3AA3A

A52l e. coli rnase hi
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMALIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease HI
publication title Protein core adaptability: crystal structures of the cavity-filling variants of Escherichia coli RNase HI
pubmed doi rcsb
source organism Escherichia coli
total genus 48
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aa3A00
3L2VA 4AHTA 3MXMA 1NKCA 2O4GA 4ELUA 4FJIA 1FXXA 3M8RA 1S1UA 4M42A 1B92A 4ZTFA 1LWEA 3F9KA 3T1AA 5JS2A 4CHOA 3THVA 4EZ6A 3EZ5A 4NCAA 3B6OA 3ZT4A 2HVIA 3TI0A 3LZJA 4KFBA 2P1JA 2YKMA 1RTIA 5CY4A 1SV5A 1RTHA 2E6LA 1VSKA 4B8CA 3FFIA 4NCGA 3QEPA 1R0AA 4FXDA 2HHVA 1BI4B 2ATQA 1RBVA 2XHBA 4B8AB 1VSIA 1C1CA 1VRUA 1QE1A 2OZMA 5KI6A 5SZTA 3AVGA 5I42A 1QSYA 2B5JA 3M8QA 3P1GA 5E41A 3RWUA 1C1BA 4E1NA 2VWKA 2PYJA 1TK0A 1CXUA 4CIEA 1RCHA 1KLMA 2E6MA 3OYIA 1Q9YA 3NGYA 2D0BA 2G8FA 3NH1A 3QLHA 3OS1A 3ZSXA 4KTQA 4DFMA 4KHUA 3AA4A 4FZYA 4E3SA 3VQAA 4AHSA 4KV8A 4CJLA 3JSMA 1RNHA 3CFPA 3D45A 3ZT1A 1WLJA 4F8RA 1JLEA 1YTAA 1B9DA 1VSHA 1KFSA 2KFNA 3LZIA 4NYNA 4CK3A 4DTMA 4FLWA 2ZD1A 4KREA 2HHWA 4CJUA 5KRTA 4UQGA 3DLKA 3AO2A 3WNGA 5FDLA 4R5PA 3KKRA 2ITGA 3BDPA 4FJXA 1TAQA 2X74A 3L2WA 4B9VA 2OPQA 4DSLA 1WSFA 3K57A 2Z1IA 5FRMA 4FW2A 1CZ9A 1ZBIA 2B4JA 2G8HA 2QKKA 4N76A 1I3AA 4J2AA 1S1WA 4IFVA 4F3OA 1J9AA 3QESA 4FLVA 1WSJA 3K58A 4OLBA 1JLAA 2X6NA 3TAEA 1TK8A 2IOCA 1KRPA 4FK0A 4KHSA 4RW4A 1O1WA 3IS9A 4OGCA 4DSKA 3ZCMA 4DTSA 2BGGA 1L3TA 3K5MA 4LSLA 3PV8A 4AHCA 2IC3A 1MU2A 3OYNA 4CF0A 4M3UA 4E89A 4OVLA 4KHQA 5HRNA 4J2DA 1RT2A 1WN7A 4KKOA 4C8NA 4J2EA 3KLIA 4CJEA 4CEBA 5I3UA 1SL2A 1EKEA 1KLNA 4OKEA 3PX0A 4E7HA 4H4OA 3O3FA 5DMRA 4B9SA 3VQQA 2YNHA 4FCYA 1RT6A 1D8YA 1BQMA 4HUEA 4IDKA 1EP4A 2YHBA 4CFCA 3V9WA 3S3MA 1DTTA 4CEZA 4DLGA 4E0DA 3NE6A 3IAYA 3AVFA 2Y1IA 1RBTA 1VSMA 4KPYA 4DTUA 3DMJA 4O4GA 3VQ7A 3DM2A 1TVRA 3QERA 4FJLA 3NF6A 4DFKA 3NDKA 3V1RA 1JLFA 4LSNA 1IKXA 4CK1A 5HLFA 1TGOA 3B6PA 4ZTJA 4CHQA 2YV0X 3OYEA 4CEEA 3KTQA 4ICLA 4N5SA 4J2BA 3NF7A 3CQ8A 4E7IA 3MXIA 4CIFA 3AVCA 3S3NA 1VSJA 4Y1DA 4Q5VA 3SUOA 1BHLA 4B9NA 1TL1A 3I0SA 4CHPA 4I9QA 3L8BA 4CGDA 4I2QA 3E01A 4B08A 4ID1A 3HP6A 3SI6A 1JXEA 1KVBA 2ZQBA 3OYFA 1L5UA 1NJYA 5HP1A 1F21A 2WONA 1HQUA 1NOZA 4CJQA 2G8KA 3C6UA 1SL1A 3SQ4A 2RF2A 1C1AA 4CGJA 1IKWA 1GOBA 4E1MA 3AVMA 2F8SA 1EXQA 3AVJA 3QO9A 4OLAA 1Z25A 3VQBA 3NAEA 2QKBA 4CGIA 4OJRA 2RPIA 4QOZB 1VSFA 3I0RA 3NF8A 3KLGA 1RT5A 2XY5A 1L3SA 1S1VA 4LH4A 4JLHA 3AVBA 2EHGA 2B6AA 1TKTA 5C24A 5T7BA 3LPTA 3OS2A 2XO7A 4RW6A 3VQ5A 4DTNA 3SPZA 1NK7A 1KTQA 1FK9A 5FROA 3V9XA 3LP1A 1X9SA 4CJKA 3VQ8A 1BCOA 3DI6A 1LWFA 1GOCA 3OY9A 3OYCA 3NH0A 3VQEA 3I8DA 4IBNA 2OA8A 2RKIA 3D0PA 4W5RA 4FLXA 2EX3A 3LP2A 3VQ6A 3QEIA 4BDPA 4HUGA 3KK1A 3O3GA 4BE1A 4YNQA 4F3TA 3DLHA 2HB5A 1QHTA 4CF8A 4CHZA 1IG9A 4EZ9A 3K2PA 3OYMA 1C0UA 4M3RA 4Z4CA 3PY8A 2HVHA 4LD0A 2XY6A 3LAMA 3HT3A 3AO4A 3VQDA 4Z4HA 1ASVA 1JXBA 2GBZA 3AVAA 3NCIA 4DF8A 1UAXA 2QXFA 1SKRA 1TAUA 1RTDA 1BL3A 3P5JA 3U6FA 5JS1A 4CIGA 3ZSOA 5CZ1A 4FM1A 3PUFA 1A5WA 2VG6A 3EY1A 3QETA 4HHTA 5C25A 1IKVA 2YNGA 3DRRA 3V1OA 3VQCA 1QTMA 2OYQA 2G8IA 4DQSA 4M3WA 4CFAA 4CFBA 3L2UA 4JS5A 2WOMA 4XIUA 3L2RA 4CHYA 3QNOA 1ITGA 4FJMA 4EP5A 4FJ8A 3VA3A 3V4IA 4O44A 2KTQA 1RT7A 1YVUA 4ID5A 3SNNA 2YNIA 4DQPA 1J5OA 4BE2A 1Q8IA 3DLGA 3O4NA 3TARA 4PWDA 3L2QA 4KHNA 3RR8A 4I9LA 4RW9A 3KK3A 1JLGA 4DMNA 3KD5E 2D0AA 3AO3A 4FJ7A 4Z4EA 4DSFA 3LWMA 2FBTA 4CERA 3OYAA 4FM0A 5J2NA 2XY7A 4QAGA 1QSLA 4HVJA 4CEAA 2NUBA 2G8VA 3AO5A 1LAVA 4DG1A 3OYLA 2D5RA 1ZBUA 3NF9A 4B9LA 4I7FA 3HL8A 4FJ9A 1LW2A 3RMDA 4DWIA 4FLUA 3AVLA 3PO4A 4M41A 4AHRA 4CGGA 4YFUA 3OYDA 2W42A 1T03A 1XHXA 1HPZA 1SL0A 4PY5A 2DY4A 2E4LA 5KGXA 2YHAA 3KLHA 5CYQA 4L8RB 4CHNA 3LWLA 4FVMA 1NK6A 2JGUA 1IO2A 1HYSA 3O3HA 2YKNA 1RDCA 3T3FA 4CCHA 3ZT2A 3OYKA 1LV5A 1T7PA 1RDBA 3V81A 1D9DA 1BIZA 1BGXT 1U04A 1ZYQA 2HHXA 3SPYA 1C6VA 1NJXA 1KCFA 3OVNA 1S6QA 1K6YA 5DK5A 4TSXA 3SV3A 3SJJA 1X9WA 5HROA 4MFBA 4O0IA 3TAMA 4W5NA 4HTUA 1BIUA 3ZSYA 4E7KA 3K59A 2IS3A 2X78A 1KVAA 1JKHA 3M8PA 3M8SA 4DLEA 3L3UA 1HYZA 4OPJA 2BDPA 1W9HA 3LALA 1S6PA 2X6SA 1TL3A 3SCXA 5D3GA 4B9UA 3RR7A 2RN2A 3RMAA 4FZZA 2HHSA 3K5OA 4Y1CA 1NK4A 1B9FA 4B9MA 4CF9A 2LSNA 3LP0A 1WSIA 3TAPA 2G8UA 3KD1E 3UIQA 4HUFA 1VSLA 3LDSA 4FK2A 3PO5A 4W5TA 4OKKA 4M3XA 4CECA 4CJVA 3RRGA 2KFZA 2PY5A 2A1RA 4MQ3A 2HHTA 2IDOA 1BQNA 2GUIA 4JRPA 4DQQA 4NCBA 2Y1JA 3QEXA 3PX4A 1BCMA 5CZ2A 4DSJA 3HJFA 3G10A 2DTUA 4FK4A 4DTPA 3MAQA 3KKSA 3HM9A 1J53A 3F73A 1ZBFA 5J2PA 3TANA 4CEFA 2HNDA 5HBMA 1NK9A 4ZHRA 4CEOA 3T19A 1IH7A 3NFAA 3SZ2A 1RBRA 1XI1A 4JS4A 1C0MA 1S5JA 3LAKA 3NGZA 3AVKA 4IFYA 4F2SA 3C6TA 2P5OA 4OKJA 3AVNA 4CGFA 3AA5X 4FZXC 3DOLA 3LP3A 5J2QA 3KIOA 1CZBA 2IAJA 5FRNA 2G8WA 4FW1A 2HNYA 5J1EA 2KQ2A 2FBXA 4RG8A 1LWCA 4FJKA 4AH9A 1EX4A 3QIOA 3K5NA 1QSSA 2OZSA 1KVCA 1NKEA 4ELVA 3HO1A 3WNFA 3IG1A 3L3VA 3MEGA 4KRFA 4QCLA 4LH5A 3HXMA 4N41A 1HMVA 1RBUA 4FLZA 4CK2A 3S9HA 4KAZA 4K8ZA 4I2PA 1BISA 1HQEA 3DRPA 3OYHA 3K5LA 5HRSA 3ZSRA 1SKSA 2Z1JA 2F96A 1EETA 1FKPA 1WNSA 2JLEA 4BACA 4CJFA 4DS5A 4AHVA 4CJSA 4CF1A 4CESA 3OJUA 3WNHA 1SKWA 4F4KA 4CFDA 3AO1A 4FJJA 4BWJA 1JL2A 3AVHA 1RBSA 3OYGA 1WAFA 2BANA 1RDAA 2DFFA 2DFEA 5HRPA 2KW4A 3ZSWA 3ASMA 3RRHA 1NK5A 1XHZA 5KTQA 4FYDA 2HHQA 3CFRA 1VSEA 3V9ZA 3AV9A 1Z26A 3HP9A 3RTVA 1IKYA 3QEWA 3DLBA 2QK9A 1YTUA 2Z1HA 4BDYA 4C8KA 1QS4A 3TWHA 2BE2A 3NH2A 4DS4A 3IRXA 1U49A 4KB1A 4AILC 1FKOA 1G15A 2I5JA 3DRSA 4CE9A 4FJGA 3O4QA 3MXJA 4Z4IA 1C0TA 1BI4A 4C8OA 1CXQA 4CEDA 3CG7A 4E7LA 1D5AA 1TV6A 4Z4FA 4O55A 4OGEA 2VG5A 3A2FA 2FC0A 3V9UA 4DU3A 4FJNA 1WSEA 3TAFA 4DTXA 2DFHA 1NJZA 4ELTA 1U45A 1Y97A 2Q3SA 3NHGA 3VA0A 1U47A 2HW3A 1L3VA 4AHUA 1WAJA 3OYBA 1N6QA 1XWLA 3HSTB 3TR8A 3ITHA 3HVRA 4PA1A 1REVA 1HNIA 2ZE2A 1S1TA 3MEEA 3ZSZA 4W5QA 3JYTA 4FJHA 4KI4A 2YNFA 2PYLA 4O0JA 4LY7A 5CYMA 4Z0UA 3KJVA 4FLYA 3HYFA 3VN5A 3OS0A 3EYZA 4CEQA 1JLQA 1I39A 3SQ0A 2ETJA 4KTWA 2O4IA 1NKBA 4E7JA 1YT3A 4FLTA 4DSIA 2KZMA 4RW7A 1NJWA 4GVMA 3H08A 3ZSVA 2Z1GA 3QEVA 1XC9A 1T8EA 4KTZA 3RMCA 2IGIA 4H8KA 3PX6A 5KRSA 4DU1A 3VQ4A 4Z4GA 3BGRA 1HJRA 5K14A 3NBPA 4CJ3A 3DYAA 4FJ5A 1VSDA 1TKZA 1QQCA 4IG0A 3AA2A 3V9SA 1UWBA 3NGIA 4BDZA 1L3UA 4DU4A 3ZT0A 3KLFA 4KHWA 4GMJB 4DF4A 1Q9XA 3G0ZA 5EU7A 1JL1A 1DTQA 1RILA 3KLEA 3RMBA 2P5GA 4M3ZA 4C8LA 1U4BA 2AJQA 4KO0A 1GOAA 3HPOA 1DLOA 4G1QA 2VG7A 1A5XA 3HPGA 4M45A 3KK2A 4HCBA 1VK0A 3HVTA 3QNNA 1NK8A 1SUQA 4OPKA 4O5BA 3SQ1A 1S1XA 1U48A 4CJ5A 3SV4A 2HMIA 4IKFA 1UA1A 1JLCA 2OPSA 3HK2A 3CYMA 3OYJA 1N5YA 2R7YA 4E19A 3CM5A 2FBYA 2F8TA 3C95A 4DQRA 3QINA 4M3YA 1T05A 4W5OA 1HYVA 4DSEA 4HCCA 3VQ9A 1D9FA 4PUOA 3SQ2A 4CJPA 3CM6A 3DOKA 1S9EA 3MECA 3TAQA 3DLEA 1RT3A 4JRQA 3ULDA 3MEDA 1ZBHA 3SUPA 4IG3A 1WSHA 2XY8A 4EP4A 3AA3A 3DLRA 4CJTA 4B3OA 3AVIA 3LPUA 3ZT3A 4DFPA 1X9MA 1TKDA 5KGWA 3C94A 2HNZA 5HRRA 3U3GA 1VRTA 1TKXA 2A1SA 3HPHA 1LAWA 1RTJA 1S9GA 3QIPA 1RDDA 3VQPA 4CJ4A 4KI6A 1A5VA 2HHUA 1TK5A 4KHYA 1ASWA 2D0CA 4CJWA 1WSGA 4DTOA 4NYFA 4DQIA 1ZBLA 3ALYA 3TABA 4BWMA 4C8MA 2P51A 4H4MA 4CJRA 2VWJA 3U3YA 2KZZA 4M3TA 1HNVA 3LANA 4F2RA 3V6DA 1RT1A 3WNEA 3TAGA 2GV9A 1ASUA 2OPPA 4FM2A 3ZSQA 2XRIA 3SUQA 4GW6A 4N47A 4N56A 1CLQA 4Q0BA 3SYZA 1HRHA 1UOCA 4PQUA 1RT4A 2OPRA 5J2MA 4K8XA 2FBVA 4WE1A 1KFDA 3P83D 3ISNC 1X1PA 4RW8A 4CF2A 3OJSA 5C42A 4KB0A 4B9TA 1LW0A 1NK0A 4BE0A 1NOYA 4DTJA 3S3OA 4DFJA 3SUNA 1UA0A 1J54A 3CFOA 3V1QA 1KSPA 5SWMA 2PZSA 1JLBA 4DTRA 1W0HA 4CGHA
chains in the Genus database with same CATH superfamily
4U7BA 3E1YA 3MXMA 3MN6A 1B92A 3P31A 1LWEA 3F9KA 3B6OA 3ZT4A 4KFBA 4H03B 4FL9A 2A3ZA 4IWVA 3FFIA 2ATQA 3DWLA 4B8AB 2CGJA 2P9NA 3C7NB 2GWJA 4GVEA 3CQYA 1VRUA 4IFEA 5KI6A 3W3DA 1QSYA 3LDQA 3M8QA 3RWUA 4E1NA 2VWKA 1EWQA 2UXDK 1VQNN 1OH7A 1NLVA 4FZYA 4KV8A 1HLUA 2NRTA 3C65A 4DUZK 3CCRN 3D45A 4OO1J 3ZT1A 1WLJA 1JLEA 1VSHA 2ZF5O 4NYNA 2FXUA 2Q1NA 4DTMA 3WUHA 2ZD1A 2NRZA 4CJUA 5KRTA 4UQGA 3DLKA 3WNGA 3CCLN 1LOTB 1DGKN 3KKRA 2D0OA 4AF1A 3P38A 1WSFA 2Z1IA 3HZ6A 4FW2A 1ZBIA 4N76A 1X3NA 2WUSA 3O80A 3O4WA 1T44A 1O13A 1KRPA 1VQPN 2J4RA 4HWIA 3CF5L 3IS9A 3ZCMA 4DTSA 5BPNA 3PV8A 1C0FA 1MU2A 3OYNA 4JV5K 5BPLA 5HRNA 4J2DA 3J80O 3KLIA 4CJEA 5I3UA 1SL2A 1EKEA 1KLNA 4BRAA 3FGUA 3O3FA 4B9SA 4HTLA 3QBWA 1IBKK 4IDKA 3S3MA 4CZKA 3IAYA 3AVFA 1VSMA 3R3LA 3DMJA 3NVKA 3DM2A 4CD3A 5BRHA 3V1RA 1KAXA 3HM8A 4CK1A 5GINA 2Q0RA 4CHQA 2YV0X 3KTQA 4ICLA 4CZEA 4J2BA 4JN4A 3CQ8A 3MXIA 4WF9L 3S3NA 4I9QA 2NRRA 4I2QA 1S72N 3E01A 4B08A 3MK6A 1JXEA 1KAYA 1NJYA 2CGLA 1NWKA 1P90A 4JKDA 1NG9A 1SL1A 3AVMA 1W2BM 4MDBA 4BQLA 3G6EN 2QKBA 1VSFA 3BZCA 1L3SA 4WFAL 1S1VA 1TUYA 4LH4A 2NRHA 3AVBA 2GWKA 3N4PA 1NK7A 1YUWA 5FROA 3J7YP 5AQKA 1YAGA 2CH5A 3OYCA 3I8DA 4BDPA 2F9WA 3KK1A 4JI6K 4YNQA 2HB5A 2NZTA 1NGBA 1QHTA 3JAMO 3R6MA 1C0UA 4LD0A 3KWGA 1NGCA 3VQDA 3P39A 1ASVA 1JXBA 3NCIA 4ILHA 4CIGA 5CZ1A 3PUFA 4CBXA 1A5WA 3QETA 1N8RO 2BH1A 3V1OA 1QTMA 2G8IA 4E1JA 4IEEA 