4OPJA

Bh-rnaseh:tcda-dna complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords 5'-D(*CP*GP*CP*GP*AP*(TCY)P*TP*TP*CP*GP*CP*G)-3'
publication title Generating Crystallographic Models of DNA Dodecamers from Structures of RNase H:DNA Complexes.
pubmed doi rcsb
source organism Bacillus halodurans
total genus 41
structure length 133
sequence length 133
chains with identical sequence C
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2014-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4opjA00
1Q8IA 4JS4A 4CESA 5FDLA 4CJFA 4BDPA 2VWKA 4EP4A 3KIOA 3LAMA 2IC3A 3LP2A 4I2QA 1F21A 1KLMA 2Q3SA 3CM5A 1S1UA 4RW7A 3RMAA 1Q9YA 1YVUA 3M8RA 3NDKA 3NF8A 4LD0A 3ISNC 4W5RA 2GBZA 3SV4A 1U04A 3V1OA 3SUQA 4RW9A 1QTMA 4FJ8A 2FBTA 1KVAA 4N56A 3ZSRA 1R0AA 4KI4A 1SV5A 4BE2A 1ASVA 4FLTA 4H8KA 4OLBA 4N5SA 3AVBA 2ZD1A 2D5RA 5CZ2A 3TI0A 2PZSA 4RW6A 4KV8A 1GOCA 3ZCMA 3SV3A 3LZJA 3SZ2A 1WAFA 4BE1A 2IGIA 1RTIA 1IKWA 1RT3A 3AO3A 4IDKA 3M8PA 4CERA 3VQ7A 3NGYA 4CHNA 3RRHA 1FXXA 4FJ9A 4DS4A 2PYLA 4DQQA 1LW0A 4CFAA 2XHBA 1RDAA 1SKSA 2G8IA 4GMJB 1Z26A 1T03A 3A2FA 5SZTA 3FFIA 4CFDA 4KFBA 1C0TA 3NF6A 3TAMA 3K57A 2OZSA 5HROA 3DLGA 4KI6A 4MFBA 2P5OA 4AILC 4XIUA 1BCMA 4FJGA 5KGXA 3E01A 2P1JA 4B9SA 1C1BA 4CJVA 3AVFA 4Z4IA 4CEFA 3I8DA 4M3RA 3V9UA 1JLGA 1I39A 1RBVA 3C6TA 4I7FA 1REVA 3KK1A 3BDPA 3NF7A 1JKHA 2DFEA 3DM2A 3LALA 3U3YA 4FZZA 4CJSA 1TAUA 2B6AA 2QXFA 4CF0A 3ULDA 1VSHA 3T3FA 4O5BA 1UAXA 1D9FA 3KK3A 3ZSVA 4KTZA 1HYVA 4M3ZA 2VG7A 2O4GA 1ASWA 1QQCA 3VN5A 4HUGA 3PY8A 3KKRA 4W5NA 3RR8A 1TGOA 3LWLA 4ZTJA 1BL3A 5KTQA 4DFJA 1NK8A 2P51A 2OPQA 3KK2A 2AJQA 4FLYA 5JS2A 4HCCA 3L3UA 1VSMA 1N5YA 4O4GA 2BANA 1WSEA 1L3TA 5FRMA 2E6LA 4CJLA 3IAYA 3WNEA 4FZYA 1SKWA 3NHGA 3HXMA 4DU4A 4DSJA 4J2EA 2KZZA 3AA2A 1RBRA 1ZBLA 1ZBIA 3TANA 1CZBA 1VSFA 4PQUA 1U45A 1CXUA 4B8CA 4HUFA 1CZ9A 1UOCA 1VSLA 4CEQA 5HP1A 4E0DA 3VQQA 5D3GA 3VQ9A 1S1VA 3DLKA 2KQ2A 4KREA 1QSYA 3L2VA 5T7BA 4UQGA 1NJYA 5HLFA 3RR7A 4IFVA 3OS1A 4KRFA 4W5OA 3S9HA 1ZBHA 1YT3A 4Q5VA 3F73A 1SL2A 3PV8A 3LP0A 3HT3A 1EX4A 3O3FA 2YNFA 2EX3A 3UIQA 4E7KA 3ZSYA 2EHGA 3M8QA 4F4KA 3KD1E 1UA0A 2WONA 2B5JA 4EP5A 1KFDA 4IBNA 4AHVA 4CJ5A 3QNNA 3HVRA 4CE9A 3WNHA 1C1CA 5C42A 3LZIA 4EZ6A 2GUIA 5CYMA 3ZSXA 3L2WA 5J2MA 1X1PA 4LH5A 1WSJA 1W9HA 4DFKA 3OYIA 3AVIA 3HVTA 5EU7A 2R7YA 5CY4A 3D45A 1IKYA 3SQ1A 3PX4A 1RNHA 1TK0A 3B6PA 1XHXA 4FJNA 3MXJA 4KHWA 4C8OA 4DQPA 2DFFA 2X6NA 1WAJA 1JLBA 5SWMA 1QE1A 3HP6A 1DTQA 3QO9A 1WSFA 4CFBA 3VQ4A 3L2RA 2F96A 3VQ8A 4JRQA 4CIEA 3DRPA 4CF2A 4ID5A 2HMIA 1C1AA 4M45A 3THVA 4O55A 4CEBA 2GV9A 1C0MA 1NK9A 4HCBA 5KGWA 3VA3A 4FLXA 2YV0X 1UWBA 4DLGA 1TAQA 1ASUA 5HRRA 3O3HA 4CJWA 4DLEA 2HHUA 1KTQA 4B8AB 3NCIA 2E4LA 4YNQA 4CJEA 3HP9A 4W5QA 3NH0A 1LW2A 5FROA 3OJUA 4FLWA 4E7IA 1U49A 3PO5A 1HQEA 4L8RB 4EZ9A 3VQEA 3V4IA 3HK2A 3VA0A 3OYCA 5FRNA 2NUBA 3ITHA 1RDDA 1J54A 3K59A 1WSGA 1T8EA 4F3OA 1NK4A 1YTAA 1BISA 4LY7A 4K8ZA 4J2BA 5HRPA 2FC0A 4AHCA 3BGRA 3DLRA 4AHSA 3V6DA 1FK9A 3VQ6A 4CEZA 4LSLA 2YNIA 3QINA 4CJPA 4DQRA 1W0HA 4FK2A 3AA4A 3AO4A 3C6UA 3KLGA 5HRNA 3O4NA 3TAFA 1EKEA 2FBVA 2VWJA 4KB1A 4M3YA 2RKIA 4OLAA 4J2DA 3DMJA 2HHQA 1RILA 2XRIA 1LV5A 1C6VA 2ATQA 1TKTA 1HPZA 1O1WA 3ZT1A 2FBXA 1RT4A 3AVNA 4AH9A 4NYNA 3RTVA 5HRSA 3V9ZA 4PA1A 4N41A 4B9VA 4KHSA 3NF9A 3ZSZA 1TK8A 3AVCA 4M42A 4DTNA 3MEDA 4JLHA 1JXEA 3VQAA 3TAQA 3SPYA 3EZ5A 4CEAA 4FM2A 1J53A 2F8TA 4YFUA 4ZHRA 5C24A 2HW3A 4FLUA 4NYFA 4NCBA 1S5JA 2Z1GA 3QLHA 3HJFA 1VSEA 2OA8A 4CJ3A 1L3SA 2HHTA 2XY7A 3IRXA 3ZSWA 2QKBA 3K58A 4G1QA 3OYHA 4DTXA 4KKOA 4Z4HA 4JS5A 3L8BA 4ELVA 1RBUA 2Z1HA 1S9EA 1T7PA 3U6FA 1KCFA 1VSDA 3TAEA 3AVJA 4HUEA 4CIGA 3RMDA 2WOMA 1X9MA 2D0AA 3G10A 4FW1A 4KHQA 1S1TA 4C8MA 3RWUA 4AHTA 4CK3A 4W5TA 3QEXA 3TAPA 4DSIA 3OYKA 3DLEA 1C0UA 3MEEA 4WE1A 1WSIA 4AHUA 3S3OA 3RRGA 2W42A 3DOLA 5DK5A 2HVHA 4B9UA 2HNZA 2QK9A 2OPSA 3CYMA 2DFHA 3CFOA 3DOKA 4CECA 1HYSA 2BE2A 3K5OA 3OYMA 3SUOA 4DG1A 2HHSA 1XWLA 4DU3A 4M3UA 3HO1A 3VQDA 2ITGA 1QS4A 2Z1JA 2KFZA 2XY8A 4ZTFA 4FVMA 3MXMA 2PY5A 4PUOA 1HQUA 3LAKA 3PO4A 3I0SA 4KO0A 4RG8A 1UA1A 1QHTA 1KFSA 4FZXC 1T05A 4ICLA 4CGIA 1CLQA 3T1AA 2Y1IA 1TL3A 4DTMA 3HPGA 4CGHA 4I9LA 1IG9A 3SCXA 1S6QA 4OGEA 3OYBA 4I9QA 4DSEA 1NJWA 3CG7A 1NKBA 4FJIA 4C8LA 1VSKA 4GVMA 3HM9A 3NGIA 3OYEA 4RW8A 1IKVA 3U3GA 1RT5A 4MQ3A 2JGUA 4NCGA 4E89A 5CYQA 3AVMA 3SUPA 4F3TA 1RT2A 5KRTA 4CGFA 3WNFA 3T19A 1TV6A 3QEWA 3DLHA 1BCOA 1Q9XA 1ITGA 1RBTA 3ASMA 1HYZA 1BI4B 2FBYA 3V1QA 4CF1A 3NH1A 4Y1CA 1JLFA 3RMBA 4KHNA 4OKKA 4AHRA 3VQPA 3SQ0A 2JLEA 1GOAA 1NOYA 4DTRA 3OS0A 1ZBFA 1DTTA 3AVHA 3SI6A 3I0RA 2IS3A 3AO2A 4Z4CA 3QEPA 2IDOA 4CHZA 1J9AA 4QOZB 2Y1JA 4CEDA 4IKFA 4DWIA 4CHYA 1JLCA 2YNHA 4B9MA 1L3UA 2G8HA 1SKRA 1TL1A 3NAEA 2ZQBA 2X6SA 3M8SA 4QAGA 3D0PA 3HYFA 1J5OA 3SJJA 1VRUA 4CEEA 1MU2A 4I2PA 3O3GA 3P1GA 2VG6A 2YNGA 3OYDA 3KLHA 1EXQA 1DLOA 1RDBA 2RF2A 3CFRA 1CXQA 4DTPA 3VQBA 4CF9A 1X9SA 4QCLA 3K5LA 1JLEA 4CGGA 3V9XA 3MECA 3QEVA 3SQ2A 2G8KA 1U4BA 1VSJA 3B6OA 4CEOA 4CJUA 3L2QA 4PY5A 1EP4A 2OYQA 1X9WA 1KLNA 1JL1A 2YKNA 3OYGA 3S3MA 4CHQA 2G8VA 3VQCA 4DSKA 4M3WA 4HHTA 3SPZA 3ZSOA 4DFPA 4CGDA 3TAGA 2OPRA 3L2UA 4PWDA 4O0IA 1S1WA 2ZE2A 4GW6A 3VQ5A 4FLVA 3MEGA 2XO7A 4BWJA 1XC9A 3QIOA 1SL1A 1NKEA 3DRSA 2D0BA 2PYJA 5DMRA 3AVLA 4FM0A 4DTSA 2G8UA 4FK0A 4KB0A 4FYDA 1VSIA 1HNIA 1WNSA 1JL2A 5J2NA 3KLEA 3V81A 1Z25A 3OYNA 3SUNA 2A1RA 1SL0A 1B9FA 5JS1A 4BDZA 1S6PA 1LWFA 4Z4GA 3ZSQA 1D9DA 4DQIA 4B08A 5J1EA 2G8WA 2Z1IA 1RTDA 2OZMA 4FM1A 3QNOA 3MXIA 1JXBA 3AO1A 4O0JA 3K5NA 3QETA 3RMCA 4RW4A 4CJKA 2BGGA 4CHPA 1NK6A 1Y97A 4J2AA 3CM6A 4Z0UA 4FJKA 4FJLA 3AVAA 3OYLA 4FXDA 3AA5X 1JLQA 3L3VA 3AA3A 1RT7A 3C95A 3QEIA 4C8NA 3OJSA 1B92A 3AV9A 3KKSA 4DS5A 1BIUA 1BGXT 1YTUA 2KW4A 4TSXA 3EY1A 4JRPA 4DSFA 4B9TA 4CK2A 4KHUA 2O4IA 2XY6A 3CFPA 3ZT0A 1ZBUA 3SYZA 1SUQA 1VK0A 4OJRA 2HNDA 3LPTA 1WSHA 1HNVA 2OPPA 4FJJA 3P5JA 4Y1DA 3TWHA 1TVRA 2B4JA 2KFNA 3S3NA 3PUFA 1NK0A 2IOCA 1WN7A 5C25A 2HHVA 4OPKA 3KJVA 4OPJA 4OVLA 3OY9A 3DRRA 4BDYA 4DTOA 2HB5A 3KLIA 2RPIA 3QERA 2KZMA 2XY5A 1IO2A 2E6MA 4H4MA 3NH2A 3ZT4A 1A5WA 3ALYA 4N47A 1A5XA 4FCYA 4FLZA 4CK1A 3SNNA 4Z4EA 1KVCA 4FJ5A 4FJMA 2IAJA 1NKCA 3LANA 1NJZA 2X74A 4ELUA 1QSLA 1WLJA 3OS2A 4BWMA 4M3TA 3LPUA 3HPOA 1TKXA 3G0ZA 4IG0A 2D0CA 3NGZA 1BQNA 2G8FA 1KRPA 1QSSA 4F2SA 3K2PA 2HNYA 1IH7A 1S1XA 3IG1A 5J2QA 4E3SA 3H08A 1JLAA 1XHZA 4CJQA 4CF8A 2F8SA 3F9KA 5CZ1A 1TK5A 2HVIA 4OKEA 3JYTA 3TR8A 1A5VA 1D5AA 3V1RA 3KTQA 1RDCA 3IS9A 1HRHA 3JSMA 1HMVA 4KAZA 5I3UA 3V9WA 3KD5E 3P83D 1BQMA 3LP1A 1L3VA 3OYFA 1NK5A 4FJXA 4NCAA 4FJHA 2YHBA 1LWEA 4OKJA 4F2RA 1ZYQA 4M3XA 1BHLA 4LH4A 3EYZA 4HTUA 3PX6A 2P5GA 2HHWA 2VG5A 4N76A 1U48A 2DTUA 3PX0A 3HSTB 3NFAA 3V9SA 3NBPA 4CHOA 1TKDA 3LP3A 1RTHA 4DTJA 1VRTA 5KI6A 1IKXA 1LAWA 3HPHA 5J2PA 3SQ4A 4B9NA 2A1SA 1KVBA 3OYAA 4HVJA 4C8KA 2YHAA 1D8YA 3DYAA 3HL8A 1NOZA 1GOBA 4ELTA 1S9GA 2RN2A 3OYJA 4Z4FA 3ZT2A 3KLFA 1TKZA 5I42A 2BDPA 4DSLA 3AVKA 1K6YA 4KTQA 4KPYA 1BIZA 1RT1A 4ID1A 4DF4A 4E19A 1N6QA 4CFCA 1RTJA 3NE6A 3AVGA 2DY4A 4BACA 4KHYA 3TABA 4FW2A 3K5MA 2LSNA 5E41A 4B3OA 4E7JA 3DI6A 2HHXA 4R5PA 2YKMA 4CGJA 3LWMA 3TARA 1NK7A 1RT6A 5K14A 5HBMA 3DLBA 1FKOA 3AO5A 1G15A 4CJTA 4E7LA 1L5UA 4DU1A 4CCHA 4LSNA 4CIFA 1RBSA 4OGCA 3QESA 2ETJA 4KTWA 4CJ4A 4E1MA 4DTUA 4DFMA 3ZT3A 1XI1A 3LDSA 4CJRA 3MAQA 3CQ8A 1FKPA 3O4QA 4E1NA 2KTQA 4FK4A 1EETA 5KRSA 1LWCA 1LAVA 3QIPA 4DQSA 4FJ7A 4M41A 4DMNA 4BE0A 4B9LA 3C94A 4IG3A 1B9DA 1NJXA 4DF8A 1BI4A 4IFYA 4O44A 3WNGA 1U47A 4F8RA 4K8XA 2I5JA 1HJRA 1I3AA 2QKKA 1RCHA 4Q0BA 3OVNA 4E7HA 1KSPA 2X78A 4H4OA
chains in the Genus database with same CATH superfamily
