3AA3A

A52l e. coli rnase hi
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMALIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein core adaptability: crystal structures of the cavity-filling variants of Escherichia coli RNase HI
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Ribonuclease HI
total genus 48
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aa3A00
1FK9A 2OZMA 5HRNA 2G8HA 4FJ7A 4GW6A 1SKRA 2P5OA 3WNGA 3AO5A 3OYEA 1D9DA 1UA0A 1XHXA 3OVNA 4FJ5A 2RKIA 1EX4A 3ZSQA 1IKXA 3AVNA 1RTDA 2F8TA 1J9AA 4O4GA 4FLYA 1YT3A 3TANA 3OJUA 4Z4EA 3P83D 4EZ9A 2YKNA 5EU7A 3K5OA 3LALA 1TL3A 4LY7A 1ASVA 3K59A 5HP1A 4B9VA 3E01A 1RTJA 2BDPA 4B9NA 2G8FA 3KD5E 3ZSYA 3C94A 3H08A 5HROA 3SQ1A 4E7KA 4E0DA 4F4KA 1S6QA 4AHSA 4FLXA 4DFJA 1HQEA 4RW7A 4ZTJA 3CM6A 4KHSA 4DQQA 3SZ2A 3PV8A 1F21A 1JLGA 1B9FA 4FXDA 2DFFA 4B9LA 1RNHA 4DS5A 2OPQA 2YKMA 1A5WA 3ITHA 4M45A 3VQ6A 4CIGA 4E7JA 4DFKA 4E89A 1SV5A 1BIUA 4OPKA 1XC9A 4DSEA 4CJWA 4DTXA 2G8IA 2LSNA 1VRUA 3D45A 4FJNA 2HVHA 1J53A 3T3FA 1D9FA 4FK4A 1VSKA 3ZT4A 3DLHA 3LANA 4DU3A 2IS3A 2P5GA 1REVA 1ZBUA 1BHLA 3PX6A 3L2WA 3RTVA 2XY8A 2QKBA 1C1CA 1J54A 5KI6A 3TABA 3V6DA 3SPYA 3V9WA 4FJKA 3QINA 5SWMA 2IGIA 1BQMA 1LWEA 3SPZA 1TK0A 4KTQA 1CZBA 3NGZA 3DMJA 1S1XA 3S3MA 4IDKA 4PWDA 3NBPA 4N5SA 3DLRA 4CEAA 4JRPA 4CHPA 1GOBA 1JL1A 3QERA 4F3TA 4ID1A 5I3UA 3K2PA 3SI6A 4ELVA 4O0JA 4M42A 4KAZA 1S6PA 1SKWA 2WONA 2Z1HA 3V1QA 5C25A 1IKWA 4Y1CA 3IS9A 4DFMA 3MEGA 1JKHA 1WSEA 1NK7A 4KTZA 1U04A 4AILC 3AVCA 4Y1DA 3AVLA 3KK3A 3TAEA 3LZIA 4FLZA 3AO1A 4PQUA 2RN2A 3K5NA 2FBTA 2HVIA 3HP6A 1DLOA 4Z4IA 1SL1A 4C8LA 1WSGA 3NF6A 5CYMA 3TAFA 3OYCA 3HPHA 1TKZA 2OA8A 4CGDA 1KFSA 2OPSA 3G10A 4J2EA 3TAGA 3MECA 2X74A 3UIQA 1ZBHA 4IG3A 4N56A 3KK2A 3VQQA 4FJGA 3AVHA 3HL8A 3L3UA 4DTOA 3QNNA 2Z1IA 1BCOA 1JLQA 3KLIA 4CIFA 1LAVA 4BWMA 1TL1A 3C6TA 4E19A 1UA1A 1I39A 4F2SA 1JLEA 3HO1A 4AHRA 4W5RA 3MAQA 3VQDA 1TK5A 1UWBA 4KV8A 4RW8A 4H4MA 4MQ3A 3PX4A 1C1BA 4M3TA 1L5UA 3MEEA 1EKEA 1XHZA 3QEIA 5KRTA 3K5LA 1LW0A 1KVCA 3OY9A 4FJ8A 4MFBA 3RR7A 4CJ5A 2DY4A 3M8SA 2D0AA 3LPUA 4BE1A 2D0BA 4FJLA 4NYFA 4DMNA 3NF8A 4CJQA 4DQSA 3S9HA 1RBTA 3BGRA 3CM5A 4CJFA 2X6NA 4GMJB 3KD1E 2HHXA 2YNHA 3OJSA 2F96A 3QIOA 2IAJA 4CFCA 1Q9YA 1RBUA 3VA0A 2GUIA 4HHTA 4FYDA 1RDCA 3CFOA 3DI6A 1Y97A 4JS5A 1RT4A 2VG5A 4AHVA 3OYGA 2OPRA 1LAWA 2D0CA 4B8CA 4FLVA 3QESA 1NOYA 3OYLA 3VQ4A 1HYZA 5J2QA 1HNIA 1WLJA 3EYZA 1WSIA 2NUBA 3IG1A 3CFRA 2DFEA 3SYZA 1L3UA 2IC3A 4CJTA 4W5QA 4IG0A 2FBVA 2GV9A 3PUFA 1U49A 1IH7A 1WAFA 1L3SA 4CHQA 3EZ5A 4DSKA 2HW3A 4NYNA 1TGOA 4DSJA 4NCBA 1EETA 4DTMA 5FDLA 3HPGA 5FROA 3L3VA 1NK8A 3CG7A 2YNFA 4CEDA 1WAJA 4W5OA 3LAMA 1SUQA 2VWJA 2Y1JA 1D5AA 1NJWA 4Z4CA 1LWFA 3L8BA 4CGHA 4CGFA 1JLAA 2VG6A 3P1GA 4Q5VA 3DRPA 2IDOA 3O4NA 3O3HA 4TSXA 4HUEA 4CGJA 3SQ0A 4HCBA 1EXQA 2B6AA 1VSIA 4DF8A 2W42A 3TI0A 3QEWA 3VQEA 5KGXA 2HHVA 5C42A 4K8XA 3DLGA 4N47A 4E7LA 2ZD1A 4I9QA 3AVFA 1D8YA 1S1TA 2E4LA 2Y1IA 4DQPA 4NCAA 5DMRA 4ID5A 4RG8A 3JSMA 4CESA 2YHBA 1ZBLA 2HB5A 5KGWA 5J2MA 4KI6A 1RT7A 1TKXA 3OS1A 4KHQA 3RRHA 3OYFA 4AHCA 3RRGA 2I5JA 4FVMA 4OKKA 4HVJA 3DYAA 3VA3A 3V4IA 1T7PA 3ZSVA 4CEZA 4E1NA 1CXQA 3QLHA 1QHTA 3ZT2A 5SZTA 4W5TA 1QE1A 2XRIA 3K5MA 4BDZA 1UOCA 1ITGA 4KB0A 4CJSA 4O0IA 4HUFA 3TAQA 4CGIA 2RF2A 3C6UA 1RT5A 1N6QA 3KKRA 2X6SA 3F73A 4WE1A 4DSFA 3I0RA 3SJJA 2QXFA 4FZYA 1VSHA 4LD0A 1A5XA 5C24A 4M41A 1RT2A 1LV5A 3ZSRA 3AO3A 4IBNA 3HM9A 3AO2A 3U6FA 2Z1GA 4DTJA 3TWHA 2QKKA 2G8UA 3PO5A 4UQGA 1HPZA 3NH0A 1VSMA 2YNIA 4FW2A 1QSLA 2WOMA 1JLCA 1SKSA 1NK0A 4HUGA 5FRMA 3K58A 2R7YA 1NK4A 1T8EA 1NKBA 4I2QA 4J2DA 3NH1A 3DOKA 3NF7A 3LWLA 3B6PA 3OS2A 3U3GA 3LP3A 1FXXA 3ZSWA 3O3FA 4BDPA 3PO4A 4M3XA 4OLAA 1W9HA 4E7IA 2FBXA 4LH5A 1XI1A 1R0AA 3MEDA 2HNZA 3O3GA 3LDSA 4DTRA 5J2NA 1KTQA 3THVA 3D0PA 2PYLA 4M3YA 2HHSA 2VWKA 1RT1A 3AVJA 3RWUA 4F8RA 4CHZA 4OGCA 4RW4A 4B8AB 4CFDA 3ALYA 1BIZA 1FKOA 2Q3SA 3LAKA 5KRSA 3SV3A 4CE9A 3AA2A 1K6YA 3T1AA 3VQAA 2ITGA 5T7BA 2HHTA 4CJEA 4PY5A 1X1PA 3SNNA 1CXUA 3AA5X 4OKEA 3VQ9A 5JS1A 3V81A 2PYJA 4CFBA 1C0UA 3OYKA 1G15A 4FJJA 3HPOA 4CK1A 3OYIA 1HMVA 3PX0A 1U48A 1L3VA 3JYTA 4W5NA 1UAXA 4CJ3A 3OYHA 4DQRA 3ULDA 3MXIA 5CYQA 1NJZA 4B3OA 1S9GA 1YTAA 5HBMA 4CEEA 2O4GA 3I8DA 3OS0A 3QNOA 1KVBA 4DF4A 3HJFA 3LP1A 3DRRA 4G1QA 4E7HA 1N5YA 1HYSA 2DTUA 5K14A 5HRSA 1RBVA 1C1AA 4GVMA 3V9ZA 3QEXA 4HCCA 3DLKA 3M8QA 4KHUA 3NGYA 1LW2A 4O5BA 1Z25A 4FLUA 3NDKA 3RMDA 3DOLA 3BDPA 4DG1A 2KQ2A 1JLBA 1NK5A 3V9XA 4IKFA 1VSJA 2B5JA 4DTPA 4I7FA 2HNDA 5E41A 3HP9A 3NE6A 4KREA 4B9SA 1ZBFA 3DM2A 4KHWA 3F9KA 3VQCA 4OPJA 4CHYA 3OYJA 4FLWA 1J5OA 1B9DA 1S1WA 1JXBA 3B6OA 3LPTA 3ASMA 2HMIA 1S9EA 5J2PA 4Z4GA 4OVLA 3WNHA 1NJXA 4CJRA 2KFNA 4AH9A 4CEFA 1RTIA 4FCYA 1WSJA 1HRHA 4IFVA 5HRRA 2OYQA 3FFIA 2KFZA 2P51A 5HLFA 4KKOA 1Q9XA 4EP5A 3S3NA 3AA4A 4B9UA 3VQPA 1KSPA 1TKDA 3NF9A 4B9TA 1T05A 3TAPA 4DLEA 3KTQA 3IRXA 4J2BA 3MXJA 3SUQA 2XO7A 1VK0A 3AV9A 1QQCA 1QSSA 1ZBIA 4CF9A 3L2QA 2JLEA 3V9SA 4DTUA 2KZZA 2YNGA 4H4OA 4E1MA 4PA1A 1KRPA 3RMAA 3OYDA 1VSEA 3L2RA 4B9MA 1RDBA 3CQ8A 4FM0A 4FLTA 4Z0UA 3KJVA 2OZSA 1JLFA 4CFAA 4CECA 1B92A 3WNFA 2XY5A 3SUOA 1U4BA 3KK1A 1BI4B 4XIUA 2ETJA 4YNQA 4CF1A 4YFUA 3NCIA 1IO2A 1VSFA 1BISA 4F3OA 2HHWA 1BQNA 2GBZA 4IFYA 4RW6A 4Z4HA 4OGEA 4R5PA 3ZT0A 4E3SA 4LSLA 1C0MA 4BWJA 4L8RB 2F8SA 5CZ1A 4CK3A 5KTQA 4O55A 4KO0A 3KLFA 1YVUA 3U3YA 2ATQA 3HK2A 4KRFA 5CY4A 3DLEA 4C8MA 5JS2A 3HVRA 1C0TA 3AVIA 1I3AA 3CYMA 1NOZA 1ZYQA 4ELTA 4FK2A 4BDYA 3LZJA 4CERA 1DTQA 4QOZB 3LP0A 4CHOA 1CZ9A 1RCHA 4FM2A 3TARA 2JGUA 2AJQA 3AVKA 4QCLA 1RDDA 1RILA 2IOCA 3KKSA 3ZT1A 4LSNA 4ELUA 4KI4A 1TAUA 3S3OA 4FZXC 3AA3A 3IAYA 4OLBA 3PY8A 4NCGA 4CJLA 3ISNC 1RDAA 2OPPA 4CJ4A 3RMCA 3MXMA 3TR8A 1NK9A 4K8ZA 4DQIA 4KHYA 4Z4FA 1Z26A 3AO4A 3ZSXA 4CJKA 2Z1JA 3SV4A 1X9MA 1RT3A 2E6MA 3LWMA 4ZTFA 1EP4A 5D3GA 3HVTA 4CF0A 2XHBA 3QETA 4H8KA 4AHUA 1QSYA 3AVGA 3ZSOA 3HT3A 2P1JA 4F2RA 4DTSA 1NKEA 4M3WA 1RBSA 2KW4A 4C8NA 4ICLA 4M3RA 3EY1A 5J1EA 4CJPA 3SUPA 5DK5A 2XY6A 1NK6A 3VQ8A 4CEOA 1NKCA 4KB1A 4KHNA 3L2VA 3HXMA 1W0HA 3AVMA 1HJRA 3V1OA 4AHTA 4QAGA 4DWIA 1O1WA 4CHNA 1CLQA 1BI4A 2EHGA 1KLNA 3SCXA 2YV0X 1X9SA 4ZHRA 2HHUA 1S5JA 2BANA 3SQ2A 3M8PA 4DU1A 3O4QA 4C8OA 2QK9A 4RW9A 1IG9A 4CK2A 5FRNA 4FM1A 2DFHA 1KVAA 4FJIA 2YHAA 3M8RA 4PUOA 1VRTA 1KFDA 5HRPA 1NJYA 3OYBA 4CGGA 1U45A 5CZ2A 3OYMA 3G0ZA 4CF2A 3WNEA 3ZT3A 4JRQA 1VSDA 4DLGA 2O4IA 4I9LA 2X78A 1TKTA 4OKJA 4CIEA 2FBYA 4CJVA 2ZE2A 4N76A 1WSHA 3RMBA 1YTUA 2HNYA 3NGIA 3QEVA 4CEBA 2ZQBA 1TAQA 3KIOA 1JXEA 4J2AA 4DFPA 2BGGA 1S1UA 1QS4A 1LWCA 1RT6A 2KZMA 3ZSZA 1SL2A 2A1SA 3VQ7A 1Q8IA 4BE2A 2RPIA 4OJRA 4CCHA 3SQ4A 1BCMA 1KLMA 1ASUA 3KLGA 2KTQA 1HYVA 4EP4A 1BGXT 4HTUA 3VN5A 4EZ6A 3A2FA 1IKVA 3AVBA 1ASWA 4DTNA 1WSFA 4FJ9A 3QO9A 3LP2A 1MU2A 1SL0A 3DLBA 3KLEA 3CFPA 4N41A 5I42A 3QIPA 4M3UA 1GOCA 1TV6A 2B4JA 1VSLA 4BE0A 1C6VA 4FJHA 4CF8A 4FJXA 4I2PA 4FZZA 2FC0A 2HHQA 3NAEA 3V9UA 4DSIA 2VG7A 1RBRA 1HQUA 2BE2A 4CEQA 1DTTA 1IKYA 1JL2A 3DRSA 2EX3A 1WN7A 3VQBA 2E6LA 3OYNA 3KLHA 3QEPA 1RTHA 4B08A 2PZSA 4FK0A 3RR8A 2PY5A 1XWLA 3VQ5A 3I0SA 1TK8A 3NFAA 2G8KA 4DSLA 1HNVA 1FKPA 3HYFA 3L2UA 1X9WA 1GOAA 3T19A 4M3ZA 1TVRA 4KFBA 4Q0BA 1QTMA 3ZCMA 4FJMA 4LH4A 2A1RA 4CJUA 2XY7A 4KTWA 4KPYA 4FW1A 1L3TA 1KCFA 3TAMA 2G8VA 4BACA 3P5JA 3HSTB 2D5RA 4O44A 3V1RA 4DS4A 3NH2A 1T03A 3NHGA 3C95A 3K57A 4JLHA 1S1VA 4JS4A 1BL3A 3AVAA 1A5VA 4C8KA 2G8WA 3OYAA 4DU4A 3SUNA 1U47A 1WNSA
chains in the Genus database with same CATH superfamily
3THWA 4DR2K 4CZIA 5HRNA 4FJ7A 3ATUA 2P5OA 3K9KA 3R8EA 3AO5A 5FPEA 1VQON 1XHXA 3LDLA 1EX4A 3ZSQA 5JICA 3AVNA 3CCRN 1RTDA 4Z4EA 3OJUA 1K73O 3P83D 2I7NA 5EU7A 3ULEA 4HTLA 1XQSC 4IJAA 3O9TA 1VQKN 3CCQN 4JKEA 2P9NA 5AQOA 4H5WA 3H08A 4XH4A 1HNZK 4AHSA 4FLXA 4B1ZA 3HRGA 1JLGA 1B9FA 4U67L 4B9LA 1K8KA 1RDUA 1IJJA 3VMFB 4CZLA 3TSQA 1SV5A 1XC9A 4CJWA 4DTXA 3C7NA 3CC7N 2G8IA 2HVHA 1J53A 1NGIA 1NM1A 3T3FA 1VSKA 2E8AA 4FWKA 3DLHA 1KAYA 3PX6A 4AQYK 3L2WA 3TABA 3CPEA 4FJKA 3EE8A 5AFUH 1BQMA 5KPRA 3CMEN 4CEAA 4CHPA 1C0FA 2H3GX 5CE3A 4F3TA 1XMQK 4BRKA 2FXUA 4ELVA 4O0JA 4YHHK 1SKWA 4Y1CA 1NGBA 2E1YA 3QBWA 1NK7A 3AVCA 5FPNA 3H45C 4FLZA 3AO1A 2YHXA 4BRPA 1P90A 3K5NA 3HSCA 3FZFA 2FBTA 1DLOA 4KBOA 1SL1A 1TKZA 3G10A 3VETA 2O8FB 4I6MB 3TAGA 3UIQA 3TSPA 3VQQA 3AVHA 3HL8A 3L3UA 3QNNA 1JLQA 1NGHA 3EKUA 1UA1A 5M1PA 4F2SA 2VGNA 3KWIA 3I55N 5AQKA 4GNIA 4H4MA 4JKAA 4M3TA 3CCUN 2OCEA 1VQ8N 5BPMA 1D4XA 3FLCO 4Y0WA 3ZETA 3M1FA 4BE1A 2D0BA 4NYFA 4DQSA 4CJQA 3BGRA 2X6NA 3EL2A 5F2RA 3OJSA 3QIOA 1Q9YA 1RBUA 2GUIA 3DI6A 4JS5A 4WQ5C 4BRAA 4EHUA 2D0CA 1HYZA 2DFEA 4W5QA 3K9JA 3GE1A 1L3SA 3CC2N 1TGOA 3MCAB 1EETA 1YIJN 3VGMA 2NRTA 1XNRK 5FROA 2YNFA 2E2OA 5AQXA 3LAMA 1SUQA 3Q7BA 1HJOA 2UUCK 4CGFA 1JLAA 3P1GA 1I94K 3UKUB 3DRPA 1NMNA 5AQMA 3SQ0A 4DF8A 2HHVA 4K8XA 4PL7A 3THXA 1S1TA 2E4LA 3G4SN 2ZJQL 3L6QA 5M1KA 4RG8A 4DQPA 3BUZB 2E88A 1VQPN 5EY4A 4KHQA 4AHCA 