4E1MA

Crystal structure of hiv-1 integrase with a non-catayltic site inhibitor
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
152
structure length
146
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSATVKAAWWAGIKQEFGIPNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Integrase
publication title New Class of HIV-1 Integrase (IN) Inhibitors with a Dual Mode of Action.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 48
structure length 146
sequence length 152
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e1mA00
2OPPA 1VSKA 4LSLA 1T03A 2PY5A 4IKFA 1BI4A 4LH5A 4OJRA 3ZT4A 4E1MA 3NH0A 4CGIA 4FJMA 2BANA 4E7LA 2OA8A 1HPZA 4QCLA 1BIZA 2B5JA 3SJJA 1FK9A 3D45A 1REVA 4FLUA 4KHQA 4CJSA 4CGDA 1R0AA 1C6VA 4E7KA 3L2VA 4R5PA 1RDDA 2HB5A 4CEEA 4FM0A 1CZ9A 2ITGA 4CF8A 3HVRA 1Q8IA 4B9UA 4FZYA 4KHWA 3AVFA 2G8IA 5HP1A 1LWCA 2PYJA 3ZT3A 1HQEA 1HNIA 1B9DA 3OYIA 1XI1A 3IG1A 2YKNA 4FVMA 1NOYA 2HVHA 5CYQA 4NYFA 4QAGA 4E7HA 3RRHA 3EYZA 4BE2A 1HYZA 1TKTA 5E41A 3K5LA 1L5UA 1HYSA 1SKSA 1IG9A 4KTZA 4CIEA 2WOMA 3QNOA 1NKEA 3HK2A 1VSJA 3DYAA 4RG8A 3NAEA 1FKOA 1XWLA 4UQGA 3KLGA 3KD1E 3PO4A 4KPYA 4O55A 1D9DA 5J2MA 3RRGA 1VSIA 5JS1A 4DQQA 4KAZA 1RTIA 1IKVA 4F4KA 4KHYA 2XY6A 3SUPA 5C25A 4C8NA 3SQ1A 3K57A 3L3UA 4DFPA 5HLFA 1RTHA 3MXJA 4CJKA 4HCBA 4NCAA 1A5XA 4IDKA 3QLHA 4CHOA 3HPOA 4HUGA 3OJUA 1NJZA 2RKIA 4DSKA 1S6QA 3SUQA 4DSFA 1NJYA 1ZBUA 3AA2A 4Q5VA 1X9MA 4KV8A 3OYFA 1SL2A 1BISA 3G0ZA 4CEAA 4E1NA 3NH2A 2Z1JA 4C8KA 1Z25A 4I9QA 3LAMA 2HNYA 3OYHA 3CG7A 2XRIA 2ZQBA 4CJQA 1D5AA 2ATQA 1C0MA 1QSLA 5SWMA 4AHRA 1SL0A 3QEXA 1U4BA 1U47A 4FLVA 4N5SA 1VSMA 1ITGA 1X9SA 2IGIA 3SQ2A 3OVNA 4FXDA 3AVHA 4IG0A 5EU7A 1WSJA 2OPRA 3VQ5A 2RPIA 3KJVA 4JS4A 4RW9A 2OZMA 4Q0BA 3AO2A 1CXUA 1U48A 3QEIA 4Z4CA 4Z4HA 1I3AA 4FJGA 2G8KA 1XHXA 2DY4A 3KK3A 4HHTA 1UA1A 2D0BA 4LSNA 5DK5A 3HO1A 2O4GA 2KZMA 4CESA 2VG7A 5J2NA 4Z4IA 3QO9A 1NOZA 3HM9A 4ELVA 2OPQA 3OYEA 1NJWA 2G8UA 3OYNA 4KI4A 1F21A 1RTDA 2JLEA 3QINA 4PWDA 4AH9A 3ZSYA 4W5RA 4AHVA 5I42A 1IKWA 4O4GA 3VA0A 4FK4A 1WN7A 1IKXA 3O4QA 4DTOA 3HPGA 2HHTA 5SZTA 2X6SA 1WSFA 1WNSA 5HRSA 5HBMA 2D5RA 4HCCA 3HL8A 4DU1A 2GBZA 3AVGA 3VQAA 3OYJA 2XO7A 5CY4A 4M3XA 1W0HA 3MEDA 4RW4A 3DLEA 4AHTA 1KFSA 4GW6A 2NUBA 1RT7A 2D0CA 5HRRA 3ZSOA 3OYMA 4DSJA 3AVCA 3SV4A 4DQSA 4FM2A 1SKRA 1JLEA 1B92A 4BE1A 3AVIA 3NFAA 3NCIA 2PYLA 4K8XA 5KTQA 4DSLA 4KO0A 4PA1A 4DQRA 2XY7A 1HRHA 1TL3A 3LP0A 4EZ6A 1WAFA 3F9KA 4ZTFA 1NK7A 3OY9A 3T3FA 5J2PA 1BCMA 4DU3A 4CIGA 4C8OA 4DQIA 4L8RB 1N5YA 4B9VA 1D8YA 4K8ZA 1T05A 1YVUA 1IH7A 4KFBA 3NGIA 4CFCA 3RTVA 2HMIA 4CFDA 3SPZA 5FRNA 4CHNA 5KRTA 3OYCA 3PX0A 1FKPA 4OPKA 4LD0A 2R7YA 4BWMA 4I7FA 1LAVA 3VQEA 1RT1A 1VSFA 3IAYA 4FZXC 2HHXA 2DFEA 1RT2A 3VQPA 3S3NA 2F96A 2ETJA 4RW6A 1ASVA 3U3YA 3DM2A 4N47A 4CF1A 3KIOA 4CHYA 2HHUA 4CJLA 1A5WA 1UAXA 1GOBA 3O3FA 3VQQA 5HRNA 2HW3A 4BDYA 5KGWA 3KK2A 3MXMA 4KI6A 2F8TA 1TGOA 3HYFA 3KKSA 3U6FA 4CEQA 2EX3A 2Q3SA 1KSPA 4MQ3A 4DLEA 4FJ9A 1SUQA 1GOCA 4M3RA 3CM6A 3OJSA 3PV8A 3LANA 5J1EA 3LWMA 3HXMA 4CCHA 5CZ1A 4KB0A 4DS4A 4FLTA 4CIFA 1TK8A 1TKZA 1C1BA 3LP3A 1BGXT 3LZJA 3NGZA 1TKDA 3DLHA 4C8LA 3K2PA 1KVBA 4PUOA 1TV6A 2O4IA 4O44A 4N56A 3NDKA 4CE9A 4DFKA 3TAQA 4H8KA 3OS1A 4W5QA 4KHNA 3SCXA 1D9FA 4XIUA 1S9EA 1WLJA 2IS3A 3OS2A 2FBXA 3F73A 4ID1A 4CEBA 4I2PA 4CJPA 3OYAA 1TL1A 3CFPA 3IRXA 4Z4GA 3CM5A 1TKXA 4AHCA 3AV9A 3CFOA 3SNNA 2RF2A 3H08A 2GUIA 4CECA 3OS0A 3ZCMA 2W42A 3CFRA 4DTNA 3QERA 2QKKA 2HHWA 1WSHA 3HT3A 4G1QA 3CQ8A 3VQ7A 1L3VA 1RDAA 3O4NA 3ALYA 1U45A 3AVAA 3WNEA 4DFMA 4FJNA 3QEWA 4DMNA 3VA3A 4FJLA 1N6QA 3OYKA 3E01A 3M8RA 3AA5X 4RW7A 3AVLA 4KKOA 2VG5A 4IFYA 4WE1A 1ZYQA 2KTQA 5I3UA 3O3HA 1KVCA 3T1AA 1DTTA 4BDZA 4DTRA 1VSLA 1ASUA 2KZZA 2IAJA 1YT3A 1RBTA 1VSDA 4OKKA 3QNNA 4DTUA 4M42A 3TI0A 4OGCA 1NK4A 4MFBA 3PX6A 2FBYA 3AO4A 3I0SA 1B9FA 3AO5A 4CK3A 1KRPA 4M3UA 2F8SA 5K14A 3OYBA 3P83D 3ZSWA 4E19A 1SL1A 1RBUA 3RR7A 2BGGA 1S1UA 3M8PA 3TAEA 4FYDA 1CLQA 3TAPA 4KTQA 3KLFA 3BDPA 4Y1DA 2HHVA 4IG3A 4FJJA 1MU2A 2HNZA 4O0JA 3OYLA 3KLIA 3P1GA 2KW4A 1WSGA 4ID5A 5C24A 3TARA 4F2SA 1JXEA 3HJFA 1CZBA 4ZTJA 3KK1A 1NK0A 4FLZA 4CF9A 3AO1A 3RR8A 3THVA 4CERA 3EZ5A 1JKHA 1JXBA 3RMAA 1DLOA 3FFIA 3RMBA 4F3TA 3QIPA 4ZHRA 5KRSA 2X6NA 4N41A 3AVMA 4GVMA 3LZIA 1QS4A 3DLKA 1QQCA 2Y1JA 4KHSA 1JL2A 4M3YA 1C0UA 1RBVA 2FBTA 3T19A 1RDBA 1J9AA 4O0IA 3K5MA 2AJQA 4NYNA 1J54A 4ICLA 4CJTA 2YNFA 3S9HA 3V1RA 4B9MA 3ULDA 1KLMA 3VQCA 3AA3A 4FK0A 1T7PA 1DTQA 1RNHA 2E6LA 3ZT2A 1LW0A 3DRPA 3TWHA 3V9ZA 5KGXA 4CGGA 2YKMA 4CGJA 4CHQA 1KFDA 4GMJB 4Z4FA 4C8MA 3DLGA 4FM1A 4M3WA 1ZBIA 3LWLA 4OLBA 2QKBA 4PQUA 4W5NA 1RT5A 4FLYA 5HRPA 1Z26A 2DFHA 1HYVA 3B6PA 4HUFA 3PX4A 1S1WA 2QXFA 4NCBA 1Y97A 3RWUA 1UOCA 2P5OA 3NBPA 3MAQA 1Q9XA 3PUFA 3C6UA 5CZ2A 4B9NA 3B6OA 3PY8A 3M8SA 4CEFA 1QHTA 4FZZA 4IFVA 5CYMA 1SV5A 1S1XA 2E6MA 3DRSA 5KI6A 3QIOA 3LDSA 4Z0UA 3ISNC 4HVJA 4CJUA 1LV5A 1G15A 3VQ4A 2P51A 4DTXA 3QESA 2EHGA 3WNGA 1S5JA 4EP5A 3I0RA 4OVLA 3V6DA 5T7BA 4CFBA 3KKRA 3ZSXA 3V9XA 4B9TA 1BL3A 1NK5A 1J53A 2DFFA 4CHPA 3NH1A 1RT4A 1FXXA 3AA4A 1BIUA 2FBVA 3DOLA 3MECA 3G10A 3NHGA 4FLWA 3SQ0A 4KB1A 1VSHA 3K59A 3SI6A 1RBRA 3C95A 3ZSVA 4DSIA 2IOCA 3NE6A 3V1OA 3K58A 3ZT0A 2Z1GA 5JS2A 4CJ5A 4CF0A 4LH4A 1K6YA 3VN5A 4JS5A 4ELTA 2HHQA 2I5JA 3CYMA 3HP9A 3SZ2A 1QSSA 3V1QA 4DTSA 3RMDA 2E4LA 4KHUA 1VRUA 1TAQA 3V9SA 4J2EA 4DLGA 5J2QA 1VK0A 1BQNA 2HNDA 3AVNA 1RDCA 5FROA 3BGRA 2YNHA 1EP4A 1HJRA 3LPTA 3OYGA 1I39A 4DG1A 1KCFA 3HPHA 4CGHA 1UA0A 2YV0X 1NK9A 1HQUA 3VQDA 3V9WA 4BWJA 2LSNA 3ASMA 3MEGA 3KTQA 4DWIA 1IKYA 3K5OA 2X74A 4HUEA 2Z1IA 2KFNA 1WSIA 4CK2A 1QE1A 3JYTA 4FJXA 4OKEA 3NF6A 2JGUA 4B8CA 4Y1CA 1LWEA 3AO3A 3SUOA 1WSEA 4CJ4A 1RT6A 3ZSQA 4H4OA 3WNFA 1RILA 4I9LA 2YHAA 3DOKA 4DFJA 2XY5A 1ZBLA 3V81A 3U3GA 4DTPA 1LAWA 4OGEA 4DF4A 4F3OA 4E0DA 3EY1A 4AILC 1BI4B 1RTJA 1JLGA 1RBSA 2D0AA 4CJ3A 3SQ4A 1S1TA 4QOZB 4H4MA 1QSYA 4M3ZA 2A1SA 2G8WA 3LP1A 1VSEA 3TAFA 1NKCA 1EETA 4W5TA 3S3OA 4DTJA 3IS9A 4EP4A 1JLCA 3SPYA 1Q9YA 1NK6A 3TR8A 2IDOA 4KREA 4KRFA 5D3GA 3VQBA 1U04A 4B08A 3WNHA 2QK9A 4OLAA 5FDLA 3NGYA 1XC9A 4CFAA 2OZSA 3QETA 2WONA 3O3GA 4O5BA 1W9HA 1RT3A 4J2DA 2G8FA 4LY7A 3AVBA 4CJVA 1JLQA 1TK0A 3L2UA 1ZBFA 1NJXA 1EX4A 2FC0A 4FCYA 2ZE2A 5HROA 4E7IA 1EXQA 1XHZA 2B6AA 4N76A 4E7JA 4I2QA 4CGFA 3LALA 2XHBA 3A2FA 3V9UA 4CJEA 4M45A 4F2RA 3ZSZA 3VQ9A 2Z1HA 2P5GA 3TAGA 2BDPA 1TVRA 3NF8A 1NKBA 4B9SA 3VQ6A 1HNVA 4CJFA 3DI6A 3D0PA 1L3UA 4J2AA 2VWJA 3SUNA 4M41A 1IO2A 3I8DA 4CF2A 1NK8A 3L2RA 1C1CA 4Z4EA 4M3TA 3ZT1A 3TANA 2B4JA 1LW2A 2HHSA 3ZSRA 2KQ2A 1VRTA 2IC3A 1BHLA 1S6PA 3AVKA 5DMRA 4CEOA 4IBNA 1S9GA 1YTAA 3K5NA 4NCGA 1KVAA 1HMVA 1TK5A 3S3MA 4CEDA 4E3SA 4KTWA 1T8EA 4PY5A 2HVIA 3HP6A 4BDPA 2PZSA 4BACA 3KD5E 4AHUA 3L2WA 2DTUA 2OPSA 3L3VA 3NF7A 3C94A 1RCHA 1QTMA 2YNGA 4F8RA 1BQMA 2KFZA 4FJ8A 1LWFA 3AVJA 2RN2A 4JLHA 3TAMA 4CJRA 2XY8A 4YNQA 3M8QA 3L2QA 4FJ5A 4B9LA 4FJ7A 5C42A 2Y1IA 3RMCA 1KTQA 3MXIA 4FW2A 4BE0A 3P5JA 1U49A 3LPUA 4EZ9A 4FW1A 4TSXA 1SKWA 3HSTB 2GV9A 1WAJA 4DTMA 3L8BA 3KLEA 2ZD1A 3DLRA 4E89A 2OYQA 4DU4A 3QEPA 5FRMA 3VQ8A 4CEZA 1A5VA 4W5OA 4B3OA 3DLBA 3QEVA 4YFUA 4B8AB 4DF8A 4JRPA 2G8VA 4FJKA 2X78A 3JSMA 1L3SA 4FJHA 2G8HA 1YTUA 1JLBA 3DRRA 3LP2A 4HTUA 3SYZA 2YNIA 1CXQA 4CHZA 3PO5A 1ASWA 4FJIA 1UWBA 1EKEA 1JL1A 2P1JA 2A1RA 1TAUA 3LAKA 1BCOA 3MEEA 1S1VA 2VWKA 3DMJA 4DSEA 3NF9A 4AHSA 1JLAA 3OYDA 1GOAA 3ITHA 1JLFA 4CK1A 4JRQA 1X9WA 4J2BA 3C6TA 1L3TA 3HVTA 1X1PA 4DS5A 3V4IA 4CJWA 1ZBHA 4FLXA 3UIQA 1KLNA 4OPJA 4ELUA 1C1AA 2VG6A 4RW8A 2BE2A 3SV3A 2YHBA 4FK2A 4DQPA 1C0TA 3TABA 3KLHA 4OKJA 1O1WA 1J5OA
chains in the Genus database with same CATH superfamily