1Q8IA 3PLAA 4EP4A 1EWQA 3CERA 2V52B 1YVUA 4WFNL 4LF6K 2GBZA 1U04A 3V1OA 4BC2A 2PAVA 4FJ8A 1KVAA 4N56A 1VAZA 4B3SK 4YORA 3CF5L 1SV5A 4KI4A 1U2VB 4H8KA 4OLBA 2NRWA 1GOCA 1WAFA 4BGBA 1RTIA 3M8PA 3NGYA 4DQQA 1LW0A 2XHBA 2G8IA 1T03A 3A2FA 4CFDA 3TAMA 1C0TA 3TU5A 3ZX0A 3IUCA 4KI6A 1YHQN 3ENBA 3DXKA 5KGXA 3AVFA 4IDHA 3H45C 3F9MA 2DFEA 1S72N 2B6AA 2YI1A 1VSHA 4WQ4C 4R79A 1D4XA 5BN9A 5AQRA 4M3ZA 4JI3K 3NVKA 3ZETB 1TGOA 3N4PA 3VEZA 1NK8A 1IBMK 5EVZA 4JI6K 3OBWA 3NVMA 2E5LK 1ZC6A 5AQGA 4L3QA 2BANA 1BOTO 4DCHA 1N5YA 1L3TA 1HJOA 3U8XA 2E6LA 3IAYA 3WNEA 1VQ9N 3HXMA 4DSJA 1HKCA 3TANA 1K73O 3ID8A 5KQ8A 4B8CA 4FL9A 4CVNE 1BG3A 1SZ2A 4JYAK 3D2FB 3VQ9A 1S1VA 3DLKA 1OH8A 2YJEA 1K8KB 3L2VA 1NJYA 5HLFA 5TKYA 3CIPA 3O3FA 2EX3A 4BG9A 2GELA 3M8QA 1NU0A 3KD1E 2B5JA 4EP5A 4ISEA 4AHVA 4K0KK 3HVRA 5I9EB 4JV5K 2GUIA 3ZSXA 4YY3K 3ID6A 5CY4A 3R3LA 3R9PA 2X6NA 4IZ9A 4NB4A 4JD2B 3V9ZA 1WSFA 4JRQA 3VQ4A 3I55N 1E4FT 1VQKN 4O55A 1SQKA 2KHOA 1NK9A 2H3GX 3ZLJA 1UWBA 1ASUA 3CCLN 3MN6A 4CJ7A 3NCIA 4ILGB 3DXMB 4CJEA 3NH0A 3THWB 4E7IA 3E9OA 3VQEA 3V4IA 4X64K 3A5OC 5FRNA 3ITHA 1RDDA 1J54A 3K59A 1IBLK 1VQ8N 4X65K 1OKJA 2F9TA 2KLAA 1XC3A 4GV9A 4FWSA 2F7TA 4FPBA 4CJPA 4KH4A 1I94K 1EWRA 4FK2A 1V4SA 3AA4A 2QTDA 3TTFA 3O9QA 3MK6A 3KLGA 2QWPA 4M3YA 4KB1A 4F9OA 2WC9A 3SAHA 2RKIA 3DMJA 3D2EA 1LV5A 5KRSA 1TKTA 3GE1A 4AH9A 1RT4A 4N41A 1U6ZA 4KHSA 4PA1A 4O5FA 3AVCA 4DTNA 3SPYA 4MDAA 4FO0A 5C24A 1WB9A 2Z1GA 3QLHA 4CJ3A 1L3SA 5CR4A 3ZSWA 4B1WB 4DV5K 4DTXA 1RGIA 4ELVA 1S9EA 2Q31A 1T7PA 4BQZA 3TAEA 4HUEA 1NWKA 4B1UB 1S1TA 1K8AO 5HL7L 3QBWA 3MEEA 2W42A 2GWJA 4CBUA 1NLVA 4JKGB 3K5OA 4IJAA 2I7PA 2ZWHA 4PKGA 5KPRA 4M3UA 1QS4A 4GV6A 5AQLA 5MLCQ 3HBTA 3MXMA 3PO4A 4C23A 3I0SA 4XH1A 3VEYA 3AGKA 1TL3A 3HPGA 2O8DB 3OYBA 3VF2A 4DSEA 3MN5A 3P31A 1M1KO 2JGUA 4NCGA 3O4WA 2NNWA 3QEWA 4V19S 3LDSA 1RBTA 3NH1A 1BI4B 2FBYA 2QWLA 3BZKA 4IJNA 4CF1A 2IVNA 4DV2K 4BVOA 4DTRA 1ZBFA 3AVHA 4X62K 3SI6A 3EE9A 3WXKA 3WUHA 3GL1A 4QOZB 4LFBK 4E1JA 2YNHA 2Q0UA 3ENHA 1HPMA 2OTLN 4QAGA 2PFUA 2HF4A 4G9ZA 2O8EB 3E66A 2YNGA 3OYDA 3KLHA 5BREA 5DM6L 2RF2A 3G71N 3VQBA 4DR4K 1JLEA 4CGGA 3QEVA 3SQ2A 2G8KA 1U4BA 3B6OA 2OYQA 1JL1A 4CHQA 3VQCA 4DSKA 4M3WA 5AQTA 4CZKA 4BC4A 3WXMB 2ZE2A 2W6KA 3R8EA 3O80A 2UXDK 3AVLA 3DLLL 4DTSA 4FYDA 1HNIA 1Z25A 4RWTA 1SL0A 1NGHA 2D1KA 5JS1A 2GTDA 1MA9B 1LWFA 4Z4GA 1D9DA 4DQIA 3IKMA 2PBDA 2Z1IA 5C2FA 2OZMA 1JXBA 4O0JA 3QETA 2BGGA 1Y97A 2QI2A 3L3VA 3A8YA 3QEIA 4O8KA 3I33A 1B92A 1NGJA 4B1YB 2QEXN 4B3MK 1N34K 1MWKA 4TSXA 3EY1A 2XY6A 1WSHA 1HNVA 3P5JA 4Y1DA 2A3ZA 1TVRA 2B4JA 2QWMA 4DQ8A 1SAZA 3S3NA 2IOCA 5M1PA 4A5AA 3VF6A 4GKKK 4B1XB 2HHVA 3DRRA 4A59A 1BDGA 4DV0K 3NMUA 4H4MA 3CPEA 3ZX2A 3JS6A 3SLCA 4FJ5A 2HSTA 3C7NA 1WLJA 4M3TA 4BWMA 3G0ZA 2G8FA 1BQNA 1N8RO 3A5MC 3IG1A 2UUBK 4E3SA 3H08A 3M5RA 3HTVA 4FWPA 4WFAL 1D5AA 3V1RA 4DR7K 5C2DA 3IS9A 2NRXA 1NK5A 4OKJA 4F2RA 1BHLA 4HTUA 4K41A 3PX0A 3NFAA 4JKEA 4BRKA 1TKDA 3FZMA 4DTJA 3HPHA 4B9NA 5J2PA 3SQ4A 3OYAA 1ZXOA 4KH5A 4DR1K 4B3TK 1D8YA 1NOZA 4JKFA 2BDPA 4KPYA 3AVKA 1K6YA 4DF4A 4IFEA 3Q7BA 4CFCA 1RTJA 3NE6A 3U9DA 4KHYA 4FW2A 4B3OA 2LSNA 5E41A 4E7JA 4BRAA 2YKMA 4R5PA 3LWMA 4MDBA 4CI6A 4JN4A 3DLBA 5AQYA 1G15A 4DU1A 4MO4A 5C15A 3E9LA 4CIFA 4IOXA 3QESA 4DTUA 1XI1A 3J8AA 2A40A 1Z05A 4LF8K 4OX9K 1EETA 4FPAA 1LAVA 3HM8A 4BE0A 4PKIA 4JNEA 3C94A 1TUYA 1WBBA 4CZLA 3ZEUA 3WNGA 2NRTA 4K8XA 4Q0BA 1QQMA 3CJ7A 4H5NA 4WYBA 3U4LA 4JS4A 4CZMA 5FDLA 4CJFA 2VWKA 3LAMA 1NJIO 3J81O 1F21A 4I6MB 1KLMA 4JHDB 1S1UA 1S22A 1XUPO 3VMFB 1YJ9N 4H0YB 1HLUA 4RW7A 2WUSA 3K9JA 4JAXA 3NF8A 4FWNA 3ISNC 1FW6A 3SUQA 3CETA 1M90O 4N5SA 3AVBA 3TI0A 2PZSA 4RW6A 3ATVA 3ZCMA 3IFRA 3PIOL 5AZIB 4KHQA 1NK7A 3AO3A 1KAYA 3VQ7A 1FXXA 5LY3A 4H0OA 2PYLA 4XEIA 1RDAA 4GMJB 1Z26A 1ATNA 5SZTA 3K57A 2OZSA 3CJ1A 3HI0A 5BPLA 4AILC 1BCMA 4FJGA 4CJVA 1G99A 2E8AA 3I8DA 2GWKA 1JKHA 3LALA 3U3YA 5FPDA 4O5BA 2CH6A 1D9FA 4BG8A 4KTZA 1HYVA 2ZM6K 3VN5A 4HUGA 4W5NA 3RR8A 4GNIA 3ZYYX 3VERA 4EIAA 2Q0RA 4NXMK 3C65A 2O8FB 4NO7A 1EO1A 3W3DA 3KK2A 3CJAA 2AJQA 4HCCA 3L3UA 1VSMA 4O4GA 3SJHA 4FZYA 2FSNA 2P9IB 4DU4A 3AA2A 1T3VA 1ZBLA 5FPMA 2HF3A 1CXUA 4YOVA 4E0DA 4JKCA 3VQQA 2KQ2A 3A5NC 4KREA 1X3NA 3RR7A 3OS1A 4H5WA 1YVNA 3F73A 5FPNA 5LL6Z 3UIQA 3HRGA 2EWSA 4E7KA 1ILYA 3GG4A 2P9NA 4F4KA 2WONA 4XH4A 1KFDA 4CJ5A 3QNNA 2P9PA 3WNHA 1IBKK 5C42A 3DWLA 4A5BA 3EN9A 3FFKB 5CYMA 4LH5A 3KWGA 1WSJA 1WOQA 3AVIA 2UYTA 5EU7A 3D45A 3PX4A 1TK0A 3B6PA 1XHXA 4KHWA 3MXJA 2QA4N 4C8OA 1NGCA 5SWMA 3UKRA 3THVA 4DB3A 3QFUA 3L2RA 3VQ8A 1C1AA 3EZWA 4M45A 2P9UA 1NGBA 3VA3A 4FLXA 2YV0X 1VHXA 3O3HA 4B8AB 2E4LA 3HP9A 1HQEA 4L8RB 3VGMA 3HK2A 3H1QA 2NUBA 3P4IA 5ADXA 1XNQK 4CD1A 2A42A 1T8EA 4F3OA 2IVOA 4JI4K 4CZHA 2E2NA 4WCEL 3QBXA 2P9KB 2FC0A 4AHSA 3K0SA 4BR0A 3CPWM 4BRLA 3C6UA 3O4NA 3TAFA 4JI5K 4OLAA 1RILA 2QM1A 4QS9A 2P9LA 4H5TA 3ZT1A 3PY8A 2FSJA 5HRSA 3JAMO 4BRPA 4BGAA 3OW2M 4JLHA 3TAQA 5KPZA 3EZ5A 4H0TB 4FM2A 1J53A 3TTDA 2F8TA 4ZHRA 3SAGA 1QHAA 2Q36A 1TYQA 4NCBA 1S5JA 2FF6A 2OA8A 3H46O 2HHTA 2XY7A 3IRXA 5BRFA 3K58A 4G1QA 4Z4HA 4YOXA 1HUXA 3L8BA 3U6FA 3AVJA 4CIGA 3G10A 3FE1A 3RWUA 4AHTA 1Y64A 3QEXA 3WXLA 3C6AA 3OYKA 3VTIA 3RRGA 4FWMA 4LF4K 3GDQA 3S3OA 4B1ZA 3WT0A 3DOLA 3VENA 3MDQA 4YDUA 2QK9A 3FZLA 2DFHA 3WEEB 4CECA 5E84A 1KAZA 3VQDA 5HOOA 3G6EN 4FVMA 5AR0A 4PUOA 4KO0A 4RG8A 5F1XA 4WQ5A 1KFSA 4CGIA 1NMNA 2GX9A 1V4TA 3EKUA 4DTMA 4CGHA 1HNWK 4I9LA 3VEWA 3TPQA 1XMOK 1NKBA 1KQSM 1VSKA 2V51B 3HM9A 5JLFA 3U3GA 4JI2K 3MWPA 1RT5A 3ENOA 3WNFA 3DLHA 1BA0A 2E88A 5AJ3K 4CZJA 3OS0A 2IS3A 1C0GA 2ASMA 2HMPA 3CHWA 2QWRA 3WQUA 4DWIA 5AQHA 4WFBL 1L3UA 2G8HA 1TL1A 5F0XA 4DKWA 1RDWX 4B3RK 5M1OA 2QW9A 3P1GA 3OHRA 1DLOA 4JKBA 3KZBA 4CF9A 5M1FA 2WFBA 4QCLA 3V9XA 1W7AA 3MECA 1VSJA 4FWQA 4DV6K 3MWTA 4OPHA 3D2FA 3ULEB 1K8KA 1KLNA 3RSEB 2Q97A 3GBTA 3BUZB 3SPZA 3AAQA 4DFPA 2OPRA 3C6HA 2FF3B 4GW6A 3VQ5A 4FLVA 1J5EK 2XO7A 4BWJA 1SL1A 2D0BA 4KB0A 3V81A 3SUNA 4BRNA 4FOIA 1S6PA 2IIRA 3CCQN 4B08A 4J8FA 4DV7K 1MDUB 3AO1A 1YI2N 4KBOA 4RW4A 4IWVA 4FJKA 4JD2A 3QICA 2UUAK 1RT7A 1Z6RA 3AV9A 3VOVA 1BIUA 1YTUA 2KW4A 4JKAA 4JRPA 4DSFA 3DXMA 3VPZA 3QFPA 4CK2A 3THWA 1VK0A 2HNDA 3THYB 3TWHA 3L4QA 4M7YA 4H0XB 1ATRA 5C25A 4JKDA 4OPKA 3OTOK 3OY9A 4BDYA 1NGFA 4DTOA 3KLIA 5EXWA 2KZMA 2OANA 2E6MA 3NH2A 1Q86O 4WQ4A 4ISGA 5ELZA 4CK1A 4FJMA 4ILHA 1XNRK 2IAJA 3LANA 2P9SB 2HBKA 3VGLA 2FLOA 5F2RA 4IG0A 3NGZA 4F2SA 5LJWA 5JMVA 1OVQA 4YOYA 3R1XA 1QVFM 4QS8A 4CJQA 3F9KA 3LM2A 2YHXA 1T6CA 1TK5A 3CJ9A 2HVIA 3TR8A 2F4VK 1VQNN 1HRHA 3JSMA 3MCAB 3LP1A 3QMLA 4GKJK 3OYFA 1T6DA 4FJXA 4M3XA 2YHBA 1LWEA 4LH4A 2P5GA 2ZJPL 1U48A 2DTUA 3L4IA 4CHOA 5GINA 4CZGA 1VRTA 1IKXA 2A1SA 4HVJA 2YHAA 3DYAA 4JKGA 4JI8K 1GOBA 3E9PA 3O9RA 3O9UA 3ZT2A 4YOTA 1TKZA 3LDQA 2HBJA 4DHYA 3M6GA 4DV3K 2DY4A 4NLBA 2HHXA 2O8DA 1GLDG 1HKBA 5K14A 3THXB 3AO5A 1L5UA 4LSNA 1RBSA 1GLCG 4OGCA 5M1NA 2ETJA 4KTWA 4E1MA 3ZT3A 4M63C 3MAQA 3CQ8A 4E1NA 4FJ7A 3QIPA 3UKUB 4DQSA 4UY8O 1S3XA 5FPEA 1NM1A 4CZFA 1BI4A 4IFYA 4O44A 4BR7A 4F8RA 1HJRA 1I3AA 2DPNA 3MMVA 4DR3K 1RCHA 5B8HA 3OVNA 3WXJA 4H4OA 1KXPA 4BDPA 4B1VA 3KIOA 2IC3A 3LP2A 1TUUA 4I2QA 3CM5A 2Q3SA 1VQ4N 3M8RA 4BRQA 3NDKA 4LD0A 3T69A 1QTMA 1HNXK 2O8EA 3ZSRA 4BE2A 1ASVA 1NBWA 1R59O 2D5RA 2ZD1A 5CZ2A 3BF1A 2Q2RA 3LZJA 3SZ2A 4OPAA 4U7BA 1IKWA 4IDKA 2IVPA 4CERA 4CHNA 3RRHA 3PSFA 4DS4A 4CFAA 3WQTA 1SKSA 1FJGK 3CC7N 1IJJA 3NF6A 4CBWA 3DLGA 1VQON 1ATSA 1Q18A 2P1JA 4Z4IA 4CW7B 3V9UA 1YIJN 1JLGA 4I7FA 3BDPA 3NF7A 3DM2A 4CJSA 2NLXA 4CF0A 3T3FA 3KK3A 4EFHA 5JVGL 1IV0A 2VG7A 1ASWA 3KKRA 2ZGZA 2WBNA 4LFAK 3LWLA 4BR9A 4ZTJA 3SBTA 5KTQA 4BRHA 3FZFA 2P51A 2OPQA 4FLYA 5M1QA 1DKGD 1WSEA 3B8AX 3T1HK 1SKWA 3NHGA 4J2EA 3J80O 1RBRA 3CCRN 3CCSN 4K42A 4PQUA 5BPMA 4HUFA 1CZ9A 1UOCA 1VSLA 4CEQA 5TKWA 5D3GA 1QSYA 5T7BA 4UQGA 3SAFA 1WBDA 3S9HA 1ZBHA 4Q5VA 1GLLO 1GLBG 1EX4A 4BR4A 4PHTX 5CE3A 2NZTA 2UXBK 3ZSYA 5KQDA 1UA0A 3I56N 4IBNA 5AFUA 1YJWN 1C1CA 3LZIA 3HOTA 1W9HA 1IKYA 3IMXA 1RNHA 1NGAA 4DQPA 2DFFA 2KZZA 1WAJA 1JLBA 3HP6A 4EHTA 1DGKN 3QO9A 5AQJA 2HMIA 4CF2A 3DRPA 4ID5A 5C10A 2GV9A 3OBYA 2CGKA 4DLGA 4DLEA 2NRRA 4YNQA 3OJUA 4W5QA 1LW2A 5ADXH 4FLWA 3PO5A 4EZ9A 1NMDA 2HBMA 2ZJRL 3VA0A 5GAEP 1WSGA 1NK4A 1YTAA 1BISA 2E2PA 4LY7A 4K8ZA 5HRPA 4AHCA 3BGRA 3DLRA 2UUCK 4LSLA 2YNIA 1W0HA 1WUAA 3CXCM 3AO4A 1E4GT 3LDNA 5HRNA 1EKEA 5IWAK 2VWJA 2HHQA 1NNEA 2FBXA 4HWIA 2JWKA 3ZSZA 4M42A 3VEXA 3MX2A 3MEDA 3VQAA 1JXEA 4PL7A 3CCEN 4YFUA 4H0PA 2HW3A 3BZCA 4FLUA 3A0IX 3EL2A 4BRDA 3HJFA 2RHKA 2O8BB 1VSEA 3ATUA 2FSKA 3O9TA 3OYHA 4KKOA 4JS5A 1ESVA 2Z1HA 2WOMA 1JJ2M 2D0AA 2A6AA 4FWKA 4JK7A 3TTCA 4CK3A 3TAPA 3BEXA 1C0UA 4WE1A 1WSIA 3FGUA 4I6MA 4JHDA 3O8MA 2HNZA 2ZJQL 2VWBA 2OPSA 2A5XA 3CYMA 3DOKA 5GAHP 1HYSA 2BE2A 1VQPN 3SUOA 4DG1A 4JI7K 1SS6A 2ITGA 2Z1JA 3MN7A 4ZTFA 3VGKA 1HQUA 1QQOA 1T05A 1CLQA 3T1AA 3M3ZA 4JKHA 2Y1IA 5AZIA 1IG9A 4FWRA 3J7ZO 4OGEA 2VQFK 3CG7A 3NGIA 1GLAG 4RTFD 3OYEA 4RW8A 4A57A 3SUPA 4E89A 4F3TA 5CYQA 3AVMA 4OO1J 1RT2A 3T19A 3WXIA 5EOYA 1HYZA 4EAHD 1XMQK 4KHNA 1GLJO 4OKKA 4AHRA 3VQPA 1RDUA 2JLEA 5AZJB 3K9KA 1DTTA 5AQUA 3O08A 3I0RA 4Z4CA 3QEPA 1J9AA 2Y1JA 4CEDA 4IKFA 4B9MA 1JLCA 4CZEA 3NAEA 4DR5K 1VQ7N 2O8FA 5BR9A 2ZQBA 2X6SA 3M8SA 3D0PA 3VTHA 3HYFA 1J5OA 4CEEA 1MU2A 1GLEG 3O3GA 2VG6A 1YUWA 5DM7L 1CXQA 4DTPA 4JI0K 3K5LA 5AQPA 3L2QA 1EP4A 4BREA 4A2BA 1X9WA 2YKNA 1NGEA 2GEMA 3CCMN 2G8VA 3VEVA 2CGLA 1K9MO 4HHTA 3ZSOA 3TAGA 3L2UA 3DXKB 4PWDA 4O0IA 1S1WA 4DUYK 3MEGA 4NLCA 1XC9A 3QIOA 1NKEA 3DRSA 2PYJA 5DMRA 2NRZA 2V7YA 4FM0A 1HR0K 1VSIA 1WNSA 1JL2A 3KLEA 3OYNA 1OH7A 3EEQA 4BDZA 1OVYA 2E20A 3GOIA 5AQQA 3CMEN 4FM1A 3MXIA 2D0PA 3K5NA 2E1YA 3L0QA 4BRIA 3RMCA 1NK6A 3CM6A 3S41A 3OYLA 1JLQA 4IO9L 2YX6A 3AA3A 3C95A 3FZKA 4BC3A 2YCHA 5JVHL 1BO5O 3P39A 3J7YP 3KKSA 4YOUA 4HTLA 1YAGA 4AM6A 2O8CA 4KHUA 3BY5A 2O4IA 3R6MA 3ZT0A 3SYZA 3E1YA 1WN7A 1BA1A 5AQSA 3KJVA 2QWOA 4OVLA 1RFQA 3FR0A 2P9KA 2HB5A 4M7XA 3QERA 2E2QA 4X66K 2XY5A 3A5LC 4N47A 3SNNA 1KVCA 3C0BA 3PSIA 1U2VA 3KHYA 2X74A 1TKXA 4MLHA 5JICA 3KVGA 3HOSA 1S1XA 2QWQA 4DUZK 1OH6A 5CZ1A 4GY2B 1J6ZA 5LMUK 3N4QA 1HMVA 3V9WA 3KD5E 3P83D 1YITN 5C12A 3LDOA 1NGDA 4FJHA 1X9JA 1VQ5N 2HHWA 3HSCA 3CJCA 3HSTB 3H3OB 4BQLA 3NBPA 3LP3A 1GLFO 3CQXA 1KVBA 3L6QA 4C8KA 