2I5JA 2IVNA 4JHDA 4HVJA 4FO0A 3GBTA 5BN9A 1NKBA 4E1NA 2ITMA 5SZTA 3G25A 3K5MA 2XRIA 1UOCA 4KB0A 5LJVA 1N34K 3CCVN 4H0VB 3KKRA 3SJJA 4DSFA 4BRLA 5KPTA 4LD0A 3SMSA 1A5XA 5C24A 4M41A 4YOXA 4GKKK 3ZSRA 1MWKA 4BR9A 3AO2A 3HM9A 4A5BA 3TWHA 3PO5A 2QA4N 1QSLA 1NGDA 4YOWA 2WFBA 4B3MK 4I2QA 3D2EA 4DV2K 3LP3A 3ZSWA 3PO4A 4OLAA 5JVHL 4LH5A 4LF7K 1GLBG 3BF3A 2HHSA 3AVJA 3RWUA 1VHXA 4XH1A 3ALYA 1FKOA 3LAKA 2HHTA 4MO4A 4CJEA 2A42A 3AA5X 4OKEA 3VQ9A 5AQUA 3OYKA 4CZHA 4FJJA 4CK1A 1L3VA 1U48A 4CZMA 4CJ3A 2HOEA 5CYQA 5HBMA 1XNQK 3HJFA 3OS0A 3TPQA 3LP1A 4G1QA 1HYSA 3U8XA 1C1AA 3J8AA 3V9ZA 3QEXA 3NGYA 4O5BA 1Z25A 3R9PA 3DOLA 4DG1A 1NK5A 1JLBA 3WUHA 4DTPA 4I7FA 5E41A 2ZF5O 1ZBFA 3P31A 4FLWA 2KHOA 1S1WA 1JXBA 3B6OA 4DV4K 4FL9A 3O8MA 2KFNA 1WSJA 1HRHA 2KFZA 5HRRA 3UE5A 5JLFA 3AA4A 1QQNA 4B9UA 3LL3A 3NF9A 3VF4A 4DLEA 3DAWA 3KVGA 1ZBIA 4JD2B 4CF9A 3L2QA 3NMUA 3EN9A 1IBMK 3R3LA 3OYDA 1VSEA 4Z0UA 4JKGB 4J8FA 2XY5A 2ETJA 4BC5A 4O8KA 4CF1A 4YFUA 3NCIA 4IDHA 3A0IX 1VSFA 4BROA 1K9MO 4F9OA 3E9PA 4RW6A 3ZT0A 4LSLA 1HKBA 4L8RB 4CK3A 4O55A 4KO0A 3KLFA 3HK2A 3GOIA 3DLEA 3HVRA 3FFKB 5JS2A 4JKDA 3M6GA 1ZYQA 4CERA 2KLAA 1CZ9A 2AJQA 2NRRA 4AF1A 1M90O 4QCLA 1RILA 4ELUA 2HMPA 1TAUA 2BTFA 3AA3A 1WBDA 1X3NA 4NCGA 4CJLA 4KHYA 2Z1JA 2E6MA 4M63C 1YF5L 4CJ7A 2Q97A 4H0XB 4IXCA 4F2RA 4DV6K 2GWJA 4M3RA 3SUPA 5DK5A 4KB1A 1NK6A 3V1OA 4AHTA 4QAGA 1HX1A 4BR5A 1O1WA 1CLQA 2EHGA 1ESVA 2YV0X 4ZHRA 1Q81O 3M8PA 4DU1A 2QK9A 4RW9A 1IG9A 4DV5K 5FRNA 2YHAA 1KFDA 4H0OA 2QWMA 3G0ZA 4CBUA 2E1ZA 3ZT3A 1YJWN 4DLGA 1MDUB 4A59A 2I7PA 2P9PA 3PIOL 3MWPA 2O8EA 3QDKA 4O5FA 4CIEA 2ZE2A 3LM2A 4PKHA 3DJCA 4N76A 3RMBA 2HF4A 1YTUA 5M1NA 3NGIA 4CEBA 1TAQA 3KIOA 1QS4A 1LWCA 1RT6A 3H6EA 4ILJA 3VQ7A 4OPHA 4BE2A 4CCHA 4OX9K 2W40A 2WTUA 1BCMA 1ASUA 5HL7L 1HYVA 3H3NO 4EP4A 1BGXT 3CIPA 1HLUA 4WF9L 4DTNA 5E26A 3FR0A 1MU2A 1SL0A 3J7YP 2IVOA 5I42A 3QIPA 3SAFA 1GOCA 4FJHA 2HHQA 4I2PA 1KC8O 5C12A 1OH5A 3V9UA 2QWLA 2VG7A 4CGGA 4FPAA 4CEQA 4J2EA 3VQBA 1DTTA 2QWNA 3KLHA 1U2VB 1ZXOA 3DXKA 4U7BA 2F4VK 1XC3A 4K41A 4PKGA 2QW9A 5AQYA 2G8KA 3VESA 1FKPA 2CH5A 4WFBL 3DXMB 2NRWA 2A1RA 2E2NA 4FW1A 2G8VA 3TAMA 4BACA 3R6MA 2D5RA 4DS4A 1S1VA 5AQHA 4IOAL 2ZGZA 2G8WA 4CBWA 1U47A 1FK9A 2OZMA 1DT9A 4FOIA 1D9DA 3OYEA 3GG4A 1UA0A 2NRZA 1S22A 3VEYA 2RKIA 5FPDA 4FVUA 1YITN 4IFEA 2NNWA 3L4IA 3OA9A 1KXPA 4BC4A 2JWLA 1IKXA 2OANA 2F8TA 4FLYA 4MO5A 3THWB 2NRVA 4LF5K 2A40A 3VEXA 1V4SA 1ASVA 2FF3B 3SK3A 4JI6K 4DCHA 3C94A 3Q7CA 4F4KA 4DFJA 4RW7A 1VQ5N 4ZTJA 3CM6A 1BO5O 3PV8A 1F21A 2DFFA 5C15A 1EWRA 4FSVA 2RE2A 4M45A 5EOYA 4EHTA 4E7JA 3U9ZA 4E89A 4OPKA 4DSEA 4LF8K 5IT9O 2LSNA 1VRUA 4BRFA 4FJNA 4OO1J 1D9FA 3ZT4A 4UY8O 4DU3A 3MN9A 2P5GA 4O8UA 1ZBUA 2QKBA 2NLXA 3SAHA 3SPYA 2GWKA 4BR0A 3V6DA 4JKFA 1VAZA 4CVNE 1TK0A 1CZBA 3FGUA 4IDKA 3WEEB 3UKRA 3ZYYX 4ID1A 3K2PA 3GL1A 1DKGD 3QMLA 4IZ9A 3VERA 3V1QA 2QWRA 1IKWA 3NVMA 3CHWA 2D1KA 3MEGA 2O8EB 1JKHA 2P9UA 4KTZA 3SBGA 3AVLA 2UXBK 3KK3A 3TAEA 4OPAA 4BQZA 2RN2A 3CC4N 2V7ZA 2HVIA 4Z4IA 3THYA 1WSGA 3NF6A 2OA8A 3BZKA 2OPSA 2Q31A 3MECA 1EWQA 4BRGA 3HM8A 4DTOA 2YJFA 2UUAK 1BCOA 3KLIA 4CIFA 2BDPA 4BWMA 1JLEA 4W5RA 3VQDA 1TK5A 5HOOA 4JNEA 4RW8A 1ATNA 1W2BM 1XMOK 1L5UA 5EX5A 1XHZA 5KRTA 4MFBA 3FZKA 4CJ5A 4X65K 2PBDA 4WCEL 4B9MA 4JI3K 1RBTA 3CM5A 4GMJB 3KD1E 3CETA 2HHXA 4BC3A 2IAJA 3CERA 1RDCA 3CFOA 3CCSN 2F9TA 4PHTX 1NOYA 1C0GA 5J2QA 1WLJA 3SAGA 1WSIA 2NUBA 3IG1A 1L3UA 1M1KO 2IC3A 5EVZA 1G99A 4CHQA 3EZ5A 1NGGA 1SS6A 4NYNA 4NCBA 5AQWA 5FDLA 3HPGA 2UUBK 3CG7A 1WAJA 4W5OA 3ENBA 4Z94A 2VWJA 1WOQA 5GINA 4JV5K 1V4TA 4IEEA 4TSXA 4YORA 4CGJA 4HUEA 4HCBA 1NMDA 2B6AA 1VSIA 3MX2A 3TI0A 2QTDA 3DLGA 4E7LA 2ZD1A 1NBWA 4E1JA 3O1WA 1RT7A 4L3QA 3HI0A 1QZ5A 3OYFA 1NG9A 4YDUC 2Q0UA 4GVEA 1T7PA 3VA3A 3ZSVA 5BRHA 2UXDK 1CXQA 3QLHA 1QHTA 2IVPA 4W5TA 2DPNA 5TKYA 4O0IA 3BY5A 1NU0A 3A5OC 5AQRA 3TAQA 4BRDA 1N6QA 1EO1A 2QXLA 3E66A 2X6SA 3M5RA 2QXFA 4NO7A 2GUPA 5GAHP 2QKKA 2QM1A 2CGKA 2YNIA 4BG9A 3LDPA 1JLCA 1SKSA 4HUGA 3K58A 4R79A 3NH1A 3LWLA 4I6MA 1FXXA 2VCPA 1W9HA 5F0XA 5GIOA 4M3YA 3O5BA 2QWPA 4FWLA 5C0YA 4F8RA 4RW4A 4B8AB 3ZX2A 4CFDA 3SV3A 3ZEUA 4CE9A 3MDQA 3VQAA 2ITGA 4PY5A 4LC9B 5JS1A 1DEJA 4MDBA 3V81A 4CFBA 1C0UA 4BRMA 3F5TA 1G15A 1GLCG 1OKJA 1E4FT 4DHYA 1FJGK 4LF9K 2IIRA 3OYHA 1YTAA 3AAPA 4DV0K 2HBJA 2O4GA 4YOUA 3QNOA 4DF4A 1N5YA 5K14A 5HRSA 4JI0K 4GVMA 2E2QA 4HCCA 1LW2A 4CZFA 4FLUA 4BRQA 2KQ2A 1R59O 1VSJA 3NE6A 4KREA 3DM2A 4A2AA 3VQCA 4OPJA 4CHYA 3OYJA 1J5OA 3A5LC 4YOVA 4DB3A 3LPTA 1S9EA 4FWMA 3WNHA 1VQMN 2VQFK 4AH9A 2ASPA 4FCYA 3FFIA 2P51A 5AQIA 1KD1O 4NLBA 2CH6A 1QVGM 3VQPA 1TKDA 1T05A 3KTQA 1VK0A 3FE1A 2YNGA 4H4OA 4CI6A 3RSEB 5A2QO 1Q82O 2O8CA 1RDBA 2P9UB 4FM0A 3KJVA 3THYB 4CFAA 3MK6A 3LDOA 4BR4A 4CECA 3KK1A 1VQ9N 4YNQA 3K0SA 3CD6N 4DR7K 3H1QA 4F3OA 1SQKA 4Z4HA 4OGEA 3VOVA 1C0MA 3O6WA 4HWIA 4BWJA 1BU6O 5AQZA 5BPLA 1YVUA 3U3YA 3ID6A 4PKIA 2PFUA 5CY4A 1C0TA 3AVIA 3VPZA 4FK2A 4BDYA 1DTQA 4FPBA 5C2FA 3D6RA 3ZT1A 1TUYA 4EFHA 3KKSA 1OH7A 1QVFM 4LSNA 3ZX0A 2O8DB 2HHHK 4LFAK 4OLBA 4CJ4A 1RDAA 2OPPA 4EAHD 3TR8A 3CCEN 4Z4FA 1Z26A 3W3DA 3ZSXA 4CJKA 3SV4A 3LWMA 4BG8A 4DR3K 5D3GA 4CF0A 2XHBA 4H8KA 4AHUA 1TYQA 3ZSOA 3HT3A 3HOSA 1NKEA 4M3WA 2P9KA 2O8CB 5J1EA 4CJPA 5AQNA 1HJRA 1MWMA 1X9SA 3IKMA 3BF1A 3SQ2A 2F9WA 3O4QA 4C8OA 2DFHA 3L0QA 5HRPA 1NJYA 5I9EB 1U45A 5CZ2A 1T3VA 1TKTA 1NNEA 3SMPA 3IMXA 3QEVA 5ADXH 2KZMA 3VTIA 1RFQA 3O08A 3ZSZA 5ADXA 3WXLA 1SL2A 1T44A 3F2KA 1KLMA 3AVBA 1IG8A 4M7XA 4FJ9A 4XEIA 1RDWX 3LP2A 3DLBA 1E4GT 1NWKA 3CFPA 2P9KB 2WBNA 2B4JA 1BA1A 5EXWA 4CF8A 4FJXA 3NAEA 2HSTA 2HBMA 2BE2A 4JI7K 1JL2A 1IKYA 2EX3A 3DRSA 1WN7A 2E6LA 1RTHA 4B08A 1CZAN 4FWQA 1XWLA 3NFAA 1GOAA 4KFBA 2NRHA 4Q0BA 3ZCMA 4KTWA 4KPYA 1KCFA 4BR2A 3V1RA 1JJ2M 2ZM6K 2AA4A 3OBWA 4JS4A 1A5VA 3OYAA 4DU4A 3KWGA 2G8HA 5AQPA 4GW6A 1NGCA 1N8RO 4V19S 3WNGA 3A5NC 3W0LA 2ZWHA 1J9AA 4O4GA 2Q0RA 1YT3A 1TL3A 5HP1A 3E01A 4B9NA 3KD5E 4BREA 4IEIA 3CQYA 3ZSYA 3WXMB 5HROA 5AQSA 4E0DA 1HQEA 2W6LA 4KHSA 4DQQA 4FXDA 1RNHA 1YUWA 2OPQA 2YKMA 1A5WA 3ITHA 3VQ6A 2O8BB 2YCHA 5LMNK 1BIUA 2O8FA 2P9LB 3D45A 4A61A 3CQXA 2P9IB 4FK4A 3QFPA 4B1UB 1OVQA 1REVA 2Q1NA 1BHLA 4WFNL 3RTVA 1C1CA 5AFUA 3V9WA 3QINA 1BG3A 5SWMA 4K25A 1LWEA 4DQ8A 3SPZA 3NGZA 4KH5A 5IWAK 3CJ1A 5FLXO 3G6EN 3NBPA 4N5SA 4JRPA 3ZETB 1JL1A 2YHYA 5BRDA 4NXMK 5I3UA 2E20A 4JK9A 4KAZA 3CCMN 1WUAA 1S6PA 2WONA 2Z1HA 1U2VA 4WFAL 5C25A 3IS9A 3VGLA 4A5AA 4B1WB 4JKHA 3D2FA 1U04A 4AILC 4K42A 4Y1DA 1MA9B 3CJ9A 3E1YA 5AQQA 3JS6A 2D4WA 3HBTA 4C8LA 2J4RA 5CYMA 1KFSA 3E9OA 3DXKB 2RHKA 1QQOA 4GKJK 2HF3A 2O8BA 2X74A 3H1VX 3P39A 2YJEA 2Z1IA 1TL1A 1X9JA 1SZ2A 3U9DA 4AHRA 5JVGL 4MQ3A 3PX4A 1C1BA 2KKZA 3H46O 3MEEA 5JLHA 1OH6A 4ILHA 5LY3A 3THXB 4CZJA 3I8BA 3FZHA 4JN4A 4CZGA 3RR7A 4B3RK 3M8SA 2D0AA 3LPUA 4FJLA 1YHQN 3NF8A 3S9HA 4H0YB 3QB0A 2F96A 4FWPA 5AZIB 3VA0A 4YOYA 4BR7A 1Z05A 2VYPA 3O9RA 1U6ZA 1FW6A 4AM7A 2VG5A 3OYGA 3WXKA 4B8CA 1LAWA 3OYLA 1ILYA 4J2BA 3EYZA 3CJBA 3CFRA 4CJTA 4IG0A 4FOEA 3U4LA 1U49A 4WQ4A 4DSKA 2HW3A 2JWKA 4DSJA 1KQSM 4DTMA 1BUPA 4CEDA 1ZBSA 3VF6A 1NJWA 4B3SK 1LWFA 5GADP 3L8BA 4ISFA 4CGHA 4JI5K 5B8HA 2GELA 3HOTA 3O4NA 3O3HA 3D2EB 1ATRA 1EXQA 1KAXA 4H5RA 2W42A 5KGXA 4JK8A 5C42A 3UKRB 1D8YA 4NCAA 5DMRA 4ID5A 3JSMA 4CESA 2YHBA 1ZBLA 5KGWA 5J2MA 1ZC6A 1TKXA 3ZX3A 4XH5A 3OS1A 2BUPA 1VQLN 3RRHA 4DR4K 4OKKA 3V4IA 3PLAA 4X66K 1ITGA 5C10A 2ZJPL 2RF2A 1RT5A 3QBXA 4WE1A 2QEXN 1RT2A 3AO3A 4IBNA 4JKCA 3O9QA 3U6FA 2Z1GA 5AZJA 3NH0A 1VSMA 2W41A 2WOMA 1NK0A 1NK4A 3DOKA 3OS2A 3O3FA 5ELZA 1XI1A 3KHYA 1R0AA 5AQGA 4DTRA 1ATSA 5J2NA 3D0PA 2VWKA 3AY9A 4CHZA 3EE9A 5M1FA 1BIZA 3EEQA 3WEEA 3I33A 4IWVA 3AA2A 1K6YA 3ID8A 3T1AA 4GV6A 3SNNA 3SJHA 4NLCA 1Q86O 3HPOA 3OYIA 3MN7A 4B3OA 2WUSA 3ULDA 1NJZA 3M3ZA 1S9GA 4B1XB 2NZTA 3I8DA 2QWQA 3DWLA 1YI2N 1BWFO 4E7HA 2DTUA 1P8ZA 3M8QA 4KH6A 3NDKA 1JCFA 1HNXK 3B8AX 3V9XA 5JMVA 4IKFA 2A5XA 3O9UA 5CR4A 5BN8A 5CHIA 2QI2A 5H1SQ 1B9DA 4Z4GA 4OVLA 3O1BA 4CJRA 4FWSA 1RTIA 4IFVA 1XUPO 4KKOA 3A8YA 3AGRA 4EP5A 1Q9XA 1BDGA 4B9TA 4LF4K 2GTDA 3IRXA 3MXJA 3SUQA 3CCJN 1QSSA 1WB9A 2JLEA 3ZLJA 2KZZA 5M1OA 4YDUA 3AARA 4FLTA 2OZSA 4KHPK 1JLFA 4JEPA 3WNFA 3SUOA 1BI4B 4XIUA 3IUCA 1IO2A 4C1NK 2HBLA 5GAEP 2HHWA 4WYBA 4RTFD 4IFYA 4M7YA 4E3SA 3T1HK 5C2DA 2F8SA 5KTQA 5AZIA 1QQMA 3LDQA 1Y64A 4KRFA 4C8MA 5AQTA 2QWOA 4FWRA 1I3AA 1NOZA 2VQEK 4QOZB 3LP0A 1RCHA 4FM2A 3AVKA 3P38A 1RDDA 2OTJN 4BQLA 1QHAA 1KAZA 3S3OA 4FZXC 3PY8A 1QTMA 3RMCA 4JI1K 4DQIA 1N36K 4ZTFA 1NGJA 3HVTA 4BVPA 1JCGA 3QETA 3ULEB 1QSYA 4K43A 4CBXA 4JKGA 2KW4A 4C8NA 4ICLA 3CJCA 2XY6A 4CEOA 4DR1K 3AVMA 3I56N 1BI4A 3E9LA 2HBKA 2BANA 5AQVA 1JCEA 4CK2A 1O13A 2BH1A 3FZLA 1VRTA 3OYBA 4IOXA 2D0PA 1RGIA 3OYMA 3WNEA 4JRQA 3QFUA 4I9LA 1TYQB 1HUXA 3TTCA 4CD1A 1W97L 2FBYA 4CJVA 2NRXA 2YI1A 5AQFA 4JAXA 3WXJA 2HNYA 3RSEA 2E5LK 4JKBA 4GY2B 2BGGA 4J2AA 4DFPA 1S1UA 5AZJB 4DV3K 2A1SA 2FSJA 2YX6A 2A6AA 3KLGA 2ZJRL 4HTUA 4EZ6A 