1B9FA

Mobility of an hiv-1 integrase active site loop is correlated with catalytic activity
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
155
structure length
151
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFAIPYNPQSQAVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (INTEGRASE)
publication title The mobility of an HIV-1 integrase active site loop is correlated with catalytic activity.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (clone 12)
molecule tags Transferase
total genus 55
structure length 151
sequence length 155
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1b9fA00
5DK5A 1HQUA 3L3VA 4IG3A 3TARA 4KTQA 4Q0BA 1UWBA 3AO1A 3VQ4A 4E89A 3NCIA 3SV4A 3KLEA 4OKEA 4CK3A 4CHQA 3S9HA 4KKOA 3RRGA 1SKSA 1K6YA 1RTDA 4BDPA 2XY7A 4KTWA 3IAYA 3VQCA 3HJFA 3G10A 4DSLA 1UAXA 4DTPA 2HW3A 3ALYA 3DLHA 4KHNA 2HVHA 1L3TA 4ZHRA 4CEZA 3SUNA 4H4MA 4DSFA 3BDPA 4B9UA 4Y1CA 1SUQA 3SPZA 4BDYA 3TAEA 2FBTA 1TK8A 4KAZA 4QCLA 1TV6A 4C8MA 4CE9A 3I8DA 4FJ9A 2FC0A 3SPYA 4DF4A 1KCFA 1D9FA 3TAQA 3O4NA 3DRRA 1TKXA 4IDKA 4JS5A 1T05A 3ZT1A 1U45A 1F21A 1JKHA 3E01A 2EHGA 5K14A 2IOCA 3QERA 1TKTA 1NJZA 3V81A 3DLKA 4CIGA 2JGUA 3HVRA 3FFIA 4DSIA 4F2RA 4AHVA 3LZJA 3VQQA 1RT7A 3KKSA 5T7BA 4E0DA 2KFZA 3QEWA 1KVCA 4ICLA 4CGHA 4KI4A 2X6SA 3ZSQA 4DU1A 4CEQA 1BCMA 4L8RB 3SV3A 1LWCA 1RDCA 1U47A 3PX6A 3EY1A 4DQSA 2YKMA 1L3VA 3OJUA 4J2DA 3AVHA 3EZ5A 3NF7A 1REVA 4RW6A 3SZ2A 2IS3A 4DS5A 1BQNA 4FLZA 1N6QA 1KVAA 5KRSA 2O4GA 3OS0A 2ZD1A 3QO9A 4CEOA 4CJUA 3LP2A 3L2QA 3MAQA 4KHSA 5CY4A 4E19A 1NOYA 4DLGA 1JL1A 3OS2A 4DSKA 3F73A 4CGGA 4PUOA 1WSIA 3MEGA 4IFYA 3QEXA 2HVIA 3ZSYA 3KD5E 3C95A 4E7IA 2HHTA 3V9ZA 1VSHA 3DLEA 3HPOA 5SWMA 1ZBLA 1U49A 1T03A 4BE0A 1WSJA 2HNZA 2P51A 2YNHA 3RMAA 2PYLA 4LSLA 1RBTA 3LAKA 4DSJA 4H8KA 3SUPA 1VSFA 3M8QA 5KGWA 3OYBA 1KTQA 1RILA 4KRFA 1B9FA 4OGCA 1GOCA 5C24A 3HSTB 3M8RA 5KGXA 1QSLA 3HL8A 1SL1A 4KPYA 4EZ6A 5CZ1A 3LALA 4CGJA 4HUGA 3RMDA 4F2SA 3AVMA 1C0TA 1HNIA 5KRTA 4DTMA 4CF2A 2KZZA 1S5JA 1C0MA 4BE1A 1TAQA 1T8EA 4MQ3A 4FJNA 1L3UA 3PX0A 3KTQA 3MXIA 1R0AA 2G8WA 1NJWA 2KFNA 4I2PA 1ASWA 2IAJA 3DLGA 1TVRA 2YNGA 3AA2A 3VQAA 4DTXA 4CJ4A 1IKYA 3KLHA 1YVUA 4DS4A 3VN5A 3DYAA 3HM9A 2XRIA 1DTTA 4DU3A 1NK8A 4Z4GA 4ID1A 5KTQA 4FLVA 2E6LA 4DQRA 4DTRA 5HP1A 3VQDA 3MEDA 4DF8A 3CG7A 4DTJA 4C8OA 2X6NA 3AO4A 4CEBA 3KLGA 1ASUA 1LW2A 1RDDA 3HPHA 4CGFA 3V9WA 3QEVA 1HRHA 4TSXA 3NGIA 1KVBA 4CHNA 1RBUA 2DFHA 2XY8A 3NF9A 3RTVA 2ITGA 3C94A 1NK0A 4M3YA 3OYMA 4CJ5A 2BE2A 4CHZA 3SQ0A 3K5MA 4BWJA 4O44A 1S1VA 1QTMA 3OYEA 4CESA 1SL0A 1RTHA 1C0UA 4O0JA 3OYIA 1RBSA 2Z1HA 4OKJA 1JLFA 1VSDA 2FBVA 2Z1GA 5HRRA 4CGDA 4BE2A 4O5BA 1BI4A 4E3SA 4B9NA 2HHXA 1GOAA 3PO5A 1O1WA 3PUFA 4Z4HA 3SYZA 3WNHA 3ZSOA 3QNOA 1D9DA 4FK4A 3HP9A 4LH4A 3VQ6A 3ZSRA 1LWEA 4DTUA 4B08A 1GOBA 1TL1A 2XY6A 2VG6A 3ZT2A 4Y1DA 3L2UA 3LP0A 2VWJA 1S6QA 3NH0A 2X74A 3QNNA 2OYQA 3PX4A 1IKVA 3NFAA 1KLNA 3O4QA 4DMNA 2NUBA 1RT2A 3ULDA 4KREA 3SQ4A 2KZMA 3LPUA 3AV9A 4PY5A 1RT3A 3QESA 4DFPA 1MU2A 1TL3A 4DFKA 1W9HA 3RMBA 4OVLA 1QHTA 4XIUA 1QSSA 4FJMA 2B4JA 1S1UA 3K58A 2QKBA 3O3HA 5J2MA 2RF2A 2RKIA 3TAMA 1XHXA 1JLCA 1LAVA 2B6AA 2I5JA 1SL2A 5KI6A 4M3TA 3AVBA 4FM0A 4Z4EA 2HNDA 4CJTA 3OYFA 2DFFA 4FVMA 4LY7A 1WSHA 4KI6A 3TAGA 4B3OA 3L2VA 3JYTA 3SI6A 4B9TA 1CZBA 1CXUA 1CLQA 1NKBA 1LV5A 4E7HA 4FJKA 1ZBHA 2HB5A 3LDSA 4M45A 2XHBA 3NDKA 3V9SA 3NF6A 4F8RA 3AVFA 4CK2A 4CHOA 1TAUA 4CF8A 1KFSA 2F8SA 2B5JA 3NF8A 4CGIA 1WSFA 1NOZA 2QXFA 4KO0A 1YTUA 1KRPA 3RR8A 3P83D 3V1QA 2OPRA 1U48A 1BISA 4AHTA 3SUOA 1FXXA 2FBYA 2P1JA 2LSNA 2YHAA 1SV5A 1FK9A 4FJJA 1HYZA 4CJRA 3V4IA 4FLTA 4E1NA 4FLUA 4W5TA 4FCYA 1DLOA 3VQEA 3K5LA 4R5PA 4RW8A 4RG8A 1ZBUA 4CJ3A 2HNYA 1A5XA 3CM5A 4I2QA 3KLFA 1KSPA 2G8KA 1FKOA 1HJRA 4DG1A 3KD1E 3OYNA 1NJYA 4JRQA 4FZYA 3HP6A 3F9KA 2FBXA 4W5RA 1RBVA 3K5NA 4M3WA 2RPIA 1RTJA 3I0RA 2AJQA 2YKNA 4BDZA 4HUFA 1RNHA 4F4KA 3AVJA 1U04A 3K57A 1QQCA 1X9MA 4DFMA 1S1TA 3OY9A 1XC9A 4KB0A 4M3XA 4C8LA 3ZT4A 1BI4B 1BL3A 3QETA 3SNNA 2G8FA 1XWLA 3AO2A 4CK1A 3V9UA 3AA4A 1D5AA 4HUEA 2D0AA 5HRSA 1C1AA 3TAPA 3ZT0A 3NHGA 1WNSA 4KFBA 4N76A 3VQ7A 2ETJA 3SCXA 1HMVA 3DM2A 2KW4A 3HXMA 1L5UA 4FJLA 3U3YA 4N5SA 3KIOA 3AVNA 3CM6A 3WNFA 4KV8A 4FJXA 3OYHA 3S3OA 1VSMA 4NYFA 3OYAA 3OYGA 3TR8A 2OA8A 1EKEA 4N41A 4HCCA 1JXEA 4DTOA 3TAFA 1JLAA 4FLWA 3SJJA 3MXJA 3T1AA 2P5OA 3A2FA 1J9AA 3WNGA 1S9EA 5CZ2A 1TK5A 2OZSA 4ELVA 1LWFA 2BGGA 4Z4FA 1HQEA 4AILC 3P1GA 1B9DA 3CFOA 1UOCA 4FLYA 3QLHA 1S1XA 4KHYA 2G8IA 4FJGA 3AVKA 4LD0A 3S3MA 3PY8A 3LWLA 1S1WA 4CFCA 4FM1A 4FXDA 2ZQBA 1QS4A 1VK0A 2GUIA 2IC3A 4IG0A 4LSNA 1TKZA 3KLIA 3K5OA 3QINA 4CJVA 2W42A 4ZTFA 1NJXA 1DTQA 1RT4A 4F3OA 4FJHA 3AVGA 3NH1A 4KHWA 4FW2A 4AHSA 2HMIA 3IG1A 3HVTA 3K2PA 4NYNA 4CJLA 1JLGA 4IFVA 3V1RA 4C8NA 3VQ9A 2KTQA 1W0HA 4GW6A 1VRTA 1SKWA 2HHVA 1ITGA 1J5OA 2IGIA 1BIUA 3T19A 3ZSWA 1SKRA 3DLBA 4O55A 1NK7A 2G8VA 4KB1A 1JLBA 3CYMA 1BGXT 4FW1A 3LP3A 4I9LA 4O4GA 1J54A 2XO7A 3NGZA 1JLEA 4LH5A 4DQPA 4ELUA 3L8BA 2PY5A 5J1EA 3EYZA 1NK9A 1HNVA 1Q8IA 1RDAA 2EX3A 4NCAA 5HRNA 1WN7A 2O4IA 4NCBA 2GBZA 1RT6A 4CIEA 3AVCA 4AHCA 4DQQA 5HLFA 1RTIA 3OYLA 1JL2A 3PV8A 4YFUA 1ZBFA 4O0IA 4CEFA 1ASVA 4JS4A 3RWUA 3ZSZA 1BCOA 3KK2A 3ZSXA 4YNQA 4N56A 5FRNA 4PWDA 5JS2A 4FYDA 3O3FA 3BGRA 1YTAA 2E6MA 4B8CA 4FLXA 1X9WA 3HK2A 4CIFA 3LAMA 3OYDA 1XHZA 3AA3A 3QIPA 4CJQA 4CF9A 1VSKA 1CZ9A 4CECA 4HCBA 3S3NA 4FZXC 1WLJA 4OKKA 1TKDA 4FJ8A 4BACA 4ZTJA 4RW9A 2YNFA 1Z26A 2D0BA 5HROA 3L2WA 4H4OA 4W5QA 4HHTA 3PO4A 4WE1A 4EP4A 3D45A 3AO5A 3ZSVA 1Q9YA 2HHQA 4E7JA 4CJWA 3M8PA 3QIOA 1BHLA 3NBPA 3OYKA 1G15A 2DY4A 4BWMA 1VRUA 1FKPA 3HYFA 5FDLA 5FROA 2Y1JA 4W5NA 4RW7A 1I39A 4FJIA 1KLMA 1NK5A 1NK4A 3NAEA 3AVLA 3ZCMA 2OPSA 4B9VA 1JLQA 2YV0X 1U4BA 3WNEA 4C8KA 3DRSA 4IBNA 2OZMA 2QK9A 5I42A 4I9QA 3VQPA 2Z1IA 4CEDA 3TI0A 4CJPA 1BQMA 3CQ8A 4DLEA 5DMRA 1EP4A 4B8AB 5J2QA 2VWKA 4DU4A 3DLRA 4PQUA 1TK0A 4DQIA 4CFBA 2BANA 4N47A 1VSLA 4FK2A 2R7YA 2D5RA 2WOMA 4OLAA 4K8XA 3L3UA 4M3UA 5E41A 1TGOA 4Q5VA 5D3GA 4DSEA 1RBRA 4M41A 3LANA 3ISNC 3ZT3A 4HVJA 1X9SA 3MEEA 1D8YA 4M42A 2G8HA 1X1PA 3U6FA 4F3TA 4DTSA 4DWIA 3I0SA 5J2NA 5JS1A 4DFJA 3V9XA 1LAWA 4B9SA 1WAJA 4Z4CA 4KTZA 1B92A 1YT3A 4CEEA 1UA0A 3RR7A 1Z25A 2Q3SA 3SQ1A 3MECA 4CF1A 4FJ5A 1Y97A 3QEPA 3DOKA 3KK3A 3T3FA 4K8ZA 4CF0A 1S6PA 2IDOA 4EZ9A 2DFEA 2KQ2A 3AO3A 1C6VA 4CERA 4OPKA 4KHQA 2F8TA 1EXQA 1WSEA 3NH2A 3P5JA 1WAFA 4E1MA 1UA1A 3VA0A 3D0PA 2DTUA 3OS1A 2Z1JA 1S9GA 3IS9A 3HT3A 3DOLA 1NK6A 1HYSA 4CJSA 2GV9A 4B9LA 2D0CA 1NKEA 2PYJA 1C1BA 5EU7A 2VG7A 3DRPA 5CYQA 3HO1A 3G0ZA 3MXMA 2OPQA 3AVIA 4ID5A 4CEAA 1N5YA 1RT1A 2XY5A 3OVNA 4PA1A 1HYVA 5CYMA 4AHUA 1RT5A 5C42A 3KJVA 1LW0A 2ZE2A 2YHBA 3C6UA 3THVA 1XI1A 4M3ZA 2RN2A 3C6TA 4CHYA 1JXBA 3AA5X 3O3GA 5J2PA 2G8UA 3B6PA 3IRXA 2A1SA 2ATQA 5I3UA 5HBMA 3TWHA 4CFDA 4RW4A 1L3SA 3NE6A 4B9MA 4FZZA 1ZBIA 3M8SA 3OJSA 4E7LA 2Y1IA 4MFBA 3UIQA 4UQGA 3B6OA 4OPJA 1A5WA 4CJFA 3LPTA 1IG9A 3RRHA 3K59A 2BDPA 4M3RA 1VSEA 5SZTA 4JLHA 5FRMA 1IH7A 2X78A 1C1CA 1IKWA 1J53A 1CXQA 1VSIA 2HHSA 2VG5A 3V6DA 4J2EA 1EETA 1NKCA 4QAGA 4AH9A 4FJ7A 2YNIA 2WONA 3KKRA 3LWMA 1Q9XA 4FK0A 4OJRA 2E4LA 3VQ5A 4CJEA 4JRPA 4ELTA 4IKFA 1HPZA 3ASMA 2F96A 1WSGA 2HHWA 1QSYA 1KFDA 3QEIA 1ZYQA 3L2RA 3KK1A 1IKXA 3DI6A 3V1OA 4W5OA 3U3GA 4CHPA 4Z0UA 1RCHA 1IO2A 3SUQA 3ITHA 1I3AA 3HPGA 4OGEA 3VA3A 4FM2A 3H08A 1VSJA 3TANA 2P5GA 3TABA 2HHUA 3OYJA 4J2AA 4Z4IA 3CFRA 4KHUA 2JLEA 4CFAA 2A1RA 3SQ2A 2PZSA 3LP1A 3DMJA 1BIZA 1QE1A 1RDBA 1A5VA 3VQBA 5HRPA 3OYCA 2OPPA 4EP5A 3RMCA 3LZIA 2QKKA 4GVMA 4CCHA 4NCGA 4QOZB 1EX4A 3VQ8A 4I7FA 3JSMA 4G1QA 4GMJB 4J2BA 4CJKA 1T7PA 4HTUA 4AHRA 3AVAA 3NGYA 5C25A 3CFPA 4DTNA 4E7KA 4OLBA
chains in the Genus database with same CATH superfamily
