4OPJA

Bh-rnaseh:tcda-dna complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generating Crystallographic Models of DNA Dodecamers from Structures of RNase H:DNA Complexes.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/dna
molecule keywords 5'-D(*CP*GP*CP*GP*AP*(TCY)P*TP*TP*CP*GP*CP*G)-3'
total genus 41
structure length 133
sequence length 133
chains with identical sequence C
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2014-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4opjA00
2FBXA 1C6VA 3CFOA 2IOCA 4CEZA 1C0TA 1BIZA 3RWUA 2XY6A 4KHQA 3AO3A 3K2PA 1IKYA 4M3RA 4QOZB 3M8QA 4CF8A 3SV4A 3L8BA 2HNZA 5D3GA 3AVHA 4RW8A 4O5BA 1XHZA 3C95A 2YKNA 5KGWA 3HP9A 3OY9A 4O4GA 3HYFA 3VA0A 1O1WA 1C1AA 3ZSZA 3ASMA 2VG7A 4AILC 2YHAA 2HVIA 4E19A 3NFAA 1ITGA 3U3GA 3PX6A 4B9SA 3QIOA 3NF9A 3PX4A 3PY8A 4E7IA 3AVNA 2P5GA 1Q9YA 3RTVA 1KTQA 1KRPA 3PO4A 1D8YA 3ZSRA 4E7KA 1IKWA 3DRSA 3ZSWA 2G8VA 4RW6A 3QERA 2Z1HA 4FLXA 4CFAA 3PUFA 1GOAA 3OYHA 3MECA 4CHZA 4CFDA 3HXMA 3E01A 4FM0A 3F9KA 3KKRA 3D0PA 4KI6A 3HK2A 1TKXA 4DSKA 4BACA 4OLAA 4OKEA 1ASWA 1QQCA 2QXFA 3ALYA 4KI4A 1J54A 1HYVA 4LD0A 1L3SA 4FK0A 3DYAA 4AHSA 1Q9XA 1KCFA 3G0ZA 4PA1A 2VWKA 1BISA 1FKOA 4CHOA 2B6AA 3S3NA 2FC0A 1U04A 4CJTA 1RDBA 1RDAA 3K5OA 4DFPA 3NH1A 4FJ7A 1BI4B 1F21A 5CYQA 1JLCA 3DOKA 4BE0A 2G8WA 4AHVA 4CJSA 1REVA 3VQ8A 4M3TA 3EYZA 4IFYA 5J2PA 3AVGA 1TVRA 4IFVA 4CHYA 2IDOA 4NYNA 3UIQA 4FJKA 4PY5A 2HW3A 4IG3A 1KVAA 1WAFA 3OYGA 4FK2A 4PWDA 3AVBA 3ZCMA 1JLBA 3H08A 5HRRA 4DG1A 4CGIA 4FK4A 3WNFA 4B8CA 3VQ9A 4WE1A 4E0DA 3LAKA 4FW2A 3DLHA 2VWJA 4FW1A 4M42A 1CXUA 3WNHA 4N47A 3JSMA 4M3XA 1VK0A 2KZZA 4FZXC 1RNHA 3QNOA 4YFUA 3QEXA 2B5JA 1RT5A 1NK6A 3QEIA 3SPYA 2G8UA 4F3OA 4Z4GA 3KLIA 5KRTA 3K57A 2G8HA 3OVNA 4W5OA 1RBUA 3ISNC 3OJUA 4LH4A 2BGGA 3ZT4A 4Y1CA 4M3UA 3S3OA 3MEGA 2KW4A 5DMRA 1N5YA 3OYCA 4B3OA 1QHTA 2VG5A 3K58A 2X6SA 1U4BA 1IG9A 1YTAA 1VRTA 4IBNA 4LSNA 2BANA 2DFFA 4KO0A 4K8ZA 1S9EA 2OZMA 3MXJA 3O3FA 4OVLA 3ZSVA 4DQRA 4DTSA 1TAUA 3SYZA 1RTJA 1W0HA 3AVMA 4W5TA 2HHTA 2W42A 3VQ7A 4B9NA 3L3VA 1ZBHA 4Z4CA 2O4IA 3DLKA 3DMJA 3SZ2A 3RMAA 4K8XA 3P5JA 5CZ1A 4ZHRA 1VSHA 2AJQA 5T7BA 1UA1A 3I0SA 3KK2A 4EP5A 5HP1A 4DQQA 1UWBA 5HRNA 1I3AA 1ZBFA 4IG0A 4CECA 2HB5A 4CJLA 5C24A 2B4JA 1WLJA 2OPSA 3VQBA 4C8NA 5CY4A 3VQ6A 4KHNA 3OYFA 5HRPA 2F8SA 1SL2A 1LW0A 1WSIA 3T19A 4N56A 4H8KA 1HMVA 2PYLA 1HYZA 4CEBA 4MFBA 1JXBA 4HCCA 3V9SA 4DU1A 2EX3A 3MAQA 3ZSXA 4FJNA 2YV0X 1QE1A 2WONA 4NCGA 4RW4A 1EETA 1FK9A 4ZTJA 3B6PA 4CE9A 3TAGA 1K6YA 3VQAA 4RW9A 1S1XA 2YNFA 2XO7A 1WSHA 1GOBA 4CHPA 2Y1JA 1T05A 3KLGA 3T3FA 4CGDA 4ZTFA 2GUIA 2D5RA 3CM5A 3O3HA 1U49A 4EZ9A 1RT3A 3TWHA 4DF4A 2A1RA 4FJ8A 3OYMA 1S9GA 4AH9A 4J2DA 1HPZA 2YHBA 4DTXA 3MXMA 1JLFA 1RT7A 1W9HA 4AHUA 5KGXA 2FBTA 4CHQA 4DS4A 3K5MA 3I8DA 2BE2A 3NGYA 4B9UA 2DY4A 3SI6A 1TKTA 4N5SA 1FXXA 1VSEA 2HNDA 3AA5X 4F3TA 3LZIA 4FLYA 2E6MA 3OS1A 2OPPA 4RW7A 2R7YA 2OZSA 4FJJA 2HHXA 3THVA 1N6QA 3SQ1A 5SZTA 3V1RA 3AVJA 3CFPA 2FBYA 1BCMA 5J2NA 4DFMA 4I2QA 4CK3A 3SUNA 4B8AB 3HVRA 5FRMA 3EY1A 1RBVA 1HRHA 2XY8A 4FJ5A 1RT2A 4HVJA 1CZ9A 3NDKA 4CJEA 3QEWA 3DM2A 4CJWA 3LANA 3KD5E 1S1TA 4FVMA 4NYFA 1TL1A 4OPJA 1WSJA 3V81A 4BDPA 4C8KA 4W5QA 3PX0A 3RR8A 3AO4A 4M3ZA 4FXDA 1QSYA 1XI1A 4KKOA 3LP0A 2XHBA 1LW2A 2HHQA 1TK0A 3HM9A 1D5AA 2O4GA 4AHCA 1DTQA 4DTMA 3AV9A 3NF7A 4LY7A 4CIFA 1JLAA 1JKHA 4BWJA 4CK1A 3KJVA 4J2EA 4E7HA 2KTQA 2FBVA 3SJJA 1Z25A 3ZSYA 3ZT3A 1XWLA 4DSJA 1JLQA 4W5RA 3BDPA 4FLZA 1D9DA 1WSEA 1SKRA 3TAQA 3MEEA 4CGHA 3P1GA 4CF9A 5KRSA 4CJUA 3F73A 2RN2A 4CEOA 3U6FA 3S9HA 5I3UA 1X9MA 4KHSA 1C1BA 4FJ9A 1SKSA 1VSDA 2P1JA 1S1VA 3V6DA 1SKWA 1WSFA 3V4IA 4KAZA 3C94A 2KFNA 2DFEA 4DWIA 1YT3A 1YTUA 5JS1A 4Z4FA 1MU2A 3G10A 4CEDA 1CXQA 1VSLA 3QO9A 3HSTB 5FROA 4HHTA 1TK5A 3AO5A 1WSGA 4JS5A 2HHVA 1L5UA 4HUEA 4F2SA 1C1CA 4NCBA 1NJZA 3LPUA 3ZSOA 3DOLA 4ID5A 4G1QA 2QKKA 2IC3A 4E3SA 4Z4HA 4R5PA 3HPHA 2ZE2A 3CQ8A 1NJWA 4DLEA 2GBZA 5C42A 4CF1A 3FFIA 1VRUA 1IH7A 3L2RA 1WNSA 4FYDA 4RG8A 2KZMA 4B9VA 2I5JA 3T1AA 3SCXA 4AHRA 1C0MA 1R0AA 1JLEA 2PZSA 1LAVA 3KLHA 3AA4A 2XRIA 4EZ6A 3IS9A 3OYAA 3LZJA 2F8TA 3O3GA 3O4QA 1TL3A 4FJLA 3TARA 1NK8A 1UOCA 1RT4A 4DLGA 1Z26A 2PY5A 4JLHA 2X74A 4EP4A 5E41A 3LDSA 3QIPA 4C8MA 1T03A 3L2QA 3OYLA 2HHUA 2QKBA 3RMBA 2OYQA 3HPGA 3SUQA 1EKEA 3DLEA 4CJ3A 4CIEA 3SQ4A 1HQUA 2E6LA 1VSKA 4DTUA 4FJXA 3OS0A 4Z4IA 1RT6A 4B9LA 2OPQA 3OYNA 3LP2A 4FJIA 4DTOA 3M8SA 4KHYA 2IGIA 3TAMA 4E7JA 4CEQA 1X9SA 4I7FA 3NF8A 5EU7A 4E7LA 2ATQA 5J2MA 3MXIA 3NBPA 1BGXT 2F96A 5CYMA 4CIGA 4FM2A 3TR8A 1HJRA 1JL2A 1RTHA 4DU3A 3IAYA 4KHUA 1U47A 3A2FA 1LAWA 1NK7A 4M45A 3L2WA 4CGGA 1HNVA 3DI6A 3KIOA 1U48A 4AHTA 2HMIA 4KV8A 3LP1A 2HHSA 1BI4A 1SL1A 3HPOA 4C8LA 4OGCA 1ZBUA 1NJXA 4DQPA 1TKZA 4CF0A 4Z0UA 3AO2A 3NH0A 4L8RB 3DRPA 4BDYA 1NK0A 4M3YA 1IO2A 4ID1A 2YNHA 3S3MA 4CFBA 1KLNA 3AVIA 5I42A 4IDKA 5KI6A 3KK1A 1ZBIA 1LWCA 1TV6A 5J2QA 3TAFA 4B9MA 3VN5A 3HVTA 2P5OA 4GVMA 1NK4A 4TSXA 2RKIA 3AVCA 1A5WA 3C6TA 2RPIA 4HUFA 3NH2A 4JRPA 4BDZA 3RRGA 2EHGA 3VQCA 1VSIA 3SUOA 3I0RA 3EZ5A 1RCHA 1NOYA 2XY7A 1EX4A 1UAXA 3V9ZA 3DLRA 4CEAA 3OS2A 3U3YA 4NCAA 1B9FA 1BHLA 1J9AA 1XHXA 2P51A 1LWEA 2ZD1A 3AVAA 1EXQA 3VQDA 3L2UA 4FCYA 4DTRA 1KFDA 1DLOA 1NOZA 1RBTA 2LSNA 4Z4EA 3OYJA 3AVKA 1WN7A 1B92A 1FKPA 4I9LA 2D0BA 4ELUA 4PQUA 4CJPA 4F8RA 3CM6A 4I2PA 3NE6A 3QETA 4N41A 3RR7A 4CHNA 4QAGA 3TAPA 3DLBA 3SUPA 3C6UA 4QCLA 2HVHA 3K59A 3V9XA 3RMCA 1S1WA 1QSLA 2WOMA 1BCOA 1EP4A 2E4LA 4DSFA 4DFKA 3TI0A 4CESA 3NAEA 2JLEA 4KREA 3KTQA 3HO1A 4N76A 4CJVA 4OPKA 1TAQA 4F4KA 1NKEA 4GW6A 3SPZA 2HHWA 4HUGA 4FZYA 1X9WA 2Z1JA 3VQPA 4KPYA 2DFHA 1WAJA 4CEFA 2Y1IA 4E89A 3RRHA 3LALA 3SQ2A 1TKDA 4DTNA 5SWMA 3QNNA 1BL3A 2ITGA 1RBSA 3L2VA 4OJRA 4JS4A 3RMDA 4DS5A 4M41A 4FJHA 1ZBLA 3DLGA 4DSIA 4IKFA 4FZZA 3K5NA 3ULDA 1SL0A 4DFJA 1J5OA 3LWLA 2G8FA 2IAJA 4HTUA 4CGFA 4CJ4A 3QEPA 1U45A 3KLFA 1RTDA 3VQQA 3VQEA 3HT3A 4J2BA 5C25A 1GOCA 4O0IA 4UQGA 1X1PA 5DK5A 2D0AA 4B9TA 4MQ3A 1A5XA 3BGRA 4FJGA 3ITHA 4FJMA 1J53A 4CJFA 3AA3A 2XY5A 3OJSA 1CLQA 1ASUA 3SQ0A 3ZT0A 2Z1IA 4XIUA 3NF6A 4CF2A 1LV5A 2ZQBA 4I9QA 4CFCA 4DTPA 4YNQA 4E1MA 3NHGA 4C8OA 3NGZA 4HCBA 2YKMA 3QINA 4CJQA 2IS3A 3CFRA 1Q8IA 3OYDA 1D9FA 4DSLA 3KK3A 3V1QA 2GV9A 3VA3A 3LPTA 3AVLA 4O44A 3HL8A 1NJYA 4W5NA 2G8KA 1QS4A 3O4NA 4CERA 3LWMA 1VSJA 5CZ2A 4LH5A 4BWMA 4KB0A 4J2AA 5FRNA 1YVUA 3JYTA 1KLMA 3V9WA 3CG7A 1I39A 4ELTA 2OPRA 3LAMA 3WNGA 3HP6A 4CCHA 4DU4A 1RILA 4CJRA 1HQEA 1VSFA 3VQ5A 1VSMA 1Y97A 3AO1A 1S6QA 4DQSA 4KHWA 3PV8A 4OLBA 4BE1A 4F2RA 1BQNA 3SV3A 1HNIA 4CK2A 3K5LA 4Q0BA 3TANA 2Z1GA 2Q3SA 2PYJA 5FDLA 1NK9A 1ASVA 4Y1DA 1B9DA 1G15A 1TGOA 4KTWA 3NCIA 2KQ2A 4DQIA 2VG6A 4OKKA 1RDDA 2X78A 1QTMA 2QK9A 1S6PA 1S5JA 4OGEA 1RBRA 3TAEA 5KTQA 1IKVA 4FM1A 5HLFA 1JXEA 1L3TA 3V1OA 4O55A 3OYEA 5HBMA 4DF8A 1KFSA 3DRRA 3PO5A 1SUQA 1DTTA 3ZT1A 3B6OA 3OYBA 3KD1E 4B08A 3VQ4A 1IKXA 2RF2A 4ICLA 4OKJA 4CJ5A 2D0CA 4FLTA 3QLHA 1TK8A 2NUBA 1KVBA 3TABA 3SNNA 3AVFA 4LSLA 1BIUA 1JL1A 3QESA 1L3UA 2BDPA 1S1UA 4H4OA 3ZT2A 1JLGA 5HRSA 5JS2A 4ELVA 2A1SA 4M3WA 1NK5A 3IRXA 3P83D 3LP3A 2JGUA 3M8PA 4H4MA 2HNYA 1XC9A 4KTQA 1LWFA 5K14A 1RT1A 3IG1A 1ZYQA 4KB1A 4PUOA 1C0UA 3CYMA 3KKSA 2X6NA 1NKBA 4CGJA 3MEDA 1A5VA 4GMJB 4CJKA 2OA8A 4CEEA 1RDCA 3ZSQA 3L3UA 5J1EA 1NKCA 4FLWA 4DTJA 2G8IA 1HYSA 1T7PA 2YNIA 3D45A 3V9UA 3M8RA 4KRFA 3HJFA 3OYKA 3OYIA 4BE2A 3QEVA 1CZBA 4O0JA 1L3VA 5HROA 3WNEA 3AA2A 4JRQA 1BQMA 4KTZA 1KVCA 4E1NA 2KFZA 3NGIA 2YNGA 4DSEA 2ETJA 4FLVA 1KSPA 1SV5A 3KLEA 2DTUA 4DMNA 1QSSA 4Q5VA 4FLUA 1UA0A 1RTIA 1T8EA 4KFBA
chains in the Genus database with same CATH superfamily