3VN5A 4NXNK 3A2FA 1WBBA 3PSIA 2GEMA 1ASWA 1WSFA 3LDNA 1VQNN 1X3MA 3L4QA 3KLEA 1TV6A 4DR5K 5FPMA 2FC0A 1HKCA 3P4IA 3G71N 2VWBA 4B9QA 3EKSA 5KQDA 4RWTA 3J81O 1IV0A 2PZSA 3RR8A 3I0SA 1TK8A 1HNVA 3HYFA 1J5EK 3CCLN 3T19A 3FZMA 1N32K 2UXCK 4B3TK 3CJAA 1LOTB 4LH4A 2XY7A 4C1NI 3BZCA 3P5JA 3WT0A 4GV3A 1T03A 3K57A 4JLHA 3AVAA 4C8KA 1GLFO 1SKRA 4DV1K 1NJIO 3OVNA 4FJ5A 5AQLA 3N4QA 5BPNA 3J7AP 5AR0A 3TANA 2ZGYA 3KK7A 4EZ9A 2YKNA 3K5OA 3LALA 3R1XA 4LY7A 3K59A 4B9VA 1RTJA 3H3OB 2G8FA 4WQ5A 4DKWA 4DR6K 3SQ1A 4E7KA 1S6QA 5TKWA 5KQ8A 3SZ2A 4DUYK 3VEVA 4DS5A 4CIGA 4DFKA 1H1VA 5DM7L 3CI5A 3UKUA 2FLOA 3J80O 1Q18A 4H5NA 3LANA 2IS3A 3MN5A 2OTLN 4YOTA 2V51B 2XY8A 1J54A 5KI6A 3EZWA 2IGIA 1S72N 4KTQA 3DMJA 1S1XA 3S3MA 4PWDA 3DXMA 3DLRA 1LCUA 3MMVA 1GOBA 3QERA 3MN6A 3O80A 3TTFA 4FWNA 2P9SA 3SI6A 1HPMA 4IOCL 1GLAG 4M42A 2WC9A 3VF2A 4DFMA 2D0OA 1WSEA 5LMUK 1BA0A 3AGKA 2UU9K 3LZIA 4PQUA 3MX5A 3HP6A 1OH8A 3TAFA 4QS9A 3OYCA 3HPHA 3CPWM 1HR0K 4CGDA 5DM6L 3WXIA 1ZBHA 1GLDG 4JYAK 4IG3A 4N56A 3KK2A 4BY9C 4FJGA 1BOTO 5LJWA 3HO1A 1LAVA 3C6TA 4E19A 1I39A 3EO3A 3MAQA 1UWBA 4KV8A 2CGLA 5AQJA 1YXQA 2Q2RA 3HZ6A 2VGMA 1OVYA 1EKEA 3QEIA 3OW2M 3K5LA 1LW0A 1KVCA 1GLEG 3OY9A 4FJ8A 3TU5A 2DY4A 2ASMA 4ISEA 1SAZA 4DMNA 4A2BA 4C23A 4CJFA 4JD2A 3T1YK 1NGAA 2YNHA 4DUZK 4CFCA 1GLJO 4HHTA 2W6KA 4IJNA 4FYDA 3MCPA 1Y97A 1RT4A 4AHVA 2PAVA 2OPRA 4FLVA 3QESA 3VQ4A 2P9IA 1VQ4N 1HNIA 3SYZA 2FBVA 2GV9A 3PUFA 1IH7A 1WAFA 3CF5L 3ZEUB 4H0TB 3L3VA 1NK8A 2Y1JA 1D5AA 4BGBA 5BREA 4Z4CA 2VG6A 4Q5VA 4BC2A 2IDOA 3JXUA 3RVCA 1NGFA 5LL6Z 3QEWA 3VQEA 2V52B 4N47A 4I9QA 3AVFA 2Y1IA 3BP8A 3T7ZA 2HB5A 1K8AO 4KI6A 1YJNN 2UYTA 1GLLO 3RRGA 4FVMA 3DYAA 4CEZA 3ZT2A 4BDZA 3JAMO 1QE1A 3SBTA 4RCHA 4MLHA 4CW7B 4CJSA 4HUFA 1HNWK 4CGIA 3C6UA 4K0KK 3F73A 4FZYA 3I0RA 3N4PA 1VSHA 2Q36A 1LV5A 1YVNA 4PL8A 2FSNA 3D2FB 3IFRA 1EQYA 4CZEA 3ATVA 4DTJA 2G8UA 4X62K 4UQGA 1HPZA 5BR9A 4FW2A 3PSFA 2AP1A 5FRMA 2R7YA 1T8EA 4J2DA 3O4WA 3NF7A 4LF6K 3B6PA 2P9SB 3C65A 3O9SA 3U3GA 4BDPA 4M3XA 3C6HA 1DGKN 4E7IA 2FBXA 3MEDA 2HNZA 3O3GA 3D7EO 3LDSA 2PYLA 1KTQA 3THVA 2ASOA 1RT1A 4OGCA 4AM6A 3NVKA 2Q3SA 5KRSA 4CZKA 5T7BA 5MLCQ 2A3ZA 3LM9A 1X1PA 1CXUA 2PYJA 1J6ZA 1HMVA 3PX0A 3JYTA 4W5NA 1Q7YO 1UAXA 4DQRA 3MXIA 4CEEA 1KVBA 3TSUA 3DRRA 5M1QA 1RBVA 3DLKA 4KHUA 3ENOA 4LFBK 4BRNA 3RMDA 4H5VA 4WQ4C 3BDPA 2FF6A 2B5JA 3VEZA 4H03B 2HNDA 4MLEA 3HP9A 2GX9A 4BGAA 4B9SA 4KHWA 3F9KA 3ENHA 1TUUA 2FSKA 3ASMA 4BRCA 5J2PA 2HMIA 1N33K 4GV9A 3T69A 1NJXA 3OHRA 4CEFA 1K8KB 2OYQA 3UB5A 2E2PA 5HLFA 4BVOA 2P9NB 3S3NA 1KSPA 2A41A 3TAPA 2XO7A 3AV9A 1QQCA 3V9SA 4DTUA 4E1MA 4PA1A 1KRPA 3RMAA 1T6DA 2F7TA 3L2RA 1IBLK 5AJ3K 5E84A 3CQ8A 1VQ7N 5BRFA 4H0PA 1NLVA 3SLCA 1B92A 1U4BA 2CGJA 4B1VA 1BISA 4JK7A 1YAGA 3CXCM 1BQNA 2GBZA 4R5PA 5CZ1A 3VGKA 2ATQA 1S3XA 4LFCK 3CYMA 3S41A 4ELTA 4ILGB 2O8DA 3LZJA 4JI4K 3DLLL 4CHOA 3IDHA 3TARA 2JGUA 3J7ZO 2V7YA 2IOCA 4KI4A 3KZBA 5BR8K 4YY3K 1YJ9N 4B1YB 3IAYA 2YHWA 3CMAN 3ISNC 1NK9A 3MXMA 4K8ZA 3AO4A 3TTDA 1X9MA 1RT3A 3C6AA 1EP4A 3C7NB 3AVGA 2P9PB 2P1JA 4A62A 4DTSA 3VEWA 1RBSA 1HKGA 3EY1A 1E3MA 3VQ8A 1NKCA 4KHNA 1T6CA 3L2VA 3HXMA 1W0HA 3GDQA 5GAGP 4CHNA 1KLNA 3SCXA 3QICA 2HHUA 1S5JA 5KPZA 1IBKK 4DV7K 3C0BA 1KVAA 4FM1A 3M8RA 4FJIA 4PUOA 4IO9L 4ISGA 1Z6RA 4CF2A 4FWOA 3VEOA 1VSDA 2O4IA 4H5TA 4NB4A 4QS8A 2X78A 3AAQA 4OKJA 5F1XA 4G9ZA 4EIAA 1WSHA 4CD3A 1W7AA 2ZQBA 1JXEA 3A5MC 3WQTA 4X64K 1Q8IA 2RPIA 4OJRA 3SQ4A 3HTVA 2KTQA 1NGEA 1IKVA 4JI8K 3PIPL 4IO8A 3QO9A 4MDAA 4N41A 4M3UA 4BRIA 3F9MA 1VSLA 5GIPA 1C6VA 4BE0A 4FZZA 4JHDB 4KH4A 4QS7A 4DSIA 1RBRA 1HQUA 4DWIA 3OYNA 3BEXA 3QEPA 3OTOK 1QZ6A 4FK0A 4JI2K 2PY5A 3VQ5A 4DSLA 3L2UA 1X9WA 4BRHA 1TVRA 4M3ZA 4FJMA 1VQ6N 4CJUA 3WQUA 3CJ7A 1L3TA 2P9LA 3HSTB 4O44A 3OBYA 3VENA 3NH2A 3NHGA 3C95A 4A57A 3MWTA 1BL3A 3VTHA 3SUNA 2EWSA 1WNSA
chains in the Genus database with same CATH topology
1FK9A 2OZMA 5HRNA 2G8HA 4FJ7A 4GW6A 1SKRA 2P5OA 3WNGA 3AO5A 3OYEA 1D9DA 1UA0A 1XHXA 3OVNA 4FJ5A 2RKIA 1EX4A 3ZSQA 1IKXA 3AVNA 1RTDA 2F8TA 1J9AA 4O4GA 4FLYA 1YT3A 3TANA 3OJUA 4Z4EA 3P83D 4EZ9A 2YKNA 5EU7A 3K5OA 3LALA 1TL3A 4LY7A 1ASVA 3K59A 5HP1A 4B9VA 3E01A 1RTJA 2BDPA 4B9NA 2G8FA 3KD5E 3ZSYA 3C94A 3H08A 5HROA 3SQ1A 4E7KA 4E0DA 4F4KA 1S6QA 4AHSA 4FLXA 4DFJA 1HQEA 4RW7A 4ZTJA 3CM6A 4KHSA 4DQQA 3SZ2A 3PV8A 1F21A 1JLGA 1B9FA 4FXDA 2DFFA 4B9LA 1RNHA 4DS5A 2OPQA 2YKMA 1A5WA 3ITHA 4M45A 3VQ6A 4CIGA 4E7JA 4DFKA 4E89A 1SV5A 1BIUA 4OPKA 1XC9A 4DSEA 4CJWA 4DTXA 2G8IA 2LSNA 1VRUA 3D45A 4FJNA 2HVHA 1J53A 3T3FA 1D9FA 4FK4A 1VSKA 3ZT4A 3DLHA 3LANA 4DU3A 2IS3A 2P5GA 1REVA 1ZBUA 1BHLA 3PX6A 3L2WA 3RTVA 2XY8A 2QKBA 1C1CA 1J54A 5KI6A 3TABA 3V6DA 3SPYA 3V9WA 4FJKA 3QINA 5SWMA 2IGIA 1BQMA 1LWEA 3SPZA 1TK0A 4KTQA 1CZBA 3NGZA 3DMJA 1S1XA 3S3MA 4IDKA 4PWDA 3NBPA 4N5SA 3DLRA 4CEAA 4JRPA 4CHPA 1GOBA 1JL1A 3QERA 4F3TA 4ID1A 5I3UA 3K2PA 3SI6A 4ELVA 4O0JA 4M42A 4KAZA 1S6PA 1SKWA 2WONA 2Z1HA 3V1QA 5C25A 1IKWA 4Y1CA 3IS9A 4DFMA 3MEGA 1JKHA 1WSEA 1NK7A 4KTZA 1U04A 4AILC 3AVCA 4Y1DA 3AVLA 3KK3A 3TAEA 3LZIA 4FLZA 3AO1A 4PQUA 2RN2A 3K5NA 2FBTA 2HVIA 3HP6A 1DLOA 4Z4IA 1SL1A 4C8LA 1WSGA 3NF6A 5CYMA 3TAFA 3OYCA 3HPHA 1TKZA 2OA8A 4CGDA 1KFSA 2OPSA 3G10A 4J2EA 3TAGA 3MECA 2X74A 3UIQA 1ZBHA 4IG3A 4N56A 3KK2A 3VQQA 4FJGA 3AVHA 3HL8A 3L3UA 4DTOA 3QNNA 2Z1IA 1BCOA 1JLQA 3KLIA 4CIFA 1LAVA 4BWMA 1TL1A 3C6TA 4E19A 1UA1A 1I39A 4F2SA 1JLEA 3HO1A 4AHRA 4W5RA 3MAQA 3VQDA 1TK5A 1UWBA 4KV8A 4RW8A 4H4MA 4MQ3A 3PX4A 1C1BA 4M3TA 1L5UA 3MEEA 1EKEA 1XHZA 3QEIA 5KRTA 3K5LA 1LW0A 1KVCA 3OY9A 4FJ8A 4MFBA 3RR7A 4CJ5A 2DY4A 3M8SA 2D0AA 3LPUA 4BE1A 2D0BA 4FJLA 4NYFA 4DMNA 3NF8A 4CJQA 4DQSA 3S9HA 1RBTA 3BGRA 3CM5A 4CJFA 2X6NA 4GMJB 3KD1E 2HHXA 2YNHA 3OJSA 2F96A 3QIOA 2IAJA 4CFCA 1Q9YA 1RBUA 3VA0A 2GUIA 4HHTA 4FYDA 1RDCA 3CFOA 3DI6A 1Y97A 4JS5A 1RT4A 2VG5A 4AHVA 3OYGA 2OPRA 1LAWA 2D0CA 4B8CA 4FLVA 3QESA 1NOYA 3OYLA 3VQ4A 1HYZA 5J2QA 1HNIA 1WLJA 3EYZA 1WSIA 2NUBA 3IG1A 3CFRA 2DFEA 3SYZA 1L3UA 2IC3A 4CJTA 4W5QA 4IG0A 2FBVA 2GV9A 3PUFA 1U49A 1IH7A 1WAFA 1L3SA 4CHQA 3EZ5A 4DSKA 2HW3A 4NYNA 1TGOA 4DSJA 4NCBA 1EETA 4DTMA 5FDLA 3HPGA 5FROA 3L3VA 1NK8A 3CG7A 2YNFA 4CEDA 1WAJA 4W5OA 3LAMA 1SUQA 2VWJA 2Y1JA 1D5AA 1NJWA 4Z4CA 1LWFA 3L8BA 4CGHA 4CGFA 1JLAA 2VG6A 3P1GA 4Q5VA 3DRPA 2IDOA 3O4NA 3O3HA 4TSXA 4HUEA 4CGJA 3SQ0A 4HCBA 1EXQA 2B6AA 1VSIA 4DF8A 2W42A 3TI0A 3QEWA 3VQEA 5KGXA 2HHVA 5C42A 4K8XA 3DLGA 4N47A 4E7LA 2ZD1A 4I9QA 3AVFA 1D8YA 1S1TA 2E4LA 2Y1IA 4DQPA 4NCAA 5DMRA 4ID5A 4RG8A 3JSMA 4CESA 2YHBA 1ZBLA 2HB5A 5KGWA 5J2MA 4KI6A 1RT7A 1TKXA 3OS1A 4KHQA 3RRHA 3OYFA 4AHCA 3RRGA 2I5JA 4FVMA 4OKKA 4HVJA 3DYAA 3VA3A 3V4IA 1T7PA 3ZSVA 4CEZA 4E1NA 1CXQA 3QLHA 1QHTA 3ZT2A 5SZTA 4W5TA 1QE1A 2XRIA 3K5MA 4BDZA 1UOCA 1ITGA 4KB0A 4CJSA 4O0IA 4HUFA 3TAQA 4CGIA 2RF2A 3C6UA 1RT5A 1N6QA 3KKRA 2X6SA 3F73A 4WE1A 4DSFA 3I0RA 3SJJA 2QXFA 4FZYA 1VSHA 4LD0A 1A5XA 5C24A 4M41A 1RT2A 1LV5A 3ZSRA 3AO3A 4IBNA 3HM9A 3AO2A 3U6FA 2Z1GA 4DTJA 3TWHA 2QKKA 2G8UA 3PO5A 4UQGA 1HPZA 3NH0A 1VSMA 2YNIA 4FW2A 1QSLA 2WOMA 1JLCA 1SKSA 1NK0A 4HUGA 5FRMA 3K58A 2R7YA 1NK4A 1T8EA 1NKBA 4I2QA 4J2DA 3NH1A 3DOKA 3NF7A 3LWLA 3B6PA 3OS2A 3U3GA 3LP3A 1FXXA 3ZSWA 3O3FA 4BDPA 3PO4A 4M3XA 4OLAA 1W9HA 4E7IA 2FBXA 4LH5A 1XI1A 1R0AA 3MEDA 2HNZA 3O3GA 3LDSA 4DTRA 5J2NA 1KTQA 3THVA 3D0PA 2PYLA 4M3YA 2HHSA 2VWKA 1RT1A 3AVJA 3RWUA 4F8RA 4CHZA 4OGCA 4RW4A 4B8AB 4CFDA 3ALYA 1BIZA 1FKOA 2Q3SA 3LAKA 5KRSA 3SV3A 4CE9A 3AA2A 1K6YA 3T1AA 3VQAA 2ITGA 5T7BA 2HHTA 4CJEA 4PY5A 1X1PA 3SNNA 1CXUA 3AA5X 4OKEA 3VQ9A 5JS1A 3V81A 2PYJA 4CFBA 1C0UA 3OYKA 1G15A 4FJJA 3HPOA 4CK1A 3OYIA 1HMVA 3PX0A 1U48A 1L3VA 3JYTA 4W5NA 1UAXA 4CJ3A 3OYHA 4DQRA 3ULDA 3MXIA 5CYQA 1NJZA 4B3OA 1S9GA 1YTAA 5HBMA 4CEEA 2O4GA 3I8DA 3OS0A 3QNOA 1KVBA 4DF4A 3HJFA 3LP1A 3DRRA 4G1QA 4E7HA 1N5YA 1HYSA 2DTUA 5K14A 5HRSA 1RBVA 1C1AA 4GVMA 3V9ZA 3QEXA 4HCCA 3DLKA 3M8QA 4KHUA 3NGYA 1LW2A 4O5BA 1Z25A 4FLUA 3NDKA 3RMDA 3DOLA 3BDPA 4DG1A 2KQ2A 1JLBA 1NK5A 3V9XA 4IKFA 1VSJA 2B5JA 4DTPA 4I7FA 2HNDA 5E41A 3HP9A 3NE6A 4KREA 4B9SA 1ZBFA 3DM2A 4KHWA 3F9KA 3VQCA 4OPJA 4CHYA 3OYJA 4FLWA 1J5OA 1B9DA 1S1WA 1JXBA 3B6OA 3LPTA 3ASMA 2HMIA 1S9EA 5J2PA 4Z4GA 4OVLA 3WNHA 1NJXA 4CJRA 2KFNA 4AH9A 4CEFA 1RTIA 4FCYA 1WSJA 1HRHA 4IFVA 5HRRA 2OYQA 3FFIA 2KFZA 2P51A 5HLFA 4KKOA 1Q9XA 4EP5A 3S3NA 3AA4A 4B9UA 3VQPA 1KSPA 1TKDA 3NF9A 4B9TA 1T05A 3TAPA 4DLEA 3KTQA 3IRXA 4J2BA 3MXJA 3SUQA 2XO7A 1VK0A 3AV9A 1QQCA 1QSSA 1ZBIA 4CF9A 3L2QA 2JLEA 3V9SA 4DTUA 2KZZA 2YNGA 4H4OA 4E1MA 4PA1A 1KRPA 3RMAA 3OYDA 1VSEA 3L2RA 4B9MA 1RDBA 3CQ8A 4FM0A 4FLTA 4Z0UA 3KJVA 2OZSA 1JLFA 4CFAA 4CECA 1B92A 3WNFA 2XY5A 3SUOA 1U4BA 3KK1A 1BI4B 4XIUA 2ETJA 4YNQA 4CF1A 4YFUA 3NCIA 1IO2A 1VSFA 1BISA 4F3OA 2HHWA 1BQNA 2GBZA 4IFYA 4RW6A 4Z4HA 4OGEA 4R5PA 3ZT0A 4E3SA 4LSLA 1C0MA 4BWJA 4L8RB 2F8SA 5CZ1A 4CK3A 5KTQA 4O55A 4KO0A 3KLFA 1YVUA 3U3YA 2ATQA 3HK2A 4KRFA 5CY4A 3DLEA 4C8MA 5JS2A 3HVRA 