3AA3A

A52l e. coli rnase hi
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMALIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Protein core adaptability: crystal structures of the cavity-filling variants of Escherichia coli RNase HI
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 48
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aa3A00
3QIPA 3KLGA 2YKMA 4Y1DA 1FKOA 3KD1E 3HPGA 4H8KA 3SQ4A 4FM0A 4O55A 3AO5A 1DTTA 3DOKA 2RPIA 4FLZA 3IAYA 3KLIA 3NGIA 3VA3A 1XHZA 4KHWA 3OYIA 3DRRA 3V1QA 1RDCA 2OPSA 1TKZA 4CGDA 3M8RA 1JLQA 4CJEA 1S5JA 2BANA 3P5JA 4MFBA 3LDSA 1RDAA 3MXJA 5CYMA 3K59A 4K8XA 1JLAA 1HNVA 2VG7A 4FW1A 5C25A 3U6FA 2XY7A 5KRSA 1SV5A 3SV3A 1NJXA 3VQCA 1L5UA 4KRFA 4FK4A 3TANA 3VA0A 2QKKA 1NKEA 1YT3A 2A1RA 3LANA 2HW3A 5HLFA 4M3WA 4DTNA 4Y1CA 1GOAA 2RF2A 1BIUA 1JL2A 2IS3A 3HT3A 3OYGA 4E7IA 4DFPA 3O3FA 2OZSA 1QE1A 4B8AB 3HL8A 3LAKA 3SV4A 1T8EA 1EX4A 3NE6A 3ZSWA 4NYNA 3AA3A 1J5OA 3LALA 3AVKA 4OGEA 4DFMA 2HHTA 4AH9A 4KO0A 4E0DA 3VQEA 3ZT1A 4ZTJA 4MQ3A 3AV9A 3OYMA 3TAEA 1NOYA 3MECA 4DMNA 1JLCA 1UWBA 1WSEA 1C1CA 1W0HA 2OZMA 2YKNA 3NF7A 4CIEA 4CHNA 4BACA 3VQAA 1NOZA 4KTZA 4CEDA 4DQSA 4CJ3A 3RRHA 4W5RA 1UA1A 4NCBA 4Z4GA 4CEEA 1KVCA 1BQMA 1U49A 4DG1A 5KTQA 3SUNA 4E7KA 3ULDA 4DU4A 3P1GA 3HSTB 4XIUA 4C8MA 1TKTA 3ZSRA 3VQQA 4JS4A 1VSKA 4HVJA 3AVJA 4PY5A 4CK3A 3LAMA 4DF4A 1A5VA 3VQ5A 2VWJA 2O4IA 1NJWA 1JLGA 1HYSA 4GW6A 4CIFA 1L3TA 1HYZA 4DSKA 3KKSA 2R7YA 2QXFA 3B6OA 4H4MA 5E41A 4OKEA 3TAQA 4CERA 1N5YA 4AHUA 1D8YA 1TAQA 1TK0A 2RKIA 4OVLA 1JL1A 4CEFA 4QCLA 2HVHA 4N47A 4KHQA 1RDBA 4CJFA 1Q9XA 1IO2A 4E7JA 1A5WA 1D9FA 2HHSA 3RMCA 4N56A 3I8DA 2ZE2A 1WAJA 1QHTA 1FXXA 5DMRA 1SKSA 4FYDA 4CFAA 3CFOA 3DLEA 2D5RA 3VQPA 5J2QA 4HUGA 4OKJA 4HCCA 3AVIA 4Q0BA 4B9SA 1VSHA 1X9MA 4KHYA 1HYVA 1JKHA 4KV8A 4M3ZA 4FM2A 3O3HA 4KI6A 2E6MA 2VG6A 1TV6A 2EHGA 3QINA 1Q8IA 2HB5A 3C6UA 1J54A 4H4OA 4RW7A 2X6SA 3VQ7A 1NK5A 3UIQA 2DY4A 4ID5A 3HO1A 3AO1A 3DM2A 4M45A 3DRPA 5J2NA 4IKFA 4Z4IA 1VSLA 1WSIA 2Q3SA 4LSLA 4CE9A 3M8PA 2B4JA 5HRRA 3SUQA 4BWMA 3AVAA 3QERA 4RW9A 1BI4B 3FFIA 3TAGA 4FXDA 4M3TA 1C1AA 4OPKA 1CLQA 3AO3A 3KD5E 1S9EA 1BQNA 4BE0A 2IGIA 1WSGA 3C6TA 3LP3A 3ZSXA 4O0IA 3AVGA 4W5OA 4HUFA 1R0AA 2XY8A 3ITHA 4KB0A 2G8UA 4RG8A 3K57A 1BISA 4ELUA 3HP9A 4DQRA 4KPYA 3TAPA 4YFUA 3D0PA 1RCHA 3ISNC 1IKWA 5JS2A 3V9WA 4DTXA 2G8WA 4KHNA 4KKOA 3ZSZA 2YNGA 1XC9A 3AVCA 4FJKA 1YTUA 1JXEA 4IFYA 4W5NA 1RBTA 3HJFA 5FDLA 3AVHA 4E3SA 3OYFA 4DSFA 2B6AA 1D9DA 4CJKA 3AVBA 4C8LA 2G8IA 4K8ZA 2F96A 3S3OA 3AO4A 4BDZA 1SL2A 2YV0X 4LSNA 4F2SA 1FKPA 1S9GA 2HNDA 4JLHA 3DLBA 3L3VA 3QLHA 4CFBA 4DFJA 4ELTA 1ZBIA 4CJLA 4LY7A 4M3UA 1JLEA 4FJ7A 3T3FA 3PUFA 5DK5A 3KLEA 4ZTFA 5KGWA 4CESA 4DFKA 1L3SA 4HCBA 3NBPA 1BL3A 5CZ2A 4I2QA 4FLUA 1O1WA 1ZBLA 1Y97A 1U04A 2X78A 2KW4A 3DLGA 3DLKA 2XY5A 1UAXA 1Z25A 2DFFA 3U3YA 4FLTA 3CYMA 2BDPA 4BDPA 1TAUA 1S1TA 4BWJA 1U4BA 3KK2A 3JYTA 3ALYA 1KRPA 2IDOA 4AILC 4B08A 4J2BA 3AVFA 1ASWA 3K2PA 4EP5A 3OYBA 4E7HA 4E19A 4CJTA 4Z0UA 3TABA 4DS5A 1GOBA 3T19A 4LH4A 5SZTA 3KJVA 4DF8A 4C8OA 3HVRA 3F73A 4GVMA 5CY4A 4CHQA 4CGIA 1WSFA 4O5BA 2VWKA 4CK1A 3OYKA 2PZSA 2WONA 2FC0A 1EXQA 4JRQA 1RBSA 3M8QA 4LD0A 4B8CA 2HHQA 1IG9A 1UA0A 3QEWA 3KTQA 1BI4A 3V9UA 4KI4A 3ZT0A 5C42A 3ZSQA 3OYLA 1I39A 4CJ4A 4I7FA 1TK8A 3SPZA 3ZT3A 1LV5A 2BGGA 2E4LA 1T7PA 2LSNA 4B9TA 3OYHA 1GOCA 3K58A 4FW2A 3V81A 4M41A 2YHAA 3V9ZA 4F3TA 4B9VA 1REVA 3CFPA 4DSEA 2ITGA 1C0MA 1HJRA 5C24A 3IG1A 1ZYQA 2KZZA 3SQ1A 4IBNA 1NK6A 4M3YA 3VQ6A 1J53A 1UOCA 4CJPA 1YVUA 4IG3A 1G15A 4RW6A 3QESA 3DRSA 1VSFA 3IRXA 2B5JA 2NUBA 2OYQA 1CXQA 1BCMA 1EP4A 5FRMA 4Z4EA 2KFZA 2YNIA 4OKKA 2P5OA 1LWEA 1SUQA 3EY1A 1NK0A 3P83D 4NCGA 1CZBA 3V9XA 1RILA 4I2PA 3NAEA 1CZ9A 3ZSVA 2Y1IA 4PWDA 1BHLA 3OJUA 2WOMA 3MEEA 2W42A 1QSSA 3S9HA 4F8RA 1RT2A 4FJMA 2F8SA 3CM5A 2HHUA 4OGCA 1TL3A 1RT1A 3TI0A 4FVMA 1KFDA 4DTUA 1RBVA 3V1RA 3LZJA 3OS0A 4FZZA 4R5PA 3PO5A 4CEQA 1LAVA 1B9FA 3DLRA 5I42A 3AO2A 1X9SA 2FBVA 1FK9A 3OJSA 3NH2A 1ASUA 1QQCA 1X1PA 5HRSA 4ICLA 4BDYA 1J9AA 2HHXA 4KREA 3LP2A 4E89A 3LP0A 3QNNA 4DTPA 4DSJA 2D0BA 4CEZA 3OYCA 3WNGA 3RR7A 4CGFA 1QSLA 5HRNA 3OY9A 3BGRA 4IDKA 3O3GA 4FLYA 4I9LA 1SL0A 4I9QA 3LPTA 3TAMA 3NDKA 4KHSA 4N5SA 3C94A 3LWLA 3F9KA 1D5AA 1NK7A 1TVRA 3NF9A 1SL1A 3RWUA 4B9LA 3HP6A 1Q9YA 4GMJB 1S1WA 3V9SA 1DTQA 4CHPA 1DLOA 4CIGA 1HQEA 3MEDA 1KVBA 4CHZA 3TWHA 4DTMA 3ZT4A 4HTUA 1WN7A 1JXBA 2IAJA 3DI6A 3QO9A 2X6NA 4CHYA 4ID1A 2BE2A 3DMJA 1ZBFA 4FJ5A 4LH5A 1VSIA 3WNFA 3V4IA 3HXMA 1RBUA 2HMIA 2ZQBA 3SQ0A 2Z1HA 2KZMA 3H08A 1VK0A 1X9WA 3L2RA 1SKRA 3PY8A 4KFBA 2Z1GA 5KI6A 3K5LA 2DTUA 3L2QA 3SNNA 1RTJA 2EX3A 3MEGA 2Z1JA 1TKDA 3L2VA 1SKWA 1NKCA 4KAZA 3JSMA 3QEIA 2O4GA 4J2DA 5J2PA 2HNYA 3I0RA 3MAQA 1LW0A 1NK8A 2F8TA 3TAFA 3NGYA 1S1VA 1W9HA 2KTQA 3SI6A 2IC3A 3QETA 4CF9A 3NH0A 3RTVA 1VSDA 1JLFA 1MU2A 3B6PA 5I3UA 4CJWA 4CGJA 3OYEA 4NYFA 4DU1A 2GUIA 4CHOA 3K5OA 4DLEA 4CGGA 2OPRA 3CG7A 4O4GA 5KRTA 1CXUA 4CF0A 1I3AA 4FJXA 4N76A 3DYAA 2XRIA 3WNHA 5HROA 3QIOA 5SWMA 4M3XA 1RT5A 3KIOA 3HM9A 4CJSA 5HBMA 4E7LA 3QEPA 1WAFA 3L2WA 5HP1A 3THVA 3D45A 4OPJA 2GV9A 1RDDA 1RT7A 4Q5VA 2HHVA 4FJIA 2KFNA 1IH7A 4WE1A 3SUPA 2PYLA 4AHSA 2QKBA 3LZIA 3RMDA 1QTMA 1VRTA 3QNOA 1C0UA 4FZYA 2JLEA 3NFAA 4CF2A 2XO7A 3EYZA 2OPQA 4KB1A 4PUOA 3BDPA 1ITGA 4FJGA 3PX6A 1S6QA 3NF6A 1WSJA 5CYQA 2ETJA 1TGOA 3VQ4A 3SPYA 1S1XA 2QK9A 1YTAA 2DFEA 2FBYA 3TR8A 4DTSA 4E1NA 1WSHA 3LP1A 2P5GA 4HHTA 1B9DA 3U3GA 1KLNA 3SZ2A 1T03A 1B92A 2FBXA 3OVNA 3E01A 1XI1A 1LW2A 2FBTA 1VRUA 3A2FA 2P1JA 4KTWA 2Y1JA 3S3MA 2YNHA 3L3UA 4DSIA 2PY5A 1L3VA 1RTDA 2AJQA 4JS5A 1S6PA 3KK1A 2G8HA 1TL1A 5EU7A 4F4KA 4F2RA 4CGHA 3KLHA 3CM6A 4CK2A 4BE2A 2A1SA 4Z4FA 4OLAA 3OYNA 2G8KA 4FJHA 2XHBA 2VG5A 1IKVA 4TSXA 1IKXA 1KTQA 1HRHA 5J1EA 5KGXA 3SQ2A 4F3OA 4C8NA 3OYJA 4BE1A 4CF1A 1Z26A 3KKRA 1C1BA 3L2UA 4Z4CA 1C6VA 1S1UA 4DS4A 3VQ9A 1TKXA 2DFHA 4UQGA 4DTRA 3RRGA 4CJVA 4CF8A 5JS1A 2Z1IA 3PO4A 3AVNA 4CEBA 3OS1A 1RTIA 3WNEA 1QSYA 4DQPA 1KSPA 3EZ5A 3LWMA 4B3OA 4CJQA 1U47A 4AHRA 3V6DA 4PA1A 1NK4A 4DWIA 4N41A 3RR8A 2I5JA 1WLJA 3ZCMA 1L3UA 2JGUA 1KVAA 2GBZA 4DU3A 1ZBUA 3OS2A 2P51A 4PQUA 4IG0A 3NCIA 3QEXA 1BIZA 4FZXC 1T05A 1EKEA 5K14A 4FJLA 3AVLA 3O4NA 1BGXT 4CFCA 4HUEA 4O0JA 3VQBA 3OYDA 3QEVA 4B9UA 3O4QA 4AHCA 4FK0A 3SYZA 4OJRA 1NKBA 1F21A 1HPZA 1RT4A 1NJYA 4EZ6A 4FJNA 5CZ1A 3PV8A 1HQUA 3ZSOA 4AHVA 4DQIA 3NGZA 3NH1A 4RW8A 1RT3A 2D0AA 2IOCA 4QOZB 4J2EA 1NJZA 3MXIA 4ELVA 1U45A 1BCOA 1RNHA 4QAGA 1KLMA 1VSEA 2HNZA 4DQQA 3G0ZA 3PX0A 3HYFA 2YHBA 3MXMA 3OYAA 1KCFA 1RT6A 2ATQA 3DOLA 4DLGA 3RMBA 4CFDA 5T7BA 3KK3A 3V1OA 4FM1A 4CEOA 2HHWA 3I0SA 1C0TA 1LWFA 2G8VA 1JLBA 1XHXA 3AA5X 4EP4A 4ZHRA 3SCXA 4O44A 3ZSYA 4DTJA 3ZT2A 1VSMA 1ASVA 1TK5A 4CCHA 3VQ8A 5FROA 3AA4A 3SUOA 4B9NA 3CFRA 4DTOA 4FJ8A 3HK2A 3TARA 3T1AA 1HNIA 3G10A 2OA8A 4E1MA 2YNFA 2HVIA 4FLWA 1ZBHA 3AA2A 1XWLA 3IS9A 4FLVA 4RW4A 1QS4A 1RBRA 1WNSA 4M3RA 3K5MA 4FLXA 1LAWA 5J2MA 3PX4A 4YNQA 1IKYA 3S3NA 4C8KA 1NK9A 3HPHA 3HPOA 5HRPA 1RTHA 2XY6A 4AHTA 4CEAA 2RN2A 5D3GA 4CECA 3VN5A 2KQ2A 2E6LA 3HVTA 3RMAA 3SJJA 4FJJA 4W5QA 3L8BA 2G8FA 3K5NA 1A5XA 4G1QA 3DLHA 1VSJA 2D0CA 3LPUA 4Z4HA 4DSLA 4KTQA 2ZD1A 1EETA 4FK2A 4OLBA 3CQ8A 1LWCA 4W5TA 3M8SA 4JRPA 3KLFA 3AVMA 3C95A 2X74A 4CJ5A 1U48A 4EZ9A 4NCAA 3NF8A 2PYJA 3VQDA 5FRNA 2OPPA 4L8RB 4KHUA 4FJ9A 1HMVA 4B9MA 3ASMA 1K6YA 4CJUA 4IFVA 4CJRA 4FCYA 4M42A 3NHGA 1N6QA 1KFSA 4J2AA
chains in the Genus database with same CATH superfamily
2CGLA 1FKOA 3SQ4A 3DOKA 3VA3A 1RDCA 4CD1A 2E1ZA 4CGDA 3THYB 3BP8A 5DM7L 3LDSA 4CZFA 5CYMA 1JLAA 2VG7A 5C25A 3SV3A 3TANA 2YHYA 3FE1A 4A57A 2YI1A 2HMPA 3O3FA 4YY3K 4CZJA 2OZSA 3JS6A 3LAKA 5F0XA 3ZLJA 5EX5A 3AVKA 2HHTA 1NGCA 1T44A 1VQPN 1TUYA 1ILYA 4KO0A 4E0DA 2A41A 3ATVA 4MQ3A 3TAEA 3CC2N 1NOYA 1NGAA 2P9KB 2V51B 4DV2K 4FWSA 4BACA 1BO5O 1NOZA 3FFKB 1U49A 1BQMA 3G6EN 3CQYA 1TKTA 1NGHA 3ZSRA 1RGIA 4HVJA 3PSIA 3LAMA 2F9WA 2GELA 1R59O 4GW6A 2E8AA 2NRHA 3TAQA 4CERA 2FSJA 2D1KA 4AHUA 1D8YA 2RKIA 2HVHA 1GLCG 1HLUA 4CJFA 3I56N 1D9FA 3THYA 1QHTA 3CJ1A 5J2QA 3A5NC 3A8YA 2ZJRL 2NRTA 3E9OA 4QS8A 1X9MA 4KV8A 4HWIA 4M3ZA 3O3HA 2E6MA 3QINA 3C6UA 1J54A 1NK5A 3HO1A 4M45A 4H5NA 4BR7A 3VF6A 3SUQA 5HRRA 1VQON 1BUPA 1P90A 3AVAA 5MLCQ 3QERA 4RW9A 1KXPA 4DR7K 3EKSA 4KHPK 4OPKA 4DV1K 1CLQA 3AO3A 1ESVA 1BQNA 4BE0A 3C6TA 3LP3A 4K43A 4H5RA 2P9KA 4HUFA 4IXCA 3LDOA 3QBXA 5I9EB 1NGBA 3V9WA 5JS2A 2P9IB 2YNGA 4JI0K 4FJKA 3HJFA 4H0TB 5JMVA 3MN9A 3OYFA 4DSFA 2B6AA 2G8IA 2HHSA 2F7TA 4K8ZA 2NRVA 4LSNA 3WUHA 1E4GT 1FKPA 2HNDA 3DLBA 3IUCA 1L3SA 4K0KK 4CESA 3NBPA 1VQKN 5CZ2A 4I2QA 4BRMA 2ZJPL 1Y97A 5DM6L 2KW4A 2V7YA 1CZAN 3U3YA 4FLTA 1S1TA 1U4BA 3JYTA 4AILC 5E84A 4B08A 1QVFM 3CPEA 4EP5A 4DR1K 4E19A 2A42A 1Q82O 1GOBA 3KJVA 1VQ8N 4IOCL 3F73A 3BY5A 4K25A 4CJ7A 5GIOA 4JK7A 3J7YP 4BREA 2WONA 4LD0A 5AQLA 5BREA 1UA0A 3CCQN 5C42A 4BR0A 3OYLA 1I39A 4CJ4A 4I7FA 1LV5A 2LSNA 2OTLN 