4CFBA 4BC5A 4JS5A 3A5MC 4XIUA 4CHYA 3QNOA 3GL1A 3D7EO 3C0BA 3V4IA 1YVUA 3SNNA 4PWDA 3RR8A 4RW9A 2HBMA 3KK3A 4DMNA 3KD5E 3UB5A 1TYQA 1QHAA 2BTFA 3VMFB 3OYAA 2XY7A 4HVJA 5TKYA 4CEAA 2G8VA 3AO5A 3NF9A 2UXCK 3RMDA 4FVUA 4CJ7A 4M41A 1T03A 3J7ZO 1XHXA 1SL0A 4JI5K 1J5EK 4V19S 2YHAA 1HNXK 3KHYA 2YHXA 4L8RB 3SBGA 3E66A 3LWLA 3ZETB 4FVMA 1NK6A 2V52B 1HYSA 4JEPA 3CCJN 3H45C 4YOUA 3V81A 1BIZA 1SAZA 5JVHL 1YHQN 1NJXA 3UKRA 2F4VK 3KWIA 1FW6A 4BRLA 4O0IA 3TAMA 4W5NA 1BUPA 1BIUA 4KH4A 3M5RA 5AQIA 2FSJA 4B3MK 3CQXA 2X78A 4PKIA 1KVAA 4QS7A 1HYZA 1ATRA 2IIRA 3LALA 4B9UA 2RN2A 3RMAA 3VEYA 2GTDA 1NK4A 2AA4A 4CF9A 4H0YB 2ZGZA 1K8KA 4M3XA 4CECA 1ZBSA 2A1RA 2IDOA 4WQ5A 4JRPA 3WT0A 1BCMA 2EWSA 3TSPA 2DTUA 3KKSA 3HM9A 1J53A 3F73A 5J2PA 4M3UA 4ZHRA 3NFAA 1RBRA 2OTLN 4JS4A 4FWMA 3OW2M 3C6TA 4ILGB 2P5OA 2P9IA 4OKJA 1OKJA 4CGFA 2ZGYA 2G8WA 4RG8A 1N36K 1QQMA 3K5NA 4LF7K 1XNRK 3HO1A 4QS8A 1EWRA 3L3VA 3WNFA 3I33A 4GNIA 1RBUA 4G9ZA 5AQPA 2UUCK 3D2FA 1HQEA 2HSTA 4XH1A 1SKSA 5DM6L 2JLEA 1OH6A 1YF5L 2P9NB 3CJ7A 4CESA 3OJUA 2O8DB 3TTFA 3D2EB 3AVHA 1RBSA 1NBWA 2VYPA 2QTDA 3ZEUA 5AQSA 3ZSWA 3RRHA 1Q18A 4YOVA 1NK5A 1XHZA 2GUPA 2HHQA 2FF3B 1JCFA 1Z26A 3RTVA 1IKYA 2QK9A 2Z1HA 3VEZA 4JK7A 2HBKA 2BE2A 3VENA 3NH2A 3CCUN 1U49A 3BF1A 2HHHK 2I5JA 3DRSA 3MXJA 1K73O 2I7NA 4CEDA 3CG7A 4IXCA 1D5AA 5HL7L 3VESA 4O55A 3A2FA 1W97L 4FJNA 4H0XB 4H5WA 4B1YB 1U45A 4CW7B 3OYBA 2E1ZA 1N6QA 3HSTB 3FLCO 4PA1A 2ZE2A 4ISGA 3MEEA 3SMSA 4XH4A 3JYTA 4KI4A 4BG9A 2UUAK 4DHYA 2ZJPL 2F7TA 3EYZA 2FF6A 1I39A 1NKBA 1Q7YO 3BF3A 3M6GA 1YT3A 4RW7A 1R59O 2Z1GA 4M7YA 4DB3A 1NGGA 1XC9A 3FZMA 2A6AA 3ID8A 4Z4GA 1IV0A 3BGRA 4CJ3A 3DYAA 4FJ5A 4JAXA 3AA2A 3UE5A 3NGIA 3V9SA 3QFUA 1L3UA 1Q9XA 4M3ZA 1DTQA 1X3MA 2P5GA 4F9OA 1U4BA 4KO0A 1GOAA 4FWLA 4G1QA 2VG7A 3EKSA 3OBWA 1NK8A 4Y0WA 3SV4A 2HMIA 4IKFA 2OPSA 2F8TA 3C95A 4JKFA 4DQRA 3QINA 4M3YA 1T05A 4B3RK 3M1FA 2UYTA 4HCCA 3ENOA 3VQ9A 3CM6A 5M1NA 4JRQA 2UU9K 3MEDA 4CZGA 4IG3A 2XY8A 4EP4A 4CZFA 3AA3A 4B3OA 3LPUA 3ZT3A 3C94A 2HNZA 1TKXA 3OA9A 1RDDA 3VQPA 4KHYA 1NGIA 1WSGA 5C2FA 3EE8A 4DTOA 1W7AA 2GELA 3O1WA 2P51A 3U3YA 4CJRA 2W41A 3BP8A 3LANA 1Z05A 4B1UB 5KQ8A 3ZX2A 4N56A 3O9SA 4Q0BA 4CVNE 3WXMB 1UOCA 3QBXA 1KFDA 3ISNC 3ULEB 1VHXA 4KB0A 5C42A 4B9TA 4BE0A 3S3OA 3SUNA 1J54A 3V1QA 5SWMA 4DTRA 4CGHA 4CZLA 1XMQK 4AHTA 4BR7A 4ELUA 4H0PA 3M8RA 1S1UA 4IO9L 4FOEA 4CHOA 3T1AA 4ZTFA 4EZ6A 3HOSA 1E4GT 2HVIA 3CC2N 4DR1K 1SV5A 1RTHA 5M1OA 4NCGA 1R0AA 1BI4B 2XHBA 3IMXA 3K0SA 1C1CA 1GLFO 5SZTA 5I42A 1TYQB 3LDNA 3P1GA 2HF3A 1Q9YA 4JKHA 3ZSXA 1HX1A 2QM1A 4DFMA 3AA4A 4KHUA 4E3SA 2ZWHA 4BC4A 5GIOA 5IT9O 1P8ZA 3VGMA 1KC8O 1YTAA 2KFNA 3LZIA 4JKEA 4FLWA 3J7AP 3OHRA 5FDLA 2X74A 3L2WA 1WBDA 4EHUA 5C12A 2G8HA 1I3AA 2W6KA 3UKRB 4JD2B 4FWOA 2D4WA 2F9TA 4IFVA 3QESA 4JI8K 3K58A 2E88A 3WQUA 5M1QA 3TSUA 1O1WA 5GAHP 3CCEN 1C0GA 5AQHA 4K43A 4AHCA 2IC3A 4E89A 4C8NA 3G25A 3O6WA 4CD1A 4J2EA 1E3MA 3ZX3A 4E7HA 5DMRA 1K8KB 2PAVA 3VQQA 4BROA 1BA1A 2FSKA 3DXMA 4CFCA 3V9WA 1DTTA 4CEZA 4DLGA 3T7ZA 4E0DA 4DR4K 4DTUA 5GAGP 1TVRA 3QERA 4DFKA 3GBTA 4LSNA 4BRIA 5HLFA 1TGOA 2WBNA 4N5SA 3AARA 4E7IA 4Y1DA 4Q5VA 3SUOA 3HI0A 4B9NA 5CE3A 3I0SA 3L8BA 4ID1A 3SI6A 1L5UA 1KVBA 2ZQBA 2E2OA 2VGNA 3D2FB 2WONA 1HQUA 2G8KA 4BR0A 3SQ4A 2RF2A 2F8SA 5AQQA 3PLAA 1EXQA 3CJCA 4OLAA 1Z25A 3NAEA 3I0RA 3KLGA 2O8FA 2EHGA 3OS2A 2XO7A 4RW6A 4DTNA 3SPZA 1KTQA 3V9XA 3VQ8A 3DI6A 5LMUK 4KH6A 3NH0A 1T3VA 4IBNA 4B1VA 4FLXA 3VQ6A 4HUGA 1XC3A 1RGIA 4DR7K 3O3GA 4BE1A 4BY9C 4F3TA 3DLHA 4B9QA 5H1SQ 4EZ9A 3O9UA 2RE2A 5C0YA 3PSFA 4DF8A 1SKRA 2O8DA 4CI6A 3D2EA 1BL3A 5FPMA 3P5JA 3A8YA 5JS1A 5BREA 5GADP 4HHTA 1SQKA 4CFAA 3L2UA 4Z94A 5CR4A 3L2RA 2V7YA 3VA3A 1RT7A 4ID5A 2YNIA 1J5OA 1Q8IA 4I9LA 1JCGA 3LDOA 2KKZA 4FM0A 2P9KA 5F0XA 4DG1A 2D5RA 1GLLO 4I7FA 1EO1A 1ESVA 2FLOA 3HL8A 1LW2A 4FJ9A 3J81O 4WCEL 4FLUA 3AVLA 2QWMA 5IWAK 4CGGA 2W42A 5TKWA 4YORA 1IBMK 1HPZA 4PY5A 1VQ6N 1YIJN 4A5BA 4C23A 1IO2A 3O3HA 4CCHA 4UY8O 1LV5A 1T7PA 4BG8A 5EXWA 1U04A 3U8XA 1ZYQA 4JI2K 3ZX0A 3SPYA 3OVNA 2HF4A 4TSXA 3SJJA 5JMVA 1MDUB 3FZFA 2A40A 3CJ1A 3CMAN 3R9PA 4CZIA 3M8SA 1N33K 5ELZA 4OPJA 1NGAA 3IFRA 4JK8A 2P9UA 2X6SA 1TL3A 5D3GA 5AQGA 2KLAA 3K5OA 1B9FA 3LP0A 1WSIA 4W5TA 4OKKA 4CJVA 4RCHA 5AZJA 3TU5A 2KFZA 4CZHA 5GAEP 3HBTA 1BQNA 2DPNA 4DQQA 4NCBA 2Y1JA 3PX4A 3VGKA 3MAQA 3EN9A 3NMUA 4JI1K 4CEOA 3T19A 1IH7A 3LL3A 4BRFA 3K9JA 2ZJRL 3LAKA 3NGZA 2YJEA 4IFYA 4F2SA 2Q2RA 4FWRA 3AA5X 2KHOA 3KIOA 2IAJA 2E20A 1KD1O 1LWCA 1EX4A 1QSSA 1KVCA 3FE1A 4CBUA 3HXMA 4N41A 1HMVA 4FLZA 3S9HA 3DRPA 3OYHA 5HRSA 2Z1JA 4JI0K 4CJFA 2QWOA 2UUBK 3ULEA 3WNHA 5AQZA 1SKWA 4CFDA 4F4KA 4FJJA 3CJ9A 4YOWA 1NGFA 4BWJA 1JL2A 3OYGA 1WAFA 1RDAA 4A5AA 5B8HA 3P4IA 3V9ZA 1KAZA 3DLBA 5A2QO 1MA9B 4IJNA 1JJ2M 3MCPA 3IKMA 1FKOA 4CE9A 3H46O 1BI4A 1RDUA 1MWMA 4FWNA 4C8OA 1CXQA 4E7LA 1HNZK 4M63C 3DAWA 2V7ZA 2FC0A 3V9UA 4DU3A 3FFKB 2DFHA 1NJZA 3SMPA 1U47A 2Q3SA 2E2NA 4XH5A 1L3VA 3SAGA 1WAJA 5AQLA 3HVRA 4FJHA 1IBLK 1NMDA 2YNFA 2PYLA 4O0JA 4LY7A 5CYMA 4Z0UA 3THXB 3HYFA 3OS0A 3VTIA 3SQ0A 2ETJA 4KTWA 3D6RA 4E7JA 4DSIA 2KZMA 1EQYA 1G99A 1VQMN 3DXMB 1T8EA 3A5NC 4ILJA 3ATUA 4DCHA 3PX6A 4JD2A 3VQ4A 4MDAA 2Q31A 1VSDA 3VEVA 1K8AO 3L4QA 4IG0A 4MLEA 1WB9A 4LFBK 5AQFA 3AY9A 3H3OB 1N34K 3KLEA 1JL1A 3EL2A 1RILA 2AJQA 3CETA 1A5XA 1BG3A 2GEMA 4M45A 4HCBA 5FPDA 4OPKA 4NXNK 1JLCA 4H5VA 3CYMA 4BR9A 1N5YA 2R7YA 3WEEA 4W5OA 4DSEA 1D9FA 1SZ2A 2VGMA 4CJPA 3MECA 1S9EA 3EE9A 5DM7L 4AQYK 1WSHA 4ELTA 5HRRA 4CK2A 5HP1A 3ZSRA 2O8FB 2KTQA 3HPHA 1LAWA 1RTJA 5AQNA 2QWQA 5MLCQ 1TK5A 5AQTA 1TUUA 2D0CA 4NYFA 4CZMA 1GLDG 2ZJQL 4C8MA 2KZZA 4H4MA 4WQ5C 1HNVA 4F2RA 3WNEA 3SUQA 1BDGA 1GLJO 4IOCL 1HPMA 4JKGA 3WXLA 3SYZA 1HRHA 4PQUA 5J2MA 2E1YA 2FBVA 4WE1A 4K8XA 4RW8A 4CF2A 3OJSA 4LFCK 1HUXA 1NK0A 3WXIA 4DTJA 1UA0A 3CFOA 2IVOA 1KSPA 3N4QA 2PZSA 1K9MO 2IVNA 1ZXOA 1W0HA 4FCYA 3G4SN 1FXXA 1VQ8N 1DKGD 5JS2A 3THVA 4NCAA 3LDLA 3TI0A 3KVGA 3LZJA 2P1JA 1RTIA 5LL6Z 1Q82O 4FXDA 2HHVA 1XUPO 3CERA 1QE1A 3TSQA 2OZMA 2HMPA 2B5JA 3VF6A 5E41A 2P9KB 3BY5A 1RCHA 1KLMA 2E6MA 3OYIA 3F2KA 1HKBA 3NGYA 1YXQA 2G8FA 3NH1A 4KTQA 1ZC6A 4B3SK 3CMEN 3CFPA 1VQLN 3AO2A 3CIPA 4R5PA 2ITGA 3BDPA 4FJXA 2P9PA 1TAQA 4K25A 4B9VA 3K57A 2ASOA 5FRMA 1S1WA 4F3OA 4IJAA 2X6NA 3H6EA 3TAEA 3U9ZA 4FK0A 5FPNA 4LF9K 4KHSA 2ZM6K 2NNWA 3EEQA 4BRDA 4BRMA 4DSKA 2BUPA 1WUAA 1L3TA 4BRNA 4LSLA 2P9UB 4KHQA 1RT2A 1WN7A 3I8BA 3CCVN 4CEBA 1E4FT 1NNEA 4OKEA 3PX0A 5M1KA 4GKKK 1GLEG 4KH5A 1FJGK 3OTOK 5AZJB 4JI7K 4FWPA 4KPYA 1RBTA 3VF2A 4O4GA 2O8CA 3FZLA 2HBJA 3NF6A 5LJWA 1JLFA 1IKXA 4ZTJA 3OYEA 4CEEA 4X66K 3THWA 1OVQA 3L4IA 3NF7A 4AM7A 1VQON 3B8AX 1YITN 4CIFA 4YOXA 2QWNA 1BHLA 4BRHA 4DR6K 4MLHA 3J8AA 4DV7K 3CCSN 1J6ZA 4CJQA 3VEXA 4DUYK 5EX5A 3AGRA 4FWSA 1C1AA 4CGJA 1IKWA 1GOBA 4E1MA 1SS6A 3AVJA 3VQBA 4CGIA 2AP1A 2RPIA 5AQMA 4BRQA 3NF8A 2XY5A 4JLHA 1TKTA 5C24A 4MO5A 3VQ5A 1Z6RA 1BCOA 3A5LC 3GDQA 2E8AA 3OY9A 4B3TK 3VQEA 5AQYA 2QI2A 2EX3A 3LP2A 4ISFA 1QVFM 4DV4K 4H5TA 4A62A 4CF8A 2O8BA 4Z4CA 3PY8A 2HVHA 3LAMA 4Z4HA 2GBZA 3AVAA 4DV3K 4BR5A 4XEIA 1RTDA 3CXCM 3U6FA 3ZSOA 4YY3K 3EY1A 2VG6A 5C25A 2W40A 1IKVA 3VEOA 3DRRA 4BC2A 3VQCA 4DQSA 4M3WA 3THYA 1WBBA 1ITGA 3GG4A 4DQPA 5BRDA 3RSEB 5BR9A 3O4NA 3PIOL 1JLGA 2D0AA 4FJ7A 3LWMA 3BUZB 2FBTA 4CERA 4WQ4A 4FSVA 4EIAA 1QSLA 4GY2B 1LAVA 3OYLA 4B9LA 3LM2A 2E2QA 4AHRA 1RDWX 4YFUA 1WOQA 2DY4A 2E4LA 4IEIA 5KGXA 3L6QA 4BVPA 3KLHA 3U4LA 5HOOA 2JGUA 3QB0A 5BN8A 2VQFK 1ATNA 2YKNA 3T3FA 3THXA 3ZT2A 4WQ4C 3OYKA 4A2AA 2YX6A 3WEEB 1C6VA 1S6QA 4O5FA 3SV3A 1X9WA 5HROA 3M3ZA 4MFBA 4HTUA 3TTDA 3U9DA 4BRKA 3JS6A 4E7KA 2HBLA 2Q0UA 2W6LA 2IS3A 1DT9A 3E9OA 1XMOK 3CI5A 3M8PA 1VQ9N 3L3UA 3R1XA 3EO3A 4JNEA 1S6PA 2QEXN 4GV6A 2HHSA 1BA0A 3H1QA 4B9MA 2LSNA 3TAPA 3KD1E 4FK2A 3MN9A 3VF4A 3CHWA 2PY5A 5E84A 2GUIA 4IOAL 3QEXA 4DSJA 5CZ2A 5AQJA 4O8UA 4L3QA 4CEFA 1ILYA 4FPBA 4JKGB 1VQ4N 5C10A 1C0MA 1QQNA 3AVKA 3AVNA 3VETA 3LP3A 5J2QA 4IO8A 5CHIA 4I6MA 2D0PA 2FBXA 3WXKA 2P9LA 2OZSA 3QIOA 1NKEA 2VCPA 3GE1A 3MN5A 3ZYYX 4KRFA 4QCLA 4LH5A 4JI4K 4NLCA 4A59A 1BU6O 4KAZA 1BISA 3K5LA 3WXJA 2ITMA 3O08A 1EETA 4BACA 4BGBA 3E9PA 4CJSA 3KZBA 3FZHA 5BRFA 3Q7CA 2BANA 5HRPA 3ASMA 4B1XB 4FYDA 4EHTA 3OBYA 1VSEA 1NGEA 3F9MA 3QEWA 1YTUA 5KPRA 3VERA 4WFBL 4NO7A 4FO0A 5AJ3K 3IRXA 1NGJA 4J8FA 4KB1A 4AILC 1G15A 1T6CA 4FJGA 1NJIO 2P9PB 1C0TA 2Q36A 3A5OC 4ISEA 1QZ5A 4Z4FA 3TAFA 5JICA 4BR4A 1Q86O 5BR8K 1Y97A 3VA0A 2HW3A 4PKGA 1REVA 1HNIA 3ZSZA 2YHYA 4W5QA 4FLYA 3G71N 4AM6A 4CEQA 2PFUA 2O4IA 2QWLA 3K9KA 4FLTA 1MWKA 1NJWA 4GVMA 3H08A 3ZSVA 4LF4K 5KRSA 4DU1A 1TKZA 4U67L 2O8CB 4DU4A 3ZT0A 4GMJB 3G0ZA 2OCEA 3PIPL 1D4XA 3T69A 1DLOA 3HPOA 3THWB 3TPQA 3HPGA 4BC3A 3ATVA 1VK0A 3HVTA 3QNNA 1SUQA 1U48A 1S1XA 4MO4A 3AAQA 3MN7A 3HK2A 5AZIA 4E19A 3CM5A 4DV1K 2FBYA 4PL8A 3CC7N 4PUOA 1V4TA 3SAFA 3VTHA 3DLEA 1RT3A 3EZWA 3ULDA 1HNWK 1ZBHA 3SUPA 2P9SA 3UKUA 4X64K 3HRGA 4CJTA 3AVIA 4DFPA 1X9MA 