2OPPA 4LSLA 2Q0UA 3CD6N 4CGIA 4KBOA 1FK9A 4FLUA 1R0AA 3GL1A 4R5PA 1QVGM 1RDDA 4BQLA 4CF8A 2IVOA 3D2EB 3HVRA 4B9UA 4ILHA 3AVFA 2PYJA 1B9DA 4JKFA 1XI1A 3BP8A 2GWKA 2YKNA 2WFBA 4FVMA 4EFHA 1NOYA 4E7HA 4BGAA 3UKRB 1IV0A 1U2VA 3A5NC 4BRAA 4BVPA 4BE2A 1HYZA 1TKTA 1HYSA 3CIPA 1IG9A 3ULEB 5LMUK 1NKEA 1NGHA 2V51B 3NAEA 3KLGA 2BH1A 5JS1A 4CD1A 4DQQA 1RTIA 4F4KA 3QFPA 5C25A 5CE3A 4JN4A 1KQSM 4DFPA 5HLFA 3T1YK 1QHAA 4CHOA 4HUGA 2RKIA 3L6QA 4DSFA 1NJYA 3LDNA 3AA2A 3QBXA 4JAXA 4KV8A 2Z1JA 1N36K 4CZGA 2A5XA 2HNYA 3IFRA 4JHDB 4CJQA 4BRCA 4JKGA 1QSLA 1U4BA 1X9SA 2CGKA 3SQ2A 2FSJA 3D2FA 3OVNA 1GLJO 3AVHA 4IG0A 1WSJA 4NLCA 4BRKA 5ADXH 3DAWA 1CXUA 3O9RA 1U48A 2D1KA 3QEIA 1RFQA 4FJGA 4A62A 1XHXA 2DY4A 4HHTA 2D0BA 4U67L 2KZMA 2O4GA 2VG7A 1NOZA 1JCGA 3FLCO 1NGDA 2G8UA 3OYNA 4KI4A 1ZBSA 1F21A 4AH9A 2A41A 5IT9O 3HPGA 3P4IA 2X6SA 2QM1A 5EXWA 4DR2K 3EO3A 1KFSA 1RGIA 2ZGZA 3AVIA 3NFAA 5FPMA 1IBLK 1QZ5A 4JK9A 4AF1A 4PKGA 1TL3A 1WAFA 4AM6A 3OY9A 3T3FA 3AAQA 3EE9A 5AQLA 3RVCA 2ZJQL 4DQIA 1N5YA 3H1VX 1EWRA 4CFCA 3SPZA 1V4TA 4UY8O 1FKPA 4FWRA 4LD0A 5AQKA 4I7FA 1X3MA 2VGMA 1BOTO 4YOVA 4FZXC 1RT2A 3VQPA 3O4WA 2F96A 3U9DA 3ZYYX 4GNIA 1VQ6N 3U3YA 4CF1A 1XNQK 4CJLA 1GOBA 4BDYA 4BGBA 4FL9A 2Q0RA 2NRXA 3MXMA 4KI6A 2F8TA 1TGOA 4PKIA 3U6FA 2EX3A 5C12A 2QWRA 4FJ9A 4M3RA 3SK3A 3OJSA 2FLOA 5E84A 4KH5A 4PKHA 4H5WA 4CIFA 1TK8A 1C1BA 3LP3A 1BGXT 1TKDA 3VESA 1KVBA 3I33A 4CE9A 3TAQA 4B9QA 3OS1A 2E88A 3SCXA 4B3RK 4JI5K 2OCEA 1WLJA 2O8DB 2YHYA 4ID1A 3OYAA 4Z4GA 2HBKA 3CFOA 2RF2A 5JLHA 2W42A 3N4PA 3QERA 2QKKA 2HHWA 1WSHA 4QS9A 4JEPA 1L3VA 1HNZK 3QEWA 4DMNA 1N6QA 3ATUA 4B3SK 3AA5X 4RW7A 4BR2A 4IFYA 1ZYQA 3FE1A 3TSUA 2NZTA 2HBMA 2IAJA 4WFAL 1BWFO 3TI0A 4IZ9A 2GEMA 4K0KK 5C15A 1X9JA 2KKZA 1Z05A 3P39A 3RR7A 2BGGA 1EO1A 4JKEA 4KTQA 1QQOA 1XNRK 3KLFA 3EL2A 3EKSA 4X65K 2HNZA 3WXJA 2KW4A 1WSGA 5C24A 3TARA 1NBWA 3HJFA 3KK1A 1NK0A 3BF1A 4FLZA 3D7EO 4DV0K 4NXNK 3ZETB 3KWGA 3RMAA 1Y64A 4N41A 3DLKA 5IWAK 3VOVA 1WUAA 4WQ5A 3IDHA 1RDBA 1J9AA 1VQKN 3ZEUB 4O0IA 3S9HA 3VF6A 3KHYA 4B9MA 3L4IA 1KLMA 3O08A 1K8KB 4AM7A 2NRVA 4PHTX 4PL7A 3TWHA 4QS8A 4CGGA 2YKMA 4CGJA 4Z4FA 1KFDA 2HMPA 4GMJB 5LMNK 3VERA 4C23A 4JKHA 4A2BA 5AQQA 4OLBA 2P9IB 2P9UA 5GIOA 2VQEK 2QXFA 4NCBA 4IOXA 5HL7L 2D0PA 3HI0A 3PUFA 1M1KO 4B1YB 1DKGD 2CH5A 4CEFA 4FZZA 5CYMA 5AQNA 2E6MA 4JNEA 3QIOA 1RDUA 3C7NA 4DQ8A 3H46O 1M90O 1G15A 2P51A 2AA4A 3QESA 4B1VA 3F9MA 3CI5A 4B3TK 3WT0A 3KKRA 1T6CA 2F9TA 1BL3A 3K9JA 3ID8A 3DOLA 2O8CB 2P9KA 4FOEA 1NMNA 1HNWK 3AY9A 2Z1GA 5JS2A 4LH4A 3MWPA 2I5JA 3CYMA 3RMDA 1VRUA 2QW9A 2A6AA 3MN7A 3OBWA 1RDCA 2GUPA 1EP4A 3OYGA 1KCFA 1DGKN 1UA0A 1HQUA 3VQDA 3PIPL 3V9WA 2LSNA 3KTQA 4DWIA 1IKYA 3VTIA 1QE1A 4A5AA 4OKEA 5E26A 2P9PA 3AO3A 3J80O 1WSEA 5GIPA 4BR9A 3A5MC 3V81A 4OGEA 4E0DA 3EY1A 4OPHA 1RTJA 2D0AA 4CJ3A 4H4MA 1QSYA 4M3ZA 2DPNA 2Q31A 1VSEA 1S22A 2YX6A 4W5TA 5C2FA 3M6GA 1JLCA 3SPYA 1Q9YA 1NK6A 4KREA 4KRFA 1IBKK 4NXMK 2QK9A 4OLAA 4CFAA 2WONA 2HF3A 1NLVA 1ZBFA 1FJGK 5AZIA 1Q7YO 3CJ1A 4I6MB 2QXLA 4E7IA 1XHZA 2HF4A 2B6AA 5AQWA 1N8RO 4CGFA 4FWKA 3RSEB 3QBWA 2Z1HA 3CCQN 3FZFA 1EQYA 3TAGA 1ZXOA 1GLFO 1N34K 4CJFA 3DI6A 1L3UA 1NWKA 3SUNA 4CF2A 1NK8A 1C1CA 4Z4EA 3ZT1A 2HHSA 3DXMA 1ESVA 4IBNA 5EY4A 3K5NA 4NCGA 4CBUA 1KVAA 1D4XA 3S3MA 1T8EA 4BDPA 3KD5E 5AQTA 3L2WA 2DTUA 2OPSA 3NF7A 1QTMA 3C94A 4GV6A 5FLXO 4FJ8A 1H1VA 5TKYA 3I56N 4CJRA 4YNQA 3CQYA 3L2QA 3EEQA 4B9LA 4FJ5A 4FJ7A 3MX2A 3J8AA 2YJEA 4EZ9A 4TSXA 4O8UA 3FFKB 2O8BB 1K73O 3FZHA 1WAJA 4DTMA 5FRMA 1W97L 2P9NA 3MDQA 1A5VA 4W5OA 2JWLA 1ZC6A 4RWTA 4B8AB 1LOTB 4FJKA 1L3SA 2G8HA 1JLBA 3SYZA 4HTUA 3PO5A 4FJIA 2A1RA 1LCUA 3MEEA 1NJIO 3LDQA 3NF9A 3ZX0A 4JKDA 4J2BA 1X1PA 3G71N 3V4IA 4CJWA 2GELA 4FLXA 4B1XB 2I7PA 4DR7K 4ELUA 5FPDA 1C1AA 3LM2A 1HNXK 4DQPA 2E8AA 4KHSA 5CR4A 4LH5A 4OJRA 3OA9A 4E1MA 4FJMA 4QCLA 3SJHA 1BIZA 2B5JA 3SJJA 3D45A 2FF6A 1KXPA 3UB5A 4CJSA 4CGDA 2E2QA 1C6VA 4E7KA 2ITGA 2E2OA 5HP1A 2ZJRL 1HQEA 3BZCA 1SZ2A 3OYIA 4DV1K 3VEWA 5CYQA 4CW7B 1C0FA 3M3ZA 4YHHK 1QVFM 4CIEA 3QNOA 4RG8A 4UQGA 1D9DA 3RRGA 1IKVA 3M1FA 3R6MA 3SQ1A 4WFNL 5I9EB 3VF4A 5AQMA 3MXJA 2HHQA 4DV5K 1YI2N 4OPAA 3HPOA 2O8FA 4FWSA 1MDUB 4DCHA 4WYBA 4Q5VA 3OYFA 1BISA 1Z25A 2NNWA 4I9QA 3LAMA 1VQ9N 3CG7A 5AJ3K 4CZKA 2ZQBA 3MN6A 4AHRA 1SL0A 1U47A 4N5SA 1MWMA 3EZWA 2WTUA 5AQOA 3G6EN 5EU7A 2RPIA 2FSKA 3JXUA 4Z4CA 1I3AA 1YIJN 2G8KA 3R3LA 3KK3A 4FWPA 1UA1A 2I7NA 4Z4IA 1YJNN 2WC9A 2E2PA 4ELVA 3OYEA 1T6DA 3K0SA 3MMVA 2V7YA 1SS6A 1I94K 4PWDA 4JK7A 4W5RA 4DB3A 5I42A 1WN7A 4DTOA 3UKUB 2D5RA 2GBZA 3AVGA 1KAZA 3VQAA 2XO7A 3MEDA 4AHTA 2D0CA 4MLHA 3SV4A 4DQSA 4DUYK 2PYLA 3IUCA 4K8XA 4PA1A 1BUPA 1HRHA 2VWBA 4EZ6A 3CQXA 3F9KA 4ZTFA 1NK7A 4WFBL 5H1SQ 5J2PA 4H0VB 4IO9L 4B9VA 1T05A 1IH7A 4MDBA 3A0IX 3RTVA 2ZM6K 1ATNA 5BRDA 2R7YA 3VQEA 4WQ5C 3CCSN 3OHRA 4N47A 5M1FA 4LFAK 2P9LB 1UAXA 5HRNA 2HW3A 3KK2A 1VHXA 5JLFA 5LJVA 4CEQA 5GADP 5EVZA 1OH8A 1GOCA 3PV8A 4H0PA 4JI2K 2E1ZA 3HXMA 4CCHA 2O8EB 5CZ1A 4DS4A 3CMEN 3BUZB 3DLHA 5B8HA 3K2PA 3VENA 4PUOA 2O4IA 4N56A 1N33K 4H8KA 1HKGA 4W5QA 1D9FA 4XIUA 3GE1A 2IS3A 4CEBA 4CJPA 1OH7A 4L3QA 3CM5A 3AV9A 3H08A 2GUIA 4CECA 3OS0A 3ZCMA 4DTNA 1VQNN 3THXB 4G1QA 3S41A 5AZJA 3ALYA 3CJBA 1U45A 3AVAA 3WNEA 2PBDA 4DFMA 3VA3A 3E01A 3AVLA 4WE1A 4A5BA 2KTQA 3O3HA 3VGKA 3TTCA 1KVCA 4DTRA 2KZZA 3WEEB 2E2NA 5KQ8A 1E4FT 1VSDA 5AQGA 4M42A 1NGCA 3CJCA 4BC3A 2FBYA 3I0SA 3AO5A 1KRPA 4CK3A 5K14A 3P83D 5BN8A 4JV5K 4E19A 1SL1A 1CLQA 4BC2A 4Y1DA 2HHVA 4CBWA 4BG9A 3OYLA 1HR0K 4BROA 4DR4K 3THYB 4YOYA 4F2SA 1JXEA 2F7TA 1XC3A 1CZBA 4YOWA 4CF9A 3G25A 1DEJA 1HLUA 3AO1A 1TUUA 2E20A 1BU6O 3RMBA 4IWVA 3CCUN 2Y1JA 4M3YA 1OH6A 3VGLA 5BPNA 3CETA 1J54A 4ICLA 4CJTA 4CI6A 3AA3A 1QZ6A 1T7PA 1DTQA 3ZT2A 1LW0A 3DRPA 3V9ZA 2UXDK 5KGXA 1YHQN 4IO8A 4C8MA 3DLGA 4BREA 4M3WA 2UXBK 3LWLA 4NB4A 3T69A 4W5NA 1RT5A 4FLYA 4HUFA 2DFHA 1YUWA 3B6PA 4V19S 5AQJA 2P5OA 2W6KA 4JD2B 3MAQA 4JI0K 1Q9XA 4B9NA 4BRLA 4IFVA 1SV5A 3LDSA 4Z0UA 3VETA 4HVJA 4CJUA 4DTXA 3DXKB 3V6DA 3I0RA 3WQUA 4LFBK 3ZSXA 5M1OA 3V9XA 1NK5A 1J53A 4CHPA 5BRHA 3MECA 1FXXA 3NHGA 2CGJA 3G10A 3LDPA 4FLWA 1RBRA 4X62K 2IOCA 4ISFA 3NE6A 3ZT0A 4JS5A 2H3GX 4K41A 5GAEP 5DM6L 1GLBG 4AQYK 5J2QA 3NVMA 3AVNA 5FROA 5HOOA 3BGRA 3F5TA 1HJRA 1I39A 4DG1A 1YAGA 1IJJA 4CGHA 3T7ZA 2YV0X 3E9LA 3MEGA 3CC2N 4CK2A 4NLBA 1QQMA 4DV4K 2CH6A 3SUOA 3QB0A 4PL8A 4H4OA 2YHAA 4DFJA 4G9ZA 3KZBA 3U8XA 4CZMA 3CXCM 4F3OA 4AILC 2NRZA 3CERA 1S1TA 3S3OA 2FSNA 4M7YA 3R1XA 3TR8A 2A42A 2NRWA 5CHIA 1XC9A 2OZSA 3AGKA 4O5BA 1W9HA 1U6ZA 3THWA 4CJVA 1TK0A 1U2VB 2FC0A 3ZX3A 4FCYA 3E1YA 2ZE2A 3JAMO 3SAGA 4M45A 3IKMA 2P5GA 1Z6RA 3NF8A 3D0PA 2VWJA 4M41A 4O8KA 3TANA 3ZSRA 2IC3A 5JICA 1BHLA 1TYQA 4CEOA 3C6HA 2QTDA 1TK5A 4E3SA 4MLEA 1YF5L 4CZIA 5MLCQ 4JKGB 3HM8A 4IEEA 4AHUA 3L3VA 1RCHA 2YNGA 4F8RA 3NMUA 3D2FB 2KFZA 4DV7K 3O9UA 2XY8A 3M8QA 5A2QO 3L0QA 4FW2A 1U49A 1SKWA 4X66K 3L8BA 2ZD1A 4FWMA 1ILYA 4H5VA 4DU4A 3QEPA 2YHXA 4CEZA 2E5LK 1KD1O 5BR8K 2IIRA 3O1BA 5BR9A 1Q86O 4DF8A 2G8VA 3AAPA 3VEOA 4IOAL 3JSMA 4FJHA 4BC4A 2JWKA 4CHZA 3ZLJA 3VMFB 1ASWA 5AR0A 4FVUA 2ITMA 1JL1A 2P1JA 4K25A 1TAUA 5FPNA 3LAKA 4CVNE 2Q97A 3VF2A 4JRQA 1JLFA 4DS5A 3J7YP 3UIQA 2QI2A 4KH6A 2YHBA 4FK2A 3H45C 2FXUA 4RCHA 3KLHA 4OKJA 1T03A 3PSFA 2PY5A 4IKFA 1BI4A 4O5FA 1VQ4N 2BANA 1HPZA 1NG9A 1OVQA 1REVA 5JVGL 4H5RA 4KHQA 1T44A 3L2VA 4CZLA 4FOIA 5BPMA 4CEEA 4FM0A 1CZ9A 2YCHA 4FZYA 4FPBA 1K8AO 1HNIA 3IG1A 4QAGA 3RRHA 3EYZA 3CCMN 1L5UA 3K5LA 1SKSA 3O9SA 4KTZA 1VSJA 1FKOA 1XWLA 4KPYA 5AFUH 5J2MA 1VSIA 3B8AX 4KAZA 2F4VK 3SUPA 4C8NA 4CZEA 4E1JA 3K57A 3L3UA 3Q7CA 2ASOA 4EHTA 4CJKA 4HCBA 4NCAA 2HVHA 3QLHA 2UXCK 3OJUA 1NJZA 4FPAA 3SUQA 3CPEA 1ZBUA 1MWKA 4C8KA 3M5RA 3NH2A 4E1NA 3DWLA 4XH4A 4GVEA 1VQMN 2OANA 2UYTA 2ATQA 4JKAA 4H5TA 4FWQA 3ENHA 3FR0A 4FLVA 3HOTA 2VGNA 4JS4A 3KJVA 2OPRA 4RW9A 4Q0BA 3EE8A 4Z4HA 4R79A 3O80A 4LSNA 2F9WA 5ELZA 4IXCA 3MK6A 3QO9A 4J8FA 2OPQA 1XUPO 1NNEA 2QWLA 1RTDA 2JLEA 3QINA 1VQ5N 4AHVA 4BR7A 4O4GA 4BRFA 3VA0A 2UUCK 3O4QA 1IKXA 4FK4A 2HHTA 2P9SA 1WSFA 1Q82O 5HRSA 5HBMA 2QWQA 4DU1A 1HKCA 4MDAA 4M3XA 4DHYA 4RW4A 4YDUC 4FYDA 3DLEA 3OYMA 1JLEA 1B92A 3NCIA 2V7ZA 5KTQA 4DSLA 5EOYA 3FZLA 4KO0A 4DQRA 3LP0A 5ADXA 4DV3K 3TTDA 2YJFA 4C8OA 1BCMA 2KLAA 4CIGA 4L8RB 3NGIA 4KFBA 3CF5L 4RTFD 2HMIA 4C1NK 3PX0A 4OPKA 4BWMA 1LAVA 3ATVA 2P9UB 2Q1NA 5AQVA 4ISGA 3IAYA 2HHXA 2DFEA 3SMSA 2ETJA 2QWPA 1ASVA 3DM2A 1RDWX 3KIOA 4CHYA 2HHUA 1A5WA 3O3FA 3VPZA 3VQQA 3HOSA 5LJWA 3D2EA 1TUYA 3C7NB 1DT9A 2Q3SA 1KSPA 1SUQA 5JMVA 3UKRA 5J1EA 3LWMA 3FZMA 4KB0A 3ULEA 5C10A 4QS7A 1TKZA 3LZJA 5AQXA 2P9KB 3C65A 3C0BA 3NGZA 4O44A 4DFKA 1E3MA 3BY5A 4CD3A 3OS2A 3CCLN 3F73A 4I2PA 1TKXA 4AHCA 3R8EA 3SNNA 3CFRA 3WXKA 1VQ7N 4IDHA 3HT3A 4DR5K 1RDAA 2OTLN 4JHDA 2ASPA 4GV3A 4KKOA 2P9PB 1HKBA 1DTTA 3QFUA 3QMLA 1VSLA 1ASUA 5M1QA 3T1HK 1YT3A 4OKKA 3QNNA 4MFBA 3PX6A 5AQFA 4IOCL 1BA1A 3AO4A 1B9FA 2F8SA 3SMPA 3J7ZO 3OYBA 1XMQK 1RBUA 2PAVA 1S1UA 3M8PA 3TAEA 3TAPA 3BDPA 4WQ4A 4IG3A 1ATRA 5M1PA 4O0JA 4U7BA 1XQSC 4H0TB 4ID5A 3SBTA 1XMOK 3MWTA 1YXQA 2VQFK 4LF4K 3CJAA 3RR8A 1JKHA 5JVHL 3L4QA 5AZIB 3G4SN 2W41A 4F3TA 3QIPA 5KRSA 2X6NA 3AVMA 4DKWA 2ASMA 1JL2A 2FBTA 3MX5A 3CMAN 3VGMA 2AJQA 3A8YA 3I55N 1GLAG 2YNFA 5AQUA 4DR6K 5GINA 3VQCA 2ZJPL 4BVOA 5KPZA 4FK0A 2E6LA 3VTHA 2PFUA 3DXMB 2NRRA 3HSCA 4FM1A 1ZBIA 4PQUA 1Z26A 3PX4A 2YI1A 1S1WA 2HBJA 2FF3B 4BRHA 1Y97A 4H03B 1UOCA 3RWUA 3NBPA 3VEZA 5AQIA 1Q18A 5CZ2A 3U9ZA 3B6OA 3PY8A 1QHTA 5KI6A 1GLLO 4WF9L 4K42A 3ISNC 4H5NA 1LV5A 3O5BA 2EHGA 4EP5A 4OVLA 5T7BA 3NH1A 1NGFA 3AA4A 1BIUA 4KB1A 3SQ0A 3K59A 2P9NB 4KH4A 1N32K 3K58A 2HHHK 4CZJA 3VN5A 1MA9B 2W6LA 1QSSA 4KHUA 2O8DA 2E4LA 1TAQA 3V9SA 4J2EA 4DLGA 3JS6A 2YNHA 2UU9K 3TU5A 2IVPA 1NK9A 4BWJA 3WQTA 1P8ZA 4BY9C 4HUEA 1ATSA 1WSIA 4FJXA 5C0YA 3NF6A 2JGUA 1YITN 4B8CA 5AQPA 3ZSQA 3WNFA 4I9LA 3DOKA 3U4LA 2XY5A 3U3GA 4DTPA 4BRDA 1LAWA 3HBTA 4DF4A 1JLGA 1RBSA 4B1UB 4QOZB 2VYPA 3SQ4A 3SAHA 1KAYA 2A1SA 2G8WA 3LP1A 3TAFA 1EETA 4BC5A 3TSQA 4DTJA 4A59A 5FPEA 4Z94A 3EKUA 5D3GA 3VQBA 1U04A 4B08A 2ZF5O 3NGYA 3O3GA 3DLLL 5C2DA 4YDUA 4LY7A 3AVBA 4IJAA 1JLQA 3ZETA 3L2UA 1NJXA 1R59O 1EX4A 4ILGB 1VQON 3TSPA 2CGLA 5EX5A 5HROA 1VQPN 1EXQA 2NRHA 4N76A 3LALA 