4E1MA

Crystal structure of hiv-1 integrase with a non-catayltic site inhibitor
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
152
structure length
146
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSATVKAAWWAGIKQEFGIPNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Integrase
publication title New Class of HIV-1 Integrase (IN) Inhibitors with a Dual Mode of Action.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 48
structure length 146
sequence length 152
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e1mA00
1BCOA 1IKWA 4CESA 4CEOA 1WSGA 2NUBA 3TAGA 1U4BA 3K5MA 3TAEA 1S5JA 2DY4A 1HMVA 3DLHA 2HHVA 2P1JA 3ZSOA 3THVA 3HYFA 4YFUA 3DLBA 2HHUA 5J2MA 1X9SA 3HK2A 2VWKA 4DU1A 3DLEA 3RWUA 1WSIA 1QSSA 2D0CA 2IDOA 1TL3A 4GVMA 1EKEA 1ZBFA 1RBSA 4F8RA 1BQMA 3K59A 2D0AA 2ATQA 3QEIA 1EXQA 3AVGA 3AVIA 3PO5A 3KK2A 4PY5A 2HHQA 3VQ4A 3OYGA 4TSXA 1WSHA 1WAJA 3ASMA 2O4GA 5HROA 4FJLA 3NF7A 1JKHA 3RRGA 2FC0A 4O0JA 4CJSA 3KIOA 4CJKA 3HT3A 2R7YA 1CXQA 3RR8A 3MEDA 2P51A 3SQ0A 3O4QA 1TKTA 3PX6A 3ZSQA 4W5QA 4Z4EA 5J1EA 3ULDA 4B9LA 5CY4A 1BGXT 2KQ2A 2BANA 3AVLA 4DFKA 4H4MA 2P5OA 1C6VA 2F96A 2BE2A 1NJXA 2HHWA 4KV8A 3DI6A 1ZBUA 4GMJB 1HRHA 3QO9A 4RW6A 3LAMA 3EZ5A 3AVMA 2YHAA 4FYDA 4OLBA 2GBZA 3NH2A 1QS4A 2OPQA 4EZ9A 4DTPA 3AVNA 5HRRA 3DRRA 4BDPA 3QERA 3EYZA 3RMAA 1JLAA 5C42A 3ZSRA 2YNGA 4HUFA 1QHTA 1FXXA 3LWMA 1TK8A 1NJYA 3PY8A 4KREA 4CHPA 5SZTA 1HJRA 3VQDA 2RF2A 4B9VA 1RT3A 3AA2A 1TVRA 1ASWA 5D3GA 1LAWA 3VQ9A 2WOMA 1Q9YA 2JGUA 1KRPA 4FJHA 4CFDA 4O5BA 2Y1IA 1RILA 5CZ2A 3LP3A 4DF4A 3QEPA 4I7FA 1Z26A 4AHCA 2A1SA 1IG9A 3ZSWA 3ALYA 4LH4A 4PQUA 4HUEA 3OYCA 4KTQA 2VG6A 1NKCA 4CHQA 4CJPA 2OPPA 2RKIA 1BL3A 4C8NA 1NK8A 4CF2A 4B9SA 1KLMA 1RNHA 3VQAA 4CGIA 2QKKA 3ZT1A 2FBTA 3L2VA 3SV3A 3SUNA 3H08A 3NH1A 1VRUA 4F3TA 4CGFA 1RBVA 3B6PA 3V1OA 4DG1A 1C0TA 2G8IA 2E6MA 3MEEA 1D9DA 3MECA 3AO2A 1K6YA 3SQ1A 1C1CA 1JLBA 1YTUA 1TKZA 1NOZA 3C6UA 1S6PA 1RTJA 4XIUA 3RMBA 4B9TA 4ELUA 4Z0UA 4M3RA 4UQGA 1SV5A 1IKXA 4FJXA 3DRPA 3UIQA 3F73A 3HPHA 3HVRA 2HVIA 3OYJA 3LWLA 1XC9A 4KI4A 1LWEA 2DFFA 3QNOA 4DWIA 1S9GA 1EP4A 1WSEA 2HNZA 1TAQA 2LSNA 1W9HA 4KTWA 3O3FA 2W42A 4FCYA 4CJEA 1RDBA 3V9SA 1NK7A 1KFSA 3VA0A 3V9XA 1RDDA 4OPKA 4FJ9A 3S3NA 5EU7A 3TWHA 1BI4B 4DTRA 2RN2A 3FFIA 4DTMA 3QEXA 2X78A 1D8YA 2KTQA 1S1VA 1UA0A 4FLZA 1KLNA 4W5NA 3RR7A 4CJ5A 1HYVA 3LDSA 1NK9A 4E7KA 4HUGA 4C8KA 4ID5A 2IOCA 4M45A 4CGJA 1LWCA 4G1QA 2XO7A 1SKWA 4B8AB 1KCFA 3C94A 1SL2A 4CJ4A 1CZ9A 1WNSA 3V1RA 4NYFA 3AVHA 3MAQA 1JL1A 3TABA 5I3UA 1QSYA 3VQQA 3L2RA 4IG3A 3DM2A 1CXUA 3OYKA 3OJUA 3ZSZA 1NK0A 1JLEA 1QSLA 5E41A 4CHYA 3PO4A 3K2PA 1NK5A 4FJGA 4FZZA 1DTTA 2AJQA 1FKPA 1TV6A 1L3VA 4Q5VA 4FVMA 4CIGA 4LSNA 2FBVA 1L3SA 3QNNA 4DMNA 1RTDA 3OY9A 1RTIA 3D45A 3OYBA 4Z4FA 1S6QA 1RTHA 4HTUA 1NK4A 3LPUA 1RT7A 4DLEA 4AHUA 4MQ3A 2HHXA 5DMRA 1ITGA 4CK3A 1YVUA 3M8RA 5KI6A 5FDLA 4DU4A 3VQ5A 4CERA 4KHSA 5CYQA 3KLFA 3NGIA 4EZ6A 1J5OA 4C8LA 4IKFA 1D5AA 1BIZA 3E01A 1C0MA 1WAFA 2IAJA 3HPGA 1D9FA 4KHQA 4W5RA 1VSHA 4LSLA 3QIPA 4IFYA 4FW1A 4CEEA 1RBUA 4FJIA 1L3UA 2HW3A 4BWJA 4B8CA 1U48A 4Z4GA 1SUQA 1F21A 1S1TA 3DOKA 3TAMA 3K5LA 2OZSA 4ELTA 4K8ZA 3C95A 4DTXA 5KGXA 3LZIA 4CECA 4JS5A 1HYSA 1QE1A 2OPRA 3AO3A 3L3VA 3SUPA 3O3GA 2G8HA 4FJMA 4FM0A 1G15A 1O1WA 3ISNC 3OYEA 4DTJA 4DFJA 4E3SA 1TK0A 4OKEA 1UOCA 1QQCA 1BI4A 3AVFA 3G0ZA 3NFAA 4DFMA 1REVA 3AVAA 2A1RA 5HRPA 1TKDA 2G8FA 3OYHA 4IDKA 1S9EA 3QINA 3HP9A 5KRTA 3NAEA 3V4IA 3CFPA 3KJVA 3QIOA 1DLOA 4ZHRA 4DQSA 4CEZA 4HVJA 4FM2A 4N5SA 4KKOA 4LD0A 3SUQA 2VG7A 1VSKA 1X9MA 3JYTA 3QLHA 3AVJA 3TR8A 3CQ8A 4KHYA 4C8MA 2IS3A 2OA8A 2YNIA 4CF0A 3NCIA 4ELVA 3OYMA 4DLGA 4DSEA 1RT1A 2EHGA 3OVNA 4R5PA 1XI1A 4H4OA 3VQBA 2Y1JA 1WSJA 1XWLA 4CHZA 4FLTA 3M8PA 5KRSA 4OPJA 1B92A 3NDKA 1VSLA 5HP1A 4ID1A 3KD5E 3SYZA 2D5RA 1A5XA 4L8RB 4DQQA 1T05A 2I5JA 2PYJA 4J2BA 5K14A 1JXEA 3CM6A 2X6NA 3LAKA 5C24A 3WNFA 4Z4CA 3L8BA 3QEVA 4KHWA 3K5OA 1RT6A 2HNYA 3HSTB 1J54A 3NF6A 2JLEA 4KO0A 2PYLA 1HQEA 3P5JA 4QCLA 4EP5A 4B9NA 2G8UA 3NE6A 3AO5A 2HNDA 2KW4A 2XHBA 1U47A 4E19A 1T8EA 3RTVA 3KTQA 1KVAA 4I2PA 4CF9A 3I8DA 3L2QA 4DSIA 2Z1GA 2FBYA 2B5JA 4H8KA 4JS4A 3HXMA 1VSMA 3BDPA 1VSDA 5T7BA 2G8VA 2XY7A 1BCMA 3AA3A 2D0BA 2E4LA 4CGGA 4YNQA 4BDYA 5HRNA 3U3YA 4Q0BA 3WNGA 4AH9A 4FZXC 3DLRA 1S1UA 4W5OA 3QETA 4N47A 1X1PA 4KI6A 2ZD1A 4DTSA 4FLVA 1YT3A 4M3ZA 3TAPA 3ZCMA 4O4GA 1NJWA 1ZBHA 1BHLA 2HVHA 1JLFA 3ITHA 3T1AA 1BIUA 4IG0A 3QEWA 4AHTA 1T7PA 2Q3SA 1UWBA 1J9AA 1Z25A 2YV0X 3NF9A 4ICLA 1JLCA 4CJ3A 4CHOA 3K5NA 4FLYA 4DF8A 2KFNA 4FJ5A 1JL2A 3U3GA 1Y97A 1SL0A 3TARA 4Z4IA 1S1WA 1GOBA 3SJJA 1GOAA 3DYAA 3HVTA 4GW6A 4OVLA 3JSMA 4CEBA 4HCCA 1U04A 4DSJA 4CGHA 4J2EA 4NCAA 2OYQA 1YTAA 1WN7A 3AA5X 3PV8A 4FJKA 3NBPA 2YNFA 1HNIA 1C0UA 2G8WA 4FW2A 4IBNA 2ZQBA 3SZ2A 4DTNA 4CHNA 2F8TA 1RDAA 1KVCA 4E1NA 3OS0A 1BISA 3SPZA 4N76A 5SWMA 4BDZA 3LALA 3TI0A 1MU2A 4QOZB 4FK2A 4Y1DA 4DQPA 3G10A 4CF8A 3NGZA 1RBRA 4O0IA 4FJ8A 4RG8A 1EETA 4NYNA 4FZYA 1Q9XA 3I0RA 3KLIA 3L3UA 4CJLA 2IGIA 3KK1A 3TAFA 2XRIA 1RDCA 3CM5A 1WSFA 1NOYA 4JRQA 4E7HA 5J2PA 4F4KA 4KAZA 2QKBA 3HO1A 4CK2A 3F9KA 4KRFA 2O4IA 3V9ZA 5KGWA 4BE1A 5CZ1A 3CFRA 2QXFA 3SQ4A 2FBXA 3L2WA 1JLQA 3K57A 3DOLA 1RBTA 2DTUA 1HYZA 3NH0A 3OYDA 1N5YA 4O55A 2HHTA 1TKXA 3DLKA 3VQPA 4CJQA 4FK4A 3BGRA 3A2FA 3RMDA 2GV9A 2XY8A 3OS1A 1A5WA 3LANA 2DFEA 1HPZA 2ETJA 3HPOA 2OZMA 3O4NA 1TGOA 2Z1JA 3KLGA 4Z4HA 2BDPA 4M3TA 5FRMA 5I42A 4IFVA 4K8XA 1JXBA 3AO1A 3LZJA 1XHXA 3ZSVA 1VSIA 2B4JA 4DS4A 4I9LA 3S3OA 4HCBA 3VQ8A 3V9UA 4BE0A 4DS5A 3V81A 3KD1E 5FRNA 4CIEA 1B9DA 3NHGA 1KFDA 4EP4A 3OYAA 1ZBIA 1IKVA 4PWDA 3OS2A 3KLEA 1X9WA 2HHSA 3VA3A 3B6OA 3VN5A 4CFBA 1R0AA 4PUOA 3V9WA 3EY1A 3QESA 4E7IA 4M42A 3LP0A 3ZT4A 4M3WA 5J2NA 3CFOA 1GOCA 4FM1A 1L5UA 1CZBA 4CFCA 1KSPA 3HJFA 1KTQA 4LH5A 4QAGA 2OPSA 1ASUA 1UAXA 1ZBLA 4F2SA 3TANA 3VQEA 2GUIA 1J53A 4DQIA 4DSFA 4BWMA 2IC3A 1LAVA 3IS9A 1VSEA 4O44A 3VQ6A 4B08A 3MEGA 1B9FA 2PZSA 4J2AA 4KPYA 1LW0A 1A5VA 1VSJA 2Z1HA 4OKKA 4FLUA 2XY6A 3C6TA 1RT5A 4F3OA 1Q8IA 3OYLA 3AA4A 4CEAA 4CJVA 4B9MA 4DQRA 3CYMA 3LP1A 5HRSA 4B3OA 1LW2A 4DSLA 2ZE2A 2YHBA 1QTMA 4AILC 4JLHA 4KFBA 3VQ7A 3U6FA 4N41A 4KB1A 4E7LA 4OLAA 3IG1A 2B6AA 3RMCA 4CJFA 2F8SA 3SNNA 4CF1A 1NK6A 5CYMA 1HQUA 4RW4A 1IO2A 4BACA 3KKSA 3NGYA 4CJUA 4CJTA 3CG7A 3AO4A 5KTQA 4M3UA 4NCBA 1NKBA 1FK9A 3AV9A 2E6LA 4RW9A 1WLJA 3IRXA 4LY7A 4KB0A 2VG5A 1RCHA 3D0PA 4FJNA 1RT2A 3T3FA 2BGGA 4M41A 3AVCA 3OYIA 3LP2A 4M3XA 3ZT2A 1BQNA 3AVKA 4I2QA 1JLGA 1VSFA 2WONA 2KZZA 2ITGA 1RT4A 3OYFA 4W5TA 3S3MA 4ZTJA 3ZT0A 3K58A 3DLGA 3O3HA 3KLHA 3ZSYA 4CEDA 1HNVA 3V6DA 3SPYA 1ZYQA 3WNHA 5J2QA 5JS1A 4RW8A 1XHZA 1U45A 4JRPA 3SV4A 1TK5A 3SQ2A 4CGDA 1W0HA 4E0DA 4FLXA 4DU3A 1CLQA 4OGEA 1IKYA 3MXMA 4CEFA 1L3TA 3WNEA 3SI6A 4E1MA 2QK9A 4DTUA 4CIFA 3RRHA 2KZMA 4CE9A 3KK3A 1NKEA 2YNHA 4FLWA 4C8OA 4I9QA 4KTZA 2Z1IA 3PUFA 3I0SA 3M8SA 3PX4A 5HBMA 4E7JA 3SCXA 1LWFA 1NJZA 3P1GA 5HLFA 2G8KA 5DK5A 4KHUA 3HL8A 4OGCA 4CCHA 5C25A 3PX0A 4CEQA 3DMJA 3P83D 5FROA 1SKSA 3OJSA 4F2RA 3AVBA 1ASVA 1FKOA 4CJWA 2YKNA 4FJJA 3L2UA 4J2DA 3ZT3A 1N6QA 4AHVA 3ZSXA 4E89A 4PA1A 4FXDA 2P5GA 1IH7A 3KKRA 4DTOA 3IAYA 3M8QA 2DFHA 3HP6A 1SL1A 4KHNA 2VWJA 4OJRA 4BE2A 2HB5A 4B9UA 2EX3A 4N56A 4HHTA 2KFZA 2RPIA 3TAQA 3LPTA 1TAUA 1DTQA 1KVBA 4MFBA 2X6SA 1I39A 4NCGA 4CFAA 1UA1A 2XY5A 1LV5A 4DSKA 2HMIA 4CK1A 4ZTFA 3DRSA 4FJ7A 1EX4A 4OKJA 1C1AA 1C1BA 4FK0A 4WE1A 1TL1A 3HM9A 1SKRA 3S9HA 1VK0A 5JS2A 3VQCA 3NF8A 4AHSA 4CJRA 4DFPA 2PY5A 1I3AA 3MXJA 4RW7A 1VRTA 2X74A 4Y1CA 3T19A 1S1XA 3V1QA 3OYNA 4AHRA 1T03A 4M3YA 3MXIA 1U49A 2YKMA 3SUOA
chains in the Genus database with same CATH superfamily