4CEZA 2IOCA 2O8DA 3RWUA 3M3ZA 3K2PA 4MO5A 3AY9A 3WXLA 3CCEN 3AVHA 2Q1NA 4WQ4A 5KGWA 1S3XA 2IIRA 3ASMA 4IJAA 1ESVA 2VG7A 5KPTA 4E19A 1KXPA 3PX6A 4B9SA 3PO4A 1KTQA 1IV0A 1K9MO 3ZSWA 1GLJO 2Z1HA 5ADXA 4FLXA 2P9UA 1Z6RA 4CFAA 3PUFA 1GOAA 2HBKA 3MECA 4CFDA 3OYHA 3HXMA 3E01A 2O8DB 3D0PA 1XNRK 4DSKA 2UUAK 1QQCA 3C0BA 3ALYA 5GINA 1J54A 1L3SA 4FK0A 1X3MA 4A61A 1KCFA 4GV3A 3FZMA 3CXCM 4CHOA 1R59O 5BRDA 4JK7A 3K5OA 4B9QA 1HNZK 1BI4B 4UY8O 2E2PA 2UYTA 3CI5A 4IFYA 3GBTA 3UIQA 4PY5A 1VQ5N 4NYNA 1DKGD 3ENHA 4FK2A 3ZCMA 4DG1A 2GWKA 4CBUA 4E0DA 4EHTA 3LAKA 2VWJA 4KBOA 4BRAA 2WTUA 1CXUA 4M3XA 5AQGA 3QEXA 2B5JA 1NK6A 3QEIA 3K57A 4I6MA 4A57A 1RBUA 3ISNC 3OJUA 4LH4A 4Y1CA 3S3OA 5DMRA 4B3OA 3CMAN 4MLHA 2ASPA 1VRTA 3CCVN 3BUZB 4DQRA 1TAUA 3SYZA 5CE3A 4W5TA 2OANA 1VQ8N 3RMAA 1VSHA 3VEVA 1KAXA 4EP5A 5ADXH 3CIPA 3MCAB 1UWBA 1YF5L 1I3AA 2HB5A 1YIJN 1TYQA 5C24A 1WLJA 1KC8O 1NGEA 3VQ6A 1VQKN 2ASOA 3OYFA 5HRPA 4K43A 1WSIA 5C2FA 4N56A 3QMLA 5F1XA 2PYLA 1HYZA 3UKRB 4CEBA 4YY3K 5FPEA 4MFBA 4E1JA 3U9DA 3KHYA 2YV0X 2ZGZA 2WONA 4NCGA 1KAYA 2A42A 3TAGA 2UUCK 1K6YA 5EXWA 1WSHA 4CHPA 3O9RA 1U2VA 3KLGA 4ZTFA 1U49A 3O3HA 3IDHA 2A1RA 1SAZA 1HPZA 2P9PB 4FWMA 4YOXA 3THYA 3NGYA 3FFKB 1TKTA 3EKUA 2NRVA 4OO1J 4FLYA 2OZSA 2HBLA 3SQ1A 2PFUA 3AVJA 4IOCL 3T1YK 3ZETB 4M7XA 2XY8A 4B1UB 4FJ5A 1RT2A 4CJEA 3DM2A 5AZIA 4BR2A 3CJ7A 3J81O 2VGNA 3D7EO 5FPNA 4OPJA 1HKCA 3V81A 4C8KA 4M3ZA 1XI1A 4KKOA 2XHBA 1LW2A 3EZWA 1TK0A 3LDPA 3M1FA 2O4GA 4CIFA 4J2EA 1JKHA 3KJVA 4E7HA 3QBWA 3I55N 2E5LK 1Z25A 4MLEA 4W5RA 1IG8A 3QB0A 1D9DA 4YORA 4FL9A 2GTDA 5EOYA 1W2BM 1U6ZA 3F73A 5KRSA 2RN2A 3TSPA 5I3UA 1YJ9N 1C1BA 3CCSN 1SKSA 4FJ9A 2P1JA 1SKWA 4JAXA 1WSFA 4JI8K 2KFNA 2DFEA 1YT3A 4Z4FA 1BDGA 1XQSC 2BTFA 4B1VA 3DAWA 5BRFA 1CXQA 4JS5A 4HUEA 3ZSOA 2Q36A 4JYAK 2IC3A 4Z4HA 3FZKA 3E9OA 3CQ8A 5JLFA 2VWBA 4BRMA 2GBZA 5GIPA 2QW9A 1GLLO 1VQ4N 4RG8A 4AHRA 1JJ2M 1C0FA 2PAVA 4CBXA 3FLCO 2AA4A 1YUWA 2A6AA 3IS9A 3CC2N 3FR0A 3OYAA 3LZJA 3O4QA 3VEOA 3GL1A 4JLHA 4EP4A 4AM7A 4BROA 2QWOA 2O8EA 2OYQA 3HPGA 2FSNA 3DLEA 4CIEA 4BC5A 3OW2M 4Y0WA 4FJXA 3MWPA 4B9LA 1VAZA 3IFRA 3TAMA 1X9SA 1K8KA 3NF8A 5EU7A 5AQVA 4OPHA 3CQYA 1FJGK 2NRHA 4DU3A 1JL2A 3M5RA 1V4SA 3PSIA 1HKGA 1NK7A 1U48A 4M7YA 4AHTA 3LDNA 3LP1A 3TSUA 4C8LA 4DQPA 1N36K 1NGAA 1YXQA 4CZIA 3AO2A 3OBWA 2YNHA 3S3MA 4IDKA 4JKBA 4DCHA 3CCUN 4LF6K 3OTOK 2P9IB 5J2QA 1Q82O 4B9MA 3VN5A 1NWKA 2P5OA 2YHXA 2O4IA 3CPWM 4JKFA 4JRPA 5ELZA 1VSIA 3F9MA 3ULEB 1RCHA 1NOYA 1UAXA 4CEAA 5KPZA 3OS2A 3U3YA 1J9AA 3VQDA 1EXQA 3CCMN 4FCYA 3H1VX 4BC4A 1WN7A 4PQUA 4L3QA 3TPQA 4CJPA 3CM6A 4N41A 4BRCA 3ENBA 4H03B 4GNIA 4DSFA 2JLEA 5C10A 2ASMA 4H5NA 5FPDA 4F4KA 3SPZA 3VQPA 3RSEA 1QQOA 3SQ2A 1TKDA 3JAMO 4DTNA 5SWMA 5H1SQ 2O8CA 1BL3A 5AFUA 3O6WA 3L2VA 2O8BA 4G9ZA 4IKFA 3LWLA 3K9KA 4CJ4A 4JK8A 1U45A 5GAGP 3KLFA 1RTDA 3VQQA 5C25A 2P9SB 3ID6A 4MQ3A 1QHAA 4FJMA 3P38A 3U8XA 3H3OB 1HLUA 1ASUA 1CLQA 3NF6A 2ZQBA 4I9QA 4DTPA 4YNQA 4U67L 2YKMA 4CBWA 4CJQA 4EIAA 3KK3A 3VA3A 2GV9A 3CCJN 4O44A 4DR3K 2NLXA 2G8KA 3O4NA 1VSJA 4GV9A 3I8BA 4J2AA 4ELTA 3JYTA 1ZC6A 2OPRA 1VQ6N 3HP6A 4CCHA 4B3RK 1MWKA 1RILA 3J7ZO 3VQ5A 2NRRA 5AQJA 1IBMK 3SV3A 3K5LA 1RFQA 3HRGA 4Q0BA 1D4XA 1B9DA 4H0YB 2VG6A 4JNEA 3LDOA 4OGEA 2VQEK 1IKVA 1L3TA 3FGUA 5HBMA 4X62K 3PO5A 1DTTA 1T44A 3OYBA 2JWLA 1IKXA 3VQ4A 4BC2A 1QVFM 1KVBA 2FLOA 2FSKA 1BA0A 4LSLA 3QESA 3K9JA 1S1UA 5HRSA 5JS2A 4ELVA 2A1SA 2FXUA 2Q31A 3CERA 3IRXA 3P83D 3C7NB 1SS6A 4H4MA 2HNYA 4KTQA 1LWFA 5K14A 3E9LA 4PUOA 4FWRA 2VCPA 1YVNA 4NB4A 3VETA 5J1EA 3SAGA 3HOTA 3L0QA 1HYSA 2YNIA 2VGMA 3M8RA 4BE2A 2O8EB 1CZBA 4O0JA 1L3VA 3WNEA 1KVCA 4E1NA 2KFZA 2HBJA 2YNGA 3NGIA 1KSPA 3KLEA 3C6AA 1RTIA 1HJOA 1T8EA 3A5OC 4KHQA 3AO3A 2UUBK 3WEEB 4QOZB 5AQMA 1H1VA 4IDHA 4DV6K 2YKNA 3E9PA 3VA0A 4GKJK 1P8ZA 4AILC 2YHAA 2HVIA 1N33K 1OH8A 4KH6A 4QS9A 3QIOA 3NF9A 4BQZA 2NRZA 1Q9YA 1D8YA 3B8AX 1JCFA 4BRPA 4A62A 2HF3A 4A5BA 3BZCA 4B1XB 4FM0A 4KI6A 4WQ5A 4BACA 1ASWA 3QFUA 1RDUA 3SAHA 3F5TA 3H46O 1IJJA 2NRWA 4JK9A 2VWKA 1BISA 2B6AA 2O8FA 3O9TA 4DFPA 3NH1A 5JVHL 2WBNA 4FJ7A 4BE0A 4AHVA 3GOIA 4HTLA 3VQ8A 4M3TA 5J2PA 3VF4A 4CHYA 3R3LA 1GLAG 4IG3A 3OYGA 4PWDA 3AVBA 1JLBA 5F2RA 3WUHA 1N8RO 4WE1A 4GV6A 4FW2A 5AQFA 4FW1A 3WNHA 2KZZA 1RNHA 4F3OA 3OBYA 3KLIA 2AP1A 3ZT4A 4CZFA 4M3UA 3MEGA 3CC7N 3CJ1A 5LJVA 2QWLA 3ATUA 3ZEUB 4V19S 4IBNA 1LOTB 2DFFA 2GEMA 4K8ZA 3DJCA 2OZMA 5KPRA 3MXJA 3CETA 3QBXA 3VEXA 4DTSA 1RTJA 1W0HA 3AVMA 2W42A 2I7PA 5AQKA 3DMJA 4ISFA 4K8XA 3P5JA 1NM1A 2CGKA 5HP1A 4DQQA 5HRNA 1ZBFA 4CECA 4IG0A 2B4JA 4KHNA 4C1NI 4WFBL 3RSEB 2RE2A 2OTLN 4H8KA 3THYB 4CJ7A 1HMVA 1JXBA 4HCCA 3MAQA 4IEEA 3ZSXA 4FJNA 4IO9L 3DXKB 4JHDA 1FK9A 3LM9A 4RW9A 1S1XA 1VQLN 4EZ9A 3VMFB 1VQNN 3OYMA 4AH9A 1TYQB 4BRFA 4O5FA 5KGXA 3LM2A 4CZGA 1E3MA 3ZX0A 3MX2A 2BE2A 2DY4A 5M1PA 3TSQA 4B3SK 1FXXA 1X3NA 2HNDA 3VEYA 3D2FA 3ATVA 4RW7A 4DV4K 1HNXK 1QZ6A 5J2NA 2FBYA 4I2QA 3DXKA 4B8AB 3HVRA 2CH5A 2P9NB 5JVGL 3EY1A 1RBVA 4HVJA 5GAEP 2ZF5O 1K8AO 3O4WA 4WQ5C 3AAPA 4CZJA 3CJBA 2QTDA 1OH5A 1LCUA 1EO1A 3PX0A 4BRQA 5EX5A 1QSYA 2QWQA 5GADP 5HOOA 4DTMA 3AV9A 3NF7A 2KTQA 3PSFA 3ZSYA 3ZT3A 1XWLA 3BDPA 4BRNA 3TAQA 3P1GA 4CF9A 4CJUA 4LF8K 3K0SA 3ZLJA 1S1VA 3BP8A 5M1KA 5AQXA 3RVCA 5JS1A 2I7NA 3GG4A 4XH5A 3HSTB 1TK5A 1WSGA 1L5UA 1C1CA 3LPUA 3DOLA 4ID5A 4G1QA 3AAQA 3SK3A 4DLEA 3ZYYX 1VRUA 3L2RA 4FYDA 2V52B 4B9VA 5BRHA 1GLBG 1R0AA 2PZSA 3KLHA 4MDBA 2XRIA 2P9KB 5AQIA 4JD2B 4B1ZA 3CCQN 3O3GA 3MN6A 3L4QA 1TL3A 1RT4A 4DLGA 2X74A 5E41A 4C8MA 3OYLA 5LMNK 2NNWA 3FZFA 2A3ZA 3O9QA 3ZX2A 3SQ4A 4DTUA 4FPAA 4Z4IA 3OS0A 2EWSA 4KHYA 4E7JA 4E7LA 3BF3A 1BGXT 5AQLA 5AQRA 1NGBA 1EQYA 1U47A 4M45A 3L2WA 3DI6A 1KD1O 3Q7CA 3VGLA 3UE5A 3CJCA 1TKZA 3MN5A 2W6KA 1E4GT 4CF0A 3NH0A 4L8RB 3HSCA 4DR7K 3THXA 4CW7B 4BREA 4CFBA 1KLNA 5I42A 3H6EA 1LWCA 3A5LC 3EN9A 3HVTA 4GVMA 5BR9A 1NK4A 1ILYA 3SBTA 4BDZA 3RRGA 1Q18A 2F7TA 1NMNA 1EX4A 1W97L 2ZJPL 1XHXA 1BHLA 1BG3A 5MLCQ 1LWEA 1OH7A 1G99A 4B3MK 3WQTA 1DLOA 1YJNN 4Z4EA 3KVGA 4ELUA 1B92A 1FKPA 5JICA 4FWNA 4I2PA 3NE6A 4ISGA 4QAGA 3RMCA 1S1WA 1EP4A 4JN4A 2ZJQL 2P9IA 3NAEA 1BOTO 3JS6A 4KREA 3AARA 3KTQA 2HHWA 1ZXOA 4HUGA 3PLAA 1X9WA 2DFHA 2P9LB 2V51B 2UXCK 4E89A 1HNWK 4AF1A 3LALA 5AQUA 3FZHA 4X65K 1RBSA 3RMDA 3DLGA 2RHKA 4FWPA 3NMUA 4FZZA 3K5NA 4DFJA 5AQHA 2IAJA 3QEPA 1S22A 4NXMK 4DKWA 5DK5A 4B9TA 2CGJA 5BPLA 3HBTA 3BGRA 2QEXN 3VERA 3SQ0A 1LV5A 2YJFA 1NNEA 3NHGA 1S72N 4QS7A 3NGZA 4HCBA 5TKWA 5LY3A 2IS3A 3OYDA 3MN9A 5AZJB 2Q97A 1NJYA 4W5NA 4A59A 1QS4A 4CERA 1E4FT 3DWLA 4LH5A 3CG7A 5LL6Z 3O80A 1NGCA 2QI2A 3PIPL 3HI0A 4MO4A 3UKRA 4DU4A 5HL7L 3KZBA 3TTCA 5IT9O 4ILHA 1KQSM 1N34K 5AQSA 4KHWA 1BQNA 3TANA 1ASVA 1TGOA 4KTWA 3NCIA 2KQ2A 4DQIA 1BUPA 2BH1A 2X78A 4OKKA 1QTMA 4B1YB 1S6PA 1S5JA 4GKKK 2YCHA 3W3DA 5AZJA 4DV5K 4JI6K 1RBRA 5KTQA 5BREA 1K73O 3SBGA 2OTJN 4DF8A 1KFSA 5AZIB 3IMXA 2D0CA 1NGDA 4FWQA 3D6RA 3SJHA 3QLHA 4DV3K 4FLTA 3DXMA 5FPMA 2FSJA 1BO5O 3F2KA 3D2FB 1JL1A 2BDPA 1JLGA 2E1ZA 1NK5A 2E2NA 2JGUA 5E84A 1ZYQA 4YOUA 1C0UA 1JCEA 3KKSA 3QICA 3MEDA 4GMJB 1NKCA 3L3UA 1YI2N 5I9EB 3LL3A 3WXMB 4BY9C 3MMVA 3O1WA 4EFHA 2ETJA 1SV5A 3WEEA 3UKUA 4WYBA 4KFBA 5M1QA 4PHTX 3CFOA 4FPBA 1BU6O 4IOAL 1BIZA 3SLCA 3WXIA 1IKYA 4M3RA 4JKGB 2W6LA 4RW8A 1ZBSA 3C95A 3KK7A 4K25A 1NJIO 4BRDA 3HYFA 1C1AA 3VPZA 3HOSA 3CJAA 1T3VA 4H5RA 4AQYK 4BRHA 3DLLL 4BG9A 3PX4A 4E7IA 3AVNA 1KRPA 4FOIA 4IWVA 1IKWA 5IWAK 5JMVA 4A2BA 4RW6A 1IBKK 4CHZA 3HK2A 3KKRA 1TKXA 3C6HA 4OLAA 4OKEA 2QXFA 4CZEA 4JKGA 3THXB 3MDQA 2ZM6K 1U04A 5A2QO 2IVOA 4JI3K 4JI7K 4OPAA 2UXBK 1F21A 3DOKA 2G8WA 4YDUA 4CJSA 1REVA 1XMQK 4DV7K 4IFVA 4FJKA 4FSVA 4B3TK 1WAFA 2WC9A 3OHRA 4B8CA 3VQ9A 3FZLA 1I94K 4LFBK 4M42A 4BR4A 5BPMA 4YFUA 4H5VA 4JI4K 2E2QA 2G8HA 4FWSA 4W5OA 3VEZA 1QHTA 2VG5A 3K58A 1YTAA 2BANA 1DGKN 4IJNA 4KO0A 3KWGA 4OVLA 3ZSVA 3P39A 3EEQA 3QDKA 2WFBA 4K0KK 1GLCG 4B9NA 4XEIA 4Z4CA 3SZ2A 4LF7K 3BZKA 2VYPA 3L4IA 4ZHRA 4BRGA 1UA1A 4DB3A 3KK2A 5B8HA 5AQWA 3VQBA 4C8NA 1HR0K 1LW0A 3CJ9A 4BGBA 3KWIA 4RCHA 1GLFO 4PL7A 3EE9A 3V9SA 2A40A 4RW4A 4ZTJA 3NVKA 4CE9A 1NMDA 5TKYA 4BG8A 1VQPN 4JKCA 3GDQA 2E8AA 2GX9A 3T3FA 4CGDA 1RT3A 3TWHA 4DF4A 4FJ8A 1S9GA 3D2EA 1W9HA 4JKEA 1MDUB 1U2VB 3CHWA 3N4PA 3K5MA 4B9UA 5AQTA 3VOVA 4EAHD 4IXCA 4F3TA 3OS1A 1XUPO 2R7YA 2QXLA 2Q0RA 4FJJA 3THVA 1N6QA 2HBMA 5SZTA 3V1RA 1KAZA 3CFPA 5LMUK 1BCMA 2QWNA 5FRMA 4CK3A 4FWLA 2GWJA 1HRHA 1HX1A 2YI1A 3QEWA 3LANA 5AQQA 1S1TA 2D1KA 4NYFA 1TL1A 3DXMB 3LDQA 3ZETA 3AO4A 3RR8A 1EWQA 2DPNA 3LP0A 3J7AP 3T7ZA 2HHQA 3HM9A 1D5AA 4AHCA 1DTQA 4XH4A 2NZTA 4BWJA 2HMPA 3R6MA 2WUSA 4DSJA 4YDUC 1JLQA 3UKUB 1WSEA 1SKRA 4DV1K 3MEEA 4CGHA 3U6FA 1VHXA 3VGKA 4H5WA 1HKBA 3S9HA 1X9MA 4KAZA 3V6DA 3C94A 5BN9A 4DWIA 4CD1A 1YTUA 4AM6A 4FVUA 1MU2A 1NU0A 3G10A 4CEDA 1VSLA 4O8KA 2NRTA 4HHTA 2HHVA 4R79A 2F9TA 4BRLA 3Q7BA 4R5PA 3HPHA 1NJWA 2F9WA 4CF1A 3FFIA 3U9ZA 1J5EK 1WNSA 1DT9A 2I5JA 5M1NA 3T1AA 3N4QA 1JLEA 4EZ6A 3I33A 4XH1A 1HPMA 3TTDA 2F8TA 1VQON 4FJLA 3TARA 1UOCA 1Z26A 1SZ2A 3MK6A 3LDSA 4LF5K 3QIPA 1T03A 2HHUA 5F0XA 1TUUA 3SUQA 1HQUA 1VSKA 1OKJA 1NG9A 1RT6A 3OYNA 3LP2A 2ZWHA 4BRKA 4DTOA 3M8SA 2IGIA 4RWTA 4CEQA 3W0LA 4DR5K 3MXIA 3CCRN 1WOQA 2F96A 1DEJA 5CYMA 3TR8A 1HJRA 1NLVA 3CPEA 1HUXA 4H0PA 2GUPA 3A2FA 1LAWA 2HMIA 3BY5A 1HNVA 2HHSA 1BI4A 2IVNA 1SL1A 3HPOA 4OGCA 3S41A 1C0GA 5E26A 1NK0A 4M3YA 1IO2A 4WQ4C 3AVIA 1OH6A 5KI6A 3O1BA 4Z94A 1TV6A 2O8FB 3QFPA 3CC4N 2RKIA 3C6TA 1QVGM 5C0YA 2FF6A 2RPIA 4H0TB 3U4LA 4HUFA 3VQCA 3R8EA 3SUOA 3I0RA 2BUPA 3HTVA 1B9FA 4H0OA 2ZD1A 2P51A 1WBBA 4DTRA 5DM6L 2HF4A 4PL8A 3AVKA 4I9LA 4J8FA 2H3GX 3RR7A 4CHNA 3DLBA 2KKZA 4LFCK 4QCLA 2HVHA 3K59A 4DFKA 1NGHA 3AGKA 3HO1A 4IFEA 4N76A 1ATSA 4PKIA 4CJVA 1BA1A 3AGRA 4YOTA 4H5TA 2Z1JA 4CEFA 3LDLA 3RRHA 1WUAA 4CZKA 2ITGA 1XNQK 4JS4A 4FJHA 4M41A 1ZBLA 2UXDK 1SL0A 1J5OA 4BVPA 1WBDA 2E2OA 4HTUA 4CGFA 3VQEA 2D0AA 2QWPA 4MDAA 4FJGA 3AA3A 2XY5A 3OJSA 2Z1IA 2F4VK 2YX6A 4CF2A 4ILGB 4CFCA 4C8OA 1VQMN 4DSLA 4IEIA 1Q8IA 4BVOA 1X9JA 2O8CB 3HL8A 4JEPA 5CZ2A 4BWMA 1YITN 5FRNA 1RDWX 1YVUA 4DQ8A 5JLHA 3LAMA 3WNGA 5BN8A 2JWKA 3R9PA 4CJRA 3G25A 1VSFA 1VSMA 1Y97A 2P9PA 2QA4N 3JXUA 1S6QA 4DQSA 3PV8A 4BE1A 2ZJRL 1O13A 1HNIA 4CK2A 2Z1GA 5FDLA 1NK9A 1G15A 5GAHP 1RDDA 3TAEA 4K41A 