4B9TA 5A2QO 1GOCA 2OCEA 3CF5L 1BOTO 3V81A 4M41A 3J7ZO 1FW6A 2P9IA 1HJRA 3OHRA 3IG1A 1ZYQA 1NK6A 3VQ6A 1J53A 1YVUA 4IG3A 4JK8A 3DRSA 2B5JA 1S22A 4EFHA 2OYQA 1BCMA 3ENBA 2QWMA 4OKKA 1NK0A 1KD1O 3O9UA 5EXWA 1CZBA 2WBNA 3ZSVA 1BHLA 1Y64A 2WOMA 1QSSA 3S9HA 5M1QA 4OGCA 4FVMA 1KFDA 4DTUA 4GY2B 2QWPA 4R5PA 3T1YK 4CEQA 5I42A 2FBVA 3NH2A 5BR9A 1X1PA 2BTFA 4DTPA 2D0BA 3VEYA 3OYCA 4LF9K 3WNGA 4H03B 1NGIA 2NNWA 3O3GA 3T1HK 3O6WA 4YOYA 4I9QA 3LPTA 3SBTA 4YOXA 1K73O 4KHSA 4N5SA 3LWLA 3RWUA 4GV9A 4GNIA 4CIGA 3MEDA 4CHZA 1QHAA 4JNEA 2X6NA 2IIRA 3U9ZA 3FGUA 3IMXA 4FJ5A 3HTVA 4H5VA 4H0VB 4BC2A 1RBUA 4FO0A 2Z1HA 2VCPA 4PL7A 2Z1GA 3UB5A 4LF7K 2Z1JA 4J2DA 5J2PA 1LW0A 3SI6A 2IC3A 3NH0A 3RTVA 1VSDA 4F9OA 4GVEA 4CGJA 4DU1A 2KLAA 3K5OA 4CGGA 4FJXA 3R9PA 3HI0A 3QIOA 3J80O 4YORA 4E7LA 2YCHA 3CJAA 1I94K 2W41A 2UXDK 3CQXA 4DB3A 3RMDA 1C0UA 4JI6K 3L4IA 4CF2A 2XO7A 4KH5A 5AQVA 3PX6A 5CYQA 1M1KO 4H0OA 3ULEB 3LDQA 3ID8A 2DFEA 4DTSA 3U3GA 1KLNA 4NO7A 2Y1JA 3MDQA 2YNHA 3L3UA 3Q7BA 2G8HA 3O1WA 2QW9A 4CGHA 4MLHA 4CK2A 5AQIA 2A1SA 3HM8A 4FJHA 1ATNA 2XHBA 2VG5A 1IKVA 3M1FA 4DHYA 4F3OA 3SLCA 1T6DA 3GE1A 1KAZA 1C1BA 3O5BA 4ISFA 4B1ZA 1S1UA 3L2UA 4DS4A 1TKXA 4DR6K 4FWNA 4DQPA 3ZX3A 3SMPA 4PKIA 3V6DA 4BR4A 4U7BA 3FLCO 1WLJA 1L3UA 1KVAA 2E2OA 1C0GA 4DV4K 5BPLA 3OS2A 4PQUA 3NCIA 3EO3A 3TSUA 1DEJA 5LMUK 3CJ9A 4DR2K 4MDBA 3MWTA 3VEZA 1BWFO 5F1XA 1RT4A 3A5MC 4EZ6A 3F9MA 5CZ1A 3PV8A 4BRPA 3ZSOA 4AHVA 4BGBA 3IKMA 3NGZA 2D0AA 1NJZA 1RNHA 4QAGA 5AQTA 5GAGP 1K8AO 4QS7A 3PX0A 1RT6A 4JKHA 3ULEA 4CFDA 5T7BA 4BQZA 4IO8A 2G8VA 1VSMA 3H3OB 1ASVA 5FPNA 3HK2A 3Q7CA 5AZIB 2O8FB 2GEMA 3TARA 3G10A 1GLAG 4FLWA 3F2KA 2FF3B 3AA2A 3IS9A 1RBRA 4FLXA 3S3NA 5J2MA 3PX4A 2D0OA 1BG3A 3HPOA 4JD2A 1RTHA 4AHTA 2RN2A 5D3GA 4CECA 2WUSA 1X3MA 4W5QA 3WQUA 1NGJA 3LPUA 2D0CA 4Z4HA 4KTQA 1Z6RA 4FK2A 5JVHL 4NLBA 3WXKA 2O8CA 4W5TA 3AVMA 1U48A 3VQDA 2OPPA 4KHUA 5ELZA 3MCPA 3SBGA 4YOWA 2QEXN 4HTLA 4CJRA 1N33K 4M42A 3NHGA 3KLGA 4X62K 2YKMA 3M6GA 2CGKA 4IZ9A 4JI3K 4FM0A 2NRRA 3AO5A 1DTTA 4FLZA 5KPZA 3KLIA 4CBWA 3DRRA 3V1QA 4MO4A 2OPSA 3M8RA 3NVMA 1S5JA 2BANA 3P5JA 4MFBA 1RDAA 4IJAA 4FW1A 2ZF5O 3U6FA 5KRSA 5AQMA 2QKKA 2A1RA 5AQRA 5HLFA 4M3WA 3SAGA 4FWPA 1QQOA 1BIUA 2IS3A 5GIPA 3HT3A 3OYGA 5GAHP 3PIPL 5AZIA 2O8FA 3NE6A 3ZSWA 4NYNA 5KPTA 1XQSC 1IBLK 4OGEA 3U9DA 2Q2RA 4AH9A 4BG8A 3VQEA 5HL7L 4IJNA 1JLCA 1C1CA 4YOTA 4CIEA 2D0PA 4KTZA 3RRHA 4NCBA 4W5RA 4CEEA 3TPQA 5KTQA 3SUNA 4E7KA 3ULDA 4DU4A 4CI6A 5HOOA 5FPMA 3CCUN 3CCVN 3CCEN 4DR4K 1NJWA 3O80A 4CIFA 5AQOA 4DSKA 2R7YA 2QXFA 1XUPO 4OKEA 1JL1A 4KHQA 3ZYYX 1Q9XA 4WFBL 4E7JA 5AQXA 5BPNA 3I8DA 1H1VA 1WAJA 1FXXA 4FYDA 3CPWM 2KKZA 2D5RA 4HUGA 1JJ2M 3DXKA 3E66A 4B3RK 2VG6A 3C7NB 3MK6A 3VQ7A 3ZSXA 1Q8IA 4RW7A 3E9PA 3AO1A 4IKFA 2Q3SA 4I6MB 4FXDA 1NU0A 1N32K 2GTDA 4NXMK 1S9EA 2IGIA 1WSGA 4FWOA 1KQSM 2XY8A 3OBWA 4KB0A 3HP9A 4KPYA 3TAPA 4DTXA 2G8WA 4KKOA 2YHWA 4JKAA 3KWIA 4IFYA 4IO9L 5FDLA 3AVHA 4E3SA 3CCMN 5CE3A 2F96A 3AO4A 4ELTA 1ZBIA 4O5FA 4CJLA 4M3UA 3WXMB 3KLEA 4EHTA 4M63C 5M1OA 3J8AA 4JK9A 2WFBA 1YIJN 2X78A 4JI1K 4A59A 2BDPA 5H1SQ 2P9UB 1XNQK 3P38A 2CH6A 3KK2A 4J2BA 3VENA 1ASWA 3K2PA 1W7AA 2F4VK 3VPZA 4Z0UA 3C7NA 4C8OA 4LH4A 3HVRA 3O08A 5CY4A 1HKGA 4O5BA 2VWKA 3GBTA 2PZSA 5AQHA 3M8QA 4B8CA 1WBDA 3KTQA 5KPRA 5ADXH 4KI4A 4I6MA 3ZSQA 2QWRA 2W6KA 3VEXA 3VF2A 3EZWA 3SPZA 1N36K 4OPHA 4JI7K 3K58A 4A2AA 1YI2N 4U67L 4KH4A 2VQEK 2ITGA 1C0MA 4RCHA 2Q0RA 3A0IX 5BR8K 4X66K 4KBOA 4BRKA 4M3YA 4CJPA 2ZGYA 4RW6A 2WC9A 3QESA 3IRXA 1CXQA 1BA0A 1K8KB 1DT9A 5FPEA 3HOSA 3P83D 4DV7K 3V9XA 2GWJA 3NAEA 3RVCA 4FVUA 1XMOK 4G9ZA 5LJWA 3MEEA 2NLXA 1YITN 3CM5A 1RT1A 4WFAL 3V1RA 3LZJA 4LF6K 2NRZA 4WCEL 1QQMA 4BRFA 2P9UA 1X9SA 3SK3A 3NVKA 2VYPA 3LDLA 3OJSA 1G99A 4R79A 4BDYA 1OVQA 3F5TA 4E89A 5LJVA 4DSJA 5IT9O 2H3GX 3SJHA 2O8BA 4CBUA 5HRNA 3EL2A 4IDKA 4FLYA 4I9LA 1T6CA 4M7YA 3C0BA 1NK7A 1TVRA 3NF9A 4CHPA 3SMSA 1HQEA 2E2PA 2D4WA 2E2QA 1JXBA 2BE2A 4LH5A 2QWLA 3C65A 1VSIA 3OA9A 4CZMA 3HXMA 5LMNK 3V4IA 2HMIA 3SQ0A 2KZMA 3MN5A 1X9WA 3EN9A 3CC4N 2Q31A 4KFBA 2DTUA 3L2QA 4ILGB 3SNNA 2EX3A 3MEGA 3FZMA 1K8KA 4KAZA 3QEIA 2GX9A 3I0RA 3TAFA 3KWGA 3QETA 1ZXOA 5I3UA 3B6PA 1IJJA 2GUIA 4ISGA 4BRGA 2O8DB 5C12A 3WNHA 3H6EA 3QFUA 3KIOA 3R8EA 5HBMA 4CJSA 3THVA 1YAGA 3D45A 2E2NA 2GV9A 4FJIA 1IH7A 3SUPA 2PYLA 2QI2A 2JLEA 4ILJA 1EWQA 3EYZA 3B8AX 5AFUH 4CBXA 5AR0A 4KB1A 4B9QA 1VQ5N 3BDPA 4BRCA 3G25A 1VQLN 2GWKA 2ETJA 3SPYA 1S1XA 3CMAN 4L3QA 3TR8A 3HSCA 3QB0A 4E1NA 1WSHA 2FBXA 1VQ4N 1XI1A 1U2VB 1LW2A 2QWQA 2YJFA 3S3MA 4BROA 2PY5A 1L3VA 1RTDA 3KVGA 4BGAA 4JS5A 3O9QA 3KK1A 3TU5A 5C2DA 4B3TK 4BE2A 4Z4FA 4CVNE 4TSXA 3SQ2A 4BC5A 3KKRA 3L0QA 4Z4CA 5GAEP 4JKBA 3VQ9A 2DFHA 5AQSA 5EY4A 3WNEA 3EZ5A 4B3OA 1NWKA 4DWIA 4N41A 3H3NO 3ZCMA 1WUAA 2O8DA 1QQNA 1ZBUA 4JKCA 3FR0A 5AJ3K 4DKWA 3QEXA 1BIZA 3GDQA 4FZXC 1T05A 3O9TA 3WXIA 3O4NA 1BGXT 3CJBA 4CFCA 3OYDA 3O4QA 4AHCA 4A5AA 3SYZA 4OJRA 4LF4K 3A5OC 1NJYA 3DAWA 4RW8A 3CJCA 1RT3A 1ATSA 4BVPA 1YUWA 3U4LA 2V7ZA 5KQDA 2YHBA 2ATQA 3DOLA 3RMBA 5AQWA 4CEOA 3I0SA 3M3ZA 1C0TA 2V52B 1JLBA 1XHXA 3SCXA 4JI5K 1U2VA 1EWRA 4CCHA 3SUOA 3TSPA 4FJ8A 3PIOL 3KK7A 2OA8A 5AQKA 1HX1A 1ZBHA 3K9JA 1XWLA 4FLVA 4M3RA 1NK9A 4FOIA 4IFEA 4XEIA 1HR0K 1VQNN 3D7EO 1NMDA 2E6LA 3HVTA 3RMAA 3L8BA 4NXNK 1A5XA 3DLHA 1VSJA 4OLBA 4DSLA 1EETA 3CQ8A 1LWCA 3BZKA 4JRPA 4NCAA 4CJ5A 3NF8A 2PYJA 2A40A 4FWRA 1HMVA 1K6YA 4XH4A 3WQTA 3J7AP 4FCYA 1N6QA 1QSYA 2OTJN 1WOQA 4H0XB 4Y1DA 3KD1E 3HPGA 3AARA 2QWOA 3IAYA 1HJOA 1EQYA 5AQFA 4KHWA 2HSTA 4C1NK 1TKZA 4WFNL 1JCEA 2HOEA 1N34K 4K8XA 3MXJA 3K59A 1HNVA 1NJXA 1SV5A 3AY9A 4FK4A 3BF3A 3MCAB 3VA0A 1YT3A 1W97L 4DTNA 4Y1CA 1JL2A 4DFPA 4E7IA 4DV6K 1EX4A 3AA3A 1N8RO 1J5OA 1K9MO 3H45C 4DFMA 2P9PB 3R6MA 2HHHK 3ZT1A 4ZTJA 4JD2B 4JKEA 3OYMA 1Q7YO 4DMNA 3JXUA 1W0HA 3PSFA 3NF7A 2OZMA 3VQAA 3P31A 4FPAA 4CEDA 4DQSA 4CJ3A 3QDKA 1FJGK 2YHXA 1UA1A 4Z4GA 3FZLA 1KVCA 1HKCA 2JWKA 2VGNA 2W40A 4DG1A 4BY9C 3P1GA 2O8CB 2QTDA 2NRXA 3K9KA 4KH6A 4BRLA 2Q97A 3VEVA 3CI5A 4CK3A 1RDWX 4DF4A 1A5VA 3VQ5A 3W0LA 5AQQA 1HYSA 5E26A 2AA4A 2JWLA 4DUZK 1L3TA 1HYZA 2ZWHA 3KKSA 3B6OA 4H4MA 3ZEUA 1TK0A 4CEFA 4N47A 1A5WA 3W3DA 3AGKA 5DMRA 1SKSA 4UY8O 3O8MA 3P4IA 4CFAA 3CFOA 3DLEA 4FL9A 3VOVA 4HCCA 3AVIA 5BPMA 4B1VA 4YOVA 1BDGA 1VSHA 1IBMK 3CCSN 4FM2A 4KI6A 5ADXA 4K41A 1TV6A 2KHOA 1SAZA 3UIQA 4EHUA 3LM9A 3DRPA 4Z4IA 1VSLA 1WSIA 2UYTA 4LSLA 3M8PA 2B4JA 3DLLL 4BWMA 3HZ6A 3R1XA 4JI8K 3FFIA 3TAGA 2P9PA 4BRHA 4MO5A 4O0IA 3AVGA 1GLLO 3H1QA 3ITHA 4O8KA 1XC3A 4RG8A 4CW7B 4JYAK 2ZM6K 5FPDA 2A6AA 4DQRA 1OH6A 3D0PA 1RCHA 1MWKA 3ISNC 4PKHA 3T7ZA 3ZSZA 4FPBA 4YHHK 4PKGA 5TKWA 4B3MK 5TKYA 1RBTA 4A61A 4B3SK 4DR3K 1OH8A 1D9DA 3AVBA 1LOTB 3S3OA 1SL2A 3D2EA 4F2SA 4JAXA 5KQ8A 4JLHA 2IVPA 4CFBA 4DFJA 1M90O 3VMFB 1JLEA 3T3FA 3MN7A 4ZTFA 2IVOA 1BL3A 1ZBLA 3CD6N 3I55N 4LF8K 3DLGA 3DLKA 1UAXA 1QZ6A 3ENHA 4BWJA 3DXKB 2UU9K 2IDOA 2YX6A 3AVFA 1NM1A 4B1YB 4E7HA 4IOAL 1U6ZA 2VWBA 3TABA 3T19A 5SZTA 4DF8A 4CZLA 4GVMA 4CHQA 3R3LA 4CGIA 1WSFA 4IWVA 5BN9A 4CK1A 3OYKA 1ZC6A 4JRQA 1IG9A 1NG9A 1TK8A 3EE9A 3MMVA 1T7PA 2J4RA 1X3NA 3HRGA 4DUYK 4WQ5C 1WB9A 2YHAA 1YJNN 4B9VA 1KAYA 1REVA 2HF3A 5C24A 3SQ1A 1UOCA 1G15A 1QVGM 2NUBA 4Z4EA 1EP4A 2YNIA 5AZJB 1SUQA 3EY1A 2P5OA 4NCGA 3EE8A 3VTHA 1RILA 1CZ9A 2Y1IA 1T3VA 1HPMA 3OJUA 3U8XA 3CIPA 2UXCK 4F8RA 1RT2A 2F8SA 4K42A 4IDHA 4E1JA 1TL3A 3ZETB 1IG8A 3ZX2A 4JKDA 5EOYA 1LAVA 4GKKK 1B9FA 3AO2A 4DCHA 5AFUA 1FK9A 3NMUA 2HHXA 1ASUA 4ICLA 1J9AA 3LP2A 3N4PA 3QNNA 4JEPA 4BRIA 3RR7A 3THXA 2VGMA 1TUUA 1SL0A 3TTFA 1NGGA 3C94A 4IEIA 3WEEB 1D5AA 4PL8A 4X65K 3HP6A 1Q9YA 4GMJB 1S1WA 1DTQA 1DLOA 4WQ5A 4DV5K 4DTMA 3ZT4A 4HTUA 3CERA 1NJIO 4CHYA 4ID1A 3DMJA 2BUPA 3VETA 1NGFA 2BH1A 3CJ7A 1XMQK 1V4TA 3H08A 1VK0A 2FSNA 1HKBA 1SKRA 4IEEA 3PY8A 5KI6A 3K5LA 1RTJA 1Z05A 1GLBG 5AZJA 1NKCA 3JSMA 1RDUA 2O4GA 3MAQA 1S1VA 1TYQA 1W9HA 4FOEA 3ZX0A 4CF9A 3L6QA 3CCJN 1XNRK 5JLHA 3OYEA 4NYFA 4CZGA 5M1KA 1DKGD 4CHOA 3ZETA 2OPRA 4O4GA 5KRTA 3QFPA 1CXUA 4N76A 3L4QA 4DR5K 4M3XA 1RT5A 3HM9A 5FLXO 2P9SB 1WAFA 3L2WA 3BZCA 3DWLA 3QEPA 1O13A 5HP1A 2HHVA 4Q5VA 3P39A 2KFNA 4JN4A 2O8BB 1LCUA 4AHSA 4FZYA 2E20A 2OPQA 4FJGA 3O4WA 2E5LK 1S6QA 3C6HA 1WSJA 3NF6A 4JKGB 4JI4K 2PBDA 1TGOA 3WEEA 2QK9A 4YOUA 3LP1A 1B9DA 1ATRA 3SZ2A 3OVNA 4BG9A 1VRUA 5AQNA 4DSIA 4H5TA 2AJQA 4NLCA 1S6PA 5EU7A 3KLHA 1E3MA 3CM6A 5BRFA 1RFQA 4OLAA 2ZGZA 3IDHA 5JLFA 1IKXA 1KTQA 5J1EA 4C8NA 3OYJA 1SS6A 4CF1A 4BE1A 2FXUA 1Z26A 4DV3K 4DTRA 5M1FA 3DJCA 5B8HA 2EWSA 5JS1A 2Z1IA 3OS1A 3PLAA 1KSPA 3LWMA 1NMNA 1MDUB 3WXLA 4CJQA 3GOIA 1U47A 3I8BA 4B1XB 3BUZB 3VGKA 1NGEA 4IG0A 5AQYA 1EKEA 5K14A 3AVLA 1VHXA 5CR4A 2P9SA 4B9UA 3VQBA 3HBTA 3QEVA 2FLOA 1YJWN 1NKBA 4H0YB 1HPZA 4FJNA 1SQKA 3UKUB 3AGRA 2QWNA 3NH1A 4J2EA 4ELVA 1BCOA 1KLMA 1VSEA 4JKGA 3G0ZA 3HYFA 4H0PA 1KCFA 3OYAA 3KK3A 3V1OA 4FM1A 1LWFA 4C23A 3AA5X 4EP4A 4ZHRA 3ZSYA 3N4QA 3VQ8A 5FROA 3CFRA 3A5LC 