1BCOA 4CBWA 1JCGA 5LJWA 1U4BA 1NMDA 3HYFA 1X9SA 3DLEA 4A57A 1N34K 3RWUA 4X62K 4WF9L 2HMPA 1BQMA 2E1ZA 1EXQA 4PY5A 2HHQA 3VQ4A 3E9OA 3OYGA 1WSHA 1K8AO 3ASMA 3ZYYX 2NRHA 1W2BM 4FJLA 1JKHA 4BR2A 2R7YA 3RR8A 1CXQA 4JI4K 3CI5A 4KH4A 5J1EA 1BGXT 2FF6A 2KQ2A 3AVLA 3MN9A 5AQRA 4H4MA 5A2QO 1C6VA 2O8EB 2BE2A 5BN8A 1NJXA 3U4LA 1ZBUA 4GMJB 1HRHA 2P9NA 1IBLK 3AGKA 4JI1K 3NVKA 4RW6A 2GBZA 2OPQA 3AVNA 4B1WB 5HRRA 4BDPA 2QEXN 2YNGA 3DLLL 1FXXA 4DB3A 3PY8A 3VQDA 3KHYA 5AQGA 1P90A 2NNWA 2WOMA 1YAGA 1Q9YA 2UXCK 4FJHA 4ISFA 2Y1IA 1RILA 1ZBSA 3WT0A 1KD1O 2P9KA 4AHCA 3ZSWA 3ALYA 1NKCA 3O6WA 1BL3A 4C8NA 1KLMA 5AJ3K 3HTVA 3H45C 1C0TA 3MEEA 1D9DA 1JJ2M 1YTUA 1NOZA 4XIUA 4YY3K 1Z6RA 2GWJA 3CD6N 3UIQA 3IUCA 3OYJA 3LWLA 4KI4A 2DFFA 2WUSA 1SS6A 4JKHA 4DWIA 1WSEA 1YVNA 5GAEP 2LSNA 2YHWA 4IOAL 5LJVA 2A6AA 1KFSA 3L4QA 3UKUA 3C65A 4OPKA 3TWHA 2ZGYA 4DTRA 2RN2A 3QEXA 2KTQA 1S1VA 1UA0A 4YOVA 4BRCA 1HYVA 1NK9A 4HUGA 2IOCA 1LWCA 4G1QA 4IJAA 3VTHA 1KCFA 3T7ZA 3C94A 1SL2A 2JWKA 1WNSA 3OJUA 3DM2A 3OYKA 3ZSZA 1JLEA 3RSEB 3K2PA 1DTTA 4BRAA 5AZJA 1L3SA 2Q31A 3CJ1A 1WBDA 1RTDA 1RTIA 4OX9K 5DMRA 1ITGA 4FWMA 4CK3A 5ELZA 1TYQB 3NGIA 5KPRA 1TUYA 4IKFA 1D5AA 2IAJA 3HPGA 3PIOL 1D9FA 5AFUA 4W5RA 5C2DA 2P9LA 4B1YB 2P9SB 4CEEA 1L3UA 3WXIA 3K5LA 3TAMA 4CZHA 3C95A 4CECA 4JS5A 2W40A 3L3VA 3AO3A 5AQVA 2CGLA 1O1WA 2YHYA 3ZX3A 5DM7L 4E3SA 3THYA 1TK0A 4OKEA 1UOCA 1QQCA 1BI4A 3AVFA 2A1RA 2G8FA 3HP9A 5KRTA 5BRDA 4KKOA 3SUQA 4JI6K 2VG7A 4LF6K 3JYTA 3TR8A 3B8AX 2OA8A 2YNIA 4FOEA 1XUPO 3TTCA 2HBLA 2EHGA 2YHXA 3KD5E 1A5XA 4OPAA 4CZKA 1JXEA 3CM6A 3QEVA 2QWNA 3NF6A 5F2RA 2JLEA 4B9NA 2E2NA 2XHBA 2HNDA 4JKBA 4E19A 3I8DA 4GNIA 2QWQA 4DSIA 2Z1GA 1E3MA 5M1QA 1V4SA 1ATSA 4CZIA 3U3YA 3C6HA 4FZXC 5AQNA 1VQ5N 4W5OA 5AQUA 2GEMA 4BR9A 4LC9B 1X1PA 1YT3A 3TAPA 4BR5A 4A61A 1BHLA 1JLFA 3T1AA 1NGIA 4AHTA 4ICLA 2Q3SA 4IOXA 1JLCA 1S22A 4FLYA 3QFUA 4JK8A 4OVLA 3J81O 1Q81O 2AA4A 4CGHA 4B1XB 3FE1A 4GV6A 1C0FA 2D4WA 2QM1A 1HUXA 4UY8O 2V7ZA 4Y0WA 3EKSA 4NB4A 4WFNL 4FW2A 4DTNA 2F8TA 1RDAA 5EY4A 5CR4A 1NGGA 5SWMA 2UU9K 4QOZB 2HBKA 2IVOA 1OH7A 3L3UA 5GAGP 4CJLA 1VQLN 2PFUA 3HO1A 1KAYA 3V9ZA 3R6MA 3H46O 1NM1A 5CZ1A 2QXFA 1JLQA 3DOLA 5F0XA 2A41A 3DLKA 2GV9A 1A5WA 1HPZA 2ETJA 3HPOA 5DM6L 4Z4HA 2BDPA 4K8XA 1QQOA 2FLOA 3LZJA 3D7EO 2RHKA 3HM8A 3ZSVA 3M3ZA 3S3OA 3VQ8A 3KD1E 4CIEA 1XQSC 1ZBIA 2HOEA 1IKVA 1XNQK 3KWIA 3O9TA 3VA3A 4CFBA 4PUOA 2ZGZA 1GOCA 3S41A 1L5UA 4CFCA 2OPSA 1UAXA 4BRMA 5GADP 3CMAN 1J53A 4DQIA 4BWMA 4O44A 4J2AA 3O1WA 1VSJA 5LMUK 4I6MB 4DQRA 3CYMA 3DAWA 5M1KA 3D6RA 3LP1A 3J7AP 1LW2A 4DV4K 2YHBA 1QTMA 4JLHA 3VMFB 3U6FA 4JI8K 4WQ5C 3UE5A 4E7LA 4OLAA 1BUPA 1KQSM 4ILGB 3RMCA 4CF1A 5CYMA 4X66K 4BACA 3KKSA 3CC4N 4M3UA 1NKBA 1QVFM 3AV9A 1TYQA 2I7NA 4RW9A 3IRXA 4LY7A 4JEPA 2UUCK 1RCHA 3GL1A 2BGGA 4O8KA 3AVCA 3LP2A 1VAZA 3ZT2A 3CJ9A 4PKHA 2Q2RA 4QS9A 2ZJPL 3FR0A 4W5TA 3S3MA 4ZTJA 1HNVA 4DV3K 5J2QA 5AQJA 4RW8A 1HKBA 4MDAA 3FFKB 2PAVA 3TTDA 2FXUA 5FPEA 2QWRA 4AM6A 4A2AA 4CEFA 3WNEA 2QK9A 4AM7A 3VTIA 3OBWA 3PUFA 3I0SA 3M8SA 4E7JA 4U67L 3LDQA 3P1GA 2CGJA 3T69A 3PX0A 4CEQA 2O8FA 5C12A 5FROA 4F2RA 2P9IA 4FJJA 4IEIA 2YKNA 4CZJA 3A5NC 1QHAA 2P9PA 4AHVA 3ZSXA 2O8DA 4YORA 3HP6A 4BRGA 2VWJA 3O9SA 4OJRA 4B9UA 1DKGD 4H5WA 3TAQA 1IBKK 4CFAA 4IDHA 1LV5A 2V51B 4K25A 2XY5A 3T1HK 2ZJRL 1HNXK 2HMIA 4H0OA 1EX4A 4A5BA 1C1AA 1DEJA 4E1JA 4XH5A 4BR0A 3THXA 4DFPA 3ZEUA 2Q97A 4ISEA 1S1XA 1BOTO 2P9KB 2ZJQL 5LY3A 3MN5A 1IKWA 4CEOA 1HMVA 3DLHA 1RFQA 1P8ZA 2HHVA 3J7ZO 3ZSOA 3THVA 3DLBA 2Q0RA 4PKIA 5J2MA 3HK2A 2VWKA 4DU1A 1NGDA 1EO1A 1QSSA 2D0CA 4F8RA 4G9ZA 1ZBFA 3K59A 2D0AA 3TSQA 3PO5A 2W41A 4B1VA 1Q18A 4NCBA 4CJKA 4YOTA 4F9OA 3ZSQA 4Z4EA 3ULDA 4B9LA 5CY4A 4NO7A 2BANA 4DFKA 2P5OA 4EFHA 2HHWA 1ZXOA 3QO9A 3EZ5A 1T3VA 4HTLA 4LF9K 4OLBA 4C23A 4EZ9A 3W3DA 4OPHA 4DTPA 3DRRA 3VF4A 1JCFA 3MWPA 4HUFA 3R9PA 1QHTA 1HR0K 2NRVA 4CHPA 3CCRN 3L0QA 2A5XA 1ASWA 3VQ9A 4YHHK 4QS7A 5AZJB 3QEPA 3SAHA 3OW2M 1Z26A 3MDQA 2A1SA 4PQUA 4KTQA 2VG6A 4CJPA 3CIPA 2QKKA 3ZT1A 3L2VA 3SV3A 3SUNA 1MWMA 4BY9C 1VRUA 3V1OA 4DG1A 4LF5K 2G8IA 2P9LB 2E88A 3SQ1A 4GV3A 3A5LC 1C1CA 4DV5K 3C6UA 4H5TA 1MWKA 1R59O 4ELUA 4Z0UA 4M3RA 1IKXA 4FJXA 3MCPA 1Y64A 1N32K 1XC9A 1LWEA 3QNOA 1NU0A 1S9GA 3VEVA 1RDBA 2NRXA 4RTFD 3M1FA 2GWKA 3SK3A 1RDDA 3THYB 1BI4B 2V7YA 2X78A 5M1OA 4FWSA 1GLLO 4FSVA 4FLZA 3DWLA 1XMOK 3LDSA 4C8KA 1OKJA 4ID5A 4M45A 3VESA 1OH6A 1SKWA 1BDGA 4B8AB 4EHTA 4IZ9A 4CZGA 1GLBG 3U9ZA 1CZ9A 3G6EN 4NYFA 1NJIO 5I3UA 3VQQA 1BWFO 3L2RA 1NK0A 1QSLA 4DR6K 5E41A 1NK5A 3L6QA 4CZEA 1FKPA 1L3VA 3R8EA 4FVMA 4Q5VA 2O8BA 2FBVA 1GLCG 3MCAB 3D45A 3OYBA 4KBOA 2GELA 3HZ6A 3DXKA 4AHUA 4MQ3A 2VCPA 2ASPA 3Q7BA 5I9EB 4A5AA 3G71N 2A3ZA 2AP1A 1WUAA 3F5TA 1C0MA 3O4WA 4DV2K 1VQ7N 2QWPA 3BY5A 3I33A 3QIPA 4FW1A 1RBUA 4NLBA 2UYTA 4MLEA 1F21A 1S1TA 2OZSA 5KGXA 3H1VX 3LZIA 5AQKA 3CJBA 1QE1A 2OPRA 2BTFA 4YOUA 5AQLA 2EWSA 3ISNC 4BVPA 5CE3A 3G0ZA 3NFAA 1REVA 5HRPA 3NAEA 1SZ2A 4DQSA 4CEZA 4HVJA 4LD0A 1VSKA 1X9MA 4FVUA 3AVJA 4H5RA 4JHDA 3CQ8A 1J6ZA 4XEIA 4DSEA 5EXWA 1RT1A 4NXNK 4H4OA 5GIPA 3CHWA 3CCVN 4FZZA 4FLTA 1B92A 1JCEA 3GOIA 4L8RB 2D5RA 1XC3A 1VQ9N 4DQQA 2OANA 2PYJA 5AQXA 2X6NA 5BRHA 5C24A 3ENHA 2UUBK 2HNYA 3HSTB 3QBWA 4KO0A 4DR3K 1HQEA 3P5JA 4QCLA 4EP5A 5BPLA 5M1NA 4DR1K 3A0IX 3L2QA 3OTOK 4H8KA 4IEEA 4JS4A 3BDPA 1VSDA 2G8VA 3JXUA 2E4LA 4CGGA 1Q82O 4YNQA 3LDNA 4BDYA 5HRNA 3UKRA 3PIPL 1S1UA 4KI6A 2ZD1A 1IJJA 2OTLN 4B3TK 1K9MO 3VENA 4JD2A 1ZBHA 4BGBA 3ITHA 1T7PA 2YX6A 2HHUA 2YV0X 3SBGA 1UWBA 1Z25A 2KFNA 4FJ5A 1RDWX 1T6DA 3DYAA 4YDUA 4CEBA 1U04A 4NCAA 4J2EA 2OYQA 4WQ4A 3AA5X 3WEEA 5HOOA 3BUZB 4NXMK 2G8WA 3SZ2A 2E1YA 4CJ7A 3CJAA 3SPZA 1BISA 5E26A 3LALA 1MU2A 4WFBL 4FK2A 4Y1DA 4DQPA 3FLCO 4RG8A 4FZYA 3U8XA 4LF4K 3I0RA 3KLIA 2IGIA 3BZCA 3CJ7A 1BU6O 1RDCA 4F4KA 4KAZA 4KRFA 4CK2A 3F9KA 3JAMO 2QI2A 3N4QA 5KGWA 2NRZA 2FBXA 4B3MK 2WBNA 1NGJA 1RBTA 3OYDA 2HHTA 3VQPA 4CJQA 3RMDA 2XY8A 3OS1A 2DFEA 5FPDA 3O4NA 2QW9A 1TGOA 4JKFA 5FRMA 5I42A 4IFVA 4GV9A 3AO1A 4DV1K 1VQON 2B4JA 4DS4A 3C6AA 1FW6A 5FRNA 4A62A 4EP4A 2HHSA 5HL7L 5JMVA 4YOXA 2D0PA 1R0AA 4BRKA 3EY1A 4E7IA 3LP0A 3ZT4A 1MDUB 5J2NA 3HJFA 4M63C 5AR0A 4DCHA 3Q7CA 1NG9A 1GLDG 2GUIA 4JK9A 1LAVA 1K8KA 4B08A 2FSJA 3MEGA 1B9FA 2F4VK 5CHIA 1Q8IA 3OYLA 4CJVA 3MWTA 2O8FB 5B8HA 2P9IB 2P9PB 5AQQA 3VQ7A 5KPZA 2W6LA 2O8DB 3A8YA 4CBUA 1T44A 1NK6A 1EWQA 3FZKA 1HQUA 4DUYK 3NGYA 3MX5A 4RCHA 3CG7A 5AFUH 3AO4A 1FK9A 4FL9A 4KB0A 2V52B 1QZ5A 2WFBA 1BQNA 4I2QA 3THXB 1JLGA 3ZEUB 3IFRA 4EHUA 3BP8A 3F9MA 3PSFA 2ITGA 2O8CA 4CW7B 3HBTA 3DLGA 5AQHA 3ZSYA 4CEDA 3P31A 4O8UA 3WNHA 5JS1A 5C2FA 2DPNA 1XHZA 4MO5A 3SV4A 3SQ2A 2QTDA 4E0DA 4FLXA 2VGNA 3ZX2A 1N33K 4OGEA 2NRTA 2QWLA 1IKYA 3CQXA 3SI6A 4E1MA 3RRHA 2YNHA 4C8OA 4K43A 2Z1IA 2H3GX 1NJZA 2KKZA 2G8KA 3G4SN 5DK5A 3FZMA 4YOWA 4OGCA 5C25A 3DMJA 3FZLA 3OJSA 4CJWA 3CCMN 4J2DA 1NGCA 1SAZA 5AQOA 3QICA 1IH7A 1KC8O 1NGBA 2DFHA 5GINA 1SL1A 3AGRA 4ILJA 2RPIA 2YJEA 1TAUA 4MFBA 2FSKA 2X6SA 3WQUA 2F7TA 1BO5O 3G25A 3DRSA 3O9RA 3SAGA 4DR7K 4OKJA 2E2OA 2NLXA 3HM9A 3S9HA 1VK0A 3NF8A 1WB9A 1GLAG 1YUWA 3OYNA 3MXIA 3ATUA 1YXQA 1U49A 2D0OA 1VQNN 2NUBA 3K5MA 1X3NA 1N36K 4YFUA 2BH1A 5BREA 2CGKA 1WSIA 5E84A 1TL3A 1EKEA 1RBSA 2E8AA 3VGKA 3QEIA 3KK2A 3VF6A 3O9QA 4TSXA 3J8AA 1WAJA 5HROA 3P39A 3K9KA 4CJSA 3CC2N 2P51A 3SQ0A 4O5FA 3O4QA 1TKTA 3PX6A 4W5QA 3ZETB 4PL7A 2F96A 2VGMA 1SQKA 4IWVA 3LAMA 3MN7A 1H1VA 5JVGL 4FYDA 3TPQA 1QS4A 1C0GA 1W97L 5LMNK 3THWA 3QERA 1GLFO 5C42A 1NJYA 4KREA 1HJRA 2RF2A 1TVRA 5D3GA 5AZIA 4LF7K 1LAWA 1S72N 4BVOA 2JGUA 2O8BB 5IT9O 1KAXA 3L4IA 1BG3A 3LP3A 3ENOA 3O5BA 4I7FA 1IG9A 4YOYA 4HUEA 3DXKB 3MX2A 3UB5A 1NK8A 4CF2A 4B9SA 1RNHA 3VQAA 4BQLA 5MLCQ 2KHOA 3HRGA 3R1XA 1BA0A 3EO3A 2D1KA 3TSPA 3MECA 3AO2A 1K6YA 1HKGA 3H3OB 4FWLA 3NVMA 4WCEL 3FGUA 3F73A 2HVIA 4BROA 1WBBA 1EP4A 4KTWA 3O3FA 1W9HA 4AF1A 3V9XA 4M7YA 3VOVA 5EU7A 1OVYA 3FFIA 1DGKN 3VEOA 1D8YA 2BUPA 4W5NA 1KLNA 1NMNA 1HLUA 4E7KA 4QS8A 4CGJA 3OA9A 4JHDB 2FSNA 3MAQA 1JL1A 1QSYA 4IG3A 1CXUA 3EE9A 3PO4A 5AQIA 5KQDA 4FJGA 1OH5A 2KLAA 2ZM6K 3DXMA 3QNNA 4DMNA 1RTHA 4HTUA 1NK4A 3LPUA 4PL8A 1YVUA 3M8RA 4DU4A 5FDLA 3CC7N 4CERA 4KHSA 3MMVA 4EZ6A 1J5OA 4C8LA 3RVCA 3E01A 1HX1A 2NZTA 5EX5A 4KHQA 1VSHA 4LSLA 3CCUN 4R79A 4IFYA 4FJIA 2HW3A 4B8CA 2ASMA 3UKRB 1U48A 4Z4GA 3DOKA 3EZWA 4DTXA 3AY9A 1HYSA 2WTUA 3O3GA 4JD2B 4BRLA 2UXDK 4FM0A 1G15A 3TTFA 3OYEA 4CBXA 4DFJA 1VQMN 4A2BA 4X64K 1NNEA 4DFMA 2HHXA 3AVAA 3VGMA 1TKDA 3OYHA 4IDKA 1S9EA 3TSUA 3AARA 3BZKA 4DQ8A 2QXLA 1KXPA 4ZHRA 1CZAN 3WEEB 4FM2A 2GTDA 3VEYA 3GDQA 2IS3A 3C7NA 4WFAL 4ELVA 3OYMA 4DLGA 4WQ5A 4R5PA 3VQBA 3ZLJA 1WSJA 4CHZA 2QA4N 5KRSA 4OPJA 3NDKA 1VSLA 4JK7A 3SMSA 3AAQA 3CCQN 1T05A 3O1BA 3E1YA 3LAKA 3WNFA 2E2QA 3K5OA 5AQMA 2PYLA 4JN4A 4RWTA 3NE6A 3AO5A 1U47A 1T8EA 3PSIA 1YHQN 2FBYA 2F9TA 2XY7A 3AA3A 5LL6Z 4FWOA 4DR5K 4MO4A 4H0TB 4Q0BA 3WNGA 4AH9A 3SLCA 3J80O 4N47A 4DTSA 4M3ZA 3SJHA 3ZCMA 1X9JA 1NJWA 3ZETA 2HVHA 4JYAK 1BIUA 3QEWA 4CJ3A 3K5NA 3C0BA 4CHOA 4DF8A 1Y97A 3VERA 4Z4IA 1S1WA 3SJJA 1GOAA 3DJCA 3HVTA 4GW6A 4BRQA 4MDBA 1U6ZA 4HCCA 4EIAA 1WN7A 3PV8A 2GX9A 1K8KB 5C15A 3CCJN 1HNIA 2IIRA 5IWAK 1VQ6N 1HNWK 4IBNA 2ZQBA 1MA9B 3EL2A 1KVCA 4N76A 3TI0A 4IFEA 3G10A 3NGZA 1Q9XA 4XH1A 3KK1A 1NOYA 2XRIA 3CM5A 2QKBA 3QDKA 5J2PA 4V19S 3H6EA 3M6GA 4DV0K 4BE1A 4OO1J 5AQYA 3SQ4A 3L2WA 4DR2K 3K57A 1HYZA 1TKXA 5ADXH 4FK4A 3A2FA 4PKGA 3LANA 1BA1A 3CMEN 2OZMA 2Z1JA 3KLGA 4M3TA 4CVNE 1XHXA 1VSIA 2HBMA 4I9LA 4HCBA 2FF3B 1XNRK 2O8CB 3D2EA 5AQWA 3V81A 4C1NI 4B3SK 3NHGA 1KFDA 3OYAA 1HNZK 3KLEA 4BQZA 5BR8K 4BGAA 3QESA 4U7BA 4M42A 4ILHA 4M3WA 3ID6A 1KSPA 4FM1A 1CZBA 4QAGA 2VQFK 1ZBLA 4F2SA 3VQEA 4B1UB 4CD1A 4B1ZA 4DSFA 5TKYA 3IS9A 3VQ6A 1LW0A 1A5VA 3P38A 2XY6A 4FLUA 1OVQA 3AA4A 4CEAA 2Q36A 4CD3A 3GBTA 5HRSA 4B3OA 4DSLA 3VEXA 4AILC 4KB1A 1M90O 1NWKA 3SNNA 1IO2A 4CJUA 2ITMA 5KTQA 4GY2B 2YCHA 2E6LA 4FJNA 1ATNA 3D0PA 2E5LK 1N8RO 5C0YA 5EOYA 4JKAA 3AVKA 4C1NK 1VSFA 5JLFA 1NGAA 4JKGA 1Q7YO 3OYFA 3ZT0A 4BC3A 3K58A 1ZYQA 3V6DA 1U45A 3CCLN 4CGDA 1W0HA 4H0YB 4H5NA 4CI6A 1S3XA 1L3TA 4DHYA 2KZMA 4DTUA 1IV0A 4CE9A 3KK3A 4FLWA 3I55N 4I9QA 1V4TA 5JICA 3PX4A 1KAZA 3W0LA 5HBMA 1RGIA 4EAHD 1W7AA 5GAHP 1EWRA 3HL8A 