1TKDA 2BDPA 1VRTA 2A1SA 3QIPA 4CJ4A 4HUFA 2OTJN 4KI6A 4K0KK 5BN9A 4DQIA 4JKBA 2E5LK 1I94K 4BWMA 4DV5K 2VWJA 4R79A 4LC9B 4M3TA 3V6DA 2GV9A 2OPPA 4FM2A 5BPMA 2YI1A 3ENHA 4BGAA 4GW6A 4N47A 1KQSM 1CLQA 3ID6A 4X65K 4A2BA 3O5BA 1RT4A 4BVOA 3NVMA 2O8BB 3VOVA 4PL7A 4DFJA 2GX9A 3H1VX 3H3NO 3C6HA 2JWLA 3E9LA 3L2VA 1NKCA 2O4GA 4NB4A 4FJIA 4M42A 3THYB 3EZ5A 2YKMA 5CY4A 4IDHA 5KPTA 2E6LA 1VSKA 4B8CA 3QEPA 4FOIA 1RBVA 2D1KA 1VSIA 3AVGA 4LF8K 3F5TA 5EOYA 1C1BA 2ASMA 3WQTA 2PYJA 1TK0A 1CXUA 4CIEA 4GKJK 3LDPA 2D0BA 3VEWA 3JXUA 1RFQA 2A42A 3QLHA 3OS1A 3VPZA 4OPHA 2CH6A 3VQAA 3QICA 4IOXA 4AHSA 4B1ZA 4RWTA 2YHWA 4CJLA 3JSMA 1RNHA 4BR2A 3QFPA 4F8RA 1B9DA 1KFSA 4YDUA 4CK3A 1U6ZA 5AFUA 4KREA 2HHWA 3MX2A 2OANA 3RSEA 3W0LA 2RHKA 2OPQA 4FPAA 4DQ8A 4DSLA 3MWTA 5EY4A 1CZ9A 2B4JA 2QKKA 2HOEA 3CJBA 4YHHK 4J2AA 3Q7BA 1J9AA 4FLVA 1Y64A 1WSJA 4OLBA 3MWPA 1JLAA 5AQXA 4C1NK 3MDQA 2IOCA 1TK8A 3CPEA 4YDUC 3MCAB 4RW4A 3MMVA 4OGCA 1S22A 2BGGA 3K5MA 4CF0A 4OVLA 1NM1A 4KKOA 2V51B 3R8EA 4LF6K 3DXKA 4H4OA 4GV3A 1M90O 2YNHA 1RT6A 1D8YA 1BQMA 4HUEA 3PSIA 1EP4A 2YHBA 1OVYA 5AQUA 2Y1IA 5AR0A 3HOTA 3VQ7A 4FJLA 3NDKA 5JVGL 4RTFD 1HJOA 3B6PA 4OX9K 3VGLA 1BOTO 4YOYA 3IDHA 4FWKA 3I55N 3AVCA 4I6MB 1VSJA 4X62K 4DR2K 4PKHA 1TL1A 2P9LB 3BEXA 4CHPA 4CGDA 3C6AA 3HP6A 3OYFA 1U2VB 1F21A 1NOZA 1VQ7N 1GLAG 3CD6N 3C6UA 5AFUH 1QZ6A 4JHDA 2NLXA 3CPWM 3QO9A 2UXBK 1S3XA 4WYBA 4OJRA 4QOZB 1RT5A 4DV0K 2B6AA 5T7BA 3LPTA 2FSNA 2YJFA 4KHPK 1HKGA 1FK9A 4DR3K 3EKUA 3LP1A 1X9SA 4CJKA 1LWFA 1GOCA 3SLCA 2OA8A 2RKIA 3D0PA 4W5RA 2JWKA 3T1YK 4JK9A 4BRGA 3QEIA 4H5NA 5F1XA 1XQSC 3FZKA 3CCQN 2O8EA 5KPZA 4CHZA 1IG9A 5FLXO 3K2PA 3OYMA 4M3RA 2A41A 2XY6A 3HT3A 3AO4A 3AGKA 3O9QA 1UAXA 2QXFA 1TAUA 1M1KO 4FM1A 4CZJA 2QWRA 3MX5A 4BRPA 2YNGA 2OYQA 1KXPA 4A61A 2WOMA 3S41A 4H0TB 4IZ9A 4EP5A 4FJMA 4FJ8A 5AQWA 4O44A 3ZLJA 4GV9A 4BE2A 3DLGA 5M1FA 3TARA 3L2QA 4KHNA 4CBWA 3C7NA 3AO3A 4Z4EA 4DSFA 5GIPA 1VAZA 4EFHA 5J2NA 4QAGA 2NUBA 2ASPA 2YCHA 2I7PA 1ZBUA 1N32K 3ENBA 4DWIA 2QWPA 4B1WB 3PO4A 3OYDA 1YJWN 3IUCA 1CZAN 2QXLA 3DLLL 3QDKA 5CYQA 4CHNA 5JLHA 4DV2K 5KQDA 2WC9A 3SBTA 1RDCA 2H3GX 4KBOA 1RDBA 1D9DA 5AZIB 1BGXT 5M1PA 2HHXA 1KCFA 5DK5A 1K6YA 3A0IX 1HKCA 3ZSYA 5JLFA 5C15A 3K59A 1VQ5N 2P9SB 3TTCA 4QS9A 3CCMN 1JKHA 3UKUB 2Q97A 4DLEA 4LFAK 1ATSA 1W9HA 1VQKN 3SCXA 3RR7A 4FZZA 4Y1CA 3O1BA 2G8UA 3SAHA 4DKWA 3DJCA 3UIQA 1VSLA 3LDSA 3PO5A 4BQZA 3RRGA 4MQ3A 2HHTA 2CGKA 4DR5K 4O8KA 3HJFA 3G10A 4FK4A 4DTPA 1ZBFA 3TANA 2HNDA 4FWQA 5HBMA 1NK9A 4BRCA 3SZ2A 1XI1A 1S5JA 3KK7A 4A57A 3O9RA 1BO5O 2IVPA 3AAPA 3DOLA 1CZBA 1YVNA 5FRNA 4FW1A 2HNYA 5J1EA 5EVZA 2KQ2A 4FJKA 4AH9A 4ELVA 1BWFO 3IG1A 3MEGA 4K8ZA 4I2PA 3L0QA 2WFBA 1X9JA 1NGDA 2F96A 4YOTA 1FKPA 1WNSA 4DS5A 4AHVA 5ADXA 2VQEK 4CF1A 3SK3A 3AO1A 3LM9A 2DFFA 2DFEA 1T6DA 2KW4A 5KTQA 1YI2N 3CFRA 1NMNA 3AV9A 3HP9A 3GOIA 4JKCA 1GLCG 4BDYA 4C8KA 1QS4A 1QQOA 1OH5A 3TWHA 4DS4A 5AQOA 3HTVA 5AQVA 1YJNN 5E26A 4NLBA 3O4QA 4Z4IA 5F2RA 1TV6A 3FR0A 4OGEA 2VG5A 4K42A 1WSEA 4DTXA 3HSCA 3NHGA 1XNQK 4AHUA 1XWLA 3TR8A 3ITHA 5LY3A 1S1TA 2A5XA 2WTUA 3KJVA 2QA4N 4H5RA 3VN5A 1JLQA 3DXKB 5LMNK 2NRVA 4EAHD 4JYAK 2QW9A 1NU0A 3QEVA 1JCEA 3O9TA 4KTZA 2IGIA 4OPAA 3RMCA 4H8KA 1OH8A 3CC4N 1HJRA 5K14A 5LJVA 3NBPA 5C2DA 1QQCA 3O8MA 1UWBA 4BDZA 2NRXA 3KLFA 4KHWA 5I9EB 5FPEA 4DF4A 5EU7A 4JI3K 3RMBA 4C8LA 5ADXH 3ZETA 3T1HK 3QMLA 3KK2A 4O5BA 3SQ1A 4CJ5A 1UA1A 4DV6K 3OYJA 2PBDA 3CJAA 1Q81O 1GLBG 1HYVA 1DEJA 4WFNL 1H1VA 3SQ2A 3DOKA 4H0OA 3TAQA 4M7XA 4JHDB 4H0VB 2P9IB 1LCUA 3DLRA 4K41A 1V4SA 4LF5K 3SJHA 2E2PA 3U3GA 5KGWA 3ZSQA 3NE6A 2HHUA 4PHTX 1S9GA 1A5VA 1NGHA 1ASWA 4CJWA 1ZBLA 3ALYA 3TABA 1RT1A 3TAGA 1YJ9N 1QVGM 1ASUA 4NXMK 2XRIA 1U2VA 2O8EB 3I56N 2OPRA 3RVCA 3P83D 2NRWA 1X1PA 4C1NI 1HR0K 1LW0A 1NOYA 4BREA 4JKAA 1IG8A 3BZKA 3ZEUB 2VWBA 5AQRA 1IJJA 1JLBA 4FZXC
chains in the Genus database with same CATH topology
3L2VA 4AHTA 3MXMA 1NKCA 2O4GA 4ELUA 4FJIA 1FXXA 3M8RA 1S1UA 4M42A 1B92A 4ZTFA 1LWEA 3F9KA 3T1AA 5JS2A 4CHOA 3THVA 4EZ6A 3EZ5A 4NCAA 3B6OA 3ZT4A 2HVIA 3TI0A 3LZJA 4KFBA 2P1JA 2YKMA 1RTIA 5CY4A 1SV5A 1RTHA 2E6LA 1VSKA 4B8CA 3FFIA 4NCGA 3QEPA 1R0AA 4FXDA 2HHVA 1BI4B 2ATQA 1RBVA 2XHBA 4B8AB 1VSIA 1C1CA 1VRUA 1QE1A 2OZMA 5KI6A 5SZTA 3AVGA 5I42A 1QSYA 2B5JA 3M8QA 3P1GA 5E41A 3RWUA 1C1BA 4E1NA 2VWKA 2PYJA 1TK0A 1CXUA 4CIEA 1RCHA 1KLMA 2E6MA 3OYIA 1Q9YA 3NGYA 2D0BA 2G8FA 3NH1A 3QLHA 3OS1A 3ZSXA 4KTQA 4DFMA 4KHUA 3AA4A 4FZYA 4E3SA 3VQAA 4AHSA 4KV8A 4CJLA 3JSMA 1RNHA 3CFPA 3D45A 3ZT1A 1WLJA 4F8RA 1JLEA 1YTAA 1B9DA 1VSHA 1KFSA 2KFNA 3LZIA 4NYNA 4CK3A 4DTMA 4FLWA 2ZD1A 4KREA 2HHWA 4CJUA 5KRTA 4UQGA 3DLKA 3AO2A 3WNGA 5FDLA 4R5PA 3KKRA 2ITGA 3BDPA 4FJXA 1TAQA 2X74A 3L2WA 4B9VA 2OPQA 4DSLA 1WSFA 3K57A 2Z1IA 5FRMA 4FW2A 1CZ9A 1ZBIA 2B4JA 2G8HA 2QKKA 4N76A 1I3AA 4J2AA 1S1WA 4IFVA 4F3OA 1J9AA 3QESA 4FLVA 1WSJA 3K58A 4OLBA 1JLAA 2X6NA 3TAEA 1TK8A 2IOCA 1KRPA 4FK0A 4KHSA 4RW4A 1O1WA 3IS9A 4OGCA 4DSKA 3ZCMA 4DTSA 2BGGA 1L3TA 3K5MA 4LSLA 3PV8A 4AHCA 2IC3A 1MU2A 3OYNA 4CF0A 4M3UA 4E89A 4OVLA 4KHQA 5HRNA 4J2DA 1RT2A 1WN7A 4KKOA 4C8NA 4J2EA 3KLIA 4CJEA 4CEBA 5I3UA 1SL2A 1EKEA 1KLNA 4OKEA 3PX0A 4E7HA 4H4OA 3O3FA 5DMRA 4B9SA 3VQQA 2YNHA 4FCYA 1RT6A 1D8YA 1BQMA 4HUEA 4IDKA 1EP4A 2YHBA 4CFCA 3V9WA 3S3MA 1DTTA 4CEZA 4DLGA 4E0DA 3NE6A 3IAYA 3AVFA 2Y1IA 1RBTA 1VSMA 4KPYA 4DTUA 3DMJA 4O4GA 3VQ7A 3DM2A 1TVRA 3QERA 4FJLA 3NF6A 4DFKA 3NDKA 3V1RA 1JLFA 4LSNA 1IKXA 4CK1A 5HLFA 1TGOA 3B6PA 4ZTJA 4CHQA 2YV0X 3OYEA 4CEEA 3KTQA 4ICLA 4N5SA 4J2BA 3NF7A 3CQ8A 4E7IA 3MXIA 4CIFA 3AVCA 3S3NA 1VSJA 4Y1DA 4Q5VA 3SUOA 1BHLA 4B9NA 1TL1A 3I0SA 4CHPA 4I9QA 3L8BA 4CGDA 4I2QA 3E01A 4B08A 4ID1A 3HP6A 3SI6A 1JXEA 1KVBA 2ZQBA 3OYFA 1L5UA 1NJYA 5HP1A 1F21A 2WONA 1HQUA 1NOZA 4CJQA 2G8KA 3C6UA 1SL1A 3SQ4A 2RF2A 1C1AA 4CGJA 1IKWA 1GOBA 4E1MA 3AVMA 2F8SA 1EXQA 3AVJA 3QO9A 4OLAA 1Z25A 3VQBA 3NAEA 2QKBA 4CGIA 4OJRA 2RPIA 4QOZB 1VSFA 3I0RA 3NF8A 3KLGA 1RT5A 2XY5A 1L3SA 1S1VA 4LH4A 4JLHA 3AVBA 2EHGA 2B6AA 1TKTA 5C24A 5T7BA 3LPTA 3OS2A 2XO7A 4RW6A 3VQ5A 4DTNA 3SPZA 1NK7A 1KTQA 1FK9A 5FROA 3V9XA 3LP1A 1X9SA 4CJKA 3VQ8A 1BCOA 3DI6A 1LWFA 1GOCA 3OY9A 3OYCA 3NH0A 3VQEA 3I8DA 4IBNA 2OA8A 2RKIA 3D0PA 4W5RA 4FLXA 2EX3A 3LP2A 3VQ6A 3QEIA 4BDPA 4HUGA 3KK1A 3O3GA 4BE1A 4YNQA 4F3TA 3DLHA 2HB5A 1QHTA 4CF8A 4CHZA 1IG9A 4EZ9A 3K2PA 3OYMA 1C0UA 4M3RA 4Z4CA 3PY8A 2HVHA 4LD0A 2XY6A 3LAMA 3HT3A 3AO4A 3VQDA 4Z4HA 1ASVA 1JXBA 2GBZA 3AVAA 3NCIA 4DF8A 1UAXA 2QXFA 1SKRA 1TAUA 1RTDA 1BL3A 3P5JA 3U6FA 5JS1A 4CIGA 3ZSOA 5CZ1A 4FM1A 3PUFA 1A5WA 2VG6A 3EY1A 3QETA 4HHTA 5C25A 1IKVA 2YNGA 3DRRA 3V1OA 3VQCA 1QTMA 2OYQA 2G8IA 4DQSA 4M3WA 4CFAA 4CFBA 3L2UA 4JS5A 2WOMA 4XIUA 3L2RA 4CHYA 3QNOA 1ITGA 4FJMA 4EP5A 4FJ8A 3VA3A 3V4IA 4O44A 2KTQA 1RT7A 1YVUA 4ID5A 3SNNA 2YNIA 4DQPA 1J5OA 4BE2A 1Q8IA 3DLGA 3O4NA 3TARA 4PWDA 3L2QA 4KHNA 3RR8A 4I9LA 4RW9A 3KK3A 1JLGA 4DMNA 3KD5E 2D0AA 3AO3A 4FJ7A 4Z4EA 4DSFA 3LWMA 2FBTA 4CERA 3OYAA 4FM0A 5J2NA 2XY7A 4QAGA 1QSLA 4HVJA 4CEAA 2NUBA 2G8VA 3AO5A 1LAVA 4DG1A 3OYLA 2D5RA 1ZBUA 3NF9A 4B9LA 4I7FA 3HL8A 4FJ9A 1LW2A 3RMDA 4DWIA 4FLUA 3AVLA 3PO4A 4M41A 4AHRA 4CGGA 4YFUA 3OYDA 2W42A 1T03A 1XHXA 1HPZA 1SL0A 4PY5A 2DY4A 2E4LA 5KGXA 2YHAA 3KLHA 5CYQA 4L8RB 4CHNA 3LWLA 4FVMA 1NK6A 2JGUA 1IO2A 1HYSA 3O3HA 2YKNA 1RDCA 3T3FA 4CCHA 3ZT2A 3OYKA 1LV5A 1T7PA 1RDBA 3V81A 1D9DA 1BIZA 1BGXT 1U04A 1ZYQA 2HHXA 3SPYA 1C6VA 1NJXA 1KCFA 3OVNA 1S6QA 1K6YA 5DK5A 4TSXA 3SV3A 3SJJA 1X9WA 5HROA 4MFBA 4O0IA 3TAMA 4W5NA 4HTUA 1BIUA 3ZSYA 4E7KA 3K59A 2IS3A 2X78A 1KVAA 1JKHA 3M8PA 3M8SA 4DLEA 3L3UA 1HYZA 4OPJA 2BDPA 1W9HA 3LALA 1S6PA 2X6SA 1TL3A 3SCXA 5D3GA 4B9UA 3RR7A 2RN2A 3RMAA 4FZZA 2HHSA 3K5OA 4Y1CA 1NK4A 1B9FA 4B9MA 4CF9A 2LSNA 3LP0A 1WSIA 3TAPA 2G8UA 3KD1E 3UIQA 4HUFA 1VSLA 3LDSA 4FK2A 3PO5A 4W5TA 4OKKA 4M3XA 4CECA 4CJVA 3RRGA 2KFZA 2PY5A 2A1RA 4MQ3A 2HHTA 2IDOA 1BQNA 2GUIA 4JRPA 4DQQA 4NCBA 2Y1JA 3QEXA 3PX4A 1BCMA 5CZ2A 4DSJA 3HJFA 3G10A 2DTUA 4FK4A 4DTPA 3MAQA 3KKSA 3HM9A 1J53A 3F73A 1ZBFA 5J2PA 3TANA 4CEFA 2HNDA 5HBMA 1NK9A 4ZHRA 4CEOA 3T19A 1IH7A 3NFAA 3SZ2A 1RBRA 1XI1A 4JS4A 1C0MA 1S5JA 3LAKA 3NGZA 3AVKA 4IFYA 4F2SA 3C6TA 2P5OA 4OKJA 3AVNA 4CGFA 3AA5X 4FZXC 3DOLA 3LP3A 5J2QA 3KIOA 1CZBA 2IAJA 5FRNA 2G8WA 4FW1A 2HNYA 5J1EA 2KQ2A 2FBXA 4RG8A 1LWCA 4FJKA 4AH9A 1EX4A 3QIOA 3K5NA 1QSSA 2OZSA 1KVCA 1NKEA 4ELVA 3HO1A 3WNFA 3IG1A 3L3VA 3MEGA 4KRFA 4QCLA 4LH5A 3HXMA 4N41A 1HMVA 1RBUA 4FLZA 4CK2A 3S9HA 4KAZA 4K8ZA 4I2PA 1BISA 1HQEA 3DRPA 3OYHA 3K5LA 5HRSA 3ZSRA 1SKSA 2Z1JA 2F96A 1EETA 1FKPA 1WNSA 2JLEA 4BACA 4CJFA 4DS5A 4AHVA 4CJSA 4CF1A 4CESA 3OJUA 3WNHA 1SKWA 4F4KA 4CFDA 3AO1A 4FJJA 4BWJA 1JL2A 3AVHA 1RBSA 3OYGA 1WAFA 2BANA 1RDAA 2DFFA 2DFEA 5HRPA 2KW4A 3ZSWA 3ASMA 3RRHA 1NK5A 1XHZA 5KTQA 4FYDA 2HHQA 3CFRA 1VSEA 3V9ZA 3AV9A 1Z26A 3HP9A 3RTVA 1IKYA 3QEWA 3DLBA 2QK9A 1YTUA 2Z1HA 4BDYA 4C8KA 1QS4A 3TWHA 2BE2A 3NH2A 4DS4A 3IRXA 1U49A 