3CCVN 3V9UA 1NGGA 2EWSA 3CCRN 2BDPA 1TVRA 1NKBA 3ZEUA 4J2AA 3FGUA 1IO2A 3O6WA 2O8FB 3L2RA 4BQZA 4HWIA 4YORA 1K8KA 2B4JA 2KQ2A 5DMRA 1YTAA 2P9IA 4LFCK 4ISEA 5AFUA 4C1NI 2AP1A 4BACA 3H3OB 1BQMA 1KC8O 5F2RA 3A5OC 1LWFA 3IMXA 1VQ8N 4B3MK 3TAMA 3RMCA 4BRIA 4FW1A 3O8MA 5AQSA 4DR3K 1HX1A 1QQNA 3KLEA 3DLRA 4E89A 2O8CA 3CCJN 4LF5K 3ENBA 1GLEG 3HRGA 4B3OA 3DLBA 3TPQA 3QEVA 5F0XA 3OW2M 1YTUA 4WCEL 3Q7BA 3DRRA 1NGAA 3ID6A 2YNIA 1CXQA 1S72N 1WB9A 1G99A 1BCOA 4CZFA 1X9WA 4CK1A 3LL3A 3C6TA 3CC4N 4JKBA 3HVTA 4XH5A 3WUHA 3GG4A 1Q81O 4JYAK 4BRNA 3OTOK 4OPJA 2VG6A 3VEVA 1NMDA 4EHUA 2BE2A 3SV3A 3CPWM 2QA4N 1C0TA 3ENOA 3TABA 1J5OA 1VSKA 3ZT4A 3NH0A 2OA8A 4E7LA 3D6RA 3ZX2A 1E4GT 5DM7L 2HB5A 1K9MO 1Q8IA 3A5LC 4KHWA 2G8IA 1LWCA 3ZT3A 3LDOA 5AQYA 4NYFA 4YOUA 2A40A 3KK7A 5E41A 4GY2B 3H6EA 3GOIA 4I6MA 5AQRA 2WOMA 4JI7K 3HK2A 3DYAA 4H0YB 4F9OA 3KD1E 3PO4A 4O55A 3RSEA 4KHYA 2XY6A 1NGIA 4H0XB 4BG8A 1RTHA 3BZKA 3O9QA 1A5XA 4IDKA 4M7XA 4DSKA 1S6QA 1X9MA 1SL2A 3G0ZA 4CEAA 1EWQA 2QWNA 1OKJA 5AZJB 2E1YA 3OYHA 2XRIA 3BEXA 2BTFA 4HTLA 3EN9A 1KAXA 3SAFA 1D5AA 1C0MA 5SWMA 3QEXA 1HUXA 1VSMA 1ITGA 4JI4K 2IGIA 4XH1A 4FXDA 3VQ5A 2OZMA 3AO2A 3CHWA 2HOEA 5DK5A 3HO1A 2O8BA 4CESA 5J2NA 2J4RA 5KPRA 3HM9A 1NJWA 4A2AA 3WXLA 1W7AA 4BRQA 5GAGP 1NGBA 3ZSYA 1IKWA 2NLXA 4LF6K 4MO4A 5SZTA 1YJ9N 1T3VA 1WNSA 2A3ZA 5KPTA 4LF8K 4HCCA 1YJWN 3HL8A 2V52B 3P31A 3OYJA 5CY4A 5KQDA 1W0HA 4GW6A 2NUBA 1RT7A 5HRRA 3ZSOA 2KHOA 3AVCA 2NRTA 4FM2A 1SKRA 4WQ4C 4BE1A 2GTDA 3HZ6A 2XY7A 1NGEA 4DU3A 5LL6Z 1D8YA 1VQLN 1YVUA 4K8ZA 3PIOL 3MN9A 1GLDG 3CJ9A 4CFDA 5FRNA 4CHNA 3J7AP 2YHWA 5KRTA 3OYCA 4JI3K 1W2BM 1OVYA 1RT1A 1VSFA 1GLCG 3S3NA 3QDKA 3QICA 4RW6A 2VCPA 4XEIA 5KGWA 3HYFA 3KKSA 4MQ3A 4MO5A 4DLEA 3CM6A 4X64K 3LANA 3P38A 4FLTA 1IBMK 4C8LA 4IJNA 1TV6A 2GWJA 3NDKA 1JJ2M 3VEXA 4KHNA 1S9EA 4KHPK 2FBXA 3VEYA 3CFPA 1TL1A 4M63C 3IRXA 1YVNA 3FZKA 4LC9B 1IG8A 4H0OA 4YOXA 3F2KA 1WBDA 3CQ8A 3VQ7A 3O4NA 3KVGA 2Q2RA 1BG3A 4DV2K 4FJNA 4FJLA 3GDQA 3OYKA 4JI6K 2RE2A 3M8RA 2VG5A 1O13A 5I3UA 3HTVA 1NGJA 3CJ7A 3W0LA 3T1AA 1BO5O 4BDZA 1RBTA 4DTUA 3CCEN 1NK4A 4OGCA 2IVNA 3LM9A 4M3UA 4DV6K 3ZSWA 1V4SA 4LF7K 3AARA 4BRPA 1S3XA 4FJJA 1MU2A 2D4WA 3KLIA 5BPLA 3P1GA 4ZTJA 4FO0A 3UE5A 3UKUA 2D0OA 1J5EK 1SAZA 3THWB 3THVA 4CERA 3EZ5A 4BR4A 1JXBA 1DLOA 1VAZA 4CBXA 3FFIA 5F1XA 4ZHRA 4GVMA 3LZIA 2WUSA 1QS4A 1P90A 1QQCA 1C0UA 1RBVA 3T19A 4B1ZA 5BRFA 3K5MA 4NYNA 3V1RA 3ULDA 1RNHA 4CHQA 4ILJA 2GX9A 1TYQB 2QKBA 5HRPA 1HYVA 4YY3K 1X3NA 3TTFA 3C6UA 2P9LA 4BRMA 3M8SA 3OBYA 4LF9K 1S1XA 3DRSA 2QWOA 3VQ4A 3O1WA 3WNGA 1S5JA 1NM1A 3K9KA 4CFBA 5LY3A 4B9TA 2UUBK 2O8EA 3CC7N 2DFFA 1RT4A 3WXIA 2FBVA 1VSHA 4FWOA 3SBGA 3SI6A 3C95A 4FSVA 3ZSVA 4DSIA 5BREA 4JI8K 3V1OA 4CJ5A 4CF0A 1K6YA 4ELTA 3SZ2A 3HP9A 3V1QA 4DTSA 3BF3A 4FWLA 3W3DA 1VK0A 1BQNA 2HNDA 2WBNA 4YOTA 3GBTA 3LPTA 1JCFA 3I8BA 4EAHD 3THXA 3HPHA 3ASMA 3K5OA 2X74A 4Y0WA 2Z1IA 2KFNA 3JYTA 4IFEA 4A61A 4CZHA 5M1NA 4Y1CA 1LWEA 4CJ4A 1RT6A 3WEEA 1RILA 1ZBLA 3MCPA 3MCAB 1HPMA 1BI4B 4EIAA 1NKCA 4GKKK 3IS9A 4EP4A 1BDGA 4GKJK 3AGRA 4JI1K 3LDLA 1HJOA 4BR0A 4OO1J 5M1KA 2IDOA 1NU0A 5AQZA 3WNHA 3THYA 3H1QA 5FDLA 4K43A 3QETA 4J2DA 1RT3A 5BN9A 2G8FA 4FWNA 3KWIA 2UUAK 5GAHP 4JK8A 4E7JA 4I2QA 2XHBA 3A2FA 4CJEA 4F2RA 3ZSZA 3VQ9A 2BUPA 5TKWA 2QWMA 5AQHA 4B9SA 3VQ6A 1HNVA 4B1WB 3MN5A 3I8DA 4M3TA 1LW2A 1SQKA 1VRTA 1S6PA 3AVKA 4A57A 1WOQA 1S9GA 1CZAN 2OTJN 4BRGA 1HMVA 4PY5A 4CEDA 4KTWA 2HVIA 3HP6A 1WBBA 2PZSA 4JD2A 2W40A 4DR1K 4GV9A 1JCEA 4IEIA 2RHKA 3E9OA 2HSTA 3AVJA 2RN2A 3H3NO 4JLHA 1FW6A 5C42A 3PSIA 3DXKA 4NO7A 2Y1IA 1KTQA 3MXIA 4BE0A 3P5JA 3PLAA 1C0GA 3LPUA 3HSTB 2GV9A 3DJCA 2OYQA 2ZWHA 3C6AA 3VQ8A 3R9PA 3N4QA 3NVKA 4YFUA 2P9SB 1BA0A 4JRPA 2ZGYA 2X78A 4CJ7A 3E66A 3LP2A 2Q36A 3WXMB 4JKCA 1UWBA 3J81O 1EKEA 2QEXN 4OX9K 2HBLA 3SLCA 1S1VA 2VWKA 3DMJA 4DSEA 4AHSA 1JLAA 3OYDA 1GOAA 3ITHA 1L3TA 1OH5A 1ZBHA 3O9TA 4BR5A 4DUZK 1KLNA 3E9PA 4RW8A 1J6ZA 4DSJA 1O1WA
chains in the Genus database with same CATH topology
2OPPA 1VSKA 4LSLA 1T03A 2PY5A 4IKFA 1BI4A 4LH5A 4OJRA 3ZT4A 4E1MA 3NH0A 4CGIA 4FJMA 2BANA 4E7LA 2OA8A 1HPZA 4QCLA 1BIZA 2B5JA 3SJJA 1FK9A 3D45A 1REVA 4FLUA 4KHQA 4CJSA 4CGDA 1R0AA 1C6VA 4E7KA 3L2VA 4R5PA 1RDDA 2HB5A 4CEEA 4FM0A 1CZ9A 2ITGA 4CF8A 3HVRA 1Q8IA 4B9UA 4FZYA 4KHWA 3AVFA 2G8IA 5HP1A 1LWCA 2PYJA 3ZT3A 1HQEA 1HNIA 1B9DA 3OYIA 1XI1A 3IG1A 2YKNA 4FVMA 1NOYA 2HVHA 5CYQA 4NYFA 4QAGA 4E7HA 3RRHA 3EYZA 4BE2A 1HYZA 1TKTA 5E41A 3K5LA 1L5UA 1HYSA 1SKSA 1IG9A 4KTZA 4CIEA 2WOMA 3QNOA 1NKEA 3HK2A 1VSJA 3DYAA 4RG8A 3NAEA 1FKOA 1XWLA 4UQGA 3KLGA 3KD1E 3PO4A 4KPYA 4O55A 1D9DA 5J2MA 3RRGA 1VSIA 5JS1A 4DQQA 4KAZA 1RTIA 1IKVA 4F4KA 4KHYA 2XY6A 3SUPA 5C25A 4C8NA 3SQ1A 3K57A 3L3UA 4DFPA 5HLFA 1RTHA 3MXJA 4CJKA 4HCBA 4NCAA 1A5XA 4IDKA 3QLHA 4CHOA 3HPOA 4HUGA 3OJUA 1NJZA 2RKIA 4DSKA 1S6QA 3SUQA 4DSFA 1NJYA 1ZBUA 3AA2A 4Q5VA 1X9MA 4KV8A 3OYFA 1SL2A 1BISA 3G0ZA 4CEAA 4E1NA 3NH2A 2Z1JA 4C8KA 1Z25A 4I9QA 3LAMA 2HNYA 3OYHA 3CG7A 2XRIA 2ZQBA 4CJQA 1D5AA 2ATQA 1C0MA 1QSLA 5SWMA 4AHRA 1SL0A 3QEXA 1U4BA 1U47A 4FLVA 4N5SA 1VSMA 1ITGA 1X9SA 2IGIA 3SQ2A 3OVNA 4FXDA 3AVHA 4IG0A 5EU7A 1WSJA 2OPRA 3VQ5A 2RPIA 3KJVA 4JS4A 4RW9A 2OZMA 4Q0BA 3AO2A 1CXUA 1U48A 3QEIA 4Z4CA 4Z4HA 1I3AA 4FJGA 2G8KA 1XHXA 2DY4A 3KK3A 4HHTA 1UA1A 2D0BA 4LSNA 5DK5A 3HO1A 2O4GA 2KZMA 4CESA 2VG7A 5J2NA 4Z4IA 3QO9A 1NOZA 3HM9A 4ELVA 2OPQA 3OYEA 1NJWA 2G8UA 3OYNA 4KI4A 1F21A 1RTDA 2JLEA 3QINA 4PWDA 4AH9A 3ZSYA 4W5RA 4AHVA 5I42A 1IKWA 4O4GA 3VA0A 4FK4A 1WN7A 1IKXA 3O4QA 4DTOA 3HPGA 2HHTA 5SZTA 2X6SA 1WSFA 1WNSA 5HRSA 5HBMA 2D5RA 4HCCA 3HL8A 4DU1A 2GBZA 3AVGA 3VQAA 3OYJA 2XO7A 5CY4A 4M3XA 1W0HA 3MEDA 4RW4A 3DLEA 4AHTA 1KFSA 4GW6A 2NUBA 1RT7A 2D0CA 5HRRA 3ZSOA 3OYMA 4DSJA 3AVCA 3SV4A 4DQSA 4FM2A 1SKRA 1JLEA 1B92A 4BE1A 3AVIA 3NFAA 3NCIA 2PYLA 4K8XA 5KTQA 4DSLA 4KO0A 4PA1A 4DQRA 2XY7A 1HRHA 1TL3A 3LP0A 4EZ6A 1WAFA 3F9KA 4ZTFA 1NK7A 3OY9A 3T3FA 5J2PA 1BCMA 4DU3A 4CIGA 4C8OA 4DQIA 4L8RB 1N5YA 4B9VA 1D8YA 4K8ZA 1T05A 1YVUA 1IH7A 4KFBA 3NGIA 4CFCA 3RTVA 2HMIA 4CFDA 3SPZA 5FRNA 4CHNA 5KRTA 3OYCA 3PX0A 1FKPA 4OPKA 4LD0A 2R7YA 4BWMA 4I7FA 1LAVA 3VQEA 1RT1A 1VSFA 3IAYA 4FZXC 2HHXA 2DFEA 1RT2A 3VQPA 3S3NA 2F96A 2ETJA 4RW6A 1ASVA 3U3YA 3DM2A 4N47A 4CF1A 3KIOA 4CHYA 2HHUA 4CJLA 1A5WA 1UAXA 1GOBA 3O3FA 3VQQA 5HRNA 2HW3A 4BDYA 5KGWA 3KK2A 3MXMA 4KI6A 2F8TA 1TGOA 3HYFA 3KKSA 3U6FA 4CEQA 2EX3A 2Q3SA 1KSPA 4MQ3A 4DLEA 4FJ9A 1SUQA 1GOCA 4M3RA 3CM6A 3OJSA 3PV8A 3LANA 5J1EA 3LWMA 3HXMA 4CCHA 5CZ1A 4KB0A 4DS4A 4FLTA 4CIFA 1TK8A 1TKZA 1C1BA 3LP3A 1BGXT 3LZJA 3NGZA 1TKDA 3DLHA 4C8LA 3K2PA 1KVBA 4PUOA 1TV6A 2O4IA 4O44A 4N56A 3NDKA 4CE9A 4DFKA 3TAQA 4H8KA 3OS1A 4W5QA 4KHNA 3SCXA 1D9FA 4XIUA 1S9EA 1WLJA 2IS3A 3OS2A 2FBXA 3F73A 4ID1A 4CEBA 4I2PA 4CJPA 3OYAA 1TL1A 3CFPA 3IRXA 4Z4GA 3CM5A 1TKXA 4AHCA 3AV9A 3CFOA 3SNNA 2RF2A 3H08A 2GUIA 4CECA 3OS0A 3ZCMA 2W42A 3CFRA 4DTNA 3QERA 2QKKA 2HHWA 1WSHA 3HT3A 4G1QA 3CQ8A 3VQ7A 1L3VA 1RDAA 3O4NA 3ALYA 1U45A 3AVAA 3WNEA 4DFMA 4FJNA 3QEWA 4DMNA 3VA3A 4FJLA 1N6QA 3OYKA 3E01A 3M8RA 3AA5X 4RW7A 3AVLA 4KKOA 2VG5A 4IFYA 4WE1A 1ZYQA 2KTQA 5I3UA 3O3HA 1KVCA 3T1AA 1DTTA 4BDZA 4DTRA 1VSLA 1ASUA 2KZZA 2IAJA 1YT3A 1RBTA 1VSDA 4OKKA 3QNNA 4DTUA 4M42A 3TI0A 4OGCA 1NK4A 4MFBA 3PX6A 2FBYA 3AO4A 3I0SA 1B9FA 3AO5A 4CK3A 1KRPA 4M3UA 2F8SA 5K14A 3OYBA 3P83D 3ZSWA 4E19A 1SL1A 1RBUA 3RR7A 2BGGA 1S1UA 3M8PA 3TAEA 4FYDA 1CLQA 3TAPA 4KTQA 3KLFA 3BDPA 4Y1DA 2HHVA 4IG3A 4FJJA 1MU2A 2HNZA 4O0JA 3OYLA 3KLIA 3P1GA 2KW4A 1WSGA 4ID5A 5C24A 3TARA 4F2SA 1JXEA 3HJFA 1CZBA 4ZTJA 3KK1A 1NK0A 4FLZA 4CF9A 3AO1A 3RR8A 3THVA 4CERA 3EZ5A 1JKHA 1JXBA 3RMAA 1DLOA 3FFIA 3RMBA 4F3TA 3QIPA 4ZHRA 5KRSA 2X6NA 4N41A 3AVMA 4GVMA 3LZIA 1QS4A 3DLKA 1QQCA 2Y1JA 4KHSA 1JL2A 4M3YA 1C0UA 1RBVA 2FBTA 3T19A 1RDBA 1J9AA 4O0IA 3K5MA 2AJQA 4NYNA 1J54A 4ICLA 4CJTA 2YNFA 3S9HA 3V1RA 4B9MA 3ULDA 1KLMA 3VQCA 3AA3A 4FK0A 1T7PA 1DTQA 1RNHA 2E6LA 3ZT2A 1LW0A 3DRPA 3TWHA 3V9ZA 5KGXA 4CGGA 2YKMA 4CGJA 4CHQA 1KFDA 4GMJB 4Z4FA 4C8MA 3DLGA 4FM1A 4M3WA 1ZBIA 3LWLA 4OLBA 2QKBA 4PQUA 4W5NA 1RT5A 4FLYA 5HRPA 1Z26A 2DFHA 1HYVA 3B6PA 4HUFA 3PX4A 1S1WA 2QXFA 4NCBA 1Y97A 3RWUA 1UOCA 2P5OA 3NBPA 3MAQA 1Q9XA 3PUFA 3C6UA 5CZ2A 4B9NA 3B6OA 3PY8A 3M8SA 4CEFA 1QHTA 4FZZA 4IFVA 5CYMA 1SV5A 1S1XA 2E6MA 3DRSA 5KI6A 3QIOA 3LDSA 4Z0UA 3ISNC 4HVJA 4CJUA 1LV5A 1G15A 3VQ4A 2P51A 4DTXA 3QESA 2EHGA 3WNGA 1S5JA 4EP5A 3I0RA 4OVLA 3V6DA 5T7BA 4CFBA 3KKRA 3ZSXA 3V9XA 4B9TA 1BL3A 1NK5A 1J53A 2DFFA 4CHPA 3NH1A 1RT4A 1FXXA 3AA4A 1BIUA 2FBVA 3DOLA 3MECA 3G10A 3NHGA 4FLWA 3SQ0A 4KB1A 1VSHA 3K59A 3SI6A 1RBRA 3C95A 3ZSVA 4DSIA 2IOCA 3NE6A 3V1OA 3K58A 3ZT0A 2Z1GA 5JS2A 4CJ5A 4CF0A 4LH4A 1K6YA 3VN5A 4JS5A 4ELTA 2HHQA 2I5JA 3CYMA 3HP9A 3SZ2A 1QSSA 3V1QA 4DTSA 3RMDA 2E4LA 4KHUA 1VRUA 1TAQA 3V9SA 4J2EA 4DLGA 5J2QA 1VK0A 1BQNA 2HNDA 3AVNA 1RDCA 5FROA 3BGRA 2YNHA 1EP4A 1HJRA 3LPTA 3OYGA 1I39A 4DG1A 1KCFA 3HPHA 