3V1OA 4O55A 4JKAA 3OYEA 2ZGYA 2HHHK 1WB9A 3ZT1A 3B6OA 3KD1E 4B08A 3A8YA 1YHQN 4DV2K 1TK8A 3TABA 3SNNA 4BRIA 1BIUA 1L3UA 2HOEA 4H4OA 4KHPK 3IKMA 4LF4K 4M3WA 4YOVA 3M8PA 2OCEA 1XC9A 3T1HK 4JD2A 2D0PA 1NKBA 4CJKA 3THWA 3CD6N 4CEEA 4FLWA 4DTJA 3D45A 3V9UA 1YJWN 4KRFA 3VF2A 5M1FA 3QEVA 5AQZA 1OVQA 4IOXA 2Q0UA 2ITMA 3HZ6A 1BQMA 4JRQA 4JV5K 4DSEA 2YHWA 4DMNA 1QSSA 4Q5VA 4FO0A 1UA0A 3VEWA 2FBXA 1C6VA 1C0TA 3H1QA 2XY6A 3HM8A 3M8QA 4CF8A 3SV4A 3L8BA 2HNZA 5D3GA 4O5BA 1XHZA 3MN7A 4JI5K 3MX5A 3HP9A 3OY9A 4O4GA 1O1WA 3ZSZA 3J8AA 3FE1A 3NFAA 1ITGA 3R1XA 3U3GA 3E66A 3PY8A 2P5GA 4C1NK 3RTVA 2QWRA 3ZSRA 4E7KA 3DRSA 2KLAA 2G8VA 3QERA 1Q7YO 1NJZA 3F9KA 3A0IX 2Q2RA 4KI4A 1HYVA 4LD0A 3DYAA 4AHSA 3P4IA 3WQUA 4DUZK 1Q9XA 3G0ZA 4PA1A 4CD3A 1FKOA 4EHUA 3S3NA 2FC0A 4CJTA 1NGIA 1RDBA 3BEXA 1XC3A 1RDAA 3EL2A 4X64K 5CYQA 1JLCA 1NBWA 3EYZA 3AVGA 1TVRA 2HW3A 2IDOA 3VGMA 5CHIA 1KVAA 2V7YA 4IO8A 3WT0A 3H08A 5HRRA 4CGIA 4FK4A 3WNFA 1JCGA 1Y64A 3DLHA 3JSMA 4N47A 1VK0A 3G4SN 4JI1K 4FZXC 1VQ9N 3QNOA 4CZHA 1RT5A 2G8UA 3SPYA 4Z4GA 5AQPA 5KRTA 2O8BB 3OVNA 3ULEA 4CZMA 2BGGA 2KW4A 1N5YA 3OYCA 4CVNE 2X6SA 1U4BA 1IG9A 4LSNA 1N32K 4NXNK 1S9EA 4DR6K 4GY2B 1ATRA 3O3FA 4DR1K 1M90O 2HHTA 3A5MC 3VQ7A 3L3VA 3ZEUA 1ZBHA 3DLKA 5CZ1A 2AJQA 5T7BA 3GE1A 2W40A 3I0SA 5EY4A 2UU9K 4HWIA 3D2EB 4BQLA 4CJLA 2OPSA 5CY4A 2F8SA 1SL2A 3T19A 1V4TA 1OVYA 4PKGA 3T69A 4JKHA 4DU1A 2EX3A 4LFAK 5M1OA 1QE1A 1QZ5A 1EETA 3B6PA 4F9OA 2GELA 3VQAA 2P9LA 2YNFA 2XO7A 2Y1JA 1GOBA 1T05A 2IVPA 2GUIA 2D5RA 3CM5A 4FWOA 2W41A 4J2DA 2YHBA 3ENOA 4DTXA 3MXMA 1JLFA 1RT7A 4AHUA 4LF9K 1ATNA 1GLEG 4ISEA 4DHYA 2FBTA 4CHQA 4DS4A 1IBLK 3I8DA 2P9NA 3VF6A 3SI6A 4N5SA 1VSEA 3AA5X 3LZIA 2E6MA 2OPPA 2HHXA 3WXKA 3MWTA 4DFMA 3SUNA 3EKSA 4DR2K 2KHOA 1CZ9A 3NDKA 5DM7L 4CJWA 3KD5E 5BR8K 4FVMA 4BDPA 3NVMA 1WSJA 4W5QA 4FXDA 4GVEA 5KQ8A 4YOWA 5C15A 4LY7A 3G6EN 1YAGA 1JLAA 4CK1A 1T6DA 2FBVA 3SJJA 1EWRA 4FWKA 4FLZA 3ZX3A 3THWB 4CEOA 4KHSA 2CGLA 3H3NO 3PIOL 1VSDA 4LC9B 3V4IA 5FROA 3QO9A 3C7NA 3AO5A 4F2SA 4NCBA 4DUYK 2QKKA 4JI0K 4E3SA 3UB5A 4BR7A 2ZE2A 5AR0A 5C42A 4BGAA 1IH7A 3VESA 3MCPA 3WXJA 2KZMA 1GLDG 2QM1A 3SCXA 1C0MA 5CR4A 1LAVA 3AA4A 3O9SA 3EE8A 1NK8A 3L6QA 3ID8A 2PY5A 2D4WA 3L2QA 4BR9A 2QWMA 3SMPA 2V7ZA 3A5NC 1J6ZA 2QKBA 3RMBA 2P9UB 1EKEA 4CJ3A 2E6LA 4CZLA 2OPQA 4FJIA 1SQKA 4I7FA 2PBDA 2ATQA 5J2MA 2E1YA 3NBPA 4CIGA 4FM2A 1QQMA 3IAYA 1RTHA 3BF1A 4KHUA 4A5AA 4DV0K 4CGGA 3KIOA 1K8KB 3TU5A 4KV8A 4OX9K 2VQFK 2A5XA 1ZBUA 1NJXA 1NGJA 3TTFA 3CF5L 4K42A 4Z0UA 2A41A 3DRPA 4BDYA 2D0OA 5AQOA 3CQXA 4A2AA 4ID1A 2NRXA 5KQDA 4WCEL 3KK1A 1ZBIA 4QS8A 3TAFA 4TSXA 3AVCA 1A5WA 3J7YP 3NH2A 2EHGA 3EZ5A 1MWMA 2XY7A 3V9ZA 5GIOA 1BWFO 3DLRA 5AJ3K 5LJWA 1T6CA 4NCAA 3O5BA 3AVAA 3L2UA 2CH6A 1KFDA 1RBTA 1NOZA 2LSNA 4RTFD 4CI6A 3OYJA 2D0BA 3H45C 4F8RA 3QETA 3TAPA 3SUPA 2J4RA 3C6UA 4I6MB 1FW6A 2YHYA 3V9XA 3O9UA 1QSLA 2WOMA 1BCOA 2E4LA 3TI0A 4CESA 4YOYA 2E88A 5AQNA 4OPKA 1TAQA 1NKEA 2YJEA 4GW6A 4FZYA 4KPYA 1WAJA 2Y1IA 1Q86O 3P31A 5C12A 4YHHK 3E1YA 3QNNA 5BPNA 1XMOK 4OJRA 4DS5A 4WFNL 4DSIA 3ULDA 3CCLN 4O8UA 2G8FA 3VTHA 5AFUH 4J2BA 3HT3A 1GOCA 4JHDB 4O0IA 4UQGA 3J80O 1X1PA 1NGFA 4PKHA 2FF3B 1A5XA 3ITHA 1J53A 4CJFA 1VQ7N 3ZT0A 4XIUA 4E1MA 3QINA 1Z05A 3CFRA 1D9FA 3V1QA 3LPTA 3AVLA 3O08A 3LWMA 4BC3A 1MA9B 3I56N 4KB0A 4KH4A 5FLXO 1KLMA 3V9WA 1I39A 1NGGA 2P9SA 4ILJA 1HQEA 3AO1A 3IUCA 4OLBA 4BR0A 4F2RA 4H0XB 2Q3SA 3OA9A 3EO3A 2PYJA 4Y1DA 4NLBA 4DR4K 2QK9A 1TUYA 1W7AA 4FM1A 5HLFA 1JXEA 3M6GA 4M63C 3DRRA 3CMEN 1SUQA 4NLCA 4JI2K 5AQYA 4B1WB 4OKJA 2RF2A 4ICLA 4CJ5A 1CZAN 2NUBA 4IZ9A 1P90A 3AVFA 4FOEA 3ZT2A 4NO7A 5C2DA 3VENA 3SAFA 2E20A 3LP3A 2P9KA 3C65A 1RT1A 3IG1A 3VTIA 4KB1A 3CYMA 4C23A 2X6NA 3O8MA 4WF9L 4U7BA 1Q81O 4CGJA 1QQNA 1A5VA 2OA8A 1RDCA 5EVZA 3ZSQA 4H0VB 4KH5A 2G8IA 1T7PA 4BR5A 1M1KO 4JKDA 3OYKA 3OYIA 3HJFA 2HSTA 4X66K 3SMSA 5HROA 3AA2A 4KTZA 1RGIA 4FLVA 4WFAL 2DTUA 4FLUA 3G71N
chains in the Genus database with same CATH topology
2FBXA 1C6VA 3CFOA 2IOCA 4CEZA 1C0TA 1BIZA 3RWUA 2XY6A 4KHQA 3AO3A 3K2PA 1IKYA 4M3RA 4QOZB 3M8QA 4CF8A 3SV4A 3L8BA 2HNZA 5D3GA 3AVHA 4RW8A 4O5BA 1XHZA 3C95A 2YKNA 5KGWA 3HP9A 3OY9A 4O4GA 3HYFA 3VA0A 1O1WA 1C1AA 3ZSZA 3ASMA 2VG7A 4AILC 2YHAA 2HVIA 4E19A 3NFAA 1ITGA 3U3GA 3PX6A 4B9SA 3QIOA 3NF9A 3PX4A 3PY8A 4E7IA 3AVNA 2P5GA 1Q9YA 3RTVA 1KTQA 1KRPA 3PO4A 1D8YA 3ZSRA 4E7KA 1IKWA 3DRSA 3ZSWA 2G8VA 4RW6A 3QERA 2Z1HA 4FLXA 4CFAA 3PUFA 1GOAA 3OYHA 3MECA 4CHZA 4CFDA 3HXMA 3E01A 4FM0A 3F9KA 3KKRA 3D0PA 4KI6A 3HK2A 1TKXA 4DSKA 4BACA 4OLAA 4OKEA 1ASWA 1QQCA 2QXFA 3ALYA 4KI4A 1J54A 1HYVA 4LD0A 1L3SA 4FK0A 3DYAA 4AHSA 1Q9XA 1KCFA 3G0ZA 4PA1A 2VWKA 1BISA 1FKOA 4CHOA 2B6AA 3S3NA 2FC0A 1U04A 4CJTA 1RDBA 1RDAA 3K5OA 4DFPA 3NH1A 4FJ7A 1BI4B 1F21A 5CYQA 1JLCA 3DOKA 4BE0A 2G8WA 4AHVA 4CJSA 1REVA 3VQ8A 4M3TA 3EYZA 4IFYA 5J2PA 3AVGA 1TVRA 4IFVA 4CHYA 2IDOA 4NYNA 3UIQA 4FJKA 4PY5A 2HW3A 4IG3A 1KVAA 1WAFA 3OYGA 4FK2A 4PWDA 3AVBA 3ZCMA 1JLBA 3H08A 5HRRA 4DG1A 4CGIA 4FK4A 3WNFA 4B8CA 3VQ9A 4WE1A 4E0DA 3LAKA 4FW2A 3DLHA 2VWJA 4FW1A 4M42A 1CXUA 3WNHA 4N47A 3JSMA 4M3XA 1VK0A 2KZZA 4FZXC 1RNHA 3QNOA 4YFUA 3QEXA 2B5JA 1RT5A 1NK6A 3QEIA 3SPYA 2G8UA 4F3OA 4Z4GA 3KLIA 5KRTA 3K57A 2G8HA 3OVNA 4W5OA 1RBUA 3ISNC 3OJUA 4LH4A 2BGGA 3ZT4A 4Y1CA 4M3UA 3S3OA 3MEGA 2KW4A 5DMRA 1N5YA 3OYCA 4B3OA 1QHTA 2VG5A 3K58A 2X6SA 1U4BA 1IG9A 1YTAA 1VRTA 4IBNA 4LSNA 2BANA 2DFFA 4KO0A 4K8ZA 1S9EA 2OZMA 3MXJA 3O3FA 4OVLA 3ZSVA 4DQRA 4DTSA 1TAUA 3SYZA 1RTJA 1W0HA 3AVMA 4W5TA 2HHTA 2W42A 3VQ7A 4B9NA 3L3VA 1ZBHA 4Z4CA 2O4IA 3DLKA 3DMJA 3SZ2A 3RMAA 4K8XA 3P5JA 5CZ1A 4ZHRA 1VSHA 2AJQA 5T7BA 1UA1A 3I0SA 3KK2A 4EP5A 5HP1A 4DQQA 1UWBA 5HRNA 1I3AA 1ZBFA 4IG0A 4CECA 2HB5A 4CJLA 5C24A 2B4JA 1WLJA 2OPSA 3VQBA 4C8NA 5CY4A 3VQ6A 4KHNA 3OYFA 5HRPA 2F8SA 1SL2A 1LW0A 1WSIA 3T19A 4N56A 4H8KA 1HMVA 2PYLA 1HYZA 4CEBA 4MFBA 1JXBA 4HCCA 3V9SA 4DU1A 2EX3A 3MAQA 3ZSXA 4FJNA 2YV0X 1QE1A 2WONA 4NCGA 4RW4A 1EETA 1FK9A 4ZTJA 3B6PA 4CE9A 3TAGA 1K6YA 3VQAA 4RW9A 1S1XA 2YNFA 2XO7A 1WSHA 1GOBA 4CHPA 2Y1JA 1T05A 3KLGA 3T3FA 4CGDA 4ZTFA 2GUIA 2D5RA 3CM5A 3O3HA 1U49A 4EZ9A 1RT3A 3TWHA 4DF4A 2A1RA 4FJ8A 3OYMA 1S9GA 4AH9A 4J2DA 1HPZA 2YHBA 4DTXA 3MXMA 1JLFA 1RT7A 1W9HA 4AHUA 5KGXA 2FBTA 4CHQA 4DS4A 3K5MA 3I8DA 2BE2A 3NGYA 4B9UA 2DY4A 3SI6A 1TKTA 4N5SA 1FXXA 1VSEA 2HNDA 3AA5X 4F3TA 3LZIA 4FLYA 2E6MA 3OS1A 2OPPA 4RW7A 2R7YA 2OZSA 4FJJA 2HHXA 3THVA 1N6QA 3SQ1A 5SZTA 3V1RA 3AVJA 3CFPA 2FBYA 1BCMA 5J2NA 4DFMA 4I2QA 4CK3A 3SUNA 4B8AB 3HVRA 5FRMA 3EY1A 1RBVA 1HRHA 2XY8A 4FJ5A 1RT2A 4HVJA 1CZ9A 3NDKA 4CJEA 3QEWA 3DM2A 4CJWA 3LANA 3KD5E 1S1TA 4FVMA 4NYFA 1TL1A 4OPJA 1WSJA 3V81A 4BDPA 4C8KA 4W5QA 3PX0A 3RR8A 3AO4A 4M3ZA 4FXDA 1QSYA 1XI1A 4KKOA 3LP0A 2XHBA 1LW2A 2HHQA 1TK0A 3HM9A 1D5AA 2O4GA 4AHCA 1DTQA 4DTMA 3AV9A 3NF7A 4LY7A 4CIFA 1JLAA 1JKHA 4BWJA 4CK1A 3KJVA 4J2EA 4E7HA 2KTQA 2FBVA 3SJJA 1Z25A 3ZSYA 3ZT3A 1XWLA 4DSJA 1JLQA 4W5RA 3BDPA 4FLZA 1D9DA 1WSEA 1SKRA 3TAQA 3MEEA 4CGHA 3P1GA 4CF9A 5KRSA 4CJUA 3F73A 2RN2A 4CEOA 3U6FA 3S9HA 5I3UA 1X9MA 4KHSA 1C1BA 4FJ9A 1SKSA 1VSDA 2P1JA 1S1VA 3V6DA 1SKWA 1WSFA 3V4IA 4KAZA 3C94A 2KFNA 2DFEA 4DWIA 1YT3A 1YTUA 5JS1A 4Z4FA 1MU2A 3G10A 4CEDA 1CXQA 1VSLA 3QO9A 3HSTB 5FROA 4HHTA 1TK5A 3AO5A 1WSGA 4JS5A 2HHVA 1L5UA 4HUEA 4F2SA 1C1CA 4NCBA 1NJZA 3LPUA 3ZSOA 3DOLA 4ID5A 4G1QA 2QKKA 2IC3A 4E3SA 4Z4HA 4R5PA 3HPHA 2ZE2A 3CQ8A 1NJWA 4DLEA 2GBZA 5C42A 4CF1A 3FFIA 1VRUA 1IH7A 3L2RA 1WNSA 4FYDA 4RG8A 2KZMA 4B9VA 2I5JA 3T1AA 3SCXA 4AHRA 1C0MA 1R0AA 1JLEA 2PZSA 1LAVA 3KLHA 3AA4A 2XRIA 4EZ6A 3IS9A 3OYAA 3LZJA 2F8TA 3O3GA 3O4QA 1TL3A 4FJLA 3TARA 1NK8A 1UOCA 1RT4A 4DLGA 1Z26A 2PY5A 4JLHA 2X74A 4EP4A 5E41A 3LDSA 3QIPA 4C8MA 1T03A 3L2QA 3OYLA 2HHUA 2QKBA 3RMBA 2OYQA 3HPGA 3SUQA 1EKEA 3DLEA 4CJ3A 4CIEA 3SQ4A 1HQUA 2E6LA 1VSKA 4DTUA 4FJXA 3OS0A 4Z4IA 1RT6A 4B9LA 2OPQA 3OYNA 3LP2A 4FJIA 4DTOA 3M8SA 4KHYA 2IGIA 3TAMA 4E7JA 4CEQA 1X9SA 4I7FA 3NF8A 5EU7A 4E7LA 2ATQA 5J2MA 3MXIA 3NBPA 1BGXT 2F96A 5CYMA 4CIGA 4FM2A 3TR8A 1HJRA 1JL2A 1RTHA 4DU3A 3IAYA 4KHUA 1U47A 3A2FA 1LAWA 1NK7A 4M45A 3L2WA 4CGGA 1HNVA 3DI6A 3KIOA 1U48A 4AHTA 2HMIA 4KV8A 3LP1A 2HHSA 1BI4A 1SL1A 3HPOA 4C8LA 4OGCA 1ZBUA 1NJXA 4DQPA 1TKZA 4CF0A 4Z0UA 3AO2A 3NH0A 4L8RB 3DRPA 4BDYA 1NK0A 4M3YA 1IO2A 4ID1A 2YNHA 3S3MA 4CFBA 1KLNA 3AVIA 5I42A 4IDKA 5KI6A 3KK1A 1ZBIA 1LWCA 1TV6A 5J2QA 3TAFA 4B9MA 3VN5A 3HVTA 2P5OA 4GVMA 1NK4A 4TSXA 2RKIA 3AVCA 1A5WA 3C6TA 2RPIA 4HUFA 3NH2A 4JRPA 4BDZA 3RRGA 2EHGA 3VQCA 1VSIA 3SUOA 3I0RA 3EZ5A 1RCHA 1NOYA 2XY7A 1EX4A 1UAXA 3V9ZA 3DLRA 4CEAA 3OS2A 3U3YA 4NCAA 1B9FA 1BHLA 1J9AA 1XHXA 2P51A 1LWEA 2ZD1A 3AVAA 1EXQA 3VQDA 3L2UA 4FCYA 4DTRA 1KFDA 1DLOA 1NOZA 1RBTA 2LSNA 4Z4EA 3OYJA 3AVKA 1WN7A 1B92A 1FKPA 4I9LA 2D0BA 4ELUA 4PQUA 4CJPA 4F8RA 3CM6A 4I2PA 3NE6A 3QETA 4N41A 3RR7A 4CHNA 4QAGA 3TAPA 3DLBA 3SUPA 3C6UA 4QCLA 2HVHA 3K59A 3V9XA 3RMCA 1S1WA 1QSLA 2WOMA 1BCOA 1EP4A 