1B9FA

Mobility of an hiv-1 integrase active site loop is correlated with catalytic activity
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
155
structure length
151
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFAIPYNPQSQAVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (INTEGRASE)
publication title The mobility of an HIV-1 integrase active site loop is correlated with catalytic activity.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (clone 12)
total genus 55
structure length 151
sequence length 155
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1b9fA00
3DRPA 1S9EA 1GOAA 1NK9A 3SUQA 3M8PA 3K5OA 4Z4HA 1A5VA 2XHBA 3VA0A 1NKEA 1WAJA 4CE9A 1SL2A 2QKKA 3OS0A 4M3XA 1JLAA 1WSHA 2P51A 3OYMA 3TWHA 3QEPA 4CJWA 3WNHA 4I2PA 4NCGA 3QO9A 4KO0A 1LWEA 1ZBHA 2FBVA 3KLEA 4FM1A 2YKNA 1D9FA 3SQ0A 3VQEA 1K6YA 4CK2A 3S3MA 4F8RA 4F3TA 1RT5A 4CGDA 1NKCA 4OKEA 1BHLA 1RDDA 3AVKA 2IGIA 3O4QA 3LWLA 3LAKA 2BANA 5J1EA 2FBXA 4RW4A 4DTUA 3B6PA 5T7BA 4KAZA 3A2FA 1TK5A 3M8QA 4FJGA 1SKSA 2OZMA 5I42A 2DFEA 1CZBA 1ITGA 3DLEA 3EYZA 3VA3A 1A5WA 4W5QA 5DK5A 1DTTA 4LSLA 4FZXC 3MEDA 4N5SA 5CYMA 3LP0A 4UQGA 2IC3A 4BACA 3DOKA 4PQUA 4AHCA 1B9DA 1VK0A 2Z1HA 2JLEA 4FLXA 4ICLA 3V6DA 3TANA 2G8FA 3LAMA 3OYEA 3SUOA 3L2RA 1RDBA 1RT1A 1X1PA 3SCXA 1T03A 1SL0A 2EX3A 2D0BA 1U04A 2F96A 1S1VA 4FZZA 1MU2A 4OLBA 3AA4A 1C6VA 4CJ5A 1FK9A 3OYDA 4Z0UA 4PY5A 4W5OA 2JGUA 3HP6A 4GMJB 3VQBA 4J2DA 1J54A 1WSGA 4FW2A 4ELUA 1C1BA 2IAJA 3AO5A 3ZT0A 3WNFA 1IG9A 3SQ1A 4EP4A 4CECA 1Q9XA 1WSFA 3KLIA 3VQCA 3DLKA 2BE2A 4E1NA 3L2WA 4OPKA 1JLQA 4DSEA 4DF8A 4J2EA 4CK1A 4CF8A 4KI6A 1WSIA 2LSNA 5C42A 1Z25A 3KLFA 4ZTFA 3OYCA 3OYHA 2GUIA 4IFYA 4J2BA 3PUFA 4B9MA 4FJMA 4PA1A 4CHQA 2X78A 4BE1A 3NDKA 3SV3A 3OY9A 2XRIA 4KHYA 4ID5A 1B92A 2Z1GA 4C8NA 1J5OA 4B8CA 1NJWA 4FK2A 4Z4EA 1JXBA 3QLHA 4E1MA 4EZ9A 1S5JA 1QE1A 1TK0A 3TARA 1NK6A 2G8WA 1RTHA 1RNHA 3MAQA 3RMCA 4OGCA 4BDZA 4B9TA 2G8VA 4B08A 4B3OA 3QETA 4I2QA 1NK0A 4RW8A 3KK3A 1NKBA 3U3GA 2HHXA 4CF0A 1EXQA 4DS4A 1KSPA 4H8KA 3S9HA 3AO2A 4DU1A 4R5PA 3C94A 4M45A 3O3FA 4DSLA 1RBSA 3OYGA 2D0CA 3FFIA 4HVJA 1X9SA 1QSSA 3SJJA 2G8KA 2Z1JA 3U6FA 1VSIA 1ZBLA 4F4KA 2OA8A 2VWJA 1UOCA 2YNIA 4QAGA 1DTQA 3ITHA 1LW0A 1NK4A 3AO4A 1RTJA 1LV5A 3LPTA 1L3UA 1RBUA 1RT6A 4IFVA 1X9WA 2OPPA 4BDPA 3IRXA 4OKJA 1B9FA 1VSEA 3NH1A 4ZTJA 2D0AA 4DQSA 4M3TA 4DTNA 4KTQA 1JLBA 3L3UA 3OYAA 4WE1A 3O4NA 3OJSA 3RMDA 2PZSA 5J2MA 4CJ3A 4E89A 4FJJA 4F2RA 3V9ZA 4E7LA 3AA3A 1J53A 4M42A 1L5UA 3RTVA 2GV9A 1S9GA 3ZT4A 3DMJA 3CG7A 1RT3A 3HP9A 4JLHA 1VSKA 2DFFA 4E7KA 4KB1A 1S1WA 2BDPA 3CYMA 3L2UA 3HO1A 4KRFA 3DI6A 4CJLA 2E6MA 1LAWA 3AVGA 2YHBA 4HHTA 4DS5A 3G10A 5KRSA 4DFJA 4LY7A 2BGGA 1ZBUA 4CHNA 3V1OA 4N56A 3HPOA 2HHVA 2HVIA 3PO4A 1BQMA 3EY1A 4FLYA 4DQRA 3K57A 4LD0A 5J2PA 4B9NA 3HM9A 4CCHA 2HW3A 1SUQA 3NE6A 2VG5A 4CF1A 4CJ4A 3IG1A 2HHWA 3C6TA 3MEGA 2P5OA 1UWBA 4DG1A 5CYQA 1GOBA 2B5JA 4KTWA 3SUNA 3AVHA 1SKRA 4AHVA 4DFKA 1IKWA 1TVRA 4DFMA 3OVNA 3LPUA 4DU3A 1RBRA 4GW6A 2E6LA 2Q3SA 3M8SA 1KVCA 4CK3A 3ALYA 1RT2A 5KI6A 3V1QA 4NCBA 4E0DA 4MFBA 3AVBA 4J2AA 3HT3A 3QINA 2XY6A 3PO5A 4XIUA 2B6AA 4DQPA 1TAUA 4O5BA 2RKIA 4NYNA 4KHWA 4IG3A 3K2PA 3NF9A 1N5YA 1J9AA 4CHYA 4CEFA 1F21A 4FLWA 3NFAA 3QEIA 3TAEA 1RTDA 3HK2A 4JS4A 3AV9A 1D5AA 1NK5A 2HHSA 3VQPA 4ID1A 2DTUA 1VRUA 2QK9A 4HUGA 2HB5A 3TI0A 3KTQA 1L3TA 3L3VA 3U3YA 3KD5E 5FRMA 1RT7A 2Y1IA 4ELTA 3CFOA 1NJYA 4C8OA 4CERA 4M3YA 3QNOA 4DTRA 4DTOA 5CZ1A 3IAYA 4G1QA 3HPHA 4Z4GA 3SI6A 3B6OA 1HNVA 2XO7A 1ZYQA 1HYVA 1YT3A 4B8AB 4BDYA 3AVCA 4RG8A 1EETA 3ZSWA 3OYNA 3TR8A 3I0SA 3OYKA 3RRGA 4M3ZA 4CEBA 4H4OA 4CJEA 3OS2A 2E4LA 2RN2A 1IO2A 3OYBA 3K58A 4CJUA 3SPZA 2QXFA 4DWIA 3SQ2A 1BIZA 1JLEA 1U4BA 3VQQA 4O0IA 4KTZA 3L8BA 4FYDA 4HCCA 4CHOA 4KKOA 4CGFA 5J2QA 3KIOA 2XY8A 1HPZA 3IS9A 2G8UA 2PYLA 4DF4A 4DTPA 3KLHA 4CJSA 2F8SA 4O0JA 4O4GA 4CEEA 2KTQA 2HNDA 4CIEA 3LZIA 3AA5X 4DSKA 1R0AA 3CM6A 4JRPA 3RRHA 1RTIA 3OYIA 1XI1A 3AVIA 4PWDA 3VQ8A 4CFBA 1VSFA 2KQ2A 5JS2A 3ZCMA 2KFNA 1NJXA 1A5XA 4MQ3A 2F8TA 1TK8A 1TV6A 3LZJA 2YNHA 4Y1DA 1RT4A 3LP1A 4CJQA 4YFUA 4IG0A 4BWMA 3NGZA 4DSJA 3K59A 4FZYA 1U47A 3CFRA 2PYJA 4IKFA 2X6NA 3AVAA 1VSHA 3NAEA 3TAQA 4KV8A 4H4MA 3PY8A 1WLJA 1KFSA 3P1GA 1C1CA 2YNGA 1KVBA 1HQUA 3NGYA 4Q5VA 1TL1A 1C0MA 2X74A 1DLOA 1YTUA 4FXDA 3RR7A 4EZ6A 1ASVA 4OGEA 4CEDA 4CEQA 3VQ6A 1KCFA 3OYFA 3PX4A 4DFPA 1HYSA 3QEWA 2IOCA 4CEAA 4FJ7A 4Z4IA 1UAXA 5I3UA 4Z4CA 1TKZA 4E19A 1QSYA 2ETJA 1UA1A 3JYTA 5KTQA 4M3WA 5FDLA 3LWMA 1U49A 4CFDA 4I9QA 1BCOA 2ZQBA 1T05A 2KZZA 4JS5A 3PX0A 4CESA 3LALA 3VQ4A 4FK0A 4AHSA 4RW6A 4CJTA 1JXEA 1NJZA 3VQ5A 4CF2A 3HSTB 4QOZB 1YVUA 4FJKA 4K8XA 4O55A 3O3HA 5HRNA 3ASMA 4FM0A 1KLMA 4FVMA 1TKTA 5HLFA 4E7HA 1D9DA 5CZ2A 4M3UA 3MXJA 2KFZA 3LP3A 3H08A 4DTJA 2IS3A 3DYAA 3SV4A 4K8ZA 3ZSQA 3K5MA 3ZT2A 3OYLA 3CQ8A 3ZSRA 4ELVA 1BIUA 5HRSA 3KKRA 3ZSOA 4Z4FA 4FJ9A 3NCIA 5HRPA 1JLGA 3QEXA 4B9UA 1KFDA 3V1RA 2XY7A 1LWCA 3K5LA 5DMRA 2I5JA 1EKEA 4B9VA 3VN5A 4E7IA 1T7PA 2YKMA 3PX6A 3THVA 3ZSXA 5EU7A 2HMIA 2R7YA 4CJRA 3SPYA 1NK8A 1BI4B 1IH7A 1LW2A 3WNGA 4CIGA 3KK2A 3V9XA 4LH5A 1EX4A 3EZ5A 4FJLA 4C8KA 3I8DA 3KLGA 1SV5A 3HL8A 4KB0A 3NHGA 3QERA 4KHUA 3TAFA 2WONA 2B4JA 1W9HA 1IKVA 2FBTA 1TKDA 4FJNA 4C8LA 3QESA 1IKXA 1X9MA 4CJFA 3G0ZA 3ZSYA 4W5RA 3HPGA 4DSFA 3RR8A 4DSIA 3AVJA 1FXXA 3WNEA 1UA0A 1C1AA 1S1TA 5KGWA 1BQNA 4W5NA 1HJRA 3AO3A 4CGJA 5KRTA 4RW9A 3TAGA 3DLBA 2FBYA 1CLQA 1GOCA 2XY5A 3DLHA 4KREA 3HVRA 5CY4A 3JSMA 2ITGA 4FCYA 1XHZA 1FKPA 5C25A 5KGXA 3V4IA 1JL2A 5HP1A 3C6UA 3CM5A 4DTMA 4FJHA 4KHNA 3O3GA 4FK4A 1S1XA 1XHXA 2X6SA 1FKOA 3NF6A 4FLZA 2W42A 1BCMA 2FC0A 2P1JA 3DRRA 2A1SA 1HYZA 4E7JA 1HMVA 2PY5A 3UIQA 1NOZA 1I3AA 3ISNC 3NBPA 3HVTA 4KHSA 1WN7A 1HQEA 3VQDA 1VSJA 1LWFA 4CGIA 3V81A 4OPJA 2HNZA 2AJQA 4F3OA 4ZHRA 4DU4A 4FJXA 4AILC 4RW7A 3ZT3A 5HROA 4KPYA 3L2QA 1HNIA 3F73A 3K5NA 4BE0A 2QKBA 3E01A 3P5JA 4CEOA 5J2NA 3SUPA 2VG7A 4AHUA 4C8MA 4NCAA 1ASUA 4FLUA 1TKXA 3NF7A 4N47A 4CFAA 2HHQA 3MEEA 3L2VA 2IDOA 1L3SA 1TAQA 3ZT1A 3TAMA 3ZSZA 2O4GA 3OJUA 2VG6A 4HUFA 3F9KA 1WSJA 3S3OA 1W0HA 1KLNA 1CZ9A 1VSMA 2GBZA 1SKWA 3I0RA 1TGOA 4CGHA 1NOYA 1QS4A 1S1UA 1C0TA 1BGXT 4JRQA 1Y97A 4IDKA 3DM2A 4DMNA 4KHQA 2HHTA 1IKYA 4Q0BA 3VQAA 2KZMA 3MECA 3AA2A 1CXUA 1JLCA 1JLFA 3QIPA 3MXIA 5FRNA 1RDAA 2Y1JA 5SZTA 1RDCA 3KD1E 2OPSA 5HRRA 4CFCA 4FJ5A 1U48A 5JS1A 4CHZA 1ZBIA 5SWMA 1BL3A 1Q8IA 3AO1A 3C95A 1I39A 3DOLA 3T3FA 4DTSA 4Y1CA 2DY4A 3RMBA 3DLGA 4CJVA 3OYJA 1LAVA 3ZSVA 1KRPA 4FLVA 4TSXA 4PUOA 3NGIA 3NH2A 2VWKA 3LDSA 4O44A 1HRHA 4B9LA 5K14A 1ZBFA 3T1AA 3AVLA 2NUBA 1RCHA 3P83D 4N76A 2RF2A 3SQ4A 4KI4A 1D8YA 4FJIA 1KVAA 4N41A 4DLEA 4I7FA 3KKSA 3LANA 3VQ9A 1VSLA 3V9UA 2OZSA 1RILA 1U45A 2RPIA 3ULDA 2A1RA 4FW1A 2G8HA 3CFPA 1REVA 1JKHA 1JL1A 4OKKA 1WSEA 5HBMA 1QQCA 3SZ2A 4HTUA 4QCLA 1YTAA 3HXMA 3VQ7A 4BWJA 3QNNA 3RMAA 3SNNA 1EP4A 1S6QA 4OJRA 4E3SA 3T19A 1VRTA 2D5RA 1CXQA 3TAPA 4W5TA 1BI4A 4L8RB 3HYFA 1WAFA 4FJ8A 3QIOA 4IBNA 3PV8A 2G8IA 1T8EA 1RBTA 4CJKA 2DFHA 3M8RA 2ZD1A 1N6QA 1TL3A 4M3RA 3QEVA 4DQIA 1RBVA 4B9SA 2O4IA 4NYFA 4AH9A 3V9SA 3MXMA 1Z26A 2YNFA 4CF9A 4EP5A 3KK1A 3BDPA 4OLAA 2HHUA 3SYZA 4FM2A 3D45A 5E41A 4AHRA 4DTXA 3S3NA 3AVNA 4HCBA 2ATQA 5D3GA 4YNQA 1O1WA 2EHGA 1QTMA 4F2SA 4M41A 4AHTA 3OS1A 4CEZA 1WNSA 1SL1A 4FLTA 2HVHA 4I9LA 4KFBA 2ZE2A 3BGRA 1VSDA 1NK7A 1C0UA 1XWLA 2WOMA 3KJVA 2P5GA 3AVMA 3AVFA 2HNYA 3D0PA 1QHTA 4BE2A 2OPQA 3TABA 2Z1IA 4LH4A 2OPRA 1Q9YA 4CJPA 1XC9A 1QSLA 1BISA 1L3VA 1G15A 1KTQA 5C24A 4HUEA 4DLGA 4CGGA 4DQQA 3RWUA 4LSNA 3NF8A 4GVMA 2KW4A 3HJFA 2OYQA 3NH0A 2YV0X 4CHPA 3LP2A 5FROA 1ASWA 3DLRA 4CIFA 3V9WA 4OVLA 1S6PA 2YHAA 3DRSA
chains in the Genus database with same CATH superfamily
