4OPJA

Bh-rnaseh:tcda-dna complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*GP*CP*GP*AP*(TCY)P*TP*TP*CP*GP*CP*G)-3'
publication title Generating Crystallographic Models of DNA Dodecamers from Structures of RNase H:DNA Complexes.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/dna
total genus 41
structure length 133
sequence length 133
chains with identical sequence C
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2014-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4opjA00
4M42A 3HJFA 4CGGA 4CJPA 3NBPA 1ZYQA 2HHUA 2KZZA 4CEEA 3O3HA 4NCBA 4FW2A 4CEAA 3O3GA 4F2RA 1U4BA 2IOCA 3VN5A 4DLEA 3VQ8A 3PX4A 2I5JA 1NKCA 1HYZA 3HSTB 4W5RA 3OYDA 3THVA 1IKXA 4KTWA 1J53A 3CG7A 3NF7A 4RW4A 3MXMA 2O4IA 5C24A 5J2QA 3SUQA 4Z0UA 4RW9A 3LP2A 3OYFA 1C0UA 3LZIA 4DU1A 1BISA 1JKHA 4W5TA 3AVHA 3AVNA 4CECA 1BI4A 1TVRA 4OKJA 5CY4A 4CGFA 3VQDA 1VSEA 1IKYA 3FFIA 1HQEA 3OYMA 3TAEA 3SUPA 3SNNA 3NF6A 3OYLA 1S9GA 5HP1A 4KAZA 4KKOA 3RMDA 4FM0A 2FBVA 3H08A 4FJMA 4FZYA 1GOCA 1IKVA 5E41A 3NE6A 4DG1A 1KLMA 4E7JA 2XRIA 1LV5A 5KGWA 1RT2A 3QEPA 4FJGA 2X78A 3E01A 3KK3A 2ZE2A 4FCYA 2OPQA 2D0CA 3VQAA 1JLAA 3DMJA 4FJ5A 4M3XA 1NK9A 4PUOA 1NK7A 4C8NA 4DTJA 3TAGA 2LSNA 2KW4A 3NAEA 1LWFA 1RT4A 2Z1HA 3G0ZA 1Y97A 3DYAA 1NK4A 4DSKA 1ZBHA 4O55A 1TKZA 5KTQA 5D3GA 3O4QA 3KKSA 3OS2A 1VRUA 3DOLA 3QIPA 4Q0BA 3L2RA 4FJLA 3BDPA 2XY8A 4M3YA 1DLOA 2EX3A 4CJSA 4DTMA 3LP3A 5JS2A 1C6VA 1HNVA 2Q3SA 4YNQA 3LWLA 4FLUA 1R0AA 3LP0A 1RDBA 2D0AA 2OPPA 3SPYA 1L5UA 4OLAA 3K5OA 3NH0A 4DFJA 2B5JA 2PY5A 4K8ZA 3SQ4A 1QSSA 3ZT2A 4CIFA 3TABA 3LANA 4I7FA 5HRRA 3SYZA 4C8OA 4L8RB 2ATQA 3ITHA 2IGIA 3DI6A 4AHUA 3O4NA 3V9ZA 3RMBA 3HT3A 3RR7A 3RRGA 3KD5E 4HCCA 5SWMA 3LZJA 3M8RA 2FBYA 3OS1A 3L3UA 3RR8A 1CLQA 2KFZA 5HBMA 3V6DA 4KB0A 2KFNA 4KREA 1RBRA 4F3OA 4DSFA 3V81A 4LY7A 3U3GA 3DLEA 1TK0A 1YVUA 3AO4A 3SUNA 1RT5A 1NKEA 1LWEA 1QQCA 3PV8A 4FJHA 4J2BA 2R7YA 3I0RA 3ZT1A 3DRPA 1JL1A 4CE9A 3V1QA 4PY5A 5J2MA 2HVHA 2Y1IA 1VK0A 3AO1A 2P5GA 1B9DA 4AHCA 3HM9A 1A5VA 1NK6A 1FXXA 2G8WA 1VSDA 2DFEA 4DSJA 3KJVA 4OGEA 1JL2A 4M3UA 4CK2A 3LWMA 2G8FA 3NHGA 1RDDA 4DU4A 3B6OA 4N56A 1VSIA 1U04A 4MQ3A 3L2UA 1D8YA 3ZT0A 5KI6A 2VG7A 1DTTA 3S3NA 3KKRA 1Q8IA 4CEZA 4OPJA 2QKKA 4M3WA 4CJ3A 3HPOA 4DTPA 1J54A 1TKXA 4FW1A 4Y1CA 4DWIA 3ZSYA 2O4GA 5FDLA 4HHTA 3TWHA 4KHSA 1S1TA 1RDCA 2XHBA 1WSHA 3PY8A 3DRSA 2OA8A 4HCBA 3SQ1A 2KZMA 3VQ5A 1ASUA 4CEBA 1G15A 4B8CA 1HYVA 4NCAA 4CJLA 3KK1A 4CFAA 1EXQA 3SCXA 4I9LA 4LH5A 3LALA 3ZSRA 5HRSA 3QIOA 1NJYA 1RTIA 4HVJA 4OKKA 1UA0A 1VSKA 4KHUA 4CGJA 4CERA 1RTJA 4B9TA 4KRFA 1NKBA 3P1GA 4FJIA 4NCGA 1NK8A 5T7BA 2QK9A 3M8SA 4N47A 4YFUA 4FK4A 4HUFA 2OZMA 3V1RA 1QTMA 1TKTA 4N76A 3OY9A 3K59A 3OJUA 2VWKA 4H8KA 4E7IA 4H4MA 3QETA 4Z4FA 3P83D 4OLBA 4FLVA 1TGOA 1X9SA 2QXFA 1WSGA 4ZHRA 3L2VA 2XY5A 4JLHA 4CESA 2JGUA 2ZD1A 1S9EA 2Z1JA 2X6SA 4FZZA 1YTUA 1YT3A 2IDOA 4CJQA 2XY7A 2G8KA 3KLFA 1BHLA 2PYJA 4B9MA 1A5WA 3TI0A 4DTSA 4OGCA 5SZTA 1O1WA 1QSLA 3IAYA 2HHQA 5KRSA 4BDYA 3UIQA 2ITGA 3SV3A 1RBTA 3QERA 1WAFA 4CEOA 4DQPA 4J2DA 2DTUA 1NJZA 1RT6A 5K14A 1SKRA 1WSEA 5DK5A 1JLFA 3CFPA 4EZ6A 2DFFA 3MEDA 5J2NA 4OJRA 4FJJA 4I2QA 2P1JA 4CJEA 4Q5VA 4DF8A 3VA0A 3NF8A 1S5JA 4E89A 3JYTA 3NH1A 1HYSA 4AH9A 3K5MA 3TAQA 1HQUA 1KRPA 3L2QA 4B3OA 4PQUA 4FK0A 1WNSA 3AVFA 4CJVA 4N5SA 1UOCA 3SI6A 1U45A 3VQ7A 1FK9A 4E7HA 4KHNA 4ID5A 3OYIA 3HVTA 4IG3A 3V9XA 5FRNA 1VSLA 4RW8A 3D45A 2VG5A 3K5LA 4CJFA 3MAQA 3CFRA 2GBZA 1ASWA 1WAJA 1LW0A 4I9QA 3TANA 4F8RA 4KB1A 3D0PA 1Z25A 3CYMA 4DLGA 3PX6A 4CFDA 4Z4IA 4Z4EA 5J1EA 2HHTA 4B8AB 4PA1A 1L3UA 3S3OA 4IBNA 4ICLA 1KLNA 4DSIA 2YNFA 1VRTA 3L3VA 4JS5A 5I42A 4XIUA 4BE0A 1NOYA 1HMVA 1N5YA 2RKIA 1LAVA 3OJSA 2P5OA 1RT3A 3AO2A 4KTZA 5CZ1A 2X6NA 4E19A 1CXQA 3HPGA 3ZSZA 1RBUA 4DU3A 3A2FA 3RRHA 1NJWA 4G1QA 4AHSA 1X1PA 3ZT4A 3TAPA 4FK2A 2HHXA 2HVIA 2X74A 1ZBLA 4B9NA 1QSYA 4ELTA 1I39A 5CZ2A 3AA2A 3ZSWA 2XY6A 4BWMA 3AVKA 4M3TA 2ETJA 2DY4A 1BCMA 3NGZA 3AVCA 3V4IA 1Z26A 1KTQA 2NUBA 2EHGA 1XHXA 4LSLA 3MXJA 3RMCA 3SQ2A 1U48A 1QHTA 1GOBA 2JLEA 3WNFA 5KGXA 3HO1A 1BQMA 4CJTA 3TARA 3AVIA 3RMAA 3PO4A 4C8KA 3DLGA 2GUIA 3DM2A 4KV8A 4M41A 4DQSA 3AV9A 4FM2A 1TL1A 1RT7A 3NF9A 3QNNA 1S6PA 1A5XA 2FC0A 3MEGA 1IO2A 3K58A 4BDZA 1XI1A 1SL1A 1RTDA 3WNEA 4HUGA 4O4GA 5DMRA 2E6LA 3K5NA 4LH4A 3SV4A 4J2EA 4FJNA 1UA1A 1EX4A 3C6TA 3QEWA 4FZXC 3HP6A 2YKMA 3B6PA 3VQ9A 2FBXA 3AVGA 1CXUA 4KI6A 4Z4GA 1FKOA 4BWJA 4CJUA 4DS5A 4FJXA 1C1BA 4NYFA 5CYMA 3OYEA 2IC3A 4CJKA 1BI4B 4E3SA 2GV9A 3AA5X 1DTQA 2D5RA 1EP4A 1VSHA 2YKNA 3AO5A 4ELUA 4OKEA 5J2PA 4F2SA 2AJQA 3LAKA 1WN7A 4DF4A 2WOMA 4NYNA 1RTHA 4CEDA 3AVJA 3HL8A 1F21A 1KFDA 1LAWA 1REVA 1RNHA 3VQCA 4E1NA 4CF2A 1MU2A 4DTRA 4CJWA 3TAFA 4E7LA 4B9VA 1IG9A 3AO3A 2PYLA 1J5OA 3NDKA 3L8BA 2G8VA 3DLBA 3S9HA 4FXDA 3AVMA 1U49A 1KFSA 1S1VA 3CM5A 3ZSXA 3SPZA 3ZSOA 1RT1A 4KHYA 3IS9A 4B08A 5HROA 4CCHA 1SUQA 1J9AA 3OS0A 3HK2A 4DS4A 3IG1A 3L2WA 1VSFA 4CJ5A 3QEXA 2Z1GA 1S6QA 1QS4A 1C1AA 2DFHA 3LP1A 1T7PA 4MFBA 3DLKA 2FBTA 4DSEA 4KHQA 2BGGA 3ISNC 4FLYA 3JSMA 2KQ2A 2YNGA 3BGRA 3IRXA 1KVBA 1HNIA 1K6YA 1T03A 3PUFA 4GMJB 4IG0A 4M3RA 4M3ZA 1TKDA 1VSMA 2WONA 3DRRA 4KTQA 4CHZA 1JLGA 1RILA 2F8TA 4H4OA 4DQIA 2OPRA 4FVMA 3OYKA 5KRTA 4FLZA 3OYNA 1X9WA 1Q9YA 4ID1A 4DTUA 1C0TA 2YV0X 4CK1A 4CJRA 4GVMA 4CFCA 4DTNA 1D9DA 4EZ9A 2G8IA 1ASVA 2VG6A 4FJKA 4EP4A 3EZ5A 3DLRA 1IH7A 2PZSA 4FJ8A 3HXMA 4I2PA 2B4JA 2YHBA 3CM6A 3OYCA 3T3FA 1JLCA 4M45A 2D0BA 4ZTJA 4B9LA 4WE1A 4CGDA 3VQ4A 2VWJA 4OVLA 5HLFA 1U47A 2HHWA 1TV6A 3ALYA 3DOKA 2HW3A 4R5PA 1KSPA 3RTVA 4CHPA 1BCOA 4DFMA 4CGHA 4HTUA 3PX0A 1KVCA 4N41A 1GOAA 3K57A 1S1WA 3KLIA 4W5OA 4ZTFA 5FRMA 1WSFA 1UAXA 5C42A 3ULDA 3NGIA 1S1UA 3VQPA 3NFAA 3M8QA 3F73A 1IKWA 1JLQA 3SJJA 3AVLA 4CF1A 1NK5A 1TK8A 4KI4A 4CHOA 3VQ6A 3HP9A 4CIGA 3HPHA 1TAUA 2E4LA 3QEVA 3C95A 4CF0A 3MXIA 3ASMA 4ELVA 2Z1IA 3RWUA 4IFVA 1ITGA 4E0DA 2OYQA 3KD1E 2XO7A 1BIUA 4CHYA 2HHSA 3AVAA 4Z4HA 3OYJA 1L3VA 4QOZB 2B6AA 1SL2A 3KIOA 3WNGA 1JXEA 1ZBIA 2F8SA 5HRNA 3EYZA 2BE2A 1D5AA 3G10A 1HJRA 1TL3A 4F4KA 3OYGA 3ZCMA 3F9KA 4O44A 3AA4A 3SZ2A 1SKWA 4BE2A 3NH2A 1XWLA 4HUEA 5JS1A 1BGXT 4IDKA 2IAJA 4E1MA 4DMNA 4FLWA 4QAGA 4AHVA 2OZSA 4DFPA 3OYAA 4JRPA 4DTXA 2QKBA 4E7KA 4AHRA 3KTQA 2A1RA 4CEFA 4JRQA 4CHQA 3HVRA 3LPUA 2HNDA 4KFBA 3QEIA 3ZT3A 3QO9A 1LWCA 3V9UA 3QNOA 2HMIA 1TAQA 3K2PA 4GW6A 1WSJA 3S3MA 4C8MA 2RN2A 2RF2A 2G8HA 4Y1DA 3DLHA 4CFBA 3VQEA 3EY1A 4BACA 4W5NA 4FJ7A 4CGIA 4DFKA 1RCHA 1FKPA 1BL3A 1NJXA 4K8XA 1SKSA 1NOZA 4C8LA 2YHAA 1S1XA 4LSNA 2HNYA 2HHVA 4CJ4A 4EP5A 1WSIA 3MECA 3V9SA 4BDPA 2IS3A 4JS4A 1C0MA 1HRHA 1JXBA 1VSJA 1L3TA 2KTQA 1SV5A 2YNHA 3C6UA 4CF8A 4Z4CA 3C94A 1T8EA 4KHWA 2Y1JA 2HNZA 1JLEA 3VQBA 3P5JA 3KK2A 3OYHA 1XHZA 3LDSA 3T1AA 1BIZA 4FYDA 1C1CA 4O5BA 5I3UA 1T05A 3LPTA 2YNIA 1I3AA 3KLEA 4LD0A 1W9HA 1EKEA 5FROA 3KLGA 3NGYA 3QESA 3HYFA 3VA3A 3TR8A 3AVBA 1X9MA 1EETA 3CQ8A 4W5QA 3SUOA 4FLTA 4IKFA 3MEEA 4CK3A 5HRPA 3OVNA 4CHNA 2G8UA 4QCLA 1CZ9A 1B92A 3OYBA 1RBVA 4DSLA 1L3SA 1XC9A 3V1OA 2RPIA 4DTOA 2E6MA 3I0SA 2ZQBA 4TSXA 4J2AA 5C25A 4O0IA 3I8DA 2A1SA 3LAMA 3NCIA 4B9SA 1LW2A 3U3YA 3U6FA 4UQGA 1D9FA 2P51A 1TK5A 1WLJA 1CZBA 5CYQA 3KLHA 4FJ9A 1ZBFA 4OPKA 2BDPA 3QLHA 4DQQA 4KO0A 3VQQA 1JLBA 4AILC 4RW6A 4CIEA 1RDAA 3AA3A 3WNHA 4FLXA 4DQRA 1SL0A 1Q9XA 1KCFA 1B9FA 5EU7A 4RW7A 3ZSQA 3PO5A 3QINA 4CF9A 1BQNA 4B9UA 1QE1A 2F96A 1N6QA 4O0JA 1NK0A 1KVAA 3M8PA 4BE1A 1ZBUA 2OPSA 4F3TA 1YTAA 4CEQA 4FM1A 4RG8A 4IFYA 3V9WA 4PWDA 1HPZA 4AHTA 2HB5A 1RBSA 3O3FA 1W0HA 1UWBA 3T19A 3CFOA 3TAMA 4KPYA 2W42A 3ZSVA 3SQ0A 2BANA
chains in the Genus database with same CATH superfamily