4XH4A 5F1XA 1SKSA 3AVBA 1ASVA 1FKOA 3VGLA 4FOIA 3QFPA 4PHTX 3N4PA 3ZT3A 1N6QA 1NLVA 1HKCA 4PA1A 4FXDA 3IMXA 2P5GA 4NLCA 2F9WA 3IAYA 4X65K 4JNEA 4BE2A 2EX3A 4N56A 2J4RA 3K9JA 3CETA 5AQTA 1Q86O 1YITN 1KVBA 4NCGA 1WOQA 3ULEA 4DSKA 4ZTFA 4IOCL 4FWKA 3THWB 1YJ9N 4LFCK 4FK0A 1QZ6A 1SKRA 2P9UA 5JS2A 3VQCA 4RW7A 5AZIB 2X74A 4GKKK 3T19A 5EVZA 4M3YA 1T03A 3NMUA 2YKMA 4CESA 1WSGA 1U2VA 3TAGA 3LM9A 1K73O 3TAEA 1S5JA 4KH6A 2DY4A 3D2FA 1DT9A 2P1JA 1GLEG 3CCEN 1EQYA 1GLJO 2IDOA 4GVMA 3H3NO 2ATQA 3AVGA 3AVIA 5KPTA 2O4GA 3NF7A 4B9QA 3RRGA 2FC0A 4O0JA 3CJCA 3KIOA 3HT3A 3MEDA 4DUZK 1J5EK 2E20A 4AQYK 4DV7K 5JVHL 1QQNA 5BPMA 4IO8A 5FPNA 3QBXA 4KV8A 3DI6A 5AQPA 4L3QA 1IG8A 3JS6A 3AVMA 2YHAA 2NRWA 2HF3A 3NH2A 3CF5L 1YJWN 3EYZA 3RMAA 1JLAA 3ZSRA 3MN6A 3LWMA 1TK8A 3AAPA 1ZC6A 5SZTA 4B9VA 1RT3A 3AA2A 2ZF5O 1NGHA 4IXCA 1KRPA 3SMPA 4CFDA 4O5BA 3TU5A 4BRHA 3DXMB 5CZ2A 4DF4A 1FJGK 5FLXO 4JKCA 4LH4A 3OYCA 4K42A 3T1YK 2UUAK 4CHQA 2OPPA 3HOSA 2RKIA 5FPMA 3WQTA 3VETA 4CGIA 2FBTA 1HJOA 3H08A 3NH1A 4F3TA 4CGFA 5GIOA 1RBVA 3B6PA 2QWMA 2E6MA 2IVPA 1YF5L 4BRIA 1JLBA 1TKZA 1S6PA 1RTJA 3RMBA 4B9TA 3HOTA 4UQGA 3QMLA 1SV5A 3DRPA 1YIJN 3HPHA 3HVRA 5JLHA 3ZX0A 2HNZA 2W42A 1TAQA 2O8EA 1ILYA 4FCYA 4CJEA 3VEZA 2W6KA 3V9SA 1NK7A 3VA0A 4FJ9A 3S3NA 4DTMA 4B3RK 1NGFA 1M1KO 5TKWA 4JKDA 3RR7A 4CJ5A 1VQKN 3KVGA 2GUPA 2OTJN 2Q0UA 2XO7A 4JAXA 1I94K 4CJ4A 2QWOA 3V1RA 3C7NB 3AVHA 3TABA 3FZHA 4HWIA 1X3MA 3O80A 5KQ8A 4CHYA 2AJQA 1TV6A 4CIGA 4LSNA 1YI2N 1NBWA 3OY9A 2RE2A 4Z4FA 1S6QA 3H1QA 4DLEA 1RT7A 1D4XA 4M7XA 5KI6A 3VQ5A 5CYQA 3KLFA 1BIZA 1WAFA 4BRPA 2NRRA 3U9DA 3F2KA 4BWJA 1SUQA 3WXMB 3I56N 4ELTA 4K8ZA 2A42A 3ENBA 2UXBK 1RDUA 1VQ8N 3SUPA 2G8HA 4FJMA 4FWRA 4DTJA 1T6CA 3GG4A 5BPNA 4K41A 5H1SQ 4H0PA 3BF3A 1QVGM 3QINA 3V4IA 3CFPA 3KJVA 4JV5K 3QIOA 2CH6A 1DLOA 3O08A 5AQFA 4N5SA 1HPMA 3QLHA 2YI1A 4C8MA 4CF0A 3NCIA 3SBTA 3VF2A 3RSEA 1XI1A 3OVNA 4FO0A 2Y1JA 1XWLA 3M8PA 5HP1A 3QB0A 4ID1A 3SYZA 3R3LA 2I5JA 2PBDA 4J2BA 5K14A 3L8BA 1E4GT 1VQ4N 4Z4CA 4KHWA 2HBJA 1RT6A 1J54A 4Z94A 3KK7A 4K0KK 4WYBA 3K0SA 2G8UA 2KW4A 3RTVA 3KTQA 1KVAA 4I2PA 4CF9A 3WXJA 2B5JA 3HXMA 1VSMA 4JI0K 5T7BA 3LDPA 4FWNA 1BCMA 1VHXA 2D0BA 2P9SA 2CH5A 3LDLA 3DLRA 4FPAA 3QETA 1XMQK 3WUHA 4FLVA 3D2EB 3WXLA 3BF1A 4BRDA 2JWLA 3VEWA 4O4GA 4IG0A 3NF9A 1J9AA 4BG8A 1JL2A 3U3GA 2ASOA 1SL0A 3TARA 1GOBA 3OBYA 3JSMA 4DSJA 2YJFA 1YTAA 4FJKA 3BEXA 3NBPA 2YNFA 2HSTA 3GE1A 3EKUA 1C0UA 3CPEA 4LFBK 3O9UA 3J7YP 4FWPA 3E9PA 4CHNA 2I7PA 4E1NA 3VPZA 3OS0A 4BDZA 4MLHA 3SAFA 2P9NB 4FJ8A 4CF8A 1RBRA 5M1FA 4O0IA 4JKEA 1EETA 4NYNA 3TAFA 1WSFA 3E66A 4J8FA 4JRQA 4E7HA 2O4IA 4IJNA 4H0XB 3CFRA 3O8MA 5BN9A 4BC2A 3KZBA 2Q1NA 4FWQA 2DTUA 3NH0A 1N5YA 4O55A 3BGRA 3EEQA 3I8BA 4BC5A 4GKJK 3M5RA 4JKGB 1JXBA 3P4IA 4N41A 4DS5A 3V9UA 4BE0A 1B9DA 3ATVA 1NGEA 4PWDA 3OS2A 1X9WA 4A59A 1Z05A 2VWBA 3PLAA 3B6OA 4H0VB 3VN5A 3V9WA 4BRFA 4KH5A 3E9LA 3CXCM 4DV6K 3CFOA 4BREA 1KTQA 4LH5A 4LF8K 1ASUA 2ZWHA 3FZFA 3TANA 3IDHA 4H03B 2IC3A 1VSEA 1G99A 2PZSA 4KPYA 3ID8A 4KHYA 2Z1HA 4JI5K 4OKKA 4M3XA 4F3OA 3C6TA 1RT5A 2E2PA 4B9MA 3CPWM 3LL3A 1E4FT 2ZE2A 4KFBA 3UKUB 4CZFA 3IG1A 2B6AA 4CJFA 3LM2A 2F8SA 1ATRA 4JI7K 4RW4A 4BR4A 5M1PA 1VQPN 4LFAK 4CJTA 3ULEB 5BR9A 3IKMA 3HSCA 1WLJA 2VG5A 1RT2A 3T3FA 4BRNA 3KWGA 4M41A 3OYIA 2WC9A 2P9UB 2IVNA 1QQMA 2WONA 5C10A 2KZZA 1RT4A 3O3HA 3KLHA 3SPYA 1O13A 4JRPA 4BR7A 1U2VB 1TK5A 3EE8A 3D2FB 4DU3A 4CZMA 1CLQA 3LDOA 2HHHK 1TUUA 3MXMA 3HI0A 4CIFA 1NKEA 3A5OC 4KTZA 1YJNN 4YDUC 3WXKA 3EN9A 3SCXA 3CERA 1LWFA 5HLFA 4GVEA 4WQ4C 4KHUA 5ADXA 4CCHA 3MK6A 4KHPK 4I6MA 3P83D 2A40A 2VYPA 5AQSA 4H5VA 3L2UA 5AQZA 4DKWA 4E89A 4ISGA 3KKRA 4DTOA 4JI3K 2VQEK 3M8QA 1OH8A 4KHNA 4IO9L 2HB5A 4HHTA 4BC4A 2KFZA 3LPTA 4BG9A 1DTQA 3OHRA 3A5MC 1I39A 1UA1A 3CCSN 4CK1A 5BRFA 4FJ7A 4DR4K 1LOTB 1C1BA 3CQYA 4WE1A 1TL1A 2OCEA 4FPBA 2PY5A 4AHSA 1ESVA 4CJRA 1I3AA 1LCUA 3MXJA 1IBMK 1VRTA 4JI2K 4Y1CA 3V1QA 4AHRA 4CZLA 2HF4A 3SUOA
chains in the Genus database with same CATH topology
1BCOA 1IKWA 4CESA 4CEOA 1WSGA 2NUBA 3TAGA 1U4BA 3K5MA 3TAEA 1S5JA 2DY4A 1HMVA 3DLHA 2HHVA 2P1JA 3ZSOA 3THVA 3HYFA 4YFUA 3DLBA 2HHUA 5J2MA 1X9SA 3HK2A 2VWKA 4DU1A 3DLEA 3RWUA 1WSIA 1QSSA 2D0CA 2IDOA 1TL3A 4GVMA 1EKEA 1ZBFA 1RBSA 4F8RA 1BQMA 3K59A 2D0AA 2ATQA 3QEIA 1EXQA 3AVGA 3AVIA 3PO5A 3KK2A 4PY5A 2HHQA 3VQ4A 3OYGA 4TSXA 1WSHA 1WAJA 3ASMA 2O4GA 5HROA 4FJLA 3NF7A 1JKHA 3RRGA 2FC0A 4O0JA 4CJSA 3KIOA 4CJKA 3HT3A 2R7YA 1CXQA 3RR8A 3MEDA 2P51A 3SQ0A 3O4QA 1TKTA 3PX6A 3ZSQA 4W5QA 4Z4EA 5J1EA 3ULDA 4B9LA 5CY4A 1BGXT 2KQ2A 2BANA 3AVLA 4DFKA 4H4MA 2P5OA 1C6VA 2F96A 2BE2A 1NJXA 2HHWA 4KV8A 3DI6A 1ZBUA 4GMJB 1HRHA 3QO9A 4RW6A 3LAMA 3EZ5A 3AVMA 2YHAA 4FYDA 4OLBA 2GBZA 3NH2A 1QS4A 2OPQA 4EZ9A 4DTPA 3AVNA 5HRRA 3DRRA 4BDPA 3QERA 3EYZA 3RMAA 1JLAA 5C42A 3ZSRA 2YNGA 4HUFA 1QHTA 1FXXA 3LWMA 1TK8A 1NJYA 3PY8A 4KREA 4CHPA 5SZTA 1HJRA 3VQDA 2RF2A 4B9VA 1RT3A 3AA2A 1TVRA 1ASWA 5D3GA 1LAWA 3VQ9A 2WOMA 1Q9YA 2JGUA 1KRPA 4FJHA 4CFDA 4O5BA 2Y1IA 1RILA 5CZ2A 3LP3A 4DF4A 3QEPA 4I7FA 1Z26A 4AHCA 2A1SA 1IG9A 3ZSWA 3ALYA 4LH4A 4PQUA 4HUEA 3OYCA 4KTQA 2VG6A 1NKCA 4CHQA 4CJPA 2OPPA 2RKIA 1BL3A 4C8NA 1NK8A 4CF2A 4B9SA 1KLMA 1RNHA 3VQAA 4CGIA 2QKKA 3ZT1A 2FBTA 3L2VA 3SV3A 3SUNA 3H08A 3NH1A 1VRUA 4F3TA 4CGFA 1RBVA 3B6PA 3V1OA 4DG1A 1C0TA 2G8IA 2E6MA 3MEEA 1D9DA 3MECA 3AO2A 1K6YA 3SQ1A 1C1CA 1JLBA 1YTUA 1TKZA 1NOZA 3C6UA 1S6PA 1RTJA 4XIUA 3RMBA 4B9TA 4ELUA 4Z0UA 4M3RA 4UQGA 1SV5A 1IKXA 4FJXA 3DRPA 3UIQA 3F73A 3HPHA 3HVRA 2HVIA 3OYJA 3LWLA 1XC9A 4KI4A 1LWEA 2DFFA 3QNOA 4DWIA 1S9GA 1EP4A 1WSEA 2HNZA 1TAQA 2LSNA 1W9HA 4KTWA 3O3FA 2W42A 4FCYA 4CJEA 1RDBA 3V9SA 1NK7A 1KFSA 3VA0A 3V9XA 1RDDA 4OPKA 4FJ9A 3S3NA 5EU7A 3TWHA 1BI4B 4DTRA 2RN2A 3FFIA 4DTMA 3QEXA 2X78A 1D8YA 2KTQA 1S1VA 1UA0A 4FLZA 1KLNA 4W5NA 3RR7A 4CJ5A 1HYVA 3LDSA 1NK9A 4E7KA 4HUGA 4C8KA 4ID5A 2IOCA 4M45A 4CGJA 1LWCA 4G1QA 2XO7A 1SKWA 4B8AB 1KCFA 3C94A 1SL2A 4CJ4A 1CZ9A 1WNSA 3V1RA 4NYFA 3AVHA 3MAQA 1JL1A 3TABA 5I3UA 1QSYA 3VQQA 3L2RA 4IG3A 3DM2A 1CXUA 3OYKA 3OJUA 3ZSZA 1NK0A 1JLEA 1QSLA 5E41A 4CHYA 3PO4A 3K2PA 1NK5A 4FJGA 4FZZA 1DTTA 2AJQA 1FKPA 1TV6A 1L3VA 4Q5VA 4FVMA 4CIGA 4LSNA 2FBVA 1L3SA 3QNNA 4DMNA 1RTDA 3OY9A 1RTIA 3D45A 3OYBA 4Z4FA 1S6QA 1RTHA 4HTUA 1NK4A 3LPUA 1RT7A 4DLEA 4AHUA 4MQ3A 2HHXA 5DMRA 1ITGA 4CK3A 1YVUA 3M8RA 5KI6A 5FDLA 4DU4A 3VQ5A 4CERA 4KHSA 5CYQA 3KLFA 3NGIA 4EZ6A 1J5OA 4C8LA 4IKFA 1D5AA 1BIZA 3E01A 1C0MA 1WAFA 2IAJA 3HPGA 1D9FA 4KHQA 4W5RA 1VSHA 4LSLA 3QIPA 4IFYA 4FW1A 4CEEA 1RBUA 4FJIA 1L3UA 2HW3A 4BWJA 4B8CA 1U48A 4Z4GA 1SUQA 1F21A 1S1TA 3DOKA 3TAMA 3K5LA 2OZSA 4ELTA 4K8ZA 3C95A 4DTXA 5KGXA 3LZIA 4CECA 4JS5A 1HYSA 1QE1A 2OPRA 3AO3A 3L3VA 3SUPA 3O3GA 2G8HA 4FJMA 4FM0A 1G15A 1O1WA 3ISNC 3OYEA 4DTJA 4DFJA 4E3SA 1TK0A 4OKEA 1UOCA 1QQCA 1BI4A 3AVFA 3G0ZA 3NFAA 4DFMA 1REVA 3AVAA 2A1RA 5HRPA 1TKDA 2G8FA 3OYHA 4IDKA 1S9EA 3QINA 3HP9A 5KRTA 3NAEA 3V4IA 3CFPA 3KJVA 3QIOA 1DLOA 4ZHRA 4DQSA 4CEZA 4HVJA 4FM2A 4N5SA 4KKOA 4LD0A 3SUQA 2VG7A 1VSKA 1X9MA 3JYTA 3QLHA 3AVJA 3TR8A 3CQ8A 4KHYA 4C8MA 2IS3A 2OA8A 2YNIA 4CF0A 3NCIA 4ELVA 3OYMA 4DLGA 4DSEA 1RT1A 2EHGA 3OVNA 4R5PA 1XI1A 4H4OA 3VQBA 2Y1JA 1WSJA 1XWLA 4CHZA 4FLTA 3M8PA 5KRSA 4OPJA 1B92A 3NDKA 1VSLA 5HP1A 4ID1A 3KD5E 3SYZA 2D5RA 1A5XA 4L8RB 4DQQA 1T05A 2I5JA 2PYJA 4J2BA 5K14A 1JXEA 3CM6A 2X6NA 3LAKA 5C24A 3WNFA 4Z4CA 3L8BA 3QEVA 4KHWA 3K5OA 1RT6A 2HNYA 3HSTB 1J54A 3NF6A 2JLEA 4KO0A 2PYLA 1HQEA 3P5JA 4QCLA 4EP5A 4B9NA 2G8UA 3NE6A 3AO5A 2HNDA 2KW4A 2XHBA 1U47A 4E19A 1T8EA 3RTVA 3KTQA 1KVAA 4I2PA 4CF9A 3I8DA 3L2QA 4DSIA 2Z1GA 2FBYA 2B5JA 4H8KA 4JS4A 3HXMA 1VSMA 3BDPA 1VSDA 5T7BA 2G8VA 2XY7A 1BCMA 3AA3A 2D0BA 2E4LA 4CGGA 4YNQA 4BDYA 5HRNA 3U3YA 4Q0BA 3WNGA 4AH9A 4FZXC 3DLRA 1S1UA 4W5OA 3QETA 4N47A 1X1PA 4KI6A 2ZD1A 4DTSA 4FLVA 1YT3A 4M3ZA 3TAPA 3ZCMA 4O4GA 1NJWA 1ZBHA 1BHLA 2HVHA 1JLFA 3ITHA 3T1AA 1BIUA 4IG0A 3QEWA 4AHTA 1T7PA 2Q3SA 1UWBA 1J9AA 1Z25A 2YV0X 3NF9A 4ICLA 1JLCA 4CJ3A 4CHOA 3K5NA 4FLYA 4DF8A 2KFNA 4FJ5A 1JL2A 3U3GA 1Y97A 1SL0A 3TARA 4Z4IA 1S1WA 1GOBA 3SJJA 1GOAA 3DYAA 3HVTA 4GW6A 4OVLA 3JSMA 4CEBA 4HCCA 1U04A 4DSJA 4CGHA 4J2EA 4NCAA 2OYQA 1YTAA 1WN7A 3AA5X 3PV8A 4FJKA 3NBPA 2YNFA 1HNIA 1C0UA 2G8WA 4FW2A 4IBNA 2ZQBA 3SZ2A 4DTNA 4CHNA 2F8TA 1RDAA 1KVCA 4E1NA 3OS0A 1BISA 3SPZA 4N76A 5SWMA 4BDZA 3LALA 3TI0A 1MU2A 4QOZB 4FK2A 4Y1DA 4DQPA 3G10A 4CF8A 3NGZA 1RBRA 4O0IA 4FJ8A 4RG8A 1EETA 4NYNA 4FZYA 1Q9XA 3I0RA 3KLIA 3L3UA 4CJLA 2IGIA 3KK1A 3TAFA 2XRIA 1RDCA 3CM5A 1WSFA 1NOYA 4JRQA 4E7HA 5J2PA 4F4KA 4KAZA 2QKBA 3HO1A 4CK2A 3F9KA 4KRFA 2O4IA 3V9ZA 5KGWA 4BE1A 5CZ1A 3CFRA 2QXFA 3SQ4A 2FBXA 3L2WA 1JLQA 3K57A 3DOLA 1RBTA 2DTUA 1HYZA 3NH0A 3OYDA 1N5YA 4O55A 2HHTA 1TKXA 3DLKA 3VQPA 4CJQA 4FK4A 3BGRA 3A2FA 3RMDA 2GV9A 2XY8A 3OS1A 1A5WA 3LANA 2DFEA 1HPZA 2ETJA 3HPOA 2OZMA 3O4NA 1TGOA 2Z1JA 3KLGA 4Z4HA 2BDPA 4M3TA 5FRMA 5I42A 4IFVA 4K8XA 1JXBA 3AO1A 3LZJA 1XHXA 3ZSVA 