3MN7A 3C65A 1XMQK 5AQHA 4IDHA 3NCIA 3SV4A 4BRQA 2P9NB 4BDPA 4KTWA 3LDNA 5GAEP 3ALYA 3DLHA 1L3TA 4B3MK 4CEZA 4H4MA 2I7NA 1TV6A 4BVOA 4FJ9A 2FC0A 4DV0K 4BRHA 4DF4A 1KCFA 1D9FA 2CGKA 3CHWA 2EHGA 4IXCA 1NJZA 1YVNA 4BGBA 2JGUA 2A3ZA 3CCJN 4DSIA 3EEQA 3VQQA 1RT7A 3VMFB 5GINA 3WUHA 3EY1A 2IS3A 4JHDA 4CJUA 2FLOA 1FW6A 1JL1A 3HI0A 2P9PB 4PUOA 3ZSYA 3KD5E 2HHTA 3V9ZA 1ZBLA 4BE0A 2HNZA 3RMAA 2WTUA 5EY4A 3NVKA 1KTQA 3M8RA 4DB3A 3CJ1A 4YDUA 4DV5K 3QFUA 5KRTA 1ATSA 1S5JA 1T8EA 4UY8O 3MN9A 3EKUA 1L3UA 3PX0A 3MXIA 1NJWA 4I2PA 3DLGA 2D1KA 3FZKA 3KLHA 1YVUA 1J5EK 2XRIA 1NK8A 4DHYA 1X9JA 2ZF5O 4YOXA 4DTRA 4DF8A 3CG7A 4DTJA 4C8OA 1LW2A 5GIOA 3V9WA 3QEVA 3NGIA 3H1VX 4FPAA 4CHNA 3NF9A 3FGUA 1RDWX 4M3YA 3SQ0A 4CHZA 4BWJA 5F2RA 1SL0A 4HWIA 3IMXA 1RBSA 2Z1HA 2FBVA 4CGDA 1ZBSA 1JJ2M 2D0OA 1VQ4N 4E3SA 4E1JA 1O1WA 4CBUA 3SAGA 2QWPA 1M1KO 3SYZA 2HF3A 3QNOA 3HP9A 3VQ6A 4CJ7A 2GWKA 3N4PA 4C1NI 4X66K 3CCLN 3ZT2A 2NRVA 3L2UA 2Q97A 5BN8A 1S6QA 1GLJO 4A61A 3PX4A 1IKVA 3ULDA 3LDLA 1N32K 5IT9O 2ASPA 3RMBA 1NGJA 3CC7N 1QHTA 4OO1J 3L4QA 1XHXA 1OVYA 1NGHA 1FJGK 3CIPA 4O8KA 3T1HK 3THWB 4BROA 5BRFA 3VERA 5IWAK 4B3OA 3SI6A 1CLQA 1NKBA 4E7HA 1E3MA 3BP8A 3LDSA 4WQ5C 3V9SA 4LC9B 3J8AA 3AVFA 4CK2A 1KFSA 1NOZA 3P83D 2OPRA 1BISA 4AHTA 4WQ4A 1VQ5N 3CERA 3KVGA 4IOAL 2LSNA 4RWTA 1FK9A 4H5NA 1RFQA 3K5LA 4RW8A 1ZBUA 3ULEA 4CJ3A 2UUBK 4I2QA 3KD1E 1KSPA 1YTUA 1FKOA 1HJRA 3FE1A 3HP6A 4M3WA 3R9PA 3I0RA 3G25A 2NRWA 1J6ZA 1NGDA 4JK8A 4MLHA 3A5MC 3DXKA 3K57A 4JI1K 1X9MA 4DFMA 4CZGA 4KB0A 3FZLA 3DXMB 5AQQA 1XC9A 1BI4B 1BL3A 1N34K 2P9SB 4O8UA 4JI2K 1U2VA 3L6QA 3AA4A 2D0AA 5HRSA 1VQNN 2ZM6K 4DR1K 3JXUA 4H5VA 2CH5A 3R8EA 4FJLA 3WNFA 3AVNA 3CM6A 5CHIA 3WEEA 1VSMA 4N41A 5BPLA 1JXEA 4ILJA 5KPRA 1KQSM 4FLWA 2P5OA 3TTDA 4BVPA 2QI2A 3WNGA 1U6ZA 3EL2A 3P1GA 4FLYA 3CFOA 1ZXOA 4LF4K 4LD0A 4CFCA 4CZKA 3CCSN 3KLIA 1DTQA 3AVGA 4XEIA 3O9QA 4FW2A 4AHSA 3VF6A 1MA9B 3IG1A 1KAYA 3K2PA 1JLGA 4IFVA 2GEMA 2KTQA 2HHVA 4GW6A 2IGIA 3DLBA 4KB1A 3LM2A 4B1XB 4JKGB 4H5WA 3C6HA 3GDQA 4U7BA 2EX3A 5HRNA 3H3NO 3O80A 1RT6A 4EFHA 4DQQA 5BR8K 1DKGD 3PV8A 5AQJA 2JWLA 5A2QO 4JS4A 5FRNA 4YNQA 5AQZA 2E6MA 3OA9A 3LAMA 2F9TA 1TYQA 5F0XA 3VGLA 3AA3A 4CJQA 5AQMA 4CF9A 4FJ8A 1TUYA 3P4IA 2YNFA 5HROA 1K73O 4H4OA 3I55N 4CZFA 3AO5A 2HHQA 4E7JA 1BHLA 1WB9A 4BWMA 2QXLA 4A2AA 4BRDA 4GNIA 1E4GT 5FROA 4RW7A 4FJIA 1KLMA 3IKMA 1NK4A 3EN9A 3ZCMA 1QVGM 3DRSA 2QK9A 3VQPA 2Z1IA 3TI0A 1BQMA 3KK7A 3CQ8A 5DMRA 3WXMB 4H0XB 4DLEA 2E5LK 2DPNA 2W41A 4CFBA 4DV7K 2BANA 4FWPA 4N47A 2R7YA 2D5RA 3CQYA 4OLAA 5E41A 4B9QA 5D3GA 1GLAG 1SQKA 1X9SA 2HBKA 1D8YA 3RSEB 1X1PA 3U6FA 4F3TA 1ATNA 3GG4A 3V9XA 3VF2A 4KTZA 4WFNL 2CGJA 3MECA 4CF1A 1MWKA 1Y97A 3QEPA 3DOKA 3KK3A 1YF5L 1NMNA 4CF0A 2KQ2A 4CERA 4KHQA 2F8TA 1YJ9N 1WSEA 1V4SA 3P5JA 3SBGA 1I94K 3VA0A 3OS1A 3DWLA 1NKEA 1T6DA 4BRMA 1YIJN 3HO1A 3MXMA 1N5YA 4ID5A 5FPEA 2Q31A 3C0BA 4ISEA 2FSKA 3C6TA 4CHYA 1JXBA 3AA5X 2VGMA 1XMOK 2ATQA 4LFAK 4XH4A 3G71N 3TSPA 5HBMA 4E7LA 1S3XA 2Y1IA 4CI6A 2PBDA 4UQGA 4A62A 2P9LA 3B6OA 4OPJA 4CZMA 4M3RA 4B3SK 1C1CA 1IKWA 4GKJK 1HKGA 4KH6A 1EETA 2J4RA 4BRPA 1NKCA 4J2EA 3BEXA 3TTFA 2QWLA 2P9PA 4CW7B 4BR2A 4ELTA 4IKFA 1HPZA 5M1NA 4MO4A 3QEIA 3IUCA 2F4VK 1IKXA 5AFUH 1IO2A 4CBWA 3ITHA 4OGEA 4X64K 3H08A 1C0GA 1YXQA 3C7NB 3SQ2A 4CBXA 1IBKK 2PZSA 4QS9A 1QE1A 2IVPA 3VQBA 3VEWA 4EP5A 2BH1A 3J7YP 2QWRA 4NCGA 1OH6A 4QOZB 2E2OA 3VQ8A 4GMJB 3CPWM 3UE5A 3ID6A 4HTUA 3VEZA 4E7KA 1YHQN 3C6AA 1IG8A 1HQUA 3L3VA 4Q0BA 1UWBA 3VQ4A 4E89A 4YOUA 3KLEA 4OKEA 4CK3A 3S9HA 3SBTA 4KKOA 1EWQA 1RTDA 3QBXA 4BRFA 1YI2N 1UAXA 4DTPA 1BOTO 4DUZK 2HBLA 1QQMA 3DLLL 4KHNA 2RHKA 4ZHRA 5ADXA 4B9UA 4Y1CA 3U4LA 4KAZA 4QCLA 4CVNE 1HNXK 1QQNA 3KZBA 3O4WA 1XNQK 3O4NA 5GAHP 4JS5A 4IO9L 1U45A 4KTQA 3E01A 5K14A 1TKTA 3V81A 2GTDA 3DLKA 3HVRA 3FFIA 1NGCA 4F2RA 4RCHA 2KFZA 4PL7A 1KC8O 2O8FB 4ICLA 4CGHA 4KI4A 3ZSQA 4CEQA 3B8AX 1RDCA 3E9OA 2QEXN 4J2DA 4PKIA 3SZ2A 4DS5A 3BF1A 4BRIA 3H45C 1KVAA 4J8FA 5KRSA 4YOWA 4DR6K 4E19A 3OS2A 4CGGA 3MEGA 3EE8A 3J81O 3HSCA 3A0IX 3THWA 4OPAA 1VSHA 3ZEUB 1T03A 5SWMA 1U49A 5AQGA 2P51A 2PYLA 2WUSA 1CZAN 3CMAN 4DSJA 1VSFA 1RILA 3ZYYX 1GOCA 1QSLA 1SL1A 3THXB 4EIAA 4F2SA 1EWRA 1C0TA 3UKUB 4CF2A 3ID8A 2KZZA 1TAQA 3WT0A 4FJNA 2FF3B 4BC3A 5LMNK 5M1OA 2YX6A 1R0AA 1ASWA 3K0SA 4DTXA 3AA2A 3M6GA 1IKYA 3IDHA 5EXWA 4B1ZA 2GX9A 3DYAA 1DTTA 3Q7CA 1Q86O 3VQDA 3MEDA 3F2KA 3VOVA 4B1VA 5AQFA 3GE1A 2NRTA 3HPHA 2XY8A 3RTVA 3WXKA 4LF9K 3C94A 4FWNA 2Q2RA 3K5MA 4O44A 3OYEA 4O0JA 3TSUA 4BE2A 1UA0A 5HRRA 1JLFA 2HBJA 2Z1GA 4K41A 1BI4A 4B9NA 1GOAA 2P9SA 3LDOA 1O13A 4FK4A 1LWEA 2A41A 4B08A 2F7TA 1TL1A 3ENOA 2P9IB 2GUPA 3A5NC 2OYQA 2E1YA 3O4QA 4DMNA 3FLCO 3MX5A 3F5TA 3SQ4A 1GLLO 5C2DA 3LPUA 2KZMA 4IZ9A 3QESA 1MU2A 1QSSA 4FJMA 1S1UA 1TUUA 1JCFA 3CC4N 2RKIA 3TAMA 1JLCA 5AQTA 4M3TA 4Z4EA 3AVBA 1QZ6A 3OYFA 4CJTA 2DFFA 4FVMA 1WSHA 4JK7A 1QHAA 5GADP 4BR4A 2QTDA 1ZBHA 5HL7L 4M45A 5BPNA 3AAQA 2VGNA 2O8DA 4I6MA 4JKGA 3VPZA 2F8SA 3CCQN 3NF8A 1WSFA 3WXIA 2QXFA 1MDUB 3RR8A 4BR7A 4IWVA 5JVGL 2KHOA 4C1NK 3OW2M 2FBYA 2NRHA 3GL1A 2P1JA 1KAZA 4JK9A 1BWFO 2YHAA 1SV5A 5LMUK 1HYZA 4CJRA 4NLBA 5ELZA 4E1NA 4FLUA 4FCYA 1XUPO 1EQYA 3L4IA 3QBWA 1H1VA 2G8KA 4BRCA 4KH4A 1NJYA 2YKNA 4HUFA 4F4KA 5GAGP 3AVJA 1U04A 4PKGA 5LJVA 1S1TA 1VQON 5BREA 1HNWK 3SNNA 5AZIB 3R6MA 3KWIA 3G6EN 2Q1NA 3ZT0A 4YOYA 4N76A 4M7XA 1BA1A 3DM2A 3HXMA 2KW4A 3HZ6A 2VQEK 4KV8A 3SK3A 3OYAA 2OA8A 1GLDG 1HLUA 2NRXA 4DTOA 2CGLA 3TAFA 2E2PA 4FWQA 3SJJA 3MXJA 3T7ZA 3RSEA 1NJIO 3A2FA 2P9UB 4NO7A 3PIOL 1S9EA 5CZ2A 5E84A 4Z4FA 4AILC 1B9DA 1UOCA 2HBMA 3QLHA 1Q7YO 2G8IA 4FJGA 1T6CA 2QWQA 3PY8A 1S1WA 4FXDA 3LM9A 1VK0A 2ZQBA 4LSNA 4KHYA 1TKZA 2W42A 4ZTFA 1NJXA 4FL9A 2V52B 4F3OA 5AQPA 3O9TA 3HVTA 4BREA 5EOYA 4C8NA 3T19A 1SKRA 2PFUA 3WXJA 3CYMA 4O4GA 2UXBK 3NGZA 1JLEA 3MCAB 3CCEN 2PY5A 3THYB 1X3NA 3EYZA 1Q8IA 4NCBA 2GBZA 3D7EO 4CD1A 5HLFA 5B8HA 4CZJA 5AQLA 3RWUA 3KK2A 3ZSXA 5JS2A 4A5AA 3CCUN 3HK2A 5AQIA 3OHRA 3OTOK 1XHZA 3VGKA 1CZ9A 3S3NA 4OKKA 5AZJB 4EHUA 5LJWA 5C2FA 1Z26A 2D0BA 3SMSA 3PO4A 4EP4A 3D45A 2E8AA 3NBPA 1G15A 2Q36A 2O8BB 2Y1JA 3D2EB 1S22A 1I39A 3AGKA 3NAEA 3AVLA 2OPSA 1QVFM 2YV0X 4U67L 5J2QA 1EP4A 4B8AB 4DU4A 3DLRA 4PQUA 1TK0A 3C7NA 5AQKA 4DQIA 1XQSC 1VSLA 4K8XA 2ZWHA 4JKDA 3CCVN 3ZETB 3I0SA 5J2NA 1LAWA 3CPEA 1WAJA 5GIPA 4CEEA 3RR7A 1Z25A 4X62K 3VEXA 1BU6O 1OVQA 5AR0A 2E20A 4AQYK 4KH5A 1S6PA 2IDOA 1WBDA 4JKCA 4DV4K 2D4WA 3TU5A 3NH2A 2QWOA 5MLCQ 1WAFA 4NXNK 4GV6A 1C0FA 4K43A 4BG9A 1S9GA 3MWTA 5FPMA 3DOLA 4LFCK 1HYSA 4B9LA 2D0CA 1NMDA 5CYQA 3G0ZA 3IFRA 2OPQA 3AVIA 4F9OA 4CEAA 2XY5A 3OVNA 4NLCA 4PA1A 4H0YB 2YHBA 3C6UA 3QICA 5KPTA 3HRGA 2VCPA 3SMPA 1YITN 2G8UA 3O3GA 3HM8A 2A1SA 3TWHA 4CFDA 3NE6A 2O8FA 3ATVA 4JI6K 4DQ8A 3OJSA 3ZX2A 3UIQA 3NVMA 4HTLA 3BY5A 5FLXO 5JVHL 1A5WA 3T69A 1VSEA 3F9MA 1NGGA 1J53A 5M1QA 1CXQA 1VSIA 4H0VB 4QS7A 4QAGA 4AH9A 2E4LA 3VQ5A 1WOQA 4JRPA 1BUPA 3ASMA 2HHWA 1QSYA 1KFDA 1LCUA 3L2RA 1T3VA 3ZEUA 3V1OA 4W5OA 4YDUC 4CHPA 2E2QA 4JI4K 5EVZA 1I3AA 1SS6A 3HPGA 3VA3A 4FM2A 3TANA 2O8EA 2HHUA 4J2AA 2JLEA 3LP1A 3UKUA 1A5VA 3OYCA 3OBYA 3RMCA 3CETA 4FSVA 2QKKA 4CCHA 1EX4A 3JSMA 4BR9A 4CZHA 3AVAA 5C25A 1VQ9N 4IG3A 3TARA 3AO1A 2QWMA 1NLVA 4CHQA 5HOOA 3SAFA 1K6YA 3IAYA 1YJNN 3G10A 2W6KA 4DSLA 3CMEN 4M63C 4KBOA 1P90A 3SUNA 4DSFA 3BDPA 4K0KK 4FOEA 5CR4A 1SUQA 3TAEA 4BRGA 2UYTA 4CE9A 2GELA 2VWBA 4WFBL 3TAQA 1T05A 3ZT1A 1JKHA 1Z05A 2IOCA 1P8ZA 5DM6L 3DAWA 4AHVA 4ILGB 3E9LA 3LZJA 5T7BA 2P9IA 3QEWA 1KVCA 1K8KB 1BCMA 1ILYA 3SV3A 2I7PA 4JKAA 1L3VA 4DQSA 3AVHA 3O9UA 1REVA 4RW6A 4JI7K 2AP1A 2P9NA 3QFPA 2ZGYA 4JAXA 2ZD1A 3QO9A 4Y0WA 5CY4A 1NOYA 4DLGA 4DSKA 3F73A 3KWGA 3QEXA 2HVIA 4IFYA 1MWMA 3EO3A 3HPOA 4IO8A 4Z94A 3G4SN 2YNHA 1Q18A 1RBTA 3TPQA 4H8KA 5KPZA 3M8QA 5KGWA 4KRFA 1B9FA 4GV3A 5C24A 3HSTB 5KGXA 4WQ4C 4EZ6A 5CZ1A 4HUGA 3RMDA 4LFBK 4BR5A 1HKCA 5KQDA 4DTMA 3O5BA 4A57A 1C0MA 4BE1A 4MQ3A 1VQMN 3AAPA 2EWSA 2G8WA 2KFNA 1HPMA 2IAJA 2YNGA 3VQAA 2ITMA 4CJ4A 5BRDA 3VN5A 5JLFA 4DU3A 4ID1A 4FLVA 2E6LA 3HBTA 4JKBA 4IOCL 3R3LA 2X6NA 1ASUA 1G99A 1RDDA 3O1BA 3PLAA 4CGFA 4LF7K 2WBNA 2OTJN 1HRHA 1KVBA 1RBUA 2DFHA 3DJCA 4CJ5A 2BE2A 1V4TA 3WQUA 4CESA 4CZEA 3AARA 1VSDA 1BG3A 5AZIA 3PO5A 5AQRA 3PUFA 4Z4HA 3ZSOA 1D9DA 4ILHA 3ZSRA 1DGKN 4BRKA 4DTUA 1GOBA 2XY6A 2VG6A 3O6WA 3LP0A 4G9ZA 3NFAA 1RT2A 4KREA 3P38A 3CJAA 2BUPA 3AV9A 4PY5A 4V19S 2JWKA 4DFPA 1TL3A 3BUZB 4DFKA 4A5BA 1W9HA 4OVLA 2UU9K 2P9UA 4XIUA 4LF5K 2QKBA 5J2MA 2RF2A 4KHPK 3I56N 2I5JA 5KI6A 4FM0A 5AQNA 3I33A 2HNDA 1S72N 5BPMA 4WF9L 4JKHA 3CD6N 4KI6A 3TAGA 3L2VA 3JYTA 1CZBA 4JNEA 4B1UB 4FOIA 3DXKB 4FJKA 2HB5A 2XHBA 3NDKA 4BC2A 5AQVA 4CHOA 1TAUA 4ISGA 4CGIA 4KO0A 4QS8A 3NMUA 3THYA 1KRPA 3V1QA 1U48A 3J7ZO 3SUOA 2P9KB 4DV1K 1FXXA 3VF4A 3VETA 3UB5A 4FLTA 3MCPA 1DLOA 2E88A 3HTVA 3U9ZA 2HNYA 4FJHA 4KHWA 4DG1A 5FPNA 4JRQA 5KQ8A 3F9KA 2FBXA 1RBVA 1LOTB 1K8AO 3ZX3A 5AZJA 1NWKA 2RPIA 5AQSA 1RTJA 1ESVA 2AJQA 2NNWA 4BDZA 5TKYA 1GLCG 1QQCA 3OY9A 4WCEL 1RGIA 4BRLA 3D2FB 4C8LA 2O8BA 2ASMA 3QETA 2G8FA 3D2EA 2E2NA 1XWLA 3AO2A 3W3DA 4FPBA 3V9UA 1D5AA 4BY9C 4HUEA 2BTFA 3A5LC 3NHGA 1WNSA 4KFBA 3VQ7A 1L5UA 1YUWA 3U3YA 1NGIA 3KIOA 4MDAA 3OYHA 1VHXA 5AQOA 1YJWN 3TR8A 5C10A 1EKEA 2NZTA 3ZETA 3EE9A 3T1AA 3O08A 4DKWA 3N4QA 1J9AA 2OZSA 3T1YK 1LWFA 4BG8A 1HQEA 1S1XA 2YI1A 3J80O 3RVCA 4DV6K 3LDPA 2A42A 3S3MA 4K42A 4FM1A 1QS4A 2IC3A 4CJVA 3QINA 2A40A 3CQXA 3DXMA 4H03B 3NH1A 4DUYK 5M1PA 4CJLA 4NYNA 3V1RA 3VQ9A 1W0HA 1VRTA 1SKWA 1J5OA 3ZSWA 4O55A 4YOVA 4JKEA 1NK7A 5C0YA 3UKRB 1JLBA 2D0PA 1VQ7N 3MK6A 1J54A 2XO7A 4LH5A 3VGMA 2NLXA 4ELUA 5J1EA 4WQ5A 1NK9A 1HNVA 2H3GX 4AHCA 4O0IA 1X3MA 3PSIA 4CEFA 1ASVA 3ZSZA 1BCOA 4PWDA 3P39A 1X9WA 3J7AP 4CIFA 4CZLA 4FWRA 1VSKA 4O5FA 2ASOA 3ATUA 4HCBA 1WLJA 3H6EA 4BACA 4IFEA 4XH1A 4HHTA 3ZSVA 2RE2A 4JYAK 5CE3A 3OYKA 2DY4A 5I9EB 1NGEA 4DR5K 3HYFA 5FDLA 3QB0A 1NK5A 4B9VA 4C8KA 5AQUA 4I9QA 4CEDA 2ZGZA 4CJPA 5AJ3K 4GKKK 4FK2A 2WOMA 1VQPN 1TGOA 4A2BA 4DSEA 4M41A 3ISNC 3ZT3A 4HVJA 3ZLJA 5JS1A 4DFJA 4Z4CA 4FVUA 4AM6A 1YT3A 4AF1A 3SQ1A 3U9DA 4FJ5A 3BF3A 2P9LB 3T3FA 4K8ZA 2YHYA 4JN4A 1Z6RA 2DFEA 3AO3A 4JI3K 1N36K 4E1MA 1UA1A 