4CGHA 1UA0A 2YV0X 1NK9A 1HQUA 3VQDA 3V9WA 4BWJA 2LSNA 3ASMA 3MEGA 3KTQA 4DWIA 1IKYA 3K5OA 2X74A 4HUEA 2Z1IA 2KFNA 1WSIA 4CK2A 1QE1A 3JYTA 4FJXA 4OKEA 3NF6A 2JGUA 4B8CA 4Y1CA 1LWEA 3AO3A 3SUOA 1WSEA 4CJ4A 1RT6A 3ZSQA 4H4OA 3WNFA 1RILA 4I9LA 2YHAA 3DOKA 4DFJA 2XY5A 1ZBLA 3V81A 3U3GA 4DTPA 1LAWA 4OGEA 4DF4A 4F3OA 4E0DA 3EY1A 4AILC 1BI4B 1RTJA 1JLGA 1RBSA 2D0AA 4CJ3A 3SQ4A 1S1TA 4QOZB 4H4MA 1QSYA 4M3ZA 2A1SA 2G8WA 3LP1A 1VSEA 3TAFA 1NKCA 1EETA 4W5TA 3S3OA 4DTJA 3IS9A 4EP4A 1JLCA 3SPYA 1Q9YA 1NK6A 3TR8A 2IDOA 4KREA 4KRFA 5D3GA 3VQBA 1U04A 4B08A 3WNHA 2QK9A 4OLAA 5FDLA 3NGYA 1XC9A 4CFAA 2OZSA 3QETA 2WONA 3O3GA 4O5BA 1W9HA 1RT3A 4J2DA 2G8FA 4LY7A 3AVBA 4CJVA 1JLQA 1TK0A 3L2UA 1ZBFA 1NJXA 1EX4A 2FC0A 4FCYA 2ZE2A 5HROA 4E7IA 1EXQA 1XHZA 2B6AA 4N76A 4E7JA 4I2QA 4CGFA 3LALA 2XHBA 3A2FA 3V9UA 4CJEA 4M45A 4F2RA 3ZSZA 3VQ9A 2Z1HA 2P5GA 3TAGA 2BDPA 1TVRA 3NF8A 1NKBA 4B9SA 3VQ6A 1HNVA 4CJFA 3DI6A 3D0PA 1L3UA 4J2AA 2VWJA 3SUNA 4M41A 1IO2A 3I8DA 4CF2A 1NK8A 3L2RA 1C1CA 4Z4EA 4M3TA 3ZT1A 3TANA 2B4JA 1LW2A 2HHSA 3ZSRA 2KQ2A 1VRTA 2IC3A 1BHLA 1S6PA 3AVKA 5DMRA 4CEOA 4IBNA 1S9GA 1YTAA 3K5NA 4NCGA 1KVAA 1HMVA 1TK5A 3S3MA 4CEDA 4E3SA 4KTWA 1T8EA 4PY5A 2HVIA 3HP6A 4BDPA 2PZSA 4BACA 3KD5E 4AHUA 3L2WA 2DTUA 2OPSA 3L3VA 3NF7A 3C94A 1RCHA 1QTMA 2YNGA 4F8RA 1BQMA 2KFZA 4FJ8A 1LWFA 3AVJA 2RN2A 4JLHA 3TAMA 4CJRA 2XY8A 4YNQA 3M8QA 3L2QA 4FJ5A 4B9LA 4FJ7A 5C42A 2Y1IA 3RMCA 1KTQA 3MXIA 4FW2A 4BE0A 3P5JA 1U49A 3LPUA 4EZ9A 4FW1A 4TSXA 1SKWA 3HSTB 2GV9A 1WAJA 4DTMA 3L8BA 3KLEA 2ZD1A 3DLRA 4E89A 2OYQA 4DU4A 3QEPA 5FRMA 3VQ8A 4CEZA 1A5VA 4W5OA 4B3OA 3DLBA 3QEVA 4YFUA 4B8AB 4DF8A 4JRPA 2G8VA 4FJKA 2X78A 3JSMA 1L3SA 4FJHA 2G8HA 1YTUA 1JLBA 3DRRA 3LP2A 4HTUA 3SYZA 2YNIA 1CXQA 4CHZA 3PO5A 1ASWA 4FJIA 1UWBA 1EKEA 1JL1A 2P1JA 2A1RA 1TAUA 3LAKA 1BCOA 3MEEA 1S1VA 2VWKA 3DMJA 4DSEA 3NF9A 4AHSA 1JLAA 3OYDA 1GOAA 3ITHA 1JLFA 4CK1A 4JRQA 1X9WA 4J2BA 3C6TA 1L3TA 3HVTA 1X1PA 4DS5A 3V4IA 4CJWA 1ZBHA 4FLXA 3UIQA 1KLNA 4OPJA 4ELUA 1C1AA 2VG6A 4RW8A 2BE2A 3SV3A 2YHBA 4FK2A 4DQPA 1C0TA 3TABA 3KLHA 4OKJA 1O1WA 1J5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPP A;  1VSK A;  4LSL A;  1T03 A;  2PY5 A;  4IKF A;  1BI4 A;  4LH5 A;  4OJR A;  3ZT4 A;  4E1M A;  3NH0 A;  4CGI A;  4FJM A;  2BAN A;  4E7L A;  2OA8 A;  1HPZ A;  4QCL A;  1BIZ A;  2B5J A;  3SJJ A;  1FK9 A;  3D45 A;  1REV A;  4FLU A;  4KHQ A;  4CJS A;  4CGD A;  1R0A A;  1C6V A;  4E7K A;  3L2V A;  4R5P A;  1RDD A;  2HB5 A;  4CEE A;  4FM0 A;  1CZ9 A;  2ITG A;  4CF8 A;  3HVR A;  1Q8I A;  4B9U A;  4FZY A;  4KHW A;  3AVF A;  2G8I A;  5HP1 A;  1LWC A;  2PYJ A;  3ZT3 A;  1HQE A;  1HNI A;  1B9D A;  3OYI A;  1XI1 A;  3IG1 A;  2YKN A;  4FVM A;  1NOY A;  2HVH A;  5CYQ A;  4NYF A;  4QAG A;  4E7H A;  3RRH A;  3EYZ A;  4BE2 A;  1HYZ A;  1TKT A;  5E41 A;  3K5L A;  1L5U A;  1HYS A;  1SKS A;  1IG9 A;  4KTZ A;  4CIE A;  2WOM A;  3QNO A;  1NKE A;  3HK2 A;  1VSJ A;  3DYA A;  4RG8 A;  3NAE A;  1FKO A;  1XWL A;  4UQG A;  3KLG A;  3KD1 E;  3PO4 A;  4KPY A;  4O55 A;  1D9D A;  5J2M A;  3RRG A;  1VSI A;  5JS1 A;  4DQQ A;  4KAZ A;  1RTI A;  1IKV A;  4F4K A;  4KHY A;  2XY6 A;  3SUP A;  5C25 A;  4C8N A;  3SQ1 A;  3K57 A;  3L3U A;  4DFP A;  5HLF A;  1RTH A;  3MXJ A;  4CJK A;  4HCB A;  4NCA A;  1A5X A;  4IDK A;  3QLH A;  4CHO A;  3HPO A;  4HUG A;  3OJU A;  1NJZ A;  2RKI A;  4DSK A;  1S6Q A;  3SUQ A;  4DSF A;  1NJY A;  1ZBU A;  3AA2 A;  4Q5V A;  1X9M A;  4KV8 A;  3OYF A;  1SL2 A;  1BIS A;  3G0Z A;  4CEA A;  4E1N A;  3NH2 A;  2Z1J A;  4C8K A;  1Z25 A;  4I9Q A;  3LAM A;  2HNY A;  3OYH A;  3CG7 A;  2XRI A;  2ZQB A;  4CJQ A;  1D5A A;  2ATQ A;  1C0M A;  1QSL A;  5SWM A;  4AHR A;  1SL0 A;  3QEX A;  1U4B A;  1U47 A;  4FLV A;  4N5S A;  1VSM A;  1ITG A;  1X9S A;  2IGI A;  3SQ2 A;  3OVN A;  4FXD A;  3AVH A;  4IG0 A;  5EU7 A;  1WSJ A;  2OPR A;  3VQ5 A;  2RPI A;  3KJV A;  4JS4 A;  4RW9 A;  2OZM A;  4Q0B A;  3AO2 A;  1CXU A;  1U48 A;  3QEI A;  4Z4C A;  4Z4H A;  1I3A A;  4FJG A;  2G8K A;  1XHX A;  2DY4 A;  3KK3 A;  4HHT A;  1UA1 A;  2D0B A;  4LSN A;  5DK5 A;  3HO1 A;  2O4G A;  2KZM A;  4CES A;  2VG7 A;  5J2N A;  4Z4I A;  3QO9 A;  1NOZ A;  3HM9 A;  4ELV A;  2OPQ A;  3OYE A;  1NJW A;  2G8U A;  3OYN A;  4KI4 A;  1F21 A;  1RTD A;  2JLE A;  3QIN A;  4PWD A;  4AH9 A;  3ZSY A;  4W5R A;  4AHV A;  5I42 A;  1IKW A;  4O4G A;  3VA0 A;  4FK4 A;  1WN7 A;  1IKX A;  3O4Q A;  4DTO A;  3HPG A;  2HHT A;  5SZT A;  2X6S A;  1WSF A;  1WNS A;  5HRS A;  5HBM A;  2D5R A;  4HCC A;  3HL8 A;  4DU1 A;  2GBZ A;  3AVG A;  3VQA A;  3OYJ A;  2XO7 A;  5CY4 A;  4M3X A;  1W0H A;  3MED A;  4RW4 A;  3DLE A;  4AHT A;  1KFS A;  4GW6 A;  2NUB A;  1RT7 A;  2D0C A;  5HRR A;  3ZSO A;  3OYM A;  4DSJ A;  3AVC A;  3SV4 A;  4DQS A;  4FM2 A;  1SKR A;  1JLE A;  1B92 A;  4BE1 A;  3AVI A;  3NFA A;  3NCI A;  2PYL A;  4K8X A;  5KTQ A;  4DSL A;  4KO0 A;  4PA1 A;  4DQR A;  2XY7 A;  1HRH A;  1TL3 A;  3LP0 A;  4EZ6 A;  1WAF A;  3F9K A;  4ZTF A;  1NK7 A;  3OY9 A;  3T3F A;  5J2P A;  1BCM A;  4DU3 A;  4CIG A;  4C8O A;  4DQI A;  4L8R B;  1N5Y A;  4B9V A;  1D8Y A;  4K8Z A;  1T05 A;  1YVU A;  1IH7 A;  4KFB A;  3NGI A;  4CFC A;  3RTV A;  2HMI A;  4CFD A;  3SPZ A;  5FRN A;  4CHN A;  5KRT A;  3OYC A;  3PX0 A;  1FKP A;  4OPK A;  4LD0 A;  2R7Y A;  4BWM A;  4I7F A;  1LAV A;  3VQE A;  1RT1 A;  1VSF A;  3IAY A;  4FZX C;  2HHX A;  2DFE A;  1RT2 A;  3VQP A;  3S3N A;  2F96 A;  2ETJ A;  4RW6 A;  1ASV A;  3U3Y A;  3DM2 A;  4N47 A;  4CF1 A;  3KIO A;  4CHY A;  2HHU A;  4CJL A;  1A5W A;  1UAX A;  1GOB A;  3O3F A;  3VQQ A;  5HRN A;  2HW3 A;  4BDY A;  5KGW A;  3KK2 A;  3MXM A;  4KI6 A;  2F8T A;  1TGO A;  3HYF A;  3KKS A;  3U6F A;  4CEQ A;  2EX3 A;  2Q3S A;  1KSP A;  4MQ3 A;  4DLE A;  4FJ9 A;  1SUQ A;  1GOC A;  4M3R A;  3CM6 A;  3OJS A;  3PV8 A;  3LAN A;  5J1E A;  3LWM A;  3HXM A;  4CCH A;  5CZ1 A;  4KB0 A;  4DS4 A;  4FLT A;  4CIF A;  1TK8 A;  1TKZ A;  1C1B A;  3LP3 A;  1BGX T;  3LZJ A;  3NGZ A;  1TKD A;  3DLH A;  4C8L A;  3K2P A;  1KVB A;  4PUO A;  1TV6 A;  2O4I A;  4O44 A;  4N56 A;  3NDK A;  4CE9 A;  4DFK A;  3TAQ A;  4H8K A;  3OS1 A;  4W5Q A;  4KHN A;  3SCX A;  1D9F A;  4XIU A;  1S9E A;  1WLJ A;  2IS3 A;  3OS2 A;  2FBX A;  3F73 A;  4ID1 A;  4CEB A;  4I2P A;  4CJP A;  3OYA A;  1TL1 A;  3CFP A;  3IRX A;  4Z4G A;  3CM5 A;  1TKX A;  4AHC A;  3AV9 A;  3CFO A;  3SNN A;  2RF2 A;  3H08 A;  2GUI A;  4CEC A;  3OS0 A;  3ZCM A;  2W42 A;  3CFR A;  4DTN A;  3QER A;  2QKK A;  2HHW A;  1WSH A;  3HT3 A;  4G1Q A;  3CQ8 A;  3VQ7 A;  1L3V A;  1RDA A;  3O4N A;  3ALY A;  1U45 A;  3AVA A;  3WNE A;  4DFM A;  4FJN A;  3QEW A;  4DMN A;  3VA3 A;  4FJL A;  1N6Q A;  3OYK A;  3E01 A;  3M8R A;  3AA5 X;  4RW7 A;  3AVL A;  4KKO A;  2VG5 A;  4IFY A;  4WE1 A;  1ZYQ A;  2KTQ A;  5I3U A;  3O3H A;  1KVC A;  3T1A A;  1DTT A;  4BDZ A;  4DTR A;  1VSL A;  1ASU A;  2KZZ A;  2IAJ A;  1YT3 A;  1RBT A;  1VSD A;  4OKK A;  3QNN A;  4DTU A;  4M42 A;  3TI0 A;  4OGC A;  1NK4 A;  4MFB A;  3PX6 A;  2FBY A;  3AO4 A;  3I0S A;  1B9F A;  3AO5 A;  4CK3 A;  1KRP A;  4M3U A;  2F8S A;  5K14 A;  3OYB A;  3P83 D;  3ZSW A;  4E19 A;  1SL1 A;  1RBU A;  3RR7 A;  2BGG A;  1S1U A;  3M8P A;  3TAE A;  4FYD A;  1CLQ A;  3TAP A;  4KTQ A;  3KLF A;  3BDP A;  4Y1D A;  2HHV A;  4IG3 A;  4FJJ A;  1MU2 A;  2HNZ A;  4O0J A;  3OYL A;  3KLI A;  3P1G A;  2KW4 A;  1WSG A;  4ID5 A;  5C24 A;  3TAR A;  4F2S A;  1JXE A;  3HJF A;  1CZB A;  4ZTJ A;  3KK1 A;  1NK0 A;  4FLZ A;  4CF9 A;  3AO1 A;  3RR8 A;  3THV A;  4CER A;  3EZ5 A;  1JKH A;  1JXB A;  3RMA A;  1DLO A;  3FFI A;  3RMB A;  4F3T A;  3QIP A;  4ZHR A;  5KRS A;  2X6N A;  4N41 A;  3AVM A;  4GVM A;  3LZI A;  1QS4 A;  3DLK A;  1QQC A;  2Y1J A;  4KHS A;  1JL2 A;  4M3Y A;  1C0U A;  1RBV A;  2FBT A;  3T19 A;  1RDB A;  1J9A A;  4O0I A;  3K5M A;  2AJQ A;  4NYN A;  1J54 A;  4ICL A;  4CJT A;  2YNF A;  3S9H A;  3V1R A;  4B9M A;  3ULD A;  1KLM A;  3VQC A;  3AA3 A;  4FK0 A;  1T7P A;  1DTQ A;  1RNH A;  2E6L A;  3ZT2 A;  1LW0 A;  3DRP A;  3TWH A;  3V9Z A;  5KGX A;  4CGG A;  2YKM A;  4CGJ A;  4CHQ A;  1KFD A;  4GMJ B;  4Z4F A;  4C8M A;  3DLG A;  4FM1 A;  4M3W A;  1ZBI A;  3LWL A;  4OLB A;  2QKB A;  4PQU A;  4W5N A;  1RT5 A;  4FLY A;  5HRP A;  1Z26 A;  2DFH A;  1HYV A;  3B6P A;  4HUF A;  3PX4 A;  1S1W A;  2QXF A;  4NCB A;  1Y97 A;  3RWU A;  1UOC A;  2P5O A;  3NBP A;  3MAQ A;  1Q9X A;  3PUF A;  3C6U A;  5CZ2 A;  4B9N A;  3B6O A;  3PY8 A;  3M8S A;  4CEF A;  1QHT A;  4FZZ A;  4IFV A;  5CYM A;  1SV5 A;  1S1X A;  2E6M A;  3DRS A;  5KI6 A;  3QIO A;  3LDS A;  4Z0U A;  3ISN C;  4HVJ A;  4CJU A;  1LV5 A;  1G15 A;  3VQ4 A;  2P51 A;  4DTX A;  3QES A;  2EHG A;  3WNG A;  1S5J A;  4EP5 A;  3I0R A;  4OVL A;  3V6D A;  5T7B A;  4CFB A;  3KKR A;  3ZSX A;  3V9X A;  4B9T A;  1BL3 A;  1NK5 A;  1J53 A;  2DFF A;  4CHP A;  3NH1 A;  1RT4 A;  1FXX A;  3AA4 