1VSIA 2B4JA 4DS4A 4I9LA 3S3OA 4HCBA 3VQ8A 3V9UA 4BE0A 4DS5A 3V81A 3KD1E 5FRNA 4CIEA 1B9DA 3NHGA 1KFDA 4EP4A 3OYAA 1ZBIA 1IKVA 4PWDA 3OS2A 3KLEA 1X9WA 2HHSA 3VA3A 3B6OA 3VN5A 4CFBA 1R0AA 4PUOA 3V9WA 3EY1A 3QESA 4E7IA 4M42A 3LP0A 3ZT4A 4M3WA 5J2NA 3CFOA 1GOCA 4FM1A 1L5UA 1CZBA 4CFCA 1KSPA 3HJFA 1KTQA 4LH5A 4QAGA 2OPSA 1ASUA 1UAXA 1ZBLA 4F2SA 3TANA 3VQEA 2GUIA 1J53A 4DQIA 4DSFA 4BWMA 2IC3A 1LAVA 3IS9A 1VSEA 4O44A 3VQ6A 4B08A 3MEGA 1B9FA 2PZSA 4J2AA 4KPYA 1LW0A 1A5VA 1VSJA 2Z1HA 4OKKA 4FLUA 2XY6A 3C6TA 1RT5A 4F3OA 1Q8IA 3OYLA 3AA4A 4CEAA 4CJVA 4B9MA 4DQRA 3CYMA 3LP1A 5HRSA 4B3OA 1LW2A 4DSLA 2ZE2A 2YHBA 1QTMA 4AILC 4JLHA 4KFBA 3VQ7A 3U6FA 4N41A 4KB1A 4E7LA 4OLAA 3IG1A 2B6AA 3RMCA 4CJFA 2F8SA 3SNNA 4CF1A 1NK6A 5CYMA 1HQUA 4RW4A 1IO2A 4BACA 3KKSA 3NGYA 4CJUA 4CJTA 3CG7A 3AO4A 5KTQA 4M3UA 4NCBA 1NKBA 1FK9A 3AV9A 2E6LA 4RW9A 1WLJA 3IRXA 4LY7A 4KB0A 2VG5A 1RCHA 3D0PA 4FJNA 1RT2A 3T3FA 2BGGA 4M41A 3AVCA 3OYIA 3LP2A 4M3XA 3ZT2A 1BQNA 3AVKA 4I2QA 1JLGA 1VSFA 2WONA 2KZZA 2ITGA 1RT4A 3OYFA 4W5TA 3S3MA 4ZTJA 3ZT0A 3K58A 3DLGA 3O3HA 3KLHA 3ZSYA 4CEDA 1HNVA 3V6DA 3SPYA 1ZYQA 3WNHA 5J2QA 5JS1A 4RW8A 1XHZA 1U45A 4JRPA 3SV4A 1TK5A 3SQ2A 4CGDA 1W0HA 4E0DA 4FLXA 4DU3A 1CLQA 4OGEA 1IKYA 3MXMA 4CEFA 1L3TA 3WNEA 3SI6A 4E1MA 2QK9A 4DTUA 4CIFA 3RRHA 2KZMA 4CE9A 3KK3A 1NKEA 2YNHA 4FLWA 4C8OA 4I9QA 4KTZA 2Z1IA 3PUFA 3I0SA 3M8SA 3PX4A 5HBMA 4E7JA 3SCXA 1LWFA 1NJZA 3P1GA 5HLFA 2G8KA 5DK5A 4KHUA 3HL8A 4OGCA 4CCHA 5C25A 3PX0A 4CEQA 3DMJA 3P83D 5FROA 1SKSA 3OJSA 4F2RA 3AVBA 1ASVA 1FKOA 4CJWA 2YKNA 4FJJA 3L2UA 4J2DA 3ZT3A 1N6QA 4AHVA 3ZSXA 4E89A 4PA1A 4FXDA 2P5GA 1IH7A 3KKRA 4DTOA 3IAYA 3M8QA 2DFHA 3HP6A 1SL1A 4KHNA 2VWJA 4OJRA 4BE2A 2HB5A 4B9UA 2EX3A 4N56A 4HHTA 2KFZA 2RPIA 3TAQA 3LPTA 1TAUA 1DTQA 1KVBA 4MFBA 2X6SA 1I39A 4NCGA 4CFAA 1UA1A 2XY5A 1LV5A 4DSKA 2HMIA 4CK1A 4ZTFA 3DRSA 4FJ7A 1EX4A 4OKJA 1C1AA 1C1BA 4FK0A 4WE1A 1TL1A 3HM9A 1SKRA 3S9HA 1VK0A 5JS2A 3VQCA 3NF8A 4AHSA 4CJRA 4DFPA 2PY5A 1I3AA 3MXJA 4RW7A 1VRTA 2X74A 4Y1CA 3T19A 1S1XA 3V1QA 3OYNA 4AHRA 1T03A 4M3YA 3MXIA 1U49A 2YKMA 3SUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCO A;  1IKW A;  4CES A;  4CEO A;  1WSG A;  2NUB A;  3TAG A;  1U4B A;  3K5M A;  3TAE A;  1S5J A;  2DY4 A;  1HMV A;  3DLH A;  2HHV A;  2P1J A;  3ZSO A;  3THV A;  3HYF A;  4YFU A;  3DLB A;  2HHU A;  5J2M A;  1X9S A;  3HK2 A;  2VWK A;  4DU1 A;  3DLE A;  3RWU A;  1WSI A;  1QSS A;  2D0C A;  2IDO A;  1TL3 A;  4GVM A;  1EKE A;  1ZBF A;  1RBS A;  4F8R A;  1BQM A;  3K59 A;  2D0A A;  2ATQ A;  3QEI A;  1EXQ A;  3AVG A;  3AVI A;  3PO5 A;  3KK2 A;  4PY5 A;  2HHQ A;  3VQ4 A;  3OYG A;  4TSX A;  1WSH A;  1WAJ A;  3ASM A;  2O4G A;  5HRO A;  4FJL A;  3NF7 A;  1JKH A;  3RRG A;  2FC0 A;  4O0J A;  4CJS A;  3KIO A;  4CJK A;  3HT3 A;  2R7Y A;  1CXQ A;  3RR8 A;  3MED A;  2P51 A;  3SQ0 A;  3O4Q A;  1TKT A;  3PX6 A;  3ZSQ A;  4W5Q A;  4Z4E A;  5J1E A;  3ULD A;  4B9L A;  5CY4 A;  1BGX T;  2KQ2 A;  2BAN A;  3AVL A;  4DFK A;  4H4M A;  2P5O A;  1C6V A;  2F96 A;  2BE2 A;  1NJX A;  2HHW A;  4KV8 A;  3DI6 A;  1ZBU A;  4GMJ B;  1HRH A;  3QO9 A;  4RW6 A;  3LAM A;  3EZ5 A;  3AVM A;  2YHA A;  4FYD A;  4OLB A;  2GBZ A;  3NH2 A;  1QS4 A;  2OPQ A;  4EZ9 A;  4DTP A;  3AVN A;  5HRR A;  3DRR A;  4BDP A;  3QER A;  3EYZ A;  3RMA A;  1JLA A;  5C42 A;  3ZSR A;  2YNG A;  4HUF A;  1QHT A;  1FXX A;  3LWM A;  1TK8 A;  1NJY A;  3PY8 A;  4KRE A;  4CHP A;  5SZT A;  1HJR A;  3VQD A;  2RF2 A;  4B9V A;  1RT3 A;  3AA2 A;  1TVR A;  1ASW A;  5D3G A;  1LAW A;  3VQ9 A;  2WOM A;  1Q9Y A;  2JGU A;  1KRP A;  4FJH A;  4CFD A;  4O5B A;  2Y1I A;  1RIL A;  5CZ2 A;  3LP3 A;  4DF4 A;  3QEP A;  4I7F A;  1Z26 A;  4AHC A;  2A1S A;  1IG9 A;  3ZSW A;  3ALY A;  4LH4 A;  4PQU A;  4HUE A;  3OYC A;  4KTQ A;  2VG6 A;  1NKC A;  4CHQ A;  4CJP A;  2OPP A;  2RKI A;  1BL3 A;  4C8N A;  1NK8 A;  4CF2 A;  4B9S A;  1KLM A;  1RNH A;  3VQA A;  4CGI A;  2QKK A;  3ZT1 A;  2FBT A;  3L2V A;  3SV3 A;  3SUN A;  3H08 A;  3NH1 A;  1VRU A;  4F3T A;  4CGF A;  1RBV A;  3B6P A;  3V1O A;  4DG1 A;  1C0T A;  2G8I A;  2E6M A;  3MEE A;  1D9D A;  3MEC A;  3AO2 A;  1K6Y A;  3SQ1 A;  1C1C A;  1JLB A;  1YTU A;  1TKZ A;  1NOZ A;  3C6U A;  1S6P A;  1RTJ A;  4XIU A;  3RMB A;  4B9T A;  4ELU A;  4Z0U A;  4M3R A;  4UQG A;  1SV5 A;  1IKX A;  4FJX A;  3DRP A;  3UIQ A;  3F73 A;  3HPH A;  3HVR A;  2HVI A;  3OYJ A;  3LWL A;  1XC9 A;  4KI4 A;  1LWE A;  2DFF A;  3QNO A;  4DWI A;  1S9G A;  1EP4 A;  1WSE A;  2HNZ A;  1TAQ A;  2LSN A;  1W9H A;  4KTW A;  3O3F A;  2W42 A;  4FCY A;  4CJE A;  1RDB A;  3V9S A;  1NK7 A;  1KFS A;  3VA0 A;  3V9X A;  1RDD A;  4OPK A;  4FJ9 A;  3S3N A;  5EU7 A;  3TWH A;  1BI4 B;  4DTR A;  2RN2 A;  3FFI A;  4DTM A;  3QEX A;  2X78 A;  1D8Y A;  2KTQ A;  1S1V A;  1UA0 A;  4FLZ A;  1KLN A;  4W5N A;  3RR7 A;  4CJ5 A;  1HYV A;  3LDS A;  1NK9 A;  4E7K A;  4HUG A;  4C8K A;  4ID5 A;  2IOC A;  4M45 A;  4CGJ A;  1LWC A;  4G1Q A;  2XO7 A;  1SKW A;  4B8A B;  1KCF A;  3C94 A;  1SL2 A;  4CJ4 A;  1CZ9 A;  1WNS A;  3V1R A;  4NYF A;  3AVH A;  3MAQ A;  1JL1 A;  3TAB A;  5I3U A;  1QSY A;  3VQQ A;  3L2R A;  4IG3 A;  3DM2 A;  1CXU A;  3OYK A;  3OJU A;  3ZSZ A;  1NK0 A;  1JLE A;  1QSL A;  5E41 A;  4CHY A;  3PO4 A;  3K2P A;  1NK5 A;  4FJG A;  4FZZ A;  1DTT A;  2AJQ A;  1FKP A;  1TV6 A;  1L3V A;  4Q5V A;  4FVM A;  4CIG A;  4LSN A;  2FBV A;  1L3S A;  3QNN A;  4DMN A;  1RTD A;  3OY9 A;  1RTI A;  3D45 A;  3OYB A;  4Z4F A;  1S6Q A;  1RTH A;  4HTU A;  1NK4 A;  3LPU A;  1RT7 A;  4DLE A;  4AHU A;  4MQ3 A;  2HHX A;  5DMR A;  1ITG A;  4CK3 A;  1YVU A;  3M8R A;  5KI6 A;  5FDL A;  4DU4 A;  3VQ5 A;  4CER A;  4KHS A;  5CYQ A;  3KLF A;  3NGI A;  4EZ6 A;  1J5O A;  4C8L A;  4IKF A;  1D5A A;  1BIZ A;  3E01 A;  1C0M A;  1WAF A;  2IAJ A;  3HPG A;  1D9F A;  4KHQ A;  4W5R A;  1VSH A;  4LSL A;  3QIP A;  4IFY A;  4FW1 A;  4CEE A;  1RBU A;  4FJI A;  1L3U A;  2HW3 A;  4BWJ A;  4B8C A;  1U48 A;  4Z4G A;  1SUQ A;  1F21 A;  1S1T A;  3DOK A;  3TAM A;  3K5L A;  2OZS A;  4ELT A;  4K8Z A;  3C95 A;  4DTX A;  5KGX A;  3LZI A;  4CEC A;  4JS5 A;  1HYS A;  1QE1 A;  2OPR A;  3AO3 A;  3L3V A;  3SUP A;  3O3G A;  2G8H A;  4FJM A;  4FM0 A;  1G15 A;  1O1W A;  3ISN C;  3OYE A;  4DTJ A;  4DFJ A;  4E3S A;  1TK0 A;  4OKE A;  1UOC A;  1QQC A;  1BI4 A;  3AVF A;  3G0Z A;  3NFA A;  4DFM A;  1REV A;  3AVA A;  2A1R A;  5HRP A;  1TKD A;  2G8F A;  3OYH A;  4IDK A;  1S9E A;  3QIN A;  3HP9 A;  5KRT A;  3NAE A;  3V4I A;  3CFP A;  3KJV A;  3QIO A;  1DLO A;  4ZHR A;  4DQS A;  4CEZ A;  4HVJ A;  4FM2 A;  4N5S A;  4KKO A;  4LD0 A;  3SUQ A;  2VG7 A;  1VSK A;  1X9M A;  3JYT A;  3QLH A;  3AVJ A;  3TR8 A;  3CQ8 A;  4KHY A;  4C8M A;  2IS3 A;  2OA8 A;  2YNI A;  4CF0 A;  3NCI A;  4ELV A;  3OYM A;  4DLG A;  4DSE A;  1RT1 A;  2EHG A;  3OVN A;  4R5P A;  1XI1 A;  4H4O A;  3VQB A;  2Y1J A;  1WSJ A;  1XWL A;  4CHZ A;  4FLT A;  3M8P A;  5KRS A;  4OPJ A;  1B92 A;  3NDK A;  1VSL A;  5HP1 A;  4ID1 A;  3KD5 E;  3SYZ A;  2D5R A;  1A5X A;  4L8R B;  4DQQ A;  1T05 A;  2I5J A;  2PYJ A;  4J2B A;  5K14 A;  1JXE A;  3CM6 A;  2X6N A;  3LAK A;  5C24 A;  3WNF A;  4Z4C A;  3L8B A;  3QEV A;  4KHW A;  3K5O A;  1RT6 A;  2HNY A;  3HST B;  1J54 A;  3NF6 A;  2JLE A;  4KO0 A;  2PYL A;  1HQE A;  3P5J A;  4QCL A;  4EP5 A;  4B9N A;  2G8U A;  3NE6 A;  3AO5 A;  2HND A;  2KW4 A;  2XHB A;  1U47 A;  4E19 A;  1T8E A;  3RTV A;  3KTQ A;  1KVA A;  4I2P A;  4CF9 A;  3I8D A;  3L2Q A;  4DSI A;  2Z1G A;  2FBY A;  2B5J A;  4H8K A;  4JS4 A;  3HXM A;  1VSM A;  3BDP A;  1VSD A;  5T7B A;  2G8V A;  2XY7 A;  1BCM A;  3AA3 A;  2D0B A;  2E4L A;  4CGG A;  4YNQ A;  4BDY A;  5HRN A;  3U3Y A;  4Q0B A;  3WNG A;  4AH9 A;  4FZX C;  3DLR A;  1S1U A;  4W5O A;  3QET A;  4N47 A;  1X1P A;  4KI6 A;  2ZD1 A;  4DTS A;  4FLV A;  1YT3 A;  4M3Z A;  3TAP A;  3ZCM A;  4O4G A;  1NJW A;  1ZBH A;  1BHL A;  2HVH A;  1JLF A;  3ITH A;  3T1A A;  1BIU A;  4IG0 A;  3QEW A;  4AHT A;  1T7P A;  2Q3S A;  1UWB A;  1J9A A;  1Z25 A;  2YV0 X;  3NF9 A;  4ICL A;  1JLC A;  4CJ3 A;  4CHO A;  3K5N A;  4FLY A;  4DF8 A;  2KFN A;  4FJ5 A;  1JL2 A;  3U3G A;  1Y97 A;  1SL0 A;  3TAR A;  4Z4I A;  1S1W A;  1GOB A;  3SJJ A;  1GOA A;  3DYA A;  3HVT A;  4GW6 A;  4OVL A;  3JSM A;  4CEB A;  4HCC A;  1U04 A;  4DSJ A;  4CGH A;  4J2E A;  4NCA A;  2OYQ A;  1YTA A;  1WN7 A;  3AA5 X;  3PV8 A;  4FJK A;  3NBP A;  2YNF A;  1HNI A;  1C0U A;  2G8W A;  4FW2 A;  4IBN A;  2ZQB A;  3SZ2 A;  4DTN A;  4CHN A;  2F8T A;  1RDA A;  1KVC A;  4E1N A;  3OS0 A;  1BIS A;  3SPZ A;  4N76 A;  5SWM A;  4BDZ A;  3LAL A;  3TI0 A;  1MU2 A;  4QOZ B;  4FK2 A;  4Y1D A;  4DQP A;  3G10 A;  4CF8 A;  3NGZ A;  1RBR A;  4O0I A;  4FJ8 A;  4RG8 A;  1EET A;  4NYN A;  4FZY A;  1Q9X A;  3I0R A;  3KLI A;  3L3U A;  4CJL A;  2IGI A;  3KK1 A;  3TAF A;  2XRI A;  1RDC A;  3CM5 A;  1WSF A;  1NOY A;  4JRQ A;  4E7H A;  5J2P A;  4F4K A;  4KAZ A;  2QKB A;  3HO1 A;  4CK2 A;  3F9K A;  4KRF A;  2O4I A;  3V9Z A;  5KGW A;  4BE1 A;  5CZ1 A;  3CFR A;  2QXF A;  3SQ4 A;  2FBX A;  3L2W A;  1JLQ A;  3K57 A;  3DOL A;  1RBT A;  2DTU A;  1HYZ A;  3NH0 A;  3OYD A;  1N5Y A;  4O55 A;  2HHT A;  1TKX A;  3DLK A;  3VQP A;  4CJQ A;  4FK4 A;  3BGR A;  3A2F A;  3RMD A;  2GV9 A;  2XY8 A;  3OS1 A;  1A5W A;  3LAN A;  2DFE A;  1HPZ A;  2ETJ A;  3HPO A;  2OZM A;  3O4N A;  1TGO A;  2Z1J A;  3KLG A;  4Z4H A;  2BDP A;  4M3T A;  5FRM A;  5I42 A;  4IFV A;  4K8X A;  1JXB A;  3AO1 A;  3LZJ A;  1XHX A;  3ZSV A;  1VSI A;  2B4J A;  4DS4 A;  4I9L A;  3S3O A;  4HCB A;  3VQ8 A;  3V9U A;  4BE0 A;  4DS5 A;  3V81 A;  3KD1 E;  5FRN A;  4CIE A;  1B9D A;  3NHG A;  1KFD A;  4EP4 A;  3OYA A;  1ZBI A;  1IKV A;  4PWD A;  3OS2 A;  3KLE A;  1X9W A;  2HHS A;  3VA3 A;  3B6O A;  3VN5 A;  4CFB A;  1R0A A;  4PUO A;  3V9W A;  3EY1 A;  3QES A;  4E7I A;  4M42 A;  3LP0 A;  3ZT4 A;  4M3W A;  5J2N A;  3CFO A;  1GOC A;  4FM1 A;  1L5U A;  1CZB A;  4CFC A;  1KSP A;  3HJF A;  1KTQ A;  4LH5 A;  4QAG A;  2OPS A;  1ASU A;  1UAX A;  1ZBL A;  4F2S A;  3TAN A;  3VQE A;  2GUI A;  1J53 A;  4DQI A;  4DSF A;  4BWM A;  2IC3 A;  1LAV A;  3IS9 A;  1VSE A;  4O44 A;  3VQ6 A;  4B08 A;  3MEG A;  1B9F A;  2PZS A;  4J2A A;  4KPY A;  1LW0 A;  1A5V A;  1VSJ A;  2Z1H A;  4OKK A;  4FLU A;  2XY6 A;  3C6T A;  1RT5 A;  4F3O A;  1Q8I A;  3OYL A;  3AA4 A;  4CEA A;  4CJV A;  4B9M A;  4DQR A;  3CYM A;  3LP1 A;  5HRS A;  4B3O A;  1LW2 A;  4DSL A;  2ZE2 A;  2YHB A;  1QTM A;  4AIL C;  4JLH A;  4KFB A;  3VQ7 A;  3U6F A;  4N41 A;  4KB1 A;  4E7L A;  4OLA A;  3IG1 A;  2B6A A;  3RMC A;  4CJF A;  2F8S A;  3SNN A;  4CF1 A;  1NK6 A;  5CYM A;  1HQU A;  4RW4 A;  1IO2 A;  4BAC A;  3KKS A;  3NGY A;  4CJU A;  4CJT A;  3CG7 A;  3AO4 A;  5KTQ A;  4M3U A;  4NCB A;  1NKB A;  1FK9 A;  3AV9 A;  2E6L A;  4RW9 A;  1WLJ A;  3IRX A;  4LY7 A;  4KB0 A;  2VG5 A;  1RCH A;  3D0P A;  4FJN A;  1RT2 A;  3T3F A;  2BGG A;  4M41 A;  3AVC A;  3OYI A;  3LP2 A;  4M3X A;  3ZT2 A;  1BQN A;  3AVK A;  4I2Q A;  1JLG A;  1VSF A;  2WON A;  2KZZ A;  2ITG A;  1RT4 A;  3OYF A;  4W5T A;  3S3M A;  4ZTJ A;  3ZT0 A;  3K58 A;  3DLG A;  3O3H A;  3KLH A;  3ZSY A;  4CED A;  1HNV A;  3V6D A;  3SPY A;  1ZYQ A;  3WNH A;  5J2Q A;  5JS1 A;  4RW8 A;  1XHZ A;  1U45 A;  4JRP A;  3SV4 A;  1TK5 A;  3SQ2 A;  4CGD A;  1W0H A;  4E0D A;  4FLX A;  4DU3 A;  1CLQ A;  4OGE A;  1IKY A;  3MXM A;  4CEF A;  1L3T A;  3WNE A;  3SI6 A;  4E1M A;  2QK9 A;  4DTU A;  4CIF A;  3RRH A;  2KZM A;  4CE9 A;  3KK3 A;  1NKE A;  2YNH A;  4FLW A;  4C8O A;  4I9Q A;  4KTZ A;  2Z1I A;  3PUF A;  3I0S A;  3M8S A;  3PX4 A;  5HBM A;  4E7J A;  3SCX A;  1LWF A;  1NJZ A;  3P1G A;  5HLF A;  2G8K A;  5DK5 A;  4KHU A;  3HL8 A;  4OGC A;  4CCH A;  5C25 A;  3PX0 A;  4CEQ A;  3DMJ A;  3P83 D;  5FRO A;  1SKS A;  3OJS A;  4F2R A;  3AVB A;  1ASV A;  1FKO A;  4CJW A;  2YKN A;  4FJJ A;  3L2U A;  4J2D A;  3ZT3 A;  1N6Q A;  4AHV A;  3ZSX A;  4E89 A;  4PA1 A;  4FXD A;  2P5G A;  1IH7 A;  3KKR A;  4DTO A;  3IAY A;  3M8Q A;  2DFH A;  3HP6 A;  1SL1 A;  4KHN A;  2VWJ A;  4OJR A;  4BE2 A;  2HB5 A;  4B9U A;  2EX3 A;  4N56 A;  4HHT A;  2KFZ A;  2RPI A;  3TAQ A;  3LPT A;  1TAU A;  1DTQ A;  1KVB A;  4MFB A;  2X6S A;  1I39 A;  4NCG A;  4CFA A;  1UA1 A;  2XY5 A;  1LV5 A;  4DSK A;  2HMI A;  4CK1 A;  4ZTF A;  3DRS A;  4FJ7 A;  1EX4 A;  4OKJ A;  1C1A A;  1C1B A;  4FK0 A;  4WE1 A;  1TL1 A;  3HM9 A;  1SKR A;  3S9H A;  1VK0 A;  5JS2 A;  3VQC A;  3NF8 A;  4AHS A;  4CJR A;  4DFP A;  2PY5 A;  1I3A A;  3MXJ A;  4RW7 A;  1VRT A;  2X74 A;  4Y1C A;  3T19 A;  1S1X A;  3V1Q A;  3OYN A;  4AHR A;  1T03 A;  4M3Y A;  3MXI A;  1U49 A;  2YKM A;  3SUO A; 
#chains in the Genus database with same CATH topology
 1BCO A;  4CBW A;  1JCG A;  5LJW A;  1U4B A;  1NMD A;  3HYF A;  1X9S A;  3DLE A;  4A57 A;  1N34 K;  3RWU A;  4X62 K;  4WF9 L;  2HMP A;  1BQM A;  2E1Z A;  1EXQ A;  4PY5 A;  2HHQ A;  3VQ4 A;  3E9O A;  3OYG A;  1WSH A;  1K8A O;  3ASM A;  3ZYY X;  2NRH A;  1W2B M;  4FJL A;  1JKH A;  4BR2 A;  2R7Y A;  3RR8 A;  1CXQ A;  4JI4 K;  3CI5 A;  4KH4 A;  5J1E A;  1BGX T;  2FF6 A;  2KQ2 A;  3AVL A;  3MN9 A;  5AQR A;  4H4M A;  5A2Q O;  1C6V A;  2O8E B;  2BE2 A;  5BN8 A;  1NJX A;  3U4L A;  1ZBU A;  4GMJ B;  1HRH A;  2P9N A;  1IBL K;  3AGK A;  4JI1 K;  3NVK A;  4RW6 A;  2GBZ A;  2OPQ A;  3AVN A;  4B1W B;  5HRR A;  4BDP A;  2QEX N;  2YNG A;  3DLL L;  1FXX A;  4DB3 A;  3PY8 A;  3VQD A;  3KHY A;  5AQG A;  1P90 A;  2NNW A;  2WOM A;  1YAG A;  1Q9Y A;  2UXC K;  4FJH A;  4ISF A;  2Y1I A;  1RIL A;  1ZBS A;  3WT0 A;  1KD1 O;  2P9K A;  4AHC A;  3ZSW A;  3ALY A;  1NKC A;  3O6W A;  1BL3 A;  4C8N A;  1KLM A;  5AJ3 K;  3HTV A;  3H45 C;  1C0T A;  3MEE A;  1D9D A;  1JJ2 M;  1YTU A;  1NOZ A;  4XIU A;  4YY3 K;  1Z6R A;  2GWJ A;  3CD6 N;  3UIQ A;  3IUC A;  3OYJ A;  3LWL A;  4KI4 A;  2DFF A;  2WUS A;  1SS6 A;  4JKH A;  4DWI A;  1WSE A;  1YVN A;  5GAE P;  2LSN A;  2YHW A;  4IOA L;  5LJV A;  2A6A A;  1KFS A;  3L4Q A;  3UKU A;  3C65 A;  4OPK A;  3TWH A;  2ZGY A;  4DTR A;  2RN2 A;  3QEX A;  2KTQ A;  1S1V A;  1UA0 A;  4YOV A;  4BRC A;  1HYV A;  1NK9 A;  4HUG A;  2IOC A;  1LWC A;  4G1Q A;  4IJA A;  3VTH A;  1KCF A;  3T7Z A;  3C94 A;  1SL2 A;  2JWK A;  1WNS A;  3OJU A;  3DM2 A;  3OYK A;  3ZSZ A;  1JLE A;  3RSE B;  3K2P A;  1DTT A;  4BRA A;  5AZJ A;  1L3S A;  2Q31 A;  3CJ1 A;  1WBD A;  1RTD A;  1RTI A;  4OX9 K;  5DMR A;  1ITG A;  4FWM A;  4CK3 A;  5ELZ A;  1TYQ B;  3NGI A;  5KPR A;  1TUY A;  4IKF A;  1D5A A;  2IAJ A;  3HPG A;  3PIO L;  1D9F A;  5AFU A;  4W5R A;  5C2D A;  2P9L A;  4B1Y B;  2P9S B;  4CEE A;  1L3U A;  3WXI A;  3K5L A;  3TAM A;  4CZH A;  3C95 A;  4CEC A;  4JS5 A;  2W40 A;  3L3V A;  3AO3 A;  5AQV A;  2CGL A;  1O1W A;  2YHY A;  3ZX3 A;  5DM7 L;  4E3S A;  3THY A;  1TK0 A;  4OKE A;  1UOC A;  1QQC A;  1BI4 A;  3AVF A;  2A1R A;  2G8F A;  3HP9 A;  5KRT A;  5BRD A;  4KKO A;  3SUQ A;  4JI6 K;  2VG7 A;  4LF6 K;  3JYT A;  3TR8 A;  3B8A X;  2OA8 A;  2YNI A;  4FOE A;  1XUP O;  3TTC A;  2HBL A;  2EHG A;  2YHX A;  3KD5 E;  1A5X A;  4OPA A;  4CZK A;  1JXE A;  3CM6 A;  3QEV A;  2QWN A;  3NF6 A;  5F2R A;  2JLE A;  4B9N A;  2E2N A;  2XHB A;  2HND A;  4JKB A;  4E19 A;  3I8D A;  4GNI A;  2QWQ A;  4DSI A;  2Z1G A;  1E3M A;  5M1Q A;  1V4S A;  1ATS A;  4CZI A;  3U3Y A;  3C6H A;  4FZX C;  5AQN A;  1VQ5 N;  4W5O A;  5AQU A;  2GEM A;  4BR9 A;  4LC9 B;  1X1P A;  1YT3 A;  3TAP A;  4BR5 A;  4A61 A;  1BHL A;  1JLF A;  3T1A A;  1NGI A;  4AHT A;  4ICL A;  2Q3S A;  4IOX A;  1JLC A;  1S22 A;  4FLY A;  3QFU A;  4JK8 A;  4OVL A;  3J81 O;  1Q81 O;  2AA4 A;  4CGH A;  4B1X B;  3FE1 A;  4GV6 A;  1C0F A;  2D4W A;  2QM1 A;  1HUX A;  4UY8 O;  2V7Z A;  4Y0W A;  3EKS A;  4NB4 A;  4WFN L;  4FW2 A;  4DTN A;  2F8T A;  1RDA A;  5EY4 A;  5CR4 A;  1NGG A;  5SWM A;  2UU9 K;  4QOZ B;  2HBK A;  2IVO A;  1OH7 A;  3L3U A;  5GAG P;  4CJL A;  1VQL N;  2PFU A;  3HO1 A;  1KAY A;  3V9Z A;  3R6M A;  3H46 O;  1NM1 A;  5CZ1 A;  2QXF A;  1JLQ A;  3DOL A;  5F0X A;  2A41 A;  3DLK A;  2GV9 A;  1A5W A;  1HPZ A;  2ETJ A;  3HPO A;  5DM6 L;  4Z4H A;  2BDP A;  4K8X A;  1QQO A;  2FLO A;  3LZJ A;  3D7E O;  2RHK A;  3HM8 A;  3ZSV A;  3M3Z A;  3S3O A;  3VQ8 A;  3KD1 E;  4CIE A;  1XQS C;  1ZBI A;  2HOE A;  1IKV A;  1XNQ K;  3KWI A;  3O9T A;  3VA3 A;  4CFB A;  4PUO A;  2ZGZ A;  1GOC A;  3S41 A;  1L5U A;  4CFC A;  2OPS A;  1UAX A;  4BRM A;  5GAD P;  3CMA N;  1J53 A;  4DQI A;  4BWM A;  4O44 A;  4J2A A;  3O1W A;  1VSJ A;  5LMU K;  4I6M B;  4DQR A;  3CYM A;  3DAW A;  5M1K A;  3D6R A;  3LP1 A;  3J7A P;  1LW2 A;  4DV4 K;  2YHB A;  1QTM A;  4JLH A;  3VMF B;  3U6F A;  4JI8 K;  4WQ5 C;  3UE5 A;  4E7L A;  4OLA A;  1BUP A;  1KQS M;  4ILG B;  3RMC A;  4CF1 A;  5CYM A;  4X66 K;  4BAC A;  3KKS A;  3CC4 N;  4M3U A;  1NKB A;  1QVF M;  3AV9 A;  1TYQ A;  2I7N A;  4RW9 A;  3IRX A;  4LY7 A;  4JEP A;  2UUC K;  1RCH A;  3GL1 A;  2BGG A;  4O8K A;  3AVC A;  3LP2 A;  1VAZ A;  3ZT2 A;  3CJ9 A;  4PKH A;  2Q2R A;  4QS9 A;  2ZJP L;  3FR0 A;  4W5T A;  3S3M A;  4ZTJ A;  1HNV A;  4DV3 K;  5J2Q A;  5AQJ A;  4RW8 A;  1HKB A;  4MDA A;  3FFK B;  2PAV A;  3TTD A;  2FXU A;  5FPE A;  2QWR A;  4AM6 A;  4A2A A;  4CEF A;  3WNE A;  2QK9 A;  4AM7 A;  3VTI A;  3OBW A;  3PUF A;  3I0S A;  3M8S A;  4E7J A;  4U67 L;  3LDQ A;  3P1G A;  2CGJ A;  3T69 A;  3PX0 A;  4CEQ A;  2O8F A;  5C12 A;  5FRO A;  4F2R A;  2P9I A;  4FJJ A;  4IEI A;  2YKN A;  4CZJ A;  3A5N C;  1QHA A;  2P9P A;  4AHV A;  3ZSX A;  2O8D A;  4YOR A;  3HP6 A;  4BRG A;  2VWJ A;  3O9S A;  4OJR A;  4B9U A;  1DKG D;  4H5W A;  3TAQ A;  1IBK K;  4CFA A;  4IDH A;  1LV5 A;  2V51 B;  4K25 A;  2XY5 A;  3T1H K;  2ZJR L;  1HNX K;  2HMI A;  4H0O A;  1EX4 A;  4A5B A;  1C1A A;  1DEJ A;  4E1J A;  4XH5 A;  4BR0 A;  3THX A;  4DFP A;  