4KB1A 4AILC 1FKOA 1G15A 2I5JA 3DRSA 4CE9A 4FJGA 3O4QA 3MXJA 4Z4IA 1C0TA 1BI4A 4C8OA 1CXQA 4CEDA 3CG7A 4E7LA 1D5AA 1TV6A 4Z4FA 4O55A 4OGEA 2VG5A 3A2FA 2FC0A 3V9UA 4DU3A 4FJNA 1WSEA 3TAFA 4DTXA 2DFHA 1NJZA 4ELTA 1U45A 1Y97A 2Q3SA 3NHGA 3VA0A 1U47A 2HW3A 1L3VA 4AHUA 1WAJA 3OYBA 1N6QA 1XWLA 3HSTB 3TR8A 3ITHA 3HVRA 4PA1A 1REVA 1HNIA 2ZE2A 1S1TA 3MEEA 3ZSZA 4W5QA 3JYTA 4FJHA 4KI4A 2YNFA 2PYLA 4O0JA 4LY7A 5CYMA 4Z0UA 3KJVA 4FLYA 3HYFA 3VN5A 3OS0A 3EYZA 4CEQA 1JLQA 1I39A 3SQ0A 2ETJA 4KTWA 2O4IA 1NKBA 4E7JA 1YT3A 4FLTA 4DSIA 2KZMA 4RW7A 1NJWA 4GVMA 3H08A 3ZSVA 2Z1GA 3QEVA 1XC9A 1T8EA 4KTZA 3RMCA 2IGIA 4H8KA 3PX6A 5KRSA 4DU1A 3VQ4A 4Z4GA 3BGRA 1HJRA 5K14A 3NBPA 4CJ3A 3DYAA 4FJ5A 1VSDA 1TKZA 1QQCA 4IG0A 3AA2A 3V9SA 1UWBA 3NGIA 4BDZA 1L3UA 4DU4A 3ZT0A 3KLFA 4KHWA 4GMJB 4DF4A 1Q9XA 3G0ZA 5EU7A 1JL1A 1DTQA 1RILA 3KLEA 3RMBA 2P5GA 4M3ZA 4C8LA 1U4BA 2AJQA 4KO0A 1GOAA 3HPOA 1DLOA 4G1QA 2VG7A 1A5XA 3HPGA 4M45A 3KK2A 4HCBA 1VK0A 3HVTA 3QNNA 1NK8A 1SUQA 4OPKA 4O5BA 3SQ1A 1S1XA 1U48A 4CJ5A 3SV4A 2HMIA 4IKFA 1UA1A 1JLCA 2OPSA 3HK2A 3CYMA 3OYJA 1N5YA 2R7YA 4E19A 3CM5A 2FBYA 2F8TA 3C95A 4DQRA 3QINA 4M3YA 1T05A 4W5OA 1HYVA 4DSEA 4HCCA 3VQ9A 1D9FA 4PUOA 3SQ2A 4CJPA 3CM6A 3DOKA 1S9EA 3MECA 3TAQA 3DLEA 1RT3A 4JRQA 3ULDA 3MEDA 1ZBHA 3SUPA 4IG3A 1WSHA 2XY8A 4EP4A 3AA3A 3DLRA 4CJTA 4B3OA 3AVIA 3LPUA 3ZT3A 4DFPA 1X9MA 1TKDA 5KGWA 3C94A 2HNZA 5HRRA 3U3GA 1VRTA 1TKXA 2A1SA 3HPHA 1LAWA 1RTJA 1S9GA 3QIPA 1RDDA 3VQPA 4CJ4A 4KI6A 1A5VA 2HHUA 1TK5A 4KHYA 1ASWA 2D0CA 4CJWA 1WSGA 4DTOA 4NYFA 4DQIA 1ZBLA 3ALYA 3TABA 4BWMA 4C8MA 2P51A 4H4MA 4CJRA 2VWJA 3U3YA 2KZZA 4M3TA 1HNVA 3LANA 4F2RA 3V6DA 1RT1A 3WNEA 3TAGA 2GV9A 1ASUA 2OPPA 4FM2A 3ZSQA 2XRIA 3SUQA 4GW6A 4N47A 4N56A 1CLQA 4Q0BA 3SYZA 1HRHA 1UOCA 4PQUA 1RT4A 2OPRA 5J2MA 4K8XA 2FBVA 4WE1A 1KFDA 3P83D 3ISNC 1X1PA 4RW8A 4CF2A 3OJSA 5C42A 4KB0A 4B9TA 1LW0A 1NK0A 4BE0A 1NOYA 4DTJA 3S3OA 4DFJA 3SUNA 1UA0A 1J54A 3CFOA 3V1QA 1KSPA 5SWMA 2PZSA 1JLBA 4DTRA 1W0HA 4CGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2V A;  4AHT A;  3MXM A;  1NKC A;  2O4G A;  4ELU A;  4FJI A;  1FXX A;  3M8R A;  1S1U A;  4M42 A;  1B92 A;  4ZTF A;  1LWE A;  3F9K A;  3T1A A;  5JS2 A;  4CHO A;  3THV A;  4EZ6 A;  3EZ5 A;  4NCA A;  3B6O A;  3ZT4 A;  2HVI A;  3TI0 A;  3LZJ A;  4KFB A;  2P1J A;  2YKM A;  1RTI A;  5CY4 A;  1SV5 A;  1RTH A;  2E6L A;  1VSK A;  4B8C A;  3FFI A;  4NCG A;  3QEP A;  1R0A A;  4FXD A;  2HHV A;  1BI4 B;  2ATQ A;  1RBV A;  2XHB A;  4B8A B;  1VSI A;  1C1C A;  1VRU A;  1QE1 A;  2OZM A;  5KI6 A;  5SZT A;  3AVG A;  5I42 A;  1QSY A;  2B5J A;  3M8Q A;  3P1G A;  5E41 A;  3RWU A;  1C1B A;  4E1N A;  2VWK A;  2PYJ A;  1TK0 A;  1CXU A;  4CIE A;  1RCH A;  1KLM A;  2E6M A;  3OYI A;  1Q9Y A;  3NGY A;  2D0B A;  2G8F A;  3NH1 A;  3QLH A;  3OS1 A;  3ZSX A;  4KTQ A;  4DFM A;  4KHU A;  3AA4 A;  4FZY A;  4E3S A;  3VQA A;  4AHS A;  4KV8 A;  4CJL A;  3JSM A;  1RNH A;  3CFP A;  3D45 A;  3ZT1 A;  1WLJ A;  4F8R A;  1JLE A;  1YTA A;  1B9D A;  1VSH A;  1KFS A;  2KFN A;  3LZI A;  4NYN A;  4CK3 A;  4DTM A;  4FLW A;  2ZD1 A;  4KRE A;  2HHW A;  4CJU A;  5KRT A;  4UQG A;  3DLK A;  3AO2 A;  3WNG A;  5FDL A;  4R5P A;  3KKR A;  2ITG A;  3BDP A;  4FJX A;  1TAQ A;  2X74 A;  3L2W A;  4B9V A;  2OPQ A;  4DSL A;  1WSF A;  3K57 A;  2Z1I A;  5FRM A;  4FW2 A;  1CZ9 A;  1ZBI A;  2B4J A;  2G8H A;  2QKK A;  4N76 A;  1I3A A;  4J2A A;  1S1W A;  4IFV A;  4F3O A;  1J9A A;  3QES A;  4FLV A;  1WSJ A;  3K58 A;  4OLB A;  1JLA A;  2X6N A;  3TAE A;  1TK8 A;  2IOC A;  1KRP A;  4FK0 A;  4KHS A;  4RW4 A;  1O1W A;  3IS9 A;  4OGC A;  4DSK A;  3ZCM A;  4DTS A;  2BGG A;  1L3T A;  3K5M A;  4LSL A;  3PV8 A;  4AHC A;  2IC3 A;  1MU2 A;  3OYN A;  4CF0 A;  4M3U A;  4E89 A;  4OVL A;  4KHQ A;  5HRN A;  4J2D A;  1RT2 A;  1WN7 A;  4KKO A;  4C8N A;  4J2E A;  3KLI A;  4CJE A;  4CEB A;  5I3U A;  1SL2 A;  1EKE A;  1KLN A;  4OKE A;  3PX0 A;  4E7H A;  4H4O A;  3O3F A;  5DMR A;  4B9S A;  3VQQ A;  2YNH A;  4FCY A;  1RT6 A;  1D8Y A;  1BQM A;  4HUE A;  4IDK A;  1EP4 A;  2YHB A;  4CFC A;  3V9W A;  3S3M A;  1DTT A;  4CEZ A;  4DLG A;  4E0D A;  3NE6 A;  3IAY A;  3AVF A;  2Y1I A;  1RBT A;  1VSM A;  4KPY A;  4DTU A;  3DMJ A;  4O4G A;  3VQ7 A;  3DM2 A;  1TVR A;  3QER A;  4FJL A;  3NF6 A;  4DFK A;  3NDK A;  3V1R A;  1JLF A;  4LSN A;  1IKX A;  4CK1 A;  5HLF A;  1TGO A;  3B6P A;  4ZTJ A;  4CHQ A;  2YV0 X;  3OYE A;  4CEE A;  3KTQ A;  4ICL A;  4N5S A;  4J2B A;  3NF7 A;  3CQ8 A;  4E7I A;  3MXI A;  4CIF A;  3AVC A;  3S3N A;  1VSJ A;  4Y1D A;  4Q5V A;  3SUO A;  1BHL A;  4B9N A;  1TL1 A;  3I0S A;  4CHP A;  4I9Q A;  3L8B A;  4CGD A;  4I2Q A;  3E01 A;  4B08 A;  4ID1 A;  3HP6 A;  3SI6 A;  1JXE A;  1KVB A;  2ZQB A;  3OYF A;  1L5U A;  1NJY A;  5HP1 A;  1F21 A;  2WON A;  1HQU A;  1NOZ A;  4CJQ A;  2G8K A;  3C6U A;  1SL1 A;  3SQ4 A;  2RF2 A;  1C1A A;  4CGJ A;  1IKW A;  1GOB A;  4E1M A;  3AVM A;  2F8S A;  1EXQ A;  3AVJ A;  3QO9 A;  4OLA A;  1Z25 A;  3VQB A;  3NAE A;  2QKB A;  4CGI A;  4OJR A;  2RPI A;  4QOZ B;  1VSF A;  3I0R A;  3NF8 A;  3KLG A;  1RT5 A;  2XY5 A;  1L3S A;  1S1V A;  4LH4 A;  4JLH A;  3AVB A;  2EHG A;  2B6A A;  1TKT A;  5C24 A;  5T7B A;  3LPT A;  3OS2 A;  2XO7 A;  4RW6 A;  3VQ5 A;  4DTN A;  3SPZ A;  1NK7 A;  1KTQ A;  1FK9 A;  5FRO A;  3V9X A;  3LP1 A;  1X9S A;  4CJK A;  3VQ8 A;  1BCO A;  3DI6 A;  1LWF A;  1GOC A;  3OY9 A;  3OYC A;  3NH0 A;  3VQE A;  3I8D A;  4IBN A;  2OA8 A;  2RKI A;  3D0P A;  4W5R A;  4FLX A;  2EX3 A;  3LP2 A;  3VQ6 A;  3QEI A;  4BDP A;  4HUG A;  3KK1 A;  3O3G A;  4BE1 A;  4YNQ A;  4F3T A;  3DLH A;  2HB5 A;  1QHT A;  4CF8 A;  4CHZ A;  1IG9 A;  4EZ9 A;  3K2P A;  3OYM A;  1C0U A;  4M3R A;  4Z4C A;  3PY8 A;  2HVH A;  4LD0 A;  2XY6 A;  3LAM A;  3HT3 A;  3AO4 A;  3VQD A;  4Z4H A;  1ASV A;  1JXB A;  2GBZ A;  3AVA A;  3NCI A;  4DF8 A;  1UAX A;  2QXF A;  1SKR A;  1TAU A;  1RTD A;  1BL3 A;  3P5J A;  3U6F A;  5JS1 A;  4CIG A;  3ZSO A;  5CZ1 A;  4FM1 A;  3PUF A;  1A5W A;  2VG6 A;  3EY1 A;  3QET A;  4HHT A;  5C25 A;  1IKV A;  2YNG A;  3DRR A;  3V1O A;  3VQC A;  1QTM A;  2OYQ A;  2G8I A;  4DQS A;  4M3W A;  4CFA A;  4CFB A;  3L2U A;  4JS5 A;  2WOM A;  4XIU A;  3L2R A;  4CHY A;  3QNO A;  1ITG A;  4FJM A;  4EP5 A;  4FJ8 A;  3VA3 A;  3V4I A;  4O44 A;  2KTQ A;  1RT7 A;  1YVU A;  4ID5 A;  3SNN A;  2YNI A;  4DQP A;  1J5O A;  4BE2 A;  1Q8I A;  3DLG A;  3O4N A;  3TAR A;  4PWD A;  3L2Q A;  4KHN A;  3RR8 A;  4I9L A;  4RW9 A;  3KK3 A;  1JLG A;  4DMN A;  3KD5 E;  2D0A A;  3AO3 A;  4FJ7 A;  4Z4E A;  4DSF A;  3LWM A;  2FBT A;  4CER A;  3OYA A;  4FM0 A;  5J2N A;  2XY7 A;  4QAG A;  1QSL A;  4HVJ A;  4CEA A;  2NUB A;  2G8V A;  3AO5 A;  1LAV A;  4DG1 A;  3OYL A;  2D5R A;  1ZBU A;  3NF9 A;  4B9L A;  4I7F A;  3HL8 A;  4FJ9 A;  1LW2 A;  3RMD A;  4DWI A;  4FLU A;  3AVL A;  3PO4 A;  4M41 A;  4AHR A;  4CGG A;  4YFU A;  3OYD A;  2W42 A;  1T03 A;  1XHX A;  1HPZ A;  1SL0 A;  4PY5 A;  2DY4 A;  2E4L A;  5KGX A;  2YHA A;  3KLH A;  5CYQ A;  4L8R B;  4CHN A;  3LWL A;  4FVM A;  1NK6 A;  2JGU A;  1IO2 A;  1HYS A;  3O3H A;  2YKN A;  1RDC A;  3T3F A;  4CCH A;  3ZT2 A;  3OYK A;  1LV5 A;  1T7P A;  1RDB A;  3V81 A;  1D9D A;  1BIZ A;  1BGX T;  1U04 A;  1ZYQ A;  2HHX A;  3SPY A;  1C6V A;  1NJX A;  1KCF A;  3OVN A;  1S6Q A;  1K6Y A;  5DK5 A;  4TSX A;  3SV3 A;  3SJJ A;  1X9W A;  5HRO A;  4MFB A;  4O0I A;  3TAM A;  4W5N A;  4HTU A;  1BIU A;  3ZSY A;  4E7K A;  3K59 A;  2IS3 A;  2X78 A;  1KVA A;  1JKH A;  3M8P A;  3M8S A;  4DLE A;  3L3U A;  1HYZ A;  4OPJ A;  2BDP A;  1W9H A;  3LAL A;  1S6P A;  2X6S A;  1TL3 A;  3SCX A;  5D3G A;  4B9U A;  3RR7 A;  2RN2 A;  3RMA A;  4FZZ A;  2HHS A;  3K5O A;  4Y1C A;  1NK4 A;  1B9F A;  4B9M A;  4CF9 A;  2LSN A;  3LP0 A;  1WSI A;  3TAP A;  2G8U A;  3KD1 E;  3UIQ A;  4HUF A;  1VSL A;  3LDS A;  4FK2 A;  3PO5 A;  4W5T A;  4OKK A;  4M3X A;  4CEC A;  4CJV A;  3RRG A;  2KFZ A;  2PY5 A;  2A1R A;  4MQ3 A;  2HHT A;  2IDO A;  1BQN A;  2GUI A;  4JRP A;  4DQQ A;  4NCB A;  2Y1J A;  3QEX A;  3PX4 A;  1BCM A;  5CZ2 A;  4DSJ A;  3HJF A;  3G10 A;  2DTU A;  4FK4 A;  4DTP A;  3MAQ A;  3KKS A;  3HM9 A;  1J53 A;  3F73 A;  1ZBF A;  5J2P A;  3TAN A;  4CEF A;  2HND A;  5HBM A;  1NK9 A;  4ZHR A;  4CEO A;  3T19 A;  1IH7 A;  3NFA A;  3SZ2 A;  1RBR A;  1XI1 A;  4JS4 A;  1C0M A;  1S5J A;  3LAK A;  3NGZ A;  3AVK A;  4IFY A;  4F2S A;  3C6T A;  2P5O A;  4OKJ A;  3AVN A;  4CGF A;  3AA5 X;  4FZX C;  3DOL A;  3LP3 A;  5J2Q A;  3KIO A;  1CZB A;  2IAJ A;  5FRN A;  2G8W A;  4FW1 A;  2HNY A;  5J1E A;  2KQ2 A;  2FBX A;  4RG8 A;  1LWC A;  4FJK A;  4AH9 A;  1EX4 A;  3QIO A;  3K5N A;  1QSS A;  2OZS A;  1KVC A;  1NKE A;  4ELV A;  3HO1 A;  3WNF A;  3IG1 A;  3L3V A;  3MEG A;  4KRF A;  4QCL A;  4LH5 A;  3HXM A;  4N41 A;  1HMV A;  1RBU A;  4FLZ A;  4CK2 A;  3S9H A;  4KAZ A;  4K8Z A;  4I2P A;  1BIS A;  1HQE A;  3DRP A;  3OYH A;  3K5L A;  5HRS A;  3ZSR A;  1SKS A;  2Z1J A;  2F96 A;  1EET A;  1FKP A;  1WNS A;  2JLE A;  4BAC A;  4CJF A;  4DS5 A;  4AHV A;  4CJS A;  4CF1 A;  4CES A;  3OJU A;  3WNH A;  1SKW A;  4F4K A;  4CFD A;  3AO1 A;  4FJJ A;  4BWJ A;  1JL2 A;  3AVH A;  1RBS A;  3OYG A;  1WAF A;  2BAN A;  1RDA A;  2DFF A;  2DFE A;  5HRP A;  2KW4 A;  3ZSW A;  3ASM A;  3RRH A;  1NK5 A;  1XHZ A;  5KTQ A;  4FYD A;  2HHQ A;  3CFR A;  1VSE A;  3V9Z A;  3AV9 A;  1Z26 A;  3HP9 A;  3RTV A;  1IKY A;  3QEW A;  3DLB A;  2QK9 A;  1YTU A;  2Z1H A;  4BDY A;  4C8K A;  1QS4 A;  3TWH A;  2BE2 A;  3NH2 A;  4DS4 A;  3IRX A;  1U49 A;  4KB1 A;  4AIL C;  1FKO A;  1G15 A;  2I5J A;  3DRS A;  4CE9 A;  4FJG A;  3O4Q A;  3MXJ A;  4Z4I A;  1C0T A;  1BI4 A;  4C8O A;  1CXQ A;  4CED A;  3CG7 A;  4E7L A;  1D5A A;  1TV6 A;  4Z4F A;  4O55 A;  4OGE A;  2VG5 A;  3A2F A;  2FC0 A;  3V9U A;  4DU3 A;  4FJN A;  1WSE A;  3TAF A;  4DTX A;  2DFH A;  1NJZ A;  4ELT A;  1U45 A;  1Y97 A;  2Q3S A;  3NHG A;  3VA0 A;  1U47 A;  2HW3 A;  1L3V A;  4AHU A;  1WAJ A;  3OYB A;  1N6Q A;  1XWL A;  3HST B;  3TR8 A;  3ITH A;  3HVR A;  4PA1 A;  1REV A;  1HNI A;  2ZE2 A;  1S1T A;  3MEE A;  3ZSZ A;  4W5Q A;  3JYT A;  4FJH A;  4KI4 A;  2YNF A;  2PYL A;  4O0J A;  4LY7 A;  5CYM A;  4Z0U A;  3KJV A;  4FLY A;  3HYF A;  3VN5 A;  3OS0 A;  3EYZ A;  4CEQ A;  1JLQ A;  1I39 A;  3SQ0 A;  2ETJ A;  4KTW A;  2O4I A;  1NKB A;  4E7J A;  1YT3 A;  4FLT A;  4DSI A;  2KZM A;  4RW7 A;  1NJW A;  4GVM A;  3H08 A;  3ZSV A;  2Z1G A;  3QEV A;  1XC9 A;  1T8E A;  4KTZ A;  3RMC A;  2IGI A;  4H8K A;  3PX6 A;  5KRS A;  4DU1 A;  3VQ4 A;  4Z4G A;  3BGR A;  1HJR A;  5K14 A;  3NBP A;  4CJ3 A;  3DYA A;  4FJ5 A;  1VSD A;  1TKZ A;  1QQC A;  4IG0 A;  3AA2 A;  3V9S A;  1UWB A;  3NGI A;  4BDZ A;  1L3U A;  4DU4 A;  3ZT0 A;  3KLF A;  4KHW A;  4GMJ B;  4DF4 A;  1Q9X A;  3G0Z A;  5EU7 A;  1JL1 A;  1DTQ A;  1RIL A;  3KLE A;  3RMB A;  2P5G A;  4M3Z A;  4C8L A;  1U4B A;  2AJQ A;  4KO0 A;  1GOA A;  3HPO A;  1DLO A;  4G1Q A;  2VG7 A;  1A5X A;  3HPG A;  4M45 A;  3KK2 A;  4HCB A;  1VK0 A;  3HVT A;  3QNN A;  1NK8 A;  1SUQ A;  4OPK A;  4O5B A;  3SQ1 A;  1S1X A;  1U48 A;  4CJ5 A;  3SV4 A;  2HMI A;  4IKF A;  1UA1 A;  1JLC A;  2OPS A;  3HK2 A;  3CYM A;  3OYJ A;  1N5Y A;  2R7Y A;  4E19 A;  3CM5 A;  2FBY A;  2F8T A;  3C95 A;  4DQR A;  3QIN A;  4M3Y A;  1T05 A;  4W5O A;  1HYV A;  4DSE A;  4HCC A;  3VQ9 A;  1D9F A;  4PUO A;  3SQ2 A;  4CJP A;  3CM6 A;  3DOK A;  1S9E A;  3MEC A;  3TAQ A;  3DLE A;  1RT3 A;  4JRQ A;  3ULD A;  3MED A;  1ZBH A;  3SUP A;  4IG3 A;  1WSH A;  2XY8 A;  4EP4 A;  3AA3 A;  3DLR A;  4CJT A;  4B3O A;  3AVI A;  3LPU A;  3ZT3 A;  4DFP A;  1X9M A;  1TKD A;  5KGW A;  3C94 A;  2HNZ A;  5HRR A;  3U3G A;  1VRT A;  1TKX A;  2A1S A;  3HPH A;  1LAW A;  1RTJ A;  1S9G A;  3QIP A;  1RDD A;  3VQP A;  4CJ4 A;  4KI6 A;  1A5V A;  2HHU A;  1TK5 A;  4KHY A;  1ASW A;  2D0C A;  4CJW A;  1WSG A;  4DTO A;  4NYF A;  4DQI A;  1ZBL A;  3ALY A;  3TAB A;  4BWM A;  4C8M A;  2P51 A;  4H4M A;  4CJR A;  2VWJ A;  3U3Y A;  2KZZ A;  4M3T A;  1HNV A;  3LAN A;  4F2R A;  3V6D A;  1RT1 A;  3WNE A;  3TAG A;  2GV9 A;  1ASU A;  2OPP A;  4FM2 A;  3ZSQ A;  2XRI A;  3SUQ A;  4GW6 A;  4N47 A;  4N56 A;  1CLQ A;  4Q0B A;  3SYZ A;  1HRH A;  1UOC A;  4PQU A;  1RT4 A;  2OPR A;  5J2M A;  4K8X A;  2FBV A;  4WE1 A;  1KFD A;  3P83 D;  3ISN C;  1X1P A;  4RW8 A;  4CF2 A;  3OJS A;  5C42 A;  4KB0 A;  4B9T A;  1LW0 A;  1NK0 A;  4BE0 A;  1NOY A;  4DTJ A;  3S3O A;  4DFJ A;  3SUN A;  1UA0 A;  1J54 A;  3CFO A;  3V1Q A;  1KSP A;  5SWM A;  2PZS A;  1JLB A;  4DTR A;  1W0H A;  4CGH A; 
#chains in the Genus database with same CATH topology
 4U7B A;  3E1Y A;  3MXM A;  3MN6 A;  1B92 A;  3P31 A;  1LWE A;  3F9K A;  3B6O A;  3ZT4 A;  4KFB A;  4H03 B;  4FL9 A;  2A3Z A;  4IWV A;  3FFI A;  2ATQ A;  3DWL A;  4B8A B;  2CGJ A;  2P9N A;  3C7N B;  2GWJ A;  4GVE A;  3CQY A;  1VRU A;  4IFE A;  5KI6 A;  3W3D A;  1QSY A;  3LDQ A;  3M8Q A;  3RWU A;  4E1N A;  2VWK A;  1EWQ A;  2UXD K;  1VQN N;  1OH7 A;  1NLV A;  4FZY A;  4KV8 A;  1HLU A;  2NRT A;  3C65 A;  4DUZ K;  3CCR N;  3D45 A;  4OO1 J;  3ZT1 A;  1WLJ A;  1JLE A;  1VSH A;  2ZF5 O;  4NYN A;  2FXU A;  2Q1N A;  4DTM A;  3WUH A;  2ZD1 A;  2NRZ A;  4CJU A;  5KRT A;  4UQG A;  3DLK A;  3WNG A;  3CCL N;  1LOT B;  1DGK N;  3KKR A;  2D0O A;  4AF1 A;  3P38 A;  1WSF A;  2Z1I A;  3HZ6 A;  4FW2 A;  1ZBI A;  4N76 A;  1X3N A;  2WUS A;  3O80 A;  3O4W A;  1T44 A;  1O13 A;  1KRP A;  1VQP N;  2J4R A;  4HWI A;  3CF5 L;  3IS9 A;  3ZCM A;  4DTS A;  5BPN A;  3PV8 A;  1C0F A;  1MU2 A;  3OYN A;  4JV5 K;  5BPL A;  5HRN A;  4J2D A;  3J80 O;  3KLI A;  4CJE A;  5I3U A;  1SL2 A;  1EKE A;  1KLN A;  4BRA A;  3FGU A;  3O3F A;  4B9S A;  4HTL A;  3QBW A;  1IBK K;  4IDK A;  3S3M A;  4CZK A;  3IAY A;  3AVF A;  1VSM A;  3R3L A;  3DMJ A;  3NVK A;  3DM2 A;  4CD3 A;  5BRH A;  3V1R A;  1KAX A;  3HM8 A;  4CK1 A;  5GIN A;  2Q0R A;  4CHQ A;  2YV0 X;  3KTQ A;  4ICL A;  4CZE A;  4J2B A;  4JN4 A;  3CQ8 A;  3MXI A;  4WF9 L;  3S3N A;  4I9Q A;  2NRR A;  4I2Q A;  1S72 N;  3E01 A;  4B08 A;  3MK6 A;  1JXE A;  1KAY A;  1NJY A;  2CGL A;  1NWK A;  1P90 A;  4JKD A;  1NG9 A;  1SL1 A;  3AVM A;  1W2B M;  4MDB A;  4BQL A;  3G6E N;  2QKB A;  1VSF A;  3BZC A;  1L3S A;  4WFA L;  1S1V A;  1TUY A;  4LH4 A;  2NRH A;  3AVB A;  2GWK A;  3N4P A;  1NK7 A;  1YUW A;  5FRO A;  3J7Y P;  5AQK A;  1YAG A;  2CH5 A;  3OYC A;  3I8D A;  4BDP A;  2F9W A;  3KK1 A;  4JI6 K;  4YNQ A;  2HB5 A;  2NZT A;  1NGB A;  1QHT A;  3JAM O;  3R6M A;  1C0U A;  4LD0 A;  3KWG A;  1NGC A;  3VQD A;  3P39 A;  1ASV A;  1JXB A;  3NCI A;  4ILH A;  4CIG A;  5CZ1 A;  3PUF A;  4CBX A;  1A5W A;  3QET A;  1N8R O;  2BH1 A;  3V1O A;  1QTM A;  2G8I A;  4E1J A;  4IEE A;  4CFB A;  4BC5 A;  4JS5 A;  3A5M C;  4XIU A;  4CHY A;  3QNO A;  3GL1 A;  3D7E O;  3C0B A;  3V4I A;  1YVU A;  3SNN A;  4PWD A;  3RR8 A;  4RW9 A;  2HBM A;  3KK3 A;  4DMN A;  3KD5 E;  3UB5 A;  1TYQ A;  1QHA A;  2BTF A;  3VMF B;  3OYA A;  2XY7 A;  4HVJ A;  5TKY A;  4CEA A;  2G8V A;  3AO5 A;  3NF9 A;  2UXC K;  3RMD A;  4FVU A;  4CJ7 A;  4M41 A;  1T03 A;  3J7Z O;  1XHX A;  1SL0 A;  4JI5 K;  1J5E K;  4V19 S;  2YHA A;  1HNX K;  3KHY A;  2YHX A;  4L8R B;  3SBG A;  3E66 A;  3LWL A;  3ZET B;  4FVM A;  1NK6 A;  2V52 B;  1HYS A;  4JEP A;  3CCJ N;  3H45 C;  4YOU A;  3V81 A;  1BIZ A;  1SAZ A;  5JVH L;  1YHQ N;  1NJX A;  3UKR A;  2F4V K;  3KWI A;  1FW6 A;  4BRL A;  4O0I A;  3TAM A;  4W5N A;  1BUP A;  1BIU A;  4KH4 A;  3M5R A;  5AQI A;  2FSJ A;  4B3M K;  3CQX A;  2X78 A;  4PKI A;  1KVA A;  4QS7 A;  1HYZ A;  1ATR A;  2IIR A;  3LAL A;  4B9U A;  2RN2 A;  3RMA A;  3VEY A;  2GTD A;  1NK4 A;  2AA4 A;  4CF9 A;  4H0Y B;  2ZGZ A;  1K8K A;  4M3X A;  4CEC A;  1ZBS A;  2A1R A;  2IDO A;  4WQ5 A;  4JRP A;  3WT0 A;  1BCM A;  2EWS A;  3TSP A;  2DTU A;  3KKS A;  3HM9 A;  1J53 A;  3F73 A;  5J2P A;  4M3U A;  4ZHR A;  3NFA A;  1RBR A;  2OTL N;  4JS4 A;  4FWM A;  3OW2 M;  3C6T A;  4ILG B;  2P5O A;  2P9I A;  4OKJ A;  1OKJ A;  4CGF A;  2ZGY A;  2G8W A;  4RG8 A;  1N36 K;  1QQM A;  3K5N A;  4LF7 K;  1XNR K;  3HO1 A;  4QS8 A;  1EWR A;  3L3V A;  3WNF A;  3I33 A;  4GNI A;  1RBU A;  4G9Z A;  5AQP A;  2UUC K;  3D2F A;  1HQE A;  2HST A;  4XH1 A;  1SKS A;  5DM6 L;  2JLE A;  1OH6 A;  1YF5 L;  2P9N B;  3CJ7 A;  4CES A;  3OJU A;  2O8D B;  3TTF A;  3D2E B;  3AVH A;  1RBS A;  1NBW A;  2VYP A;  2QTD A;  3ZEU A;  5AQS A;  3ZSW A;  3RRH A;  1Q18 A;  4YOV A;  1NK5 A;  1XHZ A;  2GUP A;  2HHQ A;  2FF3 B;  1JCF A;  1Z26 A;  3RTV A;  1IKY A;  2QK9 A;  2Z1H A;  3VEZ A;  4JK7 A;  2HBK A;  2BE2 A;  3VEN A;  3NH2 A;  3CCU N;  1U49 A;  3BF1 A;  2HHH K;  2I5J A;  3DRS A;  3MXJ A;  1K73 O;  2I7N A;  4CED A;  3CG7 A;  4IXC A;  1D5A A;  5HL7 L;  3VES A;  4O55 A;  3A2F A;  1W97 L;  4FJN A;  4H0X B;  4H5W A;  4B1Y B;  1U45 A;  4CW7 B;  3OYB A;  2E1Z A;  1N6Q A;  3HST B;  3FLC O;  4PA1 A;  2ZE2 A;  4ISG A;  3MEE A;  3SMS A;  4XH4 A;  3JYT A;  4KI4 A;  4BG9 A;  2UUA K;  4DHY A;  2ZJP L;  2F7T A;  3EYZ A;  2FF6 A;  1I39 A;  1NKB A;  1Q7Y O;  3BF3 A;  3M6G A;  1YT3 A;  4RW7 A;  1R59 O;  2Z1G A;  4M7Y A;  4DB3 A;  1NGG A;  1XC9 A;  3FZM A;  2A6A A;  3ID8 A;  4Z4G A;  1IV0 A;  3BGR A;  4CJ3 A;  3DYA A;  4FJ5 A;  4JAX A;  3AA2 A;  3UE5 A;  3NGI A;  3V9S A;  3QFU A;  1L3U A;  1Q9X A;  4M3Z A;  1DTQ A;  1X3M A;  2P5G A;  4F9O A;  1U4B A;  4KO0 A;  1GOA A;  4FWL A;  4G1Q A;  2VG7 A;  3EKS A;  3OBW A;  1NK8 A;  4Y0W A;  3SV4 A;  2HMI A;  4IKF A;  2OPS A;  2F8T A;  3C95 A;  4JKF A;  4DQR A;  3QIN A;  4M3Y A;  1T05 A;  4B3R K;  3M1F A;  2UYT A;  4HCC A;  3ENO A;  3VQ9 A;  3CM6 A;  5M1N A;  4JRQ A;  2UU9 K;  3MED A;  4CZG A;  4IG3 A;  2XY8 A;  4EP4 A;  4CZF A;  3AA3 A;  4B3O A;  3LPU A;  3ZT3 A;  3C94 A;  