1SZ2A 2DTUA 3FZHA 2Z1JA 1NK6A 2GV9A 2VG7A 4JD2B 3L0QA 4GVEA 1RT5A 3KJVA 1RDUA 2ZE2A 1HR0K 2IIRA 2KLAA 2RN2A 2UUAK 1IJJA 2HOEA 5C15A 3B6PA 4K25A 5I3UA 2OCEA 1L3SA 4R79A 4B9MA 3GBTA 2O8CB 1ZBIA 3M8SA 3TTCA 1K8KA 4MFBA 4JI8K 3M3ZA 4CJFA 3LPTA 5SZTA 2IVOA 4JLHA 5FRMA 4L3QA 2QM1A 2X78A 3CJ9A 2VG5A 3V6DA 4FJ7A 3W0LA 3KKRA 3LWMA 5EX5A 4JV5K 4PHTX 4CJEA 1BA0A 2F96A 1WSGA 4DCHA 5M1FA 3DI6A 3SLCA 3U3GA 5ADXH 1KXPA 4Z0UA 3BZKA 1HKBA 3H46O 3SUQA 1VSJA 3QDKA 3TABA 2KKZA 4H0PA 3CXCM 4Z4IA 4DR7K 4CFAA 2A1RA 3ZX0A 2YCHA 3DMJA 1JCGA 4OX9K 1RDBA 1EO1A 3AGRA 4BQLA 1QZ5A 4DR3K 2YJEA 4AHRA 4DTNA 4GV9A 3TSQA 1GLBG 1IV0A 1JCEA 5DK5A 1BO5O 1BDGA 3MX2A 3HOTA 3LL3A 3RRGA 1SKSA 2XY7A 3VQCA 3HJFA 2HW3A 4DR2K 4BGAA 2HVHA 1VQKN 4BQZA 5AFUA 3VTHA 3SPZA 4BDYA 1N33K 2FBTA 1TK8A 1VQ6N 3CJ7A 1OH5A 4C8MA 3I8DA 3SPYA 3DRRA 1TKXA 4IDKA 1F21A 3H3OB 3QERA 5F1XA 1NU0A 4GY2B 4CIGA 2GWJA 4B1WB 5JICA 1K9MO 2W40A 1SAZA 3KKSA 4E0DA 2X6SA 4DU1A 1ZC6A 4L8RB 1LWCA 1U47A 3PX6A 2YKMA 3OJUA 3VESA 3EZ5A 3NF7A 1NNEA 1BQNA 4FLZA 1N6QA 3VEVA 1ATRA 3PIPL 2O4GA 3OS0A 4CEOA 3L2QA 3LP2A 3MAQA 1Q81O 4KHSA 3FZFA 5E26A 1WSIA 3VTIA 5LL6Z 3C95A 4E7IA 3DLEA 1WSJA 4LSLA 4JEPA 2QW9A 3LAKA 3SUPA 5C12A 1N8RO 3ENBA 2Q0RA 3OYBA 4OGCA 4KPYA 4FWLA 3HL8A 4CGJA 3LALA 3JAMO 2V7YA 3AVMA 1HNIA 4BR0A 1HNZK 3CI5A 3VENA 2QA4N 1OH7A 3KTQA 2P9KA 2ZJRL 4EHTA 1TVRA 4MLEA 4DS4A 1VAZA 5BRHA 3HM9A 4Z4GA 5KTQA 4PKHA 4DQRA 5HP1A 2IVNA 5AQWA 4BC4A 3AO4A 3HOSA 4CEBA 3KLGA 4JI0K 3MN5A 1M90O 4TSXA 2FSNA 5JMVA 1NK0A 5FPDA 2ITGA 3OYMA 3MWPA 3A5OC 1S1VA 1QTMA 1RTHA 1C0UA 3OYIA 2UUCK 4W5NA 4OKJA 3D2FA 2HHXA 4O5BA 3THXA 4NXMK 3WNHA 1NGAA 4LH4A 2VYPA 4H5TA 2O8DB 4I6MB 3JS6A 1NG9A 3P31A 4Y1DA 2VWJA 3NH0A 2X74A 3QNNA 1KLNA 2NUBA 4B3TK 1RT3A 4JHDB 1QQOA 2B4JA 3K58A 3E1YA 2YJFA 3O3HA 3FZMA 2FXUA 1SL2A 1LAVA 2B6AA 3O9SA 4FWSA 3Q7BA 4LY7A 3OBWA 2E1ZA 5M1KA 4B9TA 1CXUA 1LV5A 3VEYA 2NRRA 2HF4A 4F8RA 3NF6A 3UKRA 3CCRN 4CF8A 5BR9A 2B5JA 4H5RA 3EKSA 3ENHA 4YY3K 4MDBA 2YHWA 2FSJA 3O1WA 4FJJA 3V4IA 2W6LA 2V51B 4W5TA 3VQEA 3FR0A 1W2BM 4R5PA 4RG8A 3CM5A 1A5XA 3MMVA 3KLFA 3E66A 4FZYA 3OYNA 5H1SQ 4W5RA 3K5NA 4AM7A 5LY3A 1RNHA 5TKWA 4NB4A 2HSTA 4M3XA 2PAVA 3ZT4A 4CK1A 3MN6A 1C1AA 3TAPA 4BRNA 2ETJA 3SCXA 2HMPA 1HMVA 4PL8A 1XC3A 3I8BA 4N5SA 4FJXA 2VQFK 3S3OA 4NYFA 3OYGA 4HCCA 1JLAA 3BZCA 1HX1A 2AA4A 4DV2K 1TK5A 4ELVA 2BGGA 2WC9A 3AVKA 4LF6K 1Q82O 1D4XA 3LWLA 4FWMA 2ZJQL 1W97L 1WUAA 2GUIA 4FO0A 4IG0A 3K5OA 1VQLN 1RT4A 4CD3A 4A59A 2F9WA 2HMIA 4WYBA 2UXDK 4OPHA 3VEOA 1ITGA 1BIUA 2G8VA 1BGXT 4FW1A 1Y64A 3S41A 3LP3A 4I9LA 4JD2A 4DQPA 3L8BA 1NGBA 4NCAA 1RDAA 2O4IA 1WN7A 3CC2N 2UXCK 4CIEA 3AVCA 3LDQA 2ZJPL 1RTIA 3OYLA 1JL2A 4YFUA 1YAGA 1ZBFA 4DR4K 5DM7L 4IJAA 2QWNA 4N56A 4M7YA 4FYDA 1GLFO 3BGRA 1YTAA 4B8CA 3O3FA 4FLXA 3ULEB 2O8CA 1DEJA 4YHHK 3OYDA 3QIPA 3FFKB 4CECA 4FZXC 1TKDA 3AY9A 4ZTJA 4RW9A 3L2WA 4W5QA 4WE1A 1Q9YA 5AQXA 4CJWA 4IEIA 3M8PA 3QIOA 4CZIA 1VRUA 2NRZA 3O9RA 1FKPA 1NGFA 4RTFD 1U2VB 3E9PA 1IBLK 1GLEG 3M5RA 4H0TB 1JLQA 1U4BA 3WNEA 4IBNA 2OZMA 5I42A 3O8MA 2VWKA 4IOXA 4B1YB 3CCMN 4EAHD 2WFBA 3WEEB 3L3UA 4M3UA 4Q5VA 5AQYA 1NBWA 1RBRA 3LANA 3MEEA 4ISFA 4M42A 2G8HA 4DTSA 4DWIA 4B9SA 1B92A 2Q3SA 1XNRK 1DT9A 4MO5A 3K9JA 1OH8A 2HHHK 2A6AA 4EZ9A 3D6RA 1C6VA 4OPKA 1EXQA 4BC5A 3SAHA 4XH5A 2CH6A 4BRAA 4FWKA 3D0PA 2OANA 3H1QA 3IS9A 3HT3A 3PSFA 4CJSA 1OKJA 2PYJA 1C1BA 1KAXA 5EU7A 3DRPA 2YHXA 1RT1A 1NM1A 4AHUA 1HYVA 5CYMA 5C42A 2O8EB 1LW0A 3THVA 1R59O 1XI1A 4M3ZA 5J2PA 1WBBA 4YORA 3IRXA 3SJHA 3WQTA 3MDQA 4RW4A 4YOTA 3QMLA 3CJBA 4FZZA 1W7AA 2A5XA 1TYQB 1KD1O 1IG9A 3RRHA 3K59A 2BDPA 1IBMK 1IH7A 2HHSA 2YNIA 2WONA 1Q9XA 4FK0A 4OJRA 3K9KA 3GOIA 3U8XA 1ZYQA 4B3RK 3KK1A 4X65K 5BN9A 4JI5K 2Q0UA 3A8YA 1HJOA 3EZWA 4DV3K 1RCHA 1VQ8N 3M1FA 4FWOA 4IEEA 4LF8K 2P5GA 4H0OA 2OTLN 4WFAL 3OYJA 3CFRA 3KHYA 4KHUA 1E4FT 1BIZA 5HRPA 2FF6A 2OPPA 3WXLA 5JLHA 3LZIA 4GVMA 3R1XA 3CJCA 4I7FA 1HUXA 4G1QA 3CF5L 1T44A 4IJNA 4J2BA 4CJKA 1T7PA 4JKFA 3NGYA 2V7ZA 3CFPA 4C23A 4OLBA
chains in the Genus database with same CATH topology
5DK5A 1HQUA 3L3VA 4IG3A 3TARA 4KTQA 4Q0BA 1UWBA 3AO1A 3VQ4A 4E89A 3NCIA 3SV4A 3KLEA 4OKEA 4CK3A 4CHQA 3S9HA 4KKOA 3RRGA 1SKSA 1K6YA 1RTDA 4BDPA 2XY7A 4KTWA 3IAYA 3VQCA 3HJFA 3G10A 4DSLA 1UAXA 4DTPA 2HW3A 3ALYA 3DLHA 4KHNA 2HVHA 1L3TA 4ZHRA 4CEZA 3SUNA 4H4MA 4DSFA 3BDPA 4B9UA 4Y1CA 1SUQA 3SPZA 4BDYA 3TAEA 2FBTA 1TK8A 4KAZA 4QCLA 1TV6A 4C8MA 4CE9A 3I8DA 4FJ9A 2FC0A 3SPYA 4DF4A 1KCFA 1D9FA 3TAQA 3O4NA 3DRRA 1TKXA 4IDKA 4JS5A 1T05A 3ZT1A 1U45A 1F21A 1JKHA 3E01A 2EHGA 5K14A 2IOCA 3QERA 1TKTA 1NJZA 3V81A 3DLKA 4CIGA 2JGUA 3HVRA 3FFIA 4DSIA 4F2RA 4AHVA 3LZJA 3VQQA 1RT7A 3KKSA 5T7BA 4E0DA 2KFZA 3QEWA 1KVCA 4ICLA 4CGHA 4KI4A 2X6SA 3ZSQA 4DU1A 4CEQA 1BCMA 4L8RB 3SV3A 1LWCA 1RDCA 1U47A 3PX6A 3EY1A 4DQSA 2YKMA 1L3VA 3OJUA 4J2DA 3AVHA 3EZ5A 3NF7A 1REVA 4RW6A 3SZ2A 2IS3A 4DS5A 1BQNA 4FLZA 1N6QA 1KVAA 5KRSA 2O4GA 3OS0A 2ZD1A 3QO9A 4CEOA 4CJUA 3LP2A 3L2QA 3MAQA 4KHSA 5CY4A 4E19A 1NOYA 4DLGA 1JL1A 3OS2A 4DSKA 3F73A 4CGGA 4PUOA 1WSIA 3MEGA 4IFYA 3QEXA 2HVIA 3ZSYA 3KD5E 3C95A 4E7IA 2HHTA 3V9ZA 1VSHA 3DLEA 3HPOA 5SWMA 1ZBLA 1U49A 1T03A 4BE0A 1WSJA 2HNZA 2P51A 2YNHA 3RMAA 2PYLA 4LSLA 1RBTA 3LAKA 4DSJA 4H8KA 3SUPA 1VSFA 3M8QA 5KGWA 3OYBA 1KTQA 1RILA 4KRFA 1B9FA 4OGCA 1GOCA 5C24A 3HSTB 3M8RA 5KGXA 1QSLA 3HL8A 1SL1A 4KPYA 4EZ6A 5CZ1A 3LALA 4CGJA 4HUGA 3RMDA 4F2SA 3AVMA 1C0TA 1HNIA 5KRTA 4DTMA 4CF2A 2KZZA 1S5JA 1C0MA 4BE1A 1TAQA 1T8EA 4MQ3A 4FJNA 1L3UA 3PX0A 3KTQA 3MXIA 1R0AA 2G8WA 1NJWA 2KFNA 4I2PA 1ASWA 2IAJA 3DLGA 1TVRA 2YNGA 3AA2A 3VQAA 4DTXA 4CJ4A 1IKYA 3KLHA 1YVUA 4DS4A 3VN5A 3DYAA 3HM9A 2XRIA 1DTTA 4DU3A 1NK8A 4Z4GA 4ID1A 5KTQA 4FLVA 2E6LA 4DQRA 4DTRA 5HP1A 3VQDA 3MEDA 4DF8A 3CG7A 4DTJA 4C8OA 2X6NA 3AO4A 4CEBA 3KLGA 1ASUA 1LW2A 1RDDA 3HPHA 4CGFA 3V9WA 3QEVA 1HRHA 4TSXA 3NGIA 1KVBA 4CHNA 1RBUA 2DFHA 2XY8A 3NF9A 3RTVA 2ITGA 3C94A 1NK0A 4M3YA 3OYMA 4CJ5A 2BE2A 4CHZA 3SQ0A 3K5MA 4BWJA 4O44A 1S1VA 1QTMA 3OYEA 4CESA 1SL0A 1RTHA 1C0UA 4O0JA 3OYIA 1RBSA 2Z1HA 4OKJA 1JLFA 1VSDA 2FBVA 2Z1GA 5HRRA 4CGDA 4BE2A 4O5BA 1BI4A 4E3SA 4B9NA 2HHXA 1GOAA 3PO5A 1O1WA 3PUFA 4Z4HA 3SYZA 3WNHA 3ZSOA 3QNOA 1D9DA 4FK4A 3HP9A 4LH4A 3VQ6A 3ZSRA 1LWEA 4DTUA 4B08A 1GOBA 1TL1A 2XY6A 2VG6A 3ZT2A 4Y1DA 3L2UA 3LP0A 2VWJA 1S6QA 3NH0A 2X74A 3QNNA 2OYQA 3PX4A 1IKVA 3NFAA 1KLNA 3O4QA 4DMNA 2NUBA 1RT2A 3ULDA 4KREA 3SQ4A 2KZMA 3LPUA 3AV9A 4PY5A 1RT3A 3QESA 4DFPA 1MU2A 1TL3A 4DFKA 1W9HA 3RMBA 4OVLA 1QHTA 4XIUA 1QSSA 4FJMA 2B4JA 1S1UA 3K58A 2QKBA 3O3HA 5J2MA 2RF2A 2RKIA 3TAMA 1XHXA 1JLCA 1LAVA 2B6AA 2I5JA 1SL2A 5KI6A 4M3TA 3AVBA 4FM0A 4Z4EA 2HNDA 4CJTA 3OYFA 2DFFA 4FVMA 4LY7A 1WSHA 4KI6A 3TAGA 4B3OA 3L2VA 3JYTA 3SI6A 4B9TA 1CZBA 1CXUA 1CLQA 1NKBA 1LV5A 4E7HA 4FJKA 1ZBHA 2HB5A 3LDSA 4M45A 2XHBA 3NDKA 3V9SA 3NF6A 4F8RA 3AVFA 4CK2A 4CHOA 1TAUA 4CF8A 1KFSA 2F8SA 2B5JA 3NF8A 4CGIA 1WSFA 1NOZA 2QXFA 4KO0A 1YTUA 1KRPA 3RR8A 3P83D 3V1QA 2OPRA 1U48A 1BISA 4AHTA 3SUOA 1FXXA 2FBYA 2P1JA 2LSNA 2YHAA 1SV5A 1FK9A 4FJJA 1HYZA 4CJRA 3V4IA 4FLTA 4E1NA 4FLUA 4W5TA 4FCYA 1DLOA 3VQEA 3K5LA 4R5PA 4RW8A 4RG8A 1ZBUA 4CJ3A 2HNYA 1A5XA 3CM5A 4I2QA 3KLFA 1KSPA 2G8KA 1FKOA 1HJRA 4DG1A 3KD1E 3OYNA 1NJYA 4JRQA 4FZYA 3HP6A 3F9KA 2FBXA 4W5RA 1RBVA 3K5NA 4M3WA 2RPIA 1RTJA 3I0RA 2AJQA 2YKNA 4BDZA 4HUFA 1RNHA 4F4KA 3AVJA 1U04A 3K57A 1QQCA 1X9MA 4DFMA 1S1TA 3OY9A 1XC9A 4KB0A 4M3XA 4C8LA 3ZT4A 1BI4B 1BL3A 3QETA 3SNNA 2G8FA 1XWLA 3AO2A 4CK1A 3V9UA 3AA4A 1D5AA 4HUEA 2D0AA 5HRSA 1C1AA 3TAPA 3ZT0A 3NHGA 1WNSA 4KFBA 4N76A 3VQ7A 2ETJA 3SCXA 1HMVA 3DM2A 2KW4A 3HXMA 1L5UA 4FJLA 3U3YA 4N5SA 3KIOA 3AVNA 3CM6A 3WNFA 4KV8A 4FJXA 3OYHA 3S3OA 1VSMA 4NYFA 3OYAA 3OYGA 3TR8A 2OA8A 1EKEA 4N41A 4HCCA 1JXEA 4DTOA 3TAFA 1JLAA 4FLWA 3SJJA 3MXJA 3T1AA 2P5OA 3A2FA 1J9AA 3WNGA 1S9EA 5CZ2A 1TK5A 2OZSA 4ELVA 1LWFA 2BGGA 4Z4FA 1HQEA 4AILC 3P1GA 1B9DA 3CFOA 1UOCA 4FLYA 3QLHA 1S1XA 4KHYA 2G8IA 4FJGA 3AVKA 4LD0A 3S3MA 3PY8A 3LWLA 1S1WA 4CFCA 4FM1A 4FXDA 2ZQBA 1QS4A 1VK0A 2GUIA 2IC3A 4IG0A 4LSNA 1TKZA 3KLIA 3K5OA 3QINA 4CJVA 2W42A 4ZTFA 1NJXA 1DTQA 1RT4A 4F3OA 4FJHA 3AVGA 3NH1A 4KHWA 4FW2A 4AHSA 2HMIA 3IG1A 3HVTA 3K2PA 4NYNA 4CJLA 1JLGA 4IFVA 3V1RA 4C8NA 3VQ9A 2KTQA 1W0HA 4GW6A 1VRTA 1SKWA 2HHVA 1ITGA 1J5OA 2IGIA 1BIUA 3T19A 3ZSWA 1SKRA 3DLBA 4O55A 1NK7A 2G8VA 4KB1A 1JLBA 3CYMA 1BGXT 4FW1A 3LP3A 4I9LA 4O4GA 1J54A 2XO7A 3NGZA 1JLEA 4LH5A 4DQPA 4ELUA 3L8BA 2PY5A 5J1EA 3EYZA 1NK9A 1HNVA 1Q8IA 1RDAA 2EX3A 4NCAA 5HRNA 1WN7A 2O4IA 4NCBA 2GBZA 1RT6A 4CIEA 3AVCA 4AHCA 4DQQA 5HLFA 1RTIA 3OYLA 1JL2A 3PV8A 4YFUA 1ZBFA 4O0IA 4CEFA 1ASVA 4JS4A 3RWUA 3ZSZA 1BCOA 3KK2A 3ZSXA 4YNQA 4N56A 5FRNA 4PWDA 5JS2A 4FYDA 3O3FA 3BGRA 1YTAA 2E6MA 4B8CA 4FLXA 1X9WA 3HK2A 4CIFA 3LAMA 3OYDA 1XHZA 3AA3A 3QIPA 4CJQA 4CF9A 1VSKA 1CZ9A 4CECA 4HCBA 3S3NA 4FZXC 1WLJA 4OKKA 1TKDA 4FJ8A 4BACA 4ZTJA 4RW9A 2YNFA 1Z26A 2D0BA 5HROA 3L2WA 4H4OA 4W5QA 4HHTA 3PO4A 4WE1A 