1C0TA 3AVIA 1I3AA 3CYMA 1NOZA 1ZYQA 4ELTA 4FK2A 4BDYA 3LZJA 4CERA 1DTQA 4QOZB 3LP0A 4CHOA 1CZ9A 1RCHA 4FM2A 3TARA 2JGUA 2AJQA 3AVKA 4QCLA 1RDDA 1RILA 2IOCA 3KKSA 3ZT1A 4LSNA 4ELUA 4KI4A 1TAUA 3S3OA 4FZXC 3AA3A 3IAYA 4OLBA 3PY8A 4NCGA 4CJLA 3ISNC 1RDAA 2OPPA 4CJ4A 3RMCA 3MXMA 3TR8A 1NK9A 4K8ZA 4DQIA 4KHYA 4Z4FA 1Z26A 3AO4A 3ZSXA 4CJKA 2Z1JA 3SV4A 1X9MA 1RT3A 2E6MA 3LWMA 4ZTFA 1EP4A 5D3GA 3HVTA 4CF0A 2XHBA 3QETA 4H8KA 4AHUA 1QSYA 3AVGA 3ZSOA 3HT3A 2P1JA 4F2RA 4DTSA 1NKEA 4M3WA 1RBSA 2KW4A 4C8NA 4ICLA 4M3RA 3EY1A 5J1EA 4CJPA 3SUPA 5DK5A 2XY6A 1NK6A 3VQ8A 4CEOA 1NKCA 4KB1A 4KHNA 3L2VA 3HXMA 1W0HA 3AVMA 1HJRA 3V1OA 4AHTA 4QAGA 4DWIA 1O1WA 4CHNA 1CLQA 1BI4A 2EHGA 1KLNA 3SCXA 2YV0X 1X9SA 4ZHRA 2HHUA 1S5JA 2BANA 3SQ2A 3M8PA 4DU1A 3O4QA 4C8OA 2QK9A 4RW9A 1IG9A 4CK2A 5FRNA 4FM1A 2DFHA 1KVAA 4FJIA 2YHAA 3M8RA 4PUOA 1VRTA 1KFDA 5HRPA 1NJYA 3OYBA 4CGGA 1U45A 5CZ2A 3OYMA 3G0ZA 4CF2A 3WNEA 3ZT3A 4JRQA 1VSDA 4DLGA 2O4IA 4I9LA 2X78A 1TKTA 4OKJA 4CIEA 2FBYA 4CJVA 2ZE2A 4N76A 1WSHA 3RMBA 1YTUA 2HNYA 3NGIA 3QEVA 4CEBA 2ZQBA 1TAQA 3KIOA 1JXEA 4J2AA 4DFPA 2BGGA 1S1UA 1QS4A 1LWCA 1RT6A 2KZMA 3ZSZA 1SL2A 2A1SA 3VQ7A 1Q8IA 4BE2A 2RPIA 4OJRA 4CCHA 3SQ4A 1BCMA 1KLMA 1ASUA 3KLGA 2KTQA 1HYVA 4EP4A 1BGXT 4HTUA 3VN5A 4EZ6A 3A2FA 1IKVA 3AVBA 1ASWA 4DTNA 1WSFA 4FJ9A 3QO9A 3LP2A 1MU2A 1SL0A 3DLBA 3KLEA 3CFPA 4N41A 5I42A 3QIPA 4M3UA 1GOCA 1TV6A 2B4JA 1VSLA 4BE0A 1C6VA 4FJHA 4CF8A 4FJXA 4I2PA 4FZZA 2FC0A 2HHQA 3NAEA 3V9UA 4DSIA 2VG7A 1RBRA 1HQUA 2BE2A 4CEQA 1DTTA 1IKYA 1JL2A 3DRSA 2EX3A 1WN7A 3VQBA 2E6LA 3OYNA 3KLHA 3QEPA 1RTHA 4B08A 2PZSA 4FK0A 3RR8A 2PY5A 1XWLA 3VQ5A 3I0SA 1TK8A 3NFAA 2G8KA 4DSLA 1HNVA 1FKPA 3HYFA 3L2UA 1X9WA 1GOAA 3T19A 4M3ZA 1TVRA 4KFBA 4Q0BA 1QTMA 3ZCMA 4FJMA 4LH4A 2A1RA 4CJUA 2XY7A 4KTWA 4KPYA 4FW1A 1L3TA 1KCFA 3TAMA 2G8VA 4BACA 3P5JA 3HSTB 2D5RA 4O44A 3V1RA 4DS4A 3NH2A 1T03A 3NHGA 3C95A 3K57A 4JLHA 1S1VA 4JS4A 1BL3A 3AVAA 1A5VA 4C8KA 2G8WA 3OYAA 4DU4A 3SUNA 1U47A 1WNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FK9 A;  2OZM A;  5HRN A;  2G8H A;  4FJ7 A;  4GW6 A;  1SKR A;  2P5O A;  3WNG A;  3AO5 A;  3OYE A;  1D9D A;  1UA0 A;  1XHX A;  3OVN A;  4FJ5 A;  2RKI A;  1EX4 A;  3ZSQ A;  1IKX A;  3AVN A;  1RTD A;  2F8T A;  1J9A A;  4O4G A;  4FLY A;  1YT3 A;  3TAN A;  3OJU A;  4Z4E A;  3P83 D;  4EZ9 A;  2YKN A;  5EU7 A;  3K5O A;  3LAL A;  1TL3 A;  4LY7 A;  1ASV A;  3K59 A;  5HP1 A;  4B9V A;  3E01 A;  1RTJ A;  2BDP A;  4B9N A;  2G8F A;  3KD5 E;  3ZSY A;  3C94 A;  3H08 A;  5HRO A;  3SQ1 A;  4E7K A;  4E0D A;  4F4K A;  1S6Q A;  4AHS A;  4FLX A;  4DFJ A;  1HQE A;  4RW7 A;  4ZTJ A;  3CM6 A;  4KHS A;  4DQQ A;  3SZ2 A;  3PV8 A;  1F21 A;  1JLG A;  1B9F A;  4FXD A;  2DFF A;  4B9L A;  1RNH A;  4DS5 A;  2OPQ A;  2YKM A;  1A5W A;  3ITH A;  4M45 A;  3VQ6 A;  4CIG A;  4E7J A;  4DFK A;  4E89 A;  1SV5 A;  1BIU A;  4OPK A;  1XC9 A;  4DSE A;  4CJW A;  4DTX A;  2G8I A;  2LSN A;  1VRU A;  3D45 A;  4FJN A;  2HVH A;  1J53 A;  3T3F A;  1D9F A;  4FK4 A;  1VSK A;  3ZT4 A;  3DLH A;  3LAN A;  4DU3 A;  2IS3 A;  2P5G A;  1REV A;  1ZBU A;  1BHL A;  3PX6 A;  3L2W A;  3RTV A;  2XY8 A;  2QKB A;  1C1C A;  1J54 A;  5KI6 A;  3TAB A;  3V6D A;  3SPY A;  3V9W A;  4FJK A;  3QIN A;  5SWM A;  2IGI A;  1BQM A;  1LWE A;  3SPZ A;  1TK0 A;  4KTQ A;  1CZB A;  3NGZ A;  3DMJ A;  1S1X A;  3S3M A;  4IDK A;  4PWD A;  3NBP A;  4N5S A;  3DLR A;  4CEA A;  4JRP A;  4CHP A;  1GOB A;  1JL1 A;  3QER A;  4F3T A;  4ID1 A;  5I3U A;  3K2P A;  3SI6 A;  4ELV A;  4O0J A;  4M42 A;  4KAZ A;  1S6P A;  1SKW A;  2WON A;  2Z1H A;  3V1Q A;  5C25 A;  1IKW A;  4Y1C A;  3IS9 A;  4DFM A;  3MEG A;  1JKH A;  1WSE A;  1NK7 A;  4KTZ A;  1U04 A;  4AIL C;  3AVC A;  4Y1D A;  3AVL A;  3KK3 A;  3TAE A;  3LZI A;  4FLZ A;  3AO1 A;  4PQU A;  2RN2 A;  3K5N A;  2FBT A;  2HVI A;  3HP6 A;  1DLO A;  4Z4I A;  1SL1 A;  4C8L A;  1WSG A;  3NF6 A;  5CYM A;  3TAF A;  3OYC A;  3HPH A;  1TKZ A;  2OA8 A;  4CGD A;  1KFS A;  2OPS A;  3G10 A;  4J2E A;  3TAG A;  3MEC A;  2X74 A;  3UIQ A;  1ZBH A;  4IG3 A;  4N56 A;  3KK2 A;  3VQQ A;  4FJG A;  3AVH A;  3HL8 A;  3L3U A;  4DTO A;  3QNN A;  2Z1I A;  1BCO A;  1JLQ A;  3KLI A;  4CIF A;  1LAV A;  4BWM A;  1TL1 A;  3C6T A;  4E19 A;  1UA1 A;  1I39 A;  4F2S A;  1JLE A;  3HO1 A;  4AHR A;  4W5R A;  3MAQ A;  3VQD A;  1TK5 A;  1UWB A;  4KV8 A;  4RW8 A;  4H4M A;  4MQ3 A;  3PX4 A;  1C1B A;  4M3T A;  1L5U A;  3MEE A;  1EKE A;  1XHZ A;  3QEI A;  5KRT A;  3K5L A;  1LW0 A;  1KVC A;  3OY9 A;  4FJ8 A;  4MFB A;  3RR7 A;  4CJ5 A;  2DY4 A;  3M8S A;  2D0A A;  3LPU A;  4BE1 A;  2D0B A;  4FJL A;  4NYF A;  4DMN A;  3NF8 A;  4CJQ A;  4DQS A;  3S9H A;  1RBT A;  3BGR A;  3CM5 A;  4CJF A;  2X6N A;  4GMJ B;  3KD1 E;  2HHX A;  2YNH A;  3OJS A;  2F96 A;  3QIO A;  2IAJ A;  4CFC A;  1Q9Y A;  1RBU A;  3VA0 A;  2GUI A;  4HHT A;  4FYD A;  1RDC A;  3CFO A;  3DI6 A;  1Y97 A;  4JS5 A;  1RT4 A;  2VG5 A;  4AHV A;  3OYG A;  2OPR A;  1LAW A;  2D0C A;  4B8C A;  4FLV A;  3QES A;  1NOY A;  3OYL A;  3VQ4 A;  1HYZ A;  5J2Q A;  1HNI A;  1WLJ A;  3EYZ A;  1WSI A;  2NUB A;  3IG1 A;  3CFR A;  2DFE A;  3SYZ A;  1L3U A;  2IC3 A;  4CJT A;  4W5Q A;  4IG0 A;  2FBV A;  2GV9 A;  3PUF A;  1U49 A;  1IH7 A;  1WAF A;  1L3S A;  4CHQ A;  3EZ5 A;  4DSK A;  2HW3 A;  4NYN A;  1TGO A;  4DSJ A;  4NCB A;  1EET A;  4DTM A;  5FDL A;  3HPG A;  5FRO A;  3L3V A;  1NK8 A;  3CG7 A;  2YNF A;  4CED A;  1WAJ A;  4W5O A;  3LAM A;  1SUQ A;  2VWJ A;  2Y1J A;  1D5A A;  1NJW A;  4Z4C A;  1LWF A;  3L8B A;  4CGH A;  4CGF A;  1JLA A;  2VG6 A;  3P1G A;  4Q5V A;  3DRP A;  2IDO A;  3O4N A;  3O3H A;  4TSX A;  4HUE A;  4CGJ A;  3SQ0 A;  4HCB A;  1EXQ A;  2B6A A;  1VSI A;  4DF8 A;  2W42 A;  3TI0 A;  3QEW A;  3VQE A;  5KGX A;  2HHV A;  5C42 A;  4K8X A;  3DLG A;  4N47 A;  4E7L A;  2ZD1 A;  4I9Q A;  3AVF A;  1D8Y A;  1S1T A;  2E4L A;  2Y1I A;  4DQP A;  4NCA A;  5DMR A;  4ID5 A;  4RG8 A;  3JSM A;  4CES A;  2YHB A;  1ZBL A;  2HB5 A;  5KGW A;  5J2M A;  4KI6 A;  1RT7 A;  1TKX A;  3OS1 A;  4KHQ A;  3RRH A;  3OYF A;  4AHC A;  3RRG A;  2I5J A;  4FVM A;  4OKK A;  4HVJ A;  3DYA A;  3VA3 A;  3V4I A;  1T7P A;  3ZSV A;  4CEZ A;  4E1N A;  1CXQ A;  3QLH A;  1QHT A;  3ZT2 A;  5SZT A;  4W5T A;  1QE1 A;  2XRI A;  3K5M A;  4BDZ A;  1UOC A;  1ITG A;  4KB0 A;  4CJS A;  4O0I A;  4HUF A;  3TAQ A;  4CGI A;  2RF2 A;  3C6U A;  1RT5 A;  1N6Q A;  3KKR A;  2X6S A;  3F73 A;  4WE1 A;  4DSF A;  3I0R A;  3SJJ A;  2QXF A;  4FZY A;  1VSH A;  4LD0 A;  1A5X A;  5C24 A;  4M41 A;  1RT2 A;  1LV5 A;  3ZSR A;  3AO3 A;  4IBN A;  3HM9 A;  3AO2 A;  3U6F A;  2Z1G A;  4DTJ A;  3TWH A;  2QKK A;  2G8U A;  3PO5 A;  4UQG A;  1HPZ A;  3NH0 A;  1VSM A;  2YNI A;  4FW2 A;  1QSL A;  2WOM A;  1JLC A;  1SKS A;  1NK0 A;  4HUG A;  5FRM A;  3K58 A;  2R7Y A;  1NK4 A;  1T8E A;  1NKB A;  4I2Q A;  4J2D A;  3NH1 A;  3DOK A;  3NF7 A;  3LWL A;  3B6P A;  3OS2 A;  3U3G A;  3LP3 A;  1FXX A;  3ZSW A;  3O3F A;  4BDP A;  3PO4 A;  4M3X A;  4OLA A;  1W9H A;  4E7I A;  2FBX A;  4LH5 A;  1XI1 A;  1R0A A;  3MED A;  2HNZ A;  3O3G A;  3LDS A;  4DTR A;  5J2N A;  1KTQ A;  3THV A;  3D0P A;  2PYL A;  4M3Y A;  2HHS A;  2VWK A;  1RT1 A;  3AVJ A;  3RWU A;  4F8R A;  4CHZ A;  4OGC A;  4RW4 A;  4B8A B;  4CFD A;  3ALY A;  1BIZ A;  1FKO A;  2Q3S A;  3LAK A;  5KRS A;  3SV3 A;  4CE9 A;  3AA2 A;  1K6Y A;  3T1A A;  3VQA A;  2ITG A;  5T7B A;  2HHT A;  4CJE A;  4PY5 A;  1X1P A;  3SNN A;  1CXU A;  3AA5 X;  4OKE A;  3VQ9 A;  5JS1 A;  3V81 A;  2PYJ A;  4CFB A;  1C0U A;  3OYK A;  1G15 A;  4FJJ A;  3HPO A;  4CK1 A;  3OYI A;  1HMV A;  3PX0 A;  1U48 A;  1L3V A;  3JYT A;  4W5N A;  1UAX A;  4CJ3 A;  3OYH A;  4DQR A;  3ULD A;  3MXI A;  5CYQ A;  1NJZ A;  4B3O A;  1S9G A;  1YTA A;  5HBM A;  4CEE A;  2O4G A;  3I8D A;  3OS0 A;  3QNO A;  1KVB A;  4DF4 A;  3HJF A;  3LP1 A;  3DRR A;  4G1Q A;  4E7H A;  1N5Y A;  1HYS A;  2DTU A;  5K14 A;  5HRS A;  1RBV A;  1C1A A;  4GVM A;  3V9Z A;  3QEX A;  4HCC A;  3DLK A;  3M8Q A;  4KHU A;  3NGY A;  1LW2 A;  4O5B A;  1Z25 A;  4FLU A;  3NDK A;  3RMD A;  3DOL A;  3BDP A;  4DG1 A;  2KQ2 A;  1JLB A;  1NK5 A;  3V9X A;  4IKF A;  1VSJ A;  2B5J A;  4DTP A;  4I7F A;  2HND A;  5E41 A;  3HP9 A;  3NE6 A;  4KRE A;  4B9S A;  1ZBF A;  3DM2 A;  4KHW A;  3F9K A;  3VQC A;  4OPJ A;  4CHY A;  3OYJ A;  4FLW A;  1J5O A;  1B9D A;  1S1W A;  1JXB A;  3B6O A;  3LPT A;  3ASM A;  2HMI A;  1S9E A;  5J2P A;  4Z4G A;  4OVL A;  3WNH A;  1NJX A;  4CJR A;  2KFN A;  4AH9 A;  4CEF A;  1RTI A;  4FCY A;  1WSJ A;  1HRH A;  4IFV A;  5HRR A;  2OYQ A;  3FFI A;  2KFZ A;  2P51 A;  5HLF A;  4KKO A;  1Q9X A;  4EP5 A;  3S3N A;  3AA4 A;  4B9U A;  3VQP A;  1KSP A;  1TKD A;  3NF9 A;  4B9T A;  1T05 A;  3TAP A;  4DLE A;  3KTQ A;  3IRX A;  4J2B A;  3MXJ A;  3SUQ A;  2XO7 A;  1VK0 A;  3AV9 A;  1QQC A;  1QSS A;  1ZBI A;  4CF9 A;  3L2Q A;  2JLE