4M42A 2HBJA 4GV3A 4CD3A 4CJPA 4NCBA 4FW2A 4CEAA 1NMDA 3VQ8A 4W5RA 3THVA 3W0LA 4NXMK 3SUQA 4Z0UA 1VQLN 3LZIA 4DU1A 1BISA 1JKHA 1BI4A 4CGFA 3VQDA 4IEIA 4X66K 1IKYA 3AAQA 3SNNA 2UUBK 1SAZA 3SUPA 3NF6A 5BRFA 5HP1A 3J81O 4KAZA 3RMDA 4YHHK 4FM0A 1SS6A 3H08A 3L4QA 4DQ8A 4R79A 1VQ8N 4PUOA 4DTJA 4KH5A 1VQKN 4FWSA 3RVCA 1LWFA 5AQPA 3HM8A 3NAEA 2Z1HA 3G0ZA 4FWQA 2FSKA 3CXCM 3DYAA 1NK4A 4OO1J 4O55A 1TKZA 1VRUA 4X62K 4FJLA 2EX3A 3M5RA 4DTMA 4H0XB 1C6VA 4XEIA 3THXB 3HZ6A 4BC2A 2D0AA 4LF9K 4BRGA 3NH0A 4DFJA 2PY5A 3SQ4A 1QSSA 3TABA 3ITHA 3DI6A 3RR7A 4O8UA 3ZX3A 4HCCA 3M8RA 4B3SK 3RR8A 4J8FA 1CLQA 2ITMA 1RBRA 4LY7A 1YVUA 3SJHA 3T69A 3SUNA 3EN9A 1NKEA 1QQCA 2O8BA 2R7YA 3I0RA 1EWQA 3ZT1A 3DRPA 1JL1A 4CE9A 3V1QA 4FWNA 5MLCQ 3VEOA 5J2MA 2QWNA 2Y1IA 4O5FA 3CHWA 3CCVN 3FR0A 3C7NA 3I8BA 3ZX0A 5AQHA 4CK2A 3MN7A 3L4IA 4N56A 1VSIA 3L2UA 3MX5A 3ZT0A 5KI6A 2VG7A 4DB3A 4CEZA 4OPJA 2QKKA 3WXJA 4CJ3A 1BDGA 3TWHA 4KHSA 2RE2A 1RDCA 1WSHA 3EO3A 1XQSC 5AQRA 3H46O 4HCBA 4BREA 1ASUA 5C15A 1TUYA 4WQ4A 1W7AA 4I9LA 3LALA 5HRSA 4WFNL 4HVJA 1VSKA 4JKGA 1BUPA 2QEXN 4NCGA 3R1XA 1FJGK 2QK9A 4HUFA 3V1RA 3ATUA 2VGMA 5GAGP 4H0OA 3OJUA 3O9SA 2VQEK 4AF1A 2XY5A 4CESA 5AR0A 5AQYA 2ZD1A 2Z1JA 3KLFA 1XMOK 3CIPA 5KRSA 3SV3A 4DQPA 4J2DA 1YIJN 2YHYA 1SKRA 2P9PB 5AQMA 4BQZA 5DK5A 2DFFA 2ZJRL 4Q5VA 4BRMA 2OTLN 3R6MA 3NH1A 4JK9A 1HYSA 3TAQA 2P9KA 4F9OA 1KRPA 4PQUA 1UOCA 2P9IA 3PLAA 4M7YA 1HKGA 3CPEA 5FRNA 1VSLA 3CFRA 3MAQA 4QS7A 4A5BA 3DLLL 3J8AA 1K8AO 3C0BA 1C0FA 4KB1A 1Z25A 3CYMA 3O08A 3SBGA 3PX6A 4I6MA 4KH6A 3H1QA 4DSIA 3JAMO 4CZHA 3GG4A 2VCPA 4MDBA 3FZHA 4BVPA 4BRCA 3AO2A 5CZ1A 4LFCK 1BG3A 5CE3A 3HSCA 3RRHA 1X1PA 2XY6A 3ZSWA 3AVKA 4PKGA 4H5TA 4M3TA 2DY4A 1JCEA 4JKHA 2EHGA 4FVUA 1M1KO 2JLEA 3WNFA 4EAHD 3HO1A 3EE9A 1HLUA 4M41A 3C6AA 3IUCA 1YAGA 1RT7A 3QNNA 1S6PA 1A5XA 3WXIA 3MEGA 3K58A 3ZEUA 4BDZA 4HUGA 5DMRA 3F9MA 3M1FA 1EX4A 3C6TA 2HOEA 3WEEA 3B6PA 3VQ9A 4MLHA 3AVGA 4KI6A 1GLBG 3CPWM 1FKOA 4FJXA 2W6LA 3FZMA 1BI4B 2D5RA 1EP4A 1VSHA 2UYTA 2AJQA 3LAKA 5KPZA 2WOMA 4NYNA 4CEDA 1KFDA 1REVA 1RNHA 4E1NA 5LJVA 1IG9A 3AO3A 3NDKA 4YOUA 3S9HA 1KFSA 5EOYA 2O8EB 3CC2N 1NMNA 3TTCA 1SUQA 2O8DA 3HK2A 4DHYA 2P9LB 1C1AA 2DFHA 3LP1A 4WQ4C 2UU9K 1T7PA 3VGKA 2FBTA 3S41A 2O8CA 5JVHL 3ISNC 3GBTA 2WFBA 3BGRA 3DRRA 3C6HA 3LDLA 4DQIA 1Q81O 4EZ9A 2PBDA 4IJNA 2VG6A 3T1YK 2PAVA 2A40A 2ZGZA 4K41A 1MWMA 4M45A 2D0BA 4CBWA 1KQSM 4WE1A 4CGDA 4KH4A 5AQTA 2HHWA 1TV6A 2HW3A 2NRTA 2QTDA 1KSPA 3RTVA 2O8BB 5ELZA 3T1HK 1XUPO 4W5OA 1UAXA 4AM7A 4BQLA 3NGIA 1S1UA 3MN6A 3ULDA 3F73A 4JKCA 3OA9A 4A2BA 4PHTX 3C7NB 4LF7K 4CIGA 3HPHA 2NRRA 3THWB 2HMPA 1ITGA 3R8EA 4CZJA 1XNRK 2IVOA 3A8YA 4BC4A 3OYJA 4B3TK 3KIOA 1ZBIA 3FZFA 1D5AA 1BO5O 1NWKA 5BR9A 3G10A 1HJRA 3G4SN 3QB0A 5AZJA 5IWAK 4F4KA 1N36K 3AA4A 5AQQA 2ZJQL 4BE2A 1HKBA 2IAJA 5KQDA 5C0YA 3OYAA 4JKGB 2E20A 1YI2N 1Z05A 1NNEA 3BY5A 3LPUA 3AY9A 2HNDA 1HR0K 1CZAN 3QNOA 3K2PA 3VEZA 4YDUA 1NGCA 1E4GT 3MN5A 3SAFA 3EY1A 4W5NA 3VETA 4H0VB 1FKPA 1NJXA 3N4PA 2NRHA 3CJ7A 1S1XA 1WSIA 4JS4A 1C0MA 1HRHA 2WC9A 2KTQA 3O9TA 4CF8A 4Z4CA 2HNZA 1JLEA 4FOEA 3L6QA 3P5JA 3BZKA 3LDSA 4ISEA 2E5LK 5I3UA 3NVMA 4LFBK 2P9KB 3H3OB 2VYPA 3NGYA 5FROA 3VA3A 3QESA 2IVNA 3ID6A 1X9MA 3CQ8A 4FL9A 3SUOA 3CERA 3UE5A 3MEEA 3D7EO 1ATRA 4CK3A 1EQYA 2G8UA 3O5BA 4DSLA 1XC9A 3V1OA 1EWRA 2YCHA 1JCFA 3HOTA 3I8DA 1SZ2A 4DR4K 1D9FA 3VOVA 2P51A 5CYQA 3CJBA 4DQQA 3VQQA 1JLBA 4RW6A 4FLXA 3U9DA 1Q9XA 5EU7A 3QINA 3VF2A 1QE1A 4NLBA 1N6QA 4FWOA 3M8PA 4BE1A 1RGIA 3ULEA 3SAGA 4F3TA 1S3XA 1YTAA 4AHTA 4M63C 4NXNK 1UWBA 3T19A 4KPYA 3ZSVA 2QWRA 3HJFA 3NBPA 2KZZA 2D1KA 4CEEA 3O3HA 2F7TA 1U4BA 2NZTA 2IOCA 4DLEA 3PX4A 5GIPA 1HYZA 3HSTB 4NLCA 3ZEUB 3OYDA 4DR1K 4KTWA 3MXMA 3NF7A 1MDUB 2O4IA 1DEJA 3WEEB 2J4RA 1TVRA 4OKJA 1D4XA 4JI2K 2HF4A 3FFIA 3TAEA 4LF8K 3BEXA 4DV0K 2BH1A 4BR9A 4FJMA 1GOCA 3CJ1A 3QEPA 4FJGA 2ZE2A 3EL2A 3DMJA 4BC5A 4YOWA 3TAGA 2KW4A 4DUZK 2O8DB 5M1NA 1Y97A 3MWPA 1ZBHA 5KTQA 4DCHA 4G9ZA 4K43A 1K8KB 4GV6A 3KKSA 3OS2A 3DOLA 3QIPA 3A5LC 2XY8A 3DXMA 4JK8A 3LWLA 1HNVA 2Q3SA 1R0AA 4OLAA 3LP0A 1RDBA 1L5UA 2OPPA 5C2DA 4YDUC 4CIFA 3LANA 4I7FA 3CCUN 3SYZA 3O4NA 3V9ZA 1YHQN 3RRGA 1NG9A 3KD5E 2FBYA 5CHIA 2KFNA 4K25A 4KREA 2QWQA 3U3GA 1TK0A 1YJNN 1LWEA 4J2BA 4U7BA 3D2EA 1YJ9N 2E1YA 3T7ZA 4JV5K 3AO1A 2HVHA 4CVNE 2P5GA 4MO4A 4AHCA 3HM9A 1NK6A 2G8WA 4JEPA 4DR2K 3KJVA 4OGEA 5GAHP 1JL2A 1T6DA 3NHGA 3VGMA 3UKUB 4BR4A 5BPLA 1Q8IA 4DTPA 1J54A 1TKXA 5JMVA 3ZSYA 3U4LA 1S1TA 3DAWA 2OA8A 3KHYA 4ILGB 3SQ1A 4B8CA 1HYVA 5AZJB 3SCXA 1NJYA 4OKKA 4CGJA 4CERA 3P39A 3E9PA 3M8SA 4N47A 4FK4A 1TKTA 2VWKA 4E7IA 4OLBA 1TGOA 3W3DA 2QXFA 4CI6A 4ZHRA 3L2VA 1Q86O 1S9EA 5ADXH 4FZZA 2IDOA 1W2BM 1TYQA 2G8KA 1BHLA 4B9MA 1A5WA 4DTSA 1ATSA 1HUXA 5SZTA 3E1YA 2ITGA 3MN9A 4CEOA 2DTUA 1RT6A 1WSEA 2GWJA 1NU0A 4I2QA 2P1JA 1T6CA 3NVKA 3WQTA 2WTUA 3L2QA 4LFAK 1WNSA 4CJVA 1U45A 3OBWA 2O8FA 4NO7A 4ID5A 4CZKA 3HVTA 4IG3A 3Q7BA 1KAXA 5BRDA 3OYIA 3D45A 2VG5A 3K5LA 5GADP 2ASPA 1WAJA 4H5RA 2Q31A 1VQ6N 4Z4IA 4JI0K 2E2NA 3S3OA 5AQFA 3MK6A 4BRFA 3E9OA 4IBNA 3N4QA 4ICLA 5IT9O 1NBWA 1KAYA 4FWMA 5LMUK 5I42A 3ZETA 1HMVA 4PL7A 5DM7L 3J80O 3LM9A 4DKWA 1N5YA 3CCEN 1LAVA 4KHPK 4A5AA 2GUPA 1CXQA 2Q97A 4MLEA 1NJWA 4G1QA 2HVIA 3TAPA 1U6ZA 2GX9A 3AAPA 3QBWA 1ZBLA 1QSYA 2E2OA 1EO1A 3RSEB 2CGJA 4FSVA 3ULEB 1BCMA 3V4IA 3AVCA 2UUCK 1XHXA 3SQ2A 4WF9L 4FWLA 1KC8O 2HHHK 3DLGA 2GUIA 4C8KA 4CBXA 3GOIA 1RTDA 2FC0A 1XI1A 4E1JA 5AZIB 3WNEA 5I9EB 4WFAL 2E6LA 3K5NA 3CJAA 4FJNA 4H0YB 3QEWA 1IJJA 2F9TA 4GVEA 4DV2K 2FBXA 4Z4GA 4BWJA 4CJUA 5A2QO 5CYMA 4CJKA 4E3SA 2GV9A 1DTQA 3AGRA 4ELUA 3UKRA 3I55N 5J2PA 4F2SA 4DF4A 2V7YA 4BC3A 3HL8A 3VQCA 3ENHA 5AFUA 1P8ZA 4B9VA 3E66A 4E7LA 2G8VA 3FE1A 3CCMN 4IOAL 3TTDA 4FXDA 1S1VA 1YUWA 1RT1A 1NGFA 5HROA 3OS0A 3IG1A 2VGNA 4QS8A 3QEXA 4Y0WA 1S6QA 1QS4A 4BRQA 1FW6A 4MFBA 3DLKA 1NGBA 4DSEA 4BR7A 4A61A 4PL8A 4FLYA 1E3MA 2V51B 2EWSA 2E8AA 3J7ZO 3EKSA 1WUAA 1T03A 3PUFA 3DXMB 4BG9A 4M3RA 4M3ZA 1TKDA 1VSMA 5HL7L 4A62A 1RILA 4FWKA 5AQKA 1D9DA 2G8IA 4CJRA 4GVMA 2QA4N 1ASVA 4FJKA 2E1ZA 4DV6K 4FJ8A 3HXMA 5EY4A 3OYCA 3O9RA 1JLCA 4BRKA 2VWJA 1SQKA 1OH5A 4CHPA 1ZC6A 1Q7YO 4HTUA 3D2EB 3O8MA 1GOAA 3KLIA 4ZTFA 5FRMA 5C42A 2Q36A 2UXCK 3NFAA 3M8QA 1IKWA 1TK8A 3DXKA 3R9PA 4V19S 3VQ6A 5M1KA 3MXIA 2Z1IA 3G71N 4IFVA 4IDHA 3KD1E 2UXBK 1BIUA 4CHYA 2HHSA 3AVAA 2OCEA 4Z4HA 2B6AA 1OH8A 4IFEA 1HX1A 1DKGD 3EYZA 2UXDK 1K9MO 1TL3A 4CZGA 1H1VA 4O44A 1WB9A 3P4IA 3SZ2A 3NH2A 4IDKA 4YOYA 2ZM6K 2CH6A 4QAGA 2ZJPL 4JRPA 4E7KA 4AHRA 1IG8A 5FPDA 3A5MC 4JRQA 3QEIA 3ZT3A 1LWCA 3V9UA 2HMIA 1TAQA 4OX9K 1N32K 2RF2A 1MWKA 3DLHA 5F0XA 1TYQB 1BL3A 1HNZK 3CJCA 4K8XA 1SKSA 2HHVA 3ID8A 4CJ4A 1OVYA 3MECA 4QS9A 3SBTA 3V9SA 4BDPA 1JXBA 1L3TA 3VF6A 3CF5L 3C6UA 2E88A 4IXCA 1T8EA 4KHWA 3VQBA 1S72N 3I33A 4H03B 3OYHA 4FYDA 1BIZA 1C1CA 4O5BA 3LPTA 2BTFA 2YNIA 4B3RK 4H5VA 3HYFA 3TR8A 3ATVA 3AVBA 4A57A 1X3MA 1N34K 3K9KA 4IKFA 3TPQA 1XC3A 3OVNA 4CHNA 1U2VA 4QCLA 1CZ9A 3LDOA 1L3SA 4DTOA 3I0SA 1X3NA 2UUAK 2YHXA 4J2AA 5C25A 4O0IA 3LAMA 3FZLA 4B9SA 4FOIA 5M1QA 3U6FA 4UQGA 3ZETB 1NGDA 1TK5A 1CZBA 1ZBFA 4OPKA 4LF5K 3QLHA 4GNIA 4KO0A 3P38A 4DQRA 2Q1NA 3L0QA 4DR3K 4CF9A 4IO9L 1BQNA 1ZBSA 4FPAA 4B9UA 4K0KK 4O0JA 4BR2A 4IFYA 4PWDA 3TAMA 4WFBL 3CFOA 3H6EA 2QWMA 4B1UB 1VQ4N 1VQ5N 1VQ7N 4PKIA 4X65K 3HOSA 4H5NA 1NKCA 2I5JA 4FPBA 4DV5K 4RW4A 1J53A 3ENBA 5C24A 4RW9A 3OYFA 4W5TA 4B1YB 5KPTA 1VSEA 3P31A 3OYLA 1S9GA 2Q0RA 4KKOA 4C1NK 3NE6A 5KPRA 5DM6L 4E7JA 1BU6O 5KGWA 2X78A 3FGUA 5AQNA 2OPQA 3VQAA 4FJ5A 4M3XA 1NK7A 4C8NA 2LSNA 1RT4A 1W97L 3PIPL 4CD1A 4DSKA 3GDQA 3MX2A 3QBXA 5D3GA 1VAZA 4IOCL 4B1ZA 4B3MK 4Q0BA 3L2RA 3FFKB 3BDPA 4M3YA 1DLOA 4CJSA 4FLUA 2YX6A 3K5OA 4YOVA 2B5JA 3CMAN 5HRRA 4L8RB 4C8OA 3BF1A 2ATQA 3RMBA 5SWMA 3LZJA 3MCPA 3OS1A 3L3UA 3V6DA 3QFPA 4B1XB 1OKJA 3DLEA 1QHAA 3AO4A 4FJHA 4CZMA 3CMEN 2CGKA 3AARA 5EXWA 1Z6RA 4H0TB 1OH7A 2OANA 2P9IB 1VK0A 1A5VA 4AQYK 1FXXA 1VSDA 5EX5A 2DFEA 4DSJA 1VHXA 3F2KA 2GWKA 3HTVA 3LWMA 2G8FA 5JICA 1RDDA 4OPHA 2PFUA 3B6OA 4I6MB 1U04A 1D8YA 1DTTA 3KKRA 3J7AP 2ZWHA 4M3WA 3HPOA 2ASOA 4Y1CA 4DWIA 2O4GA 4HHTA 3PY8A 4O8KA 2KZMA 4U67L 4JHDA 4CJLA 4CFAA 1EXQA 1OVQA 3TSQA 3QIOA 5C2FA 1RTIA 1UA0A 3EE8A 3LDNA 2KKZA 4EIAA 4EFHA 4B9TA 4XH1A 4KRFA 1NKBA 3P1GA 3FZKA 4FJIA 2BUPA 4FWPA 5T7BA 4YFUA 1QQMA 2OZMA 3VTIA 4ILJA 4BR0A 3OY9A 3K59A 3VTHA 4MO5A 4Z4FA 3CI5A 4FLVA 5AQOA 5AQLA 3CETA 5LMNK 1YT3A 5AQZA 3HRGA 4BRDA 4CJQA 3VENA 2PYJA 3TI0A 4OGCA 1X9JA 4BDYA 2HBKA 3QERA 1WAFA 1YJWN 5K14A 5AQVA 5LJWA 1VQ9N 1JLFA 3WXKA 4EZ6A 5J2NA 4OJRA 4FJJA 4CJEA 4DF8A 3GL1A 3VA0A 1S5JA 4E89A 4BRIA 4BRAA 4NB4A 3TU5A 4FK0A 3CCJN 3SLCA 3VF4A 5BN8A 1NLVA 4E7HA 4KHNA 3V9XA 3THYA 2GBZA 4GV9A 1ASWA 1GLAG 4I9QA 1MA9B 4F8RA 3D0PA 1U2VB 4DLGA 4IJAA 4CFDA 2HHTA 5J1EA 5BR8K 5FPMA 4GKJK 4RWTA 3KWIA 1KLNA 4DV3K 3ZYYX 4JD2A 1VRTA 4K42A 1QZ5A 3L3VA 4DV4K 2O8CB 2HBMA 2ZGYA 1NOYA 4BY9C 2RKIA 3R3LA 3OJSA 4BRPA 4X64K 2P5OA 1RT3A 3HPGA 3ZSZA 1QVGM 4DU3A 4AHSA 4FK2A 2HHXA 3IKMA 1P90A 2D0OA 3VESA 1I39A 5CZ2A 3AA2A 4ELTA 4BWMA 2D0PA 3LM2A 2ETJA 1NGHA 3NGZA 1HPMA 1Z26A 2NUBA 4LSLA 3RMCA 1U48A 1QHTA 1KAZA 2YJFA 4CJTA 4BG8A 3AVIA 3RMAA 3PO4A 4KV8A 3DM2A 2A6AA 4DQSA 3AV9A 4FM2A 2KFZA 4CW7B 5GIOA 1IO2A 1SL1A 3FLCO 1NM1A 1N33K 4O4GA 1N8RO 4J2EA 4LH4A 1UA1A 3MWTA 4FZXC 2YKMA 3G25A 2P9PA 4DS5A 3VPZA 4NYFA 2IC3A 2YKNA 3AO5A 4BRHA 4OKEA 1WN7A 4LC9B 2FF6A 3AVJA 1LAWA 3U8XA 3TAFA 1MU2A 4CJWA 3KWGA 2PYLA 1J5OA 3M3ZA 3AVMA 1U49A 3CM5A 3ZSXA 3VEYA 4KHYA 3IS9A 4B08A 5M1FA 4CCHA 1J9AA 3L2WA 1J5EK 5LY3A 3BP8A 1Q18A 1YVNA 4KHQA 1BWFO 1JCGA 2BGGA 2QWLA 1ZXOA 2YNGA 1KVBA 1HNIA 4BRNA 4JI4K 4GMJB 4IG0A 2JWLA 3TSUA 1NJIO 3U9ZA 2WONA 4BGBA 4KTQA 2F8TA 5KRTA 4FLZA 3OYNA 1X9WA 1Q9YA 2A3ZA 5BRHA 4ID1A 4DTUA 2YV0X 4C23A 4ISFA 4DTNA 1HNXK 3G6EN 5TKYA 2F4VK 3DLRA 2PZSA 4JI5K 4I2PA 4BR5A 3T3FA 1HJOA 4B9LA 5HLFA 3ALYA 3DOKA 4R5PA 3F5TA 2D4WA 1WOQA 1I94K 4CGHA 3PX0A 1KVCA 4N41A 4YORA 1S1WA 1ATNA 1C0GA 1YXQA 3VQPA 2IIRA 2FLOA 1JLQA 5TKWA 3AVLA 3EKUA 3SJJA 1NK5A 2JWKA 4KI4A 3I56N 4CBUA 1TAUA 3QEVA 3C95A 4CF0A 3WXLA 3ASMA 3IMXA 1KD1O 2OYQA 1L3VA 1RDUA 3O9UA 1SL2A 5HRNA 2O8EA 3H1VX 4RTFD 5F1XA 3CQXA 3CC4N 3OYGA 3ZCMA 2VQFK 4JHDB 1SKWA 3LDPA 5F2RA 1XWLA 2P9LA 