4EP4A 3D45A 3AO5A 3ZSVA 1Q9YA 2HHQA 4E7JA 4CJWA 3M8PA 3QIOA 1BHLA 3NBPA 3OYKA 1G15A 2DY4A 4BWMA 1VRUA 1FKPA 3HYFA 5FDLA 5FROA 2Y1JA 4W5NA 4RW7A 1I39A 4FJIA 1KLMA 1NK5A 1NK4A 3NAEA 3AVLA 3ZCMA 2OPSA 4B9VA 1JLQA 2YV0X 1U4BA 3WNEA 4C8KA 3DRSA 4IBNA 2OZMA 2QK9A 5I42A 4I9QA 3VQPA 2Z1IA 4CEDA 3TI0A 4CJPA 1BQMA 3CQ8A 4DLEA 5DMRA 1EP4A 4B8AB 5J2QA 2VWKA 4DU4A 3DLRA 4PQUA 1TK0A 4DQIA 4CFBA 2BANA 4N47A 1VSLA 4FK2A 2R7YA 2D5RA 2WOMA 4OLAA 4K8XA 3L3UA 4M3UA 5E41A 1TGOA 4Q5VA 5D3GA 4DSEA 1RBRA 4M41A 3LANA 3ISNC 3ZT3A 4HVJA 1X9SA 3MEEA 1D8YA 4M42A 2G8HA 1X1PA 3U6FA 4F3TA 4DTSA 4DWIA 3I0SA 5J2NA 5JS1A 4DFJA 3V9XA 1LAWA 4B9SA 1WAJA 4Z4CA 4KTZA 1B92A 1YT3A 4CEEA 1UA0A 3RR7A 1Z25A 2Q3SA 3SQ1A 3MECA 4CF1A 4FJ5A 1Y97A 3QEPA 3DOKA 3KK3A 3T3FA 4K8ZA 4CF0A 1S6PA 2IDOA 4EZ9A 2DFEA 2KQ2A 3AO3A 1C6VA 4CERA 4OPKA 4KHQA 2F8TA 1EXQA 1WSEA 3NH2A 3P5JA 1WAFA 4E1MA 1UA1A 3VA0A 3D0PA 2DTUA 3OS1A 2Z1JA 1S9GA 3IS9A 3HT3A 3DOLA 1NK6A 1HYSA 4CJSA 2GV9A 4B9LA 2D0CA 1NKEA 2PYJA 1C1BA 5EU7A 2VG7A 3DRPA 5CYQA 3HO1A 3G0ZA 3MXMA 2OPQA 3AVIA 4ID5A 4CEAA 1N5YA 1RT1A 2XY5A 3OVNA 4PA1A 1HYVA 5CYMA 4AHUA 1RT5A 5C42A 3KJVA 1LW0A 2ZE2A 2YHBA 3C6UA 3THVA 1XI1A 4M3ZA 2RN2A 3C6TA 4CHYA 1JXBA 3AA5X 3O3GA 5J2PA 2G8UA 3B6PA 3IRXA 2A1SA 2ATQA 5I3UA 5HBMA 3TWHA 4CFDA 4RW4A 1L3SA 3NE6A 4B9MA 4FZZA 1ZBIA 3M8SA 3OJSA 4E7LA 2Y1IA 4MFBA 3UIQA 4UQGA 3B6OA 4OPJA 1A5WA 4CJFA 3LPTA 1IG9A 3RRHA 3K59A 2BDPA 4M3RA 1VSEA 5SZTA 4JLHA 5FRMA 1IH7A 2X78A 1C1CA 1IKWA 1J53A 1CXQA 1VSIA 2HHSA 2VG5A 3V6DA 4J2EA 1EETA 1NKCA 4QAGA 4AH9A 4FJ7A 2YNIA 2WONA 3KKRA 3LWMA 1Q9XA 4FK0A 4OJRA 2E4LA 3VQ5A 4CJEA 4JRPA 4ELTA 4IKFA 1HPZA 3ASMA 2F96A 1WSGA 2HHWA 1QSYA 1KFDA 3QEIA 1ZYQA 3L2RA 3KK1A 1IKXA 3DI6A 3V1OA 4W5OA 3U3GA 4CHPA 4Z0UA 1RCHA 1IO2A 3SUQA 3ITHA 1I3AA 3HPGA 4OGEA 3VA3A 4FM2A 3H08A 1VSJA 3TANA 2P5GA 3TABA 2HHUA 3OYJA 4J2AA 4Z4IA 3CFRA 4KHUA 2JLEA 4CFAA 2A1RA 3SQ2A 2PZSA 3LP1A 3DMJA 1BIZA 1QE1A 1RDBA 1A5VA 3VQBA 5HRPA 3OYCA 2OPPA 4EP5A 3RMCA 3LZIA 2QKKA 4GVMA 4CCHA 4NCGA 4QOZB 1EX4A 3VQ8A 4I7FA 3JSMA 4G1QA 4GMJB 4J2BA 4CJKA 1T7PA 4HTUA 4AHRA 3AVAA 3NGYA 5C25A 3CFPA 4DTNA 4E7KA 4OLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DK5 A;  1HQU A;  3L3V A;  4IG3 A;  3TAR A;  4KTQ A;  4Q0B A;  1UWB A;  3AO1 A;  3VQ4 A;  4E89 A;  3NCI A;  3SV4 A;  3KLE A;  4OKE A;  4CK3 A;  4CHQ A;  3S9H A;  4KKO A;  3RRG A;  1SKS A;  1K6Y A;  1RTD A;  4BDP A;  2XY7 A;  4KTW A;  3IAY A;  3VQC A;  3HJF A;  3G10 A;  4DSL A;  1UAX A;  4DTP A;  2HW3 A;  3ALY A;  3DLH A;  4KHN A;  2HVH A;  1L3T A;  4ZHR A;  4CEZ A;  3SUN A;  4H4M A;  4DSF A;  3BDP A;  4B9U A;  4Y1C A;  1SUQ A;  3SPZ A;  4BDY A;  3TAE A;  2FBT A;  1TK8 A;  4KAZ A;  4QCL A;  1TV6 A;  4C8M A;  4CE9 A;  3I8D A;  4FJ9 A;  2FC0 A;  3SPY A;  4DF4 A;  1KCF A;  1D9F A;  3TAQ A;  3O4N A;  3DRR A;  1TKX A;  4IDK A;  4JS5 A;  1T05 A;  3ZT1 A;  1U45 A;  1F21 A;  1JKH A;  3E01 A;  2EHG A;  5K14 A;  2IOC A;  3QER A;  1TKT A;  1NJZ A;  3V81 A;  3DLK A;  4CIG A;  2JGU A;  3HVR A;  3FFI A;  4DSI A;  4F2R A;  4AHV A;  3LZJ A;  3VQQ A;  1RT7 A;  3KKS A;  5T7B A;  4E0D A;  2KFZ A;  3QEW A;  1KVC A;  4ICL A;  4CGH A;  4KI4 A;  2X6S A;  3ZSQ A;  4DU1 A;  4CEQ A;  1BCM A;  4L8R B;  3SV3 A;  1LWC A;  1RDC A;  1U47 A;  3PX6 A;  3EY1 A;  4DQS A;  2YKM A;  1L3V A;  3OJU A;  4J2D A;  3AVH A;  3EZ5 A;  3NF7 A;  1REV A;  4RW6 A;  3SZ2 A;  2IS3 A;  4DS5 A;  1BQN A;  4FLZ A;  1N6Q A;  1KVA A;  5KRS A;  2O4G A;  3OS0 A;  2ZD1 A;  3QO9 A;  4CEO A;  4CJU A;  3LP2 A;  3L2Q A;  3MAQ A;  4KHS A;  5CY4 A;  4E19 A;  1NOY A;  4DLG A;  1JL1 A;  3OS2 A;  4DSK A;  3F73 A;  4CGG A;  4PUO A;  1WSI A;  3MEG A;  4IFY A;  3QEX A;  2HVI A;  3ZSY A;  3KD5 E;  3C95 A;  4E7I A;  2HHT A;  3V9Z A;  1VSH A;  3DLE A;  3HPO A;  5SWM A;  1ZBL A;  1U49 A;  1T03 A;  4BE0 A;  1WSJ A;  2HNZ A;  2P51 A;  2YNH A;  3RMA A;  2PYL A;  4LSL A;  1RBT A;  3LAK A;  4DSJ A;  4H8K A;  3SUP A;  1VSF A;  3M8Q A;  5KGW A;  3OYB A;  1KTQ A;  1RIL A;  4KRF A;  1B9F A;  4OGC A;  1GOC A;  5C24 A;  3HST B;  3M8R A;  5KGX A;  1QSL A;  3HL8 A;  1SL1 A;  4KPY A;  4EZ6 A;  5CZ1 A;  3LAL A;  4CGJ A;  4HUG A;  3RMD A;  4F2S A;  3AVM A;  1C0T A;  1HNI A;  5KRT A;  4DTM A;  4CF2 A;  2KZZ A;  1S5J A;  1C0M A;  4BE1 A;  1TAQ A;  1T8E A;  4MQ3 A;  4FJN A;  1L3U A;  3PX0 A;  3KTQ A;  3MXI A;  1R0A A;  2G8W A;  1NJW A;  2KFN A;  4I2P A;  1ASW A;  2IAJ A;  3DLG A;  1TVR A;  2YNG A;  3AA2 A;  3VQA A;  4DTX A;  4CJ4 A;  1IKY A;  3KLH A;  1YVU A;  4DS4 A;  3VN5 A;  3DYA A;  3HM9 A;  2XRI A;  1DTT A;  4DU3 A;  1NK8 A;  4Z4G A;  4ID1 A;  5KTQ A;  4FLV A;  2E6L A;  4DQR A;  4DTR A;  5HP1 A;  3VQD A;  3MED A;  4DF8 A;  3CG7 A;  4DTJ A;  4C8O A;  2X6N A;  3AO4 A;  4CEB A;  3KLG A;  1ASU A;  1LW2 A;  1RDD A;  3HPH A;  4CGF A;  3V9W A;  3QEV A;  1HRH A;  4TSX A;  3NGI A;  1KVB A;  4CHN A;  1RBU A;  2DFH A;  2XY8 A;  3NF9 A;  3RTV A;  2ITG A;  3C94 A;  1NK0 A;  4M3Y A;  3OYM A;  4CJ5 A;  2BE2 A;  4CHZ A;  3SQ0 A;  3K5M A;  4BWJ A;  4O44 A;  1S1V A;  1QTM A;  3OYE A;  4CES A;  1SL0 A;  1RTH A;  1C0U A;  4O0J A;  3OYI A;  1RBS A;  2Z1H A;  4OKJ A;  1JLF A;  1VSD A;  2FBV A;  2Z1G A;  5HRR A;  4CGD A;  4BE2 A;  4O5B A;  1BI4 A;  4E3S A;  4B9N A;  2HHX A;  1GOA A;  3PO5 A;  1O1W A;  3PUF A;  4Z4H A;  3SYZ A;  3WNH A;  3ZSO A;  3QNO A;  1D9D A;  4FK4 A;  3HP9 A;  4LH4 A;  3VQ6 A;  3ZSR A;  1LWE A;  4DTU A;  4B08 A;  1GOB A;  1TL1 A;  2XY6 A;  2VG6 A;  3ZT2 A;  4Y1D A;  3L2U A;  3LP0 A;  2VWJ A;  1S6Q A;  3NH0 A;  2X74 A;  3QNN A;  2OYQ A;  3PX4 A;  1IKV A;  3NFA A;  1KLN A;  3O4Q A;  4DMN A;  2NUB A;  1RT2 A;  3ULD A;  4KRE A;  3SQ4 A;  2KZM A;  3LPU A;  3AV9 A;  4PY5 A;  1RT3 A;  3QES A;  4DFP A;  1MU2 A;  1TL3 A;  4DFK A;  1W9H A;  3RMB A;  4OVL A;  1QHT A;  4XIU A;  1QSS A;  4FJM A;  2B4J A;  1S1U A;  3K58 A;  2QKB A;  3O3H A;  5J2M A;  2RF2 A;  2RKI A;  3TAM A;  1XHX A;  1JLC A;  1LAV A;  2B6A A;  2I5J A;  1SL2 A;  5KI6 A;  4M3T A;  3AVB A;  4FM0 A;  4Z4E A;  2HND A;  4CJT A;  3OYF A;  2DFF A;  4FVM A;  4LY7 A;  1WSH A;  4KI6 A;  3TAG A;  4B3O A;  3L2V A;  3JYT A;  3SI6 A;  4B9T A;  1CZB A;  1CXU A;  1CLQ A;  1NKB A;  1LV5 A;  4E7H A;  4FJK A;  1ZBH A;  2HB5 A;  3LDS A;  4M45 A;  2XHB A;  3NDK A;  3V9S A;  3NF6 A;  4F8R A;  3AVF A;  4CK2 A;  4CHO A;  1TAU A;  4CF8 A;  1KFS A;  2F8S A;  2B5J A;  3NF8 A;  4CGI A;  1WSF A;  1NOZ A;  2QXF A;  4KO0 A;  1YTU A;  1KRP A;  3RR8 A;  3P83 D;  3V1Q A;  2OPR A;  1U48 A;  1BIS A;  4AHT A;  3SUO A;  1FXX A;  2FBY A;  2P1J A;  2LSN A;  2YHA A;  1SV5 A;  1FK9 A;  4FJJ A;  1HYZ A;  4CJR A;  3V4I A;  4FLT A;  4E1N A;  4FLU A;  4W5T A;  4FCY A;  1DLO A;  3VQE A;  3K5L A;  4R5P A;  4RW8 A;  4RG8 A;  1ZBU A;  4CJ3 A;  2HNY A;  1A5X A;  3CM5 A;  4I2Q A;  3KLF A;  1KSP A;  2G8K A;  1FKO A;  1HJR A;  4DG1 A;  3KD1 E;  3OYN A;  1NJY A;  4JRQ A;  4FZY A;  3HP6 A;  3F9K A;  2FBX A;  4W5R A;  1RBV A;  3K5N A;  4M3W A;  2RPI A;  1RTJ A;  3I0R A;  2AJQ A;  2YKN A;  4BDZ A;  4HUF A;  1RNH A;  4F4K A;  3AVJ A;  1U04 A;  3K57 A;  1QQC A;  1X9M A;  4DFM A;  1S1T A;  3OY9 A;  1XC9 A;  4KB0 A;  4M3X A;  4C8L A;  3ZT4 A;  1BI4 B;  1BL3 A;  3QET A;  3SNN A;  2G8F A;  1XWL A;  3AO2 A;  4CK1 A;  3V9U A;  3AA4 A;  1D5A A;  4HUE A;  2D0A A;  5HRS A;  1C1A A;  3TAP A;  3ZT0 A;  3NHG A;  1WNS A;  4KFB A;  4N76 A;  3VQ7 A;  2ETJ A;  3SCX A;  1HMV A;  3DM2 A;  2KW4 A;  3HXM A;  1L5U A;  4FJL A;  3U3Y A;  4N5S A;  3KIO A;  3AVN A;  3CM6 A;  3WNF A;  4KV8 A;  4FJX A;  3OYH A;  3S3O A;  1VSM A;  4NYF A;  3OYA A;  3OYG A;  3TR8 A;  2OA8 A;  1EKE A;  4N41 A;  4HCC A;  1JXE A;  4DTO A;  3TAF A;  1JLA A;  4FLW A;  3SJJ A;  3MXJ A;  3T1A A;  2P5O A;  3A2F A;  1J9A A;  3WNG A;  1S9E A;  5CZ2 A;  1TK5 A;  2OZS A;  4ELV A;  1LWF A;  2BGG A;  4Z4F A;  1HQE A;  4AIL C;  3P1G A;  1B9D A;  3CFO A;  1UOC A;  4FLY A;  3QLH A;  1S1X A;  4KHY A;  2G8I A;  4FJG A;  3AVK A;  4LD0 A;  3S3M A;  3PY8 A;  3LWL A;  1S1W A;  4CFC A;  4FM1 A;  4FXD A;  2ZQB A;  1QS4 A;  1VK0 A;  2GUI A;  2IC3 A;  4IG0 A;  4LSN A;  1TKZ A;  3KLI A;  3K5O A;  3QIN A;  4CJV A;  2W42 A;  4ZTF A;  1NJX A;  1DTQ A;  1RT4 A;  4F3O A;  4FJH A;  3AVG A;  3NH1 A;  4KHW A;  4FW2 A;  4AHS A;  2HMI A;  3IG1 A;  3HVT A;  3K2P A;  4NYN A;  4CJL A;  1JLG A;  4IFV A;  3V1R A;  4C8N A;  3VQ9 A;  2KTQ A;  1W0H A;  4GW6 A;  1VRT A;  1SKW A;  2HHV A;  1ITG A;  1J5O A;  2IGI A;  1BIU A;  3T19 A;  3ZSW A;  1SKR A;  3DLB A;  4O55 A;  1NK7 A;  2G8V A;  4KB1 A;  1JLB A;  3CYM A;  1BGX T;  4FW1 A;  3LP3 A;  4I9L A;  4O4G A;  1J54 A;  2XO7 A;  3NGZ A;  1JLE A;  4LH5 A;  4DQP A;  4ELU A;  3L8B A;  2PY5 A;  5J1E A;  3EYZ A;  1NK9 A;  1HNV A;  1Q8I A;  1RDA A;  2EX3 A;  4NCA A;  5HRN A;  1WN7 A;  2O4I A;  4NCB A;  2GBZ A;  1RT6 A;  4CIE A;  3AVC A;  4AHC A;  4DQQ A;  5HLF A;  1RTI