2E4LA 4DSFA 4DFKA 3TI0A 4CESA 3NAEA 2JLEA 4KREA 3KTQA 3HO1A 4N76A 4CJVA 4OPKA 1TAQA 4F4KA 1NKEA 4GW6A 3SPZA 2HHWA 4HUGA 4FZYA 1X9WA 2Z1JA 3VQPA 4KPYA 2DFHA 1WAJA 4CEFA 2Y1IA 4E89A 3RRHA 3LALA 3SQ2A 1TKDA 4DTNA 5SWMA 3QNNA 1BL3A 2ITGA 1RBSA 3L2VA 4OJRA 4JS4A 3RMDA 4DS5A 4M41A 4FJHA 1ZBLA 3DLGA 4DSIA 4IKFA 4FZZA 3K5NA 3ULDA 1SL0A 4DFJA 1J5OA 3LWLA 2G8FA 2IAJA 4HTUA 4CGFA 4CJ4A 3QEPA 1U45A 3KLFA 1RTDA 3VQQA 3VQEA 3HT3A 4J2BA 5C25A 1GOCA 4O0IA 4UQGA 1X1PA 5DK5A 2D0AA 4B9TA 4MQ3A 1A5XA 3BGRA 4FJGA 3ITHA 4FJMA 1J53A 4CJFA 3AA3A 2XY5A 3OJSA 1CLQA 1ASUA 3SQ0A 3ZT0A 2Z1IA 4XIUA 3NF6A 4CF2A 1LV5A 2ZQBA 4I9QA 4CFCA 4DTPA 4YNQA 4E1MA 3NHGA 4C8OA 3NGZA 4HCBA 2YKMA 3QINA 4CJQA 2IS3A 3CFRA 1Q8IA 3OYDA 1D9FA 4DSLA 3KK3A 3V1QA 2GV9A 3VA3A 3LPTA 3AVLA 4O44A 3HL8A 1NJYA 4W5NA 2G8KA 1QS4A 3O4NA 4CERA 3LWMA 1VSJA 5CZ2A 4LH5A 4BWMA 4KB0A 4J2AA 5FRNA 1YVUA 3JYTA 1KLMA 3V9WA 3CG7A 1I39A 4ELTA 2OPRA 3LAMA 3WNGA 3HP6A 4CCHA 4DU4A 1RILA 4CJRA 1HQEA 1VSFA 3VQ5A 1VSMA 1Y97A 3AO1A 1S6QA 4DQSA 4KHWA 3PV8A 4OLBA 4BE1A 4F2RA 1BQNA 3SV3A 1HNIA 4CK2A 3K5LA 4Q0BA 3TANA 2Z1GA 2Q3SA 2PYJA 5FDLA 1NK9A 1ASVA 4Y1DA 1B9DA 1G15A 1TGOA 4KTWA 3NCIA 2KQ2A 4DQIA 2VG6A 4OKKA 1RDDA 2X78A 1QTMA 2QK9A 1S6PA 1S5JA 4OGEA 1RBRA 3TAEA 5KTQA 1IKVA 4FM1A 5HLFA 1JXEA 1L3TA 3V1OA 4O55A 3OYEA 5HBMA 4DF8A 1KFSA 3DRRA 3PO5A 1SUQA 1DTTA 3ZT1A 3B6OA 3OYBA 3KD1E 4B08A 3VQ4A 1IKXA 2RF2A 4ICLA 4OKJA 4CJ5A 2D0CA 4FLTA 3QLHA 1TK8A 2NUBA 1KVBA 3TABA 3SNNA 3AVFA 4LSLA 1BIUA 1JL1A 3QESA 1L3UA 2BDPA 1S1UA 4H4OA 3ZT2A 1JLGA 5HRSA 5JS2A 4ELVA 2A1SA 4M3WA 1NK5A 3IRXA 3P83D 3LP3A 2JGUA 3M8PA 4H4MA 2HNYA 1XC9A 4KTQA 1LWFA 5K14A 1RT1A 3IG1A 1ZYQA 4KB1A 4PUOA 1C0UA 3CYMA 3KKSA 2X6NA 1NKBA 4CGJA 3MEDA 1A5VA 4GMJB 4CJKA 2OA8A 4CEEA 1RDCA 3ZSQA 3L3UA 5J1EA 1NKCA 4FLWA 4DTJA 2G8IA 1HYSA 1T7PA 2YNIA 3D45A 3V9UA 3M8RA 4KRFA 3HJFA 3OYKA 3OYIA 4BE2A 3QEVA 1CZBA 4O0JA 1L3VA 5HROA 3WNEA 3AA2A 4JRQA 1BQMA 4KTZA 1KVCA 4E1NA 2KFZA 3NGIA 2YNGA 4DSEA 2ETJA 4FLVA 1KSPA 1SV5A 3KLEA 2DTUA 4DMNA 1QSSA 4Q5VA 4FLUA 1UA0A 1RTIA 1T8EA 4KFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBX A;  1C6V A;  3CFO A;  2IOC A;  4CEZ A;  1C0T A;  1BIZ A;  3RWU A;  2XY6 A;  4KHQ A;  3AO3 A;  3K2P A;  1IKY A;  4M3R A;  4QOZ B;  3M8Q A;  4CF8 A;  3SV4 A;  3L8B A;  2HNZ A;  5D3G A;  3AVH A;  4RW8 A;  4O5B A;  1XHZ A;  3C95 A;  2YKN A;  5KGW A;  3HP9 A;  3OY9 A;  4O4G A;  3HYF A;  3VA0 A;  1O1W A;  1C1A A;  3ZSZ A;  3ASM A;  2VG7 A;  4AIL C;  2YHA A;  2HVI A;  4E19 A;  3NFA A;  1ITG A;  3U3G A;  3PX6 A;  4B9S A;  3QIO A;  3NF9 A;  3PX4 A;  3PY8 A;  4E7I A;  3AVN A;  2P5G A;  1Q9Y A;  3RTV A;  1KTQ A;  1KRP A;  3PO4 A;  1D8Y A;  3ZSR A;  4E7K A;  1IKW A;  3DRS A;  3ZSW A;  2G8V A;  4RW6 A;  3QER A;  2Z1H A;  4FLX A;  4CFA A;  3PUF A;  1GOA A;  3OYH A;  3MEC A;  4CHZ A;  4CFD A;  3HXM A;  3E01 A;  4FM0 A;  3F9K A;  3KKR A;  3D0P A;  4KI6 A;  3HK2 A;  1TKX A;  4DSK A;  4BAC A;  4OLA A;  4OKE A;  1ASW A;  1QQC A;  2QXF A;  3ALY A;  4KI4 A;  1J54 A;  1HYV A;  4LD0 A;  1L3S A;  4FK0 A;  3DYA A;  4AHS A;  1Q9X A;  1KCF A;  3G0Z A;  4PA1 A;  2VWK A;  1BIS A;  1FKO A;  4CHO A;  2B6A A;  3S3N A;  2FC0 A;  1U04 A;  4CJT A;  1RDB A;  1RDA A;  3K5O A;  4DFP A;  3NH1 A;  4FJ7 A;  1BI4 B;  1F21 A;  5CYQ A;  1JLC A;  3DOK A;  4BE0 A;  2G8W A;  4AHV A;  4CJS A;  1REV A;  3VQ8 A;  4M3T A;  3EYZ A;  4IFY A;  5J2P A;  3AVG A;  1TVR A;  4IFV A;  4CHY A;  2IDO A;  4NYN A;  3UIQ A;  4FJK A;  4PY5 A;  2HW3 A;  4IG3 A;  1KVA A;  1WAF A;  3OYG A;  4FK2 A;  4PWD A;  3AVB A;  3ZCM A;  1JLB A;  3H08 A;  5HRR A;  4DG1 A;  4CGI A;  4FK4 A;  3WNF A;  4B8C A;  3VQ9 A;  4WE1 A;  4E0D A;  3LAK A;  4FW2 A;  3DLH A;  2VWJ A;  4FW1 A;  4M42 A;  1CXU A;  3WNH A;  4N47 A;  3JSM A;  4M3X A;  1VK0 A;  2KZZ A;  4FZX C;  1RNH A;  3QNO A;  4YFU A;  3QEX A;  2B5J A;  1RT5 A;  1NK6 A;  3QEI A;  3SPY A;  2G8U A;  4F3O A;  4Z4G A;  3KLI A;  5KRT A;  3K57 A;  2G8H A;  3OVN A;  4W5O A;  1RBU A;  3ISN C;  3OJU A;  4LH4 A;  2BGG A;  3ZT4 A;  4Y1C A;  4M3U A;  3S3O A;  3MEG A;  2KW4 A;  5DMR A;  1N5Y A;  3OYC A;  4B3O A;  1QHT A;  2VG5 A;  3K58 A;  2X6S A;  1U4B A;  1IG9 A;  1YTA A;  1VRT A;  4IBN A;  4LSN A;  2BAN A;  2DFF A;  4KO0 A;  4K8Z A;  1S9E A;  2OZM A;  3MXJ A;  3O3F A;  4OVL A;  3ZSV A;  4DQR A;  4DTS A;  1TAU A;  3SYZ A;  1RTJ A;  1W0H A;  3AVM A;  4W5T A;  2HHT A;  2W42 A;  3VQ7 A;  4B9N A;  3L3V A;  1ZBH A;  4Z4C A;  2O4I A;  3DLK A;  3DMJ A;  3SZ2 A;  3RMA A;  4K8X A;  3P5J A;  5CZ1 A;  4ZHR A;  1VSH A;  2AJQ A;  5T7B A;  1UA1 A;  3I0S A;  3KK2 A;  4EP5 A;  5HP1 A;  4DQQ A;  1UWB A;  5HRN A;  1I3A A;  1ZBF A;  4IG0 A;  4CEC A;  2HB5 A;  4CJL A;  5C24 A;  2B4J A;  1WLJ A;  2OPS A;  3VQB A;  4C8N A;  5CY4 A;  3VQ6 A;  4KHN A;  3OYF A;  5HRP A;  2F8S A;  1SL2 A;  1LW0 A;  1WSI A;  3T19 A;  4N56 A;  4H8K A;  1HMV A;  2PYL A;  1HYZ A;  4CEB A;  4MFB A;  1JXB A;  4HCC A;  3V9S A;  4DU1 A;  2EX3 A;  3MAQ A;  3ZSX A;  4FJN A;  2YV0 X;  1QE1 A;  2WON A;  4NCG A;  4RW4 A;  1EET A;  1FK9 A;  4ZTJ A;  3B6P A;  4CE9 A;  3TAG A;  1K6Y A;  3VQA A;  4RW9 A;  1S1X A;  2YNF A;  2XO7 A;  1WSH A;  1GOB A;  4CHP A;  2Y1J A;  1T05 A;  3KLG A;  3T3F A;  4CGD A;  4ZTF A;  2GUI A;  2D5R A;  3CM5 A;  3O3H A;  1U49 A;  4EZ9 A;  1RT3 A;  3TWH A;  4DF4 A;  2A1R A;  4FJ8 A;  3OYM A;  1S9G A;  4AH9 A;  4J2D A;  1HPZ A;  2YHB A;  4DTX A;  3MXM A;  1JLF A;  1RT7 A;  1W9H A;  4AHU A;  5KGX A;  2FBT A;  4CHQ A;  4DS4 A;  3K5M A;  3I8D A;  2BE2 A;  3NGY A;  4B9U A;  2DY4 A;  3SI6 A;  1TKT A;  4N5S A;  1FXX A;  1VSE A;  2HND A;  3AA5 X;  4F3T A;  3LZI A;  4FLY A;  2E6M A;  3OS1 A;  2OPP A;  4RW7 A;  2R7Y A;  2OZS A;  4FJJ A;  2HHX A;  3THV A;  1N6Q A;  3SQ1 A;  5SZT A;  3V1R A;  3AVJ A;  3CFP A;  2FBY A;  1BCM A;  5J2N A;  4DFM A;  4I2Q A;  4CK3 A;  3SUN A;  4B8A B;  3HVR A;  5FRM A;  3EY1 A;  1RBV A;  1HRH A;  2XY8 A;  4FJ5 A;  1RT2 A;  4HVJ A;  1CZ9 A;  3NDK A;  4CJE A;  3QEW A;  3DM2 A;  4CJW A;  3LAN A;  3KD5 E;  1S1T A;  4FVM A;  4NYF A;  1TL1 A;  4OPJ A;  1WSJ A;  3V81 A;  4BDP A;  4C8K A;  4W5Q A;  3PX0 A;  3RR8 A;  3AO4 A;  4M3Z A;  4FXD A;  1QSY A;  1XI1 A;  4KKO A;  3LP0 A;  2XHB A;  1LW2 A;  2HHQ A;  1TK0 A;  3HM9 A;  1D5A A;  2O4G A;  4AHC A;  1DTQ A;  4DTM A;  3AV9 A;  3NF7 A;  4LY7 A;  4CIF A;  1JLA A;  1JKH A;  4BWJ A;  4CK1 A;  3KJV A;  4J2E A;  4E7H A;  2KTQ A;  2FBV A;  3SJJ A;  1Z25 A;  3ZSY A;  3ZT3 A;  1XWL A;  4DSJ A;  1JLQ A;  4W5R A;  3BDP A;  4FLZ A;  1D9D A;  1WSE A;  1SKR A;  3TAQ A;  3MEE A;  4CGH A;  3P1G A;  4CF9 A;  5KRS A;  4CJU A;  3F73 A;  2RN2 A;  4CEO A;  3U6F A;  3S9H A;  5I3U A;  1X9M A;  4KHS A;  1C1B A;  4FJ9 A;  1SKS A;  1VSD A;  2P1J A;  1S1V A;  3V6D A;  1SKW A;  1WSF A;  3V4I A;  4KAZ A;  3C94 A;  2KFN A;  2DFE A;  4DWI A;  1YT3 A;  1YTU A;  5JS1 A;  4Z4F A;  1MU2 A;  3G10 A;  4CED A;  1CXQ A;  1VSL A;  3QO9 A;  3HST B;  5FRO A;  4HHT A;  1TK5 A;  3AO5 A;  1WSG A;  4JS5 A;  2HHV A;  1L5U A;  4HUE A;  4F2S A;  1C1C A;  4NCB A;  1NJZ A;  3LPU A;  3ZSO A;  3DOL A;  4ID5 A;  4G1Q A;  2QKK A;  2IC3 A;  4E3S A;  4Z4H A;  4R5P A;  3HPH A;  2ZE2 A;  3CQ8 A;  1NJW A;  4DLE A;  2GBZ A;  5C42 A;  4CF1 A;  3FFI A;  1VRU A;  1IH7 A;  3L2R A;  1WNS A;  4FYD A;  4RG8 A;  2KZM A;  4B9V A;  2I5J A;  3T1A A;  3SCX A;  4AHR A;  1C0M A;  1R0A A;  1JLE A;  2PZS A;  1LAV A;  3KLH A;  3AA4 A;  2XRI A;  4EZ6 A;  3IS9 A;  3OYA A;  3LZJ A;  2F8T A;  3O3G A;  3O4Q A;  1TL3 A;  4FJL A;  3TAR A;  1NK8 A;  1UOC A;  1RT4 A;  4DLG A;  1Z26 A;  2PY5 A;  4JLH A;  2X74 A;  4EP4 A;  5E41 A;  3LDS A;  3QIP A;  4C8M A;  1T03 A;  3L2Q A;  3OYL A;  2HHU A;  2QKB A;  3RMB A;  2OYQ A;  3HPG A;  3SUQ A;  1EKE A;  3DLE A;  4CJ3 A;  4CIE A;  3SQ4 A;  1HQU A;  2E6L A;  1VSK A;  4DTU A;  4FJX A;  3OS0 A;  4Z4I A;  1RT6 A;  4B9L A;  2OPQ A;  3OYN A;  3LP2 A;  4FJI A;  4DTO A;  3M8S A;  4KHY A;  2IGI A;  3TAM A;  4E7J A;  4CEQ A;  1X9S A;  4I7F A;  3NF8 A;  5EU7 A;  4E7L A;  2ATQ A;  5J2M A;  3MXI A;  3NBP A;  1BGX T;  2F96 A;  5CYM A;  4CIG A;  4FM2 A;  3TR8 A;  1HJR A;  1JL2 A;  1RTH A;  4DU3 A;  3IAY A;  4KHU A;  1U47 A;  3A2F A;  1LAW A;  1NK7 A;  4M45 A;  3L2W A;  4CGG A;  1HNV A;  3DI6 A;  3KIO A;  1U48 A;  4AHT A;  2HMI A;  4KV8 A;  3LP1 A;  2HHS A;  1BI4 A;  1SL1 A;  3HPO A;  4C8L A;  4OGC A;  1ZBU A;  1NJX A;  4DQP A;  1TKZ A;  4CF0 A;  4Z0U A;  3AO2 A;  3NH0 A;  4L8R B;  3DRP A;  4BDY A;  1NK0 A;  4M3Y A;  1IO2 A;  4ID1 A;  2YNH A;  3S3M A;  4CFB A;  1KLN A;  3AVI A;  5I42 A;  4IDK A;  5KI6 A;  3KK1 A;  1ZBI A;  1LWC A;  1TV6 A;  5J2Q A;  3TAF A;  4B9M A;  3VN5 A;  3HVT A;  2P5O A;  4GVM A;  1NK4 A;  4TSX A;  2RKI A;  3AVC A;  1A5W A;  3C6T A;  2RPI A;  4HUF A;  3NH2 A;  4JRP A;  4BDZ A;  3RRG A;  2EHG A;  3VQC A;  1VSI A;  3SUO A;  3I0R