4E1MA

Crystal structure of hiv-1 integrase with a non-catayltic site inhibitor
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
152
structure length
146
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSATVKAAWWAGIKQEFGIPNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords HIV-1 Integrase
publication title New Class of HIV-1 Integrase (IN) Inhibitors with a Dual Mode of Action.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 48
structure length 146
sequence length 152
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e1mA00
4W5QA 4JS5A 3T19A 1U4BA 1B9DA 1WLJA 4CFDA 4DF4A 1VK0A 1T03A 1W9HA 4ELUA 2HMIA 4FCYA 4RW6A 3D0PA 3K5OA 1S1WA 4HUFA 4B8AB 4CJRA 3C6UA 4FW1A 1VSHA 3SQ0A 1NKCA 1DTTA 4B9TA 4Q0BA 1SKSA 1BI4B 2GUIA 3K5MA 4C8LA 3DYAA 3V1RA 4BE0A 3K58A 4FZXC 4Z4IA 3EYZA 4NCAA 3AVJA 3QLHA 3LANA 3D45A 2XY5A 1BISA 5FROA 4N47A 4E3SA 4M3YA 3QIOA 2HHSA 4CF1A 4B3OA 3AVHA 1QHTA 4EP5A 3PV8A 2PY5A 2HVHA 3RWUA 4H8KA 1EETA 4I9LA 1D8YA 3AO4A 4JRPA 4M42A 3NAEA 1MU2A 1QSLA 5HBMA 2KZMA 3U3YA 3NGIA 5KTQA 3HP9A 2OPSA 3HP6A 1SUQA 3ZSQA 4QCLA 3HL8A 3CFPA 4K8XA 3OYNA 2HNDA 3OJUA 3CQ8A 1RT3A 3V9WA 1S1TA 3ZT3A 2HHXA 1UAXA 3PUFA 4KO0A 4XIUA 4DFMA 3S3OA 1ZBUA 4PA1A 3DI6A 4J2AA 3SQ4A 1C0UA 5CZ1A 4F3OA 1VRUA 3M8RA 2ZE2A 4FJKA 1RT2A 4O55A 4CHPA 4PUOA 4Z4HA 4CGFA 4OPKA 4HHTA 3OYGA 4DSFA 3RMBA 4C8KA 4FJIA 3L2QA 3H08A 3CFOA 4RW4A 4N56A 3MEEA 4DTNA 1RT5A 1RDAA 3JSMA 1NJZA 4CEQA 4DU1A 1ASWA 3V1OA 1VSMA 1TKDA 5KGWA 3DLHA 3NE6A 1JLBA 3V4IA 4CF2A 4I2QA 4DTRA 2HHUA 3CG7A 1R0AA 2OPPA 3OYDA 3NCIA 4Z4EA 4Y1DA 3K57A 4CJKA 3RR7A 2PZSA 3IRXA 3KK1A 1X9WA 4IFYA 3VQQA 1DLOA 3C6TA 1EXQA 3NGYA 5CZ2A 4F3TA 1RTHA 3LDSA 1G15A 4DTXA 1RT7A 3LAMA 1UOCA 4CF9A 2D0AA 2OZSA 1ASUA 3VQAA 4B8CA 4M3WA 4FZYA 2HVIA 3SYZA 5J2PA 1U49A 4GVMA 3VQ7A 2E6LA 4CJVA 1S1UA 2VWJA 1T05A 1EP4A 2ZQBA 3QEWA 4OKEA 1BIUA 3AO3A 2W42A 4FLUA 1Q9XA 1NK5A 1Q8IA 1GOCA 3OYEA 1WNSA 3OYIA 3DLEA 3L2WA 2G8VA 4KPYA 1Y97A 2YNGA 1ASVA 4DF8A 4CEAA 1XC9A 1IKXA 3KD1E 3MEGA 2KW4A 4KHWA 1BQMA 2YHAA 4DFJA 1RBTA 4FW2A 4IG3A 2Y1JA 3F9KA 1FKPA 1VSDA 4CJ5A 1U04A 3THVA 2OA8A 1VRTA 2NUBA 4E7JA 4KKOA 2BANA 1TKTA 2X6SA 1HNVA 3DOKA 3AV9A 4PY5A 5DK5A 4E19A 4B9MA 2OYQA 4W5TA 3OS1A 2EHGA 2X74A 3V9SA 3PO4A 3ZSZA 4CERA 4DQIA 2IAJA 4HCCA 2VG6A 4O0JA 4FZZA 4KHYA 1C0TA 3V9UA 4E7LA 1U47A 5HRPA 1S9GA 4ELVA 4I2PA 3VQ5A 4TSXA 1RBUA 2HHTA 1JLGA 4DS5A 3KLHA 5J2QA 3NF6A 4BE1A 5HRRA 4LY7A 1Q9YA 5DMRA 5JS1A 1RTIA 4E7KA 1TAQA 3DRRA 1ZBIA 4E89A 1NKEA 3C94A 4DSEA 2ITGA 4AHUA 4M3XA 4DSJA 1CXQA 3KLGA 2WONA 4DLEA 4DTOA 3CYMA 2F96A 3AVIA 2BE2A 3ISNC 1TK8A 1KRPA 3PX4A 4IKFA 3HYFA 4IBNA 4CK2A 2Z1HA 3AVFA 3KD5E 1GOBA 1VSEA 3DRSA 3WNFA 4DLGA 4CIFA 1IO2A 5I42A 1CLQA 4N5SA 1W0HA 2P1JA 3K5NA 5CYQA 4O44A 3VQ4A 5HLFA 1QE1A 3OYJA 1VSFA 1U45A 2IC3A 3O3GA 5C42A 1JLCA 1HMVA 2R7YA 4FLXA 2IS3A 3L3UA 4HUEA 1UA1A 2P5OA 2F8SA 4F4KA 3QNOA 2KFZA 1S1XA 4E1NA 3WNEA 2VG7A 4AHSA 3OJSA 3PX0A 1KFSA 3ZT2A 3SUPA 5EU7A 3ZCMA 1JL2A 1RNHA 4DQQA 5J2NA 4I9QA 3O4QA 4DSIA 4CJ4A 1RT6A 3NH2A 4FJMA 4L8RB 2IDOA 4OJRA 3SV4A 3S3NA 4AHTA 4FJNA 2YHBA 4HTUA 3MEDA 4ICLA 4CHZA 4FLTA 2G8IA 5J1EA 1NK7A 1RCHA 3AA3A 3DLRA 2Q3SA 2YKNA 3B6OA 3QETA 1X9SA 4M3TA 4CJUA 2B6AA 3SUNA 1IH7A 1RBVA 4C8NA 2IOCA 2D0CA 4GMJB 2FBYA 1BGXT 3OS2A 3AO1A 4EZ6A 4CK3A 1WAJA 4KREA 4F2SA 1RBRA 2E6MA 2RPIA 4CEDA 4N76A 5FRMA 2YNHA 3TAPA 3L2VA 1RDDA 4OVLA 4CHOA 3M8QA 3V81A 4ELTA 2Z1GA 4KFBA 4W5NA 3LPTA 1TKXA 3VA3A 3AVMA 1NK0A 2IGIA 1VSJA 4CJSA 1KTQA 3KK3A 1B9FA 3TI0A 2AJQA 1IKYA 3SQ1A 1LW2A 1S5JA 3NBPA 1BIZA 4F2RA 4CJTA 3TAGA 4EP4A 1YTAA 3TAEA 4HVJA 3I0SA 2B4JA 1FKOA 4CJQA 4KHQA 3T3FA 4YNQA 1D5AA 3AVKA 1XI1A 1CZ9A 1GOAA 1S6PA 4NYNA 4DG1A 3NGZA 3K59A 3VN5A 1KVAA 5K14A 3ULDA 4FJ5A 1BI4A 2LSNA 4CF8A 3OYAA 4CJFA 1NJXA 3QEPA 2YKMA 2EX3A 3TAFA 4PQUA 1TL1A 5J2MA 3O4NA 2ZD1A 3OYMA 3VA0A 1SL1A 4B08A 1NK6A 4WE1A 4ZHRA 3ZT1A 1A5WA 1NJYA 3RR8A 1HPZA 2DFHA 2XY8A 3OY9A 4HCBA 1JLEA 1JLFA 4LH5A 4BDPA 4NCGA 5T7BA 1HYSA 2KQ2A 4OKJA 2QK9A 3VQCA 1JXEA 1C1AA 4FM1A 4R5PA 2P5GA 2P51A 4OKKA 4YFUA 1FK9A 4FJLA 5SZTA 3BDPA 4DTSA 3L8BA 3O3HA 4UQGA 3HVRA 4I7FA 4C8MA 2OPRA 1UWBA 2HNYA 3RMDA 4DU3A 4BDZA 4KI4A 1TL3A 2OZMA 2HB5A 4DQRA 3LP3A 1I3AA 2G8FA 3SUQA 3LP2A 1TGOA 3ZSXA 4CGGA 1RTDA 1C1CA 1HYVA 3U3GA 2KZZA 3ZSYA 1WN7A 1KCFA 1XHXA 3B6PA 4LSLA 2YNFA 3OYFA 2QKKA 4FJGA 4KTQA 1REVA 2I5JA 2DFEA 1JLQA 3LZJA 3V9XA 1WSGA 4DSKA 3QEVA 1I39A 1BL3A 3NH0A 4GW6A 4C8OA 4PWDA 1VSKA 3RTVA 3PX6A 3TANA 4DQPA 3PY8A 4CJWA 2D0BA 3FFIA 3MXJA 4RW9A 4CFCA 3L2RA 3HXMA 3S9HA 2F8TA 1WSFA 4E7HA 2DY4A 2YV0X 3I8DA 3LP0A 3AVGA 1X1PA 3QEXA 2QKBA 2GBZA 2HHWA 4CGIA 1ITGA 1HQUA 4KV8A 4LH4A 4M41A 2X78A 2O4GA 1KSPA 3SNNA 1CXUA 3SCXA 2KTQA 2XO7A 1TK0A 1HQEA 5FRNA 1LWCA 3NF7A 3RRHA 1C0MA 3QERA 4FLWA 4O0IA 3DOLA 4Y1CA 4DTPA 1KLMA 3NFAA 3VQ6A 5D3GA 3AVLA 2WOMA 3LWMA 4DS4A 3M8PA 3KIOA 2DTUA 3CM6A 2RF2A 3MXMA 4KHNA 2JGUA 3VQ8A 3VQDA 4M3UA 3L3VA 2VG5A 3LAKA 3P83D 1SL0A 4NCBA 3RMCA 1A5XA 4DSLA 1N5YA 3AO5A 4CIGA 4FK4A 1QSSA 3TARA 2OPQA 3K2PA 1S1VA 5I3UA 4B9NA 4AHRA 1LAWA 3DM2A 3HPHA 4F8RA 2VWKA 4N41A 1ZYQA 3ZSOA 3SQ2A 1RT4A 1NJWA 4FJ9A 3MAQA 4ZTJA 1YTUA 1WSJA 5FDLA 1O1WA 1KLNA 4IFVA 4DTJA 3QO9A 5CY4A 4Z4CA 1YT3A 3HPGA 3K5LA 5KI6A 3T1AA 1BCOA 4LSNA 4BACA 3TAQA 4FYDA 2RN2A 2X6NA 2E4LA 4DWIA 2G8KA 4CCHA 3OS0A 4CEBA 4DQSA 1KFDA 4FXDA 4G1QA 3MXIA 3ZT4A 3U6FA 4FVMA 3TR8A 2YNIA 3TAMA 4FM2A 4FLVA 4KRFA 1JLAA 1TKZA 4BE2A 2B5JA 3E01A 1J9AA 3LP1A 4KI6A 3CM5A 4RG8A 1QSYA 1HJRA 3TABA 4CGHA 4CIEA 1JXBA 2RKIA 1NK9A 4JS4A 4KHSA 3HK2A 3M8SA 2Z1IA 4AHVA 3ZSRA 3TWHA 3ITHA 4DMNA 1LWFA 3QIPA 4MFBA 3HT3A 4DU4A 3I0RA 4DFKA 3QESA 1B92A 3QEIA 1EX4A 4O4GA 1D9DA 4B9SA 3UIQA 2HHVA 1L3SA 1XWLA 3VQBA 3NHGA 2DFFA 1EKEA 3CFRA 4FK2A 3QINA 1HYZA 1X9MA 1TK5A 3OYCA 5C24A 3ZSWA 3V1QA 4FJ7A 3VQEA 1KVCA 3AVCA 1RTJA 3AA2A 1Z25A 1IKVA 4CFAA 2GV9A 4CJEA 3AA4A 5HRSA 4JRQA 4KB1A 3OYHA 1HNIA 3KLEA 3AA5X 4BWMA 1L3VA 3PO5A 4Q5VA 1L3UA 4CE9A 1S6QA 4H4MA 2A1SA 2JLEA 4QAGA 2FBVA 4BWJA 3OYBA 3OYLA 4J2BA 4EZ9A 3DLGA 4FK0A 1RDCA 4FJXA 1JKHA 1U48A 4AHCA 4KB0A 3OVNA 4KHUA 4E1MA 4CJ3A 1QTMA 1RDBA 1C6VA 3AVNA 2BGGA 4W5RA 4Z4FA 2FBTA 3KKSA 4M3ZA 3C95A 3HPOA 1WSEA 1T7PA 1ZBLA 1RILA 4B9LA 3WNHA 3KLIA 1NOYA 3WNGA 2XY6A 3S3MA 1TVRA 4AH9A 1WSIA 4CHNA 3NF8A 1F21A 1LV5A 1NKBA 4M45A 1ZBHA 3DLKA 5HROA 3AVBA 1ZBFA 4J2DA 4CJPA 2XY7A 2ETJA 4RW7A 2HHQA 1Z26A 1RBSA 1VSIA 4HUGA 5CYMA 1QS4A 5E41A 3KJVA 1WAFA 5C25A 1SKWA 3LPUA 4B9VA 3HJFA 3VQ9A 3HSTB 2Z1JA 1XHZA 1LWEA 2KFNA 3AVAA 4OLAA 5HRNA 3KLFA 3EZ5A 3SUOA 1BQNA 2FBXA 4NYFA 2HNZA 3SZ2A 3ASMA 2PYJA 3ZT0A 3ZSVA 3L2UA 4DFPA 3HVTA 1S9EA 4ID1A 1J54A 4OGCA 4OPJA 4BDYA 3BGRA 3SV3A 4E7IA 3DLBA 4QOZB 2G8HA 2G8WA 1JL1A 1SV5A 3RRGA 4CFBA 1NOZA 1YVUA 5KRSA 2XHBA 3V9ZA 1J5OA 2QXFA 2O4IA 1A5VA 1BCMA 3P1GA 4ID5A 1TAUA 4OGEA 4CF0A 4OLBA 1IKWA 1RT1A 4M3RA 4KTZA 2FC0A 2XRIA 3F73A 1VSLA 1QQCA 2D5RA 1HRHA 4DTUA 4J2EA 3NDKA 1N6QA 3G10A 3HM9A 4CEOA 2Y1IA 3ALYA 4CEEA 4FM0A 1J53A 3HO1A 1DTQA 5JS2A 4W5OA 4FJJA 4DTMA 4O5BA 1K6YA 3IS9A 4CGJA 4CHYA 4KTWA 4RW8A 3KK2A 4CECA 3QNNA 1LW0A 1FXXA 1L3TA 1L5UA 3MECA 4FJ8A 3SI6A 4H4OA 1CZBA 2ATQA 4CJLA 3O3FA 3LWLA 3JYTA 4ZTFA 5KRTA 1NK4A 3KTQA 4KAZA 1KVBA 3V6DA 4IDKA 1LAVA 5HP1A 3SPZA 1UA0A 3LZIA 4B9UA 4CK1A 5KGXA 3DMJA 4FJHA 4CHQA 3KKRA 3NH1A 4FLZA 2PYLA 4E0DA 4FLYA 2BDPA 3A2FA 1IG9A 2HW3A 4MQ3A 3IAYA 4JLHA 3AO2A 4CEFA 3NF9A 3RMAA 1C1BA 2A1RA 4CGDA 1SL2A 1D9FA 2G8UA 4LD0A 3SPYA 3IG1A 1WSHA 4CEZA 3P5JA 1T8EA 4K8ZA 4Z0UA 3VQPA 3SJJA 4Z4GA 3DRPA 4CESA 3LALA 4AILC 4IG0A 1SKRA 3EY1A 1BHLA 1TV6A 5SWMA 3OYKA 1NK8A 3G0ZA
chains in the Genus database with same CATH superfamily
