A;  3G71 N;  1NLV A;  4NLC A;  3EKS A;  1GLA G;  3UKU B;  3H3N O;  4B1W B;  1ZXO A;  5AZJ B;  4ILJ A;  2P9U A;  1NM1 A;  1ATR A;  1NGI A;  1QZ5 A;  4H5T A;  1KAX A;  3C6A A;  4O8K A;  3VEO A;  1BA0 A;  3WUH A;  5H1S Q;  1VQN N;  2BUP A;  4RCH A;  2P9I B;  2HMP A;  4AF1 A;  1V4S A;  3UKR A;  3DJC A;  5M1F A;  5M1Q A;  3CXC M;  1GLJ O;  3CCE N;  5M1K A;  2ZJQ L;  1NGF A;  2PBD A;  3P31 A;  1K9M O;  3VEY A;  5KPT A;  2YJF A;  4CJ7 A;  1SZ2 A;  3D6R A;  3LDN A;  1ZBS A;  3VF6 A;  3IKM A;  2FSJ A;  3WQT A;  4BC5 A;  2A6A A;  5GAE P;  2FSK A;  4FOI A;  3S41 A;  5LY3 A;  4F9O A;  1DGK N;  1TUU A;  4MLH A;  3J7Z O;  2E1Y A;  5AQZ A;  5M1O A;  5LJV A;  2QWQ A;  1QVG M;  4C1N I;  4BRA A;  5AQR A;  3MK6 A;  5BPL A;  3AAQ A;  1VQ9 N;  4L3Q A;  3ZET A;  1NMD A;  3QBX A;  3ZX3 A;  2VGM A;  1DKG D;  1Z05 A;  3OBY A;  5KPR A;  4I6M B;  2P9P A;  3CQX A;  4CBX A;  1RDW X;  4BR5 A;  5AQH A;  3MWT A;  3CER A;  1MA9 B;  4H0T B;  4BG9 A;  4MLE A;  2YJE A;  3DXM B;  4KBO A;  3QML A;  5M1N A;  3DXK B;  3OBW A;  1BUP A;  5E26 A;  2Q1N A;  5AZJ A;  5CR4 A;  5CE3 A;  4BC4 A;  2E2O A;  3QDK A;  5KQD A;  1GLB G;  1K8A O;  3DLL L;  4CZK A;  3F2K A;  3EE9 A;  3R6M A;  1OVY A;  3U8X A;  2RHK A;  5AQK A;  5AQP A;  3VGL A;  3OHR A;  1HUX A;  3CPE A;  2D0O A;  4FWR A;  4IZ9 A;  2NNW A;  3GE1 A;  4AM7 A;  4QS9 A;  3EL2 A;  1ZC6 A;  3C7N B;  2QEX N;  4GNI A;  4XH5 A;  5AQN A;  3E9O A;  1LOT B;  4JHD B;  3CPW M;  2QWR A;  1YI2 N;  5MLC Q;  1VQO N;  2A41 A;  5BRE A;  1D4X A;  4IDH A;  5EX5 A;  3M6G A;  1E4F T;  3VPZ A;  2A3Z A;  3ULE B;  5ADX H;  3A0I X;  3J8A A;  5FPD A;  3HTV A;  3NVK A;  2D0P A;  1HPM A;  2KLA A;  2A42 A;  2NRW A;  3QFP A;  4FWM A;  3G4S N;  3EKU A;  1VQ8 N;  1C0F A;  3A5O C;  4BGA A;  2F7T A;  4BRO A;  1TUY A;  1YXQ A;  2Q36 A;  3CD6 N;  3TSP A;  5AZI B;  3DXM A;  3N4P A;  3UE5 A;  4WFN L;  5ELZ A;  3H45 C;  5F1X A;  1QQN A;  4A5B A;  2NRZ A;  5EY4 A;  3QB0 A;  3F5T A;  3AAR A;  1BG3 A;  4KH4 A;  3HOT A;  3MX2 A;  4A5A A;  3O4W A;  2P9U B;  4MDA A;  2HBK A;  2YCH A;  4PKG A;  3VES A;  4JKC A;  3SMS A;  3WXK A;  5F0X A;  3IUC A;  3W0L A;  5GIP A;  4CZL A;  4GV9 A;  4A59 A;  3CCQ N;  5GIO A;  3MDQ A;  3UKR B;  4C1N K;  5C0Y A;  3GG4 A;  2FLO A;  2GX9 A;  4WYB A;  3OA9 A;  2ZF5 O;  5BRF A;  1W2B M;  4A2B A;  1YJ9 N;  3CCL N;  4GV3 A;  2IVO A;  1P8Z A;  2A40 A;  2FSN A;  1SS6 A;  2CGK A;  4M7X A;  3A5L C;  3BEX A;  4JHD A;  5C12 A;  3O8M A;  2IVP A;  4GVE A;  3TU5 A;  3M3Z A;  2Q31 A;  1YIJ N;  4R79 A;  3VTH A;  1CZA N;  3CJC A;  1GLD G;  3M5R A;  3MMV A;  4O8U A;  4JKA A;  3ZET B;  3VF2 A;  4GY2 B;  2YI1 A;  4H0Y B;  2RE2 A;  2OTJ N;  3E1Y A;  5AQX A;  2P9P B;  4XEI A;  4JKF A;  4RWT A;  1Q7Y O;  3QBW A;  4H0O A;  5AZI A;  3TTF A;  4FWN A;  4H5V A;  4OPA A;  3VGM A;  4WFA L;  4FWS A;  4RTF D;  1BOT O;  3O9R A;  4G9Z A;  2KKZ A;  3O1W A;  1RFQ A;  2V52 B;  4JK9 A;  3CCU N;  3HOS A;  1QZ6 A;  1RGI A;  3MN6 A;  3KHY A;  3B8A X;  4IJA A;  1QQO A;  3I55 N;  1X3N A;  3CJB A;  5BPN A;  5BN8 A;  3LDQ A;  4B1Y B;  2UYT A;  3CQY A;  4ILG B;  3CJ7 A;  4JKB A;  1T44 A;  2W40 A;  2KHO A;  3L0Q A;  4Z94 A;  1JCG A;  1VQK N;  4H0P A;  3SLC A;  4BRH A;  3CME N;  5AQF A;  1X3M A;  3PIP L;  1GLE G;  3W3D A;  5JMV A;  3HSC A;  5BR9 A;  4YOY A;  3K9J A;  3LL3 A;  4FWO A;  2WFB A;  2BH1 A;  2HST A;  1E4G T;  2GUP A;  3CF5 L;  4PL8 A;  1IJJ A;  4KH6 A;  5AQI A;  3O80 A;  4WCE L;  4IOA L;  1NGG A;  5FPM A;  3L4Q A;  1EO1 A;  2ASP A;  4WQ4 C;  3A5N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...