3VOVA 1NK9A 2Q97A 1P90A 2QKKA 1NKEA 3VA0A 1SL2A 2WC9A 4JD2B 5C10A 4R79A 5CHIA 3TWHA 4JI3K 4RCHA 1G99A 4NCGA 4KO0A 1LWEA 5CE3A 4QS9A 3KK7A 4H5WA 3QICA 3GDQA 3J7ZO 1RDDA 3LDQA 4AM7A 1TYQB 4FJGA 4H5NA 1JCGA 3AAPA 1K8AO 5FPNA 4FZXC 4LSLA 1E3MA 4IZ9A 4JKGA 3UKRA 3MEDA 1U2VA 4N5SA 5CYMA 3LP0A 2IC3A 4BG8A 3VEYA 4CZIA 4ISEA 3CCVN 1B9DA 5M1QA 2Z1HA 2PFUA 3SCXA 1SL0A 1NGCA 2EWSA 1C6VA 4CJ5A 3OYDA 3G4SN 1W2BM 4W5OA 4DV4K 4J2DA 1J54A 4DR3K 4YOUA 2V52B 3KWIA 3SQ1A 1Q9XA 4JI4K 5E84A 2BE2A 3L2WA 1JLQA 2E8AA 3TSQA 1YAGA 5C42A 3H1VX 3KLFA 3OYHA 2GUIA 1VQ4N 3O9RA 1DKGD 1Z6RA 3I55N 1OH5A 2XRIA 4KHYA 3BZCA 4ILJA 3J8AA 2Z1GA 1NK6A 3MAQA 3RMCA 3HRGA 4FOIA 4B3OA 4I2QA 3D2EA 1OH8A 3KK3A 3U3GA 5AQKA 1EXQA 4DUYK 4NB4A 3C94A 3OYGA 3FFIA 3R3LA 2WFBA 3C65A 1OH7A 2Z1JA 3JS6A 1HJOA 2YNIA 1OKJA 1NK4A 2BUPA 1L3UA 3HTVA 4IFVA 3IRXA 1WUAA 1VSEA 2D0AA 1QQMA 4WFNL 2O8FB 4CJ3A 4FJJA 3D2FA 2Q0UA 4KH6A 1S9GA 3CG7A 1VSKA 3O4WA 4WQ4C 1VQON 3F5TA 2BDPA 3CYMA 4DR1K 5KRSA 4DFJA 1ZBUA 4CHNA 3V1OA 4N56A 2E2PA 2HVIA 4LD0A 2ZGZA 3NE6A 4JI6K 3ZYYX 3ZX0A 4JK8A 4KTWA 4GY2B 4IO8A 4RWTA 3E9OA 3OVNA 4CBWA 3LPUA 4DU3A 2E6LA 1NBWA 2Q3SA 3MN5A 3M8SA 4CK3A 3AGRA 3THYA 3AVBA 3FZMA 3QINA 3HZ6A 3FGUA 2UYTA 3GOIA 2B6AA 4XIUA 4DQPA 2FSNA 4FLWA 4A2BA 4IJAA 3QEIA 1YI2N 4JS4A 4B3RK 1D5AA 3AAQA 3R8EA 1VRUA 1M1KO 2VQEK 2HB5A 4RTFD 5AQTA 3U3YA 2Y1IA 4ELTA 1NJYA 4CERA 4M3YA 5CZ1A 3SI6A 1HNVA 1ZYQA 1HYVA 1YT3A 3K0SA 3AVCA 3OYNA 3M5RA 4M3ZA 3ID6A 2RN2A 1IO2A 3SPZA 1JLEA 1U4BA 4O0IA 5ADXA 3CCJN 4FYDA 4KKOA 4CGFA 2XY8A 2G8UA 2RHKA 2KKZA 4CJSA 3KLHA 3HOTA 4O0JA 4O4GA 3AGKA 1SAZA 3CM6A 4E1JA 1RTIA 2NRWA 3AVIA 1KXPA 1VSFA 2DPNA 1W97L 3ZCMA 2P9SA 1NNEA 1RT4A 4CJQA 4BR4A 2ITMA 2PYJA 2X6NA 4AM6A 3TAQA 1WLJA 3BZKA 4FWRA 1DLOA 2FLOA 4NLBA 2VYPA 1JCFA 4MDAA 5JICA 3KZBA 3VQ6A 3OYFA 3QEWA 5I3UA 5AQGA 4E19A 1UA1A 4M3WA 5KTQA 2E88A 3LWMA 2ZQBA 4FO0A 1T05A 2KZZA 1VQKN 2F9WA 4NO7A 1LOTB 2P9IA 4QOZB 5AQHA 2P9KA 1YVNA 2ZF5O 5CZ2A 3H08A 5H1SQ 3PIOL 3IFRA 3K5MA 5AQYA 3OYLA 1K9MO 1BG3A 4FJ9A 3NCIA 2HBMA 5HRPA 3CJCA 3V1RA 1XMOK 3L4QA 5BRDA 5DMRA 4KHPK 1HKGA 3PX6A 4JV5K 1X3NA 3IMXA 4DHYA 3QBXA 4CJRA 1BI4B 1EX4A 4FJLA 3NHGA 2B4JA 2JWLA 4DR5K 3MCPA 4C8LA 4FJNA 4MLEA 3RR8A 1FXXA 1C1AA 3VPZA 2D4WA 1HJRA 3AO3A 4CGJA 5KRTA 3TAGA 3DLBA 4A5BA 4IOCL 2W40A 4CZFA 3SMSA 4JI0K 1JCEA 2E2QA 5BPMA 4WFBL 1EWRA 3CM5A 1S1XA 1XHXA 2NRHA 2W42A 1VQLN 5HOOA 1HMVA 1NOZA 1LWFA 2HNZA 4XH5A 4AILC 4RW7A 5HROA 4BRAA 5DM7L 1GLAG 1HNIA 3D7EO 3E01A 3P5JA 5GAHP 2QKBA 2VG7A 1KAZA 5AR0A 2GEMA 3MEEA 5KPZA 2IDOA 1L3SA 3U4LA 4JNEA 2CGJA 2O4GA 3CJ7A 1WSJA 1W0HA 1CZ9A 4FOEA 1SKWA 4CGHA 1QS4A 5LMUK 2NZTA 1BGXT 4IDKA 4DMNA 2KZMA 4Q0BA 1YUWA 2HBLA 2P9NA 3MXIA 5FRNA 4A57A 2Y1JA 4B3MK 5TKYA 3KD1E 5HRRA 4IO9L 3AO1A 2QXLA 4DTSA 1LAVA 3ZSVA 4FLVA 4IFEA 3NH2A 1HRHA 3T1AA 3LDPA 4LF6K 4JKCA 2RF2A 3SQ4A 1N33K 3VQ9A 4JI2K 1YF5L 3CFPA 1REVA 1JL1A 1WSEA 1QQCA 4QCLA 3RMAA 4BQLA 3R1XA 3SNNA 1S6QA 3T19A 3L0QA 4W5TA 4L8RB 1IG8A 4FJ8A 3I33A 4YDUA 3I56N 2ZD1A 3CMEN 1TL3A 3C6AA 3UKUB 1T3VA 4JHDA 3ULEB 4FM2A 4DTXA 4JN4A 3TTFA 3CCEN 4HCBA 4C1NI 3WXIA 2P9LB 3KHYA 2PBDA 3OS1A 5FPEA 1SL1A 4JKBA 3P38A 1R59O 4BRKA 1VSDA 3ATVA 2OPQA 3T1YK 3TABA 2Z1IA 4JKEA 4LH4A 1G15A 3RWUA 1GLCG 4LSNA 4GVMA 2YJFA 1GLJO 3ENBA 2YV0X 5FROA 4KH5A 1ASWA 3CIPA 4OVLA 1S6PA 2YHAA 3DRSA 3SUQA 3J7AP 3M8PA 1OVYA 3BUZB 3K5OA 2XHBA 4M3XA 4AF1A 1JLAA 3QEPA 1QZ6A 3WNHA 3QO9A 1WB9A 2FBVA 3KLEA 1E4GT 3AY9A 1K6YA 4CK2A 5EVZA 3THXA 4CGDA 3A5MC 4OKEA 3AVKA 2D0PA 3LWLA 3LAKA 2FBXA 3SAFA 3B6PA 5AQLA 3N4PA 5AQWA 3P31A 4EAHD 2UUCK 2OZMA 1CZBA 4OO1J 5DK5A 4B9QA 4BACA 3A5OC 1ATNA 4IXCA 1K73O 4CZMA 4PQUA 3G6EN 1NU0A 4ICLA 3CF5L 4PL8A 4ILGB 1X3MA 2FSJA 3VF2A 4FZZA 1MU2A 5JMVA 3AA4A 4I6MB 3CD6N 1FK9A 3B8AX 2JGUA 3HP6A 4GMJB 1WSGA 1C1BA 2IAJA 3ZT0A 1IG9A 3ATUA 4H0YB 4CECA 3CETA 4E1NA 2AP1A 4FWKA 4DUZK 4CBXA 3MX5A 4IJNA 4KI6A 2LSNA 4ZTFA 3OYCA 4IFYA 3PUFA 3SBTA 3SV3A 3N4QA 1YJWN 4DCHA 3OY9A 1DEJA 1B92A 1J5OA 3QLHA 4X66K 2PAVA 2H3GX 4LF9K 4OGCA 4BDZA 2G8VA 2YI1A 4B08A 4BRMA 4RW8A 3ZETA 2V7ZA 3U9DA 4CF0A 1KSPA 3AO2A 4M45A 3O3FA 2D0CA 5FPDA 1X9SA 3PSIA 2G8KA 3O9TA 3U6FA 4F4KA 2E1YA 4X64K 3LDOA 1UOCA 2OA8A 1DTQA 3ITHA 3FZHA 3AO4A 2QM1A 4B1YB 1BA0A 3NH1A 1HKCA 5GAEP 3C0BA 4DQSA 4DTNA 2NLXA 4KTQA 3RMDA 4E7LA 3AA3A 3WXLA 2O8BA 5AQOA 3HP9A 4PKGA 3FLCO 3SJHA 1Q18A 2DFFA 4C23A 4E7KA 3K9JA 1S1WA 4CJLA 1GLDG 1LAWA 4DS5A 2BGGA 2QWMA 4FLYA 3FE1A 3QFPA 1SUQA 2VG5A 4CF1A 3EO3A 3C6TA 4A2AA 3UB5A 5BREA 3SUNA 3AVHA 4DFKA 1TVRA 4DFMA 4GW6A 4M63C 2P9UB 2P9PA 4OX9K 2VGNA 3CPEA 4J2AA 3SBGA 5AZJB 3HT3A 2Q0RA 4CZEA 4IG3A 3K2PA 5EXWA 4CHYA 4BR7A 1RTDA 1Z05A 3AV9A 1NGIA 4ID1A 4XEIA 4NXNK 3O8MA 2DTUA 2W41A 2QK9A 4HUGA 4EFHA 3TI0A 3KTQA 3L3VA 3KD5E 3E9LA 3A5NC 3CFOA 4DV2K 4C8OA 4DTRA 3IAYA 3WEEA 4UY8O 3HPHA 2OTLN 4HWIA 3P4IA 4B8AB 4BDYA 5JLFA 3TR8A 3RRGA 1T6DA 5BR9A 1QVGM 3CJ9A 3K58A 2QXFA 3VQQA 3ZX3A 1YHQN 4EHTA 3ZLJA 3HBTA 2PYLA 1OVQA 3DXMA 4JK7A 3BEXA 4DTPA 2HNDA 3LZIA 5JVHL 2F4VK 3G71N 4IEIA 1R0AA 3VEXA 2YX6A 3DXKA 4JRPA 1XI1A 4A62A 1TUUA 4PWDA 2KQ2A 1EQYA 1A5XA 5AQJA 5AZIB 1TK8A 3LZJA 2YNHA 3LP1A 5BRFA 4YFUA 4BWMA 4FZYA 2QA4N 5BN9A 3K59A 1IBKK 1VSHA 2WBNA 4H4MA 4K42A 1KFSA 5M1FA 1C0MA 2X74A 2BH1A 3QFUA 3DWLA 3H46O 1YTUA 4FXDA 3RR7A 1GLLO 1ASVA 4CEDA 4DFPA 4CBUA 5M1PA 5IT9O 1QSYA 3WXKA 2ETJA 1VQ6N 3KWGA 5FDLA 4JS5A 3PX0A 3LDNA 2I7PA 4DKWA 4CESA 3QBWA 4B1ZA 3VQ5A 3ZEUB 4BRHA 3HSTB 3VEVA 4O55A 2RE2A 5HRNA 3ASMA 4CJ7A 1D9DA 3O1WA 3NVMA 1K8KB 4DTJA 2IS3A 4K8ZA 4H0TB 1IBLK 5FLXO 5AQPA 3ZSOA 1DGKN 3MWPA 1KFDA 3IUCA 1LWCA 2A40A 1EKEA 3VN5A 2O8EA 2W6KA 3THVA 3E1YA 3ZSXA 1IH7A 1LW2A 3H3NO 3V9XA 4LH5A 2IVOA 3EZ5A 2WUSA 3I8DA 5GIOA 4GNIA 4K41A 4KHUA 2QTDA 3TAFA 2WONA 1W9HA 2FBTA 1VQMN 2IIRA 1IKXA 3CQYA 4MO5A 2QWQA 3ZSYA 3HPGA 4W5RA 4CD1A 1VQNN 1NGGA 4YY3K 4DSIA 3AVJA 1ILYA 4W5NA 5AFUH 1BQNA 5FPMA 4NXMK 4J8FA 3SK3A 1GOCA 4LC9B 3DLHA 2HHHK 3C7NB 2E2OA 5CY4A 1XHZA 3EE9A 1JL2A 4CW7B 5HP1A 1HNZK 4KHNA 4FK4A 4FLZA 2X6SA 2FC0A 3UIQA 2A1SA 4KHSA 1CZAN 1I3AA 1NGDA 5AQVA 1WN7A 3VQDA 1VSJA 4OPJA 1NM1A 1E4FT 1ATSA 3L2QA 4BE0A 3MX2A 3SUPA 5IWAK 2YHYA 3F2KA 3ID8A 1TKXA 3NF7A 1VQ9N 4FPBA 4X65K 4B1UB 2UXDK 2I7NA 3U9ZA 5MLCQ 2HBKA 3OJUA 4HUFA 3F9KA 1QHAA 5JVGL 1VSMA 2GBZA 3I0RA 5M1KA 4BY9C 1S1UA 1C0TA 3CQXA 3ENHA 4YOWA 1IKYA 2HHTA 3VQAA 3MECA 1CXUA 1JLCA 1JLFA 5CR4A 5LY3A 2OPSA 2WTUA 5JS1A 1U48A 1XNQK 5GIPA 1BL3A 3Q7CA 4JKGB 3UKRB 1FW6A 1I39A 1U2VB 3H1QA 4YOVA 3OYJA 3NGIA 4FWSA 3WQUA 3P83D 1RCHA 4N76A 3GE1A 4FJIA 4N41A 2GWJA 5F1XA 2OZSA 3UKUA 4YHHK 2V7YA 2A1RA 1JKHA 4X62K 1I94K 4PKIA 1NGAA 4JI1K 3HXMA 3QNNA 3TU5A 1MA9B 4OPAA 4H5TA 4E3SA 3G25A 2D5RA 3QIOA 2G8IA 1Q86O 1S72N 2DFHA 4FSVA 4BREA 2ASMA 4DQIA 4KH4A 4B9SA 2O4IA 3J7YP 4NYFA 3MXMA 1Z26A 2YNFA 1IV0A 2ZWHA 4OLAA 1Q82O 4IOXA 3AVNA 4YNQA 1O1WA 2EHGA 4AHTA 3D2EB 4KFBA 3BGRA 3RSEA 4BGAA 2P5GA 3KJVA 3AVFA 4BE2A 3W3DA 4CJPA 1XC9A 1QSLA 1BISA 4QS7A 4IWVA 5C24A 3O5BA 4DQQA 3HJFA 2OYQA 3LP2A 2YHWA 4CIFA 4GV3A 5AQZA 3DRPA 4Z4HA 3THWA 3OS0A 2QWNA 4CJWA 3CI5A 4I2PA 3D2FB 3MK6A 4F8RA 3VQEA 3S3MA 4F3TA 1RT5A 2KLAA 4WF9L 1NKCA 1BHLA 1EO1A 2IGIA 4B1XB 2BANA 5AJ3K 3VENA 4RW4A 1W7AA 5T7BA 4DV1K 1QZ5A 1TK5A 1XUPO 3EYZA 1ITGA 3VA3A 1A5WA 1BU6O 3OW2M 1DTTA 1GLEG 2UU9K 3O9SA 3WQTA 1Q81O 5LJVA 3VGKA 1VK0A 2HSTA 4FLXA 2G8FA 3LAMA 5M1NA 4WFAL 3L2RA 1RDBA 1X1PA 3THYB 2O8CB 1T03A 4O8UA 2F96A 4Y0WA 1VQ7N 4Z0UA 3VQBA 4ELUA 3WNFA 4EP4A 3KLIA 4BR0A 3DLKA 3PIPL 4DSEA 4J2EA 4CK1A 4CF8A 1EWQA 4H5VA 2ZGYA 4JKFA 1WSIA 4J2BA 2ASPA 4F9OA 4B9MA 4FJMA 1NG9A 5BRHA 3NDKA 4H0OA 3VEZA 1WBBA 1N32K 4C8NA 3D6RA 4B8CA 1JXBA 4FL9A 1S5JA 4GKKK 1TK0A 4LF8K 1RTHA 2YCHA 4B9TA 4WQ5A 3QETA 3LM2A 2HHXA 4DS4A 3S9HA 4DV5K 4DU1A 3CJBA 2E5LK 4JKAA 1RBSA 2GWKA 2HF3A 4H0VB 2P9SB 1ZBLA 4QAGA 1LV5A 1LW0A 3LPTA 3R6MA 4BR2A 5B8HA 1RBUA 3VTIA 2OPPA 4BDPA 1YIJN 5JLHA 1B9FA 4ZTJA 4M3TA 4JD2A 1JLBA 3BP8A 3CCQN 3OJSA 2PZSA 4E89A 5AQXA 3V9ZA 4HTLA 1L5UA 3DMJA 4JLHA 4KB1A 3HO1A 4KRFA 3DI6A 2E6MA 1TYQA 3G10A 2HHVA 3PO4A 1BQMA 4B9NA 3K57A 5J2PA 2P9IB 3HM9A 2ZJRL 2P9KB 2ZJQL 4CJ4A 3IG1A 3M6GA 4GV9A 3MEGA 1UWBA 4DG1A 1GOBA 1NGHA 4AHVA 3CCUN 3R9PA 4LF5K 3IDHA 1BUPA 1RBRA 4FWNA 4BG9A 1KAXA 4LF4K 2D1KA 3AARA 3ALYA 3V1QA 1YXQA 4NCBA 1NGFA 1VAZA 4K25A 3OBWA 4O5BA 4DR4K 4A59A 5AQUA 4BR5A 1N5YA 3HK2A 1F21A 5BR8K 2GUPA 3KVGA 3CCMN 3E9PA 2HHSA 4K0KK 3MMVA 1L3TA 5FRMA 4O8KA 1O13A 3QNOA 4DTOA 2F7TA 2Q1NA 4Z4GA 3CC7N 3B6OA 3I8BA 4RG8A 1EETA 3ZSWA 3OYKA 3LM9A 4CEBA 3OYBA 4DWIA 4CJUA 1QVFM 3SQ2A 1BIZA 4HCCA 3A5LC 5J2QA 3EL2A 3O9QA 1HPZA 4A5AA 2Q2RA 3EE8A 2F8SA 2KTQA 3AA5X 4IDHA 4YORA 2A3ZA 1ESVA 3VQ8A 1YJNN 3NVKA 1NJXA 1TV6A 3EKSA 4IG0A 4IKFA 3AVAA 3NAEA 4KV8A 3FFKB 1KVBA 1HQUA 2HBJA 3NGYA 3ZEUA 2O8FA 4DV7K 4H5RA 4OGEA 4CEQA 1HYSA 4NLCA 2A42A 2IOCA 4CEAA 3MN9A 4Z4IA 1UAXA 2P9NB 4Z4CA 4K43A 3JYTA 3VMFB 4I9QA 4CFDA 4DV6K 3LALA 5BPLA 4FK0A 2UUAK 4AHSA 4RW6A 4CJTA 1JXEA 1NJZA 1WBDA 4FJKA 4K8XA 2GTDA 1X9JA 3OTOK 1TKTA 4E7HA 3MXJA 4G9ZA 2O8DB 1OH6A 5E26A 3ZSQA 3ZT2A 3M1FA 3CQ8A 3ZSRA 1BIUA 5HRSA 4Z4FA 3LDLA 3WXJA 1VQ5N 3QEXA 1JLGA 3W0LA 4Z94A 2XY7A 3L4IA 3VTHA 2I5JA 4JEPA 4V19S 1T7PA 4DR7K 5ADXH 5EU7A 2HMIA 2R7YA 5EX5A 1NK8A 4CIGA 3KK2A 3WNGA 4C8KA 3EZWA 3KLGA 4CZGA 4H0PA 1N36K 3QERA 2A41A 2NNWA 3QESA 1NGJA 3TSUA 4DSFA 4JHDB 1VQPN 1S1TA 5KGWA 4LF7K 3CHWA 3C6HA 1CLQA 2FBYA 2XY5A 4KREA 3VEWA 3HVRA 3JSMA 1FKPA 5C25A 3V4IA 5C12A 3C6UA 2YJEA 3F9MA 4DTMA 3P39A 3U8XA 1BCMA 1XC3A 2P1JA 4FK2A 2A6AA 3NBPA 5F2RA 2NRRA 4CGIA 3QB0A 2AJQA 4ZHRA 4FJXA 4KPYA 3K5NA 1NMNA 4CEOA 4AHUA 4C8MA 1ASUA 4FLUA 4N47A 1BWFO 4CFAA 2ZJPL 3L2VA 1TAQA 3ZT1A 3TAMA 3ZSZA 2VG6A 3GBTA 4WCEL 3S3OA 4XH1A 1J5EK 3THXB 1RDUA 4JK9A 1Y97A 3JAMO 5AQRA 4H0XB 4CZKA 4DR6K 5SZTA 4FJ5A 3VGMA 4CHZA 3CERA 1ZBIA 5SWMA 1XNRK 3DOLA 3T3FA 4Y1CA 4WQ4A 2HMPA 1XMQK 4PHTX 4PUOA 2QW9A 1ZBFA 5KPTA 4KBOA 2NUBA 4KI4A 5AQNA 1KVAA 4DB3A 4EHUA 3OA9A 1VSLA 1U45A 1FJGK 4FW1A 1V4TA 2G8HA 4OKKA 1ZBSA 4HTUA 4BWJA 1EP4A 2D0OA 4OJRA 5ELZA 1CXQA 1BI4A 1WAFA 2OCEA 4IBNA 3S41A 3ZX2A 2HF4A 3PV8A 1T8EA 3VGLA 3VESA 3M8RA 1N6QA 3QEVA 3TTDA 1BO5O 4WYBA 2BTFA 4XH4A 4BRCA 4CD3A 