A;  3OYL A;  1JL2 A;  3PV8 A;  4YFU A;  1ZBF A;  4O0I A;  4CEF A;  1ASV A;  4JS4 A;  3RWU A;  3ZSZ A;  1BCO A;  3KK2 A;  3ZSX A;  4YNQ A;  4N56 A;  5FRN A;  4PWD A;  5JS2 A;  4FYD A;  3O3F A;  3BGR A;  1YTA A;  2E6M A;  4B8C A;  4FLX A;  1X9W A;  3HK2 A;  4CIF A;  3LAM A;  3OYD A;  1XHZ A;  3AA3 A;  3QIP A;  4CJQ A;  4CF9 A;  1VSK A;  1CZ9 A;  4CEC A;  4HCB A;  3S3N A;  4FZX C;  1WLJ A;  4OKK A;  1TKD A;  4FJ8 A;  4BAC A;  4ZTJ A;  4RW9 A;  2YNF A;  1Z26 A;  2D0B A;  5HRO A;  3L2W A;  4H4O A;  4W5Q A;  4HHT A;  3PO4 A;  4WE1 A;  4EP4 A;  3D45 A;  3AO5 A;  3ZSV A;  1Q9Y A;  2HHQ A;  4E7J A;  4CJW A;  3M8P A;  3QIO A;  1BHL A;  3NBP A;  3OYK A;  1G15 A;  2DY4 A;  4BWM A;  1VRU A;  1FKP A;  3HYF A;  5FDL A;  5FRO A;  2Y1J A;  4W5N A;  4RW7 A;  1I39 A;  4FJI A;  1KLM A;  1NK5 A;  1NK4 A;  3NAE A;  3AVL A;  3ZCM A;  2OPS A;  4B9V A;  1JLQ A;  2YV0 X;  1U4B A;  3WNE A;  4C8K A;  3DRS A;  4IBN A;  2OZM A;  2QK9 A;  5I42 A;  4I9Q A;  3VQP A;  2Z1I A;  4CED A;  3TI0 A;  4CJP A;  1BQM A;  3CQ8 A;  4DLE A;  5DMR A;  1EP4 A;  4B8A B;  5J2Q A;  2VWK A;  4DU4 A;  3DLR A;  4PQU A;  1TK0 A;  4DQI A;  4CFB A;  2BAN A;  4N47 A;  1VSL A;  4FK2 A;  2R7Y A;  2D5R A;  2WOM A;  4OLA A;  4K8X A;  3L3U A;  4M3U A;  5E41 A;  1TGO A;  4Q5V A;  5D3G A;  4DSE A;  1RBR A;  4M41 A;  3LAN A;  3ISN C;  3ZT3 A;  4HVJ A;  1X9S A;  3MEE A;  1D8Y A;  4M42 A;  2G8H A;  1X1P A;  3U6F A;  4F3T A;  4DTS A;  4DWI A;  3I0S A;  5J2N A;  5JS1 A;  4DFJ A;  3V9X A;  1LAW A;  4B9S A;  1WAJ A;  4Z4C A;  4KTZ A;  1B92 A;  1YT3 A;  4CEE A;  1UA0 A;  3RR7 A;  1Z25 A;  2Q3S A;  3SQ1 A;  3MEC A;  4CF1 A;  4FJ5 A;  1Y97 A;  3QEP A;  3DOK A;  3KK3 A;  3T3F A;  4K8Z A;  4CF0 A;  1S6P A;  2IDO A;  4EZ9 A;  2DFE A;  2KQ2 A;  3AO3 A;  1C6V A;  4CER A;  4OPK A;  4KHQ A;  2F8T A;  1EXQ A;  1WSE A;  3NH2 A;  3P5J A;  1WAF A;  4E1M A;  1UA1 A;  3VA0 A;  3D0P A;  2DTU A;  3OS1 A;  2Z1J A;  1S9G A;  3IS9 A;  3HT3 A;  3DOL A;  1NK6 A;  1HYS A;  4CJS A;  2GV9 A;  4B9L A;  2D0C A;  1NKE A;  2PYJ A;  1C1B A;  5EU7 A;  2VG7 A;  3DRP A;  5CYQ A;  3HO1 A;  3G0Z A;  3MXM A;  2OPQ A;  3AVI A;  4ID5 A;  4CEA A;  1N5Y A;  1RT1 A;  2XY5 A;  3OVN A;  4PA1 A;  1HYV A;  5CYM A;  4AHU A;  1RT5 A;  5C42 A;  3KJV A;  1LW0 A;  2ZE2 A;  2YHB A;  3C6U A;  3THV A;  1XI1 A;  4M3Z A;  2RN2 A;  3C6T A;  4CHY A;  1JXB A;  3AA5 X;  3O3G A;  5J2P A;  2G8U A;  3B6P A;  3IRX A;  2A1S A;  2ATQ A;  5I3U A;  5HBM A;  3TWH A;  4CFD A;  4RW4 A;  1L3S A;  3NE6 A;  4B9M A;  4FZZ A;  1ZBI A;  3M8S A;  3OJS A;  4E7L A;  2Y1I A;  4MFB A;  3UIQ A;  4UQG A;  3B6O A;  4OPJ A;  1A5W A;  4CJF A;  3LPT A;  1IG9 A;  3RRH A;  3K59 A;  2BDP A;  4M3R A;  1VSE A;  5SZT A;  4JLH A;  5FRM A;  1IH7 A;  2X78 A;  1C1C A;  1IKW A;  1J53 A;  1CXQ A;  1VSI A;  2HHS A;  2VG5 A;  3V6D A;  4J2E A;  1EET A;  1NKC A;  4QAG A;  4AH9 A;  4FJ7 A;  2YNI A;  2WON A;  3KKR A;  3LWM A;  1Q9X A;  4FK0 A;  4OJR A;  2E4L A;  3VQ5 A;  4CJE A;  4JRP A;  4ELT A;  4IKF A;  1HPZ A;  3ASM A;  2F96 A;  1WSG A;  2HHW A;  1QSY A;  1KFD A;  3QEI A;  1ZYQ A;  3L2R A;  3KK1 A;  1IKX A;  3DI6 A;  3V1O A;  4W5O A;  3U3G A;  4CHP A;  4Z0U A;  1RCH A;  1IO2 A;  3SUQ A;  3ITH A;  1I3A A;  3HPG A;  4OGE A;  3VA3 A;  4FM2 A;  3H08 A;  1VSJ A;  3TAN A;  2P5G A;  3TAB A;  2HHU A;  3OYJ A;  4J2A A;  4Z4I A;  3CFR A;  4KHU A;  2JLE A;  4CFA A;  2A1R A;  3SQ2 A;  2PZS A;  3LP1 A;  3DMJ A;  1BIZ A;  1QE1 A;  1RDB A;  1A5V A;  3VQB A;  5HRP A;  3OYC A;  2OPP A;  4EP5 A;  3RMC A;  3LZI A;  2QKK A;  4GVM A;  4CCH A;  4NCG A;  4QOZ B;  1EX4 A;  3VQ8 A;  4I7F A;  3JSM A;  4G1Q A;  4GMJ B;  4J2B A;  4CJK A;  1T7P A;  4HTU A;  4AHR A;  3AVA A;  3NGY A;  5C25 A;  3CFP A;  4DTN A;  4E7K A;  4OLB A; 
#chains in the Genus database with same CATH topology
 3MN7 A;  3C65 A;  1XMQ K;  5AQH A;  4IDH A;  3NCI A;  3SV4 A;  4BRQ A;  2P9N B;  4BDP A;  4KTW A;  3LDN A;  5GAE P;  3ALY A;  3DLH A;  1L3T A;  4B3M K;  4CEZ A;  4H4M A;  2I7N A;  1TV6 A;  4BVO A;  4FJ9 A;  2FC0 A;  4DV0 K;  4BRH A;  4DF4 A;  1KCF A;  1D9F A;  2CGK A;  3CHW A;  2EHG A;  4IXC A;  1NJZ A;  1YVN A;  4BGB A;  2JGU A;  2A3Z A;  3CCJ N;  4DSI A;  3EEQ A;  3VQQ A;  1RT7 A;  3VMF B;  5GIN A;  3WUH A;  3EY1 A;  2IS3 A;  4JHD A;  4CJU A;  2FLO A;  1FW6 A;  1JL1 A;  3HI0 A;  2P9P B;  4PUO A;  3ZSY A;  3KD5 E;  2HHT A;  3V9Z A;  1ZBL A;  4BE0 A;  2HNZ A;  3RMA A;  2WTU A;  5EY4 A;  3NVK A;  1KTQ A;  3M8R A;  4DB3 A;  3CJ1 A;  4YDU A;  4DV5 K;  3QFU A;  5KRT A;  1ATS A;  1S5J A;  1T8E A;  4UY8 O;  3MN9 A;  3EKU A;  1L3U A;  3PX0 A;  3MXI A;  1NJW A;  4I2P A;  3DLG A;  2D1K A;  3FZK A;  3KLH A;  1YVU A;  1J5E K;  2XRI A;  1NK8 A;  4DHY A;  1X9J A;  2ZF5 O;  4YOX A;  4DTR A;  4DF8 A;  3CG7 A;  4DTJ A;  4C8O A;  1LW2 A;  5GIO A;  3V9W A;  3QEV A;  3NGI A;  3H1V X;  4FPA A;  4CHN A;  3NF9 A;  3FGU A;  1RDW X;  4M3Y A;  3SQ0 A;  4CHZ A;  4BWJ A;  5F2R A;  1SL0 A;  4HWI A;  3IMX A;  1RBS A;  2Z1H A;  2FBV A;  4CGD A;  1ZBS A;  1JJ2 M;  2D0O A;  1VQ4 N;  4E3S A;  4E1J A;  1O1W A;  4CBU A;  3SAG A;  2QWP A;  1M1K O;  3SYZ A;  2HF3 A;  3QNO A;  3HP9 A;  3VQ6 A;  4CJ7 A;  2GWK A;  3N4P A;  4C1N I;  4X66 K;  3CCL N;  3ZT2 A;  2NRV A;  3L2U A;  2Q97 A;  5BN8 A;  1S6Q A;  1GLJ O;  4A61 A;  3PX4 A;  1IKV A;  3ULD A;  3LDL A;  1N32 K;  5IT9 O;  2ASP A;  3RMB A;  1NGJ A;  3CC7 N;  1QHT A;  4OO1 J;  3L4Q A;  1XHX A;  1OVY A;  1NGH A;  1FJG K;  3CIP A;  4O8K A;  3T1H K;  3THW B;  4BRO A;  5BRF A;  3VER A;  5IWA K;  4B3O A;  3SI6 A;  1CLQ A;  1NKB A;  4E7H A;  1E3M A;  3BP8 A;  3LDS A;  4WQ5 C;  3V9S A;  4LC9 B;  3J8A A;  3AVF A;  4CK2 A;  1KFS A;  1NOZ A;  3P83 D;  2OPR A;  1BIS A;  4AHT A;  4WQ4 A;  1VQ5 N;  3CER A;  3KVG A;  4IOA L;  2LSN A;  4RWT A;  1FK9 A;  4H5N A;  1RFQ A;  3K5L A;  4RW8 A;  1ZBU A;  3ULE A;  4CJ3 A;  2UUB K;  4I2Q A;  3KD1 E;  1KSP A;  1YTU A;  1FKO A;  1HJR A;  3FE1 A;  3HP6 A;  4M3W A;  3R9P A;  3I0R A;  3G25 A;  2NRW A;  1J6Z A;  1NGD A;  4JK8 A;  4MLH A;  3A5M C;  3DXK A;  3K57 A;  4JI1 K;  1X9M A;  4DFM A;  4CZG A;  4KB0 A;  3FZL A;  3DXM B;  5AQQ A;  1XC9 A;  1BI4 B;  1BL3 A;  1N34 K;  2P9S B;  4O8U A;  4JI2 K;  1U2V A;  3L6Q A;  3AA4 A;  2D0A A;  5HRS A;  1VQN N;  2ZM6 K;  4DR1 K;  3JXU A;  4H5V A;  2CH5 A;  3R8E A;  4FJL A;  3WNF A;  3AVN A;  3CM6 A;  5CHI A;  3WEE A;  1VSM A;  4N41 A;  5BPL A;  1JXE A;  4ILJ A;  5KPR A;  1KQS M;  4FLW A;  2P5O A;  3TTD A;  4BVP A;  2QI2 A;  3WNG A;  1U6Z A;  3EL2 A;  3P1G A;  4FLY A;  3CFO A;  1ZXO A;  4LF4 K;  4LD0 A;  4CFC A;  4CZK A;  3CCS N;  3KLI A;  1DTQ A;  3AVG A;  4XEI A;  3O9Q A;  4FW2 A;  4AHS A;  3VF6 A;  1MA9 B;  3IG1 A;  1KAY A;  3K2P A;  1JLG A;  4IFV A;  2GEM A;  2KTQ A;  2HHV A;  4GW6 A;  2IGI A;  3DLB A;  4KB1 A;  3LM2 A;  4B1X B;  4JKG B;  4H5W A;  3C6H A;  3GDQ A;  4U7B A;  2EX3 A;  5HRN A;  3H3N O;  3O80 A;  1RT6 A;  4EFH A;  4DQQ A;  5BR8 K;  1DKG D;  3PV8 A;  5AQJ A;  2JWL A;  5A2Q O;  4JS4 A;  5FRN A;  4YNQ A;  5AQZ A;  2E6M A;  3OA9 A;  3LAM A;  2F9T A;  1TYQ A;  5F0X A;  3VGL A;  3AA3 A;  4CJQ A;  5AQM A;  4CF9 A;  4FJ8 A;  1TUY A;  3P4I A;  2YNF A;  5HRO A;  1K73 O;  4H4O A;  3I55 N;  4CZF A;  3AO5 A;  2HHQ A;  4E7J A;  1BHL A;  1WB9 A;  4BWM A;  2QXL A;  4A2A A;  4BRD A;  4GNI A;  1E4G T;  5FRO A;  4RW7 A;  4FJI A;  1KLM A;  3IKM A;  1NK4 A;  3EN9 A;  3ZCM A;  1QVG M;  3DRS A;  2QK9 A;  3VQP A;  2Z1I A;  3TI0 A;  1BQM A;  3KK7 A;  3CQ8 A;  5DMR A;  3WXM B;  4H0X B;  4DLE A;  2E5L K;  2DPN A;  2W41 A;  4CFB A;  4DV7 K;  2BAN A;  4FWP A;  4N47 A;  2R7Y A;  2D5R A;  3CQY A;  4OLA A;  5E41 A;  4B9Q A;  5D3G A;  1GLA G;  1SQK A;  1X9S A;  2HBK A;  1D8Y A;  3RSE B;  1X1P A;  3U6F A;  4F3T A;  1ATN A;  3GG4 A;  3V9X A;  3VF2 A;  4KTZ A;  4WFN L;  2CGJ A;  3MEC A;  4CF1 A;  1MWK A;  1Y97 A;  3QEP A;  3DOK A;  3KK3 A;  1YF5 L;  1NMN A;  4CF0 A;  2KQ2 A;  4CER A;  4KHQ A;  2F8T A;  1YJ9 N;  1WSE A;  1V4S A;  3P5J A;  3SBG A;  1I94 K;  3VA0 A;  3OS1 A;  3DWL A;  1NKE A;  1T6D A;  4BRM A;  1YIJ N;  3HO1 A;  3MXM A;  1N5Y A;  4ID5 A;  5FPE A;  2Q31 A;  3C0B A;  4ISE A;  2FSK A;  3C6T A;  4CHY A;  1JXB A;  3AA5 X;  2VGM A;  1XMO K;  2ATQ A;  4LFA K;  4XH4 A;  3G71 N;  3TSP A;  5HBM A;  4E7L A;  1S3X A;  2Y1I A;  4CI6 A;  2PBD A;  4UQG A;  4A62 A;  2P9L A;  3B6O A;  4OPJ A;  4CZM A;  4M3R A;  4B3S K;  1C1C A;  1IKW A;  4GKJ K;  1HKG A;  4KH6 A;  1EET A;  2J4R A;  4BRP A;  1NKC A;  4J2E A;  3BEX A;  3TTF A;  2QWL A;  2P9P A;  4CW7 B;  4BR2 A;  4ELT A;  4IKF A;  1HPZ A;  5M1N A;  4MO4 A;  3QEI A;  3IUC A;  2F4V K;  1IKX A;  5AFU H;  1IO2 A;  4CBW A;  3ITH A;  4OGE A;  4X64 K;  3H08 A;  1C0G A;  1YXQ A;  3C7N B;  3SQ2 A;  4CBX A;  1IBK K;  2PZS A;  4QS9 A;  1QE1 A;  2IVP A;  3VQB A;  3VEW A;  4EP5 A;  2BH1 A;  3J7Y P;  2QWR