4JI0K 1U4BA 1P8ZA 2O8CB 1W9HA 2BTFA 4HUFA 1NKCA 1SKSA 3K5MA 4BG8A 3LANA 3D45A 2XY5A 4E3SA 3QIOA 2HHSA 3O08A 4B3OA 2HBJA 1E4GT 4H03B 4I9LA 1MU2A 5HBMA 1QQNA 3VF4A 3VF6A 2OPSA 4K8XA 3HM8A 2Q2RA 3P4IA 1UAXA 4KO0A 4XIUA 3S3OA 4PA1A 4DV3K 3DI6A 4WFBL 4J2AA 5CZ1A 4FJKA 1K8KA 4Z4HA 4H0TB 3OYGA 4DSFA 4FJIA 3L2QA 1MWKA 3H08A 4N56A 3MEEA 5GAHP 4DTNA 4L3QA 1RDAA 4K42A 3GBTA 3DLHA 3NE6A 4BQZA 3AY9A 1QQMA 3K9KA 4I2QA 1R0AA 2ASPA 3OYDA 3NCIA 4Y1DA 4CJKA 2PZSA 3CJAA 3IMXA 1EXQA 3NGYA 3MN7A 4F3TA 1RTHA 3LAMA 1HKBA 4LF9K 1UOCA 2D0AA 1X3MA 3VQAA 4M3WA 3ZEUA 3PSFA 4GVMA 4ISEA 3VQ7A 4WQ5A 2VWJA 4JI5K 3AO3A 4JKGA 4FLUA 4GV3A 2AA4A 1Q8IA 2P9SB 2G8VA 3OYIA 3DLEA 1KQSM 5AQWA 1ASVA 1XNRK 4CEAA 3AAPA 4EHUA 1BQMA 4FW2A 3THVA 1VSDA 1FKPA 4E7JA 1Q18A 3AV9A 4E19A 4B9MA 4PY5A 3U9ZA 3THXA 3OS1A 2EHGA 3V9SA 4KHYA 3CPWM 4CERA 4O0JA 1FJGK 3MN6A 1U47A 2AP1A 3VQ5A 4TSXA 3KLHA 4M63C 3SBTA 1N32K 4CD1A 3DRRA 4BRNA 3R8EA 3J7ZO 1HNXK 3RSEA 5FLXO 1HPMA 4X65K 2WONA 4LF7K 5LY3A 3CYMA 3AVIA 2BE2A 2FF6A 3F9MA 5KPRA 1KRPA 2OTJN 3HYFA 4CK2A 2Z1HA 1GOBA 4C1NK 1VSEA 5JLFA 1IO2A 5I42A 1CLQA 3DXKA 1W0HA 3CCMN 2P1JA 3C6AA 3VQ4A 4X66K 3D6RA 2A5XA 1QE1A 1VSFA 1U45A 5C42A 4HUEA 2KFZA 2D0OA 1RDWX 3WQUA 3OJSA 4AHSA 1NG9A 1BG3A 3ZT2A 3SUPA 1JL2A 5J2NA 5CHIA 4BGAA 3ZLJA 4CJ4A 2GWKA 3L6QA 3SV4A 4HTUA 4ICLA 4FLTA 1RCHA 3DLRA 4M3TA 2UXCK 1VQPN 2B6AA 1SAZA 2D0CA 4EAHD 1M1KO 3R6MA 2FBYA 4WYBA 4KREA 1RBRA 1KD1O 2E6MA 1OH5A 2O8DB 1GLBG 4N76A 3G4SN 4ISFA 2YNHA 3L2VA 1RDDA 3D2EB 4CHOA 3M8QA 3V81A 2Z1GA 4BRPA 3AVMA 5AJ3K 4JI6K 3L4IA 1ILYA 5ADXH 1LW2A 1BIZA 4BR2A 4F2RA 2KHOA 4EP4A 3C7NA 1NGHA 5JVHL 3T3FA 2F4VK 1GOAA 1IG8A 3NVKA 4NYNA 3SMPA 4DHYA 1BI4A 4K41A 2WTUA 4LC9B 1OH7A 3DXMB 4PQUA 3CCLN 1TL1A 1T6CA 4ZHRA 1HNZK 2P9IB 5AQKA 1HJOA 1HPZA 3SMSA 4KBOA 5TKWA 3DLLL 1JLEA 4LH5A 2CH5A 4NCGA 1JXEA 4FM1A 4YFUA 1FK9A 5HOOA 3BDPA 4DTSA 3L8BA 1YXQA 4C8MA 3CF5L 3RMDA 4KI4A 4JK7A 4DQRA 5B8HA 1RTDA 1HYVA 3U3GA 1WN7A 1NGFA 3OYFA 2D0PA 2QKKA 1IJJA 4JI4K 4KTQA 4BREA 1I39A 4BRCA 4GW6A 1ATRA 1VSKA 4IOAL 1ZXOA 2D0BA 3MXJA 3VTIA 1FW6A 3O9TA 3S9HA 2UUBK 3JS6A 3E9OA 1N33K 4JI2K 1GLCG 4DV4K 2QKBA 2RHKA 4H5WA 2GBZA 4CGIA 1ITGA 4JD2B 2O4GA 4FSVA 3ZETB 5H1SQ 3SNNA 4IFEA 2XO7A 2A41A 1LWCA 3NF7A 4KH6A 4CBUA 3FR0A 5AQVA 2I7PA 2JWKA 3EN9A 3NFAA 4JK8A 2ZJPL 4DS4A 4BROA 3M8PA 4DR5K 2RF2A 4KHNA 5BRDA 1GLFO 1EQYA 4Z94A 4JKAA 4H0OA 1LOTB 1D4XA 3TARA 1S1VA 4B9NA 2Q1NA 3DM2A 4JHDB 1K8KB 1NJWA 1YTUA 2O8EA 4DTJA 3MN9A 3TAQA 5KI6A 1BCOA 2RN2A 4WF9L 4HTLA 3SAGA 4FXDA 3MXIA 3ZT4A 4FVMA 4O5FA 4FWMA 3TR8A 1TYQB 4FM2A 4FLVA 1JLAA 1TKZA 4PKIA 3LP1A 4KI6A 1HJRA 3TABA 2E8AA 1JXBA 3H3NO 2Z1IA 4AHVA 3O1BA 1BA1A 2QEXN 4MFBA 4NB4A 4DFKA 4JNEA 1D9DA 3QEIA 3VQBA 2DFFA 1EKEA 5FPMA 5BN9A 4DQ8A 2V51B 4FK2A 3OYCA 5C24A 4FJ7A 3AA2A 1IKVA 4BWMA 4IOCL 2VCPA 2WBNA 4BWJA 4EZ9A 1JKHA 3O4WA 4AHCA 5DM7L 2FSNA 4KB0A 4E1MA 4CJ3A 1C6VA 2FBTA 3C95A 1ZBLA 1RILA 3QFPA 1NOYA 3H1VX 3WNGA 3S3MA 1WSIA 4BY9C 4OPHA 2OCEA 3C0BA 4M45A 2HSTA 1GLAG 1ZBFA 2F7TA 3RSEB 5GADP 1NMNA 1VSIA 5E41A 3TSUA 1SKWA 5C25A 3HSTB 1XHZA 1X9JA 2EWSA 5FPNA 5HRNA 1BQNA 3ASMA 3ZT0A 4K25A 1J54A 4E7IA 1JL1A 1SV5A 5M1OA 4BG9A 5AQQA 1TAUA 4OGEA 3THYB 3FGUA 4Y0WA 1VQKN 4CEOA 3ALYA 4CEEA 1OH8A 1DTQA 2DPNA 4W5OA 1S22A 1K6YA 3O80A 4CGJA 3QNNA 4RW8A 3CMAN 4CECA 4FJ8A 4FWOA 4H4OA 3LWLA 4ZTFA 1NK4A 4CZEA 3LZIA 5KGXA 3DMJA 2FLOA 3KKRA 2PYLA 2P9SA 4M7YA 5A2QO 3IAYA 5AQPA 3AO2A 2VQEK 4CEFA 1SL2A 3QBXA 1KC8O 2YHXA 3OBYA 1N8RO 4AILC 3LALA 2J4RA 1NK8A 2PBDA 4B1XB 3VGKA 3A5LC 3CJ7A 1WLJA 2IVNA 1T03A 4ELUA 2HMIA 4FCYA 4RW6A 4EFHA 5AZJB 4B9TA 1BI4B 2HBKA 2H3GX 3V1RA 4MLHA 4NCAA 3AVJA 4N47A 1JJ2M 4M3YA 2Q0UA 4KH5A 1QHTA 3PV8A 2W41A 2HVHA 4H8KA 2A42A 4CZIA 3NGIA 5KTQA 3HP6A 1XMOK 3OYNA 3NMUA 3CQ8A 3VTHA 1ZBUA 3S41A 3SQ4A 4F3OA 3VEWA 3CC4N 3M8RA 1RT2A 3ATVA 5JLHA 4YOVA 3O8MA 4PUOA 4HHTA 3RMBA 4LFCK 3QMLA 1ASWA 2O8FB 1VSMA 2W40A 3UKUA 3VGLA 3AGRA 3WXMB 2O8DA 3J7YP 4WFAL 3KK1A 2P9NB 3D2EA 2NNWA 4O8UA 5CZ2A 3FZMA 4CF9A 1ASUA 3HZ6A 4FZYA 5TKYA 4X64K 3SYZA 1U49A 1R59O 1T05A 5AR0A 2W42A 2QXLA 1E3MA 4JI7K 3A0IX 2YHAA 4DFJA 4JKFA 4IG3A 2Y1JA 3F9KA 1U04A 1VRTA 2NUBA 3VEYA 4KKOA 3DXMA 2BANA 1C0FA 1TKTA 3H45C 5DK5A 3MN5A 5KPTA 4E1JA 2A40A 3ZSZA 4HCCA 4DQIA 3W3DA 4FZZA 2P9IA 2O8EB 5HRPA 4ELVA 2CGLA 5J2QA 4BE1A 4JN4A 3O9UA 1ZBIA 2QI2A 3C94A 5GIPA 3PSIA 4DSEA 4MDAA 4M3XA 3HTVA 2UYTA 4H5TA 4AQYK 4BRQA 3GE1A 2F96A 3N4QA 4IBNA 3AVFA 4OPAA 3A8YA 3I33A 4CIFA 3K0SA 4N5SA 5CYQA 3O3GA 1HMVA 3J80O 2V52B 4F4KA 3QNOA 5EY4A 1LCUA 2VG7A 5EU7A 3ZCMA 5BREA 1RNHA 4DQQA 2QW9A 3OBWA 4DSIA 3FZKA 4FJNA 4A62A 4JD2A 3A5MC 3MEDA 4CHZA 3ZETA 1GLDG 2G8IA 1VQ5N 3B6OA 3D2FB 1WBDA 4CJUA 4JI3K 4C8NA 4ILJA 3OS2A 2VGMA 3AO1A 3E9LA 3FFKB 4CK3A 1W97L 4JI1K 4DR7K 2RPIA 4MO5A 4CEDA 3AGKA 5FRMA 4OVLA 3VA3A 1TKXA 4YOYA 4JHDA 1B9FA 3TI0A 2AJQA 3SBGA 5HL7L 3TAGA 3WQTA 1YTAA 4G9ZA 1K73O 2B4JA 4KHQA 4YNQA 1XI1A 1S6PA 4BC2A 4DG1A 3K59A 2E2PA 3BUZB 1KVAA 4CBXA 4FJ5A 4ILGB 1TYQA 2YKMA 1NK6A 3PLAA 1V4SA 2KKZA 2XY8A 3OY9A 4ISGA 1HYSA 3OTOK 1Y64A 3VQCA 5AQZA 1SS6A 4R5PA 3CJCA 2P5GA 1WBBA 4FJLA 5SZTA 3MCPA 1QHAA 4YDUA 2OPRA 4BDZA 4AM7A 2OZMA 2HB5A 2QTDA 3P39A 3ZSXA 2ASOA 3ZSYA 1KCFA 1XHXA 4FJGA 5IT9O 1T6DA 4NXMK 1REVA 4BR7A 2DFEA 1JLQA 2QM1A 3TTDA 3QEVA 1BL3A 4PWDA 3RTVA 4DR4K 2NRZA 4CJWA 3WXIA 2F8TA 1WSFA 4IWVA 3TSPA 4BRFA 2YV0X 3I8DA 3LP0A 4EIAA 1X1PA 2D4WA 5GIOA 2KTQA 1TK0A 4OO1J 2A6AA 4IO8A 1C0MA 5EOYA 1IBMK 4O0IA 4DTPA 3UKRB 3VQ6A 3AVLA 2IVPA 2WOMA 4H0PA 3IUCA 3L0QA 3MXMA 3VQ8A 3L3VA 2VG5A 3LAKA 3DWLA 5AFUA 3P83D 1SL0A 4NCBA 3RMCA 3THYA 3AO5A 2NLXA 4FK4A 3EE9A 1QSSA 5AQFA 3KWGA 3ZSOA 3ZX0A 2FXUA 3BF1A 3H46O 3SQ2A 1I94K 3MAQA 1WSJA 1KLNA 1O1WA 3QO9A 4BC5A 3K5LA 3T1AA 3ENHA 4XH1A 4WFNL 5M1PA 4A61A 4CCHA 4H5RA 1JCEA 3UKUB 3LM2A 1EWQA 2YNIA 2QWOA 3TAMA 2B5JA 4BVPA 1J6ZA 2NZTA 4H5VA 4RG8A 3QICA 3TU5A 1QSYA 1OVQA 4CGHA 3HK2A 2RKIA 4IOXA 4JS4A 3HOTA 2A3ZA 3EKSA 3ITHA 4DMNA 3QIPA 2PFUA 5KQDA 5MLCQ 3QESA 4B9SA 3UIQA 2HHVA 1L3SA 3FE1A 3CFRA 3NHGA 2ZM6K 1XNQK 1TK5A 1X9MA 4B9QA 4BRDA 3C6HA 4YOWA 4CFAA 4JRQA 5AZJA 3AA4A 3EKUA 3AA5X 2E2QA 4CE9A 4H4MA 2FBVA 2YI1A 1YJNN 4J2BA 3DLGA 5EX5A 4FVUA 4FJXA 1QTMA 2NRVA 4Z4FA 4M3ZA 4JAXA 1T7PA 3SAFA 4B9LA 3WNHA 3KLIA 4K0KK 4EHTA 1TVRA 3NF8A 2YHWA 1F21A 1LV5A 1NKBA 1MDUB 3DLKA 3AVBA 4CJPA 2XY7A 4RW7A 2HHQA 5BRHA 3HI0A 2VQFK 1QS4A 4H0XB 3KJVA 1WAFA 3HJFA 3VQ9A 2GX9A 4FWKA 2FBXA 2YX6A 3E1YA 3A5OC 5EVZA 3ZX3A 2WC9A 1S9EA 4ID1A 4DV7K 4UY8O 4QOZB 3U9DA 3RRGA 4CVNE 1J5OA 2QXFA 2O8FA 2O4IA 2NRHA 1A5VA 3ID8A 5E84A 4ID5A 2UXDK 2V7ZA 1IKWA 5C12A 3EEQA 1QQCA 4J2EA 3MWTA 1YVNA 2P9NA 4FM0A 3OW2M 4O5BA 5ELZA 1LW0A 1FXXA 3SI6A 3O3FA 3JYTA 4CJLA 4KAZA 3EZWA 2FSJA 5JMVA 5HP1A 1UA0A 1LAVA 3WEEA 4DV2K 4FLZA 1JCFA 4FLYA 3I8BA 3DAWA 4GKKK 1VQMN 1OVYA 3LM9A 4LD0A 3P5JA 1VQ6N 1NNEA 3ULEB 3I55N 5I9EB 4BR5A 4BRAA 3DRPA 4IG0A 4IO9L 3EY1A 1BHLA 5AQHA 2IIRA 5F1XA 5SWMA 2Y1IA 3MCAB 3MECA 3G0ZA 4JS5A 3T1HK 3T19A 4NO7A 3E66A 3BF3A 1VK0A 3D0PA 1H1VA 3SQ0A 4B8AB 3C6UA 4Q0BA 4DR6K 2GELA 4C8LA 1WUAA 3K58A 4Z4IA 1BOTO 4CZMA 3EYZA 3QLHA 3ENBA 5AQGA 2ZF5O 4EP5A 5F0XA 5GAGP 2PY5A 3RWUA 4YDUC 3O6WA 1D8YA 3AO4A 4JRPA 4M42A 4CZLA 5LL6Z 4A5AA 3U3YA 4A59A 1SUQA 3ZSQA 3HL8A 3MWPA 3CFPA 2HNDA 3OJUA 3ZT3A 4FWNA 3PUFA 4DFMA 3LDLA 1C0UA 1VRUA 4DR2K 1J5EK 4CHPA 4OPKA 4C8KA 3CC7N 3D2FA 2E2NA 3BP8A 3JSMA 1YJ9N 4CEQA 4DU1A 3V1OA 5KGWA 3CC2N 4B3MK 1KAYA 4NLCA 4CF2A 3V4IA 4DTRA 5F2RA 2GWJA 3THWB 3K57A 3RR7A 1M90O 3IRXA 1X9WA 1YITN 3VQQA 3TSQA 3LDSA 3SJHA 1RT7A 4IEIA 1Q7YO 4BVOA 1Z05A 3HRGA 2HVIA 3B8AX 2E6LA 1S1UA 4OKEA 1Q9XA 3OYEA 3L2WA 1WNSA 1Y97A 3RVCA 1IKXA 4KHWA 2KW4A 4FOEA 1QVFM 4OLBA 1RBTA 2OA8A 1NMDA 3SK3A 1S3XA 2X6SA 3MDQA 3DOKA 2OYQA 3FLCO 1VQNN 2VG6A 4E7LA 2FSKA 3CJ9A 1RBUA 2HHTA 1JLGA 4B1ZA 1NGAA 1HNWK 1NBWA 1RTIA 4BC4A 3W0LA 4E89A 1NKEA 3AARA 2NRRA 4AHUA 3H6EA 1XMQK 4B3RK 3KLGA 4DLEA 4DTOA 1TK8A 3ISNC 4IZ9A 3WNFA 3DRSA 3WXJA 4DLGA 3K5NA 3HBTA 4O44A 3OYJA 2NRXA 2IC3A 1JLCA 2R7YA 4FLXA 2P5OA 3L3UA 4YOUA 4E1NA 3L4QA 4BRMA 3ENOA 4I9QA 4B1YB 4QS7A 1RT6A 4L8RB 4NLBA 3M3ZA 4AHTA 3SLCA 4DV1K 5AQXA 4A2BA 2W6LA 1X9SA 2Q3SA 3AAQA 1IH7A 4JKDA 2UUAK 2IOCA 4GMJB 4BR9A 1BGXT 3IKMA 3UKRA 1O13A 1NGCA 2NRWA 4CBWA 4F2SA 2VWBA 4PL7A 1VQ7N 5AQJA 5C2FA 2O8BB 1NLVA 2RE2A 1MWMA 2ITMA 1NK0A 2IGIA 5AZIB 3E9PA 4CJSA 1N34K 2E1ZA 1VQON 1IKYA 3SQ1A 2OANA 4CJTA 2E2OA 2E88A 3ATUA 3I0SA 4AM6A 1FKOA 3QB0A 1D5AA 1CZ9A 1T3VA 3VN5A 5K14A 3ULDA 2LSNA 3CCUN 1V4TA 1NJXA 3QEPA 2WUSA 5J2MA 3O4NA 2ZD1A 2Q0RA 3OYMA 4H0VB 2ZJRL 1SL1A 1GLJO 4B08A 4PKGA 1EO1A 4WE1A 2UU9K 5M1NA 2E5LK 2P9UB 3F2KA 1JLFA 4CD3A 4BDPA 5T7BA 3J7AP 4CZHA 2KQ2A 4OKJA 2QK9A 1JCGA 4FWQA 3WEEB 5AQYA 2P51A 3QFUA 4JV5K 4I7FA 3K9JA 5DM6L 1UWBA 3O9SA 2HNYA 3GDQA 3LP3A 4FWPA 3OHRA 3SUQA 3LP2A 2KZZA 4BR0A 2W6KA 2I5JA 4DSKA 3NH0A 4C8OA 4RWTA 5E26A 3TANA 1YHQN 4FPAA 4RW9A 4CFCA 3HXMA 3OA9A 1NWKA 4A2AA 4RTFD 4CZGA 1CZAN 2DY4A 4DKWA 3LDNA 2P9PB 4IXCA 3AVGA 4DR1K 2HHWA 1IV0A 1HQUA 4KV8A 1KSPA 1CXUA 3SCXA 1HQEA 5FRNA 4MDBA 1WOQA 3DOLA 4I6MB 4Y1CA 5D3GA 3LWMA 2DTUA 2CGKA 2QWNA 2JGUA 3VQDA 5C10A 5GINA 3KVGA 4YY3K 4DSLA 1A5XA 3CCVN 1HLUA 3BZCA 4H0YB 4CIGA 3M1FA 2ZGYA 3M6GA 4CI6A 3EE8A 3HPHA 5AQRA 1ATSA 1T44A 3IFRA 3O1WA 3NVMA 2QWLA 1RT4A 4FJ9A 4ZTJA 4IFVA 5CY4A 4Z4CA 2ZJQL 3T1YK 4FYDA 3TTCA 2E4LA 3VESA 4DQSA 4CEBA 4G1QA 3U6FA 5GAEP 4KRFA 1YUWA 4DUZK 3E01A 1J9AA 4BQLA 4AF1A 2ZGZA 3CM5A 4OX9K 4CIEA 4KHSA 3M8SA 1SZ2A 3ULEA 3A5NC 3HT3A 3P31A 1YI2N 1N36K 3WUHA 3QINA 1HYZA 3VENA 2QWPA 3VQEA 1KVCA 3CCQN 1RTJA 4KB1A 5AQNA 1L3VA 2A1SA 1U2VB 4QAGA 4FK0A 1U48A 3OVNA 4BGBA 4KHUA 3T69A 1RDBA 3AVNA 2BGGA 3KKSA 4V19S 3G25A 1WSEA 3UE5A 5CE3A 2YCHA 4AH9A 2P9LB 2ZWHA 3Q7CA 5HROA 3JAMO 1Z26A 4HUGA 5C2DA 3ZYYX 2Z1JA 4ILHA 1LWEA 3CCJN 2KFNA 3AVAA 3EZ5A 4DUYK 3SUOA 4NYFA 2HNZA 3ZSVA 3HVTA 4OGCA 3WT0A 5BPNA 1IBKK 3DLBA 4BDYA 4YOXA 5AQUA 3KK7A 4CZKA 5M1QA 5KPZA 2G8WA 5BPMA 4F9OA 4CFBA 3G6EN 2HF3A 4FWLA 5M1KA 1X3NA 5AQLA 4U7BA 1QQOA 3CJ1A 1RT1A 4M3RA 4X62K 4WQ4A 4KTZA 4NXNK 2XRIA 3THWA 1BA0A 3CD6N 4DTUA 3NDKA 3G10A 4CZJA 3VEZA 3N4PA 1K9MO 5JS2A 2HBMA 5AQIA 3RMAA 1KXPA 1VQ4N 3BZKA 4KTWA 5LMNK 5AQSA 3ZX2A 