4HWIA 1BGXT 3SMSA 4HUEA 3MMVA 5JS1A 4E1MA 4DMNA 4AHVA 4DFPA 4DTXA 2QKBA 3KTQA 2A1RA 3ENOA 3HVRA 2YHWA 4A59A 4GW6A 1WSJA 3S3MA 4C8MA 2RN2A 4L3QA 2G8HA 4Y1DA 3VQEA 3WXMB 3HBTA 4BACA 5AQJA 1QZ6A 1M90O 3Q7CA 4FJ7A 4CGIA 4DFKA 1RCHA 4CZEA 3OTOK 3D2FA 4DR7K 1NOZA 4C8LA 2YHAA 4LSNA 2HNYA 3AGKA 4EP5A 1VSJA 4JKEA 2YNHA 2Y1JA 1VQON 3BZCA 1XHZA 3T1AA 1QQOA 3GE1A 1I3AA 3KLEA 1EKEA 4YOXA 5LL6Z 1EETA 4HTLA 4W5QA 1ESVA 3THYB 4ISGA 4FO0A 5BN9A 1B92A 3SAHA 1RBVA 1GLEG 3OYBA 2RPIA 2E6MA 4TSXA 2P9NA 3THWA 5JLHA 1GLLO 2A1SA 5BPMA 4JD2B 3K0SA 3WT0A 1WLJA 4FJ9A 2Q0UA 4AILC 3WNHA 1SL0A 2CGLA 1KCFA 1B9FA 4B1VA 3PO5A 3NMUA 2GEMA 1ZBUA 3CD6N 2OPSA 3WUHA 5AQUA 1E4FT 2HF3A 4FM1A 4RG8A 3V9WA 3O3FA 2HB5A 1RBSA 3TTFA 1W0HA 1R59O 3QICA 2BANA 4Z94A 1IBLK 4BGAA 4CGGA 1ZYQA 2HHUA 3QFUA 1K73O 3MDQA 3O3GA 4F2RA 4FWRA 1NGAA 5KQ8A 3VN5A 4H5WA 2QW9A 1IKXA 2NRVA 3CG7A 3D6RA 5J2QA 3PIOL 3LP2A 1C0UA 3AVHA 3AVNA 4CECA 3LL3A 5CY4A 1HQEA 2W41A 3OYMA 1V4TA 4JKAA 1XNQK 2FBVA 4DV1K 5AQWA 4YOTA 4FZYA 1IKVA 2GTDA 5E41A 2W6KA 1KLMA 5M1OA 4DG1A 2XRIA 1LV5A 2P9UA 1RT2A 4CZIA 1LOTB 5C12A 3E01A 3KK3A 4FCYA 2D0CA 1JLAA 2AA4A 1NK9A 4DV7K 1GLJO 4DR5K 2QWOA 4WQ5A 2H3GX 5FLXO 5HOOA 2A42A 2W40A 3TSPA 4IO8A 5GINA 4C1NI 3VEVA 3O4QA 1VQPN 2YJEA 4EHTA 3MCAB 3LP3A 5JS2A 4YNQA 5C10A 2V52B 3SPYA 3QDKA 4IWVA 3ZT2A 4AHUA 1NGGA 2IGIA 4K8ZA 3HT3A 4JI8K 4UY8O 3VEWA 2FXUA 4DUYK 4JNEA 5HBMA 2HSTA 3SMPA 4KB0A 4F3OA 4DSFA 3V81A 1DGKN 1RT5A 3PV8A 1WBDA 4LF4K 2F9WA 4PY5A 2GELA 3CJ9A 1VQNN 2O8FB 2Q2RA 1B9DA 4XH5A 2A41A 1T3VA 5ADXA 4M3UA 5AQGA 3B8AX 4PKHA 4DU4A 4MQ3A 3S3NA 3VEXA 4KBOA 1NGJA 2E2PA 2KLAA 1YITN 4FW1A 2QI2A 5FDLA 2XHBA 4B1WB 3DRSA 2NNWA 4MDAA 3VQ5A 2E2QA 4CEBA 1G15A 4NCAA 3KK1A 5AJ3K 3LDQA 4LH5A 3ZSRA 3O1BA 4KHUA 2CH5A 3O80A 4JI7K 1RTJA 3OW2M 4IEEA 3VERA 4M7XA 1K8KA 5JVGL 1RDWX 1NK8A 3CCLN 1QTMA 4N76A 3CQYA 4H8KA 4JI3K 4H0PA 4H4MA 3QETA 3P83D 4A2AA 1X9SA 1WSGA 3BF3A 4JLHA 2JGUA 1YTUA 2X6SA 2XY7A 1XMQK 3JS6A 1QSLA 1O1WA 5E26A 3D2FB 3IAYA 2HHQA 3UIQA 1RBTA 1NJZA 2P9SA 3SQ0A 3CFPA 2I7PA 3MEDA 3VMFB 3UKRB 3NF8A 4EHUA 3JYTA 3H45C 4AH9A 3K5MA 1HQUA 1BOTO 4B3OA 1IBKK 3AVFA 4N5SA 3SI6A 3VQ7A 1FK9A 5E84A 4RW8A 4CJFA 1LW0A 2I7NA 3UB5A 3TANA 3UKUA 4Z4EA 3K9JA 4B8AB 1QQNA 4PA1A 1L3UA 4WQ5C 4BVOA 2P9NB 1KXPA 2YNFA 2QWPA 1ILYA 1S22A 4JS5A 4XIUA 4BE0A 3QMLA 1NGIA 4KTZA 3VGLA 2X6NA 4E19A 3EZWA 1RBUA 3A2FA 3ZT4A 2X74A 3CC7N 1IV0A 4B9NA 4JAXA 1Q82O 1TUUA 1KTQA 4BRLA 3MXJA 3ZX2A 3J7YP 1GOBA 5KGXA 1GLCG 1BQMA 3TARA 1TL1A 3NF9A 1HKCA 3SV4A 3A0IX 4CJ7A 4ILHA 4JKDA 3HP6A 1CXUA 1C1BA 3OYEA 3DXKB 1YF5L 5CR4A 3AA5X 3H3NO 4B9QA 3KZBA 4JI6K 3CCSN 1RTHA 2FF3B 4GY2B 1F21A 4CF2A 4DTRA 4E0DA 4WYBA 2P9UB 4JK7A 3L8BA 3DLBA 3EEQA 3IDHA 3SPZA 5EVZA 2WBNA 3ZSOA 4GKKK 1JJ2M 3CCRN 3O1WA 4CZLA 4DS4A 1VSFA 4CJ5A 5M1PA 2NRZA 2Z1GA 5B8HA 3DWLA 3HI0A 4YY3K 4RCHA 2KQ2A 3JSMA 3CCQN 3IRXA 2DPNA 3M6GA 1K6YA 3BUZB 3THXA 1RFQA 4CHZA 1JLGA 2HBLA 4H4OA 2OPRA 4FVMA 3OYKA 1C0TA 4CK1A 4CFCA 3RSEA 3JXUA 4EP4A 3EZ5A 2OTJN 1IH7A 3ZLJA 2B4JA 2YHBA 2FSNA 3CM6A 5AFUH 4ZTJA 1J6ZA 2VWBA 3VQ4A 3IFRA 4OVLA 1U47A 1V4SA 1HNWK 1G99A 4DR6K 1BCOA 4JN4A 2V7ZA 4XH4A 5AZIA 4DFMA 5AQSA 3OBYA 3OHRA 3K57A 1BA0A 1WSFA 2NRWA 3A5NC 5JLFA 4CF1A 1GLFO 4CHOA 3HP9A 2E4LA 4ELVA 3RWUA 4IOXA 2XO7A 5FPNA 3WQUA 2RHKA 2ASMA 4QOZB 5BREA 3WNGA 1JXEA 2F8SA 2BE2A 4JKFA 1IBMK 5BPNA 3PSIA 3F9KA 2QM1A 4OPAA 4FLWA 2OZSA 4JYAK 4CEFA 4WCEL 4CHQA 4KFBA 1DT9A 3QO9A 1BA1A 4IZ9A 3KVGA 1LCUA 2KHOA 4CFBA 4JKBA 1QVFM 5H1SQ 5AQIA 1OH6A 2NLXA 2IS3A 1SV5A 2P9SB 3SK3A 3C94A 2ZF5O 3KK2A 4JI1K 4LF6K 1T05A 4LD0A 1W9HA 3KLGA 5FPEA 5GAEP 3A5OC 4FLTA 5HRPA 3C65A 2IVPA 1VQMN 5AQXA 3O9QA 2FSJA 2ZQBA 3E9LA 3NCIA 1T44A 1LW2A 3DJCA 3U3YA 1NGEA 1Y64A 1GLDG 3KLHA 2A5XA 2QXLA 2BDPA 2AP1A 4CIEA 1RDAA 3AA3A 3KK7A 3PSFA 4CZFA 4RW7A 3ZSQA 2YI1A 3O4WA 2F96A 1NK0A 1KVAA 4BROA 3O6WA 1O13A 4CEQA 4AM6A 1HPZA 1WBBA 2W42A 2WUSA 2NRXA
chains in the Genus database with same CATH topology
4M42A 3HJFA 4CGGA 4CJPA 3NBPA 1ZYQA 2HHUA 2KZZA 4CEEA 3O3HA 4NCBA 4FW2A 4CEAA 3O3GA 4F2RA 1U4BA 2IOCA 3VN5A 4DLEA 3VQ8A 3PX4A 2I5JA 1NKCA 1HYZA 3HSTB 4W5RA 3OYDA 3THVA 1IKXA 4KTWA 1J53A 3CG7A 3NF7A 4RW4A 3MXMA 2O4IA 5C24A 5J2QA 3SUQA 4Z0UA 4RW9A 3LP2A 3OYFA 1C0UA 3LZIA 4DU1A 1BISA 1JKHA 4W5TA 3AVHA 3AVNA 4CECA 1BI4A 1TVRA 4OKJA 5CY4A 4CGFA 3VQDA 1VSEA 1IKYA 3FFIA 1HQEA 3OYMA 3TAEA 3SUPA 3SNNA 3NF6A 3OYLA 1S9GA 5HP1A 4KAZA 4KKOA 3RMDA 4FM0A 2FBVA 3H08A 4FJMA 4FZYA 1GOCA 1IKVA 5E41A 3NE6A 4DG1A 1KLMA 4E7JA 2XRIA 1LV5A 5KGWA 1RT2A 3QEPA 4FJGA 2X78A 3E01A 3KK3A 2ZE2A 4FCYA 2OPQA 2D0CA 3VQAA 1JLAA 3DMJA 4FJ5A 4M3XA 1NK9A 4PUOA 1NK7A 4C8NA 4DTJA 3TAGA 2LSNA 2KW4A 3NAEA 1LWFA 1RT4A 2Z1HA 3G0ZA 1Y97A 3DYAA 1NK4A 4DSKA 1ZBHA 4O55A 1TKZA 5KTQA 5D3GA 3O4QA 3KKSA 3OS2A 1VRUA 3DOLA 3QIPA 4Q0BA 3L2RA 4FJLA 3BDPA 2XY8A 4M3YA 1DLOA 2EX3A 4CJSA 4DTMA 3LP3A 5JS2A 1C6VA 1HNVA 2Q3SA 4YNQA 3LWLA 4FLUA 1R0AA 3LP0A 1RDBA 2D0AA 2OPPA 3SPYA 1L5UA 4OLAA 3K5OA 3NH0A 4DFJA 2B5JA 2PY5A 4K8ZA 3SQ4A 1QSSA 3ZT2A 4CIFA 3TABA 3LANA 4I7FA 5HRRA 3SYZA 4C8OA 4L8RB 2ATQA 3ITHA 2IGIA 3DI6A 4AHUA 3O4NA 3V9ZA 3RMBA 3HT3A 3RR7A 3RRGA 3KD5E 4HCCA 5SWMA 3LZJA 3M8RA 2FBYA 3OS1A 3L3UA 3RR8A 1CLQA 2KFZA 5HBMA 3V6DA 4KB0A 2KFNA 4KREA 1RBRA 4F3OA 4DSFA 3V81A 4LY7A 3U3GA 3DLEA 1TK0A 1YVUA 3AO4A 3SUNA 1RT5A 1NKEA 1LWEA 1QQCA 3PV8A 4FJHA 4J2BA 2R7YA 3I0RA 3ZT1A 3DRPA 1JL1A 4CE9A 3V1QA 4PY5A 5J2MA 2HVHA 2Y1IA 1VK0A 3AO1A 2P5GA 1B9DA 4AHCA 3HM9A 1A5VA 1NK6A 1FXXA 2G8WA 1VSDA 2DFEA 4DSJA 3KJVA 4OGEA 1JL2A 4M3UA 4CK2A 3LWMA 2G8FA 3NHGA 1RDDA 4DU4A 3B6OA 4N56A 1VSIA 1U04A 4MQ3A 3L2UA 1D8YA 3ZT0A 5KI6A 2VG7A 1DTTA 3S3NA 3KKRA 1Q8IA 4CEZA 4OPJA 2QKKA 4M3WA 4CJ3A 3HPOA 4DTPA 1J54A 1TKXA 4FW1A 4Y1CA 4DWIA 3ZSYA 2O4GA 5FDLA 4HHTA 3TWHA 4KHSA 1S1TA 1RDCA 2XHBA 1WSHA 3PY8A 3DRSA 2OA8A 4HCBA 3SQ1A 2KZMA 3VQ5A 1ASUA 4CEBA 1G15A 4B8CA 1HYVA 4NCAA 4CJLA 3KK1A 4CFAA 1EXQA 3SCXA 4I9LA 4LH5A 3LALA 3ZSRA 5HRSA 3QIOA 1NJYA 1RTIA 4HVJA 4OKKA 1UA0A 1VSKA 4KHUA 4CGJA 4CERA 1RTJA 4B9TA 4KRFA 1NKBA 3P1GA 4FJIA 4NCGA 1NK8A 5T7BA 2QK9A 3M8SA 4N47A 4YFUA 4FK4A 4HUFA 2OZMA 3V1RA 1QTMA 1TKTA 4N76A 3OY9A 3K59A 3OJUA 2VWKA 4H8KA 4E7IA 4H4MA 3QETA 4Z4FA 3P83D 4OLBA 4FLVA 1TGOA 1X9SA 2QXFA 1WSGA 4ZHRA 3L2VA 2XY5A 4JLHA 4CESA 2JGUA 2ZD1A 1S9EA 2Z1JA 2X6SA 4FZZA 1YTUA 1YT3A 2IDOA 4CJQA 2XY7A 2G8KA 3KLFA 1BHLA 2PYJA 4B9MA 1A5WA 3TI0A 4DTSA 4OGCA 5SZTA 1O1WA 1QSLA 3IAYA 2HHQA 5KRSA 4BDYA 3UIQA 2ITGA 3SV3A 1RBTA 3QERA 1WAFA 4CEOA 4DQPA 4J2DA 2DTUA 1NJZA 1RT6A 5K14A 1SKRA 1WSEA 5DK5A 1JLFA 3CFPA 4EZ6A 2DFFA 3MEDA 5J2NA 4OJRA 4FJJA 4I2QA 2P1JA 4CJEA 4Q5VA 4DF8A 3VA0A 3NF8A 1S5JA 4E89A 3JYTA 3NH1A 1HYSA 4AH9A 3K5MA 3TAQA 1HQUA 1KRPA 3L2QA 4B3OA 4PQUA 4FK0A 1WNSA 3AVFA 4CJVA 4N5SA 1UOCA 3SI6A 1U45A 3VQ7A 1FK9A 4E7HA 4KHNA 4ID5A 3OYIA 3HVTA 4IG3A 3V9XA 5FRNA 1VSLA 4RW8A 3D45A 2VG5A 3K5LA 4CJFA 3MAQA 3CFRA 2GBZA 1ASWA 1WAJA 1LW0A 4I9QA 3TANA 4F8RA 4KB1A 3D0PA 1Z25A 3CYMA 4DLGA 3PX6A 4CFDA 4Z4IA 4Z4EA 5J1EA 2HHTA 4B8AB 4PA1A 1L3UA 3S3OA 4IBNA 4ICLA 1KLNA 4DSIA 2YNFA 1VRTA 3L3VA 4JS5A 5I42A 4XIUA 4BE0A 1NOYA 1HMVA 1N5YA 2RKIA 1LAVA 3OJSA 2P5OA 1RT3A 3AO2A 4KTZA 5CZ1A 2X6NA 4E19A 1CXQA 3HPGA 3ZSZA 1RBUA 4DU3A 3A2FA 3RRHA 1NJWA 4G1QA 4AHSA 1X1PA 3ZT4A 3TAPA 4FK2A 2HHXA 2HVIA 2X74A 1ZBLA 4B9NA 1QSYA 4ELTA 1I39A 5CZ2A 3AA2A 3ZSWA 2XY6A 4BWMA 3AVKA 4M3TA 2ETJA 2DY4A 1BCMA 3NGZA 3AVCA 3V4IA 1Z26A 1KTQA 2NUBA 2EHGA 1XHXA 4LSLA 3MXJA 3RMCA 3SQ2A 1U48A 1QHTA 1GOBA 2JLEA 3WNFA 5KGXA 3HO1A 1BQMA 4CJTA 3TARA 3AVIA 3RMAA 3PO4A 4C8KA 3DLGA 2GUIA 3DM2A 4KV8A 4M41A 4DQSA 3AV9A 4FM2A 1TL1A 1RT7A 3NF9A 3QNNA 1S6PA 1A5XA 2FC0A 3MEGA 1IO2A 3K58A 4BDZA 1XI1A 1SL1A 1RTDA 3WNEA 4HUGA 4O4GA 5DMRA 2E6LA 3K5NA 4LH4A 3SV4A 4J2EA 4FJNA 1UA1A 1EX4A 3C6TA 3QEWA 4FZXC 3HP6A 2YKMA 3B6PA 3VQ9A 2FBXA 3AVGA 1CXUA 4KI6A 4Z4GA 1FKOA 4BWJA 4CJUA 4DS5A 4FJXA 1C1BA 4NYFA 5CYMA 3OYEA 2IC3A 4CJKA 1BI4B 4E3SA 2GV9A 3AA5X 1DTQA 2D5RA 1EP4A 1VSHA 2YKNA 3AO5A 4ELUA 4OKEA 5J2PA 4F2SA 2AJQA 3LAKA 1WN7A 4DF4A 2WOMA 4NYNA 1RTHA 4CEDA 3AVJA 3HL8A 1F21A 1KFDA 1LAWA 1REVA 1RNHA 3VQCA 4E1NA 4CF2A 1MU2A 4DTRA 4CJWA 3TAFA 4E7LA 4B9VA 1IG9A 3AO3A 2PYLA 1J5OA 3NDKA 3L8BA 2G8VA 3DLBA 3S9HA 4FXDA 3AVMA 1U49A 1KFSA 1S1VA 3CM5A 3ZSXA 3SPZA 3ZSOA 1RT1A 4KHYA 3IS9A 4B08A 5HROA 4CCHA 1SUQA 1J9AA 3OS0A 3HK2A 4DS4A 3IG1A 3L2WA 1VSFA 4CJ5A 3QEXA 2Z1GA 1S6QA 1QS4A 1C1AA 2DFHA 3LP1A 1T7PA 4MFBA 3DLKA 2FBTA 4DSEA 4KHQA 2BGGA 3ISNC 4FLYA 3JSMA 2KQ2A 2YNGA 3BGRA 3IRXA 1KVBA 1HNIA 1K6YA 1T03A 3PUFA 4GMJB 4IG0A 4M3RA 4M3ZA 1TKDA 1VSMA 2WONA 3DRRA 4KTQA 4CHZA 1JLGA 1RILA 2F8TA 4H4OA 4DQIA 2OPRA 4FVMA 3OYKA 5KRTA 4FLZA 3OYNA 1X9WA 1Q9YA 4ID1A 4DTUA 1C0TA 2YV0X 4CK1A 4CJRA 4GVMA 4CFCA 4DTNA 1D9DA 4EZ9A 2G8IA 1ASVA 2VG6A 4FJKA 4EP4A 3EZ5A 3DLRA 1IH7A 2PZSA 4FJ8A 3HXMA 4I2PA 2B4JA 2YHBA 3CM6A 3OYCA 3T3FA 1JLCA 4M45A 2D0BA 4ZTJA 4B9LA 4WE1A 4CGDA 