A;  1BIU A;  2FBV A;  3DOL A;  3MEC A;  3G10 A;  3NHG A;  4FLW A;  3SQ0 A;  4KB1 A;  1VSH A;  3K59 A;  3SI6 A;  1RBR A;  3C95 A;  3ZSV A;  4DSI A;  2IOC A;  3NE6 A;  3V1O A;  3K58 A;  3ZT0 A;  2Z1G A;  5JS2 A;  4CJ5 A;  4CF0 A;  4LH4 A;  1K6Y A;  3VN5 A;  4JS5 A;  4ELT A;  2HHQ A;  2I5J A;  3CYM A;  3HP9 A;  3SZ2 A;  1QSS A;  3V1Q A;  4DTS A;  3RMD A;  2E4L A;  4KHU A;  1VRU A;  1TAQ A;  3V9S A;  4J2E A;  4DLG A;  5J2Q A;  1VK0 A;  1BQN A;  2HND A;  3AVN A;  1RDC A;  5FRO A;  3BGR A;  2YNH A;  1EP4 A;  1HJR A;  3LPT A;  3OYG A;  1I39 A;  4DG1 A;  1KCF A;  3HPH A;  4CGH A;  1UA0 A;  2YV0 X;  1NK9 A;  1HQU A;  3VQD A;  3V9W A;  4BWJ A;  2LSN A;  3ASM A;  3MEG A;  3KTQ A;  4DWI A;  1IKY A;  3K5O A;  2X74 A;  4HUE A;  2Z1I A;  2KFN A;  1WSI A;  4CK2 A;  1QE1 A;  3JYT A;  4FJX A;  4OKE A;  3NF6 A;  2JGU A;  4B8C A;  4Y1C A;  1LWE A;  3AO3 A;  3SUO A;  1WSE A;  4CJ4 A;  1RT6 A;  3ZSQ A;  4H4O A;  3WNF A;  1RIL A;  4I9L A;  2YHA A;  3DOK A;  4DFJ A;  2XY5 A;  1ZBL A;  3V81 A;  3U3G A;  4DTP A;  1LAW A;  4OGE A;  4DF4 A;  4F3O A;  4E0D A;  3EY1 A;  4AIL C;  1BI4 B;  1RTJ A;  1JLG A;  1RBS A;  2D0A A;  4CJ3 A;  3SQ4 A;  1S1T A;  4QOZ B;  4H4M A;  1QSY A;  4M3Z A;  2A1S A;  2G8W A;  3LP1 A;  1VSE A;  3TAF A;  1NKC A;  1EET A;  4W5T A;  3S3O A;  4DTJ A;  3IS9 A;  4EP4 A;  1JLC A;  3SPY A;  1Q9Y A;  1NK6 A;  3TR8 A;  2IDO A;  4KRE A;  4KRF A;  5D3G A;  3VQB A;  1U04 A;  4B08 A;  3WNH A;  2QK9 A;  4OLA A;  5FDL A;  3NGY A;  1XC9 A;  4CFA A;  2OZS A;  3QET A;  2WON A;  3O3G A;  4O5B A;  1W9H A;  1RT3 A;  4J2D A;  2G8F A;  4LY7 A;  3AVB A;  4CJV A;  1JLQ A;  1TK0 A;  3L2U A;  1ZBF A;  1NJX A;  1EX4 A;  2FC0 A;  4FCY A;  2ZE2 A;  5HRO A;  4E7I A;  1EXQ A;  1XHZ A;  2B6A A;  4N76 A;  4E7J A;  4I2Q A;  4CGF A;  3LAL A;  2XHB A;  3A2F A;  3V9U A;  4CJE A;  4M45 A;  4F2R A;  3ZSZ A;  3VQ9 A;  2Z1H A;  2P5G A;  3TAG A;  2BDP A;  1TVR A;  3NF8 A;  1NKB A;  4B9S A;  3VQ6 A;  1HNV A;  4CJF A;  3DI6 A;  3D0P A;  1L3U A;  4J2A A;  2VWJ A;  3SUN A;  4M41 A;  1IO2 A;  3I8D A;  4CF2 A;  1NK8 A;  3L2R A;  1C1C A;  4Z4E A;  4M3T A;  3ZT1 A;  3TAN A;  2B4J A;  1LW2 A;  2HHS A;  3ZSR A;  2KQ2 A;  1VRT A;  2IC3 A;  1BHL A;  1S6P A;  3AVK A;  5DMR A;  4CEO A;  4IBN A;  1S9G A;  1YTA A;  3K5N A;  4NCG A;  1KVA A;  1HMV A;  1TK5 A;  3S3M A;  4CED A;  4E3S A;  4KTW A;  1T8E A;  4PY5 A;  2HVI A;  3HP6 A;  4BDP A;  2PZS A;  4BAC A;  3KD5 E;  4AHU A;  3L2W A;  2DTU A;  2OPS A;  3L3V A;  3NF7 A;  3C94 A;  1RCH A;  1QTM A;  2YNG A;  4F8R A;  1BQM A;  2KFZ A;  4FJ8 A;  1LWF A;  3AVJ A;  2RN2 A;  4JLH A;  3TAM A;  4CJR A;  2XY8 A;  4YNQ A;  3M8Q A;  3L2Q A;  4FJ5 A;  4B9L A;  4FJ7 A;  5C42 A;  2Y1I A;  3RMC A;  1KTQ A;  3MXI A;  4FW2 A;  4BE0 A;  3P5J A;  1U49 A;  3LPU A;  4EZ9 A;  4FW1 A;  4TSX A;  1SKW A;  3HST B;  2GV9 A;  1WAJ A;  4DTM A;  3L8B A;  3KLE A;  2ZD1 A;  3DLR A;  4E89 A;  2OYQ A;  4DU4 A;  3QEP A;  5FRM A;  3VQ8 A;  4CEZ A;  1A5V A;  4W5O A;  4B3O A;  3DLB A;  3QEV A;  4YFU A;  4B8A B;  4DF8 A;  4JRP A;  2G8V A;  4FJK A;  2X78 A;  3JSM A;  1L3S A;  4FJH A;  2G8H A;  1YTU A;  1JLB A;  3DRR A;  3LP2 A;  4HTU A;  3SYZ A;  2YNI A;  1CXQ A;  4CHZ A;  3PO5 A;  1ASW A;  4FJI A;  1UWB A;  1EKE A;  1JL1 A;  2P1J A;  2A1R A;  1TAU A;  3LAK A;  1BCO A;  3MEE A;  1S1V A;  2VWK A;  3DMJ A;  4DSE A;  3NF9 A;  4AHS A;  1JLA A;  3OYD A;  1GOA A;  3ITH A;  1JLF A;  4CK1 A;  4JRQ A;  1X9W A;  4J2B A;  3C6T A;  1L3T A;  3HVT A;  1X1P A;  4DS5 A;  3V4I A;  4CJW A;  1ZBH A;  4FLX A;  3UIQ A;  1KLN A;  4OPJ A;  4ELU A;  1C1A A;  2VG6 A;  4RW8 A;  2BE2 A;  3SV3 A;  2YHB A;  4FK2 A;  4DQP A;  1C0T A;  3TAB A;  3KLH A;  4OKJ A;  1O1W A;  1J5O A; 
#chains in the Genus database with same CATH topology
 2OPP A;  4LSL A;  2Q0U A;  3CD6 N;  4CGI A;  4KBO A;  1FK9 A;  4FLU A;  1R0A A;  3GL1 A;  4R5P A;  1QVG M;  1RDD A;  4BQL A;  4CF8 A;  2IVO A;  3D2E B;  3HVR A;  4B9U A;  4ILH A;  3AVF A;  2PYJ A;  1B9D A;  4JKF A;  1XI1 A;  3BP8 A;  2GWK A;  2YKN A;  2WFB A;  4FVM A;  4EFH A;  1NOY A;  4E7H A;  4BGA A;  3UKR B;  1IV0 A;  1U2V A;  3A5N C;  4BRA A;  4BVP A;  4BE2 A;  1HYZ A;  1TKT A;  1HYS A;  3CIP A;  1IG9 A;  3ULE B;  5LMU K;  1NKE A;  1NGH A;  2V51 B;  3NAE A;  3KLG A;  2BH1 A;  5JS1 A;  4CD1 A;  4DQQ A;  1RTI A;  4F4K A;  3QFP A;  5C25 A;  5CE3 A;  4JN4 A;  1KQS M;  4DFP A;  5HLF A;  3T1Y K;  1QHA A;  4CHO A;  4HUG A;  2RKI A;  3L6Q A;  4DSF A;  1NJY A;  3LDN A;  3AA2 A;  3QBX A;  4JAX A;  4KV8 A;  2Z1J A;  1N36 K;  4CZG A;  2A5X A;  2HNY A;  3IFR A;  4JHD B;  4CJQ A;  4BRC A;  4JKG A;  1QSL A;  1U4B A;  1X9S A;  2CGK A;  3SQ2 A;  2FSJ A;  3D2F A;  3OVN A;  1GLJ O;  3AVH A;  4IG0 A;  1WSJ A;  4NLC A;  4BRK A;  5ADX H;  3DAW A;  1CXU A;  3O9R A;  1U48 A;  2D1K A;  3QEI A;  1RFQ A;  4FJG A;  4A62 A;  1XHX A;  2DY4 A;  4HHT A;  2D0B A;  4U67 L;  2KZM A;  2O4G A;  2VG7 A;  1NOZ A;  1JCG A;  3FLC O;  1NGD A;  2G8U A;  3OYN A;  4KI4 A;  1ZBS A;  1F21 A;  4AH9 A;  2A41 A;  5IT9 O;  3HPG A;  3P4I A;  2X6S A;  2QM1 A;  5EXW A;  4DR2 K;  3EO3 A;  1KFS A;  1RGI A;  2ZGZ A;  3AVI A;  3NFA A;  5FPM A;  1IBL K;  1QZ5 A;  4JK9 A;  4AF1 A;  4PKG A;  1TL3 A;  1WAF A;  4AM6 A;  3OY9 A;  3T3F A;  3AAQ A;  3EE9 A;  5AQL A;  3RVC A;  2ZJQ L;  4DQI A;  1N5Y A;  3H1V X;  1EWR A;  4CFC A;  3SPZ A;  1V4T A;  4UY8 O;  1FKP A;  4FWR A;  4LD0 A;  5AQK A;  4I7F A;  1X3M A;  2VGM A;  1BOT O;  4YOV A;  4FZX C;  1RT2 A;  3VQP A;  3O4W A;  2F96 A;  3U9D A;  3ZYY X;  4GNI A;  1VQ6 N;  3U3Y A;  4CF1 A;  1XNQ K;  4CJL A;  1GOB A;  4BDY A;  4BGB A;  4FL9 A;  2Q0R A;  2NRX A;  3MXM A;  4KI6 A;  2F8T A;  1TGO A;  4PKI A;  3U6F A;  2EX3 A;  5C12 A;  2QWR A;  4FJ9 A;  4M3R A;  3SK3 A;  3OJS A;  2FLO A;  5E84 A;  4KH5 A;  4PKH A;  4H5W A;  4CIF A;  1TK8 A;  1C1B A;  3LP3 A;  1BGX T;  1TKD A;  3VES A;  1KVB A;  3I33 A;  4CE9 A;  3TAQ A;  4B9Q A;  3OS1 A;  2E88 A;  3SCX A;  4B3R K;  4JI5 K;  2OCE A;  1WLJ A;  2O8D B;  2YHY A;  4ID1 A;  3OYA A;  4Z4G A;  2HBK A;  3CFO A;  2RF2 A;  5JLH A;  2W42 A;  3N4P A;  3QER A;  2QKK A;  2HHW A;  1WSH A;  4QS9 A;  4JEP A;  1L3V A;  1HNZ K;  3QEW A;  4DMN A;  1N6Q A;  3ATU A;  4B3S K;  3AA5 X;  4RW7 A;  4BR2 A;  4IFY A;  1ZYQ A;  3FE1 A;  3TSU A;  2NZT A;  2HBM A;  2IAJ A;  4WFA L;  1BWF O;  3TI0 A;  4IZ9 A;  2GEM A;  4K0K K;  5C15 A;  1X9J A;  2KKZ A;  1Z05 A;  3P39 A;  3RR7 A;  2BGG A;  1EO1 A;  4JKE A;  4KTQ A;  1QQO A;  1XNR K;  3KLF A;  3EL2 A;  3EKS A;  4X65 K;  2HNZ A;  3WXJ A;  2KW4 A;  1WSG A;  5C24 A;  3TAR A;  1NBW A;  3HJF A;  3KK1 A;  1NK0 A;  3BF1 A;  4FLZ A;  3D7E O;  4DV0 K;  4NXN K;  3ZET B;  3KWG A;  3RMA A;  1Y64 A;  4N41 A;  3DLK A;  5IWA K;  3VOV A;  1WUA A;  4WQ5 A;  3IDH A;  1RDB A;  1J9A A;  1VQK N;  3ZEU B;  4O0I A;  3S9H A;  3VF6 A;  3KHY A;  4B9M A;  3L4I A;  1KLM A;  3O08 A;  1K8K B;  4AM7 A;  2NRV A;  4PHT X;  4PL7 A;  3TWH A;  4QS8 A;  4CGG A;  2YKM A;  4CGJ A;  4Z4F A;  1KFD A;  2HMP A;  4GMJ B;  5LMN K;  3VER A;  4C23 A;  4JKH A;  4A2B A;  5AQQ A;  4OLB A;  2P9I B;  2P9U A;  5GIO A;  2VQE K;  2QXF A;  4NCB A;  4IOX A;  5HL7 L;  2D0P A;  3HI0 A;  3PUF A;  1M1K O;  4B1Y B;  1DKG D;  2CH5 A;  4CEF A;  4FZZ A;  5CYM A;  5AQN A;  2E6M A;  4JNE A;  3QIO A;  1RDU A;  3C7N A;  4DQ8 A;  3H46 O;  1M90 O;  1G15 A;  2P51 A;  2AA4 A;  3QES A;  4B1V A;  3F9M A;  3CI5 A;  4B3T K;  3WT0 A;  3KKR A;  1T6C A;  2F9T A;  1BL3 A;  3K9J A;  3ID8 A;  3DOL A;  2O8C B;  2P9K A;  4FOE A;  1NMN A;  1HNW K;  3AY9 A;  2Z1G A;  5JS2 A;  4LH4 A;  3MWP A;  2I5J A;  3CYM A;  3RMD A;  1VRU A;  2QW9 A;  2A6A A;  3MN7 A;  3OBW A;  1RDC A;  2GUP A;  1EP4 A;  3OYG A;  1KCF A;  1DGK N;  1UA0 A;  1HQU A;  3VQD A;  3PIP L;  3V9W A;  2LSN A;  3KTQ A;  4DWI A;  1IKY A;  3VTI A;  1QE1 A;  4A5A A;  4OKE A;  5E26 A;  2P9P A;  3AO3 A;  3J80 O;  1WSE A;  5GIP A;  4BR9 A;  3A5M C;  3V81 A;  4OGE A;  4E0D A;  3EY1 A;  4OPH A;  1RTJ A;  2D0A A;  4CJ3 A;  4H4M A;  1QSY A;  4M3Z A;  2DPN A;  2Q31 A;  1VSE A;  1S22 A;  2YX6 A;  4W5T A;  5C2F A;  3M6G A;  1JLC A;  3SPY A;  1Q9Y A;  1NK6 A;  4KRE A;  4KRF A;  1IBK K;  4NXM K;  2QK9 A;  4OLA A;  4CFA A;  2WON A;  2HF3 A;  1NLV A;  1ZBF A;  1FJG K;  5AZI A;  1Q7Y O;  3CJ1 A;  4I6M B;  2QXL A;  4E7I A;  1XHZ A;  2HF4 A;  2B6A A;  5AQW A;  1N8R O;  4CGF A;  4FWK A;  3RSE B;  3QBW A;  2Z1H A;  3CCQ N;  3FZF A;  1EQY A;  3TAG A;  1ZXO A;  1GLF O;  1N34 K;  4CJF A;  3DI6 A;  1L3U A;  1NWK A;  3SUN A;  4CF2 A;  1NK8 A;  1C1C A;  4Z4E A;  3ZT1 A;  2HHS A;  3DXM A;  1ESV A;  4IBN A;  5EY4 A;  3K5N A;  4NCG A;  4CBU A;  1KVA A;  1D4X A;  3S3M A;  1T8E A;  4BDP A;  3KD5 E;  5AQT A;  3L2W A;  2DTU A;  2OPS A;  3NF7 A;  1QTM A;  3C94 A;  4GV6 A;  5FLX O;  4FJ8 A;  1H1V A;  5TKY A;  3I56 N;  4CJR A;  4YNQ A;  