3ZETA 4ELTA 5GIPA 3G25A 3WEEA 1VQLN 4DV4K 1OH5A 2ZGYA 3H3NO 5I42A 1BIZA 1RT1A 2ASOA 5BR8K 4E19A 1N6QA 1W97L 3D2EB 3FZHA 4BACA 3TABA 3IDHA 3K5MA 3TARA 2QXLA 5AQOA 4DFMA 4CJ4A 3BF3A 4CJRA 1FKPA 3O4QA 4CD3A 2VYPA 4MLEA 4B9LA 5KPTA 4IG3A 4AM7A 1B9DA 4H03B 4DF8A 1NJXA 1U47A 3O1BA 3EKSA 3JXUA 3HZ6A 1HNZK 2X78A 3TSPA 4CESA 2OTJN 3SBGA 1JCGA 4QS7A 3AARA 5EY4A 3CCUN 3RMAA 1Q9YA 1BUPA 4W5RA 3SV4A 3CI5A 4RW9A 3J7AP 2FBTA 1R0AA 4FLTA 4KV8A 3SV3A 4BE1A 2IGIA 1RT3A 5BPNA 3D7EO 4FJ9A 3O5BA 4XH5A 2E2OA 3FFIA 3ULEA 4KFBA 2CGJA 3RSEA 5HROA 4EHUA 4YOWA 3CJBA 4MFBA 2P5OA 4XIUA 2W40A 3E01A 4YHHK 1C1BA 4B9SA 2W41A 4CEFA 4M3RA 1I39A 1RBVA 3C6TA 2WTUA 1REVA 3KK1A 4FZZA 1N33K 1TAUA 2QXFA 3ULDA 1Q7YO 2F9WA 5AQFA 4DR6K 1UAXA 3ZSVA 1W2BM 2OCEA 2VGNA 3DJCA 2HOEA 2O4GA 1QQCA 3SMPA 5GIOA 1BL3A 4DFJA 3UE5A 5JS2A 3VESA 5FRMA 4CJLA 1ZBIA 4H5VA 1CZBA 1VSFA 4PKHA 1U45A 3ZX3A 1C0FA 2ZF5O 5HP1A 3THYA 2V7ZA 5AQWA 2RE2A 4B9QA 3DAWA 3MX5A 1NGGA 5AQMA 4JK8A 4IFVA 4KRFA 3I8BA 4W5OA 1YT3A 3O9SA 1SL2A 3PV8A 3LP0A 3HT3A 4JK9A 2YNFA 1NGIA 4U67L 5AQNA 5AFUH 1T44A 2EHGA 4Y0WA 2P9SA 3CQYA 4CE9A 4EZ6A 3L2WA 5J2MA 5JLHA 1X1PA 4DFKA 3OYIA 3HVTA 1N36K 3MN9A 2R7YA 4LF9K 3Q7CA 3SQ1A 4FJNA 4FJLA 1QE1A 1DTQA 4IEEA 4CFBA 2F96A 4CIEA 2ITMA 4IOCL 3OA9A 2W6LA 4CEBA 1C0MA 4HCBA 5KGWA 4C1NK 1TAQA 5HRRA 1N32K 4CJWA 4BRFA 2HHUA 1KTQA 4GV3A 3LDLA 5AQKA 1P8ZA 5FROA 1U49A 4FWOA 5GADP 3OYCA 1YXQA 1XQSC 1NG9A 1CZAN 4BC5A 2YHWA 5AQIA 4J2BA 3KWIA 3KK7A 4BRMA 3V6DA 1FK9A 5LJVA 3VQ6A 4CEZA 4DQRA 3QINA 4LFCK 2FBVA 5BRHA 2Q1NA 4J2DA 3C7NB 4WF9L 2XRIA 2UXCK 1C6VA 2ATQA 4A61A 1HPZA 1O1WA 5A2QO 3RTVA 3AVNA 2FXUA 4NYNA 2NRHA 1LCUA 4B9VA 5BN8A 3NF9A 4JEPA 3U9ZA 3THXA 2VGMA 1TK8A 2CH5A 4CEAA 5H1SQ 3TSQA 4NYFA 4C1NI 4NXNK 3UKUA 2QKBA 3CD6N 1RBUA 3EO3A 4O8UA 1BWFO 1KCFA 1VSDA 3RMDA 1X9MA 4FW1A 4C8MA 4DSIA 4W5TA 3DLEA 4AHUA 1IG8A 5DK5A 2HVHA 4IEIA 4B9UA 3CFOA 3OYMA 2HHSA 2UU9K 4BY9C 1XWLA 4DU3A 3HO1A 2KFZA 2XY8A 5BRDA 3CMAN 2PY5A 3LAKA 1UA1A 1QHTA 3CCVN 4FZXC 5LMNK 4ICLA 4BRCA 4H0VB 4KH6A 1YJNN 3SCXA 1S6QA 4I9QA 3H1VX 1NJWA 2YJFA 4FJIA 3T7ZA 4C8LA 4GVMA 5AQXA 1P90A 1IKVA 1QVGM 4MQ3A 3BP8A 5KRTA 2YHYA 4JI1K 4CGFA 3T1YK 1TV6A 1BCOA 1Q9XA 1ITGA 3V1QA 3ASMA 1QSLA 3RMBA 3ZEUB 4Y1CA 1JLFA 3W0LA 3SQ0A 1H1VA 1GOAA 1NOYA 1DEJA 4BR2A 1QQNA 3AO2A 2IDOA 4CHZA 2HBLA 3QB0A 4RCHA 4CHYA 4K43A 1Q81O 1SKRA 3LM9A 3SJJA 2NRVA 2BH1A 1VRUA 4I2PA 2BTFA 5CHIA 2D0OA 1EXQA 1RDBA 4FWLA 3CFRA 4Z94A 1X9SA 4CEOA 4CJUA 4PY5A 3RVCA 3VETA 3S3MA 1X3MA 3OYGA 2D4WA 3AY9A 3UB5A 4CGDA 4AF1A 3CCJN 4IO8A 4AQYK 1Q82O 2I7NA 3F2KA 4FSVA 4FK0A 4FVUA 2G8UA 2J4RA 5J2NA 3F5TA 2A1RA 4GVEA 2QWNA 1B9FA 4LF7K 3ZSQA 1VQ6N 5J1EA 3QDKA 2G8WA 1RTDA 3D6RA 4CZIA 4BROA 3QNOA 1KC8O 4CJKA 2GUPA 4CHPA 4J2AA 4Z0UA 3AVAA 4FXDA 2ASPA 1VQMN 2BUPA 3AA5X 3AAPA 4A2AA 5AQZA 5AQVA 2VCPA 5IT9O 4C8NA 1QZ6A 3OJSA 4DS5A 3EE8A 1BGXT 2AP1A 5E26A 4B9TA 4IOAL 3CFPA 3CC4N 1ZBUA 1SUQA 4OJRA 3LPTA 4FJJA 2OPPA 3H6EA 2KFNA 3PUFA 1NK0A 5C0YA 2AA4A 1LOTB 5M1KA 4OPJA 1KD1O 1QZ5A 5FLXO 2RPIA 1IO2A 4CBXA 4IXCA 4YDUC 1MWMA 3ZT4A 3LL3A 1A5WA 3ALYA 1A5XA 4FCYA 2P9NB 3VEOA 1HX1A 3M1FA 3O6WA 4BRGA 4FLZA 2HHHK 3CC2N 4Z4EA 1NKCA 2A41A 1NJZA 3PIPL 4ELUA 3OS2A 2P9PB 3LPUA 3HPOA 2D0CA 4WQ5C 1KRPA 1QSSA 3K2PA 2HNYA 1IH7A 5J2QA 4LF5K 1JLAA 3G4SN 1XHZA 3LDPA 4CF8A 1EQYA 3UKRB 2F8SA 4BVPA 4OKEA 3JYTA 3KTQA 1A5VA 4ILJA 2O8BA 1RDCA 2P9UB 5GAGP 4KAZA 5I3UA 2E1ZA 3TSUA 1BQMA 1L3VA 1KAXA 2JWLA 3AGRA 4NCAA 1ZYQA 3FLCO 3EYZA 3PX6A 2VG5A 4N76A 4K25A 3V9SA 1RTHA 3SMSA 5KI6A 1LAWA 4A62A 3SK3A 5EX5A 3HL8A 1S9GA 2RN2A 4ISFA 3OYJA 4Z4FA 4MO5A 3MCPA 3KLFA 4DSLA 4KTQA 4ID1A 3O1WA 2P9IA 2P9LB 3AVGA 3VF4A 2VQEK 4PL8A 1JCFA 3DI6A 1O13A 4DR2K 4CGJA 1RT6A 5HBMA 1FKOA 4CJTA 4E7LA 1JCEA 4CCHA 3P38A 1DT9A 4H5RA 1TYQB 4LC9B 1BU6O 1HKGA 2KTQA 4FK4A 1LWCA 4KHPK 1ZBSA 4M41A 4DMNA 4DV1K 1YF5L 4BR5A 2O8CB 2I5JA 2QKKA 4FOEA 5AZJA 2KKZA 1E3MA 4E7HA 1KSPA
chains in the Genus database with same CATH topology
1Q8IA 4JS4A 4CESA 5FDLA 4CJFA 4BDPA 2VWKA 4EP4A 3KIOA 3LAMA 2IC3A 3LP2A 4I2QA 1F21A 1KLMA 2Q3SA 3CM5A 1S1UA 4RW7A 3RMAA 1Q9YA 1YVUA 3M8RA 3NDKA 3NF8A 4LD0A 3ISNC 4W5RA 2GBZA 3SV4A 1U04A 3V1OA 3SUQA 4RW9A 1QTMA 4FJ8A 2FBTA 1KVAA 4N56A 3ZSRA 1R0AA 4KI4A 1SV5A 4BE2A 1ASVA 4FLTA 4H8KA 4OLBA 4N5SA 3AVBA 2ZD1A 2D5RA 5CZ2A 3TI0A 2PZSA 4RW6A 4KV8A 1GOCA 3ZCMA 3SV3A 3LZJA 3SZ2A 1WAFA 4BE1A 2IGIA 1RTIA 1IKWA 1RT3A 3AO3A 4IDKA 3M8PA 4CERA 3VQ7A 3NGYA 4CHNA 3RRHA 1FXXA 4FJ9A 4DS4A 2PYLA 4DQQA 1LW0A 4CFAA 2XHBA 1RDAA 1SKSA 2G8IA 4GMJB 1Z26A 1T03A 3A2FA 5SZTA 3FFIA 4CFDA 4KFBA 1C0TA 3NF6A 3TAMA 3K57A 2OZSA 5HROA 3DLGA 4KI6A 4MFBA 2P5OA 4AILC 4XIUA 1BCMA 4FJGA 5KGXA 3E01A 2P1JA 4B9SA 1C1BA 4CJVA 3AVFA 4Z4IA 4CEFA 3I8DA 4M3RA 3V9UA 1JLGA 1I39A 1RBVA 3C6TA 4I7FA 1REVA 3KK1A 3BDPA 3NF7A 1JKHA 2DFEA 3DM2A 3LALA 3U3YA 4FZZA 4CJSA 1TAUA 2B6AA 2QXFA 4CF0A 3ULDA 1VSHA 3T3FA 4O5BA 1UAXA 1D9FA 3KK3A 3ZSVA 4KTZA 1HYVA 4M3ZA 2VG7A 2O4GA 1ASWA 1QQCA 3VN5A 4HUGA 3PY8A 3KKRA 4W5NA 3RR8A 1TGOA 3LWLA 4ZTJA 1BL3A 5KTQA 4DFJA 1NK8A 2P51A 2OPQA 3KK2A 2AJQA 4FLYA 5JS2A 4HCCA 3L3UA 1VSMA 1N5YA 4O4GA 2BANA 1WSEA 1L3TA 5FRMA 2E6LA 4CJLA 3IAYA 3WNEA 4FZYA 1SKWA 3NHGA 3HXMA 4DU4A 4DSJA 4J2EA 2KZZA 3AA2A 1RBRA 1ZBLA 1ZBIA 3TANA 1CZBA 1VSFA 4PQUA 1U45A 1CXUA 4B8CA 4HUFA 1CZ9A 1UOCA 1VSLA 4CEQA 5HP1A 4E0DA 3VQQA 5D3GA 3VQ9A 1S1VA 3DLKA 2KQ2A 4KREA 1QSYA 3L2VA 5T7BA 4UQGA 1NJYA 5HLFA 3RR7A 4IFVA 3OS1A 4KRFA 4W5OA 3S9HA 1ZBHA 1YT3A 4Q5VA 3F73A 1SL2A 3PV8A 3LP0A 3HT3A 1EX4A 3O3FA 2YNFA 2EX3A 3UIQA 4E7KA 3ZSYA 2EHGA 3M8QA 4F4KA 3KD1E 1UA0A 2WONA 2B5JA 4EP5A 1KFDA 4IBNA 4AHVA 4CJ5A 3QNNA 3HVRA 4CE9A 3WNHA 1C1CA 5C42A 3LZIA 4EZ6A 2GUIA 5CYMA 3ZSXA 3L2WA 5J2MA 1X1PA 4LH5A 1WSJA 1W9HA 4DFKA 3OYIA 3AVIA 3HVTA 5EU7A 2R7YA 5CY4A 3D45A 1IKYA 3SQ1A 3PX4A 1RNHA 1TK0A 3B6PA 1XHXA 4FJNA 3MXJA 4KHWA 4C8OA 4DQPA 2DFFA 2X6NA 1WAJA 1JLBA 5SWMA 1QE1A 3HP6A 1DTQA 3QO9A 1WSFA 4CFBA 3VQ4A 3L2RA 2F96A 3VQ8A 4JRQA 4CIEA 3DRPA 4CF2A 4ID5A 2HMIA 1C1AA 4M45A 3THVA 4O55A 4CEBA 2GV9A 1C0MA 1NK9A 4HCBA 5KGWA 3VA3A 4FLXA 2YV0X 1UWBA 4DLGA 1TAQA 1ASUA 5HRRA 3O3HA 4CJWA 4DLEA 2HHUA 1KTQA 4B8AB 3NCIA 2E4LA 4YNQA 4CJEA 3HP9A 4W5QA 3NH0A 1LW2A 5FROA 3OJUA 4FLWA 4E7IA 1U49A 3PO5A 1HQEA 4L8RB 4EZ9A 3VQEA 3V4IA 3HK2A 3VA0A 3OYCA 5FRNA 2NUBA 3ITHA 1RDDA 1J54A 3K59A 1WSGA 1T8EA 4F3OA 1NK4A 1YTAA 1BISA 4LY7A 4K8ZA 4J2BA 5HRPA 2FC0A 4AHCA 3BGRA 3DLRA 4AHSA 3V6DA 1FK9A 3VQ6A 4CEZA 4LSLA 2YNIA 3QINA 4CJPA 4DQRA 1W0HA 4FK2A 3AA4A 3AO4A 3C6UA 3KLGA 5HRNA 3O4NA 3TAFA 1EKEA 2FBVA 2VWJA 4KB1A 4M3YA 2RKIA 4OLAA 4J2DA 3DMJA 2HHQA 1RILA 2XRIA 1LV5A 1C6VA 2ATQA 1TKTA 1HPZA 1O1WA 3ZT1A 2FBXA 1RT4A 3AVNA 4AH9A 4NYNA 3RTVA 5HRSA 3V9ZA 4PA1A 4N41A 4B9VA 4KHSA 3NF9A 3ZSZA 1TK8A 3AVCA 4M42A 4DTNA 3MEDA 4JLHA 1JXEA 3VQAA 3TAQA 3SPYA 3EZ5A 4CEAA 4FM2A 1J53A 2F8TA 4YFUA 4ZHRA 5C24A 2HW3A 4FLUA 4NYFA 4NCBA 1S5JA 2Z1GA 3QLHA 3HJFA 1VSEA 2OA8A 4CJ3A 1L3SA 2HHTA 2XY7A 3IRXA 3ZSWA 2QKBA 3K58A 4G1QA 3OYHA 4DTXA 4KKOA 4Z4HA 4JS5A 3L8BA 4ELVA 1RBUA 2Z1HA 1S9EA 1T7PA 3U6FA 1KCFA 1VSDA 3TAEA 3AVJA 4HUEA 4CIGA 3RMDA 2WOMA 1X9MA 2D0AA 3G10A 4FW1A 4KHQA 1S1TA 4C8MA 3RWUA 4AHTA 4CK3A 4W5TA 3QEXA 3TAPA 4DSIA 3OYKA 3DLEA 1C0UA 3MEEA 4WE1A 1WSIA 4AHUA 3S3OA 3RRGA 2W42A 3DOLA 5DK5A 2HVHA 4B9UA 2HNZA 2QK9A 2OPSA 3CYMA 2DFHA 3CFOA 3DOKA 4CECA 1HYSA 2BE2A 3K5OA 3OYMA 3SUOA 4DG1A 2HHSA 1XWLA 4DU3A 4M3UA 3HO1A 3VQDA 2ITGA 1QS4A 2Z1JA 2KFZA 2XY8A 4ZTFA 4FVMA 3MXMA 2PY5A 4PUOA 1HQUA 3LAKA 3PO4A 3I0SA 4KO0A 4RG8A 1UA1A 1QHTA 1KFSA 4FZXC 1T05A 4ICLA 4CGIA 1CLQA 3T1AA 2Y1IA 1TL3A 4DTMA 3HPGA 4CGHA 4I9LA 1IG9A 3SCXA 1S6QA 4OGEA 3OYBA 4I9QA 4DSEA 1NJWA 3CG7A 1NKBA 4FJIA 4C8LA 1VSKA 4GVMA 3HM9A 3NGIA 3OYEA 4RW8A 1IKVA 3U3GA 1RT5A 4MQ3A 2JGUA 4NCGA 4E89A 5CYQA 3AVMA 3SUPA 4F3TA 1RT2A 5KRTA 4CGFA 3WNFA 3T19A 1TV6A 3QEWA 3DLHA 1BCOA 1Q9XA 1ITGA 1RBTA 3ASMA 1HYZA 1BI4B 2FBYA 3V1QA 4CF1A 3NH1A 4Y1CA 1JLFA 3RMBA 4KHNA 4OKKA 4AHRA 3VQPA 3SQ0A 2JLEA 1GOAA 1NOYA 4DTRA 3OS0A 1ZBFA 1DTTA 3AVHA 3SI6A 3I0RA 2IS3A 3AO2A 4Z4CA 3QEPA 2IDOA 4CHZA 1J9AA 4QOZB 2Y1JA 4CEDA 4IKFA 4DWIA 4CHYA 1JLCA 2YNHA 4B9MA 1L3UA 2G8HA 1SKRA 1TL1A 3NAEA 2ZQBA 2X6SA 3M8SA 4QAGA 3D0PA 3HYFA 1J5OA 3SJJA 1VRUA 4CEEA 1MU2A 4I2PA 3O3GA 3P1GA 2VG6A 2YNGA 3OYDA 3KLHA 1EXQA 1DLOA 1RDBA 2RF2A 3CFRA 1CXQA 4DTPA 3VQBA 4CF9A 1X9SA 4QCLA 3K5LA 1JLEA 4CGGA 3V9XA 3MECA 3QEVA 3SQ2A 2G8KA 1U4BA 1VSJA 3B6OA 4CEOA 4CJUA 3L2QA 4PY5A 1EP4A 2OYQA 1X9WA 1KLNA 1JL1A 2YKNA 3OYGA 3S3MA 4CHQA 2G8VA 3VQCA 4DSKA 4M3WA 4HHTA 3SPZA 3ZSOA 4DFPA 4CGDA 3TAGA 2OPRA 3L2UA 4PWDA 4O0IA 1S1WA 2ZE2A 4GW6A 3VQ5A 4FLVA 3MEGA 2XO7A 4BWJA 1XC9A 3QIOA 1SL1A 1NKEA 3DRSA 2D0BA 2PYJA 5DMRA 3AVLA 4FM0A 4DTSA 2G8UA 4FK0A 4KB0A 4FYDA 1VSIA 1HNIA 1WNSA 1JL2A 5J2NA 3KLEA 3V81A 1Z25A 3OYNA 3SUNA 2A1RA 1SL0A 1B9FA 5JS1A 4BDZA 1S6PA 1LWFA 4Z4GA 3ZSQA 1D9DA 4DQIA 4B08A 5J1EA 2G8WA 2Z1IA 1RTDA 