3VQ4A 2VWJA 4OVLA 5HLFA 1U47A 2HHWA 1TV6A 3ALYA 3DOKA 2HW3A 4R5PA 1KSPA 3RTVA 4CHPA 1BCOA 4DFMA 4CGHA 4HTUA 3PX0A 1KVCA 4N41A 1GOAA 3K57A 1S1WA 3KLIA 4W5OA 4ZTFA 5FRMA 1WSFA 1UAXA 5C42A 3ULDA 3NGIA 1S1UA 3VQPA 3NFAA 3M8QA 3F73A 1IKWA 1JLQA 3SJJA 3AVLA 4CF1A 1NK5A 1TK8A 4KI4A 4CHOA 3VQ6A 3HP9A 4CIGA 3HPHA 1TAUA 2E4LA 3QEVA 3C95A 4CF0A 3MXIA 3ASMA 4ELVA 2Z1IA 3RWUA 4IFVA 1ITGA 4E0DA 2OYQA 3KD1E 2XO7A 1BIUA 4CHYA 2HHSA 3AVAA 4Z4HA 3OYJA 1L3VA 4QOZB 2B6AA 1SL2A 3KIOA 3WNGA 1JXEA 1ZBIA 2F8SA 5HRNA 3EYZA 2BE2A 1D5AA 3G10A 1HJRA 1TL3A 4F4KA 3OYGA 3ZCMA 3F9KA 4O44A 3AA4A 3SZ2A 1SKWA 4BE2A 3NH2A 1XWLA 4HUEA 5JS1A 1BGXT 4IDKA 2IAJA 4E1MA 4DMNA 4FLWA 4QAGA 4AHVA 2OZSA 4DFPA 3OYAA 4JRPA 4DTXA 2QKBA 4E7KA 4AHRA 3KTQA 2A1RA 4CEFA 4JRQA 4CHQA 3HVRA 3LPUA 2HNDA 4KFBA 3QEIA 3ZT3A 3QO9A 1LWCA 3V9UA 3QNOA 2HMIA 1TAQA 3K2PA 4GW6A 1WSJA 3S3MA 4C8MA 2RN2A 2RF2A 2G8HA 4Y1DA 3DLHA 4CFBA 3VQEA 3EY1A 4BACA 4W5NA 4FJ7A 4CGIA 4DFKA 1RCHA 1FKPA 1BL3A 1NJXA 4K8XA 1SKSA 1NOZA 4C8LA 2YHAA 1S1XA 4LSNA 2HNYA 2HHVA 4CJ4A 4EP5A 1WSIA 3MECA 3V9SA 4BDPA 2IS3A 4JS4A 1C0MA 1HRHA 1JXBA 1VSJA 1L3TA 2KTQA 1SV5A 2YNHA 3C6UA 4CF8A 4Z4CA 3C94A 1T8EA 4KHWA 2Y1JA 2HNZA 1JLEA 3VQBA 3P5JA 3KK2A 3OYHA 1XHZA 3LDSA 3T1AA 1BIZA 4FYDA 1C1CA 4O5BA 5I3UA 1T05A 3LPTA 2YNIA 1I3AA 3KLEA 4LD0A 1W9HA 1EKEA 5FROA 3KLGA 3NGYA 3QESA 3HYFA 3VA3A 3TR8A 3AVBA 1X9MA 1EETA 3CQ8A 4W5QA 3SUOA 4FLTA 4IKFA 3MEEA 4CK3A 5HRPA 3OVNA 4CHNA 2G8UA 4QCLA 1CZ9A 1B92A 3OYBA 1RBVA 4DSLA 1L3SA 1XC9A 3V1OA 2RPIA 4DTOA 2E6MA 3I0SA 2ZQBA 4TSXA 4J2AA 5C25A 4O0IA 3I8DA 2A1SA 3LAMA 3NCIA 4B9SA 1LW2A 3U3YA 3U6FA 4UQGA 1D9FA 2P51A 1TK5A 1WLJA 1CZBA 5CYQA 3KLHA 4FJ9A 1ZBFA 4OPKA 2BDPA 3QLHA 4DQQA 4KO0A 3VQQA 1JLBA 4AILC 4RW6A 4CIEA 1RDAA 3AA3A 3WNHA 4FLXA 4DQRA 1SL0A 1Q9XA 1KCFA 1B9FA 5EU7A 4RW7A 3ZSQA 3PO5A 3QINA 4CF9A 1BQNA 4B9UA 1QE1A 2F96A 1N6QA 4O0JA 1NK0A 1KVAA 3M8PA 4BE1A 1ZBUA 2OPSA 4F3TA 1YTAA 4CEQA 4FM1A 4RG8A 4IFYA 3V9WA 4PWDA 1HPZA 4AHTA 2HB5A 1RBSA 3O3FA 1W0HA 1UWBA 3T19A 3CFOA 3TAMA 4KPYA 2W42A 3ZSVA 3SQ0A 2BANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M42 A;  3HJF A;  4CGG A;  4CJP A;  3NBP A;  1ZYQ A;  2HHU A;  2KZZ A;  4CEE A;  3O3H A;  4NCB A;  4FW2 A;  4CEA A;  3O3G A;  4F2R A;  1U4B A;  2IOC A;  3VN5 A;  4DLE A;  3VQ8 A;  3PX4 A;  2I5J A;  1NKC A;  1HYZ A;  3HST B;  4W5R A;  3OYD A;  3THV A;  1IKX A;  4KTW A;  1J53 A;  3CG7 A;  3NF7 A;  4RW4 A;  3MXM A;  2O4I A;  5C24 A;  5J2Q A;  3SUQ A;  4Z0U A;  4RW9 A;  3LP2 A;  3OYF A;  1C0U A;  3LZI A;  4DU1 A;  1BIS A;  1JKH A;  4W5T A;  3AVH A;  3AVN A;  4CEC A;  1BI4 A;  1TVR A;  4OKJ A;  5CY4 A;  4CGF A;  3VQD A;  1VSE A;  1IKY A;  3FFI A;  1HQE A;  3OYM A;  3TAE A;  3SUP A;  3SNN A;  3NF6 A;  3OYL A;  1S9G A;  5HP1 A;  4KAZ A;  4KKO A;  3RMD A;  4FM0 A;  2FBV A;  3H08 A;  4FJM A;  4FZY A;  1GOC A;  1IKV A;  5E41 A;  3NE6 A;  4DG1 A;  1KLM A;  4E7J A;  2XRI A;  1LV5 A;  5KGW A;  1RT2 A;  3QEP A;  4FJG A;  2X78 A;  3E01 A;  3KK3 A;  2ZE2 A;  4FCY A;  2OPQ A;  2D0C A;  3VQA A;  1JLA A;  3DMJ A;  4FJ5 A;  4M3X A;  1NK9 A;  4PUO A;  1NK7 A;  4C8N A;  4DTJ A;  3TAG A;  2LSN A;  2KW4 A;  3NAE A;  1LWF A;  1RT4 A;  2Z1H A;  3G0Z A;  1Y97 A;  3DYA A;  1NK4 A;  4DSK A;  1ZBH A;  4O55 A;  1TKZ A;  5KTQ A;  5D3G A;  3O4Q A;  3KKS A;  3OS2 A;  1VRU A;  3DOL A;  3QIP A;  4Q0B A;  3L2R A;  4FJL A;  3BDP A;  2XY8 A;  4M3Y A;  1DLO A;  2EX3 A;  4CJS A;  4DTM A;  3LP3 A;  5JS2 A;  1C6V A;  1HNV A;  2Q3S A;  4YNQ A;  3LWL A;  4FLU A;  1R0A A;  3LP0 A;  1RDB A;  2D0A A;  2OPP A;  3SPY A;  1L5U A;  4OLA A;  3K5O A;  3NH0 A;  4DFJ A;  2B5J A;  2PY5 A;  4K8Z A;  3SQ4 A;  1QSS A;  3ZT2 A;  4CIF A;  3TAB A;  3LAN A;  4I7F A;  5HRR A;  3SYZ A;  4C8O A;  4L8R B;  2ATQ A;  3ITH A;  2IGI A;  3DI6 A;  4AHU A;  3O4N A;  3V9Z A;  3RMB A;  3HT3 A;  3RR7 A;  3RRG A;  3KD5 E;  4HCC A;  5SWM A;  3LZJ A;  3M8R A;  2FBY A;  3OS1 A;  3L3U A;  3RR8 A;  1CLQ A;  2KFZ A;  5HBM A;  3V6D A;  4KB0 A;  2KFN A;  4KRE A;  1RBR A;  4F3O A;  4DSF A;  3V81 A;  4LY7 A;  3U3G A;  3DLE A;  1TK0 A;  1YVU A;  3AO4 A;  3SUN A;  1RT5 A;  1NKE A;  1LWE A;  1QQC A;  3PV8 A;  4FJH A;  4J2B A;  2R7Y A;  3I0R A;  3ZT1 A;  3DRP A;  1JL1 A;  4CE9 A;  3V1Q A;  4PY5 A;  5J2M A;  2HVH A;  2Y1I A;  1VK0 A;  3AO1 A;  2P5G A;  1B9D A;  4AHC A;  3HM9 A;  1A5V A;  1NK6 A;  1FXX A;  2G8W A;  1VSD A;  2DFE A;  4DSJ A;  3KJV A;  4OGE A;  1JL2 A;  4M3U A;  4CK2 A;  3LWM A;  2G8F A;  3NHG A;  1RDD A;  4DU4 A;  3B6O A;  4N56 A;  1VSI A;  1U04 A;  4MQ3 A;  3L2U A;  1D8Y A;  3ZT0 A;  5KI6 A;  2VG7 A;  1DTT A;  3S3N A;  3KKR A;  1Q8I A;  4CEZ A;  4OPJ A;  2QKK A;  4M3W A;  4CJ3 A;  3HPO A;  4DTP A;  1J54 A;  1TKX A;  4FW1 A;  4Y1C A;  4DWI A;  3ZSY A;  2O4G A;  5FDL A;  4HHT A;  3TWH A;  4KHS A;  1S1T A;  1RDC A;  2XHB A;  1WSH A;  3PY8 A;  3DRS A;  2OA8 A;  4HCB A;  3SQ1 A;  2KZM A;  3VQ5 A;  1ASU A;  4CEB A;  1G15 A;  4B8C A;  1HYV A;  4NCA A;  4CJL A;  3KK1 A;  4CFA A;  1EXQ A;  3SCX A;  4I9L A;  4LH5 A;  3LAL A;  3ZSR A;  5HRS A;  3QIO A;  1NJY A;  1RTI A;  4HVJ A;  4OKK A;  1UA0 A;  1VSK A;  4KHU A;  4CGJ A;  4CER A;  1RTJ A;  4B9T A;  4KRF A;  1NKB A;  3P1G A;  4FJI A;  4NCG A;  1NK8 A;  5T7B A;  2QK9 A;  3M8S A;  4N47 A;  4YFU A;  4FK4 A;  4HUF A;  2OZM A;  3V1R A;  1QTM A;  1TKT A;  4N76 A;  3OY9 A;  3K59 A;  3OJU A;  2VWK A;  4H8K A;  4E7I A;  4H4M A;  3QET A;  4Z4F A;  3P83 D;  4OLB A;  4FLV A;  1TGO A;  1X9S A;  2QXF A;  1WSG A;  4ZHR A;  3L2V A;  2XY5 A;  4JLH A;  4CES A;  2JGU A;  2ZD1 A;  1S9E A;  2Z1J A;  2X6S A;  4FZZ A;  1YTU A;  1YT3 A;  2IDO A;  4CJQ A;  2XY7 A;  2G8K A;  3KLF A;  1BHL A;  2PYJ A;  4B9M A;  1A5W A;  3TI0 A;  4DTS A;  4OGC A;  5SZT A;  1O1W A;  1QSL A;  3IAY A;  2HHQ A;  5KRS A;  4BDY A;  3UIQ A;  2ITG A;  3SV3 A;  1RBT A;  3QER A;  1WAF A;  4CEO A;  4DQP A;  4J2D A;  2DTU A;  1NJZ A;  1RT6 A;  5K14 A;  1SKR A;  1WSE A;  5DK5 A;  1JLF A;  3CFP A;  4EZ6 A;  2DFF A;  3MED A;  5J2N A;  4OJR A;  4FJJ A;  4I2Q A;  2P1J A;  4CJE A;  4Q5V A;  4DF8 A;  3VA0 A;  3NF8 A;  1S5J A;  4E89 A;  3JYT A;  3NH1 A;  1HYS A;  4AH9 A;  3K5M A;  3TAQ A;  1HQU A;  1KRP A;  3L2Q A;  4B3O A;  4PQU A;  4FK0 A;  1WNS A;  3AVF A;  4CJV A;  4N5S A;  1UOC A;  3SI6 A;  1U45 A;  3VQ7 A;  1FK9 A;  4E7H A;  4KHN A;  4ID5 A;  3OYI A;  3HVT A;  4IG3 A;  3V9X A;  5FRN A;  1VSL A;  4RW8 A;  3D45 A;  2VG5 A;  3K5L A;  4CJF A;  3MAQ A;  3CFR A;  2GBZ A;  1ASW A;  1WAJ A;  1LW0 A;  4I9Q A;  3TAN A;  4F8R A;  4KB1 A;  3D0P A;  1Z25 A;  3CYM A;  4DLG A;  3PX6 A;  4CFD A;  4Z4I A;  4Z4E A;  5J1E A;  2HHT A;  4B8A B;  4PA1 A;  1L3U A;  3S3O A;  4IBN A;  4ICL A;  1KLN A;  4DSI A;  2YNF A;  1VRT A;  3L3V A;  4JS5 A;  5I42 A;  4XIU A;  4BE0 A;  1NOY A;  1HMV A;  1N5Y A;  2RKI A;  1LAV A;  3OJS A;  2P5O A;  1RT3 A;  3AO2 A;  4KTZ A;  5CZ1 A;  2X6N A;  4E19 A;  1CXQ A;  3HPG A;  3ZSZ A;  1RBU A;  4DU3 A;  3A2F A;  3RRH A;  1NJW A;  4G1Q A;  4AHS A;  1X1P A;  3ZT4 A;  3TAP A;  4FK2 A;  2HHX A;  2HVI A;  2X74 A;  1ZBL A;  4B9N A;  1QSY A;  4ELT A;  1I39 A;  5CZ2 A;  3AA2 A;  3ZSW A;  2XY6 A;  4BWM A;  3AVK A;  4M3T A;  2ETJ A;  2DY4 A;  1BCM A;  3NGZ A;  3AVC A;  3V4I A;  1Z26 A;  1KTQ A;  2NUB A;  2EHG A;  1XHX A;  4LSL A;  3MXJ A;  3RMC A;  3SQ2 A;  1U48 A;  1QHT A;  1GOB A;  2JLE A;  3WNF A;  5KGX A;  3HO1 A;  1BQM A;  4CJT A;  3TAR A;  3AVI A;  3RMA A;  3PO4 A;  4C8K A;  3DLG A;  2GUI A;  3DM2 A;  4KV8 A;  4M41 A;  4DQS A;  3AV9 A;  4FM2 A;  1TL1 A;  1RT7 A;  3NF9 A;  3QNN A;  1S6P A;  1A5X A;  2FC0 A;  3MEG A;  1IO2 A;  3K58 A;  4BDZ A;  1XI1 A;  1SL1 A;  1RTD A;  3WNE A;  4HUG A;  4O4G A;  5DMR A;  2E6L A;  3K5N A;  4LH4 A;  3SV4 A;  4J2E A;  4FJN A;  1UA1 A;  1EX4 A;  3C6T A;  3QEW A;  4FZX C;  3HP6 A;  2YKM A;  3B6P A;  3VQ9 A;  2FBX A;  3AVG A;  1CXU A;  4KI6 A;  4Z4G A;  1FKO A;  4BWJ A;  4CJU A;  4DS5 A;  4FJX A;  1C1B A;  4NYF A;  5CYM A;  3OYE A;  2IC3 A;  4CJK A;  1BI4 B;  4E3S A;  2GV9 A;  3AA5 X;  1DTQ A;  2D5R A;  1EP4 A;  1VSH A;  2YKN A;  3AO5 A;  4ELU A;  4OKE A;  5J2P A;  4F2S A;  2AJQ A;  3LAK A;  1WN7 A;  4DF4 A;  2WOM A;  4NYN A;  1RTH A;  4CED A;  3AVJ A;  3HL8 A;  1F21 A;  1KFD A;  1LAW A;  1REV A;  1RNH A;  3VQC A;  4E1N A;  4CF2 A;  1MU2 A;  4DTR A;  4CJW A;  3TAF A;  4E7L A;  4B9V A;  1IG9 A;  3AO3 A;  2PYL A;  1J5O A;  3NDK A;  3L8B A;  2G8V A;  3DLB A;  3S9H A;  4FXD A;  3AVM A;  1U49 A;  1KFS A;  1S1V A;  3CM5 A;  3ZSX A;  3SPZ A;  3ZSO A;  1RT1 A;  4KHY A;  3IS9 A;  4B08 A;  5HRO A;  4CCH A;  1SUQ A;  1J9A A;  3OS0 A;  3HK2 A;  4DS4 A;  3IG1 A;  3L2W A;  1VSF A;  4CJ5 A;  3QEX A;  2Z1G A;  1S6Q A;  1QS4 A;  1C1A A;  2DFH A;  3LP1 A;  1T7P A;  4MFB A;  3DLK A;  2FBT A;  4DSE A;  4KHQ A;  2BGG A;  3ISN C;  4FLY A;  3JSM A;  2KQ2 A;  2YNG