3CQY A;  3L2Q A;  3EEQ A;  4B9L A;  4FJ5 A;  4FJ7 A;  3MX2 A;  3J8A A;  2YJE A;  4EZ9 A;  4TSX A;  4O8U A;  3FFK B;  2O8B B;  1K73 O;  3FZH A;  1WAJ A;  4DTM A;  5FRM A;  1W97 L;  2P9N A;  3MDQ A;  1A5V A;  4W5O A;  2JWL A;  1ZC6 A;  4RWT A;  4B8A B;  1LOT B;  4FJK A;  1L3S A;  2G8H A;  1JLB A;  3SYZ A;  4HTU A;  3PO5 A;  4FJI A;  2A1R A;  1LCU A;  3MEE A;  1NJI O;  3LDQ A;  3NF9 A;  3ZX0 A;  4JKD A;  4J2B A;  1X1P A;  3G71 N;  3V4I A;  4CJW A;  2GEL A;  4FLX A;  4B1X B;  2I7P A;  4DR7 K;  4ELU A;  5FPD A;  1C1A A;  3LM2 A;  1HNX K;  4DQP A;  2E8A A;  4KHS A;  5CR4 A;  4LH5 A;  4OJR A;  3OA9 A;  4E1M A;  4FJM A;  4QCL A;  3SJH A;  1BIZ A;  2B5J A;  3SJJ A;  3D45 A;  2FF6 A;  1KXP A;  3UB5 A;  4CJS A;  4CGD A;  2E2Q A;  1C6V A;  4E7K A;  2ITG A;  2E2O A;  5HP1 A;  2ZJR L;  1HQE A;  3BZC A;  1SZ2 A;  3OYI A;  4DV1 K;  3VEW A;  5CYQ A;  4CW7 B;  1C0F A;  3M3Z A;  4YHH K;  1QVF M;  4CIE A;  3QNO A;  4RG8 A;  4UQG A;  1D9D A;  3RRG A;  1IKV A;  3M1F A;  3R6M A;  3SQ1 A;  4WFN L;  5I9E B;  3VF4 A;  5AQM A;  3MXJ A;  2HHQ A;  4DV5 K;  1YI2 N;  4OPA A;  3HPO A;  2O8F A;  4FWS A;  1MDU B;  4DCH A;  4WYB A;  4Q5V A;  3OYF A;  1BIS A;  1Z25 A;  2NNW A;  4I9Q A;  3LAM A;  1VQ9 N;  3CG7 A;  5AJ3 K;  4CZK A;  2ZQB A;  3MN6 A;  4AHR A;  1SL0 A;  1U47 A;  4N5S A;  1MWM A;  3EZW A;  2WTU A;  5AQO A;  3G6E N;  5EU7 A;  2RPI A;  2FSK A;  3JXU A;  4Z4C A;  1I3A A;  1YIJ N;  2G8K A;  3R3L A;  3KK3 A;  4FWP A;  1UA1 A;  2I7N A;  4Z4I A;  1YJN N;  2WC9 A;  2E2P A;  4ELV A;  3OYE A;  1T6D A;  3K0S A;  3MMV A;  2V7Y A;  1SS6 A;  1I94 K;  4PWD A;  4JK7 A;  4W5R A;  4DB3 A;  5I42 A;  1WN7 A;  4DTO A;  3UKU B;  2D5R A;  2GBZ A;  3AVG A;  1KAZ A;  3VQA A;  2XO7 A;  3MED A;  4AHT A;  2D0C A;  4MLH A;  3SV4 A;  4DQS A;  4DUY K;  2PYL A;  3IUC A;  4K8X A;  4PA1 A;  1BUP A;  1HRH A;  2VWB A;  4EZ6 A;  3CQX A;  3F9K A;  4ZTF A;  1NK7 A;  4WFB L;  5H1S Q;  5J2P A;  4H0V B;  4IO9 L;  4B9V A;  1T05 A;  1IH7 A;  4MDB A;  3A0I X;  3RTV A;  2ZM6 K;  1ATN A;  5BRD A;  2R7Y A;  3VQE A;  4WQ5 C;  3CCS N;  3OHR A;  4N47 A;  5M1F A;  4LFA K;  2P9L B;  1UAX A;  5HRN A;  2HW3 A;  3KK2 A;  1VHX A;  5JLF A;  5LJV A;  4CEQ A;  5GAD P;  5EVZ A;  1OH8 A;  1GOC A;  3PV8 A;  4H0P A;  4JI2 K;  2E1Z A;  3HXM A;  4CCH A;  2O8E B;  5CZ1 A;  4DS4 A;  3CME N;  3BUZ B;  3DLH A;  5B8H A;  3K2P A;  3VEN A;  4PUO A;  2O4I A;  4N56 A;  1N33 K;  4H8K A;  1HKG A;  4W5Q A;  1D9F A;  4XIU A;  3GE1 A;  2IS3 A;  4CEB A;  4CJP A;  1OH7 A;  4L3Q A;  3CM5 A;  3AV9 A;  3H08 A;  2GUI A;  4CEC A;  3OS0 A;  3ZCM A;  4DTN A;  1VQN N;  3THX B;  4G1Q A;  3S41 A;  5AZJ A;  3ALY A;  3CJB A;  1U45 A;  3AVA A;  3WNE A;  2PBD A;  4DFM A;  3VA3 A;  3E01 A;  3AVL A;  4WE1 A;  4A5B A;  2KTQ A;  3O3H A;  3VGK A;  3TTC A;  1KVC A;  4DTR A;  2KZZ A;  3WEE B;  2E2N A;  5KQ8 A;  1E4F T;  1VSD A;  5AQG A;  4M42 A;  1NGC A;  3CJC A;  4BC3 A;  2FBY A;  3I0S A;  3AO5 A;  1KRP A;  4CK3 A;  5K14 A;  3P83 D;  5BN8 A;  4JV5 K;  4E19 A;  1SL1 A;  1CLQ A;  4BC2 A;  4Y1D A;  2HHV A;  4CBW A;  4BG9 A;  3OYL A;  1HR0 K;  4BRO A;  4DR4 K;  3THY B;  4YOY A;  4F2S A;  1JXE A;  2F7T A;  1XC3 A;  1CZB A;  4YOW A;  4CF9 A;  3G25 A;  1DEJ A;  1HLU A;  3AO1 A;  1TUU A;  2E20 A;  1BU6 O;  3RMB A;  4IWV A;  3CCU N;  2Y1J A;  4M3Y A;  1OH6 A;  3VGL A;  5BPN A;  3CET A;  1J54 A;  4ICL A;  4CJT A;  4CI6 A;  3AA3 A;  1QZ6 A;  1T7P A;  1DTQ A;  3ZT2 A;  1LW0 A;  3DRP A;  3V9Z A;  2UXD K;  5KGX A;  1YHQ N;  4IO8 A;  4C8M A;  3DLG A;  4BRE A;  4M3W A;  2UXB K;  3LWL A;  4NB4 A;  3T69 A;  4W5N A;  1RT5 A;  4FLY A;  4HUF A;  2DFH A;  1YUW A;  3B6P A;  4V19 S;  5AQJ A;  2P5O A;  2W6K A;  4JD2 B;  3MAQ A;  4JI0 K;  1Q9X A;  4B9N A;  4BRL A;  4IFV A;  1SV5 A;  3LDS A;  4Z0U A;  3VET A;  4HVJ A;  4CJU A;  4DTX A;  3DXK B;  3V6D A;  3I0R A;  3WQU A;  4LFB K;  3ZSX A;  5M1O A;  3V9X A;  1NK5 A;  1J53 A;  4CHP A;  5BRH A;  3MEC A;  1FXX A;  3NHG A;  2CGJ A;  3G10 A;  3LDP A;  4FLW A;  1RBR A;  4X62 K;  2IOC A;  4ISF A;  3NE6 A;  3ZT0 A;  4JS5 A;  2H3G X;  4K41 A;  5GAE P;  5DM6 L;  1GLB G;  4AQY K;  5J2Q A;  3NVM A;  3AVN A;  5FRO A;  5HOO A;  3BGR A;  3F5T A;  1HJR A;  1I39 A;  4DG1 A;  1YAG A;  1IJJ A;  4CGH A;  3T7Z A;  2YV0 X;  3E9L A;  3MEG A;  3CC2 N;  4CK2 A;  4NLB A;  1QQM A;  4DV4 K;  2CH6 A;  3SUO A;  3QB0 A;  4PL8 A;  4H4O A;  2YHA A;  4DFJ A;  4G9Z A;  3KZB A;  3U8X A;  4CZM A;  3CXC M;  4F3O A;  4AIL C;  2NRZ A;  3CER A;  1S1T A;  3S3O A;  2FSN A;  4M7Y A;  3R1X A;  3TR8 A;  2A42 A;  2NRW A;  5CHI A;  1XC9 A;  2OZS A;  3AGK A;  4O5B A;  1W9H A;  1U6Z A;  3THW A;  4CJV A;  1TK0 A;  1U2V B;  2FC0 A;  3ZX3 A;  4FCY A;  3E1Y A;  2ZE2 A;  3JAM O;  3SAG A;  4M45 A;  3IKM A;  2P5G A;  1Z6R A;  3NF8 A;  3D0P A;  2VWJ A;  4M41 A;  4O8K A;  3TAN A;  3ZSR A;  2IC3 A;  5JIC A;  1BHL A;  1TYQ A;  4CEO A;  3C6H A;  2QTD A;  1TK5 A;  4E3S A;  4MLE A;  1YF5 L;  4CZI A;  5MLC Q;  4JKG B;  3HM8 A;  4IEE A;  4AHU A;  3L3V A;  1RCH A;  2YNG A;  4F8R A;  3NMU A;  3D2F B;  2KFZ A;  4DV7 K;  3O9U A;  2XY8 A;  3M8Q A;  5A2Q O;  3L0Q A;  4FW2 A;  1U49 A;  1SKW A;  4X66 K;  3L8B A;  2ZD1 A;  4FWM A;  1ILY A;  4H5V A;  4DU4 A;  3QEP A;  2YHX A;  4CEZ A;  2E5L K;  1KD1 O;  5BR8 K;  2IIR A;  3O1B A;  5BR9 A;  1Q86 O;  4DF8 A;  2G8V A;  3AAP A;  3VEO A;  4IOA L;  3JSM A;  4FJH A;  4BC4 A;  2JWK A;  4CHZ A;  3ZLJ A;  3VMF B;  1ASW A;  5AR0 A;  4FVU A;  2ITM A;  1JL1 A;  2P1J A;  4K25 A;  1TAU A;  5FPN A;  3LAK A;  4CVN E;  2Q97 A;  3VF2 A;  4JRQ A;  1JLF A;  4DS5 A;  3J7Y P;  3UIQ A;  2QI2 A;  4KH6 A;  2YHB A;  4FK2 A;  3H45 C;  2FXU A;  4RCH A;  3KLH A;  4OKJ A;  1T03 A;  3PSF A;  2PY5 A;  4IKF A;  1BI4 A;  4O5F A;  1VQ4 N;  2BAN A;  1HPZ A;  1NG9 A;  1OVQ A;  1REV A;  5JVG L;  4H5R A;  4KHQ A;  1T44 A;  3L2V A;  4CZL A;  4FOI A;  5BPM A;  4CEE A;  4FM0 A;  1CZ9 A;  2YCH A;  4FZY A;  4FPB A;  1K8A O;  1HNI A;  3IG1 A;  4QAG A;  3RRH A;  3EYZ A;  3CCM N;  1L5U A;  3K5L A;  1SKS A;  3O9S A;  4KTZ A;  1VSJ A;  1FKO A;  1XWL A;  4KPY A;  5AFU H;  5J2M A;  1VSI A;  3B8A X;  4KAZ A;  2F4V K;  3SUP A;  4C8N A;  4CZE A;  4E1J A;  3K57 A;  3L3U A;  3Q7C A;  2ASO A;  4EHT A;  4CJK A;  4HCB A;  4NCA A;  2HVH A;  3QLH A;  2UXC K;  3OJU A;  1NJZ A;  4FPA A;  3SUQ A;  3CPE A;  1ZBU A;  1MWK A;  4C8K A;  3M5R A;  3NH2 A;  4E1N A;  3DWL A;  4XH4 A;  4GVE A;  1VQM N;  2OAN A;  2UYT A;  2ATQ A;  4JKA A;  4H5T A;  4FWQ A;  3ENH A;  3FR0 A;  4FLV A;  3HOT A;  2VGN A;  4JS4 A;  3KJV A;  2OPR A;  4RW9 A;  4Q0B A;  3EE8 A;  4Z4H A;  4R79 A;  3O80 A;  4LSN A;  2F9W A;  5ELZ A;  4IXC A;  3MK6 A;  3QO9 A;  4J8F A;  2OPQ A;  1XUP O;  1NNE A;  2QWL A;  1RTD A;  2JLE A;  3QIN A;  1VQ5 N;  4AHV A;  4BR7 A;  4O4G A;  4BRF A;  3VA0 A;  2UUC K;  3O4Q A;  1IKX A;  4FK4 A;  2HHT A;  2P9S A;  1WSF A;  1Q82 O;  5HRS A;  5HBM A;  2QWQ A;  4DU1 A;  1HKC A;  4MDA A;  4M3X A;  4DHY A;  4RW4 A;  4YDU C;  4FYD A;  3DLE A;  3OYM A;  1JLE A;  1B92 A;  3NCI A;  2V7Z A;  5KTQ A;  4DSL A;  5EOY A;  3FZL A;  4KO0 A;  4DQR A;  3LP0 A;  5ADX A;  4DV3 K;  3TTD A;  2YJF A;  4C8O A;  1BCM A;  2KLA A;  4CIG A;  4L8R B;  3NGI A;  4KFB A;  3CF5 L;  4RTF D;  2HMI A;  4C1N K;  3PX0 A;  4OPK A;  4BWM A;  1LAV A;  3ATV A;  2P9U B;  2Q1N A;  5AQV A;  4ISG A;  3IAY A;  2HHX A;  2DFE A;  3SMS A;  2ETJ A;  2QWP A;  1ASV A;  3DM2 A;  1RDW X;  3KIO A;  4CHY A;  2HHU A;  1A5W A;  3O3F A;  3VPZ A;  3VQQ A;  3HOS A;  5LJW A;  3D2E A;  1TUY A;  3C7N B;  1DT9 A;  2Q3S A;  1KSP A;  1SUQ A;  5JMV A;  3UKR A;  5J1E A;  3LWM A;  3FZM A;  4KB0 A;  3ULE A;  5C10 A;  4QS7 A;  1TKZ A;  3LZJ A;  5AQX A;  2P9K B;  3C65 A;  3C0B A;  3NGZ A;  4O44 A;  4DFK A;  1E3M A;  3BY5 A;  4CD3 A;  3OS2 A;  3CCL N;  3F73 A;  4I2P A;  1TKX A;  4AHC A;  3R8E A;  3SNN A;  3CFR A;  3WXK A;  1VQ7 N;  4IDH A;  3HT3 A;  4DR5 K;  1RDA A;  2OTL N;  4JHD A;  2ASP A;  4GV3 A;  4KKO A;  2P9P B;  1HKB A;  1DTT A;  3QFU A;  3QML A;  1VSL A;  1ASU A;  5M1Q A;  3T1H K;  1YT3 A;  4OKK A;  3QNN A;  4MFB A;  3PX6 A;  5AQF A;  4IOC L;  1BA1 A;  3AO4 A;  1B9F A;  2F8S A;  3SMP A;  3J7Z O;  3OYB A;  1XMQ K;  1RBU A;  2PAV A;  1S1U A;  3M8P A;  3TAE A;  3TAP A;  3BDP A;  4WQ4 A;  4IG3 A;  1ATR A;  5M1P A;  4O0J A;  4U7B A;  1XQS C;  4H0T B;  4ID5 A;  3SBT A;  1XMO K;  3MWT A;  1YXQ A;  2VQF K;  4LF4 K;  3CJA A;  3RR8 A;  1JKH A;  5JVH L;  3L4Q A;  5AZI B;  3G4S N;  2W41 A;  4F3T A;  3QIP A;  5KRS A;  2X6N A;  3AVM A;  4DKW A;  2ASM A;  1JL2 A;  2FBT A;  3MX5 A;  3CMA N;  3VGM A;  2AJQ A;  3A8Y A;  3I55 N;  1GLA G;  2YNF A;  5AQU A;  4DR6 K;  5GIN A;  3VQC A;  2ZJP L;  4BVO A;  5KPZ A;  4FK0 A;  2E6L A;  3VTH A;  2PFU A;  3DXM B;  2NRR A;  3HSC A;  4FM1 A;  1ZBI A;  4PQU A;  1Z26 A;  3PX4 A;  2YI1 A;  1S1W A;  2HBJ A;  