2OZMA 4FM1A 3QNOA 3MXIA 1JXBA 3AO1A 4O0JA 3K5NA 3QETA 3RMCA 4RW4A 4CJKA 2BGGA 4CHPA 1NK6A 1Y97A 4J2AA 3CM6A 4Z0UA 4FJKA 4FJLA 3AVAA 3OYLA 4FXDA 3AA5X 1JLQA 3L3VA 3AA3A 1RT7A 3C95A 3QEIA 4C8NA 3OJSA 1B92A 3AV9A 3KKSA 4DS5A 1BIUA 1BGXT 1YTUA 2KW4A 4TSXA 3EY1A 4JRPA 4DSFA 4B9TA 4CK2A 4KHUA 2O4IA 2XY6A 3CFPA 3ZT0A 1ZBUA 3SYZA 1SUQA 1VK0A 4OJRA 2HNDA 3LPTA 1WSHA 1HNVA 2OPPA 4FJJA 3P5JA 4Y1DA 3TWHA 1TVRA 2B4JA 2KFNA 3S3NA 3PUFA 1NK0A 2IOCA 1WN7A 5C25A 2HHVA 4OPKA 3KJVA 4OPJA 4OVLA 3OY9A 3DRRA 4BDYA 4DTOA 2HB5A 3KLIA 2RPIA 3QERA 2KZMA 2XY5A 1IO2A 2E6MA 4H4MA 3NH2A 3ZT4A 1A5WA 3ALYA 4N47A 1A5XA 4FCYA 4FLZA 4CK1A 3SNNA 4Z4EA 1KVCA 4FJ5A 4FJMA 2IAJA 1NKCA 3LANA 1NJZA 2X74A 4ELUA 1QSLA 1WLJA 3OS2A 4BWMA 4M3TA 3LPUA 3HPOA 1TKXA 3G0ZA 4IG0A 2D0CA 3NGZA 1BQNA 2G8FA 1KRPA 1QSSA 4F2SA 3K2PA 2HNYA 1IH7A 1S1XA 3IG1A 5J2QA 4E3SA 3H08A 1JLAA 1XHZA 4CJQA 4CF8A 2F8SA 3F9KA 5CZ1A 1TK5A 2HVIA 4OKEA 3JYTA 3TR8A 1A5VA 1D5AA 3V1RA 3KTQA 1RDCA 3IS9A 1HRHA 3JSMA 1HMVA 4KAZA 5I3UA 3V9WA 3KD5E 3P83D 1BQMA 3LP1A 1L3VA 3OYFA 1NK5A 4FJXA 4NCAA 4FJHA 2YHBA 1LWEA 4OKJA 4F2RA 1ZYQA 4M3XA 1BHLA 4LH4A 3EYZA 4HTUA 3PX6A 2P5GA 2HHWA 2VG5A 4N76A 1U48A 2DTUA 3PX0A 3HSTB 3NFAA 3V9SA 3NBPA 4CHOA 1TKDA 3LP3A 1RTHA 4DTJA 1VRTA 5KI6A 1IKXA 1LAWA 3HPHA 5J2PA 3SQ4A 4B9NA 2A1SA 1KVBA 3OYAA 4HVJA 4C8KA 2YHAA 1D8YA 3DYAA 3HL8A 1NOZA 1GOBA 4ELTA 1S9GA 2RN2A 3OYJA 4Z4FA 3ZT2A 3KLFA 1TKZA 5I42A 2BDPA 4DSLA 3AVKA 1K6YA 4KTQA 4KPYA 1BIZA 1RT1A 4ID1A 4DF4A 4E19A 1N6QA 4CFCA 1RTJA 3NE6A 3AVGA 2DY4A 4BACA 4KHYA 3TABA 4FW2A 3K5MA 2LSNA 5E41A 4B3OA 4E7JA 3DI6A 2HHXA 4R5PA 2YKMA 4CGJA 3LWMA 3TARA 1NK7A 1RT6A 5K14A 5HBMA 3DLBA 1FKOA 3AO5A 1G15A 4CJTA 4E7LA 1L5UA 4DU1A 4CCHA 4LSNA 4CIFA 1RBSA 4OGCA 3QESA 2ETJA 4KTWA 4CJ4A 4E1MA 4DTUA 4DFMA 3ZT3A 1XI1A 3LDSA 4CJRA 3MAQA 3CQ8A 1FKPA 3O4QA 4E1NA 2KTQA 4FK4A 1EETA 5KRSA 1LWCA 1LAVA 3QIPA 4DQSA 4FJ7A 4M41A 4DMNA 4BE0A 4B9LA 3C94A 4IG3A 1B9DA 1NJXA 4DF8A 1BI4A 4IFYA 4O44A 3WNGA 1U47A 4F8RA 4K8XA 2I5JA 1HJRA 1I3AA 2QKKA 1RCHA 4Q0BA 3OVNA 4E7HA 1KSPA 2X78A 4H4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q8I A;  4JS4 A;  4CES A;  5FDL A;  4CJF A;  4BDP A;  2VWK A;  4EP4 A;  3KIO A;  3LAM A;  2IC3 A;  3LP2 A;  4I2Q A;  1F21 A;  1KLM A;  2Q3S A;  3CM5 A;  1S1U A;  4RW7 A;  3RMA A;  1Q9Y A;  1YVU A;  3M8R A;  3NDK A;  3NF8 A;  4LD0 A;  3ISN C;  4W5R A;  2GBZ A;  3SV4 A;  1U04 A;  3V1O A;  3SUQ A;  4RW9 A;  1QTM A;  4FJ8 A;  2FBT A;  1KVA A;  4N56 A;  3ZSR A;  1R0A A;  4KI4 A;  1SV5 A;  4BE2 A;  1ASV A;  4FLT A;  4H8K A;  4OLB A;  4N5S A;  3AVB A;  2ZD1 A;  2D5R A;  5CZ2 A;  3TI0 A;  2PZS A;  4RW6 A;  4KV8 A;  1GOC A;  3ZCM A;  3SV3 A;  3LZJ A;  3SZ2 A;  1WAF A;  4BE1 A;  2IGI A;  1RTI A;  1IKW A;  1RT3 A;  3AO3 A;  4IDK A;  3M8P A;  4CER A;  3VQ7 A;  3NGY A;  4CHN A;  3RRH A;  1FXX A;  4FJ9 A;  4DS4 A;  2PYL A;  4DQQ A;  1LW0 A;  4CFA A;  2XHB A;  1RDA A;  1SKS A;  2G8I A;  4GMJ B;  1Z26 A;  1T03 A;  3A2F A;  5SZT A;  3FFI A;  4CFD A;  4KFB A;  1C0T A;  3NF6 A;  3TAM A;  3K57 A;  2OZS A;  5HRO A;  3DLG A;  4KI6 A;  4MFB A;  2P5O A;  4AIL C;  4XIU A;  1BCM A;  4FJG A;  5KGX A;  3E01 A;  2P1J A;  4B9S A;  1C1B A;  4CJV A;  3AVF A;  4Z4I A;  4CEF A;  3I8D A;  4M3R A;  3V9U A;  1JLG A;  1I39 A;  1RBV A;  3C6T A;  4I7F A;  1REV A;  3KK1 A;  3BDP A;  3NF7 A;  1JKH A;  2DFE A;  3DM2 A;  3LAL A;  3U3Y A;  4FZZ A;  4CJS A;  1TAU A;  2B6A A;  2QXF A;  4CF0 A;  3ULD A;  1VSH A;  3T3F A;  4O5B A;  1UAX A;  1D9F A;  3KK3 A;  3ZSV A;  4KTZ A;  1HYV A;  4M3Z A;  2VG7 A;  2O4G A;  1ASW A;  1QQC A;  3VN5 A;  4HUG A;  3PY8 A;  3KKR A;  4W5N A;  3RR8 A;  1TGO A;  3LWL A;  4ZTJ A;  1BL3 A;  5KTQ A;  4DFJ A;  1NK8 A;  2P51 A;  2OPQ A;  3KK2 A;  2AJQ A;  4FLY A;  5JS2 A;  4HCC A;  3L3U A;  1VSM A;  1N5Y A;  4O4G A;  2BAN A;  1WSE A;  1L3T A;  5FRM A;  2E6L A;  4CJL A;  3IAY A;  3WNE A;  4FZY A;  1SKW A;  3NHG A;  3HXM A;  4DU4 A;  4DSJ A;  4J2E A;  2KZZ A;  3AA2 A;  1RBR A;  1ZBL A;  1ZBI A;  3TAN A;  1CZB A;  1VSF A;  4PQU A;  1U45 A;  1CXU A;  4B8C A;  4HUF A;  1CZ9 A;  1UOC A;  1VSL A;  4CEQ A;  5HP1 A;  4E0D A;  3VQQ A;  5D3G A;  3VQ9 A;  1S1V A;  3DLK A;  2KQ2 A;  4KRE A;  1QSY A;  3L2V A;  5T7B A;  4UQG A;  1NJY A;  5HLF A;  3RR7 A;  4IFV A;  3OS1 A;  4KRF A;  4W5O A;  3S9H A;  1ZBH A;  1YT3 A;  4Q5V A;  3F73 A;  1SL2 A;  3PV8 A;  3LP0 A;  3HT3 A;  1EX4 A;  3O3F A;  2YNF A;  2EX3 A;  3UIQ A;  4E7K A;  3ZSY A;  2EHG A;  3M8Q A;  4F4K A;  3KD1 E;  1UA0 A;  2WON A;  2B5J A;  4EP5 A;  1KFD A;  4IBN A;  4AHV A;  4CJ5 A;  3QNN A;  3HVR A;  4CE9 A;  3WNH A;  1C1C A;  5C42 A;  3LZI A;  4EZ6 A;  2GUI A;  5CYM A;  3ZSX A;  3L2W A;  5J2M A;  1X1P A;  4LH5 A;  1WSJ A;  1W9H A;  4DFK A;  3OYI A;  3AVI A;  3HVT A;  5EU7 A;  2R7Y A;  5CY4 A;  3D45 A;  1IKY A;  3SQ1 A;  3PX4 A;  1RNH A;  1TK0 A;  3B6P A;  1XHX A;  4FJN A;  3MXJ A;  4KHW A;  4C8O A;  4DQP A;  2DFF A;  2X6N A;  1WAJ A;  1JLB A;  5SWM A;  1QE1 A;  3HP6 A;  1DTQ A;  3QO9 A;  1WSF A;  4CFB A;  3VQ4 A;  3L2R A;  2F96 A;  3VQ8 A;  4JRQ A;  4CIE A;  3DRP A;  4CF2 A;  4ID5 A;  2HMI A;  1C1A A;  4M45 A;  3THV A;  4O55 A;  4CEB A;  2GV9 A;  1C0M A;  1NK9 A;  4HCB A;  5KGW A;  3VA3 A;  4FLX A;  2YV0 X;  1UWB A;  4DLG A;  1TAQ A;  1ASU A;  5HRR A;  3O3H A;  4CJW A;  4DLE A;  2HHU A;  1KTQ A;  4B8A B;  3NCI A;  2E4L A;  4YNQ A;  4CJE A;  3HP9 A;  4W5Q A;  3NH0 A;  1LW2 A;  5FRO A;  3OJU A;  4FLW A;  4E7I A;  1U49 A;  3PO5 A;  1HQE A;  4L8R B;  4EZ9 A;  3VQE A;  3V4I A;  3HK2 A;  3VA0 A;  3OYC A;  5FRN A;  2NUB A;  3ITH A;  1RDD A;  1J54 A;  3K59 A;  1WSG A;  1T8E A;  4F3O A;  1NK4 A;  1YTA A;  1BIS A;  4LY7 A;  4K8Z A;  4J2B A;  5HRP A;  2FC0 A;  4AHC A;  3BGR A;  3DLR A;  4AHS A;  3V6D A;  1FK9 A;  3VQ6 A;  4CEZ A;  4LSL A;  2YNI A;  3QIN A;  4CJP A;  4DQR A;  1W0H A;  4FK2 A;  3AA4 A;  3AO4 A;  3C6U A;  3KLG A;  5HRN A;  3O4N A;  3TAF A;  1EKE A;  2FBV A;  2VWJ A;  4KB1 A;  4M3Y A;  2RKI A;  4OLA A;  4J2D A;  3DMJ A;  2HHQ A;  1RIL A;  2XRI A;  1LV5 A;  1C6V A;  2ATQ A;  1TKT A;  1HPZ A;  1O1W A;  3ZT1 A;  2FBX A;  1RT4 A;  3AVN A;  4AH9 A;  4NYN A;  3RTV A;  5HRS A;  3V9Z A;  4PA1 A;  4N41 A;  4B9V A;  4KHS A;  3NF9 A;  3ZSZ A;  1TK8 A;  3AVC A;  4M42 A;  4DTN A;  3MED A;  4JLH A;  1JXE A;  3VQA A;  3TAQ A;  3SPY A;  3EZ5 A;  4CEA A;  4FM2 A;  1J53 A;  2F8T A;  4YFU A;  4ZHR A;  5C24 A;  2HW3 A;  4FLU A;  4NYF A;  4NCB A;  1S5J A;  2Z1G A;  3QLH A;  3HJF A;  1VSE A;  2OA8 A;  4CJ3 A;  1L3S A;  2HHT A;  2XY7 A;  3IRX A;  3ZSW A;  2QKB A;  3K58 A;  4G1Q A;  3OYH A;  4DTX A;  4KKO A;  4Z4H A;  4JS5 A;  3L8B A;  4ELV A;  1RBU A;  2Z1H A;  1S9E A;  1T7P A;  3U6F A;  1KCF A;  1VSD A;  3TAE A;  3AVJ A;  4HUE A;  4CIG A;  3RMD A;  2WOM A;  1X9M A;  2D0A A;  3G10 A;  4FW1 A;  4KHQ A;  1S1T A;  4C8M A;  3RWU A;  4AHT A;  4CK3 A;  4W5T A;  3QEX A;  3TAP A;  4DSI A;  3OYK A;  3DLE A;  1C0U A;  3MEE A;  4WE1 A;  1WSI A;  4AHU A;  3S3O A;  3RRG A;  2W42 A;  3DOL A;  5DK5 A;  2HVH A;  4B9U A;  2HNZ A;  2QK9 A;  2OPS A;  3CYM A;  2DFH A;  3CFO A;  3DOK A;  4CEC A;  1HYS A;  2BE2 A;  3K5O A;  3OYM A;  3SUO A;  4DG1 A;  2HHS A;  1XWL A;  4DU3 A;  4M3U A;  3HO1 A;  3VQD A;  2ITG A;  1QS4 A;  2Z1J A;  2KFZ A;  2XY8 A;  4ZTF A;  4FVM A;  3MXM A;  2PY5 A;  4PUO A;  1HQU A;  3LAK A;  3PO4 A;  3I0S A;  4KO0 A;  4RG8 A;  1UA1 A;  1QHT A;  1KFS A;  4FZX C;  1T05 A;  4ICL A;  4CGI A;  1CLQ A;  3T1A A;  2Y1I A;  1TL3 A;  4DTM A;  3HPG A;  4CGH A;  4I9L A;  1IG9 A;  3SCX A;  1S6Q A;  4OGE A;  3OYB A;  4I9Q A;  4DSE A;  1NJW A;  3CG7 A;  1NKB A;  4FJI A;  4C8L A;  1VSK A;  4GVM A;  3HM9 A;  3NGI A;  3OYE A;  4RW8 A;  1IKV A;  3U3G A;  1RT5 A;  4MQ3 A;  2JGU A;  4NCG A;  4E89 A;  5CYQ A;  3AVM A;  3SUP A;  4F3T A;  1RT2 A;  5KRT A;  4CGF A;  3WNF A;  3T19 A;  1TV6 A;  3QEW A;  3DLH A;  1BCO A;  1Q9X A;  1ITG A;  1RBT A;  3ASM A;  1HYZ A;  1BI4 B;  2FBY A;  3V1Q A;  4CF1 A;  3NH1 A;  4Y1C A;  1JLF A;  3RMB A;  4KHN A;  4OKK A;  4AHR A;  3VQP A;  3SQ0 A;  2JLE A;  1GOA A;  1NOY A;  4DTR A;  3OS0 A;  1ZBF A;  1DTT A;  3AVH A;  3SI6 A;  3I0R A;  2IS3 A;  3AO2 A;  4Z4C A;  3QEP A;  2IDO A;  4CHZ A;  1J9A A;  4QOZ B;  2Y1J A;  4CED A;  4IKF A;  4DWI A;  4CHY A;  1JLC A;  2YNH A;  4B9M A;  1L3U A;  2G8H A;  1SKR A;  1TL1 A;  3NAE A;  2ZQB A;  2X6S A;  3M8S A;  4QAG A;  3D0P A;  3HYF A;  1J5O A;  3SJJ A;  1VRU A;  4CEE A;  1MU2 A;  4I2P A;  3O3G A;  3P1G A;  2VG6 A;  2YNG A;  3OYD A;  3KLH A;  1EXQ A;  1DLO A;  1RDB A;  2RF2 A;  3CFR A;  1CXQ A;  4DTP A;  3VQB A;  4CF9 A;  1X9S A;  4QCL A;  3K5L A;  1JLE A;  4CGG A;  3V9X A;  3MEC A;  3QEV A;  3SQ2 A;  2G8K A;  1U4B A;  1VSJ A;  3B6O A;  4CEO A;  4CJU A;  3L2Q A;  4PY5 A;  1EP4 A;  2OYQ A;  1X9W A;  1KLN A;  1JL1 A;  2YKN A;  3OYG A;  3S3M