3V9SA 4YOXA 3KK1A 4EP5A 3SLCA 1XQSC 5E41A 4H03B 5BN8A 3S3NA 1C0GA 4LFBK 1QTMA 4F2SA 4CEZA 4FLTA 3ZETB 1YJ9N 2ZE2A 1NK7A 1C0UA 3HI0A 2F9TA 3AVMA 2HNYA 3D0PA 1QHTA 5LL6Z 1KC8O 2OPRA 1TUYA 4CI6A 4ILHA 5C15A 4HUEA 4U7BA 1HR0K 3NF8A 2IVNA 2HOEA 3V9WA 3IKMA 3C95A 1QQNA 1S9EA 1GOAA 5I9EB 1A5VA 4M7XA 3WUHA 1WAJA 4CE9A 1NMDA 3OYMA 1WSHA 2P51A 2A5XA 1ZBHA 2O8BB 4DV0K 4FM1A 2YKNA 1D9FA 3SQ0A 4BRFA 4QS8A 1HX1A 2OANA 5BPNA 2OTJN 3O4QA 5F0XA 2O8CA 3WXMB 5J1EA 4DTUA 3GL1A 4KAZA 1ATRA 3WT0A 3A2FA 4BC2A 3M8QA 1SKSA 5I42A 2DFEA 3DLEA 1RFQA 4DR2K 4W5QA 4MO4A 4A61A 3CPWM 3HM8A 4UQGA 3DOKA 5M1OA 1KD1O 4AHCA 3TANA 2JLEA 3V6DA 3OYEA 2P9PB 3SUOA 3CCLN 1RT1A 2EX3A 2D0BA 1U04A 4OPHA 1BA1A 1S1VA 3H3OB 4OLBA 4FWOA 4PY5A 3T1HK 4BQZA 4FW2A 4CVNE 3AO5A 2NRZA 1WSFA 3VQCA 2E20A 4OPKA 3VF4A 4M7YA 4DF8A 1RDWX 2QWPA 3WEEB 1Z25A 1BOTO 4PA1A 4CHQA 2X78A 3MN7A 4BE1A 3BF1A 3TPQA 1ZC6A 1RGIA 3DAWA 4ID5A 4Z4EA 1NJWA 3ULEA 4LFAK 4E1MA 4EZ9A 5C2FA 3GG4A 1QE1A 3TARA 2G8WA 3BF3A 1RNHA 2P9LA 3DXMB 2CGKA 2E2NA 4IEEA 1NK0A 1HNWK 4FWPA 1NKBA 3JXUA 4H8KA 3DXKB 3EKUA 4R5PA 4DSLA 4HVJA 1QSSA 3SJJA 5EY4A 1VSIA 1HNXK 2VWJA 1RTJA 1RT6A 1VHXA 1X9WA 4OKJA 3VETA 3RVCA 1N8RO 1S3XA 3L3UA 3OYAA 4WE1A 3O4NA 3CCSN 5J2MA 4JKDA 1KQSM 4F2RA 1BDGA 1J53A 1HLUA 1ZXOA 3CCRN 4M42A 3RTVA 2GV9A 2J4RA 3ZT4A 1RT3A 2QWOA 4BRQA 3FR0A 5AQIA 4BRNA 2QI2A 3L2UA 4JI8K 4BGBA 3AVGA 2YHBA 4BC4A 4HHTA 4LY7A 1WOQA 5DM6L 4CZLA 3HPOA 2VWBA 3EY1A 4DQRA 4CCHA 3EN9A 2HW3A 4CZHA 4GKJK 3O80A 2HHWA 5AQSA 4FWMA 1KAYA 2P5OA 3O08A 5CYQA 1NWKA 2B5JA 1SKRA 2Q31A 1IKWA 4GVEA 4B1WB 1KVCA 5KI6A 1RT2A 4E0DA 4MFBA 1NJIO 2XY6A 4DV3K 3PO5A 1TAUA 2O8EB 2RKIA 3O6WA 4NYNA 4I6MA 1V4SA 4KHWA 1HPMA 3NF9A 1IJJA 1J9AA 1QQOA 5EOYA 3TSPA 4C1NK 4CEFA 3NFAA 5AQMA 3TAEA 2FF6A 3UE5A 1NK5A 4O5FA 3VQPA 2QWRA 3O1BA 3VF6A 3FZFA 2UXBK 5C2DA 4GV6A 1C0FA 1RT7A 3T7ZA 1VQ8N 3SMPA 3PLAA 4JI7K 4G1QA 2QWLA 2XO7A 1Q7YO 3DLLL 3I0SA 2ZM6K 4H4OA 4CJEA 5HL7L 3OS2A 2UUBK 2E4LA 5C0YA 3L8BA 2VCPA 4KTZA 1HUXA 1T6CA 3MDQA 4CHOA 4B3TK 2NRTA 3KIOA 3IS9A 4DF4A 4CEEA 4EIAA 4CIEA 4DSKA 3QMLA 4ISFA 3RRHA 3OYIA 3O9UA 4YOTA 5JS2A 2KFNA 4MQ3A 5AFUA 2IVPA 2F8TA 3VEOA 4Y1DA 3NGZA 4DSJA 1U47A 3CFRA 2KHOA 3PY8A 3P1GA 1C1CA 2YNGA 4Q5VA 1TL1A 2CGLA 3T69A 4EZ6A 3SAHA 2VGMA 1KCFA 3PX4A 2O8DA 4ISGA 4FJ7A 3HOSA 1TKZA 2ASOA 3J81O 3M3ZA 1U49A 3L6QA 2VQFK 1BCOA 3ENOA 2NRVA 3VQ4A 5LJWA 1N34K 5A2QO 4CF2A 1YVUA 2QEXN 3O3HA 3TTCA 4FM0A 1KLMA 4FVMA 5HLFA 3CC2N 4M3UA 2KFZA 3LP3A 3SV4A 3DYAA 3Q7BA 4AQYK 2W6LA 4ELVA 1SS6A 3KKRA 4FVUA 2P9UA 4B9UA 5AZJA 1S22A 3K5LA 4BR9A 4FWQA 3CXCM 4B9VA 4E7IA 2YKMA 5GAGP 3OHRA 4CZJA 3SPYA 2CH5A 4DQ8A 4BVPA 1SV5A 3HL8A 4KB0A 3A0IX 3HSCA 1JJ2M 4JYAK 4BRIA 1IKVA 3VERA 1TKDA 4JI5K 1X9MA 4PKHA 3G0ZA 4CJFA 4WQ5C 2E1ZA 3WNEA 1UA0A 3MWTA 1MWKA 4RW9A 1NGBA 3MCAB 4BRPA 1Y64A 4YDUC 4B1VA 1NLVA 3RSEB 2ITGA 3CJAA 4FCYA 5KGXA 5KQ8A 4BRGA 4FJHA 3O3GA 2AA4A 1FKOA 3NF6A 2PY5A 3CJ1A 3DRRA 4E7JA 1HYZA 3ISNC 4BC5A 3A8YA 3HVTA 1HQEA 3V81A 5TKWA 4F3OA 4LFCK 4DU4A 2FSKA 1GLBG 3ZT3A 2CH6A 1J6ZA 3F73A 3BY5A 5J2NA 4IOAL 4NCAA 3NMUA 5AZIA 3THWB 3J80O 2HHQA 1U6ZA 3OBYA 1IBMK 3FZLA 3FZKA 1H1VA 4FWLA 4B3SK 1KLNA 5KPRA 3SAGA 1TGOA 1NOYA 3CC4N 4JRQA 4U67L 5GINA 3DM2A 4KHQA 1T44A 1P8ZA 2NRXA 3AA2A 3QIPA 2FF3B 4MLHA 1RDAA 1RDCA 2YHXA 4CFCA 4BVOA 4BRDA 4JKHA 4BROA 1Q8IA 2UXCK 2DY4A 3RMBA 3DLGA 4CJVA 1KRPA 4BC3A 4TSXA 3H6EA 4BRLA 2VWKA 3LDSA 4O44A 4B9LA 5K14A 1K8KA 3AVLA 5KQDA 3LL3A 1DT9A 4FPAA 1MDUB 1D8YA 4MDBA 1YITN 4DLEA 4I7FA 3KKSA 3LANA 3V9UA 1RILA 2RPIA 3ULDA 1GLFO 2V51B 1NGEA 3SZ2A 5HBMA 1YTAA 3H45C 3VQ7A 1MWMA 3DJCA 1VRTA 3TAPA 3HYFA 4L3QA 3MN6A 1RBTA 4CJKA 5LMNK 4M3RA 1RBVA 2FXUA 3E66A 4AH9A 5GADP 4CF9A 3CMAN 2HHUA 2GELA 3BDPA 3SYZA 3D45A 4AHRA 2Q36A 2ATQA 5D3GA 4M41A 1WNSA 1SQKA 3C7NA 2HVHA 4I9LA 3PSFA 2GX9A 2JWKA 1XWLA 2WOMA 1LCUA 1M90O 1Q9YA 4PL7A 1L3VA 1KTQA 1HKBA 4DLGA 5AQFA 4CGGA 2KW4A 3NH0A 1D4XA 3EEQA 4CHPA 3DLRA 3K9KA 1SZ2A 4JAXA 3QDKA 5AQQA 4CFBA 4YOYA
chains in the Genus database with same CATH topology
3DRPA 1S9EA 1GOAA 1NK9A 3SUQA 3M8PA 3K5OA 4Z4HA 1A5VA 2XHBA 3VA0A 1NKEA 1WAJA 4CE9A 1SL2A 2QKKA 3OS0A 4M3XA 1JLAA 1WSHA 2P51A 3OYMA 3TWHA 3QEPA 4CJWA 3WNHA 4I2PA 4NCGA 3QO9A 4KO0A 1LWEA 1ZBHA 2FBVA 3KLEA 4FM1A 2YKNA 1D9FA 3SQ0A 3VQEA 1K6YA 4CK2A 3S3MA 4F8RA 4F3TA 1RT5A 4CGDA 1NKCA 4OKEA 1BHLA 1RDDA 3AVKA 2IGIA 3O4QA 3LWLA 3LAKA 2BANA 5J1EA 2FBXA 4RW4A 4DTUA 3B6PA 5T7BA 4KAZA 3A2FA 1TK5A 3M8QA 4FJGA 1SKSA 2OZMA 5I42A 2DFEA 1CZBA 1ITGA 3DLEA 3EYZA 3VA3A 1A5WA 4W5QA 5DK5A 1DTTA 4LSLA 4FZXC 3MEDA 4N5SA 5CYMA 3LP0A 4UQGA 2IC3A 4BACA 3DOKA 4PQUA 4AHCA 1B9DA 1VK0A 2Z1HA 2JLEA 4FLXA 4ICLA 3V6DA 3TANA 2G8FA 3LAMA 3OYEA 3SUOA 3L2RA 1RDBA 1RT1A 1X1PA 3SCXA 1T03A 1SL0A 2EX3A 2D0BA 1U04A 2F96A 1S1VA 4FZZA 1MU2A 4OLBA 3AA4A 1C6VA 4CJ5A 1FK9A 3OYDA 4Z0UA 4PY5A 4W5OA 2JGUA 3HP6A 4GMJB 3VQBA 4J2DA 1J54A 1WSGA 4FW2A 4ELUA 1C1BA 2IAJA 3AO5A 3ZT0A 3WNFA 1IG9A 3SQ1A 4EP4A 4CECA 1Q9XA 1WSFA 3KLIA 3VQCA 3DLKA 2BE2A 4E1NA 3L2WA 4OPKA 1JLQA 4DSEA 4DF8A 4J2EA 4CK1A 4CF8A 4KI6A 1WSIA 2LSNA 5C42A 1Z25A 3KLFA 4ZTFA 3OYCA 3OYHA 2GUIA 4IFYA 4J2BA 3PUFA 4B9MA 4FJMA 4PA1A 4CHQA 2X78A 4BE1A 3NDKA 3SV3A 3OY9A 2XRIA 4KHYA 4ID5A 1B92A 2Z1GA 4C8NA 1J5OA 4B8CA 1NJWA 4FK2A 4Z4EA 1JXBA 3QLHA 4E1MA 4EZ9A 1S5JA 1QE1A 1TK0A 3TARA 1NK6A 2G8WA 1RTHA 1RNHA 3MAQA 3RMCA 4OGCA 4BDZA 4B9TA 2G8VA 4B08A 4B3OA 3QETA 4I2QA 1NK0A 4RW8A 3KK3A 1NKBA 3U3GA 2HHXA 4CF0A 1EXQA 4DS4A 1KSPA 4H8KA 3S9HA 3AO2A 4DU1A 4R5PA 3C94A 4M45A 3O3FA 4DSLA 1RBSA 3OYGA 2D0CA 3FFIA 4HVJA 1X9SA 1QSSA 3SJJA 2G8KA 2Z1JA 3U6FA 1VSIA 1ZBLA 4F4KA 2OA8A 2VWJA 1UOCA 2YNIA 4QAGA 1DTQA 3ITHA 1LW0A 1NK4A 3AO4A 1RTJA 1LV5A 3LPTA 1L3UA 1RBUA 1RT6A 4IFVA 1X9WA 2OPPA 4BDPA 3IRXA 4OKJA 1B9FA 1VSEA 3NH1A 4ZTJA 2D0AA 4DQSA 4M3TA 4DTNA 4KTQA 1JLBA 3L3UA 3OYAA 4WE1A 3O4NA 3OJSA 3RMDA 2PZSA 5J2MA 4CJ3A 4E89A 4FJJA 4F2RA 3V9ZA 4E7LA 3AA3A 1J53A 4M42A 1L5UA 3RTVA 2GV9A 1S9GA 3ZT4A 3DMJA 3CG7A 1RT3A 3HP9A 4JLHA 1VSKA 2DFFA 4E7KA 4KB1A 1S1WA 2BDPA 3CYMA 3L2UA 3HO1A 4KRFA 3DI6A 4CJLA 2E6MA 1LAWA 3AVGA 2YHBA 4HHTA 4DS5A 3G10A 5KRSA 4DFJA 4LY7A 2BGGA 1ZBUA 4CHNA 3V1OA 4N56A 3HPOA 2HHVA 2HVIA 3PO4A 1BQMA 3EY1A 4FLYA 4DQRA 3K57A 4LD0A 5J2PA 4B9NA 3HM9A 4CCHA 2HW3A 1SUQA 3NE6A 2VG5A 4CF1A 4CJ4A 3IG1A 2HHWA 3C6TA 3MEGA 2P5OA 1UWBA 4DG1A 5CYQA 1GOBA 2B5JA 4KTWA 3SUNA 3AVHA 1SKRA 4AHVA 4DFKA 1IKWA 1TVRA 4DFMA 3OVNA 3LPUA 4DU3A 1RBRA 4GW6A 2E6LA 2Q3SA 3M8SA 1KVCA 4CK3A 3ALYA 1RT2A 5KI6A 3V1QA 4NCBA 4E0DA 4MFBA 3AVBA 4J2AA 3HT3A 3QINA 2XY6A 3PO5A 4XIUA 2B6AA 4DQPA 1TAUA 4O5BA 2RKIA 4NYNA 4KHWA 4IG3A 3K2PA 3NF9A 1N5YA 1J9AA 4CHYA 4CEFA 1F21A 4FLWA 3NFAA 3QEIA 3TAEA 1RTDA 3HK2A 4JS4A 3AV9A 1D5AA 1NK5A 2HHSA 3VQPA 4ID1A 2DTUA 1VRUA 2QK9A 4HUGA 2HB5A 3TI0A 3KTQA 1L3TA 3L3VA 3U3YA 3KD5E 5FRMA 1RT7A 2Y1IA 4ELTA 3CFOA 1NJYA 4C8OA 4CERA 4M3YA 3QNOA 4DTRA 4DTOA 5CZ1A 3IAYA 4G1QA 3HPHA 4Z4GA 3SI6A 3B6OA 1HNVA 2XO7A 1ZYQA 1HYVA 1YT3A 4B8AB 4BDYA 3AVCA 4RG8A 1EETA 3ZSWA 3OYNA 3TR8A 3I0SA 3OYKA 3RRGA 4M3ZA 4CEBA 4H4OA 4CJEA 3OS2A 2E4LA 2RN2A 1IO2A 3OYBA 3K58A 4CJUA 3SPZA 2QXFA 4DWIA 3SQ2A 1BIZA 1JLEA 1U4BA 3VQQA 4O0IA 4KTZA 3L8BA 4FYDA 4HCCA 4CHOA 4KKOA 4CGFA 5J2QA 3KIOA 2XY8A 1HPZA 3IS9A 2G8UA 2PYLA 4DF4A 4DTPA 3KLHA 4CJSA 2F8SA 4O0JA 4O4GA 4CEEA 2KTQA 2HNDA 4CIEA 3LZIA 3AA5X 4DSKA 1R0AA 3CM6A 4JRPA 3RRHA 1RTIA 3OYIA 1XI1A 3AVIA 4PWDA 3VQ8A 4CFBA 1VSFA 2KQ2A 5JS2A 3ZCMA 2KFNA 1NJXA 1A5XA 4MQ3A 2F8TA 1TK8A 1TV6A 3LZJA 2YNHA 4Y1DA 1RT4A 3LP1A 4CJQA 4YFUA 4IG0A 4BWMA 3NGZA 4DSJA 3K59A 4FZYA 1U47A 3CFRA 2PYJA 4IKFA 2X6NA 3AVAA 1VSHA 3NAEA 3TAQA 4KV8A 4H4MA 3PY8A 1WLJA 1KFSA 3P1GA 1C1CA 2YNGA 1KVBA 1HQUA 3NGYA 4Q5VA 1TL1A 1C0MA 2X74A 1DLOA 1YTUA 4FXDA 3RR7A 4EZ6A 1ASVA 4OGEA 4CEDA 4CEQA 3VQ6A 1KCFA 3OYFA 3PX4A 4DFPA 1HYSA 3QEWA 2IOCA 4CEAA 4FJ7A 4Z4IA 1UAXA 5I3UA 4Z4CA 1TKZA 4E19A 1QSYA 2ETJA 1UA1A 3JYTA 5KTQA 4M3WA 5FDLA 3LWMA 1U49A 4CFDA 4I9QA 1BCOA 2ZQBA 1T05A 2KZZA 4JS5A 3PX0A 4CESA 3LALA 3VQ4A 4FK0A 4AHSA 4RW6A 4CJTA 1JXEA 1NJZA 3VQ5A 4CF2A 3HSTB 4QOZB 1YVUA 4FJKA 4K8XA 4O55A 3O3HA 5HRNA 3ASMA 4FM0A 1KLMA 4FVMA 1TKTA 5HLFA 4E7HA 1D9DA 5CZ2A 4M3UA 3MXJA 2KFZA 3LP3A 3H08A 4DTJA 2IS3A 3DYAA 3SV4A 4K8ZA 3ZSQA 3K5MA 3ZT2A 3OYLA 3CQ8A 3ZSRA 4ELVA 1BIUA 5HRSA 3KKRA 3ZSOA 4Z4FA 4FJ9A 3NCIA 5HRPA 1JLGA 3QEXA 4B9UA 1KFDA 3V1RA 2XY7A 1LWCA 3K5LA 5DMRA 2I5JA 1EKEA 4B9VA 3VN5A 4E7IA 1T7PA 2YKMA 3PX6A 3THVA 3ZSXA 5EU7A 2HMIA 2R7YA 4CJRA 3SPYA 1NK8A 1BI4B 1IH7A 1LW2A 3WNGA 4CIGA 3KK2A 3V9XA 4LH5A 1EX4A 3EZ5A 4FJLA 4C8KA 3I8DA 3KLGA 1SV5A 3HL8A 4KB0A 3NHGA 3QERA 4KHUA 3TAFA 2WONA 2B4JA 1W9HA 1IKVA 2FBTA 1TKDA 4FJNA 4C8LA 3QESA 1IKXA 1X9MA 4CJFA 3G0ZA 3ZSYA 4W5RA 3HPGA 4DSFA 3RR8A 4DSIA 3AVJA 1FXXA 3WNEA 1UA0A 1C1AA 1S1TA 5KGWA 1BQNA 4W5NA 1HJRA 3AO3A 4CGJA 5KRTA 4RW9A 3TAGA 3DLBA 2FBYA 1CLQA 1GOCA 2XY5A 3DLHA 4KREA 3HVRA 5CY4A 3JSMA 2ITGA 4FCYA 1XHZA 1FKPA 