1CZBA 2BUPA 1KVBA 3V6DA 4IDKA 4CK1A 3LL3A 3NH1A 1HKCA 4E0DA 2BDPA 3A2FA 1VQ9N 1XC3A 1IG9A 4LFBK 4MQ3A 2HW3A 1S72N 3NF9A 1C1BA 2A1RA 1BWFO 4CGDA 3SPYA 1WSHA 4CEZA 4K8ZA 4Z0UA 3SJJA 2QWMA 4CESA 1QZ6A 1KAXA 4FWRA 1SKRA 1Q82O 5C0YA 1TV6A 3VPZA 4IEEA 3OYKA 4HWIA 3TTFA 4W5QA 1B9DA 5IWAK 4CFDA 4DF4A 3DJCA 2UUCK 1YJWN 3K5OA 1S1WA 2Q97A 4CJRA 4FW1A 1VSHA 3BEXA 1DTTA 1NM1A 1ESVA 2GUIA 1WB9A 3DYAA 4FZXC 4BE0A 4YOTA 5AFUH 5ADXA 1BISA 2E20A 5FROA 1XQSC 4CZFA 3GG4A 4CF1A 2PAVA 3AVHA 3VERA 1YAGA 4A5BA 5LJWA 3VEXA 1EETA 4DV6K 1OKJA 3NAEA 3T7ZA 1QSLA 3CMEN 2KZMA 1BDGA 3HP9A 4QCLA 1RT3A 3V9WA 1S1TA 2HHXA 2YJFA 4JEPA 4MO4A 2ASMA 2ZE2A 3WXLA 3CQYA 4FL9A 4O55A 1IBLK 4PKHA 4CGFA 4JK9A 4RW4A 3CFOA 3CETA 3GL1A 1RT5A 2HMPA 1NJZA 3VF2A 4FPBA 1JLBA 3CI5A 2HHUA 3CG7A 2OPPA 4Z4EA 2CH6A 3M5RA 4KH4A 3UB5A 2O8BA 3LDOA 4IFYA 1DLOA 4FOIA 3C6TA 3CCRN 1G15A 4DTXA 1KAZA 1P90A 4IDHA 4DCHA 5AZIA 2OZSA 4LF5K 4B8CA 5JICA 5BR9A 5J2PA 4CJVA 1EP4A 2ZQBA 3QEWA 1BIUA 3O5BA 1NK5A 4KPYA 1GOCA 3VMFB 2YNGA 3CPEA 4A57A 2F9WA 4DF8A 1XC9A 3KD1E 3MEGA 2P9KB 3KWIA 5CR4A 4CJ5A 3CERA 1NGGA 1HNVA 4W5TA 4J8FA 2X74A 3PO4A 3PIPL 2IAJA 1C0TA 2P9UA 3V9UA 2BH1A 1S9GA 4I2PA 4DS5A 4XH4A 1BU6O 3NF6A 5HRRA 4LY7A 3WXKA 5DMRA 1Q9YA 1VQ8N 5JS1A 1HKGA 4E7KA 1TAQA 3CCSN 2ITGA 2WFBA 4JI8K 3FZFA 4DSJA 1CXQA 1U6ZA 1ATNA 3PX4A 4IKFA 3KD5E 3G71N 2I7NA 2CGJA 5HLFA 4JKCA 4BRLA 1E4FT 4GV6A 4QS8A 1UA1A 2IS3A 2QWRA 2F8SA 1S1XA 3WNEA 2D1KA 1KFSA 3PX0A 1HR0K 1BO5O 3CXCM 3H1QA 3VGMA 4PL8A 2P9PA 3O4QA 1VQLN 3NH2A 4FJMA 2IDOA 4OJRA 3S3NA 2QA4N 2YHBA 5BRFA 5KQ8A 1NGEA 3R9PA 5BPLA 5J1EA 1ZBSA 3AA3A 1NK7A 2YKNA 3QETA 2NRTA 4H5NA 3SUNA 1RBVA 3J8AA 1GLLO 4I6MA 3H3OB 4EZ6A 4BC3A 1WAJA 1C0GA 1RDUA 5FPDA 2HHHK 3Q7BA 1ZC6A 4WQ5C 1TUYA 3TAPA 4GV9A 2KLAA 4ELTA 4KFBA 4W5NA 3LPTA 1GLEG 3LDQA 1VSJA 1KTQA 3TPQA 4WQ4C 3KK3A 3ZEUB 1YIJN 1S5JA 3NBPA 5M1FA 4C1NI 4JKGB 3TAEA 4HVJA 2O8CA 4CJQA 2Q31A 1K8AO 3AVKA 3MX2A 3NGZA 1NGDA 4B1WB 4CF8A 3OYAA 4CJFA 4GY2B 4O8KA 2EX3A 3TAFA 3VA0A 2HOEA 3THXB 2GTDA 5AQMA 4GKJK 4FWSA 3ZT1A 4M7XA 1A5WA 1NJYA 2QWQA 3RR8A 3KZBA 2DFHA 3F5TA 4B3SK 3MK6A 1NU0A 5LJVA 4HCBA 4K43A 3O9RA 1C1AA 1W2BM 4OKKA 4CJ7A 3ID6A 4BRHA 3O3HA 4UQGA 3HVRA 1U2VA 4DU3A 1TL3A 1I3AA 3EL2A 2G8FA 3CQXA 4CGGA 1TGOA 2YJEA 1C1CA 4PHTX 2VYPA 5BN8A 4LSLA 3B6PA 5AQTA 3DXKB 2YNFA 3LZJA 1RFQA 3V9XA 1WSGA 3PIOL 1QVGM 4XH5A 3JXUA 3PX6A 4DV5K 4DQPA 1DGKN 3PY8A 5FPEA 3FFIA 3L2RA 4LF4K 2P9LA 1RGIA 4E7HA 3CIPA 2IVOA 4MLEA 4RCHA 3QEXA 1XUPO 4GVEA 4JKHA 4LH4A 4M41A 2X78A 1Q86O 4KHPK 4YHHK 3LDPA 1DKGD 3FZLA 1VHXA 3VEVA 3RRHA 3U4LA 3QERA 4FLWA 2V7YA 2GUPA 3MMVA 3GOIA 1KLMA 3KIOA 3CM6A 4M3UA 1N5YA 3O9QA 1Z6RA 4LF8K 2OPQA 3K2PA 5I3UA 4AHRA 4WCEL 3VEOA 1LAWA 4F8RA 4IJAA 2VWKA 4N41A 1ZYQA 4LF6K 5FDLA 4FJJA 4BACA 1YT3A 3HPGA 4GNIA 4LSNA 2X6NA 4DWIA 2G8KA 3C7NB 3OS0A 1KFDA 4LFAK 3KHYA 4CW7B 1BUPA 4BE2A 4FO0A 1W7AA 4R79A 1NK9A 1OH6A 2VGNA 3ZSRA 3TWHA 4C23A 1LWFA 4DU4A 4B3TK 3I0RA 4B1VA 1B92A 1EX4A 4O4GA 4BRIA 1XWLA 4XEIA 4QS9A 3ZSWA 3V1QA 5JVGL 1HX1A 3AVCA 3HOSA 1Z25A 4CJEA 3HSCA 2GV9A 5HRSA 2HF4A 1Q81O 2HBLA 3OYHA 1HNIA 3KLEA 2F9TA 3PO5A 4Q5VA 1L3UA 2OTLN 1S6QA 2JLEA 4JKBA 1NGJA 3OYBA 3OYLA 4JYAK 1RDCA 3SAHA 4B1UB 3CCEN 4W5RA 3HPOA 3R3LA 3MX5A 1VAZA 1EWRA 3BY5A 3CJBA 5C15A 2XY6A 5LMUK 1NJIO 3CHWA 4CHNA 1YF5L 2GEMA 4JKEA 3R1XA 2FF3B 1ZBHA 4J2DA 1DEJA 1NGIA 2ETJA 4BRGA 1RBSA 5CYMA 3U8XA 4BR4A 4B9VA 3LPUA 4DB3A 4OLAA 3KLFA 3SZ2A 2PYJA 3L2UA 4DFPA 2JWLA 4OPJA 3SV3A 3BGRA 1QZ5A 2G8HA 4U67L 2E1YA 3VETA 1G99A 1NOZA 1YVUA 4BRKA 3P38A 5KRSA 2XHBA 3V9ZA 4DR3K 1BCMA 1MA9B 3P1GA 4CF0A 4YORA 2FC0A 3F73A 1VSLA 2YHYA 2D5RA 1HRHA 1N6QA 3HM9A 3IDHA 1J53A 3HO1A 3QBWA 4DTMA 3KK2A 3IS9A 1TKDA 4CHYA 3FZHA 1L3TA 2Q36A 1L5UA 3EO3A 3J81O 3KTQA 2ATQA 5KRTA 3SPZA 3VOVA 4B9UA 4FJHA 3I56N 4CHQA 1TUUA 3C65A 1SQKA 1NGBA 4JLHA 1HUXA 2P9KA 4DV0K 2G8UA 1D9FA 2UXBK 3D7EO 3IG1A 5AQOA 1T8EA 3QDKA 1DT9A 3VQPA 4Z4GA 4IJNA 5BR8K 5EXWA
chains in the Genus database with same CATH topology
4W5QA 4JS5A 3T19A 1U4BA 1B9DA 1WLJA 4CFDA 4DF4A 1VK0A 1T03A 1W9HA 4ELUA 2HMIA 4FCYA 4RW6A 3D0PA 3K5OA 1S1WA 4HUFA 4B8AB 4CJRA 3C6UA 4FW1A 1VSHA 3SQ0A 1NKCA 1DTTA 4B9TA 4Q0BA 1SKSA 1BI4B 2GUIA 3K5MA 4C8LA 3DYAA 3V1RA 4BE0A 3K58A 4FZXC 4Z4IA 3EYZA 4NCAA 3AVJA 3QLHA 3LANA 3D45A 2XY5A 1BISA 5FROA 4N47A 4E3SA 4M3YA 3QIOA 2HHSA 4CF1A 4B3OA 3AVHA 1QHTA 4EP5A 3PV8A 2PY5A 2HVHA 3RWUA 4H8KA 1EETA 4I9LA 1D8YA 3AO4A 4JRPA 4M42A 3NAEA 1MU2A 1QSLA 5HBMA 2KZMA 3U3YA 3NGIA 5KTQA 3HP9A 2OPSA 3HP6A 1SUQA 3ZSQA 4QCLA 3HL8A 3CFPA 4K8XA 3OYNA 2HNDA 3OJUA 3CQ8A 1RT3A 3V9WA 1S1TA 3ZT3A 2HHXA 1UAXA 3PUFA 4KO0A 4XIUA 4DFMA 3S3OA 1ZBUA 4PA1A 3DI6A 4J2AA 3SQ4A 1C0UA 5CZ1A 4F3OA 1VRUA 3M8RA 2ZE2A 4FJKA 1RT2A 4O55A 4CHPA 4PUOA 4Z4HA 4CGFA 4OPKA 4HHTA 3OYGA 4DSFA 3RMBA 4C8KA 4FJIA 3L2QA 3H08A 3CFOA 4RW4A 4N56A 3MEEA 4DTNA 1RT5A 1RDAA 3JSMA 1NJZA 4CEQA 4DU1A 1ASWA 3V1OA 1VSMA 1TKDA 5KGWA 3DLHA 3NE6A 1JLBA 3V4IA 4CF2A 4I2QA 4DTRA 2HHUA 3CG7A 1R0AA 2OPPA 3OYDA 3NCIA 4Z4EA 4Y1DA 3K57A 4CJKA 3RR7A 2PZSA 3IRXA 3KK1A 1X9WA 4IFYA 3VQQA 1DLOA 3C6TA 1EXQA 3NGYA 5CZ2A 4F3TA 1RTHA 3LDSA 1G15A 4DTXA 1RT7A 3LAMA 1UOCA 4CF9A 2D0AA 2OZSA 1ASUA 3VQAA 4B8CA 4M3WA 4FZYA 2HVIA 3SYZA 5J2PA 1U49A 4GVMA 3VQ7A 2E6LA 4CJVA 1S1UA 2VWJA 1T05A 1EP4A 2ZQBA 3QEWA 4OKEA 1BIUA 3AO3A 2W42A 4FLUA 1Q9XA 1NK5A 1Q8IA 1GOCA 3OYEA 1WNSA 3OYIA 3DLEA 3L2WA 2G8VA 4KPYA 1Y97A 2YNGA 1ASVA 4DF8A 4CEAA 1XC9A 1IKXA 3KD1E 3MEGA 2KW4A 4KHWA 1BQMA 2YHAA 4DFJA 1RBTA 4FW2A 4IG3A 2Y1JA 3F9KA 1FKPA 1VSDA 4CJ5A 1U04A 3THVA 2OA8A 1VRTA 2NUBA 4E7JA 4KKOA 2BANA 1TKTA 2X6SA 1HNVA 3DOKA 3AV9A 4PY5A 5DK5A 4E19A 4B9MA 2OYQA 4W5TA 3OS1A 2EHGA 2X74A 3V9SA 3PO4A 3ZSZA 4CERA 4DQIA 2IAJA 4HCCA 2VG6A 4O0JA 4FZZA 4KHYA 1C0TA 3V9UA 4E7LA 1U47A 5HRPA 1S9GA 4ELVA 4I2PA 3VQ5A 4TSXA 1RBUA 2HHTA 1JLGA 4DS5A 3KLHA 5J2QA 3NF6A 4BE1A 5HRRA 4LY7A 1Q9YA 5DMRA 5JS1A 1RTIA 4E7KA 1TAQA 3DRRA 1ZBIA 4E89A 1NKEA 3C94A 4DSEA 2ITGA 4AHUA 4M3XA 4DSJA 1CXQA 3KLGA 2WONA 4DLEA 4DTOA 3CYMA 2F96A 3AVIA 2BE2A 3ISNC 1TK8A 1KRPA 3PX4A 4IKFA 3HYFA 4IBNA 4CK2A 2Z1HA 3AVFA 3KD5E 1GOBA 1VSEA 3DRSA 3WNFA 4DLGA 4CIFA 1IO2A 5I42A 1CLQA 4N5SA 1W0HA 2P1JA 3K5NA 5CYQA 4O44A 3VQ4A 5HLFA 1QE1A 3OYJA 1VSFA 1U45A 2IC3A 3O3GA 5C42A 1JLCA 1HMVA 2R7YA 4FLXA 2IS3A 3L3UA 4HUEA 1UA1A 2P5OA 2F8SA 4F4KA 3QNOA 2KFZA 1S1XA 4E1NA 3WNEA 2VG7A 4AHSA 3OJSA 3PX0A 1KFSA 3ZT2A 3SUPA 5EU7A 3ZCMA 1JL2A 1RNHA 4DQQA 5J2NA 4I9QA 3O4QA 4DSIA 4CJ4A 1RT6A 3NH2A 4FJMA 4L8RB 2IDOA 4OJRA 3SV4A 3S3NA 4AHTA 4FJNA 2YHBA 4HTUA 3MEDA 4ICLA 4CHZA 4FLTA 2G8IA 5J1EA 1NK7A 1RCHA 3AA3A 3DLRA 2Q3SA 2YKNA 3B6OA 3QETA 1X9SA 4M3TA 4CJUA 2B6AA 3SUNA 1IH7A 1RBVA 4C8NA 2IOCA 2D0CA 4GMJB 2FBYA 1BGXT 3OS2A 3AO1A 4EZ6A 4CK3A 1WAJA 4KREA 4F2SA 1RBRA 2E6MA 2RPIA 4CEDA 4N76A 5FRMA 2YNHA 3TAPA 3L2VA 1RDDA 4OVLA 4CHOA 3M8QA 3V81A 4ELTA 2Z1GA 4KFBA 4W5NA 3LPTA 1TKXA 3VA3A 3AVMA 1NK0A 2IGIA 1VSJA 4CJSA 1KTQA 3KK3A 1B9FA 3TI0A 2AJQA 1IKYA 3SQ1A 1LW2A 1S5JA 3NBPA 1BIZA 4F2RA 4CJTA 3TAGA 4EP4A 1YTAA 3TAEA 4HVJA 3I0SA 2B4JA 1FKOA 4CJQA 4KHQA 3T3FA 4YNQA 1D5AA 3AVKA 1XI1A 1CZ9A 1GOAA 1S6PA 4NYNA 4DG1A 3NGZA 3K59A 3VN5A 1KVAA 5K14A 3ULDA 4FJ5A 1BI4A 2LSNA 4CF8A 3OYAA 4CJFA 1NJXA 3QEPA 2YKMA 2EX3A 3TAFA 4PQUA 1TL1A 5J2MA 3O4NA 2ZD1A 3OYMA 3VA0A 1SL1A 4B08A 1NK6A 4WE1A 4ZHRA 3ZT1A 1A5WA 1NJYA 3RR8A 1HPZA 2DFHA 2XY8A 3OY9A 4HCBA 1JLEA 1JLFA 4LH5A 4BDPA 4NCGA 5T7BA 1HYSA 2KQ2A 4OKJA 2QK9A 3VQCA 1JXEA 1C1AA 4FM1A 4R5PA 2P5GA 2P51A 4OKKA 4YFUA 1FK9A 4FJLA 5SZTA 3BDPA 4DTSA 3L8BA 3O3HA 4UQGA 3HVRA 4I7FA 4C8MA 2OPRA 1UWBA 2HNYA 3RMDA 4DU3A 4BDZA 4KI4A 1TL3A 2OZMA 2HB5A 4DQRA 3LP3A 1I3AA 2G8FA 3SUQA 3LP2A 1TGOA 3ZSXA 4CGGA 1RTDA 1C1CA 1HYVA 3U3GA 2KZZA 3ZSYA 1WN7A 1KCFA 1XHXA 3B6PA 4LSLA 2YNFA 3OYFA 2QKKA 4FJGA 4KTQA 1REVA 2I5JA 2DFEA 1JLQA 3LZJA 3V9XA 1WSGA 4DSKA 3QEVA 1I39A 1BL3A 3NH0A 4GW6A 4C8OA 4PWDA 1VSKA 3RTVA 3PX6A 3TANA 4DQPA 3PY8A 4CJWA 2D0BA 3FFIA 3MXJA 4RW9A 4CFCA 3L2RA 3HXMA 3S9HA 2F8TA 1WSFA 4E7HA 2DY4A 2YV0X 3I8DA 3LP0A 3AVGA 1X1PA 3QEXA 2QKBA 2GBZA 2HHWA 4CGIA 1ITGA 1HQUA 4KV8A 4LH4A 4M41A 2X78A 2O4GA 1KSPA 3SNNA 1CXUA 3SCXA 2KTQA 2XO7A 1TK0A 1HQEA 5FRNA 1LWCA 3NF7A 3RRHA 1C0MA 3QERA 4FLWA 4O0IA 3DOLA 4Y1CA 4DTPA 1KLMA 3NFAA 3VQ6A 5D3GA 3AVLA 2WOMA 3LWMA 4DS4A 3M8PA 3KIOA 2DTUA 3CM6A 2RF2A 3MXMA 4KHNA 2JGUA 3VQ8A 3VQDA 4M3UA 3L3VA 2VG5A 3LAKA 3P83D 1SL0A 4NCBA 3RMCA 1A5XA 4DSLA 1N5YA 3AO5A 4CIGA 4FK4A 1QSSA 3TARA 2OPQA 3K2PA 1S1VA 5I3UA 4B9NA 4AHRA 1LAWA 3DM2A 3HPHA 4F8RA 2VWKA 4N41A 1ZYQA 3ZSOA 3SQ2A 1RT4A 1NJWA 4FJ9A 3MAQA 4ZTJA 1YTUA 1WSJA 5FDLA 1O1WA 1KLNA 4IFVA 4DTJA 3QO9A 5CY4A 4Z4CA 1YT3A 3HPGA 3K5LA 5KI6A 3T1AA 1BCOA 4LSNA 4BACA 3TAQA 4FYDA 2RN2A 2X6NA 2E4LA 4DWIA 2G8KA 4CCHA 3OS0A 4CEBA 4DQSA 1KFDA 4FXDA 4G1QA 3MXIA 3ZT4A 3U6FA 4FVMA 3TR8A 2YNIA 3TAMA 4FM2A 4FLVA 4KRFA 1JLAA 1TKZA 4BE2A 2B5JA 3E01A 1J9AA 3LP1A 4KI6A 3CM5A 