3ZEU A;  2Q97 A;  4ISE A;  1S1X A;  1BOT O;  2P9K B;  2ZJQ L;  5LY3 A;  3MN5 A;  1IKW A;  4CEO A;  1HMV A;  3DLH A;  1RFQ A;  1P8Z A;  2HHV A;  3J7Z O;  3ZSO A;  3THV A;  3DLB A;  2Q0R A;  4PKI A;  5J2M A;  3HK2 A;  2VWK A;  4DU1 A;  1NGD A;  1EO1 A;  1QSS A;  2D0C A;  4F8R A;  4G9Z A;  1ZBF A;  3K59 A;  2D0A A;  3TSQ A;  3PO5 A;  2W41 A;  4B1V A;  1Q18 A;  4NCB A;  4CJK A;  4YOT A;  4F9O A;  3ZSQ A;  4Z4E A;  3ULD A;  4B9L A;  5CY4 A;  4NO7 A;  2BAN A;  4DFK A;  2P5O A;  4EFH A;  2HHW A;  1ZXO A;  3QO9 A;  3EZ5 A;  1T3V A;  4HTL A;  4LF9 K;  4OLB A;  4C23 A;  4EZ9 A;  3W3D A;  4OPH A;  4DTP A;  3DRR A;  3VF4 A;  1JCF A;  3MWP A;  4HUF A;  3R9P A;  1QHT A;  1HR0 K;  2NRV A;  4CHP A;  3CCR N;  3L0Q A;  2A5X A;  1ASW A;  3VQ9 A;  4YHH K;  4QS7 A;  5AZJ B;  3QEP A;  3SAH A;  3OW2 M;  1Z26 A;  3MDQ A;  2A1S A;  4PQU A;  4KTQ A;  2VG6 A;  4CJP A;  3CIP A;  2QKK A;  3ZT1 A;  3L2V A;  3SV3 A;  3SUN A;  1MWM A;  4BY9 C;  1VRU A;  3V1O A;  4DG1 A;  4LF5 K;  2G8I A;  2P9L B;  2E88 A;  3SQ1 A;  4GV3 A;  3A5L C;  1C1C A;  4DV5 K;  3C6U A;  4H5T A;  1MWK A;  1R59 O;  4ELU A;  4Z0U A;  4M3R A;  1IKX A;  4FJX A;  3MCP A;  1Y64 A;  1N32 K;  1XC9 A;  1LWE A;  3QNO A;  1NU0 A;  1S9G A;  3VEV A;  1RDB A;  2NRX A;  4RTF D;  3M1F A;  2GWK A;  3SK3 A;  1RDD A;  3THY B;  1BI4 B;  2V7Y A;  2X78 A;  5M1O A;  4FWS A;  1GLL O;  4FSV A;  4FLZ A;  3DWL A;  1XMO K;  3LDS A;  4C8K A;  1OKJ A;  4ID5 A;  4M45 A;  3VES A;  1OH6 A;  1SKW A;  1BDG A;  4B8A B;  4EHT A;  4IZ9 A;  4CZG A;  1GLB G;  3U9Z A;  1CZ9 A;  3G6E N;  4NYF A;  1NJI O;  5I3U A;  3VQQ A;  1BWF O;  3L2R A;  1NK0 A;  1QSL A;  4DR6 K;  5E41 A;  1NK5 A;  3L6Q A;  4CZE A;  1FKP A;  1L3V A;  3R8E A;  4FVM A;  4Q5V A;  2O8B A;  2FBV A;  1GLC G;  3MCA B;  3D45 A;  3OYB A;  4KBO A;  2GEL A;  3HZ6 A;  3DXK A;  4AHU A;  4MQ3 A;  2VCP A;  2ASP A;  3Q7B A;  5I9E B;  4A5A A;  3G71 N;  2A3Z A;  2AP1 A;  1WUA A;  3F5T A;  1C0M A;  3O4W A;  4DV2 K;  1VQ7 N;  2QWP A;  3BY5 A;  3I33 A;  3QIP A;  4FW1 A;  1RBU A;  4NLB A;  2UYT A;  4MLE A;  1F21 A;  1S1T A;  2OZS A;  5KGX A;  3H1V X;  3LZI A;  5AQK A;  3CJB A;  1QE1 A;  2OPR A;  2BTF A;  4YOU A;  5AQL A;  2EWS A;  3ISN C;  4BVP A;  5CE3 A;  3G0Z A;  3NFA A;  1REV A;  5HRP A;  3NAE A;  1SZ2 A;  4DQS A;  4CEZ A;  4HVJ A;  4LD0 A;  1VSK A;  1X9M A;  4FVU A;  3AVJ A;  4H5R A;  4JHD A;  3CQ8 A;  1J6Z A;  4XEI A;  4DSE A;  5EXW A;  1RT1 A;  4NXN K;  4H4O A;  5GIP A;  3CHW A;  3CCV N;  4FZZ A;  4FLT A;  1B92 A;  1JCE A;  3GOI A;  4L8R B;  2D5R A;  1XC3 A;  1VQ9 N;  4DQQ A;  2OAN A;  2PYJ A;  5AQX A;  2X6N A;  5BRH A;  5C24 A;  3ENH A;  2UUB K;  2HNY A;  3HST B;  3QBW A;  4KO0 A;  4DR3 K;  1HQE A;  3P5J A;  4QCL A;  4EP5 A;  5BPL A;  5M1N A;  4DR1 K;  3A0I X;  3L2Q A;  3OTO K;  4H8K A;  4IEE A;  4JS4 A;  3BDP A;  1VSD A;  2G8V A;  3JXU A;  2E4L A;  4CGG A;  1Q82 O;  4YNQ A;  3LDN A;  4BDY A;  5HRN A;  3UKR A;  3PIP L;  1S1U A;  4KI6 A;  2ZD1 A;  1IJJ A;  2OTL N;  4B3T K;  1K9M O;  3VEN A;  4JD2 A;  1ZBH A;  4BGB A;  3ITH A;  1T7P A;  2YX6 A;  2HHU A;  2YV0 X;  3SBG A;  1UWB A;  1Z25 A;  2KFN A;  4FJ5 A;  1RDW X;  1T6D A;  3DYA A;  4YDU A;  4CEB A;  1U04 A;  4NCA A;  4J2E A;  2OYQ A;  4WQ4 A;  3AA5 X;  3WEE A;  5HOO A;  3BUZ B;  4NXM K;  2G8W A;  3SZ2 A;  2E1Y A;  4CJ7 A;  3CJA A;  3SPZ A;  1BIS A;  5E26 A;  3LAL A;  1MU2 A;  4WFB L;  4FK2 A;  4Y1D A;  4DQP A;  3FLC O;  4RG8 A;  4FZY A;  3U8X A;  4LF4 K;  3I0R A;  3KLI A;  2IGI A;  3BZC A;  3CJ7 A;  1BU6 O;  1RDC A;  4F4K A;  4KAZ A;  4KRF A;  4CK2 A;  3F9K A;  3JAM O;  2QI2 A;  3N4Q A;  5KGW A;  2NRZ A;  2FBX A;  4B3M K;  2WBN A;  1NGJ A;  1RBT A;  3OYD A;  2HHT A;  3VQP A;  4CJQ A;  3RMD A;  2XY8 A;  3OS1 A;  2DFE A;  5FPD A;  3O4N A;  2QW9 A;  1TGO A;  4JKF A;  5FRM A;  5I42 A;  4IFV A;  4GV9 A;  3AO1 A;  4DV1 K;  1VQO N;  2B4J A;  4DS4 A;  3C6A A;  1FW6 A;  5FRN A;  4A62 A;  4EP4 A;  2HHS A;  5HL7 L;  5JMV A;  4YOX A;  2D0P A;  1R0A A;  4BRK A;  3EY1 A;  4E7I A;  3LP0 A;  3ZT4 A;  1MDU B;  5J2N A;  3HJF A;  4M63 C;  5AR0 A;  4DCH A;  3Q7C A;  1NG9 A;  1GLD G;  2GUI A;  4JK9 A;  1LAV A;  1K8K A;  4B08 A;  2FSJ A;  3MEG A;  1B9F A;  2F4V K;  5CHI A;  1Q8I A;  3OYL A;  4CJV A;  3MWT A;  2O8F B;  5B8H A;  2P9I B;  2P9P B;  5AQQ A;  3VQ7 A;  5KPZ A;  2W6L A;  2O8D B;  3A8Y A;  4CBU A;  1T44 A;  1NK6 A;  1EWQ A;  3FZK A;  1HQU A;  4DUY K;  3NGY A;  3MX5 A;  4RCH A;  3CG7 A;  5AFU H;  3AO4 A;  1FK9 A;  4FL9 A;  4KB0 A;  2V52 B;  1QZ5 A;  2WFB A;  1BQN A;  4I2Q A;  3THX B;  1JLG A;  3ZEU B;  3IFR A;  4EHU A;  3BP8 A;  3F9M A;  3PSF A;  2ITG A;  2O8C A;  4CW7 B;  3HBT A;  3DLG A;  5AQH A;  3ZSY A;  4CED A;  3P31 A;  4O8U A;  3WNH A;  5JS1 A;  5C2F A;  2DPN A;  1XHZ A;  4MO5 A;  3SV4 A;  3SQ2 A;  2QTD A;  4E0D A;  4FLX A;  2VGN A;  3ZX2 A;  1N33 K;  4OGE A;  2NRT A;  2QWL A;  1IKY A;  3CQX A;  3SI6 A;  4E1M A;  3RRH A;  2YNH A;  4C8O A;  4K43 A;  2Z1I A;  2H3G X;  1NJZ A;  2KKZ A;  2G8K A;  3G4S N;  5DK5 A;  3FZM A;  4YOW A;  4OGC A;  5C25 A;  3DMJ A;  3FZL A;  3OJS A;  4CJW A;  3CCM N;  4J2D A;  1NGC A;  1SAZ A;  5AQO A;  3QIC A;  1IH7 A;  1KC8 O;  1NGB A;  2DFH A;  5GIN A;  1SL1 A;  3AGR A;  4ILJ A;  2RPI A;  2YJE A;  1TAU A;  4MFB A;  2FSK A;  2X6S A;  3WQU A;  2F7T A;  1BO5 O;  3G25 A;  3DRS A;  3O9R A;  3SAG A;  4DR7 K;  4OKJ A;  2E2O A;  2NLX A;  3HM9 A;  3S9H A;  1VK0 A;  3NF8 A;  1WB9 A;  1GLA G;  1YUW A;  3OYN A;  3MXI A;  3ATU A;  1YXQ A;  1U49 A;  2D0O A;  1VQN N;  2NUB A;  3K5M A;  1X3N A;  1N36 K;  4YFU A;  2BH1 A;  5BRE A;  2CGK A;  1WSI A;  5E84 A;  1TL3 A;  1EKE A;  1RBS A;  2E8A A;  3VGK A;  3QEI A;  3KK2 A;  3VF6 A;  3O9Q A;  4TSX A;  3J8A A;  1WAJ A;  5HRO A;  3P39 A;  3K9K A;  4CJS A;  3CC2 N;  2P51 A;  3SQ0 A;  4O5F A;  3O4Q A;  1TKT A;  3PX6 A;  4W5Q A;  3ZET B;  4PL7 A;  2F96 A;  2VGM A;  1SQK A;  4IWV A;  3LAM A;  3MN7 A;  1H1V A;  5JVG L;  4FYD A;  3TPQ A;  1QS4 A;  1C0G A;  1W97 L;  5LMN K;  3THW A;  3QER A;  1GLF O;  5C42 A;  1NJY A;  4KRE A;  1HJR A;  2RF2 A;  1TVR A;  5D3G A;  5AZI A;  4LF7 K;  1LAW A;  1S72 N;  4BVO A;  2JGU A;  2O8B B;  5IT9 O;  1KAX A;  3L4I A;  1BG3 A;  3LP3 A;  3ENO A;  3O5B A;  4I7F A;  1IG9 A;  4YOY A;  4HUE A;  3DXK B;  3MX2 A;  3UB5 A;  1NK8 A;  4CF2 A;  4B9S A;  1RNH A;  3VQA A;  4BQL A;  5MLC Q;  2KHO A;  3HRG A;  3R1X A;  1BA0 A;  3EO3 A;  2D1K A;  3TSP A;  3MEC A;  3AO2 A;  1K6Y A;  1HKG A;  3H3O B;  4FWL A;  3NVM A;  4WCE L;  3FGU A;  3F73 A;  2HVI A;  4BRO A;  1WBB A;  1EP4 A;  4KTW A;  3O3F A;  1W9H A;  4AF1 A;  3V9X A;  4M7Y A;  3VOV A;  5EU7 A;  1OVY A;  3FFI A;  1DGK N;  3VEO A;  1D8Y A;  2BUP A;  4W5N A;  1KLN A;  1NMN A;  1HLU A;  4E7K A;  4QS8 A;  4CGJ A;  3OA9 A;  4JHD B;  2FSN A;  3MAQ A;  1JL1 A;  1QSY A;  4IG3 A;  1CXU A;  3EE9 A;  3PO4 A;  5AQI A;  5KQD A;  4FJG A;  1OH5 A;  2KLA A;  2ZM6 K;  3DXM A;  3QNN A;  4DMN A;  1RTH A;  4HTU A;  1NK4 A;  3LPU A;  4PL8 A;  1YVU A;  3M8R A;  4DU4 A;  5FDL A;  3CC7 N;  4CER A;  4KHS A;  3MMV A;  4EZ6 A;  1J5O A;  4C8L A;  3RVC A;  3E01 A;  1HX1 A;  2NZT A;  5EX5 A;  4KHQ A;  1VSH A;  4LSL A;  3CCU N;  4R79 A;  4IFY A;  4FJI A;  2HW3 A;  4B8C A;  2ASM A;  3UKR B;  1U48 A;  4Z4G A;  3DOK A;  3EZW A;  4DTX A;  3AY9 A;  1HYS A;  2WTU A;  3O3G A;  4JD2 B;  4BRL A;  2UXD K;  4FM0 A;  1G15 A;  3TTF A;  3OYE A;  4CBX A;  4DFJ A;  1VQM N;  4A2B A;  4X64 K;  1NNE A;  4DFM A;  2HHX A;  3AVA A;  3VGM A;  1TKD A;  3OYH A;  4IDK A;  1S9E A;  3TSU A;  3AAR A;  3BZK A;  4DQ8 A;  2QXL A;  1KXP A;  4ZHR A;  1CZA N;  3WEE B;  4FM2 A;  2GTD A;  3VEY A;  3GDQ A;  2IS3 A;  3C7N A;  4WFA L;  4ELV A;  3OYM A;  4DLG A;  4WQ5 A;  4R5P A;  3VQB A;  3ZLJ A;  1WSJ A;  4CHZ A;  2QA4 N;  5KRS A;  4OPJ A;  3NDK A;  1VSL A;  4JK7 A;  3SMS A;  3AAQ A;  3CCQ N;  1T05 A;  3O1B A;  3E1Y A;  3LAK A;  3WNF A;  2E2Q A;  3K5O A;  5AQM A;  2PYL A;  4JN4 A;  4RWT A;  3NE6 A;  3AO5 A;  1U47 A;  1T8E A;  3PSI A;  1YHQ N;  2FBY A;  2F9T A;  2XY7 A;  3AA3 A;  5LL6 Z;  4FWO A;  4DR5 K;  4MO4 A;  4H0T B;  4Q0B A;  3WNG A;  4AH9 A;  3SLC A;  3J80 O;  4N47 A;  4DTS A;  4M3Z A;  3SJH A;  3ZCM A;  1X9J A;  1NJW A;  3ZET A;  2HVH A;  4JYA K;  1BIU A;  3QEW A;  4CJ3 A;  3K5N A;  3C0B A;  4CHO A;  4DF8 A;  1Y97 A;  3VER A;  4Z4I A;  1S1W A;  3SJJ A;  1GOA A;  3DJC A;  3HVT A;  4GW6 A;  4BRQ A;  4MDB A;  1U6Z A;  4HCC A;  4EIA A;  1WN7 A;  3PV8 A;  2GX9 A;  1K8K B;  5C15 A;  3CCJ N;  1HNI A;  2IIR A;  5IWA K;  1VQ6 N;  1HNW K;  4IBN A;  2ZQB A;  1MA9 B;  3EL2 A;  1KVC A;  4N76 A;  3TI0 A;  4IFE A;  3G10 A;  3NGZ A;  1Q9X A;  4XH1 A;  3KK1 A;  1NOY A;  2XRI A;  3CM5 A;  2QKB A;  3QDK A;  5J2P A;  4V19 S;  3H6E A;  3M6G A;  4DV0 K;  4BE1 A;  4OO1 J;  5AQY A;  3SQ4 A;  3L2W A;  4DR2 K;  3K57 A;  1HYZ A;  