A;  3BGR A;  3IRX A;  1KVB A;  1HNI A;  1K6Y A;  1T03 A;  3PUF A;  4GMJ B;  4IG0 A;  4M3R A;  4M3Z A;  1TKD A;  1VSM A;  2WON A;  3DRR A;  4KTQ A;  4CHZ A;  1JLG A;  1RIL A;  2F8T A;  4H4O A;  4DQI A;  2OPR A;  4FVM A;  3OYK A;  5KRT A;  4FLZ A;  3OYN A;  1X9W A;  1Q9Y A;  4ID1 A;  4DTU A;  1C0T A;  2YV0 X;  4CK1 A;  4CJR A;  4GVM A;  4CFC A;  4DTN A;  1D9D A;  4EZ9 A;  2G8I A;  1ASV A;  2VG6 A;  4FJK A;  4EP4 A;  3EZ5 A;  3DLR A;  1IH7 A;  2PZS A;  4FJ8 A;  3HXM A;  4I2P A;  2B4J A;  2YHB A;  3CM6 A;  3OYC A;  3T3F A;  1JLC A;  4M45 A;  2D0B A;  4ZTJ A;  4B9L A;  4WE1 A;  4CGD A;  3VQ4 A;  2VWJ A;  4OVL A;  5HLF A;  1U47 A;  2HHW A;  1TV6 A;  3ALY A;  3DOK A;  2HW3 A;  4R5P A;  1KSP A;  3RTV A;  4CHP A;  1BCO A;  4DFM A;  4CGH A;  4HTU A;  3PX0 A;  1KVC A;  4N41 A;  1GOA A;  3K57 A;  1S1W A;  3KLI A;  4W5O A;  4ZTF A;  5FRM A;  1WSF A;  1UAX A;  5C42 A;  3ULD A;  3NGI A;  1S1U A;  3VQP A;  3NFA A;  3M8Q A;  3F73 A;  1IKW A;  1JLQ A;  3SJJ A;  3AVL A;  4CF1 A;  1NK5 A;  1TK8 A;  4KI4 A;  4CHO A;  3VQ6 A;  3HP9 A;  4CIG A;  3HPH A;  1TAU A;  2E4L A;  3QEV A;  3C95 A;  4CF0 A;  3MXI A;  3ASM A;  4ELV A;  2Z1I A;  3RWU A;  4IFV A;  1ITG A;  4E0D A;  2OYQ A;  3KD1 E;  2XO7 A;  1BIU A;  4CHY A;  2HHS A;  3AVA A;  4Z4H A;  3OYJ A;  1L3V A;  4QOZ B;  2B6A A;  1SL2 A;  3KIO A;  3WNG A;  1JXE A;  1ZBI A;  2F8S A;  5HRN A;  3EYZ A;  2BE2 A;  1D5A A;  3G10 A;  1HJR A;  1TL3 A;  4F4K A;  3OYG A;  3ZCM A;  3F9K A;  4O44 A;  3AA4 A;  3SZ2 A;  1SKW A;  4BE2 A;  3NH2 A;  1XWL A;  4HUE A;  5JS1 A;  1BGX T;  4IDK A;  2IAJ A;  4E1M A;  4DMN A;  4FLW A;  4QAG A;  4AHV A;  2OZS A;  4DFP A;  3OYA A;  4JRP A;  4DTX A;  2QKB A;  4E7K A;  4AHR A;  3KTQ A;  2A1R A;  4CEF A;  4JRQ A;  4CHQ A;  3HVR A;  3LPU A;  2HND A;  4KFB A;  3QEI A;  3ZT3 A;  3QO9 A;  1LWC A;  3V9U A;  3QNO A;  2HMI A;  1TAQ A;  3K2P A;  4GW6 A;  1WSJ A;  3S3M A;  4C8M A;  2RN2 A;  2RF2 A;  2G8H A;  4Y1D A;  3DLH A;  4CFB A;  3VQE A;  3EY1 A;  4BAC A;  4W5N A;  4FJ7 A;  4CGI A;  4DFK A;  1RCH A;  1FKP A;  1BL3 A;  1NJX A;  4K8X A;  1SKS A;  1NOZ A;  4C8L A;  2YHA A;  1S1X A;  4LSN A;  2HNY A;  2HHV A;  4CJ4 A;  4EP5 A;  1WSI A;  3MEC A;  3V9S A;  4BDP A;  2IS3 A;  4JS4 A;  1C0M A;  1HRH A;  1JXB A;  1VSJ A;  1L3T A;  2KTQ A;  1SV5 A;  2YNH A;  3C6U A;  4CF8 A;  4Z4C A;  3C94 A;  1T8E A;  4KHW A;  2Y1J A;  2HNZ A;  1JLE A;  3VQB A;  3P5J A;  3KK2 A;  3OYH A;  1XHZ A;  3LDS A;  3T1A A;  1BIZ A;  4FYD A;  1C1C A;  4O5B A;  5I3U A;  1T05 A;  3LPT A;  2YNI A;  1I3A A;  3KLE A;  4LD0 A;  1W9H A;  1EKE A;  5FRO A;  3KLG A;  3NGY A;  3QES A;  3HYF A;  3VA3 A;  3TR8 A;  3AVB A;  1X9M A;  1EET A;  3CQ8 A;  4W5Q A;  3SUO A;  4FLT A;  4IKF A;  3MEE A;  4CK3 A;  5HRP A;  3OVN A;  4CHN A;  2G8U A;  4QCL A;  1CZ9 A;  1B92 A;  3OYB A;  1RBV A;  4DSL A;  1L3S A;  1XC9 A;  3V1O A;  2RPI A;  4DTO A;  2E6M A;  3I0S A;  2ZQB A;  4TSX A;  4J2A A;  5C25 A;  4O0I A;  3I8D A;  2A1S A;  3LAM A;  3NCI A;  4B9S A;  1LW2 A;  3U3Y A;  3U6F A;  4UQG A;  1D9F A;  2P51 A;  1TK5 A;  1WLJ A;  1CZB A;  5CYQ A;  3KLH A;  4FJ9 A;  1ZBF A;  4OPK A;  2BDP A;  3QLH A;  4DQQ A;  4KO0 A;  3VQQ A;  1JLB A;  4AIL C;  4RW6 A;  4CIE A;  1RDA A;  3AA3 A;  3WNH A;  4FLX A;  4DQR A;  1SL0 A;  1Q9X A;  1KCF A;  1B9F A;  5EU7 A;  4RW7 A;  3ZSQ A;  3PO5 A;  3QIN A;  4CF9 A;  1BQN A;  4B9U A;  1QE1 A;  2F96 A;  1N6Q A;  4O0J A;  1NK0 A;  1KVA A;  3M8P A;  4BE1 A;  1ZBU A;  2OPS A;  4F3T A;  1YTA A;  4CEQ A;  4FM1 A;  4RG8 A;  4IFY A;  3V9W A;  4PWD A;  1HPZ A;  4AHT A;  2HB5 A;  1RBS A;  3O3F A;  1W0H A;  1UWB A;  3T19 A;  3CFO A;  3TAM A;  4KPY A;  2W42 A;  3ZSV A;  3SQ0 A;  2BAN A; 
#chains in the Genus database with same CATH topology
 4M42 A;  2HBJ A;  4GV3 A;  4CD3 A;  4CJP A;  4NCB A;  4FW2 A;  4CEA A;  1NMD A;  3VQ8 A;  4W5R A;  3THV A;  3W0L A;  4NXM K;  3SUQ A;  4Z0U A;  1VQL N;  3LZI A;  4DU1 A;  1BIS A;  1JKH A;  1BI4 A;  4CGF A;  3VQD A;  4IEI A;  4X66 K;  1IKY A;  3AAQ A;  3SNN A;  2UUB K;  1SAZ A;  3SUP A;  3NF6 A;  5BRF A;  5HP1 A;  3J81 O;  4KAZ A;  3RMD A;  4YHH K;  4FM0 A;  1SS6 A;  3H08 A;  3L4Q A;  4DQ8 A;  4R79 A;  1VQ8 N;  4PUO A;  4DTJ A;  4KH5 A;  1VQK N;  4FWS A;  3RVC A;  1LWF A;  5AQP A;  3HM8 A;  3NAE A;  2Z1H A;  3G0Z A;  4FWQ A;  2FSK A;  3CXC M;  3DYA A;  1NK4 A;  4OO1 J;  4O55 A;  1TKZ A;  1VRU A;  4X62 K;  4FJL A;  2EX3 A;  3M5R A;  4DTM A;  4H0X B;  1C6V A;  4XEI A;  3THX B;  3HZ6 A;  4BC2 A;  2D0A A;  4LF9 K;  4BRG A;  3NH0 A;  4DFJ A;  2PY5 A;  3SQ4 A;  1QSS A;  3TAB A;  3ITH A;  3DI6 A;  3RR7 A;  4O8U A;  3ZX3 A;  4HCC A;  3M8R A;  4B3S K;  3RR8 A;  4J8F A;  1CLQ A;  2ITM A;  1RBR A;  4LY7 A;  1YVU A;  3SJH A;  3T69 A;  3SUN A;  3EN9 A;  1NKE A;  1QQC A;  2O8B A;  2R7Y A;  3I0R A;  1EWQ A;  3ZT1 A;  3DRP A;  1JL1 A;  4CE9 A;  3V1Q A;  4FWN A;  5MLC Q;  3VEO A;  5J2M A;  2QWN A;  2Y1I A;  4O5F A;  3CHW A;  3CCV N;  3FR0 A;  3C7N A;  3I8B A;  3ZX0 A;  5AQH A;  4CK2 A;  3MN7 A;  3L4I A;  4N56 A;  1VSI A;  3L2U A;  3MX5 A;  3ZT0 A;  5KI6 A;  2VG7 A;  4DB3 A;  4CEZ A;  4OPJ A;  2QKK A;  3WXJ A;  4CJ3 A;  1BDG A;  3TWH A;  4KHS A;  2RE2 A;  1RDC A;  1WSH A;  3EO3 A;  1XQS C;  5AQR A;  3H46 O;  4HCB A;  4BRE A;  1ASU A;  5C15 A;  1TUY A;  4WQ4 A;  1W7A A;  4I9L A;  3LAL A;  5HRS A;  4WFN L;  4HVJ A;  1VSK A;  4JKG A;  1BUP A;  2QEX N;  4NCG A;  3R1X A;  1FJG K;  2QK9 A;  4HUF A;  3V1R A;  3ATU A;  2VGM A;  5GAG P;  4H0O A;  3OJU A;  3O9S A;  2VQE K;  4AF1 A;  2XY5 A;  4CES A;  5AR0 A;  5AQY A;  2ZD1 A;  2Z1J A;  3KLF A;  1XMO K;  3CIP A;  5KRS A;  3SV3 A;  4DQP A;  4J2D A;  1YIJ N;  2YHY A;  1SKR A;  2P9P B;  5AQM A;  4BQZ A;  5DK5 A;  2DFF A;  2ZJR L;  4Q5V A;  4BRM A;  2OTL N;  3R6M A;  3NH1 A;  4JK9 A;  1HYS A;  3TAQ A;  2P9K A;  4F9O A;  1KRP A;  4PQU A;  1UOC A;  2P9I A;  3PLA A;  4M7Y A;  1HKG A;  3CPE A;  5FRN A;  1VSL A;  3CFR A;  3MAQ A;  4QS7 A;  4A5B A;  3DLL L;  3J8A A;  1K8A O;  3C0B A;  1C0F A;  4KB1 A;  1Z25 A;  3CYM A;  3O08 A;  3SBG A;  3PX6 A;  4I6M A;  4KH6 A;  3H1Q A;  4DSI A;  3JAM O;  4CZH A;  3GG4 A;  2VCP A;  4MDB A;  3FZH A;  4BVP A;  4BRC A;  3AO2 A;  5CZ1 A;  4LFC K;  1BG3 A;  5CE3 A;  3HSC A;  3RRH A;  1X1P A;  2XY6 A;  3ZSW A;  3AVK A;  4PKG A;  4H5T A;  4M3T A;  2DY4 A;  1JCE A;  4JKH A;  2EHG A;  4FVU A;  1M1K O;  2JLE A;  3WNF A;  4EAH D;  3HO1 A;  3EE9 A;  1HLU A;  4M41 A;  3C6A A;  3IUC A;  1YAG A;  1RT7 A;  3QNN A;  1S6P A;  1A5X A;  3WXI A;  3MEG A;  3K58 A;  3ZEU A;  4BDZ A;  4HUG A;  5DMR A;  3F9M A;  3M1F A;  1EX4 A;  3C6T A;  2HOE A;  3WEE A;  3B6P A;  3VQ9 A;  4MLH A;  3AVG A;  4KI6 A;  1GLB G;  3CPW M;  1FKO A;  4FJX A;  2W6L A;  3FZM A;  1BI4 B;  2D5R A;  1EP4 A;  1VSH A;  2UYT A;  2AJQ A;  3LAK A;  5KPZ A;  2WOM A;  4NYN A;  4CED A;  1KFD A;  1REV A;  1RNH A;  4E1N A;  5LJV A;  1IG9 A;  3AO3 A;  3NDK A;  4YOU A;  3S9H A;  1KFS A;  5EOY A;  2O8E B;  3CC2 N;  1NMN A;  3TTC A;  1SUQ A;  2O8D A;  3HK2 A;  4DHY A;  2P9L B;  1C1A A;  2DFH A;  3LP1 A;  4WQ4 C;  2UU9 K;  1T7P A;  3VGK A;  2FBT A;  3S41 A;  2O8C A;  5JVH L;  3ISN C;  3GBT A;  2WFB A;  3BGR A;  3DRR A;  3C6H A;  3LDL A;  4DQI A;  1Q81 O;  4EZ9 A;  2PBD A;  4IJN A;  2VG6 A;  3T1Y K;  2PAV A;  2A40 A;  2ZGZ A;  4K41 A;  1MWM A;  4M45 A;  2D0B A;  4CBW A;  1KQS M;  4WE1 A;  4CGD A;  4KH4 A;  5AQT A;  2HHW A;  1TV6 A;  2HW3 A;  2NRT A;  2QTD A;  1KSP A;  3RTV A;  2O8B B;  5ELZ A;  3T1H K;  1XUP O;  4W5O A;  1UAX A;  4AM7 A;  4BQL A;  3NGI A;  1S1U A;  3MN6 A;  3ULD A;  3F73 A;  4JKC A;  3OA9 A;  4A2B A;  4PHT X;  3C7N B;  4LF7 K;  4CIG A;  3HPH A;  2NRR A;  3THW B;  2HMP A;  1ITG A;  3R8E A;  4CZJ A;  1XNR K;  2IVO A;  3A8Y A;  4BC4 A;  3OYJ A;  4B3T K;  3KIO A;  1ZBI A;  3FZF A;  1D5A A;  1BO5 O;  1NWK A;  5BR9 A;  3G10 A;  1HJR A;  3G4S N;  3QB0 A;  5AZJ A;  5IWA K;  4F4K A;  1N36 K;  3AA4 A;  5AQQ A;  2ZJQ L;  4BE2 A;  1HKB A;  2IAJ A;  5KQD A;  5C0Y A;  3OYA A;  4JKG B;  2E20 A;  1YI2 N;  1Z05 A;  1NNE A;  3BY5 A;  3LPU A;  3AY9 A;  2HND A;  1HR0 K;  1CZA N;  3QNO A;  3K2P A;  3VEZ A;  4YDU A;  1NGC A;  1E4G T;  3MN5 A;  3SAF A;  3EY1 A;  4W5N A;  3VET A;  4H0V B;  1FKP A;  1NJX A;  3N4P A;  2NRH A;  3CJ7 A;  1S1X A;  1WSI A;  4JS4 A;  1C0M A;  1HRH A;  2WC9 A;  2KTQ A;  3O9T A;  4CF8 A;  4Z4C A;  2HNZ A;  1JLE A;  4FOE A;  3L6Q A;  3P5J A;  3BZK A;  3LDS A;  4ISE A;  2E5L K;  5I3U A;  3NVM A;  4LFB K;  2P9K B;  3H3O B;  2VYP A;  3NGY A;  5FRO A;  3VA3 A;  3QES A;  2IVN A;  3ID6 A;  1X9M A;  3CQ8 A;  4FL9 A;  3SUO A;  3CER A;  3UE5 A;  3MEE A;  3D7E O;  1ATR A;  4CK3 A;  1EQY A;  2G8U A;  3O5B A;  4DSL A;  1XC9 A;  3V1O A;  1EWR A;  2YCH A;  1JCF A;  3HOT A;  3I8D A;  1SZ2 A;  4DR4 K;  1D9F A;  3VOV A;  2P51 A;  5CYQ A;  3CJB A;  4DQQ A;  3VQQ A;  1JLB A;  4RW6 A;  4FLX A;  3U9D A;  1Q9X A;  5EU7 A;  3QIN A;  3VF2 A;  1QE1 A;  4NLB A;  1N6Q A;  4FWO A;  3M8P A;  4BE1 A;  1RGI A;  3ULE A;  3SAG A;  4F3T A;  1S3X A;  1YTA A;  4AHT A;  4M63 C;  4NXN K;  1UWB A;  3T19 A;  4KPY A;  3ZSV A;  2QWR A;  3HJF A;  3NBP A;  2KZZ A;  2D1K A;  4CEE A;  3O3H A;  2F7T A;  1U4B A;  2NZT A;  2IOC A;  4DLE A;  3PX4 A;  5GIP A;  1HYZ A;  3HST B;  4NLC A;  3ZEU B;  3OYD A;  4DR1 K;  4KTW A;  3MXM A;  3NF7 A;  1MDU B;  2O4I A;  1DEJ A;  3WEE B;  2J4R A;  1TVR A;  4OKJ A;  1D4X A;  4JI2 K;  2HF4 A;  3FFI A;  3TAE A;  4LF8 K;  3BEX A;  4DV0 K;  2BH1 A;  4BR9 A;  4FJM A;  1GOC A;  3CJ1 A;  3QEP A;  4FJG A;  2ZE2 A;  3EL2 A;  3DMJ A;  4BC5 A;  4YOW A;  3TAG A;  2KW4 A;  4DUZ K;  2O8D B;  5M1N A;  1Y97 A;  3MWP A;  1ZBH A;  5KTQ A;  4DCH A;  4G9Z A;  4K43 A;  1K8K B;  4GV6 A;  3KKS A;  3OS2 A;  3DOL A;  3QIP A;  3A5L C;  2XY8 A;  3DXM A;  4JK8 A;  3LWL A;  1HNV A;  2Q3S A;  1R0A A;  4OLA A;  3LP0 A;  1RDB A;  1L5U A;  2OPP A;  5C2D A;  4YDU C;  4CIF A;  3LAN A;  4I7F A;  3CCU N;  3SYZ A;  3O4N A;  3V9Z A;  1YHQ N;  3RRG A;  1NG9 A;  3KD5 E;  2FBY A;  5CHI A;  2KFN A;  4K25 A;  4KRE A;  2QWQ A;  3U3G A;  1TK0 A;  1YJN N;  1LWE A;  4J2B A;  4U7B A;  3D2E A;  1YJ9 N;  2E1Y A;  3T7Z A;  4JV5 K;  3AO1 A;  2HVH A;  4CVN E;  2P5G A;  4MO4 A;  4AHC A;  3HM9 A;  1NK6 A;  2G8W A;  4JEP A;  4DR2 K;  3KJV A;  4OGE A;  5GAH P;  1JL2 A;  1T6D A;  3NHG A;  3VGM A;  3UKU B;  4BR4 A;  5BPL A;  1Q8I A;  4DTP A;  1J54 A;  1TKX A;  5JMV A;  3ZSY A;  3U4L A;  1S1T A;  3DAW A;  2OA8 A;  3KHY A;  4ILG B;  3SQ1 A;  4B8C A;  1HYV A;  5AZJ B;  3SCX A;  1NJY A;  4OKK A;  4CGJ A;  4CER A;  3P39 A;  3E9P A;  3M8S A;  4N47 A;  4FK4 A;  1TKT A;  2VWK A;  4E7I A;  4OLB A;  1TGO A;  3W3D A;  2QXF A;  4CI6 A;  4ZHR A;  3L2V A;  1Q86 O;  1S9E A;  5ADX H;  4FZZ A;  2IDO A;  1W2B M;  1TYQ A;  2G8K A;  1BHL A;  4B9M A;  1A5W A;  4DTS A;  1ATS A;  1HUX A;  5SZT A;  3E1Y A;  2ITG A;  3MN9 A;  4CEO A;  2DTU A;  1RT6 A;  1WSE A;  2GWJ A;  1NU0 A;  4I2Q A;  2P1J A;  1T6C A;  3NVK A;  3WQT A;  2WTU A;  3L2Q A;  4LFA K;  1WNS A;  4CJV A;  1U45 A;  3OBW A;  2O8F A;  4NO7 A;  4ID5 A;  4CZK A;  3HVT A;  4IG3 A;  3Q7B A;  1KAX A;  5BRD A;  3OYI A;  3D45 A;  2VG5 A;  3K5L A;  5GAD P;  2ASP A;  1WAJ A;  4H5R A;  2Q31 A;  1VQ6 N;  4Z4I A;  4JI0 K;  2E2N A;  3S3O A;  5AQF A;  3MK6 A;  4BRF A;  3E9O A;  4IBN A;  3N4Q A;  4ICL A;  5IT9 O;  1NBW A;  1KAY A;  4FWM A;  5LMU K;  5I42 A;  3ZET A;  1HMV A;  4PL7 A;  5DM7 L;  3J80 O;  3LM9 A;  4DKW A;  1N5Y A;  3CCE N;  1LAV A;  4KHP K;  4A5A A;  2GUP A;  1CXQ A;  2Q97 A;  4MLE A;  1NJW A;  4G1Q A;  2HVI A;  3TAP A;  1U6Z A;  2GX9 A;  3AAP A;  3QBW A;  1ZBL A;  1QSY A;  2E2O A;  1EO1 A;  3RSE B;  2CGJ A;  4FSV A;  3ULE B;  1BCM A;  3V4I A;  3AVC A;  2UUC K;  1XHX A;  3SQ2 A;  4WF9 L;  4FWL A;  1KC8 O;  2HHH K;  3DLG A;  2GUI A;  4C8K A;  4CBX A;  3GOI A;  1RTD A;  2FC0 A;  1XI1 A;  4E1J A;  5AZI B;  3WNE A;  5I9E B;  4WFA L;  2E6L A;  3K5N A;  3CJA A;  4FJN A;  4H0Y B;  3QEW A;  1IJJ A;  2F9T A;  4GVE A;  4DV2 K;  2FBX A;  4Z4G A;  4BWJ A;  4CJU A;  5A2Q O;  5CYM A;  4CJK A;  4E3S A;  2GV9 A;  1DTQ A;  3AGR A;  4ELU A;  3UKR A;  3I55 N;  5J2P A;  4F2S A;  4DF4 A;  2V7Y A;  4BC3 A;  3HL8 A;  3VQC A;  3ENH A;  5AFU A;  1P8Z A;  4B9V A;  3E66 A;  4E7L A;  2G8V A;  3FE1 A;  3CCM N;  4IOA L;  3TTD A;  4FXD A;  1S1V A;  1YUW A;  1RT1 A;  1NGF A;  5HRO A;  3OS0 A;  3IG1 A;  2VGN A;  4QS8 A;  3QEX A;  4Y0W A;  1S6Q A;  1QS4 A;  4BRQ A;  1FW6 A;  4MFB A;  3DLK A;  1NGB A;  4DSE A;  4BR7 A;  4A61 A;  4PL8 A;  4FLY A;  1E3M A;  2V51 B;  2EWS A;  2E8A A;  3J7Z O;  3EKS A;  1WUA A;  1T03 A;  3PUF A;  3DXM B;  4BG9 A;  4M3R A;  4M3Z A;  1TKD A;  1VSM A;  5HL7 L;  4A62 A;  1RIL A;  4FWK A;  5AQK A;  1D9D A;  2G8I A;  4CJR A;  4GVM A;  2QA4 N;  1ASV A;  4FJK A;  2E1Z A;  4DV6 K;  4FJ8 A;  3HXM A;  5EY4 A;  3OYC A;  3O9R A;  1JLC A;  4BRK A;  2VWJ A;  1SQK A;  1OH5 A;  4CHP A;  1ZC6 A;  1Q7Y O;  4HTU A;  3D2E B;  3O8M A;  1GOA A;  3KLI A;  4ZTF A;  5FRM A;  5C42 A;  2Q36 A;  2UXC K;  3NFA A;  3M8Q A;  1IKW A;  1TK8 A;  3DXK A;  3R9P A;  4V19 S;  3VQ6 A;  5M1K A;  3MXI A;  2Z1I A;  3G71 N;  4IFV A;  4IDH A;  3KD1 E;  2UXB K;  1BIU A;  4CHY A;  2HHS A;  3AVA A;  2OCE A;  4Z4H A;  2B6A A;  1OH8 A;  4IFE A;  1HX1 A;  1DKG D;  3EYZ A;  2UXD K;  1K9M O;  1TL3 A;  4CZG A;  1H1V A;  4O44 A;  1WB9 A;  3P4I A;  3SZ2 A;  3NH2 A;  4IDK A;  4YOY A;  2ZM6 K;  2CH6 A;  4QAG A;  2ZJP L;  4JRP A;  4E7K A;  4AHR A;  1IG8 A;  5FPD A;  3A5M C;  4JRQ A;  3QEI A;  3ZT3 A;  1LWC A;  3V9U A;  2HMI A;  1TAQ A;  4OX9 K;  1N32 K;  2RF2 A;  1MWK A;  3DLH A;  5F0X A;  1TYQ B;  1BL3 A;  1HNZ K;  3CJC A;  4K8X A;  1SKS A;  2HHV A;  3ID8 A;  4CJ4 A;  1OVY A;  3MEC A;  4QS9 A;  3SBT A;  3V9S A;  4BDP A;  1JXB A;  1L3T A;  3VF6 A;  3CF5 L;  3C6U A;  2E88 A;  4IXC A;  1T8E A;  4KHW A;  3VQB A;  1S72 N;  3I33 A;  4H03 B;  3OYH A;  4FYD A;  1BIZ A;  1C1C A;  4O5B A;  3LPT A;  2BTF A;  2YNI A;  4B3R K;  4H5V A;  3HYF A;  3TR8 A;  3ATV A;  3AVB A;  4A57 A;  1X3M A;  1N34 K;  3K9K A;  4IKF A;  3TPQ A;  1XC3 A;  3OVN A;  4CHN A;  1U2V A;  4QCL A;  1CZ9 A;  3LDO A;  1L3S A;  4DTO A;  3I0S A;  1X3N A;  2UUA K;  2YHX A;  4J2A A;  5C25 A;  4O0I A;  3LAM A;  3FZL A;  4B9S A;  4FOI A;  5M1Q A;  3U6F A;  4UQG A;  3ZET B;  1NGD A;  1TK5 A;  1CZB A;  1ZBF A;  4OPK A;  4LF5 K;  3QLH A;  4GNI A;  4KO0 A;  3P38 A;  4DQR A;  2Q1N A;  3L0Q A;  4DR3 K;  4CF9 A;  4IO9 L;  1BQN A;  1ZBS A;  4FPA A;  4B9U A;  4K0K K;  4O0J A;  4BR2 A;  4IFY A;  4PWD A;  3TAM A;  4WFB L;  3CFO A;  3H6E A;  2QWM A;  4B1U B;  1VQ4 N;  1VQ5 N;  1VQ7 N;  4PKI A;  4X65 K;  3HOS A;  4H5N A;  1NKC A;  2I5J A;  4FPB A;  4DV5 K;  4RW4 A;  1J53 A;  3ENB A;  5C24 A;  4RW9 A;  3OYF A;  4W5T A;  4B1Y B;  5KPT A;  1VSE A;  3P31 A;  3OYL A;  1S9G A;  2Q0R A;  4KKO A;  4C1N K;  3NE6 A;  5KPR A;  5DM6 L;  4E7J A;  1BU6 O;  5KGW A;  2X78 A;  3FGU A;  5AQN A;  2OPQ A;  3VQA A;  4FJ5 A;  4M3X A;  1NK7 A;  4C8N A;  2LSN A;  1RT4 A;  1W97 L;  3PIP L;  4CD1 A;  4DSK A;  3GDQ A;  3MX2 A;  3QBX A;  5D3G A;  1VAZ A;  4IOC L;  4B1Z A;  4B3M K;  4Q0B A;  3L2R A;  3FFK B;  3BDP A;  4M3Y A;  1DLO A;  4CJS A;  4FLU A;  2YX6 A;  3K5O A;  4YOV A;  2B5J A;  3CMA N;  5HRR A;  4L8R B;  4C8O A;  3BF1 A;  2ATQ A;  3RMB A;  5SWM A;  3LZJ A;  3MCP A;  3OS1 A;  3L3U A;  3V6D A;  3QFP A;  4B1X B;  1OKJ A;  3DLE A;  1QHA A;  3AO4 A;  4FJH A;  4CZM A;  3CME N;  2CGK A;  3AAR A;  5EXW A;  1Z6R A;  4H0T B;  1OH7 A;  2OAN A;  2P9I B;  1VK0 A;  1A5V A;  4AQY K;  1FXX A;  1VSD A;  5EX5 A;  2DFE A;  4DSJ A;  1VHX A;  3F2K A;  2GWK A;  3HTV A;  3LWM A;  2G8F A;  5JIC A;  1RDD A;  4OPH A;  2PFU A;  3B6O A;  4I6M B;  1U04 A;  1D8Y A;  1DTT A;  3KKR A;  3J7A P;  2ZWH A;  4M3W A;  3HPO A;  2ASO A;  4Y1C A;  4DWI A;  2O4G A;  4HHT A;  3PY8 A;  4O8K A;  2KZM A;  4U67 L;  4JHD A;  4CJL A;  4CFA A;  1EXQ A;  1OVQ A;  3TSQ A;  3QIO A;  5C2F A;  1RTI A;  1UA0 A;  3EE8 A;  3LDN A;  2KKZ A;  4EIA A;  4EFH A;  4B9T A;  4XH1 A;  4KRF A;  1NKB A;  3P1G A;  3FZK A;  4FJI A;  2BUP A;  4FWP A;  5T7B A;  4YFU A;  1QQM A;  2OZM A;  3VTI A;  4ILJ A;  4BR0 A;  3OY9 A;  3K59 A;  3VTH A;  4MO5 A;  4Z4F A;  3CI5 A;  4FLV A;  5AQO A;  5AQL A;  3CET A;  5LMN K;  1YT3 A;  5AQZ A;  3HRG A;  4BRD A;  4CJQ A;  3VEN A;  2PYJ A;  3TI0 A;  4OGC A;  1X9J A;  4BDY A;  2HBK A;  3QER A;  1WAF A;  1YJW N;  5K14 A;  5AQV A;  5LJW A;  1VQ9 N;  1JLF A;  3WXK A;  4EZ6 A;  5J2N A;  4OJR A;  4FJJ A;  4CJE A;  4DF8 A;  3GL1 A;  3VA0 A;  1S5J A;  4E89 A;  4BRI A;  4BRA A;  4NB4 A;  3TU5 A;  4FK0 A;  3CCJ N;  3SLC A;  3VF4 A;  5BN8 A;  1NLV A;  4E7H A;  4KHN A;  3V9X A;  3THY A;  2GBZ A;  4GV9 A;  1ASW A;  1GLA G;  4I9Q A;  1MA9 B;  4F8R A;  3D0P A;  1U2V B;  4DLG A;  4IJA A;  4CFD A;  2HHT A;  5J1E A;  5BR8 K;  5FPM A;  4GKJ K;  4RWT A;  3KWI A;  1KLN A;  4DV3 K;  3ZYY X;  4JD2 A;  1VRT A;  4K42 A;  1QZ5 A;  3L3V A;  4DV4 K;  2O8C B;  2HBM A;  2ZGY A;  1NOY A;  4BY9 C;  2RKI A;  3R3L A;  3OJS A;  4BRP A;  4X64 K;  2P5O A;  1RT3 A;  3HPG A;  3ZSZ A;  1QVG M;  4DU3 A;  4AHS A;  4FK2 A;  2HHX A;  3IKM A;  1P90 A;  2D0O A;  3VES A;  1I39 A;  5CZ2 A;  3AA2 A;  4ELT A;  4BWM A;  2D0P A;  3LM2 A;  2ETJ A;  1NGH A;  3NGZ A;  1HPM A;  1Z26 A;  2NUB A;  4LSL A;  3RMC A;  1U48 A;  1QHT A;  1KAZ A;  2YJF A;  4CJT A;  4BG8 A;  3AVI A;  3RMA A;  3PO4 A;  4KV8 A;  3DM2 A;  2A6A A;  4DQS A;  3AV9 A;  4FM2 A;  2KFZ A;  4CW7 B;  5GIO A;  1IO2 A;  1SL1 A;  3FLC O;  1NM1 A;  1N33 K;  4O4G A;  1N8R O;  4J2E A;  4LH4 A;  1UA1 A;  3MWT A;  4FZX C;  2YKM A;  3G25 A;  2P9P A;  4DS5 A;  3VPZ A;  4NYF A;  2IC3 A;  2YKN A;  3AO5 A;  