4RG8A 1QSYA 1HJRA 3TABA 4CGHA 4CIEA 1JXBA 2RKIA 1NK9A 4JS4A 4KHSA 3HK2A 3M8SA 2Z1IA 4AHVA 3ZSRA 3TWHA 3ITHA 4DMNA 1LWFA 3QIPA 4MFBA 3HT3A 4DU4A 3I0RA 4DFKA 3QESA 1B92A 3QEIA 1EX4A 4O4GA 1D9DA 4B9SA 3UIQA 2HHVA 1L3SA 1XWLA 3VQBA 3NHGA 2DFFA 1EKEA 3CFRA 4FK2A 3QINA 1HYZA 1X9MA 1TK5A 3OYCA 5C24A 3ZSWA 3V1QA 4FJ7A 3VQEA 1KVCA 3AVCA 1RTJA 3AA2A 1Z25A 1IKVA 4CFAA 2GV9A 4CJEA 3AA4A 5HRSA 4JRQA 4KB1A 3OYHA 1HNIA 3KLEA 3AA5X 4BWMA 1L3VA 3PO5A 4Q5VA 1L3UA 4CE9A 1S6QA 4H4MA 2A1SA 2JLEA 4QAGA 2FBVA 4BWJA 3OYBA 3OYLA 4J2BA 4EZ9A 3DLGA 4FK0A 1RDCA 4FJXA 1JKHA 1U48A 4AHCA 4KB0A 3OVNA 4KHUA 4E1MA 4CJ3A 1QTMA 1RDBA 1C6VA 3AVNA 2BGGA 4W5RA 4Z4FA 2FBTA 3KKSA 4M3ZA 3C95A 3HPOA 1WSEA 1T7PA 1ZBLA 1RILA 4B9LA 3WNHA 3KLIA 1NOYA 3WNGA 2XY6A 3S3MA 1TVRA 4AH9A 1WSIA 4CHNA 3NF8A 1F21A 1LV5A 1NKBA 4M45A 1ZBHA 3DLKA 5HROA 3AVBA 1ZBFA 4J2DA 4CJPA 2XY7A 2ETJA 4RW7A 2HHQA 1Z26A 1RBSA 1VSIA 4HUGA 5CYMA 1QS4A 5E41A 3KJVA 1WAFA 5C25A 1SKWA 3LPUA 4B9VA 3HJFA 3VQ9A 3HSTB 2Z1JA 1XHZA 1LWEA 2KFNA 3AVAA 4OLAA 5HRNA 3KLFA 3EZ5A 3SUOA 1BQNA 2FBXA 4NYFA 2HNZA 3SZ2A 3ASMA 2PYJA 3ZT0A 3ZSVA 3L2UA 4DFPA 3HVTA 1S9EA 4ID1A 1J54A 4OGCA 4OPJA 4BDYA 3BGRA 3SV3A 4E7IA 3DLBA 4QOZB 2G8HA 2G8WA 1JL1A 1SV5A 3RRGA 4CFBA 1NOZA 1YVUA 5KRSA 2XHBA 3V9ZA 1J5OA 2QXFA 2O4IA 1A5VA 1BCMA 3P1GA 4ID5A 1TAUA 4OGEA 4CF0A 4OLBA 1IKWA 1RT1A 4M3RA 4KTZA 2FC0A 2XRIA 3F73A 1VSLA 1QQCA 2D5RA 1HRHA 4DTUA 4J2EA 3NDKA 1N6QA 3G10A 3HM9A 4CEOA 2Y1IA 3ALYA 4CEEA 4FM0A 1J53A 3HO1A 1DTQA 5JS2A 4W5OA 4FJJA 4DTMA 4O5BA 1K6YA 3IS9A 4CGJA 4CHYA 4KTWA 4RW8A 3KK2A 4CECA 3QNNA 1LW0A 1FXXA 1L3TA 1L5UA 3MECA 4FJ8A 3SI6A 4H4OA 1CZBA 2ATQA 4CJLA 3O3FA 3LWLA 3JYTA 4ZTFA 5KRTA 1NK4A 3KTQA 4KAZA 1KVBA 3V6DA 4IDKA 1LAVA 5HP1A 3SPZA 1UA0A 3LZIA 4B9UA 4CK1A 5KGXA 3DMJA 4FJHA 4CHQA 3KKRA 3NH1A 4FLZA 2PYLA 4E0DA 4FLYA 2BDPA 3A2FA 1IG9A 2HW3A 4MQ3A 3IAYA 4JLHA 3AO2A 4CEFA 3NF9A 3RMAA 1C1BA 2A1RA 4CGDA 1SL2A 1D9FA 2G8UA 4LD0A 3SPYA 3IG1A 1WSHA 4CEZA 3P5JA 1T8EA 4K8ZA 4Z0UA 3VQPA 3SJJA 4Z4GA 3DRPA 4CESA 3LALA 4AILC 4IG0A 1SKRA 3EY1A 1BHLA 1TV6A 5SWMA 3OYKA 1NK8A 3G0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W5Q A;  4JS5 A;  3T19 A;  1U4B A;  1B9D A;  1WLJ A;  4CFD A;  4DF4 A;  1VK0 A;  1T03 A;  1W9H A;  4ELU A;  2HMI A;  4FCY A;  4RW6 A;  3D0P A;  3K5O A;  1S1W A;  4HUF A;  4B8A B;  4CJR A;  3C6U A;  4FW1 A;  1VSH A;  3SQ0 A;  1NKC A;  1DTT A;  4B9T A;  4Q0B A;  1SKS A;  1BI4 B;  2GUI A;  3K5M A;  4C8L A;  3DYA A;  3V1R A;  4BE0 A;  3K58 A;  4FZX C;  4Z4I A;  3EYZ A;  4NCA A;  3AVJ A;  3QLH A;  3LAN A;  3D45 A;  2XY5 A;  1BIS A;  5FRO A;  4N47 A;  4E3S A;  4M3Y A;  3QIO A;  2HHS A;  4CF1 A;  4B3O A;  3AVH A;  1QHT A;  4EP5 A;  3PV8 A;  2PY5 A;  2HVH A;  3RWU A;  4H8K A;  1EET A;  4I9L A;  1D8Y A;  3AO4 A;  4JRP A;  4M42 A;  3NAE A;  1MU2 A;  1QSL A;  5HBM A;  2KZM A;  3U3Y A;  3NGI A;  5KTQ A;  3HP9 A;  2OPS A;  3HP6 A;  1SUQ A;  3ZSQ A;  4QCL A;  3HL8 A;  3CFP A;  4K8X A;  3OYN A;  2HND A;  3OJU A;  3CQ8 A;  1RT3 A;  3V9W A;  1S1T A;  3ZT3 A;  2HHX A;  1UAX A;  3PUF A;  4KO0 A;  4XIU A;  4DFM A;  3S3O A;  1ZBU A;  4PA1 A;  3DI6 A;  4J2A A;  3SQ4 A;  1C0U A;  5CZ1 A;  4F3O A;  1VRU A;  3M8R A;  2ZE2 A;  4FJK A;  1RT2 A;  4O55 A;  4CHP A;  4PUO A;  4Z4H A;  4CGF A;  4OPK A;  4HHT A;  3OYG A;  4DSF A;  3RMB A;  4C8K A;  4FJI A;  3L2Q A;  3H08 A;  3CFO A;  4RW4 A;  4N56 A;  3MEE A;  4DTN A;  1RT5 A;  1RDA A;  3JSM A;  1NJZ A;  4CEQ A;  4DU1 A;  1ASW A;  3V1O A;  1VSM A;  1TKD A;  5KGW A;  3DLH A;  3NE6 A;  1JLB A;  3V4I A;  4CF2 A;  4I2Q A;  4DTR A;  2HHU A;  3CG7 A;  1R0A A;  2OPP A;  3OYD A;  3NCI A;  4Z4E A;  4Y1D A;  3K57 A;  4CJK A;  3RR7 A;  2PZS A;  3IRX A;  3KK1 A;  1X9W A;  4IFY A;  3VQQ A;  1DLO A;  3C6T A;  1EXQ A;  3NGY A;  5CZ2 A;  4F3T A;  1RTH A;  3LDS A;  1G15 A;  4DTX A;  1RT7 A;  3LAM A;  1UOC A;  4CF9 A;  2D0A A;  2OZS A;  1ASU A;  3VQA A;  4B8C A;  4M3W A;  4FZY A;  2HVI A;  3SYZ A;  5J2P A;  1U49 A;  4GVM A;  3VQ7 A;  2E6L A;  4CJV A;  1S1U A;  2VWJ A;  1T05 A;  1EP4 A;  2ZQB A;  3QEW A;  4OKE A;  1BIU A;  3AO3 A;  2W42 A;  4FLU A;  1Q9X A;  1NK5 A;  1Q8I A;  1GOC A;  3OYE A;  1WNS A;  3OYI A;  3DLE A;  3L2W A;  2G8V A;  4KPY A;  1Y97 A;  2YNG A;  1ASV A;  4DF8 A;  4CEA A;  1XC9 A;  1IKX A;  3KD1 E;  3MEG A;  2KW4 A;  4KHW A;  1BQM A;  2YHA A;  4DFJ A;  1RBT A;  4FW2 A;  4IG3 A;  2Y1J A;  3F9K A;  1FKP A;  1VSD A;  4CJ5 A;  1U04 A;  3THV A;  2OA8 A;  1VRT A;  2NUB A;  4E7J A;  4KKO A;  2BAN A;  1TKT A;  2X6S A;  1HNV A;  3DOK A;  3AV9 A;  4PY5 A;  5DK5 A;  4E19 A;  4B9M A;  2OYQ A;  4W5T A;  3OS1 A;  2EHG A;  2X74 A;  3V9S A;  3PO4 A;  3ZSZ A;  4CER A;  4DQI A;  2IAJ A;  4HCC A;  2VG6 A;  4O0J A;  4FZZ A;  4KHY A;  1C0T A;  3V9U A;  4E7L A;  1U47 A;  5HRP A;  1S9G A;  4ELV A;  4I2P A;  3VQ5 A;  4TSX A;  1RBU A;  2HHT A;  1JLG A;  4DS5 A;  3KLH A;  5J2Q A;  3NF6 A;  4BE1 A;  5HRR A;  4LY7 A;  1Q9Y A;  5DMR A;  5JS1 A;  1RTI A;  4E7K A;  1TAQ A;  3DRR A;  1ZBI A;  4E89 A;  1NKE A;  3C94 A;  4DSE A;  2ITG A;  4AHU A;  4M3X A;  4DSJ A;  1CXQ A;  3KLG A;  2WON A;  4DLE A;  4DTO A;  3CYM A;  2F96 A;  3AVI A;  2BE2 A;  3ISN C;  1TK8 A;  1KRP A;  3PX4 A;  4IKF A;  3HYF A;  4IBN A;  4CK2 A;  2Z1H A;  3AVF A;  3KD5 E;  1GOB A;  1VSE A;  3DRS A;  3WNF A;  4DLG A;  4CIF A;  1IO2 A;  5I42 A;  1CLQ A;  4N5S A;  1W0H A;  2P1J A;  3K5N A;  5CYQ A;  4O44 A;  3VQ4 A;  5HLF A;  1QE1 A;  3OYJ A;  1VSF A;  1U45 A;  2IC3 A;  3O3G A;  5C42 A;  1JLC A;  1HMV A;  2R7Y A;  4FLX A;  2IS3 A;  3L3U A;  4HUE A;  1UA1 A;  2P5O A;  2F8S A;  4F4K A;  3QNO A;  2KFZ A;  1S1X A;  4E1N A;  3WNE A;  2VG7 A;  4AHS A;  3OJS A;  3PX0 A;  1KFS A;  3ZT2 A;  3SUP A;  5EU7 A;  3ZCM A;  1JL2 A;  1RNH A;  4DQQ A;  5J2N A;  4I9Q A;  3O4Q A;  4DSI A;  4CJ4 A;  1RT6 A;  3NH2 A;  4FJM A;  4L8R B;  2IDO A;  4OJR A;  3SV4 A;  3S3N A;  4AHT A;  4FJN A;  2YHB A;  4HTU A;  3MED A;  4ICL A;  4CHZ A;  4FLT A;  2G8I A;  5J1E A;  1NK7 A;  1RCH A;  3AA3 A;  3DLR A;  2Q3S A;  2YKN A;  3B6O A;  3QET A;  1X9S A;  4M3T A;  4CJU A;  2B6A A;  3SUN A;  1IH7 A;  1RBV A;  4C8N A;  2IOC A;  2D0C A;  4GMJ B;  2FBY A;  1BGX T;  3OS2 A;  3AO1 A;  4EZ6 A;  4CK3 A;  1WAJ A;  4KRE A;  4F2S A;  1RBR A;  2E6M A;  2RPI A;  4CED A;  4N76 A;  5FRM A;  2YNH A;  3TAP A;  3L2V A;  1RDD A;  4OVL A;  4CHO A;  3M8Q A;  3V81 A;  4ELT A;  2Z1G A;  4KFB A;  4W5N A;  3LPT A;  1TKX A;  3VA3 A;  3AVM A;  1NK0 A;  2IGI A;  1VSJ A;  4CJS A;  1KTQ A;  3KK3 A;  1B9F A;  3TI0 A;  2AJQ A;  1IKY A;  3SQ1 A;  1LW2 A;  1S5J A;  3NBP A;  1BIZ A;  4F2R A;  4CJT A;  3TAG A;  4EP4 A;  1YTA A;  3TAE A;  4HVJ A;  3I0S A;  2B4J A;  1FKO A;  4CJQ A;  4KHQ A;  3T3F A;  4YNQ A;  1D5A A;  3AVK A;  1XI1 A;  1CZ9 A;  1GOA A;  1S6P A;  4NYN A;  4DG1 A;  3NGZ A;  3K59 A;  3VN5 A;  1KVA A;  5K14 A;  3ULD A;  4FJ5 A;  1BI4 A;  2LSN A;  4CF8 A;  3OYA A;  4CJF A;  1NJX A;  3QEP A;  2YKM A;  2EX3 A;  3TAF A;  4PQU A;  1TL1 A;  5J2M A;  3O4N A;  2ZD1 A;  3OYM A;  3VA0 A;  1SL1 A;  4B08 A;  1NK6 A;  4WE1 A;  4ZHR A;  3ZT1 A;  1A5W A;  1NJY A;  3RR8 A;  1HPZ A;  2DFH A;  2XY8 A;  3OY9 A;  4HCB A;  1JLE A;  1JLF A;  4LH5 A;  4BDP A;  4NCG A;  5T7B A;  1HYS A;  2KQ2 A;  4OKJ A;  2QK9 A;  3VQC A;  1JXE A;  1C1A A;  4FM1 A;  4R5P A;  2P5G A;  2P51 A;  4OKK A;  4YFU A;  1FK9 A;  4FJL A;  5SZT A;  3BDP A;  4DTS A;  3L8B A;  3O3H A;  4UQG A;  3HVR A;  4I7F A;  4C8M A;  2OPR A;  1UWB A;  2HNY A;  3RMD A;  4DU3 A;  4BDZ A;  4KI4 A;  1TL3 A;  2OZM A;  2HB5 A;  4DQR A;  3LP3 A;  1I3A A;  2G8F A;  3SUQ A;  3LP2 A;  1TGO A;  3ZSX A;  4CGG A;  1RTD A;  1C1C A;  1HYV A;  3U3G A;  2KZZ A;  3ZSY A;  1WN7 A;  1KCF A;  1XHX A;  3B6P A;  4LSL A;  2YNF A;  3OYF A;  2QKK A;  4FJG A;  4KTQ A;  1REV A;  2I5J A;  2DFE A;  1JLQ A;  3LZJ A;  3V9X A;  1WSG A;  4DSK A;  3QEV A;  1I39 A;  1BL3 A;  3NH0 A;  4GW6 A;  4C8O A;  4PWD A;  1VSK A;  3RTV A;  3PX6 A;  3TAN A;  4DQP A;  3PY8 A;  4CJW A;  2D0B A;  3FFI A;  3MXJ A;  4RW9 A;  4CFC A;  3L2R A;  3HXM A;  3S9H A;  2F8T A;  1WSF A;  4E7H A;  2DY4 A;  2YV0 X;  3I8D A;  3LP0 A;  3AVG A;  1X1P A;  3QEX A;  2QKB A;  2GBZ A;  2HHW A;  4CGI A;  1ITG A;  1HQU A;  4KV8 A;  4LH4 A;  4M41 A;  2X78 A;  2O4G A;  1KSP A;  3SNN A;  1CXU A;  3SCX A;  2KTQ A;  2XO7 A;  1TK0 A;  1HQE A;  5FRN A;  1LWC A;  3NF7 A;  3RRH A;  1C0M A;  3QER A;  4FLW A;  4O0I A;  3DOL A;  4Y1C A;  4DTP A;  1KLM A;  3NFA A;  3VQ6 A;  5D3G A;  3AVL A;  2WOM A;  3LWM A;  4DS4 A;  3M8P A;  3KIO A;  2DTU A;  3CM6 A;  2RF2 A;  3MXM A;  4KHN A;  2JGU A;  3VQ8 A;  3VQD A;  4M3U A;  3L3V A;  2VG5 A;  3LAK A;  3P83 D;  1SL0 A;  4NCB A;  3RMC A;  1A5X A;  4DSL A;  1N5Y A;  3AO5 A;  4CIG A;  4FK4 A;  1QSS A;  3TAR A;  2OPQ A;  3K2P A;  1S1V A;  5I3U A;  4B9N A;  4AHR A;  1LAW A;  3DM2 A;  