1TKX A;  5ADX H;  4FK4 A;  3A2F A;  4PKG A;  3LAN A;  1BA1 A;  3CME N;  2OZM A;  2Z1J A;  3KLG A;  4M3T A;  4CVN E;  1XHX A;  1VSI A;  2HBM A;  4I9L A;  4HCB A;  2FF3 B;  1XNR K;  2O8C B;  3D2E A;  5AQW A;  3V81 A;  4C1N I;  4B3S K;  3NHG A;  1KFD A;  3OYA A;  1HNZ K;  3KLE A;  4BQZ A;  5BR8 K;  4BGA A;  3QES A;  4U7B A;  4M42 A;  4ILH A;  4M3W A;  3ID6 A;  1KSP A;  4FM1 A;  1CZB A;  4QAG A;  2VQF K;  1ZBL A;  4F2S A;  3VQE A;  4B1U B;  4CD1 A;  4B1Z A;  4DSF A;  5TKY A;  3IS9 A;  3VQ6 A;  1LW0 A;  1A5V A;  3P38 A;  2XY6 A;  4FLU A;  1OVQ A;  3AA4 A;  4CEA A;  2Q36 A;  4CD3 A;  3GBT A;  5HRS A;  4B3O A;  4DSL A;  3VEX A;  4AIL C;  4KB1 A;  1M90 O;  1NWK A;  3SNN A;  1IO2 A;  4CJU A;  2ITM A;  5KTQ A;  4GY2 B;  2YCH A;  2E6L A;  4FJN A;  1ATN A;  3D0P A;  2E5L K;  1N8R O;  5C0Y A;  5EOY A;  4JKA A;  3AVK A;  4C1N K;  1VSF A;  5JLF A;  1NGA A;  4JKG A;  1Q7Y O;  3OYF A;  3ZT0 A;  4BC3 A;  3K58 A;  1ZYQ A;  3V6D A;  1U45 A;  3CCL N;  4CGD A;  1W0H A;  4H0Y B;  4H5N A;  4CI6 A;  1S3X A;  1L3T A;  4DHY A;  2KZM A;  4DTU A;  1IV0 A;  4CE9 A;  3KK3 A;  4FLW A;  3I55 N;  4I9Q A;  1V4T A;  5JIC A;  3PX4 A;  1KAZ A;  3W0L A;  5HBM A;  1RGI A;  4EAH D;  1W7A A;  5GAH P;  1EWR A;  3HL8 A;  4XH4 A;  5F1X A;  1SKS A;  3AVB A;  1ASV A;  1FKO A;  3VGL A;  4FOI A;  3QFP A;  4PHT X;  3N4P A;  3ZT3 A;  1N6Q A;  1NLV A;  1HKC A;  4PA1 A;  4FXD A;  3IMX A;  2P5G A;  4NLC A;  2F9W A;  3IAY A;  4X65 K;  4JNE A;  4BE2 A;  2EX3 A;  4N56 A;  2J4R A;  3K9J A;  3CET A;  5AQT A;  1Q86 O;  1YIT N;  1KVB A;  4NCG A;  1WOQ A;  3ULE A;  4DSK A;  4ZTF A;  4IOC L;  4FWK A;  3THW B;  1YJ9 N;  4LFC K;  4FK0 A;  1QZ6 A;  1SKR A;  2P9U A;  5JS2 A;  3VQC A;  4RW7 A;  5AZI B;  2X74 A;  4GKK K;  3T19 A;  5EVZ A;  4M3Y A;  1T03 A;  3NMU A;  2YKM A;  4CES A;  1WSG A;  1U2V A;  3TAG A;  3LM9 A;  1K73 O;  3TAE A;  1S5J A;  4KH6 A;  2DY4 A;  3D2F A;  1DT9 A;  2P1J A;  1GLE G;  3CCE N;  1EQY A;  1GLJ O;  2IDO A;  4GVM A;  3H3N O;  2ATQ A;  3AVG A;  3AVI A;  5KPT A;  2O4G A;  3NF7 A;  4B9Q A;  3RRG A;  2FC0 A;  4O0J A;  3CJC A;  3KIO A;  3HT3 A;  3MED A;  4DUZ K;  1J5E K;  2E20 A;  4AQY K;  4DV7 K;  5JVH L;  1QQN A;  5BPM A;  4IO8 A;  5FPN A;  3QBX A;  4KV8 A;  3DI6 A;  5AQP A;  4L3Q A;  1IG8 A;  3JS6 A;  3AVM A;  2YHA A;  2NRW A;  2HF3 A;  3NH2 A;  3CF5 L;  1YJW N;  3EYZ A;  3RMA A;  1JLA A;  3ZSR A;  3MN6 A;  3LWM A;  1TK8 A;  3AAP A;  1ZC6 A;  5SZT A;  4B9V A;  1RT3 A;  3AA2 A;  2ZF5 O;  1NGH A;  4IXC A;  1KRP A;  3SMP A;  4CFD A;  4O5B A;  3TU5 A;  4BRH A;  3DXM B;  5CZ2 A;  4DF4 A;  1FJG K;  5FLX O;  4JKC A;  4LH4 A;  3OYC A;  4K42 A;  3T1Y K;  2UUA K;  4CHQ A;  2OPP A;  3HOS A;  2RKI A;  5FPM A;  3WQT A;  3VET A;  4CGI A;  2FBT A;  1HJO A;  3H08 A;  3NH1 A;  4F3T A;  4CGF A;  5GIO A;  1RBV A;  3B6P A;  2QWM A;  2E6M A;  2IVP A;  1YF5 L;  4BRI A;  1JLB A;  1TKZ A;  1S6P A;  1RTJ A;  3RMB A;  4B9T A;  3HOT A;  4UQG A;  3QML A;  1SV5 A;  3DRP A;  1YIJ N;  3HPH A;  3HVR A;  5JLH A;  3ZX0 A;  2HNZ A;  2W42 A;  1TAQ A;  2O8E A;  1ILY A;  4FCY A;  4CJE A;  3VEZ A;  2W6K A;  3V9S A;  1NK7 A;  3VA0 A;  4FJ9 A;  3S3N A;  4DTM A;  4B3R K;  1NGF A;  1M1K O;  5TKW A;  4JKD A;  3RR7 A;  4CJ5 A;  1VQK N;  3KVG A;  2GUP A;  2OTJ N;  2Q0U A;  2XO7 A;  4JAX A;  1I94 K;  4CJ4 A;  2QWO A;  3V1R A;  3C7N B;  3AVH A;  3TAB A;  3FZH A;  4HWI A;  1X3M A;  3O80 A;  5KQ8 A;  4CHY A;  2AJQ A;  1TV6 A;  4CIG A;  4LSN A;  1YI2 N;  1NBW A;  3OY9 A;  2RE2 A;  4Z4F A;  1S6Q A;  3H1Q A;  4DLE A;  1RT7 A;  1D4X A;  4M7X A;  5KI6 A;  3VQ5 A;  5CYQ A;  3KLF A;  1BIZ A;  1WAF A;  4BRP A;  2NRR A;  3U9D A;  3F2K A;  4BWJ A;  1SUQ A;  3WXM B;  3I56 N;  4ELT A;  4K8Z A;  2A42 A;  3ENB A;  2UXB K;  1RDU A;  1VQ8 N;  3SUP A;  2G8H A;  4FJM A;  4FWR A;  4DTJ A;  1T6C A;  3GG4 A;  5BPN A;  4K41 A;  5H1S Q;  4H0P A;  3BF3 A;  1QVG M;  3QIN A;  3V4I A;  3CFP A;  3KJV A;  4JV5 K;  3QIO A;  2CH6 A;  1DLO A;  3O08 A;  5AQF A;  4N5S A;  1HPM A;  3QLH A;  2YI1 A;  4C8M A;  4CF0 A;  3NCI A;  3SBT A;  3VF2 A;  3RSE A;  1XI1 A;  3OVN A;  4FO0 A;  2Y1J A;  1XWL A;  3M8P A;  5HP1 A;  3QB0 A;  4ID1 A;  3SYZ A;  3R3L A;  2I5J A;  2PBD A;  4J2B A;  5K14 A;  3L8B A;  1E4G T;  1VQ4 N;  4Z4C A;  4KHW A;  2HBJ A;  1RT6 A;  1J54 A;  4Z94 A;  3KK7 A;  4K0K K;  4WYB A;  3K0S A;  2G8U A;  2KW4 A;  3RTV A;  3KTQ A;  1KVA A;  4I2P A;  4CF9 A;  3WXJ A;  2B5J A;  3HXM A;  1VSM A;  4JI0 K;  5T7B A;  3LDP A;  4FWN A;  1BCM A;  1VHX A;  2D0B A;  2P9S A;  2CH5 A;  3LDL A;  3DLR A;  4FPA A;  3QET A;  1XMQ K;  3WUH A;  4FLV A;  3D2E B;  3WXL A;  3BF1 A;  4BRD A;  2JWL A;  3VEW A;  4O4G A;  4IG0 A;  3NF9 A;  1J9A A;  4BG8 A;  1JL2 A;  3U3G A;  2ASO A;  1SL0 A;  3TAR A;  1GOB A;  3OBY A;  3JSM A;  4DSJ A;  2YJF A;  1YTA A;  4FJK A;  3BEX A;  3NBP A;  2YNF A;  2HST A;  3GE1 A;  3EKU A;  1C0U A;  3CPE A;  4LFB K;  3O9U A;  3J7Y P;  4FWP A;  3E9P A;  4CHN A;  2I7P A;  4E1N A;  3VPZ A;  3OS0 A;  4BDZ A;  4MLH A;  3SAF A;  2P9N B;  4FJ8 A;  4CF8 A;  1RBR A;  5M1F A;  4O0I A;  4JKE A;  1EET A;  4NYN A;  3TAF A;  1WSF A;  3E66 A;  4J8F A;  4JRQ A;  4E7H A;  2O4I A;  4IJN A;  4H0X B;  3CFR A;  3O8M A;  5BN9 A;  4BC2 A;  3KZB A;  2Q1N A;  4FWQ A;  2DTU A;  3NH0 A;  1N5Y A;  4O55 A;  3BGR A;  3EEQ A;  3I8B A;  4BC5 A;  4GKJ K;  3M5R A;  4JKG B;  1JXB A;  3P4I A;  4N41 A;  4DS5 A;  3V9U A;  4BE0 A;  1B9D A;  3ATV A;  1NGE A;  4PWD A;  3OS2 A;  1X9W A;  4A59 A;  1Z05 A;  2VWB A;  3PLA A;  3B6O A;  4H0V B;  3VN5 A;  3V9W A;  4BRF A;  4KH5 A;  3E9L A;  3CXC M;  4DV6 K;  3CFO A;  4BRE A;  1KTQ A;  4LH5 A;  4LF8 K;  1ASU A;  2ZWH A;  3FZF A;  3TAN A;  3IDH A;  4H03 B;  2IC3 A;  1VSE A;  1G99 A;  2PZS A;  4KPY A;  3ID8 A;  4KHY A;  2Z1H A;  4JI5 K;  4OKK A;  4M3X A;  4F3O A;  3C6T A;  1RT5 A;  2E2P A;  4B9M A;  3CPW M;  3LL3 A;  1E4F T;  2ZE2 A;  4KFB A;  3UKU B;  4CZF A;  3IG1 A;  2B6A A;  4CJF A;  3LM2 A;  2F8S A;  1ATR A;  4JI7 K;  4RW4 A;  4BR4 A;  5M1P A;  1VQP N;  4LFA K;  4CJT A;  3ULE B;  5BR9 A;  3IKM A;  3HSC A;  1WLJ A;  2VG5 A;  1RT2 A;  3T3F A;  4BRN A;  3KWG A;  4M41 A;  3OYI A;  2WC9 A;  2P9U B;  2IVN A;  1QQM A;  2WON A;  5C10 A;  2KZZ A;  1RT4 A;  3O3H A;  3KLH A;  3SPY A;  1O13 A;  4JRP A;  4BR7 A;  1U2V B;  1TK5 A;  3EE8 A;  3D2F B;  4DU3 A;  4CZM A;  1CLQ A;  3LDO A;  2HHH K;  1TUU A;  3MXM A;  3HI0 A;  4CIF A;  1NKE A;  3A5O C;  4KTZ A;  1YJN N;  4YDU C;  3WXK A;  3EN9 A;  3SCX A;  3CER A;  1LWF A;  5HLF A;  4GVE A;  4WQ4 C;  4KHU A;  5ADX A;  4CCH A;  3MK6 A;  4KHP K;  4I6M A;  3P83 D;  2A40 A;  2VYP A;  5AQS A;  4H5V A;  3L2U A;  5AQZ A;  4DKW A;  4E89 A;  4ISG A;  3KKR A;  4DTO A;  4JI3 K;  2VQE K;  3M8Q A;  1OH8 A;  4KHN A;  4IO9 L;  2HB5 A;  4HHT A;  4BC4 A;  2KFZ A;  3LPT A;  4BG9 A;  1DTQ A;  3OHR A;  3A5M C;  1I39 A;  1UA1 A;  3CCS N;  4CK1 A;  5BRF A;  4FJ7 A;  4DR4 K;  1LOT B;  1C1B A;  3CQY A;  4WE1 A;  1TL1 A;  2OCE A;  4FPB A;  2PY5 A;  4AHS A;  1ESV A;  4CJR A;  1I3A A;  1LCU A;  3MXJ A;  1IBM K;  1VRT A;  4JI2 K;  4Y1C A;  3V1Q A;  4AHR A;  4CZL A;  2HF4 A;  3SUO A; 
#chains in the Genus database with same CATH homology
 1BCO A;  1IKW A;  4CES A;  4CEO A;  1WSG A;  2NUB A;  3TAG A;  1U4B A;  3K5M A;  3TAE A;  1S5J A;  2DY4 A;  1HMV A;  3DLH A;  2HHV A;  2P1J A;  3ZSO A;  3THV A;  3HYF A;  4YFU A;  3DLB A;  2HHU A;  5J2M A;  1X9S A;  3HK2 A;  2VWK A;  4DU1 A;  3DLE A;  3RWU A;  1WSI A;  1QSS A;  2D0C A;  2IDO A;  1TL3 A;  4GVM A;  1EKE A;  1ZBF A;  1RBS A;  4F8R A;  1BQM A;  3K59 A;  2D0A A;  2ATQ A;  3QEI A;  1EXQ A;  3AVG A;  3AVI A;  3PO5 A;  3KK2 A;  4PY5 A;  2HHQ A;  3VQ4 A;  3OYG A;  4TSX A;  1WSH A;  1WAJ A;  3ASM A;  2O4G A;  5HRO A;  4FJL A;  3NF7 A;  1JKH A;  3RRG A;  2FC0 A;  4O0J A;  4CJS A;  3KIO A;  4CJK A;  3HT3 A;  2R7Y A;  1CXQ A;  3RR8 A;  3MED A;  2P51 A;  3SQ0 A;  3O4Q A;  1TKT A;  3PX6 A;  3ZSQ A;  4W5Q A;  4Z4E A;  5J1E A;  3ULD A;  4B9L A;  5CY4 A;  1BGX T;  2KQ2 A;  2BAN A;  3AVL A;  4DFK A;  4H4M A;  2P5O A;  1C6V A;  2F96 A;  2BE2 A;  1NJX A;  2HHW A;  4KV8 A;  3DI6 A;  1ZBU A;  4GMJ B;  1HRH A;  3QO9 A;  4RW6 A;  3LAM A;  3EZ5 A;  3AVM A;  2YHA A;  4FYD A;  4OLB A;  2GBZ A;  3NH2 A;  1QS4 A;  2OPQ A;  4EZ9 A;  4DTP A;  3AVN A;  5HRR A;  3DRR A;  4BDP A;  3QER A;  3EYZ A;  3RMA A;  1JLA A;  5C42 A;  3ZSR A;  2YNG A;  4HUF A;  1QHT A;  1FXX A;  3LWM A;  1TK8 A;  1NJY A;  3PY8 A;  4KRE A;  4CHP A;  5SZT A;  1HJR A;  3VQD A;  2RF2 A;  4B9V A;  1RT3 A;  3AA2 A;  1TVR A;  1ASW A;  5D3G A;  1LAW A;  3VQ9 A;  2WOM A;  1Q9Y A;  2JGU A;  1KRP A;  4FJH A;  4CFD A;  4O5B A;  2Y1I A;  1RIL A;  5CZ2 A;  3LP3 A;  4DF4 A;  3QEP A;  4I7F A;  1Z26 A;  4AHC A;  2A1S A;  1IG9 A;  3ZSW A;  3ALY A;  4LH4 A;  4PQU A;  4HUE A;  3OYC A;  4KTQ A;  2VG6 A;  