A;  3V9S A;  4DTU A;  2KZZ A;  2YNG A;  4H4O A;  4E1M A;  4PA1 A;  1KRP A;  3RMA A;  3OYD A;  1VSE A;  3L2R A;  4B9M A;  1RDB A;  3CQ8 A;  4FM0 A;  4FLT A;  4Z0U A;  3KJV A;  2OZS A;  1JLF A;  4CFA A;  4CEC A;  1B92 A;  3WNF A;  2XY5 A;  3SUO A;  1U4B A;  3KK1 A;  1BI4 B;  4XIU A;  2ETJ A;  4YNQ A;  4CF1 A;  4YFU A;  3NCI A;  1IO2 A;  1VSF A;  1BIS A;  4F3O A;  2HHW A;  1BQN A;  2GBZ A;  4IFY A;  4RW6 A;  4Z4H A;  4OGE A;  4R5P A;  3ZT0 A;  4E3S A;  4LSL A;  1C0M A;  4BWJ A;  4L8R B;  2F8S A;  5CZ1 A;  4CK3 A;  5KTQ A;  4O55 A;  4KO0 A;  3KLF A;  1YVU A;  3U3Y A;  2ATQ A;  3HK2 A;  4KRF A;  5CY4 A;  3DLE A;  4C8M A;  5JS2 A;  3HVR A;  1C0T A;  3AVI A;  1I3A A;  3CYM A;  1NOZ A;  1ZYQ A;  4ELT A;  4FK2 A;  4BDY A;  3LZJ A;  4CER A;  1DTQ A;  4QOZ B;  3LP0 A;  4CHO A;  1CZ9 A;  1RCH A;  4FM2 A;  3TAR A;  2JGU A;  2AJQ A;  3AVK A;  4QCL A;  1RDD A;  1RIL A;  2IOC A;  3KKS A;  3ZT1 A;  4LSN A;  4ELU A;  4KI4 A;  1TAU A;  3S3O A;  4FZX C;  3AA3 A;  3IAY A;  4OLB A;  3PY8 A;  4NCG A;  4CJL A;  3ISN C;  1RDA A;  2OPP A;  4CJ4 A;  3RMC A;  3MXM A;  3TR8 A;  1NK9 A;  4K8Z A;  4DQI A;  4KHY A;  4Z4F A;  1Z26 A;  3AO4 A;  3ZSX A;  4CJK A;  2Z1J A;  3SV4 A;  1X9M A;  1RT3 A;  2E6M A;  3LWM A;  4ZTF A;  1EP4 A;  5D3G A;  3HVT A;  4CF0 A;  2XHB A;  3QET A;  4H8K A;  4AHU A;  1QSY A;  3AVG A;  3ZSO A;  3HT3 A;  2P1J A;  4F2R A;  4DTS A;  1NKE A;  4M3W A;  1RBS A;  2KW4 A;  4C8N A;  4ICL A;  4M3R A;  3EY1 A;  5J1E A;  4CJP A;  3SUP A;  5DK5 A;  2XY6 A;  1NK6 A;  3VQ8 A;  4CEO A;  1NKC A;  4KB1 A;  4KHN A;  3L2V A;  3HXM A;  1W0H A;  3AVM A;  1HJR A;  3V1O A;  4AHT A;  4QAG A;  4DWI A;  1O1W A;  4CHN A;  1CLQ A;  1BI4 A;  2EHG A;  1KLN A;  3SCX A;  2YV0 X;  1X9S A;  4ZHR A;  2HHU A;  1S5J A;  2BAN A;  3SQ2 A;  3M8P A;  4DU1 A;  3O4Q A;  4C8O A;  2QK9 A;  4RW9 A;  1IG9 A;  4CK2 A;  5FRN A;  4FM1 A;  2DFH A;  1KVA A;  4FJI A;  2YHA A;  3M8R A;  4PUO A;  1VRT A;  1KFD A;  5HRP A;  1NJY A;  3OYB A;  4CGG A;  1U45 A;  5CZ2 A;  3OYM A;  3G0Z A;  4CF2 A;  3WNE A;  3ZT3 A;  4JRQ A;  1VSD A;  4DLG A;  2O4I A;  4I9L A;  2X78 A;  1TKT A;  4OKJ A;  4CIE A;  2FBY A;  4CJV A;  2ZE2 A;  4N76 A;  1WSH A;  3RMB A;  1YTU A;  2HNY A;  3NGI A;  3QEV A;  4CEB A;  2ZQB A;  1TAQ A;  3KIO A;  1JXE A;  4J2A A;  4DFP A;  2BGG A;  1S1U A;  1QS4 A;  1LWC A;  1RT6 A;  2KZM A;  3ZSZ A;  1SL2 A;  2A1S A;  3VQ7 A;  1Q8I A;  4BE2 A;  2RPI A;  4OJR A;  4CCH A;  3SQ4 A;  1BCM A;  1KLM A;  1ASU A;  3KLG A;  2KTQ A;  1HYV A;  4EP4 A;  1BGX T;  4HTU A;  3VN5 A;  4EZ6 A;  3A2F A;  1IKV A;  3AVB A;  1ASW A;  4DTN A;  1WSF A;  4FJ9 A;  3QO9 A;  3LP2 A;  1MU2 A;  1SL0 A;  3DLB A;  3KLE A;  3CFP A;  4N41 A;  5I42 A;  3QIP A;  4M3U A;  1GOC A;  1TV6 A;  2B4J A;  1VSL A;  4BE0 A;  1C6V A;  4FJH A;  4CF8 A;  4FJX A;  4I2P A;  4FZZ A;  2FC0 A;  2HHQ A;  3NAE A;  3V9U A;  4DSI A;  2VG7 A;  1RBR A;  1HQU A;  2BE2 A;  4CEQ A;  1DTT A;  1IKY A;  1JL2 A;  3DRS A;  2EX3 A;  1WN7 A;  3VQB A;  2E6L A;  3OYN A;  3KLH A;  3QEP A;  1RTH A;  4B08 A;  2PZS A;  4FK0 A;  3RR8 A;  2PY5 A;  1XWL A;  3VQ5 A;  3I0S A;  1TK8 A;  3NFA A;  2G8K A;  4DSL A;  1HNV A;  1FKP A;  3HYF A;  3L2U A;  1X9W A;  1GOA A;  3T19 A;  4M3Z A;  1TVR A;  4KFB A;  4Q0B A;  1QTM A;  3ZCM A;  4FJM A;  4LH4 A;  2A1R A;  4CJU A;  2XY7 A;  4KTW A;  4KPY A;  4FW1 A;  1L3T A;  1KCF A;  3TAM A;  2G8V A;  4BAC A;  3P5J A;  3HST B;  2D5R A;  4O44 A;  3V1R A;  4DS4 A;  3NH2 A;  1T03 A;  3NHG A;  3C95 A;  3K57 A;  4JLH A;  1S1V A;  4JS4 A;  1BL3 A;  3AVA A;  1A5V A;  4C8K A;  2G8W A;  3OYA A;  4DU4 A;  3SUN A;  1U47 A;  1WNS A; 
#chains in the Genus database with same CATH topology
 3THW A;  4DR2 K;  4CZI A;  5HRN A;  4FJ7 A;  3ATU A;  2P5O A;  3K9K A;  3R8E A;  3AO5 A;  5FPE A;  1VQO N;  1XHX A;  3LDL A;  1EX4 A;  3ZSQ A;  5JIC A;  3AVN A;  3CCR N;  1RTD A;  4Z4E A;  3OJU A;  1K73 O;  3P83 D;  2I7N A;  5EU7 A;  3ULE A;  4HTL A;  1XQS C;  4IJA A;  3O9T A;  1VQK N;  3CCQ N;  4JKE A;  2P9N A;  5AQO A;  4H5W A;  3H08 A;  4XH4 A;  1HNZ K;  4AHS A;  4FLX A;  4B1Z A;  3HRG A;  1JLG A;  1B9F A;  4U67 L;  4B9L A;  1K8K A;  1RDU A;  1IJJ A;  3VMF B;  4CZL A;  3TSQ A;  1SV5 A;  1XC9 A;  4CJW A;  4DTX A;  3C7N A;  3CC7 N;  2G8I A;  2HVH A;  1J53 A;  1NGI A;  1NM1 A;  3T3F A;  1VSK A;  2E8A A;  4FWK A;  3DLH A;  1KAY A;  3PX6 A;  4AQY K;  3L2W A;  3TAB A;  3CPE A;  4FJK A;  3EE8 A;  5AFU H;  1BQM A;  5KPR A;  3CME N;  4CEA A;  4CHP A;  1C0F A;  2H3G X;  5CE3 A;  4F3T A;  1XMQ K;  4BRK A;  2FXU A;  4ELV A;  4O0J A;  4YHH K;  1SKW A;  4Y1C A;  1NGB A;  2E1Y A;  3QBW A;  1NK7 A;  3AVC A;  5FPN A;  3H45 C;  4FLZ A;  3AO1 A;  2YHX A;  4BRP A;  1P90 A;  3K5N A;  3HSC A;  3FZF A;  2FBT A;  1DLO A;  4KBO A;  1SL1 A;  1TKZ A;  3G10 A;  3VET A;  2O8F B;  4I6M B;  3TAG A;  3UIQ A;  3TSP A;  3VQQ A;  3AVH A;  3HL8 A;  3L3U A;  3QNN A;  1JLQ A;  1NGH A;  3EKU A;  1UA1 A;  5M1P A;  4F2S A;  2VGN A;  3KWI A;  3I55 N;  5AQK A;  4GNI A;  4H4M A;  4JKA A;  4M3T A;  3CCU N;  2OCE A;  1VQ8 N;  5BPM A;  1D4X A;  3FLC O;  4Y0W A;  3ZET A;  3M1F A;  4BE1 A;  2D0B A;  4NYF A;  4DQS A;  4CJQ A;  3BGR A;  2X6N A;  3EL2 A;  5F2R A;  3OJS A;  3QIO A;  1Q9Y A;  1RBU A;  2GUI A;  3DI6 A;  4JS5 A;  4WQ5 C;  4BRA A;  4EHU A;  2D0C A;  1HYZ A;  2DFE A;  4W5Q A;  3K9J A;  3GE1 A;  1L3S A;  3CC2 N;  1TGO A;  3MCA B;  1EET A;  1YIJ N;  3VGM A;  2NRT A;  1XNR K;  5FRO A;  2YNF A;  2E2O A;  5AQX A;  3LAM A;  1SUQ A;  3Q7B A;  1HJO A;  2UUC K;  4CGF A;  1JLA A;  3P1G A;  1I94 K;  3UKU B;  3DRP A;  1NMN A;  5AQM A;  3SQ0 A;  4DF8 A;  2HHV A;  4K8X A;  4PL7 A;  3THX A;  1S1T A;  2E4L A;  3G4S N;  2ZJQ L;  3L6Q A;  5M1K A;  4RG8 A;  4DQP A;  3BUZ B;  2E88 A;  1VQP N;  5EY4 A;  4KHQ A;  4AHC A;  2I5J A;  2IVN A;  4JHD A;  4HVJ A;  4FO0 A;  3GBT A;  5BN9 A;  1NKB A;  4E1N A;  2ITM A;  5SZT A;  3G25 A;  3K5M A;  2XRI A;  1UOC A;  4KB0 A;  5LJV A;  1N34 K;  3CCV N;  4H0V B;  3KKR A;  3SJJ A;  4DSF A;  4BRL A;  5KPT A;  4LD0 A;  3SMS A;  1A5X A;  5C24 A;  4M41 A;  4YOX A;  4GKK K;  3ZSR A;  1MWK A;  4BR9 A;  3AO2 A;  3HM9 A;  4A5B A;  3TWH A;  3PO5 A;  2QA4 N;  1QSL A;  1NGD A;  4YOW A;  2WFB A;  4B3M K;  4I2Q A;  3D2E A;  4DV2 K;  3LP3 A;  3ZSW A;  3PO4 A;  4OLA A;  5JVH L;  4LH5 A;  4LF7 K;  1GLB G;  3BF3 A;  2HHS A;  3AVJ A;  3RWU A;  1VHX A;  4XH1 A;  3ALY A;  1FKO A;  3LAK A;  2HHT A;  4MO4 A;  4CJE A;  2A42 A;  3AA5 X;  4OKE A;  3VQ9 A;  5AQU A;  3OYK A;  4CZH A;  4FJJ A;  4CK1 A;  1L3V A;  1U48 A;  4CZM A;  4CJ3 A;  2HOE A;  5CYQ A;  5HBM A;  1XNQ K;  3HJF A;  3OS0 A;  3TPQ A;  3LP1 A;  4G1Q A;  1HYS A;  3U8X A;  1C1A A;  3J8A A;  3V9Z A;  3QEX A;  3NGY A;  4O5B A;  1Z25 A;  3R9P A;  3DOL A;  4DG1 A;  1NK5 A;  1JLB A;  3WUH A;  4DTP A;  4I7F A;  5E41 A;  2ZF5 O;  1ZBF A;  3P31 A;  4FLW A;  2KHO A;  1S1W A;  1JXB A;  3B6O A;  4DV4 K;  4FL9 A;  3O8M A;  2KFN A;  1WSJ A;  1HRH A;  2KFZ A;  5HRR A;  3UE5 A;  5JLF A;  3AA4 A;  1QQN A;  4B9U A;  3LL3 A;  3NF9 A;  3VF4 A;  4DLE A;  3DAW A;  3KVG A;  1ZBI A;  4JD2 B;  4CF9 A;  3L2Q A;  3NMU A;  3EN9 A;  1IBM K;  3R3L A;  3OYD A;  1VSE A;  4Z0U A;  4JKG B;  4J8F A;  2XY5 A;  2ETJ A;  4BC5 A;  4O8K A;  4CF1 A;  4YFU A;  3NCI A;  4IDH A;  3A0I X;  1VSF A;  4BRO A;  1K9M O;  4F9O A;  3E9P A;  4RW6 A;  3ZT0 A;  4LSL A;  1HKB A;  4L8R B;  4CK3 A;  4O55 A;  4KO0 A;  3KLF A;  3HK2 A;  3GOI A;  3DLE A;  3HVR A;  3FFK B;  5JS2 A;  4JKD A;  3M6G A;  1ZYQ A;  4CER A;  2KLA A;  1CZ9 A;  2AJQ A;  2NRR A;  4AF1 A;  1M90 O;  4QCL A;  1RIL A;  4ELU A;  2HMP A;  1TAU A;  2BTF A;  3AA3 A;  1WBD A;  1X3N A;  4NCG A;  4CJL A;  4KHY A;  2Z1J A;  2E6M A;  4M63 C;  1YF5 L;  4CJ7 A;  2Q97 A;  4H0X B;  4IXC A;  4F2R A;  4DV6 K;  2GWJ A;  4M3R A;  3SUP A;  5DK5 A;  4KB1 A;  1NK6 A;  3V1O A;  4AHT A;  4QAG A;  1HX1 A;  4BR5 A;  1O1W A;  1CLQ A;  2EHG A;  1ESV A;  2YV0 X;  4ZHR A;  1Q81 O;  3M8P A;  4DU1 A;  2QK9 A;  4RW9 A;  1IG9 A;  4DV5 K;  5FRN A;  2YHA A;  1KFD A;  4H0O A;  2QWM A;  3G0Z A;  4CBU A;  2E1Z A;  3ZT3 A;  1YJW N;  4DLG A;  1MDU B;  4A59 A;  2I7P A;  2P9P A;  3PIO L;  3MWP A;  2O8E A;  3QDK A;  4O5F A;  4CIE A;  2ZE2 A;  3LM2 A;  4PKH A;  3DJC A;  4N76 A;  3RMB A;  2HF4 A;  1YTU A;  5M1N A;  3NGI A;  4CEB A;  1TAQ A;  3KIO A;  1QS4 A;  1LWC A;  1RT6 A;  3H6E A;  4ILJ A;  3VQ7 A;  4OPH A;  4BE2 A;  4CCH A;  4OX9 K;  2W40 A;  2WTU A;  1BCM A;  1ASU A;  5HL7 L;  1HYV A;  3H3N O;  4EP4 A;  1BGX T;  3CIP A;  1HLU A;  4WF9 L;  4DTN A;  5E26 A;  3FR0 A;  1MU2 A;  1SL0 A;  3J7Y P;  2IVO A;  5I42 A;  3QIP A;  3SAF A;  1GOC A;  4FJH A;  2HHQ A;  4I2P A;  1KC8 O;  5C12 A;  1OH5 A;  3V9U A;  2QWL A;  2VG7 A;  4CGG A;  4FPA A;  4CEQ A;  4J2E A;  3VQB A;  1DTT A;  2QWN A;  3KLH A;  1U2V