A;  4CHQ A;  2G8V A;  3VQC A;  4DSK A;  4M3W A;  4HHT A;  3SPZ A;  3ZSO A;  4DFP A;  4CGD A;  3TAG A;  2OPR A;  3L2U A;  4PWD A;  4O0I A;  1S1W A;  2ZE2 A;  4GW6 A;  3VQ5 A;  4FLV A;  3MEG A;  2XO7 A;  4BWJ A;  1XC9 A;  3QIO A;  1SL1 A;  1NKE A;  3DRS A;  2D0B A;  2PYJ A;  5DMR A;  3AVL A;  4FM0 A;  4DTS A;  2G8U A;  4FK0 A;  4KB0 A;  4FYD A;  1VSI A;  1HNI A;  1WNS A;  1JL2 A;  5J2N A;  3KLE A;  3V81 A;  1Z25 A;  3OYN A;  3SUN A;  2A1R A;  1SL0 A;  1B9F A;  5JS1 A;  4BDZ A;  1S6P A;  1LWF A;  4Z4G A;  3ZSQ A;  1D9D A;  4DQI A;  4B08 A;  5J1E A;  2G8W A;  2Z1I A;  1RTD A;  2OZM A;  4FM1 A;  3QNO A;  3MXI A;  1JXB A;  3AO1 A;  4O0J A;  3K5N A;  3QET A;  3RMC A;  4RW4 A;  4CJK A;  2BGG A;  4CHP A;  1NK6 A;  1Y97 A;  4J2A A;  3CM6 A;  4Z0U A;  4FJK A;  4FJL A;  3AVA A;  3OYL A;  4FXD A;  3AA5 X;  1JLQ A;  3L3V A;  3AA3 A;  1RT7 A;  3C95 A;  3QEI A;  4C8N A;  3OJS A;  1B92 A;  3AV9 A;  3KKS A;  4DS5 A;  1BIU A;  1BGX T;  1YTU A;  2KW4 A;  4TSX A;  3EY1 A;  4JRP A;  4DSF A;  4B9T A;  4CK2 A;  4KHU A;  2O4I A;  2XY6 A;  3CFP A;  3ZT0 A;  1ZBU A;  3SYZ A;  1SUQ A;  1VK0 A;  4OJR A;  2HND A;  3LPT A;  1WSH A;  1HNV A;  2OPP A;  4FJJ A;  3P5J A;  4Y1D A;  3TWH A;  1TVR A;  2B4J A;  2KFN A;  3S3N A;  3PUF A;  1NK0 A;  2IOC A;  1WN7 A;  5C25 A;  2HHV A;  4OPK A;  3KJV A;  4OPJ A;  4OVL A;  3OY9 A;  3DRR A;  4BDY A;  4DTO A;  2HB5 A;  3KLI A;  2RPI A;  3QER A;  2KZM A;  2XY5 A;  1IO2 A;  2E6M A;  4H4M A;  3NH2 A;  3ZT4 A;  1A5W A;  3ALY A;  4N47 A;  1A5X A;  4FCY A;  4FLZ A;  4CK1 A;  3SNN A;  4Z4E A;  1KVC A;  4FJ5 A;  4FJM A;  2IAJ A;  1NKC A;  3LAN A;  1NJZ A;  2X74 A;  4ELU A;  1QSL A;  1WLJ A;  3OS2 A;  4BWM A;  4M3T A;  3LPU A;  3HPO A;  1TKX A;  3G0Z A;  4IG0 A;  2D0C A;  3NGZ A;  1BQN A;  2G8F A;  1KRP A;  1QSS A;  4F2S A;  3K2P A;  2HNY A;  1IH7 A;  1S1X A;  3IG1 A;  5J2Q A;  4E3S A;  3H08 A;  1JLA A;  1XHZ A;  4CJQ A;  4CF8 A;  2F8S A;  3F9K A;  5CZ1 A;  1TK5 A;  2HVI A;  4OKE A;  3JYT A;  3TR8 A;  1A5V A;  1D5A A;  3V1R A;  3KTQ A;  1RDC A;  3IS9 A;  1HRH A;  3JSM A;  1HMV A;  4KAZ A;  5I3U A;  3V9W A;  3KD5 E;  3P83 D;  1BQM A;  3LP1 A;  1L3V A;  3OYF A;  1NK5 A;  4FJX A;  4NCA A;  4FJH A;  2YHB A;  1LWE A;  4OKJ A;  4F2R A;  1ZYQ A;  4M3X A;  1BHL A;  4LH4 A;  3EYZ A;  4HTU A;  3PX6 A;  2P5G A;  2HHW A;  2VG5 A;  4N76 A;  1U48 A;  2DTU A;  3PX0 A;  3HST B;  3NFA A;  3V9S A;  3NBP A;  4CHO A;  1TKD A;  3LP3 A;  1RTH A;  4DTJ A;  1VRT A;  5KI6 A;  1IKX A;  1LAW A;  3HPH A;  5J2P A;  3SQ4 A;  4B9N A;  2A1S A;  1KVB A;  3OYA A;  4HVJ A;  4C8K A;  2YHA A;  1D8Y A;  3DYA A;  3HL8 A;  1NOZ A;  1GOB A;  4ELT A;  1S9G A;  2RN2 A;  3OYJ A;  4Z4F A;  3ZT2 A;  3KLF A;  1TKZ A;  5I42 A;  2BDP A;  4DSL A;  3AVK A;  1K6Y A;  4KTQ A;  4KPY A;  1BIZ A;  1RT1 A;  4ID1 A;  4DF4 A;  4E19 A;  1N6Q A;  4CFC A;  1RTJ A;  3NE6 A;  3AVG A;  2DY4 A;  4BAC A;  4KHY A;  3TAB A;  4FW2 A;  3K5M A;  2LSN A;  5E41 A;  4B3O A;  4E7J A;  3DI6 A;  2HHX A;  4R5P A;  2YKM A;  4CGJ A;  3LWM A;  3TAR A;  1NK7 A;  1RT6 A;  5K14 A;  5HBM A;  3DLB A;  1FKO A;  3AO5 A;  1G15 A;  4CJT A;  4E7L A;  1L5U A;  4DU1 A;  4CCH A;  4LSN A;  4CIF A;  1RBS A;  4OGC A;  3QES A;  2ETJ A;  4KTW A;  4CJ4 A;  4E1M A;  4DTU A;  4DFM A;  3ZT3 A;  1XI1 A;  3LDS A;  4CJR A;  3MAQ A;  3CQ8 A;  1FKP A;  3O4Q A;  4E1N A;  2KTQ A;  4FK4 A;  1EET A;  5KRS A;  1LWC A;  1LAV A;  3QIP A;  4DQS A;  4FJ7 A;  4M41 A;  4DMN A;  4BE0 A;  4B9L A;  3C94 A;  4IG3 A;  1B9D A;  1NJX A;  4DF8 A;  1BI4 A;  4IFY A;  4O44 A;  3WNG A;  1U47 A;  4F8R A;  4K8X A;  2I5J A;  1HJR A;  1I3A A;  2QKK A;  1RCH A;  4Q0B A;  3OVN A;  4E7H A;  1KSP A;  2X78 A;  4H4O A; 
#chains in the Genus database with same CATH topology
 1Q8I A;  3PLA A;  4EP4 A;  1EWQ A;  3CER A;  2V52 B;  1YVU A;  4WFN L;  4LF6 K;  2GBZ A;  1U04 A;  3V1O A;  4BC2 A;  2PAV A;  4FJ8 A;  1KVA A;  4N56 A;  1VAZ A;  4B3S K;  4YOR A;  3CF5 L;  1SV5 A;  4KI4 A;  1U2V B;  4H8K A;  4OLB A;  2NRW A;  1GOC A;  1WAF A;  4BGB A;  1RTI A;  3M8P A;  3NGY A;  4DQQ A;  1LW0 A;  2XHB A;  2G8I A;  1T03 A;  3A2F A;  4CFD A;  3TAM A;  1C0T A;  3TU5 A;  3ZX0 A;  3IUC A;  4KI6 A;  1YHQ N;  3ENB A;  3DXK A;  5KGX A;  3AVF A;  4IDH A;  3H45 C;  3F9M A;  2DFE A;  1S72 N;  2B6A A;  2YI1 A;  1VSH A;  4WQ4 C;  4R79 A;  1D4X A;  5BN9 A;  5AQR A;  4M3Z A;  4JI3 K;  3NVK A;  3ZET B;  1TGO A;  3N4P A;  3VEZ A;  1NK8 A;  1IBM K;  5EVZ A;  4JI6 K;  3OBW A;  3NVM A;  2E5L K;  1ZC6 A;  5AQG A;  4L3Q A;  2BAN A;  1BOT O;  4DCH A;  1N5Y A;  1L3T A;  1HJO A;  3U8X A;  2E6L A;  3IAY A;  3WNE A;  1VQ9 N;  3HXM A;  4DSJ A;  1HKC A;  3TAN A;  1K73 O;  3ID8 A;  5KQ8 A;  4B8C A;  4FL9 A;  4CVN E;  1BG3 A;  1SZ2 A;  4JYA K;  3D2F B;  3VQ9 A;  1S1V A;  3DLK A;  1OH8 A;  2YJE A;  1K8K B;  3L2V A;  1NJY A;  5HLF A;  5TKY A;  3CIP A;  3O3F A;  2EX3 A;  4BG9 A;  2GEL A;  3M8Q A;  1NU0 A;  3KD1 E;  2B5J A;  4EP5 A;  4ISE A;  4AHV A;  4K0K K;  3HVR A;  5I9E B;  4JV5 K;  2GUI A;  3ZSX A;  4YY3 K;  3ID6 A;  5CY4 A;  3R3L A;  3R9P A;  2X6N A;  4IZ9 A;  4NB4 A;  4JD2 B;  3V9Z A;  1WSF A;  4JRQ A;  3VQ4 A;  3I55 N;  1E4F T;  1VQK N;  4O55 A;  1SQK A;  2KHO A;  1NK9 A;  2H3G X;  3ZLJ A;  1UWB A;  1ASU A;  3CCL N;  3MN6 A;  4CJ7 A;  3NCI A;  4ILG B;  3DXM B;  4CJE A;  3NH0 A;  3THW B;  4E7I A;  3E9O A;  3VQE A;  3V4I A;  4X64 K;  3A5O C;  5FRN A;  3ITH A;  1RDD A;  1J54 A;  3K59 A;  1IBL K;  1VQ8 N;  4X65 K;  1OKJ A;  2F9T A;  2KLA A;  1XC3 A;  4GV9 A;  4FWS A;  2F7T A;  4FPB A;  4CJP A;  4KH4 A;  1I94 K;  1EWR A;  4FK2 A;  1V4S A;  3AA4 A;  2QTD A;  3TTF A;  3O9Q A;  3MK6 A;  3KLG A;  2QWP A;  4M3Y A;  4KB1 A;  4F9O A;  2WC9 A;  3SAH A;  2RKI A;  3DMJ A;  3D2E A;  1LV5 A;  5KRS A;  1TKT A;  3GE1 A;  4AH9 A;  1RT4 A;  4N41 A;  1U6Z A;  4KHS A;  4PA1 A;  4O5F A;  3AVC A;  4DTN A;  3SPY A;  4MDA A;  4FO0 A;  5C24 A;  1WB9 A;  2Z1G A;  3QLH A;  4CJ3 A;  1L3S A;  5CR4 A;  3ZSW A;  4B1W B;  4DV5 K;  4DTX A;  1RGI A;  4ELV A;  1S9E A;  2Q31 A;  1T7P A;  4BQZ A;  3TAE A;  4HUE A;  1NWK A;  4B1U B;  1S1T A;  1K8A O;  5HL7 L;  3QBW A;  3MEE A;  2W42 A;  2GWJ A;  4CBU A;  1NLV A;  4JKG B;  3K5O A;  4IJA A;  2I7P A;  2ZWH A;  4PKG A;  5KPR A;  4M3U A;  1QS4 A;  4GV6 A;  5AQL A;  5MLC Q;  3HBT A;  3MXM A;  3PO4 A;  4C23 A;  3I0S A;  4XH1 A;  3VEY A;  3AGK A;  1TL3 A;  3HPG A;  2O8D B;  3OYB A;  3VF2 A;  4DSE A;  3MN5 A;  3P31 A;  1M1K O;  2JGU A;  4NCG A;  3O4W A;  2NNW A;  3QEW A;  4V19 S;  3LDS A;  1RBT A;  3NH1 A;  1BI4 B;  2FBY A;  2QWL A;  3BZK A;  4IJN A;  4CF1 A;  2IVN A;  4DV2 K;  4BVO A;  4DTR A;  1ZBF A;  3AVH A;  4X62 K;  3SI6 A;  3EE9 A;  3WXK A;  3WUH A;  3GL1 A;  4QOZ B;  4LFB K;  4E1J A;  2YNH A;  2Q0U A;  3ENH A;  1HPM A;  2OTL N;  4QAG A;  2PFU A;  2HF4 A;  4G9Z A;  2O8E B;  3E66 A;  2YNG A;  3OYD A;  3KLH A;  5BRE A;  5DM6 L;  2RF2 A;  3G71 N;  3VQB A;  4DR4 K;  1JLE A;  4CGG A;  3QEV A;  3SQ2 A;  2G8K A;  1U4B A;  3B6O A;  2OYQ A;  1JL1 A;  4CHQ A;  3VQC A;  4DSK A;  4M3W A;  5AQT A;  4CZK A;  4BC4 A;  3WXM B;  2ZE2 A;  2W6K A;  3R8E A;  3O80 A;  2UXD K;  3AVL A;  3DLL L;  4DTS A;  4FYD A;  1HNI A;  1Z25 A;  4RWT A;  1SL0 A;  1NGH A;  2D1K A;  5JS1 A;  2GTD A;  1MA9 B;  1LWF A;  4Z4G A;  1D9D A;  4DQI A;  3IKM A;  2PBD A;  2Z1I A;  5C2F A;  2OZM A;  1JXB A;  4O0J A;  3QET A;  2BGG A;  1Y97 A;  2QI2 A;  3L3V A;  3A8Y A;  3QEI A;  4O8K A;  3I33 A;  1B92 A;  1NGJ A;  4B1Y B;  2QEX N;  4B3M K;  1N34 K;  1MWK A;  4TSX A;  3EY1 A;  2XY6 A;  1WSH A;  1HNV A;  3P5J A;  4Y1D A;  2A3Z A;  1TVR A;  2B4J A;  2QWM A;  4DQ8 A;  1SAZ A;  3S3N A;  2IOC A;  5M1P A;  4A5A A;  3VF6 A;  4GKK K;  4B1X B;  2HHV A;  3DRR A;  4A59 A;  1BDG A;  4DV0 K;  3NMU A;  4H4M A;  3CPE A;  3ZX2 A;  3JS6 A;  3SLC A;  4FJ5 A;  2HST A;  3C7N A;  1WLJ A;  4M3T A;  4BWM A;  3G0Z A;  2G8F A;  1BQN A;  1N8R O;  3A5M C;  3IG1 A;  2UUB K;  4E3S A;  3H08 A;  3M5R A;  3HTV A;  4FWP A;  4WFA L;  1D5A A;  3V1R A;  4DR7 K;  5C2D A;  3IS9 A;  2NRX A;  1NK5 A;  4OKJ A;  4F2R A;  1BHL A;  4HTU A;  4K41 A;  3PX0 A;  3NFA A;  4JKE A;  4BRK A;  1TKD A;  3FZM A;  4DTJ A;  3HPH A;  4B9N A;  5J2P A;  3SQ4 A;  3OYA A;  1ZXO A;  4KH5 A;  4DR1 K;  4B3T K;  1D8Y A;  1NOZ A;  4JKF A;  2BDP A;  4KPY A;  3AVK A;  1K6Y A;  4DF4 A;  4IFE A;  3Q7B A;  4CFC A;  1RTJ A;  3NE6 A;  3U9D A;  4KHY A;  4FW2 A;  4B3O A;  2LSN A;  5E41 A;  4E7J A;  4BRA A;  2YKM A;  4R5P A;  3LWM A;  4MDB A;  4CI6 A;  4JN4 A;  3DLB A;  5AQY A;  1G15 A;  4DU1 A;  4MO4 A;  5C15 A;  3E9L A;  4CIF A;  4IOX A;  3QES A;  4DTU A;  1XI1 A;  3J8A A;  2A40 A;  1Z05 A;  4LF8 K;  4OX9 K;  1EET A;  4FPA A;  1LAV A;  3HM8 A;  4BE0 A;  4PKI A;  4JNE A;  3C94 A;  1TUY A;  1WBB A;  4CZL A;  3ZEU A;  3WNG A;  2NRT A;  4K8X A;  4Q0B A;  