5C25A 5KGXA 3V4IA 1JL2A 5HP1A 3C6UA 3CM5A 4DTMA 4FJHA 4KHNA 3O3GA 4FK4A 1S1XA 1XHXA 2X6SA 1FKOA 3NF6A 4FLZA 2W42A 1BCMA 2FC0A 2P1JA 3DRRA 2A1SA 1HYZA 4E7JA 1HMVA 2PY5A 3UIQA 1NOZA 1I3AA 3ISNC 3NBPA 3HVTA 4KHSA 1WN7A 1HQEA 3VQDA 1VSJA 1LWFA 4CGIA 3V81A 4OPJA 2HNZA 2AJQA 4F3OA 4ZHRA 4DU4A 4FJXA 4AILC 4RW7A 3ZT3A 5HROA 4KPYA 3L2QA 1HNIA 3F73A 3K5NA 4BE0A 2QKBA 3E01A 3P5JA 4CEOA 5J2NA 3SUPA 2VG7A 4AHUA 4C8MA 4NCAA 1ASUA 4FLUA 1TKXA 3NF7A 4N47A 4CFAA 2HHQA 3MEEA 3L2VA 2IDOA 1L3SA 1TAQA 3ZT1A 3TAMA 3ZSZA 2O4GA 3OJUA 2VG6A 4HUFA 3F9KA 1WSJA 3S3OA 1W0HA 1KLNA 1CZ9A 1VSMA 2GBZA 1SKWA 3I0RA 1TGOA 4CGHA 1NOYA 1QS4A 1S1UA 1C0TA 1BGXT 4JRQA 1Y97A 4IDKA 3DM2A 4DMNA 4KHQA 2HHTA 1IKYA 4Q0BA 3VQAA 2KZMA 3MECA 3AA2A 1CXUA 1JLCA 1JLFA 3QIPA 3MXIA 5FRNA 1RDAA 2Y1JA 5SZTA 1RDCA 3KD1E 2OPSA 5HRRA 4CFCA 4FJ5A 1U48A 5JS1A 4CHZA 1ZBIA 5SWMA 1BL3A 1Q8IA 3AO1A 3C95A 1I39A 3DOLA 3T3FA 4DTSA 4Y1CA 2DY4A 3RMBA 3DLGA 4CJVA 3OYJA 1LAVA 3ZSVA 1KRPA 4FLVA 4TSXA 4PUOA 3NGIA 3NH2A 2VWKA 3LDSA 4O44A 1HRHA 4B9LA 5K14A 1ZBFA 3T1AA 3AVLA 2NUBA 1RCHA 3P83D 4N76A 2RF2A 3SQ4A 4KI4A 1D8YA 4FJIA 1KVAA 4N41A 4DLEA 4I7FA 3KKSA 3LANA 3VQ9A 1VSLA 3V9UA 2OZSA 1RILA 1U45A 2RPIA 3ULDA 2A1RA 4FW1A 2G8HA 3CFPA 1REVA 1JKHA 1JL1A 4OKKA 1WSEA 5HBMA 1QQCA 3SZ2A 4HTUA 4QCLA 1YTAA 3HXMA 3VQ7A 4BWJA 3QNNA 3RMAA 3SNNA 1EP4A 1S6QA 4OJRA 4E3SA 3T19A 1VRTA 2D5RA 1CXQA 3TAPA 4W5TA 1BI4A 4L8RB 3HYFA 1WAFA 4FJ8A 3QIOA 4IBNA 3PV8A 2G8IA 1T8EA 1RBTA 4CJKA 2DFHA 3M8RA 2ZD1A 1N6QA 1TL3A 4M3RA 3QEVA 4DQIA 1RBVA 4B9SA 2O4IA 4NYFA 4AH9A 3V9SA 3MXMA 1Z26A 2YNFA 4CF9A 4EP5A 3KK1A 3BDPA 4OLAA 2HHUA 3SYZA 4FM2A 3D45A 5E41A 4AHRA 4DTXA 3S3NA 3AVNA 4HCBA 2ATQA 5D3GA 4YNQA 1O1WA 2EHGA 1QTMA 4F2SA 4M41A 4AHTA 3OS1A 4CEZA 1WNSA 1SL1A 4FLTA 2HVHA 4I9LA 4KFBA 2ZE2A 3BGRA 1VSDA 1NK7A 1C0UA 1XWLA 2WOMA 3KJVA 2P5GA 3AVMA 3AVFA 2HNYA 3D0PA 1QHTA 4BE2A 2OPQA 3TABA 2Z1IA 4LH4A 2OPRA 1Q9YA 4CJPA 1XC9A 1QSLA 1BISA 1L3VA 1G15A 1KTQA 5C24A 4HUEA 4DLGA 4CGGA 4DQQA 3RWUA 4LSNA 3NF8A 4GVMA 2KW4A 3HJFA 2OYQA 3NH0A 2YV0X 4CHPA 3LP2A 5FROA 1ASWA 3DLRA 4CIFA 3V9WA 4OVLA 1S6PA 2YHAA 3DRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DRP A;  1S9E A;  1GOA A;  1NK9 A;  3SUQ A;  3M8P A;  3K5O A;  4Z4H A;  1A5V A;  2XHB A;  3VA0 A;  1NKE A;  1WAJ A;  4CE9 A;  1SL2 A;  2QKK A;  3OS0 A;  4M3X A;  1JLA A;  1WSH A;  2P51 A;  3OYM A;  3TWH A;  3QEP A;  4CJW A;  3WNH A;  4I2P A;  4NCG A;  3QO9 A;  4KO0 A;  1LWE A;  1ZBH A;  2FBV A;  3KLE A;  4FM1 A;  2YKN A;  1D9F A;  3SQ0 A;  3VQE A;  1K6Y A;  4CK2 A;  3S3M A;  4F8R A;  4F3T A;  1RT5 A;  4CGD A;  1NKC A;  4OKE A;  1BHL A;  1RDD A;  3AVK A;  2IGI A;  3O4Q A;  3LWL A;  3LAK A;  2BAN A;  5J1E A;  2FBX A;  4RW4 A;  4DTU A;  3B6P A;  5T7B A;  4KAZ A;  3A2F A;  1TK5 A;  3M8Q A;  4FJG A;  1SKS A;  2OZM A;  5I42 A;  2DFE A;  1CZB A;  1ITG A;  3DLE A;  3EYZ A;  3VA3 A;  1A5W A;  4W5Q A;  5DK5 A;  1DTT A;  4LSL A;  4FZX C;  3MED A;  4N5S A;  5CYM A;  3LP0 A;  4UQG A;  2IC3 A;  4BAC A;  3DOK A;  4PQU A;  4AHC A;  1B9D A;  1VK0 A;  2Z1H A;  2JLE A;  4FLX A;  4ICL A;  3V6D A;  3TAN A;  2G8F A;  3LAM A;  3OYE A;  3SUO A;  3L2R A;  1RDB A;  1RT1 A;  1X1P A;  3SCX A;  1T03 A;  1SL0 A;  2EX3 A;  2D0B A;  1U04 A;  2F96 A;  1S1V A;  4FZZ A;  1MU2 A;  4OLB A;  3AA4 A;  1C6V A;  4CJ5 A;  1FK9 A;  3OYD A;  4Z0U A;  4PY5 A;  4W5O A;  2JGU A;  3HP6 A;  4GMJ B;  3VQB A;  4J2D A;  1J54 A;  1WSG A;  4FW2 A;  4ELU A;  1C1B A;  2IAJ A;  3AO5 A;  3ZT0 A;  3WNF A;  1IG9 A;  3SQ1 A;  4EP4 A;  4CEC A;  1Q9X A;  1WSF A;  3KLI A;  3VQC A;  3DLK A;  2BE2 A;  4E1N A;  3L2W A;  4OPK A;  1JLQ A;  4DSE A;  4DF8 A;  4J2E A;  4CK1 A;  4CF8 A;  4KI6 A;  1WSI A;  2LSN A;  5C42 A;  1Z25 A;  3KLF A;  4ZTF A;  3OYC A;  3OYH A;  2GUI A;  4IFY A;  4J2B A;  3PUF A;  4B9M A;  4FJM A;  4PA1 A;  4CHQ A;  2X78 A;  4BE1 A;  3NDK A;  3SV3 A;  3OY9 A;  2XRI A;  4KHY A;  4ID5 A;  1B92 A;  2Z1G A;  4C8N A;  1J5O A;  4B8C A;  1NJW A;  4FK2 A;  4Z4E A;  1JXB A;  3QLH A;  4E1M A;  4EZ9 A;  1S5J A;  1QE1 A;  1TK0 A;  3TAR A;  1NK6 A;  2G8W A;  1RTH A;  1RNH A;  3MAQ A;  3RMC A;  4OGC A;  4BDZ A;  4B9T A;  2G8V A;  4B08 A;  4B3O A;  3QET A;  4I2Q A;  1NK0 A;  4RW8 A;  3KK3 A;  1NKB A;  3U3G A;  2HHX A;  4CF0 A;  1EXQ A;  4DS4 A;  1KSP A;  4H8K A;  3S9H A;  3AO2 A;  4DU1 A;  4R5P A;  3C94 A;  4M45 A;  3O3F A;  4DSL A;  1RBS A;  3OYG A;  2D0C A;  3FFI A;  4HVJ A;  1X9S A;  1QSS A;  3SJJ A;  2G8K A;  2Z1J A;  3U6F A;  1VSI A;  1ZBL A;  4F4K A;  2OA8 A;  2VWJ A;  1UOC A;  2YNI A;  4QAG A;  1DTQ A;  3ITH A;  1LW0 A;  1NK4 A;  3AO4 A;  1RTJ A;  1LV5 A;  3LPT A;  1L3U A;  1RBU A;  1RT6 A;  4IFV A;  1X9W A;  2OPP A;  4BDP A;  3IRX A;  4OKJ A;  1B9F A;  1VSE A;  3NH1 A;  4ZTJ A;  2D0A A;  4DQS A;  4M3T A;  4DTN A;  4KTQ A;  1JLB A;  3L3U A;  3OYA A;  4WE1 A;  3O4N A;  3OJS A;  3RMD A;  2PZS A;  5J2M A;  4CJ3 A;  4E89 A;  4FJJ A;  4F2R A;  3V9Z A;  4E7L A;  3AA3 A;  1J53 A;  4M42 A;  1L5U A;  3RTV A;  2GV9 A;  1S9G A;  3ZT4 A;  3DMJ A;  3CG7 A;  1RT3 A;  3HP9 A;  4JLH A;  1VSK A;  2DFF A;  4E7K A;  4KB1 A;  1S1W A;  2BDP A;  3CYM A;  3L2U A;  3HO1 A;  4KRF A;  3DI6 A;  4CJL A;  2E6M A;  1LAW A;  3AVG A;  2YHB A;  4HHT A;  4DS5 A;  3G10 A;  5KRS A;  4DFJ A;  4LY7 A;  2BGG A;  1ZBU A;  4CHN A;  3V1O A;  4N56 A;  3HPO A;  2HHV A;  2HVI A;  3PO4 A;  1BQM A;  3EY1 A;  4FLY A;  4DQR A;  3K57 A;  4LD0 A;  5J2P A;  4B9N A;  3HM9 A;  4CCH A;  2HW3 A;  1SUQ A;  3NE6 A;  2VG5 A;  4CF1 A;  4CJ4 A;  3IG1 A;  2HHW A;  3C6T A;  3MEG A;  2P5O A;  1UWB A;  4DG1 A;  5CYQ A;  1GOB A;  2B5J A;  4KTW A;  3SUN A;  3AVH A;  1SKR A;  4AHV A;  4DFK A;  1IKW A;  1TVR A;  4DFM A;  3OVN A;  3LPU A;  4DU3 A;  1RBR A;  4GW6 A;  2E6L A;  2Q3S A;  3M8S A;  1KVC A;  4CK3 A;  3ALY A;  1RT2 A;  5KI6 A;  3V1Q A;  4NCB A;  4E0D A;  4MFB A;  3AVB A;  4J2A A;  3HT3 A;  3QIN A;  2XY6 A;  3PO5 A;  4XIU A;  2B6A A;  4DQP A;  1TAU A;  4O5B A;  2RKI A;  4NYN A;  4KHW A;  4IG3 A;  3K2P A;  3NF9 A;  1N5Y A;  1J9A A;  4CHY A;  4CEF A;  1F21 A;  4FLW A;  3NFA A;  3QEI A;  3TAE A;  1RTD A;  3HK2 A;  4JS4 A;  3AV9 A;  1D5A A;  1NK5 A;  2HHS A;  3VQP A;  4ID1 A;  2DTU A;  1VRU A;  2QK9 A;  4HUG A;  2HB5 A;  3TI0 A;  3KTQ A;  1L3T A;  3L3V A;  3U3Y A;  3KD5 E;  5FRM A;  1RT7 A;  2Y1I A;  4ELT A;  3CFO A;  1NJY A;  4C8O A;  4CER A;  4M3Y A;  3QNO A;  4DTR A;  4DTO A;  5CZ1 A;  3IAY A;  4G1Q A;  3HPH A;  4Z4G A;  3SI6 A;  3B6O A;  1HNV A;  2XO7 A;  1ZYQ A;  1HYV A;  1YT3 A;  4B8A B;  4BDY A;  3AVC A;  4RG8 A;  1EET A;  3ZSW A;  3OYN A;  3TR8 A;  3I0S A;  3OYK A;  3RRG A;  4M3Z A;  4CEB A;  4H4O A;  4CJE A;  3OS2 A;  2E4L A;  2RN2 A;  1IO2 A;  3OYB A;  3K58 A;  4CJU A;  3SPZ A;  2QXF A;  4DWI A;  3SQ2 A;  1BIZ A;  1JLE A;  1U4B A;  3VQQ A;  4O0I A;  4KTZ A;  3L8B A;  4FYD A;  4HCC A;  4CHO A;  4KKO A;  4CGF A;  5J2Q A;  3KIO A;  2XY8 A;  1HPZ A;  3IS9 A;  2G8U A;  2PYL A;  4DF4 A;  4DTP A;  3KLH A;  4CJS A;  2F8S A;  4O0J A;  4O4G A;  4CEE A;  2KTQ A;  2HND A;  4CIE A;  3LZI A;  3AA5 X;  4DSK A;  1R0A A;  3CM6 A;  4JRP A;  3RRH A;  1RTI A;  3OYI A;  1XI1 A;  3AVI A;  4PWD A;  3VQ8 A;  4CFB A;  1VSF A;  2KQ2 A;  5JS2 A;  3ZCM A;  2KFN A;  1NJX A;  1A5X A;  4MQ3 A;  2F8T A;  1TK8 A;  1TV6 A;  3LZJ A;  2YNH A;  4Y1D A;  1RT4 A;  3LP1 A;  4CJQ A;  4YFU A;  4IG0 A;  4BWM A;  3NGZ A;  4DSJ A;  3K59 A;  4FZY A;  1U47 A;  3CFR A;  2PYJ A;  4IKF A;  2X6N A;  3AVA A;  1VSH A;  3NAE A;  3TAQ A;  4KV8 A;  4H4M A;  3PY8 A;  1WLJ A;  1KFS A;  3P1G A;  1C1C A;  2YNG A;  1KVB A;  1HQU A;  3NGY A;  4Q5V A;  1TL1 A;  1C0M A;  2X74 A;  1DLO A;  1YTU A;  4FXD A;  3RR7 A;  4EZ6 A;  1ASV A;  4OGE A;  4CED A;  4CEQ A;  3VQ6 A;  1KCF A;  3OYF A;  3PX4 A;  4DFP A;  1HYS A;  3QEW A;  2IOC A;  4CEA A;  4FJ7 A;  4Z4I A;  1UAX A;  5I3U A;  4Z4C A;  1TKZ A;  4E19 A;  1QSY A;  2ETJ A;  1UA1 A;  3JYT A;  5KTQ A;  4M3W A;  5FDL A;  3LWM A;  1U49 A;  4CFD A;  4I9Q A;  1BCO A;  2ZQB A;  1T05 A;  2KZZ A;  4JS5 A;  3PX0 A;  4CES A;  3LAL A;  3VQ4 A;  4FK0 A;  4AHS A;  4RW6 A;  4CJT A;  1JXE A;  1NJZ A;  3VQ5 A;  4CF2 A;  3HST B;  4QOZ B;  1YVU A;  4FJK A;  4K8X A;  4O55 A;  3O3H A;  5HRN A;  3ASM A;  4FM0 A;  1KLM A;  4FVM A;  1TKT A;  5HLF A;  4E7H A;  1D9D A;  5CZ2 A;  4M3U A;  3MXJ A;  2KFZ A;  3LP3 A;  3H08 A;  4DTJ A;  2IS3 A;  3DYA A;  3SV4 A;  4K8Z A;  3ZSQ A;  3K5M A;  3ZT2 A;  3OYL A;  3CQ8 A;  3ZSR A;  4ELV A;  1BIU A;  5HRS A;  3KKR A;  3ZSO A;  4Z4F A;  4FJ9 A;  3NCI A;  5HRP A;  1JLG A;  3QEX A;  4B9U A;  1KFD A;  3V1R A;  2XY7 A;  1LWC A;  3K5L A;  5DMR A;  2I5J A;  1EKE A;  4B9V A;  3VN5 A;  4E7I A;  1T7P A;  2YKM A;  3PX6 A;  3THV A;  3ZSX A;  5EU7 A;  2HMI A;  2R7Y A;  4CJR A;  3SPY A;  1NK8 A;  1BI4 B;  1IH7 A;  1LW2 A;  3WNG A;  4CIG A;  3KK2 A;  3V9X A;  4LH5 A;  