3HPH A;  4F8R A;  2VWK A;  4N41 A;  1ZYQ A;  3ZSO A;  3SQ2 A;  1RT4 A;  1NJW A;  4FJ9 A;  3MAQ A;  4ZTJ A;  1YTU A;  1WSJ A;  5FDL A;  1O1W A;  1KLN A;  4IFV A;  4DTJ A;  3QO9 A;  5CY4 A;  4Z4C A;  1YT3 A;  3HPG A;  3K5L A;  5KI6 A;  3T1A A;  1BCO A;  4LSN A;  4BAC A;  3TAQ A;  4FYD A;  2RN2 A;  2X6N A;  2E4L A;  4DWI A;  2G8K A;  4CCH A;  3OS0 A;  4CEB A;  4DQS A;  1KFD A;  4FXD A;  4G1Q A;  3MXI A;  3ZT4 A;  3U6F A;  4FVM A;  3TR8 A;  2YNI A;  3TAM A;  4FM2 A;  4FLV A;  4KRF A;  1JLA A;  1TKZ A;  4BE2 A;  2B5J A;  3E01 A;  1J9A A;  3LP1 A;  4KI6 A;  3CM5 A;  4RG8 A;  1QSY A;  1HJR A;  3TAB A;  4CGH A;  4CIE A;  1JXB A;  2RKI A;  1NK9 A;  4JS4 A;  4KHS A;  3HK2 A;  3M8S A;  2Z1I A;  4AHV A;  3ZSR A;  3TWH A;  3ITH A;  4DMN A;  1LWF A;  3QIP A;  4MFB A;  3HT3 A;  4DU4 A;  3I0R A;  4DFK A;  3QES A;  1B92 A;  3QEI A;  1EX4 A;  4O4G A;  1D9D A;  4B9S A;  3UIQ A;  2HHV A;  1L3S A;  1XWL A;  3VQB A;  3NHG A;  2DFF A;  1EKE A;  3CFR A;  4FK2 A;  3QIN A;  1HYZ A;  1X9M A;  1TK5 A;  3OYC A;  5C24 A;  3ZSW A;  3V1Q A;  4FJ7 A;  3VQE A;  1KVC A;  3AVC A;  1RTJ A;  3AA2 A;  1Z25 A;  1IKV A;  4CFA A;  2GV9 A;  4CJE A;  3AA4 A;  5HRS A;  4JRQ A;  4KB1 A;  3OYH A;  1HNI A;  3KLE A;  3AA5 X;  4BWM A;  1L3V A;  3PO5 A;  4Q5V A;  1L3U A;  4CE9 A;  1S6Q A;  4H4M A;  2A1S A;  2JLE A;  4QAG A;  2FBV A;  4BWJ A;  3OYB A;  3OYL A;  4J2B A;  4EZ9 A;  3DLG A;  4FK0 A;  1RDC A;  4FJX A;  1JKH A;  1U48 A;  4AHC A;  4KB0 A;  3OVN A;  4KHU A;  4E1M A;  4CJ3 A;  1QTM A;  1RDB A;  1C6V A;  3AVN A;  2BGG A;  4W5R A;  4Z4F A;  2FBT A;  3KKS A;  4M3Z A;  3C95 A;  3HPO A;  1WSE A;  1T7P A;  1ZBL A;  1RIL A;  4B9L A;  3WNH A;  3KLI A;  1NOY A;  3WNG A;  2XY6 A;  3S3M A;  1TVR A;  4AH9 A;  1WSI A;  4CHN A;  3NF8 A;  1F21 A;  1LV5 A;  1NKB A;  4M45 A;  1ZBH A;  3DLK A;  5HRO A;  3AVB A;  1ZBF A;  4J2D A;  4CJP A;  2XY7 A;  2ETJ A;  4RW7 A;  2HHQ A;  1Z26 A;  1RBS A;  1VSI A;  4HUG A;  5CYM A;  1QS4 A;  5E41 A;  3KJV A;  1WAF A;  5C25 A;  1SKW A;  3LPU A;  4B9V A;  3HJF A;  3VQ9 A;  3HST B;  2Z1J A;  1XHZ A;  1LWE A;  2KFN A;  3AVA A;  4OLA A;  5HRN A;  3KLF A;  3EZ5 A;  3SUO A;  1BQN A;  2FBX A;  4NYF A;  2HNZ A;  3SZ2 A;  3ASM A;  2PYJ A;  3ZT0 A;  3ZSV A;  3L2U A;  4DFP A;  3HVT A;  1S9E A;  4ID1 A;  1J54 A;  4OGC A;  4OPJ A;  4BDY A;  3BGR A;  3SV3 A;  4E7I A;  3DLB A;  4QOZ B;  2G8H A;  2G8W A;  1JL1 A;  1SV5 A;  3RRG A;  4CFB A;  1NOZ A;  1YVU A;  5KRS A;  2XHB A;  3V9Z A;  1J5O A;  2QXF A;  2O4I A;  1A5V A;  1BCM A;  3P1G A;  4ID5 A;  1TAU A;  4OGE A;  4CF0 A;  4OLB A;  1IKW A;  1RT1 A;  4M3R A;  4KTZ A;  2FC0 A;  2XRI A;  3F73 A;  1VSL A;  1QQC A;  2D5R A;  1HRH A;  4DTU A;  4J2E A;  3NDK A;  1N6Q A;  3G10 A;  3HM9 A;  4CEO A;  2Y1I A;  3ALY A;  4CEE A;  4FM0 A;  1J53 A;  3HO1 A;  1DTQ A;  5JS2 A;  4W5O A;  4FJJ A;  4DTM A;  4O5B A;  1K6Y A;  3IS9 A;  4CGJ A;  4CHY A;  4KTW A;  4RW8 A;  3KK2 A;  4CEC A;  3QNN A;  1LW0 A;  1FXX A;  1L3T A;  1L5U A;  3MEC A;  4FJ8 A;  3SI6 A;  4H4O A;  1CZB A;  2ATQ A;  4CJL A;  3O3F A;  3LWL A;  3JYT A;  4ZTF A;  5KRT A;  1NK4 A;  3KTQ A;  4KAZ A;  1KVB A;  3V6D A;  4IDK A;  1LAV A;  5HP1 A;  3SPZ A;  1UA0 A;  3LZI A;  4B9U A;  4CK1 A;  5KGX A;  3DMJ A;  4FJH A;  4CHQ A;  3KKR A;  3NH1 A;  4FLZ A;  2PYL A;  4E0D A;  4FLY A;  2BDP A;  3A2F A;  1IG9 A;  2HW3 A;  4MQ3 A;  3IAY A;  4JLH A;  3AO2 A;  4CEF A;  3NF9 A;  3RMA A;  1C1B A;  2A1R A;  4CGD A;  1SL2 A;  1D9F A;  2G8U A;  4LD0 A;  3SPY A;  3IG1 A;  1WSH A;  4CEZ A;  3P5J A;  1T8E A;  4K8Z A;  4Z0U A;  3VQP A;  3SJJ A;  4Z4G A;  3DRP A;  4CES A;  3LAL A;  4AIL C;  4IG0 A;  1SKR A;  3EY1 A;  1BHL A;  1TV6 A;  5SWM A;  3OYK A;  1NK8 A;  3G0Z A; 
#chains in the Genus database with same CATH topology
 4JI0 K;  1U4B A;  1P8Z A;  2O8C B;  1W9H A;  2BTF A;  4HUF A;  1NKC A;  1SKS A;  3K5M A;  4BG8 A;  3LAN A;  3D45 A;  2XY5 A;  4E3S A;  3QIO A;  2HHS A;  3O08 A;  4B3O A;  2HBJ A;  1E4G T;  4H03 B;  4I9L A;  1MU2 A;  5HBM A;  1QQN A;  3VF4 A;  3VF6 A;  2OPS A;  4K8X A;  3HM8 A;  2Q2R A;  3P4I A;  1UAX A;  4KO0 A;  4XIU A;  3S3O A;  4PA1 A;  4DV3 K;  3DI6 A;  4WFB L;  4J2A A;  5CZ1 A;  4FJK A;  1K8K A;  4Z4H A;  4H0T B;  3OYG A;  4DSF A;  4FJI A;  3L2Q A;  1MWK A;  3H08 A;  4N56 A;  3MEE A;  5GAH P;  4DTN A;  4L3Q A;  1RDA A;  4K42 A;  3GBT A;  3DLH A;  3NE6 A;  4BQZ A;  3AY9 A;  1QQM A;  3K9K A;  4I2Q A;  1R0A A;  2ASP A;  3OYD A;  3NCI A;  4Y1D A;  4CJK A;  2PZS A;  3CJA A;  3IMX A;  1EXQ A;  3NGY A;  3MN7 A;  4F3T A;  1RTH A;  3LAM A;  1HKB A;  4LF9 K;  1UOC A;  2D0A A;  1X3M A;  3VQA A;  4M3W A;  3ZEU A;  3PSF A;  4GVM A;  4ISE A;  3VQ7 A;  4WQ5 A;  2VWJ A;  4JI5 K;  3AO3 A;  4JKG A;  4FLU A;  4GV3 A;  2AA4 A;  1Q8I A;  2P9S B;  2G8V A;  3OYI A;  3DLE A;  1KQS M;  5AQW A;  1ASV A;  1XNR K;  4CEA A;  3AAP A;  4EHU A;  1BQM A;  4FW2 A;  3THV A;  1VSD A;  1FKP A;  4E7J A;  1Q18 A;  3AV9 A;  4E19 A;  4B9M A;  4PY5 A;  3U9Z A;  3THX A;  3OS1 A;  2EHG A;  3V9S A;  4KHY A;  3CPW M;  4CER A;  4O0J A;  1FJG K;  3MN6 A;  1U47 A;  2AP1 A;  3VQ5 A;  4TSX A;  3KLH A;  4M63 C;  3SBT A;  1N32 K;  4CD1 A;  3DRR A;  4BRN A;  3R8E A;  3J7Z O;  1HNX K;  3RSE A;  5FLX O;  1HPM A;  4X65 K;  2WON A;  4LF7 K;  5LY3 A;  3CYM A;  3AVI A;  2BE2 A;  2FF6 A;  3F9M A;  5KPR A;  1KRP A;  2OTJ N;  3HYF A;  4CK2 A;  2Z1H A;  1GOB A;  4C1N K;  1VSE A;  5JLF A;  1IO2 A;  5I42 A;  1CLQ A;  3DXK A;  1W0H A;  3CCM N;  2P1J A;  3C6A A;  3VQ4 A;  4X66 K;  3D6R A;  2A5X A;  1QE1 A;  1VSF A;  1U45 A;  5C42 A;  4HUE A;  2KFZ A;  2D0O A;  1RDW X;  3WQU A;  3OJS A;  4AHS A;  1NG9 A;  1BG3 A;  3ZT2 A;  3SUP A;  1JL2 A;  5J2N A;  5CHI A;  4BGA A;  3ZLJ A;  4CJ4 A;  2GWK A;  3L6Q A;  3SV4 A;  4HTU A;  4ICL A;  4FLT A;  1RCH A;  3DLR A;  4M3T A;  2UXC K;  1VQP N;  2B6A A;  1SAZ A;  2D0C A;  4EAH D;  1M1K O;  3R6M A;  2FBY A;  4WYB A;  4KRE A;  1RBR A;  1KD1 O;  2E6M A;  1OH5 A;  2O8D B;  1GLB G;  4N76 A;  3G4S N;  4ISF A;  2YNH A;  3L2V A;  1RDD A;  3D2E B;  4CHO A;  3M8Q A;  3V81 A;  2Z1G A;  4BRP A;  3AVM A;  5AJ3 K;  4JI6 K;  3L4I A;  1ILY A;  5ADX H;  1LW2 A;  1BIZ A;  4BR2 A;  4F2R A;  2KHO A;  4EP4 A;  3C7N A;  1NGH A;  5JVH L;  3T3F A;  2F4V K;  1GOA A;  1IG8 A;  3NVK A;  4NYN A;  3SMP A;  4DHY A;  1BI4 A;  4K41 A;  2WTU A;  4LC9 B;  1OH7 A;  3DXM B;  4PQU A;  3CCL N;  1TL1 A;  1T6C A;  4ZHR A;  1HNZ K;  2P9I B;  5AQK A;  1HJO A;  1HPZ A;  3SMS A;  4KBO A;  5TKW A;  3DLL L;  1JLE A;  4LH5 A;  2CH5 A;  4NCG A;  1JXE A;  4FM1 A;  4YFU A;  1FK9 A;  5HOO A;  3BDP A;  4DTS A;  3L8B A;  1YXQ A;  4C8M A;  3CF5 L;  3RMD A;  4KI4 A;  4JK7 A;  4DQR A;  5B8H A;  1RTD A;  1HYV A;  3U3G A;  1WN7 A;  1NGF A;  3OYF A;  2D0P A;  2QKK A;  1IJJ A;  4JI4 K;  4KTQ A;  4BRE A;  1I39 A;  4BRC A;  4GW6 A;  1ATR A;  1VSK A;  4IOA L;  1ZXO A;  2D0B A;  3MXJ A;  3VTI A;  1FW6 A;  3O9T A;  3S9H A;  2UUB K;  3JS6 A;  3E9O A;  1N33 K;  4JI2 K;  1GLC G;  4DV4 K;  2QKB A;  2RHK A;  4H5W A;  2GBZ A;  4CGI A;  1ITG A;  4JD2 B;  2O4G A;  4FSV A;  3ZET B;  5H1S Q;  3SNN A;  4IFE A;  2XO7 A;  2A41 A;  1LWC A;  3NF7 A;  4KH6 A;  4CBU A;  3FR0 A;  5AQV A;  2I7P A;  2JWK A;  3EN9 A;  3NFA A;  4JK8 A;  2ZJP L;  4DS4 A;  4BRO A;  3M8P A;  4DR5 K;  2RF2 A;  4KHN A;  5BRD A;  1GLF O;  1EQY A;  4Z94 A;  4JKA A;  4H0O A;  1LOT B;  1D4X A;  3TAR A;  1S1V A;  4B9N A;  2Q1N A;  3DM2 A;  4JHD B;  1K8K B;  1NJW A;  1YTU A;  2O8E A;  4DTJ A;  3MN9 A;  3TAQ A;  5KI6 A;  1BCO A;  2RN2 A;  4WF9 L;  4HTL A;  3SAG A;  4FXD A;  3MXI A;  3ZT4 A;  4FVM A;  4O5F A;  4FWM A;  3TR8 A;  1TYQ B;  4FM2 A;  4FLV A;  1JLA A;  1TKZ A;  4PKI A;  3LP1 A;  4KI6 A;  1HJR A;  3TAB A;  2E8A A;  1JXB A;  3H3N O;  2Z1I A;  4AHV A;  3O1B A;  1BA1 A;  2QEX N;  4MFB A;  4NB4 A;  4DFK A;  4JNE A;  1D9D A;  3QEI A;  3VQB A;  2DFF A;  1EKE A;  5FPM A;  5BN9 A;  4DQ8 A;  2V51 B;  4FK2 A;  3OYC A;  5C24 A;  4FJ7 A;  3AA2 A;  1IKV A;  4BWM A;  4IOC L;  2VCP A;  2WBN A;  4BWJ A;  4EZ9 A;  1JKH A;  3O4W A;  4AHC A;  5DM7 L;  2FSN A;  4KB0 A;  4E1M A;  4CJ3 A;  1C6V A;  2FBT A;  3C95 A;  1ZBL A;  1RIL A;  3QFP A;  1NOY A;  3H1V X;  3WNG A;  3S3M A;  1WSI A;  4BY9 C;  4OPH A;  2OCE A;  3C0B A;  4M45 A;  2HST A;  1GLA G;  1ZBF A;  2F7T A;  3RSE B;  5GAD P;  1NMN A;  1VSI A;  5E41 A;  3TSU A;  1SKW A;  5C25 A;  3HST B;  1XHZ A;  1X9J A;  2EWS A;  5FPN A;  5HRN A;  1BQN A;  3ASM A;  3ZT0 A;  4K25 A;  1J54 A;  4E7I A;  1JL1 A;  1SV5 A;  5M1O A;  4BG9 A;  5AQQ A;  1TAU A;  4OGE A;  3THY B;  3FGU A;  4Y0W A;  1VQK N;  4CEO A;  3ALY A;  4CEE A;  1OH8 A;  1DTQ A;  2DPN A;  4W5O A;  1S22 A;  1K6Y A;  3O80 A;  4CGJ A;  3QNN A;  4RW8 A;  3CMA N;  4CEC A;  4FJ8 A;  4FWO A;  4H4O A;  3LWL A;  4ZTF A;  1NK4 A;  4CZE A;  3LZI A;  5KGX A;  3DMJ A;  2FLO