A;  4NCG A;  1OH6 A;  4QOZ B;  2E2O A;  3VQ8 A;  4GMJ B;  3CPW M;  3UE5 A;  3ID6 A;  4HTU A;  3VEZ A;  4E7K A;  1YHQ N;  3C6A A;  1IG8 A;  1HQU A;  3L3V A;  4Q0B A;  1UWB A;  3VQ4 A;  4E89 A;  4YOU A;  3KLE A;  4OKE A;  4CK3 A;  3S9H A;  3SBT A;  4KKO A;  1EWQ A;  1RTD A;  3QBX A;  4BRF A;  1YI2 N;  1UAX A;  4DTP A;  1BOT O;  4DUZ K;  2HBL A;  1QQM A;  3DLL L;  4KHN A;  2RHK A;  4ZHR A;  5ADX A;  4B9U A;  4Y1C A;  3U4L A;  4KAZ A;  4QCL A;  4CVN E;  1HNX K;  1QQN A;  3KZB A;  3O4W A;  1XNQ K;  3O4N A;  5GAH P;  4JS5 A;  4IO9 L;  1U45 A;  4KTQ A;  3E01 A;  5K14 A;  1TKT A;  3V81 A;  2GTD A;  3DLK A;  3HVR A;  3FFI A;  1NGC A;  4F2R A;  4RCH A;  2KFZ A;  4PL7 A;  1KC8 O;  2O8F B;  4ICL A;  4CGH A;  4KI4 A;  3ZSQ A;  4CEQ A;  3B8A X;  1RDC A;  3E9O A;  2QEX N;  4J2D A;  4PKI A;  3SZ2 A;  4DS5 A;  3BF1 A;  4BRI A;  3H45 C;  1KVA A;  4J8F A;  5KRS A;  4YOW A;  4DR6 K;  4E19 A;  3OS2 A;  4CGG A;  3MEG A;  3EE8 A;  3J81 O;  3HSC A;  3A0I X;  3THW A;  4OPA A;  1VSH A;  3ZEU B;  1T03 A;  5SWM A;  1U49 A;  5AQG A;  2P51 A;  2PYL A;  2WUS A;  1CZA N;  3CMA N;  4DSJ A;  1VSF A;  1RIL A;  3ZYY X;  1GOC A;  1QSL A;  1SL1 A;  3THX B;  4EIA A;  4F2S A;  1EWR A;  1C0T A;  3UKU B;  4CF2 A;  3ID8 A;  2KZZ A;  1TAQ A;  3WT0 A;  4FJN A;  2FF3 B;  4BC3 A;  5LMN K;  5M1O A;  2YX6 A;  1R0A A;  1ASW A;  3K0S A;  4DTX A;  3AA2 A;  3M6G A;  1IKY A;  3IDH A;  5EXW A;  4B1Z A;  2GX9 A;  3DYA A;  1DTT A;  3Q7C A;  1Q86 O;  3VQD A;  3MED A;  3F2K A;  3VOV A;  4B1V A;  5AQF A;  3GE1 A;  2NRT A;  3HPH A;  2XY8 A;  3RTV A;  3WXK A;  4LF9 K;  3C94 A;  4FWN A;  2Q2R A;  3K5M A;  4O44 A;  3OYE A;  4O0J A;  3TSU A;  4BE2 A;  1UA0 A;  5HRR A;  1JLF A;  2HBJ A;  2Z1G A;  4K41 A;  1BI4 A;  4B9N A;  1GOA A;  2P9S A;  3LDO A;  1O13 A;  4FK4 A;  1LWE A;  2A41 A;  4B08 A;  2F7T A;  1TL1 A;  3ENO A;  2P9I B;  2GUP A;  3A5N C;  2OYQ A;  2E1Y A;  3O4Q A;  4DMN A;  3FLC O;  3MX5 A;  3F5T A;  3SQ4 A;  1GLL O;  5C2D A;  3LPU A;  2KZM A;  4IZ9 A;  3QES A;  1MU2 A;  1QSS A;  4FJM A;  1S1U A;  1TUU A;  1JCF A;  3CC4 N;  2RKI A;  3TAM A;  1JLC A;  5AQT A;  4M3T A;  4Z4E A;  3AVB A;  1QZ6 A;  3OYF A;  4CJT A;  2DFF A;  4FVM A;  1WSH A;  4JK7 A;  1QHA A;  5GAD P;  4BR4 A;  2QTD A;  1ZBH A;  5HL7 L;  4M45 A;  5BPN A;  3AAQ A;  2VGN A;  2O8D A;  4I6M A;  4JKG A;  3VPZ A;  2F8S A;  3CCQ N;  3NF8 A;  1WSF A;  3WXI A;  2QXF A;  1MDU B;  3RR8 A;  4BR7 A;  4IWV A;  5JVG L;  2KHO A;  4C1N K;  3OW2 M;  2FBY A;  2NRH A;  3GL1 A;  2P1J A;  1KAZ A;  4JK9 A;  1BWF O;  2YHA A;  1SV5 A;  5LMU K;  1HYZ A;  4CJR A;  4NLB A;  5ELZ A;  4E1N A;  4FLU A;  4FCY A;  1XUP O;  1EQY A;  3L4I A;  3QBW A;  1H1V A;  2G8K A;  4BRC A;  4KH4 A;  1NJY A;  2YKN A;  4HUF A;  4F4K A;  5GAG P;  3AVJ A;  1U04 A;  4PKG A;  5LJV A;  1S1T A;  1VQO N;  5BRE A;  1HNW K;  3SNN A;  5AZI B;  3R6M A;  3KWI A;  3G6E N;  2Q1N A;  3ZT0 A;  4YOY A;  4N76 A;  4M7X A;  1BA1 A;  3DM2 A;  3HXM A;  2KW4 A;  3HZ6 A;  2VQE K;  4KV8 A;  3SK3 A;  3OYA A;  2OA8 A;  1GLD G;  1HLU A;  2NRX A;  4DTO A;  2CGL A;  3TAF A;  2E2P A;  4FWQ A;  3SJJ A;  3MXJ A;  3T7Z A;  3RSE A;  1NJI O;  3A2F A;  2P9U B;  4NO7 A;  3PIO L;  1S9E A;  5CZ2 A;  5E84 A;  4Z4F A;  4AIL C;  1B9D A;  1UOC A;  2HBM A;  3QLH A;  1Q7Y O;  2G8I A;  4FJG A;  1T6C A;  2QWQ A;  3PY8 A;  1S1W A;  4FXD A;  3LM9 A;  1VK0 A;  2ZQB A;  4LSN A;  4KHY A;  1TKZ A;  2W42 A;  4ZTF A;  1NJX A;  4FL9 A;  2V52 B;  4F3O A;  5AQP A;  3O9T A;  3HVT A;  4BRE A;  5EOY A;  4C8N A;  3T19 A;  1SKR A;  2PFU A;  3WXJ A;  3CYM A;  4O4G A;  2UXB K;  3NGZ A;  1JLE A;  3MCA B;  3CCE N;  2PY5 A;  3THY B;  1X3N A;  3EYZ A;  1Q8I A;  4NCB A;  2GBZ A;  3D7E O;  4CD1 A;  5HLF A;  5B8H A;  4CZJ A;  5AQL A;  3RWU A;  3KK2 A;  3ZSX A;  5JS2 A;  4A5A A;  3CCU N;  3HK2 A;  5AQI A;  3OHR A;  3OTO K;  1XHZ A;  3VGK A;  1CZ9 A;  3S3N A;  4OKK A;  5AZJ B;  4EHU A;  5LJW A;  5C2F A;  1Z26 A;  2D0B A;  3SMS A;  3PO4 A;  4EP4 A;  3D45 A;  2E8A A;  3NBP A;  1G15 A;  2Q36 A;  2O8B B;  2Y1J A;  3D2E B;  1S22 A;  1I39 A;  3AGK A;  3NAE A;  3AVL A;  2OPS A;  1QVF M;  2YV0 X;  4U67 L;  5J2Q A;  1EP4 A;  4B8A B;  4DU4 A;  3DLR A;  4PQU A;  1TK0 A;  3C7N A;  5AQK A;  4DQI A;  1XQS C;  1VSL A;  4K8X A;  2ZWH A;  4JKD A;  3CCV N;  3ZET B;  3I0S A;  5J2N A;  1LAW A;  3CPE A;  1WAJ A;  5GIP A;  4CEE A;  3RR7 A;  1Z25 A;  4X62 K;  3VEX A;  1BU6 O;  1OVQ A;  5AR0 A;  2E20 A;  4AQY K;  4KH5 A;  1S6P A;  2IDO A;  1WBD A;  4JKC A;  4DV4 K;  2D4W A;  3TU5 A;  3NH2 A;  2QWO A;  5MLC Q;  1WAF A;  4NXN K;  4GV6 A;  1C0F A;  4K43 A;  4BG9 A;  1S9G A;  3MWT A;  5FPM A;  3DOL A;  4LFC K;  1HYS A;  4B9L A;  2D0C A;  1NMD A;  5CYQ A;  3G0Z A;  3IFR A;  2OPQ A;  3AVI A;  4F9O A;  4CEA A;  2XY5 A;  3OVN A;  4NLC A;  4PA1 A;  4H0Y B;  2YHB A;  3C6U A;  3QIC A;  5KPT A;  3HRG A;  2VCP A;  3SMP A;  1YIT N;  2G8U A;  3O3G A;  3HM8 A;  2A1S A;  3TWH A;  4CFD A;  3NE6 A;  2O8F A;  3ATV A;  4JI6 K;  4DQ8 A;  3OJS A;  3ZX2 A;  3UIQ A;  3NVM A;  4HTL A;  3BY5 A;  5FLX O;  5JVH L;  1A5W A;  3T69 A;  1VSE A;  3F9M A;  1NGG A;  1J53 A;  5M1Q A;  1CXQ A;  1VSI A;  4H0V B;  4QS7 A;  4QAG A;  4AH9 A;  2E4L A;  3VQ5 A;  1WOQ A;  4JRP A;  1BUP A;  3ASM A;  2HHW A;  1QSY A;  1KFD A;  1LCU A;  3L2R A;  1T3V A;  3ZEU A;  3V1O A;  4W5O A;  4YDU C;  4CHP A;  2E2Q A;  4JI4 K;  5EVZ A;  1I3A A;  1SS6 A;  3HPG A;  3VA3 A;  4FM2 A;  3TAN A;  2O8E A;  2HHU A;  4J2A A;  2JLE A;  3LP1 A;  3UKU A;  1A5V A;  3OYC A;  3OBY A;  3RMC A;  3CET A;  4FSV A;  2QKK A;  4CCH A;  1EX4 A;  3JSM A;  4BR9 A;  4CZH A;  3AVA A;  5C25 A;  1VQ9 N;  4IG3 A;  3TAR A;  3AO1 A;  2QWM A;  1NLV A;  4CHQ A;  5HOO A;  3SAF A;  1K6Y A;  3IAY A;  1YJN N;  3G10 A;  2W6K A;  4DSL A;  3CME N;  4M63 C;  4KBO A;  1P90 A;  3SUN A;  4DSF A;  3BDP A;  4K0K K;  4FOE A;  5CR4 A;  1SUQ A;  3TAE A;  4BRG A;  2UYT A;  4CE9 A;  2GEL A;  2VWB A;  4WFB L;  3TAQ A;  1T05 A;  3ZT1 A;  1JKH A;  1Z05 A;  2IOC A;  1P8Z A;  5DM6 L;  3DAW A;  4AHV A;  4ILG B;  3E9L A;  3LZJ A;  5T7B A;  2P9I A;  3QEW A;  1KVC A;  1K8K B;  1BCM A;  1ILY A;  3SV3 A;  2I7P A;  4JKA A;  1L3V A;  4DQS A;  3AVH A;  3O9U A;  1REV A;  4RW6 A;  4JI7 K;  2AP1 A;  2P9N A;  3QFP A;  2ZGY A;  4JAX A;  2ZD1 A;  3QO9 A;  4Y0W A;  5CY4 A;  1NOY A;  4DLG A;  4DSK A;  3F73 A;  3KWG A;  3QEX A;  2HVI A;  4IFY A;  1MWM A;  3EO3 A;  3HPO A;  4IO8 A;  4Z94 A;  3G4S N;  2YNH A;  1Q18 A;  1RBT A;  3TPQ A;  4H8K A;  5KPZ A;  3M8Q A;  5KGW A;  4KRF A;  1B9F A;  4GV3 A;  5C24 A;  3HST B;  5KGX A;  4WQ4 C;  4EZ6 A;  5CZ1 A;  4HUG A;  3RMD A;  4LFB K;  4BR5 A;  1HKC A;  5KQD A;  4DTM A;  3O5B A;  4A57 A;  1C0M A;  4BE1 A;  4MQ3 A;  1VQM N;  3AAP A;  2EWS A;  2G8W A;  2KFN A;  1HPM A;  2IAJ A;  2YNG A;  3VQA A;  2ITM A;  4CJ4 A;  5BRD A;  3VN5 A;  5JLF A;  4DU3 A;  4ID1 A;  4FLV A;  2E6L A;  3HBT A;  4JKB A;  4IOC L;  3R3L A;  2X6N A;  1ASU A;  1G99 A;  1RDD A;  3O1B A;  3PLA A;  4CGF A;  4LF7 K;  2WBN A;  2OTJ N;  1HRH A;  1KVB A;  1RBU A;  2DFH A;  3DJC A;  4CJ5 A;  2BE2 A;  1V4T A;  3WQU A;  4CES A;  4CZE A;  3AAR A;  1VSD A;  1BG3 A;  5AZI A;  3PO5 A;  5AQR A;  3PUF A;  4Z4H A;  3ZSO A;  1D9D A;  4ILH A;  3ZSR A;  1DGK N;  4BRK A;  4DTU A;  1GOB A;  2XY6 A;  2VG6 A;  3O6W A;  3LP0 A;  4G9Z A;  3NFA A;  1RT2 A;  4KRE A;  3P38 A;  3CJA A;  2BUP A;  3AV9 A;  4PY5 A;  4V19 S;  2JWK A;  4DFP A;  1TL3 A;  3BUZ B;  4DFK A;  4A5B A;  1W9H A;  4OVL A;  2UU9 K;  2P9U A;  4XIU A;  4LF5 K;  2QKB A;  5J2M A;  2RF2 A;  4KHP K;  3I56 N;  2I5J A;  5KI6 A;  4FM0 A;  5AQN A;  3I33 A;  2HND A;  1S72 N;  5BPM A;  4WF9 L;  4JKH A;  3CD6 N;  4KI6 A;  3TAG A;  3L2V A;  3JYT A;  1CZB A;  4JNE A;  4B1U B;  4FOI A;  3DXK B;  4FJK A;  2HB5 A;  2XHB A;  3NDK A;  4BC2 A;  5AQV A;  4CHO A;  1TAU A;  4ISG A;  4CGI A;  4KO0 A;  4QS8 A;  3NMU A;  3THY A;  1KRP A;  3V1Q A;  1U48 A;  3J7Z O;  3SUO A;  2P9K B;  4DV1 K;  1FXX A;  3VF4 A;  3VET A;  3UB5 A;  4FLT A;  3MCP A;  1DLO A;  2E88 A;  3HTV A;  3U9Z A;  2HNY A;  4FJH A;  4KHW A;  4DG1 A;  5FPN A;  4JRQ A;  5KQ8 A;  3F9K A;  2FBX A;  1RBV A;  1LOT B;  1K8A O;  3ZX3 A;  5AZJ A;  1NWK A;  2RPI A;  5AQS A;  1RTJ A;  1ESV A;  2AJQ A;  2NNW A;  4BDZ A;  5TKY A;  1GLC G;  1QQC A;  3OY9 A;  4WCE L;  1RGI A;  4BRL A;  3D2F B;  4C8L A;  2O8B A;  2ASM A;  3QET A;  2G8F A;  3D2E A;  2E2N A;  1XWL A;  3AO2 A;  3W3D A;  4FPB A;  3V9U A;  1D5A A;  4BY9 C;  4HUE A;  2BTF A;  3A5L C;  3NHG A;  1WNS A;  4KFB A;  3VQ7 A;  1L5U A;  1YUW A;  3U3Y A;  1NGI A;  3KIO A;  4MDA A;  3OYH A;  1VHX A;  5AQO A;  1YJW N;  3TR8 A;  5C10 A;  1EKE A;  2NZT A;  3ZET A;  3EE9 A;  3T1A A;  3O08 A;  4DKW A;  3N4Q A;  1J9A A;  2OZS A;  3T1Y K;  1LWF A;  4BG8 A;  1HQE A;  1S1X A;  2YI1 A;  3J80 O;  3RVC A;  4DV6 K;  3LDP A;  2A42 A;  