1EX4 A;  3EZ5 A;  4FJL A;  4C8K A;  3I8D A;  3KLG A;  1SV5 A;  3HL8 A;  4KB0 A;  3NHG A;  3QER A;  4KHU A;  3TAF A;  2WON A;  2B4J A;  1W9H A;  1IKV A;  2FBT A;  1TKD A;  4FJN A;  4C8L A;  3QES A;  1IKX A;  1X9M A;  4CJF A;  3G0Z A;  3ZSY A;  4W5R A;  3HPG A;  4DSF A;  3RR8 A;  4DSI A;  3AVJ A;  1FXX A;  3WNE A;  1UA0 A;  1C1A A;  1S1T A;  5KGW A;  1BQN A;  4W5N A;  1HJR A;  3AO3 A;  4CGJ A;  5KRT A;  4RW9 A;  3TAG A;  3DLB A;  2FBY A;  1CLQ A;  1GOC A;  2XY5 A;  3DLH A;  4KRE A;  3HVR A;  5CY4 A;  3JSM A;  2ITG A;  4FCY A;  1XHZ A;  1FKP A;  5C25 A;  5KGX A;  3V4I A;  1JL2 A;  5HP1 A;  3C6U A;  3CM5 A;  4DTM A;  4FJH A;  4KHN A;  3O3G A;  4FK4 A;  1S1X A;  1XHX A;  2X6S A;  1FKO A;  3NF6 A;  4FLZ A;  2W42 A;  1BCM A;  2FC0 A;  2P1J A;  3DRR A;  2A1S A;  1HYZ A;  4E7J A;  1HMV A;  2PY5 A;  3UIQ A;  1NOZ A;  1I3A A;  3ISN C;  3NBP A;  3HVT A;  4KHS A;  1WN7 A;  1HQE A;  3VQD A;  1VSJ A;  1LWF A;  4CGI A;  3V81 A;  4OPJ A;  2HNZ A;  2AJQ A;  4F3O A;  4ZHR A;  4DU4 A;  4FJX A;  4AIL C;  4RW7 A;  3ZT3 A;  5HRO A;  4KPY A;  3L2Q A;  1HNI A;  3F73 A;  3K5N A;  4BE0 A;  2QKB A;  3E01 A;  3P5J A;  4CEO A;  5J2N A;  3SUP A;  2VG7 A;  4AHU A;  4C8M A;  4NCA A;  1ASU A;  4FLU A;  1TKX A;  3NF7 A;  4N47 A;  4CFA A;  2HHQ A;  3MEE A;  3L2V A;  2IDO A;  1L3S A;  1TAQ A;  3ZT1 A;  3TAM A;  3ZSZ A;  2O4G A;  3OJU A;  2VG6 A;  4HUF A;  3F9K A;  1WSJ A;  3S3O A;  1W0H A;  1KLN A;  1CZ9 A;  1VSM A;  2GBZ A;  1SKW A;  3I0R A;  1TGO A;  4CGH A;  1NOY A;  1QS4 A;  1S1U A;  1C0T A;  1BGX T;  4JRQ A;  1Y97 A;  4IDK A;  3DM2 A;  4DMN A;  4KHQ A;  2HHT A;  1IKY A;  4Q0B A;  3VQA A;  2KZM A;  3MEC A;  3AA2 A;  1CXU A;  1JLC A;  1JLF A;  3QIP A;  3MXI A;  5FRN A;  1RDA A;  2Y1J A;  5SZT A;  1RDC A;  3KD1 E;  2OPS A;  5HRR A;  4CFC A;  4FJ5 A;  1U48 A;  5JS1 A;  4CHZ A;  1ZBI A;  5SWM A;  1BL3 A;  1Q8I A;  3AO1 A;  3C95 A;  1I39 A;  3DOL A;  3T3F A;  4DTS A;  4Y1C A;  2DY4 A;  3RMB A;  3DLG A;  4CJV A;  3OYJ A;  1LAV A;  3ZSV A;  1KRP A;  4FLV A;  4TSX A;  4PUO A;  3NGI A;  3NH2 A;  2VWK A;  3LDS A;  4O44 A;  1HRH A;  4B9L A;  5K14 A;  1ZBF A;  3T1A A;  3AVL A;  2NUB A;  1RCH A;  3P83 D;  4N76 A;  2RF2 A;  3SQ4 A;  4KI4 A;  1D8Y A;  4FJI A;  1KVA A;  4N41 A;  4DLE A;  4I7F A;  3KKS A;  3LAN A;  3VQ9 A;  1VSL A;  3V9U A;  2OZS A;  1RIL A;  1U45 A;  2RPI A;  3ULD A;  2A1R A;  4FW1 A;  2G8H A;  3CFP A;  1REV A;  1JKH A;  1JL1 A;  4OKK A;  1WSE A;  5HBM A;  1QQC A;  3SZ2 A;  4HTU A;  4QCL A;  1YTA A;  3HXM A;  3VQ7 A;  4BWJ A;  3QNN A;  3RMA A;  3SNN A;  1EP4 A;  1S6Q A;  4OJR A;  4E3S A;  3T19 A;  1VRT A;  2D5R A;  1CXQ A;  3TAP A;  4W5T A;  1BI4 A;  4L8R B;  3HYF A;  1WAF A;  4FJ8 A;  3QIO A;  4IBN A;  3PV8 A;  2G8I A;  1T8E A;  1RBT A;  4CJK A;  2DFH A;  3M8R A;  2ZD1 A;  1N6Q A;  1TL3 A;  4M3R A;  3QEV A;  4DQI A;  1RBV A;  4B9S A;  2O4I A;  4NYF A;  4AH9 A;  3V9S A;  3MXM A;  1Z26 A;  2YNF A;  4CF9 A;  4EP5 A;  3KK1 A;  3BDP A;  4OLA A;  2HHU A;  3SYZ A;  4FM2 A;  3D45 A;  5E41 A;  4AHR A;  4DTX A;  3S3N A;  3AVN A;  4HCB A;  2ATQ A;  5D3G A;  4YNQ A;  1O1W A;  2EHG A;  1QTM A;  4F2S A;  4M41 A;  4AHT A;  3OS1 A;  4CEZ A;  1WNS A;  1SL1 A;  4FLT A;  2HVH A;  4I9L A;  4KFB A;  2ZE2 A;  3BGR A;  1VSD A;  1NK7 A;  1C0U A;  1XWL A;  2WOM A;  3KJV A;  2P5G A;  3AVM A;  3AVF A;  2HNY A;  3D0P A;  1QHT A;  4BE2 A;  2OPQ A;  3TAB A;  2Z1I A;  4LH4 A;  2OPR A;  1Q9Y A;  4CJP A;  1XC9 A;  1QSL A;  1BIS A;  1L3V A;  1G15 A;  1KTQ A;  5C24 A;  4HUE A;  4DLG A;  4CGG A;  4DQQ A;  3RWU A;  4LSN A;  3NF8 A;  4GVM A;  2KW4 A;  3HJF A;  2OYQ A;  3NH0 A;  2YV0 X;  4CHP A;  3LP2 A;  5FRO A;  1ASW A;  3DLR A;  4CIF A;  3V9W A;  4OVL A;  1S6P A;  2YHA A;  3DRS A; 
#chains in the Genus database with same CATH topology
 3VOV A;  1NK9 A;  2Q97 A;  1P90 A;  2QKK A;  1NKE A;  3VA0 A;  1SL2 A;  2WC9 A;  4JD2 B;  5C10 A;  4R79 A;  5CHI A;  3TWH A;  4JI3 K;  4RCH A;  1G99 A;  4NCG A;  4KO0 A;  1LWE A;  5CE3 A;  4QS9 A;  3KK7 A;  4H5W A;  3QIC A;  3GDQ A;  3J7Z O;  1RDD A;  3LDQ A;  4AM7 A;  1TYQ B;  4FJG A;  4H5N A;  1JCG A;  3AAP A;  1K8A O;  5FPN A;  4FZX C;  4LSL A;  1E3M A;  4IZ9 A;  4JKG A;  3UKR A;  3MED A;  1U2V A;  4N5S A;  5CYM A;  3LP0 A;  2IC3 A;  4BG8 A;  3VEY A;  4CZI A;  4ISE A;  3CCV N;  1B9D A;  5M1Q A;  2Z1H A;  2PFU A;  3SCX A;  1SL0 A;  1NGC A;  2EWS A;  1C6V A;  4CJ5 A;  3OYD A;  3G4S N;  1W2B M;  4W5O A;  4DV4 K;  4J2D A;  1J54 A;  4DR3 K;  4YOU A;  2V52 B;  3KWI A;  3SQ1 A;  1Q9X A;  4JI4 K;  5E84 A;  2BE2 A;  3L2W A;  1JLQ A;  2E8A A;  3TSQ A;  1YAG A;  5C42 A;  3H1V X;  3KLF A;  3OYH A;  2GUI A;  1VQ4 N;  3O9R A;  1DKG D;  1Z6R A;  3I55 N;  1OH5 A;  2XRI A;  4KHY A;  3BZC A;  4ILJ A;  3J8A A;  2Z1G A;  1NK6 A;  3MAQ A;  3RMC A;  3HRG A;  4FOI A;  4B3O A;  4I2Q A;  3D2E A;  1OH8 A;  3KK3 A;  3U3G A;  5AQK A;  1EXQ A;  4DUY K;  4NB4 A;  3C94 A;  3OYG A;  3FFI A;  3R3L A;  2WFB A;  3C65 A;  1OH7 A;  2Z1J A;  3JS6 A;  1HJO A;  2YNI A;  1OKJ A;  1NK4 A;  2BUP A;  1L3U A;  3HTV A;  4IFV A;  3IRX A;  1WUA A;  1VSE A;  2D0A A;  1QQM A;  4WFN L;  2O8F B;  4CJ3 A;  4FJJ A;  3D2F A;  2Q0U A;  4KH6 A;  1S9G A;  3CG7 A;  1VSK A;  3O4W A;  4WQ4 C;  1VQO N;  3F5T A;  2BDP A;  3CYM A;  4DR1 K;  5KRS A;  4DFJ A;  1ZBU A;  4CHN A;  3V1O A;  4N56 A;  2E2P A;  2HVI A;  4LD0 A;  2ZGZ A;  3NE6 A;  4JI6 K;  3ZYY X;  3ZX0 A;  4JK8 A;  4KTW A;  4GY2 B;  4IO8 A;  4RWT A;  3E9O A;  3OVN A;  4CBW A;  3LPU A;  4DU3 A;  2E6L A;  1NBW A;  2Q3S A;  3MN5 A;  3M8S A;  4CK3 A;  3AGR A;  3THY A;  3AVB A;  3FZM A;  3QIN A;  3HZ6 A;  3FGU A;  2UYT A;  3GOI A;  2B6A A;  4XIU A;  4DQP A;  2FSN A;  4FLW A;  4A2B A;  4IJA A;  3QEI A;  1YI2 N;  4JS4 A;  4B3R K;  1D5A A;  3AAQ A;  3R8E A;  1VRU A;  1M1K O;  2VQE K;  2HB5 A;  4RTF D;  5AQT A;  3U3Y A;  2Y1I A;  4ELT A;  1NJY A;  4CER A;  4M3Y A;  5CZ1 A;  3SI6 A;  1HNV A;  1ZYQ A;  1HYV A;  1YT3 A;  3K0S A;  3AVC A;  3OYN A;  3M5R A;  4M3Z A;  3ID6 A;  2RN2 A;  1IO2 A;  3SPZ A;  1JLE A;  1U4B A;  4O0I A;  5ADX A;  3CCJ N;  4FYD A;  4KKO A;  4CGF A;  2XY8 A;  2G8U A;  2RHK A;  2KKZ A;  4CJS A;  3KLH A;  3HOT A;  4O0J A;  4O4G A;  3AGK A;  1SAZ A;  3CM6 A;  4E1J A;  1RTI A;  2NRW A;  3AVI A;  1KXP A;  1VSF A;  2DPN A;  1W97 L;  3ZCM A;  2P9S A;  1NNE A;  1RT4 A;  4CJQ A;  4BR4 A;  2ITM A;  2PYJ A;  2X6N A;  4AM6 A;  3TAQ A;  1WLJ A;  3BZK A;  4FWR A;  1DLO A;  2FLO A;  4NLB A;  2VYP A;  1JCF A;  4MDA A;  5JIC A;  3KZB A;  3VQ6 A;  3OYF A;  3QEW A;  5I3U A;  5AQG A;  4E19 A;  1UA1 A;  4M3W A;  5KTQ A;  2E88 A;  3LWM A;  2ZQB A;  4FO0 A;  1T05 A;  2KZZ A;  1VQK N;  2F9W A;  4NO7 A;  1LOT B;  2P9I A;  4QOZ B;  5AQH A;  2P9K A;  1YVN A;  2ZF5 O;  5CZ2 A;  3H08 A;  5H1S Q;  3PIO L;  3IFR A;  3K5M A;  5AQY A;  3OYL A;  1K9M O;  1BG3 A;  4FJ9 A;  3NCI A;  2HBM A;  5HRP A;  3CJC A;  3V1R A;  1XMO K;  3L4Q A;  5BRD A;  5DMR A;  4KHP K;  1HKG A;  3PX6 A;  4JV5 K;  1X3N A;  3IMX A;  4DHY A;  3QBX A;  4CJR A;  1BI4 B;  1EX4 A;  4FJL A;  3NHG A;  2B4J A;  2JWL A;  4DR5 K;  3MCP A;  4C8L A;  4FJN A;  4MLE A;  3RR8 A;  1FXX A;  1C1A A;  3VPZ A;  2D4W A;  1HJR A;  3AO3 A;  4CGJ A;  5KRT A;  3TAG A;  3DLB A;  4A5B A;  4IOC L;  2W40 A;  4CZF A;  3SMS A;  4JI0 K;  1JCE A;  2E2Q A;  5BPM A;  4WFB L;  1EWR A;  3CM5 A;  1S1X A;  1XHX A;  2NRH A;  2W42 A;  1VQL N;  5HOO A;  1HMV A;  1NOZ A;  1LWF A;  2HNZ A;  4XH5 A;  4AIL C;  4RW7 A;  5HRO A;  4BRA A;  5DM7 L;  1GLA G;  1HNI A;  3D7E O;  3E01 A;  3P5J A;  5GAH P;  2QKB A;  2VG7 A;  1KAZ A;  5AR0 A;  2GEM A;  3MEE A;  5KPZ A;  2IDO A;  1L3S A;  3U4L A;  4JNE A;  2CGJ A;  2O4G A;  3CJ7 A;  1WSJ A;  1W0H A;  1CZ9 A;  4FOE A;  1SKW A;  4CGH A;  1QS4 A;  5LMU K;  2NZT A;  1BGX T;  4IDK A;  4DMN A;  2KZM A;  4Q0B A;  1YUW A;  2HBL A;  2P9N A;  3MXI A;  5FRN A;  4A57 A;  2Y1J A;  4B3M K;  5TKY A;  3KD1 E;  5HRR A;  4IO9 L;  3AO1 A;  2QXL A;  4DTS A;  1LAV A;  3ZSV A;  4FLV A;  4IFE A;  3NH2 A;  1HRH A;  3T1A A;  3LDP A;  4LF6 K;  4JKC A;  2RF2 A;  3SQ4 A;  1N33 K;  3VQ9 A;  4JI2 K;  1YF5 L;  3CFP A;  1REV A;  1JL1 A;  1WSE A;  1QQC A;  4QCL A;  3RMA A;  4BQL A;  3R1X A;  3SNN A;  1S6Q A;  3T19 A;  3L0Q A;  4W5T A;  4L8R B;  1IG8 A;  4FJ8 A;  3I33 A;  4YDU A;  3I56 N;  2ZD1 A;  3CME N;  1TL3 A;  3C6A A;  3UKU B;  1T3V A;  4JHD A;  3ULE B;  4FM2 A;  4DTX A;  4JN4 A;  3TTF A;  3CCE N;  4HCB A;  4C1N I;  3WXI A;  2P9L B;  3KHY A;  2PBD A;  3OS1 A;  5FPE A;  1SL1 A;  4JKB A;  3P38 A;  1R59 O;  4BRK A;  1VSD A;  3ATV A;  2OPQ A;  3T1Y K;  3TAB A;  2Z1I A;  4JKE A;  4LH4 A;  1G15 A;  3RWU A;  1GLC G;  4LSN A;  4GVM A;  2YJF A;  1GLJ O;  3ENB A;  2YV0 X;  5FRO A;  4KH5 A;  1ASW A;  3CIP A;  4OVL A;  1S6P A;  2YHA A;  3DRS A;  3SUQ A;  3J7A P;  3M8P A;  1OVY A;  3BUZ B;  3K5O A;  