5LY3A 2CH5A 4E1MA 3MN6A 1EO1A 3GL1A 1C0FA 4B1WB 4RW4A 1QS4A 3K5MA 1WNSA 4M3TA 2HHUA 1LAWA 4YNQA 1IKYA 1YF5L 3MX2A 4H5WA 3HPHA 4C8KA 4PHTX 3E1YA 5C0YA 4NB4A 3QMLA 3SJJA 1BU6O 2G8FA 1HNZK 4G1QA 3CCRN 4BR9A 3M8SA 3KLFA 2X74A 4EZ9A 5GADP 4FJ9A 3ASMA 1YJ9N 4BRQA 3K0SA 1YVNA 4JKFA 4OX9K 3H46O 3QIPA 5AQZA 5BRHA 4H8KA 4O55A 2P9LB 2RPIA 5IWAK 3UKUA 3D2FB 3NGIA 1XHZA 3OYIA 2HBLA 3QBWA 5M1NA 1JLQA 4CJEA 3CMEN 3AAPA 4KHNA 2ASPA 3ENOA 2XY7A 3VEOA 3VQCA 1L5UA 4KRFA 3KHYA 2HF4A 1NKEA 2QXLA 3LANA 4O8UA 2HW3A 2DPNA 2ASOA 5AQPA 1GOAA 2RF2A 3EKUA 3SAFA 1J5EK 1QE1A 4B8AB 2ASMA 3HL8A 4DQ8A 3SV4A 1T8EA 3LALA 2O8EB 4XH1A 3BEXA 3AV9A 3MECA 1UWBA 1WSEA 2YKNA 4CHNA 4OO1J 4CZIA 2UUBK 4RTFD 2GUPA 2HBMA 3HOTA 3HSTB 4XIUA 4C8MA 3TSQA 2NRWA 2Q1NA 3VQQA 4JS4A 1VSKA 3AVJA 4PY5A 4M7XA 2QA4N 2VWJA 2O4IA 1JLGA 5E41A 3DXMB 1OH7A 1HNWK 1N5YA 4AM7A 1TAQA 2ITMA 4OVLA 2P9LA 4XH5A 4QCLA 2VQFK 1RDBA 3D2FA 1IO2A 3RMCA 4N56A 2ZE2A 3VQPA 5C10A 4OKJA 4Q0BA 4B9SA 4AF1A 4KHYA 1HYVA 1JKHA 4EAHD 2EHGA 4H4OA 2HB5A 2X6SA 2DY4A 4ID5A 3DM2A 5J2NA 3OTOK 4CE9A 1S72N 1VAZA 1YXQA 2O8EA 1BI4B 3I33A 1C1AA 5AQGA 2F9TA 3KD5E 3G4SN 4W5OA 3VERA 1R0AA 2G8UA 3K57A 1BISA 4ELUA 3THWB 3ID6A 2Q36A 4YFUA 2A3ZA 1IKWA 3SAHA 4CZHA 3GG4A 1XC9A 3AVCA 1YTUA 4W5NA 1JXEA 4LFBK 1OH5A 1D4XA 4CJKA 4C8LA 4BDZA 2YV0X 1S9GA 4F3TA 3L3VA 3QLHA 3ZEUB 3FZKA 1OVYA 3DXMA 4LY7A 4CZKA 4FJ7A 4HCBA 3PUFA 5DK5A 2HBJA 5KGWA 4DFKA 3WT0A 4IOXA 1J6ZA 5LL6Z 1O1WA 4FLUA 4CD3A 2RE2A 1U04A 1IBKK 5JVGL 3D6RA 1Z25A 2XY5A 2DFFA 3CYMA 4BDPA 1TAUA 4JI2K 1WBBA 3ALYA 1KRPA 3CC7N 3TTCA 4A2BA 1NLVA 3OYBA 4FWLA 3S41A 2QM1A 4AM6A 4CJTA 1NGDA 4DS5A 2PAVA 1Q86O 3CCLN 1X9JA 2FC0A 1EXQA 1RBSA 2HHQA 2UUCK 3QEWA 1BI4A 3V9UA 3LDNA 3ZT0A 2ZJQL 3ZT3A 4DV0K 2BGGA 3E9LA 2E4LA 4FWQA 3OYHA 1QZ5A 3JAMO 1MWMA 2I7NA 4FW2A 3V9ZA 3LDPA 3THWA 2I7PA 4BQLA 3CFPA 4DSEA 4J8FA 2KZZA 4BC3A 4IBNA 4YDUC 1HUXA 2PFUA 1VSFA 4WF9L 1W2BM 5FRMA 2KFZA 4A62A 1LWEA 3D2EB 3OW2M 2FSKA 4Y0WA 4I2PA 3G71N 3IFRA 4PWDA 1VQ6N 2W42A 4FJMA 4AQYK 4JHDB 3TI0A 4MLEA 1RBVA 1V4SA 4FZZA 3OS0A 3PO5A 4C1NI 1JCFA 3DLRA 1QQCA 5HRSA 2AP1A 4KREA 3LP0A 4CEZA 4CGFA 3UKRB 3KZBA 2CGJA 1QSLA 3OY9A 3BGRA 3CXCM 3QICA 3TAMA 3NDKA 3F9KA 1SL1A 4B9LA 3V9SA 1YHQN 1KVBA 3TWHA 1WN7A 2IAJA 3DI6A 3QO9A 1Q18A 4LFAK 1ZBFA 5AQJA 3WNFA 4YDUA 2ZQBA 3VGMA 3L2RA 5C15A 4X64K 1MA9B 1TKDA 3L2VA 1SKWA 2HNYA 2UUAK 1NK8A 2F8TA 1VQ9N 3NGYA 1VQMN 4GV3A 2KTQA 1NBWA 3CETA 1JLFA 1MU2A 4CJWA 2NZTA 5CHIA 1NNEA 1ZBSA 3T69A 4B1UB 3O9RA 3MWPA 4JHDA 4DLEA 2P9NB 3CG7A 3AAQA 3EEQA 4MDAA 4CF0A 1I3AA 3DYAA 2XRIA 5HROA 4FWKA 1S3XA 5SWMA 5BRDA 5GINA 4OPJA 1RDDA 1RT7A 4WE1A 3LL3A 2QKBA 3CHWA 3LZIA 3THXB 1QTMA 3O1BA 1VRTA 3QNOA 3UKRA 3NFAA 5F2RA 3VESA 3FZFA 4PUOA 2UXBK 5BN8A 1ITGA 2IVNA 4WQ4C 3VQ4A 4EIAA 1YTAA 2FBYA 1GLFO 2P5GA 4HHTA 1T03A 1B92A 3E01A 2Q0UA 2FBTA 3A2FA 4KTWA 2P1JA 4GKJK 1P8ZA 3O9SA 1TL1A 4F4KA 2E88A 3RSEB 1DGKN 4F2RA 2FF6A 1VQ7N 1SZ2A 1GLEG 3OYNA 2G8KA 1JCGA 5KGXA 1HRHA 3VGLA 2YJEA 3BF1A 1C6VA 3RRGA 4UQGA 4CJVA 4CF8A 3PO4A 1TYQB 3AVNA 4CEBA 1RTIA 3ATUA 4AHRA 4PA1A 1NK4A 3RR8A 2I5JA 2JGUA 2WTUA 2GBZA 4DU3A 2P9NA 4BR5A 4FWMA 3M5RA 3VTIA 2P51A 3VEWA 3TTDA 4FJLA 4HUEA 4O0JA 4LFCK 4FK0A 4GV6A 1F21A 4BR2A 1BA1A 4BRDA 1HQUA 4WYBA 5JICA 4DQIA 1GLJO 4LC9B 1KAXA 4Z94A 3MX5A 3LM2A 4V19S 2IOCA 3C6AA 4QOZB 4WQ4A 3MXIA 1U45A 2A5XA 2HNZA 3FZHA 4DQQA 3WXJA 3MXMA 4JV5K 4FSVA 4DLGA 2HHWA 2RHKA 4O44A 4DTJA 4ISEA 3ZT2A 5M1PA 5EVZA 1TK5A 4BRNA 4OPAA 3AA4A 2HBKA 4B9NA 4DTOA 3T1AA 1HNIA 3RSEA 4RWTA 2E1YA 3VF4A 5AQUA 2YNFA 2HVIA 4BVOA 2OANA 3J81O 4CZEA 5HRPA 4QS9A 5C2FA 3UE5A 4BRAA 1E4FT 4CEAA 2XY6A 1IV0A 3VN5A 2KQ2A 4FJJA 3K5NA 1Q81O 4A5BA 2ZD1A 4BC4A 3H1VX 1GLDG 4ILHA 1KC8O 2W6LA 3C95A 1OKJA 5FRNA 3OBYA 4L8RB 1HNXK 4B9MA 4CJUA 4IFVA 4LF5K 1KFSA 4J2AA
chains in the Genus database with same CATH topology
3QIPA 3KLGA 2YKMA 4Y1DA 1FKOA 3KD1E 3HPGA 4H8KA 3SQ4A 4FM0A 4O55A 3AO5A 1DTTA 3DOKA 2RPIA 4FLZA 3IAYA 3KLIA 3NGIA 3VA3A 1XHZA 4KHWA 3OYIA 3DRRA 3V1QA 1RDCA 2OPSA 1TKZA 4CGDA 3M8RA 1JLQA 4CJEA 1S5JA 2BANA 3P5JA 4MFBA 3LDSA 1RDAA 3MXJA 5CYMA 3K59A 4K8XA 1JLAA 1HNVA 2VG7A 4FW1A 5C25A 3U6FA 2XY7A 5KRSA 1SV5A 3SV3A 1NJXA 3VQCA 1L5UA 4KRFA 4FK4A 3TANA 3VA0A 2QKKA 1NKEA 1YT3A 2A1RA 3LANA 2HW3A 5HLFA 4M3WA 4DTNA 4Y1CA 1GOAA 2RF2A 1BIUA 1JL2A 2IS3A 3HT3A 3OYGA 4E7IA 4DFPA 3O3FA 2OZSA 1QE1A 4B8AB 3HL8A 3LAKA 3SV4A 1T8EA 1EX4A 3NE6A 3ZSWA 4NYNA 3AA3A 1J5OA 3LALA 3AVKA 4OGEA 4DFMA 2HHTA 4AH9A 4KO0A 4E0DA 3VQEA 3ZT1A 4ZTJA 4MQ3A 3AV9A 3OYMA 3TAEA 1NOYA 3MECA 4DMNA 1JLCA 1UWBA 1WSEA 1C1CA 1W0HA 2OZMA 2YKNA 3NF7A 4CIEA 4CHNA 4BACA 3VQAA 1NOZA 4KTZA 4CEDA 4DQSA 4CJ3A 3RRHA 4W5RA 1UA1A 4NCBA 4Z4GA 4CEEA 1KVCA 1BQMA 1U49A 4DG1A 5KTQA 3SUNA 4E7KA 3ULDA 4DU4A 3P1GA 3HSTB 4XIUA 4C8MA 1TKTA 3ZSRA 3VQQA 4JS4A 1VSKA 4HVJA 3AVJA 4PY5A 4CK3A 3LAMA 4DF4A 1A5VA 3VQ5A 2VWJA 2O4IA 1NJWA 1JLGA 1HYSA 4GW6A 4CIFA 1L3TA 1HYZA 4DSKA 3KKSA 2R7YA 2QXFA 3B6OA 4H4MA 5E41A 4OKEA 3TAQA 4CERA 1N5YA 4AHUA 1D8YA 1TAQA 1TK0A 2RKIA 4OVLA 1JL1A 4CEFA 4QCLA 2HVHA 4N47A 4KHQA 1RDBA 4CJFA 1Q9XA 1IO2A 4E7JA 1A5WA 1D9FA 2HHSA 3RMCA 4N56A 3I8DA 2ZE2A 1WAJA 1QHTA 1FXXA 5DMRA 1SKSA 4FYDA 4CFAA 3CFOA 3DLEA 2D5RA 3VQPA 5J2QA 4HUGA 4OKJA 4HCCA 3AVIA 4Q0BA 4B9SA 1VSHA 1X9MA 4KHYA 1HYVA 1JKHA 4KV8A 4M3ZA 4FM2A 3O3HA 4KI6A 2E6MA 2VG6A 1TV6A 2EHGA 3QINA 1Q8IA 2HB5A 3C6UA 1J54A 4H4OA 4RW7A 2X6SA 3VQ7A 1NK5A 3UIQA 2DY4A 4ID5A 3HO1A 3AO1A 3DM2A 4M45A 3DRPA 5J2NA 4IKFA 4Z4IA 1VSLA 1WSIA 2Q3SA 4LSLA 4CE9A 3M8PA 2B4JA 5HRRA 3SUQA 4BWMA 3AVAA 3QERA 4RW9A 1BI4B 3FFIA 3TAGA 4FXDA 4M3TA 1C1AA 4OPKA 1CLQA 3AO3A 3KD5E 1S9EA 1BQNA 4BE0A 2IGIA 1WSGA 3C6TA 3LP3A 3ZSXA 4O0IA 3AVGA 4W5OA 4HUFA 1R0AA 2XY8A 3ITHA 4KB0A 2G8UA 4RG8A 3K57A 1BISA 4ELUA 3HP9A 4DQRA 4KPYA 3TAPA 4YFUA 3D0PA 1RCHA 3ISNC 1IKWA 5JS2A 3V9WA 4DTXA 2G8WA 4KHNA 4KKOA 3ZSZA 2YNGA 1XC9A 3AVCA 4FJKA 1YTUA 1JXEA 4IFYA 4W5NA 1RBTA 3HJFA 5FDLA 3AVHA 4E3SA 3OYFA 4DSFA 2B6AA 1D9DA 4CJKA 3AVBA 4C8LA 2G8IA 4K8ZA 2F96A 3S3OA 3AO4A 4BDZA 1SL2A 2YV0X 4LSNA 4F2SA 1FKPA 1S9GA 2HNDA 4JLHA 3DLBA 3L3VA 3QLHA 4CFBA 4DFJA 4ELTA 1ZBIA 4CJLA 4LY7A 4M3UA 1JLEA 4FJ7A 3T3FA 3PUFA 5DK5A 3KLEA 4ZTFA 5KGWA 4CESA 4DFKA 1L3SA 4HCBA 3NBPA 1BL3A 5CZ2A 4I2QA 4FLUA 1O1WA 1ZBLA 1Y97A 1U04A 2X78A 2KW4A 3DLGA 3DLKA 2XY5A 1UAXA 1Z25A 2DFFA 3U3YA 4FLTA 3CYMA 2BDPA 4BDPA 1TAUA 1S1TA 4BWJA 1U4BA 3KK2A 3JYTA 3ALYA 1KRPA 2IDOA 4AILC 4B08A 4J2BA 3AVFA 1ASWA 3K2PA 4EP5A 3OYBA 4E7HA 4E19A 4CJTA 4Z0UA 3TABA 4DS5A 1GOBA 3T19A 4LH4A 5SZTA 3KJVA 4DF8A 4C8OA 3HVRA 3F73A 4GVMA 5CY4A 4CHQA 4CGIA 1WSFA 4O5BA 2VWKA 4CK1A 3OYKA 2PZSA 2WONA 2FC0A 1EXQA 4JRQA 1RBSA 3M8QA 4LD0A 4B8CA 2HHQA 1IG9A 1UA0A 3QEWA 3KTQA 1BI4A 3V9UA 4KI4A 3ZT0A 5C42A 3ZSQA 3OYLA 1I39A 4CJ4A 4I7FA 1TK8A 3SPZA 3ZT3A 1LV5A 2BGGA 2E4LA 1T7PA 2LSNA 4B9TA 3OYHA 1GOCA 3K58A 4FW2A 3V81A 4M41A 2YHAA 3V9ZA 4F3TA 4B9VA 1REVA 3CFPA 4DSEA 2ITGA 1C0MA 1HJRA 5C24A 3IG1A 1ZYQA 2KZZA 3SQ1A 4IBNA 1NK6A 4M3YA 3VQ6A 1J53A 1UOCA 4CJPA 1YVUA 4IG3A 1G15A 4RW6A 3QESA 3DRSA 1VSFA 3IRXA 2B5JA 2NUBA 2OYQA 1CXQA 1BCMA 1EP4A 5FRMA 4Z4EA 2KFZA 2YNIA 4OKKA 2P5OA 1LWEA 1SUQA 3EY1A 1NK0A 3P83D 4NCGA 1CZBA 3V9XA 1RILA 4I2PA 3NAEA 1CZ9A 3ZSVA 2Y1IA 4PWDA 1BHLA 3OJUA 2WOMA 3MEEA 2W42A 1QSSA 3S9HA 4F8RA 1RT2A 4FJMA 2F8SA 3CM5A 2HHUA 4OGCA 1TL3A 1RT1A 3TI0A 4FVMA 1KFDA 4DTUA 1RBVA 3V1RA 3LZJA 3OS0A 4FZZA 4R5PA 3PO5A 4CEQA 1LAVA 1B9FA 3DLRA 5I42A 3AO2A 1X9SA 2FBVA 1FK9A 3OJSA 3NH2A 1ASUA 1QQCA 1X1PA 5HRSA 4ICLA 4BDYA 1J9AA 2HHXA 4KREA 3LP2A 4E89A 3LP0A 3QNNA 4DTPA 4DSJA 2D0BA 4CEZA 3OYCA 3WNGA 3RR7A 4CGFA 1QSLA 5HRNA 3OY9A 3BGRA 4IDKA 3O3GA 4FLYA 4I9LA 1SL0A 4I9QA 3LPTA 3TAMA 3NDKA 4KHSA 4N5SA 3C94A 3LWLA 3F9KA 1D5AA 1NK7A 1TVRA 3NF9A 1SL1A 3RWUA 4B9LA 3HP6A 1Q9YA 4GMJB 1S1WA 3V9SA 1DTQA 4CHPA 1DLOA 4CIGA 1HQEA 3MEDA 1KVBA 4CHZA 3TWHA 4DTMA 3ZT4A 4HTUA 1WN7A 1JXBA 2IAJA 3DI6A 3QO9A 2X6NA 4CHYA 4ID1A 2BE2A 3DMJA 1ZBFA 4FJ5A 4LH5A 1VSIA 3WNFA 3V4IA 3HXMA 1RBUA 2HMIA 2ZQBA 3SQ0A 2Z1HA 2KZMA 3H08A 1VK0A 1X9WA 3L2RA 1SKRA 3PY8A 4KFBA 2Z1GA 5KI6A 3K5LA 2DTUA 3L2QA 3SNNA 1RTJA 2EX3A 3MEGA 2Z1JA 1TKDA 3L2VA 1SKWA 1NKCA 4KAZA 3JSMA 3QEIA 2O4GA 4J2DA 5J2PA 2HNYA 3I0RA 3MAQA 1LW0A 1NK8A 2F8TA 3TAFA 3NGYA 1S1VA 1W9HA 2KTQA 3SI6A 2IC3A 3QETA 4CF9A 3NH0A 3RTVA 1VSDA 1JLFA 1MU2A 3B6PA 5I3UA 4CJWA 4CGJA 3OYEA 4NYFA 4DU1A 2GUIA 4CHOA 3K5OA 4DLEA 4CGGA 2OPRA 3CG7A 4O4GA 5KRTA 1CXUA 4CF0A 1I3AA 4FJXA 4N76A 3DYAA 2XRIA 3WNHA 5HROA 3QIOA 5SWMA 4M3XA 1RT5A 3KIOA 3HM9A 4CJSA 5HBMA 4E7LA 3QEPA 1WAFA 3L2WA 5HP1A 3THVA 3D45A 4OPJA 2GV9A 1RDDA 1RT7A 4Q5VA 2HHVA 4FJIA 2KFNA 1IH7A 4WE1A 3SUPA 2PYLA 4AHSA 2QKBA 3LZIA 3RMDA 1QTMA 1VRTA 3QNOA 1C0UA 4FZYA 2JLEA 3NFAA 4CF2A 2XO7A 3EYZA 2OPQA 4KB1A 4PUOA 3BDPA 1ITGA 4FJGA 3PX6A 1S6QA 3NF6A 1WSJA 5CYQA 2ETJA 1TGOA 3VQ4A 3SPYA 1S1XA 2QK9A 1YTAA 2DFEA 2FBYA 3TR8A 4DTSA 4E1NA 