3S3M A;  4K42 A;  4FM1 A;  1QS4 A;  2IC3 A;  4CJV A;  3QIN A;  2A40 A;  3CQX A;  3DXM A;  4H03 B;  3NH1 A;  4DUY K;  5M1P A;  4CJL A;  4NYN A;  3V1R A;  3VQ9 A;  1W0H A;  1VRT A;  1SKW A;  1J5O A;  3ZSW A;  4O55 A;  4YOV A;  4JKE A;  1NK7 A;  5C0Y A;  3UKR B;  1JLB A;  2D0P A;  1VQ7 N;  3MK6 A;  1J54 A;  2XO7 A;  4LH5 A;  3VGM A;  2NLX A;  4ELU A;  5J1E A;  4WQ5 A;  1NK9 A;  1HNV A;  2H3G X;  4AHC A;  4O0I A;  1X3M A;  3PSI A;  4CEF A;  1ASV A;  3ZSZ A;  1BCO A;  4PWD A;  3P39 A;  1X9W A;  3J7A P;  4CIF A;  4CZL A;  4FWR A;  1VSK A;  4O5F A;  2ASO A;  3ATU A;  4HCB A;  1WLJ A;  3H6E A;  4BAC A;  4IFE A;  4XH1 A;  4HHT A;  3ZSV A;  2RE2 A;  4JYA K;  5CE3 A;  3OYK A;  2DY4 A;  5I9E B;  1NGE A;  4DR5 K;  3HYF A;  5FDL A;  3QB0 A;  1NK5 A;  4B9V A;  4C8K A;  5AQU A;  4I9Q A;  4CED A;  2ZGZ A;  4CJP A;  5AJ3 K;  4GKK K;  4FK2 A;  2WOM A;  1VQP N;  1TGO A;  4A2B A;  4DSE A;  4M41 A;  3ISN C;  3ZT3 A;  4HVJ A;  3ZLJ A;  5JS1 A;  4DFJ A;  4Z4C A;  4FVU A;  4AM6 A;  1YT3 A;  4AF1 A;  3SQ1 A;  3U9D A;  4FJ5 A;  3BF3 A;  2P9L B;  3T3F A;  4K8Z A;  2YHY A;  4JN4 A;  1Z6R A;  2DFE A;  3AO3 A;  4JI3 K;  1N36 K;  4E1M A;  1UA1 A;  1SZ2 A;  2DTU A;  3FZH A;  2Z1J A;  1NK6 A;  2GV9 A;  2VG7 A;  4JD2 B;  3L0Q A;  4GVE A;  1RT5 A;  3KJV A;  1RDU A;  2ZE2 A;  1HR0 K;  2IIR A;  2KLA A;  2RN2 A;  2UUA K;  1IJJ A;  2HOE A;  5C15 A;  3B6P A;  4K25 A;  5I3U A;  2OCE A;  1L3S A;  4R79 A;  4B9M A;  3GBT A;  2O8C B;  1ZBI A;  3M8S A;  3TTC A;  1K8K A;  4MFB A;  4JI8 K;  3M3Z A;  4CJF A;  3LPT A;  5SZT A;  2IVO A;  4JLH A;  5FRM A;  4L3Q A;  2QM1 A;  2X78 A;  3CJ9 A;  2VG5 A;  3V6D A;  4FJ7 A;  3W0L A;  3KKR A;  3LWM A;  5EX5 A;  4JV5 K;  4PHT X;  4CJE A;  1BA0 A;  2F96 A;  1WSG A;  4DCH A;  5M1F A;  3DI6 A;  3SLC A;  3U3G A;  5ADX H;  1KXP A;  4Z0U A;  3BZK A;  1HKB A;  3H46 O;  3SUQ A;  1VSJ A;  3QDK A;  3TAB A;  2KKZ A;  4H0P A;  3CXC M;  4Z4I A;  4DR7 K;  4CFA A;  2A1R A;  3ZX0 A;  2YCH A;  3DMJ A;  1JCG A;  4OX9 K;  1RDB A;  1EO1 A;  3AGR A;  4BQL A;  1QZ5 A;  4DR3 K;  2YJE A;  4AHR A;  4DTN A;  4GV9 A;  3TSQ A;  1GLB G;  1IV0 A;  1JCE A;  5DK5 A;  1BO5 O;  1BDG A;  3MX2 A;  3HOT A;  3LL3 A;  3RRG A;  1SKS A;  2XY7 A;  3VQC A;  3HJF A;  2HW3 A;  4DR2 K;  4BGA A;  2HVH A;  1VQK N;  4BQZ A;  5AFU A;  3VTH A;  3SPZ A;  4BDY A;  1N33 K;  2FBT A;  1TK8 A;  1VQ6 N;  3CJ7 A;  1OH5 A;  4C8M A;  3I8D A;  3SPY A;  3DRR A;  1TKX A;  4IDK A;  1F21 A;  3H3O B;  3QER A;  5F1X A;  1NU0 A;  4GY2 B;  4CIG A;  2GWJ A;  4B1W B;  5JIC A;  1K9M O;  2W40 A;  1SAZ A;  3KKS A;  4E0D A;  2X6S A;  4DU1 A;  1ZC6 A;  4L8R B;  1LWC A;  1U47 A;  3PX6 A;  2YKM A;  3OJU A;  3VES A;  3EZ5 A;  3NF7 A;  1NNE A;  1BQN A;  4FLZ A;  1N6Q A;  3VEV A;  1ATR A;  3PIP L;  2O4G A;  3OS0 A;  4CEO A;  3L2Q A;  3LP2 A;  3MAQ A;  1Q81 O;  4KHS A;  3FZF A;  5E26 A;  1WSI A;  3VTI A;  5LL6 Z;  3C95 A;  4E7I A;  3DLE A;  1WSJ A;  4LSL A;  4JEP A;  2QW9 A;  3LAK A;  3SUP A;  5C12 A;  1N8R O;  3ENB A;  2Q0R A;  3OYB A;  4OGC A;  4KPY A;  4FWL A;  3HL8 A;  4CGJ A;  3LAL A;  3JAM O;  2V7Y A;  3AVM A;  1HNI A;  4BR0 A;  1HNZ K;  3CI5 A;  3VEN A;  2QA4 N;  1OH7 A;  3KTQ A;  2P9K A;  2ZJR L;  4EHT A;  1TVR A;  4MLE A;  4DS4 A;  1VAZ A;  5BRH A;  3HM9 A;  4Z4G A;  5KTQ A;  4PKH A;  4DQR A;  5HP1 A;  2IVN A;  5AQW A;  4BC4 A;  3AO4 A;  3HOS A;  4CEB A;  3KLG A;  4JI0 K;  3MN5 A;  1M90 O;  4TSX A;  2FSN A;  5JMV A;  1NK0 A;  5FPD A;  2ITG A;  3OYM A;  3MWP A;  3A5O C;  1S1V A;  1QTM A;  1RTH A;  1C0U A;  3OYI A;  2UUC K;  4W5N A;  4OKJ A;  3D2F A;  2HHX A;  4O5B A;  3THX A;  4NXM K;  3WNH A;  1NGA A;  4LH4 A;  2VYP A;  4H5T A;  2O8D B;  4I6M B;  3JS6 A;  1NG9 A;  3P31 A;  4Y1D A;  2VWJ A;  3NH0 A;  2X74 A;  3QNN A;  1KLN A;  2NUB A;  4B3T K;  1RT3 A;  4JHD B;  1QQO A;  2B4J A;  3K58 A;  3E1Y A;  2YJF A;  3O3H A;  3FZM A;  2FXU A;  1SL2 A;  1LAV A;  2B6A A;  3O9S A;  4FWS A;  3Q7B A;  4LY7 A;  3OBW A;  2E1Z A;  5M1K A;  4B9T A;  1CXU A;  1LV5 A;  3VEY A;  2NRR A;  2HF4 A;  4F8R A;  3NF6 A;  3UKR A;  3CCR N;  4CF8 A;  5BR9 A;  2B5J A;  4H5R A;  3EKS A;  3ENH A;  4YY3 K;  4MDB A;  2YHW A;  2FSJ A;  3O1W A;  4FJJ A;  3V4I A;  2W6L A;  2V51 B;  4W5T A;  3VQE A;  3FR0 A;  1W2B M;  4R5P A;  4RG8 A;  3CM5 A;  1A5X A;  3MMV A;  3KLF A;  3E66 A;  4FZY A;  3OYN A;  5H1S Q;  4W5R A;  3K5N A;  4AM7 A;  5LY3 A;  1RNH A;  5TKW A;  4NB4 A;  2HST A;  4M3X A;  2PAV A;  3ZT4 A;  4CK1 A;  3MN6 A;  1C1A A;  3TAP A;  4BRN A;  2ETJ A;  3SCX A;  2HMP A;  1HMV A;  4PL8 A;  1XC3 A;  3I8B A;  4N5S A;  4FJX A;  2VQF K;  3S3O A;  4NYF A;  3OYG A;  4HCC A;  1JLA A;  3BZC A;  1HX1 A;  2AA4 A;  4DV2 K;  1TK5 A;  4ELV A;  2BGG A;  2WC9 A;  3AVK A;  4LF6 K;  1Q82 O;  1D4X A;  3LWL A;  4FWM A;  2ZJQ L;  1W97 L;  1WUA A;  2GUI A;  4FO0 A;  4IG0 A;  3K5O A;  1VQL N;  1RT4 A;  4CD3 A;  4A59 A;  2F9W A;  2HMI A;  4WYB A;  2UXD K;  4OPH A;  3VEO A;  1ITG A;  1BIU A;  2G8V A;  1BGX T;  4FW1 A;  1Y64 A;  3S41 A;  3LP3 A;  4I9L A;  4JD2 A;  4DQP A;  3L8B A;  1NGB A;  4NCA A;  1RDA A;  2O4I A;  1WN7 A;  3CC2 N;  2UXC K;  4CIE A;  3AVC A;  3LDQ A;  2ZJP L;  1RTI A;  3OYL A;  1JL2 A;  4YFU A;  1YAG A;  1ZBF A;  4DR4 K;  5DM7 L;  4IJA A;  2QWN A;  4N56 A;  4M7Y A;  4FYD A;  1GLF O;  3BGR A;  1YTA A;  4B8C A;  3O3F A;  4FLX A;  3ULE B;  2O8C A;  1DEJ A;  4YHH K;  3OYD A;  3QIP A;  3FFK B;  4CEC A;  4FZX C;  1TKD A;  3AY9 A;  4ZTJ A;  4RW9 A;  3L2W A;  4W5Q A;  4WE1 A;  1Q9Y A;  5AQX A;  4CJW A;  4IEI A;  3M8P A;  3QIO A;  4CZI A;  1VRU A;  2NRZ A;  3O9R A;  1FKP A;  1NGF A;  4RTF D;  1U2V B;  3E9P A;  1IBL K;  1GLE G;  3M5R A;  4H0T B;  1JLQ A;  1U4B A;  3WNE A;  4IBN A;  2OZM A;  5I42 A;  3O8M A;  2VWK A;  4IOX A;  4B1Y B;  3CCM N;  4EAH D;  2WFB A;  3WEE B;  3L3U A;  4M3U A;  4Q5V A;  5AQY A;  1NBW A;  1RBR A;  3LAN A;  3MEE A;  4ISF A;  4M42 A;  2G8H A;  4DTS A;  4DWI A;  4B9S A;  1B92 A;  2Q3S A;  1XNR K;  1DT9 A;  4MO5 A;  3K9J A;  1OH8 A;  2HHH K;  2A6A A;  4EZ9 A;  3D6R A;  1C6V A;  4OPK A;  1EXQ A;  4BC5 A;  3SAH A;  4XH5 A;  2CH6 A;  4BRA A;  4FWK A;  3D0P A;  2OAN A;  3H1Q A;  3IS9 A;  3HT3 A;  3PSF A;  4CJS A;  1OKJ A;  2PYJ A;  1C1B A;  1KAX A;  5EU7 A;  3DRP A;  2YHX A;  1RT1 A;  1NM1 A;  4AHU A;  1HYV A;  5CYM A;  5C42 A;  2O8E B;  1LW0 A;  3THV A;  1R59 O;  1XI1 A;  4M3Z A;  5J2P A;  1WBB A;  4YOR A;  3IRX A;  3SJH A;  3WQT A;  3MDQ A;  4RW4 A;  4YOT A;  3QML A;  3CJB A;  4FZZ A;  1W7A A;  2A5X A;  1TYQ B;  1KD1 O;  1IG9 A;  3RRH A;  3K59 A;  2BDP A;  1IBM K;  1IH7 A;  2HHS A;  2YNI A;  2WON A;  1Q9X A;  4FK0 A;  4OJR A;  3K9K A;  3GOI A;  3U8X A;  1ZYQ A;  4B3R K;  3KK1 A;  4X65 K;  5BN9 A;  4JI5 K;  2Q0U A;  3A8Y A;  1HJO A;  3EZW A;  4DV3 K;  1RCH A;  1VQ8 N;  3M1F A;  4FWO A;  4IEE A;  4LF8 K;  2P5G A;  4H0O A;  2OTL N;  4WFA L;  3OYJ A;  3CFR A;  3KHY A;  4KHU A;  1E4F T;  1BIZ A;  5HRP A;  2FF6 A;  2OPP A;  3WXL A;  5JLH A;  3LZI A;  4GVM A;  3R1X A;  3CJC A;  4I7F A;  1HUX A;  4G1Q A;  3CF5 L;  1T44 A;  4IJN A;  4J2B A;  4CJK A;  1T7P A;  4JKF A;  3NGY A;  2V7Z A;  3CFP A;  4C23 A;  4OLB A; 
#chains in the Genus database with same CATH homology
 5DK5 A;  1HQU A;  3L3V A;  4IG3 A;  3TAR A;  4KTQ A;  4Q0B A;  1UWB A;  3AO1 A;  3VQ4 A;  4E89 A;  3NCI A;  3SV4 A;  3KLE A;  4OKE A;  4CK3 A;  4CHQ A;  3S9H A;  4KKO A;  3RRG A;  1SKS A;  1K6Y A;  1RTD A;  4BDP A;  2XY7 A;  4KTW A;  3IAY A;  3VQC A;  3HJF A;  3G10 A;  4DSL A;  1UAX A;  4DTP A;  2HW3 A;  3ALY A;  3DLH A;  4KHN A;  2HVH A;  1L3T A;  4ZHR A;  4CEZ A;  3SUN A;  4H4M A;  4DSF A;  3BDP A;  4B9U A;  4Y1C A;  1SUQ A;  3SPZ A;  4BDY A;  3TAE A;  2FBT A;  1TK8 A;  4KAZ A;  4QCL A;  1TV6 A;  4C8M A;  4CE9 A;  3I8D A;  4FJ9 A;  2FC0 A;  3SPY A;  4DF4 A;  1KCF A;  1D9F A;  3TAQ A;  3O4N A;  3DRR A;  1TKX A;  4IDK A;  4JS5 A;  1T05 A;  3ZT1 A;  1U45 A;  1F21 A;  1JKH A;  3E01 A;  2EHG A;  5K14 A;  2IOC A;  3QER A;  1TKT A;  1NJZ A;  3V81 A;  3DLK A;  4CIG A;  2JGU A;  3HVR A;  3FFI A;  4DSI A;  4F2R A;  4AHV A;  3LZJ A;  3VQQ A;  1RT7 A;  3KKS A;  5T7B A;  4E0D A;  2KFZ A;  3QEW A;  1KVC A;  4ICL A;  4CGH A;  4KI4 A;  2X6S A;  3ZSQ A;  4DU1 A;  4CEQ A;  1BCM A;  4L8R B;  3SV3 A;  1LWC A;  1RDC A;  1U47 A;  3PX6 A;  3EY1 A;  4DQS A;  2YKM A;  1L3V A;  3OJU A;  4J2D A;  3AVH A;  3EZ5 A;  3NF7 A;  1REV A;  4RW6 A;  3SZ2 A;  2IS3 A;  4DS5 A;  1BQN A;  4FLZ A;  1N6Q A;  1KVA A;  5KRS A;  2O4G A;  3OS0 A;  2ZD1 A;  3QO9 A;  4CEO A;  4CJU A;  3LP2 A;  3L2Q A;  3MAQ A;  4KHS A;  5CY4 A;  4E19 A;  1NOY A;  4DLG A;  1JL1 A;  3OS2 A;  4DSK A;  3F73 A;  4CGG A;  4PUO A;  1WSI A;  3MEG A;  4IFY A;  3QEX A;  2HVI A;  3ZSY A;  3KD5 E;  3C95 A;  4E7I A;  2HHT A;  3V9Z A;  1VSH A;  3DLE A;  3HPO A;  5SWM A;  1ZBL A;  1U49 A;  1T03 A;  4BE0 A;  