2XHB A;  4M3X A;  4AF1 A;  1JLA A;  3QEP A;  1QZ6 A;  3WNH A;  3QO9 A;  1WB9 A;  2FBV A;  3KLE A;  1E4G T;  3AY9 A;  1K6Y A;  4CK2 A;  5EVZ A;  3THX A;  4CGD A;  3A5M C;  4OKE A;  3AVK A;  2D0P A;  3LWL A;  3LAK A;  2FBX A;  3SAF A;  3B6P A;  5AQL A;  3N4P A;  5AQW A;  3P31 A;  4EAH D;  2UUC K;  2OZM A;  1CZB A;  4OO1 J;  5DK5 A;  4B9Q A;  4BAC A;  3A5O C;  1ATN A;  4IXC A;  1K73 O;  4CZM A;  4PQU A;  3G6E N;  1NU0 A;  4ICL A;  3CF5 L;  4PL8 A;  4ILG B;  1X3M A;  2FSJ A;  3VF2 A;  4FZZ A;  1MU2 A;  5JMV A;  3AA4 A;  4I6M B;  3CD6 N;  1FK9 A;  3B8A X;  2JGU A;  3HP6 A;  4GMJ B;  1WSG A;  1C1B A;  2IAJ A;  3ZT0 A;  1IG9 A;  3ATU A;  4H0Y B;  4CEC A;  3CET A;  4E1N A;  2AP1 A;  4FWK A;  4DUZ K;  4CBX A;  3MX5 A;  4IJN A;  4KI6 A;  2LSN A;  4ZTF A;  3OYC A;  4IFY A;  3PUF A;  3SBT A;  3SV3 A;  3N4Q A;  1YJW N;  4DCH A;  3OY9 A;  1DEJ A;  1B92 A;  1J5O A;  3QLH A;  4X66 K;  2PAV A;  2H3G X;  4LF9 K;  4OGC A;  4BDZ A;  2G8V A;  2YI1 A;  4B08 A;  4BRM A;  4RW8 A;  3ZET A;  2V7Z A;  3U9D A;  4CF0 A;  1KSP A;  3AO2 A;  4M45 A;  3O3F A;  2D0C A;  5FPD A;  1X9S A;  3PSI A;  2G8K A;  3O9T A;  3U6F A;  4F4K A;  2E1Y A;  4X64 K;  3LDO A;  1UOC A;  2OA8 A;  1DTQ A;  3ITH A;  3FZH A;  3AO4 A;  2QM1 A;  4B1Y B;  1BA0 A;  3NH1 A;  1HKC A;  5GAE P;  3C0B A;  4DQS A;  4DTN A;  2NLX A;  4KTQ A;  3RMD A;  4E7L A;  3AA3 A;  3WXL A;  2O8B A;  5AQO A;  3HP9 A;  4PKG A;  3FLC O;  3SJH A;  1Q18 A;  2DFF A;  4C23 A;  4E7K A;  3K9J A;  1S1W A;  4CJL A;  1GLD G;  1LAW A;  4DS5 A;  2BGG A;  2QWM A;  4FLY A;  3FE1 A;  3QFP A;  1SUQ A;  2VG5 A;  4CF1 A;  3EO3 A;  3C6T A;  4A2A A;  3UB5 A;  5BRE A;  3SUN A;  3AVH A;  4DFK A;  1TVR A;  4DFM A;  4GW6 A;  4M63 C;  2P9U B;  2P9P A;  4OX9 K;  2VGN A;  3CPE A;  4J2A A;  3SBG A;  5AZJ B;  3HT3 A;  2Q0R A;  4CZE A;  4IG3 A;  3K2P A;  5EXW A;  4CHY A;  4BR7 A;  1RTD A;  1Z05 A;  3AV9 A;  1NGI A;  4ID1 A;  4XEI A;  4NXN K;  3O8M A;  2DTU A;  2W41 A;  2QK9 A;  4HUG A;  4EFH A;  3TI0 A;  3KTQ A;  3L3V A;  3KD5 E;  3E9L A;  3A5N C;  3CFO A;  4DV2 K;  4C8O A;  4DTR A;  3IAY A;  3WEE A;  4UY8 O;  3HPH A;  2OTL N;  4HWI A;  3P4I A;  4B8A B;  4BDY A;  5JLF A;  3TR8 A;  3RRG A;  1T6D A;  5BR9 A;  1QVG M;  3CJ9 A;  3K58 A;  2QXF A;  3VQQ A;  3ZX3 A;  1YHQ N;  4EHT A;  3ZLJ A;  3HBT A;  2PYL A;  1OVQ A;  3DXM A;  4JK7 A;  3BEX A;  4DTP A;  2HND A;  3LZI A;  5JVH L;  2F4V K;  3G71 N;  4IEI A;  1R0A A;  3VEX A;  2YX6 A;  3DXK A;  4JRP A;  1XI1 A;  4A62 A;  1TUU A;  4PWD A;  2KQ2 A;  1EQY A;  1A5X A;  5AQJ A;  5AZI B;  1TK8 A;  3LZJ A;  2YNH A;  3LP1 A;  5BRF A;  4YFU A;  4BWM A;  4FZY A;  2QA4 N;  5BN9 A;  3K59 A;  1IBK K;  1VSH A;  2WBN A;  4H4M A;  4K42 A;  1KFS A;  5M1F A;  1C0M A;  2X74 A;  2BH1 A;  3QFU A;  3DWL A;  3H46 O;  1YTU A;  4FXD A;  3RR7 A;  1GLL O;  1ASV A;  4CED A;  4DFP A;  4CBU A;  5M1P A;  5IT9 O;  1QSY A;  3WXK A;  2ETJ A;  1VQ6 N;  3KWG A;  5FDL A;  4JS5 A;  3PX0 A;  3LDN A;  2I7P A;  4DKW A;  4CES A;  3QBW A;  4B1Z A;  3VQ5 A;  3ZEU B;  4BRH A;  3HST B;  3VEV A;  4O55 A;  2RE2 A;  5HRN A;  3ASM A;  4CJ7 A;  1D9D A;  3O1W A;  3NVM A;  1K8K B;  4DTJ A;  2IS3 A;  4K8Z A;  4H0T B;  1IBL K;  5FLX O;  5AQP A;  3ZSO A;  1DGK N;  3MWP A;  1KFD A;  3IUC A;  1LWC A;  2A40 A;  1EKE A;  3VN5 A;  2O8E A;  2W6K A;  3THV A;  3E1Y A;  3ZSX A;  1IH7 A;  1LW2 A;  3H3N O;  3V9X A;  4LH5 A;  2IVO A;  3EZ5 A;  2WUS A;  3I8D A;  5GIO A;  4GNI A;  4K41 A;  4KHU A;  2QTD A;  3TAF A;  2WON A;  1W9H A;  2FBT A;  1VQM N;  2IIR A;  1IKX A;  3CQY A;  4MO5 A;  2QWQ A;  3ZSY A;  3HPG A;  4W5R A;  4CD1 A;  1VQN N;  1NGG A;  4YY3 K;  4DSI A;  3AVJ A;  1ILY A;  4W5N A;  5AFU H;  1BQN A;  5FPM A;  4NXM K;  4J8F A;  3SK3 A;  1GOC A;  4LC9 B;  3DLH A;  2HHH K;  3C7N B;  2E2O A;  5CY4 A;  1XHZ A;  3EE9 A;  1JL2 A;  4CW7 B;  5HP1 A;  1HNZ K;  4KHN A;  4FK4 A;  4FLZ A;  2X6S A;  2FC0 A;  3UIQ A;  2A1S A;  4KHS A;  1CZA N;  1I3A A;  1NGD A;  5AQV A;  1WN7 A;  3VQD A;  1VSJ A;  4OPJ A;  1NM1 A;  1E4F T;  1ATS A;  3L2Q A;  4BE0 A;  3MX2 A;  3SUP A;  5IWA K;  2YHY A;  3F2K A;  3ID8 A;  1TKX A;  3NF7 A;  1VQ9 N;  4FPB A;  4X65 K;  4B1U B;  2UXD K;  2I7N A;  3U9Z A;  5MLC Q;  2HBK A;  3OJU A;  4HUF A;  3F9K A;  1QHA A;  5JVG L;  1VSM A;  2GBZ A;  3I0R A;  5M1K A;  4BY9 C;  1S1U A;  1C0T A;  3CQX A;  3ENH A;  4YOW A;  1IKY A;  2HHT A;  3VQA A;  3MEC A;  1CXU A;  1JLC A;  1JLF A;  5CR4 A;  5LY3 A;  2OPS A;  2WTU A;  5JS1 A;  1U48 A;  1XNQ K;  5GIP A;  1BL3 A;  3Q7C A;  4JKG B;  3UKR B;  1FW6 A;  1I39 A;  1U2V B;  3H1Q A;  4YOV A;  3OYJ A;  3NGI A;  4FWS A;  3WQU A;  3P83 D;  1RCH A;  4N76 A;  3GE1 A;  4FJI A;  4N41 A;  2GWJ A;  5F1X A;  2OZS A;  3UKU A;  4YHH K;  2V7Y A;  2A1R A;  1JKH A;  4X62 K;  1I94 K;  4PKI A;  1NGA A;  4JI1 K;  3HXM A;  3QNN A;  3TU5 A;  1MA9 B;  4OPA A;  4H5T A;  4E3S A;  3G25 A;  2D5R A;  3QIO A;  2G8I A;  1Q86 O;  1S72 N;  2DFH A;  4FSV A;  4BRE A;  2ASM A;  4DQI A;  4KH4 A;  4B9S A;  2O4I A;  3J7Y P;  4NYF A;  3MXM A;  1Z26 A;  2YNF A;  1IV0 A;  2ZWH A;  4OLA A;  1Q82 O;  4IOX A;  3AVN A;  4YNQ A;  1O1W A;  2EHG A;  4AHT A;  3D2E B;  4KFB A;  3BGR A;  3RSE A;  4BGA A;  2P5G A;  3KJV A;  3AVF A;  4BE2 A;  3W3D A;  4CJP A;  1XC9 A;  1QSL A;  1BIS A;  4QS7 A;  4IWV A;  5C24 A;  3O5B A;  4DQQ A;  3HJF A;  2OYQ A;  3LP2 A;  2YHW A;  4CIF A;  4GV3 A;  5AQZ A;  3DRP A;  4Z4H A;  3THW A;  3OS0 A;  2QWN A;  4CJW A;  3CI5 A;  4I2P A;  3D2F B;  3MK6 A;  4F8R A;  3VQE A;  3S3M A;  4F3T A;  1RT5 A;  2KLA A;  4WF9 L;  1NKC A;  1BHL A;  1EO1 A;  2IGI A;  4B1X B;  2BAN A;  5AJ3 K;  3VEN A;  4RW4 A;  1W7A A;  5T7B A;  4DV1 K;  1QZ5 A;  1TK5 A;  1XUP O;  3EYZ A;  1ITG A;  3VA3 A;  1A5W A;  1BU6 O;  3OW2 M;  1DTT A;  1GLE G;  2UU9 K;  3O9S A;  3WQT A;  1Q81 O;  5LJV A;  3VGK A;  1VK0 A;  2HST A;  4FLX A;  2G8F A;  3LAM A;  5M1N A;  4WFA L;  3L2R A;  1RDB A;  1X1P A;  3THY B;  2O8C B;  1T03 A;  4O8U A;  2F96 A;  4Y0W A;  1VQ7 N;  4Z0U A;  3VQB A;  4ELU A;  3WNF A;  4EP4 A;  3KLI A;  4BR0 A;  3DLK A;  3PIP L;  4DSE A;  4J2E A;  4CK1 A;  4CF8 A;  1EWQ A;  4H5V A;  2ZGY A;  4JKF A;  1WSI A;  4J2B A;  2ASP A;  4F9O A;  4B9M A;  4FJM A;  1NG9 A;  5BRH A;  3NDK A;  4H0O A;  3VEZ A;  1WBB A;  1N32 K;  4C8N A;  3D6R A;  4B8C A;  1JXB A;  4FL9 A;  1S5J A;  4GKK K;  1TK0 A;  4LF8 K;  1RTH A;  2YCH A;  4B9T A;  4WQ5 A;  3QET A;  3LM2 A;  2HHX A;  4DS4 A;  3S9H A;  4DV5 K;  4DU1 A;  3CJB A;  2E5L K;  4JKA A;  1RBS A;  2GWK A;  2HF3 A;  4H0V B;  2P9S B;  1ZBL A;  4QAG A;  1LV5 A;  1LW0 A;  3LPT A;  3R6M A;  4BR2 A;  5B8H A;  1RBU A;  3VTI A;  2OPP A;  4BDP A;  1YIJ N;  5JLH A;  1B9F A;  4ZTJ A;  4M3T A;  4JD2 A;  1JLB A;  3BP8 A;  3CCQ N;  3OJS A;  2PZS A;  4E89 A;  5AQX A;  3V9Z A;  4HTL A;  1L5U A;  3DMJ A;  4JLH A;  4KB1 A;  3HO1 A;  4KRF A;  3DI6 A;  2E6M A;  1TYQ A;  3G10 A;  2HHV A;  3PO4 A;  1BQM A;  4B9N A;  3K57 A;  5J2P A;  2P9I B;  3HM9 A;  2ZJR L;  2P9K B;  2ZJQ L;  4CJ4 A;  3IG1 A;  3M6G A;  4GV9 A;  3MEG A;  1UWB A;  4DG1 A;  1GOB A;  1NGH A;  4AHV A;  3CCU N;  3R9P A;  4LF5 K;  3IDH A;  1BUP A;  1RBR A;  4FWN A;  4BG9 A;  1KAX A;  4LF4 K;  2D1K A;  3AAR A;  3ALY A;  3V1Q A;  1YXQ A;  4NCB A;  1NGF A;  1VAZ A;  4K25 A;  3OBW A;  4O5B A;  4DR4 K;  4A59 A;  5AQU A;  4BR5 A;  1N5Y A;  3HK2 A;  1F21 A;  5BR8 K;  2GUP A;  3KVG A;  3CCM N;  3E9P A;  2HHS A;  4K0K K;  3MMV A;  1L3T A;  5FRM A;  4O8K A;  1O13 A;  3QNO A;  4DTO A;  2F7T A;  2Q1N A;  4Z4G A;  3CC7 N;  3B6O A;  3I8B A;  4RG8 A;  1EET A;  3ZSW A;  3OYK A;  3LM9 A;  4CEB A;  3OYB A;  4DWI A;  4CJU A;  1QVF M;  3SQ2 A;  1BIZ A;  4HCC A;  3A5L C;  5J2Q A;  3EL2 A;  3O9Q A;  1HPZ A;  4A5A A;  2Q2R A;  3EE8 A;  2F8S A;  2KTQ A;  3AA5 X;  4IDH A;  4YOR A;  2A3Z A;  1ESV A;  3VQ8 A;  1YJN N;  3NVK A;  1NJX A;  1TV6 A;  3EKS A;  4IG0 A;  4IKF A;  3AVA A;  3NAE A;  4KV8 A;  3FFK B;  1KVB A;  1HQU A;  2HBJ A;  3NGY A;  3ZEU A;  2O8F A;  4DV7 K;  4H5R A;  4OGE A;  4CEQ A;  1HYS A;  4NLC A;  2A42 A;  2IOC A;  4CEA A;  3MN9 A;  4Z4I A;  1UAX A;  2P9N B;  4Z4C A;  4K43 A;  3JYT A;  3VMF B;  4I9Q A;  4CFD A;  4DV6 K;  3LAL A;  5BPL A;  4FK0 A;  2UUA K;  4AHS A;  4RW6 A;  4CJT A;  1JXE A;  1NJZ A;  1WBD A;  4FJK A;  4K8X A;  2GTD A;  1X9J A;  3OTO K;  1TKT A;  4E7H A;  3MXJ A;  4G9Z A;  2O8D B;  1OH6 A;  5E26 A;  3ZSQ A;  3ZT2 A;  3M1F A;  3CQ8 A;  3ZSR A;  1BIU A;  5HRS A;  4Z4F A;  3LDL A;  3WXJ A;  1VQ5 N;  3QEX A;  1JLG A;  3W0L A;  4Z94 A;  2XY7 A;  3L4I A;  3VTH A;  2I5J A;  4JEP A;  4V19 S;  1T7P A;  4DR7 K;  5ADX H;  5EU7 A;  2HMI A;  2R7Y A;  5EX5 A;  1NK8 A;  4CIG A;  3KK2 A;  3WNG A;  4C8K A;  3EZW A;  3KLG A;  4CZG A;  4H0P A;  1N36 K;  3QER A;  2A41 A;  2NNW A;  3QES A;  1NGJ A;  3TSU A;  4DSF A;  4JHD B;  1VQP N;  1S1T A;  5KGW