1WSHA 3LP1A 2P5GA 4HHTA 1B9DA 3U3GA 1KLNA 3SZ2A 1T03A 1B92A 2FBXA 3OVNA 3E01A 1XI1A 1LW2A 2FBTA 1VRUA 3A2FA 2P1JA 4KTWA 2Y1JA 3S3MA 2YNHA 3L3UA 4DSIA 2PY5A 1L3VA 1RTDA 2AJQA 4JS5A 1S6PA 3KK1A 2G8HA 1TL1A 5EU7A 4F4KA 4F2RA 4CGHA 3KLHA 3CM6A 4CK2A 4BE2A 2A1SA 4Z4FA 4OLAA 3OYNA 2G8KA 4FJHA 2XHBA 2VG5A 1IKVA 4TSXA 1IKXA 1KTQA 1HRHA 5J1EA 5KGXA 3SQ2A 4F3OA 4C8NA 3OYJA 4BE1A 4CF1A 1Z26A 3KKRA 1C1BA 3L2UA 4Z4CA 1C6VA 1S1UA 4DS4A 3VQ9A 1TKXA 2DFHA 4UQGA 4DTRA 3RRGA 4CJVA 4CF8A 5JS1A 2Z1IA 3PO4A 3AVNA 4CEBA 3OS1A 1RTIA 3WNEA 1QSYA 4DQPA 1KSPA 3EZ5A 3LWMA 4B3OA 4CJQA 1U47A 4AHRA 3V6DA 4PA1A 1NK4A 4DWIA 4N41A 3RR8A 2I5JA 1WLJA 3ZCMA 1L3UA 2JGUA 1KVAA 2GBZA 4DU3A 1ZBUA 3OS2A 2P51A 4PQUA 4IG0A 3NCIA 3QEXA 1BIZA 4FZXC 1T05A 1EKEA 5K14A 4FJLA 3AVLA 3O4NA 1BGXT 4CFCA 4HUEA 4O0JA 3VQBA 3OYDA 3QEVA 4B9UA 3O4QA 4AHCA 4FK0A 3SYZA 4OJRA 1NKBA 1F21A 1HPZA 1RT4A 1NJYA 4EZ6A 4FJNA 5CZ1A 3PV8A 1HQUA 3ZSOA 4AHVA 4DQIA 3NGZA 3NH1A 4RW8A 1RT3A 2D0AA 2IOCA 4QOZB 4J2EA 1NJZA 3MXIA 4ELVA 1U45A 1BCOA 1RNHA 4QAGA 1KLMA 1VSEA 2HNZA 4DQQA 3G0ZA 3PX0A 3HYFA 2YHBA 3MXMA 3OYAA 1KCFA 1RT6A 2ATQA 3DOLA 4DLGA 3RMBA 4CFDA 5T7BA 3KK3A 3V1OA 4FM1A 4CEOA 2HHWA 3I0SA 1C0TA 1LWFA 2G8VA 1JLBA 1XHXA 3AA5X 4EP4A 4ZHRA 3SCXA 4O44A 3ZSYA 4DTJA 3ZT2A 1VSMA 1ASVA 1TK5A 4CCHA 3VQ8A 5FROA 3AA4A 3SUOA 4B9NA 3CFRA 4DTOA 4FJ8A 3HK2A 3TARA 3T1AA 1HNIA 3G10A 2OA8A 4E1MA 2YNFA 2HVIA 4FLWA 1ZBHA 3AA2A 1XWLA 3IS9A 4FLVA 4RW4A 1QS4A 1RBRA 1WNSA 4M3RA 3K5MA 4FLXA 1LAWA 5J2MA 3PX4A 4YNQA 1IKYA 3S3NA 4C8KA 1NK9A 3HPHA 3HPOA 5HRPA 1RTHA 2XY6A 4AHTA 4CEAA 2RN2A 5D3GA 4CECA 3VN5A 2KQ2A 2E6LA 3HVTA 3RMAA 3SJJA 4FJJA 4W5QA 3L8BA 2G8FA 3K5NA 1A5XA 4G1QA 3DLHA 1VSJA 2D0CA 3LPUA 4Z4HA 4DSLA 4KTQA 2ZD1A 1EETA 4FK2A 4OLBA 3CQ8A 1LWCA 4W5TA 3M8SA 4JRPA 3KLFA 3AVMA 3C95A 2X74A 4CJ5A 1U48A 4EZ9A 4NCAA 3NF8A 2PYJA 3VQDA 5FRNA 2OPPA 4L8RB 4KHUA 4FJ9A 1HMVA 4B9MA 3ASMA 1K6YA 4CJUA 4IFVA 4CJRA 4FCYA 4M42A 3NHGA 1N6QA 1KFSA 4J2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QIP A;  3KLG A;  2YKM A;  4Y1D A;  1FKO A;  3KD1 E;  3HPG A;  4H8K A;  3SQ4 A;  4FM0 A;  4O55 A;  3AO5 A;  1DTT A;  3DOK A;  2RPI A;  4FLZ A;  3IAY A;  3KLI A;  3NGI A;  3VA3 A;  1XHZ A;  4KHW A;  3OYI A;  3DRR A;  3V1Q A;  1RDC A;  2OPS A;  1TKZ A;  4CGD A;  3M8R A;  1JLQ A;  4CJE A;  1S5J A;  2BAN A;  3P5J A;  4MFB A;  3LDS A;  1RDA A;  3MXJ A;  5CYM A;  3K59 A;  4K8X A;  1JLA A;  1HNV A;  2VG7 A;  4FW1 A;  5C25 A;  3U6F A;  2XY7 A;  5KRS A;  1SV5 A;  3SV3 A;  1NJX A;  3VQC A;  1L5U A;  4KRF A;  4FK4 A;  3TAN A;  3VA0 A;  2QKK A;  1NKE A;  1YT3 A;  2A1R A;  3LAN A;  2HW3 A;  5HLF A;  4M3W A;  4DTN A;  4Y1C A;  1GOA A;  2RF2 A;  1BIU A;  1JL2 A;  2IS3 A;  3HT3 A;  3OYG A;  4E7I A;  4DFP A;  3O3F A;  2OZS A;  1QE1 A;  4B8A B;  3HL8 A;  3LAK A;  3SV4 A;  1T8E A;  1EX4 A;  3NE6 A;  3ZSW A;  4NYN A;  3AA3 A;  1J5O A;  3LAL A;  3AVK A;  4OGE A;  4DFM A;  2HHT A;  4AH9 A;  4KO0 A;  4E0D A;  3VQE A;  3ZT1 A;  4ZTJ A;  4MQ3 A;  3AV9 A;  3OYM A;  3TAE A;  1NOY A;  3MEC A;  4DMN A;  1JLC A;  1UWB A;  1WSE A;  1C1C A;  1W0H A;  2OZM A;  2YKN A;  3NF7 A;  4CIE A;  4CHN A;  4BAC A;  3VQA A;  1NOZ A;  4KTZ A;  4CED A;  4DQS A;  4CJ3 A;  3RRH A;  4W5R A;  1UA1 A;  4NCB A;  4Z4G A;  4CEE A;  1KVC A;  1BQM A;  1U49 A;  4DG1 A;  5KTQ A;  3SUN A;  4E7K A;  3ULD A;  4DU4 A;  3P1G A;  3HST B;  4XIU A;  4C8M A;  1TKT A;  3ZSR A;  3VQQ A;  4JS4 A;  1VSK A;  4HVJ A;  3AVJ A;  4PY5 A;  4CK3 A;  3LAM A;  4DF4 A;  1A5V A;  3VQ5 A;  2VWJ A;  2O4I A;  1NJW A;  1JLG A;  1HYS A;  4GW6 A;  4CIF A;  1L3T A;  1HYZ A;  4DSK A;  3KKS A;  2R7Y A;  2QXF A;  3B6O A;  4H4M A;  5E41 A;  4OKE A;  3TAQ A;  4CER A;  1N5Y A;  4AHU A;  1D8Y A;  1TAQ A;  1TK0 A;  2RKI A;  4OVL A;  1JL1 A;  4CEF A;  4QCL A;  2HVH A;  4N47 A;  4KHQ A;  1RDB A;  4CJF A;  1Q9X A;  1IO2 A;  4E7J A;  1A5W A;  1D9F A;  2HHS A;  3RMC A;  4N56 A;  3I8D A;  2ZE2 A;  1WAJ A;  1QHT A;  1FXX A;  5DMR A;  1SKS A;  4FYD A;  4CFA A;  3CFO A;  3DLE A;  2D5R A;  3VQP A;  5J2Q A;  4HUG A;  4OKJ A;  4HCC A;  3AVI A;  4Q0B A;  4B9S A;  1VSH A;  1X9M A;  4KHY A;  1HYV A;  1JKH A;  4KV8 A;  4M3Z A;  4FM2 A;  3O3H A;  4KI6 A;  2E6M A;  2VG6 A;  1TV6 A;  2EHG A;  3QIN A;  1Q8I A;  2HB5 A;  3C6U A;  1J54 A;  4H4O A;  4RW7 A;  2X6S A;  3VQ7 A;  1NK5 A;  3UIQ A;  2DY4 A;  4ID5 A;  3HO1 A;  3AO1 A;  3DM2 A;  4M45 A;  3DRP A;  5J2N A;  4IKF A;  4Z4I A;  1VSL A;  1WSI A;  2Q3S A;  4LSL A;  4CE9 A;  3M8P A;  2B4J A;  5HRR A;  3SUQ A;  4BWM A;  3AVA A;  3QER A;  4RW9 A;  1BI4 B;  3FFI A;  3TAG A;  4FXD A;  4M3T A;  1C1A A;  4OPK A;  1CLQ A;  3AO3 A;  3KD5 E;  1S9E A;  1BQN A;  4BE0 A;  2IGI A;  1WSG A;  3C6T A;  3LP3 A;  3ZSX A;  4O0I A;  3AVG A;  4W5O A;  4HUF A;  1R0A A;  2XY8 A;  3ITH A;  4KB0 A;  2G8U A;  4RG8 A;  3K57 A;  1BIS A;  4ELU A;  3HP9 A;  4DQR A;  4KPY A;  3TAP A;  4YFU A;  3D0P A;  1RCH A;  3ISN C;  1IKW A;  5JS2 A;  3V9W A;  4DTX A;  2G8W A;  4KHN A;  4KKO A;  3ZSZ A;  2YNG A;  1XC9 A;  3AVC A;  4FJK A;  1YTU A;  1JXE A;  4IFY A;  4W5N A;  1RBT A;  3HJF A;  5FDL A;  3AVH A;  4E3S A;  3OYF A;  4DSF A;  2B6A A;  1D9D A;  4CJK A;  3AVB A;  4C8L A;  2G8I A;  4K8Z A;  2F96 A;  3S3O A;  3AO4 A;  4BDZ A;  1SL2 A;  2YV0 X;  4LSN A;  4F2S A;  1FKP A;  1S9G A;  2HND A;  4JLH A;  3DLB A;  3L3V A;  3QLH A;  4CFB A;  4DFJ A;  4ELT A;  1ZBI A;  4CJL A;  4LY7 A;  4M3U A;  1JLE A;  4FJ7 A;  3T3F A;  3PUF A;  5DK5 A;  3KLE A;  4ZTF A;  5KGW A;  4CES A;  4DFK A;  1L3S A;  4HCB A;  3NBP A;  1BL3 A;  5CZ2 A;  4I2Q A;  4FLU A;  1O1W A;  1ZBL A;  1Y97 A;  1U04 A;  2X78 A;  2KW4 A;  3DLG A;  3DLK A;  2XY5 A;  1UAX A;  1Z25 A;  2DFF A;  3U3Y A;  4FLT A;  3CYM A;  2BDP A;  4BDP A;  1TAU A;  1S1T A;  4BWJ A;  1U4B A;  3KK2 A;  3JYT A;  3ALY A;  1KRP A;  2IDO A;  4AIL C;  4B08 A;  4J2B A;  3AVF A;  1ASW A;  3K2P A;  4EP5 A;  3OYB A;  4E7H A;  4E19 A;  4CJT A;  4Z0U A;  3TAB A;  4DS5 A;  1GOB A;  3T19 A;  4LH4 A;  5SZT A;  3KJV A;  4DF8 A;  4C8O A;  3HVR A;  3F73 A;  4GVM A;  5CY4 A;  4CHQ A;  4CGI A;  1WSF A;  4O5B A;  2VWK A;  4CK1 A;  3OYK A;  2PZS A;  2WON A;  2FC0 A;  1EXQ A;  4JRQ A;  1RBS A;  3M8Q A;  4LD0 A;  4B8C A;  2HHQ A;  1IG9 A;  1UA0 A;  3QEW A;  3KTQ A;  1BI4 A;  3V9U A;  4KI4 A;  3ZT0 A;  5C42 A;  3ZSQ A;  3OYL A;  1I39 A;  4CJ4 A;  4I7F A;  1TK8 A;  3SPZ A;  3ZT3 A;  1LV5 A;  2BGG A;  2E4L A;  1T7P A;  2LSN A;  4B9T A;  3OYH A;  1GOC A;  3K58 A;  4FW2 A;  3V81 A;  4M41 A;  2YHA A;  3V9Z A;  4F3T A;  4B9V A;  1REV A;  3CFP A;  4DSE A;  2ITG A;  1C0M A;  1HJR A;  5C24 A;  3IG1 A;  1ZYQ A;  2KZZ A;  3SQ1 A;  4IBN A;  1NK6 A;  4M3Y A;  3VQ6 A;  1J53 A;  1UOC A;  4CJP A;  1YVU A;  4IG3 A;  1G15 A;  4RW6 A;  3QES A;  3DRS A;  1VSF A;  3IRX A;  2B5J A;  2NUB A;  2OYQ A;  1CXQ A;  1BCM A;  1EP4 A;  5FRM A;  4Z4E A;  2KFZ A;  2YNI A;  4OKK A;  2P5O A;  1LWE A;  1SUQ A;  3EY1 A;  1NK0 A;  3P83 D;  4NCG A;  1CZB A;  3V9X A;  1RIL A;  4I2P A;  3NAE A;  1CZ9 A;  3ZSV A;  2Y1I A;  4PWD A;  1BHL A;  3OJU A;  2WOM A;  3MEE A;  2W42 A;  1QSS A;  3S9H A;  4F8R A;  1RT2 A;  4FJM A;  2F8S A;  3CM5 A;  2HHU A;  4OGC A;  1TL3 A;  1RT1 A;  3TI0 A;  4FVM A;  1KFD A;  4DTU A;  1RBV A;  3V1R A;  3LZJ A;  3OS0 A;  4FZZ A;  4R5P A;  3PO5 A;  4CEQ A;  1LAV A;  1B9F A;  3DLR A;  5I42 A;  3AO2 A;  1X9S A;  2FBV A;  1FK9 A;  3OJS A;  3NH2 A;  1ASU A;  1QQC A;  1X1P A;  5HRS A;  4ICL A;  4BDY A;  1J9A A;  2HHX A;  4KRE A;  3LP2 A;  4E89 A;  3LP0 A;  3QNN A;  4DTP A;  4DSJ A;  2D0B A;  4CEZ A;  3OYC A;  3WNG A;  3RR7 A;  4CGF A;  1QSL A;  5HRN A;  3OY9 A;  3BGR A;  4IDK A;  3O3G A;  4FLY A;  4I9L A;  1SL0 A;  4I9Q A;  3LPT A;  3TAM A;  3NDK A;  4KHS A;  4N5S A;  3C94 A;  3LWL A;  3F9K A;  1D5A A;  1NK7 A;  1TVR A;  3NF9 A;  1SL1 A;  3RWU A;  4B9L A;  3HP6 A;  1Q9Y A;  4GMJ B;  1S1W A;  3V9S A;  1DTQ A;  4CHP A;  1DLO A;  4CIG A;  1HQE A;  3MED A;  1KVB A;  4CHZ A;  3TWH A;  4DTM A;  3ZT4 A;  4HTU A;  1WN7 A;  1JXB A;  2IAJ A;  3DI6 A;  3QO9 A;  2X6N A;  4CHY A;  4ID1 A;  2BE2 A;  3DMJ A;  1ZBF A;  4FJ5 A;  4LH5 A;  1VSI A;  3WNF A;  3V4I A;  3HXM A;  1RBU A;  2HMI A;  2ZQB A;  3SQ0 A;  2Z1H A;  2KZM A;  3H08 A;  1VK0 A;  1X9W A;  3L2R A;  1SKR A;  3PY8 A;  4KFB A;  2Z1G A;  5KI6 A;  3K5L A;  2DTU A;  3L2Q A;  3SNN A;  1RTJ A;  2EX3 A;  3MEG A;  2Z1J A;  1TKD A;  3L2V A;  1SKW A;  1NKC A;  4KAZ A;  3JSM A;  3QEI A;  2O4G A;  4J2D A;  5J2P A;  2HNY A;  3I0R A;  3MAQ A;  1LW0 A;  1NK8 A;  2F8T A;  3TAF A;  3NGY A;  1S1V A;  1W9H A;  2KTQ A;  3SI6 A;  2IC3 A;  3QET A;  4CF9 A;  3NH0 A;  3RTV A;  1VSD A;  1JLF A;  1MU2 A;  3B6P A;  5I3U A;  4CJW A;  4CGJ A;  3OYE A;  4NYF A;  4DU1 A;  2GUI A;  4CHO A;  3K5O A;  4DLE A;  4CGG A;  2OPR A;  3CG7 A;  4O4G A;  5KRT A;  1CXU