A;  3EZ5 A;  1RCH A;  1NOY A;  2XY7 A;  1EX4 A;  1UAX A;  3V9Z A;  3DLR A;  4CEA A;  3OS2 A;  3U3Y A;  4NCA A;  1B9F A;  1BHL A;  1J9A A;  1XHX A;  2P51 A;  1LWE A;  2ZD1 A;  3AVA A;  1EXQ A;  3VQD A;  3L2U A;  4FCY A;  4DTR A;  1KFD A;  1DLO A;  1NOZ A;  1RBT A;  2LSN A;  4Z4E A;  3OYJ A;  3AVK A;  1WN7 A;  1B92 A;  1FKP A;  4I9L A;  2D0B A;  4ELU A;  4PQU A;  4CJP A;  4F8R A;  3CM6 A;  4I2P A;  3NE6 A;  3QET A;  4N41 A;  3RR7 A;  4CHN A;  4QAG A;  3TAP A;  3DLB A;  3SUP A;  3C6U A;  4QCL A;  2HVH A;  3K59 A;  3V9X A;  3RMC A;  1S1W A;  1QSL A;  2WOM A;  1BCO A;  1EP4 A;  2E4L A;  4DSF A;  4DFK A;  3TI0 A;  4CES A;  3NAE A;  2JLE A;  4KRE A;  3KTQ A;  3HO1 A;  4N76 A;  4CJV A;  4OPK A;  1TAQ A;  4F4K A;  1NKE A;  4GW6 A;  3SPZ A;  2HHW A;  4HUG A;  4FZY A;  1X9W A;  2Z1J A;  3VQP A;  4KPY A;  2DFH A;  1WAJ A;  4CEF A;  2Y1I A;  4E89 A;  3RRH A;  3LAL A;  3SQ2 A;  1TKD A;  4DTN A;  5SWM A;  3QNN A;  1BL3 A;  2ITG A;  1RBS A;  3L2V A;  4OJR A;  4JS4 A;  3RMD A;  4DS5 A;  4M41 A;  4FJH A;  1ZBL A;  3DLG A;  4DSI A;  4IKF A;  4FZZ A;  3K5N A;  3ULD A;  1SL0 A;  4DFJ A;  1J5O A;  3LWL A;  2G8F A;  2IAJ A;  4HTU A;  4CGF A;  4CJ4 A;  3QEP A;  1U45 A;  3KLF A;  1RTD A;  3VQQ A;  3VQE A;  3HT3 A;  4J2B A;  5C25 A;  1GOC A;  4O0I A;  4UQG A;  1X1P A;  5DK5 A;  2D0A A;  4B9T A;  4MQ3 A;  1A5X A;  3BGR A;  4FJG A;  3ITH A;  4FJM A;  1J53 A;  4CJF A;  3AA3 A;  2XY5 A;  3OJS A;  1CLQ A;  1ASU A;  3SQ0 A;  3ZT0 A;  2Z1I A;  4XIU A;  3NF6 A;  4CF2 A;  1LV5 A;  2ZQB A;  4I9Q A;  4CFC A;  4DTP A;  4YNQ A;  4E1M A;  3NHG A;  4C8O A;  3NGZ A;  4HCB A;  2YKM A;  3QIN A;  4CJQ A;  2IS3 A;  3CFR A;  1Q8I A;  3OYD A;  1D9F A;  4DSL A;  3KK3 A;  3V1Q A;  2GV9 A;  3VA3 A;  3LPT A;  3AVL A;  4O44 A;  3HL8 A;  1NJY A;  4W5N A;  2G8K A;  1QS4 A;  3O4N A;  4CER A;  3LWM A;  1VSJ A;  5CZ2 A;  4LH5 A;  4BWM A;  4KB0 A;  4J2A A;  5FRN A;  1YVU A;  3JYT A;  1KLM A;  3V9W A;  3CG7 A;  1I39 A;  4ELT A;  2OPR A;  3LAM A;  3WNG A;  3HP6 A;  4CCH A;  4DU4 A;  1RIL A;  4CJR A;  1HQE A;  1VSF A;  3VQ5 A;  1VSM A;  1Y97 A;  3AO1 A;  1S6Q A;  4DQS A;  4KHW A;  3PV8 A;  4OLB A;  4BE1 A;  4F2R A;  1BQN A;  3SV3 A;  1HNI A;  4CK2 A;  3K5L A;  4Q0B A;  3TAN A;  2Z1G A;  2Q3S A;  2PYJ A;  5FDL A;  1NK9 A;  1ASV A;  4Y1D A;  1B9D A;  1G15 A;  1TGO A;  4KTW A;  3NCI A;  2KQ2 A;  4DQI A;  2VG6 A;  4OKK A;  1RDD A;  2X78 A;  1QTM A;  2QK9 A;  1S6P A;  1S5J A;  4OGE A;  1RBR A;  3TAE A;  5KTQ A;  1IKV A;  4FM1 A;  5HLF A;  1JXE A;  1L3T A;  3V1O A;  4O55 A;  3OYE A;  5HBM A;  4DF8 A;  1KFS A;  3DRR A;  3PO5 A;  1SUQ A;  1DTT A;  3ZT1 A;  3B6O A;  3OYB A;  3KD1 E;  4B08 A;  3VQ4 A;  1IKX A;  2RF2 A;  4ICL A;  4OKJ A;  4CJ5 A;  2D0C A;  4FLT A;  3QLH A;  1TK8 A;  2NUB A;  1KVB A;  3TAB A;  3SNN A;  3AVF A;  4LSL A;  1BIU A;  1JL1 A;  3QES A;  1L3U A;  2BDP A;  1S1U A;  4H4O A;  3ZT2 A;  1JLG A;  5HRS A;  5JS2 A;  4ELV A;  2A1S A;  4M3W A;  1NK5 A;  3IRX A;  3P83 D;  3LP3 A;  2JGU A;  3M8P A;  4H4M A;  2HNY A;  1XC9 A;  4KTQ A;  1LWF A;  5K14 A;  1RT1 A;  3IG1 A;  1ZYQ A;  4KB1 A;  4PUO A;  1C0U A;  3CYM A;  3KKS A;  2X6N A;  1NKB A;  4CGJ A;  3MED A;  1A5V A;  4GMJ B;  4CJK A;  2OA8 A;  4CEE A;  1RDC A;  3ZSQ A;  3L3U A;  5J1E A;  1NKC A;  4FLW A;  4DTJ A;  2G8I A;  1HYS A;  1T7P A;  2YNI A;  3D45 A;  3V9U A;  3M8R A;  4KRF A;  3HJF A;  3OYK A;  3OYI A;  4BE2 A;  3QEV A;  1CZB A;  4O0J A;  1L3V A;  5HRO A;  3WNE A;  3AA2 A;  4JRQ A;  1BQM A;  4KTZ A;  1KVC A;  4E1N A;  2KFZ A;  3NGI A;  2YNG A;  4DSE A;  2ETJ A;  4FLV A;  1KSP A;  1SV5 A;  3KLE A;  2DTU A;  4DMN A;  1QSS A;  4Q5V A;  4FLU A;  1UA0 A;  1RTI A;  1T8E A;  4KFB A; 
#chains in the Genus database with same CATH topology
 4CEZ A;  2IOC A;  2O8D A;  3RWU A;  3M3Z A;  3K2P A;  4MO5 A;  3AY9 A;  3WXL A;  3CCE N;  3AVH A;  2Q1N A;  4WQ4 A;  5KGW A;  1S3X A;  2IIR A;  3ASM A;  4IJA A;  1ESV A;  2VG7 A;  5KPT A;  4E19 A;  1KXP A;  3PX6 A;  4B9S A;  3PO4 A;  1KTQ A;  1IV0 A;  1K9M O;  3ZSW A;  1GLJ O;  2Z1H A;  5ADX A;  4FLX A;  2P9U A;  1Z6R A;  4CFA A;  3PUF A;  1GOA A;  2HBK A;  3MEC A;  4CFD A;  3OYH A;  3HXM A;  3E01 A;  2O8D B;  3D0P A;  1XNR K;  4DSK A;  2UUA K;  1QQC A;  3C0B A;  3ALY A;  5GIN A;  1J54 A;  1L3S A;  4FK0 A;  1X3M A;  4A61 A;  1KCF A;  4GV3 A;  3FZM A;  3CXC M;  4CHO A;  1R59 O;  5BRD A;  4JK7 A;  3K5O A;  4B9Q A;  1HNZ K;  1BI4 B;  4UY8 O;  2E2P A;  2UYT A;  3CI5 A;  4IFY A;  3GBT A;  3UIQ A;  4PY5 A;  1VQ5 N;  4NYN A;  1DKG D;  3ENH A;  4FK2 A;  3ZCM A;  4DG1 A;  2GWK A;  4CBU A;  4E0D A;  4EHT A;  3LAK A;  2VWJ A;  4KBO A;  4BRA A;  2WTU A;  1CXU A;  4M3X A;  5AQG A;  3QEX A;  2B5J A;  1NK6 A;  3QEI A;  3K57 A;  4I6M A;  4A57 A;  1RBU A;  3ISN C;  3OJU A;  4LH4 A;  4Y1C A;  3S3O A;  5DMR A;  4B3O A;  3CMA N;  4MLH A;  2ASP A;  1VRT A;  3CCV N;  3BUZ B;  4DQR A;  1TAU A;  3SYZ A;  5CE3 A;  4W5T A;  2OAN A;  1VQ8 N;  3RMA A;  1VSH A;  3VEV A;  1KAX A;  4EP5 A;  5ADX H;  3CIP A;  3MCA B;  1UWB A;  1YF5 L;  1I3A A;  2HB5 A;  1YIJ N;  1TYQ A;  5C24 A;  1WLJ A;  1KC8 O;  1NGE A;  3VQ6 A;  1VQK N;  2ASO A;  3OYF A;  5HRP A;  4K43 A;  1WSI A;  5C2F A;  4N56 A;  3QML A;  5F1X A;  2PYL A;  1HYZ A;  3UKR B;  4CEB A;  4YY3 K;  5FPE A;  4MFB A;  4E1J A;  3U9D A;  3KHY A;  2YV0 X;  2ZGZ A;  2WON A;  4NCG A;  1KAY A;  2A42 A;  3TAG A;  2UUC K;  1K6Y A;  5EXW A;  1WSH A;  4CHP A;  3O9R A;  1U2V A;  3KLG A;  4ZTF A;  1U49 A;  3O3H A;  3IDH A;  2A1R A;  1SAZ A;  1HPZ A;  2P9P B;  4FWM A;  4YOX A;  3THY A;  3NGY A;  3FFK B;  1TKT A;  3EKU A;  2NRV A;  4OO1 J;  4FLY A;  2OZS A;  2HBL A;  3SQ1 A;  2PFU A;  3AVJ A;  4IOC L;  3T1Y K;  3ZET B;  4M7X A;  2XY8 A;  4B1U B;  4FJ5 A;  1RT2 A;  4CJE A;  3DM2 A;  5AZI A;  4BR2 A;  3CJ7 A;  3J81 O;  2VGN A;  3D7E O;  5FPN A;  4OPJ A;  1HKC A;  3V81 A;  4C8K A;  4M3Z A;  1XI1 A;  4KKO A;  2XHB A;  1LW2 A;  3EZW A;  1TK0 A;  3LDP A;  3M1F A;  2O4G A;  4CIF A;  4J2E A;  1JKH A;  3KJV A;  4E7H A;  3QBW A;  3I55 N;  2E5L K;  1Z25 A;  4MLE A;  4W5R A;  1IG8 A;  3QB0 A;  1D9D A;  4YOR A;  4FL9 A;  2GTD A;  5EOY A;  1W2B M;  1U6Z A;  3F73 A;  5KRS A;  2RN2 A;  3TSP A;  5I3U A;  1YJ9 N;  1C1B A;  3CCS N;  1SKS A;  4FJ9 A;  2P1J A;  1SKW A;  4JAX A;  1WSF A;  4JI8 K;  2KFN A;  2DFE A;  1YT3 A;  4Z4F A;  1BDG A;  1XQS C;  2BTF A;  4B1V A;  3DAW A;  5BRF A;  1CXQ A;  4JS5 A;  4HUE A;  3ZSO A;  2Q36 A;  4JYA K;  2IC3 A;  4Z4H A;  3FZK A;  3E9O A;  3CQ8 A;  5JLF A;  2VWB A;  4BRM A;  2GBZ A;  5GIP A;  2QW9 A;  1GLL O;  1VQ4 N;  4RG8 A;  4AHR A;  1JJ2 M;  1C0F A;  2PAV A;  4CBX A;  3FLC O;  2AA4 A;  1YUW A;  2A6A A;  3IS9 A;  3CC2 N;  3FR0 A;  3OYA A;  3LZJ A;  3O4Q A;  3VEO A;  3GL1 A;  4JLH A;  4EP4 A;  4AM7 A;  4BRO A;  2QWO A;  2O8E A;  2OYQ A;  3HPG A;  2FSN A;  3DLE A;  4CIE A;  4BC5 A;  3OW2 M;  4Y0W A;  4FJX A;  3MWP A;  4B9L A;  1VAZ A;  3IFR A;  3TAM A;  1X9S A;  1K8K A;  3NF8 A;  5EU7 A;  5AQV A;  4OPH A;  3CQY A;  1FJG K;  2NRH A;  4DU3 A;  1JL2 A;  3M5R A;  1V4S A;  3PSI A;  1HKG A;  1NK7 A;  1U48 A;  4M7Y A;  4AHT A;  3LDN A;  3LP1 A;  3TSU A;  4C8L A;  4DQP A;  1N36 K;  1NGA A;  1YXQ A;  4CZI A;  3AO2 A;  3OBW A;  2YNH A;  3S3M A;  4IDK A;  4JKB A;  4DCH A;  3CCU N;  4LF6 K;  3OTO K;  2P9I B;  5J2Q A;  1Q82 O;  4B9M A;  3VN5 A;  1NWK A;  2P5O A;  2YHX A;  2O4I A;  3CPW M;  4JKF A;  4JRP A;  5ELZ A;  1VSI A;  3F9M A;  3ULE B;  1RCH A;  1NOY A;  1UAX A;  4CEA A;  5KPZ A;  3OS2 A;  3U3Y A;  1J9A A;  3VQD A;  1EXQ A;  3CCM N;  4FCY A;  3H1V X;  4BC4 A;  1WN7 A;  4PQU A;  4L3Q A;  3TPQ A;  4CJP A;  3CM6 A;  4N41 A;  4BRC A;  3ENB A;  4H03 B;  4GNI A;  4DSF A;  2JLE A;  5C10 A;  2ASM A;  4H5N A;  5FPD A;  4F4K A;  3SPZ A;  3VQP A;  3RSE A;  1QQO A;  3SQ2 A;  1TKD A;  3JAM O;  4DTN A;  5SWM A;  5H1S Q;  2O8C A;  1BL3 A;  5AFU A;  3O6W A;  3L2V A;  2O8B A;  4G9Z A;  4IKF A;  3LWL A;  3K9K A;  4CJ4 A;  4JK8 A;  1U45 A;  5GAG P;  3KLF A;  1RTD A;  3VQQ A;  5C25 A;  2P9S B;  3ID6 A;  4MQ3 A;  1QHA A;  4FJM A;  3P38 A;  3U8X A;  3H3O B;  1HLU A;  1ASU A;  1CLQ A;  3NF6 A;  2ZQB A;  4I9Q A;  4DTP A;  4YNQ A;  4U67 L;  2YKM A;  4CBW A;  4CJQ A;  4EIA A;  3KK3 A;  3VA3 A;  2GV9 A;  3CCJ N;  4O44 A;  4DR3 K;  2NLX A;  2G8K A;  3O4N A;  1VSJ A;  4GV9 A;  3I8B A;  4J2A A;  4ELT A;  3JYT A;  1ZC6 A;  2OPR A;  1VQ6 N;  3HP6 A;  4CCH A;  4B3R K;  1MWK A;  1RIL A;  3J7Z O;  3VQ5 A;  2NRR A;  5AQJ A;  1IBM K;  3SV3 A;  3K5L A;  1RFQ A;  3HRG A;  4Q0B A;  1D4X A;  1B9D A;  4H0Y B;  2VG6 A;  4JNE A;  3LDO A;  4OGE A;  2VQE K;  1IKV A;  1L3T A;  3FGU A;  5HBM A;  4X62 K;  3PO5 A;  1DTT A;  1T44 A;  3OYB A;  2JWL A;  1IKX A;  3VQ4 A;  4BC2 A;  1QVF M;  1KVB A;  2FLO A;  2FSK A;  1BA0 A;  4LSL A;  3QES A;  3K9J A;  1S1U A;  5HRS A;  