1NKC A;  4CHQ A;  4CJP A;  2OPP A;  2RKI A;  1BL3 A;  4C8N A;  1NK8 A;  4CF2 A;  4B9S A;  1KLM A;  1RNH A;  3VQA A;  4CGI A;  2QKK A;  3ZT1 A;  2FBT A;  3L2V A;  3SV3 A;  3SUN A;  3H08 A;  3NH1 A;  1VRU A;  4F3T A;  4CGF A;  1RBV A;  3B6P A;  3V1O A;  4DG1 A;  1C0T A;  2G8I A;  2E6M A;  3MEE A;  1D9D A;  3MEC A;  3AO2 A;  1K6Y A;  3SQ1 A;  1C1C A;  1JLB A;  1YTU A;  1TKZ A;  1NOZ A;  3C6U A;  1S6P A;  1RTJ A;  4XIU A;  3RMB A;  4B9T A;  4ELU A;  4Z0U A;  4M3R A;  4UQG A;  1SV5 A;  1IKX A;  4FJX A;  3DRP A;  3UIQ A;  3F73 A;  3HPH A;  3HVR A;  2HVI A;  3OYJ A;  3LWL A;  1XC9 A;  4KI4 A;  1LWE A;  2DFF A;  3QNO A;  4DWI A;  1S9G A;  1EP4 A;  1WSE A;  2HNZ A;  1TAQ A;  2LSN A;  1W9H A;  4KTW A;  3O3F A;  2W42 A;  4FCY A;  4CJE A;  1RDB A;  3V9S A;  1NK7 A;  1KFS A;  3VA0 A;  3V9X A;  1RDD A;  4OPK A;  4FJ9 A;  3S3N A;  5EU7 A;  3TWH A;  1BI4 B;  4DTR A;  2RN2 A;  3FFI A;  4DTM A;  3QEX A;  2X78 A;  1D8Y A;  2KTQ A;  1S1V A;  1UA0 A;  4FLZ A;  1KLN A;  4W5N A;  3RR7 A;  4CJ5 A;  1HYV A;  3LDS A;  1NK9 A;  4E7K A;  4HUG A;  4C8K A;  4ID5 A;  2IOC A;  4M45 A;  4CGJ A;  1LWC A;  4G1Q A;  2XO7 A;  1SKW A;  4B8A B;  1KCF A;  3C94 A;  1SL2 A;  4CJ4 A;  1CZ9 A;  1WNS A;  3V1R A;  4NYF A;  3AVH A;  3MAQ A;  1JL1 A;  3TAB A;  5I3U A;  1QSY A;  3VQQ A;  3L2R A;  4IG3 A;  3DM2 A;  1CXU A;  3OYK A;  3OJU A;  3ZSZ A;  1NK0 A;  1JLE A;  1QSL A;  5E41 A;  4CHY A;  3PO4 A;  3K2P A;  1NK5 A;  4FJG A;  4FZZ A;  1DTT A;  2AJQ A;  1FKP A;  1TV6 A;  1L3V A;  4Q5V A;  4FVM A;  4CIG A;  4LSN A;  2FBV A;  1L3S A;  3QNN A;  4DMN A;  1RTD A;  3OY9 A;  1RTI A;  3D45 A;  3OYB A;  4Z4F A;  1S6Q A;  1RTH A;  4HTU A;  1NK4 A;  3LPU A;  1RT7 A;  4DLE A;  4AHU A;  4MQ3 A;  2HHX A;  5DMR A;  1ITG A;  4CK3 A;  1YVU A;  3M8R A;  5KI6 A;  5FDL A;  4DU4 A;  3VQ5 A;  4CER A;  4KHS A;  5CYQ A;  3KLF A;  3NGI A;  4EZ6 A;  1J5O A;  4C8L A;  4IKF A;  1D5A A;  1BIZ A;  3E01 A;  1C0M A;  1WAF A;  2IAJ A;  3HPG A;  1D9F A;  4KHQ A;  4W5R A;  1VSH A;  4LSL A;  3QIP A;  4IFY A;  4FW1 A;  4CEE A;  1RBU A;  4FJI A;  1L3U A;  2HW3 A;  4BWJ A;  4B8C A;  1U48 A;  4Z4G A;  1SUQ A;  1F21 A;  1S1T A;  3DOK A;  3TAM A;  3K5L A;  2OZS A;  4ELT A;  4K8Z A;  3C95 A;  4DTX A;  5KGX A;  3LZI A;  4CEC A;  4JS5 A;  1HYS A;  1QE1 A;  2OPR A;  3AO3 A;  3L3V A;  3SUP A;  3O3G A;  2G8H A;  4FJM A;  4FM0 A;  1G15 A;  1O1W A;  3ISN C;  3OYE A;  4DTJ A;  4DFJ A;  4E3S A;  1TK0 A;  4OKE A;  1UOC A;  1QQC A;  1BI4 A;  3AVF A;  3G0Z A;  3NFA A;  4DFM A;  1REV A;  3AVA A;  2A1R A;  5HRP A;  1TKD A;  2G8F A;  3OYH A;  4IDK A;  1S9E A;  3QIN A;  3HP9 A;  5KRT A;  3NAE A;  3V4I A;  3CFP A;  3KJV A;  3QIO A;  1DLO A;  4ZHR A;  4DQS A;  4CEZ A;  4HVJ A;  4FM2 A;  4N5S A;  4KKO A;  4LD0 A;  3SUQ A;  2VG7 A;  1VSK A;  1X9M A;  3JYT A;  3QLH A;  3AVJ A;  3TR8 A;  3CQ8 A;  4KHY A;  4C8M A;  2IS3 A;  2OA8 A;  2YNI A;  4CF0 A;  3NCI A;  4ELV A;  3OYM A;  4DLG A;  4DSE A;  1RT1 A;  2EHG A;  3OVN A;  4R5P A;  1XI1 A;  4H4O A;  3VQB A;  2Y1J A;  1WSJ A;  1XWL A;  4CHZ A;  4FLT A;  3M8P A;  5KRS A;  4OPJ A;  1B92 A;  3NDK A;  1VSL A;  5HP1 A;  4ID1 A;  3KD5 E;  3SYZ A;  2D5R A;  1A5X A;  4L8R B;  4DQQ A;  1T05 A;  2I5J A;  2PYJ A;  4J2B A;  5K14 A;  1JXE A;  3CM6 A;  2X6N A;  3LAK A;  5C24 A;  3WNF A;  4Z4C A;  3L8B A;  3QEV A;  4KHW A;  3K5O A;  1RT6 A;  2HNY A;  3HST B;  1J54 A;  3NF6 A;  2JLE A;  4KO0 A;  2PYL A;  1HQE A;  3P5J A;  4QCL A;  4EP5 A;  4B9N A;  2G8U A;  3NE6 A;  3AO5 A;  2HND A;  2KW4 A;  2XHB A;  1U47 A;  4E19 A;  1T8E A;  3RTV A;  3KTQ A;  1KVA A;  4I2P A;  4CF9 A;  3I8D A;  3L2Q A;  4DSI A;  2Z1G A;  2FBY A;  2B5J A;  4H8K A;  4JS4 A;  3HXM A;  1VSM A;  3BDP A;  1VSD A;  5T7B A;  2G8V A;  2XY7 A;  1BCM A;  3AA3 A;  2D0B A;  2E4L A;  4CGG A;  4YNQ A;  4BDY A;  5HRN A;  3U3Y A;  4Q0B A;  3WNG A;  4AH9 A;  4FZX C;  3DLR A;  1S1U A;  4W5O A;  3QET A;  4N47 A;  1X1P A;  4KI6 A;  2ZD1 A;  4DTS A;  4FLV A;  1YT3 A;  4M3Z A;  3TAP A;  3ZCM A;  4O4G A;  1NJW A;  1ZBH A;  1BHL A;  2HVH A;  1JLF A;  3ITH A;  3T1A A;  1BIU A;  4IG0 A;  3QEW A;  4AHT A;  1T7P A;  2Q3S A;  1UWB A;  1J9A A;  1Z25 A;  2YV0 X;  3NF9 A;  4ICL A;  1JLC A;  4CJ3 A;  4CHO A;  3K5N A;  4FLY A;  4DF8 A;  2KFN A;  4FJ5 A;  1JL2 A;  3U3G A;  1Y97 A;  1SL0 A;  3TAR A;  4Z4I A;  1S1W A;  1GOB A;  3SJJ A;  1GOA A;  3DYA A;  3HVT A;  4GW6 A;  4OVL A;  3JSM A;  4CEB A;  4HCC A;  1U04 A;  4DSJ A;  4CGH A;  4J2E A;  4NCA A;  2OYQ A;  1YTA A;  1WN7 A;  3AA5 X;  3PV8 A;  4FJK A;  3NBP A;  2YNF A;  1HNI A;  1C0U A;  2G8W A;  4FW2 A;  4IBN A;  2ZQB A;  3SZ2 A;  4DTN A;  4CHN A;  2F8T A;  1RDA A;  1KVC A;  4E1N A;  3OS0 A;  1BIS A;  3SPZ A;  4N76 A;  5SWM A;  4BDZ A;  3LAL A;  3TI0 A;  1MU2 A;  4QOZ B;  4FK2 A;  4Y1D A;  4DQP A;  3G10 A;  4CF8 A;  3NGZ A;  1RBR A;  4O0I A;  4FJ8 A;  4RG8 A;  1EET A;  4NYN A;  4FZY A;  1Q9X A;  3I0R A;  3KLI A;  3L3U A;  4CJL A;  2IGI A;  3KK1 A;  3TAF A;  2XRI A;  1RDC A;  3CM5 A;  1WSF A;  1NOY A;  4JRQ A;  4E7H A;  5J2P A;  4F4K A;  4KAZ A;  2QKB A;  3HO1 A;  4CK2 A;  3F9K A;  4KRF A;  2O4I A;  3V9Z A;  5KGW A;  4BE1 A;  5CZ1 A;  3CFR A;  2QXF A;  3SQ4 A;  2FBX A;  3L2W A;  1JLQ A;  3K57 A;  3DOL A;  1RBT A;  2DTU A;  1HYZ A;  3NH0 A;  3OYD A;  1N5Y A;  4O55 A;  2HHT A;  1TKX A;  3DLK A;  3VQP A;  4CJQ A;  4FK4 A;  3BGR A;  3A2F A;  3RMD A;  2GV9 A;  2XY8 A;  3OS1 A;  1A5W A;  3LAN A;  2DFE A;  1HPZ A;  2ETJ A;  3HPO A;  2OZM A;  3O4N A;  1TGO A;  2Z1J A;  3KLG A;  4Z4H A;  2BDP A;  4M3T A;  5FRM A;  5I42 A;  4IFV A;  4K8X A;  1JXB A;  3AO1 A;  3LZJ A;  1XHX A;  3ZSV A;  1VSI A;  2B4J A;  4DS4 A;  4I9L A;  3S3O A;  4HCB A;  3VQ8 A;  3V9U A;  4BE0 A;  4DS5 A;  3V81 A;  3KD1 E;  5FRN A;  4CIE A;  1B9D A;  3NHG A;  1KFD A;  4EP4 A;  3OYA A;  1ZBI A;  1IKV A;  4PWD A;  3OS2 A;  3KLE A;  1X9W A;  2HHS A;  3VA3 A;  3B6O A;  3VN5 A;  4CFB A;  1R0A A;  4PUO A;  3V9W A;  3EY1 A;  3QES A;  4E7I A;  4M42 A;  3LP0 A;  3ZT4 A;  4M3W A;  5J2N A;  3CFO A;  1GOC A;  4FM1 A;  1L5U A;  1CZB A;  4CFC A;  1KSP A;  3HJF A;  1KTQ A;  4LH5 A;  4QAG A;  2OPS A;  1ASU A;  1UAX A;  1ZBL A;  4F2S A;  3TAN A;  3VQE A;  2GUI A;  1J53 A;  4DQI A;  4DSF A;  4BWM A;  2IC3 A;  1LAV A;  3IS9 A;  1VSE A;  4O44 A;  3VQ6 A;  4B08 A;  3MEG A;  1B9F A;  2PZS A;  4J2A A;  4KPY A;  1LW0 A;  1A5V A;  1VSJ A;  2Z1H A;  4OKK A;  4FLU A;  2XY6 A;  3C6T A;  1RT5 A;  4F3O A;  1Q8I A;  3OYL A;  3AA4 A;  4CEA A;  4CJV A;  4B9M A;  4DQR A;  3CYM A;  3LP1 A;  5HRS A;  4B3O A;  1LW2 A;  4DSL A;  2ZE2 A;  2YHB A;  1QTM A;  4AIL C;  4JLH A;  4KFB A;  3VQ7 A;  3U6F A;  4N41 A;  4KB1 A;  4E7L A;  4OLA A;  3IG1 A;  2B6A A;  3RMC A;  4CJF A;  2F8S A;  3SNN A;  4CF1 A;  1NK6 A;  5CYM A;  1HQU A;  4RW4 A;  1IO2 A;  4BAC A;  3KKS A;  3NGY A;  4CJU A;  4CJT A;  3CG7 A;  3AO4 A;  5KTQ A;  4M3U A;  4NCB A;  1NKB A;  1FK9 A;  3AV9 A;  2E6L A;  4RW9 A;  1WLJ A;  3IRX A;  4LY7 A;  4KB0 A;  2VG5 A;  1RCH A;  3D0P A;  4FJN A;  1RT2 A;  3T3F A;  2BGG A;  4M41 A;  3AVC A;  3OYI A;  3LP2 A;  4M3X A;  3ZT2 A;  1BQN A;  3AVK A;  4I2Q A;  1JLG A;  1VSF A;  2WON A;  2KZZ A;  2ITG A;  1RT4 A;  3OYF A;  4W5T A;  3S3M A;  4ZTJ A;  3ZT0 A;  3K58 A;  3DLG A;  3O3H A;  3KLH A;  3ZSY A;  4CED A;  1HNV A;  3V6D A;  3SPY A;  1ZYQ A;  3WNH A;  5J2Q A;  5JS1 A;  4RW8 A;  1XHZ A;  1U45 A;  4JRP A;  3SV4 A;  1TK5 A;  3SQ2 A;  4CGD A;  1W0H A;  4E0D A;  4FLX A;  4DU3 A;  1CLQ A;  4OGE A;  1IKY A;  3MXM A;  4CEF A;  1L3T A;  3WNE A;  3SI6 A;  4E1M A;  2QK9 A;  4DTU A;  4CIF A;  3RRH A;  2KZM A;  4CE9 A;  3KK3 A;  1NKE A;  2YNH A;  4FLW A;  4C8O A;  4I9Q A;  4KTZ A;  2Z1I A;  3PUF A;  3I0S A;  3M8S A;  3PX4 A;  5HBM A;  4E7J A;  3SCX A;  1LWF A;  1NJZ A;  3P1G A;  5HLF A;  2G8K A;  5DK5 A;  4KHU A;  3HL8 A;  4OGC A;  4CCH A;  5C25 A;  3PX0 A;  4CEQ A;  3DMJ A;  3P83 D;  5FRO A;  1SKS A;  3OJS A;  4F2R A;  3AVB A;  1ASV A;  1FKO A;  4CJW A;  2YKN A;  4FJJ A;  3L2U A;  4J2D A;  3ZT3 A;  1N6Q A;  4AHV A;  3ZSX A;  4E89 A;  4PA1 A;  4FXD A;  2P5G A;  1IH7 A;  3KKR A;  4DTO A;  3IAY A;  3M8Q A;  2DFH A;  3HP6 A;  1SL1 A;  4KHN A;  2VWJ A;  4OJR A;  4BE2 A;  2HB5 A;  4B9U A;  2EX3 A;  4N56 A;  4HHT A;  2KFZ A;  2RPI A;  3TAQ A;  3LPT A;  1TAU A;  1DTQ A;  1KVB A;  4MFB A;  2X6S A;  1I39 A;  4NCG A;  4CFA A;  1UA1 A;  2XY5 A;  1LV5 A;  4DSK A;  2HMI A;  4CK1 A;  4ZTF A;  3DRS A;  4FJ7 A;  1EX4 A;  4OKJ A;  1C1A A;  1C1B A;  4FK0 A;  4WE1 A;  1TL1 A;  3HM9 A;  1SKR A;  3S9H A;  1VK0 A;  5JS2 A;  3VQC A;  3NF8 A;  4AHS A;  4CJR A;  4DFP A;  2PY5 A;  1I3A A;  3MXJ A;  4RW7 A;  1VRT A;  2X74 A;  4Y1C A;  3T19 A;  1S1X A;  3V1Q A;  3OYN A;  4AHR A;  1T03 A;  4M3Y A;  3MXI A;  1U49 A;  2YKM A;  3SUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...