B;  1ZXO A;  3DXK A;  4U7B A;  2F4V K;  1XC3 A;  4K41 A;  4PKG A;  2QW9 A;  5AQY A;  2G8K A;  3VES A;  1FKP A;  2CH5 A;  4WFB L;  3DXM B;  2NRW A;  2A1R A;  2E2N A;  4FW1 A;  2G8V A;  3TAM A;  4BAC A;  3R6M A;  2D5R A;  4DS4 A;  1S1V A;  5AQH A;  4IOA L;  2ZGZ A;  2G8W A;  4CBW A;  1U47 A;  1FK9 A;  2OZM A;  1DT9 A;  4FOI A;  1D9D A;  3OYE A;  3GG4 A;  1UA0 A;  2NRZ A;  1S22 A;  3VEY A;  2RKI A;  5FPD A;  4FVU A;  1YIT N;  4IFE A;  2NNW A;  3L4I A;  3OA9 A;  1KXP A;  4BC4 A;  2JWL A;  1IKX A;  2OAN A;  2F8T A;  4FLY A;  4MO5 A;  3THW B;  2NRV A;  4LF5 K;  2A40 A;  3VEX A;  1V4S A;  1ASV A;  2FF3 B;  3SK3 A;  4JI6 K;  4DCH A;  3C94 A;  3Q7C A;  4F4K A;  4DFJ A;  4RW7 A;  1VQ5 N;  4ZTJ A;  3CM6 A;  1BO5 O;  3PV8 A;  1F21 A;  2DFF A;  5C15 A;  1EWR A;  4FSV A;  2RE2 A;  4M45 A;  5EOY A;  4EHT A;  4E7J A;  3U9Z A;  4E89 A;  4OPK A;  4DSE A;  4LF8 K;  5IT9 O;  2LSN A;  1VRU A;  4BRF A;  4FJN A;  4OO1 J;  1D9F A;  3ZT4 A;  4UY8 O;  4DU3 A;  3MN9 A;  2P5G A;  4O8U A;  1ZBU A;  2QKB A;  2NLX A;  3SAH A;  3SPY A;  2GWK A;  4BR0 A;  3V6D A;  4JKF A;  1VAZ A;  4CVN E;  1TK0 A;  1CZB A;  3FGU A;  4IDK A;  3WEE B;  3UKR A;  3ZYY X;  4ID1 A;  3K2P A;  3GL1 A;  1DKG D;  3QML A;  4IZ9 A;  3VER A;  3V1Q A;  2QWR A;  1IKW A;  3NVM A;  3CHW A;  2D1K A;  3MEG A;  2O8E B;  1JKH A;  2P9U A;  4KTZ A;  3SBG A;  3AVL A;  2UXB K;  3KK3 A;  3TAE A;  4OPA A;  4BQZ A;  2RN2 A;  3CC4 N;  2V7Z A;  2HVI A;  4Z4I A;  3THY A;  1WSG A;  3NF6 A;  2OA8 A;  3BZK A;  2OPS A;  2Q31 A;  3MEC A;  1EWQ A;  4BRG A;  3HM8 A;  4DTO A;  2YJF A;  2UUA K;  1BCO A;  3KLI A;  4CIF A;  2BDP A;  4BWM A;  1JLE A;  4W5R A;  3VQD A;  1TK5 A;  5HOO A;  4JNE A;  4RW8 A;  1ATN A;  1W2B M;  1XMO K;  1L5U A;  5EX5 A;  1XHZ A;  5KRT A;  4MFB A;  3FZK A;  4CJ5 A;  4X65 K;  2PBD A;  4WCE L;  4B9M A;  4JI3 K;  1RBT A;  3CM5 A;  4GMJ B;  3KD1 E;  3CET A;  2HHX A;  4BC3 A;  2IAJ A;  3CER A;  1RDC A;  3CFO A;  3CCS N;  2F9T A;  4PHT X;  1NOY A;  1C0G A;  5J2Q A;  1WLJ A;  3SAG A;  1WSI A;  2NUB A;  3IG1 A;  1L3U A;  1M1K O;  2IC3 A;  5EVZ A;  1G99 A;  4CHQ A;  3EZ5 A;  1NGG A;  1SS6 A;  4NYN A;  4NCB A;  5AQW A;  5FDL A;  3HPG A;  2UUB K;  3CG7 A;  1WAJ A;  4W5O A;  3ENB A;  4Z94 A;  2VWJ A;  1WOQ A;  5GIN A;  4JV5 K;  1V4T A;  4IEE A;  4TSX A;  4YOR A;  4CGJ A;  4HUE A;  4HCB A;  1NMD A;  2B6A A;  1VSI A;  3MX2 A;  3TI0 A;  2QTD A;  3DLG A;  4E7L A;  2ZD1 A;  1NBW A;  4E1J A;  3O1W A;  1RT7 A;  4L3Q A;  3HI0 A;  1QZ5 A;  3OYF A;  1NG9 A;  4YDU C;  2Q0U A;  4GVE A;  1T7P A;  3VA3 A;  3ZSV A;  5BRH A;  2UXD K;  1CXQ A;  3QLH A;  1QHT A;  2IVP A;  4W5T A;  2DPN A;  5TKY A;  4O0I A;  3BY5 A;  1NU0 A;  3A5O C;  5AQR A;  3TAQ A;  4BRD A;  1N6Q A;  1EO1 A;  2QXL A;  3E66 A;  2X6S A;  3M5R A;  2QXF A;  4NO7 A;  2GUP A;  5GAH P;  2QKK A;  2QM1 A;  2CGK A;  2YNI A;  4BG9 A;  3LDP A;  1JLC A;  1SKS A;  4HUG A;  3K58 A;  4R79 A;  3NH1 A;  3LWL A;  4I6M A;  1FXX A;  2VCP A;  1W9H A;  5F0X A;  5GIO A;  4M3Y A;  3O5B A;  2QWP A;  4FWL A;  5C0Y A;  4F8R A;  4RW4 A;  4B8A B;  3ZX2 A;  4CFD A;  3SV3 A;  3ZEU A;  4CE9 A;  3MDQ A;  3VQA A;  2ITG A;  4PY5 A;  4LC9 B;  5JS1 A;  1DEJ A;  4MDB A;  3V81 A;  4CFB A;  1C0U A;  4BRM A;  3F5T A;  1G15 A;  1GLC G;  1OKJ A;  1E4F T;  4DHY A;  1FJG K;  4LF9 K;  2IIR A;  3OYH A;  1YTA A;  3AAP A;  4DV0 K;  2HBJ A;  2O4G A;  4YOU A;  3QNO A;  4DF4 A;  1N5Y A;  5K14 A;  5HRS A;  4JI0 K;  4GVM A;  2E2Q A;  4HCC A;  1LW2 A;  4CZF A;  4FLU A;  4BRQ A;  2KQ2 A;  1R59 O;  1VSJ A;  3NE6 A;  4KRE A;  3DM2 A;  4A2A A;  3VQC A;  4OPJ A;  4CHY A;  3OYJ A;  1J5O A;  3A5L C;  4YOV A;  4DB3 A;  3LPT A;  1S9E A;  4FWM A;  3WNH A;  1VQM N;  2VQF K;  4AH9 A;  2ASP A;  4FCY A;  3FFI A;  2P51 A;  5AQI A;  1KD1 O;  4NLB A;  2CH6 A;  1QVG M;  3VQP A;  1TKD A;  1T05 A;  3KTQ A;  1VK0 A;  3FE1 A;  2YNG A;  4H4O A;  4CI6 A;  3RSE B;  5A2Q O;  1Q82 O;  2O8C A;  1RDB A;  2P9U B;  4FM0 A;  3KJV A;  3THY B;  4CFA A;  3MK6 A;  3LDO A;  4BR4 A;  4CEC A;  3KK1 A;  1VQ9 N;  4YNQ A;  3K0S A;  3CD6 N;  4DR7 K;  3H1Q A;  4F3O A;  1SQK A;  4Z4H A;  4OGE A;  3VOV A;  1C0M A;  3O6W A;  4HWI A;  4BWJ A;  1BU6 O;  5AQZ A;  5BPL A;  1YVU A;  3U3Y A;  3ID6 A;  4PKI A;  2PFU A;  5CY4 A;  1C0T A;  3AVI A;  3VPZ A;  4FK2 A;  4BDY A;  1DTQ A;  4FPB A;  5C2F A;  3D6R A;  3ZT1 A;  1TUY A;  4EFH A;  3KKS A;  1OH7 A;  1QVF M;  4LSN A;  3ZX0 A;  2O8D B;  2HHH K;  4LFA K;  4OLB A;  4CJ4 A;  1RDA A;  2OPP A;  4EAH D;  3TR8 A;  3CCE N;  4Z4F A;  1Z26 A;  3W3D A;  3ZSX A;  4CJK A;  3SV4 A;  3LWM A;  4BG8 A;  4DR3 K;  5D3G A;  4CF0 A;  2XHB A;  4H8K A;  4AHU A;  1TYQ A;  3ZSO A;  3HT3 A;  3HOS A;  1NKE A;  4M3W A;  2P9K A;  2O8C B;  5J1E A;  4CJP A;  5AQN A;  1HJR A;  1MWM A;  1X9S A;  3IKM A;  3BF1 A;  3SQ2 A;  2F9W A;  3O4Q A;  4C8O A;  2DFH A;  3L0Q A;  5HRP A;  1NJY A;  5I9E B;  1U45 A;  5CZ2 A;  1T3V A;  1TKT A;  1NNE A;  3SMP A;  3IMX A;  3QEV A;  5ADX H;  2KZM A;  3VTI A;  1RFQ A;  3O08 A;  3ZSZ A;  5ADX A;  3WXL A;  1SL2 A;  1T44 A;  3F2K A;  1KLM A;  3AVB A;  1IG8 A;  4M7X A;  4FJ9 A;  4XEI A;  1RDW X;  3LP2 A;  3DLB A;  1E4G T;  1NWK A;  3CFP A;  2P9K B;  2WBN A;  2B4J A;  1BA1 A;  5EXW A;  4CF8 A;  4FJX A;  3NAE A;  2HST A;  2HBM A;  2BE2 A;  4JI7 K;  1JL2 A;  1IKY A;  2EX3 A;  3DRS A;  1WN7 A;  2E6L A;  1RTH A;  4B08 A;  1CZA N;  4FWQ A;  1XWL A;  3NFA A;  1GOA A;  4KFB A;  2NRH A;  4Q0B A;  3ZCM A;  4KTW A;  4KPY A;  1KCF A;  4BR2 A;  3V1R A;  1JJ2 M;  2ZM6 K;  2AA4 A;  3OBW A;  4JS4 A;  1A5V A;  3OYA A;  4DU4 A;  3KWG A;  2G8H A;  5AQP A;  4GW6 A;  1NGC A;  1N8R O;  4V19 S;  3WNG A;  3A5N C;  3W0L A;  2ZWH A;  1J9A A;  4O4G A;  2Q0R A;  1YT3 A;  1TL3 A;  5HP1 A;  3E01 A;  4B9N A;  3KD5 E;  4BRE A;  4IEI A;  3CQY A;  3ZSY A;  3WXM B;  5HRO A;  5AQS A;  4E0D A;  1HQE A;  2W6L A;  4KHS A;  4DQQ A;  4FXD A;  1RNH A;  1YUW A;  2OPQ A;  2YKM A;  1A5W A;  3ITH A;  3VQ6 A;  2O8B B;  2YCH A;  5LMN K;  1BIU A;  2O8F A;  2P9L B;  3D45 A;  4A61 A;  3CQX A;  2P9I B;  4FK4 A;  3QFP A;  4B1U B;  1OVQ A;  1REV A;  2Q1N A;  1BHL A;  4WFN L;  3RTV A;  1C1C A;  5AFU A;  3V9W A;  3QIN A;  1BG3 A;  5SWM A;  4K25 A;  1LWE A;  4DQ8 A;  3SPZ A;  3NGZ A;  4KH5 A;  5IWA K;  3CJ1 A;  5FLX O;  3G6E N;  3NBP A;  4N5S A;  4JRP A;  3ZET B;  1JL1 A;  2YHY A;  5BRD A;  4NXM K;  5I3U A;  2E20 A;  4JK9 A;  4KAZ A;  3CCM N;  1WUA A;  1S6P A;  2WON A;  2Z1H A;  1U2V A;  4WFA L;  5C25 A;  3IS9 A;  3VGL A;  4A5A A;  4B1W B;  4JKH A;  3D2F A;  1U04 A;  4AIL C;  4K42 A;  4Y1D A;  1MA9 B;  3CJ9 A;  3E1Y A;  5AQQ A;  3JS6 A;  2D4W A;  3HBT A;  4C8L A;  2J4R A;  5CYM A;  1KFS A;  3E9O A;  3DXK B;  2RHK A;  1QQO A;  4GKJ K;  2HF3 A;  2O8B A;  2X74 A;  3H1V X;  3P39 A;  2YJE A;  2Z1I A;  1TL1 A;  1X9J A;  1SZ2 A;  3U9D A;  4AHR A;  5JVG L;  4MQ3 A;  3PX4 A;  1C1B A;  2KKZ A;  3H46 O;  3MEE A;  5JLH A;  1OH6 A;  4ILH A;  5LY3 A;  3THX B;  4CZJ A;  3I8B A;  3FZH A;  4JN4 A;  4CZG A;  3RR7 A;  4B3R K;  3M8S A;  2D0A A;  3LPU A;  4FJL A;  1YHQ N;  3NF8 A;  3S9H A;  4H0Y B;  3QB0 A;  2F96 A;  4FWP A;  5AZI B;  3VA0 A;  4YOY A;  4BR7 A;  1Z05 A;  2VYP A;  3O9R A;  1U6Z A;  1FW6 A;  4AM7 A;  2VG5 A;  3OYG A;  3WXK A;  4B8C A;  1LAW A;  3OYL A;  1ILY A;  4J2B A;  3EYZ A;  3CJB A;  3CFR A;  4CJT A;  4IG0 A;  4FOE A;  3U4L A;  1U49 A;  4WQ4 A;  4DSK A;  2HW3 A;  2JWK A;  4DSJ A;  1KQS M;  4DTM A;  1BUP A;  4CED A;  1ZBS A;  3VF6 A;  1NJW A;  4B3S K;  1LWF A;  5GAD P;  3L8B A;  4ISF A;  4CGH A;  4JI5 K;  5B8H A;  2GEL A;  3HOT A;  3O4N A;  3O3H A;  3D2E B;  1ATR A;  1EXQ A;  1KAX A;  4H5R A;  2W42 A;  5KGX A;  4JK8 A;  5C42 A;  3UKR B;  1D8Y A;  4NCA A;  5DMR A;  4ID5 A;  3JSM A;  4CES A;  2YHB A;  1ZBL A;  5KGW A;  5J2M A;  1ZC6 A;  1TKX A;  3ZX3 A;  4XH5 A;  3OS1 A;  2BUP A;  1VQL N;  3RRH A;  4DR4 K;  4OKK A;  3V4I A;  3PLA A;  4X66 K;  1ITG A;  5C10 A;  2ZJP L;  2RF2 A;  1RT5 A;  3QBX A;  4WE1 A;  2QEX N;  1RT2 A;  3AO3 A;  4IBN A;  4JKC A;  3O9Q A;  3U6F A;  2Z1G A;  5AZJ A;  3NH0 A;  1VSM A;  2W41 A;  2WOM A;  1NK0 A;  1NK4 A;  3DOK A;  3OS2 A;  3O3F A;  5ELZ A;  1XI1 A;  3KHY A;  1R0A A;  5AQG A;  4DTR A;  1ATS A;  5J2N A;  3D0P A;  2VWK A;  3AY9 A;  4CHZ A;  3EE9 A;  5M1F A;  1BIZ A;  3EEQ A;  3WEE A;  3I33 A;  4IWV A;  3AA2 A;  1K6Y A;  3ID8 A;  3T1A A;  4GV6 A;  3SNN A;  3SJH A;  4NLC A;  1Q86 O;  3HPO A;  3OYI A;  3MN7 A;  4B3O A;  2WUS A;  3ULD A;  1NJZ A;  3M3Z A;  1S9G A;  4B1X B;  2NZT A;  3I8D A;  2QWQ A;  3DWL A;  1YI2 N;  1BWF O;  4E7H A;  2DTU A;  1P8Z A;  3M8Q A;  4KH6 A;  3NDK A;  1JCF A;  1HNX K;  3B8A X;  3V9X A;  5JMV A;  4IKF A;  2A5X A;  3O9U A;  5CR4 A;  5BN8 A;  5CHI A;  2QI2 A;  5H1S Q;  1B9D A;  4Z4G A;  4OVL A;  3O1B A;  4CJR A;  4FWS A;  1RTI A;  4IFV