A;  3KKR A;  2PYL A;  2P9S A;  4M7Y A;  5A2Q O;  3IAY A;  5AQP A;  3AO2 A;  2VQE K;  4CEF A;  1SL2 A;  3QBX A;  1KC8 O;  2YHX A;  3OBY A;  1N8R O;  4AIL C;  3LAL A;  2J4R A;  1NK8 A;  2PBD A;  4B1X B;  3VGK A;  3A5L C;  3CJ7 A;  1WLJ A;  2IVN A;  1T03 A;  4ELU A;  2HMI A;  4FCY A;  4RW6 A;  4EFH A;  5AZJ B;  4B9T A;  1BI4 B;  2HBK A;  2H3G X;  3V1R A;  4MLH A;  4NCA A;  3AVJ A;  4N47 A;  1JJ2 M;  4M3Y A;  2Q0U A;  4KH5 A;  1QHT A;  3PV8 A;  2W41 A;  2HVH A;  4H8K A;  2A42 A;  4CZI A;  3NGI A;  5KTQ A;  3HP6 A;  1XMO K;  3OYN A;  3NMU A;  3CQ8 A;  3VTH A;  1ZBU A;  3S41 A;  3SQ4 A;  4F3O A;  3VEW A;  3CC4 N;  3M8R A;  1RT2 A;  3ATV A;  5JLH A;  4YOV A;  3O8M A;  4PUO A;  4HHT A;  3RMB A;  4LFC K;  3QML A;  1ASW A;  2O8F B;  1VSM A;  2W40 A;  3UKU A;  3VGL A;  3AGR A;  3WXM B;  2O8D A;  3J7Y P;  4WFA L;  3KK1 A;  2P9N B;  3D2E A;  2NNW A;  4O8U A;  5CZ2 A;  3FZM A;  4CF9 A;  1ASU A;  3HZ6 A;  4FZY A;  5TKY A;  4X64 K;  3SYZ A;  1U49 A;  1R59 O;  1T05 A;  5AR0 A;  2W42 A;  2QXL A;  1E3M A;  4JI7 K;  3A0I X;  2YHA A;  4DFJ A;  4JKF A;  4IG3 A;  2Y1J A;  3F9K A;  1U04 A;  1VRT A;  2NUB A;  3VEY A;  4KKO A;  3DXM A;  2BAN A;  1C0F A;  1TKT A;  3H45 C;  5DK5 A;  3MN5 A;  5KPT A;  4E1J A;  2A40 A;  3ZSZ A;  4HCC A;  4DQI A;  3W3D A;  4FZZ A;  2P9I A;  2O8E B;  5HRP A;  4ELV A;  2CGL A;  5J2Q A;  4BE1 A;  4JN4 A;  3O9U A;  1ZBI A;  2QI2 A;  3C94 A;  5GIP A;  3PSI A;  4DSE A;  4MDA A;  4M3X A;  3HTV A;  2UYT A;  4H5T A;  4AQY K;  4BRQ A;  3GE1 A;  2F96 A;  3N4Q A;  4IBN A;  3AVF A;  4OPA A;  3A8Y A;  3I33 A;  4CIF A;  3K0S A;  4N5S A;  5CYQ A;  3O3G A;  1HMV A;  3J80 O;  2V52 B;  4F4K A;  3QNO A;  5EY4 A;  1LCU A;  2VG7 A;  5EU7 A;  3ZCM A;  5BRE A;  1RNH A;  4DQQ A;  2QW9 A;  3OBW A;  4DSI A;  3FZK A;  4FJN A;  4A62 A;  4JD2 A;  3A5M C;  3MED A;  4CHZ A;  3ZET A;  1GLD G;  2G8I A;  1VQ5 N;  3B6O A;  3D2F B;  1WBD A;  4CJU A;  4JI3 K;  4C8N A;  4ILJ A;  3OS2 A;  2VGM A;  3AO1 A;  3E9L A;  3FFK B;  4CK3 A;  1W97 L;  4JI1 K;  4DR7 K;  2RPI A;  4MO5 A;  4CED A;  3AGK A;  5FRM A;  4OVL A;  3VA3 A;  1TKX A;  4YOY A;  4JHD A;  1B9F A;  3TI0 A;  2AJQ A;  3SBG A;  5HL7 L;  3TAG A;  3WQT A;  1YTA A;  4G9Z A;  1K73 O;  2B4J A;  4KHQ A;  4YNQ A;  1XI1 A;  1S6P A;  4BC2 A;  4DG1 A;  3K59 A;  2E2P A;  3BUZ B;  1KVA A;  4CBX A;  4FJ5 A;  4ILG B;  1TYQ A;  2YKM A;  1NK6 A;  3PLA A;  1V4S A;  2KKZ A;  2XY8 A;  3OY9 A;  4ISG A;  1HYS A;  3OTO K;  1Y64 A;  3VQC A;  5AQZ A;  1SS6 A;  4R5P A;  3CJC A;  2P5G A;  1WBB A;  4FJL A;  5SZT A;  3MCP A;  1QHA A;  4YDU A;  2OPR A;  4BDZ A;  4AM7 A;  2OZM A;  2HB5 A;  2QTD A;  3P39 A;  3ZSX A;  2ASO A;  3ZSY A;  1KCF A;  1XHX A;  4FJG A;  5IT9 O;  1T6D A;  4NXM K;  1REV A;  4BR7 A;  2DFE A;  1JLQ A;  2QM1 A;  3TTD A;  3QEV A;  1BL3 A;  4PWD A;  3RTV A;  4DR4 K;  2NRZ A;  4CJW A;  3WXI A;  2F8T A;  1WSF A;  4IWV A;  3TSP A;  4BRF A;  2YV0 X;  3I8D A;  3LP0 A;  4EIA A;  1X1P A;  2D4W A;  5GIO A;  2KTQ A;  1TK0 A;  4OO1 J;  2A6A A;  4IO8 A;  1C0M A;  5EOY A;  1IBM K;  4O0I A;  4DTP A;  3UKR B;  3VQ6 A;  3AVL A;  2IVP A;  2WOM A;  4H0P A;  3IUC A;  3L0Q A;  3MXM A;  3VQ8 A;  3L3V A;  2VG5 A;  3LAK A;  3DWL A;  5AFU A;  3P83 D;  1SL0 A;  4NCB A;  3RMC A;  3THY A;  3AO5 A;  2NLX A;  4FK4 A;  3EE9 A;  1QSS A;  5AQF A;  3KWG A;  3ZSO A;  3ZX0 A;  2FXU A;  3BF1 A;  3H46 O;  3SQ2 A;  1I94 K;  3MAQ A;  1WSJ A;  1KLN A;  1O1W A;  3QO9 A;  4BC5 A;  3K5L A;  3T1A A;  3ENH A;  4XH1 A;  4WFN L;  5M1P A;  4A61 A;  4CCH A;  4H5R A;  1JCE A;  3UKU B;  3LM2 A;  1EWQ A;  2YNI A;  2QWO A;  3TAM A;  2B5J A;  4BVP A;  1J6Z A;  2NZT A;  4H5V A;  4RG8 A;  3QIC A;  3TU5 A;  1QSY A;  1OVQ A;  4CGH A;  3HK2 A;  2RKI A;  4IOX A;  4JS4 A;  3HOT A;  2A3Z A;  3EKS A;  3ITH A;  4DMN A;  3QIP A;  2PFU A;  5KQD A;  5MLC Q;  3QES A;  4B9S A;  3UIQ A;  2HHV A;  1L3S A;  3FE1 A;  3CFR A;  3NHG A;  2ZM6 K;  1XNQ K;  1TK5 A;  1X9M A;  4B9Q A;  4BRD A;  3C6H A;  4YOW A;  4CFA A;  4JRQ A;  5AZJ A;  3AA4 A;  3EKU A;  3AA5 X;  2E2Q A;  4CE9 A;  4H4M A;  2FBV A;  2YI1 A;  1YJN N;  4J2B A;  3DLG A;  5EX5 A;  4FVU A;  4FJX A;  1QTM A;  2NRV A;  4Z4F A;  4M3Z A;  4JAX A;  1T7P A;  3SAF A;  4B9L A;  3WNH A;  3KLI A;  4K0K K;  4EHT A;  1TVR A;  3NF8 A;  2YHW A;  1F21 A;  1LV5 A;  1NKB A;  1MDU B;  3DLK A;  3AVB A;  4CJP A;  2XY7 A;  4RW7 A;  2HHQ A;  5BRH A;  3HI0 A;  2VQF K;  1QS4 A;  4H0X B;  3KJV A;  1WAF A;  3HJF A;  3VQ9 A;  2GX9 A;  4FWK A;  2FBX A;  2YX6 A;  3E1Y A;  3A5O C;  5EVZ A;  3ZX3 A;  2WC9 A;  1S9E A;  4ID1 A;  4DV7 K;  4UY8 O;  4QOZ B;  3U9D A;  3RRG A;  4CVN E;  1J5O A;  2QXF A;  2O8F A;  2O4I A;  2NRH A;  1A5V A;  3ID8 A;  5E84 A;  4ID5 A;  2UXD K;  2V7Z A;  1IKW A;  5C12 A;  3EEQ A;  1QQC A;  4J2E A;  3MWT A;  1YVN A;  2P9N A;  4FM0 A;  3OW2 M;  4O5B A;  5ELZ A;  1LW0 A;  1FXX A;  3SI6 A;  3O3F A;  3JYT A;  4CJL A;  4KAZ A;  3EZW A;  2FSJ A;  5JMV A;  5HP1 A;  1UA0 A;  1LAV A;  3WEE A;  4DV2 K;  4FLZ A;  1JCF A;  4FLY A;  3I8B A;  3DAW A;  4GKK K;  1VQM N;  1OVY A;  3LM9 A;  4LD0 A;  3P5J A;  1VQ6 N;  1NNE A;  3ULE B;  3I55 N;  5I9E B;  4BR5 A;  4BRA A;  3DRP A;  4IG0 A;  4IO9 L;  3EY1 A;  1BHL A;  5AQH A;  2IIR A;  5F1X A;  5SWM A;  2Y1I A;  3MCA B;  3MEC A;  3G0Z A;  4JS5 A;  3T1H K;  3T19 A;  4NO7 A;  3E66 A;  3BF3 A;  1VK0 A;  3D0P A;  1H1V A;  3SQ0 A;  4B8A B;  3C6U A;  4Q0B A;  4DR6 K;  2GEL A;  4C8L A;  1WUA A;  3K58 A;  4Z4I A;  1BOT O;  4CZM A;  3EYZ A;  3QLH A;  3ENB A;  5AQG A;  2ZF5 O;  4EP5 A;  5F0X A;  5GAG P;  2PY5 A;  3RWU A;  4YDU C;  3O6W A;  1D8Y A;  3AO4 A;  4JRP A;  4M42 A;  4CZL A;  5LL6 Z;  4A5A A;  3U3Y A;  4A59 A;  1SUQ A;  3ZSQ A;  3HL8 A;  3MWP A;  3CFP A;  2HND A;  3OJU A;  3ZT3 A;  4FWN A;  3PUF A;  4DFM A;  3LDL A;  1C0U A;  1VRU A;  4DR2 K;  1J5E K;  4CHP A;  4OPK A;  4C8K A;  3CC7 N;  3D2F A;  2E2N A;  3BP8 A;  3JSM A;  1YJ9 N;  4CEQ A;  4DU1 A;  3V1O A;  5KGW A;  3CC2 N;  4B3M K;  1KAY A;  4NLC A;  4CF2 A;  3V4I A;  4DTR A;  5F2R A;  2GWJ A;  3THW B;  3K57 A;  3RR7 A;  1M90 O;  3IRX A;  1X9W A;  1YIT N;  3VQQ A;  3TSQ A;  3LDS A;  3SJH A;  1RT7 A;  4IEI A;  1Q7Y O;  4BVO A;  1Z05 A;  3HRG A;  2HVI A;  3B8A X;  2E6L A;  1S1U A;  4OKE A;  1Q9X A;  3OYE A;  3L2W A;  1WNS A;  1Y97 A;  3RVC A;  1IKX A;  4KHW A;  2KW4 A;  4FOE A;  1QVF M;  4OLB A;  1RBT A;  2OA8 A;  1NMD A;  3SK3 A;  1S3X A;  2X6S A;  3MDQ A;  3DOK A;  2OYQ A;  3FLC O;  1VQN N;  2VG6 A;  4E7L A;  2FSK A;  3CJ9 A;  1RBU A;  2HHT A;  1JLG A;  4B1Z A;  1NGA A;  1HNW K;  1NBW A;  1RTI A;  4BC4 A;  3W0L A;  4E89 A;  1NKE A;  3AAR A;  2NRR A;  4AHU A;  3H6E A;  1XMQ K;  4B3R K;  3KLG A;  4DLE A;  4DTO A;  1TK8 A;  3ISN C;  4IZ9 A;  3WNF A;  3DRS A;  3WXJ A;  4DLG A;  3K5N A;  3HBT A;  4O44 A;  3OYJ A;  2NRX A;  2IC3 A;  1JLC A;  2R7Y A;  4FLX A;  2P5O A;  3L3U A;  4YOU A;  4E1N A;  3L4Q A;  4BRM A;  3ENO A;  4I9Q A;  4B1Y B;  4QS7 A;  1RT6 A;  4L8R B;  4NLB A;  3M3Z A;  4AHT A;  3SLC A;  4DV1 K;  5AQX A;  4A2B A;  2W6L A;  1X9S A;  2Q3S A;  3AAQ A;  1IH7 A;  4JKD A;  2UUA K;  2IOC A;  4GMJ B;  4BR9 A;  1BGX T;  3IKM A;  3UKR A;  1O13 A;  1NGC A;  2NRW A;  4CBW A;  4F2S A;  2VWB A;  4PL7 A;  1VQ7 N;  5AQJ A;  5C2F A;  2O8B B;  1NLV A;  2RE2 A;  1MWM A;  2ITM A;  1NK0 A;  2IGI A;  5AZI B;  3E9P A;  4CJS A;  1N34 K;  2E1Z A;  1VQO N;  1IKY A;  3SQ1 A;  2OAN A;  4CJT A;  2E2O A;  2E88 A;  3ATU A;  3I0S A;  4AM6 A;  1FKO A;  3QB0 A;  1D5A A;  1CZ9 A;  1T3V A;  3VN5 A;  5K14 A;  3ULD A;  2LSN A;  3CCU N;  1V4T A;  1NJX A;  3QEP A;  2WUS A;  5J2M A;  3O4N A;  2ZD1 A;  2Q0R A;  3OYM A;  4H0V B;  2ZJR L;  1SL1 A;  1GLJ O;  4B08 A;  4PKG A;  1EO1 A;  4WE1 A;  2UU9 K;  5M1N A;  2E5L K;  2P9U B;  3F2K A;  1JLF A;  4CD3 A;  4BDP A;  5T7B A;  3J7A P;  4CZH A;  2KQ2 A;  4OKJ A;  2QK9 A;  1JCG A;  4FWQ A;  3WEE B;  5AQY A;  2P51 A;  3QFU A;  4JV5 K;  4I7F A;  3K9J A;  5DM6 L;  1UWB A;  3O9S A;  2HNY A;  3GDQ A;  3LP3 A;  4FWP A;  3OHR A;  3SUQ A;  3LP2 A;  2KZZ A;  4BR0 A;  2W6K A;  2I5J A;  4DSK A;  3NH0 A;  4C8O A;  4RWT A;  5E26 A;  3TAN A;  1YHQ N;  4FPA A;  4RW9 A;  4CFC A;  3HXM A;  3OA9 A;  1NWK A;  4A2A A;  4RTF D;  4CZG A;  1CZA N;  2DY4 A;  4DKW A;  3LDN A;  2P9P B;  4IXC A;  3AVG A;  4DR1 K;  2HHW A;  1IV0 A;  1HQU A;  4KV8 A;  1KSP A;  1CXU A;  3SCX A;  1HQE A;  5FRN A;  4MDB A;  1WOQ A;  3DOL A;  4I6M B;  4Y1C A;  5D3G A;  3LWM A;  2DTU A;  2CGK A;  2QWN A;  2JGU A;  3VQD A;  5C10 A;  5GIN A;  3KVG A;  4YY3 K;  4DSL A;  1A5X A;  3CCV N;  1HLU A;  3BZC A;  4H0Y B;  4CIG A;  3M1F A;  2ZGY A;  3M6G A;  4CI6 A;  3EE8 A;  3HPH A;  5AQR A;  1ATS A;  1T44 A;  3IFR A;  3O1W A;  3NVM A;  2QWL A;  1RT4 A;  4FJ9 A;  4ZTJ A;  4IFV A;  5CY4 A;  4Z4C A;  2ZJQ L;  3T1Y K;  4FYD A;  3TTC A;  2E4L A;  3VES