A;  4LF7 K;  3CHW A;  3C6H A;  1CLQ A;  2FBY A;  2XY5 A;  4KRE A;  3VEW A;  3HVR A;  3JSM A;  1FKP A;  5C25 A;  3V4I A;  5C12 A;  3C6U A;  2YJE A;  3F9M A;  4DTM A;  3P39 A;  3U8X A;  1BCM A;  1XC3 A;  2P1J A;  4FK2 A;  2A6A A;  3NBP A;  5F2R A;  2NRR A;  4CGI A;  3QB0 A;  2AJQ A;  4ZHR A;  4FJX A;  4KPY A;  3K5N A;  1NMN A;  4CEO A;  4AHU A;  4C8M A;  1ASU A;  4FLU A;  4N47 A;  1BWF O;  4CFA A;  2ZJP L;  3L2V A;  1TAQ A;  3ZT1 A;  3TAM A;  3ZSZ A;  2VG6 A;  3GBT A;  4WCE L;  3S3O A;  4XH1 A;  1J5E K;  3THX B;  1RDU A;  4JK9 A;  1Y97 A;  3JAM O;  5AQR A;  4H0X B;  4CZK A;  4DR6 K;  5SZT A;  4FJ5 A;  3VGM A;  4CHZ A;  3CER A;  1ZBI A;  5SWM A;  1XNR K;  3DOL A;  3T3F A;  4Y1C A;  4WQ4 A;  2HMP A;  1XMQ K;  4PHT X;  4PUO A;  2QW9 A;  1ZBF A;  5KPT A;  4KBO A;  2NUB A;  4KI4 A;  5AQN A;  1KVA A;  4DB3 A;  4EHU A;  3OA9 A;  1VSL A;  1U45 A;  1FJG K;  4FW1 A;  1V4T A;  2G8H A;  4OKK A;  1ZBS A;  4HTU A;  4BWJ A;  1EP4 A;  2D0O A;  4OJR A;  5ELZ A;  1CXQ A;  1BI4 A;  1WAF A;  2OCE A;  4IBN A;  3S41 A;  3ZX2 A;  2HF4 A;  3PV8 A;  1T8E A;  3VGL A;  3VES A;  3M8R A;  1N6Q A;  3QEV A;  3TTD A;  1BO5 O;  4WYB A;  2BTF A;  4XH4 A;  4BRC A;  4CD3 A;  3V9S A;  4YOX A;  3KK1 A;  4EP5 A;  3SLC A;  1XQS C;  5E41 A;  4H03 B;  5BN8 A;  3S3N A;  1C0G A;  4LFB K;  1QTM A;  4F2S A;  4CEZ A;  4FLT A;  3ZET B;  1YJ9 N;  2ZE2 A;  1NK7 A;  1C0U A;  3HI0 A;  2F9T A;  3AVM A;  2HNY A;  3D0P A;  1QHT A;  5LL6 Z;  1KC8 O;  2OPR A;  1TUY A;  4CI6 A;  4ILH A;  5C15 A;  4HUE A;  4U7B A;  1HR0 K;  3NF8 A;  2IVN A;  2HOE A;  3V9W A;  3IKM A;  3C95 A;  1QQN A;  1S9E A;  1GOA A;  5I9E B;  1A5V A;  4M7X A;  3WUH A;  1WAJ A;  4CE9 A;  1NMD A;  3OYM A;  1WSH A;  2P51 A;  2A5X A;  1ZBH A;  2O8B B;  4DV0 K;  4FM1 A;  2YKN A;  1D9F A;  3SQ0 A;  4BRF A;  4QS8 A;  1HX1 A;  2OAN A;  5BPN A;  2OTJ N;  3O4Q A;  5F0X A;  2O8C A;  3WXM B;  5J1E A;  4DTU A;  3GL1 A;  4KAZ A;  1ATR A;  3WT0 A;  3A2F A;  4BC2 A;  3M8Q A;  1SKS A;  5I42 A;  2DFE A;  3DLE A;  1RFQ A;  4DR2 K;  4W5Q A;  4MO4 A;  4A61 A;  3CPW M;  3HM8 A;  4UQG A;  3DOK A;  5M1O A;  1KD1 O;  4AHC A;  3TAN A;  2JLE A;  3V6D A;  3OYE A;  2P9P B;  3SUO A;  3CCL N;  1RT1 A;  2EX3 A;  2D0B A;  1U04 A;  4OPH A;  1BA1 A;  1S1V A;  3H3O B;  4OLB A;  4FWO A;  4PY5 A;  3T1H K;  4BQZ A;  4FW2 A;  4CVN E;  3AO5 A;  2NRZ A;  1WSF A;  3VQC A;  2E20 A;  4OPK A;  3VF4 A;  4M7Y A;  4DF8 A;  1RDW X;  2QWP A;  3WEE B;  1Z25 A;  1BOT O;  4PA1 A;  4CHQ A;  2X78 A;  3MN7 A;  4BE1 A;  3BF1 A;  3TPQ A;  1ZC6 A;  1RGI A;  3DAW A;  4ID5 A;  4Z4E A;  1NJW A;  3ULE A;  4LFA K;  4E1M A;  4EZ9 A;  5C2F A;  3GG4 A;  1QE1 A;  3TAR A;  2G8W A;  3BF3 A;  1RNH A;  2P9L A;  3DXM B;  2CGK A;  2E2N A;  4IEE A;  1NK0 A;  1HNW K;  4FWP A;  1NKB A;  3JXU A;  4H8K A;  3DXK B;  3EKU A;  4R5P A;  4DSL A;  4HVJ A;  1QSS A;  3SJJ A;  5EY4 A;  1VSI A;  1HNX K;  2VWJ A;  1RTJ A;  1RT6 A;  1VHX A;  1X9W A;  4OKJ A;  3VET A;  3RVC A;  1N8R O;  1S3X A;  3L3U A;  3OYA A;  4WE1 A;  3O4N A;  3CCS N;  5J2M A;  4JKD A;  1KQS M;  4F2R A;  1BDG A;  1J53 A;  1HLU A;  1ZXO A;  3CCR N;  4M42 A;  3RTV A;  2GV9 A;  2J4R A;  3ZT4 A;  1RT3 A;  2QWO A;  4BRQ A;  3FR0 A;  5AQI A;  4BRN A;  2QI2 A;  3L2U A;  4JI8 K;  4BGB A;  3AVG A;  2YHB A;  4BC4 A;  4HHT A;  4LY7 A;  1WOQ A;  5DM6 L;  4CZL A;  3HPO A;  2VWB A;  3EY1 A;  4DQR A;  4CCH A;  3EN9 A;  2HW3 A;  4CZH A;  4GKJ K;  3O80 A;  2HHW A;  5AQS A;  4FWM A;  1KAY A;  2P5O A;  3O08 A;  5CYQ A;  1NWK A;  2B5J A;  1SKR A;  2Q31 A;  1IKW A;  4GVE A;  4B1W B;  1KVC A;  5KI6 A;  1RT2 A;  4E0D A;  4MFB A;  1NJI O;  2XY6 A;  4DV3 K;  3PO5 A;  1TAU A;  2O8E B;  2RKI A;  3O6W A;  4NYN A;  4I6M A;  1V4S A;  4KHW A;  1HPM A;  3NF9 A;  1IJJ A;  1J9A A;  1QQO A;  5EOY A;  3TSP A;  4C1N K;  4CEF A;  3NFA A;  5AQM A;  3TAE A;  2FF6 A;  3UE5 A;  1NK5 A;  4O5F A;  3VQP A;  2QWR A;  3O1B A;  3VF6 A;  3FZF A;  2UXB K;  5C2D A;  4GV6 A;  1C0F A;  1RT7 A;  3T7Z A;  1VQ8 N;  3SMP A;  3PLA A;  4JI7 K;  4G1Q A;  2QWL A;  2XO7 A;  1Q7Y O;  3DLL L;  3I0S A;  2ZM6 K;  4H4O A;  4CJE A;  5HL7 L;  3OS2 A;  2UUB K;  2E4L A;  5C0Y A;  3L8B A;  2VCP A;  4KTZ A;  1HUX A;  1T6C A;  3MDQ A;  4CHO A;  4B3T K;  2NRT A;  3KIO A;  3IS9 A;  4DF4 A;  4CEE A;  4EIA A;  4CIE A;  4DSK A;  3QML A;  4ISF A;  3RRH A;  3OYI A;  3O9U A;  4YOT A;  5JS2 A;  2KFN A;  4MQ3 A;  5AFU A;  2IVP A;  2F8T A;  3VEO A;  4Y1D A;  3NGZ A;  4DSJ A;  1U47 A;  3CFR A;  2KHO A;  3PY8 A;  3P1G A;  1C1C A;  2YNG A;  4Q5V A;  1TL1 A;  2CGL A;  3T69 A;  4EZ6 A;  3SAH A;  2VGM A;  1KCF A;  3PX4 A;  2O8D A;  4ISG A;  4FJ7 A;  3HOS A;  1TKZ A;  2ASO A;  3J81 O;  3M3Z A;  1U49 A;  3L6Q A;  2VQF K;  1BCO A;  3ENO A;  2NRV A;  3VQ4 A;  5LJW A;  1N34 K;  5A2Q O;  4CF2 A;  1YVU A;  2QEX N;  3O3H A;  3TTC A;  4FM0 A;  1KLM A;  4FVM A;  5HLF A;  3CC2 N;  4M3U A;  2KFZ A;  3LP3 A;  3SV4 A;  3DYA A;  3Q7B A;  4AQY K;  2W6L A;  4ELV A;  1SS6 A;  3KKR A;  4FVU A;  2P9U A;  4B9U A;  5AZJ A;  1S22 A;  3K5L A;  4BR9 A;  4FWQ A;  3CXC M;  4B9V A;  4E7I A;  2YKM A;  5GAG P;  3OHR A;  4CZJ A;  3SPY A;  2CH5 A;  4DQ8 A;  4BVP A;  1SV5 A;  3HL8 A;  4KB0 A;  3A0I X;  3HSC A;  1JJ2 M;  4JYA K;  4BRI A;  1IKV A;  3VER A;  1TKD A;  4JI5 K;  1X9M A;  4PKH A;  3G0Z A;  4CJF A;  4WQ5 C;  2E1Z A;  3WNE A;  1UA0 A;  3MWT A;  1MWK A;  4RW9 A;  1NGB A;  3MCA B;  4BRP A;  1Y64 A;  4YDU C;  4B1V A;  1NLV A;  3RSE B;  2ITG A;  3CJA A;  4FCY A;  5KGX A;  5KQ8 A;  4BRG A;  4FJH A;  3O3G A;  2AA4 A;  1FKO A;  3NF6 A;  2PY5 A;  3CJ1 A;  3DRR A;  4E7J A;  1HYZ A;  3ISN C;  4BC5 A;  3A8Y A;  3HVT A;  1HQE A;  3V81 A;  5TKW A;  4F3O A;  4LFC K;  4DU4 A;  2FSK A;  1GLB G;  3ZT3 A;  2CH6 A;  1J6Z A;  3F73 A;  3BY5 A;  5J2N A;  4IOA L;  4NCA A;  3NMU A;  5AZI A;  3THW B;  3J80 O;  2HHQ A;  1U6Z A;  3OBY A;  1IBM K;  3FZL A;  3FZK A;  1H1V A;  4FWL A;  4B3S K;  1KLN A;  5KPR A;  3SAG A;  1TGO A;  1NOY A;  3CC4 N;  4JRQ A;  4U67 L;  5GIN A;  3DM2 A;  4KHQ A;  1T44 A;  1P8Z A;  2NRX A;  3AA2 A;  3QIP A;  2FF3 B;  4MLH A;  1RDA A;  1RDC A;  2YHX A;  4CFC A;  4BVO A;  4BRD A;  4JKH A;  4BRO A;  1Q8I A;  2UXC K;  2DY4 A;  3RMB A;  3DLG A;  4CJV A;  1KRP A;  4BC3 A;  4TSX A;  3H6E A;  4BRL A;  2VWK A;  3LDS A;  4O44 A;  4B9L A;  5K14 A;  1K8K A;  3AVL A;  5KQD A;  3LL3 A;  1DT9 A;  4FPA A;  1MDU B;  1D8Y A;  4MDB A;  1YIT N;  4DLE A;  4I7F A;  3KKS A;  3LAN A;  3V9U A;  1RIL A;  2RPI A;  3ULD A;  1GLF O;  2V51 B;  1NGE A;  3SZ2 A;  5HBM A;  1YTA A;  3H45 C;  3VQ7 A;  1MWM A;  3DJC A;  1VRT A;  3TAP A;  3HYF A;  4L3Q A;  3MN6 A;  1RBT A;  4CJK A;  5LMN K;  4M3R A;  1RBV A;  2FXU A;  3E66 A;  4AH9 A;  5GAD P;  4CF9 A;  3CMA N;  2HHU A;  2GEL A;  3BDP A;  3SYZ A;  3D45 A;  4AHR A;  2Q36 A;  2ATQ A;  5D3G A;  4M41 A;  1WNS A;  1SQK A;  3C7N A;  2HVH A;  4I9L A;  3PSF A;  2GX9 A;  2JWK A;  1XWL A;  2WOM A;  1LCU A;  1M90 O;  1Q9Y A;  4PL7 A;  1L3V A;  1KTQ A;  1HKB A;  4DLG A;  5AQF A;  4CGG A;  2KW4 A;  3NH0 A;  1D4X A;  3EEQ A;  4CHP A;  3DLR A;  3K9K A;  1SZ2 A;  4JAX A;  3QDK A;  5AQQ A;  4CFB A;  4YOY A; 
#chains in the Genus database with same CATH homology
 3DRP A;  1S9E A;  1GOA A;  1NK9 A;  3SUQ A;  3M8P A;  3K5O A;  4Z4H A;  1A5V A;  2XHB A;  3VA0 A;  1NKE A;  1WAJ A;  4CE9 A;  1SL2 A;  2QKK A;  3OS0 A;  4M3X A;  1JLA A;  1WSH A;  2P51 A;  3OYM A;  3TWH A;  3QEP A;  4CJW A;  3WNH A;  4I2P A;  4NCG A;  3QO9 A;  4KO0 A;  1LWE A;  1ZBH A;  2FBV A;  3KLE A;  4FM1 A;  2YKN A;  1D9F A;  3SQ0 A;  3VQE A;  1K6Y A;  4CK2 A;  3S3M A;  4F8R A;  4F3T A;  1RT5 A;  4CGD A;  1NKC A;  4OKE A;  1BHL A;  1RDD A;  3AVK A;  2IGI A;  3O4Q A;  3LWL A;  3LAK A;  2BAN A;  5J1E A;  2FBX A;  4RW4 A;  4DTU A;  3B6P A;  5T7B A;  4KAZ A;  3A2F A;  1TK5 A;  3M8Q A;  4FJG A;  1SKS A;  2OZM A;  5I42 A;  2DFE A;  1CZB A;  1ITG A;  3DLE A;  3EYZ A;  3VA3 A;  1A5W A;  4W5Q A;  5DK5 A;  1DTT A;  4LSL A;  4FZX C;  3MED A;  4N5S A;  5CYM A;  3LP0 A;  4UQG A;  2IC3 A;  4BAC A;  3DOK A;  4PQU A;  4AHC A;  1B9D A;  1VK0 A;  2Z1H A;  2JLE A;  4FLX A;  4ICL A;  3V6D A;  3TAN A;  2G8F A;  3LAM A;  3OYE A;  3SUO A;  3L2R A;  1RDB A;  1RT1 A;  1X1P A;  3SCX A;  1T03 A;  1SL0 A;  2EX3 A;  2D0B A;  1U04 A;  2F96 A;  1S1V A;  4FZZ A;  1MU2 A;  4OLB A;  3AA4 A;  1C6V A;  4CJ5 A;  1FK9 A;  3OYD A;  4Z0U A;  4PY5 A;  4W5O A;  2JGU A;  3HP6 A;  4GMJ B;  3VQB A;  4J2D A;  1J54 A;  1WSG A;  4FW2 A;  4ELU A;  1C1B A;  2IAJ A;  3AO5 A;  3ZT0 A;  3WNF A;  1IG9 A;  3SQ1 A;  4EP4 A;  4CEC A;  1Q9X A;  1WSF A;  3KLI A;  3VQC A;  3DLK A;  2BE2 A;  4E1N A;  3L2W A;  4OPK A;  1JLQ A;  4DSE A;  4DF8 A;  4J2E A;  4CK1 A;  4CF8 A;  4KI6 A;  1WSI A;  2LSN A;  5C42 A;  1Z25 A;  3KLF A;  4ZTF A;  3OYC A;  3OYH A;  2GUI A;  4IFY A;  4J2B A;  3PUF A;  4B9M