A;  4CF0 A;  1I3A A;  4FJX A;  4N76 A;  3DYA A;  2XRI A;  3WNH A;  5HRO A;  3QIO A;  5SWM A;  4M3X A;  1RT5 A;  3KIO A;  3HM9 A;  4CJS A;  5HBM A;  4E7L A;  3QEP A;  1WAF A;  3L2W A;  5HP1 A;  3THV A;  3D45 A;  4OPJ A;  2GV9 A;  1RDD A;  1RT7 A;  4Q5V A;  2HHV A;  4FJI A;  2KFN A;  1IH7 A;  4WE1 A;  3SUP A;  2PYL A;  4AHS A;  2QKB A;  3LZI A;  3RMD A;  1QTM A;  1VRT A;  3QNO A;  1C0U A;  4FZY A;  2JLE A;  3NFA A;  4CF2 A;  2XO7 A;  3EYZ A;  2OPQ A;  4KB1 A;  4PUO A;  3BDP A;  1ITG A;  4FJG A;  3PX6 A;  1S6Q A;  3NF6 A;  1WSJ A;  5CYQ A;  2ETJ A;  1TGO A;  3VQ4 A;  3SPY A;  1S1X A;  2QK9 A;  1YTA A;  2DFE A;  2FBY A;  3TR8 A;  4DTS A;  4E1N A;  1WSH A;  3LP1 A;  2P5G A;  4HHT A;  1B9D A;  3U3G A;  1KLN A;  3SZ2 A;  1T03 A;  1B92 A;  2FBX A;  3OVN A;  3E01 A;  1XI1 A;  1LW2 A;  2FBT A;  1VRU A;  3A2F A;  2P1J A;  4KTW A;  2Y1J A;  3S3M A;  2YNH A;  3L3U A;  4DSI A;  2PY5 A;  1L3V A;  1RTD A;  2AJQ A;  4JS5 A;  1S6P A;  3KK1 A;  2G8H A;  1TL1 A;  5EU7 A;  4F4K A;  4F2R A;  4CGH A;  3KLH A;  3CM6 A;  4CK2 A;  4BE2 A;  2A1S A;  4Z4F A;  4OLA A;  3OYN A;  2G8K A;  4FJH A;  2XHB A;  2VG5 A;  1IKV A;  4TSX A;  1IKX A;  1KTQ A;  1HRH A;  5J1E A;  5KGX A;  3SQ2 A;  4F3O A;  4C8N A;  3OYJ A;  4BE1 A;  4CF1 A;  1Z26 A;  3KKR A;  1C1B A;  3L2U A;  4Z4C A;  1C6V A;  1S1U A;  4DS4 A;  3VQ9 A;  1TKX A;  2DFH A;  4UQG A;  4DTR A;  3RRG A;  4CJV A;  4CF8 A;  5JS1 A;  2Z1I A;  3PO4 A;  3AVN A;  4CEB A;  3OS1 A;  1RTI A;  3WNE A;  1QSY A;  4DQP A;  1KSP A;  3EZ5 A;  3LWM A;  4B3O A;  4CJQ A;  1U47 A;  4AHR A;  3V6D A;  4PA1 A;  1NK4 A;  4DWI A;  4N41 A;  3RR8 A;  2I5J A;  1WLJ A;  3ZCM A;  1L3U A;  2JGU A;  1KVA A;  2GBZ A;  4DU3 A;  1ZBU A;  3OS2 A;  2P51 A;  4PQU A;  4IG0 A;  3NCI A;  3QEX A;  1BIZ A;  4FZX C;  1T05 A;  1EKE A;  5K14 A;  4FJL A;  3AVL A;  3O4N A;  1BGX T;  4CFC A;  4HUE A;  4O0J A;  3VQB A;  3OYD A;  3QEV A;  4B9U A;  3O4Q A;  4AHC A;  4FK0 A;  3SYZ A;  4OJR A;  1NKB A;  1F21 A;  1HPZ A;  1RT4 A;  1NJY A;  4EZ6 A;  4FJN A;  5CZ1 A;  3PV8 A;  1HQU A;  3ZSO A;  4AHV A;  4DQI A;  3NGZ A;  3NH1 A;  4RW8 A;  1RT3 A;  2D0A A;  2IOC A;  4QOZ B;  4J2E A;  1NJZ A;  3MXI A;  4ELV A;  1U45 A;  1BCO A;  1RNH A;  4QAG A;  1KLM A;  1VSE A;  2HNZ A;  4DQQ A;  3G0Z A;  3PX0 A;  3HYF A;  2YHB A;  3MXM A;  3OYA A;  1KCF A;  1RT6 A;  2ATQ A;  3DOL A;  4DLG A;  3RMB A;  4CFD A;  5T7B A;  3KK3 A;  3V1O A;  4FM1 A;  4CEO A;  2HHW A;  3I0S A;  1C0T A;  1LWF A;  2G8V A;  1JLB A;  1XHX A;  3AA5 X;  4EP4 A;  4ZHR A;  3SCX A;  4O44 A;  3ZSY A;  4DTJ A;  3ZT2 A;  1VSM A;  1ASV A;  1TK5 A;  4CCH A;  3VQ8 A;  5FRO A;  3AA4 A;  3SUO A;  4B9N A;  3CFR A;  4DTO A;  4FJ8 A;  3HK2 A;  3TAR A;  3T1A A;  1HNI A;  3G10 A;  2OA8 A;  4E1M A;  2YNF A;  2HVI A;  4FLW A;  1ZBH A;  3AA2 A;  1XWL A;  3IS9 A;  4FLV A;  4RW4 A;  1QS4 A;  1RBR A;  1WNS A;  4M3R A;  3K5M A;  4FLX A;  1LAW A;  5J2M A;  3PX4 A;  4YNQ A;  1IKY A;  3S3N A;  4C8K A;  1NK9 A;  3HPH A;  3HPO A;  5HRP A;  1RTH A;  2XY6 A;  4AHT A;  4CEA A;  2RN2 A;  5D3G A;  4CEC A;  3VN5 A;  2KQ2 A;  2E6L A;  3HVT A;  3RMA A;  3SJJ A;  4FJJ A;  4W5Q A;  3L8B A;  2G8F A;  3K5N A;  1A5X A;  4G1Q A;  3DLH A;  1VSJ A;  2D0C A;  3LPU A;  4Z4H A;  4DSL A;  4KTQ A;  2ZD1 A;  1EET A;  4FK2 A;  4OLB A;  3CQ8 A;  1LWC A;  4W5T A;  3M8S A;  4JRP A;  3KLF A;  3AVM A;  3C95 A;  2X74 A;  4CJ5 A;  1U48 A;  4EZ9 A;  4NCA A;  3NF8 A;  2PYJ A;  3VQD A;  5FRN A;  2OPP A;  4L8R B;  4KHU A;  4FJ9 A;  1HMV A;  4B9M A;  3ASM A;  1K6Y A;  4CJU A;  4IFV A;  4CJR A;  4FCY A;  4M42 A;  3NHG A;  1N6Q A;  1KFS A;  4J2A A; 
#chains in the Genus database with same CATH topology
 2CGL A;  1FKO A;  3SQ4 A;  3DOK A;  3VA3 A;  1RDC A;  4CD1 A;  2E1Z A;  4CGD A;  3THY B;  3BP8 A;  5DM7 L;  3LDS A;  4CZF A;  5CYM A;  1JLA A;  2VG7 A;  5C25 A;  3SV3 A;  3TAN A;  2YHY A;  3FE1 A;  4A57 A;  2YI1 A;  2HMP A;  3O3F A;  4YY3 K;  4CZJ A;  2OZS A;  3JS6 A;  3LAK A;  5F0X A;  3ZLJ A;  5EX5 A;  3AVK A;  2HHT A;  1NGC A;  1T44 A;  1VQP N;  1TUY A;  1ILY A;  4KO0 A;  4E0D A;  2A41 A;  3ATV A;  4MQ3 A;  3TAE A;  3CC2 N;  1NOY A;  1NGA A;  2P9K B;  2V51 B;  4DV2 K;  4FWS A;  4BAC A;  1BO5 O;  1NOZ A;  3FFK B;  1U49 A;  1BQM A;  3G6E N;  3CQY A;  1TKT A;  1NGH A;  3ZSR A;  1RGI A;  4HVJ A;  3PSI A;  3LAM A;  2F9W A;  2GEL A;  1R59 O;  4GW6 A;  2E8A A;  2NRH A;  3TAQ A;  4CER A;  2FSJ A;  2D1K A;  4AHU A;  1D8Y A;  2RKI A;  2HVH A;  1GLC G;  1HLU A;  4CJF A;  3I56 N;  1D9F A;  3THY A;  1QHT A;  3CJ1 A;  5J2Q A;  3A5N C;  3A8Y A;  2ZJR L;  2NRT A;  3E9O A;  4QS8 A;  1X9M A;  4KV8 A;  4HWI A;  4M3Z A;  3O3H A;  2E6M A;  3QIN A;  3C6U A;  1J54 A;  1NK5 A;  3HO1 A;  4M45 A;  4H5N A;  4BR7 A;  3VF6 A;  3SUQ A;  5HRR A;  1VQO N;  1BUP A;  1P90 A;  3AVA A;  5MLC Q;  3QER A;  4RW9 A;  1KXP A;  4DR7 K;  3EKS A;  4KHP K;  4OPK A;  4DV1 K;  1CLQ A;  3AO3 A;  1ESV A;  1BQN A;  4BE0 A;  3C6T A;  3LP3 A;  4K43 A;  4H5R A;  2P9K A;  4HUF A;  4IXC A;  3LDO A;  3QBX A;  5I9E B;  1NGB A;  3V9W A;  5JS2 A;  2P9I B;  2YNG A;  4JI0 K;  4FJK A;  3HJF A;  4H0T B;  5JMV A;  3MN9 A;  3OYF A;  4DSF A;  2B6A A;  2G8I A;  2HHS A;  2F7T A;  4K8Z A;  2NRV A;  4LSN A;  3WUH A;  1E4G T;  1FKP A;  2HND A;  3DLB A;  3IUC A;  1L3S A;  4K0K K;  4CES A;  3NBP A;  1VQK N;  5CZ2 A;  4I2Q A;  4BRM A;  2ZJP L;  1Y97 A;  5DM6 L;  2KW4 A;  2V7Y A;  1CZA N;  3U3Y A;  4FLT A;  1S1T A;  1U4B A;  3JYT A;  4AIL C;  5E84 A;  4B08 A;  1QVF M;  3CPE A;  4EP5 A;  4DR1 K;  4E19 A;  2A42 A;  1Q82 O;  1GOB A;  3KJV A;  1VQ8 N;  4IOC L;  3F73 A;  3BY5 A;  4K25 A;  4CJ7 A;  5GIO A;  4JK7 A;  3J7Y P;  4BRE A;  2WON A;  4LD0 A;  5AQL A;  5BRE A;  1UA0 A;  3CCQ N;  5C42 A;  4BR0 A;  3OYL A;  1I39 A;  4CJ4 A;  4I7F A;  1LV5 A;  2LSN A;  2OTL N;  4B9T A;  5A2Q O;  1GOC A;  2OCE A;  3CF5 L;  1BOT O;  3V81 A;  4M41 A;  3J7Z O;  1FW6 A;  2P9I A;  1HJR A;  3OHR A;  3IG1 A;  1ZYQ A;  1NK6 A;  3VQ6 A;  1J53 A;  1YVU A;  4IG3 A;  4JK8 A;  3DRS A;  2B5J A;  1S22 A;  4EFH A;  2OYQ A;  1BCM A;  3ENB A;  2QWM A;  4OKK A;  1NK0 A;  1KD1 O;  3O9U A;  5EXW A;  1CZB A;  2WBN A;  3ZSV A;  1BHL A;  1Y64 A;  2WOM A;  1QSS A;  3S9H A;  5M1Q A;  4OGC A;  4FVM A;  1KFD A;  4DTU A;  4GY2 B;  2QWP A;  4R5P A;  3T1Y K;  4CEQ A;  5I42 A;  2FBV A;  3NH2 A;  5BR9 A;  1X1P A;  2BTF A;  4DTP A;  2D0B A;  3VEY A;  3OYC A;  4LF9 K;  3WNG A;  4H03 B;  1NGI A;  2NNW A;  3O3G A;  3T1H K;  3O6W A;  4YOY A;  4I9Q A;  3LPT A;  3SBT A;  4YOX A;  1K73 O;  4KHS A;  4N5S A;  3LWL A;  3RWU A;  4GV9 A;  4GNI A;  4CIG A;  3MED A;  4CHZ A;  1QHA A;  4JNE A;  2X6N A;  2IIR A;  3U9Z A;  3FGU A;  3IMX A;  4FJ5 A;  3HTV A;  4H5V A;  4H0V B;  4BC2 A;  1RBU A;  4FO0 A;  2Z1H A;  2VCP A;  4PL7 A;  2Z1G A;  3UB5 A;  4LF7 K;  2Z1J A;  4J2D A;  5J2P A;  1LW0 A;  3SI6 A;  2IC3 A;  3NH0 A;  3RTV A;  1VSD A;  4F9O A;  4GVE A;  4CGJ A;  4DU1 A;  2KLA A;  3K5O A;  4CGG A;  4FJX A;  3R9P A;  3HI0 A;  3QIO A;  3J80 O;  4YOR A;  4E7L A;  2YCH A;  3CJA A;  1I94 K;  2W41 A;  2UXD K;  3CQX A;  4DB3 A;  3RMD A;  1C0U A;  4JI6 K;  3L4I A;  4CF2 A;  2XO7 A;  4KH5 A;  5AQV A;  3PX6 A;  5CYQ A;  1M1K O;  4H0O A;  3ULE B;  3LDQ A;  3ID8 A;  2DFE A;  4DTS A;  3U3G A;  1KLN A;  4NO7 A;  2Y1J A;  3MDQ A;  2YNH A;  3L3U A;  3Q7B A;  2G8H A;  3O1W A;  2QW9 A;  4CGH A;  4MLH A;  4CK2 A;  5AQI A;  2A1S A;  3HM8 A;  4FJH A;  1ATN A;  2XHB A;  2VG5 A;  1IKV A;  3M1F A;  4DHY A;  4F3O A;  3SLC A;  1T6D A;  3GE1 A;  1KAZ A;  1C1B A;  3O5B A;  4ISF A;  4B1Z A;  1S1U A;  3L2U A;  4DS4 A;  1TKX A;  4DR6 K;  4FWN A;  4DQP A;  3ZX3 A;  3SMP A;  4PKI A;  3V6D A;  4BR4 A;  4U7B A;  3FLC O;  1WLJ A;  1L3U A;  1KVA A;  2E2O A;  1C0G A;  4DV4 K;  5BPL A;  3OS2 A;  4PQU A;  3NCI A;  3EO3 A;  3TSU A;  1DEJ A;  5LMU K;  3CJ9 A;  4DR2 K;  4MDB A;  3MWT A;  3VEZ A;  1BWF O;  5F1X A;  1RT4 A;  3A5M C;  4EZ6 A;  3F9M A;  5CZ1 A;  3PV8 A;  4BRP A;  3ZSO A;  4AHV A;  4BGB A;  3IKM A;  3NGZ A;  2D0A A;  1NJZ A;  1RNH A;  4QAG A;  5AQT A;  5GAG P;  1K8A O;  4QS7 A;  3PX0 A;  1RT6 A;  4JKH A;  3ULE A;  4CFD A;  5T7B A;  4BQZ A;  4IO8 A;  2G8V A;  1VSM A;  3H3O B;  1ASV A;  5FPN A;  3HK2 A;  3Q7C A;  5AZI B;  2O8F B;  2GEM A;  3TAR A;  3G10 A;  1GLA G;  4FLW A;  3F2K A;  2FF3 B;  3AA2 A;  3IS9 A;  1RBR A;  4FLX A;  3S3N A;  5J2M A;  3PX4 A;  2D0O A;  1BG3 A;  3HPO A;  4JD2 A;  1RTH A;  4AHT A;  2RN2 A;  5D3G A;  4CEC A;  2WUS A;  1X3M A;  4W5Q A;  3WQU A;  1NGJ A;  3LPU A;  2D0C A;  4Z4H A;  4KTQ A;  1Z6R A;  4FK2 A;  5JVH L;  4NLB A;  3WXK A;  2O8C A;  4W5T A;  3AVM A;  1U48 A;  3VQD A;  2OPP A;  4KHU A;  5ELZ A;  3MCP A;  3SBG A;  4YOW A;  2QEX N;  4HTL A;  4CJR A;  1N33 K;  4M42 A;  3NHG A;  3KLG A;  4X62 K;  2YKM A;  3M6G A;  2CGK A;  4IZ9 