A;  4DQS A;  4CEB A;  4G1Q A;  3U6F A;  5GAE P;  4KRF A;  1YUW A;  4DUZ K;  3E01 A;  1J9A A;  4BQL A;  4AF1 A;  2ZGZ A;  3CM5 A;  4OX9 K;  4CIE A;  4KHS A;  3M8S A;  1SZ2 A;  3ULE A;  3A5N C;  3HT3 A;  3P31 A;  1YI2 N;  1N36 K;  3WUH A;  3QIN A;  1HYZ A;  3VEN A;  2QWP A;  3VQE A;  1KVC A;  3CCQ N;  1RTJ A;  4KB1 A;  5AQN A;  1L3V A;  2A1S A;  1U2V B;  4QAG A;  4FK0 A;  1U48 A;  3OVN A;  4BGB A;  4KHU A;  3T69 A;  1RDB A;  3AVN A;  2BGG A;  3KKS A;  4V19 S;  3G25 A;  1WSE A;  3UE5 A;  5CE3 A;  2YCH A;  4AH9 A;  2P9L B;  2ZWH A;  3Q7C A;  5HRO A;  3JAM O;  1Z26 A;  4HUG A;  5C2D A;  3ZYY X;  2Z1J A;  4ILH A;  1LWE A;  3CCJ N;  2KFN A;  3AVA A;  3EZ5 A;  4DUY K;  3SUO A;  4NYF A;  2HNZ A;  3ZSV A;  3HVT A;  4OGC A;  3WT0 A;  5BPN A;  1IBK K;  3DLB A;  4BDY A;  4YOX A;  5AQU A;  3KK7 A;  4CZK A;  5M1Q A;  5KPZ A;  2G8W A;  5BPM A;  4F9O A;  4CFB A;  3G6E N;  2HF3 A;  4FWL A;  5M1K A;  1X3N A;  5AQL A;  4U7B A;  1QQO A;  3CJ1 A;  1RT1 A;  4M3R A;  4X62 K;  4WQ4 A;  4KTZ A;  4NXN K;  2XRI A;  3THW A;  1BA0 A;  3CD6 N;  4DTU A;  3NDK A;  3G10 A;  4CZJ A;  3VEZ A;  3N4P A;  1K9M O;  5JS2 A;  2HBM A;  5AQI A;  3RMA A;  1KXP A;  1VQ4 N;  3BZK A;  4KTW A;  5LMN K;  5AQS A;  3ZX2 A;  1CZB A;  2BUP A;  1KVB A;  3V6D A;  4IDK A;  4CK1 A;  3LL3 A;  3NH1 A;  1HKC A;  4E0D A;  2BDP A;  3A2F A;  1VQ9 N;  1XC3 A;  1IG9 A;  4LFB K;  4MQ3 A;  2HW3 A;  1S72 N;  3NF9 A;  1C1B A;  2A1R A;  1BWF O;  4CGD A;  3SPY A;  1WSH A;  4CEZ A;  4K8Z A;  4Z0U A;  3SJJ A;  2QWM A;  4CES A;  1QZ6 A;  1KAX A;  4FWR A;  1SKR A;  1Q82 O;  5C0Y A;  1TV6 A;  3VPZ A;  4IEE A;  3OYK A;  4HWI A;  3TTF A;  4W5Q A;  1B9D A;  5IWA K;  4CFD A;  4DF4 A;  3DJC A;  2UUC K;  1YJW N;  3K5O A;  1S1W A;  2Q97 A;  4CJR A;  4FW1 A;  1VSH A;  3BEX A;  1DTT A;  1NM1 A;  1ESV A;  2GUI A;  1WB9 A;  3DYA A;  4FZX C;  4BE0 A;  4YOT A;  5AFU H;  5ADX A;  1BIS A;  2E20 A;  5FRO A;  1XQS C;  4CZF A;  3GG4 A;  4CF1 A;  2PAV A;  3AVH A;  3VER A;  1YAG A;  4A5B A;  5LJW A;  3VEX A;  1EET A;  4DV6 K;  1OKJ A;  3NAE A;  3T7Z A;  1QSL A;  3CME N;  2KZM A;  1BDG A;  3HP9 A;  4QCL A;  1RT3 A;  3V9W A;  1S1T A;  2HHX A;  2YJF A;  4JEP A;  4MO4 A;  2ASM A;  2ZE2 A;  3WXL A;  3CQY A;  4FL9 A;  4O55 A;  1IBL K;  4PKH A;  4CGF A;  4JK9 A;  4RW4 A;  3CFO A;  3CET A;  3GL1 A;  1RT5 A;  2HMP A;  1NJZ A;  3VF2 A;  4FPB A;  1JLB A;  3CI5 A;  2HHU A;  3CG7 A;  2OPP A;  4Z4E A;  2CH6 A;  3M5R A;  4KH4 A;  3UB5 A;  2O8B A;  3LDO A;  4IFY A;  1DLO A;  4FOI A;  3C6T A;  3CCR N;  1G15 A;  4DTX A;  1KAZ A;  1P90 A;  4IDH A;  4DCH A;  5AZI A;  2OZS A;  4LF5 K;  4B8C A;  5JIC A;  5BR9 A;  5J2P A;  4CJV A;  1EP4 A;  2ZQB A;  3QEW A;  1BIU A;  3O5B A;  1NK5 A;  4KPY A;  1GOC A;  3VMF B;  2YNG A;  3CPE A;  4A57 A;  2F9W A;  4DF8 A;  1XC9 A;  3KD1 E;  3MEG A;  2P9K B;  3KWI A;  5CR4 A;  4CJ5 A;  3CER A;  1NGG A;  1HNV A;  4W5T A;  4J8F A;  2X74 A;  3PO4 A;  3PIP L;  2IAJ A;  1C0T A;  2P9U A;  3V9U A;  2BH1 A;  1S9G A;  4I2P A;  4DS5 A;  4XH4 A;  1BU6 O;  3NF6 A;  5HRR A;  4LY7 A;  3WXK A;  5DMR A;  1Q9Y A;  1VQ8 N;  5JS1 A;  1HKG A;  4E7K A;  1TAQ A;  3CCS N;  2ITG A;  2WFB A;  4JI8 K;  3FZF A;  4DSJ A;  1CXQ A;  1U6Z A;  1ATN A;  3PX4 A;  4IKF A;  3KD5 E;  3G71 N;  2I7N A;  2CGJ A;  5HLF A;  4JKC A;  4BRL A;  1E4F T;  4GV6 A;  4QS8 A;  1UA1 A;  2IS3 A;  2QWR A;  2F8S A;  1S1X A;  3WNE A;  2D1K A;  1KFS A;  3PX0 A;  1HR0 K;  1BO5 O;  3CXC M;  3H1Q A;  3VGM A;  4PL8 A;  2P9P A;  3O4Q A;  1VQL N;  3NH2 A;  4FJM A;  2IDO A;  4OJR A;  3S3N A;  2QA4 N;  2YHB A;  5BRF A;  5KQ8 A;  1NGE A;  3R9P A;  5BPL A;  5J1E A;  1ZBS A;  3AA3 A;  1NK7 A;  2YKN A;  3QET A;  2NRT A;  4H5N A;  3SUN A;  1RBV A;  3J8A A;  1GLL O;  4I6M A;  3H3O B;  4EZ6 A;  4BC3 A;  1WAJ A;  1C0G A;  1RDU A;  5FPD A;  2HHH K;  3Q7B A;  1ZC6 A;  4WQ5 C;  1TUY A;  3TAP A;  4GV9 A;  2KLA A;  4ELT A;  4KFB A;  4W5N A;  3LPT A;  1GLE G;  3LDQ A;  1VSJ A;  1KTQ A;  3TPQ A;  4WQ4 C;  3KK3 A;  3ZEU B;  1YIJ N;  1S5J A;  3NBP A;  5M1F A;  4C1N I;  4JKG B;  3TAE A;  4HVJ A;  2O8C A;  4CJQ A;  2Q31 A;  1K8A O;  3AVK A;  3MX2 A;  3NGZ A;  1NGD A;  4B1W B;  4CF8 A;  3OYA A;  4CJF A;  4GY2 B;  4O8K A;  2EX3 A;  3TAF A;  3VA0 A;  2HOE A;  3THX B;  2GTD A;  5AQM A;  4GKJ K;  4FWS A;  3ZT1 A;  4M7X A;  1A5W A;  1NJY A;  2QWQ A;  3RR8 A;  3KZB A;  2DFH A;  3F5T A;  4B3S K;  3MK6 A;  1NU0 A;  5LJV A;  4HCB A;  4K43 A;  3O9R A;  1C1A A;  1W2B M;  4OKK A;  4CJ7 A;  3ID6 A;  4BRH A;  3O3H A;  4UQG A;  3HVR A;  1U2V A;  4DU3 A;  1TL3 A;  1I3A A;  3EL2 A;  2G8F A;  3CQX A;  4CGG A;  1TGO A;  2YJE A;  1C1C A;  4PHT X;  2VYP A;  5BN8 A;  4LSL A;  3B6P A;  5AQT A;  3DXK B;  2YNF A;  3LZJ A;  1RFQ A;  3V9X A;  1WSG A;  3PIO L;  1QVG M;  4XH5 A;  3JXU A;  3PX6 A;  4DV5 K;  4DQP A;  1DGK N;  3PY8 A;  5FPE A;  3FFI A;  3L2R A;  4LF4 K;  2P9L A;  1RGI A;  4E7H A;  3CIP A;  2IVO A;  4MLE A;  4RCH A;  3QEX A;  1XUP O;  4GVE A;  4JKH A;  4LH4 A;  4M41 A;  2X78 A;  1Q86 O;  4KHP K;  4YHH K;  3LDP A;  1DKG D;  3FZL A;  1VHX A;  3VEV A;  3RRH A;  3U4L A;  3QER A;  4FLW A;  2V7Y A;  2GUP A;  3MMV A;  3GOI A;  1KLM A;  3KIO A;  3CM6 A;  4M3U A;  1N5Y A;  3O9Q A;  1Z6R A;  4LF8 K;  2OPQ A;  3K2P A;  5I3U A;  4AHR A;  4WCE L;  3VEO A;  1LAW A;  4F8R A;  4IJA A;  2VWK A;  4N41 A;  1ZYQ A;  4LF6 K;  5FDL A;  4FJJ A;  4BAC A;  1YT3 A;  3HPG A;  4GNI A;  4LSN A;  2X6N A;  4DWI A;  2G8K A;  3C7N B;  3OS0 A;  1KFD A;  4LFA K;  3KHY A;  4CW7 B;  1BUP A;  4BE2 A;  4FO0 A;  1W7A A;  4R79 A;  1NK9 A;  1OH6 A;  2VGN A;  3ZSR A;  3TWH A;  4C23 A;  1LWF A;  4DU4 A;  4B3T K;  3I0R A;  4B1V A;  1B92 A;  1EX4 A;  4O4G A;  4BRI A;  1XWL A;  4XEI A;  4QS9 A;  3ZSW A;  3V1Q A;  5JVG L;  1HX1 A;  3AVC A;  3HOS A;  1Z25 A;  4CJE A;  3HSC A;  2GV9 A;  5HRS A;  2HF4 A;  1Q81 O;  2HBL A;  3OYH A;  1HNI A;  3KLE A;  2F9T A;  3PO5 A;  4Q5V A;  1L3U A;  2OTL N;  1S6Q A;  2JLE A;  4JKB A;  1NGJ A;  3OYB A;  3OYL A;  4JYA K;  1RDC A;  3SAH A;  4B1U B;  3CCE N;  4W5R A;  3HPO A;  3R3L A;  3MX5 A;  1VAZ A;  1EWR A;  3BY5 A;  3CJB A;  5C15 A;  2XY6 A;  5LMU K;  1NJI O;  3CHW A;  4CHN A;  1YF5 L;  2GEM A;  4JKE A;  3R1X A;  2FF3 B;  1ZBH A;  4J2D A;  1DEJ A;  1NGI A;  2ETJ A;  4BRG A;  1RBS A;  5CYM A;  3U8X A;  4BR4 A;  4B9V A;  3LPU A;  4DB3 A;  4OLA A;  3KLF A;  3SZ2 A;  2PYJ A;  3L2U A;  4DFP A;  2JWL A;  4OPJ A;  3SV3 A;  3BGR A;  1QZ5 A;  2G8H A;  4U67 L;  2E1Y A;  3VET A;  1G99 A;  1NOZ A;  1YVU A;  4BRK A;  3P38 A;  5KRS A;  2XHB A;  3V9Z A;  4DR3 K;  1BCM A;  1MA9 B;  3P1G A;  4CF0 A;  4YOR A;  2FC0 A;  3F73 A;  1VSL A;  2YHY A;  2D5R A;  1HRH A;  1N6Q A;  3HM9 A;  3IDH A;  1J53 A;  3HO1 A;  3QBW A;  4DTM A;  3KK2 A;  3IS9 A;  1TKD A;  4CHY A;  3FZH A;  1L3T A;  2Q36 A;  1L5U A;  3EO3 A;  3J81 O;  3KTQ A;  2ATQ A;  5KRT A;  3SPZ A;  3VOV A;  4B9U A;  4FJH A;  3I56 N;  4CHQ A;  1TUU A;  3C65 A;  1SQK A;  1NGB A;  4JLH A;  1HUX A;  2P9K A;  4DV0 K;  2G8U A;  1D9F A;  2UXB K;  3D7E O;  3IG1 A;  5AQO A;  1T8E A;  3QDK A;  1DT9 A;  3VQP A;  4Z4G A;  4IJN A;  5BR8 K;  5EXW A; 
#chains in the Genus database with same CATH homology
 4W5Q A;  4JS5 A;  3T19 A;  1U4B A;  1B9D A;  1WLJ A;  4CFD A;  4DF4 A;  1VK0 A;  1T03 A;  1W9H A;  4ELU A;  2HMI A;  4FCY A;  4RW6 A;  3D0P A;  3K5O A;  1S1W A;  4HUF A;  4B8A B;  4CJR A;  3C6U A;  4FW1 A;  1VSH A;  3SQ0 A;  1NKC A;  1DTT A;  4B9T A;  4Q0B A;  1SKS A;  1BI4 B;  2GUI A;  3K5M A;  4C8L A;  3DYA A;  3V1R A;  4BE0 A;  3K58 A;  4FZX C;  4Z4I A;  3EYZ A;  4NCA A;  3AVJ A;  3QLH A;  3LAN A;  3D45 A;  2XY5 A;  1BIS A;  5FRO A;  4N47 A;  4E3S A;  4M3Y A;  3QIO A;  2HHS A;  4CF1 A;  4B3O A;  3AVH A;  1QHT A;  4EP5 A;  3PV8 A;  2PY5 A;  2HVH A;  3RWU A;  4H8K A;  1EET A;  4I9L A;  1D8Y A;  3AO4 A;  4JRP A;  4M42 A;  3NAE A;  1MU2 A;  1QSL A;  5HBM A;  2KZM A;  3U3Y A;  3NGI A;  5KTQ A;  3HP9 A;  2OPS A;  3HP6 A;  1SUQ A;  3ZSQ A;  4QCL A;  3HL8 A;  3CFP A;  4K8X A;  3OYN A;  2HND A;  3OJU A;  3CQ8 A;  1RT3 A;  3V9W A;  1S1T A;  3ZT3 A;  2HHX A;  1UAX A;  3PUF A;  4KO0 A;  4XIU A;  4DFM A;  3S3O A;  1ZBU A;  4PA1 A;  3DI6 A;  4J2A A;  3SQ4 A;  1C0U A;  5CZ1 A;  4F3O A;  1VRU A;  3M8R A;  2ZE2 A;  4FJK A;  1RT2 A;  4O55 A;  4CHP A;  4PUO A;  4Z4H A;  4CGF A;  4OPK A;  4HHT A;  3OYG A;  4DSF A;  3RMB A;  4C8K A;  4FJI A;  3L2Q A;  3H08 A;  3CFO A;  4RW4 A;  4N56 A;  3MEE A;  4DTN A;  1RT5 A;  1RDA A;  3JSM A;  1NJZ A;  4CEQ A;  4DU1 A;  1ASW A;  3V1O A;  1VSM A;  1TKD A;  5KGW A;  3DLH A;  3NE6 A;  1JLB A;  3V4I A;  4CF2 A;  4I2Q A;  4DTR A;  2HHU A;  3CG7 A;  1R0A A;  2OPP A;  3OYD A;  3NCI A;  4Z4E A;  4Y1D A;  3K57 A;  4CJK A;  3RR7 A;  2PZS A;  3IRX A;  3KK1 A;  1X9W A;  4IFY A;  3VQQ A;  1DLO A;  3C6T A;  1EXQ A;  3NGY A;  5CZ2 A;  