4BRH A;  4OKE A;  1WN7 A;  4LC9 B;  2FF6 A;  3AVJ A;  1LAW A;  3U8X A;  3TAF A;  1MU2 A;  4CJW A;  3KWG A;  2PYL A;  1J5O A;  3M3Z A;  3AVM A;  1U49 A;  3CM5 A;  3ZSX A;  3VEY A;  4KHY A;  3IS9 A;  4B08 A;  5M1F A;  4CCH A;  1J9A A;  3L2W A;  1J5E K;  5LY3 A;  3BP8 A;  1Q18 A;  1YVN A;  4KHQ A;  1BWF O;  1JCG A;  2BGG A;  2QWL A;  1ZXO A;  2YNG A;  1KVB A;  1HNI A;  4BRN A;  4JI4 K;  4GMJ B;  4IG0 A;  2JWL A;  3TSU A;  1NJI O;  3U9Z A;  2WON A;  4BGB A;  4KTQ A;  2F8T A;  5KRT A;  4FLZ A;  3OYN A;  1X9W A;  1Q9Y A;  2A3Z A;  5BRH A;  4ID1 A;  4DTU A;  2YV0 X;  4C23 A;  4ISF A;  4DTN A;  1HNX K;  3G6E N;  5TKY A;  2F4V K;  3DLR A;  2PZS A;  4JI5 K;  4I2P A;  4BR5 A;  3T3F A;  1HJO A;  4B9L A;  5HLF A;  3ALY A;  3DOK A;  4R5P A;  3F5T A;  2D4W A;  1WOQ A;  1I94 K;  4CGH A;  3PX0 A;  1KVC A;  4N41 A;  4YOR A;  1S1W A;  1ATN A;  1C0G A;  1YXQ A;  3VQP A;  2IIR A;  2FLO A;  1JLQ A;  5TKW A;  3AVL A;  3EKU A;  3SJJ A;  1NK5 A;  2JWK A;  4KI4 A;  3I56 N;  4CBU A;  1TAU A;  3QEV A;  3C95 A;  4CF0 A;  3WXL A;  3ASM A;  3IMX A;  1KD1 O;  2OYQ A;  1L3V A;  1RDU A;  3O9U A;  1SL2 A;  5HRN A;  2O8E A;  3H1V X;  4RTF D;  5F1X A;  3CQX A;  3CC4 N;  3OYG A;  3ZCM A;  2VQF K;  4JHD B;  1SKW A;  3LDP A;  5F2R A;  1XWL A;  2P9L A;  4HWI A;  1BGX T;  3SMS A;  4HUE A;  3MMV A;  5JS1 A;  4E1M A;  4DMN A;  4AHV A;  4DFP A;  4DTX A;  2QKB A;  3KTQ A;  2A1R A;  3ENO A;  3HVR A;  2YHW A;  4A59 A;  4GW6 A;  1WSJ A;  3S3M A;  4C8M A;  2RN2 A;  4L3Q A;  2G8H A;  4Y1D A;  3VQE A;  3WXM B;  3HBT A;  4BAC A;  5AQJ A;  1QZ6 A;  1M90 O;  3Q7C A;  4FJ7 A;  4CGI A;  4DFK A;  1RCH A;  4CZE A;  3OTO K;  3D2F A;  4DR7 K;  1NOZ A;  4C8L A;  2YHA A;  4LSN A;  2HNY A;  3AGK A;  4EP5 A;  1VSJ A;  4JKE A;  2YNH A;  2Y1J A;  1VQO N;  3BZC A;  1XHZ A;  3T1A A;  1QQO A;  3GE1 A;  1I3A A;  3KLE A;  1EKE A;  4YOX A;  5LL6 Z;  1EET A;  4HTL A;  4W5Q A;  1ESV A;  3THY B;  4ISG A;  4FO0 A;  5BN9 A;  1B92 A;  3SAH A;  1RBV A;  1GLE G;  3OYB A;  2RPI A;  2E6M A;  4TSX A;  2P9N A;  3THW A;  5JLH A;  1GLL O;  2A1S A;  5BPM A;  4JD2 B;  3K0S A;  3WT0 A;  1WLJ A;  4FJ9 A;  2Q0U A;  4AIL C;  3WNH A;  1SL0 A;  2CGL A;  1KCF A;  1B9F A;  4B1V A;  3PO5 A;  3NMU A;  2GEM A;  1ZBU A;  3CD6 N;  2OPS A;  3WUH A;  5AQU A;  1E4F T;  2HF3 A;  4FM1 A;  4RG8 A;  3V9W A;  3O3F A;  2HB5 A;  1RBS A;  3TTF A;  1W0H A;  1R59 O;  3QIC A;  2BAN A;  4Z94 A;  1IBL K;  4BGA A;  4CGG A;  1ZYQ A;  2HHU A;  3QFU A;  1K73 O;  3MDQ A;  3O3G A;  4F2R A;  4FWR A;  1NGA A;  5KQ8 A;  3VN5 A;  4H5W A;  2QW9 A;  1IKX A;  2NRV A;  3CG7 A;  3D6R A;  5J2Q A;  3PIO L;  3LP2 A;  1C0U A;  3AVH A;  3AVN A;  4CEC A;  3LL3 A;  5CY4 A;  1HQE A;  2W41 A;  3OYM A;  1V4T A;  4JKA A;  1XNQ K;  2FBV A;  4DV1 K;  5AQW A;  4YOT A;  4FZY A;  1IKV A;  2GTD A;  5E41 A;  2W6K A;  1KLM A;  5M1O A;  4DG1 A;  2XRI A;  1LV5 A;  2P9U A;  1RT2 A;  4CZI A;  1LOT B;  5C12 A;  3E01 A;  3KK3 A;  4FCY A;  2D0C A;  1JLA A;  2AA4 A;  1NK9 A;  4DV7 K;  1GLJ O;  4DR5 K;  2QWO A;  4WQ5 A;  2H3G X;  5FLX O;  5HOO A;  2A42 A;  2W40 A;  3TSP A;  4IO8 A;  5GIN A;  4C1N I;  3VEV A;  3O4Q A;  1VQP N;  2YJE A;  4EHT A;  3MCA B;  3LP3 A;  5JS2 A;  4YNQ A;  5C10 A;  2V52 B;  3SPY A;  3QDK A;  4IWV A;  3ZT2 A;  4AHU A;  1NGG A;  2IGI A;  4K8Z A;  3HT3 A;  4JI8 K;  4UY8 O;  3VEW A;  2FXU A;  4DUY K;  4JNE A;  5HBM A;  2HST A;  3SMP A;  4KB0 A;  4F3O A;  4DSF A;  3V81 A;  1DGK N;  1RT5 A;  3PV8 A;  1WBD A;  4LF4 K;  2F9W A;  4PY5 A;  2GEL A;  3CJ9 A;  1VQN N;  2O8F B;  2Q2R A;  1B9D A;  4XH5 A;  2A41 A;  1T3V A;  5ADX A;  4M3U A;  5AQG A;  3B8A X;  4PKH A;  4DU4 A;  4MQ3 A;  3S3N A;  3VEX A;  4KBO A;  1NGJ A;  2E2P A;  2KLA A;  1YIT N;  4FW1 A;  2QI2 A;  5FDL A;  2XHB A;  4B1W B;  3DRS A;  2NNW A;  4MDA A;  3VQ5 A;  2E2Q A;  4CEB A;  1G15 A;  4NCA A;  3KK1 A;  5AJ3 K;  3LDQ A;  4LH5 A;  3ZSR A;  3O1B A;  4KHU A;  2CH5 A;  3O80 A;  4JI7 K;  1RTJ A;  3OW2 M;  4IEE A;  3VER A;  4M7X A;  1K8K A;  5JVG L;  1RDW X;  1NK8 A;  3CCL N;  1QTM A;  4N76 A;  3CQY A;  4H8K A;  4JI3 K;  4H0P A;  4H4M A;  3QET A;  3P83 D;  4A2A A;  1X9S A;  1WSG A;  3BF3 A;  4JLH A;  2JGU A;  1YTU A;  2X6S A;  2XY7 A;  1XMQ K;  3JS6 A;  1QSL A;  1O1W A;  5E26 A;  3D2F B;  3IAY A;  2HHQ A;  3UIQ A;  1RBT A;  1NJZ A;  2P9S A;  3SQ0 A;  3CFP A;  2I7P A;  3MED A;  3VMF B;  3UKR B;  3NF8 A;  4EHU A;  3JYT A;  3H45 C;  4AH9 A;  3K5M A;  1HQU A;  1BOT O;  4B3O A;  1IBK K;  3AVF A;  4N5S A;  3SI6 A;  3VQ7 A;  1FK9 A;  5E84 A;  4RW8 A;  4CJF A;  1LW0 A;  2I7N A;  3UB5 A;  3TAN A;  3UKU A;  4Z4E A;  3K9J A;  4B8A B;  1QQN A;  4PA1 A;  1L3U A;  4WQ5 C;  4BVO A;  2P9N B;  1KXP A;  2YNF A;  2QWP A;  1ILY A;  1S22 A;  4JS5 A;  4XIU A;  4BE0 A;  3QML A;  1NGI A;  4KTZ A;  3VGL A;  2X6N A;  4E19 A;  3EZW A;  1RBU A;  3A2F A;  3ZT4 A;  2X74 A;  3CC7 N;  1IV0 A;  4B9N A;  4JAX A;  1Q82 O;  1TUU A;  1KTQ A;  4BRL A;  3MXJ A;  3ZX2 A;  3J7Y P;  1GOB A;  5KGX A;  1GLC G;  1BQM A;  3TAR A;  1TL1 A;  3NF9 A;  1HKC A;  3SV4 A;  3A0I X;  4CJ7 A;  4ILH A;  4JKD A;  3HP6 A;  1CXU A;  1C1B A;  3OYE A;  3DXK B;  1YF5 L;  5CR4 A;  3AA5 X;  3H3N O;  4B9Q A;  3KZB A;  4JI6 K;  3CCS N;  1RTH A;  2FF3 B;  4GY2 B;  1F21 A;  4CF2 A;  4DTR A;  4E0D A;  4WYB A;  2P9U B;  4JK7 A;  3L8B A;  3DLB A;  3EEQ A;  3IDH A;  3SPZ A;  5EVZ A;  2WBN A;  3ZSO A;  4GKK K;  1JJ2 M;  3CCR N;  3O1W A;  4CZL A;  4DS4 A;  1VSF A;  4CJ5 A;  5M1P A;  2NRZ A;  2Z1G A;  5B8H A;  3DWL A;  3HI0 A;  4YY3 K;  4RCH A;  2KQ2 A;  3JSM A;  3CCQ N;  3IRX A;  2DPN A;  3M6G A;  1K6Y A;  3BUZ B;  3THX A;  1RFQ A;  4CHZ A;  1JLG A;  2HBL A;  4H4O A;  2OPR A;  4FVM A;  3OYK A;  1C0T A;  4CK1 A;  4CFC A;  3RSE A;  3JXU A;  4EP4 A;  3EZ5 A;  2OTJ N;  1IH7 A;  3ZLJ A;  2B4J A;  2YHB A;  2FSN A;  3CM6 A;  5AFU H;  4ZTJ A;  1J6Z A;  2VWB A;  3VQ4 A;  3IFR A;  4OVL A;  1U47 A;  1V4S A;  1HNW K;  1G99 A;  4DR6 K;  1BCO A;  4JN4 A;  2V7Z A;  4XH4 A;  5AZI A;  4DFM A;  5AQS A;  3OBY A;  3OHR A;  3K57 A;  1BA0 A;  1WSF A;  2NRW A;  3A5N C;  5JLF A;  4CF1 A;  1GLF O;  4CHO A;  3HP9 A;  2E4L A;  4ELV A;  3RWU A;  4IOX A;  2XO7 A;  5FPN A;  3WQU A;  2RHK A;  2ASM A;  4QOZ B;  5BRE A;  3WNG A;  1JXE A;  2F8S A;  2BE2 A;  4JKF A;  1IBM K;  5BPN A;  3PSI A;  3F9K A;  2QM1 A;  4OPA A;  4FLW A;  2OZS A;  4JYA K;  4CEF A;  4WCE L;  4CHQ A;  4KFB A;  1DT9 A;  3QO9 A;  1BA1 A;  4IZ9 A;  3KVG A;  1LCU A;  2KHO A;  4CFB A;  4JKB A;  1QVF M;  5H1S Q;  5AQI A;  1OH6 A;  2NLX A;  2IS3 A;  1SV5 A;  2P9S B;  3SK3 A;  3C94 A;  2ZF5 O;  3KK2 A;  4JI1 K;  4LF6 K;  1T05 A;  4LD0 A;  1W9H A;  3KLG A;  5FPE A;  5GAE P;  3A5O C;  4FLT A;  5HRP A;  3C65 A;  2IVP A;  1VQM N;  5AQX A;  3O9Q A;  2FSJ A;  2ZQB A;  3E9L A;  3NCI A;  1T44 A;  1LW2 A;  3DJC A;  3U3Y A;  1NGE A;  1Y64 A;  1GLD G;  3KLH A;  2A5X A;  2QXL A;  2BDP A;  2AP1 A;  4CIE A;  1RDA A;  3AA3 A;  3KK7 A;  3PSF A;  4CZF A;  4RW7 A;  3ZSQ A;  2YI1 A;  3O4W A;  2F96 A;  1NK0 A;  1KVA A;  4BRO A;  3O6W A;  1O13 A;  4CEQ A;  4AM6 A;  1HPZ A;  1WBB A;  2W42 A;  2WUS A;  2NRX A; 
#chains in the Genus database with same CATH homology
 4M42 A;  3HJF A;  4CGG A;  4CJP A;  3NBP A;  1ZYQ A;  2HHU A;  2KZZ A;  4CEE A;  3O3H A;  4NCB A;  4FW2 A;  4CEA A;  3O3G A;  4F2R A;  1U4B A;  2IOC A;  3VN5 A;  4DLE A;  3VQ8 A;  3PX4 A;  2I5J A;  1NKC A;  1HYZ A;  3HST B;  4W5R A;  3OYD A;  3THV A;  1IKX A;  4KTW A;  1J53 A;  3CG7 A;  3NF7 A;  4RW4 A;  3MXM A;  2O4I A;  5C24 A;  5J2Q A;  3SUQ A;  4Z0U A;  4RW9 A;  3LP2 A;  3OYF A;  1C0U A;  3LZI A;  4DU1 A;  1BIS A;  1JKH A;  4W5T A;  3AVH A;  3AVN A;  4CEC A;  1BI4 A;  1TVR A;  4OKJ A;  5CY4 A;  4CGF A;  3VQD A;  1VSE A;  1IKY A;  3FFI A;  1HQE A;  3OYM A;  3TAE A;  3SUP A;  3SNN A;  3NF6 A;  3OYL A;  1S9G A;  5HP1 A;  4KAZ A;  4KKO A;  3RMD A;  4FM0 A;  2FBV A;  3H08 A;  4FJM A;  4FZY A;  1GOC A;  1IKV A;  5E41 A;  3NE6 A;  4DG1 A;  1KLM A;  4E7J A;  2XRI A;  1LV5 A;  5KGW A;  1RT2 A;  3QEP A;  4FJG A;  2X78 A;  3E01 A;  3KK3 A;  2ZE2 A;  4FCY A;  2OPQ A;  2D0C A;  3VQA A;  1JLA A;  3DMJ A;  4FJ5 A;  4M3X A;  1NK9 A;  4PUO A;  1NK7 A;  4C8N A;  4DTJ A;  3TAG A;  2LSN A;  2KW4 A;  3NAE A;  1LWF A;  1RT4 A;  2Z1H A;  3G0Z A;  1Y97 A;  3DYA A;  1NK4 A;  4DSK A;  1ZBH A;  4O55 A;  1TKZ A;  5KTQ A;  5D3G A;  3O4Q A;  3KKS A;  3OS2 A;  1VRU A;  3DOL A;  3QIP A;  4Q0B A;  3L2R A;  4FJL A;  3BDP A;  2XY8 A;  4M3Y A;  1DLO A;  2EX3 A;  4CJS A;  4DTM A;  3LP3 A;  5JS2 A;  1C6V A;  1HNV A;  2Q3S A;  4YNQ A;  3LWL A;  4FLU A;  1R0A A;  3LP0 A;  1RDB A;  2D0A A;  2OPP A;  3SPY A;  1L5U A;  4OLA A;  3K5O A;  3NH0 A;  4DFJ A;  2B5J A;  2PY5 A;  4K8Z A;  3SQ4 A;  1QSS A;  3ZT2 A;  4CIF A;  3TAB A;  3LAN A;  4I7F A;  5HRR A;  3SYZ A;  4C8O A;  4L8R B;  2ATQ A;  