2FF3 B;  4BRH A;  1Y97 A;  4H03 B;  1UOC A;  3RWU A;  3NBP A;  3VEZ A;  5AQI A;  1Q18 A;  5CZ2 A;  3U9Z A;  3B6O A;  3PY8 A;  1QHT A;  5KI6 A;  1GLL O;  4WF9 L;  4K42 A;  3ISN C;  4H5N A;  1LV5 A;  3O5B A;  2EHG A;  4EP5 A;  4OVL A;  5T7B A;  3NH1 A;  1NGF A;  3AA4 A;  1BIU A;  4KB1 A;  3SQ0 A;  3K59 A;  2P9N B;  4KH4 A;  1N32 K;  3K58 A;  2HHH K;  4CZJ A;  3VN5 A;  1MA9 B;  2W6L A;  1QSS A;  4KHU A;  2O8D A;  2E4L A;  1TAQ A;  3V9S A;  4J2E A;  4DLG A;  3JS6 A;  2YNH A;  2UU9 K;  3TU5 A;  2IVP A;  1NK9 A;  4BWJ A;  3WQT A;  1P8Z A;  4BY9 C;  4HUE A;  1ATS A;  1WSI A;  4FJX A;  5C0Y A;  3NF6 A;  2JGU A;  1YIT N;  4B8C A;  5AQP A;  3ZSQ A;  3WNF A;  4I9L A;  3DOK A;  3U4L A;  2XY5 A;  3U3G A;  4DTP A;  4BRD A;  1LAW A;  3HBT A;  4DF4 A;  1JLG A;  1RBS A;  4B1U B;  4QOZ B;  2VYP A;  3SQ4 A;  3SAH A;  1KAY A;  2A1S A;  2G8W A;  3LP1 A;  3TAF A;  1EET A;  4BC5 A;  3TSQ A;  4DTJ A;  4A59 A;  5FPE A;  4Z94 A;  3EKU A;  5D3G A;  3VQB A;  1U04 A;  4B08 A;  2ZF5 O;  3NGY A;  3O3G A;  3DLL L;  5C2D A;  4YDU A;  4LY7 A;  3AVB A;  4IJA A;  1JLQ A;  3ZET A;  3L2U A;  1NJX A;  1R59 O;  1EX4 A;  4ILG B;  1VQO N;  3TSP A;  2CGL A;  5EX5 A;  5HRO A;  1VQP N;  1EXQ A;  2NRH A;  4N76 A;  3LAL A;  3CCV N;  3V9U A;  1NGG A;  2EWS A;  3CCR N;  2BDP A;  1TVR A;  1NKB A;  3ZEU A;  4J2A A;  3FGU A;  1IO2 A;  3O6W A;  2O8F B;  3L2R A;  4BQZ A;  4HWI A;  4YOR A;  1K8K A;  2B4J A;  2KQ2 A;  5DMR A;  1YTA A;  2P9I A;  4LFC K;  4ISE A;  5AFU A;  4C1N I;  2AP1 A;  4BAC A;  3H3O B;  1BQM A;  1KC8 O;  5F2R A;  3A5O C;  1LWF A;  3IMX A;  1VQ8 N;  4B3M K;  3TAM A;  3RMC A;  4BRI A;  4FW1 A;  3O8M A;  5AQS A;  4DR3 K;  1HX1 A;  1QQN A;  3KLE A;  3DLR A;  4E89 A;  2O8C A;  3CCJ N;  4LF5 K;  3ENB A;  1GLE G;  3HRG A;  4B3O A;  3DLB A;  3TPQ A;  3QEV A;  5F0X A;  3OW2 M;  1YTU A;  4WCE L;  3Q7B A;  3DRR A;  1NGA A;  3ID6 A;  2YNI A;  1CXQ A;  1S72 N;  1WB9 A;  1G99 A;  1BCO A;  4CZF A;  1X9W A;  4CK1 A;  3LL3 A;  3C6T A;  3CC4 N;  4JKB A;  3HVT A;  4XH5 A;  3WUH A;  3GG4 A;  1Q81 O;  4JYA K;  4BRN A;  3OTO K;  4OPJ A;  2VG6 A;  3VEV A;  1NMD A;  4EHU A;  2BE2 A;  3SV3 A;  3CPW M;  2QA4 N;  1C0T A;  3ENO A;  3TAB A;  1J5O A;  1VSK A;  3ZT4 A;  3NH0 A;  2OA8 A;  4E7L A;  3D6R A;  3ZX2 A;  1E4G T;  5DM7 L;  2HB5 A;  1K9M O;  1Q8I A;  3A5L C;  4KHW A;  2G8I A;  1LWC A;  3ZT3 A;  3LDO A;  5AQY A;  4NYF A;  4YOU A;  2A40 A;  3KK7 A;  5E41 A;  4GY2 B;  3H6E A;  3GOI A;  4I6M A;  5AQR A;  2WOM A;  4JI7 K;  3HK2 A;  3DYA A;  4H0Y B;  4F9O A;  3KD1 E;  3PO4 A;  4O55 A;  3RSE A;  4KHY A;  2XY6 A;  1NGI A;  4H0X B;  4BG8 A;  1RTH A;  3BZK A;  3O9Q A;  1A5X A;  4IDK A;  4M7X A;  4DSK A;  1S6Q A;  1X9M A;  1SL2 A;  3G0Z A;  4CEA A;  1EWQ A;  2QWN A;  1OKJ A;  5AZJ B;  2E1Y A;  3OYH A;  2XRI A;  3BEX A;  2BTF A;  4HTL A;  3EN9 A;  1KAX A;  3SAF A;  1D5A A;  1C0M A;  5SWM A;  3QEX A;  1HUX A;  1VSM A;  1ITG A;  4JI4 K;  2IGI A;  4XH1 A;  4FXD A;  3VQ5 A;  2OZM A;  3AO2 A;  3CHW A;  2HOE A;  5DK5 A;  3HO1 A;  2O8B A;  4CES A;  5J2N A;  2J4R A;  5KPR A;  3HM9 A;  1NJW A;  4A2A A;  3WXL A;  1W7A A;  4BRQ A;  5GAG P;  1NGB A;  3ZSY A;  1IKW A;  2NLX A;  4LF6 K;  4MO4 A;  5SZT A;  1YJ9 N;  1T3V A;  1WNS A;  2A3Z A;  5KPT A;  4LF8 K;  4HCC A;  1YJW N;  3HL8 A;  2V52 B;  3P31 A;  3OYJ A;  5CY4 A;  5KQD A;  1W0H A;  4GW6 A;  2NUB A;  1RT7 A;  5HRR A;  3ZSO A;  2KHO A;  3AVC A;  2NRT A;  4FM2 A;  1SKR A;  4WQ4 C;  4BE1 A;  2GTD A;  3HZ6 A;  2XY7 A;  1NGE A;  4DU3 A;  5LL6 Z;  1D8Y A;  1VQL N;  1YVU A;  4K8Z A;  3PIO L;  3MN9 A;  1GLD G;  3CJ9 A;  4CFD A;  5FRN A;  4CHN A;  3J7A P;  2YHW A;  5KRT A;  3OYC A;  4JI3 K;  1W2B M;  1OVY A;  1RT1 A;  1VSF A;  1GLC G;  3S3N A;  3QDK A;  3QIC A;  4RW6 A;  2VCP A;  4XEI A;  5KGW A;  3HYF A;  3KKS A;  4MQ3 A;  4MO5 A;  4DLE A;  3CM6 A;  4X64 K;  3LAN A;  3P38 A;  4FLT A;  1IBM K;  4C8L A;  4IJN A;  1TV6 A;  2GWJ A;  3NDK A;  1JJ2 M;  3VEX A;  4KHN A;  1S9E A;  4KHP K;  2FBX A;  3VEY A;  3CFP A;  1TL1 A;  4M63 C;  3IRX A;  1YVN A;  3FZK A;  4LC9 B;  1IG8 A;  4H0O A;  4YOX A;  3F2K A;  1WBD A;  3CQ8 A;  3VQ7 A;  3O4N A;  3KVG A;  2Q2R A;  1BG3 A;  4DV2 K;  4FJN A;  4FJL A;  3GDQ A;  3OYK A;  4JI6 K;  2RE2 A;  3M8R A;  2VG5 A;  1O13 A;  5I3U A;  3HTV A;  1NGJ A;  3CJ7 A;  3W0L A;  3T1A A;  1BO5 O;  4BDZ A;  1RBT A;  4DTU A;  3CCE N;  1NK4 A;  4OGC A;  2IVN A;  3LM9 A;  4M3U A;  4DV6 K;  3ZSW A;  1V4S A;  4LF7 K;  3AAR A;  4BRP A;  1S3X A;  4FJJ A;  1MU2 A;  2D4W A;  3KLI A;  5BPL A;  3P1G A;  4ZTJ A;  4FO0 A;  3UE5 A;  3UKU A;  2D0O A;  1J5E K;  1SAZ A;  3THW B;  3THV A;  4CER A;  3EZ5 A;  4BR4 A;  1JXB A;  1DLO A;  1VAZ A;  4CBX A;  3FFI A;  5F1X A;  4ZHR A;  4GVM A;  3LZI A;  2WUS A;  1QS4 A;  1P90 A;  1QQC A;  1C0U A;  1RBV A;  3T19 A;  4B1Z A;  5BRF A;  3K5M A;  4NYN A;  3V1R A;  3ULD A;  1RNH A;  4CHQ A;  4ILJ A;  2GX9 A;  1TYQ B;  2QKB A;  5HRP A;  1HYV A;  4YY3 K;  1X3N A;  3TTF A;  3C6U A;  2P9L A;  4BRM A;  3M8S A;  3OBY A;  4LF9 K;  1S1X A;  3DRS A;  2QWO A;  3VQ4 A;  3O1W A;  3WNG A;  1S5J A;  1NM1 A;  3K9K A;  4CFB A;  5LY3 A;  4B9T A;  2UUB K;  2O8E A;  3CC7 N;  2DFF A;  1RT4 A;  3WXI A;  2FBV A;  1VSH A;  4FWO A;  3SBG A;  3SI6 A;  3C95 A;  4FSV A;  3ZSV A;  4DSI A;  5BRE A;  4JI8 K;  3V1O A;  4CJ5 A;  4CF0 A;  1K6Y A;  4ELT A;  3SZ2 A;  3HP9 A;  3V1Q A;  4DTS A;  3BF3 A;  4FWL A;  3W3D A;  1VK0 A;  1BQN A;  2HND A;  2WBN A;  4YOT A;  3GBT A;  3LPT A;  1JCF A;  3I8B A;  4EAH D;  3THX A;  3HPH A;  3ASM A;  3K5O A;  2X74 A;  4Y0W A;  2Z1I A;  2KFN A;  3JYT A;  4IFE A;  4A61 A;  4CZH A;  5M1N A;  4Y1C A;  1LWE A;  4CJ4 A;  1RT6 A;  3WEE A;  1RIL A;  1ZBL A;  3MCP A;  3MCA B;  1HPM A;  1BI4 B;  4EIA A;  1NKC A;  4GKK K;  3IS9 A;  4EP4 A;  1BDG A;  4GKJ K;  3AGR A;  4JI1 K;  3LDL A;  1HJO A;  4BR0 A;  4OO1 J;  5M1K A;  2IDO A;  1NU0 A;  5AQZ A;  3WNH A;  3THY A;  3H1Q A;  5FDL A;  4K43 A;  3QET A;  4J2D A;  1RT3 A;  5BN9 A;  2G8F A;  4FWN A;  3KWI A;  2UUA K;  5GAH P;  4JK8 A;  4E7J A;  4I2Q A;  2XHB A;  3A2F A;  4CJE A;  4F2R A;  3ZSZ A;  3VQ9 A;  2BUP A;  5TKW A;  2QWM A;  5AQH A;  4B9S A;  3VQ6 A;  1HNV A;  4B1W B;  3MN5 A;  3I8D A;  4M3T A;  1LW2 A;  1SQK A;  1VRT A;  1S6P A;  3AVK A;  4A57 A;  1WOQ A;  1S9G A;  1CZA N;  2OTJ N;  4BRG A;  1HMV A;  4PY5 A;  4CED A;  4KTW A;  2HVI A;  3HP6 A;  1WBB A;  2PZS A;  4JD2 A;  2W40 A;  4DR1 K;  4GV9 A;  1JCE A;  4IEI A;  2RHK A;  3E9O A;  2HST A;  3AVJ A;  2RN2 A;  3H3N O;  4JLH A;  1FW6 A;  5C42 A;  3PSI A;  3DXK A;  4NO7 A;  2Y1I A;  1KTQ A;  3MXI A;  4BE0 A;  3P5J A;  3PLA A;  1C0G A;  3LPU A;  3HST B;  2GV9 A;  3DJC A;  2OYQ A;  2ZWH A;  3C6A A;  3VQ8 A;  3R9P A;  3N4Q A;  3NVK A;  4YFU A;  2P9S B;  1BA0 A;  4JRP A;  2ZGY A;  2X78 A;  4CJ7 A;  3E66 A;  3LP2 A;  2Q36 A;  3WXM B;  4JKC A;  1UWB A;  3J81 O;  1EKE A;  2QEX N;  4OX9 K;  2HBL A;  3SLC A;  1S1V A;  2VWK A;  3DMJ A;  4DSE A;  4AHS A;  1JLA A;  3OYD A;  1GOA A;  3ITH A;  1L3T A;  1OH5 A;  1ZBH A;  3O9T A;  4BR5 A;  4DUZ K;  1KLN A;  3E9P A;  4RW8 A;  1J6Z A;  4DSJ A;  1O1W A; 
#chains in the Genus database with same CATH homology
 2OPP A;  1VSK A;  4LSL A;  1T03 A;  2PY5 A;  4IKF A;  1BI4 A;  4LH5 A;  4OJR A;  3ZT4 A;  4E1M A;  3NH0 A;  4CGI A;  4FJM A;  2BAN A;  4E7L A;  2OA8 A;  1HPZ A;  4QCL A;  1BIZ A;  2B5J A;  3SJJ A;  1FK9 A;  3D45 A;  1REV A;  4FLU A;  4KHQ A;  4CJS A;  4CGD A;  1R0A A;  1C6V A;  4E7K A;  3L2V A;  4R5P A;  1RDD A;  2HB5 A;  4CEE A;  4FM0 A;  1CZ9 A;  2ITG A;  4CF8 A;  3HVR A;  1Q8I A;  4B9U A;  4FZY A;  4KHW A;  3AVF A;  2G8I A;  5HP1 A;  1LWC A;  2PYJ A;  3ZT3 A;  1HQE A;  1HNI A;  1B9D A;  3OYI A;  1XI1 A;  3IG1 A;  2YKN A;  4FVM A;  1NOY A;  2HVH A;  5CYQ A;  4NYF A;  4QAG A;  4E7H A;  3RRH A;  3EYZ A;  4BE2 A;  1HYZ A;  1TKT A;  5E41 A;  3K5L A;  1L5U A;  1HYS A;  1SKS A;  1IG9 A;  4KTZ A;  4CIE A;  2WOM A;  3QNO A;  1NKE A;  3HK2 A;  1VSJ A;  3DYA A;  4RG8 A;  3NAE A;  1FKO A;  1XWL A;  4UQG A;  3KLG A;  3KD1 E;  3PO4 A;  4KPY A;  4O55 A;  1D9D A;  5J2M A;  3RRG A;  1VSI A;  5JS1 A;  4DQQ A;  4KAZ A;  1RTI A;  1IKV A;  4F4K A;  4KHY A;  2XY6 A;  3SUP A;  5C25 A;  4C8N A;  3SQ1 A;  3K57 A;  3L3U A;  4DFP A;  5HLF A;  1RTH A;  3MXJ A;  4CJK A;  4HCB A;  4NCA A;  1A5X A;  4IDK A;  3QLH A;  4CHO A;  3HPO A;  4HUG A;  3OJU A;  1NJZ A;  2RKI A;  4DSK A;  1S6Q A;  3SUQ A;  4DSF A;  1NJY A;  1ZBU A;  3AA2 A;  4Q5V A;  1X9M A;  4KV8 A;  3OYF A;  1SL2 A;  1BIS A;  3G0Z A;  4CEA A;  4E1N A;  3NH2 A;  2Z1J A;  4C8K A;  1Z25 A;  4I9Q A;  3LAM A;  2HNY A;  3OYH A;  3CG7 A;  2XRI A;  2ZQB A;  4CJQ A;  1D5A A;  2ATQ A;  1C0M A;  1QSL A;  5SWM A;  4AHR A;  1SL0 A;  3QEX A;  1U4B A;  1U47 A;  4FLV A;  4N5S A;  1VSM A;  1ITG A;  1X9S A;  2IGI A;  3SQ2 A;  