A;  1XUP O;  4KKO A;  3A8Y A;  3AGR A;  4EP5 A;  1Q9X A;  1BDG A;  4B9T A;  4LF4 K;  2GTD A;  3IRX A;  3MXJ A;  3SUQ A;  3CCJ N;  1QSS A;  1WB9 A;  2JLE A;  3ZLJ A;  2KZZ A;  5M1O A;  4YDU A;  3AAR A;  4FLT A;  2OZS A;  4KHP K;  1JLF A;  4JEP A;  3WNF A;  3SUO A;  1BI4 B;  4XIU A;  3IUC A;  1IO2 A;  4C1N K;  2HBL A;  5GAE P;  2HHW A;  4WYB A;  4RTF D;  4IFY A;  4M7Y A;  4E3S A;  3T1H K;  5C2D A;  2F8S A;  5KTQ A;  5AZI A;  1QQM A;  3LDQ A;  1Y64 A;  4KRF A;  4C8M A;  5AQT A;  2QWO A;  4FWR A;  1I3A A;  1NOZ A;  2VQE K;  4QOZ B;  3LP0 A;  1RCH A;  4FM2 A;  3AVK A;  3P38 A;  1RDD A;  2OTJ N;  4BQL A;  1QHA A;  1KAZ A;  3S3O A;  4FZX C;  3PY8 A;  1QTM A;  3RMC A;  4JI1 K;  4DQI A;  1N36 K;  4ZTF A;  1NGJ A;  3HVT A;  4BVP A;  1JCG A;  3QET A;  3ULE B;  1QSY A;  4K43 A;  4CBX A;  4JKG A;  2KW4 A;  4C8N A;  4ICL A;  3CJC A;  2XY6 A;  4CEO A;  4DR1 K;  3AVM A;  3I56 N;  1BI4 A;  3E9L A;  2HBK A;  2BAN A;  5AQV A;  1JCE A;  4CK2 A;  1O13 A;  2BH1 A;  3FZL A;  1VRT A;  3OYB A;  4IOX A;  2D0P A;  1RGI A;  3OYM A;  3WNE A;  4JRQ A;  3QFU A;  4I9L A;  1TYQ B;  1HUX A;  3TTC A;  4CD1 A;  1W97 L;  2FBY A;  4CJV A;  2NRX A;  2YI1 A;  5AQF A;  4JAX A;  3WXJ A;  2HNY A;  3RSE A;  2E5L K;  4JKB A;  4GY2 B;  2BGG A;  4J2A A;  4DFP A;  1S1U A;  5AZJ B;  4DV3 K;  2A1S A;  2FSJ A;  2YX6 A;  2A6A A;  3KLG A;  2ZJR L;  4HTU A;  4EZ6 A;  3VN5 A;  4NXN K;  3A2F A;  1WBB A;  3PSI A;  2GEM A;  1ASW A;  1WSF A;  3LDN A;  1VQN N;  1X3M A;  3L4Q A;  3KLE A;  1TV6 A;  4DR5 K;  5FPM A;  2FC0 A;  1HKC A;  3P4I A;  3G71 N;  2VWB A;  4B9Q A;  3EKS A;  5KQD A;  4RWT A;  3J81 O;  1IV0 A;  2PZS A;  3RR8 A;  3I0S A;  1TK8 A;  1HNV A;  3HYF A;  1J5E K;  3CCL N;  3T19 A;  3FZM A;  1N32 K;  2UXC K;  4B3T K;  3CJA A;  1LOT B;  4LH4 A;  2XY7 A;  4C1N I;  3BZC A;  3P5J A;  3WT0 A;  4GV3 A;  1T03 A;  3K57 A;  4JLH A;  3AVA A;  4C8K A;  1GLF O;  1SKR A;  4DV1 K;  1NJI O;  3OVN A;  4FJ5 A;  5AQL A;  3N4Q A;  5BPN A;  3J7A P;  5AR0 A;  3TAN A;  2ZGY A;  3KK7 A;  4EZ9 A;  2YKN A;  3K5O A;  3LAL A;  3R1X A;  4LY7 A;  3K59 A;  4B9V A;  1RTJ A;  3H3O B;  2G8F A;  4WQ5 A;  4DKW A;  4DR6 K;  3SQ1 A;  4E7K A;  1S6Q A;  5TKW A;  5KQ8 A;  3SZ2 A;  4DUY K;  3VEV A;  4DS5 A;  4CIG A;  4DFK A;  1H1V A;  5DM7 L;  3CI5 A;  3UKU A;  2FLO A;  3J80 O;  1Q18 A;  4H5N A;  3LAN A;  2IS3 A;  3MN5 A;  2OTL N;  4YOT A;  2V51 B;  2XY8 A;  1J54 A;  5KI6 A;  3EZW A;  2IGI A;  1S72 N;  4KTQ A;  3DMJ A;  1S1X A;  3S3M A;  4PWD A;  3DXM A;  3DLR A;  1LCU A;  3MMV A;  1GOB A;  3QER A;  3MN6 A;  3O80 A;  3TTF A;  4FWN A;  2P9S A;  3SI6 A;  1HPM A;  4IOC L;  1GLA G;  4M42 A;  2WC9 A;  3VF2 A;  4DFM A;  2D0O A;  1WSE A;  5LMU K;  1BA0 A;  3AGK A;  2UU9 K;  3LZI A;  4PQU A;  3MX5 A;  3HP6 A;  1OH8 A;  3TAF A;  4QS9 A;  3OYC A;  3HPH A;  3CPW M;  1HR0 K;  4CGD A;  5DM6 L;  3WXI A;  1ZBH A;  1GLD G;  4JYA K;  4IG3 A;  4N56 A;  3KK2 A;  4BY9 C;  4FJG A;  1BOT O;  5LJW A;  3HO1 A;  1LAV A;  3C6T A;  4E19 A;  1I39 A;  3EO3 A;  3MAQ A;  1UWB A;  4KV8 A;  2CGL A;  5AQJ A;  1YXQ A;  2Q2R A;  3HZ6 A;  2VGM A;  1OVY A;  1EKE A;  3QEI A;  3OW2 M;  3K5L A;  1LW0 A;  1KVC A;  1GLE G;  3OY9 A;  4FJ8 A;  3TU5 A;  2DY4 A;  2ASM A;  4ISE A;  1SAZ A;  4DMN A;  4A2B A;  4C23 A;  4CJF A;  4JD2 A;  3T1Y K;  1NGA A;  2YNH A;  4DUZ K;  4CFC A;  1GLJ O;  4HHT A;  2W6K A;  4IJN A;  4FYD A;  3MCP A;  1Y97 A;  1RT4 A;  4AHV A;  2PAV A;  2OPR A;  4FLV A;  3QES A;  3VQ4 A;  2P9I A;  1VQ4 N;  1HNI A;  3SYZ A;  2FBV A;  2GV9 A;  3PUF A;  1IH7 A;  1WAF A;  3CF5 L;  3ZEU B;  4H0T B;  3L3V A;  1NK8 A;  2Y1J A;  1D5A A;  4BGB A;  5BRE A;  4Z4C A;  2VG6 A;  4Q5V A;  4BC2 A;  2IDO A;  3JXU A;  3RVC A;  1NGF A;  5LL6 Z;  3QEW A;  3VQE A;  2V52 B;  4N47 A;  4I9Q A;  3AVF A;  2Y1I A;  3BP8 A;  3T7Z A;  2HB5 A;  1K8A O;  4KI6 A;  1YJN N;  2UYT A;  1GLL O;  3RRG A;  4FVM A;  3DYA A;  4CEZ A;  3ZT2 A;  4BDZ A;  3JAM O;  1QE1 A;  3SBT A;  4RCH A;  4MLH A;  4CW7 B;  4CJS A;  4HUF A;  1HNW K;  4CGI A;  3C6U A;  4K0K K;  3F73 A;  4FZY A;  3I0R A;  3N4P A;  1VSH A;  2Q36 A;  1LV5 A;  1YVN A;  4PL8 A;  2FSN A;  3D2F B;  3IFR A;  1EQY A;  4CZE A;  3ATV A;  4DTJ A;  2G8U A;  4X62 K;  4UQG A;  1HPZ A;  5BR9 A;  4FW2 A;  3PSF A;  2AP1 A;  5FRM A;  2R7Y A;  1T8E A;  4J2D A;  3O4W A;  3NF7 A;  4LF6 K;  3B6P A;  2P9S B;  3C65 A;  3O9S A;  3U3G A;  4BDP A;  4M3X A;  3C6H A;  1DGK N;  4E7I A;  2FBX A;  3MED A;  2HNZ A;  3O3G A;  3D7E O;  3LDS A;  2PYL A;  1KTQ A;  3THV A;  2ASO A;  1RT1 A;  4OGC A;  4AM6 A;  3NVK A;  2Q3S A;  5KRS A;  4CZK A;  5T7B A;  5MLC Q;  2A3Z A;  3LM9 A;  1X1P A;  1CXU A;  2PYJ A;  1J6Z A;  1HMV A;  3PX0 A;  3JYT A;  4W5N A;  1Q7Y O;  1UAX A;  4DQR A;  3MXI A;  4CEE A;  1KVB A;  3TSU A;  3DRR A;  5M1Q A;  1RBV A;  3DLK A;  4KHU A;  3ENO A;  4LFB K;  4BRN A;  3RMD A;  4H5V A;  4WQ4 C;  3BDP A;  2FF6 A;  2B5J A;  3VEZ A;  4H03 B;  2HND A;  4MLE A;  3HP9 A;  2GX9 A;  4BGA A;  4B9S A;  4KHW A;  3F9K A;  3ENH A;  1TUU A;  2FSK A;  3ASM A;  4BRC A;  5J2P A;  2HMI A;  1N33 K;  4GV9 A;  3T69 A;  1NJX A;  3OHR A;  4CEF A;  1K8K B;  2OYQ A;  3UB5 A;  2E2P A;  5HLF A;  4BVO A;  2P9N B;  3S3N A;  1KSP A;  2A41 A;  3TAP A;  2XO7 A;  3AV9 A;  1QQC A;  3V9S A;  4DTU A;  4E1M A;  4PA1 A;  1KRP A;  3RMA A;  1T6D A;  2F7T A;  3L2R A;  1IBL K;  5AJ3 K;  5E84 A;  3CQ8 A;  1VQ7 N;  5BRF A;  4H0P A;  1NLV A;  3SLC A;  1B92 A;  1U4B A;  2CGJ A;  4B1V A;  1BIS A;  4JK7 A;  1YAG A;  3CXC M;  1BQN A;  2GBZ A;  4R5P A;  5CZ1 A;  3VGK A;  2ATQ A;  1S3X A;  4LFC K;  3CYM A;  3S41 A;  4ELT A;  4ILG B;  2O8D A;  3LZJ A;  4JI4 K;  3DLL L;  4CHO A;  3IDH A;  3TAR A;  2JGU A;  3J7Z O;  2V7Y A;  2IOC A;  4KI4 A;  3KZB A;  5BR8 K;  4YY3 K;  1YJ9 N;  4B1Y B;  3IAY A;  2YHW A;  3CMA N;  3ISN C;  1NK9 A;  3MXM A;  4K8Z A;  3AO4 A;  3TTD A;  1X9M A;  1RT3 A;  3C6A A;  1EP4 A;  3C7N B;  3AVG A;  2P9P B;  2P1J A;  4A62 A;  4DTS A;  3VEW A;  1RBS A;  1HKG A;  3EY1 A;  1E3M A;  3VQ8 A;  1NKC A;  4KHN A;  1T6C A;  3L2V A;  3HXM A;  1W0H A;  3GDQ A;  5GAG P;  4CHN A;  1KLN A;  3SCX A;  3QIC A;  2HHU A;  1S5J A;  5KPZ A;  1IBK K;  4DV7 K;  3C0B A;  1KVA A;  4FM1 A;  3M8R A;  4FJI A;  4PUO A;  4IO9 L;  4ISG A;  1Z6R A;  4CF2 A;  4FWO A;  3VEO A;  1VSD A;  2O4I A;  4H5T A;  4NB4 A;  4QS8 A;  2X78 A;  3AAQ A;  4OKJ A;  5F1X A;  4G9Z A;  4EIA A;  1WSH A;  4CD3 A;  1W7A A;  2ZQB A;  1JXE A;  3A5M C;  3WQT A;  4X64 K;  1Q8I A;  2RPI A;  4OJR A;  3SQ4 A;  3HTV A;  2KTQ A;  1NGE A;  1IKV A;  4JI8 K;  3PIP L;  4IO8 A;  3QO9 A;  4MDA A;  4N41 A;  4M3U A;  4BRI A;  3F9M A;  1VSL A;  5GIP A;  1C6V A;  4BE0 A;  4FZZ A;  4JHD B;  4KH4 A;  4QS7 A;  4DSI A;  1RBR A;  1HQU A;  4DWI A;  3OYN A;  3BEX A;  3QEP A;  3OTO K;  1QZ6 A;  4FK0 A;  4JI2 K;  2PY5 A;  3VQ5 A;  4DSL A;  3L2U A;  1X9W A;  4BRH A;  1TVR A;  4M3Z A;  4FJM A;  1VQ6 N;  4CJU A;  3WQU A;  3CJ7 A;  1L3T A;  2P9L A;  3HST B;  4O44 A;  3OBY A;  3VEN A;  3NH2 A;  3NHG A;  3C95 A;  4A57 A;  3MWT A;  1BL3 A;  3VTH A;  3SUN A;  2EWS A;  1WNS A; 
#chains in the Genus database with same CATH homology
 1FK9 A;  2OZM A;  5HRN A;  2G8H A;  4FJ7 A;  4GW6 A;  1SKR A;  2P5O A;  3WNG A;  3AO5 A;  3OYE A;  1D9D A;  1UA0 A;  1XHX A;  3OVN A;  4FJ5 A;  2RKI A;  1EX4 A;  3ZSQ A;  1IKX A;  3AVN A;  1RTD A;  2F8T A;  1J9A A;  4O4G A;  4FLY A;  1YT3 A;  3TAN A;  3OJU A;  4Z4E A;  3P83 D;  4EZ9 A;  2YKN A;  5EU7 A;  3K5O A;  3LAL A;  1TL3 A;  4LY7 A;  1ASV A;  3K59 A;  5HP1 A;  4B9V A;  3E01 A;  1RTJ A;  2BDP A;  4B9N A;  2G8F A;  3KD5 E;  3ZSY A;  3C94 A;  3H08 A;  5HRO A;  3SQ1 A;  4E7K A;  4E0D A;  4F4K A;  1S6Q A;  4AHS A;  4FLX A;  4DFJ A;  1HQE A;  4RW7 A;  4ZTJ A;  3CM6 A;  4KHS A;  4DQQ A;  3SZ2 A;  3PV8 A;  1F21 A;  1JLG A;  1B9F A;  4FXD A;  2DFF A;  4B9L A;  1RNH A;  4DS5 A;  2OPQ A;  2YKM A;  1A5W A;  3ITH A;  4M45 A;  3VQ6 A;  4CIG A;  4E7J A;  4DFK A;  4E89 A;  1SV5 A;  1BIU A;  4OPK A;  1XC9 A;  4DSE A;  4CJW A;  4DTX A;  2G8I A;  2LSN A;  1VRU A;  3D45 A;  4FJN A;  2HVH A;  1J53 A;  3T3F A;  1D9F A;  4FK4 A;  1VSK A;  3ZT4 A;  3DLH A;  3LAN A;  4DU3 A;  2IS3 A;  2P5G A;  1REV A;  1ZBU A;  1BHL A;  3PX6 A;  3L2W A;  3RTV A;  2XY8 A;  2QKB A;  1C1C A;  1J54 A;  5KI6 A;  3TAB A;  3V6D A;  3SPY A;  3V9W A;  4FJK A;  3QIN A;  5SWM A;  2IGI A;  1BQM A;  1LWE A;  3SPZ A;  1TK0 A;  4KTQ A;  1CZB A;  3NGZ A;  3DMJ A;  1S1X A;  3S3M A;  4IDK A;  4PWD A;  3NBP A;  4N5S A;  3DLR A;  4CEA A;  4JRP A;  4CHP A;  1GOB A;  1JL1 A;  3QER A;  4F3T A;  4ID1 A;  5I3U A;  3K2P A;  3SI6 A;  4ELV A;  4O0J A;  4M42 A;  4KAZ A;  1S6P A;  1SKW A;  2WON A;  2Z1H A;  3V1Q A;  5C25 A;  1IKW A;  4Y1C A;  3IS9 A;  4DFM A;  3MEG A;  1JKH A;  1WSE A;  1NK7 A;  4KTZ A;  1U04 A;  4AIL C;  3AVC