3ITH A;  2IGI A;  3DI6 A;  4AHU A;  3O4N A;  3V9Z A;  3RMB A;  3HT3 A;  3RR7 A;  3RRG A;  3KD5 E;  4HCC A;  5SWM A;  3LZJ A;  3M8R A;  2FBY A;  3OS1 A;  3L3U A;  3RR8 A;  1CLQ A;  2KFZ A;  5HBM A;  3V6D A;  4KB0 A;  2KFN A;  4KRE A;  1RBR A;  4F3O A;  4DSF A;  3V81 A;  4LY7 A;  3U3G A;  3DLE A;  1TK0 A;  1YVU A;  3AO4 A;  3SUN A;  1RT5 A;  1NKE A;  1LWE A;  1QQC A;  3PV8 A;  4FJH A;  4J2B A;  2R7Y A;  3I0R A;  3ZT1 A;  3DRP A;  1JL1 A;  4CE9 A;  3V1Q A;  4PY5 A;  5J2M A;  2HVH A;  2Y1I A;  1VK0 A;  3AO1 A;  2P5G A;  1B9D A;  4AHC A;  3HM9 A;  1A5V A;  1NK6 A;  1FXX A;  2G8W A;  1VSD A;  2DFE A;  4DSJ A;  3KJV A;  4OGE A;  1JL2 A;  4M3U A;  4CK2 A;  3LWM A;  2G8F A;  3NHG A;  1RDD A;  4DU4 A;  3B6O A;  4N56 A;  1VSI A;  1U04 A;  4MQ3 A;  3L2U A;  1D8Y A;  3ZT0 A;  5KI6 A;  2VG7 A;  1DTT A;  3S3N A;  3KKR A;  1Q8I A;  4CEZ A;  4OPJ A;  2QKK A;  4M3W A;  4CJ3 A;  3HPO A;  4DTP A;  1J54 A;  1TKX A;  4FW1 A;  4Y1C A;  4DWI A;  3ZSY A;  2O4G A;  5FDL A;  4HHT A;  3TWH A;  4KHS A;  1S1T A;  1RDC A;  2XHB A;  1WSH A;  3PY8 A;  3DRS A;  2OA8 A;  4HCB A;  3SQ1 A;  2KZM A;  3VQ5 A;  1ASU A;  4CEB A;  1G15 A;  4B8C A;  1HYV A;  4NCA A;  4CJL A;  3KK1 A;  4CFA A;  1EXQ A;  3SCX A;  4I9L A;  4LH5 A;  3LAL A;  3ZSR A;  5HRS A;  3QIO A;  1NJY A;  1RTI A;  4HVJ A;  4OKK A;  1UA0 A;  1VSK A;  4KHU A;  4CGJ A;  4CER A;  1RTJ A;  4B9T A;  4KRF A;  1NKB A;  3P1G A;  4FJI A;  4NCG A;  1NK8 A;  5T7B A;  2QK9 A;  3M8S A;  4N47 A;  4YFU A;  4FK4 A;  4HUF A;  2OZM A;  3V1R A;  1QTM A;  1TKT A;  4N76 A;  3OY9 A;  3K59 A;  3OJU A;  2VWK A;  4H8K A;  4E7I A;  4H4M A;  3QET A;  4Z4F A;  3P83 D;  4OLB A;  4FLV A;  1TGO A;  1X9S A;  2QXF A;  1WSG A;  4ZHR A;  3L2V A;  2XY5 A;  4JLH A;  4CES A;  2JGU A;  2ZD1 A;  1S9E A;  2Z1J A;  2X6S A;  4FZZ A;  1YTU A;  1YT3 A;  2IDO A;  4CJQ A;  2XY7 A;  2G8K A;  3KLF A;  1BHL A;  2PYJ A;  4B9M A;  1A5W A;  3TI0 A;  4DTS A;  4OGC A;  5SZT A;  1O1W A;  1QSL A;  3IAY A;  2HHQ A;  5KRS A;  4BDY A;  3UIQ A;  2ITG A;  3SV3 A;  1RBT A;  3QER A;  1WAF A;  4CEO A;  4DQP A;  4J2D A;  2DTU A;  1NJZ A;  1RT6 A;  5K14 A;  1SKR A;  1WSE A;  5DK5 A;  1JLF A;  3CFP A;  4EZ6 A;  2DFF A;  3MED A;  5J2N A;  4OJR A;  4FJJ A;  4I2Q A;  2P1J A;  4CJE A;  4Q5V A;  4DF8 A;  3VA0 A;  3NF8 A;  1S5J A;  4E89 A;  3JYT A;  3NH1 A;  1HYS A;  4AH9 A;  3K5M A;  3TAQ A;  1HQU A;  1KRP A;  3L2Q A;  4B3O A;  4PQU A;  4FK0 A;  1WNS A;  3AVF A;  4CJV A;  4N5S A;  1UOC A;  3SI6 A;  1U45 A;  3VQ7 A;  1FK9 A;  4E7H A;  4KHN A;  4ID5 A;  3OYI A;  3HVT A;  4IG3 A;  3V9X A;  5FRN A;  1VSL A;  4RW8 A;  3D45 A;  2VG5 A;  3K5L A;  4CJF A;  3MAQ A;  3CFR A;  2GBZ A;  1ASW A;  1WAJ A;  1LW0 A;  4I9Q A;  3TAN A;  4F8R A;  4KB1 A;  3D0P A;  1Z25 A;  3CYM A;  4DLG A;  3PX6 A;  4CFD A;  4Z4I A;  4Z4E A;  5J1E A;  2HHT A;  4B8A B;  4PA1 A;  1L3U A;  3S3O A;  4IBN A;  4ICL A;  1KLN A;  4DSI A;  2YNF A;  1VRT A;  3L3V A;  4JS5 A;  5I42 A;  4XIU A;  4BE0 A;  1NOY A;  1HMV A;  1N5Y A;  2RKI A;  1LAV A;  3OJS A;  2P5O A;  1RT3 A;  3AO2 A;  4KTZ A;  5CZ1 A;  2X6N A;  4E19 A;  1CXQ A;  3HPG A;  3ZSZ A;  1RBU A;  4DU3 A;  3A2F A;  3RRH A;  1NJW A;  4G1Q A;  4AHS A;  1X1P A;  3ZT4 A;  3TAP A;  4FK2 A;  2HHX A;  2HVI A;  2X74 A;  1ZBL A;  4B9N A;  1QSY A;  4ELT A;  1I39 A;  5CZ2 A;  3AA2 A;  3ZSW A;  2XY6 A;  4BWM A;  3AVK A;  4M3T A;  2ETJ A;  2DY4 A;  1BCM A;  3NGZ A;  3AVC A;  3V4I A;  1Z26 A;  1KTQ A;  2NUB A;  2EHG A;  1XHX A;  4LSL A;  3MXJ A;  3RMC A;  3SQ2 A;  1U48 A;  1QHT A;  1GOB A;  2JLE A;  3WNF A;  5KGX A;  3HO1 A;  1BQM A;  4CJT A;  3TAR A;  3AVI A;  3RMA A;  3PO4 A;  4C8K A;  3DLG A;  2GUI A;  3DM2 A;  4KV8 A;  4M41 A;  4DQS A;  3AV9 A;  4FM2 A;  1TL1 A;  1RT7 A;  3NF9 A;  3QNN A;  1S6P A;  1A5X A;  2FC0 A;  3MEG A;  1IO2 A;  3K58 A;  4BDZ A;  1XI1 A;  1SL1 A;  1RTD A;  3WNE A;  4HUG A;  4O4G A;  5DMR A;  2E6L A;  3K5N A;  4LH4 A;  3SV4 A;  4J2E A;  4FJN A;  1UA1 A;  1EX4 A;  3C6T A;  3QEW A;  4FZX C;  3HP6 A;  2YKM A;  3B6P A;  3VQ9 A;  2FBX A;  3AVG A;  1CXU A;  4KI6 A;  4Z4G A;  1FKO A;  4BWJ A;  4CJU A;  4DS5 A;  4FJX A;  1C1B A;  4NYF A;  5CYM A;  3OYE A;  2IC3 A;  4CJK A;  1BI4 B;  4E3S A;  2GV9 A;  3AA5 X;  1DTQ A;  2D5R A;  1EP4 A;  1VSH A;  2YKN A;  3AO5 A;  4ELU A;  4OKE A;  5J2P A;  4F2S A;  2AJQ A;  3LAK A;  1WN7 A;  4DF4 A;  2WOM A;  4NYN A;  1RTH A;  4CED A;  3AVJ A;  3HL8 A;  1F21 A;  1KFD A;  1LAW A;  1REV A;  1RNH A;  3VQC A;  4E1N A;  4CF2 A;  1MU2 A;  4DTR A;  4CJW A;  3TAF A;  4E7L A;  4B9V A;  1IG9 A;  3AO3 A;  2PYL A;  1J5O A;  3NDK A;  3L8B A;  2G8V A;  3DLB A;  3S9H A;  4FXD A;  3AVM A;  1U49 A;  1KFS A;  1S1V A;  3CM5 A;  3ZSX A;  3SPZ A;  3ZSO A;  1RT1 A;  4KHY A;  3IS9 A;  4B08 A;  5HRO A;  4CCH A;  1SUQ A;  1J9A A;  3OS0 A;  3HK2 A;  4DS4 A;  3IG1 A;  3L2W A;  1VSF A;  4CJ5 A;  3QEX A;  2Z1G A;  1S6Q A;  1QS4 A;  1C1A A;  2DFH A;  3LP1 A;  1T7P A;  4MFB A;  3DLK A;  2FBT A;  4DSE A;  4KHQ A;  2BGG A;  3ISN C;  4FLY A;  3JSM A;  2KQ2 A;  2YNG A;  3BGR A;  3IRX A;  1KVB A;  1HNI A;  1K6Y A;  1T03 A;  3PUF A;  4GMJ B;  4IG0 A;  4M3R A;  4M3Z A;  1TKD A;  1VSM A;  2WON A;  3DRR A;  4KTQ A;  4CHZ A;  1JLG A;  1RIL A;  2F8T A;  4H4O A;  4DQI A;  2OPR A;  4FVM A;  3OYK A;  5KRT A;  4FLZ A;  3OYN A;  1X9W A;  1Q9Y A;  4ID1 A;  4DTU A;  1C0T A;  2YV0 X;  4CK1 A;  4CJR A;  4GVM A;  4CFC A;  4DTN A;  1D9D A;  4EZ9 A;  2G8I A;  1ASV A;  2VG6 A;  4FJK A;  4EP4 A;  3EZ5 A;  3DLR A;  1IH7 A;  2PZS A;  4FJ8 A;  3HXM A;  4I2P A;  2B4J A;  2YHB A;  3CM6 A;  3OYC A;  3T3F A;  1JLC A;  4M45 A;  2D0B A;  4ZTJ A;  4B9L A;  4WE1 A;  4CGD A;  3VQ4 A;  2VWJ A;  4OVL A;  5HLF A;  1U47 A;  2HHW A;  1TV6 A;  3ALY A;  3DOK A;  2HW3 A;  4R5P A;  1KSP A;  3RTV A;  4CHP A;  1BCO A;  4DFM A;  4CGH A;  4HTU A;  3PX0 A;  1KVC A;  4N41 A;  1GOA A;  3K57 A;  1S1W A;  3KLI A;  4W5O A;  4ZTF A;  5FRM A;  1WSF A;  1UAX A;  5C42 A;  3ULD A;  3NGI A;  1S1U A;  3VQP A;  3NFA A;  3M8Q A;  3F73 A;  1IKW A;  1JLQ A;  3SJJ A;  3AVL A;  4CF1 A;  1NK5 A;  1TK8 A;  4KI4 A;  4CHO A;  3VQ6 A;  3HP9 A;  4CIG A;  3HPH A;  1TAU A;  2E4L A;  3QEV A;  3C95 A;  4CF0 A;  3MXI A;  3ASM A;  4ELV A;  2Z1I A;  3RWU A;  4IFV A;  1ITG A;  4E0D A;  2OYQ A;  3KD1 E;  2XO7 A;  1BIU A;  4CHY A;  2HHS A;  3AVA A;  4Z4H A;  3OYJ A;  1L3V A;  4QOZ B;  2B6A A;  1SL2 A;  3KIO A;  3WNG A;  1JXE A;  1ZBI A;  2F8S A;  5HRN A;  3EYZ A;  2BE2 A;  1D5A A;  3G10 A;  1HJR A;  1TL3 A;  4F4K A;  3OYG A;  3ZCM A;  3F9K A;  4O44 A;  3AA4 A;  3SZ2 A;  1SKW A;  4BE2 A;  3NH2 A;  1XWL A;  4HUE A;  5JS1 A;  1BGX T;  4IDK A;  2IAJ A;  4E1M A;  4DMN A;  4FLW A;  4QAG A;  4AHV A;  2OZS A;  4DFP A;  3OYA A;  4JRP A;  4DTX A;  2QKB A;  4E7K A;  4AHR A;  3KTQ A;  2A1R A;  4CEF A;  4JRQ A;  4CHQ A;  3HVR A;  3LPU A;  2HND A;  4KFB A;  3QEI A;  3ZT3 A;  3QO9 A;  1LWC A;  3V9U A;  3QNO A;  2HMI A;  1TAQ A;  3K2P A;  4GW6 A;  1WSJ A;  3S3M A;  4C8M A;  2RN2 A;  2RF2 A;  2G8H A;  4Y1D A;  3DLH A;  4CFB A;  3VQE A;  3EY1 A;  4BAC A;  4W5N A;  4FJ7 A;  4CGI A;  4DFK A;  1RCH A;  1FKP A;  1BL3 A;  1NJX A;  4K8X A;  1SKS A;  1NOZ A;  4C8L A;  2YHA A;  1S1X A;  4LSN A;  2HNY A;  2HHV A;  4CJ4 A;  4EP5 A;  1WSI A;  3MEC A;  3V9S A;  4BDP A;  2IS3 A;  4JS4 A;  1C0M A;  1HRH A;  1JXB A;  1VSJ A;  1L3T A;  2KTQ A;  1SV5 A;  2YNH A;  3C6U A;  4CF8 A;  4Z4C A;  3C94 A;  1T8E A;  4KHW A;  2Y1J A;  2HNZ A;  1JLE A;  3VQB A;  3P5J A;  3KK2 A;  3OYH A;  1XHZ A;  3LDS A;  3T1A A;  1BIZ A;  4FYD A;  1C1C A;  4O5B A;  5I3U A;  1T05 A;  3LPT A;  2YNI A;  1I3A A;  3KLE A;  4LD0 A;  1W9H A;  1EKE A;  5FRO A;  3KLG A;  3NGY A;  3QES A;  3HYF A;  3VA3 A;  3TR8 A;  3AVB A;  1X9M A;  1EET A;  3CQ8 A;  4W5Q A;  3SUO A;  4FLT A;  4IKF A;  3MEE A;  4CK3 A;  5HRP A;  3OVN A;  4CHN A;  2G8U A;  4QCL A;  1CZ9 A;  1B92 A;  3OYB A;  1RBV A;  4DSL A;  1L3S A;  1XC9 A;  3V1O A;  2RPI A;  4DTO A;  2E6M A;  3I0S A;  2ZQB A;  4TSX A;  4J2A A;  5C25 A;  4O0I A;  3I8D A;  2A1S A;  3LAM A;  3NCI A;  4B9S A;  1LW2 A;  3U3Y A;  3U6F A;  4UQG A;  1D9F A;  2P51 A;  1TK5 A;  1WLJ A;  1CZB A;  5CYQ A;  3KLH A;  4FJ9 A;  1ZBF A;  4OPK A;  2BDP A;  3QLH A;  4DQQ A;  4KO0 A;  3VQQ A;  1JLB A;  4AIL C;  4RW6 A;  4CIE A;  1RDA A;  3AA3 A;  3WNH A;  4FLX A;  4DQR A;  1SL0 A;  1Q9X A;  1KCF A;  1B9F A;  5EU7 A;  4RW7 A;  3ZSQ A;  3PO5 A;  3QIN A;  4CF9 A;  1BQN A;  4B9U A;  1QE1 A;  2F96 A;  1N6Q A;  4O0J A;  1NK0 A;  1KVA A;  3M8P A;  4BE1 A;  1ZBU A;  2OPS A;  4F3T A;  1YTA A;  4CEQ A;  4FM1 A;  4RG8 A;  4IFY A;  3V9W A;  4PWD A;  1HPZ A;  4AHT A;  2HB5 A;  1RBS A;  3O3F A;  1W0H A;  1UWB A;  3T19 A;  3CFO A;  3TAM A;  4KPY A;  2W42 A;  3ZSV A;  3SQ0 A;  2BAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...