5JS2 A;  4ELV A;  2A1S A;  2FXU A;  2Q31 A;  3CER A;  3IRX A;  3P83 D;  3C7N B;  1SS6 A;  4H4M A;  2HNY A;  4KTQ A;  1LWF A;  5K14 A;  3E9L A;  4PUO A;  4FWR A;  2VCP A;  1YVN A;  4NB4 A;  3VET A;  5J1E A;  3SAG A;  3HOT A;  3L0Q A;  1HYS A;  2YNI A;  2VGM A;  3M8R A;  4BE2 A;  2O8E B;  1CZB A;  4O0J A;  1L3V A;  3WNE A;  1KVC A;  4E1N A;  2KFZ A;  2HBJ A;  2YNG A;  3NGI A;  1KSP A;  3KLE A;  3C6A A;  1RTI A;  1HJO A;  1T8E A;  3A5O C;  4KHQ A;  3AO3 A;  2UUB K;  3WEE B;  4QOZ B;  5AQM A;  1H1V A;  4IDH A;  4DV6 K;  2YKN A;  3E9P A;  3VA0 A;  4GKJ K;  1P8Z A;  4AIL C;  2YHA A;  2HVI A;  1N33 K;  1OH8 A;  4KH6 A;  4QS9 A;  3QIO A;  3NF9 A;  4BQZ A;  2NRZ A;  1Q9Y A;  1D8Y A;  3B8A X;  1JCF A;  4BRP A;  4A62 A;  2HF3 A;  4A5B A;  3BZC A;  4B1X B;  4FM0 A;  4KI6 A;  4WQ5 A;  4BAC A;  1ASW A;  3QFU A;  1RDU A;  3SAH A;  3F5T A;  3H46 O;  1IJJ A;  2NRW A;  4JK9 A;  2VWK A;  1BIS A;  2B6A A;  2O8F A;  3O9T A;  4DFP A;  3NH1 A;  5JVH L;  2WBN A;  4FJ7 A;  4BE0 A;  4AHV A;  3GOI A;  4HTL A;  3VQ8 A;  4M3T A;  5J2P A;  3VF4 A;  4CHY A;  3R3L A;  1GLA G;  4IG3 A;  3OYG A;  4PWD A;  3AVB A;  1JLB A;  5F2R A;  3WUH A;  1N8R O;  4WE1 A;  4GV6 A;  4FW2 A;  5AQF A;  4FW1 A;  3WNH A;  2KZZ A;  1RNH A;  4F3O A;  3OBY A;  3KLI A;  2AP1 A;  3ZT4 A;  4CZF A;  4M3U A;  3MEG A;  3CC7 N;  3CJ1 A;  5LJV A;  2QWL A;  3ATU A;  3ZEU B;  4V19 S;  4IBN A;  1LOT B;  2DFF A;  2GEM A;  4K8Z A;  3DJC A;  2OZM A;  5KPR A;  3MXJ A;  3CET A;  3QBX A;  3VEX A;  4DTS A;  1RTJ A;  1W0H A;  3AVM A;  2W42 A;  2I7P A;  5AQK A;  3DMJ A;  4ISF A;  4K8X A;  3P5J A;  1NM1 A;  2CGK A;  5HP1 A;  4DQQ A;  5HRN A;  1ZBF A;  4CEC A;  4IG0 A;  2B4J A;  4KHN A;  4C1N I;  4WFB L;  3RSE B;  2RE2 A;  2OTL N;  4H8K A;  3THY B;  4CJ7 A;  1HMV A;  1JXB A;  4HCC A;  3MAQ A;  4IEE A;  3ZSX A;  4FJN A;  4IO9 L;  3DXK B;  4JHD A;  1FK9 A;  3LM9 A;  4RW9 A;  1S1X A;  1VQL N;  4EZ9 A;  3VMF B;  1VQN N;  3OYM A;  4AH9 A;  1TYQ B;  4BRF A;  4O5F A;  5KGX A;  3LM2 A;  4CZG A;  1E3M A;  3ZX0 A;  3MX2 A;  2BE2 A;  2DY4 A;  5M1P A;  3TSQ A;  4B3S K;  1FXX A;  1X3N A;  2HND A;  3VEY A;  3D2F A;  3ATV A;  4RW7 A;  4DV4 K;  1HNX K;  1QZ6 A;  5J2N A;  2FBY A;  4I2Q A;  3DXK A;  4B8A B;  3HVR A;  2CH5 A;  2P9N B;  5JVG L;  3EY1 A;  1RBV A;  4HVJ A;  5GAE P;  2ZF5 O;  1K8A O;  3O4W A;  4WQ5 C;  3AAP A;  4CZJ A;  3CJB A;  2QTD A;  1OH5 A;  1LCU A;  1EO1 A;  3PX0 A;  4BRQ A;  5EX5 A;  1QSY A;  2QWQ A;  5GAD P;  5HOO A;  4DTM A;  3AV9 A;  3NF7 A;  2KTQ A;  3PSF A;  3ZSY A;  3ZT3 A;  1XWL A;  3BDP A;  4BRN A;  3TAQ A;  3P1G A;  4CF9 A;  4CJU A;  4LF8 K;  3K0S A;  3ZLJ A;  1S1V A;  3BP8 A;  5M1K A;  5AQX A;  3RVC A;  5JS1 A;  2I7N A;  3GG4 A;  4XH5 A;  3HST B;  1TK5 A;  1WSG A;  1L5U A;  1C1C A;  3LPU A;  3DOL A;  4ID5 A;  4G1Q A;  3AAQ A;  3SK3 A;  4DLE A;  3ZYY X;  1VRU A;  3L2R A;  4FYD A;  2V52 B;  4B9V A;  5BRH A;  1GLB G;  1R0A A;  2PZS A;  3KLH A;  4MDB A;  2XRI A;  2P9K B;  5AQI A;  4JD2 B;  4B1Z A;  3CCQ N;  3O3G A;  3MN6 A;  3L4Q A;  1TL3 A;  1RT4 A;  4DLG A;  2X74 A;  5E41 A;  4C8M A;  3OYL A;  5LMN K;  2NNW A;  3FZF A;  2A3Z A;  3O9Q A;  3ZX2 A;  3SQ4 A;  4DTU A;  4FPA A;  4Z4I A;  3OS0 A;  2EWS A;  4KHY A;  4E7J A;  4E7L A;  3BF3 A;  1BGX T;  5AQL A;  5AQR A;  1NGB A;  1EQY A;  1U47 A;  4M45 A;  3L2W A;  3DI6 A;  1KD1 O;  3Q7C A;  3VGL A;  3UE5 A;  3CJC A;  1TKZ A;  3MN5 A;  2W6K A;  1E4G T;  4CF0 A;  3NH0 A;  4L8R B;  3HSC A;  4DR7 K;  3THX A;  4CW7 B;  4BRE A;  4CFB A;  1KLN A;  5I42 A;  3H6E A;  1LWC A;  3A5L C;  3EN9 A;  3HVT A;  4GVM A;  5BR9 A;  1NK4 A;  1ILY A;  3SBT A;  4BDZ A;  3RRG A;  1Q18 A;  2F7T A;  1NMN A;  1EX4 A;  1W97 L;  2ZJP L;  1XHX A;  1BHL A;  1BG3 A;  5MLC Q;  1LWE A;  1OH7 A;  1G99 A;  4B3M K;  3WQT A;  1DLO A;  1YJN N;  4Z4E A;  3KVG A;  4ELU A;  1B92 A;  1FKP A;  5JIC A;  4FWN A;  4I2P A;  3NE6 A;  4ISG A;  4QAG A;  3RMC A;  1S1W A;  1EP4 A;  4JN4 A;  2ZJQ L;  2P9I A;  3NAE A;  1BOT O;  3JS6 A;  4KRE A;  3AAR A;  3KTQ A;  2HHW A;  1ZXO A;  4HUG A;  3PLA A;  1X9W A;  2DFH A;  2P9L B;  2V51 B;  2UXC K;  4E89 A;  1HNW K;  4AF1 A;  3LAL A;  5AQU A;  3FZH A;  4X65 K;  1RBS A;  3RMD A;  3DLG A;  2RHK A;  4FWP A;  3NMU A;  4FZZ A;  3K5N A;  4DFJ A;  5AQH A;  2IAJ A;  3QEP A;  1S22 A;  4NXM K;  4DKW A;  5DK5 A;  4B9T A;  2CGJ A;  5BPL A;  3HBT A;  3BGR A;  2QEX N;  3VER A;  3SQ0 A;  1LV5 A;  2YJF A;  1NNE A;  3NHG A;  1S72 N;  4QS7 A;  3NGZ A;  4HCB A;  5TKW A;  5LY3 A;  2IS3 A;  3OYD A;  3MN9 A;  5AZJ B;  2Q97 A;  1NJY A;  4W5N A;  4A59 A;  1QS4 A;  4CER A;  1E4F T;  3DWL A;  4LH5 A;  3CG7 A;  5LL6 Z;  3O80 A;  1NGC A;  2QI2 A;  3PIP L;  3HI0 A;  4MO4 A;  3UKR A;  4DU4 A;  5HL7 L;  3KZB A;  3TTC A;  5IT9 O;  4ILH A;  1KQS M;  1N34 K;  5AQS A;  4KHW A;  1BQN A;  3TAN A;  1ASV A;  1TGO A;  4KTW A;  3NCI A;  2KQ2 A;  4DQI A;  1BUP A;  2BH1 A;  2X78 A;  4OKK A;  1QTM A;  4B1Y B;  1S6P A;  1S5J A;  4GKK K;  2YCH A;  3W3D A;  5AZJ A;  4DV5 K;  4JI6 K;  1RBR A;  5KTQ A;  5BRE A;  1K73 O;  3SBG A;  2OTJ N;  4DF8 A;  1KFS A;  5AZI B;  3IMX A;  2D0C A;  1NGD A;  4FWQ A;  3D6R A;  3SJH A;  3QLH A;  4DV3 K;  4FLT A;  3DXM A;  5FPM A;  2FSJ A;  1BO5 O;  3F2K A;  3D2F B;  1JL1 A;  2BDP A;  1JLG A;  2E1Z A;  1NK5 A;  2E2N A;  2JGU A;  5E84 A;  1ZYQ A;  4YOU A;  1C0U A;  1JCE A;  3KKS A;  3QIC A;  3MED A;  4GMJ B;  1NKC A;  3L3U A;  1YI2 N;  5I9E B;  3LL3 A;  3WXM B;  4BY9 C;  3MMV A;  3O1W A;  4EFH A;  2ETJ A;  1SV5 A;  3WEE A;  3UKU A;  4WYB A;  4KFB A;  5M1Q A;  4PHT X;  3CFO A;  4FPB A;  1BU6 O;  4IOA L;  1BIZ A;  3SLC A;  3WXI A;  1IKY A;  4M3R A;  4JKG B;  2W6L A;  4RW8 A;  1ZBS A;  3C95 A;  3KK7 A;  4K25 A;  1NJI O;  4BRD A;  3HYF A;  1C1A A;  3VPZ A;  3HOS A;  3CJA A;  1T3V A;  4H5R A;  4AQY K;  4BRH A;  3DLL L;  4BG9 A;  3PX4 A;  4E7I A;  3AVN A;  1KRP A;  4FOI A;  4IWV A;  1IKW A;  5IWA K;  5JMV A;  4A2B A;  4RW6 A;  1IBK K;  4CHZ A;  3HK2 A;  3KKR A;  1TKX A;  3C6H A;  4OLA A;  4OKE A;  2QXF A;  4CZE A;  4JKG A;  3THX B;  3MDQ A;  2ZM6 K;  1U04 A;  5A2Q O;  2IVO A;  4JI3 K;  4JI7 K;  4OPA A;  2UXB K;  1F21 A;  3DOK A;  2G8W A;  4YDU A;  4CJS A;  1REV A;  1XMQ K;  4DV7 K;  4IFV A;  4FJK A;  4FSV A;  4B3T K;  1WAF A;  2WC9 A;  3OHR A;  4B8C A;  3VQ9 A;  3FZL A;  1I94 K;  4LFB K;  4M42 A;  4BR4 A;  5BPM A;  4YFU A;  4H5V A;  4JI4 K;  2E2Q A;  2G8H A;  4FWS A;  4W5O A;  3VEZ A;  1QHT A;  2VG5 A;  3K58 A;  1YTA A;  2BAN A;  1DGK N;  4IJN A;  4KO0 A;  3KWG A;  4OVL A;  3ZSV A;  3P39 A;  3EEQ A;  3QDK A;  2WFB A;  4K0K K;  1GLC G;  4B9N A;  4XEI A;  4Z4C A;  3SZ2 A;  4LF7 K;  3BZK A;  2VYP A;  3L4I A;  4ZHR A;  4BRG A;  1UA1 A;  4DB3 A;  3KK2 A;  5B8H A;  5AQW A;  3VQB A;  4C8N A;  1HR0 K;  1LW0 A;  3CJ9 A;  4BGB A;  3KWI A;  4RCH A;  1GLF O;  4PL7 A;  3EE9 A;  3V9S A;  2A40 A;  4RW4 A;  4ZTJ A;  3NVK A;  4CE9 A;  1NMD A;  5TKY A;  4BG8 A;  1VQP N;  4JKC A;  3GDQ A;  2E8A A;  2GX9 A;  3T3F A;  4CGD A;  1RT3 A;  3TWH A;  4DF4 A;  4FJ8 A;  1S9G A;  3D2E A;  1W9H A;  4JKE A;  1MDU B;  1U2V B;  3CHW A;  3N4P A;  3K5M A;  4B9U A;  5AQT A;  3VOV A;  4EAH D;  4IXC A;  4F3T A;  3OS1 A;  1XUP O;  2R7Y A;  2QXL A;  2Q0R A;  4FJJ A;  3THV A;  1N6Q A;  2HBM A;  5SZT A;  3V1R A;  1KAZ A;  3CFP A;  5LMU K;  1BCM A;  2QWN A;  5FRM A;  4CK3 A;  4FWL A;  2GWJ A;  1HRH A;  1HX1 A;  2YI1 A;  3QEW A;  3LAN A;  5AQQ A;  1S1T A;  2D1K A;  4NYF A;  1TL1 A;  3DXM B;  3LDQ A;  3ZET A;  3AO4 A;  3RR8 A;  1EWQ A;  2DPN A;  3LP0 A;  3J7A P;  3T7Z A;  2HHQ A;  3HM9 A;  1D5A A;  4AHC A;  1DTQ A;  4XH4 A;  2NZT A;  4BWJ A;  2HMP A;  3R6M A;  2WUS A;  4DSJ A;  4YDU C;  1JLQ A;  3UKU B;  1WSE A;  1SKR A;  4DV1 K;  3MEE A;  4CGH A;  3U6F A;  1VHX A;  3VGK A;  4H5W A;  1HKB A;  3S9H A;  1X9M A;  4KAZ A;  3V6D A;  3C94 A;  5BN9 A;  4DWI A;  4CD1 A;  1YTU A;  4AM6 A;  4FVU A;  1MU2 A;  1NU0 A;  3G10 A;  4CED A;  1VSL A;  4O8K A;  2NRT A;  4HHT A;  2HHV A;  4R79 A;  2F9T A;  4BRL A;  3Q7B A;  4R5P A;  3HPH A;  1NJW A;  2F9W A;  4CF1 A;  3FFI A;  3U9Z A;  1J5E K;  1WNS A;  1DT9 A;  2I5J A;  5M1N A;  3T1A A;  3N4Q A;  1JLE A;  4EZ6 A;  3I33 A;  4XH1 A;  1HPM A;  3TTD A;  2F8T A;  1VQO N;  4FJL A;  3TAR A;  1UOC A;  1Z26 A;  1SZ2 A;  3MK6 A;  3LDS A;  4LF5 K;  3QIP A;  1T03 A;  2HHU A;  5F0X A;  1TUU A;  3SUQ A;  1HQU A;  1VSK A;  1OKJ A;  1NG9 A;  1RT6 A;  3OYN A;  3LP2 A;  2ZWH A;  4BRK A;  4DTO A;  3M8S A;  2IGI A;  4RWT A;  4CEQ A;  3W0L A;  4DR5 K;  3MXI A;  3CCR N;  1WOQ A;  2F96 A;  1DEJ A;  5CYM A;  3TR8 A;  1HJR A;  1NLV A;  3CPE A;  1HUX A;  4H0P A;  2GUP A;  3A2F A;  1LAW A;  2HMI A;  3BY5 A;  1HNV A;  2HHS A;  1BI4 A;  2IVN A;  1SL1 A;  3HPO A;  4OGC A;  3S41 A;  1C0G A;  5E26 A;  1NK0 A;  4M3Y A;  1IO2 A;  4WQ4 C;  3AVI A;  1OH6 A;  5KI6 A;  