2HNZ A;  1TKX A;  3OA9 A;  1RDD A;  3VQP A;  4KHY A;  1NGI A;  1WSG A;  5C2F A;  3EE8 A;  4DTO A;  1W7A A;  2GEL A;  3O1W A;  2P51 A;  3U3Y A;  4CJR A;  2W41 A;  3BP8 A;  3LAN A;  1Z05 A;  4B1U B;  5KQ8 A;  3ZX2 A;  4N56 A;  3O9S A;  4Q0B A;  4CVN E;  3WXM B;  1UOC A;  3QBX A;  1KFD A;  3ISN C;  3ULE B;  1VHX A;  4KB0 A;  5C42 A;  4B9T A;  4BE0 A;  3S3O A;  3SUN A;  1J54 A;  3V1Q A;  5SWM A;  4DTR A;  4CGH A;  4CZL A;  1XMQ K;  4AHT A;  4BR7 A;  4ELU A;  4H0P A;  3M8R A;  1S1U A;  4IO9 L;  4FOE A;  4CHO A;  3T1A A;  4ZTF A;  4EZ6 A;  3HOS A;  1E4G T;  2HVI A;  3CC2 N;  4DR1 K;  1SV5 A;  1RTH A;  5M1O A;  4NCG A;  1R0A A;  1BI4 B;  2XHB A;  3IMX A;  3K0S A;  1C1C A;  1GLF O;  5SZT A;  5I42 A;  1TYQ B;  3LDN A;  3P1G A;  2HF3 A;  1Q9Y A;  4JKH A;  3ZSX A;  1HX1 A;  2QM1 A;  4DFM A;  3AA4 A;  4KHU A;  4E3S A;  2ZWH A;  4BC4 A;  5GIO A;  5IT9 O;  1P8Z A;  3VGM A;  1KC8 O;  1YTA A;  2KFN A;  3LZI A;  4JKE A;  4FLW A;  3J7A P;  3OHR A;  5FDL A;  2X74 A;  3L2W A;  1WBD A;  4EHU A;  5C12 A;  2G8H A;  1I3A A;  2W6K A;  3UKR B;  4JD2 B;  4FWO A;  2D4W A;  2F9T A;  4IFV A;  3QES A;  4JI8 K;  3K58 A;  2E88 A;  3WQU A;  5M1Q A;  3TSU A;  1O1W A;  5GAH P;  3CCE N;  1C0G A;  5AQH A;  4K43 A;  4AHC A;  2IC3 A;  4E89 A;  4C8N A;  3G25 A;  3O6W A;  4CD1 A;  4J2E A;  1E3M A;  3ZX3 A;  4E7H A;  5DMR A;  1K8K B;  2PAV A;  3VQQ A;  4BRO A;  1BA1 A;  2FSK A;  3DXM A;  4CFC A;  3V9W A;  1DTT A;  4CEZ A;  4DLG A;  3T7Z A;  4E0D A;  4DR4 K;  4DTU A;  5GAG P;  1TVR A;  3QER A;  4DFK A;  3GBT A;  4LSN A;  4BRI A;  5HLF A;  1TGO A;  2WBN A;  4N5S A;  3AAR A;  4E7I A;  4Y1D A;  4Q5V A;  3SUO A;  3HI0 A;  4B9N A;  5CE3 A;  3I0S A;  3L8B A;  4ID1 A;  3SI6 A;  1L5U A;  1KVB A;  2ZQB A;  2E2O A;  2VGN A;  3D2F B;  2WON A;  1HQU A;  2G8K A;  4BR0 A;  3SQ4 A;  2RF2 A;  2F8S A;  5AQQ A;  3PLA A;  1EXQ A;  3CJC A;  4OLA A;  1Z25 A;  3NAE A;  3I0R A;  3KLG A;  2O8F A;  2EHG A;  3OS2 A;  2XO7 A;  4RW6 A;  4DTN A;  3SPZ A;  1KTQ A;  3V9X A;  3VQ8 A;  3DI6 A;  5LMU K;  4KH6 A;  3NH0 A;  1T3V A;  4IBN A;  4B1V A;  4FLX A;  3VQ6 A;  4HUG A;  1XC3 A;  1RGI A;  4DR7 K;  3O3G A;  4BE1 A;  4BY9 C;  4F3T A;  3DLH A;  4B9Q A;  5H1S Q;  4EZ9 A;  3O9U A;  2RE2 A;  5C0Y A;  3PSF A;  4DF8 A;  1SKR A;  2O8D A;  4CI6 A;  3D2E A;  1BL3 A;  5FPM A;  3P5J A;  3A8Y A;  5JS1 A;  5BRE A;  5GAD P;  4HHT A;  1SQK A;  4CFA A;  3L2U A;  4Z94 A;  5CR4 A;  3L2R A;  2V7Y A;  3VA3 A;  1RT7 A;  4ID5 A;  2YNI A;  1J5O A;  1Q8I A;  4I9L A;  1JCG A;  3LDO A;  2KKZ A;  4FM0 A;  2P9K A;  5F0X A;  4DG1 A;  2D5R A;  1GLL O;  4I7F A;  1EO1 A;  1ESV A;  2FLO A;  3HL8 A;  1LW2 A;  4FJ9 A;  3J81 O;  4WCE L;  4FLU A;  3AVL A;  2QWM A;  5IWA K;  4CGG A;  2W42 A;  5TKW A;  4YOR A;  1IBM K;  1HPZ A;  4PY5 A;  1VQ6 N;  1YIJ N;  4A5B A;  4C23 A;  1IO2 A;  3O3H A;  4CCH A;  4UY8 O;  1LV5 A;  1T7P A;  4BG8 A;  5EXW A;  1U04 A;  3U8X A;  1ZYQ A;  4JI2 K;  3ZX0 A;  3SPY A;  3OVN A;  2HF4 A;  4TSX A;  3SJJ A;  5JMV A;  1MDU B;  3FZF A;  2A40 A;  3CJ1 A;  3CMA N;  3R9P A;  4CZI A;  3M8S A;  1N33 K;  5ELZ A;  4OPJ A;  1NGA A;  3IFR A;  4JK8 A;  2P9U A;  2X6S A;  1TL3 A;  5D3G A;  5AQG A;  2KLA A;  3K5O A;  1B9F A;  3LP0 A;  1WSI A;  4W5T A;  4OKK A;  4CJV A;  4RCH A;  5AZJ A;  3TU5 A;  2KFZ A;  4CZH A;  5GAE P;  3HBT A;  1BQN A;  2DPN A;  4DQQ A;  4NCB A;  2Y1J A;  3PX4 A;  3VGK A;  3MAQ A;  3EN9 A;  3NMU A;  4JI1 K;  4CEO A;  3T19 A;  1IH7 A;  3LL3 A;  4BRF A;  3K9J A;  2ZJR L;  3LAK A;  3NGZ A;  2YJE A;  4IFY A;  4F2S A;  2Q2R A;  4FWR A;  3AA5 X;  2KHO A;  3KIO A;  2IAJ A;  2E20 A;  1KD1 O;  1LWC A;  1EX4 A;  1QSS A;  1KVC A;  3FE1 A;  4CBU A;  3HXM A;  4N41 A;  1HMV A;  4FLZ A;  3S9H A;  3DRP A;  3OYH A;  5HRS A;  2Z1J A;  4JI0 K;  4CJF A;  2QWO A;  2UUB K;  3ULE A;  3WNH A;  5AQZ A;  1SKW A;  4CFD A;  4F4K A;  4FJJ A;  3CJ9 A;  4YOW A;  1NGF A;  4BWJ A;  1JL2 A;  3OYG A;  1WAF A;  1RDA A;  4A5A A;  5B8H A;  3P4I A;  3V9Z A;  1KAZ A;  3DLB A;  5A2Q O;  1MA9 B;  4IJN A;  1JJ2 M;  3MCP A;  3IKM A;  1FKO A;  4CE9 A;  3H46 O;  1BI4 A;  1RDU A;  1MWM A;  4FWN A;  4C8O A;  1CXQ A;  4E7L A;  1HNZ K;  4M63 C;  3DAW A;  2V7Z A;  2FC0 A;  3V9U A;  4DU3 A;  3FFK B;  2DFH A;  1NJZ A;  3SMP A;  1U47 A;  2Q3S A;  2E2N A;  4XH5 A;  1L3V A;  3SAG A;  1WAJ A;  5AQL A;  3HVR A;  4FJH A;  1IBL K;  1NMD A;  2YNF A;  2PYL A;  4O0J A;  4LY7 A;  5CYM A;  4Z0U A;  3THX B;  3HYF A;  3OS0 A;  3VTI A;  3SQ0 A;  2ETJ A;  4KTW A;  3D6R A;  4E7J A;  4DSI A;  2KZM A;  1EQY A;  1G99 A;  1VQM N;  3DXM B;  1T8E A;  3A5N C;  4ILJ A;  3ATU A;  4DCH A;  3PX6 A;  4JD2 A;  3VQ4 A;  4MDA A;  2Q31 A;  1VSD A;  3VEV A;  1K8A O;  3L4Q A;  4IG0 A;  4MLE A;  1WB9 A;  4LFB K;  5AQF A;  3AY9 A;  3H3O B;  1N34 K;  3KLE A;  1JL1 A;  3EL2 A;  1RIL A;  2AJQ A;  3CET A;  1A5X A;  1BG3 A;  2GEM A;  4M45 A;  4HCB A;  5FPD A;  4OPK A;  4NXN K;  1JLC A;  4H5V A;  3CYM A;  4BR9 A;  1N5Y A;  2R7Y A;  3WEE A;  4W5O A;  4DSE A;  1D9F A;  1SZ2 A;  2VGM A;  4CJP A;  3MEC A;  1S9E A;  3EE9 A;  5DM7 L;  4AQY K;  1WSH A;  4ELT A;  5HRR A;  4CK2 A;  5HP1 A;  3ZSR A;  2O8F B;  2KTQ A;  3HPH A;  1LAW A;  1RTJ A;  5AQN A;  2QWQ A;  5MLC Q;  1TK5 A;  5AQT A;  1TUU A;  2D0C A;  4NYF A;  4CZM A;  1GLD G;  2ZJQ L;  4C8M A;  2KZZ A;  4H4M A;  4WQ5 C;  1HNV A;  4F2R A;  3WNE A;  3SUQ A;  1BDG A;  1GLJ O;  4IOC L;  1HPM A;  4JKG A;  3WXL A;  3SYZ A;  1HRH A;  4PQU A;  5J2M A;  2E1Y A;  2FBV A;  4WE1 A;  4K8X A;  4RW8 A;  4CF2 A;  3OJS A;  4LFC K;  1HUX A;  1NK0 A;  3WXI A;  4DTJ A;  1UA0 A;  3CFO A;  2IVO A;  1KSP A;  3N4Q A;  2PZS A;  1K9M O;  2IVN A;  1ZXO A;  1W0H A;  4FCY A;  3G4S N;  1FXX A;  1VQ8 N;  1DKG D;  5JS2 A;  3THV A;  4NCA A;  3LDL A;  3TI0 A;  3KVG A;  3LZJ A;  2P1J A;  1RTI A;  5LL6 Z;  1Q82 O;  4FXD A;  2HHV A;  1XUP O;  3CER A;  1QE1 A;  3TSQ A;  2OZM A;  2HMP A;  2B5J A;  3VF6 A;  5E41 A;  2P9K B;  3BY5 A;  1RCH A;  1KLM A;  2E6M A;  3OYI A;  3F2K A;  1HKB A;  3NGY A;  1YXQ A;  2G8F A;  3NH1 A;  4KTQ A;  1ZC6 A;  4B3S K;  3CME N;  3CFP A;  1VQL N;  3AO2 A;  3CIP A;  4R5P A;  2ITG A;  3BDP A;  4FJX A;  2P9P A;  1TAQ A;  4K25 A;  4B9V A;  3K57 A;  2ASO A;  5FRM A;  1S1W A;  4F3O A;  4IJA A;  2X6N A;  3H6E A;  3TAE A;  3U9Z A;  4FK0 A;  5FPN A;  4LF9 K;  4KHS A;  2ZM6 K;  2NNW A;  3EEQ A;  4BRD A;  4BRM A;  4DSK A;  2BUP A;  1WUA A;  1L3T A;  4BRN A;  4LSL A;  2P9U B;  4KHQ A;  1RT2 A;  1WN7 A;  3I8B A;  3CCV N;  4CEB A;  1E4F T;  1NNE A;  4OKE A;  3PX0 A;  5M1K A;  4GKK K;  1GLE G;  4KH5 A;  1FJG K;  3OTO K;  5AZJ B;  4JI7 K;  4FWP A;  4KPY A;  1RBT A;  3VF2 A;  4O4G A;  2O8C A;  3FZL A;  2HBJ A;  3NF6 A;  5LJW A;  1JLF A;  1IKX A;  4ZTJ A;  3OYE A;  4CEE A;  4X66 K;  3THW A;  1OVQ A;  3L4I A;  3NF7 A;  4AM7 A;  1VQO N;  3B8A X;  1YIT N;  4CIF A;  4YOX A;  2QWN A;  1BHL A;  4BRH A;  4DR6 K;  4MLH A;  3J8A A;  4DV7 K;  3CCS N;  1J6Z A;  4CJQ A;  3VEX A;  4DUY K;  5EX5 A;  3AGR A;  4FWS A;  1C1A A;  4CGJ A;  1IKW A;  1GOB A;  4E1M A;  1SS6 A;  3AVJ A;  3VQB A;  4CGI A;  2AP1 A;  2RPI A;  5AQM A;  4BRQ A;  3NF8 A;  2XY5 A;  4JLH A;  1TKT A;  5C24 A;  4MO5 A;  3VQ5 A;  1Z6R A;  1BCO A;  3A5L C;  3GDQ A;  2E8A A;  3OY9 A;  4B3T K;  3VQE A;  5AQY A;  2QI2 A;  2EX3 A;  3LP2 A;  4ISF A;  1QVF M;  4DV4 K;  4H5T A;  4A62 A;  4CF8 A;  2O8B A;  4Z4C A;  3PY8 A;  2HVH A;  3LAM A;  4Z4H A;  2GBZ A;  3AVA A;  4DV3 K;  4BR5 A;  4XEI A;  1RTD A;  3CXC M;  3U6F A;  3ZSO A;  4YY3 K;  3EY1 A;  2VG6 A;  5C25 A;  2W40 A;  1IKV A;  3VEO A;  3DRR A;  4BC2 A;  3VQC A;  4DQS A;  4M3W A;  3THY A;  1WBB A;  1ITG A;  3GG4 A;  4DQP A;  5BRD A;  3RSE B;  5BR9 A;  3O4N A;  3PIO L;  1JLG A;  2D0A A;  4FJ7 A;  3LWM A;  3BUZ B;  2FBT A;  4CER A;  4WQ4 A;  4FSV A;  4EIA A;  1QSL A;  4GY2 B;  1LAV A;  3OYL A;  4B9L A;  3LM2 A;  2E2Q A;  4AHR A;  1RDW X;  4YFU A;  1WOQ A;  2DY4 A;  2E4L A;  4IEI A;  5KGX A;  3L6Q A;  4BVP A;  3KLH A;  3U4L A;  5HOO A;  2JGU A;  3QB0 A;  5BN8 A;  2VQF K;  1ATN A;  2YKN A;  3T3F A;  3THX A;  3ZT2 A;  4WQ4 C;  3OYK A;  4A2A A;  2YX6 A;  3WEE B;  1C6V A;  1S6Q A;  4O5F A;  3SV3 A;  1X9W A;  5HRO A;  3M3Z A;  4MFB A;  4HTU A;  3TTD A;  3U9D A;  4BRK A;  3JS6 A;  4E7K A;  2HBL A;  2Q0U A;  2W6L A;  2IS3 A;  1DT9 A;  3E9O A;  1XMO K;  3CI5 A;  3M8P A;  1VQ9 N;  3L3U A;  3R1X A;  3EO3 A;  4JNE A;  1S6P A;  2QEX N;  4GV6 A;  2HHS A;  1BA0 A;  3H1Q A;  4B9M A;  2LSN A;  3TAP A;  3KD1 E;  4FK2 A;  3MN9 A;  3VF4 A;  3CHW A;  2PY5 A;  5E84 A;  2GUI A;  4IOA L;  3QEX A;  4DSJ A;  5CZ2 A;  5AQJ A;  4O8U A;  4L3Q A;  4CEF A;  1ILY A;  4FPB A;  4JKG B;  1VQ4 N;  5C10 A;  1C0M A;  1QQN A;  3AVK A;  3AVN A;  3VET A;  3LP3 A;  5J2Q A;  4IO8 A;  5CHI A;  4I6M A;  2D0P A;  2FBX A;  3WXK A;  2P9L A;  2OZS A;  