4F3T A;  1RTH A;  3LDS A;  1G15 A;  4DTX A;  1RT7 A;  3LAM A;  1UOC A;  4CF9 A;  2D0A A;  2OZS A;  1ASU A;  3VQA A;  4B8C A;  4M3W A;  4FZY A;  2HVI A;  3SYZ A;  5J2P A;  1U49 A;  4GVM A;  3VQ7 A;  2E6L A;  4CJV A;  1S1U A;  2VWJ A;  1T05 A;  1EP4 A;  2ZQB A;  3QEW A;  4OKE A;  1BIU A;  3AO3 A;  2W42 A;  4FLU A;  1Q9X A;  1NK5 A;  1Q8I A;  1GOC A;  3OYE A;  1WNS A;  3OYI A;  3DLE A;  3L2W A;  2G8V A;  4KPY A;  1Y97 A;  2YNG A;  1ASV A;  4DF8 A;  4CEA A;  1XC9 A;  1IKX A;  3KD1 E;  3MEG A;  2KW4 A;  4KHW A;  1BQM A;  2YHA A;  4DFJ A;  1RBT A;  4FW2 A;  4IG3 A;  2Y1J A;  3F9K A;  1FKP A;  1VSD A;  4CJ5 A;  1U04 A;  3THV A;  2OA8 A;  1VRT A;  2NUB A;  4E7J A;  4KKO A;  2BAN A;  1TKT A;  2X6S A;  1HNV A;  3DOK A;  3AV9 A;  4PY5 A;  5DK5 A;  4E19 A;  4B9M A;  2OYQ A;  4W5T A;  3OS1 A;  2EHG A;  2X74 A;  3V9S A;  3PO4 A;  3ZSZ A;  4CER A;  4DQI A;  2IAJ A;  4HCC A;  2VG6 A;  4O0J A;  4FZZ A;  4KHY A;  1C0T A;  3V9U A;  4E7L A;  1U47 A;  5HRP A;  1S9G A;  4ELV A;  4I2P A;  3VQ5 A;  4TSX A;  1RBU A;  2HHT A;  1JLG A;  4DS5 A;  3KLH A;  5J2Q A;  3NF6 A;  4BE1 A;  5HRR A;  4LY7 A;  1Q9Y A;  5DMR A;  5JS1 A;  1RTI A;  4E7K A;  1TAQ A;  3DRR A;  1ZBI A;  4E89 A;  1NKE A;  3C94 A;  4DSE A;  2ITG A;  4AHU A;  4M3X A;  4DSJ A;  1CXQ A;  3KLG A;  2WON A;  4DLE A;  4DTO A;  3CYM A;  2F96 A;  3AVI A;  2BE2 A;  3ISN C;  1TK8 A;  1KRP A;  3PX4 A;  4IKF A;  3HYF A;  4IBN A;  4CK2 A;  2Z1H A;  3AVF A;  3KD5 E;  1GOB A;  1VSE A;  3DRS A;  3WNF A;  4DLG A;  4CIF A;  1IO2 A;  5I42 A;  1CLQ A;  4N5S A;  1W0H A;  2P1J A;  3K5N A;  5CYQ A;  4O44 A;  3VQ4 A;  5HLF A;  1QE1 A;  3OYJ A;  1VSF A;  1U45 A;  2IC3 A;  3O3G A;  5C42 A;  1JLC A;  1HMV A;  2R7Y A;  4FLX A;  2IS3 A;  3L3U A;  4HUE A;  1UA1 A;  2P5O A;  2F8S A;  4F4K A;  3QNO A;  2KFZ A;  1S1X A;  4E1N A;  3WNE A;  2VG7 A;  4AHS A;  3OJS A;  3PX0 A;  1KFS A;  3ZT2 A;  3SUP A;  5EU7 A;  3ZCM A;  1JL2 A;  1RNH A;  4DQQ A;  5J2N A;  4I9Q A;  3O4Q A;  4DSI A;  4CJ4 A;  1RT6 A;  3NH2 A;  4FJM A;  4L8R B;  2IDO A;  4OJR A;  3SV4 A;  3S3N A;  4AHT A;  4FJN A;  2YHB A;  4HTU A;  3MED A;  4ICL A;  4CHZ A;  4FLT A;  2G8I A;  5J1E A;  1NK7 A;  1RCH A;  3AA3 A;  3DLR A;  2Q3S A;  2YKN A;  3B6O A;  3QET A;  1X9S A;  4M3T A;  4CJU A;  2B6A A;  3SUN A;  1IH7 A;  1RBV A;  4C8N A;  2IOC A;  2D0C A;  4GMJ B;  2FBY A;  1BGX T;  3OS2 A;  3AO1 A;  4EZ6 A;  4CK3 A;  1WAJ A;  4KRE A;  4F2S A;  1RBR A;  2E6M A;  2RPI A;  4CED A;  4N76 A;  5FRM A;  2YNH A;  3TAP A;  3L2V A;  1RDD A;  4OVL A;  4CHO A;  3M8Q A;  3V81 A;  4ELT A;  2Z1G A;  4KFB A;  4W5N A;  3LPT A;  1TKX A;  3VA3 A;  3AVM A;  1NK0 A;  2IGI A;  1VSJ A;  4CJS A;  1KTQ A;  3KK3 A;  1B9F A;  3TI0 A;  2AJQ A;  1IKY A;  3SQ1 A;  1LW2 A;  1S5J A;  3NBP A;  1BIZ A;  4F2R A;  4CJT A;  3TAG A;  4EP4 A;  1YTA A;  3TAE A;  4HVJ A;  3I0S A;  2B4J A;  1FKO A;  4CJQ A;  4KHQ A;  3T3F A;  4YNQ A;  1D5A A;  3AVK A;  1XI1 A;  1CZ9 A;  1GOA A;  1S6P A;  4NYN A;  4DG1 A;  3NGZ A;  3K59 A;  3VN5 A;  1KVA A;  5K14 A;  3ULD A;  4FJ5 A;  1BI4 A;  2LSN A;  4CF8 A;  3OYA A;  4CJF A;  1NJX A;  3QEP A;  2YKM A;  2EX3 A;  3TAF A;  4PQU A;  1TL1 A;  5J2M A;  3O4N A;  2ZD1 A;  3OYM A;  3VA0 A;  1SL1 A;  4B08 A;  1NK6 A;  4WE1 A;  4ZHR A;  3ZT1 A;  1A5W A;  1NJY A;  3RR8 A;  1HPZ A;  2DFH A;  2XY8 A;  3OY9 A;  4HCB A;  1JLE A;  1JLF A;  4LH5 A;  4BDP A;  4NCG A;  5T7B A;  1HYS A;  2KQ2 A;  4OKJ A;  2QK9 A;  3VQC A;  1JXE A;  1C1A A;  4FM1 A;  4R5P A;  2P5G A;  2P51 A;  4OKK A;  4YFU A;  1FK9 A;  4FJL A;  5SZT A;  3BDP A;  4DTS A;  3L8B A;  3O3H A;  4UQG A;  3HVR A;  4I7F A;  4C8M A;  2OPR A;  1UWB A;  2HNY A;  3RMD A;  4DU3 A;  4BDZ A;  4KI4 A;  1TL3 A;  2OZM A;  2HB5 A;  4DQR A;  3LP3 A;  1I3A A;  2G8F A;  3SUQ A;  3LP2 A;  1TGO A;  3ZSX A;  4CGG A;  1RTD A;  1C1C A;  1HYV A;  3U3G A;  2KZZ A;  3ZSY A;  1WN7 A;  1KCF A;  1XHX A;  3B6P A;  4LSL A;  2YNF A;  3OYF A;  2QKK A;  4FJG A;  4KTQ A;  1REV A;  2I5J A;  2DFE A;  1JLQ A;  3LZJ A;  3V9X A;  1WSG A;  4DSK A;  3QEV A;  1I39 A;  1BL3 A;  3NH0 A;  4GW6 A;  4C8O A;  4PWD A;  1VSK A;  3RTV A;  3PX6 A;  3TAN A;  4DQP A;  3PY8 A;  4CJW A;  2D0B A;  3FFI A;  3MXJ A;  4RW9 A;  4CFC A;  3L2R A;  3HXM A;  3S9H A;  2F8T A;  1WSF A;  4E7H A;  2DY4 A;  2YV0 X;  3I8D A;  3LP0 A;  3AVG A;  1X1P A;  3QEX A;  2QKB A;  2GBZ A;  2HHW A;  4CGI A;  1ITG A;  1HQU A;  4KV8 A;  4LH4 A;  4M41 A;  2X78 A;  2O4G A;  1KSP A;  3SNN A;  1CXU A;  3SCX A;  2KTQ A;  2XO7 A;  1TK0 A;  1HQE A;  5FRN A;  1LWC A;  3NF7 A;  3RRH A;  1C0M A;  3QER A;  4FLW A;  4O0I A;  3DOL A;  4Y1C A;  4DTP A;  1KLM A;  3NFA A;  3VQ6 A;  5D3G A;  3AVL A;  2WOM A;  3LWM A;  4DS4 A;  3M8P A;  3KIO A;  2DTU A;  3CM6 A;  2RF2 A;  3MXM A;  4KHN A;  2JGU A;  3VQ8 A;  3VQD A;  4M3U A;  3L3V A;  2VG5 A;  3LAK A;  3P83 D;  1SL0 A;  4NCB A;  3RMC A;  1A5X A;  4DSL A;  1N5Y A;  3AO5 A;  4CIG A;  4FK4 A;  1QSS A;  3TAR A;  2OPQ A;  3K2P A;  1S1V A;  5I3U A;  4B9N A;  4AHR A;  1LAW A;  3DM2 A;  3HPH A;  4F8R A;  2VWK A;  4N41 A;  1ZYQ A;  3ZSO A;  3SQ2 A;  1RT4 A;  1NJW A;  4FJ9 A;  3MAQ A;  4ZTJ A;  1YTU A;  1WSJ A;  5FDL A;  1O1W A;  1KLN A;  4IFV A;  4DTJ A;  3QO9 A;  5CY4 A;  4Z4C A;  1YT3 A;  3HPG A;  3K5L A;  5KI6 A;  3T1A A;  1BCO A;  4LSN A;  4BAC A;  3TAQ A;  4FYD A;  2RN2 A;  2X6N A;  2E4L A;  4DWI A;  2G8K A;  4CCH A;  3OS0 A;  4CEB A;  4DQS A;  1KFD A;  4FXD A;  4G1Q A;  3MXI A;  3ZT4 A;  3U6F A;  4FVM A;  3TR8 A;  2YNI A;  3TAM A;  4FM2 A;  4FLV A;  4KRF A;  1JLA A;  1TKZ A;  4BE2 A;  2B5J A;  3E01 A;  1J9A A;  3LP1 A;  4KI6 A;  3CM5 A;  4RG8 A;  1QSY A;  1HJR A;  3TAB A;  4CGH A;  4CIE A;  1JXB A;  2RKI A;  1NK9 A;  4JS4 A;  4KHS A;  3HK2 A;  3M8S A;  2Z1I A;  4AHV A;  3ZSR A;  3TWH A;  3ITH A;  4DMN A;  1LWF A;  3QIP A;  4MFB A;  3HT3 A;  4DU4 A;  3I0R A;  4DFK A;  3QES A;  1B92 A;  3QEI A;  1EX4 A;  4O4G A;  1D9D A;  4B9S A;  3UIQ A;  2HHV A;  1L3S A;  1XWL A;  3VQB A;  3NHG A;  2DFF A;  1EKE A;  3CFR A;  4FK2 A;  3QIN A;  1HYZ A;  1X9M A;  1TK5 A;  3OYC A;  5C24 A;  3ZSW A;  3V1Q A;  4FJ7 A;  3VQE A;  1KVC A;  3AVC A;  1RTJ A;  3AA2 A;  1Z25 A;  1IKV A;  4CFA A;  2GV9 A;  4CJE A;  3AA4 A;  5HRS A;  4JRQ A;  4KB1 A;  3OYH A;  1HNI A;  3KLE A;  3AA5 X;  4BWM A;  1L3V A;  3PO5 A;  4Q5V A;  1L3U A;  4CE9 A;  1S6Q A;  4H4M A;  2A1S A;  2JLE A;  4QAG A;  2FBV A;  4BWJ A;  3OYB A;  3OYL A;  4J2B A;  4EZ9 A;  3DLG A;  4FK0 A;  1RDC A;  4FJX A;  1JKH A;  1U48 A;  4AHC A;  4KB0 A;  3OVN A;  4KHU A;  4E1M A;  4CJ3 A;  1QTM A;  1RDB A;  1C6V A;  3AVN A;  2BGG A;  4W5R A;  4Z4F A;  2FBT A;  3KKS A;  4M3Z A;  3C95 A;  3HPO A;  1WSE A;  1T7P A;  1ZBL A;  1RIL A;  4B9L A;  3WNH A;  3KLI A;  1NOY A;  3WNG A;  2XY6 A;  3S3M A;  1TVR A;  4AH9 A;  1WSI A;  4CHN A;  3NF8 A;  1F21 A;  1LV5 A;  1NKB A;  4M45 A;  1ZBH A;  3DLK A;  5HRO A;  3AVB A;  1ZBF A;  4J2D A;  4CJP A;  2XY7 A;  2ETJ A;  4RW7 A;  2HHQ A;  1Z26 A;  1RBS A;  1VSI A;  4HUG A;  5CYM A;  1QS4 A;  5E41 A;  3KJV A;  1WAF A;  5C25 A;  1SKW A;  3LPU A;  4B9V A;  3HJF A;  3VQ9 A;  3HST B;  2Z1J A;  1XHZ A;  1LWE A;  2KFN A;  3AVA A;  4OLA A;  5HRN A;  3KLF A;  3EZ5 A;  3SUO A;  1BQN A;  2FBX A;  4NYF A;  2HNZ A;  3SZ2 A;  3ASM A;  2PYJ A;  3ZT0 A;  3ZSV A;  3L2U A;  4DFP A;  3HVT A;  1S9E A;  4ID1 A;  1J54 A;  4OGC A;  4OPJ A;  4BDY A;  3BGR A;  3SV3 A;  4E7I A;  3DLB A;  4QOZ B;  2G8H A;  2G8W A;  1JL1 A;  1SV5 A;  3RRG A;  4CFB A;  1NOZ A;  1YVU A;  5KRS A;  2XHB A;  3V9Z A;  1J5O A;  2QXF A;  2O4I A;  1A5V A;  1BCM A;  3P1G A;  4ID5 A;  1TAU A;  4OGE A;  4CF0 A;  4OLB A;  1IKW A;  1RT1 A;  4M3R A;  4KTZ A;  2FC0 A;  2XRI A;  3F73 A;  1VSL A;  1QQC A;  2D5R A;  1HRH A;  4DTU A;  4J2E A;  3NDK A;  1N6Q A;  3G10 A;  3HM9 A;  4CEO A;  2Y1I A;  3ALY A;  4CEE A;  4FM0 A;  1J53 A;  3HO1 A;  1DTQ A;  5JS2 A;  4W5O A;  4FJJ A;  4DTM A;  4O5B A;  1K6Y A;  3IS9 A;  4CGJ A;  4CHY A;  4KTW A;  4RW8 A;  3KK2 A;  4CEC A;  3QNN A;  1LW0 A;  1FXX A;  1L3T A;  1L5U A;  3MEC A;  4FJ8 A;  3SI6 A;  4H4O A;  1CZB A;  2ATQ A;  4CJL A;  3O3F A;  3LWL A;  3JYT A;  4ZTF A;  5KRT A;  1NK4 A;  3KTQ A;  4KAZ A;  1KVB A;  3V6D A;  4IDK A;  1LAV A;  5HP1 A;  3SPZ A;  1UA0 A;  3LZI A;  4B9U A;  4CK1 A;  5KGX A;  3DMJ A;  4FJH A;  4CHQ A;  3KKR A;  3NH1 A;  4FLZ A;  2PYL A;  4E0D A;  4FLY A;  2BDP A;  3A2F A;  1IG9 A;  2HW3 A;  4MQ3 A;  3IAY A;  4JLH A;  3AO2 A;  4CEF A;  3NF9 A;  3RMA A;  1C1B A;  2A1R A;  4CGD A;  1SL2 A;  1D9F A;  2G8U A;  4LD0 A;  3SPY A;  3IG1 A;  1WSH A;  4CEZ A;  3P5J A;  1T8E A;  4K8Z A;  4Z0U A;  3VQP A;  3SJJ A;  4Z4G A;  3DRP A;  4CES A;  3LAL A;  4AIL C;  4IG0 A;  1SKR A;  3EY1 A;  1BHL A;  1TV6 A;  5SWM A;  3OYK A;  1NK8 A;  3G0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...