A;  4Y1D A;  3AVL A;  3KK3 A;  3TAE A;  3LZI A;  4FLZ A;  3AO1 A;  4PQU A;  2RN2 A;  3K5N A;  2FBT A;  2HVI A;  3HP6 A;  1DLO A;  4Z4I A;  1SL1 A;  4C8L A;  1WSG A;  3NF6 A;  5CYM A;  3TAF A;  3OYC A;  3HPH A;  1TKZ A;  2OA8 A;  4CGD A;  1KFS A;  2OPS A;  3G10 A;  4J2E A;  3TAG A;  3MEC A;  2X74 A;  3UIQ A;  1ZBH A;  4IG3 A;  4N56 A;  3KK2 A;  3VQQ A;  4FJG A;  3AVH A;  3HL8 A;  3L3U A;  4DTO A;  3QNN A;  2Z1I A;  1BCO A;  1JLQ A;  3KLI A;  4CIF A;  1LAV A;  4BWM A;  1TL1 A;  3C6T A;  4E19 A;  1UA1 A;  1I39 A;  4F2S A;  1JLE A;  3HO1 A;  4AHR A;  4W5R A;  3MAQ A;  3VQD A;  1TK5 A;  1UWB A;  4KV8 A;  4RW8 A;  4H4M A;  4MQ3 A;  3PX4 A;  1C1B A;  4M3T A;  1L5U A;  3MEE A;  1EKE A;  1XHZ A;  3QEI A;  5KRT A;  3K5L A;  1LW0 A;  1KVC A;  3OY9 A;  4FJ8 A;  4MFB A;  3RR7 A;  4CJ5 A;  2DY4 A;  3M8S A;  2D0A A;  3LPU A;  4BE1 A;  2D0B A;  4FJL A;  4NYF A;  4DMN A;  3NF8 A;  4CJQ A;  4DQS A;  3S9H A;  1RBT A;  3BGR A;  3CM5 A;  4CJF A;  2X6N A;  4GMJ B;  3KD1 E;  2HHX A;  2YNH A;  3OJS A;  2F96 A;  3QIO A;  2IAJ A;  4CFC A;  1Q9Y A;  1RBU A;  3VA0 A;  2GUI A;  4HHT A;  4FYD A;  1RDC A;  3CFO A;  3DI6 A;  1Y97 A;  4JS5 A;  1RT4 A;  2VG5 A;  4AHV A;  3OYG A;  2OPR A;  1LAW A;  2D0C A;  4B8C A;  4FLV A;  3QES A;  1NOY A;  3OYL A;  3VQ4 A;  1HYZ A;  5J2Q A;  1HNI A;  1WLJ A;  3EYZ A;  1WSI A;  2NUB A;  3IG1 A;  3CFR A;  2DFE A;  3SYZ A;  1L3U A;  2IC3 A;  4CJT A;  4W5Q A;  4IG0 A;  2FBV A;  2GV9 A;  3PUF A;  1U49 A;  1IH7 A;  1WAF A;  1L3S A;  4CHQ A;  3EZ5 A;  4DSK A;  2HW3 A;  4NYN A;  1TGO A;  4DSJ A;  4NCB A;  1EET A;  4DTM A;  5FDL A;  3HPG A;  5FRO A;  3L3V A;  1NK8 A;  3CG7 A;  2YNF A;  4CED A;  1WAJ A;  4W5O A;  3LAM A;  1SUQ A;  2VWJ A;  2Y1J A;  1D5A A;  1NJW A;  4Z4C A;  1LWF A;  3L8B A;  4CGH A;  4CGF A;  1JLA A;  2VG6 A;  3P1G A;  4Q5V A;  3DRP A;  2IDO A;  3O4N A;  3O3H A;  4TSX A;  4HUE A;  4CGJ A;  3SQ0 A;  4HCB A;  1EXQ A;  2B6A A;  1VSI A;  4DF8 A;  2W42 A;  3TI0 A;  3QEW A;  3VQE A;  5KGX A;  2HHV A;  5C42 A;  4K8X A;  3DLG A;  4N47 A;  4E7L A;  2ZD1 A;  4I9Q A;  3AVF A;  1D8Y A;  1S1T A;  2E4L A;  2Y1I A;  4DQP A;  4NCA A;  5DMR A;  4ID5 A;  4RG8 A;  3JSM A;  4CES A;  2YHB A;  1ZBL A;  2HB5 A;  5KGW A;  5J2M A;  4KI6 A;  1RT7 A;  1TKX A;  3OS1 A;  4KHQ A;  3RRH A;  3OYF A;  4AHC A;  3RRG A;  2I5J A;  4FVM A;  4OKK A;  4HVJ A;  3DYA A;  3VA3 A;  3V4I A;  1T7P A;  3ZSV A;  4CEZ A;  4E1N A;  1CXQ A;  3QLH A;  1QHT A;  3ZT2 A;  5SZT A;  4W5T A;  1QE1 A;  2XRI A;  3K5M A;  4BDZ A;  1UOC A;  1ITG A;  4KB0 A;  4CJS A;  4O0I A;  4HUF A;  3TAQ A;  4CGI A;  2RF2 A;  3C6U A;  1RT5 A;  1N6Q A;  3KKR A;  2X6S A;  3F73 A;  4WE1 A;  4DSF A;  3I0R A;  3SJJ A;  2QXF A;  4FZY A;  1VSH A;  4LD0 A;  1A5X A;  5C24 A;  4M41 A;  1RT2 A;  1LV5 A;  3ZSR A;  3AO3 A;  4IBN A;  3HM9 A;  3AO2 A;  3U6F A;  2Z1G A;  4DTJ A;  3TWH A;  2QKK A;  2G8U A;  3PO5 A;  4UQG A;  1HPZ A;  3NH0 A;  1VSM A;  2YNI A;  4FW2 A;  1QSL A;  2WOM A;  1JLC A;  1SKS A;  1NK0 A;  4HUG A;  5FRM A;  3K58 A;  2R7Y A;  1NK4 A;  1T8E A;  1NKB A;  4I2Q A;  4J2D A;  3NH1 A;  3DOK A;  3NF7 A;  3LWL A;  3B6P A;  3OS2 A;  3U3G A;  3LP3 A;  1FXX A;  3ZSW A;  3O3F A;  4BDP A;  3PO4 A;  4M3X A;  4OLA A;  1W9H A;  4E7I A;  2FBX A;  4LH5 A;  1XI1 A;  1R0A A;  3MED A;  2HNZ A;  3O3G A;  3LDS A;  4DTR A;  5J2N A;  1KTQ A;  3THV A;  3D0P A;  2PYL A;  4M3Y A;  2HHS A;  2VWK A;  1RT1 A;  3AVJ A;  3RWU A;  4F8R A;  4CHZ A;  4OGC A;  4RW4 A;  4B8A B;  4CFD A;  3ALY A;  1BIZ A;  1FKO A;  2Q3S A;  3LAK A;  5KRS A;  3SV3 A;  4CE9 A;  3AA2 A;  1K6Y A;  3T1A A;  3VQA A;  2ITG A;  5T7B A;  2HHT A;  4CJE A;  4PY5 A;  1X1P A;  3SNN A;  1CXU A;  3AA5 X;  4OKE A;  3VQ9 A;  5JS1 A;  3V81 A;  2PYJ A;  4CFB A;  1C0U A;  3OYK A;  1G15 A;  4FJJ A;  3HPO A;  4CK1 A;  3OYI A;  1HMV A;  3PX0 A;  1U48 A;  1L3V A;  3JYT A;  4W5N A;  1UAX A;  4CJ3 A;  3OYH A;  4DQR A;  3ULD A;  3MXI A;  5CYQ A;  1NJZ A;  4B3O A;  1S9G A;  1YTA A;  5HBM A;  4CEE A;  2O4G A;  3I8D A;  3OS0 A;  3QNO A;  1KVB A;  4DF4 A;  3HJF A;  3LP1 A;  3DRR A;  4G1Q A;  4E7H A;  1N5Y A;  1HYS A;  2DTU A;  5K14 A;  5HRS A;  1RBV A;  1C1A A;  4GVM A;  3V9Z A;  3QEX A;  4HCC A;  3DLK A;  3M8Q A;  4KHU A;  3NGY A;  1LW2 A;  4O5B A;  1Z25 A;  4FLU A;  3NDK A;  3RMD A;  3DOL A;  3BDP A;  4DG1 A;  2KQ2 A;  1JLB A;  1NK5 A;  3V9X A;  4IKF A;  1VSJ A;  2B5J A;  4DTP A;  4I7F A;  2HND A;  5E41 A;  3HP9 A;  3NE6 A;  4KRE A;  4B9S A;  1ZBF A;  3DM2 A;  4KHW A;  3F9K A;  3VQC A;  4OPJ A;  4CHY A;  3OYJ A;  4FLW A;  1J5O A;  1B9D A;  1S1W A;  1JXB A;  3B6O A;  3LPT A;  3ASM A;  2HMI A;  1S9E A;  5J2P A;  4Z4G A;  4OVL A;  3WNH A;  1NJX A;  4CJR A;  2KFN A;  4AH9 A;  4CEF A;  1RTI A;  4FCY A;  1WSJ A;  1HRH A;  4IFV A;  5HRR A;  2OYQ A;  3FFI A;  2KFZ A;  2P51 A;  5HLF A;  4KKO A;  1Q9X A;  4EP5 A;  3S3N A;  3AA4 A;  4B9U A;  3VQP A;  1KSP A;  1TKD A;  3NF9 A;  4B9T A;  1T05 A;  3TAP A;  4DLE A;  3KTQ A;  3IRX A;  4J2B A;  3MXJ A;  3SUQ A;  2XO7 A;  1VK0 A;  3AV9 A;  1QQC A;  1QSS A;  1ZBI A;  4CF9 A;  3L2Q A;  2JLE A;  3V9S A;  4DTU A;  2KZZ A;  2YNG A;  4H4O A;  4E1M A;  4PA1 A;  1KRP A;  3RMA A;  3OYD A;  1VSE A;  3L2R A;  4B9M A;  1RDB A;  3CQ8 A;  4FM0 A;  4FLT A;  4Z0U A;  3KJV A;  2OZS A;  1JLF A;  4CFA A;  4CEC A;  1B92 A;  3WNF A;  2XY5 A;  3SUO A;  1U4B A;  3KK1 A;  1BI4 B;  4XIU A;  2ETJ A;  4YNQ A;  4CF1 A;  4YFU A;  3NCI A;  1IO2 A;  1VSF A;  1BIS A;  4F3O A;  2HHW A;  1BQN A;  2GBZ A;  4IFY A;  4RW6 A;  4Z4H A;  4OGE A;  4R5P A;  3ZT0 A;  4E3S A;  4LSL A;  1C0M A;  4BWJ A;  4L8R B;  2F8S A;  5CZ1 A;  4CK3 A;  5KTQ A;  4O55 A;  4KO0 A;  3KLF A;  1YVU A;  3U3Y A;  2ATQ A;  3HK2 A;  4KRF A;  5CY4 A;  3DLE A;  4C8M A;  5JS2 A;  3HVR A;  1C0T A;  3AVI A;  1I3A A;  3CYM A;  1NOZ A;  1ZYQ A;  4ELT A;  4FK2 A;  4BDY A;  3LZJ A;  4CER A;  1DTQ A;  4QOZ B;  3LP0 A;  4CHO A;  1CZ9 A;  1RCH A;  4FM2 A;  3TAR A;  2JGU A;  2AJQ A;  3AVK A;  4QCL A;  1RDD A;  1RIL A;  2IOC A;  3KKS A;  3ZT1 A;  4LSN A;  4ELU A;  4KI4 A;  1TAU A;  3S3O A;  4FZX C;  3AA3 A;  3IAY A;  4OLB A;  3PY8 A;  4NCG A;  4CJL A;  3ISN C;  1RDA A;  2OPP A;  4CJ4 A;  3RMC A;  3MXM A;  3TR8 A;  1NK9 A;  4K8Z A;  4DQI A;  4KHY A;  4Z4F A;  1Z26 A;  3AO4 A;  3ZSX A;  4CJK A;  2Z1J A;  3SV4 A;  1X9M A;  1RT3 A;  2E6M A;  3LWM A;  4ZTF A;  1EP4 A;  5D3G A;  3HVT A;  4CF0 A;  2XHB A;  3QET A;  4H8K A;  4AHU A;  1QSY A;  3AVG A;  3ZSO A;  3HT3 A;  2P1J A;  4F2R A;  4DTS A;  1NKE A;  4M3W A;  1RBS A;  2KW4 A;  4C8N A;  4ICL A;  4M3R A;  3EY1 A;  5J1E A;  4CJP A;  3SUP A;  5DK5 A;  2XY6 A;  1NK6 A;  3VQ8 A;  4CEO A;  1NKC A;  4KB1 A;  4KHN A;  3L2V A;  3HXM A;  1W0H A;  3AVM A;  1HJR A;  3V1O A;  4AHT A;  4QAG A;  4DWI A;  1O1W A;  4CHN A;  1CLQ A;  1BI4 A;  2EHG A;  1KLN A;  3SCX A;  2YV0 X;  1X9S A;  4ZHR A;  2HHU A;  1S5J A;  2BAN A;  3SQ2 A;  3M8P A;  4DU1 A;  3O4Q A;  4C8O A;  2QK9 A;  4RW9 A;  1IG9 A;  4CK2 A;  5FRN A;  4FM1 A;  2DFH A;  1KVA A;  4FJI A;  2YHA A;  3M8R A;  4PUO A;  1VRT A;  1KFD A;  5HRP A;  1NJY A;  3OYB A;  4CGG A;  1U45 A;  5CZ2 A;  3OYM A;  3G0Z A;  4CF2 A;  3WNE A;  3ZT3 A;  4JRQ A;  1VSD A;  4DLG A;  2O4I A;  4I9L A;  2X78 A;  1TKT A;  4OKJ A;  4CIE A;  2FBY A;  4CJV A;  2ZE2 A;  4N76 A;  1WSH A;  3RMB A;  1YTU A;  2HNY A;  3NGI A;  3QEV A;  4CEB A;  2ZQB A;  1TAQ A;  3KIO A;  1JXE A;  4J2A A;  4DFP A;  2BGG A;  1S1U A;  1QS4 A;  1LWC A;  1RT6 A;  2KZM A;  3ZSZ A;  1SL2 A;  2A1S A;  3VQ7 A;  1Q8I A;  4BE2 A;  2RPI A;  4OJR A;  4CCH A;  3SQ4 A;  1BCM A;  1KLM A;  1ASU A;  3KLG A;  2KTQ A;  1HYV A;  4EP4 A;  1BGX T;  4HTU A;  3VN5 A;  4EZ6 A;  3A2F A;  1IKV A;  3AVB A;  1ASW A;  4DTN A;  1WSF A;  4FJ9 A;  3QO9 A;  3LP2 A;  1MU2 A;  1SL0 A;  3DLB A;  3KLE A;  3CFP A;  4N41 A;  5I42 A;  3QIP A;  4M3U A;  1GOC A;  1TV6 A;  2B4J A;  1VSL A;  4BE0 A;  1C6V A;  4FJH A;  4CF8 A;  4FJX A;  4I2P A;  4FZZ A;  2FC0 A;  2HHQ A;  3NAE A;  3V9U A;  4DSI A;  2VG7 A;  1RBR A;  1HQU A;  2BE2 A;  4CEQ A;  1DTT A;  1IKY A;  1JL2 A;  3DRS A;  2EX3 A;  1WN7 A;  3VQB A;  2E6L A;  3OYN A;  3KLH A;  3QEP A;  1RTH A;  4B08 A;  2PZS A;  4FK0 A;  3RR8 A;  2PY5 A;  1XWL A;  3VQ5 A;  3I0S A;  1TK8 A;  3NFA A;  2G8K A;  4DSL A;  1HNV A;  1FKP A;  3HYF A;  3L2U A;  1X9W A;  1GOA A;  3T19 A;  4M3Z A;  1TVR A;  4KFB A;  4Q0B A;  1QTM A;  3ZCM A;  4FJM A;  4LH4 A;  2A1R A;  4CJU A;  2XY7 A;  4KTW A;  4KPY A;  4FW1 A;  1L3T A;  1KCF A;  3TAM A;  2G8V A;  4BAC A;  3P5J A;  3HST B;  2D5R A;  4O44 A;  3V1R A;  4DS4 A;  3NH2 A;  1T03 A;  3NHG A;  3C95 A;  3K57 A;  4JLH A;  1S1V A;  4JS4 A;  1BL3 A;  3AVA A;  1A5V A;  4C8K A;  2G8W A;  3OYA A;  4DU4 A;  3SUN A;  1U47 A;  1WNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...