3O1B A;  4Z94 A;  1TV6 A;  2O8F B;  3QFP A;  3CC4 N;  2RKI A;  3C6T A;  1QVG M;  5C0Y A;  2FF6 A;  2RPI A;  4H0T B;  3U4L A;  4HUF A;  3VQC A;  3R8E A;  3SUO A;  3I0R A;  2BUP A;  3HTV A;  1B9F A;  4H0O A;  2ZD1 A;  2P51 A;  1WBB A;  4DTR A;  5DM6 L;  2HF4 A;  4PL8 A;  3AVK A;  4I9L A;  4J8F A;  2H3G X;  3RR7 A;  4CHN A;  3DLB A;  2KKZ A;  4LFC K;  4QCL A;  2HVH A;  3K59 A;  4DFK A;  1NGH A;  3AGK A;  3HO1 A;  4IFE A;  4N76 A;  1ATS A;  4PKI A;  4CJV A;  1BA1 A;  3AGR A;  4YOT A;  4H5T A;  2Z1J A;  4CEF A;  3LDL A;  3RRH A;  1WUA A;  4CZK A;  2ITG A;  1XNQ K;  4JS4 A;  4FJH A;  4M41 A;  1ZBL A;  2UXD K;  1SL0 A;  1J5O A;  4BVP A;  1WBD A;  2E2O A;  4HTU A;  4CGF A;  3VQE A;  2D0A A;  2QWP A;  4MDA A;  4FJG A;  3AA3 A;  2XY5 A;  3OJS A;  2Z1I A;  2F4V K;  2YX6 A;  4CF2 A;  4ILG B;  4CFC A;  4C8O A;  1VQM N;  4DSL A;  4IEI A;  1Q8I A;  4BVO A;  1X9J A;  2O8C B;  3HL8 A;  4JEP A;  5CZ2 A;  4BWM A;  1YIT N;  5FRN A;  1RDW X;  1YVU A;  4DQ8 A;  5JLH A;  3LAM A;  3WNG A;  5BN8 A;  2JWK A;  3R9P A;  4CJR A;  3G25 A;  1VSF A;  1VSM A;  1Y97 A;  2P9P A;  2QA4 N;  3JXU A;  1S6Q A;  4DQS A;  3PV8 A;  4BE1 A;  2ZJR L;  1O13 A;  1HNI A;  4CK2 A;  2Z1G A;  5FDL A;  1NK9 A;  1G15 A;  5GAH P;  1RDD A;  3TAE A;  4K41 A;  3V1O A;  4O55 A;  4JKA A;  3OYE A;  2ZGY A;  2HHH K;  1WB9 A;  3ZT1 A;  3B6O A;  3KD1 E;  4B08 A;  3A8Y A;  1YHQ N;  4DV2 K;  1TK8 A;  3TAB A;  3SNN A;  4BRI A;  1BIU A;  1L3U A;  2HOE A;  4H4O A;  4KHP K;  3IKM A;  4LF4 K;  4M3W A;  4YOV A;  3M8P A;  2OCE A;  1XC9 A;  3T1H K;  4JD2 A;  2D0P A;  1NKB A;  4CJK A;  3THW A;  3CD6 N;  4CEE A;  4FLW A;  4DTJ A;  3D45 A;  3V9U A;  1YJW N;  4KRF A;  3VF2 A;  5M1F A;  3QEV A;  5AQZ A;  1OVQ A;  4IOX A;  2Q0U A;  2ITM A;  3HZ6 A;  1BQM A;  4JRQ A;  4JV5 K;  4DSE A;  2YHW A;  4DMN A;  1QSS A;  4Q5V A;  4FO0 A;  1UA0 A;  3VEW A;  2FBX A;  1C6V A;  1C0T A;  3H1Q A;  2XY6 A;  3HM8 A;  3M8Q A;  4CF8 A;  3SV4 A;  3L8B A;  2HNZ A;  5D3G A;  4O5B A;  1XHZ A;  3MN7 A;  4JI5 K;  3MX5 A;  3HP9 A;  3OY9 A;  4O4G A;  1O1W A;  3ZSZ A;  3J8A A;  3FE1 A;  3NFA A;  1ITG A;  3R1X A;  3U3G A;  3E66 A;  3PY8 A;  2P5G A;  4C1N K;  3RTV A;  2QWR A;  3ZSR A;  4E7K A;  3DRS A;  2KLA A;  2G8V A;  3QER A;  1Q7Y O;  1NJZ A;  3F9K A;  3A0I X;  2Q2R A;  4KI4 A;  1HYV A;  4LD0 A;  3DYA A;  4AHS A;  3P4I A;  3WQU A;  4DUZ K;  1Q9X A;  3G0Z A;  4PA1 A;  4CD3 A;  1FKO A;  4EHU A;  3S3N A;  2FC0 A;  4CJT A;  1NGI A;  1RDB A;  3BEX A;  1XC3 A;  1RDA A;  3EL2 A;  4X64 K;  5CYQ A;  1JLC A;  1NBW A;  3EYZ A;  3AVG A;  1TVR A;  2HW3 A;  2IDO A;  3VGM A;  5CHI A;  1KVA A;  2V7Y A;  4IO8 A;  3WT0 A;  3H08 A;  5HRR A;  4CGI A;  4FK4 A;  3WNF A;  1JCG A;  1Y64 A;  3DLH A;  3JSM A;  4N47 A;  1VK0 A;  3G4S N;  4JI1 K;  4FZX C;  1VQ9 N;  3QNO A;  4CZH A;  1RT5 A;  2G8U A;  3SPY A;  4Z4G A;  5AQP A;  5KRT A;  2O8B B;  3OVN A;  3ULE A;  4CZM A;  2BGG A;  2KW4 A;  1N5Y A;  3OYC A;  4CVN E;  2X6S A;  1U4B A;  1IG9 A;  4LSN A;  1N32 K;  4NXN K;  1S9E A;  4DR6 K;  4GY2 B;  1ATR A;  3O3F A;  4DR1 K;  1M90 O;  2HHT A;  3A5M C;  3VQ7 A;  3L3V A;  3ZEU A;  1ZBH A;  3DLK A;  5CZ1 A;  2AJQ A;  5T7B A;  3GE1 A;  2W40 A;  3I0S A;  5EY4 A;  2UU9 K;  4HWI A;  3D2E B;  4BQL A;  4CJL A;  2OPS A;  5CY4 A;  2F8S A;  1SL2 A;  3T19 A;  1V4T A;  1OVY A;  4PKG A;  3T69 A;  4JKH A;  4DU1 A;  2EX3 A;  4LFA K;  5M1O A;  1QE1 A;  1QZ5 A;  1EET A;  3B6P A;  4F9O A;  2GEL A;  3VQA A;  2P9L A;  2YNF A;  2XO7 A;  2Y1J A;  1GOB A;  1T05 A;  2IVP A;  2GUI A;  2D5R A;  3CM5 A;  4FWO A;  2W41 A;  4J2D A;  2YHB A;  3ENO A;  4DTX A;  3MXM A;  1JLF A;  1RT7 A;  4AHU A;  4LF9 K;  1ATN A;  1GLE G;  4ISE A;  4DHY A;  2FBT A;  4CHQ A;  4DS4 A;  1IBL K;  3I8D A;  2P9N A;  3VF6 A;  3SI6 A;  4N5S A;  1VSE A;  3AA5 X;  3LZI A;  2E6M A;  2OPP A;  2HHX A;  3WXK A;  3MWT A;  4DFM A;  3SUN A;  3EKS A;  4DR2 K;  2KHO A;  1CZ9 A;  3NDK A;  5DM7 L;  4CJW A;  3KD5 E;  5BR8 K;  4FVM A;  4BDP A;  3NVM A;  1WSJ A;  4W5Q A;  4FXD A;  4GVE A;  5KQ8 A;  4YOW A;  5C15 A;  4LY7 A;  3G6E N;  1YAG A;  1JLA A;  4CK1 A;  1T6D A;  2FBV A;  3SJJ A;  1EWR A;  4FWK A;  4FLZ A;  3ZX3 A;  3THW B;  4CEO A;  4KHS A;  2CGL A;  3H3N O;  3PIO L;  1VSD A;  4LC9 B;  3V4I A;  5FRO A;  3QO9 A;  3C7N A;  3AO5 A;  4F2S A;  4NCB A;  4DUY K;  2QKK A;  4JI0 K;  4E3S A;  3UB5 A;  4BR7 A;  2ZE2 A;  5AR0 A;  5C42 A;  4BGA A;  1IH7 A;  3VES A;  3MCP A;  3WXJ A;  2KZM A;  1GLD G;  2QM1 A;  3SCX A;  1C0M A;  5CR4 A;  1LAV A;  3AA4 A;  3O9S A;  3EE8 A;  1NK8 A;  3L6Q A;  3ID8 A;  2PY5 A;  2D4W A;  3L2Q A;  4BR9 A;  2QWM A;  3SMP A;  2V7Z A;  3A5N C;  1J6Z A;  2QKB A;  3RMB A;  2P9U B;  1EKE A;  4CJ3 A;  2E6L A;  4CZL A;  2OPQ A;  4FJI A;  1SQK A;  4I7F A;  2PBD A;  2ATQ A;  5J2M A;  2E1Y A;  3NBP A;  4CIG A;  4FM2 A;  1QQM A;  3IAY A;  1RTH A;  3BF1 A;  4KHU A;  4A5A A;  4DV0 K;  4CGG A;  3KIO A;  1K8K B;  3TU5 A;  4KV8 A;  4OX9 K;  2VQF K;  2A5X A;  1ZBU A;  1NJX A;  1NGJ A;  3TTF A;  3CF5 L;  4K42 A;  4Z0U A;  2A41 A;  3DRP A;  4BDY A;  2D0O A;  5AQO A;  3CQX A;  4A2A A;  4ID1 A;  2NRX A;  5KQD A;  4WCE L;  3KK1 A;  1ZBI A;  4QS8 A;  3TAF A;  4TSX A;  3AVC A;  1A5W A;  3J7Y P;  3NH2 A;  2EHG A;  3EZ5 A;  1MWM A;  2XY7 A;  3V9Z A;  5GIO A;  1BWF O;  3DLR A;  5AJ3 K;  5LJW A;  1T6C A;  4NCA A;  3O5B A;  3AVA A;  3L2U A;  2CH6 A;  1KFD A;  1RBT A;  1NOZ A;  2LSN A;  4RTF D;  4CI6 A;  3OYJ A;  2D0B A;  3H45 C;  4F8R A;  3QET A;  3TAP A;  3SUP A;  2J4R A;  3C6U A;  4I6M B;  1FW6 A;  2YHY A;  3V9X A;  3O9U A;  1QSL A;  2WOM A;  1BCO A;  2E4L A;  3TI0 A;  4CES A;  4YOY A;  2E88 A;  5AQN A;  4OPK A;  1TAQ A;  1NKE A;  2YJE A;  4GW6 A;  4FZY A;  4KPY A;  1WAJ A;  2Y1I A;  1Q86 O;  3P31 A;  5C12 A;  4YHH K;  3E1Y A;  3QNN A;  5BPN A;  1XMO K;  4OJR A;  4DS5 A;  4WFN L;  4DSI A;  3ULD A;  3CCL N;  4O8U A;  2G8F A;  3VTH A;  5AFU H;  4J2B A;  3HT3 A;  1GOC A;  4JHD B;  4O0I A;  4UQG A;  3J80 O;  1X1P A;  1NGF A;  4PKH A;  2FF3 B;  1A5X A;  3ITH A;  1J53 A;  4CJF A;  1VQ7 N;  3ZT0 A;  4XIU A;  4E1M A;  3QIN A;  1Z05 A;  3CFR A;  1D9F A;  3V1Q A;  3LPT A;  3AVL A;  3O08 A;  3LWM A;  4BC3 A;  1MA9 B;  3I56 N;  4KB0 A;  4KH4 A;  5FLX O;  1KLM A;  3V9W A;  1I39 A;  1NGG A;  2P9S A;  4ILJ A;  1HQE A;  3AO1 A;  3IUC A;  4OLB A;  4BR0 A;  4F2R A;  4H0X B;  2Q3S A;  3OA9 A;  3EO3 A;  2PYJ A;  4Y1D A;  4NLB A;  4DR4 K;  2QK9 A;  1TUY A;  1W7A A;  4FM1 A;  5HLF A;  1JXE A;  3M6G A;  4M63 C;  3DRR A;  3CME N;  1SUQ A;  4NLC A;  4JI2 K;  5AQY A;  4B1W B;  4OKJ A;  2RF2 A;  4ICL A;  4CJ5 A;  1CZA N;  2NUB A;  4IZ9 A;  1P90 A;  3AVF A;  4FOE A;  3ZT2 A;  4NO7 A;  5C2D A;  3VEN A;  3SAF A;  2E20 A;  3LP3 A;  2P9K A;  3C65 A;  1RT1 A;  3IG1 A;  3VTI A;  4KB1 A;  3CYM A;  4C23 A;  2X6N A;  3O8M A;  4WF9 L;  4U7B A;  1Q81 O;  4CGJ A;  1QQN A;  1A5V A;  2OA8 A;  1RDC A;  5EVZ A;  3ZSQ A;  4H0V B;  4KH5 A;  2G8I A;  1T7P A;  4BR5 A;  1M1K O;  4JKD A;  3OYK A;  3OYI A;  3HJF A;  2HST A;  4X66 K;  3SMS A;  5HRO A;  3AA2 A;  4KTZ A;  1RGI A;  4FLV A;  4WFA L;  2DTU A;  4FLU A;  3G71 N; 
#chains in the Genus database with same CATH homology
 2FBX A;  1C6V A;  3CFO A;  2IOC A;  4CEZ A;  1C0T A;  1BIZ A;  3RWU A;  2XY6 A;  4KHQ A;  3AO3 A;  3K2P A;  1IKY A;  4M3R A;  4QOZ B;  3M8Q A;  4CF8 A;  3SV4 A;  3L8B A;  2HNZ A;  5D3G A;  3AVH A;  4RW8 A;  4O5B A;  1XHZ A;  3C95 A;  2YKN A;  5KGW A;  3HP9 A;  3OY9 A;  4O4G A;  3HYF A;  3VA0 A;  1O1W A;  1C1A A;  3ZSZ A;  3ASM A;  2VG7 A;  4AIL C;  2YHA A;  2HVI A;  4E19 A;  3NFA A;  1ITG A;  3U3G A;  3PX6 A;  4B9S A;  3QIO A;  3NF9 A;  3PX4 A;  3PY8 A;  4E7I A;  3AVN A;  2P5G A;  1Q9Y A;  3RTV A;  1KTQ A;  1KRP A;  3PO4 A;  1D8Y A;  3ZSR A;  4E7K A;  1IKW A;  3DRS A;  3ZSW A;  2G8V A;  4RW6 A;  3QER A;  2Z1H A;  4FLX A;  4CFA A;  3PUF A;  1GOA A;  3OYH A;  3MEC A;  4CHZ A;  4CFD A;  3HXM A;  3E01 A;  4FM0 A;  3F9K A;  3KKR A;  3D0P A;  4KI6 A;  3HK2 A;  1TKX A;  4DSK A;  4BAC A;  4OLA A;  4OKE A;  1ASW A;  1QQC A;  2QXF A;  3ALY A;  4KI4 A;  1J54 A;  1HYV A;  4LD0 A;  1L3S A;  4FK0 A;  3DYA A;  4AHS A;  1Q9X A;  1KCF A;  3G0Z A;  4PA1 A;  2VWK A;  1BIS A;  1FKO A;  4CHO A;  2B6A A;  3S3N A;  2FC0 A;  1U04 A;  4CJT A;  1RDB A;  1RDA A;  3K5O A;  4DFP A;  3NH1 A;  4FJ7 A;  1BI4 B;  1F21 A;  5CYQ A;  1JLC A;  3DOK A;  4BE0 A;  2G8W A;  4AHV A;  4CJS A;  1REV A;  3VQ8 A;  4M3T A;  3EYZ A;  4IFY A;  5J2P A;  3AVG A;  1TVR A;  4IFV A;  4CHY A;  2IDO A;  4NYN A;  3UIQ A;  4FJK A;  4PY5 A;  2HW3 A;  4IG3 A;  1KVA A;  1WAF A;  3OYG A;  4FK2 A;  4PWD A;  3AVB A;  3ZCM A;  1JLB A;  3H08 A;  5HRR A;  4DG1 A;  4CGI A;  4FK4 A;  3WNF A;  4B8C A;  3VQ9 A;  4WE1 A;  4E0D A;  3LAK A;  4FW2 A;  3DLH A;  2VWJ A;  4FW1 A;  4M42 A;  1CXU A;  3WNH A;  4N47 A;  3JSM