1QQM A;  3CJ7 A;  4H5N A;  4WYB A;  3U4L A;  4JS4 A;  4CZM A;  5FDL A;  4CJF A;  2VWK A;  3LAM A;  1NJI O;  3J81 O;  1F21 A;  4I6M B;  1KLM A;  4JHD B;  1S1U A;  1S22 A;  1XUP O;  3VMF B;  1YJ9 N;  4H0Y B;  1HLU A;  4RW7 A;  2WUS A;  3K9J A;  4JAX A;  3NF8 A;  4FWN A;  3ISN C;  1FW6 A;  3SUQ A;  3CET A;  1M90 O;  4N5S A;  3AVB A;  3TI0 A;  2PZS A;  4RW6 A;  3ATV A;  3ZCM A;  3IFR A;  3PIO L;  5AZI B;  4KHQ A;  1NK7 A;  3AO3 A;  1KAY A;  3VQ7 A;  1FXX A;  5LY3 A;  4H0O A;  2PYL A;  4XEI A;  1RDA A;  4GMJ B;  1Z26 A;  1ATN A;  5SZT A;  3K57 A;  2OZS A;  3CJ1 A;  3HI0 A;  5BPL A;  4AIL C;  1BCM A;  4FJG A;  4CJV A;  1G99 A;  2E8A A;  3I8D A;  2GWK A;  1JKH A;  3LAL A;  3U3Y A;  5FPD A;  4O5B A;  2CH6 A;  1D9F A;  4BG8 A;  4KTZ A;  1HYV A;  2ZM6 K;  3VN5 A;  4HUG A;  4W5N A;  3RR8 A;  4GNI A;  3ZYY X;  3VER A;  4EIA A;  2Q0R A;  4NXM K;  3C65 A;  2O8F B;  4NO7 A;  1EO1 A;  3W3D A;  3KK2 A;  3CJA A;  2AJQ A;  4HCC A;  3L3U A;  1VSM A;  4O4G A;  3SJH A;  4FZY A;  2FSN A;  2P9I B;  4DU4 A;  3AA2 A;  1T3V A;  1ZBL A;  5FPM A;  2HF3 A;  1CXU A;  4YOV A;  4E0D A;  4JKC A;  3VQQ A;  2KQ2 A;  3A5N C;  4KRE A;  1X3N A;  3RR7 A;  3OS1 A;  4H5W A;  1YVN A;  3F73 A;  5FPN A;  5LL6 Z;  3UIQ A;  3HRG A;  2EWS A;  4E7K A;  1ILY A;  3GG4 A;  2P9N A;  4F4K A;  2WON A;  4XH4 A;  1KFD A;  4CJ5 A;  3QNN A;  2P9P A;  3WNH A;  1IBK K;  5C42 A;  3DWL A;  4A5B A;  3EN9 A;  3FFK B;  5CYM A;  4LH5 A;  3KWG A;  1WSJ A;  1WOQ A;  3AVI A;  2UYT A;  5EU7 A;  3D45 A;  3PX4 A;  1TK0 A;  3B6P A;  1XHX A;  4KHW A;  3MXJ A;  2QA4 N;  4C8O A;  1NGC A;  5SWM A;  3UKR A;  3THV A;  4DB3 A;  3QFU A;  3L2R A;  3VQ8 A;  1C1A A;  3EZW A;  4M45 A;  2P9U A;  1NGB A;  3VA3 A;  4FLX A;  2YV0 X;  1VHX A;  3O3H A;  4B8A B;  2E4L A;  3HP9 A;  1HQE A;  4L8R B;  3VGM A;  3HK2 A;  3H1Q A;  2NUB A;  3P4I A;  5ADX A;  1XNQ K;  4CD1 A;  2A42 A;  1T8E A;  4F3O A;  2IVO A;  4JI4 K;  4CZH A;  2E2N A;  4WCE L;  3QBX A;  2P9K B;  2FC0 A;  4AHS A;  3K0S A;  4BR0 A;  3CPW M;  4BRL A;  3C6U A;  3O4N A;  3TAF A;  4JI5 K;  4OLA A;  1RIL A;  2QM1 A;  4QS9 A;  2P9L A;  4H5T A;  3ZT1 A;  3PY8 A;  2FSJ A;  5HRS A;  3JAM O;  4BRP A;  4BGA A;  3OW2 M;  4JLH A;  3TAQ A;  5KPZ A;  3EZ5 A;  4H0T B;  4FM2 A;  1J53 A;  3TTD A;  2F8T A;  4ZHR A;  3SAG A;  1QHA A;  2Q36 A;  1TYQ A;  4NCB A;  1S5J A;  2FF6 A;  2OA8 A;  3H46 O;  2HHT A;  2XY7 A;  3IRX A;  5BRF A;  3K58 A;  4G1Q A;  4Z4H A;  4YOX A;  1HUX A;  3L8B A;  3U6F A;  3AVJ A;  4CIG A;  3G10 A;  3FE1 A;  3RWU A;  4AHT A;  1Y64 A;  3QEX A;  3WXL A;  3C6A A;  3OYK A;  3VTI A;  3RRG A;  4FWM A;  4LF4 K;  3GDQ A;  3S3O A;  4B1Z A;  3WT0 A;  3DOL A;  3VEN A;  3MDQ A;  4YDU A;  2QK9 A;  3FZL A;  2DFH A;  3WEE B;  4CEC A;  5E84 A;  1KAZ A;  3VQD A;  5HOO A;  3G6E N;  4FVM A;  5AR0 A;  4PUO A;  4KO0 A;  4RG8 A;  5F1X A;  4WQ5 A;  1KFS A;  4CGI A;  1NMN A;  2GX9 A;  1V4T A;  3EKU A;  4DTM A;  4CGH A;  1HNW K;  4I9L A;  3VEW A;  3TPQ A;  1XMO K;  1NKB A;  1KQS M;  1VSK A;  2V51 B;  3HM9 A;  5JLF A;  3U3G A;  4JI2 K;  3MWP A;  1RT5 A;  3ENO A;  3WNF A;  3DLH A;  1BA0 A;  2E88 A;  5AJ3 K;  4CZJ A;  3OS0 A;  2IS3 A;  1C0G A;  2ASM A;  2HMP A;  3CHW A;  2QWR A;  3WQU A;  4DWI A;  5AQH A;  4WFB L;  1L3U A;  2G8H A;  1TL1 A;  5F0X A;  4DKW A;  1RDW X;  4B3R K;  5M1O A;  2QW9 A;  3P1G A;  3OHR A;  1DLO A;  4JKB A;  3KZB A;  4CF9 A;  5M1F A;  2WFB A;  4QCL A;  3V9X A;  1W7A A;  3MEC A;  1VSJ A;  4FWQ A;  4DV6 K;  3MWT A;  4OPH A;  3D2F A;  3ULE B;  1K8K A;  1KLN A;  3RSE B;  2Q97 A;  3GBT A;  3BUZ B;  3SPZ A;  3AAQ A;  4DFP A;  2OPR A;  3C6H A;  2FF3 B;  4GW6 A;  3VQ5 A;  4FLV A;  1J5E K;  2XO7 A;  4BWJ A;  1SL1 A;  2D0B A;  4KB0 A;  3V81 A;  3SUN A;  4BRN A;  4FOI A;  1S6P A;  2IIR A;  3CCQ N;  4B08 A;  4J8F A;  4DV7 K;  1MDU B;  3AO1 A;  1YI2 N;  4KBO A;  4RW4 A;  4IWV A;  4FJK A;  4JD2 A;  3QIC A;  2UUA K;  1RT7 A;  1Z6R A;  3AV9 A;  3VOV A;  1BIU A;  1YTU A;  2KW4 A;  4JKA A;  4JRP A;  4DSF A;  3DXM A;  3VPZ A;  3QFP A;  4CK2 A;  3THW A;  1VK0 A;  2HND A;  3THY B;  3TWH A;  3L4Q A;  4M7Y A;  4H0X B;  1ATR A;  5C25 A;  4JKD A;  4OPK A;  3OTO K;  3OY9 A;  4BDY A;  1NGF A;  4DTO A;  3KLI A;  5EXW A;  2KZM A;  2OAN A;  2E6M A;  3NH2 A;  1Q86 O;  4WQ4 A;  4ISG A;  5ELZ A;  4CK1 A;  4FJM A;  4ILH A;  1XNR K;  2IAJ A;  3LAN A;  2P9S B;  2HBK A;  3VGL A;  2FLO A;  5F2R A;  4IG0 A;  3NGZ A;  4F2S A;  5LJW A;  5JMV A;  1OVQ A;  4YOY A;  3R1X A;  1QVF M;  4QS8 A;  4CJQ A;  3F9K A;  3LM2 A;  2YHX A;  1T6C A;  1TK5 A;  3CJ9 A;  2HVI A;  3TR8 A;  2F4V K;  1VQN N;  1HRH A;  3JSM A;  3MCA B;  3LP1 A;  3QML A;  4GKJ K;  3OYF A;  1T6D A;  4FJX A;  4M3X A;  2YHB A;  1LWE A;  4LH4 A;  2P5G A;  2ZJP L;  1U48 A;  2DTU A;  3L4I A;  4CHO A;  5GIN A;  4CZG A;  1VRT A;  1IKX A;  2A1S A;  4HVJ A;  2YHA A;  3DYA A;  4JKG A;  4JI8 K;  1GOB A;  3E9P A;  3O9R A;  3O9U A;  3ZT2 A;  4YOT A;  1TKZ A;  3LDQ A;  2HBJ A;  4DHY A;  3M6G A;  4DV3 K;  2DY4 A;  4NLB A;  2HHX A;  2O8D A;  1GLD G;  1HKB A;  5K14 A;  3THX B;  3AO5 A;  1L5U A;  4LSN A;  1RBS A;  1GLC G;  4OGC A;  5M1N A;  2ETJ A;  4KTW A;  4E1M A;  3ZT3 A;  4M63 C;  3MAQ A;  3CQ8 A;  4E1N A;  4FJ7 A;  3QIP A;  3UKU B;  4DQS A;  4UY8 O;  1S3X A;  5FPE A;  1NM1 A;  4CZF A;  1BI4 A;  4IFY A;  4O44 A;  4BR7 A;  4F8R A;  1HJR A;  1I3A A;  2DPN A;  3MMV A;  4DR3 K;  1RCH A;  5B8H A;  3OVN A;  3WXJ A;  4H4O A;  1KXP A;  4BDP A;  4B1V A;  3KIO A;  2IC3 A;  3LP2 A;  1TUU A;  4I2Q A;  3CM5 A;  2Q3S A;  1VQ4 N;  3M8R A;  4BRQ A;  3NDK A;  4LD0 A;  3T69 A;  1QTM A;  1HNX K;  2O8E A;  3ZSR A;  4BE2 A;  1ASV A;  1NBW A;  1R59 O;  2D5R A;  2ZD1 A;  5CZ2 A;  3BF1 A;  2Q2R A;  3LZJ A;  3SZ2 A;  4OPA A;  4U7B A;  1IKW A;  4IDK A;  2IVP A;  4CER A;  4CHN A;  3RRH A;  3PSF A;  4DS4 A;  4CFA A;  3WQT A;  1SKS A;  1FJG K;  3CC7 N;  1IJJ A;  3NF6 A;  4CBW A;  3DLG A;  1VQO N;  1ATS A;  1Q18 A;  2P1J A;  4Z4I A;  4CW7 B;  3V9U A;  1YIJ N;  1JLG A;  4I7F A;  3BDP A;  3NF7 A;  3DM2 A;  4CJS A;  2NLX A;  4CF0 A;  3T3F A;  3KK3 A;  4EFH A;  5JVG L;  1IV0 A;  2VG7 A;  1ASW A;  3KKR A;  2ZGZ A;  2WBN A;  4LFA K;  3LWL A;  4BR9 A;  4ZTJ A;  3SBT A;  5KTQ A;  4BRH A;  3FZF A;  2P51 A;  2OPQ A;  4FLY A;  5M1Q A;  1DKG D;  1WSE A;  3B8A X;  3T1H K;  1SKW A;  3NHG A;  4J2E A;  3J80 O;  1RBR A;  3CCR N;  3CCS N;  4K42 A;  4PQU A;  5BPM A;  4HUF A;  1CZ9 A;  1UOC A;  1VSL A;  4CEQ A;  5TKW A;  5D3G A;  1QSY A;  5T7B A;  4UQG A;  3SAF A;  1WBD A;  3S9H A;  1ZBH A;  4Q5V A;  1GLL O;  1GLB G;  1EX4 A;  4BR4 A;  4PHT X;  5CE3 A;  2NZT A;  2UXB K;  3ZSY A;  5KQD A;  1UA0 A;  3I56 N;  4IBN A;  5AFU A;  1YJW N;  1C1C A;  3LZI A;  3HOT A;  1W9H A;  1IKY A;  3IMX A;  1RNH A;  1NGA A;  4DQP A;  2DFF A;  2KZZ A;  1WAJ A;  1JLB A;  3HP6 A;  4EHT A;  1DGK N;  3QO9 A;  5AQJ A;  2HMI A;  4CF2 A;  3DRP A;  4ID5 A;  5C10 A;  2GV9 A;  3OBY A;  2CGK A;  4DLG A;  4DLE A;  2NRR A;  4YNQ A;  3OJU A;  4W5Q A;  1LW2 A;  5ADX H;  4FLW A;  3PO5 A;  4EZ9 A;  1NMD A;  2HBM A;  2ZJR L;  3VA0 A;  5GAE P;  1WSG A;  1NK4 A;  1YTA A;  1BIS A;  2E2P A;  4LY7 A;  4K8Z A;  5HRP A;  4AHC A;  3BGR A;  3DLR A;  2UUC K;  4LSL A;  2YNI A;  1W0H A;  1WUA A;  3CXC M;  3AO4 A;  1E4G T;  3LDN A;  5HRN A;  1EKE A;  5IWA K;  2VWJ A;  2HHQ A;  1NNE A;  2FBX A;  4HWI A;  2JWK A;  3ZSZ A;  4M42 A;  3VEX A;  3MX2 A;  3MED A;  3VQA A;  1JXE A;  4PL7 A;  3CCE N;  4YFU A;  4H0P A;  2HW3 A;  3BZC A;  4FLU A;  3A0I X;  3EL2 A;  4BRD A;  3HJF A;  2RHK A;  2O8B B;  1VSE A;  3ATU A;  2FSK A;  3O9T A;  3OYH A;  4KKO A;  4JS5 A;  1ESV A;  2Z1H A;  2WOM A;  1JJ2 M;  2D0A A;  2A6A A;  4FWK A;  4JK7 A;  3TTC A;  4CK3 A;  3TAP A;  3BEX A;  1C0U A;  4WE1 A;  1WSI A;  3FGU A;  4I6M A;  4JHD A;  3O8M A;  2HNZ A;  2ZJQ L;  2VWB A;  2OPS A;  2A5X A;  3CYM A;  3DOK A;  5GAH P;  1HYS A;  2BE2 A;  1VQP N;  3SUO A;  4DG1 A;  4JI7 K;  1SS6 A;  2ITG A;  2Z1J A;  3MN7 A;  4ZTF A;  3VGK A;  1HQU A;  1QQO A;  1T05 A;  1CLQ A;  3T1A A;  3M3Z A;  4JKH A;  2Y1I A;  5AZI A;  1IG9 A;  4FWR A;  3J7Z O;  4OGE A;  2VQF K;  3CG7 A;  3NGI A;  1GLA G;  4RTF D;  3OYE A;  4RW8 A;  4A57 A;  3SUP A;  4E89 A;  4F3T A;  5CYQ A;  3AVM A;  4OO1 J;  1RT2 A;  3T19 A;  3WXI A;  5EOY A;  1HYZ A;  4EAH D;  1XMQ K;  4KHN A;  1GLJ O;  4OKK A;  4AHR A;  3VQP A;  1RDU A;  2JLE A;  5AZJ B;  3K9K A;  1DTT A;  5AQU A;  3O08 A;  3I0R A;  4Z4C A;  3QEP A;  1J9A A;  2Y1J A;  4CED A;  4IKF A;  4B9M A;  1JLC A;  4CZE A;  3NAE A;  4DR5 K;  1VQ7 N;  2O8F A;  5BR9 A;  2ZQB A;  2X6S A;  3M8S A;  3D0P A;  3VTH A;  3HYF A;  1J5O A;  4CEE A;  1MU2 A;  1GLE G;  3O3G A;  2VG6 A;  1YUW A;  5DM7 L;  1CXQ A;  4DTP A;  4JI0 K;  3K5L A;  5AQP A;  3L2Q A;  1EP4 A;  4BRE A;  4A2B A;  1X9W A;  2YKN A;  1NGE A;  2GEM A;  3CCM N;  2G8V A;  