3OVN A;  4FXD A;  3AVH A;  4IG0 A;  5EU7 A;  1WSJ A;  2OPR A;  3VQ5 A;  2RPI A;  3KJV A;  4JS4 A;  4RW9 A;  2OZM A;  4Q0B A;  3AO2 A;  1CXU A;  1U48 A;  3QEI A;  4Z4C A;  4Z4H A;  1I3A A;  4FJG A;  2G8K A;  1XHX A;  2DY4 A;  3KK3 A;  4HHT A;  1UA1 A;  2D0B A;  4LSN A;  5DK5 A;  3HO1 A;  2O4G A;  2KZM A;  4CES A;  2VG7 A;  5J2N A;  4Z4I A;  3QO9 A;  1NOZ A;  3HM9 A;  4ELV A;  2OPQ A;  3OYE A;  1NJW A;  2G8U A;  3OYN A;  4KI4 A;  1F21 A;  1RTD A;  2JLE A;  3QIN A;  4PWD A;  4AH9 A;  3ZSY A;  4W5R A;  4AHV A;  5I42 A;  1IKW A;  4O4G A;  3VA0 A;  4FK4 A;  1WN7 A;  1IKX A;  3O4Q A;  4DTO A;  3HPG A;  2HHT A;  5SZT A;  2X6S A;  1WSF A;  1WNS A;  5HRS A;  5HBM A;  2D5R A;  4HCC A;  3HL8 A;  4DU1 A;  2GBZ A;  3AVG A;  3VQA A;  3OYJ A;  2XO7 A;  5CY4 A;  4M3X A;  1W0H A;  3MED A;  4RW4 A;  3DLE A;  4AHT A;  1KFS A;  4GW6 A;  2NUB A;  1RT7 A;  2D0C A;  5HRR A;  3ZSO A;  3OYM A;  4DSJ A;  3AVC A;  3SV4 A;  4DQS A;  4FM2 A;  1SKR A;  1JLE A;  1B92 A;  4BE1 A;  3AVI A;  3NFA A;  3NCI A;  2PYL A;  4K8X A;  5KTQ A;  4DSL A;  4KO0 A;  4PA1 A;  4DQR A;  2XY7 A;  1HRH A;  1TL3 A;  3LP0 A;  4EZ6 A;  1WAF A;  3F9K A;  4ZTF A;  1NK7 A;  3OY9 A;  3T3F A;  5J2P A;  1BCM A;  4DU3 A;  4CIG A;  4C8O A;  4DQI A;  4L8R B;  1N5Y A;  4B9V A;  1D8Y A;  4K8Z A;  1T05 A;  1YVU A;  1IH7 A;  4KFB A;  3NGI A;  4CFC A;  3RTV A;  2HMI A;  4CFD A;  3SPZ A;  5FRN A;  4CHN A;  5KRT A;  3OYC A;  3PX0 A;  1FKP A;  4OPK A;  4LD0 A;  2R7Y A;  4BWM A;  4I7F A;  1LAV A;  3VQE A;  1RT1 A;  1VSF A;  3IAY A;  4FZX C;  2HHX A;  2DFE A;  1RT2 A;  3VQP A;  3S3N A;  2F96 A;  2ETJ A;  4RW6 A;  1ASV A;  3U3Y A;  3DM2 A;  4N47 A;  4CF1 A;  3KIO A;  4CHY A;  2HHU A;  4CJL A;  1A5W A;  1UAX A;  1GOB A;  3O3F A;  3VQQ A;  5HRN A;  2HW3 A;  4BDY A;  5KGW A;  3KK2 A;  3MXM A;  4KI6 A;  2F8T A;  1TGO A;  3HYF A;  3KKS A;  3U6F A;  4CEQ A;  2EX3 A;  2Q3S A;  1KSP A;  4MQ3 A;  4DLE A;  4FJ9 A;  1SUQ A;  1GOC A;  4M3R A;  3CM6 A;  3OJS A;  3PV8 A;  3LAN A;  5J1E A;  3LWM A;  3HXM A;  4CCH A;  5CZ1 A;  4KB0 A;  4DS4 A;  4FLT A;  4CIF A;  1TK8 A;  1TKZ A;  1C1B A;  3LP3 A;  1BGX T;  3LZJ A;  3NGZ A;  1TKD A;  3DLH A;  4C8L A;  3K2P A;  1KVB A;  4PUO A;  1TV6 A;  2O4I A;  4O44 A;  4N56 A;  3NDK A;  4CE9 A;  4DFK A;  3TAQ A;  4H8K A;  3OS1 A;  4W5Q A;  4KHN A;  3SCX A;  1D9F A;  4XIU A;  1S9E A;  1WLJ A;  2IS3 A;  3OS2 A;  2FBX A;  3F73 A;  4ID1 A;  4CEB A;  4I2P A;  4CJP A;  3OYA A;  1TL1 A;  3CFP A;  3IRX A;  4Z4G A;  3CM5 A;  1TKX A;  4AHC A;  3AV9 A;  3CFO A;  3SNN A;  2RF2 A;  3H08 A;  2GUI A;  4CEC A;  3OS0 A;  3ZCM A;  2W42 A;  3CFR A;  4DTN A;  3QER A;  2QKK A;  2HHW A;  1WSH A;  3HT3 A;  4G1Q A;  3CQ8 A;  3VQ7 A;  1L3V A;  1RDA A;  3O4N A;  3ALY A;  1U45 A;  3AVA A;  3WNE A;  4DFM A;  4FJN A;  3QEW A;  4DMN A;  3VA3 A;  4FJL A;  1N6Q A;  3OYK A;  3E01 A;  3M8R A;  3AA5 X;  4RW7 A;  3AVL A;  4KKO A;  2VG5 A;  4IFY A;  4WE1 A;  1ZYQ A;  2KTQ A;  5I3U A;  3O3H A;  1KVC A;  3T1A A;  1DTT A;  4BDZ A;  4DTR A;  1VSL A;  1ASU A;  2KZZ A;  2IAJ A;  1YT3 A;  1RBT A;  1VSD A;  4OKK A;  3QNN A;  4DTU A;  4M42 A;  3TI0 A;  4OGC A;  1NK4 A;  4MFB A;  3PX6 A;  2FBY A;  3AO4 A;  3I0S A;  1B9F A;  3AO5 A;  4CK3 A;  1KRP A;  4M3U A;  2F8S A;  5K14 A;  3OYB A;  3P83 D;  3ZSW A;  4E19 A;  1SL1 A;  1RBU A;  3RR7 A;  2BGG A;  1S1U A;  3M8P A;  3TAE A;  4FYD A;  1CLQ A;  3TAP A;  4KTQ A;  3KLF A;  3BDP A;  4Y1D A;  2HHV A;  4IG3 A;  4FJJ A;  1MU2 A;  2HNZ A;  4O0J A;  3OYL A;  3KLI A;  3P1G A;  2KW4 A;  1WSG A;  4ID5 A;  5C24 A;  3TAR A;  4F2S A;  1JXE A;  3HJF A;  1CZB A;  4ZTJ A;  3KK1 A;  1NK0 A;  4FLZ A;  4CF9 A;  3AO1 A;  3RR8 A;  3THV A;  4CER A;  3EZ5 A;  1JKH A;  1JXB A;  3RMA A;  1DLO A;  3FFI A;  3RMB A;  4F3T A;  3QIP A;  4ZHR A;  5KRS A;  2X6N A;  4N41 A;  3AVM A;  4GVM A;  3LZI A;  1QS4 A;  3DLK A;  1QQC A;  2Y1J A;  4KHS A;  1JL2 A;  4M3Y A;  1C0U A;  1RBV A;  2FBT A;  3T19 A;  1RDB A;  1J9A A;  4O0I A;  3K5M A;  2AJQ A;  4NYN A;  1J54 A;  4ICL A;  4CJT A;  2YNF A;  3S9H A;  3V1R A;  4B9M A;  3ULD A;  1KLM A;  3VQC A;  3AA3 A;  4FK0 A;  1T7P A;  1DTQ A;  1RNH A;  2E6L A;  3ZT2 A;  1LW0 A;  3DRP A;  3TWH A;  3V9Z A;  5KGX A;  4CGG A;  2YKM A;  4CGJ A;  4CHQ A;  1KFD A;  4GMJ B;  4Z4F A;  4C8M A;  3DLG A;  4FM1 A;  4M3W A;  1ZBI A;  3LWL A;  4OLB A;  2QKB A;  4PQU A;  4W5N A;  1RT5 A;  4FLY A;  5HRP A;  1Z26 A;  2DFH A;  1HYV A;  3B6P A;  4HUF A;  3PX4 A;  1S1W A;  2QXF A;  4NCB A;  1Y97 A;  3RWU A;  1UOC A;  2P5O A;  3NBP A;  3MAQ A;  1Q9X A;  3PUF A;  3C6U A;  5CZ2 A;  4B9N A;  3B6O A;  3PY8 A;  3M8S A;  4CEF A;  1QHT A;  4FZZ A;  4IFV A;  5CYM A;  1SV5 A;  1S1X A;  2E6M A;  3DRS A;  5KI6 A;  3QIO A;  3LDS A;  4Z0U A;  3ISN C;  4HVJ A;  4CJU A;  1LV5 A;  1G15 A;  3VQ4 A;  2P51 A;  4DTX A;  3QES A;  2EHG A;  3WNG A;  1S5J A;  4EP5 A;  3I0R A;  4OVL A;  3V6D A;  5T7B A;  4CFB A;  3KKR A;  3ZSX A;  3V9X A;  4B9T A;  1BL3 A;  1NK5 A;  1J53 A;  2DFF A;  4CHP A;  3NH1 A;  1RT4 A;  1FXX A;  3AA4 A;  1BIU A;  2FBV A;  3DOL A;  3MEC A;  3G10 A;  3NHG A;  4FLW A;  3SQ0 A;  4KB1 A;  1VSH A;  3K59 A;  3SI6 A;  1RBR A;  3C95 A;  3ZSV A;  4DSI A;  2IOC A;  3NE6 A;  3V1O A;  3K58 A;  3ZT0 A;  2Z1G A;  5JS2 A;  4CJ5 A;  4CF0 A;  4LH4 A;  1K6Y A;  3VN5 A;  4JS5 A;  4ELT A;  2HHQ A;  2I5J A;  3CYM A;  3HP9 A;  3SZ2 A;  1QSS A;  3V1Q A;  4DTS A;  3RMD A;  2E4L A;  4KHU A;  1VRU A;  1TAQ A;  3V9S A;  4J2E A;  4DLG A;  5J2Q A;  1VK0 A;  1BQN A;  2HND A;  3AVN A;  1RDC A;  5FRO A;  3BGR A;  2YNH A;  1EP4 A;  1HJR A;  3LPT A;  3OYG A;  1I39 A;  4DG1 A;  1KCF A;  3HPH A;  4CGH A;  1UA0 A;  2YV0 X;  1NK9 A;  1HQU A;  3VQD A;  3V9W A;  4BWJ A;  2LSN A;  3ASM A;  3MEG A;  3KTQ A;  4DWI A;  1IKY A;  3K5O A;  2X74 A;  4HUE A;  2Z1I A;  2KFN A;  1WSI A;  4CK2 A;  1QE1 A;  3JYT A;  4FJX A;  4OKE A;  3NF6 A;  2JGU A;  4B8C A;  4Y1C A;  1LWE A;  3AO3 A;  3SUO A;  1WSE A;  4CJ4 A;  1RT6 A;  3ZSQ A;  4H4O A;  3WNF A;  1RIL A;  4I9L A;  2YHA A;  3DOK A;  4DFJ A;  2XY5 A;  1ZBL A;  3V81 A;  3U3G A;  4DTP A;  1LAW A;  4OGE A;  4DF4 A;  4F3O A;  4E0D A;  3EY1 A;  4AIL C;  1BI4 B;  1RTJ A;  1JLG A;  1RBS A;  2D0A A;  4CJ3 A;  3SQ4 A;  1S1T A;  4QOZ B;  4H4M A;  1QSY A;  4M3Z A;  2A1S A;  2G8W A;  3LP1 A;  1VSE A;  3TAF A;  1NKC A;  1EET A;  4W5T A;  3S3O A;  4DTJ A;  3IS9 A;  4EP4 A;  1JLC A;  3SPY A;  1Q9Y A;  1NK6 A;  3TR8 A;  2IDO A;  4KRE A;  4KRF A;  5D3G A;  3VQB A;  1U04 A;  4B08 A;  3WNH A;  2QK9 A;  4OLA A;  5FDL A;  3NGY A;  1XC9 A;  4CFA A;  2OZS A;  3QET A;  2WON A;  3O3G A;  4O5B A;  1W9H A;  1RT3 A;  4J2D A;  2G8F A;  4LY7 A;  3AVB A;  4CJV A;  1JLQ A;  1TK0 A;  3L2U A;  1ZBF A;  1NJX A;  1EX4 A;  2FC0 A;  4FCY A;  2ZE2 A;  5HRO A;  4E7I A;  1EXQ A;  1XHZ A;  2B6A A;  4N76 A;  4E7J A;  4I2Q A;  4CGF A;  3LAL A;  2XHB A;  3A2F A;  3V9U A;  4CJE A;  4M45 A;  4F2R A;  3ZSZ A;  3VQ9 A;  2Z1H A;  2P5G A;  3TAG A;  2BDP A;  1TVR A;  3NF8 A;  1NKB A;  4B9S A;  3VQ6 A;  1HNV A;  4CJF A;  3DI6 A;  3D0P A;  1L3U A;  4J2A A;  2VWJ A;  3SUN A;  4M41 A;  1IO2 A;  3I8D A;  4CF2 A;  1NK8 A;  3L2R A;  1C1C A;  4Z4E A;  4M3T A;  3ZT1 A;  3TAN A;  2B4J A;  1LW2 A;  2HHS A;  3ZSR A;  2KQ2 A;  1VRT A;  2IC3 A;  1BHL A;  1S6P A;  3AVK A;  5DMR A;  4CEO A;  4IBN A;  1S9G A;  1YTA A;  3K5N A;  4NCG A;  1KVA A;  1HMV A;  1TK5 A;  3S3M A;  4CED A;  4E3S A;  4KTW A;  1T8E A;  4PY5 A;  2HVI A;  3HP6 A;  4BDP A;  2PZS A;  4BAC A;  3KD5 E;  4AHU A;  3L2W A;  2DTU A;  2OPS A;  3L3V A;  3NF7 A;  3C94 A;  1RCH A;  1QTM A;  2YNG A;  4F8R A;  1BQM A;  2KFZ A;  4FJ8 A;  1LWF A;  3AVJ A;  2RN2 A;  4JLH A;  3TAM A;  4CJR A;  2XY8 A;  4YNQ A;  3M8Q A;  3L2Q A;  4FJ5 A;  4B9L A;  4FJ7 A;  5C42 A;  2Y1I A;  3RMC A;  1KTQ A;  3MXI A;  4FW2 A;  4BE0 A;  3P5J A;  1U49 A;  3LPU A;  4EZ9 A;  4FW1 A;  4TSX A;  1SKW A;  3HST B;  2GV9 A;  1WAJ A;  4DTM A;  3L8B A;  3KLE A;  2ZD1 A;  3DLR A;  4E89 A;  2OYQ A;  4DU4 A;  3QEP A;  5FRM A;  3VQ8 A;  4CEZ A;  1A5V A;  4W5O A;  4B3O A;  3DLB A;  3QEV A;  4YFU A;  4B8A B;  4DF8 A;  4JRP A;  2G8V A;  4FJK A;  2X78 A;  3JSM A;  1L3S A;  4FJH A;  2G8H A;  1YTU A;  1JLB A;  3DRR A;  3LP2 A;  4HTU A;  3SYZ A;  2YNI A;  1CXQ A;  4CHZ A;  3PO5 A;  1ASW A;  4FJI A;  1UWB A;  1EKE A;  1JL1 A;  2P1J A;  2A1R A;  1TAU A;  3LAK A;  1BCO A;  3MEE A;  1S1V A;  2VWK A;  3DMJ A;  4DSE A;  3NF9 A;  4AHS A;  1JLA A;  3OYD A;  1GOA A;  3ITH A;  1JLF A;  4CK1 A;  4JRQ A;  1X9W A;  4J2B A;  3C6T A;  1L3T A;  3HVT A;  1X1P A;  4DS5 A;  3V4I A;  4CJW A;  1ZBH A;  4FLX A;  3UIQ A;  1KLN A;  4OPJ A;  4ELU A;  1C1A A;  2VG6 A;  4RW8 A;  2BE2 A;  3SV3 A;  2YHB A;  4FK2 A;  4DQP A;  1C0T A;  3TAB A;  3KLH A;  4OKJ A;  1O1W A;  1J5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...