A;  4FJM A;  4PA1 A;  4CHQ A;  2X78 A;  4BE1 A;  3NDK A;  3SV3 A;  3OY9 A;  2XRI A;  4KHY A;  4ID5 A;  1B92 A;  2Z1G A;  4C8N A;  1J5O A;  4B8C A;  1NJW A;  4FK2 A;  4Z4E A;  1JXB A;  3QLH A;  4E1M A;  4EZ9 A;  1S5J A;  1QE1 A;  1TK0 A;  3TAR A;  1NK6 A;  2G8W A;  1RTH A;  1RNH A;  3MAQ A;  3RMC A;  4OGC A;  4BDZ A;  4B9T A;  2G8V A;  4B08 A;  4B3O A;  3QET A;  4I2Q A;  1NK0 A;  4RW8 A;  3KK3 A;  1NKB A;  3U3G A;  2HHX A;  4CF0 A;  1EXQ A;  4DS4 A;  1KSP A;  4H8K A;  3S9H A;  3AO2 A;  4DU1 A;  4R5P A;  3C94 A;  4M45 A;  3O3F A;  4DSL A;  1RBS A;  3OYG A;  2D0C A;  3FFI A;  4HVJ A;  1X9S A;  1QSS A;  3SJJ A;  2G8K A;  2Z1J A;  3U6F A;  1VSI A;  1ZBL A;  4F4K A;  2OA8 A;  2VWJ A;  1UOC A;  2YNI A;  4QAG A;  1DTQ A;  3ITH A;  1LW0 A;  1NK4 A;  3AO4 A;  1RTJ A;  1LV5 A;  3LPT A;  1L3U A;  1RBU A;  1RT6 A;  4IFV A;  1X9W A;  2OPP A;  4BDP A;  3IRX A;  4OKJ A;  1B9F A;  1VSE A;  3NH1 A;  4ZTJ A;  2D0A A;  4DQS A;  4M3T A;  4DTN A;  4KTQ A;  1JLB A;  3L3U A;  3OYA A;  4WE1 A;  3O4N A;  3OJS A;  3RMD A;  2PZS A;  5J2M A;  4CJ3 A;  4E89 A;  4FJJ A;  4F2R A;  3V9Z A;  4E7L A;  3AA3 A;  1J53 A;  4M42 A;  1L5U A;  3RTV A;  2GV9 A;  1S9G A;  3ZT4 A;  3DMJ A;  3CG7 A;  1RT3 A;  3HP9 A;  4JLH A;  1VSK A;  2DFF A;  4E7K A;  4KB1 A;  1S1W A;  2BDP A;  3CYM A;  3L2U A;  3HO1 A;  4KRF A;  3DI6 A;  4CJL A;  2E6M A;  1LAW A;  3AVG A;  2YHB A;  4HHT A;  4DS5 A;  3G10 A;  5KRS A;  4DFJ A;  4LY7 A;  2BGG A;  1ZBU A;  4CHN A;  3V1O A;  4N56 A;  3HPO A;  2HHV A;  2HVI A;  3PO4 A;  1BQM A;  3EY1 A;  4FLY A;  4DQR A;  3K57 A;  4LD0 A;  5J2P A;  4B9N A;  3HM9 A;  4CCH A;  2HW3 A;  1SUQ A;  3NE6 A;  2VG5 A;  4CF1 A;  4CJ4 A;  3IG1 A;  2HHW A;  3C6T A;  3MEG A;  2P5O A;  1UWB A;  4DG1 A;  5CYQ A;  1GOB A;  2B5J A;  4KTW A;  3SUN A;  3AVH A;  1SKR A;  4AHV A;  4DFK A;  1IKW A;  1TVR A;  4DFM A;  3OVN A;  3LPU A;  4DU3 A;  1RBR A;  4GW6 A;  2E6L A;  2Q3S A;  3M8S A;  1KVC A;  4CK3 A;  3ALY A;  1RT2 A;  5KI6 A;  3V1Q A;  4NCB A;  4E0D A;  4MFB A;  3AVB A;  4J2A A;  3HT3 A;  3QIN A;  2XY6 A;  3PO5 A;  4XIU A;  2B6A A;  4DQP A;  1TAU A;  4O5B A;  2RKI A;  4NYN A;  4KHW A;  4IG3 A;  3K2P A;  3NF9 A;  1N5Y A;  1J9A A;  4CHY A;  4CEF A;  1F21 A;  4FLW A;  3NFA A;  3QEI A;  3TAE A;  1RTD A;  3HK2 A;  4JS4 A;  3AV9 A;  1D5A A;  1NK5 A;  2HHS A;  3VQP A;  4ID1 A;  2DTU A;  1VRU A;  2QK9 A;  4HUG A;  2HB5 A;  3TI0 A;  3KTQ A;  1L3T A;  3L3V A;  3U3Y A;  3KD5 E;  5FRM A;  1RT7 A;  2Y1I A;  4ELT A;  3CFO A;  1NJY A;  4C8O A;  4CER A;  4M3Y A;  3QNO A;  4DTR A;  4DTO A;  5CZ1 A;  3IAY A;  4G1Q A;  3HPH A;  4Z4G A;  3SI6 A;  3B6O A;  1HNV A;  2XO7 A;  1ZYQ A;  1HYV A;  1YT3 A;  4B8A B;  4BDY A;  3AVC A;  4RG8 A;  1EET A;  3ZSW A;  3OYN A;  3TR8 A;  3I0S A;  3OYK A;  3RRG A;  4M3Z A;  4CEB A;  4H4O A;  4CJE A;  3OS2 A;  2E4L A;  2RN2 A;  1IO2 A;  3OYB A;  3K58 A;  4CJU A;  3SPZ A;  2QXF A;  4DWI A;  3SQ2 A;  1BIZ A;  1JLE A;  1U4B A;  3VQQ A;  4O0I A;  4KTZ A;  3L8B A;  4FYD A;  4HCC A;  4CHO A;  4KKO A;  4CGF A;  5J2Q A;  3KIO A;  2XY8 A;  1HPZ A;  3IS9 A;  2G8U A;  2PYL A;  4DF4 A;  4DTP A;  3KLH A;  4CJS A;  2F8S A;  4O0J A;  4O4G A;  4CEE A;  2KTQ A;  2HND A;  4CIE A;  3LZI A;  3AA5 X;  4DSK A;  1R0A A;  3CM6 A;  4JRP A;  3RRH A;  1RTI A;  3OYI A;  1XI1 A;  3AVI A;  4PWD A;  3VQ8 A;  4CFB A;  1VSF A;  2KQ2 A;  5JS2 A;  3ZCM A;  2KFN A;  1NJX A;  1A5X A;  4MQ3 A;  2F8T A;  1TK8 A;  1TV6 A;  3LZJ A;  2YNH A;  4Y1D A;  1RT4 A;  3LP1 A;  4CJQ A;  4YFU A;  4IG0 A;  4BWM A;  3NGZ A;  4DSJ A;  3K59 A;  4FZY A;  1U47 A;  3CFR A;  2PYJ A;  4IKF A;  2X6N A;  3AVA A;  1VSH A;  3NAE A;  3TAQ A;  4KV8 A;  4H4M A;  3PY8 A;  1WLJ A;  1KFS A;  3P1G A;  1C1C A;  2YNG A;  1KVB A;  1HQU A;  3NGY A;  4Q5V A;  1TL1 A;  1C0M A;  2X74 A;  1DLO A;  1YTU A;  4FXD A;  3RR7 A;  4EZ6 A;  1ASV A;  4OGE A;  4CED A;  4CEQ A;  3VQ6 A;  1KCF A;  3OYF A;  3PX4 A;  4DFP A;  1HYS A;  3QEW A;  2IOC A;  4CEA A;  4FJ7 A;  4Z4I A;  1UAX A;  5I3U A;  4Z4C A;  1TKZ A;  4E19 A;  1QSY A;  2ETJ A;  1UA1 A;  3JYT A;  5KTQ A;  4M3W A;  5FDL A;  3LWM A;  1U49 A;  4CFD A;  4I9Q A;  1BCO A;  2ZQB A;  1T05 A;  2KZZ A;  4JS5 A;  3PX0 A;  4CES A;  3LAL A;  3VQ4 A;  4FK0 A;  4AHS A;  4RW6 A;  4CJT A;  1JXE A;  1NJZ A;  3VQ5 A;  4CF2 A;  3HST B;  4QOZ B;  1YVU A;  4FJK A;  4K8X A;  4O55 A;  3O3H A;  5HRN A;  3ASM A;  4FM0 A;  1KLM A;  4FVM A;  1TKT A;  5HLF A;  4E7H A;  1D9D A;  5CZ2 A;  4M3U A;  3MXJ A;  2KFZ A;  3LP3 A;  3H08 A;  4DTJ A;  2IS3 A;  3DYA A;  3SV4 A;  4K8Z A;  3ZSQ A;  3K5M A;  3ZT2 A;  3OYL A;  3CQ8 A;  3ZSR A;  4ELV A;  1BIU A;  5HRS A;  3KKR A;  3ZSO A;  4Z4F A;  4FJ9 A;  3NCI A;  5HRP A;  1JLG A;  3QEX A;  4B9U A;  1KFD A;  3V1R A;  2XY7 A;  1LWC A;  3K5L A;  5DMR A;  2I5J A;  1EKE A;  4B9V A;  3VN5 A;  4E7I A;  1T7P A;  2YKM A;  3PX6 A;  3THV A;  3ZSX A;  5EU7 A;  2HMI A;  2R7Y A;  4CJR A;  3SPY A;  1NK8 A;  1BI4 B;  1IH7 A;  1LW2 A;  3WNG A;  4CIG A;  3KK2 A;  3V9X A;  4LH5 A;  1EX4 A;  3EZ5 A;  4FJL A;  4C8K A;  3I8D A;  3KLG A;  1SV5 A;  3HL8 A;  4KB0 A;  3NHG A;  3QER A;  4KHU A;  3TAF A;  2WON A;  2B4J A;  1W9H A;  1IKV A;  2FBT A;  1TKD A;  4FJN A;  4C8L A;  3QES A;  1IKX A;  1X9M A;  4CJF A;  3G0Z A;  3ZSY A;  4W5R A;  3HPG A;  4DSF A;  3RR8 A;  4DSI A;  3AVJ A;  1FXX A;  3WNE A;  1UA0 A;  1C1A A;  1S1T A;  5KGW A;  1BQN A;  4W5N A;  1HJR A;  3AO3 A;  4CGJ A;  5KRT A;  4RW9 A;  3TAG A;  3DLB A;  2FBY A;  1CLQ A;  1GOC A;  2XY5 A;  3DLH A;  4KRE A;  3HVR A;  5CY4 A;  3JSM A;  2ITG A;  4FCY A;  1XHZ A;  1FKP A;  5C25 A;  5KGX A;  3V4I A;  1JL2 A;  5HP1 A;  3C6U A;  3CM5 A;  4DTM A;  4FJH A;  4KHN A;  3O3G A;  4FK4 A;  1S1X A;  1XHX A;  2X6S A;  1FKO A;  3NF6 A;  4FLZ A;  2W42 A;  1BCM A;  2FC0 A;  2P1J A;  3DRR A;  2A1S A;  1HYZ A;  4E7J A;  1HMV A;  2PY5 A;  3UIQ A;  1NOZ A;  1I3A A;  3ISN C;  3NBP A;  3HVT A;  4KHS A;  1WN7 A;  1HQE A;  3VQD A;  1VSJ A;  1LWF A;  4CGI A;  3V81 A;  4OPJ A;  2HNZ A;  2AJQ A;  4F3O A;  4ZHR A;  4DU4 A;  4FJX A;  4AIL C;  4RW7 A;  3ZT3 A;  5HRO A;  4KPY A;  3L2Q A;  1HNI A;  3F73 A;  3K5N A;  4BE0 A;  2QKB A;  3E01 A;  3P5J A;  4CEO A;  5J2N A;  3SUP A;  2VG7 A;  4AHU A;  4C8M A;  4NCA A;  1ASU A;  4FLU A;  1TKX A;  3NF7 A;  4N47 A;  4CFA A;  2HHQ A;  3MEE A;  3L2V A;  2IDO A;  1L3S A;  1TAQ A;  3ZT1 A;  3TAM A;  3ZSZ A;  2O4G A;  3OJU A;  2VG6 A;  4HUF A;  3F9K A;  1WSJ A;  3S3O A;  1W0H A;  1KLN A;  1CZ9 A;  1VSM A;  2GBZ A;  1SKW A;  3I0R A;  1TGO A;  4CGH A;  1NOY A;  1QS4 A;  1S1U A;  1C0T A;  1BGX T;  4JRQ A;  1Y97 A;  4IDK A;  3DM2 A;  4DMN A;  4KHQ A;  2HHT A;  1IKY A;  4Q0B A;  3VQA A;  2KZM A;  3MEC A;  3AA2 A;  1CXU A;  1JLC A;  1JLF A;  3QIP A;  3MXI A;  5FRN A;  1RDA A;  2Y1J A;  5SZT A;  1RDC A;  3KD1 E;  2OPS A;  5HRR A;  4CFC A;  4FJ5 A;  1U48 A;  5JS1 A;  4CHZ A;  1ZBI A;  5SWM A;  1BL3 A;  1Q8I A;  3AO1 A;  3C95 A;  1I39 A;  3DOL A;  3T3F A;  4DTS A;  4Y1C A;  2DY4 A;  3RMB A;  3DLG A;  4CJV A;  3OYJ A;  1LAV A;  3ZSV A;  1KRP A;  4FLV A;  4TSX A;  4PUO A;  3NGI A;  3NH2 A;  2VWK A;  3LDS A;  4O44 A;  1HRH A;  4B9L A;  5K14 A;  1ZBF A;  3T1A A;  3AVL A;  2NUB A;  1RCH A;  3P83 D;  4N76 A;  2RF2 A;  3SQ4 A;  4KI4 A;  1D8Y A;  4FJI A;  1KVA A;  4N41 A;  4DLE A;  4I7F A;  3KKS A;  3LAN A;  3VQ9 A;  1VSL A;  3V9U A;  2OZS A;  1RIL A;  1U45 A;  2RPI A;  3ULD A;  2A1R A;  4FW1 A;  2G8H A;  3CFP A;  1REV A;  1JKH A;  1JL1 A;  4OKK A;  1WSE A;  5HBM A;  1QQC A;  3SZ2 A;  4HTU A;  4QCL A;  1YTA A;  3HXM A;  3VQ7 A;  4BWJ A;  3QNN A;  3RMA A;  3SNN A;  1EP4 A;  1S6Q A;  4OJR A;  4E3S A;  3T19 A;  1VRT A;  2D5R A;  1CXQ A;  3TAP A;  4W5T A;  1BI4 A;  4L8R B;  3HYF A;  1WAF A;  4FJ8 A;  3QIO A;  4IBN A;  3PV8 A;  2G8I A;  1T8E A;  1RBT A;  4CJK A;  2DFH A;  3M8R A;  2ZD1 A;  1N6Q A;  1TL3 A;  4M3R A;  3QEV A;  4DQI A;  1RBV A;  4B9S A;  2O4I A;  4NYF A;  4AH9 A;  3V9S A;  3MXM A;  1Z26 A;  2YNF A;  4CF9 A;  4EP5 A;  3KK1 A;  3BDP A;  4OLA A;  2HHU A;  3SYZ A;  4FM2 A;  3D45 A;  5E41 A;  4AHR A;  4DTX A;  3S3N A;  3AVN A;  4HCB A;  2ATQ A;  5D3G A;  4YNQ A;  1O1W A;  2EHG A;  1QTM A;  4F2S A;  4M41 A;  4AHT A;  3OS1 A;  4CEZ A;  1WNS A;  1SL1 A;  4FLT A;  2HVH A;  4I9L A;  4KFB A;  2ZE2 A;  3BGR A;  1VSD A;  1NK7 A;  1C0U A;  1XWL A;  2WOM A;  3KJV A;  2P5G A;  3AVM A;  3AVF A;  2HNY A;  3D0P A;  1QHT A;  4BE2 A;  2OPQ A;  3TAB A;  2Z1I A;  4LH4 A;  2OPR A;  1Q9Y A;  4CJP A;  1XC9 A;  1QSL A;  1BIS A;  1L3V A;  1G15 A;  1KTQ A;  5C24 A;  4HUE A;  4DLG A;  4CGG A;  4DQQ A;  3RWU A;  4LSN A;  3NF8 A;  4GVM A;  2KW4 A;  3HJF A;  2OYQ A;  3NH0 A;  2YV0 X;  4CHP A;  3LP2 A;  5FRO A;  1ASW A;  3DLR A;  4CIF A;  3V9W A;  4OVL A;  1S6P A;  2YHA A;  3DRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...