3VEV A;  2CGL A;  1K9M O;  4HHT A;  3ZSO A;  3TAG A;  3L2U A;  3DXK B;  4PWD A;  4O0I A;  1S1W A;  4DUY K;  3MEG A;  4NLC A;  1XC9 A;  3QIO A;  1NKE A;  3DRS A;  2PYJ A;  5DMR A;  2NRZ A;  2V7Y A;  4FM0 A;  1HR0 K;  1VSI A;  1WNS A;  1JL2 A;  3KLE A;  3OYN A;  1OH7 A;  3EEQ A;  4BDZ A;  1OVY A;  2E20 A;  3GOI A;  5AQQ A;  3CME N;  4FM1 A;  3MXI A;  2D0P A;  3K5N A;  2E1Y A;  3L0Q A;  4BRI A;  3RMC A;  1NK6 A;  3CM6 A;  3S41 A;  3OYL A;  1JLQ A;  4IO9 L;  2YX6 A;  3AA3 A;  3C95 A;  3FZK A;  4BC3 A;  2YCH A;  5JVH L;  1BO5 O;  3P39 A;  3J7Y P;  3KKS A;  4YOU A;  4HTL A;  1YAG A;  4AM6 A;  2O8C A;  4KHU A;  3BY5 A;  2O4I A;  3R6M A;  3ZT0 A;  3SYZ A;  3E1Y A;  1WN7 A;  1BA1 A;  5AQS A;  3KJV A;  2QWO A;  4OVL A;  1RFQ A;  3FR0 A;  2P9K A;  2HB5 A;  4M7X A;  3QER A;  2E2Q A;  4X66 K;  2XY5 A;  3A5L C;  4N47 A;  3SNN A;  1KVC A;  3C0B A;  3PSI A;  1U2V A;  3KHY A;  2X74 A;  1TKX A;  4MLH A;  5JIC A;  3KVG A;  3HOS A;  1S1X A;  2QWQ A;  4DUZ K;  1OH6 A;  5CZ1 A;  4GY2 B;  1J6Z A;  5LMU K;  3N4Q A;  1HMV A;  3V9W A;  3KD5 E;  3P83 D;  1YIT N;  5C12 A;  3LDO A;  1NGD A;  4FJH A;  1X9J A;  1VQ5 N;  2HHW A;  3HSC A;  3CJC A;  3HST B;  3H3O B;  4BQL A;  3NBP A;  3LP3 A;  1GLF O;  3CQX A;  1KVB A;  3L6Q A;  4C8K A;  3ZET A;  4ELT A;  5GIP A;  3G25 A;  3WEE A;  1VQL N;  4DV4 K;  1OH5 A;  2ZGY A;  3H3N O;  5I42 A;  1BIZ A;  1RT1 A;  2ASO A;  5BR8 K;  4E19 A;  1N6Q A;  1W97 L;  3D2E B;  3FZH A;  4BAC A;  3TAB A;  3IDH A;  3K5M A;  3TAR A;  2QXL A;  5AQO A;  4DFM A;  4CJ4 A;  3BF3 A;  4CJR A;  1FKP A;  3O4Q A;  4CD3 A;  2VYP A;  4MLE A;  4B9L A;  5KPT A;  4IG3 A;  4AM7 A;  1B9D A;  4H03 B;  4DF8 A;  1NJX A;  1U47 A;  3O1B A;  3EKS A;  3JXU A;  3HZ6 A;  1HNZ K;  2X78 A;  3TSP A;  4CES A;  2OTJ N;  3SBG A;  1JCG A;  4QS7 A;  3AAR A;  5EY4 A;  3CCU N;  3RMA A;  1Q9Y A;  1BUP A;  4W5R A;  3SV4 A;  3CI5 A;  4RW9 A;  3J7A P;  2FBT A;  1R0A A;  4FLT A;  4KV8 A;  3SV3 A;  4BE1 A;  2IGI A;  1RT3 A;  5BPN A;  3D7E O;  4FJ9 A;  3O5B A;  4XH5 A;  2E2O A;  3FFI A;  3ULE A;  4KFB A;  2CGJ A;  3RSE A;  5HRO A;  4EHU A;  4YOW A;  3CJB A;  4MFB A;  2P5O A;  4XIU A;  2W40 A;  3E01 A;  4YHH K;  1C1B A;  4B9S A;  2W41 A;  4CEF A;  4M3R A;  1I39 A;  1RBV A;  3C6T A;  2WTU A;  1REV A;  3KK1 A;  4FZZ A;  1N33 K;  1TAU A;  2QXF A;  3ULD A;  1Q7Y O;  2F9W A;  5AQF A;  4DR6 K;  1UAX A;  3ZSV A;  1W2B M;  2OCE A;  2VGN A;  3DJC A;  2HOE A;  2O4G A;  1QQC A;  3SMP A;  5GIO A;  1BL3 A;  4DFJ A;  3UE5 A;  5JS2 A;  3VES A;  5FRM A;  4CJL A;  1ZBI A;  4H5V A;  1CZB A;  1VSF A;  4PKH A;  1U45 A;  3ZX3 A;  1C0F A;  2ZF5 O;  5HP1 A;  3THY A;  2V7Z A;  5AQW A;  2RE2 A;  4B9Q A;  3DAW A;  3MX5 A;  1NGG A;  5AQM A;  4JK8 A;  4IFV A;  4KRF A;  3I8B A;  4W5O A;  1YT3 A;  3O9S A;  1SL2 A;  3PV8 A;  3LP0 A;  3HT3 A;  4JK9 A;  2YNF A;  1NGI A;  4U67 L;  5AQN A;  5AFU H;  1T44 A;  2EHG A;  4Y0W A;  2P9S A;  3CQY A;  4CE9 A;  4EZ6 A;  3L2W A;  5J2M A;  5JLH A;  1X1P A;  4DFK A;  3OYI A;  3HVT A;  1N36 K;  3MN9 A;  2R7Y A;  4LF9 K;  3Q7C A;  3SQ1 A;  4FJN A;  4FJL A;  1QE1 A;  1DTQ A;  4IEE A;  4CFB A;  2F96 A;  4CIE A;  2ITM A;  4IOC L;  3OA9 A;  2W6L A;  4CEB A;  1C0M A;  4HCB A;  5KGW A;  4C1N K;  1TAQ A;  5HRR A;  1N32 K;  4CJW A;  4BRF A;  2HHU A;  1KTQ A;  4GV3 A;  3LDL A;  5AQK A;  1P8Z A;  5FRO A;  1U49 A;  4FWO A;  5GAD P;  3OYC A;  1YXQ A;  1XQS C;  1NG9 A;  1CZA N;  4BC5 A;  2YHW A;  5AQI A;  4J2B A;  3KWI A;  3KK7 A;  4BRM A;  3V6D A;  1FK9 A;  5LJV A;  3VQ6 A;  4CEZ A;  4DQR A;  3QIN A;  4LFC K;  2FBV A;  5BRH A;  2Q1N A;  4J2D A;  3C7N B;  4WF9 L;  2XRI A;  2UXC K;  1C6V A;  2ATQ A;  4A61 A;  1HPZ A;  1O1W A;  5A2Q O;  3RTV A;  3AVN A;  2FXU A;  4NYN A;  2NRH A;  1LCU A;  4B9V A;  5BN8 A;  3NF9 A;  4JEP A;  3U9Z A;  3THX A;  2VGM A;  1TK8 A;  2CH5 A;  4CEA A;  5H1S Q;  3TSQ A;  4NYF A;  4C1N I;  4NXN K;  3UKU A;  2QKB A;  3CD6 N;  1RBU A;  3EO3 A;  4O8U A;  1BWF O;  1KCF A;  1VSD A;  3RMD A;  1X9M A;  4FW1 A;  4C8M A;  4DSI A;  4W5T A;  3DLE A;  4AHU A;  1IG8 A;  5DK5 A;  2HVH A;  4IEI A;  4B9U A;  3CFO A;  3OYM A;  2HHS A;  2UU9 K;  4BY9 C;  1XWL A;  4DU3 A;  3HO1 A;  2KFZ A;  2XY8 A;  5BRD A;  3CMA N;  2PY5 A;  3LAK A;  1UA1 A;  1QHT A;  3CCV N;  4FZX C;  5LMN K;  4ICL A;  4BRC A;  4H0V B;  4KH6 A;  1YJN N;  3SCX A;  1S6Q A;  4I9Q A;  3H1V X;  1NJW A;  2YJF A;  4FJI A;  3T7Z A;  4C8L A;  4GVM A;  5AQX A;  1P90 A;  1IKV A;  1QVG M;  4MQ3 A;  3BP8 A;  5KRT A;  2YHY A;  4JI1 K;  4CGF A;  3T1Y K;  1TV6 A;  1BCO A;  1Q9X A;  1ITG A;  3V1Q A;  3ASM A;  1QSL A;  3RMB A;  3ZEU B;  4Y1C A;  1JLF A;  3W0L A;  3SQ0 A;  1H1V A;  1GOA A;  1NOY A;  1DEJ A;  4BR2 A;  1QQN A;  3AO2 A;  2IDO A;  4CHZ A;  2HBL A;  3QB0 A;  4RCH A;  4CHY A;  4K43 A;  1Q81 O;  1SKR A;  3LM9 A;  3SJJ A;  2NRV A;  2BH1 A;  1VRU A;  4I2P A;  2BTF A;  5CHI A;  2D0O A;  1EXQ A;  1RDB A;  4FWL A;  3CFR A;  4Z94 A;  1X9S A;  4CEO A;  4CJU A;  4PY5 A;  3RVC A;  3VET A;  3S3M A;  1X3M A;  3OYG A;  2D4W A;  3AY9 A;  3UB5 A;  4CGD A;  4AF1 A;  3CCJ N;  4IO8 A;  4AQY K;  1Q82 O;  2I7N A;  3F2K A;  4FSV A;  4FK0 A;  4FVU A;  2G8U A;  2J4R A;  5J2N A;  3F5T A;  2A1R A;  4GVE A;  2QWN A;  1B9F A;  4LF7 K;  3ZSQ A;  1VQ6 N;  5J1E A;  3QDK A;  2G8W A;  1RTD A;  3D6R A;  4CZI A;  4BRO A;  3QNO A;  1KC8 O;  4CJK A;  2GUP A;  4CHP A;  4J2A A;  4Z0U A;  3AVA A;  4FXD A;  2ASP A;  1VQM N;  2BUP A;  3AA5 X;  3AAP A;  4A2A A;  5AQZ A;  5AQV A;  2VCP A;  5IT9 O;  4C8N A;  1QZ6 A;  3OJS A;  4DS5 A;  3EE8 A;  1BGX T;  2AP1 A;  5E26 A;  4B9T A;  4IOA L;  3CFP A;  3CC4 N;  1ZBU A;  1SUQ A;  4OJR A;  3LPT A;  4FJJ A;  2OPP A;  3H6E A;  2KFN A;  3PUF A;  1NK0 A;  5C0Y A;  2AA4 A;  1LOT B;  5M1K A;  4OPJ A;  1KD1 O;  1QZ5 A;  5FLX O;  2RPI A;  1IO2 A;  4CBX A;  4IXC A;  4YDU C;  1MWM A;  3ZT4 A;  3LL3 A;  1A5W A;  3ALY A;  1A5X A;  4FCY A;  2P9N B;  3VEO A;  1HX1 A;  3M1F A;  3O6W A;  4BRG A;  4FLZ A;  2HHH K;  3CC2 N;  4Z4E A;  1NKC A;  2A41 A;  1NJZ A;  3PIP L;  4ELU A;  3OS2 A;  2P9P B;  3LPU A;  3HPO A;  2D0C A;  4WQ5 C;  1KRP A;  1QSS A;  3K2P A;  2HNY A;  1IH7 A;  5J2Q A;  4LF5 K;  1JLA A;  3G4S N;  1XHZ A;  3LDP A;  4CF8 A;  1EQY A;  3UKR B;  2F8S A;  4BVP A;  4OKE A;  3JYT A;  3KTQ A;  1A5V A;  4ILJ A;  2O8B A;  1RDC A;  2P9U B;  5GAG P;  4KAZ A;  5I3U A;  2E1Z A;  3TSU A;  1BQM A;  1L3V A;  1KAX A;  2JWL A;  3AGR A;  4NCA A;  1ZYQ A;  3FLC O;  3EYZ A;  3PX6 A;  2VG5 A;  4N76 A;  4K25 A;  3V9S A;  1RTH A;  3SMS A;  5KI6 A;  1LAW A;  4A62 A;  3SK3 A;  5EX5 A;  3HL8 A;  1S9G A;  2RN2 A;  4ISF A;  3OYJ A;  4Z4F A;  4MO5 A;  3MCP A;  3KLF A;  4DSL A;  4KTQ A;  4ID1 A;  3O1W A;  2P9I A;  2P9L B;  3AVG A;  3VF4 A;  2VQE K;  4PL8 A;  1JCF A;  3DI6 A;  1O13 A;  4DR2 K;  4CGJ A;  1RT6 A;  5HBM A;  1FKO A;  4CJT A;  4E7L A;  1JCE A;  4CCH A;  3P38 A;  1DT9 A;  4H5R A;  1TYQ B;  4LC9 B;  1BU6 O;  1HKG A;  2KTQ A;  4FK4 A;  1LWC A;  4KHP K;  1ZBS A;  4M41 A;  4DMN A;  4DV1 K;  1YF5 L;  4BR5 A;  2O8C B;  2I5J A;  2QKK A;  4FOE A;  5AZJ A;  2KKZ A;  1E3M A;  4E7H A;  1KSP A; 
#chains in the Genus database with same CATH homology
 1Q8I A;  4JS4 A;  4CES A;  5FDL A;  4CJF A;  4BDP A;  2VWK A;  4EP4 A;  3KIO A;  3LAM A;  2IC3 A;  3LP2 A;  4I2Q A;  1F21 A;  1KLM A;  2Q3S A;  3CM5 A;  1S1U A;  4RW7 A;  3RMA A;  1Q9Y A;  1YVU A;  3M8R A;  3NDK A;  3NF8 A;  4LD0 A;  3ISN C;  4W5R A;  2GBZ A;  3SV4 A;  1U04 A;  3V1O A;  3SUQ A;  4RW9 A;  1QTM A;  4FJ8 A;  2FBT A;  1KVA A;  4N56 A;  3ZSR A;  1R0A A;  4KI4 A;  1SV5 A;  4BE2 A;  1ASV A;  4FLT A;  4H8K A;  4OLB A;  4N5S A;  3AVB A;  2ZD1 A;  2D5R A;  5CZ2 A;  3TI0 A;  2PZS A;  4RW6 A;  4KV8 A;  1GOC A;  3ZCM A;  3SV3 A;  3LZJ A;  3SZ2 A;  1WAF A;  4BE1 A;  2IGI A;  1RTI A;  1IKW A;  1RT3 A;  3AO3 A;  4IDK A;  3M8P A;  4CER A;  3VQ7 A;  3NGY A;  4CHN A;  3RRH A;  1FXX A;  4FJ9 A;  4DS4 A;  2PYL A;  4DQQ A;  1LW0 A;  4CFA A;  2XHB A;  1RDA A;  1SKS A;  2G8I A;  4GMJ B;  1Z26 A;  1T03 A;  3A2F A;  5SZT A;  3FFI A;  4CFD A;  4KFB A;  1C0T A;  3NF6 A;  3TAM A;  3K57 A;  2OZS A;  5HRO A;  3DLG A;  4KI6 A;  4MFB A;  2P5O A;  4AIL C;  4XIU A;  1BCM A;  4FJG A;  5KGX A;  3E01 A;  2P1J A;  4B9S A;  1C1B A;  4CJV A;  3AVF A;  4Z4I A;  4CEF A;  3I8D A;  4M3R A;  3V9U A;  1JLG A;  1I39 A;  1RBV A;  3C6T A;  4I7F A;  1REV A;  3KK1 A;  3BDP A;  3NF7 A;  1JKH A;  2DFE A;  3DM2 A;  3LAL A;  3U3Y A;  4FZZ A;  4CJS A;  1TAU A;  2B6A A;  2QXF A;  4CF0 A;  3ULD A;  1VSH A;  3T3F A;  4O5B A;  1UAX A;  1D9F A;  3KK3 A;  3ZSV A;  4KTZ A;  1HYV A;  4M3Z A;  2VG7 A;  2O4G A;  1ASW A;  1QQC A;  3VN5 A;  4HUG A;  3PY8 A;  3KKR A;  4W5N A;  3RR8 A;  1TGO A;  3LWL A;  4ZTJ A;  1BL3 A;  5KTQ A;  4DFJ A;  1NK8 A;  2P51 A;  2OPQ A;  3KK2 A;  2AJQ A;  4FLY A;  5JS2 