1WSJ A;  2HNZ A;  2P51 A;  2YNH A;  3RMA A;  2PYL A;  4LSL A;  1RBT A;  3LAK A;  4DSJ A;  4H8K A;  3SUP A;  1VSF A;  3M8Q A;  5KGW A;  3OYB A;  1KTQ A;  1RIL A;  4KRF A;  1B9F A;  4OGC A;  1GOC A;  5C24 A;  3HST B;  3M8R A;  5KGX A;  1QSL A;  3HL8 A;  1SL1 A;  4KPY A;  4EZ6 A;  5CZ1 A;  3LAL A;  4CGJ A;  4HUG A;  3RMD A;  4F2S A;  3AVM A;  1C0T A;  1HNI A;  5KRT A;  4DTM A;  4CF2 A;  2KZZ A;  1S5J A;  1C0M A;  4BE1 A;  1TAQ A;  1T8E A;  4MQ3 A;  4FJN A;  1L3U A;  3PX0 A;  3KTQ A;  3MXI A;  1R0A A;  2G8W A;  1NJW A;  2KFN A;  4I2P A;  1ASW A;  2IAJ A;  3DLG A;  1TVR A;  2YNG A;  3AA2 A;  3VQA A;  4DTX A;  4CJ4 A;  1IKY A;  3KLH A;  1YVU A;  4DS4 A;  3VN5 A;  3DYA A;  3HM9 A;  2XRI A;  1DTT A;  4DU3 A;  1NK8 A;  4Z4G A;  4ID1 A;  5KTQ A;  4FLV A;  2E6L A;  4DQR A;  4DTR A;  5HP1 A;  3VQD A;  3MED A;  4DF8 A;  3CG7 A;  4DTJ A;  4C8O A;  2X6N A;  3AO4 A;  4CEB A;  3KLG A;  1ASU A;  1LW2 A;  1RDD A;  3HPH A;  4CGF A;  3V9W A;  3QEV A;  1HRH A;  4TSX A;  3NGI A;  1KVB A;  4CHN A;  1RBU A;  2DFH A;  2XY8 A;  3NF9 A;  3RTV A;  2ITG A;  3C94 A;  1NK0 A;  4M3Y A;  3OYM A;  4CJ5 A;  2BE2 A;  4CHZ A;  3SQ0 A;  3K5M A;  4BWJ A;  4O44 A;  1S1V A;  1QTM A;  3OYE A;  4CES A;  1SL0 A;  1RTH A;  1C0U A;  4O0J A;  3OYI A;  1RBS A;  2Z1H A;  4OKJ A;  1JLF A;  1VSD A;  2FBV A;  2Z1G A;  5HRR A;  4CGD A;  4BE2 A;  4O5B A;  1BI4 A;  4E3S A;  4B9N A;  2HHX A;  1GOA A;  3PO5 A;  1O1W A;  3PUF A;  4Z4H A;  3SYZ A;  3WNH A;  3ZSO A;  3QNO A;  1D9D A;  4FK4 A;  3HP9 A;  4LH4 A;  3VQ6 A;  3ZSR A;  1LWE A;  4DTU A;  4B08 A;  1GOB A;  1TL1 A;  2XY6 A;  2VG6 A;  3ZT2 A;  4Y1D A;  3L2U A;  3LP0 A;  2VWJ A;  1S6Q A;  3NH0 A;  2X74 A;  3QNN A;  2OYQ A;  3PX4 A;  1IKV A;  3NFA A;  1KLN A;  3O4Q A;  4DMN A;  2NUB A;  1RT2 A;  3ULD A;  4KRE A;  3SQ4 A;  2KZM A;  3LPU A;  3AV9 A;  4PY5 A;  1RT3 A;  3QES A;  4DFP A;  1MU2 A;  1TL3 A;  4DFK A;  1W9H A;  3RMB A;  4OVL A;  1QHT A;  4XIU A;  1QSS A;  4FJM A;  2B4J A;  1S1U A;  3K58 A;  2QKB A;  3O3H A;  5J2M A;  2RF2 A;  2RKI A;  3TAM A;  1XHX A;  1JLC A;  1LAV A;  2B6A A;  2I5J A;  1SL2 A;  5KI6 A;  4M3T A;  3AVB A;  4FM0 A;  4Z4E A;  2HND A;  4CJT A;  3OYF A;  2DFF A;  4FVM A;  4LY7 A;  1WSH A;  4KI6 A;  3TAG A;  4B3O A;  3L2V A;  3JYT A;  3SI6 A;  4B9T A;  1CZB A;  1CXU A;  1CLQ A;  1NKB A;  1LV5 A;  4E7H A;  4FJK A;  1ZBH A;  2HB5 A;  3LDS A;  4M45 A;  2XHB A;  3NDK A;  3V9S A;  3NF6 A;  4F8R A;  3AVF A;  4CK2 A;  4CHO A;  1TAU A;  4CF8 A;  1KFS A;  2F8S A;  2B5J A;  3NF8 A;  4CGI A;  1WSF A;  1NOZ A;  2QXF A;  4KO0 A;  1YTU A;  1KRP A;  3RR8 A;  3P83 D;  3V1Q A;  2OPR A;  1U48 A;  1BIS A;  4AHT A;  3SUO A;  1FXX A;  2FBY A;  2P1J A;  2LSN A;  2YHA A;  1SV5 A;  1FK9 A;  4FJJ A;  1HYZ A;  4CJR A;  3V4I A;  4FLT A;  4E1N A;  4FLU A;  4W5T A;  4FCY A;  1DLO A;  3VQE A;  3K5L A;  4R5P A;  4RW8 A;  4RG8 A;  1ZBU A;  4CJ3 A;  2HNY A;  1A5X A;  3CM5 A;  4I2Q A;  3KLF A;  1KSP A;  2G8K A;  1FKO A;  1HJR A;  4DG1 A;  3KD1 E;  3OYN A;  1NJY A;  4JRQ A;  4FZY A;  3HP6 A;  3F9K A;  2FBX A;  4W5R A;  1RBV A;  3K5N A;  4M3W A;  2RPI A;  1RTJ A;  3I0R A;  2AJQ A;  2YKN A;  4BDZ A;  4HUF A;  1RNH A;  4F4K A;  3AVJ A;  1U04 A;  3K57 A;  1QQC A;  1X9M A;  4DFM A;  1S1T A;  3OY9 A;  1XC9 A;  4KB0 A;  4M3X A;  4C8L A;  3ZT4 A;  1BI4 B;  1BL3 A;  3QET A;  3SNN A;  2G8F A;  1XWL A;  3AO2 A;  4CK1 A;  3V9U A;  3AA4 A;  1D5A A;  4HUE A;  2D0A A;  5HRS A;  1C1A A;  3TAP A;  3ZT0 A;  3NHG A;  1WNS A;  4KFB A;  4N76 A;  3VQ7 A;  2ETJ A;  3SCX A;  1HMV A;  3DM2 A;  2KW4 A;  3HXM A;  1L5U A;  4FJL A;  3U3Y A;  4N5S A;  3KIO A;  3AVN A;  3CM6 A;  3WNF A;  4KV8 A;  4FJX A;  3OYH A;  3S3O A;  1VSM A;  4NYF A;  3OYA A;  3OYG A;  3TR8 A;  2OA8 A;  1EKE A;  4N41 A;  4HCC A;  1JXE A;  4DTO A;  3TAF A;  1JLA A;  4FLW A;  3SJJ A;  3MXJ A;  3T1A A;  2P5O A;  3A2F A;  1J9A A;  3WNG A;  1S9E A;  5CZ2 A;  1TK5 A;  2OZS A;  4ELV A;  1LWF A;  2BGG A;  4Z4F A;  1HQE A;  4AIL C;  3P1G A;  1B9D A;  3CFO A;  1UOC A;  4FLY A;  3QLH A;  1S1X A;  4KHY A;  2G8I A;  4FJG A;  3AVK A;  4LD0 A;  3S3M A;  3PY8 A;  3LWL A;  1S1W A;  4CFC A;  4FM1 A;  4FXD A;  2ZQB A;  1QS4 A;  1VK0 A;  2GUI A;  2IC3 A;  4IG0 A;  4LSN A;  1TKZ A;  3KLI A;  3K5O A;  3QIN A;  4CJV A;  2W42 A;  4ZTF A;  1NJX A;  1DTQ A;  1RT4 A;  4F3O A;  4FJH A;  3AVG A;  3NH1 A;  4KHW A;  4FW2 A;  4AHS A;  2HMI A;  3IG1 A;  3HVT A;  3K2P A;  4NYN A;  4CJL A;  1JLG A;  4IFV A;  3V1R A;  4C8N A;  3VQ9 A;  2KTQ A;  1W0H A;  4GW6 A;  1VRT A;  1SKW A;  2HHV A;  1ITG A;  1J5O A;  2IGI A;  1BIU A;  3T19 A;  3ZSW A;  1SKR A;  3DLB A;  4O55 A;  1NK7 A;  2G8V A;  4KB1 A;  1JLB A;  3CYM A;  1BGX T;  4FW1 A;  3LP3 A;  4I9L A;  4O4G A;  1J54 A;  2XO7 A;  3NGZ A;  1JLE A;  4LH5 A;  4DQP A;  4ELU A;  3L8B A;  2PY5 A;  5J1E A;  3EYZ A;  1NK9 A;  1HNV A;  1Q8I A;  1RDA A;  2EX3 A;  4NCA A;  5HRN A;  1WN7 A;  2O4I A;  4NCB A;  2GBZ A;  1RT6 A;  4CIE A;  3AVC A;  4AHC A;  4DQQ A;  5HLF A;  1RTI A;  3OYL A;  1JL2 A;  3PV8 A;  4YFU A;  1ZBF A;  4O0I A;  4CEF A;  1ASV A;  4JS4 A;  3RWU A;  3ZSZ A;  1BCO A;  3KK2 A;  3ZSX A;  4YNQ A;  4N56 A;  5FRN A;  4PWD A;  5JS2 A;  4FYD A;  3O3F A;  3BGR A;  1YTA A;  2E6M A;  4B8C A;  4FLX A;  1X9W A;  3HK2 A;  4CIF A;  3LAM A;  3OYD A;  1XHZ A;  3AA3 A;  3QIP A;  4CJQ A;  4CF9 A;  1VSK A;  1CZ9 A;  4CEC A;  4HCB A;  3S3N A;  4FZX C;  1WLJ A;  4OKK A;  1TKD A;  4FJ8 A;  4BAC A;  4ZTJ A;  4RW9 A;  2YNF A;  1Z26 A;  2D0B A;  5HRO A;  3L2W A;  4H4O A;  4W5Q A;  4HHT A;  3PO4 A;  4WE1 A;  4EP4 A;  3D45 A;  3AO5 A;  3ZSV A;  1Q9Y A;  2HHQ A;  4E7J A;  4CJW A;  3M8P A;  3QIO A;  1BHL A;  3NBP A;  3OYK A;  1G15 A;  2DY4 A;  4BWM A;  1VRU A;  1FKP A;  3HYF A;  5FDL A;  5FRO A;  2Y1J A;  4W5N A;  4RW7 A;  1I39 A;  4FJI A;  1KLM A;  1NK5 A;  1NK4 A;  3NAE A;  3AVL A;  3ZCM A;  2OPS A;  4B9V A;  1JLQ A;  2YV0 X;  1U4B A;  3WNE A;  4C8K A;  3DRS A;  4IBN A;  2OZM A;  2QK9 A;  5I42 A;  4I9Q A;  3VQP A;  2Z1I A;  4CED A;  3TI0 A;  4CJP A;  1BQM A;  3CQ8 A;  4DLE A;  5DMR A;  1EP4 A;  4B8A B;  5J2Q A;  2VWK A;  4DU4 A;  3DLR A;  4PQU A;  1TK0 A;  4DQI A;  4CFB A;  2BAN A;  4N47 A;  1VSL A;  4FK2 A;  2R7Y A;  2D5R A;  2WOM A;  4OLA A;  4K8X A;  3L3U A;  4M3U A;  5E41 A;  1TGO A;  4Q5V A;  5D3G A;  4DSE A;  1RBR A;  4M41 A;  3LAN A;  3ISN C;  3ZT3 A;  4HVJ A;  1X9S A;  3MEE A;  1D8Y A;  4M42 A;  2G8H A;  1X1P A;  3U6F A;  4F3T A;  4DTS A;  4DWI A;  3I0S A;  5J2N A;  5JS1 A;  4DFJ A;  3V9X A;  1LAW A;  4B9S A;  1WAJ A;  4Z4C A;  4KTZ A;  1B92 A;  1YT3 A;  4CEE A;  1UA0 A;  3RR7 A;  1Z25 A;  2Q3S A;  3SQ1 A;  3MEC A;  4CF1 A;  4FJ5 A;  1Y97 A;  3QEP A;  3DOK A;  3KK3 A;  3T3F A;  4K8Z A;  4CF0 A;  1S6P A;  2IDO A;  4EZ9 A;  2DFE A;  2KQ2 A;  3AO3 A;  1C6V A;  4CER A;  4OPK A;  4KHQ A;  2F8T A;  1EXQ A;  1WSE A;  3NH2 A;  3P5J A;  1WAF A;  4E1M A;  1UA1 A;  3VA0 A;  3D0P A;  2DTU A;  3OS1 A;  2Z1J A;  1S9G A;  3IS9 A;  3HT3 A;  3DOL A;  1NK6 A;  1HYS A;  4CJS A;  2GV9 A;  4B9L A;  2D0C A;  1NKE A;  2PYJ A;  1C1B A;  5EU7 A;  2VG7 A;  3DRP A;  5CYQ A;  3HO1 A;  3G0Z A;  3MXM A;  2OPQ A;  3AVI A;  4ID5 A;  4CEA A;  1N5Y A;  1RT1 A;  2XY5 A;  3OVN A;  4PA1 A;  1HYV A;  5CYM A;  4AHU A;  1RT5 A;  5C42 A;  3KJV A;  1LW0 A;  2ZE2 A;  2YHB A;  3C6U A;  3THV A;  1XI1 A;  4M3Z A;  2RN2 A;  3C6T A;  4CHY A;  1JXB A;  3AA5 X;  3O3G A;  5J2P A;  2G8U A;  3B6P A;  3IRX A;  2A1S A;  2ATQ A;  5I3U A;  5HBM A;  3TWH A;  4CFD A;  4RW4 A;  1L3S A;  3NE6 A;  4B9M A;  4FZZ A;  1ZBI A;  3M8S A;  3OJS A;  4E7L A;  2Y1I A;  4MFB A;  3UIQ A;  4UQG A;  3B6O A;  4OPJ A;  1A5W A;  4CJF A;  3LPT A;  1IG9 A;  3RRH A;  3K59 A;  2BDP A;  4M3R A;  1VSE A;  5SZT A;  4JLH A;  5FRM A;  1IH7 A;  2X78 A;  1C1C A;  1IKW A;  1J53 A;  1CXQ A;  1VSI A;  2HHS A;  2VG5 A;  3V6D A;  4J2E A;  1EET A;  1NKC A;  4QAG A;  4AH9 A;  4FJ7 A;  2YNI A;  2WON A;  3KKR A;  3LWM A;  1Q9X A;  4FK0 A;  4OJR A;  2E4L A;  3VQ5 A;  4CJE A;  4JRP A;  4ELT A;  4IKF A;  1HPZ A;  3ASM A;  2F96 A;  1WSG A;  2HHW A;  1QSY A;  1KFD A;  3QEI A;  1ZYQ A;  3L2R A;  3KK1 A;  1IKX A;  3DI6 A;  3V1O A;  4W5O A;  3U3G A;  4CHP A;  4Z0U A;  1RCH A;  1IO2 A;  3SUQ A;  3ITH A;  1I3A A;  3HPG A;  4OGE A;  3VA3 A;  4FM2 A;  3H08 A;  1VSJ A;  3TAN A;  2P5G A;  3TAB A;  2HHU A;  3OYJ A;  4J2A A;  4Z4I A;  3CFR A;  4KHU A;  2JLE A;  4CFA A;  2A1R A;  3SQ2 A;  2PZS A;  3LP1 A;  3DMJ A;  1BIZ A;  1QE1 A;  1RDB A;  1A5V A;  3VQB A;  5HRP A;  3OYC A;  2OPP A;  4EP5 A;  3RMC A;  3LZI A;  2QKK A;  4GVM A;  4CCH A;  4NCG A;  4QOZ B;  1EX4 A;  3VQ8 A;  4I7F A;  3JSM A;  4G1Q A;  4GMJ B;  4J2B A;  4CJK A;  1T7P A;  4HTU A;  4AHR A;  3AVA A;  3NGY A;  5C25 A;  3CFP A;  4DTN A;  4E7K A;  4OLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...