3QIO A;  1NKE A;  2VCP A;  3GE1 A;  3MN5 A;  3ZYY X;  4KRF A;  4QCL A;  4LH5 A;  4JI4 K;  4NLC A;  4A59 A;  1BU6 O;  4KAZ A;  1BIS A;  3K5L A;  3WXJ A;  2ITM A;  3O08 A;  1EET A;  4BAC A;  4BGB A;  3E9P A;  4CJS A;  3KZB A;  3FZH A;  5BRF A;  3Q7C A;  2BAN A;  5HRP A;  3ASM A;  4B1X B;  4FYD A;  4EHT A;  3OBY A;  1VSE A;  1NGE A;  3F9M A;  3QEW A;  1YTU A;  5KPR A;  3VER A;  4WFB L;  4NO7 A;  4FO0 A;  5AJ3 K;  3IRX A;  1NGJ A;  4J8F A;  4KB1 A;  4AIL C;  1G15 A;  1T6C A;  4FJG A;  1NJI O;  2P9P B;  1C0T A;  2Q36 A;  3A5O C;  4ISE A;  1QZ5 A;  4Z4F A;  3TAF A;  5JIC A;  4BR4 A;  1Q86 O;  5BR8 K;  1Y97 A;  3VA0 A;  2HW3 A;  4PKG A;  1REV A;  1HNI A;  3ZSZ A;  2YHY A;  4W5Q A;  4FLY A;  3G71 N;  4AM6 A;  4CEQ A;  2PFU A;  2O4I A;  2QWL A;  3K9K A;  4FLT A;  1MWK A;  1NJW A;  4GVM A;  3H08 A;  3ZSV A;  4LF4 K;  5KRS A;  4DU1 A;  1TKZ A;  4U67 L;  2O8C B;  4DU4 A;  3ZT0 A;  4GMJ B;  3G0Z A;  2OCE A;  3PIP L;  1D4X A;  3T69 A;  1DLO A;  3HPO A;  3THW B;  3TPQ A;  3HPG A;  4BC3 A;  3ATV A;  1VK0 A;  3HVT A;  3QNN A;  1SUQ A;  1U48 A;  1S1X A;  4MO4 A;  3AAQ A;  3MN7 A;  3HK2 A;  5AZI A;  4E19 A;  3CM5 A;  4DV1 K;  2FBY A;  4PL8 A;  3CC7 N;  4PUO A;  1V4T A;  3SAF A;  3VTH A;  3DLE A;  1RT3 A;  3EZW A;  3ULD A;  1HNW K;  1ZBH A;  3SUP A;  2P9S A;  3UKU A;  4X64 K;  3HRG A;  4CJT A;  3AVI A;  4DFP A;  1X9M A;  1TKD A;  2BDP A;  1VRT A;  2A1S A;  3QIP A;  4CJ4 A;  4HUF A;  2OTJ N;  4KI6 A;  4K0K K;  5BN9 A;  4DQI A;  4JKB A;  2E5L K;  1I94 K;  4BWM A;  4DV5 K;  2VWJ A;  4R79 A;  4LC9 B;  4M3T A;  3V6D A;  2GV9 A;  2OPP A;  4FM2 A;  5BPM A;  2YI1 A;  3ENH A;  4BGA A;  4GW6 A;  4N47 A;  1KQS M;  1CLQ A;  3ID6 A;  4X65 K;  4A2B A;  3O5B A;  1RT4 A;  4BVO A;  3NVM A;  2O8B B;  3VOV A;  4PL7 A;  4DFJ A;  2GX9 A;  3H1V X;  3H3N O;  3C6H A;  2JWL A;  3E9L A;  3L2V A;  1NKC A;  2O4G A;  4NB4 A;  4FJI A;  4M42 A;  3THY B;  3EZ5 A;  2YKM A;  5CY4 A;  4IDH A;  5KPT A;  2E6L A;  1VSK A;  4B8C A;  3QEP A;  4FOI A;  1RBV A;  2D1K A;  1VSI A;  3AVG A;  4LF8 K;  3F5T A;  5EOY A;  1C1B A;  2ASM A;  3WQT A;  2PYJ A;  1TK0 A;  1CXU A;  4CIE A;  4GKJ K;  3LDP A;  2D0B A;  3VEW A;  3JXU A;  1RFQ A;  2A42 A;  3QLH A;  3OS1 A;  3VPZ A;  4OPH A;  2CH6 A;  3VQA A;  3QIC A;  4IOX A;  4AHS A;  4B1Z A;  4RWT A;  2YHW A;  4CJL A;  3JSM A;  1RNH A;  4BR2 A;  3QFP A;  4F8R A;  1B9D A;  1KFS A;  4YDU A;  4CK3 A;  1U6Z A;  5AFU A;  4KRE A;  2HHW A;  3MX2 A;  2OAN A;  3RSE A;  3W0L A;  2RHK A;  2OPQ A;  4FPA A;  4DQ8 A;  4DSL A;  3MWT A;  5EY4 A;  1CZ9 A;  2B4J A;  2QKK A;  2HOE A;  3CJB A;  4YHH K;  4J2A A;  3Q7B A;  1J9A A;  4FLV A;  1Y64 A;  1WSJ A;  4OLB A;  3MWP A;  1JLA A;  5AQX A;  4C1N K;  3MDQ A;  2IOC A;  1TK8 A;  3CPE A;  4YDU C;  3MCA B;  4RW4 A;  3MMV A;  4OGC A;  1S22 A;  2BGG A;  3K5M A;  4CF0 A;  4OVL A;  1NM1 A;  4KKO A;  2V51 B;  3R8E A;  4LF6 K;  3DXK A;  4H4O A;  4GV3 A;  1M90 O;  2YNH A;  1RT6 A;  1D8Y A;  1BQM A;  4HUE A;  3PSI A;  1EP4 A;  2YHB A;  1OVY A;  5AQU A;  2Y1I A;  5AR0 A;  3HOT A;  3VQ7 A;  4FJL A;  3NDK A;  5JVG L;  4RTF D;  1HJO A;  3B6P A;  4OX9 K;  3VGL A;  1BOT O;  4YOY A;  3IDH A;  4FWK A;  3I55 N;  3AVC A;  4I6M B;  1VSJ A;  4X62 K;  4DR2 K;  4PKH A;  1TL1 A;  2P9L B;  3BEX A;  4CHP A;  4CGD A;  3C6A A;  3HP6 A;  3OYF A;  1U2V B;  1F21 A;  1NOZ A;  1VQ7 N;  1GLA G;  3CD6 N;  3C6U A;  5AFU H;  1QZ6 A;  4JHD A;  2NLX A;  3CPW M;  3QO9 A;  2UXB K;  1S3X A;  4WYB A;  4OJR A;  4QOZ B;  1RT5 A;  4DV0 K;  2B6A A;  5T7B A;  3LPT A;  2FSN A;  2YJF A;  4KHP K;  1HKG A;  1FK9 A;  4DR3 K;  3EKU A;  3LP1 A;  1X9S A;  4CJK A;  1LWF A;  1GOC A;  3SLC A;  2OA8 A;  2RKI A;  3D0P A;  4W5R A;  2JWK A;  3T1Y K;  4JK9 A;  4BRG A;  3QEI A;  4H5N A;  5F1X A;  1XQS C;  3FZK A;  3CCQ N;  2O8E A;  5KPZ A;  4CHZ A;  1IG9 A;  5FLX O;  3K2P A;  3OYM A;  4M3R A;  2A41 A;  2XY6 A;  3HT3 A;  3AO4 A;  3AGK A;  3O9Q A;  1UAX A;  2QXF A;  1TAU A;  1M1K O;  4FM1 A;  4CZJ A;  2QWR A;  3MX5 A;  4BRP A;  2YNG A;  2OYQ A;  1KXP A;  4A61 A;  2WOM A;  3S41 A;  4H0T B;  4IZ9 A;  4EP5 A;  4FJM A;  4FJ8 A;  5AQW A;  4O44 A;  3ZLJ A;  4GV9 A;  4BE2 A;  3DLG A;  5M1F A;  3TAR A;  3L2Q A;  4KHN A;  4CBW A;  3C7N A;  3AO3 A;  4Z4E A;  4DSF A;  5GIP A;  1VAZ A;  4EFH A;  5J2N A;  4QAG A;  2NUB A;  2ASP A;  2YCH A;  2I7P A;  1ZBU A;  1N32 K;  3ENB A;  4DWI A;  2QWP A;  4B1W B;  3PO4 A;  3OYD A;  1YJW N;  3IUC A;  1CZA N;  2QXL A;  3DLL L;  3QDK A;  5CYQ A;  4CHN A;  5JLH A;  4DV2 K;  5KQD A;  2WC9 A;  3SBT A;  1RDC A;  2H3G X;  4KBO A;  1RDB A;  1D9D A;  5AZI B;  1BGX T;  5M1P A;  2HHX A;  1KCF A;  5DK5 A;  1K6Y A;  3A0I X;  1HKC A;  3ZSY A;  5JLF A;  5C15 A;  3K59 A;  1VQ5 N;  2P9S B;  3TTC A;  4QS9 A;  3CCM N;  1JKH A;  3UKU B;  2Q97 A;  4DLE A;  4LFA K;  1ATS A;  1W9H A;  1VQK N;  3SCX A;  3RR7 A;  4FZZ A;  4Y1C A;  3O1B A;  2G8U A;  3SAH A;  4DKW A;  3DJC A;  3UIQ A;  1VSL A;  3LDS A;  3PO5 A;  4BQZ A;  3RRG A;  4MQ3 A;  2HHT A;  2CGK A;  4DR5 K;  4O8K A;  3HJF A;  3G10 A;  4FK4 A;  4DTP A;  1ZBF A;  3TAN A;  2HND A;  4FWQ A;  5HBM A;  1NK9 A;  4BRC A;  3SZ2 A;  1XI1 A;  1S5J A;  3KK7 A;  4A57 A;  3O9R A;  1BO5 O;  2IVP A;  3AAP A;  3DOL A;  1CZB A;  1YVN A;  5FRN A;  4FW1 A;  2HNY A;  5J1E A;  5EVZ A;  2KQ2 A;  4FJK A;  4AH9 A;  4ELV A;  1BWF O;  3IG1 A;  3MEG A;  4K8Z A;  4I2P A;  3L0Q A;  2WFB A;  1X9J A;  1NGD A;  2F96 A;  4YOT A;  1FKP A;  1WNS A;  4DS5 A;  4AHV A;  5ADX A;  2VQE K;  4CF1 A;  3SK3 A;  3AO1 A;  3LM9 A;  2DFF A;  2DFE A;  1T6D A;  2KW4 A;  5KTQ A;  1YI2 N;  3CFR A;  1NMN A;  3AV9 A;  3HP9 A;  3GOI A;  4JKC A;  1GLC G;  4BDY A;  4C8K A;  1QS4 A;  1QQO A;  1OH5 A;  3TWH A;  4DS4 A;  5AQO A;  3HTV A;  5AQV A;  1YJN N;  5E26 A;  4NLB A;  3O4Q A;  4Z4I A;  5F2R A;  1TV6 A;  3FR0 A;  4OGE A;  2VG5 A;  4K42 A;  1WSE A;  4DTX A;  3HSC A;  3NHG A;  1XNQ K;  4AHU A;  1XWL A;  3TR8 A;  3ITH A;  5LY3 A;  1S1T A;  2A5X A;  2WTU A;  3KJV A;  2QA4 N;  4H5R A;  3VN5 A;  1JLQ A;  3DXK B;  5LMN K;  2NRV A;  4EAH D;  4JYA K;  2QW9 A;  1NU0 A;  3QEV A;  1JCE A;  3O9T A;  4KTZ A;  2IGI A;  4OPA A;  3RMC A;  4H8K A;  1OH8 A;  3CC4 N;  1HJR A;  5K14 A;  5LJV A;  3NBP A;  5C2D A;  1QQC A;  3O8M A;  1UWB A;  4BDZ A;  2NRX A;  3KLF A;  4KHW A;  5I9E B;  5FPE A;  4DF4 A;  5EU7 A;  4JI3 K;  3RMB A;  4C8L A;  5ADX H;  3ZET A;  3T1H K;  3QML A;  3KK2 A;  4O5B A;  3SQ1 A;  4CJ5 A;  1UA1 A;  4DV6 K;  3OYJ A;  2PBD A;  3CJA A;  1Q81 O;  1GLB G;  1HYV A;  1DEJ A;  4WFN L;  1H1V A;  3SQ2 A;  3DOK A;  4H0O A;  3TAQ A;  4M7X A;  4JHD B;  4H0V B;  2P9I B;  1LCU A;  3DLR A;  4K41 A;  1V4S A;  4LF5 K;  3SJH A;  2E2P A;  3U3G A;  5KGW A;  3ZSQ A;  3NE6 A;  2HHU A;  4PHT X;  1S9G A;  1A5V A;  1NGH A;  1ASW A;  4CJW A;  1ZBL A;  3ALY A;  3TAB A;  1RT1 A;  3TAG A;  1YJ9 N;  1QVG M;  1ASU A;  4NXM K;  2XRI A;  1U2V A;  2O8E B;  3I56 N;  2OPR A;  3RVC A;  3P83 D;  2NRW A;  1X1P A;  4C1N I;  1HR0 K;  1LW0 A;  1NOY A;  4BRE A;  4JKA A;  1IG8 A;  3BZK A;  3ZEU B;  2VWB A;  5AQR A;  1IJJ A;  1JLB A;  4FZX C; 
#chains in the Genus database with same CATH homology
 3L2V A;  4AHT A;  3MXM A;  1NKC A;  2O4G A;  4ELU A;  4FJI A;  1FXX A;  3M8R A;  1S1U A;  4M42 A;  1B92 A;  4ZTF A;  1LWE A;  3F9K A;  3T1A A;  5JS2 A;  4CHO A;  3THV A;  4EZ6 A;  3EZ5 A;  4NCA A;  3B6O A;  3ZT4 A;  2HVI A;  3TI0 A;  3LZJ A;  4KFB A;  2P1J A;  2YKM A;  1RTI A;  5CY4 A;  1SV5 A;  1RTH A;  2E6L A;  1VSK A;  4B8C A;  3FFI A;  4NCG A;  3QEP A;  1R0A A;  4FXD A;  2HHV A;  1BI4 B;  2ATQ A;  1RBV A;  2XHB A;  4B8A B;  1VSI A;  1C1C A;  1VRU A;  1QE1 A;  2OZM A;  5KI6 A;  5SZT A;  3AVG A;  5I42 A;  1QSY A;  2B5J A;  3M8Q A;  3P1G A;  5E41 A;  3RWU A;  1C1B A;  4E1N A;  2VWK A;  2PYJ A;  1TK0 A;  1CXU A;  4CIE A;  1RCH A;  1KLM A;  2E6M A;  3OYI A;  1Q9Y A;  3NGY A;  2D0B A;  2G8F A;  3NH1 A;  3QLH A;  3OS1 A;  3ZSX A;  4KTQ A;  4DFM A;  4KHU A;  3AA4 A;  4FZY A;  4E3S A;  3VQA A;  4AHS A;  4KV8 A;  4CJL A;  3JSM A;  1RNH A;  3CFP A;  3D45 A;  3ZT1 A;  1WLJ A;  4F8R A;  1JLE A;  1YTA A;  1B9D A;  1VSH A;  1KFS A;  2KFN A;  3LZI A;  4NYN A;  4CK3 A;  4DTM A;  4FLW A;  2ZD1 A;  4KRE A;  2HHW A;  4CJU A;  5KRT A;  4UQG A;  3DLK A;  3AO2 A;  3WNG A;  5FDL A;  4R5P A;  3KKR A;  2ITG A;  3BDP A;  4FJX A;  1TAQ A;  2X74 A;  3L2W A;  4B9V A;  2OPQ A;  4DSL A;  1WSF A;  3K57 A;  2Z1I A;  5FRM A;  4FW2 A;  1CZ9 A;  1ZBI A;  2B4J A;  2G8H A;  2QKK A;  4N76 A;  1I3A A;  4J2A A;  1S1W A;  4IFV A;  4F3O A;  1J9A A;  3QES A;  4FLV A;  1WSJ A;  3K58 A;  4OLB A;  1JLA A;  2X6N A;  3TAE A;  1TK8 A;  2IOC A;  1KRP A;  4FK0 A;  4KHS A;  4RW4 A;  1O1W A;  3IS9 A;  4OGC A;  4DSK A;  3ZCM A;  4DTS A;  2BGG A;  1L3T A;  3K5M A;  4LSL A;  3PV8 A;  4AHC A;  2IC3 A;  1MU2 A;  3OYN