A;  4HCC A;  3L3U A;  1VSM A;  1N5Y A;  4O4G A;  2BAN A;  1WSE A;  1L3T A;  5FRM A;  2E6L A;  4CJL A;  3IAY A;  3WNE A;  4FZY A;  1SKW A;  3NHG A;  3HXM A;  4DU4 A;  4DSJ A;  4J2E A;  2KZZ A;  3AA2 A;  1RBR A;  1ZBL A;  1ZBI A;  3TAN A;  1CZB A;  1VSF A;  4PQU A;  1U45 A;  1CXU A;  4B8C A;  4HUF A;  1CZ9 A;  1UOC A;  1VSL A;  4CEQ A;  5HP1 A;  4E0D A;  3VQQ A;  5D3G A;  3VQ9 A;  1S1V A;  3DLK A;  2KQ2 A;  4KRE A;  1QSY A;  3L2V A;  5T7B A;  4UQG A;  1NJY A;  5HLF A;  3RR7 A;  4IFV A;  3OS1 A;  4KRF A;  4W5O A;  3S9H A;  1ZBH A;  1YT3 A;  4Q5V A;  3F73 A;  1SL2 A;  3PV8 A;  3LP0 A;  3HT3 A;  1EX4 A;  3O3F A;  2YNF A;  2EX3 A;  3UIQ A;  4E7K A;  3ZSY A;  2EHG A;  3M8Q A;  4F4K A;  3KD1 E;  1UA0 A;  2WON A;  2B5J A;  4EP5 A;  1KFD A;  4IBN A;  4AHV A;  4CJ5 A;  3QNN A;  3HVR A;  4CE9 A;  3WNH A;  1C1C A;  5C42 A;  3LZI A;  4EZ6 A;  2GUI A;  5CYM A;  3ZSX A;  3L2W A;  5J2M A;  1X1P A;  4LH5 A;  1WSJ A;  1W9H A;  4DFK A;  3OYI A;  3AVI A;  3HVT A;  5EU7 A;  2R7Y A;  5CY4 A;  3D45 A;  1IKY A;  3SQ1 A;  3PX4 A;  1RNH A;  1TK0 A;  3B6P A;  1XHX A;  4FJN A;  3MXJ A;  4KHW A;  4C8O A;  4DQP A;  2DFF A;  2X6N A;  1WAJ A;  1JLB A;  5SWM A;  1QE1 A;  3HP6 A;  1DTQ A;  3QO9 A;  1WSF A;  4CFB A;  3VQ4 A;  3L2R A;  2F96 A;  3VQ8 A;  4JRQ A;  4CIE A;  3DRP A;  4CF2 A;  4ID5 A;  2HMI A;  1C1A A;  4M45 A;  3THV A;  4O55 A;  4CEB A;  2GV9 A;  1C0M A;  1NK9 A;  4HCB A;  5KGW A;  3VA3 A;  4FLX A;  2YV0 X;  1UWB A;  4DLG A;  1TAQ A;  1ASU A;  5HRR A;  3O3H A;  4CJW A;  4DLE A;  2HHU A;  1KTQ A;  4B8A B;  3NCI A;  2E4L A;  4YNQ A;  4CJE A;  3HP9 A;  4W5Q A;  3NH0 A;  1LW2 A;  5FRO A;  3OJU A;  4FLW A;  4E7I A;  1U49 A;  3PO5 A;  1HQE A;  4L8R B;  4EZ9 A;  3VQE A;  3V4I A;  3HK2 A;  3VA0 A;  3OYC A;  5FRN A;  2NUB A;  3ITH A;  1RDD A;  1J54 A;  3K59 A;  1WSG A;  1T8E A;  4F3O A;  1NK4 A;  1YTA A;  1BIS A;  4LY7 A;  4K8Z A;  4J2B A;  5HRP A;  2FC0 A;  4AHC A;  3BGR A;  3DLR A;  4AHS A;  3V6D A;  1FK9 A;  3VQ6 A;  4CEZ A;  4LSL A;  2YNI A;  3QIN A;  4CJP A;  4DQR A;  1W0H A;  4FK2 A;  3AA4 A;  3AO4 A;  3C6U A;  3KLG A;  5HRN A;  3O4N A;  3TAF A;  1EKE A;  2FBV A;  2VWJ A;  4KB1 A;  4M3Y A;  2RKI A;  4OLA A;  4J2D A;  3DMJ A;  2HHQ A;  1RIL A;  2XRI A;  1LV5 A;  1C6V A;  2ATQ A;  1TKT A;  1HPZ A;  1O1W A;  3ZT1 A;  2FBX A;  1RT4 A;  3AVN A;  4AH9 A;  4NYN A;  3RTV A;  5HRS A;  3V9Z A;  4PA1 A;  4N41 A;  4B9V A;  4KHS A;  3NF9 A;  3ZSZ A;  1TK8 A;  3AVC A;  4M42 A;  4DTN A;  3MED A;  4JLH A;  1JXE A;  3VQA A;  3TAQ A;  3SPY A;  3EZ5 A;  4CEA A;  4FM2 A;  1J53 A;  2F8T A;  4YFU A;  4ZHR A;  5C24 A;  2HW3 A;  4FLU A;  4NYF A;  4NCB A;  1S5J A;  2Z1G A;  3QLH A;  3HJF A;  1VSE A;  2OA8 A;  4CJ3 A;  1L3S A;  2HHT A;  2XY7 A;  3IRX A;  3ZSW A;  2QKB A;  3K58 A;  4G1Q A;  3OYH A;  4DTX A;  4KKO A;  4Z4H A;  4JS5 A;  3L8B A;  4ELV A;  1RBU A;  2Z1H A;  1S9E A;  1T7P A;  3U6F A;  1KCF A;  1VSD A;  3TAE A;  3AVJ A;  4HUE A;  4CIG A;  3RMD A;  2WOM A;  1X9M A;  2D0A A;  3G10 A;  4FW1 A;  4KHQ A;  1S1T A;  4C8M A;  3RWU A;  4AHT A;  4CK3 A;  4W5T A;  3QEX A;  3TAP A;  4DSI A;  3OYK A;  3DLE A;  1C0U A;  3MEE A;  4WE1 A;  1WSI A;  4AHU A;  3S3O A;  3RRG A;  2W42 A;  3DOL A;  5DK5 A;  2HVH A;  4B9U A;  2HNZ A;  2QK9 A;  2OPS A;  3CYM A;  2DFH A;  3CFO A;  3DOK A;  4CEC A;  1HYS A;  2BE2 A;  3K5O A;  3OYM A;  3SUO A;  4DG1 A;  2HHS A;  1XWL A;  4DU3 A;  4M3U A;  3HO1 A;  3VQD A;  2ITG A;  1QS4 A;  2Z1J A;  2KFZ A;  2XY8 A;  4ZTF A;  4FVM A;  3MXM A;  2PY5 A;  4PUO A;  1HQU A;  3LAK A;  3PO4 A;  3I0S A;  4KO0 A;  4RG8 A;  1UA1 A;  1QHT A;  1KFS A;  4FZX C;  1T05 A;  4ICL A;  4CGI A;  1CLQ A;  3T1A A;  2Y1I A;  1TL3 A;  4DTM A;  3HPG A;  4CGH A;  4I9L A;  1IG9 A;  3SCX A;  1S6Q A;  4OGE A;  3OYB A;  4I9Q A;  4DSE A;  1NJW A;  3CG7 A;  1NKB A;  4FJI A;  4C8L A;  1VSK A;  4GVM A;  3HM9 A;  3NGI A;  3OYE A;  4RW8 A;  1IKV A;  3U3G A;  1RT5 A;  4MQ3 A;  2JGU A;  4NCG A;  4E89 A;  5CYQ A;  3AVM A;  3SUP A;  4F3T A;  1RT2 A;  5KRT A;  4CGF A;  3WNF A;  3T19 A;  1TV6 A;  3QEW A;  3DLH A;  1BCO A;  1Q9X A;  1ITG A;  1RBT A;  3ASM A;  1HYZ A;  1BI4 B;  2FBY A;  3V1Q A;  4CF1 A;  3NH1 A;  4Y1C A;  1JLF A;  3RMB A;  4KHN A;  4OKK A;  4AHR A;  3VQP A;  3SQ0 A;  2JLE A;  1GOA A;  1NOY A;  4DTR A;  3OS0 A;  1ZBF A;  1DTT A;  3AVH A;  3SI6 A;  3I0R A;  2IS3 A;  3AO2 A;  4Z4C A;  3QEP A;  2IDO A;  4CHZ A;  1J9A A;  4QOZ B;  2Y1J A;  4CED A;  4IKF A;  4DWI A;  4CHY A;  1JLC A;  2YNH A;  4B9M A;  1L3U A;  2G8H A;  1SKR A;  1TL1 A;  3NAE A;  2ZQB A;  2X6S A;  3M8S A;  4QAG A;  3D0P A;  3HYF A;  1J5O A;  3SJJ A;  1VRU A;  4CEE A;  1MU2 A;  4I2P A;  3O3G A;  3P1G A;  2VG6 A;  2YNG A;  3OYD A;  3KLH A;  1EXQ A;  1DLO A;  1RDB A;  2RF2 A;  3CFR A;  1CXQ A;  4DTP A;  3VQB A;  4CF9 A;  1X9S A;  4QCL A;  3K5L A;  1JLE A;  4CGG A;  3V9X A;  3MEC A;  3QEV A;  3SQ2 A;  2G8K A;  1U4B A;  1VSJ A;  3B6O A;  4CEO A;  4CJU A;  3L2Q A;  4PY5 A;  1EP4 A;  2OYQ A;  1X9W A;  1KLN A;  1JL1 A;  2YKN A;  3OYG A;  3S3M A;  4CHQ A;  2G8V A;  3VQC A;  4DSK A;  4M3W A;  4HHT A;  3SPZ A;  3ZSO A;  4DFP A;  4CGD A;  3TAG A;  2OPR A;  3L2U A;  4PWD A;  4O0I A;  1S1W A;  2ZE2 A;  4GW6 A;  3VQ5 A;  4FLV A;  3MEG A;  2XO7 A;  4BWJ A;  1XC9 A;  3QIO A;  1SL1 A;  1NKE A;  3DRS A;  2D0B A;  2PYJ A;  5DMR A;  3AVL A;  4FM0 A;  4DTS A;  2G8U A;  4FK0 A;  4KB0 A;  4FYD A;  1VSI A;  1HNI A;  1WNS A;  1JL2 A;  5J2N A;  3KLE A;  3V81 A;  1Z25 A;  3OYN A;  3SUN A;  2A1R A;  1SL0 A;  1B9F A;  5JS1 A;  4BDZ A;  1S6P A;  1LWF A;  4Z4G A;  3ZSQ A;  1D9D A;  4DQI A;  4B08 A;  5J1E A;  2G8W A;  2Z1I A;  1RTD A;  2OZM A;  4FM1 A;  3QNO A;  3MXI A;  1JXB A;  3AO1 A;  4O0J A;  3K5N A;  3QET A;  3RMC A;  4RW4 A;  4CJK A;  2BGG A;  4CHP A;  1NK6 A;  1Y97 A;  4J2A A;  3CM6 A;  4Z0U A;  4FJK A;  4FJL A;  3AVA A;  3OYL A;  4FXD A;  3AA5 X;  1JLQ A;  3L3V A;  3AA3 A;  1RT7 A;  3C95 A;  3QEI A;  4C8N A;  3OJS A;  1B92 A;  3AV9 A;  3KKS A;  4DS5 A;  1BIU A;  1BGX T;  1YTU A;  2KW4 A;  4TSX A;  3EY1 A;  4JRP A;  4DSF A;  4B9T A;  4CK2 A;  4KHU A;  2O4I A;  2XY6 A;  3CFP A;  3ZT0 A;  1ZBU A;  3SYZ A;  1SUQ A;  1VK0 A;  4OJR A;  2HND A;  3LPT A;  1WSH A;  1HNV A;  2OPP A;  4FJJ A;  3P5J A;  4Y1D A;  3TWH A;  1TVR A;  2B4J A;  2KFN A;  3S3N A;  3PUF A;  1NK0 A;  2IOC A;  1WN7 A;  5C25 A;  2HHV A;  4OPK A;  3KJV A;  4OPJ A;  4OVL A;  3OY9 A;  3DRR A;  4BDY A;  4DTO A;  2HB5 A;  3KLI A;  2RPI A;  3QER A;  2KZM A;  2XY5 A;  1IO2 A;  2E6M A;  4H4M A;  3NH2 A;  3ZT4 A;  1A5W A;  3ALY A;  4N47 A;  1A5X A;  4FCY A;  4FLZ A;  4CK1 A;  3SNN A;  4Z4E A;  1KVC A;  4FJ5 A;  4FJM A;  2IAJ A;  1NKC A;  3LAN A;  1NJZ A;  2X74 A;  4ELU A;  1QSL A;  1WLJ A;  3OS2 A;  4BWM A;  4M3T A;  3LPU A;  3HPO A;  1TKX A;  3G0Z A;  4IG0 A;  2D0C A;  3NGZ A;  1BQN A;  2G8F A;  1KRP A;  1QSS A;  4F2S A;  3K2P A;  2HNY A;  1IH7 A;  1S1X A;  3IG1 A;  5J2Q A;  4E3S A;  3H08 A;  1JLA A;  1XHZ A;  4CJQ A;  4CF8 A;  2F8S A;  3F9K A;  5CZ1 A;  1TK5 A;  2HVI A;  4OKE A;  3JYT A;  3TR8 A;  1A5V A;  1D5A A;  3V1R A;  3KTQ A;  1RDC A;  3IS9 A;  1HRH A;  3JSM A;  1HMV A;  4KAZ A;  5I3U A;  3V9W A;  3KD5 E;  3P83 D;  1BQM A;  3LP1 A;  1L3V A;  3OYF A;  1NK5 A;  4FJX A;  4NCA A;  4FJH A;  2YHB A;  1LWE A;  4OKJ A;  4F2R A;  1ZYQ A;  4M3X A;  1BHL A;  4LH4 A;  3EYZ A;  4HTU A;  3PX6 A;  2P5G A;  2HHW A;  2VG5 A;  4N76 A;  1U48 A;  2DTU A;  3PX0 A;  3HST B;  3NFA A;  3V9S A;  3NBP A;  4CHO A;  1TKD A;  3LP3 A;  1RTH A;  4DTJ A;  1VRT A;  5KI6 A;  1IKX A;  1LAW A;  3HPH A;  5J2P A;  3SQ4 A;  4B9N A;  2A1S A;  1KVB A;  3OYA A;  4HVJ A;  4C8K A;  2YHA A;  1D8Y A;  3DYA A;  3HL8 A;  1NOZ A;  1GOB A;  4ELT A;  1S9G A;  2RN2 A;  3OYJ A;  4Z4F A;  3ZT2 A;  3KLF A;  1TKZ A;  5I42 A;  2BDP A;  4DSL A;  3AVK A;  1K6Y A;  4KTQ A;  4KPY A;  1BIZ A;  1RT1 A;  4ID1 A;  4DF4 A;  4E19 A;  1N6Q A;  4CFC A;  1RTJ A;  3NE6 A;  3AVG A;  2DY4 A;  4BAC A;  4KHY A;  3TAB A;  4FW2 A;  3K5M A;  2LSN A;  5E41 A;  4B3O A;  4E7J A;  3DI6 A;  2HHX A;  4R5P A;  2YKM A;  4CGJ A;  3LWM A;  3TAR A;  1NK7 A;  1RT6 A;  5K14 A;  5HBM A;  3DLB A;  1FKO A;  3AO5 A;  1G15 A;  4CJT A;  4E7L A;  1L5U A;  4DU1 A;  4CCH A;  4LSN A;  4CIF A;  1RBS A;  4OGC A;  3QES A;  2ETJ A;  4KTW A;  4CJ4 A;  4E1M A;  4DTU A;  4DFM A;  3ZT3 A;  1XI1 A;  3LDS A;  4CJR A;  3MAQ A;  3CQ8 A;  1FKP A;  3O4Q A;  4E1N A;  2KTQ A;  4FK4 A;  1EET A;  5KRS A;  1LWC A;  1LAV A;  3QIP A;  4DQS A;  4FJ7 A;  4M41 A;  4DMN A;  4BE0 A;  4B9L A;  3C94 A;  4IG3 A;  1B9D A;  1NJX A;  4DF8 A;  1BI4 A;  4IFY A;  4O44 A;  3WNG A;  1U47 A;  4F8R A;  4K8X A;  2I5J A;  1HJR A;  1I3A A;  2QKK A;  1RCH A;  4Q0B A;  3OVN A;  4E7H A;  1KSP A;  2X78 A;  4H4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...