A;  4JI3 K;  4FM0 A;  2NRR A;  3AO5 A;  1DTT A;  4FLZ A;  5KPZ A;  3KLI A;  4CBW A;  3DRR A;  3V1Q A;  4MO4 A;  2OPS A;  3M8R A;  3NVM A;  1S5J A;  2BAN A;  3P5J A;  4MFB A;  1RDA A;  4IJA A;  4FW1 A;  2ZF5 O;  3U6F A;  5KRS A;  5AQM A;  2QKK A;  2A1R A;  5AQR A;  5HLF A;  4M3W A;  3SAG A;  4FWP A;  1QQO A;  1BIU A;  2IS3 A;  5GIP A;  3HT3 A;  3OYG A;  5GAH P;  3PIP L;  5AZI A;  2O8F A;  3NE6 A;  3ZSW A;  4NYN A;  5KPT A;  1XQS C;  1IBL K;  4OGE A;  3U9D A;  2Q2R A;  4AH9 A;  4BG8 A;  3VQE A;  5HL7 L;  4IJN A;  1JLC A;  1C1C A;  4YOT A;  4CIE A;  2D0P A;  4KTZ A;  3RRH A;  4NCB A;  4W5R A;  4CEE A;  3TPQ A;  5KTQ A;  3SUN A;  4E7K A;  3ULD A;  4DU4 A;  4CI6 A;  5HOO A;  5FPM A;  3CCU N;  3CCV N;  3CCE N;  4DR4 K;  1NJW A;  3O80 A;  4CIF A;  5AQO A;  4DSK A;  2R7Y A;  2QXF A;  1XUP O;  4OKE A;  1JL1 A;  4KHQ A;  3ZYY X;  1Q9X A;  4WFB L;  4E7J A;  5AQX A;  5BPN A;  3I8D A;  1H1V A;  1WAJ A;  1FXX A;  4FYD A;  3CPW M;  2KKZ A;  2D5R A;  4HUG A;  1JJ2 M;  3DXK A;  3E66 A;  4B3R K;  2VG6 A;  3C7N B;  3MK6 A;  3VQ7 A;  3ZSX A;  1Q8I A;  4RW7 A;  3E9P A;  3AO1 A;  4IKF A;  2Q3S A;  4I6M B;  4FXD A;  1NU0 A;  1N32 K;  2GTD A;  4NXM K;  1S9E A;  2IGI A;  1WSG A;  4FWO A;  1KQS M;  2XY8 A;  3OBW A;  4KB0 A;  3HP9 A;  4KPY A;  3TAP A;  4DTX A;  2G8W A;  4KKO A;  2YHW A;  4JKA A;  3KWI A;  4IFY A;  4IO9 L;  5FDL A;  3AVH A;  4E3S A;  3CCM N;  5CE3 A;  2F96 A;  3AO4 A;  4ELT A;  1ZBI A;  4O5F A;  4CJL A;  4M3U A;  3WXM B;  3KLE A;  4EHT A;  4M63 C;  5M1O A;  3J8A A;  4JK9 A;  2WFB A;  1YIJ N;  2X78 A;  4JI1 K;  4A59 A;  2BDP A;  5H1S Q;  2P9U B;  1XNQ K;  3P38 A;  2CH6 A;  3KK2 A;  4J2B A;  3VEN A;  1ASW A;  3K2P A;  1W7A A;  2F4V K;  3VPZ A;  4Z0U A;  3C7N A;  4C8O A;  4LH4 A;  3HVR A;  3O08 A;  5CY4 A;  1HKG A;  4O5B A;  2VWK A;  3GBT A;  2PZS A;  5AQH A;  3M8Q A;  4B8C A;  1WBD A;  3KTQ A;  5KPR A;  5ADX H;  4KI4 A;  4I6M A;  3ZSQ A;  2QWR A;  2W6K A;  3VEX A;  3VF2 A;  3EZW A;  3SPZ A;  1N36 K;  4OPH A;  4JI7 K;  3K58 A;  4A2A A;  1YI2 N;  4U67 L;  4KH4 A;  2VQE K;  2ITG A;  1C0M A;  4RCH A;  2Q0R A;  3A0I X;  5BR8 K;  4X66 K;  4KBO A;  4BRK A;  4M3Y A;  4CJP A;  2ZGY A;  4RW6 A;  2WC9 A;  3QES A;  3IRX A;  1CXQ A;  1BA0 A;  1K8K B;  1DT9 A;  5FPE A;  3HOS A;  3P83 D;  4DV7 K;  3V9X A;  2GWJ A;  3NAE A;  3RVC A;  4FVU A;  1XMO K;  4G9Z A;  5LJW A;  3MEE A;  2NLX A;  1YIT N;  3CM5 A;  1RT1 A;  4WFA L;  3V1R A;  3LZJ A;  4LF6 K;  2NRZ A;  4WCE L;  1QQM A;  4BRF A;  2P9U A;  1X9S A;  3SK3 A;  3NVK A;  2VYP A;  3LDL A;  3OJS A;  1G99 A;  4R79 A;  4BDY A;  1OVQ A;  3F5T A;  4E89 A;  5LJV A;  4DSJ A;  5IT9 O;  2H3G X;  3SJH A;  2O8B A;  4CBU A;  5HRN A;  3EL2 A;  4IDK A;  4FLY A;  4I9L A;  1T6C A;  4M7Y A;  3C0B A;  1NK7 A;  1TVR A;  3NF9 A;  4CHP A;  3SMS A;  1HQE A;  2E2P A;  2D4W A;  2E2Q A;  1JXB A;  2BE2 A;  4LH5 A;  2QWL A;  3C65 A;  1VSI A;  3OA9 A;  4CZM A;  3HXM A;  5LMN K;  3V4I A;  2HMI A;  3SQ0 A;  2KZM A;  3MN5 A;  1X9W A;  3EN9 A;  3CC4 N;  2Q31 A;  4KFB A;  2DTU A;  3L2Q A;  4ILG B;  3SNN A;  2EX3 A;  3MEG A;  3FZM A;  1K8K A;  4KAZ A;  3QEI A;  2GX9 A;  3I0R A;  3TAF A;  3KWG A;  3QET A;  1ZXO A;  5I3U A;  3B6P A;  1IJJ A;  2GUI A;  4ISG A;  4BRG A;  2O8D B;  5C12 A;  3WNH A;  3H6E A;  3QFU A;  3KIO A;  3R8E A;  5HBM A;  4CJS A;  3THV A;  1YAG A;  3D45 A;  2E2N A;  2GV9 A;  4FJI A;  1IH7 A;  3SUP A;  2PYL A;  2QI2 A;  2JLE A;  4ILJ A;  1EWQ A;  3EYZ A;  3B8A X;  5AFU H;  4CBX A;  5AR0 A;  4KB1 A;  4B9Q A;  1VQ5 N;  3BDP A;  4BRC A;  3G25 A;  1VQL N;  2GWK A;  2ETJ A;  3SPY A;  1S1X A;  3CMA N;  4L3Q A;  3TR8 A;  3HSC A;  3QB0 A;  4E1N A;  1WSH A;  2FBX A;  1VQ4 N;  1XI1 A;  1U2V B;  1LW2 A;  2QWQ A;  2YJF A;  3S3M A;  4BRO A;  2PY5 A;  1L3V A;  1RTD A;  3KVG A;  4BGA A;  4JS5 A;  3O9Q A;  3KK1 A;  3TU5 A;  5C2D A;  4B3T K;  4BE2 A;  4Z4F A;  4CVN E;  4TSX A;  3SQ2 A;  4BC5 A;  3KKR A;  3L0Q A;  4Z4C A;  5GAE P;  4JKB A;  3VQ9 A;  2DFH A;  5AQS A;  5EY4 A;  3WNE A;  3EZ5 A;  4B3O A;  1NWK A;  4DWI A;  4N41 A;  3H3N O;  3ZCM A;  1WUA A;  2O8D A;  1QQN A;  1ZBU A;  4JKC A;  3FR0 A;  5AJ3 K;  4DKW A;  3QEX A;  1BIZ A;  3GDQ A;  4FZX C;  1T05 A;  3O9T A;  3WXI A;  3O4N A;  1BGX T;  3CJB A;  4CFC A;  3OYD A;  3O4Q A;  4AHC A;  4A5A A;  3SYZ A;  4OJR A;  4LF4 K;  3A5O C;  1NJY A;  3DAW A;  4RW8 A;  3CJC A;  1RT3 A;  1ATS A;  4BVP A;  1YUW A;  3U4L A;  2V7Z A;  5KQD A;  2YHB A;  2ATQ A;  3DOL A;  3RMB A;  5AQW A;  4CEO A;  3I0S A;  3M3Z A;  1C0T A;  2V52 B;  1JLB A;  1XHX A;  3SCX A;  4JI5 K;  1U2V A;  1EWR A;  4CCH A;  3SUO A;  3TSP A;  4FJ8 A;  3PIO L;  3KK7 A;  2OA8 A;  5AQK A;  1HX1 A;  1ZBH A;  3K9J A;  1XWL A;  4FLV A;  4M3R A;  1NK9 A;  4FOI A;  4IFE A;  4XEI A;  1HR0 K;  1VQN N;  3D7E O;  1NMD A;  2E6L A;  3HVT A;  3RMA A;  3L8B A;  4NXN K;  1A5X A;  3DLH A;  1VSJ A;  4OLB A;  4DSL A;  1EET A;  3CQ8 A;  1LWC A;  3BZK A;  4JRP A;  4NCA A;  4CJ5 A;  3NF8 A;  2PYJ A;  2A40 A;  4FWR A;  1HMV A;  1K6Y A;  4XH4 A;  3WQT A;  3J7A P;  4FCY A;  1N6Q A;  1QSY A;  2OTJ N;  1WOQ A;  4H0X B;  4Y1D A;  3KD1 E;  3HPG A;  3AAR A;  2QWO A;  3IAY A;  1HJO A;  1EQY A;  5AQF A;  4KHW A;  2HST A;  4C1N K;  1TKZ A;  4WFN L;  1JCE A;  2HOE A;  1N34 K;  4K8X A;  3MXJ A;  3K59 A;  1HNV A;  1NJX A;  1SV5 A;  3AY9 A;  4FK4 A;  3BF3 A;  3MCA B;  3VA0 A;  1YT3 A;  1W97 L;  4DTN A;  4Y1C A;  1JL2 A;  4DFP A;  4E7I A;  4DV6 K;  1EX4 A;  3AA3 A;  1N8R O;  1J5O A;  1K9M O;  3H45 C;  4DFM A;  2P9P B;  3R6M A;  2HHH K;  3ZT1 A;  4ZTJ A;  4JD2 B;  4JKE A;  3OYM A;  1Q7Y O;  4DMN A;  3JXU A;  1W0H A;  3PSF A;  3NF7 A;  2OZM A;  3VQA A;  3P31 A;  4FPA A;  4CED A;  4DQS A;  4CJ3 A;  3QDK A;  1FJG K;  2YHX A;  1UA1 A;  4Z4G A;  3FZL A;  1KVC A;  1HKC A;  2JWK A;  2VGN A;  2W40 A;  4DG1 A;  4BY9 C;  3P1G A;  2O8C B;  2QTD A;  2NRX A;  3K9K A;  4KH6 A;  4BRL A;  2Q97 A;  3VEV A;  3CI5 A;  4CK3 A;  1RDW X;  4DF4 A;  1A5V A;  3VQ5 A;  3W0L A;  5AQQ A;  1HYS A;  5E26 A;  2AA4 A;  2JWL A;  4DUZ K;  1L3T A;  1HYZ A;  2ZWH A;  3KKS A;  3B6O A;  4H4M A;  3ZEU A;  1TK0 A;  4CEF A;  4N47 A;  1A5W A;  3W3D A;  3AGK A;  5DMR A;  1SKS A;  4UY8 O;  3O8M A;  3P4I A;  4CFA A;  3CFO A;  3DLE A;  4FL9 A;  3VOV A;  4HCC A;  3AVI A;  5BPM A;  4B1V A;  4YOV A;  1BDG A;  1VSH A;  1IBM K;  3CCS N;  4FM2 A;  4KI6 A;  5ADX A;  4K41 A;  1TV6 A;  2KHO A;  1SAZ A;  3UIQ A;  4EHU A;  3LM9 A;  3DRP A;  4Z4I A;  1VSL A;  1WSI A;  2UYT A;  4LSL A;  3M8P A;  2B4J A;  3DLL L;  4BWM A;  3HZ6 A;  3R1X A;  4JI8 K;  3FFI A;  3TAG A;  2P9P A;  4BRH A;  4MO5 A;  4O0I A;  3AVG A;  1GLL O;  3H1Q A;  3ITH A;  4O8K A;  1XC3 A;  4RG8 A;  4CW7 B;  4JYA K;  2ZM6 K;  5FPD A;  2A6A A;  4DQR A;  1OH6 A;  3D0P A;  1RCH A;  1MWK A;  3ISN C;  4PKH A;  3T7Z A;  3ZSZ A;  4FPB A;  4YHH K;  4PKG A;  5TKW A;  4B3M K;  5TKY A;  1RBT A;  4A61 A;  4B3S K;  4DR3 K;  1OH8 A;  1D9D A;  3AVB A;  1LOT B;  3S3O A;  1SL2 A;  3D2E A;  4F2S A;  4JAX A;  5KQ8 A;  4JLH A;  2IVP A;  4CFB A;  4DFJ A;  1M90 O;  3VMF B;  1JLE A;  3T3F A;  3MN7 A;  4ZTF A;  2IVO A;  1BL3 A;  1ZBL A;  3CD6 N;  3I55 N;  4LF8 K;  3DLG A;  3DLK A;  1UAX A;  1QZ6 A;  3ENH A;  4BWJ A;  3DXK B;  2UU9 K;  2IDO A;  2YX6 A;  3AVF A;  1NM1 A;  4B1Y B;  4E7H A;  4IOA L;  1U6Z A;  2VWB A;  3TAB A;  3T19 A;  5SZT A;  4DF8 A;  4CZL A;  4GVM A;  4CHQ A;  3R3L A;  4CGI A;  1WSF A;  4IWV A;  5BN9 A;  4CK1 A;  3OYK A;  1ZC6 A;  4JRQ A;  1IG9 A;  1NG9 A;  1TK8 A;  3EE9 A;  3MMV A;  1T7P A;  2J4R A;  1X3N A;  3HRG A;  4DUY K;  4WQ5 C;  1WB9 A;  2YHA A;  1YJN N;  4B9V A;  1KAY A;  1REV A;  2HF3 A;  5C24 A;  3SQ1 A;  1UOC A;  1G15 A;  1QVG M;  2NUB A;  4Z4E A;  1EP4 A;  2YNI A;  5AZJ B;  1SUQ A;  3EY1 A;  2P5O A;  4NCG A;  3EE8 A;  3VTH A;  1RIL A;  1CZ9 A;  2Y1I A;  1T3V A;  1HPM A;  3OJU A;  3U8X A;  3CIP A;  2UXC K;  4F8R A;  1RT2 A;  2F8S A;  4K42 A;  4IDH A;  4E1J A;  1TL3 A;  3ZET B;  1IG8 A;  3ZX2 A;  4JKD A;  5EOY A;  1LAV A;  4GKK K;  1B9F A;  3AO2 A;  4DCH A;  5AFU A;  1FK9 A;  3NMU A;  2HHX A;  1ASU A;  4ICL A;  1J9A A;  3LP2 A;  3N4P A;  3QNN A;  4JEP A;  4BRI A;  3RR7 A;  3THX A;  2VGM A;  1TUU A;  1SL0 A;  3TTF A;  1NGG A;  3C94 A;  4IEI A;  3WEE B;  1D5A A;  4PL8 A;  4X65 K;  3HP6 A;  1Q9Y A;  4GMJ B;  1S1W A;  1DTQ A;  1DLO A;  4WQ5 A;  4DV5 K;  4DTM A;  3ZT4 A;  4HTU A;  3CER A;  1NJI O;  4CHY A;  4ID1 A;  3DMJ A;  2BUP A;  3VET A;  1NGF A;  2BH1 A;  3CJ7 A;  1XMQ K;  1V4T A;  3H08 A;  1VK0 A;  2FSN A;  1HKB A;  1SKR A;  4IEE A;  3PY8 A;  5KI6 A;  3K5L A;  1RTJ A;  1Z05 A;  1GLB G;  5AZJ A;  1NKC A;  3JSM A;  1RDU A;  2O4G A;  3MAQ A;  1S1V A;  1TYQ A;  1W9H A;  4FOE A;  3ZX0 A;  4CF9 A;  3L6Q A;  3CCJ N;  1XNR K;  5JLH A;  3OYE A;  4NYF A;  4CZG A;  5M1K A;  1DKG D;  