A;  4CF0 A;  4M3U A;  4E89 A;  4OVL A;  4KHQ A;  5HRN A;  4J2D A;  1RT2 A;  1WN7 A;  4KKO A;  4C8N A;  4J2E A;  3KLI A;  4CJE A;  4CEB A;  5I3U A;  1SL2 A;  1EKE A;  1KLN A;  4OKE A;  3PX0 A;  4E7H A;  4H4O A;  3O3F A;  5DMR A;  4B9S A;  3VQQ A;  2YNH A;  4FCY A;  1RT6 A;  1D8Y A;  1BQM A;  4HUE A;  4IDK A;  1EP4 A;  2YHB A;  4CFC A;  3V9W A;  3S3M A;  1DTT A;  4CEZ A;  4DLG A;  4E0D A;  3NE6 A;  3IAY A;  3AVF A;  2Y1I A;  1RBT A;  1VSM A;  4KPY A;  4DTU A;  3DMJ A;  4O4G A;  3VQ7 A;  3DM2 A;  1TVR A;  3QER A;  4FJL A;  3NF6 A;  4DFK A;  3NDK A;  3V1R A;  1JLF A;  4LSN A;  1IKX A;  4CK1 A;  5HLF A;  1TGO A;  3B6P A;  4ZTJ A;  4CHQ A;  2YV0 X;  3OYE A;  4CEE A;  3KTQ A;  4ICL A;  4N5S A;  4J2B A;  3NF7 A;  3CQ8 A;  4E7I A;  3MXI A;  4CIF A;  3AVC A;  3S3N A;  1VSJ A;  4Y1D A;  4Q5V A;  3SUO A;  1BHL A;  4B9N A;  1TL1 A;  3I0S A;  4CHP A;  4I9Q A;  3L8B A;  4CGD A;  4I2Q A;  3E01 A;  4B08 A;  4ID1 A;  3HP6 A;  3SI6 A;  1JXE A;  1KVB A;  2ZQB A;  3OYF A;  1L5U A;  1NJY A;  5HP1 A;  1F21 A;  2WON A;  1HQU A;  1NOZ A;  4CJQ A;  2G8K A;  3C6U A;  1SL1 A;  3SQ4 A;  2RF2 A;  1C1A A;  4CGJ A;  1IKW A;  1GOB A;  4E1M A;  3AVM A;  2F8S A;  1EXQ A;  3AVJ A;  3QO9 A;  4OLA A;  1Z25 A;  3VQB A;  3NAE A;  2QKB A;  4CGI A;  4OJR A;  2RPI A;  4QOZ B;  1VSF A;  3I0R A;  3NF8 A;  3KLG A;  1RT5 A;  2XY5 A;  1L3S A;  1S1V A;  4LH4 A;  4JLH A;  3AVB A;  2EHG A;  2B6A A;  1TKT A;  5C24 A;  5T7B A;  3LPT A;  3OS2 A;  2XO7 A;  4RW6 A;  3VQ5 A;  4DTN A;  3SPZ A;  1NK7 A;  1KTQ A;  1FK9 A;  5FRO A;  3V9X A;  3LP1 A;  1X9S A;  4CJK A;  3VQ8 A;  1BCO A;  3DI6 A;  1LWF A;  1GOC A;  3OY9 A;  3OYC A;  3NH0 A;  3VQE A;  3I8D A;  4IBN A;  2OA8 A;  2RKI A;  3D0P A;  4W5R A;  4FLX A;  2EX3 A;  3LP2 A;  3VQ6 A;  3QEI A;  4BDP A;  4HUG A;  3KK1 A;  3O3G A;  4BE1 A;  4YNQ A;  4F3T A;  3DLH A;  2HB5 A;  1QHT A;  4CF8 A;  4CHZ A;  1IG9 A;  4EZ9 A;  3K2P A;  3OYM A;  1C0U A;  4M3R A;  4Z4C A;  3PY8 A;  2HVH A;  4LD0 A;  2XY6 A;  3LAM A;  3HT3 A;  3AO4 A;  3VQD A;  4Z4H A;  1ASV A;  1JXB A;  2GBZ A;  3AVA A;  3NCI A;  4DF8 A;  1UAX A;  2QXF A;  1SKR A;  1TAU A;  1RTD A;  1BL3 A;  3P5J A;  3U6F A;  5JS1 A;  4CIG A;  3ZSO A;  5CZ1 A;  4FM1 A;  3PUF A;  1A5W A;  2VG6 A;  3EY1 A;  3QET A;  4HHT A;  5C25 A;  1IKV A;  2YNG A;  3DRR A;  3V1O A;  3VQC A;  1QTM A;  2OYQ A;  2G8I A;  4DQS A;  4M3W A;  4CFA A;  4CFB A;  3L2U A;  4JS5 A;  2WOM A;  4XIU A;  3L2R A;  4CHY A;  3QNO A;  1ITG A;  4FJM A;  4EP5 A;  4FJ8 A;  3VA3 A;  3V4I A;  4O44 A;  2KTQ A;  1RT7 A;  1YVU A;  4ID5 A;  3SNN A;  2YNI A;  4DQP A;  1J5O A;  4BE2 A;  1Q8I A;  3DLG A;  3O4N A;  3TAR A;  4PWD A;  3L2Q A;  4KHN A;  3RR8 A;  4I9L A;  4RW9 A;  3KK3 A;  1JLG A;  4DMN A;  3KD5 E;  2D0A A;  3AO3 A;  4FJ7 A;  4Z4E A;  4DSF A;  3LWM A;  2FBT A;  4CER A;  3OYA A;  4FM0 A;  5J2N A;  2XY7 A;  4QAG A;  1QSL A;  4HVJ A;  4CEA A;  2NUB A;  2G8V A;  3AO5 A;  1LAV A;  4DG1 A;  3OYL A;  2D5R A;  1ZBU A;  3NF9 A;  4B9L A;  4I7F A;  3HL8 A;  4FJ9 A;  1LW2 A;  3RMD A;  4DWI A;  4FLU A;  3AVL A;  3PO4 A;  4M41 A;  4AHR A;  4CGG A;  4YFU A;  3OYD A;  2W42 A;  1T03 A;  1XHX A;  1HPZ A;  1SL0 A;  4PY5 A;  2DY4 A;  2E4L A;  5KGX A;  2YHA A;  3KLH A;  5CYQ A;  4L8R B;  4CHN A;  3LWL A;  4FVM A;  1NK6 A;  2JGU A;  1IO2 A;  1HYS A;  3O3H A;  2YKN A;  1RDC A;  3T3F A;  4CCH A;  3ZT2 A;  3OYK A;  1LV5 A;  1T7P A;  1RDB A;  3V81 A;  1D9D A;  1BIZ A;  1BGX T;  1U04 A;  1ZYQ A;  2HHX A;  3SPY A;  1C6V A;  1NJX A;  1KCF A;  3OVN A;  1S6Q A;  1K6Y A;  5DK5 A;  4TSX A;  3SV3 A;  3SJJ A;  1X9W A;  5HRO A;  4MFB A;  4O0I A;  3TAM A;  4W5N A;  4HTU A;  1BIU A;  3ZSY A;  4E7K A;  3K59 A;  2IS3 A;  2X78 A;  1KVA A;  1JKH A;  3M8P A;  3M8S A;  4DLE A;  3L3U A;  1HYZ A;  4OPJ A;  2BDP A;  1W9H A;  3LAL A;  1S6P A;  2X6S A;  1TL3 A;  3SCX A;  5D3G A;  4B9U A;  3RR7 A;  2RN2 A;  3RMA A;  4FZZ A;  2HHS A;  3K5O A;  4Y1C A;  1NK4 A;  1B9F A;  4B9M A;  4CF9 A;  2LSN A;  3LP0 A;  1WSI A;  3TAP A;  2G8U A;  3KD1 E;  3UIQ A;  4HUF A;  1VSL A;  3LDS A;  4FK2 A;  3PO5 A;  4W5T A;  4OKK A;  4M3X A;  4CEC A;  4CJV A;  3RRG A;  2KFZ A;  2PY5 A;  2A1R A;  4MQ3 A;  2HHT A;  2IDO A;  1BQN A;  2GUI A;  4JRP A;  4DQQ A;  4NCB A;  2Y1J A;  3QEX A;  3PX4 A;  1BCM A;  5CZ2 A;  4DSJ A;  3HJF A;  3G10 A;  2DTU A;  4FK4 A;  4DTP A;  3MAQ A;  3KKS A;  3HM9 A;  1J53 A;  3F73 A;  1ZBF A;  5J2P A;  3TAN A;  4CEF A;  2HND A;  5HBM A;  1NK9 A;  4ZHR A;  4CEO A;  3T19 A;  1IH7 A;  3NFA A;  3SZ2 A;  1RBR A;  1XI1 A;  4JS4 A;  1C0M A;  1S5J A;  3LAK A;  3NGZ A;  3AVK A;  4IFY A;  4F2S A;  3C6T A;  2P5O A;  4OKJ A;  3AVN A;  4CGF A;  3AA5 X;  4FZX C;  3DOL A;  3LP3 A;  5J2Q A;  3KIO A;  1CZB A;  2IAJ A;  5FRN A;  2G8W A;  4FW1 A;  2HNY A;  5J1E A;  2KQ2 A;  2FBX A;  4RG8 A;  1LWC A;  4FJK A;  4AH9 A;  1EX4 A;  3QIO A;  3K5N A;  1QSS A;  2OZS A;  1KVC A;  1NKE A;  4ELV A;  3HO1 A;  3WNF A;  3IG1 A;  3L3V A;  3MEG A;  4KRF A;  4QCL A;  4LH5 A;  3HXM A;  4N41 A;  1HMV A;  1RBU A;  4FLZ A;  4CK2 A;  3S9H A;  4KAZ A;  4K8Z A;  4I2P A;  1BIS A;  1HQE A;  3DRP A;  3OYH A;  3K5L A;  5HRS A;  3ZSR A;  1SKS A;  2Z1J A;  2F96 A;  1EET A;  1FKP A;  1WNS A;  2JLE A;  4BAC A;  4CJF A;  4DS5 A;  4AHV A;  4CJS A;  4CF1 A;  4CES A;  3OJU A;  3WNH A;  1SKW A;  4F4K A;  4CFD A;  3AO1 A;  4FJJ A;  4BWJ A;  1JL2 A;  3AVH A;  1RBS A;  3OYG A;  1WAF A;  2BAN A;  1RDA A;  2DFF A;  2DFE A;  5HRP A;  2KW4 A;  3ZSW A;  3ASM A;  3RRH A;  1NK5 A;  1XHZ A;  5KTQ A;  4FYD A;  2HHQ A;  3CFR A;  1VSE A;  3V9Z A;  3AV9 A;  1Z26 A;  3HP9 A;  3RTV A;  1IKY A;  3QEW A;  3DLB A;  2QK9 A;  1YTU A;  2Z1H A;  4BDY A;  4C8K A;  1QS4 A;  3TWH A;  2BE2 A;  3NH2 A;  4DS4 A;  3IRX A;  1U49 A;  4KB1 A;  4AIL C;  1FKO A;  1G15 A;  2I5J A;  3DRS A;  4CE9 A;  4FJG A;  3O4Q A;  3MXJ A;  4Z4I A;  1C0T A;  1BI4 A;  4C8O A;  1CXQ A;  4CED A;  3CG7 A;  4E7L A;  1D5A A;  1TV6 A;  4Z4F A;  4O55 A;  4OGE A;  2VG5 A;  3A2F A;  2FC0 A;  3V9U A;  4DU3 A;  4FJN A;  1WSE A;  3TAF A;  4DTX A;  2DFH A;  1NJZ A;  4ELT A;  1U45 A;  1Y97 A;  2Q3S A;  3NHG A;  3VA0 A;  1U47 A;  2HW3 A;  1L3V A;  4AHU A;  1WAJ A;  3OYB A;  1N6Q A;  1XWL A;  3HST B;  3TR8 A;  3ITH A;  3HVR A;  4PA1 A;  1REV A;  1HNI A;  2ZE2 A;  1S1T A;  3MEE A;  3ZSZ A;  4W5Q A;  3JYT A;  4FJH A;  4KI4 A;  2YNF A;  2PYL A;  4O0J A;  4LY7 A;  5CYM A;  4Z0U A;  3KJV A;  4FLY A;  3HYF A;  3VN5 A;  3OS0 A;  3EYZ A;  4CEQ A;  1JLQ A;  1I39 A;  3SQ0 A;  2ETJ A;  4KTW A;  2O4I A;  1NKB A;  4E7J A;  1YT3 A;  4FLT A;  4DSI A;  2KZM A;  4RW7 A;  1NJW A;  4GVM A;  3H08 A;  3ZSV A;  2Z1G A;  3QEV A;  1XC9 A;  1T8E A;  4KTZ A;  3RMC A;  2IGI A;  4H8K A;  3PX6 A;  5KRS A;  4DU1 A;  3VQ4 A;  4Z4G A;  3BGR A;  1HJR A;  5K14 A;  3NBP A;  4CJ3 A;  3DYA A;  4FJ5 A;  1VSD A;  1TKZ A;  1QQC A;  4IG0 A;  3AA2 A;  3V9S A;  1UWB A;  3NGI A;  4BDZ A;  1L3U A;  4DU4 A;  3ZT0 A;  3KLF A;  4KHW A;  4GMJ B;  4DF4 A;  1Q9X A;  3G0Z A;  5EU7 A;  1JL1 A;  1DTQ A;  1RIL A;  3KLE A;  3RMB A;  2P5G A;  4M3Z A;  4C8L A;  1U4B A;  2AJQ A;  4KO0 A;  1GOA A;  3HPO A;  1DLO A;  4G1Q A;  2VG7 A;  1A5X A;  3HPG A;  4M45 A;  3KK2 A;  4HCB A;  1VK0 A;  3HVT A;  3QNN A;  1NK8 A;  1SUQ A;  4OPK A;  4O5B A;  3SQ1 A;  1S1X A;  1U48 A;  4CJ5 A;  3SV4 A;  2HMI A;  4IKF A;  1UA1 A;  1JLC A;  2OPS A;  3HK2 A;  3CYM A;  3OYJ A;  1N5Y A;  2R7Y A;  4E19 A;  3CM5 A;  2FBY A;  2F8T A;  3C95 A;  4DQR A;  3QIN A;  4M3Y A;  1T05 A;  4W5O A;  1HYV A;  4DSE A;  4HCC A;  3VQ9 A;  1D9F A;  4PUO A;  3SQ2 A;  4CJP A;  3CM6 A;  3DOK A;  1S9E A;  3MEC A;  3TAQ A;  3DLE A;  1RT3 A;  4JRQ A;  3ULD A;  3MED A;  1ZBH A;  3SUP A;  4IG3 A;  1WSH A;  2XY8 A;  4EP4 A;  3AA3 A;  3DLR A;  4CJT A;  4B3O A;  3AVI A;  3LPU A;  3ZT3 A;  4DFP A;  1X9M A;  1TKD A;  5KGW A;  3C94 A;  2HNZ A;  5HRR A;  3U3G A;  1VRT A;  1TKX A;  2A1S A;  3HPH A;  1LAW A;  1RTJ A;  1S9G A;  3QIP A;  1RDD A;  3VQP A;  4CJ4 A;  4KI6 A;  1A5V A;  2HHU A;  1TK5 A;  4KHY A;  1ASW A;  2D0C A;  4CJW A;  1WSG A;  4DTO A;  4NYF A;  4DQI A;  1ZBL A;  3ALY A;  3TAB A;  4BWM A;  4C8M A;  2P51 A;  4H4M A;  4CJR A;  2VWJ A;  3U3Y A;  2KZZ A;  4M3T A;  1HNV A;  3LAN A;  4F2R A;  3V6D A;  1RT1 A;  3WNE A;  3TAG A;  2GV9 A;  1ASU A;  2OPP A;  4FM2 A;  3ZSQ A;  2XRI A;  3SUQ A;  4GW6 A;  4N47 A;  4N56 A;  1CLQ A;  4Q0B A;  3SYZ A;  1HRH A;  1UOC A;  4PQU A;  1RT4 A;  2OPR A;  5J2M A;  4K8X A;  2FBV A;  4WE1 A;  1KFD A;  3P83 D;  3ISN C;  1X1P A;  4RW8 A;  4CF2 A;  3OJS A;  5C42 A;  4KB0 A;  4B9T A;  1LW0 A;  1NK0 A;  4BE0 A;  1NOY A;  4DTJ A;  3S3O A;  4DFJ A;  3SUN A;  1UA0 A;  1J54 A;  3CFO A;  3V1Q A;  1KSP A;  5SWM A;  2PZS A;  1JLB A;  4DTR A;  1W0H A;  4CGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...