A;  4M3X A;  1VK0 A;  2KZZ A;  4FZX C;  1RNH A;  3QNO A;  4YFU A;  3QEX A;  2B5J A;  1RT5 A;  1NK6 A;  3QEI A;  3SPY A;  2G8U A;  4F3O A;  4Z4G A;  3KLI A;  5KRT A;  3K57 A;  2G8H A;  3OVN A;  4W5O A;  1RBU A;  3ISN C;  3OJU A;  4LH4 A;  2BGG A;  3ZT4 A;  4Y1C A;  4M3U A;  3S3O A;  3MEG A;  2KW4 A;  5DMR A;  1N5Y A;  3OYC A;  4B3O A;  1QHT A;  2VG5 A;  3K58 A;  2X6S A;  1U4B A;  1IG9 A;  1YTA A;  1VRT A;  4IBN A;  4LSN A;  2BAN A;  2DFF A;  4KO0 A;  4K8Z A;  1S9E A;  2OZM A;  3MXJ A;  3O3F A;  4OVL A;  3ZSV A;  4DQR A;  4DTS A;  1TAU A;  3SYZ A;  1RTJ A;  1W0H A;  3AVM A;  4W5T A;  2HHT A;  2W42 A;  3VQ7 A;  4B9N A;  3L3V A;  1ZBH A;  4Z4C A;  2O4I A;  3DLK A;  3DMJ A;  3SZ2 A;  3RMA A;  4K8X A;  3P5J A;  5CZ1 A;  4ZHR A;  1VSH A;  2AJQ A;  5T7B A;  1UA1 A;  3I0S A;  3KK2 A;  4EP5 A;  5HP1 A;  4DQQ A;  1UWB A;  5HRN A;  1I3A A;  1ZBF A;  4IG0 A;  4CEC A;  2HB5 A;  4CJL A;  5C24 A;  2B4J A;  1WLJ A;  2OPS A;  3VQB A;  4C8N A;  5CY4 A;  3VQ6 A;  4KHN A;  3OYF A;  5HRP A;  2F8S A;  1SL2 A;  1LW0 A;  1WSI A;  3T19 A;  4N56 A;  4H8K A;  1HMV A;  2PYL A;  1HYZ A;  4CEB A;  4MFB A;  1JXB A;  4HCC A;  3V9S A;  4DU1 A;  2EX3 A;  3MAQ A;  3ZSX A;  4FJN A;  2YV0 X;  1QE1 A;  2WON A;  4NCG A;  4RW4 A;  1EET A;  1FK9 A;  4ZTJ A;  3B6P A;  4CE9 A;  3TAG A;  1K6Y A;  3VQA A;  4RW9 A;  1S1X A;  2YNF A;  2XO7 A;  1WSH A;  1GOB A;  4CHP A;  2Y1J A;  1T05 A;  3KLG A;  3T3F A;  4CGD A;  4ZTF A;  2GUI A;  2D5R A;  3CM5 A;  3O3H A;  1U49 A;  4EZ9 A;  1RT3 A;  3TWH A;  4DF4 A;  2A1R A;  4FJ8 A;  3OYM A;  1S9G A;  4AH9 A;  4J2D A;  1HPZ A;  2YHB A;  4DTX A;  3MXM A;  1JLF A;  1RT7 A;  1W9H A;  4AHU A;  5KGX A;  2FBT A;  4CHQ A;  4DS4 A;  3K5M A;  3I8D A;  2BE2 A;  3NGY A;  4B9U A;  2DY4 A;  3SI6 A;  1TKT A;  4N5S A;  1FXX A;  1VSE A;  2HND A;  3AA5 X;  4F3T A;  3LZI A;  4FLY A;  2E6M A;  3OS1 A;  2OPP A;  4RW7 A;  2R7Y A;  2OZS A;  4FJJ A;  2HHX A;  3THV A;  1N6Q A;  3SQ1 A;  5SZT A;  3V1R A;  3AVJ A;  3CFP A;  2FBY A;  1BCM A;  5J2N A;  4DFM A;  4I2Q A;  4CK3 A;  3SUN A;  4B8A B;  3HVR A;  5FRM A;  3EY1 A;  1RBV A;  1HRH A;  2XY8 A;  4FJ5 A;  1RT2 A;  4HVJ A;  1CZ9 A;  3NDK A;  4CJE A;  3QEW A;  3DM2 A;  4CJW A;  3LAN A;  3KD5 E;  1S1T A;  4FVM A;  4NYF A;  1TL1 A;  4OPJ A;  1WSJ A;  3V81 A;  4BDP A;  4C8K A;  4W5Q A;  3PX0 A;  3RR8 A;  3AO4 A;  4M3Z A;  4FXD A;  1QSY A;  1XI1 A;  4KKO A;  3LP0 A;  2XHB A;  1LW2 A;  2HHQ A;  1TK0 A;  3HM9 A;  1D5A A;  2O4G A;  4AHC A;  1DTQ A;  4DTM A;  3AV9 A;  3NF7 A;  4LY7 A;  4CIF A;  1JLA A;  1JKH A;  4BWJ A;  4CK1 A;  3KJV A;  4J2E A;  4E7H A;  2KTQ A;  2FBV A;  3SJJ A;  1Z25 A;  3ZSY A;  3ZT3 A;  1XWL A;  4DSJ A;  1JLQ A;  4W5R A;  3BDP A;  4FLZ A;  1D9D A;  1WSE A;  1SKR A;  3TAQ A;  3MEE A;  4CGH A;  3P1G A;  4CF9 A;  5KRS A;  4CJU A;  3F73 A;  2RN2 A;  4CEO A;  3U6F A;  3S9H A;  5I3U A;  1X9M A;  4KHS A;  1C1B A;  4FJ9 A;  1SKS A;  1VSD A;  2P1J A;  1S1V A;  3V6D A;  1SKW A;  1WSF A;  3V4I A;  4KAZ A;  3C94 A;  2KFN A;  2DFE A;  4DWI A;  1YT3 A;  1YTU A;  5JS1 A;  4Z4F A;  1MU2 A;  3G10 A;  4CED A;  1CXQ A;  1VSL A;  3QO9 A;  3HST B;  5FRO A;  4HHT A;  1TK5 A;  3AO5 A;  1WSG A;  4JS5 A;  2HHV A;  1L5U A;  4HUE A;  4F2S A;  1C1C A;  4NCB A;  1NJZ A;  3LPU A;  3ZSO A;  3DOL A;  4ID5 A;  4G1Q A;  2QKK A;  2IC3 A;  4E3S A;  4Z4H A;  4R5P A;  3HPH A;  2ZE2 A;  3CQ8 A;  1NJW A;  4DLE A;  2GBZ A;  5C42 A;  4CF1 A;  3FFI A;  1VRU A;  1IH7 A;  3L2R A;  1WNS A;  4FYD A;  4RG8 A;  2KZM A;  4B9V A;  2I5J A;  3T1A A;  3SCX A;  4AHR A;  1C0M A;  1R0A A;  1JLE A;  2PZS A;  1LAV A;  3KLH A;  3AA4 A;  2XRI A;  4EZ6 A;  3IS9 A;  3OYA A;  3LZJ A;  2F8T A;  3O3G A;  3O4Q A;  1TL3 A;  4FJL A;  3TAR A;  1NK8 A;  1UOC A;  1RT4 A;  4DLG A;  1Z26 A;  2PY5 A;  4JLH A;  2X74 A;  4EP4 A;  5E41 A;  3LDS A;  3QIP A;  4C8M A;  1T03 A;  3L2Q A;  3OYL A;  2HHU A;  2QKB A;  3RMB A;  2OYQ A;  3HPG A;  3SUQ A;  1EKE A;  3DLE A;  4CJ3 A;  4CIE A;  3SQ4 A;  1HQU A;  2E6L A;  1VSK A;  4DTU A;  4FJX A;  3OS0 A;  4Z4I A;  1RT6 A;  4B9L A;  2OPQ A;  3OYN A;  3LP2 A;  4FJI A;  4DTO A;  3M8S A;  4KHY A;  2IGI A;  3TAM A;  4E7J A;  4CEQ A;  1X9S A;  4I7F A;  3NF8 A;  5EU7 A;  4E7L A;  2ATQ A;  5J2M A;  3MXI A;  3NBP A;  1BGX T;  2F96 A;  5CYM A;  4CIG A;  4FM2 A;  3TR8 A;  1HJR A;  1JL2 A;  1RTH A;  4DU3 A;  3IAY A;  4KHU A;  1U47 A;  3A2F A;  1LAW A;  1NK7 A;  4M45 A;  3L2W A;  4CGG A;  1HNV A;  3DI6 A;  3KIO A;  1U48 A;  4AHT A;  2HMI A;  4KV8 A;  3LP1 A;  2HHS A;  1BI4 A;  1SL1 A;  3HPO A;  4C8L A;  4OGC A;  1ZBU A;  1NJX A;  4DQP A;  1TKZ A;  4CF0 A;  4Z0U A;  3AO2 A;  3NH0 A;  4L8R B;  3DRP A;  4BDY A;  1NK0 A;  4M3Y A;  1IO2 A;  4ID1 A;  2YNH A;  3S3M A;  4CFB A;  1KLN A;  3AVI A;  5I42 A;  4IDK A;  5KI6 A;  3KK1 A;  1ZBI A;  1LWC A;  1TV6 A;  5J2Q A;  3TAF A;  4B9M A;  3VN5 A;  3HVT A;  2P5O A;  4GVM A;  1NK4 A;  4TSX A;  2RKI A;  3AVC A;  1A5W A;  3C6T A;  2RPI A;  4HUF A;  3NH2 A;  4JRP A;  4BDZ A;  3RRG A;  2EHG A;  3VQC A;  1VSI A;  3SUO A;  3I0R A;  3EZ5 A;  1RCH A;  1NOY A;  2XY7 A;  1EX4 A;  1UAX A;  3V9Z A;  3DLR A;  4CEA A;  3OS2 A;  3U3Y A;  4NCA A;  1B9F A;  1BHL A;  1J9A A;  1XHX A;  2P51 A;  1LWE A;  2ZD1 A;  3AVA A;  1EXQ A;  3VQD A;  3L2U A;  4FCY A;  4DTR A;  1KFD A;  1DLO A;  1NOZ A;  1RBT A;  2LSN A;  4Z4E A;  3OYJ A;  3AVK A;  1WN7 A;  1B92 A;  1FKP A;  4I9L A;  2D0B A;  4ELU A;  4PQU A;  4CJP A;  4F8R A;  3CM6 A;  4I2P A;  3NE6 A;  3QET A;  4N41 A;  3RR7 A;  4CHN A;  4QAG A;  3TAP A;  3DLB A;  3SUP A;  3C6U A;  4QCL A;  2HVH A;  3K59 A;  3V9X A;  3RMC A;  1S1W A;  1QSL A;  2WOM A;  1BCO A;  1EP4 A;  2E4L A;  4DSF A;  4DFK A;  3TI0 A;  4CES A;  3NAE A;  2JLE A;  4KRE A;  3KTQ A;  3HO1 A;  4N76 A;  4CJV A;  4OPK A;  1TAQ A;  4F4K A;  1NKE A;  4GW6 A;  3SPZ A;  2HHW A;  4HUG A;  4FZY A;  1X9W A;  2Z1J A;  3VQP A;  4KPY A;  2DFH A;  1WAJ A;  4CEF A;  2Y1I A;  4E89 A;  3RRH A;  3LAL A;  3SQ2 A;  1TKD A;  4DTN A;  5SWM A;  3QNN A;  1BL3 A;  2ITG A;  1RBS A;  3L2V A;  4OJR A;  4JS4 A;  3RMD A;  4DS5 A;  4M41 A;  4FJH A;  1ZBL A;  3DLG A;  4DSI A;  4IKF A;  4FZZ A;  3K5N A;  3ULD A;  1SL0 A;  4DFJ A;  1J5O A;  3LWL A;  2G8F A;  2IAJ A;  4HTU A;  4CGF A;  4CJ4 A;  3QEP A;  1U45 A;  3KLF A;  1RTD A;  3VQQ A;  3VQE A;  3HT3 A;  4J2B A;  5C25 A;  1GOC A;  4O0I A;  4UQG A;  1X1P A;  5DK5 A;  2D0A A;  4B9T A;  4MQ3 A;  1A5X A;  3BGR A;  4FJG A;  3ITH A;  4FJM A;  1J53 A;  4CJF A;  3AA3 A;  2XY5 A;  3OJS A;  1CLQ A;  1ASU A;  3SQ0 A;  3ZT0 A;  2Z1I A;  4XIU A;  3NF6 A;  4CF2 A;  1LV5 A;  2ZQB A;  4I9Q A;  4CFC A;  4DTP A;  4YNQ A;  4E1M A;  3NHG A;  4C8O A;  3NGZ A;  4HCB A;  2YKM A;  3QIN A;  4CJQ A;  2IS3 A;  3CFR A;  1Q8I A;  3OYD A;  1D9F A;  4DSL A;  3KK3 A;  3V1Q A;  2GV9 A;  3VA3 A;  3LPT A;  3AVL A;  4O44 A;  3HL8 A;  1NJY A;  4W5N A;  2G8K A;  1QS4 A;  3O4N A;  4CER A;  3LWM A;  1VSJ A;  5CZ2 A;  4LH5 A;  4BWM A;  4KB0 A;  4J2A A;  5FRN A;  1YVU A;  3JYT A;  1KLM A;  3V9W A;  3CG7 A;  1I39 A;  4ELT A;  2OPR A;  3LAM A;  3WNG A;  3HP6 A;  4CCH A;  4DU4 A;  1RIL A;  4CJR A;  1HQE A;  1VSF A;  3VQ5 A;  1VSM A;  1Y97 A;  3AO1 A;  1S6Q A;  4DQS A;  4KHW A;  3PV8 A;  4OLB A;  4BE1 A;  4F2R A;  1BQN A;  3SV3 A;  1HNI A;  4CK2 A;  3K5L A;  4Q0B A;  3TAN A;  2Z1G A;  2Q3S A;  2PYJ A;  5FDL A;  1NK9 A;  1ASV A;  4Y1D A;  1B9D A;  1G15 A;  1TGO A;  4KTW A;  3NCI A;  2KQ2 A;  4DQI A;  2VG6 A;  4OKK A;  1RDD A;  2X78 A;  1QTM A;  2QK9 A;  1S6P A;  1S5J A;  4OGE A;  1RBR A;  3TAE A;  5KTQ A;  1IKV A;  4FM1 A;  5HLF A;  1JXE A;  1L3T A;  3V1O A;  4O55 A;  3OYE A;  5HBM A;  4DF8 A;  1KFS A;  3DRR A;  3PO5 A;  1SUQ A;  1DTT A;  3ZT1 A;  3B6O A;  3OYB A;  3KD1 E;  4B08 A;  3VQ4 A;  1IKX A;  2RF2 A;  4ICL A;  4OKJ A;  4CJ5 A;  2D0C A;  4FLT A;  3QLH A;  1TK8 A;  2NUB A;  1KVB A;  3TAB A;  3SNN A;  3AVF A;  4LSL A;  1BIU A;  1JL1 A;  3QES A;  1L3U A;  2BDP A;  1S1U A;  4H4O A;  3ZT2 A;  1JLG A;  5HRS A;  5JS2 A;  4ELV A;  2A1S A;  4M3W A;  1NK5 A;  3IRX A;  3P83 D;  3LP3 A;  2JGU A;  3M8P A;  4H4M A;  2HNY A;  1XC9 A;  4KTQ A;  1LWF A;  5K14 A;  1RT1 A;  3IG1 A;  1ZYQ A;  4KB1 A;  4PUO A;  1C0U A;  3CYM A;  3KKS A;  2X6N A;  1NKB A;  4CGJ A;  3MED A;  1A5V A;  4GMJ B;  4CJK A;  2OA8 A;  4CEE A;  1RDC A;  3ZSQ A;  3L3U A;  5J1E A;  1NKC A;  4FLW A;  4DTJ A;  2G8I A;  1HYS A;  1T7P A;  2YNI A;  3D45 A;  3V9U A;  3M8R A;  4KRF A;  3HJF A;  3OYK A;  3OYI A;  4BE2 A;  3QEV A;  1CZB A;  4O0J A;  1L3V A;  5HRO A;  3WNE A;  3AA2 A;  4JRQ A;  1BQM A;  4KTZ A;  1KVC A;  4E1N A;  2KFZ A;  3NGI A;  2YNG A;  4DSE A;  2ETJ A;  4FLV A;  1KSP A;  1SV5 A;  3KLE A;  2DTU A;  4DMN A;  1QSS A;  4Q5V A;  4FLU A;  1UA0 A;  1RTI A;  1T8E A;  4KFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...