4CHO A;  3ZET A;  2OPR A;  4O4G A;  5KRT A;  3QFP A;  1CXU A;  4N76 A;  3L4Q A;  4DR5 K;  4M3X A;  1RT5 A;  3HM9 A;  5FLX O;  2P9S B;  1WAF A;  3L2W A;  3BZC A;  3DWL A;  3QEP A;  1O13 A;  5HP1 A;  2HHV A;  4Q5V A;  3P39 A;  2KFN A;  4JN4 A;  2O8B B;  1LCU A;  4AHS A;  4FZY A;  2E20 A;  2OPQ A;  4FJG A;  3O4W A;  2E5L K;  1S6Q A;  3C6H A;  1WSJ A;  3NF6 A;  4JKG B;  4JI4 K;  2PBD A;  1TGO A;  3WEE A;  2QK9 A;  4YOU A;  3LP1 A;  1B9D A;  1ATR A;  3SZ2 A;  3OVN A;  4BG9 A;  1VRU A;  5AQN A;  4DSI A;  4H5T A;  2AJQ A;  4NLC A;  1S6P A;  5EU7 A;  3KLH A;  1E3M A;  3CM6 A;  5BRF A;  1RFQ A;  4OLA A;  2ZGZ A;  3IDH A;  5JLF A;  1IKX A;  1KTQ A;  5J1E A;  4C8N A;  3OYJ A;  1SS6 A;  4CF1 A;  4BE1 A;  2FXU A;  1Z26 A;  4DV3 K;  4DTR A;  5M1F A;  3DJC A;  5B8H A;  2EWS A;  5JS1 A;  2Z1I A;  3OS1 A;  3PLA A;  1KSP A;  3LWM A;  1NMN A;  1MDU B;  3WXL A;  4CJQ A;  3GOI A;  1U47 A;  3I8B A;  4B1X B;  3BUZ B;  3VGK A;  1NGE A;  4IG0 A;  5AQY A;  1EKE A;  5K14 A;  3AVL A;  1VHX A;  5CR4 A;  2P9S A;  4B9U A;  3VQB A;  3HBT A;  3QEV A;  2FLO A;  1YJW N;  1NKB A;  4H0Y B;  1HPZ A;  4FJN A;  1SQK A;  3UKU B;  3AGR A;  2QWN A;  3NH1 A;  4J2E A;  4ELV A;  1BCO A;  1KLM A;  1VSE A;  4JKG A;  3G0Z A;  3HYF A;  4H0P A;  1KCF A;  3OYA A;  3KK3 A;  3V1O A;  4FM1 A;  1LWF A;  4C23 A;  3AA5 X;  4EP4 A;  4ZHR A;  3ZSY A;  3N4Q A;  3VQ8 A;  5FRO A;  3CFR A;  3A5L C;  5LY3 A;  2CH5 A;  4E1M A;  3MN6 A;  1EO1 A;  3GL1 A;  1C0F A;  4B1W B;  4RW4 A;  1QS4 A;  3K5M A;  1WNS A;  4M3T A;  2HHU A;  1LAW A;  4YNQ A;  1IKY A;  1YF5 L;  3MX2 A;  4H5W A;  3HPH A;  4C8K A;  4PHT X;  3E1Y A;  5C0Y A;  4NB4 A;  3QML A;  3SJJ A;  1BU6 O;  2G8F A;  1HNZ K;  4G1Q A;  3CCR N;  4BR9 A;  3M8S A;  3KLF A;  2X74 A;  4EZ9 A;  5GAD P;  4FJ9 A;  3ASM A;  1YJ9 N;  4BRQ A;  3K0S A;  1YVN A;  4JKF A;  4OX9 K;  3H46 O;  3QIP A;  5AQZ A;  5BRH A;  4H8K A;  4O55 A;  2P9L B;  2RPI A;  5IWA K;  3UKU A;  3D2F B;  3NGI A;  1XHZ A;  3OYI A;  2HBL A;  3QBW A;  5M1N A;  1JLQ A;  4CJE A;  3CME N;  3AAP A;  4KHN A;  2ASP A;  3ENO A;  2XY7 A;  3VEO A;  3VQC A;  1L5U A;  4KRF A;  3KHY A;  2HF4 A;  1NKE A;  2QXL A;  3LAN A;  4O8U A;  2HW3 A;  2DPN A;  2ASO A;  5AQP A;  1GOA A;  2RF2 A;  3EKU A;  3SAF A;  1J5E K;  1QE1 A;  4B8A B;  2ASM A;  3HL8 A;  4DQ8 A;  3SV4 A;  1T8E A;  3LAL A;  2O8E B;  4XH1 A;  3BEX A;  3AV9 A;  3MEC A;  1UWB A;  1WSE A;  2YKN A;  4CHN A;  4OO1 J;  4CZI A;  2UUB K;  4RTF D;  2GUP A;  2HBM A;  3HOT A;  3HST B;  4XIU A;  4C8M A;  3TSQ A;  2NRW A;  2Q1N A;  3VQQ A;  4JS4 A;  1VSK A;  3AVJ A;  4PY5 A;  4M7X A;  2QA4 N;  2VWJ A;  2O4I A;  1JLG A;  5E41 A;  3DXM B;  1OH7 A;  1HNW K;  1N5Y A;  4AM7 A;  1TAQ A;  2ITM A;  4OVL A;  2P9L A;  4XH5 A;  4QCL A;  2VQF K;  1RDB A;  3D2F A;  1IO2 A;  3RMC A;  4N56 A;  2ZE2 A;  3VQP A;  5C10 A;  4OKJ A;  4Q0B A;  4B9S A;  4AF1 A;  4KHY A;  1HYV A;  1JKH A;  4EAH D;  2EHG A;  4H4O A;  2HB5 A;  2X6S A;  2DY4 A;  4ID5 A;  3DM2 A;  5J2N A;  3OTO K;  4CE9 A;  1S72 N;  1VAZ A;  1YXQ A;  2O8E A;  1BI4 B;  3I33 A;  1C1A A;  5AQG A;  2F9T A;  3KD5 E;  3G4S N;  4W5O A;  3VER A;  1R0A A;  2G8U A;  3K57 A;  1BIS A;  4ELU A;  3THW B;  3ID6 A;  2Q36 A;  4YFU A;  2A3Z A;  1IKW A;  3SAH A;  4CZH A;  3GG4 A;  1XC9 A;  3AVC A;  1YTU A;  4W5N A;  1JXE A;  4LFB K;  1OH5 A;  1D4X A;  4CJK A;  4C8L A;  4BDZ A;  2YV0 X;  1S9G A;  4F3T A;  3L3V A;  3QLH A;  3ZEU B;  3FZK A;  1OVY A;  3DXM A;  4LY7 A;  4CZK A;  4FJ7 A;  4HCB A;  3PUF A;  5DK5 A;  2HBJ A;  5KGW A;  4DFK A;  3WT0 A;  4IOX A;  1J6Z A;  5LL6 Z;  1O1W A;  4FLU A;  4CD3 A;  2RE2 A;  1U04 A;  1IBK K;  5JVG L;  3D6R A;  1Z25 A;  2XY5 A;  2DFF A;  3CYM A;  4BDP A;  1TAU A;  4JI2 K;  1WBB A;  3ALY A;  1KRP A;  3CC7 N;  3TTC A;  4A2B A;  1NLV A;  3OYB A;  4FWL A;  3S41 A;  2QM1 A;  4AM6 A;  4CJT A;  1NGD A;  4DS5 A;  2PAV A;  1Q86 O;  3CCL N;  1X9J A;  2FC0 A;  1EXQ A;  1RBS A;  2HHQ A;  2UUC K;  3QEW A;  1BI4 A;  3V9U A;  3LDN A;  3ZT0 A;  2ZJQ L;  3ZT3 A;  4DV0 K;  2BGG A;  3E9L A;  2E4L A;  4FWQ A;  3OYH A;  1QZ5 A;  3JAM O;  1MWM A;  2I7N A;  4FW2 A;  3V9Z A;  3LDP A;  3THW A;  2I7P A;  4BQL A;  3CFP A;  4DSE A;  4J8F A;  2KZZ A;  4BC3 A;  4IBN A;  4YDU C;  1HUX A;  2PFU A;  1VSF A;  4WF9 L;  1W2B M;  5FRM A;  2KFZ A;  4A62 A;  1LWE A;  3D2E B;  3OW2 M;  2FSK A;  4Y0W A;  4I2P A;  3G71 N;  3IFR A;  4PWD A;  1VQ6 N;  2W42 A;  4FJM A;  4AQY K;  4JHD B;  3TI0 A;  4MLE A;  1RBV A;  1V4S A;  4FZZ A;  3OS0 A;  3PO5 A;  4C1N I;  1JCF A;  3DLR A;  1QQC A;  5HRS A;  2AP1 A;  4KRE A;  3LP0 A;  4CEZ A;  4CGF A;  3UKR B;  3KZB A;  2CGJ A;  1QSL A;  3OY9 A;  3BGR A;  3CXC M;  3QIC A;  3TAM A;  3NDK A;  3F9K A;  1SL1 A;  4B9L A;  3V9S A;  1YHQ N;  1KVB A;  3TWH A;  1WN7 A;  2IAJ A;  3DI6 A;  3QO9 A;  1Q18 A;  4LFA K;  1ZBF A;  5AQJ A;  3WNF A;  4YDU A;  2ZQB A;  3VGM A;  3L2R A;  5C15 A;  4X64 K;  1MA9 B;  1TKD A;  3L2V A;  1SKW A;  2HNY A;  2UUA K;  1NK8 A;  2F8T A;  1VQ9 N;  3NGY A;  1VQM N;  4GV3 A;  2KTQ A;  1NBW A;  3CET A;  1JLF A;  1MU2 A;  4CJW A;  2NZT A;  5CHI A;  1NNE A;  1ZBS A;  3T69 A;  4B1U B;  3O9R A;  3MWP A;  4JHD A;  4DLE A;  2P9N B;  3CG7 A;  3AAQ A;  3EEQ A;  4MDA A;  4CF0 A;  1I3A A;  3DYA A;  2XRI A;  5HRO A;  4FWK A;  1S3X A;  5SWM A;  5BRD A;  5GIN A;  4OPJ A;  1RDD A;  1RT7 A;  4WE1 A;  3LL3 A;  2QKB A;  3CHW A;  3LZI A;  3THX B;  1QTM A;  3O1B A;  1VRT A;  3QNO A;  3UKR A;  3NFA A;  5F2R A;  3VES A;  3FZF A;  4PUO A;  2UXB K;  5BN8 A;  1ITG A;  2IVN A;  4WQ4 C;  3VQ4 A;  4EIA A;  1YTA A;  2FBY A;  1GLF O;  2P5G A;  4HHT A;  1T03 A;  1B92 A;  3E01 A;  2Q0U A;  2FBT A;  3A2F A;  4KTW A;  2P1J A;  4GKJ K;  1P8Z A;  3O9S A;  1TL1 A;  4F4K A;  2E88 A;  3RSE B;  1DGK N;  4F2R A;  2FF6 A;  1VQ7 N;  1SZ2 A;  1GLE G;  3OYN A;  2G8K A;  1JCG A;  5KGX A;  1HRH A;  3VGL A;  2YJE A;  3BF1 A;  1C6V A;  3RRG A;  4UQG A;  4CJV A;  4CF8 A;  3PO4 A;  1TYQ B;  3AVN A;  4CEB A;  1RTI A;  3ATU A;  4AHR A;  4PA1 A;  1NK4 A;  3RR8 A;  2I5J A;  2JGU A;  2WTU A;  2GBZ A;  4DU3 A;  2P9N A;  4BR5 A;  4FWM A;  3M5R A;  3VTI A;  2P51 A;  3VEW A;  3TTD A;  4FJL A;  4HUE A;  4O0J A;  4LFC K;  4FK0 A;  4GV6 A;  1F21 A;  4BR2 A;  1BA1 A;  4BRD A;  1HQU A;  4WYB A;  5JIC A;  4DQI A;  1GLJ O;  4LC9 B;  1KAX A;  4Z94 A;  3MX5 A;  3LM2 A;  4V19 S;  2IOC A;  3C6A A;  4QOZ B;  4WQ4 A;  3MXI A;  1U45 A;  2A5X A;  2HNZ A;  3FZH A;  4DQQ A;  3WXJ A;  3MXM A;  4JV5 K;  4FSV A;  4DLG A;  2HHW A;  2RHK A;  4O44 A;  4DTJ A;  4ISE A;  3ZT2 A;  5M1P A;  5EVZ A;  1TK5 A;  4BRN A;  4OPA A;  3AA4 A;  2HBK A;  4B9N A;  4DTO A;  3T1A A;  1HNI A;  3RSE A;  4RWT A;  2E1Y A;  3VF4 A;  5AQU A;  2YNF A;  2HVI A;  4BVO A;  2OAN A;  3J81 O;  4CZE A;  5HRP A;  4QS9 A;  5C2F A;  3UE5 A;  4BRA A;  1E4F T;  4CEA A;  2XY6 A;  1IV0 A;  3VN5 A;  2KQ2 A;  4FJJ A;  3K5N A;  1Q81 O;  4A5B A;  2ZD1 A;  4BC4 A;  3H1V X;  1GLD G;  4ILH A;  1KC8 O;  2W6L A;  3C95 A;  1OKJ A;  5FRN A;  3OBY A;  4L8R B;  1HNX K;  4B9M A;  4CJU A;  4IFV A;  4LF5 K;  1KFS A;  4J2A A; 
#chains in the Genus database with same CATH homology
 3QIP A;  3KLG A;  2YKM A;  4Y1D A;  1FKO A;  3KD1 E;  3HPG A;  4H8K A;  3SQ4 A;  4FM0 A;  4O55 A;  3AO5 A;  1DTT A;  3DOK A;  2RPI A;  4FLZ A;  3IAY A;  3KLI A;  3NGI A;  3VA3 A;  1XHZ A;  4KHW A;  3OYI A;  3DRR A;  3V1Q A;  1RDC A;  2OPS A;  1TKZ A;  4CGD A;  3M8R A;  1JLQ A;  4CJE A;  1S5J A;  2BAN A;  3P5J A;  4MFB A;  3LDS A;  1RDA A;  3MXJ A;  5CYM A;  3K59 A;  4K8X A;  1JLA A;  1HNV A;  2VG7 A;  4FW1 A;  5C25 A;  3U6F A;  2XY7 A;  5KRS A;  1SV5 A;  3SV3 A;  1NJX A;  3VQC A;  1L5U A;  4KRF A;  4FK4 A;  3TAN A;  3VA0 A;  2QKK A;  1NKE A;  1YT3 A;  2A1R A;  3LAN A;  2HW3 A;  5HLF A;  4M3W A;  4DTN A;  4Y1C A;  1GOA A;  2RF2 A;  1BIU A;  1JL2 A;  2IS3 A;  3HT3 A;  3OYG A;  4E7I A;  4DFP A;  3O3F A;  2OZS A;  1QE1 A;  4B8A B;  3HL8 A;  3LAK A;  3SV4 A;  1T8E A;  1EX4 A;  3NE6 A;  3ZSW A;  4NYN A;  3AA3 A;  1J5O A;  3LAL A;  3AVK A;  4OGE A;  4DFM A;  2HHT A;  4AH9 A;  4KO0 A;  4E0D A;  3VQE A;  3ZT1 A;  4ZTJ A;  4MQ3 A;  3AV9 A;  3OYM A;  3TAE A;  1NOY A;  3MEC A;  4DMN A;  1JLC A;  1UWB A;  1WSE A;  1C1C A;  1W0H A;  2OZM A;  2YKN A;  3NF7 A;  4CIE A;  4CHN A;  4BAC A;  3VQA A;  1NOZ A;  4KTZ A;  4CED A;  4DQS A;  4CJ3 A;  3RRH A;  4W5R A;  1UA1 A;  4NCB A;  4Z4G A;  4CEE A;  1KVC A;  1BQM A;  1U49 A;  4DG1 A;  5KTQ A;  3SUN A;  4E7K A;  3ULD A;  4DU4 A;  3P1G A;  3HST B;  4XIU A;  4C8M A;  1TKT A;  3ZSR A;  3VQQ A;  4JS4 A;  1VSK A;  4HVJ A;  3AVJ A;  4PY5 A;  4CK3 A;  3LAM A;  4DF4 A;  1A5V A;  3VQ5 A;  2VWJ A;  2O4I A;  1NJW A;  1JLG A;  1HYS A;  4GW6 A;  4CIF A;  1L3T A;  1HYZ A;  4DSK A;  3KKS A;  2R7Y A;  2QXF A;  3B6O A;  4H4M A;  5E41 A;  4OKE A;  3TAQ A;  4CER A;  1N5Y A;  4AHU A;  1D8Y A;  1TAQ A;  1TK0 A;  2RKI A;  4OVL A;  1JL1 A;  4CEF A;  4QCL A;  2HVH A;  4N47 A;  4KHQ A;  1RDB A;  4CJF A;  1Q9X A;  1IO2 A;  4E7J A;  1A5W A;  1D9F A;  2HHS A;  3RMC A;  4N56 A;  3I8D A;  2ZE2 A;  1WAJ A;  1QHT A;  1FXX A;  5DMR A;  1SKS A;  4FYD A;  4CFA A;  3CFO A;  3DLE A;  2D5R A;  3VQP A;  5J2Q A;  4HUG A;  4OKJ A;  4HCC A;  3AVI A;  4Q0B A;  4B9S A;  1VSH A;  1X9M A;  4KHY A;  1HYV A;  1JKH A;  4KV8 A;  4M3Z A;  4FM2 A;  3O3H A;  4KI6 A;  2E6M A;  2VG6 A;  1TV6 A;  2EHG A;  3QIN A;  1Q8I A;  2HB5 A;  3C6U A;  1J54 A;  4H4O A;  4RW7 A;  2X6S A;  3VQ7 A;  1NK5 A;  3UIQ A;  2DY4 A;  4ID5 A;  3HO1 A;  3AO1 A;  3DM2 A;  4M45 A;  3DRP A;  5J2N A;  4IKF A;  4Z4I A;  1VSL A;  1WSI A;  2Q3S A;  4LSL A;  4CE9 A;  3M8P A;  2B4J A;  5HRR A;  3SUQ A;  4BWM A;  3AVA A;  3QER A;  4RW9 A;  1BI4 B;  3FFI A;  3TAG A;  4FXD A;  4M3T A;  1C1A A;  4OPK A;  1CLQ A;  3AO3 A;  3KD5 E;  1S9E A;  1BQN A;  4BE0 A;  2IGI A;  1WSG A;  3C6T A;  3LP3 A;  3ZSX A;  4O0I A;  3AVG A;  4W5O A;  4HUF A;  1R0A A;  2XY8 A;  3ITH A;  4KB0 A;  2G8U A;  4RG8 A;  3K57 A;  1BIS A;  4ELU A;  3HP9 A;  4DQR A;  4KPY A;  3TAP A;  4YFU A;  3D0P A;  1RCH A;  3ISN C;  1IKW A;  5JS2 A;  3V9W A;  4DTX A;  2G8W A;  4KHN A;  4KKO A;  3ZSZ A;  2YNG A;  1XC9 A;  3AVC A;  4FJK A;  1YTU A;  1JXE A;  4IFY A;  4W5N A;  1RBT A;  3HJF A;  5FDL A;  3AVH A;  4E3S A;  3OYF A;  4DSF A;  2B6A A;  1D9D A;  4CJK A;  3AVB A;  4C8L A;  2G8I A;  4K8Z A;  2F96 A;  3S3O A;  3AO4 A;  4BDZ A;  1SL2 A;  2YV0 X;  4LSN A;  4F2S A;  1FKP A;  1S9G A;  2HND A;  4JLH A;  3DLB A;  3L3V A;  3QLH A;  4CFB A;  4DFJ A;  4ELT A;  1ZBI A;  4CJL A;  4LY7 A;  4M3U A;  1JLE A;  4FJ7 A;  3T3F A;  3PUF A;  5DK5 A;  3KLE A;  4ZTF A;  5KGW A;  4CES A;  4DFK A;  1L3S A;  4HCB A;  3NBP A;  1BL3 A;  5CZ2 A;  4I2Q A;  4FLU A;  1O1W A;  1ZBL A;  1Y97 A;  1U04 A;  2X78 A;  2KW4 A;  3DLG A;  3DLK A;  2XY5 A;  1UAX A;  1Z25 A;  2DFF A;  3U3Y A;  4FLT A;  3CYM A;  2BDP A;  4BDP A;  1TAU A;  1S1T A;  4BWJ A;  1U4B A;  3KK2 A;  3JYT A;  3ALY A;  1KRP A;  2IDO A;  4AIL C;  4B08 A;  4J2B A;  3AVF A;  1ASW A;  3K2P A;  4EP5 A;  3OYB A;  4E7H A;  4E19 A;  4CJT A;  4Z0U A;  3TAB A;  4DS5 A;  1GOB A;  3T19 A;  4LH4 A;  5SZT A;  3KJV A;  4DF8 A;  4C8O A;  3HVR A;  3F73 A;  4GVM A;  5CY4 A;  4CHQ A;  4CGI A;  1WSF A;  4O5B A;  2VWK A;  4CK1 A;  3OYK A;  2PZS A;  2WON A;  2FC0 A;  1EXQ A;  4JRQ A;  1RBS A;  3M8Q A;  4LD0 A;  4B8C A;  2HHQ A;  1IG9 A;  1UA0 A;  3QEW A;  3KTQ A;  1BI4 A;  3V9U A;  4KI4 A;  3ZT0 A;  5C42 A;  3ZSQ A;  3OYL A;  1I39 A;  4CJ4 A;  4I7F A;  1TK8 A;  3SPZ A;  3ZT3 A;  1LV5 A;  2BGG A;  2E4L A;  1T7P A;  2LSN A;  4B9T A;  3OYH A;  1GOC A;  3K58 A;  4FW2 A;  3V81 A;  4M41 A;  2YHA A;  3V9Z A;  4F3T A;  4B9V A;  1REV A;  3CFP A;  4DSE A;  2ITG A;  1C0M A;  1HJR A;  5C24 A;  3IG1 A;  1ZYQ A;  2KZZ A;  3SQ1 A;  4IBN A;  1NK6 A;  4M3Y A;  3VQ6 A;  1J53 A;  1UOC A;  4CJP A;  1YVU A;  4IG3 A;  1G15 A;  4RW6 A;  3QES A;  3DRS A;  1VSF A;  3IRX A;  2B5J A;  2NUB A;  2OYQ A;  1CXQ A;  1BCM A;  1EP4 A;  5FRM A;  4Z4E A;  2KFZ A;  2YNI A;  4OKK A;  2P5O A;  1LWE A;  1SUQ A;  3EY1 A;  1NK0 A;  3P83 D;  4NCG A;  1CZB A;  3V9X A;  1RIL A;  4I2P A;  3NAE A;  1CZ9 A;  3ZSV A;  2Y1I A;  4PWD A;  1BHL A;  3OJU A;  2WOM A;  3MEE A;  2W42 A;  1QSS A;  3S9H A;  4F8R A;  1RT2 A;  4FJM A;  2F8S A;  3CM5 A;  2HHU A;  4OGC A;  1TL3 A;  1RT1 A;  3TI0 A;  4FVM A;  1KFD A;  4DTU A;  1RBV A;  3V1R A;  3LZJ A;  3OS0 A;  4FZZ A;  4R5P A;  3PO5 A;  4CEQ A;  1LAV A;  1B9F A;  3DLR A;  5I42 A;  3AO2 A;  1X9S A;  2FBV A;  1FK9 A;  3OJS A;  3NH2 A;  1ASU A;  1QQC A;  1X1P A;  5HRS A;  4ICL A;  4BDY A;  1J9A A;  2HHX A;  4KRE A;  3LP2 A;  4E89 A;  3LP0 A;  3QNN A;  4DTP A;  4DSJ A;  2D0B A;  4CEZ A;  3OYC A;  3WNG A;  3RR7 A;  4CGF A;  1QSL A;  5HRN A;  3OY9 A;  3BGR A;  4IDK A;  3O3G A;  4FLY A;  4I9L A;  1SL0 A;  4I9Q A;  3LPT A;  3TAM A;  3NDK A;  4KHS A;  4N5S A;  3C94 A;  3LWL A;  3F9K A;  1D5A A;  1NK7 A;  1TVR A;  3NF9 A;  1SL1 A;  3RWU A;  4B9L A;  3HP6 A;  1Q9Y A;  4GMJ B;  1S1W A;  3V9S A;  1DTQ A;  4CHP A;  1DLO A;  4CIG A;  1HQE A;  3MED A;  1KVB A;  4CHZ A;  3TWH A;  4DTM A;  3ZT4 A;  4HTU A;  1WN7 A;  1JXB A;  2IAJ A;  3DI6 A;  3QO9 A;  2X6N A;  4CHY A;  4ID1 A;  2BE2 A;  3DMJ A;  1ZBF A;  4FJ5 A;  4LH5 A;  1VSI A;  3WNF A;  3V4I A;  3HXM A;  1RBU A;  2HMI A;  2ZQB A;  3SQ0 A;  2Z1H A;  2KZM A;  3H08 A;  1VK0 A;  1X9W A;  3L2R A;  1SKR A;  3PY8 A;  4KFB A;  2Z1G A;  5KI6 A;  3K5L A;  2DTU A;  3L2Q A;  3SNN A;  1RTJ A;  2EX3 A;  3MEG A;  2Z1J A;  1TKD A;  3L2V A;  1SKW A;  1NKC A;  4KAZ A;  3JSM A;  3QEI A;  2O4G A;  4J2D A;  5J2P A;  2HNY A;  3I0R A;  3MAQ A;  1LW0 A;  1NK8 A;  2F8T A;  3TAF A;  3NGY A;  1S1V A;  1W9H A;  2KTQ A;  3SI6 A;  2IC3 A;  3QET A;  4CF9 A;  3NH0 A;  3RTV A;  1VSD A;  1JLF A;  1MU2 A;  3B6P A;  5I3U A;  4CJW A;  4CGJ A;  3OYE A;  4NYF A;  4DU1 A;  2GUI A;  4CHO A;  3K5O A;  4DLE A;  4CGG A;  2OPR A;  3CG7 A;  4O4G A;  5KRT A;  1CXU A;  4CF0 A;  1I3A A;  4FJX A;  4N76 A;  3DYA A;  2XRI A;  3WNH A;  5HRO A;  3QIO A;  5SWM A;  4M3X A;  1RT5 A;  3KIO A;  3HM9 A;  4CJS A;  5HBM A;  4E7L A;  3QEP A;  1WAF A;  3L2W A;  5HP1 A;  3THV A;  3D45 A;  4OPJ A;  2GV9 A;  1RDD A;  1RT7 A;  4Q5V A;  2HHV A;  4FJI A;  2KFN A;  1IH7 A;  4WE1 A;  3SUP A;  2PYL A;  4AHS A;  2QKB A;  3LZI A;  3RMD A;  1QTM A;  1VRT A;  3QNO A;  1C0U A;  4FZY A;  2JLE A;  3NFA A;  4CF2 A;  2XO7 A;  3EYZ A;  2OPQ A;  4KB1 A;  4PUO A;  3BDP A;  1ITG A;  4FJG A;  3PX6 A;  1S6Q A;  3NF6 A;  1WSJ A;  5CYQ A;  2ETJ A;  1TGO A;  3VQ4 A;  3SPY A;  1S1X A;  2QK9 A;  1YTA A;  2DFE A;  2FBY A;  3TR8 A;  4DTS A;  4E1N A;  1WSH A;  3LP1 A;  2P5G A;  4HHT A;  1B9D A;  3U3G A;  1KLN A;  3SZ2 A;  1T03 A;  1B92 A;  2FBX A;  3OVN A;  3E01 A;  1XI1 A;  1LW2 A;  2FBT A;  1VRU A;  3A2F A;  2P1J A;  4KTW A;  2Y1J A;  3S3M A;  2YNH A;  3L3U A;  4DSI A;  2PY5 A;  1L3V A;  1RTD A;  2AJQ A;  4JS5 A;  1S6P A;  3KK1 A;  2G8H A;  1TL1 A;  5EU7 A;  4F4K A;  4F2R A;  4CGH A;  3KLH A;  3CM6 A;  4CK2 A;  4BE2 A;  2A1S A;  4Z4F A;  4OLA A;  3OYN A;  2G8K A;  4FJH A;  2XHB A;  2VG5 A;  1IKV A;  4TSX A;  1IKX A;  1KTQ A;  1HRH A;  5J1E A;  5KGX A;  3SQ2 A;  4F3O A;  4C8N A;  3OYJ A;  4BE1 A;  4CF1 A;  1Z26 A;  3KKR A;  1C1B A;  3L2U A;  4Z4C A;  1C6V A;  1S1U A;  4DS4 A;  3VQ9 A;  1TKX A;  2DFH A;  4UQG A;  4DTR A;  3RRG A;  4CJV A;  4CF8 A;  5JS1 A;  2Z1I A;  3PO4 A;  3AVN A;  4CEB A;  3OS1 A;  1RTI A;  3WNE A;  1QSY A;  4DQP A;  1KSP A;  3EZ5 A;  3LWM A;  4B3O A;  4CJQ A;  1U47 A;  4AHR A;  3V6D A;  4PA1 A;  1NK4 A;  4DWI A;  4N41 A;  3RR8 A;  2I5J A;  1WLJ A;  3ZCM A;  1L3U A;  2JGU A;  1KVA A;  2GBZ A;  4DU3 A;  1ZBU A;  3OS2 A;  2P51 A;  4PQU A;  4IG0 A;  3NCI A;  3QEX A;  1BIZ A;  4FZX C;  1T05 A;  1EKE A;  5K14 A;  4FJL A;  3AVL A;  3O4N A;  1BGX T;  4CFC A;  4HUE A;  4O0J A;  3VQB A;  3OYD A;  3QEV A;  4B9U A;  3O4Q A;  4AHC A;  4FK0 A;  3SYZ A;  4OJR A;  1NKB A;  1F21 A;  1HPZ A;  1RT4 A;  1NJY A;  4EZ6 A;  4FJN A;  5CZ1 A;  3PV8 A;  1HQU A;  3ZSO A;  4AHV A;  4DQI A;  3NGZ A;  3NH1 A;  4RW8 A;  1RT3 A;  2D0A A;  2IOC A;  4QOZ B;  4J2E A;  1NJZ A;  3MXI A;  4ELV A;  1U45 A;  1BCO A;  1RNH A;  4QAG A;  1KLM A;  1VSE A;  2HNZ A;  4DQQ A;  3G0Z A;  3PX0 A;  3HYF A;  2YHB A;  3MXM A;  3OYA A;  1KCF A;  1RT6 A;  2ATQ A;  3DOL A;  4DLG A;  3RMB A;  4CFD A;  5T7B A;  3KK3 A;  3V1O A;  4FM1 A;  4CEO A;  2HHW A;  3I0S A;  1C0T A;  1LWF A;  2G8V A;  1JLB A;  1XHX A;  3AA5 X;  4EP4 A;  4ZHR A;  3SCX A;  4O44 A;  3ZSY A;  4DTJ A;  3ZT2 A;  1VSM A;  1ASV A;  1TK5 A;  4CCH A;  3VQ8 A;  5FRO A;  3AA4 A;  3SUO A;  4B9N A;  3CFR A;  4DTO A;  4FJ8 A;  3HK2 A;  3TAR A;  3T1A A;  1HNI A;  3G10 A;  2OA8 A;  4E1M A;  2YNF A;  2HVI A;  4FLW A;  1ZBH A;  3AA2 A;  1XWL A;  3IS9 A;  4FLV A;  4RW4 A;  1QS4 A;  1RBR A;  1WNS A;  4M3R A;  3K5M A;  4FLX A;  1LAW A;  5J2M A;  3PX4 A;  4YNQ A;  1IKY A;  3S3N A;  4C8K A;  1NK9 A;  3HPH A;  3HPO A;  5HRP A;  1RTH A;  2XY6 A;  4AHT A;  4CEA A;  2RN2 A;  5D3G A;  4CEC A;  3VN5 A;  2KQ2 A;  2E6L A;  3HVT A;  3RMA A;  3SJJ A;  4FJJ A;  4W5Q A;  3L8B A;  2G8F A;  3K5N A;  1A5X A;  4G1Q A;  3DLH A;  1VSJ A;  2D0C A;  3LPU A;  4Z4H A;  4DSL A;  4KTQ A;  2ZD1 A;  1EET A;  4FK2 A;  4OLB A;  3CQ8 A;  1LWC A;  4W5T A;  3M8S A;  4JRP A;  3KLF A;  3AVM A;  3C95 A;  2X74 A;  4CJ5 A;  1U48 A;  4EZ9 A;  4NCA A;  3NF8 A;  2PYJ A;  3VQD A;  5FRN A;  2OPP A;  4L8R B;  4KHU A;  4FJ9 A;  1HMV A;  4B9M A;  3ASM A;  1K6Y A;  4CJU A;  4IFV A;  4CJR A;  4FCY A;  4M42 A;  3NHG A;  1N6Q A;  1KFS A;  4J2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...